3P83D

Structure of the pcna:rnase hii complex from archaeoglobus fulgidus.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
213
structure length
213
Chain Sequence
SPEFPGRLMKAGIDEAGKGCVIGPLVVAGVACSDEDRLRKLGVKDSKKLSQGRREELAEEIRKICRTEVLKVSPENLDERMAAKTINEILKECYAEIILRLKPEIAYVDSPDVIPERLSRELEEITGLRVVAEHKADEKYPLVAAASIIAKVEREREIERLKEKFGDFGSGYASDPRTREVLKEWIASGRIPSCVRMRWKTVSNLRQKTLDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase sliding clamp
publication title PCNA directs type 2 RNase H activity on DNA replication and repair substrates.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase/dna binding protein
total genus 78
structure length 213
sequence length 213
chains with identical sequence E, F
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01351 RNase_HII Ribonuclease HII
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3p83D00
3DM2A 4BDYA 3OYMA 5E41A 2IDOA 2ITGA 2D0BA 3OYHA 3DLGA 4FJGA 2WONA 3H08A 4IFVA 4C8KA 1VK0A 1TV6A 4NCBA 2DFHA 4KHYA 1S1XA 4OGEA 3L8BA 1KLNA 4FK2A 3VQDA 2OPQA 4FW2A 4HHTA 1L5UA 1GOCA 5HRNA 2NUBA 1JLAA 3LALA 3CQ8A 1JL2A 4CK2A 4IG3A 4I2PA 3S3OA 4K8XA 2HNYA 4CHZA 4CEZA 4FJ7A 2Y1JA 2P1JA 4AHRA 1JLFA 3LDSA 3RMDA 2G8WA 2G8HA 1B9FA 1KRPA 1T7PA 3HJFA 1TK0A 4PWDA 4DSFA 4CEDA 4CEFA 5HRSA 4FW1A 4DMNA 4E7KA 5JS1A 1HRHA 1WSIA 1VSHA 1UWBA 4KHUA 2RF2A 2G8VA 1JLGA 4I2QA 2YNGA 3KJVA 5C24A 4FJJA 1KVBA 3V4IA 2VWKA 3AO2A 3K57A 4J2EA 4M3UA 5J2MA 1HQUA 3QESA 3SQ1A 4CESA 4B9TA 1LAVA 1RDBA 4GVMA 2BANA 4CJ3A 2GV9A 3L2RA 4O0JA 3V9WA 5C25A 3TAMA 3FFIA 4HUFA 1D8YA 3L3UA 3V9ZA 4E7JA 3T1AA 1HNIA 4NYNA 3KLFA 3AO5A 4FVMA 1QE1A 3G10A 4IFYA 1R0AA 2OZSA 2YHBA 1LW0A 1BCMA 3AVGA 3E01A 4CJEA 1YTAA 1FK9A 4Q5VA 3EY1A 3SQ2A 4DSKA 4F4KA 2X6NA 4M3ZA 3S3MA 3SYZA 3SQ0A 2KFZA 3ZSYA 3KK1A 4ZTFA 3VQ5A 2OZMA 1BL3A 2I5JA 4DWIA 5J1EA 1JLQA 4KHNA 3ZSOA 2E4LA 3DLHA 2GBZA 1S1WA 3RR7A 1EXQA 4RW8A 1J54A 4E0DA 3RRGA 1NJXA 2AJQA 4JLHA 3CYMA 2JLEA 1Q9YA 3QNNA 1U47A 2VG6A 2G8KA 5KGWA 4N47A 3EYZA 4FZZA 1X9WA 1SUQA 4KO0A 3M8SA 2FBYA 3I0RA 1IG9A 1ASWA 4EZ6A 1HYZA 4RW9A 4AHVA 1YVUA 2YNIA 3V1RA 3ULDA 1RT4A 1JLEA 2FBTA 4CJFA 1BIZA 4FLXA 1LWEA 4CHQA 3KIOA 3KLIA 4CGHA 4CK1A 4DTJA 3NF6A 4AHTA 1Q9XA 3DRSA 1IKXA 1ZBFA 4CEOA 4NYFA 1C6VA 2EX3A 3ZT0A 5C42A 2XY6A 4FXDA 1RILA 1A5VA 3D0PA 3AA2A 1EETA 3TAQA 2QK9A 1HYVA 1JLBA 1LAWA 3AV9A 1SKRA 4L8RB 2A1SA 2Z1IA 3SUNA 1D9FA 1UAXA 4CJUA 4FM2A 4G1QA 4E1MA 1BQNA 1VRTA 1WSFA 4CFBA 3KK3A 1KCFA 3KD1E 5D3GA 1WAFA 4KPYA 3K5LA 3V6DA 4W5RA 3MXMA 1QSSA 1Q8IA 4LY7A 4RG8A 2HHTA 3PX6A 3KKSA 1L3UA 1RTHA 2B5JA 3V1QA 4JRPA 4DTNA 3B6PA 3PV8A 3RR8A 5FDLA 2BGGA 4PUOA 2QKBA 1XWLA 3OVNA 4DFJA 4BACA 2ETJA 1JKHA 3ZSWA 2YKNA 1QHTA 2KFNA 4J2DA 4OPKA 4OPJA 3HPGA 4H4OA 3O3HA 3TWHA 5CYQA 4H8KA 4DLEA 3SQ4A 3MEGA 3LPUA 3NBPA 4DTPA 4IG0A 4ELTA 1S1TA 3ZSQA 4CGGA 5KGXA 4W5TA 2HHSA 1XI1A 1RT6A 1LV5A 3ALYA 1B9DA 1KTQA 4KI4A 5KI6A 1KFDA 5KRSA 4KFBA 3LANA 3RMCA 1W0HA 4DTMA 1RDDA 2GUIA 4CJVA 1XC9A 2R7YA 4FLVA 4OJRA 4M41A 3QETA 3HM9A 1X9MA 1J9AA 4B8AB 3OS1A 4HTUA 1NJWA 2DTUA 3S9HA 1NK9A 1KLMA 1X9SA 3K58A 4FJKA 2QKKA 3LP1A 2F8SA 3OYCA 2B6AA 3VQ9A 1FKOA 3HSTB 1NK7A 3QEWA 1U49A 1WSHA 2YNHA 3PUFA 4FJNA 4Y1CA 1HMVA 3HL8A 1ZBIA 1VSIA 1FXXA 2YNFA 3ZSVA 3V9SA 1RT2A 1TAQA 3OS0A 1T05A 4K8ZA 3CM5A 4E89A 4CJTA 5KTQA 4DSLA 3V1OA 4CGFA 5KRTA 4GMJB 2P5OA 4HUEA 3PO5A 1NKBA 4R5PA 3TAEA 1RTDA 3AVLA 4CJ4A 2P5GA 1WNSA 4N56A 4Z4CA 4W5OA 5DMRA 3PO4A 2DFEA 3OYAA 3PX0A 1QTMA 1TKDA 5FRNA 3HK2A 1CLQA 2F96A 3VQEA 4OVLA 5I3UA 1HYSA 3NF9A 3CFRA 1RT1A 3ZT2A 3AVJA 1X1PA 1L3VA 3L2VA 3TAFA 3KK2A 3OYLA 3UIQA 3SI6A 4F3TA 4AHSA 4DSEA 4M3YA 2KTQA 4M3RA 4CHPA 4DTXA 3RRHA 1UA1A 1NK0A 2IOCA 4CE9A 4YNQA 4EP4A 4CEBA 1SL0A 3NF7A 4LSLA 1SL2A 3OJSA 2OPRA 4FJHA 1ZBHA 3OYKA 4N5SA 2HHXA 4DTOA 2PYLA 4FJ9A 4B9SA 3THVA 3QLHA 1UA0A 1KVAA 4DFMA 3MECA 3O3GA 3C6UA 3WNHA 3ITHA 3AA4A 4DS4A 2HVHA 4O0IA 4C8LA 1WSGA 3LP0A 1L3TA 3KD5E 4J2AA 4FZYA 3DRRA 2BE2A 3L3VA 4AHCA 5SZTA 4JRQA 4AILC 1J5OA 4BDPA 1L3SA 3M8RA 3HO1A 4CJSA 4OLAA 3NH0A 4F2RA 2KW4A 2YKMA 5HRRA 3SV4A 3OJUA 3VQ7A 2XY7A 3O3FA 3U3YA 5CY4A 3QO9A 4ZHRA 4FJMA 3OYBA 3HPOA 4DSIA 3G0ZA 4CF9A 1D9DA 3NAEA 4B9UA 4ID1A 3SPZA 4KV8A 3SCXA 2BDPA 5HBMA 2G8UA 2X78A 4DG1A 4M3TA 3LWMA 3ASMA 1NK6A 3VQBA 3DRPA 4E3SA 1U48A 3NGYA 3K2PA 4CGJA 4I9LA 3IG1A 3U3GA 4KKOA 4FM0A 4OGCA 4HVJA 3HYFA 3SUQA 2OA8A 2RPIA 3VQ6A 1BCOA 3OS2A 1KSPA 4CK3A 1REVA 5HLFA 2XO7A 1RT7A 3QINA 2XY5A 5HROA 2PYJA 4OKJA 2E6LA 1QQCA 3AO4A 4E7IA 4DU1A 3QIOA 4CF1A 1K6YA 2YV0X 1A5XA 3KLGA 4EP5A 3NDKA 3DOLA 1VRUA 3P83D 2F8TA 1D5AA 4DU4A 3AA5X 3VQQA 2HHUA 4E1NA 1U4BA 4BDZA 1RDAA 3ISNC 1NOZA 3QEXA 4BE2A 4CF2A 3ZSXA 3V81A 3ZSZA 3LZJA 1QSYA 3AVCA 2DFFA 4WE1A 4LH4A 1C0MA 3AO1A 3F9KA 4O44A 4CJWA 1NKCA 4OKEA 1ZBLA 3AVNA 4B9NA 1S9GA 2FC0A 1QS4A 1F21A 1TK5A 1W9HA 4TSXA 4FJLA 1HJRA 4B9MA 4N76A 1EX4A 2VG5A 1RT5A 4BE0A 1IKWA 3S3NA 1RBTA 1T03A 2Q3SA 2G8FA 3AA3A 4FJIA 5J2NA 1KFSA 2O4IA 3OYGA 4JS5A 3CM6A 3QNOA 5HRPA 1ZBUA 4B3OA 3KTQA 5EU7A 4DQPA 4QAGA 1HQEA 3LP3A 3T19A 4OLBA 1VSMA 1IKYA 5CZ2A 1XHZA 4O5BA 3OY9A 4J2BA 1WLJA 4BWJA 2HHVA 1S5JA 2B4JA 1U45A 1I39A 4Z4EA 3DOKA 4E7LA 4B8CA 5FROA 1ZYQA 1BHLA 2KZMA 1BISA 4H4MA 4LH5A 3OYFA 1RDCA 3AVIA 2PZSA 1BI4B 4LD0A 3OYNA 1Y97A 4F8RA 2ZQBA 3SJJA 3PY8A 4FYDA 4CHYA 2D0CA 4LSNA 4HUGA 1QSLA 3B6OA 1C1AA 2W42A 3VA0A 2XHBA 4N41A 4QCLA 2OPSA 3LZIA 1TL1A 4CEEA 1WSEA 4ZTJA 1YTUA 2HVIA 1S1UA 4YFUA 3QEPA 3K5OA 1VSDA 4Z4GA 3ZT4A 4RW7A 3EZ5A 1N5YA 1TKZA 2OPPA 3C95A 4Z4IA 1LWFA 2HB5A 3C6TA 4UQGA 3O4NA 4CJQA 4KHQA 1C1CA 4DTRA 1IKVA 1O1WA 3TABA 1C0TA 2EHGA 1EP4A 4PA1A 3OYIA 1DTQA 1VSJA 4IDKA 1ASUA 4FLZA 3NGIA 4FLTA 4DFPA 2HHQA 4B9VA 4QOZB 4EZ9A 3SUPA 3DI6A 4DQSA 2KZZA 3PX4A 1SV5A 4O55A 5HP1A 4FK0A 2D5RA 1JL1A 3AVAA 3K59A 1NJZA 2HMIA 4M3WA 4DTUA 3L2UA 1CXUA 3CFPA 3LAMA 3NCIA 1FKPA 3TAGA 1J53A 3CG7A 4Z0UA 3VQ4A 2ZD1A 5T7BA 1TK8A 2O4GA 4KHSA 1BGXT 3VQAA 2FBVA 4JS4A 3IS9A 3AVMA 4CHOA 4NCGA 3RWUA 3M8QA 4C8OA 4ELUA 4KI6A 3QEIA 3V9XA 1U04A 5SWMA 3WNEA 5FRMA 1TVRA 1RBUA 3L2WA 4CIFA 3KLHA 3KLEA 3TAPA 3K5NA 4CECA 3SNNA 4FJ8A 2HNDA 1DTTA 4B9LA 1WAJA 2RKIA 3OYJA 4FZXC 4IKFA 4NCAA 4CFDA 2KQ2A 1VSEA 4DQIA 4KHWA 3A2FA 1S1VA 3SUOA 1A5WA 2HNZA 3QIPA 2Y1IA 1HPZA 2D0AA 4CCHA 3NH2A 3D45A 1UOCA 4MQ3A 4KRFA 3AVHA 1RBRA 1TKXA 3NGZA 1CZBA 1C0UA 4CEQA 1RTIA 4I7FA 4CERA 4CFAA 3WNFA 4CJRA 3I8DA 1EKEA 1N6QA 4DTSA 5J2QA 4C8MA 3CFOA 3VA3A 3LWLA 1VSFA 2E6MA 1B92A 2JGUA 1Z25A 3MEEA 1TKTA 4ID5A 4KAZA 4PY5A 4MFBA 3NF8A 5K14A 4DF8A 3SV3A 2YHAA 4M45A 1CXQA 3IAYA 4FLUA 1BI4A 3QERA 3TR8A 1BQMA 4W5NA 2RN2A 1DLOA 4DS5A 1SKWA 1MU2A 3MXIA 4O4GA 1LW2A 3NHGA 1S6PA 3V9UA 2A1RA 1TL3A 3LP2A 3ZT1A 4KTWA 4KB0A 3AVBA 3I0SA 1G15A 1TGOA 3IRXA 4Y1DA 4FM1A 4CGDA 1RCHA 3DLBA 4I9QA 4CHNA 3MAQA 3M8PA 4CJLA 4F3OA 4KTQA 2WOMA 1ITGA 3OYDA 5I42A 4IBNA 1NK8A 3P1GA 2X6SA 1BIUA 1ASVA 1JXBA 1VSLA 4FJ5A 3ZSRA 4CF0A 1NJYA 2OYQA 1IO2A 3C94A 4CJKA 3BDPA 2IGIA 4DF4A 1T8EA 2PY5A 3HP6A 4Z4HA 4E7HA 4GW6A 1SKSA 4CF8A 4CIEA 4XIUA 4KREA 3VQCA 3ZT3A 3K5MA 3LPTA 2Z1JA 4CJ5A 1LWCA 4AH9A 4RW6A 1S9EA 3SPYA 2ZE2A 4CEAA 3U6FA 4FK4A 3RMAA 2LSNA 1RTJA 2Z1GA 1NK4A 3HT3A 4DQRA 3RTVA 4DSJA 1GOBA 3MEDA 4FJXA 3VN5A 3WNGA 4PQUA 4AHUA 4KTZA 4CIGA 4FLYA 4CFCA 1XHXA 1RBSA 2Z1HA 3DYAA 1NK5A 1YT3A 3HXMA 3DLEA 3SZ2A 3TARA 4KB1A 1IH7A 4DU3A 2G8IA 1JXEA 3DLRA 4M3XA 4ICLA 2HHWA 1I3AA 1RT3A 1C1BA 1Z26A 3NFAA 3P5JA 4W5QA 3TANA 2VWJA 4DFKA 2IAJA 4C8NA 3DMJA 3HVTA 1TAUA 3VQ8A 1S6QA 3QEVA 1RNHA 3JSMA 3AO3A 4CJPA 4E19A 3TI0A 1HNVA 4CGIA 4DLGA 3O4QA 4M42A 2XRIA 1JLCA 1CZ9A 4HCBA 3T3FA 4B08A 4OKKA 2XY8A 2QXFA 3ZCMA 1GOAA 3HP9A 4RW4A 3HVRA 4FLWA 4BWMA 2DY4A 2IC3A 2VG7A 5DK5A 3MXJA 1WSJA 4F2SA 3F73A 5CYMA 3RMBA 4DQQA 1NKEA 3AVKA 4ELVA 3L2QA 1WN7A 3VQPA 1KVCA 3NH1A 1NOYA 5CZ1A 5JS2A 1RBVA 4HCCA 4Z4FA 2X74A 3HPHA 1VSKA 2FBXA 4BE1A 2ATQA 3JYTA 2IS3A 3DLKA 3OYEA 3BGRA 3LAKA 3NE6A 3KKRA 4FCYA 2P51A 3AVFA 2HW3A 1SL1A 4Q0BA 5J2PA
chains in the Genus database with same CATH superfamily
2ASOA 3UE5A 1VAZA 3H08A 3L4IA 2DFHA 4OGEA 3CD6N 1GOCA 4RCHA 5HRNA 1XMOK 1JLAA 3CQ8A 4IG3A 1VQ8N 3S3OA 4FJ7A 4CEZA 4WFNL 2G8WA 3WXLA 2G8HA 3ENBA 1TK0A 3H1QA 4CEFA 1VQLN 1HRHA 3QICA 1TUUA 1BDGA 2G8VA 1NJIO 5C24A 4FJJA 1KVBA 3V4IA 3CC4N 4M3UA 2GWJA 5KQ8A 5J2MA 1RDBA 2BANA 3V9WA 4BG8A 1D8YA 3L3UA 4NYNA 3HM8A 5E84A 3G10A 3PSFA 1BUPA 1LW0A 2VGNA 1FK9A 4Q5VA 3VESA 4H03B 4F4KA 2X6NA 4JEPA 3ZSYA 3WEEB 3MX2A 4BR7A 3VQ5A 2OZMA 2I5JA 4DWIA 1JLQA 3ZSOA 1OVYA 1S1WA 4E0DA 4L3QA 3ULEA 1TYQA 4YHHK 3QFPA 2VG6A 1U47A 3LL3A 3P4IA 3O1WA 4JN4A 1YJWN 1Y64A 1YVUA 3V1RA 3P31A 3ULDA 1JLEA 2E2OA 5AQHA 2DPNA 3KLIA 3NF6A 3DRSA 1IKXA 3H46O 4CEOA 1C6VA 3ZT0A 4FXDA 3D0PA 3AA2A 3HTVA 4FM2A 4CFBA 4R79A 4BQZA 3KD1E 1KCFA 5D3GA 3I33A 4EHTA 3N4QA 4W5RA 3MXMA 4JV5K 4RG8A 4BR2A 1L3UA 1RTHA 2B5JA 3PV8A 4PUOA 2QKBA 3OVNA 1JKHA 4GY2B 2YKNA 4J2DA 4A57A 3HZ6A 4H4OA 5CYQA 3SQ4A 3SMSA 5AFUA 2NRWA 1Z6RA 5EX5A 4CGGA 3ZSQA 2HHSA 5KGXA 2HF3A 4KI4A 4BQLA 5KRSA 1RDDA 2GUIA 3R9PA 4CJVA 2R7YA 3GDQA 3QETA 2BTFA 1NJWA 3S9HA 2O8BA 4O5FA 2QKKA 3LP1A 4YY3K 4JI3K 3HSTB 1NK7A 1U49A 2YNHA 3PUFA 1HMVA 1VSIA 3UB5A 3WXJA 1GLDG 3V9SA 1RT2A 3E9PA 4OO1J 4CZJA 4DSLA 4MO4A 3C6AA 4HUEA 4R5PA 5BRDA 2HBLA 3O08A 3U9DA 3M5RA 4N56A 1ZXOA 3LDPA 5EXWA 3BY5A 3VQEA 2JWLA 5I3UA 3AGKA 1X1PA 3OYLA 2ASMA 4H0PA 5JLHA 2W41A 4DSEA 2P9LB 4YNQA 4FOEA 4CEBA 3AY9A 3NF7A 3BEXA 3OJSA 4FJHA 4LFCK 2PYLA 1HKCA 2FLOA 1KVAA 3CJAA 4DFMA 3SBGA 2P9IA 5AQJA 3WNHA 3ITHA 4BRFA 4O0IA 2CH6A 4WQ5A 3S41A 3ID6A 3KD5E 4MDBA 3M8RA 3HO1A 4CJSA 2YKMA 5HRRA 4JYAK 2XY7A 4ZHRA 2HSTA 4DSIA 3G0ZA 4KBOA 5KQDA 4ID1A 4B9UA 4ILJA 3SPZA 3SCXA 5HBMA 4ILGB 3VQBA 3MDQA 3ATUA 2Q97A 2RPIA 3OS2A 4K43A 5HROA 2PYJA 4OKJA 4RWTA 3MX5A 2O8DA 3LDOA 3KLGA 4EP5A 3NDKA 3EL2A 1VRUA 4IZ9A 1U4BA 1RDAA 4BE2A 4CF2A 3AVCA 4WE1A 2E5LK 5IT9O 3AO1A 1NKCA 4CJWA 1ZBLA 3AVNA 2P9PB 4JI4K 2WTUA 2VG5A 4BE0A 3K0SA 1IKWA 1RBTA 4NLCA 3AA3A 4CZGA 1KFSA 4FO0A 1KXPA 3CM6A 4QAGA 1HQEA 3CCVN 1VSMA 2E2QA 5CZ2A 5BN8A 3AGRA 1WLJA 4Z4EA 2B4JA 4DUYK 4E7LA 4B8CA 1N32K 4F9OA 2GWKA 1BISA 3OYFA 4DR3K 3AVIA 2ZM6K 2PZSA 1T3VA 3OYNA 1Y97A 4F8RA 2ZQBA 5AQMA 4FWMA 4FYDA 3B6OA 1C1AA 3MN9A 2W42A 3D6RA 2GUPA 3LZIA 4CEEA 1WSEA 4BRLA 1YTUA 1EO1A 3QEPA 3ZT4A 3J81O 4GNIA 4JK8A 5B8HA 1VQPN 4Z4IA 1LWFA 2HB5A 4CJQA 4KHQA 4NXMK 3T1HK 3TABA 4PA1A 3OYIA 1E3MA 1DTQA 3SMPA 2QM1A 1I94K 3CCUN 3SLCA 4B9VA 1YHQN 3THYA 3D2FB 4V19S 1VHXA 4DQSA 1SV5A 5HP1A 2D5RA 2W40A 3AVAA 1NJZA 4DTUA 2QWLA 3CFPA 1FKPA 1X9JA 4IOXA 1RDWX 4KHSA 2QTDA 2FBVA 4IO9L 3RVCA 3AVMA 4CHOA 4NCGA 4ELUA 5FRMA 3WNEA 5CR4A 3R3LA 3KLEA 3K5NA 2P9UA 1DTTA 3WXIA 4IKFA 4DQIA 3OBYA 3QIPA 1ATSA 4K42A 4KH5A 2D0OA 4MQ3A 4KRFA 3AVHA 1RBRA 1TKXA 1NK8A 4DQPA 1N6QA 3WNFA 3C7NB 5HOOA 3FR0A 3CFOA 3LWLA 4LC9B 5C12A 1Z25A 2VWBA 3MEEA 4X62K 4KAZA 1K73O 5AQFA 5FPMA 4CD3A 5K14A 1HKBA 2YHAA 4M45A 1VQ5N 3THWB 1EQYA 3QERA 4XH5A 2A41A 4O8UA 2V51B 1C0FA 3MXIA 3V9UA 1W97L 3D2EB 3IRXA 4BRMA 4CJLA 5I42A 3DAWA 5AR0A 1ASVA 4FJ5A 3H6EA 4DF4A 1JCFA 2ZGYA 3KVGA 1SKSA 5KPRA 2A42A 3ZT3A 4CJ5A 4PKHA 4BRAA 4FK4A 1S9EA 3U6FA 2LSNA 1HX1A 1GOBA 2E1YA 1GLEG 2FSNA 3CQXA 4AHUA 4CIGA 1RBSA 2O8FA 2HOEA 3TARA 2G8IA 3DLRA 1I3AA 1Z26A 4W5QA 3A0IX 3P5JA 1NMNA 5EY4A 3HVTA 1TAUA 2KHOA 3J7ZO 3CMEN 2W6KA 4YDUA 3JSMA 3AO3A 4CJPA 4CGIA 1JLCA 1Q81O 3T3FA 4HCBA 4OKKA 3EEQA 4RW4A 3VTIA 5JLFA 3HVRA 4FLWA 3LDLA 3RMBA 4DQQA 3L2QA 1BG3A 2JWKA 3NH1A 1XC3A 3HPHA 2UXCK 1NWKA 3CMAN 3CF5L 4WCEL 3OYEA 3KKRA 4FCYA 3CCLN 2P51A 4JK9A 3VEZA 3DM2A 4BR0A 1ATNA 3OYMA 5E41A 4H0XB 5GAEP 5M1PA 2UU9K 2WONA 3FZHA 4EIAA 5BPNA 2FSJA 3HOSA 3UKRA 4FW2A 1ATRA 1L5UA 2CGLA 3U8XA 1NGIA 1ILYA 4B1YB 4JI8K 4K8XA 2HNYA 4AHRA 3LDSA 1KRPA 1B9FA 3GOIA 3BF3A 4BRDA 3SAGA 3G71N 4DMNA 5JS1A 4JKHA 1J6ZA 3ZYYX 5C2FA 4KHUA 2BUPA 1HKGA 5AQLA 3KJVA 3A5MC 4J2EA 3K57A 3SQ1A 1LAVA 3ZLJA 4CJ3A 4GV9A 3BP8A 4HUFA 4E7JA 3T1AA 3KLFA 4IFYA 1R0AA 5AQZA 2OZSA 3JS6A 2RHKA 3SQ2A 3EY1A 4M3ZA 3H3OB 3P38A 3S3MA 3SYZA 3MK6A 1Q86O 3KK1A 2ZWHA 3EZWA 2E4LA 1V4SA 3UKUA 1EXQA 3RRGA 1NJXA 3ATVA 2G8KA 1GLBG 4NB4A 4JKDA 4QS9A 3ZETA 1X9WA 4KO0A 4EZ6A 2YNIA 2FBTA 1LWEA 4CHQA 3KIOA 3W3DA 5LJWA 1HLUA 1Q9XA 3E1YA 2EX3A 4NYFA 2XY6A 3M1FA 1A5VA 1RGIA 1EETA 2QK9A 1HYVA 1K9MO 4L8RB 2F4VK 3KK3A 2UYTA 3K5LA 1U6ZA 1Q8IA 2HHTA 3PX6A 4JRPA 3B6PA 3RR8A 2BGGA 1JCGA 4DFJA 3HPGA 1YF5L 4DLEA 2E2NA 3CCJN 3LPUA 4YOXA 1MA9B 1HNZK 4IG0A 4W5TA 3FFKB 4O8KA 1YI2N 2HBKA 3CJBA 3ALYA 1N8RO 5KI6A 3LANA 3RMCA 1W0HA 4BC5A 4XH1A 4FLVA 1J9AA 4HTUA 4WFBL 2DTUA 1VQ7N 2Q31A 5LMUK 1WBBA 1KD1O 1NK9A 1X9SA 3K58A 3CHWA 3WEEA 4CZFA 3QEWA 2Q0UA 4Y1CA 3HL8A 3R8EA 3ZSVA 1TAQA 4X64K 2CH5A 5I9EB 4GMJB 4BRGA 3PO5A 1HPMA 3O6WA 4FPBA 1RTDA 3VERA 3AARA 3TSQA 1WNSA 4OPHA 4Z4CA 1ZBSA 4YORA 3PO4A 1WOQA 2DFEA 4CW7B 3OYAA 3HK2A 1FW6A 1CLQA 4OVLA 1HYSA 2NRXA 5M1NA 2QWMA 3L2VA 4BROA 3TAFA 3UIQA 1V4TA 4AHSA 4CHPA 4B3MK 3H3NO 1ZBHA 4M63C 3OYKA 2HHXA 5LY3A 3G4SN 4Z94A 1NGJA 3THVA 1UA0A 2WFBA 4BREA 3F2KA 3MECA 4C8LA 1L3TA 4FZYA 4JRQA 2BE2A 3L3VA 4AHCA 4AILC 1IBLK 3CC2N 1K8AO 4BDPA 4KHPK 1KAXA 2KW4A 5EVZA 3OJUA 3F9MA 3O4WA 3QO9A 5AQUA 3OYBA 4JI0K 3NAEA 1GLLO 4KV8A 4FWSA 2G8UA 4M3TA 3SBTA 3LWMA 1NK6A 5JVGL 4E3SA 3NGYA 3K2PA 3THXB 1NG9A 3VOVA 1OH5A 4KKOA 2PBDA 3SUQA 5BRHA 3I8BA 3VQ6A 1BCOA 2QWPA 4CK3A 1BA1A 1REVA 5HLFA 2XO7A 1S3XA 3AO4A 1QQCA 4E7IA 4JKEA 2YI1A 4CF1A 4U67L 3I55N 1K6YA 4WFAL 3ZEUB 1VQ4N 1D5AA 3AA5X 4K41A 2HHUA 2QXLA 4BDZA 4GKJK 3ISNC 1BO5O 3PIOL 3ZSZA 1QSYA 1QVFM 4H0OA 3F9KA 4OKEA 4AQYK 2FC0A 2I7PA 4TSXA 4DV2K 4N76A 1EX4A 2P9LA 3VF2A 3QFUA 2Q3SA 4CZKA 4A5BA 2QWNA 2E88A 5ADXH 2O4IA 3OYGA 4A2AA 3KTQA 1K8KB 3E9OA 1IKYA 1XHZA 4O5BA 4J2BA 3VEWA 4FWRA 2AA4A 4LF7K 1ZYQA 5AZIB 4EAHD 3CCRN 3TU5A 4OX9K 2D0CA 2XHBA 3J80O 3IFRA 1YJNN 2HVIA 2V7ZA 3EO3A 4YFUA 4Z4GA 1TKZA 2OPPA 1WBDA 1IKVA 4AF1A 2EHGA 1EP4A 1E4GT 1VSJA 1W2BM 2D1KA 4FLTA 4DFPA 4QOZB 2P9NB 2OTLN 5E26A 1GLFO 1JL1A 2QA4N 5BREA 2HMIA 1CXUA 3LAMA 3NCIA 2VYPA 3TAGA 1J53A 3CG7A 1TK8A 1DEJA 3IS9A 3M8QA 4C8OA 4EHUA 1XUPO 2A40A 3SAHA 1U04A 4X66K 1TVRA 2P9PA 3TAPA 3KLHA 3U4LA 4FJ8A 3IMXA 4B9LA 1WAJA 3OYJA 4FZXC 4YOVA 4CFDA 1VSEA 1SZ2A 3A2FA 1S1VA 3SUOA 2Y1IA 3MN5A 2D0AA 3D45A 5AQTA 2YJEA 3A5NC 1CZBA 4PL7A 2IVNA 4BVOA 4IJAA 4YOYA 4IWVA 5DM6L 4UY8O 1P8ZA 5J2QA 3I56N 1VSFA 2E6MA 4BY9C 1W7AA 2FF3B 2YHYA 5ELZA 2UXBK 2GTDA 3A8YA 1BQMA 2RN2A 4JKCA 1DLOA 3C65A 4DS5A 1SKWA 1EWQA 3LP2A 3ZT1A 1OH8A 1DT9A 4KB0A 3AVBA 5BPMA 1G15A 3CCSN 3DLBA 4IFEA 2FSKA 1QQMA 2ZGZA 3OYDA 3P1GA 4FVUA 1MDUB 3ZSRA 4CF0A 1NJYA 2PAVA 1IO2A 3CJCA 3MWPA 5JMVA 3CCEN 4GW6A 3D2FA 3VGMA 4CF8A 4CIEA 1GLAG 1YJ9N 3O9SA 2WC9A 3SPYA 4AH9A 2ZE2A 1RTJA 1NK4A 4DQRA 4FJXA 3VN5A 4FLYA 3B8AX 3Q7CA 5C2DA 2WUSA 2Z1HA 3DYAA 1YT3A 5BPLA 1D4XA 3FGUA 4DFKA 2IAJA 3DMJA 1VQON 1S6QA 3QEVA 1RNHA 1KAYA 3EKSA 4DLGA 5AQXA 4WF9L 3O4QA 3C7NA 3FE1A 4C1NK 1OH6A 2XY8A 3ZCMA 1GOAA 3HP9A 1KC8O 3BUZB 2O8CB 1XMQK 3MXJA 3HI0A 3F73A 3THWA 3VQPA 1SS6A 1KVCA 1NOYA 4Z4FA 2X74A 1VSKA 4YOWA 3OBWA 4BE1A 4I6MB 5AJ3K 4CZEA 1NGBA 4CVNE 4GKKK 2CGKA 3BGRA 2YX6A 3GBTA 3CXCM 3D2EA 5C15A 3VF4A 1SL1A 1RFQA 5J2PA 2AP1A 4BDYA 4LFAK 2E20A 3OYHA 3DLGA 2HF4A 4FWKA 4C8KA 4LF9K 1NGCA 4KHYA 3K9JA 3VQDA 1SAZA 5LMNK 1M90O 3VGLA 1CZAN 3QBXA 1QZ6A 2YJFA 3CPEA 1KAZA 1ESVA 4DV4K 4CHZA 2P1JA 3HJFA 1JLFA 3G6EN 4DSFA 4E1JA 4CBXA 4B9QA 3KHYA 4FW1A 1Q82O 1WSIA 1UWBA 1JLGA 1LOTB 1Q18A 3AO2A 4JAXA 1HQUA 4B3TK 3BZKA 3KK7A 5BRFA 4FWQA 5C25A 3TAMA 3E66A 3U9ZA 1YUWA 1HJOA 3FFIA 2ZJPL 5AQYA 4M7XA 1N33K 3RSEB 4CJ7A 3AO5A 1QE1A 4PL8A 2YHBA 3AVGA 4CJEA 4DSKA 1YTAA 4WQ4A 4BGBA 2QEXN 3SQ0A 3TSUA 2KFZA 1HUXA 4JI6K 4ZTFA 3P39A 4OLBA 3FLCO 2AJQA 4RW8A 2NRVA 4JLHA 3CYMA 1Q9YA 4LF5K 3KWGA 4N47A 3TTCA 4MLEA 4LF4K 1ASWA 4AHVA 1RT4A 4CJFA 1BIZA 4BRKA 4CGHA 3O9QA 4AHTA 1ZBFA 3O9TA 4JD2B 1RILA 2VGMA 1LAWA 1SKRA 2A1SA 3SUNA 4CJUA 4G1QA 4E1MA 1VRTA 3ZX2A 1WSFA 1WAFA 4LY7A 4WQ5C 4DTNA 4JKGB 4BACA 2ETJA 4GVEA 1QHTA 2KFNA 4OPKA 4JNEA 3O3HA 3TWHA 5KPTA 3C0BA 1BOTO 3MEGA 3NBPA 4FOIA 4DTPA 3PLAA 4AM6A 4DR7K 1B9DA 1KTQA 2A5XA 4DV5K 3OA9A 4KFBA 4DTMA 5AFUH 3O80A 3J7AP 4OJRA 4M41A 1X9MA 5TKYA 4B8AB 2O8EB 4JKFA 1KLMA 4EFHA 3OYCA 3T1YK 3VQ9A 1QVGM 5AQVA 4A2BA 3WQTA 1WSHA 4FJNA 1FXXA 1U2VB 3OS0A 4K8ZA 4E89A 4CJTA 5KTQA 4CGFA 2A6AA 2P5OA 4DR5K 1NKBA 4K0KK 4CJ4A 5AQNA 3QB0A 2Q2RA 4BG9A 4W5OA 5DMRA 2NRZA 1BA0A 3PX0A 5FRNA 2F96A 3NF9A 4BRIA 3ZT2A 2YCHA 3KK2A 3SI6A 4BR9A 3QMLA 4F3TA 2OTJN 3DXKB 4M3YA 2KTQA 4M3RA 1NK0A 4M7YA 4EP4A 5M1QA 1Q7YO 2OPRA 4N5SA 3HOTA 4B3RK 1DKGD 4FJ9A 4B9SA 3QLHA 5BR8K 3C6UA 1NU0A 2HVHA 4HWIA 3O5BA 1WSGA 3LP0A 3DRRA 5SZTA 1J5OA 4B1VA 4DUZK 1L3SA 1YXQA 5CY4A 1XQSC 4FJMA 3HPOA 2F9WA 4CF9A 3R6MA 3EKUA 2BDPA 3EN9A 2X78A 3ASMA 1BU6O 3FZMA 3VTHA 5F0XA 1XNQK 1FJGK 3O9RA 2GEMA 3ENHA 3IG1A 3MWTA 4FM0A 4OGCA 4HVJA 3HYFA 1HR0K 4PKIA 2RE2A 1KSPA 3KWIA 1NGGA 3QINA 4JKAA 2E6LA 1T6CA 4DU1A 1A5XA 3N4PA 1MWKA 4H5WA 3DOLA 5AQQA 3P83D 2F8TA 4BRHA 4E1NA 3OTOK 3VEYA 3D7EO 1NOZA 3QEXA 4ILHA 2HBMA 2QI2A 4O44A 5GAGP 1QS4A 4FJLA 3R1XA 1HJRA 4BR5A 4B9MA 3T7ZA 4BRCA 1T03A 4FJIA 3QNOA 5EU7A 5A2QO 4RTFD 3T19A 4FPAA 5CE3A 3OY9A 4BWJA 2HHVA 5FPNA 1U45A 1I39A 1BHLA 5C10A 2KZMA 4H4MA 1RDCA 1BI4B 4MO5A 5KPZA 2OANA 3SJJA 2QW9A 2E2PA 5GADP 4CHYA 3PY8A 1WB9A 3VA0A 4N41A 3WQUA 4BVPA 4PHTX 1S1UA 4HTLA 2GX9A 4CZHA 3AAPA 3EZ5A 4RW7A 1N5YA 2V7YA 2KKZA 3C95A 3C6TA 4UQGA 4DTRA 1O1WA 4YOUA 3EE8A 3THXA 4IDKA 4FLZA 4H5NA 3IUCA 3NGIA 2VQEK 4H5TA 3VEVA 3DI6A 5AQOA 2H3GX 1O13A 4B1WB 4O55A 3VEOA 4FK0A 4WYBA 5GINA 3K59A 4IDHA 3ZEUA 1S72N 3VQ4A 4Z0UA 1IG8A 2HMPA 4YDUC 2O4GA 1BGXT 3VQAA 4JHDA 5GIOA 3O8MA 3RWUA 1HNXK 5SWMA 4LF6K 3DXMB 1QQOA 2P9KB 2KQ2A 1HPZA 4JI2K 3NH2A 1UOCA 3K9KA 3FZKA 4CBWA 1C0UA 4CEQA 1RTIA 4I7FA 1K8KA 4CERA 4CFAA 4CJRA 1N34K 4JI7K 4DTSA 3VA3A 1JJ2M 1B92A 3M3ZA 4CZIA 1TKTA 4ID5A 3T69A 2NNWA 2P9SB 4PY5A 5AZIA 5BN9A 1NGFA 4FLUA 4G9ZA 3Q7BA 4W5NA 3NVKA 1MU2A 4A59A 2ASPA 1LW2A 1S6PA 2ZJRL 1G99A 4KTWA 2ITMA 5AZJB 3C6HA 3I0SA 4CGDA 4GV3A 4I9QA 3M8PA 3M6GA 1NMDA 1ITGA 4KTQA 3MCAB 4IBNA 1RDUA 2OYQA 3C94A 2PY5A 2NRTA 3HP6A 4Z4HA 4JHDB 4E7HA 2P9NA 4FWOA 3CIPA 4BRQA 4XEIA 4KREA 1MWMA 3MMVA 4H0YB 2Z1JA 4M3WA 4CEAA 3CCQN 3RTVA 4DKWA 3WNGA 4PQUA 2IVPA 4BC3A 2Q1NA 4KTZA 1XHXA 1T44A 4BGAA 3SZ2A 4KB1A 1IH7A 2HBJA 4M3XA 1RT3A 3DWLA 3NFAA 3TANA 2VWJA 5M1OA 4C8NA 4FSVA 2UUBK 2NLXA 4DV1K 1NLVA 4E19A 2KLAA 1HNVA 1NBWA 4BC4A 3CQYA 3TI0A 3WUHA 3W0LA 1S22A 4IJNA 4B08A 3MN7A 4BR4A 1NGAA 5M1KA 2VCPA 2VG7A 1WSJA 4CD1A 1NKEA 3AVKA 4ELVA 3ULEB 1TYQB 1WN7A 5JS2A 1E4FT 1RBVA 3A5OC 2ZF5O 3JYTA 3DLKA 2QWRA 4NXNK 3LAKA 3NE6A 3AVFA 3VMFB 2HW3A 3L6QA 4GV6A 1SQKA 3PIPL 1NM1A 2IDOA 2ITGA 2D0BA 4KH4A 5JVHL 4FJGA 3WXKA 1YIJN 4IFVA 3L4QA 1VK0A 3WXMB 1TV6A 4NCBA 1S1XA 3FZLA 3L8BA 1KLNA 4FK2A 2OPQA 4HHTA 1J5EK 3NMUA 3CJ9A 2NUBA 3LALA 3DJCA 1JL2A 4CK2A 2F9TA 1H1VA 4K25A 4I2PA 4C23A 2GELA 5FPEA 2Y1JA 1WUAA 2W6LA 2F7TA 3RMDA 4DV7K 4PWDA 4CEDA 5HRSA 3SJHA 4E7KA 4BC2A 1VSHA 4FWLA 2RF2A 4I2QA 2YNGA 1TUYA 2VWKA 3EE9A 3QESA 4CESA 4B9TA 4GVMA 2GV9A 3L2RA 4O0JA 2NZTA 3V9ZA 2EWSA 1HNIA 4DV6K 4FVMA 4H0VB 1VQ9N 1T7PA 3E01A 1BCMA 3JAMO 2O8BB 4LFBK 4MDAA 2O8CA 1BL3A 4KHNA 3H45C 5J1EA 5AQKA 3NVMA 3DLHA 2GBZA 5AQRA 4X65K 3RR7A 1J54A 2JLEA 2VQFK 3QNNA 5KGWA 4I6MA 3EYZA 4FZZA 3E9LA 1SUQA 3M8SA 4DR4K 2FBYA 3I0RA 1VQNN 4MLHA 1IG9A 1HYZA 3GG4A 4RW9A 3TTDA 4NLBA 3A5LC 4FLXA 1GLCG 3ZX3A 4CK1A 4DTJA 1QHAA 3GL1A 1P90A 5C42A 3DLLL 3TAQA 1JLBA 3AV9A 4NO7A 2Z1IA 1D9FA 1UAXA 3VF6A 1BQNA 4KPYA 1QSSA 3V6DA 5GIPA 3HRGA 4BRNA 3KKSA 2FF6A 3V1QA 5JICA 5FDLA 3TTFA 1XWLA 3PSIA 1NGDA 2QWOA 3ZSWA 3VEXA 2YHXA 3J7YP 4OPJA 4H5RA 4H8KA 2P9IB 3CI5A 1YAGA 4ISGA 4ELTA 1S1TA 1XI1A 1RT6A 1LV5A 2D4WA 1JCEA 4FWNA 4B1ZA 1KFDA 4A62A 2A3ZA 4Y0WA 3RSEA 3LM9A 1XC9A 4IOAL 3HM9A 3OS1A 2F8SA 4FJKA 1OH7A 2B6AA 1QQNA 1FKOA 3ZX0A 5C0YA 4IO8A 1ZBIA 5HL7L 2PFUA 2YNFA 4JK7A 1T05A 3CM5A 3V1OA 3VENA 5KRTA 4H0TB 1IV0A 3TAEA 5IWAK 3AVLA 2O8DB 2P5GA 3GE1A 5EOYA 4A5AA 1DGKN 4FWPA 1QTMA 1TKDA 4JD2A 1IBKK 3CFRA 1RT1A 3AVJA 1NNEA 1L3VA 5F1XA 2UXDK 3AAQA 4DQ8A 2Q36A 4DV3K 1BWFO 5LL6Z 1VQ6N 4DTXA 3RRHA 1UA1A 1VQMN 2IOCA 4CE9A 1SL0A 2IVOA 4JI1K 4LSLA 1SL2A 4JKGA 2E1ZA 4JI5K 4YOTA 4DTOA 1ZC6A 4KH6A 3TPQA 3BZCA 3J8AA 3O3GA 3OW2M 3AA4A 4ISEA 5FLXO 4DS4A 4J2AA 4B1UB 3HSCA 4OLAA 3NH0A 4F2RA 3SV4A 3O9UA 3VQ7A 3O3FA 3U3YA 4JKBA 5BR9A 1D9DA 2O8EA 2E8AA 4DR6K 4CBUA 2OCEA 4DG1A 2NRHA 5AQIA 3VETA 4DR2K 3DRPA 1U48A 4CGJA 4I9LA 3U3GA 2OA8A 1U2VA 2UUAK 3BF1A 1NGHA 1RT7A 2XY5A 3THYB 3QIOA 2ZJQL 3CCMN 2YV0X 1KQSM 4DCHA 1X3MA 1LCUA 4DU4A 3LDQA 3VQQA 4CI6A 3ZSXA 3V81A 3LZJA 4CZLA 2DFFA 5DM7L 4LH4A 1C0MA 5ADXA 3CERA 3ENOA 1GLJO 4B9NA 1S9GA 2CGJA 1TK5A 1F21A 1W9HA 3DXKA 1X3NA 2P9UB 1RT5A 3S3NA 2G8FA 5J2NA 1IBMK 4JS5A 5HRPA 2V52B 1ZBUA 4B3OA 3MN6A 3LP3A 1S5JA 4IEIA 3DOKA 5H1SQ 5FROA 2QWQA 4QS8A 1T6DA 4LH5A 4LD0A 1OVQA 1C0GA 2YHWA 4LSNA 4HUGA 1QSLA 5F2RA 4FL9A 4IEEA 4QCLA 2OPSA 1TL1A 4ZTJA 2UUCK 1VQKN 3CJ1A 1VSDA 3K5OA 3O4NA 1C1CA 3SAFA 1C0TA 4LF8K 1ASUA 2HHQA 5M1FA 4J8FA 4DHYA 4EZ9A 3SUPA 3L0QA 3PX4A 5TKWA 2KZZA 3OHRA 3L2UA 5AQPA 2ZD1A 5T7BA 2HHHK 3VPZA 3KZBA 4QS7A 4PKGA 2WBNA 4JS4A 2FXUA 4KI6A 2O8FB 3QEIA 3V9XA 3L2WA 1RBUA 4CIFA 3LM2A 3SNNA 4CECA 1OKJA 2HNDA 1M1KO 2RKIA 4NCAA 3LDNA 4KHWA 1YITN 4IXCA 1A5WA 2HNZA 3CETA 4CCHA 4B3SK 3NGZA 3I8DA 1EKEA 4C8MA 3HBTA 2JGUA 3IKMA 4MFBA 3NF8A 4DF8A 3O1BA 3SV3A 1CXQA 3IAYA 1BI4A 1R59O 5MLCQ 3TR8A 4XH4A 1NGEA 3IDHA 1YVNA 4B1XB 1HNWK 4O4GA 4A61A 5CHIA 3NHGA 2A1RA 1TL3A 3QDKA 1TGOA 4Y1DA 4FM1A 3FZFA 1RCHA 4CHNA 3MAQA 1Z05A 4F3OA 2WOMA 2X6SA 3JXUA 1BIUA 1JXBA 1VSLA 3UKRB 3WT0A 2I7NA 3F5TA 4U7BA 4CJKA 3BDPA 2IGIA 1T8EA 3SK3A 2J4RA 2NRRA 2Q0RA 5AQWA 4XIUA 4DV0K 3VQCA 4IOCL 3K5MA 3LPTA 1LWCA 4RW6A 4BRPA 1EWRA 3RMAA 2Z1GA 4DSJA 3HT3A 1IJJA 4DB3A 4C1NI 3MEDA 1QZ5A 4CFCA 2BH1A 1NK5A 3HXMA 3DLEA 4DU3A 4WQ4C 2IIRA 1JXEA 2HHWA 4ICLA 5GAHP 5AQSA 3H1VX 1C1BA 3DXMA 4AM7A 2P9KA 4ISFA 5AQGA 3VQ8A 3G25A 3VGKA 4OPAA 5FPDA 4M42A 2XRIA 1CZ9A 2QXFA 4DR1K 3ID8A 3CPWM 4BWMA 2DY4A 2IC3A 5DK5A 2P9SA 4CZMA 4F2SA 1XNRK 5CYMA 3UKUB 5CZ1A 2D0PA 3MCPA 3CJ7A 4HCCA 3QBWA 2FBXA 5LJVA 3ZETB 2ATQA 2IS3A 3TSPA 1N36K 3CC7N 5AZJA 4H5VA 4Q0BA
chains in the Genus database with same CATH topology
3DM2A 4BDYA 3OYMA 5E41A 2IDOA 2ITGA 2D0BA 3OYHA 3DLGA 4FJGA 2WONA 3H08A 4IFVA 4C8KA 1VK0A 1TV6A 4NCBA 2DFHA 4KHYA 1S1XA 4OGEA 3L8BA 1KLNA 4FK2A 3VQDA 2OPQA 4FW2A 4HHTA 1L5UA 1GOCA 5HRNA 2NUBA 1JLAA 3LALA 3CQ8A 1JL2A 4CK2A 4IG3A 4I2PA 3S3OA 4K8XA 2HNYA 4CHZA 4CEZA 4FJ7A 2Y1JA 2P1JA 4AHRA 1JLFA 3LDSA 3RMDA 2G8WA 2G8HA 1B9FA 1KRPA 1T7PA 3HJFA 1TK0A 4PWDA 4DSFA 4CEDA 4CEFA 5HRSA 4FW1A 4DMNA 4E7KA 5JS1A 1HRHA 1WSIA 1VSHA 1UWBA 4KHUA 2RF2A 2G8VA 1JLGA 4I2QA 2YNGA 3KJVA 5C24A 4FJJA 1KVBA 3V4IA 2VWKA 3AO2A 3K57A 4J2EA 4M3UA 5J2MA 1HQUA 3QESA 3SQ1A 4CESA 4B9TA 1LAVA 1RDBA 4GVMA 2BANA 4CJ3A 2GV9A 3L2RA 4O0JA 3V9WA 5C25A 3TAMA 3FFIA 4HUFA 1D8YA 3L3UA 3V9ZA 4E7JA 3T1AA 1HNIA 4NYNA 3KLFA 3AO5A 4FVMA 1QE1A 3G10A 4IFYA 1R0AA 2OZSA 2YHBA 1LW0A 1BCMA 3AVGA 3E01A 4CJEA 1YTAA 1FK9A 4Q5VA 3EY1A 3SQ2A 4DSKA 4F4KA 2X6NA 4M3ZA 3S3MA 3SYZA 3SQ0A 2KFZA 3ZSYA 3KK1A 4ZTFA 3VQ5A 2OZMA 1BL3A 2I5JA 4DWIA 5J1EA 1JLQA 4KHNA 3ZSOA 2E4LA 3DLHA 2GBZA 1S1WA 3RR7A 1EXQA 4RW8A 1J54A 4E0DA 3RRGA 1NJXA 2AJQA 4JLHA 3CYMA 2JLEA 1Q9YA 3QNNA 1U47A 2VG6A 2G8KA 5KGWA 4N47A 3EYZA 4FZZA 1X9WA 1SUQA 4KO0A 3M8SA 2FBYA 3I0RA 1IG9A 1ASWA 4EZ6A 1HYZA 4RW9A 4AHVA 1YVUA 2YNIA 3V1RA 3ULDA 1RT4A 1JLEA 2FBTA 4CJFA 1BIZA 4FLXA 1LWEA 4CHQA 3KIOA 3KLIA 4CGHA 4CK1A 4DTJA 3NF6A 4AHTA 1Q9XA 3DRSA 1IKXA 1ZBFA 4CEOA 4NYFA 1C6VA 2EX3A 3ZT0A 5C42A 2XY6A 4FXDA 1RILA 1A5VA 3D0PA 3AA2A 1EETA 3TAQA 2QK9A 1HYVA 1JLBA 1LAWA 3AV9A 1SKRA 4L8RB 2A1SA 2Z1IA 3SUNA 1D9FA 1UAXA 4CJUA 4FM2A 4G1QA 4E1MA 1BQNA 1VRTA 1WSFA 4CFBA 3KK3A 1KCFA 3KD1E 5D3GA 1WAFA 4KPYA 3K5LA 3V6DA 4W5RA 3MXMA 1QSSA 1Q8IA 4LY7A 4RG8A 2HHTA 3PX6A 3KKSA 1L3UA 1RTHA 2B5JA 3V1QA 4JRPA 4DTNA 3B6PA 3PV8A 3RR8A 5FDLA 2BGGA 4PUOA 2QKBA 1XWLA 3OVNA 4DFJA 4BACA 2ETJA 1JKHA 3ZSWA 2YKNA 1QHTA 2KFNA 4J2DA 4OPKA 4OPJA 3HPGA 4H4OA 3O3HA 3TWHA 5CYQA 4H8KA 4DLEA 3SQ4A 3MEGA 3LPUA 3NBPA 4DTPA 4IG0A 4ELTA 1S1TA 3ZSQA 4CGGA 5KGXA 4W5TA 2HHSA 1XI1A 1RT6A 1LV5A 3ALYA 1B9DA 1KTQA 4KI4A 5KI6A 1KFDA 5KRSA 4KFBA 3LANA 3RMCA 1W0HA 4DTMA 1RDDA 2GUIA 4CJVA 1XC9A 2R7YA 4FLVA 4OJRA 4M41A 3QETA 3HM9A 1X9MA 1J9AA 4B8AB 3OS1A 4HTUA 1NJWA 2DTUA 3S9HA 1NK9A 1KLMA 1X9SA 3K58A 4FJKA 2QKKA 3LP1A 2F8SA 3OYCA 2B6AA 3VQ9A 1FKOA 3HSTB 1NK7A 3QEWA 1U49A 1WSHA 2YNHA 3PUFA 4FJNA 4Y1CA 1HMVA 3HL8A 1ZBIA 1VSIA 1FXXA 2YNFA 3ZSVA 3V9SA 1RT2A 1TAQA 3OS0A 1T05A 4K8ZA 3CM5A 4E89A 4CJTA 5KTQA 4DSLA 3V1OA 4CGFA 5KRTA 4GMJB 2P5OA 4HUEA 3PO5A 1NKBA 4R5PA 3TAEA 1RTDA 3AVLA 4CJ4A 2P5GA 1WNSA 4N56A 4Z4CA 4W5OA 5DMRA 3PO4A 2DFEA 3OYAA 3PX0A 1QTMA 1TKDA 5FRNA 3HK2A 1CLQA 2F96A 3VQEA 4OVLA 5I3UA 1HYSA 3NF9A 3CFRA 1RT1A 3ZT2A 3AVJA 1X1PA 1L3VA 3L2VA 3TAFA 3KK2A 3OYLA 3UIQA 3SI6A 4F3TA 4AHSA 4DSEA 4M3YA 2KTQA 4M3RA 4CHPA 4DTXA 3RRHA 1UA1A 1NK0A 2IOCA 4CE9A 4YNQA 4EP4A 4CEBA 1SL0A 3NF7A 4LSLA 1SL2A 3OJSA 2OPRA 4FJHA 1ZBHA 3OYKA 4N5SA 2HHXA 4DTOA 2PYLA 4FJ9A 4B9SA 3THVA 3QLHA 1UA0A 1KVAA 4DFMA 3MECA 3O3GA 3C6UA 3WNHA 3ITHA 3AA4A 4DS4A 2HVHA 4O0IA 4C8LA 1WSGA 3LP0A 1L3TA 3KD5E 4J2AA 4FZYA 3DRRA 2BE2A 3L3VA 4AHCA 5SZTA 4JRQA 4AILC 1J5OA 4BDPA 1L3SA 3M8RA 3HO1A 4CJSA 4OLAA 3NH0A 4F2RA 2KW4A 2YKMA 5HRRA 3SV4A 3OJUA 3VQ7A 2XY7A 3O3FA 3U3YA 5CY4A 3QO9A 4ZHRA 4FJMA 3OYBA 3HPOA 4DSIA 3G0ZA 4CF9A 1D9DA 3NAEA 4B9UA 4ID1A 3SPZA 4KV8A 3SCXA 2BDPA 5HBMA 2G8UA 2X78A 4DG1A 4M3TA 3LWMA 3ASMA 1NK6A 3VQBA 3DRPA 4E3SA 1U48A 3NGYA 3K2PA 4CGJA 4I9LA 3IG1A 3U3GA 4KKOA 4FM0A 4OGCA 4HVJA 3HYFA 3SUQA 2OA8A 2RPIA 3VQ6A 1BCOA 3OS2A 1KSPA 4CK3A 1REVA 5HLFA 2XO7A 1RT7A 3QINA 2XY5A 5HROA 2PYJA 4OKJA 2E6LA 1QQCA 3AO4A 4E7IA 4DU1A 3QIOA 4CF1A 1K6YA 2YV0X 1A5XA 3KLGA 4EP5A 3NDKA 3DOLA 1VRUA 3P83D 2F8TA 1D5AA 4DU4A 3AA5X 3VQQA 2HHUA 4E1NA 1U4BA 4BDZA 1RDAA 3ISNC 1NOZA 3QEXA 4BE2A 4CF2A 3ZSXA 3V81A 3ZSZA 3LZJA 1QSYA 3AVCA 2DFFA 4WE1A 4LH4A 1C0MA 3AO1A 3F9KA 4O44A 4CJWA 1NKCA 4OKEA 1ZBLA 3AVNA 4B9NA 1S9GA 2FC0A 1QS4A 1F21A 1TK5A 1W9HA 4TSXA 4FJLA 1HJRA 4B9MA 4N76A 1EX4A 2VG5A 1RT5A 4BE0A 1IKWA 3S3NA 1RBTA 1T03A 2Q3SA 2G8FA 3AA3A 4FJIA 5J2NA 1KFSA 2O4IA 3OYGA 4JS5A 3CM6A 3QNOA 5HRPA 1ZBUA 4B3OA 3KTQA 5EU7A 4DQPA 4QAGA 1HQEA 3LP3A 3T19A 4OLBA 1VSMA 1IKYA 5CZ2A 1XHZA 4O5BA 3OY9A 4J2BA 1WLJA 4BWJA 2HHVA 1S5JA 2B4JA 1U45A 1I39A 4Z4EA 3DOKA 4E7LA 4B8CA 5FROA 1ZYQA 1BHLA 2KZMA 1BISA 4H4MA 4LH5A 3OYFA 1RDCA 3AVIA 2PZSA 1BI4B 4LD0A 3OYNA 1Y97A 4F8RA 2ZQBA 3SJJA 3PY8A 4FYDA 4CHYA 2D0CA 4LSNA 4HUGA 1QSLA 3B6OA 1C1AA 2W42A 3VA0A 2XHBA 4N41A 4QCLA 2OPSA 3LZIA 1TL1A 4CEEA 1WSEA 4ZTJA 1YTUA 2HVIA 1S1UA 4YFUA 3QEPA 3K5OA 1VSDA 4Z4GA 3ZT4A 4RW7A 3EZ5A 1N5YA 1TKZA 2OPPA 3C95A 4Z4IA 1LWFA 2HB5A 3C6TA 4UQGA 3O4NA 4CJQA 4KHQA 1C1CA 4DTRA 1IKVA 1O1WA 3TABA 1C0TA 2EHGA 1EP4A 4PA1A 3OYIA 1DTQA 1VSJA 4IDKA 1ASUA 4FLZA 3NGIA 4FLTA 4DFPA 2HHQA 4B9VA 4QOZB 4EZ9A 3SUPA 3DI6A 4DQSA 2KZZA 3PX4A 1SV5A 4O55A 5HP1A 4FK0A 2D5RA 1JL1A 3AVAA 3K59A 1NJZA 2HMIA 4M3WA 4DTUA 3L2UA 1CXUA 3CFPA 3LAMA 3NCIA 1FKPA 3TAGA 1J53A 3CG7A 4Z0UA 3VQ4A 2ZD1A 5T7BA 1TK8A 2O4GA 4KHSA 1BGXT 3VQAA 2FBVA 4JS4A 3IS9A 3AVMA 4CHOA 4NCGA 3RWUA 3M8QA 4C8OA 4ELUA 4KI6A 3QEIA 3V9XA 1U04A 5SWMA 3WNEA 5FRMA 1TVRA 1RBUA 3L2WA 4CIFA 3KLHA 3KLEA 3TAPA 3K5NA 4CECA 3SNNA 4FJ8A 2HNDA 1DTTA 4B9LA 1WAJA 2RKIA 3OYJA 4FZXC 4IKFA 4NCAA 4CFDA 2KQ2A 1VSEA 4DQIA 4KHWA 3A2FA 1S1VA 3SUOA 1A5WA 2HNZA 3QIPA 2Y1IA 1HPZA 2D0AA 4CCHA 3NH2A 3D45A 1UOCA 4MQ3A 4KRFA 3AVHA 1RBRA 1TKXA 3NGZA 1CZBA 1C0UA 4CEQA 1RTIA 4I7FA 4CERA 4CFAA 3WNFA 4CJRA 3I8DA 1EKEA 1N6QA 4DTSA 5J2QA 4C8MA 3CFOA 3VA3A 3LWLA 1VSFA 2E6MA 1B92A 2JGUA 1Z25A 3MEEA 1TKTA 4ID5A 4KAZA 4PY5A 4MFBA 3NF8A 5K14A 4DF8A 3SV3A 2YHAA 4M45A 1CXQA 3IAYA 4FLUA 1BI4A 3QERA 3TR8A 1BQMA 4W5NA 2RN2A 1DLOA 4DS5A 1SKWA 1MU2A 3MXIA 4O4GA 1LW2A 3NHGA 1S6PA 3V9UA 2A1RA 1TL3A 3LP2A 3ZT1A 4KTWA 4KB0A 3AVBA 3I0SA 1G15A 1TGOA 3IRXA 4Y1DA 4FM1A 4CGDA 1RCHA 3DLBA 4I9QA 4CHNA 3MAQA 3M8PA 4CJLA 4F3OA 4KTQA 2WOMA 1ITGA 3OYDA 5I42A 4IBNA 1NK8A 3P1GA 2X6SA 1BIUA 1ASVA 1JXBA 1VSLA 4FJ5A 3ZSRA 4CF0A 1NJYA 2OYQA 1IO2A 3C94A 4CJKA 3BDPA 2IGIA 4DF4A 1T8EA 2PY5A 3HP6A 4Z4HA 4E7HA 4GW6A 1SKSA 4CF8A 4CIEA 4XIUA 4KREA 3VQCA 3ZT3A 3K5MA 3LPTA 2Z1JA 4CJ5A 1LWCA 4AH9A 4RW6A 1S9EA 3SPYA 2ZE2A 4CEAA 3U6FA 4FK4A 3RMAA 2LSNA 1RTJA 2Z1GA 1NK4A 3HT3A 4DQRA 3RTVA 4DSJA 1GOBA 3MEDA 4FJXA 3VN5A 3WNGA 4PQUA 4AHUA 4KTZA 4CIGA 4FLYA 4CFCA 1XHXA 1RBSA 2Z1HA 3DYAA 1NK5A 1YT3A 3HXMA 3DLEA 3SZ2A 3TARA 4KB1A 1IH7A 4DU3A 2G8IA 1JXEA 3DLRA 4M3XA 4ICLA 2HHWA 1I3AA 1RT3A 1C1BA 1Z26A 3NFAA 3P5JA 4W5QA 3TANA 2VWJA 4DFKA 2IAJA 4C8NA 3DMJA 3HVTA 1TAUA 3VQ8A 1S6QA 3QEVA 1RNHA 3JSMA 3AO3A 4CJPA 4E19A 3TI0A 1HNVA 4CGIA 4DLGA 3O4QA 4M42A 2XRIA 1JLCA 1CZ9A 4HCBA 3T3FA 4B08A 4OKKA 2XY8A 2QXFA 3ZCMA 1GOAA 3HP9A 4RW4A 3HVRA 4FLWA 4BWMA 2DY4A 2IC3A 2VG7A 5DK5A 3MXJA 1WSJA 4F2SA 3F73A 5CYMA 3RMBA 4DQQA 1NKEA 3AVKA 4ELVA 3L2QA 1WN7A 3VQPA 1KVCA 3NH1A 1NOYA 5CZ1A 5JS2A 1RBVA 4HCCA 4Z4FA 2X74A 3HPHA 1VSKA 2FBXA 4BE1A 2ATQA 3JYTA 2IS3A 3DLKA 3OYEA 3BGRA 3LAKA 3NE6A 3KKRA 4FCYA 2P51A 3AVFA 2HW3A 1SL1A 4Q0BA 5J2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DM2 A;  4BDY A;  3OYM A;  5E41 A;  2IDO A;  2ITG A;  2D0B A;  3OYH A;  3DLG A;  4FJG A;  2WON A;  3H08 A;  4IFV A;  4C8K A;  1VK0 A;  1TV6 A;  4NCB A;  2DFH A;  4KHY A;  1S1X A;  4OGE A;  3L8B A;  1KLN A;  4FK2 A;  3VQD A;  2OPQ A;  4FW2 A;  4HHT A;  1L5U A;  1GOC A;  5HRN A;  2NUB A;  1JLA A;  3LAL A;  3CQ8 A;  1JL2 A;  4CK2 A;  4IG3 A;  4I2P A;  3S3O A;  4K8X A;  2HNY A;  4CHZ A;  4CEZ A;  4FJ7 A;  2Y1J A;  2P1J A;  4AHR A;  1JLF A;  3LDS A;  3RMD A;  2G8W A;  2G8H A;  1B9F A;  1KRP A;  1T7P A;  3HJF A;  1TK0 A;  4PWD A;  4DSF A;  4CED A;  4CEF A;  5HRS A;  4FW1 A;  4DMN A;  4E7K A;  5JS1 A;  1HRH A;  1WSI A;  1VSH A;  1UWB A;  4KHU A;  2RF2 A;  2G8V A;  1JLG A;  4I2Q A;  2YNG A;  3KJV A;  5C24 A;  4FJJ A;  1KVB A;  3V4I A;  2VWK A;  3AO2 A;  3K57 A;  4J2E A;  4M3U A;  5J2M A;  1HQU A;  3QES A;  3SQ1 A;  4CES A;  4B9T A;  1LAV A;  1RDB A;  4GVM A;  2BAN A;  4CJ3 A;  2GV9 A;  3L2R A;  4O0J A;  3V9W A;  5C25 A;  3TAM A;  3FFI A;  4HUF A;  1D8Y A;  3L3U A;  3V9Z A;  4E7J A;  3T1A A;  1HNI A;  4NYN A;  3KLF A;  3AO5 A;  4FVM A;  1QE1 A;  3G10 A;  4IFY A;  1R0A A;  2OZS A;  2YHB A;  1LW0 A;  1BCM A;  3AVG A;  3E01 A;  4CJE A;  1YTA A;  1FK9 A;  4Q5V A;  3EY1 A;  3SQ2 A;  4DSK A;  4F4K A;  2X6N A;  4M3Z A;  3S3M A;  3SYZ A;  3SQ0 A;  2KFZ A;  3ZSY A;  3KK1 A;  4ZTF A;  3VQ5 A;  2OZM A;  1BL3 A;  2I5J A;  4DWI A;  5J1E A;  1JLQ A;  4KHN A;  3ZSO A;  2E4L A;  3DLH A;  2GBZ A;  1S1W A;  3RR7 A;  1EXQ A;  4RW8 A;  1J54 A;  4E0D A;  3RRG A;  1NJX A;  2AJQ A;  4JLH A;  3CYM A;  2JLE A;  1Q9Y A;  3QNN A;  1U47 A;  2VG6 A;  2G8K A;  5KGW A;  4N47 A;  3EYZ A;  4FZZ A;  1X9W A;  1SUQ A;  4KO0 A;  3M8S A;  2FBY A;  3I0R A;  1IG9 A;  1ASW A;  4EZ6 A;  1HYZ A;  4RW9 A;  4AHV A;  1YVU A;  2YNI A;  3V1R A;  3ULD A;  1RT4 A;  1JLE A;  2FBT A;  4CJF A;  1BIZ A;  4FLX A;  1LWE A;  4CHQ A;  3KIO A;  3KLI A;  4CGH A;  4CK1 A;  4DTJ A;  3NF6 A;  4AHT A;  1Q9X A;  3DRS A;  1IKX A;  1ZBF A;  4CEO A;  4NYF A;  1C6V A;  2EX3 A;  3ZT0 A;  5C42 A;  2XY6 A;  4FXD A;  1RIL A;  1A5V A;  3D0P A;  3AA2 A;  1EET A;  3TAQ A;  2QK9 A;  1HYV A;  1JLB A;  1LAW A;  3AV9 A;  1SKR A;  4L8R B;  2A1S A;  2Z1I A;  3SUN A;  1D9F A;  1UAX A;  4CJU A;  4FM2 A;  4G1Q A;  4E1M A;  1BQN A;  1VRT A;  1WSF A;  4CFB A;  3KK3 A;  1KCF A;  3KD1 E;  5D3G A;  1WAF A;  4KPY A;  3K5L A;  3V6D A;  4W5R A;  3MXM A;  1QSS A;  1Q8I A;  4LY7 A;  4RG8 A;  2HHT A;  3PX6 A;  3KKS A;  1L3U A;  1RTH A;  2B5J A;  3V1Q A;  4JRP A;  4DTN A;  3B6P A;  3PV8 A;  3RR8 A;  5FDL A;  2BGG A;  4PUO A;  2QKB A;  1XWL A;  3OVN A;  4DFJ A;  4BAC A;  2ETJ A;  1JKH A;  3ZSW A;  2YKN A;  1QHT A;  2KFN A;  4J2D A;  4OPK A;  4OPJ A;  3HPG A;  4H4O A;  3O3H A;  3TWH A;  5CYQ A;  4H8K A;  4DLE A;  3SQ4 A;  3MEG A;  3LPU A;  3NBP A;  4DTP A;  4IG0 A;  4ELT A;  1S1T A;  3ZSQ A;  4CGG A;  5KGX A;  4W5T A;  2HHS A;  1XI1 A;  1RT6 A;  1LV5 A;  3ALY A;  1B9D A;  1KTQ A;  4KI4 A;  5KI6 A;  1KFD A;  5KRS A;  4KFB A;  3LAN A;  3RMC A;  1W0H A;  4DTM A;  1RDD A;  2GUI A;  4CJV A;  1XC9 A;  2R7Y A;  4FLV A;  4OJR A;  4M41 A;  3QET A;  3HM9 A;  1X9M A;  1J9A A;  4B8A B;  3OS1 A;  4HTU A;  1NJW A;  2DTU A;  3S9H A;  1NK9 A;  1KLM A;  1X9S A;  3K58 A;  4FJK A;  2QKK A;  3LP1 A;  2F8S A;  3OYC A;  2B6A A;  3VQ9 A;  1FKO A;  3HST B;  1NK7 A;  3QEW A;  1U49 A;  1WSH A;  2YNH A;  3PUF A;  4FJN A;  4Y1C A;  1HMV A;  3HL8 A;  1ZBI A;  1VSI A;  1FXX A;  2YNF A;  3ZSV A;  3V9S A;  1RT2 A;  1TAQ A;  3OS0 A;  1T05 A;  4K8Z A;  3CM5 A;  4E89 A;  4CJT A;  5KTQ A;  4DSL A;  3V1O A;  4CGF A;  5KRT A;  4GMJ B;  2P5O A;  4HUE A;  3PO5 A;  1NKB A;  4R5P A;  3TAE A;  1RTD A;  3AVL A;  4CJ4 A;  2P5G A;  1WNS A;  4N56 A;  4Z4C A;  4W5O A;  5DMR A;  3PO4 A;  2DFE A;  3OYA A;  3PX0 A;  1QTM A;  1TKD A;  5FRN A;  3HK2 A;  1CLQ A;  2F96 A;  3VQE A;  4OVL A;  5I3U A;  1HYS A;  3NF9 A;  3CFR A;  1RT1 A;  3ZT2 A;  3AVJ A;  1X1P A;  1L3V A;  3L2V A;  3TAF A;  3KK2 A;  3OYL A;  3UIQ A;  3SI6 A;  4F3T A;  4AHS A;  4DSE A;  4M3Y A;  2KTQ A;  4M3R A;  4CHP A;  4DTX A;  3RRH A;  1UA1 A;  1NK0 A;  2IOC A;  4CE9 A;  4YNQ A;  4EP4 A;  4CEB A;  1SL0 A;  3NF7 A;  4LSL A;  1SL2 A;  3OJS A;  2OPR A;  4FJH A;  1ZBH A;  3OYK A;  4N5S A;  2HHX A;  4DTO A;  2PYL A;  4FJ9 A;  4B9S A;  3THV A;  3QLH A;  1UA0 A;  1KVA A;  4DFM A;  3MEC A;  3O3G A;  3C6U A;  3WNH A;  3ITH A;  3AA4 A;  4DS4 A;  2HVH A;  4O0I A;  4C8L A;  1WSG A;  3LP0 A;  1L3T A;  3KD5 E;  4J2A A;  4FZY A;  3DRR A;  2BE2 A;  3L3V A;  4AHC A;  5SZT A;  4JRQ A;  4AIL C;  1J5O A;  4BDP A;  1L3S A;  3M8R A;  3HO1 A;  4CJS A;  4OLA A;  3NH0 A;  4F2R A;  2KW4 A;  2YKM A;  5HRR A;  3SV4 A;  3OJU A;  3VQ7 A;  2XY7 A;  3O3F A;  3U3Y A;  5CY4 A;  3QO9 A;  4ZHR A;  4FJM A;  3OYB A;  3HPO A;  4DSI A;  3G0Z A;  4CF9 A;  1D9D A;  3NAE A;  4B9U A;  4ID1 A;  3SPZ A;  4KV8 A;  3SCX A;  2BDP A;  5HBM A;  2G8U A;  2X78 A;  4DG1 A;  4M3T A;  3LWM A;  3ASM A;  1NK6 A;  3VQB A;  3DRP A;  4E3S A;  1U48 A;  3NGY A;  3K2P A;  4CGJ A;  4I9L A;  3IG1 A;  3U3G A;  4KKO A;  4FM0 A;  4OGC A;  4HVJ A;  3HYF A;  3SUQ A;  2OA8 A;  2RPI A;  3VQ6 A;  1BCO A;  3OS2 A;  1KSP A;  4CK3 A;  1REV A;  5HLF A;  2XO7 A;  1RT7 A;  3QIN A;  2XY5 A;  5HRO A;  2PYJ A;  4OKJ A;  2E6L A;  1QQC A;  3AO4 A;  4E7I A;  4DU1 A;  3QIO A;  4CF1 A;  1K6Y A;  2YV0 X;  1A5X A;  3KLG A;  4EP5 A;  3NDK A;  3DOL A;  1VRU A;  3P83 D;  2F8T A;  1D5A A;  4DU4 A;  3AA5 X;  3VQQ A;  2HHU A;  4E1N A;  1U4B A;  4BDZ A;  1RDA A;  3ISN C;  1NOZ A;  3QEX A;  4BE2 A;  4CF2 A;  3ZSX A;  3V81 A;  3ZSZ A;  3LZJ A;  1QSY A;  3AVC A;  2DFF A;  4WE1 A;  4LH4 A;  1C0M A;  3AO1 A;  3F9K A;  4O44 A;  4CJW A;  1NKC A;  4OKE A;  1ZBL A;  3AVN A;  4B9N A;  1S9G A;  2FC0 A;  1QS4 A;  1F21 A;  1TK5 A;  1W9H A;  4TSX A;  4FJL A;  1HJR A;  4B9M A;  4N76 A;  1EX4 A;  2VG5 A;  1RT5 A;  4BE0 A;  1IKW A;  3S3N A;  1RBT A;  1T03 A;  2Q3S A;  2G8F A;  3AA3 A;  4FJI A;  5J2N A;  1KFS A;  2O4I A;  3OYG A;  4JS5 A;  3CM6 A;  3QNO A;  5HRP A;  1ZBU A;  4B3O A;  3KTQ A;  5EU7 A;  4DQP A;  4QAG A;  1HQE A;  3LP3 A;  3T19 A;  4OLB A;  1VSM A;  1IKY A;  5CZ2 A;  1XHZ A;  4O5B A;  3OY9 A;  4J2B A;  1WLJ A;  4BWJ A;  2HHV A;  1S5J A;  2B4J A;  1U45 A;  1I39 A;  4Z4E A;  3DOK A;  4E7L A;  4B8C A;  5FRO A;  1ZYQ A;  1BHL A;  2KZM A;  1BIS A;  4H4M A;  4LH5 A;  3OYF A;  1RDC A;  3AVI A;  2PZS A;  1BI4 B;  4LD0 A;  3OYN A;  1Y97 A;  4F8R A;  2ZQB A;  3SJJ A;  3PY8 A;  4FYD A;  4CHY A;  2D0C A;  4LSN A;  4HUG A;  1QSL A;  3B6O A;  1C1A A;  2W42 A;  3VA0 A;  2XHB A;  4N41 A;  4QCL A;  2OPS A;  3LZI A;  1TL1 A;  4CEE A;  1WSE A;  4ZTJ A;  1YTU A;  2HVI A;  1S1U A;  4YFU A;  3QEP A;  3K5O A;  1VSD A;  4Z4G A;  3ZT4 A;  4RW7 A;  3EZ5 A;  1N5Y A;  1TKZ A;  2OPP A;  3C95 A;  4Z4I A;  1LWF A;  2HB5 A;  3C6T A;  4UQG A;  3O4N A;  4CJQ A;  4KHQ A;  1C1C A;  4DTR A;  1IKV A;  1O1W A;  3TAB A;  1C0T A;  2EHG A;  1EP4 A;  4PA1 A;  3OYI A;  1DTQ A;  1VSJ A;  4IDK A;  1ASU A;  4FLZ A;  3NGI A;  4FLT A;  4DFP A;  2HHQ A;  4B9V A;  4QOZ B;  4EZ9 A;  3SUP A;  3DI6 A;  4DQS A;  2KZZ A;  3PX4 A;  1SV5 A;  4O55 A;  5HP1 A;  4FK0 A;  2D5R A;  1JL1 A;  3AVA A;  3K59 A;  1NJZ A;  2HMI A;  4M3W A;  4DTU A;  3L2U A;  1CXU A;  3CFP A;  3LAM A;  3NCI A;  1FKP A;  3TAG A;  1J53 A;  3CG7 A;  4Z0U A;  3VQ4 A;  2ZD1 A;  5T7B A;  1TK8 A;  2O4G A;  4KHS A;  1BGX T;  3VQA A;  2FBV A;  4JS4 A;  3IS9 A;  3AVM A;  4CHO A;  4NCG A;  3RWU A;  3M8Q A;  4C8O A;  4ELU A;  4KI6 A;  3QEI A;  3V9X A;  1U04 A;  5SWM A;  3WNE A;  5FRM A;  1TVR A;  1RBU A;  3L2W A;  4CIF A;  3KLH A;  3KLE A;  3TAP A;  3K5N A;  4CEC A;  3SNN A;  4FJ8 A;  2HND A;  1DTT A;  4B9L A;  1WAJ A;  2RKI A;  3OYJ A;  4FZX C;  4IKF A;  4NCA A;  4CFD A;  2KQ2 A;  1VSE A;  4DQI A;  4KHW A;  3A2F A;  1S1V A;  3SUO A;  1A5W A;  2HNZ A;  3QIP A;  2Y1I A;  1HPZ A;  2D0A A;  4CCH A;  3NH2 A;  3D45 A;  1UOC A;  4MQ3 A;  4KRF A;  3AVH A;  1RBR A;  1TKX A;  3NGZ A;  1CZB A;  1C0U A;  4CEQ A;  1RTI A;  4I7F A;  4CER A;  4CFA A;  3WNF A;  4CJR A;  3I8D A;  1EKE A;  1N6Q A;  4DTS A;  5J2Q A;  4C8M A;  3CFO A;  3VA3 A;  3LWL A;  1VSF A;  2E6M A;  1B92 A;  2JGU A;  1Z25 A;  3MEE A;  1TKT A;  4ID5 A;  4KAZ A;  4PY5 A;  4MFB A;  3NF8 A;  5K14 A;  4DF8 A;  3SV3 A;  2YHA A;  4M45 A;  1CXQ A;  3IAY A;  4FLU A;  1BI4 A;  3QER A;  3TR8 A;  1BQM A;  4W5N A;  2RN2 A;  1DLO A;  4DS5 A;  1SKW A;  1MU2 A;  3MXI A;  4O4G A;  1LW2 A;  3NHG A;  1S6P A;  3V9U A;  2A1R A;  1TL3 A;  3LP2 A;  3ZT1 A;  4KTW A;  4KB0 A;  3AVB A;  3I0S A;  1G15 A;  1TGO A;  3IRX A;  4Y1D A;  4FM1 A;  4CGD A;  1RCH A;  3DLB A;  4I9Q A;  4CHN A;  3MAQ A;  3M8P A;  4CJL A;  4F3O A;  4KTQ A;  2WOM A;  1ITG A;  3OYD A;  5I42 A;  4IBN A;  1NK8 A;  3P1G A;  2X6S A;  1BIU A;  1ASV A;  1JXB A;  1VSL A;  4FJ5 A;  3ZSR A;  4CF0 A;  1NJY A;  2OYQ A;  1IO2 A;  3C94 A;  4CJK A;  3BDP A;  2IGI A;  4DF4 A;  1T8E A;  2PY5 A;  3HP6 A;  4Z4H A;  4E7H A;  4GW6 A;  1SKS A;  4CF8 A;  4CIE A;  4XIU A;  4KRE A;  3VQC A;  3ZT3 A;  3K5M A;  3LPT A;  2Z1J A;  4CJ5 A;  1LWC A;  4AH9 A;  4RW6 A;  1S9E A;  3SPY A;  2ZE2 A;  4CEA A;  3U6F A;  4FK4 A;  3RMA A;  2LSN A;  1RTJ A;  2Z1G A;  1NK4 A;  3HT3 A;  4DQR A;  3RTV A;  4DSJ A;  1GOB A;  3MED A;  4FJX A;  3VN5 A;  3WNG A;  4PQU A;  4AHU A;  4KTZ A;  4CIG A;  4FLY A;  4CFC A;  1XHX A;  1RBS A;  2Z1H A;  3DYA A;  1NK5 A;  1YT3 A;  3HXM A;  3DLE A;  3SZ2 A;  3TAR A;  4KB1 A;  1IH7 A;  4DU3 A;  2G8I A;  1JXE A;  3DLR A;  4M3X A;  4ICL A;  2HHW A;  1I3A A;  1RT3 A;  1C1B A;  1Z26 A;  3NFA A;  3P5J A;  4W5Q A;  3TAN A;  2VWJ A;  4DFK A;  2IAJ A;  4C8N A;  3DMJ A;  3HVT A;  1TAU A;  3VQ8 A;  1S6Q A;  3QEV A;  1RNH A;  3JSM A;  3AO3 A;  4CJP A;  4E19 A;  3TI0 A;  1HNV A;  4CGI A;  4DLG A;  3O4Q A;  4M42 A;  2XRI A;  1JLC A;  1CZ9 A;  4HCB A;  3T3F A;  4B08 A;  4OKK A;  2XY8 A;  2QXF A;  3ZCM A;  1GOA A;  3HP9 A;  4RW4 A;  3HVR A;  4FLW A;  4BWM A;  2DY4 A;  2IC3 A;  2VG7 A;  5DK5 A;  3MXJ A;  1WSJ A;  4F2S A;  3F73 A;  5CYM A;  3RMB A;  4DQQ A;  1NKE A;  3AVK A;  4ELV A;  3L2Q A;  1WN7 A;  3VQP A;  1KVC A;  3NH1 A;  1NOY A;  5CZ1 A;  5JS2 A;  1RBV A;  4HCC A;  4Z4F A;  2X74 A;  3HPH A;  1VSK A;  2FBX A;  4BE1 A;  2ATQ A;  3JYT A;  2IS3 A;  3DLK A;  3OYE A;  3BGR A;  3LAK A;  3NE6 A;  3KKR A;  4FCY A;  2P51 A;  3AVF A;  2HW3 A;  1SL1 A;  4Q0B A;  5J2P A; 
#chains in the Genus database with same CATH topology
 2ASO A;  3UE5 A;  1VAZ A;  3H08 A;  3L4I A;  2DFH A;  4OGE A;  3CD6 N;  1GOC A;  4RCH A;  5HRN A;  1XMO K;  1JLA A;  3CQ8 A;  4IG3 A;  1VQ8 N;  3S3O A;  4FJ7 A;  4CEZ A;  4WFN L;  2G8W A;  3WXL A;  2G8H A;  3ENB A;  1TK0 A;  3H1Q A;  4CEF A;  1VQL N;  1HRH A;  3QIC A;  1TUU A;  1BDG A;  2G8V A;  1NJI O;  5C24 A;  4FJJ A;  1KVB A;  3V4I A;  3CC4 N;  4M3U A;  2GWJ A;  5KQ8 A;  5J2M A;  1RDB A;  2BAN A;  3V9W A;  4BG8 A;  1D8Y A;  3L3U A;  4NYN A;  3HM8 A;  5E84 A;  3G10 A;  3PSF A;  1BUP A;  1LW0 A;  2VGN A;  1FK9 A;  4Q5V A;  3VES A;  4H03 B;  4F4K A;  2X6N A;  4JEP A;  3ZSY A;  3WEE B;  3MX2 A;  4BR7 A;  3VQ5 A;  2OZM A;  2I5J A;  4DWI A;  1JLQ A;  3ZSO A;  1OVY A;  1S1W A;  4E0D A;  4L3Q A;  3ULE A;  1TYQ A;  4YHH K;  3QFP A;  2VG6 A;  1U47 A;  3LL3 A;  3P4I A;  3O1W A;  4JN4 A;  1YJW N;  1Y64 A;  1YVU A;  3V1R A;  3P31 A;  3ULD A;  1JLE A;  2E2O A;  5AQH A;  2DPN A;  3KLI A;  3NF6 A;  3DRS A;  1IKX A;  3H46 O;  4CEO A;  1C6V A;  3ZT0 A;  4FXD A;  3D0P A;  3AA2 A;  3HTV A;  4FM2 A;  4CFB A;  4R79 A;  4BQZ A;  3KD1 E;  1KCF A;  5D3G A;  3I33 A;  4EHT A;  3N4Q A;  4W5R A;  3MXM A;  4JV5 K;  4RG8 A;  4BR2 A;  1L3U A;  1RTH A;  2B5J A;  3PV8 A;  4PUO A;  2QKB A;  3OVN A;  1JKH A;  4GY2 B;  2YKN A;  4J2D A;  4A57 A;  3HZ6 A;  4H4O A;  5CYQ A;  3SQ4 A;  3SMS A;  5AFU A;  2NRW A;  1Z6R A;  5EX5 A;  4CGG A;  3ZSQ A;  2HHS A;  5KGX A;  2HF3 A;  4KI4 A;  4BQL A;  5KRS A;  1RDD A;  2GUI A;  3R9P A;  4CJV A;  2R7Y A;  3GDQ A;  3QET A;  2BTF A;  1NJW A;  3S9H A;  2O8B A;  4O5F A;  2QKK A;  3LP1 A;  4YY3 K;  4JI3 K;  3HST B;  1NK7 A;  1U49 A;  2YNH A;  3PUF A;  1HMV A;  1VSI A;  3UB5 A;  3WXJ A;  1GLD G;  3V9S A;  1RT2 A;  3E9P A;  4OO1 J;  4CZJ A;  4DSL A;  4MO4 A;  3C6A A;  4HUE A;  4R5P A;  5BRD A;  2HBL A;  3O08 A;  3U9D A;  3M5R A;  4N56 A;  1ZXO A;  3LDP A;  5EXW A;  3BY5 A;  3VQE A;  2JWL A;  5I3U A;  3AGK A;  1X1P A;  3OYL A;  2ASM A;  4H0P A;  5JLH A;  2W41 A;  4DSE A;  2P9L B;  4YNQ A;  4FOE A;  4CEB A;  3AY9 A;  3NF7 A;  3BEX A;  3OJS A;  4FJH A;  4LFC K;  2PYL A;  1HKC A;  2FLO A;  1KVA A;  3CJA A;  4DFM A;  3SBG A;  2P9I A;  5AQJ A;  3WNH A;  3ITH A;  4BRF A;  4O0I A;  2CH6 A;  4WQ5 A;  3S41 A;  3ID6 A;  3KD5 E;  4MDB A;  3M8R A;  3HO1 A;  4CJS A;  2YKM A;  5HRR A;  4JYA K;  2XY7 A;  4ZHR A;  2HST A;  4DSI A;  3G0Z A;  4KBO A;  5KQD A;  4ID1 A;  4B9U A;  4ILJ A;  3SPZ A;  3SCX A;  5HBM A;  4ILG B;  3VQB A;  3MDQ A;  3ATU A;  2Q97 A;  2RPI A;  3OS2 A;  4K43 A;  5HRO A;  2PYJ A;  4OKJ A;  4RWT A;  3MX5 A;  2O8D A;  3LDO A;  3KLG A;  4EP5 A;  3NDK A;  3EL2 A;  1VRU A;  4IZ9 A;  1U4B A;  1RDA A;  4BE2 A;  4CF2 A;  3AVC A;  4WE1 A;  2E5L K;  5IT9 O;  3AO1 A;  1NKC A;  4CJW A;  1ZBL A;  3AVN A;  2P9P B;  4JI4 K;  2WTU A;  2VG5 A;  4BE0 A;  3K0S A;  1IKW A;  1RBT A;  4NLC A;  3AA3 A;  4CZG A;  1KFS A;  4FO0 A;  1KXP A;  3CM6 A;  4QAG A;  1HQE A;  3CCV N;  1VSM A;  2E2Q A;  5CZ2 A;  5BN8 A;  3AGR A;  1WLJ A;  4Z4E A;  2B4J A;  4DUY K;  4E7L A;  4B8C A;  1N32 K;  4F9O A;  2GWK A;  1BIS A;  3OYF A;  4DR3 K;  3AVI A;  2ZM6 K;  2PZS A;  1T3V A;  3OYN A;  1Y97 A;  4F8R A;  2ZQB A;  5AQM A;  4FWM A;  4FYD A;  3B6O A;  1C1A A;  3MN9 A;  2W42 A;  3D6R A;  2GUP A;  3LZI A;  4CEE A;  1WSE A;  4BRL A;  1YTU A;  1EO1 A;  3QEP A;  3ZT4 A;  3J81 O;  4GNI A;  4JK8 A;  5B8H A;  1VQP N;  4Z4I A;  1LWF A;  2HB5 A;  4CJQ A;  4KHQ A;  4NXM K;  3T1H K;  3TAB A;  4PA1 A;  3OYI A;  1E3M A;  1DTQ A;  3SMP A;  2QM1 A;  1I94 K;  3CCU N;  3SLC A;  4B9V A;  1YHQ N;  3THY A;  3D2F B;  4V19 S;  1VHX A;  4DQS A;  1SV5 A;  5HP1 A;  2D5R A;  2W40 A;  3AVA A;  1NJZ A;  4DTU A;  2QWL A;  3CFP A;  1FKP A;  1X9J A;  4IOX A;  1RDW X;  4KHS A;  2QTD A;  2FBV A;  4IO9 L;  3RVC A;  3AVM A;  4CHO A;  4NCG A;  4ELU A;  5FRM A;  3WNE A;  5CR4 A;  3R3L A;  3KLE A;  3K5N A;  2P9U A;  1DTT A;  3WXI A;  4IKF A;  4DQI A;  3OBY A;  3QIP A;  1ATS A;  4K42 A;  4KH5 A;  2D0O A;  4MQ3 A;  4KRF A;  3AVH A;  1RBR A;  1TKX A;  1NK8 A;  4DQP A;  1N6Q A;  3WNF A;  3C7N B;  5HOO A;  3FR0 A;  3CFO A;  3LWL A;  4LC9 B;  5C12 A;  1Z25 A;  2VWB A;  3MEE A;  4X62 K;  4KAZ A;  1K73 O;  5AQF A;  5FPM A;  4CD3 A;  5K14 A;  1HKB A;  2YHA A;  4M45 A;  1VQ5 N;  3THW B;  1EQY A;  3QER A;  4XH5 A;  2A41 A;  4O8U A;  2V51 B;  1C0F A;  3MXI A;  3V9U A;  1W97 L;  3D2E B;  3IRX A;  4BRM A;  4CJL A;  5I42 A;  3DAW A;  5AR0 A;  1ASV A;  4FJ5 A;  3H6E A;  4DF4 A;  1JCF A;  2ZGY A;  3KVG A;  1SKS A;  5KPR A;  2A42 A;  3ZT3 A;  4CJ5 A;  4PKH A;  4BRA A;  4FK4 A;  1S9E A;  3U6F A;  2LSN A;  1HX1 A;  1GOB A;  2E1Y A;  1GLE G;  2FSN A;  3CQX A;  4AHU A;  4CIG A;  1RBS A;  2O8F A;  2HOE A;  3TAR A;  2G8I A;  3DLR A;  1I3A A;  1Z26 A;  4W5Q A;  3A0I X;  3P5J A;  1NMN A;  5EY4 A;  3HVT A;  1TAU A;  2KHO A;  3J7Z O;  3CME N;  2W6K A;  4YDU A;  3JSM A;  3AO3 A;  4CJP A;  4CGI A;  1JLC A;  1Q81 O;  3T3F A;  4HCB A;  4OKK A;  3EEQ A;  4RW4 A;  3VTI A;  5JLF A;  3HVR A;  4FLW A;  3LDL A;  3RMB A;  4DQQ A;  3L2Q A;  1BG3 A;  2JWK A;  3NH1 A;  1XC3 A;  3HPH A;  2UXC K;  1NWK A;  3CMA N;  3CF5 L;  4WCE L;  3OYE A;  3KKR A;  4FCY A;  3CCL N;  2P51 A;  4JK9 A;  3VEZ A;  3DM2 A;  4BR0 A;  1ATN A;  3OYM A;  5E41 A;  4H0X B;  5GAE P;  5M1P A;  2UU9 K;  2WON A;  3FZH A;  4EIA A;  5BPN A;  2FSJ A;  3HOS A;  3UKR A;  4FW2 A;  1ATR A;  1L5U A;  2CGL A;  3U8X A;  1NGI A;  1ILY A;  4B1Y B;  4JI8 K;  4K8X A;  2HNY A;  4AHR A;  3LDS A;  1KRP A;  1B9F A;  3GOI A;  3BF3 A;  4BRD A;  3SAG A;  3G71 N;  4DMN A;  5JS1 A;  4JKH A;  1J6Z A;  3ZYY X;  5C2F A;  4KHU A;  2BUP A;  1HKG A;  5AQL A;  3KJV A;  3A5M C;  4J2E A;  3K57 A;  3SQ1 A;  1LAV A;  3ZLJ A;  4CJ3 A;  4GV9 A;  3BP8 A;  4HUF A;  4E7J A;  3T1A A;  3KLF A;  4IFY A;  1R0A A;  5AQZ A;  2OZS A;  3JS6 A;  2RHK A;  3SQ2 A;  3EY1 A;  4M3Z A;  3H3O B;  3P38 A;  3S3M A;  3SYZ A;  3MK6 A;  1Q86 O;  3KK1 A;  2ZWH A;  3EZW A;  2E4L A;  1V4S A;  3UKU A;  1EXQ A;  3RRG A;  1NJX A;  3ATV A;  2G8K A;  1GLB G;  4NB4 A;  4JKD A;  4QS9 A;  3ZET A;  1X9W A;  4KO0 A;  4EZ6 A;  2YNI A;  2FBT A;  1LWE A;  4CHQ A;  3KIO A;  3W3D A;  5LJW A;  1HLU A;  1Q9X A;  3E1Y A;  2EX3 A;  4NYF A;  2XY6 A;  3M1F A;  1A5V A;  1RGI A;  1EET A;  2QK9 A;  1HYV A;  1K9M O;  4L8R B;  2F4V K;  3KK3 A;  2UYT A;  3K5L A;  1U6Z A;  1Q8I A;  2HHT A;  3PX6 A;  4JRP A;  3B6P A;  3RR8 A;  2BGG A;  1JCG A;  4DFJ A;  3HPG A;  1YF5 L;  4DLE A;  2E2N A;  3CCJ N;  3LPU A;  4YOX A;  1MA9 B;  1HNZ K;  4IG0 A;  4W5T A;  3FFK B;  4O8K A;  1YI2 N;  2HBK A;  3CJB A;  3ALY A;  1N8R O;  5KI6 A;  3LAN A;  3RMC A;  1W0H A;  4BC5 A;  4XH1 A;  4FLV A;  1J9A A;  4HTU A;  4WFB L;  2DTU A;  1VQ7 N;  2Q31 A;  5LMU K;  1WBB A;  1KD1 O;  1NK9 A;  1X9S A;  3K58 A;  3CHW A;  3WEE A;  4CZF A;  3QEW A;  2Q0U A;  4Y1C A;  3HL8 A;  3R8E A;  3ZSV A;  1TAQ A;  4X64 K;  2CH5 A;  5I9E B;  4GMJ B;  4BRG A;  3PO5 A;  1HPM A;  3O6W A;  4FPB A;  1RTD A;  3VER A;  3AAR A;  3TSQ A;  1WNS A;  4OPH A;  4Z4C A;  1ZBS A;  4YOR A;  3PO4 A;  1WOQ A;  2DFE A;  4CW7 B;  3OYA A;  3HK2 A;  1FW6 A;  1CLQ A;  4OVL A;  1HYS A;  2NRX A;  5M1N A;  2QWM A;  3L2V A;  4BRO A;  3TAF A;  3UIQ A;  1V4T A;  4AHS A;  4CHP A;  4B3M K;  3H3N O;  1ZBH A;  4M63 C;  3OYK A;  2HHX A;  5LY3 A;  3G4S N;  4Z94 A;  1NGJ A;  3THV A;  1UA0 A;  2WFB A;  4BRE A;  3F2K A;  3MEC A;  4C8L A;  1L3T A;  4FZY A;  4JRQ A;  2BE2 A;  3L3V A;  4AHC A;  4AIL C;  1IBL K;  3CC2 N;  1K8A O;  4BDP A;  4KHP K;  1KAX A;  2KW4 A;  5EVZ A;  3OJU A;  3F9M A;  3O4W A;  3QO9 A;  5AQU A;  3OYB A;  4JI0 K;  3NAE A;  1GLL O;  4KV8 A;  4FWS A;  2G8U A;  4M3T A;  3SBT A;  3LWM A;  1NK6 A;  5JVG L;  4E3S A;  3NGY A;  3K2P A;  3THX B;  1NG9 A;  3VOV A;  1OH5 A;  4KKO A;  2PBD A;  3SUQ A;  5BRH A;  3I8B A;  3VQ6 A;  1BCO A;  2QWP A;  4CK3 A;  1BA1 A;  1REV A;  5HLF A;  2XO7 A;  1S3X A;  3AO4 A;  1QQC A;  4E7I A;  4JKE A;  2YI1 A;  4CF1 A;  4U67 L;  3I55 N;  1K6Y A;  4WFA L;  3ZEU B;  1VQ4 N;  1D5A A;  3AA5 X;  4K41 A;  2HHU A;  2QXL A;  4BDZ A;  4GKJ K;  3ISN C;  1BO5 O;  3PIO L;  3ZSZ A;  1QSY A;  1QVF M;  4H0O A;  3F9K A;  4OKE A;  4AQY K;  2FC0 A;  2I7P A;  4TSX A;  4DV2 K;  4N76 A;  1EX4 A;  2P9L A;  3VF2 A;  3QFU A;  2Q3S A;  4CZK A;  4A5B A;  2QWN A;  2E88 A;  5ADX H;  2O4I A;  3OYG A;  4A2A A;  3KTQ A;  1K8K B;  3E9O A;  1IKY A;  1XHZ A;  4O5B A;  4J2B A;  3VEW A;  4FWR A;  2AA4 A;  4LF7 K;  1ZYQ A;  5AZI B;  4EAH D;  3CCR N;  3TU5 A;  4OX9 K;  2D0C A;  2XHB A;  3J80 O;  3IFR A;  1YJN N;  2HVI A;  2V7Z A;  3EO3 A;  4YFU A;  4Z4G A;  1TKZ A;  2OPP A;  1WBD A;  1IKV A;  4AF1 A;  2EHG A;  1EP4 A;  1E4G T;  1VSJ A;  1W2B M;  2D1K A;  4FLT A;  4DFP A;  4QOZ B;  2P9N B;  2OTL N;  5E26 A;  1GLF O;  1JL1 A;  2QA4 N;  5BRE A;  2HMI A;  1CXU A;  3LAM A;  3NCI A;  2VYP A;  3TAG A;  1J53 A;  3CG7 A;  1TK8 A;  1DEJ A;  3IS9 A;  3M8Q A;  4C8O A;  4EHU A;  1XUP O;  2A40 A;  3SAH A;  1U04 A;  4X66 K;  1TVR A;  2P9P A;  3TAP A;  3KLH A;  3U4L A;  4FJ8 A;  3IMX A;  4B9L A;  1WAJ A;  3OYJ A;  4FZX C;  4YOV A;  4CFD A;  1VSE A;  1SZ2 A;  3A2F A;  1S1V A;  3SUO A;  2Y1I A;  3MN5 A;  2D0A A;  3D45 A;  5AQT A;  2YJE A;  3A5N C;  1CZB A;  4PL7 A;  2IVN A;  4BVO A;  4IJA A;  4YOY A;  4IWV A;  5DM6 L;  4UY8 O;  1P8Z A;  5J2Q A;  3I56 N;  1VSF A;  2E6M A;  4BY9 C;  1W7A A;  2FF3 B;  2YHY A;  5ELZ A;  2UXB K;  2GTD A;  3A8Y A;  1BQM A;  2RN2 A;  4JKC A;  1DLO A;  3C65 A;  4DS5 A;  1SKW A;  1EWQ A;  3LP2 A;  3ZT1 A;  1OH8 A;  1DT9 A;  4KB0 A;  3AVB A;  5BPM A;  1G15 A;  3CCS N;  3DLB A;  4IFE A;  2FSK A;  1QQM A;  2ZGZ A;  3OYD A;  3P1G A;  4FVU A;  1MDU B;  3ZSR A;  4CF0 A;  1NJY A;  2PAV A;  1IO2 A;  3CJC A;  3MWP A;  5JMV A;  3CCE N;  4GW6 A;  3D2F A;  3VGM A;  4CF8 A;  4CIE A;  1GLA G;  1YJ9 N;  3O9S A;  2WC9 A;  3SPY A;  4AH9 A;  2ZE2 A;  1RTJ A;  1NK4 A;  4DQR A;  4FJX A;  3VN5 A;  4FLY A;  3B8A X;  3Q7C A;  5C2D A;  2WUS A;  2Z1H A;  3DYA A;  1YT3 A;  5BPL A;  1D4X A;  3FGU A;  4DFK A;  2IAJ A;  3DMJ A;  1VQO N;  1S6Q A;  3QEV A;  1RNH A;  1KAY A;  3EKS A;  4DLG A;  5AQX A;  4WF9 L;  3O4Q A;  3C7N A;  3FE1 A;  4C1N K;  1OH6 A;  2XY8 A;  3ZCM A;  1GOA A;  3HP9 A;  1KC8 O;  3BUZ B;  2O8C B;  1XMQ K;  3MXJ A;  3HI0 A;  3F73 A;  3THW A;  3VQP A;  1SS6 A;  1KVC A;  1NOY A;  4Z4F A;  2X74 A;  1VSK A;  4YOW A;  3OBW A;  4BE1 A;  4I6M B;  5AJ3 K;  4CZE A;  1NGB A;  4CVN E;  4GKK K;  2CGK A;  3BGR A;  2YX6 A;  3GBT A;  3CXC M;  3D2E A;  5C15 A;  3VF4 A;  1SL1 A;  1RFQ A;  5J2P A;  2AP1 A;  4BDY A;  4LFA K;  2E20 A;  3OYH A;  3DLG A;  2HF4 A;  4FWK A;  4C8K A;  4LF9 K;  1NGC A;  4KHY A;  3K9J A;  3VQD A;  1SAZ A;  5LMN K;  1M90 O;  3VGL A;  1CZA N;  3QBX A;  1QZ6 A;  2YJF A;  3CPE A;  1KAZ A;  1ESV A;  4DV4 K;  4CHZ A;  2P1J A;  3HJF A;  1JLF A;  3G6E N;  4DSF A;  4E1J A;  4CBX A;  4B9Q A;  3KHY A;  4FW1 A;  1Q82 O;  1WSI A;  1UWB A;  1JLG A;  1LOT B;  1Q18 A;  3AO2 A;  4JAX A;  1HQU A;  4B3T K;  3BZK A;  3KK7 A;  5BRF A;  4FWQ A;  5C25 A;  3TAM A;  3E66 A;  3U9Z A;  1YUW A;  1HJO A;  3FFI A;  2ZJP L;  5AQY A;  4M7X A;  1N33 K;  3RSE B;  4CJ7 A;  3AO5 A;  1QE1 A;  4PL8 A;  2YHB A;  3AVG A;  4CJE A;  4DSK A;  1YTA A;  4WQ4 A;  4BGB A;  2QEX N;  3SQ0 A;  3TSU A;  2KFZ A;  1HUX A;  4JI6 K;  4ZTF A;  3P39 A;  4OLB A;  3FLC O;  2AJQ A;  4RW8 A;  2NRV A;  4JLH A;  3CYM A;  1Q9Y A;  4LF5 K;  3KWG A;  4N47 A;  3TTC A;  4MLE A;  4LF4 K;  1ASW A;  4AHV A;  1RT4 A;  4CJF A;  1BIZ A;  4BRK A;  4CGH A;  3O9Q A;  4AHT A;  1ZBF A;  3O9T A;  4JD2 B;  1RIL A;  2VGM A;  1LAW A;  1SKR A;  2A1S A;  3SUN A;  4CJU A;  4G1Q A;  4E1M A;  1VRT A;  3ZX2 A;  1WSF A;  1WAF A;  4LY7 A;  4WQ5 C;  4DTN A;  4JKG B;  4BAC A;  2ETJ A;  4GVE A;  1QHT A;  2KFN A;  4OPK A;  4JNE A;  3O3H A;  3TWH A;  5KPT A;  3C0B A;  1BOT O;  3MEG A;  3NBP A;  4FOI A;  4DTP A;  3PLA A;  4AM6 A;  4DR7 K;  1B9D A;  1KTQ A;  2A5X A;  4DV5 K;  3OA9 A;  4KFB A;  4DTM A;  5AFU H;  3O80 A;  3J7A P;  4OJR A;  4M41 A;  1X9M A;  5TKY A;  4B8A B;  2O8E B;  4JKF A;  1KLM A;  4EFH A;  3OYC A;  3T1Y K;  3VQ9 A;  1QVG M;  5AQV A;  4A2B A;  3WQT A;  1WSH A;  4FJN A;  1FXX A;  1U2V B;  3OS0 A;  4K8Z A;  4E89 A;  4CJT A;  5KTQ A;  4CGF A;  2A6A A;  2P5O A;  4DR5 K;  1NKB A;  4K0K K;  4CJ4 A;  5AQN A;  3QB0 A;  2Q2R A;  4BG9 A;  4W5O A;  5DMR A;  2NRZ A;  1BA0 A;  3PX0 A;  5FRN A;  2F96 A;  3NF9 A;  4BRI A;  3ZT2 A;  2YCH A;  3KK2 A;  3SI6 A;  4BR9 A;  3QML A;  4F3T A;  2OTJ N;  3DXK B;  4M3Y A;  2KTQ A;  4M3R A;  1NK0 A;  4M7Y A;  4EP4 A;  5M1Q A;  1Q7Y O;  2OPR A;  4N5S A;  3HOT A;  4B3R K;  1DKG D;  4FJ9 A;  4B9S A;  3QLH A;  5BR8 K;  3C6U A;  1NU0 A;  2HVH A;  4HWI A;  3O5B A;  1WSG A;  3LP0 A;  3DRR A;  5SZT A;  1J5O A;  4B1V A;  4DUZ K;  1L3S A;  1YXQ A;  5CY4 A;  1XQS C;  4FJM A;  3HPO A;  2F9W A;  4CF9 A;  3R6M A;  3EKU A;  2BDP A;  3EN9 A;  2X78 A;  3ASM A;  1BU6 O;  3FZM A;  3VTH A;  5F0X A;  1XNQ K;  1FJG K;  3O9R A;  2GEM A;  3ENH A;  3IG1 A;  3MWT A;  4FM0 A;  4OGC A;  4HVJ A;  3HYF A;  1HR0 K;  4PKI A;  2RE2 A;  1KSP A;  3KWI A;  1NGG A;  3QIN A;  4JKA A;  2E6L A;  1T6C A;  4DU1 A;  1A5X A;  3N4P A;  1MWK A;  4H5W A;  3DOL A;  5AQQ A;  3P83 D;  2F8T A;  4BRH A;  4E1N A;  3OTO K;  3VEY A;  3D7E O;  1NOZ A;  3QEX A;  4ILH A;  2HBM A;  2QI2 A;  4O44 A;  5GAG P;  1QS4 A;  4FJL A;  3R1X A;  1HJR A;  4BR5 A;  4B9M A;  3T7Z A;  4BRC A;  1T03 A;  4FJI A;  3QNO A;  5EU7 A;  5A2Q O;  4RTF D;  3T19 A;  4FPA A;  5CE3 A;  3OY9 A;  4BWJ A;  2HHV A;  5FPN A;  1U45 A;  1I39 A;  1BHL A;  5C10 A;  2KZM A;  4H4M A;  1RDC A;  1BI4 B;  4MO5 A;  5KPZ A;  2OAN A;  3SJJ A;  2QW9 A;  2E2P A;  5GAD P;  4CHY A;  3PY8 A;  1WB9 A;  3VA0 A;  4N41 A;  3WQU A;  4BVP A;  4PHT X;  1S1U A;  4HTL A;  2GX9 A;  4CZH A;  3AAP A;  3EZ5 A;  4RW7 A;  1N5Y A;  2V7Y A;  2KKZ A;  3C95 A;  3C6T A;  4UQG A;  4DTR A;  1O1W A;  4YOU A;  3EE8 A;  3THX A;  4IDK A;  4FLZ A;  4H5N A;  3IUC A;  3NGI A;  2VQE K;  4H5T A;  3VEV A;  3DI6 A;  5AQO A;  2H3G X;  1O13 A;  4B1W B;  4O55 A;  3VEO A;  4FK0 A;  4WYB A;  5GIN A;  3K59 A;  4IDH A;  3ZEU A;  1S72 N;  3VQ4 A;  4Z0U A;  1IG8 A;  2HMP A;  4YDU C;  2O4G A;  1BGX T;  3VQA A;  4JHD A;  5GIO A;  3O8M A;  3RWU A;  1HNX K;  5SWM A;  4LF6 K;  3DXM B;  1QQO A;  2P9K B;  2KQ2 A;  1HPZ A;  4JI2 K;  3NH2 A;  1UOC A;  3K9K A;  3FZK A;  4CBW A;  1C0U A;  4CEQ A;  1RTI A;  4I7F A;  1K8K A;  4CER A;  4CFA A;  4CJR A;  1N34 K;  4JI7 K;  4DTS A;  3VA3 A;  1JJ2 M;  1B92 A;  3M3Z A;  4CZI A;  1TKT A;  4ID5 A;  3T69 A;  2NNW A;  2P9S B;  4PY5 A;  5AZI A;  5BN9 A;  1NGF A;  4FLU A;  4G9Z A;  3Q7B A;  4W5N A;  3NVK A;  1MU2 A;  4A59 A;  2ASP A;  1LW2 A;  1S6P A;  2ZJR L;  1G99 A;  4KTW A;  2ITM A;  5AZJ B;  3C6H A;  3I0S A;  4CGD A;  4GV3 A;  4I9Q A;  3M8P A;  3M6G A;  1NMD A;  1ITG A;  4KTQ A;  3MCA B;  4IBN A;  1RDU A;  2OYQ A;  3C94 A;  2PY5 A;  2NRT A;  3HP6 A;  4Z4H A;  4JHD B;  4E7H A;  2P9N A;  4FWO A;  3CIP A;  4BRQ A;  4XEI A;  4KRE A;  1MWM A;  3MMV A;  4H0Y B;  2Z1J A;  4M3W A;  4CEA A;  3CCQ N;  3RTV A;  4DKW A;  3WNG A;  4PQU A;  2IVP A;  4BC3 A;  2Q1N A;  4KTZ A;  1XHX A;  1T44 A;  4BGA A;  3SZ2 A;  4KB1 A;  1IH7 A;  2HBJ A;  4M3X A;  1RT3 A;  3DWL A;  3NFA A;  3TAN A;  2VWJ A;  5M1O A;  4C8N A;  4FSV A;  2UUB K;  2NLX A;  4DV1 K;  1NLV A;  4E19 A;  2KLA A;  1HNV A;  1NBW A;  4BC4 A;  3CQY A;  3TI0 A;  3WUH A;  3W0L A;  1S22 A;  4IJN A;  4B08 A;  3MN7 A;  4BR4 A;  1NGA A;  5M1K A;  2VCP A;  2VG7 A;  1WSJ A;  4CD1 A;  1NKE A;  3AVK A;  4ELV A;  3ULE B;  1TYQ B;  1WN7 A;  5JS2 A;  1E4F T;  1RBV A;  3A5O C;  2ZF5 O;  3JYT A;  3DLK A;  2QWR A;  4NXN K;  3LAK A;  3NE6 A;  3AVF A;  3VMF B;  2HW3 A;  3L6Q A;  4GV6 A;  1SQK A;  3PIP L;  1NM1 A;  2IDO A;  2ITG A;  2D0B A;  4KH4 A;  5JVH L;  4FJG A;  3WXK A;  1YIJ N;  4IFV A;  3L4Q A;  1VK0 A;  3WXM B;  1TV6 A;  4NCB A;  1S1X A;  3FZL A;  3L8B A;  1KLN A;  4FK2 A;  2OPQ A;  4HHT A;  1J5E K;  3NMU A;  3CJ9 A;  2NUB A;  3LAL A;  3DJC A;  1JL2 A;  4CK2 A;  2F9T A;  1H1V A;  4K25 A;  4I2P A;  4C23 A;  2GEL A;  5FPE A;  2Y1J A;  1WUA A;  2W6L A;  2F7T A;  3RMD A;  4DV7 K;  4PWD A;  4CED A;  5HRS A;  3SJH A;  4E7K A;  4BC2 A;  1VSH A;  4FWL A;  2RF2 A;  4I2Q A;  2YNG A;  1TUY A;  2VWK A;  3EE9 A;  3QES A;  4CES A;  4B9T A;  4GVM A;  2GV9 A;  3L2R A;  4O0J A;  2NZT A;  3V9Z A;  2EWS A;  1HNI A;  4DV6 K;  4FVM A;  4H0V B;  1VQ9 N;  1T7P A;  3E01 A;  1BCM A;  3JAM O;  2O8B B;  4LFB K;  4MDA A;  2O8C A;  1BL3 A;  4KHN A;  3H45 C;  5J1E A;  5AQK A;  3NVM A;  3DLH A;  2GBZ A;  5AQR A;  4X65 K;  3RR7 A;  1J54 A;  2JLE A;  2VQF K;  3QNN A;  5KGW A;  4I6M A;  3EYZ A;  4FZZ A;  3E9L A;  1SUQ A;  3M8S A;  4DR4 K;  2FBY A;  3I0R A;  1VQN N;  4MLH A;  1IG9 A;  1HYZ A;  3GG4 A;  4RW9 A;  3TTD A;  4NLB A;  3A5L C;  4FLX A;  1GLC G;  3ZX3 A;  4CK1 A;  4DTJ A;  1QHA A;  3GL1 A;  1P90 A;  5C42 A;  3DLL L;  3TAQ A;  1JLB A;  3AV9 A;  4NO7 A;  2Z1I A;  1D9F A;  1UAX A;  3VF6 A;  1BQN A;  4KPY A;  1QSS A;  3V6D A;  5GIP A;  3HRG A;  4BRN A;  3KKS A;  2FF6 A;  3V1Q A;  5JIC A;  5FDL A;  3TTF A;  1XWL A;  3PSI A;  1NGD A;  2QWO A;  3ZSW A;  3VEX A;  2YHX A;  3J7Y P;  4OPJ A;  4H5R A;  4H8K A;  2P9I B;  3CI5 A;  1YAG A;  4ISG A;  4ELT A;  1S1T A;  1XI1 A;  1RT6 A;  1LV5 A;  2D4W A;  1JCE A;  4FWN A;  4B1Z A;  1KFD A;  4A62 A;  2A3Z A;  4Y0W A;  3RSE A;  3LM9 A;  1XC9 A;  4IOA L;  3HM9 A;  3OS1 A;  2F8S A;  4FJK A;  1OH7 A;  2B6A A;  1QQN A;  1FKO A;  3ZX0 A;  5C0Y A;  4IO8 A;  1ZBI A;  5HL7 L;  2PFU A;  2YNF A;  4JK7 A;  1T05 A;  3CM5 A;  3V1O A;  3VEN A;  5KRT A;  4H0T B;  1IV0 A;  3TAE A;  5IWA K;  3AVL A;  2O8D B;  2P5G A;  3GE1 A;  5EOY A;  4A5A A;  1DGK N;  4FWP A;  1QTM A;  1TKD A;  4JD2 A;  1IBK K;  3CFR A;  1RT1 A;  3AVJ A;  1NNE A;  1L3V A;  5F1X A;  2UXD K;  3AAQ A;  4DQ8 A;  2Q36 A;  4DV3 K;  1BWF O;  5LL6 Z;  1VQ6 N;  4DTX A;  3RRH A;  1UA1 A;  1VQM N;  2IOC A;  4CE9 A;  1SL0 A;  2IVO A;  4JI1 K;  4LSL A;  1SL2 A;  4JKG A;  2E1Z A;  4JI5 K;  4YOT A;  4DTO A;  1ZC6 A;  4KH6 A;  3TPQ A;  3BZC A;  3J8A A;  3O3G A;  3OW2 M;  3AA4 A;  4ISE A;  5FLX O;  4DS4 A;  4J2A A;  4B1U B;  3HSC A;  4OLA A;  3NH0 A;  4F2R A;  3SV4 A;  3O9U A;  3VQ7 A;  3O3F A;  3U3Y A;  4JKB A;  5BR9 A;  1D9D A;  2O8E A;  2E8A A;  4DR6 K;  4CBU A;  2OCE A;  4DG1 A;  2NRH A;  5AQI A;  3VET A;  4DR2 K;  3DRP A;  1U48 A;  4CGJ A;  4I9L A;  3U3G A;  2OA8 A;  1U2V A;  2UUA K;  3BF1 A;  1NGH A;  1RT7 A;  2XY5 A;  3THY B;  3QIO A;  2ZJQ L;  3CCM N;  2YV0 X;  1KQS M;  4DCH A;  1X3M A;  1LCU A;  4DU4 A;  3LDQ A;  3VQQ A;  4CI6 A;  3ZSX A;  3V81 A;  3LZJ A;  4CZL A;  2DFF A;  5DM7 L;  4LH4 A;  1C0M A;  5ADX A;  3CER A;  3ENO A;  1GLJ O;  4B9N A;  1S9G A;  2CGJ A;  1TK5 A;  1F21 A;  1W9H A;  3DXK A;  1X3N A;  2P9U B;  1RT5 A;  3S3N A;  2G8F A;  5J2N A;  1IBM K;  4JS5 A;  5HRP A;  2V52 B;  1ZBU A;  4B3O A;  3MN6 A;  3LP3 A;  1S5J A;  4IEI A;  3DOK A;  5H1S Q;  5FRO A;  2QWQ A;  4QS8 A;  1T6D A;  4LH5 A;  4LD0 A;  1OVQ A;  1C0G A;  2YHW A;  4LSN A;  4HUG A;  1QSL A;  5F2R A;  4FL9 A;  4IEE A;  4QCL A;  2OPS A;  1TL1 A;  4ZTJ A;  2UUC K;  1VQK N;  3CJ1 A;  1VSD A;  3K5O A;  3O4N A;  1C1C A;  3SAF A;  1C0T A;  4LF8 K;  1ASU A;  2HHQ A;  5M1F A;  4J8F A;  4DHY A;  4EZ9 A;  3SUP A;  3L0Q A;  3PX4 A;  5TKW A;  2KZZ A;  3OHR A;  3L2U A;  5AQP A;  2ZD1 A;  5T7B A;  2HHH K;  3VPZ A;  3KZB A;  4QS7 A;  4PKG A;  2WBN A;  4JS4 A;  2FXU A;  4KI6 A;  2O8F B;  3QEI A;  3V9X A;  3L2W A;  1RBU A;  4CIF A;  3LM2 A;  3SNN A;  4CEC A;  1OKJ A;  2HND A;  1M1K O;  2RKI A;  4NCA A;  3LDN A;  4KHW A;  1YIT N;  4IXC A;  1A5W A;  2HNZ A;  3CET A;  4CCH A;  4B3S K;  3NGZ A;  3I8D A;  1EKE A;  4C8M A;  3HBT A;  2JGU A;  3IKM A;  4MFB A;  3NF8 A;  4DF8 A;  3O1B A;  3SV3 A;  1CXQ A;  3IAY A;  1BI4 A;  1R59 O;  5MLC Q;  3TR8 A;  4XH4 A;  1NGE A;  3IDH A;  1YVN A;  4B1X B;  1HNW K;  4O4G A;  4A61 A;  5CHI A;  3NHG A;  2A1R A;  1TL3 A;  3QDK A;  1TGO A;  4Y1D A;  4FM1 A;  3FZF A;  1RCH A;  4CHN A;  3MAQ A;  1Z05 A;  4F3O A;  2WOM A;  2X6S A;  3JXU A;  1BIU A;  1JXB A;  1VSL A;  3UKR B;  3WT0 A;  2I7N A;  3F5T A;  4U7B A;  4CJK A;  3BDP A;  2IGI A;  1T8E A;  3SK3 A;  2J4R A;  2NRR A;  2Q0R A;  5AQW A;  4XIU A;  4DV0 K;  3VQC A;  4IOC L;  3K5M A;  3LPT A;  1LWC A;  4RW6 A;  4BRP A;  1EWR A;  3RMA A;  2Z1G A;  4DSJ A;  3HT3 A;  1IJJ A;  4DB3 A;  4C1N I;  3MED A;  1QZ5 A;  4CFC A;  2BH1 A;  1NK5 A;  3HXM A;  3DLE A;  4DU3 A;  4WQ4 C;  2IIR A;  1JXE A;  2HHW A;  4ICL A;  5GAH P;  5AQS A;  3H1V X;  1C1B A;  3DXM A;  4AM7 A;  2P9K A;  4ISF A;  5AQG A;  3VQ8 A;  3G25 A;  3VGK A;  4OPA A;  5FPD A;  4M42 A;  2XRI A;  1CZ9 A;  2QXF A;  4DR1 K;  3ID8 A;  3CPW M;  4BWM A;  2DY4 A;  2IC3 A;  5DK5 A;  2P9S A;  4CZM A;  4F2S A;  1XNR K;  5CYM A;  3UKU B;  5CZ1 A;  2D0P A;  3MCP A;  3CJ7 A;  4HCC A;  3QBW A;  2FBX A;  5LJV A;  3ZET B;  2ATQ A;  2IS3 A;  3TSP A;  1N36 K;  3CC7 N;  5AZJ A;  4H5V A;  4Q0B A; 
#chains in the Genus database with same CATH homology
 3DM2 A;  4BDY A;  3OYM A;  5E41 A;  2IDO A;  2ITG A;  2D0B A;  3OYH A;  3DLG A;  4FJG A;  2WON A;  3H08 A;  4IFV A;  4C8K A;  1VK0 A;  1TV6 A;  4NCB A;  2DFH A;  4KHY A;  1S1X A;  4OGE A;  3L8B A;  1KLN A;  4FK2 A;  3VQD A;  2OPQ A;  4FW2 A;  4HHT A;  1L5U A;  1GOC A;  5HRN A;  2NUB A;  1JLA A;  3LAL A;  3CQ8 A;  1JL2 A;  4CK2 A;  4IG3 A;  4I2P A;  3S3O A;  4K8X A;  2HNY A;  4CHZ A;  4CEZ A;  4FJ7 A;  2Y1J A;  2P1J A;  4AHR A;  1JLF A;  3LDS A;  3RMD A;  2G8W A;  2G8H A;  1B9F A;  1KRP A;  1T7P A;  3HJF A;  1TK0 A;  4PWD A;  4DSF A;  4CED A;  4CEF A;  5HRS A;  4FW1 A;  4DMN A;  4E7K A;  5JS1 A;  1HRH A;  1WSI A;  1VSH A;  1UWB A;  4KHU A;  2RF2 A;  2G8V A;  1JLG A;  4I2Q A;  2YNG A;  3KJV A;  5C24 A;  4FJJ A;  1KVB A;  3V4I A;  2VWK A;  3AO2 A;  3K57 A;  4J2E A;  4M3U A;  5J2M A;  1HQU A;  3QES A;  3SQ1 A;  4CES A;  4B9T A;  1LAV A;  1RDB A;  4GVM A;  2BAN A;  4CJ3 A;  2GV9 A;  3L2R A;  4O0J A;  3V9W A;  5C25 A;  3TAM A;  3FFI A;  4HUF A;  1D8Y A;  3L3U A;  3V9Z A;  4E7J A;  3T1A A;  1HNI A;  4NYN A;  3KLF A;  3AO5 A;  4FVM A;  1QE1 A;  3G10 A;  4IFY A;  1R0A A;  2OZS A;  2YHB A;  1LW0 A;  1BCM A;  3AVG A;  3E01 A;  4CJE A;  1YTA A;  1FK9 A;  4Q5V A;  3EY1 A;  3SQ2 A;  4DSK A;  4F4K A;  2X6N A;  4M3Z A;  3S3M A;  3SYZ A;  3SQ0 A;  2KFZ A;  3ZSY A;  3KK1 A;  4ZTF A;  3VQ5 A;  2OZM A;  1BL3 A;  2I5J A;  4DWI A;  5J1E A;  1JLQ A;  4KHN A;  3ZSO A;  2E4L A;  3DLH A;  2GBZ A;  1S1W A;  3RR7 A;  1EXQ A;  4RW8 A;  1J54 A;  4E0D A;  3RRG A;  1NJX A;  2AJQ A;  4JLH A;  3CYM A;  2JLE A;  1Q9Y A;  3QNN A;  1U47 A;  2VG6 A;  2G8K A;  5KGW A;  4N47 A;  3EYZ A;  4FZZ A;  1X9W A;  1SUQ A;  4KO0 A;  3M8S A;  2FBY A;  3I0R A;  1IG9 A;  1ASW A;  4EZ6 A;  1HYZ A;  4RW9 A;  4AHV A;  1YVU A;  2YNI A;  3V1R A;  3ULD A;  1RT4 A;  1JLE A;  2FBT A;  4CJF A;  1BIZ A;  4FLX A;  1LWE A;  4CHQ A;  3KIO A;  3KLI A;  4CGH A;  4CK1 A;  4DTJ A;  3NF6 A;  4AHT A;  1Q9X A;  3DRS A;  1IKX A;  1ZBF A;  4CEO A;  4NYF A;  1C6V A;  2EX3 A;  3ZT0 A;  5C42 A;  2XY6 A;  4FXD A;  1RIL A;  1A5V A;  3D0P A;  3AA2 A;  1EET A;  3TAQ A;  2QK9 A;  1HYV A;  1JLB A;  1LAW A;  3AV9 A;  1SKR A;  4L8R B;  2A1S A;  2Z1I A;  3SUN A;  1D9F A;  1UAX A;  4CJU A;  4FM2 A;  4G1Q A;  4E1M A;  1BQN A;  1VRT A;  1WSF A;  4CFB A;  3KK3 A;  1KCF A;  3KD1 E;  5D3G A;  1WAF A;  4KPY A;  3K5L A;  3V6D A;  4W5R A;  3MXM A;  1QSS A;  1Q8I A;  4LY7 A;  4RG8 A;  2HHT A;  3PX6 A;  3KKS A;  1L3U A;  1RTH A;  2B5J A;  3V1Q A;  4JRP A;  4DTN A;  3B6P A;  3PV8 A;  3RR8 A;  5FDL A;  2BGG A;  4PUO A;  2QKB A;  1XWL A;  3OVN A;  4DFJ A;  4BAC A;  2ETJ A;  1JKH A;  3ZSW A;  2YKN A;  1QHT A;  2KFN A;  4J2D A;  4OPK A;  4OPJ A;  3HPG A;  4H4O A;  3O3H A;  3TWH A;  5CYQ A;  4H8K A;  4DLE A;  3SQ4 A;  3MEG A;  3LPU A;  3NBP A;  4DTP A;  4IG0 A;  4ELT A;  1S1T A;  3ZSQ A;  4CGG A;  5KGX A;  4W5T A;  2HHS A;  1XI1 A;  1RT6 A;  1LV5 A;  3ALY A;  1B9D A;  1KTQ A;  4KI4 A;  5KI6 A;  1KFD A;  5KRS A;  4KFB A;  3LAN A;  3RMC A;  1W0H A;  4DTM A;  1RDD A;  2GUI A;  4CJV A;  1XC9 A;  2R7Y A;  4FLV A;  4OJR A;  4M41 A;  3QET A;  3HM9 A;  1X9M A;  1J9A A;  4B8A B;  3OS1 A;  4HTU A;  1NJW A;  2DTU A;  3S9H A;  1NK9 A;  1KLM A;  1X9S A;  3K58 A;  4FJK A;  2QKK A;  3LP1 A;  2F8S A;  3OYC A;  2B6A A;  3VQ9 A;  1FKO A;  3HST B;  1NK7 A;  3QEW A;  1U49 A;  1WSH A;  2YNH A;  3PUF A;  4FJN A;  4Y1C A;  1HMV A;  3HL8 A;  1ZBI A;  1VSI A;  1FXX A;  2YNF A;  3ZSV A;  3V9S A;  1RT2 A;  1TAQ A;  3OS0 A;  1T05 A;  4K8Z A;  3CM5 A;  4E89 A;  4CJT A;  5KTQ A;  4DSL A;  3V1O A;  4CGF A;  5KRT A;  4GMJ B;  2P5O A;  4HUE A;  3PO5 A;  1NKB A;  4R5P A;  3TAE A;  1RTD A;  3AVL A;  4CJ4 A;  2P5G A;  1WNS A;  4N56 A;  4Z4C A;  4W5O A;  5DMR A;  3PO4 A;  2DFE A;  3OYA A;  3PX0 A;  1QTM A;  1TKD A;  5FRN A;  3HK2 A;  1CLQ A;  2F96 A;  3VQE A;  4OVL A;  5I3U A;  1HYS A;  3NF9 A;  3CFR A;  1RT1 A;  3ZT2 A;  3AVJ A;  1X1P A;  1L3V A;  3L2V A;  3TAF A;  3KK2 A;  3OYL A;  3UIQ A;  3SI6 A;  4F3T A;  4AHS A;  4DSE A;  4M3Y A;  2KTQ A;  4M3R A;  4CHP A;  4DTX A;  3RRH A;  1UA1 A;  1NK0 A;  2IOC A;  4CE9 A;  4YNQ A;  4EP4 A;  4CEB A;  1SL0 A;  3NF7 A;  4LSL A;  1SL2 A;  3OJS A;  2OPR A;  4FJH A;  1ZBH A;  3OYK A;  4N5S A;  2HHX A;  4DTO A;  2PYL A;  4FJ9 A;  4B9S A;  3THV A;  3QLH A;  1UA0 A;  1KVA A;  4DFM A;  3MEC A;  3O3G A;  3C6U A;  3WNH A;  3ITH A;  3AA4 A;  4DS4 A;  2HVH A;  4O0I A;  4C8L A;  1WSG A;  3LP0 A;  1L3T A;  3KD5 E;  4J2A A;  4FZY A;  3DRR A;  2BE2 A;  3L3V A;  4AHC A;  5SZT A;  4JRQ A;  4AIL C;  1J5O A;  4BDP A;  1L3S A;  3M8R A;  3HO1 A;  4CJS A;  4OLA A;  3NH0 A;  4F2R A;  2KW4 A;  2YKM A;  5HRR A;  3SV4 A;  3OJU A;  3VQ7 A;  2XY7 A;  3O3F A;  3U3Y A;  5CY4 A;  3QO9 A;  4ZHR A;  4FJM A;  3OYB A;  3HPO A;  4DSI A;  3G0Z A;  4CF9 A;  1D9D A;  3NAE A;  4B9U A;  4ID1 A;  3SPZ A;  4KV8 A;  3SCX A;  2BDP A;  5HBM A;  2G8U A;  2X78 A;  4DG1 A;  4M3T A;  3LWM A;  3ASM A;  1NK6 A;  3VQB A;  3DRP A;  4E3S A;  1U48 A;  3NGY A;  3K2P A;  4CGJ A;  4I9L A;  3IG1 A;  3U3G A;  4KKO A;  4FM0 A;  4OGC A;  4HVJ A;  3HYF A;  3SUQ A;  2OA8 A;  2RPI A;  3VQ6 A;  1BCO A;  3OS2 A;  1KSP A;  4CK3 A;  1REV A;  5HLF A;  2XO7 A;  1RT7 A;  3QIN A;  2XY5 A;  5HRO A;  2PYJ A;  4OKJ A;  2E6L A;  1QQC A;  3AO4 A;  4E7I A;  4DU1 A;  3QIO A;  4CF1 A;  1K6Y A;  2YV0 X;  1A5X A;  3KLG A;  4EP5 A;  3NDK A;  3DOL A;  1VRU A;  3P83 D;  2F8T A;  1D5A A;  4DU4 A;  3AA5 X;  3VQQ A;  2HHU A;  4E1N A;  1U4B A;  4BDZ A;  1RDA A;  3ISN C;  1NOZ A;  3QEX A;  4BE2 A;  4CF2 A;  3ZSX A;  3V81 A;  3ZSZ A;  3LZJ A;  1QSY A;  3AVC A;  2DFF A;  4WE1 A;  4LH4 A;  1C0M A;  3AO1 A;  3F9K A;  4O44 A;  4CJW A;  1NKC A;  4OKE A;  1ZBL A;  3AVN A;  4B9N A;  1S9G A;  2FC0 A;  1QS4 A;  1F21 A;  1TK5 A;  1W9H A;  4TSX A;  4FJL A;  1HJR A;  4B9M A;  4N76 A;  1EX4 A;  2VG5 A;  1RT5 A;  4BE0 A;  1IKW A;  3S3N A;  1RBT A;  1T03 A;  2Q3S A;  2G8F A;  3AA3 A;  4FJI A;  5J2N A;  1KFS A;  2O4I A;  3OYG A;  4JS5 A;  3CM6 A;  3QNO A;  5HRP A;  1ZBU A;  4B3O A;  3KTQ A;  5EU7 A;  4DQP A;  4QAG A;  1HQE A;  3LP3 A;  3T19 A;  4OLB A;  1VSM A;  1IKY A;  5CZ2 A;  1XHZ A;  4O5B A;  3OY9 A;  4J2B A;  1WLJ A;  4BWJ A;  2HHV A;  1S5J A;  2B4J A;  1U45 A;  1I39 A;  4Z4E A;  3DOK A;  4E7L A;  4B8C A;  5FRO A;  1ZYQ A;  1BHL A;  2KZM A;  1BIS A;  4H4M A;  4LH5 A;  3OYF A;  1RDC A;  3AVI A;  2PZS A;  1BI4 B;  4LD0 A;  3OYN A;  1Y97 A;  4F8R A;  2ZQB A;  3SJJ A;  3PY8 A;  4FYD A;  4CHY A;  2D0C A;  4LSN A;  4HUG A;  1QSL A;  3B6O A;  1C1A A;  2W42 A;  3VA0 A;  2XHB A;  4N41 A;  4QCL A;  2OPS A;  3LZI A;  1TL1 A;  4CEE A;  1WSE A;  4ZTJ A;  1YTU A;  2HVI A;  1S1U A;  4YFU A;  3QEP A;  3K5O A;  1VSD A;  4Z4G A;  3ZT4 A;  4RW7 A;  3EZ5 A;  1N5Y A;  1TKZ A;  2OPP A;  3C95 A;  4Z4I A;  1LWF A;  2HB5 A;  3C6T A;  4UQG A;  3O4N A;  4CJQ A;  4KHQ A;  1C1C A;  4DTR A;  1IKV A;  1O1W A;  3TAB A;  1C0T A;  2EHG A;  1EP4 A;  4PA1 A;  3OYI A;  1DTQ A;  1VSJ A;  4IDK A;  1ASU A;  4FLZ A;  3NGI A;  4FLT A;  4DFP A;  2HHQ A;  4B9V A;  4QOZ B;  4EZ9 A;  3SUP A;  3DI6 A;  4DQS A;  2KZZ A;  3PX4 A;  1SV5 A;  4O55 A;  5HP1 A;  4FK0 A;  2D5R A;  1JL1 A;  3AVA A;  3K59 A;  1NJZ A;  2HMI A;  4M3W A;  4DTU A;  3L2U A;  1CXU A;  3CFP A;  3LAM A;  3NCI A;  1FKP A;  3TAG A;  1J53 A;  3CG7 A;  4Z0U A;  3VQ4 A;  2ZD1 A;  5T7B A;  1TK8 A;  2O4G A;  4KHS A;  1BGX T;  3VQA A;  2FBV A;  4JS4 A;  3IS9 A;  3AVM A;  4CHO A;  4NCG A;  3RWU A;  3M8Q A;  4C8O A;  4ELU A;  4KI6 A;  3QEI A;  3V9X A;  1U04 A;  5SWM A;  3WNE A;  5FRM A;  1TVR A;  1RBU A;  3L2W A;  4CIF A;  3KLH A;  3KLE A;  3TAP A;  3K5N A;  4CEC A;  3SNN A;  4FJ8 A;  2HND A;  1DTT A;  4B9L A;  1WAJ A;  2RKI A;  3OYJ A;  4FZX C;  4IKF A;  4NCA A;  4CFD A;  2KQ2 A;  1VSE A;  4DQI A;  4KHW A;  3A2F A;  1S1V A;  3SUO A;  1A5W A;  2HNZ A;  3QIP A;  2Y1I A;  1HPZ A;  2D0A A;  4CCH A;  3NH2 A;  3D45 A;  1UOC A;  4MQ3 A;  4KRF A;  3AVH A;  1RBR A;  1TKX A;  3NGZ A;  1CZB A;  1C0U A;  4CEQ A;  1RTI A;  4I7F A;  4CER A;  4CFA A;  3WNF A;  4CJR A;  3I8D A;  1EKE A;  1N6Q A;  4DTS A;  5J2Q A;  4C8M A;  3CFO A;  3VA3 A;  3LWL A;  1VSF A;  2E6M A;  1B92 A;  2JGU A;  1Z25 A;  3MEE A;  1TKT A;  4ID5 A;  4KAZ A;  4PY5 A;  4MFB A;  3NF8 A;  5K14 A;  4DF8 A;  3SV3 A;  2YHA A;  4M45 A;  1CXQ A;  3IAY A;  4FLU A;  1BI4 A;  3QER A;  3TR8 A;  1BQM A;  4W5N A;  2RN2 A;  1DLO A;  4DS5 A;  1SKW A;  1MU2 A;  3MXI A;  4O4G A;  1LW2 A;  3NHG A;  1S6P A;  3V9U A;  2A1R A;  1TL3 A;  3LP2 A;  3ZT1 A;  4KTW A;  4KB0 A;  3AVB A;  3I0S A;  1G15 A;  1TGO A;  3IRX A;  4Y1D A;  4FM1 A;  4CGD A;  1RCH A;  3DLB A;  4I9Q A;  4CHN A;  3MAQ A;  3M8P A;  4CJL A;  4F3O A;  4KTQ A;  2WOM A;  1ITG A;  3OYD A;  5I42 A;  4IBN A;  1NK8 A;  3P1G A;  2X6S A;  1BIU A;  1ASV A;  1JXB A;  1VSL A;  4FJ5 A;  3ZSR A;  4CF0 A;  1NJY A;  2OYQ A;  1IO2 A;  3C94 A;  4CJK A;  3BDP A;  2IGI A;  4DF4 A;  1T8E A;  2PY5 A;  3HP6 A;  4Z4H A;  4E7H A;  4GW6 A;  1SKS A;  4CF8 A;  4CIE A;  4XIU A;  4KRE A;  3VQC A;  3ZT3 A;  3K5M A;  3LPT A;  2Z1J A;  4CJ5 A;  1LWC A;  4AH9 A;  4RW6 A;  1S9E A;  3SPY A;  2ZE2 A;  4CEA A;  3U6F A;  4FK4 A;  3RMA A;  2LSN A;  1RTJ A;  2Z1G A;  1NK4 A;  3HT3 A;  4DQR A;  3RTV A;  4DSJ A;  1GOB A;  3MED A;  4FJX A;  3VN5 A;  3WNG A;  4PQU A;  4AHU A;  4KTZ A;  4CIG A;  4FLY A;  4CFC A;  1XHX A;  1RBS A;  2Z1H A;  3DYA A;  1NK5 A;  1YT3 A;  3HXM A;  3DLE A;  3SZ2 A;  3TAR A;  4KB1 A;  1IH7 A;  4DU3 A;  2G8I A;  1JXE A;  3DLR A;  4M3X A;  4ICL A;  2HHW A;  1I3A A;  1RT3 A;  1C1B A;  1Z26 A;  3NFA A;  3P5J A;  4W5Q A;  3TAN A;  2VWJ A;  4DFK A;  2IAJ A;  4C8N A;  3DMJ A;  3HVT A;  1TAU A;  3VQ8 A;  1S6Q A;  3QEV A;  1RNH A;  3JSM A;  3AO3 A;  4CJP A;  4E19 A;  3TI0 A;  1HNV A;  4CGI A;  4DLG A;  3O4Q A;  4M42 A;  2XRI A;  1JLC A;  1CZ9 A;  4HCB A;  3T3F A;  4B08 A;  4OKK A;  2XY8 A;  2QXF A;  3ZCM A;  1GOA A;  3HP9 A;  4RW4 A;  3HVR A;  4FLW A;  4BWM A;  2DY4 A;  2IC3 A;  2VG7 A;  5DK5 A;  3MXJ A;  1WSJ A;  4F2S A;  3F73 A;  5CYM A;  3RMB A;  4DQQ A;  1NKE A;  3AVK A;  4ELV A;  3L2Q A;  1WN7 A;  3VQP A;  1KVC A;  3NH1 A;  1NOY A;  5CZ1 A;  5JS2 A;  1RBV A;  4HCC A;  4Z4F A;  2X74 A;  3HPH A;  1VSK A;  2FBX A;  4BE1 A;  2ATQ A;  3JYT A;  2IS3 A;  3DLK A;  3OYE A;  3BGR A;  3LAK A;  3NE6 A;  3KKR A;  4FCY A;  2P51 A;  3AVF A;  2HW3 A;  1SL1 A;  4Q0B A;  5J2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...