5M1OA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound cobalt
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
188
structure length
188
Chain Sequence
AMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
total genus 68
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1oA00
5M1NA 5C2FA 5C10A 3C6AA 4IDHA 5M1QA 5C12A 5C15A 4IFEA 5M1FA 5M1KA 4IEIA 3C6HA 4IEEA 5M1OA 3CPEA 5M1PA 5C2DA
chains in the Genus database with same CATH superfamily
3EZ5A 4RW6A 5HL7L 4DB3A 4DKWA 4KREA 1XNRK 1LWEA 5DK5A 3MMVA 4PWDA 3C6UA 2PBDA 4K8XA 4JK9A 2E2QA 5KPZA 1J5EK 5FRNA 3TTDA 5SZTA 2OANA 3KD1E 4DV1K 4CHQA 3IDHA 1JKHA 5CZ2A 3ENHA 1KTQA 1RDUA 3O4NA 4CZGA 3HM9A 3O9QA 3H1QA 3RMCA 1WSEA 1KXPA 4H5RA 3HYFA 4LY7A 4ZTFA 4M3YA 4LF6K 4GW6A 3UIQA 4IXCA 1XNQK 3NHGA 2P9UB 3OYHA 4MO4A 1ATNA 2G8HA 1GLJO 3CQXA 4L8RB 2O8DB 4KTQA 3L6QA 4B1WB 2Y1IA 4W5TA 4M3ZA 1YTUA 3V9WA 4FLYA 3HP9A 5TKYA 4RW9A 2FF6A 3DOLA 2E2OA 3KJVA 4CJQA 1OVYA 4FJGA 1A5XA 1B92A 3CCLN 2D0OA 1KSPA 1JLAA 3ZX0A 3CM5A 4CJKA 2P9IB 1RBSA 1XMQK 3SPZA 4B9SA 1T6CA 3KLHA 4ID1A 1GLFO 3DLGA 3A2FA 1CXQA 2O8DA 3HRGA 3F9KA 4FOEA 4H0OA 4U7BA 1YAGA 2YNFA 4H5VA 1WSJA 5AQLA 4ELVA 4YOYA 3CF5L 2VWKA 1YI2N 3NGYA 3G10A 3CETA 4O8UA 2YHBA 3QEPA 2ZJQL 2HBLA 3KZBA 2G8FA 2P9IA 5HRSA 5CE3A 2O4GA 3NH1A 1U04A 3VA0A 1D4XA 1JXEA 4BROA 4CZIA 3TAMA 2G8UA 2P5GA 3VQPA 2D0CA 2E2PA 5J2QA 5BRFA 2D0AA 1X3MA 1U4BA 1OH6A 3BGRA 1QVGM 4PQUA 2P9KA 3ID6A 4FWNA 3WT0A 3PV8A 1BHLA 4RCHA 3CJ7A 4JKHA 4OKEA 3O1WA 3EYZA 3T69A 3K9KA 4WE1A 4DFPA 4CJRA 4M3WA 1LW0A 4DTOA 3UKUB 4BRNA 5EU7A 4RTFD 1TL1A 3VQBA 1NJIO 1UOCA 2X74A 1ZYQA 1CLQA 1WSGA 4O5BA 4O8KA 1BG3A 4B3OA 1E3MA 1KVCA 2CGKA 2F96A 4M3TA 1IV0A 1L3SA 1S1UA 1ZXOA 3LL3A 1KAXA 4FWMA 2YX6A 3QEVA 1NK5A 4ILHA 5AQMA 3RR8A 4M3UA 3AO2A 1QZ5A 3FZMA 2QXLA 4YOVA 4GV3A 4F3OA 2YKMA 2KTQA 3MN9A 1YTAA 2IIRA 3OY9A 4JRQA 4B9UA 1Q7YO 3NCIA 3FE1A 3JAMO 2P5OA 2FC0A 2XHBA 2KLAA 4EHTA 3HSTB 5F2RA 3QFUA 4J8FA 4CFAA 5HLFA 3DWLA 1HUXA 4JV5K 4DV4K 3CJ9A 2DTUA 1KLMA 1VQ8N 4CI6A 2OPQA 3V9UA 1E4GT 2IC3A 4CBXA 4DHYA 1MWKA 4DV3K 4XH5A 4HUEA 3NFAA 2UXCK 5FPEA 1CXUA 3FZKA 1D8YA 3BEXA 4I6MB 4CBUA 2OTJN 2FSKA 1N8RO 4U67L 1L3VA 4BRLA 1IKWA 4HUGA 3CYMA 1W2BM 5EVZA 4OKKA 2NRZA 3DRRA 3WNEA 4PL7A 3VQCA 3RTVA 1QHAA 3D2EB 3WNHA 1W97L 3NH0A 3AVGA 1HR0K 3K59A 1A5WA 4CW7B 4E7JA 4CERA 1R0AA 4DTXA 1TUUA 1IO2A 5C25A 4BRFA 4I6MA 4KO0A 2VQEK 3J7ZO 1ATRA 1XC9A 3ISNC 4KH4A 3LDSA 5AQQA 3WNFA 1BU6O 4QOZB 4IDHA 3PY8A 4KHQA 4OGCA 3TU5A 1UWBA 4Z4EA 4CEFA 4BDZA 2HB5A 3D2EA 5I3UA 4BRDA 3SV3A 3TR8A 4CK2A 4KHPK 4BE0A 3VETA 1BGXT 3LAMA 4LFAK 2QWQA 3DOKA 4Z4FA 3J7AP 3C6AA 3P83D 5HP1A 3QBXA 1ZBSA 1NGHA 4DCHA 4LF9K 1VAZA 1SL1A 4EHUA 4CK1A 3Q7BA 4QS9A 5M1KA 5KI6A 5JVHL 5F0XA 4IO8A 4CF0A 4Z94A 3VQ7A 2WC9A 1UA0A 2OZMA 3PO5A 3QNNA 2HHUA 3H45C 3RSEB 2EWSA 3SZ2A 4FSVA 2PAVA 4MLHA 4B9TA 4NB4A 1NOYA 1B9FA 3ZT4A 2YCHA 4DTMA 4FWOA 4C8MA 3ZSYA 2WONA 1Q82O 3VGKA 3ZEUB 2P9NB 3MWPA 3I56N 3DMJA 2RHKA 4FJ7A 1KD1O 1BWFO 1RT3A 3D2FB 1HX1A 5JS1A 4GNIA 4A5AA 1OH7A 5KTQA 3Q7CA 3BUZB 4M42A 4K8ZA 4DMNA 2QEXN 1SL2A 1BDGA 1T44A 3WNGA 3CXCM 1T7PA 3ZEUA 3AA5X 1N32K 4KTZA 3KIOA 1JL1A 3I8BA 2RE2A 3FZLA 4JHDB 5LJWA 3KK7A 4ELUA 1YITN 2BH1A 3D2FA 2IVNA 1NGJA 2V7ZA 1JXBA 3HBTA 3O1BA 4DQPA 3O5BA 4DV0K 2NLXA 4GKJK 4DFMA 2HHVA 1HMVA 2I5JA 3O9TA 2G8VA 3HZ6A 4X65K 3AGKA 3AVFA 1WSIA 2HBKA 3MX2A 3P4IA 4AILC 4JKBA 4ID5A 1SV5A 1QQMA 2QA4N 4WCEL 4DF8A 1IKYA 1ILYA 3ATVA 1BIUA 3AVHA 2E2NA 3CPWM 1BCMA 2F7TA 4E19A 4A61A 4Q0BA 3OYBA 2YHAA 5H1SQ 1GOBA 3LP3A 3L8BA 2V7YA 4FVMA 1T03A 3PX0A 3U9DA 3KKSA 4KKOA 1TKDA 4C8LA 2KKZA 4I2PA 3MAQA 3D7EO 2GELA 4N47A 4HTLA 1U48A 4DTNA 3I0RA 1P8ZA 1ZBHA 4IG3A 3SYZA 1G99A 2UYTA 1HNIA 4X66K 1WB9A 4OPAA 2UU9K 4ELTA 4NLBA 2H3GX 3FFIA 1YF5L 1X9JA 1XHXA 3AO3A 2VGMA 3JS6A 2YJFA 1S1TA 3MWTA 3ZT2A 1RT6A 4LF8K 2RN2A 1C1CA 4B1XB 4CEEA 1IJJA 1CZAN 5AQTA 1W9HA 5E41A 1N36K 3R3LA 5GINA 3L2RA 3M6GA 4KHNA 1J6ZA 3H3NO 1RDAA 3V9ZA 1HNWK 1ASUA 1NGCA 3EZWA 3JYTA 1DT9A 2KFZA 4CBWA 4C8NA 4CIEA 4B1VA 1MU2A 4PY5A 3IRXA 4C8OA 3T1HK 1EKEA 4DR1K 1VQLN 4QAGA 3CPEA 3M8RA 2OPRA 1YJNN 3QEIA 3LDPA 5FROA 3NAEA 2O8FB 3U3GA 3OYNA 2NRHA 4H4OA 4H0TB 4CIFA 4KH5A 2DFEA 3CCRN 1JCFA 3U3YA 3L4IA 1JLGA 4JLHA 4I9QA 2VG5A 4CEAA 3OYGA 4JI0K 3CM6A 3K2PA 3IUCA 1EP4A 4BR5A 3ZSQA 3I55N 2IGIA 1J54A 2NRRA 5CR4A 3SK3A 4PA1A 4CJSA 2Y1JA 3DLHA 2E5LK 4H0YB 2W41A 3ENOA 4KHSA 3AA2A 3QIOA 3O3FA 1QQNA 1D9FA 1SUQA 1VSIA 4QCLA 2UXDK 3M5RA 4B1ZA 4W5RA 3A5OC 2D0BA 3O6WA 1RDCA 1TGOA 5E84A 4NXMK 4KI6A 1RFQA 3DLKA 3D45A 4DUZK 1HPMA 4IKFA 3EE8A 4BACA 2NRWA 5BR9A 2HOEA 2X78A 2XRIA 1S22A 4OKJA 1CZBA 2QW9A 1GLLO 3O4QA 1KVBA 3NGZA 4DR6K 3K57A 3UB5A 3LDQA 4A57A 1YJWN 3TSUA 1MA9B 4DTPA 3TSQA 1BISA 3HPHA 1RBTA 2D0PA 3AVMA 4KFBA 2VCPA 5JS2A 2YNGA 1FW6A 5IWAK 1S6PA 3ZSWA 1NKEA 4WFBL 1QSLA 5KRTA 4E3SA 3QERA 3M1FA 3OBYA 2P51A 3F9MA 2JWLA 5EOYA 1VQPN 1VQ6N 3G0ZA 4CHPA 5AQGA 4BGBA 4E0DA 3K5MA 2J4RA 4J2AA 4WQ5C 4CJFA 1VRTA 2FLOA 1WLJA 1GLAG 4FWSA 3KWIA 4NYNA 2P1JA 4AM6A 2E88A 4CFDA 5GAGP 1KLNA 1DTTA 1HKCA 1HPZA 3NH2A 2B5JA 2HHQA 4O0JA 3CMEN 2HVIA 4CGIA 4DSJA 3QMLA 4K25A 4JI6K 4CHYA 1I94K 4E7KA 3SLCA 1VQ4N 3OYEA 3DLRA 1JLCA 2VYPA 3G4SN 4JKGA 2F4VK 1TKXA 3M3ZA 1IG9A 2ZQBA 3KKRA 3BZCA 3QBWA 3R6MA 4AHSA 4DR4K 3THYA 3DRPA 1NK4A 2D4WA 1TYQB 3O8MA 3TAFA 2E1YA 1Z6RA 3U8XA 2PFUA 4CJ7A 4CGDA 3OJSA 2YI1A 4CEBA 5BRDA 4JI3K 2WBNA 5C24A 3P31A 3WQTA 3DLBA 4KHWA 1WOQA 1C6VA 3EKUA 4BRKA 2E20A 2ASMA 4BDYA 2X6SA 3L2QA 1HQEA 2ASOA 5AQZA 4CZLA 1Y97A 2HBMA 4AHUA 5AJ3K 1NU0A 4CGHA 3CFOA 4BRGA 4DQSA 1KAYA 4GVMA 3MXJA 1TYQA 4GKKK 1X9SA 1D9DA 2HNZA 3U6FA 3K5LA 3GBTA 1HQUA 3HVRA 4IEEA 4B1UB 3NVMA 4Z4GA 4H4MA 3ZLJA 1C0UA 2P9KB 3CG7A 2O4IA 3OYDA 2E1ZA 3WXLA 2QWOA 4F9OA 4BG8A 3VN5A 3VF6A 4EAHD 3LANA 4R5PA 1JCGA 3SI6A 5JMVA 4K0KK 1BI4B 3AA3A 4IBNA 4FJ9A 1XC3A 4CGFA 3C0BA 3AY9A 4A62A 1VQ7N 3CCUN 4M63C 3AVAA 1W7AA 3MCPA 1HYVA 4B9NA 3I0SA 3PSFA 4IJNA 4FVUA 4BC3A 3VERA 4EP4A 1NJZA 3CCVN 2BDPA 3L0QA 4DSLA 4F4KA 1BI4A 3SAGA 2O8BB 3AO5A 2XY8A 4B3SK 1S1VA 1BO5O 4CESA 3OYAA 4DV2K 5BN9A 2AJQA 3PIPL 3THVA 3HI0A 4JAXA 2WOMA 4KH6A 3ZSZA 5LJVA 3T19A 4E89A 1NGEA 4F8RA 4DU1A 4CF8A 4O55A 1VHXA 3PX4A 1N33K 1O1WA 3WUHA 1NG9A 4FPAA 1E4FT 3AVBA 4OJRA 5BPNA 4H0XB 4FJHA 1N6QA 1TL3A 4HWIA 1RGIA 2Q0RA 5CYMA 2O8BA 4GY2B 3GG4A 3ZSOA 3BY5A 1KQSM 3O9UA 4CK3A 4B08A 2QWNA 1P90A 1EETA 3CC7N 4RG8A 1SQKA 4KHYA 2NUBA 4AQYK 3PSIA 3TSPA 2QWRA 2AA4A 3VEVA 3HJFA 4A2AA 3QEXA 1YT3A 5AZIB 4ILGB 4RW4A 4L3QA 1HJRA 2P9SA 1J53A 2BE2A 3PX6A 3EY1A 4CF2A 1NGFA 4BR0A 1NK7A 3O9RA 3E9PA 4BY9C 3ZT1A 1Q9YA 4E1NA 2WFBA 4CZHA 3OYCA 5ADXH 4FLWA 1XMOK 1V4TA 2E6MA 4HTUA 2IOCA 4CJ3A 2AP1A 4B9QA 2E8AA 3WEEB 2JGUA 5AZIA 4XIUA 2Q31A 1Q18A 4K43A 5ADXA 3NF7A 2I7NA 4BE2A 4C8KA 4YHHK 1NMDA 2NRTA 4FLUA 1W0HA 2Q3SA 3ITHA 3G71N 1X1PA 3HXMA 1RDDA 4Z4CA 3QESA 2XY6A 2A42A 4CE9A 3LZIA 5AR0A 4CZEA 3ZX3A 2RF2A 3I33A 3OVNA 3VQAA 5I9EB 1RT7A 4AHCA 2RKIA 2P9LB 2WUSA 3ZETB 3CC2N 3WEEA 1JLEA 3B8AX 5KPTA 3SQ4A 4NYFA 4PL8A 3OYIA 1YHQN 4CZJA 4BR4A 2QWPA 1R59O 3QINA 4CJEA 4OVLA 1HYZA 1IH7A 2X6NA 4FZYA 3C7NB 1T3VA 2OPSA 2F9WA 4WQ5A 1QE1A 4HCBA 2FXUA 1WBDA 4CEZA 2UUBK 4H8KA 3L2VA 4CHNA 1L3UA 4FXDA 3HOTA 3A5NC 2PZSA 4DS4A 3HL8A 1L3TA 3TPQA 1VQ9N 2P9LA 3ZETA 5E26A 2W6LA 1WAJA 1JLFA 3SPYA 4KI4A 4IOXA 3QO9A 4F2RA 1NJXA 4UY8O 3CFPA 3DJCA 3SUNA 1S5JA 3C7NA 3THWB 3CD6N 1YXQA 5A2QO 4CJWA 3KLEA 4FZXC 2B6AA 5DMRA 4BQLA 2UUCK 3SAHA 5GADP 4M3XA 3ZYYX 3CIPA 3NDKA 3E66A 1KFSA 4LC9B 5HRNA 3V1OA 1ATSA 4KV8A 4M41A 3VQ5A 2D5RA 2QTDA 3L3UA 4DG1A 3RR7A 2QKBA 1ZBUA 1IBLK 3P1GA 4JD2A 3UKRB 3J81O 3HO1A 4HHTA 1NK9A 1I39A 3THWA 2LSNA 3SBTA 3S9HA 3O80A 3VEYA 3KK3A 5DM7L 4H03B 3CC4N 4IOCL 1KRPA 3CI5A 3CQYA 5BN8A 5C12A 1GLEG 1J9AA 2QI2A 3AO4A 4EZ9A 2IVPA 1JCEA 4ZTJA 3HPGA 3TWHA 3C6TA 5GAHP 3MECA 3VQDA 3OS2A 3UKRA 1VSLA 3BP8A 3L2WA 1X3NA 5JICA 1FJGK 1RBVA 5AQIA 2KW4A 1TV6A 1WUAA 1C0GA 3VQ8A 5TKWA 4WFAL 3AVIA 2HHTA 3E1YA 4LFBK 4IOAL 2E6LA 4CGGA 4Y1CA 4JKEA 3E9OA 3TTFA 4E7IA 1NK8A 3OYJA 3MDQA 4BG9A 3O9SA 2HBJA 2P9PA 3FR0A 2ETJA 4BWJA 3DM2A 4BREA 3FLCO 1TK8A 3LDLA 4UQGA 2GWJA 1K8AO 2Q2RA 4GMJB 4X62K 3T1YK 4OLAA 1U47A 3QIPA 3OW2M 2Z1HA 4EFHA 4Y0WA 5AQHA 4DV6K 3LM9A 1K9MO 4LH5A 2W42A 5M1QA 5BREA 3LP2A 4DSEA 5EX5A 5AQFA 3EE9A 3KLGA 4WYBA 1S9EA 2VGNA 4QS7A 1LOTB 4GVEA 1FXXA 3CJ1A 2FSJA 1X9MA 5FPDA 3M8SA 4O4GA 4NO7A 4WQ4C 5J1EA 2D1KA 3SBGA 1JJ2M 3VPZA 2JWKA 4JNEA 3TAGA 2HW3A 3C6HA 4CD3A 3SMSA 2OZSA 3N4QA 3U9ZA 4FJLA 3EL2A 2F9TA 3TABA 3LPTA 1IKXA 4V19S 5BRHA 5M1PA 3AAQA 4JYAK 4FLTA 3HK2A 3LDNA 3QEWA 4A5BA 3MXMA 3P39A 4JS4A 5JVGL 4FLVA 3VOVA 2IAJA 1RT4A 1M90O 3CQ8A 1FK9A 4E1JA 4CZKA 3VEWA 4GV6A 5AZJB 4RW8A 3PIOL 4BVPA 3T1AA 1HNVA 5KGWA 2BANA 5C2DA 3QICA 4JI5K 4CHZA 3SCXA 1HKGA 4LF7K 4CD1A 3G6EN 2A41A 3A5LC 3OA9A 3NVKA 1VSDA 1U45A 3C95A 5FPNA 1WNSA 2NRXA 5FRMA 3OYFA 5C10A 1BA1A 4ILJA 4FLZA 5AZJA 2A1RA 4DFKA 1VSMA 1Y64A 3LDOA 4PKIA 4Q5VA 2OPPA 3QETA 3B6PA 1U6ZA 2NZTA 2VG7A 3B6OA 3OHRA 4MO5A 3HM8A 2YHWA 4W5QA 2WTUA 1KVAA 4DLEA 2O8CA 3CCMN 3O08A 1QQCA 1WSFA 3VESA 1U49A 4JKCA 3SMPA 4J2DA 4FJMA 4MQ3A 4OLBA 2GTDA 3K5OA 5C42A 3MCAB 2JLEA 4MDAA 5HRPA 4QS8A 1RTDA 1U2VA 4AHRA 4BC5A 4IEIA 3QLHA 4HCCA 3K5NA 3F2KA 4CGJA 4DTRA 4YORA 1TAQA 4JN4A 1K6YA 2E4LA 1C1AA 1HNZK 5AQWA 3VF4A 1RTJA 1J5OA 3S41A 3IMXA 2QKKA 1WN7A 2HHSA 4OPHA 2CGJA 2ATQA 2Q97A 3QDKA 1EX4A 3K0SA 4B8AB 2KZMA 1BIZA 3CJBA 4E7LA 3EO3A 4LH4A 1DTQA 4O0IA 3IKMA 1Z05A 4AH9A 4NCBA 4DWIA 3PLAA 4PUOA 3LP1A 1RNHA 4FW1A 1ZC6A 2XY5A 2Q0UA 4LFCK 4JKGB 4DFJA 3LALA 3J8AA 1F21A 4FZZA 4BGAA 2HNYA 3THYB 4KAZA 3D6RA 1MWMA 1RDWX 5AQSA 4Z4HA 5EY4A 3CHWA 4CF9A 5J2MA 3VQ6A 3SUQA 2HMPA 3HTVA 4FOIA 4KHUA 1LCUA 4N41A 5K14A 2I7PA 2Q1NA 1BA0A 3FFKB 1SKRA 1NGIA 4IWVA 3SJHA 4BR9A 1ZBIA 1QQOA 1UAXA 1TUYA 2HSTA 1Q86O 1T05A 3OJUA 2OYQA 1NK0A 3HVTA 3L4QA 3CCSN 5FLXO 3PO4A 5D3GA 4JI8K 4RWTA 4B8CA 2A3ZA 4ISEA 3ZSVA 4H5NA 3QNOA 3K58A 4BR2A 2EX3A 4MDBA 5KPRA 4FJNA 4FWQA 3WQUA 1QZ6A 1T6DA 3HT3A 3MN6A 3A8YA 3KWGA 2OTLN 2ZJPL 1NKBA 4FK0A 3CJAA 1CZ9A 5IT9O 3SQ2A 4BR7A 1IG8A 3O3GA 2Z1IA 3IFRA 3ULDA 1SZ2A 4W5NA 3R1XA 4A59A 3SQ1A 4B3MK 1M1KO 4CCHA 4K42A 5B8HA 3HOSA 3MK6A 1KCFA 1NNEA 1H1VA 1EO1A 1Q81O 1HJOA 1QS4A 2IS3A 5FDLA 4OPKA 3A0IX 4FYDA 3ZT0A 4BRHA 4C1NK 3VTHA 4BC4A 1VRUA 1ZBLA 5CYQA 4FJIA 3VQ4A 3H08A 3EEQA 3PUFA 4ISGA 1YVNA 4KPYA 3KD5E 3S3OA 3UE5A 2GV9A 1L5UA 4X64K 4B3TK 1S72N 4MLEA 4LF4K 2P9UA 1Z25A 4H5TA 4KRFA 5LY3A 3T3FA 1VQMN 3TTCA 4YY3K 2XO7A 2HNDA 3O4WA 2B4JA 2GBZA 3VQEA 5KQDA 1RBUA 4BRAA 1NJYA 4M7XA 5FPMA 4DQIA 3MXIA 4N76A 3H46O 4YDUC 1SAZA 3R9PA 2BGGA 2ZGYA 3THXB 4FJKA 1NGGA 5KGXA 4WQ4A 4RW7A 1BUPA 3U4LA 3N4PA 3IAYA 4B3RK 2FF3B 1SKWA 4JEPA 3KTQA 4NCGA 5HRRA 4N5SA 1DEJA 3ATUA 1XHZA 1RILA 3W3DA 2IDOA 3EN9A 3VEOA 4FCYA 4FWRA 3ID8A 3V6DA 3AAPA 1EWRA 3RMBA 3H3OB 1HYSA 1RT2A 3V1RA 5BPMA 3VA3A 3THXA 1OKJA 1OH5A 3V9XA 3AVLA 1QSSA 5AQPA 3A5MC 1NGAA 1RT5A 3MX5A 1WAFA 4CIGA 4I2QA 1BQNA 2Z1GA 4ICLA 3RRHA 1LW2A 5DM6L 3CCJN 1BCOA 3NMUA 1WSHA 2KQ2A 1OH8A 4CEDA 4IFEA 1DKGD 5AFUH 4O44A 2F8SA 3AGRA 3AVJA 4YNQA 2P9SB 3VEZA 4M45A 3ZSRA 4BVOA 3MEDA 3NF8A 1VQKN 3QB0A 4DSFA 3R8EA 4CJPA 1HNXK 1ESVA 4B9MA 5AFUA 2BUPA 1RBRA 3SQ0A 1NOZA 1ASWA 1LAWA 4I9LA 4NLCA 5M1NA 2QK9A 3UKUA 1MDUB 1VSHA 5GIPA 3CERA 1IBMK 4BRPA 3FGUA 1NWKA 4CEQA 4CJVA 5J2PA 4EZ6A 2EHGA 4C1NI 3V9SA 1KAZA 1SS6A 4AHVA 5LMUK 4FK4A 1YUWA 2HVHA 5C0YA 4R79A 1JLBA 4FL9A 4LSNA 3ENBA 2PYLA 3E9LA 4DTJA 4Z0UA 2NNWA 1VQON 1GOCA 3AVKA 3QFPA 4IJAA 3OTOK 4CVNE 4DLGA 5M1FA 1UA1A 1D5AA 3LWMA 1HLUA 2ZWHA 3DYAA 1C0MA 4JKAA 3BF3A 4OPJA 1VQ5N 3OYLA 4W5OA 4JI7K 3BDPA 1VSKA 1GOAA 4AHTA 1HRHA 1Z26A 3F73A 1LAVA 4Y1DA 4DSIA 1GLDG 3VGMA 4AM7A 4KBOA 4PKGA 4CJUA 2KHOA 3WXJA 1JL2A 4BE1A 4KTWA 5BR8K 1FKPA 4H0PA 5I42A 1IKVA 1JLQA 1ASVA 4O5FA 4XH4A 3RWUA 1RDBA 1V4SA 4FWKA 1QTMA 1C1BA 4FJJA 3KLFA 2YV0X 4FPBA 2GEMA 2DFFA 3H1VX 4FJ8A 5CY4A 4CEOA 1WBBA 1XQSC 1QHTA 4J2BA 2IVOA 5AQJA 1TVRA 2HF4A 3AVCA 3GDQA 1NJWA 4B9VA 1Q8IA 1DLOA 5ELZA 5J2NA 2KZZA 1TKZA 1VK0A 1C0TA 1TK0A 5BPLA 3OBWA 3BZKA 3VGLA 2PY5A 5AQNA 4PHTX 4DS5A 1GLBG 2VWBA 1NLVA 4JD2B 5HBMA 1X9WA 5T7BA 4FM0A 5SWMA 4CFCA 2ZJRL 3L3VA 2A6AA 2VQFK 3C94A 4Z4IA 4BRMA 5AQVA 5HROA 4YFUA 1LWFA 3MN7A 1EQYA 1A5VA 4CJ5A 4B1YB 2A5XA 4DTUA 4YOXA 3V4IA 2O8EB 3KHYA 4BRIA 2UXBK 4FM2A 2UUAK 4IFVA 4DR5K 4YOTA 2QXFA 2ZGZA 4CJTA 4DQRA 3AARA 2ASPA 1BL3A 5KRSA 5GAEP 3TARA 3OYKA 3NE6A 1S1WA 4NXNK 3RMAA 4J2EA 3VENA 4FLXA 1B9DA 2DPNA 4FO0A 5F1XA 4JKDA 2HMIA 3EKSA 4FWPA 3J7YP 3KVGA 3RSEA 1FKOA 1SL0A 2O8EA 3FZFA 2G8KA 3NBPA 3ASMA 2YJEA 2YKNA 5GIOA 2P9PB 1REVA 4F3TA 3GOIA 3SAFA 2GX9A 1KC8O 1ITGA 1ZBFA 2FBVA 2ITMA 4LSLA 3GL1A 3BF1A 4WFNL 2YHXA 4DR3K 3TAQA 2ZD1A 2P9NA 1NMNA 3ZSXA 1OVQA 2FBXA 4JI4K 3OYMA 1QSYA 2V52B 1YJ9N 4BRQA 4JKFA 5AQRA 2ITGA 1XI1A 4DUYK 4YOUA 3P5JA 5AQOA 4E7HA 2GUPA 1S6QA 4ZHRA 1BOTO 2QWMA 3MEGA 5C2FA 1VQNN 3AA4A 3ULEB 4YDUA 4IDKA 4K41A 2ZE2A 4OGEA 3CCEN 5M1OA 4DR2K 2FBTA 1YIJN 3T7ZA 3DXMB 3AO1A 3ZCMA 2W40A 5AQUA 3ALYA 3SUOA 4JHDA 1I3AA 2QWLA 2VWJA 4HVJA 5HOOA 1NGDA 1NGBA 3D0PA 2XY7A 4JK7A 4MFBA 4OX9K 1LV5A 3DLEA 1KFDA 3E01A 2A40A 4CZFA 1NBWA 2YNIA 4DSKA 3DXKB 2ZM6K 2NRVA 3ULEA 1GLCG 3ZT3A 3IS9A 2YNHA 3WXKA 3KK2A 2OCEA 5AQYA 1TK5A 3MEEA 1NM1A 3DAWA 2R7YA 3DXMA 3VMFB 4KB0A 3P38A 3V1QA 2W6KA 3KK1A 3TANA 2HHWA 1LWCA 4CECA 3HP6A 3J80O 4BC2A 3CMAN 4FJXA 1EWQA 4F2SA 2CH6A 3M8QA 4DU4A 2HHHK 3DXKA 5LL6Z 3RRGA 1QVFM 4HUFA 5KQ8A 4DV7K 1K8KB 2YHYA 3TAPA 3TAEA 2FBYA 3SUPA 4CZMA 2GWKA 3NF9A 4ISFA 3K9JA 3RVCA 3HSCA 4EIAA 4GV9A 2CH5A 4A2BA 1C0FA 3KLIA 5MLCQ 4G1QA 5CZ1A 3LPUA 3OS1A 4YOWA 2HHXA 4LF5K 2V51B 3VTIA 3L2UA 2O8CB 3O3HA 3VQ9A 4E1MA 2A1SA 3W0LA 4JK8A 4PKHA 4XH1A 4IG0A 4N56A 3HPOA 1N5YA 2HF3A 1K8KA 3LP0A 1U2VB 4OO1J 4JI1K 4XEIA 3SV4A 4AF1A 4BDPA 4H5WA 3VEXA 4CFBA 3AV9A 3LM2A 4FM1A 1S3XA 2FSNA 2QM1A 1XUPO 1HKBA 1S1XA 4FWLA 1T8EA 4DV5K 3CCQN 4DQQA 1G15A 4FJ5A 3G25A 1RCHA 3V81A 2F8TA 1Q9XA 4WF9L 1SKSA 2OA8A 5AQXA 3DRSA 4LD0A 3ZX2A 1YVUA 1NK6A 1VSFA 4B9LA 2G8IA 1S9GA 4BWMA 5LMNK 3RMDA 1TAUA 4FK2A 2O8FA 3VQQA 5AQKA 4IZ9A 3NF6A 4C23A 1TKTA 3JSMA 3LAKA 3I8DA 5C15A 5JLHA 4FW2A 3M8PA 4BRCA 4DTSA 4DF4A 4DQ8A 4BQZA 4CJLA 3OS0A 1XWLA 2VG6A 5JLFA 1N34K 4EP5A 3CJCA 4JRPA 4I7FA 2PYJA 3GE1A 2DFHA 3VF2A 1NKCA 4TSXA 4CJ4A 3JXUA 5CHIA 4KB1A 4G9ZA 3CFRA 4CF1A 1RT1A 3LWLA 2KFNA 3F5TA 1VSJA 3DLLL 2ZF5O 3FZHA 4H0VB 1RTIA 4NCAA 3SJJA 4DR7K 3TI0A 3MN5A 4M7YA 2DY4A 4IO9L 2RPIA 3NGIA 4M3RA 1O13A 3WXMB 3SNNA 4JS5A 2GUIA 3C65A 2BTFA 3AVNA 3H6EA 4DU3A 1BQMA 3DI6A 4CHOA 3S3NA 1RTHA 1IBKK 2G8WA 1K73O 4JI2K 5EXWA 1EXQA 4IFYA 2Z1JA 3IG1A 2CGLA 3LZJA 3WXIA 1DGKN 3S3MA 1VSEA 2Q36A
chains in the Genus database with same CATH topology
3ZYYX 3CIPA 2P9SB 3VEZA 4BVOA 1CZAN 3E66A 5AQTA 5HL7L 4LC9B 4DB3A 1ATSA 3R3LA 4DKWA 1VQKN 3QB0A 5GINA 3M6GA 3R8EA 2QTDA 3MMVA 1ESVA 1J6ZA 3H3NO 2PBDA 5AFUA 2BUPA 1NGCA 2E2QA 3EZWA 4JK9A 5KPZA 1DT9A 4CBWA 3TTDA 5M1NA 4NLCA 4JD2A 3UKUA 2OANA 4B1VA 1MDUB 3UKRB 5GIPA 3CERA 4BRPA 3FGUA 1NWKA 3IDHA 3ENHA 3SBTA 4C1NI 5F1XA 1VQLN 1RDUA 1KAZA 3CPEA 1SS6A 3O9QA 3H1QA 3O80A 4CZGA 3VEYA 1YJNN 3LDPA 5DM7L 1KXPA 1YUWA 4H03B 4H5RA 3CC4N 4IOCL 4R79A 2NRHA 5C0YA 4H0TB 4FL9A 3CI5A 4KH5A 3CQYA 5BN8A 3ENBA 1JCFA 4IXCA 3CCRN 3L4IA 2P9UB 5C12A 1GLEG 3E9LA 2QI2A 4MO4A 2NNWA 2IVPA 1VQON 1JCEA 1ATNA 1GLJO 3CQXA 3QFPA 5GAHP 3L6QA 4IJAA 4B1WB 3IUCA 4BR5A 3I55N 3UKRA 5M1FA 3BP8A 5TKYA 2NRRA 2FF6A 5CR4A 1X3NA 3SK3A 5JICA 2E2OA 1OVYA 5AQIA 3CCLN 2ZWHA 1HLUA 1WUAA 1C0GA 2W41A 2D0OA 3ENOA 4H0YB 4JKAA 5TKWA 3ZX0A 4WFAL 3BF3A 2P9IB 3E1YA 1QQNA 1VQ5N 4IOAL 4JKEA 3E9OA 3TTFA 1T6CA 1GLFO 3MDQA 4BG9A 3M5RA 3O9SA 2HBJA 4B1ZA 2P9PA 3A5OC 3FR0A 1GLDG 3HRGA 3O6WA 3VGMA 4AM7A 4KBOA 4PKGA 4BREA 5E84A 2KHOA 3WXJA 3FLCO 1RFQA 4FOEA 4H0OA 3LDLA 4U7BA 1YAGA 2GWJA 4H5VA 1HPMA 5AQLA 1K8AO 4H0PA 3EE8A 4YOYA 3CF5L 2NRWA 5BR9A 2HOEA 1YI2N 1S22A 2Q2RA 4O5FA 4XH4A 2QW9A 1V4SA 3CETA 1GLLO 4FWKA 4O8UA 2ZJQL 3UB5A 2HBLA 3KZBA 3LDQA 4FPBA 4A57A 4EFHA 3OW2M 4Y0WA 2P9IA 5AQHA 2GEMA 3LM9A 1YJWN 3TSUA 5CE3A 1K9MO 3H1VX 5M1QA 1MA9B 5BREA 1D4XA 1XQSC 3TSQA 5EX5A 5AQFA 4BROA 2D0PA 3EE9A 4CZIA 2IVOA 5AQJA 2E2PA 2VCPA 1DGKN 5BRFA 4WYBA 2VGNA 1X3MA 2HF4A 3GDQA 4QS7A 5ELZA 1LOTB 4GVEA 4WFBL 1QVGM 2P9KA 3ID6A 4FWNA 3CJ1A 3WT0A 5BPLA 2FSJA 3OBWA 4RCHA 3CJ7A 3VGLA 5FPDA 4JKHA 5AQNA 3M1FA 3O1WA 1GLBG 2D1KA 2JWLA 2VWBA 3F9MA 3OBYA 4NO7A 4WQ4C 1NLVA 5EOYA 3K9KA 3SBGA 3T69A 3VPZA 2JWKA 4JNEA 1VQPN 1JJ2M 3C6HA 4CD3A 3SMSA 4JD2B 1VQ6N 3N4QA 3U9ZA 3UKUB 4BRNA 4RTFD 3EL2A 1NJIO 2F9TA 5AQGA 4BGBA 2ZJRL 2J4RA 2A6AA 4WQ5C 5BRHA 5M1PA 3AAQA 4O8KA 4BRMA 1BG3A 5AQVA 3LDNA 3SAHA 3MN7A 4A5BA 1EQYA 2FLOA 1GLAG 2CGKA 4FWSA 3KWIA 4B1YB 3P39A 2A5XA 4AM6A 2E88A 4YOXA 5JVGL 5GAGP 3VOVA 1HKCA 1M90O 1ZXOA 3LL3A 3KHYA 4BRIA 4E1JA 1KAXA 3CMEN 4FWMA 2YX6A 4CZKA 4ILHA 5AQMA 3VEWA 3QMLA 1QZ5A 4GV6A 3FZMA 2QXLA 4K25A 2ZGZA 4YOTA 5AZJB 4YOVA 4GV3A 3MN9A 2IIRA 3AARA 3SLCA 1VQ4N 2ASPA 2VYPA 3G4SN 3PIOL 4BVPA 5GAEP 1Q7YO 4JKGA 3M3ZA 3FE1A 5C2DA 3QICA 3QBWA 3R6MA 2KLAA 4EHTA 3VENA 5F2RA 1HKGA 2DPNA 3QFUA 4FO0A 4J8FA 2D4WA 1TYQB 4JKDA 3DWLA 4CD1A 3A5LC 1HUXA 2A41A 3CJ9A 3EKSA 3OA9A 3O8MA 2E1YA 3KVGA 4FWPA 3RSEA 3NVKA 1Z6RA 1VQ8N 3FZFA 3U8XA 4CI6A 5FPNA 1E4GT 2NRXA 2PFUA 4CJ7A 2YJEA 5C10A 2P9PB 5GIOA 4CBXA 2YI1A 3GOIA 4DHYA 3SAFA 2GX9A 1KC8O 1BA1A 5BRDA 2WBNA 2ITMA 4ILJA 1MWKA 3P31A 5AZJA 3GL1A 3WQTA 3BF1A 1Y64A 4XH5A 4WFNL 1WOQA 2YHXA 3LDOA 4PKIA 2P9NA 3EKUA 4BRKA 2E20A 2ASMA 1U6ZA 2ASOA 5AQZA 2NZTA 3FZKA 4CZLA 5FPEA 2V52B 3OHRA 2HBMA 4MO5A 3BEXA 1YJ9N 4BRQA 3HM8A 4I6MB 4JKFA 4BRGA 4CBUA 2YHWA 1KAYA 2OTJN 2FSKA 5AQRA 3O08A 4U67L 3CCMN 1N8RO 4BRLA 3VESA 1TYQA 4JKCA 4YOUA 3SMPA 1W2BM 5EVZA 2GTDA 5AQOA 2NRZA 3GBTA 4PL7A 2GUPA 4IEEA 4B1UB 3MCAB 1BOTO 2QWMA 4MDAA 3NVMA 4QS8A 5C2FA 1QHAA 1U2VA 3D2EB 4BC5A 1VQNN 1W97L 2P9KB 4IEIA 3ULEB 2E1ZA 4YDUA 3WXLA 3F2KA 4K41A 2QWOA 4F9OA 4YORA 4BG8A 4JN4A 3CCEN 5M1OA 1YIJN 3VF6A 1TUUA 3T7ZA 4EAHD 3DXMB 5AQWA 4BRFA 2W40A 4I6MA 1JCGA 5AQUA 3VF4A 4JHDA 5JMVA 3J7ZO 2QWLA 1ATRA 5HOOA 1NGDA 1NGBA 4KH4A 5AQQA 1XC3A 3S41A 3IMXA 4JK7A 3C0BA 1BU6O 3AY9A 4A62A 4IDHA 4OPHA 1VQ7N 2CGJA 5GADP 3TU5A 2A40A 4CZFA 2Q97A 4M63C 3CCUN 1NBWA 3QDKA 3D2EA 3DXKB 4BRDA 3MCPA 3CJBA 2NRVA 3ULEA 1GLCG 4IJNA 4FVUA 3EO3A 4BC3A 3WXKA 3VETA 5AQYA 1NM1A 3VERA 3IKMA 1Z05A 3DAWA 3CCVN 2QWQA 3DXMA 3VMFB 3L0QA 3PLAA 3C6AA 1ZC6A 3P38A 2Q0UA 3QBXA 1ZBSA 3SAGA 1NGHA 4JKGB 4DCHA 1VAZA 4EHUA 3J8AA 3Q7BA 4BC2A 4QS9A 5M1KA 1BO5O 5JVHL 5F0XA 4IO8A 3CMAN 5BN9A 4BGAA 3PIPL 4Z94A 3HI0A 2CH6A 4JAXA 4KH6A 2WC9A 1MWMA 1RDWX 3D6RA 5AQSA 5LJVA 5EY4A 1NGEA 3CHWA 3H45C 3DXKA 3RSEB 2EWSA 1QVFM 4FSVA 2HMPA 2PAVA 3HTVA 4FOIA 4MLHA 4NB4A 5KQ8A 1K8KB 2YCHA 1LCUA 2YHYA 4FWOA 2I7PA 3WUHA 4CZMA 4FPAA 2GWKA 1E4FT 1BA0A 2Q1NA 3FFKB 4ISFA 3K9JA 3RVCA 3HSCA 4EIAA 4GV9A 1NGIA 5BPNA 4IWVA 3SJHA 4H0XB 4BR9A 1Q82O 3VGKA 3ZEUB 2CH5A 1QQOA 2P9NB 4A2BA 1C0FA 5MLCQ 1TUYA 2HSTA 1Q86O 4HWIA 3MWPA 3I56N 1RGIA 2Q0RA 4YOWA 4GY2B 3GG4A 4PHTX 3L4QA 3CCSN 2RHKA 1KD1O 1KQSM 3O9UA 2V51B 3VTIA 4RWTA 2QWNA 1BWFO 1P90A 2A3ZA 3D2FB 4ISEA 1HX1A 4GNIA 3W0LA 4H5NA 4A5AA 3CC7N 4JK8A 4PKHA 4XH1A 1SQKA 4BR2A 3Q7CA 3BUZB 2HF3A 4MDBA 5KPRA 1K8KA 3TSPA 4FWQA 3WQUA 1QZ6A 1T6DA 1U2VB 2AA4A 2QWRA 3VEVA 4OO1J 2QEXN 3MN6A 1BDGA 4A2AA 4XEIA 4AF1A 3A8YA 3KWGA 3CXCM 2OTLN 5AZIB 2ZJPL 4H5WA 3ZEUA 4ILGB 3VEXA 3CJAA 3LM2A 4L3QA 1S3XA 4BR7A 2FSNA 1IG8A 2P9SA 2QM1A 1XUPO 1HKBA 3IFRA 3I8BA 2RE2A 3FZLA 4FWLA 4JHDB 5LJWA 1SZ2A 1NGFA 3KK7A 3R1XA 3CCQN 4BR0A 4A59A 1YITN 2BH1A 3D2FA 1M1KO 3O9RA 4K42A 5B8HA 3E9PA 3HOSA 4BY9C 2IVNA 1NGJA 2V7ZA 3G25A 3MK6A 2WFBA 4CZHA 1H1VA 5ADXH 4WF9L 3HBTA 1EO1A 3O1BA 1Q81O 1HJOA 1V4TA 5AQXA 3O5BA 3ZX2A 2NLXA 2AP1A 3A0IX 4BRHA 4B9QA 2E8AA 4C1NK 3WEEB 3VTHA 4BC4A 5AZIA 2Q31A 1Q18A 4IZ9A 4K43A 3O9TA 5AQKA 4C23A 5ADXA 3HZ6A 4ISGA 1YVNA 2I7NA 3AGKA 2HBKA 1NMDA 5C15A 3MX2A 3P4IA 2NRTA 3UE5A 5JLHA 1S72N 4MLEA 4BRCA 3G71N 2P9UA 4H5TA 4JKBA 5LY3A 1VQMN 3TTCA 2A42A 4DQ8A 5AR0A 4BQZA 1QQMA 2QA4N 3O4WA 4WCEL 4CZEA 5JLFA 3ZX3A 5KQDA 1ILYA 4BRAA 3ATVA 3CJCA 3I33A 4M7XA 5FPMA 3GE1A 2E2NA 3H46O 5I9EB 3VF2A 4YDUC 3CPWM 1SAZA 3CC2N 2P9LB 2WUSA 3ZETB 2F7TA 3R9PA 4A61A 2ZGYA 3JXUA 3WEEA 3B8AX 5CHIA 5KPTA 1NGGA 4G9ZA 4PL8A 1YHQN 5H1SQ 4CZJA 4BR4A 4WQ4A 2QWPA 1R59O 1BUPA 3U4LA 3N4PA 2V7YA 3F5TA 2FF3B 3C7NB 4JEPA 3G6EN 3U9DA 1T3VA 3DLLL 2ZF5O 3FZHA 2KKZA 4H0VB 2F9WA 3D7EO 2GELA 4WQ5A 2FXUA 1DEJA 4HTLA 3ATUA 3MN5A 3W3DA 3EN9A 4M7YA 3VEOA 3HOTA 1P8ZA 4FWRA 3A5NC 4IO9L 3ID8A 3AAPA 1O13A 3WXMB 1G99A 2UYTA 3H3OB 3TPQA 1VQ9N 2P9LA 3ZETA 5E26A 3C65A 2BTFA 4OPAA 5BPMA 1OKJA 4NLBA 2H3GX 3H6EA 4IOXA 1YF5L 5AQPA 1X9JA 3A5MC 1NGAA 3MX5A 4UY8O 3DJCA 5DM6L 2VGMA 3JS6A 3CCJN 3C7NA 1K73O 3NMUA 5EXWA 3CD6N 2YJFA 1YXQA 3MWTA 4IFEA 1DKGD 5AFUH 4B1XB 4BQLA 2CGLA 3WXIA 1T44A 1IJJA 3AGRA 2Q36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1N A;  5C2F A;  5C10 A;  3C6A A;  4IDH A;  5M1Q A;  5C12 A;  5C15 A;  4IFE A;  5M1F A;  5M1K A;  4IEI A;  3C6H A;  4IEE A;  5M1O A;  3CPE A;  5M1P A;  5C2D A; 
#chains in the Genus database with same CATH topology
 3EZ5 A;  4RW6 A;  5HL7 L;  4DB3 A;  4DKW A;  4KRE A;  1XNR K;  1LWE A;  5DK5 A;  3MMV A;  4PWD A;  3C6U A;  2PBD A;  4K8X A;  4JK9 A;  2E2Q A;  5KPZ A;  1J5E K;  5FRN A;  3TTD A;  5SZT A;  2OAN A;  3KD1 E;  4DV1 K;  4CHQ A;  3IDH A;  1JKH A;  5CZ2 A;  3ENH A;  1KTQ A;  1RDU A;  3O4N A;  4CZG A;  3HM9 A;  3O9Q A;  3H1Q A;  3RMC A;  1WSE A;  1KXP A;  4H5R A;  3HYF A;  4LY7 A;  4ZTF A;  4M3Y A;  4LF6 K;  4GW6 A;  3UIQ A;  4IXC A;  1XNQ K;  3NHG A;  2P9U B;  3OYH A;  4MO4 A;  1ATN A;  2G8H A;  1GLJ O;  3CQX A;  4L8R B;  2O8D B;  4KTQ A;  3L6Q A;  4B1W B;  2Y1I A;  4W5T A;  4M3Z A;  1YTU A;  3V9W A;  4FLY A;  3HP9 A;  5TKY A;  4RW9 A;  2FF6 A;  3DOL A;  2E2O A;  3KJV A;  4CJQ A;  1OVY A;  4FJG A;  1A5X A;  1B92 A;  3CCL N;  2D0O A;  1KSP A;  1JLA A;  3ZX0 A;  3CM5 A;  4CJK A;  2P9I B;  1RBS A;  1XMQ K;  3SPZ A;  4B9S A;  1T6C A;  3KLH A;  4ID1 A;  1GLF O;  3DLG A;  3A2F A;  1CXQ A;  2O8D A;  3HRG A;  3F9K A;  4FOE A;  4H0O A;  4U7B A;  1YAG A;  2YNF A;  4H5V A;  1WSJ A;  5AQL A;  4ELV A;  4YOY A;  3CF5 L;  2VWK A;  1YI2 N;  3NGY A;  3G10 A;  3CET A;  4O8U A;  2YHB A;  3QEP A;  2ZJQ L;  2HBL A;  3KZB A;  2G8F A;  2P9I A;  5HRS A;  5CE3 A;  2O4G A;  3NH1 A;  1U04 A;  3VA0 A;  1D4X A;  1JXE A;  4BRO A;  4CZI A;  3TAM A;  2G8U A;  2P5G A;  3VQP A;  2D0C A;  2E2P A;  5J2Q A;  5BRF A;  2D0A A;  1X3M A;  1U4B A;  1OH6 A;  3BGR A;  1QVG M;  4PQU A;  2P9K A;  3ID6 A;  4FWN A;  3WT0 A;  3PV8 A;  1BHL A;  4RCH A;  3CJ7 A;  4JKH A;  4OKE A;  3O1W A;  3EYZ A;  3T69 A;  3K9K A;  4WE1 A;  4DFP A;  4CJR A;  4M3W A;  1LW0 A;  4DTO A;  3UKU B;  4BRN A;  5EU7 A;  4RTF D;  1TL1 A;  3VQB A;  1NJI O;  1UOC A;  2X74 A;  1ZYQ A;  1CLQ A;  1WSG A;  4O5B A;  4O8K A;  1BG3 A;  4B3O A;  1E3M A;  1KVC A;  2CGK A;  2F96 A;  4M3T A;  1IV0 A;  1L3S A;  1S1U A;  1ZXO A;  3LL3 A;  1KAX A;  4FWM A;  2YX6 A;  3QEV A;  1NK5 A;  4ILH A;  5AQM A;  3RR8 A;  4M3U A;  3AO2 A;  1QZ5 A;  3FZM A;  2QXL A;  4YOV A;  4GV3 A;  4F3O A;  2YKM A;  2KTQ A;  3MN9 A;  1YTA A;  2IIR A;  3OY9 A;  4JRQ A;  4B9U A;  1Q7Y O;  3NCI A;  3FE1 A;  3JAM O;  2P5O A;  2FC0 A;  2XHB A;  2KLA A;  4EHT A;  3HST B;  5F2R A;  3QFU A;  4J8F A;  4CFA A;  5HLF A;  3DWL A;  1HUX A;  4JV5 K;  4DV4 K;  3CJ9 A;  2DTU A;  1KLM A;  1VQ8 N;  4CI6 A;  2OPQ A;  3V9U A;  1E4G T;  2IC3 A;  4CBX A;  4DHY A;  1MWK A;  4DV3 K;  4XH5 A;  4HUE A;  3NFA A;  2UXC K;  5FPE A;  1CXU A;  3FZK A;  1D8Y A;  3BEX A;  4I6M B;  4CBU A;  2OTJ N;  2FSK A;  1N8R O;  4U67 L;  1L3V A;  4BRL A;  1IKW A;  4HUG A;  3CYM A;  1W2B M;  5EVZ A;  4OKK A;  2NRZ A;  3DRR A;  3WNE A;  4PL7 A;  3VQC A;  3RTV A;  1QHA A;  3D2E B;  3WNH A;  1W97 L;  3NH0 A;  3AVG A;  1HR0 K;  3K59 A;  1A5W A;  4CW7 B;  4E7J A;  4CER A;  1R0A A;  4DTX A;  1TUU A;  1IO2 A;  5C25 A;  4BRF A;  4I6M A;  4KO0 A;  2VQE K;  3J7Z O;  1ATR A;  1XC9 A;  3ISN C;  4KH4 A;  3LDS A;  5AQQ A;  3WNF A;  1BU6 O;  4QOZ B;  4IDH A;  3PY8 A;  4KHQ A;  4OGC A;  3TU5 A;  1UWB A;  4Z4E A;  4CEF A;  4BDZ A;  2HB5 A;  3D2E A;  5I3U A;  4BRD A;  3SV3 A;  3TR8 A;  4CK2 A;  4KHP K;  4BE0 A;  3VET A;  1BGX T;  3LAM A;  4LFA K;  2QWQ A;  3DOK A;  4Z4F A;  3J7A P;  3C6A A;  3P83 D;  5HP1 A;  3QBX A;  1ZBS A;  1NGH A;  4DCH A;  4LF9 K;  1VAZ A;  1SL1 A;  4EHU A;  4CK1 A;  3Q7B A;  4QS9 A;  5M1K A;  5KI6 A;  5JVH L;  5F0X A;  4IO8 A;  4CF0 A;  4Z94 A;  3VQ7 A;  2WC9 A;  1UA0 A;  2OZM A;  3PO5 A;  3QNN A;  2HHU A;  3H45 C;  3RSE B;  2EWS A;  3SZ2 A;  4FSV A;  2PAV A;  4MLH A;  4B9T A;  4NB4 A;  1NOY A;  1B9F A;  3ZT4 A;  2YCH A;  4DTM A;  4FWO A;  4C8M A;  3ZSY A;  2WON A;  1Q82 O;  3VGK A;  3ZEU B;  2P9N B;  3MWP A;  3I56 N;  3DMJ A;  2RHK A;  4FJ7 A;  1KD1 O;  1BWF O;  1RT3 A;  3D2F B;  1HX1 A;  5JS1 A;  4GNI A;  4A5A A;  1OH7 A;  5KTQ A;  3Q7C A;  3BUZ B;  4M42 A;  4K8Z A;  4DMN A;  2QEX N;  1SL2 A;  1BDG A;  1T44 A;  3WNG A;  3CXC M;  1T7P A;  3ZEU A;  3AA5 X;  1N32 K;  4KTZ A;  3KIO A;  1JL1 A;  3I8B A;  2RE2 A;  3FZL A;  4JHD B;  5LJW A;  3KK7 A;  4ELU A;  1YIT N;  2BH1 A;  3D2F A;  2IVN A;  1NGJ A;  2V7Z A;  1JXB A;  3HBT A;  3O1B A;  4DQP A;  3O5B A;  4DV0 K;  2NLX A;  4GKJ K;  4DFM A;  2HHV A;  1HMV A;  2I5J A;  3O9T A;  2G8V A;  3HZ6 A;  4X65 K;  3AGK A;  3AVF A;  1WSI A;  2HBK A;  3MX2 A;  3P4I A;  4AIL C;  4JKB A;  4ID5 A;  1SV5 A;  1QQM A;  2QA4 N;  4WCE L;  4DF8 A;  1IKY A;  1ILY A;  3ATV A;  1BIU A;  3AVH A;  2E2N A;  3CPW M;  1BCM A;  2F7T A;  4E19 A;  4A61 A;  4Q0B A;  3OYB A;  2YHA A;  5H1S Q;  1GOB A;  3LP3 A;  3L8B A;  2V7Y A;  4FVM A;  1T03 A;  3PX0 A;  3U9D A;  3KKS A;  4KKO A;  1TKD A;  4C8L A;  2KKZ A;  4I2P A;  3MAQ A;  3D7E O;  2GEL A;  4N47 A;  4HTL A;  1U48 A;  4DTN A;  3I0R A;  1P8Z A;  1ZBH A;  4IG3 A;  3SYZ A;  1G99 A;  2UYT A;  1HNI A;  4X66 K;  1WB9 A;  4OPA A;  2UU9 K;  4ELT A;  4NLB A;  2H3G X;  3FFI A;  1YF5 L;  1X9J A;  1XHX A;  3AO3 A;  2VGM A;  3JS6 A;  2YJF A;  1S1T A;  3MWT A;  3ZT2 A;  1RT6 A;  4LF8 K;  2RN2 A;  1C1C A;  4B1X B;  4CEE A;  1IJJ A;  1CZA N;  5AQT A;  1W9H A;  5E41 A;  1N36 K;  3R3L A;  5GIN A;  3L2R A;  3M6G A;  4KHN A;  1J6Z A;  3H3N O;  1RDA A;  3V9Z A;  1HNW K;  1ASU A;  1NGC A;  3EZW A;  3JYT A;  1DT9 A;  2KFZ A;  4CBW A;  4C8N A;  4CIE A;  4B1V A;  1MU2 A;  4PY5 A;  3IRX A;  4C8O A;  3T1H K;  1EKE A;  4DR1 K;  1VQL N;  4QAG A;  3CPE A;  3M8R A;  2OPR A;  1YJN N;  3QEI A;  3LDP A;  5FRO A;  3NAE A;  2O8F B;  3U3G A;  3OYN A;  2NRH A;  4H4O A;  4H0T B;  4CIF A;  4KH5 A;  2DFE A;  3CCR N;  1JCF A;  3U3Y A;  3L4I A;  1JLG A;  4JLH A;  4I9Q A;  2VG5 A;  4CEA A;  3OYG A;  4JI0 K;  3CM6 A;  3K2P A;  3IUC A;  1EP4 A;  4BR5 A;  3ZSQ A;  3I55 N;  2IGI A;  1J54 A;  2NRR A;  5CR4 A;  3SK3 A;  4PA1 A;  4CJS A;  2Y1J A;  3DLH A;  2E5L K;  4H0Y B;  2W41 A;  3ENO A;  4KHS A;  3AA2 A;  3QIO A;  3O3F A;  1QQN A;  1D9F A;  1SUQ A;  1VSI A;  4QCL A;  2UXD K;  3M5R A;  4B1Z A;  4W5R A;  3A5O C;  2D0B A;  3O6W A;  1RDC A;  1TGO A;  5E84 A;  4NXM K;  4KI6 A;  1RFQ A;  3DLK A;  3D45 A;  4DUZ K;  1HPM A;  4IKF A;  3EE8 A;  4BAC A;  2NRW A;  5BR9 A;  2HOE A;  2X78 A;  2XRI A;  1S22 A;  4OKJ A;  1CZB A;  2QW9 A;  1GLL O;  3O4Q A;  1KVB A;  3NGZ A;  4DR6 K;  3K57 A;  3UB5 A;  3LDQ A;  4A57 A;  1YJW N;  3TSU A;  1MA9 B;  4DTP A;  3TSQ A;  1BIS A;  3HPH A;  1RBT A;  2D0P A;  3AVM A;  4KFB A;  2VCP A;  5JS2 A;  2YNG A;  1FW6 A;  5IWA K;  1S6P A;  3ZSW A;  1NKE A;  4WFB L;  1QSL A;  5KRT A;  4E3S A;  3QER A;  3M1F A;  3OBY A;  2P51 A;  3F9M A;  2JWL A;  5EOY A;  1VQP N;  1VQ6 N;  3G0Z A;  4CHP A;  5AQG A;  4BGB A;  4E0D A;  3K5M A;  2J4R A;  4J2A A;  4WQ5 C;  4CJF A;  1VRT A;  2FLO A;  1WLJ A;  1GLA G;  4FWS A;  3KWI A;  4NYN A;  2P1J A;  4AM6 A;  2E88 A;  4CFD A;  5GAG P;  1KLN A;  1DTT A;  1HKC A;  1HPZ A;  3NH2 A;  2B5J A;  2HHQ A;  4O0J A;  3CME N;  2HVI A;  4CGI A;  4DSJ A;  3QML A;  4K25 A;  4JI6 K;  4CHY A;  1I94 K;  4E7K A;  3SLC A;  1VQ4 N;  3OYE A;  3DLR A;  1JLC A;  2VYP A;  3G4S N;  4JKG A;  2F4V K;  1TKX A;  3M3Z A;  1IG9 A;  2ZQB A;  3KKR A;  3BZC A;  3QBW A;  3R6M A;  4AHS A;  4DR4 K;  3THY A;  3DRP A;  1NK4 A;  2D4W A;  1TYQ B;  3O8M A;  3TAF A;  2E1Y A;  1Z6R A;  3U8X A;  2PFU A;  4CJ7 A;  4CGD A;  3OJS A;  2YI1 A;  4CEB A;  5BRD A;  4JI3 K;  2WBN A;  5C24 A;  3P31 A;  3WQT A;  3DLB A;  4KHW A;  1WOQ A;  1C6V A;  3EKU A;  4BRK A;  2E20 A;  2ASM A;  4BDY A;  2X6S A;  3L2Q A;  1HQE A;  2ASO A;  5AQZ A;  4CZL A;  1Y97 A;  2HBM A;  4AHU A;  5AJ3 K;  1NU0 A;  4CGH A;  3CFO A;  4BRG A;  4DQS A;  1KAY A;  4GVM A;  3MXJ A;  1TYQ A;  4GKK K;  1X9S A;  1D9D A;  2HNZ A;  3U6F A;  3K5L A;  3GBT A;  1HQU A;  3HVR A;  4IEE A;  4B1U B;  3NVM A;  4Z4G A;  4H4M A;  3ZLJ A;  1C0U A;  2P9K B;  3CG7 A;  2O4I A;  3OYD A;  2E1Z A;  3WXL A;  2QWO A;  4F9O A;  4BG8 A;  3VN5 A;  3VF6 A;  4EAH D;  3LAN A;  4R5P A;  1JCG A;  3SI6 A;  5JMV A;  4K0K K;  1BI4 B;  3AA3 A;  4IBN A;  4FJ9 A;  1XC3 A;  4CGF A;  3C0B A;  3AY9 A;  4A62 A;  1VQ7 N;  3CCU N;  4M63 C;  3AVA A;  1W7A A;  3MCP A;  1HYV A;  4B9N A;  3I0S A;  3PSF A;  4IJN A;  4FVU A;  4BC3 A;  3VER A;  4EP4 A;  1NJZ A;  3CCV N;  2BDP A;  3L0Q A;  4DSL A;  4F4K A;  1BI4 A;  3SAG A;  2O8B B;  3AO5 A;  2XY8 A;  4B3S K;  1S1V A;  1BO5 O;  4CES A;  3OYA A;  4DV2 K;  5BN9 A;  2AJQ A;  3PIP L;  3THV A;  3HI0 A;  4JAX A;  2WOM A;  4KH6 A;  3ZSZ A;  5LJV A;  3T19 A;  4E89 A;  1NGE A;  4F8R A;  4DU1 A;  4CF8 A;  4O55 A;  1VHX A;  3PX4 A;  1N33 K;  1O1W A;  3WUH A;  1NG9 A;  4FPA A;  1E4F T;  3AVB A;  4OJR A;  5BPN A;  4H0X B;  4FJH A;  1N6Q A;  1TL3 A;  4HWI A;  1RGI A;  2Q0R A;  5CYM A;  2O8B A;  4GY2 B;  3GG4 A;  3ZSO A;  3BY5 A;  1KQS M;  3O9U A;  4CK3 A;  4B08 A;  2QWN A;  1P90 A;  1EET A;  3CC7 N;  4RG8 A;  1SQK A;  4KHY A;  2NUB A;  4AQY K;  3PSI A;  3TSP A;  2QWR A;  2AA4 A;  3VEV A;  3HJF A;  4A2A A;  3QEX A;  1YT3 A;  5AZI B;  4ILG B;  4RW4 A;  4L3Q A;  1HJR A;  2P9S A;  1J53 A;  2BE2 A;  3PX6 A;  3EY1 A;  4CF2 A;  1NGF A;  4BR0 A;  1NK7 A;  3O9R A;  3E9P A;  4BY9 C;  3ZT1 A;  1Q9Y A;  4E1N A;  2WFB A;  4CZH A;  3OYC A;  5ADX H;  4FLW A;  1XMO K;  1V4T A;  2E6M A;  4HTU A;  2IOC A;  4CJ3 A;  2AP1 A;  4B9Q A;  2E8A A;  3WEE B;  2JGU A;  5AZI A;  4XIU A;  2Q31 A;  1Q18 A;  4K43 A;  5ADX A;  3NF7 A;  2I7N A;  4BE2 A;  4C8K A;  4YHH K;  1NMD A;  2NRT A;  4FLU A;  1W0H A;  2Q3S A;  3ITH A;  3G71 N;  1X1P A;  3HXM A;  1RDD A;  4Z4C A;  3QES A;  2XY6 A;  2A42 A;  4CE9 A;  3LZI A;  5AR0 A;  4CZE A;  3ZX3 A;  2RF2 A;  3I33 A;  3OVN A;  3VQA A;  5I9E B;  1RT7 A;  4AHC A;  2RKI A;  2P9L B;  2WUS A;  3ZET B;  3CC2 N;  3WEE A;  1JLE A;  3B8A X;  5KPT A;  3SQ4 A;  4NYF A;  4PL8 A;  3OYI A;  1YHQ N;  4CZJ A;  4BR4 A;  2QWP A;  1R59 O;  3QIN A;  4CJE A;  4OVL A;  1HYZ A;  1IH7 A;  2X6N A;  4FZY A;  3C7N B;  1T3V A;  2OPS A;  2F9W A;  4WQ5 A;  1QE1 A;  4HCB A;  2FXU A;  1WBD A;  4CEZ A;  2UUB K;  4H8K A;  3L2V A;  4CHN A;  1L3U A;  4FXD A;  3HOT A;  3A5N C;  2PZS A;  4DS4 A;  3HL8 A;  1L3T A;  3TPQ A;  1VQ9 N;  2P9L A;  3ZET A;  5E26 A;  2W6L A;  1WAJ A;  1JLF A;  3SPY A;  4KI4 A;  4IOX A;  3QO9 A;  4F2R A;  1NJX A;  4UY8 O;  3CFP A;  3DJC A;  3SUN A;  1S5J A;  3C7N A;  3THW B;  3CD6 N;  1YXQ A;  5A2Q O;  4CJW A;  3KLE A;  4FZX C;  2B6A A;  5DMR A;  4BQL A;  2UUC K;  3SAH A;  5GAD P;  4M3X A;  3ZYY X;  3CIP A;  3NDK A;  3E66 A;  1KFS A;  4LC9 B;  5HRN A;  3V1O A;  1ATS A;  4KV8 A;  4M41 A;  3VQ5 A;  2D5R A;  2QTD A;  3L3U A;  4DG1 A;  3RR7 A;  2QKB A;  1ZBU A;  1IBL K;  3P1G A;  4JD2 A;  3UKR B;  3J81 O;  3HO1 A;  4HHT A;  1NK9 A;  1I39 A;  3THW A;  2LSN A;  3SBT A;  3S9H A;  3O80 A;  3VEY A;  3KK3 A;  5DM7 L;  4H03 B;  3CC4 N;  4IOC L;  1KRP A;  3CI5 A;  3CQY A;  5BN8 A;  5C12 A;  1GLE G;  1J9A A;  2QI2 A;  3AO4 A;  4EZ9 A;  2IVP A;  1JCE A;  4ZTJ A;  3HPG A;  3TWH A;  3C6T A;  5GAH P;  3MEC A;  3VQD A;  3OS2 A;  3UKR A;  1VSL A;  3BP8 A;  3L2W A;  1X3N A;  5JIC A;  1FJG K;  1RBV A;  5AQI A;  2KW4 A;  1TV6 A;  1WUA A;  1C0G A;  3VQ8 A;  5TKW A;  4WFA L;  3AVI A;  2HHT A;  3E1Y A;  4LFB K;  4IOA L;  2E6L A;  4CGG A;  4Y1C A;  4JKE A;  3E9O A;  3TTF A;  4E7I A;  1NK8 A;  3OYJ A;  3MDQ A;  4BG9 A;  3O9S A;  2HBJ A;  2P9P A;  3FR0 A;  2ETJ A;  4BWJ A;  3DM2 A;  4BRE A;  3FLC O;  1TK8 A;  3LDL A;  4UQG A;  2GWJ A;  1K8A O;  2Q2R A;  4GMJ B;  4X62 K;  3T1Y K;  4OLA A;  1U47 A;  3QIP A;  3OW2 M;  2Z1H A;  4EFH A;  4Y0W A;  5AQH A;  4DV6 K;  3LM9 A;  1K9M O;  4LH5 A;  2W42 A;  5M1Q A;  5BRE A;  3LP2 A;  4DSE A;  5EX5 A;  5AQF A;  3EE9 A;  3KLG A;  4WYB A;  1S9E A;  2VGN A;  4QS7 A;  1LOT B;  4GVE A;  1FXX A;  3CJ1 A;  2FSJ A;  1X9M A;  5FPD A;  3M8S A;  4O4G A;  4NO7 A;  4WQ4 C;  5J1E A;  2D1K A;  3SBG A;  1JJ2 M;  3VPZ A;  2JWK A;  4JNE A;  3TAG A;  2HW3 A;  3C6H A;  4CD3 A;  3SMS A;  2OZS A;  3N4Q A;  3U9Z A;  4FJL A;  3EL2 A;  2F9T A;  3TAB A;  3LPT A;  1IKX A;  4V19 S;  5BRH A;  5M1P A;  3AAQ A;  4JYA K;  4FLT A;  3HK2 A;  3LDN A;  3QEW A;  4A5B A;  3MXM A;  3P39 A;  4JS4 A;  5JVG L;  4FLV A;  3VOV A;  2IAJ A;  1RT4 A;  1M90 O;  3CQ8 A;  1FK9 A;  4E1J A;  4CZK A;  3VEW A;  4GV6 A;  5AZJ B;  4RW8 A;  3PIO L;  4BVP A;  3T1A A;  1HNV A;  5KGW A;  2BAN A;  5C2D A;  3QIC A;  4JI5 K;  4CHZ A;  3SCX A;  1HKG A;  4LF7 K;  4CD1 A;  3G6E N;  2A41 A;  3A5L C;  3OA9 A;  3NVK A;  1VSD A;  1U45 A;  3C95 A;  5FPN A;  1WNS A;  2NRX A;  5FRM A;  3OYF A;  5C10 A;  1BA1 A;  4ILJ A;  4FLZ A;  5AZJ A;  2A1R A;  4DFK A;  1VSM A;  1Y64 A;  3LDO A;  4PKI A;  4Q5V A;  2OPP A;  3QET A;  3B6P A;  1U6Z A;  2NZT A;  2VG7 A;  3B6O A;  3OHR A;  4MO5 A;  3HM8 A;  2YHW A;  4W5Q A;  2WTU A;  1KVA A;  4DLE A;  2O8C A;  3CCM N;  3O08 A;  1QQC A;  1WSF A;  3VES A;  1U49 A;  4JKC A;  3SMP A;  4J2D A;  4FJM A;  4MQ3 A;  4OLB A;  2GTD A;  3K5O A;  5C42 A;  3MCA B;  2JLE A;  4MDA A;  5HRP A;  4QS8 A;  1RTD A;  1U2V A;  4AHR A;  4BC5 A;  4IEI A;  3QLH A;  4HCC A;  3K5N A;  3F2K A;  4CGJ A;  4DTR A;  4YOR A;  1TAQ A;  4JN4 A;  1K6Y A;  2E4L A;  1C1A A;  1HNZ K;  5AQW A;  3VF4 A;  1RTJ A;  1J5O A;  3S41 A;  3IMX A;  2QKK A;  1WN7 A;  2HHS A;  4OPH A;  2CGJ A;  2ATQ A;  2Q97 A;  3QDK A;  1EX4 A;  3K0S A;  4B8A B;  2KZM A;  1BIZ A;  3CJB A;  4E7L A;  3EO3 A;  4LH4 A;  1DTQ A;  4O0I A;  3IKM A;  1Z05 A;  4AH9 A;  4NCB A;  4DWI A;  3PLA A;  4PUO A;  3LP1 A;  1RNH A;  4FW1 A;  1ZC6 A;  2XY5 A;  2Q0U A;  4LFC K;  4JKG B;  4DFJ A;  3LAL A;  3J8A A;  1F21 A;  4FZZ A;  4BGA A;  2HNY A;  3THY B;  4KAZ A;  3D6R A;  1MWM A;  1RDW X;  5AQS A;  4Z4H A;  5EY4 A;  3CHW A;  4CF9 A;  5J2M A;  3VQ6 A;  3SUQ A;  2HMP A;  3HTV A;  4FOI A;  4KHU A;  1LCU A;  4N41 A;  5K14 A;  2I7P A;  2Q1N A;  1BA0 A;  3FFK B;  1SKR A;  1NGI A;  4IWV A;  3SJH A;  4BR9 A;  1ZBI A;  1QQO A;  1UAX A;  1TUY A;  2HST A;  1Q86 O;  1T05 A;  3OJU A;  2OYQ A;  1NK0 A;  3HVT A;  3L4Q A;  3CCS N;  5FLX O;  3PO4 A;  5D3G A;  4JI8 K;  4RWT A;  4B8C A;  2A3Z A;  4ISE A;  3ZSV A;  4H5N A;  3QNO A;  3K58 A;  4BR2 A;  2EX3 A;  4MDB A;  5KPR A;  4FJN A;  4FWQ A;  3WQU A;  1QZ6 A;  1T6D A;  3HT3 A;  3MN6 A;  3A8Y A;  3KWG A;  2OTL N;  2ZJP L;  1NKB A;  4FK0 A;  3CJA A;  1CZ9 A;  5IT9 O;  3SQ2 A;  4BR7 A;  1IG8 A;  3O3G A;  2Z1I A;  3IFR A;  3ULD A;  1SZ2 A;  4W5N A;  3R1X A;  4A59 A;  3SQ1 A;  4B3M K;  1M1K O;  4CCH A;  4K42 A;  5B8H A;  3HOS A;  3MK6 A;  1KCF A;  1NNE A;  1H1V A;  1EO1 A;  1Q81 O;  1HJO A;  1QS4 A;  2IS3 A;  5FDL A;  4OPK A;  3A0I X;  4FYD A;  3ZT0 A;  4BRH A;  4C1N K;  3VTH A;  4BC4 A;  1VRU A;  1ZBL A;  5CYQ A;  4FJI A;  3VQ4 A;  3H08 A;  3EEQ A;  3PUF A;  4ISG A;  1YVN A;  4KPY A;  3KD5 E;  3S3O A;  3UE5 A;  2GV9 A;  1L5U A;  4X64 K;  4B3T K;  1S72 N;  4MLE A;  4LF4 K;  2P9U A;  1Z25 A;  4H5T A;  4KRF A;  5LY3 A;  3T3F A;  1VQM N;  3TTC A;  4YY3 K;  2XO7 A;  2HND A;  3O4W A;  2B4J A;  2GBZ A;  3VQE A;  5KQD A;  1RBU A;  4BRA A;  1NJY A;  4M7X A;  5FPM A;  4DQI A;  3MXI A;  4N76 A;  3H46 O;  4YDU C;  1SAZ A;  3R9P A;  2BGG A;  2ZGY A;  3THX B;  4FJK A;  1NGG A;  5KGX A;  4WQ4 A;  4RW7 A;  1BUP A;  3U4L A;  3N4P A;  3IAY A;  4B3R K;  2FF3 B;  1SKW A;  4JEP A;  3KTQ A;  4NCG A;  5HRR A;  4N5S A;  1DEJ A;  3ATU A;  1XHZ A;  1RIL A;  3W3D A;  2IDO A;  3EN9 A;  3VEO A;  4FCY A;  4FWR A;  3ID8 A;  3V6D A;  3AAP A;  1EWR A;  3RMB A;  3H3O B;  1HYS A;  1RT2 A;  3V1R A;  5BPM A;  3VA3 A;  3THX A;  1OKJ A;  1OH5 A;  3V9X A;  3AVL A;  1QSS A;  5AQP A;  3A5M C;  1NGA A;  1RT5 A;  3MX5 A;  1WAF A;  4CIG A;  4I2Q A;  1BQN A;  2Z1G A;  4ICL A;  3RRH A;  1LW2 A;  5DM6 L;  3CCJ N;  1BCO A;  3NMU A;  1WSH A;  2KQ2 A;  1OH8 A;  4CED A;  4IFE A;  1DKG D;  5AFU H;  4O44 A;  2F8S A;  3AGR A;  3AVJ A;  4YNQ A;  2P9S B;  3VEZ A;  4M45 A;  3ZSR A;  4BVO A;  3MED A;  3NF8 A;  1VQK N;  3QB0 A;  4DSF A;  3R8E A;  4CJP A;  1HNX K;  1ESV A;  4B9M A;  5AFU A;  2BUP A;  1RBR A;  3SQ0 A;  1NOZ A;  1ASW A;  1LAW A;  4I9L A;  4NLC A;  5M1N A;  2QK9 A;  3UKU A;  1MDU B;  1VSH A;  5GIP A;  3CER A;  1IBM K;  4BRP A;  3FGU A;  1NWK A;  4CEQ A;  4CJV A;  5J2P A;  4EZ6 A;  2EHG A;  4C1N I;  3V9S A;  1KAZ A;  1SS6 A;  4AHV A;  5LMU K;  4FK4 A;  1YUW A;  2HVH A;  5C0Y A;  4R79 A;  1JLB A;  4FL9 A;  4LSN A;  3ENB A;  2PYL A;  3E9L A;  4DTJ A;  4Z0U A;  2NNW A;  1VQO N;  1GOC A;  3AVK A;  3QFP A;  4IJA A;  3OTO K;  4CVN E;  4DLG A;  5M1F A;  1UA1 A;  1D5A A;  3LWM A;  1HLU A;  2ZWH A;  3DYA A;  1C0M A;  4JKA A;  3BF3 A;  4OPJ A;  1VQ5 N;  3OYL A;  4W5O A;  4JI7 K;  3BDP A;  1VSK A;  1GOA A;  4AHT A;  1HRH A;  1Z26 A;  3F73 A;  1LAV A;  4Y1D A;  4DSI A;  1GLD G;  3VGM A;  4AM7 A;  4KBO A;  4PKG A;  4CJU A;  2KHO A;  3WXJ A;  1JL2 A;  4BE1 A;  4KTW A;  5BR8 K;  1FKP A;  4H0P A;  5I42 A;  1IKV A;  1JLQ A;  1ASV A;  4O5F A;  4XH4 A;  3RWU A;  1RDB A;  1V4S A;  4FWK A;  1QTM A;  1C1B A;  4FJJ A;  3KLF A;  2YV0 X;  4FPB A;  2GEM A;  2DFF A;  3H1V X;  4FJ8 A;  5CY4 A;  4CEO A;  1WBB A;  1XQS C;  1QHT A;  4J2B A;  2IVO A;  5AQJ A;  1TVR A;  2HF4 A;  3AVC A;  3GDQ A;  1NJW A;  4B9V A;  1Q8I A;  1DLO A;  5ELZ A;  5J2N A;  2KZZ A;  1TKZ A;  1VK0 A;  1C0T A;  1TK0 A;  5BPL A;  3OBW A;  3BZK A;  3VGL A;  2PY5 A;  5AQN A;  4PHT X;  4DS5 A;  1GLB G;  2VWB A;  1NLV A;  4JD2 B;  5HBM A;  1X9W A;  5T7B A;  4FM0 A;  5SWM A;  4CFC A;  2ZJR L;  3L3V A;  2A6A A;  2VQF K;  3C94 A;  4Z4I A;  4BRM A;  5AQV A;  5HRO A;  4YFU A;  1LWF A;  3MN7 A;  1EQY A;  1A5V A;  4CJ5 A;  4B1Y B;  2A5X A;  4DTU A;  4YOX A;  3V4I A;  2O8E B;  3KHY A;  4BRI A;  2UXB K;  4FM2 A;  2UUA K;  4IFV A;  4DR5 K;  4YOT A;  2QXF A;  2ZGZ A;  4CJT A;  4DQR A;  3AAR A;  2ASP A;  1BL3 A;  5KRS A;  5GAE P;  3TAR A;  3OYK A;  3NE6 A;  1S1W A;  4NXN K;  3RMA A;  4J2E A;  3VEN A;  4FLX A;  1B9D A;  2DPN A;  4FO0 A;  5F1X A;  4JKD A;  2HMI A;  3EKS A;  4FWP A;  3J7Y P;  3KVG A;  3RSE A;  1FKO A;  1SL0 A;  2O8E A;  3FZF A;  2G8K A;  3NBP A;  3ASM A;  2YJE A;  2YKN A;  5GIO A;  2P9P B;  1REV A;  4F3T A;  3GOI A;  3SAF A;  2GX9 A;  1KC8 O;  1ITG A;  1ZBF A;  2FBV A;  2ITM A;  4LSL A;  3GL1 A;  3BF1 A;  4WFN L;  2YHX A;  4DR3 K;  3TAQ A;  2ZD1 A;  2P9N A;  1NMN A;  3ZSX A;  1OVQ A;  2FBX A;  4JI4 K;  3OYM A;  1QSY A;  2V52 B;  1YJ9 N;  4BRQ A;  4JKF A;  5AQR A;  2ITG A;  1XI1 A;  4DUY K;  4YOU A;  3P5J A;  5AQO A;  4E7H A;  2GUP A;  1S6Q A;  4ZHR A;  1BOT O;  2QWM A;  3MEG A;  5C2F A;  1VQN N;  3AA4 A;  3ULE B;  4YDU A;  4IDK A;  4K41 A;  2ZE2 A;  4OGE A;  3CCE N;  5M1O A;  4DR2 K;  2FBT A;  1YIJ N;  3T7Z A;  3DXM B;  3AO1 A;  3ZCM A;  2W40 A;  5AQU A;  3ALY A;  3SUO A;  4JHD A;  1I3A A;  2QWL A;  2VWJ A;  4HVJ A;  5HOO A;  1NGD A;  1NGB A;  3D0P A;  2XY7 A;  4JK7 A;  4MFB A;  4OX9 K;  1LV5 A;  3DLE A;  1KFD A;  3E01 A;  2A40 A;  4CZF A;  1NBW A;  2YNI A;  4DSK A;  3DXK B;  2ZM6 K;  2NRV A;  3ULE A;  1GLC G;  3ZT3 A;  3IS9 A;  2YNH A;  3WXK A;  3KK2 A;  2OCE A;  5AQY A;  1TK5 A;  3MEE A;  1NM1 A;  3DAW A;  2R7Y A;  3DXM A;  3VMF B;  4KB0 A;  3P38 A;  3V1Q A;  2W6K A;  3KK1 A;  3TAN A;  2HHW A;  1LWC A;  4CEC A;  3HP6 A;  3J80 O;  4BC2 A;  3CMA N;  4FJX A;  1EWQ A;  4F2S A;  2CH6 A;  3M8Q A;  4DU4 A;  2HHH K;  3DXK A;  5LL6 Z;  3RRG A;  1QVF M;  4HUF A;  5KQ8 A;  4DV7 K;  1K8K B;  2YHY A;  3TAP A;  3TAE A;  2FBY A;  3SUP A;  4CZM A;  2GWK A;  3NF9 A;  4ISF A;  3K9J A;  3RVC A;  3HSC A;  4EIA A;  4GV9 A;  2CH5 A;  4A2B A;  1C0F A;  3KLI A;  5MLC Q;  4G1Q A;  5CZ1 A;  3LPU A;  3OS1 A;  4YOW A;  2HHX A;  4LF5 K;  2V51 B;  3VTI A;  3L2U A;  2O8C B;  3O3H A;  3VQ9 A;  4E1M A;  2A1S A;  3W0L A;  4JK8 A;  4PKH A;  4XH1 A;  4IG0 A;  4N56 A;  3HPO A;  1N5Y A;  2HF3 A;  1K8K A;  3LP0 A;  1U2V B;  4OO1 J;  4JI1 K;  4XEI A;  3SV4 A;  4AF1 A;  4BDP A;  4H5W A;  3VEX A;  4CFB A;  3AV9 A;  3LM2 A;  4FM1 A;  1S3X A;  2FSN A;  2QM1 A;  1XUP O;  1HKB A;  1S1X A;  4FWL A;  1T8E A;  4DV5 K;  3CCQ N;  4DQQ A;  1G15 A;  4FJ5 A;  3G25 A;  1RCH A;  3V81 A;  2F8T A;  1Q9X A;  4WF9 L;  1SKS A;  2OA8 A;  5AQX A;  3DRS A;  4LD0 A;  3ZX2 A;  1YVU A;  1NK6 A;  1VSF A;  4B9L A;  2G8I A;  1S9G A;  4BWM A;  5LMN K;  3RMD A;  1TAU A;  4FK2 A;  2O8F A;  3VQQ A;  5AQK A;  4IZ9 A;  3NF6 A;  4C23 A;  1TKT A;  3JSM A;  3LAK A;  3I8D A;  5C15 A;  5JLH A;  4FW2 A;  3M8P A;  4BRC A;  4DTS A;  4DF4 A;  4DQ8 A;  4BQZ A;  4CJL A;  3OS0 A;  1XWL A;  2VG6 A;  5JLF A;  1N34 K;  4EP5 A;  3CJC A;  4JRP A;  4I7F A;  2PYJ A;  3GE1 A;  2DFH A;  3VF2 A;  1NKC A;  4TSX A;  4CJ4 A;  3JXU A;  5CHI A;  4KB1 A;  4G9Z A;  3CFR A;  4CF1 A;  1RT1 A;  3LWL A;  2KFN A;  3F5T A;  1VSJ A;  3DLL L;  2ZF5 O;  3FZH A;  4H0V B;  1RTI A;  4NCA A;  3SJJ A;  4DR7 K;  3TI0 A;  3MN5 A;  4M7Y A;  2DY4 A;  4IO9 L;  2RPI A;  3NGI A;  4M3R A;  1O13 A;  3WXM B;  3SNN A;  4JS5 A;  2GUI A;  3C65 A;  2BTF A;  3AVN A;  3H6E A;  4DU3 A;  1BQM A;  3DI6 A;  4CHO A;  3S3N A;  1RTH A;  1IBK K;  2G8W A;  1K73 O;  4JI2 K;  5EXW A;  1EXQ A;  4IFY A;  2Z1J A;  3IG1 A;  2CGL A;  3LZJ A;  3WXI A;  1DGK N;  3S3M A;  1VSE A;  2Q36 A; 
#chains in the Genus database with same CATH homology
 3ZYY X;  3CIP A;  2P9S B;  3VEZ A;  4BVO A;  1CZA N;  3E66 A;  5AQT A;  5HL7 L;  4LC9 B;  4DB3 A;  1ATS A;  3R3L A;  4DKW A;  1VQK N;  3QB0 A;  5GIN A;  3M6G A;  3R8E A;  2QTD A;  3MMV A;  1ESV A;  1J6Z A;  3H3N O;  2PBD A;  5AFU A;  2BUP A;  1NGC A;  2E2Q A;  3EZW A;  4JK9 A;  5KPZ A;  1DT9 A;  4CBW A;  3TTD A;  5M1N A;  4NLC A;  4JD2 A;  3UKU A;  2OAN A;  4B1V A;  1MDU B;  3UKR B;  5GIP A;  3CER A;  4BRP A;  3FGU A;  1NWK A;  3IDH A;  3ENH A;  3SBT A;  4C1N I;  5F1X A;  1VQL N;  1RDU A;  1KAZ A;  3CPE A;  1SS6 A;  3O9Q A;  3H1Q A;  3O80 A;  4CZG A;  3VEY A;  1YJN N;  3LDP A;  5DM7 L;  1KXP A;  1YUW A;  4H03 B;  4H5R A;  3CC4 N;  4IOC L;  4R79 A;  2NRH A;  5C0Y A;  4H0T B;  4FL9 A;  3CI5 A;  4KH5 A;  3CQY A;  5BN8 A;  3ENB A;  1JCF A;  4IXC A;  3CCR N;  3L4I A;  2P9U B;  5C12 A;  1GLE G;  3E9L A;  2QI2 A;  4MO4 A;  2NNW A;  2IVP A;  1VQO N;  1JCE A;  1ATN A;  1GLJ O;  3CQX A;  3QFP A;  5GAH P;  3L6Q A;  4IJA A;  4B1W B;  3IUC A;  4BR5 A;  3I55 N;  3UKR A;  5M1F A;  3BP8 A;  5TKY A;  2NRR A;  2FF6 A;  5CR4 A;  1X3N A;  3SK3 A;  5JIC A;  2E2O A;  1OVY A;  5AQI A;  3CCL N;  2ZWH A;  1HLU A;  1WUA A;  1C0G A;  2W41 A;  2D0O A;  3ENO A;  4H0Y B;  4JKA A;  5TKW A;  3ZX0 A;  4WFA L;  3BF3 A;  2P9I B;  3E1Y A;  1QQN A;  1VQ5 N;  4IOA L;  4JKE A;  3E9O A;  3TTF A;  1T6C A;  1GLF O;  3MDQ A;  4BG9 A;  3M5R A;  3O9S A;  2HBJ A;  4B1Z A;  2P9P A;  3A5O C;  3FR0 A;  1GLD G;  3HRG A;  3O6W A;  3VGM A;  4AM7 A;  4KBO A;  4PKG A;  4BRE A;  5E84 A;  2KHO A;  3WXJ A;  3FLC O;  1RFQ A;  4FOE A;  4H0O A;  3LDL A;  4U7B A;  1YAG A;  2GWJ A;  4H5V A;  1HPM A;  5AQL A;  1K8A O;  4H0P A;  3EE8 A;  4YOY A;  3CF5 L;  2NRW A;  5BR9 A;  2HOE A;  1YI2 N;  1S22 A;  2Q2R A;  4O5F A;  4XH4 A;  2QW9 A;  1V4S A;  3CET A;  1GLL O;  4FWK A;  4O8U A;  2ZJQ L;  3UB5 A;  2HBL A;  3KZB A;  3LDQ A;  4FPB A;  4A57 A;  4EFH A;  3OW2 M;  4Y0W A;  2P9I A;  5AQH A;  2GEM A;  3LM9 A;  1YJW N;  3TSU A;  5CE3 A;  1K9M O;  3H1V X;  5M1Q A;  1MA9 B;  5BRE A;  1D4X A;  1XQS C;  3TSQ A;  5EX5 A;  5AQF A;  4BRO A;  2D0P A;  3EE9 A;  4CZI A;  2IVO A;  5AQJ A;  2E2P A;  2VCP A;  1DGK N;  5BRF A;  4WYB A;  2VGN A;  1X3M A;  2HF4 A;  3GDQ A;  4QS7 A;  5ELZ A;  1LOT B;  4GVE A;  4WFB L;  1QVG M;  2P9K A;  3ID6 A;  4FWN A;  3CJ1 A;  3WT0 A;  5BPL A;  2FSJ A;  3OBW A;  4RCH A;  3CJ7 A;  3VGL A;  5FPD A;  4JKH A;  5AQN A;  3M1F A;  3O1W A;  1GLB G;  2D1K A;  2JWL A;  2VWB A;  3F9M A;  3OBY A;  4NO7 A;  4WQ4 C;  1NLV A;  5EOY A;  3K9K A;  3SBG A;  3T69 A;  3VPZ A;  2JWK A;  4JNE A;  1VQP N;  1JJ2 M;  3C6H A;  4CD3 A;  3SMS A;  4JD2 B;  1VQ6 N;  3N4Q A;  3U9Z A;  3UKU B;  4BRN A;  4RTF D;  3EL2 A;  1NJI O;  2F9T A;  5AQG A;  4BGB A;  2ZJR L;  2J4R A;  2A6A A;  4WQ5 C;  5BRH A;  5M1P A;  3AAQ A;  4O8K A;  4BRM A;  1BG3 A;  5AQV A;  3LDN A;  3SAH A;  3MN7 A;  4A5B A;  1EQY A;  2FLO A;  1GLA G;  2CGK A;  4FWS A;  3KWI A;  4B1Y B;  3P39 A;  2A5X A;  4AM6 A;  2E88 A;  4YOX A;  5JVG L;  5GAG P;  3VOV A;  1HKC A;  1M90 O;  1ZXO A;  3LL3 A;  3KHY A;  4BRI A;  4E1J A;  1KAX A;  3CME N;  4FWM A;  2YX6 A;  4CZK A;  4ILH A;  5AQM A;  3VEW A;  3QML A;  1QZ5 A;  4GV6 A;  3FZM A;  2QXL A;  4K25 A;  2ZGZ A;  4YOT A;  5AZJ B;  4YOV A;  4GV3 A;  3MN9 A;  2IIR A;  3AAR A;  3SLC A;  1VQ4 N;  2ASP A;  2VYP A;  3G4S N;  3PIO L;  4BVP A;  5GAE P;  1Q7Y O;  4JKG A;  3M3Z A;  3FE1 A;  5C2D A;  3QIC A;  3QBW A;  3R6M A;  2KLA A;  4EHT A;  3VEN A;  5F2R A;  1HKG A;  2DPN A;  3QFU A;  4FO0 A;  4J8F A;  2D4W A;  1TYQ B;  4JKD A;  3DWL A;  4CD1 A;  3A5L C;  1HUX A;  2A41 A;  3CJ9 A;  3EKS A;  3OA9 A;  3O8M A;  2E1Y A;  3KVG A;  4FWP A;  3RSE A;  3NVK A;  1Z6R A;  1VQ8 N;  3FZF A;  3U8X A;  4CI6 A;  5FPN A;  1E4G T;  2NRX A;  2PFU A;  4CJ7 A;  2YJE A;  5C10 A;  2P9P B;  5GIO A;  4CBX A;  2YI1 A;  3GOI A;  4DHY A;  3SAF A;  2GX9 A;  1KC8 O;  1BA1 A;  5BRD A;  2WBN A;  2ITM A;  4ILJ A;  1MWK A;  3P31 A;  5AZJ A;  3GL1 A;  3WQT A;  3BF1 A;  1Y64 A;  4XH5 A;  4WFN L;  1WOQ A;  2YHX A;  3LDO A;  4PKI A;  2P9N A;  3EKU A;  4BRK A;  2E20 A;  2ASM A;  1U6Z A;  2ASO A;  5AQZ A;  2NZT A;  3FZK A;  4CZL A;  5FPE A;  2V52 B;  3OHR A;  2HBM A;  4MO5 A;  3BEX A;  1YJ9 N;  4BRQ A;  3HM8 A;  4I6M B;  4JKF A;  4BRG A;  4CBU A;  2YHW A;  1KAY A;  2OTJ N;  2FSK A;  5AQR A;  3O08 A;  4U67 L;  3CCM N;  1N8R O;  4BRL A;  3VES A;  1TYQ A;  4JKC A;  4YOU A;  3SMP A;  1W2B M;  5EVZ A;  2GTD A;  5AQO A;  2NRZ A;  3GBT A;  4PL7 A;  2GUP A;  4IEE A;  4B1U B;  3MCA B;  1BOT O;  2QWM A;  4MDA A;  3NVM A;  4QS8 A;  5C2F A;  1QHA A;  1U2V A;  3D2E B;  4BC5 A;  1VQN N;  1W97 L;  2P9K B;  4IEI A;  3ULE B;  2E1Z A;  4YDU A;  3WXL A;  3F2K A;  4K41 A;  2QWO A;  4F9O A;  4YOR A;  4BG8 A;  4JN4 A;  3CCE N;  5M1O A;  1YIJ N;  3VF6 A;  1TUU A;  3T7Z A;  4EAH D;  3DXM B;  5AQW A;  4BRF A;  2W40 A;  4I6M A;  1JCG A;  5AQU A;  3VF4 A;  4JHD A;  5JMV A;  3J7Z O;  2QWL A;  1ATR A;  5HOO A;  1NGD A;  1NGB A;  4KH4 A;  5AQQ A;  1XC3 A;  3S41 A;  3IMX A;  4JK7 A;  3C0B A;  1BU6 O;  3AY9 A;  4A62 A;  4IDH A;  4OPH A;  1VQ7 N;  2CGJ A;  5GAD P;  3TU5 A;  2A40 A;  4CZF A;  2Q97 A;  4M63 C;  3CCU N;  1NBW A;  3QDK A;  3D2E A;  3DXK B;  4BRD A;  3MCP A;  3CJB A;  2NRV A;  3ULE A;  1GLC G;  4IJN A;  4FVU A;  3EO3 A;  4BC3 A;  3WXK A;  3VET A;  5AQY A;  1NM1 A;  3VER A;  3IKM A;  1Z05 A;  3DAW A;  3CCV N;  2QWQ A;  3DXM A;  3VMF B;  3L0Q A;  3PLA A;  3C6A A;  1ZC6 A;  3P38 A;  2Q0U A;  3QBX A;  1ZBS A;  3SAG A;  1NGH A;  4JKG B;  4DCH A;  1VAZ A;  4EHU A;  3J8A A;  3Q7B A;  4BC2 A;  4QS9 A;  5M1K A;  1BO5 O;  5JVH L;  5F0X A;  4IO8 A;  3CMA N;  5BN9 A;  4BGA A;  3PIP L;  4Z94 A;  3HI0 A;  2CH6 A;  4JAX A;  4KH6 A;  2WC9 A;  1MWM A;  1RDW X;  3D6R A;  5AQS A;  5LJV A;  5EY4 A;  1NGE A;  3CHW A;  3H45 C;  3DXK A;  3RSE B;  2EWS A;  1QVF M;  4FSV A;  2HMP A;  2PAV A;  3HTV A;  4FOI A;  4MLH A;  4NB4 A;  5KQ8 A;  1K8K B;  2YCH A;  1LCU A;  2YHY A;  4FWO A;  2I7P A;  3WUH A;  4CZM A;  4FPA A;  2GWK A;  1E4F T;  1BA0 A;  2Q1N A;  3FFK B;  4ISF A;  3K9J A;  3RVC A;  3HSC A;  4EIA A;  4GV9 A;  1NGI A;  5BPN A;  4IWV A;  3SJH A;  4H0X B;  4BR9 A;  1Q82 O;  3VGK A;  3ZEU B;  2CH5 A;  1QQO A;  2P9N B;  4A2B A;  1C0F A;  5MLC Q;  1TUY A;  2HST A;  1Q86 O;  4HWI A;  3MWP A;  3I56 N;  1RGI A;  2Q0R A;  4YOW A;  4GY2 B;  3GG4 A;  4PHT X;  3L4Q A;  3CCS N;  2RHK A;  1KD1 O;  1KQS M;  3O9U A;  2V51 B;  3VTI A;  4RWT A;  2QWN A;  1BWF O;  1P90 A;  2A3Z A;  3D2F B;  4ISE A;  1HX1 A;  4GNI A;  3W0L A;  4H5N A;  4A5A A;  3CC7 N;  4JK8 A;  4PKH A;  4XH1 A;  1SQK A;  4BR2 A;  3Q7C A;  3BUZ B;  2HF3 A;  4MDB A;  5KPR A;  1K8K A;  3TSP A;  4FWQ A;  3WQU A;  1QZ6 A;  1T6D A;  1U2V B;  2AA4 A;  2QWR A;  3VEV A;  4OO1 J;  2QEX N;  3MN6 A;  1BDG A;  4A2A A;  4XEI A;  4AF1 A;  3A8Y A;  3KWG A;  3CXC M;  2OTL N;  5AZI B;  2ZJP L;  4H5W A;  3ZEU A;  4ILG B;  3VEX A;  3CJA A;  3LM2 A;  4L3Q A;  1S3X A;  4BR7 A;  2FSN A;  1IG8 A;  2P9S A;  2QM1 A;  1XUP O;  1HKB A;  3IFR A;  3I8B A;  2RE2 A;  3FZL A;  4FWL A;  4JHD B;  5LJW A;  1SZ2 A;  1NGF A;  3KK7 A;  3R1X A;  3CCQ N;  4BR0 A;  4A59 A;  1YIT N;  2BH1 A;  3D2F A;  1M1K O;  3O9R A;  4K42 A;  5B8H A;  3E9P A;  3HOS A;  4BY9 C;  2IVN A;  1NGJ A;  2V7Z A;  3G25 A;  3MK6 A;  2WFB A;  4CZH A;  1H1V A;  5ADX H;  4WF9 L;  3HBT A;  1EO1 A;  3O1B A;  1Q81 O;  1HJO A;  1V4T A;  5AQX A;  3O5B A;  3ZX2 A;  2NLX A;  2AP1 A;  3A0I X;  4BRH A;  4B9Q A;  2E8A A;  4C1N K;  3WEE B;  3VTH A;  4BC4 A;  5AZI A;  2Q31 A;  1Q18 A;  4IZ9 A;  4K43 A;  3O9T A;  5AQK A;  4C23 A;  5ADX A;  3HZ6 A;  4ISG A;  1YVN A;  2I7N A;  3AGK A;  2HBK A;  1NMD A;  5C15 A;  3MX2 A;  3P4I A;  2NRT A;  3UE5 A;  5JLH A;  1S72 N;  4MLE A;  4BRC A;  3G71 N;  2P9U A;  4H5T A;  4JKB A;  5LY3 A;  1VQM N;  3TTC A;  2A42 A;  4DQ8 A;  5AR0 A;  4BQZ A;  1QQM A;  2QA4 N;  3O4W A;  4WCE L;  4CZE A;  5JLF A;  3ZX3 A;  5KQD A;  1ILY A;  4BRA A;  3ATV A;  3CJC A;  3I33 A;  4M7X A;  5FPM A;  3GE1 A;  2E2N A;  3H46 O;  5I9E B;  3VF2 A;  4YDU C;  3CPW M;  1SAZ A;  3CC2 N;  2P9L B;  2WUS A;  3ZET B;  2F7T A;  3R9P A;  4A61 A;  2ZGY A;  3JXU A;  3WEE A;  3B8A X;  5CHI A;  5KPT A;  1NGG A;  4G9Z A;  4PL8 A;  1YHQ N;  5H1S Q;  4CZJ A;  4BR4 A;  4WQ4 A;  2QWP A;  1R59 O;  1BUP A;  3U4L A;  3N4P A;  2V7Y A;  3F5T A;  2FF3 B;  3C7N B;  4JEP A;  3G6E N;  3U9D A;  1T3V A;  3DLL L;  2ZF5 O;  3FZH A;  2KKZ A;  4H0V B;  2F9W A;  3D7E O;  2GEL A;  4WQ5 A;  2FXU A;  1DEJ A;  4HTL A;  3ATU A;  3MN5 A;  3W3D A;  3EN9 A;  4M7Y A;  3VEO A;  3HOT A;  1P8Z A;  4FWR A;  3A5N C;  4IO9 L;  3ID8 A;  3AAP A;  1O13 A;  3WXM B;  1G99 A;  2UYT A;  3H3O B;  3TPQ A;  1VQ9 N;  2P9L A;  3ZET A;  5E26 A;  3C65 A;  2BTF A;  4OPA A;  5BPM A;  1OKJ A;  4NLB A;  2H3G X;  3H6E A;  4IOX A;  1YF5 L;  5AQP A;  1X9J A;  3A5M C;  1NGA A;  3MX5 A;  4UY8 O;  3DJC A;  5DM6 L;  2VGM A;  3JS6 A;  3CCJ N;  3C7N A;  1K73 O;  3NMU A;  5EXW A;  3CD6 N;  2YJF A;  1YXQ A;  3MWT A;  4IFE A;  1DKG D;  5AFU H;  4B1X B;  4BQL A;  2CGL A;  3WXI A;  1T44 A;  1IJJ A;  3AGR A;  2Q36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...