1ASVA

Avian sarcoma virus integrase catalytic core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title High-resolution structure of the catalytic domain of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Dna integration
total genus 49
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1asvA00
3AVBA 3BGRA 1EXQA 1FXXA 4OGCA 3WNEA 4DQSA 3TAGA 5HLFA 3VQ4A 1I3AA 3F73A 3RMAA 3PO5A 1LW2A 4JLHA 4CHYA 3QETA 1J54A 3KK3A 3VQ6A 3DRRA 4TSXA 1HNVA 4FJXA 1XHZA 1X9SA 1ZBUA 4IG0A 3VQEA 2XRIA 3OYKA 4FCYA 5J1EA 4R5PA 3RRHA 1C0UA 2OYQA 4W5NA 4E7JA 1TKXA 4FJ9A 3ZT0A 1BL3A 4E7LA 3CFPA 2RF2A 2YHBA 4OKJA 4E7IA 1RTHA 3F9KA 3LP0A 3TAEA 1BIZA 4HCCA 2KZZA 3NGZA 3AVAA 3SV3A 3DLGA 4PA1A 4B9VA 5EU7A 4OKEA 3SQ4A 3PV8A 2ZE2A 3HT3A 4B9LA 4DLEA 3AO4A 4CF2A 3K59A 4I2PA 4KI6A 1ASVA 4Z4CA 4KI4A 3QIOA 3L8BA 1O1WA 1QHTA 2QXFA 5J2PA 4M42A 3OVNA 4B8CA 1TK8A 1XI1A 1TV6A 1NK0A 2VG7A 4CFBA 2VWKA 2VWJA 2HHQA 3LP3A 4FW1A 3RMBA 4DSIA 3VQ5A 4FZXC 3NGYA 4ELUA 4HUEA 5I3UA 3OYFA 3NHGA 3AVKA 3HK2A 1HYVA 3SYZA 1NKCA 2Q3SA 1JLFA 1RT5A 4CGJA 3AVNA 1NK4A 3QEWA 1YT3A 1EETA 3LALA 4Y1DA 1FKPA 2E6LA 4WE1A 1X9WA 4KTZA 1LWEA 2NUBA 3WNHA 2KQ2A 3AA5X 4AILC 2HHWA 4CF0A 4W5RA 3V81A 3OYNA 4ELVA 4CHNA 4CJWA 3LWLA 2HHXA 1C0MA 1NJYA 2Z1HA 3TI0A 1JLEA 2G8KA 3B6PA 3NCIA 3LP1A 1BISA 4DFPA 5DMRA 3NH2A 2RKIA 4DTJA 4NCBA 1HNIA 3VA0A 4M3WA 1RDAA 3M8PA 4K8ZA 4FZZA 2QKBA 4FVMA 3AVMA 1X1PA 4FK2A 4E1NA 4LSLA 4Y1CA 3ZSXA 5HRRA 2F96A 2X6NA 2A1SA 1NJXA 4DQPA 1SV5A 4IBNA 3DLKA 4CECA 2HNZA 4FLTA 1QSSA 1RT7A 2VG5A 3ZSQA 3AVHA 2IS3A 3OYHA 1RBVA 1XC9A 5SWMA 4DU1A 1VSLA 1T03A 3MXJA 2BGGA 4N47A 3KLIA 3ZT3A 1JKHA 2YKNA 1IKVA 1RDCA 1CZ9A 4BDZA 1NK9A 4IKFA 4M3TA 4F3OA 2Z1JA 1BI4A 4DTXA 1NOYA 2HB5A 4FM2A 3ITHA 3QESA 4PUOA 1HQUA 4AHRA 3CG7A 5HROA 3L2QA 1SKSA 3AVJA 1WSGA 4DSJA 2XY7A 4PY5A 2P5OA 2DFHA 3NFAA 4F2RA 1KVBA 1B92A 1DTTA 2A1RA 4CEZA 3NF6A 3AO3A 5FRMA 1NKBA 3NH0A 1IKWA 1N5YA 5J2NA 3AVIA 2FC0A 4FJLA 1DLOA 1RDDA 1HYZA 3O3HA 4O5BA 4KKOA 4PWDA 4ICLA 3KK2A 4NCAA 1WSIA 4NYNA 2E6MA 3VQ9A 4DF4A 2DFFA 4DMNA 3HO1A 1DTQA 1JLGA 1A5VA 1VSFA 2D0AA 4FLYA 4CFDA 3QEXA 1SKRA 1Y97A 3OYMA 2PYJA 5KGXA 4CJTA 3EY1A 4CJFA 4KB1A 4M41A 3NBPA 5KTQA 5J2MA 3SUOA 3SNNA 3S3OA 1UA1A 4FK0A 4KHSA 3AA3A 5CYQA 4DFJA 2R7YA 4ZTJA 4FW2A 1LV5A 4J2BA 3RMDA 4JS5A 2G8FA 1L3TA 4C8NA 4O0JA 5E41A 3OS1A 2XY6A 4FJIA 3OYBA 1J53A 1RBRA 3LP2A 5J2QA 3OJSA 5HP1A 4KPYA 3AO2A 3AA2A 4JRPA 4CFAA 2IC3A 3AO5A 4DFMA 1NK8A 1IG9A 1SKWA 3IAYA 4CE9A 4J2AA 4EP4A 1C6VA 3CFOA 3M8RA 3I8DA 4BE1A 2IAJA 4KTQA 4FLVA 1RCHA 3LAKA 4KFBA 4FM1A 1A5XA 3JSMA 3K57A 2ZQBA 3U3GA 3ZSYA 3JYTA 1BHLA 4M45A 2FBTA 4Q5VA 3S3MA 4B9NA 2W42A 2EHGA 4FXDA 3NDKA 4CK2A 4DSEA 4CJLA 1L3VA 4F2SA 2VG6A 3CM6A 1TKZA 2IDOA 3ZT4A 3K2PA 5HRSA 1RDBA 2YNGA 4OPKA 4I9QA 1G15A 3C94A 4DSKA 2YV0X 4GMJB 1UA0A 2F8SA 3WNGA 2OPPA 4KREA 4KRFA 4CEOA 1TKTA 1FK9A 4I9LA 1XWLA 3P83D 1BCMA 1RT2A 1VSMA 3A2FA 3MECA 4CJKA 1JLCA 1JXEA 3M8SA 1N6QA 3CQ8A 3SI6A 2D5RA 4Q0BA 3ZSVA 4IDKA 1C0TA 3IS9A 2JGUA 4N76A 1S1WA 1S6PA 4FJJA 3HPOA 1REVA 3DRPA 3TAMA 3O3GA 4CK3A 4YNQA 4ZTFA 1ZBLA 3ZSWA 1L5UA 4DS4A 2KFZA 2XY8A 1QS4A 1NK7A 1QTMA 4B8AB 1SL0A 4Z4IA 2QKKA 4IFYA 2XY5A 4KO0A 1NK5A 1FKOA 1BCOA 2FBVA 1GOAA 2OZMA 3L2VA 4K8XA 3HP6A 3AA4A 1JXBA 3DYAA 4CHZA 3PX0A 3HVRA 3RR7A 4AHTA 4E7KA 1Z25A 1NK6A 2JLEA 1SL2A 3IRXA 2OPRA 3SUPA 4M3XA 2WOMA 5CZ1A 5CYMA 3DOKA 1YVUA 4XIUA 2HHUA 1KLNA 1Q9XA 4AHUA 4KHQA 3ISNC 3WNFA 1WSFA 2PY5A 3SCXA 1NJZA 3O4QA 1JLAA 1S1TA 2B4JA 3ZCMA 4F8RA 4MQ3A 3HSTB 1RBUA 5KRSA 3OYEA 2G8IA 5C42A 2FBXA 2GBZA 4CGIA 3VQBA 3VN5A 4DTNA 4C8KA 3T19A 4DU4A 2Y1IA 3VA3A 3AVGA 1LAVA 1VRUA 1EKEA 3UIQA 4OPJA 1LWCA 3QINA 4LH5A 1C1AA 1KVAA 2YNIA 2D0CA 4O0IA 3PX4A 3SPYA 4C8OA 4DTOA 1YTUA 3THVA 2QK9A 4Z4EA 2O4IA 1ZYQA 3V9SA 4O4GA 1IO2A 1HRHA 4DQQA 4B3OA 2PZSA 1Z26A 3OS0A 4EZ9A 3MXIA 3SQ2A 1L3SA 4G1QA 4F3TA 2Z1GA 3K5OA 4DTPA 3EZ5A 3OYCA 4J2DA 4O55A 4KB0A 4CJQA 5D3GA 2Z1IA 4ID5A 4AHSA 4HTUA 1TVRA 4W5TA 3QEVA 1U48A 1D9FA 4B9SA 1WAFA 4I2QA 1VRTA 4E7HA 2G8UA 4KHWA 5C24A 2X74A 1RT4A 2DFEA 2YHAA 3L3UA 1RILA 1L3UA 4FYDA 2HMIA 3E01A 1S1VA 4BE0A 1U04A 4OLAA 3RRGA 2HVIA 1BQNA 3TWHA 4AHCA 4FJHA 2IOCA 1RBTA 3DLHA 4KHNA 3T3FA 1JL1A 3C6UA 4QAGA 1D9DA 1CLQA 4H8KA 3MEDA 2E4LA 2DY4A 1LAWA 3D45A 5JS2A 3HPHA 1JLQA 3QO9A 3HJFA 4CF8A 2KFNA 3OY9A 4IFVA 1TL1A 4LSNA 4B9TA 2HNDA 4DQRA 3K5NA 1TL3A 3PX6A 3KD1E 4UQGA 3SZ2A 1U47A 4Z4FA 1JL2A 5CZ2A 3HYFA 1VSJA 3CM5A 3KLHA 1C1CA 1KFSA 1EX4A 4MFBA 1T8EA 4EZ6A 1VK0A 2XHBA 4CFCA 4OVLA 1TGOA 1D5AA 3NF7A 3ASMA 4CJUA 3LZJA 2X78A 3V1RA 1Q9YA 1RBSA 1B9DA 3O4NA 4FZYA 2HW3A 5HRPA 3VQCA 1TK5A 4CCHA 5KRTA 1YTAA 3EYZA 1X9MA 4CJVA 3NH1A 3K5LA 1ZBHA 3NF9A 3T1AA 2HHTA 4DTMA 4CEAA 2OPQA 3QERA 4F4KA 3U6FA 3TAFA 1QSLA 3QEIA 1BGXT 5HRNA 1CXUA 1GOCA 1S1XA 3HM9A 4CHPA 4DTSA 4FLZA 3QEPA 3SQ1A 3QLHA 3VQDA 4YFUA 4DSFA 4J2EA 4Z4GA 4CERA 4CK1A 4E3SA 3PY8A 2BE2A 1RT1A 3IG1A 4BWMA 3QNNA 4BDPA 3KKRA 1VSHA 5FRNA 2WONA 3HVTA 5CY4A 4DLGA 4CJ3A 4JRQA 4LH4A 2Y1JA 3TAPA 4DS5A 3ZSZA 3V9UA 1CXQA 3LDSA 4O44A 4DFKA 1J5OA 3AO1A 3KKSA 3I0RA 2P5GA 4LY7A 2YNHA 4DWIA 2KTQA 1WSJA 1TKDA 4KAZA 1SUQA 4W5OA 1WLJA 3OYGA 1RTDA 3KTQA 1B9FA 3NAEA 4CIGA 3C6TA 3U3YA 1WAJA 4CIEA 1VSEA 2BANA 2YNFA 2I5JA 4AH9A 4CHOA 4AHVA 3HL8A 3DOLA 3AVCA 3L2WA 3TR8A 1LWFA 4PQUA 1QQCA 1RT3A 1BIUA 1GOBA 1SL1A 4ID1A 3KJVA 1S1UA 3KIOA 3L2RA 4DU3A 1KTQA 4FJ5A 3AVFA 1A5WA 4M3RA 3KLGA 5FROA 4H4MA 4CEEA 3DRSA 5KI6A 2G8HA 1XHXA 4FLUA 3VQ8A 3RTVA 2YKMA 4I7FA 4RG8A 1KCFA 1I39A 1VSIA 4CEQA 3MEEA 3VQPA 4EP5A 1MU2A 1UAXA 1KFDA 2OPSA 1CZBA 3ZSRA 3LPUA 1Q8IA 4E89A 1EP4A 2P1JA 1WN7A 1U49A 4GW6A 4N56A 1ITGA 4FJNA 3MXMA 1S5JA 4CEFA 4OGEA 1TAQA 4CEBA 2O4GA 4L8RB 4N41A 3CFRA 4BDYA 3ZSOA 4FLWA 4CJ5A 2BDPA 3SUQA 4DSLA 1T05A 1WSHA 4DTRA 4CJ4A 4H4OA 3ALYA 4LD0A 2KW4A 2LSNA 3OS2A 3C95A 3OJUA 3SPZA 1UWBA 4M3UA 1RTIA 3PO4A 3SJJA 1KSPA 4B9UA 3BDPA 2HHSA 3PUFA 3D0PA 1HPZA 3L3VA 3P5JA 3QNOA 1R0AA 4CJSA 3CYMA 4BACA 4RW4A 3TABA 3RMCA 1RTJA 1S9GA 1UOCA 1WNSA 3QIPA 3OYDA 1NJWA 2EX3A 4C8MA 3KLFA 2B6AA 3LAMA 5FDLA 3P1GA 4QCLA 1VSDA 2GV9A 3S3NA 4B9MA 3OYLA 3MAQA 4HVJA 2F8TA 1F21A 2ITGA 4RW6A 1U45A 1D8YA 4DQIA 4HHTA 4FJGA 1W0HA 3TARA 1W9HA 3K58A 4QOZB 4FJKA 4CJPA 2IGIA 2OZSA 3V1QA 1TAUA 1RNHA 1S6QA 3DI6A 4DG1A 3KLEA 1C1BA 2XO7A 3G10A 3NE6A 3V4IA 1KRPA 4FJ8A 1QE1A 4DTUA 4C8LA 4FK4A 4E1MA 3OYJA 4BE2A 1S9EA 1HQEA 5I42A 4HUGA 4CGDA 4JS4A 3LWMA 4M3ZA 4OLBA 1ASWA 3DM2A 2OA8A 4ELTA 2ETJA 4CGGA 4IG3A 3M8QA 4CJEA 4CGHA 4FLXA 3V9WA 1ZBFA 4FJMA 4RW9A 4KHUA 4E0DA 3HP9A 2X6SA 3DLEA 3H08A 1KLMA 3ULDA 4OJRA 3V9ZA 1IKYA 2DTUA 4CF9A 2D0BA 1ASUA 2ZD1A 1K6YA 4BWJA 4Z0UA 4CEDA 3SUNA 4FM0A 3HXMA 3V6DA 1TK0A 1WSEA 4KV8A 4RW7A 2G8VA 3RWUA 3VQ7A 1ZBIA 5KGWA 3ZT2A 1NOZA 3VQQA 4DF8A 4M3YA 4CIFA 3AVLA 3SV4A 2RPIA 1HMVA 1BI4B 2ATQA 4KHYA 1HYSA 2P51A 3KD5E 2B5JA 3I0SA 1IKXA 1NKEA 3G0ZA 4CESA 4NYFA 3AV9A 1JLBA 3K5MA 3V9XA 2AJQA 3VQAA 4FJ7A 2FBYA 3DMJA 1J9AA 3NF8A 4GVMA 1BQMA 4E19A 4ZHRA 3OYAA 4B08A 3DLBA 3MEGA 3HPGA 3KK1A 3TANA 2RN2A 3V1OA 3TAQA 2HHVA 4NCGA 3FFIA 3SQ0A 4KTWA 2HVHA 1KVCA 5C25A 3OYIA 1T7PA 3LPTA 3RR8A 5SZTA 2KZMA 2HNYA 1QSYA 1U4BA 4OKKA 1VSKA 2G8WA 3DLRA 1IH7A 4RW8A 3ZT1A 3LANA 3NGIA 5T7BA 4HUFA 3S9HA 5HBMA 4CF1A 4CHQA 3O3FA 4CJRA 4Z4HA 3L2UA 1LW0A 4CGFA 4HCBA 5JS1A 5K14A 3LZIA 4N5SA 1HJRA 4W5QA 2PYLA 1RT6A 3B6OA 2GUIA 5DK5A
chains in the Genus database with same CATH superfamily
5JVGL 3L6QA 3AVBA 3BGRA 1EXQA 4OGCA 5HLFA 3SMPA 4LF8K 3PO5A 2P9NB 4PKGA 4TSXA 1ZBUA 3VQEA 4OX9K 4R5PA 1C0UA 2KKZA 1Q82O 3O5BA 1LOTB 3CFPA 4OKEA 3LDPA 1T6DA 3PV8A 1HKCA 3K59A 4GV9A 1QVGM 1ASVA 3HZ6A 1KD1O 3L8BA 2QXFA 3OVNA 4B8CA 1S3XA 2IVPA 2HHQA 3NVKA 1GLJO 1GLLO 3RMBA 4DSIA 4R79A 5I3UA 3OYFA 2NZTA 3Q7CA 3NMUA 3AVKA 3AVNA 3QEWA 3EO3A 3VEWA 3LL3A 3H1VX 4KTZA 2KQ2A 2ZGYA 3V81A 4DR6K 3A5MC 1EWRA 1NBWA 1NJYA 3H3OB 1JLEA 2G8KA 3MX5A 3LP1A 1S72N 4FWKA 4JKFA 4WQ5C 4K8ZA 4JI5K 5FPEA 4E1NA 4Y1CA 3CHWA 2X6NA 2A1SA 1NJXA 4IWVA 4FLTA 4ILJA 3OYHA 1T03A 4FO0A 4N47A 3KWGA 3ZT3A 2YKNA 2RHKA 4F3OA 2Z1JA 3E9OA 3LDOA 5KPTA 4DTXA 3QESA 1HQUA 3L2QA 3AVJA 1WSGA 1N33K 1YJ9N 1DTTA 2A1RA 4CEZA 3NF6A 5FRMA 1NKBA 1U2VB 1IKWA 1N5YA 3AVIA 1DLOA 1RDDA 4O5BA 4WCEL 3KK2A 2HBMA 2I7NA 3VQ9A 3UE5A 3DXKA 4M7YA 3TSQA 1TYQB 1DTQA 1JLGA 1XMQK 1VHXA 4FLYA 1SKRA 4KH4A 3VEVA 5GAGP 2PYJA 5KGXA 3D2EA 4CJFA 2E20A 2A42A 3OHRA 3SNNA 3SUOA 4FK0A 1Z05A 3WQTA 2UXDK 5CYQA 2R7YA 4IFEA 4WF9L 4JS5A 3O1WA 5LL6Z 3J8AA 5E41A 4FJIA 1BUPA 1J53A 1RBRA 3LP2A 5J2QA 5BRHA 4JRPA 4CFAA 4J2AA 3CCEN 1C6VA 3IFRA 4PHTX 4BE1A 2IAJA 2HBLA 3LAKA 4CZLA 4KFBA 1A5XA 3JSMA 3K57A 3JYTA 2ZWHA 2FBTA 2QW9A 4B3TK 4CK2A 3CM6A 2IDOA 1RDBA 4CZEA 4GMJB 2FSKA 4JKBA 1VQ8N 2QA4N 4CEOA 1XWLA 5FPNA 2VGMA 3M8SA 4BGAA 1WBDA 3ZX2A 3CQ8A 5DM6L 3MWPA 4IDKA 3IS9A 2GWKA 4N76A 4EFHA 1S6PA 4DR3K 3O4WA 3TAMA 4YNQA 2PBDA 2KFZA 4DR2K 1QS4A 1QTMA 2QKKA 3EEQA 4IFYA 2XY5A 4BC5A 2OZMA 4K8XA 5AR0A 3O9RA 1Z25A 3IRXA 4G9ZA 2PAVA 5CZ1A 2HF4A 4XIUA 1FJGK 3O6WA 4KHQA 3ISNC 3WNFA 2V52B 1NJZA 2E2NA 3O4QA 2B4JA 3SK3A 3OW2M 2FBXA 2GBZA 4NLCA 4UY8O 3VN5A 4JKAA 3AARA 5C12A 5M1OA 4DKWA 2YNIA 5AQSA 4O4GA 1IO2A 2EWSA 2PZSA 3T7ZA 1GLDG 2P9IB 3TTCA 1TYQA 4F3TA 1T44A 2BUPA 4DTPA 4J2DA 3GG4A 4CJQA 3VGMA 3K0SA 1TVRA 3ZETB 3VETA 4GVEA 4H0TB 4IEIA 1VRTA 4E7HA 4B3RK 4FWLA 5AZJB 2X74A 1RT4A 2DFEA 4J8FA 1EO1A 5CR4A 3VEYA 2W6LA 3O80A 3C6UA 1CLQA 4GV6A 2FLOA 2DY4A 1MWKA 1N32K 3HJFA 4YDUC 3OY9A 1OH6A 1TL1A 4BG8A 2F7TA 3SZ2A 1U47A 2F9TA 4IOAL 3KLHA 3OBWA 1Q18A 4OVLA 1TGOA 3NF7A 2NRZA 3V1RA 3O4NA 1B9DA 5HRPA 1TK5A 2QWPA 5KRTA 1YTAA 4DV5K 5HOOA 3NH1A 2HHTA 3QB0A 3GL1A 3TAFA 3SBTA 1QSLA 2E8AA 1BGXT 3SQ1A 4FLZA 3VQDA 4YFUA 4DSFA 4J2EA 4CERA 4BWMA 4BDPA 3KKRA 5FRNA 3HVTA 4FPAA 4LH4A 1YIJN 3V9UA 3LDSA 4DFKA 1ZXOA 4FZZA 3KKSA 2YNHA 1TKDA 4KAZA 3OYGA 2RE2A 5C2DA 3QFUA 1WAJA 1V4SA 4CIEA 4WFNL 2BANA 1MWMA 3R9PA 1QQCA 1RT3A 1IG8A 4ID1A 3KJVA 3L2RA 4DU3A 3AVFA 2Q1NA 5KI6A 3E9PA 3RTVA 3T1HK 3ENOA 4A62A 2D0OA 4KI6A 3MEEA 4EP5A 1XC3A 3EKSA 4IZ9A 3ZSRA 1U49A 2P1JA 4N56A 1S5JA 3PIOL 1TAQA 4BDYA 4FLWA 1KAXA 2BDPA 1GLAG 1NMNA 3LDNA 3OS2A 3OJUA 1UWBA 4M3UA 3H3NO 1KSPA 4B9UA 2P9IA 3BDPA 2ZJQL 3P5JA 1R0AA 3CYMA 4RW4A 2HOEA 3RMCA 1UOCA 2QTDA 2EX3A 4H5WA 3P1GA 1GLEG 3ZETA 3OYLA 3MAQA 4HVJA 5LJVA 5AZJA 4NXNK 4YOYA 1W0HA 1GLFO 4CJPA 3WXLA 1TAUA 3V1QA 3JS6A 3DI6A 1VQ5N 5LY3A 5M1KA 1KXPA 3LWMA 4M3ZA 3CD6N 2D1KA 5E84A 3CJ7A 1ASWA 2OA8A 4ELTA 5AQKA 2ETJA 4CGGA 3FZHA 3M8QA 4IG3A 4CGHA 4FLXA 3V9ZA 2QM1A 1ASUA 4BWJA 1K6YA 1BU6O 4FM0A 3HXMA 3V6DA 1TK0A 4DV0K 1X9JA 3C65A 4RW7A 3R1XA 3RWUA 3VQ7A 4DHYA 1NOZA 3SBGA 4DQ8A 3CPEA 1YAGA 4CIFA 3SV4A 3I0SA 1IKXA 1NGJA 4CESA 3KHYA 1JLBA 4BRNA 2AJQA 3NF8A 1ILYA 4BRFA 3MEGA 3HPGA 5E26A 2A41A 4WQ5A 3SQ0A 3CI5A 4BR0A 2HVHA 1W2BM 2NRVA 2HNYA 1U4BA 5T7BA 3S9HA 5HBMA 3L2UA 1E4FT 1LW0A 4CGFA 3LZIA 5CHIA 1HJRA 3FR0A 2PYLA 3A0IX 4M7XA 4K43A 4O5FA 3PSIA 3R8EA 4BG9A 1LW2A 4XEIA 3QETA 1J54A 3KK3A 1XHZA 2GX9A 1BWFO 4IG0A 4FCYA 4O8UA 1K8AO 2YHBA 3TAEA 2ZGZA 3DLGA 5C0YA 3U4LA 3HT3A 4B9LA 3SAGA 4CF2A 4I2PA 1BA1A 1BOTO 1NG9A 4KI4A 2O8BB 3MN5A 3SAFA 4JKGB 2VG7A 3EZWA 3LP3A 1IBKK 4JI7K 4FZXC 4HUEA 3HK2A 1EWQA 1NKCA 2Q3SA 1JLFA 1RT5A 1NK4A 4JI3K 1YT3A 1FKPA 4JI8K 1LWEA 2GUPA 2I7PA 2HHWA 3AA5X 4CF0A 4I6MB 3OYNA 2HHXA 4CJWA 1JJ2M 1HNXK 1C0MA 3TI0A 4ISGA 5BPLA 3DWLA 1BISA 4DFPA 3HBTA 2F9WA 4NCBA 3VA0A 4BRQA 1RDAA 3M8PA 4FVMA 1X1PA 1OH8A 4LSLA 1YHQN 5HRRA 2F96A 3MCAB 4CECA 4C23A 3ZSQA 3KLIA 1JKHA 1RDCA 2UUAK 1KAZA 1TUUA 4M3TA 5FLXO 5C2FA 3ITHA 1DT9A 3CG7A 4JAXA 1SKSA 4CI6A 2ASPA 2E5LK 4DSJA 2P5OA 3NFAA 4FWQA 1KVBA 3N4QA 1B92A 5FPMA 4JI0K 3AO3A 3NH0A 4JYAK 2FC0A 4FJLA 1RFQA 1Z6RA 3MN7A 4BRKA 4PWDA 3R3LA 3AAQA 2IVOA 4ICLA 4DV4K 4FVUA 3MK6A 1E3MA 1WSIA 2QEXN 5GIPA 5M1QA 3TTFA 5AQPA 2DFFA 2WC9A 3M3ZA 4BRCA 3QEXA 2VQEK 3OYMA 1VQ4N 4CJTA 4U7BA 1YUWA 5C15A 3NBPA 4H0OA 5BPMA 5KTQA 1DKGD 4DFJA 4J2BA 3AY9A 2E2OA 2G8FA 4EAHD 4O0JA 3OYBA 2WBNA 5AQXA 3AO2A 1ATSA 4DFMA 3AO5A 3CMEN 1IG9A 3IAYA 2WUSA 3H45C 4EP4A 5AFUH 1J5EK 4BROA 3G6EN 3ZSYA 4CD1A 1BHLA 4Q5VA 4B9NA 4FXDA 3PLAA 1HJOA 4DSEA 1L3VA 2O8BA 2HSTA 1NGFA 3ZT4A 3K2PA 3VERA 2YV0X 4JKGA 4DSKA 2OPPA 1TKTA 1FK9A 4I9LA 1GLCG 2GELA 4NO7A 4YDUA 1C0TA 3K9KA 2A5XA 4I6MA 4KH5A 3E66A 3O3GA 4CK3A 2XY8A 1NK7A 1VAZA 4Z4IA 1NK5A 4K25A 5TKYA 3HP6A 3AA4A 1JXBA 4AHTA 1SL2A 4M3XA 3NVMA 4K42A 1KLNA 5M1PA 4CZKA 3EE8A 1NGHA 4YOUA 3CXCM 3J7ZO 4MQ3A 3EL2A 4JKHA 2G8IA 3O9SA 4CGIA 3VQBA 2ZJPL 3T19A 2A3ZA 3VA3A 3AVGA 1LAVA 1EKEA 2J4RA 5A2QO 2D0CA 4IJAA 1BO5O 3W3DA 2O4IA 1ZYQA 3V9SA 3J7AP 4B3OA 4U67L 3CPWM 4K0KK 1NGCA 4IOXA 1BG3A 4EZ9A 4BR4A 3CMAN 3CCUN 5AJ3K 2Z1GA 3CIPA 2VCPA 5F1XA 4O55A 2HF3A 2Z1IA 4AHSA 3QEVA 4W5TA 2FXUA 4I2QA 3GDQA 4FYDA 1L3UA 4BE0A 1U04A 4OLAA 5EXWA 4AHCA 4MDBA 5KPRA 1RBTA 4FJHA 4YORA 3T3FA 4CW7B 4QAGA 4H8KA 3L4IA 3MEDA 1LAWA 5AZIB 3ULEB 2HHHK 1Q7YO 3BF1A 4LSNA 3I55N 1OH7A 4H5TA 2YHYA 3HYFA 1VSJA 1C1CA 2YJEA 4X65K 3RSEB 1T8EA 1VK0A 2XHBA 4CFCA 1D5AA 3ASMA 4CJUA 2HBKA 2X78A 4FZYA 1RBSA 4FWPA 3VMFB 3EYZA 1EQYA 1ZBHA 3NF9A 3T1AA 4CVNE 5LMNK 2O8FB 3WUHA 3QERA 4F4KA 1VQ6N 4JV5K 3QEIA 2E88A 1GOCA 4CHPA 3QLHA 4CZMA 3PY8A 4B1YB 3TAPA 2V7YA 3MDQA 4YOTA 4O44A 3E9LA 2KTQA 4LY7A 1QZ5A 1WSJA 1SUQA 1WLJA 3VTIA 1RTDA 3KTQA 3NAEA 3U3YA 2I5JA 4AH9A 4AHVA 3L2WA 2E1ZA 1LWFA 5F2RA 1SL1A 3KIOA 1KTQA 4JI4K 1K73O 2UUCK 1A5WA 4BRAA 4H0PA 4H4MA 4A2BA 1QZ6A 2G8HA 4B1UB 3CQYA 3O9QA 4ILGB 1O13A 3VQ8A 3G71N 4FLUA 1VSIA 1KFSA 3VQPA 1KFDA 3LPUA 4E89A 4KHPK 1EP4A 1WN7A 5JICA 3J81O 4FJNA 2QWQA 3CFRA 3ZSOA 3SUQA 5DM7L 1D4XA 1BA0A 1QQOA 1WSHA 4O8KA 4CJ4A 1Q81O 2KW4A 2LSNA 5LJWA 2ZM6K 3B8AX 3SPZA 4JHDB 5GADP 4GKKK 1FW6A 3TABA 4CZIA 3SAHA 1WNSA 3QIPA 5EX5A 4IXCA 1NJWA 5F0XA 4C8MA 3KLFA 2B6AA 5FDLA 1T6CA 3SJHA 2F8TA 1XQSC 4FJGA 1WBBA 1W9HA 3ZEUB 4QOZB 4FJKA 3KLEA 2AP1A 4FK4A 4E1MA 1HQEA 4XH4A 4CGDA 5AZIA 3ULEA 4OLBA 3CJ9A 3HRGA 4CZJA 4WQ4C 3J7YP 1VQON 1ZBFA 4CBUA 5AQWA 4E0DA 5ELZA 2X6SA 3RSEA 4OJRA 1J6ZA 4CEDA 3O08A 4Z0UA 1SAZA 4JK9A 4DV3K 3QBWA 3ZT2A 1NGIA 2O8FA 4EIAA 3AVLA 2UYTA 4LFCK 4JK7A 3VF2A 1BI4B 3KD5E 2B5JA 1NKEA 1KQSM 4Z94A 4BVPA 2ZF5O 3K5MA 4FJ7A 4DTUA 3DMJA 1J9AA 4WYBA 4ZHRA 1BQMA 4B1WB 3KD1E 2UU9K 3KK1A 2JWKA 2RN2A 3UB5A 4LF6K 3FFIA 4KTWA 4LC9B 5C25A 3OYIA 4DR4K 3LPTA 3A5LC 4QS9A 4OKKA 1VSKA 2ITMA 4RW8A 1IH7A 5M1FA 3LANA 4HUFA 4CF1A 3CCMN 4Z4HA 2ASMA 4HCBA 4W5QA 3B6OA 2GUIA 5AFUA 5DK5A 3TAGA 3WNEA 1YJWN 3SLCA 4NB4A 3L4QA 3F73A 4YHHK 3ID8A 4CHYA 3TSPA 2UXCK 2CGLA 3AGRA 4FJXA 2D0PA 1Q9XA 3OYKA 3RRHA 5J1EA 1YI2N 2OYQA 4E7JA 4FJ9A 3ZT0A 1BL3A 4GKJK 5AQFA 2RF2A 4OKJA 4E7IA 1RTHA 3F9KA 4HCCA 1BIZA 3C7NB 4JHDA 3SV3A 4PA1A 4B9VA 2CGJA 1NWKA 3SQ4A 2ZE2A 3E1YA 4BRLA 4DLEA 3D2FB 4Z4CA 3QIOA 1HKGA 1O1WA 1QHTA 3BZCA 2VWBA 3JAMO 4M42A 4B1ZA 1NK0A 1TV6A 4CFBA 2VWJA 4JI6K 4ILHA 4FW1A 4JI2K 3O1BA 3VQ5A 3NGYA 4ELUA 2NNWA 3ZEUA 3NHGA 1HNWK 3SYZA 4CGJA 4Y1DA 2HBJA 2NUBA 2NRXA 5BRDA 3EN9A 1IJJA 5GIOA 2V7ZA 4PL8A 3FZKA 4C1NK 4CHNA 3LWLA 3K9JA 1V4TA 2Z1HA 3B6PA 4CZFA 3C6AA 2E2PA 5DMRA 3VPZA 2RKIA 5BN9A 1HNIA 4KH6A 1XUPO 5AQNA 4M3WA 3IUCA 3N4PA 4PL7A 3AAPA 1CZAN 3VENA 1G99A 2E2QA 3ATVA 1QSSA 2QI2A 3AVHA 1ZC6A 2IS3A 1NLVA 1RBVA 3WXKA 1XC9A 2BGGA 1NK9A 3CJBA 1BI4A 1NOYA 2HB5A 4FM2A 5HROA 4FWRA 3WEEB 2DFHA 1RGIA 3CC7N 2H3GX 4DR5K 4JI1K 5I9EB 4CBWA 5J2NA 3Q7BA 1NGDA 3O3HA 3F2KA 2NRTA 4NCAA 2E6MA 5AQMA 4DF4A 4H0XB 4BRPA 5AQZA 2GEMA 2E1YA 2D0AA 4CFDA 3CCQN 2P9KB 4YOWA 4M41A 5J2MA 3S3OA 1NMDA 3LDLA 4KHSA 1W7AA 3A5NC 3AA3A 3GOIA 4FW2A 3G4SN 3VGLA 3RMDA 4FWOA 3KK7A 5TKWA 4C8NA 4B1XB 3OJSA 3AA2A 1QHAA 2IC3A 1NK8A 1SKWA 3C7NA 3MCPA 1ATNA 3PSFA 4CE9A 4CZHA 3I8DA 1YJNN 4FLVA 4FM1A 1NU0A 1SS6A 1TUYA 3U3GA 1KC8O 4M45A 2VGNA 2W42A 2EHGA 3D2FA 2DPNA 3NDKA 4A5BA 4F2SA 2P9PB 4I9QA 4KRFA 5AQTA 4H5RA 5GAHP 4CJKA 1JLCA 3CJCA 4CJ7A 2D5RA 4Q0BA 4DB3A 3ZSVA 1P8ZA 2JGUA 1S1WA 2ZJRL 3VTHA 4FJJA 1REVA 1K9MO 3DRPA 1L5UA 1ZBLA 3ZSWA 4PKIA 4DS4A 4B8AB 1SL0A 4KO0A 4BRDA 2FBVA 1GOAA 3L2VA 3CJAA 5BR8K 4QS8A 4CHZA 3PX0A 3HVRA 3RR7A 4DV7K 1NK6A 1OVQA 2JLEA 4PKHA 3SUPA 5CE3A 2P9SB 2WOMA 4HTLA 1YVUA 2HHUA 3CCSN 1HR0K 2QWLA 4DV6K 2PY5A 3SCXA 2Q0RA 4FL9A 4HWIA 1S1TA 4F8RA 3M5RA 4LF9K 3OYEA 5C42A 1Y64A 3WXIA 4EHTA 4DU4A 3WEEA 2Y1IA 4OPJA 1LWCA 4LH5A 1KVAA 2YI1A 4O0IA 2W40A 4C8OA 2QK9A 1JCGA 3THVA 3CC4N 3FLCO 4Z4EA 1HRHA 4DQQA 4BVOA 3FZFA 2YHXA 4X62K 3LM2A 1Z26A 3OS0A 5EY4A 3SQ2A 1VQ9N 2YHWA 1L3SA 3WQUA 3K5OA 3OYCA 4OPAA 4H03B 2P9KA 4KB0A 1D9FA 2WTUA 1U48A 4B9SA 1WAFA 2G8UA 4KHWA 5C24A 4A5AA 2YHAA 4ISEA 3P39A 2HMIA 1S1VA 4JEPA 2UXBK 1BQNA 2JWLA 2IOCA 1VQ7N 5KQ8A 4BGBA 3FZMA 3EKUA 1GLBG 3FE1A 1D9DA 4YY3K 2E4LA 3LM9A 3HPHA 1JLQA 3ENHA 3QO9A 2P9LB 4BRHA 2KFNA 2UUBK 4B9TA 1NJIO 3PX6A 1YF5L 2CH5A 4AM6A 4UQGA 1JL2A 3BEXA 5CZ2A 5BRFA 3CM5A 4MFBA 4EZ6A 1ATRA 4X66K 1Q9YA 4BRGA 3RVCA 2HW3A 5BREA 3VQCA 2IIRA 2P9PA 3BF3A 1X3MA 5IT9O 4DTMA 3U9ZA 3GE1A 4CEAA 3UKRB 3DLLL 1SQKA 1CXUA 3KVGA 4LFAK 1S1XA 2CH6A 4BRMA 4Z4GA 4CK1A 4ISFA 3BZKA 3R6MA 2BE2A 1RT1A 4WQ4A 4Y0WA 3QNNA 1VSHA 4IDHA 5B8HA 4CJ3A 3UKUB 4JRQA 2Y1JA 3D6RA 3ZSZA 1CXQA 3AO1A 3I0RA 3DJCA 4DWIA 3U8XA 3QFPA 1B9FA 4CIGA 3C6TA 3BY5A 4AQYK 1HKBA 2NRRA 2Q0UA 3BP8A 3TTDA 2YNFA 3DXMB 1E4GT 4BQLA 3OA9A 3TR8A 4FSVA 3F5TA 4BC3A 4IOCL 4PQUA 1BIUA 1GOBA 2P9SA 5EVZA 1C0GA 1BDGA 4FJ5A 3DRSA 5AQYA 1JCFA 5GAEP 4I7FA 4RG8A 1MU2A 3HM8A 1UAXA 2OPSA 4GW6A 1ITGA 1HPMA 4F9OA 4CEFA 3T69A 4OGEA 3MXMA 4L8RB 2O4GA 4N41A 4IJNA 5C10A 1WB9A 3I8BA 1T05A 1N36K 3L0QA 4A59A 4DTRA 3ALYA 4LD0A 3C95A 1RTIA 3SJJA 3CCRN 2OTLN 4MO5A 2HHSA 4CBXA 1HPZA 4QS7A 4E1JA 4YOXA 4OO1J 1RTJA 1S9GA 4DR1K 4QCLA 1VSDA 2GV9A 2IVNA 3S3NA 4B9MA 1F21A 2ITGA 1U45A 5AQIA 1D8YA 4HHTA 1WUAA 5AQOA 3TARA 3K58A 2OZSA 4DG1A 2KLAA 3V4IA 1KRPA 4FJ8A 4C8LA 4BE2A 5I42A 2OTJN 4B9QA 2P9LA 3BUZB 2W41A 1YXQA 3D7EO 1MDUB 4FJMA 1P90A 4BR2A 1VQKN 5BPNA 4KHUA 3THWB 3DLEA 4V19S 1KLMA 4JK8A 4BC4A 2DTUA 4CF9A 2D0BA 2ZD1A 1NNEA 3A5OC 3QICA 3H1QA 5ADXH 3P38A 2YX6A 5AQJA 4MO4A 5MLCQ 3VQQA 2AA4A 2RPIA 3UKRA 2ATQA 1HYSA 2P51A 1RDUA 3G0ZA 4NYFA 3AV9A 4GNIA 2FBYA 3OYAA 1HNZK 2QXLA 3V1OA 3TAQA 3UKUA 5KQDA 4LFBK 2HHVA 1C0FA 3O8MA 4AM7A 1KVCA 3RR8A 5SZTA 1DEJA 2VQFK 3DXMA 2G8WA 1KAYA 2P9NA 4CZGA 2ASOA 4CHQA 3O3FA 1VQPN 4BR7A 3MN9A 1OH5A 3THYB 4K41A 4CD3A 3M1FA 5M1NA 3THXB 4N5SA 2QWRA 4M63C 1NGBA 4DQSA 1FXXA 4MLHA 4GV3A 2F4VK 3ATUA 3ID6A 3VQ4A 1I3AA 2VYPA 3JXUA 3RMAA 4JLHA 1VQNN 3VQ6A 3DRRA 1HNVA 1X9SA 2XRIA 4W5NA 3VF4A 1TKXA 1U6ZA 2GWJA 3CJ1A 4E7LA 3LP0A 2KZZA 3NGZA 3AVAA 5JMVA 3MMVA 3H6EA 5EU7A 3AO4A 5GINA 5J2PA 1QVFM 3VEZA 1TK8A 1XI1A 4BQZA 2VWKA 4IO9L 3OTOK 3QMLA 5LMUK 1MA9B 4JKEA 4FOEA 1HYVA 1EETA 3LALA 2E6LA 4WE1A 1X9WA 1Q86O 3SMSA 3WNHA 1LCUA 4WFAL 4AILC 1QQNA 5KPZA 4W5RA 4ELVA 3NCIA 3NH2A 4DTJA 4A2AA 3THWA 2QKBA 3AVMA 4FK2A 3HOTA 3ZSXA 3FZLA 4DQPA 1SV5A 4IBNA 3DLKA 2HNZA 4FWMA 1RT7A 2VG5A 5SWMA 4DU1A 1U2VA 1VSLA 3MXJA 1ZBSA 1IKVA 3CCLN 1CZ9A 4BDZA 4IKFA 1N8RO 4PUOA 4AHRA 2XY7A 3ZX3A 4PY5A 1NGAA 4A57A 4F2RA 3KZBA 4RWTA 2NLXA 5BR9A 3W0LA 1VQLN 1HYZA 4KKOA 4EHUA 4NYNA 4BREA 3MWTA 1IBLK 4DMNA 4MLEA 5FPDA 1A5VA 1VSFA 3TSUA 4BR5A 1IBMK 1Y97A 2FSJA 3THYA 2A40A 3EY1A 3THXA 4DR7K 4KB1A 3ZYYX 1UA1A 3G25A 2BTFA 1HX1A 1LV5A 4LF5K 4OPHA 1L3TA 5AQUA 2XY6A 3OS1A 3C0BA 5HP1A 4KPYA 3OBYA 4L3QA 1DGKN 3CFOA 3M8RA 1OVYA 1XNQK 1YITN 1T3VA 5IWAK 2BH1A 4KTQA 1RCHA 2ZQBA 3S3MA 5EOYA 4IEEA 4CJLA 5AQQA 3O9UA 3CQXA 4JD2B 2VG6A 4B3MK 1TKZA 4YOVA 5HRSA 2YNGA 4OPKA 2F8SA 1G15A 3C94A 4DUZK 1UA0A 4KREA 4H0YB 3WNGA 3CCVN 3VF6A 1M1KO 2Q36A 3P83D 1BCMA 1RT2A 1VSMA 3A2FA 3DAWA 3MECA 1JXEA 3VESA 1N6QA 3SI6A 1ESVA 4JKCA 3HPOA 4DCHA 4ZTFA 5H1SQ 4MDAA 1FKOA 1BCOA 4H0VB 3S41A 3TPQA 3DYAA 2O8CB 4GY2B 5HL7L 2CGKA 2Q31A 4E7KA 3VEOA 3PIPL 4LF4K 2OPRA 3FFKB 3CCJN 5CYMA 5AQGA 3CF5L 3EE9A 3DOKA 4C1NI 3WXMB 4BY9C 4AF1A 4H5VA 4AHUA 1WSFA 1JLAA 1NM1A 4RCHA 3ZCMA 3P31A 3HSTB 1RBUA 4KBOA 5KRSA 1NGGA 5BN8A 4DTNA 4C8KA 1VRUA 3UIQA 3QINA 1C1AA 3SPYA 3PX4A 1YTUA 4DTOA 3CC2N 3VOVA 2NRHA 2YJFA 4LF7K 2PFUA 4X64K 3MXIA 3T1YK 1YVNA 2QWNA 4G1QA 3EZ5A 2D4WA 3VGKA 3TU5A 1IV0A 5D3GA 4ID5A 4HTUA 4BR9A 3M6GA 4IO8A 3L3UA 2O8DB 1RILA 3E01A 2HVIA 3TWHA 3I33A 3DLHA 4KHNA 5ADXA 1JL1A 5JS2A 3D45A 4NLBA 4CF8A 2KHOA 3LDQA 4IFVA 2WFBA 2HNDA 1R59O 4DQRA 3K5NA 1TL3A 3HOSA 4Z4FA 1QQMA 1HLUA 3F9MA 1EX4A 1HUXA 3WT0A 3LZJA 1M90O 2Q2RA 4CCHA 4JD2A 1X9MA 4CJVA 3K5LA 2A6AA 2OPQA 1K8KB 2W6KA 3U6FA 4B3SK 5HRNA 2FF3B 3HM9A 4DTSA 1SZ2A 1RDWX 3QEPA 3HO1A 2O8EB 4E3SA 3CETA 3IG1A 2WONA 5CY4A 4DLGA 3AGKA 3IDHA 4WFBL 4XH1A 4DS5A 1J5OA 1WOQA 2P5GA 5AQRA 4W5OA 3A8YA 4RTFD 3J80O 4FWSA 1VSEA 2O8CA 4CHOA 5AQVA 3HL8A 3DOLA 3AVCA 2GTDA 1S1UA 4M3RA 3KLGA 5FROA 4CEEA 3HI0A 1S22A 2P9UB 1XHXA 3I56N 1I94K 4XH5A 2YKMA 1KCFA 1I39A 4CEQA 4ZTJA 3ENBA 3RRGA 1CZBA 1Q8IA 1XNRK 2Q97A 4CEBA 3IKMA 3MN6A 4CJ5A 5AQHA 5JLFA 4DSLA 1XMOK 1NGEA 3C6HA 2NRWA 4H4OA 3PO4A 4BRIA 1W97L 3PUFA 3D0PA 3L3VA 3QNOA 4CJSA 4BACA 2FSNA 2QWOA 3OYDA 5AQLA 4DUYK 3QDKA 3LAMA 2OANA 4RW6A 4DQIA 3MX2A 2O8DA 4FPBA 2IGIA 1RNHA 1OKJA 1S6QA 2XO7A 1C1BA 3G10A 3IMXA 3NE6A 1QE1A 3U9DA 3KWIA 3OYJA 1S9EA 4DV2K 4JN4A 4HUGA 4JS4A 3O9TA 3CERA 3DM2A 4A61A 3VEXA 3V9WA 4CJEA 3HSCA 4BC2A 4RW9A 3HP9A 3ULDA 3H08A 3ZX0A 4B1VA 1IKYA 1N34K 3SUNA 4H5NA 2YCHA 1WSEA 4KV8A 2G8VA 2FF6A 3GBTA 1ZBIA 5KGWA 4M3YA 4DF8A 1X3NA 2OCEA 3P4IA 1K8KA 1HMVA 4KHYA 4NXMK 1H1VA 4JKDA 4FWNA 3FGUA 3V9XA 4JNEA 3VQAA 2O8EA 4GVMA 4E19A 4B08A 3DLBA 3QBXA 3H46O 2QWMA 3TANA 3ZLJA 3WXJA 2HMPA 1VQMN 4DV1K 4NCGA 3HTVA 1T7PA 2KZMA 1QSYA 3DLRA 3ZT1A 3DXKB 5JVHL 3NGIA 2V51B 4CJRA 3D2EB 4FOIA 5JS1A 5K14A 5JLHA 1RT6A 1JCEA 2P9UA
chains in the Genus database with same CATH topology
3AVBA 3BGRA 1EXQA 1FXXA 4OGCA 3WNEA 4DQSA 3TAGA 5HLFA 3VQ4A 1I3AA 3F73A 3RMAA 3PO5A 1LW2A 4JLHA 4CHYA 3QETA 1J54A 3KK3A 3VQ6A 3DRRA 4TSXA 1HNVA 4FJXA 1XHZA 1X9SA 1ZBUA 4IG0A 3VQEA 2XRIA 3OYKA 4FCYA 5J1EA 4R5PA 3RRHA 1C0UA 2OYQA 4W5NA 4E7JA 1TKXA 4FJ9A 3ZT0A 1BL3A 4E7LA 3CFPA 2RF2A 2YHBA 4OKJA 4E7IA 1RTHA 3F9KA 3LP0A 3TAEA 1BIZA 4HCCA 2KZZA 3NGZA 3AVAA 3SV3A 3DLGA 4PA1A 4B9VA 5EU7A 4OKEA 3SQ4A 3PV8A 2ZE2A 3HT3A 4B9LA 4DLEA 3AO4A 4CF2A 3K59A 4I2PA 4KI6A 1ASVA 4Z4CA 4KI4A 3QIOA 3L8BA 1O1WA 1QHTA 2QXFA 5J2PA 4M42A 3OVNA 4B8CA 1TK8A 1XI1A 1TV6A 1NK0A 2VG7A 4CFBA 2VWKA 2VWJA 2HHQA 3LP3A 4FW1A 3RMBA 4DSIA 3VQ5A 4FZXC 3NGYA 4ELUA 4HUEA 5I3UA 3OYFA 3NHGA 3AVKA 3HK2A 1HYVA 3SYZA 1NKCA 2Q3SA 1JLFA 1RT5A 4CGJA 3AVNA 1NK4A 3QEWA 1YT3A 1EETA 3LALA 4Y1DA 1FKPA 2E6LA 4WE1A 1X9WA 4KTZA 1LWEA 2NUBA 3WNHA 2KQ2A 3AA5X 4AILC 2HHWA 4CF0A 4W5RA 3V81A 3OYNA 4ELVA 4CHNA 4CJWA 3LWLA 2HHXA 1C0MA 1NJYA 2Z1HA 3TI0A 1JLEA 2G8KA 3B6PA 3NCIA 3LP1A 1BISA 4DFPA 5DMRA 3NH2A 2RKIA 4DTJA 4NCBA 1HNIA 3VA0A 4M3WA 1RDAA 3M8PA 4K8ZA 4FZZA 2QKBA 4FVMA 3AVMA 1X1PA 4FK2A 4E1NA 4LSLA 4Y1CA 3ZSXA 5HRRA 2F96A 2X6NA 2A1SA 1NJXA 4DQPA 1SV5A 4IBNA 3DLKA 4CECA 2HNZA 4FLTA 1QSSA 1RT7A 2VG5A 3ZSQA 3AVHA 2IS3A 3OYHA 1RBVA 1XC9A 5SWMA 4DU1A 1VSLA 1T03A 3MXJA 2BGGA 4N47A 3KLIA 3ZT3A 1JKHA 2YKNA 1IKVA 1RDCA 1CZ9A 4BDZA 1NK9A 4IKFA 4M3TA 4F3OA 2Z1JA 1BI4A 4DTXA 1NOYA 2HB5A 4FM2A 3ITHA 3QESA 4PUOA 1HQUA 4AHRA 3CG7A 5HROA 3L2QA 1SKSA 3AVJA 1WSGA 4DSJA 2XY7A 4PY5A 2P5OA 2DFHA 3NFAA 4F2RA 1KVBA 1B92A 1DTTA 2A1RA 4CEZA 3NF6A 3AO3A 5FRMA 1NKBA 3NH0A 1IKWA 1N5YA 5J2NA 3AVIA 2FC0A 4FJLA 1DLOA 1RDDA 1HYZA 3O3HA 4O5BA 4KKOA 4PWDA 4ICLA 3KK2A 4NCAA 1WSIA 4NYNA 2E6MA 3VQ9A 4DF4A 2DFFA 4DMNA 3HO1A 1DTQA 1JLGA 1A5VA 1VSFA 2D0AA 4FLYA 4CFDA 3QEXA 1SKRA 1Y97A 3OYMA 2PYJA 5KGXA 4CJTA 3EY1A 4CJFA 4KB1A 4M41A 3NBPA 5KTQA 5J2MA 3SUOA 3SNNA 3S3OA 1UA1A 4FK0A 4KHSA 3AA3A 5CYQA 4DFJA 2R7YA 4ZTJA 4FW2A 1LV5A 4J2BA 3RMDA 4JS5A 2G8FA 1L3TA 4C8NA 4O0JA 5E41A 3OS1A 2XY6A 4FJIA 3OYBA 1J53A 1RBRA 3LP2A 5J2QA 3OJSA 5HP1A 4KPYA 3AO2A 3AA2A 4JRPA 4CFAA 2IC3A 3AO5A 4DFMA 1NK8A 1IG9A 1SKWA 3IAYA 4CE9A 4J2AA 4EP4A 1C6VA 3CFOA 3M8RA 3I8DA 4BE1A 2IAJA 4KTQA 4FLVA 1RCHA 3LAKA 4KFBA 4FM1A 1A5XA 3JSMA 3K57A 2ZQBA 3U3GA 3ZSYA 3JYTA 1BHLA 4M45A 2FBTA 4Q5VA 3S3MA 4B9NA 2W42A 2EHGA 4FXDA 3NDKA 4CK2A 4DSEA 4CJLA 1L3VA 4F2SA 2VG6A 3CM6A 1TKZA 2IDOA 3ZT4A 3K2PA 5HRSA 1RDBA 2YNGA 4OPKA 4I9QA 1G15A 3C94A 4DSKA 2YV0X 4GMJB 1UA0A 2F8SA 3WNGA 2OPPA 4KREA 4KRFA 4CEOA 1TKTA 1FK9A 4I9LA 1XWLA 3P83D 1BCMA 1RT2A 1VSMA 3A2FA 3MECA 4CJKA 1JLCA 1JXEA 3M8SA 1N6QA 3CQ8A 3SI6A 2D5RA 4Q0BA 3ZSVA 4IDKA 1C0TA 3IS9A 2JGUA 4N76A 1S1WA 1S6PA 4FJJA 3HPOA 1REVA 3DRPA 3TAMA 3O3GA 4CK3A 4YNQA 4ZTFA 1ZBLA 3ZSWA 1L5UA 4DS4A 2KFZA 2XY8A 1QS4A 1NK7A 1QTMA 4B8AB 1SL0A 4Z4IA 2QKKA 4IFYA 2XY5A 4KO0A 1NK5A 1FKOA 1BCOA 2FBVA 1GOAA 2OZMA 3L2VA 4K8XA 3HP6A 3AA4A 1JXBA 3DYAA 4CHZA 3PX0A 3HVRA 3RR7A 4AHTA 4E7KA 1Z25A 1NK6A 2JLEA 1SL2A 3IRXA 2OPRA 3SUPA 4M3XA 2WOMA 5CZ1A 5CYMA 3DOKA 1YVUA 4XIUA 2HHUA 1KLNA 1Q9XA 4AHUA 4KHQA 3ISNC 3WNFA 1WSFA 2PY5A 3SCXA 1NJZA 3O4QA 1JLAA 1S1TA 2B4JA 3ZCMA 4F8RA 4MQ3A 3HSTB 1RBUA 5KRSA 3OYEA 2G8IA 5C42A 2FBXA 2GBZA 4CGIA 3VQBA 3VN5A 4DTNA 4C8KA 3T19A 4DU4A 2Y1IA 3VA3A 3AVGA 1LAVA 1VRUA 1EKEA 3UIQA 4OPJA 1LWCA 3QINA 4LH5A 1C1AA 1KVAA 2YNIA 2D0CA 4O0IA 3PX4A 3SPYA 4C8OA 4DTOA 1YTUA 3THVA 2QK9A 4Z4EA 2O4IA 1ZYQA 3V9SA 4O4GA 1IO2A 1HRHA 4DQQA 4B3OA 2PZSA 1Z26A 3OS0A 4EZ9A 3MXIA 3SQ2A 1L3SA 4G1QA 4F3TA 2Z1GA 3K5OA 4DTPA 3EZ5A 3OYCA 4J2DA 4O55A 4KB0A 4CJQA 5D3GA 2Z1IA 4ID5A 4AHSA 4HTUA 1TVRA 4W5TA 3QEVA 1U48A 1D9FA 4B9SA 1WAFA 4I2QA 1VRTA 4E7HA 2G8UA 4KHWA 5C24A 2X74A 1RT4A 2DFEA 2YHAA 3L3UA 1RILA 1L3UA 4FYDA 2HMIA 3E01A 1S1VA 4BE0A 1U04A 4OLAA 3RRGA 2HVIA 1BQNA 3TWHA 4AHCA 4FJHA 2IOCA 1RBTA 3DLHA 4KHNA 3T3FA 1JL1A 3C6UA 4QAGA 1D9DA 1CLQA 4H8KA 3MEDA 2E4LA 2DY4A 1LAWA 3D45A 5JS2A 3HPHA 1JLQA 3QO9A 3HJFA 4CF8A 2KFNA 3OY9A 4IFVA 1TL1A 4LSNA 4B9TA 2HNDA 4DQRA 3K5NA 1TL3A 3PX6A 3KD1E 4UQGA 3SZ2A 1U47A 4Z4FA 1JL2A 5CZ2A 3HYFA 1VSJA 3CM5A 3KLHA 1C1CA 1KFSA 1EX4A 4MFBA 1T8EA 4EZ6A 1VK0A 2XHBA 4CFCA 4OVLA 1TGOA 1D5AA 3NF7A 3ASMA 4CJUA 3LZJA 2X78A 3V1RA 1Q9YA 1RBSA 1B9DA 3O4NA 4FZYA 2HW3A 5HRPA 3VQCA 1TK5A 4CCHA 5KRTA 1YTAA 3EYZA 1X9MA 4CJVA 3NH1A 3K5LA 1ZBHA 3NF9A 3T1AA 2HHTA 4DTMA 4CEAA 2OPQA 3QERA 4F4KA 3U6FA 3TAFA 1QSLA 3QEIA 1BGXT 5HRNA 1CXUA 1GOCA 1S1XA 3HM9A 4CHPA 4DTSA 4FLZA 3QEPA 3SQ1A 3QLHA 3VQDA 4YFUA 4DSFA 4J2EA 4Z4GA 4CERA 4CK1A 4E3SA 3PY8A 2BE2A 1RT1A 3IG1A 4BWMA 3QNNA 4BDPA 3KKRA 1VSHA 5FRNA 2WONA 3HVTA 5CY4A 4DLGA 4CJ3A 4JRQA 4LH4A 2Y1JA 3TAPA 4DS5A 3ZSZA 3V9UA 1CXQA 3LDSA 4O44A 4DFKA 1J5OA 3AO1A 3KKSA 3I0RA 2P5GA 4LY7A 2YNHA 4DWIA 2KTQA 1WSJA 1TKDA 4KAZA 1SUQA 4W5OA 1WLJA 3OYGA 1RTDA 3KTQA 1B9FA 3NAEA 4CIGA 3C6TA 3U3YA 1WAJA 4CIEA 1VSEA 2BANA 2YNFA 2I5JA 4AH9A 4CHOA 4AHVA 3HL8A 3DOLA 3AVCA 3L2WA 3TR8A 1LWFA 4PQUA 1QQCA 1RT3A 1BIUA 1GOBA 1SL1A 4ID1A 3KJVA 1S1UA 3KIOA 3L2RA 4DU3A 1KTQA 4FJ5A 3AVFA 1A5WA 4M3RA 3KLGA 5FROA 4H4MA 4CEEA 3DRSA 5KI6A 2G8HA 1XHXA 4FLUA 3VQ8A 3RTVA 2YKMA 4I7FA 4RG8A 1KCFA 1I39A 1VSIA 4CEQA 3MEEA 3VQPA 4EP5A 1MU2A 1UAXA 1KFDA 2OPSA 1CZBA 3ZSRA 3LPUA 1Q8IA 4E89A 1EP4A 2P1JA 1WN7A 1U49A 4GW6A 4N56A 1ITGA 4FJNA 3MXMA 1S5JA 4CEFA 4OGEA 1TAQA 4CEBA 2O4GA 4L8RB 4N41A 3CFRA 4BDYA 3ZSOA 4FLWA 4CJ5A 2BDPA 3SUQA 4DSLA 1T05A 1WSHA 4DTRA 4CJ4A 4H4OA 3ALYA 4LD0A 2KW4A 2LSNA 3OS2A 3C95A 3OJUA 3SPZA 1UWBA 4M3UA 1RTIA 3PO4A 3SJJA 1KSPA 4B9UA 3BDPA 2HHSA 3PUFA 3D0PA 1HPZA 3L3VA 3P5JA 3QNOA 1R0AA 4CJSA 3CYMA 4BACA 4RW4A 3TABA 3RMCA 1RTJA 1S9GA 1UOCA 1WNSA 3QIPA 3OYDA 1NJWA 2EX3A 4C8MA 3KLFA 2B6AA 3LAMA 5FDLA 3P1GA 4QCLA 1VSDA 2GV9A 3S3NA 4B9MA 3OYLA 3MAQA 4HVJA 2F8TA 1F21A 2ITGA 4RW6A 1U45A 1D8YA 4DQIA 4HHTA 4FJGA 1W0HA 3TARA 1W9HA 3K58A 4QOZB 4FJKA 4CJPA 2IGIA 2OZSA 3V1QA 1TAUA 1RNHA 1S6QA 3DI6A 4DG1A 3KLEA 1C1BA 2XO7A 3G10A 3NE6A 3V4IA 1KRPA 4FJ8A 1QE1A 4DTUA 4C8LA 4FK4A 4E1MA 3OYJA 4BE2A 1S9EA 1HQEA 5I42A 4HUGA 4CGDA 4JS4A 3LWMA 4M3ZA 4OLBA 1ASWA 3DM2A 2OA8A 4ELTA 2ETJA 4CGGA 4IG3A 3M8QA 4CJEA 4CGHA 4FLXA 3V9WA 1ZBFA 4FJMA 4RW9A 4KHUA 4E0DA 3HP9A 2X6SA 3DLEA 3H08A 1KLMA 3ULDA 4OJRA 3V9ZA 1IKYA 2DTUA 4CF9A 2D0BA 1ASUA 2ZD1A 1K6YA 4BWJA 4Z0UA 4CEDA 3SUNA 4FM0A 3HXMA 3V6DA 1TK0A 1WSEA 4KV8A 4RW7A 2G8VA 3RWUA 3VQ7A 1ZBIA 5KGWA 3ZT2A 1NOZA 3VQQA 4DF8A 4M3YA 4CIFA 3AVLA 3SV4A 2RPIA 1HMVA 1BI4B 2ATQA 4KHYA 1HYSA 2P51A 3KD5E 2B5JA 3I0SA 1IKXA 1NKEA 3G0ZA 4CESA 4NYFA 3AV9A 1JLBA 3K5MA 3V9XA 2AJQA 3VQAA 4FJ7A 2FBYA 3DMJA 1J9AA 3NF8A 4GVMA 1BQMA 4E19A 4ZHRA 3OYAA 4B08A 3DLBA 3MEGA 3HPGA 3KK1A 3TANA 2RN2A 3V1OA 3TAQA 2HHVA 4NCGA 3FFIA 3SQ0A 4KTWA 2HVHA 1KVCA 5C25A 3OYIA 1T7PA 3LPTA 3RR8A 5SZTA 2KZMA 2HNYA 1QSYA 1U4BA 4OKKA 1VSKA 2G8WA 3DLRA 1IH7A 4RW8A 3ZT1A 3LANA 3NGIA 5T7BA 4HUFA 3S9HA 5HBMA 4CF1A 4CHQA 3O3FA 4CJRA 4Z4HA 3L2UA 1LW0A 4CGFA 4HCBA 5JS1A 5K14A 3LZIA 4N5SA 1HJRA 4W5QA 2PYLA 1RT6A 3B6OA 2GUIA 5DK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AVB A;  3BGR A;  1EXQ A;  1FXX A;  4OGC A;  3WNE A;  4DQS A;  3TAG A;  5HLF A;  3VQ4 A;  1I3A A;  3F73 A;  3RMA A;  3PO5 A;  1LW2 A;  4JLH A;  4CHY A;  3QET A;  1J54 A;  3KK3 A;  3VQ6 A;  3DRR A;  4TSX A;  1HNV A;  4FJX A;  1XHZ A;  1X9S A;  1ZBU A;  4IG0 A;  3VQE A;  2XRI A;  3OYK A;  4FCY A;  5J1E A;  4R5P A;  3RRH A;  1C0U A;  2OYQ A;  4W5N A;  4E7J A;  1TKX A;  4FJ9 A;  3ZT0 A;  1BL3 A;  4E7L A;  3CFP A;  2RF2 A;  2YHB A;  4OKJ A;  4E7I A;  1RTH A;  3F9K A;  3LP0 A;  3TAE A;  1BIZ A;  4HCC A;  2KZZ A;  3NGZ A;  3AVA A;  3SV3 A;  3DLG A;  4PA1 A;  4B9V A;  5EU7 A;  4OKE A;  3SQ4 A;  3PV8 A;  2ZE2 A;  3HT3 A;  4B9L A;  4DLE A;  3AO4 A;  4CF2 A;  3K59 A;  4I2P A;  4KI6 A;  1ASV A;  4Z4C A;  4KI4 A;  3QIO A;  3L8B A;  1O1W A;  1QHT A;  2QXF A;  5J2P A;  4M42 A;  3OVN A;  4B8C A;  1TK8 A;  1XI1 A;  1TV6 A;  1NK0 A;  2VG7 A;  4CFB A;  2VWK A;  2VWJ A;  2HHQ A;  3LP3 A;  4FW1 A;  3RMB A;  4DSI A;  3VQ5 A;  4FZX C;  3NGY A;  4ELU A;  4HUE A;  5I3U A;  3OYF A;  3NHG A;  3AVK A;  3HK2 A;  1HYV A;  3SYZ A;  1NKC A;  2Q3S A;  1JLF A;  1RT5 A;  4CGJ A;  3AVN A;  1NK4 A;  3QEW A;  1YT3 A;  1EET A;  3LAL A;  4Y1D A;  1FKP A;  2E6L A;  4WE1 A;  1X9W A;  4KTZ A;  1LWE A;  2NUB A;  3WNH A;  2KQ2 A;  3AA5 X;  4AIL C;  2HHW A;  4CF0 A;  4W5R A;  3V81 A;  3OYN A;  4ELV A;  4CHN A;  4CJW A;  3LWL A;  2HHX A;  1C0M A;  1NJY A;  2Z1H A;  3TI0 A;  1JLE A;  2G8K A;  3B6P A;  3NCI A;  3LP1 A;  1BIS A;  4DFP A;  5DMR A;  3NH2 A;  2RKI A;  4DTJ A;  4NCB A;  1HNI A;  3VA0 A;  4M3W A;  1RDA A;  3M8P A;  4K8Z A;  4FZZ A;  2QKB A;  4FVM A;  3AVM A;  1X1P A;  4FK2 A;  4E1N A;  4LSL A;  4Y1C A;  3ZSX A;  5HRR A;  2F96 A;  2X6N A;  2A1S A;  1NJX A;  4DQP A;  1SV5 A;  4IBN A;  3DLK A;  4CEC A;  2HNZ A;  4FLT A;  1QSS A;  1RT7 A;  2VG5 A;  3ZSQ A;  3AVH A;  2IS3 A;  3OYH A;  1RBV A;  1XC9 A;  5SWM A;  4DU1 A;  1VSL A;  1T03 A;  3MXJ A;  2BGG A;  4N47 A;  3KLI A;  3ZT3 A;  1JKH A;  2YKN A;  1IKV A;  1RDC A;  1CZ9 A;  4BDZ A;  1NK9 A;  4IKF A;  4M3T A;  4F3O A;  2Z1J A;  1BI4 A;  4DTX A;  1NOY A;  2HB5 A;  4FM2 A;  3ITH A;  3QES A;  4PUO A;  1HQU A;  4AHR A;  3CG7 A;  5HRO A;  3L2Q A;  1SKS A;  3AVJ A;  1WSG A;  4DSJ A;  2XY7 A;  4PY5 A;  2P5O A;  2DFH A;  3NFA A;  4F2R A;  1KVB A;  1B92 A;  1DTT A;  2A1R A;  4CEZ A;  3NF6 A;  3AO3 A;  5FRM A;  1NKB A;  3NH0 A;  1IKW A;  1N5Y A;  5J2N A;  3AVI A;  2FC0 A;  4FJL A;  1DLO A;  1RDD A;  1HYZ A;  3O3H A;  4O5B A;  4KKO A;  4PWD A;  4ICL A;  3KK2 A;  4NCA A;  1WSI A;  4NYN A;  2E6M A;  3VQ9 A;  4DF4 A;  2DFF A;  4DMN A;  3HO1 A;  1DTQ A;  1JLG A;  1A5V A;  1VSF A;  2D0A A;  4FLY A;  4CFD A;  3QEX A;  1SKR A;  1Y97 A;  3OYM A;  2PYJ A;  5KGX A;  4CJT A;  3EY1 A;  4CJF A;  4KB1 A;  4M41 A;  3NBP A;  5KTQ A;  5J2M A;  3SUO A;  3SNN A;  3S3O A;  1UA1 A;  4FK0 A;  4KHS A;  3AA3 A;  5CYQ A;  4DFJ A;  2R7Y A;  4ZTJ A;  4FW2 A;  1LV5 A;  4J2B A;  3RMD A;  4JS5 A;  2G8F A;  1L3T A;  4C8N A;  4O0J A;  5E41 A;  3OS1 A;  2XY6 A;  4FJI A;  3OYB A;  1J53 A;  1RBR A;  3LP2 A;  5J2Q A;  3OJS A;  5HP1 A;  4KPY A;  3AO2 A;  3AA2 A;  4JRP A;  4CFA A;  2IC3 A;  3AO5 A;  4DFM A;  1NK8 A;  1IG9 A;  1SKW A;  3IAY A;  4CE9 A;  4J2A A;  4EP4 A;  1C6V A;  3CFO A;  3M8R A;  3I8D A;  4BE1 A;  2IAJ A;  4KTQ A;  4FLV A;  1RCH A;  3LAK A;  4KFB A;  4FM1 A;  1A5X A;  3JSM A;  3K57 A;  2ZQB A;  3U3G A;  3ZSY A;  3JYT A;  1BHL A;  4M45 A;  2FBT A;  4Q5V A;  3S3M A;  4B9N A;  2W42 A;  2EHG A;  4FXD A;  3NDK A;  4CK2 A;  4DSE A;  4CJL A;  1L3V A;  4F2S A;  2VG6 A;  3CM6 A;  1TKZ A;  2IDO A;  3ZT4 A;  3K2P A;  5HRS A;  1RDB A;  2YNG A;  4OPK A;  4I9Q A;  1G15 A;  3C94 A;  4DSK A;  2YV0 X;  4GMJ B;  1UA0 A;  2F8S A;  3WNG A;  2OPP A;  4KRE A;  4KRF A;  4CEO A;  1TKT A;  1FK9 A;  4I9L A;  1XWL A;  3P83 D;  1BCM A;  1RT2 A;  1VSM A;  3A2F A;  3MEC A;  4CJK A;  1JLC A;  1JXE A;  3M8S A;  1N6Q A;  3CQ8 A;  3SI6 A;  2D5R A;  4Q0B A;  3ZSV A;  4IDK A;  1C0T A;  3IS9 A;  2JGU A;  4N76 A;  1S1W A;  1S6P A;  4FJJ A;  3HPO A;  1REV A;  3DRP A;  3TAM A;  3O3G A;  4CK3 A;  4YNQ A;  4ZTF A;  1ZBL A;  3ZSW A;  1L5U A;  4DS4 A;  2KFZ A;  2XY8 A;  1QS4 A;  1NK7 A;  1QTM A;  4B8A B;  1SL0 A;  4Z4I A;  2QKK A;  4IFY A;  2XY5 A;  4KO0 A;  1NK5 A;  1FKO A;  1BCO A;  2FBV A;  1GOA A;  2OZM A;  3L2V A;  4K8X A;  3HP6 A;  3AA4 A;  1JXB A;  3DYA A;  4CHZ A;  3PX0 A;  3HVR A;  3RR7 A;  4AHT A;  4E7K A;  1Z25 A;  1NK6 A;  2JLE A;  1SL2 A;  3IRX A;  2OPR A;  3SUP A;  4M3X A;  2WOM A;  5CZ1 A;  5CYM A;  3DOK A;  1YVU A;  4XIU A;  2HHU A;  1KLN A;  1Q9X A;  4AHU A;  4KHQ A;  3ISN C;  3WNF A;  1WSF A;  2PY5 A;  3SCX A;  1NJZ A;  3O4Q A;  1JLA A;  1S1T A;  2B4J A;  3ZCM A;  4F8R A;  4MQ3 A;  3HST B;  1RBU A;  5KRS A;  3OYE A;  2G8I A;  5C42 A;  2FBX A;  2GBZ A;  4CGI A;  3VQB A;  3VN5 A;  4DTN A;  4C8K A;  3T19 A;  4DU4 A;  2Y1I A;  3VA3 A;  3AVG A;  1LAV A;  1VRU A;  1EKE A;  3UIQ A;  4OPJ A;  1LWC A;  3QIN A;  4LH5 A;  1C1A A;  1KVA A;  2YNI A;  2D0C A;  4O0I A;  3PX4 A;  3SPY A;  4C8O A;  4DTO A;  1YTU A;  3THV A;  2QK9 A;  4Z4E A;  2O4I A;  1ZYQ A;  3V9S A;  4O4G A;  1IO2 A;  1HRH A;  4DQQ A;  4B3O A;  2PZS A;  1Z26 A;  3OS0 A;  4EZ9 A;  3MXI A;  3SQ2 A;  1L3S A;  4G1Q A;  4F3T A;  2Z1G A;  3K5O A;  4DTP A;  3EZ5 A;  3OYC A;  4J2D A;  4O55 A;  4KB0 A;  4CJQ A;  5D3G A;  2Z1I A;  4ID5 A;  4AHS A;  4HTU A;  1TVR A;  4W5T A;  3QEV A;  1U48 A;  1D9F A;  4B9S A;  1WAF A;  4I2Q A;  1VRT A;  4E7H A;  2G8U A;  4KHW A;  5C24 A;  2X74 A;  1RT4 A;  2DFE A;  2YHA A;  3L3U A;  1RIL A;  1L3U A;  4FYD A;  2HMI A;  3E01 A;  1S1V A;  4BE0 A;  1U04 A;  4OLA A;  3RRG A;  2HVI A;  1BQN A;  3TWH A;  4AHC A;  4FJH A;  2IOC A;  1RBT A;  3DLH A;  4KHN A;  3T3F A;  1JL1 A;  3C6U A;  4QAG A;  1D9D A;  1CLQ A;  4H8K A;  3MED A;  2E4L A;  2DY4 A;  1LAW A;  3D45 A;  5JS2 A;  3HPH A;  1JLQ A;  3QO9 A;  3HJF A;  4CF8 A;  2KFN A;  3OY9 A;  4IFV A;  1TL1 A;  4LSN A;  4B9T A;  2HND A;  4DQR A;  3K5N A;  1TL3 A;  3PX6 A;  3KD1 E;  4UQG A;  3SZ2 A;  1U47 A;  4Z4F A;  1JL2 A;  5CZ2 A;  3HYF A;  1VSJ A;  3CM5 A;  3KLH A;  1C1C A;  1KFS A;  1EX4 A;  4MFB A;  1T8E A;  4EZ6 A;  1VK0 A;  2XHB A;  4CFC A;  4OVL A;  1TGO A;  1D5A A;  3NF7 A;  3ASM A;  4CJU A;  3LZJ A;  2X78 A;  3V1R A;  1Q9Y A;  1RBS A;  1B9D A;  3O4N A;  4FZY A;  2HW3 A;  5HRP A;  3VQC A;  1TK5 A;  4CCH A;  5KRT A;  1YTA A;  3EYZ A;  1X9M A;  4CJV A;  3NH1 A;  3K5L A;  1ZBH A;  3NF9 A;  3T1A A;  2HHT A;  4DTM A;  4CEA A;  2OPQ A;  3QER A;  4F4K A;  3U6F A;  3TAF A;  1QSL A;  3QEI A;  1BGX T;  5HRN A;  1CXU A;  1GOC A;  1S1X A;  3HM9 A;  4CHP A;  4DTS A;  4FLZ A;  3QEP A;  3SQ1 A;  3QLH A;  3VQD A;  4YFU A;  4DSF A;  4J2E A;  4Z4G A;  4CER A;  4CK1 A;  4E3S A;  3PY8 A;  2BE2 A;  1RT1 A;  3IG1 A;  4BWM A;  3QNN A;  4BDP A;  3KKR A;  1VSH A;  5FRN A;  2WON A;  3HVT A;  5CY4 A;  4DLG A;  4CJ3 A;  4JRQ A;  4LH4 A;  2Y1J A;  3TAP A;  4DS5 A;  3ZSZ A;  3V9U A;  1CXQ A;  3LDS A;  4O44 A;  4DFK A;  1J5O A;  3AO1 A;  3KKS A;  3I0R A;  2P5G A;  4LY7 A;  2YNH A;  4DWI A;  2KTQ A;  1WSJ A;  1TKD A;  4KAZ A;  1SUQ A;  4W5O A;  1WLJ A;  3OYG A;  1RTD A;  3KTQ A;  1B9F A;  3NAE A;  4CIG A;  3C6T A;  3U3Y A;  1WAJ A;  4CIE A;  1VSE A;  2BAN A;  2YNF A;  2I5J A;  4AH9 A;  4CHO A;  4AHV A;  3HL8 A;  3DOL A;  3AVC A;  3L2W A;  3TR8 A;  1LWF A;  4PQU A;  1QQC A;  1RT3 A;  1BIU A;  1GOB A;  1SL1 A;  4ID1 A;  3KJV A;  1S1U A;  3KIO A;  3L2R A;  4DU3 A;  1KTQ A;  4FJ5 A;  3AVF A;  1A5W A;  4M3R A;  3KLG A;  5FRO A;  4H4M A;  4CEE A;  3DRS A;  5KI6 A;  2G8H A;  1XHX A;  4FLU A;  3VQ8 A;  3RTV A;  2YKM A;  4I7F A;  4RG8 A;  1KCF A;  1I39 A;  1VSI A;  4CEQ A;  3MEE A;  3VQP A;  4EP5 A;  1MU2 A;  1UAX A;  1KFD A;  2OPS A;  1CZB A;  3ZSR A;  3LPU A;  1Q8I A;  4E89 A;  1EP4 A;  2P1J A;  1WN7 A;  1U49 A;  4GW6 A;  4N56 A;  1ITG A;  4FJN A;  3MXM A;  1S5J A;  4CEF A;  4OGE A;  1TAQ A;  4CEB A;  2O4G A;  4L8R B;  4N41 A;  3CFR A;  4BDY A;  3ZSO A;  4FLW A;  4CJ5 A;  2BDP A;  3SUQ A;  4DSL A;  1T05 A;  1WSH A;  4DTR A;  4CJ4 A;  4H4O A;  3ALY A;  4LD0 A;  2KW4 A;  2LSN A;  3OS2 A;  3C95 A;  3OJU A;  3SPZ A;  1UWB A;  4M3U A;  1RTI A;  3PO4 A;  3SJJ A;  1KSP A;  4B9U A;  3BDP A;  2HHS A;  3PUF A;  3D0P A;  1HPZ A;  3L3V A;  3P5J A;  3QNO A;  1R0A A;  4CJS A;  3CYM A;  4BAC A;  4RW4 A;  3TAB A;  3RMC A;  1RTJ A;  1S9G A;  1UOC A;  1WNS A;  3QIP A;  3OYD A;  1NJW A;  2EX3 A;  4C8M A;  3KLF A;  2B6A A;  3LAM A;  5FDL A;  3P1G A;  4QCL A;  1VSD A;  2GV9 A;  3S3N A;  4B9M A;  3OYL A;  3MAQ A;  4HVJ A;  2F8T A;  1F21 A;  2ITG A;  4RW6 A;  1U45 A;  1D8Y A;  4DQI A;  4HHT A;  4FJG A;  1W0H A;  3TAR A;  1W9H A;  3K58 A;  4QOZ B;  4FJK A;  4CJP A;  2IGI A;  2OZS A;  3V1Q A;  1TAU A;  1RNH A;  1S6Q A;  3DI6 A;  4DG1 A;  3KLE A;  1C1B A;  2XO7 A;  3G10 A;  3NE6 A;  3V4I A;  1KRP A;  4FJ8 A;  1QE1 A;  4DTU A;  4C8L A;  4FK4 A;  4E1M A;  3OYJ A;  4BE2 A;  1S9E A;  1HQE A;  5I42 A;  4HUG A;  4CGD A;  4JS4 A;  3LWM A;  4M3Z A;  4OLB A;  1ASW A;  3DM2 A;  2OA8 A;  4ELT A;  2ETJ A;  4CGG A;  4IG3 A;  3M8Q A;  4CJE A;  4CGH A;  4FLX A;  3V9W A;  1ZBF A;  4FJM A;  4RW9 A;  4KHU A;  4E0D A;  3HP9 A;  2X6S A;  3DLE A;  3H08 A;  1KLM A;  3ULD A;  4OJR A;  3V9Z A;  1IKY A;  2DTU A;  4CF9 A;  2D0B A;  1ASU A;  2ZD1 A;  1K6Y A;  4BWJ A;  4Z0U A;  4CED A;  3SUN A;  4FM0 A;  3HXM A;  3V6D A;  1TK0 A;  1WSE A;  4KV8 A;  4RW7 A;  2G8V A;  3RWU A;  3VQ7 A;  1ZBI A;  5KGW A;  3ZT2 A;  1NOZ A;  3VQQ A;  4DF8 A;  4M3Y A;  4CIF A;  3AVL A;  3SV4 A;  2RPI A;  1HMV A;  1BI4 B;  2ATQ A;  4KHY A;  1HYS A;  2P51 A;  3KD5 E;  2B5J A;  3I0S A;  1IKX A;  1NKE A;  3G0Z A;  4CES A;  4NYF A;  3AV9 A;  1JLB A;  3K5M A;  3V9X A;  2AJQ A;  3VQA A;  4FJ7 A;  2FBY A;  3DMJ A;  1J9A A;  3NF8 A;  4GVM A;  1BQM A;  4E19 A;  4ZHR A;  3OYA A;  4B08 A;  3DLB A;  3MEG A;  3HPG A;  3KK1 A;  3TAN A;  2RN2 A;  3V1O A;  3TAQ A;  2HHV A;  4NCG A;  3FFI A;  3SQ0 A;  4KTW A;  2HVH A;  1KVC A;  5C25 A;  3OYI A;  1T7P A;  3LPT A;  3RR8 A;  5SZT A;  2KZM A;  2HNY A;  1QSY A;  1U4B A;  4OKK A;  1VSK A;  2G8W A;  3DLR A;  1IH7 A;  4RW8 A;  3ZT1 A;  3LAN A;  3NGI A;  5T7B A;  4HUF A;  3S9H A;  5HBM A;  4CF1 A;  4CHQ A;  3O3F A;  4CJR A;  4Z4H A;  3L2U A;  1LW0 A;  4CGF A;  4HCB A;  5JS1 A;  5K14 A;  3LZI A;  4N5S A;  1HJR A;  4W5Q A;  2PYL A;  1RT6 A;  3B6O A;  2GUI A;  5DK5 A; 
#chains in the Genus database with same CATH topology
 5JVG L;  3L6Q A;  3AVB A;  3BGR A;  1EXQ A;  4OGC A;  5HLF A;  3SMP A;  4LF8 K;  3PO5 A;  2P9N B;  4PKG A;  4TSX A;  1ZBU A;  3VQE A;  4OX9 K;  4R5P A;  1C0U A;  2KKZ A;  1Q82 O;  3O5B A;  1LOT B;  3CFP A;  4OKE A;  3LDP A;  1T6D A;  3PV8 A;  1HKC A;  3K59 A;  4GV9 A;  1QVG M;  1ASV A;  3HZ6 A;  1KD1 O;  3L8B A;  2QXF A;  3OVN A;  4B8C A;  1S3X A;  2IVP A;  2HHQ A;  3NVK A;  1GLJ O;  1GLL O;  3RMB A;  4DSI A;  4R79 A;  5I3U A;  3OYF A;  2NZT A;  3Q7C A;  3NMU A;  3AVK A;  3AVN A;  3QEW A;  3EO3 A;  3VEW A;  3LL3 A;  3H1V X;  4KTZ A;  2KQ2 A;  2ZGY A;  3V81 A;  4DR6 K;  3A5M C;  1EWR A;  1NBW A;  1NJY A;  3H3O B;  1JLE A;  2G8K A;  3MX5 A;  3LP1 A;  1S72 N;  4FWK A;  4JKF A;  4WQ5 C;  4K8Z A;  4JI5 K;  5FPE A;  4E1N A;  4Y1C A;  3CHW A;  2X6N A;  2A1S A;  1NJX A;  4IWV A;  4FLT A;  4ILJ A;  3OYH A;  1T03 A;  4FO0 A;  4N47 A;  3KWG A;  3ZT3 A;  2YKN A;  2RHK A;  4F3O A;  2Z1J A;  3E9O A;  3LDO A;  5KPT A;  4DTX A;  3QES A;  1HQU A;  3L2Q A;  3AVJ A;  1WSG A;  1N33 K;  1YJ9 N;  1DTT A;  2A1R A;  4CEZ A;  3NF6 A;  5FRM A;  1NKB A;  1U2V B;  1IKW A;  1N5Y A;  3AVI A;  1DLO A;  1RDD A;  4O5B A;  4WCE L;  3KK2 A;  2HBM A;  2I7N A;  3VQ9 A;  3UE5 A;  3DXK A;  4M7Y A;  3TSQ A;  1TYQ B;  1DTQ A;  1JLG A;  1XMQ K;  1VHX A;  4FLY A;  1SKR A;  4KH4 A;  3VEV A;  5GAG P;  2PYJ A;  5KGX A;  3D2E A;  4CJF A;  2E20 A;  2A42 A;  3OHR A;  3SNN A;  3SUO A;  4FK0 A;  1Z05 A;  3WQT A;  2UXD K;  5CYQ A;  2R7Y A;  4IFE A;  4WF9 L;  4JS5 A;  3O1W A;  5LL6 Z;  3J8A A;  5E41 A;  4FJI A;  1BUP A;  1J53 A;  1RBR A;  3LP2 A;  5J2Q A;  5BRH A;  4JRP A;  4CFA A;  4J2A A;  3CCE N;  1C6V A;  3IFR A;  4PHT X;  4BE1 A;  2IAJ A;  2HBL A;  3LAK A;  4CZL A;  4KFB A;  1A5X A;  3JSM A;  3K57 A;  3JYT A;  2ZWH A;  2FBT A;  2QW9 A;  4B3T K;  4CK2 A;  3CM6 A;  2IDO A;  1RDB A;  4CZE A;  4GMJ B;  2FSK A;  4JKB A;  1VQ8 N;  2QA4 N;  4CEO A;  1XWL A;  5FPN A;  2VGM A;  3M8S A;  4BGA A;  1WBD A;  3ZX2 A;  3CQ8 A;  5DM6 L;  3MWP A;  4IDK A;  3IS9 A;  2GWK A;  4N76 A;  4EFH A;  1S6P A;  4DR3 K;  3O4W A;  3TAM A;  4YNQ A;  2PBD A;  2KFZ A;  4DR2 K;  1QS4 A;  1QTM A;  2QKK A;  3EEQ A;  4IFY A;  2XY5 A;  4BC5 A;  2OZM A;  4K8X A;  5AR0 A;  3O9R A;  1Z25 A;  3IRX A;  4G9Z A;  2PAV A;  5CZ1 A;  2HF4 A;  4XIU A;  1FJG K;  3O6W A;  4KHQ A;  3ISN C;  3WNF A;  2V52 B;  1NJZ A;  2E2N A;  3O4Q A;  2B4J A;  3SK3 A;  3OW2 M;  2FBX A;  2GBZ A;  4NLC A;  4UY8 O;  3VN5 A;  4JKA A;  3AAR A;  5C12 A;  5M1O A;  4DKW A;  2YNI A;  5AQS A;  4O4G A;  1IO2 A;  2EWS A;  2PZS A;  3T7Z A;  1GLD G;  2P9I B;  3TTC A;  1TYQ A;  4F3T A;  1T44 A;  2BUP A;  4DTP A;  4J2D A;  3GG4 A;  4CJQ A;  3VGM A;  3K0S A;  1TVR A;  3ZET B;  3VET A;  4GVE A;  4H0T B;  4IEI A;  1VRT A;  4E7H A;  4B3R K;  4FWL A;  5AZJ B;  2X74 A;  1RT4 A;  2DFE A;  4J8F A;  1EO1 A;  5CR4 A;  3VEY A;  2W6L A;  3O80 A;  3C6U A;  1CLQ A;  4GV6 A;  2FLO A;  2DY4 A;  1MWK A;  1N32 K;  3HJF A;  4YDU C;  3OY9 A;  1OH6 A;  1TL1 A;  4BG8 A;  2F7T A;  3SZ2 A;  1U47 A;  2F9T A;  4IOA L;  3KLH A;  3OBW A;  1Q18 A;  4OVL A;  1TGO A;  3NF7 A;  2NRZ A;  3V1R A;  3O4N A;  1B9D A;  5HRP A;  1TK5 A;  2QWP A;  5KRT A;  1YTA A;  4DV5 K;  5HOO A;  3NH1 A;  2HHT A;  3QB0 A;  3GL1 A;  3TAF A;  3SBT A;  1QSL A;  2E8A A;  1BGX T;  3SQ1 A;  4FLZ A;  3VQD A;  4YFU A;  4DSF A;  4J2E A;  4CER A;  4BWM A;  4BDP A;  3KKR A;  5FRN A;  3HVT A;  4FPA A;  4LH4 A;  1YIJ N;  3V9U A;  3LDS A;  4DFK A;  1ZXO A;  4FZZ A;  3KKS A;  2YNH A;  1TKD A;  4KAZ A;  3OYG A;  2RE2 A;  5C2D A;  3QFU A;  1WAJ A;  1V4S A;  4CIE A;  4WFN L;  2BAN A;  1MWM A;  3R9P A;  1QQC A;  1RT3 A;  1IG8 A;  4ID1 A;  3KJV A;  3L2R A;  4DU3 A;  3AVF A;  2Q1N A;  5KI6 A;  3E9P A;  3RTV A;  3T1H K;  3ENO A;  4A62 A;  2D0O A;  4KI6 A;  3MEE A;  4EP5 A;  1XC3 A;  3EKS A;  4IZ9 A;  3ZSR A;  1U49 A;  2P1J A;  4N56 A;  1S5J A;  3PIO L;  1TAQ A;  4BDY A;  4FLW A;  1KAX A;  2BDP A;  1GLA G;  1NMN A;  3LDN A;  3OS2 A;  3OJU A;  1UWB A;  4M3U A;  3H3N O;  1KSP A;  4B9U A;  2P9I A;  3BDP A;  2ZJQ L;  3P5J A;  1R0A A;  3CYM A;  4RW4 A;  2HOE A;  3RMC A;  1UOC A;  2QTD A;  2EX3 A;  4H5W A;  3P1G A;  1GLE G;  3ZET A;  3OYL A;  3MAQ A;  4HVJ A;  5LJV A;  5AZJ A;  4NXN K;  4YOY A;  1W0H A;  1GLF O;  4CJP A;  3WXL A;  1TAU A;  3V1Q A;  3JS6 A;  3DI6 A;  1VQ5 N;  5LY3 A;  5M1K A;  1KXP A;  3LWM A;  4M3Z A;  3CD6 N;  2D1K A;  5E84 A;  3CJ7 A;  1ASW A;  2OA8 A;  4ELT A;  5AQK A;  2ETJ A;  4CGG A;  3FZH A;  3M8Q A;  4IG3 A;  4CGH A;  4FLX A;  3V9Z A;  2QM1 A;  1ASU A;  4BWJ A;  1K6Y A;  1BU6 O;  4FM0 A;  3HXM A;  3V6D A;  1TK0 A;  4DV0 K;  1X9J A;  3C65 A;  4RW7 A;  3R1X A;  3RWU A;  3VQ7 A;  4DHY A;  1NOZ A;  3SBG A;  4DQ8 A;  3CPE A;  1YAG A;  4CIF A;  3SV4 A;  3I0S A;  1IKX A;  1NGJ A;  4CES A;  3KHY A;  1JLB A;  4BRN A;  2AJQ A;  3NF8 A;  1ILY A;  4BRF A;  3MEG A;  3HPG A;  5E26 A;  2A41 A;  4WQ5 A;  3SQ0 A;  3CI5 A;  4BR0 A;  2HVH A;  1W2B M;  2NRV A;  2HNY A;  1U4B A;  5T7B A;  3S9H A;  5HBM A;  3L2U A;  1E4F T;  1LW0 A;  4CGF A;  3LZI A;  5CHI A;  1HJR A;  3FR0 A;  2PYL A;  3A0I X;  4M7X A;  4K43 A;  4O5F A;  3PSI A;  3R8E A;  4BG9 A;  1LW2 A;  4XEI A;  3QET A;  1J54 A;  3KK3 A;  1XHZ A;  2GX9 A;  1BWF O;  4IG0 A;  4FCY A;  4O8U A;  1K8A O;  2YHB A;  3TAE A;  2ZGZ A;  3DLG A;  5C0Y A;  3U4L A;  3HT3 A;  4B9L A;  3SAG A;  4CF2 A;  4I2P A;  1BA1 A;  1BOT O;  1NG9 A;  4KI4 A;  2O8B B;  3MN5 A;  3SAF A;  4JKG B;  2VG7 A;  3EZW A;  3LP3 A;  1IBK K;  4JI7 K;  4FZX C;  4HUE A;  3HK2 A;  1EWQ A;  1NKC A;  2Q3S A;  1JLF A;  1RT5 A;  1NK4 A;  4JI3 K;  1YT3 A;  1FKP A;  4JI8 K;  1LWE A;  2GUP A;  2I7P A;  2HHW A;  3AA5 X;  4CF0 A;  4I6M B;  3OYN A;  2HHX A;  4CJW A;  1JJ2 M;  1HNX K;  1C0M A;  3TI0 A;  4ISG A;  5BPL A;  3DWL A;  1BIS A;  4DFP A;  3HBT A;  2F9W A;  4NCB A;  3VA0 A;  4BRQ A;  1RDA A;  3M8P A;  4FVM A;  1X1P A;  1OH8 A;  4LSL A;  1YHQ N;  5HRR A;  2F96 A;  3MCA B;  4CEC A;  4C23 A;  3ZSQ A;  3KLI A;  1JKH A;  1RDC A;  2UUA K;  1KAZ A;  1TUU A;  4M3T A;  5FLX O;  5C2F A;  3ITH A;  1DT9 A;  3CG7 A;  4JAX A;  1SKS A;  4CI6 A;  2ASP A;  2E5L K;  4DSJ A;  2P5O A;  3NFA A;  4FWQ A;  1KVB A;  3N4Q A;  1B92 A;  5FPM A;  4JI0 K;  3AO3 A;  3NH0 A;  4JYA K;  2FC0 A;  4FJL A;  1RFQ A;  1Z6R A;  3MN7 A;  4BRK A;  4PWD A;  3R3L A;  3AAQ A;  2IVO A;  4ICL A;  4DV4 K;  4FVU A;  3MK6 A;  1E3M A;  1WSI A;  2QEX N;  5GIP A;  5M1Q A;  3TTF A;  5AQP A;  2DFF A;  2WC9 A;  3M3Z A;  4BRC A;  3QEX A;  2VQE K;  3OYM A;  1VQ4 N;  4CJT A;  4U7B A;  1YUW A;  5C15 A;  3NBP A;  4H0O A;  5BPM A;  5KTQ A;  1DKG D;  4DFJ A;  4J2B A;  3AY9 A;  2E2O A;  2G8F A;  4EAH D;  4O0J A;  3OYB A;  2WBN A;  5AQX A;  3AO2 A;  1ATS A;  4DFM A;  3AO5 A;  3CME N;  1IG9 A;  3IAY A;  2WUS A;  3H45 C;  4EP4 A;  5AFU H;  1J5E K;  4BRO A;  3G6E N;  3ZSY A;  4CD1 A;  1BHL A;  4Q5V A;  4B9N A;  4FXD A;  3PLA A;  1HJO A;  4DSE A;  1L3V A;  2O8B A;  2HST A;  1NGF A;  3ZT4 A;  3K2P A;  3VER A;  2YV0 X;  4JKG A;  4DSK A;  2OPP A;  1TKT A;  1FK9 A;  4I9L A;  1GLC G;  2GEL A;  4NO7 A;  4YDU A;  1C0T A;  3K9K A;  2A5X A;  4I6M A;  4KH5 A;  3E66 A;  3O3G A;  4CK3 A;  2XY8 A;  1NK7 A;  1VAZ A;  4Z4I A;  1NK5 A;  4K25 A;  5TKY A;  3HP6 A;  3AA4 A;  1JXB A;  4AHT A;  1SL2 A;  4M3X A;  3NVM A;  4K42 A;  1KLN A;  5M1P A;  4CZK A;  3EE8 A;  1NGH A;  4YOU A;  3CXC M;  3J7Z O;  4MQ3 A;  3EL2 A;  4JKH A;  2G8I A;  3O9S A;  4CGI A;  3VQB A;  2ZJP L;  3T19 A;  2A3Z A;  3VA3 A;  3AVG A;  1LAV A;  1EKE A;  2J4R A;  5A2Q O;  2D0C A;  4IJA A;  1BO5 O;  3W3D A;  2O4I A;  1ZYQ A;  3V9S A;  3J7A P;  4B3O A;  4U67 L;  3CPW M;  4K0K K;  1NGC A;  4IOX A;  1BG3 A;  4EZ9 A;  4BR4 A;  3CMA N;  3CCU N;  5AJ3 K;  2Z1G A;  3CIP A;  2VCP A;  5F1X A;  4O55 A;  2HF3 A;  2Z1I A;  4AHS A;  3QEV A;  4W5T A;  2FXU A;  4I2Q A;  3GDQ A;  4FYD A;  1L3U A;  4BE0 A;  1U04 A;  4OLA A;  5EXW A;  4AHC A;  4MDB A;  5KPR A;  1RBT A;  4FJH A;  4YOR A;  3T3F A;  4CW7 B;  4QAG A;  4H8K A;  3L4I A;  3MED A;  1LAW A;  5AZI B;  3ULE B;  2HHH K;  1Q7Y O;  3BF1 A;  4LSN A;  3I55 N;  1OH7 A;  4H5T A;  2YHY A;  3HYF A;  1VSJ A;  1C1C A;  2YJE A;  4X65 K;  3RSE B;  1T8E A;  1VK0 A;  2XHB A;  4CFC A;  1D5A A;  3ASM A;  4CJU A;  2HBK A;  2X78 A;  4FZY A;  1RBS A;  4FWP A;  3VMF B;  3EYZ A;  1EQY A;  1ZBH A;  3NF9 A;  3T1A A;  4CVN E;  5LMN K;  2O8F B;  3WUH A;  3QER A;  4F4K A;  1VQ6 N;  4JV5 K;  3QEI A;  2E88 A;  1GOC A;  4CHP A;  3QLH A;  4CZM A;  3PY8 A;  4B1Y B;  3TAP A;  2V7Y A;  3MDQ A;  4YOT A;  4O44 A;  3E9L A;  2KTQ A;  4LY7 A;  1QZ5 A;  1WSJ A;  1SUQ A;  1WLJ A;  3VTI A;  1RTD A;  3KTQ A;  3NAE A;  3U3Y A;  2I5J A;  4AH9 A;  4AHV A;  3L2W A;  2E1Z A;  1LWF A;  5F2R A;  1SL1 A;  3KIO A;  1KTQ A;  4JI4 K;  1K73 O;  2UUC K;  1A5W A;  4BRA A;  4H0P A;  4H4M A;  4A2B A;  1QZ6 A;  2G8H A;  4B1U B;  3CQY A;  3O9Q A;  4ILG B;  1O13 A;  3VQ8 A;  3G71 N;  4FLU A;  1VSI A;  1KFS A;  3VQP A;  1KFD A;  3LPU A;  4E89 A;  4KHP K;  1EP4 A;  1WN7 A;  5JIC A;  3J81 O;  4FJN A;  2QWQ A;  3CFR A;  3ZSO A;  3SUQ A;  5DM7 L;  1D4X A;  1BA0 A;  1QQO A;  1WSH A;  4O8K A;  4CJ4 A;  1Q81 O;  2KW4 A;  2LSN A;  5LJW A;  2ZM6 K;  3B8A X;  3SPZ A;  4JHD B;  5GAD P;  4GKK K;  1FW6 A;  3TAB A;  4CZI A;  3SAH A;  1WNS A;  3QIP A;  5EX5 A;  4IXC A;  1NJW A;  5F0X A;  4C8M A;  3KLF A;  2B6A A;  5FDL A;  1T6C A;  3SJH A;  2F8T A;  1XQS C;  4FJG A;  1WBB A;  1W9H A;  3ZEU B;  4QOZ B;  4FJK A;  3KLE A;  2AP1 A;  4FK4 A;  4E1M A;  1HQE A;  4XH4 A;  4CGD A;  5AZI A;  3ULE A;  4OLB A;  3CJ9 A;  3HRG A;  4CZJ A;  4WQ4 C;  3J7Y P;  1VQO N;  1ZBF A;  4CBU A;  5AQW A;  4E0D A;  5ELZ A;  2X6S A;  3RSE A;  4OJR A;  1J6Z A;  4CED A;  3O08 A;  4Z0U A;  1SAZ A;  4JK9 A;  4DV3 K;  3QBW A;  3ZT2 A;  1NGI A;  2O8F A;  4EIA A;  3AVL A;  2UYT A;  4LFC K;  4JK7 A;  3VF2 A;  1BI4 B;  3KD5 E;  2B5J A;  1NKE A;  1KQS M;  4Z94 A;  4BVP A;  2ZF5 O;  3K5M A;  4FJ7 A;  4DTU A;  3DMJ A;  1J9A A;  4WYB A;  4ZHR A;  1BQM A;  4B1W B;  3KD1 E;  2UU9 K;  3KK1 A;  2JWK A;  2RN2 A;  3UB5 A;  4LF6 K;  3FFI A;  4KTW A;  4LC9 B;  5C25 A;  3OYI A;  4DR4 K;  3LPT A;  3A5L C;  4QS9 A;  4OKK A;  1VSK A;  2ITM A;  4RW8 A;  1IH7 A;  5M1F A;  3LAN A;  4HUF A;  4CF1 A;  3CCM N;  4Z4H A;  2ASM A;  4HCB A;  4W5Q A;  3B6O A;  2GUI A;  5AFU A;  5DK5 A;  3TAG A;  3WNE A;  1YJW N;  3SLC A;  4NB4 A;  3L4Q A;  3F73 A;  4YHH K;  3ID8 A;  4CHY A;  3TSP A;  2UXC K;  2CGL A;  3AGR A;  4FJX A;  2D0P A;  1Q9X A;  3OYK A;  3RRH A;  5J1E A;  1YI2 N;  2OYQ A;  4E7J A;  4FJ9 A;  3ZT0 A;  1BL3 A;  4GKJ K;  5AQF A;  2RF2 A;  4OKJ A;  4E7I A;  1RTH A;  3F9K A;  4HCC A;  1BIZ A;  3C7N B;  4JHD A;  3SV3 A;  4PA1 A;  4B9V A;  2CGJ A;  1NWK A;  3SQ4 A;  2ZE2 A;  3E1Y A;  4BRL A;  4DLE A;  3D2F B;  4Z4C A;  3QIO A;  1HKG A;  1O1W A;  1QHT A;  3BZC A;  2VWB A;  3JAM O;  4M42 A;  4B1Z A;  1NK0 A;  1TV6 A;  4CFB A;  2VWJ A;  4JI6 K;  4ILH A;  4FW1 A;  4JI2 K;  3O1B A;  3VQ5 A;  3NGY A;  4ELU A;  2NNW A;  3ZEU A;  3NHG A;  1HNW K;  3SYZ A;  4CGJ A;  4Y1D A;  2HBJ A;  2NUB A;  2NRX A;  5BRD A;  3EN9 A;  1IJJ A;  5GIO A;  2V7Z A;  4PL8 A;  3FZK A;  4C1N K;  4CHN A;  3LWL A;  3K9J A;  1V4T A;  2Z1H A;  3B6P A;  4CZF A;  3C6A A;  2E2P A;  5DMR A;  3VPZ A;  2RKI A;  5BN9 A;  1HNI A;  4KH6 A;  1XUP O;  5AQN A;  4M3W A;  3IUC A;  3N4P A;  4PL7 A;  3AAP A;  1CZA N;  3VEN A;  1G99 A;  2E2Q A;  3ATV A;  1QSS A;  2QI2 A;  3AVH A;  1ZC6 A;  2IS3 A;  1NLV A;  1RBV A;  3WXK A;  1XC9 A;  2BGG A;  1NK9 A;  3CJB A;  1BI4 A;  1NOY A;  2HB5 A;  4FM2 A;  5HRO A;  4FWR A;  3WEE B;  2DFH A;  1RGI A;  3CC7 N;  2H3G X;  4DR5 K;  4JI1 K;  5I9E B;  4CBW A;  5J2N A;  3Q7B A;  1NGD A;  3O3H A;  3F2K A;  2NRT A;  4NCA A;  2E6M A;  5AQM A;  4DF4 A;  4H0X B;  4BRP A;  5AQZ A;  2GEM A;  2E1Y A;  2D0A A;  4CFD A;  3CCQ N;  2P9K B;  4YOW A;  4M41 A;  5J2M A;  3S3O A;  1NMD A;  3LDL A;  4KHS A;  1W7A A;  3A5N C;  3AA3 A;  3GOI A;  4FW2 A;  3G4S N;  3VGL A;  3RMD A;  4FWO A;  3KK7 A;  5TKW A;  4C8N A;  4B1X B;  3OJS A;  3AA2 A;  1QHA A;  2IC3 A;  1NK8 A;  1SKW A;  3C7N A;  3MCP A;  1ATN A;  3PSF A;  4CE9 A;  4CZH A;  3I8D A;  1YJN N;  4FLV A;  4FM1 A;  1NU0 A;  1SS6 A;  1TUY A;  3U3G A;  1KC8 O;  4M45 A;  2VGN A;  2W42 A;  2EHG A;  3D2F A;  2DPN A;  3NDK A;  4A5B A;  4F2S A;  2P9P B;  4I9Q A;  4KRF A;  5AQT A;  4H5R A;  5GAH P;  4CJK A;  1JLC A;  3CJC A;  4CJ7 A;  2D5R A;  4Q0B A;  4DB3 A;  3ZSV A;  1P8Z A;  2JGU A;  1S1W A;  2ZJR L;  3VTH A;  4FJJ A;  1REV A;  1K9M O;  3DRP A;  1L5U A;  1ZBL A;  3ZSW A;  4PKI A;  4DS4 A;  4B8A B;  1SL0 A;  4KO0 A;  4BRD A;  2FBV A;  1GOA A;  3L2V A;  3CJA A;  5BR8 K;  4QS8 A;  4CHZ A;  3PX0 A;  3HVR A;  3RR7 A;  4DV7 K;  1NK6 A;  1OVQ A;  2JLE A;  4PKH A;  3SUP A;  5CE3 A;  2P9S B;  2WOM A;  4HTL A;  1YVU A;  2HHU A;  3CCS N;  1HR0 K;  2QWL A;  4DV6 K;  2PY5 A;  3SCX A;  2Q0R A;  4FL9 A;  4HWI A;  1S1T A;  4F8R A;  3M5R A;  4LF9 K;  3OYE A;  5C42 A;  1Y64 A;  3WXI A;  4EHT A;  4DU4 A;  3WEE A;  2Y1I A;  4OPJ A;  1LWC A;  4LH5 A;  1KVA A;  2YI1 A;  4O0I A;  2W40 A;  4C8O A;  2QK9 A;  1JCG A;  3THV A;  3CC4 N;  3FLC O;  4Z4E A;  1HRH A;  4DQQ A;  4BVO A;  3FZF A;  2YHX A;  4X62 K;  3LM2 A;  1Z26 A;  3OS0 A;  5EY4 A;  3SQ2 A;  1VQ9 N;  2YHW A;  1L3S A;  3WQU A;  3K5O A;  3OYC A;  4OPA A;  4H03 B;  2P9K A;  4KB0 A;  1D9F A;  2WTU A;  1U48 A;  4B9S A;  1WAF A;  2G8U A;  4KHW A;  5C24 A;  4A5A A;  2YHA A;  4ISE A;  3P39 A;  2HMI A;  1S1V A;  4JEP A;  2UXB K;  1BQN A;  2JWL A;  2IOC A;  1VQ7 N;  5KQ8 A;  4BGB A;  3FZM A;  3EKU A;  1GLB G;  3FE1 A;  1D9D A;  4YY3 K;  2E4L A;  3LM9 A;  3HPH A;  1JLQ A;  3ENH A;  3QO9 A;  2P9L B;  4BRH A;  2KFN A;  2UUB K;  4B9T A;  1NJI O;  3PX6 A;  1YF5 L;  2CH5 A;  4AM6 A;  4UQG A;  1JL2 A;  3BEX A;  5CZ2 A;  5BRF A;  3CM5 A;  4MFB A;  4EZ6 A;  1ATR A;  4X66 K;  1Q9Y A;  4BRG A;  3RVC A;  2HW3 A;  5BRE A;  3VQC A;  2IIR A;  2P9P A;  3BF3 A;  1X3M A;  5IT9 O;  4DTM A;  3U9Z A;  3GE1 A;  4CEA A;  3UKR B;  3DLL L;  1SQK A;  1CXU A;  3KVG A;  4LFA K;  1S1X A;  2CH6 A;  4BRM A;  4Z4G A;  4CK1 A;  4ISF A;  3BZK A;  3R6M A;  2BE2 A;  1RT1 A;  4WQ4 A;  4Y0W A;  3QNN A;  1VSH A;  4IDH A;  5B8H A;  4CJ3 A;  3UKU B;  4JRQ A;  2Y1J A;  3D6R A;  3ZSZ A;  1CXQ A;  3AO1 A;  3I0R A;  3DJC A;  4DWI A;  3U8X A;  3QFP A;  1B9F A;  4CIG A;  3C6T A;  3BY5 A;  4AQY K;  1HKB A;  2NRR A;  2Q0U A;  3BP8 A;  3TTD A;  2YNF A;  3DXM B;  1E4G T;  4BQL A;  3OA9 A;  3TR8 A;  4FSV A;  3F5T A;  4BC3 A;  4IOC L;  4PQU A;  1BIU A;  1GOB A;  2P9S A;  5EVZ A;  1C0G A;  1BDG A;  4FJ5 A;  3DRS A;  5AQY A;  1JCF A;  5GAE P;  4I7F A;  4RG8 A;  1MU2 A;  3HM8 A;  1UAX A;  2OPS A;  4GW6 A;  1ITG A;  1HPM A;  4F9O A;  4CEF A;  3T69 A;  4OGE A;  3MXM A;  4L8R B;  2O4G A;  4N41 A;  4IJN A;  5C10 A;  1WB9 A;  3I8B A;  1T05 A;  1N36 K;  3L0Q A;  4A59 A;  4DTR A;  3ALY A;  4LD0 A;  3C95 A;  1RTI A;  3SJJ A;  3CCR N;  2OTL N;  4MO5 A;  2HHS A;  4CBX A;  1HPZ A;  4QS7 A;  4E1J A;  4YOX A;  4OO1 J;  1RTJ A;  1S9G A;  4DR1 K;  4QCL A;  1VSD A;  2GV9 A;  2IVN A;  3S3N A;  4B9M A;  1F21 A;  2ITG A;  1U45 A;  5AQI A;  1D8Y A;  4HHT A;  1WUA A;  5AQO A;  3TAR A;  3K58 A;  2OZS A;  4DG1 A;  2KLA A;  3V4I A;  1KRP A;  4FJ8 A;  4C8L A;  4BE2 A;  5I42 A;  2OTJ N;  4B9Q A;  2P9L A;  3BUZ B;  2W41 A;  1YXQ A;  3D7E O;  1MDU B;  4FJM A;  1P90 A;  4BR2 A;  1VQK N;  5BPN A;  4KHU A;  3THW B;  3DLE A;  4V19 S;  1KLM A;  4JK8 A;  4BC4 A;  2DTU A;  4CF9 A;  2D0B A;  2ZD1 A;  1NNE A;  3A5O C;  3QIC A;  3H1Q A;  5ADX H;  3P38 A;  2YX6 A;  5AQJ A;  4MO4 A;  5MLC Q;  3VQQ A;  2AA4 A;  2RPI A;  3UKR A;  2ATQ A;  1HYS A;  2P51 A;  1RDU A;  3G0Z A;  4NYF A;  3AV9 A;  4GNI A;  2FBY A;  3OYA A;  1HNZ K;  2QXL A;  3V1O A;  3TAQ A;  3UKU A;  5KQD A;  4LFB K;  2HHV A;  1C0F A;  3O8M A;  4AM7 A;  1KVC A;  3RR8 A;  5SZT A;  1DEJ A;  2VQF K;  3DXM A;  2G8W A;  1KAY A;  2P9N A;  4CZG A;  2ASO A;  4CHQ A;  3O3F A;  1VQP N;  4BR7 A;  3MN9 A;  1OH5 A;  3THY B;  4K41 A;  4CD3 A;  3M1F A;  5M1N A;  3THX B;  4N5S A;  2QWR A;  4M63 C;  1NGB A;  4DQS A;  1FXX A;  4MLH A;  4GV3 A;  2F4V K;  3ATU A;  3ID6 A;  3VQ4 A;  1I3A A;  2VYP A;  3JXU A;  3RMA A;  4JLH A;  1VQN N;  3VQ6 A;  3DRR A;  1HNV A;  1X9S A;  2XRI A;  4W5N A;  3VF4 A;  1TKX A;  1U6Z A;  2GWJ A;  3CJ1 A;  4E7L A;  3LP0 A;  2KZZ A;  3NGZ A;  3AVA A;  5JMV A;  3MMV A;  3H6E A;  5EU7 A;  3AO4 A;  5GIN A;  5J2P A;  1QVF M;  3VEZ A;  1TK8 A;  1XI1 A;  4BQZ A;  2VWK A;  4IO9 L;  3OTO K;  3QML A;  5LMU K;  1MA9 B;  4JKE A;  4FOE A;  1HYV A;  1EET A;  3LAL A;  2E6L A;  4WE1 A;  1X9W A;  1Q86 O;  3SMS A;  3WNH A;  1LCU A;  4WFA L;  4AIL C;  1QQN A;  5KPZ A;  4W5R A;  4ELV A;  3NCI A;  3NH2 A;  4DTJ A;  4A2A A;  3THW A;  2QKB A;  3AVM A;  4FK2 A;  3HOT A;  3ZSX A;  3FZL A;  4DQP A;  1SV5 A;  4IBN A;  3DLK A;  2HNZ A;  4FWM A;  1RT7 A;  2VG5 A;  5SWM A;  4DU1 A;  1U2V A;  1VSL A;  3MXJ A;  1ZBS A;  1IKV A;  3CCL N;  1CZ9 A;  4BDZ A;  4IKF A;  1N8R O;  4PUO A;  4AHR A;  2XY7 A;  3ZX3 A;  4PY5 A;  1NGA A;  4A57 A;  4F2R A;  3KZB A;  4RWT A;  2NLX A;  5BR9 A;  3W0L A;  1VQL N;  1HYZ A;  4KKO A;  4EHU A;  4NYN A;  4BRE A;  3MWT A;  1IBL K;  4DMN A;  4MLE A;  5FPD A;  1A5V A;  1VSF A;  3TSU A;  4BR5 A;  1IBM K;  1Y97 A;  2FSJ A;  3THY A;  2A40 A;  3EY1 A;  3THX A;  4DR7 K;  4KB1 A;  3ZYY X;  1UA1 A;  3G25 A;  2BTF A;  1HX1 A;  1LV5 A;  4LF5 K;  4OPH A;  1L3T A;  5AQU A;  2XY6 A;  3OS1 A;  3C0B A;  5HP1 A;  4KPY A;  3OBY A;  4L3Q A;  1DGK N;  3CFO A;  3M8R A;  1OVY A;  1XNQ K;  1YIT N;  1T3V A;  5IWA K;  2BH1 A;  4KTQ A;  1RCH A;  2ZQB A;  3S3M A;  5EOY A;  4IEE A;  4CJL A;  5AQQ A;  3O9U A;  3CQX A;  4JD2 B;  2VG6 A;  4B3M K;  1TKZ A;  4YOV A;  5HRS A;  2YNG A;  4OPK A;  2F8S A;  1G15 A;  3C94 A;  4DUZ K;  1UA0 A;  4KRE A;  4H0Y B;  3WNG A;  3CCV N;  3VF6 A;  1M1K O;  2Q36 A;  3P83 D;  1BCM A;  1RT2 A;  1VSM A;  3A2F A;  3DAW A;  3MEC A;  1JXE A;  3VES A;  1N6Q A;  3SI6 A;  1ESV A;  4JKC A;  3HPO A;  4DCH A;  4ZTF A;  5H1S Q;  4MDA A;  1FKO A;  1BCO A;  4H0V B;  3S41 A;  3TPQ A;  3DYA A;  2O8C B;  4GY2 B;  5HL7 L;  2CGK A;  2Q31 A;  4E7K A;  3VEO A;  3PIP L;  4LF4 K;  2OPR A;  3FFK B;  3CCJ N;  5CYM A;  5AQG A;  3CF5 L;  3EE9 A;  3DOK A;  4C1N I;  3WXM B;  4BY9 C;  4AF1 A;  4H5V A;  4AHU A;  1WSF A;  1JLA A;  1NM1 A;  4RCH A;  3ZCM A;  3P31 A;  3HST B;  1RBU A;  4KBO A;  5KRS A;  1NGG A;  5BN8 A;  4DTN A;  4C8K A;  1VRU A;  3UIQ A;  3QIN A;  1C1A A;  3SPY A;  3PX4 A;  1YTU A;  4DTO A;  3CC2 N;  3VOV A;  2NRH A;  2YJF A;  4LF7 K;  2PFU A;  4X64 K;  3MXI A;  3T1Y K;  1YVN A;  2QWN A;  4G1Q A;  3EZ5 A;  2D4W A;  3VGK A;  3TU5 A;  1IV0 A;  5D3G A;  4ID5 A;  4HTU A;  4BR9 A;  3M6G A;  4IO8 A;  3L3U A;  2O8D B;  1RIL A;  3E01 A;  2HVI A;  3TWH A;  3I33 A;  3DLH A;  4KHN A;  5ADX A;  1JL1 A;  5JS2 A;  3D45 A;  4NLB A;  4CF8 A;  2KHO A;  3LDQ A;  4IFV A;  2WFB A;  2HND A;  1R59 O;  4DQR A;  3K5N A;  1TL3 A;  3HOS A;  4Z4F A;  1QQM A;  1HLU A;  3F9M A;  1EX4 A;  1HUX A;  3WT0 A;  3LZJ A;  1M90 O;  2Q2R A;  4CCH A;  4JD2 A;  1X9M A;  4CJV A;  3K5L A;  2A6A A;  2OPQ A;  1K8K B;  2W6K A;  3U6F A;  4B3S K;  5HRN A;  2FF3 B;  3HM9 A;  4DTS A;  1SZ2 A;  1RDW X;  3QEP A;  3HO1 A;  2O8E B;  4E3S A;  3CET A;  3IG1 A;  2WON A;  5CY4 A;  4DLG A;  3AGK A;  3IDH A;  4WFB L;  4XH1 A;  4DS5 A;  1J5O A;  1WOQ A;  2P5G A;  5AQR A;  4W5O A;  3A8Y A;  4RTF D;  3J80 O;  4FWS A;  1VSE A;  2O8C A;  4CHO A;  5AQV A;  3HL8 A;  3DOL A;  3AVC A;  2GTD A;  1S1U A;  4M3R A;  3KLG A;  5FRO A;  4CEE A;  3HI0 A;  1S22 A;  2P9U B;  1XHX A;  3I56 N;  1I94 K;  4XH5 A;  2YKM A;  1KCF A;  1I39 A;  4CEQ A;  4ZTJ A;  3ENB A;  3RRG A;  1CZB A;  1Q8I A;  1XNR K;  2Q97 A;  4CEB A;  3IKM A;  3MN6 A;  4CJ5 A;  5AQH A;  5JLF A;  4DSL A;  1XMO K;  1NGE A;  3C6H A;  2NRW A;  4H4O A;  3PO4 A;  4BRI A;  1W97 L;  3PUF A;  3D0P A;  3L3V A;  3QNO A;  4CJS A;  4BAC A;  2FSN A;  2QWO A;  3OYD A;  5AQL A;  4DUY K;  3QDK A;  3LAM A;  2OAN A;  4RW6 A;  4DQI A;  3MX2 A;  2O8D A;  4FPB A;  2IGI A;  1RNH A;  1OKJ A;  1S6Q A;  2XO7 A;  1C1B A;  3G10 A;  3IMX A;  3NE6 A;  1QE1 A;  3U9D A;  3KWI A;  3OYJ A;  1S9E A;  4DV2 K;  4JN4 A;  4HUG A;  4JS4 A;  3O9T A;  3CER A;  3DM2 A;  4A61 A;  3VEX A;  3V9W A;  4CJE A;  3HSC A;  4BC2 A;  4RW9 A;  3HP9 A;  3ULD A;  3H08 A;  3ZX0 A;  4B1V A;  1IKY A;  1N34 K;  3SUN A;  4H5N A;  2YCH A;  1WSE A;  4KV8 A;  2G8V A;  2FF6 A;  3GBT A;  1ZBI A;  5KGW A;  4M3Y A;  4DF8 A;  1X3N A;  2OCE A;  3P4I A;  1K8K A;  1HMV A;  4KHY A;  4NXM K;  1H1V A;  4JKD A;  4FWN A;  3FGU A;  3V9X A;  4JNE A;  3VQA A;  2O8E A;  4GVM A;  4E19 A;  4B08 A;  3DLB A;  3QBX A;  3H46 O;  2QWM A;  3TAN A;  3ZLJ A;  3WXJ A;  2HMP A;  1VQM N;  4DV1 K;  4NCG A;  3HTV A;  1T7P A;  2KZM A;  1QSY A;  3DLR A;  3ZT1 A;  3DXK B;  5JVH L;  3NGI A;  2V51 B;  4CJR A;  3D2E B;  4FOI A;  5JS1 A;  5K14 A;  5JLH A;  1RT6 A;  1JCE A;  2P9U A; 
#chains in the Genus database with same CATH homology
 3AVB A;  3BGR A;  1EXQ A;  1FXX A;  4OGC A;  3WNE A;  4DQS A;  3TAG A;  5HLF A;  3VQ4 A;  1I3A A;  3F73 A;  3RMA A;  3PO5 A;  1LW2 A;  4JLH A;  4CHY A;  3QET A;  1J54 A;  3KK3 A;  3VQ6 A;  3DRR A;  4TSX A;  1HNV A;  4FJX A;  1XHZ A;  1X9S A;  1ZBU A;  4IG0 A;  3VQE A;  2XRI A;  3OYK A;  4FCY A;  5J1E A;  4R5P A;  3RRH A;  1C0U A;  2OYQ A;  4W5N A;  4E7J A;  1TKX A;  4FJ9 A;  3ZT0 A;  1BL3 A;  4E7L A;  3CFP A;  2RF2 A;  2YHB A;  4OKJ A;  4E7I A;  1RTH A;  3F9K A;  3LP0 A;  3TAE A;  1BIZ A;  4HCC A;  2KZZ A;  3NGZ A;  3AVA A;  3SV3 A;  3DLG A;  4PA1 A;  4B9V A;  5EU7 A;  4OKE A;  3SQ4 A;  3PV8 A;  2ZE2 A;  3HT3 A;  4B9L A;  4DLE A;  3AO4 A;  4CF2 A;  3K59 A;  4I2P A;  4KI6 A;  1ASV A;  4Z4C A;  4KI4 A;  3QIO A;  3L8B A;  1O1W A;  1QHT A;  2QXF A;  5J2P A;  4M42 A;  3OVN A;  4B8C A;  1TK8 A;  1XI1 A;  1TV6 A;  1NK0 A;  2VG7 A;  4CFB A;  2VWK A;  2VWJ A;  2HHQ A;  3LP3 A;  4FW1 A;  3RMB A;  4DSI A;  3VQ5 A;  4FZX C;  3NGY A;  4ELU A;  4HUE A;  5I3U A;  3OYF A;  3NHG A;  3AVK A;  3HK2 A;  1HYV A;  3SYZ A;  1NKC A;  2Q3S A;  1JLF A;  1RT5 A;  4CGJ A;  3AVN A;  1NK4 A;  3QEW A;  1YT3 A;  1EET A;  3LAL A;  4Y1D A;  1FKP A;  2E6L A;  4WE1 A;  1X9W A;  4KTZ A;  1LWE A;  2NUB A;  3WNH A;  2KQ2 A;  3AA5 X;  4AIL C;  2HHW A;  4CF0 A;  4W5R A;  3V81 A;  3OYN A;  4ELV A;  4CHN A;  4CJW A;  3LWL A;  2HHX A;  1C0M A;  1NJY A;  2Z1H A;  3TI0 A;  1JLE A;  2G8K A;  3B6P A;  3NCI A;  3LP1 A;  1BIS A;  4DFP A;  5DMR A;  3NH2 A;  2RKI A;  4DTJ A;  4NCB A;  1HNI A;  3VA0 A;  4M3W A;  1RDA A;  3M8P A;  4K8Z A;  4FZZ A;  2QKB A;  4FVM A;  3AVM A;  1X1P A;  4FK2 A;  4E1N A;  4LSL A;  4Y1C A;  3ZSX A;  5HRR A;  2F96 A;  2X6N A;  2A1S A;  1NJX A;  4DQP A;  1SV5 A;  4IBN A;  3DLK A;  4CEC A;  2HNZ A;  4FLT A;  1QSS A;  1RT7 A;  2VG5 A;  3ZSQ A;  3AVH A;  2IS3 A;  3OYH A;  1RBV A;  1XC9 A;  5SWM A;  4DU1 A;  1VSL A;  1T03 A;  3MXJ A;  2BGG A;  4N47 A;  3KLI A;  3ZT3 A;  1JKH A;  2YKN A;  1IKV A;  1RDC A;  1CZ9 A;  4BDZ A;  1NK9 A;  4IKF A;  4M3T A;  4F3O A;  2Z1J A;  1BI4 A;  4DTX A;  1NOY A;  2HB5 A;  4FM2 A;  3ITH A;  3QES A;  4PUO A;  1HQU A;  4AHR A;  3CG7 A;  5HRO A;  3L2Q A;  1SKS A;  3AVJ A;  1WSG A;  4DSJ A;  2XY7 A;  4PY5 A;  2P5O A;  2DFH A;  3NFA A;  4F2R A;  1KVB A;  1B92 A;  1DTT A;  2A1R A;  4CEZ A;  3NF6 A;  3AO3 A;  5FRM A;  1NKB A;  3NH0 A;  1IKW A;  1N5Y A;  5J2N A;  3AVI A;  2FC0 A;  4FJL A;  1DLO A;  1RDD A;  1HYZ A;  3O3H A;  4O5B A;  4KKO A;  4PWD A;  4ICL A;  3KK2 A;  4NCA A;  1WSI A;  4NYN A;  2E6M A;  3VQ9 A;  4DF4 A;  2DFF A;  4DMN A;  3HO1 A;  1DTQ A;  1JLG A;  1A5V A;  1VSF A;  2D0A A;  4FLY A;  4CFD A;  3QEX A;  1SKR A;  1Y97 A;  3OYM A;  2PYJ A;  5KGX A;  4CJT A;  3EY1 A;  4CJF A;  4KB1 A;  4M41 A;  3NBP A;  5KTQ A;  5J2M A;  3SUO A;  3SNN A;  3S3O A;  1UA1 A;  4FK0 A;  4KHS A;  3AA3 A;  5CYQ A;  4DFJ A;  2R7Y A;  4ZTJ A;  4FW2 A;  1LV5 A;  4J2B A;  3RMD A;  4JS5 A;  2G8F A;  1L3T A;  4C8N A;  4O0J A;  5E41 A;  3OS1 A;  2XY6 A;  4FJI A;  3OYB A;  1J53 A;  1RBR A;  3LP2 A;  5J2Q A;  3OJS A;  5HP1 A;  4KPY A;  3AO2 A;  3AA2 A;  4JRP A;  4CFA A;  2IC3 A;  3AO5 A;  4DFM A;  1NK8 A;  1IG9 A;  1SKW A;  3IAY A;  4CE9 A;  4J2A A;  4EP4 A;  1C6V A;  3CFO A;  3M8R A;  3I8D A;  4BE1 A;  2IAJ A;  4KTQ A;  4FLV A;  1RCH A;  3LAK A;  4KFB A;  4FM1 A;  1A5X A;  3JSM A;  3K57 A;  2ZQB A;  3U3G A;  3ZSY A;  3JYT A;  1BHL A;  4M45 A;  2FBT A;  4Q5V A;  3S3M A;  4B9N A;  2W42 A;  2EHG A;  4FXD A;  3NDK A;  4CK2 A;  4DSE A;  4CJL A;  1L3V A;  4F2S A;  2VG6 A;  3CM6 A;  1TKZ A;  2IDO A;  3ZT4 A;  3K2P A;  5HRS A;  1RDB A;  2YNG A;  4OPK A;  4I9Q A;  1G15 A;  3C94 A;  4DSK A;  2YV0 X;  4GMJ B;  1UA0 A;  2F8S A;  3WNG A;  2OPP A;  4KRE A;  4KRF A;  4CEO A;  1TKT A;  1FK9 A;  4I9L A;  1XWL A;  3P83 D;  1BCM A;  1RT2 A;  1VSM A;  3A2F A;  3MEC A;  4CJK A;  1JLC A;  1JXE A;  3M8S A;  1N6Q A;  3CQ8 A;  3SI6 A;  2D5R A;  4Q0B A;  3ZSV A;  4IDK A;  1C0T A;  3IS9 A;  2JGU A;  4N76 A;  1S1W A;  1S6P A;  4FJJ A;  3HPO A;  1REV A;  3DRP A;  3TAM A;  3O3G A;  4CK3 A;  4YNQ A;  4ZTF A;  1ZBL A;  3ZSW A;  1L5U A;  4DS4 A;  2KFZ A;  2XY8 A;  1QS4 A;  1NK7 A;  1QTM A;  4B8A B;  1SL0 A;  4Z4I A;  2QKK A;  4IFY A;  2XY5 A;  4KO0 A;  1NK5 A;  1FKO A;  1BCO A;  2FBV A;  1GOA A;  2OZM A;  3L2V A;  4K8X A;  3HP6 A;  3AA4 A;  1JXB A;  3DYA A;  4CHZ A;  3PX0 A;  3HVR A;  3RR7 A;  4AHT A;  4E7K A;  1Z25 A;  1NK6 A;  2JLE A;  1SL2 A;  3IRX A;  2OPR A;  3SUP A;  4M3X A;  2WOM A;  5CZ1 A;  5CYM A;  3DOK A;  1YVU A;  4XIU A;  2HHU A;  1KLN A;  1Q9X A;  4AHU A;  4KHQ A;  3ISN C;  3WNF A;  1WSF A;  2PY5 A;  3SCX A;  1NJZ A;  3O4Q A;  1JLA A;  1S1T A;  2B4J A;  3ZCM A;  4F8R A;  4MQ3 A;  3HST B;  1RBU A;  5KRS A;  3OYE A;  2G8I A;  5C42 A;  2FBX A;  2GBZ A;  4CGI A;  3VQB A;  3VN5 A;  4DTN A;  4C8K A;  3T19 A;  4DU4 A;  2Y1I A;  3VA3 A;  3AVG A;  1LAV A;  1VRU A;  1EKE A;  3UIQ A;  4OPJ A;  1LWC A;  3QIN A;  4LH5 A;  1C1A A;  1KVA A;  2YNI A;  2D0C A;  4O0I A;  3PX4 A;  3SPY A;  4C8O A;  4DTO A;  1YTU A;  3THV A;  2QK9 A;  4Z4E A;  2O4I A;  1ZYQ A;  3V9S A;  4O4G A;  1IO2 A;  1HRH A;  4DQQ A;  4B3O A;  2PZS A;  1Z26 A;  3OS0 A;  4EZ9 A;  3MXI A;  3SQ2 A;  1L3S A;  4G1Q A;  4F3T A;  2Z1G A;  3K5O A;  4DTP A;  3EZ5 A;  3OYC A;  4J2D A;  4O55 A;  4KB0 A;  4CJQ A;  5D3G A;  2Z1I A;  4ID5 A;  4AHS A;  4HTU A;  1TVR A;  4W5T A;  3QEV A;  1U48 A;  1D9F A;  4B9S A;  1WAF A;  4I2Q A;  1VRT A;  4E7H A;  2G8U A;  4KHW A;  5C24 A;  2X74 A;  1RT4 A;  2DFE A;  2YHA A;  3L3U A;  1RIL A;  1L3U A;  4FYD A;  2HMI A;  3E01 A;  1S1V A;  4BE0 A;  1U04 A;  4OLA A;  3RRG A;  2HVI A;  1BQN A;  3TWH A;  4AHC A;  4FJH A;  2IOC A;  1RBT A;  3DLH A;  4KHN A;  3T3F A;  1JL1 A;  3C6U A;  4QAG A;  1D9D A;  1CLQ A;  4H8K A;  3MED A;  2E4L A;  2DY4 A;  1LAW A;  3D45 A;  5JS2 A;  3HPH A;  1JLQ A;  3QO9 A;  3HJF A;  4CF8 A;  2KFN A;  3OY9 A;  4IFV A;  1TL1 A;  4LSN A;  4B9T A;  2HND A;  4DQR A;  3K5N A;  1TL3 A;  3PX6 A;  3KD1 E;  4UQG A;  3SZ2 A;  1U47 A;  4Z4F A;  1JL2 A;  5CZ2 A;  3HYF A;  1VSJ A;  3CM5 A;  3KLH A;  1C1C A;  1KFS A;  1EX4 A;  4MFB A;  1T8E A;  4EZ6 A;  1VK0 A;  2XHB A;  4CFC A;  4OVL A;  1TGO A;  1D5A A;  3NF7 A;  3ASM A;  4CJU A;  3LZJ A;  2X78 A;  3V1R A;  1Q9Y A;  1RBS A;  1B9D A;  3O4N A;  4FZY A;  2HW3 A;  5HRP A;  3VQC A;  1TK5 A;  4CCH A;  5KRT A;  1YTA A;  3EYZ A;  1X9M A;  4CJV A;  3NH1 A;  3K5L A;  1ZBH A;  3NF9 A;  3T1A A;  2HHT A;  4DTM A;  4CEA A;  2OPQ A;  3QER A;  4F4K A;  3U6F A;  3TAF A;  1QSL A;  3QEI A;  1BGX T;  5HRN A;  1CXU A;  1GOC A;  1S1X A;  3HM9 A;  4CHP A;  4DTS A;  4FLZ A;  3QEP A;  3SQ1 A;  3QLH A;  3VQD A;  4YFU A;  4DSF A;  4J2E A;  4Z4G A;  4CER A;  4CK1 A;  4E3S A;  3PY8 A;  2BE2 A;  1RT1 A;  3IG1 A;  4BWM A;  3QNN A;  4BDP A;  3KKR A;  1VSH A;  5FRN A;  2WON A;  3HVT A;  5CY4 A;  4DLG A;  4CJ3 A;  4JRQ A;  4LH4 A;  2Y1J A;  3TAP A;  4DS5 A;  3ZSZ A;  3V9U A;  1CXQ A;  3LDS A;  4O44 A;  4DFK A;  1J5O A;  3AO1 A;  3KKS A;  3I0R A;  2P5G A;  4LY7 A;  2YNH A;  4DWI A;  2KTQ A;  1WSJ A;  1TKD A;  4KAZ A;  1SUQ A;  4W5O A;  1WLJ A;  3OYG A;  1RTD A;  3KTQ A;  1B9F A;  3NAE A;  4CIG A;  3C6T A;  3U3Y A;  1WAJ A;  4CIE A;  1VSE A;  2BAN A;  2YNF A;  2I5J A;  4AH9 A;  4CHO A;  4AHV A;  3HL8 A;  3DOL A;  3AVC A;  3L2W A;  3TR8 A;  1LWF A;  4PQU A;  1QQC A;  1RT3 A;  1BIU A;  1GOB A;  1SL1 A;  4ID1 A;  3KJV A;  1S1U A;  3KIO A;  3L2R A;  4DU3 A;  1KTQ A;  4FJ5 A;  3AVF A;  1A5W A;  4M3R A;  3KLG A;  5FRO A;  4H4M A;  4CEE A;  3DRS A;  5KI6 A;  2G8H A;  1XHX A;  4FLU A;  3VQ8 A;  3RTV A;  2YKM A;  4I7F A;  4RG8 A;  1KCF A;  1I39 A;  1VSI A;  4CEQ A;  3MEE A;  3VQP A;  4EP5 A;  1MU2 A;  1UAX A;  1KFD A;  2OPS A;  1CZB A;  3ZSR A;  3LPU A;  1Q8I A;  4E89 A;  1EP4 A;  2P1J A;  1WN7 A;  1U49 A;  4GW6 A;  4N56 A;  1ITG A;  4FJN A;  3MXM A;  1S5J A;  4CEF A;  4OGE A;  1TAQ A;  4CEB A;  2O4G A;  4L8R B;  4N41 A;  3CFR A;  4BDY A;  3ZSO A;  4FLW A;  4CJ5 A;  2BDP A;  3SUQ A;  4DSL A;  1T05 A;  1WSH A;  4DTR A;  4CJ4 A;  4H4O A;  3ALY A;  4LD0 A;  2KW4 A;  2LSN A;  3OS2 A;  3C95 A;  3OJU A;  3SPZ A;  1UWB A;  4M3U A;  1RTI A;  3PO4 A;  3SJJ A;  1KSP A;  4B9U A;  3BDP A;  2HHS A;  3PUF A;  3D0P A;  1HPZ A;  3L3V A;  3P5J A;  3QNO A;  1R0A A;  4CJS A;  3CYM A;  4BAC A;  4RW4 A;  3TAB A;  3RMC A;  1RTJ A;  1S9G A;  1UOC A;  1WNS A;  3QIP A;  3OYD A;  1NJW A;  2EX3 A;  4C8M A;  3KLF A;  2B6A A;  3LAM A;  5FDL A;  3P1G A;  4QCL A;  1VSD A;  2GV9 A;  3S3N A;  4B9M A;  3OYL A;  3MAQ A;  4HVJ A;  2F8T A;  1F21 A;  2ITG A;  4RW6 A;  1U45 A;  1D8Y A;  4DQI A;  4HHT A;  4FJG A;  1W0H A;  3TAR A;  1W9H A;  3K58 A;  4QOZ B;  4FJK A;  4CJP A;  2IGI A;  2OZS A;  3V1Q A;  1TAU A;  1RNH A;  1S6Q A;  3DI6 A;  4DG1 A;  3KLE A;  1C1B A;  2XO7 A;  3G10 A;  3NE6 A;  3V4I A;  1KRP A;  4FJ8 A;  1QE1 A;  4DTU A;  4C8L A;  4FK4 A;  4E1M A;  3OYJ A;  4BE2 A;  1S9E A;  1HQE A;  5I42 A;  4HUG A;  4CGD A;  4JS4 A;  3LWM A;  4M3Z A;  4OLB A;  1ASW A;  3DM2 A;  2OA8 A;  4ELT A;  2ETJ A;  4CGG A;  4IG3 A;  3M8Q A;  4CJE A;  4CGH A;  4FLX A;  3V9W A;  1ZBF A;  4FJM A;  4RW9 A;  4KHU A;  4E0D A;  3HP9 A;  2X6S A;  3DLE A;  3H08 A;  1KLM A;  3ULD A;  4OJR A;  3V9Z A;  1IKY A;  2DTU A;  4CF9 A;  2D0B A;  1ASU A;  2ZD1 A;  1K6Y A;  4BWJ A;  4Z0U A;  4CED A;  3SUN A;  4FM0 A;  3HXM A;  3V6D A;  1TK0 A;  1WSE A;  4KV8 A;  4RW7 A;  2G8V A;  3RWU A;  3VQ7 A;  1ZBI A;  5KGW A;  3ZT2 A;  1NOZ A;  3VQQ A;  4DF8 A;  4M3Y A;  4CIF A;  3AVL A;  3SV4 A;  2RPI A;  1HMV A;  1BI4 B;  2ATQ A;  4KHY A;  1HYS A;  2P51 A;  3KD5 E;  2B5J A;  3I0S A;  1IKX A;  1NKE A;  3G0Z A;  4CES A;  4NYF A;  3AV9 A;  1JLB A;  3K5M A;  3V9X A;  2AJQ A;  3VQA A;  4FJ7 A;  2FBY A;  3DMJ A;  1J9A A;  3NF8 A;  4GVM A;  1BQM A;  4E19 A;  4ZHR A;  3OYA A;  4B08 A;  3DLB A;  3MEG A;  3HPG A;  3KK1 A;  3TAN A;  2RN2 A;  3V1O A;  3TAQ A;  2HHV A;  4NCG A;  3FFI A;  3SQ0 A;  4KTW A;  2HVH A;  1KVC A;  5C25 A;  3OYI A;  1T7P A;  3LPT A;  3RR8 A;  5SZT A;  2KZM A;  2HNY A;  1QSY A;  1U4B A;  4OKK A;  1VSK A;  2G8W A;  3DLR A;  1IH7 A;  4RW8 A;  3ZT1 A;  3LAN A;  3NGI A;  5T7B A;  4HUF A;  3S9H A;  5HBM A;  4CF1 A;  4CHQ A;  3O3F A;  4CJR A;  4Z4H A;  3L2U A;  1LW0 A;  4CGF A;  4HCB A;  5JS1 A;  5K14 A;  3LZI A;  4N5S A;  1HJR A;  4W5Q A;  2PYL A;  1RT6 A;  3B6O A;  2GUI A;  5DK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...