5M1QA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound zinc
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
186
structure length
171
Chain Sequence
NSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
molecule keywords Phage terminase large subunit
total genus 58
structure length 171
sequence length 186
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1qA00
4IFEA 5C10A 3CPEA 3C6HA 4IDHA 5M1FA 3C6AA 4IEEA 4IEIA 5C12A 5M1NA 5C15A 5M1QA 5C2FA 5M1OA 5M1KA 5M1PA 5C2DA
chains in the Genus database with same CATH superfamily
4YOWA 2RF2A 3LZJA 3NGIA 3MXIA 4CJ5A 4BR0A 4E19A 3KLHA 3CCUN 3QMLA 2HVIA 1TYQB 3CQYA 1TYQA 3CYMA 4BRNA 2X74A 4Z94A 3TAPA 3A2FA 4KB0A 1TKDA 5JLHA 4ELVA 1ASWA 1DEJA 1HYSA 4ZTJA 3AVAA 3A0IX 3LP1A 4CZIA 4BRMA 3R9PA 4B9NA 3IKMA 4OJRA 4DQIA 3V9WA 2QWQA 5CZ1A 4X62K 3Q7BA 1LW2A 2FC0A 1KSPA 4E1MA 3ENOA 4BREA 3F9KA 4OGEA 4CCHA 5T7BA 4A2BA 4CEZA 1XQSC 3AVGA 4DU4A 1X9MA 3CC4N 3CJAA 3CC2N 1JLEA 4FZXC 3HO1A 1ZXOA 3EZWA 1S6PA 3NHGA 2YJEA 4MO4A 4DR2K 3TANA 3SPZA 2VQFK 4CJ3A 2IAJA 3K5LA 4BC4A 3DXMB 1E4FT 1YI2N 4C23A 1C1BA 1VQ9N 2NRWA 5CY4A 1Q9XA 4DR6K 3C6UA 3L2RA 1TKZA 2IVOA 1U04A 3D2EA 4OVLA 4DUZK 4KAZA 1TUYA 1KVBA 2WUSA 4FJ7A 4CEEA 4GKKK 1L3SA 3LPTA 3H3OB 3V4IA 3VGLA 3FZLA 2IS3A 1IJJA 3WQUA 2FSJA 4DQ8A 4CJEA 5AQPA 5JS2A 2P9PB 3ALYA 5J1EA 1HQEA 3FZKA 4YFUA 4H5VA 1DKGD 1HYVA 4ILJA 3LDLA 3MEEA 1VK0A 1BCMA 4GY2B 1B9DA 2PBDA 4M42A 4IJNA 3L8BA 4XH4A 3IDHA 3L4IA 2R7YA 2DPNA 3SZ2A 4YOVA 4LFCK 2B4JA 4JAXA 1I39A 2BGGA 1QQOA 4B9LA 3QETA 5HRRA 1NOZA 4CEQA 4KO0A 1NK4A 1KAYA 1HPMA 3FZHA 2QKBA 3OYBA 1RTHA 2VWBA 4JRPA 3CC7N 2ZGZA 4ZTFA 5KGWA 4Y1CA 5EX5A 2F4VK 1BL3A 1G15A 4JHDA 3KIOA 4DR4K 2YNIA 4LSLA 3L2VA 2A5XA 3AA5X 3K58A 4CJUA 2HHVA 2ZE2A 4N47A 4KTZA 2W6KA 2GV9A 3EEQA 3QEIA 3HOSA 3CERA 4H5TA 4WFBL 4M3XA 5H1SQ 3SYZA 4FSVA 1BWFO 4KI4A 1YVUA 3OY9A 3RMCA 3LAMA 3C6HA 5AR0A 4Y0WA 3K57A 4B3SK 5JS1A 2JGUA 2F9WA 4JI2K 2QW9A 4B8CA 4B9MA 1LW0A 5AQGA 1RBVA 4FJNA 4CHZA 3CCLN 3RMAA 4BDZA 2NLXA 4XH5A 1XHZA 1OVYA 5E26A 3ZETB 3VQ7A 1Q8IA 4JK9A 3A5NC 5CE3A 1P90A 4FCYA 4KHSA 1HJOA 1LWCA 2E2OA 4H5RA 3MN5A 2YKMA 5K14A 1D9DA 1M1KO 1CZAN 3T3FA 4JN4A 1N8RO 2UYTA 4JV5K 5LMNK 3KKRA 3T1YK 3TPQA 1NNEA 3QB0A 5AZJB 3FR0A 2FBXA 3CCMN 1NGFA 3OS1A 2D5RA 3WT0A 4W5NA 4BRHA 4CD3A 4FLZA 3A5MC 4FOIA 3AGKA 3OTOK 3SCXA 3OYDA 3VQ6A 4PY5A 4U67L 3ZSVA 3HZ6A 4KHQA 4CERA 1S1TA 2OCEA 4Q5VA 1WSHA 3J80O 1HNXK 4LF4K 1RBRA 1Q86O 2E2QA 4Z0UA 1VQLN 2HF4A 2HBKA 3C6AA 5I42A 4AHSA 2G8HA 4B3TK 2CH5A 4PKIA 1FKPA 4DR3K 1RT4A 5M1PA 5HRSA 4CFBA 2VGMA 1VRUA 1QSYA 4LY7A 2P51A 5JVGL 3O4WA 1S1VA 1NK0A 4B08A 4DU3A 4DSJA 4O8KA 4JK7A 3OYIA 3KJVA 4BQZA 3OS0A 2G8IA 1IBLK 3KD5E 3BDPA 5KRTA 1KAXA 3ZT1A 3OYFA 4KHWA 2QWLA 2Z1HA 1NKEA 1T44A 1QQCA 3S9HA 4JKFA 4B3MK 2G8KA 3BZKA 4K0KK 1EO1A 5EXWA 3DLGA 3TSPA 4DR1K 5ADXA 3TARA 1RCHA 1TKTA 4E3SA 1VSHA 1WAJA 1ATRA 2YKNA 3QICA 4CBXA 4LFBK 3JSMA 4FJ9A 5ADXH 4CZFA 4NYNA 3SMSA 3QBWA 4PWDA 1SKWA 3NMUA 1I94K 2XRIA 3KHYA 4FJ8A 4FZZA 1XC9A 4I2QA 1ATSA 4A61A 3ZT4A 3VEYA 3S3OA 4B9UA 3FE1A 3HL8A 3TSUA 4JI3K 3HK2A 1CZ9A 2OZSA 3O4QA 3PY8A 4BRPA 1LV5A 5AQMA 4BQLA 3D0PA 4AHCA 3TI0A 3FLCO 1T8EA 2JWKA 3ITHA 1S5JA 4W5OA 2WFBA 2GWKA 4YOYA 1ZBLA 4M41A 4FWQA 1NJWA 4AHUA 4IOAL 5FRNA 4CBWA 4ISEA 2VG6A 3T1AA 4ISFA 4LFAK 1WBDA 5AQXA 3SUOA 1RT1A 3N4QA 3DOKA 1KXPA 2E2PA 3CF5L 1JKHA 3EZ5A 3VN5A 3O3GA 3QNOA 4CFDA 1TK0A 3QIOA 5I9EB 1W2BM 2Z1GA 2E2NA 1NGJA 3CPWM 2KFZA 2UXCK 3QESA 1UA1A 3HP6A 1BQNA 1K8KA 1U2VB 1J5EK 1VAZA 5AFUH 4E1NA 3HM8A 3RSEA 5LMUK 3CJ1A 3KLEA 2ITGA 3NF6A 4E0DA 1RT6A 2E6MA 3CIPA 3QFUA 3D6RA 5KQ8A 5AZIB 4LF8K 3VQ4A 3FZFA 4O4GA 2PFUA 5DM6L 3O08A 3CM5A 3P39A 1NG9A 3MX2A 1WBBA 2X78A 4E7KA 2O8FB 3HTVA 4G9ZA 3O9SA 3J81O 3TAMA 4K25A 5FPNA 2VG7A 3DYAA 4YHHK 3EL2A 4B9SA 2UUCK 4QOZB 1Y64A 4DV6K 3UKRB 4KV8A 4W5QA 2E8AA 3SQ4A 3U9ZA 4DSLA 1BU6O 3SAFA 5JVHL 4CZGA 1ZYQA 5KRSA 1CZBA 3THVA 3OHRA 4EP5A 3ZT3A 2G8VA 4BRLA 5BRHA 3WXIA 3OBWA 1SAZA 2HMPA 3WUHA 4FJHA 4CK2A 4JKEA 2ZJQL 1QHAA 1EX4A 1S6QA 2B6AA 1QVFM 4OPAA 5C0YA 3AGRA 4FWSA 1NJYA 3C7NA 4IG3A 1NGHA 5CHIA 5F0XA 3CI5A 1BISA 3MAQA 4DS5A 3F73A 3QEWA 4EAHD 3OYEA 1MWMA 4KH6A 2OTLN 1NGAA 3AVMA 1TAUA 3DXKB 3TABA 4DQPA 4DCHA 1GOAA 2IVPA 3DLHA 1SL0A 1BCOA 2QWNA 4BRDA 4WFNL 2YNHA 2P9NB 4CESA 3NFAA 3VQEA 4LF9K 1RGIA 1BHLA 3PX4A 2NRZA 2AJQA 2FF3B 2LSNA 1TK8A 2VG5A 4BY9C 1RILA 2QWOA 3C65A 1HKGA 4JK8A 1OH8A 4LSNA 3K9KA 4F8RA 4CBUA 2XY6A 4IOCL 2ASOA 4MLHA 4NXNK 2PYJA 3A5OC 1NGBA 1KC8O 5CR4A 3C94A 4RTFD 1C0MA 2ATQA 2YCHA 4WFAL 1NMNA 1NOYA 3KLFA 3L2QA 4PA1A 1BGXT 2FBVA 3P1GA 4A5BA 4DQSA 4CZHA 4O8UA 1LWEA 2EX3A 4DTMA 4W5TA 3V81A 4CEFA 3EN9A 3HVRA 4H4OA 1ASUA 1RFQA 4DV4K 5M1OA 3SQ2A 3ZSOA 1Q82O 3CCRN 4EIAA 3M1FA 1JCGA 3TAFA 3DI6A 3T69A 5EOYA 1RT5A 5EY4A 5AQFA 1E3MA 1N6QA 1RDDA 2PAVA 4LH4A 4UQGA 3CQXA 2Y1JA 3QEPA 1B92A 4WYBA 4DFPA 4BR2A 1ASVA 4JD2A 1NLVA 3DRRA 5AQZA 3RWUA 2A1SA 3LDNA 2CH6A 2YNGA 3NGYA 3Q7CA 1DTTA 1JLGA 2YI1A 1SS6A 4CHNA 1XHXA 3EE8A 1S9GA 4FJIA 4H4MA 4IFYA 4IG0A 5C42A 1C0GA 4M3UA 4X66K 3SUPA 5J2PA 2O8EB 5KPRA 2ITMA 2WC9A 3L6QA 2YHBA 4XH1A 3HP9A 4CJLA 4DHYA 5AZJA 2GX9A 3EO3A 3B8AX 3RR7A 5JICA 2KKZA 1YHQN 1OH5A 2OA8A 3ZEUA 4JEPA 5LY3A 3ZEUB 4MLEA 2HBLA 3OJSA 2OPSA 4GMJB 1WNSA 3E1YA 1TKXA 3CCSN 1KRPA 2QWPA 1UWBA 2D0BA 3U6FA 5GINA 5FPMA 3H45C 1KLMA 3QNNA 1VQ4N 4FLTA 1Q7YO 5FROA 2YHWA 3LWMA 1RTIA 1X1PA 1EWRA 2D4WA 3N4PA 5AQKA 2VQEK 3NGZA 3WEEB 3CFRA 4O44A 4FYDA 4ID1A 4KHNA 3VETA 2IOCA 1KTQA 3GBTA 4X65K 1CXQA 4FWOA 4DMNA 3MECA 3V9SA 4K8ZA 3O9RA 1QSLA 1WOQA 2P9LB 4EP4A 4BRIA 4CEAA 1VQ8N 2HNYA 4F2SA 1QZ5A 1XUPO 4CJTA 4RW6A 4M63C 3UKRA 4UY8O 1ESVA 4FM0A 1IBMK 1L3TA 3O6WA 2O8CB 3C95A 5KPZA 3PV8A 5AQVA 5GIPA 4IZ9A 4CF0A 1VQKN 1RDAA 1WSJA 4BRGA 1S72N 3PUFA 4GW6A 2PZSA 5JMVA 1VQMN 4O5FA 2G8UA 4EZ9A 1VQON 4CJKA 1NK6A 4CIGA 2HHQA 2E1ZA 1TGOA 1KQSM 1EKEA 4CHYA 2GELA 4I9LA 1YUWA 4BRQA 4CGDA 4N41A 3FFIA 3M8RA 4BDYA 4AHRA 5AQSA 2F8TA 5AZIA 4FK2A 3A5LC 4JNEA 5GIOA 2KFNA 3ZT0A 1XWLA 4A62A 3VMFB 1QQMA 3TTFA 2KTQA 3I8DA 3O3HA 2FF6A 3SQ0A 3D2FA 4CJ4A 4Z4CA 3WXLA 1WSIA 3NCIA 3VEVA 4BGAA 3V9ZA 1U48A 4BR9A 3NF9A 4GVEA 5BN8A 2Q2RA 3QINA 3SQ1A 2A40A 3BZCA 2E4LA 4CF9A 3C6TA 3LM9A 3AA2A 3ZETA 4DFKA 1TUUA 1L3VA 3SMPA 4CHPA 3UIQA 4CZEA 4AH9A 3VF6A 1QE1A 5DM7L 1N32K 2FBTA 4KKOA 4CEBA 5TKYA 2D0OA 5B8HA 4N76A 1J53A 4A5AA 3KK2A 5E84A 1WSGA 3O1BA 4ID5A 3LDPA 4CK3A 2IGIA 2NRVA 4HUEA 3TAQA 1NGEA 3CCJN 5E41A 4HTUA 3ID6A 4KTQA 1MWKA 3EYZA 2HMIA 3AA3A 4CJ7A 3QFPA 4DQRA 2ZWHA 1WSFA 3BGRA 4FWMA 2YV0X 3RRGA 4JKGA 4JI6K 5KI6A 2A1RA 3PLAA 5HP1A 4M3TA 4OPHA 4BR4A 3K5NA 1YJNN 1GLAG 3ID8A 4EFHA 2JLEA 4YNQA 2ZD1A 2GUPA 3ZSZA 3KLIA 1WB9A 3KK7A 4B8AB 5AJ3K 3L2WA 4C1NI 1IH7A 5GAHP 3J8AA 3OYAA 5AQHA 4CGJA 3KZBA 4DS4A 4HHTA 4OO1J 5FPDA 1C1AA 1IG9A 4C8OA 1ZC6A 3CHWA 2P9PA 3J7AP 1BUPA 2UU9K 2IIRA 1N34K 3ULDA 4RW4A 4CFCA 3WXKA 1RDUA 4EZ6A 1JLAA 4DTRA 4F4KA 1D9FA 5EVZA 1W9HA 1IKWA 1HRHA 2F9TA 4JI5K 4E89A 5M1KA 1CXUA 3THYB 4KFBA 1WAFA 1U45A 3OYJA 2O4IA 2OPRA 4DSEA 2GEMA 3THXA 2P9LA 1UA0A 5BPNA 4FJXA 4PKGA 1FW6A 1QS4A 4FXDA 4DF8A 4M3RA 2QXFA 4DV5K 4Z4HA 4CZJA 3SNNA 2RKIA 1RDBA 3IMXA 3SV4A 5HRPA 2V51B 3R1XA 4CHOA 4HUFA 1NGGA 5LJWA 3LL3A 2NRXA 4BE2A 2HHSA 1UAXA 3DM2A 4KHYA 2Q3SA 5C15A 3D2EB 3T19A 4IO8A 3L4QA 1M90O 2RE2A 2XHBA 2O4GA 2Q0UA 1JXBA 3C0BA 4K42A 4RWTA 1EP4A 4CF2A 4LH5A 4AHVA 4H0XB 2ZF5O 1MDUB 2Q36A 3H3NO 4NCBA 3ZSWA 1WLJA 2NRTA 3UKUA 4IDHA 1BI4B 3LDOA 5HROA 3DMJA 2WBNA 3DWLA 1HQUA 3M8QA 3CFOA 3VPZA 4E1JA 3RVCA 3CCEN 3J7YP 5HOOA 3SBTA 4B9TA 3HT3A 4H5NA 4CEOA 4B1ZA 1A5VA 1X9JA 3LP3A 3AVLA 1OKJA 3SUQA 2AA4A 3GL1A 4CK1A 4BGBA 4C8KA 3LDQA 2XY5A 4K43A 5SWMA 1HKCA 2NNWA 4ELUA 3M3ZA 4CIEA 2GTDA 3CJBA 5FLXO 5C24A 1TV6A 2QM1A 1IO2A 4AF1A 3ZX0A 3BF1A 4BRAA 5JLFA 3OYGA 3A8YA 2O8DA 4R79A 4KH5A 4B1YB 4DV3K 4GV9A 3CMAN 4U7BA 3LAKA 1VSDA 4LD0A 4FJKA 3D45A 3VA3A 1K9MO 3HBTA 4GV6A 2HNDA 2I5JA 1L3UA 4DTPA 3OYMA 1XI1A 3I55N 5M1QA 3PIPL 3O5BA 3HM9A 3G0ZA 2HF3A 4DLGA 1RNHA 5I3UA 3QEXA 1ZBHA 3AO2A 2VWJA 1I3AA 4JYAK 2DFEA 2FSNA 2X6SA 4WQ5A 4N5SA 2D0PA 4WF9L 3FZMA 4CGHA 4DB3A 5BR9A 3ENHA 4QS7A 4FZYA 1ITGA 1OH6A 4A57A 4DG1A 1NGIA 3ZSYA 4CW7B 4EHTA 1DT9A 3VQ5A 2FLOA 3OJUA 4V19S 4BE0A 1X3MA 4QAGA 4MQ3A 3W3DA 1JCFA 5AQWA 3AVNA 4FPAA 2ZM6K 1IKYA 1HNVA 3PO4A 5J2MA 4OKEA 4FJGA 5AQNA 3IG1A 2Q31A 4JKGB 2GBZA 2E6LA 3DJCA 4J2BA 3BF3A 4N56A 3NH2A 2O8FA 2NUBA 4KBOA 3DOLA 4XEIA 2P9UB 3AVFA 1C6VA 2Z1IA 4W5RA 3DLBA 1JLFA 3CPEA 3O3FA 1K6YA 1IBKK 5HL7L 4B1UB 3R6MA 3LALA 3RR8A 5FRMA 4FLWA 1RTDA 1JLCA 1D4XA 1ZBUA 1IG8A 3U4LA 3T1HK 1K8KB 2HOEA 5IWAK 1NGCA 3MCAB 4FLVA 3IS9A 4FOEA 3PIOL 3CCVN 2KZZA 1BO5O 1LAVA 3VENA 3THXB 4KI6A 4J2DA 4L3QA 4DWIA 5LL6Z 4CJRA 4NLBA 4FVUA 1Z05A 4H0PA 1V4SA 5MLCQ 5AQTA 5AQRA 4IBNA 3VQCA 4FK0A 1R0AA 5BREA 1MU2A 1VQNN 2YHXA 2NRHA 3IFRA 4KH4A 3AO1A 1K8AO 3L3VA 4AM6A 1GOBA 2HVHA 3QDKA 3U9DA 1KFSA 5AQUA 1HJRA 4I2PA 3DLRA 2P9IA 3SLCA 2P9IB 2KLAA 2OZMA 1HKBA 3DAWA 2Q1NA 3EKSA 2H3GX 1BQMA 2EWSA 2E20A 4IEEA 1VQ7N 3MX5A 2F96A 3CD6N 4LF6K 3O80A 3MEDA 3NAEA 3AO3A 4DKWA 2QKKA 1W0HA 1DTQA 3PO5A 2O8BA 1YJ9N 4YDUA 2WTUA 1CLQA 4CJVA 3LP2A 1Z26A 2RN2A 4OGCA 3E9OA 3PSIA 1FKOA 4L8RB 4FLUA 1J6ZA 4DTOA 2UUBK 1WN7A 4FWRA 4LF5K 1BA0A 4ISGA 2DY4A 5BRDA 3AVBA 3JAMO 1EXQA 4O0IA 4IFVA 3ZT2A 1HX1A 3BEXA 4DV0K 3MWPA 4DLEA 4M3ZA 3AAQA 1NM1A 1QVGM 4FJ5A 1XNQK 1P8ZA 3PX0A 3V1RA 4JKDA 2KHOA 3KK3A 3C7NB 1HLUA 3DRPA 1NKCA 2VGNA 3GOIA 3K5OA 1SKSA 3AA4A 1GLLO 1S22A 1S1UA 4OKJA 3MXJA 3S3NA 3OA9A 2Y1IA 4FWNA 3V6DA 2DFHA 3VERA 1BOTO 3WXMB 3I33A 2P5OA 3I56N 2QEXN 3OVNA 1HNIA 3G6EN 4F9OA 1NBWA 2ZJRL 3EKUA 3I8BA 2V52B 4AM7A 1MA9B 1KCFA 1XMQK 1YT3A 3TAGA 2HB5A 2HW3A 3LANA 3JYTA 2D1KA 4KTWA 4HVJA 2QK9A 3U3GA 1VSFA 5KQDA 3SPYA 3NH1A 1ILYA 5FPEA 3QIPA 3K5MA 2A6AA 4H8KA 4CF1A 3HXMA 3TTDA 3ULEB 3OS2A 3VF2A 4JI0K 3H08A 4H0TB 2HHHK 4CVNE 4JI4K 3BP8A 3QBXA 2EHGA 1ZBFA 1B9FA 4O0JA 4QS8A 2BDPA 4JI8K 1NWKA 1JXEA 4ICLA 1FXXA 4JLHA 4IWVA 3MCPA 2QXLA 3AY9A 3VF4A 4CJWA 2P9SB 3ISNC 3FFKB 4HTLA 3VEXA 5KGXA 4FLXA 3L0QA 1K73O 3WNHA 3VESA 3NVMA 5BR8K 2D0AA 4PUOA 5GADP 1NK5A 4E7LA 2XO7A 4MDBA 4IO9L 4PHTX 4WE1A 3VTHA 4C8NA 3ULEA 3G25A 4RW7A 5GAEP 1NMDA 1S9EA 2D0CA 3QLHA 4PL8A 4HUGA 4GNIA 1SL1A 4IKFA 3CXCM 1T03A 4Q0BA 3AO5A 1SKRA 4BC3A 3RRHA 3QEVA 3MDQA 3ZLJA 4M3WA 1D8YA 4BG8A 3HPOA 3S3MA 4CZKA 4J2AA 4NLCA 3OYCA 4B3OA 2FBYA 1NK7A 1BDGA 1W7AA 1S1XA 3SUNA 4KHPK 3R3LA 1RBUA 2W41A 4WQ4C 2RPIA 4DFJA 2NZTA 4K41A 2W6LA 3VQPA 3OYHA 3RTVA 1XNRK 3O9UA 4FPBA 1R59O 1KAZA 3F9MA 4BACA 5LJVA 3K9JA 1GLBG 4DTXA 3QERA 3SBGA 3MN6A 1S1WA 2V7YA 4MO5A 2P1JA 4KHUA 5AQYA 1YITN 4CGGA 1C0FA 3K0SA 4OPJA 3G10A 3CM6A 3ZX3A 4JS5A 5BN9A 2HHUA 3H46O 4IFEA 3LWLA 1LCUA 1S3XA 4FL9A 3JXUA 4B1WB 1FJGK 4DFMA 3E01A 3WNEA 1NK8A 3EY1A 1RDCA 4ILHA 3CJCA 3CETA 1GLJO 3O9TA 3AV9A 1BG3A 2WOMA 4MFBA 1QHTA 1T6DA 5CZ2A 1TVRA 3SI6A 4B9VA 4G1QA 5M1FA 3GE1A 3M5RA 3P83D 4PL7A 3IAYA 3VQ9A 3VTIA 3HSCA 1QSSA 1VSLA 1DLOA 3WNFA 1VSEA 2Z1JA 1WSEA 5CYQA 5C25A 1GLCG 2BE2A 4KREA 4FM2A 4DSFA 4BROA 3KLGA 3KWIA 4C8LA 1X9WA 4BWJA 4PQUA 2OYQA 5J2QA 1U49A 4DR7K 3J7ZO 3NH0A 2VWKA 4AHTA 5BPMA 4I6MB 2IVNA 1RT3A 2E1YA 4WCEL 1VSJA 2HBMA 1ATNA 4DTJA 1W97L 1T05A 5AQQA 4KPYA 4BWMA 3L2UA 2HHWA 3O8MA 3F5TA 4FM1A 1Z25A 3HOTA 1O13A 3LDSA 1ZBIA 4CJFA 1RT7A 3BUZB 3V1OA 4CJQA 1A5XA 1N36K 3I0RA 4CJSA 4DTUA 4Z4GA 4BC5A 3VEZA 3MN9A 3HSTB 4B1XB 2UXBK 3NDKA 1RDWX 1VHXA 5C12A 5F2RA 4DSIA 4WQ5C 2ZGYA 1HUXA 1C1CA 3R8EA 1JL2A 3OYNA 1J54A 2G8FA 4KRFA 2O8BB 4ELTA 1NKBA 4H5WA 2YJFA 4RCHA 4DV2K 3DRSA 5AQLA 2IC3A 5FDLA 2F8SA 2BUPA 1BA1A 4QS9A 1H1VA 2XY8A 3AVJA 4FJLA 5C2FA 3SAGA 1HYZA 4H0OA 2YX6A 4Z4FA 3THWA 2VCPA 4BVOA 2J4RA 4I7FA 2QTDA 4FW2A 3NVKA 4YOUA 4JD2B 3AVKA 3E9PA 1YIJN 3UB5A 4GVMA 4X64K 3CCQN 1KLNA 4TSXA 2KQ2A 2G8WA 4KB1A 3KKSA 4FJMA 4BR7A 3E66A 2FXUA 4NB4A 1V4TA 3WNGA 3M8SA 2HNZA 3TTCA 4O55A 2A3ZA 4OKKA 1C0UA 2QA4N 3VQAA 4YORA 3LZIA 4BRCA 4B1VA 3D2FB 4WQ4A 2HHTA 4JKBA 1QZ6A 2QWRA 3HVTA 4FWPA 1Q18A 3P38A 4CJPA 3NE6A 2F7TA 1FK9A 4H0YB 3W0LA 2NRRA 2BANA 1NJZA 4AQYK 5C10A 3TAEA 4A59A 1JCEA 2IDOA 2P9NA 3OYLA 4MDAA 2B5JA 4BR5A 1VSKA 3VQBA 4CD1A 4FO0A 4AILC 1BIZA 4RG8A 1RTJA 2ASPA 3VA0A 3MEGA 4FW1A 3KVGA 4QCLA 2I7NA 4LC9B 5F1XA 1VQ5N 1F21A 4IDKA 3DLKA 5GAGP 1HNZK 4CGIA 1EQYA 3S41A 3O1WA 1HMVA 3PX6A 5M1NA 1Q81O 2QI2A 1KVCA 3TWHA 1DGKN 3QO9A 5C2DA 1N5YA 4YDUC 5CYMA 4DTSA 1XC3A 3ATUA 3G4SN 3D7EO 1SZ2A 3HI0A 4DQQA 4ZHRA 5BRFA 3P5JA 4CE9A 3UKUB 1HPZA 1NJXA 1LOTB 1YTUA 1IKVA 3RMDA 5KTQA 2FSKA 3P31A 4DUYK 4ILGB 1J5OA 4DU1A 1TL3A 4OX9K 3NF7A 2W40A 2AP1A 4OPKA 2BTFA 2OPQA 5TKWA 1NU0A 1ZBSA 2GUIA 1TK5A 4NCGA 4EHUA 3MWTA 5HBMA 1LWFA 3ASMA 3JS6A 1A5WA 3HPHA 4Z4IA 1VSMA 3ATVA 3OBYA 2W42A 3V9XA 1QTMA 1YAGA 2CGKA 1IKXA 2P9KA 3TSQA 1NK9A 3VOVA 2I7PA 3CMEN 3AO4A 2OANA 2O8EA 4CGFA 2V7ZA 3THYA 1YXQA 5D3GA 4HCCA 5EU7A 3H1VX 4YY3K 4JKHA 4CIFA 3DXKA 2YHAA 3SJJA 2ZJPL 4IJAA 4OLAA 1EETA 2ETJA 2DFFA 4CEDA 4NYFA 3RSEB 1BI4A 4HWIA 4NCAA 4I6MA 3ZSQA 3GG4A 1X9SA 3VEWA 1J9AA 1HNWK 2GWJA 2VYPA 3M6GA 4M7YA 4XIUA 4NXMK 3VGMA 1VQPN 1WUAA 3O9QA 4NO7A 4BRFA 3E9LA 3DXMA 4H0VB 1UOCA 4JS4A 1JLBA 1GOCA 4IXCA 4CECA 3MN7A 3ZX2A 3CG7A 1OH7A 3FGUA 3H6EA 4FWKA 3V9UA 3AVIA 1JJ2M 3AVCA 2Q97A 1NGDA 3O4NA 2P9SA 4DF4A 2BH1A 3MMVA 2HHXA 2ASMA 3KTQA 1HR0K 3LP0A 3CFPA 3V1QA 1SUQA 4PKHA 5DMRA 1KD1O 3DLEA 1EWQA 3VQQA 1T6CA 4LF7K 1QQNA 3MK6A 2CGJA 1U47A 4CFAA 1KVAA 4IOXA 2O8DB 1U2VA 4FK4A 3I0SA 2X6NA 4CHQA 3CQ8A 3U8XA 1YF5L 5BPLA 4H03B 2UXDK 4GV3A 3T7ZA 1D5AA 3TR8A 4FWLA 4RW9A 1Y97A 2UUAK 5HLFA 4O5BA 2E5LK 3H1QA 3K2PA 3L3UA 5A2QO 3P4IA 1NJIO 3GDQA 1YJWN 3IUCA 1YVNA 3RMBA 1T3VA 3PSFA 1L5UA 4BE1A 2P5GA 2ZQBA 3AVHA 1T7PA 3UE5A 3HPGA 3EE9A 1E4GT 1C0TA 4M45A 1RT2A 3TU5A 2OTJN 4C8MA 1X3NA 1VSIA 3KD1E 4GKJK 1TL1A 4M3YA 4C1NK 3BY5A 4BG9A 1N33K 5AQJA 4J8FA 3ZYYX 3VEOA 4F3TA 2QWMA 4BC2A 1VQ6N 1JLQA 3VGKA 2Q0RA 4IEIA 4BRKA 2O8CA 4JKAA 1IV0A 3ENBA 1JL1A 1TAQA 1VRTA 1Q9YA 3G71N 2E88A 4YOTA 3SV3A 1GLFO 1GLEG 4DR5K 3MXMA 5J2NA 4Z4EA 4DSKA 1OVQA 4JI7K 2A42A 3THWB 4JKCA 3VQDA 1O1WA 4DTNA 4K8XA 3OW2M 2DTUA 1KFDA 5AFUA 2KZMA 5KPTA 5AQIA 3WEEA 3B6PA 2PY5A 4F3OA 4CZMA 2XY7A 2OPPA 5ELZA 2WONA 3B6OA 1U6ZA 3HJFA 1SL2A 4FVMA 4CF8A 1BIUA 4FJJA 4DV1K 2P9KB 4E7IA 2P9UA 4B9QA 3NF8A 4Y1DA 4OLBA 2JWLA 3IRXA 3DLLL 4E7JA 3SAHA 1REVA 4CI6A 3WXJA 1GLDG 4RW8A 3SJHA 5IT9O 4FLYA 5HRNA 3OYKA 1U4BA 4I9QA 4HCBA 3HYFA 4M7XA 2KW4A 2RHKA 2YNFA 4B3RK 3NBPA 3ZSRA 1G99A 3SK3A 1RBSA 4JHDB 1YTAA 4BDPA 3K59A 3WQTA 4JRQA 1Z6RA 3M8PA 3KWGA 3LPUA 3ZSXA 2HBJA 2YHYA 4JI1K 3LM2A 3U3YA 4R5PA 4DV7K 2A41A 4YOXA 3HRGA 3KK1A 4BVPA 3CJ7A 4E7HA 5SZTA 3AARA 1SV5A 3AAPA 1SQKA 2PYLA 1XMOK 3CJ9A 4CZLA 3F2KA 1LAWA 5AQOA 2HSTA 3ZCMA 1RBTA 2CGLA 4A2AA 5DK5A 3VQ8A 4F2RA 4J2EA
chains in the Genus database with same CATH topology
2NRZA 4BGBA 2FF3B 3HOTA 1O13A 4YOWA 3LDQA 4K43A 4BY9C 2QWOA 3C65A 1HKGA 3BUZB 4JK8A 1HKCA 2NNWA 3M3ZA 4BR0A 3K9KA 2GTDA 3CJBA 4CBUA 4BC5A 4IOCL 3VEZA 3MN9A 2ASOA 2QM1A 4MLHA 3CCUN 3QMLA 4AF1A 4B1XB 3ZX0A 1TYQB 3BF1A 3CQYA 3A5OC 4BRAA 1NGBA 5JLFA 1KC8O 1TYQA 1RDWX 3A8YA 5CR4A 4BRNA 4KH5A 4B1YB 4R79A 5C12A 4GV9A 4RTFD 4Z94A 5F2RA 3CMAN 4WQ5C 4U7BA 2ZGYA 2YCHA 4WFAL 5JLHA 1K9MO 1HUXA 3HBTA 4GV6A 3R8EA 1DEJA 3A0IX 4CZIA 4A5BA 3R9PA 4BRMA 3I55N 4H5WA 3IKMA 5M1QA 4CZHA 2YJFA 4RCHA 4O8UA 3PIPL 2QWQA 3O5BA 3Q7BA 5AQLA 2HF3A 3ENOA 4BREA 2BUPA 1BA1A 4QS9A 1H1VA 3EN9A 4A2BA 1RFQA 5C2FA 5M1OA 1Q82O 1XQSC 3SAGA 4H0OA 3CCRN 2YX6A 4EIAA 2FSNA 1JCGA 3M1FA 3CC4N 2VCPA 3CJAA 3CC2N 4WQ5A 4BVOA 2J4RA 3T69A 2D0PA 4WF9L 2QTDA 3FZMA 5EOYA 1ZXOA 4DB3A 5EY4A 4YOUA 5AQFA 3EZWA 3ENHA 4JD2B 4QS7A 5BR9A 2YJEA 3E9PA 1YIJN 3UB5A 4MO4A 3CCQN 4A57A 2PAVA 1NGIA 4BR7A 4BC4A 3DXMB 2FXUA 3E66A 3CQXA 1DT9A 1V4TA 1E4FT 4NB4A 4EHTA 2FLOA 4C23A 1YI2N 1X3MA 4WYBA 3W3DA 1JCFA 5AQWA 4FPAA 2NRWA 1VQ9N 3TTCA 4BR2A 2A3ZA 4JD2A 1NLVA 2IVOA 5AQNA 2Q31A 2QA4N 3D2EA 4JKGB 5AQZA 4YORA 3LDNA 4BRCA 3DJCA 4B1VA 2CH6A 3D2FB 1TUYA 4WQ4A 3BF3A 2WUSA 3Q7CA 4JKBA 1QZ6A 2QWRA 3H3OB 4FWPA 1Q18A 3P38A 4KBOA 2F7TA 2YI1A 3FZLA 4XEIA 1SS6A 1IJJA 3VGLA 2FSJA 3EE8A 3WQUA 2P9UB 4H0YB 3W0LA 5AQPA 4DQ8A 2NRRA 2P9PB 5C10A 3CPEA 3FZKA 4H5VA 1C0GA 1JCEA 1DKGD 4A59A 4ILJA 2P9NA 5HL7L 3LDLA 4B1UB 3R6MA 4MDAA 4BR5A 5KPRA 4GY2B 2PBDA 2ITMA 4IJNA 2WC9A 3L6QA 4XH4A 4CD1A 4XH1A 1D4XA 3IDHA 4FO0A 3L4IA 1IG8A 2DPNA 3U4LA 4YOVA 5AZJA 4DHYA 1K8KB 2HOEA 4JAXA 2GX9A 3EO3A 3B8AX 1NGCA 1QQOA 5JICA 3MCAB 2KKZA 2ASPA 4FOEA 1YHQN 1KAYA 3PIOL 3ZEUA 3CCVN 4JEPA 5LY3A 1BO5O 3VENA 3ZEUB 4MLEA 1HPMA 3FZHA 3KVGA 2VWBA 2HBLA 2I7NA 4L3QA 4LC9B 5F1XA 3CC7N 1VQ5N 2ZGZA 4NLBA 4FVUA 1Z05A 5GAGP 5EX5A 4H0PA 1V4SA 3E1YA 4JHDA 5MLCQ 5AQTA 3CCSN 1EQYA 5AQRA 2QWPA 3S41A 5GINA 5FPMA 2A5XA 3H45C 3O1WA 1VQ4N 1Q7YO 5BREA 2YHWA 1VQNN 2YHXA 5M1NA 1Q81O 2NRHA 2QI2A 3IFRA 1DGKN 4KH4A 5C2DA 4YDUC 3HOSA 3CERA 4H5TA 1K8AO 4WFBL 1XC3A 2D4WA 3N4PA 5AQKA 3ATUA 4AM6A 3G4SN 5H1SQ 3WEEB 3D7EO 3QDKA 3U9DA 4FSVA 1BWFO 1SZ2A 3HI0A 5AQUA 3VETA 5BRFA 3C6HA 3GBTA 3UKUB 2P9IA 4FWOA 5AR0A 3SLCA 4Y0WA 2P9IB 1LOTB 2KLAA 3O9RA 1HKBA 3DAWA 2F9WA 2Q1NA 2QW9A 3EKSA 2FSKA 3P31A 1WOQA 4ILGB 2H3GX 2EWSA 2P9LB 4BRIA 2E20A 2W40A 4IEEA 5AQGA 1VQ7N 3MX5A 2AP1A 1VQ8N 2BTFA 3CD6N 3CCLN 3O80A 5TKWA 1QZ5A 1XUPO 2NLXA 4M63C 4XH5A 4DKWA 3UKRA 4UY8O 1ESVA 1OVYA 1ZBSA 4YDUA 1YJ9N 5E26A 4EHUA 3ZETB 3MWTA 3O6WA 4JK9A 3A5NC 5KPZA 3E9OA 5AQVA 3JS6A 5GIPA 5CE3A 1P90A 4IZ9A 3ATVA 1VQKN 1HJOA 2E2OA 3OBYA 4H5RA 4BRGA 3MN5A 1S72N 1J6ZA 1M1KO 5JMVA 1YAGA 4FWRA 1CZAN 2CGKA 2P9KA 1BA0A 4ISGA 4JN4A 4O5FA 1VQON 2UYTA 3TSQA 5BRDA 1N8RO 3TPQA 3QB0A 5AZJB 3VOVA 2E1ZA 2I7PA 3CMEN 3FR0A 3BEXA 1HX1A 2OANA 3CCMN 1KQSM 2GELA 3MWPA 1NGFA 1YUWA 2V7ZA 1YXQA 4BRQA 3WT0A 4BRHA 4CD3A 3H1VX 3A5MC 4FOIA 3AGKA 4JKHA 3AAQA 3DXKA 5AQSA 1NM1A 5AZIA 1QVGM 2ZJPL 3A5LC 4JNEA 5GIOA 4U67L 4A62A 4IJAA 1P8ZA 3HZ6A 3VMFB 1QQMA 3TTFA 2FF6A 4JKDA 3D2FA 2KHOA 3RSEB 3WXLA 3C7NB 4HWIA 3VEVA 4BGAA 1HLUA 2VGNA 3GOIA 4GVEA 3GG4A 4I6MA 4BR9A 5BN8A 2Q2RA 3VEWA 1Q86O 2E2QA 2GWJA 2VYPA 3M6GA 4M7YA 1VQLN 2HF4A 2HBKA 1GLLO 1S22A 3C6AA 3VGMA 1VQPN 1WUAA 3O9QA 3OA9A 4NO7A 4BRFA 2A40A 3E9LA 4FWNA 3DXMA 4H0VB 3LM9A 2CH5A 3VERA 1BOTO 3WXMB 3ZETA 4PKIA 1TUUA 3I33A 4IXCA 3SMPA 3I56N 3MN7A 2QEXN 5M1PA 4CZEA 3ZX2A 3G6EN 2VGMA 4F9OA 1NBWA 2ZJRL 3EKUA 3FGUA 3I8BA 3H6EA 4FWKA 1JJ2M 2V52B 5JVGL 4AM7A 3O4WA 1MA9B 3VF6A 5DM7L 2Q97A 1NGDA 2P9SA 2BH1A 2D1KA 5TKYA 3MMVA 5KQDA 4O8KA 2ASMA 2D0OA 4JK7A 4BQZA 1ILYA 5FPEA 5B8HA 4A5AA 2A6AA 5E84A 1KAXA 2QWLA 3O1BA 3TTDA 3ULEB 3LDPA 4PKHA 3VF2A 1KD1O 4H0TB 1T44A 2NRVA 4JKFA 1NGEA 1EO1A 3BP8A 1T6CA 3QBXA 3CCJN 1QQNA 5EXWA 3TSPA 3ID6A 3MK6A 4QS8A 2CGJA 1NWKA 5ADXA 1MWKA 1ATRA 4CBXA 3QICA 4IOXA 4IWVA 1U2VA 3MCPA 4CJ7A 2QXLA 3QFPA 3AY9A 5ADXH 4CZFA 2ZWHA 3SMSA 3QBWA 1YF5L 3U8XA 4FWMA 4H03B 5BPLA 4GV3A 4JKGA 3T7ZA 3NMUA 3KHYA 3PLAA 3VF4A 2P9SB 4FWLA 4OPHA 4BR4A 1GLAG 1YJNN 3ID8A 3FFKB 1ATSA 4EFHA 4HTLA 3VEXA 3H1QA 2GUPA 3L0QA 1K73O 4A61A 3VESA 3NVMA 3P4IA 3KK7A 1NJIO 3GDQA 3VEYA 1YJWN 4C1NI 5GAHP 3IUCA 5GADP 3J8AA 1YVNA 5AQHA 1T3VA 3FE1A 3KZBA 3TSUA 4MDBA 4IO9L 4PHTX 3VTHA 3ULEA 4OO1J 3G25A 5GAEP 4BRPA 3UE5A 3EE9A 1E4GT 1NMDA 5FPDA 5AQMA 3TU5A 4PL8A 1ZC6A 3CHWA 4BQLA 4GNIA 2OTJN 3CXCM 3FLCO 1X3NA 2P9PA 1BUPA 2JWKA 2WFBA 4BC3A 2GWKA 4C1NK 2IIRA 3MDQA 4YOYA 4BG8A 4FWQA 4BG9A 5AQJA 3WXKA 4J8FA 3ZYYX 4IOAL 4CZKA 1RDUA 3VEOA 4ISEA 4CBWA 2QWMA 4ISFA 4NLCA 4BC2A 1VQ6N 3VGKA 2Q0RA 5EVZA 1BDGA 3NVKA 5AQXA 2F9TA 4IEIA 4BRKA 3N4QA 4JKAA 3ENBA 5M1KA 1KXPA 2E2PA 3CF5L 3R3LA 2W41A 4WQ4C 3G71N 2NZTA 4K41A 2E88A 5I9EB 3O9UA 4FPBA 4YOTA 1GLFO 2GEMA 1W2BM 1R59O 1GLEG 1KAZA 2E2NA 1NGJA 2P9LA 3F9MA 3CPWM 5BPNA 5LJVA 3K9JA 1GLBG 4PKGA 3SBGA 3MN6A 2A42A 2V7YA 4MO5A 1K8KA 4JKCA 5AQYA 1YITN 1C0FA 1U2VB 1VAZA 5AFUH 3HM8A 3RSEA 3OW2M 4CZJA 5AFUA 3CJ1A 5KPTA 5AQIA 3WEEA 3ZX3A 3IMXA 5BN9A 3CIPA 4CZMA 3QFUA 3H46O 3D6RA 5KQ8A 5AZIB 5ELZA 4IFEA 1U6ZA 2V51B 3R1XA 1NGGA 1LCUA 5LJWA 1S3XA 3LL3A 4FL9A 3FZFA 2PFUA 5DM6L 3O08A 3JXUA 2NRXA 2P9KB 4B1WB 2P9UA 3P39A 4B9QA 3MX2A 2JWLA 4ILHA 3HTVA 4G9ZA 3O9SA 3CJCA 3DLLL 4K25A 5FPNA 5C15A 3SAHA 3D2EB 4CI6A 3CETA 4IO8A 3WXJA 1GLJO 3EL2A 3O9TA 1GLDG 1BG3A 1T6DA 3L4QA 3SJHA 1M90O 2RE2A 1Y64A 2Q0UA 3C0BA 3UKRB 2E8AA 4K42A 5M1FA 4RWTA 3U9ZA 3GE1A 3M5RA 1BU6O 4M7XA 4PL7A 3SAFA 5JVHL 2RHKA 3VTIA 3HSCA 4CZGA 1G99A 3OHRA 3SK3A 4JHDB 4H0XB 4BRLA 3WQTA 5BRHA 2ZF5O 3WXIA 3OBWA 1GLCG 1SAZA 1Z6RA 2HMPA 3WUHA 3KWGA 1MDUB 4JKEA 2Q36A 3H3NO 4BROA 2HBJA 2YHYA 2ZJQL 3LM2A 1VQMN 1QHAA 3KWIA 1QVFM 5C0YA 4OPAA 2NRTA 3AGRA 3UKUA 4FWSA 3J7ZO 4IDHA 3C7NA 3LDOA 2A41A 1NGHA 5CHIA 2WBNA 4YOXA 5F0XA 3CI5A 3DWLA 3HRGA 4BVPA 4EAHD 5BPMA 3CJ7A 4I6MB 1MWMA 4KH6A 2OTLN 1NGAA 3VPZA 2IVNA 4E1JA 2E1YA 3DXKB 3AARA 3RVCA 3CCEN 3AAPA 4WCEL 1SQKA 2HBMA 5HOOA 4DCHA 2IVPA 1ATNA 3CJ9A 3F2KA 4CZLA 3SBTA 2QWNA 1W97L 4H5NA 4BRDA 4B1ZA 4WFNL 1X9JA 5AQOA 2HSTA 2P9NB 5AQQA 1OKJA 1RGIA 2AA4A 2CGLA 3O8MA 4A2AA 3F5TA 3GL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFE A;  5C10 A;  3CPE A;  3C6H A;  4IDH A;  5M1F A;  3C6A A;  4IEE A;  4IEI A;  5C12 A;  5M1N A;  5C15 A;  5M1Q A;  5C2F A;  5M1O A;  5M1K A;  5M1P A;  5C2D A; 
#chains in the Genus database with same CATH topology
 4YOW A;  2RF2 A;  3LZJ A;  3NGI A;  3MXI A;  4CJ5 A;  4BR0 A;  4E19 A;  3KLH A;  3CCU N;  3QML A;  2HVI A;  1TYQ B;  3CQY A;  1TYQ A;  3CYM A;  4BRN A;  2X74 A;  4Z94 A;  3TAP A;  3A2F A;  4KB0 A;  1TKD A;  5JLH A;  4ELV A;  1ASW A;  1DEJ A;  1HYS A;  4ZTJ A;  3AVA A;  3A0I X;  3LP1 A;  4CZI A;  4BRM A;  3R9P A;  4B9N A;  3IKM A;  4OJR A;  4DQI A;  3V9W A;  2QWQ A;  5CZ1 A;  4X62 K;  3Q7B A;  1LW2 A;  2FC0 A;  1KSP A;  4E1M A;  3ENO A;  4BRE A;  3F9K A;  4OGE A;  4CCH A;  5T7B A;  4A2B A;  4CEZ A;  1XQS C;  3AVG A;  4DU4 A;  1X9M A;  3CC4 N;  3CJA A;  3CC2 N;  1JLE A;  4FZX C;  3HO1 A;  1ZXO A;  3EZW A;  1S6P A;  3NHG A;  2YJE A;  4MO4 A;  4DR2 K;  3TAN A;  3SPZ A;  2VQF K;  4CJ3 A;  2IAJ A;  3K5L A;  4BC4 A;  3DXM B;  1E4F T;  1YI2 N;  4C23 A;  1C1B A;  1VQ9 N;  2NRW A;  5CY4 A;  1Q9X A;  4DR6 K;  3C6U A;  3L2R A;  1TKZ A;  2IVO A;  1U04 A;  3D2E A;  4OVL A;  4DUZ K;  4KAZ A;  1TUY A;  1KVB A;  2WUS A;  4FJ7 A;  4CEE A;  4GKK K;  1L3S A;  3LPT A;  3H3O B;  3V4I A;  3VGL A;  3FZL A;  2IS3 A;  1IJJ A;  3WQU A;  2FSJ A;  4DQ8 A;  4CJE A;  5AQP A;  5JS2 A;  2P9P B;  3ALY A;  5J1E A;  1HQE A;  3FZK A;  4YFU A;  4H5V A;  1DKG D;  1HYV A;  4ILJ A;  3LDL A;  3MEE A;  1VK0 A;  1BCM A;  4GY2 B;  1B9D A;  2PBD A;  4M42 A;  4IJN A;  3L8B A;  4XH4 A;  3IDH A;  3L4I A;  2R7Y A;  2DPN A;  3SZ2 A;  4YOV A;  4LFC K;  2B4J A;  4JAX A;  1I39 A;  2BGG A;  1QQO A;  4B9L A;  3QET A;  5HRR A;  1NOZ A;  4CEQ A;  4KO0 A;  1NK4 A;  1KAY A;  1HPM A;  3FZH A;  2QKB A;  3OYB A;  1RTH A;  2VWB A;  4JRP A;  3CC7 N;  2ZGZ A;  4ZTF A;  5KGW A;  4Y1C A;  5EX5 A;  2F4V K;  1BL3 A;  1G15 A;  4JHD A;  3KIO A;  4DR4 K;  2YNI A;  4LSL A;  3L2V A;  2A5X A;  3AA5 X;  3K58 A;  4CJU A;  2HHV A;  2ZE2 A;  4N47 A;  4KTZ A;  2W6K A;  2GV9 A;  3EEQ A;  3QEI A;  3HOS A;  3CER A;  4H5T A;  4WFB L;  4M3X A;  5H1S Q;  3SYZ A;  4FSV A;  1BWF O;  4KI4 A;  1YVU A;  3OY9 A;  3RMC A;  3LAM A;  3C6H A;  5AR0 A;  4Y0W A;  3K57 A;  4B3S K;  5JS1 A;  2JGU A;  2F9W A;  4JI2 K;  2QW9 A;  4B8C A;  4B9M A;  1LW0 A;  5AQG A;  1RBV A;  4FJN A;  4CHZ A;  3CCL N;  3RMA A;  4BDZ A;  2NLX A;  4XH5 A;  1XHZ A;  1OVY A;  5E26 A;  3ZET B;  3VQ7 A;  1Q8I A;  4JK9 A;  3A5N C;  5CE3 A;  1P90 A;  4FCY A;  4KHS A;  1HJO A;  1LWC A;  2E2O A;  4H5R A;  3MN5 A;  2YKM A;  5K14 A;  1D9D A;  1M1K O;  1CZA N;  3T3F A;  4JN4 A;  1N8R O;  2UYT A;  4JV5 K;  5LMN K;  3KKR A;  3T1Y K;  3TPQ A;  1NNE A;  3QB0 A;  5AZJ B;  3FR0 A;  2FBX A;  3CCM N;  1NGF A;  3OS1 A;  2D5R A;  3WT0 A;  4W5N A;  4BRH A;  4CD3 A;  4FLZ A;  3A5M C;  4FOI A;  3AGK A;  3OTO K;  3SCX A;  3OYD A;  3VQ6 A;  4PY5 A;  4U67 L;  3ZSV A;  3HZ6 A;  4KHQ A;  4CER A;  1S1T A;  2OCE A;  4Q5V A;  1WSH A;  3J80 O;  1HNX K;  4LF4 K;  1RBR A;  1Q86 O;  2E2Q A;  4Z0U A;  1VQL N;  2HF4 A;  2HBK A;  3C6A A;  5I42 A;  4AHS A;  2G8H A;  4B3T K;  2CH5 A;  4PKI A;  1FKP A;  4DR3 K;  1RT4 A;  5M1P A;  5HRS A;  4CFB A;  2VGM A;  1VRU A;  1QSY A;  4LY7 A;  2P51 A;  5JVG L;  3O4W A;  1S1V A;  1NK0 A;  4B08 A;  4DU3 A;  4DSJ A;  4O8K A;  4JK7 A;  3OYI A;  3KJV A;  4BQZ A;  3OS0 A;  2G8I A;  1IBL K;  3KD5 E;  3BDP A;  5KRT A;  1KAX A;  3ZT1 A;  3OYF A;  4KHW A;  2QWL A;  2Z1H A;  1NKE A;  1T44 A;  1QQC A;  3S9H A;  4JKF A;  4B3M K;  2G8K A;  3BZK A;  4K0K K;  1EO1 A;  5EXW A;  3DLG A;  3TSP A;  4DR1 K;  5ADX A;  3TAR A;  1RCH A;  1TKT A;  4E3S A;  1VSH A;  1WAJ A;  1ATR A;  2YKN A;  3QIC A;  4CBX A;  4LFB K;  3JSM A;  4FJ9 A;  5ADX H;  4CZF A;  4NYN A;  3SMS A;  3QBW A;  4PWD A;  1SKW A;  3NMU A;  1I94 K;  2XRI A;  3KHY A;  4FJ8 A;  4FZZ A;  1XC9 A;  4I2Q A;  1ATS A;  4A61 A;  3ZT4 A;  3VEY A;  3S3O A;  4B9U A;  3FE1 A;  3HL8 A;  3TSU A;  4JI3 K;  3HK2 A;  1CZ9 A;  2OZS A;  3O4Q A;  3PY8 A;  4BRP A;  1LV5 A;  5AQM A;  4BQL A;  3D0P A;  4AHC A;  3TI0 A;  3FLC O;  1T8E A;  2JWK A;  3ITH A;  1S5J A;  4W5O A;  2WFB A;  2GWK A;  4YOY A;  1ZBL A;  4M41 A;  4FWQ A;  1NJW A;  4AHU A;  4IOA L;  5FRN A;  4CBW A;  4ISE A;  2VG6 A;  3T1A A;  4ISF A;  4LFA K;  1WBD A;  5AQX A;  3SUO A;  1RT1 A;  3N4Q A;  3DOK A;  1KXP A;  2E2P A;  3CF5 L;  1JKH A;  3EZ5 A;  3VN5 A;  3O3G A;  3QNO A;  4CFD A;  1TK0 A;  3QIO A;  5I9E B;  1W2B M;  2Z1G A;  2E2N A;  1NGJ A;  3CPW M;  2KFZ A;  2UXC K;  3QES A;  1UA1 A;  3HP6 A;  1BQN A;  1K8K A;  1U2V B;  1J5E K;  1VAZ A;  5AFU H;  4E1N A;  3HM8 A;  3RSE A;  5LMU K;  3CJ1 A;  3KLE A;  2ITG A;  3NF6 A;  4E0D A;  1RT6 A;  2E6M A;  3CIP A;  3QFU A;  3D6R A;  5KQ8 A;  5AZI B;  4LF8 K;  3VQ4 A;  3FZF A;  4O4G A;  2PFU A;  5DM6 L;  3O08 A;  3CM5 A;  3P39 A;  1NG9 A;  3MX2 A;  1WBB A;  2X78 A;  4E7K A;  2O8F B;  3HTV A;  4G9Z A;  3O9S A;  3J81 O;  3TAM A;  4K25 A;  5FPN A;  2VG7 A;  3DYA A;  4YHH K;  3EL2 A;  4B9S A;  2UUC K;  4QOZ B;  1Y64 A;  4DV6 K;  3UKR B;  4KV8 A;  4W5Q A;  2E8A A;  3SQ4 A;  3U9Z A;  4DSL A;  1BU6 O;  3SAF A;  5JVH L;  4CZG A;  1ZYQ A;  5KRS A;  1CZB A;  3THV A;  3OHR A;  4EP5 A;  3ZT3 A;  2G8V A;  4BRL A;  5BRH A;  3WXI A;  3OBW A;  1SAZ A;  2HMP A;  3WUH A;  4FJH A;  4CK2 A;  4JKE A;  2ZJQ L;  1QHA A;  1EX4 A;  1S6Q A;  2B6A A;  1QVF M;  4OPA A;  5C0Y A;  3AGR A;  4FWS A;  1NJY A;  3C7N A;  4IG3 A;  1NGH A;  5CHI A;  5F0X A;  3CI5 A;  1BIS A;  3MAQ A;  4DS5 A;  3F73 A;  3QEW A;  4EAH D;  3OYE A;  1MWM A;  4KH6 A;  2OTL N;  1NGA A;  3AVM A;  1TAU A;  3DXK B;  3TAB A;  4DQP A;  4DCH A;  1GOA A;  2IVP A;  3DLH A;  1SL0 A;  1BCO A;  2QWN A;  4BRD A;  4WFN L;  2YNH A;  2P9N B;  4CES A;  3NFA A;  3VQE A;  4LF9 K;  1RGI A;  1BHL A;  3PX4 A;  2NRZ A;  2AJQ A;  2FF3 B;  2LSN A;  1TK8 A;  2VG5 A;  4BY9 C;  1RIL A;  2QWO A;  3C65 A;  1HKG A;  4JK8 A;  1OH8 A;  4LSN A;  3K9K A;  4F8R A;  4CBU A;  2XY6 A;  4IOC L;  2ASO A;  4MLH A;  4NXN K;  2PYJ A;  3A5O C;  1NGB A;  1KC8 O;  5CR4 A;  3C94 A;  4RTF D;  1C0M A;  2ATQ A;  2YCH A;  4WFA L;  1NMN A;  1NOY A;  3KLF A;  3L2Q A;  4PA1 A;  1BGX T;  2FBV A;  3P1G A;  4A5B A;  4DQS A;  4CZH A;  4O8U A;  1LWE A;  2EX3 A;  4DTM A;  4W5T A;  3V81 A;  4CEF A;  3EN9 A;  3HVR A;  4H4O A;  1ASU A;  1RFQ A;  4DV4 K;  5M1O A;  3SQ2 A;  3ZSO A;  1Q82 O;  3CCR N;  4EIA A;  3M1F A;  1JCG A;  3TAF A;  3DI6 A;  3T69 A;  5EOY A;  1RT5 A;  5EY4 A;  5AQF A;  1E3M A;  1N6Q A;  1RDD A;  2PAV A;  4LH4 A;  4UQG A;  3CQX A;  2Y1J A;  3QEP A;  1B92 A;  4WYB A;  4DFP A;  4BR2 A;  1ASV A;  4JD2 A;  1NLV A;  3DRR A;  5AQZ A;  3RWU A;  2A1S A;  3LDN A;  2CH6 A;  2YNG A;  3NGY A;  3Q7C A;  1DTT A;  1JLG A;  2YI1 A;  1SS6 A;  4CHN A;  1XHX A;  3EE8 A;  1S9G A;  4FJI A;  4H4M A;  4IFY A;  4IG0 A;  5C42 A;  1C0G A;  4M3U A;  4X66 K;  3SUP A;  5J2P A;  2O8E B;  5KPR A;  2ITM A;  2WC9 A;  3L6Q A;  2YHB A;  4XH1 A;  3HP9 A;  4CJL A;  4DHY A;  5AZJ A;  2GX9 A;  3EO3 A;  3B8A X;  3RR7 A;  5JIC A;  2KKZ A;  1YHQ N;  1OH5 A;  2OA8 A;  3ZEU A;  4JEP A;  5LY3 A;  3ZEU B;  4MLE A;  2HBL A;  3OJS A;  2OPS A;  4GMJ B;  1WNS A;  3E1Y A;  1TKX A;  3CCS N;  1KRP A;  2QWP A;  1UWB A;  2D0B A;  3U6F A;  5GIN A;  5FPM A;  3H45 C;  1KLM A;  3QNN A;  1VQ4 N;  4FLT A;  1Q7Y O;  5FRO A;  2YHW A;  3LWM A;  1RTI A;  1X1P A;  1EWR A;  2D4W A;  3N4P A;  5AQK A;  2VQE K;  3NGZ A;  3WEE B;  3CFR A;  4O44 A;  4FYD A;  4ID1 A;  4KHN A;  3VET A;  2IOC A;  1KTQ A;  3GBT A;  4X65 K;  1CXQ A;  4FWO A;  4DMN A;  3MEC A;  3V9S A;  4K8Z A;  3O9R A;  1QSL A;  1WOQ A;  2P9L B;  4EP4 A;  4BRI A;  4CEA A;  1VQ8 N;  2HNY A;  4F2S A;  1QZ5 A;  1XUP O;  4CJT A;  4RW6 A;  4M63 C;  3UKR A;  4UY8 O;  1ESV A;  4FM0 A;  1IBM K;  1L3T A;  3O6W A;  2O8C B;  3C95 A;  5KPZ A;  3PV8 A;  5AQV A;  5GIP A;  4IZ9 A;  4CF0 A;  1VQK N;  1RDA A;  1WSJ A;  4BRG A;  1S72 N;  3PUF A;  4GW6 A;  2PZS A;  5JMV A;  1VQM N;  4O5F A;  2G8U A;  4EZ9 A;  1VQO N;  4CJK A;  1NK6 A;  4CIG A;  2HHQ A;  2E1Z A;  1TGO A;  1KQS M;  1EKE A;  4CHY A;  2GEL A;  4I9L A;  1YUW A;  4BRQ A;  4CGD A;  4N41 A;  3FFI A;  3M8R A;  4BDY A;  4AHR A;  5AQS A;  2F8T A;  5AZI A;  4FK2 A;  3A5L C;  4JNE A;  5GIO A;  2KFN A;  3ZT0 A;  1XWL A;  4A62 A;  3VMF B;  1QQM A;  3TTF A;  2KTQ A;  3I8D A;  3O3H A;  2FF6 A;  3SQ0 A;  3D2F A;  4CJ4 A;  4Z4C A;  3WXL A;  1WSI A;  3NCI A;  3VEV A;  4BGA A;  3V9Z A;  1U48 A;  4BR9 A;  3NF9 A;  4GVE A;  5BN8 A;  2Q2R A;  3QIN A;  3SQ1 A;  2A40 A;  3BZC A;  2E4L A;  4CF9 A;  3C6T A;  3LM9 A;  3AA2 A;  3ZET A;  4DFK A;  1TUU A;  1L3V A;  3SMP A;  4CHP A;  3UIQ A;  4CZE A;  4AH9 A;  3VF6 A;  1QE1 A;  5DM7 L;  1N32 K;  2FBT A;  4KKO A;  4CEB A;  5TKY A;  2D0O A;  5B8H A;  4N76 A;  1J53 A;  4A5A A;  3KK2 A;  5E84 A;  1WSG A;  3O1B A;  4ID5 A;  3LDP A;  4CK3 A;  2IGI A;  2NRV A;  4HUE A;  3TAQ A;  1NGE A;  3CCJ N;  5E41 A;  4HTU A;  3ID6 A;  4KTQ A;  1MWK A;  3EYZ A;  2HMI A;  3AA3 A;  4CJ7 A;  3QFP A;  4DQR A;  2ZWH A;  1WSF A;  3BGR A;  4FWM A;  2YV0 X;  3RRG A;  4JKG A;  4JI6 K;  5KI6 A;  2A1R A;  3PLA A;  5HP1 A;  4M3T A;  4OPH A;  4BR4 A;  3K5N A;  1YJN N;  1GLA G;  3ID8 A;  4EFH A;  2JLE A;  4YNQ A;  2ZD1 A;  2GUP A;  3ZSZ A;  3KLI A;  1WB9 A;  3KK7 A;  4B8A B;  5AJ3 K;  3L2W A;  4C1N I;  1IH7 A;  5GAH P;  3J8A A;  3OYA A;  5AQH A;  4CGJ A;  3KZB A;  4DS4 A;  4HHT A;  4OO1 J;  5FPD A;  1C1A A;  1IG9 A;  4C8O A;  1ZC6 A;  3CHW A;  2P9P A;  3J7A P;  1BUP A;  2UU9 K;  2IIR A;  1N34 K;  3ULD A;  4RW4 A;  4CFC A;  3WXK A;  1RDU A;  4EZ6 A;  1JLA A;  4DTR A;  4F4K A;  1D9F A;  5EVZ A;  1W9H A;  1IKW A;  1HRH A;  2F9T A;  4JI5 K;  4E89 A;  5M1K A;  1CXU A;  3THY B;  4KFB A;  1WAF A;  1U45 A;  3OYJ A;  2O4I A;  2OPR A;  4DSE A;  2GEM A;  3THX A;  2P9L A;  1UA0 A;  5BPN A;  4FJX A;  4PKG A;  1FW6 A;  1QS4 A;  4FXD A;  4DF8 A;  4M3R A;  2QXF A;  4DV5 K;  4Z4H A;  4CZJ A;  3SNN A;  2RKI A;  1RDB A;  3IMX A;  3SV4 A;  5HRP A;  2V51 B;  3R1X A;  4CHO A;  4HUF A;  1NGG A;  5LJW A;  3LL3 A;  2NRX A;  4BE2 A;  2HHS A;  1UAX A;  3DM2 A;  4KHY A;  2Q3S A;  5C15 A;  3D2E B;  3T19 A;  4IO8 A;  3L4Q A;  1M90 O;  2RE2 A;  2XHB A;  2O4G A;  2Q0U A;  1JXB A;  3C0B A;  4K42 A;  4RWT A;  1EP4 A;  4CF2 A;  4LH5 A;  4AHV A;  4H0X B;  2ZF5 O;  1MDU B;  2Q36 A;  3H3N O;  4NCB A;  3ZSW A;  1WLJ A;  2NRT A;  3UKU A;  4IDH A;  1BI4 B;  3LDO A;  5HRO A;  3DMJ A;  2WBN A;  3DWL A;  1HQU A;  3M8Q A;  3CFO A;  3VPZ A;  4E1J A;  3RVC A;  3CCE N;  3J7Y P;  5HOO A;  3SBT A;  4B9T A;  3HT3 A;  4H5N A;  4CEO A;  4B1Z A;  1A5V A;  1X9J A;  3LP3 A;  3AVL A;  1OKJ A;  3SUQ A;  2AA4 A;  3GL1 A;  4CK1 A;  4BGB A;  4C8K A;  3LDQ A;  2XY5 A;  4K43 A;  5SWM A;  1HKC A;  2NNW A;  4ELU A;  3M3Z A;  4CIE A;  2GTD A;  3CJB A;  5FLX O;  5C24 A;  1TV6 A;  2QM1 A;  1IO2 A;  4AF1 A;  3ZX0 A;  3BF1 A;  4BRA A;  5JLF A;  3OYG A;  3A8Y A;  2O8D A;  4R79 A;  4KH5 A;  4B1Y B;  4DV3 K;  4GV9 A;  3CMA N;  4U7B A;  3LAK A;  1VSD A;  4LD0 A;  4FJK A;  3D45 A;  3VA3 A;  1K9M O;  3HBT A;  4GV6 A;  2HND A;  2I5J A;  1L3U A;  4DTP A;  3OYM A;  1XI1 A;  3I55 N;  5M1Q A;  3PIP L;  3O5B A;  3HM9 A;  3G0Z A;  2HF3 A;  4DLG A;  1RNH A;  5I3U A;  3QEX A;  1ZBH A;  3AO2 A;  2VWJ A;  1I3A A;  4JYA K;  2DFE A;  2FSN A;  2X6S A;  4WQ5 A;  4N5S A;  2D0P A;  4WF9 L;  3FZM A;  4CGH A;  4DB3 A;  5BR9 A;  3ENH A;  4QS7 A;  4FZY A;  1ITG A;  1OH6 A;  4A57 A;  4DG1 A;  1NGI A;  3ZSY A;  4CW7 B;  4EHT A;  1DT9 A;  3VQ5 A;  2FLO A;  3OJU A;  4V19 S;  4BE0 A;  1X3M A;  4QAG A;  4MQ3 A;  3W3D A;  1JCF A;  5AQW A;  3AVN A;  4FPA A;  2ZM6 K;  1IKY A;  1HNV A;  3PO4 A;  5J2M A;  4OKE A;  4FJG A;  5AQN A;  3IG1 A;  2Q31 A;  4JKG B;  2GBZ A;  2E6L A;  3DJC A;  4J2B A;  3BF3 A;  4N56 A;  3NH2 A;  2O8F A;  2NUB A;  4KBO A;  3DOL A;  4XEI A;  2P9U B;  3AVF A;  1C6V A;  2Z1I A;  4W5R A;  3DLB A;  1JLF A;  3CPE A;  3O3F A;  1K6Y A;  1IBK K;  5HL7 L;  4B1U B;  3R6M A;  3LAL A;  3RR8 A;  5FRM A;  4FLW A;  1RTD A;  1JLC A;  1D4X A;  1ZBU A;  1IG8 A;  3U4L A;  3T1H K;  1K8K B;  2HOE A;  5IWA K;  1NGC A;  3MCA B;  4FLV A;  3IS9 A;  4FOE A;  3PIO L;  3CCV N;  2KZZ A;  1BO5 O;  1LAV A;  3VEN A;  3THX B;  4KI6 A;  4J2D A;  4L3Q A;  4DWI A;  5LL6 Z;  4CJR A;  4NLB A;  4FVU A;  1Z05 A;  4H0P A;  1V4S A;  5MLC Q;  5AQT A;  5AQR A;  4IBN A;  3VQC A;  4FK0 A;  1R0A A;  5BRE A;  1MU2 A;  1VQN N;  2YHX A;  2NRH A;  3IFR A;  4KH4 A;  3AO1 A;  1K8A O;  3L3V A;  4AM6 A;  1GOB A;  2HVH A;  3QDK A;  3U9D A;  1KFS A;  5AQU A;  1HJR A;  4I2P A;  3DLR A;  2P9I A;  3SLC A;  2P9I B;  2KLA A;  2OZM A;  1HKB A;  3DAW A;  2Q1N A;  3EKS A;  2H3G X;  1BQM A;  2EWS A;  2E20 A;  4IEE A;  1VQ7 N;  3MX5 A;  2F96 A;  3CD6 N;  4LF6 K;  3O80 A;  3MED A;  3NAE A;  3AO3 A;  4DKW A;  2QKK A;  1W0H A;  1DTQ A;  3PO5 A;  2O8B A;  1YJ9 N;  4YDU A;  2WTU A;  1CLQ A;  4CJV A;  3LP2 A;  1Z26 A;  2RN2 A;  4OGC A;  3E9O A;  3PSI A;  1FKO A;  4L8R B;  4FLU A;  1J6Z A;  4DTO A;  2UUB K;  1WN7 A;  4FWR A;  4LF5 K;  1BA0 A;  4ISG A;  2DY4 A;  5BRD A;  3AVB A;  3JAM O;  1EXQ A;  4O0I A;  4IFV A;  3ZT2 A;  1HX1 A;  3BEX A;  4DV0 K;  3MWP A;  4DLE A;  4M3Z A;  3AAQ A;  1NM1 A;  1QVG M;  4FJ5 A;  1XNQ K;  1P8Z A;  3PX0 A;  3V1R A;  4JKD A;  2KHO A;  3KK3 A;  3C7N B;  1HLU A;  3DRP A;  1NKC A;  2VGN A;  3GOI A;  3K5O A;  1SKS A;  3AA4 A;  1GLL O;  1S22 A;  1S1U A;  4OKJ A;  3MXJ A;  3S3N A;  3OA9 A;  2Y1I A;  4FWN A;  3V6D A;  2DFH A;  3VER A;  1BOT O;  3WXM B;  3I33 A;  2P5O A;  3I56 N;  2QEX N;  3OVN A;  1HNI A;  3G6E N;  4F9O A;  1NBW A;  2ZJR L;  3EKU A;  3I8B A;  2V52 B;  4AM7 A;  1MA9 B;  1KCF A;  1XMQ K;  1YT3 A;  3TAG A;  2HB5 A;  2HW3 A;  3LAN A;  3JYT A;  2D1K A;  4KTW A;  4HVJ A;  2QK9 A;  3U3G A;  1VSF A;  5KQD A;  3SPY A;  3NH1 A;  1ILY A;  5FPE A;  3QIP A;  3K5M A;  2A6A A;  4H8K A;  4CF1 A;  3HXM A;  3TTD A;  3ULE B;  3OS2 A;  3VF2 A;  4JI0 K;  3H08 A;  4H0T B;  2HHH K;  4CVN E;  4JI4 K;  3BP8 A;  3QBX A;  2EHG A;  1ZBF A;  1B9F A;  4O0J A;  4QS8 A;  2BDP A;  4JI8 K;  1NWK A;  1JXE A;  4ICL A;  1FXX A;  4JLH A;  4IWV A;  3MCP A;  2QXL A;  3AY9 A;  3VF4 A;  4CJW A;  2P9S B;  3ISN C;  3FFK B;  4HTL A;  3VEX A;  5KGX A;  4FLX A;  3L0Q A;  1K73 O;  3WNH A;  3VES A;  3NVM A;  5BR8 K;  2D0A A;  4PUO A;  5GAD P;  1NK5 A;  4E7L A;  2XO7 A;  4MDB A;  4IO9 L;  4PHT X;  4WE1 A;  3VTH A;  4C8N A;  3ULE A;  3G25 A;  4RW7 A;  5GAE P;  1NMD A;  1S9E A;  2D0C A;  3QLH A;  4PL8 A;  4HUG A;  4GNI A;  1SL1 A;  4IKF A;  3CXC M;  1T03 A;  4Q0B A;  3AO5 A;  1SKR A;  4BC3 A;  3RRH A;  3QEV A;  3MDQ A;  3ZLJ A;  4M3W A;  1D8Y A;  4BG8 A;  3HPO A;  3S3M A;  4CZK A;  4J2A A;  4NLC A;  3OYC A;  4B3O A;  2FBY A;  1NK7 A;  1BDG A;  1W7A A;  1S1X A;  3SUN A;  4KHP K;  3R3L A;  1RBU A;  2W41 A;  4WQ4 C;  2RPI A;  4DFJ A;  2NZT A;  4K41 A;  2W6L A;  3VQP A;  3OYH A;  3RTV A;  1XNR K;  3O9U A;  4FPB A;  1R59 O;  1KAZ A;  3F9M A;  4BAC A;  5LJV A;  3K9J A;  1GLB G;  4DTX A;  3QER A;  3SBG A;  3MN6 A;  1S1W A;  2V7Y A;  4MO5 A;  2P1J A;  4KHU A;  5AQY A;  1YIT N;  4CGG A;  1C0F A;  3K0S A;  4OPJ A;  3G10 A;  3CM6 A;  3ZX3 A;  4JS5 A;  5BN9 A;  2HHU A;  3H46 O;  4IFE A;  3LWL A;  1LCU A;  1S3X A;  4FL9 A;  3JXU A;  4B1W B;  1FJG K;  4DFM A;  3E01 A;  3WNE A;  1NK8 A;  3EY1 A;  1RDC A;  4ILH A;  3CJC A;  3CET A;  1GLJ O;  3O9T A;  3AV9 A;  1BG3 A;  2WOM A;  4MFB A;  1QHT A;  1T6D A;  5CZ2 A;  1TVR A;  3SI6 A;  4B9V A;  4G1Q A;  5M1F A;  3GE1 A;  3M5R A;  3P83 D;  4PL7 A;  3IAY A;  3VQ9 A;  3VTI A;  3HSC A;  1QSS A;  1VSL A;  1DLO A;  3WNF A;  1VSE A;  2Z1J A;  1WSE A;  5CYQ A;  5C25 A;  1GLC G;  2BE2 A;  4KRE A;  4FM2 A;  4DSF A;  4BRO A;  3KLG A;  3KWI A;  4C8L A;  1X9W A;  4BWJ A;  4PQU A;  2OYQ A;  5J2Q A;  1U49 A;  4DR7 K;  3J7Z O;  3NH0 A;  2VWK A;  4AHT A;  5BPM A;  4I6M B;  2IVN A;  1RT3 A;  2E1Y A;  4WCE L;  1VSJ A;  2HBM A;  1ATN A;  4DTJ A;  1W97 L;  1T05 A;  5AQQ A;  4KPY A;  4BWM A;  3L2U A;  2HHW A;  3O8M A;  3F5T A;  4FM1 A;  1Z25 A;  3HOT A;  1O13 A;  3LDS A;  1ZBI A;  4CJF A;  1RT7 A;  3BUZ B;  3V1O A;  4CJQ A;  1A5X A;  1N36 K;  3I0R A;  4CJS A;  4DTU A;  4Z4G A;  4BC5 A;  3VEZ A;  3MN9 A;  3HST B;  4B1X B;  2UXB K;  3NDK A;  1RDW X;  1VHX A;  5C12 A;  5F2R A;  4DSI A;  4WQ5 C;  2ZGY A;  1HUX A;  1C1C A;  3R8E A;  1JL2 A;  3OYN A;  1J54 A;  2G8F A;  4KRF A;  2O8B B;  4ELT A;  1NKB A;  4H5W A;  2YJF A;  4RCH A;  4DV2 K;  3DRS A;  5AQL A;  2IC3 A;  5FDL A;  2F8S A;  2BUP A;  1BA1 A;  4QS9 A;  1H1V A;  2XY8 A;  3AVJ A;  4FJL A;  5C2F A;  3SAG A;  1HYZ A;  4H0O A;  2YX6 A;  4Z4F A;  3THW A;  2VCP A;  4BVO A;  2J4R A;  4I7F A;  2QTD A;  4FW2 A;  3NVK A;  4YOU A;  4JD2 B;  3AVK A;  3E9P A;  1YIJ N;  3UB5 A;  4GVM A;  4X64 K;  3CCQ N;  1KLN A;  4TSX A;  2KQ2 A;  2G8W A;  4KB1 A;  3KKS A;  4FJM A;  4BR7 A;  3E66 A;  2FXU A;  4NB4 A;  1V4T A;  3WNG A;  3M8S A;  2HNZ A;  3TTC A;  4O55 A;  2A3Z A;  4OKK A;  1C0U A;  2QA4 N;  3VQA A;  4YOR A;  3LZI A;  4BRC A;  4B1V A;  3D2F B;  4WQ4 A;  2HHT A;  4JKB A;  1QZ6 A;  2QWR A;  3HVT A;  4FWP A;  1Q18 A;  3P38 A;  4CJP A;  3NE6 A;  2F7T A;  1FK9 A;  4H0Y B;  3W0L A;  2NRR A;  2BAN A;  1NJZ A;  4AQY K;  5C10 A;  3TAE A;  4A59 A;  1JCE A;  2IDO A;  2P9N A;  3OYL A;  4MDA A;  2B5J A;  4BR5 A;  1VSK A;  3VQB A;  4CD1 A;  4FO0 A;  4AIL C;  1BIZ A;  4RG8 A;  1RTJ A;  2ASP A;  3VA0 A;  3MEG A;  4FW1 A;  3KVG A;  4QCL A;  2I7N A;  4LC9 B;  5F1X A;  1VQ5 N;  1F21 A;  4IDK A;  3DLK A;  5GAG P;  1HNZ K;  4CGI A;  1EQY A;  3S41 A;  3O1W A;  1HMV A;  3PX6 A;  5M1N A;  1Q81 O;  2QI2 A;  1KVC A;  3TWH A;  1DGK N;  3QO9 A;  5C2D A;  1N5Y A;  4YDU C;  5CYM A;  4DTS A;  1XC3 A;  3ATU A;  3G4S N;  3D7E O;  1SZ2 A;  3HI0 A;  4DQQ A;  4ZHR A;  5BRF A;  3P5J A;  4CE9 A;  3UKU B;  1HPZ A;  1NJX A;  1LOT B;  1YTU A;  1IKV A;  3RMD A;  5KTQ A;  2FSK A;  3P31 A;  4DUY K;  4ILG B;  1J5O A;  4DU1 A;  1TL3 A;  4OX9 K;  3NF7 A;  2W40 A;  2AP1 A;  4OPK A;  2BTF A;  2OPQ A;  5TKW A;  1NU0 A;  1ZBS A;  2GUI A;  1TK5 A;  4NCG A;  4EHU A;  3MWT A;  5HBM A;  1LWF A;  3ASM A;  3JS6 A;  1A5W A;  3HPH A;  4Z4I A;  1VSM A;  3ATV A;  3OBY A;  2W42 A;  3V9X A;  1QTM A;  1YAG A;  2CGK A;  1IKX A;  2P9K A;  3TSQ A;  1NK9 A;  3VOV A;  2I7P A;  3CME N;  3AO4 A;  2OAN A;  2O8E A;  4CGF A;  2V7Z A;  3THY A;  1YXQ A;  5D3G A;  4HCC A;  5EU7 A;  3H1V X;  4YY3 K;  4JKH A;  4CIF A;  3DXK A;  2YHA A;  3SJJ A;  2ZJP L;  4IJA A;  4OLA A;  1EET A;  2ETJ A;  2DFF A;  4CED A;  4NYF A;  3RSE B;  1BI4 A;  4HWI A;  4NCA A;  4I6M A;  3ZSQ A;  3GG4 A;  1X9S A;  3VEW A;  1J9A A;  1HNW K;  2GWJ A;  2VYP A;  3M6G A;  4M7Y A;  4XIU A;  4NXM K;  3VGM A;  1VQP N;  1WUA A;  3O9Q A;  4NO7 A;  4BRF A;  3E9L A;  3DXM A;  4H0V B;  1UOC A;  4JS4 A;  1JLB A;  1GOC A;  4IXC A;  4CEC A;  3MN7 A;  3ZX2 A;  3CG7 A;  1OH7 A;  3FGU A;  3H6E A;  4FWK A;  3V9U A;  3AVI A;  1JJ2 M;  3AVC A;  2Q97 A;  1NGD A;  3O4N A;  2P9S A;  4DF4 A;  2BH1 A;  3MMV A;  2HHX A;  2ASM A;  3KTQ A;  1HR0 K;  3LP0 A;  3CFP A;  3V1Q A;  1SUQ A;  4PKH A;  5DMR A;  1KD1 O;  3DLE A;  1EWQ A;  3VQQ A;  1T6C A;  4LF7 K;  1QQN A;  3MK6 A;  2CGJ A;  1U47 A;  4CFA A;  1KVA A;  4IOX A;  2O8D B;  1U2V A;  4FK4 A;  3I0S A;  2X6N A;  4CHQ A;  3CQ8 A;  3U8X A;  1YF5 L;  5BPL A;  4H03 B;  2UXD K;  4GV3 A;  3T7Z A;  1D5A A;  3TR8 A;  4FWL A;  4RW9 A;  1Y97 A;  2UUA K;  5HLF A;  4O5B A;  2E5L K;  3H1Q A;  3K2P A;  3L3U A;  5A2Q O;  3P4I A;  1NJI O;  3GDQ A;  1YJW N;  3IUC A;  1YVN A;  3RMB A;  1T3V A;  3PSF A;  1L5U A;  4BE1 A;  2P5G A;  2ZQB A;  3AVH A;  1T7P A;  3UE5 A;  3HPG A;  3EE9 A;  1E4G T;  1C0T A;  4M45 A;  1RT2 A;  3TU5 A;  2OTJ N;  4C8M A;  1X3N A;  1VSI A;  3KD1 E;  4GKJ K;  1TL1 A;  4M3Y A;  4C1N K;  3BY5 A;  4BG9 A;  1N33 K;  5AQJ A;  4J8F A;  3ZYY X;  3VEO A;  4F3T A;  2QWM A;  4BC2 A;  1VQ6 N;  1JLQ A;  3VGK A;  2Q0R A;  4IEI A;  4BRK A;  2O8C A;  4JKA A;  1IV0 A;  3ENB A;  1JL1 A;  1TAQ A;  1VRT A;  1Q9Y A;  3G71 N;  2E88 A;  4YOT A;  3SV3 A;  1GLF O;  1GLE G;  4DR5 K;  3MXM A;  5J2N A;  4Z4E A;  4DSK A;  1OVQ A;  4JI7 K;  2A42 A;  3THW B;  4JKC A;  3VQD A;  1O1W A;  4DTN A;  4K8X A;  3OW2 M;  2DTU A;  1KFD A;  5AFU A;  2KZM A;  5KPT A;  5AQI A;  3WEE A;  3B6P A;  2PY5 A;  4F3O A;  4CZM A;  2XY7 A;  2OPP A;  5ELZ A;  2WON A;  3B6O A;  1U6Z A;  3HJF A;  1SL2 A;  4FVM A;  4CF8 A;  1BIU A;  4FJJ A;  4DV1 K;  2P9K B;  4E7I A;  2P9U A;  4B9Q A;  3NF8 A;  4Y1D A;  4OLB A;  2JWL A;  3IRX A;  3DLL L;  4E7J A;  3SAH A;  1REV A;  4CI6 A;  3WXJ A;  1GLD G;  4RW8 A;  3SJH A;  5IT9 O;  4FLY A;  5HRN A;  3OYK A;  1U4B A;  4I9Q A;  4HCB A;  3HYF A;  4M7X A;  2KW4 A;  2RHK A;  2YNF A;  4B3R K;  3NBP A;  3ZSR A;  1G99 A;  3SK3 A;  1RBS A;  4JHD B;  1YTA A;  4BDP A;  3K59 A;  3WQT A;  4JRQ A;  1Z6R A;  3M8P A;  3KWG A;  3LPU A;  3ZSX A;  2HBJ A;  2YHY A;  4JI1 K;  3LM2 A;  3U3Y A;  4R5P A;  4DV7 K;  2A41 A;  4YOX A;  3HRG A;  3KK1 A;  4BVP A;  3CJ7 A;  4E7H A;  5SZT A;  3AAR A;  1SV5 A;  3AAP A;  1SQK A;  2PYL A;  1XMO K;  3CJ9 A;  4CZL A;  3F2K A;  1LAW A;  5AQO A;  2HST A;  3ZCM A;  1RBT A;  2CGL A;  4A2A A;  5DK5 A;  3VQ8 A;  4F2R A;  4J2E A; 
#chains in the Genus database with same CATH homology
 2NRZ A;  4BGB A;  2FF3 B;  3HOT A;  1O13 A;  4YOW A;  3LDQ A;  4K43 A;  4BY9 C;  2QWO A;  3C65 A;  1HKG A;  3BUZ B;  4JK8 A;  1HKC A;  2NNW A;  3M3Z A;  4BR0 A;  3K9K A;  2GTD A;  3CJB A;  4CBU A;  4BC5 A;  4IOC L;  3VEZ A;  3MN9 A;  2ASO A;  2QM1 A;  4MLH A;  3CCU N;  3QML A;  4AF1 A;  4B1X B;  3ZX0 A;  1TYQ B;  3BF1 A;  3CQY A;  3A5O C;  4BRA A;  1NGB A;  5JLF A;  1KC8 O;  1TYQ A;  1RDW X;  3A8Y A;  5CR4 A;  4BRN A;  4KH5 A;  4B1Y B;  4R79 A;  5C12 A;  4GV9 A;  4RTF D;  4Z94 A;  5F2R A;  3CMA N;  4WQ5 C;  4U7B A;  2ZGY A;  2YCH A;  4WFA L;  5JLH A;  1K9M O;  1HUX A;  3HBT A;  4GV6 A;  3R8E A;  1DEJ A;  3A0I X;  4CZI A;  4A5B A;  3R9P A;  4BRM A;  3I55 N;  4H5W A;  3IKM A;  5M1Q A;  4CZH A;  2YJF A;  4RCH A;  4O8U A;  3PIP L;  2QWQ A;  3O5B A;  3Q7B A;  5AQL A;  2HF3 A;  3ENO A;  4BRE A;  2BUP A;  1BA1 A;  4QS9 A;  1H1V A;  3EN9 A;  4A2B A;  1RFQ A;  5C2F A;  5M1O A;  1Q82 O;  1XQS C;  3SAG A;  4H0O A;  3CCR N;  2YX6 A;  4EIA A;  2FSN A;  1JCG A;  3M1F A;  3CC4 N;  2VCP A;  3CJA A;  3CC2 N;  4WQ5 A;  4BVO A;  2J4R A;  3T69 A;  2D0P A;  4WF9 L;  2QTD A;  3FZM A;  5EOY A;  1ZXO A;  4DB3 A;  5EY4 A;  4YOU A;  5AQF A;  3EZW A;  3ENH A;  4JD2 B;  4QS7 A;  5BR9 A;  2YJE A;  3E9P A;  1YIJ N;  3UB5 A;  4MO4 A;  3CCQ N;  4A57 A;  2PAV A;  1NGI A;  4BR7 A;  4BC4 A;  3DXM B;  2FXU A;  3E66 A;  3CQX A;  1DT9 A;  1V4T A;  1E4F T;  4NB4 A;  4EHT A;  2FLO A;  4C23 A;  1YI2 N;  1X3M A;  4WYB A;  3W3D A;  1JCF A;  5AQW A;  4FPA A;  2NRW A;  1VQ9 N;  3TTC A;  4BR2 A;  2A3Z A;  4JD2 A;  1NLV A;  2IVO A;  5AQN A;  2Q31 A;  2QA4 N;  3D2E A;  4JKG B;  5AQZ A;  4YOR A;  3LDN A;  4BRC A;  3DJC A;  4B1V A;  2CH6 A;  3D2F B;  1TUY A;  4WQ4 A;  3BF3 A;  2WUS A;  3Q7C A;  4JKB A;  1QZ6 A;  2QWR A;  3H3O B;  4FWP A;  1Q18 A;  3P38 A;  4KBO A;  2F7T A;  2YI1 A;  3FZL A;  4XEI A;  1SS6 A;  1IJJ A;  3VGL A;  2FSJ A;  3EE8 A;  3WQU A;  2P9U B;  4H0Y B;  3W0L A;  5AQP A;  4DQ8 A;  2NRR A;  2P9P B;  5C10 A;  3CPE A;  3FZK A;  4H5V A;  1C0G A;  1JCE A;  1DKG D;  4A59 A;  4ILJ A;  2P9N A;  5HL7 L;  3LDL A;  4B1U B;  3R6M A;  4MDA A;  4BR5 A;  5KPR A;  4GY2 B;  2PBD A;  2ITM A;  4IJN A;  2WC9 A;  3L6Q A;  4XH4 A;  4CD1 A;  4XH1 A;  1D4X A;  3IDH A;  4FO0 A;  3L4I A;  1IG8 A;  2DPN A;  3U4L A;  4YOV A;  5AZJ A;  4DHY A;  1K8K B;  2HOE A;  4JAX A;  2GX9 A;  3EO3 A;  3B8A X;  1NGC A;  1QQO A;  5JIC A;  3MCA B;  2KKZ A;  2ASP A;  4FOE A;  1YHQ N;  1KAY A;  3PIO L;  3ZEU A;  3CCV N;  4JEP A;  5LY3 A;  1BO5 O;  3VEN A;  3ZEU B;  4MLE A;  1HPM A;  3FZH A;  3KVG A;  2VWB A;  2HBL A;  2I7N A;  4L3Q A;  4LC9 B;  5F1X A;  3CC7 N;  1VQ5 N;  2ZGZ A;  4NLB A;  4FVU A;  1Z05 A;  5GAG P;  5EX5 A;  4H0P A;  1V4S A;  3E1Y A;  4JHD A;  5MLC Q;  5AQT A;  3CCS N;  1EQY A;  5AQR A;  2QWP A;  3S41 A;  5GIN A;  5FPM A;  2A5X A;  3H45 C;  3O1W A;  1VQ4 N;  1Q7Y O;  5BRE A;  2YHW A;  1VQN N;  2YHX A;  5M1N A;  1Q81 O;  2NRH A;  2QI2 A;  3IFR A;  1DGK N;  4KH4 A;  5C2D A;  4YDU C;  3HOS A;  3CER A;  4H5T A;  1K8A O;  4WFB L;  1XC3 A;  2D4W A;  3N4P A;  5AQK A;  3ATU A;  4AM6 A;  3G4S N;  5H1S Q;  3WEE B;  3D7E O;  3QDK A;  3U9D A;  4FSV A;  1BWF O;  1SZ2 A;  3HI0 A;  5AQU A;  3VET A;  5BRF A;  3C6H A;  3GBT A;  3UKU B;  2P9I A;  4FWO A;  5AR0 A;  3SLC A;  4Y0W A;  2P9I B;  1LOT B;  2KLA A;  3O9R A;  1HKB A;  3DAW A;  2F9W A;  2Q1N A;  2QW9 A;  3EKS A;  2FSK A;  3P31 A;  1WOQ A;  4ILG B;  2H3G X;  2EWS A;  2P9L B;  4BRI A;  2E20 A;  2W40 A;  4IEE A;  5AQG A;  1VQ7 N;  3MX5 A;  2AP1 A;  1VQ8 N;  2BTF A;  3CD6 N;  3CCL N;  3O80 A;  5TKW A;  1QZ5 A;  1XUP O;  2NLX A;  4M63 C;  4XH5 A;  4DKW A;  3UKR A;  4UY8 O;  1ESV A;  1OVY A;  1ZBS A;  4YDU A;  1YJ9 N;  5E26 A;  4EHU A;  3ZET B;  3MWT A;  3O6W A;  4JK9 A;  3A5N C;  5KPZ A;  3E9O A;  5AQV A;  3JS6 A;  5GIP A;  5CE3 A;  1P90 A;  4IZ9 A;  3ATV A;  1VQK N;  1HJO A;  2E2O A;  3OBY A;  4H5R A;  4BRG A;  3MN5 A;  1S72 N;  1J6Z A;  1M1K O;  5JMV A;  1YAG A;  4FWR A;  1CZA N;  2CGK A;  2P9K A;  1BA0 A;  4ISG A;  4JN4 A;  4O5F A;  1VQO N;  2UYT A;  3TSQ A;  5BRD A;  1N8R O;  3TPQ A;  3QB0 A;  5AZJ B;  3VOV A;  2E1Z A;  2I7P A;  3CME N;  3FR0 A;  3BEX A;  1HX1 A;  2OAN A;  3CCM N;  1KQS M;  2GEL A;  3MWP A;  1NGF A;  1YUW A;  2V7Z A;  1YXQ A;  4BRQ A;  3WT0 A;  4BRH A;  4CD3 A;  3H1V X;  3A5M C;  4FOI A;  3AGK A;  4JKH A;  3AAQ A;  3DXK A;  5AQS A;  1NM1 A;  5AZI A;  1QVG M;  2ZJP L;  3A5L C;  4JNE A;  5GIO A;  4U67 L;  4A62 A;  4IJA A;  1P8Z A;  3HZ6 A;  3VMF B;  1QQM A;  3TTF A;  2FF6 A;  4JKD A;  3D2F A;  2KHO A;  3RSE B;  3WXL A;  3C7N B;  4HWI A;  3VEV A;  4BGA A;  1HLU A;  2VGN A;  3GOI A;  4GVE A;  3GG4 A;  4I6M A;  4BR9 A;  5BN8 A;  2Q2R A;  3VEW A;  1Q86 O;  2E2Q A;  2GWJ A;  2VYP A;  3M6G A;  4M7Y A;  1VQL N;  2HF4 A;  2HBK A;  1GLL O;  1S22 A;  3C6A A;  3VGM A;  1VQP N;  1WUA A;  3O9Q A;  3OA9 A;  4NO7 A;  4BRF A;  2A40 A;  3E9L A;  4FWN A;  3DXM A;  4H0V B;  3LM9 A;  2CH5 A;  3VER A;  1BOT O;  3WXM B;  3ZET A;  4PKI A;  1TUU A;  3I33 A;  4IXC A;  3SMP A;  3I56 N;  3MN7 A;  2QEX N;  5M1P A;  4CZE A;  3ZX2 A;  3G6E N;  2VGM A;  4F9O A;  1NBW A;  2ZJR L;  3EKU A;  3FGU A;  3I8B A;  3H6E A;  4FWK A;  1JJ2 M;  2V52 B;  5JVG L;  4AM7 A;  3O4W A;  1MA9 B;  3VF6 A;  5DM7 L;  2Q97 A;  1NGD A;  2P9S A;  2BH1 A;  2D1K A;  5TKY A;  3MMV A;  5KQD A;  4O8K A;  2ASM A;  2D0O A;  4JK7 A;  4BQZ A;  1ILY A;  5FPE A;  5B8H A;  4A5A A;  2A6A A;  5E84 A;  1KAX A;  2QWL A;  3O1B A;  3TTD A;  3ULE B;  3LDP A;  4PKH A;  3VF2 A;  1KD1 O;  4H0T B;  1T44 A;  2NRV A;  4JKF A;  1NGE A;  1EO1 A;  3BP8 A;  1T6C A;  3QBX A;  3CCJ N;  1QQN A;  5EXW A;  3TSP A;  3ID6 A;  3MK6 A;  4QS8 A;  2CGJ A;  1NWK A;  5ADX A;  1MWK A;  1ATR A;  4CBX A;  3QIC A;  4IOX A;  4IWV A;  1U2V A;  3MCP A;  4CJ7 A;  2QXL A;  3QFP A;  3AY9 A;  5ADX H;  4CZF A;  2ZWH A;  3SMS A;  3QBW A;  1YF5 L;  3U8X A;  4FWM A;  4H03 B;  5BPL A;  4GV3 A;  4JKG A;  3T7Z A;  3NMU A;  3KHY A;  3PLA A;  3VF4 A;  2P9S B;  4FWL A;  4OPH A;  4BR4 A;  1GLA G;  1YJN N;  3ID8 A;  3FFK B;  1ATS A;  4EFH A;  4HTL A;  3VEX A;  3H1Q A;  2GUP A;  3L0Q A;  1K73 O;  4A61 A;  3VES A;  3NVM A;  3P4I A;  3KK7 A;  1NJI O;  3GDQ A;  3VEY A;  1YJW N;  4C1N I;  5GAH P;  3IUC A;  5GAD P;  3J8A A;  1YVN A;  5AQH A;  1T3V A;  3FE1 A;  3KZB A;  3TSU A;  4MDB A;  4IO9 L;  4PHT X;  3VTH A;  3ULE A;  4OO1 J;  3G25 A;  5GAE P;  4BRP A;  3UE5 A;  3EE9 A;  1E4G T;  1NMD A;  5FPD A;  5AQM A;  3TU5 A;  4PL8 A;  1ZC6 A;  3CHW A;  4BQL A;  4GNI A;  2OTJ N;  3CXC M;  3FLC O;  1X3N A;  2P9P A;  1BUP A;  2JWK A;  2WFB A;  4BC3 A;  2GWK A;  4C1N K;  2IIR A;  3MDQ A;  4YOY A;  4BG8 A;  4FWQ A;  4BG9 A;  5AQJ A;  3WXK A;  4J8F A;  3ZYY X;  4IOA L;  4CZK A;  1RDU A;  3VEO A;  4ISE A;  4CBW A;  2QWM A;  4ISF A;  4NLC A;  4BC2 A;  1VQ6 N;  3VGK A;  2Q0R A;  5EVZ A;  1BDG A;  3NVK A;  5AQX A;  2F9T A;  4IEI A;  4BRK A;  3N4Q A;  4JKA A;  3ENB A;  5M1K A;  1KXP A;  2E2P A;  3CF5 L;  3R3L A;  2W41 A;  4WQ4 C;  3G71 N;  2NZT A;  4K41 A;  2E88 A;  5I9E B;  3O9U A;  4FPB A;  4YOT A;  1GLF O;  2GEM A;  1W2B M;  1R59 O;  1GLE G;  1KAZ A;  2E2N A;  1NGJ A;  2P9L A;  3F9M A;  3CPW M;  5BPN A;  5LJV A;  3K9J A;  1GLB G;  4PKG A;  3SBG A;  3MN6 A;  2A42 A;  2V7Y A;  4MO5 A;  1K8K A;  4JKC A;  5AQY A;  1YIT N;  1C0F A;  1U2V B;  1VAZ A;  5AFU H;  3HM8 A;  3RSE A;  3OW2 M;  4CZJ A;  5AFU A;  3CJ1 A;  5KPT A;  5AQI A;  3WEE A;  3ZX3 A;  3IMX A;  5BN9 A;  3CIP A;  4CZM A;  3QFU A;  3H46 O;  3D6R A;  5KQ8 A;  5AZI B;  5ELZ A;  4IFE A;  1U6Z A;  2V51 B;  3R1X A;  1NGG A;  1LCU A;  5LJW A;  1S3X A;  3LL3 A;  4FL9 A;  3FZF A;  2PFU A;  5DM6 L;  3O08 A;  3JXU A;  2NRX A;  2P9K B;  4B1W B;  2P9U A;  3P39 A;  4B9Q A;  3MX2 A;  2JWL A;  4ILH A;  3HTV A;  4G9Z A;  3O9S A;  3CJC A;  3DLL L;  4K25 A;  5FPN A;  5C15 A;  3SAH A;  3D2E B;  4CI6 A;  3CET A;  4IO8 A;  3WXJ A;  1GLJ O;  3EL2 A;  3O9T A;  1GLD G;  1BG3 A;  1T6D A;  3L4Q A;  3SJH A;  1M90 O;  2RE2 A;  1Y64 A;  2Q0U A;  3C0B A;  3UKR B;  2E8A A;  4K42 A;  5M1F A;  4RWT A;  3U9Z A;  3GE1 A;  3M5R A;  1BU6 O;  4M7X A;  4PL7 A;  3SAF A;  5JVH L;  2RHK A;  3VTI A;  3HSC A;  4CZG A;  1G99 A;  3OHR A;  3SK3 A;  4JHD B;  4H0X B;  4BRL A;  3WQT A;  5BRH A;  2ZF5 O;  3WXI A;  3OBW A;  1GLC G;  1SAZ A;  1Z6R A;  2HMP A;  3WUH A;  3KWG A;  1MDU B;  4JKE A;  2Q36 A;  3H3N O;  4BRO A;  2HBJ A;  2YHY A;  2ZJQ L;  3LM2 A;  1VQM N;  1QHA A;  3KWI A;  1QVF M;  5C0Y A;  4OPA A;  2NRT A;  3AGR A;  3UKU A;  4FWS A;  3J7Z O;  4IDH A;  3C7N A;  3LDO A;  2A41 A;  1NGH A;  5CHI A;  2WBN A;  4YOX A;  5F0X A;  3CI5 A;  3DWL A;  3HRG A;  4BVP A;  4EAH D;  5BPM A;  3CJ7 A;  4I6M B;  1MWM A;  4KH6 A;  2OTL N;  1NGA A;  3VPZ A;  2IVN A;  4E1J A;  2E1Y A;  3DXK B;  3AAR A;  3RVC A;  3CCE N;  3AAP A;  4WCE L;  1SQK A;  2HBM A;  5HOO A;  4DCH A;  2IVP A;  1ATN A;  3CJ9 A;  3F2K A;  4CZL A;  3SBT A;  2QWN A;  1W97 L;  4H5N A;  4BRD A;  4B1Z A;  4WFN L;  1X9J A;  5AQO A;  2HST A;  2P9N B;  5AQQ A;  1OKJ A;  1RGI A;  2AA4 A;  2CGL A;  3O8M A;  4A2A A;  3F5T A;  3GL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...