3P83D

Structure of the pcna:rnase hii complex from archaeoglobus fulgidus.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
213
structure length
213
Chain Sequence
b'SPEFPGRLMKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQKTLDDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase sliding clamp
publication title PCNA directs type 2 RNase H activity on DNA replication and repair substrates.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/dna binding protein
total genus 78
structure length 213
sequence length 213
chains with identical sequence E, F
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3p83D00
1W0HA 1A5XA 3LZJA 4CF9A 1K6YA 1CXUA 3AO5A 1BGXT 4J2BA 1QTMA 2A1RA 3A2FA 5CYMA 5C24A 2DFEA 3CQ8A 4RW4A 4KHWA 3TAFA 4CHOA 4QCLA 4IFYA 2IC3A 3PUFA 3IG1A 1XI1A 4LSLA 3AVKA 3OYMA 3SZ2A 2Z1HA 4CEQA 5KRSA 2PY5A 1CXQA 3RR7A 1VSIA 4C8KA 1LAVA 3T19A 2IS3A 3ZT4A 3TANA 4CEBA 3ZSOA 2KFZA 3LP1A 4N5SA 1BQMA 1VSLA 1RT7A 1ITGA 2KQ2A 2IOCA 5HBMA 3V9UA 3RMAA 4Q0BA 4E7HA 3IS9A 3VQ8A 3I0SA 3OYAA 3OS2A 1JLFA 4CF1A 4KPYA 5DMRA 1FKPA 2VG7A 4I2QA 4AH9A 3L8BA 3V9XA 1VRTA 4MQ3A 4FYDA 4DF4A 1WSJA 3M8SA 1S6QA 3DRPA 4I7FA 2VWKA 4OLAA 3PX6A 4FM2A 1KVCA 4DMNA 1NK8A 1KLMA 1FKOA 1S1VA 4FJNA 1LAWA 4E7LA 1IKXA 5JS2A 1VSMA 1TL1A 3OYBA 3S3NA 2HVHA 4KO0A 2X6SA 3ZT0A 4CFBA 4KREA 5FRNA 2Z1GA 1VSEA 4HUFA 4F4KA 2YHBA 1RBVA 1I3AA 4IG3A 3NCIA 4PQUA 1BI4B 4KHSA 4ELUA 2WONA 1SL1A 3HP6A 3AVMA 4KTWA 1QQCA 1UA1A 4W5TA 1RDCA 1NOZA 3OYFA 1SL0A 3K5MA 3K59A 5HROA 1QS4A 4RW9A 3D45A 2KFNA 3KD1E 4FJJA 4K8ZA 1L3VA 4KI4A 4BDPA 3KLHA 4ID5A 4BWMA 4O5BA 1N5YA 3HXMA 3P83D 4OGEA 3AVAA 1WSHA 3CG7A 3AA2A 1JL2A 1SV5A 2B4JA 1IH7A 3NGZA 3KIOA 2YV0X 5KI6A 1RTIA 4CCHA 2XHBA 3THVA 4PY5A 1DTQA 4LH4A 1BL3A 4DU3A 2VWJA 2QKBA 4CJQA 4QOZB 4ZHRA 1SKRA 4M3WA 4BACA 2Z1IA 1D9FA 3EZ5A 4F2SA 1UA0A 4N41A 5J2NA 2X74A 3SYZA 1HYVA 4IFVA 4AILC 3WNGA 3QIOA 5C25A 4UQGA 4Z4EA 3DRRA 4CJ5A 3NH2A 3OJSA 3T3FA 1U04A 3QEXA 5FROA 1GOAA 4ELTA 1RTJA 4AHVA 2F96A 1DLOA 3EY1A 1RDBA 4ID1A 3F73A 4PA1A 4KTZA 3AO2A 3HYFA 1YVUA 4FJKA 4N47A 3K5LA 4CJRA 4DTJA 2X78A 3ITHA 1LW0A 4CGHA 3AVLA 3OYIA 1RDAA 3AVFA 4DTXA 2HHQA 3AVBA 4DF8A 3V81A 1RBTA 4NYNA 3QIPA 4J2EA 1C6VA 1Z26A 3DOLA 2E6LA 1J9AA 3I0RA 2HHVA 1HQEA 1EKEA 2D5RA 1UWBA 3KLIA 4B8CA 3KLEA 2PYLA 4M42A 2FC0A 3ZSQA 3MAQA 4DU1A 3WNHA 4CHNA 4FJMA 3VQEA 2EHGA 3AVCA 3JYTA 3QLHA 1B9DA 3B6OA 3DI6A 1BISA 3MEGA 4M45A 4CEDA 3SUNA 1NJWA 2PYJA 1TAUA 3TAQA 3U6FA 4DQRA 3V9SA 3SUQA 2OYQA 2F8SA 3TAGA 2YNHA 3VQPA 2O4GA 3V9ZA 2ZE2A 4KHQA 4CHQA 4G1QA 1JXEA 4E19A 4E89A 1NK4A 4E0DA 2HB5A 4LD0A 4CJSA 3C6TA 1FK9A 3L2WA 1U47A 2VG6A 1RTDA 2P5GA 2B5JA 3DYAA 3SCXA 3QEWA 4B08A 4LSNA 4N56A 1XHZA 4B9MA 1RBUA 4EP4A 4CFAA 1RDDA 5E41A 4OPKA 3AO3A 3S3MA 4FK4A 2FBTA 1S6PA 2ATQA 3OYDA 3BDPA 2YNFA 1VSJA 4CJ3A 4BDYA 1RT3A 3CFOA 4M3ZA 4CJ4A 4IDKA 4CGJA 2NUBA 3HP9A 4FZYA 4FJ5A 1VSFA 4M3YA 3S9HA 5I42A 3SQ0A 1BQNA 4OKJA 1S1UA 3VQQA 4CHYA 2G8WA 5HP1A 5D3GA 2HNYA 1ZBUA 1Q8IA 2ZD1A 5KTQA 3OYKA 4DFMA 1ZBFA 4O0IA 3HSTB 3K5OA 1D5AA 3B6PA 4CGDA 4BE1A 4JS5A 3PY8A 4CK1A 1ASWA 4CEEA 3OVNA 4Z0UA 3OY9A 1HNVA 3G0ZA 2GBZA 4RG8A 3ZCMA 3VA3A 2I5JA 1RBRA 4LH5A 1Q9XA 4CJFA 3DLGA 2YKNA 1B92A 1HPZA 3AVGA 2X6NA 3QERA 2P5OA 4B9LA 2QK9A 3SPZA 4C8NA 4CHZA 3KK2A 3O4NA 4CGGA 1S1TA 3NE6A 1VSKA 4CEAA 3L2VA 4CFCA 1J5OA 4BDZA 3HL8A 1IO2A 4FM0A 3ZSXA 2OPPA 1LWEA 3SV4A 1BIUA 5KGXA 1X1PA 1TV6A 2O4IA 4OPJA 3DOKA 2DFHA 4AHCA 1QSSA 3M8RA 3TAMA 4OKEA 4FJIA 4Z4IA 4M3UA 1UAXA 1ASUA 1JXBA 3ULDA 1L3TA 4FXDA 1TAQA 3SUPA 1UOCA 4FLZA 3S3OA 1VSHA 4DSEA 4OKKA 1A5VA 4CGFA 4CESA 4O44A 4FLUA 3TAEA 1T7PA 3LP3A 3G10A 4FJHA 3LANA 4MFBA 1R0AA 3O3HA 3DMJA 3V4IA 5HRSA 4FM1A 1RNHA 3RMBA 1BHLA 1FXXA 2P1JA 4FJ9A 4CF0A 1BCOA 5DK5A 2XY6A 4M3XA 3V1QA 4B8AB 4BWJA 1KCFA 4DFJA 1ZBIA 4KB0A 1JLGA 1IKVA 3P5JA 2G8HA 4DSJA 1RCHA 4DQIA 4B3OA 3O3FA 3MEDA 4NCBA 2DTUA 1QSYA 2WOMA 4Q5VA 4FLVA 1ZYQA 2HNDA 4CERA 2RN2A 3OYHA 3RMDA 4C8LA 3HJFA 4KRFA 3HO1A 4W5NA 1JL1A 1LWCA 4FJGA 3EYZA 3C6UA 4ICLA 4NCAA 3HPHA 1XHXA 1GOBA 2G8VA 2OZMA 1HQUA 4CJPA 2A1SA 3TI0A 1SL2A 1TK5A 1TK8A 4CJEA 3ALYA 4IG0A 4QAGA 3HPOA 1D8YA 4L8RB 1HNIA 3SV3A 4DTMA 3NFAA 3RRHA 1WSFA 2XRIA 1EX4A 3NGYA 2BGGA 1RT5A 1XWLA 1SKSA 1CZBA 1MU2A 4CJVA 1NJZA 1T05A 3T1AA 3O4QA 1J54A 3AVJA 3CFRA 4FJ7A 3OJUA 2XO7A 2HW3A 1BI4A 1F21A 3NHGA 4E7JA 1TK0A 4E7KA 4F8RA 3VA0A 2AJQA 5CY4A 1S1XA 3AVNA 4PWDA 4B9NA 4OJRA 1HYSA 4M3TA 1HJRA 4I2PA 4M41A 2D0AA 4CJWA 3P1GA 3HVRA 3NDKA 3LAMA 3BGRA 3VQ9A 2G8KA 4PUOA 1RTHA 4CE9A 3U3YA 4FJXA 4CF2A 4DG1A 1CLQA 1S9GA 2JGUA 3M8QA 2G8FA 1KSPA 3KD5E 2D0CA 1WSGA 4DFKA 2JLEA 3TARA 5FDLA 3DLHA 1LV5A 3OYCA 4E3SA 4DSIA 1ZBHA 3V1RA 4YFUA 4JRQA 1X9WA 1KFSA 1SUQA 1QE1A 3DLKA 4GW6A 4JRPA 4B9SA 3VN5A 5EU7A 3C95A 2P51A 3KKSA 1WLJA 4I9LA 4Z4HA 5J2PA 3QEIA 1NK0A 1REVA 4CFDA 4YNQA 2OPRA 1KRPA 4DS4A 1NJYA 4KB1A 4DU4A 4OLBA 5I3UA 2RKIA 3SUOA 3QEPA 3OYNA 3HT3A 4F3TA 3CYMA 4DTNA 1KLNA 3HM9A 4EP5A 5HRNA 4RW8A 3VQ5A 1GOCA 3KJVA 3OS0A 1KTQA 3TWHA 3KLGA 3I8DA 4Y1CA 1TKDA 4NYFA 3ASMA 5HLFA 1ASVA 3LPTA 3E01A 3M8PA 3WNEA 3O3GA 1U48A 4CIGA 2G8UA 4KAZA 5JS1A 4H4MA 1YTUA 4DSLA 5SZTA 4FLWA 1BIZA 1D9DA 2E6MA 2FBVA 1NK5A 3ZT2A 3OS1A 2W42A 4DLEA 4W5RA 4AHSA 3VQAA 3L3VA 3SI6A 1N6QA 2HNZA 4KHYA 2B6AA 4ELVA 4I9QA 4DLGA 3ZSZA 3UIQA 4HCCA 1A5WA 4E1MA 2XY8A 4NCGA 1TL3A 4FLXA 1TVRA 1VK0A 2YNIA 1WSEA 3PO5A 2LSNA 3LAKA 1C0UA 4HUGA 5K14A 1EETA 3QNNA 5HRRA 3MXMA 4DTRA 1NK9A 1NKEA 4CEOA 3ISNC 1T8EA 4C8OA 3LP2A 4KI6A 1HYZA 3QNOA 1JLEA 3NF6A 4HUEA 3ZSWA 1RILA 3VQ6A 5HRPA 3NGIA 3LALA 1RT4A 4CF8A 3LZIA 1L3SA 3DLEA 3AA5X 2DFFA 3VQDA 1IKWA 4B9TA 4DTPA 3OYGA 1B9FA 4M3RA 4B9UA 3QESA 3QETA 3PX0A 4OVLA 4FK0A 2KZMA 2IGIA 3ZSYA 3LWMA 2FBYA 2BANA 3KKRA 3H08A 1JLBA 3V9WA 4RW7A 1IG9A 2KZZA 3L2UA 5SWMA 4E7IA 2Y1IA 2GUIA 3NF9A 4O0JA 1TKXA 2KTQA 3KK3A 4CECA 4IBNA 4CIFA 4DS5A 4FZZA 2Y1JA 2D0BA 3L2QA 3KLFA 1YTAA 3VQ7A 2YNGA 5J1EA 3MECA 3NF8A 3NH1A 4KV8A 3MXIA 4CIEA 4DFPA 3CM6A 4N76A 2IAJA 3NBPA 3L2RA 1TGOA 1KFDA 3ZT3A 2F8TA 1Q9YA 1JKHA 1G15A 2ZQBA 4XIUA 3K5NA 4E1NA 1WNSA 1Y97A 5J2MA 4FJLA 3RRGA 2OPSA 3NF7A 1NKBA 1L3UA 3VQCA 3DM2A 2IDOA 4FVMA 2YHAA 3DRSA 3K57A 4KHUA 3DLBA 3LP0A 3MXJA 1I39A 3VQBA 2QXFA 4CGIA 3V1OA 1S9EA 3DLRA 4CHPA 1JLQA 1JLCA 4CJTA 3TABA 1NOYA 1NJXA 3HK2A 2HHSA 4GMJB 1EP4A 1C1BA 4AHRA 1C0MA 3SQ1A 3QEVA 1U4BA 2YKMA 2BDPA 2FBXA 2KW4A 3NAEA 1NK6A 1HMVA 4Z4CA 3WNFA 3LWLA 5CZ2A 4FLYA 3IAYA 1NKCA 4B9VA 4H4OA 1J53A 4FW1A 1L5UA 3KTQA 3TR8A 4FCYA 3HPGA 3VQ4A 3RR8A 4WE1A 4FLTA 4CK2A 1TKTA 3SJJA 2ETJA 4CJUA 3OYEA 3IRXA 1LWFA 1RT6A 2OPQA 4DTUA 2EX3A 5KRTA 1DTTA 3KK1A 1S5JA 3AV9A 4O4GA 3PV8A 3AVIA 1WAJA 3ZSRA 1U49A 4KTQA 3C94A 3AO4A 4HTUA 2HHWA 4DQSA 3ZSVA 1SKWA 1WAFA 1NK7A 4BE0A 4AHUA 4HCBA 4AHTA 4DTSA 1JLAA 3L3UA 3OYJA 5J2QA 4K8XA 4CJKA 5CZ1A 4DSKA 1IKYA 3V6DA 3NH0A 1X9SA 2XY5A 4BE2A 3SQ4A 3LDSA 1Z25A 2OZSA 4EZ6A 4DTOA 2HHUA 4JLHA 4KHNA 4DQQA 2VG5A 4HVJA 4Y1DA 4RW6A 2Z1JA 3AVHA 1C1AA 3CM5A 4ZTJA 4J2AA 4EZ9A 3QO9A 4DSFA 3D0PA 3MEEA 2RF2A 2HMIA 4O55A 4OGCA 4Z4GA 4C8MA 3RMCA 4KKOA 4W5QA 3AA4A 1RT1A 1BCMA 3K2PA 4CK3A 5C42A 3OYLA 2GV9A 3RWUA 4R5PA 2RPIA 3FFIA 1LW2A 4LY7A 3ZT1A 4F3OA 3SQ2A 4FJ8A 2R7YA 2HHTA 1EXQA 3SPYA 3F9KA 4ZTFA 1CZ9A 4CEZA 2OA8A 2HHXA 1WN7A 5CYQA 2HVIA 1VSDA 1HRHA 4CJLA 4CEFA 4GVMA 4HHTA 2E4LA 3TAPA 1X9MA 2PZSA 1RT2A 4JS4A 4IKFA 3AA3A 2Q3SA 3HVTA 5T7BA 4FK2A 3PX4A 4DWIA 4H8KA 4KFBA 4Z4FA 1C1CA 2QKKA 1QSLA 4DQPA 2G8IA 1T03A 4W5OA 2DY4A 1XC9A 1KVAA 3AO1A 3PO4A 5KGWA 1QHTA 3RTVA 4F2RA 4FZXC 2XY7A 1O1WA 2ITGA 3QINA 1S1WA 4TSXA 3U3GA 3JSMA 3K58A 4FW2A 3CFPA 1WSIA 1VRUA 5FRMA 3LPUA 4J2DA 1KVBA 1ZBLA 2BE2A 1C0TA 1TKZA 1W9HA 3SNNA 1U45A 1RBSA 1YT3A
chains in the Genus database with same CATH superfamily
1DKGD 3TU5A 1WUAA 3A2FA 5C24A 4CJ7A 4RW4A 3CQ8A 5BR8K 2IC3A 1CZAN 3IG1A 4LSLA 1VHXA 2YI1A 1LAVA 3T19A 2IS3A 3ZT4A 4A5AA 4E3SA 3L4IA 1VSLA 1ITGA 2IOCA 4E7HA 3IS9A 3VQ8A 4I2QA 4DQ8A 2HF4A 3UKRA 3HBTA 3O5BA 4U7BA 4NO7A 4DF4A 1RDWX 4I7FA 1TUYA 4DMNA 4FM2A 1KLMA 4FJNA 3SAGA 3L6QA 2JWKA 3CETA 3OYBA 5FRNA 1VSEA 1ATSA 4JKEA 4PQUA 1NM1A 4B1UB 1SL1A 3Q7CA 3GOIA 3OYFA 4H0TB 5BPMA 1NLVA 1QS4A 4JI3K 4EHTA 4KI4A 4KHPK 3EL2A 4ID5A 3HXMA 3AVAA 2NRRA 3AA2A 3CPEA 1SV5A 3R8EA 2W40A 3NGZA 1BA1A 1R59O 3MK6A 1RTIA 4CCHA 4FPAA 3N4PA 3THVA 4OX9K 3ULEB 4CZKA 4BC4A 3WXMB 1FW6A 3Q7BA 3P31A 2GELA 1D9FA 3ATUA 2FSKA 2X74A 4DV0K 3SYZA 4IFVA 3VTIA 2CGLA 4Y0WA 3VEZA 3NH2A 3OJSA 1U04A 1ATRA 4ELTA 4AHVA 2ZJQL 1DLOA 3JAMO 4V19S 4PA1A 4KTZA 4CJRA 4DTJA 3B8AX 4EFHA 3RSEB 3OYIA 3AVLA 3LL3A 3AVFA 1LOTB 3AVBA 3DOLA 4GNIA 1J9AA 1HQEA 4IOXA 3OTOK 5AR0A 4AF1A 4M42A 4DU1A 2E2PA 2EWSA 3EZWA 3H45C 4FJMA 3B6OA 1BISA 3SUNA 1TAUA 3U6FA 4DQRA 3V9SA 2P9NA 3FFKB 3V9ZA 2F8SA 2WTUA 4BQLA 4BC2A 3WQTA 4KHQA 4KBOA 3C6HA 4G1QA 3ULEA 1JXEA 4AM6A 2YJEA 4JK9A 5GIOA 1IBMK 2VG6A 5C2DA 2B5JA 3EKUA 4LSNA 5DM6L 4NB4A 4H5VA 4EP4A 4JAXA 3OYDA 3BDPA 1VSJA 3J7ZO 3C0BA 4JHDA 5KPTA 5I42A 1BQNA 1VQON 1X9JA 5HP1A 5D3GA 2HNYA 1Q8IA 3FLCO 4DV3K 4BR9A 1ZBFA 1D4XA 2YCHA 3HSTB 1D5AA 4WCEL 3DAWA 3PY8A 4CK1A 4Z0UA 3QERA 4F9OA 4BRDA 3KK2A 5AQIA 4CEAA 1J5OA 4BDZA 4JD2A 2P9LB 3ZSXA 4X65K 1LWEA 3OBYA 4BR7A 3THYB 1TV6A 2O4IA 3BZKA 1UAXA 4H0XB 1JXBA 3SUPA 4FLZA 4DSEA 4CGFA 4CESA 4FJHA 4CD1A 3MX5A 4MFBA 3O3HA 3RMBA 1FXXA 3U8XA 3I56N 1BCOA 3G6EN 2YJFA 4M3XA 3V1QA 4BWJA 2NZTA 4DFJA 3H46O 2G8HA 4B3OA 1OH8A 1QSYA 2WOMA 4Q5VA 4OO1J 2NRXA 3ENBA 2OCEA 3RMDA 3HJFA 3PIOL 4W5NA 3EYZA 2ZJRL 1E4GT 3HPHA 4BGBA 2FF3B 2V51B 4DV6K 5MLCQ 4CJPA 2WFBA 3GL1A 2P9LA 3HPOA 1HNIA 1S22A 3THYA 4IFEA 2E2OA 1RT5A 5EVZA 4QS9A 2O8BA 3CF5L 5ELZA 3T1AA 1J54A 3AVJA 4CBUA 3CFRA 2XO7A 1BI4A 3VA0A 5CY4A 3AVNA 4I2PA 3MWTA 4FWMA 4PUOA 1OVQA 2P9PB 1RTHA 3PIPL 3A5LC 1KSPA 2D0CA 4Z94A 3FZMA 5FDLA 1ZBHA 1LV5A 3OYCA 3V1RA 4X64K 4JRPA 4Z4HA 5EU7A 3C95A 2P51A 4CFDA 1KRPA 3VGKA 4KB1A 5I3UA 2RKIA 1XC3A 3OYNA 4M63C 4C1NK 3U4LA 3TWHA 4PHTX 3I8DA 4NYFA 1ZBSA 3WEEA 4A2AA 1QZ6A 1HLUA 3WNEA 3O3GA 2G8UA 4ILJA 4DSLA 5SZTA 2E6MA 3ZT2A 4OPAA 3VEWA 4AHSA 3L3VA 3CC2N 2HNZA 4E1MA 2UUAK 2P9PA 3NVMA 4J2EA 4DR5K 3MXMA 1H1VA 4XEIA 2Q31A 2ZM6K 3ISNC 4IZ9A 4GY2B 4C8OA 3VENA 3WUHA 3OBWA 3QNOA 1JLEA 2W6KA 4JI7K 1RILA 3LALA 1RT4A 4CF8A 3LZIA 3IUCA 1L3SA 4RCHA 3THWA 1M1KO 2QWPA 3QESA 3OW2M 3QETA 4FWRA 4OVLA 4FK0A 5AZJB 2F7TA 4LFAK 3LWMA 1S72N 1Z05A 2BANA 2KZZA 5AQGA 3L2UA 4E7IA 2GUIA 3NF9A 2KTQA 1VQ9N 3D7EO 4DS5A 4MO4A 4FZZA 2Y1JA 2D0BA 3WXJA 3VQ7A 2YNGA 5M1KA 3MECA 3HM8A 4JKCA 2P9SB 4N76A 4GVEA 1WNSA 4FJLA 4EHUA 3O1BA 3RRGA 2OPSA 3NF7A 4KHUA 2YHAA 4M7XA 3LP0A 4G9ZA 5ADXH 2E1YA 2QXFA 3TABA 3ID6A 2KLAA 4QS8A 3QEVA 1EWQA 1NK6A 3SBTA 5BPLA 3J7YP 1KD1O 4IJAA 3LWLA 3IAYA 2QI2A 1NKCA 5BN8A 2UUBK 4B1WB 4WE1A 4FLTA 4CK2A 1DTTA 1WAJA 3C94A 2P9UB 2WBNA 4BE0A 5F0XA 3ZX2A 4CD3A 4K41A 1ILYA 3EN9A 1K8AO 5I9EB 2XY5A 4BE2A 1X9SA 3QB0A 1Q7YO 4Y1DA 3SK3A 4DSFA 2RF2A 2V52B 4O55A 1VQ6N 1BCMA 4B3MK 4BRQA 3PLAA 1JCEA 3ZT1A 4F3OA 3SPYA 2HHXA 2FXUA 4CEFA 2E4LA 1RT2A 3HVTA 3IKMA 4FOIA 3VF6A 4FWKA 4Z4FA 1C1CA 5GAGP 2DY4A 1XC9A 1KVAA 3AO1A 3E66A 1ESVA 3VF2A 4YOTA 2XY7A 4TSXA 2ZWHA 1N36K 3ENOA 5FRMA 3CMEN 1KVBA 2BE2A 1TKZA 3SNNA 1XQSC 1N6QA 1TUUA 1A5XA 5AQOA 1SZ2A 1CXUA 3AO5A 4J2BA 1QVGM 3T69A 5LY3A 2DFEA 4QCLA 4KHWA 3TAFA 4CHOA 3PUFA 5EY4A 4KH5A 3OYMA 2Z1HA 2VGMA 5KRSA 2PY5A 5AQRA 1VSIA 3ZSOA 3ZEUA 2KFZA 4N5SA 1BQMA 2PAVA 3RMAA 1HNXK 4Q0BA 3I0SA 4BR0A 3CCQN 1JLFA 5GADP 3DXMB 4KPYA 4CBWA 2F4VK 1EWRA 2JWLA 3MN7A 1NNEA 3DWLA 1MDUB 3PX6A 1NK8A 2BTFA 4JK7A 4JI1K 4A5BA 5BRDA 5C12A 3CC4N 4DUYK 1LAWA 4E7LA 4FO0A 1TL1A 4CFBA 3ZT0A 4HUFA 2YHBA 4IG3A 5EOYA 3IDHA 2WONA 1YAGA 3AVMA 1M90O 3L4QA 4LF5K 4RW9A 3D45A 2KFNA 4FJJA 4BWMA 4O5BA 1RDUA 3FZFA 4OGEA 1YJWN 1WSHA 3CG7A 1QHAA 4BRKA 3KIOA 5KI6A 3AARA 1JCGA 4WF9L 2XHBA 4PY5A 4LH4A 1BL3A 3NVKA 2VWJA 4C23A 2QKBA 4QOZB 3DXMA 4BACA 2Z1IA 5AQHA 4F2SA 2DPNA 3QIOA 4CZHA 4Z4EA 1T6CA 5DM7L 5JLFA 3C6AA 1Z6RA 4B1ZA 3EY1A 1RDBA 4MDBA 4RTFD 3AO2A 4MLEA 1VQKN 2CGKA 4DTXA 1LW0A 4CGHA 2HHQA 2YX6A 4DF8A 3V81A 2IVOA 1RBTA 3E9LA 1IJJA 5AQTA 2E6LA 3I0RA 3GBTA 2D5RA 3VEVA 3MCPA 2PYLA 3MAQA 3ZSQA 4KH4A 3QLHA 1NGCA 3DI6A 3MEGA 3WXKA 4CEDA 2PYJA 4LFCK 3TAQA 2FSNA 4BR2A 2AA4A 2YNHA 3A0IX 4CHQA 4YDUA 4E0DA 4LD0A 4BGAA 3DYAA 4N56A 1XHZA 4LF4K 3R6MA 3S3MA 2FBTA 1Q82O 1S6PA 2QWMA 1HNWK 2YNFA 4BDYA 1RT3A 2CGJA 4M3ZA 2NUBA 4FZYA 2HF3A 1S1UA 2NRZA 5KTQA 3KVGA 4DFMA 4BE1A 5AQLA 4K43A 1HKCA 3ENHA 2ZGZA 2GBZA 4RG8A 1YF5L 3VA3A 4LF7K 2UXBK 1RBRA 4LH5A 4BC5A 2P5OA 3AVGA 4BRAA 3VESA 3QBWA 4C8NA 4H5WA 3O4NA 4CGGA 2QM1A 1IBKK 4CFCA 1TYQB 2GWJA 3MN6A 4FWNA 1NGHA 1LCUA 2V7YA 4YY3K 3DOKA 4GV3A 2Q0UA 3I8BA 5GAHP 1K9MO 4FVUA 3FGUA 4FJIA 1ASUA 4FXDA 1TAQA 3K0SA 1NG9A 1UOCA 3S3OA 4RWTA 4BVPA 5AQJA 5BPNA 1R0AA 3H3OB 4PKIA 2H3GX 3LDQA 1RNHA 3D2EB 5AQFA 3TSQA 4CF0A 2XY6A 3O4WA 4LF8K 3MN9A 5F1XA 1RCHA 4DQIA 4NCBA 2DTUA 2HNDA 4KRFA 5C0YA 3H3NO 5GIPA 2IIRA 3HO1A 1JL1A 1HPMA 1QZ5A 4CW7B 1XHXA 3K9JA 2G8VA 2OZMA 1SL2A 1TYQA 3H1VX 3CJBA 5KPZA 1TK5A 4FSVA 3ALYA 4IG0A 2YHYA 1S3XA 3RRHA 1EX4A 1XWLA 1SKSA 3JS6A 1CZBA 1MU2A 3CCSN 3M6GA 3J81O 1NJZA 2CH6A 3O4QA 5F2RA 4E7JA 1TK0A 4E7KA 4JI4K 2A41A 3LDPA 2RHKA 1HYSA 3T1HK 4A59A 3D2EA 1N33K 4FJXA 5LJWA 4CF2A 2JLEA 4DSIA 2ZGYA 4EAHD 1X9WA 4YFUA 1KFSA 3DLKA 2KHOA 1VQ4N 4B9SA 1GLDG 3VN5A 3I55N 3CPWM 4I9LA 1WLJA 5J2PA 3QEIA 4ISEA 3HTVA 2O8FB 1REVA 4YNQA 1WBDA 4OLBA 5E84A 3EO3A 5LL6Z 4F3TA 4DTNA 1KLNA 4JKFA 4EP5A 4NLCA 5C10A 1TKDA 4Y1CA 5HLFA 1ASVA 3LPTA 1U48A 3CQXA 4CIGA 3O6WA 4KAZA 4H4MA 3TSPA 1BIZA 1D9DA 2FBVA 4J8FA 3OS1A 4DLEA 4FWLA 4KHYA 3RSEA 4DLGA 3CCLN 3AAQA 3VEOA 1TL3A 1VK0A 2YNIA 2NLXA 1C0UA 4HUGA 3QNNA 5HRRA 4CEOA 4KI6A 3FZKA 3WT0A 3NGIA 1V4SA 1U6ZA 1BOTO 3DLEA 3CI5A 1BUPA 3OYGA 4B9UA 1EQYA 3QFPA 2I7PA 3UB5A 3KKRA 4CZLA 3NMUA 3V9WA 2ZF5O 3UKUB 1IG9A 3VERA 1NGAA 4CECA 4CIFA 4B3TK 3A5NC 3KLFA 5HOOA 2YHWA 5J1EA 4XH1A 4DFPA 3CM6A 4B1VA 4I6MB 2IAJA 3NBPA 3L2RA 1TGOA 1W7AA 4H5TA 3ZT3A 2D4WA 2F8TA 1JKHA 1G15A 4XIUA 3K5NA 4LFBK 1Y97A 2GEMA 1QQMA 4LF9K 3VQCA 3K57A 3DRSA 4IWVA 5AQUA 3DLBA 1E3MA 3E9OA 4PL8A 3ZYYX 4CJTA 4JKBA 1JLCA 5ADXA 4GMJB 1EP4A 1C1BA 1Q86O 1DT9A 4AHRA 3SQ1A 1HUXA 3AY9A 2YKMA 1U4BA 2BDPA 2O8DB 2KW4A 4X62K 3WNFA 4GKKK 5CZ2A 4B9VA 4H4OA 3SAHA 3KTQA 4FCYA 3RR8A 4UY8O 2ETJA 4JI2K 3OYEA 1LWFA 4DTUA 1OH5A 4FPBA 3PV8A 3AV9A 4B1XB 1U49A 2D1KA 4DQSA 1WAFA 1NK7A 1JLAA 4BRCA 3L3UA 2QEXN 4K8XA 4DSKA 3V6DA 3NH0A 4I6MA 3LDSA 4EZ6A 4DTOA 2NRVA 3EE8A 4DQQA 2VG5A 2Z1JA 1HKBA 2HMIA 4OGCA 1MWMA 3R9PA 4W5QA 3AA4A 3IMXA 5C42A 3OYLA 3DXKB 5C15A 2GV9A 3RWUA 4LY7A 5KQ8A 3SQ2A 4ZTFA 4CEZA 2OA8A 2HVIA 5CYQA 4CJLA 3O8MA 1C0FA 4HHTA 3TAPA 2PZSA 4EIAA 4KFBA 5JVGL 1SQKA 5C2FA 1O13A 1QSLA 3P38A 2G8IA 4W5OA 4QS7A 2NNWA 3PO4A 3RTVA 4FZXC 1O1WA 2ITGA 1S1WA 4O8KA 3CFPA 4JI6K 3O9RA 4J2DA 5BN9A 1C0TA 1W9HA 1U45A 3CJ9A 1W0HA 5HL7L 4CF9A 2QWNA 3O9UA 1BGXT 2A1RA 5CYMA 3J8AA 1QQOA 4IFYA 1YITN 3AVKA 3RR7A 3DXKA 4C8KA 4BG8A 4DHYA 3TANA 3LP1A 5HBMA 1RT7A 1VQ5N 4FL9A 3BF1A 4JKGB 2HOEA 4CF1A 3ATVA 5DMRA 1FKPA 2VG7A 3VOVA 1NJIO 2WC9A 3L8BA 3V9XA 3O80A 4MQ3A 2GUPA 4DR3K 4FYDA 3M8SA 1S6QA 4OLAA 1J5EK 3MN5A 3VGLA 1S1VA 5CHIA 5JS2A 2HVHA 3MDQA 1EO1A 4OPHA 4F4KA 1I3AA 3HRGA 4KHSA 3HP6A 1QQCA 1UA1A 4W5TA 1NOZA 3CCJN 3K5MA 1X3MA 4CBXA 4K8ZA 1YXQA 4BDPA 4WFAL 3P83D 2E2QA 3ZX0A 3P39A 1JL2A 4DUZK 3T1YK 5AZJA 2YV0X 4JKGA 1T3VA 1DTQA 3CCUN 3LDOA 3BZCA 4ZHRA 4M3WA 4MDAA 1UA0A 4CZGA 4N41A 5J2NA 1HYVA 4XH5A 3WNGA 2P9SA 4CI6A 3DRRA 3T3FA 1GOAA 5BRFA 4DV7K 4ID1A 3F73A 5A2QO 5GINA 2ITMA 4CZMA 1YVUA 4CVNE 3K5LA 2X78A 2RE2A 1FJGK 1RDAA 3QIPA 4C1NI 1U2VB 1T44A 2HHVA 1EKEA 1XMOK 4B8CA 5AQKA 3KLEA 2FC0A 3WNHA 1GLJO 4DB3A 1NJWA 1KC8O 3C7NB 3SUQA 2OYQA 4M7YA 3TAGA 3A5OC 3VQPA 4AM7A 5TKYA 1VQMN 2A3ZA 4E89A 1NK4A 5H1SQ 2P9UA 4CJSA 3L2WA 4BRFA 4WQ4C 3QEWA 1WOQA 2FLOA 3SAFA 1HKGA 4OPKA 3AO3A 4DR6K 4FK4A 3CFOA 3MMVA 4CJ4A 4IDKA 4CGJA 4FJ5A 4WQ5A 1VSFA 3OHRA 4M3YA 3S9HA 2AP1A 1GLAG 4CHYA 4GV6A 1V4TA 2ZD1A 1U2VA 1N34K 4CGDA 1VQ8N 1ASWA 4CEEA 3OVNA 3PSIA 3OY9A 1HNVA 3G0ZA 3LDLA 1HR0K 1VQLN 2I5JA 4CJFA 3DLGA 1HPZA 2X6NA 5AFUH 2QK9A 3SPZA 3C7NA 4JI0K 3NE6A 4IOCL 3HL8A 1IO2A 1RFQA 4FM0A 3TTCA 2OPPA 1X1PA 4AHCA 2D0OA 3TTDA 3M8RA 3TAMA 1NGGA 1OH6A 4Z4IA 1L3TA 3ULDA 5AQPA 2W6LA 3HZ6A 2OANA 1A5VA 5E26A 4FLUA 1YHQN 3TAEA 3WXIA 1T7PA 3W0LA 2QWRA 5HRSA 4FM1A 1BHLA 2P1JA 2P9IB 5DK5A 4IEIA 4B8AB 5KPRA 3CXCM 1KCFA 4E1JA 1ZBIA 4AQYK 1BDGA 1IKVA 5AZIB 3O3FA 3SBGA 4FLVA 1SS6A 4CERA 5EX5A 2RN2A 4DCHA 4C8LA 3THXB 3M5RA 1K8KB 4H03B 4JN4A 2P9KB 3MX2A 4FJGA 3H6EA 4NCAA 1VQNN 1VQPN 1HJOA 5AQVA 1HQUA 3O9QA 4CJEA 4L8RB 1D8YA 1GLBG 4DTMA 1WSFA 2XRIA 3NGYA 1T05A 2HW3A 5BRHA 3NHGA 4F8RA 4CZIA 2VCPA 2AJQA 1S1XA 4B9NA 4OJRA 2IVPA 4B1YB 1HJRA 4M3TA 4CJWA 5FPEA 3LAMA 2G8KA 3VQ9A 2OTJN 2W41A 1W2BM 2P9IA 4DG1A 3M8QA 3TTFA 2G8FA 3DLHA 3N4QA 4JRQA 4GW6A 5BREA 1NK0A 3HOSA 2OPRA 3THXA 4DS4A 1K8KA 4IO9L 2P9KA 3CCEN 3M3ZA 1XNQK 3CYMA 3HOTA 1BWFO 3HM9A 1X3NA 5HRNA 4RW8A 3VQ5A 1GOCA 1KTQA 3KLGA 3FZHA 3ASMA 3IFRA 5TKWA 2UUCK 4B3SK 3M8PA 3CCVN 4JNEA 4FWOA 3UKRB 5GAEP 1Q81O 1NK5A 2W42A 3O9TA 4W5RA 3VQAA 3SI6A 2B6AA 4I9QA 4HCCA 3UIQA 1A5WA 2XY8A 1IG8A 1TVRA 3PO5A 2LSNA 5K14A 2Q1NA 4DTRA 1NK9A 3LP2A 3BUZB 4IDHA 1HYZA 5HRPA 4IJNA 1NGIA 3C65A 3AA5X 2DFFA 1IKWA 4DTPA 4M3RA 3PX0A 3SMSA 2IGIA 3ZSYA 2FBYA 2QXLA 4RW7A 3TPQA 3H1QA 5SWMA 2Y1IA 3GG4A 5AQYA 1TKXA 2QA4N 3KK3A 3QICA 3U9ZA 5FPMA 1RBSA 5IT9O 5EXWA 2VQEK 1YTAA 4L3QA 2VYPA 4BRNA 5FLXO 3NF8A 3NH1A 4CIEA 3CHWA 4WFBL 3KK7A 2KKZA 2PBDA 3RVCA 1XMQK 4BRLA 3CJ7A 1Q9YA 2ZQBA 3CJAA 4E1NA 5B8HA 1NKBA 1L3UA 2WUSA 3DM2A 4FVMA 3VMFB 3MXJA 1I39A 1OKJA 4CGIA 1S9EA 3DLRA 4CHPA 1JLQA 5JMVA 1NOYA 3HK2A 3KWIA 2HHSA 1C0MA 2HBLA 2FBXA 3AAPA 3NAEA 3E9PA 4Z4CA 1YJ9N 2E88A 1J53A 3TR8A 3VQ4A 1TKTA 2P9NB 2OPQA 1RT6A 2EX3A 3KK1A 1S5JA 4O4GA 4KTQA 3LM2A 3AO4A 4GV9A 4H0OA 2Q36A 4BQZA 4HCBA 4DTSA 3P4IA 3OYJA 1YUWA 5J2QA 2O8CB 4CJKA 5CZ1A 1IKYA 1JJ2M 4DR4K 1NGJA 2HHUA 1Z25A 3QFUA 4JLHA 4HVJA 4RW6A 1NGEA 3CCRN 1ATNA 1I94K 3ZLJA 4JHDB 3D0PA 2D0PA 3VGMA 4Z4GA 4K0KK 4FWSA 4C8MA 5M1NA 2UXDK 5AJ3K 3O08A 5M1QA 2Q2RA 4MLHA 4R5PA 1LW2A 1XNRK 4LC9B 2R7YA 2HHTA 3F9KA 3W3DA 3EE9A 3T7ZA 4A62A 2Q0RA 1HRHA 3DLLL 4GVMA 3CIPA 1IBLK 4FK2A 4PL7A 3PX4A 4DWIA 4PKHA 2UYTA 3AGRA 3CMAN 5AQXA 1T03A 2OTLN 4JD2B 4XH4A 4YOWA 1NGDA 5KGWA 1QHTA 4F2RA 4JV5K 3EKSA 4LF6K 3QINA 1GLFO 3CJ1A 1WSIA 2O8CA 3A5MC 3LPUA 1OVYA 1ZBLA 4FWQA 3LZJA 1WBBA 3LM9A 1K6YA 1QTMA 4DV4K 2O8FA 5LJVA 4H5NA 1XI1A 3SZ2A 3U9DA 4CEQA 1W97L 1CXQA 4MO5A 1IV0A 4CEBA 3FE1A 2KQ2A 3V9UA 1N8RO 2E20A 4FWPA 4PKGA 1E4FT 2Q97A 3OYAA 4BRMA 3G4SN 3OS2A 4JKDA 4AH9A 3F5TA 4KH6A 1VRTA 1WSJA 3DRPA 2VWKA 1KVCA 1FKOA 1MA9B 1IKXA 1VSMA 3S3NA 4KO0A 2X6SA 2O8BB 1NGFA 4KREA 2Z1GA 4YOUA 2QTDA 1RBVA 3NCIA 1BI4B 1YI2N 4ELUA 2O8EB 4O8UA 4KTWA 5AQZA 1RDCA 1SL0A 1GLLO 3K59A 5HROA 3KD1E 1L3VA 3A8YA 2ASOA 2HSTA 4NLBA 3KLHA 1N5YA 1BU6O 1P8ZA 3I33A 4BRHA 1Y64A 2B4JA 2F9WA 1IH7A 4H0YB 3UKUA 3SJHA 3BP8A 3VF4A 4YOVA 4DU3A 4CJQA 2GTDA 1SKRA 1RGIA 4FOEA 3EZ5A 3ZETB 4DV5K 3WEEB 3OA9A 4AILC 5C25A 4UQGA 2A6AA 4CJ5A 3QEXA 5AQQA 5FROA 1RTJA 4DR7K 2F96A 3QMLA 3GDQA 3O9SA 2HBJA 1K73O 3HYFA 4FJKA 4N47A 5AQWA 2O8EA 3ITHA 4NYNA 1C6VA 1KAZA 1Z26A 5M1PA 3KLIA 1UWBA 2O8DA 3F9MA 4CHNA 4K25A 3BF3A 3VQEA 2EHGA 3AVCA 3JYTA 1B9DA 3O1WA 4M45A 2F9TA 4DR1K 5LMUK 3CQYA 2ASMA 2O4GA 4A61A 2ZE2A 4DR2K 3S41A 2VGNA 4E19A 3THWB 2HHHK 2HB5A 3C6TA 1FK9A 1RTDA 1U47A 2P5GA 3J7AP 3SCXA 4B9MA 3ID8A 4B08A 1RBUA 3ZETA 4CFAA 1RDDA 5E41A 1NMNA 2ATQA 4WYBA 4CJ3A 2QWOA 4WQ5C 3HP9A 3VTHA 3SQ0A 4ILGB 4DV2K 4OKJA 2QWLA 2V7ZA 3AGKA 4WFNL 3VQQA 2G8WA 4ISGA 3GE1A 5AQSA 1ZBUA 3VPZA 2ZJPL 3OYKA 4O0IA 3K5OA 3B6PA 4JS5A 3ZCMA 2QW9A 1Q9XA 2YKNA 1B92A 3ZX3A 2GWKA 4B9LA 4CHZA 1S1TA 1VSKA 4BG9A 3L2VA 5AFUA 1KQSM 3SLCA 4O5FA 3DJCA 5JVHL 5CE3A 3SV4A 1BIUA 5KGXA 4OPJA 3VEXA 2DFHA 1QSSA 4OKEA 4M3UA 1VSHA 4OKKA 2J4RA 4O44A 4BVOA 1GLCG 3LP3A 3G10A 3WQUA 3LANA 3M1FA 3DMJA 3V4IA 3VETA 4FJ9A 4KB0A 1JLGA 3P5JA 4DSJA 3MEDA 3J80O 2QWQA 5AQMA 2HBKA 1NBWA 1VAZA 1ZYQA 3OYHA 1J6ZA 1QQNA 3BY5A 5JLHA 1LWCA 4B9QA 3C6UA 4ICLA 1JCFA 1YVNA 4HWIA 1GOBA 1DGKN 2A1SA 3TI0A 1TK8A 4YHHK 4QAGA 2NRWA 3SV3A 3NFAA 1SAZA 2BGGA 4CJVA 4FJ7A 3OJUA 1F21A 1VQ7N 4PWDA 4BC3A 4M41A 3HVRA 2D0AA 3NDKA 3P1GA 1G99A 2I7NA 3BGRA 2VWBA 4CE9A 4U67L 3U3YA 1WB9A 1CLQA 1S9GA 2JGUA 3KD5E 1WSGA 4DFKA 3TARA 2KZMA 1SUQA 1QE1A 5FPNA 2UU9K 3KKSA 2BH1A 3CC7N 2A5XA 5KQDA 1NJYA 3R1XA 4DU4A 4DKWA 4YDUC 3TSUA 3SUOA 3QEPA 4JK8A 3HT3A 2HMPA 4IOAL 1DEJA 3CCMN 3KHYA 3ZEUB 3LDNA 3KJVA 3OS0A 1MWKA 2GX9A 3KWGA 2IVNA 4CZEA 3E01A 4NXNK 1XUPO 5JS1A 1YTUA 2NRHA 4FLWA 1BA0A 2UXCK 3CJCA 3G71N 4A57A 3F2KA 4BRIA 2VQFK 5JICA 4ELVA 3ZSZA 5BR9A 2E8AA 4ISFA 3HSCA 4NCGA 4FLXA 3CD6N 1WSEA 3LAKA 5M1FA 1EETA 1NKEA 2A40A 3QBXA 5M1OA 1T8EA 4IXCA 2HBMA 4JI5K 3NF6A 4HUEA 3ZSWA 3QDKA 3SMPA 3VQ6A 3L0QA 2ASPA 4B9TA 3VQDA 4JYAK 1B9FA 4NXMK 3K9KA 4JI8K 1NU0A 4JKAA 1HNZK 4ILHA 3H08A 1JLBA 1Q18A 1KXPA 3BEXA 4IO8A 4O0JA 3D2FB 4IBNA 3L2QA 5FPDA 2A42A 3E1YA 3PSFA 4JEPA 4KV8A 5LMNK 3MXIA 2E2NA 3CERA 3VEYA 3R3LA 1KFDA 3HI0A 5J2MA 2E5LK 2BUPA 2IDOA 4H5RA 1BO5O 4X66K 1QVFM 3VQBA 3V1OA 5IWAK 1NJXA 4YOXA 4BRGA 1KAXA 3D6RA 1HMVA 1ZC6A 1NWKA 4FLYA 4FW1A 4CZJA 1L5UA 3HPGA 1YIJN 3SJJA 4CJUA 3IRXA 5KRTA 3AVIA 4H0VB 3ZSRA 2HHWA 2NRTA 4HTUA 3UE5A 3ZSVA 1SKWA 3D2FA 4CZFA 4AHUA 4AHTA 1NGBA 3FZLA 3MWPA 4JKHA 3EEQA 1ZXOA 1T6DA 1GLEG 3SQ4A 4BR4A 2OZSA 4BRPA 1NMDA 4R79A 4GKJK 4KHNA 5AZIA 4YORA 1N32K 3AVHA 4BY9C 1C1AA 2FF6A 3CM5A 3FR0A 4IEEA 4BR5A 4ZTJA 3QO9A 4EZ9A 4J2AA 3MEEA 2PFUA 3RMCA 4KKOA 1BG3A 3G25A 1RT1A 3K2PA 4CK3A 1HX1A 3MCAB 5AQNA 1P90A 3WXLA 2RPIA 3FFIA 4K42A 2E1ZA 4FJ8A 1YJNN 1EXQA 1KAYA 1CZ9A 1WN7A 1VSDA 3JXUA 4IKFA 1X9MA 4JS4A 3AA3A 2Q3SA 5T7BA 4H8KA 5CR4A 4B3RK 2QKKA 4DQPA 2YHXA 1OH7A 4BREA 4BROA 2CH5A 4HTLA 4DV1K 4H0PA 4WQ4A 3KZBA 4YOYA 3U3GA 3JSMA 3K58A 4FW2A 1VRUA 4A2BA 2FSJA 1C0GA 1YT3A
chains in the Genus database with same CATH topology
1W0HA 1A5XA 3LZJA 4CF9A 1K6YA 1CXUA 3AO5A 1BGXT 4J2BA 1QTMA 2A1RA 3A2FA 5CYMA 5C24A 2DFEA 3CQ8A 4RW4A 4KHWA 3TAFA 4CHOA 4QCLA 4IFYA 2IC3A 3PUFA 3IG1A 1XI1A 4LSLA 3AVKA 3OYMA 3SZ2A 2Z1HA 4CEQA 5KRSA 2PY5A 1CXQA 3RR7A 1VSIA 4C8KA 1LAVA 3T19A 2IS3A 3ZT4A 3TANA 4CEBA 3ZSOA 2KFZA 3LP1A 4N5SA 1BQMA 1VSLA 1RT7A 1ITGA 2KQ2A 2IOCA 5HBMA 3V9UA 3RMAA 4Q0BA 4E7HA 3IS9A 3VQ8A 3I0SA 3OYAA 3OS2A 1JLFA 4CF1A 4KPYA 5DMRA 1FKPA 2VG7A 4I2QA 4AH9A 3L8BA 3V9XA 1VRTA 4MQ3A 4FYDA 4DF4A 1WSJA 3M8SA 1S6QA 3DRPA 4I7FA 2VWKA 4OLAA 3PX6A 4FM2A 1KVCA 4DMNA 1NK8A 1KLMA 1FKOA 1S1VA 4FJNA 1LAWA 4E7LA 1IKXA 5JS2A 1VSMA 1TL1A 3OYBA 3S3NA 2HVHA 4KO0A 2X6SA 3ZT0A 4CFBA 4KREA 5FRNA 2Z1GA 1VSEA 4HUFA 4F4KA 2YHBA 1RBVA 1I3AA 4IG3A 3NCIA 4PQUA 1BI4B 4KHSA 4ELUA 2WONA 1SL1A 3HP6A 3AVMA 4KTWA 1QQCA 1UA1A 4W5TA 1RDCA 1NOZA 3OYFA 1SL0A 3K5MA 3K59A 5HROA 1QS4A 4RW9A 3D45A 2KFNA 3KD1E 4FJJA 4K8ZA 1L3VA 4KI4A 4BDPA 3KLHA 4ID5A 4BWMA 4O5BA 1N5YA 3HXMA 3P83D 4OGEA 3AVAA 1WSHA 3CG7A 3AA2A 1JL2A 1SV5A 2B4JA 1IH7A 3NGZA 3KIOA 2YV0X 5KI6A 1RTIA 4CCHA 2XHBA 3THVA 4PY5A 1DTQA 4LH4A 1BL3A 4DU3A 2VWJA 2QKBA 4CJQA 4QOZB 4ZHRA 1SKRA 4M3WA 4BACA 2Z1IA 1D9FA 3EZ5A 4F2SA 1UA0A 4N41A 5J2NA 2X74A 3SYZA 1HYVA 4IFVA 4AILC 3WNGA 3QIOA 5C25A 4UQGA 4Z4EA 3DRRA 4CJ5A 3NH2A 3OJSA 3T3FA 1U04A 3QEXA 5FROA 1GOAA 4ELTA 1RTJA 4AHVA 2F96A 1DLOA 3EY1A 1RDBA 4ID1A 3F73A 4PA1A 4KTZA 3AO2A 3HYFA 1YVUA 4FJKA 4N47A 3K5LA 4CJRA 4DTJA 2X78A 3ITHA 1LW0A 4CGHA 3AVLA 3OYIA 1RDAA 3AVFA 4DTXA 2HHQA 3AVBA 4DF8A 3V81A 1RBTA 4NYNA 3QIPA 4J2EA 1C6VA 1Z26A 3DOLA 2E6LA 1J9AA 3I0RA 2HHVA 1HQEA 1EKEA 2D5RA 1UWBA 3KLIA 4B8CA 3KLEA 2PYLA 4M42A 2FC0A 3ZSQA 3MAQA 4DU1A 3WNHA 4CHNA 4FJMA 3VQEA 2EHGA 3AVCA 3JYTA 3QLHA 1B9DA 3B6OA 3DI6A 1BISA 3MEGA 4M45A 4CEDA 3SUNA 1NJWA 2PYJA 1TAUA 3TAQA 3U6FA 4DQRA 3V9SA 3SUQA 2OYQA 2F8SA 3TAGA 2YNHA 3VQPA 2O4GA 3V9ZA 2ZE2A 4KHQA 4CHQA 4G1QA 1JXEA 4E19A 4E89A 1NK4A 4E0DA 2HB5A 4LD0A 4CJSA 3C6TA 1FK9A 3L2WA 1U47A 2VG6A 1RTDA 2P5GA 2B5JA 3DYAA 3SCXA 3QEWA 4B08A 4LSNA 4N56A 1XHZA 4B9MA 1RBUA 4EP4A 4CFAA 1RDDA 5E41A 4OPKA 3AO3A 3S3MA 4FK4A 2FBTA 1S6PA 2ATQA 3OYDA 3BDPA 2YNFA 1VSJA 4CJ3A 4BDYA 1RT3A 3CFOA 4M3ZA 4CJ4A 4IDKA 4CGJA 2NUBA 3HP9A 4FZYA 4FJ5A 1VSFA 4M3YA 3S9HA 5I42A 3SQ0A 1BQNA 4OKJA 1S1UA 3VQQA 4CHYA 2G8WA 5HP1A 5D3GA 2HNYA 1ZBUA 1Q8IA 2ZD1A 5KTQA 3OYKA 4DFMA 1ZBFA 4O0IA 3HSTB 3K5OA 1D5AA 3B6PA 4CGDA 4BE1A 4JS5A 3PY8A 4CK1A 1ASWA 4CEEA 3OVNA 4Z0UA 3OY9A 1HNVA 3G0ZA 2GBZA 4RG8A 3ZCMA 3VA3A 2I5JA 1RBRA 4LH5A 1Q9XA 4CJFA 3DLGA 2YKNA 1B92A 1HPZA 3AVGA 2X6NA 3QERA 2P5OA 4B9LA 2QK9A 3SPZA 4C8NA 4CHZA 3KK2A 3O4NA 4CGGA 1S1TA 3NE6A 1VSKA 4CEAA 3L2VA 4CFCA 1J5OA 4BDZA 3HL8A 1IO2A 4FM0A 3ZSXA 2OPPA 1LWEA 3SV4A 1BIUA 5KGXA 1X1PA 1TV6A 2O4IA 4OPJA 3DOKA 2DFHA 4AHCA 1QSSA 3M8RA 3TAMA 4OKEA 4FJIA 4Z4IA 4M3UA 1UAXA 1ASUA 1JXBA 3ULDA 1L3TA 4FXDA 1TAQA 3SUPA 1UOCA 4FLZA 3S3OA 1VSHA 4DSEA 4OKKA 1A5VA 4CGFA 4CESA 4O44A 4FLUA 3TAEA 1T7PA 3LP3A 3G10A 4FJHA 3LANA 4MFBA 1R0AA 3O3HA 3DMJA 3V4IA 5HRSA 4FM1A 1RNHA 3RMBA 1BHLA 1FXXA 2P1JA 4FJ9A 4CF0A 1BCOA 5DK5A 2XY6A 4M3XA 3V1QA 4B8AB 4BWJA 1KCFA 4DFJA 1ZBIA 4KB0A 1JLGA 1IKVA 3P5JA 2G8HA 4DSJA 1RCHA 4DQIA 4B3OA 3O3FA 3MEDA 4NCBA 2DTUA 1QSYA 2WOMA 4Q5VA 4FLVA 1ZYQA 2HNDA 4CERA 2RN2A 3OYHA 3RMDA 4C8LA 3HJFA 4KRFA 3HO1A 4W5NA 1JL1A 1LWCA 4FJGA 3EYZA 3C6UA 4ICLA 4NCAA 3HPHA 1XHXA 1GOBA 2G8VA 2OZMA 1HQUA 4CJPA 2A1SA 3TI0A 1SL2A 1TK5A 1TK8A 4CJEA 3ALYA 4IG0A 4QAGA 3HPOA 1D8YA 4L8RB 1HNIA 3SV3A 4DTMA 3NFAA 3RRHA 1WSFA 2XRIA 1EX4A 3NGYA 2BGGA 1RT5A 1XWLA 1SKSA 1CZBA 1MU2A 4CJVA 1NJZA 1T05A 3T1AA 3O4QA 1J54A 3AVJA 3CFRA 4FJ7A 3OJUA 2XO7A 2HW3A 1BI4A 1F21A 3NHGA 4E7JA 1TK0A 4E7KA 4F8RA 3VA0A 2AJQA 5CY4A 1S1XA 3AVNA 4PWDA 4B9NA 4OJRA 1HYSA 4M3TA 1HJRA 4I2PA 4M41A 2D0AA 4CJWA 3P1GA 3HVRA 3NDKA 3LAMA 3BGRA 3VQ9A 2G8KA 4PUOA 1RTHA 4CE9A 3U3YA 4FJXA 4CF2A 4DG1A 1CLQA 1S9GA 2JGUA 3M8QA 2G8FA 1KSPA 3KD5E 2D0CA 1WSGA 4DFKA 2JLEA 3TARA 5FDLA 3DLHA 1LV5A 3OYCA 4E3SA 4DSIA 1ZBHA 3V1RA 4YFUA 4JRQA 1X9WA 1KFSA 1SUQA 1QE1A 3DLKA 4GW6A 4JRPA 4B9SA 3VN5A 5EU7A 3C95A 2P51A 3KKSA 1WLJA 4I9LA 4Z4HA 5J2PA 3QEIA 1NK0A 1REVA 4CFDA 4YNQA 2OPRA 1KRPA 4DS4A 1NJYA 4KB1A 4DU4A 4OLBA 5I3UA 2RKIA 3SUOA 3QEPA 3OYNA 3HT3A 4F3TA 3CYMA 4DTNA 1KLNA 3HM9A 4EP5A 5HRNA 4RW8A 3VQ5A 1GOCA 3KJVA 3OS0A 1KTQA 3TWHA 3KLGA 3I8DA 4Y1CA 1TKDA 4NYFA 3ASMA 5HLFA 1ASVA 3LPTA 3E01A 3M8PA 3WNEA 3O3GA 1U48A 4CIGA 2G8UA 4KAZA 5JS1A 4H4MA 1YTUA 4DSLA 5SZTA 4FLWA 1BIZA 1D9DA 2E6MA 2FBVA 1NK5A 3ZT2A 3OS1A 2W42A 4DLEA 4W5RA 4AHSA 3VQAA 3L3VA 3SI6A 1N6QA 2HNZA 4KHYA 2B6AA 4ELVA 4I9QA 4DLGA 3ZSZA 3UIQA 4HCCA 1A5WA 4E1MA 2XY8A 4NCGA 1TL3A 4FLXA 1TVRA 1VK0A 2YNIA 1WSEA 3PO5A 2LSNA 3LAKA 1C0UA 4HUGA 5K14A 1EETA 3QNNA 5HRRA 3MXMA 4DTRA 1NK9A 1NKEA 4CEOA 3ISNC 1T8EA 4C8OA 3LP2A 4KI6A 1HYZA 3QNOA 1JLEA 3NF6A 4HUEA 3ZSWA 1RILA 3VQ6A 5HRPA 3NGIA 3LALA 1RT4A 4CF8A 3LZIA 1L3SA 3DLEA 3AA5X 2DFFA 3VQDA 1IKWA 4B9TA 4DTPA 3OYGA 1B9FA 4M3RA 4B9UA 3QESA 3QETA 3PX0A 4OVLA 4FK0A 2KZMA 2IGIA 3ZSYA 3LWMA 2FBYA 2BANA 3KKRA 3H08A 1JLBA 3V9WA 4RW7A 1IG9A 2KZZA 3L2UA 5SWMA 4E7IA 2Y1IA 2GUIA 3NF9A 4O0JA 1TKXA 2KTQA 3KK3A 4CECA 4IBNA 4CIFA 4DS5A 4FZZA 2Y1JA 2D0BA 3L2QA 3KLFA 1YTAA 3VQ7A 2YNGA 5J1EA 3MECA 3NF8A 3NH1A 4KV8A 3MXIA 4CIEA 4DFPA 3CM6A 4N76A 2IAJA 3NBPA 3L2RA 1TGOA 1KFDA 3ZT3A 2F8TA 1Q9YA 1JKHA 1G15A 2ZQBA 4XIUA 3K5NA 4E1NA 1WNSA 1Y97A 5J2MA 4FJLA 3RRGA 2OPSA 3NF7A 1NKBA 1L3UA 3VQCA 3DM2A 2IDOA 4FVMA 2YHAA 3DRSA 3K57A 4KHUA 3DLBA 3LP0A 3MXJA 1I39A 3VQBA 2QXFA 4CGIA 3V1OA 1S9EA 3DLRA 4CHPA 1JLQA 1JLCA 4CJTA 3TABA 1NOYA 1NJXA 3HK2A 2HHSA 4GMJB 1EP4A 1C1BA 4AHRA 1C0MA 3SQ1A 3QEVA 1U4BA 2YKMA 2BDPA 2FBXA 2KW4A 3NAEA 1NK6A 1HMVA 4Z4CA 3WNFA 3LWLA 5CZ2A 4FLYA 3IAYA 1NKCA 4B9VA 4H4OA 1J53A 4FW1A 1L5UA 3KTQA 3TR8A 4FCYA 3HPGA 3VQ4A 3RR8A 4WE1A 4FLTA 4CK2A 1TKTA 3SJJA 2ETJA 4CJUA 3OYEA 3IRXA 1LWFA 1RT6A 2OPQA 4DTUA 2EX3A 5KRTA 1DTTA 3KK1A 1S5JA 3AV9A 4O4GA 3PV8A 3AVIA 1WAJA 3ZSRA 1U49A 4KTQA 3C94A 3AO4A 4HTUA 2HHWA 4DQSA 3ZSVA 1SKWA 1WAFA 1NK7A 4BE0A 4AHUA 4HCBA 4AHTA 4DTSA 1JLAA 3L3UA 3OYJA 5J2QA 4K8XA 4CJKA 5CZ1A 4DSKA 1IKYA 3V6DA 3NH0A 1X9SA 2XY5A 4BE2A 3SQ4A 3LDSA 1Z25A 2OZSA 4EZ6A 4DTOA 2HHUA 4JLHA 4KHNA 4DQQA 2VG5A 4HVJA 4Y1DA 4RW6A 2Z1JA 3AVHA 1C1AA 3CM5A 4ZTJA 4J2AA 4EZ9A 3QO9A 4DSFA 3D0PA 3MEEA 2RF2A 2HMIA 4O55A 4OGCA 4Z4GA 4C8MA 3RMCA 4KKOA 4W5QA 3AA4A 1RT1A 1BCMA 3K2PA 4CK3A 5C42A 3OYLA 2GV9A 3RWUA 4R5PA 2RPIA 3FFIA 1LW2A 4LY7A 3ZT1A 4F3OA 3SQ2A 4FJ8A 2R7YA 2HHTA 1EXQA 3SPYA 3F9KA 4ZTFA 1CZ9A 4CEZA 2OA8A 2HHXA 1WN7A 5CYQA 2HVIA 1VSDA 1HRHA 4CJLA 4CEFA 4GVMA 4HHTA 2E4LA 3TAPA 1X9MA 2PZSA 1RT2A 4JS4A 4IKFA 3AA3A 2Q3SA 3HVTA 5T7BA 4FK2A 3PX4A 4DWIA 4H8KA 4KFBA 4Z4FA 1C1CA 2QKKA 1QSLA 4DQPA 2G8IA 1T03A 4W5OA 2DY4A 1XC9A 1KVAA 3AO1A 3PO4A 5KGWA 1QHTA 3RTVA 4F2RA 4FZXC 2XY7A 1O1WA 2ITGA 3QINA 1S1WA 4TSXA 3U3GA 3JSMA 3K58A 4FW2A 3CFPA 1WSIA 1VRUA 5FRMA 3LPUA 4J2DA 1KVBA 1ZBLA 2BE2A 1C0TA 1TKZA 1W9HA 3SNNA 1U45A 1RBSA 1YT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W0H A;  1A5X A;  3LZJ A;  4CF9 A;  1K6Y A;  1CXU A;  3AO5 A;  1BGX T;  4J2B A;  1QTM A;  2A1R A;  3A2F A;  5CYM A;  5C24 A;  2DFE A;  3CQ8 A;  4RW4 A;  4KHW A;  3TAF A;  4CHO A;  4QCL A;  4IFY A;  2IC3 A;  3PUF A;  3IG1 A;  1XI1 A;  4LSL A;  3AVK A;  3OYM A;  3SZ2 A;  2Z1H A;  4CEQ A;  5KRS A;  2PY5 A;  1CXQ A;  3RR7 A;  1VSI A;  4C8K A;  1LAV A;  3T19 A;  2IS3 A;  3ZT4 A;  3TAN A;  4CEB A;  3ZSO A;  2KFZ A;  3LP1 A;  4N5S A;  1BQM A;  1VSL A;  1RT7 A;  1ITG A;  2KQ2 A;  2IOC A;  5HBM A;  3V9U A;  3RMA A;  4Q0B A;  4E7H A;  3IS9 A;  3VQ8 A;  3I0S A;  3OYA A;  3OS2 A;  1JLF A;  4CF1 A;  4KPY A;  5DMR A;  1FKP A;  2VG7 A;  4I2Q A;  4AH9 A;  3L8B A;  3V9X A;  1VRT A;  4MQ3 A;  4FYD A;  4DF4 A;  1WSJ A;  3M8S A;  1S6Q A;  3DRP A;  4I7F A;  2VWK A;  4OLA A;  3PX6 A;  4FM2 A;  1KVC A;  4DMN A;  1NK8 A;  1KLM A;  1FKO A;  1S1V A;  4FJN A;  1LAW A;  4E7L A;  1IKX A;  5JS2 A;  1VSM A;  1TL1 A;  3OYB A;  3S3N A;  2HVH A;  4KO0 A;  2X6S A;  3ZT0 A;  4CFB A;  4KRE A;  5FRN A;  2Z1G A;  1VSE A;  4HUF A;  4F4K A;  2YHB A;  1RBV A;  1I3A A;  4IG3 A;  3NCI A;  4PQU A;  1BI4 B;  4KHS A;  4ELU A;  2WON A;  1SL1 A;  3HP6 A;  3AVM A;  4KTW A;  1QQC A;  1UA1 A;  4W5T A;  1RDC A;  1NOZ A;  3OYF A;  1SL0 A;  3K5M A;  3K59 A;  5HRO A;  1QS4 A;  4RW9 A;  3D45 A;  2KFN A;  3KD1 E;  4FJJ A;  4K8Z A;  1L3V A;  4KI4 A;  4BDP A;  3KLH A;  4ID5 A;  4BWM A;  4O5B A;  1N5Y A;  3HXM A;  3P83 D;  4OGE A;  3AVA A;  1WSH A;  3CG7 A;  3AA2 A;  1JL2 A;  1SV5 A;  2B4J A;  1IH7 A;  3NGZ A;  3KIO A;  2YV0 X;  5KI6 A;  1RTI A;  4CCH A;  2XHB A;  3THV A;  4PY5 A;  1DTQ A;  4LH4 A;  1BL3 A;  4DU3 A;  2VWJ A;  2QKB A;  4CJQ A;  4QOZ B;  4ZHR A;  1SKR A;  4M3W A;  4BAC A;  2Z1I A;  1D9F A;  3EZ5 A;  4F2S A;  1UA0 A;  4N41 A;  5J2N A;  2X74 A;  3SYZ A;  1HYV A;  4IFV A;  4AIL C;  3WNG A;  3QIO A;  5C25 A;  4UQG A;  4Z4E A;  3DRR A;  4CJ5 A;  3NH2 A;  3OJS A;  3T3F A;  1U04 A;  3QEX A;  5FRO A;  1GOA A;  4ELT A;  1RTJ A;  4AHV A;  2F96 A;  1DLO A;  3EY1 A;  1RDB A;  4ID1 A;  3F73 A;  4PA1 A;  4KTZ A;  3AO2 A;  3HYF A;  1YVU A;  4FJK A;  4N47 A;  3K5L A;  4CJR A;  4DTJ A;  2X78 A;  3ITH A;  1LW0 A;  4CGH A;  3AVL A;  3OYI A;  1RDA A;  3AVF A;  4DTX A;  2HHQ A;  3AVB A;  4DF8 A;  3V81 A;  1RBT A;  4NYN A;  3QIP A;  4J2E A;  1C6V A;  1Z26 A;  3DOL A;  2E6L A;  1J9A A;  3I0R A;  2HHV A;  1HQE A;  1EKE A;  2D5R A;  1UWB A;  3KLI A;  4B8C A;  3KLE A;  2PYL A;  4M42 A;  2FC0 A;  3ZSQ A;  3MAQ A;  4DU1 A;  3WNH A;  4CHN A;  4FJM A;  3VQE A;  2EHG A;  3AVC A;  3JYT A;  3QLH A;  1B9D A;  3B6O A;  3DI6 A;  1BIS A;  3MEG A;  4M45 A;  4CED A;  3SUN A;  1NJW A;  2PYJ A;  1TAU A;  3TAQ A;  3U6F A;  4DQR A;  3V9S A;  3SUQ A;  2OYQ A;  2F8S A;  3TAG A;  2YNH A;  3VQP A;  2O4G A;  3V9Z A;  2ZE2 A;  4KHQ A;  4CHQ A;  4G1Q A;  1JXE A;  4E19 A;  4E89 A;  1NK4 A;  4E0D A;  2HB5 A;  4LD0 A;  4CJS A;  3C6T A;  1FK9 A;  3L2W A;  1U47 A;  2VG6 A;  1RTD A;  2P5G A;  2B5J A;  3DYA A;  3SCX A;  3QEW A;  4B08 A;  4LSN A;  4N56 A;  1XHZ A;  4B9M A;  1RBU A;  4EP4 A;  4CFA A;  1RDD A;  5E41 A;  4OPK A;  3AO3 A;  3S3M A;  4FK4 A;  2FBT A;  1S6P A;  2ATQ A;  3OYD A;  3BDP A;  2YNF A;  1VSJ A;  4CJ3 A;  4BDY A;  1RT3 A;  3CFO A;  4M3Z A;  4CJ4 A;  4IDK A;  4CGJ A;  2NUB A;  3HP9 A;  4FZY A;  4FJ5 A;  1VSF A;  4M3Y A;  3S9H A;  5I42 A;  3SQ0 A;  1BQN A;  4OKJ A;  1S1U A;  3VQQ A;  4CHY A;  2G8W A;  5HP1 A;  5D3G A;  2HNY A;  1ZBU A;  1Q8I A;  2ZD1 A;  5KTQ A;  3OYK A;  4DFM A;  1ZBF A;  4O0I A;  3HST B;  3K5O A;  1D5A A;  3B6P A;  4CGD A;  4BE1 A;  4JS5 A;  3PY8 A;  4CK1 A;  1ASW A;  4CEE A;  3OVN A;  4Z0U A;  3OY9 A;  1HNV A;  3G0Z A;  2GBZ A;  4RG8 A;  3ZCM A;  3VA3 A;  2I5J A;  1RBR A;  4LH5 A;  1Q9X A;  4CJF A;  3DLG A;  2YKN A;  1B92 A;  1HPZ A;  3AVG A;  2X6N A;  3QER A;  2P5O A;  4B9L A;  2QK9 A;  3SPZ A;  4C8N A;  4CHZ A;  3KK2 A;  3O4N A;  4CGG A;  1S1T A;  3NE6 A;  1VSK A;  4CEA A;  3L2V A;  4CFC A;  1J5O A;  4BDZ A;  3HL8 A;  1IO2 A;  4FM0 A;  3ZSX A;  2OPP A;  1LWE A;  3SV4 A;  1BIU A;  5KGX A;  1X1P A;  1TV6 A;  2O4I A;  4OPJ A;  3DOK A;  2DFH A;  4AHC A;  1QSS A;  3M8R A;  3TAM A;  4OKE A;  4FJI A;  4Z4I A;  4M3U A;  1UAX A;  1ASU A;  1JXB A;  3ULD A;  1L3T A;  4FXD A;  1TAQ A;  3SUP A;  1UOC A;  4FLZ A;  3S3O A;  1VSH A;  4DSE A;  4OKK A;  1A5V A;  4CGF A;  4CES A;  4O44 A;  4FLU A;  3TAE A;  1T7P A;  3LP3 A;  3G10 A;  4FJH A;  3LAN A;  4MFB A;  1R0A A;  3O3H A;  3DMJ A;  3V4I A;  5HRS A;  4FM1 A;  1RNH A;  3RMB A;  1BHL A;  1FXX A;  2P1J A;  4FJ9 A;  4CF0 A;  1BCO A;  5DK5 A;  2XY6 A;  4M3X A;  3V1Q A;  4B8A B;  4BWJ A;  1KCF A;  4DFJ A;  1ZBI A;  4KB0 A;  1JLG A;  1IKV A;  3P5J A;  2G8H A;  4DSJ A;  1RCH A;  4DQI A;  4B3O A;  3O3F A;  3MED A;  4NCB A;  2DTU A;  1QSY A;  2WOM A;  4Q5V A;  4FLV A;  1ZYQ A;  2HND A;  4CER A;  2RN2 A;  3OYH A;  3RMD A;  4C8L A;  3HJF A;  4KRF A;  3HO1 A;  4W5N A;  1JL1 A;  1LWC A;  4FJG A;  3EYZ A;  3C6U A;  4ICL A;  4NCA A;  3HPH A;  1XHX A;  1GOB A;  2G8V A;  2OZM A;  1HQU A;  4CJP A;  2A1S A;  3TI0 A;  1SL2 A;  1TK5 A;  1TK8 A;  4CJE A;  3ALY A;  4IG0 A;  4QAG A;  3HPO A;  1D8Y A;  4L8R B;  1HNI A;  3SV3 A;  4DTM A;  3NFA A;  3RRH A;  1WSF A;  2XRI A;  1EX4 A;  3NGY A;  2BGG A;  1RT5 A;  1XWL A;  1SKS A;  1CZB A;  1MU2 A;  4CJV A;  1NJZ A;  1T05 A;  3T1A A;  3O4Q A;  1J54 A;  3AVJ A;  3CFR A;  4FJ7 A;  3OJU A;  2XO7 A;  2HW3 A;  1BI4 A;  1F21 A;  3NHG A;  4E7J A;  1TK0 A;  4E7K A;  4F8R A;  3VA0 A;  2AJQ A;  5CY4 A;  1S1X A;  3AVN A;  4PWD A;  4B9N A;  4OJR A;  1HYS A;  4M3T A;  1HJR A;  4I2P A;  4M41 A;  2D0A A;  4CJW A;  3P1G A;  3HVR A;  3NDK A;  3LAM A;  3BGR A;  3VQ9 A;  2G8K A;  4PUO A;  1RTH A;  4CE9 A;  3U3Y A;  4FJX A;  4CF2 A;  4DG1 A;  1CLQ A;  1S9G A;  2JGU A;  3M8Q A;  2G8F A;  1KSP A;  3KD5 E;  2D0C A;  1WSG A;  4DFK A;  2JLE A;  3TAR A;  5FDL A;  3DLH A;  1LV5 A;  3OYC A;  4E3S A;  4DSI A;  1ZBH A;  3V1R A;  4YFU A;  4JRQ A;  1X9W A;  1KFS A;  1SUQ A;  1QE1 A;  3DLK A;  4GW6 A;  4JRP A;  4B9S A;  3VN5 A;  5EU7 A;  3C95 A;  2P51 A;  3KKS A;  1WLJ A;  4I9L A;  4Z4H A;  5J2P A;  3QEI A;  1NK0 A;  1REV A;  4CFD A;  4YNQ A;  2OPR A;  1KRP A;  4DS4 A;  1NJY A;  4KB1 A;  4DU4 A;  4OLB A;  5I3U A;  2RKI A;  3SUO A;  3QEP A;  3OYN A;  3HT3 A;  4F3T A;  3CYM A;  4DTN A;  1KLN A;  3HM9 A;  4EP5 A;  5HRN A;  4RW8 A;  3VQ5 A;  1GOC A;  3KJV A;  3OS0 A;  1KTQ A;  3TWH A;  3KLG A;  3I8D A;  4Y1C A;  1TKD A;  4NYF A;  3ASM A;  5HLF A;  1ASV A;  3LPT A;  3E01 A;  3M8P A;  3WNE A;  3O3G A;  1U48 A;  4CIG A;  2G8U A;  4KAZ A;  5JS1 A;  4H4M A;  1YTU A;  4DSL A;  5SZT A;  4FLW A;  1BIZ A;  1D9D A;  2E6M A;  2FBV A;  1NK5 A;  3ZT2 A;  3OS1 A;  2W42 A;  4DLE A;  4W5R A;  4AHS A;  3VQA A;  3L3V A;  3SI6 A;  1N6Q A;  2HNZ A;  4KHY A;  2B6A A;  4ELV A;  4I9Q A;  4DLG A;  3ZSZ A;  3UIQ A;  4HCC A;  1A5W A;  4E1M A;  2XY8 A;  4NCG A;  1TL3 A;  4FLX A;  1TVR A;  1VK0 A;  2YNI A;  1WSE A;  3PO5 A;  2LSN A;  3LAK A;  1C0U A;  4HUG A;  5K14 A;  1EET A;  3QNN A;  5HRR A;  3MXM A;  4DTR A;  1NK9 A;  1NKE A;  4CEO A;  3ISN C;  1T8E A;  4C8O A;  3LP2 A;  4KI6 A;  1HYZ A;  3QNO A;  1JLE A;  3NF6 A;  4HUE A;  3ZSW A;  1RIL A;  3VQ6 A;  5HRP A;  3NGI A;  3LAL A;  1RT4 A;  4CF8 A;  3LZI A;  1L3S A;  3DLE A;  3AA5 X;  2DFF A;  3VQD A;  1IKW A;  4B9T A;  4DTP A;  3OYG A;  1B9F A;  4M3R A;  4B9U A;  3QES A;  3QET A;  3PX0 A;  4OVL A;  4FK0 A;  2KZM A;  2IGI A;  3ZSY A;  3LWM A;  2FBY A;  2BAN A;  3KKR A;  3H08 A;  1JLB A;  3V9W A;  4RW7 A;  1IG9 A;  2KZZ A;  3L2U A;  5SWM A;  4E7I A;  2Y1I A;  2GUI A;  3NF9 A;  4O0J A;  1TKX A;  2KTQ A;  3KK3 A;  4CEC A;  4IBN A;  4CIF A;  4DS5 A;  4FZZ A;  2Y1J A;  2D0B A;  3L2Q A;  3KLF A;  1YTA A;  3VQ7 A;  2YNG A;  5J1E A;  3MEC A;  3NF8 A;  3NH1 A;  4KV8 A;  3MXI A;  4CIE A;  4DFP A;  3CM6 A;  4N76 A;  2IAJ A;  3NBP A;  3L2R A;  1TGO A;  1KFD A;  3ZT3 A;  2F8T A;  1Q9Y A;  1JKH A;  1G15 A;  2ZQB A;  4XIU A;  3K5N A;  4E1N A;  1WNS A;  1Y97 A;  5J2M A;  4FJL A;  3RRG A;  2OPS A;  3NF7 A;  1NKB A;  1L3U A;  3VQC A;  3DM2 A;  2IDO A;  4FVM A;  2YHA A;  3DRS A;  3K57 A;  4KHU A;  3DLB A;  3LP0 A;  3MXJ A;  1I39 A;  3VQB A;  2QXF A;  4CGI A;  3V1O A;  1S9E A;  3DLR A;  4CHP A;  1JLQ A;  1JLC A;  4CJT A;  3TAB A;  1NOY A;  1NJX A;  3HK2 A;  2HHS A;  4GMJ B;  1EP4 A;  1C1B A;  4AHR A;  1C0M A;  3SQ1 A;  3QEV A;  1U4B A;  2YKM A;  2BDP A;  2FBX A;  2KW4 A;  3NAE A;  1NK6 A;  1HMV A;  4Z4C A;  3WNF A;  3LWL A;  5CZ2 A;  4FLY A;  3IAY A;  1NKC A;  4B9V A;  4H4O A;  1J53 A;  4FW1 A;  1L5U A;  3KTQ A;  3TR8 A;  4FCY A;  3HPG A;  3VQ4 A;  3RR8 A;  4WE1 A;  4FLT A;  4CK2 A;  1TKT A;  3SJJ A;  2ETJ A;  4CJU A;  3OYE A;  3IRX A;  1LWF A;  1RT6 A;  2OPQ A;  4DTU A;  2EX3 A;  5KRT A;  1DTT A;  3KK1 A;  1S5J A;  3AV9 A;  4O4G A;  3PV8 A;  3AVI A;  1WAJ A;  3ZSR A;  1U49 A;  4KTQ A;  3C94 A;  3AO4 A;  4HTU A;  2HHW A;  4DQS A;  3ZSV A;  1SKW A;  1WAF A;  1NK7 A;  4BE0 A;  4AHU A;  4HCB A;  4AHT A;  4DTS A;  1JLA A;  3L3U A;  3OYJ A;  5J2Q A;  4K8X A;  4CJK A;  5CZ1 A;  4DSK A;  1IKY A;  3V6D A;  3NH0 A;  1X9S A;  2XY5 A;  4BE2 A;  3SQ4 A;  3LDS A;  1Z25 A;  2OZS A;  4EZ6 A;  4DTO A;  2HHU A;  4JLH A;  4KHN A;  4DQQ A;  2VG5 A;  4HVJ A;  4Y1D A;  4RW6 A;  2Z1J A;  3AVH A;  1C1A A;  3CM5 A;  4ZTJ A;  4J2A A;  4EZ9 A;  3QO9 A;  4DSF A;  3D0P A;  3MEE A;  2RF2 A;  2HMI A;  4O55 A;  4OGC A;  4Z4G A;  4C8M A;  3RMC A;  4KKO A;  4W5Q A;  3AA4 A;  1RT1 A;  1BCM A;  3K2P A;  4CK3 A;  5C42 A;  3OYL A;  2GV9 A;  3RWU A;  4R5P A;  2RPI A;  3FFI A;  1LW2 A;  4LY7 A;  3ZT1 A;  4F3O A;  3SQ2 A;  4FJ8 A;  2R7Y A;  2HHT A;  1EXQ A;  3SPY A;  3F9K A;  4ZTF A;  1CZ9 A;  4CEZ A;  2OA8 A;  2HHX A;  1WN7 A;  5CYQ A;  2HVI A;  1VSD A;  1HRH A;  4CJL A;  4CEF A;  4GVM A;  4HHT A;  2E4L A;  3TAP A;  1X9M A;  2PZS A;  1RT2 A;  4JS4 A;  4IKF A;  3AA3 A;  2Q3S A;  3HVT A;  5T7B A;  4FK2 A;  3PX4 A;  4DWI A;  4H8K A;  4KFB A;  4Z4F A;  1C1C A;  2QKK A;  1QSL A;  4DQP A;  2G8I A;  1T03 A;  4W5O A;  2DY4 A;  1XC9 A;  1KVA A;  3AO1 A;  3PO4 A;  5KGW A;  1QHT A;  3RTV A;  4F2R A;  4FZX C;  2XY7 A;  1O1W A;  2ITG A;  3QIN A;  1S1W A;  4TSX A;  3U3G A;  3JSM A;  3K58 A;  4FW2 A;  3CFP A;  1WSI A;  1VRU A;  5FRM A;  3LPU A;  4J2D A;  1KVB A;  1ZBL A;  2BE2 A;  1C0T A;  1TKZ A;  1W9H A;  3SNN A;  1U45 A;  1RBS A;  1YT3 A; 
#chains in the Genus database with same CATH topology
 1DKG D;  3TU5 A;  1WUA A;  3A2F A;  5C24 A;  4CJ7 A;  4RW4 A;  3CQ8 A;  5BR8 K;  2IC3 A;  1CZA N;  3IG1 A;  4LSL A;  1VHX A;  2YI1 A;  1LAV A;  3T19 A;  2IS3 A;  3ZT4 A;  4A5A A;  4E3S A;  3L4I A;  1VSL A;  1ITG A;  2IOC A;  4E7H A;  3IS9 A;  3VQ8 A;  4I2Q A;  4DQ8 A;  2HF4 A;  3UKR A;  3HBT A;  3O5B A;  4U7B A;  4NO7 A;  4DF4 A;  1RDW X;  4I7F A;  1TUY A;  4DMN A;  4FM2 A;  1KLM A;  4FJN A;  3SAG A;  3L6Q A;  2JWK A;  3CET A;  3OYB A;  5FRN A;  1VSE A;  1ATS A;  4JKE A;  4PQU A;  1NM1 A;  4B1U B;  1SL1 A;  3Q7C A;  3GOI A;  3OYF A;  4H0T B;  5BPM A;  1NLV A;  1QS4 A;  4JI3 K;  4EHT A;  4KI4 A;  4KHP K;  3EL2 A;  4ID5 A;  3HXM A;  3AVA A;  2NRR A;  3AA2 A;  3CPE A;  1SV5 A;  3R8E A;  2W40 A;  3NGZ A;  1BA1 A;  1R59 O;  3MK6 A;  1RTI A;  4CCH A;  4FPA A;  3N4P A;  3THV A;  4OX9 K;  3ULE B;  4CZK A;  4BC4 A;  3WXM B;  1FW6 A;  3Q7B A;  3P31 A;  2GEL A;  1D9F A;  3ATU A;  2FSK A;  2X74 A;  4DV0 K;  3SYZ A;  4IFV A;  3VTI A;  2CGL A;  4Y0W A;  3VEZ A;  3NH2 A;  3OJS A;  1U04 A;  1ATR A;  4ELT A;  4AHV A;  2ZJQ L;  1DLO A;  3JAM O;  4V19 S;  4PA1 A;  4KTZ A;  4CJR A;  4DTJ A;  3B8A X;  4EFH A;  3RSE B;  3OYI A;  3AVL A;  3LL3 A;  3AVF A;  1LOT B;  3AVB A;  3DOL A;  4GNI A;  1J9A A;  1HQE A;  4IOX A;  3OTO K;  5AR0 A;  4AF1 A;  4M42 A;  4DU1 A;  2E2P A;  2EWS A;  3EZW A;  3H45 C;  4FJM A;  3B6O A;  1BIS A;  3SUN A;  1TAU A;  3U6F A;  4DQR A;  3V9S A;  2P9N A;  3FFK B;  3V9Z A;  2F8S A;  2WTU A;  4BQL A;  4BC2 A;  3WQT A;  4KHQ A;  4KBO A;  3C6H A;  4G1Q A;  3ULE A;  1JXE A;  4AM6 A;  2YJE A;  4JK9 A;  5GIO A;  1IBM K;  2VG6 A;  5C2D A;  2B5J A;  3EKU A;  4LSN A;  5DM6 L;  4NB4 A;  4H5V A;  4EP4 A;  4JAX A;  3OYD A;  3BDP A;  1VSJ A;  3J7Z O;  3C0B A;  4JHD A;  5KPT A;  5I42 A;  1BQN A;  1VQO N;  1X9J A;  5HP1 A;  5D3G A;  2HNY A;  1Q8I A;  3FLC O;  4DV3 K;  4BR9 A;  1ZBF A;  1D4X A;  2YCH A;  3HST B;  1D5A A;  4WCE L;  3DAW A;  3PY8 A;  4CK1 A;  4Z0U A;  3QER A;  4F9O A;  4BRD A;  3KK2 A;  5AQI A;  4CEA A;  1J5O A;  4BDZ A;  4JD2 A;  2P9L B;  3ZSX A;  4X65 K;  1LWE A;  3OBY A;  4BR7 A;  3THY B;  1TV6 A;  2O4I A;  3BZK A;  1UAX A;  4H0X B;  1JXB A;  3SUP A;  4FLZ A;  4DSE A;  4CGF A;  4CES A;  4FJH A;  4CD1 A;  3MX5 A;  4MFB A;  3O3H A;  3RMB A;  1FXX A;  3U8X A;  3I56 N;  1BCO A;  3G6E N;  2YJF A;  4M3X A;  3V1Q A;  4BWJ A;  2NZT A;  4DFJ A;  3H46 O;  2G8H A;  4B3O A;  1OH8 A;  1QSY A;  2WOM A;  4Q5V A;  4OO1 J;  2NRX A;  3ENB A;  2OCE A;  3RMD A;  3HJF A;  3PIO L;  4W5N A;  3EYZ A;  2ZJR L;  1E4G T;  3HPH A;  4BGB A;  2FF3 B;  2V51 B;  4DV6 K;  5MLC Q;  4CJP A;  2WFB A;  3GL1 A;  2P9L A;  3HPO A;  1HNI A;  1S22 A;  3THY A;  4IFE A;  2E2O A;  1RT5 A;  5EVZ A;  4QS9 A;  2O8B A;  3CF5 L;  5ELZ A;  3T1A A;  1J54 A;  3AVJ A;  4CBU A;  3CFR A;  2XO7 A;  1BI4 A;  3VA0 A;  5CY4 A;  3AVN A;  4I2P A;  3MWT A;  4FWM A;  4PUO A;  1OVQ A;  2P9P B;  1RTH A;  3PIP L;  3A5L C;  1KSP A;  2D0C A;  4Z94 A;  3FZM A;  5FDL A;  1ZBH A;  1LV5 A;  3OYC A;  3V1R A;  4X64 K;  4JRP A;  4Z4H A;  5EU7 A;  3C95 A;  2P51 A;  4CFD A;  1KRP A;  3VGK A;  4KB1 A;  5I3U A;  2RKI A;  1XC3 A;  3OYN A;  4M63 C;  4C1N K;  3U4L A;  3TWH A;  4PHT X;  3I8D A;  4NYF A;  1ZBS A;  3WEE A;  4A2A A;  1QZ6 A;  1HLU A;  3WNE A;  3O3G A;  2G8U A;  4ILJ A;  4DSL A;  5SZT A;  2E6M A;  3ZT2 A;  4OPA A;  3VEW A;  4AHS A;  3L3V A;  3CC2 N;  2HNZ A;  4E1M A;  2UUA K;  2P9P A;  3NVM A;  4J2E A;  4DR5 K;  3MXM A;  1H1V A;  4XEI A;  2Q31 A;  2ZM6 K;  3ISN C;  4IZ9 A;  4GY2 B;  4C8O A;  3VEN A;  3WUH A;  3OBW A;  3QNO A;  1JLE A;  2W6K A;  4JI7 K;  1RIL A;  3LAL A;  1RT4 A;  4CF8 A;  3LZI A;  3IUC A;  1L3S A;  4RCH A;  3THW A;  1M1K O;  2QWP A;  3QES A;  3OW2 M;  3QET A;  4FWR A;  4OVL A;  4FK0 A;  5AZJ B;  2F7T A;  4LFA K;  3LWM A;  1S72 N;  1Z05 A;  2BAN A;  2KZZ A;  5AQG A;  3L2U A;  4E7I A;  2GUI A;  3NF9 A;  2KTQ A;  1VQ9 N;  3D7E O;  4DS5 A;  4MO4 A;  4FZZ A;  2Y1J A;  2D0B A;  3WXJ A;  3VQ7 A;  2YNG A;  5M1K A;  3MEC A;  3HM8 A;  4JKC A;  2P9S B;  4N76 A;  4GVE A;  1WNS A;  4FJL A;  4EHU A;  3O1B A;  3RRG A;  2OPS A;  3NF7 A;  4KHU A;  2YHA A;  4M7X A;  3LP0 A;  4G9Z A;  5ADX H;  2E1Y A;  2QXF A;  3TAB A;  3ID6 A;  2KLA A;  4QS8 A;  3QEV A;  1EWQ A;  1NK6 A;  3SBT A;  5BPL A;  3J7Y P;  1KD1 O;  4IJA A;  3LWL A;  3IAY A;  2QI2 A;  1NKC A;  5BN8 A;  2UUB K;  4B1W B;  4WE1 A;  4FLT A;  4CK2 A;  1DTT A;  1WAJ A;  3C94 A;  2P9U B;  2WBN A;  4BE0 A;  5F0X A;  3ZX2 A;  4CD3 A;  4K41 A;  1ILY A;  3EN9 A;  1K8A O;  5I9E B;  2XY5 A;  4BE2 A;  1X9S A;  3QB0 A;  1Q7Y O;  4Y1D A;  3SK3 A;  4DSF A;  2RF2 A;  2V52 B;  4O55 A;  1VQ6 N;  1BCM A;  4B3M K;  4BRQ A;  3PLA A;  1JCE A;  3ZT1 A;  4F3O A;  3SPY A;  2HHX A;  2FXU A;  4CEF A;  2E4L A;  1RT2 A;  3HVT A;  3IKM A;  4FOI A;  3VF6 A;  4FWK A;  4Z4F A;  1C1C A;  5GAG P;  2DY4 A;  1XC9 A;  1KVA A;  3AO1 A;  3E66 A;  1ESV A;  3VF2 A;  4YOT A;  2XY7 A;  4TSX A;  2ZWH A;  1N36 K;  3ENO A;  5FRM A;  3CME N;  1KVB A;  2BE2 A;  1TKZ A;  3SNN A;  1XQS C;  1N6Q A;  1TUU A;  1A5X A;  5AQO A;  1SZ2 A;  1CXU A;  3AO5 A;  4J2B A;  1QVG M;  3T69 A;  5LY3 A;  2DFE A;  4QCL A;  4KHW A;  3TAF A;  4CHO A;  3PUF A;  5EY4 A;  4KH5 A;  3OYM A;  2Z1H A;  2VGM A;  5KRS A;  2PY5 A;  5AQR A;  1VSI A;  3ZSO A;  3ZEU A;  2KFZ A;  4N5S A;  1BQM A;  2PAV A;  3RMA A;  1HNX K;  4Q0B A;  3I0S A;  4BR0 A;  3CCQ N;  1JLF A;  5GAD P;  3DXM B;  4KPY A;  4CBW A;  2F4V K;  1EWR A;  2JWL A;  3MN7 A;  1NNE A;  3DWL A;  1MDU B;  3PX6 A;  1NK8 A;  2BTF A;  4JK7 A;  4JI1 K;  4A5B A;  5BRD A;  5C12 A;  3CC4 N;  4DUY K;  1LAW A;  4E7L A;  4FO0 A;  1TL1 A;  4CFB A;  3ZT0 A;  4HUF A;  2YHB A;  4IG3 A;  5EOY A;  3IDH A;  2WON A;  1YAG A;  3AVM A;  1M90 O;  3L4Q A;  4LF5 K;  4RW9 A;  3D45 A;  2KFN A;  4FJJ A;  4BWM A;  4O5B A;  1RDU A;  3FZF A;  4OGE A;  1YJW N;  1WSH A;  3CG7 A;  1QHA A;  4BRK A;  3KIO A;  5KI6 A;  3AAR A;  1JCG A;  4WF9 L;  2XHB A;  4PY5 A;  4LH4 A;  1BL3 A;  3NVK A;  2VWJ A;  4C23 A;  2QKB A;  4QOZ B;  3DXM A;  4BAC A;  2Z1I A;  5AQH A;  4F2S A;  2DPN A;  3QIO A;  4CZH A;  4Z4E A;  1T6C A;  5DM7 L;  5JLF A;  3C6A A;  1Z6R A;  4B1Z A;  3EY1 A;  1RDB A;  4MDB A;  4RTF D;  3AO2 A;  4MLE A;  1VQK N;  2CGK A;  4DTX A;  1LW0 A;  4CGH A;  2HHQ A;  2YX6 A;  4DF8 A;  3V81 A;  2IVO A;  1RBT A;  3E9L A;  1IJJ A;  5AQT A;  2E6L A;  3I0R A;  3GBT A;  2D5R A;  3VEV A;  3MCP A;  2PYL A;  3MAQ A;  3ZSQ A;  4KH4 A;  3QLH A;  1NGC A;  3DI6 A;  3MEG A;  3WXK A;  4CED A;  2PYJ A;  4LFC K;  3TAQ A;  2FSN A;  4BR2 A;  2AA4 A;  2YNH A;  3A0I X;  4CHQ A;  4YDU A;  4E0D A;  4LD0 A;  4BGA A;  3DYA A;  4N56 A;  1XHZ A;  4LF4 K;  3R6M A;  3S3M A;  2FBT A;  1Q82 O;  1S6P A;  2QWM A;  1HNW K;  2YNF A;  4BDY A;  1RT3 A;  2CGJ A;  4M3Z A;  2NUB A;  4FZY A;  2HF3 A;  1S1U A;  2NRZ A;  5KTQ A;  3KVG A;  4DFM A;  4BE1 A;  5AQL A;  4K43 A;  1HKC A;  3ENH A;  2ZGZ A;  2GBZ A;  4RG8 A;  1YF5 L;  3VA3 A;  4LF7 K;  2UXB K;  1RBR A;  4LH5 A;  4BC5 A;  2P5O A;  3AVG A;  4BRA A;  3VES A;  3QBW A;  4C8N A;  4H5W A;  3O4N A;  4CGG A;  2QM1 A;  1IBK K;  4CFC A;  1TYQ B;  2GWJ A;  3MN6 A;  4FWN A;  1NGH A;  1LCU A;  2V7Y A;  4YY3 K;  3DOK A;  4GV3 A;  2Q0U A;  3I8B A;  5GAH P;  1K9M O;  4FVU A;  3FGU A;  4FJI A;  1ASU A;  4FXD A;  1TAQ A;  3K0S A;  1NG9 A;  1UOC A;  3S3O A;  4RWT A;  4BVP A;  5AQJ A;  5BPN A;  1R0A A;  3H3O B;  4PKI A;  2H3G X;  3LDQ A;  1RNH A;  3D2E B;  5AQF A;  3TSQ A;  4CF0 A;  2XY6 A;  3O4W A;  4LF8 K;  3MN9 A;  5F1X A;  1RCH A;  4DQI A;  4NCB A;  2DTU A;  2HND A;  4KRF A;  5C0Y A;  3H3N O;  5GIP A;  2IIR A;  3HO1 A;  1JL1 A;  1HPM A;  1QZ5 A;  4CW7 B;  1XHX A;  3K9J A;  2G8V A;  2OZM A;  1SL2 A;  1TYQ A;  3H1V X;  3CJB A;  5KPZ A;  1TK5 A;  4FSV A;  3ALY A;  4IG0 A;  2YHY A;  1S3X A;  3RRH A;  1EX4 A;  1XWL A;  1SKS A;  3JS6 A;  1CZB A;  1MU2 A;  3CCS N;  3M6G A;  3J81 O;  1NJZ A;  2CH6 A;  3O4Q A;  5F2R A;  4E7J A;  1TK0 A;  4E7K A;  4JI4 K;  2A41 A;  3LDP A;  2RHK A;  1HYS A;  3T1H K;  4A59 A;  3D2E A;  1N33 K;  4FJX A;  5LJW A;  4CF2 A;  2JLE A;  4DSI A;  2ZGY A;  4EAH D;  1X9W A;  4YFU A;  1KFS A;  3DLK A;  2KHO A;  1VQ4 N;  4B9S A;  1GLD G;  3VN5 A;  3I55 N;  3CPW M;  4I9L A;  1WLJ A;  5J2P A;  3QEI A;  4ISE A;  3HTV A;  2O8F B;  1REV A;  4YNQ A;  1WBD A;  4OLB A;  5E84 A;  3EO3 A;  5LL6 Z;  4F3T A;  4DTN A;  1KLN A;  4JKF A;  4EP5 A;  4NLC A;  5C10 A;  1TKD A;  4Y1C A;  5HLF A;  1ASV A;  3LPT A;  1U48 A;  3CQX A;  4CIG A;  3O6W A;  4KAZ A;  4H4M A;  3TSP A;  1BIZ A;  1D9D A;  2FBV A;  4J8F A;  3OS1 A;  4DLE A;  4FWL A;  4KHY A;  3RSE A;  4DLG A;  3CCL N;  3AAQ A;  3VEO A;  1TL3 A;  1VK0 A;  2YNI A;  2NLX A;  1C0U A;  4HUG A;  3QNN A;  5HRR A;  4CEO A;  4KI6 A;  3FZK A;  3WT0 A;  3NGI A;  1V4S A;  1U6Z A;  1BOT O;  3DLE A;  3CI5 A;  1BUP A;  3OYG A;  4B9U A;  1EQY A;  3QFP A;  2I7P A;  3UB5 A;  3KKR A;  4CZL A;  3NMU A;  3V9W A;  2ZF5 O;  3UKU B;  1IG9 A;  3VER A;  1NGA A;  4CEC A;  4CIF A;  4B3T K;  3A5N C;  3KLF A;  5HOO A;  2YHW A;  5J1E A;  4XH1 A;  4DFP A;  3CM6 A;  4B1V A;  4I6M B;  2IAJ A;  3NBP A;  3L2R A;  1TGO A;  1W7A A;  4H5T A;  3ZT3 A;  2D4W A;  2F8T A;  1JKH A;  1G15 A;  4XIU A;  3K5N A;  4LFB K;  1Y97 A;  2GEM A;  1QQM A;  4LF9 K;  3VQC A;  3K57 A;  3DRS A;  4IWV A;  5AQU A;  3DLB A;  1E3M A;  3E9O A;  4PL8 A;  3ZYY X;  4CJT A;  4JKB A;  1JLC A;  5ADX A;  4GMJ B;  1EP4 A;  1C1B A;  1Q86 O;  1DT9 A;  4AHR A;  3SQ1 A;  1HUX A;  3AY9 A;  2YKM A;  1U4B A;  2BDP A;  2O8D B;  2KW4 A;  4X62 K;  3WNF A;  4GKK K;  5CZ2 A;  4B9V A;  4H4O A;  3SAH A;  3KTQ A;  4FCY A;  3RR8 A;  4UY8 O;  2ETJ A;  4JI2 K;  3OYE A;  1LWF A;  4DTU A;  1OH5 A;  4FPB A;  3PV8 A;  3AV9 A;  4B1X B;  1U49 A;  2D1K A;  4DQS A;  1WAF A;  1NK7 A;  1JLA A;  4BRC A;  3L3U A;  2QEX N;  4K8X A;  4DSK A;  3V6D A;  3NH0 A;  4I6M A;  3LDS A;  4EZ6 A;  4DTO A;  2NRV A;  3EE8 A;  4DQQ A;  2VG5 A;  2Z1J A;  1HKB A;  2HMI A;  4OGC A;  1MWM A;  3R9P A;  4W5Q A;  3AA4 A;  3IMX A;  5C42 A;  3OYL A;  3DXK B;  5C15 A;  2GV9 A;  3RWU A;  4LY7 A;  5KQ8 A;  3SQ2 A;  4ZTF A;  4CEZ A;  2OA8 A;  2HVI A;  5CYQ A;  4CJL A;  3O8M A;  1C0F A;  4HHT A;  3TAP A;  2PZS A;  4EIA A;  4KFB A;  5JVG L;  1SQK A;  5C2F A;  1O13 A;  1QSL A;  3P38 A;  2G8I A;  4W5O A;  4QS7 A;  2NNW A;  3PO4 A;  3RTV A;  4FZX C;  1O1W A;  2ITG A;  1S1W A;  4O8K A;  3CFP A;  4JI6 K;  3O9R A;  4J2D A;  5BN9 A;  1C0T A;  1W9H A;  1U45 A;  3CJ9 A;  1W0H A;  5HL7 L;  4CF9 A;  2QWN A;  3O9U A;  1BGX T;  2A1R A;  5CYM A;  3J8A A;  1QQO A;  4IFY A;  1YIT N;  3AVK A;  3RR7 A;  3DXK A;  4C8K A;  4BG8 A;  4DHY A;  3TAN A;  3LP1 A;  5HBM A;  1RT7 A;  1VQ5 N;  4FL9 A;  3BF1 A;  4JKG B;  2HOE A;  4CF1 A;  3ATV A;  5DMR A;  1FKP A;  2VG7 A;  3VOV A;  1NJI O;  2WC9 A;  3L8B A;  3V9X A;  3O80 A;  4MQ3 A;  2GUP A;  4DR3 K;  4FYD A;  3M8S A;  1S6Q A;  4OLA A;  1J5E K;  3MN5 A;  3VGL A;  1S1V A;  5CHI A;  5JS2 A;  2HVH A;  3MDQ A;  1EO1 A;  4OPH A;  4F4K A;  1I3A A;  3HRG A;  4KHS A;  3HP6 A;  1QQC A;  1UA1 A;  4W5T A;  1NOZ A;  3CCJ N;  3K5M A;  1X3M A;  4CBX A;  4K8Z A;  1YXQ A;  4BDP A;  4WFA L;  3P83 D;  2E2Q A;  3ZX0 A;  3P39 A;  1JL2 A;  4DUZ K;  3T1Y K;  5AZJ A;  2YV0 X;  4JKG A;  1T3V A;  1DTQ A;  3CCU N;  3LDO A;  3BZC A;  4ZHR A;  4M3W A;  4MDA A;  1UA0 A;  4CZG A;  4N41 A;  5J2N A;  1HYV A;  4XH5 A;  3WNG A;  2P9S A;  4CI6 A;  3DRR A;  3T3F A;  1GOA A;  5BRF A;  4DV7 K;  4ID1 A;  3F73 A;  5A2Q O;  5GIN A;  2ITM A;  4CZM A;  1YVU A;  4CVN E;  3K5L A;  2X78 A;  2RE2 A;  1FJG K;  1RDA A;  3QIP A;  4C1N I;  1U2V B;  1T44 A;  2HHV A;  1EKE A;  1XMO K;  4B8C A;  5AQK A;  3KLE A;  2FC0 A;  3WNH A;  1GLJ O;  4DB3 A;  1NJW A;  1KC8 O;  3C7N B;  3SUQ A;  2OYQ A;  4M7Y A;  3TAG A;  3A5O C;  3VQP A;  4AM7 A;  5TKY A;  1VQM N;  2A3Z A;  4E89 A;  1NK4 A;  5H1S Q;  2P9U A;  4CJS A;  3L2W A;  4BRF A;  4WQ4 C;  3QEW A;  1WOQ A;  2FLO A;  3SAF A;  1HKG A;  4OPK A;  3AO3 A;  4DR6 K;  4FK4 A;  3CFO A;  3MMV A;  4CJ4 A;  4IDK A;  4CGJ A;  4FJ5 A;  4WQ5 A;  1VSF A;  3OHR A;  4M3Y A;  3S9H A;  2AP1 A;  1GLA G;  4CHY A;  4GV6 A;  1V4T A;  2ZD1 A;  1U2V A;  1N34 K;  4CGD A;  1VQ8 N;  1ASW A;  4CEE A;  3OVN A;  3PSI A;  3OY9 A;  1HNV A;  3G0Z A;  3LDL A;  1HR0 K;  1VQL N;  2I5J A;  4CJF A;  3DLG A;  1HPZ A;  2X6N A;  5AFU H;  2QK9 A;  3SPZ A;  3C7N A;  4JI0 K;  3NE6 A;  4IOC L;  3HL8 A;  1IO2 A;  1RFQ A;  4FM0 A;  3TTC A;  2OPP A;  1X1P A;  4AHC A;  2D0O A;  3TTD A;  3M8R A;  3TAM A;  1NGG A;  1OH6 A;  4Z4I A;  1L3T A;  3ULD A;  5AQP A;  2W6L A;  3HZ6 A;  2OAN A;  1A5V A;  5E26 A;  4FLU A;  1YHQ N;  3TAE A;  3WXI A;  1T7P A;  3W0L A;  2QWR A;  5HRS A;  4FM1 A;  1BHL A;  2P1J A;  2P9I B;  5DK5 A;  4IEI A;  4B8A B;  5KPR A;  3CXC M;  1KCF A;  4E1J A;  1ZBI A;  4AQY K;  1BDG A;  1IKV A;  5AZI B;  3O3F A;  3SBG A;  4FLV A;  1SS6 A;  4CER A;  5EX5 A;  2RN2 A;  4DCH A;  4C8L A;  3THX B;  3M5R A;  1K8K B;  4H03 B;  4JN4 A;  2P9K B;  3MX2 A;  4FJG A;  3H6E A;  4NCA A;  1VQN N;  1VQP N;  1HJO A;  5AQV A;  1HQU A;  3O9Q A;  4CJE A;  4L8R B;  1D8Y A;  1GLB G;  4DTM A;  1WSF A;  2XRI A;  3NGY A;  1T05 A;  2HW3 A;  5BRH A;  3NHG A;  4F8R A;  4CZI A;  2VCP A;  2AJQ A;  1S1X A;  4B9N A;  4OJR A;  2IVP A;  4B1Y B;  1HJR A;  4M3T A;  4CJW A;  5FPE A;  3LAM A;  2G8K A;  3VQ9 A;  2OTJ N;  2W41 A;  1W2B M;  2P9I A;  4DG1 A;  3M8Q A;  3TTF A;  2G8F A;  3DLH A;  3N4Q A;  4JRQ A;  4GW6 A;  5BRE A;  1NK0 A;  3HOS A;  2OPR A;  3THX A;  4DS4 A;  1K8K A;  4IO9 L;  2P9K A;  3CCE N;  3M3Z A;  1XNQ K;  3CYM A;  3HOT A;  1BWF O;  3HM9 A;  1X3N A;  5HRN A;  4RW8 A;  3VQ5 A;  1GOC A;  1KTQ A;  3KLG A;  3FZH A;  3ASM A;  3IFR A;  5TKW A;  2UUC K;  4B3S K;  3M8P A;  3CCV N;  4JNE A;  4FWO A;  3UKR B;  5GAE P;  1Q81 O;  1NK5 A;  2W42 A;  3O9T A;  4W5R A;  3VQA A;  3SI6 A;  2B6A A;  4I9Q A;  4HCC A;  3UIQ A;  1A5W A;  2XY8 A;  1IG8 A;  1TVR A;  3PO5 A;  2LSN A;  5K14 A;  2Q1N A;  4DTR A;  1NK9 A;  3LP2 A;  3BUZ B;  4IDH A;  1HYZ A;  5HRP A;  4IJN A;  1NGI A;  3C65 A;  3AA5 X;  2DFF A;  1IKW A;  4DTP A;  4M3R A;  3PX0 A;  3SMS A;  2IGI A;  3ZSY A;  2FBY A;  2QXL A;  4RW7 A;  3TPQ A;  3H1Q A;  5SWM A;  2Y1I A;  3GG4 A;  5AQY A;  1TKX A;  2QA4 N;  3KK3 A;  3QIC A;  3U9Z A;  5FPM A;  1RBS A;  5IT9 O;  5EXW A;  2VQE K;  1YTA A;  4L3Q A;  2VYP A;  4BRN A;  5FLX O;  3NF8 A;  3NH1 A;  4CIE A;  3CHW A;  4WFB L;  3KK7 A;  2KKZ A;  2PBD A;  3RVC A;  1XMQ K;  4BRL A;  3CJ7 A;  1Q9Y A;  2ZQB A;  3CJA A;  4E1N A;  5B8H A;  1NKB A;  1L3U A;  2WUS A;  3DM2 A;  4FVM A;  3VMF B;  3MXJ A;  1I39 A;  1OKJ A;  4CGI A;  1S9E A;  3DLR A;  4CHP A;  1JLQ A;  5JMV A;  1NOY A;  3HK2 A;  3KWI A;  2HHS A;  1C0M A;  2HBL A;  2FBX A;  3AAP A;  3NAE A;  3E9P A;  4Z4C A;  1YJ9 N;  2E88 A;  1J53 A;  3TR8 A;  3VQ4 A;  1TKT A;  2P9N B;  2OPQ A;  1RT6 A;  2EX3 A;  3KK1 A;  1S5J A;  4O4G A;  4KTQ A;  3LM2 A;  3AO4 A;  4GV9 A;  4H0O A;  2Q36 A;  4BQZ A;  4HCB A;  4DTS A;  3P4I A;  3OYJ A;  1YUW A;  5J2Q A;  2O8C B;  4CJK A;  5CZ1 A;  1IKY A;  1JJ2 M;  4DR4 K;  1NGJ A;  2HHU A;  1Z25 A;  3QFU A;  4JLH A;  4HVJ A;  4RW6 A;  1NGE A;  3CCR N;  1ATN A;  1I94 K;  3ZLJ A;  4JHD B;  3D0P A;  2D0P A;  3VGM A;  4Z4G A;  4K0K K;  4FWS A;  4C8M A;  5M1N A;  2UXD K;  5AJ3 K;  3O08 A;  5M1Q A;  2Q2R A;  4MLH A;  4R5P A;  1LW2 A;  1XNR K;  4LC9 B;  2R7Y A;  2HHT A;  3F9K A;  3W3D A;  3EE9 A;  3T7Z A;  4A62 A;  2Q0R A;  1HRH A;  3DLL L;  4GVM A;  3CIP A;  1IBL K;  4FK2 A;  4PL7 A;  3PX4 A;  4DWI A;  4PKH A;  2UYT A;  3AGR A;  3CMA N;  5AQX A;  1T03 A;  2OTL N;  4JD2 B;  4XH4 A;  4YOW A;  1NGD A;  5KGW A;  1QHT A;  4F2R A;  4JV5 K;  3EKS A;  4LF6 K;  3QIN A;  1GLF O;  3CJ1 A;  1WSI A;  2O8C A;  3A5M C;  3LPU A;  1OVY A;  1ZBL A;  4FWQ A;  3LZJ A;  1WBB A;  3LM9 A;  1K6Y A;  1QTM A;  4DV4 K;  2O8F A;  5LJV A;  4H5N A;  1XI1 A;  3SZ2 A;  3U9D A;  4CEQ A;  1W97 L;  1CXQ A;  4MO5 A;  1IV0 A;  4CEB A;  3FE1 A;  2KQ2 A;  3V9U A;  1N8R O;  2E20 A;  4FWP A;  4PKG A;  1E4F T;  2Q97 A;  3OYA A;  4BRM A;  3G4S N;  3OS2 A;  4JKD A;  4AH9 A;  3F5T A;  4KH6 A;  1VRT A;  1WSJ A;  3DRP A;  2VWK A;  1KVC A;  1FKO A;  1MA9 B;  1IKX A;  1VSM A;  3S3N A;  4KO0 A;  2X6S A;  2O8B B;  1NGF A;  4KRE A;  2Z1G A;  4YOU A;  2QTD A;  1RBV A;  3NCI A;  1BI4 B;  1YI2 N;  4ELU A;  2O8E B;  4O8U A;  4KTW A;  5AQZ A;  1RDC A;  1SL0 A;  1GLL O;  3K59 A;  5HRO A;  3KD1 E;  1L3V A;  3A8Y A;  2ASO A;  2HST A;  4NLB A;  3KLH A;  1N5Y A;  1BU6 O;  1P8Z A;  3I33 A;  4BRH A;  1Y64 A;  2B4J A;  2F9W A;  1IH7 A;  4H0Y B;  3UKU A;  3SJH A;  3BP8 A;  3VF4 A;  4YOV A;  4DU3 A;  4CJQ A;  2GTD A;  1SKR A;  1RGI A;  4FOE A;  3EZ5 A;  3ZET B;  4DV5 K;  3WEE B;  3OA9 A;  4AIL C;  5C25 A;  4UQG A;  2A6A A;  4CJ5 A;  3QEX A;  5AQQ A;  5FRO A;  1RTJ A;  4DR7 K;  2F96 A;  3QML A;  3GDQ A;  3O9S A;  2HBJ A;  1K73 O;  3HYF A;  4FJK A;  4N47 A;  5AQW A;  2O8E A;  3ITH A;  4NYN A;  1C6V A;  1KAZ A;  1Z26 A;  5M1P A;  3KLI A;  1UWB A;  2O8D A;  3F9M A;  4CHN A;  4K25 A;  3BF3 A;  3VQE A;  2EHG A;  3AVC A;  3JYT A;  1B9D A;  3O1W A;  4M45 A;  2F9T A;  4DR1 K;  5LMU K;  3CQY A;  2ASM A;  2O4G A;  4A61 A;  2ZE2 A;  4DR2 K;  3S41 A;  2VGN A;  4E19 A;  3THW B;  2HHH K;  2HB5 A;  3C6T A;  1FK9 A;  1RTD A;  1U47 A;  2P5G A;  3J7A P;  3SCX A;  4B9M A;  3ID8 A;  4B08 A;  1RBU A;  3ZET A;  4CFA A;  1RDD A;  5E41 A;  1NMN A;  2ATQ A;  4WYB A;  4CJ3 A;  2QWO A;  4WQ5 C;  3HP9 A;  3VTH A;  3SQ0 A;  4ILG B;  4DV2 K;  4OKJ A;  2QWL A;  2V7Z A;  3AGK A;  4WFN L;  3VQQ A;  2G8W A;  4ISG A;  3GE1 A;  5AQS A;  1ZBU A;  3VPZ A;  2ZJP L;  3OYK A;  4O0I A;  3K5O A;  3B6P A;  4JS5 A;  3ZCM A;  2QW9 A;  1Q9X A;  2YKN A;  1B92 A;  3ZX3 A;  2GWK A;  4B9L A;  4CHZ A;  1S1T A;  1VSK A;  4BG9 A;  3L2V A;  5AFU A;  1KQS M;  3SLC A;  4O5F A;  3DJC A;  5JVH L;  5CE3 A;  3SV4 A;  1BIU A;  5KGX A;  4OPJ A;  3VEX A;  2DFH A;  1QSS A;  4OKE A;  4M3U A;  1VSH A;  4OKK A;  2J4R A;  4O44 A;  4BVO A;  1GLC G;  3LP3 A;  3G10 A;  3WQU A;  3LAN A;  3M1F A;  3DMJ A;  3V4I A;  3VET A;  4FJ9 A;  4KB0 A;  1JLG A;  3P5J A;  4DSJ A;  3MED A;  3J80 O;  2QWQ A;  5AQM A;  2HBK A;  1NBW A;  1VAZ A;  1ZYQ A;  3OYH A;  1J6Z A;  1QQN A;  3BY5 A;  5JLH A;  1LWC A;  4B9Q A;  3C6U A;  4ICL A;  1JCF A;  1YVN A;  4HWI A;  1GOB A;  1DGK N;  2A1S A;  3TI0 A;  1TK8 A;  4YHH K;  4QAG A;  2NRW A;  3SV3 A;  3NFA A;  1SAZ A;  2BGG A;  4CJV A;  4FJ7 A;  3OJU A;  1F21 A;  1VQ7 N;  4PWD A;  4BC3 A;  4M41 A;  3HVR A;  2D0A A;  3NDK A;  3P1G A;  1G99 A;  2I7N A;  3BGR A;  2VWB A;  4CE9 A;  4U67 L;  3U3Y A;  1WB9 A;  1CLQ A;  1S9G A;  2JGU A;  3KD5 E;  1WSG A;  4DFK A;  3TAR A;  2KZM A;  1SUQ A;  1QE1 A;  5FPN A;  2UU9 K;  3KKS A;  2BH1 A;  3CC7 N;  2A5X A;  5KQD A;  1NJY A;  3R1X A;  4DU4 A;  4DKW A;  4YDU C;  3TSU A;  3SUO A;  3QEP A;  4JK8 A;  3HT3 A;  2HMP A;  4IOA L;  1DEJ A;  3CCM N;  3KHY A;  3ZEU B;  3LDN A;  3KJV A;  3OS0 A;  1MWK A;  2GX9 A;  3KWG A;  2IVN A;  4CZE A;  3E01 A;  4NXN K;  1XUP O;  5JS1 A;  1YTU A;  2NRH A;  4FLW A;  1BA0 A;  2UXC K;  3CJC A;  3G71 N;  4A57 A;  3F2K A;  4BRI A;  2VQF K;  5JIC A;  4ELV A;  3ZSZ A;  5BR9 A;  2E8A A;  4ISF A;  3HSC A;  4NCG A;  4FLX A;  3CD6 N;  1WSE A;  3LAK A;  5M1F A;  1EET A;  1NKE A;  2A40 A;  3QBX A;  5M1O A;  1T8E A;  4IXC A;  2HBM A;  4JI5 K;  3NF6 A;  4HUE A;  3ZSW A;  3QDK A;  3SMP A;  3VQ6 A;  3L0Q A;  2ASP A;  4B9T A;  3VQD A;  4JYA K;  1B9F A;  4NXM K;  3K9K A;  4JI8 K;  1NU0 A;  4JKA A;  1HNZ K;  4ILH A;  3H08 A;  1JLB A;  1Q18 A;  1KXP A;  3BEX A;  4IO8 A;  4O0J A;  3D2F B;  4IBN A;  3L2Q A;  5FPD A;  2A42 A;  3E1Y A;  3PSF A;  4JEP A;  4KV8 A;  5LMN K;  3MXI A;  2E2N A;  3CER A;  3VEY A;  3R3L A;  1KFD A;  3HI0 A;  5J2M A;  2E5L K;  2BUP A;  2IDO A;  4H5R A;  1BO5 O;  4X66 K;  1QVF M;  3VQB A;  3V1O A;  5IWA K;  1NJX A;  4YOX A;  4BRG A;  1KAX A;  3D6R A;  1HMV A;  1ZC6 A;  1NWK A;  4FLY A;  4FW1 A;  4CZJ A;  1L5U A;  3HPG A;  1YIJ N;  3SJJ A;  4CJU A;  3IRX A;  5KRT A;  3AVI A;  4H0V B;  3ZSR A;  2HHW A;  2NRT A;  4HTU A;  3UE5 A;  3ZSV A;  1SKW A;  3D2F A;  4CZF A;  4AHU A;  4AHT A;  1NGB A;  3FZL A;  3MWP A;  4JKH A;  3EEQ A;  1ZXO A;  1T6D A;  1GLE G;  3SQ4 A;  4BR4 A;  2OZS A;  4BRP A;  1NMD A;  4R79 A;  4GKJ K;  4KHN A;  5AZI A;  4YOR A;  1N32 K;  3AVH A;  4BY9 C;  1C1A A;  2FF6 A;  3CM5 A;  3FR0 A;  4IEE A;  4BR5 A;  4ZTJ A;  3QO9 A;  4EZ9 A;  4J2A A;  3MEE A;  2PFU A;  3RMC A;  4KKO A;  1BG3 A;  3G25 A;  1RT1 A;  3K2P A;  4CK3 A;  1HX1 A;  3MCA B;  5AQN A;  1P90 A;  3WXL A;  2RPI A;  3FFI A;  4K42 A;  2E1Z A;  4FJ8 A;  1YJN N;  1EXQ A;  1KAY A;  1CZ9 A;  1WN7 A;  1VSD A;  3JXU A;  4IKF A;  1X9M A;  4JS4 A;  3AA3 A;  2Q3S A;  5T7B A;  4H8K A;  5CR4 A;  4B3R K;  2QKK A;  4DQP A;  2YHX A;  1OH7 A;  4BRE A;  4BRO A;  2CH5 A;  4HTL A;  4DV1 K;  4H0P A;  4WQ4 A;  3KZB A;  4YOY A;  3U3G A;  3JSM A;  3K58 A;  4FW2 A;  1VRU A;  4A2B A;  2FSJ A;  1C0G A;  1YT3 A; 
#chains in the Genus database with same CATH homology
 1W0H A;  1A5X A;  3LZJ A;  4CF9 A;  1K6Y A;  1CXU A;  3AO5 A;  1BGX T;  4J2B A;  1QTM A;  2A1R A;  3A2F A;  5CYM A;  5C24 A;  2DFE A;  3CQ8 A;  4RW4 A;  4KHW A;  3TAF A;  4CHO A;  4QCL A;  4IFY A;  2IC3 A;  3PUF A;  3IG1 A;  1XI1 A;  4LSL A;  3AVK A;  3OYM A;  3SZ2 A;  2Z1H A;  4CEQ A;  5KRS A;  2PY5 A;  1CXQ A;  3RR7 A;  1VSI A;  4C8K A;  1LAV A;  3T19 A;  2IS3 A;  3ZT4 A;  3TAN A;  4CEB A;  3ZSO A;  2KFZ A;  3LP1 A;  4N5S A;  1BQM A;  1VSL A;  1RT7 A;  1ITG A;  2KQ2 A;  2IOC A;  5HBM A;  3V9U A;  3RMA A;  4Q0B A;  4E7H A;  3IS9 A;  3VQ8 A;  3I0S A;  3OYA A;  3OS2 A;  1JLF A;  4CF1 A;  4KPY A;  5DMR A;  1FKP A;  2VG7 A;  4I2Q A;  4AH9 A;  3L8B A;  3V9X A;  1VRT A;  4MQ3 A;  4FYD A;  4DF4 A;  1WSJ A;  3M8S A;  1S6Q A;  3DRP A;  4I7F A;  2VWK A;  4OLA A;  3PX6 A;  4FM2 A;  1KVC A;  4DMN A;  1NK8 A;  1KLM A;  1FKO A;  1S1V A;  4FJN A;  1LAW A;  4E7L A;  1IKX A;  5JS2 A;  1VSM A;  1TL1 A;  3OYB A;  3S3N A;  2HVH A;  4KO0 A;  2X6S A;  3ZT0 A;  4CFB A;  4KRE A;  5FRN A;  2Z1G A;  1VSE A;  4HUF A;  4F4K A;  2YHB A;  1RBV A;  1I3A A;  4IG3 A;  3NCI A;  4PQU A;  1BI4 B;  4KHS A;  4ELU A;  2WON A;  1SL1 A;  3HP6 A;  3AVM A;  4KTW A;  1QQC A;  1UA1 A;  4W5T A;  1RDC A;  1NOZ A;  3OYF A;  1SL0 A;  3K5M A;  3K59 A;  5HRO A;  1QS4 A;  4RW9 A;  3D45 A;  2KFN A;  3KD1 E;  4FJJ A;  4K8Z A;  1L3V A;  4KI4 A;  4BDP A;  3KLH A;  4ID5 A;  4BWM A;  4O5B A;  1N5Y A;  3HXM A;  3P83 D;  4OGE A;  3AVA A;  1WSH A;  3CG7 A;  3AA2 A;  1JL2 A;  1SV5 A;  2B4J A;  1IH7 A;  3NGZ A;  3KIO A;  2YV0 X;  5KI6 A;  1RTI A;  4CCH A;  2XHB A;  3THV A;  4PY5 A;  1DTQ A;  4LH4 A;  1BL3 A;  4DU3 A;  2VWJ A;  2QKB A;  4CJQ A;  4QOZ B;  4ZHR A;  1SKR A;  4M3W A;  4BAC A;  2Z1I A;  1D9F A;  3EZ5 A;  4F2S A;  1UA0 A;  4N41 A;  5J2N A;  2X74 A;  3SYZ A;  1HYV A;  4IFV A;  4AIL C;  3WNG A;  3QIO A;  5C25 A;  4UQG A;  4Z4E A;  3DRR A;  4CJ5 A;  3NH2 A;  3OJS A;  3T3F A;  1U04 A;  3QEX A;  5FRO A;  1GOA A;  4ELT A;  1RTJ A;  4AHV A;  2F96 A;  1DLO A;  3EY1 A;  1RDB A;  4ID1 A;  3F73 A;  4PA1 A;  4KTZ A;  3AO2 A;  3HYF A;  1YVU A;  4FJK A;  4N47 A;  3K5L A;  4CJR A;  4DTJ A;  2X78 A;  3ITH A;  1LW0 A;  4CGH A;  3AVL A;  3OYI A;  1RDA A;  3AVF A;  4DTX A;  2HHQ A;  3AVB A;  4DF8 A;  3V81 A;  1RBT A;  4NYN A;  3QIP A;  4J2E A;  1C6V A;  1Z26 A;  3DOL A;  2E6L A;  1J9A A;  3I0R A;  2HHV A;  1HQE A;  1EKE A;  2D5R A;  1UWB A;  3KLI A;  4B8C A;  3KLE A;  2PYL A;  4M42 A;  2FC0 A;  3ZSQ A;  3MAQ A;  4DU1 A;  3WNH A;  4CHN A;  4FJM A;  3VQE A;  2EHG A;  3AVC A;  3JYT A;  3QLH A;  1B9D A;  3B6O A;  3DI6 A;  1BIS A;  3MEG A;  4M45 A;  4CED A;  3SUN A;  1NJW A;  2PYJ A;  1TAU A;  3TAQ A;  3U6F A;  4DQR A;  3V9S A;  3SUQ A;  2OYQ A;  2F8S A;  3TAG A;  2YNH A;  3VQP A;  2O4G A;  3V9Z A;  2ZE2 A;  4KHQ A;  4CHQ A;  4G1Q A;  1JXE A;  4E19 A;  4E89 A;  1NK4 A;  4E0D A;  2HB5 A;  4LD0 A;  4CJS A;  3C6T A;  1FK9 A;  3L2W A;  1U47 A;  2VG6 A;  1RTD A;  2P5G A;  2B5J A;  3DYA A;  3SCX A;  3QEW A;  4B08 A;  4LSN A;  4N56 A;  1XHZ A;  4B9M A;  1RBU A;  4EP4 A;  4CFA A;  1RDD A;  5E41 A;  4OPK A;  3AO3 A;  3S3M A;  4FK4 A;  2FBT A;  1S6P A;  2ATQ A;  3OYD A;  3BDP A;  2YNF A;  1VSJ A;  4CJ3 A;  4BDY A;  1RT3 A;  3CFO A;  4M3Z A;  4CJ4 A;  4IDK A;  4CGJ A;  2NUB A;  3HP9 A;  4FZY A;  4FJ5 A;  1VSF A;  4M3Y A;  3S9H A;  5I42 A;  3SQ0 A;  1BQN A;  4OKJ A;  1S1U A;  3VQQ A;  4CHY A;  2G8W A;  5HP1 A;  5D3G A;  2HNY A;  1ZBU A;  1Q8I A;  2ZD1 A;  5KTQ A;  3OYK A;  4DFM A;  1ZBF A;  4O0I A;  3HST B;  3K5O A;  1D5A A;  3B6P A;  4CGD A;  4BE1 A;  4JS5 A;  3PY8 A;  4CK1 A;  1ASW A;  4CEE A;  3OVN A;  4Z0U A;  3OY9 A;  1HNV A;  3G0Z A;  2GBZ A;  4RG8 A;  3ZCM A;  3VA3 A;  2I5J A;  1RBR A;  4LH5 A;  1Q9X A;  4CJF A;  3DLG A;  2YKN A;  1B92 A;  1HPZ A;  3AVG A;  2X6N A;  3QER A;  2P5O A;  4B9L A;  2QK9 A;  3SPZ A;  4C8N A;  4CHZ A;  3KK2 A;  3O4N A;  4CGG A;  1S1T A;  3NE6 A;  1VSK A;  4CEA A;  3L2V A;  4CFC A;  1J5O A;  4BDZ A;  3HL8 A;  1IO2 A;  4FM0 A;  3ZSX A;  2OPP A;  1LWE A;  3SV4 A;  1BIU A;  5KGX A;  1X1P A;  1TV6 A;  2O4I A;  4OPJ A;  3DOK A;  2DFH A;  4AHC A;  1QSS A;  3M8R A;  3TAM A;  4OKE A;  4FJI A;  4Z4I A;  4M3U A;  1UAX A;  1ASU A;  1JXB A;  3ULD A;  1L3T A;  4FXD A;  1TAQ A;  3SUP A;  1UOC A;  4FLZ A;  3S3O A;  1VSH A;  4DSE A;  4OKK A;  1A5V A;  4CGF A;  4CES A;  4O44 A;  4FLU A;  3TAE A;  1T7P A;  3LP3 A;  3G10 A;  4FJH A;  3LAN A;  4MFB A;  1R0A A;  3O3H A;  3DMJ A;  3V4I A;  5HRS A;  4FM1 A;  1RNH A;  3RMB A;  1BHL A;  1FXX A;  2P1J A;  4FJ9 A;  4CF0 A;  1BCO A;  5DK5 A;  2XY6 A;  4M3X A;  3V1Q A;  4B8A B;  4BWJ A;  1KCF A;  4DFJ A;  1ZBI A;  4KB0 A;  1JLG A;  1IKV A;  3P5J A;  2G8H A;  4DSJ A;  1RCH A;  4DQI A;  4B3O A;  3O3F A;  3MED A;  4NCB A;  2DTU A;  1QSY A;  2WOM A;  4Q5V A;  4FLV A;  1ZYQ A;  2HND A;  4CER A;  2RN2 A;  3OYH A;  3RMD A;  4C8L A;  3HJF A;  4KRF A;  3HO1 A;  4W5N A;  1JL1 A;  1LWC A;  4FJG A;  3EYZ A;  3C6U A;  4ICL A;  4NCA A;  3HPH A;  1XHX A;  1GOB A;  2G8V A;  2OZM A;  1HQU A;  4CJP A;  2A1S A;  3TI0 A;  1SL2 A;  1TK5 A;  1TK8 A;  4CJE A;  3ALY A;  4IG0 A;  4QAG A;  3HPO A;  1D8Y A;  4L8R B;  1HNI A;  3SV3 A;  4DTM A;  3NFA A;  3RRH A;  1WSF A;  2XRI A;  1EX4 A;  3NGY A;  2BGG A;  1RT5 A;  1XWL A;  1SKS A;  1CZB A;  1MU2 A;  4CJV A;  1NJZ A;  1T05 A;  3T1A A;  3O4Q A;  1J54 A;  3AVJ A;  3CFR A;  4FJ7 A;  3OJU A;  2XO7 A;  2HW3 A;  1BI4 A;  1F21 A;  3NHG A;  4E7J A;  1TK0 A;  4E7K A;  4F8R A;  3VA0 A;  2AJQ A;  5CY4 A;  1S1X A;  3AVN A;  4PWD A;  4B9N A;  4OJR A;  1HYS A;  4M3T A;  1HJR A;  4I2P A;  4M41 A;  2D0A A;  4CJW A;  3P1G A;  3HVR A;  3NDK A;  3LAM A;  3BGR A;  3VQ9 A;  2G8K A;  4PUO A;  1RTH A;  4CE9 A;  3U3Y A;  4FJX A;  4CF2 A;  4DG1 A;  1CLQ A;  1S9G A;  2JGU A;  3M8Q A;  2G8F A;  1KSP A;  3KD5 E;  2D0C A;  1WSG A;  4DFK A;  2JLE A;  3TAR A;  5FDL A;  3DLH A;  1LV5 A;  3OYC A;  4E3S A;  4DSI A;  1ZBH A;  3V1R A;  4YFU A;  4JRQ A;  1X9W A;  1KFS A;  1SUQ A;  1QE1 A;  3DLK A;  4GW6 A;  4JRP A;  4B9S A;  3VN5 A;  5EU7 A;  3C95 A;  2P51 A;  3KKS A;  1WLJ A;  4I9L A;  4Z4H A;  5J2P A;  3QEI A;  1NK0 A;  1REV A;  4CFD A;  4YNQ A;  2OPR A;  1KRP A;  4DS4 A;  1NJY A;  4KB1 A;  4DU4 A;  4OLB A;  5I3U A;  2RKI A;  3SUO A;  3QEP A;  3OYN A;  3HT3 A;  4F3T A;  3CYM A;  4DTN A;  1KLN A;  3HM9 A;  4EP5 A;  5HRN A;  4RW8 A;  3VQ5 A;  1GOC A;  3KJV A;  3OS0 A;  1KTQ A;  3TWH A;  3KLG A;  3I8D A;  4Y1C A;  1TKD A;  4NYF A;  3ASM A;  5HLF A;  1ASV A;  3LPT A;  3E01 A;  3M8P A;  3WNE A;  3O3G A;  1U48 A;  4CIG A;  2G8U A;  4KAZ A;  5JS1 A;  4H4M A;  1YTU A;  4DSL A;  5SZT A;  4FLW A;  1BIZ A;  1D9D A;  2E6M A;  2FBV A;  1NK5 A;  3ZT2 A;  3OS1 A;  2W42 A;  4DLE A;  4W5R A;  4AHS A;  3VQA A;  3L3V A;  3SI6 A;  1N6Q A;  2HNZ A;  4KHY A;  2B6A A;  4ELV A;  4I9Q A;  4DLG A;  3ZSZ A;  3UIQ A;  4HCC A;  1A5W A;  4E1M A;  2XY8 A;  4NCG A;  1TL3 A;  4FLX A;  1TVR A;  1VK0 A;  2YNI A;  1WSE A;  3PO5 A;  2LSN A;  3LAK A;  1C0U A;  4HUG A;  5K14 A;  1EET A;  3QNN A;  5HRR A;  3MXM A;  4DTR A;  1NK9 A;  1NKE A;  4CEO A;  3ISN C;  1T8E A;  4C8O A;  3LP2 A;  4KI6 A;  1HYZ A;  3QNO A;  1JLE A;  3NF6 A;  4HUE A;  3ZSW A;  1RIL A;  3VQ6 A;  5HRP A;  3NGI A;  3LAL A;  1RT4 A;  4CF8 A;  3LZI A;  1L3S A;  3DLE A;  3AA5 X;  2DFF A;  3VQD A;  1IKW A;  4B9T A;  4DTP A;  3OYG A;  1B9F A;  4M3R A;  4B9U A;  3QES A;  3QET A;  3PX0 A;  4OVL A;  4FK0 A;  2KZM A;  2IGI A;  3ZSY A;  3LWM A;  2FBY A;  2BAN A;  3KKR A;  3H08 A;  1JLB A;  3V9W A;  4RW7 A;  1IG9 A;  2KZZ A;  3L2U A;  5SWM A;  4E7I A;  2Y1I A;  2GUI A;  3NF9 A;  4O0J A;  1TKX A;  2KTQ A;  3KK3 A;  4CEC A;  4IBN A;  4CIF A;  4DS5 A;  4FZZ A;  2Y1J A;  2D0B A;  3L2Q A;  3KLF A;  1YTA A;  3VQ7 A;  2YNG A;  5J1E A;  3MEC A;  3NF8 A;  3NH1 A;  4KV8 A;  3MXI A;  4CIE A;  4DFP A;  3CM6 A;  4N76 A;  2IAJ A;  3NBP A;  3L2R A;  1TGO A;  1KFD A;  3ZT3 A;  2F8T A;  1Q9Y A;  1JKH A;  1G15 A;  2ZQB A;  4XIU A;  3K5N A;  4E1N A;  1WNS A;  1Y97 A;  5J2M A;  4FJL A;  3RRG A;  2OPS A;  3NF7 A;  1NKB A;  1L3U A;  3VQC A;  3DM2 A;  2IDO A;  4FVM A;  2YHA A;  3DRS A;  3K57 A;  4KHU A;  3DLB A;  3LP0 A;  3MXJ A;  1I39 A;  3VQB A;  2QXF A;  4CGI A;  3V1O A;  1S9E A;  3DLR A;  4CHP A;  1JLQ A;  1JLC A;  4CJT A;  3TAB A;  1NOY A;  1NJX A;  3HK2 A;  2HHS A;  4GMJ B;  1EP4 A;  1C1B A;  4AHR A;  1C0M A;  3SQ1 A;  3QEV A;  1U4B A;  2YKM A;  2BDP A;  2FBX A;  2KW4 A;  3NAE A;  1NK6 A;  1HMV A;  4Z4C A;  3WNF A;  3LWL A;  5CZ2 A;  4FLY A;  3IAY A;  1NKC A;  4B9V A;  4H4O A;  1J53 A;  4FW1 A;  1L5U A;  3KTQ A;  3TR8 A;  4FCY A;  3HPG A;  3VQ4 A;  3RR8 A;  4WE1 A;  4FLT A;  4CK2 A;  1TKT A;  3SJJ A;  2ETJ A;  4CJU A;  3OYE A;  3IRX A;  1LWF A;  1RT6 A;  2OPQ A;  4DTU A;  2EX3 A;  5KRT A;  1DTT A;  3KK1 A;  1S5J A;  3AV9 A;  4O4G A;  3PV8 A;  3AVI A;  1WAJ A;  3ZSR A;  1U49 A;  4KTQ A;  3C94 A;  3AO4 A;  4HTU A;  2HHW A;  4DQS A;  3ZSV A;  1SKW A;  1WAF A;  1NK7 A;  4BE0 A;  4AHU A;  4HCB A;  4AHT A;  4DTS A;  1JLA A;  3L3U A;  3OYJ A;  5J2Q A;  4K8X A;  4CJK A;  5CZ1 A;  4DSK A;  1IKY A;  3V6D A;  3NH0 A;  1X9S A;  2XY5 A;  4BE2 A;  3SQ4 A;  3LDS A;  1Z25 A;  2OZS A;  4EZ6 A;  4DTO A;  2HHU A;  4JLH A;  4KHN A;  4DQQ A;  2VG5 A;  4HVJ A;  4Y1D A;  4RW6 A;  2Z1J A;  3AVH A;  1C1A A;  3CM5 A;  4ZTJ A;  4J2A A;  4EZ9 A;  3QO9 A;  4DSF A;  3D0P A;  3MEE A;  2RF2 A;  2HMI A;  4O55 A;  4OGC A;  4Z4G A;  4C8M A;  3RMC A;  4KKO A;  4W5Q A;  3AA4 A;  1RT1 A;  1BCM A;  3K2P A;  4CK3 A;  5C42 A;  3OYL A;  2GV9 A;  3RWU A;  4R5P A;  2RPI A;  3FFI A;  1LW2 A;  4LY7 A;  3ZT1 A;  4F3O A;  3SQ2 A;  4FJ8 A;  2R7Y A;  2HHT A;  1EXQ A;  3SPY A;  3F9K A;  4ZTF A;  1CZ9 A;  4CEZ A;  2OA8 A;  2HHX A;  1WN7 A;  5CYQ A;  2HVI A;  1VSD A;  1HRH A;  4CJL A;  4CEF A;  4GVM A;  4HHT A;  2E4L A;  3TAP A;  1X9M A;  2PZS A;  1RT2 A;  4JS4 A;  4IKF A;  3AA3 A;  2Q3S A;  3HVT A;  5T7B A;  4FK2 A;  3PX4 A;  4DWI A;  4H8K A;  4KFB A;  4Z4F A;  1C1C A;  2QKK A;  1QSL A;  4DQP A;  2G8I A;  1T03 A;  4W5O A;  2DY4 A;  1XC9 A;  1KVA A;  3AO1 A;  3PO4 A;  5KGW A;  1QHT A;  3RTV A;  4F2R A;  4FZX C;  2XY7 A;  1O1W A;  2ITG A;  3QIN A;  1S1W A;  4TSX A;  3U3G A;  3JSM A;  3K58 A;  4FW2 A;  3CFP A;  1WSI A;  1VRU A;  5FRM A;  3LPU A;  4J2D A;  1KVB A;  1ZBL A;  2BE2 A;  1C0T A;  1TKZ A;  1W9H A;  3SNN A;  1U45 A;  1RBS A;  1YT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...