2FBTA

Wrn exonuclease
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
196
structure length
196
Chain Sequence
HHSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 61
structure length 196
sequence length 196
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbtA00
2HMIA 3AVJA 3SV3A 3SUNA 3KTQA 2G8IA 4QAGA 3NDKA 4FK2A 4CJUA 3RWUA 3RMBA 4DU1A 1X9MA 1RTJA 2OPSA 4LSNA 3DI6A 1D9FA 1HYSA 1IO2A 2VG6A 2FBVA 2NUBA 3OYBA 4N41A 2G8VA 2YNIA 3SQ1A 1DTQA 1RT7A 3VQ8A 1TV6A 4BDZA 3G10A 1B92A 1TL3A 4AHVA 3KLFA 3LP3A 1TKTA 1CXUA 1VSIA 2KFNA 3AVHA 4F2SA 1RCHA 3AA4A 2KQ2A 1BGXT 3TABA 3RRGA 4FJKA 1KSPA 4FM2A 3K5LA 3OYDA 4FK0A 4KREA 1CLQA 3LZJA 2GUIA 4AH9A 2WONA 3S3MA 1IG9A 4FJHA 3UIQA 1J54A 4B8AB 1XHZA 2A1RA 5EU7A 1T7PA 1ZBHA 3HJFA 1UA1A 3CFRA 1C0UA 3QETA 2AJQA 5CZ1A 3OVNA 1BI4A 4DTOA 5FDLA 4I2PA 4CECA 3L8BA 1HQUA 5KRSA 3BGRA 4DSLA 5HBMA 2OPPA 3LP0A 4FZZA 2KZMA 3THVA 1B9DA 1C0MA 5C42A 3VQCA 3WNHA 4CF2A 1XC9A 4FJGA 1HYVA 4KO0A 4DTXA 1Z26A 1EXQA 2HB5A 2X78A 3AO2A 1WSJA 4G1QA 1XI1A 1R0AA 3WNEA 1NKEA 4BE0A 4DWIA 4I9QA 5FRMA 2QK9A 3AVMA 1YTUA 3D45A 1SV5A 3LAKA 3CM5A 4DTRA 1GOCA 2KZZA 1NJXA 3SCXA 1RTIA 4IFYA 1J5OA 5T7BA 4R5PA 3CFOA 1TKZA 4B9VA 4B3OA 1I3AA 3O4QA 4ICLA 4HUEA 1TKDA 2G8WA 4J2AA 5CYMA 3NHGA 3AA5X 3KKSA 4JRPA 4L8RB 3DLKA 2HW3A 2FBTA 3NFAA 3VA3A 1KFSA 4KRFA 4EZ9A 1ZBFA 4CGDA 3KK1A 4Z4FA 5CYQA 3OYCA 1GOBA 2FC0A 3T19A 1W0HA 5SZTA 3RR7A 2GV9A 3I8DA 4DFKA 4CJ3A 4DFPA 2RPIA 2ZQBA 1XHXA 4CJSA 1IKXA 3AO3A 2IOCA 1RTDA 1VSKA 1BIZA 3OYAA 3DLGA 5FRNA 4JS5A 3WNFA 4NCAA 4CFAA 3HP6A 2VG5A 1RT5A 2XY6A 4EP5A 4KTQA 2Q3SA 1VSHA 2VG7A 4KI6A 1NK5A 4RW8A 4KB1A 3V9SA 2DFFA 3VA0A 4J2DA 3ISNC 4CGIA 5HLFA 4W5RA 4CHQA 4M41A 4FVMA 4BDPA 5I3UA 4CJ5A 2Y1IA 3NF9A 4H4MA 1T03A 3SPZA 4LSLA 4FLTA 2YNFA 2P5GA 4N76A 3VQEA 1WSEA 3NH2A 4M3RA 2D0AA 1SL1A 1QS4A 1KFDA 1IKVA 4FW1A 3KIOA 4E7KA 5J2PA 4CJQA 1VSFA 1LAVA 3K5MA 3NF7A 3NGZA 4CE9A 3QEXA 1S5JA 4BACA 3H08A 3NAEA 3L2RA 2W42A 4PQUA 1EX4A 1JL1A 1S9EA 4BWMA 3LZIA 1L3TA 4B9TA 4CCHA 4ELUA 1S1WA 2I5JA 3QIPA 3VQ6A 3LDSA 1YTAA 3ZT0A 3HPOA 1X9SA 1RILA 3QIOA 4I2QA 1HNVA 4OGEA 4CJLA 4N5SA 1LW2A 3KLGA 3KLHA 4CK3A 3CQ8A 3RMCA 1JLGA 4Y1DA 4RW7A 1Y97A 3M8QA 3HT3A 3VQ4A 1QSSA 2BANA 3DLEA 3LP2A 4CFBA 3L2WA 1WAJA 4J2EA 4C8KA 2E6MA 4B9UA 1KLMA 1N5YA 4HUGA 3P83D 4W5OA 3VQ9A 4OLAA 4E7IA 2ITGA 4RW6A 4E89A 1LWEA 4HCCA 3EZ5A 1S6PA 3VQBA 1EKEA 1HMVA 3DMJA 1RNHA 1U04A 3HPGA 4O5BA 4DQPA 2HVIA 1C0TA 2YV0X 3AO5A 5HRPA 3DRSA 3DRRA 4UQGA 3AVCA 4DTUA 5J2MA 3RMDA 3QEPA 4FJJA 1J9AA 3PX6A 3L2VA 1A5VA 4N56A 1B9FA 1JL2A 5J2QA 1QSLA 4OPKA 4J2BA 4AHTA 4KHUA 2IC3A 3B6OA 3SJJA 3HL8A 2XY5A 4OKKA 3S3NA 2P1JA 3JYTA 3OYMA 3OYFA 1BI4B 3V81A 2E6LA 2RN2A 2DTUA 1RBRA 5CZ2A 1JXBA 1TAQA 1REVA 3ZSZA 3OYEA 1HNIA 4E7HA 1TK5A 4F8RA 1L3SA 5HP1A 2HHQA 4Y1CA 4HHTA 4JRQA 4ID1A 4DSEA 3ALYA 4CFDA 5HRRA 4KTWA 1EETA 2YNGA 4CGGA 2PZSA 4AHUA 3I0RA 3O3FA 1U49A 3K5NA 2JGUA 4FJMA 4DLGA 3V6DA 3ITHA 3DLRA 2EX3A 4NYFA 3OYGA 2YHBA 3OS2A 2PYLA 4E19A 4KHWA 2O4IA 3A2FA 4Z4GA 4F3OA 2IGIA 4DS4A 3QERA 4E0DA 2LSNA 1FK9A 3MEEA 2VWJA 4ELTA 2P51A 1TAUA 4DFMA 2QKBA 3QLHA 2Z1IA 4QCLA 3QEWA 3TAFA 5KI6A 4B8CA 3HP9A 3DLHA 3AO4A 3NGYA 3AA2A 1S1TA 4OKEA 5C24A 4CF0A 4CJFA 4CEEA 2XRIA 4W5NA 4AILC 3SUPA 4HCBA 4M3UA 4CJTA 3T3FA 4DF8A 1RDCA 4Q5VA 2G8KA 4OGCA 5HRSA 3AVLA 2X74A 4CHYA 4W5TA 1NOZA 4JS4A 4WE1A 3OS1A 3HVTA 1TL1A 3KLIA 2FBYA 4RG8A 4DMNA 4QOZB 1N6QA 1A5WA 1BCMA 1O1WA 1CZBA 1VSDA 1BQMA 4KTZA 4B9NA 4Z4IA 3HVRA 1FKOA 4E1NA 1JXEA 4KKOA 1NKCA 4DTSA 4YFUA 1NJZA 3OYKA 2G8HA 4OPJA 4DQQA 4OKJA 3NF8A 3P5JA 5KGWA 1KVCA 1HYZA 4LY7A 3T1AA 3ZT4A 4CK2A 4DFJA 2YKNA 4DU3A 1VSEA 5J1EA 1FXXA 2JLEA 2HHWA 1VSLA 1U4BA 1K6YA 4BE1A 4DU4A 1HJRA 4C8MA 4M3YA 3CM6A 4O0JA 4E7JA 4GVMA 2Y1JA 3NF6A 4KAZA 1TVRA 3K59A 3F9KA 1EP4A 2R7YA 1Q9YA 3L3VA 3EYZA 3MXIA 2HNDA 3PO5A 4F2RA 1WAFA 5DMRA 4CGJA 3ZSYA 1FKPA 2B5JA 1C6VA 4KB0A 4I7FA 1S9GA 3SQ0A 1NK4A 1L3VA 3KD5E 1S1UA 1RT3A 1GOAA 5KRTA 3ZSOA 3VQQA 1LWCA 1NJYA 3PX0A 1S6QA 4AHSA 3SNNA 4EP4A 3TAMA 3OJSA 4HUFA 4RW4A 2G8UA 4YNQA 1F21A 3P1GA 4C8NA 4FJ5A 4FCYA 5FROA 2XHBA 2Z1GA 2IDOA 3AVFA 1KLNA 4KI4A 4CHZA 1QE1A 3RR8A 1KRPA 4B9SA 2YHAA 4FJ7A 4TSXA 3TARA 4HTUA 1Z25A 4FJ9A 3S3OA 2P5OA 1BQNA 1TGOA 2A1SA 3OYHA 3FFIA 4CIEA 3SQ2A 2EHGA 4DQIA 3QEIA 1C1AA 3HO1A 4ZTJA 1D9DA 5C25A 3TANA 1QSYA 5E41A 3AVKA 4CFCA 2X6SA 3RTVA 4LH4A 3TAPA 4C8LA 4M3TA 2HNZA 3S9HA 2VWKA 3U3GA 4N47A 4FM1A 2D0CA 3F73A 3KJVA 2HHUA 2YKMA 2HHSA 4O4GA 2KW4A 3OS0A 1RT1A 1SKWA 1SUQA 4DS5A 4FLWA 2ZD1A 4CHNA 3LWMA 4O55A 4MQ3A 1ZBUA 4CHPA 4DQSA 1LWFA 3C6TA 3NCIA 4FZXC 4E7LA 4BWJA 3SYZA 3HK2A 2ATQA 1RDDA 2HNYA 1ITGA 1DLOA 2FBXA 3TR8A 1NK9A 4PUOA 1Q8IA 1UOCA 2RF2A 4DSFA 4FJLA 4KHSA 4M3ZA 2F8SA 1RDAA 3CFPA 3VQDA 3DYAA 2XY8A 2IAJA 2O4GA 4XIUA 5I42A 1VRUA 4MFBA 3IS9A 3IRXA 1LW0A 2KTQA 2BE2A 2D5RA 4DTJA 4Z4EA 3TAEA 3HSTB 1D5AA 1L3UA 2DFHA 2PYJA 2OYQA 4OVLA 4FK4A 3NBPA 2HHVA 4CGHA 3OY9A 4C8OA 3EY1A 1HQEA 3ULDA 2D0BA 5J2NA 1SKRA 4O0IA 4B9MA 1UAXA 1ZBLA 3LPTA 3VQ7A 3I0SA 4IDKA 4M45A 3LALA 3NGIA 4FLZA 3V9ZA 4HVJA 3QO9A 4ID5A 3LWLA 2XY7A 4DSIA 1DTTA 4KFBA 1G15A 5HROA 2DY4A 3SUOA 1I39A 1SL2A 2BDPA 4FLVA 3O3HA 5K14A 3PX4A 4PWDA 3ZSQA 5JS1A 3LAMA 1CZ9A 4IBNA 1ZBIA 1ZYQA 4KHQA 2F96A 1JLBA 3L2UA 3U3YA 3DRPA 4NYNA 3PUFA 4CHOA 4CJPA 3ZSXA 4Z0UA 1ASUA 3MEGA 4CJWA 3OJUA 3K57A 1Q9XA 4FXDA 1HPZA 4Z4HA 3KD1E 3KK3A 4JLHA 3NH0A 3M8SA 4DTMA 2YNHA 1SKSA 4CEAA 1U47A 4FZYA 4NCGA 4F4KA 3LANA 4KHNA 3OYNA 1BL3A 4FJNA 1WSFA 3ASMA 1YT3A 4K8ZA 4K8XA 1BCOA 3ZSRA 1IKYA 3AVGA 4KPYA 2OA8A 2OPRA 4F3TA 2QXFA 3SI6A 1VSJA 3VQAA 3TAQA 3DM2A 4CJVA 5SWMA 1JLQA 3PY8A 4IFVA 4GMJB 4RW9A 4CJRA 4LD0A 4FJXA 3SZ2A 3O3GA 4M42A 3MECA 1NKBA 4CERA 5KTQA 4ELVA 4GW6A 4FLXA 3V1OA 1S1VA 1NOYA 3AA3A 2KFZA 4FW2A 4KV8A 1RDBA 4BE2A 1BHLA 1WLJA 4FJ8A 1RT6A 2Z1HA 1JLCA 3KK2A 4CEZA 4CEBA 2ZE2A 3M8RA 4ZTFA 2B6AA 3RMAA 4Q0BA 3MXMA 4KHYA 4H8KA 1QQCA 3E01A 4CEQA 1JLAA 3VQ5A 3QESA 1KVBA 2DFEA 3V9XA 2PY5A 4M3XA 2BGGA 3HPHA 1A5XA 3B6PA 2OPQA 5DK5A 3VN5A 1ASWA 1D8YA 2HVHA 4CESA 4CGFA 1NK7A 4E3SA 2IS3A 3L3UA 4CJKA 3O4NA 1ASVA 4H4OA 3VQPA 4CJEA 2XO7A 3LP1A 1QHTA 3ZSVA 2WOMA 3V9WA 3QNNA 5CY4A 3MXJA 1S1XA 4BDYA 4IKFA 4B08A 4FLYA 3TI0A 2RKIA 1NK0A 3DOLA 3JSMA 5D3GA 2F8TA 4DQRA 1QTMA 3AVBA 3SV4A 1NK8A 1RT4A 3KKRA 1RT2A 4FYDA 1IH7A 1T05A 1XWLA 2ETJA 3M8PA 3KLEA 1T8EA 4ZHRA 3C95A 4DTNA 1JLFA 4CEOA 1WSGA 3HM9A 3QEVA 3ZCMA 1CXQA 4PY5A 2X6NA 3OYIA 1U48A 2GBZA 1VRTA 4Z4CA 1TK0A 1VSMA 3K58A 1RBTA 4AHCA 5HRNA 3V9UA 2G8FA 4EZ6A 4CF8A 1BIUA 1RBUA 3LPUA 3C6UA 3CYMA 4PA1A 4CF1A 1JLEA 1NK6A 3AVAA 2HHTA 1KTQA 4CEFA 3CG7A 1RBVA 3ZSWA 4CK1A 4CF9A 4CIFA 3NE6A 3DLBA 4O44A 1C1BA 4LH5A 3NH1A 1VK0A 3AVIA 3D0PA 5JS2A 4FM0A 3QNOA 3SUQA 1SL0A 3TAGA 2OZSA 3PV8A 3SQ4A 3AV9A 3BDPA 1LV5A 3C94A 1MU2A 1JKHA 2E4LA 4DF4A 3U6FA 1NJWA 1U45A 4DSJA 3V1QA 1X1PA 1TK8A 3MAQA 4DTPA 1TKXA 3PO4A 4W5QA 4OJRA 3SPYA 1L5UA 1WNSA 1X9WA 4B9LA 1YVUA 2HHXA 1HRHA 1J53A 3V4IA 2OZMA 4FJIA 1KVAA 3OYJA 3HYFA 3ZT2A 4CIGA 3MEDA 3QINA 3WNGA 4AHRA 4IG0A 1UA0A 2B4JA 1KCFA 1WSIA 4E1MA 3IG1A 3L2QA 3AVNA 4I9LA 3HXMA 2QKKA 1RTHA 1RBSA 4FLUA 3IAYA 4M3WA 4DG1A 5KGXA 1W9HA 4CEDA 3K5OA 1BISA 4CJ4A 3OYLA 1UWBA 3TWHA 3V1RA 2Z1JA 3G0ZA 3AO1A 3ZT1A 3RRHA 4DSKA 3DOKA 1C1CA 4NCBA 1WSHA 3ZT3A 4OLBA 1LAWA 4DLEA 3K2PA 1WN7A 1IKWA 4IG3A
chains in the Genus database with same CATH superfamily
3SAFA 4YOWA 4O8UA 4A5BA 2ZGYA 4QAGA 5FLXO 3RMBA 4B1XB 4DV0K 4EAHD 1IO2A 1BWFO 3T7ZA 4CZIA 2FBVA 2G8VA 2YNIA 1DTQA 1RT7A 1RGIA 3AY9A 4BDZA 1XMQK 3G10A 1B92A 4NLBA 4PHTX 4WFBL 3FR0A 1RCHA 3AA4A 1KSPA 3K5LA 5KPZA 3OYDA 4KREA 3A0IX 3SMSA 2WONA 4AH9A 3S3MA 3K9JA 2A6AA 4FJHA 3WXMB 2BH1A 1XHZA 4DR5K 1O13A 5BRDA 1ZBHA 1UA1A 1C0UA 2AJQA 4DHYA 4DTOA 3MCPA 5FDLA 1P90A 1YJWN 4DSLA 5HBMA 3LP0A 3THVA 1B9DA 2NRWA 4JI2K 4EHUA 2EWSA 4G1QA 1IJJA 4YOUA 4BE0A 2QWOA 3C7NB 2QK9A 4BRKA 3D45A 3CMEN 4DTRA 4R79A 1TKZA 4ICLA 4CZJA 3ATVA 2FBTA 3VA3A 4JKFA 3KZBA 2FC0A 4BRFA 1TYQA 4DFKA 2GELA 3BEXA 4CJSA 3DLGA 4JS5A 4NCAA 3HP6A 2VG5A 5C2FA 3NVKA 2Q3SA 1VSHA 4KI6A 4J2DA 4CZHA 4MDBA 3SMPA 3THYB 2W6LA 4MO5A 4ILJA 2YNFA 1RFQA 3VQEA 1QZ5A 2NRZA 3MN7A 2E5LK 2D0AA 2UUCK 4CZMA 4CZEA 1KFDA 1IKVA 1W97L 3N4QA 3NF7A 3LDNA 4CE9A 3QEXA 4O5FA 1CZAN 5B8HA 4PQUA 1EX4A 1JL1A 4BWMA 4ELUA 2I5JA 3QIPA 1YTAA 3ZT0A 3F2KA 3KLGA 3VEZA 4RW7A 1QSSA 4J2EA 3LP2A 4CFBA 1WAJA 1OH7A 3OHRA 4IWVA 3VQBA 2OTJN 1C0TA 2YV0X 5HRPA 4UQGA 1J9AA 3PX6A 1ILYA 4J2BA 1B9FA 4K42A 5J2QA 4OX9K 4AHTA 1N33K 3T69A 2ZM6K 2XY5A 4BG8A 3V81A 1RBRA 5CZ2A 2WC9A 1HNIA 1TK5A 3M5RA 2A3ZA 1L3SA 4Y1CA 1I94K 4JRQA 3ALYA 3MCAB 4CFDA 4KTWA 4AHUA 3U9DA 1ZBSA 3BF3A 4BGAA 4FJMA 3UB5A 4DR7K 1QHAA 3OYGA 2YHBA 1NU0A 3A2FA 1TYQB 3HZ6A 4DS4A 3QERA 4E0DA 3MEEA 2VWJA 4ELTA 3WEEB 4DFMA 2Z1IA 3Q7BA 4CI6A 3VTIA 4CF0A 4CJFA 2P9IA 4AILC 4DV6K 4M3UA 4CJTA 2QM1A 4OGCA 5HRSA 3AVLA 4WE1A 5M1FA 3HVTA 4MDAA 2FBYA 4QOZB 1N6QA 4FWNA 4KTZA 1CZBA 2NRRA 4BRHA 1ATRA 4GNIA 5LJWA 1XNQK 2G8HA 4OKJA 3NF8A 5KGWA 4CK2A 2YKNA 4WCEL 1VSEA 4A57A 2HHWA 3EL2A 4BC2A 1HJRA 4FWKA 5KPTA 4E7JA 4DR3K 4GVMA 1TVRA 3K59A 2UYTA 3PO5A 4F2RA 3MXIA 1SZ2A 1WAFA 4KB0A 3CQYA 1GOAA 1S6QA 3TAMA 4YOTA 4IO8A 1F21A 4IOXA 1KAXA 3P1GA 4H5RA 4C8NA 2P9KA 2Q2RA 4B1ZA 1KRPA 2YHAA 5JLHA 1SQKA 4JHDA 1Z05A 1Z25A 4FJ9A 4K25A 2P5OA 1BQNA 1TGOA 3JXUA 2A1SA 3FFIA 3SQ2A 3WXIA 3EZWA 3CF5L 3R6MA 4ZTJA 1YJNN 1QSYA 3TANA 4BR2A 2F7TA 2FSJA 3KJVA 1RT1A 1SKWA 1SUQA 3HI0A 4DS5A 4H0VB 1J6ZA 3OA9A 4CHNA 3LWMA 4O55A 4DR1K 4CHPA 1ZBUA 4DQSA 1GLLO 3C6TA 1OH5A 3SYZA 2A42A 1RDDA 2FBXA 4DCHA 4PUOA 1UOCA 4M3ZA 3MN6A 2F8SA 2XY8A 4MFBA 1MWMA 4JYAK 2BE2A 4Z4EA 4A61A 3NBPA 4JKDA 3HBTA 4CGHA 3EY1A 5J2NA 4B9MA 1UAXA 3QMLA 4H03B 3VEVA 3O1BA 3CC7N 3QO9A 4ID5A 1DTTA 1G15A 3BUZB 3SUOA 1I39A 1YHQN 2BDPA 3O3HA 1NMDA 3VERA 4XEIA 1ZYQA 4KHQA 5AQPA 2QWMA 1WUAA 3ZSXA 1GLAG 1ASUA 3OJUA 3K57A 2VQFK 1Q9XA 1NMNA 4Z4HA 3KK3A 4DTMA 2QWRA 3TTCA 4BROA 1U47A 4FZYA 4FWLA 2VGMA 2NRVA 4KHNA 1NGGA 4PL7A 1JJ2M 5F0XA 1VSJA 3ZX3A 2GEMA 2P9KB 3PY8A 2HHHK 1OVQA 4FL9A 4CJRA 3D7EO 3IFRA 3RSEA 3S41A 4JHDB 3AA3A 2KFZA 5BPNA 3ZX2A 3KHYA 1RDBA 4NXMK 3ZEUA 1WLJA 2Z1HA 4CEBA 2ZE2A 4PKIA 3C6HA 3M8RA 4Q0BA 4H8KA 1JLAA 3VQ5A 1HR0K 3THWA 3UKUA 4XH5A 4BR9A 1A5XA 2OPQA 1D8YA 3TU5A 4JK8A 4CGFA 2ITMA 4H4OA 3VQPA 1N8RO 1GLFO 3LP1A 1EWRA 4FSVA 1S1XA 4BDYA 4FLYA 3TI0A 5D3GA 3AVBA 5ELZA 4FYDA 1XWLA 4JAXA 4MO4A 4DR2K 3M8PA 4ZHRA 1KD1O 1JLFA 3ZETA 2WFBA 3QEVA 4PY5A 3R8EA 1VRTA 4Z4CA 5GAHP 3K58A 2F4VK 3FZLA 5HRNA 2G8FA 1BIUA 1RBUA 3H46O 3C6UA 3CYMA 4PA1A 4CZLA 3CG7A 2FSNA 3ZSWA 4CF9A 4BRQA 3DLBA 4A5AA 4MLEA 3NH1A 1VK0A 2ASMA 2HF3A 5AQLA 3SUQA 1QVFM 3MWTA 2YJFA 3AV9A 1KAYA 3CCVN 1JKHA 4DSJA 2D0PA 5A2QO 3VPZA 5GIPA 1L5UA 2GWJA 1X9WA 1YVUA 5E84A 3O6WA 4RCHA 1HRHA 3V4IA 4FJIA 2P9NA 2B4JA 1WSIA 4E1MA 4JKHA 3L2QA 2D4WA 4BVPA 3SAGA 2QKKA 1RTHA 4GV3A 4FLUA 1XMOK 5KGXA 3VGLA 3VMFB 1JCEA 1UWBA 3LDOA 3V1RA 3AO1A 3ZT1A 3RRHA 1DKGD 3ZT3A 4B9UA 3RSEB 1HPMA 3GG4A 3SUNA 2A41A 3KTQA 3L4IA 3NDKA 3CIPA 2I7PA 3A5LC 1X9MA 1LOTB 2NRXA 4LFCK 3U9ZA 3DI6A 4AQYK 3ZEUB 5IT9O 3QFPA 3VQ8A 3KLFA 4AHVA 5M1QA 3THWB 3AVHA 2KQ2A 1BGXT 4FK0A 1VQ6N 4FM2A 1V4SA 4CJ7A 4JD2B 1J54A 4PKHA 1T7PA 2O8BA 3HJFA 3D2FA 3O4WA 1SS6A 1BI4A 2YHXA 4CECA 2YHYA 5KRSA 3WNHA 3TPQA 5JLFA 3H1QA 1Z26A 2HB5A 1TKDA 5LL6Z 5FRMA 4B1VA 2QWQA 3WNEA 4DWIA 4I9QA 5GIOA 3LAKA 3ZETB 3SK3A 2KZZA 1NJXA 1RTIA 4IFYA 5T7BA 5BREA 4HUEA 3T1YK 3AA5X 3KKSA 1BG3A 4JRPA 3DLKA 4L8RB 1NGIA 3NFAA 4KRFA 4EZ9A 1ZBFA 4Z4FA 3OYCA 3RR7A 3T19A 1W0HA 2GV9A 3I8DA 2GX9A 4DFPA 2ZQBA 1XHXA 2IOCA 1VSKA 2WTUA 2QWLA 3I8BA 4H5VA 2XY6A 4KTQA 3VENA 5TKWA 1NK5A 3V9SA 3ISNC 4JN4A 4CGIA 4BR7A 2YJEA 3CCLN 4BDPA 4BRNA 2Y1IA 2P9NB 4QS7A 4LSLA 4N76A 1WSEA 4M3RA 1OVYA 4JNEA 4NO7A 3O9QA 1SL1A 4E7KA 3E9OA 4CJQA 1VSFA 1LAVA 3NGZA 3MK6A 2E2NA 2FSKA 4BACA 4JEPA 4JK9A 3L2RA 3LZIA 4XH1A 2Q0RA 2UXBK 2P9PA 1X9SA 3EEQA 4O8KA 3HPOA 4DV3K 1RILA 1D4XA 1HNVA 4OGEA 4CJLA 3RMCA 3FFKB 2CGJA 4L3QA 3DLEA 4C8KA 3ZLJA 4YHHK 4W5OA 3EZ5A 4CD3A 1RNHA 1U04A 3HPGA 5HL7L 1GLBG 3AO5A 3DRSA 3DRRA 3BY5A 4AM7A 3A5MC 1KXPA 1A5VA 4BC3A 4X64K 1TUYA 3P31A 2ZJPL 2O8BB 3VETA 1GLEG 1ATSA 3D2FB 3OYFA 1BI4B 3WXKA 3QFUA 2E2PA 1JXBA 1TAQA 3ZSZA 3OYEA 3OTOK 1NG9A 3DJCA 4IXCA 4F8RA 2RE2A 5C0YA 4DV5K 3O80A 4ID1A 5F1XA 5IWAK 4X66K 2YNGA 3I0RA 3O3FA 3C65A 3ITHA 2WUSA 4KHWA 2O4IA 5BR8K 3MWPA 4LFBK 2F9WA 3QLHA 2HMPA 3CCUN 5KI6A 4B8CA 3AO4A 3AA2A 2PFUA 4OKEA 1MDUB 1NGAA 5GINA 4GV6A 5KPRA 1Q81O 1BA1A 2V7ZA 1J5EK 1RDCA 2G8KA 3GDQA 4G9ZA 4CHYA 1NOZA 3EN9A 3KLIA 4DMNA 4H0PA 1VSDA 1BCMA 4B9NA 1BQMA 2P9SA 3HVRA 1FKOA 5AQHA 1OH6A 4FWOA 4YFUA 1S3XA 3P5JA 1KVCA 4LY7A 3T1AA 5FPDA 2ZGZA 5J1EA 1U4BA 1P8ZA 5BRHA 5H1SQ 4C8MA 3MN5A 1RDWX 3CM6A 3WXLA 4KAZA 5EX5A 3F9KA 1EP4A 1QQMA 2O8EB 4IJAA 2JWKA 1NK4A 5EOYA 4FPAA 4BR4A 3SNNA 1W2BM 1KC8O 2QXLA 1U6ZA 1VQPN 4WQ4A 1NGCA 5FROA 2XHBA 4GY2B 2IDOA 4KI4A 1BU6O 1FW6A 3MDQA 4BG9A 4CBUA 4FJ7A 4E1JA 2GWKA 4U7BA 4JKCA 3ID6A 3FE1A 4CIEA 2EHGA 3VTHA 1KQSM 3TTFA 1C1AA 1Q18A 1YVNA 4KH6A 3BP8A 4KBOA 1BO5O 5C25A 3AVKA 4NLCA 4LH4A 4C8LA 2QA4N 3S9HA 3PLAA 4ISGA 4FM1A 4N47A 3F73A 1VQKN 4GVEA 2YKMA 5E26A 4O4GA 5M1OA 3SJHA 3JAMO 2ZD1A 5EXWA 2D0OA 3VGMA 3MMVA 3O8MA 4CBWA 2HNYA 1ITGA 1DLOA 4FJLA 1RDAA 4XIUA 4DV1K 4DQ8A 1NGHA 4PKGA 3IS9A 2O8CA 3TAEA 3HSTB 1L3UA 4FK4A 2HHVA 3ULDA 4O0IA 3CI5A 2Q1NA 2P9SB 3VQ7A 4M45A 1ZXOA 4HVJA 4DSIA 4IFEA 3BF1A 1T6CA 2GUPA 3L0QA 3LAMA 1ZBIA 1IBKK 4JI4K 3CQXA 4NYNA 4CHOA 4CJPA 3MEGA 4YOXA 4H0XB 4FVUA 4H0YB 3M8SA 3VOVA 2UUAK 3O9SA 1Q82O 1WSFA 1YT3A 3GE1A 4UY8O 3ZSRA 1IKYA 3AVGA 4KPYA 4BGBA 5AZJA 5LY3A 4F3TA 3VQAA 3AAQA 5SWMA 4IFVA 4GMJB 4BQZA 2Q0UA 4NB4A 1HUXA 3CD6N 2E20A 1NOYA 4KV8A 1NGFA 2P9LA 2ZJQL 4BY9C 3KK2A 3CC2N 3OW2M 2B6AA 3MXMA 4KHYA 2NRHA 2BGGA 3VN5A 1ASWA 4CESA 1GLJO 3O4NA 2XO7A 4CJEA 1XC3A 3ZSVA 2WOMA 3QNNA 5CY4A 1NK0A 5AFUH 3DOLA 3JSMA 2F8TA 1NGBA 1RT4A 1HKBA 3CPWM 1RT2A 1T05A 2CGKA 3C0BA 4LF9K 3CCQN 3KLEA 4CEOA 1WSGA 3CMAN 2QTDA 1CXQA 3NVMA 2O8CB 1TK0A 1YF5L 4AHCA 4EZ6A 4CF8A 4JKGA 3LPUA 4CF1A 1OH8A 1JLEA 3OBYA 3AVAA 4BREA 5C15A 4CK1A 2QW9A 4FPBA 3VF4A 3QNOA 3AVIA 3R9PA 5AQGA 3TAGA 3H3NO 3ID8A 3IDHA 3THXA 3PV8A 3SQ4A 1LV5A 3C94A 2UXDK 1HLUA 2E4LA 4Y0WA 1X1PA 4LF4K 3PO4A 3PIOL 4W5QA 4JI7K 4OJRA 1XQSC 3LM9A 2RHKA 2P9IB 4BRMA 2OZMA 3VGKA 3HYFA 3MEDA 3WNGA 1BUPA 3VEYA 2V7YA 4CW7B 4JK7A 4I9LA 3HXMA 5BPMA 4C1NI 5AQXA 4DV4K 2O8DA 5AZJB 1W9HA 3VEXA 4CEDA 3OYLA 1RDUA 3G0ZA 4FWQA 3DOKA 1C1CA 4DLEA 1IKWA 4B8AB 2J4RA 3SV3A 4FK2A 4CJUA 1FJGK 1RTJA 2OPSA 4H5WA 2P9LB 4QS9A 4JI5K 3H45C 3A5NC 1TV6A 3LP3A 2O8FA 4CZFA 3TABA 4CZKA 1IG9A 3E1YA 3UIQA 2A1RA 2YX6A 5EU7A 1NM1A 4LF8K 4J8FA 3LL3A 4I2PA 1HQUA 4IDHA 3BGRA 2KZMA 2OPPA 4A2AA 1HYVA 4KO0A 4DTXA 2OYQA 1EXQA 1R0AA 3VESA 1YTUA 1T44A 1HNWK 1YITN 3SCXA 1J5OA 4F9OA 4R5PA 3PSFA 4B3OA 1HJOA 3HSCA 4J2AA 4BR5A 2HW3A 4JKGB 1KFSA 5AQJA 4CD1A 4DV7K 2W41A 3CC4N 3ENHA 1IKXA 3THXB 3CJCA 1HNZK 2VG7A 4KB1A 4X65K 5HLFA 4W5RA 4CHQA 4FVMA 3NF9A 4H4MA 3DXKA 1T03A 3QDKA 2P5GA 5AQIA 3NH2A 1Q7YO 1QS4A 5AQQA 1YAGA 2YCHA 1T6DA 1S5JA 3FGUA 3M6GA 3H08A 3NAEA 3CJ7A 1S9EA 4CCHA 1L3TA 1S1WA 3QIOA 1LW2A 2D1KA 2HOEA 4IZ9A 3KLHA 1SAZA 1JLGA 4Y1DA 4MLHA 3HT3A 2BANA 3H6EA 2A5XA 2E6MA 1KLMA 1N5YA 4HUGA 4GV9A 3O9TA 3VQ9A 4E7IA 2IVPA 4RW6A 2O8FB 1LWEA 3UE5A 4HCCA 1S6PA 4WQ4C 3CETA 1EKEA 1HMVA 2HBJA 2NLXA 3DMJA 1IBLK 5AQNA 4O5BA 2HVIA 3NMUA 4DQPA 2UUBK 3QEPA 3MX2A 3AVCA 5J2MA 5LMUK 4FJJA 5JMVA 3L2VA 4N56A 1QSLA 4OPKA 4EHTA 2GTDA 3HL8A 4JKBA 1E4FT 4X62K 3S3NA 2P1JA 3JYTA 3R3LA 3OYMA 2E6LA 3CJ9A 4M7YA 1QVGM 4LF6K 2DTUA 2V52B 3K0SA 3O9UA 4IJNA 1VQMN 4DSEA 4HTLA 3KWIA 1E4GT 5BR9A 1C0GA 3P39A 1M90O 1U49A 4JI3K 1YXQA 3K5NA 1VQLN 2JGUA 4IOCL 2E1YA 3UKUB 4E19A 4BRCA 4F3OA 2IGIA 4B1YB 1TAUA 2P51A 1VQ8N 4A62A 2QKBA 4QCLA 3TAFA 4GKKK 3AGKA 3DLHA 4CEEA 3W3DA 3SUPA 4HCBA 2F9TA 4QS8A 3LDPA 2X74A 4W5TA 3DAWA 2BUPA 1EQYA 3OS1A 4RG8A 3DXKB 3VF2A 4B1WB 4BQLA 4E1NA 4KKOA 4H5NA 1NKCA 4DTSA 1NJZA 3OYKA 2Q97A 4DQQA 4KH5A 4JV5K 1K73O 4DFJA 3SLCA 4OPHA 5AZIA 1FXXA 1K6YA 4OPAA 4BE1A 5FPNA 4O0JA 5JVGL 4IOAL 3EKSA 1Q9YA 3EYZA 2HNDA 1DEJA 4CGJA 3ZSYA 3FZHA 5BRFA 1FKPA 2B5JA 2W40A 1C6VA 1GLCG 1S9GA 4I7FA 4YY3K 3SQ0A 3KD5E 3DWLA 5LMNK 3CCJN 3VQQA 3PX0A 4AHSA 5AQOA 2JWLA 3OJSA 4YNQA 4FCYA 4FOEA 3OBWA 3AVFA 3G71N 4CHZA 1N36K 1QE1A 5C10A 1NGJA 4FWMA 4V19S 3TARA 5CHIA 3JS6A 4JKAA 5DM7L 4EIAA 4U67L 3C7NA 3RVCA 4DQIA 1X3MA 1TUUA 1D9DA 2KKZA 5E41A 4CFCA 3TAPA 4LF5K 4M3TA 2VWKA 4K41A 3U3GA 3GBTA 1IV0A 2D0CA 3EKUA 2OTLN 1E3MA 2HF4A 4RTFD 5MLCQ 2KW4A 3OS0A 3EE9A 4FLWA 5AQUA 3HM8A 5AJ3K 2KHOA 3ENBA 4MQ3A 3NCIA 4FZXC 5FPEA 3WT0A 3HTVA 4BWJA 3HK2A 2ATQA 4BR0A 1NK9A 1Q8IA 4DSFA 2RF2A 3CFPA 3VQDA 3DYAA 1NNEA 5I42A 2HBLA 1VRUA 4H5TA 1VQ5N 3QBWA 3IRXA 2KTQA 4BRPA 5FPMA 5EVZA 3A5OC 2UU9K 1VHXA 4BVOA 4DV2K 2DFHA 2PYJA 2ZF5O 3IUCA 3OY9A 5KQDA 1HQEA 4FWPA 1VQ7N 2E88A 1M1KO 1ZBLA 3LPTA 3GL1A 4ILGB 3LALA 4FLZA 3MN9A 1C0FA 1SL2A 4NXNK 1S72N 4PWDA 3PX4A 5AR0A 3ZSQA 5AZIB 5BPLA 2YI1A 4IBNA 2F96A 3J7YP 3PUFA 4Z0UA 4C23A 4CJWA 4KHPK 2VWBA 4CZGA 3KD1E 2OANA 2YNHA 2OCEA 3FZMA 4B3TK 1SKSA 3TSUA 4NCGA 3LANA 4M63C 3C6AA 1BCOA 3N4PA 4Z94A 5HOOA 4ILHA 3TAQA 3J81O 5JICA 4CJVA 1JLQA 4RW9A 1QQNA 1NKBA 4CERA 5KTQA 4ELVA 4GW6A 4B1UB 3V1OA 1S1VA 4A2BA 2HSTA 1ZC6A 4BE2A 2P9PB 3ULEA 1BHLA 5I9EB 1RT6A 2QI2A 3M1FA 3PIPL 3J7AP 1VAZA 5LJVA 3V9XA 4M3XA 3B6PA 5DK5A 2ASPA 2HBKA 3L4QA 2HVHA 2E1ZA 1YJ9N 4E3SA 2IS3A 3L3UA 4CJKA 1ASVA 5ADXH 5M1PA 3WEEA 4BC5A 1QHTA 3V9WA 3DLLL 4IKFA 1NLVA 2RKIA 4DR4K 4DQRA 1QTMA 1NK8A 5AFUA 3F9MA 3KKRA 2ETJA 3CCSN 3C95A 1G99A 4WFAL 2X6NA 5C2DA 3OYIA 1U48A 5AQVA 4B3MK 2NZTA 4FWSA 3V9UA 3W0LA 4C1NK 2HHTA 1KTQA 2FF3B 3NE6A 3ZYYX 5M1KA 4FM0A 1SL0A 2E2QA 3BDPA 1LCUA 3U6FA 3V1QA 4DTPA 1DT9A 3WUHA 4I6MA 1IBMK 4CVNE 3ZX0A 2HHXA 2QEXN 1J53A 3OYJA 4XH4A 1NJIO 1YI2N 1K8AO 3AVNA 2Q31A 3IAYA 3IMXA 4DG1A 1Q86O 3TWHA 3UKRA 3O9RA 4NCBA 1WSHA 4OLBA 1LAWA 4RWTA 4GKJK 1WN7A 2HHUA 1WOQA 2HMIA 2VCPA 3AVJA 2G8IA 3RWUA 4DU1A 1EO1A 4LSNA 1D9FA 3ULEB 3GOIA 1HYSA 2VG6A 2VYPA 2NUBA 2QWNA 3OYBA 4N41A 3SQ1A 1VQNN 1TL3A 1TKTA 1CXUA 1VSIA 2KFNA 4F2SA 3DXMA 3RRGA 4FJKA 3CJ1A 4FO0A 2AP1A 1CLQA 4B9QA 3LZJA 2GUIA 3F5TA 3CFRA 3QETA 5CZ1A 3OVNA 3L8BA 4FZZA 2ZWHA 4DKWA 4CF2A 1C0MA 5C42A 3VQCA 1XC9A 4FJGA 3HOSA 3LM2A 2X78A 3AO2A 1XI1A 1NKEA 1WSJA 3AVMA 4LF7K 1SV5A 3CM5A 1GOCA 1X3NA 3CFOA 4B9VA 1I3AA 3O4QA 2H3GX 3ENOA 2G8WA 5CYMA 3NHGA 5KQ8A 4LFAK 4CGDA 3KK1A 4K0KK 5CYQA 5GADP 1GOBA 5SZTA 4CJ3A 2RPIA 2KLAA 3AO3A 1RTDA 1BIZA 3OYAA 5FRNA 1VQON 3WNFA 2WBNA 4CFAA 4ISFA 1RT5A 4DR6K 2E8AA 2ASOA 4EP5A 1NGEA 4BRLA 4RW8A 1MA9B 2DFFA 4I6MB 3VA0A 5AQZA 1EWQA 4M41A 5AQWA 4WQ5C 5I3UA 1HKGA 4CJ5A 1JCFA 3SPZA 2NRTA 4FLTA 1U2VA 1S22A 4FW1A 3L6QA 4WFNL 3KIOA 5J2PA 3K5MA 1GLDG 3BZKA 3UKRB 1N34K 2W42A 4B9TA 3FZKA 4JI8K 3VQ6A 3LDSA 3Q7CA 4I2QA 3CQ8A 4N5SA 3CCMN 4CK3A 3J80O 1Y97A 3M8QA 3VQ4A 3L2WA 3P83D 4OLAA 2ITGA 4E89A 3VEWA 3DXMB 3LDQA 3AARA 4DTUA 1BDGA 3RMDA 1JL2A 1W7AA 5C12A 4KHUA 2IC3A 3B6OA 3SJJA 3QB0A 4OKKA 3D2EA 2RN2A 3I56N 1REVA 1Y64A 4IEIA 4E7HA 4FWRA 3O1WA 5HP1A 2HHQA 3EO3A 3U8XA 4HHTA 2I7NA 5HRRA 1EETA 3KVGA 5GAEP 4CGGA 3CCRN 2PZSA 3ATUA 3P4IA 3WQTA 3CXCM 4DLGA 3V6DA 3O5BA 3DLRA 2EX3A 4NYFA 3OS2A 2PYLA 2QWPA 1N32K 4Z4GA 2LSNA 1FK9A 4H0TB 3QEWA 1DGKN 4EFHA 3HP9A 1HKCA 3NGYA 1S1TA 5C24A 5GAGP 2XRIA 3K9KA 4W5NA 3LDLA 4YDUC 4BRAA 3T3FA 4DF8A 4Q5VA 2Q36A 4JS4A 3B8AX 1TL1A 1A5WA 1O1WA 3HOTA 3G4SN 4Z4IA 1U2VB 1JXEA 3U4LA 1HNXK 4OPJA 3ZT4A 1HYZA 3AAPA 4DU3A 5F2RA 2JLEA 1VSLA 4DU4A 1T3VA 4M3YA 4JI6K 2Y1JA 3FZFA 3NF6A 1XNRK 4AF1A 2R7YA 3L3VA 5EY4A 2HBMA 3CHWA 4WYBA 5DMRA 2PAVA 3TTDA 1L3VA 5AQYA 1S1UA 1RT3A 5KRTA 3ZSOA 3KWGA 1LWCA 1NJYA 1OKJA 4JD2A 4EP4A 4HUFA 4RW4A 2G8UA 4FJ5A 5DM6L 3EE8A 2Z1GA 4FOIA 1KLNA 4H0OA 2O8DB 3RR8A 4B9SA 4TSXA 2CGLA 4HTUA 4K43A 3D2EB 3S3OA 3HRGA 3G6EN 3OYHA 4A59A 3E66A 3QEIA 3T1HK 3HO1A 3BZCA 2P9UA 1BOTO 2X6SA 3RTVA 2HNZA 3A8YA 2CH5A 4JI1K 3I33A 2HHSA 5AQKA 4AM6A 4BRIA 1BA0A 1R59O 3E9PA 1LWFA 4E7LA 5CE3A 3TR8A 4KHSA 3SBGA 2IAJA 2O4GA 2DPNA 3PSIA 1WBDA 1K8KA 1LW0A 1HX1A 2D5RA 4DTJA 1D5AA 1X9JA 4OVLA 4C8OA 3IKMA 2D0BA 1SKRA 2BTFA 5CR4A 4WF9L 2FLOA 3I0SA 4BRDA 4IDKA 3NGIA 3V9ZA 2XY7A 4HWIA 3LWLA 2VGNA 4BC4A 4KFBA 5M1NA 5HROA 2DY4A 4DB3A 3MX5A 4FLVA 5K14A 5JS1A 3J8AA 3WQUA 1CZ9A 1KAZA 1MWKA 1WB9A 5AQFA 1JLBA 3L2UA 3U3YA 3DRPA 3FLCO 1XUPO 4DUZK 1WBBA 4FXDA 1HPZA 4JLHA 3NH0A 4CEAA 4F4KA 3OYNA 1BL3A 4FJNA 4K8ZA 3ASMA 1V4TA 4YOYA 3VF6A 3O08A 4K8XA 1NGDA 4WQ5A 1VQ9N 3CJAA 2OA8A 2OPRA 2QXFA 2YHWA 3SI6A 1VQ4N 3DM2A 3CJBA 4FJXA 5AQSA 4LD0A 4BRGA 3TSQA 3SZ2A 3O3GA 4M42A 3MECA 1QZ6A 3M3ZA 4FLXA 3KK7A 4IO9L 2CH6A 4FW2A 3SAHA 2W6KA 2FF6A 4FJ8A 1JLCA 4CEZA 4ZTFA 3RMAA 3CCEN 2P9UB 1ATNA 1QQCA 3E01A 4CEQA 3QESA 1KVBA 2DFEA 2PY5A 3HPHA 3CERA 4PL8A 3CPEA 1NK7A 2IIRA 2AA4A 3QICA 1ESVA 3MXJA 5ADXA 3D6RA 1K9MO 4B08A 4IEEA 4KH4A 4LC9B 3SV4A 4ISEA 4OO1J 3TSPA 4YOVA 5AQMA 1IH7A 5JVHL 1H1VA 4B3RK 1K8KB 1T8EA 4DTNA 2IVNA 3WXJA 3HM9A 3ZCMA 1NWKA 4M7XA 2GBZA 2NNWA 1VSMA 1NBWA 1RBTA 1YIJN 4YORA 3QBXA 1NK6A 4JKEA 4CEFA 3I55N 2A40A 1RBVA 4CIFA 4O44A 1C1BA 4LH5A 3D0PA 3VEOA 1YUWA 5TKYA 5JS2A 4JI0K 2OZSA 3AGRA 3SBTA 1MU2A 1IG8A 4DF4A 1NJWA 1U45A 2E2OA 2VQEK 4DUYK 5AQTA 1TK8A 3MAQA 2O8EA 3E9LA 1TKXA 1QQOA 3SPYA 1WNSA 4B9LA 5BN8A 2ZJRL 5AQRA 3THYA 3H3OB 1KVAA 4CIGA 2IVOA 3ZT2A 3QINA 3J7ZO 4AHRA 4IG0A 2FXUA 1UA0A 1KCFA 3IG1A 4YDUA 2PBDA 3H1VX 3R1XA 1RBSA 5BN9A 4B3SK 4M3WA 2V51B 3G25A 3K5OA 1BISA 4CJ4A 4CBXA 2UXCK 1JCGA 2Z1JA 3P38A 4DSKA 3K2PA 4IG3A 1Z6RA
chains in the Genus database with same CATH topology
2HMIA 3AVJA 3SV3A 3SUNA 3KTQA 2G8IA 4QAGA 3NDKA 4FK2A 4CJUA 3RWUA 3RMBA 4DU1A 1X9MA 1RTJA 2OPSA 4LSNA 3DI6A 1D9FA 1HYSA 1IO2A 2VG6A 2FBVA 2NUBA 3OYBA 4N41A 2G8VA 2YNIA 3SQ1A 1DTQA 1RT7A 3VQ8A 1TV6A 4BDZA 3G10A 1B92A 1TL3A 4AHVA 3KLFA 3LP3A 1TKTA 1CXUA 1VSIA 2KFNA 3AVHA 4F2SA 1RCHA 3AA4A 2KQ2A 1BGXT 3TABA 3RRGA 4FJKA 1KSPA 4FM2A 3K5LA 3OYDA 4FK0A 4KREA 1CLQA 3LZJA 2GUIA 4AH9A 2WONA 3S3MA 1IG9A 4FJHA 3UIQA 1J54A 4B8AB 1XHZA 2A1RA 5EU7A 1T7PA 1ZBHA 3HJFA 1UA1A 3CFRA 1C0UA 3QETA 2AJQA 5CZ1A 3OVNA 1BI4A 4DTOA 5FDLA 4I2PA 4CECA 3L8BA 1HQUA 5KRSA 3BGRA 4DSLA 5HBMA 2OPPA 3LP0A 4FZZA 2KZMA 3THVA 1B9DA 1C0MA 5C42A 3VQCA 3WNHA 4CF2A 1XC9A 4FJGA 1HYVA 4KO0A 4DTXA 1Z26A 1EXQA 2HB5A 2X78A 3AO2A 1WSJA 4G1QA 1XI1A 1R0AA 3WNEA 1NKEA 4BE0A 4DWIA 4I9QA 5FRMA 2QK9A 3AVMA 1YTUA 3D45A 1SV5A 3LAKA 3CM5A 4DTRA 1GOCA 2KZZA 1NJXA 3SCXA 1RTIA 4IFYA 1J5OA 5T7BA 4R5PA 3CFOA 1TKZA 4B9VA 4B3OA 1I3AA 3O4QA 4ICLA 4HUEA 1TKDA 2G8WA 4J2AA 5CYMA 3NHGA 3AA5X 3KKSA 4JRPA 4L8RB 3DLKA 2HW3A 2FBTA 3NFAA 3VA3A 1KFSA 4KRFA 4EZ9A 1ZBFA 4CGDA 3KK1A 4Z4FA 5CYQA 3OYCA 1GOBA 2FC0A 3T19A 1W0HA 5SZTA 3RR7A 2GV9A 3I8DA 4DFKA 4CJ3A 4DFPA 2RPIA 2ZQBA 1XHXA 4CJSA 1IKXA 3AO3A 2IOCA 1RTDA 1VSKA 1BIZA 3OYAA 3DLGA 5FRNA 4JS5A 3WNFA 4NCAA 4CFAA 3HP6A 2VG5A 1RT5A 2XY6A 4EP5A 4KTQA 2Q3SA 1VSHA 2VG7A 4KI6A 1NK5A 4RW8A 4KB1A 3V9SA 2DFFA 3VA0A 4J2DA 3ISNC 4CGIA 5HLFA 4W5RA 4CHQA 4M41A 4FVMA 4BDPA 5I3UA 4CJ5A 2Y1IA 3NF9A 4H4MA 1T03A 3SPZA 4LSLA 4FLTA 2YNFA 2P5GA 4N76A 3VQEA 1WSEA 3NH2A 4M3RA 2D0AA 1SL1A 1QS4A 1KFDA 1IKVA 4FW1A 3KIOA 4E7KA 5J2PA 4CJQA 1VSFA 1LAVA 3K5MA 3NF7A 3NGZA 4CE9A 3QEXA 1S5JA 4BACA 3H08A 3NAEA 3L2RA 2W42A 4PQUA 1EX4A 1JL1A 1S9EA 4BWMA 3LZIA 1L3TA 4B9TA 4CCHA 4ELUA 1S1WA 2I5JA 3QIPA 3VQ6A 3LDSA 1YTAA 3ZT0A 3HPOA 1X9SA 1RILA 3QIOA 4I2QA 1HNVA 4OGEA 4CJLA 4N5SA 1LW2A 3KLGA 3KLHA 4CK3A 3CQ8A 3RMCA 1JLGA 4Y1DA 4RW7A 1Y97A 3M8QA 3HT3A 3VQ4A 1QSSA 2BANA 3DLEA 3LP2A 4CFBA 3L2WA 1WAJA 4J2EA 4C8KA 2E6MA 4B9UA 1KLMA 1N5YA 4HUGA 3P83D 4W5OA 3VQ9A 4OLAA 4E7IA 2ITGA 4RW6A 4E89A 1LWEA 4HCCA 3EZ5A 1S6PA 3VQBA 1EKEA 1HMVA 3DMJA 1RNHA 1U04A 3HPGA 4O5BA 4DQPA 2HVIA 1C0TA 2YV0X 3AO5A 5HRPA 3DRSA 3DRRA 4UQGA 3AVCA 4DTUA 5J2MA 3RMDA 3QEPA 4FJJA 1J9AA 3PX6A 3L2VA 1A5VA 4N56A 1B9FA 1JL2A 5J2QA 1QSLA 4OPKA 4J2BA 4AHTA 4KHUA 2IC3A 3B6OA 3SJJA 3HL8A 2XY5A 4OKKA 3S3NA 2P1JA 3JYTA 3OYMA 3OYFA 1BI4B 3V81A 2E6LA 2RN2A 2DTUA 1RBRA 5CZ2A 1JXBA 1TAQA 1REVA 3ZSZA 3OYEA 1HNIA 4E7HA 1TK5A 4F8RA 1L3SA 5HP1A 2HHQA 4Y1CA 4HHTA 4JRQA 4ID1A 4DSEA 3ALYA 4CFDA 5HRRA 4KTWA 1EETA 2YNGA 4CGGA 2PZSA 4AHUA 3I0RA 3O3FA 1U49A 3K5NA 2JGUA 4FJMA 4DLGA 3V6DA 3ITHA 3DLRA 2EX3A 4NYFA 3OYGA 2YHBA 3OS2A 2PYLA 4E19A 4KHWA 2O4IA 3A2FA 4Z4GA 4F3OA 2IGIA 4DS4A 3QERA 4E0DA 2LSNA 1FK9A 3MEEA 2VWJA 4ELTA 2P51A 1TAUA 4DFMA 2QKBA 3QLHA 2Z1IA 4QCLA 3QEWA 3TAFA 5KI6A 4B8CA 3HP9A 3DLHA 3AO4A 3NGYA 3AA2A 1S1TA 4OKEA 5C24A 4CF0A 4CJFA 4CEEA 2XRIA 4W5NA 4AILC 3SUPA 4HCBA 4M3UA 4CJTA 3T3FA 4DF8A 1RDCA 4Q5VA 2G8KA 4OGCA 5HRSA 3AVLA 2X74A 4CHYA 4W5TA 1NOZA 4JS4A 4WE1A 3OS1A 3HVTA 1TL1A 3KLIA 2FBYA 4RG8A 4DMNA 4QOZB 1N6QA 1A5WA 1BCMA 1O1WA 1CZBA 1VSDA 1BQMA 4KTZA 4B9NA 4Z4IA 3HVRA 1FKOA 4E1NA 1JXEA 4KKOA 1NKCA 4DTSA 4YFUA 1NJZA 3OYKA 2G8HA 4OPJA 4DQQA 4OKJA 3NF8A 3P5JA 5KGWA 1KVCA 1HYZA 4LY7A 3T1AA 3ZT4A 4CK2A 4DFJA 2YKNA 4DU3A 1VSEA 5J1EA 1FXXA 2JLEA 2HHWA 1VSLA 1U4BA 1K6YA 4BE1A 4DU4A 1HJRA 4C8MA 4M3YA 3CM6A 4O0JA 4E7JA 4GVMA 2Y1JA 3NF6A 4KAZA 1TVRA 3K59A 3F9KA 1EP4A 2R7YA 1Q9YA 3L3VA 3EYZA 3MXIA 2HNDA 3PO5A 4F2RA 1WAFA 5DMRA 4CGJA 3ZSYA 1FKPA 2B5JA 1C6VA 4KB0A 4I7FA 1S9GA 3SQ0A 1NK4A 1L3VA 3KD5E 1S1UA 1RT3A 1GOAA 5KRTA 3ZSOA 3VQQA 1LWCA 1NJYA 3PX0A 1S6QA 4AHSA 3SNNA 4EP4A 3TAMA 3OJSA 4HUFA 4RW4A 2G8UA 4YNQA 1F21A 3P1GA 4C8NA 4FJ5A 4FCYA 5FROA 2XHBA 2Z1GA 2IDOA 3AVFA 1KLNA 4KI4A 4CHZA 1QE1A 3RR8A 1KRPA 4B9SA 2YHAA 4FJ7A 4TSXA 3TARA 4HTUA 1Z25A 4FJ9A 3S3OA 2P5OA 1BQNA 1TGOA 2A1SA 3OYHA 3FFIA 4CIEA 3SQ2A 2EHGA 4DQIA 3QEIA 1C1AA 3HO1A 4ZTJA 1D9DA 5C25A 3TANA 1QSYA 5E41A 3AVKA 4CFCA 2X6SA 3RTVA 4LH4A 3TAPA 4C8LA 4M3TA 2HNZA 3S9HA 2VWKA 3U3GA 4N47A 4FM1A 2D0CA 3F73A 3KJVA 2HHUA 2YKMA 2HHSA 4O4GA 2KW4A 3OS0A 1RT1A 1SKWA 1SUQA 4DS5A 4FLWA 2ZD1A 4CHNA 3LWMA 4O55A 4MQ3A 1ZBUA 4CHPA 4DQSA 1LWFA 3C6TA 3NCIA 4FZXC 4E7LA 4BWJA 3SYZA 3HK2A 2ATQA 1RDDA 2HNYA 1ITGA 1DLOA 2FBXA 3TR8A 1NK9A 4PUOA 1Q8IA 1UOCA 2RF2A 4DSFA 4FJLA 4KHSA 4M3ZA 2F8SA 1RDAA 3CFPA 3VQDA 3DYAA 2XY8A 2IAJA 2O4GA 4XIUA 5I42A 1VRUA 4MFBA 3IS9A 3IRXA 1LW0A 2KTQA 2BE2A 2D5RA 4DTJA 4Z4EA 3TAEA 3HSTB 1D5AA 1L3UA 2DFHA 2PYJA 2OYQA 4OVLA 4FK4A 3NBPA 2HHVA 4CGHA 3OY9A 4C8OA 3EY1A 1HQEA 3ULDA 2D0BA 5J2NA 1SKRA 4O0IA 4B9MA 1UAXA 1ZBLA 3LPTA 3VQ7A 3I0SA 4IDKA 4M45A 3LALA 3NGIA 4FLZA 3V9ZA 4HVJA 3QO9A 4ID5A 3LWLA 2XY7A 4DSIA 1DTTA 4KFBA 1G15A 5HROA 2DY4A 3SUOA 1I39A 1SL2A 2BDPA 4FLVA 3O3HA 5K14A 3PX4A 4PWDA 3ZSQA 5JS1A 3LAMA 1CZ9A 4IBNA 1ZBIA 1ZYQA 4KHQA 2F96A 1JLBA 3L2UA 3U3YA 3DRPA 4NYNA 3PUFA 4CHOA 4CJPA 3ZSXA 4Z0UA 1ASUA 3MEGA 4CJWA 3OJUA 3K57A 1Q9XA 4FXDA 1HPZA 4Z4HA 3KD1E 3KK3A 4JLHA 3NH0A 3M8SA 4DTMA 2YNHA 1SKSA 4CEAA 1U47A 4FZYA 4NCGA 4F4KA 3LANA 4KHNA 3OYNA 1BL3A 4FJNA 1WSFA 3ASMA 1YT3A 4K8ZA 4K8XA 1BCOA 3ZSRA 1IKYA 3AVGA 4KPYA 2OA8A 2OPRA 4F3TA 2QXFA 3SI6A 1VSJA 3VQAA 3TAQA 3DM2A 4CJVA 5SWMA 1JLQA 3PY8A 4IFVA 4GMJB 4RW9A 4CJRA 4LD0A 4FJXA 3SZ2A 3O3GA 4M42A 3MECA 1NKBA 4CERA 5KTQA 4ELVA 4GW6A 4FLXA 3V1OA 1S1VA 1NOYA 3AA3A 2KFZA 4FW2A 4KV8A 1RDBA 4BE2A 1BHLA 1WLJA 4FJ8A 1RT6A 2Z1HA 1JLCA 3KK2A 4CEZA 4CEBA 2ZE2A 3M8RA 4ZTFA 2B6AA 3RMAA 4Q0BA 3MXMA 4KHYA 4H8KA 1QQCA 3E01A 4CEQA 1JLAA 3VQ5A 3QESA 1KVBA 2DFEA 3V9XA 2PY5A 4M3XA 2BGGA 3HPHA 1A5XA 3B6PA 2OPQA 5DK5A 3VN5A 1ASWA 1D8YA 2HVHA 4CESA 4CGFA 1NK7A 4E3SA 2IS3A 3L3UA 4CJKA 3O4NA 1ASVA 4H4OA 3VQPA 4CJEA 2XO7A 3LP1A 1QHTA 3ZSVA 2WOMA 3V9WA 3QNNA 5CY4A 3MXJA 1S1XA 4BDYA 4IKFA 4B08A 4FLYA 3TI0A 2RKIA 1NK0A 3DOLA 3JSMA 5D3GA 2F8TA 4DQRA 1QTMA 3AVBA 3SV4A 1NK8A 1RT4A 3KKRA 1RT2A 4FYDA 1IH7A 1T05A 1XWLA 2ETJA 3M8PA 3KLEA 1T8EA 4ZHRA 3C95A 4DTNA 1JLFA 4CEOA 1WSGA 3HM9A 3QEVA 3ZCMA 1CXQA 4PY5A 2X6NA 3OYIA 1U48A 2GBZA 1VRTA 4Z4CA 1TK0A 1VSMA 3K58A 1RBTA 4AHCA 5HRNA 3V9UA 2G8FA 4EZ6A 4CF8A 1BIUA 1RBUA 3LPUA 3C6UA 3CYMA 4PA1A 4CF1A 1JLEA 1NK6A 3AVAA 2HHTA 1KTQA 4CEFA 3CG7A 1RBVA 3ZSWA 4CK1A 4CF9A 4CIFA 3NE6A 3DLBA 4O44A 1C1BA 4LH5A 3NH1A 1VK0A 3AVIA 3D0PA 5JS2A 4FM0A 3QNOA 3SUQA 1SL0A 3TAGA 2OZSA 3PV8A 3SQ4A 3AV9A 3BDPA 1LV5A 3C94A 1MU2A 1JKHA 2E4LA 4DF4A 3U6FA 1NJWA 1U45A 4DSJA 3V1QA 1X1PA 1TK8A 3MAQA 4DTPA 1TKXA 3PO4A 4W5QA 4OJRA 3SPYA 1L5UA 1WNSA 1X9WA 4B9LA 1YVUA 2HHXA 1HRHA 1J53A 3V4IA 2OZMA 4FJIA 1KVAA 3OYJA 3HYFA 3ZT2A 4CIGA 3MEDA 3QINA 3WNGA 4AHRA 4IG0A 1UA0A 2B4JA 1KCFA 1WSIA 4E1MA 3IG1A 3L2QA 3AVNA 4I9LA 3HXMA 2QKKA 1RTHA 1RBSA 4FLUA 3IAYA 4M3WA 4DG1A 5KGXA 1W9HA 4CEDA 3K5OA 1BISA 4CJ4A 3OYLA 1UWBA 3TWHA 3V1RA 2Z1JA 3G0ZA 3AO1A 3ZT1A 3RRHA 4DSKA 3DOKA 1C1CA 4NCBA 1WSHA 3ZT3A 4OLBA 1LAWA 4DLEA 3K2PA 1WN7A 1IKWA 4IG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HMI A;  3AVJ A;  3SV3 A;  3SUN A;  3KTQ A;  2G8I A;  4QAG A;  3NDK A;  4FK2 A;  4CJU A;  3RWU A;  3RMB A;  4DU1 A;  1X9M A;  1RTJ A;  2OPS A;  4LSN A;  3DI6 A;  1D9F A;  1HYS A;  1IO2 A;  2VG6 A;  2FBV A;  2NUB A;  3OYB A;  4N41 A;  2G8V A;  2YNI A;  3SQ1 A;  1DTQ A;  1RT7 A;  3VQ8 A;  1TV6 A;  4BDZ A;  3G10 A;  1B92 A;  1TL3 A;  4AHV A;  3KLF A;  3LP3 A;  1TKT A;  1CXU A;  1VSI A;  2KFN A;  3AVH A;  4F2S A;  1RCH A;  3AA4 A;  2KQ2 A;  1BGX T;  3TAB A;  3RRG A;  4FJK A;  1KSP A;  4FM2 A;  3K5L A;  3OYD A;  4FK0 A;  4KRE A;  1CLQ A;  3LZJ A;  2GUI A;  4AH9 A;  2WON A;  3S3M A;  1IG9 A;  4FJH A;  3UIQ A;  1J54 A;  4B8A B;  1XHZ A;  2A1R A;  5EU7 A;  1T7P A;  1ZBH A;  3HJF A;  1UA1 A;  3CFR A;  1C0U A;  3QET A;  2AJQ A;  5CZ1 A;  3OVN A;  1BI4 A;  4DTO A;  5FDL A;  4I2P A;  4CEC A;  3L8B A;  1HQU A;  5KRS A;  3BGR A;  4DSL A;  5HBM A;  2OPP A;  3LP0 A;  4FZZ A;  2KZM A;  3THV A;  1B9D A;  1C0M A;  5C42 A;  3VQC A;  3WNH A;  4CF2 A;  1XC9 A;  4FJG A;  1HYV A;  4KO0 A;  4DTX A;  1Z26 A;  1EXQ A;  2HB5 A;  2X78 A;  3AO2 A;  1WSJ A;  4G1Q A;  1XI1 A;  1R0A A;  3WNE A;  1NKE A;  4BE0 A;  4DWI A;  4I9Q A;  5FRM A;  2QK9 A;  3AVM A;  1YTU A;  3D45 A;  1SV5 A;  3LAK A;  3CM5 A;  4DTR A;  1GOC A;  2KZZ A;  1NJX A;  3SCX A;  1RTI A;  4IFY A;  1J5O A;  5T7B A;  4R5P A;  3CFO A;  1TKZ A;  4B9V A;  4B3O A;  1I3A A;  3O4Q A;  4ICL A;  4HUE A;  1TKD A;  2G8W A;  4J2A A;  5CYM A;  3NHG A;  3AA5 X;  3KKS A;  4JRP A;  4L8R B;  3DLK A;  2HW3 A;  2FBT A;  3NFA A;  3VA3 A;  1KFS A;  4KRF A;  4EZ9 A;  1ZBF A;  4CGD A;  3KK1 A;  4Z4F A;  5CYQ A;  3OYC A;  1GOB A;  2FC0 A;  3T19 A;  1W0H A;  5SZT A;  3RR7 A;  2GV9 A;  3I8D A;  4DFK A;  4CJ3 A;  4DFP A;  2RPI A;  2ZQB A;  1XHX A;  4CJS A;  1IKX A;  3AO3 A;  2IOC A;  1RTD A;  1VSK A;  1BIZ A;  3OYA A;  3DLG A;  5FRN A;  4JS5 A;  3WNF A;  4NCA A;  4CFA A;  3HP6 A;  2VG5 A;  1RT5 A;  2XY6 A;  4EP5 A;  4KTQ A;  2Q3S A;  1VSH A;  2VG7 A;  4KI6 A;  1NK5 A;  4RW8 A;  4KB1 A;  3V9S A;  2DFF A;  3VA0 A;  4J2D A;  3ISN C;  4CGI A;  5HLF A;  4W5R A;  4CHQ A;  4M41 A;  4FVM A;  4BDP A;  5I3U A;  4CJ5 A;  2Y1I A;  3NF9 A;  4H4M A;  1T03 A;  3SPZ A;  4LSL A;  4FLT A;  2YNF A;  2P5G A;  4N76 A;  3VQE A;  1WSE A;  3NH2 A;  4M3R A;  2D0A A;  1SL1 A;  1QS4 A;  1KFD A;  1IKV A;  4FW1 A;  3KIO A;  4E7K A;  5J2P A;  4CJQ A;  1VSF A;  1LAV A;  3K5M A;  3NF7 A;  3NGZ A;  4CE9 A;  3QEX A;  1S5J A;  4BAC A;  3H08 A;  3NAE A;  3L2R A;  2W42 A;  4PQU A;  1EX4 A;  1JL1 A;  1S9E A;  4BWM A;  3LZI A;  1L3T A;  4B9T A;  4CCH A;  4ELU A;  1S1W A;  2I5J A;  3QIP A;  3VQ6 A;  3LDS A;  1YTA A;  3ZT0 A;  3HPO A;  1X9S A;  1RIL A;  3QIO A;  4I2Q A;  1HNV A;  4OGE A;  4CJL A;  4N5S A;  1LW2 A;  3KLG A;  3KLH A;  4CK3 A;  3CQ8 A;  3RMC A;  1JLG A;  4Y1D A;  4RW7 A;  1Y97 A;  3M8Q A;  3HT3 A;  3VQ4 A;  1QSS A;  2BAN A;  3DLE A;  3LP2 A;  4CFB A;  3L2W A;  1WAJ A;  4J2E A;  4C8K A;  2E6M A;  4B9U A;  1KLM A;  1N5Y A;  4HUG A;  3P83 D;  4W5O A;  3VQ9 A;  4OLA A;  4E7I A;  2ITG A;  4RW6 A;  4E89 A;  1LWE A;  4HCC A;  3EZ5 A;  1S6P A;  3VQB A;  1EKE A;  1HMV A;  3DMJ A;  1RNH A;  1U04 A;  3HPG A;  4O5B A;  4DQP A;  2HVI A;  1C0T A;  2YV0 X;  3AO5 A;  5HRP A;  3DRS A;  3DRR A;  4UQG A;  3AVC A;  4DTU A;  5J2M A;  3RMD A;  3QEP A;  4FJJ A;  1J9A A;  3PX6 A;  3L2V A;  1A5V A;  4N56 A;  1B9F A;  1JL2 A;  5J2Q A;  1QSL A;  4OPK A;  4J2B A;  4AHT A;  4KHU A;  2IC3 A;  3B6O A;  3SJJ A;  3HL8 A;  2XY5 A;  4OKK A;  3S3N A;  2P1J A;  3JYT A;  3OYM A;  3OYF A;  1BI4 B;  3V81 A;  2E6L A;  2RN2 A;  2DTU A;  1RBR A;  5CZ2 A;  1JXB A;  1TAQ A;  1REV A;  3ZSZ A;  3OYE A;  1HNI A;  4E7H A;  1TK5 A;  4F8R A;  1L3S A;  5HP1 A;  2HHQ A;  4Y1C A;  4HHT A;  4JRQ A;  4ID1 A;  4DSE A;  3ALY A;  4CFD A;  5HRR A;  4KTW A;  1EET A;  2YNG A;  4CGG A;  2PZS A;  4AHU A;  3I0R A;  3O3F A;  1U49 A;  3K5N A;  2JGU A;  4FJM A;  4DLG A;  3V6D A;  3ITH A;  3DLR A;  2EX3 A;  4NYF A;  3OYG A;  2YHB A;  3OS2 A;  2PYL A;  4E19 A;  4KHW A;  2O4I A;  3A2F A;  4Z4G A;  4F3O A;  2IGI A;  4DS4 A;  3QER A;  4E0D A;  2LSN A;  1FK9 A;  3MEE A;  2VWJ A;  4ELT A;  2P51 A;  1TAU A;  4DFM A;  2QKB A;  3QLH A;  2Z1I A;  4QCL A;  3QEW A;  3TAF A;  5KI6 A;  4B8C A;  3HP9 A;  3DLH A;  3AO4 A;  3NGY A;  3AA2 A;  1S1T A;  4OKE A;  5C24 A;  4CF0 A;  4CJF A;  4CEE A;  2XRI A;  4W5N A;  4AIL C;  3SUP A;  4HCB A;  4M3U A;  4CJT A;  3T3F A;  4DF8 A;  1RDC A;  4Q5V A;  2G8K A;  4OGC A;  5HRS A;  3AVL A;  2X74 A;  4CHY A;  4W5T A;  1NOZ A;  4JS4 A;  4WE1 A;  3OS1 A;  3HVT A;  1TL1 A;  3KLI A;  2FBY A;  4RG8 A;  4DMN A;  4QOZ B;  1N6Q A;  1A5W A;  1BCM A;  1O1W A;  1CZB A;  1VSD A;  1BQM A;  4KTZ A;  4B9N A;  4Z4I A;  3HVR A;  1FKO A;  4E1N A;  1JXE A;  4KKO A;  1NKC A;  4DTS A;  4YFU A;  1NJZ A;  3OYK A;  2G8H A;  4OPJ A;  4DQQ A;  4OKJ A;  3NF8 A;  3P5J A;  5KGW A;  1KVC A;  1HYZ A;  4LY7 A;  3T1A A;  3ZT4 A;  4CK2 A;  4DFJ A;  2YKN A;  4DU3 A;  1VSE A;  5J1E A;  1FXX A;  2JLE A;  2HHW A;  1VSL A;  1U4B A;  1K6Y A;  4BE1 A;  4DU4 A;  1HJR A;  4C8M A;  4M3Y A;  3CM6 A;  4O0J A;  4E7J A;  4GVM A;  2Y1J A;  3NF6 A;  4KAZ A;  1TVR A;  3K59 A;  3F9K A;  1EP4 A;  2R7Y A;  1Q9Y A;  3L3V A;  3EYZ A;  3MXI A;  2HND A;  3PO5 A;  4F2R A;  1WAF A;  5DMR A;  4CGJ A;  3ZSY A;  1FKP A;  2B5J A;  1C6V A;  4KB0 A;  4I7F A;  1S9G A;  3SQ0 A;  1NK4 A;  1L3V A;  3KD5 E;  1S1U A;  1RT3 A;  1GOA A;  5KRT A;  3ZSO A;  3VQQ A;  1LWC A;  1NJY A;  3PX0 A;  1S6Q A;  4AHS A;  3SNN A;  4EP4 A;  3TAM A;  3OJS A;  4HUF A;  4RW4 A;  2G8U A;  4YNQ A;  1F21 A;  3P1G A;  4C8N A;  4FJ5 A;  4FCY A;  5FRO A;  2XHB A;  2Z1G A;  2IDO A;  3AVF A;  1KLN A;  4KI4 A;  4CHZ A;  1QE1 A;  3RR8 A;  1KRP A;  4B9S A;  2YHA A;  4FJ7 A;  4TSX A;  3TAR A;  4HTU A;  1Z25 A;  4FJ9 A;  3S3O A;  2P5O A;  1BQN A;  1TGO A;  2A1S A;  3OYH A;  3FFI A;  4CIE A;  3SQ2 A;  2EHG A;  4DQI A;  3QEI A;  1C1A A;  3HO1 A;  4ZTJ A;  1D9D A;  5C25 A;  3TAN A;  1QSY A;  5E41 A;  3AVK A;  4CFC A;  2X6S A;  3RTV A;  4LH4 A;  3TAP A;  4C8L A;  4M3T A;  2HNZ A;  3S9H A;  2VWK A;  3U3G A;  4N47 A;  4FM1 A;  2D0C A;  3F73 A;  3KJV A;  2HHU A;  2YKM A;  2HHS A;  4O4G A;  2KW4 A;  3OS0 A;  1RT1 A;  1SKW A;  1SUQ A;  4DS5 A;  4FLW A;  2ZD1 A;  4CHN A;  3LWM A;  4O55 A;  4MQ3 A;  1ZBU A;  4CHP A;  4DQS A;  1LWF A;  3C6T A;  3NCI A;  4FZX C;  4E7L A;  4BWJ A;  3SYZ A;  3HK2 A;  2ATQ A;  1RDD A;  2HNY A;  1ITG A;  1DLO A;  2FBX A;  3TR8 A;  1NK9 A;  4PUO A;  1Q8I A;  1UOC A;  2RF2 A;  4DSF A;  4FJL A;  4KHS A;  4M3Z A;  2F8S A;  1RDA A;  3CFP A;  3VQD A;  3DYA A;  2XY8 A;  2IAJ A;  2O4G A;  4XIU A;  5I42 A;  1VRU A;  4MFB A;  3IS9 A;  3IRX A;  1LW0 A;  2KTQ A;  2BE2 A;  2D5R A;  4DTJ A;  4Z4E A;  3TAE A;  3HST B;  1D5A A;  1L3U A;  2DFH A;  2PYJ A;  2OYQ A;  4OVL A;  4FK4 A;  3NBP A;  2HHV A;  4CGH A;  3OY9 A;  4C8O A;  3EY1 A;  1HQE A;  3ULD A;  2D0B A;  5J2N A;  1SKR A;  4O0I A;  4B9M A;  1UAX A;  1ZBL A;  3LPT A;  3VQ7 A;  3I0S A;  4IDK A;  4M45 A;  3LAL A;  3NGI A;  4FLZ A;  3V9Z A;  4HVJ A;  3QO9 A;  4ID5 A;  3LWL A;  2XY7 A;  4DSI A;  1DTT A;  4KFB A;  1G15 A;  5HRO A;  2DY4 A;  3SUO A;  1I39 A;  1SL2 A;  2BDP A;  4FLV A;  3O3H A;  5K14 A;  3PX4 A;  4PWD A;  3ZSQ A;  5JS1 A;  3LAM A;  1CZ9 A;  4IBN A;  1ZBI A;  1ZYQ A;  4KHQ A;  2F96 A;  1JLB A;  3L2U A;  3U3Y A;  3DRP A;  4NYN A;  3PUF A;  4CHO A;  4CJP A;  3ZSX A;  4Z0U A;  1ASU A;  3MEG A;  4CJW A;  3OJU A;  3K57 A;  1Q9X A;  4FXD A;  1HPZ A;  4Z4H A;  3KD1 E;  3KK3 A;  4JLH A;  3NH0 A;  3M8S A;  4DTM A;  2YNH A;  1SKS A;  4CEA A;  1U47 A;  4FZY A;  4NCG A;  4F4K A;  3LAN A;  4KHN A;  3OYN A;  1BL3 A;  4FJN A;  1WSF A;  3ASM A;  1YT3 A;  4K8Z A;  4K8X A;  1BCO A;  3ZSR A;  1IKY A;  3AVG A;  4KPY A;  2OA8 A;  2OPR A;  4F3T A;  2QXF A;  3SI6 A;  1VSJ A;  3VQA A;  3TAQ A;  3DM2 A;  4CJV A;  5SWM A;  1JLQ A;  3PY8 A;  4IFV A;  4GMJ B;  4RW9 A;  4CJR A;  4LD0 A;  4FJX A;  3SZ2 A;  3O3G A;  4M42 A;  3MEC A;  1NKB A;  4CER A;  5KTQ A;  4ELV A;  4GW6 A;  4FLX A;  3V1O A;  1S1V A;  1NOY A;  3AA3 A;  2KFZ A;  4FW2 A;  4KV8 A;  1RDB A;  4BE2 A;  1BHL A;  1WLJ A;  4FJ8 A;  1RT6 A;  2Z1H A;  1JLC A;  3KK2 A;  4CEZ A;  4CEB A;  2ZE2 A;  3M8R A;  4ZTF A;  2B6A A;  3RMA A;  4Q0B A;  3MXM A;  4KHY A;  4H8K A;  1QQC A;  3E01 A;  4CEQ A;  1JLA A;  3VQ5 A;  3QES A;  1KVB A;  2DFE A;  3V9X A;  2PY5 A;  4M3X A;  2BGG A;  3HPH A;  1A5X A;  3B6P A;  2OPQ A;  5DK5 A;  3VN5 A;  1ASW A;  1D8Y A;  2HVH A;  4CES A;  4CGF A;  1NK7 A;  4E3S A;  2IS3 A;  3L3U A;  4CJK A;  3O4N A;  1ASV A;  4H4O A;  3VQP A;  4CJE A;  2XO7 A;  3LP1 A;  1QHT A;  3ZSV A;  2WOM A;  3V9W A;  3QNN A;  5CY4 A;  3MXJ A;  1S1X A;  4BDY A;  4IKF A;  4B08 A;  4FLY A;  3TI0 A;  2RKI A;  1NK0 A;  3DOL A;  3JSM A;  5D3G A;  2F8T A;  4DQR A;  1QTM A;  3AVB A;  3SV4 A;  1NK8 A;  1RT4 A;  3KKR A;  1RT2 A;  4FYD A;  1IH7 A;  1T05 A;  1XWL A;  2ETJ A;  3M8P A;  3KLE A;  1T8E A;  4ZHR A;  3C95 A;  4DTN A;  1JLF A;  4CEO A;  1WSG A;  3HM9 A;  3QEV A;  3ZCM A;  1CXQ A;  4PY5 A;  2X6N A;  3OYI A;  1U48 A;  2GBZ A;  1VRT A;  4Z4C A;  1TK0 A;  1VSM A;  3K58 A;  1RBT A;  4AHC A;  5HRN A;  3V9U A;  2G8F A;  4EZ6 A;  4CF8 A;  1BIU A;  1RBU A;  3LPU A;  3C6U A;  3CYM A;  4PA1 A;  4CF1 A;  1JLE A;  1NK6 A;  3AVA A;  2HHT A;  1KTQ A;  4CEF A;  3CG7 A;  1RBV A;  3ZSW A;  4CK1 A;  4CF9 A;  4CIF A;  3NE6 A;  3DLB A;  4O44 A;  1C1B A;  4LH5 A;  3NH1 A;  1VK0 A;  3AVI A;  3D0P A;  5JS2 A;  4FM0 A;  3QNO A;  3SUQ A;  1SL0 A;  3TAG A;  2OZS A;  3PV8 A;  3SQ4 A;  3AV9 A;  3BDP A;  1LV5 A;  3C94 A;  1MU2 A;  1JKH A;  2E4L A;  4DF4 A;  3U6F A;  1NJW A;  1U45 A;  4DSJ A;  3V1Q A;  1X1P A;  1TK8 A;  3MAQ A;  4DTP A;  1TKX A;  3PO4 A;  4W5Q A;  4OJR A;  3SPY A;  1L5U A;  1WNS A;  1X9W A;  4B9L A;  1YVU A;  2HHX A;  1HRH A;  1J53 A;  3V4I A;  2OZM A;  4FJI A;  1KVA A;  3OYJ A;  3HYF A;  3ZT2 A;  4CIG A;  3MED A;  3QIN A;  3WNG A;  4AHR A;  4IG0 A;  1UA0 A;  2B4J A;  1KCF A;  1WSI A;  4E1M A;  3IG1 A;  3L2Q A;  3AVN A;  4I9L A;  3HXM A;  2QKK A;  1RTH A;  1RBS A;  4FLU A;  3IAY A;  4M3W A;  4DG1 A;  5KGX A;  1W9H A;  4CED A;  3K5O A;  1BIS A;  4CJ4 A;  3OYL A;  1UWB A;  3TWH A;  3V1R A;  2Z1J A;  3G0Z A;  3AO1 A;  3ZT1 A;  3RRH A;  4DSK A;  3DOK A;  1C1C A;  4NCB A;  1WSH A;  3ZT3 A;  4OLB A;  1LAW A;  4DLE A;  3K2P A;  1WN7 A;  1IKW A;  4IG3 A; 
#chains in the Genus database with same CATH topology
 3SAF A;  4YOW A;  4O8U A;  4A5B A;  2ZGY A;  4QAG A;  5FLX O;  3RMB A;  4B1X B;  4DV0 K;  4EAH D;  1IO2 A;  1BWF O;  3T7Z A;  4CZI A;  2FBV A;  2G8V A;  2YNI A;  1DTQ A;  1RT7 A;  1RGI A;  3AY9 A;  4BDZ A;  1XMQ K;  3G10 A;  1B92 A;  4NLB A;  4PHT X;  4WFB L;  3FR0 A;  1RCH A;  3AA4 A;  1KSP A;  3K5L A;  5KPZ A;  3OYD A;  4KRE A;  3A0I X;  3SMS A;  2WON A;  4AH9 A;  3S3M A;  3K9J A;  2A6A A;  4FJH A;  3WXM B;  2BH1 A;  1XHZ A;  4DR5 K;  1O13 A;  5BRD A;  1ZBH A;  1UA1 A;  1C0U A;  2AJQ A;  4DHY A;  4DTO A;  3MCP A;  5FDL A;  1P90 A;  1YJW N;  4DSL A;  5HBM A;  3LP0 A;  3THV A;  1B9D A;  2NRW A;  4JI2 K;  4EHU A;  2EWS A;  4G1Q A;  1IJJ A;  4YOU A;  4BE0 A;  2QWO A;  3C7N B;  2QK9 A;  4BRK A;  3D45 A;  3CME N;  4DTR A;  4R79 A;  1TKZ A;  4ICL A;  4CZJ A;  3ATV A;  2FBT A;  3VA3 A;  4JKF A;  3KZB A;  2FC0 A;  4BRF A;  1TYQ A;  4DFK A;  2GEL A;  3BEX A;  4CJS A;  3DLG A;  4JS5 A;  4NCA A;  3HP6 A;  2VG5 A;  5C2F A;  3NVK A;  2Q3S A;  1VSH A;  4KI6 A;  4J2D A;  4CZH A;  4MDB A;  3SMP A;  3THY B;  2W6L A;  4MO5 A;  4ILJ A;  2YNF A;  1RFQ A;  3VQE A;  1QZ5 A;  2NRZ A;  3MN7 A;  2E5L K;  2D0A A;  2UUC K;  4CZM A;  4CZE A;  1KFD A;  1IKV A;  1W97 L;  3N4Q A;  3NF7 A;  3LDN A;  4CE9 A;  3QEX A;  4O5F A;  1CZA N;  5B8H A;  4PQU A;  1EX4 A;  1JL1 A;  4BWM A;  4ELU A;  2I5J A;  3QIP A;  1YTA A;  3ZT0 A;  3F2K A;  3KLG A;  3VEZ A;  4RW7 A;  1QSS A;  4J2E A;  3LP2 A;  4CFB A;  1WAJ A;  1OH7 A;  3OHR A;  4IWV A;  3VQB A;  2OTJ N;  1C0T A;  2YV0 X;  5HRP A;  4UQG A;  1J9A A;  3PX6 A;  1ILY A;  4J2B A;  1B9F A;  4K42 A;  5J2Q A;  4OX9 K;  4AHT A;  1N33 K;  3T69 A;  2ZM6 K;  2XY5 A;  4BG8 A;  3V81 A;  1RBR A;  5CZ2 A;  2WC9 A;  1HNI A;  1TK5 A;  3M5R A;  2A3Z A;  1L3S A;  4Y1C A;  1I94 K;  4JRQ A;  3ALY A;  3MCA B;  4CFD A;  4KTW A;  4AHU A;  3U9D A;  1ZBS A;  3BF3 A;  4BGA A;  4FJM A;  3UB5 A;  4DR7 K;  1QHA A;  3OYG A;  2YHB A;  1NU0 A;  3A2F A;  1TYQ B;  3HZ6 A;  4DS4 A;  3QER A;  4E0D A;  3MEE A;  2VWJ A;  4ELT A;  3WEE B;  4DFM A;  2Z1I A;  3Q7B A;  4CI6 A;  3VTI A;  4CF0 A;  4CJF A;  2P9I A;  4AIL C;  4DV6 K;  4M3U A;  4CJT A;  2QM1 A;  4OGC A;  5HRS A;  3AVL A;  4WE1 A;  5M1F A;  3HVT A;  4MDA A;  2FBY A;  4QOZ B;  1N6Q A;  4FWN A;  4KTZ A;  1CZB A;  2NRR A;  4BRH A;  1ATR A;  4GNI A;  5LJW A;  1XNQ K;  2G8H A;  4OKJ A;  3NF8 A;  5KGW A;  4CK2 A;  2YKN A;  4WCE L;  1VSE A;  4A57 A;  2HHW A;  3EL2 A;  4BC2 A;  1HJR A;  4FWK A;  5KPT A;  4E7J A;  4DR3 K;  4GVM A;  1TVR A;  3K59 A;  2UYT A;  3PO5 A;  4F2R A;  3MXI A;  1SZ2 A;  1WAF A;  4KB0 A;  3CQY A;  1GOA A;  1S6Q A;  3TAM A;  4YOT A;  4IO8 A;  1F21 A;  4IOX A;  1KAX A;  3P1G A;  4H5R A;  4C8N A;  2P9K A;  2Q2R A;  4B1Z A;  1KRP A;  2YHA A;  5JLH A;  1SQK A;  4JHD A;  1Z05 A;  1Z25 A;  4FJ9 A;  4K25 A;  2P5O A;  1BQN A;  1TGO A;  3JXU A;  2A1S A;  3FFI A;  3SQ2 A;  3WXI A;  3EZW A;  3CF5 L;  3R6M A;  4ZTJ A;  1YJN N;  1QSY A;  3TAN A;  4BR2 A;  2F7T A;  2FSJ A;  3KJV A;  1RT1 A;  1SKW A;  1SUQ A;  3HI0 A;  4DS5 A;  4H0V B;  1J6Z A;  3OA9 A;  4CHN A;  3LWM A;  4O55 A;  4DR1 K;  4CHP A;  1ZBU A;  4DQS A;  1GLL O;  3C6T A;  1OH5 A;  3SYZ A;  2A42 A;  1RDD A;  2FBX A;  4DCH A;  4PUO A;  1UOC A;  4M3Z A;  3MN6 A;  2F8S A;  2XY8 A;  4MFB A;  1MWM A;  4JYA K;  2BE2 A;  4Z4E A;  4A61 A;  3NBP A;  4JKD A;  3HBT A;  4CGH A;  3EY1 A;  5J2N A;  4B9M A;  1UAX A;  3QML A;  4H03 B;  3VEV A;  3O1B A;  3CC7 N;  3QO9 A;  4ID5 A;  1DTT A;  1G15 A;  3BUZ B;  3SUO A;  1I39 A;  1YHQ N;  2BDP A;  3O3H A;  1NMD A;  3VER A;  4XEI A;  1ZYQ A;  4KHQ A;  5AQP A;  2QWM A;  1WUA A;  3ZSX A;  1GLA G;  1ASU A;  3OJU A;  3K57 A;  2VQF K;  1Q9X A;  1NMN A;  4Z4H A;  3KK3 A;  4DTM A;  2QWR A;  3TTC A;  4BRO A;  1U47 A;  4FZY A;  4FWL A;  2VGM A;  2NRV A;  4KHN A;  1NGG A;  4PL7 A;  1JJ2 M;  5F0X A;  1VSJ A;  3ZX3 A;  2GEM A;  2P9K B;  3PY8 A;  2HHH K;  1OVQ A;  4FL9 A;  4CJR A;  3D7E O;  3IFR A;  3RSE A;  3S41 A;  4JHD B;  3AA3 A;  2KFZ A;  5BPN A;  3ZX2 A;  3KHY A;  1RDB A;  4NXM K;  3ZEU A;  1WLJ A;  2Z1H A;  4CEB A;  2ZE2 A;  4PKI A;  3C6H A;  3M8R A;  4Q0B A;  4H8K A;  1JLA A;  3VQ5 A;  1HR0 K;  3THW A;  3UKU A;  4XH5 A;  4BR9 A;  1A5X A;  2OPQ A;  1D8Y A;  3TU5 A;  4JK8 A;  4CGF A;  2ITM A;  4H4O A;  3VQP A;  1N8R O;  1GLF O;  3LP1 A;  1EWR A;  4FSV A;  1S1X A;  4BDY A;  4FLY A;  3TI0 A;  5D3G A;  3AVB A;  5ELZ A;  4FYD A;  1XWL A;  4JAX A;  4MO4 A;  4DR2 K;  3M8P A;  4ZHR A;  1KD1 O;  1JLF A;  3ZET A;  2WFB A;  3QEV A;  4PY5 A;  3R8E A;  1VRT A;  4Z4C A;  5GAH P;  3K58 A;  2F4V K;  3FZL A;  5HRN A;  2G8F A;  1BIU A;  1RBU A;  3H46 O;  3C6U A;  3CYM A;  4PA1 A;  4CZL A;  3CG7 A;  2FSN A;  3ZSW A;  4CF9 A;  4BRQ A;  3DLB A;  4A5A A;  4MLE A;  3NH1 A;  1VK0 A;  2ASM A;  2HF3 A;  5AQL A;  3SUQ A;  1QVF M;  3MWT A;  2YJF A;  3AV9 A;  1KAY A;  3CCV N;  1JKH A;  4DSJ A;  2D0P A;  5A2Q O;  3VPZ A;  5GIP A;  1L5U A;  2GWJ A;  1X9W A;  1YVU A;  5E84 A;  3O6W A;  4RCH A;  1HRH A;  3V4I A;  4FJI A;  2P9N A;  2B4J A;  1WSI A;  4E1M A;  4JKH A;  3L2Q A;  2D4W A;  4BVP A;  3SAG A;  2QKK A;  1RTH A;  4GV3 A;  4FLU A;  1XMO K;  5KGX A;  3VGL A;  3VMF B;  1JCE A;  1UWB A;  3LDO A;  3V1R A;  3AO1 A;  3ZT1 A;  3RRH A;  1DKG D;  3ZT3 A;  4B9U A;  3RSE B;  1HPM A;  3GG4 A;  3SUN A;  2A41 A;  3KTQ A;  3L4I A;  3NDK A;  3CIP A;  2I7P A;  3A5L C;  1X9M A;  1LOT B;  2NRX A;  4LFC K;  3U9Z A;  3DI6 A;  4AQY K;  3ZEU B;  5IT9 O;  3QFP A;  3VQ8 A;  3KLF A;  4AHV A;  5M1Q A;  3THW B;  3AVH A;  2KQ2 A;  1BGX T;  4FK0 A;  1VQ6 N;  4FM2 A;  1V4S A;  4CJ7 A;  4JD2 B;  1J54 A;  4PKH A;  1T7P A;  2O8B A;  3HJF A;  3D2F A;  3O4W A;  1SS6 A;  1BI4 A;  2YHX A;  4CEC A;  2YHY A;  5KRS A;  3WNH A;  3TPQ A;  5JLF A;  3H1Q A;  1Z26 A;  2HB5 A;  1TKD A;  5LL6 Z;  5FRM A;  4B1V A;  2QWQ A;  3WNE A;  4DWI A;  4I9Q A;  5GIO A;  3LAK A;  3ZET B;  3SK3 A;  2KZZ A;  1NJX A;  1RTI A;  4IFY A;  5T7B A;  5BRE A;  4HUE A;  3T1Y K;  3AA5 X;  3KKS A;  1BG3 A;  4JRP A;  3DLK A;  4L8R B;  1NGI A;  3NFA A;  4KRF A;  4EZ9 A;  1ZBF A;  4Z4F A;  3OYC A;  3RR7 A;  3T19 A;  1W0H A;  2GV9 A;  3I8D A;  2GX9 A;  4DFP A;  2ZQB A;  1XHX A;  2IOC A;  1VSK A;  2WTU A;  2QWL A;  3I8B A;  4H5V A;  2XY6 A;  4KTQ A;  3VEN A;  5TKW A;  1NK5 A;  3V9S A;  3ISN C;  4JN4 A;  4CGI A;  4BR7 A;  2YJE A;  3CCL N;  4BDP A;  4BRN A;  2Y1I A;  2P9N B;  4QS7 A;  4LSL A;  4N76 A;  1WSE A;  4M3R A;  1OVY A;  4JNE A;  4NO7 A;  3O9Q A;  1SL1 A;  4E7K A;  3E9O A;  4CJQ A;  1VSF A;  1LAV A;  3NGZ A;  3MK6 A;  2E2N A;  2FSK A;  4BAC A;  4JEP A;  4JK9 A;  3L2R A;  3LZI A;  4XH1 A;  2Q0R A;  2UXB K;  2P9P A;  1X9S A;  3EEQ A;  4O8K A;  3HPO A;  4DV3 K;  1RIL A;  1D4X A;  1HNV A;  4OGE A;  4CJL A;  3RMC A;  3FFK B;  2CGJ A;  4L3Q A;  3DLE A;  4C8K A;  3ZLJ A;  4YHH K;  4W5O A;  3EZ5 A;  4CD3 A;  1RNH A;  1U04 A;  3HPG A;  5HL7 L;  1GLB G;  3AO5 A;  3DRS A;  3DRR A;  3BY5 A;  4AM7 A;  3A5M C;  1KXP A;  1A5V A;  4BC3 A;  4X64 K;  1TUY A;  3P31 A;  2ZJP L;  2O8B B;  3VET A;  1GLE G;  1ATS A;  3D2F B;  3OYF A;  1BI4 B;  3WXK A;  3QFU A;  2E2P A;  1JXB A;  1TAQ A;  3ZSZ A;  3OYE A;  3OTO K;  1NG9 A;  3DJC A;  4IXC A;  4F8R A;  2RE2 A;  5C0Y A;  4DV5 K;  3O80 A;  4ID1 A;  5F1X A;  5IWA K;  4X66 K;  2YNG A;  3I0R A;  3O3F A;  3C65 A;  3ITH A;  2WUS A;  4KHW A;  2O4I A;  5BR8 K;  3MWP A;  4LFB K;  2F9W A;  3QLH A;  2HMP A;  3CCU N;  5KI6 A;  4B8C A;  3AO4 A;  3AA2 A;  2PFU A;  4OKE A;  1MDU B;  1NGA A;  5GIN A;  4GV6 A;  5KPR A;  1Q81 O;  1BA1 A;  2V7Z A;  1J5E K;  1RDC A;  2G8K A;  3GDQ A;  4G9Z A;  4CHY A;  1NOZ A;  3EN9 A;  3KLI A;  4DMN A;  4H0P A;  1VSD A;  1BCM A;  4B9N A;  1BQM A;  2P9S A;  3HVR A;  1FKO A;  5AQH A;  1OH6 A;  4FWO A;  4YFU A;  1S3X A;  3P5J A;  1KVC A;  4LY7 A;  3T1A A;  5FPD A;  2ZGZ A;  5J1E A;  1U4B A;  1P8Z A;  5BRH A;  5H1S Q;  4C8M A;  3MN5 A;  1RDW X;  3CM6 A;  3WXL A;  4KAZ A;  5EX5 A;  3F9K A;  1EP4 A;  1QQM A;  2O8E B;  4IJA A;  2JWK A;  1NK4 A;  5EOY A;  4FPA A;  4BR4 A;  3SNN A;  1W2B M;  1KC8 O;  2QXL A;  1U6Z A;  1VQP N;  4WQ4 A;  1NGC A;  5FRO A;  2XHB A;  4GY2 B;  2IDO A;  4KI4 A;  1BU6 O;  1FW6 A;  3MDQ A;  4BG9 A;  4CBU A;  4FJ7 A;  4E1J A;  2GWK A;  4U7B A;  4JKC A;  3ID6 A;  3FE1 A;  4CIE A;  2EHG A;  3VTH A;  1KQS M;  3TTF A;  1C1A A;  1Q18 A;  1YVN A;  4KH6 A;  3BP8 A;  4KBO A;  1BO5 O;  5C25 A;  3AVK A;  4NLC A;  4LH4 A;  4C8L A;  2QA4 N;  3S9H A;  3PLA A;  4ISG A;  4FM1 A;  4N47 A;  3F73 A;  1VQK N;  4GVE A;  2YKM A;  5E26 A;  4O4G A;  5M1O A;  3SJH A;  3JAM O;  2ZD1 A;  5EXW A;  2D0O A;  3VGM A;  3MMV A;  3O8M A;  4CBW A;  2HNY A;  1ITG A;  1DLO A;  4FJL A;  1RDA A;  4XIU A;  4DV1 K;  4DQ8 A;  1NGH A;  4PKG A;  3IS9 A;  2O8C A;  3TAE A;  3HST B;  1L3U A;  4FK4 A;  2HHV A;  3ULD A;  4O0I A;  3CI5 A;  2Q1N A;  2P9S B;  3VQ7 A;  4M45 A;  1ZXO A;  4HVJ A;  4DSI A;  4IFE A;  3BF1 A;  1T6C A;  2GUP A;  3L0Q A;  3LAM A;  1ZBI A;  1IBK K;  4JI4 K;  3CQX A;  4NYN A;  4CHO A;  4CJP A;  3MEG A;  4YOX A;  4H0X B;  4FVU A;  4H0Y B;  3M8S A;  3VOV A;  2UUA K;  3O9S A;  1Q82 O;  1WSF A;  1YT3 A;  3GE1 A;  4UY8 O;  3ZSR A;  1IKY A;  3AVG A;  4KPY A;  4BGB A;  5AZJ A;  5LY3 A;  4F3T A;  3VQA A;  3AAQ A;  5SWM A;  4IFV A;  4GMJ B;  4BQZ A;  2Q0U A;  4NB4 A;  1HUX A;  3CD6 N;  2E20 A;  1NOY A;  4KV8 A;  1NGF A;  2P9L A;  2ZJQ L;  4BY9 C;  3KK2 A;  3CC2 N;  3OW2 M;  2B6A A;  3MXM A;  4KHY A;  2NRH A;  2BGG A;  3VN5 A;  1ASW A;  4CES A;  1GLJ O;  3O4N A;  2XO7 A;  4CJE A;  1XC3 A;  3ZSV A;  2WOM A;  3QNN A;  5CY4 A;  1NK0 A;  5AFU H;  3DOL A;  3JSM A;  2F8T A;  1NGB A;  1RT4 A;  1HKB A;  3CPW M;  1RT2 A;  1T05 A;  2CGK A;  3C0B A;  4LF9 K;  3CCQ N;  3KLE A;  4CEO A;  1WSG A;  3CMA N;  2QTD A;  1CXQ A;  3NVM A;  2O8C B;  1TK0 A;  1YF5 L;  4AHC A;  4EZ6 A;  4CF8 A;  4JKG A;  3LPU A;  4CF1 A;  1OH8 A;  1JLE A;  3OBY A;  3AVA A;  4BRE A;  5C15 A;  4CK1 A;  2QW9 A;  4FPB A;  3VF4 A;  3QNO A;  3AVI A;  3R9P A;  5AQG A;  3TAG A;  3H3N O;  3ID8 A;  3IDH A;  3THX A;  3PV8 A;  3SQ4 A;  1LV5 A;  3C94 A;  2UXD K;  1HLU A;  2E4L A;  4Y0W A;  1X1P A;  4LF4 K;  3PO4 A;  3PIO L;  4W5Q A;  4JI7 K;  4OJR A;  1XQS C;  3LM9 A;  2RHK A;  2P9I B;  4BRM A;  2OZM A;  3VGK A;  3HYF A;  3MED A;  3WNG A;  1BUP A;  3VEY A;  2V7Y A;  4CW7 B;  4JK7 A;  4I9L A;  3HXM A;  5BPM A;  4C1N I;  5AQX A;  4DV4 K;  2O8D A;  5AZJ B;  1W9H A;  3VEX A;  4CED A;  3OYL A;  1RDU A;  3G0Z A;  4FWQ A;  3DOK A;  1C1C A;  4DLE A;  1IKW A;  4B8A B;  2J4R A;  3SV3 A;  4FK2 A;  4CJU A;  1FJG K;  1RTJ A;  2OPS A;  4H5W A;  2P9L B;  4QS9 A;  4JI5 K;  3H45 C;  3A5N C;  1TV6 A;  3LP3 A;  2O8F A;  4CZF A;  3TAB A;  4CZK A;  1IG9 A;  3E1Y A;  3UIQ A;  2A1R A;  2YX6 A;  5EU7 A;  1NM1 A;  4LF8 K;  4J8F A;  3LL3 A;  4I2P A;  1HQU A;  4IDH A;  3BGR A;  2KZM A;  2OPP A;  4A2A A;  1HYV A;  4KO0 A;  4DTX A;  2OYQ A;  1EXQ A;  1R0A A;  3VES A;  1YTU A;  1T44 A;  1HNW K;  1YIT N;  3SCX A;  1J5O A;  4F9O A;  4R5P A;  3PSF A;  4B3O A;  1HJO A;  3HSC A;  4J2A A;  4BR5 A;  2HW3 A;  4JKG B;  1KFS A;  5AQJ A;  4CD1 A;  4DV7 K;  2W41 A;  3CC4 N;  3ENH A;  1IKX A;  3THX B;  3CJC A;  1HNZ K;  2VG7 A;  4KB1 A;  4X65 K;  5HLF A;  4W5R A;  4CHQ A;  4FVM A;  3NF9 A;  4H4M A;  3DXK A;  1T03 A;  3QDK A;  2P5G A;  5AQI A;  3NH2 A;  1Q7Y O;  1QS4 A;  5AQQ A;  1YAG A;  2YCH A;  1T6D A;  1S5J A;  3FGU A;  3M6G A;  3H08 A;  3NAE A;  3CJ7 A;  1S9E A;  4CCH A;  1L3T A;  1S1W A;  3QIO A;  1LW2 A;  2D1K A;  2HOE A;  4IZ9 A;  3KLH A;  1SAZ A;  1JLG A;  4Y1D A;  4MLH A;  3HT3 A;  2BAN A;  3H6E A;  2A5X A;  2E6M A;  1KLM A;  1N5Y A;  4HUG A;  4GV9 A;  3O9T A;  3VQ9 A;  4E7I A;  2IVP A;  4RW6 A;  2O8F B;  1LWE A;  3UE5 A;  4HCC A;  1S6P A;  4WQ4 C;  3CET A;  1EKE A;  1HMV A;  2HBJ A;  2NLX A;  3DMJ A;  1IBL K;  5AQN A;  4O5B A;  2HVI A;  3NMU A;  4DQP A;  2UUB K;  3QEP A;  3MX2 A;  3AVC A;  5J2M A;  5LMU K;  4FJJ A;  5JMV A;  3L2V A;  4N56 A;  1QSL A;  4OPK A;  4EHT A;  2GTD A;  3HL8 A;  4JKB A;  1E4F T;  4X62 K;  3S3N A;  2P1J A;  3JYT A;  3R3L A;  3OYM A;  2E6L A;  3CJ9 A;  4M7Y A;  1QVG M;  4LF6 K;  2DTU A;  2V52 B;  3K0S A;  3O9U A;  4IJN A;  1VQM N;  4DSE A;  4HTL A;  3KWI A;  1E4G T;  5BR9 A;  1C0G A;  3P39 A;  1M90 O;  1U49 A;  4JI3 K;  1YXQ A;  3K5N A;  1VQL N;  2JGU A;  4IOC L;  2E1Y A;  3UKU B;  4E19 A;  4BRC A;  4F3O A;  2IGI A;  4B1Y B;  1TAU A;  2P51 A;  1VQ8 N;  4A62 A;  2QKB A;  4QCL A;  3TAF A;  4GKK K;  3AGK A;  3DLH A;  4CEE A;  3W3D A;  3SUP A;  4HCB A;  2F9T A;  4QS8 A;  3LDP A;  2X74 A;  4W5T A;  3DAW A;  2BUP A;  1EQY A;  3OS1 A;  4RG8 A;  3DXK B;  3VF2 A;  4B1W B;  4BQL A;  4E1N A;  4KKO A;  4H5N A;  1NKC A;  4DTS A;  1NJZ A;  3OYK A;  2Q97 A;  4DQQ A;  4KH5 A;  4JV5 K;  1K73 O;  4DFJ A;  3SLC A;  4OPH A;  5AZI A;  1FXX A;  1K6Y A;  4OPA A;  4BE1 A;  5FPN A;  4O0J A;  5JVG L;  4IOA L;  3EKS A;  1Q9Y A;  3EYZ A;  2HND A;  1DEJ A;  4CGJ A;  3ZSY A;  3FZH A;  5BRF A;  1FKP A;  2B5J A;  2W40 A;  1C6V A;  1GLC G;  1S9G A;  4I7F A;  4YY3 K;  3SQ0 A;  3KD5 E;  3DWL A;  5LMN K;  3CCJ N;  3VQQ A;  3PX0 A;  4AHS A;  5AQO A;  2JWL A;  3OJS A;  4YNQ A;  4FCY A;  4FOE A;  3OBW A;  3AVF A;  3G71 N;  4CHZ A;  1N36 K;  1QE1 A;  5C10 A;  1NGJ A;  4FWM A;  4V19 S;  3TAR A;  5CHI A;  3JS6 A;  4JKA A;  5DM7 L;  4EIA A;  4U67 L;  3C7N A;  3RVC A;  4DQI A;  1X3M A;  1TUU A;  1D9D A;  2KKZ A;  5E41 A;  4CFC A;  3TAP A;  4LF5 K;  4M3T A;  2VWK A;  4K41 A;  3U3G A;  3GBT A;  1IV0 A;  2D0C A;  3EKU A;  2OTL N;  1E3M A;  2HF4 A;  4RTF D;  5MLC Q;  2KW4 A;  3OS0 A;  3EE9 A;  4FLW A;  5AQU A;  3HM8 A;  5AJ3 K;  2KHO A;  3ENB A;  4MQ3 A;  3NCI A;  4FZX C;  5FPE A;  3WT0 A;  3HTV A;  4BWJ A;  3HK2 A;  2ATQ A;  4BR0 A;  1NK9 A;  1Q8I A;  4DSF A;  2RF2 A;  3CFP A;  3VQD A;  3DYA A;  1NNE A;  5I42 A;  2HBL A;  1VRU A;  4H5T A;  1VQ5 N;  3QBW A;  3IRX A;  2KTQ A;  4BRP A;  5FPM A;  5EVZ A;  3A5O C;  2UU9 K;  1VHX A;  4BVO A;  4DV2 K;  2DFH A;  2PYJ A;  2ZF5 O;  3IUC A;  3OY9 A;  5KQD A;  1HQE A;  4FWP A;  1VQ7 N;  2E88 A;  1M1K O;  1ZBL A;  3LPT A;  3GL1 A;  4ILG B;  3LAL A;  4FLZ A;  3MN9 A;  1C0F A;  1SL2 A;  4NXN K;  1S72 N;  4PWD A;  3PX4 A;  5AR0 A;  3ZSQ A;  5AZI B;  5BPL A;  2YI1 A;  4IBN A;  2F96 A;  3J7Y P;  3PUF A;  4Z0U A;  4C23 A;  4CJW A;  4KHP K;  2VWB A;  4CZG A;  3KD1 E;  2OAN A;  2YNH A;  2OCE A;  3FZM A;  4B3T K;  1SKS A;  3TSU A;  4NCG A;  3LAN A;  4M63 C;  3C6A A;  1BCO A;  3N4P A;  4Z94 A;  5HOO A;  4ILH A;  3TAQ A;  3J81 O;  5JIC A;  4CJV A;  1JLQ A;  4RW9 A;  1QQN A;  1NKB A;  4CER A;  5KTQ A;  4ELV A;  4GW6 A;  4B1U B;  3V1O A;  1S1V A;  4A2B A;  2HST A;  1ZC6 A;  4BE2 A;  2P9P B;  3ULE A;  1BHL A;  5I9E B;  1RT6 A;  2QI2 A;  3M1F A;  3PIP L;  3J7A P;  1VAZ A;  5LJV A;  3V9X A;  4M3X A;  3B6P A;  5DK5 A;  2ASP A;  2HBK A;  3L4Q A;  2HVH A;  2E1Z A;  1YJ9 N;  4E3S A;  2IS3 A;  3L3U A;  4CJK A;  1ASV A;  5ADX H;  5M1P A;  3WEE A;  4BC5 A;  1QHT A;  3V9W A;  3DLL L;  4IKF A;  1NLV A;  2RKI A;  4DR4 K;  4DQR A;  1QTM A;  1NK8 A;  5AFU A;  3F9M A;  3KKR A;  2ETJ A;  3CCS N;  3C95 A;  1G99 A;  4WFA L;  2X6N A;  5C2D A;  3OYI A;  1U48 A;  5AQV A;  4B3M K;  2NZT A;  4FWS A;  3V9U A;  3W0L A;  4C1N K;  2HHT A;  1KTQ A;  2FF3 B;  3NE6 A;  3ZYY X;  5M1K A;  4FM0 A;  1SL0 A;  2E2Q A;  3BDP A;  1LCU A;  3U6F A;  3V1Q A;  4DTP A;  1DT9 A;  3WUH A;  4I6M A;  1IBM K;  4CVN E;  3ZX0 A;  2HHX A;  2QEX N;  1J53 A;  3OYJ A;  4XH4 A;  1NJI O;  1YI2 N;  1K8A O;  3AVN A;  2Q31 A;  3IAY A;  3IMX A;  4DG1 A;  1Q86 O;  3TWH A;  3UKR A;  3O9R A;  4NCB A;  1WSH A;  4OLB A;  1LAW A;  4RWT A;  4GKJ K;  1WN7 A;  2HHU A;  1WOQ A;  2HMI A;  2VCP A;  3AVJ A;  2G8I A;  3RWU A;  4DU1 A;  1EO1 A;  4LSN A;  1D9F A;  3ULE B;  3GOI A;  1HYS A;  2VG6 A;  2VYP A;  2NUB A;  2QWN A;  3OYB A;  4N41 A;  3SQ1 A;  1VQN N;  1TL3 A;  1TKT A;  1CXU A;  1VSI A;  2KFN A;  4F2S A;  3DXM A;  3RRG A;  4FJK A;  3CJ1 A;  4FO0 A;  2AP1 A;  1CLQ A;  4B9Q A;  3LZJ A;  2GUI A;  3F5T A;  3CFR A;  3QET A;  5CZ1 A;  3OVN A;  3L8B A;  4FZZ A;  2ZWH A;  4DKW A;  4CF2 A;  1C0M A;  5C42 A;  3VQC A;  1XC9 A;  4FJG A;  3HOS A;  3LM2 A;  2X78 A;  3AO2 A;  1XI1 A;  1NKE A;  1WSJ A;  3AVM A;  4LF7 K;  1SV5 A;  3CM5 A;  1GOC A;  1X3N A;  3CFO A;  4B9V A;  1I3A A;  3O4Q A;  2H3G X;  3ENO A;  2G8W A;  5CYM A;  3NHG A;  5KQ8 A;  4LFA K;  4CGD A;  3KK1 A;  4K0K K;  5CYQ A;  5GAD P;  1GOB A;  5SZT A;  4CJ3 A;  2RPI A;  2KLA A;  3AO3 A;  1RTD A;  1BIZ A;  3OYA A;  5FRN A;  1VQO N;  3WNF A;  2WBN A;  4CFA A;  4ISF A;  1RT5 A;  4DR6 K;  2E8A A;  2ASO A;  4EP5 A;  1NGE A;  4BRL A;  4RW8 A;  1MA9 B;  2DFF A;  4I6M B;  3VA0 A;  5AQZ A;  1EWQ A;  4M41 A;  5AQW A;  4WQ5 C;  5I3U A;  1HKG A;  4CJ5 A;  1JCF A;  3SPZ A;  2NRT A;  4FLT A;  1U2V A;  1S22 A;  4FW1 A;  3L6Q A;  4WFN L;  3KIO A;  5J2P A;  3K5M A;  1GLD G;  3BZK A;  3UKR B;  1N34 K;  2W42 A;  4B9T A;  3FZK A;  4JI8 K;  3VQ6 A;  3LDS A;  3Q7C A;  4I2Q A;  3CQ8 A;  4N5S A;  3CCM N;  4CK3 A;  3J80 O;  1Y97 A;  3M8Q A;  3VQ4 A;  3L2W A;  3P83 D;  4OLA A;  2ITG A;  4E89 A;  3VEW A;  3DXM B;  3LDQ A;  3AAR A;  4DTU A;  1BDG A;  3RMD A;  1JL2 A;  1W7A A;  5C12 A;  4KHU A;  2IC3 A;  3B6O A;  3SJJ A;  3QB0 A;  4OKK A;  3D2E A;  2RN2 A;  3I56 N;  1REV A;  1Y64 A;  4IEI A;  4E7H A;  4FWR A;  3O1W A;  5HP1 A;  2HHQ A;  3EO3 A;  3U8X A;  4HHT A;  2I7N A;  5HRR A;  1EET A;  3KVG A;  5GAE P;  4CGG A;  3CCR N;  2PZS A;  3ATU A;  3P4I A;  3WQT A;  3CXC M;  4DLG A;  3V6D A;  3O5B A;  3DLR A;  2EX3 A;  4NYF A;  3OS2 A;  2PYL A;  2QWP A;  1N32 K;  4Z4G A;  2LSN A;  1FK9 A;  4H0T B;  3QEW A;  1DGK N;  4EFH A;  3HP9 A;  1HKC A;  3NGY A;  1S1T A;  5C24 A;  5GAG P;  2XRI A;  3K9K A;  4W5N A;  3LDL A;  4YDU C;  4BRA A;  3T3F A;  4DF8 A;  4Q5V A;  2Q36 A;  4JS4 A;  3B8A X;  1TL1 A;  1A5W A;  1O1W A;  3HOT A;  3G4S N;  4Z4I A;  1U2V B;  1JXE A;  3U4L A;  1HNX K;  4OPJ A;  3ZT4 A;  1HYZ A;  3AAP A;  4DU3 A;  5F2R A;  2JLE A;  1VSL A;  4DU4 A;  1T3V A;  4M3Y A;  4JI6 K;  2Y1J A;  3FZF A;  3NF6 A;  1XNR K;  4AF1 A;  2R7Y A;  3L3V A;  5EY4 A;  2HBM A;  3CHW A;  4WYB A;  5DMR A;  2PAV A;  3TTD A;  1L3V A;  5AQY A;  1S1U A;  1RT3 A;  5KRT A;  3ZSO A;  3KWG A;  1LWC A;  1NJY A;  1OKJ A;  4JD2 A;  4EP4 A;  4HUF A;  4RW4 A;  2G8U A;  4FJ5 A;  5DM6 L;  3EE8 A;  2Z1G A;  4FOI A;  1KLN A;  4H0O A;  2O8D B;  3RR8 A;  4B9S A;  4TSX A;  2CGL A;  4HTU A;  4K43 A;  3D2E B;  3S3O A;  3HRG A;  3G6E N;  3OYH A;  4A59 A;  3E66 A;  3QEI A;  3T1H K;  3HO1 A;  3BZC A;  2P9U A;  1BOT O;  2X6S A;  3RTV A;  2HNZ A;  3A8Y A;  2CH5 A;  4JI1 K;  3I33 A;  2HHS A;  5AQK A;  4AM6 A;  4BRI A;  1BA0 A;  1R59 O;  3E9P A;  1LWF A;  4E7L A;  5CE3 A;  3TR8 A;  4KHS A;  3SBG A;  2IAJ A;  2O4G A;  2DPN A;  3PSI A;  1WBD A;  1K8K A;  1LW0 A;  1HX1 A;  2D5R A;  4DTJ A;  1D5A A;  1X9J A;  4OVL A;  4C8O A;  3IKM A;  2D0B A;  1SKR A;  2BTF A;  5CR4 A;  4WF9 L;  2FLO A;  3I0S A;  4BRD A;  4IDK A;  3NGI A;  3V9Z A;  2XY7 A;  4HWI A;  3LWL A;  2VGN A;  4BC4 A;  4KFB A;  5M1N A;  5HRO A;  2DY4 A;  4DB3 A;  3MX5 A;  4FLV A;  5K14 A;  5JS1 A;  3J8A A;  3WQU A;  1CZ9 A;  1KAZ A;  1MWK A;  1WB9 A;  5AQF A;  1JLB A;  3L2U A;  3U3Y A;  3DRP A;  3FLC O;  1XUP O;  4DUZ K;  1WBB A;  4FXD A;  1HPZ A;  4JLH A;  3NH0 A;  4CEA A;  4F4K A;  3OYN A;  1BL3 A;  4FJN A;  4K8Z A;  3ASM A;  1V4T A;  4YOY A;  3VF6 A;  3O08 A;  4K8X A;  1NGD A;  4WQ5 A;  1VQ9 N;  3CJA A;  2OA8 A;  2OPR A;  2QXF A;  2YHW A;  3SI6 A;  1VQ4 N;  3DM2 A;  3CJB A;  4FJX A;  5AQS A;  4LD0 A;  4BRG A;  3TSQ A;  3SZ2 A;  3O3G A;  4M42 A;  3MEC A;  1QZ6 A;  3M3Z A;  4FLX A;  3KK7 A;  4IO9 L;  2CH6 A;  4FW2 A;  3SAH A;  2W6K A;  2FF6 A;  4FJ8 A;  1JLC A;  4CEZ A;  4ZTF A;  3RMA A;  3CCE N;  2P9U B;  1ATN A;  1QQC A;  3E01 A;  4CEQ A;  3QES A;  1KVB A;  2DFE A;  2PY5 A;  3HPH A;  3CER A;  4PL8 A;  3CPE A;  1NK7 A;  2IIR A;  2AA4 A;  3QIC A;  1ESV A;  3MXJ A;  5ADX A;  3D6R A;  1K9M O;  4B08 A;  4IEE A;  4KH4 A;  4LC9 B;  3SV4 A;  4ISE A;  4OO1 J;  3TSP A;  4YOV A;  5AQM A;  1IH7 A;  5JVH L;  1H1V A;  4B3R K;  1K8K B;  1T8E A;  4DTN A;  2IVN A;  3WXJ A;  3HM9 A;  3ZCM A;  1NWK A;  4M7X A;  2GBZ A;  2NNW A;  1VSM A;  1NBW A;  1RBT A;  1YIJ N;  4YOR A;  3QBX A;  1NK6 A;  4JKE A;  4CEF A;  3I55 N;  2A40 A;  1RBV A;  4CIF A;  4O44 A;  1C1B A;  4LH5 A;  3D0P A;  3VEO A;  1YUW A;  5TKY A;  5JS2 A;  4JI0 K;  2OZS A;  3AGR A;  3SBT A;  1MU2 A;  1IG8 A;  4DF4 A;  1NJW A;  1U45 A;  2E2O A;  2VQE K;  4DUY K;  5AQT A;  1TK8 A;  3MAQ A;  2O8E A;  3E9L A;  1TKX A;  1QQO A;  3SPY A;  1WNS A;  4B9L A;  5BN8 A;  2ZJR L;  5AQR A;  3THY A;  3H3O B;  1KVA A;  4CIG A;  2IVO A;  3ZT2 A;  3QIN A;  3J7Z O;  4AHR A;  4IG0 A;  2FXU A;  1UA0 A;  1KCF A;  3IG1 A;  4YDU A;  2PBD A;  3H1V X;  3R1X A;  1RBS A;  5BN9 A;  4B3S K;  4M3W A;  2V51 B;  3G25 A;  3K5O A;  1BIS A;  4CJ4 A;  4CBX A;  2UXC K;  1JCG A;  2Z1J A;  3P38 A;  4DSK A;  3K2P A;  4IG3 A;  1Z6R A; 
#chains in the Genus database with same CATH homology
 2HMI A;  3AVJ A;  3SV3 A;  3SUN A;  3KTQ A;  2G8I A;  4QAG A;  3NDK A;  4FK2 A;  4CJU A;  3RWU A;  3RMB A;  4DU1 A;  1X9M A;  1RTJ A;  2OPS A;  4LSN A;  3DI6 A;  1D9F A;  1HYS A;  1IO2 A;  2VG6 A;  2FBV A;  2NUB A;  3OYB A;  4N41 A;  2G8V A;  2YNI A;  3SQ1 A;  1DTQ A;  1RT7 A;  3VQ8 A;  1TV6 A;  4BDZ A;  3G10 A;  1B92 A;  1TL3 A;  4AHV A;  3KLF A;  3LP3 A;  1TKT A;  1CXU A;  1VSI A;  2KFN A;  3AVH A;  4F2S A;  1RCH A;  3AA4 A;  2KQ2 A;  1BGX T;  3TAB A;  3RRG A;  4FJK A;  1KSP A;  4FM2 A;  3K5L A;  3OYD A;  4FK0 A;  4KRE A;  1CLQ A;  3LZJ A;  2GUI A;  4AH9 A;  2WON A;  3S3M A;  1IG9 A;  4FJH A;  3UIQ A;  1J54 A;  4B8A B;  1XHZ A;  2A1R A;  5EU7 A;  1T7P A;  1ZBH A;  3HJF A;  1UA1 A;  3CFR A;  1C0U A;  3QET A;  2AJQ A;  5CZ1 A;  3OVN A;  1BI4 A;  4DTO A;  5FDL A;  4I2P A;  4CEC A;  3L8B A;  1HQU A;  5KRS A;  3BGR A;  4DSL A;  5HBM A;  2OPP A;  3LP0 A;  4FZZ A;  2KZM A;  3THV A;  1B9D A;  1C0M A;  5C42 A;  3VQC A;  3WNH A;  4CF2 A;  1XC9 A;  4FJG A;  1HYV A;  4KO0 A;  4DTX A;  1Z26 A;  1EXQ A;  2HB5 A;  2X78 A;  3AO2 A;  1WSJ A;  4G1Q A;  1XI1 A;  1R0A A;  3WNE A;  1NKE A;  4BE0 A;  4DWI A;  4I9Q A;  5FRM A;  2QK9 A;  3AVM A;  1YTU A;  3D45 A;  1SV5 A;  3LAK A;  3CM5 A;  4DTR A;  1GOC A;  2KZZ A;  1NJX A;  3SCX A;  1RTI A;  4IFY A;  1J5O A;  5T7B A;  4R5P A;  3CFO A;  1TKZ A;  4B9V A;  4B3O A;  1I3A A;  3O4Q A;  4ICL A;  4HUE A;  1TKD A;  2G8W A;  4J2A A;  5CYM A;  3NHG A;  3AA5 X;  3KKS A;  4JRP A;  4L8R B;  3DLK A;  2HW3 A;  2FBT A;  3NFA A;  3VA3 A;  1KFS A;  4KRF A;  4EZ9 A;  1ZBF A;  4CGD A;  3KK1 A;  4Z4F A;  5CYQ A;  3OYC A;  1GOB A;  2FC0 A;  3T19 A;  1W0H A;  5SZT A;  3RR7 A;  2GV9 A;  3I8D A;  4DFK A;  4CJ3 A;  4DFP A;  2RPI A;  2ZQB A;  1XHX A;  4CJS A;  1IKX A;  3AO3 A;  2IOC A;  1RTD A;  1VSK A;  1BIZ A;  3OYA A;  3DLG A;  5FRN A;  4JS5 A;  3WNF A;  4NCA A;  4CFA A;  3HP6 A;  2VG5 A;  1RT5 A;  2XY6 A;  4EP5 A;  4KTQ A;  2Q3S A;  1VSH A;  2VG7 A;  4KI6 A;  1NK5 A;  4RW8 A;  4KB1 A;  3V9S A;  2DFF A;  3VA0 A;  4J2D A;  3ISN C;  4CGI A;  5HLF A;  4W5R A;  4CHQ A;  4M41 A;  4FVM A;  4BDP A;  5I3U A;  4CJ5 A;  2Y1I A;  3NF9 A;  4H4M A;  1T03 A;  3SPZ A;  4LSL A;  4FLT A;  2YNF A;  2P5G A;  4N76 A;  3VQE A;  1WSE A;  3NH2 A;  4M3R A;  2D0A A;  1SL1 A;  1QS4 A;  1KFD A;  1IKV A;  4FW1 A;  3KIO A;  4E7K A;  5J2P A;  4CJQ A;  1VSF A;  1LAV A;  3K5M A;  3NF7 A;  3NGZ A;  4CE9 A;  3QEX A;  1S5J A;  4BAC A;  3H08 A;  3NAE A;  3L2R A;  2W42 A;  4PQU A;  1EX4 A;  1JL1 A;  1S9E A;  4BWM A;  3LZI A;  1L3T A;  4B9T A;  4CCH A;  4ELU A;  1S1W A;  2I5J A;  3QIP A;  3VQ6 A;  3LDS A;  1YTA A;  3ZT0 A;  3HPO A;  1X9S A;  1RIL A;  3QIO A;  4I2Q A;  1HNV A;  4OGE A;  4CJL A;  4N5S A;  1LW2 A;  3KLG A;  3KLH A;  4CK3 A;  3CQ8 A;  3RMC A;  1JLG A;  4Y1D A;  4RW7 A;  1Y97 A;  3M8Q A;  3HT3 A;  3VQ4 A;  1QSS A;  2BAN A;  3DLE A;  3LP2 A;  4CFB A;  3L2W A;  1WAJ A;  4J2E A;  4C8K A;  2E6M A;  4B9U A;  1KLM A;  1N5Y A;  4HUG A;  3P83 D;  4W5O A;  3VQ9 A;  4OLA A;  4E7I A;  2ITG A;  4RW6 A;  4E89 A;  1LWE A;  4HCC A;  3EZ5 A;  1S6P A;  3VQB A;  1EKE A;  1HMV A;  3DMJ A;  1RNH A;  1U04 A;  3HPG A;  4O5B A;  4DQP A;  2HVI A;  1C0T A;  2YV0 X;  3AO5 A;  5HRP A;  3DRS A;  3DRR A;  4UQG A;  3AVC A;  4DTU A;  5J2M A;  3RMD A;  3QEP A;  4FJJ A;  1J9A A;  3PX6 A;  3L2V A;  1A5V A;  4N56 A;  1B9F A;  1JL2 A;  5J2Q A;  1QSL A;  4OPK A;  4J2B A;  4AHT A;  4KHU A;  2IC3 A;  3B6O A;  3SJJ A;  3HL8 A;  2XY5 A;  4OKK A;  3S3N A;  2P1J A;  3JYT A;  3OYM A;  3OYF A;  1BI4 B;  3V81 A;  2E6L A;  2RN2 A;  2DTU A;  1RBR A;  5CZ2 A;  1JXB A;  1TAQ A;  1REV A;  3ZSZ A;  3OYE A;  1HNI A;  4E7H A;  1TK5 A;  4F8R A;  1L3S A;  5HP1 A;  2HHQ A;  4Y1C A;  4HHT A;  4JRQ A;  4ID1 A;  4DSE A;  3ALY A;  4CFD A;  5HRR A;  4KTW A;  1EET A;  2YNG A;  4CGG A;  2PZS A;  4AHU A;  3I0R A;  3O3F A;  1U49 A;  3K5N A;  2JGU A;  4FJM A;  4DLG A;  3V6D A;  3ITH A;  3DLR A;  2EX3 A;  4NYF A;  3OYG A;  2YHB A;  3OS2 A;  2PYL A;  4E19 A;  4KHW A;  2O4I A;  3A2F A;  4Z4G A;  4F3O A;  2IGI A;  4DS4 A;  3QER A;  4E0D A;  2LSN A;  1FK9 A;  3MEE A;  2VWJ A;  4ELT A;  2P51 A;  1TAU A;  4DFM A;  2QKB A;  3QLH A;  2Z1I A;  4QCL A;  3QEW A;  3TAF A;  5KI6 A;  4B8C A;  3HP9 A;  3DLH A;  3AO4 A;  3NGY A;  3AA2 A;  1S1T A;  4OKE A;  5C24 A;  4CF0 A;  4CJF A;  4CEE A;  2XRI A;  4W5N A;  4AIL C;  3SUP A;  4HCB A;  4M3U A;  4CJT A;  3T3F A;  4DF8 A;  1RDC A;  4Q5V A;  2G8K A;  4OGC A;  5HRS A;  3AVL A;  2X74 A;  4CHY A;  4W5T A;  1NOZ A;  4JS4 A;  4WE1 A;  3OS1 A;  3HVT A;  1TL1 A;  3KLI A;  2FBY A;  4RG8 A;  4DMN A;  4QOZ B;  1N6Q A;  1A5W A;  1BCM A;  1O1W A;  1CZB A;  1VSD A;  1BQM A;  4KTZ A;  4B9N A;  4Z4I A;  3HVR A;  1FKO A;  4E1N A;  1JXE A;  4KKO A;  1NKC A;  4DTS A;  4YFU A;  1NJZ A;  3OYK A;  2G8H A;  4OPJ A;  4DQQ A;  4OKJ A;  3NF8 A;  3P5J A;  5KGW A;  1KVC A;  1HYZ A;  4LY7 A;  3T1A A;  3ZT4 A;  4CK2 A;  4DFJ A;  2YKN A;  4DU3 A;  1VSE A;  5J1E A;  1FXX A;  2JLE A;  2HHW A;  1VSL A;  1U4B A;  1K6Y A;  4BE1 A;  4DU4 A;  1HJR A;  4C8M A;  4M3Y A;  3CM6 A;  4O0J A;  4E7J A;  4GVM A;  2Y1J A;  3NF6 A;  4KAZ A;  1TVR A;  3K59 A;  3F9K A;  1EP4 A;  2R7Y A;  1Q9Y A;  3L3V A;  3EYZ A;  3MXI A;  2HND A;  3PO5 A;  4F2R A;  1WAF A;  5DMR A;  4CGJ A;  3ZSY A;  1FKP A;  2B5J A;  1C6V A;  4KB0 A;  4I7F A;  1S9G A;  3SQ0 A;  1NK4 A;  1L3V A;  3KD5 E;  1S1U A;  1RT3 A;  1GOA A;  5KRT A;  3ZSO A;  3VQQ A;  1LWC A;  1NJY A;  3PX0 A;  1S6Q A;  4AHS A;  3SNN A;  4EP4 A;  3TAM A;  3OJS A;  4HUF A;  4RW4 A;  2G8U A;  4YNQ A;  1F21 A;  3P1G A;  4C8N A;  4FJ5 A;  4FCY A;  5FRO A;  2XHB A;  2Z1G A;  2IDO A;  3AVF A;  1KLN A;  4KI4 A;  4CHZ A;  1QE1 A;  3RR8 A;  1KRP A;  4B9S A;  2YHA A;  4FJ7 A;  4TSX A;  3TAR A;  4HTU A;  1Z25 A;  4FJ9 A;  3S3O A;  2P5O A;  1BQN A;  1TGO A;  2A1S A;  3OYH A;  3FFI A;  4CIE A;  3SQ2 A;  2EHG A;  4DQI A;  3QEI A;  1C1A A;  3HO1 A;  4ZTJ A;  1D9D A;  5C25 A;  3TAN A;  1QSY A;  5E41 A;  3AVK A;  4CFC A;  2X6S A;  3RTV A;  4LH4 A;  3TAP A;  4C8L A;  4M3T A;  2HNZ A;  3S9H A;  2VWK A;  3U3G A;  4N47 A;  4FM1 A;  2D0C A;  3F73 A;  3KJV A;  2HHU A;  2YKM A;  2HHS A;  4O4G A;  2KW4 A;  3OS0 A;  1RT1 A;  1SKW A;  1SUQ A;  4DS5 A;  4FLW A;  2ZD1 A;  4CHN A;  3LWM A;  4O55 A;  4MQ3 A;  1ZBU A;  4CHP A;  4DQS A;  1LWF A;  3C6T A;  3NCI A;  4FZX C;  4E7L A;  4BWJ A;  3SYZ A;  3HK2 A;  2ATQ A;  1RDD A;  2HNY A;  1ITG A;  1DLO A;  2FBX A;  3TR8 A;  1NK9 A;  4PUO A;  1Q8I A;  1UOC A;  2RF2 A;  4DSF A;  4FJL A;  4KHS A;  4M3Z A;  2F8S A;  1RDA A;  3CFP A;  3VQD A;  3DYA A;  2XY8 A;  2IAJ A;  2O4G A;  4XIU A;  5I42 A;  1VRU A;  4MFB A;  3IS9 A;  3IRX A;  1LW0 A;  2KTQ A;  2BE2 A;  2D5R A;  4DTJ A;  4Z4E A;  3TAE A;  3HST B;  1D5A A;  1L3U A;  2DFH A;  2PYJ A;  2OYQ A;  4OVL A;  4FK4 A;  3NBP A;  2HHV A;  4CGH A;  3OY9 A;  4C8O A;  3EY1 A;  1HQE A;  3ULD A;  2D0B A;  5J2N A;  1SKR A;  4O0I A;  4B9M A;  1UAX A;  1ZBL A;  3LPT A;  3VQ7 A;  3I0S A;  4IDK A;  4M45 A;  3LAL A;  3NGI A;  4FLZ A;  3V9Z A;  4HVJ A;  3QO9 A;  4ID5 A;  3LWL A;  2XY7 A;  4DSI A;  1DTT A;  4KFB A;  1G15 A;  5HRO A;  2DY4 A;  3SUO A;  1I39 A;  1SL2 A;  2BDP A;  4FLV A;  3O3H A;  5K14 A;  3PX4 A;  4PWD A;  3ZSQ A;  5JS1 A;  3LAM A;  1CZ9 A;  4IBN A;  1ZBI A;  1ZYQ A;  4KHQ A;  2F96 A;  1JLB A;  3L2U A;  3U3Y A;  3DRP A;  4NYN A;  3PUF A;  4CHO A;  4CJP A;  3ZSX A;  4Z0U A;  1ASU A;  3MEG A;  4CJW A;  3OJU A;  3K57 A;  1Q9X A;  4FXD A;  1HPZ A;  4Z4H A;  3KD1 E;  3KK3 A;  4JLH A;  3NH0 A;  3M8S A;  4DTM A;  2YNH A;  1SKS A;  4CEA A;  1U47 A;  4FZY A;  4NCG A;  4F4K A;  3LAN A;  4KHN A;  3OYN A;  1BL3 A;  4FJN A;  1WSF A;  3ASM A;  1YT3 A;  4K8Z A;  4K8X A;  1BCO A;  3ZSR A;  1IKY A;  3AVG A;  4KPY A;  2OA8 A;  2OPR A;  4F3T A;  2QXF A;  3SI6 A;  1VSJ A;  3VQA A;  3TAQ A;  3DM2 A;  4CJV A;  5SWM A;  1JLQ A;  3PY8 A;  4IFV A;  4GMJ B;  4RW9 A;  4CJR A;  4LD0 A;  4FJX A;  3SZ2 A;  3O3G A;  4M42 A;  3MEC A;  1NKB A;  4CER A;  5KTQ A;  4ELV A;  4GW6 A;  4FLX A;  3V1O A;  1S1V A;  1NOY A;  3AA3 A;  2KFZ A;  4FW2 A;  4KV8 A;  1RDB A;  4BE2 A;  1BHL A;  1WLJ A;  4FJ8 A;  1RT6 A;  2Z1H A;  1JLC A;  3KK2 A;  4CEZ A;  4CEB A;  2ZE2 A;  3M8R A;  4ZTF A;  2B6A A;  3RMA A;  4Q0B A;  3MXM A;  4KHY A;  4H8K A;  1QQC A;  3E01 A;  4CEQ A;  1JLA A;  3VQ5 A;  3QES A;  1KVB A;  2DFE A;  3V9X A;  2PY5 A;  4M3X A;  2BGG A;  3HPH A;  1A5X A;  3B6P A;  2OPQ A;  5DK5 A;  3VN5 A;  1ASW A;  1D8Y A;  2HVH A;  4CES A;  4CGF A;  1NK7 A;  4E3S A;  2IS3 A;  3L3U A;  4CJK A;  3O4N A;  1ASV A;  4H4O A;  3VQP A;  4CJE A;  2XO7 A;  3LP1 A;  1QHT A;  3ZSV A;  2WOM A;  3V9W A;  3QNN A;  5CY4 A;  3MXJ A;  1S1X A;  4BDY A;  4IKF A;  4B08 A;  4FLY A;  3TI0 A;  2RKI A;  1NK0 A;  3DOL A;  3JSM A;  5D3G A;  2F8T A;  4DQR A;  1QTM A;  3AVB A;  3SV4 A;  1NK8 A;  1RT4 A;  3KKR A;  1RT2 A;  4FYD A;  1IH7 A;  1T05 A;  1XWL A;  2ETJ A;  3M8P A;  3KLE A;  1T8E A;  4ZHR A;  3C95 A;  4DTN A;  1JLF A;  4CEO A;  1WSG A;  3HM9 A;  3QEV A;  3ZCM A;  1CXQ A;  4PY5 A;  2X6N A;  3OYI A;  1U48 A;  2GBZ A;  1VRT A;  4Z4C A;  1TK0 A;  1VSM A;  3K58 A;  1RBT A;  4AHC A;  5HRN A;  3V9U A;  2G8F A;  4EZ6 A;  4CF8 A;  1BIU A;  1RBU A;  3LPU A;  3C6U A;  3CYM A;  4PA1 A;  4CF1 A;  1JLE A;  1NK6 A;  3AVA A;  2HHT A;  1KTQ A;  4CEF A;  3CG7 A;  1RBV A;  3ZSW A;  4CK1 A;  4CF9 A;  4CIF A;  3NE6 A;  3DLB A;  4O44 A;  1C1B A;  4LH5 A;  3NH1 A;  1VK0 A;  3AVI A;  3D0P A;  5JS2 A;  4FM0 A;  3QNO A;  3SUQ A;  1SL0 A;  3TAG A;  2OZS A;  3PV8 A;  3SQ4 A;  3AV9 A;  3BDP A;  1LV5 A;  3C94 A;  1MU2 A;  1JKH A;  2E4L A;  4DF4 A;  3U6F A;  1NJW A;  1U45 A;  4DSJ A;  3V1Q A;  1X1P A;  1TK8 A;  3MAQ A;  4DTP A;  1TKX A;  3PO4 A;  4W5Q A;  4OJR A;  3SPY A;  1L5U A;  1WNS A;  1X9W A;  4B9L A;  1YVU A;  2HHX A;  1HRH A;  1J53 A;  3V4I A;  2OZM A;  4FJI A;  1KVA A;  3OYJ A;  3HYF A;  3ZT2 A;  4CIG A;  3MED A;  3QIN A;  3WNG A;  4AHR A;  4IG0 A;  1UA0 A;  2B4J A;  1KCF A;  1WSI A;  4E1M A;  3IG1 A;  3L2Q A;  3AVN A;  4I9L A;  3HXM A;  2QKK A;  1RTH A;  1RBS A;  4FLU A;  3IAY A;  4M3W A;  4DG1 A;  5KGX A;  1W9H A;  4CED A;  3K5O A;  1BIS A;  4CJ4 A;  3OYL A;  1UWB A;  3TWH A;  3V1R A;  2Z1J A;  3G0Z A;  3AO1 A;  3ZT1 A;  3RRH A;  4DSK A;  3DOK A;  1C1C A;  4NCB A;  1WSH A;  3ZT3 A;  4OLB A;  1LAW A;  4DLE A;  3K2P A;  1WN7 A;  1IKW A;  4IG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...