5M1OA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound cobalt
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
188
structure length
188
Chain Sequence
b'AMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
total genus 68
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1oA00
4IEIA 5C2DA 5M1NA 4IEEA 5C2FA 5M1OA 5M1PA 5M1QA 5C12A 5C10A 3C6AA 5C15A 3C6HA 4IDHA 5M1FA 3CPEA 4IFEA 5M1KA
chains in the Genus database with same CATH superfamily
3AA2A 1IKXA 5BRHA 1WSEA 3CFRA 3CF5L 4DU3A 4X62K 3B6OA 1MWMA 2VGMA 3J7AP 4ISGA 3SV4A 2IS3A 1IJJA 4C1NK 3H46O 2HOEA 3JSMA 4DV1K 1WAJA 2V7YA 2G8IA 1BHLA 1Z25A 4FLWA 3SJJA 1HYSA 1RTJA 4BRQA 3U6FA 1D4XA 3SPYA 4C8NA 1VQ4N 5HROA 2IVNA 4JKFA 4FLYA 1RBSA 2IGIA 1GLCG 3PIOL 4FJJA 3ZSRA 4M7YA 1L5UA 3P31A 1NKEA 4YORA 4GVMA 4CHOA 4BR0A 1NGJA 3CCSN 1FJGK 3LPUA 4RW6A 3WQUA 5KTQA 3THYB 1NGEA 1NJXA 3HSTB 3A5LC 4Z4EA 2HBKA 3L2VA 4CGDA 1WLJA 4LF4K 2YHWA 1T3VA 4PKHA 4ZTFA 4JK8A 1X9WA 1IBLK 4DV7K 4DR6K 4RW4A 4IWVA 3T1AA 1NBWA 5M1PA 1X9JA 4JLHA 4K41A 2YNIA 3CETA 3LP3A 1GLEG 3PX6A 3TI0A 2EHGA 3EO3A 1U47A 1NG9A 1QSSA 3EY1A 2IC3A 2GUPA 5AQZA 1RBUA 1SV5A 2V7ZA 1ZBIA 3V6DA 4B9TA 3L8BA 4FLXA 1ATNA 3L2UA 3ENBA 1EXQA 5DM6L 5B8HA 2GELA 4CECA 2CGKA 4FZXC 3QIOA 2X6NA 1HQEA 4NLBA 4FLUA 4NLCA 3TTCA 3KLIA 3PIPL 1VK0A 3DAWA 3HM9A 2VQEK 4AHTA 3ID6A 3NBPA 4FK2A 2G8HA 3DXKA 2HSTA 5C2FA 1RBVA 3AVAA 1NGAA 4CHNA 3CCUN 1RT6A 3CJ9A 1FK9A 3PX4A 3AO5A 4BE0A 3THXB 2QM1A 5K14A 1IG9A 4NB4A 4W5NA 2AP1A 3PO5A 4XEIA 4DR4K 3LAKA 2ITGA 3K57A 3AGRA 3DM2A 4B1UB 1C0TA 1YJWN 1BI4A 1FW6A 1NGBA 4DQ8A 3CJ1A 4GV3A 3QINA 4JKBA 1J6ZA 3O4NA 4C23A 1LW0A 3FZFA 4IXCA 1HNIA 4CEEA 4C8KA 3VQQA 1RDWX 3L3UA 4JNEA 2GEMA 4A5BA 3HM8A 3M3ZA 1TK5A 2JWLA 4B3RK 4DSEA 3IRXA 4DWIA 3KLHA 2HHHK 2JWKA 1IKVA 3A0IX 3OYAA 4A2BA 2P9IB 4LSNA 5E84A 4QOZB 3C0BA 3P4IA 5C24A 4I2PA 1WBBA 1S1VA 3VQAA 4Y1DA 4JS4A 1VQPN 3B6PA 4AHUA 4CK3A 1UWBA 2UU9K 1RNHA 4MQ3A 1HYVA 3A5NC 4DS5A 4CZLA 4KI6A 2E2NA 2HHSA 3ZSOA 1I94K 4V19S 1RTDA 4CVNE 3CC4N 3HSCA 3L4QA 1LAVA 4IFYA 3IS9A 4YOUA 4B9NA 2O8FA 3OBWA 1LWEA 2O8CB 3HI0A 4DFPA 3SPZA 3J8AA 1C1CA 4RG8A 1HRHA 1RDUA 4FWLA 3F73A 4JK9A 1GOCA 4EZ9A 4FJLA 4LF8K 1QQOA 3OJSA 4WFBL 4H0YB 2W6KA 1A5WA 1X9MA 3RMDA 3D2FA 1XHXA 4FWNA 1KAXA 3FZKA 2VCPA 1ESVA 4H0VB 1YT3A 5MLCQ 3EZWA 4W5QA 1UA0A 1KC8O 4JYAK 1EWQA 5M1OA 3KK1A 1C1BA 4DV3K 4CEOA 2HHWA 3SQ2A 4ZHRA 2Q2RA 4FM1A 1QS4A 4CF8A 4MLHA 4E1NA 1ATSA 3LM2A 4B9LA 4PUOA 3ZT4A 1BO5O 4YFUA 1IG8A 3C6HA 3FFKB 5AQHA 1VSMA 4KHUA 1IV0A 3OYLA 2GUIA 1NK8A 4F2SA 3ZSWA 4YOTA 3AVLA 3UKUA 5AQOA 4CZMA 1G15A 2W40A 4DV4K 1S5JA 1NGIA 2HVHA 2A41A 3S9HA 3O08A 3CM5A 4DR1K 2OYQA 1S3XA 2E6MA 1FXXA 3NCIA 2P9PA 4QS7A 3VGLA 4I6MB 4KFBA 4Z4FA 4JI2K 2KTQA 4CJTA 4OKKA 3H3NO 3VEXA 3O1BA 5BPNA 3W0LA 2FLOA 4KREA 2VWBA 3NF8A 4FZYA 2OPRA 4KV8A 3FZMA 3SQ1A 3ZCMA 2LSNA 3VF2A 4HUEA 4FVUA 3VEOA 4DMNA 5EY4A 2BH1A 3OW2M 1DGKN 4JEPA 4W5OA 2KZMA 3TSUA 3IUCA 4EP4A 1NGDA 1CZ9A 1BISA 5TKYA 1DTTA 1LW2A 1JXEA 3VTIA 1BCOA 1N33K 4KB1A 4OJRA 2NRHA 2CH5A 4KPYA 4H0PA 1NJWA 1K8KA 1HNWK 3OJUA 3NF6A 4AH9A 4BDYA 3KZBA 1ASVA 2Z1HA 1EO1A 4BR5A 5C2DA 3CCRN 3QMLA 4BQZA 5H1SQ 1YIJN 2E5LK 2AA4A 4XH5A 4BRLA 1J5EK 3IMXA 2DFHA 4B1XB 3THVA 4M42A 2WBNA 1L3UA 4H0XB 1QVFM 3A5OC 4CJWA 3ZETB 3CC2N 3P39A 4CJRA 2O8DB 3VEWA 3CMEN 3RR7A 2O8EB 5TKWA 4KH5A 1LCUA 4J8FA 1U45A 3F2KA 5ELZA 3OTOK 1D9DA 3ID8A 5HL7L 3VGMA 5KGWA 1TAUA 3G10A 3L2WA 3L2QA 4Z4HA 2QWNA 1BCMA 3HP6A 2F9TA 4DFJA 3P5JA 1QE1A 4RW8A 3F9KA 5EX5A 4B9SA 3NGYA 4BRCA 3LM9A 4ILHA 4CHPA 5M1NA 5LJVA 4RW9A 4OLAA 1HYZA 3NGIA 5JS1A 5SZTA 4FLTA 3D2EA 4CGHA 1WSFA 1NM1A 2FSKA 1K6YA 1X3NA 2IAJA 4IJNA 4JI5K 2Q97A 4Z0UA 4DV5K 2E2QA 4EAHD 3I0SA 4X66K 4CZFA 4FW2A 5AQWA 4H5RA 5F0XA 2VYPA 3AARA 3CQYA 2I7NA 3O9UA 3NH0A 4O4GA 1VAZA 1ZBFA 3W3DA 1C0MA 3HT3A 3RMAA 3HBTA 1VQ5N 1GLJO 5AR0A 4DG1A 3WNHA 1WSGA 4OGCA 3ZT1A 2IOCA 4LF6K 2A42A 3SJHA 3KTQA 5CY4A 4NCAA 3L4IA 4IO9L 2UXDK 5GAHP 1YVNA 4E1JA 3JXUA 3M6GA 2HHVA 4ILJA 1Q86O 1JJ2M 3CERA 3F9MA 4KRFA 4KTQA 1S1XA 1CZAN 3SUQA 4WYBA 4CESA 1IKWA 3CPWM 3BF1A 1JCFA 1KCFA 4CEQA 2QW9A 3EKSA 2F4VK 1TL3A 1Y64A 1RGIA 5F1XA 4DV0K 1KD1O 4W5TA 1T7PA 3R8EA 1HNXK 1UOCA 3QEPA 2D4WA 4LFAK 4DQQA 3DLHA 1YJ9N 3MMVA 2Z1JA 4MLEA 3JAMO 2YCHA 3CJAA 3T3FA 2W6LA 4CF1A 4KTZA 2WOMA 4EHTA 5SWMA 2P9UA 2VGNA 2HF3A 4MO4A 3QDKA 1R59O 5KI6A 3QB0A 4M45A 3C6AA 2RF2A 3ULDA 4K0KK 3MN5A 3PX0A 2OPQA 1BA0A 4M3YA 4LY7A 4HTUA 4NXMK 3MXJA 1XQSC 2BUPA 5GAGP 4J2EA 3BEXA 2YV0X 2XHBA 1KAYA 1WSHA 4BREA 3KIOA 3CI5A 4H4MA 4CEZA 1B9DA 3NDKA 5C10A 5AZJB 1D5AA 5CZ2A 5FLXO 3MCAB 2W42A 3LP0A 3QEIA 3MX2A 3O9TA 4FWSA 3ASMA 4ELTA 1TUYA 2P1JA 3Q7CA 4FWPA 1RDCA 1KFDA 4DCHA 3T1HK 1VHXA 3O6WA 2ZJQL 3CCMN 2VWJA 3DLBA 5AFUH 4LC9B 1VQNN 1RILA 1RTIA 3G6EN 3TABA 3DYAA 3IFRA 4CK1A 4CF2A 1C0UA 3OBYA 1EWRA 2D1KA 2G8FA 2Q3SA 4A62A 5I3UA 3ZSXA 4BR2A 1MWKA 3SAGA 2WTUA 5JVHL 1TL1A 4LF5K 4DTNA 3FFIA 5I9EB 4KHYA 2PY5A 1OH6A 4CJKA 3I8BA 3KD5E 4KHQA 2ZQBA 1QVGM 4CCHA 3AVJA 3I0RA 1W0HA 5AQMA 5FRMA 4WQ4A 3VGKA 2ZJPL 3VEZA 1TK8A 3VQCA 3UKRA 4O5BA 1FKPA 4CIEA 3UE5A 1B9FA 1M1KO 1VSDA 4BDPA 3LALA 3NFAA 3CG7A 1NGCA 4B8AB 4B9VA 3QERA 2Z1GA 2NRWA 4CJUA 3VQ8A 3SLCA 2HNDA 1NK7A 1HR0K 5T7BA 3SCXA 1K73O 3RRGA 3SZ2A 1JL2A 3I8DA 4UY8O 3O3FA 3WXIA 4N76A 1TKDA 1OVYA 3WNGA 3QFUA 4O0IA 4FJ5A 3G4SN 2P9SB 3CFPA 3LWLA 4BE2A 5J2QA 3KVGA 2AJQA 4DQPA 3PV8A 4DR5K 4GNIA 1JLCA 1KFSA 3MEEA 1W9HA 3SQ4A 4CJ3A 1N36K 1SQKA 4CEBA 1S22A 5KGXA 3RRHA 2O8BB 1HKGA 2D0OA 3IAYA 2QI2A 1EKEA 1DEJA 3CCEN 4X65K 1RFQA 3KHYA 2YHXA 4WQ4C 1S6QA 3V1QA 4JKAA 1T05A 1E4FT 3TSQA 1OVQA 4E7HA 4BACA 3ULEA 2FBYA 3CCQN 4LFCK 3NH1A 3CCLN 1J9AA 3M1FA 4IOXA 1BIZA 5HRPA 2Y1JA 1QHTA 2BGGA 1ILYA 3KD1E 2ZD1A 3CC7N 3RMBA 3TTDA 2HNYA 4FWRA 3NVKA 3SMSA 5FRNA 4DSFA 1U48A 5BREA 2QTDA 3VEYA 3I33A 4PL8A 4CERA 2XY5A 4O8UA 3TR8A 1YXQA 3TTFA 2HF4A 3CMAN 5AQRA 5C12A 4B08A 1K8AO 4JI6K 5FPDA 4M41A 4DF8A 3A8YA 3ZSQA 1NK5A 4FWMA 1U2VB 2UUCK 1TV6A 3SQ0A 4BWMA 3AVGA 3VENA 4JD2B 3HPOA 3GOIA 4B1WB 3CM6A 4H5TA 2QEXN 4IDKA 2PYLA 4E7KA 4FK4A 5HRRA 5AFUA 4I9QA 1SKRA 4BRPA 1VQ9N 1TVRA 5J1EA 1XWLA 2E1YA 3OHRA 4A59A 4QAGA 3THWB 1Y97A 3MAQA 1HLUA 4IG3A 4H8KA 3FE1A 1TK0A 3ZX0A 1N5YA 3HVRA 4F3TA 5IWAK 4TSXA 4DR7K 4CGJA 3GL1A 4IBNA 4CHQA 4CZJA 3H1QA 3C7NB 1GLLO 3MN7A 1XC9A 3HZ6A 2QXLA 2ZGZA 4CI6A 5AQYA 4CZKA 4B9UA 4FSVA 1WB9A 4BE1A 3SUPA 4JHDA 3T19A 5C15A 3UIQA 3R6MA 4LFBK 1KLMA 3EE8A 3HTVA 2HHUA 4JRPA 3OYBA 4FCYA 4Z4IA 3HOTA 1ZC6A 1ZXOA 3WXMB 4DV6K 4M3TA 1P90A 1ZYQA 1JCEA 1WSJA 3J81O 4OGEA 3K5MA 3M8RA 3TPQA 1KQSM 4NCGA 3QIPA 4BC4A 4DS4A 3MK6A 2P5OA 4CJVA 4BVPA 4HHTA 2P9KA 2D0PA 3AVKA 4CF9A 2YKMA 2B5JA 1JKHA 3QEWA 4CBUA 3TAQA 1RT1A 2F7TA 3FGUA 4XIUA 3J7YP 5M1QA 3ENOA 5GADP 2KLAA 4C8OA 4CZGA 4IFEA 4DUZK 4B1ZA 3HO1A 3O4WA 1IBKK 1WOQA 2RN2A 4KH6A 5AQJA 1T6CA 4GW6A 2EWSA 2R7YA 4CJEA 3AVMA 4EFHA 1XUPO 5HP1A 1WN7A 3K2PA 4PWDA 1QHAA 3VQ7A 1O13A 1OH7A 2E4LA 3CD6N 4Q5VA 5EVZA 4FWKA 1QQCA 3DRRA 4E19A 1BGXT 3ZSZA 2BE2A 3V1RA 2QWMA 3OYJA 4BRMA 3SI6A 2HMIA 1S9GA 4FW1A 3WXLA 3GG4A 3ZT2A 3HL8A 2H3GX 2W41A 1ITGA 1UA1A 4B3MK 1TYQB 4IG0A 4JN4A 1RDBA 4QS8A 4FJNA 3O4QA 1VQON 1VQMN 2CGLA 5AQGA 3ZEUB 1CLQA 1S1WA 2Q31A 5FDLA 4CF0A 3BF3A 4CEFA 3C6UA 4J2DA 4GKJK 3K9KA 1F21A 4KHNA 2OZSA 1KRPA 3EE9A 2YJFA 4CHZA 1Q9XA 2YHYA 4B3SK 4DR2K 1EQYA 1VQKN 2OZMA 4BR4A 4CJPA 4BDZA 3QICA 3IDHA 3E66A 3MEGA 4WQ5C 1NMNA 4Y1CA 1VQ8N 2B4JA 2YHBA 3O5BA 1NKBA 4BRFA 4FOEA 3PLAA 4CZEA 1H1VA 3BGRA 2A3ZA 3LZIA 5CR4A 4LH5A 4DSIA 4BRAA 5JMVA 1NK6A 3C94A 3WEEB 3D7EO 4CHYA 4ISFA 4G9ZA 4DTRA 3AA3A 3DXMB 5KPRA 2P51A 4DTPA 4XH4A 2KFNA 3OYEA 1ATRA 1QTMA 3FZHA 3RSEB 3WUHA 5E41A 4YDUA 4CGIA 3Q7BA 4RTFD 4FL9A 4U7BA 3CYMA 2ZM6K 4E0DA 3SBTA 3OYCA 5KPZA 3BUZB 4BG8A 3VEVA 1RCHA 1MU2A 3O9RA 1NK9A 4HCBA 1VRUA 2HMPA 5FPNA 1S1UA 4FJ7A 3KLFA 4F3OA 3O9SA 4Y0WA 2CGJA 4FYDA 3RWUA 5AZIB 1T03A 2GWJA 2OPPA 3K9JA 2PFUA 4HUGA 2Q1NA 1Q7YO 3L3VA 4AM6A 4K42A 4IO8A 2PAVA 2X74A 3OY9A 2NRXA 3OYHA 3QESA 4JK7A 3VETA 4BRDA 5BN8A 3THYA 3TARA 4DTMA 5GINA 1ZBHA 3K5NA 3E9LA 3D45A 2QA4N 3I55N 1VSJA 5JLHA 2DFFA 4CFCA 4DQSA 4CFDA 3DLKA 1HNVA 3VQPA 3DMJA 3ATVA 3K5LA 1BA1A 1HJOA 4CIGA 5CYQA 5HOOA 3ZX3A 1TKXA 2E1ZA 4JI0K 3S3OA 2P5GA 3VTHA 4KI4A 2A1SA 2QWPA 1NNEA 4YDUC 3LDQA 3TAMA 3BY5A 2OTLN 2HBJA 4JI1K 4IFVA 4RCHA 3HP9A 4YHHK 1HQUA 1Z6RA 4EZ6A 4DFMA 1K9MO 5DMRA 2D0BA 3QFPA 2Q36A 2EX3A 3C65A 3E9OA 3DLLL 3V1OA 3DOKA 3VESA 3THXA 4JV5K 1JCGA 4FJXA 1R0AA 3THWA 3ZYYX 1T8EA 1NLVA 5J2PA 3P1GA 1XMOK 1L3SA 2GTDA 4C1NI 4O44A 3MWTA 1WSIA 3T69A 3GDQA 2FSNA 2ZJRL 2VWKA 4AHRA 1XMQK 1YITN 4RW7A 4GV9A 4X64K 2Q0RA 5LJWA 2WUSA 1RT3A 4IZ9A 4ID1A 2ZWHA 2YJEA 1BL3A 3OYIA 3MN6A 1VSEA 3NF9A 2DFEA 1LOTB 3AA4A 3PSFA 3D6RA 3KWIA 4M3UA 3LDPA 4DTSA 2P9IA 1BI4B 1W97L 4CZIA 5AQNA 4OPJA 3NMUA 5LY3A 4B3OA 5M1KA 1U6ZA 3CCVN 3KLEA 4CEAA 1FKOA 1N34K 4HTLA 3AVIA 2HHXA 4OKEA 2I5JA 2WFBA 2UYTA 4FM2A 3R3LA 4JKEA 3S41A 3G25A 1JLQA 4ELUA 2RPIA 3DLRA 1VQ6N 4CJQA 1Z26A 4NCBA 4FM0A 4BWJA 1NGHA 4AHSA 3HK2A 2O8CA 5CYMA 4CJFA 3U3YA 5GAEP 3L0QA 1MDUB 1J53A 2YX6A 2V51B 2NZTA 1QZ5A 4DHYA 4IEEA 3M8PA 3GE1A 3PO4A 4N5SA 4R79A 5BRDA 4ZTJA 3MXIA 1BDGA 1TYQA 4KTWA 4A5AA 2ZE2A 4PL7A 3TANA 3AAPA 4FJHA 4JAXA 2YKNA 2BDPA 4NYFA 5AQPA 3WXKA 2VG5A 3BZKA 1YHQN 1SL1A 3L6QA 2GWKA 4DSKA 3AO4A 5AQXA 3AA5X 4B8CA 1IH7A 4OX9K 1NGFA 4JKCA 5AQKA 1A5VA 4BVOA 3BDPA 3QEVA 3TWHA 3OYDA 3QBXA 1LWCA 5BR9A 1HUXA 4FJIA 1I3AA 3AVNA 2P9LB 4DTJA 4MDBA 2QWLA 3OYFA 4H5NA 3D0PA 4DQRA 5AQUA 3MWPA 3NF7A 4JI7K 5CE3A 2P9NB 1KVAA 1NOYA 1ZBLA 1NGGA 3VQ9A 4E7IA 4M3ZA 4MDAA 1JXBA 2A1RA 4JKDA 1C1AA 5C42A 3G0ZA 4ICLA 3ZSVA 3K59A 2G8WA 3OS1A 4DSJA 1P8ZA 4BGAA 4BC2A 4EP5A 2QKKA 3LANA 1B92A 1U49A 4XH1A 1RBTA 4I6MA 2NRZA 4I7FA 3ENHA 3HYFA 1WUAA 1VSIA 4AHCA 3O80A 3VQ5A 4PY5A 4BG9A 3KK2A 1V4SA 5JS2A 4E7JA 4B9MA 5FPEA 4YOVA 3UKUB 4O0JA 3RSEA 4JI3K 4JKHA 4JKGB 1JLFA 3DOLA 4IKFA 4YY3K 4KHPK 4DB3A 4CBXA 4PHTX 4DSLA 1GLFO 3V81A 2O4GA 2E20A 3OYMA 2IVOA 3U4LA 4BR7A 4FJ9A 3VN5A 5AQLA 3ZSYA 3PUFA 3NGZA 1N32K 3H6EA 5AZIA 1BOTO 1OH5A 2X6SA 4H5WA 3OVNA 2ASPA 3DLGA 4E3SA 3O3GA 5AQQA 3SAFA 4I2QA 3BP8A 3SNNA 3TAGA 3CQXA 4NYNA 1C0GA 5AQSA 4OVLA 4FJ8A 4CJ5A 4CIFA 5FROA 3O9QA 1SAZA 2NUBA 3ZETA 2O8DA 2O8EA 3J80O 1K8KB 1YF5L 5AQVA 2JLEA 1JL1A 3SK3A 4A61A 4W5RA 1SS6A 4ILGB 2HBLA 1E4GT 3C95A 5KPTA 1DKGD 3EL2A 1X3MA 4WFNL 4K8ZA 5HBMA 3U9ZA 1VSHA 5AQFA 1GLAG 3OYNA 4CZHA 1NWKA 1CXUA 2RE2A 4DR3K 4F2RA 4OKJA 5LMUK 3V4IA 5JICA 1TKTA 3J7ZO 1DTQA 1I39A 1VQLN 4Z4CA 1QSLA 3TAFA 3QLHA 3R9PA 3JYTA 4OLBA 4OPAA 4AHVA 5I42A 2F8TA 3OS0A 3AVHA 1M90O 3HOSA 4DTXA 1GOAA 1RT7A 3I56N 2UUBK 3VQEA 4AM7A 1L3VA 3HJFA 3D2EB 3DLEA 1W7AA 2KKZA 5JLFA 4QCLA 5C25A 3K5OA 5KQ8A 2OANA 1IKYA 5BRFA 3KK7A 1T44A 1Q8IA 2A6AA 3CFOA 1G99A 2I7PA 2PBDA 1XNRK 3PY8A 2YNGA 1DT9A 3AVFA 3MDQA 4FWOA 5CZ1A 4DQIA 4CD3A 1L3TA 2NRVA 4H0OA 4N56A 3LPTA 1W2BM 2Z1IA 5ADXH 2IDOA 4IEIA 3VOVA 3SUOA 1RT5A 4KB0A 1XC3A 3HVTA 2XY7A 3LAMA 4B3TK 3H1VX 4KHSA 1Q9YA 4BY9C 1U4BA 4GY2B 4M3WA 2D5RA 4E7LA 4CFBA 4YOWA 3FR0A 5EXWA 3VQ6A 3V9SA 2XO7A 5HLFA 2JGUA 2ASOA 2J4RA 3H08A 2E2PA 3KK3A 2QWQA 4WE1A 4YOYA 4J2BA 1RT4A 2VQFK 1YUWA 1O1WA 3VQDA 2OTJN 3QEXA 4A2AA 5KRSA 1KLNA 4WQ5A 1GOBA 2XY8A 3AO3A 1N8RO 1YVUA 2UXBK 5EU7A 1DLOA 4CK2A 1HMVA 1MA9B 3LP2A 4DLEA 1VSKA 3C6TA 4WCEL 3KLGA 1HJRA 4LF9K 2P9UB 4M7XA 1V4TA 5AZJA 4PQUA 4FJGA 2HVIA 5D3GA 1HNZK 2QWOA 3VF6A 3L2RA 1XNQK 4H03B 2NRRA 4FPBA 4M3XA 1CZBA 1SL0A 2WC9A 4K8XA 5KRTA 3QO9A 1TUUA 3ZX2A 1RBRA 1YTAA 3NAEA 4PKIA 3WNEA 2E6LA 5DK5A 4N41A 5KQDA 3AGKA 1BUPA 1QQNA 4FO0A 3QNOA 4Z4GA 3AVBA 3WT0A 2V52B 4KO0A 1XHZA 2KQ2A 3IKMA 1VSFA 2OA8A 2GX9A 4HUFA 2E88A 3CJBA 3MN9A 4CBWA 4DU4A 3ISNC 1NU0A 3CPEA 2P9LA 1VRTA 2DPNA 2BANA 4BRNA 3B8AX 1C6VA 2B6AA 2HHTA 5AJ3K 2P9NA 4IJAA 3N4PA 4JRQA 4B9QA 3E1YA 1KAZA 3V9XA 4BRHA 4GV6A 2KZZA 3HXMA 4BGBA 1TAQA 3M8SA 1S1TA 2YI1A 1BG3A 1IBMK 3EZ5A 4J2AA 2IIRA 1WBDA 4GKKK 1LV5A 2ATQA 3P83D 2FBXA 5LL6Z 2OPSA 3OS2A 3ATUA 3TU5A 1Q82O 2UXCK 5BN9A 1BU6O 4H4OA 3NH2A 2A40A 4CD1A 3HPGA 4LD0A 3CXCM 1KTQA 2BTFA 1KVBA 1TGOA 1JLAA 2VG7A 4IDHA 3VA3A 5GIPA 4LF7K 4JKGA 2GBZA 3N4QA 4QS9A 2D0CA 1ASWA 3U3GA 4CJ4A 2KFZA 3PSIA 3HPHA 4B1VA 4LSLA 3UKRB 3TSPA 3V9WA 4F4KA 3H3OB 4WF9L 4GMJB 1SKWA 3VQ4A 3SAHA 5J2MA 4RWTA 4I9LA 2P9SA 4JI4K 1NK4A 4FK0A 3LL3A 1X1PA 5ADXA 3LDOA 2F96A 3WXJA 1RDDA 5GIOA 4O5FA 2YNHA 1X9SA 3MX5A 3AY9A 4FXDA 3AV9A 2DTUA 1RTHA 3G71N 1CXQA 4KKOA 1NK0A 3LDNA 3QNNA 4LH4A 3DRSA 4FWQA 4DTOA 5AQIA 4E89A 2O8BA 4Q0BA 1E3MA 4DV2K 3CJCA 1IO2A 3NHGA 1HKBA 4YNQA 3EEQA 3F5TA 3U9DA 1Q81O 1BIUA 4FJKA 3EN9A 3EKUA 2FSJA 2NLXA 3ZLJA 3MEDA 4KAZA 3UB5A 1S6PA 3S3NA 1U04A 4GVEA 2FF3B 4DTUA 3MECA 3VPZA 4DLGA 4PKGA 3V9ZA 4OO1J 2YNFA 5FPMA 4K43A 5J2NA 3LDSA 3ALYA 5BPMA 3KKSA 1BQMA 4DU1A 4CE9A 2E2OA 1NKCA 4EIAA 1YTUA 3V9UA 1SUQA 2XY6A 3S3MA 4C8LA 2YHAA 4BRGA 1RDAA 3ULEB 1SL2A 3ZT0A 2X78A 3DJCA 3VMFB 2FC0A 3AAQA 2QK9A 1GLDG 1UAXA 4MFBA 2HW3A 3VF4A 4CJSA 4ID5A 1U2VA 2QWRA 5BPLA 1J5OA 4KBOA 4KHWA 4R5PA 4M63C 4BRKA 4JD2A 2G8KA 1QZ6A 4BR9A 1ZBUA 4JS5A 2F9WA 4KH4A 4DUYK 1HPZA 4CFAA 3DI6A 3AO2A 4OPHA 1KSPA 3LP1A 2ZF5O 4FPAA 3P38A 4YOXA 4FJMA 3MCPA 5EOYA 3VQBA 3M5RA 4DF4A 2QXFA 4BROA 4H0TB 2UUAK 2OCEA 3LDLA 1N6QA 4N47A 3HRGA 1REVA 3C7NA 1HPMA 4OPKA 1BWFO 3DXKB 3T1YK 4A57A 1ASUA 3OA9A 1T6DA 3E01A 1QSYA 1D9FA 4O8KA 4AILC 1YAGA 5C0YA 4Z94A 1SKSA 4FVMA 2HBMA 2Q0UA 4CJ7A 5IT9O 3SV3A 1NJYA 4DKWA 1TKZA 2FXUA 4F9OA 1VQ7N 4EHUA 1HKCA 3LZJA 3KWGA 4ELVA 3TAPA 2ITMA 4E1MA 4JHDB 3CCJN 3WNFA 4BRIA 3SYZA 3T7ZA 2DY4A 2HHQA 3EYZA 1RT2A 3R1XA 3K0SA 1ZBSA 4HWIA 3SBGA 3WQTA 3BZCA 4HVJA 1NMDA 4M3RA 1OH8A 4CJLA 4FOIA 3RTVA 2FBVA 1A5XA 4BC5A 2P9KB 3O8MA 4B1YB 1JLGA 3RMCA 4CGGA 3RVCA 1QQMA 1NJZA 1SZ2A 4IOAL 2VG6A 1J54A 1WNSA 5JVGL 1XI1A 1EP4A 3O1WA 4UQGA 2GV9A 3CIPA 4F8RA 1LWFA 1Q18A 4C8MA 4CW7B 3MXMA 3VA0A 3CJ7A 4IOCL 1D8YA 1KXPA 2E8AA 3DRPA 3M8QA 3A2FA 4FLZA 4NO7A 2O8FB 1EX4A 3ZT3A 2KHOA 1JLEA 5CHIA 3ZEUA 4AQYK 2WONA 4JI8K 4AF1A 4FLVA 4DFKA 3FZLA 3LWMA 3CQ8A 3QETA 1Z05A 3NE6A 1EETA 2PYJA 1JLBA 3OYKA 4G1QA 2A5XA 1C0FA 2CH6A 2ASMA 4FZZA 4U67L 3K58A 1S72N 3SMPA 3O3HA 2IVPA 3D2FB 2KW4A 3AVCA 4CEDA 4L3QA 2F8SA 1KVCA 1BQNA 2G8UA 3VERA 4H5VA 2XRIA 4K25A 3DWLA 4HCCA 4NXNK 4PA1A 2HB5A 1S9EA 3U8XA 3RR8A 3E9PA 5LMNK 3A5MC 4CGFA 4ISEA 3KKRA 5BR8K 3QBWA 2ZGYA 3WEEA 2NRTA 1OKJA 2G8VA 5HRSA 1HX1A 3GBTA 3NVMA 1YJNN 3DXMA 4MO5A 5A2QO 1NJIO 2RKIA 4L8RB 1NOZA 2HNZA 1GLBG 4WFAL 3FLCO 5F2RA 1LAWA 3H45C 5DM7L 4BQLA 2FF6A 2RHKA 4BC3A 5M1FA 2Y1IA 2NNWA 3IG1A 2PZSA 2P9PB 2ETJA 3ITHA 3OYGA 5HRNA 4O55A 3AO1A 1YI2N 3CHWA 3TAEA 3JS6A 2QKBA 2FBTA 2O4IA 3SUNA 5AQTA 1VSLA 1WAFA 3KJVA 2D0AA 5E26A
chains in the Genus database with same CATH topology
2J4RA 3O9RA 1YJ9N 2E2PA 5BRHA 3CF5L 3MMVA 2QWQA 4MLEA 4YOYA 2HMPA 2YCHA 3CJAA 5FPNA 1MWMA 2VGMA 1YUWA 2OTJN 3O9SA 4ISGA 4Y0WA 4A2AA 2CGJA 1IJJA 4WQ5A 4C1NK 4EHTA 1N8RO 2P9UA 5AZIB 3H46O 2VGNA 2GWJA 2HF3A 2HOEA 4MO4A 4CI6A 3K9JA 3QDKA 1MA9B 1R59O 2PFUA 4WCEL 2Q1NA 3QB0A 1Q7YO 4AM6A 3C6AA 4K42A 4IO8A 2PAVA 2NRXA 2V7YA 2P9UB 4JK7A 4BRQA 3MN5A 3VETA 3UKUB 1BA0A 4M7XA 1D4XA 4BRDA 1V4TA 5BN8A 1VQ4N 1XQSC 2BUPA 5GAGP 5AZJA 2IVNA 4JKFA 3BEXA 5GINA 1KAYA 1GLCG 3PIOL 4BREA 2QWOA 4M7YA 3E9LA 3VF6A 3P31A 3CI5A 4YORA 3CCSN 2QA4N 4BR0A 1NGJA 4H03B 3I55N 2NRRA 5JLHA 4FPBA 3WQUA 2WC9A 5C10A 1NGEA 3A5LC 5AZJB 2HBKA 3ATVA 1BA1A 1TUUA 2YHWA 1T3VA 4PKHA 1HJOA 3MCAB 3ZX2A 4JK8A 4PKIA 3MX2A 5HOOA 3O9TA 5KQDA 4FWSA 3AGKA 3ZX3A 1BUPA 1QQNA 4FO0A 1TUYA 3Q7CA 4FWPA 4IWVA 2E1ZA 3VGLA 4DCHA 1NBWA 3WT0A 3VTHA 2ZJQL 2V52B 3O6WA 5M1PA 1X9JA 4K41A 3IKMA 2QWPA 2GX9A 4YDUC 3CETA 2E88A 3LDQA 3CCMN 3CJBA 3MN9A 5AFUH 4CBWA 4LC9B 1VQNN 1GLEG 3CPEA 3G6EN 2P9LA 3EO3A 2DPNA 2OTLN 3IFRA 4BRNA 2HBJA 3B8AX 2GUPA 3OBYA 5AQZA 2V7ZA 2D1KA 2P9NA 4RCHA 4IJAA 3N4PA 4A62A 4B9QA 1ATNA 3E1YA 1KAZA 1Z6RA 3ENBA 4BRHA 1K9MO 5DM6L 5B8HA 4GV6A 2GELA 2CGKA 3QFPA 4BGBA 2Q36A 4BR2A 1MWKA 2YI1A 1BG3A 3C65A 3E9OA 3SAGA 3DLLL 4NLBA 5JVHL 2IIRA 4NLCA 3TTCA 5I9EB 3VESA 3I8BA 3PIPL 1JCGA 3ATUA 3ZYYX 1QVGM 3DAWA 3TU5A 1NLVA 1Q82O 3ID6A 2GTDA 4C1NI 3MWTA 5AQMA 3DXKA 4WQ4A 2HSTA 1BU6O 5BN9A 3T69A 3GDQA 5C2FA 2FSNA 1NGAA 3CCUN 2ZJRL 3CJ9A 3VGKA 2A40A 2ZJPL 1YITN 4CD1A 2QM1A 3CXCM 4NB4A 3VEZA 2AP1A 2BTFA 4XEIA 3UKRA 4IDHA 4GV9A 5GIPA 4JKGA 3AGRA 3N4QA 3UE5A 2Q0RA 4QS9A 1M1KO 4B1UB 5LJWA 2WUSA 4IZ9A 1YJWN 1NGBA 2ZWHA 4DQ8A 2YJEA 3CJ1A 1NGCA 4B1VA 4GV3A 3MN6A 4JKBA 1J6ZA 3UKRB 4C23A 3TSPA 1LOTB 3H3OB 2NRWA 3D6RA 3FZFA 3KWIA 4IXCA 4WF9L 3SLCA 1RDWX 3SAHA 3LDPA 4RWTA 4JNEA 2P9IA 1W97L 2GEMA 4A5BA 4CZIA 3HM8A 3M3ZA 2P9SA 5AQNA 1K73O 2JWLA 3LL3A 5ADXA 3NMUA 3LDOA 4UY8O 5LY3A 3WXJA 5M1KA 1U6ZA 3CCVN 5GIOA 3WXIA 4O5FA 1OVYA 2JWKA 3A0IX 4HTLA 3MX5A 3AY9A 4A2BA 2P9IB 3QFUA 5E84A 3C0BA 3G4SN 2P9SB 3P4IA 3G71N 2WFBA 2UYTA 3KVGA 3LDNA 3R3LA 4JKEA 4FWQA 5AQIA 3S41A 4GNIA 3G25A 1VQ6N 1VQPN 3CJCA 1HKBA 3A5NC 3F5TA 3U9DA 1Q81O 1NGHA 4CZLA 3EN9A 3EKUA 1SQKA 2FSJA 2E2NA 2NLXA 1S22A 5GAEP 3L0QA 3UB5A 1HKGA 2D0OA 3CC4N 1MDUB 3HSCA 2YX6A 3L4QA 4GVEA 2V51B 2QI2A 2FF3B 1DEJA 4YOUA 3VPZA 2NZTA 4CZKA 3CCEN 4PKGA 1QZ5A 1RFQA 3KHYA 3OBWA 2YHXA 4IEEA 4DHYA 4WQ4C 3GE1A 4JKAA 4OO1J 1E4FT 5FPMA 4K43A 5BRDA 3TSQA 3HI0A 4R79A 5BPMA 3J8AA 3ULEA 3CCQN 1BDGA 1RDUA 1TYQA 2E2OA 4A5AA 4EIAA 4FWLA 3CCLN 4JK9A 4PL7A 3AAPA 3M1FA 4IOXA 4JAXA 5AQPA 3WXKA 1QQOA 4BRGA 4WFBL 1ILYA 3ULEB 3CC7N 1YHQN 3DJCA 3L6QA 3TTDA 4H0YB 3VMFB 2GWKA 4FWRA 3AAQA 3NVKA 1GLDG 5AQXA 3D2FA 4FWNA 3SMSA 1KAXA 5BREA 3VF4A 2QTDA 1NGFA 3FZKA 4JKCA 3I33A 4PL8A 2VCPA 1ESVA 1U2VA 2QWRA 4H0VB 5AQKA 4BVOA 5BPLA 5MLCQ 4O8UA 3QBXA 4KBOA 5BR9A 1HUXA 3EZWA 4M63C 4BRKA 1YXQA 4JD2A 3TTFA 1KC8O 2HF4A 2P9LB 3CMAN 1QZ6A 4MDBA 5AQRA 2QWLA 4BR9A 5M1OA 4H5NA 5C12A 1K8AO 5FPDA 3A8YA 5AQUA 2F9WA 3MWPA 4KH4A 5CE3A 4FWMA 1U2VB 2P9NB 2Q2RA 3VEYA 3VENA 1NGGA 4JD2B 4MLHA 3GOIA 4OPHA 4B1WB 2QEXN 4H5TA 2ZF5O 4FPAA 1ATSA 4MDAA 3P38A 4YOXA 3MCPA 3LM2A 5EOYA 5AFUA 4JKDA 3M5RA 1BO5O 4BRPA 1VQ9N 4BROA 4H0TB 1IG8A 3C6HA 3FFKB 5AQHA 2E1YA 1P8ZA 3OHRA 4BGAA 3LDLA 4BC2A 4A59A 4YOTA 3HRGA 3C7NA 1HPMA 3UKUA 4XH1A 1HLUA 4I6MA 2NRZA 3ENHA 3FE1A 5AQOA 1BWFO 1WUAA 3DXKB 4CZMA 2W40A 4A57A 3ZX0A 3O80A 3OA9A 1NGIA 1T6DA 4BG9A 2A41A 1V4SA 4O8KA 3GL1A 3O08A 4CZJA 1YAGA 5C0YA 3H1QA 5FPEA 4YOVA 1S3XA 3C7NB 1GLLO 4Z94A 3MN7A 2P9PA 2QXLA 2ZGZA 3HZ6A 4QS7A 4I6MB 5AQYA 2HBMA 2Q0UA 4FSVA 3RSEA 4CJ7A 4JKHA 3H3NO 4JKGB 4JHDA 3O1BA 3VEXA 4DKWA 5C15A 2FXUA 3R6MA 4F9OA 5BPNA 3W0LA 2FLOA 3EE8A 2VWBA 3HTVA 4CBXA 4DB3A 4EHUA 4PHTX 1VQ7N 1GLFO 3HOTA 1ZC6A 1ZXOA 3WXMB 3FZMA 1P90A 1JCEA 1HKCA 3KWGA 3VF2A 2E20A 3TPQA 1KQSM 4FVUA 2ITMA 3VEOA 4JHDB 5EY4A 3CCJN 2BH1A 4BRIA 1DGKN 2IVOA 3T7ZA 4BC4A 3OW2M 3U4LA 4BR7A 3MK6A 4JEPA 5AQLA 3R1XA 4BVPA 1ZBSA 4HWIA 3TSUA 3IUCA 2P9KA 3SBGA 2D0PA 3WQTA 1NGDA 3H6EA 5AZIA 1BOTO 4CBUA 4H5WA 1NMDA 2ASPA 2F7TA 3FGUA 4FOIA 5TKYA 5AQQA 3SAFA 3VTIA 3BP8A 4BC5A 5M1QA 2NRHA 3ENOA 2CH5A 3CQXA 4H0PA 5GADP 2KLAA 2P9KB 3O8MA 4B1YB 4IFEA 1C0GA 1K8KA 4B1ZA 5AQSA 4CZGA 3O4WA 1WOQA 3KZBA 4KH6A 1QQMA 5AQJA 3RVCA 1EO1A 1T6CA 4BR5A 1SZ2A 2EWSA 3O9QA 3QMLA 5C2DA 3CCRN 4IOAL 4BQZA 1SAZA 5H1SQ 1YIJN 4EFHA 1XUPO 3ZETA 2AA4A 5JVGL 4XH5A 3O1WA 4BRLA 3CIPA 3IMXA 1K8KB 1YF5L 1Q18A 5AQVA 4B1XB 1QHAA 1O13A 3SK3A 2WBNA 4A61A 3CD6N 3CJ7A 5EVZA 1SS6A 1KXPA 2E8AA 4FWKA 2HBLA 4H0XB 4ILGB 4IOCL 1E4GT 1QVFM 5KPTA 3A5OC 1DKGD 3EL2A 3ZETB 3CC2N 1X3MA 2QWMA 4NO7A 4BRMA 4WFNL 3P39A 3VEWA 3CMEN 2KHOA 3GG4A 5TKWA 3U9ZA 3WXLA 5AQFA 5CHIA 1GLAG 4KH5A 3ZEUA 4CZHA 2H3GX 2W41A 1LCUA 4J8FA 4AF1A 3F2KA 1NWKA 3FZLA 5ELZA 2RE2A 1TYQB 3ID8A 1Z05A 5HL7L 4JN4A 3VGMA 5JICA 4QS8A 3J7ZO 1VQLN 2A5XA 1C0FA 1VQON 1VQMN 2CGLA 2CH6A 5AQGA 3ZEUB 2QWNA 2Q31A 2F9TA 2ASMA 4U67L 5EX5A 1Q86O 4BRCA 3LM9A 4ILHA 3BF3A 1JJ2M 1S72N 5M1NA 5LJVA 3SMPA 3R9PA 3K9KA 5F0XA 2IVPA 3D2FB 4OPAA 3EE9A 2YJFA 4L3QA 2YHYA 3D2EA 3VERA 1NM1A 2FSKA 1M90O 4H5VA 3HOSA 1X3NA 1EQYA 4IJNA 4K25A 1VQKN 2Q97A 3DWLA 4BR4A 2E2QA 4EAHD 3I56N 3QICA 4AM7A 4CZFA 5AQWA 3D2EB 3IDHA 4H5RA 3U8XA 2VYPA 3AARA 2KKZA 3CQYA 3E9PA 2I7NA 3O9UA 3E66A 4WQ5C 5JLFA 1VAZA 3A5MC 3W3DA 1VQ8N 5KQ8A 4ISEA 3HBTA 3O5BA 1GLJO 2OANA 3QBWA 5AR0A 1VQ5N 2ZGYA 3WEEA 4BRFA 4FOEA 5BRFA 3PLAA 4CZEA 1T44A 2A6AA 3KK7A 2NRTA 1H1VA 1OKJA 1G99A 1HX1A 2A42A 2I7PA 2A3ZA 3GBTA 2PBDA 3SJHA 3NVMA 5CR4A 1YJNN 1DT9A 3DXMA 4MO5A 4BRAA 5JMVA 3MDQA 4FWOA 3L4IA 1NJIO 4IO9L 4CD3A 5GAHP 1YVNA 2NRVA 4H0OA 4E1JA 3JXUA 3M6GA 4ILJA 1W2BM 5ADXH 3WEEB 1GLBG 3CERA 3D7EO 4WFAL 3VOVA 3FLCO 4IEIA 5F2RA 3H45C 5DM7L 4ISFA 4BQLA 3F9MA 4G9ZA 1XC3A 2FF6A 2RHKA 4BC3A 1CZAN 3DXMB 5KPRA 4WYBA 3H1VX 4BY9C 3CPWM 3BF1A 1JCFA 4XH4A 5M1FA 2NNWA 1ATRA 2QW9A 3EKSA 2P9PB 3FZHA 4GY2B 3RSEB 3WUHA 4YOWA 4YDUA 1Y64A 3Q7BA 3FR0A 4FL9A 3CHWA 4RTFD 4U7BA 3JS6A 1RGIA 5F1XA 1YI2N 5EXWA 3SBTA 5KPZA 1KD1O 3BUZB 5AQTA 4BG8A 3R8EA 3VEVA 2ASOA 2D4WA 5E26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IEI A;  5C2D A;  5M1N A;  4IEE A;  5C2F A;  5M1O A;  5M1P A;  5M1Q A;  5C12 A;  5C10 A;  3C6A A;  5C15 A;  3C6H A;  4IDH A;  5M1F A;  3CPE A;  4IFE A;  5M1K A; 
#chains in the Genus database with same CATH topology
 3AA2 A;  1IKX A;  5BRH A;  1WSE A;  3CFR A;  3CF5 L;  4DU3 A;  4X62 K;  3B6O A;  1MWM A;  2VGM A;  3J7A P;  4ISG A;  3SV4 A;  2IS3 A;  1IJJ A;  4C1N K;  3H46 O;  2HOE A;  3JSM A;  4DV1 K;  1WAJ A;  2V7Y A;  2G8I A;  1BHL A;  1Z25 A;  4FLW A;  3SJJ A;  1HYS A;  1RTJ A;  4BRQ A;  3U6F A;  1D4X A;  3SPY A;  4C8N A;  1VQ4 N;  5HRO A;  2IVN A;  4JKF A;  4FLY A;  1RBS A;  2IGI A;  1GLC G;  3PIO L;  4FJJ A;  3ZSR A;  4M7Y A;  1L5U A;  3P31 A;  1NKE A;  4YOR A;  4GVM A;  4CHO A;  4BR0 A;  1NGJ A;  3CCS N;  1FJG K;  3LPU A;  4RW6 A;  3WQU A;  5KTQ A;  3THY B;  1NGE A;  1NJX A;  3HST B;  3A5L C;  4Z4E A;  2HBK A;  3L2V A;  4CGD A;  1WLJ A;  4LF4 K;  2YHW A;  1T3V A;  4PKH A;  4ZTF A;  4JK8 A;  1X9W A;  1IBL K;  4DV7 K;  4DR6 K;  4RW4 A;  4IWV A;  3T1A A;  1NBW A;  5M1P A;  1X9J A;  4JLH A;  4K41 A;  2YNI A;  3CET A;  3LP3 A;  1GLE G;  3PX6 A;  3TI0 A;  2EHG A;  3EO3 A;  1U47 A;  1NG9 A;  1QSS A;  3EY1 A;  2IC3 A;  2GUP A;  5AQZ A;  1RBU A;  1SV5 A;  2V7Z A;  1ZBI A;  3V6D A;  4B9T A;  3L8B A;  4FLX A;  1ATN A;  3L2U A;  3ENB A;  1EXQ A;  5DM6 L;  5B8H A;  2GEL A;  4CEC A;  2CGK A;  4FZX C;  3QIO A;  2X6N A;  1HQE A;  4NLB A;  4FLU A;  4NLC A;  3TTC A;  3KLI A;  3PIP L;  1VK0 A;  3DAW A;  3HM9 A;  2VQE K;  4AHT A;  3ID6 A;  3NBP A;  4FK2 A;  2G8H A;  3DXK A;  2HST A;  5C2F A;  1RBV A;  3AVA A;  1NGA A;  4CHN A;  3CCU N;  1RT6 A;  3CJ9 A;  1FK9 A;  3PX4 A;  3AO5 A;  4BE0 A;  3THX B;  2QM1 A;  5K14 A;  1IG9 A;  4NB4 A;  4W5N A;  2AP1 A;  3PO5 A;  4XEI A;  4DR4 K;  3LAK A;  2ITG A;  3K57 A;  3AGR A;  3DM2 A;  4B1U B;  1C0T A;  1YJW N;  1BI4 A;  1FW6 A;  1NGB A;  4DQ8 A;  3CJ1 A;  4GV3 A;  3QIN A;  4JKB A;  1J6Z A;  3O4N A;  4C23 A;  1LW0 A;  3FZF A;  4IXC A;  1HNI A;  4CEE A;  4C8K A;  3VQQ A;  1RDW X;  3L3U A;  4JNE A;  2GEM A;  4A5B A;  3HM8 A;  3M3Z A;  1TK5 A;  2JWL A;  4B3R K;  4DSE A;  3IRX A;  4DWI A;  3KLH A;  2HHH K;  2JWK A;  1IKV A;  3A0I X;  3OYA A;  4A2B A;  2P9I B;  4LSN A;  5E84 A;  4QOZ B;  3C0B A;  3P4I A;  5C24 A;  4I2P A;  1WBB A;  1S1V A;  3VQA A;  4Y1D A;  4JS4 A;  1VQP N;  3B6P A;  4AHU A;  4CK3 A;  1UWB A;  2UU9 K;  1RNH A;  4MQ3 A;  1HYV A;  3A5N C;  4DS5 A;  4CZL A;  4KI6 A;  2E2N A;  2HHS A;  3ZSO A;  1I94 K;  4V19 S;  1RTD A;  4CVN E;  3CC4 N;  3HSC A;  3L4Q A;  1LAV A;  4IFY A;  3IS9 A;  4YOU A;  4B9N A;  2O8F A;  3OBW A;  1LWE A;  2O8C B;  3HI0 A;  4DFP A;  3SPZ A;  3J8A A;  1C1C A;  4RG8 A;  1HRH A;  1RDU A;  4FWL A;  3F73 A;  4JK9 A;  1GOC A;  4EZ9 A;  4FJL A;  4LF8 K;  1QQO A;  3OJS A;  4WFB L;  4H0Y B;  2W6K A;  1A5W A;  1X9M A;  3RMD A;  3D2F A;  1XHX A;  4FWN A;  1KAX A;  3FZK A;  2VCP A;  1ESV A;  4H0V B;  1YT3 A;  5MLC Q;  3EZW A;  4W5Q A;  1UA0 A;  1KC8 O;  4JYA K;  1EWQ A;  5M1O A;  3KK1 A;  1C1B A;  4DV3 K;  4CEO A;  2HHW A;  3SQ2 A;  4ZHR A;  2Q2R A;  4FM1 A;  1QS4 A;  4CF8 A;  4MLH A;  4E1N A;  1ATS A;  3LM2 A;  4B9L A;  4PUO A;  3ZT4 A;  1BO5 O;  4YFU A;  1IG8 A;  3C6H A;  3FFK B;  5AQH A;  1VSM A;  4KHU A;  1IV0 A;  3OYL A;  2GUI A;  1NK8 A;  4F2S A;  3ZSW A;  4YOT A;  3AVL A;  3UKU A;  5AQO A;  4CZM A;  1G15 A;  2W40 A;  4DV4 K;  1S5J A;  1NGI A;  2HVH A;  2A41 A;  3S9H A;  3O08 A;  3CM5 A;  4DR1 K;  2OYQ A;  1S3X A;  2E6M A;  1FXX A;  3NCI A;  2P9P A;  4QS7 A;  3VGL A;  4I6M B;  4KFB A;  4Z4F A;  4JI2 K;  2KTQ A;  4CJT A;  4OKK A;  3H3N O;  3VEX A;  3O1B A;  5BPN A;  3W0L A;  2FLO A;  4KRE A;  2VWB A;  3NF8 A;  4FZY A;  2OPR A;  4KV8 A;  3FZM A;  3SQ1 A;  3ZCM A;  2LSN A;  3VF2 A;  4HUE A;  4FVU A;  3VEO A;  4DMN A;  5EY4 A;  2BH1 A;  3OW2 M;  1DGK N;  4JEP A;  4W5O A;  2KZM A;  3TSU A;  3IUC A;  4EP4 A;  1NGD A;  1CZ9 A;  1BIS A;  5TKY A;  1DTT A;  1LW2 A;  1JXE A;  3VTI A;  1BCO A;  1N33 K;  4KB1 A;  4OJR A;  2NRH A;  2CH5 A;  4KPY A;  4H0P A;  1NJW A;  1K8K A;  1HNW K;  3OJU A;  3NF6 A;  4AH9 A;  4BDY A;  3KZB A;  1ASV A;  2Z1H A;  1EO1 A;  4BR5 A;  5C2D A;  3CCR N;  3QML A;  4BQZ A;  5H1S Q;  1YIJ N;  2E5L K;  2AA4 A;  4XH5 A;  4BRL A;  1J5E K;  3IMX A;  2DFH A;  4B1X B;  3THV A;  4M42 A;  2WBN A;  1L3U A;  4H0X B;  1QVF M;  3A5O C;  4CJW A;  3ZET B;  3CC2 N;  3P39 A;  4CJR A;  2O8D B;  3VEW A;  3CME N;  3RR7 A;  2O8E B;  5TKW A;  4KH5 A;  1LCU A;  4J8F A;  1U45 A;  3F2K A;  5ELZ A;  3OTO K;  1D9D A;  3ID8 A;  5HL7 L;  3VGM A;  5KGW A;  1TAU A;  3G10 A;  3L2W A;  3L2Q A;  4Z4H A;  2QWN A;  1BCM A;  3HP6 A;  2F9T A;  4DFJ A;  3P5J A;  1QE1 A;  4RW8 A;  3F9K A;  5EX5 A;  4B9S A;  3NGY A;  4BRC A;  3LM9 A;  4ILH A;  4CHP A;  5M1N A;  5LJV A;  4RW9 A;  4OLA A;  1HYZ A;  3NGI A;  5JS1 A;  5SZT A;  4FLT A;  3D2E A;  4CGH A;  1WSF A;  1NM1 A;  2FSK A;  1K6Y A;  1X3N A;  2IAJ A;  4IJN A;  4JI5 K;  2Q97 A;  4Z0U A;  4DV5 K;  2E2Q A;  4EAH D;  3I0S A;  4X66 K;  4CZF A;  4FW2 A;  5AQW A;  4H5R A;  5F0X A;  2VYP A;  3AAR A;  3CQY A;  2I7N A;  3O9U A;  3NH0 A;  4O4G A;  1VAZ A;  1ZBF A;  3W3D A;  1C0M A;  3HT3 A;  3RMA A;  3HBT A;  1VQ5 N;  1GLJ O;  5AR0 A;  4DG1 A;  3WNH A;  1WSG A;  4OGC A;  3ZT1 A;  2IOC A;  4LF6 K;  2A42 A;  3SJH A;  3KTQ A;  5CY4 A;  4NCA A;  3L4I A;  4IO9 L;  2UXD K;  5GAH P;  1YVN A;  4E1J A;  3JXU A;  3M6G A;  2HHV A;  4ILJ A;  1Q86 O;  1JJ2 M;  3CER A;  3F9M A;  4KRF A;  4KTQ A;  1S1X A;  1CZA N;  3SUQ A;  4WYB A;  4CES A;  1IKW A;  3CPW M;  3BF1 A;  1JCF A;  1KCF A;  4CEQ A;  2QW9 A;  3EKS A;  2F4V K;  1TL3 A;  1Y64 A;  1RGI A;  5F1X A;  4DV0 K;  1KD1 O;  4W5T A;  1T7P A;  3R8E A;  1HNX K;  1UOC A;  3QEP A;  2D4W A;  4LFA K;  4DQQ A;  3DLH A;  1YJ9 N;  3MMV A;  2Z1J A;  4MLE A;  3JAM O;  2YCH A;  3CJA A;  3T3F A;  2W6L A;  4CF1 A;  4KTZ A;  2WOM A;  4EHT A;  5SWM A;  2P9U A;  2VGN A;  2HF3 A;  4MO4 A;  3QDK A;  1R59 O;  5KI6 A;  3QB0 A;  4M45 A;  3C6A A;  2RF2 A;  3ULD A;  4K0K K;  3MN5 A;  3PX0 A;  2OPQ A;  1BA0 A;  4M3Y A;  4LY7 A;  4HTU A;  4NXM K;  3MXJ A;  1XQS C;  2BUP A;  5GAG P;  4J2E A;  3BEX A;  2YV0 X;  2XHB A;  1KAY A;  1WSH A;  4BRE A;  3KIO A;  3CI5 A;  4H4M A;  4CEZ A;  1B9D A;  3NDK A;  5C10 A;  5AZJ B;  1D5A A;  5CZ2 A;  5FLX O;  3MCA B;  2W42 A;  3LP0 A;  3QEI A;  3MX2 A;  3O9T A;  4FWS A;  3ASM A;  4ELT A;  1TUY A;  2P1J A;  3Q7C A;  4FWP A;  1RDC A;  1KFD A;  4DCH A;  3T1H K;  1VHX A;  3O6W A;  2ZJQ L;  3CCM N;  2VWJ A;  3DLB A;  5AFU H;  4LC9 B;  1VQN N;  1RIL A;  1RTI A;  3G6E N;  3TAB A;  3DYA A;  3IFR A;  4CK1 A;  4CF2 A;  1C0U A;  3OBY A;  1EWR A;  2D1K A;  2G8F A;  2Q3S A;  4A62 A;  5I3U A;  3ZSX A;  4BR2 A;  1MWK A;  3SAG A;  2WTU A;  5JVH L;  1TL1 A;  4LF5 K;  4DTN A;  3FFI A;  5I9E B;  4KHY A;  2PY5 A;  1OH6 A;  4CJK A;  3I8B A;  3KD5 E;  4KHQ A;  2ZQB A;  1QVG M;  4CCH A;  3AVJ A;  3I0R A;  1W0H A;  5AQM A;  5FRM A;  4WQ4 A;  3VGK A;  2ZJP L;  3VEZ A;  1TK8 A;  3VQC A;  3UKR A;  4O5B A;  1FKP A;  4CIE A;  3UE5 A;  1B9F A;  1M1K O;  1VSD A;  4BDP A;  3LAL A;  3NFA A;  3CG7 A;  1NGC A;  4B8A B;  4B9V A;  3QER A;  2Z1G A;  2NRW A;  4CJU A;  3VQ8 A;  3SLC A;  2HND A;  1NK7 A;  1HR0 K;  5T7B A;  3SCX A;  1K73 O;  3RRG A;  3SZ2 A;  1JL2 A;  3I8D A;  4UY8 O;  3O3F A;  3WXI A;  4N76 A;  1TKD A;  1OVY A;  3WNG A;  3QFU A;  4O0I A;  4FJ5 A;  3G4S N;  2P9S B;  3CFP A;  3LWL A;  4BE2 A;  5J2Q A;  3KVG A;  2AJQ A;  4DQP A;  3PV8 A;  4DR5 K;  4GNI A;  1JLC A;  1KFS A;  3MEE A;  1W9H A;  3SQ4 A;  4CJ3 A;  1N36 K;  1SQK A;  4CEB A;  1S22 A;  5KGX A;  3RRH A;  2O8B B;  1HKG A;  2D0O A;  3IAY A;  2QI2 A;  1EKE A;  1DEJ A;  3CCE N;  4X65 K;  1RFQ A;  3KHY A;  2YHX A;  4WQ4 C;  1S6Q A;  3V1Q A;  4JKA A;  1T05 A;  1E4F T;  3TSQ A;  1OVQ A;  4E7H A;  4BAC A;  3ULE A;  2FBY A;  3CCQ N;  4LFC K;  3NH1 A;  3CCL N;  1J9A A;  3M1F A;  4IOX A;  1BIZ A;  5HRP A;  2Y1J A;  1QHT A;  2BGG A;  1ILY A;  3KD1 E;  2ZD1 A;  3CC7 N;  3RMB A;  3TTD A;  2HNY A;  4FWR A;  3NVK A;  3SMS A;  5FRN A;  4DSF A;  1U48 A;  5BRE A;  2QTD A;  3VEY A;  3I33 A;  4PL8 A;  4CER A;  2XY5 A;  4O8U A;  3TR8 A;  1YXQ A;  3TTF A;  2HF4 A;  3CMA N;  5AQR A;  5C12 A;  4B08 A;  1K8A O;  4JI6 K;  5FPD A;  4M41 A;  4DF8 A;  3A8Y A;  3ZSQ A;  1NK5 A;  4FWM A;  1U2V B;  2UUC K;  1TV6 A;  3SQ0 A;  4BWM A;  3AVG A;  3VEN A;  4JD2 B;  3HPO A;  3GOI A;  4B1W B;  3CM6 A;  4H5T A;  2QEX N;  4IDK A;  2PYL A;  4E7K A;  4FK4 A;  5HRR A;  5AFU A;  4I9Q A;  1SKR A;  4BRP A;  1VQ9 N;  1TVR A;  5J1E A;  1XWL A;  2E1Y A;  3OHR A;  4A59 A;  4QAG A;  3THW B;  1Y97 A;  3MAQ A;  1HLU A;  4IG3 A;  4H8K A;  3FE1 A;  1TK0 A;  3ZX0 A;  1N5Y A;  3HVR A;  4F3T A;  5IWA K;  4TSX A;  4DR7 K;  4CGJ A;  3GL1 A;  4IBN A;  4CHQ A;  4CZJ A;  3H1Q A;  3C7N B;  1GLL O;  3MN7 A;  1XC9 A;  3HZ6 A;  2QXL A;  2ZGZ A;  4CI6 A;  5AQY A;  4CZK A;  4B9U A;  4FSV A;  1WB9 A;  4BE1 A;  3SUP A;  4JHD A;  3T19 A;  5C15 A;  3UIQ A;  3R6M A;  4LFB K;  1KLM A;  3EE8 A;  3HTV A;  2HHU A;  4JRP A;  3OYB A;  4FCY A;  4Z4I A;  3HOT A;  1ZC6 A;  1ZXO A;  3WXM B;  4DV6 K;  4M3T A;  1P90 A;  1ZYQ A;  1JCE A;  1WSJ A;  3J81 O;  4OGE A;  3K5M A;  3M8R A;  3TPQ A;  1KQS M;  4NCG A;  3QIP A;  4BC4 A;  4DS4 A;  3MK6 A;  2P5O A;  4CJV A;  4BVP A;  4HHT A;  2P9K A;  2D0P A;  3AVK A;  4CF9 A;  2YKM A;  2B5J A;  1JKH A;  3QEW A;  4CBU A;  3TAQ A;  1RT1 A;  2F7T A;  3FGU A;  4XIU A;  3J7Y P;  5M1Q A;  3ENO A;  5GAD P;  2KLA A;  4C8O A;  4CZG A;  4IFE A;  4DUZ K;  4B1Z A;  3HO1 A;  3O4W A;  1IBK K;  1WOQ A;  2RN2 A;  4KH6 A;  5AQJ A;  1T6C A;  4GW6 A;  2EWS A;  2R7Y A;  4CJE A;  3AVM A;  4EFH A;  1XUP O;  5HP1 A;  1WN7 A;  3K2P A;  4PWD A;  1QHA A;  3VQ7 A;  1O13 A;  1OH7 A;  2E4L A;  3CD6 N;  4Q5V A;  5EVZ A;  4FWK A;  1QQC A;  3DRR A;  4E19 A;  1BGX T;  3ZSZ A;  2BE2 A;  3V1R A;  2QWM A;  3OYJ A;  4BRM A;  3SI6 A;  2HMI A;  1S9G A;  4FW1 A;  3WXL A;  3GG4 A;  3ZT2 A;  3HL8 A;  2H3G X;  2W41 A;  1ITG A;  1UA1 A;  4B3M K;  1TYQ B;  4IG0 A;  4JN4 A;  1RDB A;  4QS8 A;  4FJN A;  3O4Q A;  1VQO N;  1VQM N;  2CGL A;  5AQG A;  3ZEU B;  1CLQ A;  1S1W A;  2Q31 A;  5FDL A;  4CF0 A;  3BF3 A;  4CEF A;  3C6U A;  4J2D A;  4GKJ K;  3K9K A;  1F21 A;  4KHN A;  2OZS A;  1KRP A;  3EE9 A;  2YJF A;  4CHZ A;  1Q9X A;  2YHY A;  4B3S K;  4DR2 K;  1EQY A;  1VQK N;  2OZM A;  4BR4 A;  4CJP A;  4BDZ A;  3QIC A;  3IDH A;  3E66 A;  3MEG A;  4WQ5 C;  1NMN A;  4Y1C A;  1VQ8 N;  2B4J A;  2YHB A;  3O5B A;  1NKB A;  4BRF A;  4FOE A;  3PLA A;  4CZE A;  1H1V A;  3BGR A;  2A3Z A;  3LZI A;  5CR4 A;  4LH5 A;  4DSI A;  4BRA A;  5JMV A;  1NK6 A;  3C94 A;  3WEE B;  3D7E O;  4CHY A;  4ISF A;  4G9Z A;  4DTR A;  3AA3 A;  3DXM B;  5KPR A;  2P51 A;  4DTP A;  4XH4 A;  2KFN A;  3OYE A;  1ATR A;  1QTM A;  3FZH A;  3RSE B;  3WUH A;  5E41 A;  4YDU A;  4CGI A;  3Q7B A;  4RTF D;  4FL9 A;  4U7B A;  3CYM A;  2ZM6 K;  4E0D A;  3SBT A;  3OYC A;  5KPZ A;  3BUZ B;  4BG8 A;  3VEV A;  1RCH A;  1MU2 A;  3O9R A;  1NK9 A;  4HCB A;  1VRU A;  2HMP A;  5FPN A;  1S1U A;  4FJ7 A;  3KLF A;  4F3O A;  3O9S A;  4Y0W A;  2CGJ A;  4FYD A;  3RWU A;  5AZI B;  1T03 A;  2GWJ A;  2OPP A;  3K9J A;  2PFU A;  4HUG A;  2Q1N A;  1Q7Y O;  3L3V A;  4AM6 A;  4K42 A;  4IO8 A;  2PAV A;  2X74 A;  3OY9 A;  2NRX A;  3OYH A;  3QES A;  4JK7 A;  3VET A;  4BRD A;  5BN8 A;  3THY A;  3TAR A;  4DTM A;  5GIN A;  1ZBH A;  3K5N A;  3E9L A;  3D45 A;  2QA4 N;  3I55 N;  1VSJ A;  5JLH A;  2DFF A;  4CFC A;  4DQS A;  4CFD A;  3DLK A;  1HNV A;  3VQP A;  3DMJ A;  3ATV A;  3K5L A;  1BA1 A;  1HJO A;  4CIG A;  5CYQ A;  5HOO A;  3ZX3 A;  1TKX A;  2E1Z A;  4JI0 K;  3S3O A;  2P5G A;  3VTH A;  4KI4 A;  2A1S A;  2QWP A;  1NNE A;  4YDU C;  3LDQ A;  3TAM A;  3BY5 A;  2OTL N;  2HBJ A;  4JI1 K;  4IFV A;  4RCH A;  3HP9 A;  4YHH K;  1HQU A;  1Z6R A;  4EZ6 A;  4DFM A;  1K9M O;  5DMR A;  2D0B A;  3QFP A;  2Q36 A;  2EX3 A;  3C65 A;  3E9O A;  3DLL L;  3V1O A;  3DOK A;  3VES A;  3THX A;  4JV5 K;  1JCG A;  4FJX A;  1R0A A;  3THW A;  3ZYY X;  1T8E A;  1NLV A;  5J2P A;  3P1G A;  1XMO K;  1L3S A;  2GTD A;  4C1N I;  4O44 A;  3MWT A;  1WSI A;  3T69 A;  3GDQ A;  2FSN A;  2ZJR L;  2VWK A;  4AHR A;  1XMQ K;  1YIT N;  4RW7 A;  4GV9 A;  4X64 K;  2Q0R A;  5LJW A;  2WUS A;  1RT3 A;  4IZ9 A;  4ID1 A;  2ZWH A;  2YJE A;  1BL3 A;  3OYI A;  3MN6 A;  1VSE A;  3NF9 A;  2DFE A;  1LOT B;  3AA4 A;  3PSF A;  3D6R A;  3KWI A;  4M3U A;  3LDP A;  4DTS A;  2P9I A;  1BI4 B;  1W97 L;  4CZI A;  5AQN A;  4OPJ A;  3NMU A;  5LY3 A;  4B3O A;  5M1K A;  1U6Z A;  3CCV N;  3KLE A;  4CEA A;  1FKO A;  1N34 K;  4HTL A;  3AVI A;  2HHX A;  4OKE A;  2I5J A;  2WFB A;  2UYT A;  4FM2 A;  3R3L A;  4JKE A;  3S41 A;  3G25 A;  1JLQ A;  4ELU A;  2RPI A;  3DLR A;  1VQ6 N;  4CJQ A;  1Z26 A;  4NCB A;  4FM0 A;  4BWJ A;  1NGH A;  4AHS A;  3HK2 A;  2O8C A;  5CYM A;  4CJF A;  3U3Y A;  5GAE P;  3L0Q A;  1MDU B;  1J53 A;  2YX6 A;  2V51 B;  2NZT A;  1QZ5 A;  4DHY A;  4IEE A;  3M8P A;  3GE1 A;  3PO4 A;  4N5S A;  4R79 A;  5BRD A;  4ZTJ A;  3MXI A;  1BDG A;  1TYQ A;  4KTW A;  4A5A A;  2ZE2 A;  4PL7 A;  3TAN A;  3AAP A;  4FJH A;  4JAX A;  2YKN A;  2BDP A;  4NYF A;  5AQP A;  3WXK A;  2VG5 A;  3BZK A;  1YHQ N;  1SL1 A;  3L6Q A;  2GWK A;  4DSK A;  3AO4 A;  5AQX A;  3AA5 X;  4B8C A;  1IH7 A;  4OX9 K;  1NGF A;  4JKC A;  5AQK A;  1A5V A;  4BVO A;  3BDP A;  3QEV A;  3TWH A;  3OYD A;  3QBX A;  1LWC A;  5BR9 A;  1HUX A;  4FJI A;  1I3A A;  3AVN A;  2P9L B;  4DTJ A;  4MDB A;  2QWL A;  3OYF A;  4H5N A;  3D0P A;  4DQR A;  5AQU A;  3MWP A;  3NF7 A;  4JI7 K;  5CE3 A;  2P9N B;  1KVA A;  1NOY A;  1ZBL A;  1NGG A;  3VQ9 A;  4E7I A;  4M3Z A;  4MDA A;  1JXB A;  2A1R A;  4JKD A;  1C1A A;  5C42 A;  3G0Z A;  4ICL A;  3ZSV A;  3K59 A;  2G8W A;  3OS1 A;  4DSJ A;  1P8Z A;  4BGA A;  4BC2 A;  4EP5 A;  2QKK A;  3LAN A;  1B92 A;  1U49 A;  4XH1 A;  1RBT A;  4I6M A;  2NRZ A;  4I7F A;  3ENH A;  3HYF A;  1WUA A;  1VSI A;  4AHC A;  3O80 A;  3VQ5 A;  4PY5 A;  4BG9 A;  3KK2 A;  1V4S A;  5JS2 A;  4E7J A;  4B9M A;  5FPE A;  4YOV A;  3UKU B;  4O0J A;  3RSE A;  4JI3 K;  4JKH A;  4JKG B;  1JLF A;  3DOL A;  4IKF A;  4YY3 K;  4KHP K;  4DB3 A;  4CBX A;  4PHT X;  4DSL A;  1GLF O;  3V81 A;  2O4G A;  2E20 A;  3OYM A;  2IVO A;  3U4L A;  4BR7 A;  4FJ9 A;  3VN5 A;  5AQL A;  3ZSY A;  3PUF A;  3NGZ A;  1N32 K;  3H6E A;  5AZI A;  1BOT O;  1OH5 A;  2X6S A;  4H5W A;  3OVN A;  2ASP A;  3DLG A;  4E3S A;  3O3G A;  5AQQ A;  3SAF A;  4I2Q A;  3BP8 A;  3SNN A;  3TAG A;  3CQX A;  4NYN A;  1C0G A;  5AQS A;  4OVL A;  4FJ8 A;  4CJ5 A;  4CIF A;  5FRO A;  3O9Q A;  1SAZ A;  2NUB A;  3ZET A;  2O8D A;  2O8E A;  3J80 O;  1K8K B;  1YF5 L;  5AQV A;  2JLE A;  1JL1 A;  3SK3 A;  4A61 A;  4W5R A;  1SS6 A;  4ILG B;  2HBL A;  1E4G T;  3C95 A;  5KPT A;  1DKG D;  3EL2 A;  1X3M A;  4WFN L;  4K8Z A;  5HBM A;  3U9Z A;  1VSH A;  5AQF A;  1GLA G;  3OYN A;  4CZH A;  1NWK A;  1CXU A;  2RE2 A;  4DR3 K;  4F2R A;  4OKJ A;  5LMU K;  3V4I A;  5JIC A;  1TKT A;  3J7Z O;  1DTQ A;  1I39 A;  1VQL N;  4Z4C A;  1QSL A;  3TAF A;  3QLH A;  3R9P A;  3JYT A;  4OLB A;  4OPA A;  4AHV A;  5I42 A;  2F8T A;  3OS0 A;  3AVH A;  1M90 O;  3HOS A;  4DTX A;  1GOA A;  1RT7 A;  3I56 N;  2UUB K;  3VQE A;  4AM7 A;  1L3V A;  3HJF A;  3D2E B;  3DLE A;  1W7A A;  2KKZ A;  5JLF A;  4QCL A;  5C25 A;  3K5O A;  5KQ8 A;  2OAN A;  1IKY A;  5BRF A;  3KK7 A;  1T44 A;  1Q8I A;  2A6A A;  3CFO A;  1G99 A;  2I7P A;  2PBD A;  1XNR K;  3PY8 A;  2YNG A;  1DT9 A;  3AVF A;  3MDQ A;  4FWO A;  5CZ1 A;  4DQI A;  4CD3 A;  1L3T A;  2NRV A;  4H0O A;  4N56 A;  3LPT A;  1W2B M;  2Z1I A;  5ADX H;  2IDO A;  4IEI A;  3VOV A;  3SUO A;  1RT5 A;  4KB0 A;  1XC3 A;  3HVT A;  2XY7 A;  3LAM A;  4B3T K;  3H1V X;  4KHS A;  1Q9Y A;  4BY9 C;  1U4B A;  4GY2 B;  4M3W A;  2D5R A;  4E7L A;  4CFB A;  4YOW A;  3FR0 A;  5EXW A;  3VQ6 A;  3V9S A;  2XO7 A;  5HLF A;  2JGU A;  2ASO A;  2J4R A;  3H08 A;  2E2P A;  3KK3 A;  2QWQ A;  4WE1 A;  4YOY A;  4J2B A;  1RT4 A;  2VQF K;  1YUW A;  1O1W A;  3VQD A;  2OTJ N;  3QEX A;  4A2A A;  5KRS A;  1KLN A;  4WQ5 A;  1GOB A;  2XY8 A;  3AO3 A;  1N8R O;  1YVU A;  2UXB K;  5EU7 A;  1DLO A;  4CK2 A;  1HMV A;  1MA9 B;  3LP2 A;  4DLE A;  1VSK A;  3C6T A;  4WCE L;  3KLG A;  1HJR A;  4LF9 K;  2P9U B;  4M7X A;  1V4T A;  5AZJ A;  4PQU A;  4FJG A;  2HVI A;  5D3G A;  1HNZ K;  2QWO A;  3VF6 A;  3L2R A;  1XNQ K;  4H03 B;  2NRR A;  4FPB A;  4M3X A;  1CZB A;  1SL0 A;  2WC9 A;  4K8X A;  5KRT A;  3QO9 A;  1TUU A;  3ZX2 A;  1RBR A;  1YTA A;  3NAE A;  4PKI A;  3WNE A;  2E6L A;  5DK5 A;  4N41 A;  5KQD A;  3AGK A;  1BUP A;  1QQN A;  4FO0 A;  3QNO A;  4Z4G A;  3AVB A;  3WT0 A;  2V52 B;  4KO0 A;  1XHZ A;  2KQ2 A;  3IKM A;  1VSF A;  2OA8 A;  2GX9 A;  4HUF A;  2E88 A;  3CJB A;  3MN9 A;  4CBW A;  4DU4 A;  3ISN C;  1NU0 A;  3CPE A;  2P9L A;  1VRT A;  2DPN A;  2BAN A;  4BRN A;  3B8A X;  1C6V A;  2B6A A;  2HHT A;  5AJ3 K;  2P9N A;  4IJA A;  3N4P A;  4JRQ A;  4B9Q A;  3E1Y A;  1KAZ A;  3V9X A;  4BRH A;  4GV6 A;  2KZZ A;  3HXM A;  4BGB A;  1TAQ A;  3M8S A;  1S1T A;  2YI1 A;  1BG3 A;  1IBM K;  3EZ5 A;  4J2A A;  2IIR A;  1WBD A;  4GKK K;  1LV5 A;  2ATQ A;  3P83 D;  2FBX A;  5LL6 Z;  2OPS A;  3OS2 A;  3ATU A;  3TU5 A;  1Q82 O;  2UXC K;  5BN9 A;  1BU6 O;  4H4O A;  3NH2 A;  2A40 A;  4CD1 A;  3HPG A;  4LD0 A;  3CXC M;  1KTQ A;  2BTF A;  1KVB A;  1TGO A;  1JLA A;  2VG7 A;  4IDH A;  3VA3 A;  5GIP A;  4LF7 K;  4JKG A;  2GBZ A;  3N4Q A;  4QS9 A;  2D0C A;  1ASW A;  3U3G A;  4CJ4 A;  2KFZ A;  3PSI A;  3HPH A;  4B1V A;  4LSL A;  3UKR B;  3TSP A;  3V9W A;  4F4K A;  3H3O B;  4WF9 L;  4GMJ B;  1SKW A;  3VQ4 A;  3SAH A;  5J2M A;  4RWT A;  4I9L A;  2P9S A;  4JI4 K;  1NK4 A;  4FK0 A;  3LL3 A;  1X1P A;  5ADX A;  3LDO A;  2F96 A;  3WXJ A;  1RDD A;  5GIO A;  4O5F A;  2YNH A;  1X9S A;  3MX5 A;  3AY9 A;  4FXD A;  3AV9 A;  2DTU A;  1RTH A;  3G71 N;  1CXQ A;  4KKO A;  1NK0 A;  3LDN A;  3QNN A;  4LH4 A;  3DRS A;  4FWQ A;  4DTO A;  5AQI A;  4E89 A;  2O8B A;  4Q0B A;  1E3M A;  4DV2 K;  3CJC A;  1IO2 A;  3NHG A;  1HKB A;  4YNQ A;  3EEQ A;  3F5T A;  3U9D A;  1Q81 O;  1BIU A;  4FJK A;  3EN9 A;  3EKU A;  2FSJ A;  2NLX A;  3ZLJ A;  3MED A;  4KAZ A;  3UB5 A;  1S6P A;  3S3N A;  1U04 A;  4GVE A;  2FF3 B;  4DTU A;  3MEC A;  3VPZ A;  4DLG A;  4PKG A;  3V9Z A;  4OO1 J;  2YNF A;  5FPM A;  4K43 A;  5J2N A;  3LDS A;  3ALY A;  5BPM A;  3KKS A;  1BQM A;  4DU1 A;  4CE9 A;  2E2O A;  1NKC A;  4EIA A;  1YTU A;  3V9U A;  1SUQ A;  2XY6 A;  3S3M A;  4C8L A;  2YHA A;  4BRG A;  1RDA A;  3ULE B;  1SL2 A;  3ZT0 A;  2X78 A;  3DJC A;  3VMF B;  2FC0 A;  3AAQ A;  2QK9 A;  1GLD G;  1UAX A;  4MFB A;  2HW3 A;  3VF4 A;  4CJS A;  4ID5 A;  1U2V A;  2QWR A;  5BPL A;  1J5O A;  4KBO A;  4KHW A;  4R5P A;  4M63 C;  4BRK A;  4JD2 A;  2G8K A;  1QZ6 A;  4BR9 A;  1ZBU A;  4JS5 A;  2F9W A;  4KH4 A;  4DUY K;  1HPZ A;  4CFA A;  3DI6 A;  3AO2 A;  4OPH A;  1KSP A;  3LP1 A;  2ZF5 O;  4FPA A;  3P38 A;  4YOX A;  4FJM A;  3MCP A;  5EOY A;  3VQB A;  3M5R A;  4DF4 A;  2QXF A;  4BRO A;  4H0T B;  2UUA K;  2OCE A;  3LDL A;  1N6Q A;  4N47 A;  3HRG A;  1REV A;  3C7N A;  1HPM A;  4OPK A;  1BWF O;  3DXK B;  3T1Y K;  4A57 A;  1ASU A;  3OA9 A;  1T6D A;  3E01 A;  1QSY A;  1D9F A;  4O8K A;  4AIL C;  1YAG A;  5C0Y A;  4Z94 A;  1SKS A;  4FVM A;  2HBM A;  2Q0U A;  4CJ7 A;  5IT9 O;  3SV3 A;  1NJY A;  4DKW A;  1TKZ A;  2FXU A;  4F9O A;  1VQ7 N;  4EHU A;  1HKC A;  3LZJ A;  3KWG A;  4ELV A;  3TAP A;  2ITM A;  4E1M A;  4JHD B;  3CCJ N;  3WNF A;  4BRI A;  3SYZ A;  3T7Z A;  2DY4 A;  2HHQ A;  3EYZ A;  1RT2 A;  3R1X A;  3K0S A;  1ZBS A;  4HWI A;  3SBG A;  3WQT A;  3BZC A;  4HVJ A;  1NMD A;  4M3R A;  1OH8 A;  4CJL A;  4FOI A;  3RTV A;  2FBV A;  1A5X A;  4BC5 A;  2P9K B;  3O8M A;  4B1Y B;  1JLG A;  3RMC A;  4CGG A;  3RVC A;  1QQM A;  1NJZ A;  1SZ2 A;  4IOA L;  2VG6 A;  1J54 A;  1WNS A;  5JVG L;  1XI1 A;  1EP4 A;  3O1W A;  4UQG A;  2GV9 A;  3CIP A;  4F8R A;  1LWF A;  1Q18 A;  4C8M A;  4CW7 B;  3MXM A;  3VA0 A;  3CJ7 A;  4IOC L;  1D8Y A;  1KXP A;  2E8A A;  3DRP A;  3M8Q A;  3A2F A;  4FLZ A;  4NO7 A;  2O8F B;  1EX4 A;  3ZT3 A;  2KHO A;  1JLE A;  5CHI A;  3ZEU A;  4AQY K;  2WON A;  4JI8 K;  4AF1 A;  4FLV A;  4DFK A;  3FZL A;  3LWM A;  3CQ8 A;  3QET A;  1Z05 A;  3NE6 A;  1EET A;  2PYJ A;  1JLB A;  3OYK A;  4G1Q A;  2A5X A;  1C0F A;  2CH6 A;  2ASM A;  4FZZ A;  4U67 L;  3K58 A;  1S72 N;  3SMP A;  3O3H A;  2IVP A;  3D2F B;  2KW4 A;  3AVC A;  4CED A;  4L3Q A;  2F8S A;  1KVC A;  1BQN A;  2G8U A;  3VER A;  4H5V A;  2XRI A;  4K25 A;  3DWL A;  4HCC A;  4NXN K;  4PA1 A;  2HB5 A;  1S9E A;  3U8X A;  3RR8 A;  3E9P A;  5LMN K;  3A5M C;  4CGF A;  4ISE A;  3KKR A;  5BR8 K;  3QBW A;  2ZGY A;  3WEE A;  2NRT A;  1OKJ A;  2G8V A;  5HRS A;  1HX1 A;  3GBT A;  3NVM A;  1YJN N;  3DXM A;  4MO5 A;  5A2Q O;  1NJI O;  2RKI A;  4L8R B;  1NOZ A;  2HNZ A;  1GLB G;  4WFA L;  3FLC O;  5F2R A;  1LAW A;  3H45 C;  5DM7 L;  4BQL A;  2FF6 A;  2RHK A;  4BC3 A;  5M1F A;  2Y1I A;  2NNW A;  3IG1 A;  2PZS A;  2P9P B;  2ETJ A;  3ITH A;  3OYG A;  5HRN A;  4O55 A;  3AO1 A;  1YI2 N;  3CHW A;  3TAE A;  3JS6 A;  2QKB A;  2FBT A;  2O4I A;  3SUN A;  5AQT A;  1VSL A;  1WAF A;  3KJV A;  2D0A A;  5E26 A; 
#chains in the Genus database with same CATH homology
 2J4R A;  3O9R A;  1YJ9 N;  2E2P A;  5BRH A;  3CF5 L;  3MMV A;  2QWQ A;  4MLE A;  4YOY A;  2HMP A;  2YCH A;  3CJA A;  5FPN A;  1MWM A;  2VGM A;  1YUW A;  2OTJ N;  3O9S A;  4ISG A;  4Y0W A;  4A2A A;  2CGJ A;  1IJJ A;  4WQ5 A;  4C1N K;  4EHT A;  1N8R O;  2P9U A;  5AZI B;  3H46 O;  2VGN A;  2GWJ A;  2HF3 A;  2HOE A;  4MO4 A;  4CI6 A;  3K9J A;  3QDK A;  1MA9 B;  1R59 O;  2PFU A;  4WCE L;  2Q1N A;  3QB0 A;  1Q7Y O;  4AM6 A;  3C6A A;  4K42 A;  4IO8 A;  2PAV A;  2NRX A;  2V7Y A;  2P9U B;  4JK7 A;  4BRQ A;  3MN5 A;  3VET A;  3UKU B;  1BA0 A;  4M7X A;  1D4X A;  4BRD A;  1V4T A;  5BN8 A;  1VQ4 N;  1XQS C;  2BUP A;  5GAG P;  5AZJ A;  2IVN A;  4JKF A;  3BEX A;  5GIN A;  1KAY A;  1GLC G;  3PIO L;  4BRE A;  2QWO A;  4M7Y A;  3E9L A;  3VF6 A;  3P31 A;  3CI5 A;  4YOR A;  3CCS N;  2QA4 N;  4BR0 A;  1NGJ A;  4H03 B;  3I55 N;  2NRR A;  5JLH A;  4FPB A;  3WQU A;  2WC9 A;  5C10 A;  1NGE A;  3A5L C;  5AZJ B;  2HBK A;  3ATV A;  1BA1 A;  1TUU A;  2YHW A;  1T3V A;  4PKH A;  1HJO A;  3MCA B;  3ZX2 A;  4JK8 A;  4PKI A;  3MX2 A;  5HOO A;  3O9T A;  5KQD A;  4FWS A;  3AGK A;  3ZX3 A;  1BUP A;  1QQN A;  4FO0 A;  1TUY A;  3Q7C A;  4FWP A;  4IWV A;  2E1Z A;  3VGL A;  4DCH A;  1NBW A;  3WT0 A;  3VTH A;  2ZJQ L;  2V52 B;  3O6W A;  5M1P A;  1X9J A;  4K41 A;  3IKM A;  2QWP A;  2GX9 A;  4YDU C;  3CET A;  2E88 A;  3LDQ A;  3CCM N;  3CJB A;  3MN9 A;  5AFU H;  4CBW A;  4LC9 B;  1VQN N;  1GLE G;  3CPE A;  3G6E N;  2P9L A;  3EO3 A;  2DPN A;  2OTL N;  3IFR A;  4BRN A;  2HBJ A;  3B8A X;  2GUP A;  3OBY A;  5AQZ A;  2V7Z A;  2D1K A;  2P9N A;  4RCH A;  4IJA A;  3N4P A;  4A62 A;  4B9Q A;  1ATN A;  3E1Y A;  1KAZ A;  1Z6R A;  3ENB A;  4BRH A;  1K9M O;  5DM6 L;  5B8H A;  4GV6 A;  2GEL A;  2CGK A;  3QFP A;  4BGB A;  2Q36 A;  4BR2 A;  1MWK A;  2YI1 A;  1BG3 A;  3C65 A;  3E9O A;  3SAG A;  3DLL L;  4NLB A;  5JVH L;  2IIR A;  4NLC A;  3TTC A;  5I9E B;  3VES A;  3I8B A;  3PIP L;  1JCG A;  3ATU A;  3ZYY X;  1QVG M;  3DAW A;  3TU5 A;  1NLV A;  1Q82 O;  3ID6 A;  2GTD A;  4C1N I;  3MWT A;  5AQM A;  3DXK A;  4WQ4 A;  2HST A;  1BU6 O;  5BN9 A;  3T69 A;  3GDQ A;  5C2F A;  2FSN A;  1NGA A;  3CCU N;  2ZJR L;  3CJ9 A;  3VGK A;  2A40 A;  2ZJP L;  1YIT N;  4CD1 A;  2QM1 A;  3CXC M;  4NB4 A;  3VEZ A;  2AP1 A;  2BTF A;  4XEI A;  3UKR A;  4IDH A;  4GV9 A;  5GIP A;  4JKG A;  3AGR A;  3N4Q A;  3UE5 A;  2Q0R A;  4QS9 A;  1M1K O;  4B1U B;  5LJW A;  2WUS A;  4IZ9 A;  1YJW N;  1NGB A;  2ZWH A;  4DQ8 A;  2YJE A;  3CJ1 A;  1NGC A;  4B1V A;  4GV3 A;  3MN6 A;  4JKB A;  1J6Z A;  3UKR B;  4C23 A;  3TSP A;  1LOT B;  3H3O B;  2NRW A;  3D6R A;  3FZF A;  3KWI A;  4IXC A;  4WF9 L;  3SLC A;  1RDW X;  3SAH A;  3LDP A;  4RWT A;  4JNE A;  2P9I A;  1W97 L;  2GEM A;  4A5B A;  4CZI A;  3HM8 A;  3M3Z A;  2P9S A;  5AQN A;  1K73 O;  2JWL A;  3LL3 A;  5ADX A;  3NMU A;  3LDO A;  4UY8 O;  5LY3 A;  3WXJ A;  5M1K A;  1U6Z A;  3CCV N;  5GIO A;  3WXI A;  4O5F A;  1OVY A;  2JWK A;  3A0I X;  4HTL A;  3MX5 A;  3AY9 A;  4A2B A;  2P9I B;  3QFU A;  5E84 A;  3C0B A;  3G4S N;  2P9S B;  3P4I A;  3G71 N;  2WFB A;  2UYT A;  3KVG A;  3LDN A;  3R3L A;  4JKE A;  4FWQ A;  5AQI A;  3S41 A;  4GNI A;  3G25 A;  1VQ6 N;  1VQP N;  3CJC A;  1HKB A;  3A5N C;  3F5T A;  3U9D A;  1Q81 O;  1NGH A;  4CZL A;  3EN9 A;  3EKU A;  1SQK A;  2FSJ A;  2E2N A;  2NLX A;  1S22 A;  5GAE P;  3L0Q A;  3UB5 A;  1HKG A;  2D0O A;  3CC4 N;  1MDU B;  3HSC A;  2YX6 A;  3L4Q A;  4GVE A;  2V51 B;  2QI2 A;  2FF3 B;  1DEJ A;  4YOU A;  3VPZ A;  2NZT A;  4CZK A;  3CCE N;  4PKG A;  1QZ5 A;  1RFQ A;  3KHY A;  3OBW A;  2YHX A;  4IEE A;  4DHY A;  4WQ4 C;  3GE1 A;  4JKA A;  4OO1 J;  1E4F T;  5FPM A;  4K43 A;  5BRD A;  3TSQ A;  3HI0 A;  4R79 A;  5BPM A;  3J8A A;  3ULE A;  3CCQ N;  1BDG A;  1RDU A;  1TYQ A;  2E2O A;  4A5A A;  4EIA A;  4FWL A;  3CCL N;  4JK9 A;  4PL7 A;  3AAP A;  3M1F A;  4IOX A;  4JAX A;  5AQP A;  3WXK A;  1QQO A;  4BRG A;  4WFB L;  1ILY A;  3ULE B;  3CC7 N;  1YHQ N;  3DJC A;  3L6Q A;  3TTD A;  4H0Y B;  3VMF B;  2GWK A;  4FWR A;  3AAQ A;  3NVK A;  1GLD G;  5AQX A;  3D2F A;  4FWN A;  3SMS A;  1KAX A;  5BRE A;  3VF4 A;  2QTD A;  1NGF A;  3FZK A;  4JKC A;  3I33 A;  4PL8 A;  2VCP A;  1ESV A;  1U2V A;  2QWR A;  4H0V B;  5AQK A;  4BVO A;  5BPL A;  5MLC Q;  4O8U A;  3QBX A;  4KBO A;  5BR9 A;  1HUX A;  3EZW A;  4M63 C;  4BRK A;  1YXQ A;  4JD2 A;  3TTF A;  1KC8 O;  2HF4 A;  2P9L B;  3CMA N;  1QZ6 A;  4MDB A;  5AQR A;  2QWL A;  4BR9 A;  5M1O A;  4H5N A;  5C12 A;  1K8A O;  5FPD A;  3A8Y A;  5AQU A;  2F9W A;  3MWP A;  4KH4 A;  5CE3 A;  4FWM A;  1U2V B;  2P9N B;  2Q2R A;  3VEY A;  3VEN A;  1NGG A;  4JD2 B;  4MLH A;  3GOI A;  4OPH A;  4B1W B;  2QEX N;  4H5T A;  2ZF5 O;  4FPA A;  1ATS A;  4MDA A;  3P38 A;  4YOX A;  3MCP A;  3LM2 A;  5EOY A;  5AFU A;  4JKD A;  3M5R A;  1BO5 O;  4BRP A;  1VQ9 N;  4BRO A;  4H0T B;  1IG8 A;  3C6H A;  3FFK B;  5AQH A;  2E1Y A;  1P8Z A;  3OHR A;  4BGA A;  3LDL A;  4BC2 A;  4A59 A;  4YOT A;  3HRG A;  3C7N A;  1HPM A;  3UKU A;  4XH1 A;  1HLU A;  4I6M A;  2NRZ A;  3ENH A;  3FE1 A;  5AQO A;  1BWF O;  1WUA A;  3DXK B;  4CZM A;  2W40 A;  4A57 A;  3ZX0 A;  3O80 A;  3OA9 A;  1NGI A;  1T6D A;  4BG9 A;  2A41 A;  1V4S A;  4O8K A;  3GL1 A;  3O08 A;  4CZJ A;  1YAG A;  5C0Y A;  3H1Q A;  5FPE A;  4YOV A;  1S3X A;  3C7N B;  1GLL O;  4Z94 A;  3MN7 A;  2P9P A;  2QXL A;  2ZGZ A;  3HZ6 A;  4QS7 A;  4I6M B;  5AQY A;  2HBM A;  2Q0U A;  4FSV A;  3RSE A;  4CJ7 A;  4JKH A;  3H3N O;  4JKG B;  4JHD A;  3O1B A;  3VEX A;  4DKW A;  5C15 A;  2FXU A;  3R6M A;  4F9O A;  5BPN A;  3W0L A;  2FLO A;  3EE8 A;  2VWB A;  3HTV A;  4CBX A;  4DB3 A;  4EHU A;  4PHT X;  1VQ7 N;  1GLF O;  3HOT A;  1ZC6 A;  1ZXO A;  3WXM B;  3FZM A;  1P90 A;  1JCE A;  1HKC A;  3KWG A;  3VF2 A;  2E20 A;  3TPQ A;  1KQS M;  4FVU A;  2ITM A;  3VEO A;  4JHD B;  5EY4 A;  3CCJ N;  2BH1 A;  4BRI A;  1DGK N;  2IVO A;  3T7Z A;  4BC4 A;  3OW2 M;  3U4L A;  4BR7 A;  3MK6 A;  4JEP A;  5AQL A;  3R1X A;  4BVP A;  1ZBS A;  4HWI A;  3TSU A;  3IUC A;  2P9K A;  3SBG A;  2D0P A;  3WQT A;  1NGD A;  3H6E A;  5AZI A;  1BOT O;  4CBU A;  4H5W A;  1NMD A;  2ASP A;  2F7T A;  3FGU A;  4FOI A;  5TKY A;  5AQQ A;  3SAF A;  3VTI A;  3BP8 A;  4BC5 A;  5M1Q A;  2NRH A;  3ENO A;  2CH5 A;  3CQX A;  4H0P A;  5GAD P;  2KLA A;  2P9K B;  3O8M A;  4B1Y B;  4IFE A;  1C0G A;  1K8K A;  4B1Z A;  5AQS A;  4CZG A;  3O4W A;  1WOQ A;  3KZB A;  4KH6 A;  1QQM A;  5AQJ A;  3RVC A;  1EO1 A;  1T6C A;  4BR5 A;  1SZ2 A;  2EWS A;  3O9Q A;  3QML A;  5C2D A;  3CCR N;  4IOA L;  4BQZ A;  1SAZ A;  5H1S Q;  1YIJ N;  4EFH A;  1XUP O;  3ZET A;  2AA4 A;  5JVG L;  4XH5 A;  3O1W A;  4BRL A;  3CIP A;  3IMX A;  1K8K B;  1YF5 L;  1Q18 A;  5AQV A;  4B1X B;  1QHA A;  1O13 A;  3SK3 A;  2WBN A;  4A61 A;  3CD6 N;  3CJ7 A;  5EVZ A;  1SS6 A;  1KXP A;  2E8A A;  4FWK A;  2HBL A;  4H0X B;  4ILG B;  4IOC L;  1E4G T;  1QVF M;  5KPT A;  3A5O C;  1DKG D;  3EL2 A;  3ZET B;  3CC2 N;  1X3M A;  2QWM A;  4NO7 A;  4BRM A;  4WFN L;  3P39 A;  3VEW A;  3CME N;  2KHO A;  3GG4 A;  5TKW A;  3U9Z A;  3WXL A;  5AQF A;  5CHI A;  1GLA G;  4KH5 A;  3ZEU A;  4CZH A;  2H3G X;  2W41 A;  1LCU A;  4J8F A;  4AF1 A;  3F2K A;  1NWK A;  3FZL A;  5ELZ A;  2RE2 A;  1TYQ B;  3ID8 A;  1Z05 A;  5HL7 L;  4JN4 A;  3VGM A;  5JIC A;  4QS8 A;  3J7Z O;  1VQL N;  2A5X A;  1C0F A;  1VQO N;  1VQM N;  2CGL A;  2CH6 A;  5AQG A;  3ZEU B;  2QWN A;  2Q31 A;  2F9T A;  2ASM A;  4U67 L;  5EX5 A;  1Q86 O;  4BRC A;  3LM9 A;  4ILH A;  3BF3 A;  1JJ2 M;  1S72 N;  5M1N A;  5LJV A;  3SMP A;  3R9P A;  3K9K A;  5F0X A;  2IVP A;  3D2F B;  4OPA A;  3EE9 A;  2YJF A;  4L3Q A;  2YHY A;  3D2E A;  3VER A;  1NM1 A;  2FSK A;  1M90 O;  4H5V A;  3HOS A;  1X3N A;  1EQY A;  4IJN A;  4K25 A;  1VQK N;  2Q97 A;  3DWL A;  4BR4 A;  2E2Q A;  4EAH D;  3I56 N;  3QIC A;  4AM7 A;  4CZF A;  5AQW A;  3D2E B;  3IDH A;  4H5R A;  3U8X A;  2VYP A;  3AAR A;  2KKZ A;  3CQY A;  3E9P A;  2I7N A;  3O9U A;  3E66 A;  4WQ5 C;  5JLF A;  1VAZ A;  3A5M C;  3W3D A;  1VQ8 N;  5KQ8 A;  4ISE A;  3HBT A;  3O5B A;  1GLJ O;  2OAN A;  3QBW A;  5AR0 A;  1VQ5 N;  2ZGY A;  3WEE A;  4BRF A;  4FOE A;  5BRF A;  3PLA A;  4CZE A;  1T44 A;  2A6A A;  3KK7 A;  2NRT A;  1H1V A;  1OKJ A;  1G99 A;  1HX1 A;  2A42 A;  2I7P A;  2A3Z A;  3GBT A;  2PBD A;  3SJH A;  3NVM A;  5CR4 A;  1YJN N;  1DT9 A;  3DXM A;  4MO5 A;  4BRA A;  5JMV A;  3MDQ A;  4FWO A;  3L4I A;  1NJI O;  4IO9 L;  4CD3 A;  5GAH P;  1YVN A;  2NRV A;  4H0O A;  4E1J A;  3JXU A;  3M6G A;  4ILJ A;  1W2B M;  5ADX H;  3WEE B;  1GLB G;  3CER A;  3D7E O;  4WFA L;  3VOV A;  3FLC O;  4IEI A;  5F2R A;  3H45 C;  5DM7 L;  4ISF A;  4BQL A;  3F9M A;  4G9Z A;  1XC3 A;  2FF6 A;  2RHK A;  4BC3 A;  1CZA N;  3DXM B;  5KPR A;  4WYB A;  3H1V X;  4BY9 C;  3CPW M;  3BF1 A;  1JCF A;  4XH4 A;  5M1F A;  2NNW A;  1ATR A;  2QW9 A;  3EKS A;  2P9P B;  3FZH A;  4GY2 B;  3RSE B;  3WUH A;  4YOW A;  4YDU A;  1Y64 A;  3Q7B A;  3FR0 A;  4FL9 A;  3CHW A;  4RTF D;  4U7B A;  3JS6 A;  1RGI A;  5F1X A;  1YI2 N;  5EXW A;  3SBT A;  5KPZ A;  1KD1 O;  3BUZ B;  5AQT A;  4BG8 A;  3R8E A;  3VEV A;  2ASO A;  2D4W A;  5E26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...