5M1QA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound zinc
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
186
structure length
171
Chain Sequence
NSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
total genus 58
structure length 171
sequence length 186
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1qA00
5C2FA 4IDHA 5C12A 5C15A 5M1NA 4IEIA 5M1KA 4IEEA 5C10A 3C6AA 3CPEA 5M1QA 5M1OA 5M1PA 5C2DA 5M1FA 3C6HA 4IFEA
chains in the Genus database with same CATH superfamily
5GAHP 4DV3K 4QS9A 4CEFA 1NM1A 5CZ1A 1VQKN 2E1YA 4IJNA 3KZBA 3CM5A 1X3MA 1O1WA 4DQIA 3NMUA 3OYFA 2W6LA 3E9LA 2XO7A 3J81O 2HBKA 1VQ7N 3PIOL 3OYNA 3T1AA 4M45A 3CCMN 3NF8A 3P39A 4ILGB 4E3SA 4FZYA 2DFFA 3U9DA 3L2UA 4KB0A 3S3OA 2RE2A 2FBXA 1U49A 5HRNA 1I94K 4O0IA 4JS4A 2VWBA 4AHRA 3OS1A 4LF9K 3EL2A 3VF4A 3K5NA 1JLBA 4FPBA 2KQ2A 3GG4A 4FM1A 4FLYA 2PZSA 4JKAA 2O4IA 4PKGA 1VK0A 1WAJA 4M63C 2EWSA 3T1HK 1ATSA 4C8OA 4KH5A 3LM9A 3KKSA 1C6VA 2YX6A 3S41A 1RDWX 5AQOA 2VG5A 5JS2A 1LAVA 4K43A 3AVMA 3G10A 2B4JA 4BRIA 1IKVA 4HVJA 5JMVA 4F2RA 5J2QA 2NRZA 4JI3K 3D2EA 3TI0A 4KI4A 2NRVA 4BVOA 4H0PA 4CZGA 4W5QA 3ZEUB 4JS5A 4JAXA 4BRCA 3OYGA 4DR2K 2B6AA 4WQ4A 4Z0UA 5IT9O 1P8ZA 1VQ6N 4Q5VA 2A6AA 2P9NA 4K41A 4DTJA 4CEDA 3B6PA 4FLVA 1TYQA 3M8PA 1HJRA 4I2PA 4QOZB 3VEWA 4N5SA 1NWKA 2E8AA 4C1NI 4JI8K 3DJCA 3AVCA 4FJJA 3IKMA 4WF9L 3NGZA 4FM2A 2YJEA 4BR7A 2ATQA 3IUCA 1NNEA 4CJ3A 4KTQA 1SZ2A 1RT7A 2X78A 5EU7A 3VGLA 5LY3A 3NAEA 4F3OA 2D0OA 4OGCA 4DLEA 1ASWA 5J2NA 1B9DA 3NH0A 1XHZA 5BN9A 3K2PA 2P9UA 3P4IA 1N33K 4K8XA 3ZETA 1NKCA 4KTWA 1U48A 3V9UA 4MQ3A 4Z4HA 4O8UA 4CEQA 3OYBA 2A5XA 4JKCA 4BG8A 2Z1JA 3KWGA 4FW2A 3THXB 4JKDA 1IKWA 1KC8O 4CHPA 1BDGA 4CD3A 1X9SA 3MXJA 1IO2A 2D4WA 3SNNA 5LJVA 3MK6A 3CCLN 3WT0A 3QEPA 3H1QA 5HRRA 3JXUA 4LSLA 2FC0A 1QZ5A 2KW4A 1TK5A 1JL2A 2ZJRL 1IBMK 5C42A 3SMPA 3V1OA 2NUBA 5HOOA 3KD1E 4CEOA 3PV8A 5EVZA 5DM6L 3SV4A 3V4IA 4E0DA 1TVRA 4DB3A 2E6LA 3GOIA 4IZ9A 3DXMA 2HNYA 4ELVA 1N6QA 3AGKA 1VHXA 3KK1A 3EN9A 1IG8A 2GELA 1NMDA 5DMRA 1WBDA 1D8YA 2E5LK 1NGHA 3QERA 4HUEA 1KFDA 1KAYA 3HP6A 3WNGA 5ADXH 4JK8A 3KLGA 4KRFA 5AQGA 3VN5A 4EP4A 4XH5A 1UA0A 2FF6A 2V7YA 3ID8A 5C24A 4A5AA 4K8ZA 3I0SA 5KPRA 3HP9A 4NCGA 5FPMA 3RMCA 3MX2A 3D6RA 3O80A 2E2QA 4YFUA 4BACA 3MEEA 3EE9A 3O3GA 4E7JA 4BR4A 3SBGA 4RTFD 4PL8A 3K5LA 3V9SA 3KKRA 1NK5A 2IVNA 3NF9A 3KLEA 4DR5K 2QWQA 4B9TA 1HYZA 3QFPA 4MFBA 4CJ5A 1C0UA 2OPRA 3DAWA 5JVGL 4BR0A 3M8SA 3LAKA 4B3SK 4FWKA 4H0OA 2BE2A 5AQVA 2RHKA 3E9PA 1QHTA 2HNZA 4XH4A 1V4TA 3HM8A 1NBWA 5AQZA 3R1XA 4KB1A 4TSXA 3HJFA 1HX1A 1YIJN 1RILA 3ZLJA 2HMPA 1YI2N 3VQ6A 4RCHA 4PQUA 4DWIA 3HVTA 2PAVA 3CF5L 1ASUA 4FWPA 1RTHA 4X62K 3DWLA 4B9LA 4BE1A 2O4GA 4AM6A 1S1XA 3M1FA 3SUQA 3EEQA 1S1VA 1NJYA 2KFZA 3UKRA 2KKZA 3FZKA 5EX5A 1QTMA 4ISFA 1MWKA 4O4GA 1VSIA 1J6ZA 1J5EK 2D0AA 4BROA 1IV0A 1EWRA 1KLMA 2G8KA 2VWJA 1KCFA 3IG1A 4LFAK 5AFUH 2OTJN 3NF7A 3SYZA 3DRPA 5AQJA 1J53A 1T03A 4HWIA 1NJIO 4MLEA 3SK3A 1CXQA 4QAGA 4H4OA 1OH8A 4DU3A 4M3UA 3PLAA 1T3VA 3QLHA 4BRPA 4CJSA 3AVHA 1T7PA 4WQ5A 2E20A 3VF6A 1IH7A 4KHYA 1S9GA 1R59O 3AA5X 2I5JA 1NK8A 4B9MA 3NFAA 4IG0A 5MLCQ 4MO5A 3A5MC 3O9RA 1NMNA 5M1OA 4WYBA 4FM0A 3L2QA 4JHDB 2ITGA 3G4SN 1B92A 2VYPA 3PO4A 2JLEA 3R3LA 3AGRA 2P9KB 4A61A 4OKKA 2F8TA 5KGWA 5KPTA 3IDHA 5DK5A 3TSQA 4DQSA 3MMVA 2Q36A 5HRSA 1S22A 2ITMA 3OA9A 4EZ6A 4CF8A 2F4VK 5T7BA 4E7KA 1LOTB 2P9SB 3MCAB 1Q81O 4BRLA 4RW8A 4CJKA 5LL6Z 4DQRA 4DFJA 3CC7N 4JRPA 4CBXA 3OYDA 4FZXC 2O8CA 3THWA 3TARA 4B1YB 3E9OA 4KHNA 3C0BA 3WQTA 4K0KK 2E6MA 1TK0A 4BDYA 1YITN 4KO0A 4FOEA 4KTZA 3FZLA 1Q7YO 1OVYA 1NK7A 3SAGA 2NNWA 1XQSC 2E2NA 4JKFA 3LP1A 1N8RO 2ASMA 1Z05A 3AVKA 2G8VA 1JXEA 1R0AA 4KKOA 4B3RK 2VG7A 3RVCA 5AQFA 3V81A 4EP5A 1KVCA 1RDAA 5E26A 3RSEA 2CGKA 3KLHA 3TTFA 1HYVA 4DV2K 1U2VA 3CCVN 2HOEA 3GDQA 1JCFA 3WUHA 3ZCMA 4CGIA 1TKXA 4M3ZA 2UUBK 3OS2A 3HXMA 3SLCA 2BH1A 4FK0A 3OYHA 4EAHD 3WXJA 1VQNN 4KH4A 3DLLL 3CCJN 4YDUC 3BDPA 3U8XA 4LF5K 5KTQA 3HSCA 1VQ5N 1RDUA 2HF4A 4NB4A 2HNDA 4CW7B 4M3XA 2HB5A 5D3GA 2QXLA 4I7FA 1QSYA 2O8BA 2P9LB 2P5OA 3DLRA 3P5JA 1WSIA 1Q9XA 4GKKK 1X9JA 3VESA 3ZX3A 3UE5A 4YORA 2QK9A 4ID1A 5FPDA 3NH2A 5CY4A 3MEGA 2WC9A 2OYQA 1TUUA 4FK4A 4C23A 3T69A 5M1PA 3I8BA 4JI7K 5KRSA 1W9HA 1NKBA 2ASPA 5GAEP 1OH7A 1SAZA 3OYKA 1VRTA 1A5WA 4X64K 5F1XA 4GKJK 5C15A 3O1WA 4CHZA 1JJ2M 4CZHA 5SZTA 3TAPA 1NGFA 4AHUA 3VQEA 2JWLA 3JS6A 1BOTO 3THVA 1M90O 4JD2A 2YHWA 3EZ5A 2HSTA 1KVAA 4A2AA 3M8QA 4NXMK 3O9SA 3QEXA 3HM9A 5CE3A 3W0LA 3ASMA 2W42A 4F4KA 3TAFA 1BA1A 3M5RA 3JAMO 3VQCA 1ESVA 4FOIA 4FJ5A 1VSHA 1RTJA 3BY5A 3V1RA 4DR4K 1WOQA 3PSFA 3SCXA 4BC2A 5FRMA 1RBVA 2ZQBA 2Z1IA 3Q7CA 1WBBA 1HNWK 1YVNA 3VEVA 4FJHA 3PSIA 4B9QA 3ENBA 4ELUA 3WQUA 4JKHA 1S1UA 1WNSA 3LDOA 2GUIA 3ZSQA 4B1XB 3TABA 2ZGZA 4DV1K 4CEBA 1FJGK 4BQLA 1L3UA 2OPQA 3SQ1A 1DGKN 1RT4A 3OYAA 1SL2A 2RN2A 1K8KB 4Y1CA 4FJ8A 1VSEA 2P9PB 3VQDA 5CYQA 1GOBA 3LDQA 1NOZA 3THYB 4CF9A 3RMBA 1OKJA 4AILC 1JL1A 5ELZA 4GW6A 3DOLA 1JCGA 3W3DA 3WXKA 1I3AA 5BN8A 3PO5A 4M3WA 4M3TA 3LL3A 1KLNA 4DHYA 3A2FA 5HRPA 3V9ZA 1TGOA 4OLAA 3O9QA 3WXMB 1N5YA 2YHBA 5C12A 3L2WA 4FSVA 3MECA 4NYNA 4PUOA 4FLTA 3WEEA 2IVOA 2DY4A 3AO4A 4PA1A 2ETJA 2G8IA 2ZF5O 2FBTA 3O9TA 1XMOK 4CECA 2UYTA 2Q31A 4CHYA 4Z94A 2YJFA 4J2DA 1HJOA 3VEYA 4YOUA 1WB9A 3OYCA 4X66K 1B9FA 3O4QA 3V1QA 4CZIA 3DLKA 3SJHA 2GBZA 4DQPA 5EOYA 4FWLA 1JCEA 3KHYA 1KAXA 3ZT2A 5BR8K 2QI2A 1NJXA 5M1FA 3SJJA 3CYMA 4N56A 1EP4A 4BDZA 3MWPA 4CBUA 4F3TA 3HOSA 4DV7K 4CIGA 3MX5A 3DXKB 3PX4A 3CCSN 3AVJA 3QNNA 4DR7K 1SL1A 2HHHK 3J8AA 3LPUA 3NBPA 2YI1A 1JLQA 4HCCA 1VQLN 2P9IA 3O8MA 4H5VA 1OH5A 4DV6K 4YNQA 1HYSA 4C8NA 3TTCA 3QEVA 2G8HA 1BCMA 3H1VX 1EWQA 3L0QA 4CJWA 3F73A 3D2EB 4U7BA 1TAUA 4B1VA 1U6ZA 4BQZA 3SUPA 4HCBA 5I3UA 3AAQA 3NGIA 3DI6A 3ZT1A 1LV5A 1QQNA 3T7ZA 3QIPA 3ZSZA 5JLHA 3BUZB 3DRRA 4DCHA 1DEJA 3GL1A 3PIPL 1VRUA 3TAMA 3SQ0A 4DQQA 2IAJA 3C94A 4AHVA 3K59A 3L3VA 1P90A 5JS1A 4Y0WA 2PYLA 5M1NA 4CIEA 4DSLA 3ZEUA 3KJVA 4B3OA 4O0JA 2DTUA 4DG1A 1SS6A 3AARA 4BRKA 2VWKA 3KK2A 2WUSA 4B08A 3NGYA 2P9UB 4GVEA 3CC2N 4NCBA 3M3ZA 4DSJA 3LP2A 3QDKA 3QO9A 4C1NK 3BZKA 4Z4IA 4LH4A 3DRSA 4OPHA 4M42A 3R8EA 3U3GA 4JI4K 4DR6K 4BVPA 3L6QA 2CH5A 4FJGA 2QEXN 1GLCG 1T8EA 4IO9L 3OJUA 3OJSA 4B3TK 3FFKB 1IJJA 3O3FA 4DSFA 4H0YB 3LWLA 5GADP 1T05A 5K14A 3VQQA 1G99A 4O5FA 3LP3A 4BC5A 4KFBA 1K73O 2ZE2A 4IOCL 4F2SA 3F2KA 3H3OB 4JLHA 3F9KA 4KBOA 4DSKA 1MDUB 3LZIA 3DXMB 4NCAA 4DU4A 3VQBA 3L2VA 3SQ4A 3N4QA 4HUFA 1ZYQA 2I7NA 3IS9A 1NGIA 1QVFM 3AVNA 3HPHA 5C10A 3UKUB 4DF8A 1SQKA 4JNEA 1VQPN 1CXUA 1HLUA 5AQWA 4BRDA 4MDAA 2IC3A 5CYMA 1BI4A 3CJ9A 3O4WA 2DFHA 3K0SA 4IOXA 1TV6A 4PKIA 3NCIA 3QMLA 3LM2A 3NVMA 2HHWA 5JLFA 2QWPA 2F7TA 3AO3A 1NGEA 3HRGA 4E1NA 3LPTA 3E66A 3OW2M 5AQTA 3MN7A 4A5BA 1TAQA 4CZFA 1S6QA 1K9MO 3ATVA 3BGRA 3CJ7A 4BRGA 3NH1A 1HNZK 3J80O 4FWRA 4J8FA 1YUWA 3MDQA 3MWTA 5C2DA 1ZBLA 4DMNA 4KAZA 5BRFA 1XNRK 4DU1A 2QKBA 2DPNA 3OYJA 4DUYK 1K6YA 3NVKA 3AVIA 4JKBA 2PYJA 4B1UB 5AZIA 2Q3SA 1L3VA 4FPAA 2O8DB 1CZBA 3KK3A 3B8AX 2PFUA 5H1SQ 5BPMA 3U6FA 2XY6A 4GVMA 4RG8A 4BDPA 3CETA 4DTRA 2HBJA 1EETA 4EHUA 4JV5K 4JK7A 1SKSA 1ZXOA 4CJTA 5AQNA 2NRTA 2VQFK 4DUZK 4B9VA 1RDCA 3SUOA 1C1BA 2E4LA 3H46O 4O55A 4U67L 3VA3A 2YHXA 3KK7A 4CGDA 5AR0A 1NK6A 1E4GT 5SWMA 1VQ4N 1DTTA 4FJLA 1S5JA 3VTHA 4NYFA 3EYZA 2WONA 3ULEB 4WCEL 1GLDG 1WSJA 4RW6A 3UIQA 2Z1HA 3ZSWA 2ZJQL 2IIRA 2HBLA 4IWVA 1WN7A 2E88A 3KIOA 3QIOA 4DTUA 1YHQN 3K5MA 2D1KA 2P1JA 2FSKA 4WE1A 3FE1A 1D4XA 5AQPA 1YJWN 3MCPA 4CZMA 2X6NA 3WNFA 4E19A 3NHGA 4IFYA 4DKWA 2HVIA 1KVBA 4Z4CA 4BRMA 4UQGA 2BUPA 3V9XA 2Y1IA 3RR8A 3HZ6A 4DQ8A 1MA9B 4DV0K 3I33A 4IFVA 3I55N 3MXMA 4IEIA 3VEOA 4EHTA 5TKYA 4FLWA 3FFIA 4FL9A 3RRGA 3AA3A 4FXDA 1S3XA 1X1PA 4NO7A 3D45A 4BG9A 2W40A 3ISNC 1W2BM 4DFMA 4KHWA 4CJ4A 4JI0K 1WSHA 2YCHA 2O8CB 3THWB 2XHBA 4GNIA 3L4IA 2GWJA 3QINA 4IBNA 3ITHA 4I2QA 4CK2A 1J54A 3CMEN 3CQYA 3RR7A 5BREA 3MAQA 3D0PA 3C95A 1W0HA 4BR2A 3AVGA 1JLGA 4N41A 4BRNA 2ZGYA 5KRTA 3CD6N 2P9SA 4R79A 3VERA 1WAFA 5M1KA 4LF4K 2W6KA 3TAQA 5FRNA 1FXXA 3ZX0A 3ULDA 1W7AA 4FO0A 2HBMA 3VOVA 4CZJA 2E2OA 1ZC6A 2KTQA 4LFCK 3NF6A 4OLBA 3BF1A 1NG9A 4A62A 5HBMA 2NRWA 4DSIA 1YF5L 3RSEB 2E1ZA 4BRAA 3AVBA 4B9NA 4BRFA 2YNGA 1YJ9N 2AP1A 1U2VB 1FKPA 3ZX2A 4OX9K 2P51A 4GMJB 2IGIA 3K9JA 3CMAN 1ATRA 3CC4N 3KTQA 4BWJA 3K9KA 3I0RA 3TAEA 3CJAA 4CK3A 4JRQA 1SKRA 4BR5A 1Z6RA 3ID6A 3OY9A 2BDPA 1FKOA 4CERA 2X6SA 3ZYYX 1LW0A 1C1CA 4Q0BA 4I9LA 3R6MA 4XH1A 3O3HA 4CJUA 2XY8A 3TPQA 1V4SA 3VQAA 4CJ7A 1LCUA 4YY3K 1C1AA 1IG9A 2OTLN 4CCHA 1C0GA 4YHHK 1LWEA 5J2MA 3EY1A 4AHSA 4LF8K 4CGJA 5ADXA 2Y1JA 4FZZA 4CE9A 2KFNA 1KTQA 4MO4A 5B8HA 1I39A 3TANA 2FXUA 1XC9A 1RNHA 4LFBK 3PX0A 1GOAA 2F96A 5AZJB 4G1QA 3HSTB 3K57A 1HKGA 3MN5A 4UY8O 3D2FB 4F9OA 1DKGD 4DR1K 1GOCA 2V51B 1C0FA 3P1GA 4JEPA 2HVHA 2VG6A 1XUPO 4E1JA 4CF2A 1Y97A 5AQXA 2VGMA 4CJLA 4W5TA 2FF3B 3VQ9A 5TKWA 1JLCA 3DYAA 4H5TA 4KV8A 4JD2B 1N32K 4H5RA 4CK1A 4A2BA 3VA0A 2V7ZA 1RTIA 2Z1GA 3LALA 3TWHA 4O8KA 3G6EN 4Y1DA 2JGUA 2VCPA 3IRXA 1Q82O 1RDDA 4FWNA 4I6MB 4FLUA 1MU2A 1ZBSA 4H0VB 1FK9A 1BQMA 5FLXO 4EZ9A 1HRHA 1CZ9A 3VETA 4H8KA 4KH6A 2VQEK 1RCHA 1GLJO 1TKTA 4CJEA 3QBWA 2RPIA 5AQHA 4E7HA 4PL7A 3FLCO 3CXCM 3LWMA 5AFUA 3T3FA 3F9MA 4PKHA 4CZLA 4CEEA 5AQLA 4M41A 1NLVA 4W5OA 1XMQK 4CBWA 1U45A 4IDHA 4B1ZA 4IEEA 2D0BA 1CZAN 2QTDA 1NKEA 3O9UA 3ZT0A 4JKGA 2P5GA 1T44A 3KLFA 4KREA 3O1BA 3NE6A 3KVGA 4I9QA 1ATNA 1K8AO 5I9EB 3MN9A 1NU0A 2GTDA 4H4MA 4CJFA 4FJNA 4ILJA 4EIAA 2A1SA 2HMIA 1J5OA 1IKXA 4FLZA 3P83D 3OHRA 3DLEA 3CPWM 1S1TA 1WUAA 3BP8A 1ILYA 4YDUA 1Q18A 2V52B 2O8FB 2ZM6K 1S6PA 1BA0A 4YOYA 2OPSA 3RMDA 3RRHA 1K8KA 1CLQA 1G15A 2QWLA 5DM7L 1SKWA 1BQNA 3QEIA 2Q0RA 2Q0UA 2WBNA 1SL0A 3C6TA 3THYA 3G0ZA 3TR8A 3HYFA 4BREA 2G8FA 4CF1A 3DOKA 4RW9A 4DTXA 4GV3A 3WEEB 3L2RA 1ZBIA 3C7NA 3J7YP 1ZBUA 3RMAA 3CI5A 3I8DA 5KQ8A 2UXCK 5BPNA 2ASOA 5AQQA 2KZMA 2NRRA 4JI2K 3CCEN 1XWLA 1BU6O 2E2PA 4B8AB 1EKEA 1U04A 4E7IA 1HQUA 1S72N 4CI6A 2QKKA 3FGUA 2O8EA 3OBYA 1NK0A 2HHUA 4NLCA 1VSFA 3ZSRA 1VQ9N 4DTMA 5LMNK 4NLBA 4HUGA 1RBRA 1QQCA 1QQMA 4C8KA 3RTVA 1FW6A 3A0IX 3AY9A 1NGDA 2KZZA 3QBXA 2G8WA 3SPZA 3CIPA 1EX4A 2YNFA 3OYLA 3DLBA 3AAPA 3SQ2A 2P9IB 5AJ3K 5CZ2A 5GIOA 3LANA 3B6OA 4DV5K 3FZHA 3I56N 4JN4A 3C6HA 3EE8A 3OVNA 1U47A 2YHAA 2AJQA 3A8YA 4ZTJA 3CQXA 1BO5O 2HW3A 4AH9A 2HHSA 2GUPA 5LJWA 3DXKA 3SMSA 3CJCA 2A1RA 4BY9C 4BC3A 3HK2A 4QCLA 5KI6A 4JKEA 3EKUA 2P9NB 5M1QA 1REVA 2WOMA 1TYQB 1OH6A 3TSUA 1H1VA 1TL1A 1Y64A 5CR4A 1OVQA 4FWSA 1S9EA 4BRQA 4EFHA 1TK8A 1KAZA 3VEXA 4IFEA 2F8SA 3AA2A 1HUXA 1XHXA 5I42A 1XI1A 3FR0A 3KLIA 4MLHA 1HPZA 4W5RA 3U3YA 1X3NA 4BRHA 1N36K 1TUYA 2RF2A 2B5JA 4OKJA 4AHTA 4DR3K 3ZETB 2J4RA 4L3QA 4IO8A 3GBTA 4N76A 4WFBL 4V19S 1Q8IA 1VSKA 1GLAG 4H0TB 1L3TA 1IBLK 5AQKA 3IAYA 4WFAL 4FJ7A 4BR9A 4CHQA 3CG7A 4JYAK 4PHTX 1S1WA 1C0MA 1ASVA 3U9ZA 4IOAL 5C0YA 4DSEA 2QM1A 3P38A 1DTQA 2OANA 4CIFA 1BCOA 3BEXA 1TKDA 3J7ZO 2GV9A 3ENOA 3S9HA 3H08A 1ZBHA 4ILHA 4YOTA 2FSNA 3LZJA 1WSEA 3THXA 2OZMA 3C65A 4FWQA 1D5AA 1D9FA 4H03B 2CH6A 1T6DA 3SUNA 3LDPA 5GINA 3A5NC 1WLJA 1NK4A 3VMFB 3IMXA 4YOVA 2ZJPL 1Z25A 2A42A 4FVUA 1U4BA 1E4FT 2JWKA 5KPZA 2G8UA 1HKBA 5BRDA 4KHSA 4RWTA 4LC9B 2OZSA 1KXPA 4JI6K 1RT3A 4AF1A 3WXLA 2IOCA 3ZT3A 3WNEA 4CGFA 4WQ5C 2EHGA 1BI4B 5C25A 3OYEA 3LDNA 1JLAA 3VQ8A 2RKIA 4CEZA 3S3MA 4E89A 5BR9A 1W97L 1MWMA 4B1WB 2QXFA 3V9WA 4AHCA 3UKUA 4DLGA 4DTPA 3O08A 1EQYA 1VSMA 4FJMA 1BG3A 4BE2A 1KQSM 1NOYA 2YHYA 2OA8A 4KHPK 4ICLA 1RBTA 4BWMA 3BF3A 1HPMA 4CESA 4HHTA 3U4LA 5E41A 3CCUN 2H3GX 4KHUA 1HKCA 3DM2A 5BPLA 2F9TA 4IDKA 2Q97A 2KHOA 3LP0A 5FPNA 3TTDA 1JLEA 4CHOA 4DV4K 3VENA 4LF6K 4QS7A 5AZIB 4IKFA 4DFKA 4CZEA 1NGAA 1UAXA 3E01A 3LDSA 4AM7A 4N47A 2FBYA 4H5NA 4RW7A 2CGLA 3SPYA 4PY5A 4CFAA 2QWMA 5CHIA 3AV9A 4FVMA 1LAWA 1UA1A 3DLGA 3DMJA 1VSLA 4B9UA 1VSDA 4DTNA 5J1EA 4J2AA 1Q86O 1NGGA 3FZFA 1L5UA 2YKMA 4GV9A 1BISA 4DTOA 1QZ6A 2KLAA 4FCYA 3UKRB 2YKNA 3HBTA 1QSSA 1X9MA 3T19A 5F2RA 2UXBK 4DFPA 2O8DA 2NRHA 5FDLA 4LD0A 3EO3A 1EO1A 1BWFO 3CCQN 3F5TA 3AVFA 2GEMA 1SV5A 2A40A 4FYDA 1E3MA 4BGAA 3TSPA 3VEZA 3SZ2A 3K5OA 4OGEA 2D0CA 3LAMA 4OPAA 1DLOA 5JICA 3H6EA 1NK9A 1N34K 3ULEA 3VTIA 5HP1A 1NGJA 2UUCK 2FLOA 2D0PA 5AQYA 3CCRN 4CGHA 2W41A 4FW1A 3CERA 3OYIA 3C6AA 4M7YA 1BIUA 1ITGA 4OPJA 3HO1A 1HQEA 2YNHA 3WNHA 3TAGA 5BRHA 1A5VA 2QWNA 4FJIA 1TL3A 3QICA 4CF0A 3QFUA 1YXQA 1BGXT 4MDBA 4O44A 5E84A 2QWOA 4E7LA 2UXDK 2NZTA 4G9ZA 3D7EO 4JHDA 4CEAA 3G71N 3NDKA 1BUPA 1UWBA 2WTUA 5EY4A 4C8MA 3VGKA 4M3YA 4FJKA 1A5XA 2P9KA 3EKSA 2XRIA 4ELTA 2I7PA 4M3RA 2IVPA 1YTUA 3OS0A 4XIUA 5AQMA 4C8LA 4KI6A 1QQOA 3T1YK 2FBVA 4CVNE 3SV3A 4L8RB 3P31A 3AA4A 1QE1A 3ZT4A 4R5PA 4A57A 1J9AA 5AQRA 4ID5A 3QETA 4LF7K 2OPPA 1RT6A 3VGMA 4H0XB 3SAHA 3AVAA 2D5RA 3FZMA 3WXIA 1GLLO 1T6CA 2DFEA 3CJBA 3CPEA 3MEDA 1NJWA 1YTAA 2HHXA 1RGIA 2R7YA 3UB5A 4H5WA 3VQ5A 1VQON 1VSJA 1RT5A 4CJQA 3PY8A 2X74A 1QS4A 3AO1A 3H3NO 4CJPA 2IDOA 3QB0A 1BIZA 4DTSA 3O4NA 2IS3A 4M7XA 4YOXA 3HPGA 5FPEA 2BANA 5IWAK 1KFSA 3HL8A 1NJZA 1HMVA 1C0TA 2EX3A 2LSNA 4LH5A 3ATUA 1HNVA 4Z4FA 4JI1K 3HPOA 1XNQK 4O5BA 3K58A 1DT9A 5JVHL 4JI5K 4CGGA 1L3SA 1RTDA 3VQ4A 1ZBFA 4CFCA 3ZSXA 2UUAK 3J7AP 3ZSOA 4HTLA 3AO5A 3R9PA 3E1YA 3JSMA 2O8BB 1BHLA 4LY7A 1JLFA 4F8RA 2YV0X 4OPKA 4HTUA 1KSPA 2PY5A 4B9SA 1YJNN 4ISEA 3ZSVA 1F21A 3H45C 5HLFA 3QNOA 4DS4A 3SI6A 2XY7A 3GE1A 1RDBA 5AQUA 4K25A 2ZD1A 2P9LA 5KQDA 3O5BA 1VAZA 3L4QA 1HR0K 2F9WA 5AZJA 4LSNA 3MXIA 4DF4A 3AO2A 3A5OC 1KRPA 3HOTA 3OYMA 3D2FA 1WSGA 3M6GA 1RT1A 1EXQA 2Q1NA 2XY5A 3VF2A 1BL3A 3CFRA 3SBTA 3OTOK 3G25A 4CHNA 3PUFA 4ISGA 1NGBA 4FWOA 3CFOA 2Q2RA 2HF3A 2VGNA 4CZKA 1WSFA 3HVRA 2NLXA 3KD5E 4IG3A 4ZHRA 4QS8A 3O6WA 1YVUA 1O13A 5KGXA 1TKZA 1IKYA 5HL7L 1UOCA 3VPZA 3L3UA 5F0XA 5GIPA 1NGCA 3Q7BA 1JKHA 2NRXA 4NXNK 1QHAA 1LW2A 2A3ZA 4RW4A 3OBWA 2GX9A 3VQPA 4CJVA 1SUQA 3SAFA 4BE0A 4WFNL 4J2BA 4Z4GA 3AVLA 1GLBG 4YOWA 4A59A 4FLXA 4OKEA 1M1KO 2FSJA 3ALYA 4FWMA 1RT2A 1QVGM 1RFQA 1X9WA 4I6MA 4GY2B 3L8BA 4JKGB 3M8RA 3QEWA 1Z26A 2YNIA 3VQ7A 3DLHA 3CJ1A 2QA4N 4GV6A 3TU5A 3HT3A 2UU9K 3CQ8A 4W5NA 5HROA 2WFBA 1YAGA 5A2QO 3PX6A 4KPYA 4AQYK 1IBKK 3LDLA 3HI0A 1HNXK 3CM6A 3ZSYA 2HHTA 2PBDA 3HTVA 2CGJA 5AQSA 5J2PA 4J2EA 1GLFO 4WQ4C 1KD1O 1VQ8N 2A41A 4Z4EA 5AQIA 1QSLA 3V6DA 3IFRA 3MN6A 3A5LC 4ZTFA 2HHQA 3EZWA 2OCEA 4B8CA 3N4PA 5FROA 4BGBA 4FK2A 2P9PA 4DS5A 3CHWA 4KHQA 4BC4A 5LMUK 3C6UA 2BGGA 2GWKA 4JK9A 2HHVA 3C7NB 2AA4A 4OO1J 1VQMN 2ZWHA 1YT3A 4X65K 5C2FA 1RBUA 4FJXA 4IXCA 2QW9A 3BZCA 1JXBA 4CFBA 4CD1A 2O8FA 1Q9YA 4K42A 4OJRA 4B3MK 4XEIA 5GAGP 1XC3A 5EXWA 3QESA 3RWUA 2QWRA 1RBSA 1HNIA 4E1MA 3JYTA 1LWFA 4CJRA 3S3NA 4OVLA 4IJAA 3ENHA 4FJ9A 2O8EB 1D9DA 4PWDA 1GLEG 2BTFA 3KWIA 1LWCA 3CFPA 4CFDA
chains in the Genus database with same CATH topology
3I33A 3IMXA 3VMFB 4YOVA 2WC9A 4IEIA 5GAHP 1TUUA 2A42A 4C23A 3I55N 2ZJPL 1E4FT 4QS9A 2JWKA 3T69A 5M1PA 5KPZA 3VEOA 4EHTA 5TKYA 1NM1A 3I8BA 4FL9A 1VQKN 1HKBA 2E1YA 5BRDA 4IJNA 4RWTA 2ASPA 4LC9B 3KZBA 1X3MA 5GAEP 1KXPA 1S3XA 1SAZA 3NMUA 4NO7A 3E9LA 4AF1A 3WXLA 4DQ8A 2HBKA 1VQ7N 3PIOL 4BG9A 2W40A 5F1XA 4WQ5C 5C15A 3CCMN 3P39A 4ILGB 3O1WA 1W2BM 1JJ2M 3LDNA 3U9DA 4CZHA 2RE2A 1NGFA 2VWBA 2YCHA 3EL2A 3VF4A 5BR9A 1W97L 4FPBA 2JWLA 3JS6A 1BOTO 1MWMA 3L4IA 2GWJA 4GNIA 4B1WB 3GG4A 1M90O 4JD2A 2YHWA 2HSTA 4JKAA 3UKUA 4A2AA 3CQYA 3O08A 4PKGA 1EQYA 3CMEN 1BG3A 1KQSM 5BREA 4M63C 3O9SA 2YHYA 2EWSA 1ATSA 5CE3A 3W0LA 3BF3A 3LM9A 4KH5A 4BR2A 1HPMA 2YX6A 1BA1A 3M5RA 1RDWX 3S41A 3U4LA 4BRNA 5AQOA 2ZGYA 3CD6N 2P9SA 4R79A 3VERA 1ESVA 4FOIA 5M1KA 4K43A 3CCUN 2H3GX 1WOQA 1HKCA 3ZX0A 4BC2A 4BRIA 5BPLA 2F9TA 4FO0A 2HBMA 3VOVA 2Q97A 3Q7CA 4CZJA 5JMVA 2KHOA 5FPNA 3TTDA 1YVNA 2E2OA 3VEVA 3VENA 1ZC6A 2NRZA 4B9QA 3ENBA 3D2EA 4QS7A 5AZIB 3WQUA 4JKHA 4CZEA 3BF1A 1NGAA 2NRVA 4A62A 4BVOA 3LDOA 4H0PA 2NRWA 4CZGA 4AM7A 4B1XB 3ZEUB 1YF5L 4H5NA 4JAXA 2CGLA 3RSEB 2E1ZA 2ZGZA 4BRAA 4BRCA 4BRFA 2QWMA 1YJ9N 4WQ4A 2AP1A 5CHIA 1KD1O 1P8ZA 1U2VB 4BQLA 1VQ6N 1DGKN 2A6AA 2P9NA 4K41A 3ZX2A 1K8KB 1TYQA 2P9PB 3K9JA 3CMAN 1ATRA 3CC4N 3VEWA 1Q86O 3LDQA 1NGGA 1NWKA 2E8AA 3K9KA 4C1NI 3DJCA 3CJAA 3IKMA 3FZFA 4WF9L 1OKJA 2YJEA 4BR7A 4GV9A 4BR5A 5ELZA 1Z6RA 1QZ6A 3IUCA 3ID6A 2KLAA 3UKRB 3ZYYX 3HBTA 5F2RA 3WXKA 1JCGA 3W3DA 3R6MA 5BN8A 2NRHA 1SZ2A 4XH1A 3VGLA 5LY3A 3LL3A 3TPQA 2D0OA 1V4SA 4CJ7A 1LCUA 4DHYA 3EO3A 2OTLN 1EO1A 1C0GA 5BN9A 1BWFO 2P9UA 3P4IA 3CCQN 3F5TA 3ZETA 2GEMA 2A40A 5ADXA 4O8UA 3O9QA 3WXMB 2A5XA 4JKCA 4BG8A 4BGAA 5C12A 4FSVA 3KWGA 4JKDA 4MO4A 3TSPA 5B8HA 1KC8O 3VEZA 3WEEA 1BDGA 4CD3A 2IVOA 4OPAA 2FXUA 2D4WA 5LJVA 3MK6A 5JICA 3H6EA 3WT0A 3CCLN 5AZJB 3H1QA 2ZF5O 3ULEA 3JXUA 3VTIA 1HKGA 1NGJA 3MN5A 3O9TA 4UY8O 3D2FB 1QZ5A 2UYTA 4F9OA 1DKGD 2Q31A 4Z94A 2YJFA 2FLOA 2D0PA 5AQYA 3CCRN 2ZJRL 2V51B 1C0FA 1HJOA 3VEYA 4YOUA 3SMPA 2W41A 4JEPA 3CERA 3C6AA 4M7YA 5HOOA 4CZIA 3SJHA 1XUPO 5BRHA 4E1JA 5EVZA 5DM6L 5EOYA 4FWLA 1JCEA 3KHYA 1KAXA 2QWNA 5AQXA 2VGMA 4DB3A 3QICA 2QI2A 2FF3B 3QFUA 3GOIA 4IZ9A 1YXQA 3DXMA 5M1FA 4MDBA 5TKWA 4H5TA 3AGKA 4JD2B 5E84A 3MWPA 2QWOA 4H5RA 4CBUA 2NZTA 4G9ZA 3HOSA 3D7EO 4A2BA 4JHDA 3G71N 3MX5A 3DXKB 3EN9A 1BUPA 1IG8A 3CCSN 2GELA 2V7ZA 1NMDA 4O8KA 5EY4A 3J8AA 3VGKA 3G6EN 2YI1A 1NGHA 2P9KA 3EKSA 2VCPA 1Q82O 2I7PA 2IVPA 2P9IA 1VQLN 3O8MA 1KAYA 4FWNA 4H5VA 4I6MB 5AQMA 1VQ8N 1ZBSA 4H0VB 1QQOA 3TTCA 5ADXH 3VETA 4JK8A 4KH6A 5AQGA 1GLJO 3H1VX 4XH5A 3QBWA 3P31A 2FF6A 2V7YA 3ID8A 5AQHA 4PL7A 3L0QA 3FLCO 3CXCM 3D2EB 4A5AA 4U7BA 4A57A 4B1VA 1U6ZA 4BQZA 5AQRA 5KPRA 5AFUA 3F9MA 4PKHA 4CZLA 5FPMA 5AQLA 3VGMA 3MX2A 4H0XB 3SAHA 3D6RA 1NLVA 3O80A 3AAQA 2E2QA 4CBWA 4IDHA 4B1ZA 3FZMA 4IEEA 3WXIA 1GLLO 1T6CA 3CPEA 3CJBA 1CZAN 3EE9A 2QTDA 1QQNA 3T7ZA 1RGIA 3UB5A 4H5WA 4BR4A 5JLHA 4RTFD 3O9UA 3BUZB 4JKGA 4PL8A 3SBGA 1T44A 4DCHA 1VQON 3O1BA 1DEJA 3GL1A 3KVGA 3H3NO 1ATNA 3PIPL 3QB0A 1K8AO 5I9EB 2IVNA 2QWQA 3MN9A 2GTDA 3QFPA 4M7XA 1P90A 4YOXA 5FPEA 3DAWA 4ILJA 4EIAA 4Y0WA 5JVGL 5M1NA 4BR0A 3OHRA 4FWKA 4H0OA 3ZEUA 3CPWM 5AQVA 1WUAA 3BP8A 2RHKA 4YDUA 3E9PA 1ILYA 1SS6A 4XH4A 1V4TA 3HM8A 1Q18A 1NBWA 2V52B 3ATUA 3AARA 3R1XA 5AQZA 1BA0A 4BRKA 4YOYA 2WUSA 1HX1A 1YIJN 1K8KA 2HMPA 2P9UB 4GVEA 1YI2N 3CC2N 2QWLA 3M3ZA 4RCHA 5DM7L 1DT9A 2PAVA 2Q0RA 2Q0UA 5JVHL 2WBNA 3CF5L 4FWPA 3QDKA 4C1NK 3DWLA 4OPHA 4BREA 4AM6A 4HTLA 3R8EA 3R9PA 3E1YA 3M1FA 4BVPA 3WEEB 3L6QA 4GV3A 3UKRA 2CH5A 2KKZA 3FZKA 5EX5A 2QEXN 3C7NA 4ISFA 1MWKA 1J6ZA 1GLCG 4BROA 3CI5A 1YJNN 5KQ8A 4ISEA 4IO9L 5BPNA 2ASOA 5AQQA 3H45C 2NRRA 3FFKB 1IJJA 3CCEN 5AFUH 1BU6O 4H0YB 2OTJN 5GADP 2E2PA 5AQJA 4HWIA 1NJIO 1G99A 4O5FA 4MLEA 3SK3A 4BC5A 3GE1A 1K73O 1S72N 5AQUA 3PLAA 1T3VA 4K25A 2P9LA 4BRPA 4CI6A 4IOCL 3F2KA 3FGUA 3OBYA 3H3OB 5KQDA 4KBOA 4WQ5A 2E20A 3O5BA 3VF6A 4NLCA 1VAZA 3L4QA 2F9WA 1MDUB 1R59O 5AZJA 3DXMB 1VQ9N 3A5OC 4MO5A 3A5MC 3O9RA 5M1OA 5MLCQ 3HOTA 3N4QA 4WYBA 5GINA 3D2FA 2I7NA 3M6GA 4NLBA 1NGIA 4JHDB 2Q1NA 1QVFM 5C10A 1QQMA 3G4SN 3UKUB 3VF2A 2VYPA 3SBTA 3A0IX 1SQKA 3G25A 3AY9A 1NGDA 3QBXA 4JNEA 1VQPN 3R3LA 3CIPA 3AGRA 1NGBA 1HLUA 4FWOA 2P9KB 4ISGA 2Q2RA 5AQWA 4A61A 2HF3A 2VGNA 4BRDA 4CZKA 4MDAA 5KPTA 3AAPA 2NLXA 3IDHA 2P9IB 3TSQA 3MMVA 5GIOA 2Q36A 1S22A 4QS8A 2ITMA 3OA9A 3O6WA 3CJ9A 3O4WA 3FZHA 1LOTB 2P9SB 3C6HA 1O13A 3EE8A 3MCAB 4JN4A 4IOXA 5HL7L 3I56N 1Q81O 4PKIA 4BRLA 3VPZA 5F0XA 5GIPA 3CC7N 1NGCA 3Q7BA 2NRXA 3QMLA 4CBXA 1QHAA 3A8YA 3CQXA 3LM2A 3NVMA 1BO5O 3E9OA 4B1YB 5JLFA 2A3ZA 3C0BA 3WQTA 2QWPA 2F7TA 3OBWA 2GX9A 1NGEA 2GUPA 3SAFA 3HRGA 4WFNL 5LJWA 1GLBG 4YOWA 3DXKA 4A59A 3SMSA 1YITN 3E66A 3OW2M 1M1KO 4FOEA 5AQTA 3CJCA 2FSJA 3FZLA 3MN7A 4A5BA 4BC3A 1Q7YO 4BY9C 1OVYA 4CZFA 1K9MO 3SAGA 2NNWA 4FWMA 1QVGM 4JKEA 1XQSC 1RFQA 2P9NB 2E2NA 3ATVA 3EKUA 5M1QA 4I6MA 3CJ7A 4GY2B 4JKFA 4BRGA 4JKGB 1N8RO 2ASMA 1TYQB 3TSUA 4FWRA 1Z05A 1H1VA 4J8FA 1Y64A 1YUWA 3CJ1A 3MDQA 3MWTA 5C2DA 5CR4A 2QA4N 4GV6A 3TU5A 4FWSA 5BRFA 2DPNA 4BRQA 2WFBA 1YAGA 4EFHA 3NVKA 1KAZA 3RVCA 4JKBA 4IFEA 3VEXA 1HUXA 4B1UB 5AZIA 3LDLA 3FR0A 3HI0A 5AQFA 2PBDA 3HTVA 4MLHA 2CGJA 5E26A 4FPAA 5AQSA 1GLFO 2PFUA 3B8AX 1X3NA 2A41A 4WQ4C 4BRHA 3RSEA 5BPMA 2CGKA 3CETA 5H1SQ 5AQIA 1TUYA 2HBJA 3TTFA 3IFRA 3MN6A 3A5LC 4EHUA 1U2VA 3CCVN 3EZWA 2HOEA 4FVUA 4JK7A 3GDQA 1JCFA 3WUHA 1ZXOA 3N4PA 5AQNA 2NRTA 3ZETB 2J4RA 4BGBA 2P9PA 4L3QA 3SLCA 2BH1A 4IO8A 3GBTA 3H46O 4U67L 3CHWA 4WFBL 4EAHD 3WXJA 2YHXA 1VQNN 4BC4A 3KK7A 4KH4A 2GWKA 4JK9A 1GLAG 4H0TB 3DLLL 5AR0A 3C7NB 2AA4A 3CCJN 4OO1J 4YDUC 5AQKA 1VQMN 2ZWHA 1E4GT 3U8XA 5C2FA 4WFAL 4BR9A 1VQ4N 4IXCA 2QW9A 3HSCA 1VQ5N 1RDUA 4PHTX 2HF4A 3VTHA 4CD1A 4NB4A 3U9ZA 4K42A 3ULEB 4WCEL 4IOAL 5C0YA 1GLDG 2QM1A 3P38A 4XEIA 5GAGP 2ZJQL 2IIRA 2HBLA 1XC3A 4IWVA 2E88A 1YHQN 2OANA 5EXWA 2D1KA 2QWRA 3BEXA 2FSKA 3J7ZO 3ENOA 2QXLA 3FE1A 1D4XA 5AQPA 4IJAA 2P9LB 4ILHA 1YJWN 3MCPA 4CZMA 3ENHA 4YOTA 2FSNA 4DKWA 3C65A 1X9JA 1GLEG 4FWQA 3VESA 3UE5A 3ZX3A 2BTFA 4BRMA 3KWIA 4H03B 2CH6A 2BUPA 4YORA 1T6DA 5FPDA 3HZ6A 3LDPA 1MA9B 3A5NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2F A;  4IDH A;  5C12 A;  5C15 A;  5M1N A;  4IEI A;  5M1K A;  4IEE A;  5C10 A;  3C6A A;  3CPE A;  5M1Q A;  5M1O A;  5M1P A;  5C2D A;  5M1F A;  3C6H A;  4IFE A; 
#chains in the Genus database with same CATH topology
 5GAH P;  4DV3 K;  4QS9 A;  4CEF A;  1NM1 A;  5CZ1 A;  1VQK N;  2E1Y A;  4IJN A;  3KZB A;  3CM5 A;  1X3M A;  1O1W A;  4DQI A;  3NMU A;  3OYF A;  2W6L A;  3E9L A;  2XO7 A;  3J81 O;  2HBK A;  1VQ7 N;  3PIO L;  3OYN A;  3T1A A;  4M45 A;  3CCM N;  3NF8 A;  3P39 A;  4ILG B;  4E3S A;  4FZY A;  2DFF A;  3U9D A;  3L2U A;  4KB0 A;  3S3O A;  2RE2 A;  2FBX A;  1U49 A;  5HRN A;  1I94 K;  4O0I A;  4JS4 A;  2VWB A;  4AHR A;  3OS1 A;  4LF9 K;  3EL2 A;  3VF4 A;  3K5N A;  1JLB A;  4FPB A;  2KQ2 A;  3GG4 A;  4FM1 A;  4FLY A;  2PZS A;  4JKA A;  2O4I A;  4PKG A;  1VK0 A;  1WAJ A;  4M63 C;  2EWS A;  3T1H K;  1ATS A;  4C8O A;  4KH5 A;  3LM9 A;  3KKS A;  1C6V A;  2YX6 A;  3S41 A;  1RDW X;  5AQO A;  2VG5 A;  5JS2 A;  1LAV A;  4K43 A;  3AVM A;  3G10 A;  2B4J A;  4BRI A;  1IKV A;  4HVJ A;  5JMV A;  4F2R A;  5J2Q A;  2NRZ A;  4JI3 K;  3D2E A;  3TI0 A;  4KI4 A;  2NRV A;  4BVO A;  4H0P A;  4CZG A;  4W5Q A;  3ZEU B;  4JS5 A;  4JAX A;  4BRC A;  3OYG A;  4DR2 K;  2B6A A;  4WQ4 A;  4Z0U A;  5IT9 O;  1P8Z A;  1VQ6 N;  4Q5V A;  2A6A A;  2P9N A;  4K41 A;  4DTJ A;  4CED A;  3B6P A;  4FLV A;  1TYQ A;  3M8P A;  1HJR A;  4I2P A;  4QOZ B;  3VEW A;  4N5S A;  1NWK A;  2E8A A;  4C1N I;  4JI8 K;  3DJC A;  3AVC A;  4FJJ A;  3IKM A;  4WF9 L;  3NGZ A;  4FM2 A;  2YJE A;  4BR7 A;  2ATQ A;  3IUC A;  1NNE A;  4CJ3 A;  4KTQ A;  1SZ2 A;  1RT7 A;  2X78 A;  5EU7 A;  3VGL A;  5LY3 A;  3NAE A;  4F3O A;  2D0O A;  4OGC A;  4DLE A;  1ASW A;  5J2N A;  1B9D A;  3NH0 A;  1XHZ A;  5BN9 A;  3K2P A;  2P9U A;  3P4I A;  1N33 K;  4K8X A;  3ZET A;  1NKC A;  4KTW A;  1U48 A;  3V9U A;  4MQ3 A;  4Z4H A;  4O8U A;  4CEQ A;  3OYB A;  2A5X A;  4JKC A;  4BG8 A;  2Z1J A;  3KWG A;  4FW2 A;  3THX B;  4JKD A;  1IKW A;  1KC8 O;  4CHP A;  1BDG A;  4CD3 A;  1X9S A;  3MXJ A;  1IO2 A;  2D4W A;  3SNN A;  5LJV A;  3MK6 A;  3CCL N;  3WT0 A;  3QEP A;  3H1Q A;  5HRR A;  3JXU A;  4LSL A;  2FC0 A;  1QZ5 A;  2KW4 A;  1TK5 A;  1JL2 A;  2ZJR L;  1IBM K;  5C42 A;  3SMP A;  3V1O A;  2NUB A;  5HOO A;  3KD1 E;  4CEO A;  3PV8 A;  5EVZ A;  5DM6 L;  3SV4 A;  3V4I A;  4E0D A;  1TVR A;  4DB3 A;  2E6L A;  3GOI A;  4IZ9 A;  3DXM A;  2HNY A;  4ELV A;  1N6Q A;  3AGK A;  1VHX A;  3KK1 A;  3EN9 A;  1IG8 A;  2GEL A;  1NMD A;  5DMR A;  1WBD A;  1D8Y A;  2E5L K;  1NGH A;  3QER A;  4HUE A;  1KFD A;  1KAY A;  3HP6 A;  3WNG A;  5ADX H;  4JK8 A;  3KLG A;  4KRF A;  5AQG A;  3VN5 A;  4EP4 A;  4XH5 A;  1UA0 A;  2FF6 A;  2V7Y A;  3ID8 A;  5C24 A;  4A5A A;  4K8Z A;  3I0S A;  5KPR A;  3HP9 A;  4NCG A;  5FPM A;  3RMC A;  3MX2 A;  3D6R A;  3O80 A;  2E2Q A;  4YFU A;  4BAC A;  3MEE A;  3EE9 A;  3O3G A;  4E7J A;  4BR4 A;  3SBG A;  4RTF D;  4PL8 A;  3K5L A;  3V9S A;  3KKR A;  1NK5 A;  2IVN A;  3NF9 A;  3KLE A;  4DR5 K;  2QWQ A;  4B9T A;  1HYZ A;  3QFP A;  4MFB A;  4CJ5 A;  1C0U A;  2OPR A;  3DAW A;  5JVG L;  4BR0 A;  3M8S A;  3LAK A;  4B3S K;  4FWK A;  4H0O A;  2BE2 A;  5AQV A;  2RHK A;  3E9P A;  1QHT A;  2HNZ A;  4XH4 A;  1V4T A;  3HM8 A;  1NBW A;  5AQZ A;  3R1X A;  4KB1 A;  4TSX A;  3HJF A;  1HX1 A;  1YIJ N;  1RIL A;  3ZLJ A;  2HMP A;  1YI2 N;  3VQ6 A;  4RCH A;  4PQU A;  4DWI A;  3HVT A;  2PAV A;  3CF5 L;  1ASU A;  4FWP A;  1RTH A;  4X62 K;  3DWL A;  4B9L A;  4BE1 A;  2O4G A;  4AM6 A;  1S1X A;  3M1F A;  3SUQ A;  3EEQ A;  1S1V A;  1NJY A;  2KFZ A;  3UKR A;  2KKZ A;  3FZK A;  5EX5 A;  1QTM A;  4ISF A;  1MWK A;  4O4G A;  1VSI A;  1J6Z A;  1J5E K;  2D0A A;  4BRO A;  1IV0 A;  1EWR A;  1KLM A;  2G8K A;  2VWJ A;  1KCF A;  3IG1 A;  4LFA K;  5AFU H;  2OTJ N;  3NF7 A;  3SYZ A;  3DRP A;  5AQJ A;  1J53 A;  1T03 A;  4HWI A;  1NJI O;  4MLE A;  3SK3 A;  1CXQ A;  4QAG A;  4H4O A;  1OH8 A;  4DU3 A;  4M3U A;  3PLA A;  1T3V A;  3QLH A;  4BRP A;  4CJS A;  3AVH A;  1T7P A;  4WQ5 A;  2E20 A;  3VF6 A;  1IH7 A;  4KHY A;  1S9G A;  1R59 O;  3AA5 X;  2I5J A;  1NK8 A;  4B9M A;  3NFA A;  4IG0 A;  5MLC Q;  4MO5 A;  3A5M C;  3O9R A;  1NMN A;  5M1O A;  4WYB A;  4FM0 A;  3L2Q A;  4JHD B;  2ITG A;  3G4S N;  1B92 A;  2VYP A;  3PO4 A;  2JLE A;  3R3L A;  3AGR A;  2P9K B;  4A61 A;  4OKK A;  2F8T A;  5KGW A;  5KPT A;  3IDH A;  5DK5 A;  3TSQ A;  4DQS A;  3MMV A;  2Q36 A;  5HRS A;  1S22 A;  2ITM A;  3OA9 A;  4EZ6 A;  4CF8 A;  2F4V K;  5T7B A;  4E7K A;  1LOT B;  2P9S B;  3MCA B;  1Q81 O;  4BRL A;  4RW8 A;  4CJK A;  5LL6 Z;  4DQR A;  4DFJ A;  3CC7 N;  4JRP A;  4CBX A;  3OYD A;  4FZX C;  2O8C A;  3THW A;  3TAR A;  4B1Y B;  3E9O A;  4KHN A;  3C0B A;  3WQT A;  4K0K K;  2E6M A;  1TK0 A;  4BDY A;  1YIT N;  4KO0 A;  4FOE A;  4KTZ A;  3FZL A;  1Q7Y O;  1OVY A;  1NK7 A;  3SAG A;  2NNW A;  1XQS C;  2E2N A;  4JKF A;  3LP1 A;  1N8R O;  2ASM A;  1Z05 A;  3AVK A;  2G8V A;  1JXE A;  1R0A A;  4KKO A;  4B3R K;  2VG7 A;  3RVC A;  5AQF A;  3V81 A;  4EP5 A;  1KVC A;  1RDA A;  5E26 A;  3RSE A;  2CGK A;  3KLH A;  3TTF A;  1HYV A;  4DV2 K;  1U2V A;  3CCV N;  2HOE A;  3GDQ A;  1JCF A;  3WUH A;  3ZCM A;  4CGI A;  1TKX A;  4M3Z A;  2UUB K;  3OS2 A;  3HXM A;  3SLC A;  2BH1 A;  4FK0 A;  3OYH A;  4EAH D;  3WXJ A;  1VQN N;  4KH4 A;  3DLL L;  3CCJ N;  4YDU C;  3BDP A;  3U8X A;  4LF5 K;  5KTQ A;  3HSC A;  1VQ5 N;  1RDU A;  2HF4 A;  4NB4 A;  2HND A;  4CW7 B;  4M3X A;  2HB5 A;  5D3G A;  2QXL A;  4I7F A;  1QSY A;  2O8B A;  2P9L B;  2P5O A;  3DLR A;  3P5J A;  1WSI A;  1Q9X A;  4GKK K;  1X9J A;  3VES A;  3ZX3 A;  3UE5 A;  4YOR A;  2QK9 A;  4ID1 A;  5FPD A;  3NH2 A;  5CY4 A;  3MEG A;  2WC9 A;  2OYQ A;  1TUU A;  4FK4 A;  4C23 A;  3T69 A;  5M1P A;  3I8B A;  4JI7 K;  5KRS A;  1W9H A;  1NKB A;  2ASP A;  5GAE P;  1OH7 A;  1SAZ A;  3OYK A;  1VRT A;  1A5W A;  4X64 K;  5F1X A;  4GKJ K;  5C15 A;  3O1W A;  4CHZ A;  1JJ2 M;  4CZH A;  5SZT A;  3TAP A;  1NGF A;  4AHU A;  3VQE A;  2JWL A;  3JS6 A;  1BOT O;  3THV A;  1M90 O;  4JD2 A;  2YHW A;  3EZ5 A;  2HST A;  1KVA A;  4A2A A;  3M8Q A;  4NXM K;  3O9S A;  3QEX A;  3HM9 A;  5CE3 A;  3W0L A;  3ASM A;  2W42 A;  4F4K A;  3TAF A;  1BA1 A;  3M5R A;  3JAM O;  3VQC A;  1ESV A;  4FOI A;  4FJ5 A;  1VSH A;  1RTJ A;  3BY5 A;  3V1R A;  4DR4 K;  1WOQ A;  3PSF A;  3SCX A;  4BC2 A;  5FRM A;  1RBV A;  2ZQB A;  2Z1I A;  3Q7C A;  1WBB A;  1HNW K;  1YVN A;  3VEV A;  4FJH A;  3PSI A;  4B9Q A;  3ENB A;  4ELU A;  3WQU A;  4JKH A;  1S1U A;  1WNS A;  3LDO A;  2GUI A;  3ZSQ A;  4B1X B;  3TAB A;  2ZGZ A;  4DV1 K;  4CEB A;  1FJG K;  4BQL A;  1L3U A;  2OPQ A;  3SQ1 A;  1DGK N;  1RT4 A;  3OYA A;  1SL2 A;  2RN2 A;  1K8K B;  4Y1C A;  4FJ8 A;  1VSE A;  2P9P B;  3VQD A;  5CYQ A;  1GOB A;  3LDQ A;  1NOZ A;  3THY B;  4CF9 A;  3RMB A;  1OKJ A;  4AIL C;  1JL1 A;  5ELZ A;  4GW6 A;  3DOL A;  1JCG A;  3W3D A;  3WXK A;  1I3A A;  5BN8 A;  3PO5 A;  4M3W A;  4M3T A;  3LL3 A;  1KLN A;  4DHY A;  3A2F A;  5HRP A;  3V9Z A;  1TGO A;  4OLA A;  3O9Q A;  3WXM B;  1N5Y A;  2YHB A;  5C12 A;  3L2W A;  4FSV A;  3MEC A;  4NYN A;  4PUO A;  4FLT A;  3WEE A;  2IVO A;  2DY4 A;  3AO4 A;  4PA1 A;  2ETJ A;  2G8I A;  2ZF5 O;  2FBT A;  3O9T A;  1XMO K;  4CEC A;  2UYT A;  2Q31 A;  4CHY A;  4Z94 A;  2YJF A;  4J2D A;  1HJO A;  3VEY A;  4YOU A;  1WB9 A;  3OYC A;  4X66 K;  1B9F A;  3O4Q A;  3V1Q A;  4CZI A;  3DLK A;  3SJH A;  2GBZ A;  4DQP A;  5EOY A;  4FWL A;  1JCE A;  3KHY A;  1KAX A;  3ZT2 A;  5BR8 K;  2QI2 A;  1NJX A;  5M1F A;  3SJJ A;  3CYM A;  4N56 A;  1EP4 A;  4BDZ A;  3MWP A;  4CBU A;  4F3T A;  3HOS A;  4DV7 K;  4CIG A;  3MX5 A;  3DXK B;  3PX4 A;  3CCS N;  3AVJ A;  3QNN A;  4DR7 K;  1SL1 A;  2HHH K;  3J8A A;  3LPU A;  3NBP A;  2YI1 A;  1JLQ A;  4HCC A;  1VQL N;  2P9I A;  3O8M A;  4H5V A;  1OH5 A;  4DV6 K;  4YNQ A;  1HYS A;  4C8N A;  3TTC A;  3QEV A;  2G8H A;  1BCM A;  3H1V X;  1EWQ A;  3L0Q A;  4CJW A;  3F73 A;  3D2E B;  4U7B A;  1TAU A;  4B1V A;  1U6Z A;  4BQZ A;  3SUP A;  4HCB A;  5I3U A;  3AAQ A;  3NGI A;  3DI6 A;  3ZT1 A;  1LV5 A;  1QQN A;  3T7Z A;  3QIP A;  3ZSZ A;  5JLH A;  3BUZ B;  3DRR A;  4DCH A;  1DEJ A;  3GL1 A;  3PIP L;  1VRU A;  3TAM A;  3SQ0 A;  4DQQ A;  2IAJ A;  3C94 A;  4AHV A;  3K59 A;  3L3V A;  1P90 A;  5JS1 A;  4Y0W A;  2PYL A;  5M1N A;  4CIE A;  4DSL A;  3ZEU A;  3KJV A;  4B3O A;  4O0J A;  2DTU A;  4DG1 A;  1SS6 A;  3AAR A;  4BRK A;  2VWK A;  3KK2 A;  2WUS A;  4B08 A;  3NGY A;  2P9U B;  4GVE A;  3CC2 N;  4NCB A;  3M3Z A;  4DSJ A;  3LP2 A;  3QDK A;  3QO9 A;  4C1N K;  3BZK A;  4Z4I A;  4LH4 A;  3DRS A;  4OPH A;  4M42 A;  3R8E A;  3U3G A;  4JI4 K;  4DR6 K;  4BVP A;  3L6Q A;  2CH5 A;  4FJG A;  2QEX N;  1GLC G;  1T8E A;  4IO9 L;  3OJU A;  3OJS A;  4B3T K;  3FFK B;  1IJJ A;  3O3F A;  4DSF A;  4H0Y B;  3LWL A;  5GAD P;  1T05 A;  5K14 A;  3VQQ A;  1G99 A;  4O5F A;  3LP3 A;  4BC5 A;  4KFB A;  1K73 O;  2ZE2 A;  4IOC L;  4F2S A;  3F2K A;  3H3O B;  4JLH A;  3F9K A;  4KBO A;  4DSK A;  1MDU B;  3LZI A;  3DXM B;  4NCA A;  4DU4 A;  3VQB A;  3L2V A;  3SQ4 A;  3N4Q A;  4HUF A;  1ZYQ A;  2I7N A;  3IS9 A;  1NGI A;  1QVF M;  3AVN A;  3HPH A;  5C10 A;  3UKU B;  4DF8 A;  1SQK A;  4JNE A;  1VQP N;  1CXU A;  1HLU A;  5AQW A;  4BRD A;  4MDA A;  2IC3 A;  5CYM A;  1BI4 A;  3CJ9 A;  3O4W A;  2DFH A;  3K0S A;  4IOX A;  1TV6 A;  4PKI A;  3NCI A;  3QML A;  3LM2 A;  3NVM A;  2HHW A;  5JLF A;  2QWP A;  2F7T A;  3AO3 A;  1NGE A;  3HRG A;  4E1N A;  3LPT A;  3E66 A;  3OW2 M;  5AQT A;  3MN7 A;  4A5B A;  1TAQ A;  4CZF A;  1S6Q A;  1K9M O;  3ATV A;  3BGR A;  3CJ7 A;  4BRG A;  3NH1 A;  1HNZ K;  3J80 O;  4FWR A;  4J8F A;  1YUW A;  3MDQ A;  3MWT A;  5C2D A;  1ZBL A;  4DMN A;  4KAZ A;  5BRF A;  1XNR K;  4DU1 A;  2QKB A;  2DPN A;  3OYJ A;  4DUY K;  1K6Y A;  3NVK A;  3AVI A;  4JKB A;  2PYJ A;  4B1U B;  5AZI A;  2Q3S A;  1L3V A;  4FPA A;  2O8D B;  1CZB A;  3KK3 A;  3B8A X;  2PFU A;  5H1S Q;  5BPM A;  3U6F A;  2XY6 A;  4GVM A;  4RG8 A;  4BDP A;  3CET A;  4DTR A;  2HBJ A;  1EET A;  4EHU A;  4JV5 K;  4JK7 A;  1SKS A;  1ZXO A;  4CJT A;  5AQN A;  2NRT A;  2VQF K;  4DUZ K;  4B9V A;  1RDC A;  3SUO A;  1C1B A;  2E4L A;  3H46 O;  4O55 A;  4U67 L;  3VA3 A;  2YHX A;  3KK7 A;  4CGD A;  5AR0 A;  1NK6 A;  1E4G T;  5SWM A;  1VQ4 N;  1DTT A;  4FJL A;  1S5J A;  3VTH A;  4NYF A;  3EYZ A;  2WON A;  3ULE B;  4WCE L;  1GLD G;  1WSJ A;  4RW6 A;  3UIQ A;  2Z1H A;  3ZSW A;  2ZJQ L;  2IIR A;  2HBL A;  4IWV A;  1WN7 A;  2E88 A;  3KIO A;  3QIO A;  4DTU A;  1YHQ N;  3K5M A;  2D1K A;  2P1J A;  2FSK A;  4WE1 A;  3FE1 A;  1D4X A;  5AQP A;  1YJW N;  3MCP A;  4CZM A;  2X6N A;  3WNF A;  4E19 A;  3NHG A;  4IFY A;  4DKW A;  2HVI A;  1KVB A;  4Z4C A;  4BRM A;  4UQG A;  2BUP A;  3V9X A;  2Y1I A;  3RR8 A;  3HZ6 A;  4DQ8 A;  1MA9 B;  4DV0 K;  3I33 A;  4IFV A;  3I55 N;  3MXM A;  4IEI A;  3VEO A;  4EHT A;  5TKY A;  4FLW A;  3FFI A;  4FL9 A;  3RRG A;  3AA3 A;  4FXD A;  1S3X A;  1X1P A;  4NO7 A;  3D45 A;  4BG9 A;  2W40 A;  3ISN C;  1W2B M;  4DFM A;  4KHW A;  4CJ4 A;  4JI0 K;  1WSH A;  2YCH A;  2O8C B;  3THW B;  2XHB A;  4GNI A;  3L4I A;  2GWJ A;  3QIN A;  4IBN A;  3ITH A;  4I2Q A;  4CK2 A;  1J54 A;  3CME N;  3CQY A;  3RR7 A;  5BRE A;  3MAQ A;  3D0P A;  3C95 A;  1W0H A;  4BR2 A;  3AVG A;  1JLG A;  4N41 A;  4BRN A;  2ZGY A;  5KRT A;  3CD6 N;  2P9S A;  4R79 A;  3VER A;  1WAF A;  5M1K A;  4LF4 K;  2W6K A;  3TAQ A;  5FRN A;  1FXX A;  3ZX0 A;  3ULD A;  1W7A A;  4FO0 A;  2HBM A;  3VOV A;  4CZJ A;  2E2O A;  1ZC6 A;  2KTQ A;  4LFC K;  3NF6 A;  4OLB A;  3BF1 A;  1NG9 A;  4A62 A;  5HBM A;  2NRW A;  4DSI A;  1YF5 L;  3RSE B;  2E1Z A;  4BRA A;  3AVB A;  4B9N A;  4BRF A;  2YNG A;  1YJ9 N;  2AP1 A;  1U2V B;  1FKP A;  3ZX2 A;  4OX9 K;  2P51 A;  4GMJ B;  2IGI A;  3K9J A;  3CMA N;  1ATR A;  3CC4 N;  3KTQ A;  4BWJ A;  3K9K A;  3I0R A;  3TAE A;  3CJA A;  4CK3 A;  4JRQ A;  1SKR A;  4BR5 A;  1Z6R A;  3ID6 A;  3OY9 A;  2BDP A;  1FKO A;  4CER A;  2X6S A;  3ZYY X;  1LW0 A;  1C1C A;  4Q0B A;  4I9L A;  3R6M A;  4XH1 A;  3O3H A;  4CJU A;  2XY8 A;  3TPQ A;  1V4S A;  3VQA A;  4CJ7 A;  1LCU A;  4YY3 K;  1C1A A;  1IG9 A;  2OTL N;  4CCH A;  1C0G A;  4YHH K;  1LWE A;  5J2M A;  3EY1 A;  4AHS A;  4LF8 K;  4CGJ A;  5ADX A;  2Y1J A;  4FZZ A;  4CE9 A;  2KFN A;  1KTQ A;  4MO4 A;  5B8H A;  1I39 A;  3TAN A;  2FXU A;  1XC9 A;  1RNH A;  4LFB K;  3PX0 A;  1GOA A;  2F96 A;  5AZJ B;  4G1Q A;  3HST B;  3K57 A;  1HKG A;  3MN5 A;  4UY8 O;  3D2F B;  4F9O A;  1DKG D;  4DR1 K;  1GOC A;  2V51 B;  1C0F A;  3P1G A;  4JEP A;  2HVH A;  2VG6 A;  1XUP O;  4E1J A;  4CF2 A;  1Y97 A;  5AQX A;  2VGM A;  4CJL A;  4W5T A;  2FF3 B;  3VQ9 A;  5TKW A;  1JLC A;  3DYA A;  4H5T A;  4KV8 A;  4JD2 B;  1N32 K;  4H5R A;  4CK1 A;  4A2B A;  3VA0 A;  2V7Z A;  1RTI A;  2Z1G A;  3LAL A;  3TWH A;  4O8K A;  3G6E N;  4Y1D A;  2JGU A;  2VCP A;  3IRX A;  1Q82 O;  1RDD A;  4FWN A;  4I6M B;  4FLU A;  1MU2 A;  1ZBS A;  4H0V B;  1FK9 A;  1BQM A;  5FLX O;  4EZ9 A;  1HRH A;  1CZ9 A;  3VET A;  4H8K A;  4KH6 A;  2VQE K;  1RCH A;  1GLJ O;  1TKT A;  4CJE A;  3QBW A;  2RPI A;  5AQH A;  4E7H A;  4PL7 A;  3FLC O;  3CXC M;  3LWM A;  5AFU A;  3T3F A;  3F9M A;  4PKH A;  4CZL A;  4CEE A;  5AQL A;  4M41 A;  1NLV A;  4W5O A;  1XMQ K;  4CBW A;  1U45 A;  4IDH A;  4B1Z A;  4IEE A;  2D0B A;  1CZA N;  2QTD A;  1NKE A;  3O9U A;  3ZT0 A;  4JKG A;  2P5G A;  1T44 A;  3KLF A;  4KRE A;  3O1B A;  3NE6 A;  3KVG A;  4I9Q A;  1ATN A;  1K8A O;  5I9E B;  3MN9 A;  1NU0 A;  2GTD A;  4H4M A;  4CJF A;  4FJN A;  4ILJ A;  4EIA A;  2A1S A;  2HMI A;  1J5O A;  1IKX A;  4FLZ A;  3P83 D;  3OHR A;  3DLE A;  3CPW M;  1S1T A;  1WUA A;  3BP8 A;  1ILY A;  4YDU A;  1Q18 A;  2V52 B;  2O8F B;  2ZM6 K;  1S6P A;  1BA0 A;  4YOY A;  2OPS A;  3RMD A;  3RRH A;  1K8K A;  1CLQ A;  1G15 A;  2QWL A;  5DM7 L;  1SKW A;  1BQN A;  3QEI A;  2Q0R A;  2Q0U A;  2WBN A;  1SL0 A;  3C6T A;  3THY A;  3G0Z A;  3TR8 A;  3HYF A;  4BRE A;  2G8F A;  4CF1 A;  3DOK A;  4RW9 A;  4DTX A;  4GV3 A;  3WEE B;  3L2R A;  1ZBI A;  3C7N A;  3J7Y P;  1ZBU A;  3RMA A;  3CI5 A;  3I8D A;  5KQ8 A;  2UXC K;  5BPN A;  2ASO A;  5AQQ A;  2KZM A;  2NRR A;  4JI2 K;  3CCE N;  1XWL A;  1BU6 O;  2E2P A;  4B8A B;  1EKE A;  1U04 A;  4E7I A;  1HQU A;  1S72 N;  4CI6 A;  2QKK A;  3FGU A;  2O8E A;  3OBY A;  1NK0 A;  2HHU A;  4NLC A;  1VSF A;  3ZSR A;  1VQ9 N;  4DTM A;  5LMN K;  4NLB A;  4HUG A;  1RBR A;  1QQC A;  1QQM A;  4C8K A;  3RTV A;  1FW6 A;  3A0I X;  3AY9 A;  1NGD A;  2KZZ A;  3QBX A;  2G8W A;  3SPZ A;  3CIP A;  1EX4 A;  2YNF A;  3OYL A;  3DLB A;  3AAP A;  3SQ2 A;  2P9I B;  5AJ3 K;  5CZ2 A;  5GIO A;  3LAN A;  3B6O A;  4DV5 K;  3FZH A;  3I56 N;  4JN4 A;  3C6H A;  3EE8 A;  3OVN A;  1U47 A;  2YHA A;  2AJQ A;  3A8Y A;  4ZTJ A;  3CQX A;  1BO5 O;  2HW3 A;  4AH9 A;  2HHS A;  2GUP A;  5LJW A;  3DXK A;  3SMS A;  3CJC A;  2A1R A;  4BY9 C;  4BC3 A;  3HK2 A;  4QCL A;  5KI6 A;  4JKE A;  3EKU A;  2P9N B;  5M1Q A;  1REV A;  2WOM A;  1TYQ B;  1OH6 A;  3TSU A;  1H1V A;  1TL1 A;  1Y64 A;  5CR4 A;  1OVQ A;  4FWS A;  1S9E A;  4BRQ A;  4EFH A;  1TK8 A;  1KAZ A;  3VEX A;  4IFE A;  2F8S A;  3AA2 A;  1HUX A;  1XHX A;  5I42 A;  1XI1 A;  3FR0 A;  3KLI A;  4MLH A;  1HPZ A;  4W5R A;  3U3Y A;  1X3N A;  4BRH A;  1N36 K;  1TUY A;  2RF2 A;  2B5J A;  4OKJ A;  4AHT A;  4DR3 K;  3ZET B;  2J4R A;  4L3Q A;  4IO8 A;  3GBT A;  4N76 A;  4WFB L;  4V19 S;  1Q8I A;  1VSK A;  1GLA G;  4H0T B;  1L3T A;  1IBL K;  5AQK A;  3IAY A;  4WFA L;  4FJ7 A;  4BR9 A;  4CHQ A;  3CG7 A;  4JYA K;  4PHT X;  1S1W A;  1C0M A;  1ASV A;  3U9Z A;  4IOA L;  5C0Y A;  4DSE A;  2QM1 A;  3P38 A;  1DTQ A;  2OAN A;  4CIF A;  1BCO A;  3BEX A;  1TKD A;  3J7Z O;  2GV9 A;  3ENO A;  3S9H A;  3H08 A;  1ZBH A;  4ILH A;  4YOT A;  2FSN A;  3LZJ A;  1WSE A;  3THX A;  2OZM A;  3C65 A;  4FWQ A;  1D5A A;  1D9F A;  4H03 B;  2CH6 A;  1T6D A;  3SUN A;  3LDP A;  5GIN A;  3A5N C;  1WLJ A;  1NK4 A;  3VMF B;  3IMX A;  4YOV A;  2ZJP L;  1Z25 A;  2A42 A;  4FVU A;  1U4B A;  1E4F T;  2JWK A;  5KPZ A;  2G8U A;  1HKB A;  5BRD A;  4KHS A;  4RWT A;  4LC9 B;  2OZS A;  1KXP A;  4JI6 K;  1RT3 A;  4AF1 A;  3WXL A;  2IOC A;  3ZT3 A;  3WNE A;  4CGF A;  4WQ5 C;  2EHG A;  1BI4 B;  5C25 A;  3OYE A;  3LDN A;  1JLA A;  3VQ8 A;  2RKI A;  4CEZ A;  3S3M A;  4E89 A;  5BR9 A;  1W97 L;  1MWM A;  4B1W B;  2QXF A;  3V9W A;  4AHC A;  3UKU A;  4DLG A;  4DTP A;  3O08 A;  1EQY A;  1VSM A;  4FJM A;  1BG3 A;  4BE2 A;  1KQS M;  1NOY A;  2YHY A;  2OA8 A;  4KHP K;  4ICL A;  1RBT A;  4BWM A;  3BF3 A;  1HPM A;  4CES A;  4HHT A;  3U4L A;  5E41 A;  3CCU N;  2H3G X;  4KHU A;  1HKC A;  3DM2 A;  5BPL A;  2F9T A;  4IDK A;  2Q97 A;  2KHO A;  3LP0 A;  5FPN A;  3TTD A;  1JLE A;  4CHO A;  4DV4 K;  3VEN A;  4LF6 K;  4QS7 A;  5AZI B;  4IKF A;  4DFK A;  4CZE A;  1NGA A;  1UAX A;  3E01 A;  3LDS A;  4AM7 A;  4N47 A;  2FBY A;  4H5N A;  4RW7 A;  2CGL A;  3SPY A;  4PY5 A;  4CFA A;  2QWM A;  5CHI A;  3AV9 A;  4FVM A;  1LAW A;  1UA1 A;  3DLG A;  3DMJ A;  1VSL A;  4B9U A;  1VSD A;  4DTN A;  5J1E A;  4J2A A;  1Q86 O;  1NGG A;  3FZF A;  1L5U A;  2YKM A;  4GV9 A;  1BIS A;  4DTO A;  1QZ6 A;  2KLA A;  4FCY A;  3UKR B;  2YKN A;  3HBT A;  1QSS A;  1X9M A;  3T19 A;  5F2R A;  2UXB K;  4DFP A;  2O8D A;  2NRH A;  5FDL A;  4LD0 A;  3EO3 A;  1EO1 A;  1BWF O;  3CCQ N;  3F5T A;  3AVF A;  2GEM A;  1SV5 A;  2A40 A;  4FYD A;  1E3M A;  4BGA A;  3TSP A;  3VEZ A;  3SZ2 A;  3K5O A;  4OGE A;  2D0C A;  3LAM A;  4OPA A;  1DLO A;  5JIC A;  3H6E A;  1NK9 A;  1N34 K;  3ULE A;  3VTI A;  5HP1 A;  1NGJ A;  2UUC K;  2FLO A;  2D0P A;  5AQY A;  3CCR N;  4CGH A;  2W41 A;  4FW1 A;  3CER A;  3OYI A;  3C6A A;  4M7Y A;  1BIU A;  1ITG A;  4OPJ A;  3HO1 A;  1HQE A;  2YNH A;  3WNH A;  3TAG A;  5BRH A;  1A5V A;  2QWN A;  4FJI A;  1TL3 A;  3QIC A;  4CF0 A;  3QFU A;  1YXQ A;  1BGX T;  4MDB A;  4O44 A;  5E84 A;  2QWO A;  4E7L A;  2UXD K;  2NZT A;  4G9Z A;  3D7E O;  4JHD A;  4CEA A;  3G71 N;  3NDK A;  1BUP A;  1UWB A;  2WTU A;  5EY4 A;  4C8M A;  3VGK A;  4M3Y A;  4FJK A;  1A5X A;  2P9K A;  3EKS A;  2XRI A;  4ELT A;  2I7P A;  4M3R A;  2IVP A;  1YTU A;  3OS0 A;  4XIU A;  5AQM A;  4C8L A;  4KI6 A;  1QQO A;  3T1Y K;  2FBV A;  4CVN E;  3SV3 A;  4L8R B;  3P31 A;  3AA4 A;  1QE1 A;  3ZT4 A;  4R5P A;  4A57 A;  1J9A A;  5AQR A;  4ID5 A;  3QET A;  4LF7 K;  2OPP A;  1RT6 A;  3VGM A;  4H0X B;  3SAH A;  3AVA A;  2D5R A;  3FZM A;  3WXI A;  1GLL O;  1T6C A;  2DFE A;  3CJB A;  3CPE A;  3MED A;  1NJW A;  1YTA A;  2HHX A;  1RGI A;  2R7Y A;  3UB5 A;  4H5W A;  3VQ5 A;  1VQO N;  1VSJ A;  1RT5 A;  4CJQ A;  3PY8 A;  2X74 A;  1QS4 A;  3AO1 A;  3H3N O;  4CJP A;  2IDO A;  3QB0 A;  1BIZ A;  4DTS A;  3O4N A;  2IS3 A;  4M7X A;  4YOX A;  3HPG A;  5FPE A;  2BAN A;  5IWA K;  1KFS A;  3HL8 A;  1NJZ A;  1HMV A;  1C0T A;  2EX3 A;  2LSN A;  4LH5 A;  3ATU A;  1HNV A;  4Z4F A;  4JI1 K;  3HPO A;  1XNQ K;  4O5B A;  3K58 A;  1DT9 A;  5JVH L;  4JI5 K;  4CGG A;  1L3S A;  1RTD A;  3VQ4 A;  1ZBF A;  4CFC A;  3ZSX A;  2UUA K;  3J7A P;  3ZSO A;  4HTL A;  3AO5 A;  3R9P A;  3E1Y A;  3JSM A;  2O8B B;  1BHL A;  4LY7 A;  1JLF A;  4F8R A;  2YV0 X;  4OPK A;  4HTU A;  1KSP A;  2PY5 A;  4B9S A;  1YJN N;  4ISE A;  3ZSV A;  1F21 A;  3H45 C;  5HLF A;  3QNO A;  4DS4 A;  3SI6 A;  2XY7 A;  3GE1 A;  1RDB A;  5AQU A;  4K25 A;  2ZD1 A;  2P9L A;  5KQD A;  3O5B A;  1VAZ A;  3L4Q A;  1HR0 K;  2F9W A;  5AZJ A;  4LSN A;  3MXI A;  4DF4 A;  3AO2 A;  3A5O C;  1KRP A;  3HOT A;  3OYM A;  3D2F A;  1WSG A;  3M6G A;  1RT1 A;  1EXQ A;  2Q1N A;  2XY5 A;  3VF2 A;  1BL3 A;  3CFR A;  3SBT A;  3OTO K;  3G25 A;  4CHN A;  3PUF A;  4ISG A;  1NGB A;  4FWO A;  3CFO A;  2Q2R A;  2HF3 A;  2VGN A;  4CZK A;  1WSF A;  3HVR A;  2NLX A;  3KD5 E;  4IG3 A;  4ZHR A;  4QS8 A;  3O6W A;  1YVU A;  1O13 A;  5KGX A;  1TKZ A;  1IKY A;  5HL7 L;  1UOC A;  3VPZ A;  3L3U A;  5F0X A;  5GIP A;  1NGC A;  3Q7B A;  1JKH A;  2NRX A;  4NXN K;  1QHA A;  1LW2 A;  2A3Z A;  4RW4 A;  3OBW A;  2GX9 A;  3VQP A;  4CJV A;  1SUQ A;  3SAF A;  4BE0 A;  4WFN L;  4J2B A;  4Z4G A;  3AVL A;  1GLB G;  4YOW A;  4A59 A;  4FLX A;  4OKE A;  1M1K O;  2FSJ A;  3ALY A;  4FWM A;  1RT2 A;  1QVG M;  1RFQ A;  1X9W A;  4I6M A;  4GY2 B;  3L8B A;  4JKG B;  3M8R A;  3QEW A;  1Z26 A;  2YNI A;  3VQ7 A;  3DLH A;  3CJ1 A;  2QA4 N;  4GV6 A;  3TU5 A;  3HT3 A;  2UU9 K;  3CQ8 A;  4W5N A;  5HRO A;  2WFB A;  1YAG A;  5A2Q O;  3PX6 A;  4KPY A;  4AQY K;  1IBK K;  3LDL A;  3HI0 A;  1HNX K;  3CM6 A;  3ZSY A;  2HHT A;  2PBD A;  3HTV A;  2CGJ A;  5AQS A;  5J2P A;  4J2E A;  1GLF O;  4WQ4 C;  1KD1 O;  1VQ8 N;  2A41 A;  4Z4E A;  5AQI A;  1QSL A;  3V6D A;  3IFR A;  3MN6 A;  3A5L C;  4ZTF A;  2HHQ A;  3EZW A;  2OCE A;  4B8C A;  3N4P A;  5FRO A;  4BGB A;  4FK2 A;  2P9P A;  4DS5 A;  3CHW A;  4KHQ A;  4BC4 A;  5LMU K;  3C6U A;  2BGG A;  2GWK A;  4JK9 A;  2HHV A;  3C7N B;  2AA4 A;  4OO1 J;  1VQM N;  2ZWH A;  1YT3 A;  4X65 K;  5C2F A;  1RBU A;  4FJX A;  4IXC A;  2QW9 A;  3BZC A;  1JXB A;  4CFB A;  4CD1 A;  2O8F A;  1Q9Y A;  4K42 A;  4OJR A;  4B3M K;  4XEI A;  5GAG P;  1XC3 A;  5EXW A;  3QES A;  3RWU A;  2QWR A;  1RBS A;  1HNI A;  4E1M A;  3JYT A;  1LWF A;  4CJR A;  3S3N A;  4OVL A;  4IJA A;  3ENH A;  4FJ9 A;  2O8E B;  1D9D A;  4PWD A;  1GLE G;  2BTF A;  3KWI A;  1LWC A;  3CFP A;  4CFD A; 
#chains in the Genus database with same CATH homology
 3I33 A;  3IMX A;  3VMF B;  4YOV A;  2WC9 A;  4IEI A;  5GAH P;  1TUU A;  2A42 A;  4C23 A;  3I55 N;  2ZJP L;  1E4F T;  4QS9 A;  2JWK A;  3T69 A;  5M1P A;  5KPZ A;  3VEO A;  4EHT A;  5TKY A;  1NM1 A;  3I8B A;  4FL9 A;  1VQK N;  1HKB A;  2E1Y A;  5BRD A;  4IJN A;  4RWT A;  2ASP A;  4LC9 B;  3KZB A;  1X3M A;  5GAE P;  1KXP A;  1S3X A;  1SAZ A;  3NMU A;  4NO7 A;  3E9L A;  4AF1 A;  3WXL A;  4DQ8 A;  2HBK A;  1VQ7 N;  3PIO L;  4BG9 A;  2W40 A;  5F1X A;  4WQ5 C;  5C15 A;  3CCM N;  3P39 A;  4ILG B;  3O1W A;  1W2B M;  1JJ2 M;  3LDN A;  3U9D A;  4CZH A;  2RE2 A;  1NGF A;  2VWB A;  2YCH A;  3EL2 A;  3VF4 A;  5BR9 A;  1W97 L;  4FPB A;  2JWL A;  3JS6 A;  1BOT O;  1MWM A;  3L4I A;  2GWJ A;  4GNI A;  4B1W B;  3GG4 A;  1M90 O;  4JD2 A;  2YHW A;  2HST A;  4JKA A;  3UKU A;  4A2A A;  3CQY A;  3O08 A;  4PKG A;  1EQY A;  3CME N;  1BG3 A;  1KQS M;  5BRE A;  4M63 C;  3O9S A;  2YHY A;  2EWS A;  1ATS A;  5CE3 A;  3W0L A;  3BF3 A;  3LM9 A;  4KH5 A;  4BR2 A;  1HPM A;  2YX6 A;  1BA1 A;  3M5R A;  1RDW X;  3S41 A;  3U4L A;  4BRN A;  5AQO A;  2ZGY A;  3CD6 N;  2P9S A;  4R79 A;  3VER A;  1ESV A;  4FOI A;  5M1K A;  4K43 A;  3CCU N;  2H3G X;  1WOQ A;  1HKC A;  3ZX0 A;  4BC2 A;  4BRI A;  5BPL A;  2F9T A;  4FO0 A;  2HBM A;  3VOV A;  2Q97 A;  3Q7C A;  4CZJ A;  5JMV A;  2KHO A;  5FPN A;  3TTD A;  1YVN A;  2E2O A;  3VEV A;  3VEN A;  1ZC6 A;  2NRZ A;  4B9Q A;  3ENB A;  3D2E A;  4QS7 A;  5AZI B;  3WQU A;  4JKH A;  4CZE A;  3BF1 A;  1NGA A;  2NRV A;  4A62 A;  4BVO A;  3LDO A;  4H0P A;  2NRW A;  4CZG A;  4AM7 A;  4B1X B;  3ZEU B;  1YF5 L;  4H5N A;  4JAX A;  2CGL A;  3RSE B;  2E1Z A;  2ZGZ A;  4BRA A;  4BRC A;  4BRF A;  2QWM A;  1YJ9 N;  4WQ4 A;  2AP1 A;  5CHI A;  1KD1 O;  1P8Z A;  1U2V B;  4BQL A;  1VQ6 N;  1DGK N;  2A6A A;  2P9N A;  4K41 A;  3ZX2 A;  1K8K B;  1TYQ A;  2P9P B;  3K9J A;  3CMA N;  1ATR A;  3CC4 N;  3VEW A;  1Q86 O;  3LDQ A;  1NGG A;  1NWK A;  2E8A A;  3K9K A;  4C1N I;  3DJC A;  3CJA A;  3IKM A;  3FZF A;  4WF9 L;  1OKJ A;  2YJE A;  4BR7 A;  4GV9 A;  4BR5 A;  5ELZ A;  1Z6R A;  1QZ6 A;  3IUC A;  3ID6 A;  2KLA A;  3UKR B;  3ZYY X;  3HBT A;  5F2R A;  3WXK A;  1JCG A;  3W3D A;  3R6M A;  5BN8 A;  2NRH A;  1SZ2 A;  4XH1 A;  3VGL A;  5LY3 A;  3LL3 A;  3TPQ A;  2D0O A;  1V4S A;  4CJ7 A;  1LCU A;  4DHY A;  3EO3 A;  2OTL N;  1EO1 A;  1C0G A;  5BN9 A;  1BWF O;  2P9U A;  3P4I A;  3CCQ N;  3F5T A;  3ZET A;  2GEM A;  2A40 A;  5ADX A;  4O8U A;  3O9Q A;  3WXM B;  2A5X A;  4JKC A;  4BG8 A;  4BGA A;  5C12 A;  4FSV A;  3KWG A;  4JKD A;  4MO4 A;  3TSP A;  5B8H A;  1KC8 O;  3VEZ A;  3WEE A;  1BDG A;  4CD3 A;  2IVO A;  4OPA A;  2FXU A;  2D4W A;  5LJV A;  3MK6 A;  5JIC A;  3H6E A;  3WT0 A;  3CCL N;  5AZJ B;  3H1Q A;  2ZF5 O;  3ULE A;  3JXU A;  3VTI A;  1HKG A;  1NGJ A;  3MN5 A;  3O9T A;  4UY8 O;  3D2F B;  1QZ5 A;  2UYT A;  4F9O A;  1DKG D;  2Q31 A;  4Z94 A;  2YJF A;  2FLO A;  2D0P A;  5AQY A;  3CCR N;  2ZJR L;  2V51 B;  1C0F A;  1HJO A;  3VEY A;  4YOU A;  3SMP A;  2W41 A;  4JEP A;  3CER A;  3C6A A;  4M7Y A;  5HOO A;  4CZI A;  3SJH A;  1XUP O;  5BRH A;  4E1J A;  5EVZ A;  5DM6 L;  5EOY A;  4FWL A;  1JCE A;  3KHY A;  1KAX A;  2QWN A;  5AQX A;  2VGM A;  4DB3 A;  3QIC A;  2QI2 A;  2FF3 B;  3QFU A;  3GOI A;  4IZ9 A;  1YXQ A;  3DXM A;  5M1F A;  4MDB A;  5TKW A;  4H5T A;  3AGK A;  4JD2 B;  5E84 A;  3MWP A;  2QWO A;  4H5R A;  4CBU A;  2NZT A;  4G9Z A;  3HOS A;  3D7E O;  4A2B A;  4JHD A;  3G71 N;  3MX5 A;  3DXK B;  3EN9 A;  1BUP A;  1IG8 A;  3CCS N;  2GEL A;  2V7Z A;  1NMD A;  4O8K A;  5EY4 A;  3J8A A;  3VGK A;  3G6E N;  2YI1 A;  1NGH A;  2P9K A;  3EKS A;  2VCP A;  1Q82 O;  2I7P A;  2IVP A;  2P9I A;  1VQL N;  3O8M A;  1KAY A;  4FWN A;  4H5V A;  4I6M B;  5AQM A;  1VQ8 N;  1ZBS A;  4H0V B;  1QQO A;  3TTC A;  5ADX H;  3VET A;  4JK8 A;  4KH6 A;  5AQG A;  1GLJ O;  3H1V X;  4XH5 A;  3QBW A;  3P31 A;  2FF6 A;  2V7Y A;  3ID8 A;  5AQH A;  4PL7 A;  3L0Q A;  3FLC O;  3CXC M;  3D2E B;  4A5A A;  4U7B A;  4A57 A;  4B1V A;  1U6Z A;  4BQZ A;  5AQR A;  5KPR A;  5AFU A;  3F9M A;  4PKH A;  4CZL A;  5FPM A;  5AQL A;  3VGM A;  3MX2 A;  4H0X B;  3SAH A;  3D6R A;  1NLV A;  3O80 A;  3AAQ A;  2E2Q A;  4CBW A;  4IDH A;  4B1Z A;  3FZM A;  4IEE A;  3WXI A;  1GLL O;  1T6C A;  3CPE A;  3CJB A;  1CZA N;  3EE9 A;  2QTD A;  1QQN A;  3T7Z A;  1RGI A;  3UB5 A;  4H5W A;  4BR4 A;  5JLH A;  4RTF D;  3O9U A;  3BUZ B;  4JKG A;  4PL8 A;  3SBG A;  1T44 A;  4DCH A;  1VQO N;  3O1B A;  1DEJ A;  3GL1 A;  3KVG A;  3H3N O;  1ATN A;  3PIP L;  3QB0 A;  1K8A O;  5I9E B;  2IVN A;  2QWQ A;  3MN9 A;  2GTD A;  3QFP A;  4M7X A;  1P90 A;  4YOX A;  5FPE A;  3DAW A;  4ILJ A;  4EIA A;  4Y0W A;  5JVG L;  5M1N A;  4BR0 A;  3OHR A;  4FWK A;  4H0O A;  3ZEU A;  3CPW M;  5AQV A;  1WUA A;  3BP8 A;  2RHK A;  4YDU A;  3E9P A;  1ILY A;  1SS6 A;  4XH4 A;  1V4T A;  3HM8 A;  1Q18 A;  1NBW A;  2V52 B;  3ATU A;  3AAR A;  3R1X A;  5AQZ A;  1BA0 A;  4BRK A;  4YOY A;  2WUS A;  1HX1 A;  1YIJ N;  1K8K A;  2HMP A;  2P9U B;  4GVE A;  1YI2 N;  3CC2 N;  2QWL A;  3M3Z A;  4RCH A;  5DM7 L;  1DT9 A;  2PAV A;  2Q0R A;  2Q0U A;  5JVH L;  2WBN A;  3CF5 L;  4FWP A;  3QDK A;  4C1N K;  3DWL A;  4OPH A;  4BRE A;  4AM6 A;  4HTL A;  3R8E A;  3R9P A;  3E1Y A;  3M1F A;  4BVP A;  3WEE B;  3L6Q A;  4GV3 A;  3UKR A;  2CH5 A;  2KKZ A;  3FZK A;  5EX5 A;  2QEX N;  3C7N A;  4ISF A;  1MWK A;  1J6Z A;  1GLC G;  4BRO A;  3CI5 A;  1YJN N;  5KQ8 A;  4ISE A;  4IO9 L;  5BPN A;  2ASO A;  5AQQ A;  3H45 C;  2NRR A;  3FFK B;  1IJJ A;  3CCE N;  5AFU H;  1BU6 O;  4H0Y B;  2OTJ N;  5GAD P;  2E2P A;  5AQJ A;  4HWI A;  1NJI O;  1G99 A;  4O5F A;  4MLE A;  3SK3 A;  4BC5 A;  3GE1 A;  1K73 O;  1S72 N;  5AQU A;  3PLA A;  1T3V A;  4K25 A;  2P9L A;  4BRP A;  4CI6 A;  4IOC L;  3F2K A;  3FGU A;  3OBY A;  3H3O B;  5KQD A;  4KBO A;  4WQ5 A;  2E20 A;  3O5B A;  3VF6 A;  4NLC A;  1VAZ A;  3L4Q A;  2F9W A;  1MDU B;  1R59 O;  5AZJ A;  3DXM B;  1VQ9 N;  3A5O C;  4MO5 A;  3A5M C;  3O9R A;  5M1O A;  5MLC Q;  3HOT A;  3N4Q A;  4WYB A;  5GIN A;  3D2F A;  2I7N A;  3M6G A;  4NLB A;  1NGI A;  4JHD B;  2Q1N A;  1QVF M;  5C10 A;  1QQM A;  3G4S N;  3UKU B;  3VF2 A;  2VYP A;  3SBT A;  3A0I X;  1SQK A;  3G25 A;  3AY9 A;  1NGD A;  3QBX A;  4JNE A;  1VQP N;  3R3L A;  3CIP A;  3AGR A;  1NGB A;  1HLU A;  4FWO A;  2P9K B;  4ISG A;  2Q2R A;  5AQW A;  4A61 A;  2HF3 A;  2VGN A;  4BRD A;  4CZK A;  4MDA A;  5KPT A;  3AAP A;  2NLX A;  3IDH A;  2P9I B;  3TSQ A;  3MMV A;  5GIO A;  2Q36 A;  1S22 A;  4QS8 A;  2ITM A;  3OA9 A;  3O6W A;  3CJ9 A;  3O4W A;  3FZH A;  1LOT B;  2P9S B;  3C6H A;  1O13 A;  3EE8 A;  3MCA B;  4JN4 A;  4IOX A;  5HL7 L;  3I56 N;  1Q81 O;  4PKI A;  4BRL A;  3VPZ A;  5F0X A;  5GIP A;  3CC7 N;  1NGC A;  3Q7B A;  2NRX A;  3QML A;  4CBX A;  1QHA A;  3A8Y A;  3CQX A;  3LM2 A;  3NVM A;  1BO5 O;  3E9O A;  4B1Y B;  5JLF A;  2A3Z A;  3C0B A;  3WQT A;  2QWP A;  2F7T A;  3OBW A;  2GX9 A;  1NGE A;  2GUP A;  3SAF A;  3HRG A;  4WFN L;  5LJW A;  1GLB G;  4YOW A;  3DXK A;  4A59 A;  3SMS A;  1YIT N;  3E66 A;  3OW2 M;  1M1K O;  4FOE A;  5AQT A;  3CJC A;  2FSJ A;  3FZL A;  3MN7 A;  4A5B A;  4BC3 A;  1Q7Y O;  4BY9 C;  1OVY A;  4CZF A;  1K9M O;  3SAG A;  2NNW A;  4FWM A;  1QVG M;  4JKE A;  1XQS C;  1RFQ A;  2P9N B;  2E2N A;  3ATV A;  3EKU A;  5M1Q A;  4I6M A;  3CJ7 A;  4GY2 B;  4JKF A;  4BRG A;  4JKG B;  1N8R O;  2ASM A;  1TYQ B;  3TSU A;  4FWR A;  1Z05 A;  1H1V A;  4J8F A;  1Y64 A;  1YUW A;  3CJ1 A;  3MDQ A;  3MWT A;  5C2D A;  5CR4 A;  2QA4 N;  4GV6 A;  3TU5 A;  4FWS A;  5BRF A;  2DPN A;  4BRQ A;  2WFB A;  1YAG A;  4EFH A;  3NVK A;  1KAZ A;  3RVC A;  4JKB A;  4IFE A;  3VEX A;  1HUX A;  4B1U B;  5AZI A;  3LDL A;  3FR0 A;  3HI0 A;  5AQF A;  2PBD A;  3HTV A;  4MLH A;  2CGJ A;  5E26 A;  4FPA A;  5AQS A;  1GLF O;  2PFU A;  3B8A X;  1X3N A;  2A41 A;  4WQ4 C;  4BRH A;  3RSE A;  5BPM A;  2CGK A;  3CET A;  5H1S Q;  5AQI A;  1TUY A;  2HBJ A;  3TTF A;  3IFR A;  3MN6 A;  3A5L C;  4EHU A;  1U2V A;  3CCV N;  3EZW A;  2HOE A;  4FVU A;  4JK7 A;  3GDQ A;  1JCF A;  3WUH A;  1ZXO A;  3N4P A;  5AQN A;  2NRT A;  3ZET B;  2J4R A;  4BGB A;  2P9P A;  4L3Q A;  3SLC A;  2BH1 A;  4IO8 A;  3GBT A;  3H46 O;  4U67 L;  3CHW A;  4WFB L;  4EAH D;  3WXJ A;  2YHX A;  1VQN N;  4BC4 A;  3KK7 A;  4KH4 A;  2GWK A;  4JK9 A;  1GLA G;  4H0T B;  3DLL L;  5AR0 A;  3C7N B;  2AA4 A;  3CCJ N;  4OO1 J;  4YDU C;  5AQK A;  1VQM N;  2ZWH A;  1E4G T;  3U8X A;  5C2F A;  4WFA L;  4BR9 A;  1VQ4 N;  4IXC A;  2QW9 A;  3HSC A;  1VQ5 N;  1RDU A;  4PHT X;  2HF4 A;  3VTH A;  4CD1 A;  4NB4 A;  3U9Z A;  4K42 A;  3ULE B;  4WCE L;  4IOA L;  5C0Y A;  1GLD G;  2QM1 A;  3P38 A;  4XEI A;  5GAG P;  2ZJQ L;  2IIR A;  2HBL A;  1XC3 A;  4IWV A;  2E88 A;  1YHQ N;  2OAN A;  5EXW A;  2D1K A;  2QWR A;  3BEX A;  2FSK A;  3J7Z O;  3ENO A;  2QXL A;  3FE1 A;  1D4X A;  5AQP A;  4IJA A;  2P9L B;  4ILH A;  1YJW N;  3MCP A;  4CZM A;  3ENH A;  4YOT A;  2FSN A;  4DKW A;  3C65 A;  1X9J A;  1GLE G;  4FWQ A;  3VES A;  3UE5 A;  3ZX3 A;  2BTF A;  4BRM A;  3KWI A;  4H03 B;  2CH6 A;  2BUP A;  4YOR A;  1T6D A;  5FPD A;  3HZ6 A;  3LDP A;  1MA9 B;  3A5N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...