3P83D

Structure of the pcna:rnase hii complex from archaeoglobus fulgidus.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
213
structure length
213
Chain Sequence
SPEFPGRLMKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQKTLDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase sliding clamp
publication title PCNA directs type 2 RNase H activity on DNA replication and repair substrates.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/dna binding protein
total genus 78
structure length 213
sequence length 213
chains with identical sequence E, F
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3p83D00
3OYAA 2HB5A 2YNHA 3MAQA 4IBNA 1B92A 4LSLA 1LWFA 1RTIA 4E1NA 1BIZA 4CEZA 1D5AA 4DTNA 1ZBHA 3RMBA 4DF4A 3QEVA 1GOCA 4DS4A 1CXQA 2IOCA 4CK3A 4KTZA 3CG7A 3LP0A 1DTTA 4W5NA 5CYQA 4CECA 3KLFA 3DRPA 2IS3A 3F9KA 4LSNA 2Y1JA 1XC9A 3TARA 3K59A 4FK2A 3AVHA 1L3SA 1CZBA 2F96A 1SKWA 2VWKA 3DYAA 4CJPA 1UA1A 4Q5VA 2VWJA 1XHZA 4W5RA 3SJJA 3QINA 2DFHA 5J2QA 4M3WA 4CK2A 3NHGA 4I2PA 4DMNA 3LZIA 1TL1A 1U47A 4FLUA 4CF8A 1KCFA 2Z1IA 1JXEA 5SZTA 4O5BA 1C0UA 4KHNA 3TAPA 2HHTA 1UWBA 4KKOA 1KLNA 3ULDA 2LSNA 3IS9A 4FW2A 1S1WA 4MQ3A 4NYFA 4KREA 3KTQA 1HYSA 5FROA 4FLWA 2AJQA 4NCBA 3VQQA 1NJZA 4ID1A 3VA0A 4HUFA 5EU7A 4YFUA 3NF9A 4BDPA 4DWIA 3V1QA 4FJNA 2FBVA 3KK2A 3WNHA 1EX4A 4CHYA 1ZBIA 3HVTA 1C1AA 1WLJA 3AVJA 3PO4A 3DMJA 1GOAA 2WONA 3S9HA 3U6FA 4KB0A 4FZXC 4CJTA 3NCIA 3P5JA 4FW1A 4W5OA 1C0TA 4F3OA 1FK9A 3ZT0A 3OYKA 2ZD1A 4CEDA 4FCYA 3DRSA 1RT3A 1R0AA 3DLBA 3O4NA 3HVRA 3OYMA 5FRNA 4CHQA 1BCOA 4HVJA 1HNVA 4EP5A 2BDPA 1TKTA 3A2FA 3EYZA 3T1AA 4DTRA 4CHZA 2Y1IA 4FVMA 1U45A 2YKNA 3KKSA 2A1RA 2HHSA 1JLFA 4CF9A 3M8QA 1Z26A 2PYLA 4DTJA 1TK0A 3HSTB 4M3UA 3AVIA 4KHYA 3ZSRA 3O4QA 3P83D 2QK9A 3WNEA 4CEQA 5JS1A 4RW9A 3CFPA 2B6AA 1TL3A 4FJ5A 1FXXA 1TKZA 3DOKA 3D45A 4KHWA 1X1PA 1EP4A 3L2WA 3T3FA 3ISNC 3S3OA 1IO2A 1U49A 1RT2A 1G15A 1HYZA 1BI4A 2DTUA 2BE2A 4CJUA 2HHVA 3LDSA 4KRFA 3ZSWA 4N76A 1KSPA 1L3TA 1J54A 2BANA 4E89A 1RBUA 1MU2A 2R7YA 1RDDA 4CGDA 3LWMA 4CHPA 5KTQA 3I0RA 4C8OA 2HHXA 1K6YA 3LAMA 4FM0A 4IFVA 1C1CA 2X74A 2E6MA 3E01A 2KFNA 4ZTJA 3OYDA 1EXQA 4JS5A 1YTUA 3OYJA 4DFKA 1T05A 3AVLA 2Q3SA 3LAKA 4CHOA 3SUOA 1TAUA 3KLHA 3IAYA 5KRTA 5KRSA 1YT3A 4DTMA 2GUIA 1BGXT 3I0SA 1W0HA 4RW7A 1NK9A 2VG6A 2EHGA 4DQQA 1VSEA 3RR8A 2HVIA 3PO5A 3LP2A 2XRIA 4CJRA 5J2PA 2VG5A 3TWHA 2HVHA 3NBPA 2PZSA 3LALA 4CJKA 4OPKA 4ELTA 3HPOA 1VRTA 2HW3A 1JKHA 1J9AA 1RT4A 3ZSOA 4E7KA 4IKFA 3RR7A 1KFDA 3VQAA 1WSFA 1BCMA 3ZSXA 1RCHA 3HM9A 4CHNA 3KKRA 4K8XA 1RBSA 2KW4A 5D3GA 3LP1A 4B08A 3QERA 4CK1A 1SL0A 1KVAA 1NK5A 4E0DA 3SQ4A 3UIQA 5HRNA 4M41A 2QXFA 4CFDA 3ITHA 2G8IA 4O0JA 1QQCA 1BIUA 1DTQA 4ZHRA 1C6VA 3LPUA 3AA2A 3NF6A 3O3GA 3OYFA 3L2RA 2OPQA 4DTOA 2KZMA 4DTSA 4BE1A 1VRUA 4IG3A 3OYGA 3I8DA 4DTUA 3QIOA 1LAWA 1ZBFA 5CYMA 1U04A 4IG0A 4DFMA 2D0BA 2YHBA 2O4GA 1WSIA 4M3ZA 3V9UA 4OKEA 3VQ7A 4DFJA 1LW0A 1RBRA 4AHUA 3SPYA 2YNFA 3MEDA 4I7FA 4KFBA 4CF0A 3L2UA 5C25A 4F2SA 3HPGA 1WSJA 4G1QA 2EX3A 4EZ9A 1D8YA 1JL1A 4Z4CA 2FC0A 4TSXA 1N6QA 4FJIA 2W42A 2XO7A 1Q9XA 4N5SA 4OLAA 1LW2A 4DFPA 4FJGA 2P51A 1GOBA 4I9QA 4KI6A 4N41A 2GBZA 3DI6A 4RW4A 3LANA 3ZSZA 1RT1A 3NE6A 4B9TA 1RNHA 4NCAA 4W5TA 1WSEA 3AVGA 1T8EA 3DLGA 3LPTA 1NK0A 3QEPA 4CJLA 3PV8A 3ZT2A 4CIFA 1S6PA 4CGHA 3PUFA 5HBMA 1QSLA 4AHVA 4LY7A 2HHQA 2OZSA 1LWEA 1NKCA 3MXJA 5I42A 3TI0A 4J2BA 2ITGA 1A5VA 2P1JA 4BDZA 1S1UA 2E6LA 5CY4A 1VSIA 4OJRA 3MXMA 2RPIA 3IRXA 2QKKA 3PY8A 4KI4A 3ZT3A 4L8RB 2QKBA 1SKRA 4CJSA 4DQRA 3AA4A 4CESA 3K5NA 2KZZA 1YVUA 1F21A 3AO4A 5JS2A 4CEEA 4CEFA 3NH0A 3OJSA 1J5OA 4OKJA 4B9SA 4KHSA 1IKVA 1KLMA 4BWMA 1BL3A 3AO1A 4B3OA 1Q9YA 1S6QA 2IDOA 1ZBUA 5C42A 1FKOA 1JLAA 1BQNA 3SYZA 1VSKA 2YHAA 4CGJA 4DSJA 4Z4FA 1NK6A 4F2RA 4KV8A 1RTJA 2XY5A 3JSMA 1NJYA 4O0IA 4KTQA 4AH9A 1RBTA 1RDCA 4LH4A 4KPYA 4I9LA 4CE9A 3OVNA 3D0PA 4DTPA 3T19A 3K5LA 1WSHA 4UQGA 3M8SA 1KRPA 4FZZA 1X9SA 4B9MA 4B9LA 4DLEA 4B9VA 1HMVA 4W5QA 3AO2A 4DSLA 3SQ2A 3L8BA 4OLBA 3U3GA 4ICLA 4J2EA 3QETA 1S1VA 4GMJB 4ELUA 2XHBA 3SUNA 2XY7A 1QTMA 1S1XA 3RRHA 1TAQA 1HYVA 2X78A 4CJQA 3NGZA 4GW6A 4CGIA 3TAFA 3ASMA 5C24A 2YV0X 4HUGA 1QSSA 3RRGA 1LWCA 3RTVA 3PX6A 1T03A 1UAXA 1ZBLA 3HL8A 1KVCA 4KTWA 4CFBA 1QSYA 1FKPA 1O1WA 4HTUA 4BACA 3AA3A 4Z4EA 3HPHA 3NGYA 4Z4HA 4Y1CA 1X9MA 2D0AA 3L2VA 1IKXA 2OPRA 4BE2A 3BGRA 3FFIA 3WNFA 1KTQA 2Z1HA 3CQ8A 2KQ2A 2IC3A 3K5OA 4RG8A 3VQ9A 3WNGA 3SI6A 3NF7A 1JLEA 4FLVA 1I3AA 1X9WA 3HO1A 4PWDA 1TV6A 3QLHA 3O3HA 3BDPA 3DM2A 2E4LA 3G0ZA 3PX4A 3AO3A 4RW6A 5CZ2A 5DK5A 2OZMA 3TAMA 2YKMA 3AVFA 3JYTA 3SPZA 4CJFA 2PY5A 1JLBA 3DRRA 2I5JA 2RKIA 4O55A 4Y1DA 4CGFA 4E7JA 4HCBA 4CIGA 3DLKA 1RT6A 1WAFA 4FXDA 1CXUA 2D5RA 4XIUA 3RMCA 4KHQA 3V81A 2G8VA 3HP9A 2OA8A 3OS2A 4E7HA 1A5XA 4FM1A 4M3RA 5KGWA 3HK2A 1S5JA 3QEIA 1N5YA 5HP1A 2FBYA 4PA1A 3MEEA 3NF8A 3OYBA 2F8SA 3ZT1A 1WAJA 4CJ3A 3HYFA 3S3MA 2OPPA 2DFEA 3KD5E 4PY5A 2G8WA 3QIPA 3VQEA 1VSMA 4C8NA 2ATQA 1HNIA 3K57A 4PQUA 4AHSA 4IFYA 1NJWA 3QNOA 4DF8A 2HNZA 1Z25A 3DOLA 3OS0A 3SV3A 2G8KA 3VQ4A 4F3TA 1RTHA 2Z1GA 4LD0A 4EP4A 1EKEA 3DLHA 4R5PA 3ZT4A 3L2QA 3V9SA 3KJVA 4OGCA 1NK8A 4Z4IA 2FBTA 1WSGA 3VA3A 3NH2A 1J53A 2OPSA 4CFCA 5K14A 1KFSA 4EZ6A 4F8RA 1QE1A 3AVNA 1JL2A 2YNGA 1BHLA 3V1OA 4MFBA 3PX0A 4CJWA 3KK3A 1ITGA 4DSIA 1TVRA 4CEAA 3ZSVA 1JLGA 3RMDA 2ETJA 3AO5A 4Q0BA 4CJ5A 3ALYA 2A1SA 3L3VA 1NOYA 4DTXA 3P1GA 5J1EA 4QOZB 3VQDA 2ZQBA 4CJVA 3RWUA 1WN7A 3M8PA 1TKXA 1D9FA 4AILC 4FLXA 1U48A 1W9HA 4FJ8A 4M42A 2HHWA 3ZSYA 1LV5A 5J2MA 1CLQA 3MXIA 3K2PA 3KLIA 4DG1A 4B8CA 4AHTA 4WE1A 3OYCA 3KD1E 3SUPA 2G8HA 3VQ8A 2RF2A 1JXBA 5SWMA 1RTDA 4E7LA 4O4GA 3AVCA 4LH5A 4Z0UA 4C8MA 3OYIA 1IKYA 2B4JA 3TAEA 4M3XA 1ZYQA 4J2AA 1L3UA 2G8FA 2RN2A 2GV9A 4QAGA 3VQ6A 4E1MA 1VK0A 3SUQA 2D0CA 1U4BA 3CFOA 4DLGA 1C0MA 1S9EA 2WOMA 3AVBA 4FJLA 1HQEA 4FJ9A 3KLGA 1C1BA 4FLTA 2HNYA 1L3VA 1Y97A 2DFFA 4DSKA 1NJXA 2DY4A 5DMRA 2JLEA 5T7BA 5FDLA 3EZ5A 4BE0A 1DLOA 4RW8A 3O3FA 2G8UA 1VSJA 3CFRA 1HJRA 3TAQA 3HJFA 1SL1A 4NYNA 4FZYA 2ZE2A 3V9WA 3TANA 3DLRA 3VQPA 4CFAA 4DSEA 5HRSA 2OYQA 3CM6A 3H08A 4FLYA 4FM2A 2X6SA 4B8AB 3SCXA 1SV5A 3VQ5A 1NOZA 4N56A 4JS4A 3G10A 3THVA 4YNQA 1A5WA 2B5JA 1BQMA 1KVBA 2FBXA 4O44A 1S1TA 3NAEA 2BGGA 4PUOA 2Z1JA 1TK5A 1RILA 4DQSA 4HHTA 3OJUA 4M3TA 2X6NA 4NCGA 1BI4B 4Z4GA 1JLCA 4DSFA 4DU1A 4JRQA 4CGGA 4FLZA 3QEXA 3SQ1A 4FK0A 1SL2A 1TK8A 1XHXA 3F73A 3C6UA 2PYJA 1L5UA 2IGIA 1XI1A 1QS4A 3AA5X 1Q8IA 4CJEA 4FK4A 5I3UA 3LP3A 3S3NA 4CJ4A 1SUQA 4H8KA 2IAJA 4FJJA 3AVMA 1TGOA 3OYHA 4CF2A 3V9XA 3IG1A 2VG7A 3QO9A 3VQCA 1RDAA 4KB1A 5KGXA 4DS5A 4I2QA 4DU4A 4E7IA 4CEBA 3K5MA 4FJ7A 1QHTA 1NKEA 3NDKA 5J2NA 4IDKA 1IH7A 2KTQA 4JLHA 1VSDA 1RT7A 1RT5A 3V4IA 3RMAA 3OYLA 3SQ0A 4FJXA 3ZCMA 2KFZA 1VSFA 1JLQA 3V6DA 1T7PA 3C94A 4HUEA 5HRPA 3LWLA 4H4MA 3KK1A 4M45A 3DLEA 2NUBA 3QEWA 4H4OA 3SZ2A 3VQBA 1IKWA 3SNNA 3QESA 4BDYA 1IG9A 3B6OA 4FYDA 4OVLA 1LAVA 2YNIA 3NGIA 1B9FA 1NK7A 1NKBA 4JRPA 4KO0A 4B9NA 3K58A 3AV9A 4ID5A 2XY6A 5HROA 4N47A 2P5OA 1I39A 4DU3A 2P5GA 3TABA 1D9DA 3AVAA 4AHRA 4QCLA 1VSLA 3NFAA 1TKDA 1HPZA 4OKKA 1HRHA 3TR8A 3C95A 3ZSQA 4CEOA 4GVMA 2HMIA 4OPJA 3LZJA 4E3SA 5HLFA 4DQPA 1B9DA 1WNSA 5E41A 3OYNA 4C8KA 3V9ZA 3NH1A 4KHUA 4ELVA 1CZ9A 4J2DA 1REVA 1ASUA 4CF1A 4CIEA 3OY9A 3KLEA 4DQIA 3MEGA 5HRRA 3HT3A 4KAZA 4K8ZA 1HQUA 3OS1A 4CERA 2HNDA 3HP6A 1ASWA 5CZ1A 3V1RA 5KI6A 1SKSA 1S9GA 3CM5A 3OYEA 3M8RA 4M3YA 4ZTFA 4FJMA 3CYMA 1VSHA 2F8TA 1ASVA 3EY1A 2O4IA 4FJHA 4C8LA 4B9UA 1YTAA 4BWJA 3QNNA 3MECA 3SV4A 4CCHA 3U3YA 3TAGA 4FJKA 1RDBA 4F4KA 1UOCA 3AVKA 1RBVA 4E19A 1UA0A 2XY8A 2JGUA 3VN5A 3HXMA 1NK4A 4AHCA 1XWLA 2HHUA 3B6PA 4HCCA 4OGEA 1BISA 1EETA 3C6TA 3L3UA 3KIOA 5FRMA
chains in the Genus database with same CATH superfamily
2ASOA 3OYAA 2HB5A 4LSLA 4DV7K 4ISEA 1VQNN 3O4WA 4DTNA 3QEVA 1CXQA 5C2DA 3U4LA 4BRKA 4CECA 3KLFA 2IS3A 1XC9A 2Y1JA 3K59A 3DYAA 2WUSA 5HL7L 4W5RA 3HBTA 3QINA 4A62A 3Q7CA 4I2PA 1TL1A 4HWIA 4BRHA 4BRIA 1DGKN 1KLNA 3SAFA 4PKGA 3KTQA 4BRLA 1T6CA 4NCBA 1NJZA 3VA0A 4YFUA 3NF9A 3KK2A 4BQZA 4XEIA 5AQXA 4DR2K 1C1AA 2HSTA 3L0QA 4CI6A 4FZXC 2WONA 3MN9A 3NCIA 2RHKA 1C0TA 2UUBK 3ZT0A 3OYKA 2ZD1A 4CEDA 1RT3A 1R0AA 3HVRA 5FRNA 4FWPA 4HVJA 2Q2RA 1TKTA 2HHSA 5AQOA 4BRCA 3KKSA 2BUPA 4M3UA 3AVIA 3ZSRA 2CGLA 4CEQA 5JS1A 2QWPA 3T3FA 1XMOK 5DM7L 1RT2A 3VEWA 3R1XA 2DTUA 1TUYA 3E9LA 1NGJA 4JI4K 4CGDA 5KTQA 1FJGK 4JI1K 1C1CA 4LF6K 1YTUA 4ILHA 1T05A 4X62K 3LDOA 4CHOA 1HKCA 3KLHA 1YT3A 2GUIA 3T69A 1W0HA 1BOTO 4CZLA 1U2VA 4JK7A 3LP2A 2VG5A 3ENHA 3LALA 3MX2A 4JKDA 1JKHA 1RT4A 4E7KA 4JI3K 5C0YA 1C0GA 3VQAA 1WSFA 1RCHA 3HM9A 2QWLA 4K8XA 4E0DA 1SL0A 4JD2A 3SQ4A 1VAZA 4BVPA 4O0JA 1DTQA 2Q97A 3WT0A 4DTSA 2HHHK 4DTUA 3WEEA 3I8DA 3QIOA 1Z05A 4DFMA 2D0BA 2YHBA 2VCPA 3V9UA 4IEIA 1RBRA 4AHUA 4FL9A 3S41A 3OBYA 2UUAK 4CF0A 2A40A 5C25A 4DQ8A 1WSJA 1JL1A 5LMUK 3OW2M 2W42A 4OLAA 2P51A 2PBDA 4N41A 2GBZA 1R59O 3O8MA 2E20A 3LANA 3NE6A 1RT1A 4B9TA 1QQOA 4W5TA 1T8EA 3H6EA 3LPTA 1NK0A 3SBGA 4M7YA 2O8FB 4CGHA 1E4GT 4IEEA 1QSLA 3WXIA 4LY7A 2OZSA 2JWLA 1LWEA 4LFAK 1T3VA 3O08A 2HF3A 3KWGA 2P1JA 4BDZA 3SLCA 1S1UA 2E6LA 1VSIA 4OJRA 3IRXA 4KI4A 1SKRA 5AQQA 1YVUA 1F21A 5JS2A 3QICA 4B9SA 5C2FA 1IG8A 1JLAA 3TPQA 1VSKA 2YHAA 4CGJA 4Z4FA 5EOYA 1NK6A 3R8EA 4H5WA 1RTJA 3QB0A 4B1UB 2XY5A 3JSMA 1NJYA 3D2FB 1RBTA 4PHTX 4JI6K 4JI2K 4NLCA 3OVNA 4CE9A 3D0PA 3T1HK 3K5LA 1NGFA 1KRPA 1X9SA 2QEXN 1NGDA 4DSLA 1VHXA 3SQ2A 4OLBA 1K73O 5E26A 4IO9L 3QETA 3WUHA 3DJCA 4KH5A 2NNWA 3H1QA 2XHBA 2XY7A 4GW6A 1RFQA 3IMXA 1GLLO 1YITN 3D6RA 4DV3K 3RTVA 3PX6A 1T03A 1H1VA 4DKWA 3ATVA 4U7BA 4KTWA 3THWA 4Z4EA 3L2VA 3WNFA 3D7EO 1QQMA 1W97L 2IC3A 2FF3B 1MA9B 3M1FA 3NF7A 5ADXH 3SI6A 2NRZA 4NB4A 1X9WA 4WFNL 3O3HA 3H1VX 3VEYA 2E4LA 3BUZB 3AO3A 4R79A 1ILYA 3TAMA 2YKMA 3JYTA 3O5BA 1JLBA 2I5JA 2RKIA 1T6DA 4FXDA 3RMCA 3V81A 2OA8A 2Q31A 3OS2A 3BY5A 1A5XA 2PAVA 3HK2A 2FBYA 3OYBA 1K8KA 2P9NA 4K42A 3KD5E 4PY5A 1X3NA 2G8WA 1N8RO 2ATQA 4AHSA 4IFYA 1NJWA 4DF8A 2HNZA 3SV3A 3OS0A 1W7AA 4EP4A 3V9SA 2A42A 1NK8A 4LFCK 4CZIA 3NH2A 1J53A 4F8RA 3BF1A 1WBBA 3V1OA 1JL2A 1BHLA 4FOEA 5M1OA 4CJWA 3L6QA 3KK3A 4DSIA 1TVRA 1JCEA 5BR8K 2E8AA 1JLGA 1SS6A 1NGBA 3TSUA 2A1SA 4DTXA 4LF7K 4QOZB 4H0TB 4CJVA 4LF8K 1D9FA 1W9HA 1VQ9N 2HHWA 3ZSYA 2KLAA 3MXIA 1QZ5A 3K2PA 5FPDA 4ISFA 3MN7A 3SUPA 2YI1A 5C15A 4E7LA 1ZC6A 4AM7A 4LH5A 4Z0UA 4C8MA 3KZBA 3THYA 3OYIA 4RWTA 4J2AA 2G8FA 2RN2A 4GV9A 3JXUA 4QAGA 3SUQA 1VK0A 3U9ZA 4BRMA 2WOMA 4RCHA 4A61A 5JLHA 4K25A 3HOSA 4FJLA 5KPZA 2ZGYA 3J8AA 4DSKA 4BC3A 5DMRA 2DY4A 3TAQA 5CE3A 1SL1A 3TTFA 4H5TA 3V9WA 1Q86O 3VQPA 4FLYA 1GLDG 2ASMA 4FM2A 2X6SA 3GL1A 3O1BA 3SK3A 3SCXA 3VQ5A 1NOZA 2O8BA 4YNQA 1BQMA 1KVBA 1OVQA 2Z1JA 2P9SB 3I33A 4M3TA 3O9UA 4BREA 5LJVA 2E2PA 1JCGA 4JRQA 3SQ1A 3QEXA 4FK0A 1DKGD 1XHXA 3C6UA 2PYJA 2YJEA 3QMLA 3THWB 1OH5A 2UXCK 3ZX0A 4FK4A 2Q0RA 4CJ4A 4H8KA 2IAJA 4HTLA 4BC4A 1TGOA 4C23A 3VQCA 3QO9A 3VOVA 1RDAA 3FZKA 3VGMA 3O1WA 5FLXO 3THXB 3V4IA 1RT5A 3OYLA 3SQ0A 4MDAA 5BN8A 1VQ5N 3V6DA 1VQLN 5HRPA 1OKJA 4H4OA 3WXLA 4JKCA 3CIPA 1IKWA 3O9TA 2P9KA 5KQ8A 4BDYA 3B6OA 4OVLA 1LAVA 4B9NA 4NXNK 2P9NB 2OTLN 5JVGL 4N47A 5F0XA 1D9DA 2E1ZA 4AHRA 3HOTA 4DR7K 4OKKA 3TR8A 2WC9A 1OH8A 1I94K 3LZJA 4DQPA 1FW6A 1XMQK 4CZJA 4H5NA 4BC5A 1CZ9A 1YJWN 1ASUA 3MEGA 3HT3A 4K8ZA 1CZAN 4JKGA 4CERA 2HNDA 3HP6A 1ZXOA 2I7NA 5KI6A 4M3YA 2ZJPL 4H0OA 5EX5A 3CYMA 1VSHA 4U67L 3DLLL 1IJJA 3IDHA 4B9UA 1YTAA 5AQWA 3MECA 4FJKA 3VMFB 4IZ9A 4F4KA 2JGUA 3CETA 3LDPA 3B6PA 3L3UA 1Q18A 5FRMA 4H0PA 2YNHA 3MAQA 1EWRA 2NLXA 4E1NA 4O8KA 3AGRA 4CD3A 1D5AA 1GOCA 4KTZA 2OTJN 3WQTA 3DRPA 4LSNA 1S3XA 3VESA 1SKWA 5ADXA 4CJPA 4A2AA 2A41A 4JK9A 4JKBA 4Q5VA 2VWJA 1XHZA 3SJJA 2FSJA 4M3WA 4CK2A 3G6EN 3LZIA 3RSEA 1U47A 1JXEA 5SZTA 4KHNA 3C0BA 3R3LA 3ULEB 2LSNA 3FLCO 4FW2A 1S1WA 1HNXK 3VQQA 5EU7A 4BDPA 4FJNA 4FWQA 2FBVA 3WNHA 5JICA 4CZKA 3DXKA 3HVTA 2NRRA 3S9HA 3D2EB 3HZ6A 4CJTA 4BR9A 4W5OA 1FK9A 4FCYA 1N36K 3TU5A 4DV0K 4AF1A 4CHQA 1BCOA 4EP5A 2QWMA 3CERA 2Y1IA 1JLFA 4CF9A 3EN9A 1Z26A 4KH4A 4JKHA 4DTJA 3O4QA 3P83D 3DOKA 4KHWA 4YHHK 4PKHA 3VF2A 3A5OC 1G15A 1HYZA 4CJUA 2HHVA 3ZSWA 1KSPA 2BANA 5AQPA 4K41A 4E89A 4GKJK 5FPMA 4IFVA 3CHWA 2BH1A 4JEPA 2NRVA 3E01A 3H3OB 5AQHA 3OYDA 1BDGA 4JS5A 1YF5L 3KK7A 3P38A 1K8AO 3AVLA 1GLBG 2HMPA 3LAKA 2OANA 5KRTA 4RW7A 3IUCA 2EHGA 2HVIA 3RR8A 3PO5A 2XRIA 3O80A 4JKGB 2PZSA 5IT9O 2QWNA 2F9WA 2QWOA 3DXMA 4DR5K 4ELTA 2HW3A 4WCEL 4IKFA 5TKYA 2E5LK 1NJIO 3LP1A 3QERA 4CK1A 1KVAA 1NK5A 1Y64A 3VETA 5AQSA 4DV4K 1DT9A 5BN9A 4ZHRA 1UA0A 4H0VB 3U9DA 1JJ2M 3NVMA 4BE1A 3T1YK 2WBNA 2VWBA 1ZBFA 3HM8A 4IG0A 2AP1A 1NM1A 1LW0A 5GAGP 3AAPA 4I7FA 4MO4A 5AQMA 3L2UA 3CMAN 2CH5A 3PIOL 1MWMA 4G1QA 2EX3A 4EZ9A 1D8YA 4FWSA 2FC0A 4FJIA 1Q9XA 3T7ZA 4DFPA 4KI6A 2UUCK 4A5AA 2Q36A 3ZSZA 3H46O 3AVGA 3GE1A 3DLGA 5AQUA 1K9MO 3F2KA 1S6PA 3PUFA 4KBOA 1SAZA 4AHVA 3J81O 2HHQA 4LF4K 4ILGB 3TI0A 3MXMA 4ELUA 3DXKB 3ID6A 3PY8A 3HSCA 4L8RB 2H3GX 5GAEP 5GADP 2KZZA 3NH0A 4AQYK 2QWRA 3OJSA 3IKMA 4OKJA 5AJ3K 3J7AP 1BL3A 2GWKA 3AO1A 3VERA 2VQEK 4UY8O 1S6QA 2GUPA 1ZBUA 1FKOA 1BQNA 5B8HA 4LC9B 4F2RA 4KV8A 4FWLA 3P31A 3LDQA 4KTQA 1RDCA 2P9PA 4DTPA 3T19A 4CBUA 5A2QO 3VEZA 5LL6Z 3U3GA 4ICLA 4A2BA 4GMJB 3VGLA 1QTMA 4BR7A 4QS8A 4CJQA 4CGIA 3TAFA 4HUGA 3RRGA 4IJNA 2PFUA 3HL8A 4BRDA 1KVCA 3CD6N 2QA4N 4CFBA 2ZJRL 1FKPA 3E9OA 4BACA 3AA3A 3PSFA 3NGYA 2QWQA 4Y1CA 2D0AA 4BE2A 3BGRA 3EE8A 4BG8A 4BRQA 1TV6A 3BDPA 1OH7A 1KQSM 3BZCA 3PX4A 5CZ2A 5AQGA 2OZMA 4FJ5A 4CJFA 4CJ7A 4O55A 4H5RA 3CPWM 3G25A 4XIUA 1GLFO 1WUAA 3HP9A 4E7HA 1NMNA 4FM1A 4BQLA 4M3RA 1S5JA 3QEIA 2HBMA 5HP1A 1N5YA 2Q0UA 4WFAL 1KAXA 2OPPA 1T44A 1VSMA 3L4IA 3VPZA 1QHAA 3QNOA 4BR4A 4CZEA 1Z25A 2G8KA 1GLCG 3VQ4A 1RTHA 3DLHA 3VEXA 4OGCA 4BGAA 5CHIA 5K14A 1OVYA 1X3MA 3MN6A 3CQXA 1BWFO 1QE1A 5AQLA 2J4RA 3P4IA 3J80O 3NMUA 1Q7YO 4Q0BA 3MK6A 4CJ5A 4DV6K 3P1GA 3C7NA 2VYPA 2E2NA 5AQJA 4YOUA 1BG3A 3EEQA 3R6MA 1VQPN 2DPNA 3P39A 1IKYA 2B4JA 3VQ6A 2D0CA 3UE5A 3CFOA 4DLGA 1C0MA 1S9EA 3SMSA 2A5XA 5KPTA 1HQEA 2D0OA 2ZGZA 1C1BA 2FSKA 4FOIA 4FLTA 1NJXA 4DV1K 2O8DA 5FDLA 4JKEA 2P9PB 3EKSA 3MN5A 4WQ5C 1VQ4N 4NYNA 2ZE2A 3TANA 3DLRA 3ZETA 3CI5A 4LFBK 1M1KO 3H08A 3CJ7A 3N4PA 3QBXA 3CJBA 4JS4A 5CR4A 3UKRA 4WQ5A 3NAEA 4YDUC 4EHTA 3OJUA 4NCGA 1Q82O 1JLCA 4DSFA 2A6AA 4DU1A 4CGGA 4DR6K 2FF6A 2EWSA 4BR2A 4L3QA 1TK8A 3F73A 1L5UA 2ZJQL 2IGIA 4CD1A 1BO5O 5M1QA 4CJEA 4YDUA 3GBTA 3LP3A 3S3NA 1SUQA 3K0SA 4WFBL 3OYHA 1Q81O 1VQKN 4I2QA 4DU4A 3AARA 5AQTA 4IDKA 5J2NA 3BEXA 4BROA 4JLHA 1RT7A 1HKGA 1E3MA 3ZCMA 2KFZA 1U2VB 4YORA 3WXMB 3H45C 1WB9A 4H4MA 3KK1A 3TSQA 3QEWA 3VQBA 3CCSN 5TKWA 3NGIA 4FVUA 2OCEA 3K58A 4EFHA 3OTOK 3FR0A 4YOVA 4DU3A 2P5GA 4QCLA 3AVAA 1VSLA 3EL2A 3ZSQA 2UU9K 4OPJA 5HLFA 4JD2B 1B9DA 3NH1A 5GAHP 1REVA 4MLEA 3M3ZA 3OY9A 3KLEA 4KAZA 1HQUA 2YX6A 3UKUA 3WEEB 5CZ1A 1SKSA 2NRHA 4A59A 2F8TA 3EY1A 3CJCA 2O4IA 3C65A 5KQDA 4C8LA 3N4QA 3C7NB 3U3YA 1ATRA 1RDBA 3AVKA 1RBVA 4E19A 3B8AX 1U6ZA 5C12A 4HCCA 3CC7N 2E88A 2HBLA 3C6TA 2P9IA 3HI0A 4IBNA 1B92A 3GG4A 1BIZA 4JHDA 3CJ9A 4CEZA 3CCMN 4DF4A 4DS4A 4CK3A 4W5NA 1DTTA 4QS9A 5CYQA 4FPBA 4BR0A 3TARA 3QFUA 3AVHA 1CZBA 1UA1A 5M1KA 4B1WB 5J2QA 3AY9A 4DMNA 3TSPA 2O8DB 1KAZA 1KCFA 2Z1IA 4O5BA 1C0UA 2HHTA 3CF5L 4KKOA 3ULDA 5AQFA 4KREA 4MQ3A 4NYFA 1HYSA 5FROA 4FLWA 3OBWA 1J6ZA 3K9KA 3PLAA 3ATUA 4DWIA 1SQKA 1EX4A 3AAQA 4JI5K 4CHYA 5I9EB 5GIOA 3PSIA 5M1PA 4JI7K 1WLJA 3AVJA 3E9PA 1GOAA 3MWPA 4YOTA 3P5JA 4OPHA 3DRSA 3DLBA 3O4NA 3CPEA 1HNVA 4Y0WA 2BDPA 4DTRA 3T1AA 4BG9A 1U45A 3M8QA 2A3ZA 1NGGA 1JCFA 2W40A 4KHYA 3HSTB 3CMEN 4RW9A 3CFPA 2B6AA 1VQMN 1FXXA 1X1PA 3A5LC 1IO2A 1U49A 3C6HA 4GNIA 4IOAL 5AQKA 1BI4A 2BE2A 1C0FA 4JN4A 1L3TA 1RBUA 1RDDA 3LWMA 3I0RA 4FM0A 5E84A 4BVOA 2WTUA 2E6MA 2F9TA 1K8KB 4ZTJA 1EXQA 3OYJA 4DFKA 2Q3SA 4XH5A 5BPMA 3IAYA 5KRSA 4DTMA 3I0SA 1HUXA 3SJHA 2VG6A 1LCUA 5J2PA 2HVHA 3TWHA 5F2RA 1VRTA 1BU6O 1D4XA 1J9AA 3ZSOA 4WF9L 3RR7A 3FFKB 3UB5A 5ELZA 3ZSXA 4CHNA 3LM9A 3KKRA 2BTFA 1ESVA 1IBLK 4M41A 2G8IA 3ITHA 2P9IB 2FSNA 3OYFA 3AA2A 2OPQA 2KZMA 3DWLA 2V51B 1VRUA 4IG3A 2E2OA 5CYMA 1U04A 5AQNA 2O4GA 1WSIA 4M3ZA 3THYB 4OKEA 3VQ7A 2ZWHA 2FLOA 3SPYA 5AQYA 5H1SQ 4A5BA 4Z4CA 4TSXA 2XO7A 4N5SA 1LW2A 1GOBA 3DI6A 2W6LA 1WSEA 3LDLA 4CJLA 3PV8A 4CIFA 3ZLJA 5HBMA 1IBMK 1NKCA 4A57A 5I42A 1NMDA 4GVEA 4J2BA 2O8BB 3ID8A 3ZT3A 4DUZK 3ZX3A 4CJSA 4BRNA 3AO4A 4CEEA 4F9OA 2ITMA 1IKVA 1LOTB 4BWMA 2HOEA 4IOXA 1Q9YA 2IDOA 4MLHA 4DSJA 4O0IA 3CCJN 4H03B 4B1YB 2HF4A 1BA1A 4UQGA 4H0YB 4B9MA 4K0KK 3SAGA 3AO2A 4QS7A 3L8BA 1S72N 3MMVA 5FPEA 4LF5K 2YV0X 3CCUN 1LWCA 1ZBLA 2P9KB 1QSYA 1O1WA 4HTUA 3I56N 2KKZA 1IKXA 1WBDA 3L4QA 3A5MC 2Z1HA 3CQ8A 3WNGA 4IJAA 1I3AA 2YJFA 4DQIA 4RW6A 3SPZA 2PY5A 4E7JA 5LMNK 3DLKA 1RT6A 2D5RA 5JMVA 2G8VA 4KHPK 5KGWA 4FWMA 4PA1A 3MEEA 3NF8A 3ZT1A 1WAJA 3S3MA 4C8NA 4BR5A 3K57A 4PQUA 4DV5K 4CZGA 4FWNA 1KC8O 1NBWA 1X9JA 3BP8A 2F4VK 1EKEA 3L2QA 5IWAK 1GLEG 3KJVA 3SMPA 4Z4IA 2FBTA 1WSGA 2OPSA 1KFSA 4PKIA 3AVNA 4ILJA 4MFBA 2P9UA 3PX0A 3W3DA 4DHYA 3ZSVA 4DB3A 2ETJA 3AO5A 3I8BA 3RMDA 1OH6A 5BPNA 1NNEA 2VGMA 3VQDA 2ZQBA 4B9QA 4NXMK 1TKXA 2IVPA 4FLXA 4M42A 4FJ8A 1CLQA 1LV5A 1BA0A 3RSEB 3KLIA 4DG1A 4B8CA 4AHTA 4RTFD 3OYCA 3MX5A 5EY4A 3G71N 4X64K 4O4GA 4EAHD 1ZYQA 3J7YP 1KD1O 4FWRA 3EE9A 4MDBA 3QDKA 4FJ9A 1W2BM 1QVFM 3WXKA 1YI2N 1L3VA 1Y97A 2DFFA 4WYBA 3MCPA 3FZFA 3EZ5A 3H3NO 4BE0A 4RW8A 2G8UA 3CFRA 4FZYA 2UXBK 2O8FA 5AZIA 2E2QA 1EO1A 3CM6A 4EIAA 4B8AB 4JK8A 1NGCA 4Z94A 5JLFA 2BGGA 1J5EK 1RILA 5BR9A 4HHTA 4FO0A 4Z4GA 3ENOA 1XC3A 1SL2A 5AFUA 2F7TA 4IWVA 5MLCQ 1QS4A 4H5VA 5HOOA 2ZM6K 3DAWA 4FJJA 3D2FA 2GELA 4KB1A 4BRAA 3IG1A 5C10A 5LY3A 1QHTA 3NDKA 4B3RK 3JAMO 1IH7A 2KTQA 1NGIA 3RMAA 5BPLA 1KXPA 1NG9A 1JLQA 3C94A 4HUEA 3LWLA 2HBJA 4M45A 3DLEA 3SNNA 3DXMB 1IG9A 1GLAG 1NK7A 1B9FA 1NKBA 4JRPA 2D0PA 3AV9A 4ID5A 5EXWA 2V7YA 3NVKA 3OHRA 3NFAA 1HPZA 2D1KA 1HRHA 3CXCM 3C95A 2HMIA 2QM1A 3O6WA 5LJWA 1WNSA 4AM6A 4C8KA 3V9ZA 1N33K 4KHUA 1HNWK 2YCHA 4J2DA 4CIEA 2FXUA 2JWKA 5AQRA 1ASWA 1XUPO 1S9GA 2IIRA 4JI8K 3FZHA 2P9UB 3CCLN 1ASVA 3CJAA 4FJHA 3FZMA 4BC2A 3TAGA 2XY8A 1HNZK 1SZ2A 3VN5A 3HXMA 4FWKA 2GWJA 1YXQA 1BISA 3K9JA 1N32K 1O13A 1LWFA 1RTIA 2NRWA 4JAXA 1ZBHA 3RMBA 2IOCA 3CG7A 3LP0A 1NU0A 4FPAA 3F9KA 1WOQA 4FK2A 4C1NK 1L3SA 2F96A 3A8YA 2VWKA 3BF3A 2V52B 2DFHA 3WQUA 1VQ7N 1IBKK 3NHGA 2WFBA 4FLUA 4CF8A 3ZEUA 3TAPA 1UWBA 3A5NC 3IS9A 5FPNA 3AGKA 2UXDK 5AZIB 4JYAK 2AJQA 3F9MA 4ID1A 4HUFA 3V1QA 3I55N 1VQ6N 2V7ZA 1ZBIA 1E4FT 3PO4A 3DMJA 3U6FA 4KB0A 4X65K 4FW1A 4F3OA 4YOYA 3KVGA 2ASPA 3OYMA 5GINA 3A2FA 1XNRK 3EYZA 3VF6A 4CHZA 4FVMA 2YKNA 2A1RA 4YY3K 2PYLA 1KAYA 1TK0A 4PL8A 2QK9A 3WNEA 1TL3A 1VQON 3RVCA 1TKZA 3MDQA 3D45A 1EP4A 3L2WA 3ISNC 1RDUA 3S3OA 4CBWA 2P9SA 2CH6A 3LDSA 2VGNA 4KRFA 4N76A 1J54A 3GDQA 1MU2A 2R7YA 4GV6A 4CHPA 1NGAA 5BRDA 4C8OA 2HHXA 1K6YA 3LAMA 1DEJA 4NLBA 2X74A 1MWKA 2KFNA 4BGBA 4CZHA 1HX1A 1TAUA 3SUOA 4DR4K 3VEVA 5BREA 2IVNA 3TTDA 3THXA 1BGXT 1NK9A 3W0LA 4NO7A 4DQQA 1VSEA 1QVGM 4CJRA 3NBPA 4CJKA 4OPKA 4BRGA 3CC2N 4MO5A 4XH1A 3HPOA 4YOXA 1YJ9N 3VEOA 5AZJA 4CVNE 3C6AA 1KFDA 1BCMA 3MWTA 3EZWA 1RBSA 2KW4A 5D3GA 4B08A 3PIPL 1HLUA 2O8EA 3UIQA 5HRNA 4CFDA 2QXFA 1QQCA 4JV5K 1BIUA 3ZYYX 4DTOA 1C6VA 3LPUA 3NF6A 3O3GA 3L2RA 2W6KA 2CGKA 3IFRA 3OYGA 4JNEA 4FWOA 4OO1J 1LAWA 3MCAB 1EQYA 1Z6RA 3O9QA 2GTDA 4DFJA 2NRTA 4YOWA 4B3TK 1NWKA 2YNFA 3MEDA 1IV0A 4KFBA 4F2SA 3QFPA 3HPGA 1N6QA 5AQIA 4E1JA 4FJGA 4I9QA 2ZF5O 4RW4A 3ZEUB 1RNHA 4NCAA 1QQNA 3QEPA 3WXJA 3ZT2A 3ZETB 3FZLA 3MXJA 3E66A 5EVZA 2ITGA 1A5VA 4KH6A 1NLVA 5CY4A 3CC4N 2VQFK 3UKRB 2QKKA 2RPIA 2QKBA 3ZX2A 4G9ZA 1QZ6A 3AA4A 4IO8A 4CESA 3K5NA 4DQRA 4CEFA 1J5OA 4ISGA 1NGHA 1XQSC 4KHSA 1KLMA 3A0IX 4B3OA 4OX9K 3F5TA 5C42A 3SYZA 4BRFA 4M7XA 1YVNA 3O9SA 3ULEA 5BRHA 3O9RA 2GEMA 4AH9A 1V4TA 4LH4A 4KPYA 4X66K 3OA9A 4I9LA 3LM2A 1WSHA 4I6MA 3M8SA 4CW7B 4FZZA 4B9LA 4DLEA 2AA4A 1HMVA 4W5QA 4BY9C 4B9VA 1N34K 4J2EA 1S1VA 3SUNA 1S1XA 3RRHA 1TAQA 1HYVA 2X78A 3NGZA 3Q7BA 3ASMA 5C24A 1QSSA 3D2EA 5M1FA 3VGKA 1UAXA 2D4WA 2YHYA 3CCVN 3LDNA 4DUYK 3CCEN 1BUPA 3HPHA 4O8UA 4Z4HA 1X9MA 3SBTA 2OPRA 4JI0K 3FFIA 3EKUA 1KTQA 2KQ2A 3K5OA 4RG8A 4LF9K 3VQ9A 3HO1A 4PWDA 4FLVA 1JLEA 4EHUA 3QLHA 3DM2A 3G0ZA 1TUUA 5DK5A 2HHUA 4FJXA 3AVFA 3DRRA 4Y1DA 4HCBA 4CGFA 4CIGA 1WAFA 1CXUA 1YIJN 4KHQA 3UKUB 3KHYA 2GX9A 1V4SA 5AZJB 3E1YA 1YUWA 1XNQK 4IFEA 2F8SA 4CJ3A 3HYFA 2DFEA 3U8XA 3QIPA 3VQEA 1ATSA 5BRFA 2CGJA 4CZFA 1HNIA 2IVOA 4K43A 2O8EB 5DM6L 4DR1K 3J7ZO 2UYTA 3DOLA 4F3TA 4B1VA 2Z1GA 4LD0A 4R5PA 3ZT4A 4IDHA 5AFUH 3VA3A 4DCHA 4CFCA 4JHDB 1P8ZA 2Q1NA 4EZ6A 2P9LA 4IXCA 2YNGA 5F1XA 4PL7A 4CBXA 1ITGA 1HKBA 4CEAA 1TYQA 2O8CA 4C1NI 4GKKK 4H0XB 3ALYA 3L3VA 1NOYA 3CCQN 5J1EA 1M90O 3ENBA 4J8FA 2KHOA 5AQZA 3RWUA 1WN7A 3M8PA 4AILC 1U48A 4B3SK 4DR3K 4XH4A 5J2MA 4WE1A 3LL3A 2QI2A 3M6GA 3KD1E 2G8HA 3VQ8A 2RF2A 2I7PA 4GY2B 1JXBA 5SWMA 1RTDA 3AVCA 3TAEA 4M3XA 1L3UA 2GV9A 4E1MA 3FGUA 4B1ZA 1U4BA 3SAHA 3AVBA 3KLGA 2QW9A 3G4SN 2HNYA 2JLEA 3JS6A 5T7BA 2HBKA 1DLOA 3O3FA 1VSJA 1HJRA 3HJFA 1YJNN 3VTHA 3GOIA 4I6MB 4CFAA 1HPMA 4DSEA 5HRSA 2OYQA 4CZMA 3TTCA 1SV5A 3THVA 4N56A 3G10A 1A5WA 2B5JA 2FBXA 5GIPA 4O44A 2NRXA 1S1TA 3M5RA 4PUOA 1G99A 1TK5A 3HTVA 4DQSA 2X6NA 1BI4B 1HJOA 4FLZA 3BZKA 1XI1A 3AA5X 3VENA 1Q8IA 4V19S 5I3UA 3EO3A 3AVMA 4FSVA 4CF2A 3V9XA 2VG7A 3KWIA 4JKFA 4B1XB 4GV3A 1YAGA 5KGXA 4DS5A 4B3MK 3FE1A 2QTDA 4E7IA 4CEBA 3K5MA 4FJ7A 1NKEA 1ATNA 5JVHL 1VSDA 1HR0K 2W41A 1VSFA 5M1NA 1T7PA 2NZTA 2NUBA 3CJ1A 4OPAA 5AQVA 3SZ2A 3QBWA 1YHQN 1RDWX 3QESA 4FYDA 2YNIA 4KO0A 2XY6A 5HROA 2P5OA 1I39A 3TABA 1TKDA 4JKAA 2RE2A 4M63C 4CEOA 4GVMA 4E3SA 3VF4A 5E41A 3HRGA 2QXLA 3OYNA 4IOCL 1S22A 4ELVA 4CF1A 2YHWA 1RGIA 5HRRA 2YHXA 1VQ8N 3OS1A 1EWQA 3V1RA 2P9LB 3CQYA 1MDUB 4O5FA 2E1YA 5KPRA 3CM5A 3OYEA 3M8RA 4ZTFA 4FJMA 5AR0A 1P90A 1TYQB 2O8CB 1ZBSA 1NGEA 4BWJA 4WQ4C 3QNNA 3SV4A 4CCHA 1UOCA 3R9PA 1GLJO 1NK4A 4AHCA 1XWLA 3CCRN 4DV2K 4OGEA 3VTIA 1EETA 4WQ4A 3KIOA 4BRPA
chains in the Genus database with same CATH topology
3OYAA 2HB5A 2YNHA 3MAQA 4IBNA 1B92A 4LSLA 1LWFA 1RTIA 4E1NA 1BIZA 4CEZA 1D5AA 4DTNA 1ZBHA 3RMBA 4DF4A 3QEVA 1GOCA 4DS4A 1CXQA 2IOCA 4CK3A 4KTZA 3CG7A 3LP0A 1DTTA 4W5NA 5CYQA 4CECA 3KLFA 3DRPA 2IS3A 3F9KA 4LSNA 2Y1JA 1XC9A 3TARA 3K59A 4FK2A 3AVHA 1L3SA 1CZBA 2F96A 1SKWA 2VWKA 3DYAA 4CJPA 1UA1A 4Q5VA 2VWJA 1XHZA 4W5RA 3SJJA 3QINA 2DFHA 5J2QA 4M3WA 4CK2A 3NHGA 4I2PA 4DMNA 3LZIA 1TL1A 1U47A 4FLUA 4CF8A 1KCFA 2Z1IA 1JXEA 5SZTA 4O5BA 1C0UA 4KHNA 3TAPA 2HHTA 1UWBA 4KKOA 1KLNA 3ULDA 2LSNA 3IS9A 4FW2A 1S1WA 4MQ3A 4NYFA 4KREA 3KTQA 1HYSA 5FROA 4FLWA 2AJQA 4NCBA 3VQQA 1NJZA 4ID1A 3VA0A 4HUFA 5EU7A 4YFUA 3NF9A 4BDPA 4DWIA 3V1QA 4FJNA 2FBVA 3KK2A 3WNHA 1EX4A 4CHYA 1ZBIA 3HVTA 1C1AA 1WLJA 3AVJA 3PO4A 3DMJA 1GOAA 2WONA 3S9HA 3U6FA 4KB0A 4FZXC 4CJTA 3NCIA 3P5JA 4FW1A 4W5OA 1C0TA 4F3OA 1FK9A 3ZT0A 3OYKA 2ZD1A 4CEDA 4FCYA 3DRSA 1RT3A 1R0AA 3DLBA 3O4NA 3HVRA 3OYMA 5FRNA 4CHQA 1BCOA 4HVJA 1HNVA 4EP5A 2BDPA 1TKTA 3A2FA 3EYZA 3T1AA 4DTRA 4CHZA 2Y1IA 4FVMA 1U45A 2YKNA 3KKSA 2A1RA 2HHSA 1JLFA 4CF9A 3M8QA 1Z26A 2PYLA 4DTJA 1TK0A 3HSTB 4M3UA 3AVIA 4KHYA 3ZSRA 3O4QA 3P83D 2QK9A 3WNEA 4CEQA 5JS1A 4RW9A 3CFPA 2B6AA 1TL3A 4FJ5A 1FXXA 1TKZA 3DOKA 3D45A 4KHWA 1X1PA 1EP4A 3L2WA 3T3FA 3ISNC 3S3OA 1IO2A 1U49A 1RT2A 1G15A 1HYZA 1BI4A 2DTUA 2BE2A 4CJUA 2HHVA 3LDSA 4KRFA 3ZSWA 4N76A 1KSPA 1L3TA 1J54A 2BANA 4E89A 1RBUA 1MU2A 2R7YA 1RDDA 4CGDA 3LWMA 4CHPA 5KTQA 3I0RA 4C8OA 2HHXA 1K6YA 3LAMA 4FM0A 4IFVA 1C1CA 2X74A 2E6MA 3E01A 2KFNA 4ZTJA 3OYDA 1EXQA 4JS5A 1YTUA 3OYJA 4DFKA 1T05A 3AVLA 2Q3SA 3LAKA 4CHOA 3SUOA 1TAUA 3KLHA 3IAYA 5KRTA 5KRSA 1YT3A 4DTMA 2GUIA 1BGXT 3I0SA 1W0HA 4RW7A 1NK9A 2VG6A 2EHGA 4DQQA 1VSEA 3RR8A 2HVIA 3PO5A 3LP2A 2XRIA 4CJRA 5J2PA 2VG5A 3TWHA 2HVHA 3NBPA 2PZSA 3LALA 4CJKA 4OPKA 4ELTA 3HPOA 1VRTA 2HW3A 1JKHA 1J9AA 1RT4A 3ZSOA 4E7KA 4IKFA 3RR7A 1KFDA 3VQAA 1WSFA 1BCMA 3ZSXA 1RCHA 3HM9A 4CHNA 3KKRA 4K8XA 1RBSA 2KW4A 5D3GA 3LP1A 4B08A 3QERA 4CK1A 1SL0A 1KVAA 1NK5A 4E0DA 3SQ4A 3UIQA 5HRNA 4M41A 2QXFA 4CFDA 3ITHA 2G8IA 4O0JA 1QQCA 1BIUA 1DTQA 4ZHRA 1C6VA 3LPUA 3AA2A 3NF6A 3O3GA 3OYFA 3L2RA 2OPQA 4DTOA 2KZMA 4DTSA 4BE1A 1VRUA 4IG3A 3OYGA 3I8DA 4DTUA 3QIOA 1LAWA 1ZBFA 5CYMA 1U04A 4IG0A 4DFMA 2D0BA 2YHBA 2O4GA 1WSIA 4M3ZA 3V9UA 4OKEA 3VQ7A 4DFJA 1LW0A 1RBRA 4AHUA 3SPYA 2YNFA 3MEDA 4I7FA 4KFBA 4CF0A 3L2UA 5C25A 4F2SA 3HPGA 1WSJA 4G1QA 2EX3A 4EZ9A 1D8YA 1JL1A 4Z4CA 2FC0A 4TSXA 1N6QA 4FJIA 2W42A 2XO7A 1Q9XA 4N5SA 4OLAA 1LW2A 4DFPA 4FJGA 2P51A 1GOBA 4I9QA 4KI6A 4N41A 2GBZA 3DI6A 4RW4A 3LANA 3ZSZA 1RT1A 3NE6A 4B9TA 1RNHA 4NCAA 4W5TA 1WSEA 3AVGA 1T8EA 3DLGA 3LPTA 1NK0A 3QEPA 4CJLA 3PV8A 3ZT2A 4CIFA 1S6PA 4CGHA 3PUFA 5HBMA 1QSLA 4AHVA 4LY7A 2HHQA 2OZSA 1LWEA 1NKCA 3MXJA 5I42A 3TI0A 4J2BA 2ITGA 1A5VA 2P1JA 4BDZA 1S1UA 2E6LA 5CY4A 1VSIA 4OJRA 3MXMA 2RPIA 3IRXA 2QKKA 3PY8A 4KI4A 3ZT3A 4L8RB 2QKBA 1SKRA 4CJSA 4DQRA 3AA4A 4CESA 3K5NA 2KZZA 1YVUA 1F21A 3AO4A 5JS2A 4CEEA 4CEFA 3NH0A 3OJSA 1J5OA 4OKJA 4B9SA 4KHSA 1IKVA 1KLMA 4BWMA 1BL3A 3AO1A 4B3OA 1Q9YA 1S6QA 2IDOA 1ZBUA 5C42A 1FKOA 1JLAA 1BQNA 3SYZA 1VSKA 2YHAA 4CGJA 4DSJA 4Z4FA 1NK6A 4F2RA 4KV8A 1RTJA 2XY5A 3JSMA 1NJYA 4O0IA 4KTQA 4AH9A 1RBTA 1RDCA 4LH4A 4KPYA 4I9LA 4CE9A 3OVNA 3D0PA 4DTPA 3T19A 3K5LA 1WSHA 4UQGA 3M8SA 1KRPA 4FZZA 1X9SA 4B9MA 4B9LA 4DLEA 4B9VA 1HMVA 4W5QA 3AO2A 4DSLA 3SQ2A 3L8BA 4OLBA 3U3GA 4ICLA 4J2EA 3QETA 1S1VA 4GMJB 4ELUA 2XHBA 3SUNA 2XY7A 1QTMA 1S1XA 3RRHA 1TAQA 1HYVA 2X78A 4CJQA 3NGZA 4GW6A 4CGIA 3TAFA 3ASMA 5C24A 2YV0X 4HUGA 1QSSA 3RRGA 1LWCA 3RTVA 3PX6A 1T03A 1UAXA 1ZBLA 3HL8A 1KVCA 4KTWA 4CFBA 1QSYA 1FKPA 1O1WA 4HTUA 4BACA 3AA3A 4Z4EA 3HPHA 3NGYA 4Z4HA 4Y1CA 1X9MA 2D0AA 3L2VA 1IKXA 2OPRA 4BE2A 3BGRA 3FFIA 3WNFA 1KTQA 2Z1HA 3CQ8A 2KQ2A 2IC3A 3K5OA 4RG8A 3VQ9A 3WNGA 3SI6A 3NF7A 1JLEA 4FLVA 1I3AA 1X9WA 3HO1A 4PWDA 1TV6A 3QLHA 3O3HA 3BDPA 3DM2A 2E4LA 3G0ZA 3PX4A 3AO3A 4RW6A 5CZ2A 5DK5A 2OZMA 3TAMA 2YKMA 3AVFA 3JYTA 3SPZA 4CJFA 2PY5A 1JLBA 3DRRA 2I5JA 2RKIA 4O55A 4Y1DA 4CGFA 4E7JA 4HCBA 4CIGA 3DLKA 1RT6A 1WAFA 4FXDA 1CXUA 2D5RA 4XIUA 3RMCA 4KHQA 3V81A 2G8VA 3HP9A 2OA8A 3OS2A 4E7HA 1A5XA 4FM1A 4M3RA 5KGWA 3HK2A 1S5JA 3QEIA 1N5YA 5HP1A 2FBYA 4PA1A 3MEEA 3NF8A 3OYBA 2F8SA 3ZT1A 1WAJA 4CJ3A 3HYFA 3S3MA 2OPPA 2DFEA 3KD5E 4PY5A 2G8WA 3QIPA 3VQEA 1VSMA 4C8NA 2ATQA 1HNIA 3K57A 4PQUA 4AHSA 4IFYA 1NJWA 3QNOA 4DF8A 2HNZA 1Z25A 3DOLA 3OS0A 3SV3A 2G8KA 3VQ4A 4F3TA 1RTHA 2Z1GA 4LD0A 4EP4A 1EKEA 3DLHA 4R5PA 3ZT4A 3L2QA 3V9SA 3KJVA 4OGCA 1NK8A 4Z4IA 2FBTA 1WSGA 3VA3A 3NH2A 1J53A 2OPSA 4CFCA 5K14A 1KFSA 4EZ6A 4F8RA 1QE1A 3AVNA 1JL2A 2YNGA 1BHLA 3V1OA 4MFBA 3PX0A 4CJWA 3KK3A 1ITGA 4DSIA 1TVRA 4CEAA 3ZSVA 1JLGA 3RMDA 2ETJA 3AO5A 4Q0BA 4CJ5A 3ALYA 2A1SA 3L3VA 1NOYA 4DTXA 3P1GA 5J1EA 4QOZB 3VQDA 2ZQBA 4CJVA 3RWUA 1WN7A 3M8PA 1TKXA 1D9FA 4AILC 4FLXA 1U48A 1W9HA 4FJ8A 4M42A 2HHWA 3ZSYA 1LV5A 5J2MA 1CLQA 3MXIA 3K2PA 3KLIA 4DG1A 4B8CA 4AHTA 4WE1A 3OYCA 3KD1E 3SUPA 2G8HA 3VQ8A 2RF2A 1JXBA 5SWMA 1RTDA 4E7LA 4O4GA 3AVCA 4LH5A 4Z0UA 4C8MA 3OYIA 1IKYA 2B4JA 3TAEA 4M3XA 1ZYQA 4J2AA 1L3UA 2G8FA 2RN2A 2GV9A 4QAGA 3VQ6A 4E1MA 1VK0A 3SUQA 2D0CA 1U4BA 3CFOA 4DLGA 1C0MA 1S9EA 2WOMA 3AVBA 4FJLA 1HQEA 4FJ9A 3KLGA 1C1BA 4FLTA 2HNYA 1L3VA 1Y97A 2DFFA 4DSKA 1NJXA 2DY4A 5DMRA 2JLEA 5T7BA 5FDLA 3EZ5A 4BE0A 1DLOA 4RW8A 3O3FA 2G8UA 1VSJA 3CFRA 1HJRA 3TAQA 3HJFA 1SL1A 4NYNA 4FZYA 2ZE2A 3V9WA 3TANA 3DLRA 3VQPA 4CFAA 4DSEA 5HRSA 2OYQA 3CM6A 3H08A 4FLYA 4FM2A 2X6SA 4B8AB 3SCXA 1SV5A 3VQ5A 1NOZA 4N56A 4JS4A 3G10A 3THVA 4YNQA 1A5WA 2B5JA 1BQMA 1KVBA 2FBXA 4O44A 1S1TA 3NAEA 2BGGA 4PUOA 2Z1JA 1TK5A 1RILA 4DQSA 4HHTA 3OJUA 4M3TA 2X6NA 4NCGA 1BI4B 4Z4GA 1JLCA 4DSFA 4DU1A 4JRQA 4CGGA 4FLZA 3QEXA 3SQ1A 4FK0A 1SL2A 1TK8A 1XHXA 3F73A 3C6UA 2PYJA 1L5UA 2IGIA 1XI1A 1QS4A 3AA5X 1Q8IA 4CJEA 4FK4A 5I3UA 3LP3A 3S3NA 4CJ4A 1SUQA 4H8KA 2IAJA 4FJJA 3AVMA 1TGOA 3OYHA 4CF2A 3V9XA 3IG1A 2VG7A 3QO9A 3VQCA 1RDAA 4KB1A 5KGXA 4DS5A 4I2QA 4DU4A 4E7IA 4CEBA 3K5MA 4FJ7A 1QHTA 1NKEA 3NDKA 5J2NA 4IDKA 1IH7A 2KTQA 4JLHA 1VSDA 1RT7A 1RT5A 3V4IA 3RMAA 3OYLA 3SQ0A 4FJXA 3ZCMA 2KFZA 1VSFA 1JLQA 3V6DA 1T7PA 3C94A 4HUEA 5HRPA 3LWLA 4H4MA 3KK1A 4M45A 3DLEA 2NUBA 3QEWA 4H4OA 3SZ2A 3VQBA 1IKWA 3SNNA 3QESA 4BDYA 1IG9A 3B6OA 4FYDA 4OVLA 1LAVA 2YNIA 3NGIA 1B9FA 1NK7A 1NKBA 4JRPA 4KO0A 4B9NA 3K58A 3AV9A 4ID5A 2XY6A 5HROA 4N47A 2P5OA 1I39A 4DU3A 2P5GA 3TABA 1D9DA 3AVAA 4AHRA 4QCLA 1VSLA 3NFAA 1TKDA 1HPZA 4OKKA 1HRHA 3TR8A 3C95A 3ZSQA 4CEOA 4GVMA 2HMIA 4OPJA 3LZJA 4E3SA 5HLFA 4DQPA 1B9DA 1WNSA 5E41A 3OYNA 4C8KA 3V9ZA 3NH1A 4KHUA 4ELVA 1CZ9A 4J2DA 1REVA 1ASUA 4CF1A 4CIEA 3OY9A 3KLEA 4DQIA 3MEGA 5HRRA 3HT3A 4KAZA 4K8ZA 1HQUA 3OS1A 4CERA 2HNDA 3HP6A 1ASWA 5CZ1A 3V1RA 5KI6A 1SKSA 1S9GA 3CM5A 3OYEA 3M8RA 4M3YA 4ZTFA 4FJMA 3CYMA 1VSHA 2F8TA 1ASVA 3EY1A 2O4IA 4FJHA 4C8LA 4B9UA 1YTAA 4BWJA 3QNNA 3MECA 3SV4A 4CCHA 3U3YA 3TAGA 4FJKA 1RDBA 4F4KA 1UOCA 3AVKA 1RBVA 4E19A 1UA0A 2XY8A 2JGUA 3VN5A 3HXMA 1NK4A 4AHCA 1XWLA 2HHUA 3B6PA 4HCCA 4OGEA 1BISA 1EETA 3C6TA 3L3UA 3KIOA 5FRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYA A;  2HB5 A;  2YNH A;  3MAQ A;  4IBN A;  1B92 A;  4LSL A;  1LWF A;  1RTI A;  4E1N A;  1BIZ A;  4CEZ A;  1D5A A;  4DTN A;  1ZBH A;  3RMB A;  4DF4 A;  3QEV A;  1GOC A;  4DS4 A;  1CXQ A;  2IOC A;  4CK3 A;  4KTZ A;  3CG7 A;  3LP0 A;  1DTT A;  4W5N A;  5CYQ A;  4CEC A;  3KLF A;  3DRP A;  2IS3 A;  3F9K A;  4LSN A;  2Y1J A;  1XC9 A;  3TAR A;  3K59 A;  4FK2 A;  3AVH A;  1L3S A;  1CZB A;  2F96 A;  1SKW A;  2VWK A;  3DYA A;  4CJP A;  1UA1 A;  4Q5V A;  2VWJ A;  1XHZ A;  4W5R A;  3SJJ A;  3QIN A;  2DFH A;  5J2Q A;  4M3W A;  4CK2 A;  3NHG A;  4I2P A;  4DMN A;  3LZI A;  1TL1 A;  1U47 A;  4FLU A;  4CF8 A;  1KCF A;  2Z1I A;  1JXE A;  5SZT A;  4O5B A;  1C0U A;  4KHN A;  3TAP A;  2HHT A;  1UWB A;  4KKO A;  1KLN A;  3ULD A;  2LSN A;  3IS9 A;  4FW2 A;  1S1W A;  4MQ3 A;  4NYF A;  4KRE A;  3KTQ A;  1HYS A;  5FRO A;  4FLW A;  2AJQ A;  4NCB A;  3VQQ A;  1NJZ A;  4ID1 A;  3VA0 A;  4HUF A;  5EU7 A;  4YFU A;  3NF9 A;  4BDP A;  4DWI A;  3V1Q A;  4FJN A;  2FBV A;  3KK2 A;  3WNH A;  1EX4 A;  4CHY A;  1ZBI A;  3HVT A;  1C1A A;  1WLJ A;  3AVJ A;  3PO4 A;  3DMJ A;  1GOA A;  2WON A;  3S9H A;  3U6F A;  4KB0 A;  4FZX C;  4CJT A;  3NCI A;  3P5J A;  4FW1 A;  4W5O A;  1C0T A;  4F3O A;  1FK9 A;  3ZT0 A;  3OYK A;  2ZD1 A;  4CED A;  4FCY A;  3DRS A;  1RT3 A;  1R0A A;  3DLB A;  3O4N A;  3HVR A;  3OYM A;  5FRN A;  4CHQ A;  1BCO A;  4HVJ A;  1HNV A;  4EP5 A;  2BDP A;  1TKT A;  3A2F A;  3EYZ A;  3T1A A;  4DTR A;  4CHZ A;  2Y1I A;  4FVM A;  1U45 A;  2YKN A;  3KKS A;  2A1R A;  2HHS A;  1JLF A;  4CF9 A;  3M8Q A;  1Z26 A;  2PYL A;  4DTJ A;  1TK0 A;  3HST B;  4M3U A;  3AVI A;  4KHY A;  3ZSR A;  3O4Q A;  3P83 D;  2QK9 A;  3WNE A;  4CEQ A;  5JS1 A;  4RW9 A;  3CFP A;  2B6A A;  1TL3 A;  4FJ5 A;  1FXX A;  1TKZ A;  3DOK A;  3D45 A;  4KHW A;  1X1P A;  1EP4 A;  3L2W A;  3T3F A;  3ISN C;  3S3O A;  1IO2 A;  1U49 A;  1RT2 A;  1G15 A;  1HYZ A;  1BI4 A;  2DTU A;  2BE2 A;  4CJU A;  2HHV A;  3LDS A;  4KRF A;  3ZSW A;  4N76 A;  1KSP A;  1L3T A;  1J54 A;  2BAN A;  4E89 A;  1RBU A;  1MU2 A;  2R7Y A;  1RDD A;  4CGD A;  3LWM A;  4CHP A;  5KTQ A;  3I0R A;  4C8O A;  2HHX A;  1K6Y A;  3LAM A;  4FM0 A;  4IFV A;  1C1C A;  2X74 A;  2E6M A;  3E01 A;  2KFN A;  4ZTJ A;  3OYD A;  1EXQ A;  4JS5 A;  1YTU A;  3OYJ A;  4DFK A;  1T05 A;  3AVL A;  2Q3S A;  3LAK A;  4CHO A;  3SUO A;  1TAU A;  3KLH A;  3IAY A;  5KRT A;  5KRS A;  1YT3 A;  4DTM A;  2GUI A;  1BGX T;  3I0S A;  1W0H A;  4RW7 A;  1NK9 A;  2VG6 A;  2EHG A;  4DQQ A;  1VSE A;  3RR8 A;  2HVI A;  3PO5 A;  3LP2 A;  2XRI A;  4CJR A;  5J2P A;  2VG5 A;  3TWH A;  2HVH A;  3NBP A;  2PZS A;  3LAL A;  4CJK A;  4OPK A;  4ELT A;  3HPO A;  1VRT A;  2HW3 A;  1JKH A;  1J9A A;  1RT4 A;  3ZSO A;  4E7K A;  4IKF A;  3RR7 A;  1KFD A;  3VQA A;  1WSF A;  1BCM A;  3ZSX A;  1RCH A;  3HM9 A;  4CHN A;  3KKR A;  4K8X A;  1RBS A;  2KW4 A;  5D3G A;  3LP1 A;  4B08 A;  3QER A;  4CK1 A;  1SL0 A;  1KVA A;  1NK5 A;  4E0D A;  3SQ4 A;  3UIQ A;  5HRN A;  4M41 A;  2QXF A;  4CFD A;  3ITH A;  2G8I A;  4O0J A;  1QQC A;  1BIU A;  1DTQ A;  4ZHR A;  1C6V A;  3LPU A;  3AA2 A;  3NF6 A;  3O3G A;  3OYF A;  3L2R A;  2OPQ A;  4DTO A;  2KZM A;  4DTS A;  4BE1 A;  1VRU A;  4IG3 A;  3OYG A;  3I8D A;  4DTU A;  3QIO A;  1LAW A;  1ZBF A;  5CYM A;  1U04 A;  4IG0 A;  4DFM A;  2D0B A;  2YHB A;  2O4G A;  1WSI A;  4M3Z A;  3V9U A;  4OKE A;  3VQ7 A;  4DFJ A;  1LW0 A;  1RBR A;  4AHU A;  3SPY A;  2YNF A;  3MED A;  4I7F A;  4KFB A;  4CF0 A;  3L2U A;  5C25 A;  4F2S A;  3HPG A;  1WSJ A;  4G1Q A;  2EX3 A;  4EZ9 A;  1D8Y A;  1JL1 A;  4Z4C A;  2FC0 A;  4TSX A;  1N6Q A;  4FJI A;  2W42 A;  2XO7 A;  1Q9X A;  4N5S A;  4OLA A;  1LW2 A;  4DFP A;  4FJG A;  2P51 A;  1GOB A;  4I9Q A;  4KI6 A;  4N41 A;  2GBZ A;  3DI6 A;  4RW4 A;  3LAN A;  3ZSZ A;  1RT1 A;  3NE6 A;  4B9T A;  1RNH A;  4NCA A;  4W5T A;  1WSE A;  3AVG A;  1T8E A;  3DLG A;  3LPT A;  1NK0 A;  3QEP A;  4CJL A;  3PV8 A;  3ZT2 A;  4CIF A;  1S6P A;  4CGH A;  3PUF A;  5HBM A;  1QSL A;  4AHV A;  4LY7 A;  2HHQ A;  2OZS A;  1LWE A;  1NKC A;  3MXJ A;  5I42 A;  3TI0 A;  4J2B A;  2ITG A;  1A5V A;  2P1J A;  4BDZ A;  1S1U A;  2E6L A;  5CY4 A;  1VSI A;  4OJR A;  3MXM A;  2RPI A;  3IRX A;  2QKK A;  3PY8 A;  4KI4 A;  3ZT3 A;  4L8R B;  2QKB A;  1SKR A;  4CJS A;  4DQR A;  3AA4 A;  4CES A;  3K5N A;  2KZZ A;  1YVU A;  1F21 A;  3AO4 A;  5JS2 A;  4CEE A;  4CEF A;  3NH0 A;  3OJS A;  1J5O A;  4OKJ A;  4B9S A;  4KHS A;  1IKV A;  1KLM A;  4BWM A;  1BL3 A;  3AO1 A;  4B3O A;  1Q9Y A;  1S6Q A;  2IDO A;  1ZBU A;  5C42 A;  1FKO A;  1JLA A;  1BQN A;  3SYZ A;  1VSK A;  2YHA A;  4CGJ A;  4DSJ A;  4Z4F A;  1NK6 A;  4F2R A;  4KV8 A;  1RTJ A;  2XY5 A;  3JSM A;  1NJY A;  4O0I A;  4KTQ A;  4AH9 A;  1RBT A;  1RDC A;  4LH4 A;  4KPY A;  4I9L A;  4CE9 A;  3OVN A;  3D0P A;  4DTP A;  3T19 A;  3K5L A;  1WSH A;  4UQG A;  3M8S A;  1KRP A;  4FZZ A;  1X9S A;  4B9M A;  4B9L A;  4DLE A;  4B9V A;  1HMV A;  4W5Q A;  3AO2 A;  4DSL A;  3SQ2 A;  3L8B A;  4OLB A;  3U3G A;  4ICL A;  4J2E A;  3QET A;  1S1V A;  4GMJ B;  4ELU A;  2XHB A;  3SUN A;  2XY7 A;  1QTM A;  1S1X A;  3RRH A;  1TAQ A;  1HYV A;  2X78 A;  4CJQ A;  3NGZ A;  4GW6 A;  4CGI A;  3TAF A;  3ASM A;  5C24 A;  2YV0 X;  4HUG A;  1QSS A;  3RRG A;  1LWC A;  3RTV A;  3PX6 A;  1T03 A;  1UAX A;  1ZBL A;  3HL8 A;  1KVC A;  4KTW A;  4CFB A;  1QSY A;  1FKP A;  1O1W A;  4HTU A;  4BAC A;  3AA3 A;  4Z4E A;  3HPH A;  3NGY A;  4Z4H A;  4Y1C A;  1X9M A;  2D0A A;  3L2V A;  1IKX A;  2OPR A;  4BE2 A;  3BGR A;  3FFI A;  3WNF A;  1KTQ A;  2Z1H A;  3CQ8 A;  2KQ2 A;  2IC3 A;  3K5O A;  4RG8 A;  3VQ9 A;  3WNG A;  3SI6 A;  3NF7 A;  1JLE A;  4FLV A;  1I3A A;  1X9W A;  3HO1 A;  4PWD A;  1TV6 A;  3QLH A;  3O3H A;  3BDP A;  3DM2 A;  2E4L A;  3G0Z A;  3PX4 A;  3AO3 A;  4RW6 A;  5CZ2 A;  5DK5 A;  2OZM A;  3TAM A;  2YKM A;  3AVF A;  3JYT A;  3SPZ A;  4CJF A;  2PY5 A;  1JLB A;  3DRR A;  2I5J A;  2RKI A;  4O55 A;  4Y1D A;  4CGF A;  4E7J A;  4HCB A;  4CIG A;  3DLK A;  1RT6 A;  1WAF A;  4FXD A;  1CXU A;  2D5R A;  4XIU A;  3RMC A;  4KHQ A;  3V81 A;  2G8V A;  3HP9 A;  2OA8 A;  3OS2 A;  4E7H A;  1A5X A;  4FM1 A;  4M3R A;  5KGW A;  3HK2 A;  1S5J A;  3QEI A;  1N5Y A;  5HP1 A;  2FBY A;  4PA1 A;  3MEE A;  3NF8 A;  3OYB A;  2F8S A;  3ZT1 A;  1WAJ A;  4CJ3 A;  3HYF A;  3S3M A;  2OPP A;  2DFE A;  3KD5 E;  4PY5 A;  2G8W A;  3QIP A;  3VQE A;  1VSM A;  4C8N A;  2ATQ A;  1HNI A;  3K57 A;  4PQU A;  4AHS A;  4IFY A;  1NJW A;  3QNO A;  4DF8 A;  2HNZ A;  1Z25 A;  3DOL A;  3OS0 A;  3SV3 A;  2G8K A;  3VQ4 A;  4F3T A;  1RTH A;  2Z1G A;  4LD0 A;  4EP4 A;  1EKE A;  3DLH A;  4R5P A;  3ZT4 A;  3L2Q A;  3V9S A;  3KJV A;  4OGC A;  1NK8 A;  4Z4I A;  2FBT A;  1WSG A;  3VA3 A;  3NH2 A;  1J53 A;  2OPS A;  4CFC A;  5K14 A;  1KFS A;  4EZ6 A;  4F8R A;  1QE1 A;  3AVN A;  1JL2 A;  2YNG A;  1BHL A;  3V1O A;  4MFB A;  3PX0 A;  4CJW A;  3KK3 A;  1ITG A;  4DSI A;  1TVR A;  4CEA A;  3ZSV A;  1JLG A;  3RMD A;  2ETJ A;  3AO5 A;  4Q0B A;  4CJ5 A;  3ALY A;  2A1S A;  3L3V A;  1NOY A;  4DTX A;  3P1G A;  5J1E A;  4QOZ B;  3VQD A;  2ZQB A;  4CJV A;  3RWU A;  1WN7 A;  3M8P A;  1TKX A;  1D9F A;  4AIL C;  4FLX A;  1U48 A;  1W9H A;  4FJ8 A;  4M42 A;  2HHW A;  3ZSY A;  1LV5 A;  5J2M A;  1CLQ A;  3MXI A;  3K2P A;  3KLI A;  4DG1 A;  4B8C A;  4AHT A;  4WE1 A;  3OYC A;  3KD1 E;  3SUP A;  2G8H A;  3VQ8 A;  2RF2 A;  1JXB A;  5SWM A;  1RTD A;  4E7L A;  4O4G A;  3AVC A;  4LH5 A;  4Z0U A;  4C8M A;  3OYI A;  1IKY A;  2B4J A;  3TAE A;  4M3X A;  1ZYQ A;  4J2A A;  1L3U A;  2G8F A;  2RN2 A;  2GV9 A;  4QAG A;  3VQ6 A;  4E1M A;  1VK0 A;  3SUQ A;  2D0C A;  1U4B A;  3CFO A;  4DLG A;  1C0M A;  1S9E A;  2WOM A;  3AVB A;  4FJL A;  1HQE A;  4FJ9 A;  3KLG A;  1C1B A;  4FLT A;  2HNY A;  1L3V A;  1Y97 A;  2DFF A;  4DSK A;  1NJX A;  2DY4 A;  5DMR A;  2JLE A;  5T7B A;  5FDL A;  3EZ5 A;  4BE0 A;  1DLO A;  4RW8 A;  3O3F A;  2G8U A;  1VSJ A;  3CFR A;  1HJR A;  3TAQ A;  3HJF A;  1SL1 A;  4NYN A;  4FZY A;  2ZE2 A;  3V9W A;  3TAN A;  3DLR A;  3VQP A;  4CFA A;  4DSE A;  5HRS A;  2OYQ A;  3CM6 A;  3H08 A;  4FLY A;  4FM2 A;  2X6S A;  4B8A B;  3SCX A;  1SV5 A;  3VQ5 A;  1NOZ A;  4N56 A;  4JS4 A;  3G10 A;  3THV A;  4YNQ A;  1A5W A;  2B5J A;  1BQM A;  1KVB A;  2FBX A;  4O44 A;  1S1T A;  3NAE A;  2BGG A;  4PUO A;  2Z1J A;  1TK5 A;  1RIL A;  4DQS A;  4HHT A;  3OJU A;  4M3T A;  2X6N A;  4NCG A;  1BI4 B;  4Z4G A;  1JLC A;  4DSF A;  4DU1 A;  4JRQ A;  4CGG A;  4FLZ A;  3QEX A;  3SQ1 A;  4FK0 A;  1SL2 A;  1TK8 A;  1XHX A;  3F73 A;  3C6U A;  2PYJ A;  1L5U A;  2IGI A;  1XI1 A;  1QS4 A;  3AA5 X;  1Q8I A;  4CJE A;  4FK4 A;  5I3U A;  3LP3 A;  3S3N A;  4CJ4 A;  1SUQ A;  4H8K A;  2IAJ A;  4FJJ A;  3AVM A;  1TGO A;  3OYH A;  4CF2 A;  3V9X A;  3IG1 A;  2VG7 A;  3QO9 A;  3VQC A;  1RDA A;  4KB1 A;  5KGX A;  4DS5 A;  4I2Q A;  4DU4 A;  4E7I A;  4CEB A;  3K5M A;  4FJ7 A;  1QHT A;  1NKE A;  3NDK A;  5J2N A;  4IDK A;  1IH7 A;  2KTQ A;  4JLH A;  1VSD A;  1RT7 A;  1RT5 A;  3V4I A;  3RMA A;  3OYL A;  3SQ0 A;  4FJX A;  3ZCM A;  2KFZ A;  1VSF A;  1JLQ A;  3V6D A;  1T7P A;  3C94 A;  4HUE A;  5HRP A;  3LWL A;  4H4M A;  3KK1 A;  4M45 A;  3DLE A;  2NUB A;  3QEW A;  4H4O A;  3SZ2 A;  3VQB A;  1IKW A;  3SNN A;  3QES A;  4BDY A;  1IG9 A;  3B6O A;  4FYD A;  4OVL A;  1LAV A;  2YNI A;  3NGI A;  1B9F A;  1NK7 A;  1NKB A;  4JRP A;  4KO0 A;  4B9N A;  3K58 A;  3AV9 A;  4ID5 A;  2XY6 A;  5HRO A;  4N47 A;  2P5O A;  1I39 A;  4DU3 A;  2P5G A;  3TAB A;  1D9D A;  3AVA A;  4AHR A;  4QCL A;  1VSL A;  3NFA A;  1TKD A;  1HPZ A;  4OKK A;  1HRH A;  3TR8 A;  3C95 A;  3ZSQ A;  4CEO A;  4GVM A;  2HMI A;  4OPJ A;  3LZJ A;  4E3S A;  5HLF A;  4DQP A;  1B9D A;  1WNS A;  5E41 A;  3OYN A;  4C8K A;  3V9Z A;  3NH1 A;  4KHU A;  4ELV A;  1CZ9 A;  4J2D A;  1REV A;  1ASU A;  4CF1 A;  4CIE A;  3OY9 A;  3KLE A;  4DQI A;  3MEG A;  5HRR A;  3HT3 A;  4KAZ A;  4K8Z A;  1HQU A;  3OS1 A;  4CER A;  2HND A;  3HP6 A;  1ASW A;  5CZ1 A;  3V1R A;  5KI6 A;  1SKS A;  1S9G A;  3CM5 A;  3OYE A;  3M8R A;  4M3Y A;  4ZTF A;  4FJM A;  3CYM A;  1VSH A;  2F8T A;  1ASV A;  3EY1 A;  2O4I A;  4FJH A;  4C8L A;  4B9U A;  1YTA A;  4BWJ A;  3QNN A;  3MEC A;  3SV4 A;  4CCH A;  3U3Y A;  3TAG A;  4FJK A;  1RDB A;  4F4K A;  1UOC A;  3AVK A;  1RBV A;  4E19 A;  1UA0 A;  2XY8 A;  2JGU A;  3VN5 A;  3HXM A;  1NK4 A;  4AHC A;  1XWL A;  2HHU A;  3B6P A;  4HCC A;  4OGE A;  1BIS A;  1EET A;  3C6T A;  3L3U A;  3KIO A;  5FRM A; 
#chains in the Genus database with same CATH topology
 2ASO A;  3OYA A;  2HB5 A;  4LSL A;  4DV7 K;  4ISE A;  1VQN N;  3O4W A;  4DTN A;  3QEV A;  1CXQ A;  5C2D A;  3U4L A;  4BRK A;  4CEC A;  3KLF A;  2IS3 A;  1XC9 A;  2Y1J A;  3K59 A;  3DYA A;  2WUS A;  5HL7 L;  4W5R A;  3HBT A;  3QIN A;  4A62 A;  3Q7C A;  4I2P A;  1TL1 A;  4HWI A;  4BRH A;  4BRI A;  1DGK N;  1KLN A;  3SAF A;  4PKG A;  3KTQ A;  4BRL A;  1T6C A;  4NCB A;  1NJZ A;  3VA0 A;  4YFU A;  3NF9 A;  3KK2 A;  4BQZ A;  4XEI A;  5AQX A;  4DR2 K;  1C1A A;  2HST A;  3L0Q A;  4CI6 A;  4FZX C;  2WON A;  3MN9 A;  3NCI A;  2RHK A;  1C0T A;  2UUB K;  3ZT0 A;  3OYK A;  2ZD1 A;  4CED A;  1RT3 A;  1R0A A;  3HVR A;  5FRN A;  4FWP A;  4HVJ A;  2Q2R A;  1TKT A;  2HHS A;  5AQO A;  4BRC A;  3KKS A;  2BUP A;  4M3U A;  3AVI A;  3ZSR A;  2CGL A;  4CEQ A;  5JS1 A;  2QWP A;  3T3F A;  1XMO K;  5DM7 L;  1RT2 A;  3VEW A;  3R1X A;  2DTU A;  1TUY A;  3E9L A;  1NGJ A;  4JI4 K;  4CGD A;  5KTQ A;  1FJG K;  4JI1 K;  1C1C A;  4LF6 K;  1YTU A;  4ILH A;  1T05 A;  4X62 K;  3LDO A;  4CHO A;  1HKC A;  3KLH A;  1YT3 A;  2GUI A;  3T69 A;  1W0H A;  1BOT O;  4CZL A;  1U2V A;  4JK7 A;  3LP2 A;  2VG5 A;  3ENH A;  3LAL A;  3MX2 A;  4JKD A;  1JKH A;  1RT4 A;  4E7K A;  4JI3 K;  5C0Y A;  1C0G A;  3VQA A;  1WSF A;  1RCH A;  3HM9 A;  2QWL A;  4K8X A;  4E0D A;  1SL0 A;  4JD2 A;  3SQ4 A;  1VAZ A;  4BVP A;  4O0J A;  1DTQ A;  2Q97 A;  3WT0 A;  4DTS A;  2HHH K;  4DTU A;  3WEE A;  3I8D A;  3QIO A;  1Z05 A;  4DFM A;  2D0B A;  2YHB A;  2VCP A;  3V9U A;  4IEI A;  1RBR A;  4AHU A;  4FL9 A;  3S41 A;  3OBY A;  2UUA K;  4CF0 A;  2A40 A;  5C25 A;  4DQ8 A;  1WSJ A;  1JL1 A;  5LMU K;  3OW2 M;  2W42 A;  4OLA A;  2P51 A;  2PBD A;  4N41 A;  2GBZ A;  1R59 O;  3O8M A;  2E20 A;  3LAN A;  3NE6 A;  1RT1 A;  4B9T A;  1QQO A;  4W5T A;  1T8E A;  3H6E A;  3LPT A;  1NK0 A;  3SBG A;  4M7Y A;  2O8F B;  4CGH A;  1E4G T;  4IEE A;  1QSL A;  3WXI A;  4LY7 A;  2OZS A;  2JWL A;  1LWE A;  4LFA K;  1T3V A;  3O08 A;  2HF3 A;  3KWG A;  2P1J A;  4BDZ A;  3SLC A;  1S1U A;  2E6L A;  1VSI A;  4OJR A;  3IRX A;  4KI4 A;  1SKR A;  5AQQ A;  1YVU A;  1F21 A;  5JS2 A;  3QIC A;  4B9S A;  5C2F A;  1IG8 A;  1JLA A;  3TPQ A;  1VSK A;  2YHA A;  4CGJ A;  4Z4F A;  5EOY A;  1NK6 A;  3R8E A;  4H5W A;  1RTJ A;  3QB0 A;  4B1U B;  2XY5 A;  3JSM A;  1NJY A;  3D2F B;  1RBT A;  4PHT X;  4JI6 K;  4JI2 K;  4NLC A;  3OVN A;  4CE9 A;  3D0P A;  3T1H K;  3K5L A;  1NGF A;  1KRP A;  1X9S A;  2QEX N;  1NGD A;  4DSL A;  1VHX A;  3SQ2 A;  4OLB A;  1K73 O;  5E26 A;  4IO9 L;  3QET A;  3WUH A;  3DJC A;  4KH5 A;  2NNW A;  3H1Q A;  2XHB A;  2XY7 A;  4GW6 A;  1RFQ A;  3IMX A;  1GLL O;  1YIT N;  3D6R A;  4DV3 K;  3RTV A;  3PX6 A;  1T03 A;  1H1V A;  4DKW A;  3ATV A;  4U7B A;  4KTW A;  3THW A;  4Z4E A;  3L2V A;  3WNF A;  3D7E O;  1QQM A;  1W97 L;  2IC3 A;  2FF3 B;  1MA9 B;  3M1F A;  3NF7 A;  5ADX H;  3SI6 A;  2NRZ A;  4NB4 A;  1X9W A;  4WFN L;  3O3H A;  3H1V X;  3VEY A;  2E4L A;  3BUZ B;  3AO3 A;  4R79 A;  1ILY A;  3TAM A;  2YKM A;  3JYT A;  3O5B A;  1JLB A;  2I5J A;  2RKI A;  1T6D A;  4FXD A;  3RMC A;  3V81 A;  2OA8 A;  2Q31 A;  3OS2 A;  3BY5 A;  1A5X A;  2PAV A;  3HK2 A;  2FBY A;  3OYB A;  1K8K A;  2P9N A;  4K42 A;  3KD5 E;  4PY5 A;  1X3N A;  2G8W A;  1N8R O;  2ATQ A;  4AHS A;  4IFY A;  1NJW A;  4DF8 A;  2HNZ A;  3SV3 A;  3OS0 A;  1W7A A;  4EP4 A;  3V9S A;  2A42 A;  1NK8 A;  4LFC K;  4CZI A;  3NH2 A;  1J53 A;  4F8R A;  3BF1 A;  1WBB A;  3V1O A;  1JL2 A;  1BHL A;  4FOE A;  5M1O A;  4CJW A;  3L6Q A;  3KK3 A;  4DSI A;  1TVR A;  1JCE A;  5BR8 K;  2E8A A;  1JLG A;  1SS6 A;  1NGB A;  3TSU A;  2A1S A;  4DTX A;  4LF7 K;  4QOZ B;  4H0T B;  4CJV A;  4LF8 K;  1D9F A;  1W9H A;  1VQ9 N;  2HHW A;  3ZSY A;  2KLA A;  3MXI A;  1QZ5 A;  3K2P A;  5FPD A;  4ISF A;  3MN7 A;  3SUP A;  2YI1 A;  5C15 A;  4E7L A;  1ZC6 A;  4AM7 A;  4LH5 A;  4Z0U A;  4C8M A;  3KZB A;  3THY A;  3OYI A;  4RWT A;  4J2A A;  2G8F A;  2RN2 A;  4GV9 A;  3JXU A;  4QAG A;  3SUQ A;  1VK0 A;  3U9Z A;  4BRM A;  2WOM A;  4RCH A;  4A61 A;  5JLH A;  4K25 A;  3HOS A;  4FJL A;  5KPZ A;  2ZGY A;  3J8A A;  4DSK A;  4BC3 A;  5DMR A;  2DY4 A;  3TAQ A;  5CE3 A;  1SL1 A;  3TTF A;  4H5T A;  3V9W A;  1Q86 O;  3VQP A;  4FLY A;  1GLD G;  2ASM A;  4FM2 A;  2X6S A;  3GL1 A;  3O1B A;  3SK3 A;  3SCX A;  3VQ5 A;  1NOZ A;  2O8B A;  4YNQ A;  1BQM A;  1KVB A;  1OVQ A;  2Z1J A;  2P9S B;  3I33 A;  4M3T A;  3O9U A;  4BRE A;  5LJV A;  2E2P A;  1JCG A;  4JRQ A;  3SQ1 A;  3QEX A;  4FK0 A;  1DKG D;  1XHX A;  3C6U A;  2PYJ A;  2YJE A;  3QML A;  3THW B;  1OH5 A;  2UXC K;  3ZX0 A;  4FK4 A;  2Q0R A;  4CJ4 A;  4H8K A;  2IAJ A;  4HTL A;  4BC4 A;  1TGO A;  4C23 A;  3VQC A;  3QO9 A;  3VOV A;  1RDA A;  3FZK A;  3VGM A;  3O1W A;  5FLX O;  3THX B;  3V4I A;  1RT5 A;  3OYL A;  3SQ0 A;  4MDA A;  5BN8 A;  1VQ5 N;  3V6D A;  1VQL N;  5HRP A;  1OKJ A;  4H4O A;  3WXL A;  4JKC A;  3CIP A;  1IKW A;  3O9T A;  2P9K A;  5KQ8 A;  4BDY A;  3B6O A;  4OVL A;  1LAV A;  4B9N A;  4NXN K;  2P9N B;  2OTL N;  5JVG L;  4N47 A;  5F0X A;  1D9D A;  2E1Z A;  4AHR A;  3HOT A;  4DR7 K;  4OKK A;  3TR8 A;  2WC9 A;  1OH8 A;  1I94 K;  3LZJ A;  4DQP A;  1FW6 A;  1XMQ K;  4CZJ A;  4H5N A;  4BC5 A;  1CZ9 A;  1YJW N;  1ASU A;  3MEG A;  3HT3 A;  4K8Z A;  1CZA N;  4JKG A;  4CER A;  2HND A;  3HP6 A;  1ZXO A;  2I7N A;  5KI6 A;  4M3Y A;  2ZJP L;  4H0O A;  5EX5 A;  3CYM A;  1VSH A;  4U67 L;  3DLL L;  1IJJ A;  3IDH A;  4B9U A;  1YTA A;  5AQW A;  3MEC A;  4FJK A;  3VMF B;  4IZ9 A;  4F4K A;  2JGU A;  3CET A;  3LDP A;  3B6P A;  3L3U A;  1Q18 A;  5FRM A;  4H0P A;  2YNH A;  3MAQ A;  1EWR A;  2NLX A;  4E1N A;  4O8K A;  3AGR A;  4CD3 A;  1D5A A;  1GOC A;  4KTZ A;  2OTJ N;  3WQT A;  3DRP A;  4LSN A;  1S3X A;  3VES A;  1SKW A;  5ADX A;  4CJP A;  4A2A A;  2A41 A;  4JK9 A;  4JKB A;  4Q5V A;  2VWJ A;  1XHZ A;  3SJJ A;  2FSJ A;  4M3W A;  4CK2 A;  3G6E N;  3LZI A;  3RSE A;  1U47 A;  1JXE A;  5SZT A;  4KHN A;  3C0B A;  3R3L A;  3ULE B;  2LSN A;  3FLC O;  4FW2 A;  1S1W A;  1HNX K;  3VQQ A;  5EU7 A;  4BDP A;  4FJN A;  4FWQ A;  2FBV A;  3WNH A;  5JIC A;  4CZK A;  3DXK A;  3HVT A;  2NRR A;  3S9H A;  3D2E B;  3HZ6 A;  4CJT A;  4BR9 A;  4W5O A;  1FK9 A;  4FCY A;  1N36 K;  3TU5 A;  4DV0 K;  4AF1 A;  4CHQ A;  1BCO A;  4EP5 A;  2QWM A;  3CER A;  2Y1I A;  1JLF A;  4CF9 A;  3EN9 A;  1Z26 A;  4KH4 A;  4JKH A;  4DTJ A;  3O4Q A;  3P83 D;  3DOK A;  4KHW A;  4YHH K;  4PKH A;  3VF2 A;  3A5O C;  1G15 A;  1HYZ A;  4CJU A;  2HHV A;  3ZSW A;  1KSP A;  2BAN A;  5AQP A;  4K41 A;  4E89 A;  4GKJ K;  5FPM A;  4IFV A;  3CHW A;  2BH1 A;  4JEP A;  2NRV A;  3E01 A;  3H3O B;  5AQH A;  3OYD A;  1BDG A;  4JS5 A;  1YF5 L;  3KK7 A;  3P38 A;  1K8A O;  3AVL A;  1GLB G;  2HMP A;  3LAK A;  2OAN A;  5KRT A;  4RW7 A;  3IUC A;  2EHG A;  2HVI A;  3RR8 A;  3PO5 A;  2XRI A;  3O80 A;  4JKG B;  2PZS A;  5IT9 O;  2QWN A;  2F9W A;  2QWO A;  3DXM A;  4DR5 K;  4ELT A;  2HW3 A;  4WCE L;  4IKF A;  5TKY A;  2E5L K;  1NJI O;  3LP1 A;  3QER A;  4CK1 A;  1KVA A;  1NK5 A;  1Y64 A;  3VET A;  5AQS A;  4DV4 K;  1DT9 A;  5BN9 A;  4ZHR A;  1UA0 A;  4H0V B;  3U9D A;  1JJ2 M;  3NVM A;  4BE1 A;  3T1Y K;  2WBN A;  2VWB A;  1ZBF A;  3HM8 A;  4IG0 A;  2AP1 A;  1NM1 A;  1LW0 A;  5GAG P;  3AAP A;  4I7F A;  4MO4 A;  5AQM A;  3L2U A;  3CMA N;  2CH5 A;  3PIO L;  1MWM A;  4G1Q A;  2EX3 A;  4EZ9 A;  1D8Y A;  4FWS A;  2FC0 A;  4FJI A;  1Q9X A;  3T7Z A;  4DFP A;  4KI6 A;  2UUC K;  4A5A A;  2Q36 A;  3ZSZ A;  3H46 O;  3AVG A;  3GE1 A;  3DLG A;  5AQU A;  1K9M O;  3F2K A;  1S6P A;  3PUF A;  4KBO A;  1SAZ A;  4AHV A;  3J81 O;  2HHQ A;  4LF4 K;  4ILG B;  3TI0 A;  3MXM A;  4ELU A;  3DXK B;  3ID6 A;  3PY8 A;  3HSC A;  4L8R B;  2H3G X;  5GAE P;  5GAD P;  2KZZ A;  3NH0 A;  4AQY K;  2QWR A;  3OJS A;  3IKM A;  4OKJ A;  5AJ3 K;  3J7A P;  1BL3 A;  2GWK A;  3AO1 A;  3VER A;  2VQE K;  4UY8 O;  1S6Q A;  2GUP A;  1ZBU A;  1FKO A;  1BQN A;  5B8H A;  4LC9 B;  4F2R A;  4KV8 A;  4FWL A;  3P31 A;  3LDQ A;  4KTQ A;  1RDC A;  2P9P A;  4DTP A;  3T19 A;  4CBU A;  5A2Q O;  3VEZ A;  5LL6 Z;  3U3G A;  4ICL A;  4A2B A;  4GMJ B;  3VGL A;  1QTM A;  4BR7 A;  4QS8 A;  4CJQ A;  4CGI A;  3TAF A;  4HUG A;  3RRG A;  4IJN A;  2PFU A;  3HL8 A;  4BRD A;  1KVC A;  3CD6 N;  2QA4 N;  4CFB A;  2ZJR L;  1FKP A;  3E9O A;  4BAC A;  3AA3 A;  3PSF A;  3NGY A;  2QWQ A;  4Y1C A;  2D0A A;  4BE2 A;  3BGR A;  3EE8 A;  4BG8 A;  4BRQ A;  1TV6 A;  3BDP A;  1OH7 A;  1KQS M;  3BZC A;  3PX4 A;  5CZ2 A;  5AQG A;  2OZM A;  4FJ5 A;  4CJF A;  4CJ7 A;  4O55 A;  4H5R A;  3CPW M;  3G25 A;  4XIU A;  1GLF O;  1WUA A;  3HP9 A;  4E7H A;  1NMN A;  4FM1 A;  4BQL A;  4M3R A;  1S5J A;  3QEI A;  2HBM A;  5HP1 A;  1N5Y A;  2Q0U A;  4WFA L;  1KAX A;  2OPP A;  1T44 A;  1VSM A;  3L4I A;  3VPZ A;  1QHA A;  3QNO A;  4BR4 A;  4CZE A;  1Z25 A;  2G8K A;  1GLC G;  3VQ4 A;  1RTH A;  3DLH A;  3VEX A;  4OGC A;  4BGA A;  5CHI A;  5K14 A;  1OVY A;  1X3M A;  3MN6 A;  3CQX A;  1BWF O;  1QE1 A;  5AQL A;  2J4R A;  3P4I A;  3J80 O;  3NMU A;  1Q7Y O;  4Q0B A;  3MK6 A;  4CJ5 A;  4DV6 K;  3P1G A;  3C7N A;  2VYP A;  2E2N A;  5AQJ A;  4YOU A;  1BG3 A;  3EEQ A;  3R6M A;  1VQP N;  2DPN A;  3P39 A;  1IKY A;  2B4J A;  3VQ6 A;  2D0C A;  3UE5 A;  3CFO A;  4DLG A;  1C0M A;  1S9E A;  3SMS A;  2A5X A;  5KPT A;  1HQE A;  2D0O A;  2ZGZ A;  1C1B A;  2FSK A;  4FOI A;  4FLT A;  1NJX A;  4DV1 K;  2O8D A;  5FDL A;  4JKE A;  2P9P B;  3EKS A;  3MN5 A;  4WQ5 C;  1VQ4 N;  4NYN A;  2ZE2 A;  3TAN A;  3DLR A;  3ZET A;  3CI5 A;  4LFB K;  1M1K O;  3H08 A;  3CJ7 A;  3N4P A;  3QBX A;  3CJB A;  4JS4 A;  5CR4 A;  3UKR A;  4WQ5 A;  3NAE A;  4YDU C;  4EHT A;  3OJU A;  4NCG A;  1Q82 O;  1JLC A;  4DSF A;  2A6A A;  4DU1 A;  4CGG A;  4DR6 K;  2FF6 A;  2EWS A;  4BR2 A;  4L3Q A;  1TK8 A;  3F73 A;  1L5U A;  2ZJQ L;  2IGI A;  4CD1 A;  1BO5 O;  5M1Q A;  4CJE A;  4YDU A;  3GBT A;  3LP3 A;  3S3N A;  1SUQ A;  3K0S A;  4WFB L;  3OYH A;  1Q81 O;  1VQK N;  4I2Q A;  4DU4 A;  3AAR A;  5AQT A;  4IDK A;  5J2N A;  3BEX A;  4BRO A;  4JLH A;  1RT7 A;  1HKG A;  1E3M A;  3ZCM A;  2KFZ A;  1U2V B;  4YOR A;  3WXM B;  3H45 C;  1WB9 A;  4H4M A;  3KK1 A;  3TSQ A;  3QEW A;  3VQB A;  3CCS N;  5TKW A;  3NGI A;  4FVU A;  2OCE A;  3K58 A;  4EFH A;  3OTO K;  3FR0 A;  4YOV A;  4DU3 A;  2P5G A;  4QCL A;  3AVA A;  1VSL A;  3EL2 A;  3ZSQ A;  2UU9 K;  4OPJ A;  5HLF A;  4JD2 B;  1B9D A;  3NH1 A;  5GAH P;  1REV A;  4MLE A;  3M3Z A;  3OY9 A;  3KLE A;  4KAZ A;  1HQU A;  2YX6 A;  3UKU A;  3WEE B;  5CZ1 A;  1SKS A;  2NRH A;  4A59 A;  2F8T A;  3EY1 A;  3CJC A;  2O4I A;  3C65 A;  5KQD A;  4C8L A;  3N4Q A;  3C7N B;  3U3Y A;  1ATR A;  1RDB A;  3AVK A;  1RBV A;  4E19 A;  3B8A X;  1U6Z A;  5C12 A;  4HCC A;  3CC7 N;  2E88 A;  2HBL A;  3C6T A;  2P9I A;  3HI0 A;  4IBN A;  1B92 A;  3GG4 A;  1BIZ A;  4JHD A;  3CJ9 A;  4CEZ A;  3CCM N;  4DF4 A;  4DS4 A;  4CK3 A;  4W5N A;  1DTT A;  4QS9 A;  5CYQ A;  4FPB A;  4BR0 A;  3TAR A;  3QFU A;  3AVH A;  1CZB A;  1UA1 A;  5M1K A;  4B1W B;  5J2Q A;  3AY9 A;  4DMN A;  3TSP A;  2O8D B;  1KAZ A;  1KCF A;  2Z1I A;  4O5B A;  1C0U A;  2HHT A;  3CF5 L;  4KKO A;  3ULD A;  5AQF A;  4KRE A;  4MQ3 A;  4NYF A;  1HYS A;  5FRO A;  4FLW A;  3OBW A;  1J6Z A;  3K9K A;  3PLA A;  3ATU A;  4DWI A;  1SQK A;  1EX4 A;  3AAQ A;  4JI5 K;  4CHY A;  5I9E B;  5GIO A;  3PSI A;  5M1P A;  4JI7 K;  1WLJ A;  3AVJ A;  3E9P A;  1GOA A;  3MWP A;  4YOT A;  3P5J A;  4OPH A;  3DRS A;  3DLB A;  3O4N A;  3CPE A;  1HNV A;  4Y0W A;  2BDP A;  4DTR A;  3T1A A;  4BG9 A;  1U45 A;  3M8Q A;  2A3Z A;  1NGG A;  1JCF A;  2W40 A;  4KHY A;  3HST B;  3CME N;  4RW9 A;  3CFP A;  2B6A A;  1VQM N;  1FXX A;  1X1P A;  3A5L C;  1IO2 A;  1U49 A;  3C6H A;  4GNI A;  4IOA L;  5AQK A;  1BI4 A;  2BE2 A;  1C0F A;  4JN4 A;  1L3T A;  1RBU A;  1RDD A;  3LWM A;  3I0R A;  4FM0 A;  5E84 A;  4BVO A;  2WTU A;  2E6M A;  2F9T A;  1K8K B;  4ZTJ A;  1EXQ A;  3OYJ A;  4DFK A;  2Q3S A;  4XH5 A;  5BPM A;  3IAY A;  5KRS A;  4DTM A;  3I0S A;  1HUX A;  3SJH A;  2VG6 A;  1LCU A;  5J2P A;  2HVH A;  3TWH A;  5F2R A;  1VRT A;  1BU6 O;  1D4X A;  1J9A A;  3ZSO A;  4WF9 L;  3RR7 A;  3FFK B;  3UB5 A;  5ELZ A;  3ZSX A;  4CHN A;  3LM9 A;  3KKR A;  2BTF A;  1ESV A;  1IBL K;  4M41 A;  2G8I A;  3ITH A;  2P9I B;  2FSN A;  3OYF A;  3AA2 A;  2OPQ A;  2KZM A;  3DWL A;  2V51 B;  1VRU A;  4IG3 A;  2E2O A;  5CYM A;  1U04 A;  5AQN A;  2O4G A;  1WSI A;  4M3Z A;  3THY B;  4OKE A;  3VQ7 A;  2ZWH A;  2FLO A;  3SPY A;  5AQY A;  5H1S Q;  4A5B A;  4Z4C A;  4TSX A;  2XO7 A;  4N5S A;  1LW2 A;  1GOB A;  3DI6 A;  2W6L A;  1WSE A;  3LDL A;  4CJL A;  3PV8 A;  4CIF A;  3ZLJ A;  5HBM A;  1IBM K;  1NKC A;  4A57 A;  5I42 A;  1NMD A;  4GVE A;  4J2B A;  2O8B B;  3ID8 A;  3ZT3 A;  4DUZ K;  3ZX3 A;  4CJS A;  4BRN A;  3AO4 A;  4CEE A;  4F9O A;  2ITM A;  1IKV A;  1LOT B;  4BWM A;  2HOE A;  4IOX A;  1Q9Y A;  2IDO A;  4MLH A;  4DSJ A;  4O0I A;  3CCJ N;  4H03 B;  4B1Y B;  2HF4 A;  1BA1 A;  4UQG A;  4H0Y B;  4B9M A;  4K0K K;  3SAG A;  3AO2 A;  4QS7 A;  3L8B A;  1S72 N;  3MMV A;  5FPE A;  4LF5 K;  2YV0 X;  3CCU N;  1LWC A;  1ZBL A;  2P9K B;  1QSY A;  1O1W A;  4HTU A;  3I56 N;  2KKZ A;  1IKX A;  1WBD A;  3L4Q A;  3A5M C;  2Z1H A;  3CQ8 A;  3WNG A;  4IJA A;  1I3A A;  2YJF A;  4DQI A;  4RW6 A;  3SPZ A;  2PY5 A;  4E7J A;  5LMN K;  3DLK A;  1RT6 A;  2D5R A;  5JMV A;  2G8V A;  4KHP K;  5KGW A;  4FWM A;  4PA1 A;  3MEE A;  3NF8 A;  3ZT1 A;  1WAJ A;  3S3M A;  4C8N A;  4BR5 A;  3K57 A;  4PQU A;  4DV5 K;  4CZG A;  4FWN A;  1KC8 O;  1NBW A;  1X9J A;  3BP8 A;  2F4V K;  1EKE A;  3L2Q A;  5IWA K;  1GLE G;  3KJV A;  3SMP A;  4Z4I A;  2FBT A;  1WSG A;  2OPS A;  1KFS A;  4PKI A;  3AVN A;  4ILJ A;  4MFB A;  2P9U A;  3PX0 A;  3W3D A;  4DHY A;  3ZSV A;  4DB3 A;  2ETJ A;  3AO5 A;  3I8B A;  3RMD A;  1OH6 A;  5BPN A;  1NNE A;  2VGM A;  3VQD A;  2ZQB A;  4B9Q A;  4NXM K;  1TKX A;  2IVP A;  4FLX A;  4M42 A;  4FJ8 A;  1CLQ A;  1LV5 A;  1BA0 A;  3RSE B;  3KLI A;  4DG1 A;  4B8C A;  4AHT A;  4RTF D;  3OYC A;  3MX5 A;  5EY4 A;  3G71 N;  4X64 K;  4O4G A;  4EAH D;  1ZYQ A;  3J7Y P;  1KD1 O;  4FWR A;  3EE9 A;  4MDB A;  3QDK A;  4FJ9 A;  1W2B M;  1QVF M;  3WXK A;  1YI2 N;  1L3V A;  1Y97 A;  2DFF A;  4WYB A;  3MCP A;  3FZF A;  3EZ5 A;  3H3N O;  4BE0 A;  4RW8 A;  2G8U A;  3CFR A;  4FZY A;  2UXB K;  2O8F A;  5AZI A;  2E2Q A;  1EO1 A;  3CM6 A;  4EIA A;  4B8A B;  4JK8 A;  1NGC A;  4Z94 A;  5JLF A;  2BGG A;  1J5E K;  1RIL A;  5BR9 A;  4HHT A;  4FO0 A;  4Z4G A;  3ENO A;  1XC3 A;  1SL2 A;  5AFU A;  2F7T A;  4IWV A;  5MLC Q;  1QS4 A;  4H5V A;  5HOO A;  2ZM6 K;  3DAW A;  4FJJ A;  3D2F A;  2GEL A;  4KB1 A;  4BRA A;  3IG1 A;  5C10 A;  5LY3 A;  1QHT A;  3NDK A;  4B3R K;  3JAM O;  1IH7 A;  2KTQ A;  1NGI A;  3RMA A;  5BPL A;  1KXP A;  1NG9 A;  1JLQ A;  3C94 A;  4HUE A;  3LWL A;  2HBJ A;  4M45 A;  3DLE A;  3SNN A;  3DXM B;  1IG9 A;  1GLA G;  1NK7 A;  1B9F A;  1NKB A;  4JRP A;  2D0P A;  3AV9 A;  4ID5 A;  5EXW A;  2V7Y A;  3NVK A;  3OHR A;  3NFA A;  1HPZ A;  2D1K A;  1HRH A;  3CXC M;  3C95 A;  2HMI A;  2QM1 A;  3O6W A;  5LJW A;  1WNS A;  4AM6 A;  4C8K A;  3V9Z A;  1N33 K;  4KHU A;  1HNW K;  2YCH A;  4J2D A;  4CIE A;  2FXU A;  2JWK A;  5AQR A;  1ASW A;  1XUP O;  1S9G A;  2IIR A;  4JI8 K;  3FZH A;  2P9U B;  3CCL N;  1ASV A;  3CJA A;  4FJH A;  3FZM A;  4BC2 A;  3TAG A;  2XY8 A;  1HNZ K;  1SZ2 A;  3VN5 A;  3HXM A;  4FWK A;  2GWJ A;  1YXQ A;  1BIS A;  3K9J A;  1N32 K;  1O13 A;  1LWF A;  1RTI A;  2NRW A;  4JAX A;  1ZBH A;  3RMB A;  2IOC A;  3CG7 A;  3LP0 A;  1NU0 A;  4FPA A;  3F9K A;  1WOQ A;  4FK2 A;  4C1N K;  1L3S A;  2F96 A;  3A8Y A;  2VWK A;  3BF3 A;  2V52 B;  2DFH A;  3WQU A;  1VQ7 N;  1IBK K;  3NHG A;  2WFB A;  4FLU A;  4CF8 A;  3ZEU A;  3TAP A;  1UWB A;  3A5N C;  3IS9 A;  5FPN A;  3AGK A;  2UXD K;  5AZI B;  4JYA K;  2AJQ A;  3F9M A;  4ID1 A;  4HUF A;  3V1Q A;  3I55 N;  1VQ6 N;  2V7Z A;  1ZBI A;  1E4F T;  3PO4 A;  3DMJ A;  3U6F A;  4KB0 A;  4X65 K;  4FW1 A;  4F3O A;  4YOY A;  3KVG A;  2ASP A;  3OYM A;  5GIN A;  3A2F A;  1XNR K;  3EYZ A;  3VF6 A;  4CHZ A;  4FVM A;  2YKN A;  2A1R A;  4YY3 K;  2PYL A;  1KAY A;  1TK0 A;  4PL8 A;  2QK9 A;  3WNE A;  1TL3 A;  1VQO N;  3RVC A;  1TKZ A;  3MDQ A;  3D45 A;  1EP4 A;  3L2W A;  3ISN C;  1RDU A;  3S3O A;  4CBW A;  2P9S A;  2CH6 A;  3LDS A;  2VGN A;  4KRF A;  4N76 A;  1J54 A;  3GDQ A;  1MU2 A;  2R7Y A;  4GV6 A;  4CHP A;  1NGA A;  5BRD A;  4C8O A;  2HHX A;  1K6Y A;  3LAM A;  1DEJ A;  4NLB A;  2X74 A;  1MWK A;  2KFN A;  4BGB A;  4CZH A;  1HX1 A;  1TAU A;  3SUO A;  4DR4 K;  3VEV A;  5BRE A;  2IVN A;  3TTD A;  3THX A;  1BGX T;  1NK9 A;  3W0L A;  4NO7 A;  4DQQ A;  1VSE A;  1QVG M;  4CJR A;  3NBP A;  4CJK A;  4OPK A;  4BRG A;  3CC2 N;  4MO5 A;  4XH1 A;  3HPO A;  4YOX A;  1YJ9 N;  3VEO A;  5AZJ A;  4CVN E;  3C6A A;  1KFD A;  1BCM A;  3MWT A;  3EZW A;  1RBS A;  2KW4 A;  5D3G A;  4B08 A;  3PIP L;  1HLU A;  2O8E A;  3UIQ A;  5HRN A;  4CFD A;  2QXF A;  1QQC A;  4JV5 K;  1BIU A;  3ZYY X;  4DTO A;  1C6V A;  3LPU A;  3NF6 A;  3O3G A;  3L2R A;  2W6K A;  2CGK A;  3IFR A;  3OYG A;  4JNE A;  4FWO A;  4OO1 J;  1LAW A;  3MCA B;  1EQY A;  1Z6R A;  3O9Q A;  2GTD A;  4DFJ A;  2NRT A;  4YOW A;  4B3T K;  1NWK A;  2YNF A;  3MED A;  1IV0 A;  4KFB A;  4F2S A;  3QFP A;  3HPG A;  1N6Q A;  5AQI A;  4E1J A;  4FJG A;  4I9Q A;  2ZF5 O;  4RW4 A;  3ZEU B;  1RNH A;  4NCA A;  1QQN A;  3QEP A;  3WXJ A;  3ZT2 A;  3ZET B;  3FZL A;  3MXJ A;  3E66 A;  5EVZ A;  2ITG A;  1A5V A;  4KH6 A;  1NLV A;  5CY4 A;  3CC4 N;  2VQF K;  3UKR B;  2QKK A;  2RPI A;  2QKB A;  3ZX2 A;  4G9Z A;  1QZ6 A;  3AA4 A;  4IO8 A;  4CES A;  3K5N A;  4DQR A;  4CEF A;  1J5O A;  4ISG A;  1NGH A;  1XQS C;  4KHS A;  1KLM A;  3A0I X;  4B3O A;  4OX9 K;  3F5T A;  5C42 A;  3SYZ A;  4BRF A;  4M7X A;  1YVN A;  3O9S A;  3ULE A;  5BRH A;  3O9R A;  2GEM A;  4AH9 A;  1V4T A;  4LH4 A;  4KPY A;  4X66 K;  3OA9 A;  4I9L A;  3LM2 A;  1WSH A;  4I6M A;  3M8S A;  4CW7 B;  4FZZ A;  4B9L A;  4DLE A;  2AA4 A;  1HMV A;  4W5Q A;  4BY9 C;  4B9V A;  1N34 K;  4J2E A;  1S1V A;  3SUN A;  1S1X A;  3RRH A;  1TAQ A;  1HYV A;  2X78 A;  3NGZ A;  3Q7B A;  3ASM A;  5C24 A;  1QSS A;  3D2E A;  5M1F A;  3VGK A;  1UAX A;  2D4W A;  2YHY A;  3CCV N;  3LDN A;  4DUY K;  3CCE N;  1BUP A;  3HPH A;  4O8U A;  4Z4H A;  1X9M A;  3SBT A;  2OPR A;  4JI0 K;  3FFI A;  3EKU A;  1KTQ A;  2KQ2 A;  3K5O A;  4RG8 A;  4LF9 K;  3VQ9 A;  3HO1 A;  4PWD A;  4FLV A;  1JLE A;  4EHU A;  3QLH A;  3DM2 A;  3G0Z A;  1TUU A;  5DK5 A;  2HHU A;  4FJX A;  3AVF A;  3DRR A;  4Y1D A;  4HCB A;  4CGF A;  4CIG A;  1WAF A;  1CXU A;  1YIJ N;  4KHQ A;  3UKU B;  3KHY A;  2GX9 A;  1V4S A;  5AZJ B;  3E1Y A;  1YUW A;  1XNQ K;  4IFE A;  2F8S A;  4CJ3 A;  3HYF A;  2DFE A;  3U8X A;  3QIP A;  3VQE A;  1ATS A;  5BRF A;  2CGJ A;  4CZF A;  1HNI A;  2IVO A;  4K43 A;  2O8E B;  5DM6 L;  4DR1 K;  3J7Z O;  2UYT A;  3DOL A;  4F3T A;  4B1V A;  2Z1G A;  4LD0 A;  4R5P A;  3ZT4 A;  4IDH A;  5AFU H;  3VA3 A;  4DCH A;  4CFC A;  4JHD B;  1P8Z A;  2Q1N A;  4EZ6 A;  2P9L A;  4IXC A;  2YNG A;  5F1X A;  4PL7 A;  4CBX A;  1ITG A;  1HKB A;  4CEA A;  1TYQ A;  2O8C A;  4C1N I;  4GKK K;  4H0X B;  3ALY A;  3L3V A;  1NOY A;  3CCQ N;  5J1E A;  1M90 O;  3ENB A;  4J8F A;  2KHO A;  5AQZ A;  3RWU A;  1WN7 A;  3M8P A;  4AIL C;  1U48 A;  4B3S K;  4DR3 K;  4XH4 A;  5J2M A;  4WE1 A;  3LL3 A;  2QI2 A;  3M6G A;  3KD1 E;  2G8H A;  3VQ8 A;  2RF2 A;  2I7P A;  4GY2 B;  1JXB A;  5SWM A;  1RTD A;  3AVC A;  3TAE A;  4M3X A;  1L3U A;  2GV9 A;  4E1M A;  3FGU A;  4B1Z A;  1U4B A;  3SAH A;  3AVB A;  3KLG A;  2QW9 A;  3G4S N;  2HNY A;  2JLE A;  3JS6 A;  5T7B A;  2HBK A;  1DLO A;  3O3F A;  1VSJ A;  1HJR A;  3HJF A;  1YJN N;  3VTH A;  3GOI A;  4I6M B;  4CFA A;  1HPM A;  4DSE A;  5HRS A;  2OYQ A;  4CZM A;  3TTC A;  1SV5 A;  3THV A;  4N56 A;  3G10 A;  1A5W A;  2B5J A;  2FBX A;  5GIP A;  4O44 A;  2NRX A;  1S1T A;  3M5R A;  4PUO A;  1G99 A;  1TK5 A;  3HTV A;  4DQS A;  2X6N A;  1BI4 B;  1HJO A;  4FLZ A;  3BZK A;  1XI1 A;  3AA5 X;  3VEN A;  1Q8I A;  4V19 S;  5I3U A;  3EO3 A;  3AVM A;  4FSV A;  4CF2 A;  3V9X A;  2VG7 A;  3KWI A;  4JKF A;  4B1X B;  4GV3 A;  1YAG A;  5KGX A;  4DS5 A;  4B3M K;  3FE1 A;  2QTD A;  4E7I A;  4CEB A;  3K5M A;  4FJ7 A;  1NKE A;  1ATN A;  5JVH L;  1VSD A;  1HR0 K;  2W41 A;  1VSF A;  5M1N A;  1T7P A;  2NZT A;  2NUB A;  3CJ1 A;  4OPA A;  5AQV A;  3SZ2 A;  3QBW A;  1YHQ N;  1RDW X;  3QES A;  4FYD A;  2YNI A;  4KO0 A;  2XY6 A;  5HRO A;  2P5O A;  1I39 A;  3TAB A;  1TKD A;  4JKA A;  2RE2 A;  4M63 C;  4CEO A;  4GVM A;  4E3S A;  3VF4 A;  5E41 A;  3HRG A;  2QXL A;  3OYN A;  4IOC L;  1S22 A;  4ELV A;  4CF1 A;  2YHW A;  1RGI A;  5HRR A;  2YHX A;  1VQ8 N;  3OS1 A;  1EWQ A;  3V1R A;  2P9L B;  3CQY A;  1MDU B;  4O5F A;  2E1Y A;  5KPR A;  3CM5 A;  3OYE A;  3M8R A;  4ZTF A;  4FJM A;  5AR0 A;  1P90 A;  1TYQ B;  2O8C B;  1ZBS A;  1NGE A;  4BWJ A;  4WQ4 C;  3QNN A;  3SV4 A;  4CCH A;  1UOC A;  3R9P A;  1GLJ O;  1NK4 A;  4AHC A;  1XWL A;  3CCR N;  4DV2 K;  4OGE A;  3VTI A;  1EET A;  4WQ4 A;  3KIO A;  4BRP A; 
#chains in the Genus database with same CATH homology
 3OYA A;  2HB5 A;  2YNH A;  3MAQ A;  4IBN A;  1B92 A;  4LSL A;  1LWF A;  1RTI A;  4E1N A;  1BIZ A;  4CEZ A;  1D5A A;  4DTN A;  1ZBH A;  3RMB A;  4DF4 A;  3QEV A;  1GOC A;  4DS4 A;  1CXQ A;  2IOC A;  4CK3 A;  4KTZ A;  3CG7 A;  3LP0 A;  1DTT A;  4W5N A;  5CYQ A;  4CEC A;  3KLF A;  3DRP A;  2IS3 A;  3F9K A;  4LSN A;  2Y1J A;  1XC9 A;  3TAR A;  3K59 A;  4FK2 A;  3AVH A;  1L3S A;  1CZB A;  2F96 A;  1SKW A;  2VWK A;  3DYA A;  4CJP A;  1UA1 A;  4Q5V A;  2VWJ A;  1XHZ A;  4W5R A;  3SJJ A;  3QIN A;  2DFH A;  5J2Q A;  4M3W A;  4CK2 A;  3NHG A;  4I2P A;  4DMN A;  3LZI A;  1TL1 A;  1U47 A;  4FLU A;  4CF8 A;  1KCF A;  2Z1I A;  1JXE A;  5SZT A;  4O5B A;  1C0U A;  4KHN A;  3TAP A;  2HHT A;  1UWB A;  4KKO A;  1KLN A;  3ULD A;  2LSN A;  3IS9 A;  4FW2 A;  1S1W A;  4MQ3 A;  4NYF A;  4KRE A;  3KTQ A;  1HYS A;  5FRO A;  4FLW A;  2AJQ A;  4NCB A;  3VQQ A;  1NJZ A;  4ID1 A;  3VA0 A;  4HUF A;  5EU7 A;  4YFU A;  3NF9 A;  4BDP A;  4DWI A;  3V1Q A;  4FJN A;  2FBV A;  3KK2 A;  3WNH A;  1EX4 A;  4CHY A;  1ZBI A;  3HVT A;  1C1A A;  1WLJ A;  3AVJ A;  3PO4 A;  3DMJ A;  1GOA A;  2WON A;  3S9H A;  3U6F A;  4KB0 A;  4FZX C;  4CJT A;  3NCI A;  3P5J A;  4FW1 A;  4W5O A;  1C0T A;  4F3O A;  1FK9 A;  3ZT0 A;  3OYK A;  2ZD1 A;  4CED A;  4FCY A;  3DRS A;  1RT3 A;  1R0A A;  3DLB A;  3O4N A;  3HVR A;  3OYM A;  5FRN A;  4CHQ A;  1BCO A;  4HVJ A;  1HNV A;  4EP5 A;  2BDP A;  1TKT A;  3A2F A;  3EYZ A;  3T1A A;  4DTR A;  4CHZ A;  2Y1I A;  4FVM A;  1U45 A;  2YKN A;  3KKS A;  2A1R A;  2HHS A;  1JLF A;  4CF9 A;  3M8Q A;  1Z26 A;  2PYL A;  4DTJ A;  1TK0 A;  3HST B;  4M3U A;  3AVI A;  4KHY A;  3ZSR A;  3O4Q A;  3P83 D;  2QK9 A;  3WNE A;  4CEQ A;  5JS1 A;  4RW9 A;  3CFP A;  2B6A A;  1TL3 A;  4FJ5 A;  1FXX A;  1TKZ A;  3DOK A;  3D45 A;  4KHW A;  1X1P A;  1EP4 A;  3L2W A;  3T3F A;  3ISN C;  3S3O A;  1IO2 A;  1U49 A;  1RT2 A;  1G15 A;  1HYZ A;  1BI4 A;  2DTU A;  2BE2 A;  4CJU A;  2HHV A;  3LDS A;  4KRF A;  3ZSW A;  4N76 A;  1KSP A;  1L3T A;  1J54 A;  2BAN A;  4E89 A;  1RBU A;  1MU2 A;  2R7Y A;  1RDD A;  4CGD A;  3LWM A;  4CHP A;  5KTQ A;  3I0R A;  4C8O A;  2HHX A;  1K6Y A;  3LAM A;  4FM0 A;  4IFV A;  1C1C A;  2X74 A;  2E6M A;  3E01 A;  2KFN A;  4ZTJ A;  3OYD A;  1EXQ A;  4JS5 A;  1YTU A;  3OYJ A;  4DFK A;  1T05 A;  3AVL A;  2Q3S A;  3LAK A;  4CHO A;  3SUO A;  1TAU A;  3KLH A;  3IAY A;  5KRT A;  5KRS A;  1YT3 A;  4DTM A;  2GUI A;  1BGX T;  3I0S A;  1W0H A;  4RW7 A;  1NK9 A;  2VG6 A;  2EHG A;  4DQQ A;  1VSE A;  3RR8 A;  2HVI A;  3PO5 A;  3LP2 A;  2XRI A;  4CJR A;  5J2P A;  2VG5 A;  3TWH A;  2HVH A;  3NBP A;  2PZS A;  3LAL A;  4CJK A;  4OPK A;  4ELT A;  3HPO A;  1VRT A;  2HW3 A;  1JKH A;  1J9A A;  1RT4 A;  3ZSO A;  4E7K A;  4IKF A;  3RR7 A;  1KFD A;  3VQA A;  1WSF A;  1BCM A;  3ZSX A;  1RCH A;  3HM9 A;  4CHN A;  3KKR A;  4K8X A;  1RBS A;  2KW4 A;  5D3G A;  3LP1 A;  4B08 A;  3QER A;  4CK1 A;  1SL0 A;  1KVA A;  1NK5 A;  4E0D A;  3SQ4 A;  3UIQ A;  5HRN A;  4M41 A;  2QXF A;  4CFD A;  3ITH A;  2G8I A;  4O0J A;  1QQC A;  1BIU A;  1DTQ A;  4ZHR A;  1C6V A;  3LPU A;  3AA2 A;  3NF6 A;  3O3G A;  3OYF A;  3L2R A;  2OPQ A;  4DTO A;  2KZM A;  4DTS A;  4BE1 A;  1VRU A;  4IG3 A;  3OYG A;  3I8D A;  4DTU A;  3QIO A;  1LAW A;  1ZBF A;  5CYM A;  1U04 A;  4IG0 A;  4DFM A;  2D0B A;  2YHB A;  2O4G A;  1WSI A;  4M3Z A;  3V9U A;  4OKE A;  3VQ7 A;  4DFJ A;  1LW0 A;  1RBR A;  4AHU A;  3SPY A;  2YNF A;  3MED A;  4I7F A;  4KFB A;  4CF0 A;  3L2U A;  5C25 A;  4F2S A;  3HPG A;  1WSJ A;  4G1Q A;  2EX3 A;  4EZ9 A;  1D8Y A;  1JL1 A;  4Z4C A;  2FC0 A;  4TSX A;  1N6Q A;  4FJI A;  2W42 A;  2XO7 A;  1Q9X A;  4N5S A;  4OLA A;  1LW2 A;  4DFP A;  4FJG A;  2P51 A;  1GOB A;  4I9Q A;  4KI6 A;  4N41 A;  2GBZ A;  3DI6 A;  4RW4 A;  3LAN A;  3ZSZ A;  1RT1 A;  3NE6 A;  4B9T A;  1RNH A;  4NCA A;  4W5T A;  1WSE A;  3AVG A;  1T8E A;  3DLG A;  3LPT A;  1NK0 A;  3QEP A;  4CJL A;  3PV8 A;  3ZT2 A;  4CIF A;  1S6P A;  4CGH A;  3PUF A;  5HBM A;  1QSL A;  4AHV A;  4LY7 A;  2HHQ A;  2OZS A;  1LWE A;  1NKC A;  3MXJ A;  5I42 A;  3TI0 A;  4J2B A;  2ITG A;  1A5V A;  2P1J A;  4BDZ A;  1S1U A;  2E6L A;  5CY4 A;  1VSI A;  4OJR A;  3MXM A;  2RPI A;  3IRX A;  2QKK A;  3PY8 A;  4KI4 A;  3ZT3 A;  4L8R B;  2QKB A;  1SKR A;  4CJS A;  4DQR A;  3AA4 A;  4CES A;  3K5N A;  2KZZ A;  1YVU A;  1F21 A;  3AO4 A;  5JS2 A;  4CEE A;  4CEF A;  3NH0 A;  3OJS A;  1J5O A;  4OKJ A;  4B9S A;  4KHS A;  1IKV A;  1KLM A;  4BWM A;  1BL3 A;  3AO1 A;  4B3O A;  1Q9Y A;  1S6Q A;  2IDO A;  1ZBU A;  5C42 A;  1FKO A;  1JLA A;  1BQN A;  3SYZ A;  1VSK A;  2YHA A;  4CGJ A;  4DSJ A;  4Z4F A;  1NK6 A;  4F2R A;  4KV8 A;  1RTJ A;  2XY5 A;  3JSM A;  1NJY A;  4O0I A;  4KTQ A;  4AH9 A;  1RBT A;  1RDC A;  4LH4 A;  4KPY A;  4I9L A;  4CE9 A;  3OVN A;  3D0P A;  4DTP A;  3T19 A;  3K5L A;  1WSH A;  4UQG A;  3M8S A;  1KRP A;  4FZZ A;  1X9S A;  4B9M A;  4B9L A;  4DLE A;  4B9V A;  1HMV A;  4W5Q A;  3AO2 A;  4DSL A;  3SQ2 A;  3L8B A;  4OLB A;  3U3G A;  4ICL A;  4J2E A;  3QET A;  1S1V A;  4GMJ B;  4ELU A;  2XHB A;  3SUN A;  2XY7 A;  1QTM A;  1S1X A;  3RRH A;  1TAQ A;  1HYV A;  2X78 A;  4CJQ A;  3NGZ A;  4GW6 A;  4CGI A;  3TAF A;  3ASM A;  5C24 A;  2YV0 X;  4HUG A;  1QSS A;  3RRG A;  1LWC A;  3RTV A;  3PX6 A;  1T03 A;  1UAX A;  1ZBL A;  3HL8 A;  1KVC A;  4KTW A;  4CFB A;  1QSY A;  1FKP A;  1O1W A;  4HTU A;  4BAC A;  3AA3 A;  4Z4E A;  3HPH A;  3NGY A;  4Z4H A;  4Y1C A;  1X9M A;  2D0A A;  3L2V A;  1IKX A;  2OPR A;  4BE2 A;  3BGR A;  3FFI A;  3WNF A;  1KTQ A;  2Z1H A;  3CQ8 A;  2KQ2 A;  2IC3 A;  3K5O A;  4RG8 A;  3VQ9 A;  3WNG A;  3SI6 A;  3NF7 A;  1JLE A;  4FLV A;  1I3A A;  1X9W A;  3HO1 A;  4PWD A;  1TV6 A;  3QLH A;  3O3H A;  3BDP A;  3DM2 A;  2E4L A;  3G0Z A;  3PX4 A;  3AO3 A;  4RW6 A;  5CZ2 A;  5DK5 A;  2OZM A;  3TAM A;  2YKM A;  3AVF A;  3JYT A;  3SPZ A;  4CJF A;  2PY5 A;  1JLB A;  3DRR A;  2I5J A;  2RKI A;  4O55 A;  4Y1D A;  4CGF A;  4E7J A;  4HCB A;  4CIG A;  3DLK A;  1RT6 A;  1WAF A;  4FXD A;  1CXU A;  2D5R A;  4XIU A;  3RMC A;  4KHQ A;  3V81 A;  2G8V A;  3HP9 A;  2OA8 A;  3OS2 A;  4E7H A;  1A5X A;  4FM1 A;  4M3R A;  5KGW A;  3HK2 A;  1S5J A;  3QEI A;  1N5Y A;  5HP1 A;  2FBY A;  4PA1 A;  3MEE A;  3NF8 A;  3OYB A;  2F8S A;  3ZT1 A;  1WAJ A;  4CJ3 A;  3HYF A;  3S3M A;  2OPP A;  2DFE A;  3KD5 E;  4PY5 A;  2G8W A;  3QIP A;  3VQE A;  1VSM A;  4C8N A;  2ATQ A;  1HNI A;  3K57 A;  4PQU A;  4AHS A;  4IFY A;  1NJW A;  3QNO A;  4DF8 A;  2HNZ A;  1Z25 A;  3DOL A;  3OS0 A;  3SV3 A;  2G8K A;  3VQ4 A;  4F3T A;  1RTH A;  2Z1G A;  4LD0 A;  4EP4 A;  1EKE A;  3DLH A;  4R5P A;  3ZT4 A;  3L2Q A;  3V9S A;  3KJV A;  4OGC A;  1NK8 A;  4Z4I A;  2FBT A;  1WSG A;  3VA3 A;  3NH2 A;  1J53 A;  2OPS A;  4CFC A;  5K14 A;  1KFS A;  4EZ6 A;  4F8R A;  1QE1 A;  3AVN A;  1JL2 A;  2YNG A;  1BHL A;  3V1O A;  4MFB A;  3PX0 A;  4CJW A;  3KK3 A;  1ITG A;  4DSI A;  1TVR A;  4CEA A;  3ZSV A;  1JLG A;  3RMD A;  2ETJ A;  3AO5 A;  4Q0B A;  4CJ5 A;  3ALY A;  2A1S A;  3L3V A;  1NOY A;  4DTX A;  3P1G A;  5J1E A;  4QOZ B;  3VQD A;  2ZQB A;  4CJV A;  3RWU A;  1WN7 A;  3M8P A;  1TKX A;  1D9F A;  4AIL C;  4FLX A;  1U48 A;  1W9H A;  4FJ8 A;  4M42 A;  2HHW A;  3ZSY A;  1LV5 A;  5J2M A;  1CLQ A;  3MXI A;  3K2P A;  3KLI A;  4DG1 A;  4B8C A;  4AHT A;  4WE1 A;  3OYC A;  3KD1 E;  3SUP A;  2G8H A;  3VQ8 A;  2RF2 A;  1JXB A;  5SWM A;  1RTD A;  4E7L A;  4O4G A;  3AVC A;  4LH5 A;  4Z0U A;  4C8M A;  3OYI A;  1IKY A;  2B4J A;  3TAE A;  4M3X A;  1ZYQ A;  4J2A A;  1L3U A;  2G8F A;  2RN2 A;  2GV9 A;  4QAG A;  3VQ6 A;  4E1M A;  1VK0 A;  3SUQ A;  2D0C A;  1U4B A;  3CFO A;  4DLG A;  1C0M A;  1S9E A;  2WOM A;  3AVB A;  4FJL A;  1HQE A;  4FJ9 A;  3KLG A;  1C1B A;  4FLT A;  2HNY A;  1L3V A;  1Y97 A;  2DFF A;  4DSK A;  1NJX A;  2DY4 A;  5DMR A;  2JLE A;  5T7B A;  5FDL A;  3EZ5 A;  4BE0 A;  1DLO A;  4RW8 A;  3O3F A;  2G8U A;  1VSJ A;  3CFR A;  1HJR A;  3TAQ A;  3HJF A;  1SL1 A;  4NYN A;  4FZY A;  2ZE2 A;  3V9W A;  3TAN A;  3DLR A;  3VQP A;  4CFA A;  4DSE A;  5HRS A;  2OYQ A;  3CM6 A;  3H08 A;  4FLY A;  4FM2 A;  2X6S A;  4B8A B;  3SCX A;  1SV5 A;  3VQ5 A;  1NOZ A;  4N56 A;  4JS4 A;  3G10 A;  3THV A;  4YNQ A;  1A5W A;  2B5J A;  1BQM A;  1KVB A;  2FBX A;  4O44 A;  1S1T A;  3NAE A;  2BGG A;  4PUO A;  2Z1J A;  1TK5 A;  1RIL A;  4DQS A;  4HHT A;  3OJU A;  4M3T A;  2X6N A;  4NCG A;  1BI4 B;  4Z4G A;  1JLC A;  4DSF A;  4DU1 A;  4JRQ A;  4CGG A;  4FLZ A;  3QEX A;  3SQ1 A;  4FK0 A;  1SL2 A;  1TK8 A;  1XHX A;  3F73 A;  3C6U A;  2PYJ A;  1L5U A;  2IGI A;  1XI1 A;  1QS4 A;  3AA5 X;  1Q8I A;  4CJE A;  4FK4 A;  5I3U A;  3LP3 A;  3S3N A;  4CJ4 A;  1SUQ A;  4H8K A;  2IAJ A;  4FJJ A;  3AVM A;  1TGO A;  3OYH A;  4CF2 A;  3V9X A;  3IG1 A;  2VG7 A;  3QO9 A;  3VQC A;  1RDA A;  4KB1 A;  5KGX A;  4DS5 A;  4I2Q A;  4DU4 A;  4E7I A;  4CEB A;  3K5M A;  4FJ7 A;  1QHT A;  1NKE A;  3NDK A;  5J2N A;  4IDK A;  1IH7 A;  2KTQ A;  4JLH A;  1VSD A;  1RT7 A;  1RT5 A;  3V4I A;  3RMA A;  3OYL A;  3SQ0 A;  4FJX A;  3ZCM A;  2KFZ A;  1VSF A;  1JLQ A;  3V6D A;  1T7P A;  3C94 A;  4HUE A;  5HRP A;  3LWL A;  4H4M A;  3KK1 A;  4M45 A;  3DLE A;  2NUB A;  3QEW A;  4H4O A;  3SZ2 A;  3VQB A;  1IKW A;  3SNN A;  3QES A;  4BDY A;  1IG9 A;  3B6O A;  4FYD A;  4OVL A;  1LAV A;  2YNI A;  3NGI A;  1B9F A;  1NK7 A;  1NKB A;  4JRP A;  4KO0 A;  4B9N A;  3K58 A;  3AV9 A;  4ID5 A;  2XY6 A;  5HRO A;  4N47 A;  2P5O A;  1I39 A;  4DU3 A;  2P5G A;  3TAB A;  1D9D A;  3AVA A;  4AHR A;  4QCL A;  1VSL A;  3NFA A;  1TKD A;  1HPZ A;  4OKK A;  1HRH A;  3TR8 A;  3C95 A;  3ZSQ A;  4CEO A;  4GVM A;  2HMI A;  4OPJ A;  3LZJ A;  4E3S A;  5HLF A;  4DQP A;  1B9D A;  1WNS A;  5E41 A;  3OYN A;  4C8K A;  3V9Z A;  3NH1 A;  4KHU A;  4ELV A;  1CZ9 A;  4J2D A;  1REV A;  1ASU A;  4CF1 A;  4CIE A;  3OY9 A;  3KLE A;  4DQI A;  3MEG A;  5HRR A;  3HT3 A;  4KAZ A;  4K8Z A;  1HQU A;  3OS1 A;  4CER A;  2HND A;  3HP6 A;  1ASW A;  5CZ1 A;  3V1R A;  5KI6 A;  1SKS A;  1S9G A;  3CM5 A;  3OYE A;  3M8R A;  4M3Y A;  4ZTF A;  4FJM A;  3CYM A;  1VSH A;  2F8T A;  1ASV A;  3EY1 A;  2O4I A;  4FJH A;  4C8L A;  4B9U A;  1YTA A;  4BWJ A;  3QNN A;  3MEC A;  3SV4 A;  4CCH A;  3U3Y A;  3TAG A;  4FJK A;  1RDB A;  4F4K A;  1UOC A;  3AVK A;  1RBV A;  4E19 A;  1UA0 A;  2XY8 A;  2JGU A;  3VN5 A;  3HXM A;  1NK4 A;  4AHC A;  1XWL A;  2HHU A;  3B6P A;  4HCC A;  4OGE A;  1BIS A;  1EET A;  3C6T A;  3L3U A;  3KIO A;  5FRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...