5M1QA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound zinc
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
186
structure length
171
Chain Sequence
b'NSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYGHDDIVMSLALAYSQYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
total genus 58
structure length 171
sequence length 186
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1qA00
5M1FA 4IEEA 5M1OA 5M1NA 3CPEA 5C2FA 5M1QA 5M1PA 4IDHA 3C6AA 4IEIA 5C10A 4IFEA 5C15A 5C12A 3C6HA 5C2DA 5M1KA
chains in the Genus database with same CATH superfamily
4DLEA 1YAGA 1VQ5N 3HVRA 5AQPA 3AVIA 2KQ2A 2Q0RA 3GL1A 1MDUB 1S3XA 4I7FA 3VPZA 4BRDA 4KHQA 3ENOA 3CM5A 3R3LA 4JHDA 4DSEA 3C94A 4KTZA 2B6AA 3C7NA 3VQQA 4CE9A 2GWKA 4DSJA 2KZMA 2QWLA 1QSSA 2XY8A 2CGJA 4W5TA 1ZBHA 2FXUA 3H46O 1CXUA 2NRVA 3OYMA 4LD0A 3C6TA 3MEDA 4BRLA 4DTPA 4WYBA 3CFOA 4I9LA 2HNYA 1NOYA 3I8BA 3CCQN 2D0BA 1TKTA 4L8RB 3LDSA 3TSQA 2O8FA 3CJ1A 1RT1A 3CETA 4PHTX 5GAEP 3TU5A 3Q7BA 4DV0K 1NJWA 2VQEK 3L2VA 2V52B 3LPTA 1BCMA 3QERA 2J4RA 4JI6K 4DFKA 1IO2A 1VQ6N 1LWCA 5AQHA 3D2EB 5JVHL 1N32K 5AQIA 1HKBA 4K43A 4E3SA 4Z94A 1RDCA 3L2WA 3SYZA 1HKGA 3KD1E 2O8DB 4Z4CA 4BRPA 3HT3A 5JS1A 4ISGA 4LSNA 1RTHA 1T6DA 4PUOA 1OH5A 3ZX2A 2QXLA 3SAFA 3KK2A 2FBXA 3KLGA 4CHQA 2JLEA 2DPNA 3I0SA 4H0TB 3G6EN 1OH7A 2Q31A 1KFSA 1U2VA 3HJFA 3SNNA 1I39A 2RN2A 1OVYA 3CCUN 5ELZA 3TSUA 3CCEN 5AZJA 1JXBA 3DXMA 4ID5A 4E7HA 5AQGA 3HM9A 2YCHA 3BZKA 1ATRA 3ZYYX 5AQZA 2FSNA 1VK0A 1U6ZA 4MQ3A 4OX9K 4E7IA 1VAZA 4JI8K 4DV4K 3ENBA 3FFIA 4JAXA 4AM7A 4QOZB 3CJAA 1JCGA 3WQUA 3AAQA 4Z0UA 3ZSRA 1I94K 4K0KK 5C2DA 4DR7K 1HPZA 2XY6A 2ZJQL 4KV8A 4DQQA 1VQON 1V4SA 3BF3A 2QW9A 5FLXO 2W6KA 4YOWA 4ELVA 2IIRA 3C6UA 4O4GA 4KH5A 3MEEA 4FK2A 4GVEA 1EO1A 1RBRA 3NGIA 3RMCA 2YX6A 4EHUA 1Q18A 4XH4A 2E88A 2ASMA 4C8OA 3P39A 1N33K 2JGUA 1ASVA 1WBBA 2E5LK 1ZC6A 3GBTA 1O13A 4CJRA 3VESA 4KHPK 1C1BA 3LANA 4YORA 2NRHA 3O3GA 1RT3A 3HSCA 4KI4A 1A5WA 1B9FA 1XMOK 1JL1A 3PIPL 2UUCK 1VSLA 4JS5A 1QE1A 5LJVA 3J7ZO 2FC0A 4E7JA 4O8KA 4L3QA 4CEOA 2UXCK 3P4IA 3IKMA 4A62A 4YDUA 2F9TA 4GV3A 1D9FA 1DT9A 3ZT4A 1A5VA 1TKDA 4DTJA 3THWA 4E1JA 4EP4A 1Q81O 2P9PB 3WNGA 2BANA 4CHZA 1J5EK 3OYNA 3MN6A 4M41A 2HHSA 3L4IA 4NCAA 2P1JA 4ZTFA 2VGMA 4X66K 1BI4B 4EHTA 4DSIA 4BC2A 4FL9A 3SCXA 3TWHA 4DFJA 4DU1A 3AGRA 4NYNA 1RTDA 4N47A 2UUBK 1FK9A 1LCUA 2ITGA 3L4QA 2YI1A 4BACA 3QDKA 3T1HK 2V7YA 3OYJA 4CJSA 1S6PA 1UWBA 2GWJA 4FLTA 4OPAA 3D2EA 2E2NA 2UXBK 4F2RA 1NKBA 4BR0A 1GLBG 1D9DA 1S1XA 2A42A 2O8DA 2VG6A 1IKVA 2VG7A 3U6FA 4KAZA 5GAHP 1IKYA 2G8IA 3V9ZA 2IS3A 2YHAA 4IKFA 4M3RA 5M1OA 1JLFA 1HKCA 3P5JA 3C95A 3CQ8A 3VQDA 3QINA 3EEQA 2RPIA 1TL1A 3OYHA 4W5RA 4X64K 1VSJA 4DS4A 3CC4N 2FSJA 3CCSN 4MLHA 2YKNA 4YOUA 4PWDA 2ZD1A 2GELA 1DLOA 3QBXA 5KPRA 4FJNA 4FJXA 4Q0BA 5GADP 4BE2A 2A3ZA 1TVRA 1BWFO 1NGAA 4GVMA 3EZWA 2A41A 1IH7A 2QTDA 2G8WA 3TAGA 1U47A 1REVA 1L3TA 1Z05A 4CJWA 5EX5A 3SQ4A 3MK6A 3SQ0A 4B1VA 2QEXN 3KJVA 3NVKA 1E3MA 4B9LA 2HMIA 3QICA 4QS8A 1C0FA 3I8DA 1V4TA 3O4NA 4FJGA 3CC2N 3HPGA 2HVHA 4B3MK 4Z4EA 1RBSA 3RVCA 4RTFD 4K42A 1KD1O 4M45A 1JLCA 4O5BA 3T69A 5HL7L 4CEZA 3EKUA 2F4VK 4CBXA 3V4IA 3OY9A 4IWVA 4JI5K 1BIZA 4CJ3A 4BC5A 2XO7A 4B1XB 3IUCA 3H08A 1LAWA 4DQRA 3B6OA 4CJKA 3QBWA 2VWKA 4FM2A 1YIJN 4DFPA 3SJHA 3FGUA 4KKOA 3OYGA 1GOBA 5LJWA 1ILYA 4H0OA 4O5FA 3CC7N 4CJPA 3V9SA 4PY5A 4FCYA 1S72N 5FRMA 1D8YA 3A8YA 1NGIA 2VQFK 2D5RA 5C0YA 4LF8K 4OGEA 3TAFA 2G8FA 1Q8IA 4IBNA 2Y1IA 1FW6A 3QEVA 3CERA 3GG4A 5AQLA 3MN5A 3CCVN 4FPAA 2P9PA 3NGYA 1QQNA 1VHXA 2GTDA 1L3VA 1ESVA 4RW7A 3SMPA 2WOMA 1BUPA 4R5PA 3FZHA 4BRAA 3CCMN 3DLHA 5KI6A 3PSIA 3MXIA 1RDDA 4K8XA 2NUBA 2BDPA 4CIGA 3MCPA 1QZ6A 4DTUA 3AVBA 1KVBA 2QKBA 4IEEA 5IT9O 2VCPA 5AQKA 2QK9A 4CF1A 3LDOA 1IBKK 4OGCA 5AZIB 5I3UA 1XC3A 4JRQA 3SI6A 4GMJB 2DY4A 2O8BB 3LWMA 3NF6A 3U8XA 1NK5A 3WXKA 4F3OA 4G1QA 3O3HA 3DMJA 5KQ8A 1NK4A 2HNZA 5C2FA 4CEEA 4BGBA 3D0PA 1XQSC 1B9DA 5LY3A 3CCRN 4EFHA 5KPTA 3V9XA 3SK3A 3E66A 2RE2A 4B3TK 4QAGA 1K9MO 4FJHA 4O44A 2Z1JA 4JKGA 4BR7A 4CJLA 5E41A 1WSEA 3U3GA 5M1KA 2KHOA 4CHOA 1KLNA 3M3ZA 1R59O 3KLHA 4KBOA 2YJEA 5CYMA 4B8AB 4KHUA 5GIPA 5HRPA 5EOYA 4HWIA 1C6VA 4E89A 4QS7A 1IBMK 2NRWA 3R6MA 2ZGYA 3BGRA 1SL2A 2W41A 2KLAA 4CIEA 1DGKN 3VENA 2QWOA 3O1BA 2I7PA 4FJ8A 2P9SB 3SAGA 4JK7A 1R0AA 4B3SK 5JLFA 4JI7K 1XNRK 4EAHD 3UKUB 3ZT3A 1VQLN 1BO5O 3MMVA 4CZLA 4F2SA 1NJIO 3LZIA 4O0JA 1HJRA 4DTNA 1XMQK 2F8SA 1WBDA 3Q7CA 2HVIA 2E2QA 4BQZA 4N41A 1QTMA 3CJCA 2HHVA 3K5NA 3CI5A 2OYQA 4J2BA 2OPRA 4E1NA 4CZEA 2HHHK 1BOTO 4DR6K 4DV2K 3CHWA 1T7PA 3DLEA 4BG8A 4DV7K 2OTJN 3HPOA 1JCFA 5F1XA 1G99A 2D0CA 3O1WA 1DTTA 1GLDG 3IFRA 3OBWA 1TK0A 4GKJK 4U67L 4EIAA 1XWLA 1KSPA 3VMFB 3VA0A 5FPDA 4FO0A 1GOCA 3ATVA 4R79A 4FWPA 3LP0A 5AQFA 4FJJA 4CI6A 4WCEL 5BR9A 1G15A 3F2KA 1Q82O 3VQ8A 4XH1A 4IOCL 1RNHA 3VF6A 4JI0K 3AVNA 1VSMA 5DK5A 4YOTA 4OLAA 3O4WA 1YXQA 2HHQA 4FOEA 4G9ZA 4W5OA 3ULEA 1VSDA 4IFVA 2OZMA 4WQ4A 3WXJA 4DTOA 1NGHA 5CZ2A 1UA0A 4IEIA 4WQ5A 2KW4A 2VWJA 2JWLA 5C10A 4NXNK 1GLAG 4XIUA 2Q97A 3SBGA 4FWRA 1Q9YA 4E0DA 2FBTA 4A61A 1JLQA 5BPLA 3KLEA 4CBUA 4I6MA 2RF2A 4I9QA 5BN9A 3O80A 3HSTB 1C1CA 3OYKA 3PV8A 1FXXA 3OJUA 1HYSA 4C1NI 3EKSA 4BQLA 5AQOA 3VQBA 5AZIA 1QQMA 4DS5A 3DLGA 4HTLA 1WSGA 3HYFA 2ATQA 4GY2B 3OBYA 3ZT1A 5AR0A 1JCEA 4M3WA 3SUNA 4CERA 2P9LB 3EL2A 1TYQB 5SZTA 4H4MA 4YHHK 2IGIA 1CZBA 2H3GX 1X9WA 3DXKB 1SL1A 1VQ4N 1QVFM 2HHUA 3KK3A 3DWLA 3ZETB 4FWQA 3P31A 3E1YA 4CVNE 3LAMA 5J2QA 1JJ2M 3SAHA 4AF1A 5J2NA 1IJJA 3HO1A 4JRPA 1X9JA 4JYAK 1I3AA 4BGAA 2E2PA 2O8EB 4AHVA 4PA1A 3G25A 3SUOA 4M3TA 4A2AA 2IC3A 2IOCA 4H5NA 3KK1A 1IG8A 2D0PA 2BGGA 2P9SA 4FZZA 3AA2A 3UKUA 5AQVA 4J2AA 3VERA 3U9DA 4IFEA 4M3ZA 1HMVA 1KQSM 2B4JA 2OA8A 3PO5A 3VQ7A 3GDQA 1VQNN 4IO8A 4OVLA 4CEBA 2VYPA 3LDLA 5ADXH 5C25A 3KLIA 3WUHA 1VRTA 2P9IB 4AHTA 3CYMA 3S3MA 4CZJA 3SZ2A 3QEXA 4BWMA 3H3OB 2BTFA 4FWMA 4ZHRA 1X9SA 2PYLA 4LC9B 4JS4A 1QQOA 2NRZA 4MLEA 1SKSA 4DQIA 1YJ9N 1LWEA 1HNXK 2E6MA 5BR8K 4UY8O 1ATNA 5HBMA 3VEYA 1EKEA 3DOLA 4B1YB 1NMNA 1RT4A 1T6CA 2WC9A 2EWSA 4WFBL 3NGZA 3TI0A 4DU3A 4DTXA 5D3GA 4KRFA 3NVMA 1HNIA 3ZSYA 4GV6A 1YHQN 3FFKB 2CH5A 2IVOA 2NZTA 1ZBIA 2NRTA 1N36K 2DFEA 5HP1A 1GLFO 3AAPA 4CEAA 4CK1A 4DUYK 4F4KA 3CIPA 4KB1A 5T7BA 2A5XA 1NGGA 1HPMA 4RW8A 4FLUA 1JLAA 1ZBSA 1J5OA 3TTCA 1BG3A 3T1AA 3EYZA 2YHXA 4CJ7A 4MFBA 4X65K 5JS2A 3UKRB 4FWLA 2E2OA 4IDKA 2QWPA 4ICLA 1RDUA 3SBTA 2XY5A 2DFHA 5E26A 3VETA 3NDKA 3MXMA 2E20A 4H5TA 4BE0A 1C0UA 4CJ4A 5C15A 3ZX3A 1DEJA 1TK8A 4FLZA 4LFCK 1HQUA 2HBJA 2Q2RA 1ITGA 3P83D 3TTDA 1L3UA 3KTQA 1RFQA 4E7LA 3A5LC 1NJZA 3CFRA 1RCHA 2AA4A 1SS6A 3BZCA 1YJWN 1WOQA 4F8RA 3VQ4A 2P9LA 5AQJA 1TAQA 1TYQA 2FBYA 2VGNA 5C42A 2ZE2A 4HTUA 2GUIA 4AILC 4N5SA 2OTLN 4OPKA 5ADXA 4DQ8A 3NHGA 4RW9A 1LW2A 1SV5A 3AVCA 4LH5A 4EZ9A 3M8PA 3ZETA 3AA4A 3QFPA 2HHWA 2G8VA 3L2QA 3DLKA 4J2EA 1Z25A 5GINA 3J7AP 1TUUA 1S1WA 1KXPA 1CXQA 3HPHA 5LL6Z 5HOOA 1IBLK 4FYDA 2O8EA 1BISA 3A5NC 4CJUA 1ZYQA 2P9NB 4JKDA 3N4QA 5M1NA 4B08A 3JYTA 3PX0A 4KB0A 4DB3A 3I56N 1OH6A 1X1PA 3LALA 3RR7A 4Z4IA 2GX9A 3AO4A 3OYCA 2YNIA 4B9VA 4ISEA 4B3OA 5FDLA 3K2PA 4ILGB 1CZAN 2WUSA 3LPUA 4KHNA 5K14A 1U4BA 4NB4A 1WSFA 4U7BA 3LAKA 4CZHA 5I42A 1JLBA 2CGKA 3I0RA 4M7XA 1RGIA 4PKGA 1NOZA 1NK8A 2HBKA 3AGKA 4CJFA 3VTHA 4CZIA 4BR2A 5CHIA 4BRHA 3P38A 2ZM6K 3C6HA 1NGDA 3U9ZA 3O9TA 1RBTA 1CZ9A 3BDPA 1YITN 2P9IA 3G0ZA 2P51A 4JKFA 4MO5A 3WNHA 1GLLO 3LP3A 4YFUA 1OVQA 1VQPN 2WTUA 3MEGA 1A5XA 3HTVA 4OJRA 2E1ZA 5HROA 3NH2A 1MWKA 3CJBA 2HBMA 5AQXA 4AH9A 1FKPA 2NLXA 5BPNA 3QMLA 3ZSVA 1OH8A 1OKJA 3AV9A 3AO5A 1EX4A 4CK3A 4B9UA 4HVJA 1X3MA 3QEWA 3J8AA 5B8HA 3OJSA 4JI2K 4DQPA 3FZLA 3VEOA 4LF6K 3HL8A 3C65A 4IOXA 1TGOA 1J9AA 1LWFA 3OS1A 3QEIA 2QWQA 1KTQA 4FOIA 5CYQA 4DR4K 3TAPA 3PLAA 3MX5A 3NF8A 1QSYA 3S9HA 4BDYA 4W5QA 4JI3K 1NGJA 2I7NA 3LP2A 5DM6L 4BE1A 1BL3A 4JEPA 3KWGA 1VSHA 2XHBA 2ZWHA 2IAJA 4FJMA 1QZ5A 3CJ7A 3SLCA 2HW3A 1S6QA 3AA3A 3DLBA 4OKEA 4LSLA 4CEDA 4K41A 4K8ZA 3S3OA 2O4IA 4KO0A 4DQSA 4IZ9A 4EP5A 1L5UA 3EO3A 4M3XA 4H0YB 5H1SQ 3BP8A 3UKRA 2OZSA 1SQKA 3ZSWA 4H03B 4DFMA 1QQCA 3ZT0A 1YF5L 2W6LA 4HCCA 3DYAA 4BRFA 3H1QA 2FF3B 4H8KA 1F21A 1S9EA 2OPPA 4B1ZA 4DR1K 3K57A 1LOTB 1C1AA 2KZZA 2ZF5O 2B5JA 3M6GA 1WAFA 3A5MC 1NKEA 2ZQBA 3LZJA 2OANA 2CH6A 3EN9A 3H1VX 4FK0A 4CF8A 4A57A 3AY9A 3E01A 2P9UB 3M8RA 3K5MA 3CMEN 5M1PA 4BC4A 1BI4A 4IJAA 4CK2A 3RMBA 1L3SA 4WF9L 1QS4A 4FJ5A 1ASUA 4IXCA 5TKWA 3RWUA 3C6AA 2G8HA 1J54A 2NRRA 1WN7A 4NCGA 4RW4A 4HCBA 1HYZA 1BCOA 1J6ZA 2NNWA 4H5WA 4CD1A 2FLOA 1U45A 1U48A 3A0IX 3HK2A 3TARA 2QWRA 3HP6A 1U49A 3QIPA 1VSKA 1TV6A 4CCHA 2P9NA 4H4OA 3R1XA 4IDHA 5AFUH 2ITMA 4BRQA 3PY8A 1WUAA 4O55A 4M3UA 1YUWA 5CE3A 1NK0A 1N34K 1UAXA 3U4LA 1BDGA 3V1RA 1HQEA 4FLVA 4B3RK 2G8KA 1C0TA 3FZFA 1M90O 3AVAA 3ZSOA 3OYLA 3V9WA 3IAYA 4CD3A 3VF4A 4JHDB 1NWKA 3DLLL 4FZXC 3EZ5A 3AO2A 3E9PA 2WBNA 5EY4A 1RBVA 1QVGM 2KKZA 4CFDA 3ASMA 4JKEA 3LL3A 4DR2K 1KVCA 2YNHA 1FKOA 4KREA 1BIUA 1RTIA 1JKHA 3E9LA 3ATUA 4CGFA 1NNEA 3H3NO 3LDNA 3MAQA 2JWKA 1WSHA 1RTJA 4BC3A 4BVPA 4IO9L 1N8RO 4PKIA 4CGGA 4CBWA 3GE1A 5EVZA 3PIOL 2I5JA 4DSLA 5FPEA 1TUYA 2D4WA 4DU4A 4F3TA 3M1FA 3AA5X 1YTAA 4FWNA 3TAMA 4JLHA 4WE1A 1Q86O 3L2RA 2QI2A 4B9NA 4RWTA 4H0VB 4DTSA 1SKRA 3J80O 2QWNA 4CF0A 3AVMA 4BRMA 1XC9A 4DTMA 3SJJA 3FE1A 1B92A 4NLCA 1JLGA 1RBUA 2A1RA 1ZBUA 3NF7A 3MDQA 4LH4A 4LY7A 2A40A 1WLJA 4BR4A 4WFAL 4ILJA 4ID1A 5CR4A 3MN7A 2QWMA 1X3NA 4IG3A 3JS6A 1KRPA 3KK7A 4FSVA 2YNGA 1GLEG 4A5BA 3CM6A 3HZ6A 4CEFA 3HVTA 1X9MA 3SV4A 1NG9A 5JICA 4YDUC 1GOAA 1S1VA 1TAUA 3A2FA 4N56A 3FR0A 5C24A 2ZJPL 1J53A 5JMVA 3DLRA 3DRSA 2FBVA 5KGWA 4C8NA 3QEPA 4JN4A 2DTUA 4A59A 3VF2A 1WSJA 2Q0UA 1KAYA 2AP1A 3NE6A 2NRXA 1GLCG 5AFUA 3K0SA 3VQ6A 1LV5A 2PBDA 4NCBA 5IWAK 3OYFA 2UUAK 3MXJA 3UIQA 3H45C 1HLUA 1C0GA 4H5VA 5AJ3K 4DR5K 3QESA 1NK9A 5I9EB 4BR5A 4DTRA 1NLVA 3CF5L 2P9UA 4JKAA 4B9QA 3CPEA 1SAZA 3AVGA 1WAJA 2GUPA 4M3YA 4FJ7A 3CD6N 3AVKA 1W7AA 3SV3A 4JV5K 3DM2A 2IVPA 2E4LA 3DI6A 1QHAA 3NFAA 3TR8A 4KHSA 1LW0A 4I2QA 3NAEA 4TSXA 1RDBA 1ASWA 3LWLA 3OS2A 2Z1HA 3VGMA 3ENHA 4W5NA 3V9UA 4CHPA 4FJLA 4E1MA 5DMRA 1RDWX 2HF3A 1W97L 1KAXA 5MLCQ 2O8BA 3KLFA 4CFBA 3B8AX 4DHYA 2E8AA 1GLJO 5E84A 5LMUK 3BY5A 3RMDA 3O8MA 4DKWA 1RT2A 4FXDA 1SUQA 4B1UB 1RT6A 3N4PA 3THWB 3K59A 5KQDA 4NO7A 4KH6A 1S1UA 3HOSA 1ZBFA 2EX3A 4CW7B 2QA4N 1Z26A 4LF5K 1JXEA 3SUPA 2F9WA 4ISFA 3T7ZA 1NU0A 3NH1A 3G71N 1YVNA 3HRGA 1VRUA 4H0XB 3BF1A 2UYTA 5HRSA 3O08A 4CF2A 1KVAA 1K8AO 3W3DA 2XY7A 4DV3K 4O0IA 4HHTA 5KRTA 3D7EO 5J1EA 2Z1IA 5FRNA 1D5AA 4DV6K 4BR9A 1QHTA 4F9OA 5M1FA 3B6PA 3ITHA 3AVJA 4YOYA 2BE2A 4Z4FA 1UOCA 3LP1A 3EY1A 4DMNA 5FPMA 3MECA 4B1WB 4OLBA 3WNEA 1BQNA 1O1WA 3OYDA 4A2BA 1TKZA 4KFBA 1SKWA 4BVOA 1U04A 2FF6A 3VOVA 2O8CB 3CPWM 5AQTA 3HM8A 3JXUA 3WQTA 4OKJA 2RKIA 1XHXA 4AM6A 4B9MA 1BGXT 4XEIA 4BG9A 3SPZA 4IG0A 3RSEB 3CQYA 3R9PA 2GBZA 4CJTA 3ULDA 2FSKA 4MDBA 4C8KA 1NM1A 3MX2A 4BRNA 1T8EA 4KTQA 1YI2N 3EE8A 3QETA 3SQ1A 2O4GA 4JKBA 2EHGA 4CFCA 3AVLA 5GIOA 3EE9A 4J2DA 2RHKA 5AQYA 4O8UA 5CY4A 3T1YK 1XNQK 3UE5A 3L8BA 3QNOA 3F5TA 1EWRA 2Y1JA 2XRIA 4BRIA 5HRNA 3RMAA 4FW2A 5HRRA 3LM2A 2V7ZA 1NGCA 2X6SA 1NK7A 1EP4A 5AQNA 1MA9B 3WEEB 3JAMO 4J8FA 1VSFA 1S5JA 2D0OA 4ILHA 3LDQA 4PKHA 2VG5A 5AQRA 4Q5VA 1XUPO 5CZ1A 2F96A 1MWMA 4DSFA 4N76A 3CQXA 4Z4HA 3KD5E 4B8CA 2ZJRL 4LFBK 3I55N 1DKGD 4CECA 4UQGA 3W0LA 4RCHA 2YHBA 4BDPA 4FLYA 3T19A 4FK4A 2KFNA 2CGLA 3CMAN 1TK5A 2QM1A 4X62K 3O9RA 3M8SA 2GV9A 3K9JA 4FWKA 3NMUA 3OS0A 4CZMA 3WNFA 1WB9A 4JD2B 1IG9A 4BY9C 4GV9A 1IKWA 4B9SA 2PFUA 2ZGZA 3O9UA 3QFUA 1T44A 3CFPA 3PX6A 1VSEA 4FW1A 2IDOA 4CGIA 5HLFA 1KC8O 2BUPA 2Q3SA 4KTWA 4BRGA 2GEMA 3F9MA 3QLHA 4Y0WA 1EQYA 2HSTA 1VQ8N 3CCLN 2UXDK 3HBTA 3R8EA 5DM7L 3RRGA 3KHYA 3DXKA 2QXFA 4CHNA 1HUXA 3P1GA 3V1QA 1K6YA 4CF9A 4ZTJA 3F73A 2W42A 3DRPA 2IVNA 3CCJN 5EXWA 2A1SA 4LF7K 4JKHA 1NBWA 1UA1A 3L3VA 2YNFA 4A5AA 4JK8A 3HOTA 4QCLA 5AQMA 1FJGK 1EXQA 1XHZA 3DJCA 4CESA 1W0HA 4NYFA 3DOKA 4AHUA 3HXMA 2P9KB 4WFNL 4H0PA 4Z4GA 4FLWA 3GOIA 3O5BA 3ZT2A 3THXB 4IFYA 5C12A 4MDAA 3D6RA 4JK9A 3J81O 1Q7YO 1EWQA 4XH5A 2E6LA 4E19A 1Z6RA 1BU6O 3VQ9A 3SQ2A 4FJ9A 5F0XA 1VQ7N 3E9OA 2HMPA 3ISNC 3VGLA 4CFAA 4CJQA 3BEXA 3TSPA 4Y1DA 2PZSA 4DV5K 4CGJA 5GAGP 3A5OC 3RRHA 4DF8A 1Y64A 3ID8A 2O8CA 2DFFA 4JNEA 4JKGB 3KVGA 4H5RA 2KFZA 1TL3A 3IRXA 4BDZA 1W9HA 3V81A 5JLHA 3S3NA 4IJNA 1KLMA 1E4GT 1MU2A 4CZFA 2UU9K 2OPSA 3RSEA 5A2QO 3FZMA 4GNIA 3VN5A 1NK6A 1HNWK 4WQ4C 1M1KO 4E7KA 4C23A 1YJNN 4WQ5C 3CXCM 4FPBA 4AHRA 4BROA 1T03A 1KAZA 2HOEA 3QIOA 4HUGA 4BREA 1BQMA 5BRDA 3VQ5A 1S22A 3RR8A 2PAVA 3I33A 5J2PA 4B9TA 1BA1A 1TKXA 5EU7A 3M8QA 3C0BA 3D2FB 1LAVA 3VGKA 4BRKA 2D1KA 5AQWA 3ZCMA 3VQEA 4GW6A 3PO4A 1EETA 3WEEA 1E4FT 1S1TA 2G8UA 4DLGA 1HX1A 3F9KA 3UB5A 4YOVA 3OYAA 2HF4A 3MN9A 1N5YA 4FWOA 1NGFA 3G10A 3PUFA 3SPYA 2W40A 3G4SN 1HJOA 1WSIA 5KPZA 3ID6A 2X78A 3THYB 1KCFA 4RG8A 3V6DA 5FPNA 1H1VA 3KKRA 4KI6A 2HHTA 4M7YA 4DSKA 4JD2A 2Q36A 1YTUA 4DR3K 1HRHA 2ASOA 3WXLA 3VEWA 2PY5A 3IDHA 1N6QA 1P8ZA 4FLXA 4YOXA 2BH1A 3DAWA 3CJ9A 2WFBA 3TANA 3OYIA 4PL7A 4FZYA 1XI1A 4FM0A 3ZSZA 1NGBA 3ULEB 2A6AA 1K8KB 5M1QA 1IV0A 3AARA 4M63C 1CLQA 1ZXOA 3OHRA 2PYJA 3CG7A 1K73O 3ALYA 1C0MA 4OKKA 1RT5A 1BHLA 3LM9A 2X6NA 2YKMA 4JI4K 3MCAB 3ZEUB 4AQYK 3IS9A 4JI1K 1BA0A 4ELUA 2VWBA 3M5RA 4DUZK 1HR0K 3SUQA 4AHSA 1T05A 4RW6A 3OA9A 4I6MB 4LF9K 5J2MA 4Y1CA 4NXMK 5SWMA 4KHWA 2Z1GA 1HYVA 3O6WA 3WXMB 4PQUA 4YNQA 3L0QA 4CJVA 3O3FA 1WNSA 2OCEA 3L6QA 2P9KA 1JLEA 2ETJA 3S41A 3VA3A 1VQMN 1QSLA 1NGEA 4HUEA 1KFDA 3PX4A 4BWJA 3THXA 3OYBA 4KHYA 5BREA 2R7YA 4CZKA 2HBLA 3BUZB 3C7NB 4ELTA 4CJ5A 2LSNA 1ZBLA 2E1YA 2YHWA 5JVGL 2YJFA 3KKSA 3ZLJA 2F7TA 3OVNA 3NBPA 4GKKK 1D4XA 3AO1A 3D45A 4FJIA 4CJEA 3KZBA 4FWSA 3K5OA 1VQ9N 4V19S 4PL8A 3VQPA 2HNDA 4C8LA 2O8FB 3RTVA 4YY3K 4LF4K 3OYEA 2WONA 3TAEA 3TAQA 1HNZK 3L2UA 4HUFA 4CZGA 3ZX0A 1YT3A 2HB5A 3H6EA 3T3FA 4K25A 3FLCO 3THVA 2KTQA 3OW2M 4CGDA 3HP9A 3O4QA 5F2RA 3IG1A 4FVUA 3QB0A 1P90A 5BPMA 4OO1J 3TABA 2P5GA 1JL2A 3D2FA 3VQAA 1VSIA 1RILA 1U2VB 3SMSA 2OPQA 5AZJB 3AVHA 4NLBA 3DXMB 1T3VA 4CEQA 4IOAL 1DTQA 2D0AA 3MWPA 1IKXA 4FM1A 3WXIA 3TPQA 3PSFA 3NCIA 3O9QA 3QNNA 1Y97A 5BN8A 4EZ6A 4FVMA 5KRSA 3THYA 4DG1A 4C1NK 3AO3A 3VEVA 3MWTA 3K58A 1SZ2A 1Q9XA 2YV0X 3K9KA 1NJXA 2QKKA 1ATSA 1RDAA 4M42A 3AVFA 4OPJA 4CGHA 1NJYA 3LDPA 4QS9A 3QO9A 3ZSXA 3L3UA 4LFAK 2F8TA 2Q1NA 1NMDA 1NKCA 5AQUA 3IMXA 4JKCA 2YHYA 2ASPA 1VQKN 1SL0A 4DF4A 5AQQA 2AJQA 3U3YA 3K5LA 4DWIA 3VQCA 5LMNK 5BRFA 1K8KA 2X74A 2V51B 3VTIA 4KPYA 4FJKA 3OTOK 3JSMA 3VEXA 3HI0A 3KWIA 5BRHA 5KGXA 2HHXA 5AQSA 5TKYA 3J7YP 3NF9A 3O9SA 3ZSQA 1W2BM 3VEZA 4BRCA 4KH4A 4DCHA 3DRRA 3WT0A 3ZEUA 4DV1K 1YVUA 3V1OA 4AHCA 4OPHA 4CHYA 3KIOA 4CIFA 4MO4A 3NH0A 3FZKA 1HNVA 2P5OA 3TTFA 1RT7A 5KTQA 4C8MA 4I2PA 1S9GA 5FROA
chains in the Genus database with same CATH topology
1DKGD 2KHOA 1X3MA 1YAGA 3W0LA 1VQ5N 5AQPA 3J8AA 4RCHA 5B8HA 2Q0RA 3M3ZA 3FZLA 1MDUB 2CGLA 3GL1A 1S3XA 2QM1A 3O9RA 1R59O 3VEOA 3K9JA 3VPZA 3C65A 2YJEA 3ENOA 4IOXA 4KBOA 3R3LA 4FWKA 5GIPA 3NMUA 4JHDA 5EOYA 4HWIA 4CZMA 4QS7A 2QWQA 2NRWA 3C7NA 3R6MA 4FOIA 2ZGYA 4JD2B 4BY9C 4GV9A 2GWKA 2W41A 2KLAA 3PLAA 3MX5A 1DGKN 3VENA 2QWLA 2QWOA 2PFUA 2ZGZA 3O1BA 2I7PA 2CGJA 2P9SB 4JK7A 3SAGA 1NGJA 2FXUA 2I7NA 5JLFA 5DM6L 3O9UA 3QFUA 3H46O 1T44A 4EAHD 2NRVA 4JEPA 3UKUB 3KWGA 1VQLN 1BO5O 1KC8O 2ZWHA 4BRLA 3MMVA 4WYBA 1QZ5A 3CJ7A 3SLCA 2BUPA 4BRGA 4CZLA 3I8BA 2GEMA 3F9MA 3CCQN 1NJIO 4Y0WA 1EQYA 2HSTA 1VQ8N 3TSQA 4K41A 3CJ1A 3CCLN 3I55N 3CETA 3HBTA 4PHTX 5GAEP 3R8EA 3Q7CA 3TU5A 3Q7BA 2E2QA 4IZ9A 4BQZA 3KHYA 5DM7L 3EO3A 3CJCA 4H0YB 3CI5A 5H1SQ 3BP8A 3DXKA 3UKRA 1SQKA 1HUXA 4CZEA 4H03B 2J4RA 1VQ6N 5AQHA 3D2EB 1BOTO 1YF5L 5JVHL 5AQIA 4BRFA 3H1QA 1HKBA 3CHWA 4K43A 2FF3B 4Z94A 4BG8A 1HKGA 2OTJN 4B1ZA 1JCFA 2IVNA 5F1XA 1G99A 3O1WA 4BRPA 3CCJN 1GLDG 4ISGA 3IFRA 1T6DA 5EXWA 1LOTB 3OBWA 4JKHA 1NBWA 4U67L 2ZF5O 3M6GA 4EIAA 3A5MC 4A5AA 4JK8A 3VMFB 3HOTA 5AQMA 5FPDA 4FO0A 3ZX2A 4R79A 3ATVA 2QXLA 4FWPA 5AQFA 3SAFA 3DJCA 4CI6A 3G6EN 2DPNA 2OANA 2CH6A 3EN9A 3H1VX 4H0TB 4WCEL 5BR9A 2Q31A 3AY9A 4A57A 2P9KB 3F2KA 4WFNL 2P9UB 1U2VA 1Q82O 4H0PA 1OVYA 3CCUN 4XH1A 3GOIA 3CMEN 5M1PA 5ELZA 3O5BA 3TSUA 4IJAA 4BC4A 3VF6A 4IOCL 5AZJA 4WF9L 3CCEN 5C12A 4MDAA 3D6RA 3DXMA 4JK9A 1Q7YO 4IXCA 4XH5A 5AQGA 4YOTA 2YCHA 3ZYYX 1ATRA 5TKWA 3C6AA 1Z6RA 3O4WA 1BU6O 1YXQA 2NRRA 5AQZA 2FSNA 4FOEA 4G9ZA 5F0XA 1VQ7N 3E9OA 1U6ZA 3ULEA 1J6ZA 2NNWA 4H5WA 2HMPA 4CD1A 3VGLA 2FLOA 3A0IX 4WQ4A 1VAZA 3WXJA 1NGHA 3ENBA 4IEIA 3BEXA 4JAXA 2QWRA 3TSPA 4AM7A 4WQ5A 3CJAA 1JCGA 2JWLA 2P9NA 3R1XA 4IDHA 3AAQA 3WQUA 5GAGP 5AFUH 3A5OC 2ITMA 5C10A 1Y64A 3ID8A 5C2DA 1GLAG 4JNEA 4JKGB 3KVGA 2Q97A 3SBGA 4H5RA 4BRQA 1WUAA 4FWRA 1YUWA 5CE3A 2ZJQL 4A61A 1VQON 5JLHA 5BPLA 4CBUA 3U4LA 1BDGA 1V4SA 3BF3A 2QW9A 4I6MA 4IJNA 3FZFA 1E4GT 3CMAN 4YOWA 4CZFA 1M90O 5BN9A 3O80A 3RSEA 4CD3A 3VF4A 4JHDB 1NWKA 3DLLL 2IIRA 3FZMA 4GNIA 4KH5A 3E9PA 4GVEA 4WQ4C 2WBNA 1M1KO 1EO1A 5EY4A 4C23A 1QVGM 2KKZA 1YJNN 2YX6A 4C1NI 3EKSA 4JKEA 4WQ5C 4EHUA 4BQLA 3LL3A 5AQOA 1Q18A 4FPBA 4XH4A 3CXCM 4BROA 2E88A 5AZIA 1QQMA 1KAZA 2HOEA 2ASMA 3P39A 4BREA 5BRDA 1S22A 4HTLA 1ZC6A 3GBTA 2PAVA 3I33A 1O13A 4GY2B 3VESA 1BA1A 3E9LA 3OBYA 3ATUA 3C0BA 3D2FB 4YORA 3H3NO 3VGKA 4BRKA 3LDNA 5AR0A 2D1KA 2NRHA 1JCEA 5AQWA 2JWKA 3HSCA 4BC3A 4BVPA 4IO9L 1N8RO 4PKIA 2P9LB 3EL2A 4CBWA 1TYQB 3GE1A 5EVZA 3PIOL 3WEEA 1E4FT 2H3GX 5FPEA 1TUYA 3DXKB 1VQ4N 3PIPL 1HX1A 2D4WA 1QVFM 3UB5A 4YOVA 3DWLA 3ZETB 2HF4A 5LJVA 4FWQA 3J7ZO 3P31A 3M1FA 3E1YA 4O8KA 4L3QA 3MN9A 3P4IA 4FWOA 1NGFA 1JJ2M 4FWNA 3SAHA 4AF1A 3IKMA 4A62A 4YDUA 1IJJA 2F9TA 2W40A 1Q86O 4GV3A 3G4SN 1HJOA 1X9JA 1DT9A 5KPZA 2QI2A 3ID6A 4BGAA 4RWTA 4H0VB 2E2PA 2QWNA 5FPNA 1H1VA 4BRMA 4E1JA 3FE1A 4M7YA 1Q81O 4JD2A 2Q36A 4NLCA 3G25A 2P9PB 3MDQA 4A2AA 2A40A 4H5NA 1IG8A 2D0PA 4BR4A 3MN6A 4WFAL 4ILJA 2ASOA 2P9SA 3MN7A 2QWMA 1X3NA 3L4IA 5CR4A 3WXLA 3JS6A 3KK7A 3VEWA 3IDHA 2VGMA 3UKUA 4FSVA 4EHTA 1GLEG 4A5BA 4BC2A 3HZ6A 5AQVA 3VERA 4FL9A 1P8ZA 3U9DA 4IFEA 4YOXA 2BH1A 1KQSM 3DAWA 5JICA 4YDUC 3CJ9A 2WFBA 4PL7A 3AGRA 3FR0A 3GDQA 2ZJPL 1NGBA 3ULEB 5JMVA 1VQNN 4IO8A 2A6AA 1K8KB 5M1QA 2VYPA 3AARA 3LDLA 4M63C 1LCUA 3L4QA 1ZXOA 2YI1A 5ADXH 3OHRA 3QDKA 2V7YA 4JN4A 3WUHA 4A59A 1K73O 3VF2A 2GWJA 4OPAA 3D2EA 2Q0UA 2P9IB 2E2NA 1KAYA 2AP1A 2NRXA 1GLCG 4BR0A 4CZJA 5AFUA 3LM9A 3MCAB 1GLBG 3ZEUB 1BA0A 2A42A 2VWBA 3M5RA 2PBDA 3H3OB 2BTFA 3OA9A 4FWMA 3H45C 4I6MB 5GAHP 1HLUA 4LC9B 1QQOA 1C0GA 2NRZA 4H5VA 4MLEA 1YJ9N 3O6WA 3WXMB 5M1OA 4UY8O 3L0QA 4BRDA 1HKCA 1ATNA 5I9EB 4BR5A 3L6QA 1NLVA 2P9KA 3CF5L 2P9UA 4JKAA 4B9QA 3S41A 3VEYA 3CPEA 1NGEA 1VQMN 4B1YB 1SAZA 3CC4N 2FSJA 2GUPA 3CCSN 4MLHA 3CD6N 1T6CA 4YOUA 2WC9A 2EWSA 2GELA 3QBXA 5BREA 4CZKA 2IVPA 5KPRA 4WFBL 2HBLA 1QHAA 3BUZB 3C7NB 5GADP 3NVMA 4GV6A 2E1YA 2A3ZA 1YHQN 2YHWA 3FFKB 5JVGL 2CH5A 2IVOA 2YJFA 1BWFO 2NZTA 1NGAA 2NRTA 2F7TA 3VGMA 3ENHA 3EZWA 2A41A 1GLFO 1D4XA 2QTDA 1RDWX 2HF3A 3AAPA 1W97L 1KAXA 5MLCQ 1Z05A 3CIPA 3KZBA 3B8AX 4FWSA 2A5XA 5EX5A 4DHYA 1VQ9N 2E8AA 4PL8A 3MK6A 1GLJO 1NGGA 1HPMA 5E84A 4B1VA 2QEXN 1ZBSA 3O8MA 4DKWA 3TTCA 1BG3A 3NVKA 2YHXA 4CJ7A 3QICA 3UKRB 4FWLA 4QS8A 2E2OA 4CZGA 3ZX0A 1C0FA 4B1UB 3N4PA 2QWPA 3H6EA 3SBTA 1RDUA 1V4TA 4K25A 5KQDA 5E26A 3FLCO 3VETA 3CC2N 4NO7A 3OW2M 4KH6A 3RVCA 2E20A 4H5TA 3HOSA 4RTFD 4K42A 2QA4N 5C15A 1KD1O 3ZX3A 5HL7L 1DEJA 3T69A 2F9WA 5F2RA 3EKUA 4ISFA 3T7ZA 4FVUA 2HBJA 4CBXA 3G71N 1YVNA 2Q2RA 3HRGA 3QB0A 4IWVA 1P90A 3TTDA 1RFQA 4H0XB 5BPMA 4OO1J 3A5LC 4BC5A 4B1XB 3BF1A 2UYTA 2AA4A 3D2FA 3IUCA 3O08A 1SS6A 1YJWN 1WOQA 3QBWA 1K8AO 3W3DA 1YIJN 2P9LA 5AQJA 1TYQA 2VGNA 1U2VB 3D7EO 3FGUA 3SJHA 3SMSA 5AZJB 2OTLN 4BR9A 4NLBA 5LJWA 5ADXA 3DXMB 1T3VA 4DQ8A 4F9OA 5M1FA 4H0OA 4IOAL 1ILYA 4O5FA 4YOYA 3CC7N 3ZETA 3MWPA 3WXIA 1S72N 3QFPA 3TPQA 3O9QA 5GINA 3A8YA 5FPMA 1NGIA 1TUUA 4B1WB 5BN8A 5C0YA 1KXPA 4C1NK 5HOOA 3CERA 3GG4A 4A2BA 3A5NC 3VEVA 5AQLA 3MWTA 2P9NB 1SZ2A 3MN5A 4BVOA 3CCVN 2FF6A 3K9KA 4JKDA 3VOVA 3N4QA 2P9PA 1ATSA 4FPAA 5M1NA 3CPWM 4DB3A 1QQNA 3I56N 3LDPA 4QS9A 2GTDA 5AQTA 3HM8A 1ESVA 2GX9A 3JXUA 3WQTA 3SMPA 1BUPA 2Q1NA 3FZHA 4BRAA 1NMDA 4AM6A 3CCMN 4ISEA 4XEIA 4BG9A 5AQUA 4ILGB 1CZAN 2WUSA 3IMXA 4JKCA 2YHYA 3RSEB 2ASPA 3CQYA 3R9PA 2FSKA 1VQKN 4MDBA 5AQQA 4NB4A 4U7BA 1NM1A 3MX2A 4BRNA 3MCPA 4CZHA 1QZ6A 2CGKA 1YI2N 3EE8A 4IEEA 4JKBA 4M7XA 1RGIA 4PKGA 2VCPA 5AQKA 2HBKA 5BRFA 1K8KA 3AGKA 2V51B 3VTIA 3LDOA 5GIOA 3VTHA 3EE9A 2RHKA 5AQYA 5AZIB 4O8UA 4BR2A 4CZIA 5CHIA 1XC3A 4BRHA 3VEXA 3UE5A 3HI0A 3KWIA 3P38A 5BRHA 3C6HA 3F5TA 1NGDA 3U9ZA 3U8XA 5AQSA 4BRIA 3O9TA 5TKYA 3WXKA 1YITN 2P9IA 3O9SA 4JKFA 4MO5A 3LM2A 2V7ZA 1W2BM 1GLLO 1VQPN 1NGCA 3VEZA 4BRCA 5KQ8A 4KH4A 4DCHA 3WT0A 3ZEUA 5C2FA 4OPHA 3HTVA 4BGBA 5AQNA 1MA9B 3WEEB 2E1ZA 1XQSC 1MWKA 4J8FA 2D0OA 4ILHA 5LY3A 3CCRN 3LDQA 4EFHA 3CJBA 4MO4A 4PKHA 2HBMA 5KPTA 5AQXA 5AQRA 3FZKA 3E66A 3SK3A 1XUPO 2NLXA 2RE2A 3QMLA 1MWMA 3TTFA 5BPNA 1K9MO 3CQXA 4JKGA 4BR7A 1OKJA 2V52B 2ZJRL 5M1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M1F A;  4IEE A;  5M1O A;  5M1N A;  3CPE A;  5C2F A;  5M1Q A;  5M1P A;  4IDH A;  3C6A A;  4IEI A;  5C10 A;  4IFE A;  5C15 A;  5C12 A;  3C6H A;  5C2D A;  5M1K A; 
#chains in the Genus database with same CATH topology
 4DLE A;  1YAG A;  1VQ5 N;  3HVR A;  5AQP A;  3AVI A;  2KQ2 A;  2Q0R A;  3GL1 A;  1MDU B;  1S3X A;  4I7F A;  3VPZ A;  4BRD A;  4KHQ A;  3ENO A;  3CM5 A;  3R3L A;  4JHD A;  4DSE A;  3C94 A;  4KTZ A;  2B6A A;  3C7N A;  3VQQ A;  4CE9 A;  2GWK A;  4DSJ A;  2KZM A;  2QWL A;  1QSS A;  2XY8 A;  2CGJ A;  4W5T A;  1ZBH A;  2FXU A;  3H46 O;  1CXU A;  2NRV A;  3OYM A;  4LD0 A;  3C6T A;  3MED A;  4BRL A;  4DTP A;  4WYB A;  3CFO A;  4I9L A;  2HNY A;  1NOY A;  3I8B A;  3CCQ N;  2D0B A;  1TKT A;  4L8R B;  3LDS A;  3TSQ A;  2O8F A;  3CJ1 A;  1RT1 A;  3CET A;  4PHT X;  5GAE P;  3TU5 A;  3Q7B A;  4DV0 K;  1NJW A;  2VQE K;  3L2V A;  2V52 B;  3LPT A;  1BCM A;  3QER A;  2J4R A;  4JI6 K;  4DFK A;  1IO2 A;  1VQ6 N;  1LWC A;  5AQH A;  3D2E B;  5JVH L;  1N32 K;  5AQI A;  1HKB A;  4K43 A;  4E3S A;  4Z94 A;  1RDC A;  3L2W A;  3SYZ A;  1HKG A;  3KD1 E;  2O8D B;  4Z4C A;  4BRP A;  3HT3 A;  5JS1 A;  4ISG A;  4LSN A;  1RTH A;  1T6D A;  4PUO A;  1OH5 A;  3ZX2 A;  2QXL A;  3SAF A;  3KK2 A;  2FBX A;  3KLG A;  4CHQ A;  2JLE A;  2DPN A;  3I0S A;  4H0T B;  3G6E N;  1OH7 A;  2Q31 A;  1KFS A;  1U2V A;  3HJF A;  3SNN A;  1I39 A;  2RN2 A;  1OVY A;  3CCU N;  5ELZ A;  3TSU A;  3CCE N;  5AZJ A;  1JXB A;  3DXM A;  4ID5 A;  4E7H A;  5AQG A;  3HM9 A;  2YCH A;  3BZK A;  1ATR A;  3ZYY X;  5AQZ A;  2FSN A;  1VK0 A;  1U6Z A;  4MQ3 A;  4OX9 K;  4E7I A;  1VAZ A;  4JI8 K;  4DV4 K;  3ENB A;  3FFI A;  4JAX A;  4AM7 A;  4QOZ B;  3CJA A;  1JCG A;  3WQU A;  3AAQ A;  4Z0U A;  3ZSR A;  1I94 K;  4K0K K;  5C2D A;  4DR7 K;  1HPZ A;  2XY6 A;  2ZJQ L;  4KV8 A;  4DQQ A;  1VQO N;  1V4S A;  3BF3 A;  2QW9 A;  5FLX O;  2W6K A;  4YOW A;  4ELV A;  2IIR A;  3C6U A;  4O4G A;  4KH5 A;  3MEE A;  4FK2 A;  4GVE A;  1EO1 A;  1RBR A;  3NGI A;  3RMC A;  2YX6 A;  4EHU A;  1Q18 A;  4XH4 A;  2E88 A;  2ASM A;  4C8O A;  3P39 A;  1N33 K;  2JGU A;  1ASV A;  1WBB A;  2E5L K;  1ZC6 A;  3GBT A;  1O13 A;  4CJR A;  3VES A;  4KHP K;  1C1B A;  3LAN A;  4YOR A;  2NRH A;  3O3G A;  1RT3 A;  3HSC A;  4KI4 A;  1A5W A;  1B9F A;  1XMO K;  1JL1 A;  3PIP L;  2UUC K;  1VSL A;  4JS5 A;  1QE1 A;  5LJV A;  3J7Z O;  2FC0 A;  4E7J A;  4O8K A;  4L3Q A;  4CEO A;  2UXC K;  3P4I A;  3IKM A;  4A62 A;  4YDU A;  2F9T A;  4GV3 A;  1D9F A;  1DT9 A;  3ZT4 A;  1A5V A;  1TKD A;  4DTJ A;  3THW A;  4E1J A;  4EP4 A;  1Q81 O;  2P9P B;  3WNG A;  2BAN A;  4CHZ A;  1J5E K;  3OYN A;  3MN6 A;  4M41 A;  2HHS A;  3L4I A;  4NCA A;  2P1J A;  4ZTF A;  2VGM A;  4X66 K;  1BI4 B;  4EHT A;  4DSI A;  4BC2 A;  4FL9 A;  3SCX A;  3TWH A;  4DFJ A;  4DU1 A;  3AGR A;  4NYN A;  1RTD A;  4N47 A;  2UUB K;  1FK9 A;  1LCU A;  2ITG A;  3L4Q A;  2YI1 A;  4BAC A;  3QDK A;  3T1H K;  2V7Y A;  3OYJ A;  4CJS A;  1S6P A;  1UWB A;  2GWJ A;  4FLT A;  4OPA A;  3D2E A;  2E2N A;  2UXB K;  4F2R A;  1NKB A;  4BR0 A;  1GLB G;  1D9D A;  1S1X A;  2A42 A;  2O8D A;  2VG6 A;  1IKV A;  2VG7 A;  3U6F A;  4KAZ A;  5GAH P;  1IKY A;  2G8I A;  3V9Z A;  2IS3 A;  2YHA A;  4IKF A;  4M3R A;  5M1O A;  1JLF A;  1HKC A;  3P5J A;  3C95 A;  3CQ8 A;  3VQD A;  3QIN A;  3EEQ A;  2RPI A;  1TL1 A;  3OYH A;  4W5R A;  4X64 K;  1VSJ A;  4DS4 A;  3CC4 N;  2FSJ A;  3CCS N;  4MLH A;  2YKN A;  4YOU A;  4PWD A;  2ZD1 A;  2GEL A;  1DLO A;  3QBX A;  5KPR A;  4FJN A;  4FJX A;  4Q0B A;  5GAD P;  4BE2 A;  2A3Z A;  1TVR A;  1BWF O;  1NGA A;  4GVM A;  3EZW A;  2A41 A;  1IH7 A;  2QTD A;  2G8W A;  3TAG A;  1U47 A;  1REV A;  1L3T A;  1Z05 A;  4CJW A;  5EX5 A;  3SQ4 A;  3MK6 A;  3SQ0 A;  4B1V A;  2QEX N;  3KJV A;  3NVK A;  1E3M A;  4B9L A;  2HMI A;  3QIC A;  4QS8 A;  1C0F A;  3I8D A;  1V4T A;  3O4N A;  4FJG A;  3CC2 N;  3HPG A;  2HVH A;  4B3M K;  4Z4E A;  1RBS A;  3RVC A;  4RTF D;  4K42 A;  1KD1 O;  4M45 A;  1JLC A;  4O5B A;  3T69 A;  5HL7 L;  4CEZ A;  3EKU A;  2F4V K;  4CBX A;  3V4I A;  3OY9 A;  4IWV A;  4JI5 K;  1BIZ A;  4CJ3 A;  4BC5 A;  2XO7 A;  4B1X B;  3IUC A;  3H08 A;  1LAW A;  4DQR A;  3B6O A;  4CJK A;  3QBW A;  2VWK A;  4FM2 A;  1YIJ N;  4DFP A;  3SJH A;  3FGU A;  4KKO A;  3OYG A;  1GOB A;  5LJW A;  1ILY A;  4H0O A;  4O5F A;  3CC7 N;  4CJP A;  3V9S A;  4PY5 A;  4FCY A;  1S72 N;  5FRM A;  1D8Y A;  3A8Y A;  1NGI A;  2VQF K;  2D5R A;  5C0Y A;  4LF8 K;  4OGE A;  3TAF A;  2G8F A;  1Q8I A;  4IBN A;  2Y1I A;  1FW6 A;  3QEV A;  3CER A;  3GG4 A;  5AQL A;  3MN5 A;  3CCV N;  4FPA A;  2P9P A;  3NGY A;  1QQN A;  1VHX A;  2GTD A;  1L3V A;  1ESV A;  4RW7 A;  3SMP A;  2WOM A;  1BUP A;  4R5P A;  3FZH A;  4BRA A;  3CCM N;  3DLH A;  5KI6 A;  3PSI A;  3MXI A;  1RDD A;  4K8X A;  2NUB A;  2BDP A;  4CIG A;  3MCP A;  1QZ6 A;  4DTU A;  3AVB A;  1KVB A;  2QKB A;  4IEE A;  5IT9 O;  2VCP A;  5AQK A;  2QK9 A;  4CF1 A;  3LDO A;  1IBK K;  4OGC A;  5AZI B;  5I3U A;  1XC3 A;  4JRQ A;  3SI6 A;  4GMJ B;  2DY4 A;  2O8B B;  3LWM A;  3NF6 A;  3U8X A;  1NK5 A;  3WXK A;  4F3O A;  4G1Q A;  3O3H A;  3DMJ A;  5KQ8 A;  1NK4 A;  2HNZ A;  5C2F A;  4CEE A;  4BGB A;  3D0P A;  1XQS C;  1B9D A;  5LY3 A;  3CCR N;  4EFH A;  5KPT A;  3V9X A;  3SK3 A;  3E66 A;  2RE2 A;  4B3T K;  4QAG A;  1K9M O;  4FJH A;  4O44 A;  2Z1J A;  4JKG A;  4BR7 A;  4CJL A;  5E41 A;  1WSE A;  3U3G A;  5M1K A;  2KHO A;  4CHO A;  1KLN A;  3M3Z A;  1R59 O;  3KLH A;  4KBO A;  2YJE A;  5CYM A;  4B8A B;  4KHU A;  5GIP A;  5HRP A;  5EOY A;  4HWI A;  1C6V A;  4E89 A;  4QS7 A;  1IBM K;  2NRW A;  3R6M A;  2ZGY A;  3BGR A;  1SL2 A;  2W41 A;  2KLA A;  4CIE A;  1DGK N;  3VEN A;  2QWO A;  3O1B A;  2I7P A;  4FJ8 A;  2P9S B;  3SAG A;  4JK7 A;  1R0A A;  4B3S K;  5JLF A;  4JI7 K;  1XNR K;  4EAH D;  3UKU B;  3ZT3 A;  1VQL N;  1BO5 O;  3MMV A;  4CZL A;  4F2S A;  1NJI O;  3LZI A;  4O0J A;  1HJR A;  4DTN A;  1XMQ K;  2F8S A;  1WBD A;  3Q7C A;  2HVI A;  2E2Q A;  4BQZ A;  4N41 A;  1QTM A;  3CJC A;  2HHV A;  3K5N A;  3CI5 A;  2OYQ A;  4J2B A;  2OPR A;  4E1N A;  4CZE A;  2HHH K;  1BOT O;  4DR6 K;  4DV2 K;  3CHW A;  1T7P A;  3DLE A;  4BG8 A;  4DV7 K;  2OTJ N;  3HPO A;  1JCF A;  5F1X A;  1G99 A;  2D0C A;  3O1W A;  1DTT A;  1GLD G;  3IFR A;  3OBW A;  1TK0 A;  4GKJ K;  4U67 L;  4EIA A;  1XWL A;  1KSP A;  3VMF B;  3VA0 A;  5FPD A;  4FO0 A;  1GOC A;  3ATV A;  4R79 A;  4FWP A;  3LP0 A;  5AQF A;  4FJJ A;  4CI6 A;  4WCE L;  5BR9 A;  1G15 A;  3F2K A;  1Q82 O;  3VQ8 A;  4XH1 A;  4IOC L;  1RNH A;  3VF6 A;  4JI0 K;  3AVN A;  1VSM A;  5DK5 A;  4YOT A;  4OLA A;  3O4W A;  1YXQ A;  2HHQ A;  4FOE A;  4G9Z A;  4W5O A;  3ULE A;  1VSD A;  4IFV A;  2OZM A;  4WQ4 A;  3WXJ A;  4DTO A;  1NGH A;  5CZ2 A;  1UA0 A;  4IEI A;  4WQ5 A;  2KW4 A;  2VWJ A;  2JWL A;  5C10 A;  4NXN K;  1GLA G;  4XIU A;  2Q97 A;  3SBG A;  4FWR A;  1Q9Y A;  4E0D A;  2FBT A;  4A61 A;  1JLQ A;  5BPL A;  3KLE A;  4CBU A;  4I6M A;  2RF2 A;  4I9Q A;  5BN9 A;  3O80 A;  3HST B;  1C1C A;  3OYK A;  3PV8 A;  1FXX A;  3OJU A;  1HYS A;  4C1N I;  3EKS A;  4BQL A;  5AQO A;  3VQB A;  5AZI A;  1QQM A;  4DS5 A;  3DLG A;  4HTL A;  1WSG A;  3HYF A;  2ATQ A;  4GY2 B;  3OBY A;  3ZT1 A;  5AR0 A;  1JCE A;  4M3W A;  3SUN A;  4CER A;  2P9L B;  3EL2 A;  1TYQ B;  5SZT A;  4H4M A;  4YHH K;  2IGI A;  1CZB A;  2H3G X;  1X9W A;  3DXK B;  1SL1 A;  1VQ4 N;  1QVF M;  2HHU A;  3KK3 A;  3DWL A;  3ZET B;  4FWQ A;  3P31 A;  3E1Y A;  4CVN E;  3LAM A;  5J2Q A;  1JJ2 M;  3SAH A;  4AF1 A;  5J2N A;  1IJJ A;  3HO1 A;  4JRP A;  1X9J A;  4JYA K;  1I3A A;  4BGA A;  2E2P A;  2O8E B;  4AHV A;  4PA1 A;  3G25 A;  3SUO A;  4M3T A;  4A2A A;  2IC3 A;  2IOC A;  4H5N A;  3KK1 A;  1IG8 A;  2D0P A;  2BGG A;  2P9S A;  4FZZ A;  3AA2 A;  3UKU A;  5AQV A;  4J2A A;  3VER A;  3U9D A;  4IFE A;  4M3Z A;  1HMV A;  1KQS M;  2B4J A;  2OA8 A;  3PO5 A;  3VQ7 A;  3GDQ A;  1VQN N;  4IO8 A;  4OVL A;  4CEB A;  2VYP A;  3LDL A;  5ADX H;  5C25 A;  3KLI A;  3WUH A;  1VRT A;  2P9I B;  4AHT A;  3CYM A;  3S3M A;  4CZJ A;  3SZ2 A;  3QEX A;  4BWM A;  3H3O B;  2BTF A;  4FWM A;  4ZHR A;  1X9S A;  2PYL A;  4LC9 B;  4JS4 A;  1QQO A;  2NRZ A;  4MLE A;  1SKS A;  4DQI A;  1YJ9 N;  1LWE A;  1HNX K;  2E6M A;  5BR8 K;  4UY8 O;  1ATN A;  5HBM A;  3VEY A;  1EKE A;  3DOL A;  4B1Y B;  1NMN A;  1RT4 A;  1T6C A;  2WC9 A;  2EWS A;  4WFB L;  3NGZ A;  3TI0 A;  4DU3 A;  4DTX A;  5D3G A;  4KRF A;  3NVM A;  1HNI A;  3ZSY A;  4GV6 A;  1YHQ N;  3FFK B;  2CH5 A;  2IVO A;  2NZT A;  1ZBI A;  2NRT A;  1N36 K;  2DFE A;  5HP1 A;  1GLF O;  3AAP A;  4CEA A;  4CK1 A;  4DUY K;  4F4K A;  3CIP A;  4KB1 A;  5T7B A;  2A5X A;  1NGG A;  1HPM A;  4RW8 A;  4FLU A;  1JLA A;  1ZBS A;  1J5O A;  3TTC A;  1BG3 A;  3T1A A;  3EYZ A;  2YHX A;  4CJ7 A;  4MFB A;  4X65 K;  5JS2 A;  3UKR B;  4FWL A;  2E2O A;  4IDK A;  2QWP A;  4ICL A;  1RDU A;  3SBT A;  2XY5 A;  2DFH A;  5E26 A;  3VET A;  3NDK A;  3MXM A;  2E20 A;  4H5T A;  4BE0 A;  1C0U A;  4CJ4 A;  5C15 A;  3ZX3 A;  1DEJ A;  1TK8 A;  4FLZ A;  4LFC K;  1HQU A;  2HBJ A;  2Q2R A;  1ITG A;  3P83 D;  3TTD A;  1L3U A;  3KTQ A;  1RFQ A;  4E7L A;  3A5L C;  1NJZ A;  3CFR A;  1RCH A;  2AA4 A;  1SS6 A;  3BZC A;  1YJW N;  1WOQ A;  4F8R A;  3VQ4 A;  2P9L A;  5AQJ A;  1TAQ A;  1TYQ A;  2FBY A;  2VGN A;  5C42 A;  2ZE2 A;  4HTU A;  2GUI A;  4AIL C;  4N5S A;  2OTL N;  4OPK A;  5ADX A;  4DQ8 A;  3NHG A;  4RW9 A;  1LW2 A;  1SV5 A;  3AVC A;  4LH5 A;  4EZ9 A;  3M8P A;  3ZET A;  3AA4 A;  3QFP A;  2HHW A;  2G8V A;  3L2Q A;  3DLK A;  4J2E A;  1Z25 A;  5GIN A;  3J7A P;  1TUU A;  1S1W A;  1KXP A;  1CXQ A;  3HPH A;  5LL6 Z;  5HOO A;  1IBL K;  4FYD A;  2O8E A;  1BIS A;  3A5N C;  4CJU A;  1ZYQ A;  2P9N B;  4JKD A;  3N4Q A;  5M1N A;  4B08 A;  3JYT A;  3PX0 A;  4KB0 A;  4DB3 A;  3I56 N;  1OH6 A;  1X1P A;  3LAL A;  3RR7 A;  4Z4I A;  2GX9 A;  3AO4 A;  3OYC A;  2YNI A;  4B9V A;  4ISE A;  4B3O A;  5FDL A;  3K2P A;  4ILG B;  1CZA N;  2WUS A;  3LPU A;  4KHN A;  5K14 A;  1U4B A;  4NB4 A;  1WSF A;  4U7B A;  3LAK A;  4CZH A;  5I42 A;  1JLB A;  2CGK A;  3I0R A;  4M7X A;  1RGI A;  4PKG A;  1NOZ A;  1NK8 A;  2HBK A;  3AGK A;  4CJF A;  3VTH A;  4CZI A;  4BR2 A;  5CHI A;  4BRH A;  3P38 A;  2ZM6 K;  3C6H A;  1NGD A;  3U9Z A;  3O9T A;  1RBT A;  1CZ9 A;  3BDP A;  1YIT N;  2P9I A;  3G0Z A;  2P51 A;  4JKF A;  4MO5 A;  3WNH A;  1GLL O;  3LP3 A;  4YFU A;  1OVQ A;  1VQP N;  2WTU A;  3MEG A;  1A5X A;  3HTV A;  4OJR A;  2E1Z A;  5HRO A;  3NH2 A;  1MWK A;  3CJB A;  2HBM A;  5AQX A;  4AH9 A;  1FKP A;  2NLX A;  5BPN A;  3QML A;  3ZSV A;  1OH8 A;  1OKJ A;  3AV9 A;  3AO5 A;  1EX4 A;  4CK3 A;  4B9U A;  4HVJ A;  1X3M A;  3QEW A;  3J8A A;  5B8H A;  3OJS A;  4JI2 K;  4DQP A;  3FZL A;  3VEO A;  4LF6 K;  3HL8 A;  3C65 A;  4IOX A;  1TGO A;  1J9A A;  1LWF A;  3OS1 A;  3QEI A;  2QWQ A;  1KTQ A;  4FOI A;  5CYQ A;  4DR4 K;  3TAP A;  3PLA A;  3MX5 A;  3NF8 A;  1QSY A;  3S9H A;  4BDY A;  4W5Q A;  4JI3 K;  1NGJ A;  2I7N A;  3LP2 A;  5DM6 L;  4BE1 A;  1BL3 A;  4JEP A;  3KWG A;  1VSH A;  2XHB A;  2ZWH A;  2IAJ A;  4FJM A;  1QZ5 A;  3CJ7 A;  3SLC A;  2HW3 A;  1S6Q A;  3AA3 A;  3DLB A;  4OKE A;  4LSL A;  4CED A;  4K41 A;  4K8Z A;  3S3O A;  2O4I A;  4KO0 A;  4DQS A;  4IZ9 A;  4EP5 A;  1L5U A;  3EO3 A;  4M3X A;  4H0Y B;  5H1S Q;  3BP8 A;  3UKR A;  2OZS A;  1SQK A;  3ZSW A;  4H03 B;  4DFM A;  1QQC A;  3ZT0 A;  1YF5 L;  2W6L A;  4HCC A;  3DYA A;  4BRF A;  3H1Q A;  2FF3 B;  4H8K A;  1F21 A;  1S9E A;  2OPP A;  4B1Z A;  4DR1 K;  3K57 A;  1LOT B;  1C1A A;  2KZZ A;  2ZF5 O;  2B5J A;  3M6G A;  1WAF A;  3A5M C;  1NKE A;  2ZQB A;  3LZJ A;  2OAN A;  2CH6 A;  3EN9 A;  3H1V X;  4FK0 A;  4CF8 A;  4A57 A;  3AY9 A;  3E01 A;  2P9U B;  3M8R A;  3K5M A;  3CME N;  5M1P A;  4BC4 A;  1BI4 A;  4IJA A;  4CK2 A;  3RMB A;  1L3S A;  4WF9 L;  1QS4 A;  4FJ5 A;  1ASU A;  4IXC A;  5TKW A;  3RWU A;  3C6A A;  2G8H A;  1J54 A;  2NRR A;  1WN7 A;  4NCG A;  4RW4 A;  4HCB A;  1HYZ A;  1BCO A;  1J6Z A;  2NNW A;  4H5W A;  4CD1 A;  2FLO A;  1U45 A;  1U48 A;  3A0I X;  3HK2 A;  3TAR A;  2QWR A;  3HP6 A;  1U49 A;  3QIP A;  1VSK A;  1TV6 A;  4CCH A;  2P9N A;  4H4O A;  3R1X A;  4IDH A;  5AFU H;  2ITM A;  4BRQ A;  3PY8 A;  1WUA A;  4O55 A;  4M3U A;  1YUW A;  5CE3 A;  1NK0 A;  1N34 K;  1UAX A;  3U4L A;  1BDG A;  3V1R A;  1HQE A;  4FLV A;  4B3R K;  2G8K A;  1C0T A;  3FZF A;  1M90 O;  3AVA A;  3ZSO A;  3OYL A;  3V9W A;  3IAY A;  4CD3 A;  3VF4 A;  4JHD B;  1NWK A;  3DLL L;  4FZX C;  3EZ5 A;  3AO2 A;  3E9P A;  2WBN A;  5EY4 A;  1RBV A;  1QVG M;  2KKZ A;  4CFD A;  3ASM A;  4JKE A;  3LL3 A;  4DR2 K;  1KVC A;  2YNH A;  1FKO A;  4KRE A;  1BIU A;  1RTI A;  1JKH A;  3E9L A;  3ATU A;  4CGF A;  1NNE A;  3H3N O;  3LDN A;  3MAQ A;  2JWK A;  1WSH A;  1RTJ A;  4BC3 A;  4BVP A;  4IO9 L;  1N8R O;  4PKI A;  4CGG A;  4CBW A;  3GE1 A;  5EVZ A;  3PIO L;  2I5J A;  4DSL A;  5FPE A;  1TUY A;  2D4W A;  4DU4 A;  4F3T A;  3M1F A;  3AA5 X;  1YTA A;  4FWN A;  3TAM A;  4JLH A;  4WE1 A;  1Q86 O;  3L2R A;  2QI2 A;  4B9N A;  4RWT A;  4H0V B;  4DTS A;  1SKR A;  3J80 O;  2QWN A;  4CF0 A;  3AVM A;  4BRM A;  1XC9 A;  4DTM A;  3SJJ A;  3FE1 A;  1B92 A;  4NLC A;  1JLG A;  1RBU A;  2A1R A;  1ZBU A;  3NF7 A;  3MDQ A;  4LH4 A;  4LY7 A;  2A40 A;  1WLJ A;  4BR4 A;  4WFA L;  4ILJ A;  4ID1 A;  5CR4 A;  3MN7 A;  2QWM A;  1X3N A;  4IG3 A;  3JS6 A;  1KRP A;  3KK7 A;  4FSV A;  2YNG A;  1GLE G;  4A5B A;  3CM6 A;  3HZ6 A;  4CEF A;  3HVT A;  1X9M A;  3SV4 A;  1NG9 A;  5JIC A;  4YDU C;  1GOA A;  1S1V A;  1TAU A;  3A2F A;  4N56 A;  3FR0 A;  5C24 A;  2ZJP L;  1J53 A;  5JMV A;  3DLR A;  3DRS A;  2FBV A;  5KGW A;  4C8N A;  3QEP A;  4JN4 A;  2DTU A;  4A59 A;  3VF2 A;  1WSJ A;  2Q0U A;  1KAY A;  2AP1 A;  3NE6 A;  2NRX A;  1GLC G;  5AFU A;  3K0S A;  3VQ6 A;  1LV5 A;  2PBD A;  4NCB A;  5IWA K;  3OYF A;  2UUA K;  3MXJ A;  3UIQ A;  3H45 C;  1HLU A;  1C0G A;  4H5V A;  5AJ3 K;  4DR5 K;  3QES A;  1NK9 A;  5I9E B;  4BR5 A;  4DTR A;  1NLV A;  3CF5 L;  2P9U A;  4JKA A;  4B9Q A;  3CPE A;  1SAZ A;  3AVG A;  1WAJ A;  2GUP A;  4M3Y A;  4FJ7 A;  3CD6 N;  3AVK A;  1W7A A;  3SV3 A;  4JV5 K;  3DM2 A;  2IVP A;  2E4L A;  3DI6 A;  1QHA A;  3NFA A;  3TR8 A;  4KHS A;  1LW0 A;  4I2Q A;  3NAE A;  4TSX A;  1RDB A;  1ASW A;  3LWL A;  3OS2 A;  2Z1H A;  3VGM A;  3ENH A;  4W5N A;  3V9U A;  4CHP A;  4FJL A;  4E1M A;  5DMR A;  1RDW X;  2HF3 A;  1W97 L;  1KAX A;  5MLC Q;  2O8B A;  3KLF A;  4CFB A;  3B8A X;  4DHY A;  2E8A A;  1GLJ O;  5E84 A;  5LMU K;  3BY5 A;  3RMD A;  3O8M A;  4DKW A;  1RT2 A;  4FXD A;  1SUQ A;  4B1U B;  1RT6 A;  3N4P A;  3THW B;  3K59 A;  5KQD A;  4NO7 A;  4KH6 A;  1S1U A;  3HOS A;  1ZBF A;  2EX3 A;  4CW7 B;  2QA4 N;  1Z26 A;  4LF5 K;  1JXE A;  3SUP A;  2F9W A;  4ISF A;  3T7Z A;  1NU0 A;  3NH1 A;  3G71 N;  1YVN A;  3HRG A;  1VRU A;  4H0X B;  3BF1 A;  2UYT A;  5HRS A;  3O08 A;  4CF2 A;  1KVA A;  1K8A O;  3W3D A;  2XY7 A;  4DV3 K;  4O0I A;  4HHT A;  5KRT A;  3D7E O;  5J1E A;  2Z1I A;  5FRN A;  1D5A A;  4DV6 K;  4BR9 A;  1QHT A;  4F9O A;  5M1F A;  3B6P A;  3ITH A;  3AVJ A;  4YOY A;  2BE2 A;  4Z4F A;  1UOC A;  3LP1 A;  3EY1 A;  4DMN A;  5FPM A;  3MEC A;  4B1W B;  4OLB A;  3WNE A;  1BQN A;  1O1W A;  3OYD A;  4A2B A;  1TKZ A;  4KFB A;  1SKW A;  4BVO A;  1U04 A;  2FF6 A;  3VOV A;  2O8C B;  3CPW M;  5AQT A;  3HM8 A;  3JXU A;  3WQT A;  4OKJ A;  2RKI A;  1XHX A;  4AM6 A;  4B9M A;  1BGX T;  4XEI A;  4BG9 A;  3SPZ A;  4IG0 A;  3RSE B;  3CQY A;  3R9P A;  2GBZ A;  4CJT A;  3ULD A;  2FSK A;  4MDB A;  4C8K A;  1NM1 A;  3MX2 A;  4BRN A;  1T8E A;  4KTQ A;  1YI2 N;  3EE8 A;  3QET A;  3SQ1 A;  2O4G A;  4JKB A;  2EHG A;  4CFC A;  3AVL A;  5GIO A;  3EE9 A;  4J2D A;  2RHK A;  5AQY A;  4O8U A;  5CY4 A;  3T1Y K;  1XNQ K;  3UE5 A;  3L8B A;  3QNO A;  3F5T A;  1EWR A;  2Y1J A;  2XRI A;  4BRI A;  5HRN A;  3RMA A;  4FW2 A;  5HRR A;  3LM2 A;  2V7Z A;  1NGC A;  2X6S A;  1NK7 A;  1EP4 A;  5AQN A;  1MA9 B;  3WEE B;  3JAM O;  4J8F A;  1VSF A;  1S5J A;  2D0O A;  4ILH A;  3LDQ A;  4PKH A;  2VG5 A;  5AQR A;  4Q5V A;  1XUP O;  5CZ1 A;  2F96 A;  1MWM A;  4DSF A;  4N76 A;  3CQX A;  4Z4H A;  3KD5 E;  4B8C A;  2ZJR L;  4LFB K;  3I55 N;  1DKG D;  4CEC A;  4UQG A;  3W0L A;  4RCH A;  2YHB A;  4BDP A;  4FLY A;  3T19 A;  4FK4 A;  2KFN A;  2CGL A;  3CMA N;  1TK5 A;  2QM1 A;  4X62 K;  3O9R A;  3M8S A;  2GV9 A;  3K9J A;  4FWK A;  3NMU A;  3OS0 A;  4CZM A;  3WNF A;  1WB9 A;  4JD2 B;  1IG9 A;  4BY9 C;  4GV9 A;  1IKW A;  4B9S A;  2PFU A;  2ZGZ A;  3O9U A;  3QFU A;  1T44 A;  3CFP A;  3PX6 A;  1VSE A;  4FW1 A;  2IDO A;  4CGI A;  5HLF A;  1KC8 O;  2BUP A;  2Q3S A;  4KTW A;  4BRG A;  2GEM A;  3F9M A;  3QLH A;  4Y0W A;  1EQY A;  2HST A;  1VQ8 N;  3CCL N;  2UXD K;  3HBT A;  3R8E A;  5DM7 L;  3RRG A;  3KHY A;  3DXK A;  2QXF A;  4CHN A;  1HUX A;  3P1G A;  3V1Q A;  1K6Y A;  4CF9 A;  4ZTJ A;  3F73 A;  2W42 A;  3DRP A;  2IVN A;  3CCJ N;  5EXW A;  2A1S A;  4LF7 K;  4JKH A;  1NBW A;  1UA1 A;  3L3V A;  2YNF A;  4A5A A;  4JK8 A;  3HOT A;  4QCL A;  5AQM A;  1FJG K;  1EXQ A;  1XHZ A;  3DJC A;  4CES A;  1W0H A;  4NYF A;  3DOK A;  4AHU A;  3HXM A;  2P9K B;  4WFN L;  4H0P A;  4Z4G A;  4FLW A;  3GOI A;  3O5B A;  3ZT2 A;  3THX B;  4IFY A;  5C12 A;  4MDA A;  3D6R A;  4JK9 A;  3J81 O;  1Q7Y O;  1EWQ A;  4XH5 A;  2E6L A;  4E19 A;  1Z6R A;  1BU6 O;  3VQ9 A;  3SQ2 A;  4FJ9 A;  5F0X A;  1VQ7 N;  3E9O A;  2HMP A;  3ISN C;  3VGL A;  4CFA A;  4CJQ A;  3BEX A;  3TSP A;  4Y1D A;  2PZS A;  4DV5 K;  4CGJ A;  5GAG P;  3A5O C;  3RRH A;  4DF8 A;  1Y64 A;  3ID8 A;  2O8C A;  2DFF A;  4JNE A;  4JKG B;  3KVG A;  4H5R A;  2KFZ A;  1TL3 A;  3IRX A;  4BDZ A;  1W9H A;  3V81 A;  5JLH A;  3S3N A;  4IJN A;  1KLM A;  1E4G T;  1MU2 A;  4CZF A;  2UU9 K;  2OPS A;  3RSE A;  5A2Q O;  3FZM A;  4GNI A;  3VN5 A;  1NK6 A;  1HNW K;  4WQ4 C;  1M1K O;  4E7K A;  4C23 A;  1YJN N;  4WQ5 C;  3CXC M;  4FPB A;  4AHR A;  4BRO A;  1T03 A;  1KAZ A;  2HOE A;  3QIO A;  4HUG A;  4BRE A;  1BQM A;  5BRD A;  3VQ5 A;  1S22 A;  3RR8 A;  2PAV A;  3I33 A;  5J2P A;  4B9T A;  1BA1 A;  1TKX A;  5EU7 A;  3M8Q A;  3C0B A;  3D2F B;  1LAV A;  3VGK A;  4BRK A;  2D1K A;  5AQW A;  3ZCM A;  3VQE A;  4GW6 A;  3PO4 A;  1EET A;  3WEE A;  1E4F T;  1S1T A;  2G8U A;  4DLG A;  1HX1 A;  3F9K A;  3UB5 A;  4YOV A;  3OYA A;  2HF4 A;  3MN9 A;  1N5Y A;  4FWO A;  1NGF A;  3G10 A;  3PUF A;  3SPY A;  2W40 A;  3G4S N;  1HJO A;  1WSI A;  5KPZ A;  3ID6 A;  2X78 A;  3THY B;  1KCF A;  4RG8 A;  3V6D A;  5FPN A;  1H1V A;  3KKR A;  4KI6 A;  2HHT A;  4M7Y A;  4DSK A;  4JD2 A;  2Q36 A;  1YTU A;  4DR3 K;  1HRH A;  2ASO A;  3WXL A;  3VEW A;  2PY5 A;  3IDH A;  1N6Q A;  1P8Z A;  4FLX A;  4YOX A;  2BH1 A;  3DAW A;  3CJ9 A;  2WFB A;  3TAN A;  3OYI A;  4PL7 A;  4FZY A;  1XI1 A;  4FM0 A;  3ZSZ A;  1NGB A;  3ULE B;  2A6A A;  1K8K B;  5M1Q A;  1IV0 A;  3AAR A;  4M63 C;  1CLQ A;  1ZXO A;  3OHR A;  2PYJ A;  3CG7 A;  1K73 O;  3ALY A;  1C0M A;  4OKK A;  1RT5 A;  1BHL A;  3LM9 A;  2X6N A;  2YKM A;  4JI4 K;  3MCA B;  3ZEU B;  4AQY K;  3IS9 A;  4JI1 K;  1BA0 A;  4ELU A;  2VWB A;  3M5R A;  4DUZ K;  1HR0 K;  3SUQ A;  4AHS A;  1T05 A;  4RW6 A;  3OA9 A;  4I6M B;  4LF9 K;  5J2M A;  4Y1C A;  4NXM K;  5SWM A;  4KHW A;  2Z1G A;  1HYV A;  3O6W A;  3WXM B;  4PQU A;  4YNQ A;  3L0Q A;  4CJV A;  3O3F A;  1WNS A;  2OCE A;  3L6Q A;  2P9K A;  1JLE A;  2ETJ A;  3S41 A;  3VA3 A;  1VQM N;  1QSL A;  1NGE A;  4HUE A;  1KFD A;  3PX4 A;  4BWJ A;  3THX A;  3OYB A;  4KHY A;  5BRE A;  2R7Y A;  4CZK A;  2HBL A;  3BUZ B;  3C7N B;  4ELT A;  4CJ5 A;  2LSN A;  1ZBL A;  2E1Y A;  2YHW A;  5JVG L;  2YJF A;  3KKS A;  3ZLJ A;  2F7T A;  3OVN A;  3NBP A;  4GKK K;  1D4X A;  3AO1 A;  3D45 A;  4FJI A;  4CJE A;  3KZB A;  4FWS A;  3K5O A;  1VQ9 N;  4V19 S;  4PL8 A;  3VQP A;  2HND A;  4C8L A;  2O8F B;  3RTV A;  4YY3 K;  4LF4 K;  3OYE A;  2WON A;  3TAE A;  3TAQ A;  1HNZ K;  3L2U A;  4HUF A;  4CZG A;  3ZX0 A;  1YT3 A;  2HB5 A;  3H6E A;  3T3F A;  4K25 A;  3FLC O;  3THV A;  2KTQ A;  3OW2 M;  4CGD A;  3HP9 A;  3O4Q A;  5F2R A;  3IG1 A;  4FVU A;  3QB0 A;  1P90 A;  5BPM A;  4OO1 J;  3TAB A;  2P5G A;  1JL2 A;  3D2F A;  3VQA A;  1VSI A;  1RIL A;  1U2V B;  3SMS A;  2OPQ A;  5AZJ B;  3AVH A;  4NLB A;  3DXM B;  1T3V A;  4CEQ A;  4IOA L;  1DTQ A;  2D0A A;  3MWP A;  1IKX A;  4FM1 A;  3WXI A;  3TPQ A;  3PSF A;  3NCI A;  3O9Q A;  3QNN A;  1Y97 A;  5BN8 A;  4EZ6 A;  4FVM A;  5KRS A;  3THY A;  4DG1 A;  4C1N K;  3AO3 A;  3VEV A;  3MWT A;  3K58 A;  1SZ2 A;  1Q9X A;  2YV0 X;  3K9K A;  1NJX A;  2QKK A;  1ATS A;  1RDA A;  4M42 A;  3AVF A;  4OPJ A;  4CGH A;  1NJY A;  3LDP A;  4QS9 A;  3QO9 A;  3ZSX A;  3L3U A;  4LFA K;  2F8T A;  2Q1N A;  1NMD A;  1NKC A;  5AQU A;  3IMX A;  4JKC A;  2YHY A;  2ASP A;  1VQK N;  1SL0 A;  4DF4 A;  5AQQ A;  2AJQ A;  3U3Y A;  3K5L A;  4DWI A;  3VQC A;  5LMN K;  5BRF A;  1K8K A;  2X74 A;  2V51 B;  3VTI A;  4KPY A;  4FJK A;  3OTO K;  3JSM A;  3VEX A;  3HI0 A;  3KWI A;  5BRH A;  5KGX A;  2HHX A;  5AQS A;  5TKY A;  3J7Y P;  3NF9 A;  3O9S A;  3ZSQ A;  1W2B M;  3VEZ A;  4BRC A;  4KH4 A;  4DCH A;  3DRR A;  3WT0 A;  3ZEU A;  4DV1 K;  1YVU A;  3V1O A;  4AHC A;  4OPH A;  4CHY A;  3KIO A;  4CIF A;  4MO4 A;  3NH0 A;  3FZK A;  1HNV A;  2P5O A;  3TTF A;  1RT7 A;  5KTQ A;  4C8M A;  4I2P A;  1S9G A;  5FRO A; 
#chains in the Genus database with same CATH homology
 1DKG D;  2KHO A;  1X3M A;  1YAG A;  3W0L A;  1VQ5 N;  5AQP A;  3J8A A;  4RCH A;  5B8H A;  2Q0R A;  3M3Z A;  3FZL A;  1MDU B;  2CGL A;  3GL1 A;  1S3X A;  2QM1 A;  3O9R A;  1R59 O;  3VEO A;  3K9J A;  3VPZ A;  3C65 A;  2YJE A;  3ENO A;  4IOX A;  4KBO A;  3R3L A;  4FWK A;  5GIP A;  3NMU A;  4JHD A;  5EOY A;  4HWI A;  4CZM A;  4QS7 A;  2QWQ A;  2NRW A;  3C7N A;  3R6M A;  4FOI A;  2ZGY A;  4JD2 B;  4BY9 C;  4GV9 A;  2GWK A;  2W41 A;  2KLA A;  3PLA A;  3MX5 A;  1DGK N;  3VEN A;  2QWL A;  2QWO A;  2PFU A;  2ZGZ A;  3O1B A;  2I7P A;  2CGJ A;  2P9S B;  4JK7 A;  3SAG A;  1NGJ A;  2FXU A;  2I7N A;  5JLF A;  5DM6 L;  3O9U A;  3QFU A;  3H46 O;  1T44 A;  4EAH D;  2NRV A;  4JEP A;  3UKU B;  3KWG A;  1VQL N;  1BO5 O;  1KC8 O;  2ZWH A;  4BRL A;  3MMV A;  4WYB A;  1QZ5 A;  3CJ7 A;  3SLC A;  2BUP A;  4BRG A;  4CZL A;  3I8B A;  2GEM A;  3F9M A;  3CCQ N;  1NJI O;  4Y0W A;  1EQY A;  2HST A;  1VQ8 N;  3TSQ A;  4K41 A;  3CJ1 A;  3CCL N;  3I55 N;  3CET A;  3HBT A;  4PHT X;  5GAE P;  3R8E A;  3Q7C A;  3TU5 A;  3Q7B A;  2E2Q A;  4IZ9 A;  4BQZ A;  3KHY A;  5DM7 L;  3EO3 A;  3CJC A;  4H0Y B;  3CI5 A;  5H1S Q;  3BP8 A;  3DXK A;  3UKR A;  1SQK A;  1HUX A;  4CZE A;  4H03 B;  2J4R A;  1VQ6 N;  5AQH A;  3D2E B;  1BOT O;  1YF5 L;  5JVH L;  5AQI A;  4BRF A;  3H1Q A;  1HKB A;  3CHW A;  4K43 A;  2FF3 B;  4Z94 A;  4BG8 A;  1HKG A;  2OTJ N;  4B1Z A;  1JCF A;  2IVN A;  5F1X A;  1G99 A;  3O1W A;  4BRP A;  3CCJ N;  1GLD G;  4ISG A;  3IFR A;  1T6D A;  5EXW A;  1LOT B;  3OBW A;  4JKH A;  1NBW A;  4U67 L;  2ZF5 O;  3M6G A;  4EIA A;  3A5M C;  4A5A A;  4JK8 A;  3VMF B;  3HOT A;  5AQM A;  5FPD A;  4FO0 A;  3ZX2 A;  4R79 A;  3ATV A;  2QXL A;  4FWP A;  5AQF A;  3SAF A;  3DJC A;  4CI6 A;  3G6E N;  2DPN A;  2OAN A;  2CH6 A;  3EN9 A;  3H1V X;  4H0T B;  4WCE L;  5BR9 A;  2Q31 A;  3AY9 A;  4A57 A;  2P9K B;  3F2K A;  4WFN L;  2P9U B;  1U2V A;  1Q82 O;  4H0P A;  1OVY A;  3CCU N;  4XH1 A;  3GOI A;  3CME N;  5M1P A;  5ELZ A;  3O5B A;  3TSU A;  4IJA A;  4BC4 A;  3VF6 A;  4IOC L;  5AZJ A;  4WF9 L;  3CCE N;  5C12 A;  4MDA A;  3D6R A;  3DXM A;  4JK9 A;  1Q7Y O;  4IXC A;  4XH5 A;  5AQG A;  4YOT A;  2YCH A;  3ZYY X;  1ATR A;  5TKW A;  3C6A A;  1Z6R A;  3O4W A;  1BU6 O;  1YXQ A;  2NRR A;  5AQZ A;  2FSN A;  4FOE A;  4G9Z A;  5F0X A;  1VQ7 N;  3E9O A;  1U6Z A;  3ULE A;  1J6Z A;  2NNW A;  4H5W A;  2HMP A;  4CD1 A;  3VGL A;  2FLO A;  3A0I X;  4WQ4 A;  1VAZ A;  3WXJ A;  1NGH A;  3ENB A;  4IEI A;  3BEX A;  4JAX A;  2QWR A;  3TSP A;  4AM7 A;  4WQ5 A;  3CJA A;  1JCG A;  2JWL A;  2P9N A;  3R1X A;  4IDH A;  3AAQ A;  3WQU A;  5GAG P;  5AFU H;  3A5O C;  2ITM A;  5C10 A;  1Y64 A;  3ID8 A;  5C2D A;  1GLA G;  4JNE A;  4JKG B;  3KVG A;  2Q97 A;  3SBG A;  4H5R A;  4BRQ A;  1WUA A;  4FWR A;  1YUW A;  5CE3 A;  2ZJQ L;  4A61 A;  1VQO N;  5JLH A;  5BPL A;  4CBU A;  3U4L A;  1BDG A;  1V4S A;  3BF3 A;  2QW9 A;  4I6M A;  4IJN A;  3FZF A;  1E4G T;  3CMA N;  4YOW A;  4CZF A;  1M90 O;  5BN9 A;  3O80 A;  3RSE A;  4CD3 A;  3VF4 A;  4JHD B;  1NWK A;  3DLL L;  2IIR A;  3FZM A;  4GNI A;  4KH5 A;  3E9P A;  4GVE A;  4WQ4 C;  2WBN A;  1M1K O;  1EO1 A;  5EY4 A;  4C23 A;  1QVG M;  2KKZ A;  1YJN N;  2YX6 A;  4C1N I;  3EKS A;  4JKE A;  4WQ5 C;  4EHU A;  4BQL A;  3LL3 A;  5AQO A;  1Q18 A;  4FPB A;  4XH4 A;  3CXC M;  4BRO A;  2E88 A;  5AZI A;  1QQM A;  1KAZ A;  2HOE A;  2ASM A;  3P39 A;  4BRE A;  5BRD A;  1S22 A;  4HTL A;  1ZC6 A;  3GBT A;  2PAV A;  3I33 A;  1O13 A;  4GY2 B;  3VES A;  1BA1 A;  3E9L A;  3OBY A;  3ATU A;  3C0B A;  3D2F B;  4YOR A;  3H3N O;  3VGK A;  4BRK A;  3LDN A;  5AR0 A;  2D1K A;  2NRH A;  1JCE A;  5AQW A;  2JWK A;  3HSC A;  4BC3 A;  4BVP A;  4IO9 L;  1N8R O;  4PKI A;  2P9L B;  3EL2 A;  4CBW A;  1TYQ B;  3GE1 A;  5EVZ A;  3PIO L;  3WEE A;  1E4F T;  2H3G X;  5FPE A;  1TUY A;  3DXK B;  1VQ4 N;  3PIP L;  1HX1 A;  2D4W A;  1QVF M;  3UB5 A;  4YOV A;  3DWL A;  3ZET B;  2HF4 A;  5LJV A;  4FWQ A;  3J7Z O;  3P31 A;  3M1F A;  3E1Y A;  4O8K A;  4L3Q A;  3MN9 A;  3P4I A;  4FWO A;  1NGF A;  1JJ2 M;  4FWN A;  3SAH A;  4AF1 A;  3IKM A;  4A62 A;  4YDU A;  1IJJ A;  2F9T A;  2W40 A;  1Q86 O;  4GV3 A;  3G4S N;  1HJO A;  1X9J A;  1DT9 A;  5KPZ A;  2QI2 A;  3ID6 A;  4BGA A;  4RWT A;  4H0V B;  2E2P A;  2QWN A;  5FPN A;  1H1V A;  4BRM A;  4E1J A;  3FE1 A;  4M7Y A;  1Q81 O;  4JD2 A;  2Q36 A;  4NLC A;  3G25 A;  2P9P B;  3MDQ A;  4A2A A;  2A40 A;  4H5N A;  1IG8 A;  2D0P A;  4BR4 A;  3MN6 A;  4WFA L;  4ILJ A;  2ASO A;  2P9S A;  3MN7 A;  2QWM A;  1X3N A;  3L4I A;  5CR4 A;  3WXL A;  3JS6 A;  3KK7 A;  3VEW A;  3IDH A;  2VGM A;  3UKU A;  4FSV A;  4EHT A;  1GLE G;  4A5B A;  4BC2 A;  3HZ6 A;  5AQV A;  3VER A;  4FL9 A;  1P8Z A;  3U9D A;  4IFE A;  4YOX A;  2BH1 A;  1KQS M;  3DAW A;  5JIC A;  4YDU C;  3CJ9 A;  2WFB A;  4PL7 A;  3AGR A;  3FR0 A;  3GDQ A;  2ZJP L;  1NGB A;  3ULE B;  5JMV A;  1VQN N;  4IO8 A;  2A6A A;  1K8K B;  5M1Q A;  2VYP A;  3AAR A;  3LDL A;  4M63 C;  1LCU A;  3L4Q A;  1ZXO A;  2YI1 A;  5ADX H;  3OHR A;  3QDK A;  2V7Y A;  4JN4 A;  3WUH A;  4A59 A;  1K73 O;  3VF2 A;  2GWJ A;  4OPA A;  3D2E A;  2Q0U A;  2P9I B;  2E2N A;  1KAY A;  2AP1 A;  2NRX A;  1GLC G;  4BR0 A;  4CZJ A;  5AFU A;  3LM9 A;  3MCA B;  1GLB G;  3ZEU B;  1BA0 A;  2A42 A;  2VWB A;  3M5R A;  2PBD A;  3H3O B;  2BTF A;  3OA9 A;  4FWM A;  3H45 C;  4I6M B;  5GAH P;  1HLU A;  4LC9 B;  1QQO A;  1C0G A;  2NRZ A;  4H5V A;  4MLE A;  1YJ9 N;  3O6W A;  3WXM B;  5M1O A;  4UY8 O;  3L0Q A;  4BRD A;  1HKC A;  1ATN A;  5I9E B;  4BR5 A;  3L6Q A;  1NLV A;  2P9K A;  3CF5 L;  2P9U A;  4JKA A;  4B9Q A;  3S41 A;  3VEY A;  3CPE A;  1NGE A;  1VQM N;  4B1Y B;  1SAZ A;  3CC4 N;  2FSJ A;  2GUP A;  3CCS N;  4MLH A;  3CD6 N;  1T6C A;  4YOU A;  2WC9 A;  2EWS A;  2GEL A;  3QBX A;  5BRE A;  4CZK A;  2IVP A;  5KPR A;  4WFB L;  2HBL A;  1QHA A;  3BUZ B;  3C7N B;  5GAD P;  3NVM A;  4GV6 A;  2E1Y A;  2A3Z A;  1YHQ N;  2YHW A;  3FFK B;  5JVG L;  2CH5 A;  2IVO A;  2YJF A;  1BWF O;  2NZT A;  1NGA A;  2NRT A;  2F7T A;  3VGM A;  3ENH A;  3EZW A;  2A41 A;  1GLF O;  1D4X A;  2QTD A;  1RDW X;  2HF3 A;  3AAP A;  1W97 L;  1KAX A;  5MLC Q;  1Z05 A;  3CIP A;  3KZB A;  3B8A X;  4FWS A;  2A5X A;  5EX5 A;  4DHY A;  1VQ9 N;  2E8A A;  4PL8 A;  3MK6 A;  1GLJ O;  1NGG A;  1HPM A;  5E84 A;  4B1V A;  2QEX N;  1ZBS A;  3O8M A;  4DKW A;  3TTC A;  1BG3 A;  3NVK A;  2YHX A;  4CJ7 A;  3QIC A;  3UKR B;  4FWL A;  4QS8 A;  2E2O A;  4CZG A;  3ZX0 A;  1C0F A;  4B1U B;  3N4P A;  2QWP A;  3H6E A;  3SBT A;  1RDU A;  1V4T A;  4K25 A;  5KQD A;  5E26 A;  3FLC O;  3VET A;  3CC2 N;  4NO7 A;  3OW2 M;  4KH6 A;  3RVC A;  2E20 A;  4H5T A;  3HOS A;  4RTF D;  4K42 A;  2QA4 N;  5C15 A;  1KD1 O;  3ZX3 A;  5HL7 L;  1DEJ A;  3T69 A;  2F9W A;  5F2R A;  3EKU A;  4ISF A;  3T7Z A;  4FVU A;  2HBJ A;  4CBX A;  3G71 N;  1YVN A;  2Q2R A;  3HRG A;  3QB0 A;  4IWV A;  1P90 A;  3TTD A;  1RFQ A;  4H0X B;  5BPM A;  4OO1 J;  3A5L C;  4BC5 A;  4B1X B;  3BF1 A;  2UYT A;  2AA4 A;  3D2F A;  3IUC A;  3O08 A;  1SS6 A;  1YJW N;  1WOQ A;  3QBW A;  1K8A O;  3W3D A;  1YIJ N;  2P9L A;  5AQJ A;  1TYQ A;  2VGN A;  1U2V B;  3D7E O;  3FGU A;  3SJH A;  3SMS A;  5AZJ B;  2OTL N;  4BR9 A;  4NLB A;  5LJW A;  5ADX A;  3DXM B;  1T3V A;  4DQ8 A;  4F9O A;  5M1F A;  4H0O A;  4IOA L;  1ILY A;  4O5F A;  4YOY A;  3CC7 N;  3ZET A;  3MWP A;  3WXI A;  1S72 N;  3QFP A;  3TPQ A;  3O9Q A;  5GIN A;  3A8Y A;  5FPM A;  1NGI A;  1TUU A;  4B1W B;  5BN8 A;  5C0Y A;  1KXP A;  4C1N K;  5HOO A;  3CER A;  3GG4 A;  4A2B A;  3A5N C;  3VEV A;  5AQL A;  3MWT A;  2P9N B;  1SZ2 A;  3MN5 A;  4BVO A;  3CCV N;  2FF6 A;  3K9K A;  4JKD A;  3VOV A;  3N4Q A;  2P9P A;  1ATS A;  4FPA A;  5M1N A;  3CPW M;  4DB3 A;  1QQN A;  3I56 N;  3LDP A;  4QS9 A;  2GTD A;  5AQT A;  3HM8 A;  1ESV A;  2GX9 A;  3JXU A;  3WQT A;  3SMP A;  1BUP A;  2Q1N A;  3FZH A;  4BRA A;  1NMD A;  4AM6 A;  3CCM N;  4ISE A;  4XEI A;  4BG9 A;  5AQU A;  4ILG B;  1CZA N;  2WUS A;  3IMX A;  4JKC A;  2YHY A;  3RSE B;  2ASP A;  3CQY A;  3R9P A;  2FSK A;  1VQK N;  4MDB A;  5AQQ A;  4NB4 A;  4U7B A;  1NM1 A;  3MX2 A;  4BRN A;  3MCP A;  4CZH A;  1QZ6 A;  2CGK A;  1YI2 N;  3EE8 A;  4IEE A;  4JKB A;  4M7X A;  1RGI A;  4PKG A;  2VCP A;  5AQK A;  2HBK A;  5BRF A;  1K8K A;  3AGK A;  2V51 B;  3VTI A;  3LDO A;  5GIO A;  3VTH A;  3EE9 A;  2RHK A;  5AQY A;  5AZI B;  4O8U A;  4BR2 A;  4CZI A;  5CHI A;  1XC3 A;  4BRH A;  3VEX A;  3UE5 A;  3HI0 A;  3KWI A;  3P38 A;  5BRH A;  3C6H A;  3F5T A;  1NGD A;  3U9Z A;  3U8X A;  5AQS A;  4BRI A;  3O9T A;  5TKY A;  3WXK A;  1YIT N;  2P9I A;  3O9S A;  4JKF A;  4MO5 A;  3LM2 A;  2V7Z A;  1W2B M;  1GLL O;  1VQP N;  1NGC A;  3VEZ A;  4BRC A;  5KQ8 A;  4KH4 A;  4DCH A;  3WT0 A;  3ZEU A;  5C2F A;  4OPH A;  3HTV A;  4BGB A;  5AQN A;  1MA9 B;  3WEE B;  2E1Z A;  1XQS C;  1MWK A;  4J8F A;  2D0O A;  4ILH A;  5LY3 A;  3CCR N;  3LDQ A;  4EFH A;  3CJB A;  4MO4 A;  4PKH A;  2HBM A;  5KPT A;  5AQX A;  5AQR A;  3FZK A;  3E66 A;  3SK3 A;  1XUP O;  2NLX A;  2RE2 A;  3QML A;  1MWM A;  3TTF A;  5BPN A;  1K9M O;  3CQX A;  4JKG A;  4BR7 A;  1OKJ A;  2V52 B;  2ZJR L;  5M1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...