1ASVA

Avian sarcoma virus integrase catalytic core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of the catalytic domain of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Dna integration
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
total genus 49
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1asvA00
3NF8A 1JLCA 4E3SA 4DQRA 4CJEA 1XC9A 1IKXA 4C8OA 4IFVA 4CJFA 1LWFA 4FW2A 3L2UA 3DLRA 3I0SA 3DYAA 5KRTA 4Z4EA 2HHXA 1VSDA 3DRPA 4JRPA 4CJPA 4KAZA 3WNGA 1S9EA 3VQPA 5FDLA 3D0PA 4KB0A 1MU2A 4CEEA 4CEZA 2OZSA 3AVKA 3LP1A 1IKYA 4M41A 3S3NA 3PO5A 4FJXA 1JXBA 4BE2A 4IFYA 3NH0A 1RT1A 5J1EA 3KK3A 4I9QA 4CJ4A 4B8AB 4CHPA 4FLXA 4CIGA 4NCGA 4OVLA 3DLHA 3PX0A 4LY7A 3M8PA 4ZHRA 1Z26A 3RMBA 3EYZA 1KVAA 2FBVA 3ZSYA 2YHAA 3SV3A 4KHQA 4O5BA 1W9HA 4HCBA 3KKSA 4ID1A 3ASMA 1RTJA 3NAEA 3QESA 2OPRA 3AO3A 3THVA 2HMIA 3DMJA 1S1VA 3C94A 3PY8A 4FZXC 2F8TA 2KFZA 4CK1A 2BGGA 3K5MA 3K58A 2XY5A 4PA1A 4F3OA 3NF9A 3MEGA 2HHSA 1NJZA 3TI0A 4N76A 4CF0A 4KHSA 3UIQA 1ASVA 3ZT3A 1N6QA 2HVHA 1VSIA 2RKIA 4W5OA 3RMAA 1R0AA 4KI6A 4DTOA 1KFDA 4B08A 1K6YA 3KK1A 5J2QA 4B9SA 3PX6A 3V6DA 4CJUA 3AO1A 4CIFA 4O4GA 3RTVA 2P5OA 4J2EA 4EP4A 5SZTA 3TAGA 3L2WA 4CHNA 1L3TA 3KD1E 1NK9A 3AA3A 3VQEA 4DQQA 3S9HA 1D9DA 4CGJA 4E0DA 3O3FA 2W42A 4OLBA 3O4NA 4W5TA 1KRPA 4H8KA 3HP6A 4KPYA 3CFRA 2G8WA 5HRNA 1I3AA 3RR8A 4IKFA 3CFPA 2EHGA 2KFNA 3V81A 3HO1A 4DTRA 3O3HA 3VQQA 4CGHA 2KZMA 2VG5A 3MAQA 1N5YA 2FBXA 3C6TA 3C95A 4E1NA 3TARA 3M8RA 4OGCA 3VQ5A 1TL1A 3OYMA 3F73A 3LWMA 3KIOA 3L2RA 3SNNA 4B9TA 4JS4A 4JLHA 3DLEA 1TGOA 1VSMA 2B5JA 2GUIA 4QAGA 1Q9XA 4F3TA 1XHZA 1TV6A 2ITGA 1T05A 1UA0A 3QO9A 4FCYA 1U47A 3DOKA 3LAKA 3CQ8A 2BDPA 4FLWA 1LAVA 1ZBLA 4ICLA 2IDOA 1RCHA 4E7KA 2YNIA 2ZD1A 2PYJA 1S6QA 5KI6A 4NYFA 2YV0X 4CK3A 3HVRA 1IKVA 2R7YA 4DLEA 3OY9A 3NCIA 1DTQA 5J2MA 2HHWA 4BWJA 3QERA 4HCCA 3DLGA 3JSMA 3NDKA 1NJWA 1LW0A 3QNOA 3QEXA 3LZIA 5CYQA 3ZSZA 3AA4A 3DOLA 1RBVA 3MXJA 3WNHA 3O4QA 3P5JA 4OPKA 4HTUA 4KFBA 3TR8A 2D0AA 3A2FA 3OS0A 5FROA 3SCXA 4HUGA 3NBPA 4OKKA 2JGUA 4LSNA 4CESA 4DTNA 3TANA 3SQ0A 2P51A 2HNDA 4C8KA 2QXFA 1EX4A 3QIOA 3RR7A 1J54A 4W5NA 2GBZA 1RILA 3LALA 4Z0UA 2KQ2A 3K2PA 1XI1A 3ALYA 3NH2A 1D9FA 2XRIA 4CGGA 2G8KA 1LW2A 1RT6A 1IKWA 3LAMA 2X6NA 3AVFA 2ZE2A 4N5SA 1JL1A 5HLFA 3PUFA 4CIEA 1TK5A 3BDPA 4CF2A 5KGWA 4F2SA 1YT3A 3OYAA 4YFUA 3TABA 2HHQA 3E01A 4RW4A 5CY4A 3OYCA 3WNFA 2XY6A 4LH4A 5KRSA 1WAFA 1SL2A 3OYBA 3KLFA 3ZSRA 5HP1A 1WSHA 1S5JA 1S1XA 3AO2A 2IS3A 3RMCA 2QKBA 3D45A 2Q3SA 5DMRA 3LDSA 3NE6A 3DRRA 3KK2A 2HNZA 2VWJA 1NK4A 2GV9A 4BDYA 4NCBA 2DTUA 4DSIA 1TKXA 1RBTA 3V9WA 2VG7A 3V9UA 1QSSA 3EZ5A 4LSLA 3QNNA 4KHWA 1JL2A 4GW6A 2YNFA 4Q5VA 1VSKA 3VN5A 4FJ5A 4ID5A 1U04A 1BI4A 3NH1A 1TAUA 4CJKA 1BISA 3TWHA 4IBNA 5SWMA 3K5OA 4KKOA 3L3VA 3SZ2A 4XIUA 4GMJB 3AVBA 5J2PA 4DSKA 1XHXA 1NK5A 4PWDA 1WSEA 1IO2A 3K5LA 1X9WA 2G8IA 2OPPA 1KCFA 2B4JA 1BIUA 3KJVA 4DQSA 2FBTA 1A5VA 2XO7A 3KLEA 3V4IA 2YNGA 1VSLA 3VA0A 3VQ9A 4M3UA 1BCMA 1HPZA 3IS9A 1B9DA 3KTQA 1RT7A 1VRTA 1RT4A 2QKKA 3OVNA 1RT3A 4KTWA 4PUOA 4ELUA 4AH9A 4E7LA 4C8MA 3P83D 4AILC 4DF4A 1WLJA 4W5RA 4AHUA 1UOCA 2D0CA 1U45A 4CJQA 2DFHA 3HP9A 4FJ9A 1S1TA 4FLYA 1NK8A 1DTTA 3K57A 3EY1A 4Z4FA 4FW1A 4DSLA 3LP0A 4I9LA 4BWMA 1U48A 4CF8A 2IGIA 1UWBA 4W5QA 4FJMA 4E19A 1CZBA 4CHZA 3HPHA 3AVAA 1HQUA 3ITHA 1BIZA 1BHLA 3HM9A 5C25A 3IG1A 3V9ZA 1RBRA 4CGFA 4H4MA 3G10A 1QSYA 1SUQA 1CZ9A 1KVCA 4Y1CA 2D5RA 4CJVA 5I42A 2HVIA 1ZBFA 4J2BA 3L3UA 1C0TA 1YVUA 4N56A 2HHUA 4DSJA 4CHOA 1NJYA 2LSNA 1JLAA 4O0JA 2ATQA 2KZZA 4I2QA 3B6PA 4KV8A 3V1RA 3B6OA 4M42A 3NFAA 4BDZA 3U3GA 2Z1GA 3ZT0A 5DK5A 1ZBHA 4KHYA 2PZSA 1C6VA 3AVLA 1QHTA 1JLEA 4DS5A 3T3FA 3OYNA 3TAMA 1SKSA 3M8QA 1HYZA 4ZTFA 2A1SA 3VQCA 1GOAA 1SKRA 3LZJA 4YNQA 1X1PA 1C0UA 4ZTJA 3G0ZA 4CK2A 4FVMA 1FKOA 1BL3A 2OPSA 4J2DA 3SI6A 3NGYA 4O0IA 1REVA 3QEPA 2E4LA 2Z1IA 3F9KA 4R5PA 4OPJA 2KW4A 3DI6A 3OS2A 4DF8A 1QTMA 1EKEA 1JLFA 1ZBIA 1RDBA 3LPUA 1S1UA 1TVRA 4DMNA 1RTDA 1S6PA 4FK4A 2O4IA 3BGRA 1VSEA 1IG9A 3ISNC 1S1WA 1NOYA 2XY7A 1RBSA 1KVBA 4KTQA 5J2NA 4KI4A 1T8EA 3RMDA 3KLIA 1TAQA 4AHRA 3TAPA 4IG3A 4NCAA 1L5UA 1RBUA 4FLTA 1S9GA 4DG1A 2AJQA 2IC3A 3CG7A 2A1RA 4CEFA 1L3UA 4CGIA 3L8BA 1RDCA 2OZMA 4HVJA 4B9MA 4F2RA 4M3TA 3DRSA 4HUFA 1T7PA 4FXDA 4CJWA 5HRPA 1Q8IA 4BE1A 3VQ6A 4DTMA 2KTQA 3HPOA 3OYDA 3RWUA 4DSFA 3HPGA 4M3RA 4CFAA 4FM1A 1VSFA 1CXQA 1NKCA 5JS2A 3V9XA 1NKEA 4FZZA 3HYFA 2Z1JA 3JYTA 3VQ8A 4AHVA 1C1AA 4LH5A 1ASWA 5HRSA 1D8YA 1X9SA 4Q0BA 1BGXT 1O1WA 2D0BA 4Y1DA 3HT3A 4DTSA 4FJNA 4N41A 3OS1A 4CEBA 4H4OA 3AVMA 4BE0A 3ZSXA 4C8LA 3L2QA 1KLMA 3ZT4A 4DLGA 3T1AA 4G1QA 4DFMA 4FLZA 3CYMA 1RNHA 2PYLA 2WONA 4CEDA 4E7JA 4B3OA 2O4GA 1NOZA 1GOBA 4FJGA 4FK0A 1FKPA 1JLQA 3NF7A 3U6FA 2Y1IA 3SUOA 4KTZA 3NGZA 1LV5A 1Z25A 3S3MA 3RRHA 4CGDA 2OA8A 1SKWA 2XHBA 4DFJA 2XY8A 1J53A 3AO4A 2BE2A 1C1BA 1WAJA 1HYVA 1EXQA 3ZSOA 3OJSA 5HROA 4AHCA 4DU3A 2HHTA 1CXUA 3QIPA 4CF9A 3SPYA 1HQEA 3OYIA 4CHYA 5EU7A 4I2PA 1D5AA 3AA5X 1VRUA 4OKJA 4EP5A 3HVTA 3AVCA 3VQ4A 2HW3A 4DTUA 2P5GA 4KHUA 4RW8A 4CCHA 2OYQA 3CM5A 2WOMA 1RTHA 3LP3A 4FJ8A 2F8SA 1VSJA 1TK0A 4CFDA 4B9NA 3MECA 4O44A 4FJLA 3AVNA 4GVMA 2E6MA 2E6LA 4E1MA 1NJXA 3AVHA 1GOCA 4CJTA 2OPQA 3IRXA 3HSTB 1RT2A 2P1JA 3OJUA 3OYGA 4FK2A 3H08A 2G8HA 4FJKA 4M3YA 3U3YA 3V1QA 4CF1A 1RDAA 4IDKA 3KLHA 1UAXA 4I7FA 3HK2A 4FJ7A 4CFCA 5FRMA 4FYDA 3OYLA 3QINA 3QLHA 5D3GA 3DLBA 2YNHA 1TKDA 3L2VA 1U4BA 1VSHA 4AHTA 3OYJA 5HRRA 1TKZA 4O55A 1QS4A 3SQ1A 4EZ6A 3SJJA 2I5JA 1RDDA 4WE1A 3AVJA 3NF6A 2RN2A 4CEAA 2X6SA 4KB1A 4M3ZA 3TAQA 1BI4B 1BQNA 5I3UA 1A5XA 1L3SA 1ASUA 1A5WA 5E41A 3ZSQA 1HNVA 3RRGA 2HB5A 3LWLA 4FM2A 3LP2A 4ELVA 4N47A 4CEQA 4CJ3A 3KD5E 1JLGA 1WSGA 4K8XA 1Q9YA 1EETA 5C42A 4E7HA 2QK9A 2VWKA 3I8DA 3P1GA 5KTQA 3AO5A 3SPZA 2ETJA 1B9FA 3SUNA 2Z1HA 5CZ2A 4CERA 4CJRA 3V9SA 4L8RB 1JLBA 1G15A 1IH7A 3HL8A 4IG0A 3AV9A 4B9VA 1YTAA 2X78A 1QE1A 4M3WA 1HMVA 4MFBA 4CECA 3NHGA 3ZT1A 3MXMA 4PY5A 3LANA 2DFEA 3M8SA 1T03A 1KLNA 4QCLA 4KO0A 3QETA 4FJHA 3ULDA 4RW7A 4CE9A 3V1OA 4CJSA 3K5NA 1RT5A 3MEDA 1JXEA 3DLKA 3ZSWA 5C24A 3OYHA 5CZ1A 2YKNA 3C6UA 3MXIA 1SL1A 3NGIA 1ZBUA 3MEEA 1TK8A 4ELTA 1BCOA 4Z4HA 4UQGA 3KLGA 4LD0A 1FXXA 2YKMA 2DFFA 1ZYQA 1NK7A 3PO4A 3SYZA 3CM6A 3VQBA 1BQMA 2B6AA 1J5OA 4K8ZA 1C1CA 5HBMA 1HJRA 1QQCA 4DTPA 1LAWA 4CJLA 4DFKA 1WNSA 3CFOA 2G8VA 1CLQA 1HYSA 2HHVA 3TAEA 4B8CA 4KREA 2FBYA 2HNYA 1HNIA 3ZCMA 1NKBA 3VQDA 1KSPA 4HUEA 2NUBA 3ZT2A 3K59A 2IOCA 1C0MA 4FLVA 3VQ7A 2RF2A 4TSXA 4CJ5A 4OGEA 1JKHA 1SL0A 3TAFA 4KHNA 1Y97A 4Z4GA 5JS1A 1F21A 3HXMA 1SV5A 2BANA 2JLEA 3PX4A 4MQ3A 4OJRA 1KFSA 4AHSA 4EZ9A 4DWIA 1HRHA 3QEVA 1RTIA 5FRNA 4OLAA 4FJIA 3KKRA 1DLOA 2ZQBA 3T19A 4BDPA 3HJFA 4F8RA 3AA2A 4DSEA 4FLUA 1X9MA 2FC0A 3OYKA 4Z4IA 4BACA 3DM2A 4M3XA 4RG8A 2YHBA 5T7BA 1WN7A 1WSFA 2G8FA 4FZYA 1I39A 1J9AA 2VG6A 3SQ2A 4FJJA 2G8UA 3LPTA 3SUPA 3S3OA 4J2AA 1LWEA 5CYMA 3OYEA 3SV4A 3VQAA 4M45A 4DU1A 1KTQA 1WSIA 3OYFA 4OKEA 4CFBA 2Y1JA 4B9LA 3WNEA 4C8NA 1TL3A 2X74A 4Z4CA 4DTXA 1TKTA 4DQIA 4DS4A 4KRFA 1XWLA 1VK0A 4NYNA 4E89A 2DY4A 1ITGA 3QEWA 3QEIA 5K14A 4JRQA 3O3GA 3SUQA 1NK6A 3FFIA 3AVIA 1FK9A 2IAJA 3ZSVA 2PY5A 3IAYA 1EP4A 4RW6A 4PQUA 4E7IA 1NK0A 4DFPA 4DTJA 3I0RA 1U49A 4DQPA 1W0HA 4DU4A 3VA3A 3PV8A 1QSLA 4RW9A 1YTUA 1B92A 3AVGA 2F96A 1L3VA 5KGXA 4CEOA 4JS5A 4CHQA 4HHTA 4F4KA 1LWCA 2EX3A 4FM0A 4B9UA 3SQ4A 4QOZB 2RPIA 1WSJA 1UA1A
chains in the Genus database with same CATH superfamily
4MLHA 1SS6A 1NLVA 4C8OA 4FW2A 1W7AA 3DLRA 4BR9A 2BH1A 1Q82O 4BC3A 4KB0A 2ZWHA 5FDLA 4CEZA 2FSNA 4MO5A 3CCJN 5AQVA 3S3NA 3ULEA 1JXBA 1QQNA 4XEIA 2Q97A 5J1EA 3FFKB 1E4GT 1XMOK 3DLHA 3CJ1A 3M8PA 1Z26A 3RMBA 1VQ7N 3MCPA 3EYZA 5AQNA 3MMVA 2YHAA 4YDUC 4GV6A 2E2OA 3N4PA 4ID1A 3ATVA 3PY8A 3DMJA 1D4XA 5GAHP 4JI8K 2BGGA 4DR1K 3MEGA 3J80O 4DR7K 4KHSA 1IG8A 1ASVA 5E84A 4QS8A 3ZT3A 3UIQA 4W5OA 2A3ZA 1YIJN 1MA9B 3QBXA 4B9SA 4BRHA 4IOAL 3AO1A 4O4GA 2P9SB 3HM8A 5SZTA 2IVNA 4HTLA 3KD1E 1NK9A 5KQ8A 3VQEA 4OLBA 3GE1A 5H1SQ 3HP6A 3F9MA 2FSJA 4KPYA 5HRNA 4CZFA 2KFNA 5LY3A 3MAQA 3TARA 3VQ5A 3F73A 2E1ZA 3L2RA 1GLFO 4B9TA 3L6QA 1J6ZA 1TGOA 1VSMA 1XHZA 1GLCG 3LAKA 3CQ8A 4FLWA 4BGAA 4ICLA 3CCSN 1RCHA 3VEXA 3CQXA 2P9SA 1S6QA 4CK3A 3HVRA 3NCIA 3UKRB 2HHWA 3CC7N 3C7NA 3P4IA 3WUHA 3LZIA 4HTUA 3WNHA 1OVQA 2BTFA 3DXKA 3TR8A 4A57A 4HUGA 5M1PA 3NMUA 4DTNA 2P51A 5KPTA 4GY2B 3QIOA 3RR7A 1J54A 2GBZA 3LALA 1D9FA 3ENHA 2XRIA 5AQMA 2G8KA 1Q18A 4N5SA 1JL1A 1TK5A 4YORA 4H5TA 3T1HK 3OYAA 1MWMA 4IZ9A 3F5TA 3EKUA 3HOSA 3MCAB 2QI2A 3NE6A 3DRRA 3KK2A 1NK4A 4NCBA 4DSIA 2HOEA 1BO5O 4LSLA 3QNNA 3VN5A 4FJ5A 3LM2A 4GVEA 4KKOA 3K5OA 4EZ9A 3J8AA 2CGKA 1M90O 1Y64A 1NK5A 4DSKA 3M3ZA 1WSEA 3J7ZO 1IO2A 1IV0A 2OPPA 3D6RA 1OH7A 2B4JA 2IIRA 1BIUA 5M1KA 2D0OA 2XO7A 1Q7YO 3H46O 1BCMA 3SAHA 2OCEA 1RT3A 2P9IB 1TYQB 3P39A 4DF4A 3P83D 5F0XA 4AILC 3W3DA 4GKKK 1WLJA 4W5RA 3QMLA 4FLYA 1NK8A 4YOYA 3LP0A 3MN7A 2HF3A 3O4WA 4I9LA 1UWBA 1WB9A 4FJMA 4CHZA 4BRQA 1VQ8N 1TUUA 3IG1A 3G10A 1SUQA 2I7NA 5AZIA 5I42A 1ZBFA 5AQZA 2A42A 3L3UA 4AF1A 4N56A 3C6AA 3B6PA 3NFAA 4BDZA 3WXIA 5DK5A 3UE5A 3WQTA 4MO4A 2PZSA 3KK7A 3HRGA 4ILJA 5TKWA 1JLEA 3TAMA 3U9ZA 1HYZA 5AQSA 2A1SA 3HSCA 1W97L 1MDUB 4FVMA 4J2DA 3NGYA 4O0IA 3QEPA 2E4LA 2QWNA 2Z1IA 4A62A 4OX9K 3F9KA 2KW4A 3DI6A 1EKEA 5CHIA 2W6KA 4DMNA 4FK4A 1S1WA 1V4TA 1RBSA 4KI4A 1T8EA 3RMDA 1TAQA 4GKJK 5CR4A 4IG3A 4CJ7A 2OTLN 3EE9A 4FLTA 3VEZA 1HPMA 3PLAA 2AJQA 2A1RA 1CZAN 4ISGA 1T7PA 2WFBA 2JWLA 3R9PA 3OYDA 3BP8A 3RWUA 3HPGA 4YDUA 4M3RA 5FPMA 1CXQA 1NKCA 3BEXA 4BRAA 3V9XA 4FZZA 3HYFA 2Z1JA 4BRLA 4M7XA 5ADXH 1X9SA 3D7EO 4Y1DA 4M63C 4DV5K 5AFUA 5KPRA 3SBTA 3ZSXA 1T6DA 1R59O 3WXMB 4FLZA 1GOBA 4FJGA 1FKPA 1JLQA 3SUOA 1XQSC 3ENOA 4KTZA 2RE2A 3NGZA 3CXCM 3S3MA 4BY9C 1S3XA 4WFBL 4CGDA 3K9KA 4B1UB 2O8CA 3DWLA 3ZSOA 3CJ9A 2HHTA 1CXUA 3QIPA 5EU7A 1D5AA 3AA5X 1VRUA 4EP5A 4H5WA 5C2FA 3A5MC 3AVCA 4FJ8A 1RTHA 2VYPA 4CBUA 1VSJA 4RTFD 1XUPO 1ZC6A 4B9NA 3ZX0A 1QVGM 4E1MA 1NJXA 3U8XA 3UKUB 1RT2A 1YUWA 3OJUA 3QBWA 2GTDA 4IJNA 4IDKA 4JI0K 5D3GA 3FZLA 4LF5K 5AQHA 4XH1A 2E5LK 5FPDA 5AQKA 3GBTA 1TKZA 3SQ1A 1QS4A 3SJJA 2RN2A 4CEAA 4CZKA 1L3SA 3RRGA 4I6MB 4N47A 3U9DA 3FZMA 1EQYA 4K8XA 1N34K 1EETA 4EAHD 2Z1HA 4L8RB 1JLBA 1G15A 4BRCA 1HKCA 1YTAA 2X78A 3EEQA 4PY5A 4MFBA 4CECA 3I8BA 3LANA 2DFEA 5EY4A 3M8SA 4FJHA 4CJSA 1RT5A 5EOYA 5CZ1A 2YKNA 2BUPA 3VEYA 3MEEA 1TK8A 5E26A 1BCOA 5HL7L 3KLGA 1ZYQA 3PO4A 1NK7A 2FXUA 2ZM6K 3VQBA 2B6AA 3Q7BA 5LL6Z 4CJLA 4B3RK 3CFOA 4H5VA 2G8VA 1CLQA 4B8CA 1NKBA 1KSPA 3K59A 2IOCA 2RF2A 4CJ5A 4TSXA 1QZ6A 4MLEA 3TAFA 4KHNA 1Y97A 3HXMA 2NRHA 3SBGA 2NRRA 4EIAA 4AHSA 3VGKA 2CH6A 3E66A 3KKRA 1P8ZA 1DLOA 3T19A 3UB5A 4BDPA 1X9MA 3KZBA 3DM2A 2QWOA 1DEJA 1WSFA 2NRVA 3BZKA 5MLCQ 5C10A 1T3VA 1EWQA 4NB4A 4KRFA 1OH8A 1TKTA 3DAWA 3TSUA 5K14A 4F9OA 4JRQA 3SUQA 4FO0A 2IAJA 4NLBA 3TTCA 2D0PA 4ISEA 3G4SN 4NXNK 4CD3A 4F4KA 2WC9A 1JCGA 1H1VA 4FM0A 2O8CB 4QOZB 3IDHA 1WSJA 1U2VA 4AM6A 3NF8A 5BPLA 4IFVA 3L2UA 2V51B 3DYAA 3DRPA 2WTUA 3WNGA 3D0PA 4KAZA 5JLFA 1YJ9N 1KAZA 3MN5A 2OZSA 3WXLA 4FJXA 2YHYA 3KK3A 4B8AB 4CHPA 3T69A 4C1NI 4ZHRA 3PX0A 4JKAA 3C6HA 1KVAA 3C7NB 3SV3A 4JAXA 1M1KO 2FSKA 4HCBA 4K43A 1NM1A 1NNEA 3QESA 3THYA 3WEEB 2F8TA 1HJOA 4CK1A 3VEWA 5BN9A 3K5MA 3EZWA 3SLCA 1NGBA 4F3OA 3TI0A 4CF0A 4ILHA 4IO9L 1N6QA 2RKIA 1K8KA 4KI6A 3VEOA 1KFDA 1K6YA 3EN9A 1XNRK 3RTVA 2HBLA 3AA3A 3CCEN 2VGNA 3WT0A 1KRPA 4DR3K 1T44A 5DM6L 4FWRA 1U2VB 3CFRA 3RR8A 4IKFA 3CFPA 1NGDA 4LC9B 4CGHA 1I94K 2P9UB 2FBXA 3C6TA 4OGCA 4A61A 2V7YA 1TL1A 5EXWA 3SMPA 3WXJA 4JS4A 3IUCA 4JLHA 1Q9XA 4QAGA 1TV6A 2ITGA 4JN4A 3QO9A 1U47A 3DOKA 1LAVA 3E9PA 4E7KA 3I55N 4DB3A 2ZD1A 2YV0X 5J2MA 5EVZA 1HKBA 3JSMA 4DUYK 5AQWA 3QEXA 5CYQA 4OPKA 2VWBA 5FROA 5AQUA 3AAPA 3SCXA 2FLOA 3NBPA 1K9MO 1IBKK 1EWRA 5AFUH 5GADP 3TANA 3SQ0A 5ADXA 2HNDA 1VAZA 4C8KA 4JKBA 1RILA 4Z0UA 1XI1A 2P9UA 3ALYA 3NH2A 5ELZA 4CGGA 2W40A 1LW2A 4BG8A 5HLFA 1BA1A 4ILGB 1HR0K 4FVUA 4F2SA 4CZEA 5CY4A 3NVKA 3OYCA 5KRSA 5HP1A 3GOIA 3D45A 2Q3SA 3RSEB 3LDSA 2HNZA 3H3NO 2VWJA 4DR4K 4WQ5C 2GV9A 4BDYA 2GELA 3V9UA 1QSSA 3ENBA 4YHHK 3VEVA 1JL2A 4IOCL 2YNFA 3PIOL 1VSKA 4ID5A 1BISA 3MN6A 4IBNA 3TWHA 3SZ2A 2WUSA 3S41A 1XHXA 1X9WA 3K5LA 2QWPA 4H03B 1KQSM 1A5VA 3KLEA 3J81O 3SJHA 1VSLA 5AQXA 2P9LA 3OVNA 4GV3A 4DHYA 4X62K 4KTWA 1YITN 2E2QA 4E7LA 4MDBA 2VQFK 1UOCA 2DFHA 3HP9A 4FJ9A 4FWNA 1X3NA 3AY9A 3VF4A 3K57A 4DSLA 4CF8A 2IGIA 3K9JA 3LM9A 5AQOA 1CZBA 1HQUA 3AVAA 1OKJA 1BIZA 3M6GA 3HM9A 1YAGA 5C25A 4A2BA 3L4QA 2CH5A 1CZ9A 1KVCA 4CJVA 3OBYA 4FWSA 4J2BA 1XNQK 1C0TA 1YVUA 2LSNA 4O0JA 2ATQA 4I2QA 4KV8A 4M42A 1NGJA 3U3GA 4JK8A 4WQ4A 4O8UA 1C6VA 1TYQA 4JHDB 4BRKA 2E88A 1JCFA 4DS5A 5C15A 4ZTFA 1SZ2A 4YNQA 4HWIA 4FSVA 3TSQA 1P90A 4PKHA 4R5PA 4OPJA 3OS2A 4U7BA 1ZBIA 3ZEUA 1HKGA 4CD1A 2F7TA 1S6PA 3PIPL 1IG9A 4UY8O 1NOYA 2XY7A 5J2NA 3KLIA 4AHRA 3TAPA 4A5AA 1L5UA 3CF5L 5LMUK 4DG1A 4EHTA 2KKZA 1RDCA 2OZMA 3DRSA 3KHYA 4FXDA 4BE1A 2KTQA 3HPOA 4KHPK 1DGKN 3O9SA 1VSFA 1Q81O 1HNXK 3DXMA 4JHDA 3OTOK 3FR0A 2D1KA 1D8YA 1O1WA 2D0BA 4DTSA 4H4OA 3AVMA 3LL3A 3CCQN 2ASMA 1GLEG 2QW9A 4WQ4C 3TU5A 2PYLA 2WONA 4J8FA 4BRDA 4CEDA 2UXDK 3VERA 4FK0A 1LV5A 3RRHA 3OA9A 2XY8A 1J53A 3MN9A 1WAJA 1HYVA 1N36K 5HROA 5M1QA 1HX1A 4CF9A 2EWSA 3T7ZA 1HQEA 3E9LA 3SPYA 4KH5A 1YHQN 3CD6N 2P5GA 4RW8A 4CCHA 3CM5A 2WOMA 1ATSA 2RHKA 1TK0A 4FJLA 2O8DA 3AVNA 4KHQA 2E6MA 4QCLA 1Z6RA 1GOCA 4CJTA 3IRXA 4BR5A 4LF6K 4I7FA 1YJWN 4NO7A 2UUAK 4FJ7A 2KLAA 3O08A 1KAXA 5LMNK 4JKGA 4IEIA 3W0LA 4B1YB 1LCUA 1VSHA 3OYJA 2PFUA 2V7ZA 2I5JA 4WE1A 3NF6A 2HF4A 4KB1A 1W2BM 2A41A 1BI4B 5I3UA 1ASUA 2Q0UA 2HB5A 1BWFO 1S22A 5A2QO 2UXBK 2YI1A 3FGUA 4E7HA 2QK9A 3THWB 2O8FA 3SPZA 1B9FA 5CZ2A 3V9SA 3QB0A 1IH7A 2PBDA 3AV9A 4BRMA 5AR0A 3NHGA 3ZT1A 1KLNA 4QS9A 3QETA 2JWKA 3ZSWA 1NJIO 5C24A 3HZ6A 3MXIA 1SL1A 2GWKA 1VQKN 3O80A 4UQGA 4LD0A 2DFFA 1RGIA 4BRFA 3SYZA 1BQMA 4CVNE 3CMEN 5IWAK 1C1CA 2NRXA 3FZHA 5HBMA 4DFKA 2HHVA 1XC3A 3CJAA 2O8EB 3MX5A 3ZCMA 5M1FA 5FPEA 1DT9A 4FLVA 1SL0A 5GAEP 4Z4GA 1ZBSA 2BANA 2JLEA 4BGBA 4O8KA 5FRNA 1HRHA 1RTIA 4IOXA 3AA2A 4DSEA 4FLUA 4BACA 1GLDG 2YHBA 4RG8A 4K42A 4H0XB 1WN7A 2G8FA 2KHOA 1I39A 3SQ2A 4PKGA 1GLBG 1RDWX 2G8UA 2NLXA 3SUPA 4JI5K 2ZGZA 3SV4A 3VQAA 4M45A 2NRZA 4DU1A 1KTQA 3OYFA 2Y1JA 3P31A 1TL3A 3G6EN 3VPZA 2DY4A 1N32K 3O3GA 2PY5A 1FK9A 1HUXA 4DKWA 5HOOA 3THYB 1NK0A 4DTJA 3I0RA 2HSTA 3PV8A 1QSLA 2F96A 4WFAL 4JI1K 2P9KA 4JS5A 4CEOA 4CHQA 4B9UA 3SQ4A 4XH4A 1JLCA 3THXB 4L3QA 2ZGYA 5M1OA 4DQRA 1XC9A 1IKXA 4DV1K 4CJFA 1LWFA 3I0SA 5KRTA 4Z4EA 2J4RA 1VSDA 2ZJPL 4H0OA 1NWKA 4CJPA 1S9EA 1NGIA 4CEEA 2P9LB 2ZJQL 1EO1A 1IKYA 4M41A 3PO5A 5GIPA 2A5XA 4IFYA 1RT1A 4DV4K 4BR2A 2O8BB 4NCGA 4OVLA 4Y0WA 3ZSYA 4O5BA 1BDGA 5BPMA 3KKSA 2OPRA 3AO3A 4CZJA 1S1VA 3C94A 3CMAN 3K58A 5JVGL 5B8HA 1ILYA 3NF9A 1NJZA 1BG3A 4N76A 3OW2M 4U67L 2YJFA 2HVHA 1NBWA 3H45C 4B08A 4JKFA 4H5RA 3V6DA 4J2EA 3AGRA 4EP4A 3O1WA 3L2WA 3D2EA 2F4VK 4CHNA 1L3TA 3T1YK 3S9HA 1D9DA 4CGJA 2W42A 3BF3A 1I3AA 2EHGA 5BRFA 3O3HA 1KAYA 3VQQA 2VG5A 5JVHL 3C95A 4E1NA 3M8RA 1IBLK 3LWMA 2FF6A 4B1ZA 3KIOA 3H1VX 3VGMA 4DR2K 2H3GX 2B5JA 2GUIA 4F3TA 1BUPA 4CI6A 1VQPN 1UA0A 3ZEUB 1BU6O 4FCYA 1ZBLA 3E1YA 1WBBA 4YOTA 2YNIA 2PYJA 5KI6A 3VA3A 4PHTX 4FWMA 4CZGA 3CC2N 4NLCA 4HCCA 3DLGA 4BR4A 4CBXA 5JICA 3GG4A 1NJWA 1LW0A 3QNOA 5KQDA 4JI7K 1KXPA 4LF8K 3ZSZA 3DOLA 1RBVA 1E4FT 3O4QA 3F2KA 2HBKA 4CZMA 5AQIA 1WUAA 3OS0A 1VHXA 4OKKA 3QDKA 4LSNA 4CESA 2E8AA 5DM7L 2CGLA 4A2AA 4W5NA 1KD1O 5GINA 3NVMA 3L0QA 1RT6A 3LAMA 2X6NA 2ZE2A 3PUFA 3CC4N 1QHAA 4IO8A 3BDPA 3A5OC 3R8EA 1VQON 1YT3A 3UKRA 3TABA 4RW4A 4LH4A 1SL2A 1WAFA 3ZSRA 1WSHA 2QKBA 1S1XA 3AO2A 2IS3A 3MDQA 3CCUN 2UXCK 5DMRA 4WCEL 1QQMA 4WQ5A 2DTUA 1TKXA 4YOWA 2VG7A 2V52B 4JI6K 4IDHA 4Q5VA 3SK3A 1VQ9N 4BR7A 1BI4A 1TAUA 5SWMA 3L3VA 2P9PA 4XIUA 4GMJB 2ZJRL 5J2PA 4B3TK 2YHWA 5AZIB 2O8DB 2G8IA 1T6CA 4WYBA 1YXQA 2NRWA 2YNGA 2W41A 3C65A 1HPZA 1B9DA 1RT7A 1VRTA 1RT4A 2HMPA 1Q86O 2YJEA 4FWPA 4C8MA 3ZX2A 3O9TA 3CPEA 4AHUA 2D0CA 3R6MA 1U45A 3O9RA 3O9UA 4BWMA 3KWIA 4W5QA 4E19A 5BREA 4G9ZA 3HPHA 3ITHA 1BHLA 2DPNA 3V9ZA 1RBRA 4CGFA 4H4MA 1QSYA 3CETA 4Y1CA 2HVIA 5JMVA 3H1QA 4JI3K 4DSJA 4CHOA 1NJYA 2F9WA 4LFCK 2KZZA 3V1RA 3B6OA 3ID6A 3VF2A 3AARA 1ZBHA 2GEMA 3CI5A 1FW6A 3O6WA 3AVLA 2Q31A 1NGCA 4FWLA 3CERA 1GOAA 1SKRA 1X1PA 1C0UA 4CK2A 4AQYK 1FKOA 2OPSA 4YOVA 1N8RO 3FE1A 4DF8A 1QTMA 2IVOA 1JLFA 1RDBA 1RTDA 1TVRA 2O4IA 3E9OA 4JD2B 4NCAA 4OPAA 3BF1A 1S9GA 2AA4A 2IC3A 4CGIA 3ZETA 3L4IA 3L8BA 4F2RA 4MDAA 4HVJA 4B9MA 3KVGA 4JI2K 5HRPA 1Q8IA 3U4LA 4BROA 4C1NK 1NGAA 4RCHA 4JI4K 4BRNA 4CFAA 2OANA 3J7YP 4FM1A 1K8AO 3VTIA 3LDOA 3DXKB 1NG9A 3VQ8A 4AHVA 4LH5A 4LF7K 1BGXT 3ZLJA 4C8LA 3L2QA 1KLMA 3ZT4A 3H6EA 3T1AA 3VF6A 3CYMA 1JJ2M 2O4GA 1NOZA 1YF5L 3HBTA 1Z25A 2OA8A 4GNIA 1SKWA 2QWMA 2XHBA 3EKSA 2NNWA 1EXQA 4AHCA 3TTFA 3JXUA 4GV9A 4K41A 3OYIA 4I2PA 2CGJA 2I7PA 3HVTA 3VQ4A 4DTUA 3K0SA 2OYQA 3N4QA 4CZIA 4CFDA 3MECA 4O44A 4DQPA 2OPQA 2P1JA 3OYGA 4FK2A 3H08A 1K8KB 1FJGK 3V1QA 4CF1A 3KLHA 2IVPA 3HK2A 1GLAG 5IT9O 1YVNA 1VQ5N 5LJVA 3OYLA 3QLHA 4DR5K 3L2VA 4DUZK 5HRRA 1U6ZA 1N33K 4EZ6A 4E1JA 1RDDA 3O1BA 3AVJA 2E20A 3TAQA 1BQNA 1A5XA 3TTDA 3CJBA 3MX2A 3ZSQA 4H0YB 3LWLA 4CJ3A 3KD5E 1Q9YA 1YI2N 3P38A 3I8DA 5BRDA 5KTQA 4V19S 2ETJA 2HBJA 4BG9A 4M7YA 4CERA 4CJRA 2UYTA 4FOEA 4IG0A 3HL8A 4M3WA 1QE1A 1HMVA 3MXMA 4KO0A 3ULDA 4CE9A 4JK7A 3V1OA 2PAVA 3WQUA 3CCMN 3MEDA 4LFBK 3NGIA 2HBMA 3OBWA 3O9QA 2YKMA 3SAGA 1WBDA 1J5OA 4R79A 5AZJA 1IJJA 1LAWA 4JEPA 1WNSA 1HYSA 5F2RA 2HNYA 1HNIA 1QQOA 2Q2RA 3VQDA 2NUBA 2QTDA 3B8AX 1BOTO 5GAGP 3Q7CA 1KFSA 4DWIA 4OLAA 4FJIA 1Z05A 4F8RA 4DV3K 3OYKA 1OH6A 4M3XA 4CZLA 2UUCK 2P9NB 3CJ7A 4FZYA 4J2AA 1LWEA 3PSFA 3CQYA 5CYMA 3OYEA 2E1YA 2O8BA 4OKEA 4B9LA 3QFUA 3WNEA 1NU0A 4C8NA 4FPBA 2X74A 4K25A 4Z4CA 4DTXA 4DS4A 1XWLA 3M1FA 3QFPA 1EP4A 1VQMN 4E7IA 1U49A 1W0HA 4DU4A 4LFAK 4RW9A 1YTUA 4K0KK 4BRGA 3AVGA 4JKHA 5C12A 4BC5A 1L3VA 2VCPA 2EX3A 1UA1A 4YY3K 2GUPA 2A6AA 5FPNA 4FPAA 4PL7A 4E3SA 4Z94A 2Q36A 4IEEA 4CJEA 2HHHK 2HHXA 4B1VA 1OH5A 3GL1A 4JRPA 3VQPA 1MU2A 3LDNA 2Q1NA 4DV6K 3AVKA 3LP1A 4DV7K 4BE2A 3NH0A 4PL8A 4I9QA 4CJ4A 4FLXA 4CIGA 4LY7A 2W6LA 4CZHA 2FBVA 3MWTA 1W9HA 4H0TB 1S72N 4BREA 4JKCA 3ASMA 1RTJA 3NAEA 4X65K 3THVA 2HMIA 4FZXC 2P9NA 4KH6A 1IBMK 2KFZA 5AQTA 5JLHA 4PA1A 2XY5A 2HHSA 4JKDA 2QXLA 1VSIA 3RMAA 1R0AA 1DKGD 4DTOA 3A0IX 5J2QA 3KK1A 2GWJA 2F9TA 3DLLL 3PX6A 4CJUA 4CIFA 2P5OA 3TAGA 2NRTA 5BR8K 4BC4A 4B1WB 4DQQA 4E0DA 1K73O 3I33A 5BN8A 3O3FA 3O4NA 4W5TA 3IKMA 4H8KA 3SAFA 2G8WA 1JCEA 4LF9K 1ATNA 4XH5A 3V81A 2VGMA 3HO1A 4X66K 4DTRA 2KZMA 5AQFA 2QM1A 1N5YA 2QA4N 2QWQA 3OYMA 3SNNA 4WF9L 3DLEA 1C0GA 4H5NA 1T05A 3FLCO 3WXKA 1RDUA 4OO1J 2BDPA 3THWA 2O8FB 2IDOA 2YHXA 1NMNA 4BVOA 1G99A 2R7YA 4NYFA 4DLEA 1IKVA 4BRIA 4EFHA 3OY9A 1DTQA 3G25A 4BWJA 3QERA 3GDQA 3NDKA 3RVCA 3LDQA 3AA4A 3MXJA 3P5JA 4KFBA 4H0PA 5GIOA 2D0AA 3A2FA 3AGKA 3HI0A 3KWGA 2JGUA 4FWQA 2QXFA 1EX4A 3D2EB 2KQ2A 3C0BA 3K2PA 1BA0A 2UUBK 1IKWA 3AVFA 4CIEA 1C0FA 3J7AP 3TSPA 3G71N 4CF2A 3SMSA 5KGWA 4B3SK 4YFUA 2HHQA 1MWKA 3E01A 3O5BA 3IMXA 2XY6A 4KBOA 3WNFA 3MWPA 5EX5A 3OYBA 3KLFA 1S5JA 3RMCA 4IJAA 5KPZA 4A5BA 4IFEA 1RBTA 3V9WA 3EZ5A 4KHWA 4GW6A 1U04A 4DV0K 3NH1A 4CJKA 1NGGA 3AVBA 1J5EK 4PWDA 5AQPA 3THXA 5BRHA 1HNZK 3BZCA 1KCFA 3KJVA 4DQSA 2FBTA 3O8MA 3V4IA 3ZYYX 3VA0A 4M3UA 3VQ9A 3IS9A 3KTQA 1XMQK 2QKKA 4PUOA 4DQ8A 4AH9A 3OHRA 4ELUA 1E3MA 3EL2A 2P9KB 2NZTA 2ASOA 3ZX3A 4CJQA 4JKEA 3D2FB 1S1TA 1X3MA 1DTTA 4Z4FA 3EY1A 4FW1A 1GLLO 4O5FA 1U48A 3DXMB 3CCLN 5M1NA 1LOTB 5C2DA 2D5RA 2HHUA 4BRPA 3ATUA 1JLAA 2QEXN 2Z1GA 3ZT0A 3JAMO 4KHYA 3MK6A 4B3MK 3AAQA 4FOIA 1QHTA 3T3FA 3OYNA 1OVYA 1SKSA 3M8QA 5BR9A 3VQCA 1YJNN 3D2FA 3H3OB 3LZJA 4ZTJA 3IFRA 3G0ZA 4FWKA 1BL3A 3SI6A 3VTHA 1REVA 3R1XA 3A8YA 1VQNN 4YOUA 3CCVN 2P9PB 3LPUA 3EE8A 1S1UA 1ATRA 4JV5K 3BGRA 1VSEA 3ISNC 4YOXA 2ITMA 1KVBA 4KTQA 3CJCA 5TKYA 4QS7A 2E2NA 4IWVA 4BC2A 1QVFM 1QZ5A 1RBUA 3CG7A 2P9IA 4CEFA 1L3UA 4JYAK 4M3TA 4PKIA 4HUFA 4CJWA 3VQ6A 4DTMA 3VGLA 4DSFA 4WFNL 5JS2A 1TUYA 1NKEA 3JYTA 1C1AA 4JK9A 3PSIA 1ASWA 2AP1A 4CBWA 5HRSA 4Q0BA 3HT3A 3FZFA 5LJWA 4FJNA 4LF4K 4N41A 3OS1A 4CEBA 5BPNA 4DV2K 4BE0A 3UKUA 4OPHA 4DLGA 4G1QA 2E2PA 4JNEA 4DFMA 1RNHA 4B3OA 4E7JA 4BQLA 2A40A 3LDPA 2Y1IA 3NF7A 3U6FA 4FWOA 3RSEA 4RWTA 1ESVA 4DFJA 5AQJA 3AO4A 2BE2A 1C1BA 3OJSA 4KH4A 4DU3A 4CHYA 3ULEB 4OKJA 5C0YA 3VMFB 4H0VB 4I6MA 2HW3A 4KHUA 2F8SA 3LP3A 3A5NC 5CE3A 3FZKA 4NXMK 4GVMA 2E6LA 3AVHA 3ZETB 3HTVA 3HSTB 2G8HA 4M3YA 4FJKA 3U3YA 1RDAA 5I9EB 1UAXA 3DJCA 4CFCA 5FRMA 4FYDA 3QINA 3DLBA 2YNHA 3CPWM 1TKDA 1U4BA 4AHTA 4O55A 1NGHA 1VQ4N 4BVPA 2UU9K 2X6SA 4M3ZA 2QWLA 5E41A 4A59A 1A5WA 3LDLA 1HNVA 4FL9A 3BY5A 4FM2A 3LP2A 1VQLN 4ELVA 4CEQA 2O8EA 3BUZB 4C23A 2OTJN 1JLGA 1WSGA 5C42A 2Q0RA 4BQZA 2VWKA 3P1GA 3AO5A 2ASPA 4ISFA 3SUNA 3QICA 1NGFA 4B9VA 5AQLA 1ZXOA 1T03A 3CHWA 4RW7A 3R3LA 3K5NA 2VQEK 3OYHA 1JXEA 3DLKA 3C6UA 1ZBUA 1GLJO 1RFQA 2GX9A 4Z4HA 4ELTA 1VQ6N 1FXXA 3CM6A 1X9JA 4K8ZA 4EHUA 3I56N 1HJRA 1QQCA 3VESA 3VENA 4DCHA 4DTPA 3ID8A 3TAEA 4KREA 2FBYA 2D4WA 5AQYA 4BR0A 2ZF5O 4HUEA 4IXCA 5AQQA 3ZT2A 2YX6A 1C0MA 5AQRA 3VQ7A 3M5RA 1HNWK 4JKGB 3EO3A 1NMDA 4OGEA 1JKHA 3JS6A 5JS1A 4B1XB 1F21A 1SV5A 3PX4A 4MQ3A 4OJRA 4DR6K 3QEVA 4JD2A 3VOVA 2ZQBA 3HJFA 2YCHA 1HLUA 2FC0A 3HOTA 4Z4IA 5T7BA 5FLXO 1WOQA 1J9AA 2VG6A 4FJJA 4CW7B 3CCRN 3LPTA 5AJ3K 3VETA 3S3OA 5AQGA 5AZJB 3WEEA 1V4SA 1WSIA 3CIPA 4CFBA 4B9QA 1KC8O 4DQIA 1O13A 1VK0A 4NYNA 4E89A 1ITGA 3QEWA 3QEIA 1NK6A 3FFIA 3AVIA 3ZSVA 3IAYA 2QWRA 4RW6A 4PQUA 4X64K 2WBNA 4DFPA 1SAZA 1NGEA 2FF3B 1B92A 1SQKA 5F1XA 5KGXA 4HHTA 1LWCA 4AM7A 3TPQA 2RPIA 3A5LC
chains in the Genus database with same CATH topology
3NF8A 1JLCA 4E3SA 4DQRA 4CJEA 1XC9A 1IKXA 4C8OA 4IFVA 4CJFA 1LWFA 4FW2A 3L2UA 3DLRA 3I0SA 3DYAA 5KRTA 4Z4EA 2HHXA 1VSDA 3DRPA 4JRPA 4CJPA 4KAZA 3WNGA 1S9EA 3VQPA 5FDLA 3D0PA 4KB0A 1MU2A 4CEEA 4CEZA 2OZSA 3AVKA 3LP1A 1IKYA 4M41A 3S3NA 3PO5A 4FJXA 1JXBA 4BE2A 4IFYA 3NH0A 1RT1A 5J1EA 3KK3A 4I9QA 4CJ4A 4B8AB 4CHPA 4FLXA 4CIGA 4NCGA 4OVLA 3DLHA 3PX0A 4LY7A 3M8PA 4ZHRA 1Z26A 3RMBA 3EYZA 1KVAA 2FBVA 3ZSYA 2YHAA 3SV3A 4KHQA 4O5BA 1W9HA 4HCBA 3KKSA 4ID1A 3ASMA 1RTJA 3NAEA 3QESA 2OPRA 3AO3A 3THVA 2HMIA 3DMJA 1S1VA 3C94A 3PY8A 4FZXC 2F8TA 2KFZA 4CK1A 2BGGA 3K5MA 3K58A 2XY5A 4PA1A 4F3OA 3NF9A 3MEGA 2HHSA 1NJZA 3TI0A 4N76A 4CF0A 4KHSA 3UIQA 1ASVA 3ZT3A 1N6QA 2HVHA 1VSIA 2RKIA 4W5OA 3RMAA 1R0AA 4KI6A 4DTOA 1KFDA 4B08A 1K6YA 3KK1A 5J2QA 4B9SA 3PX6A 3V6DA 4CJUA 3AO1A 4CIFA 4O4GA 3RTVA 2P5OA 4J2EA 4EP4A 5SZTA 3TAGA 3L2WA 4CHNA 1L3TA 3KD1E 1NK9A 3AA3A 3VQEA 4DQQA 3S9HA 1D9DA 4CGJA 4E0DA 3O3FA 2W42A 4OLBA 3O4NA 4W5TA 1KRPA 4H8KA 3HP6A 4KPYA 3CFRA 2G8WA 5HRNA 1I3AA 3RR8A 4IKFA 3CFPA 2EHGA 2KFNA 3V81A 3HO1A 4DTRA 3O3HA 3VQQA 4CGHA 2KZMA 2VG5A 3MAQA 1N5YA 2FBXA 3C6TA 3C95A 4E1NA 3TARA 3M8RA 4OGCA 3VQ5A 1TL1A 3OYMA 3F73A 3LWMA 3KIOA 3L2RA 3SNNA 4B9TA 4JS4A 4JLHA 3DLEA 1TGOA 1VSMA 2B5JA 2GUIA 4QAGA 1Q9XA 4F3TA 1XHZA 1TV6A 2ITGA 1T05A 1UA0A 3QO9A 4FCYA 1U47A 3DOKA 3LAKA 3CQ8A 2BDPA 4FLWA 1LAVA 1ZBLA 4ICLA 2IDOA 1RCHA 4E7KA 2YNIA 2ZD1A 2PYJA 1S6QA 5KI6A 4NYFA 2YV0X 4CK3A 3HVRA 1IKVA 2R7YA 4DLEA 3OY9A 3NCIA 1DTQA 5J2MA 2HHWA 4BWJA 3QERA 4HCCA 3DLGA 3JSMA 3NDKA 1NJWA 1LW0A 3QNOA 3QEXA 3LZIA 5CYQA 3ZSZA 3AA4A 3DOLA 1RBVA 3MXJA 3WNHA 3O4QA 3P5JA 4OPKA 4HTUA 4KFBA 3TR8A 2D0AA 3A2FA 3OS0A 5FROA 3SCXA 4HUGA 3NBPA 4OKKA 2JGUA 4LSNA 4CESA 4DTNA 3TANA 3SQ0A 2P51A 2HNDA 4C8KA 2QXFA 1EX4A 3QIOA 3RR7A 1J54A 4W5NA 2GBZA 1RILA 3LALA 4Z0UA 2KQ2A 3K2PA 1XI1A 3ALYA 3NH2A 1D9FA 2XRIA 4CGGA 2G8KA 1LW2A 1RT6A 1IKWA 3LAMA 2X6NA 3AVFA 2ZE2A 4N5SA 1JL1A 5HLFA 3PUFA 4CIEA 1TK5A 3BDPA 4CF2A 5KGWA 4F2SA 1YT3A 3OYAA 4YFUA 3TABA 2HHQA 3E01A 4RW4A 5CY4A 3OYCA 3WNFA 2XY6A 4LH4A 5KRSA 1WAFA 1SL2A 3OYBA 3KLFA 3ZSRA 5HP1A 1WSHA 1S5JA 1S1XA 3AO2A 2IS3A 3RMCA 2QKBA 3D45A 2Q3SA 5DMRA 3LDSA 3NE6A 3DRRA 3KK2A 2HNZA 2VWJA 1NK4A 2GV9A 4BDYA 4NCBA 2DTUA 4DSIA 1TKXA 1RBTA 3V9WA 2VG7A 3V9UA 1QSSA 3EZ5A 4LSLA 3QNNA 4KHWA 1JL2A 4GW6A 2YNFA 4Q5VA 1VSKA 3VN5A 4FJ5A 4ID5A 1U04A 1BI4A 3NH1A 1TAUA 4CJKA 1BISA 3TWHA 4IBNA 5SWMA 3K5OA 4KKOA 3L3VA 3SZ2A 4XIUA 4GMJB 3AVBA 5J2PA 4DSKA 1XHXA 1NK5A 4PWDA 1WSEA 1IO2A 3K5LA 1X9WA 2G8IA 2OPPA 1KCFA 2B4JA 1BIUA 3KJVA 4DQSA 2FBTA 1A5VA 2XO7A 3KLEA 3V4IA 2YNGA 1VSLA 3VA0A 3VQ9A 4M3UA 1BCMA 1HPZA 3IS9A 1B9DA 3KTQA 1RT7A 1VRTA 1RT4A 2QKKA 3OVNA 1RT3A 4KTWA 4PUOA 4ELUA 4AH9A 4E7LA 4C8MA 3P83D 4AILC 4DF4A 1WLJA 4W5RA 4AHUA 1UOCA 2D0CA 1U45A 4CJQA 2DFHA 3HP9A 4FJ9A 1S1TA 4FLYA 1NK8A 1DTTA 3K57A 3EY1A 4Z4FA 4FW1A 4DSLA 3LP0A 4I9LA 4BWMA 1U48A 4CF8A 2IGIA 1UWBA 4W5QA 4FJMA 4E19A 1CZBA 4CHZA 3HPHA 3AVAA 1HQUA 3ITHA 1BIZA 1BHLA 3HM9A 5C25A 3IG1A 3V9ZA 1RBRA 4CGFA 4H4MA 3G10A 1QSYA 1SUQA 1CZ9A 1KVCA 4Y1CA 2D5RA 4CJVA 5I42A 2HVIA 1ZBFA 4J2BA 3L3UA 1C0TA 1YVUA 4N56A 2HHUA 4DSJA 4CHOA 1NJYA 2LSNA 1JLAA 4O0JA 2ATQA 2KZZA 4I2QA 3B6PA 4KV8A 3V1RA 3B6OA 4M42A 3NFAA 4BDZA 3U3GA 2Z1GA 3ZT0A 5DK5A 1ZBHA 4KHYA 2PZSA 1C6VA 3AVLA 1QHTA 1JLEA 4DS5A 3T3FA 3OYNA 3TAMA 1SKSA 3M8QA 1HYZA 4ZTFA 2A1SA 3VQCA 1GOAA 1SKRA 3LZJA 4YNQA 1X1PA 1C0UA 4ZTJA 3G0ZA 4CK2A 4FVMA 1FKOA 1BL3A 2OPSA 4J2DA 3SI6A 3NGYA 4O0IA 1REVA 3QEPA 2E4LA 2Z1IA 3F9KA 4R5PA 4OPJA 2KW4A 3DI6A 3OS2A 4DF8A 1QTMA 1EKEA 1JLFA 1ZBIA 1RDBA 3LPUA 1S1UA 1TVRA 4DMNA 1RTDA 1S6PA 4FK4A 2O4IA 3BGRA 1VSEA 1IG9A 3ISNC 1S1WA 1NOYA 2XY7A 1RBSA 1KVBA 4KTQA 5J2NA 4KI4A 1T8EA 3RMDA 3KLIA 1TAQA 4AHRA 3TAPA 4IG3A 4NCAA 1L5UA 1RBUA 4FLTA 1S9GA 4DG1A 2AJQA 2IC3A 3CG7A 2A1RA 4CEFA 1L3UA 4CGIA 3L8BA 1RDCA 2OZMA 4HVJA 4B9MA 4F2RA 4M3TA 3DRSA 4HUFA 1T7PA 4FXDA 4CJWA 5HRPA 1Q8IA 4BE1A 3VQ6A 4DTMA 2KTQA 3HPOA 3OYDA 3RWUA 4DSFA 3HPGA 4M3RA 4CFAA 4FM1A 1VSFA 1CXQA 1NKCA 5JS2A 3V9XA 1NKEA 4FZZA 3HYFA 2Z1JA 3JYTA 3VQ8A 4AHVA 1C1AA 4LH5A 1ASWA 5HRSA 1D8YA 1X9SA 4Q0BA 1BGXT 1O1WA 2D0BA 4Y1DA 3HT3A 4DTSA 4FJNA 4N41A 3OS1A 4CEBA 4H4OA 3AVMA 4BE0A 3ZSXA 4C8LA 3L2QA 1KLMA 3ZT4A 4DLGA 3T1AA 4G1QA 4DFMA 4FLZA 3CYMA 1RNHA 2PYLA 2WONA 4CEDA 4E7JA 4B3OA 2O4GA 1NOZA 1GOBA 4FJGA 4FK0A 1FKPA 1JLQA 3NF7A 3U6FA 2Y1IA 3SUOA 4KTZA 3NGZA 1LV5A 1Z25A 3S3MA 3RRHA 4CGDA 2OA8A 1SKWA 2XHBA 4DFJA 2XY8A 1J53A 3AO4A 2BE2A 1C1BA 1WAJA 1HYVA 1EXQA 3ZSOA 3OJSA 5HROA 4AHCA 4DU3A 2HHTA 1CXUA 3QIPA 4CF9A 3SPYA 1HQEA 3OYIA 4CHYA 5EU7A 4I2PA 1D5AA 3AA5X 1VRUA 4OKJA 4EP5A 3HVTA 3AVCA 3VQ4A 2HW3A 4DTUA 2P5GA 4KHUA 4RW8A 4CCHA 2OYQA 3CM5A 2WOMA 1RTHA 3LP3A 4FJ8A 2F8SA 1VSJA 1TK0A 4CFDA 4B9NA 3MECA 4O44A 4FJLA 3AVNA 4GVMA 2E6MA 2E6LA 4E1MA 1NJXA 3AVHA 1GOCA 4CJTA 2OPQA 3IRXA 3HSTB 1RT2A 2P1JA 3OJUA 3OYGA 4FK2A 3H08A 2G8HA 4FJKA 4M3YA 3U3YA 3V1QA 4CF1A 1RDAA 4IDKA 3KLHA 1UAXA 4I7FA 3HK2A 4FJ7A 4CFCA 5FRMA 4FYDA 3OYLA 3QINA 3QLHA 5D3GA 3DLBA 2YNHA 1TKDA 3L2VA 1U4BA 1VSHA 4AHTA 3OYJA 5HRRA 1TKZA 4O55A 1QS4A 3SQ1A 4EZ6A 3SJJA 2I5JA 1RDDA 4WE1A 3AVJA 3NF6A 2RN2A 4CEAA 2X6SA 4KB1A 4M3ZA 3TAQA 1BI4B 1BQNA 5I3UA 1A5XA 1L3SA 1ASUA 1A5WA 5E41A 3ZSQA 1HNVA 3RRGA 2HB5A 3LWLA 4FM2A 3LP2A 4ELVA 4N47A 4CEQA 4CJ3A 3KD5E 1JLGA 1WSGA 4K8XA 1Q9YA 1EETA 5C42A 4E7HA 2QK9A 2VWKA 3I8DA 3P1GA 5KTQA 3AO5A 3SPZA 2ETJA 1B9FA 3SUNA 2Z1HA 5CZ2A 4CERA 4CJRA 3V9SA 4L8RB 1JLBA 1G15A 1IH7A 3HL8A 4IG0A 3AV9A 4B9VA 1YTAA 2X78A 1QE1A 4M3WA 1HMVA 4MFBA 4CECA 3NHGA 3ZT1A 3MXMA 4PY5A 3LANA 2DFEA 3M8SA 1T03A 1KLNA 4QCLA 4KO0A 3QETA 4FJHA 3ULDA 4RW7A 4CE9A 3V1OA 4CJSA 3K5NA 1RT5A 3MEDA 1JXEA 3DLKA 3ZSWA 5C24A 3OYHA 5CZ1A 2YKNA 3C6UA 3MXIA 1SL1A 3NGIA 1ZBUA 3MEEA 1TK8A 4ELTA 1BCOA 4Z4HA 4UQGA 3KLGA 4LD0A 1FXXA 2YKMA 2DFFA 1ZYQA 1NK7A 3PO4A 3SYZA 3CM6A 3VQBA 1BQMA 2B6AA 1J5OA 4K8ZA 1C1CA 5HBMA 1HJRA 1QQCA 4DTPA 1LAWA 4CJLA 4DFKA 1WNSA 3CFOA 2G8VA 1CLQA 1HYSA 2HHVA 3TAEA 4B8CA 4KREA 2FBYA 2HNYA 1HNIA 3ZCMA 1NKBA 3VQDA 1KSPA 4HUEA 2NUBA 3ZT2A 3K59A 2IOCA 1C0MA 4FLVA 3VQ7A 2RF2A 4TSXA 4CJ5A 4OGEA 1JKHA 1SL0A 3TAFA 4KHNA 1Y97A 4Z4GA 5JS1A 1F21A 3HXMA 1SV5A 2BANA 2JLEA 3PX4A 4MQ3A 4OJRA 1KFSA 4AHSA 4EZ9A 4DWIA 1HRHA 3QEVA 1RTIA 5FRNA 4OLAA 4FJIA 3KKRA 1DLOA 2ZQBA 3T19A 4BDPA 3HJFA 4F8RA 3AA2A 4DSEA 4FLUA 1X9MA 2FC0A 3OYKA 4Z4IA 4BACA 3DM2A 4M3XA 4RG8A 2YHBA 5T7BA 1WN7A 1WSFA 2G8FA 4FZYA 1I39A 1J9AA 2VG6A 3SQ2A 4FJJA 2G8UA 3LPTA 3SUPA 3S3OA 4J2AA 1LWEA 5CYMA 3OYEA 3SV4A 3VQAA 4M45A 4DU1A 1KTQA 1WSIA 3OYFA 4OKEA 4CFBA 2Y1JA 4B9LA 3WNEA 4C8NA 1TL3A 2X74A 4Z4CA 4DTXA 1TKTA 4DQIA 4DS4A 4KRFA 1XWLA 1VK0A 4NYNA 4E89A 2DY4A 1ITGA 3QEWA 3QEIA 5K14A 4JRQA 3O3GA 3SUQA 1NK6A 3FFIA 3AVIA 1FK9A 2IAJA 3ZSVA 2PY5A 3IAYA 1EP4A 4RW6A 4PQUA 4E7IA 1NK0A 4DFPA 4DTJA 3I0RA 1U49A 4DQPA 1W0HA 4DU4A 3VA3A 3PV8A 1QSLA 4RW9A 1YTUA 1B92A 3AVGA 2F96A 1L3VA 5KGXA 4CEOA 4JS5A 4CHQA 4HHTA 4F4KA 1LWCA 2EX3A 4FM0A 4B9UA 3SQ4A 4QOZB 2RPIA 1WSJA 1UA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NF8 A;  1JLC A;  4E3S A;  4DQR A;  4CJE A;  1XC9 A;  1IKX A;  4C8O A;  4IFV A;  4CJF A;  1LWF A;  4FW2 A;  3L2U A;  3DLR A;  3I0S A;  3DYA A;  5KRT A;  4Z4E A;  2HHX A;  1VSD A;  3DRP A;  4JRP A;  4CJP A;  4KAZ A;  3WNG A;  1S9E A;  3VQP A;  5FDL A;  3D0P A;  4KB0 A;  1MU2 A;  4CEE A;  4CEZ A;  2OZS A;  3AVK A;  3LP1 A;  1IKY A;  4M41 A;  3S3N A;  3PO5 A;  4FJX A;  1JXB A;  4BE2 A;  4IFY A;  3NH0 A;  1RT1 A;  5J1E A;  3KK3 A;  4I9Q A;  4CJ4 A;  4B8A B;  4CHP A;  4FLX A;  4CIG A;  4NCG A;  4OVL A;  3DLH A;  3PX0 A;  4LY7 A;  3M8P A;  4ZHR A;  1Z26 A;  3RMB A;  3EYZ A;  1KVA A;  2FBV A;  3ZSY A;  2YHA A;  3SV3 A;  4KHQ A;  4O5B A;  1W9H A;  4HCB A;  3KKS A;  4ID1 A;  3ASM A;  1RTJ A;  3NAE A;  3QES A;  2OPR A;  3AO3 A;  3THV A;  2HMI A;  3DMJ A;  1S1V A;  3C94 A;  3PY8 A;  4FZX C;  2F8T A;  2KFZ A;  4CK1 A;  2BGG A;  3K5M A;  3K58 A;  2XY5 A;  4PA1 A;  4F3O A;  3NF9 A;  3MEG A;  2HHS A;  1NJZ A;  3TI0 A;  4N76 A;  4CF0 A;  4KHS A;  3UIQ A;  1ASV A;  3ZT3 A;  1N6Q A;  2HVH A;  1VSI A;  2RKI A;  4W5O A;  3RMA A;  1R0A A;  4KI6 A;  4DTO A;  1KFD A;  4B08 A;  1K6Y A;  3KK1 A;  5J2Q A;  4B9S A;  3PX6 A;  3V6D A;  4CJU A;  3AO1 A;  4CIF A;  4O4G A;  3RTV A;  2P5O A;  4J2E A;  4EP4 A;  5SZT A;  3TAG A;  3L2W A;  4CHN A;  1L3T A;  3KD1 E;  1NK9 A;  3AA3 A;  3VQE A;  4DQQ A;  3S9H A;  1D9D A;  4CGJ A;  4E0D A;  3O3F A;  2W42 A;  4OLB A;  3O4N A;  4W5T A;  1KRP A;  4H8K A;  3HP6 A;  4KPY A;  3CFR A;  2G8W A;  5HRN A;  1I3A A;  3RR8 A;  4IKF A;  3CFP A;  2EHG A;  2KFN A;  3V81 A;  3HO1 A;  4DTR A;  3O3H A;  3VQQ A;  4CGH A;  2KZM A;  2VG5 A;  3MAQ A;  1N5Y A;  2FBX A;  3C6T A;  3C95 A;  4E1N A;  3TAR A;  3M8R A;  4OGC A;  3VQ5 A;  1TL1 A;  3OYM A;  3F73 A;  3LWM A;  3KIO A;  3L2R A;  3SNN A;  4B9T A;  4JS4 A;  4JLH A;  3DLE A;  1TGO A;  1VSM A;  2B5J A;  2GUI A;  4QAG A;  1Q9X A;  4F3T A;  1XHZ A;  1TV6 A;  2ITG A;  1T05 A;  1UA0 A;  3QO9 A;  4FCY A;  1U47 A;  3DOK A;  3LAK A;  3CQ8 A;  2BDP A;  4FLW A;  1LAV A;  1ZBL A;  4ICL A;  2IDO A;  1RCH A;  4E7K A;  2YNI A;  2ZD1 A;  2PYJ A;  1S6Q A;  5KI6 A;  4NYF A;  2YV0 X;  4CK3 A;  3HVR A;  1IKV A;  2R7Y A;  4DLE A;  3OY9 A;  3NCI A;  1DTQ A;  5J2M A;  2HHW A;  4BWJ A;  3QER A;  4HCC A;  3DLG A;  3JSM A;  3NDK A;  1NJW A;  1LW0 A;  3QNO A;  3QEX A;  3LZI A;  5CYQ A;  3ZSZ A;  3AA4 A;  3DOL A;  1RBV A;  3MXJ A;  3WNH A;  3O4Q A;  3P5J A;  4OPK A;  4HTU A;  4KFB A;  3TR8 A;  2D0A A;  3A2F A;  3OS0 A;  5FRO A;  3SCX A;  4HUG A;  3NBP A;  4OKK A;  2JGU A;  4LSN A;  4CES A;  4DTN A;  3TAN A;  3SQ0 A;  2P51 A;  2HND A;  4C8K A;  2QXF A;  1EX4 A;  3QIO A;  3RR7 A;  1J54 A;  4W5N A;  2GBZ A;  1RIL A;  3LAL A;  4Z0U A;  2KQ2 A;  3K2P A;  1XI1 A;  3ALY A;  3NH2 A;  1D9F A;  2XRI A;  4CGG A;  2G8K A;  1LW2 A;  1RT6 A;  1IKW A;  3LAM A;  2X6N A;  3AVF A;  2ZE2 A;  4N5S A;  1JL1 A;  5HLF A;  3PUF A;  4CIE A;  1TK5 A;  3BDP A;  4CF2 A;  5KGW A;  4F2S A;  1YT3 A;  3OYA A;  4YFU A;  3TAB A;  2HHQ A;  3E01 A;  4RW4 A;  5CY4 A;  3OYC A;  3WNF A;  2XY6 A;  4LH4 A;  5KRS A;  1WAF A;  1SL2 A;  3OYB A;  3KLF A;  3ZSR A;  5HP1 A;  1WSH A;  1S5J A;  1S1X A;  3AO2 A;  2IS3 A;  3RMC A;  2QKB A;  3D45 A;  2Q3S A;  5DMR A;  3LDS A;  3NE6 A;  3DRR A;  3KK2 A;  2HNZ A;  2VWJ A;  1NK4 A;  2GV9 A;  4BDY A;  4NCB A;  2DTU A;  4DSI A;  1TKX A;  1RBT A;  3V9W A;  2VG7 A;  3V9U A;  1QSS A;  3EZ5 A;  4LSL A;  3QNN A;  4KHW A;  1JL2 A;  4GW6 A;  2YNF A;  4Q5V A;  1VSK A;  3VN5 A;  4FJ5 A;  4ID5 A;  1U04 A;  1BI4 A;  3NH1 A;  1TAU A;  4CJK A;  1BIS A;  3TWH A;  4IBN A;  5SWM A;  3K5O A;  4KKO A;  3L3V A;  3SZ2 A;  4XIU A;  4GMJ B;  3AVB A;  5J2P A;  4DSK A;  1XHX A;  1NK5 A;  4PWD A;  1WSE A;  1IO2 A;  3K5L A;  1X9W A;  2G8I A;  2OPP A;  1KCF A;  2B4J A;  1BIU A;  3KJV A;  4DQS A;  2FBT A;  1A5V A;  2XO7 A;  3KLE A;  3V4I A;  2YNG A;  1VSL A;  3VA0 A;  3VQ9 A;  4M3U A;  1BCM A;  1HPZ A;  3IS9 A;  1B9D A;  3KTQ A;  1RT7 A;  1VRT A;  1RT4 A;  2QKK A;  3OVN A;  1RT3 A;  4KTW A;  4PUO A;  4ELU A;  4AH9 A;  4E7L A;  4C8M A;  3P83 D;  4AIL C;  4DF4 A;  1WLJ A;  4W5R A;  4AHU A;  1UOC A;  2D0C A;  1U45 A;  4CJQ A;  2DFH A;  3HP9 A;  4FJ9 A;  1S1T A;  4FLY A;  1NK8 A;  1DTT A;  3K57 A;  3EY1 A;  4Z4F A;  4FW1 A;  4DSL A;  3LP0 A;  4I9L A;  4BWM A;  1U48 A;  4CF8 A;  2IGI A;  1UWB A;  4W5Q A;  4FJM A;  4E19 A;  1CZB A;  4CHZ A;  3HPH A;  3AVA A;  1HQU A;  3ITH A;  1BIZ A;  1BHL A;  3HM9 A;  5C25 A;  3IG1 A;  3V9Z A;  1RBR A;  4CGF A;  4H4M A;  3G10 A;  1QSY A;  1SUQ A;  1CZ9 A;  1KVC A;  4Y1C A;  2D5R A;  4CJV A;  5I42 A;  2HVI A;  1ZBF A;  4J2B A;  3L3U A;  1C0T A;  1YVU A;  4N56 A;  2HHU A;  4DSJ A;  4CHO A;  1NJY A;  2LSN A;  1JLA A;  4O0J A;  2ATQ A;  2KZZ A;  4I2Q A;  3B6P A;  4KV8 A;  3V1R A;  3B6O A;  4M42 A;  3NFA A;  4BDZ A;  3U3G A;  2Z1G A;  3ZT0 A;  5DK5 A;  1ZBH A;  4KHY A;  2PZS A;  1C6V A;  3AVL A;  1QHT A;  1JLE A;  4DS5 A;  3T3F A;  3OYN A;  3TAM A;  1SKS A;  3M8Q A;  1HYZ A;  4ZTF A;  2A1S A;  3VQC A;  1GOA A;  1SKR A;  3LZJ A;  4YNQ A;  1X1P A;  1C0U A;  4ZTJ A;  3G0Z A;  4CK2 A;  4FVM A;  1FKO A;  1BL3 A;  2OPS A;  4J2D A;  3SI6 A;  3NGY A;  4O0I A;  1REV A;  3QEP A;  2E4L A;  2Z1I A;  3F9K A;  4R5P A;  4OPJ A;  2KW4 A;  3DI6 A;  3OS2 A;  4DF8 A;  1QTM A;  1EKE A;  1JLF A;  1ZBI A;  1RDB A;  3LPU A;  1S1U A;  1TVR A;  4DMN A;  1RTD A;  1S6P A;  4FK4 A;  2O4I A;  3BGR A;  1VSE A;  1IG9 A;  3ISN C;  1S1W A;  1NOY A;  2XY7 A;  1RBS A;  1KVB A;  4KTQ A;  5J2N A;  4KI4 A;  1T8E A;  3RMD A;  3KLI A;  1TAQ A;  4AHR A;  3TAP A;  4IG3 A;  4NCA A;  1L5U A;  1RBU A;  4FLT A;  1S9G A;  4DG1 A;  2AJQ A;  2IC3 A;  3CG7 A;  2A1R A;  4CEF A;  1L3U A;  4CGI A;  3L8B A;  1RDC A;  2OZM A;  4HVJ A;  4B9M A;  4F2R A;  4M3T A;  3DRS A;  4HUF A;  1T7P A;  4FXD A;  4CJW A;  5HRP A;  1Q8I A;  4BE1 A;  3VQ6 A;  4DTM A;  2KTQ A;  3HPO A;  3OYD A;  3RWU A;  4DSF A;  3HPG A;  4M3R A;  4CFA A;  4FM1 A;  1VSF A;  1CXQ A;  1NKC A;  5JS2 A;  3V9X A;  1NKE A;  4FZZ A;  3HYF A;  2Z1J A;  3JYT A;  3VQ8 A;  4AHV A;  1C1A A;  4LH5 A;  1ASW A;  5HRS A;  1D8Y A;  1X9S A;  4Q0B A;  1BGX T;  1O1W A;  2D0B A;  4Y1D A;  3HT3 A;  4DTS A;  4FJN A;  4N41 A;  3OS1 A;  4CEB A;  4H4O A;  3AVM A;  4BE0 A;  3ZSX A;  4C8L A;  3L2Q A;  1KLM A;  3ZT4 A;  4DLG A;  3T1A A;  4G1Q A;  4DFM A;  4FLZ A;  3CYM A;  1RNH A;  2PYL A;  2WON A;  4CED A;  4E7J A;  4B3O A;  2O4G A;  1NOZ A;  1GOB A;  4FJG A;  4FK0 A;  1FKP A;  1JLQ A;  3NF7 A;  3U6F A;  2Y1I A;  3SUO A;  4KTZ A;  3NGZ A;  1LV5 A;  1Z25 A;  3S3M A;  3RRH A;  4CGD A;  2OA8 A;  1SKW A;  2XHB A;  4DFJ A;  2XY8 A;  1J53 A;  3AO4 A;  2BE2 A;  1C1B A;  1WAJ A;  1HYV A;  1EXQ A;  3ZSO A;  3OJS A;  5HRO A;  4AHC A;  4DU3 A;  2HHT A;  1CXU A;  3QIP A;  4CF9 A;  3SPY A;  1HQE A;  3OYI A;  4CHY A;  5EU7 A;  4I2P A;  1D5A A;  3AA5 X;  1VRU A;  4OKJ A;  4EP5 A;  3HVT A;  3AVC A;  3VQ4 A;  2HW3 A;  4DTU A;  2P5G A;  4KHU A;  4RW8 A;  4CCH A;  2OYQ A;  3CM5 A;  2WOM A;  1RTH A;  3LP3 A;  4FJ8 A;  2F8S A;  1VSJ A;  1TK0 A;  4CFD A;  4B9N A;  3MEC A;  4O44 A;  4FJL A;  3AVN A;  4GVM A;  2E6M A;  2E6L A;  4E1M A;  1NJX A;  3AVH A;  1GOC A;  4CJT A;  2OPQ A;  3IRX A;  3HST B;  1RT2 A;  2P1J A;  3OJU A;  3OYG A;  4FK2 A;  3H08 A;  2G8H A;  4FJK A;  4M3Y A;  3U3Y A;  3V1Q A;  4CF1 A;  1RDA A;  4IDK A;  3KLH A;  1UAX A;  4I7F A;  3HK2 A;  4FJ7 A;  4CFC A;  5FRM A;  4FYD A;  3OYL A;  3QIN A;  3QLH A;  5D3G A;  3DLB A;  2YNH A;  1TKD A;  3L2V A;  1U4B A;  1VSH A;  4AHT A;  3OYJ A;  5HRR A;  1TKZ A;  4O55 A;  1QS4 A;  3SQ1 A;  4EZ6 A;  3SJJ A;  2I5J A;  1RDD A;  4WE1 A;  3AVJ A;  3NF6 A;  2RN2 A;  4CEA A;  2X6S A;  4KB1 A;  4M3Z A;  3TAQ A;  1BI4 B;  1BQN A;  5I3U A;  1A5X A;  1L3S A;  1ASU A;  1A5W A;  5E41 A;  3ZSQ A;  1HNV A;  3RRG A;  2HB5 A;  3LWL A;  4FM2 A;  3LP2 A;  4ELV A;  4N47 A;  4CEQ A;  4CJ3 A;  3KD5 E;  1JLG A;  1WSG A;  4K8X A;  1Q9Y A;  1EET A;  5C42 A;  4E7H A;  2QK9 A;  2VWK A;  3I8D A;  3P1G A;  5KTQ A;  3AO5 A;  3SPZ A;  2ETJ A;  1B9F A;  3SUN A;  2Z1H A;  5CZ2 A;  4CER A;  4CJR A;  3V9S A;  4L8R B;  1JLB A;  1G15 A;  1IH7 A;  3HL8 A;  4IG0 A;  3AV9 A;  4B9V A;  1YTA A;  2X78 A;  1QE1 A;  4M3W A;  1HMV A;  4MFB A;  4CEC A;  3NHG A;  3ZT1 A;  3MXM A;  4PY5 A;  3LAN A;  2DFE A;  3M8S A;  1T03 A;  1KLN A;  4QCL A;  4KO0 A;  3QET A;  4FJH A;  3ULD A;  4RW7 A;  4CE9 A;  3V1O A;  4CJS A;  3K5N A;  1RT5 A;  3MED A;  1JXE A;  3DLK A;  3ZSW A;  5C24 A;  3OYH A;  5CZ1 A;  2YKN A;  3C6U A;  3MXI A;  1SL1 A;  3NGI A;  1ZBU A;  3MEE A;  1TK8 A;  4ELT A;  1BCO A;  4Z4H A;  4UQG A;  3KLG A;  4LD0 A;  1FXX A;  2YKM A;  2DFF A;  1ZYQ A;  1NK7 A;  3PO4 A;  3SYZ A;  3CM6 A;  3VQB A;  1BQM A;  2B6A A;  1J5O A;  4K8Z A;  1C1C A;  5HBM A;  1HJR A;  1QQC A;  4DTP A;  1LAW A;  4CJL A;  4DFK A;  1WNS A;  3CFO A;  2G8V A;  1CLQ A;  1HYS A;  2HHV A;  3TAE A;  4B8C A;  4KRE A;  2FBY A;  2HNY A;  1HNI A;  3ZCM A;  1NKB A;  3VQD A;  1KSP A;  4HUE A;  2NUB A;  3ZT2 A;  3K59 A;  2IOC A;  1C0M A;  4FLV A;  3VQ7 A;  2RF2 A;  4TSX A;  4CJ5 A;  4OGE A;  1JKH A;  1SL0 A;  3TAF A;  4KHN A;  1Y97 A;  4Z4G A;  5JS1 A;  1F21 A;  3HXM A;  1SV5 A;  2BAN A;  2JLE A;  3PX4 A;  4MQ3 A;  4OJR A;  1KFS A;  4AHS A;  4EZ9 A;  4DWI A;  1HRH A;  3QEV A;  1RTI A;  5FRN A;  4OLA A;  4FJI A;  3KKR A;  1DLO A;  2ZQB A;  3T19 A;  4BDP A;  3HJF A;  4F8R A;  3AA2 A;  4DSE A;  4FLU A;  1X9M A;  2FC0 A;  3OYK A;  4Z4I A;  4BAC A;  3DM2 A;  4M3X A;  4RG8 A;  2YHB A;  5T7B A;  1WN7 A;  1WSF A;  2G8F A;  4FZY A;  1I39 A;  1J9A A;  2VG6 A;  3SQ2 A;  4FJJ A;  2G8U A;  3LPT A;  3SUP A;  3S3O A;  4J2A A;  1LWE A;  5CYM A;  3OYE A;  3SV4 A;  3VQA A;  4M45 A;  4DU1 A;  1KTQ A;  1WSI A;  3OYF A;  4OKE A;  4CFB A;  2Y1J A;  4B9L A;  3WNE A;  4C8N A;  1TL3 A;  2X74 A;  4Z4C A;  4DTX A;  1TKT A;  4DQI A;  4DS4 A;  4KRF A;  1XWL A;  1VK0 A;  4NYN A;  4E89 A;  2DY4 A;  1ITG A;  3QEW A;  3QEI A;  5K14 A;  4JRQ A;  3O3G A;  3SUQ A;  1NK6 A;  3FFI A;  3AVI A;  1FK9 A;  2IAJ A;  3ZSV A;  2PY5 A;  3IAY A;  1EP4 A;  4RW6 A;  4PQU A;  4E7I A;  1NK0 A;  4DFP A;  4DTJ A;  3I0R A;  1U49 A;  4DQP A;  1W0H A;  4DU4 A;  3VA3 A;  3PV8 A;  1QSL A;  4RW9 A;  1YTU A;  1B92 A;  3AVG A;  2F96 A;  1L3V A;  5KGX A;  4CEO A;  4JS5 A;  4CHQ A;  4HHT A;  4F4K A;  1LWC A;  2EX3 A;  4FM0 A;  4B9U A;  3SQ4 A;  4QOZ B;  2RPI A;  1WSJ A;  1UA1 A; 
#chains in the Genus database with same CATH topology
 4MLH A;  1SS6 A;  1NLV A;  4C8O A;  4FW2 A;  1W7A A;  3DLR A;  4BR9 A;  2BH1 A;  1Q82 O;  4BC3 A;  4KB0 A;  2ZWH A;  5FDL A;  4CEZ A;  2FSN A;  4MO5 A;  3CCJ N;  5AQV A;  3S3N A;  3ULE A;  1JXB A;  1QQN A;  4XEI A;  2Q97 A;  5J1E A;  3FFK B;  1E4G T;  1XMO K;  3DLH A;  3CJ1 A;  3M8P A;  1Z26 A;  3RMB A;  1VQ7 N;  3MCP A;  3EYZ A;  5AQN A;  3MMV A;  2YHA A;  4YDU C;  4GV6 A;  2E2O A;  3N4P A;  4ID1 A;  3ATV A;  3PY8 A;  3DMJ A;  1D4X A;  5GAH P;  4JI8 K;  2BGG A;  4DR1 K;  3MEG A;  3J80 O;  4DR7 K;  4KHS A;  1IG8 A;  1ASV A;  5E84 A;  4QS8 A;  3ZT3 A;  3UIQ A;  4W5O A;  2A3Z A;  1YIJ N;  1MA9 B;  3QBX A;  4B9S A;  4BRH A;  4IOA L;  3AO1 A;  4O4G A;  2P9S B;  3HM8 A;  5SZT A;  2IVN A;  4HTL A;  3KD1 E;  1NK9 A;  5KQ8 A;  3VQE A;  4OLB A;  3GE1 A;  5H1S Q;  3HP6 A;  3F9M A;  2FSJ A;  4KPY A;  5HRN A;  4CZF A;  2KFN A;  5LY3 A;  3MAQ A;  3TAR A;  3VQ5 A;  3F73 A;  2E1Z A;  3L2R A;  1GLF O;  4B9T A;  3L6Q A;  1J6Z A;  1TGO A;  1VSM A;  1XHZ A;  1GLC G;  3LAK A;  3CQ8 A;  4FLW A;  4BGA A;  4ICL A;  3CCS N;  1RCH A;  3VEX A;  3CQX A;  2P9S A;  1S6Q A;  4CK3 A;  3HVR A;  3NCI A;  3UKR B;  2HHW A;  3CC7 N;  3C7N A;  3P4I A;  3WUH A;  3LZI A;  4HTU A;  3WNH A;  1OVQ A;  2BTF A;  3DXK A;  3TR8 A;  4A57 A;  4HUG A;  5M1P A;  3NMU A;  4DTN A;  2P51 A;  5KPT A;  4GY2 B;  3QIO A;  3RR7 A;  1J54 A;  2GBZ A;  3LAL A;  1D9F A;  3ENH A;  2XRI A;  5AQM A;  2G8K A;  1Q18 A;  4N5S A;  1JL1 A;  1TK5 A;  4YOR A;  4H5T A;  3T1H K;  3OYA A;  1MWM A;  4IZ9 A;  3F5T A;  3EKU A;  3HOS A;  3MCA B;  2QI2 A;  3NE6 A;  3DRR A;  3KK2 A;  1NK4 A;  4NCB A;  4DSI A;  2HOE A;  1BO5 O;  4LSL A;  3QNN A;  3VN5 A;  4FJ5 A;  3LM2 A;  4GVE A;  4KKO A;  3K5O A;  4EZ9 A;  3J8A A;  2CGK A;  1M90 O;  1Y64 A;  1NK5 A;  4DSK A;  3M3Z A;  1WSE A;  3J7Z O;  1IO2 A;  1IV0 A;  2OPP A;  3D6R A;  1OH7 A;  2B4J A;  2IIR A;  1BIU A;  5M1K A;  2D0O A;  2XO7 A;  1Q7Y O;  3H46 O;  1BCM A;  3SAH A;  2OCE A;  1RT3 A;  2P9I B;  1TYQ B;  3P39 A;  4DF4 A;  3P83 D;  5F0X A;  4AIL C;  3W3D A;  4GKK K;  1WLJ A;  4W5R A;  3QML A;  4FLY A;  1NK8 A;  4YOY A;  3LP0 A;  3MN7 A;  2HF3 A;  3O4W A;  4I9L A;  1UWB A;  1WB9 A;  4FJM A;  4CHZ A;  4BRQ A;  1VQ8 N;  1TUU A;  3IG1 A;  3G10 A;  1SUQ A;  2I7N A;  5AZI A;  5I42 A;  1ZBF A;  5AQZ A;  2A42 A;  3L3U A;  4AF1 A;  4N56 A;  3C6A A;  3B6P A;  3NFA A;  4BDZ A;  3WXI A;  5DK5 A;  3UE5 A;  3WQT A;  4MO4 A;  2PZS A;  3KK7 A;  3HRG A;  4ILJ A;  5TKW A;  1JLE A;  3TAM A;  3U9Z A;  1HYZ A;  5AQS A;  2A1S A;  3HSC A;  1W97 L;  1MDU B;  4FVM A;  4J2D A;  3NGY A;  4O0I A;  3QEP A;  2E4L A;  2QWN A;  2Z1I A;  4A62 A;  4OX9 K;  3F9K A;  2KW4 A;  3DI6 A;  1EKE A;  5CHI A;  2W6K A;  4DMN A;  4FK4 A;  1S1W A;  1V4T A;  1RBS A;  4KI4 A;  1T8E A;  3RMD A;  1TAQ A;  4GKJ K;  5CR4 A;  4IG3 A;  4CJ7 A;  2OTL N;  3EE9 A;  4FLT A;  3VEZ A;  1HPM A;  3PLA A;  2AJQ A;  2A1R A;  1CZA N;  4ISG A;  1T7P A;  2WFB A;  2JWL A;  3R9P A;  3OYD A;  3BP8 A;  3RWU A;  3HPG A;  4YDU A;  4M3R A;  5FPM A;  1CXQ A;  1NKC A;  3BEX A;  4BRA A;  3V9X A;  4FZZ A;  3HYF A;  2Z1J A;  4BRL A;  4M7X A;  5ADX H;  1X9S A;  3D7E O;  4Y1D A;  4M63 C;  4DV5 K;  5AFU A;  5KPR A;  3SBT A;  3ZSX A;  1T6D A;  1R59 O;  3WXM B;  4FLZ A;  1GOB A;  4FJG A;  1FKP A;  1JLQ A;  3SUO A;  1XQS C;  3ENO A;  4KTZ A;  2RE2 A;  3NGZ A;  3CXC M;  3S3M A;  4BY9 C;  1S3X A;  4WFB L;  4CGD A;  3K9K A;  4B1U B;  2O8C A;  3DWL A;  3ZSO A;  3CJ9 A;  2HHT A;  1CXU A;  3QIP A;  5EU7 A;  1D5A A;  3AA5 X;  1VRU A;  4EP5 A;  4H5W A;  5C2F A;  3A5M C;  3AVC A;  4FJ8 A;  1RTH A;  2VYP A;  4CBU A;  1VSJ A;  4RTF D;  1XUP O;  1ZC6 A;  4B9N A;  3ZX0 A;  1QVG M;  4E1M A;  1NJX A;  3U8X A;  3UKU B;  1RT2 A;  1YUW A;  3OJU A;  3QBW A;  2GTD A;  4IJN A;  4IDK A;  4JI0 K;  5D3G A;  3FZL A;  4LF5 K;  5AQH A;  4XH1 A;  2E5L K;  5FPD A;  5AQK A;  3GBT A;  1TKZ A;  3SQ1 A;  1QS4 A;  3SJJ A;  2RN2 A;  4CEA A;  4CZK A;  1L3S A;  3RRG A;  4I6M B;  4N47 A;  3U9D A;  3FZM A;  1EQY A;  4K8X A;  1N34 K;  1EET A;  4EAH D;  2Z1H A;  4L8R B;  1JLB A;  1G15 A;  4BRC A;  1HKC A;  1YTA A;  2X78 A;  3EEQ A;  4PY5 A;  4MFB A;  4CEC A;  3I8B A;  3LAN A;  2DFE A;  5EY4 A;  3M8S A;  4FJH A;  4CJS A;  1RT5 A;  5EOY A;  5CZ1 A;  2YKN A;  2BUP A;  3VEY A;  3MEE A;  1TK8 A;  5E26 A;  1BCO A;  5HL7 L;  3KLG A;  1ZYQ A;  3PO4 A;  1NK7 A;  2FXU A;  2ZM6 K;  3VQB A;  2B6A A;  3Q7B A;  5LL6 Z;  4CJL A;  4B3R K;  3CFO A;  4H5V A;  2G8V A;  1CLQ A;  4B8C A;  1NKB A;  1KSP A;  3K59 A;  2IOC A;  2RF2 A;  4CJ5 A;  4TSX A;  1QZ6 A;  4MLE A;  3TAF A;  4KHN A;  1Y97 A;  3HXM A;  2NRH A;  3SBG A;  2NRR A;  4EIA A;  4AHS A;  3VGK A;  2CH6 A;  3E66 A;  3KKR A;  1P8Z A;  1DLO A;  3T19 A;  3UB5 A;  4BDP A;  1X9M A;  3KZB A;  3DM2 A;  2QWO A;  1DEJ A;  1WSF A;  2NRV A;  3BZK A;  5MLC Q;  5C10 A;  1T3V A;  1EWQ A;  4NB4 A;  4KRF A;  1OH8 A;  1TKT A;  3DAW A;  3TSU A;  5K14 A;  4F9O A;  4JRQ A;  3SUQ A;  4FO0 A;  2IAJ A;  4NLB A;  3TTC A;  2D0P A;  4ISE A;  3G4S N;  4NXN K;  4CD3 A;  4F4K A;  2WC9 A;  1JCG A;  1H1V A;  4FM0 A;  2O8C B;  4QOZ B;  3IDH A;  1WSJ A;  1U2V A;  4AM6 A;  3NF8 A;  5BPL A;  4IFV A;  3L2U A;  2V51 B;  3DYA A;  3DRP A;  2WTU A;  3WNG A;  3D0P A;  4KAZ A;  5JLF A;  1YJ9 N;  1KAZ A;  3MN5 A;  2OZS A;  3WXL A;  4FJX A;  2YHY A;  3KK3 A;  4B8A B;  4CHP A;  3T69 A;  4C1N I;  4ZHR A;  3PX0 A;  4JKA A;  3C6H A;  1KVA A;  3C7N B;  3SV3 A;  4JAX A;  1M1K O;  2FSK A;  4HCB A;  4K43 A;  1NM1 A;  1NNE A;  3QES A;  3THY A;  3WEE B;  2F8T A;  1HJO A;  4CK1 A;  3VEW A;  5BN9 A;  3K5M A;  3EZW A;  3SLC A;  1NGB A;  4F3O A;  3TI0 A;  4CF0 A;  4ILH A;  4IO9 L;  1N6Q A;  2RKI A;  1K8K A;  4KI6 A;  3VEO A;  1KFD A;  1K6Y A;  3EN9 A;  1XNR K;  3RTV A;  2HBL A;  3AA3 A;  3CCE N;  2VGN A;  3WT0 A;  1KRP A;  4DR3 K;  1T44 A;  5DM6 L;  4FWR A;  1U2V B;  3CFR A;  3RR8 A;  4IKF A;  3CFP A;  1NGD A;  4LC9 B;  4CGH A;  1I94 K;  2P9U B;  2FBX A;  3C6T A;  4OGC A;  4A61 A;  2V7Y A;  1TL1 A;  5EXW A;  3SMP A;  3WXJ A;  4JS4 A;  3IUC A;  4JLH A;  1Q9X A;  4QAG A;  1TV6 A;  2ITG A;  4JN4 A;  3QO9 A;  1U47 A;  3DOK A;  1LAV A;  3E9P A;  4E7K A;  3I55 N;  4DB3 A;  2ZD1 A;  2YV0 X;  5J2M A;  5EVZ A;  1HKB A;  3JSM A;  4DUY K;  5AQW A;  3QEX A;  5CYQ A;  4OPK A;  2VWB A;  5FRO A;  5AQU A;  3AAP A;  3SCX A;  2FLO A;  3NBP A;  1K9M O;  1IBK K;  1EWR A;  5AFU H;  5GAD P;  3TAN A;  3SQ0 A;  5ADX A;  2HND A;  1VAZ A;  4C8K A;  4JKB A;  1RIL A;  4Z0U A;  1XI1 A;  2P9U A;  3ALY A;  3NH2 A;  5ELZ A;  4CGG A;  2W40 A;  1LW2 A;  4BG8 A;  5HLF A;  1BA1 A;  4ILG B;  1HR0 K;  4FVU A;  4F2S A;  4CZE A;  5CY4 A;  3NVK A;  3OYC A;  5KRS A;  5HP1 A;  3GOI A;  3D45 A;  2Q3S A;  3RSE B;  3LDS A;  2HNZ A;  3H3N O;  2VWJ A;  4DR4 K;  4WQ5 C;  2GV9 A;  4BDY A;  2GEL A;  3V9U A;  1QSS A;  3ENB A;  4YHH K;  3VEV A;  1JL2 A;  4IOC L;  2YNF A;  3PIO L;  1VSK A;  4ID5 A;  1BIS A;  3MN6 A;  4IBN A;  3TWH A;  3SZ2 A;  2WUS A;  3S41 A;  1XHX A;  1X9W A;  3K5L A;  2QWP A;  4H03 B;  1KQS M;  1A5V A;  3KLE A;  3J81 O;  3SJH A;  1VSL A;  5AQX A;  2P9L A;  3OVN A;  4GV3 A;  4DHY A;  4X62 K;  4KTW A;  1YIT N;  2E2Q A;  4E7L A;  4MDB A;  2VQF K;  1UOC A;  2DFH A;  3HP9 A;  4FJ9 A;  4FWN A;  1X3N A;  3AY9 A;  3VF4 A;  3K57 A;  4DSL A;  4CF8 A;  2IGI A;  3K9J A;  3LM9 A;  5AQO A;  1CZB A;  1HQU A;  3AVA A;  1OKJ A;  1BIZ A;  3M6G A;  3HM9 A;  1YAG A;  5C25 A;  4A2B A;  3L4Q A;  2CH5 A;  1CZ9 A;  1KVC A;  4CJV A;  3OBY A;  4FWS A;  4J2B A;  1XNQ K;  1C0T A;  1YVU A;  2LSN A;  4O0J A;  2ATQ A;  4I2Q A;  4KV8 A;  4M42 A;  1NGJ A;  3U3G A;  4JK8 A;  4WQ4 A;  4O8U A;  1C6V A;  1TYQ A;  4JHD B;  4BRK A;  2E88 A;  1JCF A;  4DS5 A;  5C15 A;  4ZTF A;  1SZ2 A;  4YNQ A;  4HWI A;  4FSV A;  3TSQ A;  1P90 A;  4PKH A;  4R5P A;  4OPJ A;  3OS2 A;  4U7B A;  1ZBI A;  3ZEU A;  1HKG A;  4CD1 A;  2F7T A;  1S6P A;  3PIP L;  1IG9 A;  4UY8 O;  1NOY A;  2XY7 A;  5J2N A;  3KLI A;  4AHR A;  3TAP A;  4A5A A;  1L5U A;  3CF5 L;  5LMU K;  4DG1 A;  4EHT A;  2KKZ A;  1RDC A;  2OZM A;  3DRS A;  3KHY A;  4FXD A;  4BE1 A;  2KTQ A;  3HPO A;  4KHP K;  1DGK N;  3O9S A;  1VSF A;  1Q81 O;  1HNX K;  3DXM A;  4JHD A;  3OTO K;  3FR0 A;  2D1K A;  1D8Y A;  1O1W A;  2D0B A;  4DTS A;  4H4O A;  3AVM A;  3LL3 A;  3CCQ N;  2ASM A;  1GLE G;  2QW9 A;  4WQ4 C;  3TU5 A;  2PYL A;  2WON A;  4J8F A;  4BRD A;  4CED A;  2UXD K;  3VER A;  4FK0 A;  1LV5 A;  3RRH A;  3OA9 A;  2XY8 A;  1J53 A;  3MN9 A;  1WAJ A;  1HYV A;  1N36 K;  5HRO A;  5M1Q A;  1HX1 A;  4CF9 A;  2EWS A;  3T7Z A;  1HQE A;  3E9L A;  3SPY A;  4KH5 A;  1YHQ N;  3CD6 N;  2P5G A;  4RW8 A;  4CCH A;  3CM5 A;  2WOM A;  1ATS A;  2RHK A;  1TK0 A;  4FJL A;  2O8D A;  3AVN A;  4KHQ A;  2E6M A;  4QCL A;  1Z6R A;  1GOC A;  4CJT A;  3IRX A;  4BR5 A;  4LF6 K;  4I7F A;  1YJW N;  4NO7 A;  2UUA K;  4FJ7 A;  2KLA A;  3O08 A;  1KAX A;  5LMN K;  4JKG A;  4IEI A;  3W0L A;  4B1Y B;  1LCU A;  1VSH A;  3OYJ A;  2PFU A;  2V7Z A;  2I5J A;  4WE1 A;  3NF6 A;  2HF4 A;  4KB1 A;  1W2B M;  2A41 A;  1BI4 B;  5I3U A;  1ASU A;  2Q0U A;  2HB5 A;  1BWF O;  1S22 A;  5A2Q O;  2UXB K;  2YI1 A;  3FGU A;  4E7H A;  2QK9 A;  3THW B;  2O8F A;  3SPZ A;  1B9F A;  5CZ2 A;  3V9S A;  3QB0 A;  1IH7 A;  2PBD A;  3AV9 A;  4BRM A;  5AR0 A;  3NHG A;  3ZT1 A;  1KLN A;  4QS9 A;  3QET A;  2JWK A;  3ZSW A;  1NJI O;  5C24 A;  3HZ6 A;  3MXI A;  1SL1 A;  2GWK A;  1VQK N;  3O80 A;  4UQG A;  4LD0 A;  2DFF A;  1RGI A;  4BRF A;  3SYZ A;  1BQM A;  4CVN E;  3CME N;  5IWA K;  1C1C A;  2NRX A;  3FZH A;  5HBM A;  4DFK A;  2HHV A;  1XC3 A;  3CJA A;  2O8E B;  3MX5 A;  3ZCM A;  5M1F A;  5FPE A;  1DT9 A;  4FLV A;  1SL0 A;  5GAE P;  4Z4G A;  1ZBS A;  2BAN A;  2JLE A;  4BGB A;  4O8K A;  5FRN A;  1HRH A;  1RTI A;  4IOX A;  3AA2 A;  4DSE A;  4FLU A;  4BAC A;  1GLD G;  2YHB A;  4RG8 A;  4K42 A;  4H0X B;  1WN7 A;  2G8F A;  2KHO A;  1I39 A;  3SQ2 A;  4PKG A;  1GLB G;  1RDW X;  2G8U A;  2NLX A;  3SUP A;  4JI5 K;  2ZGZ A;  3SV4 A;  3VQA A;  4M45 A;  2NRZ A;  4DU1 A;  1KTQ A;  3OYF A;  2Y1J A;  3P31 A;  1TL3 A;  3G6E N;  3VPZ A;  2DY4 A;  1N32 K;  3O3G A;  2PY5 A;  1FK9 A;  1HUX A;  4DKW A;  5HOO A;  3THY B;  1NK0 A;  4DTJ A;  3I0R A;  2HST A;  3PV8 A;  1QSL A;  2F96 A;  4WFA L;  4JI1 K;  2P9K A;  4JS5 A;  4CEO A;  4CHQ A;  4B9U A;  3SQ4 A;  4XH4 A;  1JLC A;  3THX B;  4L3Q A;  2ZGY A;  5M1O A;  4DQR A;  1XC9 A;  1IKX A;  4DV1 K;  4CJF A;  1LWF A;  3I0S A;  5KRT A;  4Z4E A;  2J4R A;  1VSD A;  2ZJP L;  4H0O A;  1NWK A;  4CJP A;  1S9E A;  1NGI A;  4CEE A;  2P9L B;  2ZJQ L;  1EO1 A;  1IKY A;  4M41 A;  3PO5 A;  5GIP A;  2A5X A;  4IFY A;  1RT1 A;  4DV4 K;  4BR2 A;  2O8B B;  4NCG A;  4OVL A;  4Y0W A;  3ZSY A;  4O5B A;  1BDG A;  5BPM A;  3KKS A;  2OPR A;  3AO3 A;  4CZJ A;  1S1V A;  3C94 A;  3CMA N;  3K58 A;  5JVG L;  5B8H A;  1ILY A;  3NF9 A;  1NJZ A;  1BG3 A;  4N76 A;  3OW2 M;  4U67 L;  2YJF A;  2HVH A;  1NBW A;  3H45 C;  4B08 A;  4JKF A;  4H5R A;  3V6D A;  4J2E A;  3AGR A;  4EP4 A;  3O1W A;  3L2W A;  3D2E A;  2F4V K;  4CHN A;  1L3T A;  3T1Y K;  3S9H A;  1D9D A;  4CGJ A;  2W42 A;  3BF3 A;  1I3A A;  2EHG A;  5BRF A;  3O3H A;  1KAY A;  3VQQ A;  2VG5 A;  5JVH L;  3C95 A;  4E1N A;  3M8R A;  1IBL K;  3LWM A;  2FF6 A;  4B1Z A;  3KIO A;  3H1V X;  3VGM A;  4DR2 K;  2H3G X;  2B5J A;  2GUI A;  4F3T A;  1BUP A;  4CI6 A;  1VQP N;  1UA0 A;  3ZEU B;  1BU6 O;  4FCY A;  1ZBL A;  3E1Y A;  1WBB A;  4YOT A;  2YNI A;  2PYJ A;  5KI6 A;  3VA3 A;  4PHT X;  4FWM A;  4CZG A;  3CC2 N;  4NLC A;  4HCC A;  3DLG A;  4BR4 A;  4CBX A;  5JIC A;  3GG4 A;  1NJW A;  1LW0 A;  3QNO A;  5KQD A;  4JI7 K;  1KXP A;  4LF8 K;  3ZSZ A;  3DOL A;  1RBV A;  1E4F T;  3O4Q A;  3F2K A;  2HBK A;  4CZM A;  5AQI A;  1WUA A;  3OS0 A;  1VHX A;  4OKK A;  3QDK A;  4LSN A;  4CES A;  2E8A A;  5DM7 L;  2CGL A;  4A2A A;  4W5N A;  1KD1 O;  5GIN A;  3NVM A;  3L0Q A;  1RT6 A;  3LAM A;  2X6N A;  2ZE2 A;  3PUF A;  3CC4 N;  1QHA A;  4IO8 A;  3BDP A;  3A5O C;  3R8E A;  1VQO N;  1YT3 A;  3UKR A;  3TAB A;  4RW4 A;  4LH4 A;  1SL2 A;  1WAF A;  3ZSR A;  1WSH A;  2QKB A;  1S1X A;  3AO2 A;  2IS3 A;  3MDQ A;  3CCU N;  2UXC K;  5DMR A;  4WCE L;  1QQM A;  4WQ5 A;  2DTU A;  1TKX A;  4YOW A;  2VG7 A;  2V52 B;  4JI6 K;  4IDH A;  4Q5V A;  3SK3 A;  1VQ9 N;  4BR7 A;  1BI4 A;  1TAU A;  5SWM A;  3L3V A;  2P9P A;  4XIU A;  4GMJ B;  2ZJR L;  5J2P A;  4B3T K;  2YHW A;  5AZI B;  2O8D B;  2G8I A;  1T6C A;  4WYB A;  1YXQ A;  2NRW A;  2YNG A;  2W41 A;  3C65 A;  1HPZ A;  1B9D A;  1RT7 A;  1VRT A;  1RT4 A;  2HMP A;  1Q86 O;  2YJE A;  4FWP A;  4C8M A;  3ZX2 A;  3O9T A;  3CPE A;  4AHU A;  2D0C A;  3R6M A;  1U45 A;  3O9R A;  3O9U A;  4BWM A;  3KWI A;  4W5Q A;  4E19 A;  5BRE A;  4G9Z A;  3HPH A;  3ITH A;  1BHL A;  2DPN A;  3V9Z A;  1RBR A;  4CGF A;  4H4M A;  1QSY A;  3CET A;  4Y1C A;  2HVI A;  5JMV A;  3H1Q A;  4JI3 K;  4DSJ A;  4CHO A;  1NJY A;  2F9W A;  4LFC K;  2KZZ A;  3V1R A;  3B6O A;  3ID6 A;  3VF2 A;  3AAR A;  1ZBH A;  2GEM A;  3CI5 A;  1FW6 A;  3O6W A;  3AVL A;  2Q31 A;  1NGC A;  4FWL A;  3CER A;  1GOA A;  1SKR A;  1X1P A;  1C0U A;  4CK2 A;  4AQY K;  1FKO A;  2OPS A;  4YOV A;  1N8R O;  3FE1 A;  4DF8 A;  1QTM A;  2IVO A;  1JLF A;  1RDB A;  1RTD A;  1TVR A;  2O4I A;  3E9O A;  4JD2 B;  4NCA A;  4OPA A;  3BF1 A;  1S9G A;  2AA4 A;  2IC3 A;  4CGI A;  3ZET A;  3L4I A;  3L8B A;  4F2R A;  4MDA A;  4HVJ A;  4B9M A;  3KVG A;  4JI2 K;  5HRP A;  1Q8I A;  3U4L A;  4BRO A;  4C1N K;  1NGA A;  4RCH A;  4JI4 K;  4BRN A;  4CFA A;  2OAN A;  3J7Y P;  4FM1 A;  1K8A O;  3VTI A;  3LDO A;  3DXK B;  1NG9 A;  3VQ8 A;  4AHV A;  4LH5 A;  4LF7 K;  1BGX T;  3ZLJ A;  4C8L A;  3L2Q A;  1KLM A;  3ZT4 A;  3H6E A;  3T1A A;  3VF6 A;  3CYM A;  1JJ2 M;  2O4G A;  1NOZ A;  1YF5 L;  3HBT A;  1Z25 A;  2OA8 A;  4GNI A;  1SKW A;  2QWM A;  2XHB A;  3EKS A;  2NNW A;  1EXQ A;  4AHC A;  3TTF A;  3JXU A;  4GV9 A;  4K41 A;  3OYI A;  4I2P A;  2CGJ A;  2I7P A;  3HVT A;  3VQ4 A;  4DTU A;  3K0S A;  2OYQ A;  3N4Q A;  4CZI A;  4CFD A;  3MEC A;  4O44 A;  4DQP A;  2OPQ A;  2P1J A;  3OYG A;  4FK2 A;  3H08 A;  1K8K B;  1FJG K;  3V1Q A;  4CF1 A;  3KLH A;  2IVP A;  3HK2 A;  1GLA G;  5IT9 O;  1YVN A;  1VQ5 N;  5LJV A;  3OYL A;  3QLH A;  4DR5 K;  3L2V A;  4DUZ K;  5HRR A;  1U6Z A;  1N33 K;  4EZ6 A;  4E1J A;  1RDD A;  3O1B A;  3AVJ A;  2E20 A;  3TAQ A;  1BQN A;  1A5X A;  3TTD A;  3CJB A;  3MX2 A;  3ZSQ A;  4H0Y B;  3LWL A;  4CJ3 A;  3KD5 E;  1Q9Y A;  1YI2 N;  3P38 A;  3I8D A;  5BRD A;  5KTQ A;  4V19 S;  2ETJ A;  2HBJ A;  4BG9 A;  4M7Y A;  4CER A;  4CJR A;  2UYT A;  4FOE A;  4IG0 A;  3HL8 A;  4M3W A;  1QE1 A;  1HMV A;  3MXM A;  4KO0 A;  3ULD A;  4CE9 A;  4JK7 A;  3V1O A;  2PAV A;  3WQU A;  3CCM N;  3MED A;  4LFB K;  3NGI A;  2HBM A;  3OBW A;  3O9Q A;  2YKM A;  3SAG A;  1WBD A;  1J5O A;  4R79 A;  5AZJ A;  1IJJ A;  1LAW A;  4JEP A;  1WNS A;  1HYS A;  5F2R A;  2HNY A;  1HNI A;  1QQO A;  2Q2R A;  3VQD A;  2NUB A;  2QTD A;  3B8A X;  1BOT O;  5GAG P;  3Q7C A;  1KFS A;  4DWI A;  4OLA A;  4FJI A;  1Z05 A;  4F8R A;  4DV3 K;  3OYK A;  1OH6 A;  4M3X A;  4CZL A;  2UUC K;  2P9N B;  3CJ7 A;  4FZY A;  4J2A A;  1LWE A;  3PSF A;  3CQY A;  5CYM A;  3OYE A;  2E1Y A;  2O8B A;  4OKE A;  4B9L A;  3QFU A;  3WNE A;  1NU0 A;  4C8N A;  4FPB A;  2X74 A;  4K25 A;  4Z4C A;  4DTX A;  4DS4 A;  1XWL A;  3M1F A;  3QFP A;  1EP4 A;  1VQM N;  4E7I A;  1U49 A;  1W0H A;  4DU4 A;  4LFA K;  4RW9 A;  1YTU A;  4K0K K;  4BRG A;  3AVG A;  4JKH A;  5C12 A;  4BC5 A;  1L3V A;  2VCP A;  2EX3 A;  1UA1 A;  4YY3 K;  2GUP A;  2A6A A;  5FPN A;  4FPA A;  4PL7 A;  4E3S A;  4Z94 A;  2Q36 A;  4IEE A;  4CJE A;  2HHH K;  2HHX A;  4B1V A;  1OH5 A;  3GL1 A;  4JRP A;  3VQP A;  1MU2 A;  3LDN A;  2Q1N A;  4DV6 K;  3AVK A;  3LP1 A;  4DV7 K;  4BE2 A;  3NH0 A;  4PL8 A;  4I9Q A;  4CJ4 A;  4FLX A;  4CIG A;  4LY7 A;  2W6L A;  4CZH A;  2FBV A;  3MWT A;  1W9H A;  4H0T B;  1S72 N;  4BRE A;  4JKC A;  3ASM A;  1RTJ A;  3NAE A;  4X65 K;  3THV A;  2HMI A;  4FZX C;  2P9N A;  4KH6 A;  1IBM K;  2KFZ A;  5AQT A;  5JLH A;  4PA1 A;  2XY5 A;  2HHS A;  4JKD A;  2QXL A;  1VSI A;  3RMA A;  1R0A A;  1DKG D;  4DTO A;  3A0I X;  5J2Q A;  3KK1 A;  2GWJ A;  2F9T A;  3DLL L;  3PX6 A;  4CJU A;  4CIF A;  2P5O A;  3TAG A;  2NRT A;  5BR8 K;  4BC4 A;  4B1W B;  4DQQ A;  4E0D A;  1K73 O;  3I33 A;  5BN8 A;  3O3F A;  3O4N A;  4W5T A;  3IKM A;  4H8K A;  3SAF A;  2G8W A;  1JCE A;  4LF9 K;  1ATN A;  4XH5 A;  3V81 A;  2VGM A;  3HO1 A;  4X66 K;  4DTR A;  2KZM A;  5AQF A;  2QM1 A;  1N5Y A;  2QA4 N;  2QWQ A;  3OYM A;  3SNN A;  4WF9 L;  3DLE A;  1C0G A;  4H5N A;  1T05 A;  3FLC O;  3WXK A;  1RDU A;  4OO1 J;  2BDP A;  3THW A;  2O8F B;  2IDO A;  2YHX A;  1NMN A;  4BVO A;  1G99 A;  2R7Y A;  4NYF A;  4DLE A;  1IKV A;  4BRI A;  4EFH A;  3OY9 A;  1DTQ A;  3G25 A;  4BWJ A;  3QER A;  3GDQ A;  3NDK A;  3RVC A;  3LDQ A;  3AA4 A;  3MXJ A;  3P5J A;  4KFB A;  4H0P A;  5GIO A;  2D0A A;  3A2F A;  3AGK A;  3HI0 A;  3KWG A;  2JGU A;  4FWQ A;  2QXF A;  1EX4 A;  3D2E B;  2KQ2 A;  3C0B A;  3K2P A;  1BA0 A;  2UUB K;  1IKW A;  3AVF A;  4CIE A;  1C0F A;  3J7A P;  3TSP A;  3G71 N;  4CF2 A;  3SMS A;  5KGW A;  4B3S K;  4YFU A;  2HHQ A;  1MWK A;  3E01 A;  3O5B A;  3IMX A;  2XY6 A;  4KBO A;  3WNF A;  3MWP A;  5EX5 A;  3OYB A;  3KLF A;  1S5J A;  3RMC A;  4IJA A;  5KPZ A;  4A5B A;  4IFE A;  1RBT A;  3V9W A;  3EZ5 A;  4KHW A;  4GW6 A;  1U04 A;  4DV0 K;  3NH1 A;  4CJK A;  1NGG A;  3AVB A;  1J5E K;  4PWD A;  5AQP A;  3THX A;  5BRH A;  1HNZ K;  3BZC A;  1KCF A;  3KJV A;  4DQS A;  2FBT A;  3O8M A;  3V4I A;  3ZYY X;  3VA0 A;  4M3U A;  3VQ9 A;  3IS9 A;  3KTQ A;  1XMQ K;  2QKK A;  4PUO A;  4DQ8 A;  4AH9 A;  3OHR A;  4ELU A;  1E3M A;  3EL2 A;  2P9K B;  2NZT A;  2ASO A;  3ZX3 A;  4CJQ A;  4JKE A;  3D2F B;  1S1T A;  1X3M A;  1DTT A;  4Z4F A;  3EY1 A;  4FW1 A;  1GLL O;  4O5F A;  1U48 A;  3DXM B;  3CCL N;  5M1N A;  1LOT B;  5C2D A;  2D5R A;  2HHU A;  4BRP A;  3ATU A;  1JLA A;  2QEX N;  2Z1G A;  3ZT0 A;  3JAM O;  4KHY A;  3MK6 A;  4B3M K;  3AAQ A;  4FOI A;  1QHT A;  3T3F A;  3OYN A;  1OVY A;  1SKS A;  3M8Q A;  5BR9 A;  3VQC A;  1YJN N;  3D2F A;  3H3O B;  3LZJ A;  4ZTJ A;  3IFR A;  3G0Z A;  4FWK A;  1BL3 A;  3SI6 A;  3VTH A;  1REV A;  3R1X A;  3A8Y A;  1VQN N;  4YOU A;  3CCV N;  2P9P B;  3LPU A;  3EE8 A;  1S1U A;  1ATR A;  4JV5 K;  3BGR A;  1VSE A;  3ISN C;  4YOX A;  2ITM A;  1KVB A;  4KTQ A;  3CJC A;  5TKY A;  4QS7 A;  2E2N A;  4IWV A;  4BC2 A;  1QVF M;  1QZ5 A;  1RBU A;  3CG7 A;  2P9I A;  4CEF A;  1L3U A;  4JYA K;  4M3T A;  4PKI A;  4HUF A;  4CJW A;  3VQ6 A;  4DTM A;  3VGL A;  4DSF A;  4WFN L;  5JS2 A;  1TUY A;  1NKE A;  3JYT A;  1C1A A;  4JK9 A;  3PSI A;  1ASW A;  2AP1 A;  4CBW A;  5HRS A;  4Q0B A;  3HT3 A;  3FZF A;  5LJW A;  4FJN A;  4LF4 K;  4N41 A;  3OS1 A;  4CEB A;  5BPN A;  4DV2 K;  4BE0 A;  3UKU A;  4OPH A;  4DLG A;  4G1Q A;  2E2P A;  4JNE A;  4DFM A;  1RNH A;  4B3O A;  4E7J A;  4BQL A;  2A40 A;  3LDP A;  2Y1I A;  3NF7 A;  3U6F A;  4FWO A;  3RSE A;  4RWT A;  1ESV A;  4DFJ A;  5AQJ A;  3AO4 A;  2BE2 A;  1C1B A;  3OJS A;  4KH4 A;  4DU3 A;  4CHY A;  3ULE B;  4OKJ A;  5C0Y A;  3VMF B;  4H0V B;  4I6M A;  2HW3 A;  4KHU A;  2F8S A;  3LP3 A;  3A5N C;  5CE3 A;  3FZK A;  4NXM K;  4GVM A;  2E6L A;  3AVH A;  3ZET B;  3HTV A;  3HST B;  2G8H A;  4M3Y A;  4FJK A;  3U3Y A;  1RDA A;  5I9E B;  1UAX A;  3DJC A;  4CFC A;  5FRM A;  4FYD A;  3QIN A;  3DLB A;  2YNH A;  3CPW M;  1TKD A;  1U4B A;  4AHT A;  4O55 A;  1NGH A;  1VQ4 N;  4BVP A;  2UU9 K;  2X6S A;  4M3Z A;  2QWL A;  5E41 A;  4A59 A;  1A5W A;  3LDL A;  1HNV A;  4FL9 A;  3BY5 A;  4FM2 A;  3LP2 A;  1VQL N;  4ELV A;  4CEQ A;  2O8E A;  3BUZ B;  4C23 A;  2OTJ N;  1JLG A;  1WSG A;  5C42 A;  2Q0R A;  4BQZ A;  2VWK A;  3P1G A;  3AO5 A;  2ASP A;  4ISF A;  3SUN A;  3QIC A;  1NGF A;  4B9V A;  5AQL A;  1ZXO A;  1T03 A;  3CHW A;  4RW7 A;  3R3L A;  3K5N A;  2VQE K;  3OYH A;  1JXE A;  3DLK A;  3C6U A;  1ZBU A;  1GLJ O;  1RFQ A;  2GX9 A;  4Z4H A;  4ELT A;  1VQ6 N;  1FXX A;  3CM6 A;  1X9J A;  4K8Z A;  4EHU A;  3I56 N;  1HJR A;  1QQC A;  3VES A;  3VEN A;  4DCH A;  4DTP A;  3ID8 A;  3TAE A;  4KRE A;  2FBY A;  2D4W A;  5AQY A;  4BR0 A;  2ZF5 O;  4HUE A;  4IXC A;  5AQQ A;  3ZT2 A;  2YX6 A;  1C0M A;  5AQR A;  3VQ7 A;  3M5R A;  1HNW K;  4JKG B;  3EO3 A;  1NMD A;  4OGE A;  1JKH A;  3JS6 A;  5JS1 A;  4B1X B;  1F21 A;  1SV5 A;  3PX4 A;  4MQ3 A;  4OJR A;  4DR6 K;  3QEV A;  4JD2 A;  3VOV A;  2ZQB A;  3HJF A;  2YCH A;  1HLU A;  2FC0 A;  3HOT A;  4Z4I A;  5T7B A;  5FLX O;  1WOQ A;  1J9A A;  2VG6 A;  4FJJ A;  4CW7 B;  3CCR N;  3LPT A;  5AJ3 K;  3VET A;  3S3O A;  5AQG A;  5AZJ B;  3WEE A;  1V4S A;  1WSI A;  3CIP A;  4CFB A;  4B9Q A;  1KC8 O;  4DQI A;  1O13 A;  1VK0 A;  4NYN A;  4E89 A;  1ITG A;  3QEW A;  3QEI A;  1NK6 A;  3FFI A;  3AVI A;  3ZSV A;  3IAY A;  2QWR A;  4RW6 A;  4PQU A;  4X64 K;  2WBN A;  4DFP A;  1SAZ A;  1NGE A;  2FF3 B;  1B92 A;  1SQK A;  5F1X A;  5KGX A;  4HHT A;  1LWC A;  4AM7 A;  3TPQ A;  2RPI A;  3A5L C; 
#chains in the Genus database with same CATH homology
 3NF8 A;  1JLC A;  4E3S A;  4DQR A;  4CJE A;  1XC9 A;  1IKX A;  4C8O A;  4IFV A;  4CJF A;  1LWF A;  4FW2 A;  3L2U A;  3DLR A;  3I0S A;  3DYA A;  5KRT A;  4Z4E A;  2HHX A;  1VSD A;  3DRP A;  4JRP A;  4CJP A;  4KAZ A;  3WNG A;  1S9E A;  3VQP A;  5FDL A;  3D0P A;  4KB0 A;  1MU2 A;  4CEE A;  4CEZ A;  2OZS A;  3AVK A;  3LP1 A;  1IKY A;  4M41 A;  3S3N A;  3PO5 A;  4FJX A;  1JXB A;  4BE2 A;  4IFY A;  3NH0 A;  1RT1 A;  5J1E A;  3KK3 A;  4I9Q A;  4CJ4 A;  4B8A B;  4CHP A;  4FLX A;  4CIG A;  4NCG A;  4OVL A;  3DLH A;  3PX0 A;  4LY7 A;  3M8P A;  4ZHR A;  1Z26 A;  3RMB A;  3EYZ A;  1KVA A;  2FBV A;  3ZSY A;  2YHA A;  3SV3 A;  4KHQ A;  4O5B A;  1W9H A;  4HCB A;  3KKS A;  4ID1 A;  3ASM A;  1RTJ A;  3NAE A;  3QES A;  2OPR A;  3AO3 A;  3THV A;  2HMI A;  3DMJ A;  1S1V A;  3C94 A;  3PY8 A;  4FZX C;  2F8T A;  2KFZ A;  4CK1 A;  2BGG A;  3K5M A;  3K58 A;  2XY5 A;  4PA1 A;  4F3O A;  3NF9 A;  3MEG A;  2HHS A;  1NJZ A;  3TI0 A;  4N76 A;  4CF0 A;  4KHS A;  3UIQ A;  1ASV A;  3ZT3 A;  1N6Q A;  2HVH A;  1VSI A;  2RKI A;  4W5O A;  3RMA A;  1R0A A;  4KI6 A;  4DTO A;  1KFD A;  4B08 A;  1K6Y A;  3KK1 A;  5J2Q A;  4B9S A;  3PX6 A;  3V6D A;  4CJU A;  3AO1 A;  4CIF A;  4O4G A;  3RTV A;  2P5O A;  4J2E A;  4EP4 A;  5SZT A;  3TAG A;  3L2W A;  4CHN A;  1L3T A;  3KD1 E;  1NK9 A;  3AA3 A;  3VQE A;  4DQQ A;  3S9H A;  1D9D A;  4CGJ A;  4E0D A;  3O3F A;  2W42 A;  4OLB A;  3O4N A;  4W5T A;  1KRP A;  4H8K A;  3HP6 A;  4KPY A;  3CFR A;  2G8W A;  5HRN A;  1I3A A;  3RR8 A;  4IKF A;  3CFP A;  2EHG A;  2KFN A;  3V81 A;  3HO1 A;  4DTR A;  3O3H A;  3VQQ A;  4CGH A;  2KZM A;  2VG5 A;  3MAQ A;  1N5Y A;  2FBX A;  3C6T A;  3C95 A;  4E1N A;  3TAR A;  3M8R A;  4OGC A;  3VQ5 A;  1TL1 A;  3OYM A;  3F73 A;  3LWM A;  3KIO A;  3L2R A;  3SNN A;  4B9T A;  4JS4 A;  4JLH A;  3DLE A;  1TGO A;  1VSM A;  2B5J A;  2GUI A;  4QAG A;  1Q9X A;  4F3T A;  1XHZ A;  1TV6 A;  2ITG A;  1T05 A;  1UA0 A;  3QO9 A;  4FCY A;  1U47 A;  3DOK A;  3LAK A;  3CQ8 A;  2BDP A;  4FLW A;  1LAV A;  1ZBL A;  4ICL A;  2IDO A;  1RCH A;  4E7K A;  2YNI A;  2ZD1 A;  2PYJ A;  1S6Q A;  5KI6 A;  4NYF A;  2YV0 X;  4CK3 A;  3HVR A;  1IKV A;  2R7Y A;  4DLE A;  3OY9 A;  3NCI A;  1DTQ A;  5J2M A;  2HHW A;  4BWJ A;  3QER A;  4HCC A;  3DLG A;  3JSM A;  3NDK A;  1NJW A;  1LW0 A;  3QNO A;  3QEX A;  3LZI A;  5CYQ A;  3ZSZ A;  3AA4 A;  3DOL A;  1RBV A;  3MXJ A;  3WNH A;  3O4Q A;  3P5J A;  4OPK A;  4HTU A;  4KFB A;  3TR8 A;  2D0A A;  3A2F A;  3OS0 A;  5FRO A;  3SCX A;  4HUG A;  3NBP A;  4OKK A;  2JGU A;  4LSN A;  4CES A;  4DTN A;  3TAN A;  3SQ0 A;  2P51 A;  2HND A;  4C8K A;  2QXF A;  1EX4 A;  3QIO A;  3RR7 A;  1J54 A;  4W5N A;  2GBZ A;  1RIL A;  3LAL A;  4Z0U A;  2KQ2 A;  3K2P A;  1XI1 A;  3ALY A;  3NH2 A;  1D9F A;  2XRI A;  4CGG A;  2G8K A;  1LW2 A;  1RT6 A;  1IKW A;  3LAM A;  2X6N A;  3AVF A;  2ZE2 A;  4N5S A;  1JL1 A;  5HLF A;  3PUF A;  4CIE A;  1TK5 A;  3BDP A;  4CF2 A;  5KGW A;  4F2S A;  1YT3 A;  3OYA A;  4YFU A;  3TAB A;  2HHQ A;  3E01 A;  4RW4 A;  5CY4 A;  3OYC A;  3WNF A;  2XY6 A;  4LH4 A;  5KRS A;  1WAF A;  1SL2 A;  3OYB A;  3KLF A;  3ZSR A;  5HP1 A;  1WSH A;  1S5J A;  1S1X A;  3AO2 A;  2IS3 A;  3RMC A;  2QKB A;  3D45 A;  2Q3S A;  5DMR A;  3LDS A;  3NE6 A;  3DRR A;  3KK2 A;  2HNZ A;  2VWJ A;  1NK4 A;  2GV9 A;  4BDY A;  4NCB A;  2DTU A;  4DSI A;  1TKX A;  1RBT A;  3V9W A;  2VG7 A;  3V9U A;  1QSS A;  3EZ5 A;  4LSL A;  3QNN A;  4KHW A;  1JL2 A;  4GW6 A;  2YNF A;  4Q5V A;  1VSK A;  3VN5 A;  4FJ5 A;  4ID5 A;  1U04 A;  1BI4 A;  3NH1 A;  1TAU A;  4CJK A;  1BIS A;  3TWH A;  4IBN A;  5SWM A;  3K5O A;  4KKO A;  3L3V A;  3SZ2 A;  4XIU A;  4GMJ B;  3AVB A;  5J2P A;  4DSK A;  1XHX A;  1NK5 A;  4PWD A;  1WSE A;  1IO2 A;  3K5L A;  1X9W A;  2G8I A;  2OPP A;  1KCF A;  2B4J A;  1BIU A;  3KJV A;  4DQS A;  2FBT A;  1A5V A;  2XO7 A;  3KLE A;  3V4I A;  2YNG A;  1VSL A;  3VA0 A;  3VQ9 A;  4M3U A;  1BCM A;  1HPZ A;  3IS9 A;  1B9D A;  3KTQ A;  1RT7 A;  1VRT A;  1RT4 A;  2QKK A;  3OVN A;  1RT3 A;  4KTW A;  4PUO A;  4ELU A;  4AH9 A;  4E7L A;  4C8M A;  3P83 D;  4AIL C;  4DF4 A;  1WLJ A;  4W5R A;  4AHU A;  1UOC A;  2D0C A;  1U45 A;  4CJQ A;  2DFH A;  3HP9 A;  4FJ9 A;  1S1T A;  4FLY A;  1NK8 A;  1DTT A;  3K57 A;  3EY1 A;  4Z4F A;  4FW1 A;  4DSL A;  3LP0 A;  4I9L A;  4BWM A;  1U48 A;  4CF8 A;  2IGI A;  1UWB A;  4W5Q A;  4FJM A;  4E19 A;  1CZB A;  4CHZ A;  3HPH A;  3AVA A;  1HQU A;  3ITH A;  1BIZ A;  1BHL A;  3HM9 A;  5C25 A;  3IG1 A;  3V9Z A;  1RBR A;  4CGF A;  4H4M A;  3G10 A;  1QSY A;  1SUQ A;  1CZ9 A;  1KVC A;  4Y1C A;  2D5R A;  4CJV A;  5I42 A;  2HVI A;  1ZBF A;  4J2B A;  3L3U A;  1C0T A;  1YVU A;  4N56 A;  2HHU A;  4DSJ A;  4CHO A;  1NJY A;  2LSN A;  1JLA A;  4O0J A;  2ATQ A;  2KZZ A;  4I2Q A;  3B6P A;  4KV8 A;  3V1R A;  3B6O A;  4M42 A;  3NFA A;  4BDZ A;  3U3G A;  2Z1G A;  3ZT0 A;  5DK5 A;  1ZBH A;  4KHY A;  2PZS A;  1C6V A;  3AVL A;  1QHT A;  1JLE A;  4DS5 A;  3T3F A;  3OYN A;  3TAM A;  1SKS A;  3M8Q A;  1HYZ A;  4ZTF A;  2A1S A;  3VQC A;  1GOA A;  1SKR A;  3LZJ A;  4YNQ A;  1X1P A;  1C0U A;  4ZTJ A;  3G0Z A;  4CK2 A;  4FVM A;  1FKO A;  1BL3 A;  2OPS A;  4J2D A;  3SI6 A;  3NGY A;  4O0I A;  1REV A;  3QEP A;  2E4L A;  2Z1I A;  3F9K A;  4R5P A;  4OPJ A;  2KW4 A;  3DI6 A;  3OS2 A;  4DF8 A;  1QTM A;  1EKE A;  1JLF A;  1ZBI A;  1RDB A;  3LPU A;  1S1U A;  1TVR A;  4DMN A;  1RTD A;  1S6P A;  4FK4 A;  2O4I A;  3BGR A;  1VSE A;  1IG9 A;  3ISN C;  1S1W A;  1NOY A;  2XY7 A;  1RBS A;  1KVB A;  4KTQ A;  5J2N A;  4KI4 A;  1T8E A;  3RMD A;  3KLI A;  1TAQ A;  4AHR A;  3TAP A;  4IG3 A;  4NCA A;  1L5U A;  1RBU A;  4FLT A;  1S9G A;  4DG1 A;  2AJQ A;  2IC3 A;  3CG7 A;  2A1R A;  4CEF A;  1L3U A;  4CGI A;  3L8B A;  1RDC A;  2OZM A;  4HVJ A;  4B9M A;  4F2R A;  4M3T A;  3DRS A;  4HUF A;  1T7P A;  4FXD A;  4CJW A;  5HRP A;  1Q8I A;  4BE1 A;  3VQ6 A;  4DTM A;  2KTQ A;  3HPO A;  3OYD A;  3RWU A;  4DSF A;  3HPG A;  4M3R A;  4CFA A;  4FM1 A;  1VSF A;  1CXQ A;  1NKC A;  5JS2 A;  3V9X A;  1NKE A;  4FZZ A;  3HYF A;  2Z1J A;  3JYT A;  3VQ8 A;  4AHV A;  1C1A A;  4LH5 A;  1ASW A;  5HRS A;  1D8Y A;  1X9S A;  4Q0B A;  1BGX T;  1O1W A;  2D0B A;  4Y1D A;  3HT3 A;  4DTS A;  4FJN A;  4N41 A;  3OS1 A;  4CEB A;  4H4O A;  3AVM A;  4BE0 A;  3ZSX A;  4C8L A;  3L2Q A;  1KLM A;  3ZT4 A;  4DLG A;  3T1A A;  4G1Q A;  4DFM A;  4FLZ A;  3CYM A;  1RNH A;  2PYL A;  2WON A;  4CED A;  4E7J A;  4B3O A;  2O4G A;  1NOZ A;  1GOB A;  4FJG A;  4FK0 A;  1FKP A;  1JLQ A;  3NF7 A;  3U6F A;  2Y1I A;  3SUO A;  4KTZ A;  3NGZ A;  1LV5 A;  1Z25 A;  3S3M A;  3RRH A;  4CGD A;  2OA8 A;  1SKW A;  2XHB A;  4DFJ A;  2XY8 A;  1J53 A;  3AO4 A;  2BE2 A;  1C1B A;  1WAJ A;  1HYV A;  1EXQ A;  3ZSO A;  3OJS A;  5HRO A;  4AHC A;  4DU3 A;  2HHT A;  1CXU A;  3QIP A;  4CF9 A;  3SPY A;  1HQE A;  3OYI A;  4CHY A;  5EU7 A;  4I2P A;  1D5A A;  3AA5 X;  1VRU A;  4OKJ A;  4EP5 A;  3HVT A;  3AVC A;  3VQ4 A;  2HW3 A;  4DTU A;  2P5G A;  4KHU A;  4RW8 A;  4CCH A;  2OYQ A;  3CM5 A;  2WOM A;  1RTH A;  3LP3 A;  4FJ8 A;  2F8S A;  1VSJ A;  1TK0 A;  4CFD A;  4B9N A;  3MEC A;  4O44 A;  4FJL A;  3AVN A;  4GVM A;  2E6M A;  2E6L A;  4E1M A;  1NJX A;  3AVH A;  1GOC A;  4CJT A;  2OPQ A;  3IRX A;  3HST B;  1RT2 A;  2P1J A;  3OJU A;  3OYG A;  4FK2 A;  3H08 A;  2G8H A;  4FJK A;  4M3Y A;  3U3Y A;  3V1Q A;  4CF1 A;  1RDA A;  4IDK A;  3KLH A;  1UAX A;  4I7F A;  3HK2 A;  4FJ7 A;  4CFC A;  5FRM A;  4FYD A;  3OYL A;  3QIN A;  3QLH A;  5D3G A;  3DLB A;  2YNH A;  1TKD A;  3L2V A;  1U4B A;  1VSH A;  4AHT A;  3OYJ A;  5HRR A;  1TKZ A;  4O55 A;  1QS4 A;  3SQ1 A;  4EZ6 A;  3SJJ A;  2I5J A;  1RDD A;  4WE1 A;  3AVJ A;  3NF6 A;  2RN2 A;  4CEA A;  2X6S A;  4KB1 A;  4M3Z A;  3TAQ A;  1BI4 B;  1BQN A;  5I3U A;  1A5X A;  1L3S A;  1ASU A;  1A5W A;  5E41 A;  3ZSQ A;  1HNV A;  3RRG A;  2HB5 A;  3LWL A;  4FM2 A;  3LP2 A;  4ELV A;  4N47 A;  4CEQ A;  4CJ3 A;  3KD5 E;  1JLG A;  1WSG A;  4K8X A;  1Q9Y A;  1EET A;  5C42 A;  4E7H A;  2QK9 A;  2VWK A;  3I8D A;  3P1G A;  5KTQ A;  3AO5 A;  3SPZ A;  2ETJ A;  1B9F A;  3SUN A;  2Z1H A;  5CZ2 A;  4CER A;  4CJR A;  3V9S A;  4L8R B;  1JLB A;  1G15 A;  1IH7 A;  3HL8 A;  4IG0 A;  3AV9 A;  4B9V A;  1YTA A;  2X78 A;  1QE1 A;  4M3W A;  1HMV A;  4MFB A;  4CEC A;  3NHG A;  3ZT1 A;  3MXM A;  4PY5 A;  3LAN A;  2DFE A;  3M8S A;  1T03 A;  1KLN A;  4QCL A;  4KO0 A;  3QET A;  4FJH A;  3ULD A;  4RW7 A;  4CE9 A;  3V1O A;  4CJS A;  3K5N A;  1RT5 A;  3MED A;  1JXE A;  3DLK A;  3ZSW A;  5C24 A;  3OYH A;  5CZ1 A;  2YKN A;  3C6U A;  3MXI A;  1SL1 A;  3NGI A;  1ZBU A;  3MEE A;  1TK8 A;  4ELT A;  1BCO A;  4Z4H A;  4UQG A;  3KLG A;  4LD0 A;  1FXX A;  2YKM A;  2DFF A;  1ZYQ A;  1NK7 A;  3PO4 A;  3SYZ A;  3CM6 A;  3VQB A;  1BQM A;  2B6A A;  1J5O A;  4K8Z A;  1C1C A;  5HBM A;  1HJR A;  1QQC A;  4DTP A;  1LAW A;  4CJL A;  4DFK A;  1WNS A;  3CFO A;  2G8V A;  1CLQ A;  1HYS A;  2HHV A;  3TAE A;  4B8C A;  4KRE A;  2FBY A;  2HNY A;  1HNI A;  3ZCM A;  1NKB A;  3VQD A;  1KSP A;  4HUE A;  2NUB A;  3ZT2 A;  3K59 A;  2IOC A;  1C0M A;  4FLV A;  3VQ7 A;  2RF2 A;  4TSX A;  4CJ5 A;  4OGE A;  1JKH A;  1SL0 A;  3TAF A;  4KHN A;  1Y97 A;  4Z4G A;  5JS1 A;  1F21 A;  3HXM A;  1SV5 A;  2BAN A;  2JLE A;  3PX4 A;  4MQ3 A;  4OJR A;  1KFS A;  4AHS A;  4EZ9 A;  4DWI A;  1HRH A;  3QEV A;  1RTI A;  5FRN A;  4OLA A;  4FJI A;  3KKR A;  1DLO A;  2ZQB A;  3T19 A;  4BDP A;  3HJF A;  4F8R A;  3AA2 A;  4DSE A;  4FLU A;  1X9M A;  2FC0 A;  3OYK A;  4Z4I A;  4BAC A;  3DM2 A;  4M3X A;  4RG8 A;  2YHB A;  5T7B A;  1WN7 A;  1WSF A;  2G8F A;  4FZY A;  1I39 A;  1J9A A;  2VG6 A;  3SQ2 A;  4FJJ A;  2G8U A;  3LPT A;  3SUP A;  3S3O A;  4J2A A;  1LWE A;  5CYM A;  3OYE A;  3SV4 A;  3VQA A;  4M45 A;  4DU1 A;  1KTQ A;  1WSI A;  3OYF A;  4OKE A;  4CFB A;  2Y1J A;  4B9L A;  3WNE A;  4C8N A;  1TL3 A;  2X74 A;  4Z4C A;  4DTX A;  1TKT A;  4DQI A;  4DS4 A;  4KRF A;  1XWL A;  1VK0 A;  4NYN A;  4E89 A;  2DY4 A;  1ITG A;  3QEW A;  3QEI A;  5K14 A;  4JRQ A;  3O3G A;  3SUQ A;  1NK6 A;  3FFI A;  3AVI A;  1FK9 A;  2IAJ A;  3ZSV A;  2PY5 A;  3IAY A;  1EP4 A;  4RW6 A;  4PQU A;  4E7I A;  1NK0 A;  4DFP A;  4DTJ A;  3I0R A;  1U49 A;  4DQP A;  1W0H A;  4DU4 A;  3VA3 A;  3PV8 A;  1QSL A;  4RW9 A;  1YTU A;  1B92 A;  3AVG A;  2F96 A;  1L3V A;  5KGX A;  4CEO A;  4JS5 A;  4CHQ A;  4HHT A;  4F4K A;  1LWC A;  2EX3 A;  4FM0 A;  4B9U A;  3SQ4 A;  4QOZ B;  2RPI A;  1WSJ A;  1UA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...