3P83D

Structure of the pcna:rnase hii complex from archaeoglobus fulgidus.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
213
structure length
213
Chain Sequence
SPEFPGRLMKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQKTLDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna binding protein
molecule keywords DNA polymerase sliding clamp
publication title PCNA directs type 2 RNase H activity on DNA replication and repair substrates.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 78
structure length 213
sequence length 213
chains with identical sequence E, F
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3p83D00
4DTPA 3JYTA 4DSJA 2D0AA 1LWFA 2HNYA 4O55A 2IOCA 5KI6A 3V1OA 4O0JA 5J1EA 3PY8A 3HYFA 1WLJA 4L8RB 1HQUA 4GVMA 1BISA 3ZT2A 4HTUA 3U6FA 4PQUA 3ZSOA 2GBZA 4Z4IA 1WSEA 3O3HA 4C8OA 3AA4A 2XY5A 3D45A 3I0SA 3ZSRA 4IG3A 3NH2A 4CJSA 4CEFA 2PYLA 5CZ1A 4E7HA 4DSLA 1RT7A 2OPRA 2X6SA 3SQ2A 5HRSA 1I3AA 2D5RA 1J54A 4PUOA 3SUPA 4CJQA 2F8TA 1NKCA 1QSLA 3SYZA 3QEWA 5FDLA 4DTSA 2VG7A 3OYKA 4B9SA 3MEGA 4DWIA 4M3YA 1RDCA 1WSIA 1HRHA 2P51A 1TK8A 2HHTA 3OYHA 4OKJA 4CERA 2B5JA 3OYCA 1TKDA 3OVNA 3VQ4A 4DS4A 4OKEA 1XC9A 2KW4A 4CFBA 1TKTA 3L2WA 2A1RA 3RMBA 4N41A 4FM2A 1WSHA 3CG7A 4KAZA 3AVJA 4W5NA 1JLEA 4Z4GA 4DQRA 1GOCA 4B9MA 1NK0A 2GV9A 1VK0A 3LWMA 2VG5A 4DF8A 3U3GA 3QEXA 3RR8A 4FJ7A 4YNQA 1RDBA 1Z26A 1QSYA 2XY8A 3ITHA 3K58A 4CFAA 1GOAA 3AVAA 3L3UA 4CHNA 1CXQA 4KTQA 2DFEA 5JS2A 2JLEA 4CJEA 4KPYA 2Z1IA 4BDYA 3NFAA 3WNEA 2ETJA 5SWMA 4E7LA 3M8RA 4DSEA 1X9MA 1X9SA 3SI6A 3LAMA 3RRHA 1WSJA 3EYZA 5C25A 1NKBA 4DS5A 2IC3A 5JS1A 4CF0A 1HYSA 1QHTA 1HNIA 1G15A 1RTIA 5CY4A 3ZCMA 4CE9A 3EY1A 4FCYA 3UIQA 3T1AA 4M42A 1CLQA 2O4GA 4KB1A 1J5OA 2DFFA 1BIUA 1BI4A 5CZ2A 4DFKA 3OYDA 1REVA 1LWEA 2EX3A 3AV9A 3VN5A 1RBVA 3QNOA 3HK2A 3AVBA 3VQDA 3CFPA 3LANA 1MU2A 2YKMA 3SPZA 3A2FA 1EP4A 2VWKA 4FYDA 2HW3A 2FBTA 4DQSA 2G8IA 3PO4A 4M3XA 4CF2A 4QAGA 3QINA 3OS2A 4FLXA 3B6OA 3K5OA 4Z4FA 2KZMA 1IKYA 4QCLA 2X78A 1KTQA 2IAJA 2F96A 3HPHA 4CGJA 4CCHA 3D0PA 1EETA 1S5JA 4C8MA 3PV8A 2YNGA 4CJ3A 3NHGA 1S6PA 3OYAA 2HVIA 3TI0A 1RBRA 1XHXA 4CGDA 3OYFA 3SV3A 3LP1A 1KSPA 1W0HA 2ITGA 3M8SA 4E1NA 1Q9YA 2B4JA 2OA8A 2WOMA 4IFYA 3VQBA 2OYQA 4CK1A 3TAEA 3JSMA 3LAKA 2D0BA 3KKSA 1TAUA 4CJPA 4FJJA 4PWDA 1X1PA 1TKXA 4F2SA 3OJSA 1S1WA 3HPOA 2G8UA 3LALA 4ID1A 1JL2A 1UAXA 2G8HA 1IKVA 2KQ2A 4CFDA 4EZ6A 3DRPA 4F2RA 4KHSA 1SL1A 3NDKA 1L3VA 5E41A 4Y1DA 4FLYA 4KI4A 1VSHA 4CJ4A 3KLIA 3PX0A 1TGOA 4NYFA 3AVHA 4CIEA 3OYJA 1QTMA 3HPGA 3PX6A 4OGEA 3S3NA 4HCCA 5FRMA 4KTZA 1TAQA 5C24A 4LD0A 2HHSA 1JLQA 3RRGA 1KRPA 4KHQA 1C6VA 3SQ1A 3ASMA 4FJNA 4M3UA 1B9FA 1KVBA 3K5LA 2G8KA 2RKIA 4B8AB 3TAQA 1BI4B 3IS9A 2Z1HA 3V81A 4FJ5A 3VA3A 3P5JA 1T05A 1XHZA 3VQ6A 4Z4CA 4RW7A 4OGCA 4O0IA 3TAPA 1UA1A 2LSNA 2E4LA 4J2EA 5KTQA 4CK3A 3OY9A 3KD5E 4I2PA 1JKHA 1SL0A 4LSLA 3K5MA 4KREA 1EX4A 4CGGA 3NF8A 4OPJA 1JLGA 3S3OA 2B6AA 1UA0A 4AILC 4NCGA 3VQ9A 1IO2A 4CEEA 4CEZA 5KGXA 3CYMA 4CGIA 1ITGA 4JS5A 1BQNA 4E19A 4I7FA 1C0UA 3DLHA 1SV5A 1UOCA 3VA0A 3DLBA 2KTQA 1ZBLA 4J2DA 3C95A 1HYZA 4NYNA 3HM9A 3OS0A 1HPZA 4IBNA 4DSKA 4PA1A 4J2BA 4CJLA 5J2NA 3ZT1A 4DU3A 1VSLA 4CJTA 3PX4A 3AA2A 3SUOA 1RT2A 4OJRA 4RW9A 1SKSA 3KLEA 1SUQA 4DSFA 4HUGA 4BE0A 1LAWA 2IS3A 3L2QA 1U4BA 1D5AA 1HNVA 2Q3SA 4E7KA 1L3TA 2IDOA 2Z1JA 3CM6A 1S1UA 3WNGA 1A5VA 1TKZA 3AVMA 3KJVA 4FJKA 1ASUA 3DMJA 1RBSA 2ZQBA 3K59A 1NJXA 1ZBFA 3QESA 4ELVA 4DU1A 3VQ8A 4TSXA 3KTQA 1S9GA 1F21A 4RW6A 1NK8A 3BDPA 4FJLA 1IG9A 1S1VA 3RWUA 1KLMA 3U3YA 2G8VA 4DQIA 3OS1A 4DTXA 1HJRA 4KHYA 1LW0A 3L2RA 3TABA 4DTRA 3QERA 1RT4A 1NK5A 3HVTA 2YKNA 1T03A 4CF9A 1FKOA 2OPSA 4ZHRA 4WE1A 2HHQA 4CJRA 4DTUA 3SJJA 1J53A 1Q9XA 5HP1A 1TL3A 2P5GA 1VSKA 2YNFA 3DM2A 2HVHA 1JXBA 1JXEA 3WNHA 3LPUA 4HUEA 3ZT0A 4HHTA 1JLCA 3V6DA 4DQQA 4QOZB 4HUFA 3AO2A 2Y1IA 1LW2A 2KFNA 1YT3A 2HNZA 4FW2A 3TWHA 4RW8A 3T3FA 4F4KA 3CFOA 4I2QA 1U49A 2HHUA 2YNHA 4ICLA 4H8KA 1TV6A 4AHRA 4HVJA 4Z4EA 3NF7A 3V9WA 4NCAA 4JS4A 4FK4A 1C0TA 3HP9A 4JRQA 2NUBA 4CJUA 3ZSWA 1WSGA 3NH1A 1JLAA 4KKOA 4E1MA 3I0RA 4DG1A 3QEVA 4RW4A 1RT3A 5I42A 1N5YA 1LAVA 3H08A 2G8WA 4OLBA 3MECA 3K57A 1NK9A 1SL2A 2Z1GA 2P1JA 4LH5A 3NCIA 4FLZA 2RN2A 5CYMA 3V9ZA 3B6PA 1NJYA 1RCHA 3OYMA 2FC0A 3LP2A 3K5NA 2OPQA 5HRNA 3DRRA 4ELUA 3VQCA 3AA5X 3QO9A 5T7BA 4FLWA 1ASVA 4Z0UA 4BWJA 1DLOA 1KFDA 5HRPA 1L5UA 3ZT4A 1NK7A 1ZYQA 4AHCA 4CHQA 4Z4HA 4DLEA 2PYJA 4E0DA 4KHUA 3SZ2A 5HROA 1Z25A 4DFMA 4CF8A 2I5JA 1RT1A 3L8BA 2BE2A 1HMVA 4R5PA 3HSTB 3DLGA 5FRNA 2KFZA 1VSIA 3MEDA 4FVMA 3VQ7A 1U47A 4CFCA 4HCBA 1S6QA 1LWCA 4DQPA 4FLTA 3F73A 3SNNA 4C8LA 2HHVA 5I3UA 1KFSA 3RR7A 4FK0A 2E6MA 1HQEA 4FXDA 1U04A 4BE2A 4E7IA 1QQCA 4FM1A 3OYGA 1KVCA 2XO7A 4Y1CA 3QNNA 2BDPA 3NGYA 4GW6A 4FJXA 1C1CA 1QE1A 4CHOA 4K8ZA 4O4GA 2ZD1A 3C6UA 5KRTA 4B9UA 3NH0A 4J2AA 4FJ9A 2BANA 1B92A 3ZSXA 1EKEA 4FLVA 1GOBA 3KLGA 1KLNA 3TAMA 3ZSQA 2G8FA 5CYQA 3V4IA 4FK2A 2KZZA 3C6TA 1JLFA 1A5WA 4AHVA 4KTWA 1DTTA 1BGXT 4YFUA 2ATQA 1WAFA 2DFHA 2RF2A 4CJFA 3RMAA 3IG1A 4BDPA 1BHLA 4NCBA 3QEPA 1C0MA 4M3ZA 3G10A 3HJFA 1D9FA 4KHWA 3HL8A 4LH4A 4AHTA 4BWMA 3O3FA 3VQQA 5J2MA 1IKWA 2VWJA 4E7JA 1SKWA 2FBVA 1SKRA 3P1GA 1RBTA 4JRPA 1D9DA 3KIOA 4DTNA 3S9HA 2QKKA 4FJMA 2FBYA 1YTAA 4AH9A 4AHSA 1S9EA 4DSIA 3O3GA 4N76A 3MXJA 3AVCA 3ULDA 5KRSA 3SCXA 3LWLA 2F8SA 2YNIA 2R7YA 3PUFA 3M8QA 4H4OA 4W5RA 3DRSA 4C8KA 5D3GA 4CGFA 3HP6A 3HO1A 3KK2A 3NF9A 1BCMA 4JLHA 4CJVA 3G0ZA 3VQPA 4DFPA 3DLRA 2HHWA 1VSDA 1EXQA 1IH7A 5HRRA 5J2PA 3MXIA 3PO5A 3AVGA 4I9QA 4M41A 4CJ5A 2X74A 1U48A 4B9LA 2YHBA 4CK2A 2HB5A 2A1SA 3V9XA 1O1WA 2EHGA 1FKPA 1WAJA 1UWBA 1RDDA 1VSJA 4G1QA 3CFRA 2XY6A 3FFIA 1C1BA 3L2VA 5HLFA 2IGIA 4BACA 4DMNA 3TAFA 1IKXA 3AO1A 1NKEA 3LDSA 5EU7A 4N47A 3V9SA 4H4MA 4FZYA 4CEBA 2OPPA 3OYIA 1X9WA 1RTJA 4CF1A 3NAEA 1ZBIA 1XI1A 2YV0X 2WONA 4EP5A 4B9VA 4FZZA 2AJQA 4O44A 1RDAA 3ALYA 1VSFA 2OZSA 3KLHA 1K6YA 1QSSA 4BE1A 5HBMA 2X6NA 3EZ5A 3ZSYA 3OJUA 4OKKA 1YVUA 3KD1E 1RBUA 3T19A 2HHXA 2PY5A 3NE6A 1CZBA 1D8YA 2O4IA 4CJKA 4B08A 4MQ3A 3L3VA 3DOLA 1YTUA 4O5BA 1RTDA 3NGIA 2DTUA 3SPYA 4DTMA 3ZT3A 4CEOA 1FK9A 1KCFA 4CHYA 3I8DA 3CQ8A 3TANA 4M45A 3IAYA 1TK0A 3SQ4A 1T8EA 4CHPA 1N6QA 2YHAA 1Y97A 2XRIA 4W5QA 3OYLA 4XIUA 4DLGA 1RT6A 4W5TA 4F8RA 4KRFA 4KFBA 4B9TA 5J2QA 4FJIA 3DYAA 4W5OA 4UQGA 1I39A 3LZJA 2W42A 1R0AA 4CEQA 1VSEA 3LP0A 3P83D 1KVAA 2FBXA 5KGWA 3LZIA 3RTVA 3QEIA 5K14A 4K8XA 5C42A 3AVIA 1VSMA 3V1QA 1J9AA 4FLUA 3LP3A 3IRXA 4KO0A 4DTJA 1T7PA 3QLHA 4LSNA 3HXMA 4PY5A 2JGUA 3MEEA 4IFVA 3TR8A 2HNDA 4DFJA 4CJWA 3WNFA 1BQMA 2OZMA 3AVNA 3ZSZA 4MFBA 1NK4A 1L3UA 1XWLA 4ELTA 1ZBHA 1WSFA 1CXUA 1S1TA 3S3MA 4IKFA 3TARA 2XHBA 4E89A 3HT3A 3BGRA 1RT5A 3NBPA 4IDKA 4OVLA 4OLAA 2DY4A 3O4QA 4ZTFA 4KHNA 1BIZA 3QIPA 1BL3A 4C8NA 4B8CA 4CGHA 4AHUA 1JL1A 1RILA 3OYNA 2RPIA 3AVLA 4FJHA 2QXFA 3SUNA 4IG0A 3K2PA 1ASWA 4CEAA 4CEDA 1TK5A 4N56A 1C1AA 2QK9A 3V1RA 4CECA 4DTOA 4F3OA 4OPKA 3DOKA 2QKBA 1VRTA 2D0CA 4GMJB 4FJ8A 4ZTJA 1TVRA 4DF4A 3O4NA 1NOZA 1WNSA 1WN7A 5FROA 1NOYA 2PZSA 3TAGA 4FW1A 4CESA 2E6LA 3AO3A 5DK5A 4N5SA 3RMCA 3M8PA 4M3WA 1DTQA 1RNHA 2BGGA 4Q0BA 1CZ9A 3AO5A 5DMRA 1L3SA 1B9DA 5SZTA 4DU4A 1QS4A 2HMIA 1ZBUA 4B3OA 4CIGA 2VG6A 4LY7A 4CIFA 3KK1A 1LV5A 3VQ5A 2Y1JA 4EP4A 4KB0A 1NJZA 1FXXA 1W9HA 3DLKA 3OYBA 3F9KA 3QETA 1Q8IA 3THVA 3SUQA 4RG8A 4CHZA 4KV8A 3MAQA 4FM0A 4M3TA 4FZXC 1A5XA 4E3SA 1NK6A 3E01A 3DLEA 1RTHA 3VQAA 3KK3A 3NF6A 3MXMA 4I9LA 1S1XA 3V9UA 4FJGA 3RMDA 4F3TA 3C94A 4KI6A 3HVRA 4ID5A 4B9NA 1U45A 3QIOA 3AVFA 1VRUA 3AO4A 3ZSVA 1BCOA 3ISNC 3OYEA 3AVKA 3LPTA 3CM5A 4EZ9A 3DI6A 4Q5VA 3AA3A 3NGZA 3KLFA 3VQEA 1NJWA 4BDZA 1HYVA 3SQ0A 2XY7A 2ZE2A 1TL1A 3KKRA 3SV4A 2GUIA 4M3RA 3L2UA 1JLBA 2P5OA
chains in the Genus database with same CATH superfamily
4DTPA 3R6MA 2IOCA 4O0JA 2E8AA 4WQ4A 1HQUA 4GVMA 3ENOA 3U6FA 4PQUA 1BWFO 4Z4IA 3O3HA 3A5MC 4WQ5A 3D45A 4FOEA 3ZSRA 3NH2A 4C23A 4IOCL 4JI7K 4PKHA 4E7HA 2FSJA 4A61A 2OPRA 4F9OA 3SQ2A 5HRSA 4DR2K 3CCEN 2F8TA 2YJFA 4DTSA 2NRVA 4B9SA 1WSIA 4B3MK 1R59O 5C10A 3H3NO 1MA9B 2ZM6K 2QXLA 2A1RA 3I55N 5AQIA 4W5NA 1VK0A 3LWMA 4DF8A 1HLUA 3VEYA 3CF5L 1RDUA 3CCSN 3CMEN 4H5WA 3AVAA 4OX9K 4YOVA 2HMPA 3HZ6A 4BRAA 4CJEA 4DSEA 5AQGA 1WSJA 2IC3A 5TKYA 3SMPA 4CF0A 1HYSA 1RTIA 5C2DA 1NGBA 2W41A 2O4GA 4CD1A 1BI4A 2VCPA 3J7YP 2WTUA 3VN5A 4H0YB 1MU2A 2YKMA 3SPZA 3A2FA 2QM1A 4JI6K 1TUUA 2VQEK 3OS2A 1VQ4N 3K5OA 4QCLA 3HPHA 4DV2K 1YJNN 3PV8A 2NRHA 3THYB 3OYAA 3CQXA 1XHXA 3SV3A 4FWPA 3LP1A 5AQVA 4DV3K 1Q9YA 2OYQA 2P9UB 1OH8A 5IT9O 3KKSA 3WQTA 4FJJA 2GX9A 5C12A 1TKXA 3TSQA 4ID1A 4BR4A 4XH4A 2G8HA 5AR0A 3WEEA 1DT9A 1T6DA 5M1FA 1M90O 2E2QA 3DRPA 4KHSA 1SL1A 4Y1DA 1NWKA 1VSHA 4H03B 4NYFA 3AVHA 4CIEA 3HPGA 2VWBA 5GADP 3PX6A 3S3NA 4HCCA 4KTZA 2GWJA 4LD0A 3RRGA 1GLBG 5F2RA 4KHQA 4M3UA 1KVBA 1EWQA 2G8KA 4YOYA 4BRIA 2YCHA 4XH5A 2GWKA 3TAQA 3V81A 4EFHA 1WBDA 4MDAA 5LMUK 1GLFO 4O0IA 5CHIA 3TAPA 2LSNA 3U8XA 2E4LA 4J2EA 3NMUA 3UKRA 3KD5E 5EX5A 1JKHA 2I7NA 4CGGA 2B6AA 3O6WA 5KGXA 3VQ9A 4CEEA 4CEZA 3C7NA 4CGIA 3E9OA 3ATVA 3ZX2A 1BQNA 4E19A 3DLHA 1SV5A 3VA0A 3DLBA 4J2DA 1TYQB 1HYZA 4NYNA 3OS0A 5J2NA 4DU3A 1NGEA 3L4IA 3D7EO 3SUOA 4QS9A 3CJ9A 1SUQA 4DSFA 4BE0A 3LM2A 3L2QA 4E7KA 4IJAA 2O8FB 3O80A 1A5VA 3ZX3A 4CZGA 3DMJA 1RBSA 3EL2A 1RDWX 1NJXA 2QWOA 4ELVA 2NRTA 5C0YA 1S9GA 3AAPA 4RW6A 4EIAA 1BA0A 1NBWA 4DTXA 1HJRA 3TABA 3FZFA 4JK8A 3R8EA 4CF9A 1FKOA 4CZEA 4XEIA 4ZHRA 4CJRA 1N8RO 3SJJA 3O5BA 2YNFA 3DM2A 3WXKA 3QBWA 3LPUA 4HUEA 3ZT0A 5EXWA 4DQQA 4HUFA 2A41A 2KFNA 3TWHA 2HHUA 1HKBA 4I2QA 4KBOA 4ICLA 1TV6A 4HVJA 4CZLA 1E4FT 4NCAA 4FK4A 1XQSC 1C0TA 3HP9A 4JRQA 3H46O 4CJUA 2YI1A 3BP8A 3I0RA 4DG1A 4YOWA 5ADXA 2IVNA 3MECA 3WXIA 5AQTA 4GKJK 1SL2A 3NCIA 3B6PA 4MO4A 1RCHA 1C0FA 2FC0A 3A5NC 1Z05A 4FLWA 3SAFA 3O08A 1ASVA 4Z0UA 1DLOA 2P9KB 3ZT4A 1BU6O 3KWGA 4AHCA 4CHQA 5BRFA 4BY9C 3SZ2A 4DFMA 2D1KA 1J5EK 3W3DA 3M6GA 2BE2A 2NZTA 4H5VA 3RVCA 1XC3A 4FVMA 3C0BA 3VQ7A 2BTFA 3ZX0A 4K41A 3LDQA 3G6EN 4C8LA 3WQUA 3M1FA 2E6MA 1HQEA 1U04A 4E7IA 4FM1A 2P9LA 3OYGA 4BRKA 4Y1CA 1S72N 4GW6A 1QE1A 4K8ZA 4O4GA 2ZD1A 5LL6Z 2ZJQL 3NH0A 1B92A 2FF3B 5JVGL 1KLNA 3KLGA 1E4GT 3ZSQA 3C6TA 4LF9K 4KTWA 3KVGA 5LJWA 1BGXT 4CJFA 4JK9A 2O8CB 5AQLA 3QEPA 1VQNN 4M3ZA 3ZEUB 4LH4A 4AHTA 5AQQA 3OW2M 2QWMA 4E7JA 1SKWA 1SKRA 3QDKA 5KPZA 1RBTA 3KWIA 1KAXA 3TTFA 1S9EA 4DSIA 3AVCA 4A57A 1SQKA 3PUFA 3CERA 4W5RA 4ISFA 3BUZB 5A2QO 4DFPA 3G0ZA 3VQPA 2CGJA 3DLRA 5BREA 2HHWA 1VSDA 3S41A 3ZYYX 4IOAL 1U48A 2A1SA 5E26A 1NM1A 4RWTA 2XY6A 3AO1A 4GKKK 1U6ZA 3QMLA 3V9SA 4FZYA 1X9WA 1RTJA 3O9QA 3NAEA 1ZBIA 5M1OA 2YV0X 2KLAA 4O44A 1VSFA 2ZJRL 3ZSYA 4CBUA 3QFUA 4G9ZA 2O8EB 4FOIA 4B08A 1SAZA 3LDOA 4GV3A 1YTUA 3NGIA 2WC9A 3MCPA 2AP1A 2A5XA 3G4SN 3SBGA 1HX1A 1FK9A 4KH5A 5GAEP 3CQ8A 4BVOA 2P9IA 5MLCQ 1T8EA 4JHDA 5LY3A 2KZZA 4W5QA 1OH6A 4KRFA 1BUPA 1W97L 3D2EA 2NRXA 3DYAA 4DHYA 1VSEA 4EHTA 3LP0A 3RTVA 5KGWA 2Q2RA 3AVIA 1J9AA 1H1VA 1T7PA 3IRXA 2RHKA 5JLHA 5LJVA 3HXMA 3VPZA 5F1XA 3WNFA 1BQMA 3ENBA 3HSCA 1XWLA 2JWLA 1WSFA 1S1TA 4JKAA 1NGJA 2IIRA 2P9PA 3CQYA 3M5RA 2OANA 3NBPA 3O4QA 4ZTFA 3OYNA 4C8NA 4B8CA 1JL1A 1RILA 2UXBK 2QK9A 3V1RA 4CECA 4CW7B 1HKCA 2F7TA 1VRTA 3E1YA 4GNIA 1NOZA 1WNSA 1WN7A 1NOYA 3TAGA 2E6LA 3Q7CA 3M8PA 3OBWA 4Q0BA 3AO5A 3WUHA 3VEVA 3R1XA 4LY7A 1VQMN 4CIFA 1YHQN 3VQ5A 4EP4A 5BRHA 1FXXA 1W9HA 3OYBA 4FPBA 1SZ2A 3THVA 4JI2K 3MDQA 4CHZA 4IO9L 3MAQA 4FM0A 4M3TA 4E3SA 4YY3K 1RTHA 3VQAA 1S1XA 2CGKA 5M1NA 1SS6A 4ID5A 3CD6N 4FWQA 3CMAN 3QIOA 3AGKA 5DM7L 3AVKA 3CM5A 3DI6A 4Q5VA 1N32K 3KLFA 4H5NA 4X66K 3LDPA 2GEMA 3SQ0A 2QEXN 3SV4A 3UKUB 2GUIA 2NRZA 3S9HA 2P5OA 3JYTA 4DSJA 2D0AA 4O55A 3MK6A 3CCLN 2Q36A 1BISA 3A0IX 4HTUA 3ZSOA 1WSEA 2VYPA 4RCHA 1K8AO 4C8OA 1V4TA 3I0SA 3ID8A 3J80O 1XNRK 4CEFA 1YF5L 4BRPA 2D5RA 1NGHA 4PUOA 1LCUA 4NLBA 4CJQA 3QEWA 4LF8K 3OYKA 4DWIA 2HHTA 2HF4A 1GLCG 3R3LA 4OKJA 1ATNA 3DWLA 3UB5A 1K9MO 3EKSA 3OYCA 1TKDA 2P9UA 4CZFA 3NVKA 1XC9A 4OKEA 1GLJO 4CFBA 3L2WA 2ZWHA 3AVJA 1JLEA 4NXNK 4IO8A 2GV9A 3RR8A 4PL8A 1Z26A 1VQ8N 3HOTA 2F9TA 4CBWA 3K58A 3ITHA 4KTQA 3T69A 2JLEA 4KPYA 4BDYA 1ATSA 3NFAA 3SBTA 3WNEA 5SWMA 3EE9A 3LAMA 5C25A 4BRMA 1ESVA 1YAGA 4EHUA 2NRWA 3EY1A 4PHTX 4CE9A 3UIQA 3O9TA 3T1AA 3CJCA 5AQOA 4C1NI 4KB1A 3OYDA 2EX3A 1NGCA 3AVBA 4IXCA 3T7ZA 4DUZK 5I9EB 1EP4A 2HW3A 3HOSA 4DR3K 4M3XA 4CF2A 4QAGA 1KTQA 2IAJA 3D0PA 3IDHA 1NG9A 3GL1A 3Q7BA 3OYFA 1W0HA 4JEPA 3M8SA 4XH1A 1X9JA 1GLEG 3O1WA 4CK1A 2WUSA 3TAEA 3LAKA 2P9NB 2D0BA 4PWDA 3U9DA 3QICA 1X1PA 3D2FB 1EO1A 3OJSA 3LALA 1JL2A 1UAXA 5GIPA 1IKVA 1QVGM 1U2VA 4CFDA 2O8FA 3DXMB 1L3VA 2Q31A 4Z94A 2D0OA 5C24A 3WT0A 3K9JA 1C6VA 4FJNA 1NGDA 3VENA 5AQMA 3NVMA 3IS9A 3P5JA 1T05A 1OH5A 3VQ6A 1VQPN 3ATUA 1ILYA 4FVUA 2W6KA 4BRLA 3OY9A 4LSLA 3NF8A 2IVOA 1JLGA 4IOXA 4HTLA 1QQNA 4NCGA 1IO2A 1K8KB 3CYMA 4CZJA 4OPAA 4B1WB 4YHHK 4LFBK 4CZMA 4K0KK 4DUYK 2KTQA 4YOUA 3MWPA 3HM9A 1HPZA 4IBNA 2E88A 1KAZA 4BR2A 4J2BA 4IDHA 1RT2A 3KLEA 3I33A 3B8AX 3CM6A 2Z1JA 3KJVA 1ASUA 3K59A 4DV6K 1ZBFA 4JI8K 4FWRA 1KXPA 4IJNA 3VQ8A 1YJ9N 4GY2B 3KTQA 3BY5A 3GE1A 3BDPA 2AA4A 4B1UB 2G8VA 5BRDA 1T03A 3QERA 1QZ6A 3HVTA 2YKNA 4FL9A 4V19S 3GBTA 4BRCA 1J53A 5HP1A 1TL3A 1VSKA 4WFBL 4BR9A 1XUPO 5FPNA 3T1HK 1RFQA 1G99A 3ZEUA 4K43A 3T3FA 4F4KA 2DPNA 2QA4N 3VETA 4Z4EA 4JS4A 5C15A 3ZSWA 1WSGA 4BR7A 4KKOA 1BA1A 3QEVA 2VGNA 3BF3A 3A5OC 4O8UA 2G8WA 4OLBA 5CE3A 3V9ZA 5CYMA 1VQKN 5HRNA 4FWSA 5JMVA 1S3XA 1NK7A 1ZYQA 4Z4HA 2PYJA 3FZKA 1WBBA 3L8BA 4CI6A 5AQFA 3MN6A 3HSTB 3DLGA 2A42A 3MEDA 4HCBA 4FLTA 2HHVA 5AQNA 3VEXA 4FK0A 1ZBSA 1QQMA 4BE2A 4GV6A 1QQCA 1C0GA 1KVCA 4FJXA 3JS6A 3H1QA 5KRTA 1QVFM 4J2AA 4FJ9A 3AY9A 4M7YA 4NO7A 3SK3A 5CYQA 3V4IA 2E1ZA 2ATQA 1WAFA 2DFHA 2RF2A 4BDPA 2O8EA 3IG1A 4NCBA 1C0MA 4KHWA 3RSEB 4BRQA 3VQQA 2ASOA 4JI5K 3HBTA 3H3OB 4DTNA 2QKKA 1DKGD 2UXDK 3MXJA 1YJWN 2YNIA 2R7YA 4C8KA 3BF1A 3IKMA 5D3GA 4CGFA 4Y0WA 3OTOK 3NF9A 4JD2B 4JLHA 4CJVA 4BC5A 1NGFA 3WXJA 1EXQA 3AVGA 4JKGB 4B9LA 1VQ9N 2YHBA 2HB5A 1WB9A 5AQSA 4BQLA 5AZJB 1FKPA 4JI1K 5JLFA 1VSJA 3CFRA 3FFIA 2GUPA 2IGIA 1IKXA 5M1KA 3LDSA 4H4MA 1OVYA 2ITMA 5BPMA 5KPTA 2OPPA 5BN9A 2Q97A 1XI1A 2PAVA 5EOYA 1N36K 4A5BA 5AZIA 4O8KA 3F5TA 4DV5K 3THXB 3MMVA 4FO0A 3TSPA 4JKHA 4YOXA 4DV0K 5HBMA 2X6NA 3EZ5A 4OKKA 1YVUA 4JN4A 3O9RA 2O4IA 3CCVN 4CJKA 3SLCA 4CJ7A 3U9ZA 2DTUA 1YXQA 3SPYA 3ZT3A 1KCFA 3TANA 1TK0A 3SQ4A 3CHWA 3K9KA 5HOOA 2YHAA 4F8RA 3DLLL 3F9MA 1FW6A 4W5OA 1QZ5A 4CEQA 3LZIA 4N76A 3V1QA 4KO0A 4LSNA 2JGUA 3WXMB 3AVNA 3ZSZA 4I6MA 1L3UA 1CXUA 4IKFA 4E89A 3BGRA 4OVLA 1VAZA 4OLAA 5AQUA 3QIPA 4FJHA 2RPIA 4IG0A 4F3OA 2QWQA 2D0CA 4GMJB 3VF4A 1M1KO 4FJ8A 4ZTJA 1IBMK 4DF4A 4AF1A 2VQFK 4ISEA 3AO3A 4N5SA 5DK5A 1RNHA 2BGGA 4NB4A 3AARA 3N4PA 1QS4A 3HI0A 2Y1JA 3DLKA 3F9KA 3FGUA 4RG8A 3E01A 3DLEA 1NMNA 2RE2A 4X65K 4I9LA 4BROA 4FJGA 3RMDA 5FPDA 1JCFA 4IEEA 3AO4A 3ZSVA 1X3NA 3ISNC 3OYEA 4EZ9A 4YORA 4U7BA 1YITN 5AQZA 4B3RK 3PLAA 2VGMA 4CZKA 3VQEA 1HYVA 3KKRA 5DM6L 4IWVA 1LWFA 3V1OA 5J1EA 3PY8A 3HYFA 1WLJA 1TUYA 3ZETB 1D4XA 2Q1NA 5BR8K 3AA4A 2A6AA 2W40A 1WUAA 4IG3A 4B1YB 4CJSA 4B1VA 4DV1K 5CZ1A 4DSLA 4QS7A 1W7AA 1QSLA 3HM8A 3SYZA 3I56N 5AQWA 5FDLA 2VG7A 3MEGA 1RDCA 2P51A 1TK8A 5GINA 3CI5A 4CERA 2B5JA 3EKUA 4DS4A 2KW4A 3CCJN 2O8BA 1TKTA 4N41A 2FSNA 4MDBA 4FM2A 3CG7A 4KAZA 1GLAG 3D2FA 3ENHA 4DQRA 1GOCA 4B9MA 1NK0A 3CJ1A 2VG5A 3J7ZO 4FJ7A 4YNQA 3KZBA 1QSYA 2O8DB 2XY8A 4CHNA 3DXMA 4DR4K 2ASPA 3VTIA 3PSFA 4LC9B 5BR9A 1X9MA 1X9SA 5AFUH 3EYZA 1NKBA 1NGAA 4U67L 5M1PA 5M1QA 3UKRB 1HNIA 3ZCMA 4BG9A 4M42A 1CLQA 4DR7K 1J5OA 2DFFA 1BIUA 5CZ2A 1LWEA 3AV9A 3UE5A 3HK2A 3C7NB 3VQDA 3LANA 4ILGB 4BQZA 2VWKA 4DQSA 4FWLA 4K42A 3PO4A 4BRHA 2KZMA 1IKYA 2X78A 4CGJA 1XNQK 1EETA 1K8KA 4C8MA 2JWKA 2YNGA 1VQ5N 1S6PA 2HVIA 1J6ZA 4BRDA 1NNEA 3OBYA 4ISGA 2ITGA 2OA8A 4E1NA 4BR5A 2B4JA 2WOMA 3VQBA 2HBLA 3EO3A 4HWIA 3JSMA 1TAUA 1OH7A 5GAGP 3QB0A 4F2SA 2G8UA 4A2AA 3N4QA 4X62K 3CXCM 5AQYA 3NDKA 5E41A 1HNXK 4FLYA 2NRRA 3O9SA 4CJ4A 1TGOA 3OYJA 1QTMA 5FRMA 3P4IA 4K25A 4MLEA 1VQ7N 1TAQA 1E3MA 2HHSA 3KHYA 4AQYK 1KRPA 3SQ1A 3EE8A 3ASMA 3TU5A 3T1YK 3K5LA 1BDGA 3GG4A 2RKIA 4B8AB 1NMDA 1KD1O 2Z1HA 3VA3A 1JJ2M 1XHZA 4Z4CA 4OGCA 1YI2N 1UA1A 4BVPA 2W6LA 4B1ZA 3CCMN 5KTQA 4I2PA 1EX4A 2PFUA 3O9UA 4FWOA 1UA0A 2HBJA 2HF3A 2YHWA 1GLDG 1C0UA 3DAWA 1UOCA 1V4SA 1ZBLA 3C95A 3MX5A 2Q0UA 4CJLA 3ZT1A 3CJBA 1VSLA 1KQSM 3PX4A 3CPEA 3THYA 2EWSA 3AA2A 5AQKA 4RW9A 1SKSA 4H5TA 4HUGA 2IS3A 1D5AA 1HNVA 1L3TA 2IDOA 3WNGA 1GLLO 1TKZA 4DR6K 2P9LB 1IV0A 4LF7K 1IG9A 3DXKB 4KH4A 3CJ7A 1KLMA 4DQIA 3OS1A 3ZLJA 4KHYA 3L2RA 1RT4A 1NK5A 4EAHD 3TTCA 2OPSA 2HHQA 1YVNA 2HBKA 2P5GA 5FPEA 2WBNA 4H0XB 1Y64A 4JV5K 2E20A 3FZMA 4QOZB 3AO2A 2Y1IA 2HNZA 4FW2A 3P31A 2FLOA 3CFOA 3MN9A 4H8KA 2NUBA 3THWB 3FE1A 5I42A 1RT3A 1LAVA 3K57A 2Z1GA 4MLHA 1JCGA 4LH5A 4FLZA 1KC8O 4NLCA 3OYMA 2QWRA 4OO1J 3LP2A 2OPQA 2V52B 3DRRA 3VQCA 1TYQA 3QO9A 4CVNE 3LDLA 4JI0K 3D6RA 4BWJA 4CZHA 5HRPA 1KFDA 4JI3K 4JKGA 2I5JA 1N33K 1HMVA 1U47A 4LF5K 5AQPA 3SNNA 1OKJA 5I3UA 4QS8A 1KFSA 4FXDA 3FZHA 3SJHA 3NGYA 1C1CA 5BPNA 5EY4A 4B9UA 4M7XA 4ILHA 2CH6A 3ZSXA 1EKEA 4FLVA 1GOBA 3TAMA 4FK2A 3VMFB 3J8AA 4YFUA 1HR0K 3J7AP 4JHDB 4BWMA 3O3FA 4B3SK 3D2EB 2VWJA 2FBVA 4JAXA 4JRPA 1D9DA 2FBYA 1YTAA 4IFEA 4AHSA 4AH9A 3L0QA 4A62A 3QBXA 5KRSA 2F8SA 4H4OA 3DRSA 5TKWA 1VHXA 3HP6A 3HO1A 3R9PA 1IH7A 2BH1A 2KKZA 4CBXA 3GOIA 1W2BM 2P9PB 4CK2A 4NXMK 3V9XA 2EHGA 5FPMA 2YX6A 4H0OA 4BACA 5JVHL 5EU7A 2P9KA 4N47A 1ZC6A 4CEBA 3OYIA 3OHRA 2BUPA 4CF1A 4BRFA 3O1BA 3TPQA 1NJIO 4EP5A 1LOTB 2E2OA 2AJQA 1RDAA 3ALYA 3O4WA 1Q82O 3O8MA 1K6YA 1QSSA 4BE1A 4AM6A 4JNEA 3KD1E 1RBUA 3VGLA 2HHXA 2PY5A 1BO5O 5GAHP 3DOLA 1O13A 4O5BA 4H0TB 4DTMA 4CEOA 3WXLA 5JICA 3CC7N 4CHYA 2O8CA 4IZ9A 3VEWA 1N6QA 2ZGZA 4WFNL 2QTDA 2GELA 3CETA 5KQ8A 2CGLA 5J2QA 4FJIA 5B8HA 3TTDA 3U4LA 1I39A 1R0AA 4BRGA 4DV4K 2ASMA 2FBXA 3CCUN 3QEIA 5K14A 3QLHA 4PY5A 1P8ZA 4IFVA 3TR8A 2YJEA 4CJWA 4MFBA 4JKDA 4BRNA 4B3TK 3VEOA 3EN9A 5ADXH 3TSUA 3HT3A 4IDKA 4CGHA 1FJGK 4UY8O 4YOTA 1K73O 3SUNA 3ZETA 4CEAA 4DR5K 3H45C 3SMSA 1C1AA 2HOEA 4DTOA 3DOKA 2QKBA 4FWMA 4LFCK 2NNWA 5FROA 3E66A 3RMCA 2F4VK 4M3WA 1CZ9A 5DMRA 1XMQK 3EZWA 4DU4A 4CIGA 3MN7A 1LV5A 1BOTO 4KB0A 3CIPA 3FFKB 1Q8IA 1A5XA 2OTLN 3V9UA 2V7YA 1Q18A 2O8DA 4DCHA 4BGAA 3LPTA 4ILJA 2IVPA 4WQ4C 3AA3A 3NGZA 2H3GX 4A2BA 4WQ5C 4A59A 2YHYA 4M3RA 2HNYA 4H5RA 5KI6A 4L8RB 4BC3A 3ZT2A 2GBZA 1T3VA 2XY5A 3ULEB 2PYLA 2NLXA 1RT7A 2X6SA 4KHPK 1I3AA 1J54A 4KH6A 3SUPA 3PSIA 1NKCA 5IWAK 4IEIA 2P9SB 4M3YA 1HRHA 3OYHA 1U2VB 3OVNA 3VQ4A 1CZAN 3RMBA 1T44A 1WSHA 2YHXA 2WFBA 3VF6A 4Z4GA 3QEXA 5BN8A 3U3GA 2HSTA 2D0PA 1RDBA 5AQJA 1XMOK 2V51B 4CFAA 1GOAA 3L3UA 1CXQA 1HKGA 3HTVA 5BPLA 2DFEA 5JS2A 2Z1IA 3LL3A 4JKCA 4LFAK 4E7LA 2ETJA 3M8RA 4DQ8A 3SI6A 3RRHA 3DJCA 4DS5A 5JS1A 1QHTA 1G15A 5CY4A 4FCYA 4FSVA 1EQYA 4DFKA 1REVA 3BEXA 4B9QA 1RBVA 3QNOA 3CFPA 1MWMA 3UKUA 3CC2N 1QHAA 4BC2A 4FYDA 2FBTA 2G8IA 3QFPA 3VOVA 3QINA 4FLXA 4Z4FA 3B6OA 1YIJN 4GV9A 2F96A 3H6EA 4WCEL 4CCHA 1S5JA 3MX2A 3C6AA 4CJ3A 3NHGA 4BGBA 3TI0A 1RBRA 4CGDA 3IUCA 1KSPA 3L6QA 4IFYA 5FLXO 3I8BA 1MWKA 4B1XB 4CJPA 4WFAL 3EEQA 1S1WA 1KAYA 3HPOA 1HPMA 2KQ2A 1NGGA 4EZ6A 1P90A 5E84A 4F2RA 2ZJPL 2I7PA 4KI4A 2E2PA 2D4WA 3AGRA 3KLIA 3OA9A 4AM7A 3PX0A 1Q81O 1NLVA 4OGEA 1I94K 1JLQA 3DXKA 4C1NK 3IMXA 5AJ3K 1B9FA 5KPRA 3SAHA 1BI4B 4FJ5A 3PIOL 1Q86O 4RW7A 3BZKA 3VERA 3HRGA 1JCEA 1X3MA 4PKGA 5EVZA 4CK3A 1SL0A 3A8YA 3G25A 3K5MA 4KREA 1WOQA 4OPJA 3S3OA 4AILC 2UYTA 1ZXOA 4WYBA 3FR0A 4X64K 1ITGA 4JS5A 1N34K 4I7FA 4FWNA 1HJOA 2F9WA 1MDUB 3THWA 4DSKA 4PA1A 4YDUA 4CJTA 2CH5A 1RGIA 4OJRA 2UXCK 5GIOA 1BG3A 1LAWA 3WEEB 3K0SA 4BG8A 1U4BA 4PKIA 2Q3SA 2P9NA 2HBMA 1S1UA 3ID6A 3AVMA 4FJKA 2ZQBA 3QESA 4DU1A 4TSXA 1F21A 4FJLA 1NK8A 1S1VA 4H0VB 3RWUA 3VF2A 3U3YA 2UUBK 1LW0A 3FLCO 4DTRA 4JK7A 1QQOA 4WE1A 4DTUA 1IG8A 1Q9XA 2E1YA 2HVHA 1JXBA 1JXEA 3WNHA 5AQHA 4HHTA 1JLCA 3V6DA 5H1SQ 4E1JA 1LW2A 3W0LA 1YT3A 4RW8A 3PIPL 1U49A 3CPWM 2HHHK 2YNHA 4FWKA 4AHRA 5F0XA 3A5LC 3NF7A 3V9WA 3NH1A 1Q7YO 1JLAA 4E1MA 1N5YA 4JYAK 4RW4A 3H08A 3MWTA 1NK9A 2P1JA 1NJYA 2RN2A 3CJAA 3K5NA 4ELUA 3AA5X 5T7BA 1ATRA 1L5UA 2E5LK 4FPAA 4DLEA 4E0DA 4KHUA 5HROA 1Z25A 4CF8A 1RT1A 3E9LA 4R5PA 5AZIB 1IJJA 2OCEA 5FRNA 1VSIA 2KFZA 4A5AA 3L4QA 4BR0A 3VTHA 2A3ZA 1S6QA 4CFCA 1LWCA 4DQPA 2QW9A 3F73A 1HNWK 1OVQA 3C65A 3RR7A 4JI4K 3VGMA 1S22A 2XO7A 3QNNA 2BDPA 4CHOA 1VQON 3C6UA 1IBKK 2BANA 5CR4A 2G8FA 1EWRA 4AHVA 1JLFA 1A5WA 1VQ6N 1DTTA 2J4RA 3RMAA 1HUXA 3H1VX 1BHLA 4PL7A 3HJFA 3G10A 1D9FA 3HL8A 2QWPA 3MN5A 1YUWA 5J2MA 1IKWA 3P1GA 3C6HA 5AQXA 3KIOA 4FJMA 4LF4K 4YDUC 3E9PA 3O3GA 3ULDA 3SCXA 3LWLA 4BREA 3JXUA 3M8QA 2PBDA 4RTFD 1BCMA 3KK2A 2UUAK 4I6MB 5J2PA 5HRRA 3MXIA 4O5FA 2FF6A 3PO5A 4I9QA 4M41A 4CJ5A 2X74A 4JKEA 3GDQA 2GTDA 1O1WA 3CC4N 2V7ZA 1WAJA 1UWBA 1RDDA 4G1QA 4R79A 5HLFA 1C1BA 3L2VA 4DV7K 4DMNA 3TAFA 1NKEA 2UUCK 2ZF5O 3BZCA 1VQLN 2WONA 4B9VA 4FZZA 2KHOA 4BC4A 2OZSA 3KLHA 3AAQA 4OPHA 4L3QA 3OJUA 1DGKN 3T19A 3NE6A 1CZBA 4MO5A 3F2KA 3KK7A 1D8YA 3G71N 1NU0A 4MQ3A 3L3VA 4J8FA 1RTDA 4LF6K 3I8DA 3IAYA 4M45A 3LM9A 3CCQN 4DB3A 2QI2A 4CHPA 5ELZA 5AFUA 3RSEA 1Y97A 2XRIA 3OYLA 4DLGA 4XIUA 1RT6A 4W5TA 4KFBA 4B9TA 3VEZA 4UQGA 3LZJA 2W42A 1IBLK 3P83D 1KVAA 3P39A 2A40A 4K8XA 5C42A 1VSMA 4FLUA 4DTJA 3LP3A 1Z6RA 3MEEA 1HNZK 2HNDA 4CZIA 4DFJA 2OZMA 4JD2A 3VGKA 1NK4A 4ELTA 1ZBHA 2OTJN 1T6CA 3S3MA 3TARA 2XHBA 2FSKA 4DR1K 1RT5A 3MCAB 5AZJA 3LDNA 2DY4A 4KHNA 1BIZA 5C2FA 1BL3A 5HL7L 4AHUA 3AVLA 2QXFA 3FZLA 4CEDA 3K2PA 1ASWA 1TK5A 4N56A 3J81O 4OPKA 3P38A 3SAGA 5LMNK 3ULEA 5AQRA 1DEJA 1TVRA 4JKBA 3O4NA 2QWLA 2PZSA 4FW1A 4CESA 1DTQA 3THXA 1L3SA 1B9DA 4CD3A 2O8BB 5SZTA 2E2NA 5KQDA 2HMIA 1ZBUA 4B3OA 2VG6A 2P9SA 3JAMO 3KK1A 4DKWA 1NJZA 2P9IB 3QETA 4GVEA 2ZGYA 2Q0RA 3SUQA 4M63C 4JKFA 4KV8A 3M3ZA 4FZXC 1NK6A 3KK3A 1NGIA 2FXUA 3NF6A 4WF9L 3MXMA 2UU9K 4F3TA 3C94A 4KI6A 3HVRA 4B9NA 1U45A 3AVFA 1VRUA 1BCOA 4H0PA 2QWNA 1NJWA 4BDZA 3CCRN 3VESA 3IFRA 2XY7A 2ZE2A 1TL1A 3L2UA 1JLBA
chains in the Genus database with same CATH topology
4DTPA 3JYTA 4DSJA 2D0AA 1LWFA 2HNYA 4O55A 2IOCA 5KI6A 3V1OA 4O0JA 5J1EA 3PY8A 3HYFA 1WLJA 4L8RB 1HQUA 4GVMA 1BISA 3ZT2A 4HTUA 3U6FA 4PQUA 3ZSOA 2GBZA 4Z4IA 1WSEA 3O3HA 4C8OA 3AA4A 2XY5A 3D45A 3I0SA 3ZSRA 4IG3A 3NH2A 4CJSA 4CEFA 2PYLA 5CZ1A 4E7HA 4DSLA 1RT7A 2OPRA 2X6SA 3SQ2A 5HRSA 1I3AA 2D5RA 1J54A 4PUOA 3SUPA 4CJQA 2F8TA 1NKCA 1QSLA 3SYZA 3QEWA 5FDLA 4DTSA 2VG7A 3OYKA 4B9SA 3MEGA 4DWIA 4M3YA 1RDCA 1WSIA 1HRHA 2P51A 1TK8A 2HHTA 3OYHA 4OKJA 4CERA 2B5JA 3OYCA 1TKDA 3OVNA 3VQ4A 4DS4A 4OKEA 1XC9A 2KW4A 4CFBA 1TKTA 3L2WA 2A1RA 3RMBA 4N41A 4FM2A 1WSHA 3CG7A 4KAZA 3AVJA 4W5NA 1JLEA 4Z4GA 4DQRA 1GOCA 4B9MA 1NK0A 2GV9A 1VK0A 3LWMA 2VG5A 4DF8A 3U3GA 3QEXA 3RR8A 4FJ7A 4YNQA 1RDBA 1Z26A 1QSYA 2XY8A 3ITHA 3K58A 4CFAA 1GOAA 3AVAA 3L3UA 4CHNA 1CXQA 4KTQA 2DFEA 5JS2A 2JLEA 4CJEA 4KPYA 2Z1IA 4BDYA 3NFAA 3WNEA 2ETJA 5SWMA 4E7LA 3M8RA 4DSEA 1X9MA 1X9SA 3SI6A 3LAMA 3RRHA 1WSJA 3EYZA 5C25A 1NKBA 4DS5A 2IC3A 5JS1A 4CF0A 1HYSA 1QHTA 1HNIA 1G15A 1RTIA 5CY4A 3ZCMA 4CE9A 3EY1A 4FCYA 3UIQA 3T1AA 4M42A 1CLQA 2O4GA 4KB1A 1J5OA 2DFFA 1BIUA 1BI4A 5CZ2A 4DFKA 3OYDA 1REVA 1LWEA 2EX3A 3AV9A 3VN5A 1RBVA 3QNOA 3HK2A 3AVBA 3VQDA 3CFPA 3LANA 1MU2A 2YKMA 3SPZA 3A2FA 1EP4A 2VWKA 4FYDA 2HW3A 2FBTA 4DQSA 2G8IA 3PO4A 4M3XA 4CF2A 4QAGA 3QINA 3OS2A 4FLXA 3B6OA 3K5OA 4Z4FA 2KZMA 1IKYA 4QCLA 2X78A 1KTQA 2IAJA 2F96A 3HPHA 4CGJA 4CCHA 3D0PA 1EETA 1S5JA 4C8MA 3PV8A 2YNGA 4CJ3A 3NHGA 1S6PA 3OYAA 2HVIA 3TI0A 1RBRA 1XHXA 4CGDA 3OYFA 3SV3A 3LP1A 1KSPA 1W0HA 2ITGA 3M8SA 4E1NA 1Q9YA 2B4JA 2OA8A 2WOMA 4IFYA 3VQBA 2OYQA 4CK1A 3TAEA 3JSMA 3LAKA 2D0BA 3KKSA 1TAUA 4CJPA 4FJJA 4PWDA 1X1PA 1TKXA 4F2SA 3OJSA 1S1WA 3HPOA 2G8UA 3LALA 4ID1A 1JL2A 1UAXA 2G8HA 1IKVA 2KQ2A 4CFDA 4EZ6A 3DRPA 4F2RA 4KHSA 1SL1A 3NDKA 1L3VA 5E41A 4Y1DA 4FLYA 4KI4A 1VSHA 4CJ4A 3KLIA 3PX0A 1TGOA 4NYFA 3AVHA 4CIEA 3OYJA 1QTMA 3HPGA 3PX6A 4OGEA 3S3NA 4HCCA 5FRMA 4KTZA 1TAQA 5C24A 4LD0A 2HHSA 1JLQA 3RRGA 1KRPA 4KHQA 1C6VA 3SQ1A 3ASMA 4FJNA 4M3UA 1B9FA 1KVBA 3K5LA 2G8KA 2RKIA 4B8AB 3TAQA 1BI4B 3IS9A 2Z1HA 3V81A 4FJ5A 3VA3A 3P5JA 1T05A 1XHZA 3VQ6A 4Z4CA 4RW7A 4OGCA 4O0IA 3TAPA 1UA1A 2LSNA 2E4LA 4J2EA 5KTQA 4CK3A 3OY9A 3KD5E 4I2PA 1JKHA 1SL0A 4LSLA 3K5MA 4KREA 1EX4A 4CGGA 3NF8A 4OPJA 1JLGA 3S3OA 2B6AA 1UA0A 4AILC 4NCGA 3VQ9A 1IO2A 4CEEA 4CEZA 5KGXA 3CYMA 4CGIA 1ITGA 4JS5A 1BQNA 4E19A 4I7FA 1C0UA 3DLHA 1SV5A 1UOCA 3VA0A 3DLBA 2KTQA 1ZBLA 4J2DA 3C95A 1HYZA 4NYNA 3HM9A 3OS0A 1HPZA 4IBNA 4DSKA 4PA1A 4J2BA 4CJLA 5J2NA 3ZT1A 4DU3A 1VSLA 4CJTA 3PX4A 3AA2A 3SUOA 1RT2A 4OJRA 4RW9A 1SKSA 3KLEA 1SUQA 4DSFA 4HUGA 4BE0A 1LAWA 2IS3A 3L2QA 1U4BA 1D5AA 1HNVA 2Q3SA 4E7KA 1L3TA 2IDOA 2Z1JA 3CM6A 1S1UA 3WNGA 1A5VA 1TKZA 3AVMA 3KJVA 4FJKA 1ASUA 3DMJA 1RBSA 2ZQBA 3K59A 1NJXA 1ZBFA 3QESA 4ELVA 4DU1A 3VQ8A 4TSXA 3KTQA 1S9GA 1F21A 4RW6A 1NK8A 3BDPA 4FJLA 1IG9A 1S1VA 3RWUA 1KLMA 3U3YA 2G8VA 4DQIA 3OS1A 4DTXA 1HJRA 4KHYA 1LW0A 3L2RA 3TABA 4DTRA 3QERA 1RT4A 1NK5A 3HVTA 2YKNA 1T03A 4CF9A 1FKOA 2OPSA 4ZHRA 4WE1A 2HHQA 4CJRA 4DTUA 3SJJA 1J53A 1Q9XA 5HP1A 1TL3A 2P5GA 1VSKA 2YNFA 3DM2A 2HVHA 1JXBA 1JXEA 3WNHA 3LPUA 4HUEA 3ZT0A 4HHTA 1JLCA 3V6DA 4DQQA 4QOZB 4HUFA 3AO2A 2Y1IA 1LW2A 2KFNA 1YT3A 2HNZA 4FW2A 3TWHA 4RW8A 3T3FA 4F4KA 3CFOA 4I2QA 1U49A 2HHUA 2YNHA 4ICLA 4H8KA 1TV6A 4AHRA 4HVJA 4Z4EA 3NF7A 3V9WA 4NCAA 4JS4A 4FK4A 1C0TA 3HP9A 4JRQA 2NUBA 4CJUA 3ZSWA 1WSGA 3NH1A 1JLAA 4KKOA 4E1MA 3I0RA 4DG1A 3QEVA 4RW4A 1RT3A 5I42A 1N5YA 1LAVA 3H08A 2G8WA 4OLBA 3MECA 3K57A 1NK9A 1SL2A 2Z1GA 2P1JA 4LH5A 3NCIA 4FLZA 2RN2A 5CYMA 3V9ZA 3B6PA 1NJYA 1RCHA 3OYMA 2FC0A 3LP2A 3K5NA 2OPQA 5HRNA 3DRRA 4ELUA 3VQCA 3AA5X 3QO9A 5T7BA 4FLWA 1ASVA 4Z0UA 4BWJA 1DLOA 1KFDA 5HRPA 1L5UA 3ZT4A 1NK7A 1ZYQA 4AHCA 4CHQA 4Z4HA 4DLEA 2PYJA 4E0DA 4KHUA 3SZ2A 5HROA 1Z25A 4DFMA 4CF8A 2I5JA 1RT1A 3L8BA 2BE2A 1HMVA 4R5PA 3HSTB 3DLGA 5FRNA 2KFZA 1VSIA 3MEDA 4FVMA 3VQ7A 1U47A 4CFCA 4HCBA 1S6QA 1LWCA 4DQPA 4FLTA 3F73A 3SNNA 4C8LA 2HHVA 5I3UA 1KFSA 3RR7A 4FK0A 2E6MA 1HQEA 4FXDA 1U04A 4BE2A 4E7IA 1QQCA 4FM1A 3OYGA 1KVCA 2XO7A 4Y1CA 3QNNA 2BDPA 3NGYA 4GW6A 4FJXA 1C1CA 1QE1A 4CHOA 4K8ZA 4O4GA 2ZD1A 3C6UA 5KRTA 4B9UA 3NH0A 4J2AA 4FJ9A 2BANA 1B92A 3ZSXA 1EKEA 4FLVA 1GOBA 3KLGA 1KLNA 3TAMA 3ZSQA 2G8FA 5CYQA 3V4IA 4FK2A 2KZZA 3C6TA 1JLFA 1A5WA 4AHVA 4KTWA 1DTTA 1BGXT 4YFUA 2ATQA 1WAFA 2DFHA 2RF2A 4CJFA 3RMAA 3IG1A 4BDPA 1BHLA 4NCBA 3QEPA 1C0MA 4M3ZA 3G10A 3HJFA 1D9FA 4KHWA 3HL8A 4LH4A 4AHTA 4BWMA 3O3FA 3VQQA 5J2MA 1IKWA 2VWJA 4E7JA 1SKWA 2FBVA 1SKRA 3P1GA 1RBTA 4JRPA 1D9DA 3KIOA 4DTNA 3S9HA 2QKKA 4FJMA 2FBYA 1YTAA 4AH9A 4AHSA 1S9EA 4DSIA 3O3GA 4N76A 3MXJA 3AVCA 3ULDA 5KRSA 3SCXA 3LWLA 2F8SA 2YNIA 2R7YA 3PUFA 3M8QA 4H4OA 4W5RA 3DRSA 4C8KA 5D3GA 4CGFA 3HP6A 3HO1A 3KK2A 3NF9A 1BCMA 4JLHA 4CJVA 3G0ZA 3VQPA 4DFPA 3DLRA 2HHWA 1VSDA 1EXQA 1IH7A 5HRRA 5J2PA 3MXIA 3PO5A 3AVGA 4I9QA 4M41A 4CJ5A 2X74A 1U48A 4B9LA 2YHBA 4CK2A 2HB5A 2A1SA 3V9XA 1O1WA 2EHGA 1FKPA 1WAJA 1UWBA 1RDDA 1VSJA 4G1QA 3CFRA 2XY6A 3FFIA 1C1BA 3L2VA 5HLFA 2IGIA 4BACA 4DMNA 3TAFA 1IKXA 3AO1A 1NKEA 3LDSA 5EU7A 4N47A 3V9SA 4H4MA 4FZYA 4CEBA 2OPPA 3OYIA 1X9WA 1RTJA 4CF1A 3NAEA 1ZBIA 1XI1A 2YV0X 2WONA 4EP5A 4B9VA 4FZZA 2AJQA 4O44A 1RDAA 3ALYA 1VSFA 2OZSA 3KLHA 1K6YA 1QSSA 4BE1A 5HBMA 2X6NA 3EZ5A 3ZSYA 3OJUA 4OKKA 1YVUA 3KD1E 1RBUA 3T19A 2HHXA 2PY5A 3NE6A 1CZBA 1D8YA 2O4IA 4CJKA 4B08A 4MQ3A 3L3VA 3DOLA 1YTUA 4O5BA 1RTDA 3NGIA 2DTUA 3SPYA 4DTMA 3ZT3A 4CEOA 1FK9A 1KCFA 4CHYA 3I8DA 3CQ8A 3TANA 4M45A 3IAYA 1TK0A 3SQ4A 1T8EA 4CHPA 1N6QA 2YHAA 1Y97A 2XRIA 4W5QA 3OYLA 4XIUA 4DLGA 1RT6A 4W5TA 4F8RA 4KRFA 4KFBA 4B9TA 5J2QA 4FJIA 3DYAA 4W5OA 4UQGA 1I39A 3LZJA 2W42A 1R0AA 4CEQA 1VSEA 3LP0A 3P83D 1KVAA 2FBXA 5KGWA 3LZIA 3RTVA 3QEIA 5K14A 4K8XA 5C42A 3AVIA 1VSMA 3V1QA 1J9AA 4FLUA 3LP3A 3IRXA 4KO0A 4DTJA 1T7PA 3QLHA 4LSNA 3HXMA 4PY5A 2JGUA 3MEEA 4IFVA 3TR8A 2HNDA 4DFJA 4CJWA 3WNFA 1BQMA 2OZMA 3AVNA 3ZSZA 4MFBA 1NK4A 1L3UA 1XWLA 4ELTA 1ZBHA 1WSFA 1CXUA 1S1TA 3S3MA 4IKFA 3TARA 2XHBA 4E89A 3HT3A 3BGRA 1RT5A 3NBPA 4IDKA 4OVLA 4OLAA 2DY4A 3O4QA 4ZTFA 4KHNA 1BIZA 3QIPA 1BL3A 4C8NA 4B8CA 4CGHA 4AHUA 1JL1A 1RILA 3OYNA 2RPIA 3AVLA 4FJHA 2QXFA 3SUNA 4IG0A 3K2PA 1ASWA 4CEAA 4CEDA 1TK5A 4N56A 1C1AA 2QK9A 3V1RA 4CECA 4DTOA 4F3OA 4OPKA 3DOKA 2QKBA 1VRTA 2D0CA 4GMJB 4FJ8A 4ZTJA 1TVRA 4DF4A 3O4NA 1NOZA 1WNSA 1WN7A 5FROA 1NOYA 2PZSA 3TAGA 4FW1A 4CESA 2E6LA 3AO3A 5DK5A 4N5SA 3RMCA 3M8PA 4M3WA 1DTQA 1RNHA 2BGGA 4Q0BA 1CZ9A 3AO5A 5DMRA 1L3SA 1B9DA 5SZTA 4DU4A 1QS4A 2HMIA 1ZBUA 4B3OA 4CIGA 2VG6A 4LY7A 4CIFA 3KK1A 1LV5A 3VQ5A 2Y1JA 4EP4A 4KB0A 1NJZA 1FXXA 1W9HA 3DLKA 3OYBA 3F9KA 3QETA 1Q8IA 3THVA 3SUQA 4RG8A 4CHZA 4KV8A 3MAQA 4FM0A 4M3TA 4FZXC 1A5XA 4E3SA 1NK6A 3E01A 3DLEA 1RTHA 3VQAA 3KK3A 3NF6A 3MXMA 4I9LA 1S1XA 3V9UA 4FJGA 3RMDA 4F3TA 3C94A 4KI6A 3HVRA 4ID5A 4B9NA 1U45A 3QIOA 3AVFA 1VRUA 3AO4A 3ZSVA 1BCOA 3ISNC 3OYEA 3AVKA 3LPTA 3CM5A 4EZ9A 3DI6A 4Q5VA 3AA3A 3NGZA 3KLFA 3VQEA 1NJWA 4BDZA 1HYVA 3SQ0A 2XY7A 2ZE2A 1TL1A 3KKRA 3SV4A 2GUIA 4M3RA 3L2UA 1JLBA 2P5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DTP A;  3JYT A;  4DSJ A;  2D0A A;  1LWF A;  2HNY A;  4O55 A;  2IOC A;  5KI6 A;  3V1O A;  4O0J A;  5J1E A;  3PY8 A;  3HYF A;  1WLJ A;  4L8R B;  1HQU A;  4GVM A;  1BIS A;  3ZT2 A;  4HTU A;  3U6F A;  4PQU A;  3ZSO A;  2GBZ A;  4Z4I A;  1WSE A;  3O3H A;  4C8O A;  3AA4 A;  2XY5 A;  3D45 A;  3I0S A;  3ZSR A;  4IG3 A;  3NH2 A;  4CJS A;  4CEF A;  2PYL A;  5CZ1 A;  4E7H A;  4DSL A;  1RT7 A;  2OPR A;  2X6S A;  3SQ2 A;  5HRS A;  1I3A A;  2D5R A;  1J54 A;  4PUO A;  3SUP A;  4CJQ A;  2F8T A;  1NKC A;  1QSL A;  3SYZ A;  3QEW A;  5FDL A;  4DTS A;  2VG7 A;  3OYK A;  4B9S A;  3MEG A;  4DWI A;  4M3Y A;  1RDC A;  1WSI A;  1HRH A;  2P51 A;  1TK8 A;  2HHT A;  3OYH A;  4OKJ A;  4CER A;  2B5J A;  3OYC A;  1TKD A;  3OVN A;  3VQ4 A;  4DS4 A;  4OKE A;  1XC9 A;  2KW4 A;  4CFB A;  1TKT A;  3L2W A;  2A1R A;  3RMB A;  4N41 A;  4FM2 A;  1WSH A;  3CG7 A;  4KAZ A;  3AVJ A;  4W5N A;  1JLE A;  4Z4G A;  4DQR A;  1GOC A;  4B9M A;  1NK0 A;  2GV9 A;  1VK0 A;  3LWM A;  2VG5 A;  4DF8 A;  3U3G A;  3QEX A;  3RR8 A;  4FJ7 A;  4YNQ A;  1RDB A;  1Z26 A;  1QSY A;  2XY8 A;  3ITH A;  3K58 A;  4CFA A;  1GOA A;  3AVA A;  3L3U A;  4CHN A;  1CXQ A;  4KTQ A;  2DFE A;  5JS2 A;  2JLE A;  4CJE A;  4KPY A;  2Z1I A;  4BDY A;  3NFA A;  3WNE A;  2ETJ A;  5SWM A;  4E7L A;  3M8R A;  4DSE A;  1X9M A;  1X9S A;  3SI6 A;  3LAM A;  3RRH A;  1WSJ A;  3EYZ A;  5C25 A;  1NKB A;  4DS5 A;  2IC3 A;  5JS1 A;  4CF0 A;  1HYS A;  1QHT A;  1HNI A;  1G15 A;  1RTI A;  5CY4 A;  3ZCM A;  4CE9 A;  3EY1 A;  4FCY A;  3UIQ A;  3T1A A;  4M42 A;  1CLQ A;  2O4G A;  4KB1 A;  1J5O A;  2DFF A;  1BIU A;  1BI4 A;  5CZ2 A;  4DFK A;  3OYD A;  1REV A;  1LWE A;  2EX3 A;  3AV9 A;  3VN5 A;  1RBV A;  3QNO A;  3HK2 A;  3AVB A;  3VQD A;  3CFP A;  3LAN A;  1MU2 A;  2YKM A;  3SPZ A;  3A2F A;  1EP4 A;  2VWK A;  4FYD A;  2HW3 A;  2FBT A;  4DQS A;  2G8I A;  3PO4 A;  4M3X A;  4CF2 A;  4QAG A;  3QIN A;  3OS2 A;  4FLX A;  3B6O A;  3K5O A;  4Z4F A;  2KZM A;  1IKY A;  4QCL A;  2X78 A;  1KTQ A;  2IAJ A;  2F96 A;  3HPH A;  4CGJ A;  4CCH A;  3D0P A;  1EET A;  1S5J A;  4C8M A;  3PV8 A;  2YNG A;  4CJ3 A;  3NHG A;  1S6P A;  3OYA A;  2HVI A;  3TI0 A;  1RBR A;  1XHX A;  4CGD A;  3OYF A;  3SV3 A;  3LP1 A;  1KSP A;  1W0H A;  2ITG A;  3M8S A;  4E1N A;  1Q9Y A;  2B4J A;  2OA8 A;  2WOM A;  4IFY A;  3VQB A;  2OYQ A;  4CK1 A;  3TAE A;  3JSM A;  3LAK A;  2D0B A;  3KKS A;  1TAU A;  4CJP A;  4FJJ A;  4PWD A;  1X1P A;  1TKX A;  4F2S A;  3OJS A;  1S1W A;  3HPO A;  2G8U A;  3LAL A;  4ID1 A;  1JL2 A;  1UAX A;  2G8H A;  1IKV A;  2KQ2 A;  4CFD A;  4EZ6 A;  3DRP A;  4F2R A;  4KHS A;  1SL1 A;  3NDK A;  1L3V A;  5E41 A;  4Y1D A;  4FLY A;  4KI4 A;  1VSH A;  4CJ4 A;  3KLI A;  3PX0 A;  1TGO A;  4NYF A;  3AVH A;  4CIE A;  3OYJ A;  1QTM A;  3HPG A;  3PX6 A;  4OGE A;  3S3N A;  4HCC A;  5FRM A;  4KTZ A;  1TAQ A;  5C24 A;  4LD0 A;  2HHS A;  1JLQ A;  3RRG A;  1KRP A;  4KHQ A;  1C6V A;  3SQ1 A;  3ASM A;  4FJN A;  4M3U A;  1B9F A;  1KVB A;  3K5L A;  2G8K A;  2RKI A;  4B8A B;  3TAQ A;  1BI4 B;  3IS9 A;  2Z1H A;  3V81 A;  4FJ5 A;  3VA3 A;  3P5J A;  1T05 A;  1XHZ A;  3VQ6 A;  4Z4C A;  4RW7 A;  4OGC A;  4O0I A;  3TAP A;  1UA1 A;  2LSN A;  2E4L A;  4J2E A;  5KTQ A;  4CK3 A;  3OY9 A;  3KD5 E;  4I2P A;  1JKH A;  1SL0 A;  4LSL A;  3K5M A;  4KRE A;  1EX4 A;  4CGG A;  3NF8 A;  4OPJ A;  1JLG A;  3S3O A;  2B6A A;  1UA0 A;  4AIL C;  4NCG A;  3VQ9 A;  1IO2 A;  4CEE A;  4CEZ A;  5KGX A;  3CYM A;  4CGI A;  1ITG A;  4JS5 A;  1BQN A;  4E19 A;  4I7F A;  1C0U A;  3DLH A;  1SV5 A;  1UOC A;  3VA0 A;  3DLB A;  2KTQ A;  1ZBL A;  4J2D A;  3C95 A;  1HYZ A;  4NYN A;  3HM9 A;  3OS0 A;  1HPZ A;  4IBN A;  4DSK A;  4PA1 A;  4J2B A;  4CJL A;  5J2N A;  3ZT1 A;  4DU3 A;  1VSL A;  4CJT A;  3PX4 A;  3AA2 A;  3SUO A;  1RT2 A;  4OJR A;  4RW9 A;  1SKS A;  3KLE A;  1SUQ A;  4DSF A;  4HUG A;  4BE0 A;  1LAW A;  2IS3 A;  3L2Q A;  1U4B A;  1D5A A;  1HNV A;  2Q3S A;  4E7K A;  1L3T A;  2IDO A;  2Z1J A;  3CM6 A;  1S1U A;  3WNG A;  1A5V A;  1TKZ A;  3AVM A;  3KJV A;  4FJK A;  1ASU A;  3DMJ A;  1RBS A;  2ZQB A;  3K59 A;  1NJX A;  1ZBF A;  3QES A;  4ELV A;  4DU1 A;  3VQ8 A;  4TSX A;  3KTQ A;  1S9G A;  1F21 A;  4RW6 A;  1NK8 A;  3BDP A;  4FJL A;  1IG9 A;  1S1V A;  3RWU A;  1KLM A;  3U3Y A;  2G8V A;  4DQI A;  3OS1 A;  4DTX A;  1HJR A;  4KHY A;  1LW0 A;  3L2R A;  3TAB A;  4DTR A;  3QER A;  1RT4 A;  1NK5 A;  3HVT A;  2YKN A;  1T03 A;  4CF9 A;  1FKO A;  2OPS A;  4ZHR A;  4WE1 A;  2HHQ A;  4CJR A;  4DTU A;  3SJJ A;  1J53 A;  1Q9X A;  5HP1 A;  1TL3 A;  2P5G A;  1VSK A;  2YNF A;  3DM2 A;  2HVH A;  1JXB A;  1JXE A;  3WNH A;  3LPU A;  4HUE A;  3ZT0 A;  4HHT A;  1JLC A;  3V6D A;  4DQQ A;  4QOZ B;  4HUF A;  3AO2 A;  2Y1I A;  1LW2 A;  2KFN A;  1YT3 A;  2HNZ A;  4FW2 A;  3TWH A;  4RW8 A;  3T3F A;  4F4K A;  3CFO A;  4I2Q A;  1U49 A;  2HHU A;  2YNH A;  4ICL A;  4H8K A;  1TV6 A;  4AHR A;  4HVJ A;  4Z4E A;  3NF7 A;  3V9W A;  4NCA A;  4JS4 A;  4FK4 A;  1C0T A;  3HP9 A;  4JRQ A;  2NUB A;  4CJU A;  3ZSW A;  1WSG A;  3NH1 A;  1JLA A;  4KKO A;  4E1M A;  3I0R A;  4DG1 A;  3QEV A;  4RW4 A;  1RT3 A;  5I42 A;  1N5Y A;  1LAV A;  3H08 A;  2G8W A;  4OLB A;  3MEC A;  3K57 A;  1NK9 A;  1SL2 A;  2Z1G A;  2P1J A;  4LH5 A;  3NCI A;  4FLZ A;  2RN2 A;  5CYM A;  3V9Z A;  3B6P A;  1NJY A;  1RCH A;  3OYM A;  2FC0 A;  3LP2 A;  3K5N A;  2OPQ A;  5HRN A;  3DRR A;  4ELU A;  3VQC A;  3AA5 X;  3QO9 A;  5T7B A;  4FLW A;  1ASV A;  4Z0U A;  4BWJ A;  1DLO A;  1KFD A;  5HRP A;  1L5U A;  3ZT4 A;  1NK7 A;  1ZYQ A;  4AHC A;  4CHQ A;  4Z4H A;  4DLE A;  2PYJ A;  4E0D A;  4KHU A;  3SZ2 A;  5HRO A;  1Z25 A;  4DFM A;  4CF8 A;  2I5J A;  1RT1 A;  3L8B A;  2BE2 A;  1HMV A;  4R5P A;  3HST B;  3DLG A;  5FRN A;  2KFZ A;  1VSI A;  3MED A;  4FVM A;  3VQ7 A;  1U47 A;  4CFC A;  4HCB A;  1S6Q A;  1LWC A;  4DQP A;  4FLT A;  3F73 A;  3SNN A;  4C8L A;  2HHV A;  5I3U A;  1KFS A;  3RR7 A;  4FK0 A;  2E6M A;  1HQE A;  4FXD A;  1U04 A;  4BE2 A;  4E7I A;  1QQC A;  4FM1 A;  3OYG A;  1KVC A;  2XO7 A;  4Y1C A;  3QNN A;  2BDP A;  3NGY A;  4GW6 A;  4FJX A;  1C1C A;  1QE1 A;  4CHO A;  4K8Z A;  4O4G A;  2ZD1 A;  3C6U A;  5KRT A;  4B9U A;  3NH0 A;  4J2A A;  4FJ9 A;  2BAN A;  1B92 A;  3ZSX A;  1EKE A;  4FLV A;  1GOB A;  3KLG A;  1KLN A;  3TAM A;  3ZSQ A;  2G8F A;  5CYQ A;  3V4I A;  4FK2 A;  2KZZ A;  3C6T A;  1JLF A;  1A5W A;  4AHV A;  4KTW A;  1DTT A;  1BGX T;  4YFU A;  2ATQ A;  1WAF A;  2DFH A;  2RF2 A;  4CJF A;  3RMA A;  3IG1 A;  4BDP A;  1BHL A;  4NCB A;  3QEP A;  1C0M A;  4M3Z A;  3G10 A;  3HJF A;  1D9F A;  4KHW A;  3HL8 A;  4LH4 A;  4AHT A;  4BWM A;  3O3F A;  3VQQ A;  5J2M A;  1IKW A;  2VWJ A;  4E7J A;  1SKW A;  2FBV A;  1SKR A;  3P1G A;  1RBT A;  4JRP A;  1D9D A;  3KIO A;  4DTN A;  3S9H A;  2QKK A;  4FJM A;  2FBY A;  1YTA A;  4AH9 A;  4AHS A;  1S9E A;  4DSI A;  3O3G A;  4N76 A;  3MXJ A;  3AVC A;  3ULD A;  5KRS A;  3SCX A;  3LWL A;  2F8S A;  2YNI A;  2R7Y A;  3PUF A;  3M8Q A;  4H4O A;  4W5R A;  3DRS A;  4C8K A;  5D3G A;  4CGF A;  3HP6 A;  3HO1 A;  3KK2 A;  3NF9 A;  1BCM A;  4JLH A;  4CJV A;  3G0Z A;  3VQP A;  4DFP A;  3DLR A;  2HHW A;  1VSD A;  1EXQ A;  1IH7 A;  5HRR A;  5J2P A;  3MXI A;  3PO5 A;  3AVG A;  4I9Q A;  4M41 A;  4CJ5 A;  2X74 A;  1U48 A;  4B9L A;  2YHB A;  4CK2 A;  2HB5 A;  2A1S A;  3V9X A;  1O1W A;  2EHG A;  1FKP A;  1WAJ A;  1UWB A;  1RDD A;  1VSJ A;  4G1Q A;  3CFR A;  2XY6 A;  3FFI A;  1C1B A;  3L2V A;  5HLF A;  2IGI A;  4BAC A;  4DMN A;  3TAF A;  1IKX A;  3AO1 A;  1NKE A;  3LDS A;  5EU7 A;  4N47 A;  3V9S A;  4H4M A;  4FZY A;  4CEB A;  2OPP A;  3OYI A;  1X9W A;  1RTJ A;  4CF1 A;  3NAE A;  1ZBI A;  1XI1 A;  2YV0 X;  2WON A;  4EP5 A;  4B9V A;  4FZZ A;  2AJQ A;  4O44 A;  1RDA A;  3ALY A;  1VSF A;  2OZS A;  3KLH A;  1K6Y A;  1QSS A;  4BE1 A;  5HBM A;  2X6N A;  3EZ5 A;  3ZSY A;  3OJU A;  4OKK A;  1YVU A;  3KD1 E;  1RBU A;  3T19 A;  2HHX A;  2PY5 A;  3NE6 A;  1CZB A;  1D8Y A;  2O4I A;  4CJK A;  4B08 A;  4MQ3 A;  3L3V A;  3DOL A;  1YTU A;  4O5B A;  1RTD A;  3NGI A;  2DTU A;  3SPY A;  4DTM A;  3ZT3 A;  4CEO A;  1FK9 A;  1KCF A;  4CHY A;  3I8D A;  3CQ8 A;  3TAN A;  4M45 A;  3IAY A;  1TK0 A;  3SQ4 A;  1T8E A;  4CHP A;  1N6Q A;  2YHA A;  1Y97 A;  2XRI A;  4W5Q A;  3OYL A;  4XIU A;  4DLG A;  1RT6 A;  4W5T A;  4F8R A;  4KRF A;  4KFB A;  4B9T A;  5J2Q A;  4FJI A;  3DYA A;  4W5O A;  4UQG A;  1I39 A;  3LZJ A;  2W42 A;  1R0A A;  4CEQ A;  1VSE A;  3LP0 A;  3P83 D;  1KVA A;  2FBX A;  5KGW A;  3LZI A;  3RTV A;  3QEI A;  5K14 A;  4K8X A;  5C42 A;  3AVI A;  1VSM A;  3V1Q A;  1J9A A;  4FLU A;  3LP3 A;  3IRX A;  4KO0 A;  4DTJ A;  1T7P A;  3QLH A;  4LSN A;  3HXM A;  4PY5 A;  2JGU A;  3MEE A;  4IFV A;  3TR8 A;  2HND A;  4DFJ A;  4CJW A;  3WNF A;  1BQM A;  2OZM A;  3AVN A;  3ZSZ A;  4MFB A;  1NK4 A;  1L3U A;  1XWL A;  4ELT A;  1ZBH A;  1WSF A;  1CXU A;  1S1T A;  3S3M A;  4IKF A;  3TAR A;  2XHB A;  4E89 A;  3HT3 A;  3BGR A;  1RT5 A;  3NBP A;  4IDK A;  4OVL A;  4OLA A;  2DY4 A;  3O4Q A;  4ZTF A;  4KHN A;  1BIZ A;  3QIP A;  1BL3 A;  4C8N A;  4B8C A;  4CGH A;  4AHU A;  1JL1 A;  1RIL A;  3OYN A;  2RPI A;  3AVL A;  4FJH A;  2QXF A;  3SUN A;  4IG0 A;  3K2P A;  1ASW A;  4CEA A;  4CED A;  1TK5 A;  4N56 A;  1C1A A;  2QK9 A;  3V1R A;  4CEC A;  4DTO A;  4F3O A;  4OPK A;  3DOK A;  2QKB A;  1VRT A;  2D0C A;  4GMJ B;  4FJ8 A;  4ZTJ A;  1TVR A;  4DF4 A;  3O4N A;  1NOZ A;  1WNS A;  1WN7 A;  5FRO A;  1NOY A;  2PZS A;  3TAG A;  4FW1 A;  4CES A;  2E6L A;  3AO3 A;  5DK5 A;  4N5S A;  3RMC A;  3M8P A;  4M3W A;  1DTQ A;  1RNH A;  2BGG A;  4Q0B A;  1CZ9 A;  3AO5 A;  5DMR A;  1L3S A;  1B9D A;  5SZT A;  4DU4 A;  1QS4 A;  2HMI A;  1ZBU A;  4B3O A;  4CIG A;  2VG6 A;  4LY7 A;  4CIF A;  3KK1 A;  1LV5 A;  3VQ5 A;  2Y1J A;  4EP4 A;  4KB0 A;  1NJZ A;  1FXX A;  1W9H A;  3DLK A;  3OYB A;  3F9K A;  3QET A;  1Q8I A;  3THV A;  3SUQ A;  4RG8 A;  4CHZ A;  4KV8 A;  3MAQ A;  4FM0 A;  4M3T A;  4FZX C;  1A5X A;  4E3S A;  1NK6 A;  3E01 A;  3DLE A;  1RTH A;  3VQA A;  3KK3 A;  3NF6 A;  3MXM A;  4I9L A;  1S1X A;  3V9U A;  4FJG A;  3RMD A;  4F3T A;  3C94 A;  4KI6 A;  3HVR A;  4ID5 A;  4B9N A;  1U45 A;  3QIO A;  3AVF A;  1VRU A;  3AO4 A;  3ZSV A;  1BCO A;  3ISN C;  3OYE A;  3AVK A;  3LPT A;  3CM5 A;  4EZ9 A;  3DI6 A;  4Q5V A;  3AA3 A;  3NGZ A;  3KLF A;  3VQE A;  1NJW A;  4BDZ A;  1HYV A;  3SQ0 A;  2XY7 A;  2ZE2 A;  1TL1 A;  3KKR A;  3SV4 A;  2GUI A;  4M3R A;  3L2U A;  1JLB A;  2P5O A; 
#chains in the Genus database with same CATH topology
 4DTP A;  3R6M A;  2IOC A;  4O0J A;  2E8A A;  4WQ4 A;  1HQU A;  4GVM A;  3ENO A;  3U6F A;  4PQU A;  1BWF O;  4Z4I A;  3O3H A;  3A5M C;  4WQ5 A;  3D45 A;  4FOE A;  3ZSR A;  3NH2 A;  4C23 A;  4IOC L;  4JI7 K;  4PKH A;  4E7H A;  2FSJ A;  4A61 A;  2OPR A;  4F9O A;  3SQ2 A;  5HRS A;  4DR2 K;  3CCE N;  2F8T A;  2YJF A;  4DTS A;  2NRV A;  4B9S A;  1WSI A;  4B3M K;  1R59 O;  5C10 A;  3H3N O;  1MA9 B;  2ZM6 K;  2QXL A;  2A1R A;  3I55 N;  5AQI A;  4W5N A;  1VK0 A;  3LWM A;  4DF8 A;  1HLU A;  3VEY A;  3CF5 L;  1RDU A;  3CCS N;  3CME N;  4H5W A;  3AVA A;  4OX9 K;  4YOV A;  2HMP A;  3HZ6 A;  4BRA A;  4CJE A;  4DSE A;  5AQG A;  1WSJ A;  2IC3 A;  5TKY A;  3SMP A;  4CF0 A;  1HYS A;  1RTI A;  5C2D A;  1NGB A;  2W41 A;  2O4G A;  4CD1 A;  1BI4 A;  2VCP A;  3J7Y P;  2WTU A;  3VN5 A;  4H0Y B;  1MU2 A;  2YKM A;  3SPZ A;  3A2F A;  2QM1 A;  4JI6 K;  1TUU A;  2VQE K;  3OS2 A;  1VQ4 N;  3K5O A;  4QCL A;  3HPH A;  4DV2 K;  1YJN N;  3PV8 A;  2NRH A;  3THY B;  3OYA A;  3CQX A;  1XHX A;  3SV3 A;  4FWP A;  3LP1 A;  5AQV A;  4DV3 K;  1Q9Y A;  2OYQ A;  2P9U B;  1OH8 A;  5IT9 O;  3KKS A;  3WQT A;  4FJJ A;  2GX9 A;  5C12 A;  1TKX A;  3TSQ A;  4ID1 A;  4BR4 A;  4XH4 A;  2G8H A;  5AR0 A;  3WEE A;  1DT9 A;  1T6D A;  5M1F A;  1M90 O;  2E2Q A;  3DRP A;  4KHS A;  1SL1 A;  4Y1D A;  1NWK A;  1VSH A;  4H03 B;  4NYF A;  3AVH A;  4CIE A;  3HPG A;  2VWB A;  5GAD P;  3PX6 A;  3S3N A;  4HCC A;  4KTZ A;  2GWJ A;  4LD0 A;  3RRG A;  1GLB G;  5F2R A;  4KHQ A;  4M3U A;  1KVB A;  1EWQ A;  2G8K A;  4YOY A;  4BRI A;  2YCH A;  4XH5 A;  2GWK A;  3TAQ A;  3V81 A;  4EFH A;  1WBD A;  4MDA A;  5LMU K;  1GLF O;  4O0I A;  5CHI A;  3TAP A;  2LSN A;  3U8X A;  2E4L A;  4J2E A;  3NMU A;  3UKR A;  3KD5 E;  5EX5 A;  1JKH A;  2I7N A;  4CGG A;  2B6A A;  3O6W A;  5KGX A;  3VQ9 A;  4CEE A;  4CEZ A;  3C7N A;  4CGI A;  3E9O A;  3ATV A;  3ZX2 A;  1BQN A;  4E19 A;  3DLH A;  1SV5 A;  3VA0 A;  3DLB A;  4J2D A;  1TYQ B;  1HYZ A;  4NYN A;  3OS0 A;  5J2N A;  4DU3 A;  1NGE A;  3L4I A;  3D7E O;  3SUO A;  4QS9 A;  3CJ9 A;  1SUQ A;  4DSF A;  4BE0 A;  3LM2 A;  3L2Q A;  4E7K A;  4IJA A;  2O8F B;  3O80 A;  1A5V A;  3ZX3 A;  4CZG A;  3DMJ A;  1RBS A;  3EL2 A;  1RDW X;  1NJX A;  2QWO A;  4ELV A;  2NRT A;  5C0Y A;  1S9G A;  3AAP A;  4RW6 A;  4EIA A;  1BA0 A;  1NBW A;  4DTX A;  1HJR A;  3TAB A;  3FZF A;  4JK8 A;  3R8E A;  4CF9 A;  1FKO A;  4CZE A;  4XEI A;  4ZHR A;  4CJR A;  1N8R O;  3SJJ A;  3O5B A;  2YNF A;  3DM2 A;  3WXK A;  3QBW A;  3LPU A;  4HUE A;  3ZT0 A;  5EXW A;  4DQQ A;  4HUF A;  2A41 A;  2KFN A;  3TWH A;  2HHU A;  1HKB A;  4I2Q A;  4KBO A;  4ICL A;  1TV6 A;  4HVJ A;  4CZL A;  1E4F T;  4NCA A;  4FK4 A;  1XQS C;  1C0T A;  3HP9 A;  4JRQ A;  3H46 O;  4CJU A;  2YI1 A;  3BP8 A;  3I0R A;  4DG1 A;  4YOW A;  5ADX A;  2IVN A;  3MEC A;  3WXI A;  5AQT A;  4GKJ K;  1SL2 A;  3NCI A;  3B6P A;  4MO4 A;  1RCH A;  1C0F A;  2FC0 A;  3A5N C;  1Z05 A;  4FLW A;  3SAF A;  3O08 A;  1ASV A;  4Z0U A;  1DLO A;  2P9K B;  3ZT4 A;  1BU6 O;  3KWG A;  4AHC A;  4CHQ A;  5BRF A;  4BY9 C;  3SZ2 A;  4DFM A;  2D1K A;  1J5E K;  3W3D A;  3M6G A;  2BE2 A;  2NZT A;  4H5V A;  3RVC A;  1XC3 A;  4FVM A;  3C0B A;  3VQ7 A;  2BTF A;  3ZX0 A;  4K41 A;  3LDQ A;  3G6E N;  4C8L A;  3WQU A;  3M1F A;  2E6M A;  1HQE A;  1U04 A;  4E7I A;  4FM1 A;  2P9L A;  3OYG A;  4BRK A;  4Y1C A;  1S72 N;  4GW6 A;  1QE1 A;  4K8Z A;  4O4G A;  2ZD1 A;  5LL6 Z;  2ZJQ L;  3NH0 A;  1B92 A;  2FF3 B;  5JVG L;  1KLN A;  3KLG A;  1E4G T;  3ZSQ A;  3C6T A;  4LF9 K;  4KTW A;  3KVG A;  5LJW A;  1BGX T;  4CJF A;  4JK9 A;  2O8C B;  5AQL A;  3QEP A;  1VQN N;  4M3Z A;  3ZEU B;  4LH4 A;  4AHT A;  5AQQ A;  3OW2 M;  2QWM A;  4E7J A;  1SKW A;  1SKR A;  3QDK A;  5KPZ A;  1RBT A;  3KWI A;  1KAX A;  3TTF A;  1S9E A;  4DSI A;  3AVC A;  4A57 A;  1SQK A;  3PUF A;  3CER A;  4W5R A;  4ISF A;  3BUZ B;  5A2Q O;  4DFP A;  3G0Z A;  3VQP A;  2CGJ A;  3DLR A;  5BRE A;  2HHW A;  1VSD A;  3S41 A;  3ZYY X;  4IOA L;  1U48 A;  2A1S A;  5E26 A;  1NM1 A;  4RWT A;  2XY6 A;  3AO1 A;  4GKK K;  1U6Z A;  3QML A;  3V9S A;  4FZY A;  1X9W A;  1RTJ A;  3O9Q A;  3NAE A;  1ZBI A;  5M1O A;  2YV0 X;  2KLA A;  4O44 A;  1VSF A;  2ZJR L;  3ZSY A;  4CBU A;  3QFU A;  4G9Z A;  2O8E B;  4FOI A;  4B08 A;  1SAZ A;  3LDO A;  4GV3 A;  1YTU A;  3NGI A;  2WC9 A;  3MCP A;  2AP1 A;  2A5X A;  3G4S N;  3SBG A;  1HX1 A;  1FK9 A;  4KH5 A;  5GAE P;  3CQ8 A;  4BVO A;  2P9I A;  5MLC Q;  1T8E A;  4JHD A;  5LY3 A;  2KZZ A;  4W5Q A;  1OH6 A;  4KRF A;  1BUP A;  1W97 L;  3D2E A;  2NRX A;  3DYA A;  4DHY A;  1VSE A;  4EHT A;  3LP0 A;  3RTV A;  5KGW A;  2Q2R A;  3AVI A;  1J9A A;  1H1V A;  1T7P A;  3IRX A;  2RHK A;  5JLH A;  5LJV A;  3HXM A;  3VPZ A;  5F1X A;  3WNF A;  1BQM A;  3ENB A;  3HSC A;  1XWL A;  2JWL A;  1WSF A;  1S1T A;  4JKA A;  1NGJ A;  2IIR A;  2P9P A;  3CQY A;  3M5R A;  2OAN A;  3NBP A;  3O4Q A;  4ZTF A;  3OYN A;  4C8N A;  4B8C A;  1JL1 A;  1RIL A;  2UXB K;  2QK9 A;  3V1R A;  4CEC A;  4CW7 B;  1HKC A;  2F7T A;  1VRT A;  3E1Y A;  4GNI A;  1NOZ A;  1WNS A;  1WN7 A;  1NOY A;  3TAG A;  2E6L A;  3Q7C A;  3M8P A;  3OBW A;  4Q0B A;  3AO5 A;  3WUH A;  3VEV A;  3R1X A;  4LY7 A;  1VQM N;  4CIF A;  1YHQ N;  3VQ5 A;  4EP4 A;  5BRH A;  1FXX A;  1W9H A;  3OYB A;  4FPB A;  1SZ2 A;  3THV A;  4JI2 K;  3MDQ A;  4CHZ A;  4IO9 L;  3MAQ A;  4FM0 A;  4M3T A;  4E3S A;  4YY3 K;  1RTH A;  3VQA A;  1S1X A;  2CGK A;  5M1N A;  1SS6 A;  4ID5 A;  3CD6 N;  4FWQ A;  3CMA N;  3QIO A;  3AGK A;  5DM7 L;  3AVK A;  3CM5 A;  3DI6 A;  4Q5V A;  1N32 K;  3KLF A;  4H5N A;  4X66 K;  3LDP A;  2GEM A;  3SQ0 A;  2QEX N;  3SV4 A;  3UKU B;  2GUI A;  2NRZ A;  3S9H A;  2P5O A;  3JYT A;  4DSJ A;  2D0A A;  4O55 A;  3MK6 A;  3CCL N;  2Q36 A;  1BIS A;  3A0I X;  4HTU A;  3ZSO A;  1WSE A;  2VYP A;  4RCH A;  1K8A O;  4C8O A;  1V4T A;  3I0S A;  3ID8 A;  3J80 O;  1XNR K;  4CEF A;  1YF5 L;  4BRP A;  2D5R A;  1NGH A;  4PUO A;  1LCU A;  4NLB A;  4CJQ A;  3QEW A;  4LF8 K;  3OYK A;  4DWI A;  2HHT A;  2HF4 A;  1GLC G;  3R3L A;  4OKJ A;  1ATN A;  3DWL A;  3UB5 A;  1K9M O;  3EKS A;  3OYC A;  1TKD A;  2P9U A;  4CZF A;  3NVK A;  1XC9 A;  4OKE A;  1GLJ O;  4CFB A;  3L2W A;  2ZWH A;  3AVJ A;  1JLE A;  4NXN K;  4IO8 A;  2GV9 A;  3RR8 A;  4PL8 A;  1Z26 A;  1VQ8 N;  3HOT A;  2F9T A;  4CBW A;  3K58 A;  3ITH A;  4KTQ A;  3T69 A;  2JLE A;  4KPY A;  4BDY A;  1ATS A;  3NFA A;  3SBT A;  3WNE A;  5SWM A;  3EE9 A;  3LAM A;  5C25 A;  4BRM A;  1ESV A;  1YAG A;  4EHU A;  2NRW A;  3EY1 A;  4PHT X;  4CE9 A;  3UIQ A;  3O9T A;  3T1A A;  3CJC A;  5AQO A;  4C1N I;  4KB1 A;  3OYD A;  2EX3 A;  1NGC A;  3AVB A;  4IXC A;  3T7Z A;  4DUZ K;  5I9E B;  1EP4 A;  2HW3 A;  3HOS A;  4DR3 K;  4M3X A;  4CF2 A;  4QAG A;  1KTQ A;  2IAJ A;  3D0P A;  3IDH A;  1NG9 A;  3GL1 A;  3Q7B A;  3OYF A;  1W0H A;  4JEP A;  3M8S A;  4XH1 A;  1X9J A;  1GLE G;  3O1W A;  4CK1 A;  2WUS A;  3TAE A;  3LAK A;  2P9N B;  2D0B A;  4PWD A;  3U9D A;  3QIC A;  1X1P A;  3D2F B;  1EO1 A;  3OJS A;  3LAL A;  1JL2 A;  1UAX A;  5GIP A;  1IKV A;  1QVG M;  1U2V A;  4CFD A;  2O8F A;  3DXM B;  1L3V A;  2Q31 A;  4Z94 A;  2D0O A;  5C24 A;  3WT0 A;  3K9J A;  1C6V A;  4FJN A;  1NGD A;  3VEN A;  5AQM A;  3NVM A;  3IS9 A;  3P5J A;  1T05 A;  1OH5 A;  3VQ6 A;  1VQP N;  3ATU A;  1ILY A;  4FVU A;  2W6K A;  4BRL A;  3OY9 A;  4LSL A;  3NF8 A;  2IVO A;  1JLG A;  4IOX A;  4HTL A;  1QQN A;  4NCG A;  1IO2 A;  1K8K B;  3CYM A;  4CZJ A;  4OPA A;  4B1W B;  4YHH K;  4LFB K;  4CZM A;  4K0K K;  4DUY K;  2KTQ A;  4YOU A;  3MWP A;  3HM9 A;  1HPZ A;  4IBN A;  2E88 A;  1KAZ A;  4BR2 A;  4J2B A;  4IDH A;  1RT2 A;  3KLE A;  3I33 A;  3B8A X;  3CM6 A;  2Z1J A;  3KJV A;  1ASU A;  3K59 A;  4DV6 K;  1ZBF A;  4JI8 K;  4FWR A;  1KXP A;  4IJN A;  3VQ8 A;  1YJ9 N;  4GY2 B;  3KTQ A;  3BY5 A;  3GE1 A;  3BDP A;  2AA4 A;  4B1U B;  2G8V A;  5BRD A;  1T03 A;  3QER A;  1QZ6 A;  3HVT A;  2YKN A;  4FL9 A;  4V19 S;  3GBT A;  4BRC A;  1J53 A;  5HP1 A;  1TL3 A;  1VSK A;  4WFB L;  4BR9 A;  1XUP O;  5FPN A;  3T1H K;  1RFQ A;  1G99 A;  3ZEU A;  4K43 A;  3T3F A;  4F4K A;  2DPN A;  2QA4 N;  3VET A;  4Z4E A;  4JS4 A;  5C15 A;  3ZSW A;  1WSG A;  4BR7 A;  4KKO A;  1BA1 A;  3QEV A;  2VGN A;  3BF3 A;  3A5O C;  4O8U A;  2G8W A;  4OLB A;  5CE3 A;  3V9Z A;  5CYM A;  1VQK N;  5HRN A;  4FWS A;  5JMV A;  1S3X A;  1NK7 A;  1ZYQ A;  4Z4H A;  2PYJ A;  3FZK A;  1WBB A;  3L8B A;  4CI6 A;  5AQF A;  3MN6 A;  3HST B;  3DLG A;  2A42 A;  3MED A;  4HCB A;  4FLT A;  2HHV A;  5AQN A;  3VEX A;  4FK0 A;  1ZBS A;  1QQM A;  4BE2 A;  4GV6 A;  1QQC A;  1C0G A;  1KVC A;  4FJX A;  3JS6 A;  3H1Q A;  5KRT A;  1QVF M;  4J2A A;  4FJ9 A;  3AY9 A;  4M7Y A;  4NO7 A;  3SK3 A;  5CYQ A;  3V4I A;  2E1Z A;  2ATQ A;  1WAF A;  2DFH A;  2RF2 A;  4BDP A;  2O8E A;  3IG1 A;  4NCB A;  1C0M A;  4KHW A;  3RSE B;  4BRQ A;  3VQQ A;  2ASO A;  4JI5 K;  3HBT A;  3H3O B;  4DTN A;  2QKK A;  1DKG D;  2UXD K;  3MXJ A;  1YJW N;  2YNI A;  2R7Y A;  4C8K A;  3BF1 A;  3IKM A;  5D3G A;  4CGF A;  4Y0W A;  3OTO K;  3NF9 A;  4JD2 B;  4JLH A;  4CJV A;  4BC5 A;  1NGF A;  3WXJ A;  1EXQ A;  3AVG A;  4JKG B;  4B9L A;  1VQ9 N;  2YHB A;  2HB5 A;  1WB9 A;  5AQS A;  4BQL A;  5AZJ B;  1FKP A;  4JI1 K;  5JLF A;  1VSJ A;  3CFR A;  3FFI A;  2GUP A;  2IGI A;  1IKX A;  5M1K A;  3LDS A;  4H4M A;  1OVY A;  2ITM A;  5BPM A;  5KPT A;  2OPP A;  5BN9 A;  2Q97 A;  1XI1 A;  2PAV A;  5EOY A;  1N36 K;  4A5B A;  5AZI A;  4O8K A;  3F5T A;  4DV5 K;  3THX B;  3MMV A;  4FO0 A;  3TSP A;  4JKH A;  4YOX A;  4DV0 K;  5HBM A;  2X6N A;  3EZ5 A;  4OKK A;  1YVU A;  4JN4 A;  3O9R A;  2O4I A;  3CCV N;  4CJK A;  3SLC A;  4CJ7 A;  3U9Z A;  2DTU A;  1YXQ A;  3SPY A;  3ZT3 A;  1KCF A;  3TAN A;  1TK0 A;  3SQ4 A;  3CHW A;  3K9K A;  5HOO A;  2YHA A;  4F8R A;  3DLL L;  3F9M A;  1FW6 A;  4W5O A;  1QZ5 A;  4CEQ A;  3LZI A;  4N76 A;  3V1Q A;  4KO0 A;  4LSN A;  2JGU A;  3WXM B;  3AVN A;  3ZSZ A;  4I6M A;  1L3U A;  1CXU A;  4IKF A;  4E89 A;  3BGR A;  4OVL A;  1VAZ A;  4OLA A;  5AQU A;  3QIP A;  4FJH A;  2RPI A;  4IG0 A;  4F3O A;  2QWQ A;  2D0C A;  4GMJ B;  3VF4 A;  1M1K O;  4FJ8 A;  4ZTJ A;  1IBM K;  4DF4 A;  4AF1 A;  2VQF K;  4ISE A;  3AO3 A;  4N5S A;  5DK5 A;  1RNH A;  2BGG A;  4NB4 A;  3AAR A;  3N4P A;  1QS4 A;  3HI0 A;  2Y1J A;  3DLK A;  3F9K A;  3FGU A;  4RG8 A;  3E01 A;  3DLE A;  1NMN A;  2RE2 A;  4X65 K;  4I9L A;  4BRO A;  4FJG A;  3RMD A;  5FPD A;  1JCF A;  4IEE A;  3AO4 A;  3ZSV A;  1X3N A;  3ISN C;  3OYE A;  4EZ9 A;  4YOR A;  4U7B A;  1YIT N;  5AQZ A;  4B3R K;  3PLA A;  2VGM A;  4CZK A;  3VQE A;  1HYV A;  3KKR A;  5DM6 L;  4IWV A;  1LWF A;  3V1O A;  5J1E A;  3PY8 A;  3HYF A;  1WLJ A;  1TUY A;  3ZET B;  1D4X A;  2Q1N A;  5BR8 K;  3AA4 A;  2A6A A;  2W40 A;  1WUA A;  4IG3 A;  4B1Y B;  4CJS A;  4B1V A;  4DV1 K;  5CZ1 A;  4DSL A;  4QS7 A;  1W7A A;  1QSL A;  3HM8 A;  3SYZ A;  3I56 N;  5AQW A;  5FDL A;  2VG7 A;  3MEG A;  1RDC A;  2P51 A;  1TK8 A;  5GIN A;  3CI5 A;  4CER A;  2B5J A;  3EKU A;  4DS4 A;  2KW4 A;  3CCJ N;  2O8B A;  1TKT A;  4N41 A;  2FSN A;  4MDB A;  4FM2 A;  3CG7 A;  4KAZ A;  1GLA G;  3D2F A;  3ENH A;  4DQR A;  1GOC A;  4B9M A;  1NK0 A;  3CJ1 A;  2VG5 A;  3J7Z O;  4FJ7 A;  4YNQ A;  3KZB A;  1QSY A;  2O8D B;  2XY8 A;  4CHN A;  3DXM A;  4DR4 K;  2ASP A;  3VTI A;  3PSF A;  4LC9 B;  5BR9 A;  1X9M A;  1X9S A;  5AFU H;  3EYZ A;  1NKB A;  1NGA A;  4U67 L;  5M1P A;  5M1Q A;  3UKR B;  1HNI A;  3ZCM A;  4BG9 A;  4M42 A;  1CLQ A;  4DR7 K;  1J5O A;  2DFF A;  1BIU A;  5CZ2 A;  1LWE A;  3AV9 A;  3UE5 A;  3HK2 A;  3C7N B;  3VQD A;  3LAN A;  4ILG B;  4BQZ A;  2VWK A;  4DQS A;  4FWL A;  4K42 A;  3PO4 A;  4BRH A;  2KZM A;  1IKY A;  2X78 A;  4CGJ A;  1XNQ K;  1EET A;  1K8K A;  4C8M A;  2JWK A;  2YNG A;  1VQ5 N;  1S6P A;  2HVI A;  1J6Z A;  4BRD A;  1NNE A;  3OBY A;  4ISG A;  2ITG A;  2OA8 A;  4E1N A;  4BR5 A;  2B4J A;  2WOM A;  3VQB A;  2HBL A;  3EO3 A;  4HWI A;  3JSM A;  1TAU A;  1OH7 A;  5GAG P;  3QB0 A;  4F2S A;  2G8U A;  4A2A A;  3N4Q A;  4X62 K;  3CXC M;  5AQY A;  3NDK A;  5E41 A;  1HNX K;  4FLY A;  2NRR A;  3O9S A;  4CJ4 A;  1TGO A;  3OYJ A;  1QTM A;  5FRM A;  3P4I A;  4K25 A;  4MLE A;  1VQ7 N;  1TAQ A;  1E3M A;  2HHS A;  3KHY A;  4AQY K;  1KRP A;  3SQ1 A;  3EE8 A;  3ASM A;  3TU5 A;  3T1Y K;  3K5L A;  1BDG A;  3GG4 A;  2RKI A;  4B8A B;  1NMD A;  1KD1 O;  2Z1H A;  3VA3 A;  1JJ2 M;  1XHZ A;  4Z4C A;  4OGC A;  1YI2 N;  1UA1 A;  4BVP A;  2W6L A;  4B1Z A;  3CCM N;  5KTQ A;  4I2P A;  1EX4 A;  2PFU A;  3O9U A;  4FWO A;  1UA0 A;  2HBJ A;  2HF3 A;  2YHW A;  1GLD G;  1C0U A;  3DAW A;  1UOC A;  1V4S A;  1ZBL A;  3C95 A;  3MX5 A;  2Q0U A;  4CJL A;  3ZT1 A;  3CJB A;  1VSL A;  1KQS M;  3PX4 A;  3CPE A;  3THY A;  2EWS A;  3AA2 A;  5AQK A;  4RW9 A;  1SKS A;  4H5T A;  4HUG A;  2IS3 A;  1D5A A;  1HNV A;  1L3T A;  2IDO A;  3WNG A;  1GLL O;  1TKZ A;  4DR6 K;  2P9L B;  1IV0 A;  4LF7 K;  1IG9 A;  3DXK B;  4KH4 A;  3CJ7 A;  1KLM A;  4DQI A;  3OS1 A;  3ZLJ A;  4KHY A;  3L2R A;  1RT4 A;  1NK5 A;  4EAH D;  3TTC A;  2OPS A;  2HHQ A;  1YVN A;  2HBK A;  2P5G A;  5FPE A;  2WBN A;  4H0X B;  1Y64 A;  4JV5 K;  2E20 A;  3FZM A;  4QOZ B;  3AO2 A;  2Y1I A;  2HNZ A;  4FW2 A;  3P31 A;  2FLO A;  3CFO A;  3MN9 A;  4H8K A;  2NUB A;  3THW B;  3FE1 A;  5I42 A;  1RT3 A;  1LAV A;  3K57 A;  2Z1G A;  4MLH A;  1JCG A;  4LH5 A;  4FLZ A;  1KC8 O;  4NLC A;  3OYM A;  2QWR A;  4OO1 J;  3LP2 A;  2OPQ A;  2V52 B;  3DRR A;  3VQC A;  1TYQ A;  3QO9 A;  4CVN E;  3LDL A;  4JI0 K;  3D6R A;  4BWJ A;  4CZH A;  5HRP A;  1KFD A;  4JI3 K;  4JKG A;  2I5J A;  1N33 K;  1HMV A;  1U47 A;  4LF5 K;  5AQP A;  3SNN A;  1OKJ A;  5I3U A;  4QS8 A;  1KFS A;  4FXD A;  3FZH A;  3SJH A;  3NGY A;  1C1C A;  5BPN A;  5EY4 A;  4B9U A;  4M7X A;  4ILH A;  2CH6 A;  3ZSX A;  1EKE A;  4FLV A;  1GOB A;  3TAM A;  4FK2 A;  3VMF B;  3J8A A;  4YFU A;  1HR0 K;  3J7A P;  4JHD B;  4BWM A;  3O3F A;  4B3S K;  3D2E B;  2VWJ A;  2FBV A;  4JAX A;  4JRP A;  1D9D A;  2FBY A;  1YTA A;  4IFE A;  4AHS A;  4AH9 A;  3L0Q A;  4A62 A;  3QBX A;  5KRS A;  2F8S A;  4H4O A;  3DRS A;  5TKW A;  1VHX A;  3HP6 A;  3HO1 A;  3R9P A;  1IH7 A;  2BH1 A;  2KKZ A;  4CBX A;  3GOI A;  1W2B M;  2P9P B;  4CK2 A;  4NXM K;  3V9X A;  2EHG A;  5FPM A;  2YX6 A;  4H0O A;  4BAC A;  5JVH L;  5EU7 A;  2P9K A;  4N47 A;  1ZC6 A;  4CEB A;  3OYI A;  3OHR A;  2BUP A;  4CF1 A;  4BRF A;  3O1B A;  3TPQ A;  1NJI O;  4EP5 A;  1LOT B;  2E2O A;  2AJQ A;  1RDA A;  3ALY A;  3O4W A;  1Q82 O;  3O8M A;  1K6Y A;  1QSS A;  4BE1 A;  4AM6 A;  4JNE A;  3KD1 E;  1RBU A;  3VGL A;  2HHX A;  2PY5 A;  1BO5 O;  5GAH P;  3DOL A;  1O13 A;  4O5B A;  4H0T B;  4DTM A;  4CEO A;  3WXL A;  5JIC A;  3CC7 N;  4CHY A;  2O8C A;  4IZ9 A;  3VEW A;  1N6Q A;  2ZGZ A;  4WFN L;  2QTD A;  2GEL A;  3CET A;  5KQ8 A;  2CGL A;  5J2Q A;  4FJI A;  5B8H A;  3TTD A;  3U4L A;  1I39 A;  1R0A A;  4BRG A;  4DV4 K;  2ASM A;  2FBX A;  3CCU N;  3QEI A;  5K14 A;  3QLH A;  4PY5 A;  1P8Z A;  4IFV A;  3TR8 A;  2YJE A;  4CJW A;  4MFB A;  4JKD A;  4BRN A;  4B3T K;  3VEO A;  3EN9 A;  5ADX H;  3TSU A;  3HT3 A;  4IDK A;  4CGH A;  1FJG K;  4UY8 O;  4YOT A;  1K73 O;  3SUN A;  3ZET A;  4CEA A;  4DR5 K;  3H45 C;  3SMS A;  1C1A A;  2HOE A;  4DTO A;  3DOK A;  2QKB A;  4FWM A;  4LFC K;  2NNW A;  5FRO A;  3E66 A;  3RMC A;  2F4V K;  4M3W A;  1CZ9 A;  5DMR A;  1XMQ K;  3EZW A;  4DU4 A;  4CIG A;  3MN7 A;  1LV5 A;  1BOT O;  4KB0 A;  3CIP A;  3FFK B;  1Q8I A;  1A5X A;  2OTL N;  3V9U A;  2V7Y A;  1Q18 A;  2O8D A;  4DCH A;  4BGA A;  3LPT A;  4ILJ A;  2IVP A;  4WQ4 C;  3AA3 A;  3NGZ A;  2H3G X;  4A2B A;  4WQ5 C;  4A59 A;  2YHY A;  4M3R A;  2HNY A;  4H5R A;  5KI6 A;  4L8R B;  4BC3 A;  3ZT2 A;  2GBZ A;  1T3V A;  2XY5 A;  3ULE B;  2PYL A;  2NLX A;  1RT7 A;  2X6S A;  4KHP K;  1I3A A;  1J54 A;  4KH6 A;  3SUP A;  3PSI A;  1NKC A;  5IWA K;  4IEI A;  2P9S B;  4M3Y A;  1HRH A;  3OYH A;  1U2V B;  3OVN A;  3VQ4 A;  1CZA N;  3RMB A;  1T44 A;  1WSH A;  2YHX A;  2WFB A;  3VF6 A;  4Z4G A;  3QEX A;  5BN8 A;  3U3G A;  2HST A;  2D0P A;  1RDB A;  5AQJ A;  1XMO K;  2V51 B;  4CFA A;  1GOA A;  3L3U A;  1CXQ A;  1HKG A;  3HTV A;  5BPL A;  2DFE A;  5JS2 A;  2Z1I A;  3LL3 A;  4JKC A;  4LFA K;  4E7L A;  2ETJ A;  3M8R A;  4DQ8 A;  3SI6 A;  3RRH A;  3DJC A;  4DS5 A;  5JS1 A;  1QHT A;  1G15 A;  5CY4 A;  4FCY A;  4FSV A;  1EQY A;  4DFK A;  1REV A;  3BEX A;  4B9Q A;  1RBV A;  3QNO A;  3CFP A;  1MWM A;  3UKU A;  3CC2 N;  1QHA A;  4BC2 A;  4FYD A;  2FBT A;  2G8I A;  3QFP A;  3VOV A;  3QIN A;  4FLX A;  4Z4F A;  3B6O A;  1YIJ N;  4GV9 A;  2F96 A;  3H6E A;  4WCE L;  4CCH A;  1S5J A;  3MX2 A;  3C6A A;  4CJ3 A;  3NHG A;  4BGB A;  3TI0 A;  1RBR A;  4CGD A;  3IUC A;  1KSP A;  3L6Q A;  4IFY A;  5FLX O;  3I8B A;  1MWK A;  4B1X B;  4CJP A;  4WFA L;  3EEQ A;  1S1W A;  1KAY A;  3HPO A;  1HPM A;  2KQ2 A;  1NGG A;  4EZ6 A;  1P90 A;  5E84 A;  4F2R A;  2ZJP L;  2I7P A;  4KI4 A;  2E2P A;  2D4W A;  3AGR A;  3KLI A;  3OA9 A;  4AM7 A;  3PX0 A;  1Q81 O;  1NLV A;  4OGE A;  1I94 K;  1JLQ A;  3DXK A;  4C1N K;  3IMX A;  5AJ3 K;  1B9F A;  5KPR A;  3SAH A;  1BI4 B;  4FJ5 A;  3PIO L;  1Q86 O;  4RW7 A;  3BZK A;  3VER A;  3HRG A;  1JCE A;  1X3M A;  4PKG A;  5EVZ A;  4CK3 A;  1SL0 A;  3A8Y A;  3G25 A;  3K5M A;  4KRE A;  1WOQ A;  4OPJ A;  3S3O A;  4AIL C;  2UYT A;  1ZXO A;  4WYB A;  3FR0 A;  4X64 K;  1ITG A;  4JS5 A;  1N34 K;  4I7F A;  4FWN A;  1HJO A;  2F9W A;  1MDU B;  3THW A;  4DSK A;  4PA1 A;  4YDU A;  4CJT A;  2CH5 A;  1RGI A;  4OJR A;  2UXC K;  5GIO A;  1BG3 A;  1LAW A;  3WEE B;  3K0S A;  4BG8 A;  1U4B A;  4PKI A;  2Q3S A;  2P9N A;  2HBM A;  1S1U A;  3ID6 A;  3AVM A;  4FJK A;  2ZQB A;  3QES A;  4DU1 A;  4TSX A;  1F21 A;  4FJL A;  1NK8 A;  1S1V A;  4H0V B;  3RWU A;  3VF2 A;  3U3Y A;  2UUB K;  1LW0 A;  3FLC O;  4DTR A;  4JK7 A;  1QQO A;  4WE1 A;  4DTU A;  1IG8 A;  1Q9X A;  2E1Y A;  2HVH A;  1JXB A;  1JXE A;  3WNH A;  5AQH A;  4HHT A;  1JLC A;  3V6D A;  5H1S Q;  4E1J A;  1LW2 A;  3W0L A;  1YT3 A;  4RW8 A;  3PIP L;  1U49 A;  3CPW M;  2HHH K;  2YNH A;  4FWK A;  4AHR A;  5F0X A;  3A5L C;  3NF7 A;  3V9W A;  3NH1 A;  1Q7Y O;  1JLA A;  4E1M A;  1N5Y A;  4JYA K;  4RW4 A;  3H08 A;  3MWT A;  1NK9 A;  2P1J A;  1NJY A;  2RN2 A;  3CJA A;  3K5N A;  4ELU A;  3AA5 X;  5T7B A;  1ATR A;  1L5U A;  2E5L K;  4FPA A;  4DLE A;  4E0D A;  4KHU A;  5HRO A;  1Z25 A;  4CF8 A;  1RT1 A;  3E9L A;  4R5P A;  5AZI B;  1IJJ A;  2OCE A;  5FRN A;  1VSI A;  2KFZ A;  4A5A A;  3L4Q A;  4BR0 A;  3VTH A;  2A3Z A;  1S6Q A;  4CFC A;  1LWC A;  4DQP A;  2QW9 A;  3F73 A;  1HNW K;  1OVQ A;  3C65 A;  3RR7 A;  4JI4 K;  3VGM A;  1S22 A;  2XO7 A;  3QNN A;  2BDP A;  4CHO A;  1VQO N;  3C6U A;  1IBK K;  2BAN A;  5CR4 A;  2G8F A;  1EWR A;  4AHV A;  1JLF A;  1A5W A;  1VQ6 N;  1DTT A;  2J4R A;  3RMA A;  1HUX A;  3H1V X;  1BHL A;  4PL7 A;  3HJF A;  3G10 A;  1D9F A;  3HL8 A;  2QWP A;  3MN5 A;  1YUW A;  5J2M A;  1IKW A;  3P1G A;  3C6H A;  5AQX A;  3KIO A;  4FJM A;  4LF4 K;  4YDU C;  3E9P A;  3O3G A;  3ULD A;  3SCX A;  3LWL A;  4BRE A;  3JXU A;  3M8Q A;  2PBD A;  4RTF D;  1BCM A;  3KK2 A;  2UUA K;  4I6M B;  5J2P A;  5HRR A;  3MXI A;  4O5F A;  2FF6 A;  3PO5 A;  4I9Q A;  4M41 A;  4CJ5 A;  2X74 A;  4JKE A;  3GDQ A;  2GTD A;  1O1W A;  3CC4 N;  2V7Z A;  1WAJ A;  1UWB A;  1RDD A;  4G1Q A;  4R79 A;  5HLF A;  1C1B A;  3L2V A;  4DV7 K;  4DMN A;  3TAF A;  1NKE A;  2UUC K;  2ZF5 O;  3BZC A;  1VQL N;  2WON A;  4B9V A;  4FZZ A;  2KHO A;  4BC4 A;  2OZS A;  3KLH A;  3AAQ A;  4OPH A;  4L3Q A;  3OJU A;  1DGK N;  3T19 A;  3NE6 A;  1CZB A;  4MO5 A;  3F2K A;  3KK7 A;  1D8Y A;  3G71 N;  1NU0 A;  4MQ3 A;  3L3V A;  4J8F A;  1RTD A;  4LF6 K;  3I8D A;  3IAY A;  4M45 A;  3LM9 A;  3CCQ N;  4DB3 A;  2QI2 A;  4CHP A;  5ELZ A;  5AFU A;  3RSE A;  1Y97 A;  2XRI A;  3OYL A;  4DLG A;  4XIU A;  1RT6 A;  4W5T A;  4KFB A;  4B9T A;  3VEZ A;  4UQG A;  3LZJ A;  2W42 A;  1IBL K;  3P83 D;  1KVA A;  3P39 A;  2A40 A;  4K8X A;  5C42 A;  1VSM A;  4FLU A;  4DTJ A;  3LP3 A;  1Z6R A;  3MEE A;  1HNZ K;  2HND A;  4CZI A;  4DFJ A;  2OZM A;  4JD2 A;  3VGK A;  1NK4 A;  4ELT A;  1ZBH A;  2OTJ N;  1T6C A;  3S3M A;  3TAR A;  2XHB A;  2FSK A;  4DR1 K;  1RT5 A;  3MCA B;  5AZJ A;  3LDN A;  2DY4 A;  4KHN A;  1BIZ A;  5C2F A;  1BL3 A;  5HL7 L;  4AHU A;  3AVL A;  2QXF A;  3FZL A;  4CED A;  3K2P A;  1ASW A;  1TK5 A;  4N56 A;  3J81 O;  4OPK A;  3P38 A;  3SAG A;  5LMN K;  3ULE A;  5AQR A;  1DEJ A;  1TVR A;  4JKB A;  3O4N A;  2QWL A;  2PZS A;  4FW1 A;  4CES A;  1DTQ A;  3THX A;  1L3S A;  1B9D A;  4CD3 A;  2O8B B;  5SZT A;  2E2N A;  5KQD A;  2HMI A;  1ZBU A;  4B3O A;  2VG6 A;  2P9S A;  3JAM O;  3KK1 A;  4DKW A;  1NJZ A;  2P9I B;  3QET A;  4GVE A;  2ZGY A;  2Q0R A;  3SUQ A;  4M63 C;  4JKF A;  4KV8 A;  3M3Z A;  4FZX C;  1NK6 A;  3KK3 A;  1NGI A;  2FXU A;  3NF6 A;  4WF9 L;  3MXM A;  2UU9 K;  4F3T A;  3C94 A;  4KI6 A;  3HVR A;  4B9N A;  1U45 A;  3AVF A;  1VRU A;  1BCO A;  4H0P A;  2QWN A;  1NJW A;  4BDZ A;  3CCR N;  3VES A;  3IFR A;  2XY7 A;  2ZE2 A;  1TL1 A;  3L2U A;  1JLB A; 
#chains in the Genus database with same CATH homology
 4DTP A;  3JYT A;  4DSJ A;  2D0A A;  1LWF A;  2HNY A;  4O55 A;  2IOC A;  5KI6 A;  3V1O A;  4O0J A;  5J1E A;  3PY8 A;  3HYF A;  1WLJ A;  4L8R B;  1HQU A;  4GVM A;  1BIS A;  3ZT2 A;  4HTU A;  3U6F A;  4PQU A;  3ZSO A;  2GBZ A;  4Z4I A;  1WSE A;  3O3H A;  4C8O A;  3AA4 A;  2XY5 A;  3D45 A;  3I0S A;  3ZSR A;  4IG3 A;  3NH2 A;  4CJS A;  4CEF A;  2PYL A;  5CZ1 A;  4E7H A;  4DSL A;  1RT7 A;  2OPR A;  2X6S A;  3SQ2 A;  5HRS A;  1I3A A;  2D5R A;  1J54 A;  4PUO A;  3SUP A;  4CJQ A;  2F8T A;  1NKC A;  1QSL A;  3SYZ A;  3QEW A;  5FDL A;  4DTS A;  2VG7 A;  3OYK A;  4B9S A;  3MEG A;  4DWI A;  4M3Y A;  1RDC A;  1WSI A;  1HRH A;  2P51 A;  1TK8 A;  2HHT A;  3OYH A;  4OKJ A;  4CER A;  2B5J A;  3OYC A;  1TKD A;  3OVN A;  3VQ4 A;  4DS4 A;  4OKE A;  1XC9 A;  2KW4 A;  4CFB A;  1TKT A;  3L2W A;  2A1R A;  3RMB A;  4N41 A;  4FM2 A;  1WSH A;  3CG7 A;  4KAZ A;  3AVJ A;  4W5N A;  1JLE A;  4Z4G A;  4DQR A;  1GOC A;  4B9M A;  1NK0 A;  2GV9 A;  1VK0 A;  3LWM A;  2VG5 A;  4DF8 A;  3U3G A;  3QEX A;  3RR8 A;  4FJ7 A;  4YNQ A;  1RDB A;  1Z26 A;  1QSY A;  2XY8 A;  3ITH A;  3K58 A;  4CFA A;  1GOA A;  3AVA A;  3L3U A;  4CHN A;  1CXQ A;  4KTQ A;  2DFE A;  5JS2 A;  2JLE A;  4CJE A;  4KPY A;  2Z1I A;  4BDY A;  3NFA A;  3WNE A;  2ETJ A;  5SWM A;  4E7L A;  3M8R A;  4DSE A;  1X9M A;  1X9S A;  3SI6 A;  3LAM A;  3RRH A;  1WSJ A;  3EYZ A;  5C25 A;  1NKB A;  4DS5 A;  2IC3 A;  5JS1 A;  4CF0 A;  1HYS A;  1QHT A;  1HNI A;  1G15 A;  1RTI A;  5CY4 A;  3ZCM A;  4CE9 A;  3EY1 A;  4FCY A;  3UIQ A;  3T1A A;  4M42 A;  1CLQ A;  2O4G A;  4KB1 A;  1J5O A;  2DFF A;  1BIU A;  1BI4 A;  5CZ2 A;  4DFK A;  3OYD A;  1REV A;  1LWE A;  2EX3 A;  3AV9 A;  3VN5 A;  1RBV A;  3QNO A;  3HK2 A;  3AVB A;  3VQD A;  3CFP A;  3LAN A;  1MU2 A;  2YKM A;  3SPZ A;  3A2F A;  1EP4 A;  2VWK A;  4FYD A;  2HW3 A;  2FBT A;  4DQS A;  2G8I A;  3PO4 A;  4M3X A;  4CF2 A;  4QAG A;  3QIN A;  3OS2 A;  4FLX A;  3B6O A;  3K5O A;  4Z4F A;  2KZM A;  1IKY A;  4QCL A;  2X78 A;  1KTQ A;  2IAJ A;  2F96 A;  3HPH A;  4CGJ A;  4CCH A;  3D0P A;  1EET A;  1S5J A;  4C8M A;  3PV8 A;  2YNG A;  4CJ3 A;  3NHG A;  1S6P A;  3OYA A;  2HVI A;  3TI0 A;  1RBR A;  1XHX A;  4CGD A;  3OYF A;  3SV3 A;  3LP1 A;  1KSP A;  1W0H A;  2ITG A;  3M8S A;  4E1N A;  1Q9Y A;  2B4J A;  2OA8 A;  2WOM A;  4IFY A;  3VQB A;  2OYQ A;  4CK1 A;  3TAE A;  3JSM A;  3LAK A;  2D0B A;  3KKS A;  1TAU A;  4CJP A;  4FJJ A;  4PWD A;  1X1P A;  1TKX A;  4F2S A;  3OJS A;  1S1W A;  3HPO A;  2G8U A;  3LAL A;  4ID1 A;  1JL2 A;  1UAX A;  2G8H A;  1IKV A;  2KQ2 A;  4CFD A;  4EZ6 A;  3DRP A;  4F2R A;  4KHS A;  1SL1 A;  3NDK A;  1L3V A;  5E41 A;  4Y1D A;  4FLY A;  4KI4 A;  1VSH A;  4CJ4 A;  3KLI A;  3PX0 A;  1TGO A;  4NYF A;  3AVH A;  4CIE A;  3OYJ A;  1QTM A;  3HPG A;  3PX6 A;  4OGE A;  3S3N A;  4HCC A;  5FRM A;  4KTZ A;  1TAQ A;  5C24 A;  4LD0 A;  2HHS A;  1JLQ A;  3RRG A;  1KRP A;  4KHQ A;  1C6V A;  3SQ1 A;  3ASM A;  4FJN A;  4M3U A;  1B9F A;  1KVB A;  3K5L A;  2G8K A;  2RKI A;  4B8A B;  3TAQ A;  1BI4 B;  3IS9 A;  2Z1H A;  3V81 A;  4FJ5 A;  3VA3 A;  3P5J A;  1T05 A;  1XHZ A;  3VQ6 A;  4Z4C A;  4RW7 A;  4OGC A;  4O0I A;  3TAP A;  1UA1 A;  2LSN A;  2E4L A;  4J2E A;  5KTQ A;  4CK3 A;  3OY9 A;  3KD5 E;  4I2P A;  1JKH A;  1SL0 A;  4LSL A;  3K5M A;  4KRE A;  1EX4 A;  4CGG A;  3NF8 A;  4OPJ A;  1JLG A;  3S3O A;  2B6A A;  1UA0 A;  4AIL C;  4NCG A;  3VQ9 A;  1IO2 A;  4CEE A;  4CEZ A;  5KGX A;  3CYM A;  4CGI A;  1ITG A;  4JS5 A;  1BQN A;  4E19 A;  4I7F A;  1C0U A;  3DLH A;  1SV5 A;  1UOC A;  3VA0 A;  3DLB A;  2KTQ A;  1ZBL A;  4J2D A;  3C95 A;  1HYZ A;  4NYN A;  3HM9 A;  3OS0 A;  1HPZ A;  4IBN A;  4DSK A;  4PA1 A;  4J2B A;  4CJL A;  5J2N A;  3ZT1 A;  4DU3 A;  1VSL A;  4CJT A;  3PX4 A;  3AA2 A;  3SUO A;  1RT2 A;  4OJR A;  4RW9 A;  1SKS A;  3KLE A;  1SUQ A;  4DSF A;  4HUG A;  4BE0 A;  1LAW A;  2IS3 A;  3L2Q A;  1U4B A;  1D5A A;  1HNV A;  2Q3S A;  4E7K A;  1L3T A;  2IDO A;  2Z1J A;  3CM6 A;  1S1U A;  3WNG A;  1A5V A;  1TKZ A;  3AVM A;  3KJV A;  4FJK A;  1ASU A;  3DMJ A;  1RBS A;  2ZQB A;  3K59 A;  1NJX A;  1ZBF A;  3QES A;  4ELV A;  4DU1 A;  3VQ8 A;  4TSX A;  3KTQ A;  1S9G A;  1F21 A;  4RW6 A;  1NK8 A;  3BDP A;  4FJL A;  1IG9 A;  1S1V A;  3RWU A;  1KLM A;  3U3Y A;  2G8V A;  4DQI A;  3OS1 A;  4DTX A;  1HJR A;  4KHY A;  1LW0 A;  3L2R A;  3TAB A;  4DTR A;  3QER A;  1RT4 A;  1NK5 A;  3HVT A;  2YKN A;  1T03 A;  4CF9 A;  1FKO A;  2OPS A;  4ZHR A;  4WE1 A;  2HHQ A;  4CJR A;  4DTU A;  3SJJ A;  1J53 A;  1Q9X A;  5HP1 A;  1TL3 A;  2P5G A;  1VSK A;  2YNF A;  3DM2 A;  2HVH A;  1JXB A;  1JXE A;  3WNH A;  3LPU A;  4HUE A;  3ZT0 A;  4HHT A;  1JLC A;  3V6D A;  4DQQ A;  4QOZ B;  4HUF A;  3AO2 A;  2Y1I A;  1LW2 A;  2KFN A;  1YT3 A;  2HNZ A;  4FW2 A;  3TWH A;  4RW8 A;  3T3F A;  4F4K A;  3CFO A;  4I2Q A;  1U49 A;  2HHU A;  2YNH A;  4ICL A;  4H8K A;  1TV6 A;  4AHR A;  4HVJ A;  4Z4E A;  3NF7 A;  3V9W A;  4NCA A;  4JS4 A;  4FK4 A;  1C0T A;  3HP9 A;  4JRQ A;  2NUB A;  4CJU A;  3ZSW A;  1WSG A;  3NH1 A;  1JLA A;  4KKO A;  4E1M A;  3I0R A;  4DG1 A;  3QEV A;  4RW4 A;  1RT3 A;  5I42 A;  1N5Y A;  1LAV A;  3H08 A;  2G8W A;  4OLB A;  3MEC A;  3K57 A;  1NK9 A;  1SL2 A;  2Z1G A;  2P1J A;  4LH5 A;  3NCI A;  4FLZ A;  2RN2 A;  5CYM A;  3V9Z A;  3B6P A;  1NJY A;  1RCH A;  3OYM A;  2FC0 A;  3LP2 A;  3K5N A;  2OPQ A;  5HRN A;  3DRR A;  4ELU A;  3VQC A;  3AA5 X;  3QO9 A;  5T7B A;  4FLW A;  1ASV A;  4Z0U A;  4BWJ A;  1DLO A;  1KFD A;  5HRP A;  1L5U A;  3ZT4 A;  1NK7 A;  1ZYQ A;  4AHC A;  4CHQ A;  4Z4H A;  4DLE A;  2PYJ A;  4E0D A;  4KHU A;  3SZ2 A;  5HRO A;  1Z25 A;  4DFM A;  4CF8 A;  2I5J A;  1RT1 A;  3L8B A;  2BE2 A;  1HMV A;  4R5P A;  3HST B;  3DLG A;  5FRN A;  2KFZ A;  1VSI A;  3MED A;  4FVM A;  3VQ7 A;  1U47 A;  4CFC A;  4HCB A;  1S6Q A;  1LWC A;  4DQP A;  4FLT A;  3F73 A;  3SNN A;  4C8L A;  2HHV A;  5I3U A;  1KFS A;  3RR7 A;  4FK0 A;  2E6M A;  1HQE A;  4FXD A;  1U04 A;  4BE2 A;  4E7I A;  1QQC A;  4FM1 A;  3OYG A;  1KVC A;  2XO7 A;  4Y1C A;  3QNN A;  2BDP A;  3NGY A;  4GW6 A;  4FJX A;  1C1C A;  1QE1 A;  4CHO A;  4K8Z A;  4O4G A;  2ZD1 A;  3C6U A;  5KRT A;  4B9U A;  3NH0 A;  4J2A A;  4FJ9 A;  2BAN A;  1B92 A;  3ZSX A;  1EKE A;  4FLV A;  1GOB A;  3KLG A;  1KLN A;  3TAM A;  3ZSQ A;  2G8F A;  5CYQ A;  3V4I A;  4FK2 A;  2KZZ A;  3C6T A;  1JLF A;  1A5W A;  4AHV A;  4KTW A;  1DTT A;  1BGX T;  4YFU A;  2ATQ A;  1WAF A;  2DFH A;  2RF2 A;  4CJF A;  3RMA A;  3IG1 A;  4BDP A;  1BHL A;  4NCB A;  3QEP A;  1C0M A;  4M3Z A;  3G10 A;  3HJF A;  1D9F A;  4KHW A;  3HL8 A;  4LH4 A;  4AHT A;  4BWM A;  3O3F A;  3VQQ A;  5J2M A;  1IKW A;  2VWJ A;  4E7J A;  1SKW A;  2FBV A;  1SKR A;  3P1G A;  1RBT A;  4JRP A;  1D9D A;  3KIO A;  4DTN A;  3S9H A;  2QKK A;  4FJM A;  2FBY A;  1YTA A;  4AH9 A;  4AHS A;  1S9E A;  4DSI A;  3O3G A;  4N76 A;  3MXJ A;  3AVC A;  3ULD A;  5KRS A;  3SCX A;  3LWL A;  2F8S A;  2YNI A;  2R7Y A;  3PUF A;  3M8Q A;  4H4O A;  4W5R A;  3DRS A;  4C8K A;  5D3G A;  4CGF A;  3HP6 A;  3HO1 A;  3KK2 A;  3NF9 A;  1BCM A;  4JLH A;  4CJV A;  3G0Z A;  3VQP A;  4DFP A;  3DLR A;  2HHW A;  1VSD A;  1EXQ A;  1IH7 A;  5HRR A;  5J2P A;  3MXI A;  3PO5 A;  3AVG A;  4I9Q A;  4M41 A;  4CJ5 A;  2X74 A;  1U48 A;  4B9L A;  2YHB A;  4CK2 A;  2HB5 A;  2A1S A;  3V9X A;  1O1W A;  2EHG A;  1FKP A;  1WAJ A;  1UWB A;  1RDD A;  1VSJ A;  4G1Q A;  3CFR A;  2XY6 A;  3FFI A;  1C1B A;  3L2V A;  5HLF A;  2IGI A;  4BAC A;  4DMN A;  3TAF A;  1IKX A;  3AO1 A;  1NKE A;  3LDS A;  5EU7 A;  4N47 A;  3V9S A;  4H4M A;  4FZY A;  4CEB A;  2OPP A;  3OYI A;  1X9W A;  1RTJ A;  4CF1 A;  3NAE A;  1ZBI A;  1XI1 A;  2YV0 X;  2WON A;  4EP5 A;  4B9V A;  4FZZ A;  2AJQ A;  4O44 A;  1RDA A;  3ALY A;  1VSF A;  2OZS A;  3KLH A;  1K6Y A;  1QSS A;  4BE1 A;  5HBM A;  2X6N A;  3EZ5 A;  3ZSY A;  3OJU A;  4OKK A;  1YVU A;  3KD1 E;  1RBU A;  3T19 A;  2HHX A;  2PY5 A;  3NE6 A;  1CZB A;  1D8Y A;  2O4I A;  4CJK A;  4B08 A;  4MQ3 A;  3L3V A;  3DOL A;  1YTU A;  4O5B A;  1RTD A;  3NGI A;  2DTU A;  3SPY A;  4DTM A;  3ZT3 A;  4CEO A;  1FK9 A;  1KCF A;  4CHY A;  3I8D A;  3CQ8 A;  3TAN A;  4M45 A;  3IAY A;  1TK0 A;  3SQ4 A;  1T8E A;  4CHP A;  1N6Q A;  2YHA A;  1Y97 A;  2XRI A;  4W5Q A;  3OYL A;  4XIU A;  4DLG A;  1RT6 A;  4W5T A;  4F8R A;  4KRF A;  4KFB A;  4B9T A;  5J2Q A;  4FJI A;  3DYA A;  4W5O A;  4UQG A;  1I39 A;  3LZJ A;  2W42 A;  1R0A A;  4CEQ A;  1VSE A;  3LP0 A;  3P83 D;  1KVA A;  2FBX A;  5KGW A;  3LZI A;  3RTV A;  3QEI A;  5K14 A;  4K8X A;  5C42 A;  3AVI A;  1VSM A;  3V1Q A;  1J9A A;  4FLU A;  3LP3 A;  3IRX A;  4KO0 A;  4DTJ A;  1T7P A;  3QLH A;  4LSN A;  3HXM A;  4PY5 A;  2JGU A;  3MEE A;  4IFV A;  3TR8 A;  2HND A;  4DFJ A;  4CJW A;  3WNF A;  1BQM A;  2OZM A;  3AVN A;  3ZSZ A;  4MFB A;  1NK4 A;  1L3U A;  1XWL A;  4ELT A;  1ZBH A;  1WSF A;  1CXU A;  1S1T A;  3S3M A;  4IKF A;  3TAR A;  2XHB A;  4E89 A;  3HT3 A;  3BGR A;  1RT5 A;  3NBP A;  4IDK A;  4OVL A;  4OLA A;  2DY4 A;  3O4Q A;  4ZTF A;  4KHN A;  1BIZ A;  3QIP A;  1BL3 A;  4C8N A;  4B8C A;  4CGH A;  4AHU A;  1JL1 A;  1RIL A;  3OYN A;  2RPI A;  3AVL A;  4FJH A;  2QXF A;  3SUN A;  4IG0 A;  3K2P A;  1ASW A;  4CEA A;  4CED A;  1TK5 A;  4N56 A;  1C1A A;  2QK9 A;  3V1R A;  4CEC A;  4DTO A;  4F3O A;  4OPK A;  3DOK A;  2QKB A;  1VRT A;  2D0C A;  4GMJ B;  4FJ8 A;  4ZTJ A;  1TVR A;  4DF4 A;  3O4N A;  1NOZ A;  1WNS A;  1WN7 A;  5FRO A;  1NOY A;  2PZS A;  3TAG A;  4FW1 A;  4CES A;  2E6L A;  3AO3 A;  5DK5 A;  4N5S A;  3RMC A;  3M8P A;  4M3W A;  1DTQ A;  1RNH A;  2BGG A;  4Q0B A;  1CZ9 A;  3AO5 A;  5DMR A;  1L3S A;  1B9D A;  5SZT A;  4DU4 A;  1QS4 A;  2HMI A;  1ZBU A;  4B3O A;  4CIG A;  2VG6 A;  4LY7 A;  4CIF A;  3KK1 A;  1LV5 A;  3VQ5 A;  2Y1J A;  4EP4 A;  4KB0 A;  1NJZ A;  1FXX A;  1W9H A;  3DLK A;  3OYB A;  3F9K A;  3QET A;  1Q8I A;  3THV A;  3SUQ A;  4RG8 A;  4CHZ A;  4KV8 A;  3MAQ A;  4FM0 A;  4M3T A;  4FZX C;  1A5X A;  4E3S A;  1NK6 A;  3E01 A;  3DLE A;  1RTH A;  3VQA A;  3KK3 A;  3NF6 A;  3MXM A;  4I9L A;  1S1X A;  3V9U A;  4FJG A;  3RMD A;  4F3T A;  3C94 A;  4KI6 A;  3HVR A;  4ID5 A;  4B9N A;  1U45 A;  3QIO A;  3AVF A;  1VRU A;  3AO4 A;  3ZSV A;  1BCO A;  3ISN C;  3OYE A;  3AVK A;  3LPT A;  3CM5 A;  4EZ9 A;  3DI6 A;  4Q5V A;  3AA3 A;  3NGZ A;  3KLF A;  3VQE A;  1NJW A;  4BDZ A;  1HYV A;  3SQ0 A;  2XY7 A;  2ZE2 A;  1TL1 A;  3KKR A;  3SV4 A;  2GUI A;  4M3R A;  3L2U A;  1JLB A;  2P5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...