2FBTA

Wrn exonuclease
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbtA00
1HQUA 1HPZA 5DK5A 3QESA 1SUQA 4KV8A 2BE2A 4RW8A 2XY5A 1FXXA 3M8RA 1NK7A 3ALYA 1A5VA 5KGXA 4W5RA 4DTMA 2YHAA 3ZSYA 2ATQA 3B6OA 4CGJA 4WE1A 2PYJA 3DYAA 4HHTA 4FJGA 3EYZA 3SQ2A 1S1UA 4CFCA 1W9HA 3TAGA 3DM2A 2HVIA 4DG1A 3V4IA 4J2AA 1CLQA 3DLKA 3OVNA 3MAQA 3DRPA 3AVJA 4OGEA 2HHXA 1HNIA 1JLBA 2O4GA 5CY4A 3NGZA 3TABA 4CEBA 1KLNA 3DLBA 3VQQA 1VRTA 2FBVA 4UQGA 3CQ8A 3ZT3A 1Q9YA 1YVUA 4DSEA 4HCBA 4O4GA 3KLGA 3S3NA 1TGOA 4CECA 3O3GA 2G8WA 4M3ZA 5JS1A 4CGIA 4B3OA 1WN7A 4CEEA 5FRNA 4F2RA 2X78A 4CHQA 3ZT0A 1MU2A 3QEPA 3SPZA 4E7KA 1QSSA 2KZZA 3LPUA 3AVKA 1L3UA 2PZSA 1NK9A 1RBVA 1VRUA 4M45A 4CESA 3OYBA 5HROA 5D3GA 4OLAA 1XHXA 3LP3A 4B9VA 1TK5A 4NCAA 4JRPA 3AVCA 1BIUA 5CYMA 4B8CA 4FLXA 2XY7A 3QERA 1RTHA 4KFBA 1KSPA 4FJHA 1A5WA 4CF0A 4ELTA 2YKMA 2OPPA 3SUPA 3L3VA 2QK9A 3AO5A 4CK3A 2GBZA 4OPJA 1ASVA 1WLJA 5J2PA 3KIOA 4ZTFA 3KTQA 3D0PA 1RTJA 2OPRA 1BGXT 2AJQA 4DSIA 2BGGA 3HO1A 3L8BA 1U49A 4DQQA 4M42A 4DWIA 3SNNA 3AA2A 2HVHA 3VA0A 4E7LA 4FZXC 1JLAA 4CJUA 1XI1A 1HYZA 1UAXA 3T19A 4E7IA 1RTDA 4DTSA 4KHNA 3QEIA 1C6VA 4LD0A 4CIEA 3TR8A 4CEDA 1D8YA 1NK4A 3AV9A 4IG3A 4Z4GA 3VA3A 4CGFA 5CZ1A 3HP6A 4FJLA 2Z1IA 1SL1A 1KVBA 1QE1A 4ID1A 3WNEA 4QOZB 1WSIA 3PX0A 3HJFA 4KTZA 3CM6A 2FC0A 1SL0A 1JKHA 5HRPA 5K14A 3VQ8A 4CJPA 2BDPA 2RF2A 4NCGA 3KJVA 3HK2A 1UWBA 3MEGA 3WNHA 3SYZA 1ZBFA 1RDAA 1RT6A 4FLWA 3QINA 2HNZA 5J2NA 3S9HA 1ASUA 1W0HA 1RT1A 4KKOA 3V1QA 1T7PA 1VSFA 4J2DA 2YNGA 1L3SA 4FK2A 1REVA 2OZMA 1RBSA 3ZSRA 1VSMA 3U3YA 3RRHA 1N6QA 3HPOA 3RMDA 4CF1A 2X6NA 4R5PA 3C95A 1IO2A 3K5MA 4RW7A 4BDYA 5KGWA 4DTUA 4E3SA 2IC3A 4EZ6A 4JLHA 3V1OA 3DMJA 1WSGA 5T7BA 4FJMA 4FJXA 1TV6A 3F9KA 4O55A 5HRRA 3HXMA 5KTQA 3VQEA 2B4JA 4N56A 3AVNA 4CHZA 4CJFA 2HHTA 3C94A 1WAJA 4I2PA 1U04A 1HNVA 1TAUA 4PUOA 4CJRA 2P51A 3AVFA 4RW9A 1IG9A 2G8HA 3AVGA 1R0AA 1NJXA 2G8FA 3U3GA 3OYDA 2IS3A 2D0AA 4IFVA 5KRTA 3NGYA 3NH1A 1J53A 3KK2A 3TAPA 4RW6A 1NK8A 1RTIA 4OKEA 3V6DA 1EKEA 5HBMA 3JSMA 4FLVA 1TK0A 1ZBHA 4DU4A 4DFMA 3OS0A 4DFJA 3G10A 1SKSA 4KTWA 3O4QA 2A1RA 3PY8A 1JXBA 3KKRA 2VG7A 4RG8A 2Y1JA 4H8KA 4E0DA 4PQUA 3TAEA 4LH5A 1J5OA 4FK4A 1LW2A 2B6AA 3SZ2A 3ZSWA 3QEXA 2X74A 3IAYA 4W5OA 4I7FA 1WSHA 1RILA 3OY9A 2R7YA 4KPYA 1C1AA 4DF8A 4MFBA 4J2BA 4LY7A 3HVTA 3AVMA 4AHTA 1NKCA 4CF9A 4W5TA 4DLGA 3RMAA 3M8QA 3MECA 4IDKA 3NE6A 3JYTA 1I3AA 3L2VA 3SV4A 1KRPA 3OYKA 3SI6A 2F8TA 2KZMA 2XY6A 4FLTA 1RDBA 1SKRA 4DSJA 5HRNA 3FFIA 3ZT2A 2Y1IA 4OKKA 3AA5X 2Z1JA 1TL3A 1BCMA 2HNDA 4K8XA 1UA1A 1RBRA 5HP1A 3NGIA 4B8AB 1TKZA 2HW3A 4DU3A 1NK6A 4FLUA 5DMRA 3DOKA 4KHQA 4CEFA 4Y1DA 2HHVA 4ID5A 5C25A 3K2PA 3OYGA 2IDOA 3LP2A 4O5BA 5JS2A 3SQ4A 1VSDA 3TAQA 4F3OA 1ZBIA 1S1VA 1FKOA 1S6PA 1LAWA 3K59A 1B9FA 4AHSA 4CJQA 1JL2A 3OYHA 1VSKA 4GMJB 1KFSA 4FJIA 3AVIA 1KTQA 1VSEA 3RMCA 3AVBA 3VQBA 1RBUA 4M3YA 2IOCA 3OJUA 3AA4A 2XY8A 1J9AA 3LZIA 4FM1A 2QKKA 2ZE2A 4B9TA 1CZBA 4M3UA 1BQNA 1EETA 2F96A 5FROA 3VQ7A 2OA8A 2PY5A 1BISA 2P5GA 1FK9A 4AHUA 4DMNA 3AO4A 4C8LA 1BI4A 4O0JA 3NH2A 3LZJA 2BANA 3I8DA 1T05A 2FBTA 4DFKA 4QAGA 4CERA 4OVLA 4CJWA 1NK5A 1L3TA 4F4KA 4CJVA 1Q8IA 2DTUA 3OYIA 4KHWA 4FJ7A 2YNHA 3I0RA 2LSNA 3LP0A 1BIZA 3S3OA 4ELVA 4AH9A 4DTRA 3NFAA 3HSTB 3U6FA 3AA3A 4I9LA 4E89A 3OYAA 4FCYA 1ZBUA 1GOBA 2G8VA 1NOYA 3KK3A 5FDLA 1ZBLA 4DLEA 4CF8A 3ZSVA 3PV8A 3AVLA 4W5NA 1U47A 2YNIA 3E01A 3NF8A 4FK0A 3KD5E 3OYLA 3HM9A 3QEWA 3OYNA 4Z4IA 1TAQA 3V9ZA 2HB5A 2KW4A 1S5JA 4HTUA 3LP1A 4HVJA 3QNNA 4CIGA 3KD1E 2VG5A 4KHUA 2DFFA 2W42A 3LPTA 1S9GA 4DTPA 3BDPA 3UIQA 1S1WA 3RWUA 4JS5A 1LWFA 2RN2A 1C0TA 1JLCA 3M8PA 3OYCA 4HUEA 4H4MA 4YFUA 4FM0A 4CJSA 3O3HA 4DQIA 3SQ1A 3IG1A 1JLQA 3KKSA 1NKBA 1NKEA 2IGIA 3O3FA 4K8ZA 2F8SA 1CZ9A 1RT5A 4BDPA 3QEVA 4HCCA 1HYVA 3VQ4A 5CZ2A 4Z4CA 3OYJA 2G8KA 3QIPA 3NBPA 1JL1A 2XRIA 4CJ4A 2ZD1A 4CE9A 2DFEA 4CK1A 2G8IA 4B08A 4E1MA 1KVAA 1G15A 2GUIA 2E6LA 2KQ2A 4O0IA 3I0SA 4AHVA 3PX4A 1EP4A 4FJJA 1A5XA 3NAEA 4CIFA 1DTTA 1WNSA 4EP5A 4BWJA 3OYEA 2KTQA 2DY4A 1O1WA 4E7JA 3K5OA 3LAKA 4E1NA 4M3WA 1RCHA 1L3VA 1X1PA 3SUOA 1Q9XA 4KREA 4CJTA 4PWDA 2GV9A 4KRFA 4CEQA 3SV3A 3THVA 2HMIA 3LANA 1YT3A 3MEEA 4B9UA 4CFAA 4BWMA 4DF4A 4C8NA 3VQCA 3KLFA 1QSYA 2Z1GA 3LALA 4AHCA 2WONA 3ZSXA 4DQSA 2NUBA 1D9FA 3DRRA 1IKVA 3OJSA 3DLRA 4RW4A 3RTVA 2FBXA 1DLOA 1QS4A 2X6SA 4FJ8A 2EX3A 4FW2A 4FM2A 1C0MA 1JLEA 4YNQA 4BACA 3SCXA 1U45A 4OLBA 4KHYA 4CFDA 1Z25A 4F2SA 2HHQA 3NDKA 4FLZA 4HUFA 3EZ5A 3SQ0A 3K5LA 4BE2A 4AILC 3AVAA 4KO0A 3T1AA 3HT3A 3PO4A 3IRXA 1NK0A 4CHNA 3SPYA 4FJKA 4TSXA 2OPSA 3WNGA 1X9SA 4JS4A 1HMVA 1TKTA 1T8EA 5SZTA 1XHZA 3PUFA 1XWLA 3OYMA 3O4NA 2Z1HA 4H4OA 3K57A 1LW0A 1UOCA 4HUGA 3NF9A 1RT3A 3V9SA 2JGUA 4CEOA 1HRHA 1KVCA 4N47A 1C0UA 1B9DA 1TVRA 1RT4A 3DOLA 3OS1A 4DTJA 3TANA 2OZSA 3V9XA 3NF6A 3VQ6A 5E41A 1EXQA 2VWKA 3MXJA 1KCFA 5EU7A 3ZT4A 5I3UA 3MXIA 4M3XA 2P1JA 4KI6A 3CFOA 3RR8A 1I39A 3IS9A 1BCOA 1C1CA 2YV0X 4O44A 4AHRA 4M41A 3TAFA 3L2WA 1WSJA 2HNYA 1TKDA 1SKWA 2PYLA 3V1RA 5FRMA 3AO3A 1BQMA 1NJYA 1LAVA 1WSFA 4EZ9A 2KFZA 4KB1A 4C8OA 1JXEA 1IKYA 1F21A 2E6MA 1YTAA 4KAZA 3DI6A 2YKNA 4KI4A 3C6UA 3T3FA 1QHTA 4DQPA 3NF7A 5HLFA 2XHBA 3HYFA 3TI0A 1X9WA 1NOZA 1YTUA 3K58A 4XIUA 2DFHA 3DLEA 3SUQA 4W5QA 1QTMA 3CG7A 4CHPA 3NHGA 1VSLA 1RDCA 4BE1A 2JLEA 3QO9A 1D5AA 4LH4A 1B92A 1RDDA 4CGHA 4BDZA 4FJ9A 2ITGA 4OKJA 4I2QA 4IBNA 3KLEA 5CYQA 2YNFA 4FYDA 1IH7A 3QNOA 3LDSA 4NYFA 3KLHA 3K5NA 4MQ3A 4B9SA 1NJWA 1QQCA 2IAJA 2RKIA 4E7HA 3L2RA 1U4BA 3V81A 1L5UA 1CXQA 2D0BA 3TAMA 3RMBA 4B9NA 1RT7A 2HHSA 3CFPA 4I9QA 4FLYA 1JLFA 1T03A 3TARA 1ASWA 4DTXA 3RRGA 4FW1A 5KRSA 3HL8A 2RPIA 4DTOA 3LWLA 3A2FA 1Z26A 2QXFA 1RNHA 1S1XA 3ISNC 3WNFA 2B5JA 1NJZA 2P5OA 5J2MA 4Z4HA 4Q5VA 4DQRA 2A1SA 4FZZA 3M8SA 2FBYA 2EHGA 2QKBA 3BGRA 4KHSA 2D5RA 1TL1A 3ZSQA 3AO1A 5C42A 3L2QA 3ZSZA 4N5SA 3HVRA 3S3MA 3OS2A 1XC9A 1RBTA 3AVHA 3P1GA 4OPKA 4DU1A 4DFPA 1CXUA 3QIOA 1VSHA 1WAFA 4KB0A 1J54A 3CYMA 3ULDA 4GW6A 3ZT1A 3P5JA 4CGDA 5C24A 3VN5A 4IFYA 3NH0A 4N76A 2OPQA 1S1TA 4JRQA 3VQPA 1HYSA 3V9WA 4PY5A 3CM5A 4EP4A 3DLGA 4CGGA 1BHLA 4CJ3A 4Z4FA 3H08A 3VQAA 3OYFA 4PA1A 4Z4EA 2ZQBA 2WOMA 4DSLA 3P83D 1D9DA 4DS5A 3ITHA 1TK8A 1SL2A 4FXDA 3VQDA 3DLHA 4IG0A 3ZSOA 3CFRA 4IKFA 1VSIA 1BL3A 2YHBA 4DSFA 4L8RB 3VQ9A 1N5YA 3B6PA 5I42A 2KFNA 1ZYQA 3G0ZA 5SWMA 5KI6A 4KTQA 1SV5A 3HP9A 4M3RA 3PO5A 2OYQA 4NYNA 4FVMA 4J2EA 4GVMA 1VSJA 4CJLA 3PX6A 3KK1A 3F73A 4ZTJA 5J2QA 3C6TA 3EY1A 3MXMA 1K6YA 3MEDA 1RT2A 4NCBA 3DRSA 2ETJA 1U48A 3VQ5A 4Y1CA 4CFBA 5HRSA 3ASMA 4DS4A 4CJEA 3QLHA 4OJRA 4FZYA 1JLGA 3HPGA 4CEZA 3QETA 3HPHA 4CEAA 3L2UA 3L3UA 1EX4A 1ITGA 1S6QA 4CHOA 4M3TA 4OGCA 2G8UA 3NCIA 1S9EA 4N41A 1C1BA 4CK2A 3LWMA 2VWJA 3AO2A 4CF2A 4DTNA 1X9MA 2XO7A 2HHUA 1WSEA 3D45A 1IKXA 4LSLA 4F3TA 1TKXA 4Q0BA 3LAMA 1HQEA 2HHWA 1UA0A 1FKPA 4B9MA 3SUNA 2Q3SA 4C8MA 4CJKA 1LWEA 3KLIA 3V9UA 4ELUA 4E19A 4QCLA 4CHYA 1LWCA 2E4LA 1QSLA 1DTQA 1IKWA 1Y97A 1KLMA 4CCHA 1VK0A 3TWHA 1GOAA 1HJRA 2D0CA 4ZHRA 4LSNA 2I5JA 4CJ5A 3SJJA 4B9LA 4F8RA 1KFDA 5J1EA 3RR7A 1BI4B 4ICLA 4DSKA 4FJ5A 2O4IA 3ZCMA 4G1QA 4FJNA 1GOCA 4BE0A 4C8KA 1LV5A 2VG6A 4Z0UA
chains in the Genus database with same CATH superfamily
1HQUA 1SUQA 5AQZA 2FF3B 4DTMA 2ATQA 4H0VB 1KXPA 3OTOK 4BRMA 1VQNN 4FJGA 4ISFA 4CFCA 2JWLA 1BU6O 4J2AA 5AQLA 2O8BA 3DLKA 3DRPA 1HJOA 2O4GA 3R3LA 1KLNA 3VQQA 1VRTA 1YVUA 3H1VX 5JS1A 2G8WA 1MU2A 3E66A 1QSSA 3AVKA 4I6MA 1YTUA 1VRUA 1JJ2M 4CESA 5D3GA 1EQYA 3HSCA 4B9VA 1VQ6N 4FLXA 3QERA 4FJHA 3THYA 3CCLN 2UUAK 3D6RA 4OPJA 1ASVA 3T1HK 3L8BA 4DWIA 5AQWA 3MMVA 2E2OA 2CGLA 3LL3A 4BGAA 4B9QA 4E7LA 1JLAA 3QFPA 1XI1A 3T19A 3M5RA 1V4TA 1C6VA 4LD0A 3C6AA 5M1QA 5LMNK 4IG3A 4CGFA 1KVBA 2UXBK 3VMFB 1SL0A 1JKHA 1IBKK 1KAZA 2NLXA 2GWKA 5K14A 3THWA 2P9KA 2BDPA 5LJWA 3MN9A 3A0IX 1RDAA 1RT6A 4FLWA 1OH7A 2HNZA 5J2NA 1ASUA 5AZJA 5B8HA 4FK2A 1RBSA 3U3YA 3VEZA 1N6QA 3HPOA 3RMDA 4A2BA 4R5PA 1HNXK 1IO2A 5KGWA 2IC3A 3ZLJA 4JLHA 5T7BA 1WSGA 4FJXA 2BUPA 3FLCO 1NM1A 3AVNA 3DXKB 1WAJA 1U04A 2YHXA 1VQ4N 4GVEA 1XUPO 3AVFA 4RW9A 4B1YB 4JAXA 2E5LK 3AVGA 1NJXA 1KAXA 4JHDB 3OYDA 3CI5A 3SJHA 4IFVA 3NGYA 1NK8A 5A2QO 1EKEA 5HBMA 3WXLA 3CMEN 4DU4A 4U67L 2P9SA 3TSUA 4QS8A 3ZETB 3LDLA 4RG8A 4E0DA 5AQHA 4FK4A 4YDUC 1LW2A 2O8CB 2B6AA 3ZSWA 3QEXA 4I7FA 2R7YA 4MFBA 4J2BA 4BRKA 1IBMK 3HVTA 4DR2K 1WOQA 3J7YP 4AHTA 1MDUB 4CF9A 3MCAB 4CZHA 4DLGA 3RMAA 2KLAA 3M8QA 4EIAA 3JYTA 1I3AA 2ZJPL 2F8TA 2XY6A 1ZBSA 3ZT2A 1Z6RA 3ENHA 3CHWA 3AY9A 1BCMA 1RDUA 4JI6K 4B8AB 4DU3A 3DOKA 4B3RK 2IDOA 3TSQA 1K73O 3TAQA 1DEJA 1I94K 1LAWA 3K59A 3OYHA 4BREA 3P4IA 2NRXA 1VSEA 4WFNL 4M3YA 1TUUA 3Q7BA 3AA4A 2XY8A 3LZIA 1P8ZA 1OVYA 4FM1A 3VESA 4M3UA 1K8AO 2F96A 2WUSA 2OA8A 2A5XA 1X3NA 1BISA 1FK9A 3C65A 1YITN 4JYAK 3AO4A 4JEPA 4C8LA 1BI4A 4JKCA 2CGKA 3QICA 3LZJA 2BANA 3C6HA 2JWKA 1NK5A 1L3TA 3O08A 3OYIA 3RVCA 3I0RA 2LSNA 4YOWA 4AH9A 3NFAA 4K25A 3HSTB 3U6FA 3AA3A 1ZBUA 5ADXH 2G8VA 4C1NK 5FDLA 1QZ5A 3Q7CA 3ZSVA 3AVLA 3E01A 3ID6A 3OYLA 3QEWA 4OPAA 4JKAA 4LFCK 4Z4IA 2KW4A 2QW9A 4HTLA 4M7XA 3IDHA 1LWFA 2RN2A 4JKHA 4H4MA 3W0LA 3O9SA 2E2NA 2IGIA 3O3FA 4R79A 3TTDA 2F4VK 1SZ2A 3OYJA 3QIPA 4CE9A 1J5EK 4M7YA 4B08A 4E1MA 4CZIA 4QS7A 4DR6K 1KVAA 3I33A 2A40A 3PX4A 1A5XA 2KTQA 3DXMA 3QBXA 5JICA 3K5OA 4DHYA 5GADP 1L3VA 4CJTA 4PWDA 2P9LA 3THVA 1Q86O 1E3MA 1K8KB 3P31A 3VQCA 2VQEK 4EFHA 3ZSXA 1IKVA 4K42A 3DLRA 1OH6A 2FBXA 1QS4A 1XQSC 4FM2A 4RTFD 4CW7B 3NDKA 4KO0A 3GG4A 3IRXA 1VQ8N 2V7ZA 4CHNA 4FJKA 1OH5A 3HOTA 5BN8A 3D7EO 4MO5A 3EZWA 3O4NA 3WQTA 4BRAA 1TUYA 3V9SA 4K41A 4CEOA 1HR0K 5AZIA 3DOLA 3V9XA 3ULEA 3L4QA 4B3SK 4RWTA 4IO8A 5EU7A 4WQ4C 3KVGA 5I3UA 1N36K 4KI6A 2QWOA 3TAFA 5FRMA 1WSJA 2O8DA 4DV5K 3V1RA 2E6MA 4DQPA 3HYFA 1NOZA 2I7NA 4XIUA 4W5QA 1QTMA 3CG7A 2QWMA 3NHGA 4DV3K 4BRNA 1D5AA 1B92A 3KZBA 2UU9K 4OKJA 5AQGA 3FZHA 3LDSA 3OBWA 3GBTA 3WQUA 5EY4A 5LL6Z 4E7HA 4DUZK 3L2RA 3TTFA 2D0BA 4JI2K 3RMBA 5CE3A 3VF6A 4IFEA 3RRGA 4FWQA 2QEXN 3HL8A 3SAGA 1RNHA 2ZGYA 3IMXA 1NJZA 4FOIA 2A1SA 5AQOA 1HLUA 2YHYA 1TL1A 2HBMA 3J81O 3L2QA 5AQRA 1YI2N 3QIOA 3VEOA 4KB0A 3U9DA 3CYMA 3ULDA 4CGDA 4U7BA 2OPQA 1S1TA 4JRQA 3C0BA 4YOXA 3DLGA 4CBXA 1BHLA 1YJNN 1IV0A 1LCUA 3P83D 1GLJO 3WXKA 2ZJRL 1MWKA 4DSFA 4L8RB 3BF3A 5TKWA 3HP9A 3PO5A 4IXCA 4FVMA 4ZTJA 5J2QA 3EY1A 3MEDA 3UKUA 3VQ5A 1VQKN 4DS4A 4CJEA 3QLHA 3EE8A 4WFAL 4M3TA 1YJ9N 3NCIA 3UKRB 4CK2A 2HHUA 3SLCA 2WTUA 4DTNA 1NGAA 3EEQA 5BRDA 2XO7A 3ZYYX 4XH5A 1M90O 1UA0A 2IVOA 4A61A 4CJKA 4CHYA 4DR5K 5AQJA 3TWHA 3SJJA 4LSNA 4F8RA 1OKJA 1HPMA 3RR7A 4ICLA 1BA0A 5M1FA 5KPRA 4BE0A 2HHVA 3LP1A 3R1XA 4BVOA 4CZEA 1FXXA 3M8RA 5KGXA 4W5RA 4BRIA 4WE1A 3J7AP 4YOYA 3FZMA 3EYZA 1VQMN 1BWFO 3TAGA 2HVIA 2IVPA 3V4IA 4H5VA 5AQTA 2NRVA 2HHXA 1JLBA 4PHTX 4CEBA 3CQ8A 1Q9YA 3HZ6A 5EOYA 4CGIA 4CEEA 5FRNA 3EL2A 2X78A 4CHQA 5BR9A 4O8UA 3QDKA 4YOUA 5HROA 3OYBA 3N4PA 4JRPA 2XY7A 3ZX3A 1KSPA 1JCFA 1A5WA 3VEYA 3L0QA 4ELTA 3SUPA 4CK3A 4DSIA 3HBTA 5LMUK 4M42A 3LDOA 4CBWA 3AA2A 3EKSA 4FPAA 4BR2A 3CJ7A 2FXUA 4CJUA 1UAXA 3DLLL 1HUXA 3AV9A 3DAWA 4C1NI 4Z4GA 3O8MA 2Z1IA 1MWMA 4BRDA 4QOZB 5BRHA 5I9EB 3O80A 3VQ8A 2VGNA 4H0XB 5M1NA 3SYZA 3CJBA 1QHAA 4J2DA 4KKOA 1W0HA 1VSFA 1L3SA 3ZSRA 1VSMA 3CCMN 3C95A 4E3SA 1YAGA 1BO5O 4EZ6A 3V1OA 1E4GT 3F9KA 4O55A 5KTQA 3VQEA 4CHZA 3W3DA 4CJFA 3VF4A 4I2PA 4X65K 2QWLA 4BC3A 1IG9A 2G8HA 1R0AA 3RSEB 5FPNA 5ELZA 5LY3A 5KRTA 2HMPA 5HL7L 3V6DA 3JSMA 4DV0K 1TK0A 3IFRA 4FWLA 4DFMA 4DFJA 4JK8A 4KTWA 2A1RA 4BRQA 4LH5A 1MA9B 3O9TA 3K9KA 3AAPA 3LDQA 1RILA 3C7NB 2W6LA 3OY9A 2NRZA 5JVHL 3ZX0A 3PSIA 1NKCA 4LF6K 3OHRA 3MECA 3FZKA 3A5LC 3SI6A 4WQ5C 1RDBA 1GLEG 3U9ZA 3FFIA 3HRGA 2Z1JA 5F0XA 5C2DA 4X66K 2ASPA 4JNEA 2P9PB 1TKZA 2HW3A 4FLUA 1VQ7N 3OYGA 3LP2A 5JS2A 2QWRA 1VSDA 3SQ4A 2V51B 1FKOA 1RDWX 3VENA 4AHSA 1JL2A 1NMNA 1XNQK 3AVIA 1KTQA 1VQLN 4JI5K 3AVBA 4FWMA 3KWIA 2ZJQL 2IOCA 4C23A 1RFQA 3CCQN 4B9TA 1EETA 3QBWA 5FROA 3VQ7A 4BG8A 2PY5A 1K9MO 2VGMA 2FLOA 4AHUA 3ZETA 2O8CA 1WB9A 4MLHA 5EVZA 1H1VA 4F4KA 4CJVA 1Q8IA 3EO3A 4KHWA 2YNHA 3LP0A 3SBGA 2ITMA 3N4QA 3VTHA 4DB3A 3B8AX 4LF7K 4DLEA 4CF8A 2IVNA 2ASMA 3GE1A 4FK0A 3HM9A 2FSKA 4K43A 1DGKN 1S5JA 4JK7A 3QNNA 4HVJA 3CJ1A 4CIGA 3KD1E 2VG5A 2W42A 3AGRA 1S1WA 4JS5A 4JI1K 4HUEA 1C0TA 1JLCA 3CPEA 4AM7A 3OBYA 3U4LA 2OANA 4FM0A 4BR4A 3IG1A 1JLQA 4BRPA 3KKSA 5BRFA 1CZ9A 5GAGP 3GDQA 4GV6A 5GINA 4CJ4A 2G8IA 4CK1A 3F2KA 2W6KA 1G15A 1X9JA 3I0SA 4AHVA 3NAEA 4EP5A 3OYEA 1O1WA 2P9UB 4E1NA 4Z94A 1RCHA 1X1PA 2O8FB 2A6AA 4KREA 4A62A 4KRFA 2P9IB 4CEQA 3SV3A 2HMIA 1YT3A 3I56N 4JI4K 4A57A 1QSYA 3LALA 4DQSA 1D9FA 2Q97A 2PBDA 4RW4A 1QQMA 4LFAK 1IG8A 3FR0A 1JLEA 3SCXA 1U45A 2H3GX 4FLZA 4HUFA 3CMAN 5EX5A 3PO4A 1NK0A 3BEXA 4TSXA 2OPSA 3THYB 4JS4A 1HMVA 1T8EA 2E2PA 3EE9A 2FF6A 3MWTA 3M3ZA 1XWLA 3OYMA 1XHZA 3D2FB 4LFBK 3P39A 4JKFA 4OX9K 3LDNA 4H4OA 4HUGA 3NF9A 3WEEB 1RT3A 3OS1A 5GAEP 4FOEA 4QS9A 3FZFA 2VWKA 1KCFA 2PFUA 4M3XA 2P1JA 4CI6A 5GAHP 3PSFA 3IS9A 1C1CA 2YV0X 1TKDA 3CCSN 2HNYA 1E4FT 1BQMA 3CCEN 1ATNA 1JXEA 4BC5A 4A2AA 1YTAA 3DI6A 2YKNA 4KI4A 3NF7A 3H3OB 2XHBA 4NXNK 1X9WA 2Q31A 5C10A 2DFHA 3DLEA 4E1JA 4CHPA 2JLEA 4WF9L 5AZJB 4A5BA 5C12A 1RDDA 4J8FA 3IUCA 3QNOA 4EHTA 4MQ3A 4B9SA 1NJWA 1QQCA 5JLFA 2RKIA 3V81A 4DV6K 2HHSA 3CFPA 4I9QA 1JLFA 1T03A 3TARA 1ASWA 4FW1A 4DTOA 3A2FA 1Z26A 5BPNA 2B5JA 2ZF5O 2KKZA 5J2MA 4Q5VA 4IJAA 3M8SA 2FBYA 2EHGA 2QKBA 4NLCA 5F1XA 4KHSA 4FSVA 3ZSQA 3MX2A 2HBLA 4BROA 3HOSA 3HVRA 1RBTA 3P1GA 1CXUA 2GTDA 1J54A 3FFKB 5C24A 1HYSA 4N76A 3VQPA 3V9WA 3CM5A 4EP4A 4IOXA 4LF4K 4PA1A 2NZTA 2QWNA 5AFUA 2FSNA 3ITHA 4DS5A 1SL2A 4OO1J 5IT9O 2F9TA 2YHBA 5I42A 3G0ZA 4KTQA 1SV5A 1DKGD 4LF5K 5TKYA 3F73A 3C6TA 3G4SN 2ETJA 4DV4K 2FSJA 3MN5A 5HRSA 4FZYA 2NRHA 3LM9A 3HPHA 1ATRA 3AGKA 4NLBA 3L3UA 1EX4A 1ITGA 4H5WA 4IOCL 1V4SA 4CD1A 1WSEA 5AQIA 2HHWA 1FKPA 2Q3SA 3VGKA 4PKGA 4QCLA 3ZEUB 1LWCA 1GOAA 2D0CA 4XH4A 4B9LA 1KFDA 4DSKA 1BI4B 1Q18A 5CR4A 3E9OA 4C8KA 1LV5A 2VG6A 3CETA 3QESA 4KV8A 2BE2A 1QVFM 3I55N 4H0OA 2XY5A 3ALYA 4BRLA 5MLCQ 4DR7K 3ZSYA 3B6OA 2PYJA 4DV7K 4JKEA 2PAVA 4HHTA 3SQ2A 2UXCK 4DG1A 3OVNA 3MAQA 3AVJA 1HNIA 5CY4A 3NGZA 4Y0WA 3DLBA 3QB0A 2FBVA 1NGBA 4DSEA 2D0OA 4O4GA 3KLGA 3S3NA 5M1KA 2O8EB 2D0PA 4B3OA 4F2RA 3FGUA 4G9ZA 1BUPA 3UKRA 3ZX2A 4BRHA 2PZSA 1RBVA 3DXMB 2I7PA 1TK5A 4NCAA 1BIUA 4B8CA 1RTHA 4H5RA 2P9LB 4CF0A 3NMUA 2QK9A 3AO5A 2V52B 3KIOA 2BH1A 5AQSA 4ZTFA 3KTQA 5LJVA 1BGXT 3HO1A 1U49A 3SNNA 2IIRA 4FZXC 4DTSA 4KHNA 3QEIA 1GLBG 4CIEA 3F5TA 1D8YA 1FJGK 4H0TB 4XH1A 5JMVA 3HP6A 1SL1A 4BVPA 1QE1A 2GEMA 3H46O 1WSIA 3PX0A 3CM6A 2FC0A 4LF9K 5HRPA 1NGCA 2RF2A 4NCGA 4CZFA 3KJVA 3HK2A 3MEGA 2YCHA 3WNHA 2HSTA 1Z05A 3QINA 1FW6A 4JV5K 2YNGA 1REVA 2OZMA 4B1ZA 3RRHA 3THXA 2X6NA 4DTUA 4RW7A 4O8KA 3L6QA 3O5BA 1T3VA 3HXMA 1ZXOA 4B3MK 4BR0A 3C94A 1HNVA 4PUOA 4CJRA 3HI0A 2P51A 4H5TA 1J6ZA 3U3GA 3VTIA 2IS3A 3KHYA 1XNRK 3KK2A 3TAPA 3BP8A 4BRCA 3OS0A 3O4QA 1QVGM 5FPDA 2ZM6K 1XC3A 1S72N 2VG7A 1VQ9N 2Y1JA 4PQUA 1OVQA 2ASOA 3TAEA 1J5OA 4B1XB 3EN9A 3SZ2A 2HBKA 3IAYA 4W5OA 4X62K 1WSHA 2GELA 3CC2N 1C1AA 4DF8A 1T6CA 4NO7A 3CF5L 3CJAA 1RGIA 4DUYK 2UUCK 4W5TA 4IDKA 4NXMK 3L2VA 3SV4A 2E8AA 1KRPA 2KZMA 3CXCM 1YHQN 4FLTA 1SKRA 2W40A 4FWKA 3ATVA 5F2RA 4PKIA 1NMDA 3DWLA 4PL7A 2QWPA 4JN4A 5FPMA 4CD3A 4K8XA 1UA1A 4KHQA 3J80O 1U2VA 4JI7K 3CC4N 5C25A 4BRGA 3K2PA 5C0YA 2J4RA 1S6PA 2Q2RA 1KFSA 2E1YA 4FJIA 3RMCA 3CCVN 3VQBA 1RBUA 5IWAK 1YIJN 1J9AA 5AJ3K 1WBDA 3VEXA 2ZE2A 4JI3K 3D2EB 5BN9A 3MWPA 5HOOA 2P5GA 4PKHA 1KAYA 4HWIA 4CZLA 3NH2A 3I8DA 4IEEA 1T05A 4DFKA 4QAGA 4DR4K 3C7NA 3ENBA 4MDAA 3S3OA 4BQLA 4JD2B 4I9LA 4FCYA 5FLXO 3KK3A 1ZBLA 4W5NA 2YNIA 1HKBA 3NF8A 1NJIO 2VCPA 3OYNA 3V9ZA 1N33K 2HB5A 2A41A 4HTUA 3KK7A 3TSPA 2DFFA 4IDHA 3L4IA 3RWUA 4XEIA 3M8PA 3OYCA 4FXDA 1NLVA 3O3HA 2P9NB 4CBUA 1NKBA 3PIOL 4K8ZA 4BDPA 3VQ4A 5CZ2A 2XRIA 2ZD1A 4O0IA 2HHHK 4FJJA 3A8YA 4CIFA 1DTTA 1WNSA 4YDUA 4H5NA 5C15A 4M3WA 2E20A 3EKUA 1JCEA 3LAKA 2DPNA 2NRTA 1TYQB 4B9UA 3LANA 3SK3A 4CFAA 3SMSA 4EHUA 4DF4A 1Q81O 3E1YA 2Z1GA 2NUBA 3OJSA 1JCGA 3RTVA 4FJ8A 4KHPK 2EX3A 3FZLA 4FW2A 4IEIA 4YNQA 5AQYA 4CFDA 1Z25A 4F2SA 3NVKA 2HHQA 3EZ5A 2ZGZA 4AILC 3T1AA 1GLFO 1GLCG 5JLHA 3WNGA 1X9SA 1TKTA 5SZTA 3PUFA 3CJCA 3M6GA 2NNWA 3O4WA 4YHHK 3VPZA 1UOCA 2JGUA 1ZC6A 1HRHA 1KVCA 4YOTA 1C0UA 1B9DA 4N47A 1RT4A 4FJLA 2OZSA 1VHXA 3NF6A 3M1FA 3VQ6A 1EXQA 3P38A 1XMOK 3ZT4A 3MXIA 4FWSA 1CZAN 3CFOA 1I39A 5AQVA 1ESVA 4MLEA 4O44A 4M41A 2PYLA 1NJYA 1LAVA 1WSFA 3MX5A 4EZ9A 2KFZA 4KB1A 4C8OA 1F21A 1VQ5N 1Q7YO 1QHTA 3DXKA 3R8EA 2P9UA 1VSLA 1RDCA 1WBBA 2O8FA 2RHKA 3QO9A 4JHDA 4LH4A 4CGHA 2P9IA 2ITGA 1GLAG 2Q0RA 4I2QA 4FYDA 3CQXA 2YI1A 3R6MA 3KLHA 3K5NA 2QTDA 2BTFA 3CCRN 5BPMA 2OTLN 1U4BA 2KHOA 1CXQA 4AF1A 3ATUA 2Q36A 3TAMA 5AQXA 5DM6L 5KRSA 4BG9A 1Y64A 2RPIA 3LWLA 1XMQK 2QXFA 3ISNC 3WNFA 2E2QA 1M1KO 5JVGL 4DQRA 4FZZA 5AR0A 3D2FA 2YJFA 4IJNA 3T1YK 3AO1A 4N5SA 3WEEA 3WXMB 3OS2A 1XC9A 4DU1A 1VSHA 1NU0A 4JKGB 4JKDA 1BA1A 4GW6A 3ID8A 3NH0A 4IFYA 4DQ8A 4PY5A 4CGGA 4CJ3A 3O6WA 3H08A 5GIOA 4Z4FA 4Z4EA 3H3NO 5BREA 1TK8A 1C0FA 2D1KA 4MO4A 3VQDA 3DLHA 1ILYA 3ZSOA 3CFRA 1T44A 4IKFA 3VQ9A 1N5YA 3B6PA 1ZYQA 5KI6A 5KPTA 4NB4A 5CHIA 3J7ZO 3PX6A 3KK1A 2O8BB 3FE1A 1K6YA 4NCBA 1RT2A 3CCUN 3O1WA 4Y1CA 3HPGA 4PL8A 4BR9A 4CEZA 3QETA 1HNWK 4CEAA 4CZMA 4FVUA 3L2UA 4IOAL 3WUHA 1S6QA 3AAQA 2G8UA 2QM1A 4N41A 1C1BA 3LWMA 2VWJA 4BC2A 3AO2A 4CF2A 1X9MA 4I6MB 4EAHD 3NVMA 4GNIA 1NWKA 3D45A 1YVNA 3MN7A 4LSLA 4F3TA 1N8RO 1TKXA 4Q0BA 4WQ4A 1HQEA 3SUNA 1NGIA 3UB5A 4E19A 5M1PA 1HKCA 1DTQA 1YUWA 1Y97A 1KLMA 1HJRA 4ZHRA 1KQSM 2D4WA 2I5JA 4CJ5A 4KH6A 3MDQA 5AQPA 4BR5A 5J1EA 3ZCMA 3BZKA 3WXJA 4FJNA 1IBLK 3MN6A 1HPZA 5DK5A 4X64K 3I8BA 3GL1A 2HOEA 4RW8A 1P90A 4JK9A 4A59A 1NK7A 1A5VA 2YHAA 3PIPL 2A42A 4CGJA 3DYAA 1NGJA 1S1UA 5AQMA 1W9HA 4CVNE 3THWB 2P9KB 2WBNA 3DM2A 4CZGA 1CLQA 4WYBA 4OGEA 2HF4A 1HNZK 3TABA 2VQFK 4ILHA 4RCHA 2UUBK 3T7ZA 1K8KA 3BZCA 3ZT3A 4UQGA 4LF8K 4HCBA 1NNEA 1TGOA 4CECA 3O3GA 4M3ZA 3H1QA 1WN7A 2HF3A 3QEPA 3ZT0A 3ENOA 3SPZA 4IWVA 4E7KA 2KZZA 3LPUA 1L3UA 1NK9A 4M45A 4OLAA 4FWNA 1XHXA 3LP3A 4GY2B 2NRWA 3U8XA 4YY3K 1VAZA 3AVCA 5CYMA 4B1WB 4KFBA 4WFBL 1T6DA 4DR3K 3ZEUA 2YKMA 2OPPA 3L3VA 3WXIA 2GBZA 5J2PA 1WLJA 5M1OA 3D0PA 1RTJA 2OPRA 4FPBA 2AJQA 2P9SB 2BGGA 3K9JA 3O9UA 4DQQA 3CD6N 3BUZB 1GLDG 2HVHA 3VA0A 5ADXA 1HYZA 1RTDA 4E7IA 3BY5A 4DV2K 5AQQA 3TR8A 4CEDA 2CH5A 3CCJN 1NK4A 3VA3A 5CZ1A 5DM7L 4ID1A 2CGJA 3WNEA 3HJFA 4KTZA 3QFUA 3KWGA 1QZ6A 4CJPA 1NGHA 5AFUH 1UWBA 1ZBFA 1QQNA 3OA9A 3O9QA 4B3TK 3S9HA 3V1QA 1RT1A 1W7AA 1T7PA 3PLAA 4B1VA 5EXWA 3DJCA 4CF1A 3K5MA 4BDYA 5AQFA 2O8EA 3JXUA 3DMJA 4FJMA 3VF2A 1TV6A 5HRRA 3LM2A 4N56A 2B4JA 3IKMA 4H0YB 2HHTA 3MK6A 1TAUA 4BY9C 1S3XA 3R9PA 4CZKA 3K0SA 2G8FA 2D0AA 4IO9L 3NH1A 1J53A 1YXQA 2CH6A 3J8AA 4RW6A 1RTIA 4OKEA 1ZBHA 4FLVA 5AQKA 1SKSA 3G10A 4KBOA 4FWRA 4BRFA 3PY8A 1JXBA 3KKRA 3TTCA 4H8KA 2F7TA 3UE5A 2X74A 4K0KK 4JI8K 2E1ZA 1EWRA 4KPYA 3CERA 4LY7A 3AVMA 4V19S 3G6EN 3NE6A 3OYKA 2AP1A 4DSJA 5HRNA 2Y1IA 4IZ9A 4OKKA 3AA5X 2YJEA 3AARA 1TL3A 2HNDA 1LOTB 1RBRA 5HP1A 3NGIA 4GV9A 1NK6A 5DMRA 3A5NC 4CEFA 4Y1DA 4ID5A 4O5BA 4F3OA 1ZBIA 1S1VA 1B9FA 4CJQA 1VSKA 4GMJB 4UY8O 1NGDA 1VQON 3OJUA 2QKKA 2UYTA 2ZWHA 1CZBA 1BQNA 4AQYK 4DMNA 4ILGB 4O0JA 4GV3A 4H03B 1BG3A 2FBTA 2OCEA 1Q82O 4CERA 4OVLA 4CJWA 4L3QA 1BDGA 2DTUA 5H1SQ 4FJ7A 4ELVA 1HKGA 3CPWM 1BIZA 2QI2A 4DTRA 4E89A 3OYAA 1GOBA 3E9LA 1NOYA 4WCEL 4DKWA 2QA4N 3PV8A 4ILJA 3SAFA 4O5FA 1U47A 3KD5E 2V7YA 5AZIB 1TAQA 3ULEB 1W97L 1GLLO 4KHUA 3LPTA 1S9GA 4DTPA 3BDPA 3UIQA 4B9NA 2EWSA 4YFUA 3SMPA 4CJSA 1BOTO 1KC8O 5BR8K 2WFBA 3SQ1A 4CZJA 4DQIA 2O8DB 1NKEA 3F9MA 5BPLA 2F8SA 1RT5A 3QEVA 4HCCA 1HYVA 1D4XA 4GKJK 4Z4CA 1DT9A 2G8KA 3NBPA 1JL1A 2DFEA 2GUIA 2E6LA 2KQ2A 3CIPA 1EP4A 3QMLA 2DY4A 3GOIA 3TPQA 4OPHA 4BWJA 4MDBA 4E7JA 4JKBA 3SUOA 1Q9XA 2GV9A 2UXDK 1N34K 3MEEA 3D2EA 4LC9B 4BWMA 4C8NA 1NGEA 5E84A 3KLFA 4AHCA 2WONA 1VQPN 3DRRA 3O9RA 1DLOA 4BC4A 2X6SA 2GUPA 5FPEA 3G71N 1C0MA 4BACA 4OLBA 4KHYA 3H6EA 1YF5L 1NBWA 4WQ5A 3K5LA 3SQ0A 4BE2A 5KQ8A 1EO1A 3AVAA 3HT3A 2VYPA 3SPYA 1NGFA 4JD2A 3MCPA 4A5AA 4DV1K 1U6ZA 1EWQA 4ISGA 2Z1HA 4B1UB 1C0GA 4DCHA 3K57A 1LW0A 3HTVA 4YORA 3SBTA 4DR1K 2WC9A 1TVRA 4DTJA 3TANA 2VWBA 1O13A 4FL9A 5E41A 1ATSA 3MXJA 3RR8A 1BCOA 4AHRA 3TU5A 4BR7A 1SKWA 3L2WA 2P9NA 2F9WA 3AO3A 1IKYA 4ISEA 2Q0UA 4AM6A 4KAZA 4FWOA 1W2BM 2RE2A 2W41A 3C6UA 3A5OC 3T3FA 5HLFA 4FWPA 1SQKA 3TI0A 5AQUA 2GWJA 3K58A 3SUQA 3CC7N 4BE1A 3WT0A 3RSEA 3UKUB 4BDZA 1TYQA 4FJ9A 3A5MC 4IBNA 5C2FA 5CYQA 2YNFA 4BQZA 1IH7A 3KLEA 3THXB 4NYFA 3VGLA 2IAJA 1N32K 2YX6A 4CJ7A 1L5UA 2QXLA 3VGMA 3HM8A 1KD1O 2E88A 5AQNA 1RT7A 3VOVA 4FLYA 3VERA 4DTXA 2A3ZA 1QQOA 3H45C 1S1XA 3O1BA 4M63C 4F9OA 2P5OA 3G25A 2NRRA 2Q1NA 3S41A 4Z4HA 1OH8A 2GX9A 3OW2M 3E9PA 3BGRA 2D5RA 5C42A 3ZSZA 1X3MA 3S3MA 4DFPA 3AVHA 4OPKA 3VEWA 5KPZA 1WAFA 4H0PA 3ZT1A 3BF1A 3P5JA 3VN5A 2YHWA 3SAHA 3VETA 3VQAA 1S22A 3OYFA 4BGBA 3CQYA 4FO0A 2ZQBA 2WOMA 4DSLA 2P9PA 1D9DA 4IG0A 2QWQA 3CJ9A 1VSIA 1BL3A 2KFNA 5SWMA 4M3RA 3T69A 2OYQA 4NYNA 1R59O 4J2EA 2HBJA 4GVMA 1VSJA 4CJLA 3MXMA 1SS6A 3DRSA 1U48A 4KH4A 2OTJN 4CFBA 3ASMA 4OJRA 1JLGA 3LDPA 3VEVA 4YOVA 1NG9A 4KH5A 1U2VB 3JAMO 5KQDA 1IJJA 1SAZA 4OGCA 4CHOA 4JI0K 1S9EA 1IKXA 1G99A 3LAMA 1YJWN 4B9MA 1NGGA 4C8MA 2AA4A 1LWEA 3KLIA 5GIPA 3V9UA 4ELUA 2E4LA 1QSLA 1IKWA 4CCHA 1VK0A 2O4IA 4FJ5A 4JKGA 4GKKK 1WUAA 3JS6A 4G1QA 1GOCA 5E26A 1HX1A 4Z0UA
chains in the Genus database with same CATH topology
1HQUA 1HPZA 5DK5A 3QESA 1SUQA 4KV8A 2BE2A 4RW8A 2XY5A 1FXXA 3M8RA 1NK7A 3ALYA 1A5VA 5KGXA 4W5RA 4DTMA 2YHAA 3ZSYA 2ATQA 3B6OA 4CGJA 4WE1A 2PYJA 3DYAA 4HHTA 4FJGA 3EYZA 3SQ2A 1S1UA 4CFCA 1W9HA 3TAGA 3DM2A 2HVIA 4DG1A 3V4IA 4J2AA 1CLQA 3DLKA 3OVNA 3MAQA 3DRPA 3AVJA 4OGEA 2HHXA 1HNIA 1JLBA 2O4GA 5CY4A 3NGZA 3TABA 4CEBA 1KLNA 3DLBA 3VQQA 1VRTA 2FBVA 4UQGA 3CQ8A 3ZT3A 1Q9YA 1YVUA 4DSEA 4HCBA 4O4GA 3KLGA 3S3NA 1TGOA 4CECA 3O3GA 2G8WA 4M3ZA 5JS1A 4CGIA 4B3OA 1WN7A 4CEEA 5FRNA 4F2RA 2X78A 4CHQA 3ZT0A 1MU2A 3QEPA 3SPZA 4E7KA 1QSSA 2KZZA 3LPUA 3AVKA 1L3UA 2PZSA 1NK9A 1RBVA 1VRUA 4M45A 4CESA 3OYBA 5HROA 5D3GA 4OLAA 1XHXA 3LP3A 4B9VA 1TK5A 4NCAA 4JRPA 3AVCA 1BIUA 5CYMA 4B8CA 4FLXA 2XY7A 3QERA 1RTHA 4KFBA 1KSPA 4FJHA 1A5WA 4CF0A 4ELTA 2YKMA 2OPPA 3SUPA 3L3VA 2QK9A 3AO5A 4CK3A 2GBZA 4OPJA 1ASVA 1WLJA 5J2PA 3KIOA 4ZTFA 3KTQA 3D0PA 1RTJA 2OPRA 1BGXT 2AJQA 4DSIA 2BGGA 3HO1A 3L8BA 1U49A 4DQQA 4M42A 4DWIA 3SNNA 3AA2A 2HVHA 3VA0A 4E7LA 4FZXC 1JLAA 4CJUA 1XI1A 1HYZA 1UAXA 3T19A 4E7IA 1RTDA 4DTSA 4KHNA 3QEIA 1C6VA 4LD0A 4CIEA 3TR8A 4CEDA 1D8YA 1NK4A 3AV9A 4IG3A 4Z4GA 3VA3A 4CGFA 5CZ1A 3HP6A 4FJLA 2Z1IA 1SL1A 1KVBA 1QE1A 4ID1A 3WNEA 4QOZB 1WSIA 3PX0A 3HJFA 4KTZA 3CM6A 2FC0A 1SL0A 1JKHA 5HRPA 5K14A 3VQ8A 4CJPA 2BDPA 2RF2A 4NCGA 3KJVA 3HK2A 1UWBA 3MEGA 3WNHA 3SYZA 1ZBFA 1RDAA 1RT6A 4FLWA 3QINA 2HNZA 5J2NA 3S9HA 1ASUA 1W0HA 1RT1A 4KKOA 3V1QA 1T7PA 1VSFA 4J2DA 2YNGA 1L3SA 4FK2A 1REVA 2OZMA 1RBSA 3ZSRA 1VSMA 3U3YA 3RRHA 1N6QA 3HPOA 3RMDA 4CF1A 2X6NA 4R5PA 3C95A 1IO2A 3K5MA 4RW7A 4BDYA 5KGWA 4DTUA 4E3SA 2IC3A 4EZ6A 4JLHA 3V1OA 3DMJA 1WSGA 5T7BA 4FJMA 4FJXA 1TV6A 3F9KA 4O55A 5HRRA 3HXMA 5KTQA 3VQEA 2B4JA 4N56A 3AVNA 4CHZA 4CJFA 2HHTA 3C94A 1WAJA 4I2PA 1U04A 1HNVA 1TAUA 4PUOA 4CJRA 2P51A 3AVFA 4RW9A 1IG9A 2G8HA 3AVGA 1R0AA 1NJXA 2G8FA 3U3GA 3OYDA 2IS3A 2D0AA 4IFVA 5KRTA 3NGYA 3NH1A 1J53A 3KK2A 3TAPA 4RW6A 1NK8A 1RTIA 4OKEA 3V6DA 1EKEA 5HBMA 3JSMA 4FLVA 1TK0A 1ZBHA 4DU4A 4DFMA 3OS0A 4DFJA 3G10A 1SKSA 4KTWA 3O4QA 2A1RA 3PY8A 1JXBA 3KKRA 2VG7A 4RG8A 2Y1JA 4H8KA 4E0DA 4PQUA 3TAEA 4LH5A 1J5OA 4FK4A 1LW2A 2B6AA 3SZ2A 3ZSWA 3QEXA 2X74A 3IAYA 4W5OA 4I7FA 1WSHA 1RILA 3OY9A 2R7YA 4KPYA 1C1AA 4DF8A 4MFBA 4J2BA 4LY7A 3HVTA 3AVMA 4AHTA 1NKCA 4CF9A 4W5TA 4DLGA 3RMAA 3M8QA 3MECA 4IDKA 3NE6A 3JYTA 1I3AA 3L2VA 3SV4A 1KRPA 3OYKA 3SI6A 2F8TA 2KZMA 2XY6A 4FLTA 1RDBA 1SKRA 4DSJA 5HRNA 3FFIA 3ZT2A 2Y1IA 4OKKA 3AA5X 2Z1JA 1TL3A 1BCMA 2HNDA 4K8XA 1UA1A 1RBRA 5HP1A 3NGIA 4B8AB 1TKZA 2HW3A 4DU3A 1NK6A 4FLUA 5DMRA 3DOKA 4KHQA 4CEFA 4Y1DA 2HHVA 4ID5A 5C25A 3K2PA 3OYGA 2IDOA 3LP2A 4O5BA 5JS2A 3SQ4A 1VSDA 3TAQA 4F3OA 1ZBIA 1S1VA 1FKOA 1S6PA 1LAWA 3K59A 1B9FA 4AHSA 4CJQA 1JL2A 3OYHA 1VSKA 4GMJB 1KFSA 4FJIA 3AVIA 1KTQA 1VSEA 3RMCA 3AVBA 3VQBA 1RBUA 4M3YA 2IOCA 3OJUA 3AA4A 2XY8A 1J9AA 3LZIA 4FM1A 2QKKA 2ZE2A 4B9TA 1CZBA 4M3UA 1BQNA 1EETA 2F96A 5FROA 3VQ7A 2OA8A 2PY5A 1BISA 2P5GA 1FK9A 4AHUA 4DMNA 3AO4A 4C8LA 1BI4A 4O0JA 3NH2A 3LZJA 2BANA 3I8DA 1T05A 2FBTA 4DFKA 4QAGA 4CERA 4OVLA 4CJWA 1NK5A 1L3TA 4F4KA 4CJVA 1Q8IA 2DTUA 3OYIA 4KHWA 4FJ7A 2YNHA 3I0RA 2LSNA 3LP0A 1BIZA 3S3OA 4ELVA 4AH9A 4DTRA 3NFAA 3HSTB 3U6FA 3AA3A 4I9LA 4E89A 3OYAA 4FCYA 1ZBUA 1GOBA 2G8VA 1NOYA 3KK3A 5FDLA 1ZBLA 4DLEA 4CF8A 3ZSVA 3PV8A 3AVLA 4W5NA 1U47A 2YNIA 3E01A 3NF8A 4FK0A 3KD5E 3OYLA 3HM9A 3QEWA 3OYNA 4Z4IA 1TAQA 3V9ZA 2HB5A 2KW4A 1S5JA 4HTUA 3LP1A 4HVJA 3QNNA 4CIGA 3KD1E 2VG5A 4KHUA 2DFFA 2W42A 3LPTA 1S9GA 4DTPA 3BDPA 3UIQA 1S1WA 3RWUA 4JS5A 1LWFA 2RN2A 1C0TA 1JLCA 3M8PA 3OYCA 4HUEA 4H4MA 4YFUA 4FM0A 4CJSA 3O3HA 4DQIA 3SQ1A 3IG1A 1JLQA 3KKSA 1NKBA 1NKEA 2IGIA 3O3FA 4K8ZA 2F8SA 1CZ9A 1RT5A 4BDPA 3QEVA 4HCCA 1HYVA 3VQ4A 5CZ2A 4Z4CA 3OYJA 2G8KA 3QIPA 3NBPA 1JL1A 2XRIA 4CJ4A 2ZD1A 4CE9A 2DFEA 4CK1A 2G8IA 4B08A 4E1MA 1KVAA 1G15A 2GUIA 2E6LA 2KQ2A 4O0IA 3I0SA 4AHVA 3PX4A 1EP4A 4FJJA 1A5XA 3NAEA 4CIFA 1DTTA 1WNSA 4EP5A 4BWJA 3OYEA 2KTQA 2DY4A 1O1WA 4E7JA 3K5OA 3LAKA 4E1NA 4M3WA 1RCHA 1L3VA 1X1PA 3SUOA 1Q9XA 4KREA 4CJTA 4PWDA 2GV9A 4KRFA 4CEQA 3SV3A 3THVA 2HMIA 3LANA 1YT3A 3MEEA 4B9UA 4CFAA 4BWMA 4DF4A 4C8NA 3VQCA 3KLFA 1QSYA 2Z1GA 3LALA 4AHCA 2WONA 3ZSXA 4DQSA 2NUBA 1D9FA 3DRRA 1IKVA 3OJSA 3DLRA 4RW4A 3RTVA 2FBXA 1DLOA 1QS4A 2X6SA 4FJ8A 2EX3A 4FW2A 4FM2A 1C0MA 1JLEA 4YNQA 4BACA 3SCXA 1U45A 4OLBA 4KHYA 4CFDA 1Z25A 4F2SA 2HHQA 3NDKA 4FLZA 4HUFA 3EZ5A 3SQ0A 3K5LA 4BE2A 4AILC 3AVAA 4KO0A 3T1AA 3HT3A 3PO4A 3IRXA 1NK0A 4CHNA 3SPYA 4FJKA 4TSXA 2OPSA 3WNGA 1X9SA 4JS4A 1HMVA 1TKTA 1T8EA 5SZTA 1XHZA 3PUFA 1XWLA 3OYMA 3O4NA 2Z1HA 4H4OA 3K57A 1LW0A 1UOCA 4HUGA 3NF9A 1RT3A 3V9SA 2JGUA 4CEOA 1HRHA 1KVCA 4N47A 1C0UA 1B9DA 1TVRA 1RT4A 3DOLA 3OS1A 4DTJA 3TANA 2OZSA 3V9XA 3NF6A 3VQ6A 5E41A 1EXQA 2VWKA 3MXJA 1KCFA 5EU7A 3ZT4A 5I3UA 3MXIA 4M3XA 2P1JA 4KI6A 3CFOA 3RR8A 1I39A 3IS9A 1BCOA 1C1CA 2YV0X 4O44A 4AHRA 4M41A 3TAFA 3L2WA 1WSJA 2HNYA 1TKDA 1SKWA 2PYLA 3V1RA 5FRMA 3AO3A 1BQMA 1NJYA 1LAVA 1WSFA 4EZ9A 2KFZA 4KB1A 4C8OA 1JXEA 1IKYA 1F21A 2E6MA 1YTAA 4KAZA 3DI6A 2YKNA 4KI4A 3C6UA 3T3FA 1QHTA 4DQPA 3NF7A 5HLFA 2XHBA 3HYFA 3TI0A 1X9WA 1NOZA 1YTUA 3K58A 4XIUA 2DFHA 3DLEA 3SUQA 4W5QA 1QTMA 3CG7A 4CHPA 3NHGA 1VSLA 1RDCA 4BE1A 2JLEA 3QO9A 1D5AA 4LH4A 1B92A 1RDDA 4CGHA 4BDZA 4FJ9A 2ITGA 4OKJA 4I2QA 4IBNA 3KLEA 5CYQA 2YNFA 4FYDA 1IH7A 3QNOA 3LDSA 4NYFA 3KLHA 3K5NA 4MQ3A 4B9SA 1NJWA 1QQCA 2IAJA 2RKIA 4E7HA 3L2RA 1U4BA 3V81A 1L5UA 1CXQA 2D0BA 3TAMA 3RMBA 4B9NA 1RT7A 2HHSA 3CFPA 4I9QA 4FLYA 1JLFA 1T03A 3TARA 1ASWA 4DTXA 3RRGA 4FW1A 5KRSA 3HL8A 2RPIA 4DTOA 3LWLA 3A2FA 1Z26A 2QXFA 1RNHA 1S1XA 3ISNC 3WNFA 2B5JA 1NJZA 2P5OA 5J2MA 4Z4HA 4Q5VA 4DQRA 2A1SA 4FZZA 3M8SA 2FBYA 2EHGA 2QKBA 3BGRA 4KHSA 2D5RA 1TL1A 3ZSQA 3AO1A 5C42A 3L2QA 3ZSZA 4N5SA 3HVRA 3S3MA 3OS2A 1XC9A 1RBTA 3AVHA 3P1GA 4OPKA 4DU1A 4DFPA 1CXUA 3QIOA 1VSHA 1WAFA 4KB0A 1J54A 3CYMA 3ULDA 4GW6A 3ZT1A 3P5JA 4CGDA 5C24A 3VN5A 4IFYA 3NH0A 4N76A 2OPQA 1S1TA 4JRQA 3VQPA 1HYSA 3V9WA 4PY5A 3CM5A 4EP4A 3DLGA 4CGGA 1BHLA 4CJ3A 4Z4FA 3H08A 3VQAA 3OYFA 4PA1A 4Z4EA 2ZQBA 2WOMA 4DSLA 3P83D 1D9DA 4DS5A 3ITHA 1TK8A 1SL2A 4FXDA 3VQDA 3DLHA 4IG0A 3ZSOA 3CFRA 4IKFA 1VSIA 1BL3A 2YHBA 4DSFA 4L8RB 3VQ9A 1N5YA 3B6PA 5I42A 2KFNA 1ZYQA 3G0ZA 5SWMA 5KI6A 4KTQA 1SV5A 3HP9A 4M3RA 3PO5A 2OYQA 4NYNA 4FVMA 4J2EA 4GVMA 1VSJA 4CJLA 3PX6A 3KK1A 3F73A 4ZTJA 5J2QA 3C6TA 3EY1A 3MXMA 1K6YA 3MEDA 1RT2A 4NCBA 3DRSA 2ETJA 1U48A 3VQ5A 4Y1CA 4CFBA 5HRSA 3ASMA 4DS4A 4CJEA 3QLHA 4OJRA 4FZYA 1JLGA 3HPGA 4CEZA 3QETA 3HPHA 4CEAA 3L2UA 3L3UA 1EX4A 1ITGA 1S6QA 4CHOA 4M3TA 4OGCA 2G8UA 3NCIA 1S9EA 4N41A 1C1BA 4CK2A 3LWMA 2VWJA 3AO2A 4CF2A 4DTNA 1X9MA 2XO7A 2HHUA 1WSEA 3D45A 1IKXA 4LSLA 4F3TA 1TKXA 4Q0BA 3LAMA 1HQEA 2HHWA 1UA0A 1FKPA 4B9MA 3SUNA 2Q3SA 4C8MA 4CJKA 1LWEA 3KLIA 3V9UA 4ELUA 4E19A 4QCLA 4CHYA 1LWCA 2E4LA 1QSLA 1DTQA 1IKWA 1Y97A 1KLMA 4CCHA 1VK0A 3TWHA 1GOAA 1HJRA 2D0CA 4ZHRA 4LSNA 2I5JA 4CJ5A 3SJJA 4B9LA 4F8RA 1KFDA 5J1EA 3RR7A 1BI4B 4ICLA 4DSKA 4FJ5A 2O4IA 3ZCMA 4G1QA 4FJNA 1GOCA 4BE0A 4C8KA 1LV5A 2VG6A 4Z0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQU A;  1HPZ A;  5DK5 A;  3QES A;  1SUQ A;  4KV8 A;  2BE2 A;  4RW8 A;  2XY5 A;  1FXX A;  3M8R A;  1NK7 A;  3ALY A;  1A5V A;  5KGX A;  4W5R A;  4DTM A;  2YHA A;  3ZSY A;  2ATQ A;  3B6O A;  4CGJ A;  4WE1 A;  2PYJ A;  3DYA A;  4HHT A;  4FJG A;  3EYZ A;  3SQ2 A;  1S1U A;  4CFC A;  1W9H A;  3TAG A;  3DM2 A;  2HVI A;  4DG1 A;  3V4I A;  4J2A A;  1CLQ A;  3DLK A;  3OVN A;  3MAQ A;  3DRP A;  3AVJ A;  4OGE A;  2HHX A;  1HNI A;  1JLB A;  2O4G A;  5CY4 A;  3NGZ A;  3TAB A;  4CEB A;  1KLN A;  3DLB A;  3VQQ A;  1VRT A;  2FBV A;  4UQG A;  3CQ8 A;  3ZT3 A;  1Q9Y A;  1YVU A;  4DSE A;  4HCB A;  4O4G A;  3KLG A;  3S3N A;  1TGO A;  4CEC A;  3O3G A;  2G8W A;  4M3Z A;  5JS1 A;  4CGI A;  4B3O A;  1WN7 A;  4CEE A;  5FRN A;  4F2R A;  2X78 A;  4CHQ A;  3ZT0 A;  1MU2 A;  3QEP A;  3SPZ A;  4E7K A;  1QSS A;  2KZZ A;  3LPU A;  3AVK A;  1L3U A;  2PZS A;  1NK9 A;  1RBV A;  1VRU A;  4M45 A;  4CES A;  3OYB A;  5HRO A;  5D3G A;  4OLA A;  1XHX A;  3LP3 A;  4B9V A;  1TK5 A;  4NCA A;  4JRP A;  3AVC A;  1BIU A;  5CYM A;  4B8C A;  4FLX A;  2XY7 A;  3QER A;  1RTH A;  4KFB A;  1KSP A;  4FJH A;  1A5W A;  4CF0 A;  4ELT A;  2YKM A;  2OPP A;  3SUP A;  3L3V A;  2QK9 A;  3AO5 A;  4CK3 A;  2GBZ A;  4OPJ A;  1ASV A;  1WLJ A;  5J2P A;  3KIO A;  4ZTF A;  3KTQ A;  3D0P A;  1RTJ A;  2OPR A;  1BGX T;  2AJQ A;  4DSI A;  2BGG A;  3HO1 A;  3L8B A;  1U49 A;  4DQQ A;  4M42 A;  4DWI A;  3SNN A;  3AA2 A;  2HVH A;  3VA0 A;  4E7L A;  4FZX C;  1JLA A;  4CJU A;  1XI1 A;  1HYZ A;  1UAX A;  3T19 A;  4E7I A;  1RTD A;  4DTS A;  4KHN A;  3QEI A;  1C6V A;  4LD0 A;  4CIE A;  3TR8 A;  4CED A;  1D8Y A;  1NK4 A;  3AV9 A;  4IG3 A;  4Z4G A;  3VA3 A;  4CGF A;  5CZ1 A;  3HP6 A;  4FJL A;  2Z1I A;  1SL1 A;  1KVB A;  1QE1 A;  4ID1 A;  3WNE A;  4QOZ B;  1WSI A;  3PX0 A;  3HJF A;  4KTZ A;  3CM6 A;  2FC0 A;  1SL0 A;  1JKH A;  5HRP A;  5K14 A;  3VQ8 A;  4CJP A;  2BDP A;  2RF2 A;  4NCG A;  3KJV A;  3HK2 A;  1UWB A;  3MEG A;  3WNH A;  3SYZ A;  1ZBF A;  1RDA A;  1RT6 A;  4FLW A;  3QIN A;  2HNZ A;  5J2N A;  3S9H A;  1ASU A;  1W0H A;  1RT1 A;  4KKO A;  3V1Q A;  1T7P A;  1VSF A;  4J2D A;  2YNG A;  1L3S A;  4FK2 A;  1REV A;  2OZM A;  1RBS A;  3ZSR A;  1VSM A;  3U3Y A;  3RRH A;  1N6Q A;  3HPO A;  3RMD A;  4CF1 A;  2X6N A;  4R5P A;  3C95 A;  1IO2 A;  3K5M A;  4RW7 A;  4BDY A;  5KGW A;  4DTU A;  4E3S A;  2IC3 A;  4EZ6 A;  4JLH A;  3V1O A;  3DMJ A;  1WSG A;  5T7B A;  4FJM A;  4FJX A;  1TV6 A;  3F9K A;  4O55 A;  5HRR A;  3HXM A;  5KTQ A;  3VQE A;  2B4J A;  4N56 A;  3AVN A;  4CHZ A;  4CJF A;  2HHT A;  3C94 A;  1WAJ A;  4I2P A;  1U04 A;  1HNV A;  1TAU A;  4PUO A;  4CJR A;  2P51 A;  3AVF A;  4RW9 A;  1IG9 A;  2G8H A;  3AVG A;  1R0A A;  1NJX A;  2G8F A;  3U3G A;  3OYD A;  2IS3 A;  2D0A A;  4IFV A;  5KRT A;  3NGY A;  3NH1 A;  1J53 A;  3KK2 A;  3TAP A;  4RW6 A;  1NK8 A;  1RTI A;  4OKE A;  3V6D A;  1EKE A;  5HBM A;  3JSM A;  4FLV A;  1TK0 A;  1ZBH A;  4DU4 A;  4DFM A;  3OS0 A;  4DFJ A;  3G10 A;  1SKS A;  4KTW A;  3O4Q A;  2A1R A;  3PY8 A;  1JXB A;  3KKR A;  2VG7 A;  4RG8 A;  2Y1J A;  4H8K A;  4E0D A;  4PQU A;  3TAE A;  4LH5 A;  1J5O A;  4FK4 A;  1LW2 A;  2B6A A;  3SZ2 A;  3ZSW A;  3QEX A;  2X74 A;  3IAY A;  4W5O A;  4I7F A;  1WSH A;  1RIL A;  3OY9 A;  2R7Y A;  4KPY A;  1C1A A;  4DF8 A;  4MFB A;  4J2B A;  4LY7 A;  3HVT A;  3AVM A;  4AHT A;  1NKC A;  4CF9 A;  4W5T A;  4DLG A;  3RMA A;  3M8Q A;  3MEC A;  4IDK A;  3NE6 A;  3JYT A;  1I3A A;  3L2V A;  3SV4 A;  1KRP A;  3OYK A;  3SI6 A;  2F8T A;  2KZM A;  2XY6 A;  4FLT A;  1RDB A;  1SKR A;  4DSJ A;  5HRN A;  3FFI A;  3ZT2 A;  2Y1I A;  4OKK A;  3AA5 X;  2Z1J A;  1TL3 A;  1BCM A;  2HND A;  4K8X A;  1UA1 A;  1RBR A;  5HP1 A;  3NGI A;  4B8A B;  1TKZ A;  2HW3 A;  4DU3 A;  1NK6 A;  4FLU A;  5DMR A;  3DOK A;  4KHQ A;  4CEF A;  4Y1D A;  2HHV A;  4ID5 A;  5C25 A;  3K2P A;  3OYG A;  2IDO A;  3LP2 A;  4O5B A;  5JS2 A;  3SQ4 A;  1VSD A;  3TAQ A;  4F3O A;  1ZBI A;  1S1V A;  1FKO A;  1S6P A;  1LAW A;  3K59 A;  1B9F A;  4AHS A;  4CJQ A;  1JL2 A;  3OYH A;  1VSK A;  4GMJ B;  1KFS A;  4FJI A;  3AVI A;  1KTQ A;  1VSE A;  3RMC A;  3AVB A;  3VQB A;  1RBU A;  4M3Y A;  2IOC A;  3OJU A;  3AA4 A;  2XY8 A;  1J9A A;  3LZI A;  4FM1 A;  2QKK A;  2ZE2 A;  4B9T A;  1CZB A;  4M3U A;  1BQN A;  1EET A;  2F96 A;  5FRO A;  3VQ7 A;  2OA8 A;  2PY5 A;  1BIS A;  2P5G A;  1FK9 A;  4AHU A;  4DMN A;  3AO4 A;  4C8L A;  1BI4 A;  4O0J A;  3NH2 A;  3LZJ A;  2BAN A;  3I8D A;  1T05 A;  2FBT A;  4DFK A;  4QAG A;  4CER A;  4OVL A;  4CJW A;  1NK5 A;  1L3T A;  4F4K A;  4CJV A;  1Q8I A;  2DTU A;  3OYI A;  4KHW A;  4FJ7 A;  2YNH A;  3I0R A;  2LSN A;  3LP0 A;  1BIZ A;  3S3O A;  4ELV A;  4AH9 A;  4DTR A;  3NFA A;  3HST B;  3U6F A;  3AA3 A;  4I9L A;  4E89 A;  3OYA A;  4FCY A;  1ZBU A;  1GOB A;  2G8V A;  1NOY A;  3KK3 A;  5FDL A;  1ZBL A;  4DLE A;  4CF8 A;  3ZSV A;  3PV8 A;  3AVL A;  4W5N A;  1U47 A;  2YNI A;  3E01 A;  3NF8 A;  4FK0 A;  3KD5 E;  3OYL A;  3HM9 A;  3QEW A;  3OYN A;  4Z4I A;  1TAQ A;  3V9Z A;  2HB5 A;  2KW4 A;  1S5J A;  4HTU A;  3LP1 A;  4HVJ A;  3QNN A;  4CIG A;  3KD1 E;  2VG5 A;  4KHU A;  2DFF A;  2W42 A;  3LPT A;  1S9G A;  4DTP A;  3BDP A;  3UIQ A;  1S1W A;  3RWU A;  4JS5 A;  1LWF A;  2RN2 A;  1C0T A;  1JLC A;  3M8P A;  3OYC A;  4HUE A;  4H4M A;  4YFU A;  4FM0 A;  4CJS A;  3O3H A;  4DQI A;  3SQ1 A;  3IG1 A;  1JLQ A;  3KKS A;  1NKB A;  1NKE A;  2IGI A;  3O3F A;  4K8Z A;  2F8S A;  1CZ9 A;  1RT5 A;  4BDP A;  3QEV A;  4HCC A;  1HYV A;  3VQ4 A;  5CZ2 A;  4Z4C A;  3OYJ A;  2G8K A;  3QIP A;  3NBP A;  1JL1 A;  2XRI A;  4CJ4 A;  2ZD1 A;  4CE9 A;  2DFE A;  4CK1 A;  2G8I A;  4B08 A;  4E1M A;  1KVA A;  1G15 A;  2GUI A;  2E6L A;  2KQ2 A;  4O0I A;  3I0S A;  4AHV A;  3PX4 A;  1EP4 A;  4FJJ A;  1A5X A;  3NAE A;  4CIF A;  1DTT A;  1WNS A;  4EP5 A;  4BWJ A;  3OYE A;  2KTQ A;  2DY4 A;  1O1W A;  4E7J A;  3K5O A;  3LAK A;  4E1N A;  4M3W A;  1RCH A;  1L3V A;  1X1P A;  3SUO A;  1Q9X A;  4KRE A;  4CJT A;  4PWD A;  2GV9 A;  4KRF A;  4CEQ A;  3SV3 A;  3THV A;  2HMI A;  3LAN A;  1YT3 A;  3MEE A;  4B9U A;  4CFA A;  4BWM A;  4DF4 A;  4C8N A;  3VQC A;  3KLF A;  1QSY A;  2Z1G A;  3LAL A;  4AHC A;  2WON A;  3ZSX A;  4DQS A;  2NUB A;  1D9F A;  3DRR A;  1IKV A;  3OJS A;  3DLR A;  4RW4 A;  3RTV A;  2FBX A;  1DLO A;  1QS4 A;  2X6S A;  4FJ8 A;  2EX3 A;  4FW2 A;  4FM2 A;  1C0M A;  1JLE A;  4YNQ A;  4BAC A;  3SCX A;  1U45 A;  4OLB A;  4KHY A;  4CFD A;  1Z25 A;  4F2S A;  2HHQ A;  3NDK A;  4FLZ A;  4HUF A;  3EZ5 A;  3SQ0 A;  3K5L A;  4BE2 A;  4AIL C;  3AVA A;  4KO0 A;  3T1A A;  3HT3 A;  3PO4 A;  3IRX A;  1NK0 A;  4CHN A;  3SPY A;  4FJK A;  4TSX A;  2OPS A;  3WNG A;  1X9S A;  4JS4 A;  1HMV A;  1TKT A;  1T8E A;  5SZT A;  1XHZ A;  3PUF A;  1XWL A;  3OYM A;  3O4N A;  2Z1H A;  4H4O A;  3K57 A;  1LW0 A;  1UOC A;  4HUG A;  3NF9 A;  1RT3 A;  3V9S A;  2JGU A;  4CEO A;  1HRH A;  1KVC A;  4N47 A;  1C0U A;  1B9D A;  1TVR A;  1RT4 A;  3DOL A;  3OS1 A;  4DTJ A;  3TAN A;  2OZS A;  3V9X A;  3NF6 A;  3VQ6 A;  5E41 A;  1EXQ A;  2VWK A;  3MXJ A;  1KCF A;  5EU7 A;  3ZT4 A;  5I3U A;  3MXI A;  4M3X A;  2P1J A;  4KI6 A;  3CFO A;  3RR8 A;  1I39 A;  3IS9 A;  1BCO A;  1C1C A;  2YV0 X;  4O44 A;  4AHR A;  4M41 A;  3TAF A;  3L2W A;  1WSJ A;  2HNY A;  1TKD A;  1SKW A;  2PYL A;  3V1R A;  5FRM A;  3AO3 A;  1BQM A;  1NJY A;  1LAV A;  1WSF A;  4EZ9 A;  2KFZ A;  4KB1 A;  4C8O A;  1JXE A;  1IKY A;  1F21 A;  2E6M A;  1YTA A;  4KAZ A;  3DI6 A;  2YKN A;  4KI4 A;  3C6U A;  3T3F A;  1QHT A;  4DQP A;  3NF7 A;  5HLF A;  2XHB A;  3HYF A;  3TI0 A;  1X9W A;  1NOZ A;  1YTU A;  3K58 A;  4XIU A;  2DFH A;  3DLE A;  3SUQ A;  4W5Q A;  1QTM A;  3CG7 A;  4CHP A;  3NHG A;  1VSL A;  1RDC A;  4BE1 A;  2JLE A;  3QO9 A;  1D5A A;  4LH4 A;  1B92 A;  1RDD A;  4CGH A;  4BDZ A;  4FJ9 A;  2ITG A;  4OKJ A;  4I2Q A;  4IBN A;  3KLE A;  5CYQ A;  2YNF A;  4FYD A;  1IH7 A;  3QNO A;  3LDS A;  4NYF A;  3KLH A;  3K5N A;  4MQ3 A;  4B9S A;  1NJW A;  1QQC A;  2IAJ A;  2RKI A;  4E7H A;  3L2R A;  1U4B A;  3V81 A;  1L5U A;  1CXQ A;  2D0B A;  3TAM A;  3RMB A;  4B9N A;  1RT7 A;  2HHS A;  3CFP A;  4I9Q A;  4FLY A;  1JLF A;  1T03 A;  3TAR A;  1ASW A;  4DTX A;  3RRG A;  4FW1 A;  5KRS A;  3HL8 A;  2RPI A;  4DTO A;  3LWL A;  3A2F A;  1Z26 A;  2QXF A;  1RNH A;  1S1X A;  3ISN C;  3WNF A;  2B5J A;  1NJZ A;  2P5O A;  5J2M A;  4Z4H A;  4Q5V A;  4DQR A;  2A1S A;  4FZZ A;  3M8S A;  2FBY A;  2EHG A;  2QKB A;  3BGR A;  4KHS A;  2D5R A;  1TL1 A;  3ZSQ A;  3AO1 A;  5C42 A;  3L2Q A;  3ZSZ A;  4N5S A;  3HVR A;  3S3M A;  3OS2 A;  1XC9 A;  1RBT A;  3AVH A;  3P1G A;  4OPK A;  4DU1 A;  4DFP A;  1CXU A;  3QIO A;  1VSH A;  1WAF A;  4KB0 A;  1J54 A;  3CYM A;  3ULD A;  4GW6 A;  3ZT1 A;  3P5J A;  4CGD A;  5C24 A;  3VN5 A;  4IFY A;  3NH0 A;  4N76 A;  2OPQ A;  1S1T A;  4JRQ A;  3VQP A;  1HYS A;  3V9W A;  4PY5 A;  3CM5 A;  4EP4 A;  3DLG A;  4CGG A;  1BHL A;  4CJ3 A;  4Z4F A;  3H08 A;  3VQA A;  3OYF A;  4PA1 A;  4Z4E A;  2ZQB A;  2WOM A;  4DSL A;  3P83 D;  1D9D A;  4DS5 A;  3ITH A;  1TK8 A;  1SL2 A;  4FXD A;  3VQD A;  3DLH A;  4IG0 A;  3ZSO A;  3CFR A;  4IKF A;  1VSI A;  1BL3 A;  2YHB A;  4DSF A;  4L8R B;  3VQ9 A;  1N5Y A;  3B6P A;  5I42 A;  2KFN A;  1ZYQ A;  3G0Z A;  5SWM A;  5KI6 A;  4KTQ A;  1SV5 A;  3HP9 A;  4M3R A;  3PO5 A;  2OYQ A;  4NYN A;  4FVM A;  4J2E A;  4GVM A;  1VSJ A;  4CJL A;  3PX6 A;  3KK1 A;  3F73 A;  4ZTJ A;  5J2Q A;  3C6T A;  3EY1 A;  3MXM A;  1K6Y A;  3MED A;  1RT2 A;  4NCB A;  3DRS A;  2ETJ A;  1U48 A;  3VQ5 A;  4Y1C A;  4CFB A;  5HRS A;  3ASM A;  4DS4 A;  4CJE A;  3QLH A;  4OJR A;  4FZY A;  1JLG A;  3HPG A;  4CEZ A;  3QET A;  3HPH A;  4CEA A;  3L2U A;  3L3U A;  1EX4 A;  1ITG A;  1S6Q A;  4CHO A;  4M3T A;  4OGC A;  2G8U A;  3NCI A;  1S9E A;  4N41 A;  1C1B A;  4CK2 A;  3LWM A;  2VWJ A;  3AO2 A;  4CF2 A;  4DTN A;  1X9M A;  2XO7 A;  2HHU A;  1WSE A;  3D45 A;  1IKX A;  4LSL A;  4F3T A;  1TKX A;  4Q0B A;  3LAM A;  1HQE A;  2HHW A;  1UA0 A;  1FKP A;  4B9M A;  3SUN A;  2Q3S A;  4C8M A;  4CJK A;  1LWE A;  3KLI A;  3V9U A;  4ELU A;  4E19 A;  4QCL A;  4CHY A;  1LWC A;  2E4L A;  1QSL A;  1DTQ A;  1IKW A;  1Y97 A;  1KLM A;  4CCH A;  1VK0 A;  3TWH A;  1GOA A;  1HJR A;  2D0C A;  4ZHR A;  4LSN A;  2I5J A;  4CJ5 A;  3SJJ A;  4B9L A;  4F8R A;  1KFD A;  5J1E A;  3RR7 A;  1BI4 B;  4ICL A;  4DSK A;  4FJ5 A;  2O4I A;  3ZCM A;  4G1Q A;  4FJN A;  1GOC A;  4BE0 A;  4C8K A;  1LV5 A;  2VG6 A;  4Z0U A; 
#chains in the Genus database with same CATH topology
 1HQU A;  1SUQ A;  5AQZ A;  2FF3 B;  4DTM A;  2ATQ A;  4H0V B;  1KXP A;  3OTO K;  4BRM A;  1VQN N;  4FJG A;  4ISF A;  4CFC A;  2JWL A;  1BU6 O;  4J2A A;  5AQL A;  2O8B A;  3DLK A;  3DRP A;  1HJO A;  2O4G A;  3R3L A;  1KLN A;  3VQQ A;  1VRT A;  1YVU A;  3H1V X;  5JS1 A;  2G8W A;  1MU2 A;  3E66 A;  1QSS A;  3AVK A;  4I6M A;  1YTU A;  1VRU A;  1JJ2 M;  4CES A;  5D3G A;  1EQY A;  3HSC A;  4B9V A;  1VQ6 N;  4FLX A;  3QER A;  4FJH A;  3THY A;  3CCL N;  2UUA K;  3D6R A;  4OPJ A;  1ASV A;  3T1H K;  3L8B A;  4DWI A;  5AQW A;  3MMV A;  2E2O A;  2CGL A;  3LL3 A;  4BGA A;  4B9Q A;  4E7L A;  1JLA A;  3QFP A;  1XI1 A;  3T19 A;  3M5R A;  1V4T A;  1C6V A;  4LD0 A;  3C6A A;  5M1Q A;  5LMN K;  4IG3 A;  4CGF A;  1KVB A;  2UXB K;  3VMF B;  1SL0 A;  1JKH A;  1IBK K;  1KAZ A;  2NLX A;  2GWK A;  5K14 A;  3THW A;  2P9K A;  2BDP A;  5LJW A;  3MN9 A;  3A0I X;  1RDA A;  1RT6 A;  4FLW A;  1OH7 A;  2HNZ A;  5J2N A;  1ASU A;  5AZJ A;  5B8H A;  4FK2 A;  1RBS A;  3U3Y A;  3VEZ A;  1N6Q A;  3HPO A;  3RMD A;  4A2B A;  4R5P A;  1HNX K;  1IO2 A;  5KGW A;  2IC3 A;  3ZLJ A;  4JLH A;  5T7B A;  1WSG A;  4FJX A;  2BUP A;  3FLC O;  1NM1 A;  3AVN A;  3DXK B;  1WAJ A;  1U04 A;  2YHX A;  1VQ4 N;  4GVE A;  1XUP O;  3AVF A;  4RW9 A;  4B1Y B;  4JAX A;  2E5L K;  3AVG A;  1NJX A;  1KAX A;  4JHD B;  3OYD A;  3CI5 A;  3SJH A;  4IFV A;  3NGY A;  1NK8 A;  5A2Q O;  1EKE A;  5HBM A;  3WXL A;  3CME N;  4DU4 A;  4U67 L;  2P9S A;  3TSU A;  4QS8 A;  3ZET B;  3LDL A;  4RG8 A;  4E0D A;  5AQH A;  4FK4 A;  4YDU C;  1LW2 A;  2O8C B;  2B6A A;  3ZSW A;  3QEX A;  4I7F A;  2R7Y A;  4MFB A;  4J2B A;  4BRK A;  1IBM K;  3HVT A;  4DR2 K;  1WOQ A;  3J7Y P;  4AHT A;  1MDU B;  4CF9 A;  3MCA B;  4CZH A;  4DLG A;  3RMA A;  2KLA A;  3M8Q A;  4EIA A;  3JYT A;  1I3A A;  2ZJP L;  2F8T A;  2XY6 A;  1ZBS A;  3ZT2 A;  1Z6R A;  3ENH A;  3CHW A;  3AY9 A;  1BCM A;  1RDU A;  4JI6 K;  4B8A B;  4DU3 A;  3DOK A;  4B3R K;  2IDO A;  3TSQ A;  1K73 O;  3TAQ A;  1DEJ A;  1I94 K;  1LAW A;  3K59 A;  3OYH A;  4BRE A;  3P4I A;  2NRX A;  1VSE A;  4WFN L;  4M3Y A;  1TUU A;  3Q7B A;  3AA4 A;  2XY8 A;  3LZI A;  1P8Z A;  1OVY A;  4FM1 A;  3VES A;  4M3U A;  1K8A O;  2F96 A;  2WUS A;  2OA8 A;  2A5X A;  1X3N A;  1BIS A;  1FK9 A;  3C65 A;  1YIT N;  4JYA K;  3AO4 A;  4JEP A;  4C8L A;  1BI4 A;  4JKC A;  2CGK A;  3QIC A;  3LZJ A;  2BAN A;  3C6H A;  2JWK A;  1NK5 A;  1L3T A;  3O08 A;  3OYI A;  3RVC A;  3I0R A;  2LSN A;  4YOW A;  4AH9 A;  3NFA A;  4K25 A;  3HST B;  3U6F A;  3AA3 A;  1ZBU A;  5ADX H;  2G8V A;  4C1N K;  5FDL A;  1QZ5 A;  3Q7C A;  3ZSV A;  3AVL A;  3E01 A;  3ID6 A;  3OYL A;  3QEW A;  4OPA A;  4JKA A;  4LFC K;  4Z4I A;  2KW4 A;  2QW9 A;  4HTL A;  4M7X A;  3IDH A;  1LWF A;  2RN2 A;  4JKH A;  4H4M A;  3W0L A;  3O9S A;  2E2N A;  2IGI A;  3O3F A;  4R79 A;  3TTD A;  2F4V K;  1SZ2 A;  3OYJ A;  3QIP A;  4CE9 A;  1J5E K;  4M7Y A;  4B08 A;  4E1M A;  4CZI A;  4QS7 A;  4DR6 K;  1KVA A;  3I33 A;  2A40 A;  3PX4 A;  1A5X A;  2KTQ A;  3DXM A;  3QBX A;  5JIC A;  3K5O A;  4DHY A;  5GAD P;  1L3V A;  4CJT A;  4PWD A;  2P9L A;  3THV A;  1Q86 O;  1E3M A;  1K8K B;  3P31 A;  3VQC A;  2VQE K;  4EFH A;  3ZSX A;  1IKV A;  4K42 A;  3DLR A;  1OH6 A;  2FBX A;  1QS4 A;  1XQS C;  4FM2 A;  4RTF D;  4CW7 B;  3NDK A;  4KO0 A;  3GG4 A;  3IRX A;  1VQ8 N;  2V7Z A;  4CHN A;  4FJK A;  1OH5 A;  3HOT A;  5BN8 A;  3D7E O;  4MO5 A;  3EZW A;  3O4N A;  3WQT A;  4BRA A;  1TUY A;  3V9S A;  4K41 A;  4CEO A;  1HR0 K;  5AZI A;  3DOL A;  3V9X A;  3ULE A;  3L4Q A;  4B3S K;  4RWT A;  4IO8 A;  5EU7 A;  4WQ4 C;  3KVG A;  5I3U A;  1N36 K;  4KI6 A;  2QWO A;  3TAF A;  5FRM A;  1WSJ A;  2O8D A;  4DV5 K;  3V1R A;  2E6M A;  4DQP A;  3HYF A;  1NOZ A;  2I7N A;  4XIU A;  4W5Q A;  1QTM A;  3CG7 A;  2QWM A;  3NHG A;  4DV3 K;  4BRN A;  1D5A A;  1B92 A;  3KZB A;  2UU9 K;  4OKJ A;  5AQG A;  3FZH A;  3LDS A;  3OBW A;  3GBT A;  3WQU A;  5EY4 A;  5LL6 Z;  4E7H A;  4DUZ K;  3L2R A;  3TTF A;  2D0B A;  4JI2 K;  3RMB A;  5CE3 A;  3VF6 A;  4IFE A;  3RRG A;  4FWQ A;  2QEX N;  3HL8 A;  3SAG A;  1RNH A;  2ZGY A;  3IMX A;  1NJZ A;  4FOI A;  2A1S A;  5AQO A;  1HLU A;  2YHY A;  1TL1 A;  2HBM A;  3J81 O;  3L2Q A;  5AQR A;  1YI2 N;  3QIO A;  3VEO A;  4KB0 A;  3U9D A;  3CYM A;  3ULD A;  4CGD A;  4U7B A;  2OPQ A;  1S1T A;  4JRQ A;  3C0B A;  4YOX A;  3DLG A;  4CBX A;  1BHL A;  1YJN N;  1IV0 A;  1LCU A;  3P83 D;  1GLJ O;  3WXK A;  2ZJR L;  1MWK A;  4DSF A;  4L8R B;  3BF3 A;  5TKW A;  3HP9 A;  3PO5 A;  4IXC A;  4FVM A;  4ZTJ A;  5J2Q A;  3EY1 A;  3MED A;  3UKU A;  3VQ5 A;  1VQK N;  4DS4 A;  4CJE A;  3QLH A;  3EE8 A;  4WFA L;  4M3T A;  1YJ9 N;  3NCI A;  3UKR B;  4CK2 A;  2HHU A;  3SLC A;  2WTU A;  4DTN A;  1NGA A;  3EEQ A;  5BRD A;  2XO7 A;  3ZYY X;  4XH5 A;  1M90 O;  1UA0 A;  2IVO A;  4A61 A;  4CJK A;  4CHY A;  4DR5 K;  5AQJ A;  3TWH A;  3SJJ A;  4LSN A;  4F8R A;  1OKJ A;  1HPM A;  3RR7 A;  4ICL A;  1BA0 A;  5M1F A;  5KPR A;  4BE0 A;  2HHV A;  3LP1 A;  3R1X A;  4BVO A;  4CZE A;  1FXX A;  3M8R A;  5KGX A;  4W5R A;  4BRI A;  4WE1 A;  3J7A P;  4YOY A;  3FZM A;  3EYZ A;  1VQM N;  1BWF O;  3TAG A;  2HVI A;  2IVP A;  3V4I A;  4H5V A;  5AQT A;  2NRV A;  2HHX A;  1JLB A;  4PHT X;  4CEB A;  3CQ8 A;  1Q9Y A;  3HZ6 A;  5EOY A;  4CGI A;  4CEE A;  5FRN A;  3EL2 A;  2X78 A;  4CHQ A;  5BR9 A;  4O8U A;  3QDK A;  4YOU A;  5HRO A;  3OYB A;  3N4P A;  4JRP A;  2XY7 A;  3ZX3 A;  1KSP A;  1JCF A;  1A5W A;  3VEY A;  3L0Q A;  4ELT A;  3SUP A;  4CK3 A;  4DSI A;  3HBT A;  5LMU K;  4M42 A;  3LDO A;  4CBW A;  3AA2 A;  3EKS A;  4FPA A;  4BR2 A;  3CJ7 A;  2FXU A;  4CJU A;  1UAX A;  3DLL L;  1HUX A;  3AV9 A;  3DAW A;  4C1N I;  4Z4G A;  3O8M A;  2Z1I A;  1MWM A;  4BRD A;  4QOZ B;  5BRH A;  5I9E B;  3O80 A;  3VQ8 A;  2VGN A;  4H0X B;  5M1N A;  3SYZ A;  3CJB A;  1QHA A;  4J2D A;  4KKO A;  1W0H A;  1VSF A;  1L3S A;  3ZSR A;  1VSM A;  3CCM N;  3C95 A;  4E3S A;  1YAG A;  1BO5 O;  4EZ6 A;  3V1O A;  1E4G T;  3F9K A;  4O55 A;  5KTQ A;  3VQE A;  4CHZ A;  3W3D A;  4CJF A;  3VF4 A;  4I2P A;  4X65 K;  2QWL A;  4BC3 A;  1IG9 A;  2G8H A;  1R0A A;  3RSE B;  5FPN A;  5ELZ A;  5LY3 A;  5KRT A;  2HMP A;  5HL7 L;  3V6D A;  3JSM A;  4DV0 K;  1TK0 A;  3IFR A;  4FWL A;  4DFM A;  4DFJ A;  4JK8 A;  4KTW A;  2A1R A;  4BRQ A;  4LH5 A;  1MA9 B;  3O9T A;  3K9K A;  3AAP A;  3LDQ A;  1RIL A;  3C7N B;  2W6L A;  3OY9 A;  2NRZ A;  5JVH L;  3ZX0 A;  3PSI A;  1NKC A;  4LF6 K;  3OHR A;  3MEC A;  3FZK A;  3A5L C;  3SI6 A;  4WQ5 C;  1RDB A;  1GLE G;  3U9Z A;  3FFI A;  3HRG A;  2Z1J A;  5F0X A;  5C2D A;  4X66 K;  2ASP A;  4JNE A;  2P9P B;  1TKZ A;  2HW3 A;  4FLU A;  1VQ7 N;  3OYG A;  3LP2 A;  5JS2 A;  2QWR A;  1VSD A;  3SQ4 A;  2V51 B;  1FKO A;  1RDW X;  3VEN A;  4AHS A;  1JL2 A;  1NMN A;  1XNQ K;  3AVI A;  1KTQ A;  1VQL N;  4JI5 K;  3AVB A;  4FWM A;  3KWI A;  2ZJQ L;  2IOC A;  4C23 A;  1RFQ A;  3CCQ N;  4B9T A;  1EET A;  3QBW A;  5FRO A;  3VQ7 A;  4BG8 A;  2PY5 A;  1K9M O;  2VGM A;  2FLO A;  4AHU A;  3ZET A;  2O8C A;  1WB9 A;  4MLH A;  5EVZ A;  1H1V A;  4F4K A;  4CJV A;  1Q8I A;  3EO3 A;  4KHW A;  2YNH A;  3LP0 A;  3SBG A;  2ITM A;  3N4Q A;  3VTH A;  4DB3 A;  3B8A X;  4LF7 K;  4DLE A;  4CF8 A;  2IVN A;  2ASM A;  3GE1 A;  4FK0 A;  3HM9 A;  2FSK A;  4K43 A;  1DGK N;  1S5J A;  4JK7 A;  3QNN A;  4HVJ A;  3CJ1 A;  4CIG A;  3KD1 E;  2VG5 A;  2W42 A;  3AGR A;  1S1W A;  4JS5 A;  4JI1 K;  4HUE A;  1C0T A;  1JLC A;  3CPE A;  4AM7 A;  3OBY A;  3U4L A;  2OAN A;  4FM0 A;  4BR4 A;  3IG1 A;  1JLQ A;  4BRP A;  3KKS A;  5BRF A;  1CZ9 A;  5GAG P;  3GDQ A;  4GV6 A;  5GIN A;  4CJ4 A;  2G8I A;  4CK1 A;  3F2K A;  2W6K A;  1G15 A;  1X9J A;  3I0S A;  4AHV A;  3NAE A;  4EP5 A;  3OYE A;  1O1W A;  2P9U B;  4E1N A;  4Z94 A;  1RCH A;  1X1P A;  2O8F B;  2A6A A;  4KRE A;  4A62 A;  4KRF A;  2P9I B;  4CEQ A;  3SV3 A;  2HMI A;  1YT3 A;  3I56 N;  4JI4 K;  4A57 A;  1QSY A;  3LAL A;  4DQS A;  1D9F A;  2Q97 A;  2PBD A;  4RW4 A;  1QQM A;  4LFA K;  1IG8 A;  3FR0 A;  1JLE A;  3SCX A;  1U45 A;  2H3G X;  4FLZ A;  4HUF A;  3CMA N;  5EX5 A;  3PO4 A;  1NK0 A;  3BEX A;  4TSX A;  2OPS A;  3THY B;  4JS4 A;  1HMV A;  1T8E A;  2E2P A;  3EE9 A;  2FF6 A;  3MWT A;  3M3Z A;  1XWL A;  3OYM A;  1XHZ A;  3D2F B;  4LFB K;  3P39 A;  4JKF A;  4OX9 K;  3LDN A;  4H4O A;  4HUG A;  3NF9 A;  3WEE B;  1RT3 A;  3OS1 A;  5GAE P;  4FOE A;  4QS9 A;  3FZF A;  2VWK A;  1KCF A;  2PFU A;  4M3X A;  2P1J A;  4CI6 A;  5GAH P;  3PSF A;  3IS9 A;  1C1C A;  2YV0 X;  1TKD A;  3CCS N;  2HNY A;  1E4F T;  1BQM A;  3CCE N;  1ATN A;  1JXE A;  4BC5 A;  4A2A A;  1YTA A;  3DI6 A;  2YKN A;  4KI4 A;  3NF7 A;  3H3O B;  2XHB A;  4NXN K;  1X9W A;  2Q31 A;  5C10 A;  2DFH A;  3DLE A;  4E1J A;  4CHP A;  2JLE A;  4WF9 L;  5AZJ B;  4A5B A;  5C12 A;  1RDD A;  4J8F A;  3IUC A;  3QNO A;  4EHT A;  4MQ3 A;  4B9S A;  1NJW A;  1QQC A;  5JLF A;  2RKI A;  3V81 A;  4DV6 K;  2HHS A;  3CFP A;  4I9Q A;  1JLF A;  1T03 A;  3TAR A;  1ASW A;  4FW1 A;  4DTO A;  3A2F A;  1Z26 A;  5BPN A;  2B5J A;  2ZF5 O;  2KKZ A;  5J2M A;  4Q5V A;  4IJA A;  3M8S A;  2FBY A;  2EHG A;  2QKB A;  4NLC A;  5F1X A;  4KHS A;  4FSV A;  3ZSQ A;  3MX2 A;  2HBL A;  4BRO A;  3HOS A;  3HVR A;  1RBT A;  3P1G A;  1CXU A;  2GTD A;  1J54 A;  3FFK B;  5C24 A;  1HYS A;  4N76 A;  3VQP A;  3V9W A;  3CM5 A;  4EP4 A;  4IOX A;  4LF4 K;  4PA1 A;  2NZT A;  2QWN A;  5AFU A;  2FSN A;  3ITH A;  4DS5 A;  1SL2 A;  4OO1 J;  5IT9 O;  2F9T A;  2YHB A;  5I42 A;  3G0Z A;  4KTQ A;  1SV5 A;  1DKG D;  4LF5 K;  5TKY A;  3F73 A;  3C6T A;  3G4S N;  2ETJ A;  4DV4 K;  2FSJ A;  3MN5 A;  5HRS A;  4FZY A;  2NRH A;  3LM9 A;  3HPH A;  1ATR A;  3AGK A;  4NLB A;  3L3U A;  1EX4 A;  1ITG A;  4H5W A;  4IOC L;  1V4S A;  4CD1 A;  1WSE A;  5AQI A;  2HHW A;  1FKP A;  2Q3S A;  3VGK A;  4PKG A;  4QCL A;  3ZEU B;  1LWC A;  1GOA A;  2D0C A;  4XH4 A;  4B9L A;  1KFD A;  4DSK A;  1BI4 B;  1Q18 A;  5CR4 A;  3E9O A;  4C8K A;  1LV5 A;  2VG6 A;  3CET A;  3QES A;  4KV8 A;  2BE2 A;  1QVF M;  3I55 N;  4H0O A;  2XY5 A;  3ALY A;  4BRL A;  5MLC Q;  4DR7 K;  3ZSY A;  3B6O A;  2PYJ A;  4DV7 K;  4JKE A;  2PAV A;  4HHT A;  3SQ2 A;  2UXC K;  4DG1 A;  3OVN A;  3MAQ A;  3AVJ A;  1HNI A;  5CY4 A;  3NGZ A;  4Y0W A;  3DLB A;  3QB0 A;  2FBV A;  1NGB A;  4DSE A;  2D0O A;  4O4G A;  3KLG A;  3S3N A;  5M1K A;  2O8E B;  2D0P A;  4B3O A;  4F2R A;  3FGU A;  4G9Z A;  1BUP A;  3UKR A;  3ZX2 A;  4BRH A;  2PZS A;  1RBV A;  3DXM B;  2I7P A;  1TK5 A;  4NCA A;  1BIU A;  4B8C A;  1RTH A;  4H5R A;  2P9L B;  4CF0 A;  3NMU A;  2QK9 A;  3AO5 A;  2V52 B;  3KIO A;  2BH1 A;  5AQS A;  4ZTF A;  3KTQ A;  5LJV A;  1BGX T;  3HO1 A;  1U49 A;  3SNN A;  2IIR A;  4FZX C;  4DTS A;  4KHN A;  3QEI A;  1GLB G;  4CIE A;  3F5T A;  1D8Y A;  1FJG K;  4H0T B;  4XH1 A;  5JMV A;  3HP6 A;  1SL1 A;  4BVP A;  1QE1 A;  2GEM A;  3H46 O;  1WSI A;  3PX0 A;  3CM6 A;  2FC0 A;  4LF9 K;  5HRP A;  1NGC A;  2RF2 A;  4NCG A;  4CZF A;  3KJV A;  3HK2 A;  3MEG A;  2YCH A;  3WNH A;  2HST A;  1Z05 A;  3QIN A;  1FW6 A;  4JV5 K;  2YNG A;  1REV A;  2OZM A;  4B1Z A;  3RRH A;  3THX A;  2X6N A;  4DTU A;  4RW7 A;  4O8K A;  3L6Q A;  3O5B A;  1T3V A;  3HXM A;  1ZXO A;  4B3M K;  4BR0 A;  3C94 A;  1HNV A;  4PUO A;  4CJR A;  3HI0 A;  2P51 A;  4H5T A;  1J6Z A;  3U3G A;  3VTI A;  2IS3 A;  3KHY A;  1XNR K;  3KK2 A;  3TAP A;  3BP8 A;  4BRC A;  3OS0 A;  3O4Q A;  1QVG M;  5FPD A;  2ZM6 K;  1XC3 A;  1S72 N;  2VG7 A;  1VQ9 N;  2Y1J A;  4PQU A;  1OVQ A;  2ASO A;  3TAE A;  1J5O A;  4B1X B;  3EN9 A;  3SZ2 A;  2HBK A;  3IAY A;  4W5O A;  4X62 K;  1WSH A;  2GEL A;  3CC2 N;  1C1A A;  4DF8 A;  1T6C A;  4NO7 A;  3CF5 L;  3CJA A;  1RGI A;  4DUY K;  2UUC K;  4W5T A;  4IDK A;  4NXM K;  3L2V A;  3SV4 A;  2E8A A;  1KRP A;  2KZM A;  3CXC M;  1YHQ N;  4FLT A;  1SKR A;  2W40 A;  4FWK A;  3ATV A;  5F2R A;  4PKI A;  1NMD A;  3DWL A;  4PL7 A;  2QWP A;  4JN4 A;  5FPM A;  4CD3 A;  4K8X A;  1UA1 A;  4KHQ A;  3J80 O;  1U2V A;  4JI7 K;  3CC4 N;  5C25 A;  4BRG A;  3K2P A;  5C0Y A;  2J4R A;  1S6P A;  2Q2R A;  1KFS A;  2E1Y A;  4FJI A;  3RMC A;  3CCV N;  3VQB A;  1RBU A;  5IWA K;  1YIJ N;  1J9A A;  5AJ3 K;  1WBD A;  3VEX A;  2ZE2 A;  4JI3 K;  3D2E B;  5BN9 A;  3MWP A;  5HOO A;  2P5G A;  4PKH A;  1KAY A;  4HWI A;  4CZL A;  3NH2 A;  3I8D A;  4IEE A;  1T05 A;  4DFK A;  4QAG A;  4DR4 K;  3C7N A;  3ENB A;  4MDA A;  3S3O A;  4BQL A;  4JD2 B;  4I9L A;  4FCY A;  5FLX O;  3KK3 A;  1ZBL A;  4W5N A;  2YNI A;  1HKB A;  3NF8 A;  1NJI O;  2VCP A;  3OYN A;  3V9Z A;  1N33 K;  2HB5 A;  2A41 A;  4HTU A;  3KK7 A;  3TSP A;  2DFF A;  4IDH A;  3L4I A;  3RWU A;  4XEI A;  3M8P A;  3OYC A;  4FXD A;  1NLV A;  3O3H A;  2P9N B;  4CBU A;  1NKB A;  3PIO L;  4K8Z A;  4BDP A;  3VQ4 A;  5CZ2 A;  2XRI A;  2ZD1 A;  4O0I A;  2HHH K;  4FJJ A;  3A8Y A;  4CIF A;  1DTT A;  1WNS A;  4YDU A;  4H5N A;  5C15 A;  4M3W A;  2E20 A;  3EKU A;  1JCE A;  3LAK A;  2DPN A;  2NRT A;  1TYQ B;  4B9U A;  3LAN A;  3SK3 A;  4CFA A;  3SMS A;  4EHU A;  4DF4 A;  1Q81 O;  3E1Y A;  2Z1G A;  2NUB A;  3OJS A;  1JCG A;  3RTV A;  4FJ8 A;  4KHP K;  2EX3 A;  3FZL A;  4FW2 A;  4IEI A;  4YNQ A;  5AQY A;  4CFD A;  1Z25 A;  4F2S A;  3NVK A;  2HHQ A;  3EZ5 A;  2ZGZ A;  4AIL C;  3T1A A;  1GLF O;  1GLC G;  5JLH A;  3WNG A;  1X9S A;  1TKT A;  5SZT A;  3PUF A;  3CJC A;  3M6G A;  2NNW A;  3O4W A;  4YHH K;  3VPZ A;  1UOC A;  2JGU A;  1ZC6 A;  1HRH A;  1KVC A;  4YOT A;  1C0U A;  1B9D A;  4N47 A;  1RT4 A;  4FJL A;  2OZS A;  1VHX A;  3NF6 A;  3M1F A;  3VQ6 A;  1EXQ A;  3P38 A;  1XMO K;  3ZT4 A;  3MXI A;  4FWS A;  1CZA N;  3CFO A;  1I39 A;  5AQV A;  1ESV A;  4MLE A;  4O44 A;  4M41 A;  2PYL A;  1NJY A;  1LAV A;  1WSF A;  3MX5 A;  4EZ9 A;  2KFZ A;  4KB1 A;  4C8O A;  1F21 A;  1VQ5 N;  1Q7Y O;  1QHT A;  3DXK A;  3R8E A;  2P9U A;  1VSL A;  1RDC A;  1WBB A;  2O8F A;  2RHK A;  3QO9 A;  4JHD A;  4LH4 A;  4CGH A;  2P9I A;  2ITG A;  1GLA G;  2Q0R A;  4I2Q A;  4FYD A;  3CQX A;  2YI1 A;  3R6M A;  3KLH A;  3K5N A;  2QTD A;  2BTF A;  3CCR N;  5BPM A;  2OTL N;  1U4B A;  2KHO A;  1CXQ A;  4AF1 A;  3ATU A;  2Q36 A;  3TAM A;  5AQX A;  5DM6 L;  5KRS A;  4BG9 A;  1Y64 A;  2RPI A;  3LWL A;  1XMQ K;  2QXF A;  3ISN C;  3WNF A;  2E2Q A;  1M1K O;  5JVG L;  4DQR A;  4FZZ A;  5AR0 A;  3D2F A;  2YJF A;  4IJN A;  3T1Y K;  3AO1 A;  4N5S A;  3WEE A;  3WXM B;  3OS2 A;  1XC9 A;  4DU1 A;  1VSH A;  1NU0 A;  4JKG B;  4JKD A;  1BA1 A;  4GW6 A;  3ID8 A;  3NH0 A;  4IFY A;  4DQ8 A;  4PY5 A;  4CGG A;  4CJ3 A;  3O6W A;  3H08 A;  5GIO A;  4Z4F A;  4Z4E A;  3H3N O;  5BRE A;  1TK8 A;  1C0F A;  2D1K A;  4MO4 A;  3VQD A;  3DLH A;  1ILY A;  3ZSO A;  3CFR A;  1T44 A;  4IKF A;  3VQ9 A;  1N5Y A;  3B6P A;  1ZYQ A;  5KI6 A;  5KPT A;  4NB4 A;  5CHI A;  3J7Z O;  3PX6 A;  3KK1 A;  2O8B B;  3FE1 A;  1K6Y A;  4NCB A;  1RT2 A;  3CCU N;  3O1W A;  4Y1C A;  3HPG A;  4PL8 A;  4BR9 A;  4CEZ A;  3QET A;  1HNW K;  4CEA A;  4CZM A;  4FVU A;  3L2U A;  4IOA L;  3WUH A;  1S6Q A;  3AAQ A;  2G8U A;  2QM1 A;  4N41 A;  1C1B A;  3LWM A;  2VWJ A;  4BC2 A;  3AO2 A;  4CF2 A;  1X9M A;  4I6M B;  4EAH D;  3NVM A;  4GNI A;  1NWK A;  3D45 A;  1YVN A;  3MN7 A;  4LSL A;  4F3T A;  1N8R O;  1TKX A;  4Q0B A;  4WQ4 A;  1HQE A;  3SUN A;  1NGI A;  3UB5 A;  4E19 A;  5M1P A;  1HKC A;  1DTQ A;  1YUW A;  1Y97 A;  1KLM A;  1HJR A;  4ZHR A;  1KQS M;  2D4W A;  2I5J A;  4CJ5 A;  4KH6 A;  3MDQ A;  5AQP A;  4BR5 A;  5J1E A;  3ZCM A;  3BZK A;  3WXJ A;  4FJN A;  1IBL K;  3MN6 A;  1HPZ A;  5DK5 A;  4X64 K;  3I8B A;  3GL1 A;  2HOE A;  4RW8 A;  1P90 A;  4JK9 A;  4A59 A;  1NK7 A;  1A5V A;  2YHA A;  3PIP L;  2A42 A;  4CGJ A;  3DYA A;  1NGJ A;  1S1U A;  5AQM A;  1W9H A;  4CVN E;  3THW B;  2P9K B;  2WBN A;  3DM2 A;  4CZG A;  1CLQ A;  4WYB A;  4OGE A;  2HF4 A;  1HNZ K;  3TAB A;  2VQF K;  4ILH A;  4RCH A;  2UUB K;  3T7Z A;  1K8K A;  3BZC A;  3ZT3 A;  4UQG A;  4LF8 K;  4HCB A;  1NNE A;  1TGO A;  4CEC A;  3O3G A;  4M3Z A;  3H1Q A;  1WN7 A;  2HF3 A;  3QEP A;  3ZT0 A;  3ENO A;  3SPZ A;  4IWV A;  4E7K A;  2KZZ A;  3LPU A;  1L3U A;  1NK9 A;  4M45 A;  4OLA A;  4FWN A;  1XHX A;  3LP3 A;  4GY2 B;  2NRW A;  3U8X A;  4YY3 K;  1VAZ A;  3AVC A;  5CYM A;  4B1W B;  4KFB A;  4WFB L;  1T6D A;  4DR3 K;  3ZEU A;  2YKM A;  2OPP A;  3L3V A;  3WXI A;  2GBZ A;  5J2P A;  1WLJ A;  5M1O A;  3D0P A;  1RTJ A;  2OPR A;  4FPB A;  2AJQ A;  2P9S B;  2BGG A;  3K9J A;  3O9U A;  4DQQ A;  3CD6 N;  3BUZ B;  1GLD G;  2HVH A;  3VA0 A;  5ADX A;  1HYZ A;  1RTD A;  4E7I A;  3BY5 A;  4DV2 K;  5AQQ A;  3TR8 A;  4CED A;  2CH5 A;  3CCJ N;  1NK4 A;  3VA3 A;  5CZ1 A;  5DM7 L;  4ID1 A;  2CGJ A;  3WNE A;  3HJF A;  4KTZ A;  3QFU A;  3KWG A;  1QZ6 A;  4CJP A;  1NGH A;  5AFU H;  1UWB A;  1ZBF A;  1QQN A;  3OA9 A;  3O9Q A;  4B3T K;  3S9H A;  3V1Q A;  1RT1 A;  1W7A A;  1T7P A;  3PLA A;  4B1V A;  5EXW A;  3DJC A;  4CF1 A;  3K5M A;  4BDY A;  5AQF A;  2O8E A;  3JXU A;  3DMJ A;  4FJM A;  3VF2 A;  1TV6 A;  5HRR A;  3LM2 A;  4N56 A;  2B4J A;  3IKM A;  4H0Y B;  2HHT A;  3MK6 A;  1TAU A;  4BY9 C;  1S3X A;  3R9P A;  4CZK A;  3K0S A;  2G8F A;  2D0A A;  4IO9 L;  3NH1 A;  1J53 A;  1YXQ A;  2CH6 A;  3J8A A;  4RW6 A;  1RTI A;  4OKE A;  1ZBH A;  4FLV A;  5AQK A;  1SKS A;  3G10 A;  4KBO A;  4FWR A;  4BRF A;  3PY8 A;  1JXB A;  3KKR A;  3TTC A;  4H8K A;  2F7T A;  3UE5 A;  2X74 A;  4K0K K;  4JI8 K;  2E1Z A;  1EWR A;  4KPY A;  3CER A;  4LY7 A;  3AVM A;  4V19 S;  3G6E N;  3NE6 A;  3OYK A;  2AP1 A;  4DSJ A;  5HRN A;  2Y1I A;  4IZ9 A;  4OKK A;  3AA5 X;  2YJE A;  3AAR A;  1TL3 A;  2HND A;  1LOT B;  1RBR A;  5HP1 A;  3NGI A;  4GV9 A;  1NK6 A;  5DMR A;  3A5N C;  4CEF A;  4Y1D A;  4ID5 A;  4O5B A;  4F3O A;  1ZBI A;  1S1V A;  1B9F A;  4CJQ A;  1VSK A;  4GMJ B;  4UY8 O;  1NGD A;  1VQO N;  3OJU A;  2QKK A;  2UYT A;  2ZWH A;  1CZB A;  1BQN A;  4AQY K;  4DMN A;  4ILG B;  4O0J A;  4GV3 A;  4H03 B;  1BG3 A;  2FBT A;  2OCE A;  1Q82 O;  4CER A;  4OVL A;  4CJW A;  4L3Q A;  1BDG A;  2DTU A;  5H1S Q;  4FJ7 A;  4ELV A;  1HKG A;  3CPW M;  1BIZ A;  2QI2 A;  4DTR A;  4E89 A;  3OYA A;  1GOB A;  3E9L A;  1NOY A;  4WCE L;  4DKW A;  2QA4 N;  3PV8 A;  4ILJ A;  3SAF A;  4O5F A;  1U47 A;  3KD5 E;  2V7Y A;  5AZI B;  1TAQ A;  3ULE B;  1W97 L;  1GLL O;  4KHU A;  3LPT A;  1S9G A;  4DTP A;  3BDP A;  3UIQ A;  4B9N A;  2EWS A;  4YFU A;  3SMP A;  4CJS A;  1BOT O;  1KC8 O;  5BR8 K;  2WFB A;  3SQ1 A;  4CZJ A;  4DQI A;  2O8D B;  1NKE A;  3F9M A;  5BPL A;  2F8S A;  1RT5 A;  3QEV A;  4HCC A;  1HYV A;  1D4X A;  4GKJ K;  4Z4C A;  1DT9 A;  2G8K A;  3NBP A;  1JL1 A;  2DFE A;  2GUI A;  2E6L A;  2KQ2 A;  3CIP A;  1EP4 A;  3QML A;  2DY4 A;  3GOI A;  3TPQ A;  4OPH A;  4BWJ A;  4MDB A;  4E7J A;  4JKB A;  3SUO A;  1Q9X A;  2GV9 A;  2UXD K;  1N34 K;  3MEE A;  3D2E A;  4LC9 B;  4BWM A;  4C8N A;  1NGE A;  5E84 A;  3KLF A;  4AHC A;  2WON A;  1VQP N;  3DRR A;  3O9R A;  1DLO A;  4BC4 A;  2X6S A;  2GUP A;  5FPE A;  3G71 N;  1C0M A;  4BAC A;  4OLB A;  4KHY A;  3H6E A;  1YF5 L;  1NBW A;  4WQ5 A;  3K5L A;  3SQ0 A;  4BE2 A;  5KQ8 A;  1EO1 A;  3AVA A;  3HT3 A;  2VYP A;  3SPY A;  1NGF A;  4JD2 A;  3MCP A;  4A5A A;  4DV1 K;  1U6Z A;  1EWQ A;  4ISG A;  2Z1H A;  4B1U B;  1C0G A;  4DCH A;  3K57 A;  1LW0 A;  3HTV A;  4YOR A;  3SBT A;  4DR1 K;  2WC9 A;  1TVR A;  4DTJ A;  3TAN A;  2VWB A;  1O13 A;  4FL9 A;  5E41 A;  1ATS A;  3MXJ A;  3RR8 A;  1BCO A;  4AHR A;  3TU5 A;  4BR7 A;  1SKW A;  3L2W A;  2P9N A;  2F9W A;  3AO3 A;  1IKY A;  4ISE A;  2Q0U A;  4AM6 A;  4KAZ A;  4FWO A;  1W2B M;  2RE2 A;  2W41 A;  3C6U A;  3A5O C;  3T3F A;  5HLF A;  4FWP A;  1SQK A;  3TI0 A;  5AQU A;  2GWJ A;  3K58 A;  3SUQ A;  3CC7 N;  4BE1 A;  3WT0 A;  3RSE A;  3UKU B;  4BDZ A;  1TYQ A;  4FJ9 A;  3A5M C;  4IBN A;  5C2F A;  5CYQ A;  2YNF A;  4BQZ A;  1IH7 A;  3KLE A;  3THX B;  4NYF A;  3VGL A;  2IAJ A;  1N32 K;  2YX6 A;  4CJ7 A;  1L5U A;  2QXL A;  3VGM A;  3HM8 A;  1KD1 O;  2E88 A;  5AQN A;  1RT7 A;  3VOV A;  4FLY A;  3VER A;  4DTX A;  2A3Z A;  1QQO A;  3H45 C;  1S1X A;  3O1B A;  4M63 C;  4F9O A;  2P5O A;  3G25 A;  2NRR A;  2Q1N A;  3S41 A;  4Z4H A;  1OH8 A;  2GX9 A;  3OW2 M;  3E9P A;  3BGR A;  2D5R A;  5C42 A;  3ZSZ A;  1X3M A;  3S3M A;  4DFP A;  3AVH A;  4OPK A;  3VEW A;  5KPZ A;  1WAF A;  4H0P A;  3ZT1 A;  3BF1 A;  3P5J A;  3VN5 A;  2YHW A;  3SAH A;  3VET A;  3VQA A;  1S22 A;  3OYF A;  4BGB A;  3CQY A;  4FO0 A;  2ZQB A;  2WOM A;  4DSL A;  2P9P A;  1D9D A;  4IG0 A;  2QWQ A;  3CJ9 A;  1VSI A;  1BL3 A;  2KFN A;  5SWM A;  4M3R A;  3T69 A;  2OYQ A;  4NYN A;  1R59 O;  4J2E A;  2HBJ A;  4GVM A;  1VSJ A;  4CJL A;  3MXM A;  1SS6 A;  3DRS A;  1U48 A;  4KH4 A;  2OTJ N;  4CFB A;  3ASM A;  4OJR A;  1JLG A;  3LDP A;  3VEV A;  4YOV A;  1NG9 A;  4KH5 A;  1U2V B;  3JAM O;  5KQD A;  1IJJ A;  1SAZ A;  4OGC A;  4CHO A;  4JI0 K;  1S9E A;  1IKX A;  1G99 A;  3LAM A;  1YJW N;  4B9M A;  1NGG A;  4C8M A;  2AA4 A;  1LWE A;  3KLI A;  5GIP A;  3V9U A;  4ELU A;  2E4L A;  1QSL A;  1IKW A;  4CCH A;  1VK0 A;  2O4I A;  4FJ5 A;  4JKG A;  4GKK K;  1WUA A;  3JS6 A;  4G1Q A;  1GOC A;  5E26 A;  1HX1 A;  4Z0U A; 
#chains in the Genus database with same CATH homology
 1HQU A;  1HPZ A;  5DK5 A;  3QES A;  1SUQ A;  4KV8 A;  2BE2 A;  4RW8 A;  2XY5 A;  1FXX A;  3M8R A;  1NK7 A;  3ALY A;  1A5V A;  5KGX A;  4W5R A;  4DTM A;  2YHA A;  3ZSY A;  2ATQ A;  3B6O A;  4CGJ A;  4WE1 A;  2PYJ A;  3DYA A;  4HHT A;  4FJG A;  3EYZ A;  3SQ2 A;  1S1U A;  4CFC A;  1W9H A;  3TAG A;  3DM2 A;  2HVI A;  4DG1 A;  3V4I A;  4J2A A;  1CLQ A;  3DLK A;  3OVN A;  3MAQ A;  3DRP A;  3AVJ A;  4OGE A;  2HHX A;  1HNI A;  1JLB A;  2O4G A;  5CY4 A;  3NGZ A;  3TAB A;  4CEB A;  1KLN A;  3DLB A;  3VQQ A;  1VRT A;  2FBV A;  4UQG A;  3CQ8 A;  3ZT3 A;  1Q9Y A;  1YVU A;  4DSE A;  4HCB A;  4O4G A;  3KLG A;  3S3N A;  1TGO A;  4CEC A;  3O3G A;  2G8W A;  4M3Z A;  5JS1 A;  4CGI A;  4B3O A;  1WN7 A;  4CEE A;  5FRN A;  4F2R A;  2X78 A;  4CHQ A;  3ZT0 A;  1MU2 A;  3QEP A;  3SPZ A;  4E7K A;  1QSS A;  2KZZ A;  3LPU A;  3AVK A;  1L3U A;  2PZS A;  1NK9 A;  1RBV A;  1VRU A;  4M45 A;  4CES A;  3OYB A;  5HRO A;  5D3G A;  4OLA A;  1XHX A;  3LP3 A;  4B9V A;  1TK5 A;  4NCA A;  4JRP A;  3AVC A;  1BIU A;  5CYM A;  4B8C A;  4FLX A;  2XY7 A;  3QER A;  1RTH A;  4KFB A;  1KSP A;  4FJH A;  1A5W A;  4CF0 A;  4ELT A;  2YKM A;  2OPP A;  3SUP A;  3L3V A;  2QK9 A;  3AO5 A;  4CK3 A;  2GBZ A;  4OPJ A;  1ASV A;  1WLJ A;  5J2P A;  3KIO A;  4ZTF A;  3KTQ A;  3D0P A;  1RTJ A;  2OPR A;  1BGX T;  2AJQ A;  4DSI A;  2BGG A;  3HO1 A;  3L8B A;  1U49 A;  4DQQ A;  4M42 A;  4DWI A;  3SNN A;  3AA2 A;  2HVH A;  3VA0 A;  4E7L A;  4FZX C;  1JLA A;  4CJU A;  1XI1 A;  1HYZ A;  1UAX A;  3T19 A;  4E7I A;  1RTD A;  4DTS A;  4KHN A;  3QEI A;  1C6V A;  4LD0 A;  4CIE A;  3TR8 A;  4CED A;  1D8Y A;  1NK4 A;  3AV9 A;  4IG3 A;  4Z4G A;  3VA3 A;  4CGF A;  5CZ1 A;  3HP6 A;  4FJL A;  2Z1I A;  1SL1 A;  1KVB A;  1QE1 A;  4ID1 A;  3WNE A;  4QOZ B;  1WSI A;  3PX0 A;  3HJF A;  4KTZ A;  3CM6 A;  2FC0 A;  1SL0 A;  1JKH A;  5HRP A;  5K14 A;  3VQ8 A;  4CJP A;  2BDP A;  2RF2 A;  4NCG A;  3KJV A;  3HK2 A;  1UWB A;  3MEG A;  3WNH A;  3SYZ A;  1ZBF A;  1RDA A;  1RT6 A;  4FLW A;  3QIN A;  2HNZ A;  5J2N A;  3S9H A;  1ASU A;  1W0H A;  1RT1 A;  4KKO A;  3V1Q A;  1T7P A;  1VSF A;  4J2D A;  2YNG A;  1L3S A;  4FK2 A;  1REV A;  2OZM A;  1RBS A;  3ZSR A;  1VSM A;  3U3Y A;  3RRH A;  1N6Q A;  3HPO A;  3RMD A;  4CF1 A;  2X6N A;  4R5P A;  3C95 A;  1IO2 A;  3K5M A;  4RW7 A;  4BDY A;  5KGW A;  4DTU A;  4E3S A;  2IC3 A;  4EZ6 A;  4JLH A;  3V1O A;  3DMJ A;  1WSG A;  5T7B A;  4FJM A;  4FJX A;  1TV6 A;  3F9K A;  4O55 A;  5HRR A;  3HXM A;  5KTQ A;  3VQE A;  2B4J A;  4N56 A;  3AVN A;  4CHZ A;  4CJF A;  2HHT A;  3C94 A;  1WAJ A;  4I2P A;  1U04 A;  1HNV A;  1TAU A;  4PUO A;  4CJR A;  2P51 A;  3AVF A;  4RW9 A;  1IG9 A;  2G8H A;  3AVG A;  1R0A A;  1NJX A;  2G8F A;  3U3G A;  3OYD A;  2IS3 A;  2D0A A;  4IFV A;  5KRT A;  3NGY A;  3NH1 A;  1J53 A;  3KK2 A;  3TAP A;  4RW6 A;  1NK8 A;  1RTI A;  4OKE A;  3V6D A;  1EKE A;  5HBM A;  3JSM A;  4FLV A;  1TK0 A;  1ZBH A;  4DU4 A;  4DFM A;  3OS0 A;  4DFJ A;  3G10 A;  1SKS A;  4KTW A;  3O4Q A;  2A1R A;  3PY8 A;  1JXB A;  3KKR A;  2VG7 A;  4RG8 A;  2Y1J A;  4H8K A;  4E0D A;  4PQU A;  3TAE A;  4LH5 A;  1J5O A;  4FK4 A;  1LW2 A;  2B6A A;  3SZ2 A;  3ZSW A;  3QEX A;  2X74 A;  3IAY A;  4W5O A;  4I7F A;  1WSH A;  1RIL A;  3OY9 A;  2R7Y A;  4KPY A;  1C1A A;  4DF8 A;  4MFB A;  4J2B A;  4LY7 A;  3HVT A;  3AVM A;  4AHT A;  1NKC A;  4CF9 A;  4W5T A;  4DLG A;  3RMA A;  3M8Q A;  3MEC A;  4IDK A;  3NE6 A;  3JYT A;  1I3A A;  3L2V A;  3SV4 A;  1KRP A;  3OYK A;  3SI6 A;  2F8T A;  2KZM A;  2XY6 A;  4FLT A;  1RDB A;  1SKR A;  4DSJ A;  5HRN A;  3FFI A;  3ZT2 A;  2Y1I A;  4OKK A;  3AA5 X;  2Z1J A;  1TL3 A;  1BCM A;  2HND A;  4K8X A;  1UA1 A;  1RBR A;  5HP1 A;  3NGI A;  4B8A B;  1TKZ A;  2HW3 A;  4DU3 A;  1NK6 A;  4FLU A;  5DMR A;  3DOK A;  4KHQ A;  4CEF A;  4Y1D A;  2HHV A;  4ID5 A;  5C25 A;  3K2P A;  3OYG A;  2IDO A;  3LP2 A;  4O5B A;  5JS2 A;  3SQ4 A;  1VSD A;  3TAQ A;  4F3O A;  1ZBI A;  1S1V A;  1FKO A;  1S6P A;  1LAW A;  3K59 A;  1B9F A;  4AHS A;  4CJQ A;  1JL2 A;  3OYH A;  1VSK A;  4GMJ B;  1KFS A;  4FJI A;  3AVI A;  1KTQ A;  1VSE A;  3RMC A;  3AVB A;  3VQB A;  1RBU A;  4M3Y A;  2IOC A;  3OJU A;  3AA4 A;  2XY8 A;  1J9A A;  3LZI A;  4FM1 A;  2QKK A;  2ZE2 A;  4B9T A;  1CZB A;  4M3U A;  1BQN A;  1EET A;  2F96 A;  5FRO A;  3VQ7 A;  2OA8 A;  2PY5 A;  1BIS A;  2P5G A;  1FK9 A;  4AHU A;  4DMN A;  3AO4 A;  4C8L A;  1BI4 A;  4O0J A;  3NH2 A;  3LZJ A;  2BAN A;  3I8D A;  1T05 A;  2FBT A;  4DFK A;  4QAG A;  4CER A;  4OVL A;  4CJW A;  1NK5 A;  1L3T A;  4F4K A;  4CJV A;  1Q8I A;  2DTU A;  3OYI A;  4KHW A;  4FJ7 A;  2YNH A;  3I0R A;  2LSN A;  3LP0 A;  1BIZ A;  3S3O A;  4ELV A;  4AH9 A;  4DTR A;  3NFA A;  3HST B;  3U6F A;  3AA3 A;  4I9L A;  4E89 A;  3OYA A;  4FCY A;  1ZBU A;  1GOB A;  2G8V A;  1NOY A;  3KK3 A;  5FDL A;  1ZBL A;  4DLE A;  4CF8 A;  3ZSV A;  3PV8 A;  3AVL A;  4W5N A;  1U47 A;  2YNI A;  3E01 A;  3NF8 A;  4FK0 A;  3KD5 E;  3OYL A;  3HM9 A;  3QEW A;  3OYN A;  4Z4I A;  1TAQ A;  3V9Z A;  2HB5 A;  2KW4 A;  1S5J A;  4HTU A;  3LP1 A;  4HVJ A;  3QNN A;  4CIG A;  3KD1 E;  2VG5 A;  4KHU A;  2DFF A;  2W42 A;  3LPT A;  1S9G A;  4DTP A;  3BDP A;  3UIQ A;  1S1W A;  3RWU A;  4JS5 A;  1LWF A;  2RN2 A;  1C0T A;  1JLC A;  3M8P A;  3OYC A;  4HUE A;  4H4M A;  4YFU A;  4FM0 A;  4CJS A;  3O3H A;  4DQI A;  3SQ1 A;  3IG1 A;  1JLQ A;  3KKS A;  1NKB A;  1NKE A;  2IGI A;  3O3F A;  4K8Z A;  2F8S A;  1CZ9 A;  1RT5 A;  4BDP A;  3QEV A;  4HCC A;  1HYV A;  3VQ4 A;  5CZ2 A;  4Z4C A;  3OYJ A;  2G8K A;  3QIP A;  3NBP A;  1JL1 A;  2XRI A;  4CJ4 A;  2ZD1 A;  4CE9 A;  2DFE A;  4CK1 A;  2G8I A;  4B08 A;  4E1M A;  1KVA A;  1G15 A;  2GUI A;  2E6L A;  2KQ2 A;  4O0I A;  3I0S A;  4AHV A;  3PX4 A;  1EP4 A;  4FJJ A;  1A5X A;  3NAE A;  4CIF A;  1DTT A;  1WNS A;  4EP5 A;  4BWJ A;  3OYE A;  2KTQ A;  2DY4 A;  1O1W A;  4E7J A;  3K5O A;  3LAK A;  4E1N A;  4M3W A;  1RCH A;  1L3V A;  1X1P A;  3SUO A;  1Q9X A;  4KRE A;  4CJT A;  4PWD A;  2GV9 A;  4KRF A;  4CEQ A;  3SV3 A;  3THV A;  2HMI A;  3LAN A;  1YT3 A;  3MEE A;  4B9U A;  4CFA A;  4BWM A;  4DF4 A;  4C8N A;  3VQC A;  3KLF A;  1QSY A;  2Z1G A;  3LAL A;  4AHC A;  2WON A;  3ZSX A;  4DQS A;  2NUB A;  1D9F A;  3DRR A;  1IKV A;  3OJS A;  3DLR A;  4RW4 A;  3RTV A;  2FBX A;  1DLO A;  1QS4 A;  2X6S A;  4FJ8 A;  2EX3 A;  4FW2 A;  4FM2 A;  1C0M A;  1JLE A;  4YNQ A;  4BAC A;  3SCX A;  1U45 A;  4OLB A;  4KHY A;  4CFD A;  1Z25 A;  4F2S A;  2HHQ A;  3NDK A;  4FLZ A;  4HUF A;  3EZ5 A;  3SQ0 A;  3K5L A;  4BE2 A;  4AIL C;  3AVA A;  4KO0 A;  3T1A A;  3HT3 A;  3PO4 A;  3IRX A;  1NK0 A;  4CHN A;  3SPY A;  4FJK A;  4TSX A;  2OPS A;  3WNG A;  1X9S A;  4JS4 A;  1HMV A;  1TKT A;  1T8E A;  5SZT A;  1XHZ A;  3PUF A;  1XWL A;  3OYM A;  3O4N A;  2Z1H A;  4H4O A;  3K57 A;  1LW0 A;  1UOC A;  4HUG A;  3NF9 A;  1RT3 A;  3V9S A;  2JGU A;  4CEO A;  1HRH A;  1KVC A;  4N47 A;  1C0U A;  1B9D A;  1TVR A;  1RT4 A;  3DOL A;  3OS1 A;  4DTJ A;  3TAN A;  2OZS A;  3V9X A;  3NF6 A;  3VQ6 A;  5E41 A;  1EXQ A;  2VWK A;  3MXJ A;  1KCF A;  5EU7 A;  3ZT4 A;  5I3U A;  3MXI A;  4M3X A;  2P1J A;  4KI6 A;  3CFO A;  3RR8 A;  1I39 A;  3IS9 A;  1BCO A;  1C1C A;  2YV0 X;  4O44 A;  4AHR A;  4M41 A;  3TAF A;  3L2W A;  1WSJ A;  2HNY A;  1TKD A;  1SKW A;  2PYL A;  3V1R A;  5FRM A;  3AO3 A;  1BQM A;  1NJY A;  1LAV A;  1WSF A;  4EZ9 A;  2KFZ A;  4KB1 A;  4C8O A;  1JXE A;  1IKY A;  1F21 A;  2E6M A;  1YTA A;  4KAZ A;  3DI6 A;  2YKN A;  4KI4 A;  3C6U A;  3T3F A;  1QHT A;  4DQP A;  3NF7 A;  5HLF A;  2XHB A;  3HYF A;  3TI0 A;  1X9W A;  1NOZ A;  1YTU A;  3K58 A;  4XIU A;  2DFH A;  3DLE A;  3SUQ A;  4W5Q A;  1QTM A;  3CG7 A;  4CHP A;  3NHG A;  1VSL A;  1RDC A;  4BE1 A;  2JLE A;  3QO9 A;  1D5A A;  4LH4 A;  1B92 A;  1RDD A;  4CGH A;  4BDZ A;  4FJ9 A;  2ITG A;  4OKJ A;  4I2Q A;  4IBN A;  3KLE A;  5CYQ A;  2YNF A;  4FYD A;  1IH7 A;  3QNO A;  3LDS A;  4NYF A;  3KLH A;  3K5N A;  4MQ3 A;  4B9S A;  1NJW A;  1QQC A;  2IAJ A;  2RKI A;  4E7H A;  3L2R A;  1U4B A;  3V81 A;  1L5U A;  1CXQ A;  2D0B A;  3TAM A;  3RMB A;  4B9N A;  1RT7 A;  2HHS A;  3CFP A;  4I9Q A;  4FLY A;  1JLF A;  1T03 A;  3TAR A;  1ASW A;  4DTX A;  3RRG A;  4FW1 A;  5KRS A;  3HL8 A;  2RPI A;  4DTO A;  3LWL A;  3A2F A;  1Z26 A;  2QXF A;  1RNH A;  1S1X A;  3ISN C;  3WNF A;  2B5J A;  1NJZ A;  2P5O A;  5J2M A;  4Z4H A;  4Q5V A;  4DQR A;  2A1S A;  4FZZ A;  3M8S A;  2FBY A;  2EHG A;  2QKB A;  3BGR A;  4KHS A;  2D5R A;  1TL1 A;  3ZSQ A;  3AO1 A;  5C42 A;  3L2Q A;  3ZSZ A;  4N5S A;  3HVR A;  3S3M A;  3OS2 A;  1XC9 A;  1RBT A;  3AVH A;  3P1G A;  4OPK A;  4DU1 A;  4DFP A;  1CXU A;  3QIO A;  1VSH A;  1WAF A;  4KB0 A;  1J54 A;  3CYM A;  3ULD A;  4GW6 A;  3ZT1 A;  3P5J A;  4CGD A;  5C24 A;  3VN5 A;  4IFY A;  3NH0 A;  4N76 A;  2OPQ A;  1S1T A;  4JRQ A;  3VQP A;  1HYS A;  3V9W A;  4PY5 A;  3CM5 A;  4EP4 A;  3DLG A;  4CGG A;  1BHL A;  4CJ3 A;  4Z4F A;  3H08 A;  3VQA A;  3OYF A;  4PA1 A;  4Z4E A;  2ZQB A;  2WOM A;  4DSL A;  3P83 D;  1D9D A;  4DS5 A;  3ITH A;  1TK8 A;  1SL2 A;  4FXD A;  3VQD A;  3DLH A;  4IG0 A;  3ZSO A;  3CFR A;  4IKF A;  1VSI A;  1BL3 A;  2YHB A;  4DSF A;  4L8R B;  3VQ9 A;  1N5Y A;  3B6P A;  5I42 A;  2KFN A;  1ZYQ A;  3G0Z A;  5SWM A;  5KI6 A;  4KTQ A;  1SV5 A;  3HP9 A;  4M3R A;  3PO5 A;  2OYQ A;  4NYN A;  4FVM A;  4J2E A;  4GVM A;  1VSJ A;  4CJL A;  3PX6 A;  3KK1 A;  3F73 A;  4ZTJ A;  5J2Q A;  3C6T A;  3EY1 A;  3MXM A;  1K6Y A;  3MED A;  1RT2 A;  4NCB A;  3DRS A;  2ETJ A;  1U48 A;  3VQ5 A;  4Y1C A;  4CFB A;  5HRS A;  3ASM A;  4DS4 A;  4CJE A;  3QLH A;  4OJR A;  4FZY A;  1JLG A;  3HPG A;  4CEZ A;  3QET A;  3HPH A;  4CEA A;  3L2U A;  3L3U A;  1EX4 A;  1ITG A;  1S6Q A;  4CHO A;  4M3T A;  4OGC A;  2G8U A;  3NCI A;  1S9E A;  4N41 A;  1C1B A;  4CK2 A;  3LWM A;  2VWJ A;  3AO2 A;  4CF2 A;  4DTN A;  1X9M A;  2XO7 A;  2HHU A;  1WSE A;  3D45 A;  1IKX A;  4LSL A;  4F3T A;  1TKX A;  4Q0B A;  3LAM A;  1HQE A;  2HHW A;  1UA0 A;  1FKP A;  4B9M A;  3SUN A;  2Q3S A;  4C8M A;  4CJK A;  1LWE A;  3KLI A;  3V9U A;  4ELU A;  4E19 A;  4QCL A;  4CHY A;  1LWC A;  2E4L A;  1QSL A;  1DTQ A;  1IKW A;  1Y97 A;  1KLM A;  4CCH A;  1VK0 A;  3TWH A;  1GOA A;  1HJR A;  2D0C A;  4ZHR A;  4LSN A;  2I5J A;  4CJ5 A;  3SJJ A;  4B9L A;  4F8R A;  1KFD A;  5J1E A;  3RR7 A;  1BI4 B;  4ICL A;  4DSK A;  4FJ5 A;  2O4I A;  3ZCM A;  4G1Q A;  4FJN A;  1GOC A;  4BE0 A;  4C8K A;  1LV5 A;  2VG6 A;  4Z0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...