1ASVA

Avian sarcoma virus integrase catalytic core domain
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIAN SARCOMA VIRUS INTEGRASE
publication title High-resolution structure of the catalytic domain of avian sarcoma virus integrase.
pubmed doi rcsb
source organism Avian sarcoma virus
molecule tags Dna integration
total genus 49
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1asvA00
1HNIA 1NOZA 3HP9A 3TAMA 2HHQA 4DSLA 4C8NA 4QOZB 3HPGA 4ID5A 4FJXA 1CLQA 4M3WA 4CJQA 1SL2A 4LSLA 4RW7A 1FKOA 4DTSA 4FJLA 4C8OA 4KV8A 2OPQA 3AO3A 3QESA 1RT6A 2YKNA 3RRHA 1VSIA 2HVHA 2X74A 1MU2A 3HT3A 1RTIA 3D45A 2KZMA 1FXXA 3A2FA 3PX6A 3RWUA 1JL1A 3NF6A 4Z4HA 3NE6A 3AV9A 3KD1E 3I8DA 4J2DA 4O0IA 3RMCA 1TK5A 1JKHA 1NK0A 3FFIA 4Z4GA 4UQGA 3LPTA 1ASUA 2Z1GA 3M8QA 3ZSQA 3KLGA 5JS1A 3NAEA 3DRPA 2D5RA 3OYNA 3EYZA 4EZ9A 4CFBA 3OJUA 3CYMA 3NGYA 2NUBA 3M8SA 4ICLA 1G15A 3T3FA 4HCCA 4DTJA 1RT2A 3S9HA 4DF8A 1Q8IA 1RDDA 3L8BA 4FJNA 5KGWA 2X78A 4OPJA 4RW4A 3RMAA 3V9ZA 3UIQA 3SZ2A 4CEZA 3SI6A 4DG1A 2ZE2A 1ZBHA 1NJZA 3RR7A 1JLFA 4DU3A 3PO5A 4FJKA 4CK2A 1LAVA 1J9AA 4TSXA 3VQ6A 4CHQA 4AHRA 1X9WA 4N5SA 1F21A 3L2QA 4CFCA 1HQEA 4FM1A 4FJGA 4KHWA 2QKBA 2HHTA 3C94A 4CEBA 4B9TA 2JGUA 5CY4A 3VQ4A 1EETA 1RBTA 2ATQA 3ZT2A 4E7KA 4C8KA 4FJ5A 4CFAA 3P83D 1IG9A 3SUOA 2DTUA 4IBNA 3OYAA 4I7FA 3SUPA 4ZTFA 1T7PA 3NF8A 4O55A 1VSHA 4HUGA 3ZSOA 1T8EA 4BDZA 2VG7A 3DI6A 1B9DA 4BE0A 4B9NA 3IS9A 3MEDA 1S9GA 4KO0A 4AHCA 3U6FA 1C1BA 1TL1A 4DTOA 3ULDA 3PV8A 4CF2A 3PX0A 3RMDA 3KK2A 1WAJA 4GMJB 1S1XA 3ZSYA 4B9VA 3LP1A 1NKBA 1EKEA 5CZ1A 3NH0A 3ITHA 5HP1A 4EP5A 3NGIA 4AHSA 1LW0A 1N5YA 1HJRA 5C24A 4O4GA 4ID1A 1NJXA 2P5GA 1LAWA 4DQSA 4DSKA 4CF1A 3THVA 1GOCA 4M42A 1HNVA 3SUQA 3ZSZA 1U48A 3ZT3A 3NBPA 2DFFA 2XY5A 4H8KA 3S3MA 3ZT4A 3MEGA 3K57A 4CHNA 4L8RB 4FLXA 3TABA 4PUOA 1KVBA 1D5AA 4CF9A 2GBZA 5D3GA 3SV4A 3JYTA 4CEQA 3VA0A 3G10A 4FLTA 2X6NA 2B4JA 2D0AA 2HHVA 3VQAA 4AHUA 2W42A 4OLBA 2IOCA 2RF2A 3E01A 3HPHA 2YNHA 3AVCA 2G8UA 4WE1A 2RN2A 4FW2A 1S1TA 4KHSA 4DS4A 4JRPA 4OGEA 4AILC 2VWJA 1K6YA 3MEEA 3K5MA 3L3UA 4CJKA 1BI4A 4I2PA 4DFPA 2FBXA 3LZJA 1QSLA 1JXEA 2ZD1A 4CIGA 5J1EA 4DTXA 1NJYA 4Y1CA 4M3XA 3TWHA 3QINA 1CXQA 3M8PA 4OJRA 5EU7A 3NF9A 3VQEA 1ZBUA 5HRSA 5J2NA 3F9KA 1KLNA 2OPSA 4FLVA 1RCHA 4OLAA 4FLYA 3AO5A 3P5JA 3QEXA 1HYSA 4CJ3A 1I3AA 4OGCA 3WNHA 1QSYA 1A5VA 4FM0A 1UOCA 5C42A 3EZ5A 1SKWA 1BIUA 3OJSA 4FLWA 1VSEA 3DOLA 3OS2A 4KTZA 4CJLA 1TAUA 4CEFA 4F3TA 4FYDA 1JL2A 4DTMA 1D8YA 5J2PA 4BACA 4QCLA 5T7BA 2IDOA 4MQ3A 3HSTB 4PA1A 3F73A 2F96A 3H08A 4NYFA 4J2BA 4AHTA 2YHAA 2F8TA 2IGIA 1LWEA 3AVAA 4E1NA 1UAXA 3VQDA 1TK8A 2DY4A 3LWLA 3AA3A 3O3FA 1TKDA 4LD0A 4DF4A 1T03A 3MAQA 1J5OA 1BGXT 1HYZA 5I3UA 1HPZA 3DRRA 3V4IA 1RDCA 3HM9A 3S3NA 3OYMA 4DLEA 4YNQA 5KRSA 2QKKA 4CEOA 2HMIA 1S1VA 3DLEA 3I0RA 4KTWA 3V1OA 3L2WA 4DLGA 2OYQA 2KW4A 2EHGA 3OYEA 4CGFA 4DQPA 2FBYA 5HRPA 4M3UA 1WLJA 1KVAA 1WAFA 1EP4A 2XY8A 2XHBA 1TVRA 3VQCA 4CJSA 4DMNA 4H4MA 4RW6A 1XC9A 3AA4A 5FROA 3KKRA 4K8ZA 1ZBFA 3VQBA 3QERA 1NK4A 3CM5A 4F3OA 4PY5A 4DSJA 2BDPA 3ISNC 3NGZA 4E3SA 2FBTA 1J53A 4FJ9A 2BGGA 1RBSA 3AA2A 4F4KA 4N56A 1BIZA 2D0CA 2ITGA 3DLGA 3KLFA 1CXUA 2O4GA 4EP4A 4CJRA 4XIUA 3U3YA 1TK0A 4DQRA 2IAJA 1BCOA 1FK9A 4DS5A 4DQIA 1UA1A 1EX4A 3ZSWA 1IO2A 4CERA 5HRNA 1UA0A 2XY6A 2QK9A 3SQ1A 1L3SA 3HVTA 1BL3A 4B8CA 3QEPA 1RNHA 3LPUA 4CJVA 3O3HA 3SUNA 1SV5A 3S3OA 1QE1A 2G8KA 3NDKA 1CZ9A 4G1QA 4I2QA 1B92A 3CFOA 3RR8A 2PZSA 3AVBA 1L5UA 1NK6A 3I0SA 2G8WA 4ELVA 3OYHA 2VG6A 2YNFA 2HHUA 4FJ8A 1B9FA 4DU4A 3QO9A 1XI1A 4PQUA 5J2QA 3HO1A 5DK5A 4Q0BA 5KI6A 3RTVA 3LP0A 3DYAA 1ZBLA 1VRUA 3QNOA 2PY5A 4OVLA 1YTUA 4C8LA 2Y1JA 4FXDA 1NK8A 4FJJA 2B6AA 2YV0X 4LY7A 4CK1A 3HK2A 3KD5E 3VQ5A 1VSKA 1YVUA 2QXFA 4FW1A 3AVHA 3U3GA 1REVA 4Z4FA 1SL0A 4HCBA 1ZYQA 4W5QA 4AH9A 1VK0A 4ZTJA 3OYIA 4N47A 3SQ2A 5HLFA 4DSIA 3T1AA 3OYCA 2LSNA 1XHZA 3AVKA 2RPIA 4RG8A 3QLHA 1YT3A 3TAEA 1RTHA 3DRSA 3QIOA 3SPYA 3ALYA 4IG3A 4CJ4A 4JS4A 4NCAA 4DTRA 1Y97A 1GOAA 1D9DA 3LDSA 4HTUA 2HB5A 4F8RA 1NK7A 4W5TA 2XO7A 3AVMA 3K5LA 3QNNA 4CHYA 4CGGA 1D9FA 5FRNA 4CF8A 1NKCA 1JLQA 1C1CA 4FJ7A 3QIPA 4CFDA 5KTQA 5C25A 4FJIA 4B9LA 2A1RA 4KHYA 2R7YA 3DLKA 3ZT1A 4CEEA 3QEVA 2KTQA 2P5OA 2HNDA 1O1WA 2FBVA 4M3TA 1WN7A 3ZCMA 2O4IA 3C6UA 3TR8A 3AVLA 4CIEA 3AVGA 3NFAA 2HHSA 1EXQA 3VQ8A 2XY7A 4CF0A 4CGDA 4OKJA 2RKIA 1QHTA 4LH5A 3CFPA 4RW9A 4Z4IA 1ASVA 3LALA 4CECA 1UWBA 4MFBA 1XHXA 3NHGA 4KHQA 1TKXA 1U04A 3AO4A 4E7JA 3DLHA 1ASWA 3V1QA 2PYJA 4GVMA 1KSPA 4CJ5A 1LWFA 1SKSA 1BQNA 2HNZA 4M3RA 1TL3A 3AVFA 4B9SA 2BANA 1RTDA 1C0UA 4CGHA 4GW6A 4CHZA 3ZSXA 4KB0A 4O5BA 1DTQA 2OZSA 1WSEA 2EX3A 4B08A 1SKRA 4F2RA 4IFVA 5SZTA 3O4NA 3DOKA 4CIFA 3EY1A 4E7LA 1KCFA 3HPOA 3SQ0A 3BDPA 1TKZA 2X6SA 3L2RA 2KQ2A 1YTAA 4LH4A 1LW2A 3KK3A 3OYGA 4J2EA 3WNEA 3KK1A 4E89A 2D0BA 4E0DA 3KJVA 4J2AA 4FLZA 5HROA 1LWCA 1WSGA 1RT1A 3CQ8A 1SL1A 1RT3A 4KHNA 3PY8A 1S6QA 1IKVA 1BQMA 3RRGA 4DTUA 1TGOA 1QQCA 4JS5A 3AVIA 3HL8A 1RTJA 1DTTA 2E6MA 3PX4A 3V9WA 3B6PA 3JSMA 5HBMA 4FJHA 2HHWA 1RDBA 1VRTA 1NK9A 5JS2A 1T05A 1I39A 3VQPA 4FK0A 4B8AB 5HRRA 3V1RA 4BE2A 1QS4A 2HVIA 1ITGA 1JLBA 3KLEA 4KTQA 3LAMA 1LV5A 2OA8A 5CZ2A 4CJWA 1QTMA 4K8XA 4KRFA 1W9HA 4ELUA 1DLOA 5J2MA 1FKPA 2G8VA 1U49A 5CYMA 3VA3A 1HYVA 2XRIA 2OZMA 1C0TA 4E1MA 1X9MA 3KKSA 3K5NA 1KLMA 2GUIA 3ZT0A 4CESA 3WNFA 3HYFA 3OYKA 3V9XA 1L3TA 4ELTA 1Z26A 3KLHA 1U4BA 2B5JA 2G8HA 3VN5A 3AA5X 4BDPA 3K59A 4PWDA 4M41A 3LZIA 1IKWA 1Q9YA 4DWIA 4KPYA 4CJTA 2KZZA 4KAZA 1JLCA 4O44A 4Z4CA 3CG7A 2I5JA 4FCYA 3WNGA 3SCXA 1X1PA 2HW3A 3M8RA 4F2SA 2E6LA 1JLAA 4IFYA 4Y1DA 4CJFA 4FLUA 4CHOA 1RBVA 2ZQBA 1J54A 1JLGA 2YHBA 3P1GA 5E41A 4DFMA 1VSDA 3QEWA 4FK2A 3PUFA 4Z0UA 5KRTA 1TKTA 1BHLA 3K5OA 4JLHA 4IDKA 4R5PA 4FM2A 1R0AA 2BE2A 3HVRA 1BI4B 3V9SA 1KFSA 4CGIA 1A5XA 4BE1A 4DFJA 2YNIA 5CYQA 1WSHA 1U45A 1NJWA 3IAYA 2KFZA 4HUEA 1L3UA 1VSLA 1KTQA 1WSIA 3OVNA 2WOMA 3OYFA 4NCGA 3TAGA 5FRMA 1NOYA 3L2UA 4CEDA 3QETA 1S9EA 4E19A 4BDYA 4B9MA 1VSMA 2G8IA 1WNSA 5K14A 3SYZA 4KKOA 5FDLA 4W5NA 4LSNA 2Q3SA 1GOBA 3AO2A 1S1UA 3KTQA 2E4LA 1N6QA 1WSJA 1BISA 3AVNA 2YKMA 1W0HA 4O0JA 3VQ7A 4CK3A 3ASMA 4HUFA 4I9QA 2AJQA 3V9UA 3V6DA 1RT7A 2Z1JA 4E7HA 4IG0A 4OPKA 3IG1A 1NKEA 2JLEA 2P51A 1NK5A 4KI6A 3NH2A 3SJJA 1HMVA 2OPRA 3K2PA 3OYJA 2FC0A 4DSEA 3MXMA 1C0MA 3B6OA 3MXIA 4EZ6A 1RILA 2HNYA 4CJEA 1A5WA 3V81A 2PYLA 4M3ZA 2Y1IA 2IC3A 3RMBA 2G8FA 1VSJA 2Z1IA 3ZSRA 2DFHA 4CEAA 3SPZA 5SWMA 4AHVA 1RT5A 1RT4A 1TAQA 1IKYA 4RW8A 1RBRA 4CGJA 3OYBA 4Q5VA 3LWMA 4FK4A 4NYNA 4FZZA 3LANA 3HJFA 3IRXA 3KLIA 4W5OA 3AVJA 4JRQA 3SV3A 4DFKA 3LAKA 3TARA 1S6PA 4M3YA 2F8SA 4CE9A 3L3VA 4KREA 3LP2A 4CCHA 4N41A 1IH7A 4OKKA 4OKEA 3HP6A 1BCMA 1KFDA 4KB1A 3QEIA 3TAQA 3TI0A 1X9SA 3BGRA 2DFEA 2OPPA 1QSSA 3TAFA 4NCBA 2HHXA 4M45A 4CHPA 1KVCA 4DQQA 3OS0A 4B9UA 3LP3A 3DLBA 4KI4A 3CFRA 3VQQA 4N76A 2KFNA 3D0PA 2P1JA 3C6TA 3DM2A 3DMJA 4C8MA 4DTPA 1S1WA 3AO1A 4B3OA 5DMRA 3K58A 3TANA 3KIOA 4QAGA 3VQ9A 4DU1A 2VWKA 4KFBA 1C1AA 1VSFA 1HRHA 1HQUA 3OY9A 3OYDA 3C95A 1CZBA 1KRPA 4FJMA 3NH1A 3OS1A 1SUQA 3DLRA 3T19A 4FVMA 1ZBIA 4HHTA 1Q9XA 4ZHRA 5I42A 1XWLA 2Z1HA 4CJPA 2GV9A 1IKXA 4H4OA 4DSFA 1L3VA 4IKFA 4Z4EA 2A1SA 4E7IA 1Z25A 2IS3A 2VG5A 3PO4A 1WSFA 4FZYA 3CM6A 4BWMA 3L2VA 3MECA 4CJUA 4YFUA 1C6VA 4I9LA 1U47A 4HVJA 3G0ZA 1JXBA 1TV6A 1RDAA 4DTNA 4FZXC 3NF7A 3MXJA 3O4QA 3HXMA 3SNNA 3O3GA 1JLEA 4BWJA 1S5JA 5KGXA 2ETJA 3OYLA 3NCIA 2WONA 2YNGA 3TAPA 4KHUA 4W5RA 1RBUA 3ZSVA 3SQ4A
chains in the Genus database with same CATH superfamily
2OCEA 2HHQA 2PAVA 4C8NA 4QOZB 3HPGA 3RSEA 4LFCK 2I7NA 2VQEK 4M3WA 1BWFO 3NVKA 4FJLA 4BR4A 3TSQA 5GAGP 1M1KO 1O13A 4LF4K 3QICA 2X74A 3CERA 3U8XA 1CZAN 1BUPA 2NRHA 4U7BA 4CZKA 4YOUA 2ZM6K 2FSKA 4JV5K 3RMCA 4Z4GA 3LPTA 3ZSQA 3M8QA 3L0QA 2D5RA 3EYZA 4EZ9A 3T3FA 4ICLA 2QA4N 4FJNA 3L8BA 2WBNA 1Q82O 3V9ZA 3CCQN 3IDHA 3MWTA 4DG1A 1ZBHA 1EO1A 2UU9K 4DU3A 4FJKA 1J9AA 3VQ6A 3VEWA 1F21A 4JHDB 1XUPO 4CFCA 1HQEA 4FM1A 4FJGA 4KHWA 4CEBA 2JGUA 1NBWA 1QZ5A 3SUOA 2E2QA 1T7PA 3NF8A 4BQLA 1VSHA 2EWSA 1T8EA 3DI6A 4B9NA 3MEDA 4KO0A 3U6FA 4CF2A 2GTDA 1WAJA 3HZ6A 4GMJB 4B9VA 4JKDA 2HBJA 1EKEA 3FGUA 3NH0A 5HP1A 2BH1A 2CGKA 4EP5A 3NGIA 5C2DA 1NJIO 5AQIA 2P5GA 4PL7A 3RVCA 1LAWA 4DQSA 4OX9K 4M42A 3SUQA 4MO5A 3ZSZA 1OVYA 3S3MA 4L8RB 3SV4A 3VA0A 3CQYA 5BPMA 2B4JA 1YITN 5AQQA 1KAZA 3E01A 1QZ6A 2GUPA 3PSFA 4DS4A 1YJNN 3MX5A 4OGEA 4AILC 1K6YA 4DFPA 4DUYK 1BI4A 2FBXA 3LZJA 2UUAK 2F7TA 4DV3K 4M3XA 1NJYA 1GLBG 4X64K 3DXKB 3M8PA 4FLVA 4MDAA 3CD6N 4FLYA 3AO5A 1N34K 1I3AA 4OGCA 2UXDK 1A5VA 2HSTA 2Q31A 4FWMA 1UOCA 4FM0A 1SKWA 3LM2A 3OS2A 4B1WB 1ZBSA 3IKMA 3F73A 2F96A 3AGKA 4K25A 1TKDA 4DF4A 1T03A 3MAQA 1HYZA 4BGBA 3DXMA 5AQGA 4CEOA 5AQLA 4CW7B 1S1VA 4KTWA 3L2WA 2OYQA 1WB9A 1J6ZA 4BC3A 1GLFO 1QHAA 1WLJA 5AQPA 4H5RA 5IT9O 4H5WA 3G6EN 4BVPA 3PSIA 1NK4A 1RDWX 4E3SA 3CCMN 1J53A 2V51B 2ITGA 3E9LA 3VMFB 1EX4A 2O8CA 2XY6A 3SQ1A 3HVTA 1BL3A 1RNHA 3SUNA 5M1FA 4H03B 4FWNA 3LDPA 1L5UA 1NK6A 2G8WA 3N4PA 2WUSA 3MMVA 4Q0BA 3H6EA 3DYAA 3O1BA 1VRUA 3FE1A 4C8LA 4FXDA 2B6AA 2YV0X 2WC9A 3HK2A 1E3MA 1VSKA 2W6LA 1ZYQA 2NLXA 4YDUA 4AH9A 1VQ5N 3OYIA 5HLFA 4DSIA 2LSNA 1XHZA 3AVKA 3NVMA 3VENA 2RPIA 3ULEB 4EAHD 2YI1A 3SPYA 3M6GA 2PBDA 4JS4A 4NCAA 4DTRA 1BG3A 4F8RA 4YOYA 4JI7K 4CHYA 5FRNA 1NKCA 1C1CA 5JMVA 4FJIA 4H0VB 1T3VA 3QEVA 3DLKA 3ZT1A 4CEEA 3H3OB 2P5OA 1ATRA 4FWKA 1NGFA 3VEYA 3TR8A 1M90O 3NFAA 4GY2B 4KH6A 4CF0A 2O8EA 3QBXA 2RKIA 3CFPA 4LH5A 5C12A 3I33A 4RW9A 4CZJA 2NRWA 2Q36A 1ASVA 3C6AA 4CECA 1UWBA 4MFBA 1U2VA 3NHGA 4J8FA 4MO4A 4GVMA 1SKSA 4B9SA 1TL3A 4LF7K 2BANA 4CGHA 4O5BA 1DTQA 2OZSA 2EX3A 4CZMA 3O4NA 4CIFA 5AQJA 3P4IA 3HPOA 3SQ0A 3BDPA 1YTAA 3OYGA 4E89A 2A40A 1VQON 1WSGA 1RT3A 1IKVA 4DTUA 1TGOA 4YDUC 3SJHA 1DTTA 3G4SN 5HBMA 1RDBA 1VRTA 5JVHL 1YI2N 4B3TK 1ITGA 3LAMA 4JK7A 5M1PA 1QTMA 3BUZB 1W9HA 5KQ8A 4WF9L 1FKPA 4DR1K 2G8VA 2XRIA 3SBGA 4E1MA 1SS6A 1BOTO 1KLMA 4JI4K 3WNFA 1Z26A 2G8HA 4JKFA 1HPMA 3H3NO 3THYA 1Q9YA 3I8BA 4KPYA 4Z4CA 1TUUA 3CG7A 4JKEA 3MN9A 3WNGA 2FSJA 3P1GA 2YHBA 1JLGA 3UKRA 1DGKN 3PUFA 4PHTX 2NZTA 1TKTA 3K5OA 1R0AA 3LDLA 1KFSA 2HBKA 4CGIA 1A5XA 4JKGB 3IAYA 2ZJRL 4HUEA 1S9EA 4BDYA 1GOBA 1S1UA 2OTLN 4O0JA 1BISA 3V9UA 3V6DA 2Z1JA 2O8BB 4OPKA 1IBLK 1NK5A 3SJJA 3OYJA 2FC0A 3BEXA 5AQMA 2PYLA 3HSCA 2Y1IA 2IC3A 3RMBA 3L4QA 1VSJA 4AHVA 1TAQA 3THWA 4RW8A 3OYBA 1HKCA 3LWMA 4LF5K 5AQOA 3HJFA 5B8HA 4CE9A 5FPEA 3LP2A 1Q86O 1NGGA 1ZC6A 4OKKA 1KFDA 4LF8K 3QEIA 1NM1A 4BGAA 3MX2A 4JKCA 3MK6A 2E1YA 3OS0A 4B9UA 3D2FB 3LP3A 4KI4A 3CFRA 3GBTA 2KFNA 2P1JA 1VQ8N 4FOEA 3VGMA 4DTPA 4B3OA 4PKHA 3KIOA 1C1AA 3OYDA 1HQUA 4CZGA 5FPDA 4DR3K 3ZETA 5KPZA 5JLHA 3NH1A 4IDHA 3T19A 3LDOA 1WUAA 1Q9XA 5I42A 4Z4EA 4BRQA 3EKSA 2A1SA 3WXMB 3SAHA 4DV7K 3CM6A 1Q18A 3UE5A 4FPBA 1C6VA 5AZJA 1U47A 2QM1A 2P9IA 3WXIA 5AQUA 3HXMA 3SNNA 4IOXA 4A57A 2FSNA 2ETJA 2WONA 3ZSVA 3K5LA 3HP9A 4FJXA 1SL2A 4RW7A 4BRAA 4C8OA 4KV8A 2OPQA 1MWKA 5AQYA 3LL3A 3RRHA 1VSIA 4DV2K 2HVHA 1RTIA 2E8AA 5M1QA 1FXXA 3A2FA 3PX6A 3RWUA 1JL1A 4O0IA 1TK5A 5H1SQ 1JKHA 3WXJA 1ASUA 4YOXA 4CFBA 1XQSC 3CYMA 5EOYA 3NGYA 2NUBA 3ZEUA 4DTJA 1RT2A 3CXCM 2X78A 4OPJA 3RMAA 1KQSM 3SI6A 2P9PB 2ZE2A 1W7AA 1VQLN 2V7ZA 1JLFA 1QQOA 1LAVA 4BRMA 1S3XA 4O8UA 4RCHA 2QKBA 3SBTA 4JI6K 1EETA 2ATQA 1KXPA 1C0FA 1SQKA 3WEEB 1IG9A 2DTUA 3EE8A 3OYAA 3ZSOA 2VG7A 1R59O 4BE0A 3IS9A 1S9GA 4BR2A 3J7AP 4JD2B 1TL1A 4DTOA 2IVOA 1VQMN 2Q0UA 3LP1A 2YHWA 5CR4A 1N5YA 1NJXA 1DKGD 4FWLA 3THVA 3O1WA 1U48A 1YF5L 3GOIA 1MWMA 3ZT4A 3MEGA 5CE3A 4CHNA 4FLXA 3TABA 1KVBA 3C7NA 4CF9A 3JYTA 4CEQA 2Q1NA 4JI0K 3O80A 2D0AA 2HHVA 2W42A 3H1QA 3HPHA 2IOCA 2RF2A 4WQ5C 3S41A 4FW2A 3CETA 3ENOA 4JRPA 3CJCA 3MEEA 3K5MA 1Y64A 4I2PA 2PFUA 4ILGB 1Z6RA 2VCPA 4WYBA 5J1EA 1WOQA 3O5BA 4OJRA 1ZBUA 5HRSA 3F9KA 4NXMK 5EY4A 1RCHA 2E2NA 3SAFA 3P5JA 1HYSA 3VF4A 2HF4A 4XH1A 3OJSA 1VSEA 1YXQA 3ZX3A 3DOLA 3R3LA 4KTZA 1TAUA 5LL6Z 4JKAA 1JL2A 1D4XA 2O8FB 3HSTB 4PA1A 3CCJN 3AVAA 4E1NA 3VF6A 3VQDA 3AA3A 3O3FA 4LD0A 3AAQA 1J5OA 1HPZA 3DRRA 2IVNA 1RDCA 4B1YB 5KRSA 3G25A 3LDNA 4DLGA 1NGAA 2EHGA 3L6QA 4M3UA 3CHWA 1WAFA 1DT9A 1EP4A 4I6MA 3VQCA 1HX1A 4RW6A 4K8ZA 1XNQK 1I94K 1ZBFA 3CM5A 2J4RA 4F3OA 3FZKA 4JI8K 4F9OA 1N36K 2FBTA 4FJ9A 2BGGA 1RBSA 4F4KA 1XMQK 4N56A 1BIZA 5HL7L 4EP4A 3WUHA 3UKUA 4DQRA 2IAJA 5FPNA 1BCOA 5E84A 1IO2A 5HRNA 1L3SA 1W2BM 3CCEN 1QE1A 2YJFA 3NDKA 4K41A 3RR8A 4AQYK 4ELVA 3OYHA 2ZJQL 2VG6A 2YNFA 2HHUA 4DHYA 3KK7A 1MDUB 3QO9A 3H46O 4DU4A 1VHXA 4BRHA 1ZBLA 3QNOA 1YTUA 2Y1JA 4FJJA 4CK1A 3KD5E 1YVUA 2QXFA 4FW1A 3AVHA 4Z4FA 1REVA 1SL0A 3TU5A 4W5QA 1XNRK 3SQ2A 3OYCA 3TAEA 1NMNA 1RTHA 4IG3A 4CJ4A 1D9DA 5BPNA 4HTUA 5F1XA 2HB5A 4W5TA 3QNNA 1RDUA 3CJAA 4FJ7A 5KTQA 5C25A 4B9LA 4LF9K 3VTIA 4BRNA 4KHYA 2ITMA 2KTQA 5F2RA 1O1WA 4CZHA 3TSUA 4M3TA 1H1VA 3QFPA 3ZCMA 2O4IA 3C6UA 3AVLA 3AVGA 1GLLO 3M5RA 5IWAK 4AM6A 5KQDA 4Z4IA 4IJAA 5LJVA 1NNEA 2W41A 1OH5A 2PYJA 3EO3A 4OPHA 1KSPA 1ILYA 1LWFA 4JKHA 4JHDA 1BQNA 1C0UA 4FWOA 3KWGA 4CD3A 4F2RA 5F0XA 5SZTA 3DOKA 1YAGA 3A5LC 4IZ9A 2FXUA 3NMUA 4LH4A 3KK3A 4J2EA 3P38A 4X66K 2O8CB 3WNEA 3KK1A 2D0BA 1VQ4N 3KJVA 4E0DA 4WFNL 2HMPA 3CMAN 4J2AA 3DAWA 4FLZA 5HROA 5AR0A 3VEOA 3IFRA 3F5TA 3RRGA 3HL8A 4DR5K 1N32K 2E6MA 2KLAA 3B6PA 3JSMA 4B1XB 4JEPA 5BREA 4FJHA 1XC3A 3D6RA 4ISEA 1I39A 2ZF5O 5HRRA 3V1RA 4C1NK 2BUPA 4BE2A 2OA8A 4KRFA 5CYMA 3R8EA 5FPMA 2OZMA 3KKSA 4GKJK 2GUIA 1G99A 4CESA 1L3TA 4GV9A 4ELTA 3O9TA 4IEIA 1U4BA 1NU0A 3VN5A 4BDPA 3K59A 4PWDA 4BROA 4NLCA 2E5LK 4M41A 3LZIA 1WBBA 1JLCA 4O44A 4CZIA 4CVNE 4FCYA 3M8RA 4ILHA 4KBOA 2FLOA 3DXKA 2E6LA 4FLUA 2ZQBA 4DFMA 5E41A 4FK2A 1HLUA 4Z0UA 2YHXA 3FFKB 1BHLA 4FM2A 4IDKA 4A2BA 2BE2A 2QWRA 4B9QA 2RHKA 2CGJA 2KFZA 2YX6A 5BRFA 1VSLA 3TAGA 3OYFA 1L3UA 5FRMA 1NOYA 3FLCO 2AA4A 3MN7A 1VSMA 1WNSA 3PLAA 1X3MA 2V52B 4WFAL 4A5BA 4PL8A 1HJOA 1WSJA 2YKMA 4I9QA 4CK3A 3CJ1A 1RT7A 3IG1A 2W6KA 4DV5K 1RGIA 3K2PA 1ESVA 3MXMA 2NRXA 3B6OA 3MXIA 2CH6A 2HNYA 3MN6A 4IO8A 4CJEA 3V81A 3VERA 2F4VK 2GELA 3ZSRA 5SWMA 1RT5A 1IKYA 2E1ZA 4BRPA 4U67L 3IRXA 3TARA 3AVJA 5AQKA 4M3YA 4CCHA 4N41A 4OKEA 5JICA 4KB1A 1X9SA 5AZIA 3BGRA 3HI0A 2DFEA 4DR6K 1QSSA 2HHXA 2P9NB 2UXCK 4M45A 3LM9A 1BA1A 3C6TA 3DM2A 3TANA 4QAGA 4DU1A 4NB4A 1HNZK 2VWKA 1HRHA 4IXCA 1KRPA 2OANA 4IFEA 4BRLA 1LCUA 4H4OA 1L3VA 4LFBK 4E7IA 1Z25A 3PO4A 5AQWA 4FZYA 3MECA 4YFUA 1YVNA 5BRDA 3THXB 4GVEA 3D2EA 4BRCA 3NF7A 4CBUA 3B8AX 3MXJA 3O4QA 5BR8K 3O3GA 3ULEA 4IJNA 4BR0A 3OYLA 3U4LA 2VWBA 3SQ4A 1NOZA 4EHTA 3TAMA 4KHPK 4LSLA 1FKOA 4DTSA 2P9UB 4AF1A 2HBMA 2E88A 1MU2A 1S72N 2KZMA 3A8YA 4X65K 3NF6A 4Z4HA 3NE6A 3AV9A 1WBDA 2GEMA 3KD1E 2O8DB 4DV1K 4PKIA 1NK0A 3CJ7A 2Z1GA 5JS1A 3NAEA 4K0KK 1G15A 4HCCA 5FLXO 1RDDA 3O6WA 4DF8A 1TYQB 5KGWA 3UIQA 4CEZA 2WTUA 4IEEA 1P8ZA 2E2OA 5LJWA 4FWQA 2OTJN 4TSXA 4CHQA 5GAEP 3JS6A 3OBWA 1X9WA 4N5SA 4CD1A 5TKWA 1HKGA 2IIRA 2YCHA 1NGJA 5CY4A 1OH8A 4E7KA 3TTDA 4CFAA 2CH5A 5HOOA 3SUPA 4ISFA 3J7ZO 4HUGA 5GINA 1B9DA 3QMLA 4AHCA 4V19S 1C1BA 1K8KB 3RMDA 3CQXA 1HR0K 4LF6K 1NGIA 1HUXA 5AZJB 5CZ1A 3ITHA 3U9ZA 2P9IB 2Q0RA 1LW0A 1HJRA 5C24A 4O4GA 4ID1A 2W40A 3CPEA 5JLFA 3ZT3A 3NBPA 2DFFA 4H8KA 3EL2A 3K57A 4GNIA 5D3GA 1D5AA 1J5EK 4B3RK 3SAGA 1ZXOA 3AARA 1EWQA 4FLTA 2ASPA 3VEVA 4BC5A 3BF1A 3AVCA 2G8UA 1S1TA 4KHSA 3WXLA 4GV6A 4CZEA 3EN9A 3L3UA 4Z94A 4CJKA 1QSLA 1JXEA 4HTLA 4JKGA 2ZD1A 4DTXA 4DR2K 3TWHA 1JCGA 3QINA 1CXQA 2QTDA 5EU7A 3NF9A 3VQEA 3T7ZA 2RE2A 4E1JA 4OLAA 4B1UB 2QWLA 3E9PA 4JI1K 4CJ3A 3WNHA 3CCSN 5C42A 3EZ5A 1BIUA 3FZHA 4CJLA 1SAZA 1D8YA 5J2PA 4QCLA 4BRDA 3H08A 5LY3A 2F8TA 2IGIA 1LWEA 3EEQA 3VTHA 3ENBA 4B1VA 1SZ2A 3ZX2A 3QB0A 2QI2A 3CPWM 1BGXT 4NO7A 5I3UA 3Q7CA 3V4IA 3FR0A 5AQXA 3S3NA 3OYMA 4DLEA 4OO1J 2P9SB 4FOIA 3MCPA 3DLEA 3I0RA 1ATSA 2KW4A 3QFUA 3OYEA 4CGFA 5HRPA 3ID8A 1K9MO 5I9EB 1KVAA 2XHBA 3QBWA 4H0XB 4WQ5A 4CJSA 4DMNA 4H4MA 1IV0A 3AA4A 5FROA 3D2FA 3R9PA 3QERA 5AQTA 4PY5A 4MLHA 1N33K 2F9WA 4G9ZA 1K8AO 3J8AA 3JAMO 4HCBA 3KLFA 2VYPA 4XIUA 4CJRA 4JK9A 2QWQA 1FK9A 3PIPL 2UYTA 3LDQA 1UA0A 4JI3K 4B8CA 3QEPA 3LPUA 4CJVA 4RWTA 2G8KA 1CZ9A 4I2QA 3CC7N 1B92A 3AVBA 2D0PA 1B9FA 3O9UA 4YY3K 1XI1A 4PQUA 1P90A 5DK5A 1BU6O 3LP0A 4A59A 2AP1A 4OVLA 1VQNN 4LY7A 3ZYYX 3U3GA 2HOEA 3BF3A 1Q81O 3QDKA 4O5FA 2F9TA 4CZLA 1VK0A 4ZTJA 3HM8A 4N47A 4CI6A 1QVFM 4BG9A 4RG8A 4H0OA 3QIOA 1GOAA 3LDSA 5LMUK 4FWSA 2UXBK 2XO7A 5ADXH 3RSEB 1D9FA 4CGGA 4DV0K 4CF8A 1JLQA 3SLCA 3GE1A 5AQFA 2A1RA 1HNWK 4DV6K 1X9JA 1WN7A 3VQ8A 4OKJA 5EVZA 1QHTA 4M7YA 4H5NA 3LALA 4KHQA 1E4FT 1KC8O 3AO4A 1ASWA 3V1QA 3MN5A 4IO9L 4M3RA 3CC2N 2P9LA 1RTDA 4GW6A 3ZSXA 4BVOA 2CGLA 1WSEA 4IFVA 1KCFA 2JWLA 2X6SA 3WT0A 2ZWHA 5BN9A 3L2RA 3DJCA 1JJ2M 2A3ZA 4JD2A 3PIOL 1LWCA 1SL1A 4KHNA 3PY8A 1S6QA 5TKYA 4IOCL 1VAZA 4DKWA 3ATUA 4JS5A 2D1KA 5GIPA 3KZBA 4BQZA 1YJ9N 5AQZA 3V9WA 4QS8A 3GDQA 3F2KA 4XH4A 4FK0A 4B8AB 4GKKK 2HVIA 1QS4A 4YHHK 1OVQA 1JLBA 3ID6A 3KLEA 5GADP 4K8XA 5CZ2A 3VOVA 4ELUA 4JK8A 5J2MA 4BR7A 1U49A 3VA3A 1HYVA 3K5NA 3ZT0A 2DPNA 3OYKA 3HYFA 3V9XA 5ADXA 3BZKA 4BR9A 4BG8A 2FF3B 4DWIA 1IKWA 2D0OA 4CJTA 4KAZA 2I5JA 2HW3A 3E1YA 3SCXA 2NRRA 1N8RO 3K9JA 4KH5A 4B1ZA 1JLAA 4Y1DA 3OHRA 4K43A 1RBVA 4FZZA 1J54A 3QEWA 4BRIA 1VSDA 1BI4B 3V9SA 2P9KA 4DFJA 2YNIA 4PKGA 4C23A 1WSHA 1U45A 1NJWA 4FWRA 3O4WA 1KTQA 3OVNA 4M63C 4DCHA 3L2UA 4CEDA 2O8FA 4E19A 3E66A 4B9MA 5K14A 3SYZA 4KKOA 5FDLA 4LSNA 2Q3SA 1U6ZA 3AO2A 3CCUN 3KTQA 2E4LA 2KKZA 4FVUA 4MDBA 3AVNA 2AJQA 3ASMA 4E7HA 1NKEA 4KI6A 3CCVN 2QWPA 3NH2A 2OPRA 3FZMA 3IUCA 1C0MA 1IJJA 1BDGA 1RILA 3C65A 5AQSA 5C15A 4AM7A 2E2PA 2Q97A 4IOAL 4FL9A 4CBWA 1YJWN 3SPZA 1NLVA 3ENHA 4CGJA 1RBRA 3DXMB 4Q5VA 3OBYA 3LANA 4YOVA 3W3DA 5AQNA 1S6PA 3VESA 3E9OA 4KREA 3HOTA 3J80O 3HP6A 4B3MK 2QWOA 3AGRA 4NCBA 3TAFA 4CHPA 1KVCA 3SK3A 5E26A 3CMEN 4N76A 1GLCG 2GWJA 4LFAK 4C8MA 1S1WA 3AO1A 3W0LA 5DMRA 4KFBA 4WFBL 3KWIA 3M3ZA 1GLEG 4FVMA 3OW2M 1ZBIA 4HHTA 1XWLA 3BZCA 1IKXA 3EKUA 5DM7L 4DSFA 5AQVA 4GV3A 5KPTA 1VQPN 2IS3A 2VG5A 4RTFD 3VGKA 4LC9B 3TTCA 3VF2A 4BWMA 3U9DA 1RDAA 3H1VX 3TSPA 1T6DA 4BWJA 1K73O 1S5JA 1Q7YO 3UB5A 4W5RA 1RBUA 1BO5O 1HNIA 2GX9A 4BRFA 4DSLA 3KHYA 4ID5A 3KVGA 1CLQA 3P39A 4CJQA 2VGMA 4NXNK 3HRGA 3CC4N 1YIJN 5GAHP 3AO3A 3A0IX 2QWMA 5EX5A 3QESA 1RT6A 2YKNA 5DM6L 3IMXA 4DR4K 3HT3A 3D45A 5C10A 4BRKA 5EXWA 4J2DA 4H0PA 3I8DA 5AJ3K 1VQ7N 3FFIA 4UQGA 3HOSA 3KLGA 5BR9A 3DRPA 3OYNA 3OJUA 3M8SA 3S9HA 5ELZA 1Q8IA 4JI5K 1E4GT 4RW4A 2O8EB 3SZ2A 5AZIB 1NJZA 3RR7A 3PO5A 4CK2A 1U2VB 5AQHA 3O8MA 4AHRA 3L2QA 2ZJPL 2HHTA 3C94A 4B9TA 3ZT2A 3VQ4A 2NRVA 4C8KA 1RBTA 4DR7K 4FJ5A 2QXLA 3P83D 2NRTA 4JYAK 4IBNA 4I7FA 4ZTFA 3CJBA 4O55A 4ILJA 4BDZA 1HKBA 3L4IA 3SMPA 4CBXA 3ZLJA 3PV8A 3ULDA 3PX0A 3KK2A 1S1XA 3ZSYA 1NKBA 1NMDA 4CJ7A 3D2EB 4AHSA 4YORA 3C6HA 3WQUA 1NGEA 2VGNA 3DWLA 4DSKA 1ATNA 4CF1A 1GLDG 1GOCA 1HNVA 2XY5A 4BC2A 3F9MA 1KD1O 4PUOA 2GBZA 4DQ8A 3G10A 3FZFA 3K0SA 2QEXN 2X6NA 4WCEL 4H0YB 3VQAA 4AHUA 4OLBA 1QQNA 2YNHA 4WE1A 2RN2A 2A42A 3THYB 2VWJA 2KHOA 2ZGZA 4QS7A 2JWKA 4CIGA 1NWKA 4Y1CA 1IBKK 2NNWA 4QS9A 3CCRN 5J2NA 3UKRB 2OPSA 1KLNA 3T1HK 1YHQN 3QEXA 3HTVA 1QSYA 3P31A 4FLWA 1GLJO 5M1KA 4CEFA 4F3TA 2IVPA 4DTMA 4FYDA 4BACA 5T7BA 2IDOA 4MQ3A 4J2BA 4NYFA 3MDQA 2YHAA 4AHTA 1UAXA 1TK8A 2DY4A 3LWLA 3T1YK 1GLAG 4XEIA 3OA9A 2HBLA 4FO0A 5M1OA 3HM9A 4YNQA 2A6AA 2E20A 1C0GA 2QKKA 2HMIA 3A5MC 3V1OA 3O9QA 4DQPA 2FBYA 2XY8A 4IWVA 1TVRA 4A61A 2P9NA 1XC9A 3THWB 3KKRA 3VQBA 4DSJA 3ZX0A 2BDPA 1S22A 3A5OC 3ISNC 3NGZA 4BC4A 3AA2A 1VQ6N 2D0CA 3DLGA 1CXUA 2O4GA 3CF5L 3U3YA 1TK0A 1VQ9N 4DS5A 3N4QA 4DQIA 1UA1A 1MA9B 3ZSWA 1KAYA 3R1XA 4CERA 2QK9A 3O3HA 3S3OA 1SV5A 4BY9C 4G1QA 3CFOA 2PZSA 3I0SA 4C1NI 3I55N 3ZETB 4FJ8A 3THXA 5A2QO 2UUBK 5J2QA 3HO1A 5KI6A 3RTVA 3EE9A 2PY5A 4M7XA 4HWIA 3JXUA 3O08A 3GL1A 4JI2K 3G71N 1NK8A 1FW6A 2YJEA 3VQ5A 3CIPA 4JKBA 3K9KA 3SMSA 3T1AA 2P9UA 5M1NA 2A41A 3QLHA 1YT3A 2V7YA 3DRSA 3ALYA 3H45C 1Y97A 2ASMA 1T6CA 4BRGA 3VGLA 4R79A 1JCFA 1NK7A 4FSVA 3Q7BA 3AVMA 2VQFK 4O8KA 3CJ9A 4BREA 2O8DA 1LOTB 3HBTA 3QIPA 4CFDA 5CHIA 1OH7A 1BA0A 2R7YA 4B3SK 5JVGL 3A5NC 2HNDA 3M1FA 2FBVA 3VEZA 4H5TA 4YOTA 3TTFA 4CIEA 2HHSA 1EXQA 1TYQA 2XY7A 4CGDA 1NGHA 1HNXK 3CCLN 3FZLA 3O9SA 4K42A 1XHXA 1TKXA 1U04A 4A2AA 4E7JA 1NG9A 3DLHA 3R6MA 1X3NA 3I56N 4CJ5A 3ZEUB 2HNZA 1VQKN 3AAPA 3AVFA 4FWPA 4H0TB 1V4SA 4CHZA 4KB0A 2NRZA 2Q2RA 4B08A 4OPAA 1SKRA 3EY1A 4E7LA 4EIAA 1TKZA 4EFHA 2O8BA 2KQ2A 1LW2A 1EQYA 1T44A 5AQRA 1DEJA 4YOWA 1K8KA 3J7YP 1IG8A 1RT1A 3CQ8A 1W97L 5C2FA 5LMNK 2HF3A 1BQMA 5KPRA 3D7EO 2YHYA 3TPQA 1QQCA 3AVIA 1RTJA 1V4TA 3PX4A 5MLCQ 2HHWA 1NK9A 2I7PA 5JS2A 1T05A 3VQPA 4Y0WA 3AY9A 4KTQA 1LV5A 5AFUH 4CJWA 1DLOA 1EWRA 2BTFA 1IBMK 1C0TA 1X9MA 2ZGYA 2GWKA 4DB3A 5C0YA 3KLHA 2B5JA 3AA5X 3EZWA 1JCEA 3C7NB 1TUYA 3O9RA 4DV4K 1YUWA 2KZZA 1FJGK 1X1PA 4WQ4A 2QW9A 3MWPA 4F2SA 3T69A 5BRHA 4IFYA 1KAXA 4CJFA 1Z05A 4CHOA 2D4WA 3ATVA 5KRTA 4JLHA 4R5PA 1RFQA 3HVRA 4H5VA 4BE1A 5CYQA 1WSIA 2WOMA 4MLEA 4NCGA 3CI5A 5BPLA 3VPZA 3QETA 4JN4A 2G8IA 1QVGM 4W5NA 1NGBA 3BY5A 2P9LB 4L3QA 1N6QA 4HUFA 1W0HA 3VQ7A 1OH6A 3VETA 3MCAB 1OKJA 4IG0A 4A62A 2JLEA 2P51A 2P9SA 1NGCA 1HMVA 4DSEA 4X62K 3WXKA 4EHUA 4EZ6A 1A5WA 4M3ZA 2G8FA 3BP8A 2Z1IA 2ASOA 2DFHA 4CEAA 5GIOA 1RT4A 2H3GX 3GG4A 4FK4A 4NYNA 4NLBA 3KLIA 4W5OA 4JRQA 4DUZK 3SV3A 4DFKA 3LAKA 2F8SA 4ISGA 2HHHK 3L3VA 5AFUA 1IH7A 2P9PA 1BCMA 4FPAA 2FF6A 4I6MB 3TAQA 3TI0A 2OPPA 2UUCK 3J81O 4DQQA 3DLBA 3VQQA 3D0PA 4WQ4C 3DMJA 4XH5A 4JAXA 3K58A 3VQ9A 4UY8O 1VSFA 3OY9A 3C95A 1CZBA 3WEEA 3UKUB 4FJMA 3OS1A 1SUQA 3DLRA 4ZHRA 4CJPA 2Z1HA 2GV9A 2WFBA 1QQMA 3VEXA 3DLLL 4IKFA 1WSFA 3L2VA 4CJUA 4I9LA 1XMOK 4HVJA 2QWNA 3G0ZA 1JXBA 1NGDA 1TV6A 4A5AA 4CZFA 4DTNA 4FZXC 2P9KB 4BR5A 3OTOK 1JLEA 3WQTA 5KGXA 3NCIA 4JNEA 2YNGA 5BN8A 3TAPA 4KHUA 3C0BA 2A5XA 4KH4A
chains in the Genus database with same CATH topology
1HNIA 1NOZA 3HP9A 3TAMA 2HHQA 4DSLA 4C8NA 4QOZB 3HPGA 4ID5A 4FJXA 1CLQA 4M3WA 4CJQA 1SL2A 4LSLA 4RW7A 1FKOA 4DTSA 4FJLA 4C8OA 4KV8A 2OPQA 3AO3A 3QESA 1RT6A 2YKNA 3RRHA 1VSIA 2HVHA 2X74A 1MU2A 3HT3A 1RTIA 3D45A 2KZMA 1FXXA 3A2FA 3PX6A 3RWUA 1JL1A 3NF6A 4Z4HA 3NE6A 3AV9A 3KD1E 3I8DA 4J2DA 4O0IA 3RMCA 1TK5A 1JKHA 1NK0A 3FFIA 4Z4GA 4UQGA 3LPTA 1ASUA 2Z1GA 3M8QA 3ZSQA 3KLGA 5JS1A 3NAEA 3DRPA 2D5RA 3OYNA 3EYZA 4EZ9A 4CFBA 3OJUA 3CYMA 3NGYA 2NUBA 3M8SA 4ICLA 1G15A 3T3FA 4HCCA 4DTJA 1RT2A 3S9HA 4DF8A 1Q8IA 1RDDA 3L8BA 4FJNA 5KGWA 2X78A 4OPJA 4RW4A 3RMAA 3V9ZA 3UIQA 3SZ2A 4CEZA 3SI6A 4DG1A 2ZE2A 1ZBHA 1NJZA 3RR7A 1JLFA 4DU3A 3PO5A 4FJKA 4CK2A 1LAVA 1J9AA 4TSXA 3VQ6A 4CHQA 4AHRA 1X9WA 4N5SA 1F21A 3L2QA 4CFCA 1HQEA 4FM1A 4FJGA 4KHWA 2QKBA 2HHTA 3C94A 4CEBA 4B9TA 2JGUA 5CY4A 3VQ4A 1EETA 1RBTA 2ATQA 3ZT2A 4E7KA 4C8KA 4FJ5A 4CFAA 3P83D 1IG9A 3SUOA 2DTUA 4IBNA 3OYAA 4I7FA 3SUPA 4ZTFA 1T7PA 3NF8A 4O55A 1VSHA 4HUGA 3ZSOA 1T8EA 4BDZA 2VG7A 3DI6A 1B9DA 4BE0A 4B9NA 3IS9A 3MEDA 1S9GA 4KO0A 4AHCA 3U6FA 1C1BA 1TL1A 4DTOA 3ULDA 3PV8A 4CF2A 3PX0A 3RMDA 3KK2A 1WAJA 4GMJB 1S1XA 3ZSYA 4B9VA 3LP1A 1NKBA 1EKEA 5CZ1A 3NH0A 3ITHA 5HP1A 4EP5A 3NGIA 4AHSA 1LW0A 1N5YA 1HJRA 5C24A 4O4GA 4ID1A 1NJXA 2P5GA 1LAWA 4DQSA 4DSKA 4CF1A 3THVA 1GOCA 4M42A 1HNVA 3SUQA 3ZSZA 1U48A 3ZT3A 3NBPA 2DFFA 2XY5A 4H8KA 3S3MA 3ZT4A 3MEGA 3K57A 4CHNA 4L8RB 4FLXA 3TABA 4PUOA 1KVBA 1D5AA 4CF9A 2GBZA 5D3GA 3SV4A 3JYTA 4CEQA 3VA0A 3G10A 4FLTA 2X6NA 2B4JA 2D0AA 2HHVA 3VQAA 4AHUA 2W42A 4OLBA 2IOCA 2RF2A 3E01A 3HPHA 2YNHA 3AVCA 2G8UA 4WE1A 2RN2A 4FW2A 1S1TA 4KHSA 4DS4A 4JRPA 4OGEA 4AILC 2VWJA 1K6YA 3MEEA 3K5MA 3L3UA 4CJKA 1BI4A 4I2PA 4DFPA 2FBXA 3LZJA 1QSLA 1JXEA 2ZD1A 4CIGA 5J1EA 4DTXA 1NJYA 4Y1CA 4M3XA 3TWHA 3QINA 1CXQA 3M8PA 4OJRA 5EU7A 3NF9A 3VQEA 1ZBUA 5HRSA 5J2NA 3F9KA 1KLNA 2OPSA 4FLVA 1RCHA 4OLAA 4FLYA 3AO5A 3P5JA 3QEXA 1HYSA 4CJ3A 1I3AA 4OGCA 3WNHA 1QSYA 1A5VA 4FM0A 1UOCA 5C42A 3EZ5A 1SKWA 1BIUA 3OJSA 4FLWA 1VSEA 3DOLA 3OS2A 4KTZA 4CJLA 1TAUA 4CEFA 4F3TA 4FYDA 1JL2A 4DTMA 1D8YA 5J2PA 4BACA 4QCLA 5T7BA 2IDOA 4MQ3A 3HSTB 4PA1A 3F73A 2F96A 3H08A 4NYFA 4J2BA 4AHTA 2YHAA 2F8TA 2IGIA 1LWEA 3AVAA 4E1NA 1UAXA 3VQDA 1TK8A 2DY4A 3LWLA 3AA3A 3O3FA 1TKDA 4LD0A 4DF4A 1T03A 3MAQA 1J5OA 1BGXT 1HYZA 5I3UA 1HPZA 3DRRA 3V4IA 1RDCA 3HM9A 3S3NA 3OYMA 4DLEA 4YNQA 5KRSA 2QKKA 4CEOA 2HMIA 1S1VA 3DLEA 3I0RA 4KTWA 3V1OA 3L2WA 4DLGA 2OYQA 2KW4A 2EHGA 3OYEA 4CGFA 4DQPA 2FBYA 5HRPA 4M3UA 1WLJA 1KVAA 1WAFA 1EP4A 2XY8A 2XHBA 1TVRA 3VQCA 4CJSA 4DMNA 4H4MA 4RW6A 1XC9A 3AA4A 5FROA 3KKRA 4K8ZA 1ZBFA 3VQBA 3QERA 1NK4A 3CM5A 4F3OA 4PY5A 4DSJA 2BDPA 3ISNC 3NGZA 4E3SA 2FBTA 1J53A 4FJ9A 2BGGA 1RBSA 3AA2A 4F4KA 4N56A 1BIZA 2D0CA 2ITGA 3DLGA 3KLFA 1CXUA 2O4GA 4EP4A 4CJRA 4XIUA 3U3YA 1TK0A 4DQRA 2IAJA 1BCOA 1FK9A 4DS5A 4DQIA 1UA1A 1EX4A 3ZSWA 1IO2A 4CERA 5HRNA 1UA0A 2XY6A 2QK9A 3SQ1A 1L3SA 3HVTA 1BL3A 4B8CA 3QEPA 1RNHA 3LPUA 4CJVA 3O3HA 3SUNA 1SV5A 3S3OA 1QE1A 2G8KA 3NDKA 1CZ9A 4G1QA 4I2QA 1B92A 3CFOA 3RR8A 2PZSA 3AVBA 1L5UA 1NK6A 3I0SA 2G8WA 4ELVA 3OYHA 2VG6A 2YNFA 2HHUA 4FJ8A 1B9FA 4DU4A 3QO9A 1XI1A 4PQUA 5J2QA 3HO1A 5DK5A 4Q0BA 5KI6A 3RTVA 3LP0A 3DYAA 1ZBLA 1VRUA 3QNOA 2PY5A 4OVLA 1YTUA 4C8LA 2Y1JA 4FXDA 1NK8A 4FJJA 2B6AA 2YV0X 4LY7A 4CK1A 3HK2A 3KD5E 3VQ5A 1VSKA 1YVUA 2QXFA 4FW1A 3AVHA 3U3GA 1REVA 4Z4FA 1SL0A 4HCBA 1ZYQA 4W5QA 4AH9A 1VK0A 4ZTJA 3OYIA 4N47A 3SQ2A 5HLFA 4DSIA 3T1AA 3OYCA 2LSNA 1XHZA 3AVKA 2RPIA 4RG8A 3QLHA 1YT3A 3TAEA 1RTHA 3DRSA 3QIOA 3SPYA 3ALYA 4IG3A 4CJ4A 4JS4A 4NCAA 4DTRA 1Y97A 1GOAA 1D9DA 3LDSA 4HTUA 2HB5A 4F8RA 1NK7A 4W5TA 2XO7A 3AVMA 3K5LA 3QNNA 4CHYA 4CGGA 1D9FA 5FRNA 4CF8A 1NKCA 1JLQA 1C1CA 4FJ7A 3QIPA 4CFDA 5KTQA 5C25A 4FJIA 4B9LA 2A1RA 4KHYA 2R7YA 3DLKA 3ZT1A 4CEEA 3QEVA 2KTQA 2P5OA 2HNDA 1O1WA 2FBVA 4M3TA 1WN7A 3ZCMA 2O4IA 3C6UA 3TR8A 3AVLA 4CIEA 3AVGA 3NFAA 2HHSA 1EXQA 3VQ8A 2XY7A 4CF0A 4CGDA 4OKJA 2RKIA 1QHTA 4LH5A 3CFPA 4RW9A 4Z4IA 1ASVA 3LALA 4CECA 1UWBA 4MFBA 1XHXA 3NHGA 4KHQA 1TKXA 1U04A 3AO4A 4E7JA 3DLHA 1ASWA 3V1QA 2PYJA 4GVMA 1KSPA 4CJ5A 1LWFA 1SKSA 1BQNA 2HNZA 4M3RA 1TL3A 3AVFA 4B9SA 2BANA 1RTDA 1C0UA 4CGHA 4GW6A 4CHZA 3ZSXA 4KB0A 4O5BA 1DTQA 2OZSA 1WSEA 2EX3A 4B08A 1SKRA 4F2RA 4IFVA 5SZTA 3O4NA 3DOKA 4CIFA 3EY1A 4E7LA 1KCFA 3HPOA 3SQ0A 3BDPA 1TKZA 2X6SA 3L2RA 2KQ2A 1YTAA 4LH4A 1LW2A 3KK3A 3OYGA 4J2EA 3WNEA 3KK1A 4E89A 2D0BA 4E0DA 3KJVA 4J2AA 4FLZA 5HROA 1LWCA 1WSGA 1RT1A 3CQ8A 1SL1A 1RT3A 4KHNA 3PY8A 1S6QA 1IKVA 1BQMA 3RRGA 4DTUA 1TGOA 1QQCA 4JS5A 3AVIA 3HL8A 1RTJA 1DTTA 2E6MA 3PX4A 3V9WA 3B6PA 3JSMA 5HBMA 4FJHA 2HHWA 1RDBA 1VRTA 1NK9A 5JS2A 1T05A 1I39A 3VQPA 4FK0A 4B8AB 5HRRA 3V1RA 4BE2A 1QS4A 2HVIA 1ITGA 1JLBA 3KLEA 4KTQA 3LAMA 1LV5A 2OA8A 5CZ2A 4CJWA 1QTMA 4K8XA 4KRFA 1W9HA 4ELUA 1DLOA 5J2MA 1FKPA 2G8VA 1U49A 5CYMA 3VA3A 1HYVA 2XRIA 2OZMA 1C0TA 4E1MA 1X9MA 3KKSA 3K5NA 1KLMA 2GUIA 3ZT0A 4CESA 3WNFA 3HYFA 3OYKA 3V9XA 1L3TA 4ELTA 1Z26A 3KLHA 1U4BA 2B5JA 2G8HA 3VN5A 3AA5X 4BDPA 3K59A 4PWDA 4M41A 3LZIA 1IKWA 1Q9YA 4DWIA 4KPYA 4CJTA 2KZZA 4KAZA 1JLCA 4O44A 4Z4CA 3CG7A 2I5JA 4FCYA 3WNGA 3SCXA 1X1PA 2HW3A 3M8RA 4F2SA 2E6LA 1JLAA 4IFYA 4Y1DA 4CJFA 4FLUA 4CHOA 1RBVA 2ZQBA 1J54A 1JLGA 2YHBA 3P1GA 5E41A 4DFMA 1VSDA 3QEWA 4FK2A 3PUFA 4Z0UA 5KRTA 1TKTA 1BHLA 3K5OA 4JLHA 4IDKA 4R5PA 4FM2A 1R0AA 2BE2A 3HVRA 1BI4B 3V9SA 1KFSA 4CGIA 1A5XA 4BE1A 4DFJA 2YNIA 5CYQA 1WSHA 1U45A 1NJWA 3IAYA 2KFZA 4HUEA 1L3UA 1VSLA 1KTQA 1WSIA 3OVNA 2WOMA 3OYFA 4NCGA 3TAGA 5FRMA 1NOYA 3L2UA 4CEDA 3QETA 1S9EA 4E19A 4BDYA 4B9MA 1VSMA 2G8IA 1WNSA 5K14A 3SYZA 4KKOA 5FDLA 4W5NA 4LSNA 2Q3SA 1GOBA 3AO2A 1S1UA 3KTQA 2E4LA 1N6QA 1WSJA 1BISA 3AVNA 2YKMA 1W0HA 4O0JA 3VQ7A 4CK3A 3ASMA 4HUFA 4I9QA 2AJQA 3V9UA 3V6DA 1RT7A 2Z1JA 4E7HA 4IG0A 4OPKA 3IG1A 1NKEA 2JLEA 2P51A 1NK5A 4KI6A 3NH2A 3SJJA 1HMVA 2OPRA 3K2PA 3OYJA 2FC0A 4DSEA 3MXMA 1C0MA 3B6OA 3MXIA 4EZ6A 1RILA 2HNYA 4CJEA 1A5WA 3V81A 2PYLA 4M3ZA 2Y1IA 2IC3A 3RMBA 2G8FA 1VSJA 2Z1IA 3ZSRA 2DFHA 4CEAA 3SPZA 5SWMA 4AHVA 1RT5A 1RT4A 1TAQA 1IKYA 4RW8A 1RBRA 4CGJA 3OYBA 4Q5VA 3LWMA 4FK4A 4NYNA 4FZZA 3LANA 3HJFA 3IRXA 3KLIA 4W5OA 3AVJA 4JRQA 3SV3A 4DFKA 3LAKA 3TARA 1S6PA 4M3YA 2F8SA 4CE9A 3L3VA 4KREA 3LP2A 4CCHA 4N41A 1IH7A 4OKKA 4OKEA 3HP6A 1BCMA 1KFDA 4KB1A 3QEIA 3TAQA 3TI0A 1X9SA 3BGRA 2DFEA 2OPPA 1QSSA 3TAFA 4NCBA 2HHXA 4M45A 4CHPA 1KVCA 4DQQA 3OS0A 4B9UA 3LP3A 3DLBA 4KI4A 3CFRA 3VQQA 4N76A 2KFNA 3D0PA 2P1JA 3C6TA 3DM2A 3DMJA 4C8MA 4DTPA 1S1WA 3AO1A 4B3OA 5DMRA 3K58A 3TANA 3KIOA 4QAGA 3VQ9A 4DU1A 2VWKA 4KFBA 1C1AA 1VSFA 1HRHA 1HQUA 3OY9A 3OYDA 3C95A 1CZBA 1KRPA 4FJMA 3NH1A 3OS1A 1SUQA 3DLRA 3T19A 4FVMA 1ZBIA 4HHTA 1Q9XA 4ZHRA 5I42A 1XWLA 2Z1HA 4CJPA 2GV9A 1IKXA 4H4OA 4DSFA 1L3VA 4IKFA 4Z4EA 2A1SA 4E7IA 1Z25A 2IS3A 2VG5A 3PO4A 1WSFA 4FZYA 3CM6A 4BWMA 3L2VA 3MECA 4CJUA 4YFUA 1C6VA 4I9LA 1U47A 4HVJA 3G0ZA 1JXBA 1TV6A 1RDAA 4DTNA 4FZXC 3NF7A 3MXJA 3O4QA 3HXMA 3SNNA 3O3GA 1JLEA 4BWJA 1S5JA 5KGXA 2ETJA 3OYLA 3NCIA 2WONA 2YNGA 3TAPA 4KHUA 4W5RA 1RBUA 3ZSVA 3SQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNI A;  1NOZ A;  3HP9 A;  3TAM A;  2HHQ A;  4DSL A;  4C8N A;  4QOZ B;  3HPG A;  4ID5 A;  4FJX A;  1CLQ A;  4M3W A;  4CJQ A;  1SL2 A;  4LSL A;  4RW7 A;  1FKO A;  4DTS A;  4FJL A;  4C8O A;  4KV8 A;  2OPQ A;  3AO3 A;  3QES A;  1RT6 A;  2YKN A;  3RRH A;  1VSI A;  2HVH A;  2X74 A;  1MU2 A;  3HT3 A;  1RTI A;  3D45 A;  2KZM A;  1FXX A;  3A2F A;  3PX6 A;  3RWU A;  1JL1 A;  3NF6 A;  4Z4H A;  3NE6 A;  3AV9 A;  3KD1 E;  3I8D A;  4J2D A;  4O0I A;  3RMC A;  1TK5 A;  1JKH A;  1NK0 A;  3FFI A;  4Z4G A;  4UQG A;  3LPT A;  1ASU A;  2Z1G A;  3M8Q A;  3ZSQ A;  3KLG A;  5JS1 A;  3NAE A;  3DRP A;  2D5R A;  3OYN A;  3EYZ A;  4EZ9 A;  4CFB A;  3OJU A;  3CYM A;  3NGY A;  2NUB A;  3M8S A;  4ICL A;  1G15 A;  3T3F A;  4HCC A;  4DTJ A;  1RT2 A;  3S9H A;  4DF8 A;  1Q8I A;  1RDD A;  3L8B A;  4FJN A;  5KGW A;  2X78 A;  4OPJ A;  4RW4 A;  3RMA A;  3V9Z A;  3UIQ A;  3SZ2 A;  4CEZ A;  3SI6 A;  4DG1 A;  2ZE2 A;  1ZBH A;  1NJZ A;  3RR7 A;  1JLF A;  4DU3 A;  3PO5 A;  4FJK A;  4CK2 A;  1LAV A;  1J9A A;  4TSX A;  3VQ6 A;  4CHQ A;  4AHR A;  1X9W A;  4N5S A;  1F21 A;  3L2Q A;  4CFC A;  1HQE A;  4FM1 A;  4FJG A;  4KHW A;  2QKB A;  2HHT A;  3C94 A;  4CEB A;  4B9T A;  2JGU A;  5CY4 A;  3VQ4 A;  1EET A;  1RBT A;  2ATQ A;  3ZT2 A;  4E7K A;  4C8K A;  4FJ5 A;  4CFA A;  3P83 D;  1IG9 A;  3SUO A;  2DTU A;  4IBN A;  3OYA A;  4I7F A;  3SUP A;  4ZTF A;  1T7P A;  3NF8 A;  4O55 A;  1VSH A;  4HUG A;  3ZSO A;  1T8E A;  4BDZ A;  2VG7 A;  3DI6 A;  1B9D A;  4BE0 A;  4B9N A;  3IS9 A;  3MED A;  1S9G A;  4KO0 A;  4AHC A;  3U6F A;  1C1B A;  1TL1 A;  4DTO A;  3ULD A;  3PV8 A;  4CF2 A;  3PX0 A;  3RMD A;  3KK2 A;  1WAJ A;  4GMJ B;  1S1X A;  3ZSY A;  4B9V A;  3LP1 A;  1NKB A;  1EKE A;  5CZ1 A;  3NH0 A;  3ITH A;  5HP1 A;  4EP5 A;  3NGI A;  4AHS A;  1LW0 A;  1N5Y A;  1HJR A;  5C24 A;  4O4G A;  4ID1 A;  1NJX A;  2P5G A;  1LAW A;  4DQS A;  4DSK A;  4CF1 A;  3THV A;  1GOC A;  4M42 A;  1HNV A;  3SUQ A;  3ZSZ A;  1U48 A;  3ZT3 A;  3NBP A;  2DFF A;  2XY5 A;  4H8K A;  3S3M A;  3ZT4 A;  3MEG A;  3K57 A;  4CHN A;  4L8R B;  4FLX A;  3TAB A;  4PUO A;  1KVB A;  1D5A A;  4CF9 A;  2GBZ A;  5D3G A;  3SV4 A;  3JYT A;  4CEQ A;  3VA0 A;  3G10 A;  4FLT A;  2X6N A;  2B4J A;  2D0A A;  2HHV A;  3VQA A;  4AHU A;  2W42 A;  4OLB A;  2IOC A;  2RF2 A;  3E01 A;  3HPH A;  2YNH A;  3AVC A;  2G8U A;  4WE1 A;  2RN2 A;  4FW2 A;  1S1T A;  4KHS A;  4DS4 A;  4JRP A;  4OGE A;  4AIL C;  2VWJ A;  1K6Y A;  3MEE A;  3K5M A;  3L3U A;  4CJK A;  1BI4 A;  4I2P A;  4DFP A;  2FBX A;  3LZJ A;  1QSL A;  1JXE A;  2ZD1 A;  4CIG A;  5J1E A;  4DTX A;  1NJY A;  4Y1C A;  4M3X A;  3TWH A;  3QIN A;  1CXQ A;  3M8P A;  4OJR A;  5EU7 A;  3NF9 A;  3VQE A;  1ZBU A;  5HRS A;  5J2N A;  3F9K A;  1KLN A;  2OPS A;  4FLV A;  1RCH A;  4OLA A;  4FLY A;  3AO5 A;  3P5J A;  3QEX A;  1HYS A;  4CJ3 A;  1I3A A;  4OGC A;  3WNH A;  1QSY A;  1A5V A;  4FM0 A;  1UOC A;  5C42 A;  3EZ5 A;  1SKW A;  1BIU A;  3OJS A;  4FLW A;  1VSE A;  3DOL A;  3OS2 A;  4KTZ A;  4CJL A;  1TAU A;  4CEF A;  4F3T A;  4FYD A;  1JL2 A;  4DTM A;  1D8Y A;  5J2P A;  4BAC A;  4QCL A;  5T7B A;  2IDO A;  4MQ3 A;  3HST B;  4PA1 A;  3F73 A;  2F96 A;  3H08 A;  4NYF A;  4J2B A;  4AHT A;  2YHA A;  2F8T A;  2IGI A;  1LWE A;  3AVA A;  4E1N A;  1UAX A;  3VQD A;  1TK8 A;  2DY4 A;  3LWL A;  3AA3 A;  3O3F A;  1TKD A;  4LD0 A;  4DF4 A;  1T03 A;  3MAQ A;  1J5O A;  1BGX T;  1HYZ A;  5I3U A;  1HPZ A;  3DRR A;  3V4I A;  1RDC A;  3HM9 A;  3S3N A;  3OYM A;  4DLE A;  4YNQ A;  5KRS A;  2QKK A;  4CEO A;  2HMI A;  1S1V A;  3DLE A;  3I0R A;  4KTW A;  3V1O A;  3L2W A;  4DLG A;  2OYQ A;  2KW4 A;  2EHG A;  3OYE A;  4CGF A;  4DQP A;  2FBY A;  5HRP A;  4M3U A;  1WLJ A;  1KVA A;  1WAF A;  1EP4 A;  2XY8 A;  2XHB A;  1TVR A;  3VQC A;  4CJS A;  4DMN A;  4H4M A;  4RW6 A;  1XC9 A;  3AA4 A;  5FRO A;  3KKR A;  4K8Z A;  1ZBF A;  3VQB A;  3QER A;  1NK4 A;  3CM5 A;  4F3O A;  4PY5 A;  4DSJ A;  2BDP A;  3ISN C;  3NGZ A;  4E3S A;  2FBT A;  1J53 A;  4FJ9 A;  2BGG A;  1RBS A;  3AA2 A;  4F4K A;  4N56 A;  1BIZ A;  2D0C A;  2ITG A;  3DLG A;  3KLF A;  1CXU A;  2O4G A;  4EP4 A;  4CJR A;  4XIU A;  3U3Y A;  1TK0 A;  4DQR A;  2IAJ A;  1BCO A;  1FK9 A;  4DS5 A;  4DQI A;  1UA1 A;  1EX4 A;  3ZSW A;  1IO2 A;  4CER A;  5HRN A;  1UA0 A;  2XY6 A;  2QK9 A;  3SQ1 A;  1L3S A;  3HVT A;  1BL3 A;  4B8C A;  3QEP A;  1RNH A;  3LPU A;  4CJV A;  3O3H A;  3SUN A;  1SV5 A;  3S3O A;  1QE1 A;  2G8K A;  3NDK A;  1CZ9 A;  4G1Q A;  4I2Q A;  1B92 A;  3CFO A;  3RR8 A;  2PZS A;  3AVB A;  1L5U A;  1NK6 A;  3I0S A;  2G8W A;  4ELV A;  3OYH A;  2VG6 A;  2YNF A;  2HHU A;  4FJ8 A;  1B9F A;  4DU4 A;  3QO9 A;  1XI1 A;  4PQU A;  5J2Q A;  3HO1 A;  5DK5 A;  4Q0B A;  5KI6 A;  3RTV A;  3LP0 A;  3DYA A;  1ZBL A;  1VRU A;  3QNO A;  2PY5 A;  4OVL A;  1YTU A;  4C8L A;  2Y1J A;  4FXD A;  1NK8 A;  4FJJ A;  2B6A A;  2YV0 X;  4LY7 A;  4CK1 A;  3HK2 A;  3KD5 E;  3VQ5 A;  1VSK A;  1YVU A;  2QXF A;  4FW1 A;  3AVH A;  3U3G A;  1REV A;  4Z4F A;  1SL0 A;  4HCB A;  1ZYQ A;  4W5Q A;  4AH9 A;  1VK0 A;  4ZTJ A;  3OYI A;  4N47 A;  3SQ2 A;  5HLF A;  4DSI A;  3T1A A;  3OYC A;  2LSN A;  1XHZ A;  3AVK A;  2RPI A;  4RG8 A;  3QLH A;  1YT3 A;  3TAE A;  1RTH A;  3DRS A;  3QIO A;  3SPY A;  3ALY A;  4IG3 A;  4CJ4 A;  4JS4 A;  4NCA A;  4DTR A;  1Y97 A;  1GOA A;  1D9D A;  3LDS A;  4HTU A;  2HB5 A;  4F8R A;  1NK7 A;  4W5T A;  2XO7 A;  3AVM A;  3K5L A;  3QNN A;  4CHY A;  4CGG A;  1D9F A;  5FRN A;  4CF8 A;  1NKC A;  1JLQ A;  1C1C A;  4FJ7 A;  3QIP A;  4CFD A;  5KTQ A;  5C25 A;  4FJI A;  4B9L A;  2A1R A;  4KHY A;  2R7Y A;  3DLK A;  3ZT1 A;  4CEE A;  3QEV A;  2KTQ A;  2P5O A;  2HND A;  1O1W A;  2FBV A;  4M3T A;  1WN7 A;  3ZCM A;  2O4I A;  3C6U A;  3TR8 A;  3AVL A;  4CIE A;  3AVG A;  3NFA A;  2HHS A;  1EXQ A;  3VQ8 A;  2XY7 A;  4CF0 A;  4CGD A;  4OKJ A;  2RKI A;  1QHT A;  4LH5 A;  3CFP A;  4RW9 A;  4Z4I A;  1ASV A;  3LAL A;  4CEC A;  1UWB A;  4MFB A;  1XHX A;  3NHG A;  4KHQ A;  1TKX A;  1U04 A;  3AO4 A;  4E7J A;  3DLH A;  1ASW A;  3V1Q A;  2PYJ A;  4GVM A;  1KSP A;  4CJ5 A;  1LWF A;  1SKS A;  1BQN A;  2HNZ A;  4M3R A;  1TL3 A;  3AVF A;  4B9S A;  2BAN A;  1RTD A;  1C0U A;  4CGH A;  4GW6 A;  4CHZ A;  3ZSX A;  4KB0 A;  4O5B A;  1DTQ A;  2OZS A;  1WSE A;  2EX3 A;  4B08 A;  1SKR A;  4F2R A;  4IFV A;  5SZT A;  3O4N A;  3DOK A;  4CIF A;  3EY1 A;  4E7L A;  1KCF A;  3HPO A;  3SQ0 A;  3BDP A;  1TKZ A;  2X6S A;  3L2R A;  2KQ2 A;  1YTA A;  4LH4 A;  1LW2 A;  3KK3 A;  3OYG A;  4J2E A;  3WNE A;  3KK1 A;  4E89 A;  2D0B A;  4E0D A;  3KJV A;  4J2A A;  4FLZ A;  5HRO A;  1LWC A;  1WSG A;  1RT1 A;  3CQ8 A;  1SL1 A;  1RT3 A;  4KHN A;  3PY8 A;  1S6Q A;  1IKV A;  1BQM A;  3RRG A;  4DTU A;  1TGO A;  1QQC A;  4JS5 A;  3AVI A;  3HL8 A;  1RTJ A;  1DTT A;  2E6M A;  3PX4 A;  3V9W A;  3B6P A;  3JSM A;  5HBM A;  4FJH A;  2HHW A;  1RDB A;  1VRT A;  1NK9 A;  5JS2 A;  1T05 A;  1I39 A;  3VQP A;  4FK0 A;  4B8A B;  5HRR A;  3V1R A;  4BE2 A;  1QS4 A;  2HVI A;  1ITG A;  1JLB A;  3KLE A;  4KTQ A;  3LAM A;  1LV5 A;  2OA8 A;  5CZ2 A;  4CJW A;  1QTM A;  4K8X A;  4KRF A;  1W9H A;  4ELU A;  1DLO A;  5J2M A;  1FKP A;  2G8V A;  1U49 A;  5CYM A;  3VA3 A;  1HYV A;  2XRI A;  2OZM A;  1C0T A;  4E1M A;  1X9M A;  3KKS A;  3K5N A;  1KLM A;  2GUI A;  3ZT0 A;  4CES A;  3WNF A;  3HYF A;  3OYK A;  3V9X A;  1L3T A;  4ELT A;  1Z26 A;  3KLH A;  1U4B A;  2B5J A;  2G8H A;  3VN5 A;  3AA5 X;  4BDP A;  3K59 A;  4PWD A;  4M41 A;  3LZI A;  1IKW A;  1Q9Y A;  4DWI A;  4KPY A;  4CJT A;  2KZZ A;  4KAZ A;  1JLC A;  4O44 A;  4Z4C A;  3CG7 A;  2I5J A;  4FCY A;  3WNG A;  3SCX A;  1X1P A;  2HW3 A;  3M8R A;  4F2S A;  2E6L A;  1JLA A;  4IFY A;  4Y1D A;  4CJF A;  4FLU A;  4CHO A;  1RBV A;  2ZQB A;  1J54 A;  1JLG A;  2YHB A;  3P1G A;  5E41 A;  4DFM A;  1VSD A;  3QEW A;  4FK2 A;  3PUF A;  4Z0U A;  5KRT A;  1TKT A;  1BHL A;  3K5O A;  4JLH A;  4IDK A;  4R5P A;  4FM2 A;  1R0A A;  2BE2 A;  3HVR A;  1BI4 B;  3V9S A;  1KFS A;  4CGI A;  1A5X A;  4BE1 A;  4DFJ A;  2YNI A;  5CYQ A;  1WSH A;  1U45 A;  1NJW A;  3IAY A;  2KFZ A;  4HUE A;  1L3U A;  1VSL A;  1KTQ A;  1WSI A;  3OVN A;  2WOM A;  3OYF A;  4NCG A;  3TAG A;  5FRM A;  1NOY A;  3L2U A;  4CED A;  3QET A;  1S9E A;  4E19 A;  4BDY A;  4B9M A;  1VSM A;  2G8I A;  1WNS A;  5K14 A;  3SYZ A;  4KKO A;  5FDL A;  4W5N A;  4LSN A;  2Q3S A;  1GOB A;  3AO2 A;  1S1U A;  3KTQ A;  2E4L A;  1N6Q A;  1WSJ A;  1BIS A;  3AVN A;  2YKM A;  1W0H A;  4O0J A;  3VQ7 A;  4CK3 A;  3ASM A;  4HUF A;  4I9Q A;  2AJQ A;  3V9U A;  3V6D A;  1RT7 A;  2Z1J A;  4E7H A;  4IG0 A;  4OPK A;  3IG1 A;  1NKE A;  2JLE A;  2P51 A;  1NK5 A;  4KI6 A;  3NH2 A;  3SJJ A;  1HMV A;  2OPR A;  3K2P A;  3OYJ A;  2FC0 A;  4DSE A;  3MXM A;  1C0M A;  3B6O A;  3MXI A;  4EZ6 A;  1RIL A;  2HNY A;  4CJE A;  1A5W A;  3V81 A;  2PYL A;  4M3Z A;  2Y1I A;  2IC3 A;  3RMB A;  2G8F A;  1VSJ A;  2Z1I A;  3ZSR A;  2DFH A;  4CEA A;  3SPZ A;  5SWM A;  4AHV A;  1RT5 A;  1RT4 A;  1TAQ A;  1IKY A;  4RW8 A;  1RBR A;  4CGJ A;  3OYB A;  4Q5V A;  3LWM A;  4FK4 A;  4NYN A;  4FZZ A;  3LAN A;  3HJF A;  3IRX A;  3KLI A;  4W5O A;  3AVJ A;  4JRQ A;  3SV3 A;  4DFK A;  3LAK A;  3TAR A;  1S6P A;  4M3Y A;  2F8S A;  4CE9 A;  3L3V A;  4KRE A;  3LP2 A;  4CCH A;  4N41 A;  1IH7 A;  4OKK A;  4OKE A;  3HP6 A;  1BCM A;  1KFD A;  4KB1 A;  3QEI A;  3TAQ A;  3TI0 A;  1X9S A;  3BGR A;  2DFE A;  2OPP A;  1QSS A;  3TAF A;  4NCB A;  2HHX A;  4M45 A;  4CHP A;  1KVC A;  4DQQ A;  3OS0 A;  4B9U A;  3LP3 A;  3DLB A;  4KI4 A;  3CFR A;  3VQQ A;  4N76 A;  2KFN A;  3D0P A;  2P1J A;  3C6T A;  3DM2 A;  3DMJ A;  4C8M A;  4DTP A;  1S1W A;  3AO1 A;  4B3O A;  5DMR A;  3K58 A;  3TAN A;  3KIO A;  4QAG A;  3VQ9 A;  4DU1 A;  2VWK A;  4KFB A;  1C1A A;  1VSF A;  1HRH A;  1HQU A;  3OY9 A;  3OYD A;  3C95 A;  1CZB A;  1KRP A;  4FJM A;  3NH1 A;  3OS1 A;  1SUQ A;  3DLR A;  3T19 A;  4FVM A;  1ZBI A;  4HHT A;  1Q9X A;  4ZHR A;  5I42 A;  1XWL A;  2Z1H A;  4CJP A;  2GV9 A;  1IKX A;  4H4O A;  4DSF A;  1L3V A;  4IKF A;  4Z4E A;  2A1S A;  4E7I A;  1Z25 A;  2IS3 A;  2VG5 A;  3PO4 A;  1WSF A;  4FZY A;  3CM6 A;  4BWM A;  3L2V A;  3MEC A;  4CJU A;  4YFU A;  1C6V A;  4I9L A;  1U47 A;  4HVJ A;  3G0Z A;  1JXB A;  1TV6 A;  1RDA A;  4DTN A;  4FZX C;  3NF7 A;  3MXJ A;  3O4Q A;  3HXM A;  3SNN A;  3O3G A;  1JLE A;  4BWJ A;  1S5J A;  5KGX A;  2ETJ A;  3OYL A;  3NCI A;  2WON A;  2YNG A;  3TAP A;  4KHU A;  4W5R A;  1RBU A;  3ZSV A;  3SQ4 A; 
#chains in the Genus database with same CATH topology
 2OCE A;  2HHQ A;  2PAV A;  4C8N A;  4QOZ B;  3HPG A;  3RSE A;  4LFC K;  2I7N A;  2VQE K;  4M3W A;  1BWF O;  3NVK A;  4FJL A;  4BR4 A;  3TSQ A;  5GAG P;  1M1K O;  1O13 A;  4LF4 K;  3QIC A;  2X74 A;  3CER A;  3U8X A;  1CZA N;  1BUP A;  2NRH A;  4U7B A;  4CZK A;  4YOU A;  2ZM6 K;  2FSK A;  4JV5 K;  3RMC A;  4Z4G A;  3LPT A;  3ZSQ A;  3M8Q A;  3L0Q A;  2D5R A;  3EYZ A;  4EZ9 A;  3T3F A;  4ICL A;  2QA4 N;  4FJN A;  3L8B A;  2WBN A;  1Q82 O;  3V9Z A;  3CCQ N;  3IDH A;  3MWT A;  4DG1 A;  1ZBH A;  1EO1 A;  2UU9 K;  4DU3 A;  4FJK A;  1J9A A;  3VQ6 A;  3VEW A;  1F21 A;  4JHD B;  1XUP O;  4CFC A;  1HQE A;  4FM1 A;  4FJG A;  4KHW A;  4CEB A;  2JGU A;  1NBW A;  1QZ5 A;  3SUO A;  2E2Q A;  1T7P A;  3NF8 A;  4BQL A;  1VSH A;  2EWS A;  1T8E A;  3DI6 A;  4B9N A;  3MED A;  4KO0 A;  3U6F A;  4CF2 A;  2GTD A;  1WAJ A;  3HZ6 A;  4GMJ B;  4B9V A;  4JKD A;  2HBJ A;  1EKE A;  3FGU A;  3NH0 A;  5HP1 A;  2BH1 A;  2CGK A;  4EP5 A;  3NGI A;  5C2D A;  1NJI O;  5AQI A;  2P5G A;  4PL7 A;  3RVC A;  1LAW A;  4DQS A;  4OX9 K;  4M42 A;  3SUQ A;  4MO5 A;  3ZSZ A;  1OVY A;  3S3M A;  4L8R B;  3SV4 A;  3VA0 A;  3CQY A;  5BPM A;  2B4J A;  1YIT N;  5AQQ A;  1KAZ A;  3E01 A;  1QZ6 A;  2GUP A;  3PSF A;  4DS4 A;  1YJN N;  3MX5 A;  4OGE A;  4AIL C;  1K6Y A;  4DFP A;  4DUY K;  1BI4 A;  2FBX A;  3LZJ A;  2UUA K;  2F7T A;  4DV3 K;  4M3X A;  1NJY A;  1GLB G;  4X64 K;  3DXK B;  3M8P A;  4FLV A;  4MDA A;  3CD6 N;  4FLY A;  3AO5 A;  1N34 K;  1I3A A;  4OGC A;  2UXD K;  1A5V A;  2HST A;  2Q31 A;  4FWM A;  1UOC A;  4FM0 A;  1SKW A;  3LM2 A;  3OS2 A;  4B1W B;  1ZBS A;  3IKM A;  3F73 A;  2F96 A;  3AGK A;  4K25 A;  1TKD A;  4DF4 A;  1T03 A;  3MAQ A;  1HYZ A;  4BGB A;  3DXM A;  5AQG A;  4CEO A;  5AQL A;  4CW7 B;  1S1V A;  4KTW A;  3L2W A;  2OYQ A;  1WB9 A;  1J6Z A;  4BC3 A;  1GLF O;  1QHA A;  1WLJ A;  5AQP A;  4H5R A;  5IT9 O;  4H5W A;  3G6E N;  4BVP A;  3PSI A;  1NK4 A;  1RDW X;  4E3S A;  3CCM N;  1J53 A;  2V51 B;  2ITG A;  3E9L A;  3VMF B;  1EX4 A;  2O8C A;  2XY6 A;  3SQ1 A;  3HVT A;  1BL3 A;  1RNH A;  3SUN A;  5M1F A;  4H03 B;  4FWN A;  3LDP A;  1L5U A;  1NK6 A;  2G8W A;  3N4P A;  2WUS A;  3MMV A;  4Q0B A;  3H6E A;  3DYA A;  3O1B A;  1VRU A;  3FE1 A;  4C8L A;  4FXD A;  2B6A A;  2YV0 X;  2WC9 A;  3HK2 A;  1E3M A;  1VSK A;  2W6L A;  1ZYQ A;  2NLX A;  4YDU A;  4AH9 A;  1VQ5 N;  3OYI A;  5HLF A;  4DSI A;  2LSN A;  1XHZ A;  3AVK A;  3NVM A;  3VEN A;  2RPI A;  3ULE B;  4EAH D;  2YI1 A;  3SPY A;  3M6G A;  2PBD A;  4JS4 A;  4NCA A;  4DTR A;  1BG3 A;  4F8R A;  4YOY A;  4JI7 K;  4CHY A;  5FRN A;  1NKC A;  1C1C A;  5JMV A;  4FJI A;  4H0V B;  1T3V A;  3QEV A;  3DLK A;  3ZT1 A;  4CEE A;  3H3O B;  2P5O A;  1ATR A;  4FWK A;  1NGF A;  3VEY A;  3TR8 A;  1M90 O;  3NFA A;  4GY2 B;  4KH6 A;  4CF0 A;  2O8E A;  3QBX A;  2RKI A;  3CFP A;  4LH5 A;  5C12 A;  3I33 A;  4RW9 A;  4CZJ A;  2NRW A;  2Q36 A;  1ASV A;  3C6A A;  4CEC A;  1UWB A;  4MFB A;  1U2V A;  3NHG A;  4J8F A;  4MO4 A;  4GVM A;  1SKS A;  4B9S A;  1TL3 A;  4LF7 K;  2BAN A;  4CGH A;  4O5B A;  1DTQ A;  2OZS A;  2EX3 A;  4CZM A;  3O4N A;  4CIF A;  5AQJ A;  3P4I A;  3HPO A;  3SQ0 A;  3BDP A;  1YTA A;  3OYG A;  4E89 A;  2A40 A;  1VQO N;  1WSG A;  1RT3 A;  1IKV A;  4DTU A;  1TGO A;  4YDU C;  3SJH A;  1DTT A;  3G4S N;  5HBM A;  1RDB A;  1VRT A;  5JVH L;  1YI2 N;  4B3T K;  1ITG A;  3LAM A;  4JK7 A;  5M1P A;  1QTM A;  3BUZ B;  1W9H A;  5KQ8 A;  4WF9 L;  1FKP A;  4DR1 K;  2G8V A;  2XRI A;  3SBG A;  4E1M A;  1SS6 A;  1BOT O;  1KLM A;  4JI4 K;  3WNF A;  1Z26 A;  2G8H A;  4JKF A;  1HPM A;  3H3N O;  3THY A;  1Q9Y A;  3I8B A;  4KPY A;  4Z4C A;  1TUU A;  3CG7 A;  4JKE A;  3MN9 A;  3WNG A;  2FSJ A;  3P1G A;  2YHB A;  1JLG A;  3UKR A;  1DGK N;  3PUF A;  4PHT X;  2NZT A;  1TKT A;  3K5O A;  1R0A A;  3LDL A;  1KFS A;  2HBK A;  4CGI A;  1A5X A;  4JKG B;  3IAY A;  2ZJR L;  4HUE A;  1S9E A;  4BDY A;  1GOB A;  1S1U A;  2OTL N;  4O0J A;  1BIS A;  3V9U A;  3V6D A;  2Z1J A;  2O8B B;  4OPK A;  1IBL K;  1NK5 A;  3SJJ A;  3OYJ A;  2FC0 A;  3BEX A;  5AQM A;  2PYL A;  3HSC A;  2Y1I A;  2IC3 A;  3RMB A;  3L4Q A;  1VSJ A;  4AHV A;  1TAQ A;  3THW A;  4RW8 A;  3OYB A;  1HKC A;  3LWM A;  4LF5 K;  5AQO A;  3HJF A;  5B8H A;  4CE9 A;  5FPE A;  3LP2 A;  1Q86 O;  1NGG A;  1ZC6 A;  4OKK A;  1KFD A;  4LF8 K;  3QEI A;  1NM1 A;  4BGA A;  3MX2 A;  4JKC A;  3MK6 A;  2E1Y A;  3OS0 A;  4B9U A;  3D2F B;  3LP3 A;  4KI4 A;  3CFR A;  3GBT A;  2KFN A;  2P1J A;  1VQ8 N;  4FOE A;  3VGM A;  4DTP A;  4B3O A;  4PKH A;  3KIO A;  1C1A A;  3OYD A;  1HQU A;  4CZG A;  5FPD A;  4DR3 K;  3ZET A;  5KPZ A;  5JLH A;  3NH1 A;  4IDH A;  3T19 A;  3LDO A;  1WUA A;  1Q9X A;  5I42 A;  4Z4E A;  4BRQ A;  3EKS A;  2A1S A;  3WXM B;  3SAH A;  4DV7 K;  3CM6 A;  1Q18 A;  3UE5 A;  4FPB A;  1C6V A;  5AZJ A;  1U47 A;  2QM1 A;  2P9I A;  3WXI A;  5AQU A;  3HXM A;  3SNN A;  4IOX A;  4A57 A;  2FSN A;  2ETJ A;  2WON A;  3ZSV A;  3K5L A;  3HP9 A;  4FJX A;  1SL2 A;  4RW7 A;  4BRA A;  4C8O A;  4KV8 A;  2OPQ A;  1MWK A;  5AQY A;  3LL3 A;  3RRH A;  1VSI A;  4DV2 K;  2HVH A;  1RTI A;  2E8A A;  5M1Q A;  1FXX A;  3A2F A;  3PX6 A;  3RWU A;  1JL1 A;  4O0I A;  1TK5 A;  5H1S Q;  1JKH A;  3WXJ A;  1ASU A;  4YOX A;  4CFB A;  1XQS C;  3CYM A;  5EOY A;  3NGY A;  2NUB A;  3ZEU A;  4DTJ A;  1RT2 A;  3CXC M;  2X78 A;  4OPJ A;  3RMA A;  1KQS M;  3SI6 A;  2P9P B;  2ZE2 A;  1W7A A;  1VQL N;  2V7Z A;  1JLF A;  1QQO A;  1LAV A;  4BRM A;  1S3X A;  4O8U A;  4RCH A;  2QKB A;  3SBT A;  4JI6 K;  1EET A;  2ATQ A;  1KXP A;  1C0F A;  1SQK A;  3WEE B;  1IG9 A;  2DTU A;  3EE8 A;  3OYA A;  3ZSO A;  2VG7 A;  1R59 O;  4BE0 A;  3IS9 A;  1S9G A;  4BR2 A;  3J7A P;  4JD2 B;  1TL1 A;  4DTO A;  2IVO A;  1VQM N;  2Q0U A;  3LP1 A;  2YHW A;  5CR4 A;  1N5Y A;  1NJX A;  1DKG D;  4FWL A;  3THV A;  3O1W A;  1U48 A;  1YF5 L;  3GOI A;  1MWM A;  3ZT4 A;  3MEG A;  5CE3 A;  4CHN A;  4FLX A;  3TAB A;  1KVB A;  3C7N A;  4CF9 A;  3JYT A;  4CEQ A;  2Q1N A;  4JI0 K;  3O80 A;  2D0A A;  2HHV A;  2W42 A;  3H1Q A;  3HPH A;  2IOC A;  2RF2 A;  4WQ5 C;  3S41 A;  4FW2 A;  3CET A;  3ENO A;  4JRP A;  3CJC A;  3MEE A;  3K5M A;  1Y64 A;  4I2P A;  2PFU A;  4ILG B;  1Z6R A;  2VCP A;  4WYB A;  5J1E A;  1WOQ A;  3O5B A;  4OJR A;  1ZBU A;  5HRS A;  3F9K A;  4NXM K;  5EY4 A;  1RCH A;  2E2N A;  3SAF A;  3P5J A;  1HYS A;  3VF4 A;  2HF4 A;  4XH1 A;  3OJS A;  1VSE A;  1YXQ A;  3ZX3 A;  3DOL A;  3R3L A;  4KTZ A;  1TAU A;  5LL6 Z;  4JKA A;  1JL2 A;  1D4X A;  2O8F B;  3HST B;  4PA1 A;  3CCJ N;  3AVA A;  4E1N A;  3VF6 A;  3VQD A;  3AA3 A;  3O3F A;  4LD0 A;  3AAQ A;  1J5O A;  1HPZ A;  3DRR A;  2IVN A;  1RDC A;  4B1Y B;  5KRS A;  3G25 A;  3LDN A;  4DLG A;  1NGA A;  2EHG A;  3L6Q A;  4M3U A;  3CHW A;  1WAF A;  1DT9 A;  1EP4 A;  4I6M A;  3VQC A;  1HX1 A;  4RW6 A;  4K8Z A;  1XNQ K;  1I94 K;  1ZBF A;  3CM5 A;  2J4R A;  4F3O A;  3FZK A;  4JI8 K;  4F9O A;  1N36 K;  2FBT A;  4FJ9 A;  2BGG A;  1RBS A;  4F4K A;  1XMQ K;  4N56 A;  1BIZ A;  5HL7 L;  4EP4 A;  3WUH A;  3UKU A;  4DQR A;  2IAJ A;  5FPN A;  1BCO A;  5E84 A;  1IO2 A;  5HRN A;  1L3S A;  1W2B M;  3CCE N;  1QE1 A;  2YJF A;  3NDK A;  4K41 A;  3RR8 A;  4AQY K;  4ELV A;  3OYH A;  2ZJQ L;  2VG6 A;  2YNF A;  2HHU A;  4DHY A;  3KK7 A;  1MDU B;  3QO9 A;  3H46 O;  4DU4 A;  1VHX A;  4BRH A;  1ZBL A;  3QNO A;  1YTU A;  2Y1J A;  4FJJ A;  4CK1 A;  3KD5 E;  1YVU A;  2QXF A;  4FW1 A;  3AVH A;  4Z4F A;  1REV A;  1SL0 A;  3TU5 A;  4W5Q A;  1XNR K;  3SQ2 A;  3OYC A;  3TAE A;  1NMN A;  1RTH A;  4IG3 A;  4CJ4 A;  1D9D A;  5BPN A;  4HTU A;  5F1X A;  2HB5 A;  4W5T A;  3QNN A;  1RDU A;  3CJA A;  4FJ7 A;  5KTQ A;  5C25 A;  4B9L A;  4LF9 K;  3VTI A;  4BRN A;  4KHY A;  2ITM A;  2KTQ A;  5F2R A;  1O1W A;  4CZH A;  3TSU A;  4M3T A;  1H1V A;  3QFP A;  3ZCM A;  2O4I A;  3C6U A;  3AVL A;  3AVG A;  1GLL O;  3M5R A;  5IWA K;  4AM6 A;  5KQD A;  4Z4I A;  4IJA A;  5LJV A;  1NNE A;  2W41 A;  1OH5 A;  2PYJ A;  3EO3 A;  4OPH A;  1KSP A;  1ILY A;  1LWF A;  4JKH A;  4JHD A;  1BQN A;  1C0U A;  4FWO A;  3KWG A;  4CD3 A;  4F2R A;  5F0X A;  5SZT A;  3DOK A;  1YAG A;  3A5L C;  4IZ9 A;  2FXU A;  3NMU A;  4LH4 A;  3KK3 A;  4J2E A;  3P38 A;  4X66 K;  2O8C B;  3WNE A;  3KK1 A;  2D0B A;  1VQ4 N;  3KJV A;  4E0D A;  4WFN L;  2HMP A;  3CMA N;  4J2A A;  3DAW A;  4FLZ A;  5HRO A;  5AR0 A;  3VEO A;  3IFR A;  3F5T A;  3RRG A;  3HL8 A;  4DR5 K;  1N32 K;  2E6M A;  2KLA A;  3B6P A;  3JSM A;  4B1X B;  4JEP A;  5BRE A;  4FJH A;  1XC3 A;  3D6R A;  4ISE A;  1I39 A;  2ZF5 O;  5HRR A;  3V1R A;  4C1N K;  2BUP A;  4BE2 A;  2OA8 A;  4KRF A;  5CYM A;  3R8E A;  5FPM A;  2OZM A;  3KKS A;  4GKJ K;  2GUI A;  1G99 A;  4CES A;  1L3T A;  4GV9 A;  4ELT A;  3O9T A;  4IEI A;  1U4B A;  1NU0 A;  3VN5 A;  4BDP A;  3K59 A;  4PWD A;  4BRO A;  4NLC A;  2E5L K;  4M41 A;  3LZI A;  1WBB A;  1JLC A;  4O44 A;  4CZI A;  4CVN E;  4FCY A;  3M8R A;  4ILH A;  4KBO A;  2FLO A;  3DXK A;  2E6L A;  4FLU A;  2ZQB A;  4DFM A;  5E41 A;  4FK2 A;  1HLU A;  4Z0U A;  2YHX A;  3FFK B;  1BHL A;  4FM2 A;  4IDK A;  4A2B A;  2BE2 A;  2QWR A;  4B9Q A;  2RHK A;  2CGJ A;  2KFZ A;  2YX6 A;  5BRF A;  1VSL A;  3TAG A;  3OYF A;  1L3U A;  5FRM A;  1NOY A;  3FLC O;  2AA4 A;  3MN7 A;  1VSM A;  1WNS A;  3PLA A;  1X3M A;  2V52 B;  4WFA L;  4A5B A;  4PL8 A;  1HJO A;  1WSJ A;  2YKM A;  4I9Q A;  4CK3 A;  3CJ1 A;  1RT7 A;  3IG1 A;  2W6K A;  4DV5 K;  1RGI A;  3K2P A;  1ESV A;  3MXM A;  2NRX A;  3B6O A;  3MXI A;  2CH6 A;  2HNY A;  3MN6 A;  4IO8 A;  4CJE A;  3V81 A;  3VER A;  2F4V K;  2GEL A;  3ZSR A;  5SWM A;  1RT5 A;  1IKY A;  2E1Z A;  4BRP A;  4U67 L;  3IRX A;  3TAR A;  3AVJ A;  5AQK A;  4M3Y A;  4CCH A;  4N41 A;  4OKE A;  5JIC A;  4KB1 A;  1X9S A;  5AZI A;  3BGR A;  3HI0 A;  2DFE A;  4DR6 K;  1QSS A;  2HHX A;  2P9N B;  2UXC K;  4M45 A;  3LM9 A;  1BA1 A;  3C6T A;  3DM2 A;  3TAN A;  4QAG A;  4DU1 A;  4NB4 A;  1HNZ K;  2VWK A;  1HRH A;  4IXC A;  1KRP A;  2OAN A;  4IFE A;  4BRL A;  1LCU A;  4H4O A;  1L3V A;  4LFB K;  4E7I A;  1Z25 A;  3PO4 A;  5AQW A;  4FZY A;  3MEC A;  4YFU A;  1YVN A;  5BRD A;  3THX B;  4GVE A;  3D2E A;  4BRC A;  3NF7 A;  4CBU A;  3B8A X;  3MXJ A;  3O4Q A;  5BR8 K;  3O3G A;  3ULE A;  4IJN A;  4BR0 A;  3OYL A;  3U4L A;  2VWB A;  3SQ4 A;  1NOZ A;  4EHT A;  3TAM A;  4KHP K;  4LSL A;  1FKO A;  4DTS A;  2P9U B;  4AF1 A;  2HBM A;  2E88 A;  1MU2 A;  1S72 N;  2KZM A;  3A8Y A;  4X65 K;  3NF6 A;  4Z4H A;  3NE6 A;  3AV9 A;  1WBD A;  2GEM A;  3KD1 E;  2O8D B;  4DV1 K;  4PKI A;  1NK0 A;  3CJ7 A;  2Z1G A;  5JS1 A;  3NAE A;  4K0K K;  1G15 A;  4HCC A;  5FLX O;  1RDD A;  3O6W A;  4DF8 A;  1TYQ B;  5KGW A;  3UIQ A;  4CEZ A;  2WTU A;  4IEE A;  1P8Z A;  2E2O A;  5LJW A;  4FWQ A;  2OTJ N;  4TSX A;  4CHQ A;  5GAE P;  3JS6 A;  3OBW A;  1X9W A;  4N5S A;  4CD1 A;  5TKW A;  1HKG A;  2IIR A;  2YCH A;  1NGJ A;  5CY4 A;  1OH8 A;  4E7K A;  3TTD A;  4CFA A;  2CH5 A;  5HOO A;  3SUP A;  4ISF A;  3J7Z O;  4HUG A;  5GIN A;  1B9D A;  3QML A;  4AHC A;  4V19 S;  1C1B A;  1K8K B;  3RMD A;  3CQX A;  1HR0 K;  4LF6 K;  1NGI A;  1HUX A;  5AZJ B;  5CZ1 A;  3ITH A;  3U9Z A;  2P9I B;  2Q0R A;  1LW0 A;  1HJR A;  5C24 A;  4O4G A;  4ID1 A;  2W40 A;  3CPE A;  5JLF A;  3ZT3 A;  3NBP A;  2DFF A;  4H8K A;  3EL2 A;  3K57 A;  4GNI A;  5D3G A;  1D5A A;  1J5E K;  4B3R K;  3SAG A;  1ZXO A;  3AAR A;  1EWQ A;  4FLT A;  2ASP A;  3VEV A;  4BC5 A;  3BF1 A;  3AVC A;  2G8U A;  1S1T A;  4KHS A;  3WXL A;  4GV6 A;  4CZE A;  3EN9 A;  3L3U A;  4Z94 A;  4CJK A;  1QSL A;  1JXE A;  4HTL A;  4JKG A;  2ZD1 A;  4DTX A;  4DR2 K;  3TWH A;  1JCG A;  3QIN A;  1CXQ A;  2QTD A;  5EU7 A;  3NF9 A;  3VQE A;  3T7Z A;  2RE2 A;  4E1J A;  4OLA A;  4B1U B;  2QWL A;  3E9P A;  4JI1 K;  4CJ3 A;  3WNH A;  3CCS N;  5C42 A;  3EZ5 A;  1BIU A;  3FZH A;  4CJL A;  1SAZ A;  1D8Y A;  5J2P A;  4QCL A;  4BRD A;  3H08 A;  5LY3 A;  2F8T A;  2IGI A;  1LWE A;  3EEQ A;  3VTH A;  3ENB A;  4B1V A;  1SZ2 A;  3ZX2 A;  3QB0 A;  2QI2 A;  3CPW M;  1BGX T;  4NO7 A;  5I3U A;  3Q7C A;  3V4I A;  3FR0 A;  5AQX A;  3S3N A;  3OYM A;  4DLE A;  4OO1 J;  2P9S B;  4FOI A;  3MCP A;  3DLE A;  3I0R A;  1ATS A;  2KW4 A;  3QFU A;  3OYE A;  4CGF A;  5HRP A;  3ID8 A;  1K9M O;  5I9E B;  1KVA A;  2XHB A;  3QBW A;  4H0X B;  4WQ5 A;  4CJS A;  4DMN A;  4H4M A;  1IV0 A;  3AA4 A;  5FRO A;  3D2F A;  3R9P A;  3QER A;  5AQT A;  4PY5 A;  4MLH A;  1N33 K;  2F9W A;  4G9Z A;  1K8A O;  3J8A A;  3JAM O;  4HCB A;  3KLF A;  2VYP A;  4XIU A;  4CJR A;  4JK9 A;  2QWQ A;  1FK9 A;  3PIP L;  2UYT A;  3LDQ A;  1UA0 A;  4JI3 K;  4B8C A;  3QEP A;  3LPU A;  4CJV A;  4RWT A;  2G8K A;  1CZ9 A;  4I2Q A;  3CC7 N;  1B92 A;  3AVB A;  2D0P A;  1B9F A;  3O9U A;  4YY3 K;  1XI1 A;  4PQU A;  1P90 A;  5DK5 A;  1BU6 O;  3LP0 A;  4A59 A;  2AP1 A;  4OVL A;  1VQN N;  4LY7 A;  3ZYY X;  3U3G A;  2HOE A;  3BF3 A;  1Q81 O;  3QDK A;  4O5F A;  2F9T A;  4CZL A;  1VK0 A;  4ZTJ A;  3HM8 A;  4N47 A;  4CI6 A;  1QVF M;  4BG9 A;  4RG8 A;  4H0O A;  3QIO A;  1GOA A;  3LDS A;  5LMU K;  4FWS A;  2UXB K;  2XO7 A;  5ADX H;  3RSE B;  1D9F A;  4CGG A;  4DV0 K;  4CF8 A;  1JLQ A;  3SLC A;  3GE1 A;  5AQF A;  2A1R A;  1HNW K;  4DV6 K;  1X9J A;  1WN7 A;  3VQ8 A;  4OKJ A;  5EVZ A;  1QHT A;  4M7Y A;  4H5N A;  3LAL A;  4KHQ A;  1E4F T;  1KC8 O;  3AO4 A;  1ASW A;  3V1Q A;  3MN5 A;  4IO9 L;  4M3R A;  3CC2 N;  2P9L A;  1RTD A;  4GW6 A;  3ZSX A;  4BVO A;  2CGL A;  1WSE A;  4IFV A;  1KCF A;  2JWL A;  2X6S A;  3WT0 A;  2ZWH A;  5BN9 A;  3L2R A;  3DJC A;  1JJ2 M;  2A3Z A;  4JD2 A;  3PIO L;  1LWC A;  1SL1 A;  4KHN A;  3PY8 A;  1S6Q A;  5TKY A;  4IOC L;  1VAZ A;  4DKW A;  3ATU A;  4JS5 A;  2D1K A;  5GIP A;  3KZB A;  4BQZ A;  1YJ9 N;  5AQZ A;  3V9W A;  4QS8 A;  3GDQ A;  3F2K A;  4XH4 A;  4FK0 A;  4B8A B;  4GKK K;  2HVI A;  1QS4 A;  4YHH K;  1OVQ A;  1JLB A;  3ID6 A;  3KLE A;  5GAD P;  4K8X A;  5CZ2 A;  3VOV A;  4ELU A;  4JK8 A;  5J2M A;  4BR7 A;  1U49 A;  3VA3 A;  1HYV A;  3K5N A;  3ZT0 A;  2DPN A;  3OYK A;  3HYF A;  3V9X A;  5ADX A;  3BZK A;  4BR9 A;  4BG8 A;  2FF3 B;  4DWI A;  1IKW A;  2D0O A;  4CJT A;  4KAZ A;  2I5J A;  2HW3 A;  3E1Y A;  3SCX A;  2NRR A;  1N8R O;  3K9J A;  4KH5 A;  4B1Z A;  1JLA A;  4Y1D A;  3OHR A;  4K43 A;  1RBV A;  4FZZ A;  1J54 A;  3QEW A;  4BRI A;  1VSD A;  1BI4 B;  3V9S A;  2P9K A;  4DFJ A;  2YNI A;  4PKG A;  4C23 A;  1WSH A;  1U45 A;  1NJW A;  4FWR A;  3O4W A;  1KTQ A;  3OVN A;  4M63 C;  4DCH A;  3L2U A;  4CED A;  2O8F A;  4E19 A;  3E66 A;  4B9M A;  5K14 A;  3SYZ A;  4KKO A;  5FDL A;  4LSN A;  2Q3S A;  1U6Z A;  3AO2 A;  3CCU N;  3KTQ A;  2E4L A;  2KKZ A;  4FVU A;  4MDB A;  3AVN A;  2AJQ A;  3ASM A;  4E7H A;  1NKE A;  4KI6 A;  3CCV N;  2QWP A;  3NH2 A;  2OPR A;  3FZM A;  3IUC A;  1C0M A;  1IJJ A;  1BDG A;  1RIL A;  3C65 A;  5AQS A;  5C15 A;  4AM7 A;  2E2P A;  2Q97 A;  4IOA L;  4FL9 A;  4CBW A;  1YJW N;  3SPZ A;  1NLV A;  3ENH A;  4CGJ A;  1RBR A;  3DXM B;  4Q5V A;  3OBY A;  3LAN A;  4YOV A;  3W3D A;  5AQN A;  1S6P A;  3VES A;  3E9O A;  4KRE A;  3HOT A;  3J80 O;  3HP6 A;  4B3M K;  2QWO A;  3AGR A;  4NCB A;  3TAF A;  4CHP A;  1KVC A;  3SK3 A;  5E26 A;  3CME N;  4N76 A;  1GLC G;  2GWJ A;  4LFA K;  4C8M A;  1S1W A;  3AO1 A;  3W0L A;  5DMR A;  4KFB A;  4WFB L;  3KWI A;  3M3Z A;  1GLE G;  4FVM A;  3OW2 M;  1ZBI A;  4HHT A;  1XWL A;  3BZC A;  1IKX A;  3EKU A;  5DM7 L;  4DSF A;  5AQV A;  4GV3 A;  5KPT A;  1VQP N;  2IS3 A;  2VG5 A;  4RTF D;  3VGK A;  4LC9 B;  3TTC A;  3VF2 A;  4BWM A;  3U9D A;  1RDA A;  3H1V X;  3TSP A;  1T6D A;  4BWJ A;  1K73 O;  1S5J A;  1Q7Y O;  3UB5 A;  4W5R A;  1RBU A;  1BO5 O;  1HNI A;  2GX9 A;  4BRF A;  4DSL A;  3KHY A;  4ID5 A;  3KVG A;  1CLQ A;  3P39 A;  4CJQ A;  2VGM A;  4NXN K;  3HRG A;  3CC4 N;  1YIJ N;  5GAH P;  3AO3 A;  3A0I X;  2QWM A;  5EX5 A;  3QES A;  1RT6 A;  2YKN A;  5DM6 L;  3IMX A;  4DR4 K;  3HT3 A;  3D45 A;  5C10 A;  4BRK A;  5EXW A;  4J2D A;  4H0P A;  3I8D A;  5AJ3 K;  1VQ7 N;  3FFI A;  4UQG A;  3HOS A;  3KLG A;  5BR9 A;  3DRP A;  3OYN A;  3OJU A;  3M8S A;  3S9H A;  5ELZ A;  1Q8I A;  4JI5 K;  1E4G T;  4RW4 A;  2O8E B;  3SZ2 A;  5AZI B;  1NJZ A;  3RR7 A;  3PO5 A;  4CK2 A;  1U2V B;  5AQH A;  3O8M A;  4AHR A;  3L2Q A;  2ZJP L;  2HHT A;  3C94 A;  4B9T A;  3ZT2 A;  3VQ4 A;  2NRV A;  4C8K A;  1RBT A;  4DR7 K;  4FJ5 A;  2QXL A;  3P83 D;  2NRT A;  4JYA K;  4IBN A;  4I7F A;  4ZTF A;  3CJB A;  4O55 A;  4ILJ A;  4BDZ A;  1HKB A;  3L4I A;  3SMP A;  4CBX A;  3ZLJ A;  3PV8 A;  3ULD A;  3PX0 A;  3KK2 A;  1S1X A;  3ZSY A;  1NKB A;  1NMD A;  4CJ7 A;  3D2E B;  4AHS A;  4YOR A;  3C6H A;  3WQU A;  1NGE A;  2VGN A;  3DWL A;  4DSK A;  1ATN A;  4CF1 A;  1GLD G;  1GOC A;  1HNV A;  2XY5 A;  4BC2 A;  3F9M A;  1KD1 O;  4PUO A;  2GBZ A;  4DQ8 A;  3G10 A;  3FZF A;  3K0S A;  2QEX N;  2X6N A;  4WCE L;  4H0Y B;  3VQA A;  4AHU A;  4OLB A;  1QQN A;  2YNH A;  4WE1 A;  2RN2 A;  2A42 A;  3THY B;  2VWJ A;  2KHO A;  2ZGZ A;  4QS7 A;  2JWK A;  4CIG A;  1NWK A;  4Y1C A;  1IBK K;  2NNW A;  4QS9 A;  3CCR N;  5J2N A;  3UKR B;  2OPS A;  1KLN A;  3T1H K;  1YHQ N;  3QEX A;  3HTV A;  1QSY A;  3P31 A;  4FLW A;  1GLJ O;  5M1K A;  4CEF A;  4F3T A;  2IVP A;  4DTM A;  4FYD A;  4BAC A;  5T7B A;  2IDO A;  4MQ3 A;  4J2B A;  4NYF A;  3MDQ A;  2YHA A;  4AHT A;  1UAX A;  1TK8 A;  2DY4 A;  3LWL A;  3T1Y K;  1GLA G;  4XEI A;  3OA9 A;  2HBL A;  4FO0 A;  5M1O A;  3HM9 A;  4YNQ A;  2A6A A;  2E20 A;  1C0G A;  2QKK A;  2HMI A;  3A5M C;  3V1O A;  3O9Q A;  4DQP A;  2FBY A;  2XY8 A;  4IWV A;  1TVR A;  4A61 A;  2P9N A;  1XC9 A;  3THW B;  3KKR A;  3VQB A;  4DSJ A;  3ZX0 A;  2BDP A;  1S22 A;  3A5O C;  3ISN C;  3NGZ A;  4BC4 A;  3AA2 A;  1VQ6 N;  2D0C A;  3DLG A;  1CXU A;  2O4G A;  3CF5 L;  3U3Y A;  1TK0 A;  1VQ9 N;  4DS5 A;  3N4Q A;  4DQI A;  1UA1 A;  1MA9 B;  3ZSW A;  1KAY A;  3R1X A;  4CER A;  2QK9 A;  3O3H A;  3S3O A;  1SV5 A;  4BY9 C;  4G1Q A;  3CFO A;  2PZS A;  3I0S A;  4C1N I;  3I55 N;  3ZET B;  4FJ8 A;  3THX A;  5A2Q O;  2UUB K;  5J2Q A;  3HO1 A;  5KI6 A;  3RTV A;  3EE9 A;  2PY5 A;  4M7X A;  4HWI A;  3JXU A;  3O08 A;  3GL1 A;  4JI2 K;  3G71 N;  1NK8 A;  1FW6 A;  2YJE A;  3VQ5 A;  3CIP A;  4JKB A;  3K9K A;  3SMS A;  3T1A A;  2P9U A;  5M1N A;  2A41 A;  3QLH A;  1YT3 A;  2V7Y A;  3DRS A;  3ALY A;  3H45 C;  1Y97 A;  2ASM A;  1T6C A;  4BRG A;  3VGL A;  4R79 A;  1JCF A;  1NK7 A;  4FSV A;  3Q7B A;  3AVM A;  2VQF K;  4O8K A;  3CJ9 A;  4BRE A;  2O8D A;  1LOT B;  3HBT A;  3QIP A;  4CFD A;  5CHI A;  1OH7 A;  1BA0 A;  2R7Y A;  4B3S K;  5JVG L;  3A5N C;  2HND A;  3M1F A;  2FBV A;  3VEZ A;  4H5T A;  4YOT A;  3TTF A;  4CIE A;  2HHS A;  1EXQ A;  1TYQ A;  2XY7 A;  4CGD A;  1NGH A;  1HNX K;  3CCL N;  3FZL A;  3O9S A;  4K42 A;  1XHX A;  1TKX A;  1U04 A;  4A2A A;  4E7J A;  1NG9 A;  3DLH A;  3R6M A;  1X3N A;  3I56 N;  4CJ5 A;  3ZEU B;  2HNZ A;  1VQK N;  3AAP A;  3AVF A;  4FWP A;  4H0T B;  1V4S A;  4CHZ A;  4KB0 A;  2NRZ A;  2Q2R A;  4B08 A;  4OPA A;  1SKR A;  3EY1 A;  4E7L A;  4EIA A;  1TKZ A;  4EFH A;  2O8B A;  2KQ2 A;  1LW2 A;  1EQY A;  1T44 A;  5AQR A;  1DEJ A;  4YOW A;  1K8K A;  3J7Y P;  1IG8 A;  1RT1 A;  3CQ8 A;  1W97 L;  5C2F A;  5LMN K;  2HF3 A;  1BQM A;  5KPR A;  3D7E O;  2YHY A;  3TPQ A;  1QQC A;  3AVI A;  1RTJ A;  1V4T A;  3PX4 A;  5MLC Q;  2HHW A;  1NK9 A;  2I7P A;  5JS2 A;  1T05 A;  3VQP A;  4Y0W A;  3AY9 A;  4KTQ A;  1LV5 A;  5AFU H;  4CJW A;  1DLO A;  1EWR A;  2BTF A;  1IBM K;  1C0T A;  1X9M A;  2ZGY A;  2GWK A;  4DB3 A;  5C0Y A;  3KLH A;  2B5J A;  3AA5 X;  3EZW A;  1JCE A;  3C7N B;  1TUY A;  3O9R A;  4DV4 K;  1YUW A;  2KZZ A;  1FJG K;  1X1P A;  4WQ4 A;  2QW9 A;  3MWP A;  4F2S A;  3T69 A;  5BRH A;  4IFY A;  1KAX A;  4CJF A;  1Z05 A;  4CHO A;  2D4W A;  3ATV A;  5KRT A;  4JLH A;  4R5P A;  1RFQ A;  3HVR A;  4H5V A;  4BE1 A;  5CYQ A;  1WSI A;  2WOM A;  4MLE A;  4NCG A;  3CI5 A;  5BPL A;  3VPZ A;  3QET A;  4JN4 A;  2G8I A;  1QVG M;  4W5N A;  1NGB A;  3BY5 A;  2P9L B;  4L3Q A;  1N6Q A;  4HUF A;  1W0H A;  3VQ7 A;  1OH6 A;  3VET A;  3MCA B;  1OKJ A;  4IG0 A;  4A62 A;  2JLE A;  2P51 A;  2P9S A;  1NGC A;  1HMV A;  4DSE A;  4X62 K;  3WXK A;  4EHU A;  4EZ6 A;  1A5W A;  4M3Z A;  2G8F A;  3BP8 A;  2Z1I A;  2ASO A;  2DFH A;  4CEA A;  5GIO A;  1RT4 A;  2H3G X;  3GG4 A;  4FK4 A;  4NYN A;  4NLB A;  3KLI A;  4W5O A;  4JRQ A;  4DUZ K;  3SV3 A;  4DFK A;  3LAK A;  2F8S A;  4ISG A;  2HHH K;  3L3V A;  5AFU A;  1IH7 A;  2P9P A;  1BCM A;  4FPA A;  2FF6 A;  4I6M B;  3TAQ A;  3TI0 A;  2OPP A;  2UUC K;  3J81 O;  4DQQ A;  3DLB A;  3VQQ A;  3D0P A;  4WQ4 C;  3DMJ A;  4XH5 A;  4JAX A;  3K58 A;  3VQ9 A;  4UY8 O;  1VSF A;  3OY9 A;  3C95 A;  1CZB A;  3WEE A;  3UKU B;  4FJM A;  3OS1 A;  1SUQ A;  3DLR A;  4ZHR A;  4CJP A;  2Z1H A;  2GV9 A;  2WFB A;  1QQM A;  3VEX A;  3DLL L;  4IKF A;  1WSF A;  3L2V A;  4CJU A;  4I9L A;  1XMO K;  4HVJ A;  2QWN A;  3G0Z A;  1JXB A;  1NGD A;  1TV6 A;  4A5A A;  4CZF A;  4DTN A;  4FZX C;  2P9K B;  4BR5 A;  3OTO K;  1JLE A;  3WQT A;  5KGX A;  3NCI A;  4JNE A;  2YNG A;  5BN8 A;  3TAP A;  4KHU A;  3C0B A;  2A5X A;  4KH4 A; 
#chains in the Genus database with same CATH homology
 1HNI A;  1NOZ A;  3HP9 A;  3TAM A;  2HHQ A;  4DSL A;  4C8N A;  4QOZ B;  3HPG A;  4ID5 A;  4FJX A;  1CLQ A;  4M3W A;  4CJQ A;  1SL2 A;  4LSL A;  4RW7 A;  1FKO A;  4DTS A;  4FJL A;  4C8O A;  4KV8 A;  2OPQ A;  3AO3 A;  3QES A;  1RT6 A;  2YKN A;  3RRH A;  1VSI A;  2HVH A;  2X74 A;  1MU2 A;  3HT3 A;  1RTI A;  3D45 A;  2KZM A;  1FXX A;  3A2F A;  3PX6 A;  3RWU A;  1JL1 A;  3NF6 A;  4Z4H A;  3NE6 A;  3AV9 A;  3KD1 E;  3I8D A;  4J2D A;  4O0I A;  3RMC A;  1TK5 A;  1JKH A;  1NK0 A;  3FFI A;  4Z4G A;  4UQG A;  3LPT A;  1ASU A;  2Z1G A;  3M8Q A;  3ZSQ A;  3KLG A;  5JS1 A;  3NAE A;  3DRP A;  2D5R A;  3OYN A;  3EYZ A;  4EZ9 A;  4CFB A;  3OJU A;  3CYM A;  3NGY A;  2NUB A;  3M8S A;  4ICL A;  1G15 A;  3T3F A;  4HCC A;  4DTJ A;  1RT2 A;  3S9H A;  4DF8 A;  1Q8I A;  1RDD A;  3L8B A;  4FJN A;  5KGW A;  2X78 A;  4OPJ A;  4RW4 A;  3RMA A;  3V9Z A;  3UIQ A;  3SZ2 A;  4CEZ A;  3SI6 A;  4DG1 A;  2ZE2 A;  1ZBH A;  1NJZ A;  3RR7 A;  1JLF A;  4DU3 A;  3PO5 A;  4FJK A;  4CK2 A;  1LAV A;  1J9A A;  4TSX A;  3VQ6 A;  4CHQ A;  4AHR A;  1X9W A;  4N5S A;  1F21 A;  3L2Q A;  4CFC A;  1HQE A;  4FM1 A;  4FJG A;  4KHW A;  2QKB A;  2HHT A;  3C94 A;  4CEB A;  4B9T A;  2JGU A;  5CY4 A;  3VQ4 A;  1EET A;  1RBT A;  2ATQ A;  3ZT2 A;  4E7K A;  4C8K A;  4FJ5 A;  4CFA A;  3P83 D;  1IG9 A;  3SUO A;  2DTU A;  4IBN A;  3OYA A;  4I7F A;  3SUP A;  4ZTF A;  1T7P A;  3NF8 A;  4O55 A;  1VSH A;  4HUG A;  3ZSO A;  1T8E A;  4BDZ A;  2VG7 A;  3DI6 A;  1B9D A;  4BE0 A;  4B9N A;  3IS9 A;  3MED A;  1S9G A;  4KO0 A;  4AHC A;  3U6F A;  1C1B A;  1TL1 A;  4DTO A;  3ULD A;  3PV8 A;  4CF2 A;  3PX0 A;  3RMD A;  3KK2 A;  1WAJ A;  4GMJ B;  1S1X A;  3ZSY A;  4B9V A;  3LP1 A;  1NKB A;  1EKE A;  5CZ1 A;  3NH0 A;  3ITH A;  5HP1 A;  4EP5 A;  3NGI A;  4AHS A;  1LW0 A;  1N5Y A;  1HJR A;  5C24 A;  4O4G A;  4ID1 A;  1NJX A;  2P5G A;  1LAW A;  4DQS A;  4DSK A;  4CF1 A;  3THV A;  1GOC A;  4M42 A;  1HNV A;  3SUQ A;  3ZSZ A;  1U48 A;  3ZT3 A;  3NBP A;  2DFF A;  2XY5 A;  4H8K A;  3S3M A;  3ZT4 A;  3MEG A;  3K57 A;  4CHN A;  4L8R B;  4FLX A;  3TAB A;  4PUO A;  1KVB A;  1D5A A;  4CF9 A;  2GBZ A;  5D3G A;  3SV4 A;  3JYT A;  4CEQ A;  3VA0 A;  3G10 A;  4FLT A;  2X6N A;  2B4J A;  2D0A A;  2HHV A;  3VQA A;  4AHU A;  2W42 A;  4OLB A;  2IOC A;  2RF2 A;  3E01 A;  3HPH A;  2YNH A;  3AVC A;  2G8U A;  4WE1 A;  2RN2 A;  4FW2 A;  1S1T A;  4KHS A;  4DS4 A;  4JRP A;  4OGE A;  4AIL C;  2VWJ A;  1K6Y A;  3MEE A;  3K5M A;  3L3U A;  4CJK A;  1BI4 A;  4I2P A;  4DFP A;  2FBX A;  3LZJ A;  1QSL A;  1JXE A;  2ZD1 A;  4CIG A;  5J1E A;  4DTX A;  1NJY A;  4Y1C A;  4M3X A;  3TWH A;  3QIN A;  1CXQ A;  3M8P A;  4OJR A;  5EU7 A;  3NF9 A;  3VQE A;  1ZBU A;  5HRS A;  5J2N A;  3F9K A;  1KLN A;  2OPS A;  4FLV A;  1RCH A;  4OLA A;  4FLY A;  3AO5 A;  3P5J A;  3QEX A;  1HYS A;  4CJ3 A;  1I3A A;  4OGC A;  3WNH A;  1QSY A;  1A5V A;  4FM0 A;  1UOC A;  5C42 A;  3EZ5 A;  1SKW A;  1BIU A;  3OJS A;  4FLW A;  1VSE A;  3DOL A;  3OS2 A;  4KTZ A;  4CJL A;  1TAU A;  4CEF A;  4F3T A;  4FYD A;  1JL2 A;  4DTM A;  1D8Y A;  5J2P A;  4BAC A;  4QCL A;  5T7B A;  2IDO A;  4MQ3 A;  3HST B;  4PA1 A;  3F73 A;  2F96 A;  3H08 A;  4NYF A;  4J2B A;  4AHT A;  2YHA A;  2F8T A;  2IGI A;  1LWE A;  3AVA A;  4E1N A;  1UAX A;  3VQD A;  1TK8 A;  2DY4 A;  3LWL A;  3AA3 A;  3O3F A;  1TKD A;  4LD0 A;  4DF4 A;  1T03 A;  3MAQ A;  1J5O A;  1BGX T;  1HYZ A;  5I3U A;  1HPZ A;  3DRR A;  3V4I A;  1RDC A;  3HM9 A;  3S3N A;  3OYM A;  4DLE A;  4YNQ A;  5KRS A;  2QKK A;  4CEO A;  2HMI A;  1S1V A;  3DLE A;  3I0R A;  4KTW A;  3V1O A;  3L2W A;  4DLG A;  2OYQ A;  2KW4 A;  2EHG A;  3OYE A;  4CGF A;  4DQP A;  2FBY A;  5HRP A;  4M3U A;  1WLJ A;  1KVA A;  1WAF A;  1EP4 A;  2XY8 A;  2XHB A;  1TVR A;  3VQC A;  4CJS A;  4DMN A;  4H4M A;  4RW6 A;  1XC9 A;  3AA4 A;  5FRO A;  3KKR A;  4K8Z A;  1ZBF A;  3VQB A;  3QER A;  1NK4 A;  3CM5 A;  4F3O A;  4PY5 A;  4DSJ A;  2BDP A;  3ISN C;  3NGZ A;  4E3S A;  2FBT A;  1J53 A;  4FJ9 A;  2BGG A;  1RBS A;  3AA2 A;  4F4K A;  4N56 A;  1BIZ A;  2D0C A;  2ITG A;  3DLG A;  3KLF A;  1CXU A;  2O4G A;  4EP4 A;  4CJR A;  4XIU A;  3U3Y A;  1TK0 A;  4DQR A;  2IAJ A;  1BCO A;  1FK9 A;  4DS5 A;  4DQI A;  1UA1 A;  1EX4 A;  3ZSW A;  1IO2 A;  4CER A;  5HRN A;  1UA0 A;  2XY6 A;  2QK9 A;  3SQ1 A;  1L3S A;  3HVT A;  1BL3 A;  4B8C A;  3QEP A;  1RNH A;  3LPU A;  4CJV A;  3O3H A;  3SUN A;  1SV5 A;  3S3O A;  1QE1 A;  2G8K A;  3NDK A;  1CZ9 A;  4G1Q A;  4I2Q A;  1B92 A;  3CFO A;  3RR8 A;  2PZS A;  3AVB A;  1L5U A;  1NK6 A;  3I0S A;  2G8W A;  4ELV A;  3OYH A;  2VG6 A;  2YNF A;  2HHU A;  4FJ8 A;  1B9F A;  4DU4 A;  3QO9 A;  1XI1 A;  4PQU A;  5J2Q A;  3HO1 A;  5DK5 A;  4Q0B A;  5KI6 A;  3RTV A;  3LP0 A;  3DYA A;  1ZBL A;  1VRU A;  3QNO A;  2PY5 A;  4OVL A;  1YTU A;  4C8L A;  2Y1J A;  4FXD A;  1NK8 A;  4FJJ A;  2B6A A;  2YV0 X;  4LY7 A;  4CK1 A;  3HK2 A;  3KD5 E;  3VQ5 A;  1VSK A;  1YVU A;  2QXF A;  4FW1 A;  3AVH A;  3U3G A;  1REV A;  4Z4F A;  1SL0 A;  4HCB A;  1ZYQ A;  4W5Q A;  4AH9 A;  1VK0 A;  4ZTJ A;  3OYI A;  4N47 A;  3SQ2 A;  5HLF A;  4DSI A;  3T1A A;  3OYC A;  2LSN A;  1XHZ A;  3AVK A;  2RPI A;  4RG8 A;  3QLH A;  1YT3 A;  3TAE A;  1RTH A;  3DRS A;  3QIO A;  3SPY A;  3ALY A;  4IG3 A;  4CJ4 A;  4JS4 A;  4NCA A;  4DTR A;  1Y97 A;  1GOA A;  1D9D A;  3LDS A;  4HTU A;  2HB5 A;  4F8R A;  1NK7 A;  4W5T A;  2XO7 A;  3AVM A;  3K5L A;  3QNN A;  4CHY A;  4CGG A;  1D9F A;  5FRN A;  4CF8 A;  1NKC A;  1JLQ A;  1C1C A;  4FJ7 A;  3QIP A;  4CFD A;  5KTQ A;  5C25 A;  4FJI A;  4B9L A;  2A1R A;  4KHY A;  2R7Y A;  3DLK A;  3ZT1 A;  4CEE A;  3QEV A;  2KTQ A;  2P5O A;  2HND A;  1O1W A;  2FBV A;  4M3T A;  1WN7 A;  3ZCM A;  2O4I A;  3C6U A;  3TR8 A;  3AVL A;  4CIE A;  3AVG A;  3NFA A;  2HHS A;  1EXQ A;  3VQ8 A;  2XY7 A;  4CF0 A;  4CGD A;  4OKJ A;  2RKI A;  1QHT A;  4LH5 A;  3CFP A;  4RW9 A;  4Z4I A;  1ASV A;  3LAL A;  4CEC A;  1UWB A;  4MFB A;  1XHX A;  3NHG A;  4KHQ A;  1TKX A;  1U04 A;  3AO4 A;  4E7J A;  3DLH A;  1ASW A;  3V1Q A;  2PYJ A;  4GVM A;  1KSP A;  4CJ5 A;  1LWF A;  1SKS A;  1BQN A;  2HNZ A;  4M3R A;  1TL3 A;  3AVF A;  4B9S A;  2BAN A;  1RTD A;  1C0U A;  4CGH A;  4GW6 A;  4CHZ A;  3ZSX A;  4KB0 A;  4O5B A;  1DTQ A;  2OZS A;  1WSE A;  2EX3 A;  4B08 A;  1SKR A;  4F2R A;  4IFV A;  5SZT A;  3O4N A;  3DOK A;  4CIF A;  3EY1 A;  4E7L A;  1KCF A;  3HPO A;  3SQ0 A;  3BDP A;  1TKZ A;  2X6S A;  3L2R A;  2KQ2 A;  1YTA A;  4LH4 A;  1LW2 A;  3KK3 A;  3OYG A;  4J2E A;  3WNE A;  3KK1 A;  4E89 A;  2D0B A;  4E0D A;  3KJV A;  4J2A A;  4FLZ A;  5HRO A;  1LWC A;  1WSG A;  1RT1 A;  3CQ8 A;  1SL1 A;  1RT3 A;  4KHN A;  3PY8 A;  1S6Q A;  1IKV A;  1BQM A;  3RRG A;  4DTU A;  1TGO A;  1QQC A;  4JS5 A;  3AVI A;  3HL8 A;  1RTJ A;  1DTT A;  2E6M A;  3PX4 A;  3V9W A;  3B6P A;  3JSM A;  5HBM A;  4FJH A;  2HHW A;  1RDB A;  1VRT A;  1NK9 A;  5JS2 A;  1T05 A;  1I39 A;  3VQP A;  4FK0 A;  4B8A B;  5HRR A;  3V1R A;  4BE2 A;  1QS4 A;  2HVI A;  1ITG A;  1JLB A;  3KLE A;  4KTQ A;  3LAM A;  1LV5 A;  2OA8 A;  5CZ2 A;  4CJW A;  1QTM A;  4K8X A;  4KRF A;  1W9H A;  4ELU A;  1DLO A;  5J2M A;  1FKP A;  2G8V A;  1U49 A;  5CYM A;  3VA3 A;  1HYV A;  2XRI A;  2OZM A;  1C0T A;  4E1M A;  1X9M A;  3KKS A;  3K5N A;  1KLM A;  2GUI A;  3ZT0 A;  4CES A;  3WNF A;  3HYF A;  3OYK A;  3V9X A;  1L3T A;  4ELT A;  1Z26 A;  3KLH A;  1U4B A;  2B5J A;  2G8H A;  3VN5 A;  3AA5 X;  4BDP A;  3K59 A;  4PWD A;  4M41 A;  3LZI A;  1IKW A;  1Q9Y A;  4DWI A;  4KPY A;  4CJT A;  2KZZ A;  4KAZ A;  1JLC A;  4O44 A;  4Z4C A;  3CG7 A;  2I5J A;  4FCY A;  3WNG A;  3SCX A;  1X1P A;  2HW3 A;  3M8R A;  4F2S A;  2E6L A;  1JLA A;  4IFY A;  4Y1D A;  4CJF A;  4FLU A;  4CHO A;  1RBV A;  2ZQB A;  1J54 A;  1JLG A;  2YHB A;  3P1G A;  5E41 A;  4DFM A;  1VSD A;  3QEW A;  4FK2 A;  3PUF A;  4Z0U A;  5KRT A;  1TKT A;  1BHL A;  3K5O A;  4JLH A;  4IDK A;  4R5P A;  4FM2 A;  1R0A A;  2BE2 A;  3HVR A;  1BI4 B;  3V9S A;  1KFS A;  4CGI A;  1A5X A;  4BE1 A;  4DFJ A;  2YNI A;  5CYQ A;  1WSH A;  1U45 A;  1NJW A;  3IAY A;  2KFZ A;  4HUE A;  1L3U A;  1VSL A;  1KTQ A;  1WSI A;  3OVN A;  2WOM A;  3OYF A;  4NCG A;  3TAG A;  5FRM A;  1NOY A;  3L2U A;  4CED A;  3QET A;  1S9E A;  4E19 A;  4BDY A;  4B9M A;  1VSM A;  2G8I A;  1WNS A;  5K14 A;  3SYZ A;  4KKO A;  5FDL A;  4W5N A;  4LSN A;  2Q3S A;  1GOB A;  3AO2 A;  1S1U A;  3KTQ A;  2E4L A;  1N6Q A;  1WSJ A;  1BIS A;  3AVN A;  2YKM A;  1W0H A;  4O0J A;  3VQ7 A;  4CK3 A;  3ASM A;  4HUF A;  4I9Q A;  2AJQ A;  3V9U A;  3V6D A;  1RT7 A;  2Z1J A;  4E7H A;  4IG0 A;  4OPK A;  3IG1 A;  1NKE A;  2JLE A;  2P51 A;  1NK5 A;  4KI6 A;  3NH2 A;  3SJJ A;  1HMV A;  2OPR A;  3K2P A;  3OYJ A;  2FC0 A;  4DSE A;  3MXM A;  1C0M A;  3B6O A;  3MXI A;  4EZ6 A;  1RIL A;  2HNY A;  4CJE A;  1A5W A;  3V81 A;  2PYL A;  4M3Z A;  2Y1I A;  2IC3 A;  3RMB A;  2G8F A;  1VSJ A;  2Z1I A;  3ZSR A;  2DFH A;  4CEA A;  3SPZ A;  5SWM A;  4AHV A;  1RT5 A;  1RT4 A;  1TAQ A;  1IKY A;  4RW8 A;  1RBR A;  4CGJ A;  3OYB A;  4Q5V A;  3LWM A;  4FK4 A;  4NYN A;  4FZZ A;  3LAN A;  3HJF A;  3IRX A;  3KLI A;  4W5O A;  3AVJ A;  4JRQ A;  3SV3 A;  4DFK A;  3LAK A;  3TAR A;  1S6P A;  4M3Y A;  2F8S A;  4CE9 A;  3L3V A;  4KRE A;  3LP2 A;  4CCH A;  4N41 A;  1IH7 A;  4OKK A;  4OKE A;  3HP6 A;  1BCM A;  1KFD A;  4KB1 A;  3QEI A;  3TAQ A;  3TI0 A;  1X9S A;  3BGR A;  2DFE A;  2OPP A;  1QSS A;  3TAF A;  4NCB A;  2HHX A;  4M45 A;  4CHP A;  1KVC A;  4DQQ A;  3OS0 A;  4B9U A;  3LP3 A;  3DLB A;  4KI4 A;  3CFR A;  3VQQ A;  4N76 A;  2KFN A;  3D0P A;  2P1J A;  3C6T A;  3DM2 A;  3DMJ A;  4C8M A;  4DTP A;  1S1W A;  3AO1 A;  4B3O A;  5DMR A;  3K58 A;  3TAN A;  3KIO A;  4QAG A;  3VQ9 A;  4DU1 A;  2VWK A;  4KFB A;  1C1A A;  1VSF A;  1HRH A;  1HQU A;  3OY9 A;  3OYD A;  3C95 A;  1CZB A;  1KRP A;  4FJM A;  3NH1 A;  3OS1 A;  1SUQ A;  3DLR A;  3T19 A;  4FVM A;  1ZBI A;  4HHT A;  1Q9X A;  4ZHR A;  5I42 A;  1XWL A;  2Z1H A;  4CJP A;  2GV9 A;  1IKX A;  4H4O A;  4DSF A;  1L3V A;  4IKF A;  4Z4E A;  2A1S A;  4E7I A;  1Z25 A;  2IS3 A;  2VG5 A;  3PO4 A;  1WSF A;  4FZY A;  3CM6 A;  4BWM A;  3L2V A;  3MEC A;  4CJU A;  4YFU A;  1C6V A;  4I9L A;  1U47 A;  4HVJ A;  3G0Z A;  1JXB A;  1TV6 A;  1RDA A;  4DTN A;  4FZX C;  3NF7 A;  3MXJ A;  3O4Q A;  3HXM A;  3SNN A;  3O3G A;  1JLE A;  4BWJ A;  1S5J A;  5KGX A;  2ETJ A;  3OYL A;  3NCI A;  2WON A;  2YNG A;  3TAP A;  4KHU A;  4W5R A;  1RBU A;  3ZSV A;  3SQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...