5M1QA

Crystal structure of the large terminase nuclease from thermophilic phage g20c with bound zinc
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
186
structure length
171
Chain Sequence
NSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGINYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYGHDDIVMSLALAYSQYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Viral genome packaging terminase cleaves DNA using the canonical RuvC-like two-metal catalysis mechanism.
pubmed doi rcsb
source organism Thermus phage g20c
molecule tags Viral protein
molecule keywords Phage terminase large subunit
total genus 58
structure length 171
sequence length 186
ec nomenclature
pdb deposition date 2016-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.240 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5m1qA00
3CPEA 3C6HA 5M1KA 3C6AA 5M1PA 5C2DA 4IFEA 5M1OA 5C10A 5C2FA 5M1FA 5M1QA 5C12A 4IEIA 4IEEA 5C15A 4IDHA 5M1NA
chains in the Genus database with same CATH superfamily
1JLBA 5AFUH 4BREA 4OPHA 2ZJPL 1V4TA 1S9GA 2IC3A 3A5MC 1QQNA 4C8OA 2JWLA 3AO3A 2CGKA 2RPIA 3C7NB 5GIOA 4IFEA 4YHHK 2J4RA 4PKIA 4L8RB 4AILC 1S1WA 3I0SA 1LWFA 1D5AA 4DV2K 1J5OA 4JK9A 1BL3A 5AQQA 4FJKA 3CJ9A 3O9TA 3S3OA 3AO2A 4DR1K 4LFBK 2I7NA 3C94A 4O8KA 2HHSA 3RSEB 3ZX3A 3SI6A 2VQEK 1JXBA 3LP0A 1DT9A 3VEWA 4FWNA 1K8KB 4JI4K 4BWMA 4CZKA 3CXCM 4MO5A 3LWLA 3CC4N 2YHWA 3MCAB 5KI6A 4KRFA 4EAHD 1ZBSA 4O0IA 3WEEB 3NMUA 4K8ZA 4HTLA 4KPYA 5KPTA 3H3NO 1T03A 1KRPA 4JLHA 4GNIA 4B9TA 1JL2A 3KLIA 4WFNL 4WQ5C 4HWIA 3SPZA 3OYNA 4C8NA 1UA0A 4OLAA 3BGRA 5AQWA 4LSLA 3OYEA 2IS3A 3C6TA 4CGFA 3SMSA 3SAFA 4A57A 4DTNA 4ID5A 3TARA 4DHYA 1U47A 1NK0A 1FJGK 3V1OA 2F9TA 5EOYA 1NWKA 1DLOA 4DFPA 1DGKN 1BIZA 1RDAA 4JK8A 1JLCA 2QWQA 2Z1IA 4LF8K 2ZM6K 1VQ9N 3DWLA 2EWSA 2CH5A 2V7ZA 4CIGA 1BWFO 3KWIA 4J2EA 1SZ2A 1WSJA 4EHTA 4FZZA 2HHTA 2OTJN 1G99A 3TTCA 4JI1K 4CERA 2O8CA 3IS9A 2VG7A 4C1NK 4YOWA 4DU3A 1S22A 1NK4A 4YORA 4CE9A 1V4SA 4FWPA 5BR8K 1HKCA 3O9QA 3VMFB 1E4FT 2I7PA 1WBDA 3ALYA 1Z05A 3AY9A 1Y97A 3GBTA 1VK0A 2FF6A 4H0XB 3FFIA 3KVGA 4CF8A 2KTQA 3RMDA 4BRMA 3KLEA 1JLQA 5C12A 4JI0K 4WQ5A 2HVIA 3K5NA 2P9PA 4CBUA 4JKGB 4IDKA 2PYLA 3M5RA 3AVJA 4JV5K 4CK3A 3P1GA 1SQKA 3OYBA 2ETJA 4BRPA 1A5XA 1IBKK 1VAZA 4BY9C 1WSIA 4FSVA 1J6ZA 2O8BB 4FK0A 2XY7A 2UUCK 2IAJA 3HSTB 5AQZA 2X6SA 4RW8A 4PY5A 2HBMA 3MEEA 4F3OA 4V19S 2O4GA 2QWLA 1RNHA 1KCFA 3AVKA 3OA9A 2GBZA 4RW7A 4BE0A 4FWOA 2OTLN 1JXEA 1WAFA 3QICA 3OYFA 3UKUB 4DTRA 4LFAK 3I8BA 4DTJA 3I0RA 4KHWA 4U7BA 5IWAK 1NGBA 4JRPA 4BR2A 2UYTA 3FZFA 4CI6A 4CBXA 3L2UA 3ENOA 3QESA 3EZWA 5CHIA 3SYZA 1O13A 5AQSA 1TAUA 4DSJA 4CJ4A 4JKCA 2P9KB 2QI2A 3TSPA 5KQ8A 3ZSQA 2IGIA 2P9LB 1EQYA 2P9IA 2FXUA 2EHGA 1HJOA 3QFUA 4YOXA 3RVCA 4JI3K 3VQ9A 5J2NA 4BVOA 3QBXA 3VENA 2G8IA 4CEDA 1ILYA 2PFUA 1BU6O 1N32K 2G8HA 4FJ9A 2QK9A 4KREA 2CH6A 4WQ4A 1HPMA 2Z1JA 1HUXA 5AR0A 4DLGA 2O8DB 4JS5A 2QXFA 4YDUA 4BDPA 4C8LA 3CERA 3O4NA 1HQEA 3VQDA 2YX6A 4BROA 4K41A 3THXB 3ZT0A 4FK4A 4DMNA 4Q0BA 3ZYYX 3NAEA 3H45C 1RTDA 3H3OB 3NGIA 2BE2A 1GOAA 1WSEA 4B8CA 2G8KA 3HK2A 3FZLA 1XMQK 4QOZB 4CF2A 4IFYA 3AVCA 4JI8K 4NYNA 4XH5A 4FLVA 4DQQA 5M1QA 3CC7N 1HQUA 3A5LC 5AQNA 4FCYA 2O8FB 3TAFA 3K5LA 1YTUA 3VF2A 4AM6A 4FOIA 1MWMA 4FPBA 3QO9A 4O0JA 3GDQA 4H0PA 1S3XA 3GG4A 1D8YA 2H3GX 3T1YK 2UXDK 3VESA 4B9MA 4L3QA 4BACA 3HPGA 4GV9A 1YVUA 3K2PA 5FRNA 4IG3A 3EZ5A 1ZYQA 3O9SA 2AA4A 2NRVA 5AQOA 5AQLA 4MDBA 3NGYA 4BE1A 3QEXA 2QWPA 2V51B 3R1XA 1J9AA 3I56N 4W5TA 3C65A 3ZX2A 3RMAA 2F8TA 2YNIA 4CF9A 4ILJA 2WONA 1EP4A 3KTQA 3P83D 1MDUB 2QEXN 3NBPA 5GAHP 4FOEA 4DSIA 2BTFA 1NKEA 5KQDA 5JS1A 4IKFA 3PIOL 4BGBA 3OYIA 5ADXA 3WXMB 1GOCA 4FJNA 3V6DA 3HVTA 3OYLA 5AQMA 3MCPA 4BVPA 4CHOA 3OS2A 3E01A 3L4QA 2YHXA 1HNXK 4I2PA 1NGGA 1S1VA 3SJHA 4F4KA 4RG8A 5FPDA 3QEWA 4FW2A 4BC3A 3AVMA 3A5OC 3QDKA 1NLVA 4CJRA 3H1QA 4FJ5A 1VSHA 3ENBA 4A61A 3SPYA 3B6PA 4DSFA 1P8ZA 4GVEA 1Q18A 4FWKA 5AQUA 3ZT1A 3PUFA 3TANA 2E2QA 1NBWA 3IKMA 3CCMN 2F9WA 4CGHA 2YKNA 3BZKA 2A41A 3ID6A 3CFOA 3QIOA 1NJYA 3PV8A 4PL7A 3THYB 3U4LA 3CQXA 4CJPA 4NCGA 1FXXA 3HL8A 2HHHK 1RTIA 4MQ3A 4CZMA 4Z94A 4DWIA 3LM2A 4DQIA 3KLHA 3VQ5A 3R9PA 4KB1A 4O55A 2BH1A 3FLCO 4G9ZA 1MA9B 1N33K 3FFKB 4RWTA 1QTMA 1YITN 4H4MA 1NK8A 2ATQA 2KFZA 2X6NA 4IJAA 4M7XA 2D0OA 4IJNA 1U4BA 5KRSA 1BA0A 3O1BA 4GV6A 1NOZA 4PKGA 2QWOA 1XUPO 2PAVA 5J2PA 1LWEA 3VEOA 4IOCL 4FLTA 3OYAA 1NJZA 2GX9A 3DI6A 2IDOA 1NJWA 1VQ5N 3WEEA 3A5NC 5AQHA 3SQ4A 4FJJA 2QKBA 5E84A 1T05A 2E2PA 4HUEA 3E9LA 2YHYA 3DYAA 3OW2M 4PL8A 2HVHA 2NRZA 1WUAA 2WTUA 1X9WA 4DU1A 1KD1O 2E2NA 2G8FA 1S1TA 3OTOK 4M63C 4ZTJA 2WFBA 3HVRA 4KHSA 3CM5A 3IDHA 1QVGM 1KXPA 1RT5A 3ID8A 3VQ7A 4A5AA 3D2FB 1TAQA 2QM1A 4X62K 1ATSA 3CCJN 2NRRA 1C0TA 4ZHRA 4DF4A 3CYMA 4QS8A 5D3GA 3VETA 5CZ2A 1HR0K 4M3UA 1ATRA 4XH1A 3K9KA 1QSLA 1TV6A 3CI5A 3M8QA 1QHTA 3UKRA 4CGDA 4DS4A 2P9UA 3KK2A 1XNRK 3LP1A 5AQJA 4R79A 3QINA 4YOTA 4CZJA 1RT3A 1ITGA 3K5OA 3MWPA 1VQLN 2FBVA 4C1NI 4FJXA 4LF5K 1K9MO 3CHWA 3HOSA 4LD0A 3HM8A 3SV3A 2FSNA 2P9SB 2VG5A 3KZBA 5F2RA 1IG8A 3CF5L 2EX3A 4YDUC 5SWMA 3K57A 5BRDA 3FGUA 4CJWA 3TABA 1CXQA 4CECA 2V7YA 4DFMA 4LH4A 1RDCA 3MEGA 1U49A 4M3XA 2O8CB 5AQVA 5AQRA 4H0VB 2VQFK 4E7JA 4Z4FA 1EXQA 2B6AA 1NM1A 3TWHA 1IBMK 1NMNA 1NK5A 4B1WB 1EETA 1YHQN 2XY6A 1EKEA 4HCCA 4JI6K 4EHUA 2VYPA 3U9DA 1BUPA 4BRLA 2JLEA 1QZ6A 4I7FA 1QSYA 3FZMA 2VGNA 4BRNA 1TL1A 4CK1A 1VQ8N 1NMDA 4JNEA 4DF8A 4CEFA 3E1YA 3D7EO 2ZWHA 1TYQB 4KBOA 4CEOA 2DPNA 1BI4B 4CFAA 3K59A 1XQSC 1LWCA 1WAJA 3LDLA 1LAVA 4JD2A 2ITMA 3WXIA 3QEVA 1UA1A 3I8DA 2PY5A 3PY8A 4PUOA 5CY4A 2F4VK 1X3MA 2P1JA 4K25A 4AQYK 4NCAA 2HSTA 1FW6A 3HSCA 4NO7A 3SAHA 1S5JA 2OZSA 2D4WA 3EYZA 4HUFA 5C24A 3VEYA 5HRPA 4KHYA 4H5RA 3ZEUA 5GIPA 3HO1A 1SL0A 4FLXA 4CZEA 4DSKA 3EL2A 3SBTA 3EY1A 3CPEA 3RR8A 4WE1A 1Z26A 1NNEA 1KAYA 4CGIA 2A1SA 2W41A 4M3RA 1LCUA 3T69A 1YF5L 3D2EA 3DLBA 2Q0UA 2O8FA 3L2VA 1X9MA 3VA3A 1KFDA 4BR9A 4IEEA 4A2AA 4FWMA 4WYBA 4FXDA 4CW7B 4HVJA 4CEZA 2YNFA 4FWSA 1XHXA 1GLJO 3AGRA 2E1ZA 4B1XB 1VRUA 3EO3A 3F5TA 1KVCA 3OYCA 2O8EB 1BIUA 4H5TA 1QVFM 3PX4A 2WOMA 3V9WA 2ASOA 4IBNA 4DR7K 4BRIA 3JS6A 5KRTA 2Q3SA 5EU7A 1OVQA 4X65K 3HPHA 5F0XA 3AO5A 3SK3A 2YI1A 1P90A 1TKDA 3WNHA 1GOBA 4DTXA 2RE2A 3M6GA 4M7YA 3LANA 3MECA 4JKGA 3NHGA 1TVRA 1Z25A 3QB0A 3O08A 3VN5A 4B1YB 3C6UA 1TGOA 3NF6A 3E66A 4CFCA 3SQ2A 3KWGA 3MEDA 4I6MB 2HHQA 2X78A 4CHZA 3LAMA 5CYMA 2O4IA 2ASPA 1ATNA 4CJKA 1SS6A 3B8AX 3O9RA 1U6ZA 3O9UA 5A2QO 4BC4A 3L4IA 3H46O 3AO4A 2IVOA 4B3MK 2GEMA 2VWBA 4B9LA 3DLGA 1KAZA 1IJJA 2P5OA 1RBUA 3ATVA 4DR4K 4H0YB 4W5OA 2D0PA 5EVZA 3NVMA 3MK6A 3RR7A 1K6YA 3MWTA 1NGHA 2NNWA 4PA1A 4K0KK 3SUNA 3WQUA 2QW9A 4WQ4C 1VQKN 1ZBIA 1VQNN 1E3MA 5KPZA 3M3ZA 1U48A 2D1KA 1ZBHA 3UB5A 1SKWA 1L3TA 1SL2A 3TI0A 4DV7K 3MXIA 4E7KA 1HPZA 3TTFA 5M1OA 3TSQA 4E0DA 1RBTA 3SZ2A 5FPEA 1BG3A 1K73O 1C0MA 3O80A 4DQRA 4FZYA 4E1JA 2FBYA 1VSFA 3LPUA 4CHNA 1WLJA 2VG6A 4OJRA 3RTVA 5AFUA 2NUBA 4N5SA 4BE2A 5I42A 3VF4A 3BY5A 3M1FA 3RMCA 3KHYA 1IKWA 4XIUA 4BRKA 3G0ZA 2ZD1A 3FZHA 3UKUA 1UOCA 1IV0A 4DV4K 1VHXA 3AVAA 1TUYA 2A3ZA 2OA8A 2NLXA 4JI5K 5HROA 3NFAA 4BR0A 3MN9A 4LF6K 5JLHA 3BF1A 3KD5E 3O5BA 3AAPA 1QSSA 3F9MA 1JKHA 4BRAA 3MX2A 3CJCA 5CZ1A 3ZETA 1JJ2M 2KLAA 5EY4A 1RGIA 4BRGA 3QFPA 4IXCA 3LAKA 4RTFD 4DSLA 3C0BA 5LMUK 4AHTA 1D9DA 2DTUA 3T7ZA 1VSDA 4M41A 3VQEA 3TR8A 4NYFA 4KFBA 3VF6A 1L3VA 2NRTA 3PIPL 1KAXA 4JN4A 3CQYA 3KLGA 5GADP 4CIEA 1XMOK 4B3TK 4XEIA 4YOUA 2UUAK 3U3YA 1GLEG 5AQFA 4CGGA 4A62A 4B9QA 4GMJB 1XC9A 4LSNA 3TTDA 3QEIA 2XO7A 1BCOA 1ZXOA 1K8KA 3IFRA 1QS4A 3NE6A 2ZGYA 4KTZA 3KLFA 3R8EA 4KTQA 1TYQA 5AQXA 3KIOA 3BEXA 2BGGA 4CEBA 2A40A 3L3UA 1L3SA 3ULDA 3RSEA 3AVNA 1KVBA 2Q31A 1EO1A 1I39A 1LOTB 1KTQA 5AQPA 3WXLA 5BN8A 5HLFA 5CE3A 3ZEUB 1NK9A 4CJSA 3HJFA 1L3UA 3PO4A 4OPJA 4DUYK 1T8EA 2HOEA 3KK3A 1X1PA 2HMIA 1EWQA 2F96A 5AQYA 3K9JA 4KHQA 2FBTA 3Q7CA 1UAXA 3PSFA 1S1UA 4Z4HA 4IOXA 4FJLA 3M8PA 3DRRA 1IBLK 3P5JA 3QNOA 4LF4K 3TPQA 3VEZA 3HBTA 1OH6A 1RCHA 3SQ1A 1RDDA 3OS1A 1M90O 2W6KA 4ELUA 4H5VA 2HNZA 3ZSVA 3MDQA 4DB3A 4KHUA 3CMEN 3TAGA 2VWJA 3VTHA 4OLBA 1VSJA 3DJCA 5M1KA 3HXMA 3HZ6A 3M8SA 2ZQBA 2G8UA 3NH1A 2V52B 3DXMA 1JCEA 4NLBA 3L2WA 2HMPA 4N56A 5AQKA 2D0BA 2OANA 5EXWA 4W5NA 2HF4A 5H1SQ 3HTVA 1WNSA 4JD2B 5AZIA 5C15A 2KZMA 1NG9A 2FF3B 4IOAL 3T19A 4NXMK 4B9NA 4BRDA 4B1UB 2GELA 5J2MA 2UU9K 3JSMA 2KFNA 4W5QA 3CCEN 4O4GA 4OVLA 5JVHL 5KGWA 4JRQA 3IMXA 4OGEA 4H0TB 4CESA 3NCIA 2HHWA 4JHDA 4FWLA 3RRHA 4H5NA 3LPTA 1RT1A 3OBYA 1HKBA 2YCHA 4DV0K 5LJWA 4J2AA 3LDPA 4E89A 5C10A 5KTQA 3VPZA 2LSNA 3C7NA 1TK5A 1G15A 2NRHA 4J8FA 2B5JA 1YIJN 4CJ5A 4U67L 1C6VA 1BI4A 4DQPA 4E7LA 3N4PA 1BCMA 3V9ZA 2NRWA 3T1AA 3SV4A 3PO5A 4IWVA 4H5WA 1JL1A 4DKWA 4NXNK 4CD3A 2QKKA 1WB9A 1QHAA 3W0LA 5IT9O 3ZX0A 4JKBA 2PZSA 5AQIA 3PX6A 3VGMA 4DTSA 1BHLA 2E6LA 4BDZA 5BPLA 3VTIA 2OZMA 2QWRA 3WNGA 4MDAA 4FJ8A 1F21A 3J80O 1IKXA 3UIQA 3K58A 2A5XA 2HBJA 1C1AA 4UY8O 3ATUA 3U8XA 3ZSYA 3C95A 4DTUA 1CZ9A 5AZJA 3OYJA 5HP1A 1EX4A 2A42A 3SBGA 1TKZA 4AF1A 1BA1A 4RW6A 5KPRA 4LH5A 1TKTA 4QS7A 1TKXA 1KC8O 3E9PA 5BRFA 4DV6K 3C6AA 3AA5X 1T3VA 3V9XA 3E9OA 3LP2A 4M3YA 1IO2A 3NF8A 4PQUA 2HNYA 3P38A 4Z4CA 1A5VA 3K0SA 3WQTA 4H4OA 5ELZA 4PWDA 4AHVA 4B3RK 4I2QA 3LZIA 1N34K 3G25A 4CJ3A 4CHYA 3VERA 2P9NB 3LP3A 4HUGA 2Q1NA 1BOTO 4BDYA 1MWKA 1HKGA 1VQPN 2QXLA 1NJIO 1C1BA 2W40A 1OH8A 4A59A 4CIFA 4JEPA 1U45A 1FKOA 4Q5VA 4FM0A 3J8AA 4DLEA 3J7ZO 3LWMA 3CFRA 1YI2N 4IG0A 1RT7A 1WSHA 1SAZA 3O3GA 4JS4A 1ASVA 1HJRA 4DUZK 1RBSA 3DOKA 4JYAK 2XRIA 3OJSA 4LC9B 1HX1A 3G71N 4JK7A 1KLNA 4FJGA 3JXUA 3DRPA 1ZC6A 3ULEA 4JKFA 4CEQA 2O8EA 1NGIA 2OPPA 4E19A 4BC5A 1C0GA 3BUZB 5CYQA 3HM9A 5J2QA 4IO8A 1QQMA 2ZF5O 1IKYA 5LJVA 4AHCA 4BRQA 4BRFA 3SLCA 4X66K 4G1QA 4O5FA 3M8RA 3THVA 3THWB 1JLAA 3V9SA 2E8AA 4XH4A 3CJ1A 4B1VA 1S72N 3D6RA 4IFVA 3AA3A 1GLLO 4YOVA 2G8VA 3BP8A 2E5LK 4K42A 1HYSA 3L2QA 3CG7A 3O6WA 3CMAN 4CEEA 3KK1A 1GLFO 2UXCK 4FWRA 3CFPA 2D0CA 1LAWA 4KAZA 3A0IX 4KHPK 1U2VA 3V1QA 3KJVA 4CFBA 2E20A 3CCSN 1NGCA 4ID1A 1KVAA 3ZT4A 1HYZA 4WFBL 2Q2RA 2OPQA 3KK7A 1RILA 4KHNA 4ELVA 4MFBA 4CZHA 3V4IA 3V9UA 1R59O 4M3TA 2FC0A 1RT2A 3SCXA 3F2KA 3H1VX 1N5YA 1DEJA 3LDOA 4HTUA 1WSGA 4CZGA 4YY3K 4FVUA 1NGAA 3CM6A 1JLEA 4K8XA 3OYHA 3ISNC 3CD6N 1SKRA 4LY7A 4CZLA 2VWKA 3QETA 2KW4A 3UE5A 2D5RA 3VQCA 3OS0A 4CJTA 1K8AO 1RT4A 4W5RA 1J5EK 5HOOA 4J2DA 5I9EB 3R3LA 4YFUA 5HBMA 4IDHA 1Y64A 4CJFA 1N8RO 4O5BA 4R5PA 2I5JA 4KB0A 4EP4A 4DV1K 3OYMA 3VEVA 1XI1A 4I6MA 4DTPA 4ELTA 3NH2A 3MX5A 1O1WA 3OYKA 1N6QA 4DR6K 2HHXA 1YXQA 4BG9A 4CJQA 2KZZA 3LZJA 3VA0A 4PKHA 3CCQN 1LW2A 1QQCA 1Q86O 4BG8A 3MXMA 3PX0A 4KH5A 3D0PA 1NJXA 3HP6A 5F1XA 4ZTFA 3AA4A 2YNHA 3CQ8A 2JWKA 3DLEA 5TKWA 2O8DA 2P9NA 1SUQA 4DFJA 1D9FA 1S6PA 4FO0A 1T7PA 1XHZA 3TU5A 2E6MA 4B1ZA 4IO9L 4DR2K 3ZCMA 4M42A 4UQGA 5M1NA 1C0FA 1B9DA 5KGXA 1FK9A 1BGXT 5BRHA 2Q0RA 1GLDG 4HHTA 2ZJQL 4LF9K 2XY8A 2NZTA 2E2OA 4GVMA 2R7YA 4O44A 1SL1A 3PSIA 5E26A 5HRRA 4CHPA 2ASMA 1JLFA 3F9KA 3IRXA 5BR9A 4M3WA 4CGJA 3OYGA 2RN2A 1I3AA 3MMVA 5DM7L 3J81O 1R0AA 3HYFA 1HNZK 3HT3A 4H0OA 4JI7K 4AM7A 4CJEA 3AARA 3SMPA 3J7YP 3RWUA 4FLWA 5BPNA 2IVNA 3EEQA 5JVGL 5C42A 5C25A 2YV0X 4JAXA 3Q7BA 3DLHA 3DOLA 4HCBA 3NH0A 2QA4N 1FKPA 1HYVA 3ITHA 4DFKA 1Q8IA 4CK2A 1X9JA 3B6OA 2B4JA 4B3SK 3G4SN 1HNVA 3ZT2A 4GY2B 4BR4A 2IVPA 4GW6A 3SUQA 4GV3A 3CJAA 3LALA 3WXKA 1NGFA 3DMJA 1MU2A 3T3FA 1BQNA 4F2SA 1X3NA 3MAQA 3GL1A 4KV8A 2BANA 1REVA 3I55N 3TAEA 2HF3A 4DTOA 2KKZA 3P4IA 4A5BA 5HRSA 1VQON 5C2DA 3R6MA 3IAYA 2VGMA 3D2EB 4C8MA 4EZ9A 1BDGA 2A6AA 1C0UA 1RDUA 1KQSM 2Y1JA 5ADXH 2OCEA 3H08A 5AQGA 2QTDA 3VOVA 4AH9A 1CZAN 4MO4A 3WXJA 3C6HA 5BREA 5J1EA 3N4QA 4EIAA 1QZ5A 3EE9A 1LW0A 4FJIA 3QMLA 1OKJA 4JKEA 2HHUA 4BGAA 1VQ7N 3AVGA 2NRXA 4CZIA 1VSMA 3AGKA 1S9EA 1YUWA 3A8YA 2E1YA 1W2BM 4OO1J 1J54A 4FWQA 4BRCA 3DAWA 1YAGA 5LMNK 4Z0UA 1WBBA 1YTAA 2P9PB 3ZSOA 1KFSA 2P51A 1WOQA 1XWLA 4E7IA 4FYDA 3O4QA 5AQTA 3DRSA 5M1FA 4QCLA 4H8KA 3KKSA 3L3VA 5B8HA 3DXKB 4DU4A 4M45A 3JAMO 1HRHA 1XC3A 1VSKA 3LM9A 4Z4IA 4FPAA 5T7BA 4BWJA 2FLOA 3KD1E 2QWNA 3ZLJA 1DTTA 4ICLA 1CZBA 5GAGP 2GUPA 3OVNA 1I94K 5BN9A 4E7HA 1QQOA 5MLCQ 5LY3A 4J2BA 3NVKA 1ZBLA 3TSUA 1DTQA 2A1RA 3D2FA 3FZKA 1NK7A 1XNQK 3O8MA 3DLRA 1HNIA 1ZBUA 3VGLA 2YHAA 1HLUA 1VSIA 4FVMA 4FL9A 2Y1IA 1RTHA 2GUIA 4AHRA 1N36K 2KHOA 3ZSRA 2ZE2A 3SUOA 1M1KO 4CZFA 3MN7A 4DQ8A 2RKIA 4Y0WA 4QAGA 1RBRA 4KTWA 4OX9K 4F9OA 1SV5A 4B3OA 4FLZA 4NLCA 3QERA 3QEPA 3LDQA 1J53A 3AVHA 4FW1A 4CJVA 3VQ8A 4CCHA 3VQBA 1QE1A 4IEIA 3MN6A 4I9QA 4RCHA 4FM1A 1VSLA 2F7TA 3SQ0A 1SKSA 1W9HA 4CHQA 3D45A 4DCHA 3HRGA 4BRHA 4F2RA 1D4XA 4N76A 3HPOA 2GWKA 3V81A 1RT6A 2W6LA 2ZGZA 3EE8A 1ESVA 3VEXA 2OYQA 3I33A 1CLQA 4OPAA 1BO5O 4CFDA 3VGKA 1B9FA 1ZBFA 1KSPA 3HP9A 4B9VA 2P9SA 4BC2A 1DKGD 5E41A 3U9ZA 3WT0A 3RRGA 1A5WA 3DXMB 4Z4EA 4DTMA 5LL6Z 1C1CA 5GINA 1YJWN 4NCBA 1U04A 3CJ7A 5HRNA 3L8BA 1OVYA 1YJNN 3H6EA 1E4GT 3ZT3A 4IZ9A 4FM2A 1HMVA 4AHUA 2FSJA 2QWMA 5FLXO 1BQMA 4DS5A 2E4LA 2GTDA 1GLAG 1S1XA 2FSKA 5SZTA 4CEAA 3U3GA 2DFEA 2HBLA 1ASWA 1T6DA 3LDNA 4KH4A 4JKHA 2JGUA 4MLEA 4QS9A 5GAEP 4K43A 2GWJA 3AVLA 1X9SA 3NF9A 1TUUA 4KKOA 3QIPA 3BZCA 3FR0A 4FJ7A 5EX5A 1RDBA 2IOCA 4FJHA 1H1VA 4WCEL 3QNNA 4B8AB 3TAMA 5DM6L 3VQPA 4ILHA 2YKMA 1KLMA 5JICA 1NKBA 4NB4A 5JMVA 2XY5A 2P9UB 4DQSA 3ZSZA 2Z1GA 5TKYA 1YVNA 5DK5A 4FLUA 3AVFA 1T6CA 4B9SA 1CXUA 4A2BA 3CC2N 3S3MA 4GKJK 3IUCA 4CJUA 4TSXA 2ZJRL 4CBWA 3AVBA 1BISA 3SAGA 2HW3A 4C23A 4CJ7A 5FDLA 5HL7L 4EFHA 3QLHA 5CR4A 2CGJA 4DR3K 3OHRA 3SNNA 3EKUA 3ULEB 3BDPA 4KO0A 3AV9A 2RHKA 2O8BA 1NGEA 1GLCG 5I3UA 4DV5K 3WNEA 2HB5A 4N41A 1NK6A 3A2FA 4B08A 4YOYA 3IG1A 5AJ3K 1WSFA 1WN7A 3P39A 2HHVA 3DLLL 3VQ4A 2AP1A 3CCUN 4OKJA 2UXBK 3L6QA 1TL3A 2YJFA 1W7AA 4CF1A 4N47A 3THXA 4FZXC 2UUBK 3TAQA 3OYDA 2X74A 3W3DA 4RW4A 3RMBA 1YJ9N 3HOTA 1LV5A 5JLFA 3AAQA 4OPKA 4LF7K 1VQ6N 4CD1A 1U2VB 2D0AA 3GE1A 4AHSA 3AVIA 4E1MA 4KH6A 1RTJA 1JLGA 3VQAA 3G10A 3QBWA 1EWRA 1VRTA 2P9KA 2DFHA 3LL3A 3O3HA 4ISEA 4WFAL 4FK2A 4ILGB 2YHBA 2OPSA 4JI2K 3KKRA 3S3NA 3OJUA 2G8WA 2XHBA 3K5MA 1TK0A 4X64K 3THWA 4E3SA 4E1NA 1RFQA 3BF3A 1OH5A 3ENHA 2E88A 1Q9XA 2HNDA 4I9LA 3T1HK 4M3ZA 3FE1A 4Z4GA 2CGLA 4F8RA 3THYA 4F3TA 3SUPA 3ASMA 3S41A 3JYTA 3DM2A 4ISGA 2Q36A 3O3FA 2YNGA 4C8KA 1B92A 2VCPA 1RBVA 4CF0A 4B9UA 1S6QA 3EKSA 2P5GA 1T44A 4WF9L 3MN5A 1Q82O 4FJMA 4BR7A 1VSEA 3ZETB 3G6EN 3V1RA 3U6FA 3TAPA 1VQ4N 4Y1CA 4KI4A 1OH7A 2P9IB 3SJJA 3O1WA 3L2RA 4OKKA 3EN9A 1Q9YA 3P31A 2PYJA 4MLHA 2YJEA 4JKAA 2GV9A 4OKEA 5BPMA 4CJLA 4DV3K 2BDPA 1UWBA 2W42A 4EZ6A 3CCLN 2BUPA 1VQMN 2DFFA 2HBKA 2DY4A 1GLBG 2IIRA 3DXKA 4CVNE 5M1PA 3ZSXA 1NGJA 4Y1DA 3GOIA 1NOYA 3F73A 3S9HA 1NGDA 3ZSWA 4GKKK 3CETA 3HI0A 2WBNA 2F8SA 3AO1A 4O8UA 1YT3A 2WC9A 2Q97A 3AA2A 3L0QA 4LFCK 1IH7A 5JS2A 3DLKA 1HNWK 5FRMA 5AZJB 3NDKA 2KQ2A 1W0HA 3VQ6A 3VQQA 3OBWA 1TK8A 4H03B 2ITGA 4BR5A 4DG1A 4FLYA 3CPWM 2RF2A 1JCGA 4JHDB 5FPNA 2OPRA 1Z6RA 4JKDA 1NKCA 4BQLA 3CCRN 4DR5K 1IKVA 2PBDA 3NF7A 1W97L 2WUSA 1JCFA 4RW9A 2FBXA 5FPMA 2AJQA 1RDWX 1IG9A 4BQZA 3LDSA 1NU0A 3UKRB 4YNQA 3J7AP 3OY9A 3WUHA 3PLAA 3WNFA 5C0YA 2P9LA 5DMRA 2Z1HA 3NGZA 5AZIB 4EP5A 5K14A 3O4WA 3CIPA 3CCVN 4PHTX 1ASUA 4ISFA 1Q7YO 4OGCA 4KI6A 3MXJA 5FROA 1Q81O 5C2FA 3CJBA 4DSEA 1L5UA
chains in the Genus database with same CATH topology
3QMLA 1OKJA 4JKEA 2FF3B 5AFUH 4BREA 4IOAL 4OPHA 4BGAA 2NRZA 1VQ7N 2ZJPL 1WUAA 1V4TA 2NRXA 4BRDA 4CZIA 4B1UB 1KD1O 2E2NA 3AGKA 3A5MC 2GELA 1YUWA 3A8YA 1QQNA 2E1YA 4M63C 3CCEN 1W2BM 2JWLA 5JVHL 4OO1J 4FWQA 2WFBA 4BRCA 2CGKA 3C7NB 3DAWA 5GIOA 1YAGA 4IFEA 3IMXA 3IDHA 4H0TB 1QVGM 2J4RA 4PKIA 1KXPA 4JHDA 2P9PB 3ID8A 4FWLA 4A5AA 3D2FB 4H5NA 2QM1A 3OBYA 1ATSA 4JK9A 1WOQA 2NRRA 1HKBA 3CCJN 2YCHA 4QS8A 5LJWA 3LDPA 5AQTA 5AQQA 5C10A 3VETA 5M1FA 3VPZA 3C7NA 2NRHA 1ATRA 3CJ9A 3O9TA 5B8HA 2I7NA 3DXKB 4O8KA 4XH1A 4J8FA 1YIJN 3K9KA 3RSEB 3ZX3A 3CI5A 1XC3A 4U67L 3LM9A 3N4PA 4FPAA 3UKRA 1DT9A 2NRWA 3VEWA 2P9UA 5AQJA 4R79A 2FLOA 4IWVA 4FWNA 1K8KB 4YOTA 2QWNA 4H5WA 4CZJA 4DKWA 4CD3A 3MWPA 1VQLN 3CC4N 4C1NI 2GUPA 4MO5A 4CZKA 5GAGP 2YHWA 3MCAB 3CXCM 1K9MO 5BN9A 1QHAA 1ZBSA 3CHWA 3W0LA 4EAHD 1QQOA 5MLCQ 5LY3A 3HOSA 3WEEB 3NMUA 4HTLA 3NVKA 3ZX0A 4JKBA 5KPTA 3TSUA 3H3NO 5AQIA 3VGMA 3HM8A 3D2FA 3FZKA 2FSNA 2P9SB 3KZBA 4GNIA 3O8MA 4WFNL 5F2RA 1IG8A 3CF5L 4WQ5C 3VGLA 4YDUC 4HWIA 5BPLA 5BRDA 3VTIA 3FGUA 1HLUA 4FL9A 2V7YA 2QWRA 4MDAA 5AQWA 2KHOA 5AQVA 1M1KO 4CZFA 3MN7A 5AQRA 3SMSA 4DQ8A 2A5XA 3SAFA 4A57A 2HBJA 4UY8O 4H0VB 4Y0WA 3ATUA 3U8XA 4DHYA 1NM1A 5AZJA 2F9TA 4F9OA 5EOYA 4NLCA 1NWKA 2A42A 4B1WB 3LDQA 3SBGA 4AF1A 1YHQN 1BA1A 1DGKN 5KPRA 4QS7A 4EHUA 4JK8A 4IEIA 2VYPA 1KC8O 3MN6A 2QWQA 3E9PA 3U9DA 5BRFA 1BUPA 4BRLA 1QZ6A 4RCHA 2F7TA 3FZMA 3DWLA 3C6AA 2VGNA 2V7ZA 2CH5A 2EWSA 4BRNA 1NMDA 1BWFO 3KWIA 1VQ8N 4JNEA 1T3VA 1SZ2A 3E1YA 3E9OA 3D7EO 2ZWHA 4DCHA 4EHTA 1TYQB 3HRGA 4KBOA 2OTJN 2DPNA 4BRHA 1G99A 3TTCA 3P38A 1D4XA 1XQSC 2GWKA 3LDLA 4JD2A 2ITMA 3WXIA 2ZGZA 4C1NK 3EE8A 1ESVA 3VEXA 4YOWA 3I33A 1X3MA 4K25A 1S22A 5ELZA 4OPAA 4YORA 1BO5O 3WQTA 1V4SA 2HSTA 4FWPA 1HKCA 3HSCA 3O9QA 3VMFB 4NO7A 3VGKA 3SAHA 3G25A 1E4FT 2D4WA 2I7PA 3VEYA 2P9SA 3VERA 2P9NB 4H5RA 1Z05A 1DKGD 3ZEUA 4BC2A 2Q1NA 3U9ZA 1BOTO 3AY9A 3GBTA 3WT0A 5GIPA 2FF6A 4H0XB 3KVGA 1MWKA 1HKGA 4BRMA 3DXMB 4CZEA 1VQPN 2QXLA 1NJIO 3EL2A 5C12A 3SBTA 2W40A 4WQ5A 5GINA 3CPEA 4A59A 2P9PA 1YJWN 1KAYA 4CBUA 4JEPA 3CJ7A 2W41A 4JKGB 3J8AA 1LCUA 1OVYA 3H6EA 3M5RA 1E4GT 3J7ZO 3T69A 1YJNN 1YF5L 4IZ9A 1YI2N 3D2EA 2Q0UA 1SAZA 2FSJA 1SQKA 2QWMA 4BRPA 4BR9A 1VAZA 4IEEA 4A2AA 4FWMA 4WYBA 4LC9B 4BY9C 1HX1A 2GTDA 1J6ZA 4FSVA 4FWSA 1GLAG 3G71N 4JK7A 2FSKA 1GLJO 3AGRA 2E1ZA 3LDNA 2HBLA 1T6DA 3JXUA 4B1XB 4KH4A 5AQZA 1ZC6A 3EO3A 3F5TA 4JKHA 4MLEA 4JKFA 4QS9A 2HBMA 4K43A 3ULEA 2GWJA 5GAEP 1TUUA 3FR0A 1NGIA 2QWLA 4BC5A 4H5TA 1C0GA 3BUZB 5EX5A 1QVFM 4IO8A 3OA9A 2ASOA 1H1VA 1QQMA 2ZF5O 4WCEL 5LJVA 4BRQA 3JS6A 4BRIA 4BRFA 3SLCA 4FWOA 2OTLN 5DM6L 4O5FA 4ILHA 5F0XA 3QICA 5JICA 4NB4A 3UKUB 5JMVA 2P9UB 3SK3A 2E8AA 4XH4A 3I8BA 3CJ1A 4B1VA 1S72N 3D6RA 2YI1A 5TKYA 1P90A 1YVNA 4U7BA 1T6CA 1NGBA 2RE2A 1GLLO 3M6GA 4M7YA 4JKGA 3BP8A 4A2BA 2UYTA 4BR2A 4YOVA 3CC2N 3IUCA 3FZFA 3QB0A 4K42A 4CBXA 3O08A 4CI6A 2ZJRL 4B1YB 3ENOA 3O6WA 4CBWA 3EZWA 5CHIA 3CMAN 3E66A 1GLFO 1O13A 5AQSA 3KWGA 4FWRA 4I6MB 3SAGA 3A0IX 4C23A 1U2VA 4JKCA 2P9KB 2QI2A 1ATNA 2ASPA 3TSPA 5CR4A 4CJ7A 1SS6A 4EFHA 5KQ8A 5HL7L 3B8AX 2CGJA 2P9LB 1EQYA 2E20A 3O9RA 2P9IA 1U6ZA 3O9UA 2FXUA 3OHRA 3CCSN 1HJOA 1NGCA 3EKUA 3QFUA 3RVCA 3ULEB 4YOXA 4WFBL 3L4IA 2Q2RA 3H46O 4BC4A 3KK7A 2RHKA 2IVOA 4BVOA 2GEMA 1NGEA 2VWBA 3QBXA 1KAZA 3VENA 1IJJA 1GLCG 4CZHA 1ILYA 2PFUA 3ATVA 1BU6O 4H0YB 2D0PA 5EVZA 1R59O 2CH6A 3MK6A 3NVMA 1HPMA 4WQ4A 4YOYA 1HUXA 1NGHA 2NNWA 3F2KA 3H1VX 1DEJA 3LDOA 3MWTA 3P39A 5AR0A 3WQUA 2QW9A 4CZGA 4WQ4C 3DLLL 1VQKN 4FVUA 4YDUA 1NGAA 2AP1A 3CCUN 5KPZA 1VQNN 3M3ZA 3CERA 3L6QA 2YJFA 2D1KA 2YX6A 3UB5A 3CD6N 4BROA 4K41A 4CZLA 3ZYYX 3TTFA 3UE5A 3H45C 3W3DA 1YJ9N 3HOTA 5M1OA 3TSQA 3AAQA 5JLFA 1VQ6N 5FPEA 1BG3A 1K8AO 4CD1A 1U2VB 1K73O 3H3OB 3GE1A 3O80A 3FZLA 4KH6A 4E1JA 5HOOA 5I9EB 3R3LA 4IDHA 1Y64A 1N8RO 4XH5A 3QBWA 2P9KA 5M1QA 3LL3A 5AFUA 4ISEA 3CC7N 3A5LC 3VF4A 5AQNA 3M1FA 3VEVA 4WFAL 4ILGB 4I6MA 3KHYA 3MX5A 3VF2A 4AM6A 4FOIA 4BRKA 1MWMA 3FZHA 4FPBA 3UKUA 1YXQA 3GDQA 4BG9A 4H0PA 1RFQA 1S3XA 3BF3A 3ENHA 4PKHA 3CCQN 3GG4A 1TUYA 1Q86O 2H3GX 2A3ZA 2E88A 3VESA 4BG8A 2NLXA 4L3QA 4GV9A 4KH5A 4BR0A 5F1XA 3MN9A 3FE1A 2CGLA 2JWKA 5TKWA 5JLHA 3BF1A 3O9SA 2P9NA 3O5BA 3AAPA 2AA4A 2NRVA 3F9MA 4BRAA 3MX2A 5AQOA 3S41A 3CJCA 4FO0A 3ZETA 4ISGA 2KLAA 4MDBA 2Q36A 5AQLA 2QWPA 1JJ2M 5EY4A 2V51B 3R1XA 1RGIA 3TU5A 4BRGA 3I56N 2VCPA 3QFPA 3C65A 4IXCA 3ZX2A 4RTFD 3EKSA 3C0BA 1T44A 4B1ZA 4IO9L 4WF9L 3T7ZA 3MN5A 1Q82O 4ILJA 3VF6A 5M1NA 2NRTA 1MDUB 4BR7A 1C0FA 3PIPL 2QEXN 5GAHP 4FOEA 1KAXA 4JN4A 2BTFA 3ZETB 3G6EN 3CQYA 5KQDA 5GADP 5BRHA 2Q0RA 4XEIA 4YOUA 3PIOL 1GLDG 4BGBA 1GLEG 5AQFA 5ADXA 3WXMB 2ZJQL 1VQ4N 2P9IB 4A62A 2NZTA 2E2OA 5AQMA 3MCPA 3O1WA 4B9QA 4BVPA 3L4QA 3EN9A 2YHXA 5E26A 3P31A 3TTDA 4MLHA 2ASMA 1NGGA 1ZXOA 2YJEA 4JKAA 1K8KA 3SJHA 5BR9A 3IFRA 2ZGYA 5BPMA 5FPDA 4BC3A 3R8EA 3A5OC 3MMVA 1NLVA 3QDKA 1TYQA 3H1QA 5AQXA 3ENBA 5C15A 3BEXA 4A61A 5DM7L 3CCLN 2A40A 2BUPA 1VQMN 1P8ZA 2HBKA 4GVEA 3RSEA 1Q18A 4FWKA 4H0OA 5AQUA 1GLBG 2IIRA 3DXKA 2Q31A 4AM7A 1EO1A 1LOTB 3AARA 5M1PA 3SMPA 1NGJA 5AQPA 2E2QA 1NBWA 3IKMA 5BPNA 3CCMN 2IVNA 2F9WA 3GOIA 3WXLA 5BN8A 5JVGL 2A41A 1NGDA 3ID6A 5CE3A 4JAXA 3CETA 3HI0A 3Q7BA 3ZEUB 2WBNA 4PL7A 2QA4N 3U4LA 4O8UA 3CQXA 1X9JA 2HOEA 2WC9A 2Q97A 3L0QA 3G4SN 5AQYA 4GY2B 4CZMA 4BR4A 4Z94A 3K9JA 2IVPA 5AZJB 3LM2A 3Q7CA 4GV3A 3CJAA 3WXKA 1NGFA 3R9PA 3OBWA 4H03B 1X3NA 4IOXA 2BH1A 3FLCO 4BR5A 3GL1A 4G9ZA 3CPWM 3I55N 1MA9B 3TPQA 2HF3A 3VEZA 1JCGA 3HBTA 3FFKB 4JHDB 2KKZA 3P4IA 5FPNA 4RWTA 1Z6RA 1YITN 4JKDA 4A5BA 1M90O 4H5VA 4BQLA 3CCRN 2PBDA 4DB3A 3MDQA 1VQON 5C2DA 1W97L 3R6MA 2WUSA 4IJAA 1JCFA 2D0OA 4IJNA 4M7XA 2VGMA 1BA0A 3CMEN 3O1BA 5FPMA 3D2EB 1RDWX 4GV6A 1BDGA 2A6AA 4PKGA 3VTHA 4BQZA 1VQ9N 3UKRB 2QWOA 1RDUA 1XUPO 2PAVA 3WUHA 3PLAA 5C0YA 2P9LA 3VEOA 3DJCA 4IOCL 1KQSM 5AZIB 5M1KA 3HZ6A 5ADXH 2GX9A 3O4WA 1VQ5N 3CIPA 3WEEA 3CCVN 3A5NC 5AQHA 2V52B 2QTDA 3DXMA 5AQGA 3VOVA 4PHTX 5E84A 1JCEA 1CZAN 2E2PA 4ISFA 4NLBA 1Q7YO 2HMPA 3E9LA 2YHYA 4MO4A 5AQKA 3WXJA 3C6HA 2OANA 5EXWA 5BREA 1Q81O 5C2FA 2HF4A 5H1SQ 3N4QA 4EIAA 3CJBA 3HTVA 1QZ5A 4JD2B 5AZIA 3OW2M 4PL8A 3EE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPE A;  3C6H A;  5M1K A;  3C6A A;  5M1P A;  5C2D A;  4IFE A;  5M1O A;  5C10 A;  5C2F A;  5M1F A;  5M1Q A;  5C12 A;  4IEI A;  4IEE A;  5C15 A;  4IDH A;  5M1N A; 
#chains in the Genus database with same CATH topology
 1JLB A;  5AFU H;  4BRE A;  4OPH A;  2ZJP L;  1V4T A;  1S9G A;  2IC3 A;  3A5M C;  1QQN A;  4C8O A;  2JWL A;  3AO3 A;  2CGK A;  2RPI A;  3C7N B;  5GIO A;  4IFE A;  4YHH K;  2J4R A;  4PKI A;  4L8R B;  4AIL C;  1S1W A;  3I0S A;  1LWF A;  1D5A A;  4DV2 K;  1J5O A;  4JK9 A;  1BL3 A;  5AQQ A;  4FJK A;  3CJ9 A;  3O9T A;  3S3O A;  3AO2 A;  4DR1 K;  4LFB K;  2I7N A;  3C94 A;  4O8K A;  2HHS A;  3RSE B;  3ZX3 A;  3SI6 A;  2VQE K;  1JXB A;  3LP0 A;  1DT9 A;  3VEW A;  4FWN A;  1K8K B;  4JI4 K;  4BWM A;  4CZK A;  3CXC M;  4MO5 A;  3LWL A;  3CC4 N;  2YHW A;  3MCA B;  5KI6 A;  4KRF A;  4EAH D;  1ZBS A;  4O0I A;  3WEE B;  3NMU A;  4K8Z A;  4HTL A;  4KPY A;  5KPT A;  3H3N O;  1T03 A;  1KRP A;  4JLH A;  4GNI A;  4B9T A;  1JL2 A;  3KLI A;  4WFN L;  4WQ5 C;  4HWI A;  3SPZ A;  3OYN A;  4C8N A;  1UA0 A;  4OLA A;  3BGR A;  5AQW A;  4LSL A;  3OYE A;  2IS3 A;  3C6T A;  4CGF A;  3SMS A;  3SAF A;  4A57 A;  4DTN A;  4ID5 A;  3TAR A;  4DHY A;  1U47 A;  1NK0 A;  1FJG K;  3V1O A;  2F9T A;  5EOY A;  1NWK A;  1DLO A;  4DFP A;  1DGK N;  1BIZ A;  1RDA A;  4JK8 A;  1JLC A;  2QWQ A;  2Z1I A;  4LF8 K;  2ZM6 K;  1VQ9 N;  3DWL A;  2EWS A;  2CH5 A;  2V7Z A;  4CIG A;  1BWF O;  3KWI A;  4J2E A;  1SZ2 A;  1WSJ A;  4EHT A;  4FZZ A;  2HHT A;  2OTJ N;  1G99 A;  3TTC A;  4JI1 K;  4CER A;  2O8C A;  3IS9 A;  2VG7 A;  4C1N K;  4YOW A;  4DU3 A;  1S22 A;  1NK4 A;  4YOR A;  4CE9 A;  1V4S A;  4FWP A;  5BR8 K;  1HKC A;  3O9Q A;  3VMF B;  1E4F T;  2I7P A;  1WBD A;  3ALY A;  1Z05 A;  3AY9 A;  1Y97 A;  3GBT A;  1VK0 A;  2FF6 A;  4H0X B;  3FFI A;  3KVG A;  4CF8 A;  2KTQ A;  3RMD A;  4BRM A;  3KLE A;  1JLQ A;  5C12 A;  4JI0 K;  4WQ5 A;  2HVI A;  3K5N A;  2P9P A;  4CBU A;  4JKG B;  4IDK A;  2PYL A;  3M5R A;  3AVJ A;  4JV5 K;  4CK3 A;  3P1G A;  1SQK A;  3OYB A;  2ETJ A;  4BRP A;  1A5X A;  1IBK K;  1VAZ A;  4BY9 C;  1WSI A;  4FSV A;  1J6Z A;  2O8B B;  4FK0 A;  2XY7 A;  2UUC K;  2IAJ A;  3HST B;  5AQZ A;  2X6S A;  4RW8 A;  4PY5 A;  2HBM A;  3MEE A;  4F3O A;  4V19 S;  2O4G A;  2QWL A;  1RNH A;  1KCF A;  3AVK A;  3OA9 A;  2GBZ A;  4RW7 A;  4BE0 A;  4FWO A;  2OTL N;  1JXE A;  1WAF A;  3QIC A;  3OYF A;  3UKU B;  4DTR A;  4LFA K;  3I8B A;  4DTJ A;  3I0R A;  4KHW A;  4U7B A;  5IWA K;  1NGB A;  4JRP A;  4BR2 A;  2UYT A;  3FZF A;  4CI6 A;  4CBX A;  3L2U A;  3ENO A;  3QES A;  3EZW A;  5CHI A;  3SYZ A;  1O13 A;  5AQS A;  1TAU A;  4DSJ A;  4CJ4 A;  4JKC A;  2P9K B;  2QI2 A;  3TSP A;  5KQ8 A;  3ZSQ A;  2IGI A;  2P9L B;  1EQY A;  2P9I A;  2FXU A;  2EHG A;  1HJO A;  3QFU A;  4YOX A;  3RVC A;  4JI3 K;  3VQ9 A;  5J2N A;  4BVO A;  3QBX A;  3VEN A;  2G8I A;  4CED A;  1ILY A;  2PFU A;  1BU6 O;  1N32 K;  2G8H A;  4FJ9 A;  2QK9 A;  4KRE A;  2CH6 A;  4WQ4 A;  1HPM A;  2Z1J A;  1HUX A;  5AR0 A;  4DLG A;  2O8D B;  4JS5 A;  2QXF A;  4YDU A;  4BDP A;  4C8L A;  3CER A;  3O4N A;  1HQE A;  3VQD A;  2YX6 A;  4BRO A;  4K41 A;  3THX B;  3ZT0 A;  4FK4 A;  4DMN A;  4Q0B A;  3ZYY X;  3NAE A;  3H45 C;  1RTD A;  3H3O B;  3NGI A;  2BE2 A;  1GOA A;  1WSE A;  4B8C A;  2G8K A;  3HK2 A;  3FZL A;  1XMQ K;  4QOZ B;  4CF2 A;  4IFY A;  3AVC A;  4JI8 K;  4NYN A;  4XH5 A;  4FLV A;  4DQQ A;  5M1Q A;  3CC7 N;  1HQU A;  3A5L C;  5AQN A;  4FCY A;  2O8F B;  3TAF A;  3K5L A;  1YTU A;  3VF2 A;  4AM6 A;  4FOI A;  1MWM A;  4FPB A;  3QO9 A;  4O0J A;  3GDQ A;  4H0P A;  1S3X A;  3GG4 A;  1D8Y A;  2H3G X;  3T1Y K;  2UXD K;  3VES A;  4B9M A;  4L3Q A;  4BAC A;  3HPG A;  4GV9 A;  1YVU A;  3K2P A;  5FRN A;  4IG3 A;  3EZ5 A;  1ZYQ A;  3O9S A;  2AA4 A;  2NRV A;  5AQO A;  5AQL A;  4MDB A;  3NGY A;  4BE1 A;  3QEX A;  2QWP A;  2V51 B;  3R1X A;  1J9A A;  3I56 N;  4W5T A;  3C65 A;  3ZX2 A;  3RMA A;  2F8T A;  2YNI A;  4CF9 A;  4ILJ A;  2WON A;  1EP4 A;  3KTQ A;  3P83 D;  1MDU B;  2QEX N;  3NBP A;  5GAH P;  4FOE A;  4DSI A;  2BTF A;  1NKE A;  5KQD A;  5JS1 A;  4IKF A;  3PIO L;  4BGB A;  3OYI A;  5ADX A;  3WXM B;  1GOC A;  4FJN A;  3V6D A;  3HVT A;  3OYL A;  5AQM A;  3MCP A;  4BVP A;  4CHO A;  3OS2 A;  3E01 A;  3L4Q A;  2YHX A;  1HNX K;  4I2P A;  1NGG A;  1S1V A;  3SJH A;  4F4K A;  4RG8 A;  5FPD A;  3QEW A;  4FW2 A;  4BC3 A;  3AVM A;  3A5O C;  3QDK A;  1NLV A;  4CJR A;  3H1Q A;  4FJ5 A;  1VSH A;  3ENB A;  4A61 A;  3SPY A;  3B6P A;  4DSF A;  1P8Z A;  4GVE A;  1Q18 A;  4FWK A;  5AQU A;  3ZT1 A;  3PUF A;  3TAN A;  2E2Q A;  1NBW A;  3IKM A;  3CCM N;  2F9W A;  4CGH A;  2YKN A;  3BZK A;  2A41 A;  3ID6 A;  3CFO A;  3QIO A;  1NJY A;  3PV8 A;  4PL7 A;  3THY B;  3U4L A;  3CQX A;  4CJP A;  4NCG A;  1FXX A;  3HL8 A;  2HHH K;  1RTI A;  4MQ3 A;  4CZM A;  4Z94 A;  4DWI A;  3LM2 A;  4DQI A;  3KLH A;  3VQ5 A;  3R9P A;  4KB1 A;  4O55 A;  2BH1 A;  3FLC O;  4G9Z A;  1MA9 B;  1N33 K;  3FFK B;  4RWT A;  1QTM A;  1YIT N;  4H4M A;  1NK8 A;  2ATQ A;  2KFZ A;  2X6N A;  4IJA A;  4M7X A;  2D0O A;  4IJN A;  1U4B A;  5KRS A;  1BA0 A;  3O1B A;  4GV6 A;  1NOZ A;  4PKG A;  2QWO A;  1XUP O;  2PAV A;  5J2P A;  1LWE A;  3VEO A;  4IOC L;  4FLT A;  3OYA A;  1NJZ A;  2GX9 A;  3DI6 A;  2IDO A;  1NJW A;  1VQ5 N;  3WEE A;  3A5N C;  5AQH A;  3SQ4 A;  4FJJ A;  2QKB A;  5E84 A;  1T05 A;  2E2P A;  4HUE A;  3E9L A;  2YHY A;  3DYA A;  3OW2 M;  4PL8 A;  2HVH A;  2NRZ A;  1WUA A;  2WTU A;  1X9W A;  4DU1 A;  1KD1 O;  2E2N A;  2G8F A;  1S1T A;  3OTO K;  4M63 C;  4ZTJ A;  2WFB A;  3HVR A;  4KHS A;  3CM5 A;  3IDH A;  1QVG M;  1KXP A;  1RT5 A;  3ID8 A;  3VQ7 A;  4A5A A;  3D2F B;  1TAQ A;  2QM1 A;  4X62 K;  1ATS A;  3CCJ N;  2NRR A;  1C0T A;  4ZHR A;  4DF4 A;  3CYM A;  4QS8 A;  5D3G A;  3VET A;  5CZ2 A;  1HR0 K;  4M3U A;  1ATR A;  4XH1 A;  3K9K A;  1QSL A;  1TV6 A;  3CI5 A;  3M8Q A;  1QHT A;  3UKR A;  4CGD A;  4DS4 A;  2P9U A;  3KK2 A;  1XNR K;  3LP1 A;  5AQJ A;  4R79 A;  3QIN A;  4YOT A;  4CZJ A;  1RT3 A;  1ITG A;  3K5O A;  3MWP A;  1VQL N;  2FBV A;  4C1N I;  4FJX A;  4LF5 K;  1K9M O;  3CHW A;  3HOS A;  4LD0 A;  3HM8 A;  3SV3 A;  2FSN A;  2P9S B;  2VG5 A;  3KZB A;  5F2R A;  1IG8 A;  3CF5 L;  2EX3 A;  4YDU C;  5SWM A;  3K57 A;  5BRD A;  3FGU A;  4CJW A;  3TAB A;  1CXQ A;  4CEC A;  2V7Y A;  4DFM A;  4LH4 A;  1RDC A;  3MEG A;  1U49 A;  4M3X A;  2O8C B;  5AQV A;  5AQR A;  4H0V B;  2VQF K;  4E7J A;  4Z4F A;  1EXQ A;  2B6A A;  1NM1 A;  3TWH A;  1IBM K;  1NMN A;  1NK5 A;  4B1W B;  1EET A;  1YHQ N;  2XY6 A;  1EKE A;  4HCC A;  4JI6 K;  4EHU A;  2VYP A;  3U9D A;  1BUP A;  4BRL A;  2JLE A;  1QZ6 A;  4I7F A;  1QSY A;  3FZM A;  2VGN A;  4BRN A;  1TL1 A;  4CK1 A;  1VQ8 N;  1NMD A;  4JNE A;  4DF8 A;  4CEF A;  3E1Y A;  3D7E O;  2ZWH A;  1TYQ B;  4KBO A;  4CEO A;  2DPN A;  1BI4 B;  4CFA A;  3K59 A;  1XQS C;  1LWC A;  1WAJ A;  3LDL A;  1LAV A;  4JD2 A;  2ITM A;  3WXI A;  3QEV A;  1UA1 A;  3I8D A;  2PY5 A;  3PY8 A;  4PUO A;  5CY4 A;  2F4V K;  1X3M A;  2P1J A;  4K25 A;  4AQY K;  4NCA A;  2HST A;  1FW6 A;  3HSC A;  4NO7 A;  3SAH A;  1S5J A;  2OZS A;  2D4W A;  3EYZ A;  4HUF A;  5C24 A;  3VEY A;  5HRP A;  4KHY A;  4H5R A;  3ZEU A;  5GIP A;  3HO1 A;  1SL0 A;  4FLX A;  4CZE A;  4DSK A;  3EL2 A;  3SBT A;  3EY1 A;  3CPE A;  3RR8 A;  4WE1 A;  1Z26 A;  1NNE A;  1KAY A;  4CGI A;  2A1S A;  2W41 A;  4M3R A;  1LCU A;  3T69 A;  1YF5 L;  3D2E A;  3DLB A;  2Q0U A;  2O8F A;  3L2V A;  1X9M A;  3VA3 A;  1KFD A;  4BR9 A;  4IEE A;  4A2A A;  4FWM A;  4WYB A;  4FXD A;  4CW7 B;  4HVJ A;  4CEZ A;  2YNF A;  4FWS A;  1XHX A;  1GLJ O;  3AGR A;  2E1Z A;  4B1X B;  1VRU A;  3EO3 A;  3F5T A;  1KVC A;  3OYC A;  2O8E B;  1BIU A;  4H5T A;  1QVF M;  3PX4 A;  2WOM A;  3V9W A;  2ASO A;  4IBN A;  4DR7 K;  4BRI A;  3JS6 A;  5KRT A;  2Q3S A;  5EU7 A;  1OVQ A;  4X65 K;  3HPH A;  5F0X A;  3AO5 A;  3SK3 A;  2YI1 A;  1P90 A;  1TKD A;  3WNH A;  1GOB A;  4DTX A;  2RE2 A;  3M6G A;  4M7Y A;  3LAN A;  3MEC A;  4JKG A;  3NHG A;  1TVR A;  1Z25 A;  3QB0 A;  3O08 A;  3VN5 A;  4B1Y B;  3C6U A;  1TGO A;  3NF6 A;  3E66 A;  4CFC A;  3SQ2 A;  3KWG A;  3MED A;  4I6M B;  2HHQ A;  2X78 A;  4CHZ A;  3LAM A;  5CYM A;  2O4I A;  2ASP A;  1ATN A;  4CJK A;  1SS6 A;  3B8A X;  3O9R A;  1U6Z A;  3O9U A;  5A2Q O;  4BC4 A;  3L4I A;  3H46 O;  3AO4 A;  2IVO A;  4B3M K;  2GEM A;  2VWB A;  4B9L A;  3DLG A;  1KAZ A;  1IJJ A;  2P5O A;  1RBU A;  3ATV A;  4DR4 K;  4H0Y B;  4W5O A;  2D0P A;  5EVZ A;  3NVM A;  3MK6 A;  3RR7 A;  1K6Y A;  3MWT A;  1NGH A;  2NNW A;  4PA1 A;  4K0K K;  3SUN A;  3WQU A;  2QW9 A;  4WQ4 C;  1VQK N;  1ZBI A;  1VQN N;  1E3M A;  5KPZ A;  3M3Z A;  1U48 A;  2D1K A;  1ZBH A;  3UB5 A;  1SKW A;  1L3T A;  1SL2 A;  3TI0 A;  4DV7 K;  3MXI A;  4E7K A;  1HPZ A;  3TTF A;  5M1O A;  3TSQ A;  4E0D A;  1RBT A;  3SZ2 A;  5FPE A;  1BG3 A;  1K73 O;  1C0M A;  3O80 A;  4DQR A;  4FZY A;  4E1J A;  2FBY A;  1VSF A;  3LPU A;  4CHN A;  1WLJ A;  2VG6 A;  4OJR A;  3RTV A;  5AFU A;  2NUB A;  4N5S A;  4BE2 A;  5I42 A;  3VF4 A;  3BY5 A;  3M1F A;  3RMC A;  3KHY A;  1IKW A;  4XIU A;  4BRK A;  3G0Z A;  2ZD1 A;  3FZH A;  3UKU A;  1UOC A;  1IV0 A;  4DV4 K;  1VHX A;  3AVA A;  1TUY A;  2A3Z A;  2OA8 A;  2NLX A;  4JI5 K;  5HRO A;  3NFA A;  4BR0 A;  3MN9 A;  4LF6 K;  5JLH A;  3BF1 A;  3KD5 E;  3O5B A;  3AAP A;  1QSS A;  3F9M A;  1JKH A;  4BRA A;  3MX2 A;  3CJC A;  5CZ1 A;  3ZET A;  1JJ2 M;  2KLA A;  5EY4 A;  1RGI A;  4BRG A;  3QFP A;  4IXC A;  3LAK A;  4RTF D;  4DSL A;  3C0B A;  5LMU K;  4AHT A;  1D9D A;  2DTU A;  3T7Z A;  1VSD A;  4M41 A;  3VQE A;  3TR8 A;  4NYF A;  4KFB A;  3VF6 A;  1L3V A;  2NRT A;  3PIP L;  1KAX A;  4JN4 A;  3CQY A;  3KLG A;  5GAD P;  4CIE A;  1XMO K;  4B3T K;  4XEI A;  4YOU A;  2UUA K;  3U3Y A;  1GLE G;  5AQF A;  4CGG A;  4A62 A;  4B9Q A;  4GMJ B;  1XC9 A;  4LSN A;  3TTD A;  3QEI A;  2XO7 A;  1BCO A;  1ZXO A;  1K8K A;  3IFR A;  1QS4 A;  3NE6 A;  2ZGY A;  4KTZ A;  3KLF A;  3R8E A;  4KTQ A;  1TYQ A;  5AQX A;  3KIO A;  3BEX A;  2BGG A;  4CEB A;  2A40 A;  3L3U A;  1L3S A;  3ULD A;  3RSE A;  3AVN A;  1KVB A;  2Q31 A;  1EO1 A;  1I39 A;  1LOT B;  1KTQ A;  5AQP A;  3WXL A;  5BN8 A;  5HLF A;  5CE3 A;  3ZEU B;  1NK9 A;  4CJS A;  3HJF A;  1L3U A;  3PO4 A;  4OPJ A;  4DUY K;  1T8E A;  2HOE A;  3KK3 A;  1X1P A;  2HMI A;  1EWQ A;  2F96 A;  5AQY A;  3K9J A;  4KHQ A;  2FBT A;  3Q7C A;  1UAX A;  3PSF A;  1S1U A;  4Z4H A;  4IOX A;  4FJL A;  3M8P A;  3DRR A;  1IBL K;  3P5J A;  3QNO A;  4LF4 K;  3TPQ A;  3VEZ A;  3HBT A;  1OH6 A;  1RCH A;  3SQ1 A;  1RDD A;  3OS1 A;  1M90 O;  2W6K A;  4ELU A;  4H5V A;  2HNZ A;  3ZSV A;  3MDQ A;  4DB3 A;  4KHU A;  3CME N;  3TAG A;  2VWJ A;  3VTH A;  4OLB A;  1VSJ A;  3DJC A;  5M1K A;  3HXM A;  3HZ6 A;  3M8S A;  2ZQB A;  2G8U A;  3NH1 A;  2V52 B;  3DXM A;  1JCE A;  4NLB A;  3L2W A;  2HMP A;  4N56 A;  5AQK A;  2D0B A;  2OAN A;  5EXW A;  4W5N A;  2HF4 A;  5H1S Q;  3HTV A;  1WNS A;  4JD2 B;  5AZI A;  5C15 A;  2KZM A;  1NG9 A;  2FF3 B;  4IOA L;  3T19 A;  4NXM K;  4B9N A;  4BRD A;  4B1U B;  2GEL A;  5J2M A;  2UU9 K;  3JSM A;  2KFN A;  4W5Q A;  3CCE N;  4O4G A;  4OVL A;  5JVH L;  5KGW A;  4JRQ A;  3IMX A;  4OGE A;  4H0T B;  4CES A;  3NCI A;  2HHW A;  4JHD A;  4FWL A;  3RRH A;  4H5N A;  3LPT A;  1RT1 A;  3OBY A;  1HKB A;  2YCH A;  4DV0 K;  5LJW A;  4J2A A;  3LDP A;  4E89 A;  5C10 A;  5KTQ A;  3VPZ A;  2LSN A;  3C7N A;  1TK5 A;  1G15 A;  2NRH A;  4J8F A;  2B5J A;  1YIJ N;  4CJ5 A;  4U67 L;  1C6V A;  1BI4 A;  4DQP A;  4E7L A;  3N4P A;  1BCM A;  3V9Z A;  2NRW A;  3T1A A;  3SV4 A;  3PO5 A;  4IWV A;  4H5W A;  1JL1 A;  4DKW A;  4NXN K;  4CD3 A;  2QKK A;  1WB9 A;  1QHA A;  3W0L A;  5IT9 O;  3ZX0 A;  4JKB A;  2PZS A;  5AQI A;  3PX6 A;  3VGM A;  4DTS A;  1BHL A;  2E6L A;  4BDZ A;  5BPL A;  3VTI A;  2OZM A;  2QWR A;  3WNG A;  4MDA A;  4FJ8 A;  1F21 A;  3J80 O;  1IKX A;  3UIQ A;  3K58 A;  2A5X A;  2HBJ A;  1C1A A;  4UY8 O;  3ATU A;  3U8X A;  3ZSY A;  3C95 A;  4DTU A;  1CZ9 A;  5AZJ A;  3OYJ A;  5HP1 A;  1EX4 A;  2A42 A;  3SBG A;  1TKZ A;  4AF1 A;  1BA1 A;  4RW6 A;  5KPR A;  4LH5 A;  1TKT A;  4QS7 A;  1TKX A;  1KC8 O;  3E9P A;  5BRF A;  4DV6 K;  3C6A A;  3AA5 X;  1T3V A;  3V9X A;  3E9O A;  3LP2 A;  4M3Y A;  1IO2 A;  3NF8 A;  4PQU A;  2HNY A;  3P38 A;  4Z4C A;  1A5V A;  3K0S A;  3WQT A;  4H4O A;  5ELZ A;  4PWD A;  4AHV A;  4B3R K;  4I2Q A;  3LZI A;  1N34 K;  3G25 A;  4CJ3 A;  4CHY A;  3VER A;  2P9N B;  3LP3 A;  4HUG A;  2Q1N A;  1BOT O;  4BDY A;  1MWK A;  1HKG A;  1VQP N;  2QXL A;  1NJI O;  1C1B A;  2W40 A;  1OH8 A;  4A59 A;  4CIF A;  4JEP A;  1U45 A;  1FKO A;  4Q5V A;  4FM0 A;  3J8A A;  4DLE A;  3J7Z O;  3LWM A;  3CFR A;  1YI2 N;  4IG0 A;  1RT7 A;  1WSH A;  1SAZ A;  3O3G A;  4JS4 A;  1ASV A;  1HJR A;  4DUZ K;  1RBS A;  3DOK A;  4JYA K;  2XRI A;  3OJS A;  4LC9 B;  1HX1 A;  3G71 N;  4JK7 A;  1KLN A;  4FJG A;  3JXU A;  3DRP A;  1ZC6 A;  3ULE A;  4JKF A;  4CEQ A;  2O8E A;  1NGI A;  2OPP A;  4E19 A;  4BC5 A;  1C0G A;  3BUZ B;  5CYQ A;  3HM9 A;  5J2Q A;  4IO8 A;  1QQM A;  2ZF5 O;  1IKY A;  5LJV A;  4AHC A;  4BRQ A;  4BRF A;  3SLC A;  4X66 K;  4G1Q A;  4O5F A;  3M8R A;  3THV A;  3THW B;  1JLA A;  3V9S A;  2E8A A;  4XH4 A;  3CJ1 A;  4B1V A;  1S72 N;  3D6R A;  4IFV A;  3AA3 A;  1GLL O;  4YOV A;  2G8V A;  3BP8 A;  2E5L K;  4K42 A;  1HYS A;  3L2Q A;  3CG7 A;  3O6W A;  3CMA N;  4CEE A;  3KK1 A;  1GLF O;  2UXC K;  4FWR A;  3CFP A;  2D0C A;  1LAW A;  4KAZ A;  3A0I X;  4KHP K;  1U2V A;  3V1Q A;  3KJV A;  4CFB A;  2E20 A;  3CCS N;  1NGC A;  4ID1 A;  1KVA A;  3ZT4 A;  1HYZ A;  4WFB L;  2Q2R A;  2OPQ A;  3KK7 A;  1RIL A;  4KHN A;  4ELV A;  4MFB A;  4CZH A;  3V4I A;  3V9U A;  1R59 O;  4M3T A;  2FC0 A;  1RT2 A;  3SCX A;  3F2K A;  3H1V X;  1N5Y A;  1DEJ A;  3LDO A;  4HTU A;  1WSG A;  4CZG A;  4YY3 K;  4FVU A;  1NGA A;  3CM6 A;  1JLE A;  4K8X A;  3OYH A;  3ISN C;  3CD6 N;  1SKR A;  4LY7 A;  4CZL A;  2VWK A;  3QET A;  2KW4 A;  3UE5 A;  2D5R A;  3VQC A;  3OS0 A;  4CJT A;  1K8A O;  1RT4 A;  4W5R A;  1J5E K;  5HOO A;  4J2D A;  5I9E B;  3R3L A;  4YFU A;  5HBM A;  4IDH A;  1Y64 A;  4CJF A;  1N8R O;  4O5B A;  4R5P A;  2I5J A;  4KB0 A;  4EP4 A;  4DV1 K;  3OYM A;  3VEV A;  1XI1 A;  4I6M A;  4DTP A;  4ELT A;  3NH2 A;  3MX5 A;  1O1W A;  3OYK A;  1N6Q A;  4DR6 K;  2HHX A;  1YXQ A;  4BG9 A;  4CJQ A;  2KZZ A;  3LZJ A;  3VA0 A;  4PKH A;  3CCQ N;  1LW2 A;  1QQC A;  1Q86 O;  4BG8 A;  3MXM A;  3PX0 A;  4KH5 A;  3D0P A;  1NJX A;  3HP6 A;  5F1X A;  4ZTF A;  3AA4 A;  2YNH A;  3CQ8 A;  2JWK A;  3DLE A;  5TKW A;  2O8D A;  2P9N A;  1SUQ A;  4DFJ A;  1D9F A;  1S6P A;  4FO0 A;  1T7P A;  1XHZ A;  3TU5 A;  2E6M A;  4B1Z A;  4IO9 L;  4DR2 K;  3ZCM A;  4M42 A;  4UQG A;  5M1N A;  1C0F A;  1B9D A;  5KGX A;  1FK9 A;  1BGX T;  5BRH A;  2Q0R A;  1GLD G;  4HHT A;  2ZJQ L;  4LF9 K;  2XY8 A;  2NZT A;  2E2O A;  4GVM A;  2R7Y A;  4O44 A;  1SL1 A;  3PSI A;  5E26 A;  5HRR A;  4CHP A;  2ASM A;  1JLF A;  3F9K A;  3IRX A;  5BR9 A;  4M3W A;  4CGJ A;  3OYG A;  2RN2 A;  1I3A A;  3MMV A;  5DM7 L;  3J81 O;  1R0A A;  3HYF A;  1HNZ K;  3HT3 A;  4H0O A;  4JI7 K;  4AM7 A;  4CJE A;  3AAR A;  3SMP A;  3J7Y P;  3RWU A;  4FLW A;  5BPN A;  2IVN A;  3EEQ A;  5JVG L;  5C42 A;  5C25 A;  2YV0 X;  4JAX A;  3Q7B A;  3DLH A;  3DOL A;  4HCB A;  3NH0 A;  2QA4 N;  1FKP A;  1HYV A;  3ITH A;  4DFK A;  1Q8I A;  4CK2 A;  1X9J A;  3B6O A;  2B4J A;  4B3S K;  3G4S N;  1HNV A;  3ZT2 A;  4GY2 B;  4BR4 A;  2IVP A;  4GW6 A;  3SUQ A;  4GV3 A;  3CJA A;  3LAL A;  3WXK A;  1NGF A;  3DMJ A;  1MU2 A;  3T3F A;  1BQN A;  4F2S A;  1X3N A;  3MAQ A;  3GL1 A;  4KV8 A;  2BAN A;  1REV A;  3I55 N;  3TAE A;  2HF3 A;  4DTO A;  2KKZ A;  3P4I A;  4A5B A;  5HRS A;  1VQO N;  5C2D A;  3R6M A;  3IAY A;  2VGM A;  3D2E B;  4C8M A;  4EZ9 A;  1BDG A;  2A6A A;  1C0U A;  1RDU A;  1KQS M;  2Y1J A;  5ADX H;  2OCE A;  3H08 A;  5AQG A;  2QTD A;  3VOV A;  4AH9 A;  1CZA N;  4MO4 A;  3WXJ A;  3C6H A;  5BRE A;  5J1E A;  3N4Q A;  4EIA A;  1QZ5 A;  3EE9 A;  1LW0 A;  4FJI A;  3QML A;  1OKJ A;  4JKE A;  2HHU A;  4BGA A;  1VQ7 N;  3AVG A;  2NRX A;  4CZI A;  1VSM A;  3AGK A;  1S9E A;  1YUW A;  3A8Y A;  2E1Y A;  1W2B M;  4OO1 J;  1J54 A;  4FWQ A;  4BRC A;  3DAW A;  1YAG A;  5LMN K;  4Z0U A;  1WBB A;  1YTA A;  2P9P B;  3ZSO A;  1KFS A;  2P51 A;  1WOQ A;  1XWL A;  4E7I A;  4FYD A;  3O4Q A;  5AQT A;  3DRS A;  5M1F A;  4QCL A;  4H8K A;  3KKS A;  3L3V A;  5B8H A;  3DXK B;  4DU4 A;  4M45 A;  3JAM O;  1HRH A;  1XC3 A;  1VSK A;  3LM9 A;  4Z4I A;  4FPA A;  5T7B A;  4BWJ A;  2FLO A;  3KD1 E;  2QWN A;  3ZLJ A;  1DTT A;  4ICL A;  1CZB A;  5GAG P;  2GUP A;  3OVN A;  1I94 K;  5BN9 A;  4E7H A;  1QQO A;  5MLC Q;  5LY3 A;  4J2B A;  3NVK A;  1ZBL A;  3TSU A;  1DTQ A;  2A1R A;  3D2F A;  3FZK A;  1NK7 A;  1XNQ K;  3O8M A;  3DLR A;  1HNI A;  1ZBU A;  3VGL A;  2YHA A;  1HLU A;  1VSI A;  4FVM A;  4FL9 A;  2Y1I A;  1RTH A;  2GUI A;  4AHR A;  1N36 K;  2KHO A;  3ZSR A;  2ZE2 A;  3SUO A;  1M1K O;  4CZF A;  3MN7 A;  4DQ8 A;  2RKI A;  4Y0W A;  4QAG A;  1RBR A;  4KTW A;  4OX9 K;  4F9O A;  1SV5 A;  4B3O A;  4FLZ A;  4NLC A;  3QER A;  3QEP A;  3LDQ A;  1J53 A;  3AVH A;  4FW1 A;  4CJV A;  3VQ8 A;  4CCH A;  3VQB A;  1QE1 A;  4IEI A;  3MN6 A;  4I9Q A;  4RCH A;  4FM1 A;  1VSL A;  2F7T A;  3SQ0 A;  1SKS A;  1W9H A;  4CHQ A;  3D45 A;  4DCH A;  3HRG A;  4BRH A;  4F2R A;  1D4X A;  4N76 A;  3HPO A;  2GWK A;  3V81 A;  1RT6 A;  2W6L A;  2ZGZ A;  3EE8 A;  1ESV A;  3VEX A;  2OYQ A;  3I33 A;  1CLQ A;  4OPA A;  1BO5 O;  4CFD A;  3VGK A;  1B9F A;  1ZBF A;  1KSP A;  3HP9 A;  4B9V A;  2P9S A;  4BC2 A;  1DKG D;  5E41 A;  3U9Z A;  3WT0 A;  3RRG A;  1A5W A;  3DXM B;  4Z4E A;  4DTM A;  5LL6 Z;  1C1C A;  5GIN A;  1YJW N;  4NCB A;  1U04 A;  3CJ7 A;  5HRN A;  3L8B A;  1OVY A;  1YJN N;  3H6E A;  1E4G T;  3ZT3 A;  4IZ9 A;  4FM2 A;  1HMV A;  4AHU A;  2FSJ A;  2QWM A;  5FLX O;  1BQM A;  4DS5 A;  2E4L A;  2GTD A;  1GLA G;  1S1X A;  2FSK A;  5SZT A;  4CEA A;  3U3G A;  2DFE A;  2HBL A;  1ASW A;  1T6D A;  3LDN A;  4KH4 A;  4JKH A;  2JGU A;  4MLE A;  4QS9 A;  5GAE P;  4K43 A;  2GWJ A;  3AVL A;  1X9S A;  3NF9 A;  1TUU A;  4KKO A;  3QIP A;  3BZC A;  3FR0 A;  4FJ7 A;  5EX5 A;  1RDB A;  2IOC A;  4FJH A;  1H1V A;  4WCE L;  3QNN A;  4B8A B;  3TAM A;  5DM6 L;  3VQP A;  4ILH A;  2YKM A;  1KLM A;  5JIC A;  1NKB A;  4NB4 A;  5JMV A;  2XY5 A;  2P9U B;  4DQS A;  3ZSZ A;  2Z1G A;  5TKY A;  1YVN A;  5DK5 A;  4FLU A;  3AVF A;  1T6C A;  4B9S A;  1CXU A;  4A2B A;  3CC2 N;  3S3M A;  4GKJ K;  3IUC A;  4CJU A;  4TSX A;  2ZJR L;  4CBW A;  3AVB A;  1BIS A;  3SAG A;  2HW3 A;  4C23 A;  4CJ7 A;  5FDL A;  5HL7 L;  4EFH A;  3QLH A;  5CR4 A;  2CGJ A;  4DR3 K;  3OHR A;  3SNN A;  3EKU A;  3ULE B;  3BDP A;  4KO0 A;  3AV9 A;  2RHK A;  2O8B A;  1NGE A;  1GLC G;  5I3U A;  4DV5 K;  3WNE A;  2HB5 A;  4N41 A;  1NK6 A;  3A2F A;  4B08 A;  4YOY A;  3IG1 A;  5AJ3 K;  1WSF A;  1WN7 A;  3P39 A;  2HHV A;  3DLL L;  3VQ4 A;  2AP1 A;  3CCU N;  4OKJ A;  2UXB K;  3L6Q A;  1TL3 A;  2YJF A;  1W7A A;  4CF1 A;  4N47 A;  3THX A;  4FZX C;  2UUB K;  3TAQ A;  3OYD A;  2X74 A;  3W3D A;  4RW4 A;  3RMB A;  1YJ9 N;  3HOT A;  1LV5 A;  5JLF A;  3AAQ A;  4OPK A;  4LF7 K;  1VQ6 N;  4CD1 A;  1U2V B;  2D0A A;  3GE1 A;  4AHS A;  3AVI A;  4E1M A;  4KH6 A;  1RTJ A;  1JLG A;  3VQA A;  3G10 A;  3QBW A;  1EWR A;  1VRT A;  2P9K A;  2DFH A;  3LL3 A;  3O3H A;  4ISE A;  4WFA L;  4FK2 A;  4ILG B;  2YHB A;  2OPS A;  4JI2 K;  3KKR A;  3S3N A;  3OJU A;  2G8W A;  2XHB A;  3K5M A;  1TK0 A;  4X64 K;  3THW A;  4E3S A;  4E1N A;  1RFQ A;  3BF3 A;  1OH5 A;  3ENH A;  2E88 A;  1Q9X A;  2HND A;  4I9L A;  3T1H K;  4M3Z A;  3FE1 A;  4Z4G A;  2CGL A;  4F8R A;  3THY A;  4F3T A;  3SUP A;  3ASM A;  3S41 A;  3JYT A;  3DM2 A;  4ISG A;  2Q36 A;  3O3F A;  2YNG A;  4C8K A;  1B92 A;  2VCP A;  1RBV A;  4CF0 A;  4B9U A;  1S6Q A;  3EKS A;  2P5G A;  1T44 A;  4WF9 L;  3MN5 A;  1Q82 O;  4FJM A;  4BR7 A;  1VSE A;  3ZET B;  3G6E N;  3V1R A;  3U6F A;  3TAP A;  1VQ4 N;  4Y1C A;  4KI4 A;  1OH7 A;  2P9I B;  3SJJ A;  3O1W A;  3L2R A;  4OKK A;  3EN9 A;  1Q9Y A;  3P31 A;  2PYJ A;  4MLH A;  2YJE A;  4JKA A;  2GV9 A;  4OKE A;  5BPM A;  4CJL A;  4DV3 K;  2BDP A;  1UWB A;  2W42 A;  4EZ6 A;  3CCL N;  2BUP A;  1VQM N;  2DFF A;  2HBK A;  2DY4 A;  1GLB G;  2IIR A;  3DXK A;  4CVN E;  5M1P A;  3ZSX A;  1NGJ A;  4Y1D A;  3GOI A;  1NOY A;  3F73 A;  3S9H A;  1NGD A;  3ZSW A;  4GKK K;  3CET A;  3HI0 A;  2WBN A;  2F8S A;  3AO1 A;  4O8U A;  1YT3 A;  2WC9 A;  2Q97 A;  3AA2 A;  3L0Q A;  4LFC K;  1IH7 A;  5JS2 A;  3DLK A;  1HNW K;  5FRM A;  5AZJ B;  3NDK A;  2KQ2 A;  1W0H A;  3VQ6 A;  3VQQ A;  3OBW A;  1TK8 A;  4H03 B;  2ITG A;  4BR5 A;  4DG1 A;  4FLY A;  3CPW M;  2RF2 A;  1JCG A;  4JHD B;  5FPN A;  2OPR A;  1Z6R A;  4JKD A;  1NKC A;  4BQL A;  3CCR N;  4DR5 K;  1IKV A;  2PBD A;  3NF7 A;  1W97 L;  2WUS A;  1JCF A;  4RW9 A;  2FBX A;  5FPM A;  2AJQ A;  1RDW X;  1IG9 A;  4BQZ A;  3LDS A;  1NU0 A;  3UKR B;  4YNQ A;  3J7A P;  3OY9 A;  3WUH A;  3PLA A;  3WNF A;  5C0Y A;  2P9L A;  5DMR A;  2Z1H A;  3NGZ A;  5AZI B;  4EP5 A;  5K14 A;  3O4W A;  3CIP A;  3CCV N;  4PHT X;  1ASU A;  4ISF A;  1Q7Y O;  4OGC A;  4KI6 A;  3MXJ A;  5FRO A;  1Q81 O;  5C2F A;  3CJB A;  4DSE A;  1L5U A; 
#chains in the Genus database with same CATH homology
 3QML A;  1OKJ A;  4JKE A;  2FF3 B;  5AFU H;  4BRE A;  4IOA L;  4OPH A;  4BGA A;  2NRZ A;  1VQ7 N;  2ZJP L;  1WUA A;  1V4T A;  2NRX A;  4BRD A;  4CZI A;  4B1U B;  1KD1 O;  2E2N A;  3AGK A;  3A5M C;  2GEL A;  1YUW A;  3A8Y A;  1QQN A;  2E1Y A;  4M63 C;  3CCE N;  1W2B M;  2JWL A;  5JVH L;  4OO1 J;  4FWQ A;  2WFB A;  4BRC A;  2CGK A;  3C7N B;  3DAW A;  5GIO A;  1YAG A;  4IFE A;  3IMX A;  3IDH A;  4H0T B;  1QVG M;  2J4R A;  4PKI A;  1KXP A;  4JHD A;  2P9P B;  3ID8 A;  4FWL A;  4A5A A;  3D2F B;  4H5N A;  2QM1 A;  3OBY A;  1ATS A;  4JK9 A;  1WOQ A;  2NRR A;  1HKB A;  3CCJ N;  2YCH A;  4QS8 A;  5LJW A;  3LDP A;  5AQT A;  5AQQ A;  5C10 A;  3VET A;  5M1F A;  3VPZ A;  3C7N A;  2NRH A;  1ATR A;  3CJ9 A;  3O9T A;  5B8H A;  2I7N A;  3DXK B;  4O8K A;  4XH1 A;  4J8F A;  1YIJ N;  3K9K A;  3RSE B;  3ZX3 A;  3CI5 A;  1XC3 A;  4U67 L;  3LM9 A;  3N4P A;  4FPA A;  3UKR A;  1DT9 A;  2NRW A;  3VEW A;  2P9U A;  5AQJ A;  4R79 A;  2FLO A;  4IWV A;  4FWN A;  1K8K B;  4YOT A;  2QWN A;  4H5W A;  4CZJ A;  4DKW A;  4CD3 A;  3MWP A;  1VQL N;  3CC4 N;  4C1N I;  2GUP A;  4MO5 A;  4CZK A;  5GAG P;  2YHW A;  3MCA B;  3CXC M;  1K9M O;  5BN9 A;  1QHA A;  1ZBS A;  3CHW A;  3W0L A;  4EAH D;  1QQO A;  5MLC Q;  5LY3 A;  3HOS A;  3WEE B;  3NMU A;  4HTL A;  3NVK A;  3ZX0 A;  4JKB A;  5KPT A;  3TSU A;  3H3N O;  5AQI A;  3VGM A;  3HM8 A;  3D2F A;  3FZK A;  2FSN A;  2P9S B;  3KZB A;  4GNI A;  3O8M A;  4WFN L;  5F2R A;  1IG8 A;  3CF5 L;  4WQ5 C;  3VGL A;  4YDU C;  4HWI A;  5BPL A;  5BRD A;  3VTI A;  3FGU A;  1HLU A;  4FL9 A;  2V7Y A;  2QWR A;  4MDA A;  5AQW A;  2KHO A;  5AQV A;  1M1K O;  4CZF A;  3MN7 A;  5AQR A;  3SMS A;  4DQ8 A;  2A5X A;  3SAF A;  4A57 A;  2HBJ A;  4UY8 O;  4H0V B;  4Y0W A;  3ATU A;  3U8X A;  4DHY A;  1NM1 A;  5AZJ A;  2F9T A;  4F9O A;  5EOY A;  4NLC A;  1NWK A;  2A42 A;  4B1W B;  3LDQ A;  3SBG A;  4AF1 A;  1YHQ N;  1BA1 A;  1DGK N;  5KPR A;  4QS7 A;  4EHU A;  4JK8 A;  4IEI A;  2VYP A;  1KC8 O;  3MN6 A;  2QWQ A;  3E9P A;  3U9D A;  5BRF A;  1BUP A;  4BRL A;  1QZ6 A;  4RCH A;  2F7T A;  3FZM A;  3DWL A;  3C6A A;  2VGN A;  2V7Z A;  2CH5 A;  2EWS A;  4BRN A;  1NMD A;  1BWF O;  3KWI A;  1VQ8 N;  4JNE A;  1T3V A;  1SZ2 A;  3E1Y A;  3E9O A;  3D7E O;  2ZWH A;  4DCH A;  4EHT A;  1TYQ B;  3HRG A;  4KBO A;  2OTJ N;  2DPN A;  4BRH A;  1G99 A;  3TTC A;  3P38 A;  1D4X A;  1XQS C;  2GWK A;  3LDL A;  4JD2 A;  2ITM A;  3WXI A;  2ZGZ A;  4C1N K;  3EE8 A;  1ESV A;  3VEX A;  4YOW A;  3I33 A;  1X3M A;  4K25 A;  1S22 A;  5ELZ A;  4OPA A;  4YOR A;  1BO5 O;  3WQT A;  1V4S A;  2HST A;  4FWP A;  1HKC A;  3HSC A;  3O9Q A;  3VMF B;  4NO7 A;  3VGK A;  3SAH A;  3G25 A;  1E4F T;  2D4W A;  2I7P A;  3VEY A;  2P9S A;  3VER A;  2P9N B;  4H5R A;  1Z05 A;  1DKG D;  3ZEU A;  4BC2 A;  2Q1N A;  3U9Z A;  1BOT O;  3AY9 A;  3GBT A;  3WT0 A;  5GIP A;  2FF6 A;  4H0X B;  3KVG A;  1MWK A;  1HKG A;  4BRM A;  3DXM B;  4CZE A;  1VQP N;  2QXL A;  1NJI O;  3EL2 A;  5C12 A;  3SBT A;  2W40 A;  4WQ5 A;  5GIN A;  3CPE A;  4A59 A;  2P9P A;  1YJW N;  1KAY A;  4CBU A;  4JEP A;  3CJ7 A;  2W41 A;  4JKG B;  3J8A A;  1LCU A;  1OVY A;  3H6E A;  3M5R A;  1E4G T;  3J7Z O;  3T69 A;  1YJN N;  1YF5 L;  4IZ9 A;  1YI2 N;  3D2E A;  2Q0U A;  1SAZ A;  2FSJ A;  1SQK A;  2QWM A;  4BRP A;  4BR9 A;  1VAZ A;  4IEE A;  4A2A A;  4FWM A;  4WYB A;  4LC9 B;  4BY9 C;  1HX1 A;  2GTD A;  1J6Z A;  4FSV A;  4FWS A;  1GLA G;  3G71 N;  4JK7 A;  2FSK A;  1GLJ O;  3AGR A;  2E1Z A;  3LDN A;  2HBL A;  1T6D A;  3JXU A;  4B1X B;  4KH4 A;  5AQZ A;  1ZC6 A;  3EO3 A;  3F5T A;  4JKH A;  4MLE A;  4JKF A;  4QS9 A;  2HBM A;  4K43 A;  3ULE A;  2GWJ A;  5GAE P;  1TUU A;  3FR0 A;  1NGI A;  2QWL A;  4BC5 A;  4H5T A;  1C0G A;  3BUZ B;  5EX5 A;  1QVF M;  4IO8 A;  3OA9 A;  2ASO A;  1H1V A;  1QQM A;  2ZF5 O;  4WCE L;  5LJV A;  4BRQ A;  3JS6 A;  4BRI A;  4BRF A;  3SLC A;  4FWO A;  2OTL N;  5DM6 L;  4O5F A;  4ILH A;  5F0X A;  3QIC A;  5JIC A;  4NB4 A;  3UKU B;  5JMV A;  2P9U B;  3SK3 A;  2E8A A;  4XH4 A;  3I8B A;  3CJ1 A;  4B1V A;  1S72 N;  3D6R A;  2YI1 A;  5TKY A;  1P90 A;  1YVN A;  4U7B A;  1T6C A;  1NGB A;  2RE2 A;  1GLL O;  3M6G A;  4M7Y A;  4JKG A;  3BP8 A;  4A2B A;  2UYT A;  4BR2 A;  4YOV A;  3CC2 N;  3IUC A;  3FZF A;  3QB0 A;  4K42 A;  4CBX A;  3O08 A;  4CI6 A;  2ZJR L;  4B1Y B;  3ENO A;  3O6W A;  4CBW A;  3EZW A;  5CHI A;  3CMA N;  3E66 A;  1GLF O;  1O13 A;  5AQS A;  3KWG A;  4FWR A;  4I6M B;  3SAG A;  3A0I X;  4C23 A;  1U2V A;  4JKC A;  2P9K B;  2QI2 A;  1ATN A;  2ASP A;  3TSP A;  5CR4 A;  4CJ7 A;  1SS6 A;  4EFH A;  5KQ8 A;  5HL7 L;  3B8A X;  2CGJ A;  2P9L B;  1EQY A;  2E20 A;  3O9R A;  2P9I A;  1U6Z A;  3O9U A;  2FXU A;  3OHR A;  3CCS N;  1HJO A;  1NGC A;  3EKU A;  3QFU A;  3RVC A;  3ULE B;  4YOX A;  4WFB L;  3L4I A;  2Q2R A;  3H46 O;  4BC4 A;  3KK7 A;  2RHK A;  2IVO A;  4BVO A;  2GEM A;  1NGE A;  2VWB A;  3QBX A;  1KAZ A;  3VEN A;  1IJJ A;  1GLC G;  4CZH A;  1ILY A;  2PFU A;  3ATV A;  1BU6 O;  4H0Y B;  2D0P A;  5EVZ A;  1R59 O;  2CH6 A;  3MK6 A;  3NVM A;  1HPM A;  4WQ4 A;  4YOY A;  1HUX A;  1NGH A;  2NNW A;  3F2K A;  3H1V X;  1DEJ A;  3LDO A;  3MWT A;  3P39 A;  5AR0 A;  3WQU A;  2QW9 A;  4CZG A;  4WQ4 C;  3DLL L;  1VQK N;  4FVU A;  4YDU A;  1NGA A;  2AP1 A;  3CCU N;  5KPZ A;  1VQN N;  3M3Z A;  3CER A;  3L6Q A;  2YJF A;  2D1K A;  2YX6 A;  3UB5 A;  3CD6 N;  4BRO A;  4K41 A;  4CZL A;  3ZYY X;  3TTF A;  3UE5 A;  3H45 C;  3W3D A;  1YJ9 N;  3HOT A;  5M1O A;  3TSQ A;  3AAQ A;  5JLF A;  1VQ6 N;  5FPE A;  1BG3 A;  1K8A O;  4CD1 A;  1U2V B;  1K73 O;  3H3O B;  3GE1 A;  3O80 A;  3FZL A;  4KH6 A;  4E1J A;  5HOO A;  5I9E B;  3R3L A;  4IDH A;  1Y64 A;  1N8R O;  4XH5 A;  3QBW A;  2P9K A;  5M1Q A;  3LL3 A;  5AFU A;  4ISE A;  3CC7 N;  3A5L C;  3VF4 A;  5AQN A;  3M1F A;  3VEV A;  4WFA L;  4ILG B;  4I6M A;  3KHY A;  3MX5 A;  3VF2 A;  4AM6 A;  4FOI A;  4BRK A;  1MWM A;  3FZH A;  4FPB A;  3UKU A;  1YXQ A;  3GDQ A;  4BG9 A;  4H0P A;  1RFQ A;  1S3X A;  3BF3 A;  3ENH A;  4PKH A;  3CCQ N;  3GG4 A;  1TUY A;  1Q86 O;  2H3G X;  2A3Z A;  2E88 A;  3VES A;  4BG8 A;  2NLX A;  4L3Q A;  4GV9 A;  4KH5 A;  4BR0 A;  5F1X A;  3MN9 A;  3FE1 A;  2CGL A;  2JWK A;  5TKW A;  5JLH A;  3BF1 A;  3O9S A;  2P9N A;  3O5B A;  3AAP A;  2AA4 A;  2NRV A;  3F9M A;  4BRA A;  3MX2 A;  5AQO A;  3S41 A;  3CJC A;  4FO0 A;  3ZET A;  4ISG A;  2KLA A;  4MDB A;  2Q36 A;  5AQL A;  2QWP A;  1JJ2 M;  5EY4 A;  2V51 B;  3R1X A;  1RGI A;  3TU5 A;  4BRG A;  3I56 N;  2VCP A;  3QFP A;  3C65 A;  4IXC A;  3ZX2 A;  4RTF D;  3EKS A;  3C0B A;  1T44 A;  4B1Z A;  4IO9 L;  4WF9 L;  3T7Z A;  3MN5 A;  1Q82 O;  4ILJ A;  3VF6 A;  5M1N A;  2NRT A;  1MDU B;  4BR7 A;  1C0F A;  3PIP L;  2QEX N;  5GAH P;  4FOE A;  1KAX A;  4JN4 A;  2BTF A;  3ZET B;  3G6E N;  3CQY A;  5KQD A;  5GAD P;  5BRH A;  2Q0R A;  4XEI A;  4YOU A;  3PIO L;  1GLD G;  4BGB A;  1GLE G;  5AQF A;  5ADX A;  3WXM B;  2ZJQ L;  1VQ4 N;  2P9I B;  4A62 A;  2NZT A;  2E2O A;  5AQM A;  3MCP A;  3O1W A;  4B9Q A;  4BVP A;  3L4Q A;  3EN9 A;  2YHX A;  5E26 A;  3P31 A;  3TTD A;  4MLH A;  2ASM A;  1NGG A;  1ZXO A;  2YJE A;  4JKA A;  1K8K A;  3SJH A;  5BR9 A;  3IFR A;  2ZGY A;  5BPM A;  5FPD A;  4BC3 A;  3R8E A;  3A5O C;  3MMV A;  1NLV A;  3QDK A;  1TYQ A;  3H1Q A;  5AQX A;  3ENB A;  5C15 A;  3BEX A;  4A61 A;  5DM7 L;  3CCL N;  2A40 A;  2BUP A;  1VQM N;  1P8Z A;  2HBK A;  4GVE A;  3RSE A;  1Q18 A;  4FWK A;  4H0O A;  5AQU A;  1GLB G;  2IIR A;  3DXK A;  2Q31 A;  4AM7 A;  1EO1 A;  1LOT B;  3AAR A;  5M1P A;  3SMP A;  1NGJ A;  5AQP A;  2E2Q A;  1NBW A;  3IKM A;  5BPN A;  3CCM N;  2IVN A;  2F9W A;  3GOI A;  3WXL A;  5BN8 A;  5JVG L;  2A41 A;  1NGD A;  3ID6 A;  5CE3 A;  4JAX A;  3CET A;  3HI0 A;  3Q7B A;  3ZEU B;  2WBN A;  4PL7 A;  2QA4 N;  3U4L A;  4O8U A;  3CQX A;  1X9J A;  2HOE A;  2WC9 A;  2Q97 A;  3L0Q A;  3G4S N;  5AQY A;  4GY2 B;  4CZM A;  4BR4 A;  4Z94 A;  3K9J A;  2IVP A;  5AZJ B;  3LM2 A;  3Q7C A;  4GV3 A;  3CJA A;  3WXK A;  1NGF A;  3R9P A;  3OBW A;  4H03 B;  1X3N A;  4IOX A;  2BH1 A;  3FLC O;  4BR5 A;  3GL1 A;  4G9Z A;  3CPW M;  3I55 N;  1MA9 B;  3TPQ A;  2HF3 A;  3VEZ A;  1JCG A;  3HBT A;  3FFK B;  4JHD B;  2KKZ A;  3P4I A;  5FPN A;  4RWT A;  1Z6R A;  1YIT N;  4JKD A;  4A5B A;  1M90 O;  4H5V A;  4BQL A;  3CCR N;  2PBD A;  4DB3 A;  3MDQ A;  1VQO N;  5C2D A;  1W97 L;  3R6M A;  2WUS A;  4IJA A;  1JCF A;  2D0O A;  4IJN A;  4M7X A;  2VGM A;  1BA0 A;  3CME N;  3O1B A;  5FPM A;  3D2E B;  1RDW X;  4GV6 A;  1BDG A;  2A6A A;  4PKG A;  3VTH A;  4BQZ A;  1VQ9 N;  3UKR B;  2QWO A;  1RDU A;  1XUP O;  2PAV A;  3WUH A;  3PLA A;  5C0Y A;  2P9L A;  3VEO A;  3DJC A;  4IOC L;  1KQS M;  5AZI B;  5M1K A;  3HZ6 A;  5ADX H;  2GX9 A;  3O4W A;  1VQ5 N;  3CIP A;  3WEE A;  3CCV N;  3A5N C;  5AQH A;  2V52 B;  2QTD A;  3DXM A;  5AQG A;  3VOV A;  4PHT X;  5E84 A;  1JCE A;  1CZA N;  2E2P A;  4ISF A;  4NLB A;  1Q7Y O;  2HMP A;  3E9L A;  2YHY A;  4MO4 A;  5AQK A;  3WXJ A;  3C6H A;  2OAN A;  5EXW A;  5BRE A;  1Q81 O;  5C2F A;  2HF4 A;  5H1S Q;  3N4Q A;  4EIA A;  3CJB A;  3HTV A;  1QZ5 A;  4JD2 B;  5AZI A;  3OW2 M;  4PL8 A;  3EE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...