5M1QA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound zinc
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
186
structure length
171
Chain Sequence
NSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Phage terminase large subunit
publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
total genus 58
structure length 171
sequence length 186
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1qA00
3CPEA 3C6HA 4IFEA 5M1OA 5C2DA 5M1QA 5M1NA 5M1KA 5M1FA 4IEEA 5C10A 3C6AA 4IEIA 5M1PA 5C2FA 4IDHA 5C15A 5C12A
chains in the Genus database with same CATH superfamily
1WN7A 3M8RA 1MDUB 4NCGA 1IG8A 3SAGA 1TUYA 1U48A 3RR7A 3NF7A 4QS7A 4Y0WA 3O4QA 5FPMA 3AA3A 2P9UB 4ISGA 4IG3A 4BWMA 1RDAA 4CIFA 1U2VA 4M3TA 3C94A 1U04A 3I8BA 2O8BB 3CFOA 3MXMA 4UQGA 2G8IA 1QS4A 1TVRA 2B5JA 4CVNE 1FXXA 5LMUK 4CJFA 1XNRK 1VSJA 5FPEA 1QHAA 3P38A 1C1CA 1VQLN 3CF5L 2E1ZA 2UUAK 3VEOA 5GADP 4FWLA 2G8UA 4JI5K 3CQXA 1IH7A 3LM9A 2YKNA 3OYBA 1SQKA 4B3TK 3A5LC 1V4SA 1HNWK 3SNNA 4LSNA 4DSJA 4FJ7A 3OJSA 3FZMA 1Q18A 4HTUA 1QSLA 1OH7A 3O9UA 3O9TA 3A5MC 2Z1IA 5FLXO 1CXUA 1YJWN 3ZT0A 4J8FA 3MN5A 2HNZA 1ZXOA 4J2BA 1S1XA 1FK9A 4G1QA 1YI2N 2QW9A 3C0BA 4C8MA 3KKRA 4DCHA 1T3VA 2QTDA 5ELZA 5KGXA 4E7LA 3CCJN 3O9RA 1KVBA 3L2VA 5SWMA 4FZXC 1EX4A 3R6MA 1NK9A 4GNIA 5JLHA 2D5RA 1RBTA 3H3OB 3O3GA 4CEQA 4YOVA 2QWNA 5KGWA 4JNEA 2ETJA 3C6HA 1HJOA 1SUQA 4MLEA 1YF5L 3F5TA 2YKMA 3I33A 2Q3SA 4DKWA 5C2FA 4YDUC 2QXLA 1HNVA 3TAPA 1IV0A 4FJLA 1GOCA 4BR5A 4IDKA 3E01A 5B8HA 2VG5A 1OH8A 3J8AA 4YOXA 2Q36A 1BA0A 2B4JA 2YNGA 2ASPA 1SKWA 3QLHA 1KAZA 1NGHA 3AVGA 3DWLA 2OPPA 3U9ZA 4FWOA 4PA1A 1VQPN 2P9LA 3HOTA 1JXEA 1Q7YO 2E4LA 4RCHA 3ITHA 3TI0A 3TAEA 4BRPA 4CBWA 2HHTA 4BE0A 4FM2A 3FFIA 2FF6A 3UIQA 4WYBA 4DWIA 4I9QA 2FSKA 1Q82O 2OYQA 1S9GA 3AO3A 3IAYA 2CGLA 3RVCA 3OYNA 3RTVA 3AO5A 4M3WA 4KHWA 1S3XA 2WOMA 2PY5A 3KVGA 5K14A 3OY9A 2O8EA 4FLVA 4JI4K 3VETA 2FBXA 2BE2A 4ILJA 2HMIA 3EKSA 1BWFO 4DSIA 4BRNA 3OVNA 1OH5A 3OYEA 3QFPA 4DU3A 3SV3A 4CF0A 5EU7A 2ZGZA 3U8XA 5HL7L 1U49A 2VCPA 4ILHA 2P9SB 2W40A 3VERA 4IG0A 1VQ8N 4K8ZA 2Q2RA 3V6DA 4CGFA 3QO9A 2P9IB 4FLUA 1EQYA 1VQON 3HOSA 1VK0A 3CM5A 4OLAA 3DRRA 4TSXA 3MEGA 1D8YA 3QIPA 4PKGA 4GMJB 4I6MA 2IC3A 2NRHA 1IJJA 4DF4A 1GLCG 3G0ZA 2WTUA 3NHGA 5M1QA 2O8BA 4LF6K 1U4BA 2PAVA 4H0VB 1N6QA 2BANA 4CJLA 2E88A 3NFAA 3AAQA 3QICA 3T1HK 4YOTA 4FJXA 4RG8A 2G8KA 3V1OA 4N56A 3WNHA 3ZETB 3MEEA 1G99A 1GOBA 1RT3A 5AFUA 1NK7A 1ZBHA 5EXWA 3HM8A 1MWMA 1EWQA 3A2FA 3EEQA 3WEEB 4CGIA 2O4GA 4IXCA 1QZ6A 3CPWM 3LPTA 4WCEL 1JCEA 2KZMA 4FLXA 1NG9A 3IFRA 2XY8A 2G8HA 4Z4GA 3A8YA 4DV0K 3HJFA 3OYLA 4BRIA 4IO9L 3T7ZA 2NUBA 4CECA 4ID1A 4BRLA 4KO0A 4DTMA 4IBNA 1TGOA 1NGBA 1RDCA 5AQQA 3IS9A 1NGDA 2LSNA 4Z0UA 5JVHL 4M45A 5BRFA 1C0UA 3QEVA 2RE2A 4KBOA 5C15A 3DAWA 4AHRA 3TPQA 2FF3B 4WFNL 1IBLK 1YHQN 4PY5A 1BQMA 2F9WA 1ZBLA 1N34K 4CJKA 2VQFK 2RF2A 4AHSA 3OYKA 4DLGA 4M3YA 4FWQA 2QM1A 3L3VA 1WAFA 3M8QA 3NH2A 4AQYK 4E7HA 3VPZA 4H0OA 2HOEA 2FLOA 3O3FA 1JCFA 3E1YA 1RT5A 3CJBA 2ASMA 1YIJN 2W6KA 4A61A 3MMVA 4CJEA 3EN9A 4RW6A 3THWB 1CZ9A 4C8KA 4DHYA 5FPDA 5CZ2A 3VF2A 2FSNA 3LP1A 4HHTA 3SAFA 2O8DB 2NLXA 2A40A 2XRIA 3MCPA 5SZTA 1CLQA 3NDKA 2E8AA 4BR4A 3CC2N 4NLBA 4EHTA 2AJQA 4C8LA 5CYMA 5I9EB 1VRTA 1RBUA 3VQDA 4A2AA 3UKRB 4CK3A 4BRFA 1Q9YA 2FBVA 4B9VA 1LWCA 3VGLA 2VQEK 4IFVA 5C10A 4DR1K 2D0PA 4I2PA 4PUOA 1JJ2M 3N4QA 3Q7BA 1TUUA 3U6FA 1KTQA 4H0TB 5HRPA 3T3FA 1BI4B 4ISEA 3TSUA 2Q97A 4H4OA 4DV6K 2X74A 4E1JA 2XY6A 4M41A 4DR7K 1NGGA 4BWJA 1TAQA 4CGJA 4YOWA 3SUPA 1BO5O 3K57A 4DV2K 4CGHA 3ZSXA 4F3OA 1J5OA 5GIOA 3P4IA 4FZZA 2O8CB 3DLRA 5KQDA 2ITMA 4KTZA 5ADXA 1UWBA 3DYAA 4BRHA 4DQQA 4F9OA 4YORA 3JAMO 3ZX0A 1U2VB 3ZSWA 5AQVA 2QWQA 3WXIA 2GBZA 1BISA 2NNWA 3FFKB 4X65K 1WBDA 2P51A 3MXIA 3PX6A 4CD3A 4IFEA 5FDLA 1YUWA 4JKEA 4BRAA 4KI4A 1KXPA 2JWKA 5CHIA 1WUAA 3D7EO 4AHTA 4CF9A 3BY5A 4OPJA 1JLGA 2DFFA 3SMSA 3I55N 3ATVA 4H03B 3CJ9A 3SCXA 2UXCK 1UA1A 2OANA 3THXB 3MXJA 1SKRA 2D0CA 5AZIB 3EE8A 1TV6A 2O4IA 1LW2A 3ENBA 3O8MA 3VEZA 4H5WA 4B9TA 1Y97A 4K8XA 3E9PA 2GELA 4JD2B 5BRHA 2YNIA 1NOYA 1EO1A 4HCCA 3K5OA 3FZHA 1RILA 3O9QA 4Z4FA 4ID5A 2QA4N 3FZLA 3KLHA 2J4RA 3IG1A 1HMVA 5JICA 1NMDA 3BP8A 1HX1A 3L0QA 1QVGM 3QNOA 5EVZA 4CHZA 4FOIA 5AQXA 3MN9A 4OJRA 5HOOA 2PYJA 1HPMA 3AVCA 3K9JA 1RTJA 4FWPA 4M3UA 5DMRA 1NKCA 3DLBA 4O55A 4DTRA 3UKUA 3VN5A 3FE1A 1VSHA 1CXQA 4CI6A 3DLKA 4LH4A 3ZSRA 3CFPA 4DQSA 4KTQA 4OKEA 2HB5A 1WBBA 5JS2A 1XNQK 1MU2A 3VEWA 3PO4A 3AA4A 2HBLA 3HVRA 2RKIA 3CCSN 2BTFA 3BUZB 1HPZA 3SJHA 1NGCA 1NBWA 3THWA 2DFEA 4OLBA 4AHVA 2P9LB 4PL7A 4R5PA 4H5VA 1TKZA 2ATQA 5GIPA 3C6UA 3TR8A 3EZ5A 5HLFA 1LOTB 3ALYA 1X3NA 4RW4A 4DSFA 2VWJA 1NKEA 3CCVN 2QK9A 3K2PA 2EX3A 2KQ2A 1TK0A 3BEXA 1ZBSA 3O1BA 4GKJK 5AQPA 4H5TA 4JKGA 3WXMB 4DFKA 1KLMA 3BZCA 1HNIA 4JK8A 1GLLO 5JS1A 4RTFD 3AVKA 1XC3A 2VYPA 3HI0A 1BA1A 2CGJA 3TARA 3F9MA 3AVAA 3V81A 1TL1A 4J2DA 3C7NA 1LV5A 3D2FB 4IFYA 2WBNA 1VSLA 4O5FA 1GLFO 1LAVA 2KHOA 4N41A 2D1KA 1VSEA 3M1FA 3QNNA 3DMJA 1B92A 1YAGA 1J5EK 3J81O 2VG6A 2IIRA 3OYFA 4BR7A 1NJXA 3WXLA 5DM6L 4IOAL 2FC0A 4FLWA 5JVGL 1MA9B 4DSLA 3VESA 1S9EA 4KI6A 4QCLA 4CZGA 2DPNA 4JK7A 4CJ7A 3C65A 4B3RK 4I6MB 2P1JA 3IUCA 3SMPA 3RMBA 2D4WA 2NRRA 1O1WA 3VEYA 3QBXA 1S1WA 3ZSQA 1G15A 3DLEA 3VF4A 4N47A 4E1MA 5I42A 3O9SA 4QOZB 4FVMA 2KLAA 4CJUA 4CEDA 2ASOA 3DLLL 3CCQN 1Q9XA 4JK9A 3QB0A 1OKJA 2Q31A 4FM1A 3SUOA 1VQMN 2I7NA 3L2WA 5GINA 1YVNA 1M90O 2UUBK 3ENHA 4FWKA 5HBMA 3VQ8A 5C42A 1LCUA 4JRPA 1B9FA 1QSSA 4E7IA 3CG7A 4LFAK 3THXA 3SPZA 4LFCK 4DQPA 3HP9A 3H6EA 3I0SA 4H0XB 5AZIA 4KV8A 4DR5K 3CCMN 2P9KB 3DM2A 1NKBA 4J2EA 5H1SQ 4BQLA 1NGEA 1WOQA 4BC4A 4X64K 4CHOA 1HKGA 2G8WA 3DJCA 1IG9A 4JD2A 4W5TA 5LJWA 3RMCA 2QWMA 1KRPA 1EXQA 1JLFA 5M1OA 2ZM6K 2JWLA 1NK4A 1HQUA 3A5NC 3O1WA 2P9NB 4KH6A 4FJ5A 2KTQA 3VQ7A 4OKKA 3PSFA 4CZEA 1KAXA 2QKBA 3FZFA 4E0DA 3VMFB 2GTDA 3JXUA 5TKYA 4FLYA 1Z26A 4E89A 4LSLA 4JKHA 1XC9A 4LH5A 5FPNA 2YHWA 1NWKA 1NOZA 4CF8A 4C8NA 5HRNA 1QHTA 4FJ8A 4CK2A 4X62K 2H3GX 4AM6A 1HKCA 3TSPA 4C23A 4CJ4A 3RMDA 4YY3K 4KTWA 3CJ1A 3DLGA 4IO8A 1REVA 3AGKA 2Y1JA 2X6NA 2OZSA 4IJNA 3CC4N 1C6VA 1DGKN 2A42A 4AHUA 1QQNA 4DFPA 1FKOA 4NXMK 4MLHA 4C1NK 2IAJA 4KREA 3G71N 4JI2K 4L8RB 1UA0A 4AM7A 3CCRN 5BPNA 4OO1J 1RCHA 5TKWA 4O8KA 2V51B 4Y1CA 1YXQA 4WF9L 5EX5A 3O6WA 1HYVA 4JI0K 4F2SA 3WNFA 4CESA 3NE6A 4FWNA 1Z6RA 1R59O 1XQSC 3B6OA 4DTXA 3MX2A 3SQ1A 1YTUA 4LD0A 2YJFA 4I2QA 1K6YA 3F9KA 2RPIA 4BRMA 4DU4A 5EOYA 2D0AA 3HSTB 3WQUA 2UXBK 2F9TA 4CFDA 2YHYA 3LDLA 4LY7A 1BDGA 1T6CA 5AQHA 1RBRA 3TABA 2CGKA 3WXKA 2F96A 2YHAA 4YNQA 3D2FA 3LAKA 3PLAA 1D5AA 4WFBL 4DU1A 5AQYA 2WONA 1ATSA 3ZX2A 3AARA 4Q0BA 1DKGD 4FWRA 1T8EA 2NRZA 1F21A 1X9SA 1KFDA 3BF3A 1KVAA 5A2QO 3M8PA 3L2RA 5M1FA 2UUCK 4CHPA 4LF7K 1K8AO 4FJGA 4HVJA 1K9MO 5FROA 2W42A 3SK3A 3S3MA 3QEPA 4JHDA 4A2BA 3CM6A 3M8SA 5KPTA 3O08A 1N8RO 2RN2A 5J2MA 4CHNA 2ZWHA 2F4VK 2P5OA 3AVBA 4RW9A 1A5WA 1BUPA 2A41A 3OBYA 4FWSA 5AQGA 4CZLA 1XHXA 5AQZA 1RFQA 2GWJA 2E2OA 2UYTA 4OKJA 3VQEA 3CCLN 3CYMA 4DV1K 3TTDA 2F8SA 5AQUA 1U6ZA 2Y1IA 4O44A 1IKYA 3FLCO 3KJVA 3MWTA 1X3MA 4CFBA 2E6MA 1RDUA 2FXUA 2A5XA 3EY1A 3MN6A 2YNFA 1XUPO 1VSMA 2P9KA 1CZAN 1HQEA 3JS6A 3O3HA 3WNEA 4FYDA 4LFBK 4A57A 2NRWA 3SZ2A 1XI1A 2HNYA 4B9UA 5AQIA 4GY2B 1BCOA 4OGEA 4BE1A 2P9NA 1OVYA 1WLJA 1J6ZA 4HWIA 1L3VA 3SQ4A 4BY9C 3VA0A 2FBYA 4WE1A 2BGGA 2XY5A 4B8AB 3GG4A 1ATRA 1N36K 4GV9A 1IKXA 1N33K 1KCFA 3TAMA 2ZGYA 4K41A 3MAQA 4FW1A 3G4SN 2IOCA 3ZT1A 1KC8O 5AQFA 2IGIA 3VF6A 2YV0X 1E4FT 4FJNA 4M3ZA 1BIZA 2BH1A 3NH0A 2EHGA 4PL8A 3V9XA 3UKUB 4JRQA 1NK6A 1YJ9N 4IEEA 5BN9A 4B9NA 2D0BA 4Z4CA 4NYFA 2QEXN 4CZMA 5J2NA 3KD1E 1GLBG 2OTJN 4JKCA 1CZBA 1VSDA 3ZCMA 3KLFA 5AZJA 3TWHA 4E3SA 5C12A 4FM0A 4I9LA 4HTLA 3G25A 1NJIO 4CEOA 4GVEA 1EETA 3V9WA 1IBKK 3F2KA 3JSMA 1C1BA 5BN8A 5LJVA 3QDKA 5T7BA 4NO7A 4BGBA 3PX0A 5C25A 4ELVA 3QFUA 2FBTA 1RT2A 3W3DA 3AAPA 4JI1K 4DG1A 1QSYA 3G6EN 4O4GA 2NRVA 3M6GA 4CEZA 4YFUA 3NF8A 1DTQA 2E6LA 4JKGB 4NYNA 3NVKA 4GKKK 3OW2M 3HVTA 3VQCA 4KH4A 4RWTA 4F4KA 2HHHK 5CY4A 2XY7A 1JKHA 3C7NB 4DQ8A 4UY8O 3ULEB 3LDSA 3VQPA 1ITGA 4AF1A 4B9QA 4N76A 4R79A 4JKFA 3QEXA 3THVA 3H1QA 4NCAA 4JLHA 3VEVA 5AJ3K 5KQ8A 4H4MA 1VQNN 1C0FA 4ELTA 3QEWA 5MLCQ 4H5RA 1BOTO 4MQ3A 1B9DA 1DLOA 4Z4EA 4DTPA 3CQ8A 1S1VA 4BRQA 1OH6A 1KD1O 1RT4A 3MCAB 5C2DA 2PFUA 4KPYA 1WSJA 1J9AA 2I5JA 4GVMA 4BRCA 3LDPA 3RR8A 1GLEG 4CZIA 2GV9A 5DK5A 1TK5A 2AP1A 4CCHA 3R1XA 3OBWA 3PX4A 1W7AA 4FLZA 4CFCA 1C0MA 4HUEA 1SAZA 1HUXA 2ITGA 2BDPA 4FXDA 1L3TA 5BR8K 1NGJA 4LF5K 3R8EA 1X9WA 3D45A 4CERA 3DXKA 1JL1A 1JLCA 2VG7A 4M3RA 3T1YK 4NCBA 5AQKA 4B9SA 3TTFA 1WNSA 1BQNA 1ZBFA 3WXJA 3V1QA 2GUIA 4M3XA 3DXMB 3AGRA 1WB9A 5JMVA 4AHCA 4Z4IA 4DB3A 2JLEA 5F1XA 3HPHA 3SUQA 5BRDA 3ZX3A 3HBTA 1VSKA 3LM2A 1SKSA 2VWKA 2HW3A 2ZF5O 3KK1A 4BVPA 2IVNA 2G8VA 1T6DA 4IOXA 4DTUA 2FSJA 2Z1GA 3OS2A 1I3AA 4YOUA 4FSVA 4B1ZA 4IDHA 3L2UA 1YJNN 3CJCA 4CJ3A 3H46O 1HLUA 5AQRA 3TANA 2P5GA 3NF9A 5KRSA 2BUPA 1XMQK 4JKAA 2HBKA 4MFBA 3WUHA 5HP1A 3MN7A 3S41A 1QE1A 4BDZA 2V52B 1YT3A 1L3SA 1RGIA 3DLHA 2EWSA 3L3UA 3P83D 1RDDA 3O5BA 4KHPK 3KWIA 1TYQA 3VQ9A 4B1UB 4N5SA 1BHLA 3ZSOA 3HSCA 3VEXA 1VQ5N 2E2PA 3BDPA 3SQ0A 1ESVA 4GW6A 3KK7A 4HUFA 4KHUA 1TL3A 2PYLA 1X9MA 4CJQA 4CJWA 2YHXA 3GBTA 3SI6A 2P9PA 3ID8A 1HR0K 4AILC 3HT3A 2ZE2A 3EYZA 4O0JA 1WAJA 1W2BM 1NU0A 1DEJA 3KIOA 4CGGA 1IKVA 1L5UA 3VTHA 1GLAG 1U45A 4FJJA 5KPRA 4DQIA 1EP4A 3WT0A 2A3ZA 4A62A 4MO4A 5AQSA 4JS4A 3QBWA 3QEIA 3RSEB 3CETA 4FOEA 4FK4A 1R0AA 1C0GA 2Q1NA 3VQBA 1QTMA 3AO1A 4M42A 2VGNA 3SAHA 1NK0A 2KFZA 3A0IX 4CJSA 3PIOL 4I7FA 4FLTA 3C95A 3MECA 3ULEA 1VRUA 1HKBA 1P8ZA 1BL3A 2X6SA 3VENA 2GUPA 1S5JA 4PWDA 4A59A 4WFAL 3OS0A 5E84A 5F2RA 3EKUA 3NVMA 4KB1A 2W6LA 4IWVA 3KD5E 3D0PA 4J2AA 4DUYK 4BDPA 2WC9A 3MEDA 3E9OA 2E5LK 1NK8A 3AVJA 4DUZK 4OPKA 4RW7A 4DTJA 1V4TA 2PZSA 4ISFA 4O5BA 3CPEA 5BPLA 1Y64A 3B8AX 3VQ6A 1NM1A 2YHBA 4LF4K 4PQUA 3CQYA 4YDUA 3DOLA 4LC9B 3KK3A 1H1VA 4L3QA 4KFBA 3CXCM 3K5LA 4OPAA 4JHDB 1I94K 4CHQA 4WQ4A 3DRSA 4BC5A 4DS5A 1GOAA 3VQAA 1KLNA 1HNXK 1D9DA 4FJHA 4CF2A 4CZJA 5IT9O 4WQ5A 3KLGA 1IO2A 3PSIA 3RWUA 1BGXT 1QQMA 2HBMA 2OPRA 2Q0UA 4ZTJA 1GLJO 3OYJA 3ZEUB 4X66K 2NZTA 4CEEA 1Q86O 1TK8A 3ASMA 4YHHK 4QS8A 3SLCA 4B3SK 3KHYA 3I56N 4BG9A 2ZJQL 4Q5VA 2A1SA 3LANA 4PHTX 1KSPA 4DR3K 3VQQA 5D3GA 3GL1A 4KAZA 5DM7L 1ZBUA 3OYMA 4CZHA 4AH9A 3DXMA 1S72N 4KHQA 4BC3A 4CF1A 4KB0A 3LP0A 4BROA 1RBVA 4F2RA 4CGDA 4DV5K 3BGRA 3PUFA 2F8TA 2UXDK 4BQZA 3ISNC 3J7ZO 2CH5A 4DS4A 5AQOA 2OTLN 2YCHA 3HYFA 3V9UA 3O4NA 3VGMA 1NGIA 4IOCL 1I39A 5AQMA 1RT6A 4JKDA 3OTOK 2AA4A 1C0TA 4B9LA 4DR4K 4CJVA 1SL1A 4C1NI 4H0PA 3LZJA 3RRGA 1HRHA 4F8RA 4MDBA 3QINA 2B6AA 4PKHA 1J54A 2Z1HA 5M1KA 4DFJA 4B08A 3TAFA 3AA5X 4E7KA 1HYSA 3CMAN 2OPSA 3L4QA 2QI2A 2HHXA 5I3UA 4ZTFA 3HO1A 2HVIA 3H1VX 3VTIA 3CC7N 4ELUA 3SV4A 1LWFA 1RNHA 4B8CA 5AZJB 3IRXA 3NGIA 2O8FA 3HP6A 3AO2A 1WSEA 3IKMA 3LPUA 4DSEA 2WFBA 2ZJPL 4KH5A 4LF8K 3AO4A 5KRTA 1DTTA 3VQ4A 1SL2A 4FPBA 5C24A 3V4IA 4NB4A 4K43A 3UB5A 3U4LA 4W5RA 3LDOA 4WQ4C 5C0YA 4BC2A 3CCEN 3CCUN 4WQ5C 4EP4A 4E7JA 4CIEA 3OYAA 3RSEA 5HRSA 2WUSA 5AFUH 2OPQA 1RTDA 3DI6A 3CFRA 2KZZA 3P5JA 3G10A 2YNHA 1K73O 4B3OA 5CYQA 3EO3A 1LAWA 4XH4A 4KRFA 3L2QA 4BRGA 4BE2A 3WQTA 5CR4A 4DF8A 1T05A 1XMOK 4OPHA 1NJZA 2IS3A 3ID6A 4BR9A 3N4PA 3RMAA 4JV5K 5M1PA 3K5NA 3MWPA 3LDNA 2XO7A 4CE9A 2E2NA 1ATNA 1T44A 3THYA 3GDQA 3CI5A 3DRPA 2I7PA 4RW8A 1VSIA 3LP3A 4OVLA 3SYZA 5IWAK 4JI8K 1JXBA 1BCMA 1YTAA 4OGCA 3D2EB 3AVMA 3NCIA 1YVUA 4KHYA 2RHKA 4K42A 3V1RA 3FR0A 3UE5A 3VGKA 3SPYA 4O0IA 1NJWA 1GLDG 1MWKA 3HPOA 2VGMA 4FK2A 2IVPA 1BIUA 4XIUA 1HNZK 4BDYA 1NNEA 1T7PA 4CBXA 2F7TA 2PBDA 5AR0A 3OS1A 4NXNK 3CERA 3QMLA 2P9UA 4M7YA 4KHNA 3GOIA 3ZEUA 3CHWA 4ICLA 2KKZA 2ZJRL 1VQ6N 3AVNA 3J80O 2E1YA 3DXKB 3AVIA 4F3TA 4XH5A 2NRXA 3O80A 2JGUA 4JS5A 1W0HA 4G9ZA 1WSHA 4A5BA 4GV6A 3BZKA 1P90A 5E26A 2DTUA 1KQSM 1NLVA 2HHUA 1E4GT 2HF4A 1D4XA 3T19A 3V9SA 4CIGA 4JI7K 3H08A 2Z1JA 1NJYA 1M1KO 1ZC6A 4FK0A 1WSGA 4JEPA 5BPMA 4FPAA 4JYAK 5GAGP 4DQRA 4IKFA 2HBJA 1SZ2A 4JKBA 1VQKN 3AVFA 4U7BA 1NGFA 5AQNA 5KPZA 1Q8IA 5JLFA 4QS9A 1NGAA 5FRMA 4CZFA 4FJIA 1HYZA 4B9MA 1TKXA 2HHWA 1Z05A 1LW0A 2KW4A 2HHSA 3NGYA 4B1WB 3A5OC 4ZHRA 4FJKA 1XWLA 3LP2A 3FZKA 3E9LA 3NBPA 5KI6A 4BRKA 1TYQB 2QWRA 4FWMA 2CH6A 2E2QA 3C6AA 4B3MK 1KAYA 4DR6K 3QESA 2QKKA 1TKTA 3P39A 3E66A 1ILYA 3SJJA 4BR0A 3KLEA 3CMEN 3VQ5A 4K25A 5ADXH 5EY4A 4W5QA 1N32K 1J53A 2XHBA 4B1XB 1ZYQA 3J7YP 1S1TA 5LY3A 3ZSZA 3S3OA 5AQJA 1WSFA 2HNDA 1S6QA 2P9PB 4V19S 4CJTA 3JYTA 3T69A 1BU6O 1K8KB 4H5NA 4CEFA 4YOYA 1DT9A 4DTSA 1JLAA 1UOCA 4CK1A 3SUNA 3VOVA 3ZSVA 1S22A 3SBGA 3KZBA 1RDWX 5KTQA 3TSQA 1X9JA 2KFNA 1N5YA 2A6AA 1QVFM 4KKOA 2R7YA 4HUGA 4C8OA 4DMNA 1JLQA 5CZ1A 5F0XA 3K5MA 1IKWA 2X78A 4E1NA 5J2QA 3WNGA 3T1AA 3AVLA 2ZD1A 3EZWA 3QIOA 4DV4K 4FVUA 3SQ2A 4XH1A 1S6PA 3NAEA 1SL0A 3HPGA 1IBMK 1QQCA 3P1GA 3KWGA 1ZBIA 3ZSYA 2VWBA 4XEIA 3KLIA 2GEMA 2QWPA 3LL3A 4K0KK 4BRDA 3U3GA 3Q7CA 1KFSA 3TU5A 5BREA 2Q0RA 4DFMA 3ULDA 2OCEA 3J7AP 1EKEA 1XHZA 1Z25A 4JN4A 1TKDA 3L8BA 5M1NA 3RRHA 2QWLA 4BACA 3D2EA 4IJAA 1TAUA 1ASWA 2P9SA 3NH1A 3EE9A 4CEAA 3OHRA 3HL8A 4Z94A 4GV3A 4H8KA 3K0SA 1RBSA 2P9IA 4W5OA 3AA2A 3EL2A 2HSTA 2YJEA 3H3NO 4NLCA 5GAEP 4M63C 3NGZA 2A1RA 4H0YB 4DR2K 4BGAA 4BVOA 4FO0A 4JAXA 3NF6A 1RT1A 4JI6K 3KKSA 3QERA 4M7XA 2DFHA 3U3YA 4DSKA 1NK5A 5HRRA 5GAHP 4EFHA 4CW7B 3PO5A 3B6PA 4CJRA 5J1EA 1U47A 3IDHA 5FRNA 4BG8A 5AQLA 4B1YB 1JCGA 3OYDA 2YI1A 1WSIA 1L3UA 3ZETA 4LF9K 2V7YA 4EIAA 1C1AA 3I8DA 3SBTA 4MO5A 3V9ZA 3HK2A 3WEEA 3S9HA 3K58A 1HJRA 3C6TA 3P31A 2IVOA 4EHUA 1OVQA 1EWRA 1S1UA 5CE3A 3AY9A 3LALA 1W9HA 3R3LA 5AQTA 4QAGA 4EP5A 3L6QA 4W5NA 3O4WA 3OYGA 3KK2A 1VQ9N 2YX6A 2QWOA 5BR9A 3LZIA 3OYCA 1RTIA 3ZT4A 3MK6A 1JL2A 3L4IA 4DLEA 2HHQA 4CFAA 4DV3K 3NMUA 4EAHD 5HROA 1SV5A 2HVHA 3R9PA 3HM9A 1ASVA 1T03A 3ZT3A 3K9KA 1RTHA 3OJUA 3DOKA 3KTQA 3CD6N 3PIPL 4CJPA 3VA3A 3TAQA 4E19A 1D9FA 3U9DA 1FKPA 3OA9A 3OYIA 2O8FB 2HHVA 4PKIA 3D6RA 1QQOA 4B1VA 1UAXA 1VQ4N 4CEBA 1Q81O 4O8UA 4CHYA 1LWEA 3CIPA 3ZLJA 3MX5A 3ZT2A 5AQWA 4Z4HA 3QETA 1K8KA 3AV9A 3S3NA 4EZ6A 3K59A 2OZMA 5J2PA 4FJ9A 3HXMA 2QXFA 1FW6A 2DY4A 4A5AA 2O8DA 4DTNA 4FZYA 3H45C 3TTCA 4DTOA 3PY8A 1A5XA 3HZ6A 4BREA 4CD1A 1NMNA 3LDQA 1SS6A 4HCBA 1ASUA 1BG3A 1JLBA 3AVHA 4KHSA 1X1PA 1W97L 2V7ZA 3ATUA 3LWMA 4OX9K 2O8EB 3UKRA 2HMPA 2D0OA 1JLEA 4MDAA 3W0LA 4CBUA 5E41A 4CJ5A 3M3ZA 3M5RA 2OA8A 3FGUA 4EZ9A 1VQ7N 4BR2A 3HRGA 3I0RA 1VHXA 2ZQBA 4Y1DA 3THYB 3PV8A 1RDBA 1FJGK 3LAMA 1VAZA 2GWKA 3BF1A 2E20A 4FJMA 1E3MA 1KVCA 1A5VA 3LWLA 4FW2A 4U67L 3CJ7A 3F73A 1BI4A 4JI3K 3ENOA 2IDOA 4CZKA 2HF3A 4IZ9A 3GE1A 3MDQA 2NRTA 4IEIA 3TAGA 3OYHA 1RT7A 5LL6Z 1YITN 4FCYA 1VSFA 2W41A 4ILGB 1O13A 3CJAA 5LMNK 4DV7K 2GX9A 1QZ5A 4FL9A 3ZYYX 3IMXA 2UU9K 2O8CA 2G8FA 3HTVA
chains in the Genus database with same CATH topology
4H5WA 1MDUB 4XH4A 1IG8A 3SAGA 3E9PA 1TUYA 2GELA 4JD2B 4BRGA 5BRHA 5AZJA 1EO1A 3WQTA 5CR4A 4QS7A 5C12A 4OPHA 4Y0WA 3ID6A 5FPMA 4BR9A 3FZHA 2P9UB 3N4PA 3O9QA 4ISGA 4HTLA 3G25A 1NJIO 2QA4N 1U2VA 3FZLA 5M1PA 3MWPA 4GVEA 2J4RA 3LDNA 5JICA 1NMDA 2E2NA 3I8BA 3BP8A 1ATNA 1HX1A 3L0QA 1QVGM 3F2KA 1T44A 5EVZA 4FOIA 5AQXA 3MN9A 5BN8A 3GDQA 5LJVA 3CI5A 3QDKA 5HOOA 2I7PA 4NO7A 4BGBA 1HPMA 3QFUA 3K9JA 4FWPA 3W3DA 3AAPA 5FPEA 1QHAA 3P38A 1VQLN 3D2EB 3CF5L 2E1ZA 3G6EN 3VEOA 2NRVA 3M6GA 5BPLA 5GADP 2RHKA 4K42A 4FWLA 3FR0A 3UE5A 4JKGB 3VGKA 3UKUA 3CQXA 3FE1A 3NVKA 3LM9A 1GLDG 1SQKA 3OW2M 1MWKA 3A5LC 2VGMA 1V4SA 4CI6A 4KH4A 4RWTA 2IVPA 3FZMA 1Q18A 3O9UA 3O9TA 4CBXA 3C7NB 3A5MC 4DQ8A 4UY8O 2F7TA 2PBDA 5AR0A 3ULEB 3CERA 3QMLA 3VEWA 1YJWN 2HBLA 4AF1A 4B9QA 2P9UA 4M7YA 2BTFA 3BUZB 4JKFA 4J8FA 4R79A 3SJHA 1NGCA 3H1QA 3CCSN 3GOIA 1NBWA 3ZEUA 3CHWA 3VEVA 2KKZA 5KQ8A 3MN5A 2ZJRL 1ZXOA 1VQ6N 2P9LB 1VQNN 4PL7A 1C0FA 2E1YA 3DXKB 5MLCQ 1YI2N 2QW9A 2NRXA 4XH5A 4H5VA 3O80A 3C0BA 4DCHA 4G9ZA 4H5RA 1T3VA 2QTDA 5ELZA 4WF9L 1BOTO 4A5BA 4GV6A 5GIPA 3CCJN 1P90A 5E26A 3O9RA 1KQSM 1LOTB 1NLVA 1X3NA 3R6MA 1E4GT 4GNIA 5JLHA 3CCVN 4BRQA 1KD1O 2HF4A 3H3OB 1D4XA 3MCAB 5C2DA 3BEXA 1ZBSA 3O1BA 2PFUA 4YOVA 5AQPA 2QWNA 4H5TA 4BRCA 3LDPA 4JKGA 4JNEA 3WXMB 3C6HA 1GLEG 1HJOA 4MLEA 1M1KO 1ZC6A 4CZIA 1YF5L 3F5TA 1GLLO 3I33A 4JK8A 4JEPA 5BPMA 4DKWA 4RTFD 4FPAA 5C2FA 1XC3A 4YDUC 2QXLA 2AP1A 2VYPA 3HI0A 5GAGP 3R1XA 1BA1A 2CGJA 3OBWA 3F9MA 4BR5A 2HBJA 3C7NA 1SZ2A 5B8HA 4JKBA 1VQKN 3J8AA 4YOXA 1SAZA 3D2FB 4U7BA 2Q36A 1BA0A 1HUXA 2WBNA 1NGFA 2ASPA 4O5FA 1GLFO 5AQNA 1KAZA 1NGHA 2KHOA 3DWLA 5KPZA 5JLFA 2D1KA 3M1FA 4QS9A 3U9ZA 1NGAA 1NGJA 4FWOA 4CZFA 1YAGA 3R8EA 1VQPN 2P9LA 3HOTA 2IIRA 1Z05A 3DXKA 4BR7A 1Q7YO 4B1WB 3A5OC 5AQKA 3WXLA 4RCHA 5DM6L 4IOAL 3FZKA 5JVGL 1MA9B 3E9LA 4BRPA 4CBWA 3TTFA 4BRKA 2FF6A 3VESA 1TYQB 4WYBA 2FSKA 2QWRA 3WXJA 2DPNA 2CH6A 4FWMA 2E2QA 4CZGA 1Q82O 4JK7A 2CGLA 3RVCA 3DXMB 3AGRA 4CJ7A 3C6AA 3C65A 5JMVA 1KAYA 4I6MB 1S3XA 3SMPA 3IUCA 4DB3A 3KVGA 5F1XA 2D4WA 2NRRA 3E66A 3P39A 5BRDA 3VEYA 1ILYA 3QBXA 3ZX3A 3HBTA 4BR0A 3LM2A 3VETA 3CMEN 4ILJA 4K25A 5ADXH 5EY4A 3VF4A 4B1XB 2ZF5O 3O9SA 3EKSA 1BWFO 2KLAA 5LY3A 4BRNA 4BVPA 2IVNA 2ASOA 1T6DA 4IOXA 3DLLL 3CCQN 2FSJA 5AQJA 3QFPA 4JK9A 3QB0A 4YOUA 1OKJA 2P9PB 4FSVA 4IDHA 4B1ZA 2Q31A 1YJNN 3CJCA 1VQMN 2I7NA 1HLUA 3H46O 5AQRA 5GINA 1YVNA 2ZGZA 3U8XA 3T69A 1BU6O 1M90O 1K8KB 4H5NA 3ENHA 4FWKA 5HL7L 4YOYA 2BUPA 1DT9A 2VCPA 4ILHA 2P9SB 4JKAA 2HBKA 2W40A 3VOVA 3WUHA 1LCUA 3MN7A 3S41A 3VERA 1S22A 2V52B 3SBGA 3KZBA 1RGIA 1VQ8N 1RDWX 2EWSA 2Q2RA 2P9IB 3TSQA 1X9JA 1EQYA 3O5BA 3H6EA 2A6AA 3KWIA 4H0XB 5AZIA 1VQON 1QVFM 3HOSA 3CCMN 2P9KB 1TYQA 4B1UB 5F0XA 5H1SQ 4BQLA 1NGEA 1WOQA 4BC4A 1HKGA 3DJCA 4PKGA 4JD2A 3EZWA 3HSCA 3VEXA 1VQ5N 4FVUA 5LJWA 2E2PA 4I6MA 2QWMA 4XH1A 5M1OA 2NRHA 1IJJA 1ESVA 3KK7A 3KWGA 2JWLA 4KH6A 1GLCG 3A5NC 2P9NB 3O1WA 2VWBA 4XEIA 2GEMA 2QWPA 3LL3A 4CZEA 1KAXA 5M1QA 4BRDA 3FZFA 3Q7CA 2PAVA 4H0VB 3VMFB 3TU5A 2GTDA 5BREA 2Q0RA 3JXUA 5TKYA 2YHXA 2E88A 3GBTA 3AAQA 3QICA 2P9PA 4JKHA 3ID8A 4YOTA 4JN4A 5FPNA 2YHWA 1NWKA 5M1NA 1W2BM 2QWLA 1DEJA 3ZETB 3D2EA 4IJAA 2P9SA 1G99A 1GLAG 3VTHA 5AFUA 5KPRA 3WT0A 2A3ZA 3EE9A 3OHRA 4A62A 4MO4A 4Z94A 5EXWA 2H3GX 1MWMA 3HM8A 4AM6A 5AQSA 4GV3A 1HKCA 3TSPA 3WEEB 2P9IA 4C23A 3QBWA 4IXCA 1QZ6A 3RSEB 3EL2A 3CPWM 3CETA 4WCEL 2HSTA 2YJEA 4FOEA 1C0GA 3H3NO 1JCEA 2Q1NA 3CJ1A 4NLCA 4M63C 5GAEP 4IO8A 3AGKA 2VGNA 3IFRA 4H0YB 4BGAA 4BVOA 3SAHA 3A8YA 4IJNA 3A0IX 4FO0A 4JAXA 3PIOL 4BRIA 3CC4N 1DGKN 3ULEA 4IO9L 1HKBA 1P8ZA 2A42A 3T7ZA 3VENA 4M7XA 2GUPA 1QQNA 4BRLA 4A59A 4WFAL 5E84A 5F2RA 3EKUA 3NVMA 4MLHA 4C1NK 4EFHA 1NGBA 4IWVA 5AQQA 5GAHP 1NGDA 3G71N 3IDHA 5JVHL 2WC9A 4AM7A 4BG8A 3CCRN 5AQLA 4B1YB 5BPNA 1JCGA 3E9OA 5BRFA 4OO1J 2RE2A 5TKWA 4KBOA 5C15A 1V4TA 2V51B 1YXQA 2YI1A 3CPEA 4ISFA 4O8KA 3O6WA 5EX5A 1Y64A 3B8AX 3DAWA 3ZETA 1NM1A 2V7YA 4EIAA 4FWNA 3TPQA 1Z6RA 3CQYA 1R59O 1XQSC 2FF3B 4YDUA 3MX2A 4WFNL 4LC9B 2YJFA 1H1VA 4L3QA 1YHQN 3SBTA 3CXCM 4MO5A 4BRMA 2F9WA 5EOYA 4OPAA 3WEEA 3WQUA 4JHDB 4WQ4A 2F9TA 3P31A 4BC5A 2IVOA 4EHUA 2YHYA 4FWQA 2QM1A 3LDLA 1BDGA 1T6CA 5AQHA 5CE3A 4CZJA 3AY9A 2CGKA 4WQ5A 3WXKA 3PLAA 3D2FA 3VPZA 4H0OA 2HOEA 3R3LA 4WFBL 1QQMA 2FLOA 5AQTA 1JCFA 5AQYA 3E1YA 2HBMA 3L6QA 2Q0UA 3CJBA 3O4WA 1ATSA 2ASMA 1YIJN 2YX6A 2QWOA 5BR9A 1VQ9N 4A61A 3ZX2A 1GLJO 3AARA 3MMVA 3EN9A 3ZEUB 1DKGD 2NZTA 4FWRA 1Q86O 2NRZA 4DHYA 5FPDA 3VF2A 3MK6A 2FSNA 3L4IA 4QS8A 3SLCA 3SAFA 3NMUA 4EAHD 3KHYA 3I56N 3BF3A 4BG9A 2ZJQL 2NLXA 2A40A 3MCPA 4PHTX 3R9PA 5M1FA 3GL1A 3K9KA 5DM7L 2E8AA 4BR4A 3CC2N 3CD6N 3PIPL 4NLBA 4CZHA 4EHTA 3DXMA 1S72N 4BC3A 5I9EB 1K8AO 1K9MO 3U9DA 4BROA 3OA9A 3SK3A 4A2AA 3UKRB 4JHDA 4A2BA 4BQZA 4PKIA 3J7ZO 2CH5A 3D6RA 3O08A 4BRFA 5KPTA 1N8RO 1QQOA 5AQOA 4B1VA 1VQ4N 2YCHA 2OTLN 3VGLA 2ZWHA 3VGMA 1NGIA 5C10A 4IOCL 4O8UA 1Q81O 2D0PA 5AQMA 3CIPA 4JKDA 1BUPA 1JJ2M 3N4QA 3Q7BA 3MX5A 2A41A 1TUUA 2AA4A 3OBYA 5AQWA 4FWSA 5AQGA 1K8KA 4CZLA 4H0TB 5AQZA 1RFQA 2GWJA 2E2OA 2UYTA 4C1NI 3CCLN 4H0PA 4ISEA 3TTDA 3TSUA 5AQUA 4A5AA 1U6ZA 2Q97A 4MDBA 4PKHA 4E1JA 3FLCO 3MWTA 1X3MA 1NGGA 5M1KA 3H45C 3TTCA 1RDUA 2FXUA 2A5XA 4YOWA 3MN6A 3CMAN 1BO5O 1XUPO 2P9KA 1CZAN 3HZ6A 4BREA 4CD1A 3L4QA 2QI2A 3JS6A 3LDQA 1SS6A 3P4IA 5GIOA 4A57A 2NRWA 3H1VX 3VTIA 3CC7N 5KQDA 2ITMA 1BG3A 5AQIA 5AZJB 5ADXA 4BRHA 4F9OA 4YORA 1W97L 2V7ZA 3ATUA 3ZX0A 3IKMA 4GY2B 3UKRA 2HMPA 1U2VB 2D0OA 2P9NA 2WFBA 4MDAA 1OVYA 4KH5A 5AQVA 3W0LA 4CBUA 2ZJPL 2QWQA 3WXIA 1J6ZA 2NNWA 3M3ZA 3M5RA 3FFKB 4HWIA 4BY9C 3FGUA 4FPBA 1VQ7N 4BR2A 3HRGA 4CD3A 4IFEA 1YUWA 4JKEA 4BRAA 1VAZA 2GWKA 3BF1A 2E20A 4NB4A 1KXPA 2JWKA 3GG4A 4K43A 1ATRA 3UB5A 3U4LA 5CHIA 4U67L 4GV9A 1WUAA 3D7EO 3LDOA 4WQ4C 2ZGYA 4K41A 3CJ7A 3G4SN 1KC8O 5AQFA 5C0YA 4BC2A 3VF6A 3ENOA 3EO3A 3CCEN 1E4FT 3SMSA 4CZKA 2BH1A 2HF3A 3ATVA 3I55N 4H03B 4IZ9A 3CCUN 3GE1A 3CJ9A 2NRTA 3MDQA 4IEIA 4WQ5C 4PL8A 1YITN 3UKUB 2OANA 1YJ9N 3RSEA 2W41A 4ILGB 1O13A 2WUSA 3CJAA 4IEEA 2GX9A 5BN9A 1QZ5A 5AFUH 4FL9A 5AZIB 3EE8A 3ZYYX 2QEXN 3IMXA 3ENBA 3O8MA 4CZMA 1K73O 1GLBG 3VEZA 2OTJN 4JKCA 3HTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPE A;  3C6H A;  4IFE A;  5M1O A;  5C2D A;  5M1Q A;  5M1N A;  5M1K A;  5M1F A;  4IEE A;  5C10 A;  3C6A A;  4IEI A;  5M1P A;  5C2F A;  4IDH A;  5C15 A;  5C12 A; 
#chains in the Genus database with same CATH topology
 1WN7 A;  3M8R A;  1MDU B;  4NCG A;  1IG8 A;  3SAG A;  1TUY A;  1U48 A;  3RR7 A;  3NF7 A;  4QS7 A;  4Y0W A;  3O4Q A;  5FPM A;  3AA3 A;  2P9U B;  4ISG A;  4IG3 A;  4BWM A;  1RDA A;  4CIF A;  1U2V A;  4M3T A;  3C94 A;  1U04 A;  3I8B A;  2O8B B;  3CFO A;  3MXM A;  4UQG A;  2G8I A;  1QS4 A;  1TVR A;  2B5J A;  4CVN E;  1FXX A;  5LMU K;  4CJF A;  1XNR K;  1VSJ A;  5FPE A;  1QHA A;  3P38 A;  1C1C A;  1VQL N;  3CF5 L;  2E1Z A;  2UUA K;  3VEO A;  5GAD P;  4FWL A;  2G8U A;  4JI5 K;  3CQX A;  1IH7 A;  3LM9 A;  2YKN A;  3OYB A;  1SQK A;  4B3T K;  3A5L C;  1V4S A;  1HNW K;  3SNN A;  4LSN A;  4DSJ A;  4FJ7 A;  3OJS A;  3FZM A;  1Q18 A;  4HTU A;  1QSL A;  1OH7 A;  3O9U A;  3O9T A;  3A5M C;  2Z1I A;  5FLX O;  1CXU A;  1YJW N;  3ZT0 A;  4J8F A;  3MN5 A;  2HNZ A;  1ZXO A;  4J2B A;  1S1X A;  1FK9 A;  4G1Q A;  1YI2 N;  2QW9 A;  3C0B A;  4C8M A;  3KKR A;  4DCH A;  1T3V A;  2QTD A;  5ELZ A;  5KGX A;  4E7L A;  3CCJ N;  3O9R A;  1KVB A;  3L2V A;  5SWM A;  4FZX C;  1EX4 A;  3R6M A;  1NK9 A;  4GNI A;  5JLH A;  2D5R A;  1RBT A;  3H3O B;  3O3G A;  4CEQ A;  4YOV A;  2QWN A;  5KGW A;  4JNE A;  2ETJ A;  3C6H A;  1HJO A;  1SUQ A;  4MLE A;  1YF5 L;  3F5T A;  2YKM A;  3I33 A;  2Q3S A;  4DKW A;  5C2F A;  4YDU C;  2QXL A;  1HNV A;  3TAP A;  1IV0 A;  4FJL A;  1GOC A;  4BR5 A;  4IDK A;  3E01 A;  5B8H A;  2VG5 A;  1OH8 A;  3J8A A;  4YOX A;  2Q36 A;  1BA0 A;  2B4J A;  2YNG A;  2ASP A;  1SKW A;  3QLH A;  1KAZ A;  1NGH A;  3AVG A;  3DWL A;  2OPP A;  3U9Z A;  4FWO A;  4PA1 A;  1VQP N;  2P9L A;  3HOT A;  1JXE A;  1Q7Y O;  2E4L A;  4RCH A;  3ITH A;  3TI0 A;  3TAE A;  4BRP A;  4CBW A;  2HHT A;  4BE0 A;  4FM2 A;  3FFI A;  2FF6 A;  3UIQ A;  4WYB A;  4DWI A;  4I9Q A;  2FSK A;  1Q82 O;  2OYQ A;  1S9G A;  3AO3 A;  3IAY A;  2CGL A;  3RVC A;  3OYN A;  3RTV A;  3AO5 A;  4M3W A;  4KHW A;  1S3X A;  2WOM A;  2PY5 A;  3KVG A;  5K14 A;  3OY9 A;  2O8E A;  4FLV A;  4JI4 K;  3VET A;  2FBX A;  2BE2 A;  4ILJ A;  2HMI A;  3EKS A;  1BWF O;  4DSI A;  4BRN A;  3OVN A;  1OH5 A;  3OYE A;  3QFP A;  4DU3 A;  3SV3 A;  4CF0 A;  5EU7 A;  2ZGZ A;  3U8X A;  5HL7 L;  1U49 A;  2VCP A;  4ILH A;  2P9S B;  2W40 A;  3VER A;  4IG0 A;  1VQ8 N;  4K8Z A;  2Q2R A;  3V6D A;  4CGF A;  3QO9 A;  2P9I B;  4FLU A;  1EQY A;  1VQO N;  3HOS A;  1VK0 A;  3CM5 A;  4OLA A;  3DRR A;  4TSX A;  3MEG A;  1D8Y A;  3QIP A;  4PKG A;  4GMJ B;  4I6M A;  2IC3 A;  2NRH A;  1IJJ A;  4DF4 A;  1GLC G;  3G0Z A;  2WTU A;  3NHG A;  5M1Q A;  2O8B A;  4LF6 K;  1U4B A;  2PAV A;  4H0V B;  1N6Q A;  2BAN A;  4CJL A;  2E88 A;  3NFA A;  3AAQ A;  3QIC A;  3T1H K;  4YOT A;  4FJX A;  4RG8 A;  2G8K A;  3V1O A;  4N56 A;  3WNH A;  3ZET B;  3MEE A;  1G99 A;  1GOB A;  1RT3 A;  5AFU A;  1NK7 A;  1ZBH A;  5EXW A;  3HM8 A;  1MWM A;  1EWQ A;  3A2F A;  3EEQ A;  3WEE B;  4CGI A;  2O4G A;  4IXC A;  1QZ6 A;  3CPW M;  3LPT A;  4WCE L;  1JCE A;  2KZM A;  4FLX A;  1NG9 A;  3IFR A;  2XY8 A;  2G8H A;  4Z4G A;  3A8Y A;  4DV0 K;  3HJF A;  3OYL A;  4BRI A;  4IO9 L;  3T7Z A;  2NUB A;  4CEC A;  4ID1 A;  4BRL A;  4KO0 A;  4DTM A;  4IBN A;  1TGO A;  1NGB A;  1RDC A;  5AQQ A;  3IS9 A;  1NGD A;  2LSN A;  4Z0U A;  5JVH L;  4M45 A;  5BRF A;  1C0U A;  3QEV A;  2RE2 A;  4KBO A;  5C15 A;  3DAW A;  4AHR A;  3TPQ A;  2FF3 B;  4WFN L;  1IBL K;  1YHQ N;  4PY5 A;  1BQM A;  2F9W A;  1ZBL A;  1N34 K;  4CJK A;  2VQF K;  2RF2 A;  4AHS A;  3OYK A;  4DLG A;  4M3Y A;  4FWQ A;  2QM1 A;  3L3V A;  1WAF A;  3M8Q A;  3NH2 A;  4AQY K;  4E7H A;  3VPZ A;  4H0O A;  2HOE A;  2FLO A;  3O3F A;  1JCF A;  3E1Y A;  1RT5 A;  3CJB A;  2ASM A;  1YIJ N;  2W6K A;  4A61 A;  3MMV A;  4CJE A;  3EN9 A;  4RW6 A;  3THW B;  1CZ9 A;  4C8K A;  4DHY A;  5FPD A;  5CZ2 A;  3VF2 A;  2FSN A;  3LP1 A;  4HHT A;  3SAF A;  2O8D B;  2NLX A;  2A40 A;  2XRI A;  3MCP A;  5SZT A;  1CLQ A;  3NDK A;  2E8A A;  4BR4 A;  3CC2 N;  4NLB A;  4EHT A;  2AJQ A;  4C8L A;  5CYM A;  5I9E B;  1VRT A;  1RBU A;  3VQD A;  4A2A A;  3UKR B;  4CK3 A;  4BRF A;  1Q9Y A;  2FBV A;  4B9V A;  1LWC A;  3VGL A;  2VQE K;  4IFV A;  5C10 A;  4DR1 K;  2D0P A;  4I2P A;  4PUO A;  1JJ2 M;  3N4Q A;  3Q7B A;  1TUU A;  3U6F A;  1KTQ A;  4H0T B;  5HRP A;  3T3F A;  1BI4 B;  4ISE A;  3TSU A;  2Q97 A;  4H4O A;  4DV6 K;  2X74 A;  4E1J A;  2XY6 A;  4M41 A;  4DR7 K;  1NGG A;  4BWJ A;  1TAQ A;  4CGJ A;  4YOW A;  3SUP A;  1BO5 O;  3K57 A;  4DV2 K;  4CGH A;  3ZSX A;  4F3O A;  1J5O A;  5GIO A;  3P4I A;  4FZZ A;  2O8C B;  3DLR A;  5KQD A;  2ITM A;  4KTZ A;  5ADX A;  1UWB A;  3DYA A;  4BRH A;  4DQQ A;  4F9O A;  4YOR A;  3JAM O;  3ZX0 A;  1U2V B;  3ZSW A;  5AQV A;  2QWQ A;  3WXI A;  2GBZ A;  1BIS A;  2NNW A;  3FFK B;  4X65 K;  1WBD A;  2P51 A;  3MXI A;  3PX6 A;  4CD3 A;  4IFE A;  5FDL A;  1YUW A;  4JKE A;  4BRA A;  4KI4 A;  1KXP A;  2JWK A;  5CHI A;  1WUA A;  3D7E O;  4AHT A;  4CF9 A;  3BY5 A;  4OPJ A;  1JLG A;  2DFF A;  3SMS A;  3I55 N;  3ATV A;  4H03 B;  3CJ9 A;  3SCX A;  2UXC K;  1UA1 A;  2OAN A;  3THX B;  3MXJ A;  1SKR A;  2D0C A;  5AZI B;  3EE8 A;  1TV6 A;  2O4I A;  1LW2 A;  3ENB A;  3O8M A;  3VEZ A;  4H5W A;  4B9T A;  1Y97 A;  4K8X A;  3E9P A;  2GEL A;  4JD2 B;  5BRH A;  2YNI A;  1NOY A;  1EO1 A;  4HCC A;  3K5O A;  3FZH A;  1RIL A;  3O9Q A;  4Z4F A;  4ID5 A;  2QA4 N;  3FZL A;  3KLH A;  2J4R A;  3IG1 A;  1HMV A;  5JIC A;  1NMD A;  3BP8 A;  1HX1 A;  3L0Q A;  1QVG M;  3QNO A;  5EVZ A;  4CHZ A;  4FOI A;  5AQX A;  3MN9 A;  4OJR A;  5HOO A;  2PYJ A;  1HPM A;  3AVC A;  3K9J A;  1RTJ A;  4FWP A;  4M3U A;  5DMR A;  1NKC A;  3DLB A;  4O55 A;  4DTR A;  3UKU A;  3VN5 A;  3FE1 A;  1VSH A;  1CXQ A;  4CI6 A;  3DLK A;  4LH4 A;  3ZSR A;  3CFP A;  4DQS A;  4KTQ A;  4OKE A;  2HB5 A;  1WBB A;  5JS2 A;  1XNQ K;  1MU2 A;  3VEW A;  3PO4 A;  3AA4 A;  2HBL A;  3HVR A;  2RKI A;  3CCS N;  2BTF A;  3BUZ B;  1HPZ A;  3SJH A;  1NGC A;  1NBW A;  3THW A;  2DFE A;  4OLB A;  4AHV A;  2P9L B;  4PL7 A;  4R5P A;  4H5V A;  1TKZ A;  2ATQ A;  5GIP A;  3C6U A;  3TR8 A;  3EZ5 A;  5HLF A;  1LOT B;  3ALY A;  1X3N A;  4RW4 A;  4DSF A;  2VWJ A;  1NKE A;  3CCV N;  2QK9 A;  3K2P A;  2EX3 A;  2KQ2 A;  1TK0 A;  3BEX A;  1ZBS A;  3O1B A;  4GKJ K;  5AQP A;  4H5T A;  4JKG A;  3WXM B;  4DFK A;  1KLM A;  3BZC A;  1HNI A;  4JK8 A;  1GLL O;  5JS1 A;  4RTF D;  3AVK A;  1XC3 A;  2VYP A;  3HI0 A;  1BA1 A;  2CGJ A;  3TAR A;  3F9M A;  3AVA A;  3V81 A;  1TL1 A;  4J2D A;  3C7N A;  1LV5 A;  3D2F B;  4IFY A;  2WBN A;  1VSL A;  4O5F A;  1GLF O;  1LAV A;  2KHO A;  4N41 A;  2D1K A;  1VSE A;  3M1F A;  3QNN A;  3DMJ A;  1B92 A;  1YAG A;  1J5E K;  3J81 O;  2VG6 A;  2IIR A;  3OYF A;  4BR7 A;  1NJX A;  3WXL A;  5DM6 L;  4IOA L;  2FC0 A;  4FLW A;  5JVG L;  1MA9 B;  4DSL A;  3VES A;  1S9E A;  4KI6 A;  4QCL A;  4CZG A;  2DPN A;  4JK7 A;  4CJ7 A;  3C65 A;  4B3R K;  4I6M B;  2P1J A;  3IUC A;  3SMP A;  3RMB A;  2D4W A;  2NRR A;  1O1W A;  3VEY A;  3QBX A;  1S1W A;  3ZSQ A;  1G15 A;  3DLE A;  3VF4 A;  4N47 A;  4E1M A;  5I42 A;  3O9S A;  4QOZ B;  4FVM A;  2KLA A;  4CJU A;  4CED A;  2ASO A;  3DLL L;  3CCQ N;  1Q9X A;  4JK9 A;  3QB0 A;  1OKJ A;  2Q31 A;  4FM1 A;  3SUO A;  1VQM N;  2I7N A;  3L2W A;  5GIN A;  1YVN A;  1M90 O;  2UUB K;  3ENH A;  4FWK A;  5HBM A;  3VQ8 A;  5C42 A;  1LCU A;  4JRP A;  1B9F A;  1QSS A;  4E7I A;  3CG7 A;  4LFA K;  3THX A;  3SPZ A;  4LFC K;  4DQP A;  3HP9 A;  3H6E A;  3I0S A;  4H0X B;  5AZI A;  4KV8 A;  4DR5 K;  3CCM N;  2P9K B;  3DM2 A;  1NKB A;  4J2E A;  5H1S Q;  4BQL A;  1NGE A;  1WOQ A;  4BC4 A;  4X64 K;  4CHO A;  1HKG A;  2G8W A;  3DJC A;  1IG9 A;  4JD2 A;  4W5T A;  5LJW A;  3RMC A;  2QWM A;  1KRP A;  1EXQ A;  1JLF A;  5M1O A;  2ZM6 K;  2JWL A;  1NK4 A;  1HQU A;  3A5N C;  3O1W A;  2P9N B;  4KH6 A;  4FJ5 A;  2KTQ A;  3VQ7 A;  4OKK A;  3PSF A;  4CZE A;  1KAX A;  2QKB A;  3FZF A;  4E0D A;  3VMF B;  2GTD A;  3JXU A;  5TKY A;  4FLY A;  1Z26 A;  4E89 A;  4LSL A;  4JKH A;  1XC9 A;  4LH5 A;  5FPN A;  2YHW A;  1NWK A;  1NOZ A;  4CF8 A;  4C8N A;  5HRN A;  1QHT A;  4FJ8 A;  4CK2 A;  4X62 K;  2H3G X;  4AM6 A;  1HKC A;  3TSP A;  4C23 A;  4CJ4 A;  3RMD A;  4YY3 K;  4KTW A;  3CJ1 A;  3DLG A;  4IO8 A;  1REV A;  3AGK A;  2Y1J A;  2X6N A;  2OZS A;  4IJN A;  3CC4 N;  1C6V A;  1DGK N;  2A42 A;  4AHU A;  1QQN A;  4DFP A;  1FKO A;  4NXM K;  4MLH A;  4C1N K;  2IAJ A;  4KRE A;  3G71 N;  4JI2 K;  4L8R B;  1UA0 A;  4AM7 A;  3CCR N;  5BPN A;  4OO1 J;  1RCH A;  5TKW A;  4O8K A;  2V51 B;  4Y1C A;  1YXQ A;  4WF9 L;  5EX5 A;  3O6W A;  1HYV A;  4JI0 K;  4F2S A;  3WNF A;  4CES A;  3NE6 A;  4FWN A;  1Z6R A;  1R59 O;  1XQS C;  3B6O A;  4DTX A;  3MX2 A;  3SQ1 A;  1YTU A;  4LD0 A;  2YJF A;  4I2Q A;  1K6Y A;  3F9K A;  2RPI A;  4BRM A;  4DU4 A;  5EOY A;  2D0A A;  3HST B;  3WQU A;  2UXB K;  2F9T A;  4CFD A;  2YHY A;  3LDL A;  4LY7 A;  1BDG A;  1T6C A;  5AQH A;  1RBR A;  3TAB A;  2CGK A;  3WXK A;  2F96 A;  2YHA A;  4YNQ A;  3D2F A;  3LAK A;  3PLA A;  1D5A A;  4WFB L;  4DU1 A;  5AQY A;  2WON A;  1ATS A;  3ZX2 A;  3AAR A;  4Q0B A;  1DKG D;  4FWR A;  1T8E A;  2NRZ A;  1F21 A;  1X9S A;  1KFD A;  3BF3 A;  1KVA A;  5A2Q O;  3M8P A;  3L2R A;  5M1F A;  2UUC K;  4CHP A;  4LF7 K;  1K8A O;  4FJG A;  4HVJ A;  1K9M O;  5FRO A;  2W42 A;  3SK3 A;  3S3M A;  3QEP A;  4JHD A;  4A2B A;  3CM6 A;  3M8S A;  5KPT A;  3O08 A;  1N8R O;  2RN2 A;  5J2M A;  4CHN A;  2ZWH A;  2F4V K;  2P5O A;  3AVB A;  4RW9 A;  1A5W A;  1BUP A;  2A41 A;  3OBY A;  4FWS A;  5AQG A;  4CZL A;  1XHX A;  5AQZ A;  1RFQ A;  2GWJ A;  2E2O A;  2UYT A;  4OKJ A;  3VQE A;  3CCL N;  3CYM A;  4DV1 K;  3TTD A;  2F8S A;  5AQU A;  1U6Z A;  2Y1I A;  4O44 A;  1IKY A;  3FLC O;  3KJV A;  3MWT A;  1X3M A;  4CFB A;  2E6M A;  1RDU A;  2FXU A;  2A5X A;  3EY1 A;  3MN6 A;  2YNF A;  1XUP O;  1VSM A;  2P9K A;  1CZA N;  1HQE A;  3JS6 A;  3O3H A;  3WNE A;  4FYD A;  4LFB K;  4A57 A;  2NRW A;  3SZ2 A;  1XI1 A;  2HNY A;  4B9U A;  5AQI A;  4GY2 B;  1BCO A;  4OGE A;  4BE1 A;  2P9N A;  1OVY A;  1WLJ A;  1J6Z A;  4HWI A;  1L3V A;  3SQ4 A;  4BY9 C;  3VA0 A;  2FBY A;  4WE1 A;  2BGG A;  2XY5 A;  4B8A B;  3GG4 A;  1ATR A;  1N36 K;  4GV9 A;  1IKX A;  1N33 K;  1KCF A;  3TAM A;  2ZGY A;  4K41 A;  3MAQ A;  4FW1 A;  3G4S N;  2IOC A;  3ZT1 A;  1KC8 O;  5AQF A;  2IGI A;  3VF6 A;  2YV0 X;  1E4F T;  4FJN A;  4M3Z A;  1BIZ A;  2BH1 A;  3NH0 A;  2EHG A;  4PL8 A;  3V9X A;  3UKU B;  4JRQ A;  1NK6 A;  1YJ9 N;  4IEE A;  5BN9 A;  4B9N A;  2D0B A;  4Z4C A;  4NYF A;  2QEX N;  4CZM A;  5J2N A;  3KD1 E;  1GLB G;  2OTJ N;  4JKC A;  1CZB A;  1VSD A;  3ZCM A;  3KLF A;  5AZJ A;  3TWH A;  4E3S A;  5C12 A;  4FM0 A;  4I9L A;  4HTL A;  3G25 A;  1NJI O;  4CEO A;  4GVE A;  1EET A;  3V9W A;  1IBK K;  3F2K A;  3JSM A;  1C1B A;  5BN8 A;  5LJV A;  3QDK A;  5T7B A;  4NO7 A;  4BGB A;  3PX0 A;  5C25 A;  4ELV A;  3QFU A;  2FBT A;  1RT2 A;  3W3D A;  3AAP A;  4JI1 K;  4DG1 A;  1QSY A;  3G6E N;  4O4G A;  2NRV A;  3M6G A;  4CEZ A;  4YFU A;  3NF8 A;  1DTQ A;  2E6L A;  4JKG B;  4NYN A;  3NVK A;  4GKK K;  3OW2 M;  3HVT A;  3VQC A;  4KH4 A;  4RWT A;  4F4K A;  2HHH K;  5CY4 A;  2XY7 A;  1JKH A;  3C7N B;  4DQ8 A;  4UY8 O;  3ULE B;  3LDS A;  3VQP A;  1ITG A;  4AF1 A;  4B9Q A;  4N76 A;  4R79 A;  4JKF A;  3QEX A;  3THV A;  3H1Q A;  4NCA A;  4JLH A;  3VEV A;  5AJ3 K;  5KQ8 A;  4H4M A;  1VQN N;  1C0F A;  4ELT A;  3QEW A;  5MLC Q;  4H5R A;  1BOT O;  4MQ3 A;  1B9D A;  1DLO A;  4Z4E A;  4DTP A;  3CQ8 A;  1S1V A;  4BRQ A;  1OH6 A;  1KD1 O;  1RT4 A;  3MCA B;  5C2D A;  2PFU A;  4KPY A;  1WSJ A;  1J9A A;  2I5J A;  4GVM A;  4BRC A;  3LDP A;  3RR8 A;  1GLE G;  4CZI A;  2GV9 A;  5DK5 A;  1TK5 A;  2AP1 A;  4CCH A;  3R1X A;  3OBW A;  3PX4 A;  1W7A A;  4FLZ A;  4CFC A;  1C0M A;  4HUE A;  1SAZ A;  1HUX A;  2ITG A;  2BDP A;  4FXD A;  1L3T A;  5BR8 K;  1NGJ A;  4LF5 K;  3R8E A;  1X9W A;  3D45 A;  4CER A;  3DXK A;  1JL1 A;  1JLC A;  2VG7 A;  4M3R A;  3T1Y K;  4NCB A;  5AQK A;  4B9S A;  3TTF A;  1WNS A;  1BQN A;  1ZBF A;  3WXJ A;  3V1Q A;  2GUI A;  4M3X A;  3DXM B;  3AGR A;  1WB9 A;  5JMV A;  4AHC A;  4Z4I A;  4DB3 A;  2JLE A;  5F1X A;  3HPH A;  3SUQ A;  5BRD A;  3ZX3 A;  3HBT A;  1VSK A;  3LM2 A;  1SKS A;  2VWK A;  2HW3 A;  2ZF5 O;  3KK1 A;  4BVP A;  2IVN A;  2G8V A;  1T6D A;  4IOX A;  4DTU A;  2FSJ A;  2Z1G A;  3OS2 A;  1I3A A;  4YOU A;  4FSV A;  4B1Z A;  4IDH A;  3L2U A;  1YJN N;  3CJC A;  4CJ3 A;  3H46 O;  1HLU A;  5AQR A;  3TAN A;  2P5G A;  3NF9 A;  5KRS A;  2BUP A;  1XMQ K;  4JKA A;  2HBK A;  4MFB A;  3WUH A;  5HP1 A;  3MN7 A;  3S41 A;  1QE1 A;  4BDZ A;  2V52 B;  1YT3 A;  1L3S A;  1RGI A;  3DLH A;  2EWS A;  3L3U A;  3P83 D;  1RDD A;  3O5B A;  4KHP K;  3KWI A;  1TYQ A;  3VQ9 A;  4B1U B;  4N5S A;  1BHL A;  3ZSO A;  3HSC A;  3VEX A;  1VQ5 N;  2E2P A;  3BDP A;  3SQ0 A;  1ESV A;  4GW6 A;  3KK7 A;  4HUF A;  4KHU A;  1TL3 A;  2PYL A;  1X9M A;  4CJQ A;  4CJW A;  2YHX A;  3GBT A;  3SI6 A;  2P9P A;  3ID8 A;  1HR0 K;  4AIL C;  3HT3 A;  2ZE2 A;  3EYZ A;  4O0J A;  1WAJ A;  1W2B M;  1NU0 A;  1DEJ A;  3KIO A;  4CGG A;  1IKV A;  1L5U A;  3VTH A;  1GLA G;  1U45 A;  4FJJ A;  5KPR A;  4DQI A;  1EP4 A;  3WT0 A;  2A3Z A;  4A62 A;  4MO4 A;  5AQS A;  4JS4 A;  3QBW A;  3QEI A;  3RSE B;  3CET A;  4FOE A;  4FK4 A;  1R0A A;  1C0G A;  2Q1N A;  3VQB A;  1QTM A;  3AO1 A;  4M42 A;  2VGN A;  3SAH A;  1NK0 A;  2KFZ A;  3A0I X;  4CJS A;  3PIO L;  4I7F A;  4FLT A;  3C95 A;  3MEC A;  3ULE A;  1VRU A;  1HKB A;  1P8Z A;  1BL3 A;  2X6S A;  3VEN A;  2GUP A;  1S5J A;  4PWD A;  4A59 A;  4WFA L;  3OS0 A;  5E84 A;  5F2R A;  3EKU A;  3NVM A;  4KB1 A;  2W6L A;  4IWV A;  3KD5 E;  3D0P A;  4J2A A;  4DUY K;  4BDP A;  2WC9 A;  3MED A;  3E9O A;  2E5L K;  1NK8 A;  3AVJ A;  4DUZ K;  4OPK A;  4RW7 A;  4DTJ A;  1V4T A;  2PZS A;  4ISF A;  4O5B A;  3CPE A;  5BPL A;  1Y64 A;  3B8A X;  3VQ6 A;  1NM1 A;  2YHB A;  4LF4 K;  4PQU A;  3CQY A;  4YDU A;  3DOL A;  4LC9 B;  3KK3 A;  1H1V A;  4L3Q A;  4KFB A;  3CXC M;  3K5L A;  4OPA A;  4JHD B;  1I94 K;  4CHQ A;  4WQ4 A;  3DRS A;  4BC5 A;  4DS5 A;  1GOA A;  3VQA A;  1KLN A;  1HNX K;  1D9D A;  4FJH A;  4CF2 A;  4CZJ A;  5IT9 O;  4WQ5 A;  3KLG A;  1IO2 A;  3PSI A;  3RWU A;  1BGX T;  1QQM A;  2HBM A;  2OPR A;  2Q0U A;  4ZTJ A;  1GLJ O;  3OYJ A;  3ZEU B;  4X66 K;  2NZT A;  4CEE A;  1Q86 O;  1TK8 A;  3ASM A;  4YHH K;  4QS8 A;  3SLC A;  4B3S K;  3KHY A;  3I56 N;  4BG9 A;  2ZJQ L;  4Q5V A;  2A1S A;  3LAN A;  4PHT X;  1KSP A;  4DR3 K;  3VQQ A;  5D3G A;  3GL1 A;  4KAZ A;  5DM7 L;  1ZBU A;  3OYM A;  4CZH A;  4AH9 A;  3DXM A;  1S72 N;  4KHQ A;  4BC3 A;  4CF1 A;  4KB0 A;  3LP0 A;  4BRO A;  1RBV A;  4F2R A;  4CGD A;  4DV5 K;  3BGR A;  3PUF A;  2F8T A;  2UXD K;  4BQZ A;  3ISN C;  3J7Z O;  2CH5 A;  4DS4 A;  5AQO A;  2OTL N;  2YCH A;  3HYF A;  3V9U A;  3O4N A;  3VGM A;  1NGI A;  4IOC L;  1I39 A;  5AQM A;  1RT6 A;  4JKD A;  3OTO K;  2AA4 A;  1C0T A;  4B9L A;  4DR4 K;  4CJV A;  1SL1 A;  4C1N I;  4H0P A;  3LZJ A;  3RRG A;  1HRH A;  4F8R A;  4MDB A;  3QIN A;  2B6A A;  4PKH A;  1J54 A;  2Z1H A;  5M1K A;  4DFJ A;  4B08 A;  3TAF A;  3AA5 X;  4E7K A;  1HYS A;  3CMA N;  2OPS A;  3L4Q A;  2QI2 A;  2HHX A;  5I3U A;  4ZTF A;  3HO1 A;  2HVI A;  3H1V X;  3VTI A;  3CC7 N;  4ELU A;  3SV4 A;  1LWF A;  1RNH A;  4B8C A;  5AZJ B;  3IRX A;  3NGI A;  2O8F A;  3HP6 A;  3AO2 A;  1WSE A;  3IKM A;  3LPU A;  4DSE A;  2WFB A;  2ZJP L;  4KH5 A;  4LF8 K;  3AO4 A;  5KRT A;  1DTT A;  3VQ4 A;  1SL2 A;  4FPB A;  5C24 A;  3V4I A;  4NB4 A;  4K43 A;  3UB5 A;  3U4L A;  4W5R A;  3LDO A;  4WQ4 C;  5C0Y A;  4BC2 A;  3CCE N;  3CCU N;  4WQ5 C;  4EP4 A;  4E7J A;  4CIE A;  3OYA A;  3RSE A;  5HRS A;  2WUS A;  5AFU H;  2OPQ A;  1RTD A;  3DI6 A;  3CFR A;  2KZZ A;  3P5J A;  3G10 A;  2YNH A;  1K73 O;  4B3O A;  5CYQ A;  3EO3 A;  1LAW A;  4XH4 A;  4KRF A;  3L2Q A;  4BRG A;  4BE2 A;  3WQT A;  5CR4 A;  4DF8 A;  1T05 A;  1XMO K;  4OPH A;  1NJZ A;  2IS3 A;  3ID6 A;  4BR9 A;  3N4P A;  3RMA A;  4JV5 K;  5M1P A;  3K5N A;  3MWP A;  3LDN A;  2XO7 A;  4CE9 A;  2E2N A;  1ATN A;  1T44 A;  3THY A;  3GDQ A;  3CI5 A;  3DRP A;  2I7P A;  4RW8 A;  1VSI A;  3LP3 A;  4OVL A;  3SYZ A;  5IWA K;  4JI8 K;  1JXB A;  1BCM A;  1YTA A;  4OGC A;  3D2E B;  3AVM A;  3NCI A;  1YVU A;  4KHY A;  2RHK A;  4K42 A;  3V1R A;  3FR0 A;  3UE5 A;  3VGK A;  3SPY A;  4O0I A;  1NJW A;  1GLD G;  1MWK A;  3HPO A;  2VGM A;  4FK2 A;  2IVP A;  1BIU A;  4XIU A;  1HNZ K;  4BDY A;  1NNE A;  1T7P A;  4CBX A;  2F7T A;  2PBD A;  5AR0 A;  3OS1 A;  4NXN K;  3CER A;  3QML A;  2P9U A;  4M7Y A;  4KHN A;  3GOI A;  3ZEU A;  3CHW A;  4ICL A;  2KKZ A;  2ZJR L;  1VQ6 N;  3AVN A;  3J80 O;  2E1Y A;  3DXK B;  3AVI A;  4F3T A;  4XH5 A;  2NRX A;  3O80 A;  2JGU A;  4JS5 A;  1W0H A;  4G9Z A;  1WSH A;  4A5B A;  4GV6 A;  3BZK A;  1P90 A;  5E26 A;  2DTU A;  1KQS M;  1NLV A;  2HHU A;  1E4G T;  2HF4 A;  1D4X A;  3T19 A;  3V9S A;  4CIG A;  4JI7 K;  3H08 A;  2Z1J A;  1NJY A;  1M1K O;  1ZC6 A;  4FK0 A;  1WSG A;  4JEP A;  5BPM A;  4FPA A;  4JYA K;  5GAG P;  4DQR A;  4IKF A;  2HBJ A;  1SZ2 A;  4JKB A;  1VQK N;  3AVF A;  4U7B A;  1NGF A;  5AQN A;  5KPZ A;  1Q8I A;  5JLF A;  4QS9 A;  1NGA A;  5FRM A;  4CZF A;  4FJI A;  1HYZ A;  4B9M A;  1TKX A;  2HHW A;  1Z05 A;  1LW0 A;  2KW4 A;  2HHS A;  3NGY A;  4B1W B;  3A5O C;  4ZHR A;  4FJK A;  1XWL A;  3LP2 A;  3FZK A;  3E9L A;  3NBP A;  5KI6 A;  4BRK A;  1TYQ B;  2QWR A;  4FWM A;  2CH6 A;  2E2Q A;  3C6A A;  4B3M K;  1KAY A;  4DR6 K;  3QES A;  2QKK A;  1TKT A;  3P39 A;  3E66 A;  1ILY A;  3SJJ A;  4BR0 A;  3KLE A;  3CME N;  3VQ5 A;  4K25 A;  5ADX H;  5EY4 A;  4W5Q A;  1N32 K;  1J53 A;  2XHB A;  4B1X B;  1ZYQ A;  3J7Y P;  1S1T A;  5LY3 A;  3ZSZ A;  3S3O A;  5AQJ A;  1WSF A;  2HND A;  1S6Q A;  2P9P B;  4V19 S;  4CJT A;  3JYT A;  3T69 A;  1BU6 O;  1K8K B;  4H5N A;  4CEF A;  4YOY A;  1DT9 A;  4DTS A;  1JLA A;  1UOC A;  4CK1 A;  3SUN A;  3VOV A;  3ZSV A;  1S22 A;  3SBG A;  3KZB A;  1RDW X;  5KTQ A;  3TSQ A;  1X9J A;  2KFN A;  1N5Y A;  2A6A A;  1QVF M;  4KKO A;  2R7Y A;  4HUG A;  4C8O A;  4DMN A;  1JLQ A;  5CZ1 A;  5F0X A;  3K5M A;  1IKW A;  2X78 A;  4E1N A;  5J2Q A;  3WNG A;  3T1A A;  3AVL A;  2ZD1 A;  3EZW A;  3QIO A;  4DV4 K;  4FVU A;  3SQ2 A;  4XH1 A;  1S6P A;  3NAE A;  1SL0 A;  3HPG A;  1IBM K;  1QQC A;  3P1G A;  3KWG A;  1ZBI A;  3ZSY A;  2VWB A;  4XEI A;  3KLI A;  2GEM A;  2QWP A;  3LL3 A;  4K0K K;  4BRD A;  3U3G A;  3Q7C A;  1KFS A;  3TU5 A;  5BRE A;  2Q0R A;  4DFM A;  3ULD A;  2OCE A;  3J7A P;  1EKE A;  1XHZ A;  1Z25 A;  4JN4 A;  1TKD A;  3L8B A;  5M1N A;  3RRH A;  2QWL A;  4BAC A;  3D2E A;  4IJA A;  1TAU A;  1ASW A;  2P9S A;  3NH1 A;  3EE9 A;  4CEA A;  3OHR A;  3HL8 A;  4Z94 A;  4GV3 A;  4H8K A;  3K0S A;  1RBS A;  2P9I A;  4W5O A;  3AA2 A;  3EL2 A;  2HST A;  2YJE A;  3H3N O;  4NLC A;  5GAE P;  4M63 C;  3NGZ A;  2A1R A;  4H0Y B;  4DR2 K;  4BGA A;  4BVO A;  4FO0 A;  4JAX A;  3NF6 A;  1RT1 A;  4JI6 K;  3KKS A;  3QER A;  4M7X A;  2DFH A;  3U3Y A;  4DSK A;  1NK5 A;  5HRR A;  5GAH P;  4EFH A;  4CW7 B;  3PO5 A;  3B6P A;  4CJR A;  5J1E A;  1U47 A;  3IDH A;  5FRN A;  4BG8 A;  5AQL A;  4B1Y B;  1JCG A;  3OYD A;  2YI1 A;  1WSI A;  1L3U A;  3ZET A;  4LF9 K;  2V7Y A;  4EIA A;  1C1A A;  3I8D A;  3SBT A;  4MO5 A;  3V9Z A;  3HK2 A;  3WEE A;  3S9H A;  3K58 A;  1HJR A;  3C6T A;  3P31 A;  2IVO A;  4EHU A;  1OVQ A;  1EWR A;  1S1U A;  5CE3 A;  3AY9 A;  3LAL A;  1W9H A;  3R3L A;  5AQT A;  4QAG A;  4EP5 A;  3L6Q A;  4W5N A;  3O4W A;  3OYG A;  3KK2 A;  1VQ9 N;  2YX6 A;  2QWO A;  5BR9 A;  3LZI A;  3OYC A;  1RTI A;  3ZT4 A;  3MK6 A;  1JL2 A;  3L4I A;  4DLE A;  2HHQ A;  4CFA A;  4DV3 K;  3NMU A;  4EAH D;  5HRO A;  1SV5 A;  2HVH A;  3R9P A;  3HM9 A;  1ASV A;  1T03 A;  3ZT3 A;  3K9K A;  1RTH A;  3OJU A;  3DOK A;  3KTQ A;  3CD6 N;  3PIP L;  4CJP A;  3VA3 A;  3TAQ A;  4E19 A;  1D9F A;  3U9D A;  1FKP A;  3OA9 A;  3OYI A;  2O8F B;  2HHV A;  4PKI A;  3D6R A;  1QQO A;  4B1V A;  1UAX A;  1VQ4 N;  4CEB A;  1Q81 O;  4O8U A;  4CHY A;  1LWE A;  3CIP A;  3ZLJ A;  3MX5 A;  3ZT2 A;  5AQW A;  4Z4H A;  3QET A;  1K8K A;  3AV9 A;  3S3N A;  4EZ6 A;  3K59 A;  2OZM A;  5J2P A;  4FJ9 A;  3HXM A;  2QXF A;  1FW6 A;  2DY4 A;  4A5A A;  2O8D A;  4DTN A;  4FZY A;  3H45 C;  3TTC A;  4DTO A;  3PY8 A;  1A5X A;  3HZ6 A;  4BRE A;  4CD1 A;  1NMN A;  3LDQ A;  1SS6 A;  4HCB A;  1ASU A;  1BG3 A;  1JLB A;  3AVH A;  4KHS A;  1X1P A;  1W97 L;  2V7Z A;  3ATU A;  3LWM A;  4OX9 K;  2O8E B;  3UKR A;  2HMP A;  2D0O A;  1JLE A;  4MDA A;  3W0L A;  4CBU A;  5E41 A;  4CJ5 A;  3M3Z A;  3M5R A;  2OA8 A;  3FGU A;  4EZ9 A;  1VQ7 N;  4BR2 A;  3HRG A;  3I0R A;  1VHX A;  2ZQB A;  4Y1D A;  3THY B;  3PV8 A;  1RDB A;  1FJG K;  3LAM A;  1VAZ A;  2GWK A;  3BF1 A;  2E20 A;  4FJM A;  1E3M A;  1KVC A;  1A5V A;  3LWL A;  4FW2 A;  4U67 L;  3CJ7 A;  3F73 A;  1BI4 A;  4JI3 K;  3ENO A;  2IDO A;  4CZK A;  2HF3 A;  4IZ9 A;  3GE1 A;  3MDQ A;  2NRT A;  4IEI A;  3TAG A;  3OYH A;  1RT7 A;  5LL6 Z;  1YIT N;  4FCY A;  1VSF A;  2W41 A;  4ILG B;  1O13 A;  3CJA A;  5LMN K;  4DV7 K;  2GX9 A;  1QZ5 A;  4FL9 A;  3ZYY X;  3IMX A;  2UU9 K;  2O8C A;  2G8F A;  3HTV A; 
#chains in the Genus database with same CATH homology
 4H5W A;  1MDU B;  4XH4 A;  1IG8 A;  3SAG A;  3E9P A;  1TUY A;  2GEL A;  4JD2 B;  4BRG A;  5BRH A;  5AZJ A;  1EO1 A;  3WQT A;  5CR4 A;  4QS7 A;  5C12 A;  4OPH A;  4Y0W A;  3ID6 A;  5FPM A;  4BR9 A;  3FZH A;  2P9U B;  3N4P A;  3O9Q A;  4ISG A;  4HTL A;  3G25 A;  1NJI O;  2QA4 N;  1U2V A;  3FZL A;  5M1P A;  3MWP A;  4GVE A;  2J4R A;  3LDN A;  5JIC A;  1NMD A;  2E2N A;  3I8B A;  3BP8 A;  1ATN A;  1HX1 A;  3L0Q A;  1QVG M;  3F2K A;  1T44 A;  5EVZ A;  4FOI A;  5AQX A;  3MN9 A;  5BN8 A;  3GDQ A;  5LJV A;  3CI5 A;  3QDK A;  5HOO A;  2I7P A;  4NO7 A;  4BGB A;  1HPM A;  3QFU A;  3K9J A;  4FWP A;  3W3D A;  3AAP A;  5FPE A;  1QHA A;  3P38 A;  1VQL N;  3D2E B;  3CF5 L;  2E1Z A;  3G6E N;  3VEO A;  2NRV A;  3M6G A;  5BPL A;  5GAD P;  2RHK A;  4K42 A;  4FWL A;  3FR0 A;  3UE5 A;  4JKG B;  3VGK A;  3UKU A;  3CQX A;  3FE1 A;  3NVK A;  3LM9 A;  1GLD G;  1SQK A;  3OW2 M;  1MWK A;  3A5L C;  2VGM A;  1V4S A;  4CI6 A;  4KH4 A;  4RWT A;  2IVP A;  3FZM A;  1Q18 A;  3O9U A;  3O9T A;  4CBX A;  3C7N B;  3A5M C;  4DQ8 A;  4UY8 O;  2F7T A;  2PBD A;  5AR0 A;  3ULE B;  3CER A;  3QML A;  3VEW A;  1YJW N;  2HBL A;  4AF1 A;  4B9Q A;  2P9U A;  4M7Y A;  2BTF A;  3BUZ B;  4JKF A;  4J8F A;  4R79 A;  3SJH A;  1NGC A;  3H1Q A;  3CCS N;  3GOI A;  1NBW A;  3ZEU A;  3CHW A;  3VEV A;  2KKZ A;  5KQ8 A;  3MN5 A;  2ZJR L;  1ZXO A;  1VQ6 N;  2P9L B;  1VQN N;  4PL7 A;  1C0F A;  2E1Y A;  3DXK B;  5MLC Q;  1YI2 N;  2QW9 A;  2NRX A;  4XH5 A;  4H5V A;  3O80 A;  3C0B A;  4DCH A;  4G9Z A;  4H5R A;  1T3V A;  2QTD A;  5ELZ A;  4WF9 L;  1BOT O;  4A5B A;  4GV6 A;  5GIP A;  3CCJ N;  1P90 A;  5E26 A;  3O9R A;  1KQS M;  1LOT B;  1NLV A;  1X3N A;  3R6M A;  1E4G T;  4GNI A;  5JLH A;  3CCV N;  4BRQ A;  1KD1 O;  2HF4 A;  3H3O B;  1D4X A;  3MCA B;  5C2D A;  3BEX A;  1ZBS A;  3O1B A;  2PFU A;  4YOV A;  5AQP A;  2QWN A;  4H5T A;  4BRC A;  3LDP A;  4JKG A;  4JNE A;  3WXM B;  3C6H A;  1GLE G;  1HJO A;  4MLE A;  1M1K O;  1ZC6 A;  4CZI A;  1YF5 L;  3F5T A;  1GLL O;  3I33 A;  4JK8 A;  4JEP A;  5BPM A;  4DKW A;  4RTF D;  4FPA A;  5C2F A;  1XC3 A;  4YDU C;  2QXL A;  2AP1 A;  2VYP A;  3HI0 A;  5GAG P;  3R1X A;  1BA1 A;  2CGJ A;  3OBW A;  3F9M A;  4BR5 A;  2HBJ A;  3C7N A;  1SZ2 A;  5B8H A;  4JKB A;  1VQK N;  3J8A A;  4YOX A;  1SAZ A;  3D2F B;  4U7B A;  2Q36 A;  1BA0 A;  1HUX A;  2WBN A;  1NGF A;  2ASP A;  4O5F A;  1GLF O;  5AQN A;  1KAZ A;  1NGH A;  2KHO A;  3DWL A;  5KPZ A;  5JLF A;  2D1K A;  3M1F A;  4QS9 A;  3U9Z A;  1NGA A;  1NGJ A;  4FWO A;  4CZF A;  1YAG A;  3R8E A;  1VQP N;  2P9L A;  3HOT A;  2IIR A;  1Z05 A;  3DXK A;  4BR7 A;  1Q7Y O;  4B1W B;  3A5O C;  5AQK A;  3WXL A;  4RCH A;  5DM6 L;  4IOA L;  3FZK A;  5JVG L;  1MA9 B;  3E9L A;  4BRP A;  4CBW A;  3TTF A;  4BRK A;  2FF6 A;  3VES A;  1TYQ B;  4WYB A;  2FSK A;  2QWR A;  3WXJ A;  2DPN A;  2CH6 A;  4FWM A;  2E2Q A;  4CZG A;  1Q82 O;  4JK7 A;  2CGL A;  3RVC A;  3DXM B;  3AGR A;  4CJ7 A;  3C6A A;  3C65 A;  5JMV A;  1KAY A;  4I6M B;  1S3X A;  3SMP A;  3IUC A;  4DB3 A;  3KVG A;  5F1X A;  2D4W A;  2NRR A;  3E66 A;  3P39 A;  5BRD A;  3VEY A;  1ILY A;  3QBX A;  3ZX3 A;  3HBT A;  4BR0 A;  3LM2 A;  3VET A;  3CME N;  4ILJ A;  4K25 A;  5ADX H;  5EY4 A;  3VF4 A;  4B1X B;  2ZF5 O;  3O9S A;  3EKS A;  1BWF O;  2KLA A;  5LY3 A;  4BRN A;  4BVP A;  2IVN A;  2ASO A;  1T6D A;  4IOX A;  3DLL L;  3CCQ N;  2FSJ A;  5AQJ A;  3QFP A;  4JK9 A;  3QB0 A;  4YOU A;  1OKJ A;  2P9P B;  4FSV A;  4IDH A;  4B1Z A;  2Q31 A;  1YJN N;  3CJC A;  1VQM N;  2I7N A;  1HLU A;  3H46 O;  5AQR A;  5GIN A;  1YVN A;  2ZGZ A;  3U8X A;  3T69 A;  1BU6 O;  1M90 O;  1K8K B;  4H5N A;  3ENH A;  4FWK A;  5HL7 L;  4YOY A;  2BUP A;  1DT9 A;  2VCP A;  4ILH A;  2P9S B;  4JKA A;  2HBK A;  2W40 A;  3VOV A;  3WUH A;  1LCU A;  3MN7 A;  3S41 A;  3VER A;  1S22 A;  2V52 B;  3SBG A;  3KZB A;  1RGI A;  1VQ8 N;  1RDW X;  2EWS A;  2Q2R A;  2P9I B;  3TSQ A;  1X9J A;  1EQY A;  3O5B A;  3H6E A;  2A6A A;  3KWI A;  4H0X B;  5AZI A;  1VQO N;  1QVF M;  3HOS A;  3CCM N;  2P9K B;  1TYQ A;  4B1U B;  5F0X A;  5H1S Q;  4BQL A;  1NGE A;  1WOQ A;  4BC4 A;  1HKG A;  3DJC A;  4PKG A;  4JD2 A;  3EZW A;  3HSC A;  3VEX A;  1VQ5 N;  4FVU A;  5LJW A;  2E2P A;  4I6M A;  2QWM A;  4XH1 A;  5M1O A;  2NRH A;  1IJJ A;  1ESV A;  3KK7 A;  3KWG A;  2JWL A;  4KH6 A;  1GLC G;  3A5N C;  2P9N B;  3O1W A;  2VWB A;  4XEI A;  2GEM A;  2QWP A;  3LL3 A;  4CZE A;  1KAX A;  5M1Q A;  4BRD A;  3FZF A;  3Q7C A;  2PAV A;  4H0V B;  3VMF B;  3TU5 A;  2GTD A;  5BRE A;  2Q0R A;  3JXU A;  5TKY A;  2YHX A;  2E88 A;  3GBT A;  3AAQ A;  3QIC A;  2P9P A;  4JKH A;  3ID8 A;  4YOT A;  4JN4 A;  5FPN A;  2YHW A;  1NWK A;  5M1N A;  1W2B M;  2QWL A;  1DEJ A;  3ZET B;  3D2E A;  4IJA A;  2P9S A;  1G99 A;  1GLA G;  3VTH A;  5AFU A;  5KPR A;  3WT0 A;  2A3Z A;  3EE9 A;  3OHR A;  4A62 A;  4MO4 A;  4Z94 A;  5EXW A;  2H3G X;  1MWM A;  3HM8 A;  4AM6 A;  5AQS A;  4GV3 A;  1HKC A;  3TSP A;  3WEE B;  2P9I A;  4C23 A;  3QBW A;  4IXC A;  1QZ6 A;  3RSE B;  3EL2 A;  3CPW M;  3CET A;  4WCE L;  2HST A;  2YJE A;  4FOE A;  1C0G A;  3H3N O;  1JCE A;  2Q1N A;  3CJ1 A;  4NLC A;  4M63 C;  5GAE P;  4IO8 A;  3AGK A;  2VGN A;  3IFR A;  4H0Y B;  4BGA A;  4BVO A;  3SAH A;  3A8Y A;  4IJN A;  3A0I X;  4FO0 A;  4JAX A;  3PIO L;  4BRI A;  3CC4 N;  1DGK N;  3ULE A;  4IO9 L;  1HKB A;  1P8Z A;  2A42 A;  3T7Z A;  3VEN A;  4M7X A;  2GUP A;  1QQN A;  4BRL A;  4A59 A;  4WFA L;  5E84 A;  5F2R A;  3EKU A;  3NVM A;  4MLH A;  4C1N K;  4EFH A;  1NGB A;  4IWV A;  5AQQ A;  5GAH P;  1NGD A;  3G71 N;  3IDH A;  5JVH L;  2WC9 A;  4AM7 A;  4BG8 A;  3CCR N;  5AQL A;  4B1Y B;  5BPN A;  1JCG A;  3E9O A;  5BRF A;  4OO1 J;  2RE2 A;  5TKW A;  4KBO A;  5C15 A;  1V4T A;  2V51 B;  1YXQ A;  2YI1 A;  3CPE A;  4ISF A;  4O8K A;  3O6W A;  5EX5 A;  1Y64 A;  3B8A X;  3DAW A;  3ZET A;  1NM1 A;  2V7Y A;  4EIA A;  4FWN A;  3TPQ A;  1Z6R A;  3CQY A;  1R59 O;  1XQS C;  2FF3 B;  4YDU A;  3MX2 A;  4WFN L;  4LC9 B;  2YJF A;  1H1V A;  4L3Q A;  1YHQ N;  3SBT A;  3CXC M;  4MO5 A;  4BRM A;  2F9W A;  5EOY A;  4OPA A;  3WEE A;  3WQU A;  4JHD B;  4WQ4 A;  2F9T A;  3P31 A;  4BC5 A;  2IVO A;  4EHU A;  2YHY A;  4FWQ A;  2QM1 A;  3LDL A;  1BDG A;  1T6C A;  5AQH A;  5CE3 A;  4CZJ A;  3AY9 A;  2CGK A;  4WQ5 A;  3WXK A;  3PLA A;  3D2F A;  3VPZ A;  4H0O A;  2HOE A;  3R3L A;  4WFB L;  1QQM A;  2FLO A;  5AQT A;  1JCF A;  5AQY A;  3E1Y A;  2HBM A;  3L6Q A;  2Q0U A;  3CJB A;  3O4W A;  1ATS A;  2ASM A;  1YIJ N;  2YX6 A;  2QWO A;  5BR9 A;  1VQ9 N;  4A61 A;  3ZX2 A;  1GLJ O;  3AAR A;  3MMV A;  3EN9 A;  3ZEU B;  1DKG D;  2NZT A;  4FWR A;  1Q86 O;  2NRZ A;  4DHY A;  5FPD A;  3VF2 A;  3MK6 A;  2FSN A;  3L4I A;  4QS8 A;  3SLC A;  3SAF A;  3NMU A;  4EAH D;  3KHY A;  3I56 N;  3BF3 A;  4BG9 A;  2ZJQ L;  2NLX A;  2A40 A;  3MCP A;  4PHT X;  3R9P A;  5M1F A;  3GL1 A;  3K9K A;  5DM7 L;  2E8A A;  4BR4 A;  3CC2 N;  3CD6 N;  3PIP L;  4NLB A;  4CZH A;  4EHT A;  3DXM A;  1S72 N;  4BC3 A;  5I9E B;  1K8A O;  1K9M O;  3U9D A;  4BRO A;  3OA9 A;  3SK3 A;  4A2A A;  3UKR B;  4JHD A;  4A2B A;  4BQZ A;  4PKI A;  3J7Z O;  2CH5 A;  3D6R A;  3O08 A;  4BRF A;  5KPT A;  1N8R O;  1QQO A;  5AQO A;  4B1V A;  1VQ4 N;  2YCH A;  2OTL N;  3VGL A;  2ZWH A;  3VGM A;  1NGI A;  5C10 A;  4IOC L;  4O8U A;  1Q81 O;  2D0P A;  5AQM A;  3CIP A;  4JKD A;  1BUP A;  1JJ2 M;  3N4Q A;  3Q7B A;  3MX5 A;  2A41 A;  1TUU A;  2AA4 A;  3OBY A;  5AQW A;  4FWS A;  5AQG A;  1K8K A;  4CZL A;  4H0T B;  5AQZ A;  1RFQ A;  2GWJ A;  2E2O A;  2UYT A;  4C1N I;  3CCL N;  4H0P A;  4ISE A;  3TTD A;  3TSU A;  5AQU A;  4A5A A;  1U6Z A;  2Q97 A;  4MDB A;  4PKH A;  4E1J A;  3FLC O;  3MWT A;  1X3M A;  1NGG A;  5M1K A;  3H45 C;  3TTC A;  1RDU A;  2FXU A;  2A5X A;  4YOW A;  3MN6 A;  3CMA N;  1BO5 O;  1XUP O;  2P9K A;  1CZA N;  3HZ6 A;  4BRE A;  4CD1 A;  3L4Q A;  2QI2 A;  3JS6 A;  3LDQ A;  1SS6 A;  3P4I A;  5GIO A;  4A57 A;  2NRW A;  3H1V X;  3VTI A;  3CC7 N;  5KQD A;  2ITM A;  1BG3 A;  5AQI A;  5AZJ B;  5ADX A;  4BRH A;  4F9O A;  4YOR A;  1W97 L;  2V7Z A;  3ATU A;  3ZX0 A;  3IKM A;  4GY2 B;  3UKR A;  2HMP A;  1U2V B;  2D0O A;  2P9N A;  2WFB A;  4MDA A;  1OVY A;  4KH5 A;  5AQV A;  3W0L A;  4CBU A;  2ZJP L;  2QWQ A;  3WXI A;  1J6Z A;  2NNW A;  3M3Z A;  3M5R A;  3FFK B;  4HWI A;  4BY9 C;  3FGU A;  4FPB A;  1VQ7 N;  4BR2 A;  3HRG A;  4CD3 A;  4IFE A;  1YUW A;  4JKE A;  4BRA A;  1VAZ A;  2GWK A;  3BF1 A;  2E20 A;  4NB4 A;  1KXP A;  2JWK A;  3GG4 A;  4K43 A;  1ATR A;  3UB5 A;  3U4L A;  5CHI A;  4U67 L;  4GV9 A;  1WUA A;  3D7E O;  3LDO A;  4WQ4 C;  2ZGY A;  4K41 A;  3CJ7 A;  3G4S N;  1KC8 O;  5AQF A;  5C0Y A;  4BC2 A;  3VF6 A;  3ENO A;  3EO3 A;  3CCE N;  1E4F T;  3SMS A;  4CZK A;  2BH1 A;  2HF3 A;  3ATV A;  3I55 N;  4H03 B;  4IZ9 A;  3CCU N;  3GE1 A;  3CJ9 A;  2NRT A;  3MDQ A;  4IEI A;  4WQ5 C;  4PL8 A;  1YIT N;  3UKU B;  2OAN A;  1YJ9 N;  3RSE A;  2W41 A;  4ILG B;  1O13 A;  2WUS A;  3CJA A;  4IEE A;  2GX9 A;  5BN9 A;  1QZ5 A;  5AFU H;  4FL9 A;  5AZI B;  3EE8 A;  3ZYY X;  2QEX N;  3IMX A;  3ENB A;  3O8M A;  4CZM A;  1K73 O;  1GLB G;  3VEZ A;  2OTJ N;  4JKC A;  3HTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...