2FBTA

Wrn exonuclease
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
196
structure length
196
Chain Sequence
b'HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbtA00
1RDCA 1VSIA 1TK5A 4FXDA 4DG1A 2IC3A 4J2DA 1LAWA 4OKEA 4DTUA 1RT3A 1N6QA 3HPOA 4M3RA 1R0AA 2YKMA 3BGRA 1I3AA 3K5MA 4DTJA 4ZTFA 4FCYA 2BANA 3PX6A 4Q0BA 4KV8A 4Y1DA 3SUNA 3AVHA 1HMVA 3CYMA 3AVBA 4BWMA 4DTXA 1YVUA 1L5UA 1LAVA 2X74A 4KTZA 4CGFA 3QEIA 4UQGA 4DTSA 1CXQA 4CHQA 1SV5A 4DU4A 1XC9A 1L3SA 3KD5E 3VA3A 3QLHA 1TAUA 1VSHA 4BE2A 3PV8A 4CJVA 3ZSOA 4E19A 3OYHA 2YKNA 4FJ8A 4E3SA 4N5SA 4FLZA 3SV4A 1T03A 2O4IA 3OYEA 3K57A 3PO4A 3RRGA 2F8TA 4FJIA 3U3GA 5DMRA 4GW6A 3M8RA 2KZMA 3MXMA 3OS1A 2HHQA 3AVMA 3LPTA 2A1SA 4PWDA 4CJUA 1WN7A 4E7KA 1NJZA 5CZ2A 2IDOA 4YNQA 3K5NA 4DQSA 3EYZA 3PO5A 4KHYA 1HQUA 2W42A 3VQCA 4H4OA 2IS3A 3AVIA 4J2AA 4YFUA 1VK0A 3TWHA 3OYIA 2NUBA 5J2QA 2HHXA 2HHVA 1X9WA 1QHTA 4I9QA 2HVHA 4FJMA 1S6QA 3TABA 3T1AA 1S5JA 4CJTA 1UWBA 3DYAA 2BGGA 3HO1A 4DFJA 4Y1CA 3T19A 4CFAA 3QIPA 1IKYA 1RILA 3KKSA 2Z1IA 4KTQA 1J5OA 4EZ6A 3ZSRA 1BQMA 1EX4A 1GOCA 3V4IA 4ELVA 3SQ1A 1A5XA 4OJRA 1XWLA 2YHAA 1JLCA 3OS2A 2BDPA 2YNIA 3DRRA 1VSJA 3EZ5A 3NGZA 1MU2A 2F8SA 3CFRA 4C8NA 3JSMA 3TARA 1X9SA 3VQ8A 4CJRA 4K8ZA 4CJWA 1WSHA 3ISNC 1BIZA 2FC0A 3L8BA 3RRHA 1L3TA 4RW9A 3AA2A 4DFMA 4FW2A 4Q5VA 3PUFA 4G1QA 3EY1A 1UA1A 1VSMA 1JLGA 2G8WA 3LP1A 1J53A 1TKXA 3HM9A 3TAQA 1CLQA 4HUGA 2PYJA 3WNHA 4M3YA 2D0BA 4KO0A 3K5LA 3DLRA 3NDKA 3DRSA 4FZZA 4M3TA 1TL1A 3AVLA 1RDAA 1NOYA 1BQNA 3K59A 4M3ZA 1KVAA 2DFFA 2Z1HA 4FLYA 4DS4A 2GBZA 4ZHRA 4DTNA 1NK9A 4BE1A 2XY6A 2G8FA 2ATQA 2XHBA 4ID5A 2OPQA 3HJFA 3VQ9A 1C0MA 4KKOA 2PY5A 1ZBIA 3KIOA 4F8RA 4TSXA 1NJYA 1B92A 4DSFA 1ZBLA 3C6TA 3QEXA 1X1PA 3O4QA 4RW6A 4OKJA 5C24A 1U04A 3OYDA 4HHTA 1G15A 4CHOA 4I9LA 4AHTA 5J1EA 1YT3A 3B6PA 2XRIA 3LDSA 2DFHA 5SWMA 3OYNA 3NF7A 3ZSQA 3NAEA 3RR8A 3ITHA 3QERA 1JLBA 5CY4A 3MEDA 4ID1A 1QSSA 1BI4A 3LZIA 1JL2A 3M8QA 3KLHA 3MAQA 3TR8A 2JGUA 2OPPA 4CK2A 3S3NA 4C8MA 2FBYA 5KI6A 1SKWA 3LWLA 1ZBFA 1SL1A 5JS2A 3K2PA 4JS4A 1SL0A 1NK8A 4CEDA 4KHWA 4CEAA 3OYKA 4F2RA 2FBTA 4FJ5A 4DMNA 3AO4A 1EETA 4I7FA 1VRTA 1QE1A 2I5JA 1RTJA 4ICLA 1TK0A 2PZSA 3P83D 3NH0A 4DSLA 3E01A 3ZT3A 1DLOA 1YTAA 4DTRA 3VQ6A 4Z4EA 1W0HA 3QNOA 4DSKA 1XHXA 3RMDA 4PQUA 2B5JA 4CFDA 1HJRA 4DQRA 1QTMA 4E0DA 3MXJA 4M42A 3V1OA 3VQPA 5JS1A 3ASMA 3IS9A 1Q9YA 4BACA 1L3VA 1U47A 4B9LA 3CM5A 1N5YA 3SI6A 4CK3A 3V6DA 3AVCA 3V1QA 1S9GA 1O1WA 1WLJA 3FFIA 2YV0X 3KK3A 3HPGA 3HSTB 4PA1A 4N47A 2HNDA 4MFBA 5HRNA 3OYCA 3VA0A 2E6MA 4NCGA 3M8SA 3QEWA 1HYZA 4RW7A 1T05A 3TANA 3OJSA 1Y97A 4CHYA 3UIQA 3HXMA 4CGGA 3RWUA 4FLVA 1RT2A 3KK1A 2KZZA 4CJ5A 3LWMA 4ELUA 4FM1A 3OYAA 3HPHA 3IAYA 1CZ9A 1YTUA 1S9EA 4H4MA 3LALA 5FDLA 3OYLA 1TKDA 3OJUA 4WE1A 3KLGA 4FLTA 1ITGA 1BCMA 3U3YA 1LWEA 1NK7A 4PUOA 4F3TA 1VSFA 2E6LA 3LP0A 5J2PA 1RBRA 1RBUA 1SUQA 4AHSA 1IO2A 4QOZB 4CJFA 2ZQBA 1RDDA 1U45A 3BDPA 4M3UA 1WAFA 3NH1A 3OY9A 2XY7A 2PYLA 4IBNA 2ETJA 4EP4A 4CF2A 3I8DA 5SZTA 1HYSA 3P1GA 4LH4A 1UA0A 3V9SA 4LSNA 1NOZA 3G0ZA 3NE6A 4EP5A 3M8PA 1L3UA 1RTHA 2HHTA 1ASVA 5FROA 4MQ3A 2QXFA 3ZSWA 1B9FA 1Z26A 4I2QA 4HUFA 4NCBA 1EP4A 1RBSA 3L3UA 3HVRA 4CHZA 4IDKA 4DSEA 3SJJA 4OGCA 3V9WA 2OPSA 3NBPA 2A1RA 4KB1A 4DFPA 3RMBA 1TVRA 3AA4A 3SQ0A 4RW4A 1NK6A 4FJGA 1KVCA 1KFSA 4JRQA 4OPJA 4QAGA 4B9NA 1ZBHA 4HCCA 3ZSXA 5D3GA 1S1UA 3VQEA 3OS0A 3LP2A 5CYMA 3HL8A 3QESA 3VQQA 4FJ7A 1HQEA 4IFVA 4GVMA 3DOLA 4OKKA 4OPKA 3DLBA 4E7IA 2ITGA 1D9FA 3L2RA 1NK5A 4K8XA 5J2NA 4XIUA 4CJ3A 4OGEA 1GOBA 1SKSA 1EXQA 3NF9A 1WSJA 5C25A 4DFKA 1Q9XA 4FK0A 3VN5A 2X6SA 3V81A 3SPYA 1LWCA 3PY8A 1RT5A 3AO1A 3NH2A 1S1XA 2XY5A 4FK4A 3MEGA 3AO2A 4FJXA 3HP9A 3AA3A 3V9XA 3SQ4A 5I42A 4NCAA 5FRMA 2GUIA 3LAMA 4OLAA 3AVKA 1NK4A 5HRRA 3THVA 1KRPA 4AH9A 1BL3A 2KFZA 4DF8A 3QO9A 4CESA 1JKHA 4F4KA 1HRHA 1S6PA 2P5GA 3OYJA 1LV5A 4EZ9A 2DY4A 3IRXA 1B9DA 2LSNA 4O4GA 4AHVA 3ZSVA 4CJLA 3CM6A 2RPIA 4B9VA 1KLNA 2G8HA 2FBXA 5HBMA 2OZMA 3ULDA 1U48A 2EX3A 1BISA 2RKIA 1Z25A 3NFAA 4CF0A 2DTUA 4KHQA 3NHGA 1J54A 1IKVA 4CF1A 1NKCA 4Z4FA 4F2SA 1JXBA 4E89A 4CEBA 3CG7A 1UAXA 2AJQA 4O5BA 3S3MA 1BIUA 3LPUA 3O4NA 1FXXA 3QEVA 1REVA 2P51A 2X78A 1NJXA 2G8KA 4Z4IA 1HYVA 4RW8A 4CGHA 4FW1A 3PX4A 2OA8A 3SCXA 2Z1JA 1T7PA 3L3VA 3IG1A 3DLGA 3AVGA 2E4LA 1S1VA 4W5RA 1KFDA 2JLEA 4M3WA 1JXEA 4B3OA 1RTDA 2D5RA 4AILC 3LP3A 2XY8A 3SUQA 2D0CA 1RNHA 3LANA 1A5WA 4E7LA 3RTVA 4IKFA 2YNGA 4FJKA 3AV9A 4CJ4A 2X6NA 2OYQA 1A5VA 2HHUA 4JRPA 2G8IA 1RDBA 1EKEA 2HNYA 4DQPA 3HT3A 2VG6A 1KTQA 4DTMA 4O55A 2Y1JA 5HP1A 3AVAA 1SL2A 2BE2A 1JLAA 1T8EA 2OZSA 3C95A 1HNIA 1KSPA 1WAJA 3KLIA 4E7HA 1NKEA 1JLQA 1RT6A 2VWKA 5KGWA 4PY5A 1LW2A 1QSYA 1WSEA 3SV3A 4C8KA 1W9HA 1NKBA 4JLHA 3DOKA 3H08A 3QINA 4BDYA 1RT4A 4CE9A 3VQAA 4CJKA 3NF8A 4H8KA 4FJLA 3L2VA 4W5OA 1XHZA 4CF8A 1FKOA 1TKZA 3K58A 3ZT4A 1VSLA 3TAPA 2EHGA 4FLXA 3ZCMA 3D45A 3WNGA 1RBVA 5HRSA 1S1TA 4DU1A 1WSGA 2Q3SA 3G10A 4HVJA 1BI4B 2YNFA 3O3HA 1IKWA 3HP6A 1QS4A 4FVMA 3JYTA 4DLEA 3TAGA 3NCIA 1ASUA 1NJWA 1ZBUA 3O3FA 4Z4CA 4JS5A 1VSDA 2ZD1A 4NYFA 4W5QA 1IKXA 4CJQA 3L2UA 4KI4A 3AVFA 3TAMA 1VSKA 4BWJA 5KRTA 4DTOA 1F21A 4KI6A 3ZT1A 3L2WA 4BDPA 4FJHA 1BHLA 4Z4GA 3SZ2A 4C8LA 3ZT2A 5KRSA 4DLGA 4BE0A 5C42A 4NYNA 2IGIA 4B08A 4FYDA 3ZT0A 3OVNA 3DLHA 1U49A 1DTTA 3RMCA 3WNEA 4KHUA 1Q8IA 4KB0A 4FJ9A 4CFBA 5K14A 3KLFA 1D8YA 2HHWA 3KD1E 4B8CA 5EU7A 3NF6A 1TGOA 2G8UA 2VG7A 5FRNA 3I0RA 1S1WA 1WNSA 2KW4A 1JL1A 2F96A 3F9KA 1LW0A 3DMJA 4LD0A 4I2PA 4AHRA 2DFEA 4CECA 1CZBA 4E1NA 1K6YA 4R5PA 3OYGA 3CQ8A 4IFYA 1TK8A 3QNNA 4J2BA 1CXUA 5I3UA 5CZ1A 4AHCA 4B9UA 3LAKA 3CFPA 3AA5X 4O0JA 3HK2A 1SKRA 3MXIA 1TL3A 1KVBA 3A2FA 4O0IA 4DU3A 4KHSA 3V1RA 4CJPA 4OLBA 1WSIA 3V9ZA 3QETA 3U6FA 5HRPA 4CEEA 1RT1A 4CIFA 5KGXA 1D9DA 4CERA 4B8AB 4W5TA 4FZXC 4LH5A 3KK2A 4KRFA 4LY7A 1IG9A 1D5AA 4Z0UA 4HUEA 3V9UA 4L8RB 3MEEA 3D0PA 4CK1A 3S3OA 3CFOA 1LWFA 4CHNA 1VSEA 3WNFA 2KQ2A 4CJEA 1TAQA 2QKKA 2P5OA 4DS5A 2G8VA 3SUPA 4FZYA 2WONA 3VQ5A 3TAFA 2RN2A 1RTIA 4CJSA 4O44A 1DTQA 3AO3A 4KFBA 5KTQA 1NK0A 1C1AA 3QIOA 1UOCA 5HROA 1ZYQA 4N41A 4CGJA 4CEFA 4DSJA 3AVNA 3B6OA 3C6UA 4RG8A 3VQBA 3S9HA 2R7YA 4B9MA 4M45A 4CGDA 3SUOA 4HCBA 2VG5A 2HW3A 2B6AA 3KLEA 3DRPA 1GOAA 2Z1GA 2O4GA 4GMJB 4E7JA 3OYFA 2HNZA 2IOCA 3P5JA 2RF2A 3VQDA 1RT7A 1I39A 5T7BA 4DF4A 1QSLA 3MECA 1JLEA 4CEZA 4KREA 2HB5A 3AVJA 4DTPA 4W5NA 2GV9A 1WSFA 3SPZA 1C0TA 2QKBA 1KLMA 3LZJA 3SNNA 1X9MA 3SQ2A 3QEPA 4FK2A 2FBVA 1XI1A 3KTQA 4OVLA 4F3OA 4CHPA 1U4BA 3NGYA 4DQIA 3OYMA 4KPYA 2ZE2A 1JLFA 5J2MA 4IG3A 4CEQA 2IAJA 2Y1IA 2HMIA 1C6VA 4FM2A 4N76A 3VQ7A 5DK5A 4FJNA 1BCOA 4IG0A 3ZSYA 4E1MA 1TV6A 4DWIA 3I0SA 3HYFA 3AO5A 1HNVA 2B4JA 4DQQA 4CCHA 3O3GA 1C1BA 3HVTA 4M3XA 3ALYA 3ZSZA 1C0UA 2VWJA 2KTQA 2QK9A 3L2QA 4QCLA 2OPRA 4FLWA 4DSIA 5HLFA 3NGIA 3DI6A 4CFCA 1VRUA 1FK9A 1RCHA 4N56A 3VQ4A 3KJVA 4KHNA 2D0AA 4KAZA 1C1CA 1QQCA 3TAEA 1KCFA 2YHBA 3RMAA 3K5OA 4CEOA 1IH7A 5CYQA 4FJJA 3SYZA 4CIEA 4FM0A 1TKTA 4BDZA 1RBTA 4LSLA 4CGIA 3DLKA 1FKPA 4KTWA 4CIGA 3OYBA 3TI0A 4Z4HA 4B9SA 2KFNA 3T3FA 1ASWA 1J9AA 2WOMA 3C94A 4C8OA 2HVIA 2HHSA 1BGXT 5E41A 4ZTJA 3PX0A 1HPZA 4B9TA 3F73A 3KKRA 3DLEA 4AHUA 4CF9A 4M41A 4HTUA 3DM2A 2XO7A 2P1JA 4ELTA 3RR7A 4J2EA 2YNHA 4FLUA
chains in the Genus database with same CATH superfamily
2PBDA 1VSIA 1TK5A 2ZJRL 4J2DA 4DTUA 2E1ZA 1YXQA 2P9NB 2YKMA 1I3AA 4KV8A 5AQGA 1HMVA 3E9LA 4KH6A 3O8MA 1LAVA 3NVKA 2HOEA 4KTZA 3QEIA 3CCEN 4DU4A 4YDUC 3VA3A 3QLHA 5EX5A 1VSHA 3SMPA 2E5LK 2NNWA 3ZSOA 4CZHA 3O9SA 1NLVA 3RRGA 2D1KA 3BZCA 3M8RA 3ZEUB 3OS1A 3BUZB 5GINA 1WN7A 3FE1A 1DT9A 2IDOA 3K5NA 4DQSA 4JN4A 4JI2K 4BR7A 1HQUA 2W42A 4H4OA 4FO0A 3AVIA 3TWHA 2HHVA 3CCRN 3A8YA 1QHTA 2HVHA 3T1AA 1S5JA 3HTVA 4B1YB 4Y1CA 4EHTA 2P9KB 1GLJO 3MN7A 1HKBA 1N34K 4IXCA 3SQ1A 1XWLA 5GADP 3OS2A 3DRRA 2F8SA 1MU2A 3CFRA 1X9SA 3JSMA 5M1FA 4CJRA 4IOCL 3AAPA 3RRHA 2QWRA 3EE9A 4FW2A 1Q18A 3DXKA 1OH5A 3HM9A 3RVCA 2P9SB 3KWGA 3WNHA 4JKGB 3GBTA 1EWQA 3AVLA 1HPMA 3K59A 2ZGYA 4FVUA 2DFFA 4DS4A 4ZHRA 2EWSA 4YOUA 5AQVA 2ZJPL 1C0MA 4DV1K 3KIOA 3C6HA 3O9TA 3THYB 2A40A 2E88A 3CPEA 1X1PA 3EO3A 5BN8A 1U04A 1N32K 3OYDA 1NNEA 1JCFA 4CHOA 4I9LA 3B6PA 3VPZA 2DFHA 3NAEA 3ZSQA 3ITHA 3QERA 3F5TA 4GY2B 4WQ4A 1JL2A 3KLHA 4DV0K 3MAQA 4CK2A 2FBYA 5KI6A 4BRMA 3H3NO 4BR0A 3VEYA 4H5VA 3K2PA 4JS4A 4CD3A 1NU0A 2WBNA 1NMNA 3A0IX 2FBTA 4I7FA 5BR9A 1RTJA 5F2RA 3P83D 3NH0A 3IMXA 3E01A 3ZT3A 4CBUA 1DLOA 1YTAA 4Z4EA 2E2QA 1U2VB 1VQPN 1XHXA 4PQUA 2B5JA 2A42A 3I56N 4CI6A 1KXPA 3EZWA 3ASMA 1V4TA 4CVNE 4CK3A 3AVCA 3KK3A 2YV0X 4N47A 2HNDA 3VA0A 3H45C 4IFEA 3TANA 4YOXA 3HXMA 4CGGA 2KZZA 3G6EN 3LWMA 3ENOA 3HPHA 3OYLA 3F2KA 4JNEA 2J4RA 1ITGA 4YOYA 1BCMA 2P9KA 3UE5A 3LP0A 3CCQN 2ASMA 5J2PA 1SUQA 4AHSA 2ZQBA 3NH1A 4IBNA 3ZLJA 2ETJA 4CF2A 5SZTA 3P1GA 3T7ZA 1R59O 3V9SA 4JI7K 4EP5A 3M8PA 2GX9A 3ZSWA 2ZF5O 3F9MA 3M3ZA 4I2QA 4B1ZA 3HVRA 4IDKA 3SJJA 3WQUA 4OGCA 3HZ6A 4H5RA 5IT9O 1LCUA 4GV3A 3RMBA 1TVRA 3AA4A 4IOXA 4BR2A 3SQ0A 3CC7N 4OPJA 1ZBHA 4IJNA 5CYMA 3HL8A 3O5BA 4I6MB 4FJ7A 1GLBG 4CZMA 3DLBA 1NK5A 4K8XA 4CZKA 4CJ3A 1SKSA 4K43A 3VN5A 3PY8A 4A5AA 1RT5A 4EHUA 4O8KA 1S1XA 4QS9A 1OVYA 4BGBA 3LAMA 4NLCA 4Z94A 1LV5A 3QFUA 4EZ9A 5AQKA 1B9DA 3M5RA 2RPIA 1KLNA 3GE1A 4NXNK 1NGEA 2FBXA 1M1KO 3H3OB 2EX3A 4KHQA 3MCPA 3SMSA 3NMUA 3CG7A 1OH6A 1KD1O 3S3MA 3LPUA 3O4NA 2P51A 3EN9A 1NJXA 4Z4IA 4O8UA 4CGHA 3GDQA 1T7PA 4WQ4C 3AVGA 2CH6A 1S1VA 2JLEA 1RTDA 3SUQA 5FPDA 4A59A 1KAZA 4L3QA 2Y1JA 2BE2A 1JLAA 3C95A 4E7HA 4GVEA 1QSYA 1W9HA 4JLHA 3DOKA 2FF6A 4XEIA 4FJLA 3PIOL 4JHDB 2ZGZA 4BQZA 4B3SK 3TAPA 2UXDK 3HM8A 3ZCMA 3WNGA 1GLAG 1YF5L 4CZIA 2V7YA 5AQZA 3T69A 4LFAK 1QS4A 3NVMA 1ASUA 4B1XB 4KRFA 4W5QA 4JYAK 1K8KB 4CJQA 3VEXA 2GEMA 1VSKA 5FPNA 1F21A 3ZT1A 3L2WA 1BHLA 4C8LA 4FL9A 3KVGA 4DUYK 5C42A 4K42A 4B08A 3DLHA 4BVOA 4AQYK 1DTTA 4FPAA 3LDPA 3KD1E 3L4IA 3AGRA 2FLOA 5C10A 2KW4A 1JL1A 4KTQA 4AHRA 4E1NA 1CZBA 4M7YA 4IFYA 1TK8A 5I3UA 4AHCA 3AA5X 4PKGA 4H0PA 1TL3A 4KHSA 3CCUN 3C6AA 5HRPA 3LM2A 4CEEA 1D9DA 4NXMK 4CERA 4FZXC 1IG9A 3V9UA 1NGHA 4L8RB 3S3OA 4CHNA 2O8CB 1TAQA 2P5OA 4OX9K 3VQ5A 4CJSA 1DTQA 1NK0A 3WXLA 5KTQA 3CJBA 4CGJA 3C6UA 3VQBA 3LDNA 4GNIA 1YJWN 4HCBA 1HKCA 4A61A 3VMFB 5AJ3K 3DWLA 4GMJB 2IOCA 3VQDA 2RF2A 3PIPL 1I39A 3MECA 3CJ9A 2GV9A 3CQYA 1C0TA 5KPZA 3FZKA 3LZJA 4LF5K 1X9MA 1XI1A 1HLUA 1OH7A 1JLFA 4FOEA 4IG3A 1C6VA 5DK5A 5LMNK 4IG0A 2Q0RA 1BU6O 3MN6A 3VEOA 2O8DB 1C1BA 3C7NA 1MA9B 2O8EB 1C0GA 3ZX0A 3NGIA 4CFCA 4KHNA 1C1CA 3ZX3A 1KCFA 4IDHA 4LSLA 1FKPA 4M63C 4GKKK 2W40A 2WOMA 4C8OA 2HHSA 3TSUA 3PX0A 1HPZA 4J2AA 4CF9A 4J2EA 3DM2A 5FRNA 4BC2A 1RDCA 1LAWA 4OKEA 3VGMA 1N6QA 3HPOA 4M3RA 3K5MA 4DTJA 4FCYA 2BANA 3PX6A 4Q0BA 3O1BA 3CYMA 4BWMA 1L5UA 4DCHA 4IO8A 1NBWA 4DTSA 4B1WB 4X64K 1L3SA 4CJVA 3J7ZO 4E3SA 4N5SA 4FLZA 1FW6A 3K57A 2O8FB 4BRKA 5DMRA 5M1QA 1HNXK 3J81O 3AVMA 2A1SA 3D2EB 3SBGA 4X66K 3I33A 5CZ2A 3D2FB 2NRWA 1VQ4N 3EYZA 3PO5A 1DGKN 1O13A 2WC9A 4KHYA 4WQ5A 5C0YA 4YFUA 2NUBA 3G4SN 3N4QA 1BA1A 5EY4A 2Q0UA 4CJTA 4BRCA 3DYAA 3T1YK 5E84A 4MLHA 4RWTA 4DFJA 4O5FA 4ILGB 3FR0A 4NLBA 1IBMK 1VQ5N 1RDWX 1EX4A 1GOCA 4JI3K 4ELVA 4DV5K 2YNIA 4BC3A 4BRNA 4LC9B 3EZ5A 3NGZA 1RFQA 3TARA 3ENBA 3E9OA 4K8ZA 3L8BA 3ISNC 1L3TA 2FC0A 3E1YA 3P38A 4DR7K 4DFMA 3QDKA 3UKRB 4G1QA 4Q5VA 1UA1A 2G8WA 1TKXA 2O8DA 4HUGA 2VWBA 1HUXA 2BH1A 2CH5A 2D0BA 4KO0A 2UXBK 3DRSA 1XQSC 4JD2A 2AP1A 4FZZA 2HBKA 1RDAA 2UU9K 5ELZA 4JI6K 1KVAA 1NK9A 3O80A 4BE1A 2H3GX 4A2AA 2XHBA 1TYQA 4DV4K 3VQ9A 2IVNA 1BO5O 1ZBIA 4TSXA 1B92A 1Q7YO 4IEEA 4DV6K 3C6TA 2D0PA 3QEXA 3O4QA 1K9MO 5C24A 2E2OA 5BR8K 3CXCM 2Q31A 4AHTA 1YT3A 3LDSA 3MWPA 3OYNA 2HBLA 1DKGD 3MEDA 5FPEA 4JEPA 3M8QA 3TR8A 2JGUA 2OPPA 3S3NA 1YI2N 5BPMA 2VCPA 3S41A 3HOTA 1SL1A 5GIOA 2E2PA 4G9ZA 3OYKA 4FJ5A 1NWKA 5C2DA 4ICLA 4BC5A 1ZXOA 5AQPA 4DSLA 3TSQA 4DTRA 3E9PA 3O1WA 1W0HA 3G71N 3QNOA 3RMDA 4DQRA 1WUAA 3V1OA 2GTDA 3VQPA 4K0KK 3VOVA 2CGKA 5JS1A 1Q9YA 1U47A 1U6ZA 1S9GA 1WLJA 3FFIA 3HPGA 3HSTB 4MFBA 4R79A 4NCGA 1HYZA 4RW7A 1Q82O 3MX5A 3OJSA 3RWUA 2ASPA 1RT2A 4CJ5A 3LDOA 4FM1A 3OYAA 1S9EA 4H4MA 5FDLA 4IO9L 3QFPA 4AF1A 3CI5A 4CZEA 1IBKK 3U3YA 1RBUA 1IO2A 1RDDA 3VENA 1U45A 1S3XA 4M3UA 2XY7A 2P9LB 3QB0A 4LSNA 1NOZA 3G0ZA 3NE6A 1L3UA 3CHWA 3CCVN 3QBWA 3BEXA 4A62A 4WQ5C 4HUFA 2P9PA 1RBSA 3CCMN 2Q1NA 3CJCA 4DR2K 1E4GT 3NBPA 2A1RA 4RW4A 4FJGA 3ZYYX 3VTIA 5AQIA 1GLEG 3ZSXA 2UXCK 1S1UA 3VQEA 4LF6K 3LP2A 1BWFO 5IWAK 4B3TK 4OKKA 3WXMB 3G25A 4OPKA 2ZM6K 5AR0A 2FSKA 2RHKA 4YY3K 4AM6A 3L2RA 2VQFK 3SLCA 4OO1J 3AAQA 1KQSM 4DFKA 1Q9XA 1LWCA 3NH2A 3DXMA 4FK4A 3LL3A 3C0BA 3HI0A 4NCAA 1T6DA 3JS6A 3AVKA 1VQKN 5JLHA 4FOIA 1T6CA 4BC4A 3QO9A 4F4KA 1NGJA 3TPQA 1Q81O 1VQLN 2DY4A 4O4GA 4CJLA 4PKIA 4B9VA 2G8HA 5HBMA 4QS7A 3MCAB 5BN9A 1U48A 2RKIA 3D6RA 1IKVA 1NKCA 4F2SA 4E89A 5AQMA 2AJQA 4O5BA 3AGKA 2P9NA 1BIUA 3ENHA 3QEVA 4JI4K 4H0VB 3ZX2A 2G8KA 2A3ZA 1P90A 1HYVA 3SCXA 4DR6K 5LY3A 3DLGA 1QQNA 4W5RA 1KFDA 3DAWA 2FSJA 4NB4A 2XY8A 5AQQA 2D0CA 5KQ8A 3KK7A 1A5WA 4CJ4A 3A5OC 4MO4A 4MO5A 1H1VA 4XH1A 2G8IA 2HNYA 2HF4A 4DQPA 1SQKA 4DTMA 2OZSA 3AVAA 3BY5A 5DM7L 1KSPA 3UKUB 1WAJA 3ZEUA 4H0OA 1JLQA 5KGWA 1LW2A 4KHPK 1QZ6A 1WSEA 3SV3A 2NRVA 1NKBA 1C0FA 3QINA 4KH4A 3K9JA 4CE9A 2VGMA 4CF8A 4V19S 2W41A 4PKHA 2QWNA 3K58A 3ZT4A 3VGKA 1YHQN 2NRXA 2GUPA 3CJ1A 3G10A 1BI4B 3JYTA 4FVMA 3TAGA 3I8BA 4OPAA 4CZLA 3CMAN 4QS8A 5BPNA 5J2QA 4JS5A 1VSDA 2ZD1A 4JKHA 1VHXA 1IKXA 4BR4A 4Y0WA 3D7EO 5KRTA 4BWJA 5FPMA 2QWPA 2YHWA 1HX1A 4JKBA 3JAMO 2NRTA 2IGIA 4FYDA 5JVGL 3RMCA 1Q8IA 4FJ9A 3NF6A 2P9SA 2KLAA 4JKGA 3I0RA 1ZC6A 3QBXA 3WT0A 3EKSA 4AM7A 2NLXA 3TTFA 1KAYA 3F9KA 4BRHA 3SBTA 5H1SQ 5CZ1A 4B9UA 1NGCA 3LAKA 1SKRA 3MXIA 3THYA 1Z6RA 4CJPA 3QETA 5JLFA 1S22A 2IVOA 1NMDA 3J7AP 4DHYA 2UUAK 4Z0UA 3FZFA 2CGJA 3BF1A 2GWJA 1VSEA 4CJEA 2QKKA 4DS5A 3SUPA 2RN2A 2UUBK 5AZIB 4CZGA 3AO3A 3SK3A 4ISEA 1UOCA 5HROA 3TU5A 3RSEB 1ZYQA 2GELA 3AVNA 4B9MA 3S9HA 4DV3K 2QXLA 4DKWA 3KLEA 1YUWA 3DRPA 2YJFA 4JKEA 3OYFA 3GG4A 3IUCA 2PFUA 4DR5K 3FFKB 4DF4A 1JLEA 3IDHA 3MK6A 5TKYA 1U2VA 4KREA 4W5NA 5JICA 3SPZA 3MMVA 4H0TB 4FK2A 3K0SA 4C1NI 4F3OA 2YJEA 3OYMA 4IJAA 5J2MA 3SAGA 3K9KA 1I94K 4FM2A 3THWB 1N36K 1BCOA 5CE3A 3ZSYA 4DWIA 4M3XA 5E26A 2IIRA 2QW9A 3HVTA 4FWNA 3ZSZA 1C0UA 2VWJA 3L2QA 5KPRA 1VQ9N 1FK9A 3KJVA 3VQ4A 2D0AA 4KAZA 2YHBA 3CCLN 3RMAA 3K5OA 5CYQA 4CIGA 1P8ZA 4CGIA 2KFNA 3CETA 1ASWA 1J9AA 3GL1A 2FSNA 3C94A 5CR4A 2HVIA 4OLAA 4H0YB 4AHUA 5AZJB 1XNRK 4H5TA 2P1JA 3RR7A 4FXDA 4DG1A 1RT3A 1R0AA 3BGRA 1YIJN 3VERA 4LF8K 2QWLA 1DEJA 4Y1DA 3OTOK 4DTXA 3FZHA 4I6MA 2X74A 3L0QA 5B8HA 3ID8A 4UQGA 1CXQA 2E20A 1XC9A 3EL2A 3KD5E 3PV8A 1NGIA 4YOTA 5F0XA 4E19A 4FJ8A 3SV4A 1N8RO 3OYEA 3PO4A 4FJIA 2NZTA 2KZMA 1SZ2A 4PWDA 2F9TA 3EE8A 2E1YA 3DJCA 1ZBSA 4B9QA 3OBYA 4YNQA 1ILYA 3VQCA 3MWTA 2A5XA 2JWKA 3ATUA 3TTDA 5AQUA 3BZKA 3ULEB 5AQFA 3OYIA 2P9UB 3P4IA 1BDGA 4I9QA 1S6QA 2Q2RA 3IFRA 5F1XA 3THXB 3VEWA 3R1XA 1SS6A 2BGGA 3QIPA 1IKYA 3KKSA 2Z1IA 2YCHA 1J5OA 4EZ6A 3ZSRA 4LF4K 1BQMA 2KHOA 3V4IA 2BDPA 4OJRA 3MX2A 2YHAA 3Q7CA 4LFBK 2ASOA 1BIZA 2O8BB 4JK9A 4CZFA 1JLGA 3LP1A 1J53A 4BGAA 2ZJQL 1CLQA 4M3YA 3DLRA 3NDKA 4M3TA 4B1UB 1TL1A 2NRRA 5AQYA 1NOYA 1BQNA 5JMVA 4M3ZA 4FLYA 4DTNA 2Z1HA 3HJFA 2V7ZA 3R6MA 3P39A 4JK7A 2FXUA 4EIAA 2PY5A 2F4VK 4DSFA 5HOOA 3VESA 2HBMA 3CIPA 4JHDA 4RW6A 4OKJA 5EVZA 1GLDG 1G15A 4JKFA 3AY9A 3O9UA 5A2QO 2XRIA 5SWMA 2P9IB 5CY4A 4ID1A 4BRDA 1QSSA 5LL6Z 1TUYA 3VF2A 2HHHK 4C8MA 1K8KA 3LWLA 3HRGA 5LJWA 5FLXO 1SL0A 1NK8A 4KHWA 4F2RA 1FJGK 4CZJA 1QE1A 1TK0A 3VQ6A 1NGBA 4DUZK 1EWRA 1JCGA 4DSKA 4CBWA 1HJRA 1VQ7N 4JKDA 3IS9A 4BACA 1N5YA 3V6DA 1O1WA 1QQMA 5HRNA 4PA1A 3OYCA 1T05A 2E6MA 3M8SA 5BPLA 1Y97A 4FLVA 3QICA 4DR4K 1E3MA 4ELUA 2YI1A 1S72N 1CZ9A 1YTUA 3LALA 1TKDA 3PSIA 5AQXA 3I55N 1LWEA 4PUOA 4F3TA 1VSFA 2E6LA 1RBRA 2QEXN 4QOZB 2O8CA 5AFUH 1WAFA 3OY9A 2PYLA 3ID6A 3I8DA 4LH4A 1UA0A 4WYBA 4GV6A 1ASVA 5FROA 2QXFA 2WUSA 5DM6L 1Z26A 1EP4A 3EKUA 4CHZA 4DSEA 4B3MK 3V9WA 3O08A 4KB1A 4DFPA 3BP8A 3SAFA 4CJ7A 4BRGA 4BRPA 1NK6A 4NO7A 1KVCA 1KFSA 4HCCA 1W97L 1HKGA 3OS0A 4YORA 3VQQA 1HQEA 1D9FA 2HF3A 3J8AA 5BRDA 1EXQA 3NF9A 1WSJA 4FK0A 3V81A 3CMEN 2XY5A 3HBTA 1QQOA 4GKJK 2GUIA 2O8EA 3ZETB 5HRRA 4AH9A 1BL3A 2VGNA 4DF8A 3R9PA 1JKHA 4AHVA 4B1VA 3M6GA 1BISA 5BRFA 1Z25A 3NFAA 4CF0A 2DTUA 1GLFO 3NHGA 1J54A 4CF1A 4CEBA 2A41A 4BRLA 1ESVA 4IWVA 1FXXA 1ATRA 1REVA 4BG8A 2X78A 1IBLK 4FW1A 3VEVA 3L3VA 3IG1A 4E1JA 4RCHA 1JXEA 1YAGA 2D5RA 1RNHA 4E7LA 4FJKA 5AQHA 3VTHA 2X6NA 1YVNA 2QWMA 2OYQA 5JVHL 4JRPA 1YJ9N 1EKEA 2VG6A 1KTQA 2O8FA 4O55A 1XMQK 1T8EA 4DV7K 3D2EA 4B3RK 1RT6A 2VWKA 4PY5A 1W2BM 3PLAA 3D2FA 4CBXA 3H08A 4CJKA 3NF8A 4H8KA 4DQ8A 1NGFA 1XHZA 1TKZA 2VQEK 2WFBA 1VSLA 4EAHD 4WF9L 3CJAA 3D45A 1RBVA 2OTLN 3AARA 5HRSA 1S1TA 1WSGA 4X62K 3HP6A 4JAXA 3WEEB 4DR1K 4FWMA 1ZBUA 3FLCO 3O3FA 3CCSN 4JKAA 5M1OA 4DTOA 4FJHA 4PL8A 4X65K 3ZT2A 5KRSA 3A5MC 4DLGA 4BE0A 4HTLA 4NYNA 3ZT0A 3OVNA 3DLLL 4KHUA 3WNEA 4FPBA 4M7XA 3UKRA 4CFBA 5K14A 3KLFA 2HHWA 5EU7A 1TGOA 4ISGA 5LJVA 1S1WA 3ZETA 2UYTA 1YITN 1WNSA 5AQSA 2F96A 1RDUA 1LW0A 4WFBL 1K6YA 3OYGA 3L4QA 5AQWA 1WOQA 3QNNA 2W6KA 1CXUA 1VQMN 3HK2A 4LF7K 5AQTA 1KVBA 4LF9K 4BQLA 5I9EB 3V1RA 4OLBA 1WSIA 3V9ZA 3U6FA 4A57A 3VF6A 2PAVA 1RT1A 5KGXA 4LH5A 4LY7A 2E8AA 1D5AA 3D0PA 4CK1A 3LDLA 1LWFA 4J8FA 2QTDA 2G8VA 4FZYA 2WONA 4YOVA 2D4WA 1C1AA 3QIOA 3T1HK 4CEFA 4DSJA 3CC2N 2R7YA 4M45A 4CGDA 1QHAA 2VG5A 2HW3A 3P31A 1MWMA 1GOAA 2O4GA 4E7JA 3WXIA 2HNZA 3P5JA 5T7BA 3W0LA 1QSLA 2CGLA 3WQTA 4CEZA 2HB5A 1QVFM 1KLMA 1OVQA 1J6ZA 3SNNA 3MN5A 1OKJA 4OVLA 4MDAA 4CHPA 1U4BA 4DQIA 4KPYA 2ZE2A 4CEQA 2IAJA 2HMIA 4N76A 3GOIA 4FJNA 4E1MA 3WUHA 1TV6A 3I0SA 3HYFA 4OPHA 2B4JA 3O9RA 3ALYA 2OPRA 4FLWA 3SAHA 5HLFA 1VRUA 3WEEA 1SAZA 3O9QA 4N56A 3CQXA 1QQCA 4CEOA 2F7TA 1IH7A 1EQYA 3M1FA 3SYZA 1TKTA 2QWQA 4KTWA 2P9LA 3T3FA 1X3MA 2D0OA 5E41A 4ZTJA 3F73A 4ELTA 3U4LA 1BA0A 2IC3A 1IV0A 3C65A 4IEIA 4ZTFA 2V52B 3SUNA 3AVHA 5ADXH 3AVBA 1YVUA 4EFHA 3O4WA 4CGFA 1HR0K 4CHQA 1SV5A 4FSVA 3R8EA 2W6LA 4IOAL 1TAUA 4BE2A 4C23A 5ADXA 2HMPA 1T3VA 3OYHA 2YKNA 1T03A 2O4IA 2I7NA 4ILHA 2F8TA 3U3GA 4GW6A 2QM1A 3BF3A 3MXMA 2HHQA 1G99A 3LPTA 1Y64A 4CJUA 1RGIA 3ATVA 4E7KA 1NJZA 1EO1A 2DPNA 2RE2A 2IS3A 3H46O 4KBOA 1WB9A 1VK0A 5GAGP 2HHXA 1X9WA 3E66A 4FJMA 3TABA 1UWBA 3HO1A 1QZ5A 5C12A 4XH4A 4JI1K 3T19A 4CFAA 1RILA 1K8AO 3N4PA 5MLCQ 3R3LA 1VQ8N 2BTFA 4A2BA 2Q36A 4C1NK 1A5XA 1JLCA 1E4FT 1VSJA 4BRAA 3CD6N 1XNQK 4C8NA 3VQ8A 4CJWA 1WSHA 3UB5A 1NGGA 4RW9A 3AA2A 3EY1A 3PUFA 1VQ6N 1VSMA 5GAHP 3W3DA 3TAQA 2PYJA 4BRFA 3K5LA 2ZWHA 3MDQA 1NGDA 3UKUA 1VQNN 3B8AX 2GBZA 4PL7A 4IZ9A 3OW2M 2XY6A 2G8FA 2ATQA 4ID5A 2E2NA 2OPQA 4KKOA 1HJOA 4F8RA 1NJYA 1ZBLA 3HSCA 3VEZA 4HHTA 3CERA 2ITMA 5J1EA 3NF7A 5TKWA 4DR3K 3RR8A 1JLBA 1Q86O 1BI4A 1YJNN 3LZIA 3WXKA 1SKWA 1ZBFA 5JS2A 4JV5K 4CEDA 2VYPA 4CEAA 2NRZA 4DMNA 3AO4A 1EETA 1VRTA 2A6AA 2I5JA 1QVGM 2PZSA 5C15A 3VF4A 3FGUA 4BG9A 4RTFD 4BRQA 1WBDA 4CFDA 3OA9A 1QTMA 4E0DA 4M42A 3MXJA 1N33K 1T44A 1L3VA 4JKCA 4B9LA 3CM5A 2KKZA 3SI6A 3V1QA 4M3WA 1ATSA 2YX6A 3JXUA 2QA4N 1TUUA 4H5WA 3QEWA 1GLCG 3UIQA 5AQLA 4CHYA 5EOYA 4YOWA 3KK1A 4ISFA 3C7NB 3IAYA 2YHYA 3OJUA 4WE1A 3KLGA 4WFNL 4FLTA 1NK7A 2QI2A 2GWKA 4CJFA 3BDPA 1XC3A 5AZIA 4EP4A 1HYSA 3O6WA 3RSEA 4DB3A 4H5NA 1RTHA 4MQ3A 1B9FA 4NCBA 3L3UA 5BRHA 1XMOK 4BVPA 5AQRA 3U8XA 1ATNA 2OPSA 4JI8K 5M1KA 4PHTX 4B9NA 4JRQA 4QAGA 5KPTA 2I7PA 5D3GA 3QESA 4IFVA 4GVMA 3DOLA 1X3NA 4E7IA 2ITGA 4FWLA 5HL7L 2OCEA 3FZMA 5J2NA 4JK8A 4XIUA 4OGEA 1GOBA 5C25A 3THWA 3MN9A 3SPYA 2X6SA 3AO1A 1K73O 1M90O 1NG9A 3MEGA 2BUPA 3AO2A 4FJXA 3HP9A 3TSPA 3AA3A 3V9XA 3SQ4A 5I42A 5FRMA 1NK4A 2HBJA 3THVA 1KRPA 2KFZA 4CD1A 2WTUA 5LMUK 4FWQA 4CESA 2YHXA 1HRHA 1S6PA 2P5GA 3OYJA 3IKMA 4BR5A 5BREA 3IRXA 2LSNA 3ZSVA 3CM6A 2AA4A 2OZMA 4BREA 3ULDA 1BOTO 1HNWK 3WXJA 5C2FA 2JWLA 5AZJA 3PSFA 4WFAL 4U7BA 4Z4FA 1JXBA 1NM1A 2HSTA 1VAZA 4MLEA 1UAXA 3VGLA 3A5LC 5M1PA 3CCJN 4RW8A 3PX4A 5GIPA 2OA8A 2Z1JA 4ILJA 2E4LA 4JI5K 4B3OA 4AILC 3LP3A 5AQNA 3TTCA 1NGAA 4A5BA 1BG3A 3LANA 4IKFA 3RTVA 2YNGA 3AV9A 4CW7B 1J5EK 4UY8O 1VQON 1A5VA 2HHUA 1RDBA 4JD2B 3HT3A 1SL2A 5HP1A 3OBWA 2HHTA 1OH8A 1HNIA 3CPWM 3KLIA 1NKEA 1W7AA 3CF5L 1TYQB 4K41A 4C8KA 4BDYA 1RT4A 3VETA 3VQAA 3U9ZA 3ULEA 3L2VA 4W5OA 1FKOA 2P9UA 3EEQA 2EHGA 4FLXA 3THXA 4FWKA 4DU1A 2Q3SA 4HVJA 4K25A 3O3HA 1JCEA 2YNFA 4F9OA 1IKWA 4DLEA 4DV2K 3NCIA 1NJWA 4Z4CA 4NYFA 4BY9C 3L2UA 4KI4A 3AVFA 3TAMA 5CHIA 5AQJA 4YDUA 4KI6A 1KC8O 4BDPA 4Z4GA 4FWOA 3Q7BA 3H1QA 3OHRA 1U49A 5AFUA 2O8BA 4KB0A 1D8YA 4B8CA 4GV9A 2G8UA 3J7YP 2VG7A 1WBBA 4XH5A 3U9DA 4LD0A 3SZ2A 4CECA 3DMJA 3KZBA 4I2PA 4LFCK 2DFEA 4R5PA 3QMLA 3CQ8A 1GLLO 1XUPO 3KHYA 4J2BA 5GAEP 1JJ2M 3CFPA 3SJHA 3FZLA 1D4XA 4O0JA 5KQDA 4DU3A 3A2FA 4O0IA 2Q97A 3CC4N 2UUCK 1MWKA 1BUPA 4CIFA 4B8AB 4W5TA 3KK2A 4HUEA 2P9IA 1HNZK 3MEEA 1LOTB 3CFOA 4BROA 4U67L 3WNFA 2KQ2A 3TAFA 3H6EA 1RTIA 4O44A 4KFBA 4N41A 5M1NA 3B6OA 2IVPA 4RG8A 3H1VX 3KWIA 3SUOA 1MDUB 3L6QA 2B6AA 2P9PB 2Z1GA 3J80O 4FWRA 2FF3B 1RT7A 2F9WA 4H03B 1Z05A 4DTPA 3AVJA 1WSFA 3HOSA 2QKBA 4HWIA 3LM9A 5EXWA 2OTJN 3SQ2A 4BRIA 3QEPA 2FBVA 3KTQA 3NGYA 3CJ7A 1V4SA 2Y1IA 3VQ7A 2NRHA 3DXKB 3DXMB 3AO5A 1IG8A 1HNVA 4DQQA 1X9JA 4BR9A 4CCHA 3O3GA 1CZAN 2KTQA 2QK9A 2V51B 4QCLA 1NJIO 4DSIA 3LDQA 3DI6A 4MDBA 1IJJA 4H0XB 1RCHA 3TAEA 4JI0K 4FJJA 5AQOA 4CIEA 4YHHK 4FM0A 4BDZA 1RBTA 4FWPA 4WCEL 3DLKA 3TI0A 3OYBA 2OANA 4Z4HA 4B9SA 1KAXA 1BGXT 3A5NC 2QWOA 4B9TA 3KKRA 3DLEA 4HTUA 4M41A 2XO7A 4KH5A 4FWSA 2YNHA 4FLUA
chains in the Genus database with same CATH topology
1RDCA 1VSIA 1TK5A 4FXDA 4DG1A 2IC3A 4J2DA 1LAWA 4OKEA 4DTUA 1RT3A 1N6QA 3HPOA 4M3RA 1R0AA 2YKMA 3BGRA 1I3AA 3K5MA 4DTJA 4ZTFA 4FCYA 2BANA 3PX6A 4Q0BA 4KV8A 4Y1DA 3SUNA 3AVHA 1HMVA 3CYMA 3AVBA 4BWMA 4DTXA 1YVUA 1L5UA 1LAVA 2X74A 4KTZA 4CGFA 3QEIA 4UQGA 4DTSA 1CXQA 4CHQA 1SV5A 4DU4A 1XC9A 1L3SA 3KD5E 3VA3A 3QLHA 1TAUA 1VSHA 4BE2A 3PV8A 4CJVA 3ZSOA 4E19A 3OYHA 2YKNA 4FJ8A 4E3SA 4N5SA 4FLZA 3SV4A 1T03A 2O4IA 3OYEA 3K57A 3PO4A 3RRGA 2F8TA 4FJIA 3U3GA 5DMRA 4GW6A 3M8RA 2KZMA 3MXMA 3OS1A 2HHQA 3AVMA 3LPTA 2A1SA 4PWDA 4CJUA 1WN7A 4E7KA 1NJZA 5CZ2A 2IDOA 4YNQA 3K5NA 4DQSA 3EYZA 3PO5A 4KHYA 1HQUA 2W42A 3VQCA 4H4OA 2IS3A 3AVIA 4J2AA 4YFUA 1VK0A 3TWHA 3OYIA 2NUBA 5J2QA 2HHXA 2HHVA 1X9WA 1QHTA 4I9QA 2HVHA 4FJMA 1S6QA 3TABA 3T1AA 1S5JA 4CJTA 1UWBA 3DYAA 2BGGA 3HO1A 4DFJA 4Y1CA 3T19A 4CFAA 3QIPA 1IKYA 1RILA 3KKSA 2Z1IA 4KTQA 1J5OA 4EZ6A 3ZSRA 1BQMA 1EX4A 1GOCA 3V4IA 4ELVA 3SQ1A 1A5XA 4OJRA 1XWLA 2YHAA 1JLCA 3OS2A 2BDPA 2YNIA 3DRRA 1VSJA 3EZ5A 3NGZA 1MU2A 2F8SA 3CFRA 4C8NA 3JSMA 3TARA 1X9SA 3VQ8A 4CJRA 4K8ZA 4CJWA 1WSHA 3ISNC 1BIZA 2FC0A 3L8BA 3RRHA 1L3TA 4RW9A 3AA2A 4DFMA 4FW2A 4Q5VA 3PUFA 4G1QA 3EY1A 1UA1A 1VSMA 1JLGA 2G8WA 3LP1A 1J53A 1TKXA 3HM9A 3TAQA 1CLQA 4HUGA 2PYJA 3WNHA 4M3YA 2D0BA 4KO0A 3K5LA 3DLRA 3NDKA 3DRSA 4FZZA 4M3TA 1TL1A 3AVLA 1RDAA 1NOYA 1BQNA 3K59A 4M3ZA 1KVAA 2DFFA 2Z1HA 4FLYA 4DS4A 2GBZA 4ZHRA 4DTNA 1NK9A 4BE1A 2XY6A 2G8FA 2ATQA 2XHBA 4ID5A 2OPQA 3HJFA 3VQ9A 1C0MA 4KKOA 2PY5A 1ZBIA 3KIOA 4F8RA 4TSXA 1NJYA 1B92A 4DSFA 1ZBLA 3C6TA 3QEXA 1X1PA 3O4QA 4RW6A 4OKJA 5C24A 1U04A 3OYDA 4HHTA 1G15A 4CHOA 4I9LA 4AHTA 5J1EA 1YT3A 3B6PA 2XRIA 3LDSA 2DFHA 5SWMA 3OYNA 3NF7A 3ZSQA 3NAEA 3RR8A 3ITHA 3QERA 1JLBA 5CY4A 3MEDA 4ID1A 1QSSA 1BI4A 3LZIA 1JL2A 3M8QA 3KLHA 3MAQA 3TR8A 2JGUA 2OPPA 4CK2A 3S3NA 4C8MA 2FBYA 5KI6A 1SKWA 3LWLA 1ZBFA 1SL1A 5JS2A 3K2PA 4JS4A 1SL0A 1NK8A 4CEDA 4KHWA 4CEAA 3OYKA 4F2RA 2FBTA 4FJ5A 4DMNA 3AO4A 1EETA 4I7FA 1VRTA 1QE1A 2I5JA 1RTJA 4ICLA 1TK0A 2PZSA 3P83D 3NH0A 4DSLA 3E01A 3ZT3A 1DLOA 1YTAA 4DTRA 3VQ6A 4Z4EA 1W0HA 3QNOA 4DSKA 1XHXA 3RMDA 4PQUA 2B5JA 4CFDA 1HJRA 4DQRA 1QTMA 4E0DA 3MXJA 4M42A 3V1OA 3VQPA 5JS1A 3ASMA 3IS9A 1Q9YA 4BACA 1L3VA 1U47A 4B9LA 3CM5A 1N5YA 3SI6A 4CK3A 3V6DA 3AVCA 3V1QA 1S9GA 1O1WA 1WLJA 3FFIA 2YV0X 3KK3A 3HPGA 3HSTB 4PA1A 4N47A 2HNDA 4MFBA 5HRNA 3OYCA 3VA0A 2E6MA 4NCGA 3M8SA 3QEWA 1HYZA 4RW7A 1T05A 3TANA 3OJSA 1Y97A 4CHYA 3UIQA 3HXMA 4CGGA 3RWUA 4FLVA 1RT2A 3KK1A 2KZZA 4CJ5A 3LWMA 4ELUA 4FM1A 3OYAA 3HPHA 3IAYA 1CZ9A 1YTUA 1S9EA 4H4MA 3LALA 5FDLA 3OYLA 1TKDA 3OJUA 4WE1A 3KLGA 4FLTA 1ITGA 1BCMA 3U3YA 1LWEA 1NK7A 4PUOA 4F3TA 1VSFA 2E6LA 3LP0A 5J2PA 1RBRA 1RBUA 1SUQA 4AHSA 1IO2A 4QOZB 4CJFA 2ZQBA 1RDDA 1U45A 3BDPA 4M3UA 1WAFA 3NH1A 3OY9A 2XY7A 2PYLA 4IBNA 2ETJA 4EP4A 4CF2A 3I8DA 5SZTA 1HYSA 3P1GA 4LH4A 1UA0A 3V9SA 4LSNA 1NOZA 3G0ZA 3NE6A 4EP5A 3M8PA 1L3UA 1RTHA 2HHTA 1ASVA 5FROA 4MQ3A 2QXFA 3ZSWA 1B9FA 1Z26A 4I2QA 4HUFA 4NCBA 1EP4A 1RBSA 3L3UA 3HVRA 4CHZA 4IDKA 4DSEA 3SJJA 4OGCA 3V9WA 2OPSA 3NBPA 2A1RA 4KB1A 4DFPA 3RMBA 1TVRA 3AA4A 3SQ0A 4RW4A 1NK6A 4FJGA 1KVCA 1KFSA 4JRQA 4OPJA 4QAGA 4B9NA 1ZBHA 4HCCA 3ZSXA 5D3GA 1S1UA 3VQEA 3OS0A 3LP2A 5CYMA 3HL8A 3QESA 3VQQA 4FJ7A 1HQEA 4IFVA 4GVMA 3DOLA 4OKKA 4OPKA 3DLBA 4E7IA 2ITGA 1D9FA 3L2RA 1NK5A 4K8XA 5J2NA 4XIUA 4CJ3A 4OGEA 1GOBA 1SKSA 1EXQA 3NF9A 1WSJA 5C25A 4DFKA 1Q9XA 4FK0A 3VN5A 2X6SA 3V81A 3SPYA 1LWCA 3PY8A 1RT5A 3AO1A 3NH2A 1S1XA 2XY5A 4FK4A 3MEGA 3AO2A 4FJXA 3HP9A 3AA3A 3V9XA 3SQ4A 5I42A 4NCAA 5FRMA 2GUIA 3LAMA 4OLAA 3AVKA 1NK4A 5HRRA 3THVA 1KRPA 4AH9A 1BL3A 2KFZA 4DF8A 3QO9A 4CESA 1JKHA 4F4KA 1HRHA 1S6PA 2P5GA 3OYJA 1LV5A 4EZ9A 2DY4A 3IRXA 1B9DA 2LSNA 4O4GA 4AHVA 3ZSVA 4CJLA 3CM6A 2RPIA 4B9VA 1KLNA 2G8HA 2FBXA 5HBMA 2OZMA 3ULDA 1U48A 2EX3A 1BISA 2RKIA 1Z25A 3NFAA 4CF0A 2DTUA 4KHQA 3NHGA 1J54A 1IKVA 4CF1A 1NKCA 4Z4FA 4F2SA 1JXBA 4E89A 4CEBA 3CG7A 1UAXA 2AJQA 4O5BA 3S3MA 1BIUA 3LPUA 3O4NA 1FXXA 3QEVA 1REVA 2P51A 2X78A 1NJXA 2G8KA 4Z4IA 1HYVA 4RW8A 4CGHA 4FW1A 3PX4A 2OA8A 3SCXA 2Z1JA 1T7PA 3L3VA 3IG1A 3DLGA 3AVGA 2E4LA 1S1VA 4W5RA 1KFDA 2JLEA 4M3WA 1JXEA 4B3OA 1RTDA 2D5RA 4AILC 3LP3A 2XY8A 3SUQA 2D0CA 1RNHA 3LANA 1A5WA 4E7LA 3RTVA 4IKFA 2YNGA 4FJKA 3AV9A 4CJ4A 2X6NA 2OYQA 1A5VA 2HHUA 4JRPA 2G8IA 1RDBA 1EKEA 2HNYA 4DQPA 3HT3A 2VG6A 1KTQA 4DTMA 4O55A 2Y1JA 5HP1A 3AVAA 1SL2A 2BE2A 1JLAA 1T8EA 2OZSA 3C95A 1HNIA 1KSPA 1WAJA 3KLIA 4E7HA 1NKEA 1JLQA 1RT6A 2VWKA 5KGWA 4PY5A 1LW2A 1QSYA 1WSEA 3SV3A 4C8KA 1W9HA 1NKBA 4JLHA 3DOKA 3H08A 3QINA 4BDYA 1RT4A 4CE9A 3VQAA 4CJKA 3NF8A 4H8KA 4FJLA 3L2VA 4W5OA 1XHZA 4CF8A 1FKOA 1TKZA 3K58A 3ZT4A 1VSLA 3TAPA 2EHGA 4FLXA 3ZCMA 3D45A 3WNGA 1RBVA 5HRSA 1S1TA 4DU1A 1WSGA 2Q3SA 3G10A 4HVJA 1BI4B 2YNFA 3O3HA 1IKWA 3HP6A 1QS4A 4FVMA 3JYTA 4DLEA 3TAGA 3NCIA 1ASUA 1NJWA 1ZBUA 3O3FA 4Z4CA 4JS5A 1VSDA 2ZD1A 4NYFA 4W5QA 1IKXA 4CJQA 3L2UA 4KI4A 3AVFA 3TAMA 1VSKA 4BWJA 5KRTA 4DTOA 1F21A 4KI6A 3ZT1A 3L2WA 4BDPA 4FJHA 1BHLA 4Z4GA 3SZ2A 4C8LA 3ZT2A 5KRSA 4DLGA 4BE0A 5C42A 4NYNA 2IGIA 4B08A 4FYDA 3ZT0A 3OVNA 3DLHA 1U49A 1DTTA 3RMCA 3WNEA 4KHUA 1Q8IA 4KB0A 4FJ9A 4CFBA 5K14A 3KLFA 1D8YA 2HHWA 3KD1E 4B8CA 5EU7A 3NF6A 1TGOA 2G8UA 2VG7A 5FRNA 3I0RA 1S1WA 1WNSA 2KW4A 1JL1A 2F96A 3F9KA 1LW0A 3DMJA 4LD0A 4I2PA 4AHRA 2DFEA 4CECA 1CZBA 4E1NA 1K6YA 4R5PA 3OYGA 3CQ8A 4IFYA 1TK8A 3QNNA 4J2BA 1CXUA 5I3UA 5CZ1A 4AHCA 4B9UA 3LAKA 3CFPA 3AA5X 4O0JA 3HK2A 1SKRA 3MXIA 1TL3A 1KVBA 3A2FA 4O0IA 4DU3A 4KHSA 3V1RA 4CJPA 4OLBA 1WSIA 3V9ZA 3QETA 3U6FA 5HRPA 4CEEA 1RT1A 4CIFA 5KGXA 1D9DA 4CERA 4B8AB 4W5TA 4FZXC 4LH5A 3KK2A 4KRFA 4LY7A 1IG9A 1D5AA 4Z0UA 4HUEA 3V9UA 4L8RB 3MEEA 3D0PA 4CK1A 3S3OA 3CFOA 1LWFA 4CHNA 1VSEA 3WNFA 2KQ2A 4CJEA 1TAQA 2QKKA 2P5OA 4DS5A 2G8VA 3SUPA 4FZYA 2WONA 3VQ5A 3TAFA 2RN2A 1RTIA 4CJSA 4O44A 1DTQA 3AO3A 4KFBA 5KTQA 1NK0A 1C1AA 3QIOA 1UOCA 5HROA 1ZYQA 4N41A 4CGJA 4CEFA 4DSJA 3AVNA 3B6OA 3C6UA 4RG8A 3VQBA 3S9HA 2R7YA 4B9MA 4M45A 4CGDA 3SUOA 4HCBA 2VG5A 2HW3A 2B6AA 3KLEA 3DRPA 1GOAA 2Z1GA 2O4GA 4GMJB 4E7JA 3OYFA 2HNZA 2IOCA 3P5JA 2RF2A 3VQDA 1RT7A 1I39A 5T7BA 4DF4A 1QSLA 3MECA 1JLEA 4CEZA 4KREA 2HB5A 3AVJA 4DTPA 4W5NA 2GV9A 1WSFA 3SPZA 1C0TA 2QKBA 1KLMA 3LZJA 3SNNA 1X9MA 3SQ2A 3QEPA 4FK2A 2FBVA 1XI1A 3KTQA 4OVLA 4F3OA 4CHPA 1U4BA 3NGYA 4DQIA 3OYMA 4KPYA 2ZE2A 1JLFA 5J2MA 4IG3A 4CEQA 2IAJA 2Y1IA 2HMIA 1C6VA 4FM2A 4N76A 3VQ7A 5DK5A 4FJNA 1BCOA 4IG0A 3ZSYA 4E1MA 1TV6A 4DWIA 3I0SA 3HYFA 3AO5A 1HNVA 2B4JA 4DQQA 4CCHA 3O3GA 1C1BA 3HVTA 4M3XA 3ALYA 3ZSZA 1C0UA 2VWJA 2KTQA 2QK9A 3L2QA 4QCLA 2OPRA 4FLWA 4DSIA 5HLFA 3NGIA 3DI6A 4CFCA 1VRUA 1FK9A 1RCHA 4N56A 3VQ4A 3KJVA 4KHNA 2D0AA 4KAZA 1C1CA 1QQCA 3TAEA 1KCFA 2YHBA 3RMAA 3K5OA 4CEOA 1IH7A 5CYQA 4FJJA 3SYZA 4CIEA 4FM0A 1TKTA 4BDZA 1RBTA 4LSLA 4CGIA 3DLKA 1FKPA 4KTWA 4CIGA 3OYBA 3TI0A 4Z4HA 4B9SA 2KFNA 3T3FA 1ASWA 1J9AA 2WOMA 3C94A 4C8OA 2HVIA 2HHSA 1BGXT 5E41A 4ZTJA 3PX0A 1HPZA 4B9TA 3F73A 3KKRA 3DLEA 4AHUA 4CF9A 4M41A 4HTUA 3DM2A 2XO7A 2P1JA 4ELTA 3RR7A 4J2EA 2YNHA 4FLUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDC A;  1VSI A;  1TK5 A;  4FXD A;  4DG1 A;  2IC3 A;  4J2D A;  1LAW A;  4OKE A;  4DTU A;  1RT3 A;  1N6Q A;  3HPO A;  4M3R A;  1R0A A;  2YKM A;  3BGR A;  1I3A A;  3K5M A;  4DTJ A;  4ZTF A;  4FCY A;  2BAN A;  3PX6 A;  4Q0B A;  4KV8 A;  4Y1D A;  3SUN A;  3AVH A;  1HMV A;  3CYM A;  3AVB A;  4BWM A;  4DTX A;  1YVU A;  1L5U A;  1LAV A;  2X74 A;  4KTZ A;  4CGF A;  3QEI A;  4UQG A;  4DTS A;  1CXQ A;  4CHQ A;  1SV5 A;  4DU4 A;  1XC9 A;  1L3S A;  3KD5 E;  3VA3 A;  3QLH A;  1TAU A;  1VSH A;  4BE2 A;  3PV8 A;  4CJV A;  3ZSO A;  4E19 A;  3OYH A;  2YKN A;  4FJ8 A;  4E3S A;  4N5S A;  4FLZ A;  3SV4 A;  1T03 A;  2O4I A;  3OYE A;  3K57 A;  3PO4 A;  3RRG A;  2F8T A;  4FJI A;  3U3G A;  5DMR A;  4GW6 A;  3M8R A;  2KZM A;  3MXM A;  3OS1 A;  2HHQ A;  3AVM A;  3LPT A;  2A1S A;  4PWD A;  4CJU A;  1WN7 A;  4E7K A;  1NJZ A;  5CZ2 A;  2IDO A;  4YNQ A;  3K5N A;  4DQS A;  3EYZ A;  3PO5 A;  4KHY A;  1HQU A;  2W42 A;  3VQC A;  4H4O A;  2IS3 A;  3AVI A;  4J2A A;  4YFU A;  1VK0 A;  3TWH A;  3OYI A;  2NUB A;  5J2Q A;  2HHX A;  2HHV A;  1X9W A;  1QHT A;  4I9Q A;  2HVH A;  4FJM A;  1S6Q A;  3TAB A;  3T1A A;  1S5J A;  4CJT A;  1UWB A;  3DYA A;  2BGG A;  3HO1 A;  4DFJ A;  4Y1C A;  3T19 A;  4CFA A;  3QIP A;  1IKY A;  1RIL A;  3KKS A;  2Z1I A;  4KTQ A;  1J5O A;  4EZ6 A;  3ZSR A;  1BQM A;  1EX4 A;  1GOC A;  3V4I A;  4ELV A;  3SQ1 A;  1A5X A;  4OJR A;  1XWL A;  2YHA A;  1JLC A;  3OS2 A;  2BDP A;  2YNI A;  3DRR A;  1VSJ A;  3EZ5 A;  3NGZ A;  1MU2 A;  2F8S A;  3CFR A;  4C8N A;  3JSM A;  3TAR A;  1X9S A;  3VQ8 A;  4CJR A;  4K8Z A;  4CJW A;  1WSH A;  3ISN C;  1BIZ A;  2FC0 A;  3L8B A;  3RRH A;  1L3T A;  4RW9 A;  3AA2 A;  4DFM A;  4FW2 A;  4Q5V A;  3PUF A;  4G1Q A;  3EY1 A;  1UA1 A;  1VSM A;  1JLG A;  2G8W A;  3LP1 A;  1J53 A;  1TKX A;  3HM9 A;  3TAQ A;  1CLQ A;  4HUG A;  2PYJ A;  3WNH A;  4M3Y A;  2D0B A;  4KO0 A;  3K5L A;  3DLR A;  3NDK A;  3DRS A;  4FZZ A;  4M3T A;  1TL1 A;  3AVL A;  1RDA A;  1NOY A;  1BQN A;  3K59 A;  4M3Z A;  1KVA A;  2DFF A;  2Z1H A;  4FLY A;  4DS4 A;  2GBZ A;  4ZHR A;  4DTN A;  1NK9 A;  4BE1 A;  2XY6 A;  2G8F A;  2ATQ A;  2XHB A;  4ID5 A;  2OPQ A;  3HJF A;  3VQ9 A;  1C0M A;  4KKO A;  2PY5 A;  1ZBI A;  3KIO A;  4F8R A;  4TSX A;  1NJY A;  1B92 A;  4DSF A;  1ZBL A;  3C6T A;  3QEX A;  1X1P A;  3O4Q A;  4RW6 A;  4OKJ A;  5C24 A;  1U04 A;  3OYD A;  4HHT A;  1G15 A;  4CHO A;  4I9L A;  4AHT A;  5J1E A;  1YT3 A;  3B6P A;  2XRI A;  3LDS A;  2DFH A;  5SWM A;  3OYN A;  3NF7 A;  3ZSQ A;  3NAE A;  3RR8 A;  3ITH A;  3QER A;  1JLB A;  5CY4 A;  3MED A;  4ID1 A;  1QSS A;  1BI4 A;  3LZI A;  1JL2 A;  3M8Q A;  3KLH A;  3MAQ A;  3TR8 A;  2JGU A;  2OPP A;  4CK2 A;  3S3N A;  4C8M A;  2FBY A;  5KI6 A;  1SKW A;  3LWL A;  1ZBF A;  1SL1 A;  5JS2 A;  3K2P A;  4JS4 A;  1SL0 A;  1NK8 A;  4CED A;  4KHW A;  4CEA A;  3OYK A;  4F2R A;  2FBT A;  4FJ5 A;  4DMN A;  3AO4 A;  1EET A;  4I7F A;  1VRT A;  1QE1 A;  2I5J A;  1RTJ A;  4ICL A;  1TK0 A;  2PZS A;  3P83 D;  3NH0 A;  4DSL A;  3E01 A;  3ZT3 A;  1DLO A;  1YTA A;  4DTR A;  3VQ6 A;  4Z4E A;  1W0H A;  3QNO A;  4DSK A;  1XHX A;  3RMD A;  4PQU A;  2B5J A;  4CFD A;  1HJR A;  4DQR A;  1QTM A;  4E0D A;  3MXJ A;  4M42 A;  3V1O A;  3VQP A;  5JS1 A;  3ASM A;  3IS9 A;  1Q9Y A;  4BAC A;  1L3V A;  1U47 A;  4B9L A;  3CM5 A;  1N5Y A;  3SI6 A;  4CK3 A;  3V6D A;  3AVC A;  3V1Q A;  1S9G A;  1O1W A;  1WLJ A;  3FFI A;  2YV0 X;  3KK3 A;  3HPG A;  3HST B;  4PA1 A;  4N47 A;  2HND A;  4MFB A;  5HRN A;  3OYC A;  3VA0 A;  2E6M A;  4NCG A;  3M8S A;  3QEW A;  1HYZ A;  4RW7 A;  1T05 A;  3TAN A;  3OJS A;  1Y97 A;  4CHY A;  3UIQ A;  3HXM A;  4CGG A;  3RWU A;  4FLV A;  1RT2 A;  3KK1 A;  2KZZ A;  4CJ5 A;  3LWM A;  4ELU A;  4FM1 A;  3OYA A;  3HPH A;  3IAY A;  1CZ9 A;  1YTU A;  1S9E A;  4H4M A;  3LAL A;  5FDL A;  3OYL A;  1TKD A;  3OJU A;  4WE1 A;  3KLG A;  4FLT A;  1ITG A;  1BCM A;  3U3Y A;  1LWE A;  1NK7 A;  4PUO A;  4F3T A;  1VSF A;  2E6L A;  3LP0 A;  5J2P A;  1RBR A;  1RBU A;  1SUQ A;  4AHS A;  1IO2 A;  4QOZ B;  4CJF A;  2ZQB A;  1RDD A;  1U45 A;  3BDP A;  4M3U A;  1WAF A;  3NH1 A;  3OY9 A;  2XY7 A;  2PYL A;  4IBN A;  2ETJ A;  4EP4 A;  4CF2 A;  3I8D A;  5SZT A;  1HYS A;  3P1G A;  4LH4 A;  1UA0 A;  3V9S A;  4LSN A;  1NOZ A;  3G0Z A;  3NE6 A;  4EP5 A;  3M8P A;  1L3U A;  1RTH A;  2HHT A;  1ASV A;  5FRO A;  4MQ3 A;  2QXF A;  3ZSW A;  1B9F A;  1Z26 A;  4I2Q A;  4HUF A;  4NCB A;  1EP4 A;  1RBS A;  3L3U A;  3HVR A;  4CHZ A;  4IDK A;  4DSE A;  3SJJ A;  4OGC A;  3V9W A;  2OPS A;  3NBP A;  2A1R A;  4KB1 A;  4DFP A;  3RMB A;  1TVR A;  3AA4 A;  3SQ0 A;  4RW4 A;  1NK6 A;  4FJG A;  1KVC A;  1KFS A;  4JRQ A;  4OPJ A;  4QAG A;  4B9N A;  1ZBH A;  4HCC A;  3ZSX A;  5D3G A;  1S1U A;  3VQE A;  3OS0 A;  3LP2 A;  5CYM A;  3HL8 A;  3QES A;  3VQQ A;  4FJ7 A;  1HQE A;  4IFV A;  4GVM A;  3DOL A;  4OKK A;  4OPK A;  3DLB A;  4E7I A;  2ITG A;  1D9F A;  3L2R A;  1NK5 A;  4K8X A;  5J2N A;  4XIU A;  4CJ3 A;  4OGE A;  1GOB A;  1SKS A;  1EXQ A;  3NF9 A;  1WSJ A;  5C25 A;  4DFK A;  1Q9X A;  4FK0 A;  3VN5 A;  2X6S A;  3V81 A;  3SPY A;  1LWC A;  3PY8 A;  1RT5 A;  3AO1 A;  3NH2 A;  1S1X A;  2XY5 A;  4FK4 A;  3MEG A;  3AO2 A;  4FJX A;  3HP9 A;  3AA3 A;  3V9X A;  3SQ4 A;  5I42 A;  4NCA A;  5FRM A;  2GUI A;  3LAM A;  4OLA A;  3AVK A;  1NK4 A;  5HRR A;  3THV A;  1KRP A;  4AH9 A;  1BL3 A;  2KFZ A;  4DF8 A;  3QO9 A;  4CES A;  1JKH A;  4F4K A;  1HRH A;  1S6P A;  2P5G A;  3OYJ A;  1LV5 A;  4EZ9 A;  2DY4 A;  3IRX A;  1B9D A;  2LSN A;  4O4G A;  4AHV A;  3ZSV A;  4CJL A;  3CM6 A;  2RPI A;  4B9V A;  1KLN A;  2G8H A;  2FBX A;  5HBM A;  2OZM A;  3ULD A;  1U48 A;  2EX3 A;  1BIS A;  2RKI A;  1Z25 A;  3NFA A;  4CF0 A;  2DTU A;  4KHQ A;  3NHG A;  1J54 A;  1IKV A;  4CF1 A;  1NKC A;  4Z4F A;  4F2S A;  1JXB A;  4E89 A;  4CEB A;  3CG7 A;  1UAX A;  2AJQ A;  4O5B A;  3S3M A;  1BIU A;  3LPU A;  3O4N A;  1FXX A;  3QEV A;  1REV A;  2P51 A;  2X78 A;  1NJX A;  2G8K A;  4Z4I A;  1HYV A;  4RW8 A;  4CGH A;  4FW1 A;  3PX4 A;  2OA8 A;  3SCX A;  2Z1J A;  1T7P A;  3L3V A;  3IG1 A;  3DLG A;  3AVG A;  2E4L A;  1S1V A;  4W5R A;  1KFD A;  2JLE A;  4M3W A;  1JXE A;  4B3O A;  1RTD A;  2D5R A;  4AIL C;  3LP3 A;  2XY8 A;  3SUQ A;  2D0C A;  1RNH A;  3LAN A;  1A5W A;  4E7L A;  3RTV A;  4IKF A;  2YNG A;  4FJK A;  3AV9 A;  4CJ4 A;  2X6N A;  2OYQ A;  1A5V A;  2HHU A;  4JRP A;  2G8I A;  1RDB A;  1EKE A;  2HNY A;  4DQP A;  3HT3 A;  2VG6 A;  1KTQ A;  4DTM A;  4O55 A;  2Y1J A;  5HP1 A;  3AVA A;  1SL2 A;  2BE2 A;  1JLA A;  1T8E A;  2OZS A;  3C95 A;  1HNI A;  1KSP A;  1WAJ A;  3KLI A;  4E7H A;  1NKE A;  1JLQ A;  1RT6 A;  2VWK A;  5KGW A;  4PY5 A;  1LW2 A;  1QSY A;  1WSE A;  3SV3 A;  4C8K A;  1W9H A;  1NKB A;  4JLH A;  3DOK A;  3H08 A;  3QIN A;  4BDY A;  1RT4 A;  4CE9 A;  3VQA A;  4CJK A;  3NF8 A;  4H8K A;  4FJL A;  3L2V A;  4W5O A;  1XHZ A;  4CF8 A;  1FKO A;  1TKZ A;  3K58 A;  3ZT4 A;  1VSL A;  3TAP A;  2EHG A;  4FLX A;  3ZCM A;  3D45 A;  3WNG A;  1RBV A;  5HRS A;  1S1T A;  4DU1 A;  1WSG A;  2Q3S A;  3G10 A;  4HVJ A;  1BI4 B;  2YNF A;  3O3H A;  1IKW A;  3HP6 A;  1QS4 A;  4FVM A;  3JYT A;  4DLE A;  3TAG A;  3NCI A;  1ASU A;  1NJW A;  1ZBU A;  3O3F A;  4Z4C A;  4JS5 A;  1VSD A;  2ZD1 A;  4NYF A;  4W5Q A;  1IKX A;  4CJQ A;  3L2U A;  4KI4 A;  3AVF A;  3TAM A;  1VSK A;  4BWJ A;  5KRT A;  4DTO A;  1F21 A;  4KI6 A;  3ZT1 A;  3L2W A;  4BDP A;  4FJH A;  1BHL A;  4Z4G A;  3SZ2 A;  4C8L A;  3ZT2 A;  5KRS A;  4DLG A;  4BE0 A;  5C42 A;  4NYN A;  2IGI A;  4B08 A;  4FYD A;  3ZT0 A;  3OVN A;  3DLH A;  1U49 A;  1DTT A;  3RMC A;  3WNE A;  4KHU A;  1Q8I A;  4KB0 A;  4FJ9 A;  4CFB A;  5K14 A;  3KLF A;  1D8Y A;  2HHW A;  3KD1 E;  4B8C A;  5EU7 A;  3NF6 A;  1TGO A;  2G8U A;  2VG7 A;  5FRN A;  3I0R A;  1S1W A;  1WNS A;  2KW4 A;  1JL1 A;  2F96 A;  3F9K A;  1LW0 A;  3DMJ A;  4LD0 A;  4I2P A;  4AHR A;  2DFE A;  4CEC A;  1CZB A;  4E1N A;  1K6Y A;  4R5P A;  3OYG A;  3CQ8 A;  4IFY A;  1TK8 A;  3QNN A;  4J2B A;  1CXU A;  5I3U A;  5CZ1 A;  4AHC A;  4B9U A;  3LAK A;  3CFP A;  3AA5 X;  4O0J A;  3HK2 A;  1SKR A;  3MXI A;  1TL3 A;  1KVB A;  3A2F A;  4O0I A;  4DU3 A;  4KHS A;  3V1R A;  4CJP A;  4OLB A;  1WSI A;  3V9Z A;  3QET A;  3U6F A;  5HRP A;  4CEE A;  1RT1 A;  4CIF A;  5KGX A;  1D9D A;  4CER A;  4B8A B;  4W5T A;  4FZX C;  4LH5 A;  3KK2 A;  4KRF A;  4LY7 A;  1IG9 A;  1D5A A;  4Z0U A;  4HUE A;  3V9U A;  4L8R B;  3MEE A;  3D0P A;  4CK1 A;  3S3O A;  3CFO A;  1LWF A;  4CHN A;  1VSE A;  3WNF A;  2KQ2 A;  4CJE A;  1TAQ A;  2QKK A;  2P5O A;  4DS5 A;  2G8V A;  3SUP A;  4FZY A;  2WON A;  3VQ5 A;  3TAF A;  2RN2 A;  1RTI A;  4CJS A;  4O44 A;  1DTQ A;  3AO3 A;  4KFB A;  5KTQ A;  1NK0 A;  1C1A A;  3QIO A;  1UOC A;  5HRO A;  1ZYQ A;  4N41 A;  4CGJ A;  4CEF A;  4DSJ A;  3AVN A;  3B6O A;  3C6U A;  4RG8 A;  3VQB A;  3S9H A;  2R7Y A;  4B9M A;  4M45 A;  4CGD A;  3SUO A;  4HCB A;  2VG5 A;  2HW3 A;  2B6A A;  3KLE A;  3DRP A;  1GOA A;  2Z1G A;  2O4G A;  4GMJ B;  4E7J A;  3OYF A;  2HNZ A;  2IOC A;  3P5J A;  2RF2 A;  3VQD A;  1RT7 A;  1I39 A;  5T7B A;  4DF4 A;  1QSL A;  3MEC A;  1JLE A;  4CEZ A;  4KRE A;  2HB5 A;  3AVJ A;  4DTP A;  4W5N A;  2GV9 A;  1WSF A;  3SPZ A;  1C0T A;  2QKB A;  1KLM A;  3LZJ A;  3SNN A;  1X9M A;  3SQ2 A;  3QEP A;  4FK2 A;  2FBV A;  1XI1 A;  3KTQ A;  4OVL A;  4F3O A;  4CHP A;  1U4B A;  3NGY A;  4DQI A;  3OYM A;  4KPY A;  2ZE2 A;  1JLF A;  5J2M A;  4IG3 A;  4CEQ A;  2IAJ A;  2Y1I A;  2HMI A;  1C6V A;  4FM2 A;  4N76 A;  3VQ7 A;  5DK5 A;  4FJN A;  1BCO A;  4IG0 A;  3ZSY A;  4E1M A;  1TV6 A;  4DWI A;  3I0S A;  3HYF A;  3AO5 A;  1HNV A;  2B4J A;  4DQQ A;  4CCH A;  3O3G A;  1C1B A;  3HVT A;  4M3X A;  3ALY A;  3ZSZ A;  1C0U A;  2VWJ A;  2KTQ A;  2QK9 A;  3L2Q A;  4QCL A;  2OPR A;  4FLW A;  4DSI A;  5HLF A;  3NGI A;  3DI6 A;  4CFC A;  1VRU A;  1FK9 A;  1RCH A;  4N56 A;  3VQ4 A;  3KJV A;  4KHN A;  2D0A A;  4KAZ A;  1C1C A;  1QQC A;  3TAE A;  1KCF A;  2YHB A;  3RMA A;  3K5O A;  4CEO A;  1IH7 A;  5CYQ A;  4FJJ A;  3SYZ A;  4CIE A;  4FM0 A;  1TKT A;  4BDZ A;  1RBT A;  4LSL A;  4CGI A;  3DLK A;  1FKP A;  4KTW A;  4CIG A;  3OYB A;  3TI0 A;  4Z4H A;  4B9S A;  2KFN A;  3T3F A;  1ASW A;  1J9A A;  2WOM A;  3C94 A;  4C8O A;  2HVI A;  2HHS A;  1BGX T;  5E41 A;  4ZTJ A;  3PX0 A;  1HPZ A;  4B9T A;  3F73 A;  3KKR A;  3DLE A;  4AHU A;  4CF9 A;  4M41 A;  4HTU A;  3DM2 A;  2XO7 A;  2P1J A;  4ELT A;  3RR7 A;  4J2E A;  2YNH A;  4FLU A; 
#chains in the Genus database with same CATH topology
 2PBD A;  1VSI A;  1TK5 A;  2ZJR L;  4J2D A;  4DTU A;  2E1Z A;  1YXQ A;  2P9N B;  2YKM A;  1I3A A;  4KV8 A;  5AQG A;  1HMV A;  3E9L A;  4KH6 A;  3O8M A;  1LAV A;  3NVK A;  2HOE A;  4KTZ A;  3QEI A;  3CCE N;  4DU4 A;  4YDU C;  3VA3 A;  3QLH A;  5EX5 A;  1VSH A;  3SMP A;  2E5L K;  2NNW A;  3ZSO A;  4CZH A;  3O9S A;  1NLV A;  3RRG A;  2D1K A;  3BZC A;  3M8R A;  3ZEU B;  3OS1 A;  3BUZ B;  5GIN A;  1WN7 A;  3FE1 A;  1DT9 A;  2IDO A;  3K5N A;  4DQS A;  4JN4 A;  4JI2 K;  4BR7 A;  1HQU A;  2W42 A;  4H4O A;  4FO0 A;  3AVI A;  3TWH A;  2HHV A;  3CCR N;  3A8Y A;  1QHT A;  2HVH A;  3T1A A;  1S5J A;  3HTV A;  4B1Y B;  4Y1C A;  4EHT A;  2P9K B;  1GLJ O;  3MN7 A;  1HKB A;  1N34 K;  4IXC A;  3SQ1 A;  1XWL A;  5GAD P;  3OS2 A;  3DRR A;  2F8S A;  1MU2 A;  3CFR A;  1X9S A;  3JSM A;  5M1F A;  4CJR A;  4IOC L;  3AAP A;  3RRH A;  2QWR A;  3EE9 A;  4FW2 A;  1Q18 A;  3DXK A;  1OH5 A;  3HM9 A;  3RVC A;  2P9S B;  3KWG A;  3WNH A;  4JKG B;  3GBT A;  1EWQ A;  3AVL A;  1HPM A;  3K59 A;  2ZGY A;  4FVU A;  2DFF A;  4DS4 A;  4ZHR A;  2EWS A;  4YOU A;  5AQV A;  2ZJP L;  1C0M A;  4DV1 K;  3KIO A;  3C6H A;  3O9T A;  3THY B;  2A40 A;  2E88 A;  3CPE A;  1X1P A;  3EO3 A;  5BN8 A;  1U04 A;  1N32 K;  3OYD A;  1NNE A;  1JCF A;  4CHO A;  4I9L A;  3B6P A;  3VPZ A;  2DFH A;  3NAE A;  3ZSQ A;  3ITH A;  3QER A;  3F5T A;  4GY2 B;  4WQ4 A;  1JL2 A;  3KLH A;  4DV0 K;  3MAQ A;  4CK2 A;  2FBY A;  5KI6 A;  4BRM A;  3H3N O;  4BR0 A;  3VEY A;  4H5V A;  3K2P A;  4JS4 A;  4CD3 A;  1NU0 A;  2WBN A;  1NMN A;  3A0I X;  2FBT A;  4I7F A;  5BR9 A;  1RTJ A;  5F2R A;  3P83 D;  3NH0 A;  3IMX A;  3E01 A;  3ZT3 A;  4CBU A;  1DLO A;  1YTA A;  4Z4E A;  2E2Q A;  1U2V B;  1VQP N;  1XHX A;  4PQU A;  2B5J A;  2A42 A;  3I56 N;  4CI6 A;  1KXP A;  3EZW A;  3ASM A;  1V4T A;  4CVN E;  4CK3 A;  3AVC A;  3KK3 A;  2YV0 X;  4N47 A;  2HND A;  3VA0 A;  3H45 C;  4IFE A;  3TAN A;  4YOX A;  3HXM A;  4CGG A;  2KZZ A;  3G6E N;  3LWM A;  3ENO A;  3HPH A;  3OYL A;  3F2K A;  4JNE A;  2J4R A;  1ITG A;  4YOY A;  1BCM A;  2P9K A;  3UE5 A;  3LP0 A;  3CCQ N;  2ASM A;  5J2P A;  1SUQ A;  4AHS A;  2ZQB A;  3NH1 A;  4IBN A;  3ZLJ A;  2ETJ A;  4CF2 A;  5SZT A;  3P1G A;  3T7Z A;  1R59 O;  3V9S A;  4JI7 K;  4EP5 A;  3M8P A;  2GX9 A;  3ZSW A;  2ZF5 O;  3F9M A;  3M3Z A;  4I2Q A;  4B1Z A;  3HVR A;  4IDK A;  3SJJ A;  3WQU A;  4OGC A;  3HZ6 A;  4H5R A;  5IT9 O;  1LCU A;  4GV3 A;  3RMB A;  1TVR A;  3AA4 A;  4IOX A;  4BR2 A;  3SQ0 A;  3CC7 N;  4OPJ A;  1ZBH A;  4IJN A;  5CYM A;  3HL8 A;  3O5B A;  4I6M B;  4FJ7 A;  1GLB G;  4CZM A;  3DLB A;  1NK5 A;  4K8X A;  4CZK A;  4CJ3 A;  1SKS A;  4K43 A;  3VN5 A;  3PY8 A;  4A5A A;  1RT5 A;  4EHU A;  4O8K A;  1S1X A;  4QS9 A;  1OVY A;  4BGB A;  3LAM A;  4NLC A;  4Z94 A;  1LV5 A;  3QFU A;  4EZ9 A;  5AQK A;  1B9D A;  3M5R A;  2RPI A;  1KLN A;  3GE1 A;  4NXN K;  1NGE A;  2FBX A;  1M1K O;  3H3O B;  2EX3 A;  4KHQ A;  3MCP A;  3SMS A;  3NMU A;  3CG7 A;  1OH6 A;  1KD1 O;  3S3M A;  3LPU A;  3O4N A;  2P51 A;  3EN9 A;  1NJX A;  4Z4I A;  4O8U A;  4CGH A;  3GDQ A;  1T7P A;  4WQ4 C;  3AVG A;  2CH6 A;  1S1V A;  2JLE A;  1RTD A;  3SUQ A;  5FPD A;  4A59 A;  1KAZ A;  4L3Q A;  2Y1J A;  2BE2 A;  1JLA A;  3C95 A;  4E7H A;  4GVE A;  1QSY A;  1W9H A;  4JLH A;  3DOK A;  2FF6 A;  4XEI A;  4FJL A;  3PIO L;  4JHD B;  2ZGZ A;  4BQZ A;  4B3S K;  3TAP A;  2UXD K;  3HM8 A;  3ZCM A;  3WNG A;  1GLA G;  1YF5 L;  4CZI A;  2V7Y A;  5AQZ A;  3T69 A;  4LFA K;  1QS4 A;  3NVM A;  1ASU A;  4B1X B;  4KRF A;  4W5Q A;  4JYA K;  1K8K B;  4CJQ A;  3VEX A;  2GEM A;  1VSK A;  5FPN A;  1F21 A;  3ZT1 A;  3L2W A;  1BHL A;  4C8L A;  4FL9 A;  3KVG A;  4DUY K;  5C42 A;  4K42 A;  4B08 A;  3DLH A;  4BVO A;  4AQY K;  1DTT A;  4FPA A;  3LDP A;  3KD1 E;  3L4I A;  3AGR A;  2FLO A;  5C10 A;  2KW4 A;  1JL1 A;  4KTQ A;  4AHR A;  4E1N A;  1CZB A;  4M7Y A;  4IFY A;  1TK8 A;  5I3U A;  4AHC A;  3AA5 X;  4PKG A;  4H0P A;  1TL3 A;  4KHS A;  3CCU N;  3C6A A;  5HRP A;  3LM2 A;  4CEE A;  1D9D A;  4NXM K;  4CER A;  4FZX C;  1IG9 A;  3V9U A;  1NGH A;  4L8R B;  3S3O A;  4CHN A;  2O8C B;  1TAQ A;  2P5O A;  4OX9 K;  3VQ5 A;  4CJS A;  1DTQ A;  1NK0 A;  3WXL A;  5KTQ A;  3CJB A;  4CGJ A;  3C6U A;  3VQB A;  3LDN A;  4GNI A;  1YJW N;  4HCB A;  1HKC A;  4A61 A;  3VMF B;  5AJ3 K;  3DWL A;  4GMJ B;  2IOC A;  3VQD A;  2RF2 A;  3PIP L;  1I39 A;  3MEC A;  3CJ9 A;  2GV9 A;  3CQY A;  1C0T A;  5KPZ A;  3FZK A;  3LZJ A;  4LF5 K;  1X9M A;  1XI1 A;  1HLU A;  1OH7 A;  1JLF A;  4FOE A;  4IG3 A;  1C6V A;  5DK5 A;  5LMN K;  4IG0 A;  2Q0R A;  1BU6 O;  3MN6 A;  3VEO A;  2O8D B;  1C1B A;  3C7N A;  1MA9 B;  2O8E B;  1C0G A;  3ZX0 A;  3NGI A;  4CFC A;  4KHN A;  1C1C A;  3ZX3 A;  1KCF A;  4IDH A;  4LSL A;  1FKP A;  4M63 C;  4GKK K;  2W40 A;  2WOM A;  4C8O A;  2HHS A;  3TSU A;  3PX0 A;  1HPZ A;  4J2A A;  4CF9 A;  4J2E A;  3DM2 A;  5FRN A;  4BC2 A;  1RDC A;  1LAW A;  4OKE A;  3VGM A;  1N6Q A;  3HPO A;  4M3R A;  3K5M A;  4DTJ A;  4FCY A;  2BAN A;  3PX6 A;  4Q0B A;  3O1B A;  3CYM A;  4BWM A;  1L5U A;  4DCH A;  4IO8 A;  1NBW A;  4DTS A;  4B1W B;  4X64 K;  1L3S A;  4CJV A;  3J7Z O;  4E3S A;  4N5S A;  4FLZ A;  1FW6 A;  3K57 A;  2O8F B;  4BRK A;  5DMR A;  5M1Q A;  1HNX K;  3J81 O;  3AVM A;  2A1S A;  3D2E B;  3SBG A;  4X66 K;  3I33 A;  5CZ2 A;  3D2F B;  2NRW A;  1VQ4 N;  3EYZ A;  3PO5 A;  1DGK N;  1O13 A;  2WC9 A;  4KHY A;  4WQ5 A;  5C0Y A;  4YFU A;  2NUB A;  3G4S N;  3N4Q A;  1BA1 A;  5EY4 A;  2Q0U A;  4CJT A;  4BRC A;  3DYA A;  3T1Y K;  5E84 A;  4MLH A;  4RWT A;  4DFJ A;  4O5F A;  4ILG B;  3FR0 A;  4NLB A;  1IBM K;  1VQ5 N;  1RDW X;  1EX4 A;  1GOC A;  4JI3 K;  4ELV A;  4DV5 K;  2YNI A;  4BC3 A;  4BRN A;  4LC9 B;  3EZ5 A;  3NGZ A;  1RFQ A;  3TAR A;  3ENB A;  3E9O A;  4K8Z A;  3L8B A;  3ISN C;  1L3T A;  2FC0 A;  3E1Y A;  3P38 A;  4DR7 K;  4DFM A;  3QDK A;  3UKR B;  4G1Q A;  4Q5V A;  1UA1 A;  2G8W A;  1TKX A;  2O8D A;  4HUG A;  2VWB A;  1HUX A;  2BH1 A;  2CH5 A;  2D0B A;  4KO0 A;  2UXB K;  3DRS A;  1XQS C;  4JD2 A;  2AP1 A;  4FZZ A;  2HBK A;  1RDA A;  2UU9 K;  5ELZ A;  4JI6 K;  1KVA A;  1NK9 A;  3O80 A;  4BE1 A;  2H3G X;  4A2A A;  2XHB A;  1TYQ A;  4DV4 K;  3VQ9 A;  2IVN A;  1BO5 O;  1ZBI A;  4TSX A;  1B92 A;  1Q7Y O;  4IEE A;  4DV6 K;  3C6T A;  2D0P A;  3QEX A;  3O4Q A;  1K9M O;  5C24 A;  2E2O A;  5BR8 K;  3CXC M;  2Q31 A;  4AHT A;  1YT3 A;  3LDS A;  3MWP A;  3OYN A;  2HBL A;  1DKG D;  3MED A;  5FPE A;  4JEP A;  3M8Q A;  3TR8 A;  2JGU A;  2OPP A;  3S3N A;  1YI2 N;  5BPM A;  2VCP A;  3S41 A;  3HOT A;  1SL1 A;  5GIO A;  2E2P A;  4G9Z A;  3OYK A;  4FJ5 A;  1NWK A;  5C2D A;  4ICL A;  4BC5 A;  1ZXO A;  5AQP A;  4DSL A;  3TSQ A;  4DTR A;  3E9P A;  3O1W A;  1W0H A;  3G71 N;  3QNO A;  3RMD A;  4DQR A;  1WUA A;  3V1O A;  2GTD A;  3VQP A;  4K0K K;  3VOV A;  2CGK A;  5JS1 A;  1Q9Y A;  1U47 A;  1U6Z A;  1S9G A;  1WLJ A;  3FFI A;  3HPG A;  3HST B;  4MFB A;  4R79 A;  4NCG A;  1HYZ A;  4RW7 A;  1Q82 O;  3MX5 A;  3OJS A;  3RWU A;  2ASP A;  1RT2 A;  4CJ5 A;  3LDO A;  4FM1 A;  3OYA A;  1S9E A;  4H4M A;  5FDL A;  4IO9 L;  3QFP A;  4AF1 A;  3CI5 A;  4CZE A;  1IBK K;  3U3Y A;  1RBU A;  1IO2 A;  1RDD A;  3VEN A;  1U45 A;  1S3X A;  4M3U A;  2XY7 A;  2P9L B;  3QB0 A;  4LSN A;  1NOZ A;  3G0Z A;  3NE6 A;  1L3U A;  3CHW A;  3CCV N;  3QBW A;  3BEX A;  4A62 A;  4WQ5 C;  4HUF A;  2P9P A;  1RBS A;  3CCM N;  2Q1N A;  3CJC A;  4DR2 K;  1E4G T;  3NBP A;  2A1R A;  4RW4 A;  4FJG A;  3ZYY X;  3VTI A;  5AQI A;  1GLE G;  3ZSX A;  2UXC K;  1S1U A;  3VQE A;  4LF6 K;  3LP2 A;  1BWF O;  5IWA K;  4B3T K;  4OKK A;  3WXM B;  3G25 A;  4OPK A;  2ZM6 K;  5AR0 A;  2FSK A;  2RHK A;  4YY3 K;  4AM6 A;  3L2R A;  2VQF K;  3SLC A;  4OO1 J;  3AAQ A;  1KQS M;  4DFK A;  1Q9X A;  1LWC A;  3NH2 A;  3DXM A;  4FK4 A;  3LL3 A;  3C0B A;  3HI0 A;  4NCA A;  1T6D A;  3JS6 A;  3AVK A;  1VQK N;  5JLH A;  4FOI A;  1T6C A;  4BC4 A;  3QO9 A;  4F4K A;  1NGJ A;  3TPQ A;  1Q81 O;  1VQL N;  2DY4 A;  4O4G A;  4CJL A;  4PKI A;  4B9V A;  2G8H A;  5HBM A;  4QS7 A;  3MCA B;  5BN9 A;  1U48 A;  2RKI A;  3D6R A;  1IKV A;  1NKC A;  4F2S A;  4E89 A;  5AQM A;  2AJQ A;  4O5B A;  3AGK A;  2P9N A;  1BIU A;  3ENH A;  3QEV A;  4JI4 K;  4H0V B;  3ZX2 A;  2G8K A;  2A3Z A;  1P90 A;  1HYV A;  3SCX A;  4DR6 K;  5LY3 A;  3DLG A;  1QQN A;  4W5R A;  1KFD A;  3DAW A;  2FSJ A;  4NB4 A;  2XY8 A;  5AQQ A;  2D0C A;  5KQ8 A;  3KK7 A;  1A5W A;  4CJ4 A;  3A5O C;  4MO4 A;  4MO5 A;  1H1V A;  4XH1 A;  2G8I A;  2HNY A;  2HF4 A;  4DQP A;  1SQK A;  4DTM A;  2OZS A;  3AVA A;  3BY5 A;  5DM7 L;  1KSP A;  3UKU B;  1WAJ A;  3ZEU A;  4H0O A;  1JLQ A;  5KGW A;  1LW2 A;  4KHP K;  1QZ6 A;  1WSE A;  3SV3 A;  2NRV A;  1NKB A;  1C0F A;  3QIN A;  4KH4 A;  3K9J A;  4CE9 A;  2VGM A;  4CF8 A;  4V19 S;  2W41 A;  4PKH A;  2QWN A;  3K58 A;  3ZT4 A;  3VGK A;  1YHQ N;  2NRX A;  2GUP A;  3CJ1 A;  3G10 A;  1BI4 B;  3JYT A;  4FVM A;  3TAG A;  3I8B A;  4OPA A;  4CZL A;  3CMA N;  4QS8 A;  5BPN A;  5J2Q A;  4JS5 A;  1VSD A;  2ZD1 A;  4JKH A;  1VHX A;  1IKX A;  4BR4 A;  4Y0W A;  3D7E O;  5KRT A;  4BWJ A;  5FPM A;  2QWP A;  2YHW A;  1HX1 A;  4JKB A;  3JAM O;  2NRT A;  2IGI A;  4FYD A;  5JVG L;  3RMC A;  1Q8I A;  4FJ9 A;  3NF6 A;  2P9S A;  2KLA A;  4JKG A;  3I0R A;  1ZC6 A;  3QBX A;  3WT0 A;  3EKS A;  4AM7 A;  2NLX A;  3TTF A;  1KAY A;  3F9K A;  4BRH A;  3SBT A;  5H1S Q;  5CZ1 A;  4B9U A;  1NGC A;  3LAK A;  1SKR A;  3MXI A;  3THY A;  1Z6R A;  4CJP A;  3QET A;  5JLF A;  1S22 A;  2IVO A;  1NMD A;  3J7A P;  4DHY A;  2UUA K;  4Z0U A;  3FZF A;  2CGJ A;  3BF1 A;  2GWJ A;  1VSE A;  4CJE A;  2QKK A;  4DS5 A;  3SUP A;  2RN2 A;  2UUB K;  5AZI B;  4CZG A;  3AO3 A;  3SK3 A;  4ISE A;  1UOC A;  5HRO A;  3TU5 A;  3RSE B;  1ZYQ A;  2GEL A;  3AVN A;  4B9M A;  3S9H A;  4DV3 K;  2QXL A;  4DKW A;  3KLE A;  1YUW A;  3DRP A;  2YJF A;  4JKE A;  3OYF A;  3GG4 A;  3IUC A;  2PFU A;  4DR5 K;  3FFK B;  4DF4 A;  1JLE A;  3IDH A;  3MK6 A;  5TKY A;  1U2V A;  4KRE A;  4W5N A;  5JIC A;  3SPZ A;  3MMV A;  4H0T B;  4FK2 A;  3K0S A;  4C1N I;  4F3O A;  2YJE A;  3OYM A;  4IJA A;  5J2M A;  3SAG A;  3K9K A;  1I94 K;  4FM2 A;  3THW B;  1N36 K;  1BCO A;  5CE3 A;  3ZSY A;  4DWI A;  4M3X A;  5E26 A;  2IIR A;  2QW9 A;  3HVT A;  4FWN A;  3ZSZ A;  1C0U A;  2VWJ A;  3L2Q A;  5KPR A;  1VQ9 N;  1FK9 A;  3KJV A;  3VQ4 A;  2D0A A;  4KAZ A;  2YHB A;  3CCL N;  3RMA A;  3K5O A;  5CYQ A;  4CIG A;  1P8Z A;  4CGI A;  2KFN A;  3CET A;  1ASW A;  1J9A A;  3GL1 A;  2FSN A;  3C94 A;  5CR4 A;  2HVI A;  4OLA A;  4H0Y B;  4AHU A;  5AZJ B;  1XNR K;  4H5T A;  2P1J A;  3RR7 A;  4FXD A;  4DG1 A;  1RT3 A;  1R0A A;  3BGR A;  1YIJ N;  3VER A;  4LF8 K;  2QWL A;  1DEJ A;  4Y1D A;  3OTO K;  4DTX A;  3FZH A;  4I6M A;  2X74 A;  3L0Q A;  5B8H A;  3ID8 A;  4UQG A;  1CXQ A;  2E20 A;  1XC9 A;  3EL2 A;  3KD5 E;  3PV8 A;  1NGI A;  4YOT A;  5F0X A;  4E19 A;  4FJ8 A;  3SV4 A;  1N8R O;  3OYE A;  3PO4 A;  4FJI A;  2NZT A;  2KZM A;  1SZ2 A;  4PWD A;  2F9T A;  3EE8 A;  2E1Y A;  3DJC A;  1ZBS A;  4B9Q A;  3OBY A;  4YNQ A;  1ILY A;  3VQC A;  3MWT A;  2A5X A;  2JWK A;  3ATU A;  3TTD A;  5AQU A;  3BZK A;  3ULE B;  5AQF A;  3OYI A;  2P9U B;  3P4I A;  1BDG A;  4I9Q A;  1S6Q A;  2Q2R A;  3IFR A;  5F1X A;  3THX B;  3VEW A;  3R1X A;  1SS6 A;  2BGG A;  3QIP A;  1IKY A;  3KKS A;  2Z1I A;  2YCH A;  1J5O A;  4EZ6 A;  3ZSR A;  4LF4 K;  1BQM A;  2KHO A;  3V4I A;  2BDP A;  4OJR A;  3MX2 A;  2YHA A;  3Q7C A;  4LFB K;  2ASO A;  1BIZ A;  2O8B B;  4JK9 A;  4CZF A;  1JLG A;  3LP1 A;  1J53 A;  4BGA A;  2ZJQ L;  1CLQ A;  4M3Y A;  3DLR A;  3NDK A;  4M3T A;  4B1U B;  1TL1 A;  2NRR A;  5AQY A;  1NOY A;  1BQN A;  5JMV A;  4M3Z A;  4FLY A;  4DTN A;  2Z1H A;  3HJF A;  2V7Z A;  3R6M A;  3P39 A;  4JK7 A;  2FXU A;  4EIA A;  2PY5 A;  2F4V K;  4DSF A;  5HOO A;  3VES A;  2HBM A;  3CIP A;  4JHD A;  4RW6 A;  4OKJ A;  5EVZ A;  1GLD G;  1G15 A;  4JKF A;  3AY9 A;  3O9U A;  5A2Q O;  2XRI A;  5SWM A;  2P9I B;  5CY4 A;  4ID1 A;  4BRD A;  1QSS A;  5LL6 Z;  1TUY A;  3VF2 A;  2HHH K;  4C8M A;  1K8K A;  3LWL A;  3HRG A;  5LJW A;  5FLX O;  1SL0 A;  1NK8 A;  4KHW A;  4F2R A;  1FJG K;  4CZJ A;  1QE1 A;  1TK0 A;  3VQ6 A;  1NGB A;  4DUZ K;  1EWR A;  1JCG A;  4DSK A;  4CBW A;  1HJR A;  1VQ7 N;  4JKD A;  3IS9 A;  4BAC A;  1N5Y A;  3V6D A;  1O1W A;  1QQM A;  5HRN A;  4PA1 A;  3OYC A;  1T05 A;  2E6M A;  3M8S A;  5BPL A;  1Y97 A;  4FLV A;  3QIC A;  4DR4 K;  1E3M A;  4ELU A;  2YI1 A;  1S72 N;  1CZ9 A;  1YTU A;  3LAL A;  1TKD A;  3PSI A;  5AQX A;  3I55 N;  1LWE A;  4PUO A;  4F3T A;  1VSF A;  2E6L A;  1RBR A;  2QEX N;  4QOZ B;  2O8C A;  5AFU H;  1WAF A;  3OY9 A;  2PYL A;  3ID6 A;  3I8D A;  4LH4 A;  1UA0 A;  4WYB A;  4GV6 A;  1ASV A;  5FRO A;  2QXF A;  2WUS A;  5DM6 L;  1Z26 A;  1EP4 A;  3EKU A;  4CHZ A;  4DSE A;  4B3M K;  3V9W A;  3O08 A;  4KB1 A;  4DFP A;  3BP8 A;  3SAF A;  4CJ7 A;  4BRG A;  4BRP A;  1NK6 A;  4NO7 A;  1KVC A;  1KFS A;  4HCC A;  1W97 L;  1HKG A;  3OS0 A;  4YOR A;  3VQQ A;  1HQE A;  1D9F A;  2HF3 A;  3J8A A;  5BRD A;  1EXQ A;  3NF9 A;  1WSJ A;  4FK0 A;  3V81 A;  3CME N;  2XY5 A;  3HBT A;  1QQO A;  4GKJ K;  2GUI A;  2O8E A;  3ZET B;  5HRR A;  4AH9 A;  1BL3 A;  2VGN A;  4DF8 A;  3R9P A;  1JKH A;  4AHV A;  4B1V A;  3M6G A;  1BIS A;  5BRF A;  1Z25 A;  3NFA A;  4CF0 A;  2DTU A;  1GLF O;  3NHG A;  1J54 A;  4CF1 A;  4CEB A;  2A41 A;  4BRL A;  1ESV A;  4IWV A;  1FXX A;  1ATR A;  1REV A;  4BG8 A;  2X78 A;  1IBL K;  4FW1 A;  3VEV A;  3L3V A;  3IG1 A;  4E1J A;  4RCH A;  1JXE A;  1YAG A;  2D5R A;  1RNH A;  4E7L A;  4FJK A;  5AQH A;  3VTH A;  2X6N A;  1YVN A;  2QWM A;  2OYQ A;  5JVH L;  4JRP A;  1YJ9 N;  1EKE A;  2VG6 A;  1KTQ A;  2O8F A;  4O55 A;  1XMQ K;  1T8E A;  4DV7 K;  3D2E A;  4B3R K;  1RT6 A;  2VWK A;  4PY5 A;  1W2B M;  3PLA A;  3D2F A;  4CBX A;  3H08 A;  4CJK A;  3NF8 A;  4H8K A;  4DQ8 A;  1NGF A;  1XHZ A;  1TKZ A;  2VQE K;  2WFB A;  1VSL A;  4EAH D;  4WF9 L;  3CJA A;  3D45 A;  1RBV A;  2OTL N;  3AAR A;  5HRS A;  1S1T A;  1WSG A;  4X62 K;  3HP6 A;  4JAX A;  3WEE B;  4DR1 K;  4FWM A;  1ZBU A;  3FLC O;  3O3F A;  3CCS N;  4JKA A;  5M1O A;  4DTO A;  4FJH A;  4PL8 A;  4X65 K;  3ZT2 A;  5KRS A;  3A5M C;  4DLG A;  4BE0 A;  4HTL A;  4NYN A;  3ZT0 A;  3OVN A;  3DLL L;  4KHU A;  3WNE A;  4FPB A;  4M7X A;  3UKR A;  4CFB A;  5K14 A;  3KLF A;  2HHW A;  5EU7 A;  1TGO A;  4ISG A;  5LJV A;  1S1W A;  3ZET A;  2UYT A;  1YIT N;  1WNS A;  5AQS A;  2F96 A;  1RDU A;  1LW0 A;  4WFB L;  1K6Y A;  3OYG A;  3L4Q A;  5AQW A;  1WOQ A;  3QNN A;  2W6K A;  1CXU A;  1VQM N;  3HK2 A;  4LF7 K;  5AQT A;  1KVB A;  4LF9 K;  4BQL A;  5I9E B;  3V1R A;  4OLB A;  1WSI A;  3V9Z A;  3U6F A;  4A57 A;  3VF6 A;  2PAV A;  1RT1 A;  5KGX A;  4LH5 A;  4LY7 A;  2E8A A;  1D5A A;  3D0P A;  4CK1 A;  3LDL A;  1LWF A;  4J8F A;  2QTD A;  2G8V A;  4FZY A;  2WON A;  4YOV A;  2D4W A;  1C1A A;  3QIO A;  3T1H K;  4CEF A;  4DSJ A;  3CC2 N;  2R7Y A;  4M45 A;  4CGD A;  1QHA A;  2VG5 A;  2HW3 A;  3P31 A;  1MWM A;  1GOA A;  2O4G A;  4E7J A;  3WXI A;  2HNZ A;  3P5J A;  5T7B A;  3W0L A;  1QSL A;  2CGL A;  3WQT A;  4CEZ A;  2HB5 A;  1QVF M;  1KLM A;  1OVQ A;  1J6Z A;  3SNN A;  3MN5 A;  1OKJ A;  4OVL A;  4MDA A;  4CHP A;  1U4B A;  4DQI A;  4KPY A;  2ZE2 A;  4CEQ A;  2IAJ A;  2HMI A;  4N76 A;  3GOI A;  4FJN A;  4E1M A;  3WUH A;  1TV6 A;  3I0S A;  3HYF A;  4OPH A;  2B4J A;  3O9R A;  3ALY A;  2OPR A;  4FLW A;  3SAH A;  5HLF A;  1VRU A;  3WEE A;  1SAZ A;  3O9Q A;  4N56 A;  3CQX A;  1QQC A;  4CEO A;  2F7T A;  1IH7 A;  1EQY A;  3M1F A;  3SYZ A;  1TKT A;  2QWQ A;  4KTW A;  2P9L A;  3T3F A;  1X3M A;  2D0O A;  5E41 A;  4ZTJ A;  3F73 A;  4ELT A;  3U4L A;  1BA0 A;  2IC3 A;  1IV0 A;  3C65 A;  4IEI A;  4ZTF A;  2V52 B;  3SUN A;  3AVH A;  5ADX H;  3AVB A;  1YVU A;  4EFH A;  3O4W A;  4CGF A;  1HR0 K;  4CHQ A;  1SV5 A;  4FSV A;  3R8E A;  2W6L A;  4IOA L;  1TAU A;  4BE2 A;  4C23 A;  5ADX A;  2HMP A;  1T3V A;  3OYH A;  2YKN A;  1T03 A;  2O4I A;  2I7N A;  4ILH A;  2F8T A;  3U3G A;  4GW6 A;  2QM1 A;  3BF3 A;  3MXM A;  2HHQ A;  1G99 A;  3LPT A;  1Y64 A;  4CJU A;  1RGI A;  3ATV A;  4E7K A;  1NJZ A;  1EO1 A;  2DPN A;  2RE2 A;  2IS3 A;  3H46 O;  4KBO A;  1WB9 A;  1VK0 A;  5GAG P;  2HHX A;  1X9W A;  3E66 A;  4FJM A;  3TAB A;  1UWB A;  3HO1 A;  1QZ5 A;  5C12 A;  4XH4 A;  4JI1 K;  3T19 A;  4CFA A;  1RIL A;  1K8A O;  3N4P A;  5MLC Q;  3R3L A;  1VQ8 N;  2BTF A;  4A2B A;  2Q36 A;  4C1N K;  1A5X A;  1JLC A;  1E4F T;  1VSJ A;  4BRA A;  3CD6 N;  1XNQ K;  4C8N A;  3VQ8 A;  4CJW A;  1WSH A;  3UB5 A;  1NGG A;  4RW9 A;  3AA2 A;  3EY1 A;  3PUF A;  1VQ6 N;  1VSM A;  5GAH P;  3W3D A;  3TAQ A;  2PYJ A;  4BRF A;  3K5L A;  2ZWH A;  3MDQ A;  1NGD A;  3UKU A;  1VQN N;  3B8A X;  2GBZ A;  4PL7 A;  4IZ9 A;  3OW2 M;  2XY6 A;  2G8F A;  2ATQ A;  4ID5 A;  2E2N A;  2OPQ A;  4KKO A;  1HJO A;  4F8R A;  1NJY A;  1ZBL A;  3HSC A;  3VEZ A;  4HHT A;  3CER A;  2ITM A;  5J1E A;  3NF7 A;  5TKW A;  4DR3 K;  3RR8 A;  1JLB A;  1Q86 O;  1BI4 A;  1YJN N;  3LZI A;  3WXK A;  1SKW A;  1ZBF A;  5JS2 A;  4JV5 K;  4CED A;  2VYP A;  4CEA A;  2NRZ A;  4DMN A;  3AO4 A;  1EET A;  1VRT A;  2A6A A;  2I5J A;  1QVG M;  2PZS A;  5C15 A;  3VF4 A;  3FGU A;  4BG9 A;  4RTF D;  4BRQ A;  1WBD A;  4CFD A;  3OA9 A;  1QTM A;  4E0D A;  4M42 A;  3MXJ A;  1N33 K;  1T44 A;  1L3V A;  4JKC A;  4B9L A;  3CM5 A;  2KKZ A;  3SI6 A;  3V1Q A;  4M3W A;  1ATS A;  2YX6 A;  3JXU A;  2QA4 N;  1TUU A;  4H5W A;  3QEW A;  1GLC G;  3UIQ A;  5AQL A;  4CHY A;  5EOY A;  4YOW A;  3KK1 A;  4ISF A;  3C7N B;  3IAY A;  2YHY A;  3OJU A;  4WE1 A;  3KLG A;  4WFN L;  4FLT A;  1NK7 A;  2QI2 A;  2GWK A;  4CJF A;  3BDP A;  1XC3 A;  5AZI A;  4EP4 A;  1HYS A;  3O6W A;  3RSE A;  4DB3 A;  4H5N A;  1RTH A;  4MQ3 A;  1B9F A;  4NCB A;  3L3U A;  5BRH A;  1XMO K;  4BVP A;  5AQR A;  3U8X A;  1ATN A;  2OPS A;  4JI8 K;  5M1K A;  4PHT X;  4B9N A;  4JRQ A;  4QAG A;  5KPT A;  2I7P A;  5D3G A;  3QES A;  4IFV A;  4GVM A;  3DOL A;  1X3N A;  4E7I A;  2ITG A;  4FWL A;  5HL7 L;  2OCE A;  3FZM A;  5J2N A;  4JK8 A;  4XIU A;  4OGE A;  1GOB A;  5C25 A;  3THW A;  3MN9 A;  3SPY A;  2X6S A;  3AO1 A;  1K73 O;  1M90 O;  1NG9 A;  3MEG A;  2BUP A;  3AO2 A;  4FJX A;  3HP9 A;  3TSP A;  3AA3 A;  3V9X A;  3SQ4 A;  5I42 A;  5FRM A;  1NK4 A;  2HBJ A;  3THV A;  1KRP A;  2KFZ A;  4CD1 A;  2WTU A;  5LMU K;  4FWQ A;  4CES A;  2YHX A;  1HRH A;  1S6P A;  2P5G A;  3OYJ A;  3IKM A;  4BR5 A;  5BRE A;  3IRX A;  2LSN A;  3ZSV A;  3CM6 A;  2AA4 A;  2OZM A;  4BRE A;  3ULD A;  1BOT O;  1HNW K;  3WXJ A;  5C2F A;  2JWL A;  5AZJ A;  3PSF A;  4WFA L;  4U7B A;  4Z4F A;  1JXB A;  1NM1 A;  2HST A;  1VAZ A;  4MLE A;  1UAX A;  3VGL A;  3A5L C;  5M1P A;  3CCJ N;  4RW8 A;  3PX4 A;  5GIP A;  2OA8 A;  2Z1J A;  4ILJ A;  2E4L A;  4JI5 K;  4B3O A;  4AIL C;  3LP3 A;  5AQN A;  3TTC A;  1NGA A;  4A5B A;  1BG3 A;  3LAN A;  4IKF A;  3RTV A;  2YNG A;  3AV9 A;  4CW7 B;  1J5E K;  4UY8 O;  1VQO N;  1A5V A;  2HHU A;  1RDB A;  4JD2 B;  3HT3 A;  1SL2 A;  5HP1 A;  3OBW A;  2HHT A;  1OH8 A;  1HNI A;  3CPW M;  3KLI A;  1NKE A;  1W7A A;  3CF5 L;  1TYQ B;  4K41 A;  4C8K A;  4BDY A;  1RT4 A;  3VET A;  3VQA A;  3U9Z A;  3ULE A;  3L2V A;  4W5O A;  1FKO A;  2P9U A;  3EEQ A;  2EHG A;  4FLX A;  3THX A;  4FWK A;  4DU1 A;  2Q3S A;  4HVJ A;  4K25 A;  3O3H A;  1JCE A;  2YNF A;  4F9O A;  1IKW A;  4DLE A;  4DV2 K;  3NCI A;  1NJW A;  4Z4C A;  4NYF A;  4BY9 C;  3L2U A;  4KI4 A;  3AVF A;  3TAM A;  5CHI A;  5AQJ A;  4YDU A;  4KI6 A;  1KC8 O;  4BDP A;  4Z4G A;  4FWO A;  3Q7B A;  3H1Q A;  3OHR A;  1U49 A;  5AFU A;  2O8B A;  4KB0 A;  1D8Y A;  4B8C A;  4GV9 A;  2G8U A;  3J7Y P;  2VG7 A;  1WBB A;  4XH5 A;  3U9D A;  4LD0 A;  3SZ2 A;  4CEC A;  3DMJ A;  3KZB A;  4I2P A;  4LFC K;  2DFE A;  4R5P A;  3QML A;  3CQ8 A;  1GLL O;  1XUP O;  3KHY A;  4J2B A;  5GAE P;  1JJ2 M;  3CFP A;  3SJH A;  3FZL A;  1D4X A;  4O0J A;  5KQD A;  4DU3 A;  3A2F A;  4O0I A;  2Q97 A;  3CC4 N;  2UUC K;  1MWK A;  1BUP A;  4CIF A;  4B8A B;  4W5T A;  3KK2 A;  4HUE A;  2P9I A;  1HNZ K;  3MEE A;  1LOT B;  3CFO A;  4BRO A;  4U67 L;  3WNF A;  2KQ2 A;  3TAF A;  3H6E A;  1RTI A;  4O44 A;  4KFB A;  4N41 A;  5M1N A;  3B6O A;  2IVP A;  4RG8 A;  3H1V X;  3KWI A;  3SUO A;  1MDU B;  3L6Q A;  2B6A A;  2P9P B;  2Z1G A;  3J80 O;  4FWR A;  2FF3 B;  1RT7 A;  2F9W A;  4H03 B;  1Z05 A;  4DTP A;  3AVJ A;  1WSF A;  3HOS A;  2QKB A;  4HWI A;  3LM9 A;  5EXW A;  2OTJ N;  3SQ2 A;  4BRI A;  3QEP A;  2FBV A;  3KTQ A;  3NGY A;  3CJ7 A;  1V4S A;  2Y1I A;  3VQ7 A;  2NRH A;  3DXK B;  3DXM B;  3AO5 A;  1IG8 A;  1HNV A;  4DQQ A;  1X9J A;  4BR9 A;  4CCH A;  3O3G A;  1CZA N;  2KTQ A;  2QK9 A;  2V51 B;  4QCL A;  1NJI O;  4DSI A;  3LDQ A;  3DI6 A;  4MDB A;  1IJJ A;  4H0X B;  1RCH A;  3TAE A;  4JI0 K;  4FJJ A;  5AQO A;  4CIE A;  4YHH K;  4FM0 A;  4BDZ A;  1RBT A;  4FWP A;  4WCE L;  3DLK A;  3TI0 A;  3OYB A;  2OAN A;  4Z4H A;  4B9S A;  1KAX A;  1BGX T;  3A5N C;  2QWO A;  4B9T A;  3KKR A;  3DLE A;  4HTU A;  4M41 A;  2XO7 A;  4KH5 A;  4FWS A;  2YNH A;  4FLU A; 
#chains in the Genus database with same CATH homology
 1RDC A;  1VSI A;  1TK5 A;  4FXD A;  4DG1 A;  2IC3 A;  4J2D A;  1LAW A;  4OKE A;  4DTU A;  1RT3 A;  1N6Q A;  3HPO A;  4M3R A;  1R0A A;  2YKM A;  3BGR A;  1I3A A;  3K5M A;  4DTJ A;  4ZTF A;  4FCY A;  2BAN A;  3PX6 A;  4Q0B A;  4KV8 A;  4Y1D A;  3SUN A;  3AVH A;  1HMV A;  3CYM A;  3AVB A;  4BWM A;  4DTX A;  1YVU A;  1L5U A;  1LAV A;  2X74 A;  4KTZ A;  4CGF A;  3QEI A;  4UQG A;  4DTS A;  1CXQ A;  4CHQ A;  1SV5 A;  4DU4 A;  1XC9 A;  1L3S A;  3KD5 E;  3VA3 A;  3QLH A;  1TAU A;  1VSH A;  4BE2 A;  3PV8 A;  4CJV A;  3ZSO A;  4E19 A;  3OYH A;  2YKN A;  4FJ8 A;  4E3S A;  4N5S A;  4FLZ A;  3SV4 A;  1T03 A;  2O4I A;  3OYE A;  3K57 A;  3PO4 A;  3RRG A;  2F8T A;  4FJI A;  3U3G A;  5DMR A;  4GW6 A;  3M8R A;  2KZM A;  3MXM A;  3OS1 A;  2HHQ A;  3AVM A;  3LPT A;  2A1S A;  4PWD A;  4CJU A;  1WN7 A;  4E7K A;  1NJZ A;  5CZ2 A;  2IDO A;  4YNQ A;  3K5N A;  4DQS A;  3EYZ A;  3PO5 A;  4KHY A;  1HQU A;  2W42 A;  3VQC A;  4H4O A;  2IS3 A;  3AVI A;  4J2A A;  4YFU A;  1VK0 A;  3TWH A;  3OYI A;  2NUB A;  5J2Q A;  2HHX A;  2HHV A;  1X9W A;  1QHT A;  4I9Q A;  2HVH A;  4FJM A;  1S6Q A;  3TAB A;  3T1A A;  1S5J A;  4CJT A;  1UWB A;  3DYA A;  2BGG A;  3HO1 A;  4DFJ A;  4Y1C A;  3T19 A;  4CFA A;  3QIP A;  1IKY A;  1RIL A;  3KKS A;  2Z1I A;  4KTQ A;  1J5O A;  4EZ6 A;  3ZSR A;  1BQM A;  1EX4 A;  1GOC A;  3V4I A;  4ELV A;  3SQ1 A;  1A5X A;  4OJR A;  1XWL A;  2YHA A;  1JLC A;  3OS2 A;  2BDP A;  2YNI A;  3DRR A;  1VSJ A;  3EZ5 A;  3NGZ A;  1MU2 A;  2F8S A;  3CFR A;  4C8N A;  3JSM A;  3TAR A;  1X9S A;  3VQ8 A;  4CJR A;  4K8Z A;  4CJW A;  1WSH A;  3ISN C;  1BIZ A;  2FC0 A;  3L8B A;  3RRH A;  1L3T A;  4RW9 A;  3AA2 A;  4DFM A;  4FW2 A;  4Q5V A;  3PUF A;  4G1Q A;  3EY1 A;  1UA1 A;  1VSM A;  1JLG A;  2G8W A;  3LP1 A;  1J53 A;  1TKX A;  3HM9 A;  3TAQ A;  1CLQ A;  4HUG A;  2PYJ A;  3WNH A;  4M3Y A;  2D0B A;  4KO0 A;  3K5L A;  3DLR A;  3NDK A;  3DRS A;  4FZZ A;  4M3T A;  1TL1 A;  3AVL A;  1RDA A;  1NOY A;  1BQN A;  3K59 A;  4M3Z A;  1KVA A;  2DFF A;  2Z1H A;  4FLY A;  4DS4 A;  2GBZ A;  4ZHR A;  4DTN A;  1NK9 A;  4BE1 A;  2XY6 A;  2G8F A;  2ATQ A;  2XHB A;  4ID5 A;  2OPQ A;  3HJF A;  3VQ9 A;  1C0M A;  4KKO A;  2PY5 A;  1ZBI A;  3KIO A;  4F8R A;  4TSX A;  1NJY A;  1B92 A;  4DSF A;  1ZBL A;  3C6T A;  3QEX A;  1X1P A;  3O4Q A;  4RW6 A;  4OKJ A;  5C24 A;  1U04 A;  3OYD A;  4HHT A;  1G15 A;  4CHO A;  4I9L A;  4AHT A;  5J1E A;  1YT3 A;  3B6P A;  2XRI A;  3LDS A;  2DFH A;  5SWM A;  3OYN A;  3NF7 A;  3ZSQ A;  3NAE A;  3RR8 A;  3ITH A;  3QER A;  1JLB A;  5CY4 A;  3MED A;  4ID1 A;  1QSS A;  1BI4 A;  3LZI A;  1JL2 A;  3M8Q A;  3KLH A;  3MAQ A;  3TR8 A;  2JGU A;  2OPP A;  4CK2 A;  3S3N A;  4C8M A;  2FBY A;  5KI6 A;  1SKW A;  3LWL A;  1ZBF A;  1SL1 A;  5JS2 A;  3K2P A;  4JS4 A;  1SL0 A;  1NK8 A;  4CED A;  4KHW A;  4CEA A;  3OYK A;  4F2R A;  2FBT A;  4FJ5 A;  4DMN A;  3AO4 A;  1EET A;  4I7F A;  1VRT A;  1QE1 A;  2I5J A;  1RTJ A;  4ICL A;  1TK0 A;  2PZS A;  3P83 D;  3NH0 A;  4DSL A;  3E01 A;  3ZT3 A;  1DLO A;  1YTA A;  4DTR A;  3VQ6 A;  4Z4E A;  1W0H A;  3QNO A;  4DSK A;  1XHX A;  3RMD A;  4PQU A;  2B5J A;  4CFD A;  1HJR A;  4DQR A;  1QTM A;  4E0D A;  3MXJ A;  4M42 A;  3V1O A;  3VQP A;  5JS1 A;  3ASM A;  3IS9 A;  1Q9Y A;  4BAC A;  1L3V A;  1U47 A;  4B9L A;  3CM5 A;  1N5Y A;  3SI6 A;  4CK3 A;  3V6D A;  3AVC A;  3V1Q A;  1S9G A;  1O1W A;  1WLJ A;  3FFI A;  2YV0 X;  3KK3 A;  3HPG A;  3HST B;  4PA1 A;  4N47 A;  2HND A;  4MFB A;  5HRN A;  3OYC A;  3VA0 A;  2E6M A;  4NCG A;  3M8S A;  3QEW A;  1HYZ A;  4RW7 A;  1T05 A;  3TAN A;  3OJS A;  1Y97 A;  4CHY A;  3UIQ A;  3HXM A;  4CGG A;  3RWU A;  4FLV A;  1RT2 A;  3KK1 A;  2KZZ A;  4CJ5 A;  3LWM A;  4ELU A;  4FM1 A;  3OYA A;  3HPH A;  3IAY A;  1CZ9 A;  1YTU A;  1S9E A;  4H4M A;  3LAL A;  5FDL A;  3OYL A;  1TKD A;  3OJU A;  4WE1 A;  3KLG A;  4FLT A;  1ITG A;  1BCM A;  3U3Y A;  1LWE A;  1NK7 A;  4PUO A;  4F3T A;  1VSF A;  2E6L A;  3LP0 A;  5J2P A;  1RBR A;  1RBU A;  1SUQ A;  4AHS A;  1IO2 A;  4QOZ B;  4CJF A;  2ZQB A;  1RDD A;  1U45 A;  3BDP A;  4M3U A;  1WAF A;  3NH1 A;  3OY9 A;  2XY7 A;  2PYL A;  4IBN A;  2ETJ A;  4EP4 A;  4CF2 A;  3I8D A;  5SZT A;  1HYS A;  3P1G A;  4LH4 A;  1UA0 A;  3V9S A;  4LSN A;  1NOZ A;  3G0Z A;  3NE6 A;  4EP5 A;  3M8P A;  1L3U A;  1RTH A;  2HHT A;  1ASV A;  5FRO A;  4MQ3 A;  2QXF A;  3ZSW A;  1B9F A;  1Z26 A;  4I2Q A;  4HUF A;  4NCB A;  1EP4 A;  1RBS A;  3L3U A;  3HVR A;  4CHZ A;  4IDK A;  4DSE A;  3SJJ A;  4OGC A;  3V9W A;  2OPS A;  3NBP A;  2A1R A;  4KB1 A;  4DFP A;  3RMB A;  1TVR A;  3AA4 A;  3SQ0 A;  4RW4 A;  1NK6 A;  4FJG A;  1KVC A;  1KFS A;  4JRQ A;  4OPJ A;  4QAG A;  4B9N A;  1ZBH A;  4HCC A;  3ZSX A;  5D3G A;  1S1U A;  3VQE A;  3OS0 A;  3LP2 A;  5CYM A;  3HL8 A;  3QES A;  3VQQ A;  4FJ7 A;  1HQE A;  4IFV A;  4GVM A;  3DOL A;  4OKK A;  4OPK A;  3DLB A;  4E7I A;  2ITG A;  1D9F A;  3L2R A;  1NK5 A;  4K8X A;  5J2N A;  4XIU A;  4CJ3 A;  4OGE A;  1GOB A;  1SKS A;  1EXQ A;  3NF9 A;  1WSJ A;  5C25 A;  4DFK A;  1Q9X A;  4FK0 A;  3VN5 A;  2X6S A;  3V81 A;  3SPY A;  1LWC A;  3PY8 A;  1RT5 A;  3AO1 A;  3NH2 A;  1S1X A;  2XY5 A;  4FK4 A;  3MEG A;  3AO2 A;  4FJX A;  3HP9 A;  3AA3 A;  3V9X A;  3SQ4 A;  5I42 A;  4NCA A;  5FRM A;  2GUI A;  3LAM A;  4OLA A;  3AVK A;  1NK4 A;  5HRR A;  3THV A;  1KRP A;  4AH9 A;  1BL3 A;  2KFZ A;  4DF8 A;  3QO9 A;  4CES A;  1JKH A;  4F4K A;  1HRH A;  1S6P A;  2P5G A;  3OYJ A;  1LV5 A;  4EZ9 A;  2DY4 A;  3IRX A;  1B9D A;  2LSN A;  4O4G A;  4AHV A;  3ZSV A;  4CJL A;  3CM6 A;  2RPI A;  4B9V A;  1KLN A;  2G8H A;  2FBX A;  5HBM A;  2OZM A;  3ULD A;  1U48 A;  2EX3 A;  1BIS A;  2RKI A;  1Z25 A;  3NFA A;  4CF0 A;  2DTU A;  4KHQ A;  3NHG A;  1J54 A;  1IKV A;  4CF1 A;  1NKC A;  4Z4F A;  4F2S A;  1JXB A;  4E89 A;  4CEB A;  3CG7 A;  1UAX A;  2AJQ A;  4O5B A;  3S3M A;  1BIU A;  3LPU A;  3O4N A;  1FXX A;  3QEV A;  1REV A;  2P51 A;  2X78 A;  1NJX A;  2G8K A;  4Z4I A;  1HYV A;  4RW8 A;  4CGH A;  4FW1 A;  3PX4 A;  2OA8 A;  3SCX A;  2Z1J A;  1T7P A;  3L3V A;  3IG1 A;  3DLG A;  3AVG A;  2E4L A;  1S1V A;  4W5R A;  1KFD A;  2JLE A;  4M3W A;  1JXE A;  4B3O A;  1RTD A;  2D5R A;  4AIL C;  3LP3 A;  2XY8 A;  3SUQ A;  2D0C A;  1RNH A;  3LAN A;  1A5W A;  4E7L A;  3RTV A;  4IKF A;  2YNG A;  4FJK A;  3AV9 A;  4CJ4 A;  2X6N A;  2OYQ A;  1A5V A;  2HHU A;  4JRP A;  2G8I A;  1RDB A;  1EKE A;  2HNY A;  4DQP A;  3HT3 A;  2VG6 A;  1KTQ A;  4DTM A;  4O55 A;  2Y1J A;  5HP1 A;  3AVA A;  1SL2 A;  2BE2 A;  1JLA A;  1T8E A;  2OZS A;  3C95 A;  1HNI A;  1KSP A;  1WAJ A;  3KLI A;  4E7H A;  1NKE A;  1JLQ A;  1RT6 A;  2VWK A;  5KGW A;  4PY5 A;  1LW2 A;  1QSY A;  1WSE A;  3SV3 A;  4C8K A;  1W9H A;  1NKB A;  4JLH A;  3DOK A;  3H08 A;  3QIN A;  4BDY A;  1RT4 A;  4CE9 A;  3VQA A;  4CJK A;  3NF8 A;  4H8K A;  4FJL A;  3L2V A;  4W5O A;  1XHZ A;  4CF8 A;  1FKO A;  1TKZ A;  3K58 A;  3ZT4 A;  1VSL A;  3TAP A;  2EHG A;  4FLX A;  3ZCM A;  3D45 A;  3WNG A;  1RBV A;  5HRS A;  1S1T A;  4DU1 A;  1WSG A;  2Q3S A;  3G10 A;  4HVJ A;  1BI4 B;  2YNF A;  3O3H A;  1IKW A;  3HP6 A;  1QS4 A;  4FVM A;  3JYT A;  4DLE A;  3TAG A;  3NCI A;  1ASU A;  1NJW A;  1ZBU A;  3O3F A;  4Z4C A;  4JS5 A;  1VSD A;  2ZD1 A;  4NYF A;  4W5Q A;  1IKX A;  4CJQ A;  3L2U A;  4KI4 A;  3AVF A;  3TAM A;  1VSK A;  4BWJ A;  5KRT A;  4DTO A;  1F21 A;  4KI6 A;  3ZT1 A;  3L2W A;  4BDP A;  4FJH A;  1BHL A;  4Z4G A;  3SZ2 A;  4C8L A;  3ZT2 A;  5KRS A;  4DLG A;  4BE0 A;  5C42 A;  4NYN A;  2IGI A;  4B08 A;  4FYD A;  3ZT0 A;  3OVN A;  3DLH A;  1U49 A;  1DTT A;  3RMC A;  3WNE A;  4KHU A;  1Q8I A;  4KB0 A;  4FJ9 A;  4CFB A;  5K14 A;  3KLF A;  1D8Y A;  2HHW A;  3KD1 E;  4B8C A;  5EU7 A;  3NF6 A;  1TGO A;  2G8U A;  2VG7 A;  5FRN A;  3I0R A;  1S1W A;  1WNS A;  2KW4 A;  1JL1 A;  2F96 A;  3F9K A;  1LW0 A;  3DMJ A;  4LD0 A;  4I2P A;  4AHR A;  2DFE A;  4CEC A;  1CZB A;  4E1N A;  1K6Y A;  4R5P A;  3OYG A;  3CQ8 A;  4IFY A;  1TK8 A;  3QNN A;  4J2B A;  1CXU A;  5I3U A;  5CZ1 A;  4AHC A;  4B9U A;  3LAK A;  3CFP A;  3AA5 X;  4O0J A;  3HK2 A;  1SKR A;  3MXI A;  1TL3 A;  1KVB A;  3A2F A;  4O0I A;  4DU3 A;  4KHS A;  3V1R A;  4CJP A;  4OLB A;  1WSI A;  3V9Z A;  3QET A;  3U6F A;  5HRP A;  4CEE A;  1RT1 A;  4CIF A;  5KGX A;  1D9D A;  4CER A;  4B8A B;  4W5T A;  4FZX C;  4LH5 A;  3KK2 A;  4KRF A;  4LY7 A;  1IG9 A;  1D5A A;  4Z0U A;  4HUE A;  3V9U A;  4L8R B;  3MEE A;  3D0P A;  4CK1 A;  3S3O A;  3CFO A;  1LWF A;  4CHN A;  1VSE A;  3WNF A;  2KQ2 A;  4CJE A;  1TAQ A;  2QKK A;  2P5O A;  4DS5 A;  2G8V A;  3SUP A;  4FZY A;  2WON A;  3VQ5 A;  3TAF A;  2RN2 A;  1RTI A;  4CJS A;  4O44 A;  1DTQ A;  3AO3 A;  4KFB A;  5KTQ A;  1NK0 A;  1C1A A;  3QIO A;  1UOC A;  5HRO A;  1ZYQ A;  4N41 A;  4CGJ A;  4CEF A;  4DSJ A;  3AVN A;  3B6O A;  3C6U A;  4RG8 A;  3VQB A;  3S9H A;  2R7Y A;  4B9M A;  4M45 A;  4CGD A;  3SUO A;  4HCB A;  2VG5 A;  2HW3 A;  2B6A A;  3KLE A;  3DRP A;  1GOA A;  2Z1G A;  2O4G A;  4GMJ B;  4E7J A;  3OYF A;  2HNZ A;  2IOC A;  3P5J A;  2RF2 A;  3VQD A;  1RT7 A;  1I39 A;  5T7B A;  4DF4 A;  1QSL A;  3MEC A;  1JLE A;  4CEZ A;  4KRE A;  2HB5 A;  3AVJ A;  4DTP A;  4W5N A;  2GV9 A;  1WSF A;  3SPZ A;  1C0T A;  2QKB A;  1KLM A;  3LZJ A;  3SNN A;  1X9M A;  3SQ2 A;  3QEP A;  4FK2 A;  2FBV A;  1XI1 A;  3KTQ A;  4OVL A;  4F3O A;  4CHP A;  1U4B A;  3NGY A;  4DQI A;  3OYM A;  4KPY A;  2ZE2 A;  1JLF A;  5J2M A;  4IG3 A;  4CEQ A;  2IAJ A;  2Y1I A;  2HMI A;  1C6V A;  4FM2 A;  4N76 A;  3VQ7 A;  5DK5 A;  4FJN A;  1BCO A;  4IG0 A;  3ZSY A;  4E1M A;  1TV6 A;  4DWI A;  3I0S A;  3HYF A;  3AO5 A;  1HNV A;  2B4J A;  4DQQ A;  4CCH A;  3O3G A;  1C1B A;  3HVT A;  4M3X A;  3ALY A;  3ZSZ A;  1C0U A;  2VWJ A;  2KTQ A;  2QK9 A;  3L2Q A;  4QCL A;  2OPR A;  4FLW A;  4DSI A;  5HLF A;  3NGI A;  3DI6 A;  4CFC A;  1VRU A;  1FK9 A;  1RCH A;  4N56 A;  3VQ4 A;  3KJV A;  4KHN A;  2D0A A;  4KAZ A;  1C1C A;  1QQC A;  3TAE A;  1KCF A;  2YHB A;  3RMA A;  3K5O A;  4CEO A;  1IH7 A;  5CYQ A;  4FJJ A;  3SYZ A;  4CIE A;  4FM0 A;  1TKT A;  4BDZ A;  1RBT A;  4LSL A;  4CGI A;  3DLK A;  1FKP A;  4KTW A;  4CIG A;  3OYB A;  3TI0 A;  4Z4H A;  4B9S A;  2KFN A;  3T3F A;  1ASW A;  1J9A A;  2WOM A;  3C94 A;  4C8O A;  2HVI A;  2HHS A;  1BGX T;  5E41 A;  4ZTJ A;  3PX0 A;  1HPZ A;  4B9T A;  3F73 A;  3KKR A;  3DLE A;  4AHU A;  4CF9 A;  4M41 A;  4HTU A;  3DM2 A;  2XO7 A;  2P1J A;  4ELT A;  3RR7 A;  4J2E A;  2YNH A;  4FLU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...