5M1OA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound cobalt
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
188
structure length
188
Chain Sequence
AMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
molecule keywords Phage terminase large subunit
total genus 68
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1oA00
5M1NA 4IDHA 3CPEA 4IFEA 5C12A 5C2DA 5C2FA 4IEIA 5M1OA 3C6AA 5M1QA 5C15A 5C10A 4IEEA 5M1FA 5M1KA 5M1PA 3C6HA
chains in the Genus database with same CATH superfamily
4BVPA 3LAMA 3ZETB 4KH4A 2E2PA 4FWSA 4DV2K 5C2DA 4L3QA 3WNEA 2P9LB 2OPPA 4QCLA 4CHOA 4E7JA 2ASOA 2XHBA 3TAEA 2O8BB 4DSLA 1ZBLA 3BDPA 2O4GA 2IGIA 5AZIA 4B1YB 1KC8O 4ZTJA 3TTDA 1F21A 1Z25A 1RCHA 5F0XA 5KPTA 1KCFA 3CFRA 2F7TA 1RTIA 4CK1A 3I0RA 2W6KA 4CEOA 3JSMA 2OCEA 3FR0A 3NVMA 3V81A 3NVKA 4FLWA 3ZEUB 4CF1A 4BDYA 3FZHA 4CFBA 3HJFA 1XMOK 5AR0A 1EKEA 4M7YA 4LFAK 1LWEA 3CCMN 2VG5A 3J7AP 4B9UA 1JLBA 1HKCA 3H1VX 3TI0A 4KREA 1NOZA 2YNFA 3ZX3A 1HR0K 5EVZA 4CJTA 3F73A 2YCHA 3O9SA 1QZ6A 3M1FA 4YY3K 1T6CA 1X3MA 2CGKA 4FJ7A 4DR5K 4W5TA 2LSNA 2OZMA 4H5NA 2WC9A 1BGXT 4B9QA 4A5AA 3QESA 2PYLA 4LH4A 3HM9A 1VQMN 1C0TA 1WNSA 2E2OA 3SAGA 4BWMA 5EY4A 5KPZA 2ZJRL 1TL3A 4H5WA 4DS5A 2D0PA 2BANA 4B9VA 3AA2A 4CD3A 4FVUA 3KLGA 5FDLA 4DTSA 3ID6A 2O8EA 3O1BA 1T3VA 4YNQA 4I6MB 4FLVA 3OHRA 4IFEA 4PUOA 1WBBA 2A42A 3LDOA 4H0YB 3VF4A 2H3GX 2I7NA 4BC2A 5C2FA 3ZETA 1HJOA 5AQOA 4I2QA 3TWHA 5E84A 1BA0A 4JHDA 4K43A 3NHGA 4ZHRA 1W0HA 4CJ7A 3AO5A 1X9WA 4E0DA 3HVTA 3SMPA 1WBDA 2JWLA 1BQNA 4DKWA 1VSJA 3C6TA 2YHBA 1NGCA 4CW7B 4KHSA 2Q97A 4FW2A 2FSJA 1YJ9N 4K42A 3NH0A 1S3XA 1TVRA 4CJ3A 4CZMA 4LFBK 4IJNA 4HTUA 1NGGA 3OYAA 3OYEA 4AHTA 4CJSA 4M7XA 2O4IA 1LAWA 4DS4A 2Q2RA 3H3NO 3SCXA 4CF0A 3DLRA 4GMJB 2VWJA 4DV7K 1K8KA 4M3TA 2NZTA 1ITGA 2HHWA 4AHUA 4M3RA 4CZEA 1JL2A 3P5JA 5FROA 4N47A 4DFPA 5JS1A 3OYGA 5HBMA 3HRGA 4FWLA 3QEWA 4DR3K 4I6MA 3VGLA 1MDUB 4BGBA 3KHYA 3EYZA 2IVOA 4CJQA 3J7YP 2P9KB 4O0JA 3WQTA 3DJCA 4DR2K 1SL2A 3MN6A 2G8HA 1JLQA 2PAVA 3SLCA 3RTVA 2AA4A 3HPOA 2HBJA 4DR4K 4F2SA 1B9FA 2HHVA 1WSIA 1RT3A 3MXJA 4RWTA 2ITGA 2BDPA 4N41A 4O0IA 2RN2A 1YUWA 3NCIA 3VF2A 3S3OA 3AAQA 4WF9L 1RDDA 1W9HA 2HOEA 2A5XA 4LF4K 4HCBA 3B6PA 1EWQA 3QIOA 1NKCA 4MQ3A 2IVPA 3H45C 4JRPA 4KTZA 2NRHA 3C6AA 3QFUA 3MMVA 5I3UA 3J81O 3CCJN 2IC3A 1U04A 3H3OB 4DR1K 1VSKA 2YHYA 4BRCA 4K0KK 4FJ8A 3SBGA 4ILHA 1XWLA 5C24A 2CGJA 4AHVA 1HUXA 4FM1A 1RILA 5GAGP 5AQXA 1VSEA 3QICA 3CJBA 1TL1A 4HTLA 2OYQA 1XC3A 4Z0UA 4JS4A 3HVRA 4DQQA 2D1KA 3ZT2A 4JI6K 3NE6A 3PSFA 1N6QA 1VQ8N 1GLEG 3M6GA 3C6HA 1RDAA 4GKKK 3PX0A 4BRIA 1QHAA 1WSGA 4IOXA 2G8FA 3I8DA 3CQYA 2IVNA 1C0FA 4EZ6A 1NKEA 2OTLN 3ATVA 3OW2M 5KPRA 3CC2N 3CCLN 3RMCA 2FSNA 3WXKA 5F1XA 3VQQA 3CPEA 4ISEA 1EX4A 3O4QA 3V6DA 3EO3A 1SQKA 3CHWA 4JKCA 2XO7A 1QSYA 4F3TA 3ZT4A 4JI3K 4I2PA 2O8EB 3SMSA 1EXQA 3CYMA 3PIOL 2QA4N 5HROA 1BA1A 1SKSA 4UQGA 5AFUH 1NGBA 1LWCA 2KTQA 1ZC6A 1VSIA 4QS7A 4KPYA 3HPHA 3TAGA 1HNZK 5AQKA 3D45A 4IEEA 1Q82O 4CIFA 3M8SA 4RW6A 1Q8IA 5JS2A 4FCYA 3U4LA 2P9NA 1TK5A 2G8VA 3K5MA 4BG9A 2P5GA 2HHSA 1ATRA 1JXBA 1XMQK 3OBYA 5HOOA 1L3SA 5K14A 3WQUA 1VK0A 1S9GA 3VQ4A 3HO1A 2QK9A 4H8KA 2HF4A 2UXDK 2GBZA 2O8CA 4ILGB 3WXJA 3ZT3A 1NGJA 4YOUA 1X9JA 4PKIA 4YFUA 1C1AA 1OH8A 4FLZA 3ZT0A 4BRGA 3D0PA 3FGUA 4YDUC 4FM0A 3CD6N 3HOSA 3KVGA 4L8RB 1TV6A 4FK0A 3Q7BA 2VQEK 4U67L 4CERA 3UE5A 3CCEN 3SBTA 3WXLA 3ASMA 1YF5L 1HNXK 1SAZA 3WEEB 2O8FB 4C8OA 4F8RA 4JKGB 4YORA 1BCMA 1YXQA 4IEIA 4M3XA 1J5OA 3SAFA 1QTMA 1HJRA 2F9TA 4EAHD 3FZFA 2Q3SA 4E1NA 1Q81O 2F4VK 1Y64A 3ZSWA 3V9WA 4DTOA 3QNNA 1A5XA 3V1QA 5AQVA 4FSVA 1WB9A 2NRVA 4IDHA 5JICA 2J4RA 3EZWA 4CJFA 1ASUA 3F5TA 1X9MA 2KW4A 4DV4K 4BRLA 4IG3A 4KI6A 4BC5A 2IOCA 1JXEA 1X9SA 5TKYA 1WUAA 3FE1A 2JWKA 4DLGA 4W5NA 3CETA 2DPNA 4E1MA 1P8ZA 1NK6A 1VQ5N 3LDPA 4LC9B 2YV0X 2XRIA 1IKXA 3O3GA 1KXPA 1XI1A 1VQNN 4KHYA 3L2QA 3T1AA 2Q0RA 3E9PA 4Q0BA 3TPQA 4CEAA 1W7AA 1CXUA 1X1PA 3TSPA 1ATSA 1E4FT 3V1OA 1XQSC 4E7LA 3GDQA 1IKWA 2F8SA 3PV8A 4JYAK 3NGZA 1J53A 3O3HA 1IO2A 4DSIA 2YHXA 3BEXA 3SV3A 3C94A 1S1XA 5M1QA 2OTJN 1CXQA 3DLGA 3TAMA 4FYDA 1NOYA 1QS4A 4IBNA 4ELVA 4FLYA 4BR4A 4FJMA 4FK2A 4KO0A 4OPAA 3D7EO 3R1XA 3ZYYX 3E1YA 2G8IA 1IBMK 3C0BA 1VRUA 4DTPA 1RDCA 1L3TA 2VYPA 4CEQA 4KH6A 4DLEA 2HHTA 5AQGA 3GL1A 3O6WA 1QSLA 5C12A 1N5YA 4Y1DA 1GLJO 4CF9A 4DTRA 3SJHA 4BRKA 3O4NA 3AVHA 4B1XB 4FXDA 4WYBA 5FPEA 1RDBA 3DLEA 5BR8K 4MLHA 3TAQA 2P9KA 4O55A 3SPYA 1LW2A 4NCAA 2D4WA 3VERA 2B6AA 3IMXA 1NGIA 1NGEA 2QM1A 4ILJA 5AQHA 3RSEA 5BN8A 3RWUA 1LCUA 3AVBA 3SJJA 3IDHA 4AH9A 5DM7L 1GLFO 2GELA 3AAPA 3UKUB 3KLEA 4M42A 3KK3A 3R6MA 2QXFA 3AGRA 4FWKA 1NGHA 3KJVA 1FK9A 1G15A 3ID8A 3UKRB 3VESA 3ZX0A 3NMUA 1QHTA 4CFDA 1SKWA 1QQCA 4NB4A 3T3FA 2D0OA 3I33A 5CZ1A 3KD5E 3OYFA 4OKJA 2PFUA 2ZJPL 1M1KO 1VQ4N 1NGFA 4IDKA 4U7BA 1NGAA 3K0SA 2YJFA 3PX6A 1QQNA 1S5JA 3KLFA 2FLOA 2VG6A 2HNZA 2ZJQL 4AF1A 2XY7A 2WTUA 1UWBA 3L3UA 3CXCM 4JKGA 1B9DA 5JLHA 4X66K 3WT0A 1Y97A 2E6LA 3DXMB 2A1RA 3OBWA 1GOCA 4NLCA 1U47A 4CJ5A 1TUYA 3JXUA 4FO0A 3AVGA 1H1VA 1YJNN 1NJZA 4E19A 2ZQBA 4CE9A 2ATQA 1S1WA 3CMEN 5CR4A 3EE9A 3O08A 3OYJA 4EIAA 1HMVA 3QEIA 2QI2A 3HBTA 1EO1A 4IFYA 1REVA 3EE8A 4PQUA 3DLKA 5AZJB 4DUYK 3T1HK 5A2QO 3MAQA 1KVBA 3K2PA 1TKTA 1RBSA 3I55N 3NF8A 1KLMA 1S6PA 3P1GA 5DK5A 4BRMA 3H6EA 4B3OA 2Q36A 5JLFA 2X74A 3AVFA 3EEQA 4DWIA 4I7FA 3P39A 1BQMA 1JL1A 2XY6A 5GADP 4YOWA 3QEVA 3OJUA 4B8CA 1D5AA 4X65K 4OPKA 1GOBA 4WCEL 3U3GA 5EU7A 2V52B 2ZF5O 3HM8A 2P5OA 4DG1A 1K73O 2Y1JA 4CK2A 4KHQA 2EHGA 3VF6A 4DV3K 1YI2N 1RNHA 3IUCA 2IIRA 3QBWA 4IFVA 1I3AA 2HSTA 5LMUK 1YVNA 3C95A 3O9UA 4KBOA 4OX9K 2KZZA 3K59A 2B5JA 1MWMA 3AA3A 3ENHA 5M1KA 5IWAK 4BR0A 3F9KA 3OYKA 1HYSA 5AQTA 4M45A 5GAHP 5CY4A 1TKZA 3LPUA 5I42A 1YJWN 2EX3A 4AHCA 1BOTO 4CJ4A 1LV5A 4CF2A 2YNGA 5EXWA 1C1CA 4DV6K 4Z4FA 3MCAB 3ZEUA 3ZSVA 3LANA 4B8AB 4BE2A 4DTNA 1HX1A 4BGAA 2NRXA 3ZLJA 3OYNA 4NXMK 3SYZA 3WNFA 3ITHA 4JKEA 3DXKB 4ID5A 1NK0A 3EZ5A 4M3UA 4BR5A 4CK3A 1L3UA 4CGJA 1EP4A 2YKMA 5AQIA 4W5OA 4AM7A 2ZM6K 4RTFD 3EKUA 2HBLA 3SQ0A 5J2PA 2ZE2A 4PKHA 5AQRA 4CIGA 5ELZA 1K8AO 1K9MO 2XY8A 3A5MC 5MLCQ 3HP9A 5BN9A 3KWIA 1TUUA 3L4QA 3CQXA 3T69A 4R5PA 4JKAA 4R79A 2QWNA 4GVMA 4GVEA 5ADXA 1U2VB 3GOIA 4HCCA 4CBWA 5KRTA 4DU4A 2A41A 4EP4A 1FKPA 1T03A 1CLQA 2YX6A 4O44A 4CFCA 3M8PA 1BO5O 1ZBIA 3DRRA 1OH6A 4ICLA 3NAEA 4LF9K 5C25A 1U48A 4FJHA 4ID1A 1JLFA 4JK9A 1E4GT 3KIOA 3EL2A 2O8BA 4OLAA 4BDPA 1VSMA 3QERA 3AVMA 4BQZA 3TAFA 2WOMA 1VQPN 1NM1A 2BUPA 4H0XB 3HSTB 3UB5A 4DTUA 2VQFK 4ZTFA 3VQ5A 3NH1A 1NLVA 1S1UA 5AZIB 5AQMA 3KK1A 4FVMA 4CVNE 3OYDA 3NGIA 1VQLN 4PKGA 3SQ1A 1P90A 4G9ZA 4CJRA 3THXB 1SL0A 1RTDA 3FZKA 4WQ4C 3THXA 5JVGL 5J2QA 3MEDA 3LDLA 5HRRA 5AQLA 4BRAA 1TAQA 3L3VA 3O5BA 1HNIA 1KTQA 1KFSA 3VQ9A 2QTDA 3RMAA 3BUZB 3VEZA 4A5BA 2E2NA 2JLEA 3BP8A 2P1JA 4DFJA 1TKDA 4FJKA 1U6ZA 1U45A 3LP1A 4PL7A 3HZ6A 4DCHA 1D4XA 3MK6A 3B8AX 1BI4A 1YHQN 1KAZA 3ZCMA 4A61A 4LF7K 4QOZB 5KGWA 4CGGA 1IBKK 3VA3A 4WQ5A 4FW1A 3D2FA 3VEYA 4B3RK 3ZSYA 3AO1A 5HRPA 2YNIA 1T44A 3LP2A 5M1NA 2X6NA 2HVHA 1IH7A 1KSPA 1XNRK 2G8UA 4B1VA 3PY8A 4O5FA 1UA0A 4Y0WA 4KTWA 3LZIA 3LM9A 4M3WA 4H0TB 3WEEA 4FWOA 4JI7K 2P9NB 4EFHA 3SUQA 4JEPA 3SAHA 5BPLA 3CI5A 1MA9B 3MX2A 4CHYA 3KKRA 1EWRA 2RE2A 4CJPA 1UOCA 2Z1GA 3LM2A 4JNEA 4FOIA 5M1FA 1RFQA 1S1VA 3GBTA 2P9PA 4JK8A 4CZGA 1U4BA 4BRFA 4DQPA 4IOCL 3CCSN 3RR7A 3UKUA 3S41A 4BE0A 3VENA 4CFAA 2IAJA 2KQ2A 1J6ZA 1FJGK 4JI2K 4WQ4A 2WFBA 3VEVA 5FPNA 3CERA 2D0BA 3W3DA 3OYCA 1A5WA 2P9SB 4AHSA 5AQZA 1EETA 2E1YA 1VQKN 4FJIA 2E5LK 4XIUA 3SQ4A 4BVOA 3DXKA 3HXMA 4EZ9A 1YT3A 2YKNA 3AA4A 3IRXA 4OVLA 3JAMO 1JCEA 3TANA 4BR9A 5I9EB 4KFBA 3P38A 4F9OA 2GWJA 2P9IA 2UUCK 1M90O 4Z4HA 4Z4GA 3VPZA 2HW3A 1NMDA 4KB0A 2AP1A 4LD0A 3WXMB 1TGOA 4JHDB 1KQSM 4C1NI 2P9UB 2O8CB 4KHWA 4BRNA 2YNHA 1WAFA 3FFKB 1RBVA 5SWMA 3KLHA 4J8FA 2QKKA 3F9MA 4FJXA 4MDAA 1VHXA 2QW9A 1L3VA 3AO2A 4XH1A 4B3MK 3A5NC 3OYIA 2QXLA 3CF5L 4G1QA 1A5VA 3V4IA 2R7YA 1I94K 4CF8A 1MWKA 3CG7A 4X64K 1EQYA 3OYMA 4FPAA 3WNHA 4DU1A 3FZLA 1K8KB 5FPMA 3Q7CA 4XEIA 4KTQA 1C1BA 1T8EA 1IG9A 5HP1A 1V4TA 3VQAA 3ZSXA 3RRGA 5IT9O 3L2UA 1RT7A 1S22A 1OVQA 2I5JA 3CC7N 5AZJA 3ULEA 1SKRA 3MN9A 4B1ZA 3FLCO 4WE1A 3T1YK 3A5LC 3KD1E 1QZ5A 1VSFA 2ZD1A 1HPZA 3MCPA 3KWGA 3V1RA 4MFBA 3MXIA 1C0UA 4FLTA 2PY5A 4IZ9A 4WFNL 4FWMA 4CZHA 2UU9K 1SV5A 1XUPO 1U49A 4IOAL 4A57A 5CYQA 1OH5A 1Q7YO 4WFAL 2OPRA 2ZWHA 4J2DA 1HKGA 2P9UA 4CGHA 3TTCA 2HHQA 1BI4B 5CHIA 1BIUA 1FKOA 3CIPA 3E9OA 1YTAA 3S3NA 3ZX2A 3K5LA 3L2WA 3THVA 2GWKA 1IKYA 4B1UB 4RW8A 2OPSA 1Z05A 4BR2A 5J2NA 3LAKA 3D2EB 3I56N 4A59A 3MEEA 2V7YA 2P9SA 2BTFA 4A2BA 3BY5A 3AARA 1O1WA 5CYMA 2KHOA 3O80A 1X3NA 2F9WA 3K58A 1DKGD 4N56A 4CEDA 3V9UA 3MWPA 1VSHA 4IJAA 4M63C 4V19S 5KI6A 4Z4EA 1LAVA 3J8AA 1LW0A 1KAYA 1KVAA 4BR7A 4IO8A 4MO4A 2GUIA 4KH5A 3H1QA 3DOLA 4KRFA 4CHZA 3SI6A 1G99A 3OYHA 3I0SA 4GV6A 4HWIA 2ZGZA 2YHAA 1CZ9A 1RBUA 3K9KA 5E41A 2VCPA 3KK7A 3PSIA 3QEPA 4B9TA 1L5UA 3IS9A 3O9TA 4KHUA 3BF1A 4J2BA 3C7NA 4CZFA 1QE1A 2A40A 1BISA 5AQPA 1Q18A 4OKKA 1ZBSA 3U9DA 4YHHK 3VTIA 3RMBA 1BG3A 3TSUA 1YVUA 1D8YA 3L2VA 4FWRA 1JLCA 4CJVA 1BCOA 4E7IA 3BF3A 4Y1CA 4MO5A 3VTHA 5AFUA 4J2AA 3VQ8A 4Q5VA 3EY1A 1RDUA 1SUQA 1YITN 4H5RA 3OVNA 3DRPA 3O4WA 5E26A 4DR7K 2X78A 5LL6Z 4OLBA 3CMAN 5AQUA 1BU6O 4CJKA 1UA1A 1IV0A 3VA0A 3TAPA 3H08A 2VGMA 4H5TA 1RTHA 1JCGA 3VQBA 4E7HA 2E1ZA 4JKDA 2RF2A 4PY5A 1ZBFA 5D3GA 5FLXO 5H1SQ 3U6FA 4PHTX 4FJ5A 3O1WA 4ISGA 4BRHA 2HBMA 2F96A 2FSKA 3B6OA 4GY2B 1VAZA 4DV0K 3ULDA 2E6MA 2VG7A 4PA1A 4O4GA 4QS9A 1JJ2M 3CJCA 1RT6A 4ISFA 2NRRA 3NFAA 4FWQA 1OVYA 4JAXA 4KI4A 2RPIA 1N8RO 4NXNK 1GOAA 1XHXA 1BUPA 3LL3A 4RW4A 4B1WB 3THYA 4JK7A 3QB0A 1T7PA 5J2MA 1NJIO 2KKZA 3L8BA 5AQYA 4LY7A 1GLDG 3HYFA 4OKEA 1I39A 3QO9A 1FW6A 3G25A 1OKJA 3CCRN 4HUGA 3O3FA 3QEXA 1NBWA 3MX5A 3ZSZA 3AO3A 3AVIA 4CIEA 1VQ6N 3G4SN 3JS6A 2QKBA 4FJGA 4WFBL 2CH5A 2GX9A 4FJLA 2ASMA 4DTXA 4C8NA 1K6YA 4B9SA 3MDQA 1VQ9N 4FOEA 3K5NA 4DQIA 4YOVA 1ILYA 3NF9A 3HL8A 2PZSA 2E2QA 2DTUA 5JMVA 5AQJA 4CZJA 5GINA 4DHYA 3HK2A 1DEJA 5BRFA 2ITMA 1U2VA 3DYAA 3VQPA 5DM6L 1IG8A 2IDOA 2XY5A 2FF3B 1NK4A 2DFFA 3QFPA 5EX5A 3BZKA 2W40A 4KHNA 3AV9A 4B9NA 3SNNA 1ZBHA 4KKOA 4W5QA 2QWLA 3VOVA 2HB5A 3O8MA 1B92A 1NK7A 4CBXA 3M8RA 2PYJA 3DI6A 3CCVN 4LF8K 4XH4A 1C0MA 3N4QA 4DUZK 3PO5A 1ASWA 3LDSA 3RVCA 4Z94A 4KB1A 5C0YA 4JD2A 2FBYA 4BC4A 1HQEA 1E3MA 3RRHA 1NJWA 3U3YA 5BRHA 3VEWA 3VQCA 4AM6A 3G10A 4MLEA 1WAJA 4TSXA 1C6VA 1UAXA 4E7KA 3QIPA 1NG9A 3DLHA 2I7PA 2QEXN 2O8FA 1NU0A 3CJ7A 3G0ZA 4K25A 2A3ZA 1HLUA 2GEMA 4BRDA 3WNGA 4CEEA 3CC4N 3TSQA 1RBTA 4DSFA 1QSSA 4DSJA 3NH2A 2RKIA 1DLOA 2HNYA 3VN5A 2FBTA 3D2FB 3ISNC 1KFDA 3NF7A 4JKBA 4HUFA 3A5OC 4LSLA 1DGKN 3HT3A 3I8BA 4E89A 1TK8A 3AO4A 4DF8A 1N33K 3PO4A 4OJRA 3J7ZO 1BIZA 3DWLA 2AJQA 3UKRA 4H4MA 3S9HA 4FZZA 3WXIA 2NUBA 5KGXA 4YOXA 4JI0K 1BL3A 4H0VB 4MDBA 4CJEA 4N5SA 2QWQA 4QS8A 4BC3A 1MU2A 3DM2A 5AQSA 1SS6A 3AVJA 4I9LA 5CE3A 4GKJK 3OYLA 2GV9A 1CZAN 3QDKA 3OTOK 1V4SA 4DB3A 2DY4A 3V9ZA 2Y1IA 3DMJA 2HMIA 3CM6A 3DRSA 4NCBA 3ZT1A 4YOYA 4C8LA 1S9EA 3CJ1A 4C23A 4E1JA 3HP6A 3HSCA 3QLHA 3TU5A 3GE1A 1Q9XA 4IWVA 2ZGYA 1C0GA 4RCHA 3RMDA 1NMNA 3EN9A 3VEXA 1Z26A 4DV5K 3AA5X 3P4IA 2DFHA 4JN4A 4BE1A 1J54A 3O9RA 4FWPA 4JI5K 4DV1K 2HVIA 1JLEA 1TYQB 3CM5A 4DF4A 3UIQA 1YTUA 3VQ6A 4K8ZA 2RHKA 4K8XA 4CJWA 3SUNA 1J9AA 4EHUA 3O9QA 1DTQA 5BREA 1RT4A 4IKFA 4NYFA 1D9FA 2PBDA 4XH5A 3OS2A 3GG4A 1NKBA 3EKSA 3OYBA 3R9PA 3ULEB 1DT9A 2KLAA 2WONA 3AVAA 3R8EA 1XC9A 1JLAA 4JD2B 4B08A 4OGEA 5GIOA 3PUFA 4C1NK 4BQLA 3HI0A 3AGKA 3VQ7A 5KTQA 3SUPA 4CJLA 1RT5A 1HYVA 3NDKA 3AVNA 3AVCA 1TKXA 3E01A 3QNOA 3L0QA 5FPDA 3F2KA 4JI1K 4DQRA 4CHPA 4YOTA 1HNVA 4O8UA 4IXCA 3THWB 4ELTA 3C65A 3FFIA 2D5RA 4LF6K 1ATNA 5ADXH 2P9IB 4CHQA 4HUEA 5FRNA 2X6SA 1S6QA 3ENOA 1IBLK 4JV5K 4KAZA 3TTFA 3VETA 4BREA 4B9MA 4OPJA 1S72N 4F3OA 5AQNA 3R3LA 3U9ZA 4BRPA 1KD1O 5C42A 3KK2A 2NLXA 4NYNA 3L2RA 2KFNA 2HHUA 1HYZA 3ALYA 4AHRA 1DTTA 3KZBA 3DLBA 2NRTA 3AVKA 1NJXA 3K57A 3M5RA 2Q31A 2A6AA 1NNEA 5T7BA 5B8HA 1LOTB 2G8KA 2IS3A 2D0CA 2YJEA 5HLFA 3OS1A 5GIPA 4UY8O 4BACA 3VGMA 3OY9A 4JS5A 1WSHA 2QWRA 1R0AA 3PX4A 2FXUA 4A2AA 2WBNA 2CGLA 4CEZA 3LALA 5C15A 4CD1A 2BH1A 4O8KA 3VQEA 2FBVA 2HHXA 1JLGA 3MWTA 3IKMA 4F4KA 2HMPA 4FJ9A 2BGGA 4B9LA 2HNDA 3RR8A 4C8MA 1GLBG 3JYTA 4HVJA 2DFEA 1TYQA 4CI6A 3L6QA 1T6DA 4LSNA 3KLIA 4FPBA 5LJWA 1FXXA 3S3MA 2G8WA 3MEGA 4H5VA 1RT2A 2HF3A 1Z6RA 1JCFA 1WSJA 4H4OA 1IJJA 4FLXA 4GNIA 1HNWK 4YDUA 1QQMA 1VSLA 2O8DB 3FZMA 4N76A 4KV8A 4DSEA 4DFMA 4CJUA 3CFPA 1S1TA 2UXCK 4FZXC 4FK4A 3LDQA 3NGYA 4DSKA 1HQUA 3LP0A 3A8YA 1Q9YA 4BROA 4CZKA 3P83D 3QBXA 3SQ2A 3PIPL 3DXMA 3NBPA 1VQ7N 4FM2A 3TR8A 2V51B 4AILC 5EOYA 3H46O 3K5OA 3N4PA 4CHNA 4OPHA 5AQQA 3LWMA 3D2EA 1BWFO 3A0IX 4BRQA 3E9LA 3NF6A 2YHWA 3CCQN 3BZCA 1TK0A 2NRZA 1HKBA 4Z4IA 3QMLA 3VMFB 4JLHA 2EWSA 3OS0A 3TABA 2V7ZA 4GV3A 4CZIA 3VQDA 2W42A 4FLUA 5C10A 3VEOA 2NNWA 4ELUA 3J80O 5AJ3K 2D0AA 1RT1A 5KRSA 3G71N 2W41A 4GW6A 3W0LA 4E3SA 3DLLL 4QAGA 1WSFA 4LF5K 4JRQA 3ZSRA 2B4JA 3AY9A 5DMRA 3C6UA 4I9QA 1QVFM 1KAXA 3BGRA 5AQFA 4W5RA 3QINA 5LJVA 3CCUN 4FZYA 3ENBA 4H0OA 3V9SA 4NLBA 2O8DA 4DTJA 4EHTA 3CJAA 3L4IA 5BRDA 3THYB 1WSEA 5TKWA 1ZYQA 1NK8A 4H03B 4DMNA 2VWKA 4GV9A 3CQ8A 1KLNA 2CH6A 1ZXOA 4CGIA 2Z1JA 2UXBK 2OANA 5FRMA 4DR6K 2NRWA 3OJSA 1R59O 3ZSQA 4CGDA 4F2RA 3E66A 3VGKA 3CPWM 1WOQA 3LPTA 5GAEP 3LWLA 3CJ9A 2BE2A 4BY9C 3ZSOA 2ASPA 4B3TK 1NK9A 4JKHA 4NO7A 4DQ8A 3LZJA 3SPZA 5SZTA 2Q0UA 4FWNA 2UUBK 2QWMA 1RDWX 1RBRA 1HPMA 1YIJN 1KVCA 2FBXA 3RSEB 1HRHA 4BDZA 5HRNA 1W97L 2E88A 3KKSA 5CZ2A 2HHHK 4J2EA 2OPQA 1O13A 4DU3A 4DTMA 4OO1J 2E8AA 4OGCA 4CECA 5F2RA 4FJJA 5KQ8A 4DFKA 1LWFA 5AQWA 1T05A 1YAGA 3MN7A 5BPNA 4JKFA 3LDNA 2OA8A 1WLJA 1BDGA 3A2FA 2QWOA 5BR9A 1RGIA 4M3YA 1GLAG 4DQSA 3IAYA 2HBKA 1OH7A 3P31A 2W6LA 2GUPA 2FC0A 5HL7L 5M1PA 4KHPK 4CESA 1NGDA 1VSDA 4O5BA 3U8XA 4RW9A 2GTDA 4AQYK 1BHLA 3OA9A 1ESVA 4CEBA 4B3SK 3QETA 4A62A 1D9DA 3HPGA 4PL8A 2KZMA 3THWA 3IG1A 4HHTA 1N34K 4CCHA 4EP5A 1J5EK 1W2BM 2WUSA 5BPMA 3DOKA 2Z1HA 1XHZA 4NCGA 4FJNA 4PWDA 3SV4A 2P51A 3D6RA 1JKHA 3T7ZA 2UUAK 3MN5A 1TAUA 2Z1IA 4WQ5C 5KQDA 1NJYA 4LH5A 2OZSA 4IO9L 2P9LA 1QVGM 1QQOA 3WUHA 2VWBA 5LY3A 4X62K 2ETJA 3G6EN 2A1SA 4CEFA 2VGNA 4K41A 4M41A 2YI1A 3M3ZA 1NK5A 5M1OA 5J1EA 2E20A 3MECA 3PLAA 1GLLO 4CBUA 3V9XA 3SUOA 4CZLA 4IG0A 2QWPA 3AVLA 4JI4K 3TARA 3DAWA 5HRSA 2F8TA 3LP3A 4C8KA 3SZ2A 3CFOA 2E4LA 4LFCK 1VQON 1XNQK 3K9JA 2P9PB 2FF6A 1KRPA 1Q86O 1SZ2A 3HOTA 1GLCG 4JI8K 2UYTA 1NWKA 1N36K 3M8QA 1CZBA 4BWJA 4RW7A 4Z4CA 4M3ZA 1N32K 1ZBUA 3T19A 1WN7A 4H0PA 3IFRA 5JVHL 3ATUA 3HTVA 4CGFA 1RTJA 1VRTA 3MXMA 1ASVA 2JGUA 3KTQA 4RG8A 4FL9A 3SK3A 5LMNK 2KFZA 1SL1A 4BG8A 1IKVA 2Q1NA 3C7NB
chains in the Genus database with same CATH topology
3GE1A 4IWVA 2P9SB 2ZGYA 3TPQA 1C0GA 4BVPA 3ZETB 4RCHA 4KH4A 5AQZA 3EN9A 2E1YA 1VQKN 2E2PA 4FWSA 3VEXA 4BVOA 3DXKA 5C2DA 3TSPA 1ATSA 1E4FT 3P4IA 4L3QA 1XQSC 4JN4A 2P9LB 3O9RA 1JCEA 3GDQA 4BR9A 5I9EB 4FWPA 3P38A 1TYQB 4F9OA 2ASOA 2GWJA 2P9IA 1M90O 3VPZA 2YHXA 2RHKA 1NMDA 3BEXA 4EHUA 2AP1A 3WXMB 4JHDB 5M1QA 5AZIA 2OTJN 3O9QA 4B1YB 5BREA 1KC8O 1KQSM 4C1NI 3TTDA 2P9UB 4BR4A 2PBDA 4OPAA 5F0XA 5KPTA 4XH5A 3D7EO 2F7TA 3R1XA 3ZYYX 3GG4A 3E1YA 3EKSA 4BRNA 3R9PA 3FFKB 3C0BA 3ULEB 1DT9A 4J8FA 3F9MA 2KLAA 3FR0A 3NVMA 4MDAA 3NVKA 2QW9A 2VYPA 4XH1A 3ZEUB 4KH6A 3R8EA 3A5NC 3FZHA 2QXLA 3CF5L 4JD2B 5AQGA 3GL1A 5AR0A 3O6WA 5GIOA 4M7YA 5C12A 1MWKA 4C1NK 4BQLA 3HI0A 3AGKA 1EQYA 4FPAA 1GLJO 3CCMN 3SJHA 4BRKA 3FZLA 1K8KB 5FPMA 3Q7CA 4B1XB 4WYBA 5FPEA 3L0QA 4XEIA 5FPDA 3F2KA 1HKCA 3H1VX 4MLHA 2P9KA 1V4TA 4YOTA 4O8UA 2D4WA 3VERA 3ZX3A 4IXCA 1S22A 5EVZA 3C65A 3CC7N 2YCHA 3IMXA 3O9SA 5AZJA 3ULEA 1QZ6A 1NGEA 1NGIA 2QM1A 3M1FA 1T6CA 1X3MA 3MN9A 4ILJA 2CGKA 4B1ZA 1ATNA 3FLCO 5AQHA 3RSEA 5BN8A 5ADXH 2P9IB 1LCUA 3A5LC 1QZ5A 4H5NA 2WC9A 3IDHA 5DM7L 1GLFO 2GELA 3ENOA 4B9QA 3AAPA 4A5AA 3UKUB 3R6MA 3TTFA 3VETA 3MCPA 3AGRA 4FWKA 4BREA 1NGHA 3KWGA 1S72N 5AQNA 3ID8A 3UKRB 3VESA 3ZX0A 3R3LA 3U9ZA 4BRPA 3NMUA 1KD1O 1VQMN 4IZ9A 4WFNL 4FWMA 4NB4A 2E2OA 4CZHA 2NLXA 3SAGA 2D0OA 3I33A 1XUPO 5EY4A 5KPZA 2ZJRL 2ZJPL 2PFUA 1M1KO 1VQ4N 1NGFA 4U7BA 4IOAL 1NGAA 4H5WA 4A57A 2D0PA 2YJFA 3KZBA 2NRTA 1Q7YO 3M5RA 4WFAL 1QQNA 2ZWHA 2Q31A 4CD3A 4FVUA 2A6AA 5JVHL 1HKGA 2P9UA 2FLOA 3ID6A 3TTCA 3O1BA 2ZJQL 1T3VA 4AF1A 5B8HA 1LOTB 5CHIA 3CXCM 4I6MB 4JKGA 5JLHA 2YJEA 3CIPA 5GIPA 3E9OA 3OHRA 3WT0A 4UY8O 3ZX2A 4IFEA 3VGMA 2GWKA 2QWRA 2A42A 3LDOA 4H0YB 3VF4A 2H3GX 2FXUA 4A2AA 3DXMB 2WBNA 4B1UB 3OBWA 2I7NA 1Z05A 4BR2A 2CGLA 5C15A 4BC2A 4CD1A 2BH1A 4NLCA 3D2EB 3I56N 4A59A 4O8KA 5C2FA 1TUYA 3ZETA 2V7YA 3JXUA 4FO0A 1H1VA 1HJOA 2P9SA 1YJNN 5AQOA 2BTFA 3MWTA 3IKMA 5E84A 4A2BA 1BA0A 4JHDA 2HMPA 4K43A 3AARA 4CJ7A 2KHOA 3CMEN 3O80A 1X3NA 1GLBG 5CR4A 2F9WA 3SMPA 1TYQA 3EE9A 3O08A 4CI6A 3L6QA 1T6DA 1DKGD 2JWLA 4FPBA 5LJWA 4DKWA 3MWPA 4M63C 4IJAA 4EIAA 4H5VA 3J8AA 2QI2A 3HBTA 1NGCA 2HF3A 1EO1A 3EE8A 1Z6RA 1JCFA 5AZJB 1IJJA 4GNIA 1KAYA 2Q97A 4BR7A 2FSJA 4IO8A 4YDUA 4MO4A 1YJ9N 4K42A 4KH5A 3I55N 1S3XA 4CZMA 1QQMA 4IJNA 3H1QA 1NGGA 4BRMA 1G99A 3H6EA 3FZMA 2Q36A 4HWIA 5JLFA 4GV6A 2ZGZA 4M7XA 3P39A 2Q2RA 3H3NO 3LDQA 3K9KA 2VCPA 3KK7A 5GADP 4YOWA 3A8YA 1K8KA 3O9TA 2NZTA 4BROA 3BF1A 4CZKA 3C7NA 3QBXA 4CZFA 2A40A 3PIPL 5AQPA 3DXMA 4CZEA 1VQ7N 1Q18A 4WCEL 1ZBSA 3U9DA 3VTIA 2V51B 1BG3A 5EOYA 2ZF5O 2V52B 3HM8A 3H46O 3TSUA 1K73O 3N4PA 3HRGA 4FWLA 1YI2N 3VF6A 3IUCA 2IIRA 3QBWA 4FWRA 4OPHA 4I6MA 5AQQA 2HSTA 3D2EA 1YVNA 3VGLA 1BWFO 1MDUB 4BGBA 3A0IX 3BF3A 4BRQA 3KHYA 3E9LA 3O9UA 4KBOA 2IVOA 4MO5A 2YHWA 3VTHA 5AFUA 3CCQN 2P9KB 3WQTA 2NRZA 1HKBA 1MWMA 1RDUA 1YITN 3QMLA 4H5RA 3VMFB 2EWSA 4GV3A 3O4WA 2V7ZA 3ENHA 3DJCA 5E26A 5M1KA 4BR0A 4CZIA 3CMAN 5AQTA 3MN6A 5AQUA 1BU6O 2PAVA 5C10A 3SLCA 3VEOA 5GAHP 2NNWA 2AA4A 2HBJA 1YJWN 2VGMA 4H5TA 1BOTO 1JCGA 4RWTA 3G71N 2E1ZA 4JKDA 2W41A 5EXWA 1YUWA 3MCAB 3VF2A 3ZEUA 3W0LA 3DLLL 3AAQA 4WF9L 1HX1A 5H1SQ 4BGAA 2HOEA 3AY9A 2A5XA 2NRXA 3O1WA 4ISGA 4PHTX 4BRHA 2HBMA 2FSKA 4GY2B 1VAZA 2IVPA 1JJ2M 4QS9A 1KAXA 5AQFA 3CJCA 3H45C 1QVFM 4ISFA 2NRHA 3C6AA 2NRRA 3QFUA 3DXKB 4JKEA 5LJVA 4BR5A 3MMVA 3CCUN 3ENBA 4FWQA 4H0OA 3CCJN 1OVYA 4JAXA 4NLBA 3H3OB 4EHTA 5AQIA 1N8RO 3CJAA 2YHYA 3L4IA 4AM7A 4BRCA 5BRDA 4RTFD 1BUPA 3EKUA 2HBLA 3LL3A 4H03B 5TKWA 3SBGA 4B1WB 4GV9A 4PKHA 4ILHA 4JK7A 5AQRA 5ELZA 1K8AO 1K9MO 3QB0A 1NJIO 2KKZA 2CH6A 5AQYA 1ZXOA 3A5MC 1GLDG 2CGJA 5MLCQ 5BN9A 2OANA 3KWIA 1TUUA 3L4QA 1HUXA 3CQXA 3G25A 2NRWA 5GAGP 1R59O 1OKJA 3CCRN 5AQXA 3E66A 3T69A 3VGKA 1NBWA 3MX5A 4JKAA 1WOQA 3QICA 4R79A 2QWNA 3CJBA 5GAEP 3CPWM 4GVEA 3CJ9A 3G4SN 3JS6A 4HTLA 5ADXA 1XC3A 1VQ6N 4BY9C 1U2VB 3GOIA 4WFBL 2CH5A 2ASPA 2GX9A 2D1KA 4CBWA 2ASMA 4JKHA 4NO7A 4DQ8A 1VQ8N 3MDQA 1GLEG 1VQ9N 3M6GA 2Q0UA 3C6HA 2A41A 2QWMA 4FWNA 4FOEA 4YOVA 1ILYA 1RDWX 2YX6A 4BRIA 1QHAA 4IOXA 2E2QA 5JMVA 5AQJA 4CZJA 5GINA 4DHYA 3CQYA 1BO5O 1HPMA 1DEJA 2IVNA 1C0FA 3RSEB 5BRFA 1YIJN 2ITMA 1U2VA 1W97L 3VENA 5DM6L 2E88A 1IG8A 2OTLN 3ATVA 3OW2M 1O13A 5KPRA 2FF3B 4OO1J 2E8AA 3CC2N 3QFPA 5F2RA 4JK9A 5EX5A 3CCLN 1E4GT 2FSNA 2W40A 3WXKA 5KQ8A 5F1XA 3CPEA 4ISEA 5AQWA 1YAGA 3EL2A 3MN7A 5BPNA 2QWLA 3VOVA 3EO3A 4JKFA 4BQZA 1SQKA 3CHWA 3LDNA 3O8MA 4JKCA 1VQPN 4CBXA 1NM1A 1BDGA 2BUPA 2QWOA 3CCVN 4H0XB 4XH4A 3UB5A 5BR9A 3N4QA 1RGIA 1NLVA 5AZIB 1GLAG 5AQMA 2HBKA 3RVCA 1VQLN 4Z94A 3P31A 4PKGA 3SMSA 5C0YA 2GUPA 3PIOL 4JD2A 2QA4N 5HL7L 1P90A 4G9ZA 5M1PA 1BA1A 3FZKA 4WQ4C 5AFUH 4BC4A 1NGBA 5JVGL 1NGDA 1ZC6A 3U8XA 3LDLA 4QS7A 2GTDA 5AQLA 4BRAA 3OA9A 3O5BA 1ESVA 4A62A 5AQKA 4PL8A 4IEEA 5BRHA 2QTDA 3VEWA 4AM6A 1Q82O 3BUZB 4MLEA 3VEZA 3U4LA 4A5BA 2E2NA 3BP8A 1W2BM 2I7PA 2QEXN 2P9NA 3CJ7A 2WUSA 5BPMA 4K25A 4BG9A 1ATRA 2A3ZA 1U6ZA 3D6RA 3T7ZA 3MN5A 3OBYA 5HOOA 1HLUA 4PL7A 3WQUA 2GEMA 4WQ5C 5KQDA 3HZ6A 4BRDA 4DCHA 4IO9L 2P9LA 1QVGM 1D4XA 1QQOA 3MK6A 2VWBA 2HF4A 3B8AX 3WUHA 5LY3A 1YHQN 3CC4N 4ILGB 3TSQA 3WXJA 1NGJA 1KAZA 4YOUA 1X9JA 4PKIA 4A61A 4BRGA 3D2FB 3FGUA 4YDUC 3G6EN 4WQ5A 3VEYA 3D2FA 3CD6N 3HOSA 3KVGA 4JKBA 2VGNA 3A5OC 4K41A 1T44A 3Q7BA 1DGKN 2YI1A 3I8BA 3M3ZA 4U67L 3UE5A 5M1NA 3CCEN 3SBTA 5M1OA 3WXLA 4B1VA 1YF5L 4O5FA 4Y0WA 3LM9A 1SAZA 2E20A 3PLAA 3WEEB 1GLLO 4H0TB 4CBUA 3WEEA 4FWOA 3J7ZO 3DWLA 2P9NB 4JKGB 3UKRA 4YORA 4CZLA 4EFHA 4JEPA 3SAHA 5BPLA 2QWPA 3CI5A 3WXIA 1YXQA 1MA9B 4YOXA 3MX2A 4IEIA 4H0VB 3DAWA 4MDBA 3SAFA 2F9TA 4EAHD 2RE2A 2QWQA 3FZFA 1Q81O 1Y64A 5AQVA 3LM2A 4JNEA 4FOIA 4QS8A 4BC3A 4FSVA 1VQON 5M1FA 5AQSA 1RFQA 3K9JA 2P9PB 2FF6A 2NRVA 4IDHA 5JICA 3GBTA 2P9PA 2J4RA 4JK8A 1SZ2A 4CZGA 3EZWA 1SS6A 1GLCG 5CE3A 4BRFA 3HOTA 1Q86O 2UYTA 1NWKA 1CZAN 4IOCL 3QDKA 3F5TA 3CCSN 4BRLA 1V4SA 4DB3A 4BC5A 3UKUA 3S41A 4H0PA 3IFRA 5TKYA 1WUAA 3ATUA 2JWKA 3FE1A 1J6ZA 3HTVA 3CETA 2DPNA 4YOYA 1P8ZA 1VQ5N 3LDPA 4LC9B 4WQ4A 2WFBA 3CJ1A 4C23A 3VEVA 4E1JA 5FPNA 1KXPA 3CERA 4FL9A 3SK3A 1VQNN 4BG8A 3HSCA 2Q0RA 3W3DA 3TU5A 2Q1NA 3E9PA 3C7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1N A;  4IDH A;  3CPE A;  4IFE A;  5C12 A;  5C2D A;  5C2F A;  4IEI A;  5M1O A;  3C6A A;  5M1Q A;  5C15 A;  5C10 A;  4IEE A;  5M1F A;  5M1K A;  5M1P A;  3C6H A; 
#chains in the Genus database with same CATH topology
 4BVP A;  3LAM A;  3ZET B;  4KH4 A;  2E2P A;  4FWS A;  4DV2 K;  5C2D A;  4L3Q A;  3WNE A;  2P9L B;  2OPP A;  4QCL A;  4CHO A;  4E7J A;  2ASO A;  2XHB A;  3TAE A;  2O8B B;  4DSL A;  1ZBL A;  3BDP A;  2O4G A;  2IGI A;  5AZI A;  4B1Y B;  1KC8 O;  4ZTJ A;  3TTD A;  1F21 A;  1Z25 A;  1RCH A;  5F0X A;  5KPT A;  1KCF A;  3CFR A;  2F7T A;  1RTI A;  4CK1 A;  3I0R A;  2W6K A;  4CEO A;  3JSM A;  2OCE A;  3FR0 A;  3NVM A;  3V81 A;  3NVK A;  4FLW A;  3ZEU B;  4CF1 A;  4BDY A;  3FZH A;  4CFB A;  3HJF A;  1XMO K;  5AR0 A;  1EKE A;  4M7Y A;  4LFA K;  1LWE A;  3CCM N;  2VG5 A;  3J7A P;  4B9U A;  1JLB A;  1HKC A;  3H1V X;  3TI0 A;  4KRE A;  1NOZ A;  2YNF A;  3ZX3 A;  1HR0 K;  5EVZ A;  4CJT A;  3F73 A;  2YCH A;  3O9S A;  1QZ6 A;  3M1F A;  4YY3 K;  1T6C A;  1X3M A;  2CGK A;  4FJ7 A;  4DR5 K;  4W5T A;  2LSN A;  2OZM A;  4H5N A;  2WC9 A;  1BGX T;  4B9Q A;  4A5A A;  3QES A;  2PYL A;  4LH4 A;  3HM9 A;  1VQM N;  1C0T A;  1WNS A;  2E2O A;  3SAG A;  4BWM A;  5EY4 A;  5KPZ A;  2ZJR L;  1TL3 A;  4H5W A;  4DS5 A;  2D0P A;  2BAN A;  4B9V A;  3AA2 A;  4CD3 A;  4FVU A;  3KLG A;  5FDL A;  4DTS A;  3ID6 A;  2O8E A;  3O1B A;  1T3V A;  4YNQ A;  4I6M B;  4FLV A;  3OHR A;  4IFE A;  4PUO A;  1WBB A;  2A42 A;  3LDO A;  4H0Y B;  3VF4 A;  2H3G X;  2I7N A;  4BC2 A;  5C2F A;  3ZET A;  1HJO A;  5AQO A;  4I2Q A;  3TWH A;  5E84 A;  1BA0 A;  4JHD A;  4K43 A;  3NHG A;  4ZHR A;  1W0H A;  4CJ7 A;  3AO5 A;  1X9W A;  4E0D A;  3HVT A;  3SMP A;  1WBD A;  2JWL A;  1BQN A;  4DKW A;  1VSJ A;  3C6T A;  2YHB A;  1NGC A;  4CW7 B;  4KHS A;  2Q97 A;  4FW2 A;  2FSJ A;  1YJ9 N;  4K42 A;  3NH0 A;  1S3X A;  1TVR A;  4CJ3 A;  4CZM A;  4LFB K;  4IJN A;  4HTU A;  1NGG A;  3OYA A;  3OYE A;  4AHT A;  4CJS A;  4M7X A;  2O4I A;  1LAW A;  4DS4 A;  2Q2R A;  3H3N O;  3SCX A;  4CF0 A;  3DLR A;  4GMJ B;  2VWJ A;  4DV7 K;  1K8K A;  4M3T A;  2NZT A;  1ITG A;  2HHW A;  4AHU A;  4M3R A;  4CZE A;  1JL2 A;  3P5J A;  5FRO A;  4N47 A;  4DFP A;  5JS1 A;  3OYG A;  5HBM A;  3HRG A;  4FWL A;  3QEW A;  4DR3 K;  4I6M A;  3VGL A;  1MDU B;  4BGB A;  3KHY A;  3EYZ A;  2IVO A;  4CJQ A;  3J7Y P;  2P9K B;  4O0J A;  3WQT A;  3DJC A;  4DR2 K;  1SL2 A;  3MN6 A;  2G8H A;  1JLQ A;  2PAV A;  3SLC A;  3RTV A;  2AA4 A;  3HPO A;  2HBJ A;  4DR4 K;  4F2S A;  1B9F A;  2HHV A;  1WSI A;  1RT3 A;  3MXJ A;  4RWT A;  2ITG A;  2BDP A;  4N41 A;  4O0I A;  2RN2 A;  1YUW A;  3NCI A;  3VF2 A;  3S3O A;  3AAQ A;  4WF9 L;  1RDD A;  1W9H A;  2HOE A;  2A5X A;  4LF4 K;  4HCB A;  3B6P A;  1EWQ A;  3QIO A;  1NKC A;  4MQ3 A;  2IVP A;  3H45 C;  4JRP A;  4KTZ A;  2NRH A;  3C6A A;  3QFU A;  3MMV A;  5I3U A;  3J81 O;  3CCJ N;  2IC3 A;  1U04 A;  3H3O B;  4DR1 K;  1VSK A;  2YHY A;  4BRC A;  4K0K K;  4FJ8 A;  3SBG A;  4ILH A;  1XWL A;  5C24 A;  2CGJ A;  4AHV A;  1HUX A;  4FM1 A;  1RIL A;  5GAG P;  5AQX A;  1VSE A;  3QIC A;  3CJB A;  1TL1 A;  4HTL A;  2OYQ A;  1XC3 A;  4Z0U A;  4JS4 A;  3HVR A;  4DQQ A;  2D1K A;  3ZT2 A;  4JI6 K;  3NE6 A;  3PSF A;  1N6Q A;  1VQ8 N;  1GLE G;  3M6G A;  3C6H A;  1RDA A;  4GKK K;  3PX0 A;  4BRI A;  1QHA A;  1WSG A;  4IOX A;  2G8F A;  3I8D A;  3CQY A;  2IVN A;  1C0F A;  4EZ6 A;  1NKE A;  2OTL N;  3ATV A;  3OW2 M;  5KPR A;  3CC2 N;  3CCL N;  3RMC A;  2FSN A;  3WXK A;  5F1X A;  3VQQ A;  3CPE A;  4ISE A;  1EX4 A;  3O4Q A;  3V6D A;  3EO3 A;  1SQK A;  3CHW A;  4JKC A;  2XO7 A;  1QSY A;  4F3T A;  3ZT4 A;  4JI3 K;  4I2P A;  2O8E B;  3SMS A;  1EXQ A;  3CYM A;  3PIO L;  2QA4 N;  5HRO A;  1BA1 A;  1SKS A;  4UQG A;  5AFU H;  1NGB A;  1LWC A;  2KTQ A;  1ZC6 A;  1VSI A;  4QS7 A;  4KPY A;  3HPH A;  3TAG A;  1HNZ K;  5AQK A;  3D45 A;  4IEE A;  1Q82 O;  4CIF A;  3M8S A;  4RW6 A;  1Q8I A;  5JS2 A;  4FCY A;  3U4L A;  2P9N A;  1TK5 A;  2G8V A;  3K5M A;  4BG9 A;  2P5G A;  2HHS A;  1ATR A;  1JXB A;  1XMQ K;  3OBY A;  5HOO A;  1L3S A;  5K14 A;  3WQU A;  1VK0 A;  1S9G A;  3VQ4 A;  3HO1 A;  2QK9 A;  4H8K A;  2HF4 A;  2UXD K;  2GBZ A;  2O8C A;  4ILG B;  3WXJ A;  3ZT3 A;  1NGJ A;  4YOU A;  1X9J A;  4PKI A;  4YFU A;  1C1A A;  1OH8 A;  4FLZ A;  3ZT0 A;  4BRG A;  3D0P A;  3FGU A;  4YDU C;  4FM0 A;  3CD6 N;  3HOS A;  3KVG A;  4L8R B;  1TV6 A;  4FK0 A;  3Q7B A;  2VQE K;  4U67 L;  4CER A;  3UE5 A;  3CCE N;  3SBT A;  3WXL A;  3ASM A;  1YF5 L;  1HNX K;  1SAZ A;  3WEE B;  2O8F B;  4C8O A;  4F8R A;  4JKG B;  4YOR A;  1BCM A;  1YXQ A;  4IEI A;  4M3X A;  1J5O A;  3SAF A;  1QTM A;  1HJR A;  2F9T A;  4EAH D;  3FZF A;  2Q3S A;  4E1N A;  1Q81 O;  2F4V K;  1Y64 A;  3ZSW A;  3V9W A;  4DTO A;  3QNN A;  1A5X A;  3V1Q A;  5AQV A;  4FSV A;  1WB9 A;  2NRV A;  4IDH A;  5JIC A;  2J4R A;  3EZW A;  4CJF A;  1ASU A;  3F5T A;  1X9M A;  2KW4 A;  4DV4 K;  4BRL A;  4IG3 A;  4KI6 A;  4BC5 A;  2IOC A;  1JXE A;  1X9S A;  5TKY A;  1WUA A;  3FE1 A;  2JWK A;  4DLG A;  4W5N A;  3CET A;  2DPN A;  4E1M A;  1P8Z A;  1NK6 A;  1VQ5 N;  3LDP A;  4LC9 B;  2YV0 X;  2XRI A;  1IKX A;  3O3G A;  1KXP A;  1XI1 A;  1VQN N;  4KHY A;  3L2Q A;  3T1A A;  2Q0R A;  3E9P A;  4Q0B A;  3TPQ A;  4CEA A;  1W7A A;  1CXU A;  1X1P A;  3TSP A;  1ATS A;  1E4F T;  3V1O A;  1XQS C;  4E7L A;  3GDQ A;  1IKW A;  2F8S A;  3PV8 A;  4JYA K;  3NGZ A;  1J53 A;  3O3H A;  1IO2 A;  4DSI A;  2YHX A;  3BEX A;  3SV3 A;  3C94 A;  1S1X A;  5M1Q A;  2OTJ N;  1CXQ A;  3DLG A;  3TAM A;  4FYD A;  1NOY A;  1QS4 A;  4IBN A;  4ELV A;  4FLY A;  4BR4 A;  4FJM A;  4FK2 A;  4KO0 A;  4OPA A;  3D7E O;  3R1X A;  3ZYY X;  3E1Y A;  2G8I A;  1IBM K;  3C0B A;  1VRU A;  4DTP A;  1RDC A;  1L3T A;  2VYP A;  4CEQ A;  4KH6 A;  4DLE A;  2HHT A;  5AQG A;  3GL1 A;  3O6W A;  1QSL A;  5C12 A;  1N5Y A;  4Y1D A;  1GLJ O;  4CF9 A;  4DTR A;  3SJH A;  4BRK A;  3O4N A;  3AVH A;  4B1X B;  4FXD A;  4WYB A;  5FPE A;  1RDB A;  3DLE A;  5BR8 K;  4MLH A;  3TAQ A;  2P9K A;  4O55 A;  3SPY A;  1LW2 A;  4NCA A;  2D4W A;  3VER A;  2B6A A;  3IMX A;  1NGI A;  1NGE A;  2QM1 A;  4ILJ A;  5AQH A;  3RSE A;  5BN8 A;  3RWU A;  1LCU A;  3AVB A;  3SJJ A;  3IDH A;  4AH9 A;  5DM7 L;  1GLF O;  2GEL A;  3AAP A;  3UKU B;  3KLE A;  4M42 A;  3KK3 A;  3R6M A;  2QXF A;  3AGR A;  4FWK A;  1NGH A;  3KJV A;  1FK9 A;  1G15 A;  3ID8 A;  3UKR B;  3VES A;  3ZX0 A;  3NMU A;  1QHT A;  4CFD A;  1SKW A;  1QQC A;  4NB4 A;  3T3F A;  2D0O A;  3I33 A;  5CZ1 A;  3KD5 E;  3OYF A;  4OKJ A;  2PFU A;  2ZJP L;  1M1K O;  1VQ4 N;  1NGF A;  4IDK A;  4U7B A;  1NGA A;  3K0S A;  2YJF A;  3PX6 A;  1QQN A;  1S5J A;  3KLF A;  2FLO A;  2VG6 A;  2HNZ A;  2ZJQ L;  4AF1 A;  2XY7 A;  2WTU A;  1UWB A;  3L3U A;  3CXC M;  4JKG A;  1B9D A;  5JLH A;  4X66 K;  3WT0 A;  1Y97 A;  2E6L A;  3DXM B;  2A1R A;  3OBW A;  1GOC A;  4NLC A;  1U47 A;  4CJ5 A;  1TUY A;  3JXU A;  4FO0 A;  3AVG A;  1H1V A;  1YJN N;  1NJZ A;  4E19 A;  2ZQB A;  4CE9 A;  2ATQ A;  1S1W A;  3CME N;  5CR4 A;  3EE9 A;  3O08 A;  3OYJ A;  4EIA A;  1HMV A;  3QEI A;  2QI2 A;  3HBT A;  1EO1 A;  4IFY A;  1REV A;  3EE8 A;  4PQU A;  3DLK A;  5AZJ B;  4DUY K;  3T1H K;  5A2Q O;  3MAQ A;  1KVB A;  3K2P A;  1TKT A;  1RBS A;  3I55 N;  3NF8 A;  1KLM A;  1S6P A;  3P1G A;  5DK5 A;  4BRM A;  3H6E A;  4B3O A;  2Q36 A;  5JLF A;  2X74 A;  3AVF A;  3EEQ A;  4DWI A;  4I7F A;  3P39 A;  1BQM A;  1JL1 A;  2XY6 A;  5GAD P;  4YOW A;  3QEV A;  3OJU A;  4B8C A;  1D5A A;  4X65 K;  4OPK A;  1GOB A;  4WCE L;  3U3G A;  5EU7 A;  2V52 B;  2ZF5 O;  3HM8 A;  2P5O A;  4DG1 A;  1K73 O;  2Y1J A;  4CK2 A;  4KHQ A;  2EHG A;  3VF6 A;  4DV3 K;  1YI2 N;  1RNH A;  3IUC A;  2IIR A;  3QBW A;  4IFV A;  1I3A A;  2HST A;  5LMU K;  1YVN A;  3C95 A;  3O9U A;  4KBO A;  4OX9 K;  2KZZ A;  3K59 A;  2B5J A;  1MWM A;  3AA3 A;  3ENH A;  5M1K A;  5IWA K;  4BR0 A;  3F9K A;  3OYK A;  1HYS A;  5AQT A;  4M45 A;  5GAH P;  5CY4 A;  1TKZ A;  3LPU A;  5I42 A;  1YJW N;  2EX3 A;  4AHC A;  1BOT O;  4CJ4 A;  1LV5 A;  4CF2 A;  2YNG A;  5EXW A;  1C1C A;  4DV6 K;  4Z4F A;  3MCA B;  3ZEU A;  3ZSV A;  3LAN A;  4B8A B;  4BE2 A;  4DTN A;  1HX1 A;  4BGA A;  2NRX A;  3ZLJ A;  3OYN A;  4NXM K;  3SYZ A;  3WNF A;  3ITH A;  4JKE A;  3DXK B;  4ID5 A;  1NK0 A;  3EZ5 A;  4M3U A;  4BR5 A;  4CK3 A;  1L3U A;  4CGJ A;  1EP4 A;  2YKM A;  5AQI A;  4W5O A;  4AM7 A;  2ZM6 K;  4RTF D;  3EKU A;  2HBL A;  3SQ0 A;  5J2P A;  2ZE2 A;  4PKH A;  5AQR A;  4CIG A;  5ELZ A;  1K8A O;  1K9M O;  2XY8 A;  3A5M C;  5MLC Q;  3HP9 A;  5BN9 A;  3KWI A;  1TUU A;  3L4Q A;  3CQX A;  3T69 A;  4R5P A;  4JKA A;  4R79 A;  2QWN A;  4GVM A;  4GVE A;  5ADX A;  1U2V B;  3GOI A;  4HCC A;  4CBW A;  5KRT A;  4DU4 A;  2A41 A;  4EP4 A;  1FKP A;  1T03 A;  1CLQ A;  2YX6 A;  4O44 A;  4CFC A;  3M8P A;  1BO5 O;  1ZBI A;  3DRR A;  1OH6 A;  4ICL A;  3NAE A;  4LF9 K;  5C25 A;  1U48 A;  4FJH A;  4ID1 A;  1JLF A;  4JK9 A;  1E4G T;  3KIO A;  3EL2 A;  2O8B A;  4OLA A;  4BDP A;  1VSM A;  3QER A;  3AVM A;  4BQZ A;  3TAF A;  2WOM A;  1VQP N;  1NM1 A;  2BUP A;  4H0X B;  3HST B;  3UB5 A;  4DTU A;  2VQF K;  4ZTF A;  3VQ5 A;  3NH1 A;  1NLV A;  1S1U A;  5AZI B;  5AQM A;  3KK1 A;  4FVM A;  4CVN E;  3OYD A;  3NGI A;  1VQL N;  4PKG A;  3SQ1 A;  1P90 A;  4G9Z A;  4CJR A;  3THX B;  1SL0 A;  1RTD A;  3FZK A;  4WQ4 C;  3THX A;  5JVG L;  5J2Q A;  3MED A;  3LDL A;  5HRR A;  5AQL A;  4BRA A;  1TAQ A;  3L3V A;  3O5B A;  1HNI A;  1KTQ A;  1KFS A;  3VQ9 A;  2QTD A;  3RMA A;  3BUZ B;  3VEZ A;  4A5B A;  2E2N A;  2JLE A;  3BP8 A;  2P1J A;  4DFJ A;  1TKD A;  4FJK A;  1U6Z A;  1U45 A;  3LP1 A;  4PL7 A;  3HZ6 A;  4DCH A;  1D4X A;  3MK6 A;  3B8A X;  1BI4 A;  1YHQ N;  1KAZ A;  3ZCM A;  4A61 A;  4LF7 K;  4QOZ B;  5KGW A;  4CGG A;  1IBK K;  3VA3 A;  4WQ5 A;  4FW1 A;  3D2F A;  3VEY A;  4B3R K;  3ZSY A;  3AO1 A;  5HRP A;  2YNI A;  1T44 A;  3LP2 A;  5M1N A;  2X6N A;  2HVH A;  1IH7 A;  1KSP A;  1XNR K;  2G8U A;  4B1V A;  3PY8 A;  4O5F A;  1UA0 A;  4Y0W A;  4KTW A;  3LZI A;  3LM9 A;  4M3W A;  4H0T B;  3WEE A;  4FWO A;  4JI7 K;  2P9N B;  4EFH A;  3SUQ A;  4JEP A;  3SAH A;  5BPL A;  3CI5 A;  1MA9 B;  3MX2 A;  4CHY A;  3KKR A;  1EWR A;  2RE2 A;  4CJP A;  1UOC A;  2Z1G A;  3LM2 A;  4JNE A;  4FOI A;  5M1F A;  1RFQ A;  1S1V A;  3GBT A;  2P9P A;  4JK8 A;  4CZG A;  1U4B A;  4BRF A;  4DQP A;  4IOC L;  3CCS N;  3RR7 A;  3UKU A;  3S41 A;  4BE0 A;  3VEN A;  4CFA A;  2IAJ A;  2KQ2 A;  1J6Z A;  1FJG K;  4JI2 K;  4WQ4 A;  2WFB A;  3VEV A;  5FPN A;  3CER A;  2D0B A;  3W3D A;  3OYC A;  1A5W A;  2P9S B;  4AHS A;  5AQZ A;  1EET A;  2E1Y A;  1VQK N;  4FJI A;  2E5L K;  4XIU A;  3SQ4 A;  4BVO A;  3DXK A;  3HXM A;  4EZ9 A;  1YT3 A;  2YKN A;  3AA4 A;  3IRX A;  4OVL A;  3JAM O;  1JCE A;  3TAN A;  4BR9 A;  5I9E B;  4KFB A;  3P38 A;  4F9O A;  2GWJ A;  2P9I A;  2UUC K;  1M90 O;  4Z4H A;  4Z4G A;  3VPZ A;  2HW3 A;  1NMD A;  4KB0 A;  2AP1 A;  4LD0 A;  3WXM B;  1TGO A;  4JHD B;  1KQS M;  4C1N I;  2P9U B;  2O8C B;  4KHW A;  4BRN A;  2YNH A;  1WAF A;  3FFK B;  1RBV A;  5SWM A;  3KLH A;  4J8F A;  2QKK A;  3F9M A;  4FJX A;  4MDA A;  1VHX A;  2QW9 A;  1L3V A;  3AO2 A;  4XH1 A;  4B3M K;  3A5N C;  3OYI A;  2QXL A;  3CF5 L;  4G1Q A;  1A5V A;  3V4I A;  2R7Y A;  1I94 K;  4CF8 A;  1MWK A;  3CG7 A;  4X64 K;  1EQY A;  3OYM A;  4FPA A;  3WNH A;  4DU1 A;  3FZL A;  1K8K B;  5FPM A;  3Q7C A;  4XEI A;  4KTQ A;  1C1B A;  1T8E A;  1IG9 A;  5HP1 A;  1V4T A;  3VQA A;  3ZSX A;  3RRG A;  5IT9 O;  3L2U A;  1RT7 A;  1S22 A;  1OVQ A;  2I5J A;  3CC7 N;  5AZJ A;  3ULE A;  1SKR A;  3MN9 A;  4B1Z A;  3FLC O;  4WE1 A;  3T1Y K;  3A5L C;  3KD1 E;  1QZ5 A;  1VSF A;  2ZD1 A;  1HPZ A;  3MCP A;  3KWG A;  3V1R A;  4MFB A;  3MXI A;  1C0U A;  4FLT A;  2PY5 A;  4IZ9 A;  4WFN L;  4FWM A;  4CZH A;  2UU9 K;  1SV5 A;  1XUP O;  1U49 A;  4IOA L;  4A57 A;  5CYQ A;  1OH5 A;  1Q7Y O;  4WFA L;  2OPR A;  2ZWH A;  4J2D A;  1HKG A;  2P9U A;  4CGH A;  3TTC A;  2HHQ A;  1BI4 B;  5CHI A;  1BIU A;  1FKO A;  3CIP A;  3E9O A;  1YTA A;  3S3N A;  3ZX2 A;  3K5L A;  3L2W A;  3THV A;  2GWK A;  1IKY A;  4B1U B;  4RW8 A;  2OPS A;  1Z05 A;  4BR2 A;  5J2N A;  3LAK A;  3D2E B;  3I56 N;  4A59 A;  3MEE A;  2V7Y A;  2P9S A;  2BTF A;  4A2B A;  3BY5 A;  3AAR A;  1O1W A;  5CYM A;  2KHO A;  3O80 A;  1X3N A;  2F9W A;  3K58 A;  1DKG D;  4N56 A;  4CED A;  3V9U A;  3MWP A;  1VSH A;  4IJA A;  4M63 C;  4V19 S;  5KI6 A;  4Z4E A;  1LAV A;  3J8A A;  1LW0 A;  1KAY A;  1KVA A;  4BR7 A;  4IO8 A;  4MO4 A;  2GUI A;  4KH5 A;  3H1Q A;  3DOL A;  4KRF A;  4CHZ A;  3SI6 A;  1G99 A;  3OYH A;  3I0S A;  4GV6 A;  4HWI A;  2ZGZ A;  2YHA A;  1CZ9 A;  1RBU A;  3K9K A;  5E41 A;  2VCP A;  3KK7 A;  3PSI A;  3QEP A;  4B9T A;  1L5U A;  3IS9 A;  3O9T A;  4KHU A;  3BF1 A;  4J2B A;  3C7N A;  4CZF A;  1QE1 A;  2A40 A;  1BIS A;  5AQP A;  1Q18 A;  4OKK A;  1ZBS A;  3U9D A;  4YHH K;  3VTI A;  3RMB A;  1BG3 A;  3TSU A;  1YVU A;  1D8Y A;  3L2V A;  4FWR A;  1JLC A;  4CJV A;  1BCO A;  4E7I A;  3BF3 A;  4Y1C A;  4MO5 A;  3VTH A;  5AFU A;  4J2A A;  3VQ8 A;  4Q5V A;  3EY1 A;  1RDU A;  1SUQ A;  1YIT N;  4H5R A;  3OVN A;  3DRP A;  3O4W A;  5E26 A;  4DR7 K;  2X78 A;  5LL6 Z;  4OLB A;  3CMA N;  5AQU A;  1BU6 O;  4CJK A;  1UA1 A;  1IV0 A;  3VA0 A;  3TAP A;  3H08 A;  2VGM A;  4H5T A;  1RTH A;  1JCG A;  3VQB A;  4E7H A;  2E1Z A;  4JKD A;  2RF2 A;  4PY5 A;  1ZBF A;  5D3G A;  5FLX O;  5H1S Q;  3U6F A;  4PHT X;  4FJ5 A;  3O1W A;  4ISG A;  4BRH A;  2HBM A;  2F96 A;  2FSK A;  3B6O A;  4GY2 B;  1VAZ A;  4DV0 K;  3ULD A;  2E6M A;  2VG7 A;  4PA1 A;  4O4G A;  4QS9 A;  1JJ2 M;  3CJC A;  1RT6 A;  4ISF A;  2NRR A;  3NFA A;  4FWQ A;  1OVY A;  4JAX A;  4KI4 A;  2RPI A;  1N8R O;  4NXN K;  1GOA A;  1XHX A;  1BUP A;  3LL3 A;  4RW4 A;  4B1W B;  3THY A;  4JK7 A;  3QB0 A;  1T7P A;  5J2M A;  1NJI O;  2KKZ A;  3L8B A;  5AQY A;  4LY7 A;  1GLD G;  3HYF A;  4OKE A;  1I39 A;  3QO9 A;  1FW6 A;  3G25 A;  1OKJ A;  3CCR N;  4HUG A;  3O3F A;  3QEX A;  1NBW A;  3MX5 A;  3ZSZ A;  3AO3 A;  3AVI A;  4CIE A;  1VQ6 N;  3G4S N;  3JS6 A;  2QKB A;  4FJG A;  4WFB L;  2CH5 A;  2GX9 A;  4FJL A;  2ASM A;  4DTX A;  4C8N A;  1K6Y A;  4B9S A;  3MDQ A;  1VQ9 N;  4FOE A;  3K5N A;  4DQI A;  4YOV A;  1ILY A;  3NF9 A;  3HL8 A;  2PZS A;  2E2Q A;  2DTU A;  5JMV A;  5AQJ A;  4CZJ A;  5GIN A;  4DHY A;  3HK2 A;  1DEJ A;  5BRF A;  2ITM A;  1U2V A;  3DYA A;  3VQP A;  5DM6 L;  1IG8 A;  2IDO A;  2XY5 A;  2FF3 B;  1NK4 A;  2DFF A;  3QFP A;  5EX5 A;  3BZK A;  2W40 A;  4KHN A;  3AV9 A;  4B9N A;  3SNN A;  1ZBH A;  4KKO A;  4W5Q A;  2QWL A;  3VOV A;  2HB5 A;  3O8M A;  1B92 A;  1NK7 A;  4CBX A;  3M8R A;  2PYJ A;  3DI6 A;  3CCV N;  4LF8 K;  4XH4 A;  1C0M A;  3N4Q A;  4DUZ K;  3PO5 A;  1ASW A;  3LDS A;  3RVC A;  4Z94 A;  4KB1 A;  5C0Y A;  4JD2 A;  2FBY A;  4BC4 A;  1HQE A;  1E3M A;  3RRH A;  1NJW A;  3U3Y A;  5BRH A;  3VEW A;  3VQC A;  4AM6 A;  3G10 A;  4MLE A;  1WAJ A;  4TSX A;  1C6V A;  1UAX A;  4E7K A;  3QIP A;  1NG9 A;  3DLH A;  2I7P A;  2QEX N;  2O8F A;  1NU0 A;  3CJ7 A;  3G0Z A;  4K25 A;  2A3Z A;  1HLU A;  2GEM A;  4BRD A;  3WNG A;  4CEE A;  3CC4 N;  3TSQ A;  1RBT A;  4DSF A;  1QSS A;  4DSJ A;  3NH2 A;  2RKI A;  1DLO A;  2HNY A;  3VN5 A;  2FBT A;  3D2F B;  3ISN C;  1KFD A;  3NF7 A;  4JKB A;  4HUF A;  3A5O C;  4LSL A;  1DGK N;  3HT3 A;  3I8B A;  4E89 A;  1TK8 A;  3AO4 A;  4DF8 A;  1N33 K;  3PO4 A;  4OJR A;  3J7Z O;  1BIZ A;  3DWL A;  2AJQ A;  3UKR A;  4H4M A;  3S9H A;  4FZZ A;  3WXI A;  2NUB A;  5KGX A;  4YOX A;  4JI0 K;  1BL3 A;  4H0V B;  4MDB A;  4CJE A;  4N5S A;  2QWQ A;  4QS8 A;  4BC3 A;  1MU2 A;  3DM2 A;  5AQS A;  1SS6 A;  3AVJ A;  4I9L A;  5CE3 A;  4GKJ K;  3OYL A;  2GV9 A;  1CZA N;  3QDK A;  3OTO K;  1V4S A;  4DB3 A;  2DY4 A;  3V9Z A;  2Y1I A;  3DMJ A;  2HMI A;  3CM6 A;  3DRS A;  4NCB A;  3ZT1 A;  4YOY A;  4C8L A;  1S9E A;  3CJ1 A;  4C23 A;  4E1J A;  3HP6 A;  3HSC A;  3QLH A;  3TU5 A;  3GE1 A;  1Q9X A;  4IWV A;  2ZGY A;  1C0G A;  4RCH A;  3RMD A;  1NMN A;  3EN9 A;  3VEX A;  1Z26 A;  4DV5 K;  3AA5 X;  3P4I A;  2DFH A;  4JN4 A;  4BE1 A;  1J54 A;  3O9R A;  4FWP A;  4JI5 K;  4DV1 K;  2HVI A;  1JLE A;  1TYQ B;  3CM5 A;  4DF4 A;  3UIQ A;  1YTU A;  3VQ6 A;  4K8Z A;  2RHK A;  4K8X A;  4CJW A;  3SUN A;  1J9A A;  4EHU A;  3O9Q A;  1DTQ A;  5BRE A;  1RT4 A;  4IKF A;  4NYF A;  1D9F A;  2PBD A;  4XH5 A;  3OS2 A;  3GG4 A;  1NKB A;  3EKS A;  3OYB A;  3R9P A;  3ULE B;  1DT9 A;  2KLA A;  2WON A;  3AVA A;  3R8E A;  1XC9 A;  1JLA A;  4JD2 B;  4B08 A;  4OGE A;  5GIO A;  3PUF A;  4C1N K;  4BQL A;  3HI0 A;  3AGK A;  3VQ7 A;  5KTQ A;  3SUP A;  4CJL A;  1RT5 A;  1HYV A;  3NDK A;  3AVN A;  3AVC A;  1TKX A;  3E01 A;  3QNO A;  3L0Q A;  5FPD A;  3F2K A;  4JI1 K;  4DQR A;  4CHP A;  4YOT A;  1HNV A;  4O8U A;  4IXC A;  3THW B;  4ELT A;  3C65 A;  3FFI A;  2D5R A;  4LF6 K;  1ATN A;  5ADX H;  2P9I B;  4CHQ A;  4HUE A;  5FRN A;  2X6S A;  1S6Q A;  3ENO A;  1IBL K;  4JV5 K;  4KAZ A;  3TTF A;  3VET A;  4BRE A;  4B9M A;  4OPJ A;  1S72 N;  4F3O A;  5AQN A;  3R3L A;  3U9Z A;  4BRP A;  1KD1 O;  5C42 A;  3KK2 A;  2NLX A;  4NYN A;  3L2R A;  2KFN A;  2HHU A;  1HYZ A;  3ALY A;  4AHR A;  1DTT A;  3KZB A;  3DLB A;  2NRT A;  3AVK A;  1NJX A;  3K57 A;  3M5R A;  2Q31 A;  2A6A A;  1NNE A;  5T7B A;  5B8H A;  1LOT B;  2G8K A;  2IS3 A;  2D0C A;  2YJE A;  5HLF A;  3OS1 A;  5GIP A;  4UY8 O;  4BAC A;  3VGM A;  3OY9 A;  4JS5 A;  1WSH A;  2QWR A;  1R0A A;  3PX4 A;  2FXU A;  4A2A A;  2WBN A;  2CGL A;  4CEZ A;  3LAL A;  5C15 A;  4CD1 A;  2BH1 A;  4O8K A;  3VQE A;  2FBV A;  2HHX A;  1JLG A;  3MWT A;  3IKM A;  4F4K A;  2HMP A;  4FJ9 A;  2BGG A;  4B9L A;  2HND A;  3RR8 A;  4C8M A;  1GLB G;  3JYT A;  4HVJ A;  2DFE A;  1TYQ A;  4CI6 A;  3L6Q A;  1T6D A;  4LSN A;  3KLI A;  4FPB A;  5LJW A;  1FXX A;  3S3M A;  2G8W A;  3MEG A;  4H5V A;  1RT2 A;  2HF3 A;  1Z6R A;  1JCF A;  1WSJ A;  4H4O A;  1IJJ A;  4FLX A;  4GNI A;  1HNW K;  4YDU A;  1QQM A;  1VSL A;  2O8D B;  3FZM A;  4N76 A;  4KV8 A;  4DSE A;  4DFM A;  4CJU A;  3CFP A;  1S1T A;  2UXC K;  4FZX C;  4FK4 A;  3LDQ A;  3NGY A;  4DSK A;  1HQU A;  3LP0 A;  3A8Y A;  1Q9Y A;  4BRO A;  4CZK A;  3P83 D;  3QBX A;  3SQ2 A;  3PIP L;  3DXM A;  3NBP A;  1VQ7 N;  4FM2 A;  3TR8 A;  2V51 B;  4AIL C;  5EOY A;  3H46 O;  3K5O A;  3N4P A;  4CHN A;  4OPH A;  5AQQ A;  3LWM A;  3D2E A;  1BWF O;  3A0I X;  4BRQ A;  3E9L A;  3NF6 A;  2YHW A;  3CCQ N;  3BZC A;  1TK0 A;  2NRZ A;  1HKB A;  4Z4I A;  3QML A;  3VMF B;  4JLH A;  2EWS A;  3OS0 A;  3TAB A;  2V7Z A;  4GV3 A;  4CZI A;  3VQD A;  2W42 A;  4FLU A;  5C10 A;  3VEO A;  2NNW A;  4ELU A;  3J80 O;  5AJ3 K;  2D0A A;  1RT1 A;  5KRS A;  3G71 N;  2W41 A;  4GW6 A;  3W0L A;  4E3S A;  3DLL L;  4QAG A;  1WSF A;  4LF5 K;  4JRQ A;  3ZSR A;  2B4J A;  3AY9 A;  5DMR A;  3C6U A;  4I9Q A;  1QVF M;  1KAX A;  3BGR A;  5AQF A;  4W5R A;  3QIN A;  5LJV A;  3CCU N;  4FZY A;  3ENB A;  4H0O A;  3V9S A;  4NLB A;  2O8D A;  4DTJ A;  4EHT A;  3CJA A;  3L4I A;  5BRD A;  3THY B;  1WSE A;  5TKW A;  1ZYQ A;  1NK8 A;  4H03 B;  4DMN A;  2VWK A;  4GV9 A;  3CQ8 A;  1KLN A;  2CH6 A;  1ZXO A;  4CGI A;  2Z1J A;  2UXB K;  2OAN A;  5FRM A;  4DR6 K;  2NRW A;  3OJS A;  1R59 O;  3ZSQ A;  4CGD A;  4F2R A;  3E66 A;  3VGK A;  3CPW M;  1WOQ A;  3LPT A;  5GAE P;  3LWL A;  3CJ9 A;  2BE2 A;  4BY9 C;  3ZSO A;  2ASP A;  4B3T K;  1NK9 A;  4JKH A;  4NO7 A;  4DQ8 A;  3LZJ A;  3SPZ A;  5SZT A;  2Q0U A;  4FWN A;  2UUB K;  2QWM A;  1RDW X;  1RBR A;  1HPM A;  1YIJ N;  1KVC A;  2FBX A;  3RSE B;  1HRH A;  4BDZ A;  5HRN A;  1W97 L;  2E88 A;  3KKS A;  5CZ2 A;  2HHH K;  4J2E A;  2OPQ A;  1O13 A;  4DU3 A;  4DTM A;  4OO1 J;  2E8A A;  4OGC A;  4CEC A;  5F2R A;  4FJJ A;  5KQ8 A;  4DFK A;  1LWF A;  5AQW A;  1T05 A;  1YAG A;  3MN7 A;  5BPN A;  4JKF A;  3LDN A;  2OA8 A;  1WLJ A;  1BDG A;  3A2F A;  2QWO A;  5BR9 A;  1RGI A;  4M3Y A;  1GLA G;  4DQS A;  3IAY A;  2HBK A;  1OH7 A;  3P31 A;  2W6L A;  2GUP A;  2FC0 A;  5HL7 L;  5M1P A;  4KHP K;  4CES A;  1NGD A;  1VSD A;  4O5B A;  3U8X A;  4RW9 A;  2GTD A;  4AQY K;  1BHL A;  3OA9 A;  1ESV A;  4CEB A;  4B3S K;  3QET A;  4A62 A;  1D9D A;  3HPG A;  4PL8 A;  2KZM A;  3THW A;  3IG1 A;  4HHT A;  1N34 K;  4CCH A;  4EP5 A;  1J5E K;  1W2B M;  2WUS A;  5BPM A;  3DOK A;  2Z1H A;  1XHZ A;  4NCG A;  4FJN A;  4PWD A;  3SV4 A;  2P51 A;  3D6R A;  1JKH A;  3T7Z A;  2UUA K;  3MN5 A;  1TAU A;  2Z1I A;  4WQ5 C;  5KQD A;  1NJY A;  4LH5 A;  2OZS A;  4IO9 L;  2P9L A;  1QVG M;  1QQO A;  3WUH A;  2VWB A;  5LY3 A;  4X62 K;  2ETJ A;  3G6E N;  2A1S A;  4CEF A;  2VGN A;  4K41 A;  4M41 A;  2YI1 A;  3M3Z A;  1NK5 A;  5M1O A;  5J1E A;  2E20 A;  3MEC A;  3PLA A;  1GLL O;  4CBU A;  3V9X A;  3SUO A;  4CZL A;  4IG0 A;  2QWP A;  3AVL A;  4JI4 K;  3TAR A;  3DAW A;  5HRS A;  2F8T A;  3LP3 A;  4C8K A;  3SZ2 A;  3CFO A;  2E4L A;  4LFC K;  1VQO N;  1XNQ K;  3K9J A;  2P9P B;  2FF6 A;  1KRP A;  1Q86 O;  1SZ2 A;  3HOT A;  1GLC G;  4JI8 K;  2UYT A;  1NWK A;  1N36 K;  3M8Q A;  1CZB A;  4BWJ A;  4RW7 A;  4Z4C A;  4M3Z A;  1N32 K;  1ZBU A;  3T19 A;  1WN7 A;  4H0P A;  3IFR A;  5JVH L;  3ATU A;  3HTV A;  4CGF A;  1RTJ A;  1VRT A;  3MXM A;  1ASV A;  2JGU A;  3KTQ A;  4RG8 A;  4FL9 A;  3SK3 A;  5LMN K;  2KFZ A;  1SL1 A;  4BG8 A;  1IKV A;  2Q1N A;  3C7N B; 
#chains in the Genus database with same CATH homology
 3GE1 A;  4IWV A;  2P9S B;  2ZGY A;  3TPQ A;  1C0G A;  4BVP A;  3ZET B;  4RCH A;  4KH4 A;  5AQZ A;  3EN9 A;  2E1Y A;  1VQK N;  2E2P A;  4FWS A;  3VEX A;  4BVO A;  3DXK A;  5C2D A;  3TSP A;  1ATS A;  1E4F T;  3P4I A;  4L3Q A;  1XQS C;  4JN4 A;  2P9L B;  3O9R A;  1JCE A;  3GDQ A;  4BR9 A;  5I9E B;  4FWP A;  3P38 A;  1TYQ B;  4F9O A;  2ASO A;  2GWJ A;  2P9I A;  1M90 O;  3VPZ A;  2YHX A;  2RHK A;  1NMD A;  3BEX A;  4EHU A;  2AP1 A;  3WXM B;  4JHD B;  5M1Q A;  5AZI A;  2OTJ N;  3O9Q A;  4B1Y B;  5BRE A;  1KC8 O;  1KQS M;  4C1N I;  3TTD A;  2P9U B;  4BR4 A;  2PBD A;  4OPA A;  5F0X A;  5KPT A;  4XH5 A;  3D7E O;  2F7T A;  3R1X A;  3ZYY X;  3GG4 A;  3E1Y A;  3EKS A;  4BRN A;  3R9P A;  3FFK B;  3C0B A;  3ULE B;  1DT9 A;  4J8F A;  3F9M A;  2KLA A;  3FR0 A;  3NVM A;  4MDA A;  3NVK A;  2QW9 A;  2VYP A;  4XH1 A;  3ZEU B;  4KH6 A;  3R8E A;  3A5N C;  3FZH A;  2QXL A;  3CF5 L;  4JD2 B;  5AQG A;  3GL1 A;  5AR0 A;  3O6W A;  5GIO A;  4M7Y A;  5C12 A;  1MWK A;  4C1N K;  4BQL A;  3HI0 A;  3AGK A;  1EQY A;  4FPA A;  1GLJ O;  3CCM N;  3SJH A;  4BRK A;  3FZL A;  1K8K B;  5FPM A;  3Q7C A;  4B1X B;  4WYB A;  5FPE A;  3L0Q A;  4XEI A;  5FPD A;  3F2K A;  1HKC A;  3H1V X;  4MLH A;  2P9K A;  1V4T A;  4YOT A;  4O8U A;  2D4W A;  3VER A;  3ZX3 A;  4IXC A;  1S22 A;  5EVZ A;  3C65 A;  3CC7 N;  2YCH A;  3IMX A;  3O9S A;  5AZJ A;  3ULE A;  1QZ6 A;  1NGE A;  1NGI A;  2QM1 A;  3M1F A;  1T6C A;  1X3M A;  3MN9 A;  4ILJ A;  2CGK A;  4B1Z A;  1ATN A;  3FLC O;  5AQH A;  3RSE A;  5BN8 A;  5ADX H;  2P9I B;  1LCU A;  3A5L C;  1QZ5 A;  4H5N A;  2WC9 A;  3IDH A;  5DM7 L;  1GLF O;  2GEL A;  3ENO A;  4B9Q A;  3AAP A;  4A5A A;  3UKU B;  3R6M A;  3TTF A;  3VET A;  3MCP A;  3AGR A;  4FWK A;  4BRE A;  1NGH A;  3KWG A;  1S72 N;  5AQN A;  3ID8 A;  3UKR B;  3VES A;  3ZX0 A;  3R3L A;  3U9Z A;  4BRP A;  3NMU A;  1KD1 O;  1VQM N;  4IZ9 A;  4WFN L;  4FWM A;  4NB4 A;  2E2O A;  4CZH A;  2NLX A;  3SAG A;  2D0O A;  3I33 A;  1XUP O;  5EY4 A;  5KPZ A;  2ZJR L;  2ZJP L;  2PFU A;  1M1K O;  1VQ4 N;  1NGF A;  4U7B A;  4IOA L;  1NGA A;  4H5W A;  4A57 A;  2D0P A;  2YJF A;  3KZB A;  2NRT A;  1Q7Y O;  3M5R A;  4WFA L;  1QQN A;  2ZWH A;  2Q31 A;  4CD3 A;  4FVU A;  2A6A A;  5JVH L;  1HKG A;  2P9U A;  2FLO A;  3ID6 A;  3TTC A;  3O1B A;  2ZJQ L;  1T3V A;  4AF1 A;  5B8H A;  1LOT B;  5CHI A;  3CXC M;  4I6M B;  4JKG A;  5JLH A;  2YJE A;  3CIP A;  5GIP A;  3E9O A;  3OHR A;  3WT0 A;  4UY8 O;  3ZX2 A;  4IFE A;  3VGM A;  2GWK A;  2QWR A;  2A42 A;  3LDO A;  4H0Y B;  3VF4 A;  2H3G X;  2FXU A;  4A2A A;  3DXM B;  2WBN A;  4B1U B;  3OBW A;  2I7N A;  1Z05 A;  4BR2 A;  2CGL A;  5C15 A;  4BC2 A;  4CD1 A;  2BH1 A;  4NLC A;  3D2E B;  3I56 N;  4A59 A;  4O8K A;  5C2F A;  1TUY A;  3ZET A;  2V7Y A;  3JXU A;  4FO0 A;  1H1V A;  1HJO A;  2P9S A;  1YJN N;  5AQO A;  2BTF A;  3MWT A;  3IKM A;  5E84 A;  4A2B A;  1BA0 A;  4JHD A;  2HMP A;  4K43 A;  3AAR A;  4CJ7 A;  2KHO A;  3CME N;  3O80 A;  1X3N A;  1GLB G;  5CR4 A;  2F9W A;  3SMP A;  1TYQ A;  3EE9 A;  3O08 A;  4CI6 A;  3L6Q A;  1T6D A;  1DKG D;  2JWL A;  4FPB A;  5LJW A;  4DKW A;  3MWP A;  4M63 C;  4IJA A;  4EIA A;  4H5V A;  3J8A A;  2QI2 A;  3HBT A;  1NGC A;  2HF3 A;  1EO1 A;  3EE8 A;  1Z6R A;  1JCF A;  5AZJ B;  1IJJ A;  4GNI A;  1KAY A;  2Q97 A;  4BR7 A;  2FSJ A;  4IO8 A;  4YDU A;  4MO4 A;  1YJ9 N;  4K42 A;  4KH5 A;  3I55 N;  1S3X A;  4CZM A;  1QQM A;  4IJN A;  3H1Q A;  1NGG A;  4BRM A;  1G99 A;  3H6E A;  3FZM A;  2Q36 A;  4HWI A;  5JLF A;  4GV6 A;  2ZGZ A;  4M7X A;  3P39 A;  2Q2R A;  3H3N O;  3LDQ A;  3K9K A;  2VCP A;  3KK7 A;  5GAD P;  4YOW A;  3A8Y A;  1K8K A;  3O9T A;  2NZT A;  4BRO A;  3BF1 A;  4CZK A;  3C7N A;  3QBX A;  4CZF A;  2A40 A;  3PIP L;  5AQP A;  3DXM A;  4CZE A;  1VQ7 N;  1Q18 A;  4WCE L;  1ZBS A;  3U9D A;  3VTI A;  2V51 B;  1BG3 A;  5EOY A;  2ZF5 O;  2V52 B;  3HM8 A;  3H46 O;  3TSU A;  1K73 O;  3N4P A;  3HRG A;  4FWL A;  1YI2 N;  3VF6 A;  3IUC A;  2IIR A;  3QBW A;  4FWR A;  4OPH A;  4I6M A;  5AQQ A;  2HST A;  3D2E A;  1YVN A;  3VGL A;  1BWF O;  1MDU B;  4BGB A;  3A0I X;  3BF3 A;  4BRQ A;  3KHY A;  3E9L A;  3O9U A;  4KBO A;  2IVO A;  4MO5 A;  2YHW A;  3VTH A;  5AFU A;  3CCQ N;  2P9K B;  3WQT A;  2NRZ A;  1HKB A;  1MWM A;  1RDU A;  1YIT N;  3QML A;  4H5R A;  3VMF B;  2EWS A;  4GV3 A;  3O4W A;  2V7Z A;  3ENH A;  3DJC A;  5E26 A;  5M1K A;  4BR0 A;  4CZI A;  3CMA N;  5AQT A;  3MN6 A;  5AQU A;  1BU6 O;  2PAV A;  5C10 A;  3SLC A;  3VEO A;  5GAH P;  2NNW A;  2AA4 A;  2HBJ A;  1YJW N;  2VGM A;  4H5T A;  1BOT O;  1JCG A;  4RWT A;  3G71 N;  2E1Z A;  4JKD A;  2W41 A;  5EXW A;  1YUW A;  3MCA B;  3VF2 A;  3ZEU A;  3W0L A;  3DLL L;  3AAQ A;  4WF9 L;  1HX1 A;  5H1S Q;  4BGA A;  2HOE A;  3AY9 A;  2A5X A;  2NRX A;  3O1W A;  4ISG A;  4PHT X;  4BRH A;  2HBM A;  2FSK A;  4GY2 B;  1VAZ A;  2IVP A;  1JJ2 M;  4QS9 A;  1KAX A;  5AQF A;  3CJC A;  3H45 C;  1QVF M;  4ISF A;  2NRH A;  3C6A A;  2NRR A;  3QFU A;  3DXK B;  4JKE A;  5LJV A;  4BR5 A;  3MMV A;  3CCU N;  3ENB A;  4FWQ A;  4H0O A;  3CCJ N;  1OVY A;  4JAX A;  4NLB A;  3H3O B;  4EHT A;  5AQI A;  1N8R O;  3CJA A;  2YHY A;  3L4I A;  4AM7 A;  4BRC A;  5BRD A;  4RTF D;  1BUP A;  3EKU A;  2HBL A;  3LL3 A;  4H03 B;  5TKW A;  3SBG A;  4B1W B;  4GV9 A;  4PKH A;  4ILH A;  4JK7 A;  5AQR A;  5ELZ A;  1K8A O;  1K9M O;  3QB0 A;  1NJI O;  2KKZ A;  2CH6 A;  5AQY A;  1ZXO A;  3A5M C;  1GLD G;  2CGJ A;  5MLC Q;  5BN9 A;  2OAN A;  3KWI A;  1TUU A;  3L4Q A;  1HUX A;  3CQX A;  3G25 A;  2NRW A;  5GAG P;  1R59 O;  1OKJ A;  3CCR N;  5AQX A;  3E66 A;  3T69 A;  3VGK A;  1NBW A;  3MX5 A;  4JKA A;  1WOQ A;  3QIC A;  4R79 A;  2QWN A;  3CJB A;  5GAE P;  3CPW M;  4GVE A;  3CJ9 A;  3G4S N;  3JS6 A;  4HTL A;  5ADX A;  1XC3 A;  1VQ6 N;  4BY9 C;  1U2V B;  3GOI A;  4WFB L;  2CH5 A;  2ASP A;  2GX9 A;  2D1K A;  4CBW A;  2ASM A;  4JKH A;  4NO7 A;  4DQ8 A;  1VQ8 N;  3MDQ A;  1GLE G;  1VQ9 N;  3M6G A;  2Q0U A;  3C6H A;  2A41 A;  2QWM A;  4FWN A;  4FOE A;  4YOV A;  1ILY A;  1RDW X;  2YX6 A;  4BRI A;  1QHA A;  4IOX A;  2E2Q A;  5JMV A;  5AQJ A;  4CZJ A;  5GIN A;  4DHY A;  3CQY A;  1BO5 O;  1HPM A;  1DEJ A;  2IVN A;  1C0F A;  3RSE B;  5BRF A;  1YIJ N;  2ITM A;  1U2V A;  1W97 L;  3VEN A;  5DM6 L;  2E88 A;  1IG8 A;  2OTL N;  3ATV A;  3OW2 M;  1O13 A;  5KPR A;  2FF3 B;  4OO1 J;  2E8A A;  3CC2 N;  3QFP A;  5F2R A;  4JK9 A;  5EX5 A;  3CCL N;  1E4G T;  2FSN A;  2W40 A;  3WXK A;  5KQ8 A;  5F1X A;  3CPE A;  4ISE A;  5AQW A;  1YAG A;  3EL2 A;  3MN7 A;  5BPN A;  2QWL A;  3VOV A;  3EO3 A;  4JKF A;  4BQZ A;  1SQK A;  3CHW A;  3LDN A;  3O8M A;  4JKC A;  1VQP N;  4CBX A;  1NM1 A;  1BDG A;  2BUP A;  2QWO A;  3CCV N;  4H0X B;  4XH4 A;  3UB5 A;  5BR9 A;  3N4Q A;  1RGI A;  1NLV A;  5AZI B;  1GLA G;  5AQM A;  2HBK A;  3RVC A;  1VQL N;  4Z94 A;  3P31 A;  4PKG A;  3SMS A;  5C0Y A;  2GUP A;  3PIO L;  4JD2 A;  2QA4 N;  5HL7 L;  1P90 A;  4G9Z A;  5M1P A;  1BA1 A;  3FZK A;  4WQ4 C;  5AFU H;  4BC4 A;  1NGB A;  5JVG L;  1NGD A;  1ZC6 A;  3U8X A;  3LDL A;  4QS7 A;  2GTD A;  5AQL A;  4BRA A;  3OA9 A;  3O5B A;  1ESV A;  4A62 A;  5AQK A;  4PL8 A;  4IEE A;  5BRH A;  2QTD A;  3VEW A;  4AM6 A;  1Q82 O;  3BUZ B;  4MLE A;  3VEZ A;  3U4L A;  4A5B A;  2E2N A;  3BP8 A;  1W2B M;  2I7P A;  2QEX N;  2P9N A;  3CJ7 A;  2WUS A;  5BPM A;  4K25 A;  4BG9 A;  1ATR A;  2A3Z A;  1U6Z A;  3D6R A;  3T7Z A;  3MN5 A;  3OBY A;  5HOO A;  1HLU A;  4PL7 A;  3WQU A;  2GEM A;  4WQ5 C;  5KQD A;  3HZ6 A;  4BRD A;  4DCH A;  4IO9 L;  2P9L A;  1QVG M;  1D4X A;  1QQO A;  3MK6 A;  2VWB A;  2HF4 A;  3B8A X;  3WUH A;  5LY3 A;  1YHQ N;  3CC4 N;  4ILG B;  3TSQ A;  3WXJ A;  1NGJ A;  1KAZ A;  4YOU A;  1X9J A;  4PKI A;  4A61 A;  4BRG A;  3D2F B;  3FGU A;  4YDU C;  3G6E N;  4WQ5 A;  3VEY A;  3D2F A;  3CD6 N;  3HOS A;  3KVG A;  4JKB A;  2VGN A;  3A5O C;  4K41 A;  1T44 A;  3Q7B A;  1DGK N;  2YI1 A;  3I8B A;  3M3Z A;  4U67 L;  3UE5 A;  5M1N A;  3CCE N;  3SBT A;  5M1O A;  3WXL A;  4B1V A;  1YF5 L;  4O5F A;  4Y0W A;  3LM9 A;  1SAZ A;  2E20 A;  3PLA A;  3WEE B;  1GLL O;  4H0T B;  4CBU A;  3WEE A;  4FWO A;  3J7Z O;  3DWL A;  2P9N B;  4JKG B;  3UKR A;  4YOR A;  4CZL A;  4EFH A;  4JEP A;  3SAH A;  5BPL A;  2QWP A;  3CI5 A;  3WXI A;  1YXQ A;  1MA9 B;  4YOX A;  3MX2 A;  4IEI A;  4H0V B;  3DAW A;  4MDB A;  3SAF A;  2F9T A;  4EAH D;  2RE2 A;  2QWQ A;  3FZF A;  1Q81 O;  1Y64 A;  5AQV A;  3LM2 A;  4JNE A;  4FOI A;  4QS8 A;  4BC3 A;  4FSV A;  1VQO N;  5M1F A;  5AQS A;  1RFQ A;  3K9J A;  2P9P B;  2FF6 A;  2NRV A;  4IDH A;  5JIC A;  3GBT A;  2P9P A;  2J4R A;  4JK8 A;  1SZ2 A;  4CZG A;  3EZW A;  1SS6 A;  1GLC G;  5CE3 A;  4BRF A;  3HOT A;  1Q86 O;  2UYT A;  1NWK A;  1CZA N;  4IOC L;  3QDK A;  3F5T A;  3CCS N;  4BRL A;  1V4S A;  4DB3 A;  4BC5 A;  3UKU A;  3S41 A;  4H0P A;  3IFR A;  5TKY A;  1WUA A;  3ATU A;  2JWK A;  3FE1 A;  1J6Z A;  3HTV A;  3CET A;  2DPN A;  4YOY A;  1P8Z A;  1VQ5 N;  3LDP A;  4LC9 B;  4WQ4 A;  2WFB A;  3CJ1 A;  4C23 A;  3VEV A;  4E1J A;  5FPN A;  1KXP A;  3CER A;  4FL9 A;  3SK3 A;  1VQN N;  4BG8 A;  3HSC A;  2Q0R A;  3W3D A;  3TU5 A;  2Q1N A;  3E9P A;  3C7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...