5M1OA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound cobalt
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
188
structure length
188
Chain Sequence
AMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
total genus 68
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1oA00
5M1QA 5M1KA 3CPEA 5M1PA 5C10A 5C12A 5M1OA 5C2DA 5C15A 5C2FA 3C6HA 4IEEA 5M1FA 4IDHA 3C6AA 4IEIA 5M1NA 4IFEA
chains in the Genus database with same CATH superfamily
1NU0A 4Z4CA 2XO7A 3SMPA 3DLGA 4IKFA 3EE8A 3K57A 3OS2A 4FJ5A 4IWVA 4OPKA 3KK1A 4DUZK 1QZ6A 5F2RA 2Q3SA 2UXBK 4YOYA 1ZC6A 3ITHA 4KFBA 3ZSQA 1NK7A 1KAZA 2NNWA 4DF8A 1BI4A 2HBLA 4CJFA 4DFMA 1RT2A 5HROA 2QWNA 1Q81O 3DLKA 3WUHA 5J2MA 3LDSA 5AZJB 4FJ7A 3DXMB 5HL7L 1VHXA 4B1VA 4MLHA 4ELUA 2RPIA 1B9DA 4JHDA 1WSEA 4DV0K 4KTZA 1RILA 2IOCA 4FWLA 2V52B 2IS3A 2PAVA 4JI6K 3VERA 2G8WA 2P9NA 1ZBUA 4YHHK 4KAZA 5GAEP 4XEIA 1GOAA 4JI7K 3HSTB 5E41A 4H5RA 3OS0A 2KZMA 3P83D 3FZMA 3KWIA 3VGMA 3OYHA 4JRPA 4KHUA 3R6MA 3OJUA 3E01A 2A5XA 4CFDA 1L3TA 5JLHA 1TV6A 1YF5L 4DQSA 3CJBA 3GL1A 2FSNA 4FPAA 3LDNA 1Q18A 1I3AA 2F9TA 1YJWN 2E2OA 3BEXA 5AZIB 3VGLA 1X3NA 3NF7A 3F9MA 1ASUA 4B3OA 3TABA 1NK8A 4FPBA 4QS8A 3QBWA 2PYLA 4GNIA 4NXNK 4HTUA 4UY8O 4DR7K 5E84A 2Q36A 2O8BA 3M5RA 1WOQA 4DTJA 3NBPA 4B1WB 3FLCO 1ATRA 4O8UA 4GMJB 3L2RA 4KTWA 3ZSYA 5IWAK 4B08A 5AQKA 1NGAA 4DV4K 3VEXA 2D0OA 1QSYA 4KV8A 5T7BA 3PV8A 4W5OA 3QESA 4BE2A 5FRMA 3AO4A 2VGNA 1SL0A 4BG9A 2KW4A 4CGIA 4JS5A 3NGIA 1NJYA 3I0SA 1BOTO 4K8XA 3NFAA 4CZIA 3MWTA 1OH6A 1IG9A 5AQSA 1SV5A 3KKSA 2CH6A 4KB0A 1EP4A 3QB0A 2HOEA 3BUZB 3PSFA 1O1WA 3T1HK 1KCFA 4JD2A 3N4QA 3W3DA 4IG0A 2D0CA 4YOXA 1F21A 3OYDA 3VA0A 2ZJQL 3THYB 5SZTA 3UB5A 3C94A 2E88A 1LWCA 3AO2A 4MQ3A 5AQOA 1BGXT 1KC8O 4OLBA 4MLEA 1Q7YO 2IC3A 3AGKA 3R8EA 1GOBA 2P9KB 3ZT3A 1VSJA 4B1ZA 3V81A 5HRSA 5BR9A 4E89A 3D2FA 3QEWA 1S6PA 3CXCM 4H5TA 4CBXA 2G8IA 4CF9A 3UIQA 1HPMA 1FK9A 5FRNA 3VN5A 3WEEA 1KD1O 4AHSA 5AQXA 4FLYA 2KQ2A 3DYAA 3PUFA 4PQUA 3ZT2A 1JLGA 4DV5K 2HBJA 4LF4K 3O9UA 3VQ7A 4CBWA 3LDQA 4DSKA 1LW0A 1RDDA 4DTMA 4GKJK 3OBYA 2QK9A 4DR6K 1RTIA 1BIUA 1NGHA 1L3VA 3SZ2A 3ASMA 5FPDA 3CIPA 4Y1DA 3CF5L 4DLEA 3KWGA 4FK2A 4K41A 3WXKA 4I2QA 3L2WA 4AM7A 3VPZA 1WAFA 4BROA 1DGKN 4E7KA 4WE1A 4JKGB 3VQAA 1NK9A 1E3MA 3AARA 2A42A 5FDLA 4W5RA 3DLBA 2P5OA 1UA1A 1N32K 2YNHA 2O8FB 4O8KA 4HTLA 4NCBA 1HJRA 3FE1A 4PKHA 2KKZA 4FJMA 4IFEA 4JI2K 4CEOA 3MAQA 2I7PA 3DLRA 1SAZA 4NO7A 2CH5A 5KI6A 2BDPA 3SI6A 3ULEB 2F8TA 3CC7N 4FWPA 1R0AA 5M1QA 1ITGA 3K5OA 3HYFA 4IJNA 4CHOA 4DB3A 1K8AO 3RWUA 4A61A 3H08A 1NLVA 2A3ZA 4IO9L 1QVGM 3SK3A 2ZJRL 2UUAK 1IH7A 3KK3A 4B1XB 3L3UA 4IFVA 4FLZA 3UKUB 1ATSA 4EHTA 3PO5A 4BC5A 2HF3A 4EFHA 2P1JA 3BP8A 3CPWM 1RBTA 3MXIA 3FFKB 1BA0A 3S9HA 2FBVA 3FR0A 5KGWA 4KHSA 4J2AA 1LCUA 2X6NA 3NGYA 2VWKA 3VQPA 2BUPA 4JKFA 2P9LA 4FLTA 4OPHA 3OJSA 2OZSA 3LM9A 4LF8K 4OGEA 2AJQA 3O8MA 3PIPL 2HHHK 3Q7CA 1N33K 4CEZA 4JI1K 4JN4A 3I56N 3LAKA 4FJIA 2KZZA 2UXDK 2P9PA 4CF8A 3VETA 1NWKA 4YOTA 3MX2A 4EZ9A 3KLIA 4MDBA 4DTRA 3HP9A 3BDPA 4DV3K 4FLVA 2NRTA 3QLHA 1QQNA 3AVNA 2OYQA 2D4WA 3OYAA 5M1OA 2A1SA 4B9QA 1K8KA 2IDOA 2HHQA 3RRHA 3THWA 4ILGB 3SYZA 4RW7A 1YIJN 1VQON 3A8YA 1TKXA 4QAGA 3TAPA 4JAXA 1BG3A 1S1XA 2FLOA 4CIFA 3QFPA 2Z1JA 2E2PA 3FZLA 5AQTA 3ZETA 3VTHA 5AQVA 1WUAA 4FYDA 3O1WA 3LWMA 1HNIA 3HTVA 2PY5A 2HNZA 4B9MA 2VG6A 4DTNA 1JLBA 3S3MA 3U3YA 4CJUA 4CGHA 4CEAA 1CZ9A 4C1NI 4CIEA 3C7NB 2HMPA 2IVNA 4FJ8A 3TPQA 3DLEA 4LD0A 2JWLA 3TSPA 4RW4A 2OPPA 5GAHP 3RR8A 1J54A 3IUCA 1REVA 2GTDA 4BRDA 4BWMA 1TYQB 1OH5A 2VCPA 1HJOA 3D0PA 1NMNA 5F0XA 1S72N 1SKSA 5JVGL 1C0FA 4GV6A 2UYTA 1OVYA 4J2EA 4M3YA 3HM9A 1RT7A 4HHTA 3DM2A 4O4GA 4JKCA 4CI6A 4B9NA 3NF6A 3OYFA 1NGGA 3KLEA 2EX3A 3UKRA 4WQ5C 1VSIA 1BCOA 4YDUC 2HNDA 2E2QA 2O8EB 1KAXA 4CFCA 4RW6A 1TUYA 4IBNA 1XHXA 2ATQA 2OZMA 4CGJA 4OPAA 1VQNN 4CEDA 4FW1A 1JJ2M 3CCRN 4E0DA 2ZF5O 5AR0A 1ZBSA 3J8AA 3H1QA 3T1YK 1OKJA 1VSLA 2QTDA 1T6CA 4DG1A 1BL3A 4OKJA 4RW8A 1XWLA 3T1AA 1J5OA 3NE6A 4FM0A 2BE2A 4JK8A 1E4FT 3K59A 1QQMA 3VQ8A 3RVCA 3VQQA 4E1NA 1MWKA 2WBNA 4GV9A 5AQUA 3AAPA 4M3RA 3RTVA 2IVOA 2X6SA 1WSHA 4H0VB 5ADXA 5DM6L 3EY1A 5LY3A 1HQUA 3AA5X 2FSJA 2GEMA 3F73A 2F4VK 4CGGA 2DTUA 5HRNA 4PHTX 1HX1A 3MN7A 3KVGA 4O44A 3SBGA 2KFZA 4N47A 5AZJA 5AQQA 3DXMA 4N76A 1KLNA 3GDQA 4E1JA 4FK0A 1RBVA 3ZX3A 3IFRA 5H1SQ 2E8AA 1G99A 4BC3A 3RMCA 1GLDG 1T3VA 4M3ZA 1HLUA 2G8UA 3ZT1A 3L4QA 2GX9A 1VK0A 4BRMA 4BRCA 4HUEA 1RBRA 1J6ZA 1LWFA 3AVFA 4M7XA 4OKEA 2ETJA 5CYMA 4KHQA 1LWEA 4DFKA 4ILHA 1U48A 4K42A 5KPTA 2A41A 5ADXH 4B3MK 2O8DB 2D0AA 2G8HA 3SQ1A 3B6PA 3AA4A 3BF3A 3I33A 4E7IA 4O0JA 4CHNA 4WQ5A 2LSNA 4KI4A 3DWLA 5AQNA 3NH0A 3H45C 5FPEA 4IOXA 4OJRA 4C8MA 2D0BA 4GW6A 3CD6N 4DCHA 1JLQA 1SKRA 1SUQA 1L5UA 1VSFA 3VEOA 3TARA 4FZYA 2DPNA 4FJXA 1W2BM 4JKBA 5AZIA 4DS5A 4GKKK 3VOVA 1WB9A 5ELZA 4A57A 2F9WA 1BIZA 4TSXA 4A5BA 3JSMA 3G4SN 2YJEA 1RTDA 1VSHA 3EKSA 2D1KA 3SLCA 3OY9A 4CJTA 3O5BA 2NUBA 3CM5A 3J7AP 4E7HA 3CMEN 1UA0A 5IT9O 1X9JA 1NK5A 4G1QA 3OYCA 3ZEUB 3WNHA 2PBDA 3BF1A 4CFBA 4AM6A 1I39A 3QNOA 3MN9A 4IFYA 3MEGA 2UXCK 1GLCG 2GWJA 1FKOA 4DU3A 5EY4A 3QIPA 2OCEA 3RSEB 1KSPA 3SAHA 2IVPA 1S3XA 2D0PA 3HRGA 5EVZA 2RF2A 3CCVN 4OLAA 4CZGA 1C0GA 3VQ9A 2IAJA 3MDQA 1CLQA 4I9QA 3VGKA 5C15A 3OYJA 4AHTA 4BDYA 3TAMA 1V4SA 2Z1HA 4H0OA 2OTLN 1DKGD 2FF6A 3ZX2A 3G71N 1M90O 2GUPA 2DFFA 4KREA 1LV5A 3SUNA 1NJIO 3KKRA 2FF3B 3VEZA 4DQ8A 2V51B 1NKEA 2HHTA 5AQZA 4XH5A 3I8BA 4ISEA 3THYA 4BR4A 3DLLL 3LP3A 1QQOA 5FPMA 3TWHA 3I8DA 1N5YA 4F3TA 3ZSOA 3KHYA 3R1XA 3H1VX 3D7EO 1A5WA 2P9KA 5HP1A 3EE9A 4KHYA 1B92A 5BPNA 4A2BA 4H0YB 1VSKA 4FVMA 4IDKA 1X9MA 3TSUA 3CCJN 3M8SA 3QO9A 2I7NA 1MA9B 4CZFA 3DJCA 2AA4A 5LL6Z 2CGKA 4OVLA 3C6HA 1K73O 2O8CB 4A5AA 4FJ9A 2BTFA 4CFAA 4KB1A 4W5NA 3QFUA 4BE0A 1T6DA 3U4LA 4AHVA 4N41A 5J2NA 1TL1A 1JKHA 3ENHA 1B9FA 1XC9A 2X78A 4X62K 4Z4HA 3ENOA 3WNEA 3CCUN 3J7ZO 1VQ8N 1RT6A 3VMFB 3LAMA 2X74A 3K5NA 1D8YA 4CJWA 4Y0WA 4IO8A 5LJVA 4H5NA 1VRUA 2FSKA 3IAYA 2Q97A 4JKGA 3GOIA 1LAVA 1YVUA 4IXCA 4DTPA 4F8RA 3WXIA 3V1OA 1TKZA 1T8EA 3LM2A 2E4LA 4DF4A 2ZWHA 3O9TA 4M45A 1S5JA 1JCEA 5KQ8A 4M3UA 5MLCQ 4DU4A 5CY4A 1MWMA 3EKUA 3EO3A 2RKIA 3AVGA 3BZCA 3VEYA 3NF9A 4BRIA 1M1KO 1VQLN 3VA3A 4DV6K 1EX4A 2UUCK 3PY8A 3K0SA 3ZSRA 2F7TA 3NGZA 2XRIA 1KVCA 5BRFA 4H5VA 4FWQA 3DOKA 1BI4B 4CZEA 4FOEA 1QHAA 4BQLA 2YKNA 4R79A 5CZ2A 4YY3K 4CF0A 4WFAL 3NCIA 1CXQA 5HLFA 3UKUA 2HHWA 3IKMA 1VQ5N 1NJZA 4JS4A 4I9LA 3WXLA 3T3FA 3QETA 1T44A 4BWJA 3O3FA 2W40A 2P9NB 1RDAA 1Z05A 3DAWA 3S41A 2BGGA 3RR7A 3E9PA 4LH4A 5JVHL 1ESVA 2IIRA 1ATNA 4BREA 5CR4A 3V9XA 2HSTA 3LDPA 2YX6A 4CEFA 3PX4A 4FJHA 1D9FA 4FJJA 4LF9K 3VENA 1NGIA 1TKTA 3KD1E 3MMVA 1YHQN 2WFBA 2YI1A 2FBTA 2CGLA 3W0LA 1BQMA 2XY7A 3AV9A 1X3MA 3O3GA 1FXXA 2YNFA 4CJSA 2JLEA 3N4PA 1R59O 1C0TA 2E20A 3OYLA 4V19S 2YHYA 4RTFD 3K9JA 5LMUK 5GADP 1D9DA 4BR9A 5HRRA 4FJLA 2ZE2A 1RT5A 3K9KA 1BWFO 4H0PA 4WF9L 5SWMA 1LW2A 3EEQA 4CJVA 1RBSA 1NK6A 1XI1A 3JS6A 4IDHA 3QBXA 2A1RA 1IO2A 1RT3A 1QE1A 2ASOA 4J8FA 2FC0A 3VF2A 3ZLJA 2RHKA 1RDWX 3DXKB 4MO5A 2HVIA 5AQWA 5TKYA 2HBKA 4DQIA 4E3SA 1VQPN 1D5AA 4Y1CA 3VQEA 2OANA 3DLHA 3MCAB 4NLBA 1N8RO 1N36K 3G6EN 4BRPA 4JYAK 5AQMA 2UUBK 5BRDA 3P39A 4I6MB 1CXUA 4FL9A 5AJ3K 1A5VA 2E6MA 4B3TK 3C6UA 3C7NA 3SUOA 1BCMA 3O4NA 4CZMA 1KVBA 4LFAK 3LDOA 4JKEA 3I55N 3MK6A 5M1KA 2VGMA 2Q1NA 5AQYA 4CBUA 1DEJA 4AQYK 3NAEA 2O4GA 1TYQA 3M6GA 3AAQA 2HNYA 2FXUA 2QXFA 2V7ZA 3TTDA 4DSFA 1C1CA 1BHLA 3VQ6A 3DRPA 4KKOA 4C1NK 4CJPA 2E5LK 4BVPA 5EX5A 3HPOA 2UU9K 4ISGA 2QWMA 1W7AA 1IBKK 3ZCMA 5KPRA 1IBLK 4FJGA 3B8AX 5AFUA 1HNXK 4W5QA 4FOIA 2O8EA 1BQNA 1RBUA 2Q0RA 5KRTA 4M3XA 4CJQA 1MU2A 3FZHA 1SKWA 5EU7A 3LWLA 1LOTB 4JKDA 3PO4A 5A2QO 4KHPK 1U4BA 4OGCA 2P9SB 3FFIA 1WAJA 4DFPA 1YITN 4M42A 1HMVA 3SV4A 1NNEA 4LFBK 1U47A 3QNNA 1OH8A 4U67L 3RMAA 2DFEA 4PUOA 2F8SA 2NRXA 1JL2A 2P51A 4F2SA 4N56A 3AA3A 3HPHA 2FBYA 1JXBA 3CC2N 2VWJA 3CI5A 4DSEA 2WC9A 3TANA 1HR0K 3M1FA 2B6AA 1BU6O 3CFPA 3L2UA 4QCLA 5AFUH 4DSLA 4K43A 3VF6A 1FKPA 1K6YA 3NF8A 3ID6A 3V1RA 3B6OA 4NXMK 3OA9A 4CJRA 2W41A 2E1YA 1X1PA 3HSCA 3C95A 3LALA 3TU5A 4YOVA 1TK8A 1NGCA 2VQFK 2Z1GA 5M1NA 1ZBFA 1U45A 3A0IX 3Q7BA 3HJFA 3E9LA 4FWMA 2XY6A 3AVLA 2RN2A 2QA4N 4IOCL 4CVNE 1NGDA 4DSIA 4JKHA 3AVBA 4CEBA 2V7YA 4BACA 4DV1K 1JCFA 4AILC 4B3SK 3A5NC 3THVA 2WUSA 2EWSA 2E2NA 3OS1A 1GLAG 1GLBG 4KHNA 2ZGYA 3SAFA 2W6LA 1TAUA 1NGEA 1YT3A 4BRNA 3SPZA 1KXPA 1JXEA 3C6TA 2P9UB 4KO0A 2E1ZA 5FROA 3VQ5A 3V9ZA 2QXLA 4CEQA 1HYSA 4CIGA 3HL8A 4DR5K 3HOTA 3WQUA 3C65A 4FJNA 1NKCA 4CGDA 1NBWA 4NB4A 3CCLN 2HF4A 3F9KA 1IKXA 4JI4K 4DTXA 1GLFO 4F4KA 4IG3A 3HZ6A 3OW2M 4F2RA 4CHQA 1D4XA 1Y97A 1T7PA 4HWIA 3LP2A 1C0MA 2KTQA 2NRVA 3PX6A 1JLFA 4EIAA 2WONA 3J7YP 3PSIA 1S22A 3P1GA 4NYNA 4BC2A 4DSJA 1ZXOA 5BPLA 4PL7A 2YNGA 4XH4A 1VSDA 1QQCA 3LP1A 3F2KA 4DR2K 4DTOA 3RSEA 5JMVA 3M8QA 3CMAN 3QDKA 4DTSA 2O4IA 3ULDA 4B9LA 1RGIA 2Y1IA 1YJ9N 2NRRA 1VQKN 2FBXA 1C0UA 1NMDA 3LPTA 4DFJA 4LF5K 3TTFA 5BPMA 3ZSVA 4H03B 3OYEA 5EOYA 1KLMA 3GG4A 3P5JA 1C6VA 4DHYA 4DQQA 3HBTA 3HK2A 5GINA 1HQEA 4H5WA 3L6QA 3IMXA 4Z4FA 3NH1A 4HVJA 1U49A 4B1YB 3A2FA 4AHCA 1U2VB 4IZ9A 4A59A 4Z94A 4LF6K 1QSSA 5I9EB 3VF4A 4KRFA 3THXB 3LL3A 1A5XA 5AQFA 3JAMO 2VG5A 4ISFA 3OYMA 1S9EA 3IG1A 1TK0A 1TUUA 5BN9A 1WN7A 1O13A 2QEXN 1DT9A 4M41A 2KHOA 1VQ7N 3O1BA 4CK2A 4CF1A 4DTUA 4WFNL 4DR4K 4K25A 4BR0A 3V4IA 3TAEA 1RTHA 3FGUA 4CJ5A 1WBBA 3KIOA 4CK3A 2O8CA 3QEXA 4LSLA 4CZHA 2P9IB 1C1AA 4KH4A 4E7JA 4AF1A 4DLGA 2NRZA 2YHWA 1T03A 1NJXA 4Q5VA 3V9SA 1TAQA 4U7BA 3AGRA 1EETA 1EWQA 3LZJA 2BH1A 2ITGA 2QW9A 1BUPA 3D2EB 4B8CA 3VEWA 3MXMA 3ZT4A 1SQKA 3SJJA 4BR5A 1CZAN 1L3SA 3SJHA 3CQXA 4N5SA 3SUPA 3ZYYX 3R3LA 3WXMB 5BN8A 1EWRA 1XC3A 3D45A 5JS1A 1Q8IA 3DOLA 3FZKA 2BANA 3UE5A 3OVNA 4XIUA 1UAXA 3DMJA 3J81O 1FW6A 3P31A 3SQ2A 3OYGA 1XNQK 3V6DA 2HBMA 4CHPA 1U6ZA 1S9GA 4CD3A 3M3ZA 3TTCA 3PX0A 4JI0K 1W9HA 5C25A 3V9UA 3AVJA 3OYNA 3AO3A 1XNRK 2QI2A 3CHWA 1XMQK 3SCXA 4FJKA 5CZ1A 5AQPA 1OH7A 1VRTA 3NMUA 2G8FA 4ILJA 2JGUA 1HNWK 1RDBA 3IDHA 4WFBL 2HVHA 1S1TA 2ZD1A 1J53A 1N34K 1QTMA 3KLGA 3OHRA 4AHRA 5J2QA 3HP6A 1VQ9N 1RCHA 1CZBA 3OTOK 4CESA 3L3VA 4I2PA 4HCBA 2B5JA 4GV3A 4BRQA 4RG8A 4DKWA 2VYPA 4BGAA 4BC4A 4NCGA 5HBMA 4EZ6A 2DY4A 3H3NO 4XH1A 3G0ZA 1VSMA 3PIOL 2Q0UA 3RMDA 3U9ZA 3ZSXA 3IS9A 3EZ5A 1Q82O 1K9MO 4E19A 1NM1A 2GUIA 3CCMN 3ENBA 4IOAL 2A6AA 5BRHA 1NK0A 1NGFA 4CW7B 3AVIA 5AQRA 2QWQA 1S1WA 4O55A 2QM1A 3DI6A 4O5BA 3TAGA 3U8XA 1G15A 3MEDA 3MCPA 3T7ZA 2VWBA 4CHYA 3CJ1A 4EP4A 3TI0A 1KFSA 3NDKA 1IKYA 4CK1A 4GY2B 4FWNA 2GELA 3U6FA 2YV0X 4CZLA 3CJCA 3O9QA 3QEVA 4PWDA 3SNNA 5KGXA 3OBWA 2ITMA 4BRGA 4Z4EA 4JLHA 4M3TA 1ZBLA 2ZM6K 1S1UA 2ZQBA 4YOUA 3VQCA 4K0KK 3CJAA 2R7YA 4BR2A 4K8ZA 1IJJA 3J80O 3CC4N 4DR3K 1YJNN 1NK4A 4QOZB 2O8FA 3WNGA 3R9PA 1GLJO 3S3NA 1JLCA 4JNEA 1YUWA 3CCEN 1ZBHA 1HNVA 4DV2K 3OYBA 4PL8A 5DM7L 4JK9A 1UWBA 4J2DA 3E9OA 4HUFA 4FXDA 3DXKA 4FWOA 4CEEA 3JYTA 4C8OA 1GLEG 1HPZA 2QKKA 1L3UA 3BY5A 3TSQA 4B9UA 3ULEA 1RTJA 3CETA 3ZT0A 3AO1A 3GBTA 4KTQA 1RT1A 3LPUA 1P8ZA 3A5LC 3CJ9A 4FVUA 4C23A 5AQLA 3AO5A 3HT3A 3JXUA 3VESA 4I6MA 1YI2N 1GOCA 4B8AB 1NJWA 4W5TA 1VAZA 4DQPA 3KTQA 4CHZA 2P5GA 1S6QA 3MX5A 5CHIA 3O08A 4ICLA 2YHXA 3MECA 1SL2A 1WSJA 3H3OB 3L2QA 1SS6A 3V9WA 4JHDB 1NOYA 4WYBA 1WSGA 5B8HA 2Q31A 2NZTA 2OPSA 1S1VA 1JLEA 1IG8A 1HKCA 4BRAA 3E66A 1N6QA 3HM8A 3L0QA 2YHBA 2DFHA 3CERA 1IKVA 4X65K 3EZWA 1QVFM 4PKGA 5LMNK 3A5OC 3SV3A 5E26A 4MO4A 2B4JA 2GBZA 2JWKA 5D3GA 1EXQA 3CJ7A 3CYMA 1HKBA 1EQYA 3NHGA 5DMRA 1KVAA 4ZHRA 4BE1A 4X64K 3TAQA 4QS7A 3LZIA 4DMNA 4PY5A 3HOSA 2W42A 4CD1A 2QWPA 4KPYA 4CCHA 5I3UA 1Z25A 3TAFA 1U04A 3VQBA 4RCHA 1KRPA 1HKGA 3F5TA 3AY9A 2P9SA 2O8BB 3MN5A 3EYZA 3O4QA 4CJ7A 4CE9A 4CGFA 1X9WA 2F96A 4FWKA 5HRPA 5GIPA 3WQTA 5C0YA 3QEPA 3MWPA 5AQHA 4GVMA 1NGJA 4YFUA 5C12A 3OYKA 5K14A 2YCHA 4Z4IA 1HYVA 4LF7K 2G8VA 3QIOA 3CQYA 2QWOA 3CG7A 2ASMA 4BDZA 1XHZA 3AA2A 3ALYA 1WLJA 1J5EK 5KPZA 1TGOA 4H4MA 4BVOA 3KLHA 1DLOA 2HMIA 3HVTA 4JKAA 3HXMA 5BREA 4UQGA 3KJVA 4FWSA 3KK2A 4JD2B 3BGRA 3CPEA 3ZSZA 2CGJA 3WXJA 1YVNA 4GVEA 1W0HA 1IKWA 4KH6A 4CJLA 4L8RB 3U3GA 2PZSA 3SPYA 1T05A 3ID8A 4JRQA 4WCEL 1KTQA 1XMOK 1NGBA 4JK7A 4L3QA 3O3HA 5AQJA 4FLUA 5GIOA 3M8RA 3EN9A 4H0XB 4B9VA 2YJFA 2IGIA 2YNIA 3D2FB 3VQDA 4WQ4C 3KLFA 1EKEA 4F3OA 2J4RA 4DV7K 4ID1A 4CJKA 3SQ0A 1RNHA 3G10A 4OO1J 1ZBIA 3K5LA 5AQIA 2P9UA 3WEEB 4CZJA 1RT4A 1KFDA 2EHGA 2Y1JA 3SQ4A 4CJ3A 4FCYA 5EXWA 1VQ4N 3L4IA 4FWRA 5M1FA 2WOMA 4BG8A 5KTQA 4IEIA 5C2DA 3A5MC 4PA1A 2HB5A 5DK5A 1JCGA 4B1UB 1BO5O 5BR8K 3M8PA 5F1XA 3L2VA 4FLXA 4NCAA 1TK5A 4BGBA 1JL1A 3AVMA 3HPGA 2KLAA 2XHBA 1LAWA 4CJ4A 4HUGA 2Z1IA 2GV9A 2YKMA 2VG7A 4BDPA 4YOWA 2E6LA 4EHUA 1XQSC 4RW9A 3SUQA 3V1QA 3KK7A 4BQZA 5FLXO 3QMLA 1GLLO 1QS4A 4LFCK 4H0TB 1IV0A 3AVKA 3O9RA 4O0IA 3PLAA 3AVCA 3VQ4A 4B3RK 4LH5A 1TVRA 4G9ZA 1Q9XA 1DTQA 1KAYA 4HCCA 3NH2A 3VTIA 2Q2RA 4B9SA 1RDUA 4BRKA 2PYJA 2QKBA 1C1BA 3K2PA 3SBTA 4IJAA 1NOZA 1WNSA 1Z26A 4DU1A 4YNQA 4BRLA 4OKKA 4FSVA 4FM2A 3AVHA 3L8BA 1HRHA 3QICA 4ELVA 1U2VA 1NKBA 2HHUA 4EAHD 2G8KA 3HI0A 1E4GT 4WQ4A 4F9OA 1ILYA 5JICA 1FJGK 3O6WA 4CJEA 3THXA 3H6EA 5I42A 1WBDA 4DWIA 3H46O 5LJWA 4RWTA 3D6RA 4EP5A 4JEPA 2OPQA 2O8DA 4A2AA 5M1PA 3E1YA 4JV5K 3GE1A 4Q0BA 3QINA 3MEEA 1OVQA 3K5MA 4BY9C 2OA8A 3FZFA 3I0RA 3LANA 2P9IA 4NLCA 2YHAA 3T69A 5KRSA 2P9LB 1KQSM 2KFNA 1XUPO 1QSLA 5AQGA 5TKWA 1Y64A 2XY5A 5CYQA 3D2EA 3CFOA 2W6KA 5GAGP 4FW2A 4A62A 2RE2A 2P9PB 2HHVA 1EO1A 4AH9A 2OTJN 3ZEUA 1JLAA 4LY7A 2HW3A 3CQ8A 3O9SA 2XY8A 4M63C 5KQDA 2A40A 3G25A 3CCSN 3BZKA 4JI3K 1K8KB 4E1MA 1QHTA 3O4WA 3QEIA 2I5JA 4CECA 2ZJPL 2QWLA 4FLWA 4ID5A 3DRRA 4CERA 3THWB 4DQRA 3EL2A 4DUYK 2HHSA 4BRHA 4C8NA 1TKDA 1VQ6N 5C42A 5CE3A 4NYFA 4Z4GA 3C0BA 3K58A 3VEVA 3O80A 3P4IA 2NRWA 4CZKA 4OPJA 3ZETB 4Z0UA 1VQMN 4PKIA 4M3WA 3HO1A 1IBMK 4BR7A 1SZ2A 5J1EA 2VQEK 2OPRA 3TR8A 3AVAA 1HUXA 4M7YA 1Z6RA 4J2BA 4KBOA 3U9DA 5HOOA 3IRXA 4C8LA 1YXQA 2AP1A 4FZZA 4FK4A 1YAGA 1VSEA 1I94K 5J2PA 4JI8K 5JLFA 4OX9K 4R5PA 1DTTA 1X9SA 4BRFA 1NG9A 4KI6A 3RMBA 1MDUB 3ATVA 4FZXC 3MXJA 5C10A 5C24A 1Q86O 4DR1K 1HYZA 2HHXA 2D5RA 1ASVA 1BISA 5JS2A 4AHUA 1H1VA 3KD5E 1YTUA 4YORA 3LP0A 4ZTFA 3OYIA 1ZYQA 4KH5A 3P38A 1WSFA 5FPNA 3WNFA 1QZ5A 4IEEA 4YDUA 4MFBA 4JI5K 3NVKA 3HVRA 4ELTA 1Q9YA 1HNZK 4ZTJA 4MDAA 4FM1A 1BA1A 1YTAA 3UKRB 1SL1A 3RRGA 4E7LA 3CM6A 4DS4A 4O5FA 3MN6A 1BDGA 2NRHA 3CCQN 3QERA 3C6AA 2ASPA 1WSIA 2WTUA 4LC9B 1UOCA 3T19A 3ZSWA 2ZGZA 2QWRA 4KHWA 3NVMA 3DRSA 4LSNA 4FO0A 4I7FA 3LDLA 4QS9A 2PFUA 4H8KA 3S3OA 3SAGA 2H3GX 3SMSA 1ASWA 3ATUA 5C2FA 3ISNC 3KZBA 1V4TA 2NLXA 3ZX0A 4X66K 1J9AA 4B9TA 3CFRA 1TL3A 3WT0A 4H4OA 1W97L 1P90A 4C8KA 1RDCA 1RFQA 4CF2A 2GWKA
chains in the Genus database with same CATH topology
3AAQA 1VAZA 3SMPA 3TTDA 2FXUA 2V7ZA 3MX5A 4OPAA 1VQNN 3EE8A 5CHIA 3O08A 2YHXA 1JJ2M 3H3OB 3CCRN 1SS6A 4IWVA 4C1NK 1QZ6A 5F2RA 2ZF5O 4JHDB 4BVPA 4YOYA 1ZC6A 1ZBSA 3J8AA 3H1QA 4WYBA 5AR0A 5EX5A 5B8HA 4ISGA 2Q31A 1OKJA 2NZTA 1KAZA 2QWMA 2NNWA 2QTDA 1T6CA 1IG8A 1HKCA 4BRAA 5KPRA 2HBLA 3E66A 3B8AX 5AFUA 3HM8A 4JK8A 1E4FT 4FOIA 1QQMA 2QWNA 1Q81O 3WUHA 3L0QA 2Q0RA 5AZJB 3CERA 3RVCA 3DXMB 3EZWA 5HL7L 1MWKA 1QVFM 3FZHA 2WBNA 4GV9A 5AQUA 4B1VA 4PKGA 3AAPA 3A5OC 4MLHA 1LOTB 2IVOA 4JKDA 5E26A 4MO4A 4JHDA 4H0VB 5ADXA 5DM6L 2P9SB 4FWLA 2JWKA 2V52B 5LY3A 2PAVA 3VERA 3CJ7A 1YITN 2FSJA 1HKBA 2GEMA 1EQYA 2P9NA 5GAEP 4U67L 4XEIA 2NRXA 4PHTX 4QS7A 1HX1A 3MN7A 3KVGA 3SBGA 4H5RA 3CC2N 5AZJA 5AQQA 3HOSA 3CI5A 4CD1A 3DXMA 2QWPA 2WC9A 3GDQA 3FZMA 3KWIA 3VGMA 4E1JA 3M1FA 1BU6O 3ZX3A 3IFRA 3R6MA 5H1SQ 5AFUH 4RCHA 2E8AA 2A5XA 1G99A 1HKGA 4K43A 3VF6A 4BC3A 3F5TA 1GLDG 1T3VA 1YF5L 3ID6A 5JLHA 3CJBA 1HLUA 3AY9A 2P9SA 3L4QA 3OA9A 3GL1A 3MN5A 2GX9A 2FSNA 2W41A 4BRMA 4BRCA 4FPAA 3LDNA 4CJ7A 2E1YA 1J6ZA 3HSCA 1Q18A 4M7XA 2F9TA 3TU5A 1YJWN 4YOVA 2E2OA 3BEXA 5AZIB 3VGLA 1NGCA 1X3NA 4FWKA 4ILHA 5GIPA 4K42A 5M1NA 3F9MA 3WQTA 5KPTA 2A41A 5ADXH 5C0YA 3A0IX 3Q7BA 3MWPA 3E9LA 4FWMA 5AQHA 1NGJA 3I33A 3BF3A 4FPBA 4QS8A 5C12A 2QA4N 3QBWA 4WQ5A 2YCHA 4GNIA 3DWLA 4IOCL 5AQNA 4UY8O 3H45C 5FPEA 4IOXA 5E84A 1NGDA 3CQYA 2Q36A 2QWOA 4JKHA 3CD6N 3M5RA 4DCHA 1WOQA 2ASMA 2V7YA 1JCFA 3VEOA 2DPNA 4B1WB 3A5NC 3FLCO 1ATRA 2WUSA 4O8UA 5KPZA 2EWSA 1W2BM 2E2NA 4JKBA 4BVOA 5AZIA 5AQKA 3VOVA 4JKAA 1GLAG 5ELZA 4A57A 1GLBG 2F9WA 5BREA 1NGAA 4A5BA 2ZGYA 3VEXA 2D0OA 4FWSA 3SAFA 4JD2B 3CPEA 3G4SN 2YJEA 2CGJA 3WXJA 3EKSA 1NGEA 2D1KA 1YVNA 4GVEA 4BRNA 4KH6A 3SLCA 2VGNA 1KXPA 4BG9A 2P9UB 2E1ZA 3O5BA 3CMEN 1X9JA 2QXLA 3ID8A 3ZEUB 2PBDA 3BF1A 4WCEL 3HOTA 4AM6A 3WQUA 1BOTO 1NGBA 3C65A 3MN9A 4JK7A 4L3QA 4CZIA 1NBWA 3MWTA 1GLCG 2GWJA 4NB4A 2HF4A 5AQJA 2CH6A 5AQSA 3CCLN 5GIOA 5EY4A 3QB0A 2HOEA 3BUZB 3EN9A 4H0XB 1GLFO 2YJFA 3HZ6A 3D2FB 3RSEB 4WQ4C 4JD2A 3OW2M 3N4QA 3SAHA 2J4RA 2IVPA 3W3DA 1D4XA 1S3XA 2D0PA 3HRGA 5EVZA 4HWIA 4OO1J 4YOXA 3CCVN 2NRVA 4CZGA 1C0GA 3MDQA 2ZJQL 5AQIA 2P9UA 3VGKA 4EIAA 5C15A 1VQMN 3UB5A 3WEEB 4CZJA 2E88A 1S22A 1V4SA 5AQOA 1KC8O 4MLEA 4BC2A 4H0OA 1Q7YO 1ZXOA 5BPLA 3AGKA 5EXWA 3R8EA 2P9KB 1VQ4N 3L4IA 4PL7A 2OTLN 1DKGD 2FF6A 3ZX2A 3G71N 4FWRA 2GUPA 5M1FA 4XH4A 1M90O 4BG8A 4B1ZA 4IEIA 5C2DA 3A5MC 3F2KA 5BR9A 1NJIO 3D2FA 3RSEA 1JCGA 5JMVA 4B1UB 3CXCM 2FF3B 1BO5O 3CMAN 3QDKA 3VEZA 4H5TA 4CBXA 4DQ8A 2V51B 5AQZA 1HPMA 5F1XA 4XH5A 1RGIA 3I8BA 4ISEA 4BR4A 2NRRA 1YJ9N 1VQKN 3DLLL 5FPMA 1QQOA 4BGBA 3WEEA 1KD1O 1NMDA 5AQXA 2KLAA 3KHYA 3TTFA 5BPMA 3R1XA 3H1VX 3D7EO 4H03B 2P9KA 4YOWA 3EE9A 5EOYA 4EHUA 5BPNA 1XQSC 3GG4A 4A2BA 2HBJA 4H0YB 3KK7A 4BQZA 4DHYA 3O9UA 1YI2N 3TSUA 3HBTA 3QMLA 5GINA 1GLLO 4H5WA 4CBWA 3CCJN 3LDQA 2I7NA 3L6QA 1MA9B 4CZFA 3OBYA 3DJCA 2AA4A 4H0TB 2CGKA 1NGHA 3IMXA 3C6HA 1K73O 3O9RA 5FPDA 4B1YB 3CIPA 3CF5L 3PLAA 3KWGA 4G9ZA 1U2VB 4IZ9A 4K41A 1KAYA 3WXKA 4A59A 4A5AA 4Z94A 4AM7A 2BTFA 3VPZA 5I9EB 3VF4A 3VTIA 2Q2RA 1RDUA 4BRKA 3LL3A 4BROA 1DGKN 3QFUA 5AQFA 4JKGB 1T6DA 4ISFA 3U4LA 3AARA 2A42A 3SBTA 1TUUA 5BN9A 1O13A 2QEXN 1DT9A 2KHOA 4IJAA 1VQ7N 3ENHA 3O1BA 4WFNL 4BRLA 3ENOA 4K25A 4BR0A 3CCUN 3J7ZO 4O8KA 1VQ8N 4FSVA 4HTLA 3FE1A 3VMFB 4PKHA 3FGUA 2KKZA 3QICA 4IFEA 4Y0WA 1U2VA 4EAHD 4CZHA 3HI0A 1E4GT 2P9IB 4IO8A 4WQ4A 4KH4A 4F9OA 4H5NA 5JICA 5LJVA 1ILYA 3O6WA 4AF1A 2I7PA 2FSKA 3H6EA 3H46O 5LJWA 2Q97A 1SAZA 2NRZA 4NO7A 4RWTA 2YHWA 3D6RA 4JKGA 3GOIA 4JEPA 2CH5A 4A2AA 4IXCA 5M1PA 3WXIA 3E1YA 3ULEB 3GE1A 3AGRA 4FWPA 4U7BA 3CC7N 3LM2A 2BH1A 5M1QA 2QW9A 1BUPA 3D2EB 2ZWHA 3VEWA 3O9TA 4IJNA 4BY9C 4DB3A 1K8AO 1SQKA 1JCEA 4BR5A 5KQ8A 1CZAN 4A61A 3FZFA 1NLVA 2A3ZA 3SJHA 4IO9L 3CQXA 1QVGM 5MLCQ 3SK3A 2P9IA 4NLCA 2ZJRL 3T69A 3ZYYX 1MWMA 3EKUA 3EO3A 3R3LA 3WXMB 3VEYA 4BRIA 2P9LB 1M1KO 1VQLN 5BN8A 1KQSM 1XC3A 4B1XB 3UKUB 1XUPO 3FZKA 5AQGA 2F7TA 1ATSA 5TKWA 3UE5A 1Y64A 4EHTA 4BC5A 3P31A 5BRFA 2HF3A 4EFHA 4H5VA 4FWQA 2HBMA 3D2EA 4CZEA 4FOEA 1U6ZA 3BP8A 3M3ZA 3TTCA 4CD3A 5GAGP 4A62A 2RE2A 2P9PB 3CPWM 3FFKB 1BA0A 1EO1A 1QHAA 2OTJN 3ZEUA 4BQLA 3FR0A 4R79A 1LCUA 3O9SA 4WFAL 2QI2A 3CHWA 2BUPA 4JKFA 2P9LA 4M63C 4OPHA 5KQDA 3LM9A 5AQPA 2A40A 3G25A 3UKUA 3CCSN 3NMUA 3IKMA 1VQ5N 4ILJA 3WXLA 1K8KB 3O8MA 1T44A 3PIPL 3IDHA 3Q7CA 3O4WA 2W40A 4WFBL 2P9NB 4JN4A 2ZJPL 3I56N 2QWLA 1Z05A 3DAWA 3S41A 2P9PA 3EL2A 3E9PA 3VETA 1NWKA 4BRHA 4YOTA 3MX2A 3OHRA 5JVHL 1ESVA 1VQ6N 4MDBA 2IIRA 5CE3A 1VQ9N 1ATNA 4BREA 5CR4A 2HSTA 2NRTA 1QQNA 3C0BA 3LDPA 2YX6A 4GV3A 4BRQA 3VEVA 4DKWA 3O80A 3P4IA 2D4WA 5M1OA 2NRWA 1NGIA 2VYPA 3VENA 3MMVA 3ZETB 4PKIA 2WFBA 4B9QA 4CZKA 4BGAA 2YI1A 4BR7A 1YHQN 2CGLA 1SZ2A 4BC4A 1K8KA 3W0LA 3H3NO 1X3MA 1HUXA 4M7YA 1Z6RA 4XH1A 4KBOA 3U9DA 3N4PA 2Q0UA 3PIOL 1R59O 3U9ZA 5HOOA 1K9MO 2E20A 4ILGB 1Q82O 1NM1A 3CCMN 1YXQA 2YHYA 4RTFD 3ENBA 1YIJN 1VQON 4IOAL 3A8YA 3K9JA 2A6AA 5BRHA 2AP1A 5GADP 4BR9A 1NGFA 1YAGA 4JAXA 1BG3A 2FLOA 2QWQA 5AQRA 2QM1A 3QFPA 3U8XA 5JLFA 2E2PA 3FZLA 3K9KA 3MCPA 3T7ZA 5AQTA 2VWBA 3ZETA 3CJ1A 5AQVA 3VTHA 4BRFA 1BWFO 4H0PA 4WF9L 1WUAA 3O1WA 1MDUB 3ATVA 3HTVA 4GY2B 4FWNA 5C10A 2GELA 4CZLA 1Q86O 3CJCA 3JS6A 4IDHA 3O9QA 3QBXA 3OBWA 1H1VA 4C1NI 2ASOA 3C7NB 2ITMA 4J8FA 4BRGA 4YORA 2HMPA 3VF2A 2IVNA 3TPQA 2RHKA 1RDWX 3DXKB 4KH5A 3P38A 4YOUA 4MO5A 5FPNA 1QZ5A 4IEEA 2JWLA 4YDUA 5AQWA 5TKYA 3TSPA 2HBKA 3CJAA 3NVKA 1VQPN 4BR2A 1IJJA 4MDAA 5GAHP 3CC4N 2OANA 1YJNN 3IUCA 1BA1A 3MCAB 4NLBA 3UKRB 1N8RO 3G6EN 2GTDA 1GLJO 3R9PA 4BRPA 4O5FA 4BRDA 3MN6A 4JNEA 5AQMA 1YUWA 5BRDA 1BDGA 1TYQB 3P39A 3CCEN 2VCPA 2NRHA 4I6MB 1HJOA 3CCQN 4FL9A 3C6AA 2ASPA 4PL8A 5F0XA 1S72N 5DM7L 4JK9A 4LC9B 2ZGZA 2QWRA 3C7NA 3E9OA 1C0FA 3NVMA 5JVGL 4GV6A 4FO0A 2UYTA 1OVYA 3LDLA 3DXKA 4FWOA 4CZMA 1GLEG 4QS9A 2PFUA 3LDOA 4JKEA 3SAGA 3MK6A 3I55N 2H3GX 4JKCA 3SMSA 3TSQA 4CI6A 3ULEA 5M1KA 3ATUA 5C2FA 1NGGA 3CETA 3KZBA 1V4TA 2NLXA 3ZX0A 3GBTA 2VGMA 2Q1NA 1P8ZA 4WQ5C 3UKRA 5AQYA 4CBUA 1DEJA 3A5LC 3CJ9A 4FVUA 4C23A 5AQLA 4YDUC 2E2QA 3WT0A 1W97L 1P90A 1KAXA 1TYQA 3JXUA 3VESA 4I6MA 1RFQA 1TUYA 3M6GA 2GWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1Q A;  5M1K A;  3CPE A;  5M1P A;  5C10 A;  5C12 A;  5M1O A;  5C2D A;  5C15 A;  5C2F A;  3C6H A;  4IEE A;  5M1F A;  4IDH A;  3C6A A;  4IEI A;  5M1N A;  4IFE A; 
#chains in the Genus database with same CATH topology
 1NU0 A;  4Z4C A;  2XO7 A;  3SMP A;  3DLG A;  4IKF A;  3EE8 A;  3K57 A;  3OS2 A;  4FJ5 A;  4IWV A;  4OPK A;  3KK1 A;  4DUZ K;  1QZ6 A;  5F2R A;  2Q3S A;  2UXB K;  4YOY A;  1ZC6 A;  3ITH A;  4KFB A;  3ZSQ A;  1NK7 A;  1KAZ A;  2NNW A;  4DF8 A;  1BI4 A;  2HBL A;  4CJF A;  4DFM A;  1RT2 A;  5HRO A;  2QWN A;  1Q81 O;  3DLK A;  3WUH A;  5J2M A;  3LDS A;  5AZJ B;  4FJ7 A;  3DXM B;  5HL7 L;  1VHX A;  4B1V A;  4MLH A;  4ELU A;  2RPI A;  1B9D A;  4JHD A;  1WSE A;  4DV0 K;  4KTZ A;  1RIL A;  2IOC A;  4FWL A;  2V52 B;  2IS3 A;  2PAV A;  4JI6 K;  3VER A;  2G8W A;  2P9N A;  1ZBU A;  4YHH K;  4KAZ A;  5GAE P;  4XEI A;  1GOA A;  4JI7 K;  3HST B;  5E41 A;  4H5R A;  3OS0 A;  2KZM A;  3P83 D;  3FZM A;  3KWI A;  3VGM A;  3OYH A;  4JRP A;  4KHU A;  3R6M A;  3OJU A;  3E01 A;  2A5X A;  4CFD A;  1L3T A;  5JLH A;  1TV6 A;  1YF5 L;  4DQS A;  3CJB A;  3GL1 A;  2FSN A;  4FPA A;  3LDN A;  1Q18 A;  1I3A A;  2F9T A;  1YJW N;  2E2O A;  3BEX A;  5AZI B;  3VGL A;  1X3N A;  3NF7 A;  3F9M A;  1ASU A;  4B3O A;  3TAB A;  1NK8 A;  4FPB A;  4QS8 A;  3QBW A;  2PYL A;  4GNI A;  4NXN K;  4HTU A;  4UY8 O;  4DR7 K;  5E84 A;  2Q36 A;  2O8B A;  3M5R A;  1WOQ A;  4DTJ A;  3NBP A;  4B1W B;  3FLC O;  1ATR A;  4O8U A;  4GMJ B;  3L2R A;  4KTW A;  3ZSY A;  5IWA K;  4B08 A;  5AQK A;  1NGA A;  4DV4 K;  3VEX A;  2D0O A;  1QSY A;  4KV8 A;  5T7B A;  3PV8 A;  4W5O A;  3QES A;  4BE2 A;  5FRM A;  3AO4 A;  2VGN A;  1SL0 A;  4BG9 A;  2KW4 A;  4CGI A;  4JS5 A;  3NGI A;  1NJY A;  3I0S A;  1BOT O;  4K8X A;  3NFA A;  4CZI A;  3MWT A;  1OH6 A;  1IG9 A;  5AQS A;  1SV5 A;  3KKS A;  2CH6 A;  4KB0 A;  1EP4 A;  3QB0 A;  2HOE A;  3BUZ B;  3PSF A;  1O1W A;  3T1H K;  1KCF A;  4JD2 A;  3N4Q A;  3W3D A;  4IG0 A;  2D0C A;  4YOX A;  1F21 A;  3OYD A;  3VA0 A;  2ZJQ L;  3THY B;  5SZT A;  3UB5 A;  3C94 A;  2E88 A;  1LWC A;  3AO2 A;  4MQ3 A;  5AQO A;  1BGX T;  1KC8 O;  4OLB A;  4MLE A;  1Q7Y O;  2IC3 A;  3AGK A;  3R8E A;  1GOB A;  2P9K B;  3ZT3 A;  1VSJ A;  4B1Z A;  3V81 A;  5HRS A;  5BR9 A;  4E89 A;  3D2F A;  3QEW A;  1S6P A;  3CXC M;  4H5T A;  4CBX A;  2G8I A;  4CF9 A;  3UIQ A;  1HPM A;  1FK9 A;  5FRN A;  3VN5 A;  3WEE A;  1KD1 O;  4AHS A;  5AQX A;  4FLY A;  2KQ2 A;  3DYA A;  3PUF A;  4PQU A;  3ZT2 A;  1JLG A;  4DV5 K;  2HBJ A;  4LF4 K;  3O9U A;  3VQ7 A;  4CBW A;  3LDQ A;  4DSK A;  1LW0 A;  1RDD A;  4DTM A;  4GKJ K;  3OBY A;  2QK9 A;  4DR6 K;  1RTI A;  1BIU A;  1NGH A;  1L3V A;  3SZ2 A;  3ASM A;  5FPD A;  3CIP A;  4Y1D A;  3CF5 L;  4DLE A;  3KWG A;  4FK2 A;  4K41 A;  3WXK A;  4I2Q A;  3L2W A;  4AM7 A;  3VPZ A;  1WAF A;  4BRO A;  1DGK N;  4E7K A;  4WE1 A;  4JKG B;  3VQA A;  1NK9 A;  1E3M A;  3AAR A;  2A42 A;  5FDL A;  4W5R A;  3DLB A;  2P5O A;  1UA1 A;  1N32 K;  2YNH A;  2O8F B;  4O8K A;  4HTL A;  4NCB A;  1HJR A;  3FE1 A;  4PKH A;  2KKZ A;  4FJM A;  4IFE A;  4JI2 K;  4CEO A;  3MAQ A;  2I7P A;  3DLR A;  1SAZ A;  4NO7 A;  2CH5 A;  5KI6 A;  2BDP A;  3SI6 A;  3ULE B;  2F8T A;  3CC7 N;  4FWP A;  1R0A A;  5M1Q A;  1ITG A;  3K5O A;  3HYF A;  4IJN A;  4CHO A;  4DB3 A;  1K8A O;  3RWU A;  4A61 A;  3H08 A;  1NLV A;  2A3Z A;  4IO9 L;  1QVG M;  3SK3 A;  2ZJR L;  2UUA K;  1IH7 A;  3KK3 A;  4B1X B;  3L3U A;  4IFV A;  4FLZ A;  3UKU B;  1ATS A;  4EHT A;  3PO5 A;  4BC5 A;  2HF3 A;  4EFH A;  2P1J A;  3BP8 A;  3CPW M;  1RBT A;  3MXI A;  3FFK B;  1BA0 A;  3S9H A;  2FBV A;  3FR0 A;  5KGW A;  4KHS A;  4J2A A;  1LCU A;  2X6N A;  3NGY A;  2VWK A;  3VQP A;  2BUP A;  4JKF A;  2P9L A;  4FLT A;  4OPH A;  3OJS A;  2OZS A;  3LM9 A;  4LF8 K;  4OGE A;  2AJQ A;  3O8M A;  3PIP L;  2HHH K;  3Q7C A;  1N33 K;  4CEZ A;  4JI1 K;  4JN4 A;  3I56 N;  3LAK A;  4FJI A;  2KZZ A;  2UXD K;  2P9P A;  4CF8 A;  3VET A;  1NWK A;  4YOT A;  3MX2 A;  4EZ9 A;  3KLI A;  4MDB A;  4DTR A;  3HP9 A;  3BDP A;  4DV3 K;  4FLV A;  2NRT A;  3QLH A;  1QQN A;  3AVN A;  2OYQ A;  2D4W A;  3OYA A;  5M1O A;  2A1S A;  4B9Q A;  1K8K A;  2IDO A;  2HHQ A;  3RRH A;  3THW A;  4ILG B;  3SYZ A;  4RW7 A;  1YIJ N;  1VQO N;  3A8Y A;  1TKX A;  4QAG A;  3TAP A;  4JAX A;  1BG3 A;  1S1X A;  2FLO A;  4CIF A;  3QFP A;  2Z1J A;  2E2P A;  3FZL A;  5AQT A;  3ZET A;  3VTH A;  5AQV A;  1WUA A;  4FYD A;  3O1W A;  3LWM A;  1HNI A;  3HTV A;  2PY5 A;  2HNZ A;  4B9M A;  2VG6 A;  4DTN A;  1JLB A;  3S3M A;  3U3Y A;  4CJU A;  4CGH A;  4CEA A;  1CZ9 A;  4C1N I;  4CIE A;  3C7N B;  2HMP A;  2IVN A;  4FJ8 A;  3TPQ A;  3DLE A;  4LD0 A;  2JWL A;  3TSP A;  4RW4 A;  2OPP A;  5GAH P;  3RR8 A;  1J54 A;  3IUC A;  1REV A;  2GTD A;  4BRD A;  4BWM A;  1TYQ B;  1OH5 A;  2VCP A;  1HJO A;  3D0P A;  1NMN A;  5F0X A;  1S72 N;  1SKS A;  5JVG L;  1C0F A;  4GV6 A;  2UYT A;  1OVY A;  4J2E A;  4M3Y A;  3HM9 A;  1RT7 A;  4HHT A;  3DM2 A;  4O4G A;  4JKC A;  4CI6 A;  4B9N A;  3NF6 A;  3OYF A;  1NGG A;  3KLE A;  2EX3 A;  3UKR A;  4WQ5 C;  1VSI A;  1BCO A;  4YDU C;  2HND A;  2E2Q A;  2O8E B;  1KAX A;  4CFC A;  4RW6 A;  1TUY A;  4IBN A;  1XHX A;  2ATQ A;  2OZM A;  4CGJ A;  4OPA A;  1VQN N;  4CED A;  4FW1 A;  1JJ2 M;  3CCR N;  4E0D A;  2ZF5 O;  5AR0 A;  1ZBS A;  3J8A A;  3H1Q A;  3T1Y K;  1OKJ A;  1VSL A;  2QTD A;  1T6C A;  4DG1 A;  1BL3 A;  4OKJ A;  4RW8 A;  1XWL A;  3T1A A;  1J5O A;  3NE6 A;  4FM0 A;  2BE2 A;  4JK8 A;  1E4F T;  3K59 A;  1QQM A;  3VQ8 A;  3RVC A;  3VQQ A;  4E1N A;  1MWK A;  2WBN A;  4GV9 A;  5AQU A;  3AAP A;  4M3R A;  3RTV A;  2IVO A;  2X6S A;  1WSH A;  4H0V B;  5ADX A;  5DM6 L;  3EY1 A;  5LY3 A;  1HQU A;  3AA5 X;  2FSJ A;  2GEM A;  3F73 A;  2F4V K;  4CGG A;  2DTU A;  5HRN A;  4PHT X;  1HX1 A;  3MN7 A;  3KVG A;  4O44 A;  3SBG A;  2KFZ A;  4N47 A;  5AZJ A;  5AQQ A;  3DXM A;  4N76 A;  1KLN A;  3GDQ A;  4E1J A;  4FK0 A;  1RBV A;  3ZX3 A;  3IFR A;  5H1S Q;  2E8A A;  1G99 A;  4BC3 A;  3RMC A;  1GLD G;  1T3V A;  4M3Z A;  1HLU A;  2G8U A;  3ZT1 A;  3L4Q A;  2GX9 A;  1VK0 A;  4BRM A;  4BRC A;  4HUE A;  1RBR A;  1J6Z A;  1LWF A;  3AVF A;  4M7X A;  4OKE A;  2ETJ A;  5CYM A;  4KHQ A;  1LWE A;  4DFK A;  4ILH A;  1U48 A;  4K42 A;  5KPT A;  2A41 A;  5ADX H;  4B3M K;  2O8D B;  2D0A A;  2G8H A;  3SQ1 A;  3B6P A;  3AA4 A;  3BF3 A;  3I33 A;  4E7I A;  4O0J A;  4CHN A;  4WQ5 A;  2LSN A;  4KI4 A;  3DWL A;  5AQN A;  3NH0 A;  3H45 C;  5FPE A;  4IOX A;  4OJR A;  4C8M A;  2D0B A;  4GW6 A;  3CD6 N;  4DCH A;  1JLQ A;  1SKR A;  1SUQ A;  1L5U A;  1VSF A;  3VEO A;  3TAR A;  4FZY A;  2DPN A;  4FJX A;  1W2B M;  4JKB A;  5AZI A;  4DS5 A;  4GKK K;  3VOV A;  1WB9 A;  5ELZ A;  4A57 A;  2F9W A;  1BIZ A;  4TSX A;  4A5B A;  3JSM A;  3G4S N;  2YJE A;  1RTD A;  1VSH A;  3EKS A;  2D1K A;  3SLC A;  3OY9 A;  4CJT A;  3O5B A;  2NUB A;  3CM5 A;  3J7A P;  4E7H A;  3CME N;  1UA0 A;  5IT9 O;  1X9J A;  1NK5 A;  4G1Q A;  3OYC A;  3ZEU B;  3WNH A;  2PBD A;  3BF1 A;  4CFB A;  4AM6 A;  1I39 A;  3QNO A;  3MN9 A;  4IFY A;  3MEG A;  2UXC K;  1GLC G;  2GWJ A;  1FKO A;  4DU3 A;  5EY4 A;  3QIP A;  2OCE A;  3RSE B;  1KSP A;  3SAH A;  2IVP A;  1S3X A;  2D0P A;  3HRG A;  5EVZ A;  2RF2 A;  3CCV N;  4OLA A;  4CZG A;  1C0G A;  3VQ9 A;  2IAJ A;  3MDQ A;  1CLQ A;  4I9Q A;  3VGK A;  5C15 A;  3OYJ A;  4AHT A;  4BDY A;  3TAM A;  1V4S A;  2Z1H A;  4H0O A;  2OTL N;  1DKG D;  2FF6 A;  3ZX2 A;  3G71 N;  1M90 O;  2GUP A;  2DFF A;  4KRE A;  1LV5 A;  3SUN A;  1NJI O;  3KKR A;  2FF3 B;  3VEZ A;  4DQ8 A;  2V51 B;  1NKE A;  2HHT A;  5AQZ A;  4XH5 A;  3I8B A;  4ISE A;  3THY A;  4BR4 A;  3DLL L;  3LP3 A;  1QQO A;  5FPM A;  3TWH A;  3I8D A;  1N5Y A;  4F3T A;  3ZSO A;  3KHY A;  3R1X A;  3H1V X;  3D7E O;  1A5W A;  2P9K A;  5HP1 A;  3EE9 A;  4KHY A;  1B92 A;  5BPN A;  4A2B A;  4H0Y B;  1VSK A;  4FVM A;  4IDK A;  1X9M A;  3TSU A;  3CCJ N;  3M8S A;  3QO9 A;  2I7N A;  1MA9 B;  4CZF A;  3DJC A;  2AA4 A;  5LL6 Z;  2CGK A;  4OVL A;  3C6H A;  1K73 O;  2O8C B;  4A5A A;  4FJ9 A;  2BTF A;  4CFA A;  4KB1 A;  4W5N A;  3QFU A;  4BE0 A;  1T6D A;  3U4L A;  4AHV A;  4N41 A;  5J2N A;  1TL1 A;  1JKH A;  3ENH A;  1B9F A;  1XC9 A;  2X78 A;  4X62 K;  4Z4H A;  3ENO A;  3WNE A;  3CCU N;  3J7Z O;  1VQ8 N;  1RT6 A;  3VMF B;  3LAM A;  2X74 A;  3K5N A;  1D8Y A;  4CJW A;  4Y0W A;  4IO8 A;  5LJV A;  4H5N A;  1VRU A;  2FSK A;  3IAY A;  2Q97 A;  4JKG A;  3GOI A;  1LAV A;  1YVU A;  4IXC A;  4DTP A;  4F8R A;  3WXI A;  3V1O A;  1TKZ A;  1T8E A;  3LM2 A;  2E4L A;  4DF4 A;  2ZWH A;  3O9T A;  4M45 A;  1S5J A;  1JCE A;  5KQ8 A;  4M3U A;  5MLC Q;  4DU4 A;  5CY4 A;  1MWM A;  3EKU A;  3EO3 A;  2RKI A;  3AVG A;  3BZC A;  3VEY A;  3NF9 A;  4BRI A;  1M1K O;  1VQL N;  3VA3 A;  4DV6 K;  1EX4 A;  2UUC K;  3PY8 A;  3K0S A;  3ZSR A;  2F7T A;  3NGZ A;  2XRI A;  1KVC A;  5BRF A;  4H5V A;  4FWQ A;  3DOK A;  1BI4 B;  4CZE A;  4FOE A;  1QHA A;  4BQL A;  2YKN A;  4R79 A;  5CZ2 A;  4YY3 K;  4CF0 A;  4WFA L;  3NCI A;  1CXQ A;  5HLF A;  3UKU A;  2HHW A;  3IKM A;  1VQ5 N;  1NJZ A;  4JS4 A;  4I9L A;  3WXL A;  3T3F A;  3QET A;  1T44 A;  4BWJ A;  3O3F A;  2W40 A;  2P9N B;  1RDA A;  1Z05 A;  3DAW A;  3S41 A;  2BGG A;  3RR7 A;  3E9P A;  4LH4 A;  5JVH L;  1ESV A;  2IIR A;  1ATN A;  4BRE A;  5CR4 A;  3V9X A;  2HST A;  3LDP A;  2YX6 A;  4CEF A;  3PX4 A;  4FJH A;  1D9F A;  4FJJ A;  4LF9 K;  3VEN A;  1NGI A;  1TKT A;  3KD1 E;  3MMV A;  1YHQ N;  2WFB A;  2YI1 A;  2FBT A;  2CGL A;  3W0L A;  1BQM A;  2XY7 A;  3AV9 A;  1X3M A;  3O3G A;  1FXX A;  2YNF A;  4CJS A;  2JLE A;  3N4P A;  1R59 O;  1C0T A;  2E20 A;  3OYL A;  4V19 S;  2YHY A;  4RTF D;  3K9J A;  5LMU K;  5GAD P;  1D9D A;  4BR9 A;  5HRR A;  4FJL A;  2ZE2 A;  1RT5 A;  3K9K A;  1BWF O;  4H0P A;  4WF9 L;  5SWM A;  1LW2 A;  3EEQ A;  4CJV A;  1RBS A;  1NK6 A;  1XI1 A;  3JS6 A;  4IDH A;  3QBX A;  2A1R A;  1IO2 A;  1RT3 A;  1QE1 A;  2ASO A;  4J8F A;  2FC0 A;  3VF2 A;  3ZLJ A;  2RHK A;  1RDW X;  3DXK B;  4MO5 A;  2HVI A;  5AQW A;  5TKY A;  2HBK A;  4DQI A;  4E3S A;  1VQP N;  1D5A A;  4Y1C A;  3VQE A;  2OAN A;  3DLH A;  3MCA B;  4NLB A;  1N8R O;  1N36 K;  3G6E N;  4BRP A;  4JYA K;  5AQM A;  2UUB K;  5BRD A;  3P39 A;  4I6M B;  1CXU A;  4FL9 A;  5AJ3 K;  1A5V A;  2E6M A;  4B3T K;  3C6U A;  3C7N A;  3SUO A;  1BCM A;  3O4N A;  4CZM A;  1KVB A;  4LFA K;  3LDO A;  4JKE A;  3I55 N;  3MK6 A;  5M1K A;  2VGM A;  2Q1N A;  5AQY A;  4CBU A;  1DEJ A;  4AQY K;  3NAE A;  2O4G A;  1TYQ A;  3M6G A;  3AAQ A;  2HNY A;  2FXU A;  2QXF A;  2V7Z A;  3TTD A;  4DSF A;  1C1C A;  1BHL A;  3VQ6 A;  3DRP A;  4KKO A;  4C1N K;  4CJP A;  2E5L K;  4BVP A;  5EX5 A;  3HPO A;  2UU9 K;  4ISG A;  2QWM A;  1W7A A;  1IBK K;  3ZCM A;  5KPR A;  1IBL K;  4FJG A;  3B8A X;  5AFU A;  1HNX K;  4W5Q A;  4FOI A;  2O8E A;  1BQN A;  1RBU A;  2Q0R A;  5KRT A;  4M3X A;  4CJQ A;  1MU2 A;  3FZH A;  1SKW A;  5EU7 A;  3LWL A;  1LOT B;  4JKD A;  3PO4 A;  5A2Q O;  4KHP K;  1U4B A;  4OGC A;  2P9S B;  3FFI A;  1WAJ A;  4DFP A;  1YIT N;  4M42 A;  1HMV A;  3SV4 A;  1NNE A;  4LFB K;  1U47 A;  3QNN A;  1OH8 A;  4U67 L;  3RMA A;  2DFE A;  4PUO A;  2F8S A;  2NRX A;  1JL2 A;  2P51 A;  4F2S A;  4N56 A;  3AA3 A;  3HPH A;  2FBY A;  1JXB A;  3CC2 N;  2VWJ A;  3CI5 A;  4DSE A;  2WC9 A;  3TAN A;  1HR0 K;  3M1F A;  2B6A A;  1BU6 O;  3CFP A;  3L2U A;  4QCL A;  5AFU H;  4DSL A;  4K43 A;  3VF6 A;  1FKP A;  1K6Y A;  3NF8 A;  3ID6 A;  3V1R A;  3B6O A;  4NXM K;  3OA9 A;  4CJR A;  2W41 A;  2E1Y A;  1X1P A;  3HSC A;  3C95 A;  3LAL A;  3TU5 A;  4YOV A;  1TK8 A;  1NGC A;  2VQF K;  2Z1G A;  5M1N A;  1ZBF A;  1U45 A;  3A0I X;  3Q7B A;  3HJF A;  3E9L A;  4FWM A;  2XY6 A;  3AVL A;  2RN2 A;  2QA4 N;  4IOC L;  4CVN E;  1NGD A;  4DSI A;  4JKH A;  3AVB A;  4CEB A;  2V7Y A;  4BAC A;  4DV1 K;  1JCF A;  4AIL C;  4B3S K;  3A5N C;  3THV A;  2WUS A;  2EWS A;  2E2N A;  3OS1 A;  1GLA G;  1GLB G;  4KHN A;  2ZGY A;  3SAF A;  2W6L A;  1TAU A;  1NGE A;  1YT3 A;  4BRN A;  3SPZ A;  1KXP A;  1JXE A;  3C6T A;  2P9U B;  4KO0 A;  2E1Z A;  5FRO A;  3VQ5 A;  3V9Z A;  2QXL A;  4CEQ A;  1HYS A;  4CIG A;  3HL8 A;  4DR5 K;  3HOT A;  3WQU A;  3C65 A;  4FJN A;  1NKC A;  4CGD A;  1NBW A;  4NB4 A;  3CCL N;  2HF4 A;  3F9K A;  1IKX A;  4JI4 K;  4DTX A;  1GLF O;  4F4K A;  4IG3 A;  3HZ6 A;  3OW2 M;  4F2R A;  4CHQ A;  1D4X A;  1Y97 A;  1T7P A;  4HWI A;  3LP2 A;  1C0M A;  2KTQ A;  2NRV A;  3PX6 A;  1JLF A;  4EIA A;  2WON A;  3J7Y P;  3PSI A;  1S22 A;  3P1G A;  4NYN A;  4BC2 A;  4DSJ A;  1ZXO A;  5BPL A;  4PL7 A;  2YNG A;  4XH4 A;  1VSD A;  1QQC A;  3LP1 A;  3F2K A;  4DR2 K;  4DTO A;  3RSE A;  5JMV A;  3M8Q A;  3CMA N;  3QDK A;  4DTS A;  2O4I A;  3ULD A;  4B9L A;  1RGI A;  2Y1I A;  1YJ9 N;  2NRR A;  1VQK N;  2FBX A;  1C0U A;  1NMD A;  3LPT A;  4DFJ A;  4LF5 K;  3TTF A;  5BPM A;  3ZSV A;  4H03 B;  3OYE A;  5EOY A;  1KLM A;  3GG4 A;  3P5J A;  1C6V A;  4DHY A;  4DQQ A;  3HBT A;  3HK2 A;  5GIN A;  1HQE A;  4H5W A;  3L6Q A;  3IMX A;  4Z4F A;  3NH1 A;  4HVJ A;  1U49 A;  4B1Y B;  3A2F A;  4AHC A;  1U2V B;  4IZ9 A;  4A59 A;  4Z94 A;  4LF6 K;  1QSS A;  5I9E B;  3VF4 A;  4KRF A;  3THX B;  3LL3 A;  1A5X A;  5AQF A;  3JAM O;  2VG5 A;  4ISF A;  3OYM A;  1S9E A;  3IG1 A;  1TK0 A;  1TUU A;  5BN9 A;  1WN7 A;  1O13 A;  2QEX N;  1DT9 A;  4M41 A;  2KHO A;  1VQ7 N;  3O1B A;  4CK2 A;  4CF1 A;  4DTU A;  4WFN L;  4DR4 K;  4K25 A;  4BR0 A;  3V4I A;  3TAE A;  1RTH A;  3FGU A;  4CJ5 A;  1WBB A;  3KIO A;  4CK3 A;  2O8C A;  3QEX A;  4LSL A;  4CZH A;  2P9I B;  1C1A A;  4KH4 A;  4E7J A;  4AF1 A;  4DLG A;  2NRZ A;  2YHW A;  1T03 A;  1NJX A;  4Q5V A;  3V9S A;  1TAQ A;  4U7B A;  3AGR A;  1EET A;  1EWQ A;  3LZJ A;  2BH1 A;  2ITG A;  2QW9 A;  1BUP A;  3D2E B;  4B8C A;  3VEW A;  3MXM A;  3ZT4 A;  1SQK A;  3SJJ A;  4BR5 A;  1CZA N;  1L3S A;  3SJH A;  3CQX A;  4N5S A;  3SUP A;  3ZYY X;  3R3L A;  3WXM B;  5BN8 A;  1EWR A;  1XC3 A;  3D45 A;  5JS1 A;  1Q8I A;  3DOL A;  3FZK A;  2BAN A;  3UE5 A;  3OVN A;  4XIU A;  1UAX A;  3DMJ A;  3J81 O;  1FW6 A;  3P31 A;  3SQ2 A;  3OYG A;  1XNQ K;  3V6D A;  2HBM A;  4CHP A;  1U6Z A;  1S9G A;  4CD3 A;  3M3Z A;  3TTC A;  3PX0 A;  4JI0 K;  1W9H A;  5C25 A;  3V9U A;  3AVJ A;  3OYN A;  3AO3 A;  1XNR K;  2QI2 A;  3CHW A;  1XMQ K;  3SCX A;  4FJK A;  5CZ1 A;  5AQP A;  1OH7 A;  1VRT A;  3NMU A;  2G8F A;  4ILJ A;  2JGU A;  1HNW K;  1RDB A;  3IDH A;  4WFB L;  2HVH A;  1S1T A;  2ZD1 A;  1J53 A;  1N34 K;  1QTM A;  3KLG A;  3OHR A;  4AHR A;  5J2Q A;  3HP6 A;  1VQ9 N;  1RCH A;  1CZB A;  3OTO K;  4CES A;  3L3V A;  4I2P A;  4HCB A;  2B5J A;  4GV3 A;  4BRQ A;  4RG8 A;  4DKW A;  2VYP A;  4BGA A;  4BC4 A;  4NCG A;  5HBM A;  4EZ6 A;  2DY4 A;  3H3N O;  4XH1 A;  3G0Z A;  1VSM A;  3PIO L;  2Q0U A;  3RMD A;  3U9Z A;  3ZSX A;  3IS9 A;  3EZ5 A;  1Q82 O;  1K9M O;  4E19 A;  1NM1 A;  2GUI A;  3CCM N;  3ENB A;  4IOA L;  2A6A A;  5BRH A;  1NK0 A;  1NGF A;  4CW7 B;  3AVI A;  5AQR A;  2QWQ A;  1S1W A;  4O55 A;  2QM1 A;  3DI6 A;  4O5B A;  3TAG A;  3U8X A;  1G15 A;  3MED A;  3MCP A;  3T7Z A;  2VWB A;  4CHY A;  3CJ1 A;  4EP4 A;  3TI0 A;  1KFS A;  3NDK A;  1IKY A;  4CK1 A;  4GY2 B;  4FWN A;  2GEL A;  3U6F A;  2YV0 X;  4CZL A;  3CJC A;  3O9Q A;  3QEV A;  4PWD A;  3SNN A;  5KGX A;  3OBW A;  2ITM A;  4BRG A;  4Z4E A;  4JLH A;  4M3T A;  1ZBL A;  2ZM6 K;  1S1U A;  2ZQB A;  4YOU A;  3VQC A;  4K0K K;  3CJA A;  2R7Y A;  4BR2 A;  4K8Z A;  1IJJ A;  3J80 O;  3CC4 N;  4DR3 K;  1YJN N;  1NK4 A;  4QOZ B;  2O8F A;  3WNG A;  3R9P A;  1GLJ O;  3S3N A;  1JLC A;  4JNE A;  1YUW A;  3CCE N;  1ZBH A;  1HNV A;  4DV2 K;  3OYB A;  4PL8 A;  5DM7 L;  4JK9 A;  1UWB A;  4J2D A;  3E9O A;  4HUF A;  4FXD A;  3DXK A;  4FWO A;  4CEE A;  3JYT A;  4C8O A;  1GLE G;  1HPZ A;  2QKK A;  1L3U A;  3BY5 A;  3TSQ A;  4B9U A;  3ULE A;  1RTJ A;  3CET A;  3ZT0 A;  3AO1 A;  3GBT A;  4KTQ A;  1RT1 A;  3LPU A;  1P8Z A;  3A5L C;  3CJ9 A;  4FVU A;  4C23 A;  5AQL A;  3AO5 A;  3HT3 A;  3JXU A;  3VES A;  4I6M A;  1YI2 N;  1GOC A;  4B8A B;  1NJW A;  4W5T A;  1VAZ A;  4DQP A;  3KTQ A;  4CHZ A;  2P5G A;  1S6Q A;  3MX5 A;  5CHI A;  3O08 A;  4ICL A;  2YHX A;  3MEC A;  1SL2 A;  1WSJ A;  3H3O B;  3L2Q A;  1SS6 A;  3V9W A;  4JHD B;  1NOY A;  4WYB A;  1WSG A;  5B8H A;  2Q31 A;  2NZT A;  2OPS A;  1S1V A;  1JLE A;  1IG8 A;  1HKC A;  4BRA A;  3E66 A;  1N6Q A;  3HM8 A;  3L0Q A;  2YHB A;  2DFH A;  3CER A;  1IKV A;  4X65 K;  3EZW A;  1QVF M;  4PKG A;  5LMN K;  3A5O C;  3SV3 A;  5E26 A;  4MO4 A;  2B4J A;  2GBZ A;  2JWK A;  5D3G A;  1EXQ A;  3CJ7 A;  3CYM A;  1HKB A;  1EQY A;  3NHG A;  5DMR A;  1KVA A;  4ZHR A;  4BE1 A;  4X64 K;  3TAQ A;  4QS7 A;  3LZI A;  4DMN A;  4PY5 A;  3HOS A;  2W42 A;  4CD1 A;  2QWP A;  4KPY A;  4CCH A;  5I3U A;  1Z25 A;  3TAF A;  1U04 A;  3VQB A;  4RCH A;  1KRP A;  1HKG A;  3F5T A;  3AY9 A;  2P9S A;  2O8B B;  3MN5 A;  3EYZ A;  3O4Q A;  4CJ7 A;  4CE9 A;  4CGF A;  1X9W A;  2F96 A;  4FWK A;  5HRP A;  5GIP A;  3WQT A;  5C0Y A;  3QEP A;  3MWP A;  5AQH A;  4GVM A;  1NGJ A;  4YFU A;  5C12 A;  3OYK A;  5K14 A;  2YCH A;  4Z4I A;  1HYV A;  4LF7 K;  2G8V A;  3QIO A;  3CQY A;  2QWO A;  3CG7 A;  2ASM A;  4BDZ A;  1XHZ A;  3AA2 A;  3ALY A;  1WLJ A;  1J5E K;  5KPZ A;  1TGO A;  4H4M A;  4BVO A;  3KLH A;  1DLO A;  2HMI A;  3HVT A;  4JKA A;  3HXM A;  5BRE A;  4UQG A;  3KJV A;  4FWS A;  3KK2 A;  4JD2 B;  3BGR A;  3CPE A;  3ZSZ A;  2CGJ A;  3WXJ A;  1YVN A;  4GVE A;  1W0H A;  1IKW A;  4KH6 A;  4CJL A;  4L8R B;  3U3G A;  2PZS A;  3SPY A;  1T05 A;  3ID8 A;  4JRQ A;  4WCE L;  1KTQ A;  1XMO K;  1NGB A;  4JK7 A;  4L3Q A;  3O3H A;  5AQJ A;  4FLU A;  5GIO A;  3M8R A;  3EN9 A;  4H0X B;  4B9V A;  2YJF A;  2IGI A;  2YNI A;  3D2F B;  3VQD A;  4WQ4 C;  3KLF A;  1EKE A;  4F3O A;  2J4R A;  4DV7 K;  4ID1 A;  4CJK A;  3SQ0 A;  1RNH A;  3G10 A;  4OO1 J;  1ZBI A;  3K5L A;  5AQI A;  2P9U A;  3WEE B;  4CZJ A;  1RT4 A;  1KFD A;  2EHG A;  2Y1J A;  3SQ4 A;  4CJ3 A;  4FCY A;  5EXW A;  1VQ4 N;  3L4I A;  4FWR A;  5M1F A;  2WOM A;  4BG8 A;  5KTQ A;  4IEI A;  5C2D A;  3A5M C;  4PA1 A;  2HB5 A;  5DK5 A;  1JCG A;  4B1U B;  1BO5 O;  5BR8 K;  3M8P A;  5F1X A;  3L2V A;  4FLX A;  4NCA A;  1TK5 A;  4BGB A;  1JL1 A;  3AVM A;  3HPG A;  2KLA A;  2XHB A;  1LAW A;  4CJ4 A;  4HUG A;  2Z1I A;  2GV9 A;  2YKM A;  2VG7 A;  4BDP A;  4YOW A;  2E6L A;  4EHU A;  1XQS C;  4RW9 A;  3SUQ A;  3V1Q A;  3KK7 A;  4BQZ A;  5FLX O;  3QML A;  1GLL O;  1QS4 A;  4LFC K;  4H0T B;  1IV0 A;  3AVK A;  3O9R A;  4O0I A;  3PLA A;  3AVC A;  3VQ4 A;  4B3R K;  4LH5 A;  1TVR A;  4G9Z A;  1Q9X A;  1DTQ A;  1KAY A;  4HCC A;  3NH2 A;  3VTI A;  2Q2R A;  4B9S A;  1RDU A;  4BRK A;  2PYJ A;  2QKB A;  1C1B A;  3K2P A;  3SBT A;  4IJA A;  1NOZ A;  1WNS A;  1Z26 A;  4DU1 A;  4YNQ A;  4BRL A;  4OKK A;  4FSV A;  4FM2 A;  3AVH A;  3L8B A;  1HRH A;  3QIC A;  4ELV A;  1U2V A;  1NKB A;  2HHU A;  4EAH D;  2G8K A;  3HI0 A;  1E4G T;  4WQ4 A;  4F9O A;  1ILY A;  5JIC A;  1FJG K;  3O6W A;  4CJE A;  3THX A;  3H6E A;  5I42 A;  1WBD A;  4DWI A;  3H46 O;  5LJW A;  4RWT A;  3D6R A;  4EP5 A;  4JEP A;  2OPQ A;  2O8D A;  4A2A A;  5M1P A;  3E1Y A;  4JV5 K;  3GE1 A;  4Q0B A;  3QIN A;  3MEE A;  1OVQ A;  3K5M A;  4BY9 C;  2OA8 A;  3FZF A;  3I0R A;  3LAN A;  2P9I A;  4NLC A;  2YHA A;  3T69 A;  5KRS A;  2P9L B;  1KQS M;  2KFN A;  1XUP O;  1QSL A;  5AQG A;  5TKW A;  1Y64 A;  2XY5 A;  5CYQ A;  3D2E A;  3CFO A;  2W6K A;  5GAG P;  4FW2 A;  4A62 A;  2RE2 A;  2P9P B;  2HHV A;  1EO1 A;  4AH9 A;  2OTJ N;  3ZEU A;  1JLA A;  4LY7 A;  2HW3 A;  3CQ8 A;  3O9S A;  2XY8 A;  4M63 C;  5KQD A;  2A40 A;  3G25 A;  3CCS N;  3BZK A;  4JI3 K;  1K8K B;  4E1M A;  1QHT A;  3O4W A;  3QEI A;  2I5J A;  4CEC A;  2ZJP L;  2QWL A;  4FLW A;  4ID5 A;  3DRR A;  4CER A;  3THW B;  4DQR A;  3EL2 A;  4DUY K;  2HHS A;  4BRH A;  4C8N A;  1TKD A;  1VQ6 N;  5C42 A;  5CE3 A;  4NYF A;  4Z4G A;  3C0B A;  3K58 A;  3VEV A;  3O80 A;  3P4I A;  2NRW A;  4CZK A;  4OPJ A;  3ZET B;  4Z0U A;  1VQM N;  4PKI A;  4M3W A;  3HO1 A;  1IBM K;  4BR7 A;  1SZ2 A;  5J1E A;  2VQE K;  2OPR A;  3TR8 A;  3AVA A;  1HUX A;  4M7Y A;  1Z6R A;  4J2B A;  4KBO A;  3U9D A;  5HOO A;  3IRX A;  4C8L A;  1YXQ A;  2AP1 A;  4FZZ A;  4FK4 A;  1YAG A;  1VSE A;  1I94 K;  5J2P A;  4JI8 K;  5JLF A;  4OX9 K;  4R5P A;  1DTT A;  1X9S A;  4BRF A;  1NG9 A;  4KI6 A;  3RMB A;  1MDU B;  3ATV A;  4FZX C;  3MXJ A;  5C10 A;  5C24 A;  1Q86 O;  4DR1 K;  1HYZ A;  2HHX A;  2D5R A;  1ASV A;  1BIS A;  5JS2 A;  4AHU A;  1H1V A;  3KD5 E;  1YTU A;  4YOR A;  3LP0 A;  4ZTF A;  3OYI A;  1ZYQ A;  4KH5 A;  3P38 A;  1WSF A;  5FPN A;  3WNF A;  1QZ5 A;  4IEE A;  4YDU A;  4MFB A;  4JI5 K;  3NVK A;  3HVR A;  4ELT A;  1Q9Y A;  1HNZ K;  4ZTJ A;  4MDA A;  4FM1 A;  1BA1 A;  1YTA A;  3UKR B;  1SL1 A;  3RRG A;  4E7L A;  3CM6 A;  4DS4 A;  4O5F A;  3MN6 A;  1BDG A;  2NRH A;  3CCQ N;  3QER A;  3C6A A;  2ASP A;  1WSI A;  2WTU A;  4LC9 B;  1UOC A;  3T19 A;  3ZSW A;  2ZGZ A;  2QWR A;  4KHW A;  3NVM A;  3DRS A;  4LSN A;  4FO0 A;  4I7F A;  3LDL A;  4QS9 A;  2PFU A;  4H8K A;  3S3O A;  3SAG A;  2H3G X;  3SMS A;  1ASW A;  3ATU A;  5C2F A;  3ISN C;  3KZB A;  1V4T A;  2NLX A;  3ZX0 A;  4X66 K;  1J9A A;  4B9T A;  3CFR A;  1TL3 A;  3WT0 A;  4H4O A;  1W97 L;  1P90 A;  4C8K A;  1RDC A;  1RFQ A;  4CF2 A;  2GWK A; 
#chains in the Genus database with same CATH homology
 3AAQ A;  1VAZ A;  3SMP A;  3TTD A;  2FXU A;  2V7Z A;  3MX5 A;  4OPA A;  1VQN N;  3EE8 A;  5CHI A;  3O08 A;  2YHX A;  1JJ2 M;  3H3O B;  3CCR N;  1SS6 A;  4IWV A;  4C1N K;  1QZ6 A;  5F2R A;  2ZF5 O;  4JHD B;  4BVP A;  4YOY A;  1ZC6 A;  1ZBS A;  3J8A A;  3H1Q A;  4WYB A;  5AR0 A;  5EX5 A;  5B8H A;  4ISG A;  2Q31 A;  1OKJ A;  2NZT A;  1KAZ A;  2QWM A;  2NNW A;  2QTD A;  1T6C A;  1IG8 A;  1HKC A;  4BRA A;  5KPR A;  2HBL A;  3E66 A;  3B8A X;  5AFU A;  3HM8 A;  4JK8 A;  1E4F T;  4FOI A;  1QQM A;  2QWN A;  1Q81 O;  3WUH A;  3L0Q A;  2Q0R A;  5AZJ B;  3CER A;  3RVC A;  3DXM B;  3EZW A;  5HL7 L;  1MWK A;  1QVF M;  3FZH A;  2WBN A;  4GV9 A;  5AQU A;  4B1V A;  4PKG A;  3AAP A;  3A5O C;  4MLH A;  1LOT B;  2IVO A;  4JKD A;  5E26 A;  4MO4 A;  4JHD A;  4H0V B;  5ADX A;  5DM6 L;  2P9S B;  4FWL A;  2JWK A;  2V52 B;  5LY3 A;  2PAV A;  3VER A;  3CJ7 A;  1YIT N;  2FSJ A;  1HKB A;  2GEM A;  1EQY A;  2P9N A;  5GAE P;  4U67 L;  4XEI A;  2NRX A;  4PHT X;  4QS7 A;  1HX1 A;  3MN7 A;  3KVG A;  3SBG A;  4H5R A;  3CC2 N;  5AZJ A;  5AQQ A;  3HOS A;  3CI5 A;  4CD1 A;  3DXM A;  2QWP A;  2WC9 A;  3GDQ A;  3FZM A;  3KWI A;  3VGM A;  4E1J A;  3M1F A;  1BU6 O;  3ZX3 A;  3IFR A;  3R6M A;  5H1S Q;  5AFU H;  4RCH A;  2E8A A;  2A5X A;  1G99 A;  1HKG A;  4K43 A;  3VF6 A;  4BC3 A;  3F5T A;  1GLD G;  1T3V A;  1YF5 L;  3ID6 A;  5JLH A;  3CJB A;  1HLU A;  3AY9 A;  2P9S A;  3L4Q A;  3OA9 A;  3GL1 A;  3MN5 A;  2GX9 A;  2FSN A;  2W41 A;  4BRM A;  4BRC A;  4FPA A;  3LDN A;  4CJ7 A;  2E1Y A;  1J6Z A;  3HSC A;  1Q18 A;  4M7X A;  2F9T A;  3TU5 A;  1YJW N;  4YOV A;  2E2O A;  3BEX A;  5AZI B;  3VGL A;  1NGC A;  1X3N A;  4FWK A;  4ILH A;  5GIP A;  4K42 A;  5M1N A;  3F9M A;  3WQT A;  5KPT A;  2A41 A;  5ADX H;  5C0Y A;  3A0I X;  3Q7B A;  3MWP A;  3E9L A;  4FWM A;  5AQH A;  1NGJ A;  3I33 A;  3BF3 A;  4FPB A;  4QS8 A;  5C12 A;  2QA4 N;  3QBW A;  4WQ5 A;  2YCH A;  4GNI A;  3DWL A;  4IOC L;  5AQN A;  4UY8 O;  3H45 C;  5FPE A;  4IOX A;  5E84 A;  1NGD A;  3CQY A;  2Q36 A;  2QWO A;  4JKH A;  3CD6 N;  3M5R A;  4DCH A;  1WOQ A;  2ASM A;  2V7Y A;  1JCF A;  3VEO A;  2DPN A;  4B1W B;  3A5N C;  3FLC O;  1ATR A;  2WUS A;  4O8U A;  5KPZ A;  2EWS A;  1W2B M;  2E2N A;  4JKB A;  4BVO A;  5AZI A;  5AQK A;  3VOV A;  4JKA A;  1GLA G;  5ELZ A;  4A57 A;  1GLB G;  2F9W A;  5BRE A;  1NGA A;  4A5B A;  2ZGY A;  3VEX A;  2D0O A;  4FWS A;  3SAF A;  4JD2 B;  3CPE A;  3G4S N;  2YJE A;  2CGJ A;  3WXJ A;  3EKS A;  1NGE A;  2D1K A;  1YVN A;  4GVE A;  4BRN A;  4KH6 A;  3SLC A;  2VGN A;  1KXP A;  4BG9 A;  2P9U B;  2E1Z A;  3O5B A;  3CME N;  1X9J A;  2QXL A;  3ID8 A;  3ZEU B;  2PBD A;  3BF1 A;  4WCE L;  3HOT A;  4AM6 A;  3WQU A;  1BOT O;  1NGB A;  3C65 A;  3MN9 A;  4JK7 A;  4L3Q A;  4CZI A;  1NBW A;  3MWT A;  1GLC G;  2GWJ A;  4NB4 A;  2HF4 A;  5AQJ A;  2CH6 A;  5AQS A;  3CCL N;  5GIO A;  5EY4 A;  3QB0 A;  2HOE A;  3BUZ B;  3EN9 A;  4H0X B;  1GLF O;  2YJF A;  3HZ6 A;  3D2F B;  3RSE B;  4WQ4 C;  4JD2 A;  3OW2 M;  3N4Q A;  3SAH A;  2J4R A;  2IVP A;  3W3D A;  1D4X A;  1S3X A;  2D0P A;  3HRG A;  5EVZ A;  4HWI A;  4OO1 J;  4YOX A;  3CCV N;  2NRV A;  4CZG A;  1C0G A;  3MDQ A;  2ZJQ L;  5AQI A;  2P9U A;  3VGK A;  4EIA A;  5C15 A;  1VQM N;  3UB5 A;  3WEE B;  4CZJ A;  2E88 A;  1S22 A;  1V4S A;  5AQO A;  1KC8 O;  4MLE A;  4BC2 A;  4H0O A;  1Q7Y O;  1ZXO A;  5BPL A;  3AGK A;  5EXW A;  3R8E A;  2P9K B;  1VQ4 N;  3L4I A;  4PL7 A;  2OTL N;  1DKG D;  2FF6 A;  3ZX2 A;  3G71 N;  4FWR A;  2GUP A;  5M1F A;  4XH4 A;  1M90 O;  4BG8 A;  4B1Z A;  4IEI A;  5C2D A;  3A5M C;  3F2K A;  5BR9 A;  1NJI O;  3D2F A;  3RSE A;  1JCG A;  5JMV A;  4B1U B;  3CXC M;  2FF3 B;  1BO5 O;  3CMA N;  3QDK A;  3VEZ A;  4H5T A;  4CBX A;  4DQ8 A;  2V51 B;  5AQZ A;  1HPM A;  5F1X A;  4XH5 A;  1RGI A;  3I8B A;  4ISE A;  4BR4 A;  2NRR A;  1YJ9 N;  1VQK N;  3DLL L;  5FPM A;  1QQO A;  4BGB A;  3WEE A;  1KD1 O;  1NMD A;  5AQX A;  2KLA A;  3KHY A;  3TTF A;  5BPM A;  3R1X A;  3H1V X;  3D7E O;  4H03 B;  2P9K A;  4YOW A;  3EE9 A;  5EOY A;  4EHU A;  5BPN A;  1XQS C;  3GG4 A;  4A2B A;  2HBJ A;  4H0Y B;  3KK7 A;  4BQZ A;  4DHY A;  3O9U A;  1YI2 N;  3TSU A;  3HBT A;  3QML A;  5GIN A;  1GLL O;  4H5W A;  4CBW A;  3CCJ N;  3LDQ A;  2I7N A;  3L6Q A;  1MA9 B;  4CZF A;  3OBY A;  3DJC A;  2AA4 A;  4H0T B;  2CGK A;  1NGH A;  3IMX A;  3C6H A;  1K73 O;  3O9R A;  5FPD A;  4B1Y B;  3CIP A;  3CF5 L;  3PLA A;  3KWG A;  4G9Z A;  1U2V B;  4IZ9 A;  4K41 A;  1KAY A;  3WXK A;  4A59 A;  4A5A A;  4Z94 A;  4AM7 A;  2BTF A;  3VPZ A;  5I9E B;  3VF4 A;  3VTI A;  2Q2R A;  1RDU A;  4BRK A;  3LL3 A;  4BRO A;  1DGK N;  3QFU A;  5AQF A;  4JKG B;  1T6D A;  4ISF A;  3U4L A;  3AAR A;  2A42 A;  3SBT A;  1TUU A;  5BN9 A;  1O13 A;  2QEX N;  1DT9 A;  2KHO A;  4IJA A;  1VQ7 N;  3ENH A;  3O1B A;  4WFN L;  4BRL A;  3ENO A;  4K25 A;  4BR0 A;  3CCU N;  3J7Z O;  4O8K A;  1VQ8 N;  4FSV A;  4HTL A;  3FE1 A;  3VMF B;  4PKH A;  3FGU A;  2KKZ A;  3QIC A;  4IFE A;  4Y0W A;  1U2V A;  4EAH D;  4CZH A;  3HI0 A;  1E4G T;  2P9I B;  4IO8 A;  4WQ4 A;  4KH4 A;  4F9O A;  4H5N A;  5JIC A;  5LJV A;  1ILY A;  3O6W A;  4AF1 A;  2I7P A;  2FSK A;  3H6E A;  3H46 O;  5LJW A;  2Q97 A;  1SAZ A;  2NRZ A;  4NO7 A;  4RWT A;  2YHW A;  3D6R A;  4JKG A;  3GOI A;  4JEP A;  2CH5 A;  4A2A A;  4IXC A;  5M1P A;  3WXI A;  3E1Y A;  3ULE B;  3GE1 A;  3AGR A;  4FWP A;  4U7B A;  3CC7 N;  3LM2 A;  2BH1 A;  5M1Q A;  2QW9 A;  1BUP A;  3D2E B;  2ZWH A;  3VEW A;  3O9T A;  4IJN A;  4BY9 C;  4DB3 A;  1K8A O;  1SQK A;  1JCE A;  4BR5 A;  5KQ8 A;  1CZA N;  4A61 A;  3FZF A;  1NLV A;  2A3Z A;  3SJH A;  4IO9 L;  3CQX A;  1QVG M;  5MLC Q;  3SK3 A;  2P9I A;  4NLC A;  2ZJR L;  3T69 A;  3ZYY X;  1MWM A;  3EKU A;  3EO3 A;  3R3L A;  3WXM B;  3VEY A;  4BRI A;  2P9L B;  1M1K O;  1VQL N;  5BN8 A;  1KQS M;  1XC3 A;  4B1X B;  3UKU B;  1XUP O;  3FZK A;  5AQG A;  2F7T A;  1ATS A;  5TKW A;  3UE5 A;  1Y64 A;  4EHT A;  4BC5 A;  3P31 A;  5BRF A;  2HF3 A;  4EFH A;  4H5V A;  4FWQ A;  2HBM A;  3D2E A;  4CZE A;  4FOE A;  1U6Z A;  3BP8 A;  3M3Z A;  3TTC A;  4CD3 A;  5GAG P;  4A62 A;  2RE2 A;  2P9P B;  3CPW M;  3FFK B;  1BA0 A;  1EO1 A;  1QHA A;  2OTJ N;  3ZEU A;  4BQL A;  3FR0 A;  4R79 A;  1LCU A;  3O9S A;  4WFA L;  2QI2 A;  3CHW A;  2BUP A;  4JKF A;  2P9L A;  4M63 C;  4OPH A;  5KQD A;  3LM9 A;  5AQP A;  2A40 A;  3G25 A;  3UKU A;  3CCS N;  3NMU A;  3IKM A;  1VQ5 N;  4ILJ A;  3WXL A;  1K8K B;  3O8M A;  1T44 A;  3PIP L;  3IDH A;  3Q7C A;  3O4W A;  2W40 A;  4WFB L;  2P9N B;  4JN4 A;  2ZJP L;  3I56 N;  2QWL A;  1Z05 A;  3DAW A;  3S41 A;  2P9P A;  3EL2 A;  3E9P A;  3VET A;  1NWK A;  4BRH A;  4YOT A;  3MX2 A;  3OHR A;  5JVH L;  1ESV A;  1VQ6 N;  4MDB A;  2IIR A;  5CE3 A;  1VQ9 N;  1ATN A;  4BRE A;  5CR4 A;  2HST A;  2NRT A;  1QQN A;  3C0B A;  3LDP A;  2YX6 A;  4GV3 A;  4BRQ A;  3VEV A;  4DKW A;  3O80 A;  3P4I A;  2D4W A;  5M1O A;  2NRW A;  1NGI A;  2VYP A;  3VEN A;  3MMV A;  3ZET B;  4PKI A;  2WFB A;  4B9Q A;  4CZK A;  4BGA A;  2YI1 A;  4BR7 A;  1YHQ N;  2CGL A;  1SZ2 A;  4BC4 A;  1K8K A;  3W0L A;  3H3N O;  1X3M A;  1HUX A;  4M7Y A;  1Z6R A;  4XH1 A;  4KBO A;  3U9D A;  3N4P A;  2Q0U A;  3PIO L;  1R59 O;  3U9Z A;  5HOO A;  1K9M O;  2E20 A;  4ILG B;  1Q82 O;  1NM1 A;  3CCM N;  1YXQ A;  2YHY A;  4RTF D;  3ENB A;  1YIJ N;  1VQO N;  4IOA L;  3A8Y A;  3K9J A;  2A6A A;  5BRH A;  2AP1 A;  5GAD P;  4BR9 A;  1NGF A;  1YAG A;  4JAX A;  1BG3 A;  2FLO A;  2QWQ A;  5AQR A;  2QM1 A;  3QFP A;  3U8X A;  5JLF A;  2E2P A;  3FZL A;  3K9K A;  3MCP A;  3T7Z A;  5AQT A;  2VWB A;  3ZET A;  3CJ1 A;  5AQV A;  3VTH A;  4BRF A;  1BWF O;  4H0P A;  4WF9 L;  1WUA A;  3O1W A;  1MDU B;  3ATV A;  3HTV A;  4GY2 B;  4FWN A;  5C10 A;  2GEL A;  4CZL A;  1Q86 O;  3CJC A;  3JS6 A;  4IDH A;  3O9Q A;  3QBX A;  3OBW A;  1H1V A;  4C1N I;  2ASO A;  3C7N B;  2ITM A;  4J8F A;  4BRG A;  4YOR A;  2HMP A;  3VF2 A;  2IVN A;  3TPQ A;  2RHK A;  1RDW X;  3DXK B;  4KH5 A;  3P38 A;  4YOU A;  4MO5 A;  5FPN A;  1QZ5 A;  4IEE A;  2JWL A;  4YDU A;  5AQW A;  5TKY A;  3TSP A;  2HBK A;  3CJA A;  3NVK A;  1VQP N;  4BR2 A;  1IJJ A;  4MDA A;  5GAH P;  3CC4 N;  2OAN A;  1YJN N;  3IUC A;  1BA1 A;  3MCA B;  4NLB A;  3UKR B;  1N8R O;  3G6E N;  2GTD A;  1GLJ O;  3R9P A;  4BRP A;  4O5F A;  4BRD A;  3MN6 A;  4JNE A;  5AQM A;  1YUW A;  5BRD A;  1BDG A;  1TYQ B;  3P39 A;  3CCE N;  2VCP A;  2NRH A;  4I6M B;  1HJO A;  3CCQ N;  4FL9 A;  3C6A A;  2ASP A;  4PL8 A;  5F0X A;  1S72 N;  5DM7 L;  4JK9 A;  4LC9 B;  2ZGZ A;  2QWR A;  3C7N A;  3E9O A;  1C0F A;  3NVM A;  5JVG L;  4GV6 A;  4FO0 A;  2UYT A;  1OVY A;  3LDL A;  3DXK A;  4FWO A;  4CZM A;  1GLE G;  4QS9 A;  2PFU A;  3LDO A;  4JKE A;  3SAG A;  3MK6 A;  3I55 N;  2H3G X;  4JKC A;  3SMS A;  3TSQ A;  4CI6 A;  3ULE A;  5M1K A;  3ATU A;  5C2F A;  1NGG A;  3CET A;  3KZB A;  1V4T A;  2NLX A;  3ZX0 A;  3GBT A;  2VGM A;  2Q1N A;  1P8Z A;  4WQ5 C;  3UKR A;  5AQY A;  4CBU A;  1DEJ A;  3A5L C;  3CJ9 A;  4FVU A;  4C23 A;  5AQL A;  4YDU C;  2E2Q A;  3WT0 A;  1W97 L;  1P90 A;  1KAX A;  1TYQ A;  3JXU A;  3VES A;  4I6M A;  1RFQ A;  1TUY A;  3M6G A;  2GWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...