3P83D

Structure of the pcna:rnase hii complex from archaeoglobus fulgidus.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
213
structure length
213
Chain Sequence
SPEFPGRLMKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQKTLDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PCNA directs type 2 RNase H activity on DNA replication and repair substrates.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/dna binding protein
molecule keywords DNA polymerase sliding clamp
total genus 78
structure length 213
sequence length 213
chains with identical sequence E, F
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3p83D00
2OPPA 4CF1A 2QKKA 3AA4A 3OY9A 1ZBUA 1QTMA 3QINA 4W5QA 3OYEA 3K5NA 1BISA 4Z0UA 4OLAA 3L3UA 2HHTA 4O0IA 3OS0A 4M3RA 4H4MA 4I2PA 1JXEA 1S5JA 4FLUA 4RW7A 4EZ6A 1VSDA 3MAQA 1Y97A 1U49A 4LD0A 3TAPA 1NOYA 3SV4A 1L3SA 3LWMA 3QEXA 1F21A 3C6UA 4OGEA 4WE1A 4BDPA 2KW4A 3LANA 4CHOA 5KRSA 3QEPA 5DK5A 2HVHA 4M3WA 2G8VA 3VQEA 1IG9A 1Z25A 3U3GA 4CFAA 3OYLA 3HSTB 1R0AA 1UAXA 2XRIA 3HPHA 3T19A 4FW2A 3JSMA 4M3UA 3CM6A 1BL3A 4IG3A 5KRTA 3HP6A 4CECA 1VSJA 4CJSA 4B9MA 4FJHA 4PWDA 3KK3A 4PY5A 3KD5E 4OGCA 4W5RA 3V9XA 4B9LA 4ID5A 3M8SA 1BCMA 2WONA 4IFYA 5KI6A 3LZJA 3TAGA 3DLHA 4FJNA 1U48A 4DSFA 1RCHA 3TAFA 5CYMA 3PO4A 3QLHA 1C1BA 3QNNA 3I0SA 2KQ2A 5EU7A 1NJZA 4JLHA 4E19A 1FKPA 2Z1GA 4TSXA 1YVUA 4DLEA 1RTDA 5HP1A 3NF7A 4DSKA 2KTQA 1QSYA 3TARA 2O4IA 3MXJA 2Y1IA 4LSNA 3ISNC 3SQ2A 4CJUA 2Z1HA 1NKCA 3VQ8A 3V1OA 2OZSA 1TKZA 3F73A 3U6FA 2XY8A 3OYIA 4KB0A 2YKNA 1VRTA 4DTSA 4RW4A 3KLEA 3KLHA 3B6PA 4CK1A 3KLIA 1RTIA 1Q8IA 2Y1JA 3QERA 3SI6A 3MXMA 1QSSA 1EXQA 3NH0A 4E7KA 4KFBA 3THVA 1FXXA 4CHZA 3KKSA 3NH1A 4FLTA 4FJ7A 3OYBA 4FJ5A 1IO2A 1CZ9A 3L2VA 1KLNA 1KRPA 4DSLA 4N56A 1LW2A 4JS5A 4NCBA 3ZT4A 1Q9YA 4DSIA 4KRFA 1SKSA 3C6TA 3KKRA 2B5JA 3RMDA 3V81A 4J2DA 2EX3A 4Z4EA 3WNEA 5J2QA 4EP4A 1A5VA 1RDCA 3K57A 1NK6A 4CEEA 1VSEA 4B9UA 4DFKA 5HRRA 4CJTA 4DTXA 5C25A 3KK2A 4E1MA 4ICLA 3NGYA 1RDBA 4W5OA 2OZMA 2O4GA 4HTUA 2YHBA 4DTMA 2HHVA 1G15A 5J2MA 1KSPA 1RT1A 3DRPA 2P5GA 1UWBA 4KI4A 1JL1A 4FM2A 5I3UA 1LV5A 4W5NA 1S1WA 2DFEA 4E89A 4CJRA 3OYHA 4AILC 4FZYA 4B3OA 1RDDA 3ITHA 4BWJA 3ZSVA 5HRPA 1I3AA 2GV9A 1HMVA 1SUQA 4KV8A 4OKKA 4CEZA 4I2QA 1JLAA 1LWEA 3VN5A 4DTNA 4M3TA 3PX6A 3M8RA 2LSNA 3IS9A 2EHGA 3NF8A 1U04A 3NF6A 3ZSWA 1NK9A 4FVMA 3RR7A 3DLKA 3ZSRA 2OA8A 4HHTA 3QNOA 1IKVA 4CJ5A 2G8FA 3OYAA 1JLCA 4N47A 3HPOA 4LY7A 1C6VA 1VSHA 3C95A 4YNQA 3OYFA 1JLEA 2HMIA 4DWIA 4HUFA 2YV0X 5CY4A 3EY1A 2D0CA 2HNZA 3ZT0A 4FYDA 3AVNA 3K5MA 1X9SA 4M3XA 3O4QA 1ZBHA 3ZT1A 1KFDA 3AVKA 4IG0A 3AVFA 1X9MA 2BGGA 1BGXT 2R7YA 1HYZA 1RBTA 4O5BA 4O44A 4PA1A 4QAGA 1JKHA 1U45A 4K8XA 3DOKA 5HLFA 1XWLA 3P1GA 1ZBIA 2D5RA 3O4NA 5J2NA 4J2AA 4DTJA 4GW6A 5FRMA 1BI4B 4CFCA 1SV5A 2P5OA 1BI4A 3VQQA 4O55A 1L5UA 4CJLA 3A2FA 1WAJA 4OPKA 5JS2A 3SUOA 2PY5A 4EZ9A 2HHQA 3AVLA 3KIOA 2QKBA 1UA1A 4OLBA 2FBXA 4FJXA 1KVCA 3RMAA 3SPZA 1WSFA 1CLQA 2E4LA 4QOZB 4HUGA 1UA0A 1RILA 3I0RA 1C1AA 3KLGA 5J1EA 1J5OA 1VK0A 1DTTA 1WN7A 4CJFA 5FROA 4EP5A 3L2QA 1Z26A 2P1JA 3K59A 3RMCA 1NK5A 1N5YA 2OPQA 4Q5VA 3SCXA 3V4IA 3DI6A 3B6OA 4CEQA 4KHSA 1DTQA 3AA5X 4ZTFA 4DF8A 1VSMA 4F4KA 4DQIA 4CERA 4IDKA 1EETA 3AVCA 2G8IA 1VSIA 3AVGA 4PUOA 1C1CA 3V6DA 1ZBLA 4FJJA 4F3TA 4AHTA 3NE6A 3SUNA 1GOAA 3U3YA 3ASMA 1NK4A 4FJGA 1JLQA 4NYFA 2DFHA 4AHCA 3HP9A 4XIUA 4DF4A 4E0DA 1T8EA 2FBVA 1J9AA 2XY6A 1LW0A 1LWFA 2F96A 4IFVA 3OS2A 3LPTA 3WNFA 4NCGA 1C0TA 3OYDA 3NDKA 1GOCA 3NCIA 3TWHA 4DQSA 2VG5A 3LZIA 3DM2A 4M41A 2DFFA 2GBZA 4DLGA 3C94A 1S9EA 4KO0A 3V9UA 1NOZA 1RDAA 3DLRA 2PZSA 3CQ8A 3I8DA 4C8OA 1HJRA 2IC3A 1XHXA 1BHLA 3VA0A 3LALA 4CF8A 1A5XA 3ZCMA 3QIPA 4LH4A 3QEIA 4BWMA 1VSKA 3AO4A 2FC0A 2X78A 2YNFA 1IKYA 1ASUA 1W0HA 4IBNA 1NK0A 4KPYA 4KTZA 1SL1A 4KHYA 4FM1A 1EKEA 2QXFA 3NGZA 2VG7A 3EYZA 1RBVA 4BE2A 4H8KA 5I42A 3K2PA 4C8LA 2P51A 4ZHRA 4E7JA 4Q0BA 3LPUA 3TAMA 1RBUA 2HVIA 1S1VA 4OJRA 4CGFA 1Q9XA 1TAUA 1XI1A 4JRPA 3SYZA 4DQPA 3JYTA 3DYAA 1IH7A 2GUIA 2Q3SA 4BDZA 3SQ0A 3O3HA 4DQQA 4Z4FA 2VG6A 3ALYA 4DTUA 5SZTA 1CZBA 4NCAA 1RBRA 3HM9A 3AVBA 3LP0A 3KJVA 3L8BA 1JL2A 1UOCA 4YFUA 2OPRA 3AO3A 3OS1A 2W42A 4CGDA 2ZE2A 4FM0A 5J2PA 3AA3A 4CF0A 3DLBA 1B9FA 3S9HA 4CJEA 5D3GA 4DG1A 4BE0A 2KZZA 2BDPA 1N6QA 4MFBA 2VWKA 3NGIA 2G8HA 1QHTA 4E3SA 3ZSYA 3HK2A 4RG8A 4FZXC 3RRHA 4AHVA 3HT3A 4CCHA 3O3FA 3NHGA 2D0BA 4KTQA 3RWUA 1GOBA 3OYNA 3OJSA 2ETJA 3CG7A 4CGGA 2BANA 4O4GA 1WNSA 3DMJA 3VQDA 4KAZA 4UQGA 1FK9A 5HRNA 3VQCA 1FKOA 3ZSOA 1TKXA 1TV6A 3MEDA 2PYJA 2RN2A 2XHBA 1TK0A 3P83D 4KREA 1TVRA 1HYSA 4HCCA 2YNIA 1X1PA 2X74A 4CE9A 4JS4A 4CFDA 3VQ5A 1L3TA 3TAEA 1L3UA 3S3MA 2JLEA 2E6LA 4DTRA 4KTWA 5CYQA 4CGIA 4ELVA 3V9SA 1XHZA 4M3YA 2FBYA 3CYMA 2OYQA 5C24A 1RT3A 4DS5A 3M8QA 3CM5A 1T03A 3HL8A 4DSJA 3QIOA 2AJQA 2ATQA 4DQRA 3FFIA 3TABA 3AVIA 4DMNA 5FDLA 4FJ9A 1S6PA 3L2RA 1TK8A 3KD1E 1LWCA 4FLWA 5KGWA 4B08A 1JLBA 1HRHA 1L3VA 5C42A 2PYLA 2XY7A 4F3OA 1WSJA 1KTQA 3OJUA 4DTPA 4Z4IA 3TR8A 1U47A 4RW6A 4J2BA 5FRNA 4M45A 1S6QA 3IG1A 4CHQA 3WNGA 2A1SA 4M42A 4CK3A 1BCOA 4KHUA 1BIZA 5KTQA 1RBSA 4CEFA 4CEOA 1ZYQA 4CGHA 2Z1IA 2ZQBA 4BE1A 4N41A 4Z4CA 1KVBA 3V1QA 4BDYA 5DMRA 4OKJA 3OYCA 4QCLA 1SKWA 3O3GA 2DY4A 4DSEA 2ITGA 1REVA 2HHSA 2NUBA 4LSLA 4Z4GA 1KVAA 4ELUA 4FK2A 2X6NA 3QO9A 3VA3A 4DFJA 1TKDA 2IGIA 1BIUA 1WSHA 3MECA 3NFAA 4HCBA 3PUFA 2DTUA 4NYNA 1LAVA 4KHQA 4ID1A 3IRXA 4CGJA 1NK8A 3HVTA 3OYMA 3MEEA 1SL2A 3OYGA 1CXUA 1NKEA 4E1NA 3NBPA 1RT4A 4ZTJA 2HHWA 1JLFA 4IKFA 4DU1A 3BGRA 4B9VA 4CIGA 1WSGA 1ITGA 2RF2A 3NH2A 3OYJA 1U4BA 1BQMA 2JGUA 4FJIA 4B9SA 3DRRA 1VSLA 3UIQA 5CZ1A 4C8KA 3LP3A 2IAJA 2IOCA 2KFNA 3VQAA 1B9DA 1HNIA 3L2UA 3MEGA 3V1RA 4Z4HA 1YTUA 1T05A 5KGXA 2YHAA 4FK0A 3ZT2A 2WOMA 3DOLA 4FLZA 1XC9A 1RNHA 3AVHA 3M8PA 3SUPA 1S1TA 4KHWA 1KCFA 4FCYA 3AO1A 3LWLA 3NF9A 2FBTA 4KB1A 4Y1CA 4AHSA 4E7HA 1WSIA 4JRQA 4FK4A 4B8AB 4DFMA 3AO5A 4CESA 4CHYA 5SWMA 3QEWA 3LAMA 4I9LA 3DRSA 4DTOA 2HHXA 1S1UA 1LAWA 4DU3A 4N5SA 2YKMA 3DLGA 4FW1A 2YNHA 4FJ8A 1VRUA 4FZZA 3LAKA 4I9QA 1ZBFA 3VQ9A 1JLGA 1I39A 3VQ6A 4HVJA 1J53A 1NJXA 3AVAA 4RW8A 1TAQA 5K14A 4CF2A 3K5LA 2ZD1A 3L3VA 2I5JA 1EX4A 4FJKA 1SKRA 4FXDA 4H4OA 1JXBA 1KFSA 3SQ1A 3VQBA 3RTVA 4KI6A 3VQ4A 1TKTA 3KLFA 3WNHA 4CJ4A 3G10A 3ZT3A 2VWJA 3VQ7A 4FLYA 3SNNA 4CFBA 4CK2A 4W5TA 4F8RA 5HROA 4DU4A 4LH5A 4B9TA 4C8MA 3PX4A 3HVRA 2HW3A 4GVMA 3V9ZA 1X9WA 3LP2A 3AVJA 2RKIA 3SZ2A 1YTAA 1S9GA 1QQCA 5T7BA 4HUEA 4CJKA 4ELTA 4L8RB 4N76A 3ZSZA 3S3OA 1VSFA 1QE1A 1WAFA 4RW9A 4DFPA 5E41A 1S1XA 4C8NA 4CJWA 2IDOA 3HJFA 3QESA 3TANA 1IKXA 3RMBA 5HBMA 1RTHA 3S3NA 1A5WA 3AA2A 2A1RA 4M3ZA 2BE2A 4R5PA 1WSEA 2IS3A 4O0JA 4CJVA 3KTQA 2E6MA 3T1AA 3TI0A 3ZSQA 4PQUA 3LDSA 1C0MA 2D0AA 1BQNA 1RTJA 3E01A 1D9DA 1W9HA 3MXIA 2KZMA 3AV9A 4AHUA 4AHRA 1EP4A 2HB5A 3CFRA 3T3FA 1RT7A 1TL1A 3CFOA 1B92A 3OVNA 4E7LA 4CHPA 1HPZA 2X6SA 1NJYA 4K8ZA 1ASVA 1CXQA 3KK1A 4CJQA 1D8YA 3P5JA 2G8WA 3LP1A 5CZ2A 2G8UA 3TAQA 3QEVA 1ASWA 3AO2A 5JS1A 4CHNA 4B8CA 4KKOA 1HQUA 4CIEA 3SQ4A 3RRGA 1RT2A 1O1WA 3ULDA 1J54A 3BDPA 3EZ5A 1T7PA 1K6YA 1C0UA 3HO1A 4MQ3A 4CJ3A 3PY8A 2QK9A 2F8SA 3SUQA 2KFZA 3NAEA 4Y1DA 2OPSA 4BACA 1QS4A 3VQPA 1MU2A 4E7IA 4CIFA 3L2WA 3QETA 3D45A 1HYVA 3F9KA 1SL0A 4F2RA 1YT3A 4CEDA 2G8KA 3H08A 1IKWA 2XY5A 3PO5A 2B6AA 3IAYA 4GMJB 1WLJA 3DLEA 2B4JA 3PX0A 3HXMA 3RR8A 4CF9A 1TGOA 4OKEA 5HRSA 4J2EA 3HYFA 3PV8A 1NKBA 4CEBA 1RT6A 4CJPA 1TL3A 3K5OA 4KHNA 4FJMA 1DLOA 3SV3A 4FJLA 1HQEA 2Z1JA 4G1QA 1RT5A 3D0PA 4B9NA 2YNGA 4FLVA 4I7FA 1D5AA 3SJJA 1QSLA 4F2SA 2F8TA 4DS4A 1HNVA 3ZSXA 4CEAA 3OYKA 1NK7A 3AVMA 1NJWA 3V9WA 2XO7A 4OPJA 2HNYA 1TK5A 4OVLA 3K58A 1D9FA 2RPIA 3HPGA 2HNDA 4FLXA 4AH9A 3SPYA 2HHUA 3CFPA 1KLMA 3G0ZA
chains in the Genus database with same CATH superfamily
2QKKA 3AA4A 3UKUB 1ZBUA 1QTMA 4YOWA 4O0IA 3AARA 1KAZA 4LD0A 1T44A 1W2BM 3TAPA 1L3SA 4CHOA 5DK5A 2G8VA 2QWQA 1HUXA 5AQXA 3VPZA 1IG9A 3U3GA 1KD1O 2A41A 3ZETA 1BL3A 5KRTA 1NWKA 4FPAA 4FJHA 1T6DA 3KD5E 4OGCA 4W5RA 4X66K 2A3ZA 1G99A 1BCMA 2WONA 5KI6A 1E4GT 1RCHA 1XC3A 3B8AX 3TAFA 5CYMA 3PO4A 3QNNA 1OH8A 2KQ2A 4JLHA 4E19A 1FKPA 2Z1GA 4TSXA 1YVUA 3NF7A 4JI6K 1QSYA 3TARA 2O4IA 4BY9C 3SQ2A 3ISNC 1RGIA 4CJUA 1NKCA 2OZSA 3I33A 4I6MB 3J80O 1VQ9N 3KLIA 1RTIA 3MXMA 3QERA 3NH0A 4KFBA 1HJOA 3KZBA 4CHZA 4BRGA 4FJ5A 1KRPA 4N56A 5FPMA 1Q9YA 1Q86O 4J2DA 2B5JA 3I8BA 1U6ZA 3PLAA 1SQKA 4B9UA 3ZETB 2NLXA 4GY2B 5A2QO 5AQMA 4W5OA 2OZMA 2P9UA 5AQLA 4HTUA 2VCPA 4JKGB 4KI4A 3CF5L 1LV5A 3SMSA 3MN6A 2DFEA 1TYQA 2GV9A 4OKKA 3TSPA 3LDLA 2LSNA 3IS9A 1YI2N 4FVMA 2OA8A 5E26A 4HHTA 3QNOA 1IKVA 4CJ5A 2G8FA 4JI3K 1JLCA 3HPOA 3C95A 3HRGA 3ID8A 4DWIA 1K8KB 1HR0K 2YV0X 5CY4A 2HNZA 3ZT0A 4FYDA 1OH5A 1X9SA 4M3XA 4H5TA 4JHDA 4IG0A 3AVFA 3TSQA 5JLHA 2BH1A 2JWLA 2RHKA 4CZJA 1JKHA 3DOKA 2YHYA 2D5RA 3O4NA 5J2NA 4LF8K 4GW6A 4CFCA 1BI4A 5AQJA 1L5UA 5BN9A 4H0VB 2HOEA 4EZ9A 3AVLA 2HF4A 3KIOA 2QKBA 3QMLA 1UA1A 4JI2K 3RMAA 1CLQA 2E4LA 1NGFA 5BPNA 3KLGA 5J1EA 1JCFA 1DTTA 2P1JA 2O8BA 4Q5VA 5LMUK 3SCXA 3V4IA 3DI6A 3B6OA 4CEQA 2NRWA 3AA5X 4CD1A 1EETA 3AVCA 3UB5A 1W7AA 4B9QA 4PUOA 3V6DA 3CCRN 3CETA 3ASMA 4FJGA 1JLQA 4NYFA 2DFHA 4ISGA 4DF4A 1HPMA 1LW0A 4BR9A 3WNFA 4NCGA 4LF7K 3OYDA 5GIPA 2VG5A 3LZIA 3DM2A 5AFUA 3HOSA 3FZLA 3WEEB 4JI5K 2GBZA 2UUCK 4WFAL 1NOZA 4FWLA 3CQ8A 1HKBA 5AQUA 4NB4A 4JD2A 3CC2N 1A5XA 4LH4A 3QEIA 1VSKA 2H3GX 2X78A 1KAYA 4IBNA 3VEOA 4KTZA 4DV4K 1SL1A 4FM1A 4H8KA 3R3LA 2QW9A 1RBUA 4OJRA 4JRPA 3DYAA 3SQ0A 3OW2M 4Z4FA 3MN9A 3CI5A 4KH4A 4DV2K 1RBRA 3LP0A 1JL2A 2P9NA 1UOCA 4YFUA 2W42A 3S3OA 1KSPA 4CGDA 3AA3A 5BRDA 3DLBA 5D3GA 4DG1A 1MWMA 4FWOA 1N6QA 4BR0A 2VWKA 2G8HA 3HK2A 4RG8A 4AHVA 4KTQA 3OJSA 2BANA 3DMJA 2NNWA 3A5MC 1FK9A 4LF4K 3VQCA 3SAHA 3CCUN 2GX9A 1TK0A 5EY4A 1NG9A 1EWRA 4WF9L 3LL3A 4CE9A 4JS4A 3G6EN 4EIAA 5ADXH 3S3MA 4DTRA 5CYQA 4CZMA 2QXLA 4ELVA 3V9SA 2WUSA 2OYQA 1RT3A 1T03A 3IKMA 3QIOA 4B1XB 4YOVA 3TTCA 2AJQA 3O9SA 4H5VA 2P9LA 4DQRA 3AVIA 4DMNA 4FJ9A 1S6PA 1KXPA 5FPEA 3DLLL 1JLBA 1L3VA 2PYLA 1WSJA 1KTQA 3SAGA 3OJUA 4Z4IA 4O8KA 3TR8A 3MK6A 4NO7A 3IG1A 2W6KA 5KTQA 2QI2A 5GAGP 3ZX3A 1SZ2A 1KVBA 3V1QA 5EX5A 5DMRA 1SKWA 5GAEP 3C6HA 4GV6A 2NUBA 1QQMA 1NLVA 1LOTB 4NLBA 2IGIA 1BIUA 4KHPK 2E88A 3PIPL 4HCBA 3PUFA 2DTUA 4NYNA 3HVTA 1V4SA 3MEEA 4A62A 4E1NA 1JLFA 4DQ8A 2IIRA 4DU1A 3WXMB 4YOYA 4BRPA 1WSGA 2RF2A 3OBYA 4OPHA 1U4BA 1ATNA 3DRRA 2E2QA 2P9IB 4C8KA 1K9MO 2IAJA 4WQ4C 4JKGA 3TSUA 4CW7B 3EKSA 3CCMN 1VQ5N 4LFBK 5AQSA 4Z4HA 4XH1A 4M7XA 4MLEA 4H0YB 4FK0A 4BR2A 4DR5K 1RNHA 3SUPA 1S1TA 4H03B 4LF6K 5BRFA 1EWQA 4KB1A 4Y1CA 1VAZA 1HLUA 4FK4A 4B8AB 4M63C 4CHYA 3LAMA 4BC4A 1GLJO 3GG4A 4H0XB 2YNHA 1JCEA 4I9QA 1ZBFA 1NJXA 3VQ6A 1J53A 4RW8A 5K14A 4CF2A 2ZD1A 3OBWA 4H4OA 4XEIA 3VQBA 4KI6A 4LF9K 2ZGZA 3WNHA 3ZT3A 4KBOA 4W5TA 3CC4N 4LH5A 4EHUA 2VQEK 4JI7K 2HW3A 3V9ZA 1VQMN 2RKIA 1YTAA 1QQCA 4HUEA 4JKAA 4CJKA 4RW9A 4PKHA 1CZAN 4DFPA 1S1XA 4CJWA 4PL8A 3RMBA 4FVUA 1A5WA 2UU9K 1WSEA 3CCSN 3KTQA 2E6MA 3TI0A 4CBXA 4PQUA 3E01A 1M90O 4AHRA 2HB5A 3D2EA 4E7LA 2ZM6K 4CHPA 1NJIO 5JVGL 4CJQA 2G8WA 3TTDA 3LP1A 4BRMA 3TAQA 3QEVA 4B8CA 3SQ4A 3P38A 3RRGA 4X65K 3BDPA 1K6YA 2QK9A 1YUWA 2P9SA 3FZKA 3FFKB 4O5FA 4Y1DA 5BR8K 2PBDA 3VQPA 1MU2A 4E7IA 3L2WA 1HYVA 3PO5A 1WLJA 3DLEA 3L4QA 5GINA 3BF1A 3RR8A 3EKUA 5HRSA 4CJPA 1RT6A 4KHNA 3K5OA 1QVGM 4G1QA 2NRTA 2ITMA 1YXQA 3SJJA 4K41A 1D5AA 1QSLA 4GKKK 3ZSXA 4CEAA 4E1JA 1D9FA 2AP1A 2RPIA 3HPGA 4AH9A 3J7ZO 3O9TA 2GWJA 3C65A 3QINA 2PFUA 3OS0A 4M3RA 4H5RA 2QWPA 1Y97A 4H0TB 3LWMA 4PKGA 4BDPA 5AQFA 2KW4A 3LANA 2CGJA 5KRSA 3QEPA 4J8FA 2HVHA 1BU6O 3VQEA 1Z25A 4CFAA 3HSTB 3IUCA 3T19A 4IG3A 3HP6A 2AA4A 4B9MA 1RFQA 2QM1A 4RWTA 5EOYA 4JKCA 3QLHA 3THYA 1WOQA 4HWIA 3MXJA 3U9DA 2Y1IA 4B1ZA 2Z1HA 3HZ6A 3MWPA 4NXMK 2XY8A 3OYIA 2YKNA 4WQ5C 3KLHA 2YJFA 4CK1A 3SI6A 1QSSA 5AZIA 4AQYK 4KH6A 4FJ7A 3KKSA 4WQ5A 3OYBA 3JS6A 2E8AA 3DJCA 1HNZK 4DSLA 4JS5A 5AQOA 4DSIA 4FWQA 5GADP 1OVYA 1RDCA 2JWKA 3CJCA 4H5WA 1Q81O 5HRRA 1SAZA 1VQ6N 1BG3A 3H3NO 1C0FA 5AQZA 1HNWK 3H3OB 4DR1K 2UUBK 2YHBA 2HHVA 1G15A 3SMPA 1W97L 3DRPA 5I3UA 4E89A 4B3OA 1RDDA 3ITHA 4BWJA 3ZSVA 3ATUA 3RRHA 4CEZA 4I2QA 3ZEUB 1LWEA 3GL1A 3CMAN 3M8RA 3ZSWA 5M1PA 2FLOA 1U04A 3MDQA 1BWFO 3KVGA 4DV0K 4DV5K 3D6RA 2NRHA 4JK8A 3WQTA 3ZX2A 5M1KA 1JLEA 2CH6A 2HMIA 4AM6A 5BREA 4HUFA 3UKUA 2D0CA 3AVNA 1ZBHA 3O4QA 2BGGA 2R7YA 1HYZA 5EXWA 1U45A 4K8XA 1XWLA 3P1GA 3O6WA 4JD2B 1BI4B 3E1YA 1T6CA 4C1NK 3A2FA 3SUOA 5JS2A 4OLBA 2FBXA 1WSFA 3CIPA 3CCQN 1RILA 3HI0A 3I0RA 1UA0A 2VGMA 3L2QA 1WN7A 1J5OA 5FROA 4N41A 3ZEUA 1C0GA 1Z26A 2VGNA 3RMCA 3PIOL 2OPQA 3CC7N 3CERA 3K0SA 1VSMA 4CERA 5ADXA 4IDKA 4BRKA 3K9KA 1VSIA 4XH5A 5GAHP 5DM6L 4ISEA 3NE6A 3U3YA 2O8DA 2O8BB 3VF6A 1XNQK 4AHCA 1DT9A 4E0DA 2F96A 4IFVA 1VQNN 3OS2A 5FPNA 3NCIA 4M41A 3RVCA 2DFFA 3LDNA 2D4WA 3C94A 3GDQA 4KO0A 4FWKA 3V9UA 2PZSA 2O8CB 3AY9A 4IZ9A 3T7ZA 1WB9A 3LALA 4CF8A 5BPMA 3O1WA 2QWRA 1ASUA 3DXKA 4G9ZA 1EKEA 3BZCA 4IXCA 4IJAA 3EYZA 1RBVA 4Q0BA 1VQON 1YF5L 2HVIA 3CHWA 1Q9XA 1XI1A 3THXA 2GUIA 3VTIA 2FXUA 4DQQA 4JNEA 1BA0A 1CZBA 5AQTA 4DHYA 5AFUH 4BG8A 1ATRA 3ZX0A 5F0XA 5J2PA 4FM0A 4CF0A 4IOXA 3S9HA 2V51B 2O8DB 4CJEA 2KZZA 3NGIA 1QHTA 2GEMA 4FZXC 3RWUA 3OYNA 4O4GA 1WNSA 5HRNA 3A5OC 1TV6A 2PYJA 2RN2A 2XHBA 3P83D 3FR0A 1TVRA 4DR7K 4HCCA 1NGEA 2X74A 2QA4N 1L3TA 4DV3K 2JLEA 1NM1A 2F9WA 4CGIA 2W6LA 1XHZA 1NBWA 1WBDA 3M8QA 3CM5A 1BA1A 5AZJA 3LDOA 3VGLA 5BRHA 4JKDA 3C7NB 4F3OA 3M6GA 4DTPA 4J2BA 3NVMA 1QZ5A 1BCOA 4FOEA 1RBSA 3C7NA 4CGHA 4DR4K 2ZQBA 4BE1A 2NRZA 4OKJA 3OYCA 4GKJK 4JV5K 4BRIA 4K25A 1KVAA 4ELUA 1KC8O 1NGGA 1DGKN 3MECA 3NFAA 4BGBA 1DEJA 1LAVA 3QFPA 5KPZA 3O4WA 4CGJA 4BRQA 2OANA 2UXCK 1CXUA 1NKEA 4BR4A 3NBPA 4ZTJA 3EE8A 2HHWA 4DCHA 1NGDA 3THWB 4QS9A 4FO0A 3ZLJA 3NH2A 4BQLA 3SBTA 3UKRB 2D1KA 1ESVA 2CH5A 3CCJN 3UIQA 5CZ1A 2IOCA 1B9DA 1N34K 3EN9A 4JKHA 3MEGA 4GVEA 4B1UB 2YJEA 5IWAK 1IG8A 3ZT2A 2O8EA 2WOMA 2P9PA 3TPQA 1XC9A 4AM7A 4KHWA 5M1QA 4BRNA 4FCYA 4BRHA 3LWLA 3NF9A 1QVFM 3MCAB 4E7HA 3BZKA 4CESA 4DFMA 4JI4K 4IEEA 4I9LA 3DRSA 4EFHA 4DTOA 3T1YK 5HL7L 4FW1A 2QTDA 4FJ8A 3CQYA 1JLGA 4HVJA 3EE9A 3K5LA 2I5JA 3VQ4A 3NMUA 4JYAK 2VWJA 3G10A 3CPWM 4FLYA 3SNNA 4CFBA 4CK2A 3BF3A 4DU4A 3VF2A 3L4IA 4YOTA 3MX5A 3HVRA 3J7YP 3LP2A 1QHAA 3AVJA 3SZ2A 1X9WA 1S9GA 2P9UB 1X3MA 2ZWHA 4ELTA 4L8RB 4N76A 3ZSZA 1QE1A 4C8NA 3QESA 2E2OA 1RTHA 3S3NA 2J4RA 3AA2A 4V19S 2BE2A 2ZGYA 4O0JA 3T1AA 4LFAK 3ZSQA 1C0MA 3SJHA 1BQNA 1RTJA 1T3VA 1W9HA 3AV9A 4AHUA 1EP4A 2KHOA 1TL1A 3SBGA 1GLLO 3OVNA 5EVZA 3CJ9A 1NJYA 1ASVA 1IBMK 1CXQA 3H6EA 3KK1A 2Q0RA 5CZ2A 3LM9A 1ASWA 3AO2A 5AQYA 3MWTA 4CHNA 1O1WA 3ULDA 1J54A 3KWIA 1QS4A 1SL0A 1N8RO 3QETA 3F9KA 4BR5A 2G8KA 2XY5A 3OA9A 3A5LC 4IJNA 1NGAA 5KQ8A 3PX0A 5CE3A 2WBNA 3L6QA 2P9SB 4OKEA 4J2EA 1NKBA 5LMNK 4YHHK 4CEBA 1TL3A 3VESA 4FJMA 4FJLA 3JXUA 5JLFA 2FSKA 2YNGA 4I7FA 3M5RA 2HSTA 5BN8A 5C12A 1MA9B 5FPDA 1NK7A 3OYKA 3AVMA 3BY5A 1TK5A 3K58A 4DB3A 4EHTA 3I55N 2HNDA 1GLDG 4FLXA 3CFPA 1KLMA 3G0ZA 3CJBA 1V4TA 4JK9A 3OY9A 5M1NA 4W5QA 4Z0UA 2HF3A 3L3UA 2HHTA 4WFNL 4H4MA 4I2PA 1GLBG 3G25A 4RW7A 4EZ6A 3MAQA 2V7YA 3AGRA 3VEZA 3D2EB 1F21A 1FJGK 3NVKA 1VQ8N 4M3WA 3VTHA 3OYLA 1UAXA 2XRIA 4M3UA 4MLHA 4CECA 4CJSA 3DXKB 4PWDA 3VMFB 3KK3A 3O8MA 4PY5A 3V9XA 1Z6RA 2OTLN 4B9LA 3TAGA 3DLHA 4FJNA 3DAWA 4BROA 1U48A 4DSFA 3J7AP 1C1BA 4LF5K 3I0SA 5EU7A 1Y64A 4H0OA 1NJZA 4DLEA 1RTDA 3DWLA 5HP1A 4K0KK 1U2VB 4YORA 4B1WB 3E9PA 2A40A 3AAPA 3VQ8A 4DKWA 1TKZA 1IBKK 4KB0A 3KLEA 3B6PA 3J81O 5AZIB 1EXQA 3THVA 2IVOA 4FWPA 2VQFK 1FXXA 4R79A 3L2VA 1KLNA 3I56N 5AQIA 3GBTA 3C6TA 3KKRA 1SKSA 5J2QA 4EP4A 1A5VA 3K57A 1VSEA 4BRFA 4DTXA 3Q7BA 3R9PA 3KK2A 3O9UA 5ELZA 3O08A 2IVNA 4ICLA 3NGYA 4UY8O 5J2MA 1RT1A 2P5GA 4W5NA 1JL1A 3MX2A 4CZLA 4FZYA 1ATSA 1H1VA 5HRPA 1HMVA 4KV8A 3Q7CA 4DTNA 4M3TA 1JLAA 3VN5A 3A8YA 3VERA 3W0LA 1NK9A 4GNIA 3NF8A 3NF6A 3RR7A 4LFCK 3DLKA 4BR7A 4OPAA 3R1XA 2E20A 3OYAA 3HTVA 3WEEA 4YNQA 1VSHA 3OYFA 3D7EO 1YJWN 2YCHA 3ZT1A 3AVKA 4JAXA 1X9MA 1BGXT 4O5BA 4O44A 5HLFA 3EEQA 1E3MA 1ZBIA 4J2AA 1BOTO 4H5NA 2RE2A 2P5OA 3FZHA 2PY5A 2HHQA 3UKRA 4CI6A 1S72N 1KVCA 3SPZA 5AQQA 3SK3A 1IV0A 5TKWA 1C1AA 1BUPA 3E66A 2A42A 3ENBA 2P9KB 1VK0A 4CJFA 1NOYA 2HMPA 3ULEA 5CR4A 1NK5A 3K59A 1Q7YO 1N5YA 5DM7L 4KHSA 4ZTFA 3QBXA 4WQ4A 4F4KA 1X3NA 4K42A 4DQIA 3MMVA 1ZBLA 4AHTA 1XUPO 3SUNA 1GOAA 2QWLA 2FBVA 4A59A 1T8EA 1J9AA 4FPBA 4CVNE 3NDKA 3TWHA 3EZWA 5AQWA 2ASMA 3H46O 2HHHK 1RDAA 3DLRA 3DXMB 1GLCG 3I8DA 1HJRA 4A2BA 3VA0A 2E1ZA 5M1FA 1NGBA 3ZCMA 1NGCA 3CCLN 1IKYA 1W0HA 1NK0A 3QDKA 5KPRA 4MDBA 2QXFA 3NGZA 4BGAA 3HOTA 5I42A 4ZHRA 3TAMA 2HBJA 3WT0A 3SYZA 4DQPA 3JYTA 1IH7A 4EAHD 4XH4A 3O3HA 3UE5A 2CGLA 2VG6A 4DTUA 5SZTA 2E5LK 4IFEA 1YJ9N 3AVBA 5C15A 3OS1A 2OPRA 3AO3A 2ZE2A 1XMQK 2E1YA 5CHIA 4DUZK 4JI1K 2PAVA 4MFBA 4A57A 3H1VX 4E3SA 4C1NI 4CCHA 3O3FA 3NHGA 2D0BA 1IJJA 1GOBA 2ETJA 4BRCA 4CGGA 3VQDA 3VEVA 3P4IA 3ZSOA 1FKOA 2E2NA 3MEDA 4KREA 1X1PA 4CZFA 5I9EB 3VEWA 3TAEA 1L3UA 4DR3K 3LDQA 5FLXO 3M1FA 4IOAL 3CYMA 4MO4A 1E4FT 3O5BA 4DSJA 2ATQA 3FFIA 3TABA 5FDLA 3C0BA 4M7YA 3WQUA 4IEIA 2F7TA 5C42A 2XY7A 3VENA 3GE1A 2Q0UA 1U47A 4M45A 3LDPA 3WNGA 3P31A 3U9ZA 4KHUA 1BIZA 5TKYA 1SS6A 1ZYQA 3OTOK 3KHYA 4B1VA 4Z4CA 4BDYA 2W40A 3ZYYX 3CPEA 3G71N 3O3GA 4GV9A 2V7ZA 4DSEA 4JHDB 2HHSA 4FK2A 3VA3A 3QO9A 3ID6A 1WSHA 2O8CA 3O9QA 1X9JA 3IRXA 1VQKN 1NK8A 3OYMA 1ZXOA 3LM2A 3OYGA 1VHXA 3W3DA 1RT4A 3BGRA 3U8XA 2QWOA 1ITGA 2YHWA 4PHTX 5JVHL 5LL6Z 2P9IA 1VSLA 3LP3A 2FF3B 4DUYK 4CJ7A 2GTDA 4FWRA 2KFNA 3VQAA 1HNIA 1NU0A 4BVPA 1T05A 5KGXA 3A0IX 2YHAA 5E84A 3CJ7A 1GLFO 3AVHA 3M8PA 5GIOA 4JI0K 1KCFA 3AO1A 2FBTA 1YJNN 4JN4A 2UUAK 5KPTA 2GUPA 4X64K 4JRQA 3AO5A 1TUYA 2NZTA 3VGKA 4QS7A 4DU3A 4N5SA 3DLGA 3F2KA 4BREA 3VQ9A 1I39A 3TTFA 1TAQA 3L3VA 1BO5O 1SKRA 4FXDA 3WXLA 4YDUC 1TKTA 3KLFA 4CJ4A 1YHQN 3VQ7A 4F8RA 2IVPA 5LJWA 3KK7A 4B9TA 3PX4A 3R8EA 4FWSA 5T7BA 4A5AA 1WAFA 1NGJA 4FWNA 1XMOK 3HJFA 2IDOA 3CJ1A 1YVNA 1YITN 2D0OA 4L3QA 2A1RA 1S3XA 4M3ZA 4R5PA 5MLCQ 4FL9A 2Q31A 3TU5A 3LDSA 2D0AA 3SLCA 2NRVA 3MXIA 3S41A 3CFOA 1B92A 1VQPN 1ZC6A 1VQ4N 1HPZA 2V52B 2X6SA 4K8ZA 1D8YA 3P5JA 3CQXA 2G8UA 2Q36A 4JI8K 4CIEA 2FSJA 3ATVA 4JEPA 2A6AA 3EZ5A 1T7PA 1RDWX 4CJ3A 2I7NA 4BC3A 2F8SA 3SUQA 3CD6N 4YOXA 2OPSA 4BACA 1R59O 4F2RA 1P90A 3D45A 3QFUA 1IKWA 3H08A 2B6AA 5M1OA 1HKCA 3AGKA 4IDHA 1JJ2M 3HXMA 1TGOA 2P9LB 3HYFA 3E9OA 5BPLA 1DLOA 1HQEA 1RT5A 2BUPA 3D0PA 4B9NA 4FLVA 4F2SA 2F8TA 3WXKA 3V9WA 3N4QA 2HNYA 4OVLA 5AZJB 4U7BA 1Q82O 1NGIA 3SPYA 4HUGA 2OPPA 4CF1A 1K8KA 3OYEA 3ENHA 1BISA 3K5NA 3CCVN 4OLAA 3IDHA 1JXEA 1S5JA 4FLUA 3HM8A 1VSDA 4WFBL 1U49A 3SV4A 4JKBA 3QEXA 3C6UA 4OGEA 4WE1A 3MN5A 1NGHA 1NMDA 1R0AA 3HPHA 1DKGD 3JSMA 1GLEG 4FW2A 3CM6A 2HBMA 1VSJA 3MN7A 1HNXK 3BUZB 4WYBA 2ASOA 4ID5A 3M8SA 4IFYA 3QICA 3LZJA 4NLCA 1QZ6A 4JKFA 2DPNA 3THWA 1S22A 4DV1K 4DSKA 2KTQA 2HBLA 1NNEA 3OHRA 5F1XA 4IOCL 4LSNA 4WCEL 3V1OA 3VF4A 5HOOA 5AJ3K 1HX1A 3F73A 3U6FA 4YY3K 1IBLK 1VRTA 1XQSC 3PSFA 4DTSA 4RW4A 2FF6A 1Q8IA 2Y1JA 3D2FA 1OVQA 2P9NB 2P9PB 4E7KA 4PKIA 4FLTA 3NH1A 3RSEB 4GV3A 1IO2A 1CZ9A 1LW2A 3EO3A 4BRLA 3ZT4A 4NCBA 2OTJN 4KRFA 3RMDA 3V81A 4DR2K 2EX3A 4Z4EA 3WNEA 4B3MK 1NK6A 4CEEA 4CZIA 4DFKA 3P39A 3WXJA 4CJTA 5C25A 4E1MA 2QWMA 1RDBA 5KQDA 2O4GA 4DTMA 4BQZA 2UXDK 3BP8A 4K43A 1UWBA 4FM2A 2ZJQL 1S1WA 4CJRA 3OYHA 4AILC 1I3AA 1SUQA 2GWKA 3PX6A 1JCGA 2EHGA 4DV7K 4DV6K 4Z94A 3E9LA 3ZSRA 4N47A 4LY7A 1C6VA 4ILGB 3IFRA 3EY1A 4BG9A 3K5MA 3EL2A 1YIJN 3H1QA 3MCPA 1KFDA 4BC2A 1ILYA 1RBTA 3H45C 4PA1A 1HKGA 4QAGA 1J5EK 1OH7A 4DTJA 2HBKA 5FRMA 4Y0WA 1SV5A 3VQQA 4O55A 4CJLA 1WAJA 4OPKA 4JKEA 4QS8A 1FW6A 4FJXA 4A5BA 1O13A 4QOZB 5AQKA 4EP5A 3T1HK 1DTQA 3QB0A 4DF8A 3O80A 2G8IA 1J6ZA 3AAQA 3AVGA 2F4VK 1C1CA 4FJJA 4F3TA 5AQHA 3K9JA 1NK4A 3R6MA 5H1SQ 3HP9A 4XIUA 3O1BA 2XY6A 1LWFA 3LPTA 1C0TA 4F9OA 1GOCA 3FE1A 1N36K 2BTFA 4DQSA 2ZF5O 4DLGA 1S9EA 3VETA 2KKZA 4OO1J 4C8OA 2IC3A 4KH5A 1XHXA 1BHLA 3N4PA 4CD3A 1LCUA 4A2AA 4RCHA 4ILJA 1K73O 3QIPA 4BWMA 3AO4A 2FC0A 3HBTA 2YNFA 4KPYA 4FSVA 4AF1A 4KHYA 2OCEA 2VG7A 2O8FB 4BE2A 4C8LA 3K2PA 2P51A 4E7JA 2ASPA 3LPUA 1S1VA 4CGFA 1TAUA 4U67L 3L0QA 4BRDA 2Q3SA 4BDZA 4HTLA 4CZGA 4IO8A 2QWNA 3ALYA 3U4LA 4FOIA 3CMEN 4NCAA 3HM9A 3KJVA 4YDUA 5B8HA 3L8BA 5JMVA 4B3SK 1QQNA 1OH6A 3ULEB 1B9FA 2F9TA 3FLCO 3GOIA 4I6MA 3VOVA 1MWKA 1VQ7N 5C10A 4CZKA 4BE0A 2BDPA 1GLAG 3KWGA 3ZSYA 2EWSA 5C2DA 3HT3A 2E2PA 3CG7A 2WC9A 1XNRK 4KAZA 4UQGA 2NRXA 3WUHA 1TKXA 1HYSA 4CZEA 2YNIA 2WFBA 4B1YB 4CFDA 3VQ5A 2E6LA 4KTWA 1NMNA 4BVOA 4M3YA 2FBYA 2W41A 5C24A 1KAXA 4DS5A 3HL8A 2Q1NA 3C6AA 5AQGA 2P9KA 5JICA 3L2RA 2YI1A 1Z05A 1TK8A 3KD1E 1LWCA 4FLWA 5KGWA 4B08A 1HRHA 3VGMA 1TUUA 3J8AA 2QEXN 2VWBA 5AQVA 4RW6A 2YHXA 5FRNA 3CXCM 1S6QA 4CHQA 3THXB 2A1SA 4M42A 2D0PA 4CK3A 3VEXA 1MDUB 4CEFA 4CEOA 2Z1IA 3FGUA 3CCEN 3D2FB 5AR0A 4QCLA 2DY4A 2ITGA 1REVA 4Z4GA 4LSLA 2X6NA 4DFJA 1M1KO 3BEXA 1TKDA 1N32K 1K8AO 4ISFA 1BDGA 4KHQA 3FZFA 4ID1A 2NRRA 2KLAA 1SL2A 2FSNA 2GELA 5F2RA 4IKFA 1WBBA 2YX6A 4CIGA 4B9VA 3OYJA 1BQMA 2JGUA 4FJIA 4B9SA 5AQNA 2UYTA 3G4SN 1TYQB 2I7PA 4LC9B 3L2UA 1WUAA 1OKJA 3V1RA 1YTUA 2WTUA 1U2VA 3DOLA 4FLZA 4X62K 1Q18A 3F9MA 4AHSA 2VYPA 1WSIA 3FZMA 5SWMA 3QEWA 4DR6K 2HHXA 1S1UA 5C0YA 4O8UA 1LAWA 2YKMA 4FWMA 3RSEA 1VRUA 4FZZA 3LAKA 5AQRA 3AVAA 4IO9L 3WXIA 5IT9O 1EX4A 4FJKA 1JXBA 1KFSA 3SQ1A 3RTVA 3SAFA 4PL7A 2Q2RA 5HROA 3F5TA 4C8MA 4GVMA 3DXMA 4MDAA 4A61A 3CJAA 4MO5A 1VSFA 5E41A 3THYB 4CZHA 5LY3A 3TANA 1IKXA 1EO1A 5HBMA 4C23A 2CGKA 3T69A 3QBWA 1P8ZA 2IS3A 4CJVA 4BRAA 2Q97A 2UXBK 1D9DA 2KZMA 3CFRA 3T3FA 1RT7A 4JK7A 3A5NC 1RDUA 1N33K 1KQSM 3HSCA 5JS1A 4KKOA 1HQUA 1VQLN 1RT2A 1D4XA 5BR9A 1C0UA 3HO1A 1ZBSA 4MQ3A 3PY8A 4YOUA 2A5XA 4OX9K 2KFZA 3NAEA 4BC5A 3IMXA 4H0PA 4CIFA 1YT3A 4CEDA 3IAYA 4GMJB 5LJVA 2B4JA 3ENOA 2O8FA 5AQPA 4ILHA 4CF9A 5C2FA 3O9RA 4CBUA 3M3ZA 1EQYA 3PV8A 3JAMO 4CBWA 1QQOA 3VEYA 3SV3A 2Z1JA 4RTFD 2ZJPL 2ZJRL 4DS4A 1HNVA 1NJWA 2XO7A 4OPJA 3PSIA 1I94K 4B3TK 2O8EB 4NXNK 4B3RK 1YAGA 2HHUA 4IWVA
chains in the Genus database with same CATH topology
2OPPA 4CF1A 2QKKA 3AA4A 3OY9A 1ZBUA 1QTMA 3QINA 4W5QA 3OYEA 3K5NA 1BISA 4Z0UA 4OLAA 3L3UA 2HHTA 4O0IA 3OS0A 4M3RA 4H4MA 4I2PA 1JXEA 1S5JA 4FLUA 4RW7A 4EZ6A 1VSDA 3MAQA 1Y97A 1U49A 4LD0A 3TAPA 1NOYA 3SV4A 1L3SA 3LWMA 3QEXA 1F21A 3C6UA 4OGEA 4WE1A 4BDPA 2KW4A 3LANA 4CHOA 5KRSA 3QEPA 5DK5A 2HVHA 4M3WA 2G8VA 3VQEA 1IG9A 1Z25A 3U3GA 4CFAA 3OYLA 3HSTB 1R0AA 1UAXA 2XRIA 3HPHA 3T19A 4FW2A 3JSMA 4M3UA 3CM6A 1BL3A 4IG3A 5KRTA 3HP6A 4CECA 1VSJA 4CJSA 4B9MA 4FJHA 4PWDA 3KK3A 4PY5A 3KD5E 4OGCA 4W5RA 3V9XA 4B9LA 4ID5A 3M8SA 1BCMA 2WONA 4IFYA 5KI6A 3LZJA 3TAGA 3DLHA 4FJNA 1U48A 4DSFA 1RCHA 3TAFA 5CYMA 3PO4A 3QLHA 1C1BA 3QNNA 3I0SA 2KQ2A 5EU7A 1NJZA 4JLHA 4E19A 1FKPA 2Z1GA 4TSXA 1YVUA 4DLEA 1RTDA 5HP1A 3NF7A 4DSKA 2KTQA 1QSYA 3TARA 2O4IA 3MXJA 2Y1IA 4LSNA 3ISNC 3SQ2A 4CJUA 2Z1HA 1NKCA 3VQ8A 3V1OA 2OZSA 1TKZA 3F73A 3U6FA 2XY8A 3OYIA 4KB0A 2YKNA 1VRTA 4DTSA 4RW4A 3KLEA 3KLHA 3B6PA 4CK1A 3KLIA 1RTIA 1Q8IA 2Y1JA 3QERA 3SI6A 3MXMA 1QSSA 1EXQA 3NH0A 4E7KA 4KFBA 3THVA 1FXXA 4CHZA 3KKSA 3NH1A 4FLTA 4FJ7A 3OYBA 4FJ5A 1IO2A 1CZ9A 3L2VA 1KLNA 1KRPA 4DSLA 4N56A 1LW2A 4JS5A 4NCBA 3ZT4A 1Q9YA 4DSIA 4KRFA 1SKSA 3C6TA 3KKRA 2B5JA 3RMDA 3V81A 4J2DA 2EX3A 4Z4EA 3WNEA 5J2QA 4EP4A 1A5VA 1RDCA 3K57A 1NK6A 4CEEA 1VSEA 4B9UA 4DFKA 5HRRA 4CJTA 4DTXA 5C25A 3KK2A 4E1MA 4ICLA 3NGYA 1RDBA 4W5OA 2OZMA 2O4GA 4HTUA 2YHBA 4DTMA 2HHVA 1G15A 5J2MA 1KSPA 1RT1A 3DRPA 2P5GA 1UWBA 4KI4A 1JL1A 4FM2A 5I3UA 1LV5A 4W5NA 1S1WA 2DFEA 4E89A 4CJRA 3OYHA 4AILC 4FZYA 4B3OA 1RDDA 3ITHA 4BWJA 3ZSVA 5HRPA 1I3AA 2GV9A 1HMVA 1SUQA 4KV8A 4OKKA 4CEZA 4I2QA 1JLAA 1LWEA 3VN5A 4DTNA 4M3TA 3PX6A 3M8RA 2LSNA 3IS9A 2EHGA 3NF8A 1U04A 3NF6A 3ZSWA 1NK9A 4FVMA 3RR7A 3DLKA 3ZSRA 2OA8A 4HHTA 3QNOA 1IKVA 4CJ5A 2G8FA 3OYAA 1JLCA 4N47A 3HPOA 4LY7A 1C6VA 1VSHA 3C95A 4YNQA 3OYFA 1JLEA 2HMIA 4DWIA 4HUFA 2YV0X 5CY4A 3EY1A 2D0CA 2HNZA 3ZT0A 4FYDA 3AVNA 3K5MA 1X9SA 4M3XA 3O4QA 1ZBHA 3ZT1A 1KFDA 3AVKA 4IG0A 3AVFA 1X9MA 2BGGA 1BGXT 2R7YA 1HYZA 1RBTA 4O5BA 4O44A 4PA1A 4QAGA 1JKHA 1U45A 4K8XA 3DOKA 5HLFA 1XWLA 3P1GA 1ZBIA 2D5RA 3O4NA 5J2NA 4J2AA 4DTJA 4GW6A 5FRMA 1BI4B 4CFCA 1SV5A 2P5OA 1BI4A 3VQQA 4O55A 1L5UA 4CJLA 3A2FA 1WAJA 4OPKA 5JS2A 3SUOA 2PY5A 4EZ9A 2HHQA 3AVLA 3KIOA 2QKBA 1UA1A 4OLBA 2FBXA 4FJXA 1KVCA 3RMAA 3SPZA 1WSFA 1CLQA 2E4LA 4QOZB 4HUGA 1UA0A 1RILA 3I0RA 1C1AA 3KLGA 5J1EA 1J5OA 1VK0A 1DTTA 1WN7A 4CJFA 5FROA 4EP5A 3L2QA 1Z26A 2P1JA 3K59A 3RMCA 1NK5A 1N5YA 2OPQA 4Q5VA 3SCXA 3V4IA 3DI6A 3B6OA 4CEQA 4KHSA 1DTQA 3AA5X 4ZTFA 4DF8A 1VSMA 4F4KA 4DQIA 4CERA 4IDKA 1EETA 3AVCA 2G8IA 1VSIA 3AVGA 4PUOA 1C1CA 3V6DA 1ZBLA 4FJJA 4F3TA 4AHTA 3NE6A 3SUNA 1GOAA 3U3YA 3ASMA 1NK4A 4FJGA 1JLQA 4NYFA 2DFHA 4AHCA 3HP9A 4XIUA 4DF4A 4E0DA 1T8EA 2FBVA 1J9AA 2XY6A 1LW0A 1LWFA 2F96A 4IFVA 3OS2A 3LPTA 3WNFA 4NCGA 1C0TA 3OYDA 3NDKA 1GOCA 3NCIA 3TWHA 4DQSA 2VG5A 3LZIA 3DM2A 4M41A 2DFFA 2GBZA 4DLGA 3C94A 1S9EA 4KO0A 3V9UA 1NOZA 1RDAA 3DLRA 2PZSA 3CQ8A 3I8DA 4C8OA 1HJRA 2IC3A 1XHXA 1BHLA 3VA0A 3LALA 4CF8A 1A5XA 3ZCMA 3QIPA 4LH4A 3QEIA 4BWMA 1VSKA 3AO4A 2FC0A 2X78A 2YNFA 1IKYA 1ASUA 1W0HA 4IBNA 1NK0A 4KPYA 4KTZA 1SL1A 4KHYA 4FM1A 1EKEA 2QXFA 3NGZA 2VG7A 3EYZA 1RBVA 4BE2A 4H8KA 5I42A 3K2PA 4C8LA 2P51A 4ZHRA 4E7JA 4Q0BA 3LPUA 3TAMA 1RBUA 2HVIA 1S1VA 4OJRA 4CGFA 1Q9XA 1TAUA 1XI1A 4JRPA 3SYZA 4DQPA 3JYTA 3DYAA 1IH7A 2GUIA 2Q3SA 4BDZA 3SQ0A 3O3HA 4DQQA 4Z4FA 2VG6A 3ALYA 4DTUA 5SZTA 1CZBA 4NCAA 1RBRA 3HM9A 3AVBA 3LP0A 3KJVA 3L8BA 1JL2A 1UOCA 4YFUA 2OPRA 3AO3A 3OS1A 2W42A 4CGDA 2ZE2A 4FM0A 5J2PA 3AA3A 4CF0A 3DLBA 1B9FA 3S9HA 4CJEA 5D3GA 4DG1A 4BE0A 2KZZA 2BDPA 1N6QA 4MFBA 2VWKA 3NGIA 2G8HA 1QHTA 4E3SA 3ZSYA 3HK2A 4RG8A 4FZXC 3RRHA 4AHVA 3HT3A 4CCHA 3O3FA 3NHGA 2D0BA 4KTQA 3RWUA 1GOBA 3OYNA 3OJSA 2ETJA 3CG7A 4CGGA 2BANA 4O4GA 1WNSA 3DMJA 3VQDA 4KAZA 4UQGA 1FK9A 5HRNA 3VQCA 1FKOA 3ZSOA 1TKXA 1TV6A 3MEDA 2PYJA 2RN2A 2XHBA 1TK0A 3P83D 4KREA 1TVRA 1HYSA 4HCCA 2YNIA 1X1PA 2X74A 4CE9A 4JS4A 4CFDA 3VQ5A 1L3TA 3TAEA 1L3UA 3S3MA 2JLEA 2E6LA 4DTRA 4KTWA 5CYQA 4CGIA 4ELVA 3V9SA 1XHZA 4M3YA 2FBYA 3CYMA 2OYQA 5C24A 1RT3A 4DS5A 3M8QA 3CM5A 1T03A 3HL8A 4DSJA 3QIOA 2AJQA 2ATQA 4DQRA 3FFIA 3TABA 3AVIA 4DMNA 5FDLA 4FJ9A 1S6PA 3L2RA 1TK8A 3KD1E 1LWCA 4FLWA 5KGWA 4B08A 1JLBA 1HRHA 1L3VA 5C42A 2PYLA 2XY7A 4F3OA 1WSJA 1KTQA 3OJUA 4DTPA 4Z4IA 3TR8A 1U47A 4RW6A 4J2BA 5FRNA 4M45A 1S6QA 3IG1A 4CHQA 3WNGA 2A1SA 4M42A 4CK3A 1BCOA 4KHUA 1BIZA 5KTQA 1RBSA 4CEFA 4CEOA 1ZYQA 4CGHA 2Z1IA 2ZQBA 4BE1A 4N41A 4Z4CA 1KVBA 3V1QA 4BDYA 5DMRA 4OKJA 3OYCA 4QCLA 1SKWA 3O3GA 2DY4A 4DSEA 2ITGA 1REVA 2HHSA 2NUBA 4LSLA 4Z4GA 1KVAA 4ELUA 4FK2A 2X6NA 3QO9A 3VA3A 4DFJA 1TKDA 2IGIA 1BIUA 1WSHA 3MECA 3NFAA 4HCBA 3PUFA 2DTUA 4NYNA 1LAVA 4KHQA 4ID1A 3IRXA 4CGJA 1NK8A 3HVTA 3OYMA 3MEEA 1SL2A 3OYGA 1CXUA 1NKEA 4E1NA 3NBPA 1RT4A 4ZTJA 2HHWA 1JLFA 4IKFA 4DU1A 3BGRA 4B9VA 4CIGA 1WSGA 1ITGA 2RF2A 3NH2A 3OYJA 1U4BA 1BQMA 2JGUA 4FJIA 4B9SA 3DRRA 1VSLA 3UIQA 5CZ1A 4C8KA 3LP3A 2IAJA 2IOCA 2KFNA 3VQAA 1B9DA 1HNIA 3L2UA 3MEGA 3V1RA 4Z4HA 1YTUA 1T05A 5KGXA 2YHAA 4FK0A 3ZT2A 2WOMA 3DOLA 4FLZA 1XC9A 1RNHA 3AVHA 3M8PA 3SUPA 1S1TA 4KHWA 1KCFA 4FCYA 3AO1A 3LWLA 3NF9A 2FBTA 4KB1A 4Y1CA 4AHSA 4E7HA 1WSIA 4JRQA 4FK4A 4B8AB 4DFMA 3AO5A 4CESA 4CHYA 5SWMA 3QEWA 3LAMA 4I9LA 3DRSA 4DTOA 2HHXA 1S1UA 1LAWA 4DU3A 4N5SA 2YKMA 3DLGA 4FW1A 2YNHA 4FJ8A 1VRUA 4FZZA 3LAKA 4I9QA 1ZBFA 3VQ9A 1JLGA 1I39A 3VQ6A 4HVJA 1J53A 1NJXA 3AVAA 4RW8A 1TAQA 5K14A 4CF2A 3K5LA 2ZD1A 3L3VA 2I5JA 1EX4A 4FJKA 1SKRA 4FXDA 4H4OA 1JXBA 1KFSA 3SQ1A 3VQBA 3RTVA 4KI6A 3VQ4A 1TKTA 3KLFA 3WNHA 4CJ4A 3G10A 3ZT3A 2VWJA 3VQ7A 4FLYA 3SNNA 4CFBA 4CK2A 4W5TA 4F8RA 5HROA 4DU4A 4LH5A 4B9TA 4C8MA 3PX4A 3HVRA 2HW3A 4GVMA 3V9ZA 1X9WA 3LP2A 3AVJA 2RKIA 3SZ2A 1YTAA 1S9GA 1QQCA 5T7BA 4HUEA 4CJKA 4ELTA 4L8RB 4N76A 3ZSZA 3S3OA 1VSFA 1QE1A 1WAFA 4RW9A 4DFPA 5E41A 1S1XA 4C8NA 4CJWA 2IDOA 3HJFA 3QESA 3TANA 1IKXA 3RMBA 5HBMA 1RTHA 3S3NA 1A5WA 3AA2A 2A1RA 4M3ZA 2BE2A 4R5PA 1WSEA 2IS3A 4O0JA 4CJVA 3KTQA 2E6MA 3T1AA 3TI0A 3ZSQA 4PQUA 3LDSA 1C0MA 2D0AA 1BQNA 1RTJA 3E01A 1D9DA 1W9HA 3MXIA 2KZMA 3AV9A 4AHUA 4AHRA 1EP4A 2HB5A 3CFRA 3T3FA 1RT7A 1TL1A 3CFOA 1B92A 3OVNA 4E7LA 4CHPA 1HPZA 2X6SA 1NJYA 4K8ZA 1ASVA 1CXQA 3KK1A 4CJQA 1D8YA 3P5JA 2G8WA 3LP1A 5CZ2A 2G8UA 3TAQA 3QEVA 1ASWA 3AO2A 5JS1A 4CHNA 4B8CA 4KKOA 1HQUA 4CIEA 3SQ4A 3RRGA 1RT2A 1O1WA 3ULDA 1J54A 3BDPA 3EZ5A 1T7PA 1K6YA 1C0UA 3HO1A 4MQ3A 4CJ3A 3PY8A 2QK9A 2F8SA 3SUQA 2KFZA 3NAEA 4Y1DA 2OPSA 4BACA 1QS4A 3VQPA 1MU2A 4E7IA 4CIFA 3L2WA 3QETA 3D45A 1HYVA 3F9KA 1SL0A 4F2RA 1YT3A 4CEDA 2G8KA 3H08A 1IKWA 2XY5A 3PO5A 2B6AA 3IAYA 4GMJB 1WLJA 3DLEA 2B4JA 3PX0A 3HXMA 3RR8A 4CF9A 1TGOA 4OKEA 5HRSA 4J2EA 3HYFA 3PV8A 1NKBA 4CEBA 1RT6A 4CJPA 1TL3A 3K5OA 4KHNA 4FJMA 1DLOA 3SV3A 4FJLA 1HQEA 2Z1JA 4G1QA 1RT5A 3D0PA 4B9NA 2YNGA 4FLVA 4I7FA 1D5AA 3SJJA 1QSLA 4F2SA 2F8TA 4DS4A 1HNVA 3ZSXA 4CEAA 3OYKA 1NK7A 3AVMA 1NJWA 3V9WA 2XO7A 4OPJA 2HNYA 1TK5A 4OVLA 3K58A 1D9FA 2RPIA 3HPGA 2HNDA 4FLXA 4AH9A 3SPYA 2HHUA 3CFPA 1KLMA 3G0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OPP A;  4CF1 A;  2QKK A;  3AA4 A;  3OY9 A;  1ZBU A;  1QTM A;  3QIN A;  4W5Q A;  3OYE A;  3K5N A;  1BIS A;  4Z0U A;  4OLA A;  3L3U A;  2HHT A;  4O0I A;  3OS0 A;  4M3R A;  4H4M A;  4I2P A;  1JXE A;  1S5J A;  4FLU A;  4RW7 A;  4EZ6 A;  1VSD A;  3MAQ A;  1Y97 A;  1U49 A;  4LD0 A;  3TAP A;  1NOY A;  3SV4 A;  1L3S A;  3LWM A;  3QEX A;  1F21 A;  3C6U A;  4OGE A;  4WE1 A;  4BDP A;  2KW4 A;  3LAN A;  4CHO A;  5KRS A;  3QEP A;  5DK5 A;  2HVH A;  4M3W A;  2G8V A;  3VQE A;  1IG9 A;  1Z25 A;  3U3G A;  4CFA A;  3OYL A;  3HST B;  1R0A A;  1UAX A;  2XRI A;  3HPH A;  3T19 A;  4FW2 A;  3JSM A;  4M3U A;  3CM6 A;  1BL3 A;  4IG3 A;  5KRT A;  3HP6 A;  4CEC A;  1VSJ A;  4CJS A;  4B9M A;  4FJH A;  4PWD A;  3KK3 A;  4PY5 A;  3KD5 E;  4OGC A;  4W5R A;  3V9X A;  4B9L A;  4ID5 A;  3M8S A;  1BCM A;  2WON A;  4IFY A;  5KI6 A;  3LZJ A;  3TAG A;  3DLH A;  4FJN A;  1U48 A;  4DSF A;  1RCH A;  3TAF A;  5CYM A;  3PO4 A;  3QLH A;  1C1B A;  3QNN A;  3I0S A;  2KQ2 A;  5EU7 A;  1NJZ A;  4JLH A;  4E19 A;  1FKP A;  2Z1G A;  4TSX A;  1YVU A;  4DLE A;  1RTD A;  5HP1 A;  3NF7 A;  4DSK A;  2KTQ A;  1QSY A;  3TAR A;  2O4I A;  3MXJ A;  2Y1I A;  4LSN A;  3ISN C;  3SQ2 A;  4CJU A;  2Z1H A;  1NKC A;  3VQ8 A;  3V1O A;  2OZS A;  1TKZ A;  3F73 A;  3U6F A;  2XY8 A;  3OYI A;  4KB0 A;  2YKN A;  1VRT A;  4DTS A;  4RW4 A;  3KLE A;  3KLH A;  3B6P A;  4CK1 A;  3KLI A;  1RTI A;  1Q8I A;  2Y1J A;  3QER A;  3SI6 A;  3MXM A;  1QSS A;  1EXQ A;  3NH0 A;  4E7K A;  4KFB A;  3THV A;  1FXX A;  4CHZ A;  3KKS A;  3NH1 A;  4FLT A;  4FJ7 A;  3OYB A;  4FJ5 A;  1IO2 A;  1CZ9 A;  3L2V A;  1KLN A;  1KRP A;  4DSL A;  4N56 A;  1LW2 A;  4JS5 A;  4NCB A;  3ZT4 A;  1Q9Y A;  4DSI A;  4KRF A;  1SKS A;  3C6T A;  3KKR A;  2B5J A;  3RMD A;  3V81 A;  4J2D A;  2EX3 A;  4Z4E A;  3WNE A;  5J2Q A;  4EP4 A;  1A5V A;  1RDC A;  3K57 A;  1NK6 A;  4CEE A;  1VSE A;  4B9U A;  4DFK A;  5HRR A;  4CJT A;  4DTX A;  5C25 A;  3KK2 A;  4E1M A;  4ICL A;  3NGY A;  1RDB A;  4W5O A;  2OZM A;  2O4G A;  4HTU A;  2YHB A;  4DTM A;  2HHV A;  1G15 A;  5J2M A;  1KSP A;  1RT1 A;  3DRP A;  2P5G A;  1UWB A;  4KI4 A;  1JL1 A;  4FM2 A;  5I3U A;  1LV5 A;  4W5N A;  1S1W A;  2DFE A;  4E89 A;  4CJR A;  3OYH A;  4AIL C;  4FZY A;  4B3O A;  1RDD A;  3ITH A;  4BWJ A;  3ZSV A;  5HRP A;  1I3A A;  2GV9 A;  1HMV A;  1SUQ A;  4KV8 A;  4OKK A;  4CEZ A;  4I2Q A;  1JLA A;  1LWE A;  3VN5 A;  4DTN A;  4M3T A;  3PX6 A;  3M8R A;  2LSN A;  3IS9 A;  2EHG A;  3NF8 A;  1U04 A;  3NF6 A;  3ZSW A;  1NK9 A;  4FVM A;  3RR7 A;  3DLK A;  3ZSR A;  2OA8 A;  4HHT A;  3QNO A;  1IKV A;  4CJ5 A;  2G8F A;  3OYA A;  1JLC A;  4N47 A;  3HPO A;  4LY7 A;  1C6V A;  1VSH A;  3C95 A;  4YNQ A;  3OYF A;  1JLE A;  2HMI A;  4DWI A;  4HUF A;  2YV0 X;  5CY4 A;  3EY1 A;  2D0C A;  2HNZ A;  3ZT0 A;  4FYD A;  3AVN A;  3K5M A;  1X9S A;  4M3X A;  3O4Q A;  1ZBH A;  3ZT1 A;  1KFD A;  3AVK A;  4IG0 A;  3AVF A;  1X9M A;  2BGG A;  1BGX T;  2R7Y A;  1HYZ A;  1RBT A;  4O5B A;  4O44 A;  4PA1 A;  4QAG A;  1JKH A;  1U45 A;  4K8X A;  3DOK A;  5HLF A;  1XWL A;  3P1G A;  1ZBI A;  2D5R A;  3O4N A;  5J2N A;  4J2A A;  4DTJ A;  4GW6 A;  5FRM A;  1BI4 B;  4CFC A;  1SV5 A;  2P5O A;  1BI4 A;  3VQQ A;  4O55 A;  1L5U A;  4CJL A;  3A2F A;  1WAJ A;  4OPK A;  5JS2 A;  3SUO A;  2PY5 A;  4EZ9 A;  2HHQ A;  3AVL A;  3KIO A;  2QKB A;  1UA1 A;  4OLB A;  2FBX A;  4FJX A;  1KVC A;  3RMA A;  3SPZ A;  1WSF A;  1CLQ A;  2E4L A;  4QOZ B;  4HUG A;  1UA0 A;  1RIL A;  3I0R A;  1C1A A;  3KLG A;  5J1E A;  1J5O A;  1VK0 A;  1DTT A;  1WN7 A;  4CJF A;  5FRO A;  4EP5 A;  3L2Q A;  1Z26 A;  2P1J A;  3K59 A;  3RMC A;  1NK5 A;  1N5Y A;  2OPQ A;  4Q5V A;  3SCX A;  3V4I A;  3DI6 A;  3B6O A;  4CEQ A;  4KHS A;  1DTQ A;  3AA5 X;  4ZTF A;  4DF8 A;  1VSM A;  4F4K A;  4DQI A;  4CER A;  4IDK A;  1EET A;  3AVC A;  2G8I A;  1VSI A;  3AVG A;  4PUO A;  1C1C A;  3V6D A;  1ZBL A;  4FJJ A;  4F3T A;  4AHT A;  3NE6 A;  3SUN A;  1GOA A;  3U3Y A;  3ASM A;  1NK4 A;  4FJG A;  1JLQ A;  4NYF A;  2DFH A;  4AHC A;  3HP9 A;  4XIU A;  4DF4 A;  4E0D A;  1T8E A;  2FBV A;  1J9A A;  2XY6 A;  1LW0 A;  1LWF A;  2F96 A;  4IFV A;  3OS2 A;  3LPT A;  3WNF A;  4NCG A;  1C0T A;  3OYD A;  3NDK A;  1GOC A;  3NCI A;  3TWH A;  4DQS A;  2VG5 A;  3LZI A;  3DM2 A;  4M41 A;  2DFF A;  2GBZ A;  4DLG A;  3C94 A;  1S9E A;  4KO0 A;  3V9U A;  1NOZ A;  1RDA A;  3DLR A;  2PZS A;  3CQ8 A;  3I8D A;  4C8O A;  1HJR A;  2IC3 A;  1XHX A;  1BHL A;  3VA0 A;  3LAL A;  4CF8 A;  1A5X A;  3ZCM A;  3QIP A;  4LH4 A;  3QEI A;  4BWM A;  1VSK A;  3AO4 A;  2FC0 A;  2X78 A;  2YNF A;  1IKY A;  1ASU A;  1W0H A;  4IBN A;  1NK0 A;  4KPY A;  4KTZ A;  1SL1 A;  4KHY A;  4FM1 A;  1EKE A;  2QXF A;  3NGZ A;  2VG7 A;  3EYZ A;  1RBV A;  4BE2 A;  4H8K A;  5I42 A;  3K2P A;  4C8L A;  2P51 A;  4ZHR A;  4E7J A;  4Q0B A;  3LPU A;  3TAM A;  1RBU A;  2HVI A;  1S1V A;  4OJR A;  4CGF A;  1Q9X A;  1TAU A;  1XI1 A;  4JRP A;  3SYZ A;  4DQP A;  3JYT A;  3DYA A;  1IH7 A;  2GUI A;  2Q3S A;  4BDZ A;  3SQ0 A;  3O3H A;  4DQQ A;  4Z4F A;  2VG6 A;  3ALY A;  4DTU A;  5SZT A;  1CZB A;  4NCA A;  1RBR A;  3HM9 A;  3AVB A;  3LP0 A;  3KJV A;  3L8B A;  1JL2 A;  1UOC A;  4YFU A;  2OPR A;  3AO3 A;  3OS1 A;  2W42 A;  4CGD A;  2ZE2 A;  4FM0 A;  5J2P A;  3AA3 A;  4CF0 A;  3DLB A;  1B9F A;  3S9H A;  4CJE A;  5D3G A;  4DG1 A;  4BE0 A;  2KZZ A;  2BDP A;  1N6Q A;  4MFB A;  2VWK A;  3NGI A;  2G8H A;  1QHT A;  4E3S A;  3ZSY A;  3HK2 A;  4RG8 A;  4FZX C;  3RRH A;  4AHV A;  3HT3 A;  4CCH A;  3O3F A;  3NHG A;  2D0B A;  4KTQ A;  3RWU A;  1GOB A;  3OYN A;  3OJS A;  2ETJ A;  3CG7 A;  4CGG A;  2BAN A;  4O4G A;  1WNS A;  3DMJ A;  3VQD A;  4KAZ A;  4UQG A;  1FK9 A;  5HRN A;  3VQC A;  1FKO A;  3ZSO A;  1TKX A;  1TV6 A;  3MED A;  2PYJ A;  2RN2 A;  2XHB A;  1TK0 A;  3P83 D;  4KRE A;  1TVR A;  1HYS A;  4HCC A;  2YNI A;  1X1P A;  2X74 A;  4CE9 A;  4JS4 A;  4CFD A;  3VQ5 A;  1L3T A;  3TAE A;  1L3U A;  3S3M A;  2JLE A;  2E6L A;  4DTR A;  4KTW A;  5CYQ A;  4CGI A;  4ELV A;  3V9S A;  1XHZ A;  4M3Y A;  2FBY A;  3CYM A;  2OYQ A;  5C24 A;  1RT3 A;  4DS5 A;  3M8Q A;  3CM5 A;  1T03 A;  3HL8 A;  4DSJ A;  3QIO A;  2AJQ A;  2ATQ A;  4DQR A;  3FFI A;  3TAB A;  3AVI A;  4DMN A;  5FDL A;  4FJ9 A;  1S6P A;  3L2R A;  1TK8 A;  3KD1 E;  1LWC A;  4FLW A;  5KGW A;  4B08 A;  1JLB A;  1HRH A;  1L3V A;  5C42 A;  2PYL A;  2XY7 A;  4F3O A;  1WSJ A;  1KTQ A;  3OJU A;  4DTP A;  4Z4I A;  3TR8 A;  1U47 A;  4RW6 A;  4J2B A;  5FRN A;  4M45 A;  1S6Q A;  3IG1 A;  4CHQ A;  3WNG A;  2A1S A;  4M42 A;  4CK3 A;  1BCO A;  4KHU A;  1BIZ A;  5KTQ A;  1RBS A;  4CEF A;  4CEO A;  1ZYQ A;  4CGH A;  2Z1I A;  2ZQB A;  4BE1 A;  4N41 A;  4Z4C A;  1KVB A;  3V1Q A;  4BDY A;  5DMR A;  4OKJ A;  3OYC A;  4QCL A;  1SKW A;  3O3G A;  2DY4 A;  4DSE A;  2ITG A;  1REV A;  2HHS A;  2NUB A;  4LSL A;  4Z4G A;  1KVA A;  4ELU A;  4FK2 A;  2X6N A;  3QO9 A;  3VA3 A;  4DFJ A;  1TKD A;  2IGI A;  1BIU A;  1WSH A;  3MEC A;  3NFA A;  4HCB A;  3PUF A;  2DTU A;  4NYN A;  1LAV A;  4KHQ A;  4ID1 A;  3IRX A;  4CGJ A;  1NK8 A;  3HVT A;  3OYM A;  3MEE A;  1SL2 A;  3OYG A;  1CXU A;  1NKE A;  4E1N A;  3NBP A;  1RT4 A;  4ZTJ A;  2HHW A;  1JLF A;  4IKF A;  4DU1 A;  3BGR A;  4B9V A;  4CIG A;  1WSG A;  1ITG A;  2RF2 A;  3NH2 A;  3OYJ A;  1U4B A;  1BQM A;  2JGU A;  4FJI A;  4B9S A;  3DRR A;  1VSL A;  3UIQ A;  5CZ1 A;  4C8K A;  3LP3 A;  2IAJ A;  2IOC A;  2KFN A;  3VQA A;  1B9D A;  1HNI A;  3L2U A;  3MEG A;  3V1R A;  4Z4H A;  1YTU A;  1T05 A;  5KGX A;  2YHA A;  4FK0 A;  3ZT2 A;  2WOM A;  3DOL A;  4FLZ A;  1XC9 A;  1RNH A;  3AVH A;  3M8P A;  3SUP A;  1S1T A;  4KHW A;  1KCF A;  4FCY A;  3AO1 A;  3LWL A;  3NF9 A;  2FBT A;  4KB1 A;  4Y1C A;  4AHS A;  4E7H A;  1WSI A;  4JRQ A;  4FK4 A;  4B8A B;  4DFM A;  3AO5 A;  4CES A;  4CHY A;  5SWM A;  3QEW A;  3LAM A;  4I9L A;  3DRS A;  4DTO A;  2HHX A;  1S1U A;  1LAW A;  4DU3 A;  4N5S A;  2YKM A;  3DLG A;  4FW1 A;  2YNH A;  4FJ8 A;  1VRU A;  4FZZ A;  3LAK A;  4I9Q A;  1ZBF A;  3VQ9 A;  1JLG A;  1I39 A;  3VQ6 A;  4HVJ A;  1J53 A;  1NJX A;  3AVA A;  4RW8 A;  1TAQ A;  5K14 A;  4CF2 A;  3K5L A;  2ZD1 A;  3L3V A;  2I5J A;  1EX4 A;  4FJK A;  1SKR A;  4FXD A;  4H4O A;  1JXB A;  1KFS A;  3SQ1 A;  3VQB A;  3RTV A;  4KI6 A;  3VQ4 A;  1TKT A;  3KLF A;  3WNH A;  4CJ4 A;  3G10 A;  3ZT3 A;  2VWJ A;  3VQ7 A;  4FLY A;  3SNN A;  4CFB A;  4CK2 A;  4W5T A;  4F8R A;  5HRO A;  4DU4 A;  4LH5 A;  4B9T A;  4C8M A;  3PX4 A;  3HVR A;  2HW3 A;  4GVM A;  3V9Z A;  1X9W A;  3LP2 A;  3AVJ A;  2RKI A;  3SZ2 A;  1YTA A;  1S9G A;  1QQC A;  5T7B A;  4HUE A;  4CJK A;  4ELT A;  4L8R B;  4N76 A;  3ZSZ A;  3S3O A;  1VSF A;  1QE1 A;  1WAF A;  4RW9 A;  4DFP A;  5E41 A;  1S1X A;  4C8N A;  4CJW A;  2IDO A;  3HJF A;  3QES A;  3TAN A;  1IKX A;  3RMB A;  5HBM A;  1RTH A;  3S3N A;  1A5W A;  3AA2 A;  2A1R A;  4M3Z A;  2BE2 A;  4R5P A;  1WSE A;  2IS3 A;  4O0J A;  4CJV A;  3KTQ A;  2E6M A;  3T1A A;  3TI0 A;  3ZSQ A;  4PQU A;  3LDS A;  1C0M A;  2D0A A;  1BQN A;  1RTJ A;  3E01 A;  1D9D A;  1W9H A;  3MXI A;  2KZM A;  3AV9 A;  4AHU A;  4AHR A;  1EP4 A;  2HB5 A;  3CFR A;  3T3F A;  1RT7 A;  1TL1 A;  3CFO A;  1B92 A;  3OVN A;  4E7L A;  4CHP A;  1HPZ A;  2X6S A;  1NJY A;  4K8Z A;  1ASV A;  1CXQ A;  3KK1 A;  4CJQ A;  1D8Y A;  3P5J A;  2G8W A;  3LP1 A;  5CZ2 A;  2G8U A;  3TAQ A;  3QEV A;  1ASW A;  3AO2 A;  5JS1 A;  4CHN A;  4B8C A;  4KKO A;  1HQU A;  4CIE A;  3SQ4 A;  3RRG A;  1RT2 A;  1O1W A;  3ULD A;  1J54 A;  3BDP A;  3EZ5 A;  1T7P A;  1K6Y A;  1C0U A;  3HO1 A;  4MQ3 A;  4CJ3 A;  3PY8 A;  2QK9 A;  2F8S A;  3SUQ A;  2KFZ A;  3NAE A;  4Y1D A;  2OPS A;  4BAC A;  1QS4 A;  3VQP A;  1MU2 A;  4E7I A;  4CIF A;  3L2W A;  3QET A;  3D45 A;  1HYV A;  3F9K A;  1SL0 A;  4F2R A;  1YT3 A;  4CED A;  2G8K A;  3H08 A;  1IKW A;  2XY5 A;  3PO5 A;  2B6A A;  3IAY A;  4GMJ B;  1WLJ A;  3DLE A;  2B4J A;  3PX0 A;  3HXM A;  3RR8 A;  4CF9 A;  1TGO A;  4OKE A;  5HRS A;  4J2E A;  3HYF A;  3PV8 A;  1NKB A;  4CEB A;  1RT6 A;  4CJP A;  1TL3 A;  3K5O A;  4KHN A;  4FJM A;  1DLO A;  3SV3 A;  4FJL A;  1HQE A;  2Z1J A;  4G1Q A;  1RT5 A;  3D0P A;  4B9N A;  2YNG A;  4FLV A;  4I7F A;  1D5A A;  3SJJ A;  1QSL A;  4F2S A;  2F8T A;  4DS4 A;  1HNV A;  3ZSX A;  4CEA A;  3OYK A;  1NK7 A;  3AVM A;  1NJW A;  3V9W A;  2XO7 A;  4OPJ A;  2HNY A;  1TK5 A;  4OVL A;  3K58 A;  1D9F A;  2RPI A;  3HPG A;  2HND A;  4FLX A;  4AH9 A;  3SPY A;  2HHU A;  3CFP A;  1KLM A;  3G0Z A; 
#chains in the Genus database with same CATH topology
 2QKK A;  3AA4 A;  3UKU B;  1ZBU A;  1QTM A;  4YOW A;  4O0I A;  3AAR A;  1KAZ A;  4LD0 A;  1T44 A;  1W2B M;  3TAP A;  1L3S A;  4CHO A;  5DK5 A;  2G8V A;  2QWQ A;  1HUX A;  5AQX A;  3VPZ A;  1IG9 A;  3U3G A;  1KD1 O;  2A41 A;  3ZET A;  1BL3 A;  5KRT A;  1NWK A;  4FPA A;  4FJH A;  1T6D A;  3KD5 E;  4OGC A;  4W5R A;  4X66 K;  2A3Z A;  1G99 A;  1BCM A;  2WON A;  5KI6 A;  1E4G T;  1RCH A;  1XC3 A;  3B8A X;  3TAF A;  5CYM A;  3PO4 A;  3QNN A;  1OH8 A;  2KQ2 A;  4JLH A;  4E19 A;  1FKP A;  2Z1G A;  4TSX A;  1YVU A;  3NF7 A;  4JI6 K;  1QSY A;  3TAR A;  2O4I A;  4BY9 C;  3SQ2 A;  3ISN C;  1RGI A;  4CJU A;  1NKC A;  2OZS A;  3I33 A;  4I6M B;  3J80 O;  1VQ9 N;  3KLI A;  1RTI A;  3MXM A;  3QER A;  3NH0 A;  4KFB A;  1HJO A;  3KZB A;  4CHZ A;  4BRG A;  4FJ5 A;  1KRP A;  4N56 A;  5FPM A;  1Q9Y A;  1Q86 O;  4J2D A;  2B5J A;  3I8B A;  1U6Z A;  3PLA A;  1SQK A;  4B9U A;  3ZET B;  2NLX A;  4GY2 B;  5A2Q O;  5AQM A;  4W5O A;  2OZM A;  2P9U A;  5AQL A;  4HTU A;  2VCP A;  4JKG B;  4KI4 A;  3CF5 L;  1LV5 A;  3SMS A;  3MN6 A;  2DFE A;  1TYQ A;  2GV9 A;  4OKK A;  3TSP A;  3LDL A;  2LSN A;  3IS9 A;  1YI2 N;  4FVM A;  2OA8 A;  5E26 A;  4HHT A;  3QNO A;  1IKV A;  4CJ5 A;  2G8F A;  4JI3 K;  1JLC A;  3HPO A;  3C95 A;  3HRG A;  3ID8 A;  4DWI A;  1K8K B;  1HR0 K;  2YV0 X;  5CY4 A;  2HNZ A;  3ZT0 A;  4FYD A;  1OH5 A;  1X9S A;  4M3X A;  4H5T A;  4JHD A;  4IG0 A;  3AVF A;  3TSQ A;  5JLH A;  2BH1 A;  2JWL A;  2RHK A;  4CZJ A;  1JKH A;  3DOK A;  2YHY A;  2D5R A;  3O4N A;  5J2N A;  4LF8 K;  4GW6 A;  4CFC A;  1BI4 A;  5AQJ A;  1L5U A;  5BN9 A;  4H0V B;  2HOE A;  4EZ9 A;  3AVL A;  2HF4 A;  3KIO A;  2QKB A;  3QML A;  1UA1 A;  4JI2 K;  3RMA A;  1CLQ A;  2E4L A;  1NGF A;  5BPN A;  3KLG A;  5J1E A;  1JCF A;  1DTT A;  2P1J A;  2O8B A;  4Q5V A;  5LMU K;  3SCX A;  3V4I A;  3DI6 A;  3B6O A;  4CEQ A;  2NRW A;  3AA5 X;  4CD1 A;  1EET A;  3AVC A;  3UB5 A;  1W7A A;  4B9Q A;  4PUO A;  3V6D A;  3CCR N;  3CET A;  3ASM A;  4FJG A;  1JLQ A;  4NYF A;  2DFH A;  4ISG A;  4DF4 A;  1HPM A;  1LW0 A;  4BR9 A;  3WNF A;  4NCG A;  4LF7 K;  3OYD A;  5GIP A;  2VG5 A;  3LZI A;  3DM2 A;  5AFU A;  3HOS A;  3FZL A;  3WEE B;  4JI5 K;  2GBZ A;  2UUC K;  4WFA L;  1NOZ A;  4FWL A;  3CQ8 A;  1HKB A;  5AQU A;  4NB4 A;  4JD2 A;  3CC2 N;  1A5X A;  4LH4 A;  3QEI A;  1VSK A;  2H3G X;  2X78 A;  1KAY A;  4IBN A;  3VEO A;  4KTZ A;  4DV4 K;  1SL1 A;  4FM1 A;  4H8K A;  3R3L A;  2QW9 A;  1RBU A;  4OJR A;  4JRP A;  3DYA A;  3SQ0 A;  3OW2 M;  4Z4F A;  3MN9 A;  3CI5 A;  4KH4 A;  4DV2 K;  1RBR A;  3LP0 A;  1JL2 A;  2P9N A;  1UOC A;  4YFU A;  2W42 A;  3S3O A;  1KSP A;  4CGD A;  3AA3 A;  5BRD A;  3DLB A;  5D3G A;  4DG1 A;  1MWM A;  4FWO A;  1N6Q A;  4BR0 A;  2VWK A;  2G8H A;  3HK2 A;  4RG8 A;  4AHV A;  4KTQ A;  3OJS A;  2BAN A;  3DMJ A;  2NNW A;  3A5M C;  1FK9 A;  4LF4 K;  3VQC A;  3SAH A;  3CCU N;  2GX9 A;  1TK0 A;  5EY4 A;  1NG9 A;  1EWR A;  4WF9 L;  3LL3 A;  4CE9 A;  4JS4 A;  3G6E N;  4EIA A;  5ADX H;  3S3M A;  4DTR A;  5CYQ A;  4CZM A;  2QXL A;  4ELV A;  3V9S A;  2WUS A;  2OYQ A;  1RT3 A;  1T03 A;  3IKM A;  3QIO A;  4B1X B;  4YOV A;  3TTC A;  2AJQ A;  3O9S A;  4H5V A;  2P9L A;  4DQR A;  3AVI A;  4DMN A;  4FJ9 A;  1S6P A;  1KXP A;  5FPE A;  3DLL L;  1JLB A;  1L3V A;  2PYL A;  1WSJ A;  1KTQ A;  3SAG A;  3OJU A;  4Z4I A;  4O8K A;  3TR8 A;  3MK6 A;  4NO7 A;  3IG1 A;  2W6K A;  5KTQ A;  2QI2 A;  5GAG P;  3ZX3 A;  1SZ2 A;  1KVB A;  3V1Q A;  5EX5 A;  5DMR A;  1SKW A;  5GAE P;  3C6H A;  4GV6 A;  2NUB A;  1QQM A;  1NLV A;  1LOT B;  4NLB A;  2IGI A;  1BIU A;  4KHP K;  2E88 A;  3PIP L;  4HCB A;  3PUF A;  2DTU A;  4NYN A;  3HVT A;  1V4S A;  3MEE A;  4A62 A;  4E1N A;  1JLF A;  4DQ8 A;  2IIR A;  4DU1 A;  3WXM B;  4YOY A;  4BRP A;  1WSG A;  2RF2 A;  3OBY A;  4OPH A;  1U4B A;  1ATN A;  3DRR A;  2E2Q A;  2P9I B;  4C8K A;  1K9M O;  2IAJ A;  4WQ4 C;  4JKG A;  3TSU A;  4CW7 B;  3EKS A;  3CCM N;  1VQ5 N;  4LFB K;  5AQS A;  4Z4H A;  4XH1 A;  4M7X A;  4MLE A;  4H0Y B;  4FK0 A;  4BR2 A;  4DR5 K;  1RNH A;  3SUP A;  1S1T A;  4H03 B;  4LF6 K;  5BRF A;  1EWQ A;  4KB1 A;  4Y1C A;  1VAZ A;  1HLU A;  4FK4 A;  4B8A B;  4M63 C;  4CHY A;  3LAM A;  4BC4 A;  1GLJ O;  3GG4 A;  4H0X B;  2YNH A;  1JCE A;  4I9Q A;  1ZBF A;  1NJX A;  3VQ6 A;  1J53 A;  4RW8 A;  5K14 A;  4CF2 A;  2ZD1 A;  3OBW A;  4H4O A;  4XEI A;  3VQB A;  4KI6 A;  4LF9 K;  2ZGZ A;  3WNH A;  3ZT3 A;  4KBO A;  4W5T A;  3CC4 N;  4LH5 A;  4EHU A;  2VQE K;  4JI7 K;  2HW3 A;  3V9Z A;  1VQM N;  2RKI A;  1YTA A;  1QQC A;  4HUE A;  4JKA A;  4CJK A;  4RW9 A;  4PKH A;  1CZA N;  4DFP A;  1S1X A;  4CJW A;  4PL8 A;  3RMB A;  4FVU A;  1A5W A;  2UU9 K;  1WSE A;  3CCS N;  3KTQ A;  2E6M A;  3TI0 A;  4CBX A;  4PQU A;  3E01 A;  1M90 O;  4AHR A;  2HB5 A;  3D2E A;  4E7L A;  2ZM6 K;  4CHP A;  1NJI O;  5JVG L;  4CJQ A;  2G8W A;  3TTD A;  3LP1 A;  4BRM A;  3TAQ A;  3QEV A;  4B8C A;  3SQ4 A;  3P38 A;  3RRG A;  4X65 K;  3BDP A;  1K6Y A;  2QK9 A;  1YUW A;  2P9S A;  3FZK A;  3FFK B;  4O5F A;  4Y1D A;  5BR8 K;  2PBD A;  3VQP A;  1MU2 A;  4E7I A;  3L2W A;  1HYV A;  3PO5 A;  1WLJ A;  3DLE A;  3L4Q A;  5GIN A;  3BF1 A;  3RR8 A;  3EKU A;  5HRS A;  4CJP A;  1RT6 A;  4KHN A;  3K5O A;  1QVG M;  4G1Q A;  2NRT A;  2ITM A;  1YXQ A;  3SJJ A;  4K41 A;  1D5A A;  1QSL A;  4GKK K;  3ZSX A;  4CEA A;  4E1J A;  1D9F A;  2AP1 A;  2RPI A;  3HPG A;  4AH9 A;  3J7Z O;  3O9T A;  2GWJ A;  3C65 A;  3QIN A;  2PFU A;  3OS0 A;  4M3R A;  4H5R A;  2QWP A;  1Y97 A;  4H0T B;  3LWM A;  4PKG A;  4BDP A;  5AQF A;  2KW4 A;  3LAN A;  2CGJ A;  5KRS A;  3QEP A;  4J8F A;  2HVH A;  1BU6 O;  3VQE A;  1Z25 A;  4CFA A;  3HST B;  3IUC A;  3T19 A;  4IG3 A;  3HP6 A;  2AA4 A;  4B9M A;  1RFQ A;  2QM1 A;  4RWT A;  5EOY A;  4JKC A;  3QLH A;  3THY A;  1WOQ A;  4HWI A;  3MXJ A;  3U9D A;  2Y1I A;  4B1Z A;  2Z1H A;  3HZ6 A;  3MWP A;  4NXM K;  2XY8 A;  3OYI A;  2YKN A;  4WQ5 C;  3KLH A;  2YJF A;  4CK1 A;  3SI6 A;  1QSS A;  5AZI A;  4AQY K;  4KH6 A;  4FJ7 A;  3KKS A;  4WQ5 A;  3OYB A;  3JS6 A;  2E8A A;  3DJC A;  1HNZ K;  4DSL A;  4JS5 A;  5AQO A;  4DSI A;  4FWQ A;  5GAD P;  1OVY A;  1RDC A;  2JWK A;  3CJC A;  4H5W A;  1Q81 O;  5HRR A;  1SAZ A;  1VQ6 N;  1BG3 A;  3H3N O;  1C0F A;  5AQZ A;  1HNW K;  3H3O B;  4DR1 K;  2UUB K;  2YHB A;  2HHV A;  1G15 A;  3SMP A;  1W97 L;  3DRP A;  5I3U A;  4E89 A;  4B3O A;  1RDD A;  3ITH A;  4BWJ A;  3ZSV A;  3ATU A;  3RRH A;  4CEZ A;  4I2Q A;  3ZEU B;  1LWE A;  3GL1 A;  3CMA N;  3M8R A;  3ZSW A;  5M1P A;  2FLO A;  1U04 A;  3MDQ A;  1BWF O;  3KVG A;  4DV0 K;  4DV5 K;  3D6R A;  2NRH A;  4JK8 A;  3WQT A;  3ZX2 A;  5M1K A;  1JLE A;  2CH6 A;  2HMI A;  4AM6 A;  5BRE A;  4HUF A;  3UKU A;  2D0C A;  3AVN A;  1ZBH A;  3O4Q A;  2BGG A;  2R7Y A;  1HYZ A;  5EXW A;  1U45 A;  4K8X A;  1XWL A;  3P1G A;  3O6W A;  4JD2 B;  1BI4 B;  3E1Y A;  1T6C A;  4C1N K;  3A2F A;  3SUO A;  5JS2 A;  4OLB A;  2FBX A;  1WSF A;  3CIP A;  3CCQ N;  1RIL A;  3HI0 A;  3I0R A;  1UA0 A;  2VGM A;  3L2Q A;  1WN7 A;  1J5O A;  5FRO A;  4N41 A;  3ZEU A;  1C0G A;  1Z26 A;  2VGN A;  3RMC A;  3PIO L;  2OPQ A;  3CC7 N;  3CER A;  3K0S A;  1VSM A;  4CER A;  5ADX A;  4IDK A;  4BRK A;  3K9K A;  1VSI A;  4XH5 A;  5GAH P;  5DM6 L;  4ISE A;  3NE6 A;  3U3Y A;  2O8D A;  2O8B B;  3VF6 A;  1XNQ K;  4AHC A;  1DT9 A;  4E0D A;  2F96 A;  4IFV A;  1VQN N;  3OS2 A;  5FPN A;  3NCI A;  4M41 A;  3RVC A;  2DFF A;  3LDN A;  2D4W A;  3C94 A;  3GDQ A;  4KO0 A;  4FWK A;  3V9U A;  2PZS A;  2O8C B;  3AY9 A;  4IZ9 A;  3T7Z A;  1WB9 A;  3LAL A;  4CF8 A;  5BPM A;  3O1W A;  2QWR A;  1ASU A;  3DXK A;  4G9Z A;  1EKE A;  3BZC A;  4IXC A;  4IJA A;  3EYZ A;  1RBV A;  4Q0B A;  1VQO N;  1YF5 L;  2HVI A;  3CHW A;  1Q9X A;  1XI1 A;  3THX A;  2GUI A;  3VTI A;  2FXU A;  4DQQ A;  4JNE A;  1BA0 A;  1CZB A;  5AQT A;  4DHY A;  5AFU H;  4BG8 A;  1ATR A;  3ZX0 A;  5F0X A;  5J2P A;  4FM0 A;  4CF0 A;  4IOX A;  3S9H A;  2V51 B;  2O8D B;  4CJE A;  2KZZ A;  3NGI A;  1QHT A;  2GEM A;  4FZX C;  3RWU A;  3OYN A;  4O4G A;  1WNS A;  5HRN A;  3A5O C;  1TV6 A;  2PYJ A;  2RN2 A;  2XHB A;  3P83 D;  3FR0 A;  1TVR A;  4DR7 K;  4HCC A;  1NGE A;  2X74 A;  2QA4 N;  1L3T A;  4DV3 K;  2JLE A;  1NM1 A;  2F9W A;  4CGI A;  2W6L A;  1XHZ A;  1NBW A;  1WBD A;  3M8Q A;  3CM5 A;  1BA1 A;  5AZJ A;  3LDO A;  3VGL A;  5BRH A;  4JKD A;  3C7N B;  4F3O A;  3M6G A;  4DTP A;  4J2B A;  3NVM A;  1QZ5 A;  1BCO A;  4FOE A;  1RBS A;  3C7N A;  4CGH A;  4DR4 K;  2ZQB A;  4BE1 A;  2NRZ A;  4OKJ A;  3OYC A;  4GKJ K;  4JV5 K;  4BRI A;  4K25 A;  1KVA A;  4ELU A;  1KC8 O;  1NGG A;  1DGK N;  3MEC A;  3NFA A;  4BGB A;  1DEJ A;  1LAV A;  3QFP A;  5KPZ A;  3O4W A;  4CGJ A;  4BRQ A;  2OAN A;  2UXC K;  1CXU A;  1NKE A;  4BR4 A;  3NBP A;  4ZTJ A;  3EE8 A;  2HHW A;  4DCH A;  1NGD A;  3THW B;  4QS9 A;  4FO0 A;  3ZLJ A;  3NH2 A;  4BQL A;  3SBT A;  3UKR B;  2D1K A;  1ESV A;  2CH5 A;  3CCJ N;  3UIQ A;  5CZ1 A;  2IOC A;  1B9D A;  1N34 K;  3EN9 A;  4JKH A;  3MEG A;  4GVE A;  4B1U B;  2YJE A;  5IWA K;  1IG8 A;  3ZT2 A;  2O8E A;  2WOM A;  2P9P A;  3TPQ A;  1XC9 A;  4AM7 A;  4KHW A;  5M1Q A;  4BRN A;  4FCY A;  4BRH A;  3LWL A;  3NF9 A;  1QVF M;  3MCA B;  4E7H A;  3BZK A;  4CES A;  4DFM A;  4JI4 K;  4IEE A;  4I9L A;  3DRS A;  4EFH A;  4DTO A;  3T1Y K;  5HL7 L;  4FW1 A;  2QTD A;  4FJ8 A;  3CQY A;  1JLG A;  4HVJ A;  3EE9 A;  3K5L A;  2I5J A;  3VQ4 A;  3NMU A;  4JYA K;  2VWJ A;  3G10 A;  3CPW M;  4FLY A;  3SNN A;  4CFB A;  4CK2 A;  3BF3 A;  4DU4 A;  3VF2 A;  3L4I A;  4YOT A;  3MX5 A;  3HVR A;  3J7Y P;  3LP2 A;  1QHA A;  3AVJ A;  3SZ2 A;  1X9W A;  1S9G A;  2P9U B;  1X3M A;  2ZWH A;  4ELT A;  4L8R B;  4N76 A;  3ZSZ A;  1QE1 A;  4C8N A;  3QES A;  2E2O A;  1RTH A;  3S3N A;  2J4R A;  3AA2 A;  4V19 S;  2BE2 A;  2ZGY A;  4O0J A;  3T1A A;  4LFA K;  3ZSQ A;  1C0M A;  3SJH A;  1BQN A;  1RTJ A;  1T3V A;  1W9H A;  3AV9 A;  4AHU A;  1EP4 A;  2KHO A;  1TL1 A;  3SBG A;  1GLL O;  3OVN A;  5EVZ A;  3CJ9 A;  1NJY A;  1ASV A;  1IBM K;  1CXQ A;  3H6E A;  3KK1 A;  2Q0R A;  5CZ2 A;  3LM9 A;  1ASW A;  3AO2 A;  5AQY A;  3MWT A;  4CHN A;  1O1W A;  3ULD A;  1J54 A;  3KWI A;  1QS4 A;  1SL0 A;  1N8R O;  3QET A;  3F9K A;  4BR5 A;  2G8K A;  2XY5 A;  3OA9 A;  3A5L C;  4IJN A;  1NGA A;  5KQ8 A;  3PX0 A;  5CE3 A;  2WBN A;  3L6Q A;  2P9S B;  4OKE A;  4J2E A;  1NKB A;  5LMN K;  4YHH K;  4CEB A;  1TL3 A;  3VES A;  4FJM A;  4FJL A;  3JXU A;  5JLF A;  2FSK A;  2YNG A;  4I7F A;  3M5R A;  2HST A;  5BN8 A;  5C12 A;  1MA9 B;  5FPD A;  1NK7 A;  3OYK A;  3AVM A;  3BY5 A;  1TK5 A;  3K58 A;  4DB3 A;  4EHT A;  3I55 N;  2HND A;  1GLD G;  4FLX A;  3CFP A;  1KLM A;  3G0Z A;  3CJB A;  1V4T A;  4JK9 A;  3OY9 A;  5M1N A;  4W5Q A;  4Z0U A;  2HF3 A;  3L3U A;  2HHT A;  4WFN L;  4H4M A;  4I2P A;  1GLB G;  3G25 A;  4RW7 A;  4EZ6 A;  3MAQ A;  2V7Y A;  3AGR A;  3VEZ A;  3D2E B;  1F21 A;  1FJG K;  3NVK A;  1VQ8 N;  4M3W A;  3VTH A;  3OYL A;  1UAX A;  2XRI A;  4M3U A;  4MLH A;  4CEC A;  4CJS A;  3DXK B;  4PWD A;  3VMF B;  3KK3 A;  3O8M A;  4PY5 A;  3V9X A;  1Z6R A;  2OTL N;  4B9L A;  3TAG A;  3DLH A;  4FJN A;  3DAW A;  4BRO A;  1U48 A;  4DSF A;  3J7A P;  1C1B A;  4LF5 K;  3I0S A;  5EU7 A;  1Y64 A;  4H0O A;  1NJZ A;  4DLE A;  1RTD A;  3DWL A;  5HP1 A;  4K0K K;  1U2V B;  4YOR A;  4B1W B;  3E9P A;  2A40 A;  3AAP A;  3VQ8 A;  4DKW A;  1TKZ A;  1IBK K;  4KB0 A;  3KLE A;  3B6P A;  3J81 O;  5AZI B;  1EXQ A;  3THV A;  2IVO A;  4FWP A;  2VQF K;  1FXX A;  4R79 A;  3L2V A;  1KLN A;  3I56 N;  5AQI A;  3GBT A;  3C6T A;  3KKR A;  1SKS A;  5J2Q A;  4EP4 A;  1A5V A;  3K57 A;  1VSE A;  4BRF A;  4DTX A;  3Q7B A;  3R9P A;  3KK2 A;  3O9U A;  5ELZ A;  3O08 A;  2IVN A;  4ICL A;  3NGY A;  4UY8 O;  5J2M A;  1RT1 A;  2P5G A;  4W5N A;  1JL1 A;  3MX2 A;  4CZL A;  4FZY A;  1ATS A;  1H1V A;  5HRP A;  1HMV A;  4KV8 A;  3Q7C A;  4DTN A;  4M3T A;  1JLA A;  3VN5 A;  3A8Y A;  3VER A;  3W0L A;  1NK9 A;  4GNI A;  3NF8 A;  3NF6 A;  3RR7 A;  4LFC K;  3DLK A;  4BR7 A;  4OPA A;  3R1X A;  2E20 A;  3OYA A;  3HTV A;  3WEE A;  4YNQ A;  1VSH A;  3OYF A;  3D7E O;  1YJW N;  2YCH A;  3ZT1 A;  3AVK A;  4JAX A;  1X9M A;  1BGX T;  4O5B A;  4O44 A;  5HLF A;  3EEQ A;  1E3M A;  1ZBI A;  4J2A A;  1BOT O;  4H5N A;  2RE2 A;  2P5O A;  3FZH A;  2PY5 A;  2HHQ A;  3UKR A;  4CI6 A;  1S72 N;  1KVC A;  3SPZ A;  5AQQ A;  3SK3 A;  1IV0 A;  5TKW A;  1C1A A;  1BUP A;  3E66 A;  2A42 A;  3ENB A;  2P9K B;  1VK0 A;  4CJF A;  1NOY A;  2HMP A;  3ULE A;  5CR4 A;  1NK5 A;  3K59 A;  1Q7Y O;  1N5Y A;  5DM7 L;  4KHS A;  4ZTF A;  3QBX A;  4WQ4 A;  4F4K A;  1X3N A;  4K42 A;  4DQI A;  3MMV A;  1ZBL A;  4AHT A;  1XUP O;  3SUN A;  1GOA A;  2QWL A;  2FBV A;  4A59 A;  1T8E A;  1J9A A;  4FPB A;  4CVN E;  3NDK A;  3TWH A;  3EZW A;  5AQW A;  2ASM A;  3H46 O;  2HHH K;  1RDA A;  3DLR A;  3DXM B;  1GLC G;  3I8D A;  1HJR A;  4A2B A;  3VA0 A;  2E1Z A;  5M1F A;  1NGB A;  3ZCM A;  1NGC A;  3CCL N;  1IKY A;  1W0H A;  1NK0 A;  3QDK A;  5KPR A;  4MDB A;  2QXF A;  3NGZ A;  4BGA A;  3HOT A;  5I42 A;  4ZHR A;  3TAM A;  2HBJ A;  3WT0 A;  3SYZ A;  4DQP A;  3JYT A;  1IH7 A;  4EAH D;  4XH4 A;  3O3H A;  3UE5 A;  2CGL A;  2VG6 A;  4DTU A;  5SZT A;  2E5L K;  4IFE A;  1YJ9 N;  3AVB A;  5C15 A;  3OS1 A;  2OPR A;  3AO3 A;  2ZE2 A;  1XMQ K;  2E1Y A;  5CHI A;  4DUZ K;  4JI1 K;  2PAV A;  4MFB A;  4A57 A;  3H1V X;  4E3S A;  4C1N I;  4CCH A;  3O3F A;  3NHG A;  2D0B A;  1IJJ A;  1GOB A;  2ETJ A;  4BRC A;  4CGG A;  3VQD A;  3VEV A;  3P4I A;  3ZSO A;  1FKO A;  2E2N A;  3MED A;  4KRE A;  1X1P A;  4CZF A;  5I9E B;  3VEW A;  3TAE A;  1L3U A;  4DR3 K;  3LDQ A;  5FLX O;  3M1F A;  4IOA L;  3CYM A;  4MO4 A;  1E4F T;  3O5B A;  4DSJ A;  2ATQ A;  3FFI A;  3TAB A;  5FDL A;  3C0B A;  4M7Y A;  3WQU A;  4IEI A;  2F7T A;  5C42 A;  2XY7 A;  3VEN A;  3GE1 A;  2Q0U A;  1U47 A;  4M45 A;  3LDP A;  3WNG A;  3P31 A;  3U9Z A;  4KHU A;  1BIZ A;  5TKY A;  1SS6 A;  1ZYQ A;  3OTO K;  3KHY A;  4B1V A;  4Z4C A;  4BDY A;  2W40 A;  3ZYY X;  3CPE A;  3G71 N;  3O3G A;  4GV9 A;  2V7Z A;  4DSE A;  4JHD B;  2HHS A;  4FK2 A;  3VA3 A;  3QO9 A;  3ID6 A;  1WSH A;  2O8C A;  3O9Q A;  1X9J A;  3IRX A;  1VQK N;  1NK8 A;  3OYM A;  1ZXO A;  3LM2 A;  3OYG A;  1VHX A;  3W3D A;  1RT4 A;  3BGR A;  3U8X A;  2QWO A;  1ITG A;  2YHW A;  4PHT X;  5JVH L;  5LL6 Z;  2P9I A;  1VSL A;  3LP3 A;  2FF3 B;  4DUY K;  4CJ7 A;  2GTD A;  4FWR A;  2KFN A;  3VQA A;  1HNI A;  1NU0 A;  4BVP A;  1T05 A;  5KGX A;  3A0I X;  2YHA A;  5E84 A;  3CJ7 A;  1GLF O;  3AVH A;  3M8P A;  5GIO A;  4JI0 K;  1KCF A;  3AO1 A;  2FBT A;  1YJN N;  4JN4 A;  2UUA K;  5KPT A;  2GUP A;  4X64 K;  4JRQ A;  3AO5 A;  1TUY A;  2NZT A;  3VGK A;  4QS7 A;  4DU3 A;  4N5S A;  3DLG A;  3F2K A;  4BRE A;  3VQ9 A;  1I39 A;  3TTF A;  1TAQ A;  3L3V A;  1BO5 O;  1SKR A;  4FXD A;  3WXL A;  4YDU C;  1TKT A;  3KLF A;  4CJ4 A;  1YHQ N;  3VQ7 A;  4F8R A;  2IVP A;  5LJW A;  3KK7 A;  4B9T A;  3PX4 A;  3R8E A;  4FWS A;  5T7B A;  4A5A A;  1WAF A;  1NGJ A;  4FWN A;  1XMO K;  3HJF A;  2IDO A;  3CJ1 A;  1YVN A;  1YIT N;  2D0O A;  4L3Q A;  2A1R A;  1S3X A;  4M3Z A;  4R5P A;  5MLC Q;  4FL9 A;  2Q31 A;  3TU5 A;  3LDS A;  2D0A A;  3SLC A;  2NRV A;  3MXI A;  3S41 A;  3CFO A;  1B92 A;  1VQP N;  1ZC6 A;  1VQ4 N;  1HPZ A;  2V52 B;  2X6S A;  4K8Z A;  1D8Y A;  3P5J A;  3CQX A;  2G8U A;  2Q36 A;  4JI8 K;  4CIE A;  2FSJ A;  3ATV A;  4JEP A;  2A6A A;  3EZ5 A;  1T7P A;  1RDW X;  4CJ3 A;  2I7N A;  4BC3 A;  2F8S A;  3SUQ A;  3CD6 N;  4YOX A;  2OPS A;  4BAC A;  1R59 O;  4F2R A;  1P90 A;  3D45 A;  3QFU A;  1IKW A;  3H08 A;  2B6A A;  5M1O A;  1HKC A;  3AGK A;  4IDH A;  1JJ2 M;  3HXM A;  1TGO A;  2P9L B;  3HYF A;  3E9O A;  5BPL A;  1DLO A;  1HQE A;  1RT5 A;  2BUP A;  3D0P A;  4B9N A;  4FLV A;  4F2S A;  2F8T A;  3WXK A;  3V9W A;  3N4Q A;  2HNY A;  4OVL A;  5AZJ B;  4U7B A;  1Q82 O;  1NGI A;  3SPY A;  4HUG A;  2OPP A;  4CF1 A;  1K8K A;  3OYE A;  3ENH A;  1BIS A;  3K5N A;  3CCV N;  4OLA A;  3IDH A;  1JXE A;  1S5J A;  4FLU A;  3HM8 A;  1VSD A;  4WFB L;  1U49 A;  3SV4 A;  4JKB A;  3QEX A;  3C6U A;  4OGE A;  4WE1 A;  3MN5 A;  1NGH A;  1NMD A;  1R0A A;  3HPH A;  1DKG D;  3JSM A;  1GLE G;  4FW2 A;  3CM6 A;  2HBM A;  1VSJ A;  3MN7 A;  1HNX K;  3BUZ B;  4WYB A;  2ASO A;  4ID5 A;  3M8S A;  4IFY A;  3QIC A;  3LZJ A;  4NLC A;  1QZ6 A;  4JKF A;  2DPN A;  3THW A;  1S22 A;  4DV1 K;  4DSK A;  2KTQ A;  2HBL A;  1NNE A;  3OHR A;  5F1X A;  4IOC L;  4LSN A;  4WCE L;  3V1O A;  3VF4 A;  5HOO A;  5AJ3 K;  1HX1 A;  3F73 A;  3U6F A;  4YY3 K;  1IBL K;  1VRT A;  1XQS C;  3PSF A;  4DTS A;  4RW4 A;  2FF6 A;  1Q8I A;  2Y1J A;  3D2F A;  1OVQ A;  2P9N B;  2P9P B;  4E7K A;  4PKI A;  4FLT A;  3NH1 A;  3RSE B;  4GV3 A;  1IO2 A;  1CZ9 A;  1LW2 A;  3EO3 A;  4BRL A;  3ZT4 A;  4NCB A;  2OTJ N;  4KRF A;  3RMD A;  3V81 A;  4DR2 K;  2EX3 A;  4Z4E A;  3WNE A;  4B3M K;  1NK6 A;  4CEE A;  4CZI A;  4DFK A;  3P39 A;  3WXJ A;  4CJT A;  5C25 A;  4E1M A;  2QWM A;  1RDB A;  5KQD A;  2O4G A;  4DTM A;  4BQZ A;  2UXD K;  3BP8 A;  4K43 A;  1UWB A;  4FM2 A;  2ZJQ L;  1S1W A;  4CJR A;  3OYH A;  4AIL C;  1I3A A;  1SUQ A;  2GWK A;  3PX6 A;  1JCG A;  2EHG A;  4DV7 K;  4DV6 K;  4Z94 A;  3E9L A;  3ZSR A;  4N47 A;  4LY7 A;  1C6V A;  4ILG B;  3IFR A;  3EY1 A;  4BG9 A;  3K5M A;  3EL2 A;  1YIJ N;  3H1Q A;  3MCP A;  1KFD A;  4BC2 A;  1ILY A;  1RBT A;  3H45 C;  4PA1 A;  1HKG A;  4QAG A;  1J5E K;  1OH7 A;  4DTJ A;  2HBK A;  5FRM A;  4Y0W A;  1SV5 A;  3VQQ A;  4O55 A;  4CJL A;  1WAJ A;  4OPK A;  4JKE A;  4QS8 A;  1FW6 A;  4FJX A;  4A5B A;  1O13 A;  4QOZ B;  5AQK A;  4EP5 A;  3T1H K;  1DTQ A;  3QB0 A;  4DF8 A;  3O80 A;  2G8I A;  1J6Z A;  3AAQ A;  3AVG A;  2F4V K;  1C1C A;  4FJJ A;  4F3T A;  5AQH A;  3K9J A;  1NK4 A;  3R6M A;  5H1S Q;  3HP9 A;  4XIU A;  3O1B A;  2XY6 A;  1LWF A;  3LPT A;  1C0T A;  4F9O A;  1GOC A;  3FE1 A;  1N36 K;  2BTF A;  4DQS A;  2ZF5 O;  4DLG A;  1S9E A;  3VET A;  2KKZ A;  4OO1 J;  4C8O A;  2IC3 A;  4KH5 A;  1XHX A;  1BHL A;  3N4P A;  4CD3 A;  1LCU A;  4A2A A;  4RCH A;  4ILJ A;  1K73 O;  3QIP A;  4BWM A;  3AO4 A;  2FC0 A;  3HBT A;  2YNF A;  4KPY A;  4FSV A;  4AF1 A;  4KHY A;  2OCE A;  2VG7 A;  2O8F B;  4BE2 A;  4C8L A;  3K2P A;  2P51 A;  4E7J A;  2ASP A;  3LPU A;  1S1V A;  4CGF A;  1TAU A;  4U67 L;  3L0Q A;  4BRD A;  2Q3S A;  4BDZ A;  4HTL A;  4CZG A;  4IO8 A;  2QWN A;  3ALY A;  3U4L A;  4FOI A;  3CME N;  4NCA A;  3HM9 A;  3KJV A;  4YDU A;  5B8H A;  3L8B A;  5JMV A;  4B3S K;  1QQN A;  1OH6 A;  3ULE B;  1B9F A;  2F9T A;  3FLC O;  3GOI A;  4I6M A;  3VOV A;  1MWK A;  1VQ7 N;  5C10 A;  4CZK A;  4BE0 A;  2BDP A;  1GLA G;  3KWG A;  3ZSY A;  2EWS A;  5C2D A;  3HT3 A;  2E2P A;  3CG7 A;  2WC9 A;  1XNR K;  4KAZ A;  4UQG A;  2NRX A;  3WUH A;  1TKX A;  1HYS A;  4CZE A;  2YNI A;  2WFB A;  4B1Y B;  4CFD A;  3VQ5 A;  2E6L A;  4KTW A;  1NMN A;  4BVO A;  4M3Y A;  2FBY A;  2W41 A;  5C24 A;  1KAX A;  4DS5 A;  3HL8 A;  2Q1N A;  3C6A A;  5AQG A;  2P9K A;  5JIC A;  3L2R A;  2YI1 A;  1Z05 A;  1TK8 A;  3KD1 E;  1LWC A;  4FLW A;  5KGW A;  4B08 A;  1HRH A;  3VGM A;  1TUU A;  3J8A A;  2QEX N;  2VWB A;  5AQV A;  4RW6 A;  2YHX A;  5FRN A;  3CXC M;  1S6Q A;  4CHQ A;  3THX B;  2A1S A;  4M42 A;  2D0P A;  4CK3 A;  3VEX A;  1MDU B;  4CEF A;  4CEO A;  2Z1I A;  3FGU A;  3CCE N;  3D2F B;  5AR0 A;  4QCL A;  2DY4 A;  2ITG A;  1REV A;  4Z4G A;  4LSL A;  2X6N A;  4DFJ A;  1M1K O;  3BEX A;  1TKD A;  1N32 K;  1K8A O;  4ISF A;  1BDG A;  4KHQ A;  3FZF A;  4ID1 A;  2NRR A;  2KLA A;  1SL2 A;  2FSN A;  2GEL A;  5F2R A;  4IKF A;  1WBB A;  2YX6 A;  4CIG A;  4B9V A;  3OYJ A;  1BQM A;  2JGU A;  4FJI A;  4B9S A;  5AQN A;  2UYT A;  3G4S N;  1TYQ B;  2I7P A;  4LC9 B;  3L2U A;  1WUA A;  1OKJ A;  3V1R A;  1YTU A;  2WTU A;  1U2V A;  3DOL A;  4FLZ A;  4X62 K;  1Q18 A;  3F9M A;  4AHS A;  2VYP A;  1WSI A;  3FZM A;  5SWM A;  3QEW A;  4DR6 K;  2HHX A;  1S1U A;  5C0Y A;  4O8U A;  1LAW A;  2YKM A;  4FWM A;  3RSE A;  1VRU A;  4FZZ A;  3LAK A;  5AQR A;  3AVA A;  4IO9 L;  3WXI A;  5IT9 O;  1EX4 A;  4FJK A;  1JXB A;  1KFS A;  3SQ1 A;  3RTV A;  3SAF A;  4PL7 A;  2Q2R A;  5HRO A;  3F5T A;  4C8M A;  4GVM A;  3DXM A;  4MDA A;  4A61 A;  3CJA A;  4MO5 A;  1VSF A;  5E41 A;  3THY B;  4CZH A;  5LY3 A;  3TAN A;  1IKX A;  1EO1 A;  5HBM A;  4C23 A;  2CGK A;  3T69 A;  3QBW A;  1P8Z A;  2IS3 A;  4CJV A;  4BRA A;  2Q97 A;  2UXB K;  1D9D A;  2KZM A;  3CFR A;  3T3F A;  1RT7 A;  4JK7 A;  3A5N C;  1RDU A;  1N33 K;  1KQS M;  3HSC A;  5JS1 A;  4KKO A;  1HQU A;  1VQL N;  1RT2 A;  1D4X A;  5BR9 A;  1C0U A;  3HO1 A;  1ZBS A;  4MQ3 A;  3PY8 A;  4YOU A;  2A5X A;  4OX9 K;  2KFZ A;  3NAE A;  4BC5 A;  3IMX A;  4H0P A;  4CIF A;  1YT3 A;  4CED A;  3IAY A;  4GMJ B;  5LJV A;  2B4J A;  3ENO A;  2O8F A;  5AQP A;  4ILH A;  4CF9 A;  5C2F A;  3O9R A;  4CBU A;  3M3Z A;  1EQY A;  3PV8 A;  3JAM O;  4CBW A;  1QQO A;  3VEY A;  3SV3 A;  2Z1J A;  4RTF D;  2ZJP L;  2ZJR L;  4DS4 A;  1HNV A;  1NJW A;  2XO7 A;  4OPJ A;  3PSI A;  1I94 K;  4B3T K;  2O8E B;  4NXN K;  4B3R K;  1YAG A;  2HHU A;  4IWV A; 
#chains in the Genus database with same CATH homology
 2OPP A;  4CF1 A;  2QKK A;  3AA4 A;  3OY9 A;  1ZBU A;  1QTM A;  3QIN A;  4W5Q A;  3OYE A;  3K5N A;  1BIS A;  4Z0U A;  4OLA A;  3L3U A;  2HHT A;  4O0I A;  3OS0 A;  4M3R A;  4H4M A;  4I2P A;  1JXE A;  1S5J A;  4FLU A;  4RW7 A;  4EZ6 A;  1VSD A;  3MAQ A;  1Y97 A;  1U49 A;  4LD0 A;  3TAP A;  1NOY A;  3SV4 A;  1L3S A;  3LWM A;  3QEX A;  1F21 A;  3C6U A;  4OGE A;  4WE1 A;  4BDP A;  2KW4 A;  3LAN A;  4CHO A;  5KRS A;  3QEP A;  5DK5 A;  2HVH A;  4M3W A;  2G8V A;  3VQE A;  1IG9 A;  1Z25 A;  3U3G A;  4CFA A;  3OYL A;  3HST B;  1R0A A;  1UAX A;  2XRI A;  3HPH A;  3T19 A;  4FW2 A;  3JSM A;  4M3U A;  3CM6 A;  1BL3 A;  4IG3 A;  5KRT A;  3HP6 A;  4CEC A;  1VSJ A;  4CJS A;  4B9M A;  4FJH A;  4PWD A;  3KK3 A;  4PY5 A;  3KD5 E;  4OGC A;  4W5R A;  3V9X A;  4B9L A;  4ID5 A;  3M8S A;  1BCM A;  2WON A;  4IFY A;  5KI6 A;  3LZJ A;  3TAG A;  3DLH A;  4FJN A;  1U48 A;  4DSF A;  1RCH A;  3TAF A;  5CYM A;  3PO4 A;  3QLH A;  1C1B A;  3QNN A;  3I0S A;  2KQ2 A;  5EU7 A;  1NJZ A;  4JLH A;  4E19 A;  1FKP A;  2Z1G A;  4TSX A;  1YVU A;  4DLE A;  1RTD A;  5HP1 A;  3NF7 A;  4DSK A;  2KTQ A;  1QSY A;  3TAR A;  2O4I A;  3MXJ A;  2Y1I A;  4LSN A;  3ISN C;  3SQ2 A;  4CJU A;  2Z1H A;  1NKC A;  3VQ8 A;  3V1O A;  2OZS A;  1TKZ A;  3F73 A;  3U6F A;  2XY8 A;  3OYI A;  4KB0 A;  2YKN A;  1VRT A;  4DTS A;  4RW4 A;  3KLE A;  3KLH A;  3B6P A;  4CK1 A;  3KLI A;  1RTI A;  1Q8I A;  2Y1J A;  3QER A;  3SI6 A;  3MXM A;  1QSS A;  1EXQ A;  3NH0 A;  4E7K A;  4KFB A;  3THV A;  1FXX A;  4CHZ A;  3KKS A;  3NH1 A;  4FLT A;  4FJ7 A;  3OYB A;  4FJ5 A;  1IO2 A;  1CZ9 A;  3L2V A;  1KLN A;  1KRP A;  4DSL A;  4N56 A;  1LW2 A;  4JS5 A;  4NCB A;  3ZT4 A;  1Q9Y A;  4DSI A;  4KRF A;  1SKS A;  3C6T A;  3KKR A;  2B5J A;  3RMD A;  3V81 A;  4J2D A;  2EX3 A;  4Z4E A;  3WNE A;  5J2Q A;  4EP4 A;  1A5V A;  1RDC A;  3K57 A;  1NK6 A;  4CEE A;  1VSE A;  4B9U A;  4DFK A;  5HRR A;  4CJT A;  4DTX A;  5C25 A;  3KK2 A;  4E1M A;  4ICL A;  3NGY A;  1RDB A;  4W5O A;  2OZM A;  2O4G A;  4HTU A;  2YHB A;  4DTM A;  2HHV A;  1G15 A;  5J2M A;  1KSP A;  1RT1 A;  3DRP A;  2P5G A;  1UWB A;  4KI4 A;  1JL1 A;  4FM2 A;  5I3U A;  1LV5 A;  4W5N A;  1S1W A;  2DFE A;  4E89 A;  4CJR A;  3OYH A;  4AIL C;  4FZY A;  4B3O A;  1RDD A;  3ITH A;  4BWJ A;  3ZSV A;  5HRP A;  1I3A A;  2GV9 A;  1HMV A;  1SUQ A;  4KV8 A;  4OKK A;  4CEZ A;  4I2Q A;  1JLA A;  1LWE A;  3VN5 A;  4DTN A;  4M3T A;  3PX6 A;  3M8R A;  2LSN A;  3IS9 A;  2EHG A;  3NF8 A;  1U04 A;  3NF6 A;  3ZSW A;  1NK9 A;  4FVM A;  3RR7 A;  3DLK A;  3ZSR A;  2OA8 A;  4HHT A;  3QNO A;  1IKV A;  4CJ5 A;  2G8F A;  3OYA A;  1JLC A;  4N47 A;  3HPO A;  4LY7 A;  1C6V A;  1VSH A;  3C95 A;  4YNQ A;  3OYF A;  1JLE A;  2HMI A;  4DWI A;  4HUF A;  2YV0 X;  5CY4 A;  3EY1 A;  2D0C A;  2HNZ A;  3ZT0 A;  4FYD A;  3AVN A;  3K5M A;  1X9S A;  4M3X A;  3O4Q A;  1ZBH A;  3ZT1 A;  1KFD A;  3AVK A;  4IG0 A;  3AVF A;  1X9M A;  2BGG A;  1BGX T;  2R7Y A;  1HYZ A;  1RBT A;  4O5B A;  4O44 A;  4PA1 A;  4QAG A;  1JKH A;  1U45 A;  4K8X A;  3DOK A;  5HLF A;  1XWL A;  3P1G A;  1ZBI A;  2D5R A;  3O4N A;  5J2N A;  4J2A A;  4DTJ A;  4GW6 A;  5FRM A;  1BI4 B;  4CFC A;  1SV5 A;  2P5O A;  1BI4 A;  3VQQ A;  4O55 A;  1L5U A;  4CJL A;  3A2F A;  1WAJ A;  4OPK A;  5JS2 A;  3SUO A;  2PY5 A;  4EZ9 A;  2HHQ A;  3AVL A;  3KIO A;  2QKB A;  1UA1 A;  4OLB A;  2FBX A;  4FJX A;  1KVC A;  3RMA A;  3SPZ A;  1WSF A;  1CLQ A;  2E4L A;  4QOZ B;  4HUG A;  1UA0 A;  1RIL A;  3I0R A;  1C1A A;  3KLG A;  5J1E A;  1J5O A;  1VK0 A;  1DTT A;  1WN7 A;  4CJF A;  5FRO A;  4EP5 A;  3L2Q A;  1Z26 A;  2P1J A;  3K59 A;  3RMC A;  1NK5 A;  1N5Y A;  2OPQ A;  4Q5V A;  3SCX A;  3V4I A;  3DI6 A;  3B6O A;  4CEQ A;  4KHS A;  1DTQ A;  3AA5 X;  4ZTF A;  4DF8 A;  1VSM A;  4F4K A;  4DQI A;  4CER A;  4IDK A;  1EET A;  3AVC A;  2G8I A;  1VSI A;  3AVG A;  4PUO A;  1C1C A;  3V6D A;  1ZBL A;  4FJJ A;  4F3T A;  4AHT A;  3NE6 A;  3SUN A;  1GOA A;  3U3Y A;  3ASM A;  1NK4 A;  4FJG A;  1JLQ A;  4NYF A;  2DFH A;  4AHC A;  3HP9 A;  4XIU A;  4DF4 A;  4E0D A;  1T8E A;  2FBV A;  1J9A A;  2XY6 A;  1LW0 A;  1LWF A;  2F96 A;  4IFV A;  3OS2 A;  3LPT A;  3WNF A;  4NCG A;  1C0T A;  3OYD A;  3NDK A;  1GOC A;  3NCI A;  3TWH A;  4DQS A;  2VG5 A;  3LZI A;  3DM2 A;  4M41 A;  2DFF A;  2GBZ A;  4DLG A;  3C94 A;  1S9E A;  4KO0 A;  3V9U A;  1NOZ A;  1RDA A;  3DLR A;  2PZS A;  3CQ8 A;  3I8D A;  4C8O A;  1HJR A;  2IC3 A;  1XHX A;  1BHL A;  3VA0 A;  3LAL A;  4CF8 A;  1A5X A;  3ZCM A;  3QIP A;  4LH4 A;  3QEI A;  4BWM A;  1VSK A;  3AO4 A;  2FC0 A;  2X78 A;  2YNF A;  1IKY A;  1ASU A;  1W0H A;  4IBN A;  1NK0 A;  4KPY A;  4KTZ A;  1SL1 A;  4KHY A;  4FM1 A;  1EKE A;  2QXF A;  3NGZ A;  2VG7 A;  3EYZ A;  1RBV A;  4BE2 A;  4H8K A;  5I42 A;  3K2P A;  4C8L A;  2P51 A;  4ZHR A;  4E7J A;  4Q0B A;  3LPU A;  3TAM A;  1RBU A;  2HVI A;  1S1V A;  4OJR A;  4CGF A;  1Q9X A;  1TAU A;  1XI1 A;  4JRP A;  3SYZ A;  4DQP A;  3JYT A;  3DYA A;  1IH7 A;  2GUI A;  2Q3S A;  4BDZ A;  3SQ0 A;  3O3H A;  4DQQ A;  4Z4F A;  2VG6 A;  3ALY A;  4DTU A;  5SZT A;  1CZB A;  4NCA A;  1RBR A;  3HM9 A;  3AVB A;  3LP0 A;  3KJV A;  3L8B A;  1JL2 A;  1UOC A;  4YFU A;  2OPR A;  3AO3 A;  3OS1 A;  2W42 A;  4CGD A;  2ZE2 A;  4FM0 A;  5J2P A;  3AA3 A;  4CF0 A;  3DLB A;  1B9F A;  3S9H A;  4CJE A;  5D3G A;  4DG1 A;  4BE0 A;  2KZZ A;  2BDP A;  1N6Q A;  4MFB A;  2VWK A;  3NGI A;  2G8H A;  1QHT A;  4E3S A;  3ZSY A;  3HK2 A;  4RG8 A;  4FZX C;  3RRH A;  4AHV A;  3HT3 A;  4CCH A;  3O3F A;  3NHG A;  2D0B A;  4KTQ A;  3RWU A;  1GOB A;  3OYN A;  3OJS A;  2ETJ A;  3CG7 A;  4CGG A;  2BAN A;  4O4G A;  1WNS A;  3DMJ A;  3VQD A;  4KAZ A;  4UQG A;  1FK9 A;  5HRN A;  3VQC A;  1FKO A;  3ZSO A;  1TKX A;  1TV6 A;  3MED A;  2PYJ A;  2RN2 A;  2XHB A;  1TK0 A;  3P83 D;  4KRE A;  1TVR A;  1HYS A;  4HCC A;  2YNI A;  1X1P A;  2X74 A;  4CE9 A;  4JS4 A;  4CFD A;  3VQ5 A;  1L3T A;  3TAE A;  1L3U A;  3S3M A;  2JLE A;  2E6L A;  4DTR A;  4KTW A;  5CYQ A;  4CGI A;  4ELV A;  3V9S A;  1XHZ A;  4M3Y A;  2FBY A;  3CYM A;  2OYQ A;  5C24 A;  1RT3 A;  4DS5 A;  3M8Q A;  3CM5 A;  1T03 A;  3HL8 A;  4DSJ A;  3QIO A;  2AJQ A;  2ATQ A;  4DQR A;  3FFI A;  3TAB A;  3AVI A;  4DMN A;  5FDL A;  4FJ9 A;  1S6P A;  3L2R A;  1TK8 A;  3KD1 E;  1LWC A;  4FLW A;  5KGW A;  4B08 A;  1JLB A;  1HRH A;  1L3V A;  5C42 A;  2PYL A;  2XY7 A;  4F3O A;  1WSJ A;  1KTQ A;  3OJU A;  4DTP A;  4Z4I A;  3TR8 A;  1U47 A;  4RW6 A;  4J2B A;  5FRN A;  4M45 A;  1S6Q A;  3IG1 A;  4CHQ A;  3WNG A;  2A1S A;  4M42 A;  4CK3 A;  1BCO A;  4KHU A;  1BIZ A;  5KTQ A;  1RBS A;  4CEF A;  4CEO A;  1ZYQ A;  4CGH A;  2Z1I A;  2ZQB A;  4BE1 A;  4N41 A;  4Z4C A;  1KVB A;  3V1Q A;  4BDY A;  5DMR A;  4OKJ A;  3OYC A;  4QCL A;  1SKW A;  3O3G A;  2DY4 A;  4DSE A;  2ITG A;  1REV A;  2HHS A;  2NUB A;  4LSL A;  4Z4G A;  1KVA A;  4ELU A;  4FK2 A;  2X6N A;  3QO9 A;  3VA3 A;  4DFJ A;  1TKD A;  2IGI A;  1BIU A;  1WSH A;  3MEC A;  3NFA A;  4HCB A;  3PUF A;  2DTU A;  4NYN A;  1LAV A;  4KHQ A;  4ID1 A;  3IRX A;  4CGJ A;  1NK8 A;  3HVT A;  3OYM A;  3MEE A;  1SL2 A;  3OYG A;  1CXU A;  1NKE A;  4E1N A;  3NBP A;  1RT4 A;  4ZTJ A;  2HHW A;  1JLF A;  4IKF A;  4DU1 A;  3BGR A;  4B9V A;  4CIG A;  1WSG A;  1ITG A;  2RF2 A;  3NH2 A;  3OYJ A;  1U4B A;  1BQM A;  2JGU A;  4FJI A;  4B9S A;  3DRR A;  1VSL A;  3UIQ A;  5CZ1 A;  4C8K A;  3LP3 A;  2IAJ A;  2IOC A;  2KFN A;  3VQA A;  1B9D A;  1HNI A;  3L2U A;  3MEG A;  3V1R A;  4Z4H A;  1YTU A;  1T05 A;  5KGX A;  2YHA A;  4FK0 A;  3ZT2 A;  2WOM A;  3DOL A;  4FLZ A;  1XC9 A;  1RNH A;  3AVH A;  3M8P A;  3SUP A;  1S1T A;  4KHW A;  1KCF A;  4FCY A;  3AO1 A;  3LWL A;  3NF9 A;  2FBT A;  4KB1 A;  4Y1C A;  4AHS A;  4E7H A;  1WSI A;  4JRQ A;  4FK4 A;  4B8A B;  4DFM A;  3AO5 A;  4CES A;  4CHY A;  5SWM A;  3QEW A;  3LAM A;  4I9L A;  3DRS A;  4DTO A;  2HHX A;  1S1U A;  1LAW A;  4DU3 A;  4N5S A;  2YKM A;  3DLG A;  4FW1 A;  2YNH A;  4FJ8 A;  1VRU A;  4FZZ A;  3LAK A;  4I9Q A;  1ZBF A;  3VQ9 A;  1JLG A;  1I39 A;  3VQ6 A;  4HVJ A;  1J53 A;  1NJX A;  3AVA A;  4RW8 A;  1TAQ A;  5K14 A;  4CF2 A;  3K5L A;  2ZD1 A;  3L3V A;  2I5J A;  1EX4 A;  4FJK A;  1SKR A;  4FXD A;  4H4O A;  1JXB A;  1KFS A;  3SQ1 A;  3VQB A;  3RTV A;  4KI6 A;  3VQ4 A;  1TKT A;  3KLF A;  3WNH A;  4CJ4 A;  3G10 A;  3ZT3 A;  2VWJ A;  3VQ7 A;  4FLY A;  3SNN A;  4CFB A;  4CK2 A;  4W5T A;  4F8R A;  5HRO A;  4DU4 A;  4LH5 A;  4B9T A;  4C8M A;  3PX4 A;  3HVR A;  2HW3 A;  4GVM A;  3V9Z A;  1X9W A;  3LP2 A;  3AVJ A;  2RKI A;  3SZ2 A;  1YTA A;  1S9G A;  1QQC A;  5T7B A;  4HUE A;  4CJK A;  4ELT A;  4L8R B;  4N76 A;  3ZSZ A;  3S3O A;  1VSF A;  1QE1 A;  1WAF A;  4RW9 A;  4DFP A;  5E41 A;  1S1X A;  4C8N A;  4CJW A;  2IDO A;  3HJF A;  3QES A;  3TAN A;  1IKX A;  3RMB A;  5HBM A;  1RTH A;  3S3N A;  1A5W A;  3AA2 A;  2A1R A;  4M3Z A;  2BE2 A;  4R5P A;  1WSE A;  2IS3 A;  4O0J A;  4CJV A;  3KTQ A;  2E6M A;  3T1A A;  3TI0 A;  3ZSQ A;  4PQU A;  3LDS A;  1C0M A;  2D0A A;  1BQN A;  1RTJ A;  3E01 A;  1D9D A;  1W9H A;  3MXI A;  2KZM A;  3AV9 A;  4AHU A;  4AHR A;  1EP4 A;  2HB5 A;  3CFR A;  3T3F A;  1RT7 A;  1TL1 A;  3CFO A;  1B92 A;  3OVN A;  4E7L A;  4CHP A;  1HPZ A;  2X6S A;  1NJY A;  4K8Z A;  1ASV A;  1CXQ A;  3KK1 A;  4CJQ A;  1D8Y A;  3P5J A;  2G8W A;  3LP1 A;  5CZ2 A;  2G8U A;  3TAQ A;  3QEV A;  1ASW A;  3AO2 A;  5JS1 A;  4CHN A;  4B8C A;  4KKO A;  1HQU A;  4CIE A;  3SQ4 A;  3RRG A;  1RT2 A;  1O1W A;  3ULD A;  1J54 A;  3BDP A;  3EZ5 A;  1T7P A;  1K6Y A;  1C0U A;  3HO1 A;  4MQ3 A;  4CJ3 A;  3PY8 A;  2QK9 A;  2F8S A;  3SUQ A;  2KFZ A;  3NAE A;  4Y1D A;  2OPS A;  4BAC A;  1QS4 A;  3VQP A;  1MU2 A;  4E7I A;  4CIF A;  3L2W A;  3QET A;  3D45 A;  1HYV A;  3F9K A;  1SL0 A;  4F2R A;  1YT3 A;  4CED A;  2G8K A;  3H08 A;  1IKW A;  2XY5 A;  3PO5 A;  2B6A A;  3IAY A;  4GMJ B;  1WLJ A;  3DLE A;  2B4J A;  3PX0 A;  3HXM A;  3RR8 A;  4CF9 A;  1TGO A;  4OKE A;  5HRS A;  4J2E A;  3HYF A;  3PV8 A;  1NKB A;  4CEB A;  1RT6 A;  4CJP A;  1TL3 A;  3K5O A;  4KHN A;  4FJM A;  1DLO A;  3SV3 A;  4FJL A;  1HQE A;  2Z1J A;  4G1Q A;  1RT5 A;  3D0P A;  4B9N A;  2YNG A;  4FLV A;  4I7F A;  1D5A A;  3SJJ A;  1QSL A;  4F2S A;  2F8T A;  4DS4 A;  1HNV A;  3ZSX A;  4CEA A;  3OYK A;  1NK7 A;  3AVM A;  1NJW A;  3V9W A;  2XO7 A;  4OPJ A;  2HNY A;  1TK5 A;  4OVL A;  3K58 A;  1D9F A;  2RPI A;  3HPG A;  2HND A;  4FLX A;  4AH9 A;  3SPY A;  2HHU A;  3CFP A;  1KLM A;  3G0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...