2FBTA

Wrn exonuclease
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
total genus 61
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbtA00
2E6MA 3EY1A 4FJLA 3I0RA 3TAFA 4C8NA 3RTVA 2I5JA 1BIZA 3PV8A 3PY8A 3LZIA 2XHBA 5FDLA 1JLQA 1S1WA 3OYGA 1BL3A 4HHTA 2B6AA 3KJVA 4LY7A 4NCGA 4CJPA 4ELUA 4I2PA 4F3OA 1XI1A 3C6TA 1W0HA 4JLHA 5CYQA 4DTMA 5HRPA 1KSPA 3LALA 1MU2A 2X6SA 4CIFA 3V81A 3PUFA 1N6QA 4EZ9A 3QESA 1UWBA 4EP4A 3KIOA 3AO5A 4FJ8A 1DTQA 3QO9A 2IC3A 4PQUA 3WNFA 3NAEA 4C8KA 1FXXA 1O1WA 3CFOA 4LD0A 2WOMA 1SUQA 1BHLA 3C95A 4FW1A 3KK2A 4HUFA 2VG5A 4DTPA 2G8HA 1YVUA 4IKFA 2P1JA 2X78A 4BE1A 1NK7A 3HO1A 4DFKA 3D0PA 4E7IA 4RW6A 4FZZA 2HHQA 4Z4CA 5C42A 4OGCA 4N5SA 3K59A 1ASVA 5HRRA 1C6VA 1ITGA 3OS1A 1U4BA 4E0DA 1W9HA 1D8YA 2XY5A 1L3SA 4KO0A 1YTAA 3AVBA 1NK6A 1CXUA 1RDCA 3RMBA 4CJQA 3HM9A 3BGRA 4FJ7A 5J2NA 5KGXA 3ZT2A 1K6YA 3ALYA 4Y1CA 4H4MA 4DSKA 4F3TA 2DFHA 4QOZB 2HHTA 1TKDA 2JLEA 4NYFA 3AVHA 1L3VA 1QS4A 1Z26A 3OS0A 4BWJA 4YFUA 3OYMA 1TKTA 4FLYA 1ZBUA 3O3HA 1XHXA 1WSEA 4M45A 2A1RA 3DRRA 1ZBFA 5FRNA 4CE9A 4FW2A 4FLTA 4HUGA 3C6UA 3AA3A 1JLGA 4RW9A 4KB1A 1HYVA 3VQCA 2X6NA 4DF8A 2FBXA 3G10A 1FK9A 3PX0A 1XC9A 3O3FA 1NK9A 2JGUA 2G8WA 3K5OA 2ATQA 4CJLA 3QEXA 3HSTB 4YNQA 4W5OA 4LH5A 4FZXC 1IKXA 4FK4A 1RDBA 3QIOA 1HQUA 2HHXA 1NOZA 1S1VA 3NF6A 3K2PA 4CIEA 4L8RB 3SPZA 1NK8A 4E7KA 4QAGA 2YHAA 2XO7A 4CHQA 4BDZA 3QNOA 3O4QA 1WAFA 3SUNA 4F4KA 3DMJA 3HYFA 2BE2A 4FJ9A 3RRHA 1U47A 1WSHA 3TAGA 2G8VA 3RR7A 4M3YA 2IAJA 1B9DA 3OYFA 1RT1A 2XRIA 3LWMA 3SV3A 1NJZA 2OZMA 4KHUA 3RR8A 3TI0A 1KRPA 1RILA 1EX4A 2GV9A 5SWMA 3ZSOA 4AHUA 2E4LA 3F73A 3AVKA 3S3MA 4DU1A 4KKOA 3LAKA 2PYJA 4JS5A 4Y1DA 1D5AA 4XIUA 4CGIA 4DQPA 1JLEA 4ELVA 1RT4A 2DY4A 1S9EA 1VSEA 1RBTA 3IAYA 2ETJA 4MQ3A 1ZBHA 2HHWA 4CJUA 3DLRA 3L2VA 2O4GA 3AVJA 3DLHA 2YKMA 3ZSVA 3L2UA 3NCIA 4DLGA 3KLHA 3K57A 3AO1A 3MEEA 5HBMA 1KFSA 4OPKA 4CHOA 4KV8A 4DFJA 4OGEA 5J2MA 4B8CA 4NCAA 3ZSZA 2KZMA 3V9WA 4CJTA 4CJKA 2P51A 4KAZA 1U04A 2FBYA 2F8SA 1HQEA 3NDKA 4CEOA 4CHPA 2FBVA 3VQPA 1L3TA 3TABA 3RMDA 2KFNA 1RCHA 3B6PA 3DLGA 1TL3A 3CQ8A 1KCFA 4IFYA 4AILC 1S1UA 4DTSA 1TV6A 4FLVA 4O4GA 3NFAA 1TKXA 1RT2A 1TGOA 3OVNA 3AVCA 1NKCA 4J2DA 2F8TA 3NF7A 1N5YA 4NCBA 3ZT0A 4EP5A 4M3ZA 3P1GA 2E6LA 4B08A 1LAWA 4CK3A 1J5OA 4CEFA 5KRTA 3LPUA 1J54A 1NJXA 3SQ4A 3B6OA 1IKYA 3P83D 3VQEA 1S6QA 4CF0A 3HPGA 4CGHA 4CGJA 4FM2A 1S1XA 3U3GA 2PYLA 1KLMA 4O0JA 4B9MA 1C0UA 3T1AA 4BE2A 1ZBIA 5KI6A 3SQ2A 4C8MA 2A1SA 3NF9A 4ID1A 3AVIA 2WONA 3AVNA 4CK1A 4JS4A 3S3NA 4KTQA 4KHQA 5D3GA 2HW3A 3DLEA 1IG9A 4E19A 3EYZA 1NKEA 1C1CA 3QEIA 4B9VA 1J9AA 3IS9A 1RT7A 2O4IA 3V9ZA 4FK2A 4DFPA 2HNDA 4R5PA 2Y1IA 3CM6A 1X9SA 3ASMA 3IRXA 3V4IA 2XY8A 3QLHA 3SQ1A 2AJQA 3V9XA 1VK0A 3M8QA 2RKIA 5FRMA 3LP2A 3KK1A 3HJFA 1BCOA 2BANA 3VA3A 3DOLA 3KD5E 4DTXA 4DTJA 2PZSA 3K5LA 2EHGA 4M3WA 3F9KA 2YNGA 1XWLA 4BACA 1BISA 1BGXT 2HHVA 5C24A 5J2PA 1NK5A 4PWDA 2D0BA 3DRSA 3CFRA 3DM2A 2KZZA 4C8LA 3TWHA 4I9LA 1IH7A 5SZTA 4Q5VA 3HVRA 1EP4A 4DQQA 1XHZA 2VG7A 1BCMA 4OJRA 4CEAA 3DLKA 4CEQA 1VSMA 2OPSA 5EU7A 3U6FA 1WLJA 3MXMA 4LH4A 3OS2A 3VQBA 2ZQBA 1LWFA 2Z1IA 4EZ6A 2LSNA 1RT5A 2BDPA 4J2AA 2OPRA 1HNIA 1FKPA 3OYLA 4MFBA 4CJ3A 4KRFA 1VSDA 3SUQA 4DSFA 3I8DA 4DTRA 3TANA 4OLAA 3QERA 1T8EA 3DRPA 3P5JA 2ZE2A 1HNVA 5HLFA 1Q9XA 1RT6A 1RBVA 1JL2A 3VQAA 3ZSWA 3AA5X 3LAMA 4IDKA 4E3SA 4E7JA 2GUIA 2ITGA 4IFVA 1Q9YA 1T05A 4F2SA 5CZ2A 4CHNA 4DSEA 4DU3A 4RW7A 4FJGA 3QEVA 3ZSXA 1RTIA 1CZBA 1JKHA 4N56A 1REVA 5T7BA 4PUOA 4CJ5A 2B4JA 2B5JA 4FJJA 2G8IA 2Z1JA 4DTNA 4FJNA 3TAPA 2OZSA 2KFZA 2QK9A 5JS2A 1NK4A 1TK5A 1U45A 4M3TA 1B9FA 4CJRA 3ZT4A 1L5UA 1GOCA 4DSIA 1KVCA 1C0TA 3HXMA 1Y97A 1JLAA 3VN5A 4FM1A 3SPYA 3NBPA 3I0SA 4E1NA 1TKZA 4CJFA 4O0IA 1T7PA 4OLBA 3L3VA 3K5MA 3L2WA 3S3OA 4CF9A 4OPJA 3VA0A 4KB0A 2BGGA 1YTUA 1BQNA 2NUBA 1HYSA 1RTJA 1RDAA 3HT3A 5JS1A 1LAVA 3VQ5A 4B9LA 3OYKA 1VRTA 1X1PA 4I7FA 3OJUA 1LW0A 3KLFA 4KHWA 1S1TA 1TVRA 4O5BA 1EKEA 4DMNA 2XY7A 4CEZA 1TAUA 3SCXA 3MXIA 4CFAA 4KPYA 4I9QA 4DS4A 5I3UA 1RBSA 2YNIA 4FVMA 1RDDA 4F8RA 3ZSRA 3QEPA 4CHZA 2Z1HA 3FFIA 4CJEA 1T03A 3LANA 5HP1A 2DFEA 5J1EA 4DS5A 1Z25A 3ISNC 2HVHA 4IG3A 5CZ1A 4FLUA 2W42A 3LZJA 1EXQA 3M8SA 3ZSYA 1D9DA 5DK5A 4DSLA 3WNHA 2VG6A 3IG1A 3V1QA 3HP6A 4FLWA 2R7YA 4DSJA 3HK2A 4M3RA 1UA0A 3TAMA 4CJWA 3CYMA 4ZTJA 5E41A 4DF4A 3AVAA 4Z0UA 4CF2A 5KTQA 3SUOA 3VQQA 3OJSA 3AVFA 3ITHA 3VQ4A 3CM5A 4KTZA 4AHCA 4HUEA 3SNNA 1TK8A 2G8FA 4Z4EA 2HVIA 1BQMA 2RF2A 4CEBA 1RT3A 2HMIA 2XY6A 4FJKA 2OA8A 3VQDA 3PO4A 1JLFA 3O4NA 1VRUA 3AVMA 4DTUA 3UIQA 4KHNA 4CJVA 3OYNA 1A5XA 3RMCA 4FJ5A 3TAEA 1VSHA 2HNYA 1G15A 1VSJA 3M8RA 2HNZA 3LDSA 4CESA 1JXBA 1NJYA 4FJHA 4HTUA 4O44A 2EX3A 2IOCA 4HVJA 1S6PA 1HPZA 3HPOA 4NYNA 3THVA 3S9HA 3HVTA 4BDPA 4Z4GA 2FC0A 3QETA 4M42A 3VQ7A 4CEDA 2G8KA 4K8ZA 1FKOA 3DI6A 5C25A 1L3UA 3AO4A 1Q8IA 3RWUA 1VSKA 4FM0A 1DTTA 3AO3A 4AHSA 4J2BA 4B3OA 1NKBA 5I42A 4LSLA 4CFDA 3OYJA 5KGWA 2Q3SA 3L8BA 4DQSA 4Z4FA 2VWJA 4CECA 1SV5A 4AHTA 1JLCA 3ULDA 3LP3A 4RW8A 1WSFA 3DYAA 4DTOA 1CZ9A 3SJJA 2Z1GA 4CIGA 3CFPA 2OPQA 3SZ2A 1WNSA 3K58A 1TL1A 3KLIA 1RBUA 4B9SA 1SKWA 1I39A 3C94A 3JYTA 2P5GA 4CCHA 4FJMA 4KI6A 3KK3A 3OYHA 4AH9A 3KKRA 3V1RA 4DQIA 4FLXA 4FJIA 3L2QA 1IO2A 4FYDA 4CERA 5J2QA 4CEEA 4QCLA 4W5TA 1NJWA 4DWIA 1BI4B 3ZT3A 3O3GA 4DLEA 1LV5A 3OYBA 4PA1A 4GW6A 3ZT1A 1EETA 1KTQA 4Z4HA 1F21A 3QNNA 2YV0X 4IBNA 3OYCA 2PY5A 4N76A 4KREA 4CGGA 4ZTFA 3E01A 1KVBA 2HB5A 3LPTA 4CGDA 4DG1A 3NHGA 5K14A 3SI6A 4AHRA 1IKVA 3VQ9A 3CG7A 1VSIA 3TR8A 2ZD1A 4RW4A 3SUPA 4AHVA 4I2QA 3NH0A 3K5NA 3L3UA 4G1QA 3SV4A 1UA1A 3PX4A 4B9NA 1JLBA 3A2FA 5KRSA 1C1BA 5DMRA 1WN7A 3LP0A 1TAQA 3OYIA 3ZSQA 4KHYA 1QQCA 3ZCMA 1SL2A 2DTUA 3MECA 1SKRA 4BE0A 4H4OA 1I3AA 1SL1A 3KTQA 4PY5A 4B9TA 4J2EA 4ID5A 4Q0BA 5HRSA 2F96A 3AV9A 1UOCA 4OKJA 4W5NA 3SQ0A 2DFFA 4TSXA 4BDYA 3QINA 1ASWA 1VSFA 4B8AB 3M8PA 4M3XA 3U3YA 2YNHA 4W5RA 1NK0A 1ZYQA 3BDPA 2YKNA 2IDOA 3KD1E 1GOBA 1WAJA 3MEGA 3V9UA 1C1AA 1ZBLA 4E1MA 4FZYA 2KQ2A 3NGYA 4ZHRA 1KLNA 2G8UA 2IGIA 4M3UA 3T19A 2YHBA 1QSLA 4W5QA 2YNFA 3KLGA 1SKSA 2QKKA 4KHSA 1QSSA 4E7HA 3QIPA 2KW4A 3AO2A 3PX6A 3RRGA 3VQ8A 4OKKA 1RBRA 3V9SA 4OVLA 3L2RA 1S9GA 1TK0A 3WNEA 3TARA 1U49A 3MXJA 2QKBA 1VSLA 4CFCA 1QTMA 2OYQA 1KVAA 4CJSA 1DLOA 1RNHA 3SYZA 4CGFA 3NE6A 4UQGA 1HYZA 2IS3A 1BI4A 3HP9A 3T3FA 4KI4A 1JL1A 3MEDA 1J53A 4K8XA 1RTDA 4H8KA 4CJ4A 3OYEA 3DOKA 1QHTA 4ICLA 4FJXA 5FROA 2RPIA 3QEWA 5HROA 1X9WA 2P5OA 1CLQA 3TAQA 1X9MA 3NF8A 1QE1A 4CK2A 4HCCA 2KTQA 1WSGA 3V6DA 3EZ5A 4E7LA 4HCBA 3AVLA 3DLBA 4CF1A 3D45A 4CHYA 3HL8A 4RG8A 1D9FA 2RN2A 3HPHA 4M41A 1HJRA 4FXDA 3NGZA 3RMAA 4DQRA 1WSJA 1BIUA 4FCYA 1A5WA 1JXEA 3AVGA 2HHUA 3LWLA 1IKWA 3V1OA 2HHSA 2VWKA 1C0MA 1ASUA 3MAQA 1WSIA 4FK0A 3WNGA 3KLEA 1UAXA 4DFMA 4N41A 1LWEA 3PO5A 5CYMA 4JRQA 2QXFA 3AA2A 1A5VA 3NH2A 4BWMA 2GBZA 3NH1A 1RTHA 4WE1A 3JSMA 3NGIA 3KKSA 4DU4A 2FBTA 4GVMA 1QSYA 4C8OA 4KFBA 3AA4A 4LSNA 3OY9A 2Y1JA 3OYDA 1CXQA 2D0AA 4O55A 4CFBA 1LW2A 1R0AA 2X74A 3G0ZA 1HMVA 4E89A 4B9UA 3H08A 4KTWA 1GOAA 4N47A 4CF8A 3OYAA 1HRHA 2D5RA 1LWCA 1NOYA 4ELTA 3LP1A 2OPPA 4IG0A 4FLZA 4Z4IA 4OKEA 1KFDA 1YT3A 1U48A 1SL0A 4F2RA 2D0CA 4JRPA 5HRNA 3VQ6A 1B92A 5CY4A 1S5JA 4GMJB
chains in the Genus database with same CATH superfamily
3EY1A 3O80A 4FJLA 3ATUA 3PV8A 2RHKA 5FDLA 2FLOA 3I8BA 2B6AA 3S41A 3IKMA 5LMUK 5AQJA 1W0HA 4DTMA 5HRPA 5AJ3K 1KSPA 4CIFA 2X6SA 3PUFA 1ZBSA 1HUXA 4FJ8A 1DTQA 4GKKK 4PQUA 5E84A 1O1WA 4HUFA 4LFBK 1SUQA 3C95A 2VG5A 1NK7A 2O8BA 3H45C 4RW6A 4Z4CA 4OGCA 3FGUA 2ZJRL 2XY5A 1L3SA 4KO0A 2BTFA 1S3XA 3ZLJA 1NK6A 5FPMA 4CJQA 4FWNA 4V19S 4BC3A 5KGXA 3CCVN 2GELA 1K6YA 4Y1CA 4X65K 3SJHA 1TKDA 2JLEA 1O13A 2QI2A 1Z26A 3OS0A 3OYMA 2QEXN 4YFUA 3P31A 1TKTA 2A1RA 3O9TA 5FRNA 3C6UA 2D0PA 4RW9A 1FK9A 5ELZA 3BY5A 3O3FA 2G8WA 4DB3A 4A5AA 3QEXA 4FZXC 1HQUA 4H5TA 1S1VA 2F9WA 3NF6A 3K2PA 4CI6A 3G25A 2XO7A 4KB0A 3SUNA 4F4KA 1WAFA 1ZC6A 1R59O 2BE2A 2OANA 5C12A 3SAGA 1U47A 1WSHA 4B1XB 3RR7A 4M3YA 1HKCA 1NJZA 1RGIA 2OZMA 2GTDA 2F7TA 3T1HK 4QS9A 5LMNK 2E4LA 1HPMA 3S3MA 4KKOA 4XIUA 5KQDA 4C1NI 3TSUA 3VEZA 2V52B 2HHWA 5C2FA 3DLRA 2O4GA 3AVJA 1M90O 2ASPA 3ZSVA 2GUPA 3KLHA 3K57A 3AO1A 1KFSA 5TKYA 4M7YA 4KV8A 1LOTB 4B8CA 4NCAA 3V9WA 1TYQB 2VYPA 4CJKA 4KAZA 2F8SA 3NDKA 2H3GX 3CJ9A 4JKAA 2KFNA 3B6PA 4CZFA 2Q36A 4AM7A 3NFAA 3AVCA 1NKCA 2F8TA 3R6MA 1N5YA 4NCBA 2VWBA 4PL7A 3CI5A 4CK3A 4CEFA 2P9LB 1J54A 3TSQA 4CF0A 1S1XA 2P9UB 3U3GA 1KLMA 4B9MA 1C0UA 3T1AA 1ZBIA 5KI6A 2A1SA 4ID1A 1JJ2M 2WONA 4KHQA 2HW3A 3DLEA 3EYZA 4B3SK 1ILYA 1C1CA 3QEIA 3IS9A 3CXCM 4FK2A 2HNDA 4R5PA 3MN7A 1NGGA 4H5RA 1XQSC 1BCOA 2BANA 3DOLA 4DTXA 3PLAA 3DXKB 3E9OA 1XWLA 4YDUA 2D0BA 3DM2A 1HNXK 2PBDA 3P39A 3HVRA 4DQQA 4DUYK 4GVEA 4BRKA 3DLKA 1VSMA 1TYQA 4A5BA 3MCPA 4BR9A 5H1SQ 2HOEA 1HNIA 1FKPA 4MFBA 3SUQA 4DSFA 3I8DA 4JD2B 1Q9XA 1RBVA 1JL2A 3MN6A 4B3TK 4E3SA 2YHXA 4DR6K 4E7JA 3UKUB 5BR8K 1T05A 4DSEA 3ZSXA 3CCEN 2P9LA 4YOWA 4N56A 5AQYA 2P9UA 4FJJA 1XMQK 3H3NO 2Z1JA 3TAPA 4DR1K 2HF3A 2OZSA 3PIOL 1NK4A 1U45A 3E66A 3ZT4A 3VGKA 5JMVA 2YJEA 1C0TA 1ATSA 2A6AA 3R9PA 2VGMA 4O0IA 4H0XB 1T7PA 3L3VA 1IBLK 3FE1A 1BOTO 3KK7A 4OPJA 2D4WA 2BGGA 1YTUA 1BQNA 2O8DB 1RTJA 5JS1A 4B9LA 3C6AA 3DXKA 2XY7A 1EKEA 4DMNA 4CEZA 3MXIA 1RBSA 2YNIA 4FVMA 3ZSRA 2KHOA 1K9MO 3FFIA 3LANA 3O5BA 5HP1A 5J1EA 2NRTA 2FXUA 2W42A 3M8SA 3IG1A 4JD2A 5F2RA 4M3RA 5HL7L 1N8RO 1T44A 3Q7CA 3ZEUB 3UKUA 2HMIA 4FWPA 5C15A 4H0YB 4DTUA 2E1ZA 3OYNA 4H03B 1ESVA 3K9KA 5BPNA 4YHHK 1VSHA 2HNYA 1NJYA 3ZX2A 4O44A 4HVJA 2G8KA 1HPZA 4MDBA 4M42A 3LDNA 4CEDA 3GE1A 4CZGA 4B3OA 2O8DA 3OYJA 2Q3SA 4Z4FA 2VWJA 4PKGA 4DHYA 3WQUA 3ULDA 3PSFA 1WSFA 3DYAA 1RBUA 2UXDK 3PIPL 3THYB 3OYHA 3JXUA 3V1RA 1HX1A 4K43A 5BPLA 1IO2A 4FYDA 4CEEA 1W2BM 1NJWA 5AQGA 1IBKK 3AAPA 3ZT1A 4Z4HA 1F21A 3OYCA 2NLXA 4JKDA 4CGGA 3E01A 4ZTFA 3SI6A 3VQ9A 3CG7A 3WXMB 3TR8A 3NH0A 3K5NA 1UA1A 4CZJA 4LF6K 3VGMA 4B9NA 3VGLA 1C1BA 1WOQA 5DMRA 4BY9C 3ZX3A 3OYIA 2DTUA 4FPAA 3KTQA 3GL1A 3P38A 4J2EA 2DFFA 4WFNL 1ASWA 3L4QA 1VSFA 4B8AB 3M8PA 2YNHA 5AQNA 1ZYQA 3BDPA 1WAJA 3C7NB 1C1AA 2CGKA 2KQ2A 1KLNA 1FJGK 1QSLA 2YNFA 2QKKA 1SKSA 3VESA 2KW4A 3AO2A 3SLCA 3PX6A 3RRGA 1RBRA 4H0TB 3WNEA 3TARA 3THYA 2QKBA 3J80O 1SZ2A 1RFQA 3ZYYX 2O8FA 3BZKA 3SYZA 5I9EB 2BUPA 4UQGA 1HYZA 3QB0A 4FL9A 3DOKA 4J8FA 2FSJA 4WYBA 4IEEA 4FJXA 3QEWA 1CLQA 1EQYA 4CK2A 3WXJA 3EZ5A 4E7LA 4JKEA 4GV6A 4H5WA 1Q86O 4BVPA 1VQ9N 2RN2A 3HPHA 3GBTA 3I56N 1GLEG 4DQRA 1BIUA 1V4SA 4O8UA 4IFEA 4CJ7A 1OVQA 4DFMA 4N41A 3LDOA 1DGKN 4FOIA 4BWMA 3NH1A 5HOOA 3NGIA 4IZ9A 2FBTA 1WUAA 2Q0UA 3C7NA 2JWLA 1R0AA 2X74A 3G0ZA 3H08A 3VTHA 4N47A 4CF8A 3OYAA 5AQIA 2OPPA 4QS8A 3H6EA 1SL0A 4JRPA 5CY4A 1BCMA 1N32K 4GMJB 1YF5L 4C8NA 1YI2N 2UU9K 1BIZA 4ISEA 2I7NA 3AARA 3KJVA 2NRRA 4ELUA 4DR4K 4HWIA 5FLXO 1X3MA 3LALA 4BGAA 4A61A 4EZ9A 3QESA 2A3ZA 4JAXA 1ATNA 3KIOA 3AO5A 4JI1K 1VQ4N 3GG4A 4ILGB 2G8IA 2WOMA 5TKWA 2QWQA 1YVUA 2P1JA 3HO1A 4DV3K 1ASVA 1ITGA 3OS1A 4E0DA 1W9HA 5ADXH 1D8YA 3AVBA 3RMBA 3HM9A 2QA4N 3CCQN 3C65A 4JKHA 1YJNN 2HHTA 4Y0WA 4NYFA 5AQMA 5A2QO 1XHXA 4CZMA 3DRRA 1EWRA 2OCEA 4FW2A 4FLTA 2D1KA 5KPRA 3AA3A 4DF8A 4JYAK 2FBXA 5BN8A 4DQ8A 1XC9A 2JGUA 4JI4K 4YNQA 4LH5A 3SPZA 1NK8A 5DM6L 2HBMA 1OH7A 2YHAA 4F8RA 3KWGA 3HYFA 3RRHA 2G8VA 3OYFA 1RT1A 4YOUA 5M1QA 1VAZA 1I94K 1GLCG 2GV9A 4DU1A 1Q81O 4JS5A 4Y1DA 2DY4A 1S9EA 1VSEA 2HSTA 3IAYA 1GLBG 2ETJA 1OH5A 2HBJA 3NCIA 5BN9A 2E5LK 5F0XA 3CJ7A 4QS7A 4CHOA 3R3LA 1J6ZA 3ID8A 3ATVA 2KKZA 2PAVA 1NGIA 2A42A 4CJTA 3ZX0A 3IUCA 3U9ZA 2FBYA 2NNWA 4CEOA 4CHPA 2NRHA 3VOVA 3L6QA 3VQPA 4IO9L 3CIPA 3TABA 1RCHA 3DLGA 1TL3A 1KCFA 4AILC 1S1UA 4BC5A 1TKXA 4J2DA 2NRZA 1MWKA 1SQKA 4B08A 1LAWA 3J81O 5IT9O 3VERA 5KRTA 3TU5A 3R8EA 5M1OA 3J7YP 4K25A 1NJXA 1Q7YO 3SQ4A 3H1QA 3WT0A 1S6QA 4B1WB 2FSKA 4FM2A 2PYLA 2IVPA 4BE2A 4GKJK 3SQ2A 3NF9A 4JS4A 5D3GA 1GLFO 2VQFK 2CGJA 1C0GA 1Y64A 4DFPA 4IDHA 3CM6A 1X9SA 3CJ1A 3V4IA 2XY8A 3VEWA 3V9XA 1VK0A 2ZF5O 4CZHA 5FRMA 3HJFA 4IWVA 4DTJA 1LCUA 4BRQA 4M3WA 4BACA 1BISA 2W6KA 5C24A 1JCEA 2ZGYA 3DRSA 3CMAN 4LF9K 4I9LA 1IH7A 4Q5VA 1FW6A 3FZLA 1XHZA 2EWSA 1HJOA 5GAGP 4H0VB 1WLJA 4LH4A 3OS2A 2ZQBA 1LWFA 2LSNA 1RT5A 4J2AA 2RE2A 4IJAA 4KH5A 4CJ3A 4DTRA 2ZJQL 3QERA 1T8EA 3IFRA 5BR9A 4U67L 3J7AP 3DAWA 3LAMA 5M1KA 4YDUC 5CR4A 5BRDA 4FPBA 4RW7A 3QEVA 2E88A 3QFUA 1KQSM 3IMXA 5T7BA 4CJ5A 3MWPA 3CPEA 1B9FA 1ATRA 4CJRA 1GOCA 4DSIA 1KVCA 4PKIA 3HXMA 3SPYA 3NBPA 3I0SA 4E1NA 1TKZA 3TPQA 4CJFA 2A40A 4CF9A 3VA0A 1HYSA 3HT3A 5AFUA 3VQ5A 3OYKA 1X1PA 2FF6A 1TVRA 1TAUA 4CFAA 4CVNE 1RDDA 2WFBA 4YOTA 3HTVA 4CJEA 5FPEA 3MX5A 4GV9A 3VTIA 4EHTA 5CZ1A 5AQVA 4FWMA 1D9DA 4DSLA 3HP6A 4FLWA 1YVNA 4MLHA 2R7YA 4BRDA 3CYMA 5KTQA 3O8MA 2HF4A 3OJSA 3ITHA 3VQ4A 4KTZA 4AHCA 4HUEA 2BH1A 3FFKB 2RF2A 4FJKA 1DT9A 4IOCL 3O4NA 1E4FT 4KHNA 4BRPA 1A5XA 1NGFA 4RCHA 1VSJA 4YY3K 4JI6K 4BRAA 4CESA 3K9JA 4HTUA 2EX3A 3THVA 2FC0A 3QETA 1YHQN 1YJ9N 3DI6A 5C25A 3HRGA 3FZMA 3N4QA 4FM0A 1DTTA 2QXLA 1NKBA 3L8BA 5KGWA 4DQSA 1ZXOA 5AQHA 1JLCA 3F5TA 4K41A 2ZWHA 3HBTA 4CIGA 1S22A 3U9DA 4IXCA 1WNSA 4KH6A 3C94A 1CZAN 2P5GA 3M5RA 1NLVA 1EWQA 4B1UB 5AQWA 3L2QA 2Q2RA 4QCLA 3EE8A 5CHIA 3ZT3A 5C10A 4PA1A 1E3MA 3QNNA 2PY5A 3ID6A 2HB5A 4CGDA 3CJCA 1YXQA 4CD3A 3EN9A 5KQ8A 4BRMA 3SUPA 4I2QA 3SV4A 2A41A 3L3UA 3PX4A 3A2FA 3SMSA 1KAZA 5BRHA 4DR2K 4CZKA 2ZGZA 4UY8O 1QQCA 3ZCMA 4KBOA 4XEIA 4A57A 4LFAK 3MECA 4BE0A 4H4OA 3LDLA 5AQFA 4B9TA 1U2VB 1UOCA 4OKJA 4BREA 3SQ0A 4TSXA 2P9NB 4M3XA 3BP8A 3U3YA 1NK0A 2YKNA 1GOBA 3EEQA 2HBLA 4E1MA 4MDAA 1VQON 4FZYA 2AP1A 4M3UA 3T19A 2YHBA 3UB5A 4DKWA 4OPAA 4KHSA 4E7HA 3L2RA 3T1YK 1S9GA 5AQOA 3WXKA 3E9PA 5GINA 1QTMA 2OYQA 4KHPK 3TSPA 3FLCO 4CGFA 3NE6A 4OX9K 1JL1A 4H5NA 1HLUA 1YJWN 4XH4A 4HTLA 2RPIA 5HROA 2YCHA 3TAQA 1X9MA 1WSGA 2GWJA 3AVLA 3A8YA 4AF1A 4GY2B 1HNWK 4RG8A 2OTJN 3NGZA 2O8CB 1NGCA 1MA9B 1JXEA 4FWQA 2HHSA 3V1OA 4LF7K 2VWKA 1C0MA 1KAXA 3MAQA 1WSIA 4FK0A 3EKUA 3PO5A 4WQ4A 1U2VA 3CHWA 3AA2A 1A5VA 2P9NA 2Q0RA 3CC4N 1OVYA 3KKSA 2A5XA 4GVMA 5BRFA 4C8OA 3L4IA 4KFBA 3THXA 2JWKA 3CQYA 3OYDA 3THWB 3MWTA 1LW2A 4E89A 4IOAL 4KTWA 4WFAL 1NU0A 1NOYA 4FO0A 4IG0A 3D2EB 1YT3A 5HRNA 3FZFA 1JCGA 1JCFA 3RTVA 2QWLA 3PY8A 1OKJA 3LZIA 1DEJA 2XHBA 1S1WA 3OYGA 4HHTA 4XH5A 2O8FB 4NCGA 4CJPA 4F3OA 4I2PA 2NZTA 3HSCA 4BRIA 1KD1O 5E26A 5CYQA 3CCRN 3NVMA 1Z05A 1UWBA 4EP4A 4LC9B 3WQTA 3QO9A 2P9SB 2O8CA 1NJIO 4FLZA 3CFOA 4LD0A 3DJCA 4FW1A 3HOSA 4DV4K 3KK2A 2X78A 3R1XA 5CE3A 4DFKA 3SBGA 4E7IA 4B3RK 5HRRA 1U4BA 1CXUA 2V51B 5AQLA 3BGRA 4FJ7A 3ALYA 4H4MA 4DSKA 4F3TA 2DFHA 3THWA 4M45A 3CCLN 1ZBFA 3D2EA 1K8KA 1JLGA 1W97L 4PKHA 4A2BA 3PX0A 2E1YA 4CJLA 4M63C 4W5OA 4FK4A 1RDBA 3QIOA 2HHXA 4H0PA 1NOZA 4X62K 2I7PA 4CIEA 4BDZA 4BRNA 4CHQA 3QNOA 3DMJA 2VCPA 2IAJA 1B9DA 2XRIA 1VHXA 4KHUA 3RR8A 1RILA 1EX4A 5SWMA 3NMUA 4NLBA 2P9SA 3LAKA 2PYJA 3BF3A 4DQPA 1D5AA 4CGIA 1JLEA 1RT4A 3BF1A 4MQ3A 1ZBHA 4CJUA 3F9MA 2IVOA 4NLCA 1RDWX 4WQ5A 3DLHA 1GLDG 2YKMA 3L2UA 4DLGA 5HBMA 3MEEA 2ASMA 3MMVA 2FF3B 4IEIA 3ZSZA 3BUZB 3LL3A 3BZCA 3U4LA 1U04A 2Q97A 1HQEA 3WXLA 2FBVA 1L3TA 3CQ8A 4FLVA 4O4GA 1TGOA 3OVNA 5AQRA 4MO4A 5C2DA 3ZT0A 4DV5K 4EP5A 2YHWA 1SS6A 2E6LA 1J5OA 4CZIA 3B6OA 4IOXA 3VQEA 4CGHA 3HPGA 2D0OA 2V7ZA 4C8MA 3IDHA 4CK1A 3CCUN 3S3NA 4KTQA 3HOTA 4E19A 4JKBA 2HHHK 4BGBA 1MDUB 3G6EN 3ASMA 3IRXA 3O9SA 3SQ1A 2AJQA 2HBKA 3M8QA 2RKIA 3LP2A 1T6CA 3KK1A 3LDQA 3RVCA 4K0KK 1M1KO 1YIJN 4C23A 1BGXT 2HHVA 4PWDA 4LF4K 3CFRA 5M1NA 4C8LA 3TWHA 5SZTA 3CERA 1EP4A 4NXMK 4PHTX 2VG7A 2YHYA 3JAMO 4JI0K 3QBWA 4CEAA 4CEQA 5EU7A 1QQNA 3J7ZO 1YAGA 3MXMA 1HNZK 2O8EB 3QDKA 5AQQA 3SK3A 2BDPA 2OPRA 4KRFA 1VSDA 5LL6Z 3KHYA 4OLAA 3TANA 3P5JA 1HNVA 2CH5A 1RT6A 1G99A 1X3NA 3TTFA 3SMPA 3AA5X 4IDKA 1Q9YA 3CCSN 4F2SA 5CZ2A 4CHNA 4RTFD 4FJGA 2UXBK 1VQ5N 2NRXA 5LY3A 2QW9A 1JKHA 1RDUA 2B4JA 2B5JA 4JEPA 4GNIA 1YITN 4DTNA 4FJNA 4EIAA 2KFZA 2QK9A 5JS2A 4M3TA 3VEYA 5KPZA 1JLAA 3VN5A 4FM1A 5EY4A 4ILJA 4OLBA 5FPNA 3S3OA 4FWRA 1RDAA 3EL2A 4AM6A 1LAVA 5AR0A 3WUHA 3OJUA 3KLFA 4KHWA 1S1TA 2NRVA 2YI1A 1WB9A 4DS4A 5I3UA 1YUWA 1Q82O 2Z1HA 4BQLA 2O8EA 2V7YA 2DFEA 4DS5A 2HVHA 3AY9A 4CBWA 3WNHA 4JKCA 3HK2A 3N4PA 3E1YA 1UA0A 4ZTJA 5AZJB 4DF4A 3AVAA 4Z0UA 2ITMA 3VQQA 3BEXA 1NGBA 5IWAK 3AVFA 2G8FA 3CM5A 1BO5O 5BPMA 1RT3A 3VF2A 3CQXA 2OA8A 3VQDA 4BROA 3PO4A 3AVMA 2P9PB 4AQYK 3UIQA 2ASOA 5AQPA 3RMCA 4GV3A 4FJ5A 3TAEA 3FR0A 4FWLA 2HNZA 4FJHA 3O4WA 2IOCA 1S6PA 4Z4GA 3LM2A 3K0SA 4LF5K 3AO4A 4B1YB 3NVKA 4AHSA 3DXMB 1VQKN 4NXNK 3VENA 4LSLA 4CFDA 1TUYA 1XNRK 3LP3A 3I55N 4DUZK 4FWSA 4RW8A 1CZ9A 3SJJA 1OH8A 2OPQA 3SZ2A 3K58A 3KLIA 4B9SA 1SKWA 3RSEA 1I39A 3JYTA 3WEEB 4FJIA 4CERA 3CETA 5J2QA 1KXPA 4W5TA 4BRCA 4C1NK 1LV5A 5B8HA 1KTQA 5AZJA 4IBNA 4KREA 1KVBA 4CD1A 4E1JA 3O1WA 3VEXA 4AHRA 5GIPA 2W41A 2ZD1A 4RW4A 2P9PA 3CC2N 1NGHA 4AHVA 2GWKA 4G1QA 5KRSA 3QICA 1DKGD 3Q7BA 3LP0A 4ISGA 1QZ6A 5AQSA 4KHYA 4XH1A 1GLJO 1K73O 1SKRA 1WBDA 3CJBA 4PY5A 5FPDA 5HRSA 4W5NA 4JI3K 3A0IX 3QINA 1D4XA 3DXMA 1WBBA 2F9TA 1N34K 3A5NC 3ENOA 3KD1E 3MEGA 4JHDB 4BG8A 4YORA 1ZBLA 2YJFA 3NGYA 2G8UA 2IGIA 5M1PA 4B3MK 4MLEA 1QSSA 3QIPA 4OKKA 3V9SA 1TK0A 3WEEA 5GAEP 1U49A 3MXJA 4CFCA 3CC7N 1KVAA 4CJSA 2HMPA 1NMDA 1BDGA 2IS3A 3HP9A 3T3FA 4FOEA 3MEDA 1J53A 3W3DA 3CD6N 1QHTA 4BQZA 5EOYA 5FROA 3UE5A 4B9QA 4F9OA 4HCCA 3EKSA 3D45A 3TTDA 3HL8A 5AQTA 1D9FA 4M41A 1HJRA 4FXDA 3RMAA 2QTDA 4OO1J 4CBUA 3PSIA 1A5WA 2HHUA 5KPTA 4NB4A 1ASUA 1NGAA 4JNEA 3P4IA 3WNGA 4DV7K 1LWEA 4DCHA 5CYMA 4JRQA 2QXFA 3EO3A 2GBZA 4WE1A 3JSMA 4DU4A 3DWLA 1QSYA 1IBMK 1XUPO 5AQUA 3H3OB 4JI7K 4JHDA 2Y1JA 1VQLN 2D0AA 1HMVA 4B9UA 4B1ZA 1IG8A 2NRWA 3QFPA 5JLFA 3LP1A 4ELTA 4Z4IA 3MN9A 2E2QA 4OKEA 2UUBK 4PL8A 2D0CA 3VQ6A 4H5VA 2E6MA 4WQ4C 3I0RA 3TAFA 3FZKA 2I5JA 2FSNA 4X64K 1JLQA 3EE9A 1BL3A 4LY7A 3GOIA 1XI1A 3C6TA 4JLHA 1BUPA 4BC2A 1V4TA 5BREA 1MU2A 3V81A 4OPHA 1N6QA 2UUAK 2IC3A 3WNFA 3OW2M 3NAEA 4C8KA 1FXXA 1BHLA 1QVFM 4IKFA 3E9LA 4DTPA 2G8HA 3VPZA 4BE1A 4BR5A 3D0PA 4DV1K 4FZZA 1NMNA 2HHQA 5C42A 4N5SA 3K59A 1VQMN 1C6VA 5JLHA 1YTAA 1RDCA 2DPNA 5J2NA 5EVZA 3ZT2A 4IJNA 5M1FA 1NG9A 1N33K 2F4VK 4A2AA 4WCEL 4QOZB 4RWTA 3AVHA 1L3VA 1QS4A 4BWJA 4EHUA 4FLYA 1ZBUA 2AA4A 4YOYA 3O3HA 1WSEA 3C6HA 4FVUA 3THXB 2E8AA 4CE9A 3ENBA 4HUGA 3O08A 4KB1A 1HYVA 3VQCA 2QWRA 2X6NA 5EX5A 3G10A 1NK9A 3K5OA 2ATQA 3HSTB 3CJAA 1IKXA 1BU6O 1HR0K 1NBWA 4H0OA 2E2NA 3CPWM 4L8RB 5DM7L 1QZ5A 4E7KA 1J5EK 4QAGA 2PFUA 4FJ9A 3O4QA 1P8ZA 4LFCK 3TAGA 4BG9A 3LWMA 3SV3A 2J4RA 1NM1A 2CGLA 3TI0A 1KRPA 3ZSOA 3J8AA 4AHUA 3F73A 3AVKA 4ELVA 3L0QA 1VQ7N 1NWKA 1RBTA 3L2VA 2WUSA 4DR5K 4OPKA 3HZ6A 4DFJA 5J2MA 1TUUA 4OGEA 4CZEA 1HKBA 2KZMA 4CBXA 3OBYA 2P51A 4I6MB 3GDQA 3CCJN 2ZJPL 4JKFA 3RMDA 1QQOA 4IFYA 4DTSA 1TV6A 1RT2A 3NF7A 1Z6RA 5AFUH 4JI2K 4M3ZA 4WQ5C 1XC3A 3P1GA 1P90A 4BRHA 3OTOK 2UYTA 3LPUA 3KVGA 5C0YA 4A62A 1K8KB 5ADXA 4MO5A 1IKYA 3P83D 4K8ZA 3VMFB 4BR2A 4CGJA 4HCBA 4O0JA 1W7AA 2Q1NA 4K42A 5LJVA 1KC8O 3U8XA 4DV2K 2IVNA 3AVIA 3AVNA 3OHRA 1IG9A 1NKEA 3D7EO 4B9VA 1J9AA 1RT7A 2O4IA 3V9ZA 2Y1IA 3I33A 3QLHA 3ULEB 4FWOA 1BWFO 5GADP 3VA3A 3KD5E 2PZSA 1GLLO 4BR7A 4JK9A 3K5LA 4M7XA 2EHGA 3F9KA 2YNGA 3OA9A 4EAHD 1Q18A 2KLAA 1NK5A 5J2PA 4KH4A 2KZZA 2WTUA 1VQPN 3HM8A 3MCAB 4OJRA 4CZLA 4YOXA 2OPSA 3U6FA 1NNEA 1QQMA 4BRGA 4EZ6A 1BA1A 3VQBA 2Z1IA 5LJWA 3O1BA 4I6MA 3OYLA 2P9KB 3DRPA 3ZEUA 2ZE2A 4B1VA 4JKGB 4L3QA 5HLFA 1T6DA 3VQAA 3ZSWA 5EXWA 2GUIA 2ITGA 4IFVA 3DLLL 2QWPA 1K8AO 3CF5L 2E2OA 4DU3A 2W6LA 3G71N 3QMLA 1RTIA 1CZBA 5AQZA 3B8AX 1REVA 4JK8A 4PUOA 2UXCK 3FZHA 1T3VA 4O5FA 4ISFA 3TTCA 1TK5A 1L5UA 5AQKA 1Y97A 3ULEA 3K5MA 3L2WA 4JI8K 3M3ZA 2NUBA 4BR0A 1VRTA 4I7FA 1LW0A 2VQEK 5JVGL 4O5BA 3SCXA 1S72N 4KPYA 4I9QA 3A5OC 3JS6A 3QEPA 4CHZA 3O9RA 4WFBL 1BA0A 1T03A 4LF8K 1Z25A 3ISNC 4IG3A 3G4SN 4FLUA 4BRFA 3LZJA 1EXQA 3ZSYA 5DK5A 3D2FB 2VG6A 3V1QA 3QBXA 4G9ZA 4DSJA 2P9KA 4R79A 2QM1A 4JKGA 3TAMA 4CJWA 5E41A 3LDPA 4CF2A 3SUOA 4BRLA 3SNNA 1TK8A 2HVIA 4Z4EA 1BQMA 4CEBA 3MX2A 2XY6A 4DR3K 1JLFA 1VRUA 1NGJA 1XMOK 4CJVA 4DV0K 2Q31A 4YOVA 1G15A 3M8RA 5AQXA 4BC4A 3LDSA 1JXBA 3VEVA 3HPOA 4NYNA 3S9HA 3HVTA 4BDPA 3MN5A 2WBNA 3VQ7A 1FKOA 4BR4A 1L3UA 5JICA 1Q8IA 1NGEA 3RWUA 1VSKA 2GX9A 3AO3A 4J2BA 4CW7B 1IV0A 5I42A 2QWNA 3VF4A 4CECA 1SV5A 4Z94A 4AHTA 5JVHL 3AGRA 4DTOA 2Z1GA 3CFPA 1VQNN 3CMEN 1TL1A 4JV5K 4U7BA 4CCHA 4FJMA 2E20A 4KI6A 1EO1A 3KK3A 4AH9A 3KKRA 4DQIA 4FLXA 3M1FA 1MWMA 3OBWA 3D2FA 4DWIA 4FWKA 1BI4B 3O3GA 4DLEA 3OYBA 1QVGM 4GW6A 1EETA 4O8KA 2YV0X 4N76A 3CCMN 2P9IB 3LPTA 4DG1A 3NHGA 3VEOA 5K14A 1IKVA 3W0LA 1VSIA 1OH6A 3SBTA 3ENHA 1JLBA 1BG3A 4BVOA 3LM9A 1WN7A 3UKRB 4FSVA 1TAQA 3ZSQA 1HKGA 1SL2A 1SL1A 1I3AA 3HI0A 4ID5A 4Q0BA 3VETA 2F96A 3AV9A 3ZETB 4BDYA 3AGKA 4W5RA 2QWMA 2IDOA 3V9UA 4ZHRA 2WC9A 2YX6A 1NGDA 4W5QA 3KLGA 1VQ8N 3O9UA 4DV6K 5AZIB 4DR7K 3VQ8A 4JI5K 4OVLA 1VSLA 3WXIA 1N36K 3RSEB 1C0FA 1DLOA 1RNHA 1U6ZA 5GAHP 1BI4A 3H46O 4KI4A 2IIRA 1IJJA 3O9QA 4K8XA 1RTDA 3T7ZA 3MK6A 4H8KA 3H1VX 4CJ4A 3OYEA 1H1VA 4ICLA 4A59A 3SAFA 2P9IA 2E2PA 5F1XA 1X9WA 2P5OA 3KZBA 3NF8A 1QE1A 2KTQA 5MLCQ 3V6DA 1VQ6N 3DLBA 4NO7A 4CF1A 2CH6A 2VGNA 4CHYA 3D6RA 2ZM6K 1XNQK 4IO8A 1GLAG 1WSJA 1X9JA 3UKRA 4FCYA 3AVGA 3LWLA 1IKWA 1SAZA 4WF9L 2O8BB 2GEMA 3M6GA 3KLEA 1UAXA 4JN4A 4EFHA 3ZETA 3NH2A 2OTLN 2UUCK 3A5LC 1RTHA 1E4GT 3KWIA 3EZWA 5GIOA 3O6WA 4JK7A 3SAHA 3A5MC 3AA4A 4ILHA 4LSNA 3OY9A 3C0BA 1CXQA 1KAYA 1QHAA 4O55A 4CFBA 2W40A 3AAQA 3MDQA 4X66K 1GOAA 5AZIA 1HRHA 2D5RA 1LWCA 3F2KA 1U48A 1KFDA 4F2RA 1B92A 3VF6A 1S5JA 2QWOA 3T69A
chains in the Genus database with same CATH topology
2E6MA 3EY1A 4FJLA 3I0RA 3TAFA 4C8NA 3RTVA 2I5JA 1BIZA 3PV8A 3PY8A 3LZIA 2XHBA 5FDLA 1JLQA 1S1WA 3OYGA 1BL3A 4HHTA 2B6AA 3KJVA 4LY7A 4NCGA 4CJPA 4ELUA 4I2PA 4F3OA 1XI1A 3C6TA 1W0HA 4JLHA 5CYQA 4DTMA 5HRPA 1KSPA 3LALA 1MU2A 2X6SA 4CIFA 3V81A 3PUFA 1N6QA 4EZ9A 3QESA 1UWBA 4EP4A 3KIOA 3AO5A 4FJ8A 1DTQA 3QO9A 2IC3A 4PQUA 3WNFA 3NAEA 4C8KA 1FXXA 1O1WA 3CFOA 4LD0A 2WOMA 1SUQA 1BHLA 3C95A 4FW1A 3KK2A 4HUFA 2VG5A 4DTPA 2G8HA 1YVUA 4IKFA 2P1JA 2X78A 4BE1A 1NK7A 3HO1A 4DFKA 3D0PA 4E7IA 4RW6A 4FZZA 2HHQA 4Z4CA 5C42A 4OGCA 4N5SA 3K59A 1ASVA 5HRRA 1C6VA 1ITGA 3OS1A 1U4BA 4E0DA 1W9HA 1D8YA 2XY5A 1L3SA 4KO0A 1YTAA 3AVBA 1NK6A 1CXUA 1RDCA 3RMBA 4CJQA 3HM9A 3BGRA 4FJ7A 5J2NA 5KGXA 3ZT2A 1K6YA 3ALYA 4Y1CA 4H4MA 4DSKA 4F3TA 2DFHA 4QOZB 2HHTA 1TKDA 2JLEA 4NYFA 3AVHA 1L3VA 1QS4A 1Z26A 3OS0A 4BWJA 4YFUA 3OYMA 1TKTA 4FLYA 1ZBUA 3O3HA 1XHXA 1WSEA 4M45A 2A1RA 3DRRA 1ZBFA 5FRNA 4CE9A 4FW2A 4FLTA 4HUGA 3C6UA 3AA3A 1JLGA 4RW9A 4KB1A 1HYVA 3VQCA 2X6NA 4DF8A 2FBXA 3G10A 1FK9A 3PX0A 1XC9A 3O3FA 1NK9A 2JGUA 2G8WA 3K5OA 2ATQA 4CJLA 3QEXA 3HSTB 4YNQA 4W5OA 4LH5A 4FZXC 1IKXA 4FK4A 1RDBA 3QIOA 1HQUA 2HHXA 1NOZA 1S1VA 3NF6A 3K2PA 4CIEA 4L8RB 3SPZA 1NK8A 4E7KA 4QAGA 2YHAA 2XO7A 4CHQA 4BDZA 3QNOA 3O4QA 1WAFA 3SUNA 4F4KA 3DMJA 3HYFA 2BE2A 4FJ9A 3RRHA 1U47A 1WSHA 3TAGA 2G8VA 3RR7A 4M3YA 2IAJA 1B9DA 3OYFA 1RT1A 2XRIA 3LWMA 3SV3A 1NJZA 2OZMA 4KHUA 3RR8A 3TI0A 1KRPA 1RILA 1EX4A 2GV9A 5SWMA 3ZSOA 4AHUA 2E4LA 3F73A 3AVKA 3S3MA 4DU1A 4KKOA 3LAKA 2PYJA 4JS5A 4Y1DA 1D5AA 4XIUA 4CGIA 4DQPA 1JLEA 4ELVA 1RT4A 2DY4A 1S9EA 1VSEA 1RBTA 3IAYA 2ETJA 4MQ3A 1ZBHA 2HHWA 4CJUA 3DLRA 3L2VA 2O4GA 3AVJA 3DLHA 2YKMA 3ZSVA 3L2UA 3NCIA 4DLGA 3KLHA 3K57A 3AO1A 3MEEA 5HBMA 1KFSA 4OPKA 4CHOA 4KV8A 4DFJA 4OGEA 5J2MA 4B8CA 4NCAA 3ZSZA 2KZMA 3V9WA 4CJTA 4CJKA 2P51A 4KAZA 1U04A 2FBYA 2F8SA 1HQEA 3NDKA 4CEOA 4CHPA 2FBVA 3VQPA 1L3TA 3TABA 3RMDA 2KFNA 1RCHA 3B6PA 3DLGA 1TL3A 3CQ8A 1KCFA 4IFYA 4AILC 1S1UA 4DTSA 1TV6A 4FLVA 4O4GA 3NFAA 1TKXA 1RT2A 1TGOA 3OVNA 3AVCA 1NKCA 4J2DA 2F8TA 3NF7A 1N5YA 4NCBA 3ZT0A 4EP5A 4M3ZA 3P1GA 2E6LA 4B08A 1LAWA 4CK3A 1J5OA 4CEFA 5KRTA 3LPUA 1J54A 1NJXA 3SQ4A 3B6OA 1IKYA 3P83D 3VQEA 1S6QA 4CF0A 3HPGA 4CGHA 4CGJA 4FM2A 1S1XA 3U3GA 2PYLA 1KLMA 4O0JA 4B9MA 1C0UA 3T1AA 4BE2A 1ZBIA 5KI6A 3SQ2A 4C8MA 2A1SA 3NF9A 4ID1A 3AVIA 2WONA 3AVNA 4CK1A 4JS4A 3S3NA 4KTQA 4KHQA 5D3GA 2HW3A 3DLEA 1IG9A 4E19A 3EYZA 1NKEA 1C1CA 3QEIA 4B9VA 1J9AA 3IS9A 1RT7A 2O4IA 3V9ZA 4FK2A 4DFPA 2HNDA 4R5PA 2Y1IA 3CM6A 1X9SA 3ASMA 3IRXA 3V4IA 2XY8A 3QLHA 3SQ1A 2AJQA 3V9XA 1VK0A 3M8QA 2RKIA 5FRMA 3LP2A 3KK1A 3HJFA 1BCOA 2BANA 3VA3A 3DOLA 3KD5E 4DTXA 4DTJA 2PZSA 3K5LA 2EHGA 4M3WA 3F9KA 2YNGA 1XWLA 4BACA 1BISA 1BGXT 2HHVA 5C24A 5J2PA 1NK5A 4PWDA 2D0BA 3DRSA 3CFRA 3DM2A 2KZZA 4C8LA 3TWHA 4I9LA 1IH7A 5SZTA 4Q5VA 3HVRA 1EP4A 4DQQA 1XHZA 2VG7A 1BCMA 4OJRA 4CEAA 3DLKA 4CEQA 1VSMA 2OPSA 5EU7A 3U6FA 1WLJA 3MXMA 4LH4A 3OS2A 3VQBA 2ZQBA 1LWFA 2Z1IA 4EZ6A 2LSNA 1RT5A 2BDPA 4J2AA 2OPRA 1HNIA 1FKPA 3OYLA 4MFBA 4CJ3A 4KRFA 1VSDA 3SUQA 4DSFA 3I8DA 4DTRA 3TANA 4OLAA 3QERA 1T8EA 3DRPA 3P5JA 2ZE2A 1HNVA 5HLFA 1Q9XA 1RT6A 1RBVA 1JL2A 3VQAA 3ZSWA 3AA5X 3LAMA 4IDKA 4E3SA 4E7JA 2GUIA 2ITGA 4IFVA 1Q9YA 1T05A 4F2SA 5CZ2A 4CHNA 4DSEA 4DU3A 4RW7A 4FJGA 3QEVA 3ZSXA 1RTIA 1CZBA 1JKHA 4N56A 1REVA 5T7BA 4PUOA 4CJ5A 2B4JA 2B5JA 4FJJA 2G8IA 2Z1JA 4DTNA 4FJNA 3TAPA 2OZSA 2KFZA 2QK9A 5JS2A 1NK4A 1TK5A 1U45A 4M3TA 1B9FA 4CJRA 3ZT4A 1L5UA 1GOCA 4DSIA 1KVCA 1C0TA 3HXMA 1Y97A 1JLAA 3VN5A 4FM1A 3SPYA 3NBPA 3I0SA 4E1NA 1TKZA 4CJFA 4O0IA 1T7PA 4OLBA 3L3VA 3K5MA 3L2WA 3S3OA 4CF9A 4OPJA 3VA0A 4KB0A 2BGGA 1YTUA 1BQNA 2NUBA 1HYSA 1RTJA 1RDAA 3HT3A 5JS1A 1LAVA 3VQ5A 4B9LA 3OYKA 1VRTA 1X1PA 4I7FA 3OJUA 1LW0A 3KLFA 4KHWA 1S1TA 1TVRA 4O5BA 1EKEA 4DMNA 2XY7A 4CEZA 1TAUA 3SCXA 3MXIA 4CFAA 4KPYA 4I9QA 4DS4A 5I3UA 1RBSA 2YNIA 4FVMA 1RDDA 4F8RA 3ZSRA 3QEPA 4CHZA 2Z1HA 3FFIA 4CJEA 1T03A 3LANA 5HP1A 2DFEA 5J1EA 4DS5A 1Z25A 3ISNC 2HVHA 4IG3A 5CZ1A 4FLUA 2W42A 3LZJA 1EXQA 3M8SA 3ZSYA 1D9DA 5DK5A 4DSLA 3WNHA 2VG6A 3IG1A 3V1QA 3HP6A 4FLWA 2R7YA 4DSJA 3HK2A 4M3RA 1UA0A 3TAMA 4CJWA 3CYMA 4ZTJA 5E41A 4DF4A 3AVAA 4Z0UA 4CF2A 5KTQA 3SUOA 3VQQA 3OJSA 3AVFA 3ITHA 3VQ4A 3CM5A 4KTZA 4AHCA 4HUEA 3SNNA 1TK8A 2G8FA 4Z4EA 2HVIA 1BQMA 2RF2A 4CEBA 1RT3A 2HMIA 2XY6A 4FJKA 2OA8A 3VQDA 3PO4A 1JLFA 3O4NA 1VRUA 3AVMA 4DTUA 3UIQA 4KHNA 4CJVA 3OYNA 1A5XA 3RMCA 4FJ5A 3TAEA 1VSHA 2HNYA 1G15A 1VSJA 3M8RA 2HNZA 3LDSA 4CESA 1JXBA 1NJYA 4FJHA 4HTUA 4O44A 2EX3A 2IOCA 4HVJA 1S6PA 1HPZA 3HPOA 4NYNA 3THVA 3S9HA 3HVTA 4BDPA 4Z4GA 2FC0A 3QETA 4M42A 3VQ7A 4CEDA 2G8KA 4K8ZA 1FKOA 3DI6A 5C25A 1L3UA 3AO4A 1Q8IA 3RWUA 1VSKA 4FM0A 1DTTA 3AO3A 4AHSA 4J2BA 4B3OA 1NKBA 5I42A 4LSLA 4CFDA 3OYJA 5KGWA 2Q3SA 3L8BA 4DQSA 4Z4FA 2VWJA 4CECA 1SV5A 4AHTA 1JLCA 3ULDA 3LP3A 4RW8A 1WSFA 3DYAA 4DTOA 1CZ9A 3SJJA 2Z1GA 4CIGA 3CFPA 2OPQA 3SZ2A 1WNSA 3K58A 1TL1A 3KLIA 1RBUA 4B9SA 1SKWA 1I39A 3C94A 3JYTA 2P5GA 4CCHA 4FJMA 4KI6A 3KK3A 3OYHA 4AH9A 3KKRA 3V1RA 4DQIA 4FLXA 4FJIA 3L2QA 1IO2A 4FYDA 4CERA 5J2QA 4CEEA 4QCLA 4W5TA 1NJWA 4DWIA 1BI4B 3ZT3A 3O3GA 4DLEA 1LV5A 3OYBA 4PA1A 4GW6A 3ZT1A 1EETA 1KTQA 4Z4HA 1F21A 3QNNA 2YV0X 4IBNA 3OYCA 2PY5A 4N76A 4KREA 4CGGA 4ZTFA 3E01A 1KVBA 2HB5A 3LPTA 4CGDA 4DG1A 3NHGA 5K14A 3SI6A 4AHRA 1IKVA 3VQ9A 3CG7A 1VSIA 3TR8A 2ZD1A 4RW4A 3SUPA 4AHVA 4I2QA 3NH0A 3K5NA 3L3UA 4G1QA 3SV4A 1UA1A 3PX4A 4B9NA 1JLBA 3A2FA 5KRSA 1C1BA 5DMRA 1WN7A 3LP0A 1TAQA 3OYIA 3ZSQA 4KHYA 1QQCA 3ZCMA 1SL2A 2DTUA 3MECA 1SKRA 4BE0A 4H4OA 1I3AA 1SL1A 3KTQA 4PY5A 4B9TA 4J2EA 4ID5A 4Q0BA 5HRSA 2F96A 3AV9A 1UOCA 4OKJA 4W5NA 3SQ0A 2DFFA 4TSXA 4BDYA 3QINA 1ASWA 1VSFA 4B8AB 3M8PA 4M3XA 3U3YA 2YNHA 4W5RA 1NK0A 1ZYQA 3BDPA 2YKNA 2IDOA 3KD1E 1GOBA 1WAJA 3MEGA 3V9UA 1C1AA 1ZBLA 4E1MA 4FZYA 2KQ2A 3NGYA 4ZHRA 1KLNA 2G8UA 2IGIA 4M3UA 3T19A 2YHBA 1QSLA 4W5QA 2YNFA 3KLGA 1SKSA 2QKKA 4KHSA 1QSSA 4E7HA 3QIPA 2KW4A 3AO2A 3PX6A 3RRGA 3VQ8A 4OKKA 1RBRA 3V9SA 4OVLA 3L2RA 1S9GA 1TK0A 3WNEA 3TARA 1U49A 3MXJA 2QKBA 1VSLA 4CFCA 1QTMA 2OYQA 1KVAA 4CJSA 1DLOA 1RNHA 3SYZA 4CGFA 3NE6A 4UQGA 1HYZA 2IS3A 1BI4A 3HP9A 3T3FA 4KI4A 1JL1A 3MEDA 1J53A 4K8XA 1RTDA 4H8KA 4CJ4A 3OYEA 3DOKA 1QHTA 4ICLA 4FJXA 5FROA 2RPIA 3QEWA 5HROA 1X9WA 2P5OA 1CLQA 3TAQA 1X9MA 3NF8A 1QE1A 4CK2A 4HCCA 2KTQA 1WSGA 3V6DA 3EZ5A 4E7LA 4HCBA 3AVLA 3DLBA 4CF1A 3D45A 4CHYA 3HL8A 4RG8A 1D9FA 2RN2A 3HPHA 4M41A 1HJRA 4FXDA 3NGZA 3RMAA 4DQRA 1WSJA 1BIUA 4FCYA 1A5WA 1JXEA 3AVGA 2HHUA 3LWLA 1IKWA 3V1OA 2HHSA 2VWKA 1C0MA 1ASUA 3MAQA 1WSIA 4FK0A 3WNGA 3KLEA 1UAXA 4DFMA 4N41A 1LWEA 3PO5A 5CYMA 4JRQA 2QXFA 3AA2A 1A5VA 3NH2A 4BWMA 2GBZA 3NH1A 1RTHA 4WE1A 3JSMA 3NGIA 3KKSA 4DU4A 2FBTA 4GVMA 1QSYA 4C8OA 4KFBA 3AA4A 4LSNA 3OY9A 2Y1JA 3OYDA 1CXQA 2D0AA 4O55A 4CFBA 1LW2A 1R0AA 2X74A 3G0ZA 1HMVA 4E89A 4B9UA 3H08A 4KTWA 1GOAA 4N47A 4CF8A 3OYAA 1HRHA 2D5RA 1LWCA 1NOYA 4ELTA 3LP1A 2OPPA 4IG0A 4FLZA 4Z4IA 4OKEA 1KFDA 1YT3A 1U48A 1SL0A 4F2RA 2D0CA 4JRPA 5HRNA 3VQ6A 1B92A 5CY4A 1S5JA 4GMJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E6M A;  3EY1 A;  4FJL A;  3I0R A;  3TAF A;  4C8N A;  3RTV A;  2I5J A;  1BIZ A;  3PV8 A;  3PY8 A;  3LZI A;  2XHB A;  5FDL A;  1JLQ A;  1S1W A;  3OYG A;  1BL3 A;  4HHT A;  2B6A A;  3KJV A;  4LY7 A;  4NCG A;  4CJP A;  4ELU A;  4I2P A;  4F3O A;  1XI1 A;  3C6T A;  1W0H A;  4JLH A;  5CYQ A;  4DTM A;  5HRP A;  1KSP A;  3LAL A;  1MU2 A;  2X6S A;  4CIF A;  3V81 A;  3PUF A;  1N6Q A;  4EZ9 A;  3QES A;  1UWB A;  4EP4 A;  3KIO A;  3AO5 A;  4FJ8 A;  1DTQ A;  3QO9 A;  2IC3 A;  4PQU A;  3WNF A;  3NAE A;  4C8K A;  1FXX A;  1O1W A;  3CFO A;  4LD0 A;  2WOM A;  1SUQ A;  1BHL A;  3C95 A;  4FW1 A;  3KK2 A;  4HUF A;  2VG5 A;  4DTP A;  2G8H A;  1YVU A;  4IKF A;  2P1J A;  2X78 A;  4BE1 A;  1NK7 A;  3HO1 A;  4DFK A;  3D0P A;  4E7I A;  4RW6 A;  4FZZ A;  2HHQ A;  4Z4C A;  5C42 A;  4OGC A;  4N5S A;  3K59 A;  1ASV A;  5HRR A;  1C6V A;  1ITG A;  3OS1 A;  1U4B A;  4E0D A;  1W9H A;  1D8Y A;  2XY5 A;  1L3S A;  4KO0 A;  1YTA A;  3AVB A;  1NK6 A;  1CXU A;  1RDC A;  3RMB A;  4CJQ A;  3HM9 A;  3BGR A;  4FJ7 A;  5J2N A;  5KGX A;  3ZT2 A;  1K6Y A;  3ALY A;  4Y1C A;  4H4M A;  4DSK A;  4F3T A;  2DFH A;  4QOZ B;  2HHT A;  1TKD A;  2JLE A;  4NYF A;  3AVH A;  1L3V A;  1QS4 A;  1Z26 A;  3OS0 A;  4BWJ A;  4YFU A;  3OYM A;  1TKT A;  4FLY A;  1ZBU A;  3O3H A;  1XHX A;  1WSE A;  4M45 A;  2A1R A;  3DRR A;  1ZBF A;  5FRN A;  4CE9 A;  4FW2 A;  4FLT A;  4HUG A;  3C6U A;  3AA3 A;  1JLG A;  4RW9 A;  4KB1 A;  1HYV A;  3VQC A;  2X6N A;  4DF8 A;  2FBX A;  3G10 A;  1FK9 A;  3PX0 A;  1XC9 A;  3O3F A;  1NK9 A;  2JGU A;  2G8W A;  3K5O A;  2ATQ A;  4CJL A;  3QEX A;  3HST B;  4YNQ A;  4W5O A;  4LH5 A;  4FZX C;  1IKX A;  4FK4 A;  1RDB A;  3QIO A;  1HQU A;  2HHX A;  1NOZ A;  1S1V A;  3NF6 A;  3K2P A;  4CIE A;  4L8R B;  3SPZ A;  1NK8 A;  4E7K A;  4QAG A;  2YHA A;  2XO7 A;  4CHQ A;  4BDZ A;  3QNO A;  3O4Q A;  1WAF A;  3SUN A;  4F4K A;  3DMJ A;  3HYF A;  2BE2 A;  4FJ9 A;  3RRH A;  1U47 A;  1WSH A;  3TAG A;  2G8V A;  3RR7 A;  4M3Y A;  2IAJ A;  1B9D A;  3OYF A;  1RT1 A;  2XRI A;  3LWM A;  3SV3 A;  1NJZ A;  2OZM A;  4KHU A;  3RR8 A;  3TI0 A;  1KRP A;  1RIL A;  1EX4 A;  2GV9 A;  5SWM A;  3ZSO A;  4AHU A;  2E4L A;  3F73 A;  3AVK A;  3S3M A;  4DU1 A;  4KKO A;  3LAK A;  2PYJ A;  4JS5 A;  4Y1D A;  1D5A A;  4XIU A;  4CGI A;  4DQP A;  1JLE A;  4ELV A;  1RT4 A;  2DY4 A;  1S9E A;  1VSE A;  1RBT A;  3IAY A;  2ETJ A;  4MQ3 A;  1ZBH A;  2HHW A;  4CJU A;  3DLR A;  3L2V A;  2O4G A;  3AVJ A;  3DLH A;  2YKM A;  3ZSV A;  3L2U A;  3NCI A;  4DLG A;  3KLH A;  3K57 A;  3AO1 A;  3MEE A;  5HBM A;  1KFS A;  4OPK A;  4CHO A;  4KV8 A;  4DFJ A;  4OGE A;  5J2M A;  4B8C A;  4NCA A;  3ZSZ A;  2KZM A;  3V9W A;  4CJT A;  4CJK A;  2P51 A;  4KAZ A;  1U04 A;  2FBY A;  2F8S A;  1HQE A;  3NDK A;  4CEO A;  4CHP A;  2FBV A;  3VQP A;  1L3T A;  3TAB A;  3RMD A;  2KFN A;  1RCH A;  3B6P A;  3DLG A;  1TL3 A;  3CQ8 A;  1KCF A;  4IFY A;  4AIL C;  1S1U A;  4DTS A;  1TV6 A;  4FLV A;  4O4G A;  3NFA A;  1TKX A;  1RT2 A;  1TGO A;  3OVN A;  3AVC A;  1NKC A;  4J2D A;  2F8T A;  3NF7 A;  1N5Y A;  4NCB A;  3ZT0 A;  4EP5 A;  4M3Z A;  3P1G A;  2E6L A;  4B08 A;  1LAW A;  4CK3 A;  1J5O A;  4CEF A;  5KRT A;  3LPU A;  1J54 A;  1NJX A;  3SQ4 A;  3B6O A;  1IKY A;  3P83 D;  3VQE A;  1S6Q A;  4CF0 A;  3HPG A;  4CGH A;  4CGJ A;  4FM2 A;  1S1X A;  3U3G A;  2PYL A;  1KLM A;  4O0J A;  4B9M A;  1C0U A;  3T1A A;  4BE2 A;  1ZBI A;  5KI6 A;  3SQ2 A;  4C8M A;  2A1S A;  3NF9 A;  4ID1 A;  3AVI A;  2WON A;  3AVN A;  4CK1 A;  4JS4 A;  3S3N A;  4KTQ A;  4KHQ A;  5D3G A;  2HW3 A;  3DLE A;  1IG9 A;  4E19 A;  3EYZ A;  1NKE A;  1C1C A;  3QEI A;  4B9V A;  1J9A A;  3IS9 A;  1RT7 A;  2O4I A;  3V9Z A;  4FK2 A;  4DFP A;  2HND A;  4R5P A;  2Y1I A;  3CM6 A;  1X9S A;  3ASM A;  3IRX A;  3V4I A;  2XY8 A;  3QLH A;  3SQ1 A;  2AJQ A;  3V9X A;  1VK0 A;  3M8Q A;  2RKI A;  5FRM A;  3LP2 A;  3KK1 A;  3HJF A;  1BCO A;  2BAN A;  3VA3 A;  3DOL A;  3KD5 E;  4DTX A;  4DTJ A;  2PZS A;  3K5L A;  2EHG A;  4M3W A;  3F9K A;  2YNG A;  1XWL A;  4BAC A;  1BIS A;  1BGX T;  2HHV A;  5C24 A;  5J2P A;  1NK5 A;  4PWD A;  2D0B A;  3DRS A;  3CFR A;  3DM2 A;  2KZZ A;  4C8L A;  3TWH A;  4I9L A;  1IH7 A;  5SZT A;  4Q5V A;  3HVR A;  1EP4 A;  4DQQ A;  1XHZ A;  2VG7 A;  1BCM A;  4OJR A;  4CEA A;  3DLK A;  4CEQ A;  1VSM A;  2OPS A;  5EU7 A;  3U6F A;  1WLJ A;  3MXM A;  4LH4 A;  3OS2 A;  3VQB A;  2ZQB A;  1LWF A;  2Z1I A;  4EZ6 A;  2LSN A;  1RT5 A;  2BDP A;  4J2A A;  2OPR A;  1HNI A;  1FKP A;  3OYL A;  4MFB A;  4CJ3 A;  4KRF A;  1VSD A;  3SUQ A;  4DSF A;  3I8D A;  4DTR A;  3TAN A;  4OLA A;  3QER A;  1T8E A;  3DRP A;  3P5J A;  2ZE2 A;  1HNV A;  5HLF A;  1Q9X A;  1RT6 A;  1RBV A;  1JL2 A;  3VQA A;  3ZSW A;  3AA5 X;  3LAM A;  4IDK A;  4E3S A;  4E7J A;  2GUI A;  2ITG A;  4IFV A;  1Q9Y A;  1T05 A;  4F2S A;  5CZ2 A;  4CHN A;  4DSE A;  4DU3 A;  4RW7 A;  4FJG A;  3QEV A;  3ZSX A;  1RTI A;  1CZB A;  1JKH A;  4N56 A;  1REV A;  5T7B A;  4PUO A;  4CJ5 A;  2B4J A;  2B5J A;  4FJJ A;  2G8I A;  2Z1J A;  4DTN A;  4FJN A;  3TAP A;  2OZS A;  2KFZ A;  2QK9 A;  5JS2 A;  1NK4 A;  1TK5 A;  1U45 A;  4M3T A;  1B9F A;  4CJR A;  3ZT4 A;  1L5U A;  1GOC A;  4DSI A;  1KVC A;  1C0T A;  3HXM A;  1Y97 A;  1JLA A;  3VN5 A;  4FM1 A;  3SPY A;  3NBP A;  3I0S A;  4E1N A;  1TKZ A;  4CJF A;  4O0I A;  1T7P A;  4OLB A;  3L3V A;  3K5M A;  3L2W A;  3S3O A;  4CF9 A;  4OPJ A;  3VA0 A;  4KB0 A;  2BGG A;  1YTU A;  1BQN A;  2NUB A;  1HYS A;  1RTJ A;  1RDA A;  3HT3 A;  5JS1 A;  1LAV A;  3VQ5 A;  4B9L A;  3OYK A;  1VRT A;  1X1P A;  4I7F A;  3OJU A;  1LW0 A;  3KLF A;  4KHW A;  1S1T A;  1TVR A;  4O5B A;  1EKE A;  4DMN A;  2XY7 A;  4CEZ A;  1TAU A;  3SCX A;  3MXI A;  4CFA A;  4KPY A;  4I9Q A;  4DS4 A;  5I3U A;  1RBS A;  2YNI A;  4FVM A;  1RDD A;  4F8R A;  3ZSR A;  3QEP A;  4CHZ A;  2Z1H A;  3FFI A;  4CJE A;  1T03 A;  3LAN A;  5HP1 A;  2DFE A;  5J1E A;  4DS5 A;  1Z25 A;  3ISN C;  2HVH A;  4IG3 A;  5CZ1 A;  4FLU A;  2W42 A;  3LZJ A;  1EXQ A;  3M8S A;  3ZSY A;  1D9D A;  5DK5 A;  4DSL A;  3WNH A;  2VG6 A;  3IG1 A;  3V1Q A;  3HP6 A;  4FLW A;  2R7Y A;  4DSJ A;  3HK2 A;  4M3R A;  1UA0 A;  3TAM A;  4CJW A;  3CYM A;  4ZTJ A;  5E41 A;  4DF4 A;  3AVA A;  4Z0U A;  4CF2 A;  5KTQ A;  3SUO A;  3VQQ A;  3OJS A;  3AVF A;  3ITH A;  3VQ4 A;  3CM5 A;  4KTZ A;  4AHC A;  4HUE A;  3SNN A;  1TK8 A;  2G8F A;  4Z4E A;  2HVI A;  1BQM A;  2RF2 A;  4CEB A;  1RT3 A;  2HMI A;  2XY6 A;  4FJK A;  2OA8 A;  3VQD A;  3PO4 A;  1JLF A;  3O4N A;  1VRU A;  3AVM A;  4DTU A;  3UIQ A;  4KHN A;  4CJV A;  3OYN A;  1A5X A;  3RMC A;  4FJ5 A;  3TAE A;  1VSH A;  2HNY A;  1G15 A;  1VSJ A;  3M8R A;  2HNZ A;  3LDS A;  4CES A;  1JXB A;  1NJY A;  4FJH A;  4HTU A;  4O44 A;  2EX3 A;  2IOC A;  4HVJ A;  1S6P A;  1HPZ A;  3HPO A;  4NYN A;  3THV A;  3S9H A;  3HVT A;  4BDP A;  4Z4G A;  2FC0 A;  3QET A;  4M42 A;  3VQ7 A;  4CED A;  2G8K A;  4K8Z A;  1FKO A;  3DI6 A;  5C25 A;  1L3U A;  3AO4 A;  1Q8I A;  3RWU A;  1VSK A;  4FM0 A;  1DTT A;  3AO3 A;  4AHS A;  4J2B A;  4B3O A;  1NKB A;  5I42 A;  4LSL A;  4CFD A;  3OYJ A;  5KGW A;  2Q3S A;  3L8B A;  4DQS A;  4Z4F A;  2VWJ A;  4CEC A;  1SV5 A;  4AHT A;  1JLC A;  3ULD A;  3LP3 A;  4RW8 A;  1WSF A;  3DYA A;  4DTO A;  1CZ9 A;  3SJJ A;  2Z1G A;  4CIG A;  3CFP A;  2OPQ A;  3SZ2 A;  1WNS A;  3K58 A;  1TL1 A;  3KLI A;  1RBU A;  4B9S A;  1SKW A;  1I39 A;  3C94 A;  3JYT A;  2P5G A;  4CCH A;  4FJM A;  4KI6 A;  3KK3 A;  3OYH A;  4AH9 A;  3KKR A;  3V1R A;  4DQI A;  4FLX A;  4FJI A;  3L2Q A;  1IO2 A;  4FYD A;  4CER A;  5J2Q A;  4CEE A;  4QCL A;  4W5T A;  1NJW A;  4DWI A;  1BI4 B;  3ZT3 A;  3O3G A;  4DLE A;  1LV5 A;  3OYB A;  4PA1 A;  4GW6 A;  3ZT1 A;  1EET A;  1KTQ A;  4Z4H A;  1F21 A;  3QNN A;  2YV0 X;  4IBN A;  3OYC A;  2PY5 A;  4N76 A;  4KRE A;  4CGG A;  4ZTF A;  3E01 A;  1KVB A;  2HB5 A;  3LPT A;  4CGD A;  4DG1 A;  3NHG A;  5K14 A;  3SI6 A;  4AHR A;  1IKV A;  3VQ9 A;  3CG7 A;  1VSI A;  3TR8 A;  2ZD1 A;  4RW4 A;  3SUP A;  4AHV A;  4I2Q A;  3NH0 A;  3K5N A;  3L3U A;  4G1Q A;  3SV4 A;  1UA1 A;  3PX4 A;  4B9N A;  1JLB A;  3A2F A;  5KRS A;  1C1B A;  5DMR A;  1WN7 A;  3LP0 A;  1TAQ A;  3OYI A;  3ZSQ A;  4KHY A;  1QQC A;  3ZCM A;  1SL2 A;  2DTU A;  3MEC A;  1SKR A;  4BE0 A;  4H4O A;  1I3A A;  1SL1 A;  3KTQ A;  4PY5 A;  4B9T A;  4J2E A;  4ID5 A;  4Q0B A;  5HRS A;  2F96 A;  3AV9 A;  1UOC A;  4OKJ A;  4W5N A;  3SQ0 A;  2DFF A;  4TSX A;  4BDY A;  3QIN A;  1ASW A;  1VSF A;  4B8A B;  3M8P A;  4M3X A;  3U3Y A;  2YNH A;  4W5R A;  1NK0 A;  1ZYQ A;  3BDP A;  2YKN A;  2IDO A;  3KD1 E;  1GOB A;  1WAJ A;  3MEG A;  3V9U A;  1C1A A;  1ZBL A;  4E1M A;  4FZY A;  2KQ2 A;  3NGY A;  4ZHR A;  1KLN A;  2G8U A;  2IGI A;  4M3U A;  3T19 A;  2YHB A;  1QSL A;  4W5Q A;  2YNF A;  3KLG A;  1SKS A;  2QKK A;  4KHS A;  1QSS A;  4E7H A;  3QIP A;  2KW4 A;  3AO2 A;  3PX6 A;  3RRG A;  3VQ8 A;  4OKK A;  1RBR A;  3V9S A;  4OVL A;  3L2R A;  1S9G A;  1TK0 A;  3WNE A;  3TAR A;  1U49 A;  3MXJ A;  2QKB A;  1VSL A;  4CFC A;  1QTM A;  2OYQ A;  1KVA A;  4CJS A;  1DLO A;  1RNH A;  3SYZ A;  4CGF A;  3NE6 A;  4UQG A;  1HYZ A;  2IS3 A;  1BI4 A;  3HP9 A;  3T3F A;  4KI4 A;  1JL1 A;  3MED A;  1J53 A;  4K8X A;  1RTD A;  4H8K A;  4CJ4 A;  3OYE A;  3DOK A;  1QHT A;  4ICL A;  4FJX A;  5FRO A;  2RPI A;  3QEW A;  5HRO A;  1X9W A;  2P5O A;  1CLQ A;  3TAQ A;  1X9M A;  3NF8 A;  1QE1 A;  4CK2 A;  4HCC A;  2KTQ A;  1WSG A;  3V6D A;  3EZ5 A;  4E7L A;  4HCB A;  3AVL A;  3DLB A;  4CF1 A;  3D45 A;  4CHY A;  3HL8 A;  4RG8 A;  1D9F A;  2RN2 A;  3HPH A;  4M41 A;  1HJR A;  4FXD A;  3NGZ A;  3RMA A;  4DQR A;  1WSJ A;  1BIU A;  4FCY A;  1A5W A;  1JXE A;  3AVG A;  2HHU A;  3LWL A;  1IKW A;  3V1O A;  2HHS A;  2VWK A;  1C0M A;  1ASU A;  3MAQ A;  1WSI A;  4FK0 A;  3WNG A;  3KLE A;  1UAX A;  4DFM A;  4N41 A;  1LWE A;  3PO5 A;  5CYM A;  4JRQ A;  2QXF A;  3AA2 A;  1A5V A;  3NH2 A;  4BWM A;  2GBZ A;  3NH1 A;  1RTH A;  4WE1 A;  3JSM A;  3NGI A;  3KKS A;  4DU4 A;  2FBT A;  4GVM A;  1QSY A;  4C8O A;  4KFB A;  3AA4 A;  4LSN A;  3OY9 A;  2Y1J A;  3OYD A;  1CXQ A;  2D0A A;  4O55 A;  4CFB A;  1LW2 A;  1R0A A;  2X74 A;  3G0Z A;  1HMV A;  4E89 A;  4B9U A;  3H08 A;  4KTW A;  1GOA A;  4N47 A;  4CF8 A;  3OYA A;  1HRH A;  2D5R A;  1LWC A;  1NOY A;  4ELT A;  3LP1 A;  2OPP A;  4IG0 A;  4FLZ A;  4Z4I A;  4OKE A;  1KFD A;  1YT3 A;  1U48 A;  1SL0 A;  4F2R A;  2D0C A;  4JRP A;  5HRN A;  3VQ6 A;  1B92 A;  5CY4 A;  1S5J A;  4GMJ B; 
#chains in the Genus database with same CATH topology
 3EY1 A;  3O80 A;  4FJL A;  3ATU A;  3PV8 A;  2RHK A;  5FDL A;  2FLO A;  3I8B A;  2B6A A;  3S41 A;  3IKM A;  5LMU K;  5AQJ A;  1W0H A;  4DTM A;  5HRP A;  5AJ3 K;  1KSP A;  4CIF A;  2X6S A;  3PUF A;  1ZBS A;  1HUX A;  4FJ8 A;  1DTQ A;  4GKK K;  4PQU A;  5E84 A;  1O1W A;  4HUF A;  4LFB K;  1SUQ A;  3C95 A;  2VG5 A;  1NK7 A;  2O8B A;  3H45 C;  4RW6 A;  4Z4C A;  4OGC A;  3FGU A;  2ZJR L;  2XY5 A;  1L3S A;  4KO0 A;  2BTF A;  1S3X A;  3ZLJ A;  1NK6 A;  5FPM A;  4CJQ A;  4FWN A;  4V19 S;  4BC3 A;  5KGX A;  3CCV N;  2GEL A;  1K6Y A;  4Y1C A;  4X65 K;  3SJH A;  1TKD A;  2JLE A;  1O13 A;  2QI2 A;  1Z26 A;  3OS0 A;  3OYM A;  2QEX N;  4YFU A;  3P31 A;  1TKT A;  2A1R A;  3O9T A;  5FRN A;  3C6U A;  2D0P A;  4RW9 A;  1FK9 A;  5ELZ A;  3BY5 A;  3O3F A;  2G8W A;  4DB3 A;  4A5A A;  3QEX A;  4FZX C;  1HQU A;  4H5T A;  1S1V A;  2F9W A;  3NF6 A;  3K2P A;  4CI6 A;  3G25 A;  2XO7 A;  4KB0 A;  3SUN A;  4F4K A;  1WAF A;  1ZC6 A;  1R59 O;  2BE2 A;  2OAN A;  5C12 A;  3SAG A;  1U47 A;  1WSH A;  4B1X B;  3RR7 A;  4M3Y A;  1HKC A;  1NJZ A;  1RGI A;  2OZM A;  2GTD A;  2F7T A;  3T1H K;  4QS9 A;  5LMN K;  2E4L A;  1HPM A;  3S3M A;  4KKO A;  4XIU A;  5KQD A;  4C1N I;  3TSU A;  3VEZ A;  2V52 B;  2HHW A;  5C2F A;  3DLR A;  2O4G A;  3AVJ A;  1M90 O;  2ASP A;  3ZSV A;  2GUP A;  3KLH A;  3K57 A;  3AO1 A;  1KFS A;  5TKY A;  4M7Y A;  4KV8 A;  1LOT B;  4B8C A;  4NCA A;  3V9W A;  1TYQ B;  2VYP A;  4CJK A;  4KAZ A;  2F8S A;  3NDK A;  2H3G X;  3CJ9 A;  4JKA A;  2KFN A;  3B6P A;  4CZF A;  2Q36 A;  4AM7 A;  3NFA A;  3AVC A;  1NKC A;  2F8T A;  3R6M A;  1N5Y A;  4NCB A;  2VWB A;  4PL7 A;  3CI5 A;  4CK3 A;  4CEF A;  2P9L B;  1J54 A;  3TSQ A;  4CF0 A;  1S1X A;  2P9U B;  3U3G A;  1KLM A;  4B9M A;  1C0U A;  3T1A A;  1ZBI A;  5KI6 A;  2A1S A;  4ID1 A;  1JJ2 M;  2WON A;  4KHQ A;  2HW3 A;  3DLE A;  3EYZ A;  4B3S K;  1ILY A;  1C1C A;  3QEI A;  3IS9 A;  3CXC M;  4FK2 A;  2HND A;  4R5P A;  3MN7 A;  1NGG A;  4H5R A;  1XQS C;  1BCO A;  2BAN A;  3DOL A;  4DTX A;  3PLA A;  3DXK B;  3E9O A;  1XWL A;  4YDU A;  2D0B A;  3DM2 A;  1HNX K;  2PBD A;  3P39 A;  3HVR A;  4DQQ A;  4DUY K;  4GVE A;  4BRK A;  3DLK A;  1VSM A;  1TYQ A;  4A5B A;  3MCP A;  4BR9 A;  5H1S Q;  2HOE A;  1HNI A;  1FKP A;  4MFB A;  3SUQ A;  4DSF A;  3I8D A;  4JD2 B;  1Q9X A;  1RBV A;  1JL2 A;  3MN6 A;  4B3T K;  4E3S A;  2YHX A;  4DR6 K;  4E7J A;  3UKU B;  5BR8 K;  1T05 A;  4DSE A;  3ZSX A;  3CCE N;  2P9L A;  4YOW A;  4N56 A;  5AQY A;  2P9U A;  4FJJ A;  1XMQ K;  3H3N O;  2Z1J A;  3TAP A;  4DR1 K;  2HF3 A;  2OZS A;  3PIO L;  1NK4 A;  1U45 A;  3E66 A;  3ZT4 A;  3VGK A;  5JMV A;  2YJE A;  1C0T A;  1ATS A;  2A6A A;  3R9P A;  2VGM A;  4O0I A;  4H0X B;  1T7P A;  3L3V A;  1IBL K;  3FE1 A;  1BOT O;  3KK7 A;  4OPJ A;  2D4W A;  2BGG A;  1YTU A;  1BQN A;  2O8D B;  1RTJ A;  5JS1 A;  4B9L A;  3C6A A;  3DXK A;  2XY7 A;  1EKE A;  4DMN A;  4CEZ A;  3MXI A;  1RBS A;  2YNI A;  4FVM A;  3ZSR A;  2KHO A;  1K9M O;  3FFI A;  3LAN A;  3O5B A;  5HP1 A;  5J1E A;  2NRT A;  2FXU A;  2W42 A;  3M8S A;  3IG1 A;  4JD2 A;  5F2R A;  4M3R A;  5HL7 L;  1N8R O;  1T44 A;  3Q7C A;  3ZEU B;  3UKU A;  2HMI A;  4FWP A;  5C15 A;  4H0Y B;  4DTU A;  2E1Z A;  3OYN A;  4H03 B;  1ESV A;  3K9K A;  5BPN A;  4YHH K;  1VSH A;  2HNY A;  1NJY A;  3ZX2 A;  4O44 A;  4HVJ A;  2G8K A;  1HPZ A;  4MDB A;  4M42 A;  3LDN A;  4CED A;  3GE1 A;  4CZG A;  4B3O A;  2O8D A;  3OYJ A;  2Q3S A;  4Z4F A;  2VWJ A;  4PKG A;  4DHY A;  3WQU A;  3ULD A;  3PSF A;  1WSF A;  3DYA A;  1RBU A;  2UXD K;  3PIP L;  3THY B;  3OYH A;  3JXU A;  3V1R A;  1HX1 A;  4K43 A;  5BPL A;  1IO2 A;  4FYD A;  4CEE A;  1W2B M;  1NJW A;  5AQG A;  1IBK K;  3AAP A;  3ZT1 A;  4Z4H A;  1F21 A;  3OYC A;  2NLX A;  4JKD A;  4CGG A;  3E01 A;  4ZTF A;  3SI6 A;  3VQ9 A;  3CG7 A;  3WXM B;  3TR8 A;  3NH0 A;  3K5N A;  1UA1 A;  4CZJ A;  4LF6 K;  3VGM A;  4B9N A;  3VGL A;  1C1B A;  1WOQ A;  5DMR A;  4BY9 C;  3ZX3 A;  3OYI A;  2DTU A;  4FPA A;  3KTQ A;  3GL1 A;  3P38 A;  4J2E A;  2DFF A;  4WFN L;  1ASW A;  3L4Q A;  1VSF A;  4B8A B;  3M8P A;  2YNH A;  5AQN A;  1ZYQ A;  3BDP A;  1WAJ A;  3C7N B;  1C1A A;  2CGK A;  2KQ2 A;  1KLN A;  1FJG K;  1QSL A;  2YNF A;  2QKK A;  1SKS A;  3VES A;  2KW4 A;  3AO2 A;  3SLC A;  3PX6 A;  3RRG A;  1RBR A;  4H0T B;  3WNE A;  3TAR A;  3THY A;  2QKB A;  3J80 O;  1SZ2 A;  1RFQ A;  3ZYY X;  2O8F A;  3BZK A;  3SYZ A;  5I9E B;  2BUP A;  4UQG A;  1HYZ A;  3QB0 A;  4FL9 A;  3DOK A;  4J8F A;  2FSJ A;  4WYB A;  4IEE A;  4FJX A;  3QEW A;  1CLQ A;  1EQY A;  4CK2 A;  3WXJ A;  3EZ5 A;  4E7L A;  4JKE A;  4GV6 A;  4H5W A;  1Q86 O;  4BVP A;  1VQ9 N;  2RN2 A;  3HPH A;  3GBT A;  3I56 N;  1GLE G;  4DQR A;  1BIU A;  1V4S A;  4O8U A;  4IFE A;  4CJ7 A;  1OVQ A;  4DFM A;  4N41 A;  3LDO A;  1DGK N;  4FOI A;  4BWM A;  3NH1 A;  5HOO A;  3NGI A;  4IZ9 A;  2FBT A;  1WUA A;  2Q0U A;  3C7N A;  2JWL A;  1R0A A;  2X74 A;  3G0Z A;  3H08 A;  3VTH A;  4N47 A;  4CF8 A;  3OYA A;  5AQI A;  2OPP A;  4QS8 A;  3H6E A;  1SL0 A;  4JRP A;  5CY4 A;  1BCM A;  1N32 K;  4GMJ B;  1YF5 L;  4C8N A;  1YI2 N;  2UU9 K;  1BIZ A;  4ISE A;  2I7N A;  3AAR A;  3KJV A;  2NRR A;  4ELU A;  4DR4 K;  4HWI A;  5FLX O;  1X3M A;  3LAL A;  4BGA A;  4A61 A;  4EZ9 A;  3QES A;  2A3Z A;  4JAX A;  1ATN A;  3KIO A;  3AO5 A;  4JI1 K;  1VQ4 N;  3GG4 A;  4ILG B;  2G8I A;  2WOM A;  5TKW A;  2QWQ A;  1YVU A;  2P1J A;  3HO1 A;  4DV3 K;  1ASV A;  1ITG A;  3OS1 A;  4E0D A;  1W9H A;  5ADX H;  1D8Y A;  3AVB A;  3RMB A;  3HM9 A;  2QA4 N;  3CCQ N;  3C65 A;  4JKH A;  1YJN N;  2HHT A;  4Y0W A;  4NYF A;  5AQM A;  5A2Q O;  1XHX A;  4CZM A;  3DRR A;  1EWR A;  2OCE A;  4FW2 A;  4FLT A;  2D1K A;  5KPR A;  3AA3 A;  4DF8 A;  4JYA K;  2FBX A;  5BN8 A;  4DQ8 A;  1XC9 A;  2JGU A;  4JI4 K;  4YNQ A;  4LH5 A;  3SPZ A;  1NK8 A;  5DM6 L;  2HBM A;  1OH7 A;  2YHA A;  4F8R A;  3KWG A;  3HYF A;  3RRH A;  2G8V A;  3OYF A;  1RT1 A;  4YOU A;  5M1Q A;  1VAZ A;  1I94 K;  1GLC G;  2GV9 A;  4DU1 A;  1Q81 O;  4JS5 A;  4Y1D A;  2DY4 A;  1S9E A;  1VSE A;  2HST A;  3IAY A;  1GLB G;  2ETJ A;  1OH5 A;  2HBJ A;  3NCI A;  5BN9 A;  2E5L K;  5F0X A;  3CJ7 A;  4QS7 A;  4CHO A;  3R3L A;  1J6Z A;  3ID8 A;  3ATV A;  2KKZ A;  2PAV A;  1NGI A;  2A42 A;  4CJT A;  3ZX0 A;  3IUC A;  3U9Z A;  2FBY A;  2NNW A;  4CEO A;  4CHP A;  2NRH A;  3VOV A;  3L6Q A;  3VQP A;  4IO9 L;  3CIP A;  3TAB A;  1RCH A;  3DLG A;  1TL3 A;  1KCF A;  4AIL C;  1S1U A;  4BC5 A;  1TKX A;  4J2D A;  2NRZ A;  1MWK A;  1SQK A;  4B08 A;  1LAW A;  3J81 O;  5IT9 O;  3VER A;  5KRT A;  3TU5 A;  3R8E A;  5M1O A;  3J7Y P;  4K25 A;  1NJX A;  1Q7Y O;  3SQ4 A;  3H1Q A;  3WT0 A;  1S6Q A;  4B1W B;  2FSK A;  4FM2 A;  2PYL A;  2IVP A;  4BE2 A;  4GKJ K;  3SQ2 A;  3NF9 A;  4JS4 A;  5D3G A;  1GLF O;  2VQF K;  2CGJ A;  1C0G A;  1Y64 A;  4DFP A;  4IDH A;  3CM6 A;  1X9S A;  3CJ1 A;  3V4I A;  2XY8 A;  3VEW A;  3V9X A;  1VK0 A;  2ZF5 O;  4CZH A;  5FRM A;  3HJF A;  4IWV A;  4DTJ A;  1LCU A;  4BRQ A;  4M3W A;  4BAC A;  1BIS A;  2W6K A;  5C24 A;  1JCE A;  2ZGY A;  3DRS A;  3CMA N;  4LF9 K;  4I9L A;  1IH7 A;  4Q5V A;  1FW6 A;  3FZL A;  1XHZ A;  2EWS A;  1HJO A;  5GAG P;  4H0V B;  1WLJ A;  4LH4 A;  3OS2 A;  2ZQB A;  1LWF A;  2LSN A;  1RT5 A;  4J2A A;  2RE2 A;  4IJA A;  4KH5 A;  4CJ3 A;  4DTR A;  2ZJQ L;  3QER A;  1T8E A;  3IFR A;  5BR9 A;  4U67 L;  3J7A P;  3DAW A;  3LAM A;  5M1K A;  4YDU C;  5CR4 A;  5BRD A;  4FPB A;  4RW7 A;  3QEV A;  2E88 A;  3QFU A;  1KQS M;  3IMX A;  5T7B A;  4CJ5 A;  3MWP A;  3CPE A;  1B9F A;  1ATR A;  4CJR A;  1GOC A;  4DSI A;  1KVC A;  4PKI A;  3HXM A;  3SPY A;  3NBP A;  3I0S A;  4E1N A;  1TKZ A;  3TPQ A;  4CJF A;  2A40 A;  4CF9 A;  3VA0 A;  1HYS A;  3HT3 A;  5AFU A;  3VQ5 A;  3OYK A;  1X1P A;  2FF6 A;  1TVR A;  1TAU A;  4CFA A;  4CVN E;  1RDD A;  2WFB A;  4YOT A;  3HTV A;  4CJE A;  5FPE A;  3MX5 A;  4GV9 A;  3VTI A;  4EHT A;  5CZ1 A;  5AQV A;  4FWM A;  1D9D A;  4DSL A;  3HP6 A;  4FLW A;  1YVN A;  4MLH A;  2R7Y A;  4BRD A;  3CYM A;  5KTQ A;  3O8M A;  2HF4 A;  3OJS A;  3ITH A;  3VQ4 A;  4KTZ A;  4AHC A;  4HUE A;  2BH1 A;  3FFK B;  2RF2 A;  4FJK A;  1DT9 A;  4IOC L;  3O4N A;  1E4F T;  4KHN A;  4BRP A;  1A5X A;  1NGF A;  4RCH A;  1VSJ A;  4YY3 K;  4JI6 K;  4BRA A;  4CES A;  3K9J A;  4HTU A;  2EX3 A;  3THV A;  2FC0 A;  3QET A;  1YHQ N;  1YJ9 N;  3DI6 A;  5C25 A;  3HRG A;  3FZM A;  3N4Q A;  4FM0 A;  1DTT A;  2QXL A;  1NKB A;  3L8B A;  5KGW A;  4DQS A;  1ZXO A;  5AQH A;  1JLC A;  3F5T A;  4K41 A;  2ZWH A;  3HBT A;  4CIG A;  1S22 A;  3U9D A;  4IXC A;  1WNS A;  4KH6 A;  3C94 A;  1CZA N;  2P5G A;  3M5R A;  1NLV A;  1EWQ A;  4B1U B;  5AQW A;  3L2Q A;  2Q2R A;  4QCL A;  3EE8 A;  5CHI A;  3ZT3 A;  5C10 A;  4PA1 A;  1E3M A;  3QNN A;  2PY5 A;  3ID6 A;  2HB5 A;  4CGD A;  3CJC A;  1YXQ A;  4CD3 A;  3EN9 A;  5KQ8 A;  4BRM A;  3SUP A;  4I2Q A;  3SV4 A;  2A41 A;  3L3U A;  3PX4 A;  3A2F A;  3SMS A;  1KAZ A;  5BRH A;  4DR2 K;  4CZK A;  2ZGZ A;  4UY8 O;  1QQC A;  3ZCM A;  4KBO A;  4XEI A;  4A57 A;  4LFA K;  3MEC A;  4BE0 A;  4H4O A;  3LDL A;  5AQF A;  4B9T A;  1U2V B;  1UOC A;  4OKJ A;  4BRE A;  3SQ0 A;  4TSX A;  2P9N B;  4M3X A;  3BP8 A;  3U3Y A;  1NK0 A;  2YKN A;  1GOB A;  3EEQ A;  2HBL A;  4E1M A;  4MDA A;  1VQO N;  4FZY A;  2AP1 A;  4M3U A;  3T19 A;  2YHB A;  3UB5 A;  4DKW A;  4OPA A;  4KHS A;  4E7H A;  3L2R A;  3T1Y K;  1S9G A;  5AQO A;  3WXK A;  3E9P A;  5GIN A;  1QTM A;  2OYQ A;  4KHP K;  3TSP A;  3FLC O;  4CGF A;  3NE6 A;  4OX9 K;  1JL1 A;  4H5N A;  1HLU A;  1YJW N;  4XH4 A;  4HTL A;  2RPI A;  5HRO A;  2YCH A;  3TAQ A;  1X9M A;  1WSG A;  2GWJ A;  3AVL A;  3A8Y A;  4AF1 A;  4GY2 B;  1HNW K;  4RG8 A;  2OTJ N;  3NGZ A;  2O8C B;  1NGC A;  1MA9 B;  1JXE A;  4FWQ A;  2HHS A;  3V1O A;  4LF7 K;  2VWK A;  1C0M A;  1KAX A;  3MAQ A;  1WSI A;  4FK0 A;  3EKU A;  3PO5 A;  4WQ4 A;  1U2V A;  3CHW A;  3AA2 A;  1A5V A;  2P9N A;  2Q0R A;  3CC4 N;  1OVY A;  3KKS A;  2A5X A;  4GVM A;  5BRF A;  4C8O A;  3L4I A;  4KFB A;  3THX A;  2JWK A;  3CQY A;  3OYD A;  3THW B;  3MWT A;  1LW2 A;  4E89 A;  4IOA L;  4KTW A;  4WFA L;  1NU0 A;  1NOY A;  4FO0 A;  4IG0 A;  3D2E B;  1YT3 A;  5HRN A;  3FZF A;  1JCG A;  1JCF A;  3RTV A;  2QWL A;  3PY8 A;  1OKJ A;  3LZI A;  1DEJ A;  2XHB A;  1S1W A;  3OYG A;  4HHT A;  4XH5 A;  2O8F B;  4NCG A;  4CJP A;  4F3O A;  4I2P A;  2NZT A;  3HSC A;  4BRI A;  1KD1 O;  5E26 A;  5CYQ A;  3CCR N;  3NVM A;  1Z05 A;  1UWB A;  4EP4 A;  4LC9 B;  3WQT A;  3QO9 A;  2P9S B;  2O8C A;  1NJI O;  4FLZ A;  3CFO A;  4LD0 A;  3DJC A;  4FW1 A;  3HOS A;  4DV4 K;  3KK2 A;  2X78 A;  3R1X A;  5CE3 A;  4DFK A;  3SBG A;  4E7I A;  4B3R K;  5HRR A;  1U4B A;  1CXU A;  2V51 B;  5AQL A;  3BGR A;  4FJ7 A;  3ALY A;  4H4M A;  4DSK A;  4F3T A;  2DFH A;  3THW A;  4M45 A;  3CCL N;  1ZBF A;  3D2E A;  1K8K A;  1JLG A;  1W97 L;  4PKH A;  4A2B A;  3PX0 A;  2E1Y A;  4CJL A;  4M63 C;  4W5O A;  4FK4 A;  1RDB A;  3QIO A;  2HHX A;  4H0P A;  1NOZ A;  4X62 K;  2I7P A;  4CIE A;  4BDZ A;  4BRN A;  4CHQ A;  3QNO A;  3DMJ A;  2VCP A;  2IAJ A;  1B9D A;  2XRI A;  1VHX A;  4KHU A;  3RR8 A;  1RIL A;  1EX4 A;  5SWM A;  3NMU A;  4NLB A;  2P9S A;  3LAK A;  2PYJ A;  3BF3 A;  4DQP A;  1D5A A;  4CGI A;  1JLE A;  1RT4 A;  3BF1 A;  4MQ3 A;  1ZBH A;  4CJU A;  3F9M A;  2IVO A;  4NLC A;  1RDW X;  4WQ5 A;  3DLH A;  1GLD G;  2YKM A;  3L2U A;  4DLG A;  5HBM A;  3MEE A;  2ASM A;  3MMV A;  2FF3 B;  4IEI A;  3ZSZ A;  3BUZ B;  3LL3 A;  3BZC A;  3U4L A;  1U04 A;  2Q97 A;  1HQE A;  3WXL A;  2FBV A;  1L3T A;  3CQ8 A;  4FLV A;  4O4G A;  1TGO A;  3OVN A;  5AQR A;  4MO4 A;  5C2D A;  3ZT0 A;  4DV5 K;  4EP5 A;  2YHW A;  1SS6 A;  2E6L A;  1J5O A;  4CZI A;  3B6O A;  4IOX A;  3VQE A;  4CGH A;  3HPG A;  2D0O A;  2V7Z A;  4C8M A;  3IDH A;  4CK1 A;  3CCU N;  3S3N A;  4KTQ A;  3HOT A;  4E19 A;  4JKB A;  2HHH K;  4BGB A;  1MDU B;  3G6E N;  3ASM A;  3IRX A;  3O9S A;  3SQ1 A;  2AJQ A;  2HBK A;  3M8Q A;  2RKI A;  3LP2 A;  1T6C A;  3KK1 A;  3LDQ A;  3RVC A;  4K0K K;  1M1K O;  1YIJ N;  4C23 A;  1BGX T;  2HHV A;  4PWD A;  4LF4 K;  3CFR A;  5M1N A;  4C8L A;  3TWH A;  5SZT A;  3CER A;  1EP4 A;  4NXM K;  4PHT X;  2VG7 A;  2YHY A;  3JAM O;  4JI0 K;  3QBW A;  4CEA A;  4CEQ A;  5EU7 A;  1QQN A;  3J7Z O;  1YAG A;  3MXM A;  1HNZ K;  2O8E B;  3QDK A;  5AQQ A;  3SK3 A;  2BDP A;  2OPR A;  4KRF A;  1VSD A;  5LL6 Z;  3KHY A;  4OLA A;  3TAN A;  3P5J A;  1HNV A;  2CH5 A;  1RT6 A;  1G99 A;  1X3N A;  3TTF A;  3SMP A;  3AA5 X;  4IDK A;  1Q9Y A;  3CCS N;  4F2S A;  5CZ2 A;  4CHN A;  4RTF D;  4FJG A;  2UXB K;  1VQ5 N;  2NRX A;  5LY3 A;  2QW9 A;  1JKH A;  1RDU A;  2B4J A;  2B5J A;  4JEP A;  4GNI A;  1YIT N;  4DTN A;  4FJN A;  4EIA A;  2KFZ A;  2QK9 A;  5JS2 A;  4M3T A;  3VEY A;  5KPZ A;  1JLA A;  3VN5 A;  4FM1 A;  5EY4 A;  4ILJ A;  4OLB A;  5FPN A;  3S3O A;  4FWR A;  1RDA A;  3EL2 A;  4AM6 A;  1LAV A;  5AR0 A;  3WUH A;  3OJU A;  3KLF A;  4KHW A;  1S1T A;  2NRV A;  2YI1 A;  1WB9 A;  4DS4 A;  5I3U A;  1YUW A;  1Q82 O;  2Z1H A;  4BQL A;  2O8E A;  2V7Y A;  2DFE A;  4DS5 A;  2HVH A;  3AY9 A;  4CBW A;  3WNH A;  4JKC A;  3HK2 A;  3N4P A;  3E1Y A;  1UA0 A;  4ZTJ A;  5AZJ B;  4DF4 A;  3AVA A;  4Z0U A;  2ITM A;  3VQQ A;  3BEX A;  1NGB A;  5IWA K;  3AVF A;  2G8F A;  3CM5 A;  1BO5 O;  5BPM A;  1RT3 A;  3VF2 A;  3CQX A;  2OA8 A;  3VQD A;  4BRO A;  3PO4 A;  3AVM A;  2P9P B;  4AQY K;  3UIQ A;  2ASO A;  5AQP A;  3RMC A;  4GV3 A;  4FJ5 A;  3TAE A;  3FR0 A;  4FWL A;  2HNZ A;  4FJH A;  3O4W A;  2IOC A;  1S6P A;  4Z4G A;  3LM2 A;  3K0S A;  4LF5 K;  3AO4 A;  4B1Y B;  3NVK A;  4AHS A;  3DXM B;  1VQK N;  4NXN K;  3VEN A;  4LSL A;  4CFD A;  1TUY A;  1XNR K;  3LP3 A;  3I55 N;  4DUZ K;  4FWS A;  4RW8 A;  1CZ9 A;  3SJJ A;  1OH8 A;  2OPQ A;  3SZ2 A;  3K58 A;  3KLI A;  4B9S A;  1SKW A;  3RSE A;  1I39 A;  3JYT A;  3WEE B;  4FJI A;  4CER A;  3CET A;  5J2Q A;  1KXP A;  4W5T A;  4BRC A;  4C1N K;  1LV5 A;  5B8H A;  1KTQ A;  5AZJ A;  4IBN A;  4KRE A;  1KVB A;  4CD1 A;  4E1J A;  3O1W A;  3VEX A;  4AHR A;  5GIP A;  2W41 A;  2ZD1 A;  4RW4 A;  2P9P A;  3CC2 N;  1NGH A;  4AHV A;  2GWK A;  4G1Q A;  5KRS A;  3QIC A;  1DKG D;  3Q7B A;  3LP0 A;  4ISG A;  1QZ6 A;  5AQS A;  4KHY A;  4XH1 A;  1GLJ O;  1K73 O;  1SKR A;  1WBD A;  3CJB A;  4PY5 A;  5FPD A;  5HRS A;  4W5N A;  4JI3 K;  3A0I X;  3QIN A;  1D4X A;  3DXM A;  1WBB A;  2F9T A;  1N34 K;  3A5N C;  3ENO A;  3KD1 E;  3MEG A;  4JHD B;  4BG8 A;  4YOR A;  1ZBL A;  2YJF A;  3NGY A;  2G8U A;  2IGI A;  5M1P A;  4B3M K;  4MLE A;  1QSS A;  3QIP A;  4OKK A;  3V9S A;  1TK0 A;  3WEE A;  5GAE P;  1U49 A;  3MXJ A;  4CFC A;  3CC7 N;  1KVA A;  4CJS A;  2HMP A;  1NMD A;  1BDG A;  2IS3 A;  3HP9 A;  3T3F A;  4FOE A;  3MED A;  1J53 A;  3W3D A;  3CD6 N;  1QHT A;  4BQZ A;  5EOY A;  5FRO A;  3UE5 A;  4B9Q A;  4F9O A;  4HCC A;  3EKS A;  3D45 A;  3TTD A;  3HL8 A;  5AQT A;  1D9F A;  4M41 A;  1HJR A;  4FXD A;  3RMA A;  2QTD A;  4OO1 J;  4CBU A;  3PSI A;  1A5W A;  2HHU A;  5KPT A;  4NB4 A;  1ASU A;  1NGA A;  4JNE A;  3P4I A;  3WNG A;  4DV7 K;  1LWE A;  4DCH A;  5CYM A;  4JRQ A;  2QXF A;  3EO3 A;  2GBZ A;  4WE1 A;  3JSM A;  4DU4 A;  3DWL A;  1QSY A;  1IBM K;  1XUP O;  5AQU A;  3H3O B;  4JI7 K;  4JHD A;  2Y1J A;  1VQL N;  2D0A A;  1HMV A;  4B9U A;  4B1Z A;  1IG8 A;  2NRW A;  3QFP A;  5JLF A;  3LP1 A;  4ELT A;  4Z4I A;  3MN9 A;  2E2Q A;  4OKE A;  2UUB K;  4PL8 A;  2D0C A;  3VQ6 A;  4H5V A;  2E6M A;  4WQ4 C;  3I0R A;  3TAF A;  3FZK A;  2I5J A;  2FSN A;  4X64 K;  1JLQ A;  3EE9 A;  1BL3 A;  4LY7 A;  3GOI A;  1XI1 A;  3C6T A;  4JLH A;  1BUP A;  4BC2 A;  1V4T A;  5BRE A;  1MU2 A;  3V81 A;  4OPH A;  1N6Q A;  2UUA K;  2IC3 A;  3WNF A;  3OW2 M;  3NAE A;  4C8K A;  1FXX A;  1BHL A;  1QVF M;  4IKF A;  3E9L A;  4DTP A;  2G8H A;  3VPZ A;  4BE1 A;  4BR5 A;  3D0P A;  4DV1 K;  4FZZ A;  1NMN A;  2HHQ A;  5C42 A;  4N5S A;  3K59 A;  1VQM N;  1C6V A;  5JLH A;  1YTA A;  1RDC A;  2DPN A;  5J2N A;  5EVZ A;  3ZT2 A;  4IJN A;  5M1F A;  1NG9 A;  1N33 K;  2F4V K;  4A2A A;  4WCE L;  4QOZ B;  4RWT A;  3AVH A;  1L3V A;  1QS4 A;  4BWJ A;  4EHU A;  4FLY A;  1ZBU A;  2AA4 A;  4YOY A;  3O3H A;  1WSE A;  3C6H A;  4FVU A;  3THX B;  2E8A A;  4CE9 A;  3ENB A;  4HUG A;  3O08 A;  4KB1 A;  1HYV A;  3VQC A;  2QWR A;  2X6N A;  5EX5 A;  3G10 A;  1NK9 A;  3K5O A;  2ATQ A;  3HST B;  3CJA A;  1IKX A;  1BU6 O;  1HR0 K;  1NBW A;  4H0O A;  2E2N A;  3CPW M;  4L8R B;  5DM7 L;  1QZ5 A;  4E7K A;  1J5E K;  4QAG A;  2PFU A;  4FJ9 A;  3O4Q A;  1P8Z A;  4LFC K;  3TAG A;  4BG9 A;  3LWM A;  3SV3 A;  2J4R A;  1NM1 A;  2CGL A;  3TI0 A;  1KRP A;  3ZSO A;  3J8A A;  4AHU A;  3F73 A;  3AVK A;  4ELV A;  3L0Q A;  1VQ7 N;  1NWK A;  1RBT A;  3L2V A;  2WUS A;  4DR5 K;  4OPK A;  3HZ6 A;  4DFJ A;  5J2M A;  1TUU A;  4OGE A;  4CZE A;  1HKB A;  2KZM A;  4CBX A;  3OBY A;  2P51 A;  4I6M B;  3GDQ A;  3CCJ N;  2ZJP L;  4JKF A;  3RMD A;  1QQO A;  4IFY A;  4DTS A;  1TV6 A;  1RT2 A;  3NF7 A;  1Z6R A;  5AFU H;  4JI2 K;  4M3Z A;  4WQ5 C;  1XC3 A;  3P1G A;  1P90 A;  4BRH A;  3OTO K;  2UYT A;  3LPU A;  3KVG A;  5C0Y A;  4A62 A;  1K8K B;  5ADX A;  4MO5 A;  1IKY A;  3P83 D;  4K8Z A;  3VMF B;  4BR2 A;  4CGJ A;  4HCB A;  4O0J A;  1W7A A;  2Q1N A;  4K42 A;  5LJV A;  1KC8 O;  3U8X A;  4DV2 K;  2IVN A;  3AVI A;  3AVN A;  3OHR A;  1IG9 A;  1NKE A;  3D7E O;  4B9V A;  1J9A A;  1RT7 A;  2O4I A;  3V9Z A;  2Y1I A;  3I33 A;  3QLH A;  3ULE B;  4FWO A;  1BWF O;  5GAD P;  3VA3 A;  3KD5 E;  2PZS A;  1GLL O;  4BR7 A;  4JK9 A;  3K5L A;  4M7X A;  2EHG A;  3F9K A;  2YNG A;  3OA9 A;  4EAH D;  1Q18 A;  2KLA A;  1NK5 A;  5J2P A;  4KH4 A;  2KZZ A;  2WTU A;  1VQP N;  3HM8 A;  3MCA B;  4OJR A;  4CZL A;  4YOX A;  2OPS A;  3U6F A;  1NNE A;  1QQM A;  4BRG A;  4EZ6 A;  1BA1 A;  3VQB A;  2Z1I A;  5LJW A;  3O1B A;  4I6M A;  3OYL A;  2P9K B;  3DRP A;  3ZEU A;  2ZE2 A;  4B1V A;  4JKG B;  4L3Q A;  5HLF A;  1T6D A;  3VQA A;  3ZSW A;  5EXW A;  2GUI A;  2ITG A;  4IFV A;  3DLL L;  2QWP A;  1K8A O;  3CF5 L;  2E2O A;  4DU3 A;  2W6L A;  3G71 N;  3QML A;  1RTI A;  1CZB A;  5AQZ A;  3B8A X;  1REV A;  4JK8 A;  4PUO A;  2UXC K;  3FZH A;  1T3V A;  4O5F A;  4ISF A;  3TTC A;  1TK5 A;  1L5U A;  5AQK A;  1Y97 A;  3ULE A;  3K5M A;  3L2W A;  4JI8 K;  3M3Z A;  2NUB A;  4BR0 A;  1VRT A;  4I7F A;  1LW0 A;  2VQE K;  5JVG L;  4O5B A;  3SCX A;  1S72 N;  4KPY A;  4I9Q A;  3A5O C;  3JS6 A;  3QEP A;  4CHZ A;  3O9R A;  4WFB L;  1BA0 A;  1T03 A;  4LF8 K;  1Z25 A;  3ISN C;  4IG3 A;  3G4S N;  4FLU A;  4BRF A;  3LZJ A;  1EXQ A;  3ZSY A;  5DK5 A;  3D2F B;  2VG6 A;  3V1Q A;  3QBX A;  4G9Z A;  4DSJ A;  2P9K A;  4R79 A;  2QM1 A;  4JKG A;  3TAM A;  4CJW A;  5E41 A;  3LDP A;  4CF2 A;  3SUO A;  4BRL A;  3SNN A;  1TK8 A;  2HVI A;  4Z4E A;  1BQM A;  4CEB A;  3MX2 A;  2XY6 A;  4DR3 K;  1JLF A;  1VRU A;  1NGJ A;  1XMO K;  4CJV A;  4DV0 K;  2Q31 A;  4YOV A;  1G15 A;  3M8R A;  5AQX A;  4BC4 A;  3LDS A;  1JXB A;  3VEV A;  3HPO A;  4NYN A;  3S9H A;  3HVT A;  4BDP A;  3MN5 A;  2WBN A;  3VQ7 A;  1FKO A;  4BR4 A;  1L3U A;  5JIC A;  1Q8I A;  1NGE A;  3RWU A;  1VSK A;  2GX9 A;  3AO3 A;  4J2B A;  4CW7 B;  1IV0 A;  5I42 A;  2QWN A;  3VF4 A;  4CEC A;  1SV5 A;  4Z94 A;  4AHT A;  5JVH L;  3AGR A;  4DTO A;  2Z1G A;  3CFP A;  1VQN N;  3CME N;  1TL1 A;  4JV5 K;  4U7B A;  4CCH A;  4FJM A;  2E20 A;  4KI6 A;  1EO1 A;  3KK3 A;  4AH9 A;  3KKR A;  4DQI A;  4FLX A;  3M1F A;  1MWM A;  3OBW A;  3D2F A;  4DWI A;  4FWK A;  1BI4 B;  3O3G A;  4DLE A;  3OYB A;  1QVG M;  4GW6 A;  1EET A;  4O8K A;  2YV0 X;  4N76 A;  3CCM N;  2P9I B;  3LPT A;  4DG1 A;  3NHG A;  3VEO A;  5K14 A;  1IKV A;  3W0L A;  1VSI A;  1OH6 A;  3SBT A;  3ENH A;  1JLB A;  1BG3 A;  4BVO A;  3LM9 A;  1WN7 A;  3UKR B;  4FSV A;  1TAQ A;  3ZSQ A;  1HKG A;  1SL2 A;  1SL1 A;  1I3A A;  3HI0 A;  4ID5 A;  4Q0B A;  3VET A;  2F96 A;  3AV9 A;  3ZET B;  4BDY A;  3AGK A;  4W5R A;  2QWM A;  2IDO A;  3V9U A;  4ZHR A;  2WC9 A;  2YX6 A;  1NGD A;  4W5Q A;  3KLG A;  1VQ8 N;  3O9U A;  4DV6 K;  5AZI B;  4DR7 K;  3VQ8 A;  4JI5 K;  4OVL A;  1VSL A;  3WXI A;  1N36 K;  3RSE B;  1C0F A;  1DLO A;  1RNH A;  1U6Z A;  5GAH P;  1BI4 A;  3H46 O;  4KI4 A;  2IIR A;  1IJJ A;  3O9Q A;  4K8X A;  1RTD A;  3T7Z A;  3MK6 A;  4H8K A;  3H1V X;  4CJ4 A;  3OYE A;  1H1V A;  4ICL A;  4A59 A;  3SAF A;  2P9I A;  2E2P A;  5F1X A;  1X9W A;  2P5O A;  3KZB A;  3NF8 A;  1QE1 A;  2KTQ A;  5MLC Q;  3V6D A;  1VQ6 N;  3DLB A;  4NO7 A;  4CF1 A;  2CH6 A;  2VGN A;  4CHY A;  3D6R A;  2ZM6 K;  1XNQ K;  4IO8 A;  1GLA G;  1WSJ A;  1X9J A;  3UKR A;  4FCY A;  3AVG A;  3LWL A;  1IKW A;  1SAZ A;  4WF9 L;  2O8B B;  2GEM A;  3M6G A;  3KLE A;  1UAX A;  4JN4 A;  4EFH A;  3ZET A;  3NH2 A;  2OTL N;  2UUC K;  3A5L C;  1RTH A;  1E4G T;  3KWI A;  3EZW A;  5GIO A;  3O6W A;  4JK7 A;  3SAH A;  3A5M C;  3AA4 A;  4ILH A;  4LSN A;  3OY9 A;  3C0B A;  1CXQ A;  1KAY A;  1QHA A;  4O55 A;  4CFB A;  2W40 A;  3AAQ A;  3MDQ A;  4X66 K;  1GOA A;  5AZI A;  1HRH A;  2D5R A;  1LWC A;  3F2K A;  1U48 A;  1KFD A;  4F2R A;  1B92 A;  3VF6 A;  1S5J A;  2QWO A;  3T69 A; 
#chains in the Genus database with same CATH homology
 2E6M A;  3EY1 A;  4FJL A;  3I0R A;  3TAF A;  4C8N A;  3RTV A;  2I5J A;  1BIZ A;  3PV8 A;  3PY8 A;  3LZI A;  2XHB A;  5FDL A;  1JLQ A;  1S1W A;  3OYG A;  1BL3 A;  4HHT A;  2B6A A;  3KJV A;  4LY7 A;  4NCG A;  4CJP A;  4ELU A;  4I2P A;  4F3O A;  1XI1 A;  3C6T A;  1W0H A;  4JLH A;  5CYQ A;  4DTM A;  5HRP A;  1KSP A;  3LAL A;  1MU2 A;  2X6S A;  4CIF A;  3V81 A;  3PUF A;  1N6Q A;  4EZ9 A;  3QES A;  1UWB A;  4EP4 A;  3KIO A;  3AO5 A;  4FJ8 A;  1DTQ A;  3QO9 A;  2IC3 A;  4PQU A;  3WNF A;  3NAE A;  4C8K A;  1FXX A;  1O1W A;  3CFO A;  4LD0 A;  2WOM A;  1SUQ A;  1BHL A;  3C95 A;  4FW1 A;  3KK2 A;  4HUF A;  2VG5 A;  4DTP A;  2G8H A;  1YVU A;  4IKF A;  2P1J A;  2X78 A;  4BE1 A;  1NK7 A;  3HO1 A;  4DFK A;  3D0P A;  4E7I A;  4RW6 A;  4FZZ A;  2HHQ A;  4Z4C A;  5C42 A;  4OGC A;  4N5S A;  3K59 A;  1ASV A;  5HRR A;  1C6V A;  1ITG A;  3OS1 A;  1U4B A;  4E0D A;  1W9H A;  1D8Y A;  2XY5 A;  1L3S A;  4KO0 A;  1YTA A;  3AVB A;  1NK6 A;  1CXU A;  1RDC A;  3RMB A;  4CJQ A;  3HM9 A;  3BGR A;  4FJ7 A;  5J2N A;  5KGX A;  3ZT2 A;  1K6Y A;  3ALY A;  4Y1C A;  4H4M A;  4DSK A;  4F3T A;  2DFH A;  4QOZ B;  2HHT A;  1TKD A;  2JLE A;  4NYF A;  3AVH A;  1L3V A;  1QS4 A;  1Z26 A;  3OS0 A;  4BWJ A;  4YFU A;  3OYM A;  1TKT A;  4FLY A;  1ZBU A;  3O3H A;  1XHX A;  1WSE A;  4M45 A;  2A1R A;  3DRR A;  1ZBF A;  5FRN A;  4CE9 A;  4FW2 A;  4FLT A;  4HUG A;  3C6U A;  3AA3 A;  1JLG A;  4RW9 A;  4KB1 A;  1HYV A;  3VQC A;  2X6N A;  4DF8 A;  2FBX A;  3G10 A;  1FK9 A;  3PX0 A;  1XC9 A;  3O3F A;  1NK9 A;  2JGU A;  2G8W A;  3K5O A;  2ATQ A;  4CJL A;  3QEX A;  3HST B;  4YNQ A;  4W5O A;  4LH5 A;  4FZX C;  1IKX A;  4FK4 A;  1RDB A;  3QIO A;  1HQU A;  2HHX A;  1NOZ A;  1S1V A;  3NF6 A;  3K2P A;  4CIE A;  4L8R B;  3SPZ A;  1NK8 A;  4E7K A;  4QAG A;  2YHA A;  2XO7 A;  4CHQ A;  4BDZ A;  3QNO A;  3O4Q A;  1WAF A;  3SUN A;  4F4K A;  3DMJ A;  3HYF A;  2BE2 A;  4FJ9 A;  3RRH A;  1U47 A;  1WSH A;  3TAG A;  2G8V A;  3RR7 A;  4M3Y A;  2IAJ A;  1B9D A;  3OYF A;  1RT1 A;  2XRI A;  3LWM A;  3SV3 A;  1NJZ A;  2OZM A;  4KHU A;  3RR8 A;  3TI0 A;  1KRP A;  1RIL A;  1EX4 A;  2GV9 A;  5SWM A;  3ZSO A;  4AHU A;  2E4L A;  3F73 A;  3AVK A;  3S3M A;  4DU1 A;  4KKO A;  3LAK A;  2PYJ A;  4JS5 A;  4Y1D A;  1D5A A;  4XIU A;  4CGI A;  4DQP A;  1JLE A;  4ELV A;  1RT4 A;  2DY4 A;  1S9E A;  1VSE A;  1RBT A;  3IAY A;  2ETJ A;  4MQ3 A;  1ZBH A;  2HHW A;  4CJU A;  3DLR A;  3L2V A;  2O4G A;  3AVJ A;  3DLH A;  2YKM A;  3ZSV A;  3L2U A;  3NCI A;  4DLG A;  3KLH A;  3K57 A;  3AO1 A;  3MEE A;  5HBM A;  1KFS A;  4OPK A;  4CHO A;  4KV8 A;  4DFJ A;  4OGE A;  5J2M A;  4B8C A;  4NCA A;  3ZSZ A;  2KZM A;  3V9W A;  4CJT A;  4CJK A;  2P51 A;  4KAZ A;  1U04 A;  2FBY A;  2F8S A;  1HQE A;  3NDK A;  4CEO A;  4CHP A;  2FBV A;  3VQP A;  1L3T A;  3TAB A;  3RMD A;  2KFN A;  1RCH A;  3B6P A;  3DLG A;  1TL3 A;  3CQ8 A;  1KCF A;  4IFY A;  4AIL C;  1S1U A;  4DTS A;  1TV6 A;  4FLV A;  4O4G A;  3NFA A;  1TKX A;  1RT2 A;  1TGO A;  3OVN A;  3AVC A;  1NKC A;  4J2D A;  2F8T A;  3NF7 A;  1N5Y A;  4NCB A;  3ZT0 A;  4EP5 A;  4M3Z A;  3P1G A;  2E6L A;  4B08 A;  1LAW A;  4CK3 A;  1J5O A;  4CEF A;  5KRT A;  3LPU A;  1J54 A;  1NJX A;  3SQ4 A;  3B6O A;  1IKY A;  3P83 D;  3VQE A;  1S6Q A;  4CF0 A;  3HPG A;  4CGH A;  4CGJ A;  4FM2 A;  1S1X A;  3U3G A;  2PYL A;  1KLM A;  4O0J A;  4B9M A;  1C0U A;  3T1A A;  4BE2 A;  1ZBI A;  5KI6 A;  3SQ2 A;  4C8M A;  2A1S A;  3NF9 A;  4ID1 A;  3AVI A;  2WON A;  3AVN A;  4CK1 A;  4JS4 A;  3S3N A;  4KTQ A;  4KHQ A;  5D3G A;  2HW3 A;  3DLE A;  1IG9 A;  4E19 A;  3EYZ A;  1NKE A;  1C1C A;  3QEI A;  4B9V A;  1J9A A;  3IS9 A;  1RT7 A;  2O4I A;  3V9Z A;  4FK2 A;  4DFP A;  2HND A;  4R5P A;  2Y1I A;  3CM6 A;  1X9S A;  3ASM A;  3IRX A;  3V4I A;  2XY8 A;  3QLH A;  3SQ1 A;  2AJQ A;  3V9X A;  1VK0 A;  3M8Q A;  2RKI A;  5FRM A;  3LP2 A;  3KK1 A;  3HJF A;  1BCO A;  2BAN A;  3VA3 A;  3DOL A;  3KD5 E;  4DTX A;  4DTJ A;  2PZS A;  3K5L A;  2EHG A;  4M3W A;  3F9K A;  2YNG A;  1XWL A;  4BAC A;  1BIS A;  1BGX T;  2HHV A;  5C24 A;  5J2P A;  1NK5 A;  4PWD A;  2D0B A;  3DRS A;  3CFR A;  3DM2 A;  2KZZ A;  4C8L A;  3TWH A;  4I9L A;  1IH7 A;  5SZT A;  4Q5V A;  3HVR A;  1EP4 A;  4DQQ A;  1XHZ A;  2VG7 A;  1BCM A;  4OJR A;  4CEA A;  3DLK A;  4CEQ A;  1VSM A;  2OPS A;  5EU7 A;  3U6F A;  1WLJ A;  3MXM A;  4LH4 A;  3OS2 A;  3VQB A;  2ZQB A;  1LWF A;  2Z1I A;  4EZ6 A;  2LSN A;  1RT5 A;  2BDP A;  4J2A A;  2OPR A;  1HNI A;  1FKP A;  3OYL A;  4MFB A;  4CJ3 A;  4KRF A;  1VSD A;  3SUQ A;  4DSF A;  3I8D A;  4DTR A;  3TAN A;  4OLA A;  3QER A;  1T8E A;  3DRP A;  3P5J A;  2ZE2 A;  1HNV A;  5HLF A;  1Q9X A;  1RT6 A;  1RBV A;  1JL2 A;  3VQA A;  3ZSW A;  3AA5 X;  3LAM A;  4IDK A;  4E3S A;  4E7J A;  2GUI A;  2ITG A;  4IFV A;  1Q9Y A;  1T05 A;  4F2S A;  5CZ2 A;  4CHN A;  4DSE A;  4DU3 A;  4RW7 A;  4FJG A;  3QEV A;  3ZSX A;  1RTI A;  1CZB A;  1JKH A;  4N56 A;  1REV A;  5T7B A;  4PUO A;  4CJ5 A;  2B4J A;  2B5J A;  4FJJ A;  2G8I A;  2Z1J A;  4DTN A;  4FJN A;  3TAP A;  2OZS A;  2KFZ A;  2QK9 A;  5JS2 A;  1NK4 A;  1TK5 A;  1U45 A;  4M3T A;  1B9F A;  4CJR A;  3ZT4 A;  1L5U A;  1GOC A;  4DSI A;  1KVC A;  1C0T A;  3HXM A;  1Y97 A;  1JLA A;  3VN5 A;  4FM1 A;  3SPY A;  3NBP A;  3I0S A;  4E1N A;  1TKZ A;  4CJF A;  4O0I A;  1T7P A;  4OLB A;  3L3V A;  3K5M A;  3L2W A;  3S3O A;  4CF9 A;  4OPJ A;  3VA0 A;  4KB0 A;  2BGG A;  1YTU A;  1BQN A;  2NUB A;  1HYS A;  1RTJ A;  1RDA A;  3HT3 A;  5JS1 A;  1LAV A;  3VQ5 A;  4B9L A;  3OYK A;  1VRT A;  1X1P A;  4I7F A;  3OJU A;  1LW0 A;  3KLF A;  4KHW A;  1S1T A;  1TVR A;  4O5B A;  1EKE A;  4DMN A;  2XY7 A;  4CEZ A;  1TAU A;  3SCX A;  3MXI A;  4CFA A;  4KPY A;  4I9Q A;  4DS4 A;  5I3U A;  1RBS A;  2YNI A;  4FVM A;  1RDD A;  4F8R A;  3ZSR A;  3QEP A;  4CHZ A;  2Z1H A;  3FFI A;  4CJE A;  1T03 A;  3LAN A;  5HP1 A;  2DFE A;  5J1E A;  4DS5 A;  1Z25 A;  3ISN C;  2HVH A;  4IG3 A;  5CZ1 A;  4FLU A;  2W42 A;  3LZJ A;  1EXQ A;  3M8S A;  3ZSY A;  1D9D A;  5DK5 A;  4DSL A;  3WNH A;  2VG6 A;  3IG1 A;  3V1Q A;  3HP6 A;  4FLW A;  2R7Y A;  4DSJ A;  3HK2 A;  4M3R A;  1UA0 A;  3TAM A;  4CJW A;  3CYM A;  4ZTJ A;  5E41 A;  4DF4 A;  3AVA A;  4Z0U A;  4CF2 A;  5KTQ A;  3SUO A;  3VQQ A;  3OJS A;  3AVF A;  3ITH A;  3VQ4 A;  3CM5 A;  4KTZ A;  4AHC A;  4HUE A;  3SNN A;  1TK8 A;  2G8F A;  4Z4E A;  2HVI A;  1BQM A;  2RF2 A;  4CEB A;  1RT3 A;  2HMI A;  2XY6 A;  4FJK A;  2OA8 A;  3VQD A;  3PO4 A;  1JLF A;  3O4N A;  1VRU A;  3AVM A;  4DTU A;  3UIQ A;  4KHN A;  4CJV A;  3OYN A;  1A5X A;  3RMC A;  4FJ5 A;  3TAE A;  1VSH A;  2HNY A;  1G15 A;  1VSJ A;  3M8R A;  2HNZ A;  3LDS A;  4CES A;  1JXB A;  1NJY A;  4FJH A;  4HTU A;  4O44 A;  2EX3 A;  2IOC A;  4HVJ A;  1S6P A;  1HPZ A;  3HPO A;  4NYN A;  3THV A;  3S9H A;  3HVT A;  4BDP A;  4Z4G A;  2FC0 A;  3QET A;  4M42 A;  3VQ7 A;  4CED A;  2G8K A;  4K8Z A;  1FKO A;  3DI6 A;  5C25 A;  1L3U A;  3AO4 A;  1Q8I A;  3RWU A;  1VSK A;  4FM0 A;  1DTT A;  3AO3 A;  4AHS A;  4J2B A;  4B3O A;  1NKB A;  5I42 A;  4LSL A;  4CFD A;  3OYJ A;  5KGW A;  2Q3S A;  3L8B A;  4DQS A;  4Z4F A;  2VWJ A;  4CEC A;  1SV5 A;  4AHT A;  1JLC A;  3ULD A;  3LP3 A;  4RW8 A;  1WSF A;  3DYA A;  4DTO A;  1CZ9 A;  3SJJ A;  2Z1G A;  4CIG A;  3CFP A;  2OPQ A;  3SZ2 A;  1WNS A;  3K58 A;  1TL1 A;  3KLI A;  1RBU A;  4B9S A;  1SKW A;  1I39 A;  3C94 A;  3JYT A;  2P5G A;  4CCH A;  4FJM A;  4KI6 A;  3KK3 A;  3OYH A;  4AH9 A;  3KKR A;  3V1R A;  4DQI A;  4FLX A;  4FJI A;  3L2Q A;  1IO2 A;  4FYD A;  4CER A;  5J2Q A;  4CEE A;  4QCL A;  4W5T A;  1NJW A;  4DWI A;  1BI4 B;  3ZT3 A;  3O3G A;  4DLE A;  1LV5 A;  3OYB A;  4PA1 A;  4GW6 A;  3ZT1 A;  1EET A;  1KTQ A;  4Z4H A;  1F21 A;  3QNN A;  2YV0 X;  4IBN A;  3OYC A;  2PY5 A;  4N76 A;  4KRE A;  4CGG A;  4ZTF A;  3E01 A;  1KVB A;  2HB5 A;  3LPT A;  4CGD A;  4DG1 A;  3NHG A;  5K14 A;  3SI6 A;  4AHR A;  1IKV A;  3VQ9 A;  3CG7 A;  1VSI A;  3TR8 A;  2ZD1 A;  4RW4 A;  3SUP A;  4AHV A;  4I2Q A;  3NH0 A;  3K5N A;  3L3U A;  4G1Q A;  3SV4 A;  1UA1 A;  3PX4 A;  4B9N A;  1JLB A;  3A2F A;  5KRS A;  1C1B A;  5DMR A;  1WN7 A;  3LP0 A;  1TAQ A;  3OYI A;  3ZSQ A;  4KHY A;  1QQC A;  3ZCM A;  1SL2 A;  2DTU A;  3MEC A;  1SKR A;  4BE0 A;  4H4O A;  1I3A A;  1SL1 A;  3KTQ A;  4PY5 A;  4B9T A;  4J2E A;  4ID5 A;  4Q0B A;  5HRS A;  2F96 A;  3AV9 A;  1UOC A;  4OKJ A;  4W5N A;  3SQ0 A;  2DFF A;  4TSX A;  4BDY A;  3QIN A;  1ASW A;  1VSF A;  4B8A B;  3M8P A;  4M3X A;  3U3Y A;  2YNH A;  4W5R A;  1NK0 A;  1ZYQ A;  3BDP A;  2YKN A;  2IDO A;  3KD1 E;  1GOB A;  1WAJ A;  3MEG A;  3V9U A;  1C1A A;  1ZBL A;  4E1M A;  4FZY A;  2KQ2 A;  3NGY A;  4ZHR A;  1KLN A;  2G8U A;  2IGI A;  4M3U A;  3T19 A;  2YHB A;  1QSL A;  4W5Q A;  2YNF A;  3KLG A;  1SKS A;  2QKK A;  4KHS A;  1QSS A;  4E7H A;  3QIP A;  2KW4 A;  3AO2 A;  3PX6 A;  3RRG A;  3VQ8 A;  4OKK A;  1RBR A;  3V9S A;  4OVL A;  3L2R A;  1S9G A;  1TK0 A;  3WNE A;  3TAR A;  1U49 A;  3MXJ A;  2QKB A;  1VSL A;  4CFC A;  1QTM A;  2OYQ A;  1KVA A;  4CJS A;  1DLO A;  1RNH A;  3SYZ A;  4CGF A;  3NE6 A;  4UQG A;  1HYZ A;  2IS3 A;  1BI4 A;  3HP9 A;  3T3F A;  4KI4 A;  1JL1 A;  3MED A;  1J53 A;  4K8X A;  1RTD A;  4H8K A;  4CJ4 A;  3OYE A;  3DOK A;  1QHT A;  4ICL A;  4FJX A;  5FRO A;  2RPI A;  3QEW A;  5HRO A;  1X9W A;  2P5O A;  1CLQ A;  3TAQ A;  1X9M A;  3NF8 A;  1QE1 A;  4CK2 A;  4HCC A;  2KTQ A;  1WSG A;  3V6D A;  3EZ5 A;  4E7L A;  4HCB A;  3AVL A;  3DLB A;  4CF1 A;  3D45 A;  4CHY A;  3HL8 A;  4RG8 A;  1D9F A;  2RN2 A;  3HPH A;  4M41 A;  1HJR A;  4FXD A;  3NGZ A;  3RMA A;  4DQR A;  1WSJ A;  1BIU A;  4FCY A;  1A5W A;  1JXE A;  3AVG A;  2HHU A;  3LWL A;  1IKW A;  3V1O A;  2HHS A;  2VWK A;  1C0M A;  1ASU A;  3MAQ A;  1WSI A;  4FK0 A;  3WNG A;  3KLE A;  1UAX A;  4DFM A;  4N41 A;  1LWE A;  3PO5 A;  5CYM A;  4JRQ A;  2QXF A;  3AA2 A;  1A5V A;  3NH2 A;  4BWM A;  2GBZ A;  3NH1 A;  1RTH A;  4WE1 A;  3JSM A;  3NGI A;  3KKS A;  4DU4 A;  2FBT A;  4GVM A;  1QSY A;  4C8O A;  4KFB A;  3AA4 A;  4LSN A;  3OY9 A;  2Y1J A;  3OYD A;  1CXQ A;  2D0A A;  4O55 A;  4CFB A;  1LW2 A;  1R0A A;  2X74 A;  3G0Z A;  1HMV A;  4E89 A;  4B9U A;  3H08 A;  4KTW A;  1GOA A;  4N47 A;  4CF8 A;  3OYA A;  1HRH A;  2D5R A;  1LWC A;  1NOY A;  4ELT A;  3LP1 A;  2OPP A;  4IG0 A;  4FLZ A;  4Z4I A;  4OKE A;  1KFD A;  1YT3 A;  1U48 A;  1SL0 A;  4F2R A;  2D0C A;  4JRP A;  5HRN A;  3VQ6 A;  1B92 A;  5CY4 A;  1S5J A;  4GMJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...