1ASVA

Avian sarcoma virus integrase catalytic core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna integration
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title High-resolution structure of the catalytic domain of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Avian sarcoma virus
total genus 49
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1asvA00
2Y1JA 4L8RB 2A1SA 3A2FA 1KTQA 1LW2A 4C8OA 1JL2A 2DFEA 3HPGA 3V9ZA 4O55A 3V9XA 2AJQA 3SUQA 4KI6A 3QETA 3QESA 4FCYA 4IFVA 3LAMA 4RW7A 5HRPA 3QEIA 3KLEA 3VQBA 4KAZA 5J2QA 3C95A 2OPRA 4Z4IA 1N5YA 4CHNA 2WOMA 4LH5A 3HP6A 2XY7A 1JKHA 4BE2A 3KTQA 4CJ5A 4B9SA 3HVTA 3U3GA 1ASVA 3K5LA 4BACA 1TK8A 3TAGA 3KD1E 4FJ9A 3KK1A 3OYIA 3BDPA 3C6UA 3NH2A 1X9SA 1SKSA 2WONA 1ZBIA 1GOBA 4BWJA 4M3WA 1S5JA 1IKXA 1HQUA 2OPSA 3K58A 1U49A 4DSLA 1BIUA 4FXDA 4PWDA 1X1PA 4Y1CA 3OYDA 3ZSZA 2QK9A 4AH9A 1ZBLA 4FM0A 1Y97A 4DTMA 2IC3A 2QKKA 4E7KA 4GW6A 2X6SA 2YNHA 3DLKA 5C42A 3QEVA 4DTOA 2RN2A 1TL1A 3NFAA 4DQRA 1QHTA 1UAXA 1SL0A 4FLWA 4PA1A 4FJMA 5HRSA 4CESA 1ZBFA 5CYQA 2D0AA 3TI0A 3DOKA 3PX0A 2ZQBA 3M8PA 4CHPA 3VQ8A 4ELVA 2XRIA 1JLCA 3WNFA 1TK5A 2ETJA 4FW1A 4YNQA 3LAKA 3OS0A 1JXEA 3VQPA 4FK0A 3WNGA 1KLMA 1TKTA 4K8ZA 1HQEA 3K5NA 1N6QA 4F8RA 4DG1A 1KSPA 2O4IA 3DLBA 2FBYA 3IAYA 2HHVA 1L3SA 2GUIA 5HP1A 3FFIA 1HMVA 2DFHA 4KFBA 4DS4A 3M8SA 3AVLA 3ZT1A 3AO5A 1VSFA 3OJUA 4CIGA 3SPZA 2OA8A 4FW2A 1FXXA 4DTPA 4M3UA 1RBSA 1A5XA 4YFUA 4FZZA 4HUGA 5CYMA 1JLBA 3QEXA 2P1JA 3SQ2A 2HHXA 4AHSA 4W5OA 3PO5A 2DFFA 2IOCA 4HCBA 3EZ5A 3AVMA 3IRXA 3NDKA 3HL8A 1L3VA 4O0IA 1LWCA 4I9LA 3B6PA 4O0JA 3ZCMA 1NJYA 3I0RA 4NCBA 4CJPA 3DOLA 1T7PA 2OYQA 1BGXT 2Z1IA 1HRHA 4WE1A 2KW4A 1RTHA 3TR8A 3NCIA 2KFZA 3B6OA 3QINA 2HNZA 1RT5A 1WAFA 2ZD1A 1QSYA 1TAUA 4O44A 3OYFA 3RMDA 1S1TA 1NJWA 3V1OA 4DQPA 4M45A 4CGFA 4F2SA 4OVLA 3ZSYA 4B3OA 3RRGA 3RMBA 1NJXA 3L3VA 4CEOA 3KKSA 4OJRA 4B9TA 1U47A 4CGDA 1VSDA 1WN7A 3KKRA 3DI6A 1YVUA 5C25A 5KRTA 4B9UA 4FYDA 4KHSA 1NJZA 4FJKA 5DK5A 1JLEA 1QE1A 1UA0A 3S3NA 1SKWA 1DTTA 1HYZA 3AV9A 4KKOA 1D8YA 1DLOA 1RT4A 4CGGA 2HHUA 4ELTA 3AVBA 1EXQA 3AVCA 4IG3A 3PO4A 2XHBA 4I9QA 1I39A 2EX3A 4CHZA 4BDPA 1HNVA 1A5WA 3P83D 5CZ2A 1W0HA 2NUBA 1ZBUA 2Z1HA 4DQQA 1LWEA 3OYAA 3WNHA 2B4JA 1WAJA 4CJWA 3TAPA 4B8CA 4RW6A 3HO1A 1RDCA 4AHVA 4ID5A 2JGUA 1TAQA 2IGIA 2XY8A 4KO0A 4OGEA 4HHTA 1RBTA 3TAMA 4XIUA 4I2QA 1SV5A 4HUFA 4F3TA 1RNHA 4IFYA 3O3GA 3NF8A 3U6FA 4PY5A 4FJIA 2HHWA 3K57A 4Z4FA 4CJRA 4DF4A 3HPOA 1T05A 4HUEA 3RTVA 4KHNA 3KIOA 1C1AA 4DU1A 3PUFA 5JS1A 4CK3A 4M42A 1GOAA 2YNGA 5CZ1A 3ZSXA 1D5AA 2OPQA 3L3UA 3T1AA 5KGWA 3NF7A 3HVRA 5I42A 4DQIA 1VSKA 2X78A 3D45A 1WSFA 4KHWA 1BQNA 4CJTA 3MXMA 5I3UA 3TAFA 5FRNA 1HYSA 3OYKA 3T3FA 3BGRA 2D0BA 4HVJA 1TK0A 3AVAA 1KVBA 1Q8IA 3NF9A 3QIOA 4DLGA 1HNIA 2P5GA 4DQSA 3EYZA 2KQ2A 3AO1A 1VSJA 4JRPA 4ZTJA 3OYEA 2HVHA 1QSSA 4N56A 3HP9A 1WSGA 3OYJA 1Z25A 2YV0X 3LPTA 3QNNA 3SNNA 3D0PA 1X9WA 1NK6A 1VSLA 1JLQA 4Z4GA 4FZXC 3LP1A 2BGGA 4FJLA 4CK1A 4O5BA 2OPPA 2IAJA 3CM6A 1VRUA 4OPKA 4AHCA 4OKJA 4TSXA 1RCHA 5J2NA 4B08A 1SUQA 3AVIA 4DU4A 1JL1A 3NE6A 4W5NA 3VQ6A 4CEFA 2I5JA 4RW4A 1RTDA 3SUPA 3K5MA 1NK7A 3JYTA 1XWLA 4M3ZA 1YTUA 1K6YA 3MECA 2GV9A 5HROA 1YTAA 2QXFA 4FLYA 2BE2A 3JSMA 1IKWA 3M8QA 4Z0UA 2YNIA 3TANA 4CEEA 3QNOA 3G10A 3V1QA 5J1EA 3O3FA 1S1WA 3K59A 1TKZA 2O4GA 4CHQA 3MXJA 4QAGA 4DU3A 2VWKA 1CXQA 4CEBA 4CEQA 4CFCA 2E4LA 3OVNA 1HYVA 1ASUA 1RT6A 2RKIA 1BI4B 3AVGA 3CFRA 3LZJA 2RPIA 4IG0A 3VQDA 2P5OA 2BDPA 4FK2A 2G8FA 3LWMA 1EKEA 4CIFA 2DY4A 1BCMA 2R7YA 3ITHA 4DF8A 4FLTA 3VQEA 1KCFA 3SQ4A 4NCGA 4RG8A 1EX4A 3DLGA 1MU2A 2FBTA 4CCHA 3ZSWA 4DTUA 5CY4A 2P51A 4FJXA 4Z4EA 4IKFA 2Z1GA 4DTXA 1NOZA 4E7JA 2PZSA 3ZT0A 2XY6A 4B9VA 3H08A 3O4QA 1CXUA 4AHRA 1J5OA 1RDAA 1VSHA 3V4IA 4DMNA 4IBNA 1NKCA 4CF8A 1QSLA 1A5VA 2YHBA 2Y1IA 1QTMA 3DRSA 3OS2A 4J2DA 4CJ4A 4C8MA 3VQCA 4HTUA 4Z4CA 1RT1A 1RBVA 5DMRA 4N5SA 4OLAA 1RBRA 3MEEA 3VA0A 2X74A 3SZ2A 3AVJA 4Q5VA 4E3SA 4DTRA 3LALA 1G15A 1TL3A 4LSNA 1F21A 1IG9A 2FBVA 3ZT3A 1S6PA 3DRRA 4CGHA 1S1VA 1UOCA 3AO2A 1FKPA 4CJ3A 4F3OA 2HB5A 4J2EA 4CFDA 4NCAA 3TAQA 1DTQA 2LSNA 4DLEA 2HVIA 4UQGA 1U48A 1XC9A 4CERA 4PQUA 3HXMA 1KRPA 1TKDA 2EHGA 4J2BA 3K5OA 1NK4A 4CE9A 4DSEA 4C8KA 1QS4A 1X9MA 4C8LA 3F9KA 2IDOA 1WSIA 4B9LA 2YKMA 3DRPA 1C0UA 5T7BA 4H4MA 1L3TA 4CEAA 4AHUA 1RILA 4DS5A 3LWLA 2G8WA 1LAVA 3S3MA 1LAWA 4DSIA 4CECA 3OYNA 4FLVA 4LY7A 2W42A 4DFMA 2KZZA 4KTWA 1C1CA 4PUOA 3ZSOA 3ASMA 5FROA 1WSEA 4FLXA 3SQ1A 3RWUA 4KTQA 4M3TA 2YKNA 1GOCA 1BL3A 4KREA 3CYMA 1FK9A 2ATQA 3SPYA 3RR8A 1RT2A 3ALYA 3ZSRA 3V9WA 5J2PA 4M3YA 2G8IA 3QIPA 1I3AA 1B92A 1ITGA 4B8AB 4KPYA 1S1XA 3I0SA 4QCLA 4DTSA 1RT3A 3AVFA 3ZSQA 4CF1A 3IG1A 2E6MA 3OYGA 4M41A 3THVA 5HBMA 1JLGA 2G8HA 4FJ8A 4CEDA 2BANA 4M3XA 3PY8A 2VG6A 4HCCA 4M3RA 1YT3A 1S9EA 1BHLA 1FKOA 2GBZA 4RW9A 4AHTA 3KD5E 1SL2A 4OGCA 4LD0A 3SYZA 3VA3A 5KRSA 3SV4A 1KLNA 3OYBA 4RW8A 1NKBA 4CJKA 1S6QA 3L2VA 3LP0A 4CJUA 2HW3A 1VSEA 3KK2A 3NH0A 4I7FA 5KTQA 4I2PA 4KRFA 1IO2A 1U04A 1RTJA 2Q3SA 4KB1A 3O3HA 3RRHA 1KVAA 4N47A 4EZ9A 3OS1A 2IS3A 4W5RA 3CFPA 5SZTA 3AO4A 1NOYA 3HYFA 4CGIA 1C6VA 3TABA 1EP4A 3AA5X 4EZ6A 4JLHA 2PYLA 1ZYQA 1SL1A 2ZE2A 2OZMA 4LSLA 1SKRA 3NBPA 3O4NA 4KI4A 2HHTA 2D5RA 2A1RA 2KZMA 2XO7A 4C8NA 1J9AA 1NKEA 3AA4A 3TWHA 3MAQA 3HK2A 1IKYA 1EETA 4KV8A 4CJVA 2KFNA 4FJ7A 3LZIA 1RT7A 4Y1DA 1ASWA 1B9FA 1W9HA 4FVMA 4FM1A 3VN5A 3OJSA 4E7LA 1XI1A 1NK9A 4KHYA 2F8SA 1S1UA 2HHSA 3PX6A 1TGOA 4CJQA 3ZT4A 5EU7A 2YNFA 2JLEA 3SUNA 1XHZA 2FC0A 4E1MA 4G1QA 3SJJA 4BDZA 3CM5A 1U4BA 4AILC 3DYAA 3AO3A 4OPJA 3OYCA 3LANA 1BISA 1VSIA 3SV3A 1VK0A 3SI6A 1KFSA 4N41A 3KJVA 3QEPA 4ELUA 1LWFA 4CJLA 4CF9A 4JRQA 4CIEA 4LH4A 3VQQA 3KLHA 1HPZA 3VQ9A 4IDKA 4W5QA 1VRTA 4CHOA 3V6DA 3VQ5A 3PV8A 4F2RA 3ISNC 3P5JA 3C6TA 3HJFA 3OYHA 3QLHA 3ZSVA 3P1GA 2E6LA 3L2WA 3LPUA 3ULDA 4ID1A 1J54A 3AVHA 3CG7A 3EY1A 3KLIA 3L2UA 4B9NA 4CF0A 4KB0A 4Q0BA 3G0ZA 4OKEA 4ZHRA 4NYNA 1J53A 2B6AA 3E01A 4BWMA 4Z4HA 1IH7A 3IS9A 3V81A 1TKXA 3HPHA 3OYLA 4EP4A 5KGXA 1JXBA 3NGZA 3S3OA 3U3YA 4K8XA 3WNEA 4DSFA 4MFBA 3AVKA 3F73A 1U45A 3C94A 1IKVA 2VWJA 4EP5A 3DLEA 3MXIA 1Q9XA 2F96A 1BIZA 4FJGA 1NK5A 3ZT2A 4B9MA 1KVCA 4FJJA 3LP2A 5HRNA 3OY9A 1Q9YA 3LDSA 2OZSA 2YHAA 2HHQA 2DTUA 3NGYA 4N76A 3MEGA 4CGJA 4JS5A 3M8RA 4FLUA 1T8EA 4F4KA 1R0AA 2FBXA 4DFJA 1CLQA 3CFOA 4E1NA 3CQ8A 3LP3A 3VQ4A 4QOZB 1O1WA 1WSHA 1WLJA 4CJEA 4R5PA 3I8DA 3TAEA 4E0DA 3L2QA 4E89A 3HT3A 1T03A 1Z26A 4CEZA 1UWBA 3NH1A 1TVRA 4DTNA 2VG7A 3HM9A 1WSJA 4FM2A 3PX4A 1CZBA 3AA2A 1L3UA 3KK3A 3DMJA 4JS4A 1TV6A 3V9SA 2HMIA 1BCOA 4NYFA 3DLRA 4MQ3A 3AVNA 3RMCA 5SWMA 2VG5A 5HLFA 3QO9A 3QEWA 4CFBA 3AA3A 4E19A 4O4GA 5FDLA 4CF2A 3V9UA 1REVA 2G8KA 3KLFA 1BI4A 3RMAA 2XY5A 2G8UA 4DTJA 4CFAA 4OLBA 3SCXA 4DWIA 3MEDA 5E41A 1RBUA 1JLAA 5HRRA 3QERA 4KTZA 4DSJA 4DFKA 5D3GA 1C0MA 3OYMA 3VQ7A 4H4OA 2D0CA 1QQCA 4CJFA 4CK2A 4FJHA 3L2RA 2QKBA 1XHXA 1JLFA 1C0TA 2HNDA 1HJRA 3SQ0A 2PYJA 5K14A 1NK0A 4CHYA 3DM2A 1RDBA 4H8KA 5JS2A 4DFPA 3VQAA 1D9DA 1KFDA 3TARA 4GVMA 4BDYA 4ZTFA 1VSMA 4GMJB 3KLGA 4E7HA 3DLHA 4ICLA 4DSKA 5KI6A 3SUOA 4W5TA 4BE1A 3S9HA 1L5UA 2ITGA 4KHUA 1RDDA 2G8VA 1ZBHA 1C1BA 4FJNA 3K2PA 3NHGA 3NAEA 2PY5A 3RR7A 5FRMA 3HSTB 3L8BA 3NF6A 1BQMA 1WNSA 1LV5A 4CJSA 1RTIA 2Z1JA 3V1RA 2X6NA 1S9GA 1D9FA 4BE0A 2B5JA 3NGIA 1UA1A 2KTQA 1LW0A 4KHQA 1CZ9A 2F8TA 4FJ5A 4FLZA 1B9DA 5C24A 5J2MA 4J2AA 4FZYA 4OKKA 4E7IA 2HNYA 3UIQA 3T19A 2RF2A 1NK8A 4FK4A
chains in the Genus database with same CATH superfamily
3HOTA 3A2FA 1LW2A 3CCLN 1JL2A 4JHDA 3M1FA 5HRPA 2FLOA 5J2QA 3C95A 4CHNA 3HP6A 2ITMA 3KTQA 4CJ5A 5AFUH 3U3GA 3DXMA 5C2DA 3CMEN 3KD1E 3TAGA 3BY5A 3C6UA 1W97L 5AQSA 4DV5K 4DSLA 1BIUA 2QK9A 3FZKA 4AH9A 3R8EA 4E7KA 4GW6A 4A62A 4BREA 3IDHA 4WQ4A 4C1NI 3NFAA 4DQRA 3CC4N 1SL0A 4FLWA 4CESA 3LDNA 2D0AA 3DOKA 2EWSA 3PX0A 4ELVA 4CHPA 3VQ8A 4CZFA 4K41A 3LAKA 3ATVA 1JXEA 1NGGA 5AQGA 3VQPA 1WOQA 2O4IA 2HHVA 5ADXA 4IOAL 3TSPA 2GUIA 1VQKN 4M3UA 1VSFA 3OJUA 4FW2A 1FXXA 4YFUA 4DR2K 3CJBA 2P1JA 4JKDA 4AHSA 4W5OA 1HR0K 4FWSA 5AQRA 3HL8A 4CZEA 3DOLA 1BGXT 4FOEA 3B6OA 3QINA 4O44A 4FWNA 1YI2N 4CGFA 1SQKA 4BR7A 3CCSN 1N32K 5JVHL 3DI6A 5C25A 5AQOA 5DK5A 2Q1NA 3AV9A 4KKOA 1D8YA 2QWNA 4JKGA 3MN7A 2YCHA 4IG3A 2D0OA 1VQ6N 1HNVA 2KKZA 4DQQA 3DXMB 5AQWA 1Q18A 1ESVA 1WAJA 3HO1A 1RDCA 4AHVA 4ID5A 4KO0A 1ATRA 1TAQA 2XY8A 3TAMA 4XIUA 2WBNA 4IJAA 4F3TA 2ZJRL 3O9QA 4PY5A 4YDUC 4Z4FA 4DF4A 4M42A 2QWRA 1GOAA 2YNGA 5CZ1A 3ZSXA 1D5AA 3HVRA 3T1AA 2F4VK 3D45A 1BQNA 5I3UA 3OYKA 1BA1A 2D0BA 4HVJA 3QBWA 4DQSA 2VQEK 1NGHA 3EYZA 3A5MC 3A5OC 3OYEA 3E1YA 4N56A 3OYJA 2ZJQL 3SNNA 2GEMA 1KC8O 2BGGA 2HF3A 4IOXA 4OKJA 4B08A 4DU4A 2QWQA 4GV3A 1HLUA 3HSCA 2QWPA 4W5NA 3ZETA 1NK7A 2I7NA 1YTAA 5BPMA 4MLHA 2V51B 2YNIA 4Z0UA 3QNOA 1QQNA 1S1WA 3K59A 1GLDG 4CHQA 4YOTA 1V4TA 4DU3A 2VWKA 4CEQA 4GV6A 4CFCA 2E4LA 3C0BA 1HYVA 1RT6A 3AVGA 2RPIA 3VQDA 2Q97A 2G8FA 1GLJO 1VQ5N 4DF8A 4C1NK 1NNEA 4BC5A 1KCFA 2PFUA 4LF7K 1MU2A 2FBTA 4QS9A 4JKGB 4KH6A 4BRQA 4FJXA 4IKFA 1NOZA 3FZLA 3H08A 3O4QA 1J5OA 1RDAA 4KH4A 5A2QO 4BROA 4X62K 3SK3A 1NKCA 3O9RA 1GLLO 3DRSA 3VQCA 4HTUA 1T3VA 2ZGZA 4PL7A 4N5SA 4OLAA 3R1XA 3AVJA 1G15A 4LSNA 1IJJA 1F21A 5AZIB 4FWPA 3SMPA 1FW6A 3DRRA 1S1VA 2F9TA 3AO2A 3D2FA 4FWQA 3A8YA 3QFUA 3VESA 1C0GA 3KK7A 1U48A 3WXIA 4XH4A 4CERA 1KRPA 3T69A 3K5OA 3DLLL 1YIJN 4CE9A 4BC2A 4DSEA 1QS4A 5BRDA 1X9MA 2IDOA 4B9LA 2YKMA 3DRPA 5T7BA 1RILA 3CCJN 1LAVA 5AQQA 3D2EA 4CECA 2KZZA 4IWVA 4LY7A 2VQFK 4KTWA 4FLXA 4KTQA 5BR8K 1E4FT 2QXLA 3V9WA 3QIPA 4BRAA 1W7AA 1I3AA 3W3DA 2OTLN 4H0PA 2E6MA 3THVA 5HBMA 5M1NA 2G8HA 4BR0A 5FPEA 2ZF5O 4HCCA 1YT3A 1JCEA 1BHLA 3T7ZA 2YJFA 5EOYA 2FSNA 3MX5A 4BRLA 4OGCA 5KRSA 3SV4A 4K42A 3VERA 2IIRA 3U4LA 3WEEB 1NKBA 4CJKA 3PSIA 4I7FA 3O9TA 1IO2A 4YORA 1BDGA 3OS1A 4NLBA 2IS3A 3J7AP 1QZ6A 3HYFA 1C6VA 4EZ6A 1ZYQA 3ZEUA 2OZMA 3CCVN 5IWAK 1QVGM 1SKRA 3NBPA 4KI4A 1KAXA 3AAQA 3B8AX 1NKEA 3AA4A 3VEOA 4CBWA 3MAQA 3TWHA 3HK2A 1EETA 4KV8A 2KZMA 3LZIA 1B9FA 1W9HA 2P9KA 3H3NO 2F8SA 3VN5A 1XI1A 4E7LA 5C2FA 1OH6A 1TGOA 5GAEP 5ELZA 4G1QA 2P9LA 4A57A 3DJCA 4AILC 1K9MO 3CIPA 3OYCA 3D2FB 2P9IA 3PIPL 1BISA 1YUWA 4CF9A 4PL8A 1HPZA 3R3LA 4YDUA 4IDKA 4W5QA 4IOCL 4CHOA 4F2RA 2UYTA 3P1GA 3CG7A 3FZHA 4KB0A 4OKEA 4ZHRA 4NYNA 4Z4HA 3E01A 1ATNA 3OYLA 3S3OA 3D2EB 4DSFA 3C94A 4EP5A 3MXIA 3ENBA 3WXJA 2HSTA 2VGMA 3ZT2A 4F9OA 1MWMA 3OY9A 3J81O 2DTUA 3MEGA 3VETA 4FLUA 4JD2A 2FBXA 4E1NA 1JCGA 3P38A 4IFEA 1WLJA 4R5PA 3TAEA 3L2QA 3HT3A 2QM1A 1TVRA 5FPNA 1WSJA 3PX4A 1CZBA 2HBLA 3T1HK 1K8AO 3CJ1A 3DMJA 3V9SA 2HMIA 1BCOA 3VGMA 1NM1A 1VQ9N 3RMCA 5HLFA 3QEWA 3M3ZA 1T6CA 4E19A 4WYBA 2Q2RA 1REVA 3KLFA 3ID8A 1T44A 4OLBA 1JLAA 3O6WA 5HRRA 4DSJA 3PSFA 5ADXH 4CJFA 4DUZK 4FJHA 1BOTO 3H1VX 4ILHA 2HNDA 2HHHK 1HJRA 1NK0A 1HJOA 2KHOA 4DR3K 2P9KB 2FSJA 4BDYA 4DV6K 4O8KA 4E7HA 3LDQA 4AQYK 3S9HA 4BR9A 1ZBHA 1RDDA 2G8VA 3K2PA 2PY5A 2UXBK 3HI0A 1BQMA 3CF5L 3V1RA 1XNQK 2B5JA 3NGIA 1UA1A 1LW0A 3IFRA 4DV1K 3T1YK 3FR0A 4FK4A 3WQUA 4BY9C 4L8RB 1NGDA 2A1SA 2F9WA 3AGRA 2YX6A 5AQJA 2DFEA 3V9XA 2AJQA 4KI6A 2Q0RA 3QETA 3QESA 5CHIA 4KAZA 3CQYA 3WQTA 1N5YA 3AAPA 1NMNA 3HVTA 4AF1A 4FJ9A 3GDQA 3KK1A 3NH2A 1X9SA 1SKSA 1U2VB 2WONA 4BWJA 1IKXA 4PWDA 1ZBLA 2E20A 4FM0A 1Y97A 3MDQA 4DTMA 3HBTA 2UXCK 3DLKA 4KHPK 1TL1A 1KAZA 2O8EA 5HRSA 2GWKA 3WT0A 3GG4A 4BRHA 2ETJA 4YNQA 3GL1A 5AZJA 1KLMA 4MO5A 2FBYA 5DM7L 1L3SA 2F7TA 1YJWN 2DFHA 4KFBA 4DS4A 2OA8A 4BRDA 4DTPA 3IKMA 1RBSA 4FZZA 5CYMA 1JLBA 3SQ2A 2E2OA 4DQ8A 3MCPA 2IOCA 1OH7A 3IRXA 4JI6K 4O0IA 1RDWX 4I9LA 3B6PA 1NJYA 3VPZA 1S72N 5AQHA 1VQ8N 2OYQA 2Z1IA 5AQLA 3UE5A 3EZWA 1RTHA 3TR8A 1RT5A 2ZD1A 1QSYA 1TAUA 2E1YA 1NJWA 2RE2A 4M45A 4F2SA 3HTVA 3RMBA 4K43A 3KKSA 1U47A 3KKRA 1YVUA 4LF4K 3CMAN 3HRGA 2P9PA 4B3TK 1JLEA 1UA0A 3S3NA 4CGGA 2HHUA 3C6AA 4Z94A 3GOIA 4GY2B 2XHBA 4Y0WA 1E3MA 1W0HA 2NUBA 2UUCK 2Z1HA 4BR2A 3TAPA 3U9DA 3EKUA 1T6DA 3RVCA 2A42A 1RBTA 3LM9A 3VEZA 4OO1J 3EE8A 2QEXN 3O3GA 3L4IA 4FJIA 2HHWA 3ULEB 4KHNA 3HPOA 1T05A 3CJ7A 4BVOA 4DU1A 3BUZB 2OPQA 3EO3A 3L3UA 3P39A 4DQIA 2E5LK 1NG9A 1VSKA 3I55N 4ISFA 4KHWA 1HYSA 3T3FA 2Q36A 4DLGA 2P5GA 5DM6L 5C0YA 1QSSA 2IVPA 2YV0X 3QNNA 1NK6A 3OA9A 5EXWA 5EVZA 3GE1A 2OPPA 3CM6A 4OPKA 4LFCK 5KPTA 3AVIA 1JL1A 3NE6A 1K8KB 4A59A 1RTDA 4RW4A 4AM6A 1XWLA 1K6YA 3FZMA 2BE2A 2GWJA 2HF4A 4MDBA 5LJWA 1EO1A 4CEEA 2A6AA 2UUBK 2P9UA 3V1QA 5J1EA 3UKUB 1TKZA 2O4GA 1NJIO 4CEBA 4CVNE 2QA4N 2RKIA 4IG0A 2P5OA 1EKEA 4CIFA 2DY4A 4KBOA 1GLCG 3VQEA 2WC9A 3SQ4A 3HM8A 4RG8A 1EX4A 4JNEA 4RCHA 3VEVA 5CY4A 2Z1GA 4DTXA 1SAZA 3ZT0A 1CXUA 4DMNA 4JKBA 4DR1K 2WUSA 1QHAA 1QTMA 4V19S 3OS2A 4C8MA 3ZX2A 5C12A 2RHKA 1OH5A 1RBVA 4OX9K 4JI4K 5LJVA 3VA0A 1MDUB 4DTRA 3LALA 4JI1K 3BZKA 1UOCA 3DXKA 1FKPA 2HB5A 4J2EA 4NCAA 1DTQA 5FPMA 4DLEA 2HVIA 4PQUA 3R6MA 1KAYA 4UY8O 2EHGA 3ZX0A 5AQZA 3Q7BA 2D1KA 4JHDB 1YITN 4CEAA 1XQSC 1IBLK 3KWGA 2G8WA 5BRHA 4FLVA 2W42A 4DFMA 1C1CA 5FROA 4B1YB 3I56N 4NLCA 2YKNA 5F1XA 3JXUA 3QBXA 3AGKA 3CYMA 1YJ9N 3RR8A 5J2PA 4B8AB 4KPYA 5AR0A 4CF1A 3IG1A 1VQMN 3NVKA 3A0IX 3VGKA 4FJ8A 4CEDA 3O8MA 4XEIA 3QFPA 1FKOA 1ZXOA 4ISEA 3FFKB 4RW9A 2FF3B 1SL2A 3SYZA 4ILGB 3LP0A 1VSEA 3NH0A 4RTFD 4I2PA 5AQYA 5M1KA 1RTJA 1TUYA 1KVAA 1J6ZA 4BQZA 4W5RA 3CFPA 2YJEA 3FZFA 4H5RA 3TABA 4JKFA 3AA5X 2PYLA 2ZE2A 4LSLA 3QMLA 3O4NA 2HHTA 3M6GA 5JLFA 1IKYA 3J8AA 4B1XB 4J8FA 2BUPA 5BRFA 3TPQA 1N34K 2VCPA 4FVMA 4FM1A 3OJSA 2HHSA 3PX6A 4BVPA 2YNFA 4RWTA 3SMSA 5FPDA 2FC0A 3SJJA 4BDZA 4GKKK 3DYAA 3VF4A 1HPMA 3FLCO 5M1QA 2O8CA 4N41A 1QQMA 4CJLA 2VWBA 3LM2A 4H5VA 4BC4A 1LCUA 4H0OA 1VRTA 3PV8A 3L4QA 1Z05A 3HJFA 2P9NA 2O8DA 3OYHA 3L2WA 2PBDA 3ZSVA 1YTUA 1WUAA 4B9NA 3G0ZA 4GKJK 4BWMA 2B6AA 2WTUA 3V81A 4BRIA 1JXBA 3F2KA 2WFBA 2ZM6K 4MFBA 1YHQN 3AVKA 1U45A 1KD1O 1IKVA 1Q9XA 3MWTA 1CZAN 4B9MA 4BGBA 2NNWA 5FLXO 2OZSA 2YHAA 3BP8A 4NB4A 3NGYA 1YXQA 4H0VB 4CGJA 1QZ5A 3CQ8A 4QOZB 3LP3A 2AP1A 3C7NA 3SAHA 4JI8K 3CXCM 3A5NC 1S22A 4CJEA 5AQTA 3K0SA 2CGKA 4CZIA 3NH1A 4CEZA 1UWBA 3CCMN 4DTNA 4A61A 4IEIA 2D4WA 4BRFA 2QI2A 5SWMA 4CFBA 1NGFA 2GUPA 5FDLA 3BZCA 1R59O 3MN6A 1S3XA 1BI4A 3G4SN 4A5AA 4WFAL 1KXPA 3QERA 5D3GA 4DFKA 2A3ZA 3LL3A 4PKIA 4H4OA 5JICA 1QQCA 1Q82O 3EE9A 3IUCA 3L2RA 4LF5K 3KZBA 1C0TA 3ZETB 2PYJA 1EQYA 3DM2A 1RDBA 3VQAA 4EHTA 1HUXA 4ICLA 3VOVA 5KI6A 2DPNA 4W5TA 3SUOA 1L5UA 5I9EB 4KHUA 1EWQA 4JKHA 3CI5A 3NAEA 3RR7A 1DKGD 3HSTB 3SBGA 3NF6A 4CJSA 4CZLA 3I8BA 2KTQA 3SBTA 4FL9A 4FLZA 5C24A 5J2MA 5GAHP 5BPLA 4DCHA 2HNYA 3T19A 4B3RK 3OW2M 4BC3A 1KTQA 2NRZA 1GLAG 1Z6RA 3V9ZA 2QTDA 3SUQA 4FCYA 3D7EO 4IFVA 3LAMA 3KLEA 2OPRA 2WOMA 3TTFA 2XY7A 4BE2A 4CZMA 3U9ZA 4B9SA 1NU0A 1ASVA 3TU5A 4BACA 5EX5A 3OYIA 1G99A 4CD1A 4DHYA 4M3WA 2OPSA 5KQDA 1U49A 1X1PA 3OYDA 3C7NB 2QKKA 2QW9A 2X6SA 2YNHA 2ASMA 2RN2A 1HKBA 2VYPA 2V7ZA 3THYA 1QHTA 4OPAA 3O9SA 4LF9K 1ZBFA 5CYQA 4FVUA 3TI0A 3M8PA 2XRIA 1JLCA 4FW1A 3WNGA 4BRMA 3E9OA 3THWA 1KSPA 3DLBA 3IAYA 3ENOA 3RSEA 1HMVA 3M8SA 3ZT1A 3AO5A 3SLCA 3SPZA 1A5XA 4HUGA 4GNIA 3QEXA 4JYAK 2HHXA 2H3GX 3CERA 2DFFA 1E4GT 3EKSA 3AVMA 4FWMA 3EZ5A 1LWCA 4O0JA 2QWOA 4DR6K 1BWFO 4JK7A 1WBBA 4I6MA 3NCIA 2KFZA 3MWPA 2HNZA 1WAFA 4FPAA 3OYFA 3RMDA 3BEXA 2O8BA 1GLFO 3L3VA 4MLEA 2OCEA 4CEOA 4B9TA 3CD6N 4CGDA 1JJ2M 4FYDA 4O5FA 4KHSA 1NJZA 5GIOA 3ZEUB 4B9QA 1DTTA 1RT4A 4R79A 4H5TA 4ELTA 3AVBA 2YHYA 4I9QA 5AQKA 1NGIA 4CHZA 3P83D 1XNRK 2CGJA 3VEWA 3WNHA 4CZGA 4B8CA 2P9LB 4RW6A 2JGUA 4BRPA 2IGIA 2P9IB 3UKRA 4I2QA 1SV5A 4HUFA 1RNHA 4IFYA 4IXCA 4IO9L 4LFAK 4PKGA 4HUEA 5JS1A 3PUFA 4CK3A 1YVNA 3N4QA 1KQSM 3ATUA 3ZYYX 2Y1IA 2FXUA 5I42A 4DB3A 3TAFA 2E2QA 3BGRA 4B1UB 3BF3A 4FWLA 3QIOA 1HNIA 5EY4A 1VSJA 2P9SA 4JRPA 4IDHA 4ZTJA 2HVHA 3HP9A 1WSGA 4DR7K 1Z25A 3LPTA 4CBXA 5GIPA 3D0PA 1JLQA 4O8UA 4FZXC 1DEJA 3LP1A 4FJLA 4CK1A 4O5BA 1VQNN 4JD2B 4QS7A 1RCHA 2NRXA 2E2NA 3VQ6A 1ILYA 4WFNL 3K5MA 3QICA 4MDAA 3F9MA 4M3ZA 4IO8A 3GBTA 4DV4K 2JWLA 5HROA 2QXFA 4FLYA 3JSMA 3M8QA 1HX1A 4JAXA 1J5EK 3O3FA 3E9PA 4JI3K 4QAGA 1C0FA 3OVNA 3CCRN 1ASUA 3CFRA 5JVGL 2V7YA 4FK2A 3P4IA 3LWMA 3THXA 4FWRA 1BCMA 4X65K 2R7YA 5AQVA 4DV7K 1N8RO 4FLTA 1M1KO 4DV3K 1XMQK 4DTUA 2A5XA 2P51A 1RDUA 4B9VA 4E7JA 2PZSA 1VSHA 4DV0K 1VQLN 1QSLA 2E1ZA 4U67L 2YHBA 2HBJA 5LMNK 1VQPN 4CJ4A 3CQXA 1RBRA 1VAZA 1NBWA 2X74A 4Q5VA 4E3SA 1LOTB 3M5RA 3ZT3A 1HNXK 5HOOA 4BRGA 4XH5A 3TAQA 4CI6A 3MMVA 1XC9A 4EFHA 3EL2A 2YHXA 1WSIA 1C0UA 1L3TA 3J80O 4DS5A 3LWLA 3S3MA 3OBWA 3I33A 3CCQN 4PUOA 3ZSOA 3ASMA 3SQ1A 1WSEA 3RWUA 5AQUA 3FE1A 1GOCA 3G25A 4A2BA 1FK9A 1RT2A 4M3YA 2G8IA 3CJ9A 1IBKK 1B92A 4A2AA 1ITGA 3U8XA 1IG8A 4A5BA 1Q86O 4DTSA 1RT3A 3AVFA 4BQLA 4M41A 2O8EB 2BANA 2NRHA 3O80A 4DKWA 3PY8A 4JK8A 3WXLA 4CW7B 1S9EA 5GAGP 3CC2N 5AZJB 4JK9A 3OYBA 4RW8A 1S6QA 4IEEA 2E2PA 3KK2A 1EWRA 4KRFA 4XH1A 2Q3SA 4KB1A 4EZ9A 3CCUN 2ZGYA 4LFBK 5SZTA 3AO4A 1NOYA 4CGIA 1EP4A 1DT9A 3TSUA 3DWLA 4C8NA 1TYQA 4Y1DA 1K73O 4CJQA 3ZT4A 5LL6Z 5EU7A 2JLEA 3SUNA 3E66A 1XHZA 1QQOA 4E1MA 4NO7A 2NRWA 2BTFA 5GADP 3WXMB 3LANA 3SV3A 1KFSA 4ISGA 3Q7CA 4L3QA 4CIEA 3VQ9A 3LDPA 5MLCQ 2P9PB 3VQ5A 5M1FA 3P5JA 3SJHA 4BRKA 2E6LA 3SAFA 2W6LA 1SL1A 4JI5K 1J54A 3AVHA 3H6EA 3KLIA 3O9UA 5BREA 4CF0A 1IH7A 3IS9A 1QVFM 3HPHA 4EP4A 5KGXA 3U3YA 5F2RA 3WNEA 4B1ZA 5AQPA 3UB5A 1NMDA 5AQNA 2VWJA 4NXMK 3K9KA 4FJJA 3LP2A 4CZHA 1Q9YA 3TSQA 3LDSA 2UXDK 4BRCA 4F4KA 4JKEA 1T8EA 4K0KK 1R0AA 2D0PA 3WXKA 4DR4K 3CFOA 1YJNN 5CR4A 1WSHA 4E0DA 4E89A 1T03A 1Z26A 2VG7A 2ASPA 4FM2A 4NXNK 2NZTA 1L3UA 4JS4A 4NYFA 3DLRA 4JN4A 4WFBL 4U7BA 5BN9A 4JI0K 2Q31A 2W6KA 2ZJPL 2VG5A 1NWKA 1FJGK 3JS6A 5KPZA 4O4GA 3O1WA 5C10A 4CF2A 1BG3A 4DTJA 4CFAA 3SCXA 1RBUA 4OPHA 1C0MA 3L6QA 3VQ7A 2D0CA 4CK2A 4YOWA 2QKBA 1JLFA 1ZC6A 1TYQB 1I94K 4H8KA 5JS2A 4DFPA 1D9DA 4H0TB 4GVMA 4BR4A 4ZTFA 3TTDA 4DSKA 5HL7L 2ITGA 2P9UB 2IVNA 5AJ3K 4G9ZA 3AARA 3L8BA 1LV5A 1WNSA 3O4WA 3TTCA 1S9GA 1D9FA 4X64K 5AZIA 1CZ9A 2GELA 4YY3K 1XC3A 3J7YP 3H1QA 3VF6A 4J2AA 4FZYA 3UIQA 4BR5A 4E1JA 2Y1JA 4DUYK 3R9PA 4C8OA 3O1BA 3HPGA 3O5BA 4O55A 4CD3A 4RW7A 3QEIA 3VQBA 4M63C 3MCAB 4Z4IA 4LH5A 1JKHA 2KLAA 4LF8K 3K5LA 4H5NA 3BDPA 1ZBIA 3CJCA 1GOBA 2HBKA 1S5JA 2YI1A 1HQUA 3DXKB 3K9JA 3K58A 4FWOA 1N33K 4FXDA 4Y1CA 3ZSZA 5AQIA 2IC3A 2V52B 5C42A 3QEVA 2E8AA 4DTOA 2CH6A 3F5TA 1UAXA 4PA1A 4FJMA 2ZQBA 3WNFA 1TK5A 4M7XA 2CGLA 3OS0A 4FK0A 1TKTA 4K8ZA 5IT9O 1HQEA 3WEEA 3K5NA 1N6QA 4F8RA 4DG1A 5C15A 3JAMO 3FFIA 4YHHK 3AVLA 4CIGA 3SAGA 4JI2K 4CBUA 1OH8A 3PO5A 4HCBA 1L3VA 3NDKA 2HMPA 3ZCMA 3I0RA 4NCBA 4CJPA 1T7PA 1RGIA 3CPEA 1HRHA 4WE1A 2KW4A 1DGKN 2O8FA 3H3OB 1S1TA 3V1OA 4DQPA 2GX9A 2OANA 4OVLA 3ZSYA 4C23A 3RRGA 1Q81O 2ZWHA 1NJXA 4OJRA 2HOEA 1V4SA 1VSDA 1WN7A 2FSKA 1RFQA 5KRTA 4B9UA 4FJKA 1QE1A 1SKWA 1HYZA 1DLOA 1NGJA 1P8ZA 1EXQA 3AVCA 3PO4A 5AFUA 3BF1A 1I39A 2EX3A 2OTJN 4BDPA 1A5WA 2QWLA 3EEQA 4QS8A 5CZ2A 1ZBUA 1LWEA 3H45C 3OYAA 2B4JA 4CJWA 1BA0A 4IJNA 4H5WA 1SS6A 5KQ8A 4OGEA 4HHTA 3LDLA 4B1WB 2O8CB 3KWIA 5M1PA 3NF8A 3U6FA 4H03B 3K57A 4B3OA 4CJRA 3LDOA 3RTVA 3KIOA 1C1AA 3MN5A 2W40A 4M7YA 3G6EN 3S41A 2P9NB 3A5LC 2O8DB 2G8KA 5KGWA 3NF7A 3NMUA 2X78A 1WSFA 3MXMA 4CJTA 5FRNA 1TK0A 4PKHA 3AVAA 1KVBA 1Q8IA 3CCEN 3NF9A 1HKGA 2KQ2A 3AO1A 2I7PA 1X9WA 1VSLA 4Z4GA 1BO5O 2IAJA 2A41A 1VRUA 4AHCA 1M90O 4TSXA 5J2NA 1SUQA 1OVYA 4CEFA 1X3NA 4YOUA 2I5JA 3HOSA 3G71N 3SUPA 3CC7N 3JYTA 3MECA 2GV9A 1IBMK 1IKWA 1X9JA 2O8FB 3TANA 3G10A 3AY9A 3MXJA 2QWMA 2JWKA 1CXQA 5E84A 2YHWA 5HP1A 1BI4B 1NGEA 3MK6A 3LZJA 2BDPA 3C6HA 3ITHA 1XUPO 4NCGA 3VF2A 2NLXA 5B8HA 3DLGA 5GINA 4B3MK 4CCHA 3ZSWA 4JI7K 4Z4EA 2XY6A 4HWIA 4AHRA 3J7ZO 5H1SQ 5CE3A 3V4IA 4IBNA 4CF8A 1HNWK 1A5VA 3NVMA 4J2DA 4LC9B 4Z4CA 1RT1A 5DMRA 4BG9A 5JLHA 4JV5K 3WUHA 3MEEA 4AM7A 3SZ2A 4GVEA 4WQ5C 1TL3A 1IG9A 2FBVA 5M1OA 1U2VA 1S6PA 1HKCA 4CGHA 2W41A 5TKYA 4CJ3A 4F3OA 1NGCA 4CFDA 4KH5A 4FSVA 1X3MA 2LSNA 2A40A 4JKCA 3PLAA 4UQGA 2NRTA 1U6ZA 1OKJA 3FGUA 3HXMA 4GV9A 4J2BA 1TKDA 1HNZK 1NK4A 3QDKA 4WF9L 4C8KA 4H0YB 5LY3A 4C8LA 1ZBSA 3F9KA 4PHTX 5E26A 4H4MA 3H46O 1VHXA 3VEXA 4AHUA 3N4PA 1H1VA 2IVOA 1LAWA 3VEYA 3OYNA 4DSIA 3L0QA 4M3TA 4EHUA 1IV0A 1BL3A 4KREA 1TUUA 2ATQA 3SPYA 1VQON 3ALYA 3ZSRA 3KHYA 1YF5L 4EIAA 1VQ7N 1S1XA 2NRVA 3I0SA 1P90A 4QCLA 3OHRA 2FF6A 4WQ4C 3ZSQA 3OYGA 2NRRA 3OBYA 3OTOK 3THYB 1O13A 1JLGA 5BR9A 4M3XA 2VG6A 5JMVA 1BU6O 4M3RA 3CETA 2GBZA 4BGAA 4AHTA 3KD5E 4LD0A 3VA3A 1KLNA 3THWB 1MWKA 4LF6K 3L2VA 2HW3A 4CJUA 4JKAA 3RSEB 3O08A 4CZJA 5KTQA 1U04A 3O3HA 3RRHA 4N47A 1ATSA 2UU9K 3MX2A 4JLHA 3VTIA 1VQ4N 2D5RA 2A1RA 2XO7A 1J9AA 3EN9A 4CJVA 2KFNA 2GTDA 3CJAA 4FJ7A 1RT7A 1TK8A 1ASWA 3DAWA 4KHYA 4I6MB 1S1UA 3PIOL 1NGBA 5KPRA 3CM5A 1NLVA 1U4BA 2E88A 2O8BB 1GLEG 3AO3A 4OPJA 3C65A 1VSIA 3SI6A 1VK0A 3KJVA 3QEPA 4ELUA 1LWFA 4JRQA 4LH4A 3VQQA 5LMUK 5AQXA 3KLHA 3ULEA 1WBDA 1W2BM 3D6RA 5BPNA 1Y64A 3V6DA 2Q0UA 3ISNC 3C6TA 3QLHA 1NK9A 3ULDA 3LPUA 2UUAK 4ID1A 4FOIA 3EY1A 1N36K 3L2UA 3ZLJA 4Q0BA 3VTHA 1J53A 1MA9B 3HZ6A 4JEPA 1TKXA 3NGZA 1JCFA 3ID6A 4K8XA 4BRNA 3QB0A 4DR5K 3F73A 3IMXA 3DLEA 5AQFA 4FJGA 2F96A 1BIZA 3P31A 1NK5A 1WB9A 1KVCA 5HRNA 3VMFB 5TKWA 2HHQA 3UKRB 1OVQA 1YAGA 4FWKA 2VGNA 4JS5A 4N76A 2HBMA 3M8RA 4ILJA 4H0XB 5F0XA 4DFJA 1CLQA 4BG8A 3VQ4A 1O1WA 1K8KA 3W0LA 4YOVA 3I8DA 4K25A 4FPBA 3HM9A 3AA2A 4WCEL 3KK3A 3CHWA 1TV6A 4MO4A 4MQ3A 3UKUA 1SZ2A 3AVNA 3E9LA 2P9SB 3QO9A 3AA3A 3V9UA 1Q7YO 3RMAA 2XY5A 2G8UA 5BN8A 4DWIA 3MEDA 5E41A 3CPWM 4KTZA 4HTLA 3OYMA 4IZ9A 4CJ7A 1XHXA 4DV2K 1BUPA 3SQ0A 5K14A 1NGAA 4CHYA 1KFDA 2PAVA 3MN9A 3TARA 1VSMA 4GMJB 3KLGA 3DLHA 4CZKA 3KVGA 3ENHA 4BE1A 3VENA 1C1BA 4X66K 4FJNA 3NHGA 5FRMA 4B3SK 4FO0A 3ZX3A 2CH5A 4B1VA 1RTIA 1D4XA 2Z1JA 2X6NA 4WQ5A 4BE0A 4EAHD 3THXB 1GLBG 2ASOA 4KHQA 3VGLA 2F8TA 2J4RA 4FJ5A 1B9DA 4OKKA 4YOXA 1XMOK 2BH1A 4E7IA 2AA4A 2RF2A 1NK8A 5AQMA 4YOYA
chains in the Genus database with same CATH topology
2Y1JA 4L8RB 2A1SA 3A2FA 1KTQA 1LW2A 4C8OA 1JL2A 2DFEA 3HPGA 3V9ZA 4O55A 3V9XA 2AJQA 3SUQA 4KI6A 3QETA 3QESA 4FCYA 4IFVA 3LAMA 4RW7A 5HRPA 3QEIA 3KLEA 3VQBA 4KAZA 5J2QA 3C95A 2OPRA 4Z4IA 1N5YA 4CHNA 2WOMA 4LH5A 3HP6A 2XY7A 1JKHA 4BE2A 3KTQA 4CJ5A 4B9SA 3HVTA 3U3GA 1ASVA 3K5LA 4BACA 1TK8A 3TAGA 3KD1E 4FJ9A 3KK1A 3OYIA 3BDPA 3C6UA 3NH2A 1X9SA 1SKSA 2WONA 1ZBIA 1GOBA 4BWJA 4M3WA 1S5JA 1IKXA 1HQUA 2OPSA 3K58A 1U49A 4DSLA 1BIUA 4FXDA 4PWDA 1X1PA 4Y1CA 3OYDA 3ZSZA 2QK9A 4AH9A 1ZBLA 4FM0A 1Y97A 4DTMA 2IC3A 2QKKA 4E7KA 4GW6A 2X6SA 2YNHA 3DLKA 5C42A 3QEVA 4DTOA 2RN2A 1TL1A 3NFAA 4DQRA 1QHTA 1UAXA 1SL0A 4FLWA 4PA1A 4FJMA 5HRSA 4CESA 1ZBFA 5CYQA 2D0AA 3TI0A 3DOKA 3PX0A 2ZQBA 3M8PA 4CHPA 3VQ8A 4ELVA 2XRIA 1JLCA 3WNFA 1TK5A 2ETJA 4FW1A 4YNQA 3LAKA 3OS0A 1JXEA 3VQPA 4FK0A 3WNGA 1KLMA 1TKTA 4K8ZA 1HQEA 3K5NA 1N6QA 4F8RA 4DG1A 1KSPA 2O4IA 3DLBA 2FBYA 3IAYA 2HHVA 1L3SA 2GUIA 5HP1A 3FFIA 1HMVA 2DFHA 4KFBA 4DS4A 3M8SA 3AVLA 3ZT1A 3AO5A 1VSFA 3OJUA 4CIGA 3SPZA 2OA8A 4FW2A 1FXXA 4DTPA 4M3UA 1RBSA 1A5XA 4YFUA 4FZZA 4HUGA 5CYMA 1JLBA 3QEXA 2P1JA 3SQ2A 2HHXA 4AHSA 4W5OA 3PO5A 2DFFA 2IOCA 4HCBA 3EZ5A 3AVMA 3IRXA 3NDKA 3HL8A 1L3VA 4O0IA 1LWCA 4I9LA 3B6PA 4O0JA 3ZCMA 1NJYA 3I0RA 4NCBA 4CJPA 3DOLA 1T7PA 2OYQA 1BGXT 2Z1IA 1HRHA 4WE1A 2KW4A 1RTHA 3TR8A 3NCIA 2KFZA 3B6OA 3QINA 2HNZA 1RT5A 1WAFA 2ZD1A 1QSYA 1TAUA 4O44A 3OYFA 3RMDA 1S1TA 1NJWA 3V1OA 4DQPA 4M45A 4CGFA 4F2SA 4OVLA 3ZSYA 4B3OA 3RRGA 3RMBA 1NJXA 3L3VA 4CEOA 3KKSA 4OJRA 4B9TA 1U47A 4CGDA 1VSDA 1WN7A 3KKRA 3DI6A 1YVUA 5C25A 5KRTA 4B9UA 4FYDA 4KHSA 1NJZA 4FJKA 5DK5A 1JLEA 1QE1A 1UA0A 3S3NA 1SKWA 1DTTA 1HYZA 3AV9A 4KKOA 1D8YA 1DLOA 1RT4A 4CGGA 2HHUA 4ELTA 3AVBA 1EXQA 3AVCA 4IG3A 3PO4A 2XHBA 4I9QA 1I39A 2EX3A 4CHZA 4BDPA 1HNVA 1A5WA 3P83D 5CZ2A 1W0HA 2NUBA 1ZBUA 2Z1HA 4DQQA 1LWEA 3OYAA 3WNHA 2B4JA 1WAJA 4CJWA 3TAPA 4B8CA 4RW6A 3HO1A 1RDCA 4AHVA 4ID5A 2JGUA 1TAQA 2IGIA 2XY8A 4KO0A 4OGEA 4HHTA 1RBTA 3TAMA 4XIUA 4I2QA 1SV5A 4HUFA 4F3TA 1RNHA 4IFYA 3O3GA 3NF8A 3U6FA 4PY5A 4FJIA 2HHWA 3K57A 4Z4FA 4CJRA 4DF4A 3HPOA 1T05A 4HUEA 3RTVA 4KHNA 3KIOA 1C1AA 4DU1A 3PUFA 5JS1A 4CK3A 4M42A 1GOAA 2YNGA 5CZ1A 3ZSXA 1D5AA 2OPQA 3L3UA 3T1AA 5KGWA 3NF7A 3HVRA 5I42A 4DQIA 1VSKA 2X78A 3D45A 1WSFA 4KHWA 1BQNA 4CJTA 3MXMA 5I3UA 3TAFA 5FRNA 1HYSA 3OYKA 3T3FA 3BGRA 2D0BA 4HVJA 1TK0A 3AVAA 1KVBA 1Q8IA 3NF9A 3QIOA 4DLGA 1HNIA 2P5GA 4DQSA 3EYZA 2KQ2A 3AO1A 1VSJA 4JRPA 4ZTJA 3OYEA 2HVHA 1QSSA 4N56A 3HP9A 1WSGA 3OYJA 1Z25A 2YV0X 3LPTA 3QNNA 3SNNA 3D0PA 1X9WA 1NK6A 1VSLA 1JLQA 4Z4GA 4FZXC 3LP1A 2BGGA 4FJLA 4CK1A 4O5BA 2OPPA 2IAJA 3CM6A 1VRUA 4OPKA 4AHCA 4OKJA 4TSXA 1RCHA 5J2NA 4B08A 1SUQA 3AVIA 4DU4A 1JL1A 3NE6A 4W5NA 3VQ6A 4CEFA 2I5JA 4RW4A 1RTDA 3SUPA 3K5MA 1NK7A 3JYTA 1XWLA 4M3ZA 1YTUA 1K6YA 3MECA 2GV9A 5HROA 1YTAA 2QXFA 4FLYA 2BE2A 3JSMA 1IKWA 3M8QA 4Z0UA 2YNIA 3TANA 4CEEA 3QNOA 3G10A 3V1QA 5J1EA 3O3FA 1S1WA 3K59A 1TKZA 2O4GA 4CHQA 3MXJA 4QAGA 4DU3A 2VWKA 1CXQA 4CEBA 4CEQA 4CFCA 2E4LA 3OVNA 1HYVA 1ASUA 1RT6A 2RKIA 1BI4B 3AVGA 3CFRA 3LZJA 2RPIA 4IG0A 3VQDA 2P5OA 2BDPA 4FK2A 2G8FA 3LWMA 1EKEA 4CIFA 2DY4A 1BCMA 2R7YA 3ITHA 4DF8A 4FLTA 3VQEA 1KCFA 3SQ4A 4NCGA 4RG8A 1EX4A 3DLGA 1MU2A 2FBTA 4CCHA 3ZSWA 4DTUA 5CY4A 2P51A 4FJXA 4Z4EA 4IKFA 2Z1GA 4DTXA 1NOZA 4E7JA 2PZSA 3ZT0A 2XY6A 4B9VA 3H08A 3O4QA 1CXUA 4AHRA 1J5OA 1RDAA 1VSHA 3V4IA 4DMNA 4IBNA 1NKCA 4CF8A 1QSLA 1A5VA 2YHBA 2Y1IA 1QTMA 3DRSA 3OS2A 4J2DA 4CJ4A 4C8MA 3VQCA 4HTUA 4Z4CA 1RT1A 1RBVA 5DMRA 4N5SA 4OLAA 1RBRA 3MEEA 3VA0A 2X74A 3SZ2A 3AVJA 4Q5VA 4E3SA 4DTRA 3LALA 1G15A 1TL3A 4LSNA 1F21A 1IG9A 2FBVA 3ZT3A 1S6PA 3DRRA 4CGHA 1S1VA 1UOCA 3AO2A 1FKPA 4CJ3A 4F3OA 2HB5A 4J2EA 4CFDA 4NCAA 3TAQA 1DTQA 2LSNA 4DLEA 2HVIA 4UQGA 1U48A 1XC9A 4CERA 4PQUA 3HXMA 1KRPA 1TKDA 2EHGA 4J2BA 3K5OA 1NK4A 4CE9A 4DSEA 4C8KA 1QS4A 1X9MA 4C8LA 3F9KA 2IDOA 1WSIA 4B9LA 2YKMA 3DRPA 1C0UA 5T7BA 4H4MA 1L3TA 4CEAA 4AHUA 1RILA 4DS5A 3LWLA 2G8WA 1LAVA 3S3MA 1LAWA 4DSIA 4CECA 3OYNA 4FLVA 4LY7A 2W42A 4DFMA 2KZZA 4KTWA 1C1CA 4PUOA 3ZSOA 3ASMA 5FROA 1WSEA 4FLXA 3SQ1A 3RWUA 4KTQA 4M3TA 2YKNA 1GOCA 1BL3A 4KREA 3CYMA 1FK9A 2ATQA 3SPYA 3RR8A 1RT2A 3ALYA 3ZSRA 3V9WA 5J2PA 4M3YA 2G8IA 3QIPA 1I3AA 1B92A 1ITGA 4B8AB 4KPYA 1S1XA 3I0SA 4QCLA 4DTSA 1RT3A 3AVFA 3ZSQA 4CF1A 3IG1A 2E6MA 3OYGA 4M41A 3THVA 5HBMA 1JLGA 2G8HA 4FJ8A 4CEDA 2BANA 4M3XA 3PY8A 2VG6A 4HCCA 4M3RA 1YT3A 1S9EA 1BHLA 1FKOA 2GBZA 4RW9A 4AHTA 3KD5E 1SL2A 4OGCA 4LD0A 3SYZA 3VA3A 5KRSA 3SV4A 1KLNA 3OYBA 4RW8A 1NKBA 4CJKA 1S6QA 3L2VA 3LP0A 4CJUA 2HW3A 1VSEA 3KK2A 3NH0A 4I7FA 5KTQA 4I2PA 4KRFA 1IO2A 1U04A 1RTJA 2Q3SA 4KB1A 3O3HA 3RRHA 1KVAA 4N47A 4EZ9A 3OS1A 2IS3A 4W5RA 3CFPA 5SZTA 3AO4A 1NOYA 3HYFA 4CGIA 1C6VA 3TABA 1EP4A 3AA5X 4EZ6A 4JLHA 2PYLA 1ZYQA 1SL1A 2ZE2A 2OZMA 4LSLA 1SKRA 3NBPA 3O4NA 4KI4A 2HHTA 2D5RA 2A1RA 2KZMA 2XO7A 4C8NA 1J9AA 1NKEA 3AA4A 3TWHA 3MAQA 3HK2A 1IKYA 1EETA 4KV8A 4CJVA 2KFNA 4FJ7A 3LZIA 1RT7A 4Y1DA 1ASWA 1B9FA 1W9HA 4FVMA 4FM1A 3VN5A 3OJSA 4E7LA 1XI1A 1NK9A 4KHYA 2F8SA 1S1UA 2HHSA 3PX6A 1TGOA 4CJQA 3ZT4A 5EU7A 2YNFA 2JLEA 3SUNA 1XHZA 2FC0A 4E1MA 4G1QA 3SJJA 4BDZA 3CM5A 1U4BA 4AILC 3DYAA 3AO3A 4OPJA 3OYCA 3LANA 1BISA 1VSIA 3SV3A 1VK0A 3SI6A 1KFSA 4N41A 3KJVA 3QEPA 4ELUA 1LWFA 4CJLA 4CF9A 4JRQA 4CIEA 4LH4A 3VQQA 3KLHA 1HPZA 3VQ9A 4IDKA 4W5QA 1VRTA 4CHOA 3V6DA 3VQ5A 3PV8A 4F2RA 3ISNC 3P5JA 3C6TA 3HJFA 3OYHA 3QLHA 3ZSVA 3P1GA 2E6LA 3L2WA 3LPUA 3ULDA 4ID1A 1J54A 3AVHA 3CG7A 3EY1A 3KLIA 3L2UA 4B9NA 4CF0A 4KB0A 4Q0BA 3G0ZA 4OKEA 4ZHRA 4NYNA 1J53A 2B6AA 3E01A 4BWMA 4Z4HA 1IH7A 3IS9A 3V81A 1TKXA 3HPHA 3OYLA 4EP4A 5KGXA 1JXBA 3NGZA 3S3OA 3U3YA 4K8XA 3WNEA 4DSFA 4MFBA 3AVKA 3F73A 1U45A 3C94A 1IKVA 2VWJA 4EP5A 3DLEA 3MXIA 1Q9XA 2F96A 1BIZA 4FJGA 1NK5A 3ZT2A 4B9MA 1KVCA 4FJJA 3LP2A 5HRNA 3OY9A 1Q9YA 3LDSA 2OZSA 2YHAA 2HHQA 2DTUA 3NGYA 4N76A 3MEGA 4CGJA 4JS5A 3M8RA 4FLUA 1T8EA 4F4KA 1R0AA 2FBXA 4DFJA 1CLQA 3CFOA 4E1NA 3CQ8A 3LP3A 3VQ4A 4QOZB 1O1WA 1WSHA 1WLJA 4CJEA 4R5PA 3I8DA 3TAEA 4E0DA 3L2QA 4E89A 3HT3A 1T03A 1Z26A 4CEZA 1UWBA 3NH1A 1TVRA 4DTNA 2VG7A 3HM9A 1WSJA 4FM2A 3PX4A 1CZBA 3AA2A 1L3UA 3KK3A 3DMJA 4JS4A 1TV6A 3V9SA 2HMIA 1BCOA 4NYFA 3DLRA 4MQ3A 3AVNA 3RMCA 5SWMA 2VG5A 5HLFA 3QO9A 3QEWA 4CFBA 3AA3A 4E19A 4O4GA 5FDLA 4CF2A 3V9UA 1REVA 2G8KA 3KLFA 1BI4A 3RMAA 2XY5A 2G8UA 4DTJA 4CFAA 4OLBA 3SCXA 4DWIA 3MEDA 5E41A 1RBUA 1JLAA 5HRRA 3QERA 4KTZA 4DSJA 4DFKA 5D3GA 1C0MA 3OYMA 3VQ7A 4H4OA 2D0CA 1QQCA 4CJFA 4CK2A 4FJHA 3L2RA 2QKBA 1XHXA 1JLFA 1C0TA 2HNDA 1HJRA 3SQ0A 2PYJA 5K14A 1NK0A 4CHYA 3DM2A 1RDBA 4H8KA 5JS2A 4DFPA 3VQAA 1D9DA 1KFDA 3TARA 4GVMA 4BDYA 4ZTFA 1VSMA 4GMJB 3KLGA 4E7HA 3DLHA 4ICLA 4DSKA 5KI6A 3SUOA 4W5TA 4BE1A 3S9HA 1L5UA 2ITGA 4KHUA 1RDDA 2G8VA 1ZBHA 1C1BA 4FJNA 3K2PA 3NHGA 3NAEA 2PY5A 3RR7A 5FRMA 3HSTB 3L8BA 3NF6A 1BQMA 1WNSA 1LV5A 4CJSA 1RTIA 2Z1JA 3V1RA 2X6NA 1S9GA 1D9FA 4BE0A 2B5JA 3NGIA 1UA1A 2KTQA 1LW0A 4KHQA 1CZ9A 2F8TA 4FJ5A 4FLZA 1B9DA 5C24A 5J2MA 4J2AA 4FZYA 4OKKA 4E7IA 2HNYA 3UIQA 3T19A 2RF2A 1NK8A 4FK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1J A;  4L8R B;  2A1S A;  3A2F A;  1KTQ A;  1LW2 A;  4C8O A;  1JL2 A;  2DFE A;  3HPG A;  3V9Z A;  4O55 A;  3V9X A;  2AJQ A;  3SUQ A;  4KI6 A;  3QET A;  3QES A;  4FCY A;  4IFV A;  3LAM A;  4RW7 A;  5HRP A;  3QEI A;  3KLE A;  3VQB A;  4KAZ A;  5J2Q A;  3C95 A;  2OPR A;  4Z4I A;  1N5Y A;  4CHN A;  2WOM A;  4LH5 A;  3HP6 A;  2XY7 A;  1JKH A;  4BE2 A;  3KTQ A;  4CJ5 A;  4B9S A;  3HVT A;  3U3G A;  1ASV A;  3K5L A;  4BAC A;  1TK8 A;  3TAG A;  3KD1 E;  4FJ9 A;  3KK1 A;  3OYI A;  3BDP A;  3C6U A;  3NH2 A;  1X9S A;  1SKS A;  2WON A;  1ZBI A;  1GOB A;  4BWJ A;  4M3W A;  1S5J A;  1IKX A;  1HQU A;  2OPS A;  3K58 A;  1U49 A;  4DSL A;  1BIU A;  4FXD A;  4PWD A;  1X1P A;  4Y1C A;  3OYD A;  3ZSZ A;  2QK9 A;  4AH9 A;  1ZBL A;  4FM0 A;  1Y97 A;  4DTM A;  2IC3 A;  2QKK A;  4E7K A;  4GW6 A;  2X6S A;  2YNH A;  3DLK A;  5C42 A;  3QEV A;  4DTO A;  2RN2 A;  1TL1 A;  3NFA A;  4DQR A;  1QHT A;  1UAX A;  1SL0 A;  4FLW A;  4PA1 A;  4FJM A;  5HRS A;  4CES A;  1ZBF A;  5CYQ A;  2D0A A;  3TI0 A;  3DOK A;  3PX0 A;  2ZQB A;  3M8P A;  4CHP A;  3VQ8 A;  4ELV A;  2XRI A;  1JLC A;  3WNF A;  1TK5 A;  2ETJ A;  4FW1 A;  4YNQ A;  3LAK A;  3OS0 A;  1JXE A;  3VQP A;  4FK0 A;  3WNG A;  1KLM A;  1TKT A;  4K8Z A;  1HQE A;  3K5N A;  1N6Q A;  4F8R A;  4DG1 A;  1KSP A;  2O4I A;  3DLB A;  2FBY A;  3IAY A;  2HHV A;  1L3S A;  2GUI A;  5HP1 A;  3FFI A;  1HMV A;  2DFH A;  4KFB A;  4DS4 A;  3M8S A;  3AVL A;  3ZT1 A;  3AO5 A;  1VSF A;  3OJU A;  4CIG A;  3SPZ A;  2OA8 A;  4FW2 A;  1FXX A;  4DTP A;  4M3U A;  1RBS A;  1A5X A;  4YFU A;  4FZZ A;  4HUG A;  5CYM A;  1JLB A;  3QEX A;  2P1J A;  3SQ2 A;  2HHX A;  4AHS A;  4W5O A;  3PO5 A;  2DFF A;  2IOC A;  4HCB A;  3EZ5 A;  3AVM A;  3IRX A;  3NDK A;  3HL8 A;  1L3V A;  4O0I A;  1LWC A;  4I9L A;  3B6P A;  4O0J A;  3ZCM A;  1NJY A;  3I0R A;  4NCB A;  4CJP A;  3DOL A;  1T7P A;  2OYQ A;  1BGX T;  2Z1I A;  1HRH A;  4WE1 A;  2KW4 A;  1RTH A;  3TR8 A;  3NCI A;  2KFZ A;  3B6O A;  3QIN A;  2HNZ A;  1RT5 A;  1WAF A;  2ZD1 A;  1QSY A;  1TAU A;  4O44 A;  3OYF A;  3RMD A;  1S1T A;  1NJW A;  3V1O A;  4DQP A;  4M45 A;  4CGF A;  4F2S A;  4OVL A;  3ZSY A;  4B3O A;  3RRG A;  3RMB A;  1NJX A;  3L3V A;  4CEO A;  3KKS A;  4OJR A;  4B9T A;  1U47 A;  4CGD A;  1VSD A;  1WN7 A;  3KKR A;  3DI6 A;  1YVU A;  5C25 A;  5KRT A;  4B9U A;  4FYD A;  4KHS A;  1NJZ A;  4FJK A;  5DK5 A;  1JLE A;  1QE1 A;  1UA0 A;  3S3N A;  1SKW A;  1DTT A;  1HYZ A;  3AV9 A;  4KKO A;  1D8Y A;  1DLO A;  1RT4 A;  4CGG A;  2HHU A;  4ELT A;  3AVB A;  1EXQ A;  3AVC A;  4IG3 A;  3PO4 A;  2XHB A;  4I9Q A;  1I39 A;  2EX3 A;  4CHZ A;  4BDP A;  1HNV A;  1A5W A;  3P83 D;  5CZ2 A;  1W0H A;  2NUB A;  1ZBU A;  2Z1H A;  4DQQ A;  1LWE A;  3OYA A;  3WNH A;  2B4J A;  1WAJ A;  4CJW A;  3TAP A;  4B8C A;  4RW6 A;  3HO1 A;  1RDC A;  4AHV A;  4ID5 A;  2JGU A;  1TAQ A;  2IGI A;  2XY8 A;  4KO0 A;  4OGE A;  4HHT A;  1RBT A;  3TAM A;  4XIU A;  4I2Q A;  1SV5 A;  4HUF A;  4F3T A;  1RNH A;  4IFY A;  3O3G A;  3NF8 A;  3U6F A;  4PY5 A;  4FJI A;  2HHW A;  3K57 A;  4Z4F A;  4CJR A;  4DF4 A;  3HPO A;  1T05 A;  4HUE A;  3RTV A;  4KHN A;  3KIO A;  1C1A A;  4DU1 A;  3PUF A;  5JS1 A;  4CK3 A;  4M42 A;  1GOA A;  2YNG A;  5CZ1 A;  3ZSX A;  1D5A A;  2OPQ A;  3L3U A;  3T1A A;  5KGW A;  3NF7 A;  3HVR A;  5I42 A;  4DQI A;  1VSK A;  2X78 A;  3D45 A;  1WSF A;  4KHW A;  1BQN A;  4CJT A;  3MXM A;  5I3U A;  3TAF A;  5FRN A;  1HYS A;  3OYK A;  3T3F A;  3BGR A;  2D0B A;  4HVJ A;  1TK0 A;  3AVA A;  1KVB A;  1Q8I A;  3NF9 A;  3QIO A;  4DLG A;  1HNI A;  2P5G A;  4DQS A;  3EYZ A;  2KQ2 A;  3AO1 A;  1VSJ A;  4JRP A;  4ZTJ A;  3OYE A;  2HVH A;  1QSS A;  4N56 A;  3HP9 A;  1WSG A;  3OYJ A;  1Z25 A;  2YV0 X;  3LPT A;  3QNN A;  3SNN A;  3D0P A;  1X9W A;  1NK6 A;  1VSL A;  1JLQ A;  4Z4G A;  4FZX C;  3LP1 A;  2BGG A;  4FJL A;  4CK1 A;  4O5B A;  2OPP A;  2IAJ A;  3CM6 A;  1VRU A;  4OPK A;  4AHC A;  4OKJ A;  4TSX A;  1RCH A;  5J2N A;  4B08 A;  1SUQ A;  3AVI A;  4DU4 A;  1JL1 A;  3NE6 A;  4W5N A;  3VQ6 A;  4CEF A;  2I5J A;  4RW4 A;  1RTD A;  3SUP A;  3K5M A;  1NK7 A;  3JYT A;  1XWL A;  4M3Z A;  1YTU A;  1K6Y A;  3MEC A;  2GV9 A;  5HRO A;  1YTA A;  2QXF A;  4FLY A;  2BE2 A;  3JSM A;  1IKW A;  3M8Q A;  4Z0U A;  2YNI A;  3TAN A;  4CEE A;  3QNO A;  3G10 A;  3V1Q A;  5J1E A;  3O3F A;  1S1W A;  3K59 A;  1TKZ A;  2O4G A;  4CHQ A;  3MXJ A;  4QAG A;  4DU3 A;  2VWK A;  1CXQ A;  4CEB A;  4CEQ A;  4CFC A;  2E4L A;  3OVN A;  1HYV A;  1ASU A;  1RT6 A;  2RKI A;  1BI4 B;  3AVG A;  3CFR A;  3LZJ A;  2RPI A;  4IG0 A;  3VQD A;  2P5O A;  2BDP A;  4FK2 A;  2G8F A;  3LWM A;  1EKE A;  4CIF A;  2DY4 A;  1BCM A;  2R7Y A;  3ITH A;  4DF8 A;  4FLT A;  3VQE A;  1KCF A;  3SQ4 A;  4NCG A;  4RG8 A;  1EX4 A;  3DLG A;  1MU2 A;  2FBT A;  4CCH A;  3ZSW A;  4DTU A;  5CY4 A;  2P51 A;  4FJX A;  4Z4E A;  4IKF A;  2Z1G A;  4DTX A;  1NOZ A;  4E7J A;  2PZS A;  3ZT0 A;  2XY6 A;  4B9V A;  3H08 A;  3O4Q A;  1CXU A;  4AHR A;  1J5O A;  1RDA A;  1VSH A;  3V4I A;  4DMN A;  4IBN A;  1NKC A;  4CF8 A;  1QSL A;  1A5V A;  2YHB A;  2Y1I A;  1QTM A;  3DRS A;  3OS2 A;  4J2D A;  4CJ4 A;  4C8M A;  3VQC A;  4HTU A;  4Z4C A;  1RT1 A;  1RBV A;  5DMR A;  4N5S A;  4OLA A;  1RBR A;  3MEE A;  3VA0 A;  2X74 A;  3SZ2 A;  3AVJ A;  4Q5V A;  4E3S A;  4DTR A;  3LAL A;  1G15 A;  1TL3 A;  4LSN A;  1F21 A;  1IG9 A;  2FBV A;  3ZT3 A;  1S6P A;  3DRR A;  4CGH A;  1S1V A;  1UOC A;  3AO2 A;  1FKP A;  4CJ3 A;  4F3O A;  2HB5 A;  4J2E A;  4CFD A;  4NCA A;  3TAQ A;  1DTQ A;  2LSN A;  4DLE A;  2HVI A;  4UQG A;  1U48 A;  1XC9 A;  4CER A;  4PQU A;  3HXM A;  1KRP A;  1TKD A;  2EHG A;  4J2B A;  3K5O A;  1NK4 A;  4CE9 A;  4DSE A;  4C8K A;  1QS4 A;  1X9M A;  4C8L A;  3F9K A;  2IDO A;  1WSI A;  4B9L A;  2YKM A;  3DRP A;  1C0U A;  5T7B A;  4H4M A;  1L3T A;  4CEA A;  4AHU A;  1RIL A;  4DS5 A;  3LWL A;  2G8W A;  1LAV A;  3S3M A;  1LAW A;  4DSI A;  4CEC A;  3OYN A;  4FLV A;  4LY7 A;  2W42 A;  4DFM A;  2KZZ A;  4KTW A;  1C1C A;  4PUO A;  3ZSO A;  3ASM A;  5FRO A;  1WSE A;  4FLX A;  3SQ1 A;  3RWU A;  4KTQ A;  4M3T A;  2YKN A;  1GOC A;  1BL3 A;  4KRE A;  3CYM A;  1FK9 A;  2ATQ A;  3SPY A;  3RR8 A;  1RT2 A;  3ALY A;  3ZSR A;  3V9W A;  5J2P A;  4M3Y A;  2G8I A;  3QIP A;  1I3A A;  1B92 A;  1ITG A;  4B8A B;  4KPY A;  1S1X A;  3I0S A;  4QCL A;  4DTS A;  1RT3 A;  3AVF A;  3ZSQ A;  4CF1 A;  3IG1 A;  2E6M A;  3OYG A;  4M41 A;  3THV A;  5HBM A;  1JLG A;  2G8H A;  4FJ8 A;  4CED A;  2BAN A;  4M3X A;  3PY8 A;  2VG6 A;  4HCC A;  4M3R A;  1YT3 A;  1S9E A;  1BHL A;  1FKO A;  2GBZ A;  4RW9 A;  4AHT A;  3KD5 E;  1SL2 A;  4OGC A;  4LD0 A;  3SYZ A;  3VA3 A;  5KRS A;  3SV4 A;  1KLN A;  3OYB A;  4RW8 A;  1NKB A;  4CJK A;  1S6Q A;  3L2V A;  3LP0 A;  4CJU A;  2HW3 A;  1VSE A;  3KK2 A;  3NH0 A;  4I7F A;  5KTQ A;  4I2P A;  4KRF A;  1IO2 A;  1U04 A;  1RTJ A;  2Q3S A;  4KB1 A;  3O3H A;  3RRH A;  1KVA A;  4N47 A;  4EZ9 A;  3OS1 A;  2IS3 A;  4W5R A;  3CFP A;  5SZT A;  3AO4 A;  1NOY A;  3HYF A;  4CGI A;  1C6V A;  3TAB A;  1EP4 A;  3AA5 X;  4EZ6 A;  4JLH A;  2PYL A;  1ZYQ A;  1SL1 A;  2ZE2 A;  2OZM A;  4LSL A;  1SKR A;  3NBP A;  3O4N A;  4KI4 A;  2HHT A;  2D5R A;  2A1R A;  2KZM A;  2XO7 A;  4C8N A;  1J9A A;  1NKE A;  3AA4 A;  3TWH A;  3MAQ A;  3HK2 A;  1IKY A;  1EET A;  4KV8 A;  4CJV A;  2KFN A;  4FJ7 A;  3LZI A;  1RT7 A;  4Y1D A;  1ASW A;  1B9F A;  1W9H A;  4FVM A;  4FM1 A;  3VN5 A;  3OJS A;  4E7L A;  1XI1 A;  1NK9 A;  4KHY A;  2F8S A;  1S1U A;  2HHS A;  3PX6 A;  1TGO A;  4CJQ A;  3ZT4 A;  5EU7 A;  2YNF A;  2JLE A;  3SUN A;  1XHZ A;  2FC0 A;  4E1M A;  4G1Q A;  3SJJ A;  4BDZ A;  3CM5 A;  1U4B A;  4AIL C;  3DYA A;  3AO3 A;  4OPJ A;  3OYC A;  3LAN A;  1BIS A;  1VSI A;  3SV3 A;  1VK0 A;  3SI6 A;  1KFS A;  4N41 A;  3KJV A;  3QEP A;  4ELU A;  1LWF A;  4CJL A;  4CF9 A;  4JRQ A;  4CIE A;  4LH4 A;  3VQQ A;  3KLH A;  1HPZ A;  3VQ9 A;  4IDK A;  4W5Q A;  1VRT A;  4CHO A;  3V6D A;  3VQ5 A;  3PV8 A;  4F2R A;  3ISN C;  3P5J A;  3C6T A;  3HJF A;  3OYH A;  3QLH A;  3ZSV A;  3P1G A;  2E6L A;  3L2W A;  3LPU A;  3ULD A;  4ID1 A;  1J54 A;  3AVH A;  3CG7 A;  3EY1 A;  3KLI A;  3L2U A;  4B9N A;  4CF0 A;  4KB0 A;  4Q0B A;  3G0Z A;  4OKE A;  4ZHR A;  4NYN A;  1J53 A;  2B6A A;  3E01 A;  4BWM A;  4Z4H A;  1IH7 A;  3IS9 A;  3V81 A;  1TKX A;  3HPH A;  3OYL A;  4EP4 A;  5KGX A;  1JXB A;  3NGZ A;  3S3O A;  3U3Y A;  4K8X A;  3WNE A;  4DSF A;  4MFB A;  3AVK A;  3F73 A;  1U45 A;  3C94 A;  1IKV A;  2VWJ A;  4EP5 A;  3DLE A;  3MXI A;  1Q9X A;  2F96 A;  1BIZ A;  4FJG A;  1NK5 A;  3ZT2 A;  4B9M A;  1KVC A;  4FJJ A;  3LP2 A;  5HRN A;  3OY9 A;  1Q9Y A;  3LDS A;  2OZS A;  2YHA A;  2HHQ A;  2DTU A;  3NGY A;  4N76 A;  3MEG A;  4CGJ A;  4JS5 A;  3M8R A;  4FLU A;  1T8E A;  4F4K A;  1R0A A;  2FBX A;  4DFJ A;  1CLQ A;  3CFO A;  4E1N A;  3CQ8 A;  3LP3 A;  3VQ4 A;  4QOZ B;  1O1W A;  1WSH A;  1WLJ A;  4CJE A;  4R5P A;  3I8D A;  3TAE A;  4E0D A;  3L2Q A;  4E89 A;  3HT3 A;  1T03 A;  1Z26 A;  4CEZ A;  1UWB A;  3NH1 A;  1TVR A;  4DTN A;  2VG7 A;  3HM9 A;  1WSJ A;  4FM2 A;  3PX4 A;  1CZB A;  3AA2 A;  1L3U A;  3KK3 A;  3DMJ A;  4JS4 A;  1TV6 A;  3V9S A;  2HMI A;  1BCO A;  4NYF A;  3DLR A;  4MQ3 A;  3AVN A;  3RMC A;  5SWM A;  2VG5 A;  5HLF A;  3QO9 A;  3QEW A;  4CFB A;  3AA3 A;  4E19 A;  4O4G A;  5FDL A;  4CF2 A;  3V9U A;  1REV A;  2G8K A;  3KLF A;  1BI4 A;  3RMA A;  2XY5 A;  2G8U A;  4DTJ A;  4CFA A;  4OLB A;  3SCX A;  4DWI A;  3MED A;  5E41 A;  1RBU A;  1JLA A;  5HRR A;  3QER A;  4KTZ A;  4DSJ A;  4DFK A;  5D3G A;  1C0M A;  3OYM A;  3VQ7 A;  4H4O A;  2D0C A;  1QQC A;  4CJF A;  4CK2 A;  4FJH A;  3L2R A;  2QKB A;  1XHX A;  1JLF A;  1C0T A;  2HND A;  1HJR A;  3SQ0 A;  2PYJ A;  5K14 A;  1NK0 A;  4CHY A;  3DM2 A;  1RDB A;  4H8K A;  5JS2 A;  4DFP A;  3VQA A;  1D9D A;  1KFD A;  3TAR A;  4GVM A;  4BDY A;  4ZTF A;  1VSM A;  4GMJ B;  3KLG A;  4E7H A;  3DLH A;  4ICL A;  4DSK A;  5KI6 A;  3SUO A;  4W5T A;  4BE1 A;  3S9H A;  1L5U A;  2ITG A;  4KHU A;  1RDD A;  2G8V A;  1ZBH A;  1C1B A;  4FJN A;  3K2P A;  3NHG A;  3NAE A;  2PY5 A;  3RR7 A;  5FRM A;  3HST B;  3L8B A;  3NF6 A;  1BQM A;  1WNS A;  1LV5 A;  4CJS A;  1RTI A;  2Z1J A;  3V1R A;  2X6N A;  1S9G A;  1D9F A;  4BE0 A;  2B5J A;  3NGI A;  1UA1 A;  2KTQ A;  1LW0 A;  4KHQ A;  1CZ9 A;  2F8T A;  4FJ5 A;  4FLZ A;  1B9D A;  5C24 A;  5J2M A;  4J2A A;  4FZY A;  4OKK A;  4E7I A;  2HNY A;  3UIQ A;  3T19 A;  2RF2 A;  1NK8 A;  4FK4 A; 
#chains in the Genus database with same CATH topology
 3HOT A;  3A2F A;  1LW2 A;  3CCL N;  1JL2 A;  4JHD A;  3M1F A;  5HRP A;  2FLO A;  5J2Q A;  3C95 A;  4CHN A;  3HP6 A;  2ITM A;  3KTQ A;  4CJ5 A;  5AFU H;  3U3G A;  3DXM A;  5C2D A;  3CME N;  3KD1 E;  3TAG A;  3BY5 A;  3C6U A;  1W97 L;  5AQS A;  4DV5 K;  4DSL A;  1BIU A;  2QK9 A;  3FZK A;  4AH9 A;  3R8E A;  4E7K A;  4GW6 A;  4A62 A;  4BRE A;  3IDH A;  4WQ4 A;  4C1N I;  3NFA A;  4DQR A;  3CC4 N;  1SL0 A;  4FLW A;  4CES A;  3LDN A;  2D0A A;  3DOK A;  2EWS A;  3PX0 A;  4ELV A;  4CHP A;  3VQ8 A;  4CZF A;  4K41 A;  3LAK A;  3ATV A;  1JXE A;  1NGG A;  5AQG A;  3VQP A;  1WOQ A;  2O4I A;  2HHV A;  5ADX A;  4IOA L;  3TSP A;  2GUI A;  1VQK N;  4M3U A;  1VSF A;  3OJU A;  4FW2 A;  1FXX A;  4YFU A;  4DR2 K;  3CJB A;  2P1J A;  4JKD A;  4AHS A;  4W5O A;  1HR0 K;  4FWS A;  5AQR A;  3HL8 A;  4CZE A;  3DOL A;  1BGX T;  4FOE A;  3B6O A;  3QIN A;  4O44 A;  4FWN A;  1YI2 N;  4CGF A;  1SQK A;  4BR7 A;  3CCS N;  1N32 K;  5JVH L;  3DI6 A;  5C25 A;  5AQO A;  5DK5 A;  2Q1N A;  3AV9 A;  4KKO A;  1D8Y A;  2QWN A;  4JKG A;  3MN7 A;  2YCH A;  4IG3 A;  2D0O A;  1VQ6 N;  1HNV A;  2KKZ A;  4DQQ A;  3DXM B;  5AQW A;  1Q18 A;  1ESV A;  1WAJ A;  3HO1 A;  1RDC A;  4AHV A;  4ID5 A;  4KO0 A;  1ATR A;  1TAQ A;  2XY8 A;  3TAM A;  4XIU A;  2WBN A;  4IJA A;  4F3T A;  2ZJR L;  3O9Q A;  4PY5 A;  4YDU C;  4Z4F A;  4DF4 A;  4M42 A;  2QWR A;  1GOA A;  2YNG A;  5CZ1 A;  3ZSX A;  1D5A A;  3HVR A;  3T1A A;  2F4V K;  3D45 A;  1BQN A;  5I3U A;  3OYK A;  1BA1 A;  2D0B A;  4HVJ A;  3QBW A;  4DQS A;  2VQE K;  1NGH A;  3EYZ A;  3A5M C;  3A5O C;  3OYE A;  3E1Y A;  4N56 A;  3OYJ A;  2ZJQ L;  3SNN A;  2GEM A;  1KC8 O;  2BGG A;  2HF3 A;  4IOX A;  4OKJ A;  4B08 A;  4DU4 A;  2QWQ A;  4GV3 A;  1HLU A;  3HSC A;  2QWP A;  4W5N A;  3ZET A;  1NK7 A;  2I7N A;  1YTA A;  5BPM A;  4MLH A;  2V51 B;  2YNI A;  4Z0U A;  3QNO A;  1QQN A;  1S1W A;  3K59 A;  1GLD G;  4CHQ A;  4YOT A;  1V4T A;  4DU3 A;  2VWK A;  4CEQ A;  4GV6 A;  4CFC A;  2E4L A;  3C0B A;  1HYV A;  1RT6 A;  3AVG A;  2RPI A;  3VQD A;  2Q97 A;  2G8F A;  1GLJ O;  1VQ5 N;  4DF8 A;  4C1N K;  1NNE A;  4BC5 A;  1KCF A;  2PFU A;  4LF7 K;  1MU2 A;  2FBT A;  4QS9 A;  4JKG B;  4KH6 A;  4BRQ A;  4FJX A;  4IKF A;  1NOZ A;  3FZL A;  3H08 A;  3O4Q A;  1J5O A;  1RDA A;  4KH4 A;  5A2Q O;  4BRO A;  4X62 K;  3SK3 A;  1NKC A;  3O9R A;  1GLL O;  3DRS A;  3VQC A;  4HTU A;  1T3V A;  2ZGZ A;  4PL7 A;  4N5S A;  4OLA A;  3R1X A;  3AVJ A;  1G15 A;  4LSN A;  1IJJ A;  1F21 A;  5AZI B;  4FWP A;  3SMP A;  1FW6 A;  3DRR A;  1S1V A;  2F9T A;  3AO2 A;  3D2F A;  4FWQ A;  3A8Y A;  3QFU A;  3VES A;  1C0G A;  3KK7 A;  1U48 A;  3WXI A;  4XH4 A;  4CER A;  1KRP A;  3T69 A;  3K5O A;  3DLL L;  1YIJ N;  4CE9 A;  4BC2 A;  4DSE A;  1QS4 A;  5BRD A;  1X9M A;  2IDO A;  4B9L A;  2YKM A;  3DRP A;  5T7B A;  1RIL A;  3CCJ N;  1LAV A;  5AQQ A;  3D2E A;  4CEC A;  2KZZ A;  4IWV A;  4LY7 A;  2VQF K;  4KTW A;  4FLX A;  4KTQ A;  5BR8 K;  1E4F T;  2QXL A;  3V9W A;  3QIP A;  4BRA A;  1W7A A;  1I3A A;  3W3D A;  2OTL N;  4H0P A;  2E6M A;  3THV A;  5HBM A;  5M1N A;  2G8H A;  4BR0 A;  5FPE A;  2ZF5 O;  4HCC A;  1YT3 A;  1JCE A;  1BHL A;  3T7Z A;  2YJF A;  5EOY A;  2FSN A;  3MX5 A;  4BRL A;  4OGC A;  5KRS A;  3SV4 A;  4K42 A;  3VER A;  2IIR A;  3U4L A;  3WEE B;  1NKB A;  4CJK A;  3PSI A;  4I7F A;  3O9T A;  1IO2 A;  4YOR A;  1BDG A;  3OS1 A;  4NLB A;  2IS3 A;  3J7A P;  1QZ6 A;  3HYF A;  1C6V A;  4EZ6 A;  1ZYQ A;  3ZEU A;  2OZM A;  3CCV N;  5IWA K;  1QVG M;  1SKR A;  3NBP A;  4KI4 A;  1KAX A;  3AAQ A;  3B8A X;  1NKE A;  3AA4 A;  3VEO A;  4CBW A;  3MAQ A;  3TWH A;  3HK2 A;  1EET A;  4KV8 A;  2KZM A;  3LZI A;  1B9F A;  1W9H A;  2P9K A;  3H3N O;  2F8S A;  3VN5 A;  1XI1 A;  4E7L A;  5C2F A;  1OH6 A;  1TGO A;  5GAE P;  5ELZ A;  4G1Q A;  2P9L A;  4A57 A;  3DJC A;  4AIL C;  1K9M O;  3CIP A;  3OYC A;  3D2F B;  2P9I A;  3PIP L;  1BIS A;  1YUW A;  4CF9 A;  4PL8 A;  1HPZ A;  3R3L A;  4YDU A;  4IDK A;  4W5Q A;  4IOC L;  4CHO A;  4F2R A;  2UYT A;  3P1G A;  3CG7 A;  3FZH A;  4KB0 A;  4OKE A;  4ZHR A;  4NYN A;  4Z4H A;  3E01 A;  1ATN A;  3OYL A;  3S3O A;  3D2E B;  4DSF A;  3C94 A;  4EP5 A;  3MXI A;  3ENB A;  3WXJ A;  2HST A;  2VGM A;  3ZT2 A;  4F9O A;  1MWM A;  3OY9 A;  3J81 O;  2DTU A;  3MEG A;  3VET A;  4FLU A;  4JD2 A;  2FBX A;  4E1N A;  1JCG A;  3P38 A;  4IFE A;  1WLJ A;  4R5P A;  3TAE A;  3L2Q A;  3HT3 A;  2QM1 A;  1TVR A;  5FPN A;  1WSJ A;  3PX4 A;  1CZB A;  2HBL A;  3T1H K;  1K8A O;  3CJ1 A;  3DMJ A;  3V9S A;  2HMI A;  1BCO A;  3VGM A;  1NM1 A;  1VQ9 N;  3RMC A;  5HLF A;  3QEW A;  3M3Z A;  1T6C A;  4E19 A;  4WYB A;  2Q2R A;  1REV A;  3KLF A;  3ID8 A;  1T44 A;  4OLB A;  1JLA A;  3O6W A;  5HRR A;  4DSJ A;  3PSF A;  5ADX H;  4CJF A;  4DUZ K;  4FJH A;  1BOT O;  3H1V X;  4ILH A;  2HND A;  2HHH K;  1HJR A;  1NK0 A;  1HJO A;  2KHO A;  4DR3 K;  2P9K B;  2FSJ A;  4BDY A;  4DV6 K;  4O8K A;  4E7H A;  3LDQ A;  4AQY K;  3S9H A;  4BR9 A;  1ZBH A;  1RDD A;  2G8V A;  3K2P A;  2PY5 A;  2UXB K;  3HI0 A;  1BQM A;  3CF5 L;  3V1R A;  1XNQ K;  2B5J A;  3NGI A;  1UA1 A;  1LW0 A;  3IFR A;  4DV1 K;  3T1Y K;  3FR0 A;  4FK4 A;  3WQU A;  4BY9 C;  4L8R B;  1NGD A;  2A1S A;  2F9W A;  3AGR A;  2YX6 A;  5AQJ A;  2DFE A;  3V9X A;  2AJQ A;  4KI6 A;  2Q0R A;  3QET A;  3QES A;  5CHI A;  4KAZ A;  3CQY A;  3WQT A;  1N5Y A;  3AAP A;  1NMN A;  3HVT A;  4AF1 A;  4FJ9 A;  3GDQ A;  3KK1 A;  3NH2 A;  1X9S A;  1SKS A;  1U2V B;  2WON A;  4BWJ A;  1IKX A;  4PWD A;  1ZBL A;  2E20 A;  4FM0 A;  1Y97 A;  3MDQ A;  4DTM A;  3HBT A;  2UXC K;  3DLK A;  4KHP K;  1TL1 A;  1KAZ A;  2O8E A;  5HRS A;  2GWK A;  3WT0 A;  3GG4 A;  4BRH A;  2ETJ A;  4YNQ A;  3GL1 A;  5AZJ A;  1KLM A;  4MO5 A;  2FBY A;  5DM7 L;  1L3S A;  2F7T A;  1YJW N;  2DFH A;  4KFB A;  4DS4 A;  2OA8 A;  4BRD A;  4DTP A;  3IKM A;  1RBS A;  4FZZ A;  5CYM A;  1JLB A;  3SQ2 A;  2E2O A;  4DQ8 A;  3MCP A;  2IOC A;  1OH7 A;  3IRX A;  4JI6 K;  4O0I A;  1RDW X;  4I9L A;  3B6P A;  1NJY A;  3VPZ A;  1S72 N;  5AQH A;  1VQ8 N;  2OYQ A;  2Z1I A;  5AQL A;  3UE5 A;  3EZW A;  1RTH A;  3TR8 A;  1RT5 A;  2ZD1 A;  1QSY A;  1TAU A;  2E1Y A;  1NJW A;  2RE2 A;  4M45 A;  4F2S A;  3HTV A;  3RMB A;  4K43 A;  3KKS A;  1U47 A;  3KKR A;  1YVU A;  4LF4 K;  3CMA N;  3HRG A;  2P9P A;  4B3T K;  1JLE A;  1UA0 A;  3S3N A;  4CGG A;  2HHU A;  3C6A A;  4Z94 A;  3GOI A;  4GY2 B;  2XHB A;  4Y0W A;  1E3M A;  1W0H A;  2NUB A;  2UUC K;  2Z1H A;  4BR2 A;  3TAP A;  3U9D A;  3EKU A;  1T6D A;  3RVC A;  2A42 A;  1RBT A;  3LM9 A;  3VEZ A;  4OO1 J;  3EE8 A;  2QEX N;  3O3G A;  3L4I A;  4FJI A;  2HHW A;  3ULE B;  4KHN A;  3HPO A;  1T05 A;  3CJ7 A;  4BVO A;  4DU1 A;  3BUZ B;  2OPQ A;  3EO3 A;  3L3U A;  3P39 A;  4DQI A;  2E5L K;  1NG9 A;  1VSK A;  3I55 N;  4ISF A;  4KHW A;  1HYS A;  3T3F A;  2Q36 A;  4DLG A;  2P5G A;  5DM6 L;  5C0Y A;  1QSS A;  2IVP A;  2YV0 X;  3QNN A;  1NK6 A;  3OA9 A;  5EXW A;  5EVZ A;  3GE1 A;  2OPP A;  3CM6 A;  4OPK A;  4LFC K;  5KPT A;  3AVI A;  1JL1 A;  3NE6 A;  1K8K B;  4A59 A;  1RTD A;  4RW4 A;  4AM6 A;  1XWL A;  1K6Y A;  3FZM A;  2BE2 A;  2GWJ A;  2HF4 A;  4MDB A;  5LJW A;  1EO1 A;  4CEE A;  2A6A A;  2UUB K;  2P9U A;  3V1Q A;  5J1E A;  3UKU B;  1TKZ A;  2O4G A;  1NJI O;  4CEB A;  4CVN E;  2QA4 N;  2RKI A;  4IG0 A;  2P5O A;  1EKE A;  4CIF A;  2DY4 A;  4KBO A;  1GLC G;  3VQE A;  2WC9 A;  3SQ4 A;  3HM8 A;  4RG8 A;  1EX4 A;  4JNE A;  4RCH A;  3VEV A;  5CY4 A;  2Z1G A;  4DTX A;  1SAZ A;  3ZT0 A;  1CXU A;  4DMN A;  4JKB A;  4DR1 K;  2WUS A;  1QHA A;  1QTM A;  4V19 S;  3OS2 A;  4C8M A;  3ZX2 A;  5C12 A;  2RHK A;  1OH5 A;  1RBV A;  4OX9 K;  4JI4 K;  5LJV A;  3VA0 A;  1MDU B;  4DTR A;  3LAL A;  4JI1 K;  3BZK A;  1UOC A;  3DXK A;  1FKP A;  2HB5 A;  4J2E A;  4NCA A;  1DTQ A;  5FPM A;  4DLE A;  2HVI A;  4PQU A;  3R6M A;  1KAY A;  4UY8 O;  2EHG A;  3ZX0 A;  5AQZ A;  3Q7B A;  2D1K A;  4JHD B;  1YIT N;  4CEA A;  1XQS C;  1IBL K;  3KWG A;  2G8W A;  5BRH A;  4FLV A;  2W42 A;  4DFM A;  1C1C A;  5FRO A;  4B1Y B;  3I56 N;  4NLC A;  2YKN A;  5F1X A;  3JXU A;  3QBX A;  3AGK A;  3CYM A;  1YJ9 N;  3RR8 A;  5J2P A;  4B8A B;  4KPY A;  5AR0 A;  4CF1 A;  3IG1 A;  1VQM N;  3NVK A;  3A0I X;  3VGK A;  4FJ8 A;  4CED A;  3O8M A;  4XEI A;  3QFP A;  1FKO A;  1ZXO A;  4ISE A;  3FFK B;  4RW9 A;  2FF3 B;  1SL2 A;  3SYZ A;  4ILG B;  3LP0 A;  1VSE A;  3NH0 A;  4RTF D;  4I2P A;  5AQY A;  5M1K A;  1RTJ A;  1TUY A;  1KVA A;  1J6Z A;  4BQZ A;  4W5R A;  3CFP A;  2YJE A;  3FZF A;  4H5R A;  3TAB A;  4JKF A;  3AA5 X;  2PYL A;  2ZE2 A;  4LSL A;  3QML A;  3O4N A;  2HHT A;  3M6G A;  5JLF A;  1IKY A;  3J8A A;  4B1X B;  4J8F A;  2BUP A;  5BRF A;  3TPQ A;  1N34 K;  2VCP A;  4FVM A;  4FM1 A;  3OJS A;  2HHS A;  3PX6 A;  4BVP A;  2YNF A;  4RWT A;  3SMS A;  5FPD A;  2FC0 A;  3SJJ A;  4BDZ A;  4GKK K;  3DYA A;  3VF4 A;  1HPM A;  3FLC O;  5M1Q A;  2O8C A;  4N41 A;  1QQM A;  4CJL A;  2VWB A;  3LM2 A;  4H5V A;  4BC4 A;  1LCU A;  4H0O A;  1VRT A;  3PV8 A;  3L4Q A;  1Z05 A;  3HJF A;  2P9N A;  2O8D A;  3OYH A;  3L2W A;  2PBD A;  3ZSV A;  1YTU A;  1WUA A;  4B9N A;  3G0Z A;  4GKJ K;  4BWM A;  2B6A A;  2WTU A;  3V81 A;  4BRI A;  1JXB A;  3F2K A;  2WFB A;  2ZM6 K;  4MFB A;  1YHQ N;  3AVK A;  1U45 A;  1KD1 O;  1IKV A;  1Q9X A;  3MWT A;  1CZA N;  4B9M A;  4BGB A;  2NNW A;  5FLX O;  2OZS A;  2YHA A;  3BP8 A;  4NB4 A;  3NGY A;  1YXQ A;  4H0V B;  4CGJ A;  1QZ5 A;  3CQ8 A;  4QOZ B;  3LP3 A;  2AP1 A;  3C7N A;  3SAH A;  4JI8 K;  3CXC M;  3A5N C;  1S22 A;  4CJE A;  5AQT A;  3K0S A;  2CGK A;  4CZI A;  3NH1 A;  4CEZ A;  1UWB A;  3CCM N;  4DTN A;  4A61 A;  4IEI A;  2D4W A;  4BRF A;  2QI2 A;  5SWM A;  4CFB A;  1NGF A;  2GUP A;  5FDL A;  3BZC A;  1R59 O;  3MN6 A;  1S3X A;  1BI4 A;  3G4S N;  4A5A A;  4WFA L;  1KXP A;  3QER A;  5D3G A;  4DFK A;  2A3Z A;  3LL3 A;  4PKI A;  4H4O A;  5JIC A;  1QQC A;  1Q82 O;  3EE9 A;  3IUC A;  3L2R A;  4LF5 K;  3KZB A;  1C0T A;  3ZET B;  2PYJ A;  1EQY A;  3DM2 A;  1RDB A;  3VQA A;  4EHT A;  1HUX A;  4ICL A;  3VOV A;  5KI6 A;  2DPN A;  4W5T A;  3SUO A;  1L5U A;  5I9E B;  4KHU A;  1EWQ A;  4JKH A;  3CI5 A;  3NAE A;  3RR7 A;  1DKG D;  3HST B;  3SBG A;  3NF6 A;  4CJS A;  4CZL A;  3I8B A;  2KTQ A;  3SBT A;  4FL9 A;  4FLZ A;  5C24 A;  5J2M A;  5GAH P;  5BPL A;  4DCH A;  2HNY A;  3T19 A;  4B3R K;  3OW2 M;  4BC3 A;  1KTQ A;  2NRZ A;  1GLA G;  1Z6R A;  3V9Z A;  2QTD A;  3SUQ A;  4FCY A;  3D7E O;  4IFV A;  3LAM A;  3KLE A;  2OPR A;  2WOM A;  3TTF A;  2XY7 A;  4BE2 A;  4CZM A;  3U9Z A;  4B9S A;  1NU0 A;  1ASV A;  3TU5 A;  4BAC A;  5EX5 A;  3OYI A;  1G99 A;  4CD1 A;  4DHY A;  4M3W A;  2OPS A;  5KQD A;  1U49 A;  1X1P A;  3OYD A;  3C7N B;  2QKK A;  2QW9 A;  2X6S A;  2YNH A;  2ASM A;  2RN2 A;  1HKB A;  2VYP A;  2V7Z A;  3THY A;  1QHT A;  4OPA A;  3O9S A;  4LF9 K;  1ZBF A;  5CYQ A;  4FVU A;  3TI0 A;  3M8P A;  2XRI A;  1JLC A;  4FW1 A;  3WNG A;  4BRM A;  3E9O A;  3THW A;  1KSP A;  3DLB A;  3IAY A;  3ENO A;  3RSE A;  1HMV A;  3M8S A;  3ZT1 A;  3AO5 A;  3SLC A;  3SPZ A;  1A5X A;  4HUG A;  4GNI A;  3QEX A;  4JYA K;  2HHX A;  2H3G X;  3CER A;  2DFF A;  1E4G T;  3EKS A;  3AVM A;  4FWM A;  3EZ5 A;  1LWC A;  4O0J A;  2QWO A;  4DR6 K;  1BWF O;  4JK7 A;  1WBB A;  4I6M A;  3NCI A;  2KFZ A;  3MWP A;  2HNZ A;  1WAF A;  4FPA A;  3OYF A;  3RMD A;  3BEX A;  2O8B A;  1GLF O;  3L3V A;  4MLE A;  2OCE A;  4CEO A;  4B9T A;  3CD6 N;  4CGD A;  1JJ2 M;  4FYD A;  4O5F A;  4KHS A;  1NJZ A;  5GIO A;  3ZEU B;  4B9Q A;  1DTT A;  1RT4 A;  4R79 A;  4H5T A;  4ELT A;  3AVB A;  2YHY A;  4I9Q A;  5AQK A;  1NGI A;  4CHZ A;  3P83 D;  1XNR K;  2CGJ A;  3VEW A;  3WNH A;  4CZG A;  4B8C A;  2P9L B;  4RW6 A;  2JGU A;  4BRP A;  2IGI A;  2P9I B;  3UKR A;  4I2Q A;  1SV5 A;  4HUF A;  1RNH A;  4IFY A;  4IXC A;  4IO9 L;  4LFA K;  4PKG A;  4HUE A;  5JS1 A;  3PUF A;  4CK3 A;  1YVN A;  3N4Q A;  1KQS M;  3ATU A;  3ZYY X;  2Y1I A;  2FXU A;  5I42 A;  4DB3 A;  3TAF A;  2E2Q A;  3BGR A;  4B1U B;  3BF3 A;  4FWL A;  3QIO A;  1HNI A;  5EY4 A;  1VSJ A;  2P9S A;  4JRP A;  4IDH A;  4ZTJ A;  2HVH A;  3HP9 A;  1WSG A;  4DR7 K;  1Z25 A;  3LPT A;  4CBX A;  5GIP A;  3D0P A;  1JLQ A;  4O8U A;  4FZX C;  1DEJ A;  3LP1 A;  4FJL A;  4CK1 A;  4O5B A;  1VQN N;  4JD2 B;  4QS7 A;  1RCH A;  2NRX A;  2E2N A;  3VQ6 A;  1ILY A;  4WFN L;  3K5M A;  3QIC A;  4MDA A;  3F9M A;  4M3Z A;  4IO8 A;  3GBT A;  4DV4 K;  2JWL A;  5HRO A;  2QXF A;  4FLY A;  3JSM A;  3M8Q A;  1HX1 A;  4JAX A;  1J5E K;  3O3F A;  3E9P A;  4JI3 K;  4QAG A;  1C0F A;  3OVN A;  3CCR N;  1ASU A;  3CFR A;  5JVG L;  2V7Y A;  4FK2 A;  3P4I A;  3LWM A;  3THX A;  4FWR A;  1BCM A;  4X65 K;  2R7Y A;  5AQV A;  4DV7 K;  1N8R O;  4FLT A;  1M1K O;  4DV3 K;  1XMQ K;  4DTU A;  2A5X A;  2P51 A;  1RDU A;  4B9V A;  4E7J A;  2PZS A;  1VSH A;  4DV0 K;  1VQL N;  1QSL A;  2E1Z A;  4U67 L;  2YHB A;  2HBJ A;  5LMN K;  1VQP N;  4CJ4 A;  3CQX A;  1RBR A;  1VAZ A;  1NBW A;  2X74 A;  4Q5V A;  4E3S A;  1LOT B;  3M5R A;  3ZT3 A;  1HNX K;  5HOO A;  4BRG A;  4XH5 A;  3TAQ A;  4CI6 A;  3MMV A;  1XC9 A;  4EFH A;  3EL2 A;  2YHX A;  1WSI A;  1C0U A;  1L3T A;  3J80 O;  4DS5 A;  3LWL A;  3S3M A;  3OBW A;  3I33 A;  3CCQ N;  4PUO A;  3ZSO A;  3ASM A;  3SQ1 A;  1WSE A;  3RWU A;  5AQU A;  3FE1 A;  1GOC A;  3G25 A;  4A2B A;  1FK9 A;  1RT2 A;  4M3Y A;  2G8I A;  3CJ9 A;  1IBK K;  1B92 A;  4A2A A;  1ITG A;  3U8X A;  1IG8 A;  4A5B A;  1Q86 O;  4DTS A;  1RT3 A;  3AVF A;  4BQL A;  4M41 A;  2O8E B;  2BAN A;  2NRH A;  3O80 A;  4DKW A;  3PY8 A;  4JK8 A;  3WXL A;  4CW7 B;  1S9E A;  5GAG P;  3CC2 N;  5AZJ B;  4JK9 A;  3OYB A;  4RW8 A;  1S6Q A;  4IEE A;  2E2P A;  3KK2 A;  1EWR A;  4KRF A;  4XH1 A;  2Q3S A;  4KB1 A;  4EZ9 A;  3CCU N;  2ZGY A;  4LFB K;  5SZT A;  3AO4 A;  1NOY A;  4CGI A;  1EP4 A;  1DT9 A;  3TSU A;  3DWL A;  4C8N A;  1TYQ A;  4Y1D A;  1K73 O;  4CJQ A;  3ZT4 A;  5LL6 Z;  5EU7 A;  2JLE A;  3SUN A;  3E66 A;  1XHZ A;  1QQO A;  4E1M A;  4NO7 A;  2NRW A;  2BTF A;  5GAD P;  3WXM B;  3LAN A;  3SV3 A;  1KFS A;  4ISG A;  3Q7C A;  4L3Q A;  4CIE A;  3VQ9 A;  3LDP A;  5MLC Q;  2P9P B;  3VQ5 A;  5M1F A;  3P5J A;  3SJH A;  4BRK A;  2E6L A;  3SAF A;  2W6L A;  1SL1 A;  4JI5 K;  1J54 A;  3AVH A;  3H6E A;  3KLI A;  3O9U A;  5BRE A;  4CF0 A;  1IH7 A;  3IS9 A;  1QVF M;  3HPH A;  4EP4 A;  5KGX A;  3U3Y A;  5F2R A;  3WNE A;  4B1Z A;  5AQP A;  3UB5 A;  1NMD A;  5AQN A;  2VWJ A;  4NXM K;  3K9K A;  4FJJ A;  3LP2 A;  4CZH A;  1Q9Y A;  3TSQ A;  3LDS A;  2UXD K;  4BRC A;  4F4K A;  4JKE A;  1T8E A;  4K0K K;  1R0A A;  2D0P A;  3WXK A;  4DR4 K;  3CFO A;  1YJN N;  5CR4 A;  1WSH A;  4E0D A;  4E89 A;  1T03 A;  1Z26 A;  2VG7 A;  2ASP A;  4FM2 A;  4NXN K;  2NZT A;  1L3U A;  4JS4 A;  4NYF A;  3DLR A;  4JN4 A;  4WFB L;  4U7B A;  5BN9 A;  4JI0 K;  2Q31 A;  2W6K A;  2ZJP L;  2VG5 A;  1NWK A;  1FJG K;  3JS6 A;  5KPZ A;  4O4G A;  3O1W A;  5C10 A;  4CF2 A;  1BG3 A;  4DTJ A;  4CFA A;  3SCX A;  1RBU A;  4OPH A;  1C0M A;  3L6Q A;  3VQ7 A;  2D0C A;  4CK2 A;  4YOW A;  2QKB A;  1JLF A;  1ZC6 A;  1TYQ B;  1I94 K;  4H8K A;  5JS2 A;  4DFP A;  1D9D A;  4H0T B;  4GVM A;  4BR4 A;  4ZTF A;  3TTD A;  4DSK A;  5HL7 L;  2ITG A;  2P9U B;  2IVN A;  5AJ3 K;  4G9Z A;  3AAR A;  3L8B A;  1LV5 A;  1WNS A;  3O4W A;  3TTC A;  1S9G A;  1D9F A;  4X64 K;  5AZI A;  1CZ9 A;  2GEL A;  4YY3 K;  1XC3 A;  3J7Y P;  3H1Q A;  3VF6 A;  4J2A A;  4FZY A;  3UIQ A;  4BR5 A;  4E1J A;  2Y1J A;  4DUY K;  3R9P A;  4C8O A;  3O1B A;  3HPG A;  3O5B A;  4O55 A;  4CD3 A;  4RW7 A;  3QEI A;  3VQB A;  4M63 C;  3MCA B;  4Z4I A;  4LH5 A;  1JKH A;  2KLA A;  4LF8 K;  3K5L A;  4H5N A;  3BDP A;  1ZBI A;  3CJC A;  1GOB A;  2HBK A;  1S5J A;  2YI1 A;  1HQU A;  3DXK B;  3K9J A;  3K58 A;  4FWO A;  1N33 K;  4FXD A;  4Y1C A;  3ZSZ A;  5AQI A;  2IC3 A;  2V52 B;  5C42 A;  3QEV A;  2E8A A;  4DTO A;  2CH6 A;  3F5T A;  1UAX A;  4PA1 A;  4FJM A;  2ZQB A;  3WNF A;  1TK5 A;  4M7X A;  2CGL A;  3OS0 A;  4FK0 A;  1TKT A;  4K8Z A;  5IT9 O;  1HQE A;  3WEE A;  3K5N A;  1N6Q A;  4F8R A;  4DG1 A;  5C15 A;  3JAM O;  3FFI A;  4YHH K;  3AVL A;  4CIG A;  3SAG A;  4JI2 K;  4CBU A;  1OH8 A;  3PO5 A;  4HCB A;  1L3V A;  3NDK A;  2HMP A;  3ZCM A;  3I0R A;  4NCB A;  4CJP A;  1T7P A;  1RGI A;  3CPE A;  1HRH A;  4WE1 A;  2KW4 A;  1DGK N;  2O8F A;  3H3O B;  1S1T A;  3V1O A;  4DQP A;  2GX9 A;  2OAN A;  4OVL A;  3ZSY A;  4C23 A;  3RRG A;  1Q81 O;  2ZWH A;  1NJX A;  4OJR A;  2HOE A;  1V4S A;  1VSD A;  1WN7 A;  2FSK A;  1RFQ A;  5KRT A;  4B9U A;  4FJK A;  1QE1 A;  1SKW A;  1HYZ A;  1DLO A;  1NGJ A;  1P8Z A;  1EXQ A;  3AVC A;  3PO4 A;  5AFU A;  3BF1 A;  1I39 A;  2EX3 A;  2OTJ N;  4BDP A;  1A5W A;  2QWL A;  3EEQ A;  4QS8 A;  5CZ2 A;  1ZBU A;  1LWE A;  3H45 C;  3OYA A;  2B4J A;  4CJW A;  1BA0 A;  4IJN A;  4H5W A;  1SS6 A;  5KQ8 A;  4OGE A;  4HHT A;  3LDL A;  4B1W B;  2O8C B;  3KWI A;  5M1P A;  3NF8 A;  3U6F A;  4H03 B;  3K57 A;  4B3O A;  4CJR A;  3LDO A;  3RTV A;  3KIO A;  1C1A A;  3MN5 A;  2W40 A;  4M7Y A;  3G6E N;  3S41 A;  2P9N B;  3A5L C;  2O8D B;  2G8K A;  5KGW A;  3NF7 A;  3NMU A;  2X78 A;  1WSF A;  3MXM A;  4CJT A;  5FRN A;  1TK0 A;  4PKH A;  3AVA A;  1KVB A;  1Q8I A;  3CCE N;  3NF9 A;  1HKG A;  2KQ2 A;  3AO1 A;  2I7P A;  1X9W A;  1VSL A;  4Z4G A;  1BO5 O;  2IAJ A;  2A41 A;  1VRU A;  4AHC A;  1M90 O;  4TSX A;  5J2N A;  1SUQ A;  1OVY A;  4CEF A;  1X3N A;  4YOU A;  2I5J A;  3HOS A;  3G71 N;  3SUP A;  3CC7 N;  3JYT A;  3MEC A;  2GV9 A;  1IBM K;  1IKW A;  1X9J A;  2O8F B;  3TAN A;  3G10 A;  3AY9 A;  3MXJ A;  2QWM A;  2JWK A;  1CXQ A;  5E84 A;  2YHW A;  5HP1 A;  1BI4 B;  1NGE A;  3MK6 A;  3LZJ A;  2BDP A;  3C6H A;  3ITH A;  1XUP O;  4NCG A;  3VF2 A;  2NLX A;  5B8H A;  3DLG A;  5GIN A;  4B3M K;  4CCH A;  3ZSW A;  4JI7 K;  4Z4E A;  2XY6 A;  4HWI A;  4AHR A;  3J7Z O;  5H1S Q;  5CE3 A;  3V4I A;  4IBN A;  4CF8 A;  1HNW K;  1A5V A;  3NVM A;  4J2D A;  4LC9 B;  4Z4C A;  1RT1 A;  5DMR A;  4BG9 A;  5JLH A;  4JV5 K;  3WUH A;  3MEE A;  4AM7 A;  3SZ2 A;  4GVE A;  4WQ5 C;  1TL3 A;  1IG9 A;  2FBV A;  5M1O A;  1U2V A;  1S6P A;  1HKC A;  4CGH A;  2W41 A;  5TKY A;  4CJ3 A;  4F3O A;  1NGC A;  4CFD A;  4KH5 A;  4FSV A;  1X3M A;  2LSN A;  2A40 A;  4JKC A;  3PLA A;  4UQG A;  2NRT A;  1U6Z A;  1OKJ A;  3FGU A;  3HXM A;  4GV9 A;  4J2B A;  1TKD A;  1HNZ K;  1NK4 A;  3QDK A;  4WF9 L;  4C8K A;  4H0Y B;  5LY3 A;  4C8L A;  1ZBS A;  3F9K A;  4PHT X;  5E26 A;  4H4M A;  3H46 O;  1VHX A;  3VEX A;  4AHU A;  3N4P A;  1H1V A;  2IVO A;  1LAW A;  3VEY A;  3OYN A;  4DSI A;  3L0Q A;  4M3T A;  4EHU A;  1IV0 A;  1BL3 A;  4KRE A;  1TUU A;  2ATQ A;  3SPY A;  1VQO N;  3ALY A;  3ZSR A;  3KHY A;  1YF5 L;  4EIA A;  1VQ7 N;  1S1X A;  2NRV A;  3I0S A;  1P90 A;  4QCL A;  3OHR A;  2FF6 A;  4WQ4 C;  3ZSQ A;  3OYG A;  2NRR A;  3OBY A;  3OTO K;  3THY B;  1O13 A;  1JLG A;  5BR9 A;  4M3X A;  2VG6 A;  5JMV A;  1BU6 O;  4M3R A;  3CET A;  2GBZ A;  4BGA A;  4AHT A;  3KD5 E;  4LD0 A;  3VA3 A;  1KLN A;  3THW B;  1MWK A;  4LF6 K;  3L2V A;  2HW3 A;  4CJU A;  4JKA A;  3RSE B;  3O08 A;  4CZJ A;  5KTQ A;  1U04 A;  3O3H A;  3RRH A;  4N47 A;  1ATS A;  2UU9 K;  3MX2 A;  4JLH A;  3VTI A;  1VQ4 N;  2D5R A;  2A1R A;  2XO7 A;  1J9A A;  3EN9 A;  4CJV A;  2KFN A;  2GTD A;  3CJA A;  4FJ7 A;  1RT7 A;  1TK8 A;  1ASW A;  3DAW A;  4KHY A;  4I6M B;  1S1U A;  3PIO L;  1NGB A;  5KPR A;  3CM5 A;  1NLV A;  1U4B A;  2E88 A;  2O8B B;  1GLE G;  3AO3 A;  4OPJ A;  3C65 A;  1VSI A;  3SI6 A;  1VK0 A;  3KJV A;  3QEP A;  4ELU A;  1LWF A;  4JRQ A;  4LH4 A;  3VQQ A;  5LMU K;  5AQX A;  3KLH A;  3ULE A;  1WBD A;  1W2B M;  3D6R A;  5BPN A;  1Y64 A;  3V6D A;  2Q0U A;  3ISN C;  3C6T A;  3QLH A;  1NK9 A;  3ULD A;  3LPU A;  2UUA K;  4ID1 A;  4FOI A;  3EY1 A;  1N36 K;  3L2U A;  3ZLJ A;  4Q0B A;  3VTH A;  1J53 A;  1MA9 B;  3HZ6 A;  4JEP A;  1TKX A;  3NGZ A;  1JCF A;  3ID6 A;  4K8X A;  4BRN A;  3QB0 A;  4DR5 K;  3F73 A;  3IMX A;  3DLE A;  5AQF A;  4FJG A;  2F96 A;  1BIZ A;  3P31 A;  1NK5 A;  1WB9 A;  1KVC A;  5HRN A;  3VMF B;  5TKW A;  2HHQ A;  3UKR B;  1OVQ A;  1YAG A;  4FWK A;  2VGN A;  4JS5 A;  4N76 A;  2HBM A;  3M8R A;  4ILJ A;  4H0X B;  5F0X A;  4DFJ A;  1CLQ A;  4BG8 A;  3VQ4 A;  1O1W A;  1K8K A;  3W0L A;  4YOV A;  3I8D A;  4K25 A;  4FPB A;  3HM9 A;  3AA2 A;  4WCE L;  3KK3 A;  3CHW A;  1TV6 A;  4MO4 A;  4MQ3 A;  3UKU A;  1SZ2 A;  3AVN A;  3E9L A;  2P9S B;  3QO9 A;  3AA3 A;  3V9U A;  1Q7Y O;  3RMA A;  2XY5 A;  2G8U A;  5BN8 A;  4DWI A;  3MED A;  5E41 A;  3CPW M;  4KTZ A;  4HTL A;  3OYM A;  4IZ9 A;  4CJ7 A;  1XHX A;  4DV2 K;  1BUP A;  3SQ0 A;  5K14 A;  1NGA A;  4CHY A;  1KFD A;  2PAV A;  3MN9 A;  3TAR A;  1VSM A;  4GMJ B;  3KLG A;  3DLH A;  4CZK A;  3KVG A;  3ENH A;  4BE1 A;  3VEN A;  1C1B A;  4X66 K;  4FJN A;  3NHG A;  5FRM A;  4B3S K;  4FO0 A;  3ZX3 A;  2CH5 A;  4B1V A;  1RTI A;  1D4X A;  2Z1J A;  2X6N A;  4WQ5 A;  4BE0 A;  4EAH D;  3THX B;  1GLB G;  2ASO A;  4KHQ A;  3VGL A;  2F8T A;  2J4R A;  4FJ5 A;  1B9D A;  4OKK A;  4YOX A;  1XMO K;  2BH1 A;  4E7I A;  2AA4 A;  2RF2 A;  1NK8 A;  5AQM A;  4YOY A; 
#chains in the Genus database with same CATH homology
 2Y1J A;  4L8R B;  2A1S A;  3A2F A;  1KTQ A;  1LW2 A;  4C8O A;  1JL2 A;  2DFE A;  3HPG A;  3V9Z A;  4O55 A;  3V9X A;  2AJQ A;  3SUQ A;  4KI6 A;  3QET A;  3QES A;  4FCY A;  4IFV A;  3LAM A;  4RW7 A;  5HRP A;  3QEI A;  3KLE A;  3VQB A;  4KAZ A;  5J2Q A;  3C95 A;  2OPR A;  4Z4I A;  1N5Y A;  4CHN A;  2WOM A;  4LH5 A;  3HP6 A;  2XY7 A;  1JKH A;  4BE2 A;  3KTQ A;  4CJ5 A;  4B9S A;  3HVT A;  3U3G A;  1ASV A;  3K5L A;  4BAC A;  1TK8 A;  3TAG A;  3KD1 E;  4FJ9 A;  3KK1 A;  3OYI A;  3BDP A;  3C6U A;  3NH2 A;  1X9S A;  1SKS A;  2WON A;  1ZBI A;  1GOB A;  4BWJ A;  4M3W A;  1S5J A;  1IKX A;  1HQU A;  2OPS A;  3K58 A;  1U49 A;  4DSL A;  1BIU A;  4FXD A;  4PWD A;  1X1P A;  4Y1C A;  3OYD A;  3ZSZ A;  2QK9 A;  4AH9 A;  1ZBL A;  4FM0 A;  1Y97 A;  4DTM A;  2IC3 A;  2QKK A;  4E7K A;  4GW6 A;  2X6S A;  2YNH A;  3DLK A;  5C42 A;  3QEV A;  4DTO A;  2RN2 A;  1TL1 A;  3NFA A;  4DQR A;  1QHT A;  1UAX A;  1SL0 A;  4FLW A;  4PA1 A;  4FJM A;  5HRS A;  4CES A;  1ZBF A;  5CYQ A;  2D0A A;  3TI0 A;  3DOK A;  3PX0 A;  2ZQB A;  3M8P A;  4CHP A;  3VQ8 A;  4ELV A;  2XRI A;  1JLC A;  3WNF A;  1TK5 A;  2ETJ A;  4FW1 A;  4YNQ A;  3LAK A;  3OS0 A;  1JXE A;  3VQP A;  4FK0 A;  3WNG A;  1KLM A;  1TKT A;  4K8Z A;  1HQE A;  3K5N A;  1N6Q A;  4F8R A;  4DG1 A;  1KSP A;  2O4I A;  3DLB A;  2FBY A;  3IAY A;  2HHV A;  1L3S A;  2GUI A;  5HP1 A;  3FFI A;  1HMV A;  2DFH A;  4KFB A;  4DS4 A;  3M8S A;  3AVL A;  3ZT1 A;  3AO5 A;  1VSF A;  3OJU A;  4CIG A;  3SPZ A;  2OA8 A;  4FW2 A;  1FXX A;  4DTP A;  4M3U A;  1RBS A;  1A5X A;  4YFU A;  4FZZ A;  4HUG A;  5CYM A;  1JLB A;  3QEX A;  2P1J A;  3SQ2 A;  2HHX A;  4AHS A;  4W5O A;  3PO5 A;  2DFF A;  2IOC A;  4HCB A;  3EZ5 A;  3AVM A;  3IRX A;  3NDK A;  3HL8 A;  1L3V A;  4O0I A;  1LWC A;  4I9L A;  3B6P A;  4O0J A;  3ZCM A;  1NJY A;  3I0R A;  4NCB A;  4CJP A;  3DOL A;  1T7P A;  2OYQ A;  1BGX T;  2Z1I A;  1HRH A;  4WE1 A;  2KW4 A;  1RTH A;  3TR8 A;  3NCI A;  2KFZ A;  3B6O A;  3QIN A;  2HNZ A;  1RT5 A;  1WAF A;  2ZD1 A;  1QSY A;  1TAU A;  4O44 A;  3OYF A;  3RMD A;  1S1T A;  1NJW A;  3V1O A;  4DQP A;  4M45 A;  4CGF A;  4F2S A;  4OVL A;  3ZSY A;  4B3O A;  3RRG A;  3RMB A;  1NJX A;  3L3V A;  4CEO A;  3KKS A;  4OJR A;  4B9T A;  1U47 A;  4CGD A;  1VSD A;  1WN7 A;  3KKR A;  3DI6 A;  1YVU A;  5C25 A;  5KRT A;  4B9U A;  4FYD A;  4KHS A;  1NJZ A;  4FJK A;  5DK5 A;  1JLE A;  1QE1 A;  1UA0 A;  3S3N A;  1SKW A;  1DTT A;  1HYZ A;  3AV9 A;  4KKO A;  1D8Y A;  1DLO A;  1RT4 A;  4CGG A;  2HHU A;  4ELT A;  3AVB A;  1EXQ A;  3AVC A;  4IG3 A;  3PO4 A;  2XHB A;  4I9Q A;  1I39 A;  2EX3 A;  4CHZ A;  4BDP A;  1HNV A;  1A5W A;  3P83 D;  5CZ2 A;  1W0H A;  2NUB A;  1ZBU A;  2Z1H A;  4DQQ A;  1LWE A;  3OYA A;  3WNH A;  2B4J A;  1WAJ A;  4CJW A;  3TAP A;  4B8C A;  4RW6 A;  3HO1 A;  1RDC A;  4AHV A;  4ID5 A;  2JGU A;  1TAQ A;  2IGI A;  2XY8 A;  4KO0 A;  4OGE A;  4HHT A;  1RBT A;  3TAM A;  4XIU A;  4I2Q A;  1SV5 A;  4HUF A;  4F3T A;  1RNH A;  4IFY A;  3O3G A;  3NF8 A;  3U6F A;  4PY5 A;  4FJI A;  2HHW A;  3K57 A;  4Z4F A;  4CJR A;  4DF4 A;  3HPO A;  1T05 A;  4HUE A;  3RTV A;  4KHN A;  3KIO A;  1C1A A;  4DU1 A;  3PUF A;  5JS1 A;  4CK3 A;  4M42 A;  1GOA A;  2YNG A;  5CZ1 A;  3ZSX A;  1D5A A;  2OPQ A;  3L3U A;  3T1A A;  5KGW A;  3NF7 A;  3HVR A;  5I42 A;  4DQI A;  1VSK A;  2X78 A;  3D45 A;  1WSF A;  4KHW A;  1BQN A;  4CJT A;  3MXM A;  5I3U A;  3TAF A;  5FRN A;  1HYS A;  3OYK A;  3T3F A;  3BGR A;  2D0B A;  4HVJ A;  1TK0 A;  3AVA A;  1KVB A;  1Q8I A;  3NF9 A;  3QIO A;  4DLG A;  1HNI A;  2P5G A;  4DQS A;  3EYZ A;  2KQ2 A;  3AO1 A;  1VSJ A;  4JRP A;  4ZTJ A;  3OYE A;  2HVH A;  1QSS A;  4N56 A;  3HP9 A;  1WSG A;  3OYJ A;  1Z25 A;  2YV0 X;  3LPT A;  3QNN A;  3SNN A;  3D0P A;  1X9W A;  1NK6 A;  1VSL A;  1JLQ A;  4Z4G A;  4FZX C;  3LP1 A;  2BGG A;  4FJL A;  4CK1 A;  4O5B A;  2OPP A;  2IAJ A;  3CM6 A;  1VRU A;  4OPK A;  4AHC A;  4OKJ A;  4TSX A;  1RCH A;  5J2N A;  4B08 A;  1SUQ A;  3AVI A;  4DU4 A;  1JL1 A;  3NE6 A;  4W5N A;  3VQ6 A;  4CEF A;  2I5J A;  4RW4 A;  1RTD A;  3SUP A;  3K5M A;  1NK7 A;  3JYT A;  1XWL A;  4M3Z A;  1YTU A;  1K6Y A;  3MEC A;  2GV9 A;  5HRO A;  1YTA A;  2QXF A;  4FLY A;  2BE2 A;  3JSM A;  1IKW A;  3M8Q A;  4Z0U A;  2YNI A;  3TAN A;  4CEE A;  3QNO A;  3G10 A;  3V1Q A;  5J1E A;  3O3F A;  1S1W A;  3K59 A;  1TKZ A;  2O4G A;  4CHQ A;  3MXJ A;  4QAG A;  4DU3 A;  2VWK A;  1CXQ A;  4CEB A;  4CEQ A;  4CFC A;  2E4L A;  3OVN A;  1HYV A;  1ASU A;  1RT6 A;  2RKI A;  1BI4 B;  3AVG A;  3CFR A;  3LZJ A;  2RPI A;  4IG0 A;  3VQD A;  2P5O A;  2BDP A;  4FK2 A;  2G8F A;  3LWM A;  1EKE A;  4CIF A;  2DY4 A;  1BCM A;  2R7Y A;  3ITH A;  4DF8 A;  4FLT A;  3VQE A;  1KCF A;  3SQ4 A;  4NCG A;  4RG8 A;  1EX4 A;  3DLG A;  1MU2 A;  2FBT A;  4CCH A;  3ZSW A;  4DTU A;  5CY4 A;  2P51 A;  4FJX A;  4Z4E A;  4IKF A;  2Z1G A;  4DTX A;  1NOZ A;  4E7J A;  2PZS A;  3ZT0 A;  2XY6 A;  4B9V A;  3H08 A;  3O4Q A;  1CXU A;  4AHR A;  1J5O A;  1RDA A;  1VSH A;  3V4I A;  4DMN A;  4IBN A;  1NKC A;  4CF8 A;  1QSL A;  1A5V A;  2YHB A;  2Y1I A;  1QTM A;  3DRS A;  3OS2 A;  4J2D A;  4CJ4 A;  4C8M A;  3VQC A;  4HTU A;  4Z4C A;  1RT1 A;  1RBV A;  5DMR A;  4N5S A;  4OLA A;  1RBR A;  3MEE A;  3VA0 A;  2X74 A;  3SZ2 A;  3AVJ A;  4Q5V A;  4E3S A;  4DTR A;  3LAL A;  1G15 A;  1TL3 A;  4LSN A;  1F21 A;  1IG9 A;  2FBV A;  3ZT3 A;  1S6P A;  3DRR A;  4CGH A;  1S1V A;  1UOC A;  3AO2 A;  1FKP A;  4CJ3 A;  4F3O A;  2HB5 A;  4J2E A;  4CFD A;  4NCA A;  3TAQ A;  1DTQ A;  2LSN A;  4DLE A;  2HVI A;  4UQG A;  1U48 A;  1XC9 A;  4CER A;  4PQU A;  3HXM A;  1KRP A;  1TKD A;  2EHG A;  4J2B A;  3K5O A;  1NK4 A;  4CE9 A;  4DSE A;  4C8K A;  1QS4 A;  1X9M A;  4C8L A;  3F9K A;  2IDO A;  1WSI A;  4B9L A;  2YKM A;  3DRP A;  1C0U A;  5T7B A;  4H4M A;  1L3T A;  4CEA A;  4AHU A;  1RIL A;  4DS5 A;  3LWL A;  2G8W A;  1LAV A;  3S3M A;  1LAW A;  4DSI A;  4CEC A;  3OYN A;  4FLV A;  4LY7 A;  2W42 A;  4DFM A;  2KZZ A;  4KTW A;  1C1C A;  4PUO A;  3ZSO A;  3ASM A;  5FRO A;  1WSE A;  4FLX A;  3SQ1 A;  3RWU A;  4KTQ A;  4M3T A;  2YKN A;  1GOC A;  1BL3 A;  4KRE A;  3CYM A;  1FK9 A;  2ATQ A;  3SPY A;  3RR8 A;  1RT2 A;  3ALY A;  3ZSR A;  3V9W A;  5J2P A;  4M3Y A;  2G8I A;  3QIP A;  1I3A A;  1B92 A;  1ITG A;  4B8A B;  4KPY A;  1S1X A;  3I0S A;  4QCL A;  4DTS A;  1RT3 A;  3AVF A;  3ZSQ A;  4CF1 A;  3IG1 A;  2E6M A;  3OYG A;  4M41 A;  3THV A;  5HBM A;  1JLG A;  2G8H A;  4FJ8 A;  4CED A;  2BAN A;  4M3X A;  3PY8 A;  2VG6 A;  4HCC A;  4M3R A;  1YT3 A;  1S9E A;  1BHL A;  1FKO A;  2GBZ A;  4RW9 A;  4AHT A;  3KD5 E;  1SL2 A;  4OGC A;  4LD0 A;  3SYZ A;  3VA3 A;  5KRS A;  3SV4 A;  1KLN A;  3OYB A;  4RW8 A;  1NKB A;  4CJK A;  1S6Q A;  3L2V A;  3LP0 A;  4CJU A;  2HW3 A;  1VSE A;  3KK2 A;  3NH0 A;  4I7F A;  5KTQ A;  4I2P A;  4KRF A;  1IO2 A;  1U04 A;  1RTJ A;  2Q3S A;  4KB1 A;  3O3H A;  3RRH A;  1KVA A;  4N47 A;  4EZ9 A;  3OS1 A;  2IS3 A;  4W5R A;  3CFP A;  5SZT A;  3AO4 A;  1NOY A;  3HYF A;  4CGI A;  1C6V A;  3TAB A;  1EP4 A;  3AA5 X;  4EZ6 A;  4JLH A;  2PYL A;  1ZYQ A;  1SL1 A;  2ZE2 A;  2OZM A;  4LSL A;  1SKR A;  3NBP A;  3O4N A;  4KI4 A;  2HHT A;  2D5R A;  2A1R A;  2KZM A;  2XO7 A;  4C8N A;  1J9A A;  1NKE A;  3AA4 A;  3TWH A;  3MAQ A;  3HK2 A;  1IKY A;  1EET A;  4KV8 A;  4CJV A;  2KFN A;  4FJ7 A;  3LZI A;  1RT7 A;  4Y1D A;  1ASW A;  1B9F A;  1W9H A;  4FVM A;  4FM1 A;  3VN5 A;  3OJS A;  4E7L A;  1XI1 A;  1NK9 A;  4KHY A;  2F8S A;  1S1U A;  2HHS A;  3PX6 A;  1TGO A;  4CJQ A;  3ZT4 A;  5EU7 A;  2YNF A;  2JLE A;  3SUN A;  1XHZ A;  2FC0 A;  4E1M A;  4G1Q A;  3SJJ A;  4BDZ A;  3CM5 A;  1U4B A;  4AIL C;  3DYA A;  3AO3 A;  4OPJ A;  3OYC A;  3LAN A;  1BIS A;  1VSI A;  3SV3 A;  1VK0 A;  3SI6 A;  1KFS A;  4N41 A;  3KJV A;  3QEP A;  4ELU A;  1LWF A;  4CJL A;  4CF9 A;  4JRQ A;  4CIE A;  4LH4 A;  3VQQ A;  3KLH A;  1HPZ A;  3VQ9 A;  4IDK A;  4W5Q A;  1VRT A;  4CHO A;  3V6D A;  3VQ5 A;  3PV8 A;  4F2R A;  3ISN C;  3P5J A;  3C6T A;  3HJF A;  3OYH A;  3QLH A;  3ZSV A;  3P1G A;  2E6L A;  3L2W A;  3LPU A;  3ULD A;  4ID1 A;  1J54 A;  3AVH A;  3CG7 A;  3EY1 A;  3KLI A;  3L2U A;  4B9N A;  4CF0 A;  4KB0 A;  4Q0B A;  3G0Z A;  4OKE A;  4ZHR A;  4NYN A;  1J53 A;  2B6A A;  3E01 A;  4BWM A;  4Z4H A;  1IH7 A;  3IS9 A;  3V81 A;  1TKX A;  3HPH A;  3OYL A;  4EP4 A;  5KGX A;  1JXB A;  3NGZ A;  3S3O A;  3U3Y A;  4K8X A;  3WNE A;  4DSF A;  4MFB A;  3AVK A;  3F73 A;  1U45 A;  3C94 A;  1IKV A;  2VWJ A;  4EP5 A;  3DLE A;  3MXI A;  1Q9X A;  2F96 A;  1BIZ A;  4FJG A;  1NK5 A;  3ZT2 A;  4B9M A;  1KVC A;  4FJJ A;  3LP2 A;  5HRN A;  3OY9 A;  1Q9Y A;  3LDS A;  2OZS A;  2YHA A;  2HHQ A;  2DTU A;  3NGY A;  4N76 A;  3MEG A;  4CGJ A;  4JS5 A;  3M8R A;  4FLU A;  1T8E A;  4F4K A;  1R0A A;  2FBX A;  4DFJ A;  1CLQ A;  3CFO A;  4E1N A;  3CQ8 A;  3LP3 A;  3VQ4 A;  4QOZ B;  1O1W A;  1WSH A;  1WLJ A;  4CJE A;  4R5P A;  3I8D A;  3TAE A;  4E0D A;  3L2Q A;  4E89 A;  3HT3 A;  1T03 A;  1Z26 A;  4CEZ A;  1UWB A;  3NH1 A;  1TVR A;  4DTN A;  2VG7 A;  3HM9 A;  1WSJ A;  4FM2 A;  3PX4 A;  1CZB A;  3AA2 A;  1L3U A;  3KK3 A;  3DMJ A;  4JS4 A;  1TV6 A;  3V9S A;  2HMI A;  1BCO A;  4NYF A;  3DLR A;  4MQ3 A;  3AVN A;  3RMC A;  5SWM A;  2VG5 A;  5HLF A;  3QO9 A;  3QEW A;  4CFB A;  3AA3 A;  4E19 A;  4O4G A;  5FDL A;  4CF2 A;  3V9U A;  1REV A;  2G8K A;  3KLF A;  1BI4 A;  3RMA A;  2XY5 A;  2G8U A;  4DTJ A;  4CFA A;  4OLB A;  3SCX A;  4DWI A;  3MED A;  5E41 A;  1RBU A;  1JLA A;  5HRR A;  3QER A;  4KTZ A;  4DSJ A;  4DFK A;  5D3G A;  1C0M A;  3OYM A;  3VQ7 A;  4H4O A;  2D0C A;  1QQC A;  4CJF A;  4CK2 A;  4FJH A;  3L2R A;  2QKB A;  1XHX A;  1JLF A;  1C0T A;  2HND A;  1HJR A;  3SQ0 A;  2PYJ A;  5K14 A;  1NK0 A;  4CHY A;  3DM2 A;  1RDB A;  4H8K A;  5JS2 A;  4DFP A;  3VQA A;  1D9D A;  1KFD A;  3TAR A;  4GVM A;  4BDY A;  4ZTF A;  1VSM A;  4GMJ B;  3KLG A;  4E7H A;  3DLH A;  4ICL A;  4DSK A;  5KI6 A;  3SUO A;  4W5T A;  4BE1 A;  3S9H A;  1L5U A;  2ITG A;  4KHU A;  1RDD A;  2G8V A;  1ZBH A;  1C1B A;  4FJN A;  3K2P A;  3NHG A;  3NAE A;  2PY5 A;  3RR7 A;  5FRM A;  3HST B;  3L8B A;  3NF6 A;  1BQM A;  1WNS A;  1LV5 A;  4CJS A;  1RTI A;  2Z1J A;  3V1R A;  2X6N A;  1S9G A;  1D9F A;  4BE0 A;  2B5J A;  3NGI A;  1UA1 A;  2KTQ A;  1LW0 A;  4KHQ A;  1CZ9 A;  2F8T A;  4FJ5 A;  4FLZ A;  1B9D A;  5C24 A;  5J2M A;  4J2A A;  4FZY A;  4OKK A;  4E7I A;  2HNY A;  3UIQ A;  3T19 A;  2RF2 A;  1NK8 A;  4FK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...