3VQDA

Hiv-1 in core domain in complex with 5-methyl-3-phenyl-1,2-oxazole-4-carboxylic acid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 49
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqdA00
1TKZA 3MXIA 3JSMA 3PX6A 3AVHA 3NF6A 4GW6A 4CJSA 4CEDA 2QXFA 1NJXA 5FRMA 2G8KA 1LWEA 1HYVA 2VG5A 4CE9A 1QQCA 3OS1A 2A1RA 1IKXA 1FKOA 3VQEA 4CJVA 4KPYA 1WN7A 3QNOA 3KJVA 3TARA 1S9GA 4FJKA 1JL2A 4I9QA 3AVJA 1GOAA 1HNIA 3DLGA 2Y1JA 1DTQA 4B9NA 3O4QA 3VQPA 2HHWA 1D5AA 4RG8A 4KREA 4OPKA 4DTRA 1KVBA 3PX0A 1KVCA 3IRXA 4J2BA 1IKVA 1N5YA 3L2WA 4CEAA 2OPQA 4M3TA 3HYFA 2YNFA 2YHBA 5HBMA 1KTQA 1QHTA 4FLZA 3RWUA 4XIUA 1UOCA 4N76A 1I39A 4FJNA 2ZD1A 4CEOA 1YT3A 3KK2A 3VQQA 3RMAA 1QSLA 3RRHA 2E4LA 3HSTB 4BWMA 3V9ZA 5C25A 1MU2A 1BQMA 1L3SA 4CJPA 3OYNA 1JLFA 1LWCA 3DLEA 3NGZA 2G8IA 4KFBA 3QNNA 1NKCA 4HCBA 3TABA 4AHVA 3VQ4A 4FJHA 1VRTA 3HM9A 4Z4HA 4J2DA 3NF7A 4CGHA 1BIUA 4MFBA 4KHSA 1S1WA 2YHAA 2YKMA 1LW0A 2YNHA 3P83D 3G10A 2KFZA 3LP1A 3DYAA 1EKEA 3ZT3A 4DG1A 2HNDA 2D5RA 5CZ1A 3ZT0A 4BDZA 1U49A 3AA5X 3NGIA 3G0ZA 4LD0A 3V9WA 3SQ2A 2FC0A 2Z1JA 4B9TA 3MAQA 4CHQA 2Z1IA 1GOBA 3TAPA 2PYLA 2ETJA 1I3AA 3QEPA 4CJTA 2A1SA 1RT7A 3AVGA 4NCBA 5HROA 3SQ0A 4OPJA 4FVMA 3O3GA 3F73A 1U45A 3T19A 4B9VA 4JLHA 3QIOA 3C6UA 5CYMA 1S1VA 2JLEA 4LSNA 4WE1A 5C42A 3V1OA 3M8PA 4QAGA 4FLUA 3QERA 4E7LA 4DSFA 2LSNA 1D9DA 2AJQA 4NYFA 3PO4A 4FZXC 4KRFA 4CHZA 3KIOA 3T3FA 5E41A 4DWIA 4CJEA 4M45A 2DFHA 1N6QA 4B9MA 4HCCA 1S5JA 1BCMA 3AA2A 4N47A 3V9SA 1HNVA 1YTAA 1SUQA 2ITGA 2WONA 4RW9A 1SL1A 2O4IA 1C6VA 2HHSA 3NH2A 4KAZA 1RDDA 2DY4A 2FBXA 1A5WA 3SUOA 4B9UA 3HP9A 3ULDA 2PY5A 2OPRA 1ZBLA 4B8AB 4CFAA 4PWDA 5CZ2A 3LZJA 5J2NA 4ZHRA 4L8RB 3SI6A 2Z1GA 2P5OA 4KB1A 3NH0A 2VG6A 3VQ6A 3MEDA 1LAVA 1HJRA 3CQ8A 1RT4A 4ELVA 1A5XA 1KVAA 3T1AA 4OKJA 2X78A 3AVCA 3VQBA 2HHQA 4M3UA 1J9AA 1RDCA 4DS5A 4CJ5A 1TKDA 1FK9A 3AVBA 4DTXA 1IH7A 4FM0A 1BL3A 2HNZA 1ASVA 2HMIA 3KD5E 2X6NA 4B8CA 4CEQA 3NH1A 3OYCA 1T8EA 4DTJA 3ITHA 2KTQA 3ZSOA 1Q9XA 2FBYA 2Y1IA 1Z26A 3EZ5A 1NK9A 1RDAA 5DK5A 3SUPA 4KI6A 1KSPA 1HYZA 4E1NA 1NJZA 2ZQBA 3OVNA 1VK0A 4AHSA 3NHGA 3K5MA 1KFDA 3DMJA 4HUGA 3TAEA 1RTDA 4IG0A 3ZSXA 3ZT2A 2XO7A 2D0AA 4C8OA 3IAYA 4CFBA 1NK0A 4PQUA 4CHPA 3HJFA 1SKWA 4FJ8A 2W42A 1XHZA 3VN5A 4CF8A 4DSLA 4IKFA 3OYLA 2HW3A 3ALYA 3K58A 1VSIA 1Q9YA 1VSDA 1Y97A 1T05A 4CJQA 3OYFA 2KQ2A 4I2PA 3LWMA 4F3TA 5HRRA 4PY5A 4YFUA 3L3VA 1NOZA 2RN2A 3TR8A 4CERA 4DU4A 1FKPA 1CZBA 1YVUA 3KK1A 3RMDA 3MXMA 2P1JA 3QEWA 3SV3A 5HP1A 2ATQA 1ZYQA 4KHWA 3AO4A 4FK4A 3S9HA 3NGYA 3KK3A 5KRSA 4HUFA 3O4NA 3ZSRA 3SV4A 2G8FA 4J2AA 1RILA 3V4IA 4BE2A 3LPTA 3QIPA 3RMCA 4KHUA 4BACA 2HB5A 1BHLA 4KO0A 1WAFA 4CK1A 3OYHA 3V1RA 3LZIA 4CF1A 2YV0X 1VSFA 1ZBHA 4C8LA 1WAJA 4RW4A 2XY6A 2YKNA 2HHVA 1ASWA 3V1QA 4FZYA 4CECA 4CGDA 1JKHA 2NUBA 3VQDA 1ZBIA 5CY4A 4CJLA 4FJMA 4KHNA 3SUQA 4QOZB 1BGXT 3SQ4A 4AHUA 4CEBA 2KZMA 4KTZA 2XY5A 1NK7A 3DOLA 4F2RA 4NYNA 1WSEA 2BE2A 1EXQA 1TK0A 3SYZA 1S6QA 3AO5A 3LP3A 1TAQA 3AO1A 3ISNC 2PYJA 3PY8A 4FJ7A 4TSXA 3ZT4A 1CLQA 4CCHA 1L3TA 3BGRA 3LP0A 5J2QA 2ZE2A 4KTWA 1T03A 3ZSVA 3CM6A 3U6FA 4AHRA 1EP4A 2Z1HA 4Z0UA 4DLEA 4EP4A 3B6OA 5FRNA 1TKXA 1X9SA 4EZ6A 4QCLA 3DRPA 1B9FA 4FJJA 2XY8A 3AVAA 1RBVA 1UA0A 4Z4GA 3QEVA 4O44A 4DTOA 4B9LA 3DRSA 4FM2A 4HTUA 1EETA 4W5QA 4CHNA 1CXUA 4FLVA 1S6PA 3VA0A 1KFSA 4M3RA 4NCAA 1B92A 1ZBFA 3IG1A 3AVMA 3B6PA 4CJRA 4CEFA 1NK6A 1TAUA 3HVTA 4DQSA 1QTMA 1J54A 2XY7A 1CZ9A 4CJ4A 3VQ8A 4J2EA 2E6MA 4F8RA 4NCGA 2G8VA 3AO3A 3ZSYA 3TWHA 2HHTA 1TV6A 4AH9A 3VQ7A 4DTUA 5I3UA 5EU7A 4OLAA 3M8SA 1WSJA 3MEGA 3K59A 4CEEA 3CM5A 3QESA 1RDBA 1RBSA 4DS4A 1XI1A 1X9WA 1RCHA 3L2VA 4OKEA 2E6LA 1L3UA 4Z4FA 1HRHA 3E01A 3KLIA 3AA3A 1TVRA 2QK9A 1IO2A 1SV5A 5JS2A 4KHYA 2PZSA 1JLQA 3L2QA 1BI4B 1WNSA 4B08A 2X6SA 3AVFA 4AHTA 3CFOA 1U48A 2IDOA 1VSLA 4DTNA 2DFEA 1WSHA 3LDSA 1VSEA 5J2MA 4ELUA 3HP6A 4KKOA 3C6TA 1ASUA 4RW8A 2R7YA 3DLBA 4O5BA 4CEZA 2HVIA 1KLMA 4JRPA 1IKYA 4JS4A 3OYKA 2B6AA 4HHTA 3L2UA 4UQGA 1NJYA 4W5TA 1NKBA 1VSJA 3VQ5A 1R0AA 3K57A 2IOCA 3LP2A 3TAFA 2D0BA 3THVA 4FM1A 4O55A 3L3UA 4DF8A 2KFNA 1IG9A 3AV9A 1JXEA 1JXBA 4CF9A 5KRTA 4C8KA 1JLAA 3DM2A 2F8TA 2EHGA 3P5JA 4HUEA 4DFPA 1GOCA 4N5SA 3AVIA 4OGCA 3K5NA 2X74A 3WNGA 2FBVA 3S3NA 3NBPA 3V6DA 2GV9A 3QINA 4LH4A 4Y1CA 3VQ9A 4OVLA 4CJFA 1NKEA 2GUIA 4BE1A 3QEXA 3KLEA 4CJUA 2F96A 3QO9A 4Z4CA 3HT3A 3NE6A 2P51A 3DI6A 3LPUA 4IG3A 4O0IA 4DFMA 1VSMA 1RT1A 2OPPA 4MQ3A 4CGGA 3NDKA 4JRQA 4C8MA 4E7HA 3ASMA 2HVHA 4CGFA 4FLWA 1NOYA 3QLHA 3NF9A 1BQNA 3HXMA 3HPHA 1UWBA 4JS5A 4AILC 2P5GA 4DQPA 2DTUA 1C0MA 4FZZA 4CF2A 3SZ2A 4KHQA 2KZZA 1J53A 2OZMA 1C1CA 4FLYA 4G1QA 3KKSA 4IBNA 1J5OA 1NK4A 3S3OA 1LW2A 3K5LA 1XHXA 1WLJA 3OYEA 1VSHA 3DLKA 4IFYA 3SUNA 4FK2A 4F3OA 1NJWA 2DFFA 4ID5A 4M3WA 2RKIA 4Y1DA 4FJGA 1B9DA 4CHYA 5CYQA 2G8WA 1HQEA 5HRPA 3PX4A 3WNEA 3JYTA 4R5PA 3TAQA 3HK2A 1L5UA 5KGXA 2BANA 2IS3A 3A2FA 3LANA 1BIZA 4FXDA 3SPYA 1WSGA 4DF4A 3S3MA 3EYZA 4CJKA 3HVRA 3AO2A 4FW1A 2WOMA 1SKSA 3OY9A 3RMBA 2HNYA 5HLFA 4KTQA 1HMVA 4DQRA 5J2PA 3SQ1A 1HYSA 5T7BA 4W5OA 3I0RA 1RTIA 3TAGA 3TI0A 3QETA 3ZSZA 3IS9A 3NF8A 1IKWA 1JL1A 1NK8A 5HRSA 2BDPA 4FJXA 4E3SA 1LWFA 1REVA 4AHCA 4CIGA 5K14A 1JLEA 4OKKA 4ICLA 1RT6A 2YNIA 4M3XA 1Q8IA 1VSKA 1WSFA 4F2SA 2EX3A 5FROA 3OJSA 3KTQA 3RTVA 3FFIA 4HVJA 1JLBA 4DTSA 3SCXA 4Q5VA 3DRRA 4FLTA 4DSEA 4I2QA 4K8ZA 4LH5A 4N56A 1RT2A 1W0HA 3EY1A 1C0TA 4DQQA 5JS1A 3OYJA 2IGIA 4DU1A 1HQUA 1HPZA 3RR7A 4M3ZA 3DLHA 4FCYA 1QS4A 1F21A 1RTJA 2QKBA 4B3OA 4ELTA 2Q3SA 4RW7A 3OYMA 4OGEA 5I42A 4F4KA 4H8KA 1XWLA 4I9LA 1RBTA 3CYMA 4W5RA 3H08A 4E7IA 4YNQA 3I0SA 2FBTA 3KD1E 4W5NA 3CG7A 1T7PA 2QKKA 4LY7A 4DMNA 3VA3A 1TGOA 4ZTFA 4DTPA 1RBUA 1S1TA 4BWJA 1SL0A 4BDPA 5C24A 4FJ9A 3PUFA 4E7KA 1UA1A 4M41A 3OYAA 1FXXA 3RR8A 4FLXA 3LALA 2G8HA 4I7FA 3OS2A 3CFRA 4BDYA 4FK0A 2VG7A 5D3GA 1D9FA 1NK5A 1DLOA 4DSKA 3I8DA 2F8SA 3LWLA 5KI6A 4Q0BA 4N41A 3QEIA 1WSIA 5DMRA 1YTUA 1W9HA 5SZTA 4BE0A 3K2PA 4E19A 3O3FA 3D0PA 3OJUA 3SNNA 4DQIA 3HL8A 3L2RA 1C0UA 2XRIA 3U3GA 1S1UA 1XC9A 3TAMA 1X9MA 1KRPA 4DSIA 2JGUA 4PA1A 1A5VA 1KCFA 4E1MA 4B9SA 3CFPA 2HHUA 3NFAA 3PO5A 2VWKA 4EP5A 3HO1A 1G15A 4CGJA 4Z4IA 3SPZA 4EZ9A 3TANA 4C8NA 3ZT1A 3UIQA 2OPSA 2VWJA 3M8RA 3LAKA 3U3YA 1BI4A 4FW2A 1TL1A 3WNFA 4LSLA 3D45A 2KW4A 1TK5A 2RF2A 1JLCA 4PUOA 4GMJB 3PV8A 3P1GA 3VQCA 5HRNA 4CJ3A 1K6YA 3SJJA 1RT3A 4IFVA 3K5OA 4CFCA 4ID1A 1JLGA 1UAXA 3LAMA 4E0DA 3ZSWA 3OYGA 1L3VA 1QSSA 1D8YA 1ZBUA 1RBRA 1CXQA 4ZTJA 3AVLA 4OLBA 1U4BA 3M8QA 4IDKA 2B5JA 3NAEA 4DTMA 3BDPA 4CK3A 3HPOA 2B4JA 4CIFA 4H4OA 4OJRA 2D0CA 2YNGA 4H4MA 5J1EA 3AVNA 1SL2A 4CESA 4FJIA 2OZSA 4Z4EA 5SWMA 3OS0A 2BGGA 3MEEA 3O3HA 3VQAA 2IC3A 1RTHA 4CGIA 4CIEA 3L8BA 1SKRA 1RNHA 2XHBA 4M3YA 2HHXA 3ZCMA 4KI4A 4K8XA 1U47A 1QE1A 4E7JA 1C1AA 3KLHA 4DLGA 4O0JA 1QSYA 2G8UA 4CJWA 1TKTA 4FJLA 3V9XA 1LV5A 1ITGA 3ZSQA 1Z25A 3F9KA 1O1WA 4DFJA 1DTTA 3AA4A 4O4GA 2O4GA 3C94A 3KLGA 1TK8A 3RRGA 4CHOA 4DFKA 1S9EA 1RT5A 4GVMA 4KV8A 3MXJA 3V9UA 1BISA 3V81A 3OYDA 4DSJA 1U04A 2RPIA 1EX4A 3C95A 1BCOA 4CK2A 3OYIA 1KLNA 4KB0A 3KLFA 3DLRA 3WNHA 5KGWA 4E89A 2IAJA 1C1BA 3OYBA 1LAWA 2OYQA 5KTQA 4FJ5A 4RW6A 2OA8A 3HPGA 3DOKA 1S1XA 2GBZA 2I5JA 4DU3A 4M42A 3KKRA 1X1PA 4CFDA 1TL3A 3NCIA 3MECA 3AVKA 4FYDA 5FDLA 1VRUA 4CF0A
chains in the Genus database with same CATH superfamily
3MN7A 3MXIA 3JSMA 5AQGA 4IJAA 2QWOA 3NF6A 4CEDA 2O8CA 1LWEA 5AQZA 1IKXA 3THYB 4CJVA 1OH7A 4KPYA 1WN7A 3QNOA 3TARA 2OTLN 3WXMB 1VQMN 1DTQA 3O4QA 3CCUN 4KREA 3IRXA 1IKVA 3MK6A 5LJVA 5M1FA 3AAPA 4DUYK 2QWMA 1UOCA 5JLFA 4CEOA 1YT3A 4BR4A 2UUAK 3RRHA 1VQKN 2E4LA 1YVNA 3V9ZA 3KWGA 4CJPA 3OYNA 1LWCA 3DLEA 5AQLA 3NGZA 4AHVA 3VQ4A 4BVOA 2ZJRL 1QQNA 2HNDA 4DR4K 5CZ1A 3ZT0A 1U49A 5IT9O 2Z1JA 3MAQA 4QS8A 3G4SN 2A1SA 3TTFA 3T19A 3C6UA 5C42A 3M8PA 3QERA 2BUPA 5KPRA 2AJQA 4NYFA 3SLCA 4JI1K 3T3FA 5E41A 4DWIA 4HCCA 5BPNA 3N4QA 4B9MA 1S5JA 1BCMA 3AA2A 1HNVA 2ITGA 2HHSA 1SL1A 3CCLN 1C6VA 4KAZA 3VEZA 2RE2A 1HPMA 1A5WA 4B9UA 3ULDA 5J2NA 1BO5O 4MLHA 4KB1A 5GIPA 2P9IA 1HJRA 1KVAA 3T1AA 2X78A 1J9AA 1RDCA 1RDUA 3ZX3A 2D1KA 4MO4A 4FM0A 2HBLA 2HMIA 3KD5E 4H5TA 3OYCA 4DTJA 3KWIA 1VQPN 2Y1IA 3EZ5A 1NK9A 3MCAB 5DK5A 4BRAA 4E1NA 2ZGZA 3OVNA 3K5MA 3NHGA 1KFDA 3DMJA 3GL1A 3TPQA 4CZEA 3THXB 3I33A 4FWLA 4BRMA 2D0AA 4CFBA 4B9QA 4CHPA 1GLFO 1HX1A 4PKIA 2GUPA 3HM8A 4H0OA 4LC9B 4KH6A 3CERA 1VSIA 1W7AA 5LMUK 4CJQA 4I2PA 4YDUA 2RN2A 3ATUA 1BU6O 3VGKA 1ZYQA 3S9HA 3KK3A 4HUFA 3SV4A 3ZSRA 1RDWX 4KHUA 3ZX0A 3R3LA 2O8BA 4BACA 2O8CB 5EXWA 1WAFA 2E8AA 1XMOK 2W41A 2YV0X 1VSFA 4BR0A 3TTCA 4C8LA 4PKHA 4CGDA 2NUBA 1YXQA 4CJLA 4FJMA 4A59A 1QQMA 4QOZB 4CEBA 2QW9A 4X62K 2XY5A 3CI5A 1NK7A 3GDQA 1U2VA 2A41A 5MLCQ 1S6QA 3B8AX 3K9JA 3CETA 3ISNC 5GIOA 4KHPK 4H0TB 4TSXA 1IBLK 3EKUA 3K0SA 3VETA 3LP0A 1MDUB 2ZE2A 1T03A 1SAZA 1EP4A 3ZEUB 3NVKA 4JKBA 4EP4A 4QCLA 4ILGB 4FWQA 3LDOA 4FOIA 2KHOA 1NMDA 3QICA 2A42A 4B9LA 1LOTB 4HTUA 3U9DA 1EETA 4FLVA 2D0OA 3VA0A 1S6PA 3VF4A 3L4QA 1ZBFA 1TAUA 1QTMA 1CZ9A 1D4XA 4CJ4A 3VQ8A 4J2EA 1QZ6A 3AO3A 3ZSYA 1TV6A 4AH9A 3VQ7A 5EU7A 4ISGA 3MEGA 3SK3A 4IO8A 2QTDA 1X9WA 4DS4A 1XI1A 3AA3A 1TVRA 4KHYA 3L2QA 1BI4B 1WNSA 1BUPA 1U48A 2IDOA 4HTLA 4ELUA 1VSEA 4WYBA 3HP6A 3C6TA 4NXNK 2HHHK 4RW8A 4BR9A 3DLBA 2QWNA 4CEZA 1IKYA 4JS4A 3H6EA 2WBNA 4W5TA 1VSJA 1YUWA 3Q7BA 5ELZA 3TAFA 4IEIA 3O9UA 3L3UA 4CZKA 2F4VK 2KFNA 3AV9A 5TKWA 3C6HA 5KRTA 3AARA 1I94K 5C10A 3P5JA 1GOCA 3K5NA 2FBVA 3RVCA 3NBPA 3V6DA 3S3NA 3QINA 1LCUA 4LH4A 4JI5K 4EAHD 3ULEA 4CJFA 4JK8A 3PIPL 2GUIA 4X66K 5M1NA 4DV6K 4DR6K 4GV6A 4Z4CA 4O0IA 4L3QA 4E7HA 4JKCA 4C8MA 2HVHA 4CGFA 4FLWA 2O8DB 3E9OA 1Q18A 3NF9A 1BQNA 4IZ9A 5FPMA 2O8EB 5AQFA 4AILC 2P5GA 4FZZA 2KZZA 3RSEB 4G1QA 3KKSA 4DV3K 3CQXA 2EWSA 1KAZA 1XHXA 4LFAK 1WLJA 3OYEA 4FK2A 1NJWA 4M3WA 4Y1DA 2GELA 3PX4A 4R5PA 4CZIA 1YIJN 3CJ1A 4JKDA 4BRLA 3AO2A 2O8BB 2YJFA 4DV4K 4W5OA 2ZWHA 1E4GT 3ZSZA 1JL1A 5F2RA 1Q82O 1LWFA 5K14A 1JLEA 3WXJA 1RT6A 3H3OB 2EX3A 5F1XA 4K25A 5FROA 3J7YP 4DV0K 3TSQA 3WQUA 3GOIA 3EL2A 1JLBA 2NRTA 4FLTA 3DRRA 2P9PA 3SCXA 4K8ZA 1RT2A 2O8FA 4DQQA 5JS1A 4DU1A 3DLHA 1VQ4N 4GKJK 2NRXA 1RTJA 4B3OA 3OYMA 2IVOA 1NU0A 1XWLA 4I9LA 1RBTA 4E7IA 4YNQA 4M7YA 2YHWA 4Y0WA 5AZIA 1TGOA 3L0QA 4ZTFA 3C7NA 1K73O 4DTPA 3CCJN 2YHYA 1KXPA 4WQ4C 4E7KA 4FLXA 4I7FA 4DB3A 3OS2A 2VG7A 3BZKA 4Q0BA 3EKSA 3QEIA 2V7YA 3KK7A 2NLXA 4E19A 3O3FA 3OJUA 4DQIA 1S72N 1XC9A 3TAMA 1KRPA 3D6RA 2CH6A 4XH4A 2E1ZA 2GX9A 3IUCA 4EZ9A 4BR5A 3ZT1A 2JWKA 3U3YA 2QEXN 1TL1A 3BY5A 3K9KA 4RWTA 4BC4A 1EWQA 2KW4A 3PLAA 4PUOA 4QS9A 1K6YA 5JMVA 2HBMA 3OTOK 1RT3A 3N4PA 3K5OA 1M90O 3A0IX 4CFCA 5AQSA 4EHUA 1JLGA 3ZSWA 3OYGA 1QSSA 2Q2RA 4ZTJA 3AVLA 3NAEA 2B5JA 3BF3A 4H5VA 4JI3K 3AVNA 2QWQA 3P38A 2J4RA 3OS0A 4WQ5C 4CIEA 1SKRA 3ULEB 4Z94A 2QA4N 4BC5A 1QE1A 3KLHA 3HI0A 3SJHA 4EHTA 4FJLA 3V9XA 1LV5A 1ITGA 3CJBA 3F9KA 4DFJA 2H3GX 3C94A 3RRGA 1S9EA 3D7EO 4KV8A 3BUZB 1BISA 3OYDA 1EX4A 3C95A 5AZJA 1KLNA 2NRHA 2HBKA 3KLFA 5KGWA 4K42A 4E89A 1C1BA 1LAWA 5C12A 4GV9A 4FJ5A 3DOKA 2I5JA 2GBZA 4M42A 3KKRA 4CFDA 3NCIA 3ID8A 5BN8A 5FDLA 4CF0A 1Q86O 3CHWA 3AVHA 4CJSA 1X9JA 5FRMA 4YHHK 3H1QA 5BN9A 1S9GA 2Y1JA 1ATSA 2V7ZA 1HR0K 4RG8A 2UXCK 1YJ9N 4J2BA 2QXLA 1N5YA 2P9PB 3O8MA 3HYFA 2QWRA 1BG3A 4FLZA 4N76A 3O9SA 2WTUA 3RMAA 3LDNA 3HSTB 4BWMA 5AFUH 5EOYA 1JLFA 4HCBA 4KH4A 3ZETA 4AM6A 3LM2A 1VRTA 3HM9A 4OPHA 4J2DA 1BIUA 5GAEP 2YHAA 2YNHA 5ADXA 3G10A 3LP1A 2D5RA 1RGIA 1YF5L 3SQ2A 3NGIA 1T44A 2FC0A 3SBTA 3TAPA 2PYLA 4JI7K 3ZX2A 1RT7A 4NCBA 5HROA 3CCMN 4AQYK 3SQ0A 4FVMA 3QIOA 2JLEA 4WE1A 1BA1A 1S3XA 2ITMA 3PO4A 4H03B 3E66A 2F9TA 3KIOA 2P9NA 4CJEA 4M45A 2DFHA 4BRNA 4JV5K 1YTAA 1SUQA 4NO7A 1NGJA 1RDDA 2FBXA 3A5LC 3HP9A 1VQLN 1ZBLA 4H5NA 4CFAA 5CZ2A 3MX2A 5GADP 2P5OA 2VG6A 1A5XA 1FJGK 4K41A 4M3UA 4DS5A 1TKDA 5EX5A 3AVBA 3LM9A 1BL3A 4JD2B 4CEQA 3ITHA 4DR2K 2YHXA 1Q9XA 1W97L 2FBYA 1NBWA 1OH6A 4BC2A 3PSIA 1NMNA 5GAGP 1RTDA 4IG0A 4H0VB 3ZSXA 3ZT2A 2XO7A 1NK0A 4LF7K 3CJCA 4FJ8A 2AP1A 2UYTA 3LL3A 3ALYA 5AZJB 3K58A 1Q9YA 3OYFA 2Q1NA 2KQ2A 5M1OA 5C15A 4MDAA 3J7AP 3SBGA 3L3VA 1NOZA 1NLVA 2FF6A 1QVFM 1FKPA 4WQ4A 1K8KA 1YVUA 3KK1A 3ENOA 3QEWA 4KHWA 4OX9K 3E1YA 3ZYYX 5KRSA 2W40A 2G8FA 3JAMO 4BE2A 4DR3K 4JI6K 5BPLA 3LZIA 4BR7A 3W0LA 4B1ZA 3CC7N 1WAJA 4RW4A 2XY6A 3MWPA 4FZYA 1ILYA 4B1VA 1ZBSA 3VQDA 2UXDK 3EE8A 3SUQA 5I9EB 2KZMA 2FF3B 4F2RA 3DJCA 4FJ7A 1TAQA 1OVQA 5AQWA 2PYJA 3F5TA 4YOWA 1IBKK 3WQTA 4Z0UA 4DLEA 2HMPA 3ZLJA 2DPNA 4YORA 3QBXA 1TKXA 1X9SA 4H0XB 3DRPA 4FJJA 2XY8A 3AVAA 3ZETB 4Z4GA 4EIAA 2NRVA 4DTOA 4LF9K 3DRSA 4W5QA 4FO0A 1KFSA 2P9UA 4WQ5A 4IOAL 3AVMA 4CEFA 1HKCA 2NRRA 4BREA 5BRHA 3TWHA 3WXIA 2ZJPL 3UKRA 1QZ5A 4OLAA 1WSJA 4CEEA 3ENHA 1L3UA 1HRHA 1GLDG 5JS2A 5IWAK 3VF6A 3CFOA 2P9NB 1YJWN 1VSLA 4DTNA 3LDSA 2R7YA 4O5BA 1V4TA 4BGBA 4EFHA 3OYKA 3L2UA 1NKBA 1R0AA 3CF5L 4DV7K 3LP2A 2D0BA 5AQYA 3SAFA 4DF8A 1JXBA 4CF9A 4C8KA 3WEEA 3DM2A 3GG4A 1H1VA 4DFPA 3QB0A 2X74A 1OVYA 4Y1CA 1NKEA 3DLLL 1Y64A 1Z6RA 4CJUA 2F96A 3EO3A 4LF5K 3QO9A 1NGAA 2FLOA 4IG3A 4A5AA 3NDKA 1RT1A 2OPPA 4CGGA 3O08A 1QQOA 5B8HA 5AJ3K 2FSKA 3QMLA 4JS5A 2DTUA 4JKGA 1N33K 1DEJA 3MCPA 4CF2A 4JEPA 1J53A 2OZMA 4IBNA 1J5OA 3DWLA 1NK4A 3S3OA 1LW2A 3K5LA 3VESA 4FOEA 2DFFA 3VOVA 3MDQA 4B1UB 3WUHA 1B9DA 4CHYA 5CYQA 2G8WA 5HRPA 4YY3K 3HK2A 5KGXA 1VQ7N 2KKZA 3CD6N 2VYPA 3A2FA 3LANA 1BIZA 2P9SA 4FXDA 4DF4A 3H3NO 2D4WA 4O8KA 4FW1A 4KTQA 3M6GA 3OY9A 2HNYA 4B3MK 5J2PA 3G71N 3SQ1A 3EN9A 1N34K 3QETA 3O9TA 1NK8A 3NF8A 1P90A 2BDPA 5HRSA 4E3SA 1NGCA 1WUAA 3QFUA 4DR7K 4OKKA 1Q8IA 4A57A 3FGUA 3KTQA 3RTVA 4IJNA 4Q5VA 4I2QA 1W0HA 3KZBA 3EY1A 1HNXK 1TUYA 2F7TA 4M3ZA 1QHAA 4GV3A 1QS4A 2QKBA 1ESVA 1KC8O 2ZF5O 5CR4A 4RW7A 4BRCA 4W5RA 3H08A 3KD1E 4DR1K 4DMNA 4JHDA 5BRDA 2WC9A 3R9PA 1SL0A 3MN5A 4M63C 3CFRA 4BDYA 2P9UB 5D3GA 3QDKA 4DSKA 4CZHA 3I8DA 3LWLA 3NMUA 1YTUA 1NG9A 4BY9C 1HKBA 5SZTA 1TYQA 3A5OC 1KD1O 3UKRB 5FPNA 2ASMA 3SNNA 4YOYA 3L2RA 1X9MA 1X3MA 4E1MA 3CFPA 2HHUA 1G15A 3KVGA 4CJ7A 3M3ZA 3M8RA 3WNFA 4LSLA 4AM7A 4LF4K 1XNQK 4GMJB 4WFAL 2P9IB 5HRNA 3SJJA 4IFVA 1S22A 2NRZA 2VCPA 4ID1A 3LAMA 1ZBUA 2IIRA 4BRKA 3M8QA 4IDKA 1U4BA 1NGBA 4F9OA 4CK3A 3HPOA 4OJRA 1KQSM 5J1EA 1SL2A 4FJIA 1VQ6N 4M7XA 4Z4EA 5M1KA 4JK9A 1TUUA 3MEEA 3VQAA 3L8BA 1RTHA 3UKUA 2W6LA 1GLEG 3SAGA 3H1VX 4DLGA 1QSYA 1TKTA 3R1XA 3MMVA 4DCHA 1HNZK 1Z25A 4PL7A 3AA4A 4O4GA 4B3SK 3KLGA 1TK8A 4JKGB 1RT5A 3VEXA 3MXJA 1BCOA 4WFBL 5AQQA 2E2QA 3VTIA 3GBTA 2I7PA 2OA8A 2P9LA 1BOTO 1X1PA 4MLEA 4DV2K 4FYDA 3OBYA 1YAGA 1MWKA 3VEYA 3PX6A 2P9SB 4H0PA 4FVUA 4JN4A 3CCEN 1HYVA 3TSUA 3OS1A 2A1RA 3VQEA 4GKKK 1JL2A 4I9QA 2Q31A 1HNIA 1U2VB 3DLGA 4B9NA 3O9QA 1D5AA 4OPKA 4DTRA 1KVBA 3R6MA 1KVCA 2YX6A 3L2WA 4CEAA 4M3TA 5HBMA 1KTQA 1QHTA 4XIUA 1I39A 2ZD1A 1NGIA 3KK2A 2CGKA 2FXUA 3U4LA 3KHYA 1MU2A 5AQIA 4FWPA 4OPAA 2G8IA 4KFBA 3QNNA 1NKCA 1HUXA 3TABA 2A5XA 4ISFA 1ATNA 5AQVA 2PAVA 2NZTA 3NF7A 4MFBA 4B1XB 2YKMA 3P83D 3ZT3A 1EKEA 4DG1A 2BH1A 4U7BA 4BDZA 2OANA 4A2AA 4NXMK 3V9WA 4QS7A 4CHQA 1E4FT 5AR0A 2ETJA 1I3AA 3QEPA 3C0BA 3AVGA 4OPJA 4B9VA 5CYMA 4LSNA 3VERA 1YI2N 1BDGA 3V1OA 4QAGA 3CJAA 1KAXA 4FWSA 3IFRA 4K43A 4FZXC 4KRFA 4MDBA 4C1NI 2UXBK 5AQPA 1MA9B 1N6QA 2CGLA 1JCGA 3V9SA 4N47A 1EWRA 2WONA 3O4WA 4RW9A 3THWA 4B1YB 4BRQA 1XMQK 1VHXA 2OPRA 3DXMA 4B8AB 4PWDA 4L8RB 2Z1GA 3NH0A 3VQ6A 3MEDA 1LAVA 3CQ8A 3CCSN 3VQBA 2FSNA 3AVCA 4CJ5A 1FK9A 1HNWK 2HNZA 1ASVA 4GNIA 2JWLA 3NH1A 1T8EA 5GINA 1K9MO 4DR5K 3ZSOA 3UKUB 3T69A 3D2FA 1Z26A 4R79A 5JVGL 2I7NA 1Q7YO 4KI6A 1NNEA 1VK0A 4HUGA 3TAEA 1NJIO 2E2OA 5LY3A 3IAYA 4IOXA 3R8EA 1WBDA 4FPAA 1YJNN 3HJFA 1XHZA 4BROA 4DSLA 4IKFA 3OYLA 1OKJA 3E9LA 1N32K 2HW3A 1Y97A 4A5BA 1T05A 3VGLA 3LWMA 5HRRA 2P9LB 3TR8A 4ISEA 4CERA 4DU4A 4XEIA 1CZBA 3RMDA 3MXMA 2P1JA 2YI1A 5HP1A 2E88A 1ATRA 4FK4A 5KPTA 3BP8A 3O4NA 1WBBA 4J2AA 1RILA 1SZ2A 3LPTA 2ASOA 3IDHA 1XQSC 1BHLA 4KO0A 4CK1A 1JCEA 3V1RA 1QVGM 2YKNA 2HHVA 3THYA 5EVZA 1ZBIA 1JKHA 5CY4A 1JCFA 4KHNA 2VWBA 2O8FB 4E1JA 1BGXT 3SQ4A 4AHUA 3FZHA 3DOLA 4NYNA 3HTVA 1WSEA 1TK0A 5TKYA 3AO5A 3AO1A 3PY8A 2A3ZA 3ZT4A 1CLQA 4CCHA 4JI0K 3BGRA 1GLBG 3ZSVA 3CM6A 4AHRA 5AZIB 3T7ZA 1RFQA 1OH8A 2ZM6K 2PBDA 2Z1HA 2ZGYA 3C7NB 5AQUA 4CW7B 5H1SQ 5FRNA 3J81O 1B9FA 5FLXO 1UA0A 1RBVA 5AQXA 3QEVA 4O44A 2Q97A 3G6EN 4M3RA 4NCAA 4IO9L 3HVTA 1J54A 2XY7A 4LF6K 3EZWA 4NCGA 3CIPA 4DTUA 5I3UA 4LF8K 3VF2A 3CM5A 1RDBA 1RBSA 1RCHA 4OKEA 2E6LA 3E01A 3KLIA 2QK9A 4IEEA 3MN9A 4B08A 5CE3A 2X6SA 4AHTA 4IXCA 5ADXH 2DFEA 1G99A 3CJ7A 3THWB 1ASUA 2Q0RA 2HVIA 4O8UA 3QFPA 4IFEA 3DXMB 2B6AA 4UQGA 4C23A 3VQ5A 2IOCA 2BTFA 4CD1A 3D2EA 4CZGA 3THVA 4O55A 2YJEA 1JXEA 2OCEA 1NM1A 2F8TA 3E9PA 2EHGA 2A6AA 4OGCA 3WNGA 2GV9A 4CVNE 4RTFD 4U67L 1NGHA 3CXCM 3G25A 3OA9A 2HF3A 4BE1A 3QEXA 3D2FB 5C2DA 3NE6A 2P51A 3DI6A 3HSCA 4H0YB 4JRQA 3HO1A 3LDQA 3ASMA 1Z05A 3EE9A 3QLHA 3HXMA 3HPHA 1VQ9N 3WXLA 1C1CA 4FLYA 5AQOA 2UUCK 4IFYA 3SUNA 4JK7A 4F3OA 3MX5A 4ID5A 2RKIA 4FJGA 5AQTA 4ILHA 1HQEA 3C65A 3TAQA 1L5UA 4MO5A 2PFUA 2BANA 2IS3A 3SPYA 5JICA 2KLAA 3O9RA 3LDLA 2WOMA 1SKSA 5KQ8A 5HLFA 4DQRA 1HYSA 1U6ZA 5T7BA 2NRWA 1RTIA 3VEWA 3TAGA 3TI0A 1IKWA 2F9WA 4FJXA 1REVA 4H5WA 4RCHA 4KH5A 4YOXA 4ICLA 2YNIA 4M3XA 4UY8O 1VSKA 1WSFA 4CBWA 4F2SA 2E20A 5HOOA 2HOEA 4BGAA 3FFIA 4HVJA 4BRFA 1IBMK 4LH5A 1C0TA 1ZXOA 2IGIA 1HPZA 3P4IA 4PL8A 3RR7A 1F21A 3JS6A 2Q3SA 3FZMA 5I42A 4H8KA 2IVNA 1DT9A 3VGMA 5C2FA 4WF9L 2FBTA 4DHYA 1J5EK 1MWMA 1T7PA 4LY7A 3VA3A 3ZEUA 3P39A 1GLCG 4JI8K 2CGJA 1S1TA 4BWJA 3FZKA 4J8FA 4FJ9A 1UA1A 4M41A 3OYAA 1FXXA 4ILJA 2G8HA 2ZJQL 4O5FA 4FK0A 5DM6L 3HOSA 1VQON 1NK5A 1DLOA 5AQJA 1XUPO 2V52B 2F8SA 3A5MC 5KI6A 2E2NA 4N41A 5DMRA 3ID6A 1W9HA 5BR9A 3TSPA 1T6DA 3K2PA 3D0PA 4FWOA 5CHIA 5GAHP 1YHQN 2XRIA 1S1UA 2JGUA 4PA1A 4B9SA 5KQDA 1WOQA 3NFAA 2VWKA 4EP5A 3L6QA 4DKWA 4DV1K 4CGJA 2VQFK 3AY9A 2RHKA 3TANA 2P9KA 3AAQA 3UIQA 2OPSA 3WT0A 2VWJA 3LAKA 1BI4A 1GLAG 1IV0A 3FFKB 1TK5A 2RF2A 3SMSA 3PV8A 1CZAN 3M5RA 1BA0A 3D2EB 4E0DA 1X3NA 1D8YA 1RBRA 1CXQA 2FSJA 2B4JA 4H4OA 2D0CA 2YNGA 4H4MA 5E84A 4CESA 5C0YA 2IVPA 3J7ZO 3O6WA 2QWLA 2XHBA 4K8XA 4BRPA 4O0JA 3VEOA 2G8UA 4CJWA 3A5NC 5AQKA 2Q0UA 1O1WA 4XH1A 1DTTA 4CHOA 2NNWA 4DFKA 4BQZA 4GVMA 2O8DA 2RPIA 2O8EA 4CZJA 4DQ8A 4BRHA 4A61A 3WNHA 3CQYA 3DXKA 1K8KB 3RSEA 4CZLA 3OYBA 5KTQA 4RW6A 3A8YA 3HPGA 4DU3A 1GLLO 2YCHA 4PKGA 3O5BA 1V4SA 2E2PA 1TKZA 1O13A 4GW6A 5BREA 2QXFA 3O1WA 1NJXA 1KAYA 2G8KA 5BPMA 2VG5A 4CE9A 1QQCA 3ENBA 1FKOA 3S41A 1K8AO 3KJVA 3T1HK 4FJKA 3HOTA 3AVJA 1GOAA 2HHWA 3VQPA 1NWKA 1Q81O 3PX0A 3H46O 3CPWM 2OPQA 5DM7L 2YNFA 2YHBA 4HWIA 3RWUA 3AGRA 4C1NK 4FJNA 3VQQA 4K0KK 1QSLA 1NGEA 5E26A 1HLUA 5C25A 1BQMA 1L3SA 2QM1A 3J8AA 4FJHA 5FPEA 4Z4HA 5JVHL 4KHSA 4CGHA 1S1WA 1LW0A 3CCQN 2KFZA 3DYAA 1M1KO 3AA5X 3G0ZA 4LD0A 4B9TA 4GVEA 2Z1IA 1GOBA 1SS6A 5AQHA 2UU9K 4CJTA 1C0FA 3O3GA 3J80O 3F73A 1XNRK 1U45A 2WUSA 3QBWA 4JLHA 1S1VA 3MWTA 4FLUA 5AQNA 4E7LA 1EQYA 3FZFA 4DSFA 3O80A 2LSNA 1D9DA 4CHZA 4G9ZA 5LMNK 2P9KB 3F2KA 2O4IA 4IOCL 2GEMA 3NH2A 4NLCA 2DY4A 3SUOA 3PIOL 2PY5A 3LZJA 2HSTA 4ZHRA 3UE5A 3SI6A 3WEEB 3CC2N 4I6MA 5FPDA 4JYAK 1RT4A 4ELVA 2HHQA 4OKJA 4YOVA 3NVMA 2ASPA 4DTXA 1IH7A 4JKFA 2X6NA 4B8CA 2KTQA 4GY2B 3BF1A 5BRFA 4B3TK 1RDAA 3EEQA 5BR8K 3SUPA 1KSPA 1HYZA 3M1FA 2W6KA 3GE1A 2ZQBA 4AHSA 2GTDA 1NJZA 4C8OA 4PQUA 1HJOA 4JKEA 1SKWA 2W42A 3VN5A 4CF8A 2AA4A 1VSDA 4F3TA 3DXKB 4PY5A 4YFUA 3TU5A 3SV3A 2ATQA 1NGFA 2Q36A 3AO4A 1DGKN 3NGYA 3P31A 3LDPA 2OTJN 3V4IA 3BEXA 3QIPA 3RMCA 4CBXA 2HB5A 3VENA 3OYHA 2VQEK 4CF1A 1ZBHA 1VQNN 1ASWA 3V1QA 3JXUA 4CECA 1BWFO 1SQKA 3IMXA 4KTZA 4BRGA 4V19S 4NLBA 2BE2A 1EXQA 3SYZA 3LP3A 1YITN 3IKMA 1L3TA 5J2QA 4KTWA 1NGDA 3L4IA 2HF4A 3U6FA 4JHDB 3I56N 3B6OA 4BG8A 3CCVN 4EZ6A 4B1WB 4A62A 4CBUA 3ATVA 1ZC6A 4JKHA 3OBWA 4JI4K 4FM2A 4CHNA 1CXUA 3O1BA 3CCRN 4IWVA 1B92A 3IG1A 4YOTA 4XH5A 3B6PA 1TYQB 4CJRA 1NK6A 4DQSA 4BRDA 4LFBK 1VQ5N 2E6MA 4F8RA 4KBOA 2G8VA 5M1QA 2D0PA 3DAWA 2HHTA 3AGKA 4LFCK 2WFBA 3M8SA 3U9ZA 3K59A 3QESA 3HRGA 3L2VA 4Z4FA 4JAXA 2E1YA 1IO2A 1SV5A 4CZFA 2PZSA 1JLQA 3AVFA 3WXKA 1JJ2M 1WSHA 5J2MA 4KKOA 4BRIA 4X64K 3UB5A 1KLMA 3U8XA 4JRPA 3H45C 5LL6Z 4HHTA 1NJYA 2CH5A 3K57A 1C0GA 4FM1A 1IG9A 1XC3A 2GWKA 4I6MB 4CD3A 1JLAA 2E5LK 3SAHA 3CMAN 4HUEA 2QWPA 4N5SA 3AVIA 1WB9A 3OHRA 4JI2K 3VQ9A 1VQ8N 4OVLA 4JD2A 3KLEA 4DFMA 3HT3A 3LPUA 3HBTA 1VSMA 4MQ3A 2GWJA 1NOYA 1UWBA 4DQPA 1C0MA 3SZ2A 4KHQA 4DUZK 3Q7CA 4AF1A 1VSHA 3DLKA 3FE1A 2QI2A 3TTDA 1FW6A 3WNEA 5AQRA 3JYTA 2V51B 4FWKA 5KPZA 3MN6A 1WSGA 3W3DA 3S3MA 3EYZA 3FLCO 4CJKA 3HVRA 4JKAA 3RMBA 1HMVA 3VTHA 3I0RA 3IS9A 5AFUA 4CIGA 4AHCA 3PSFA 1W2BM 3OJSA 4WCEL 1DKGD 4DTSA 4FWNA 1IJJA 4BQLA 4DSEA 4N56A 4BR2A 5AQMA 4FL9A 4BVPA 3OYJA 1HQUA 1N8RO 4FCYA 4BG9A 5F0XA 4ELTA 3HZ6A 4FSVA 1T6CA 1P8ZA 4OGEA 4F4KA 4PHTX 5JLHA 3CYMA 4W5NA 3I0SA 1R59O 3CG7A 4YDUC 1VAZA 1N36K 2QKKA 4JNEA 3FR0A 1RBUA 1EO1A 4WFNL 4BDPA 2VGNA 5C24A 3PUFA 4BC3A 3RR8A 3F9MA 3LALA 4FWRA 4CZMA 3C6AA 1D9FA 5LJWA 4X65K 1HKGA 4FWMA 1WSIA 3OW2M 4H5RA 5EY4A 4BE0A 5HL7L 3HL8A 3I55N 1C0UA 3CMEN 3U3GA 3FZLA 2VGMA 4DSIA 4A2BA 1A5VA 1KCFA 3PO5A 4Z4IA 3SPZA 4C8NA 4FW2A 3D45A 1JLCA 3P1GA 3VQCA 4CJ3A 4YOUA 1UAXA 1L3VA 1NGGA 4OLBA 1J6ZA 3VPZA 5A2QO 4DTMA 3BDPA 3VEVA 1E3MA 4CIFA 2OZSA 5SWMA 2BGGA 3BZCA 3O3HA 4CGIA 2IC3A 4M3YA 1RNHA 2HHXA 3ZCMA 4KI4A 1U47A 4E7JA 4B3RK 1C1AA 4NB4A 2A40A 3T1YK 3THXA 3ZSQA 4DV5K 1IG8A 1GLJO 2O4GA 3V9UA 5M1PA 3V81A 4DSJA 1U04A 2UUBK 3SMPA 4CK2A 3OYIA 3CC4N 4KB0A 1T3VA 3DLRA 4FPBA 2IAJA 2OYQA 1OH5A 1S1XA 1TL3A 3VMFB 3MECA 3AVKA 3CJ9A 4CI6A 3CPEA 2HBJA 3I8BA 4OO1J 1VRUA 4IDHA
chains in the Genus database with same CATH topology
1TKZA 3MXIA 3JSMA 3PX6A 3AVHA 3NF6A 4GW6A 4CJSA 4CEDA 2QXFA 1NJXA 5FRMA 2G8KA 1LWEA 1HYVA 2VG5A 4CE9A 1QQCA 3OS1A 2A1RA 1IKXA 1FKOA 3VQEA 4CJVA 4KPYA 1WN7A 3QNOA 3KJVA 3TARA 1S9GA 4FJKA 1JL2A 4I9QA 3AVJA 1GOAA 1HNIA 3DLGA 2Y1JA 1DTQA 4B9NA 3O4QA 3VQPA 2HHWA 1D5AA 4RG8A 4KREA 4OPKA 4DTRA 1KVBA 3PX0A 1KVCA 3IRXA 4J2BA 1IKVA 1N5YA 3L2WA 4CEAA 2OPQA 4M3TA 3HYFA 2YNFA 2YHBA 5HBMA 1KTQA 1QHTA 4FLZA 3RWUA 4XIUA 1UOCA 4N76A 1I39A 4FJNA 2ZD1A 4CEOA 1YT3A 3KK2A 3VQQA 3RMAA 1QSLA 3RRHA 2E4LA 3HSTB 4BWMA 3V9ZA 5C25A 1MU2A 1BQMA 1L3SA 4CJPA 3OYNA 1JLFA 1LWCA 3DLEA 3NGZA 2G8IA 4KFBA 3QNNA 1NKCA 4HCBA 3TABA 4AHVA 3VQ4A 4FJHA 1VRTA 3HM9A 4Z4HA 4J2DA 3NF7A 4CGHA 1BIUA 4MFBA 4KHSA 1S1WA 2YHAA 2YKMA 1LW0A 2YNHA 3P83D 3G10A 2KFZA 3LP1A 3DYAA 1EKEA 3ZT3A 4DG1A 2HNDA 2D5RA 5CZ1A 3ZT0A 4BDZA 1U49A 3AA5X 3NGIA 3G0ZA 4LD0A 3V9WA 3SQ2A 2FC0A 2Z1JA 4B9TA 3MAQA 4CHQA 2Z1IA 1GOBA 3TAPA 2PYLA 2ETJA 1I3AA 3QEPA 4CJTA 2A1SA 1RT7A 3AVGA 4NCBA 5HROA 3SQ0A 4OPJA 4FVMA 3O3GA 3F73A 1U45A 3T19A 4B9VA 4JLHA 3QIOA 3C6UA 5CYMA 1S1VA 2JLEA 4LSNA 4WE1A 5C42A 3V1OA 3M8PA 4QAGA 4FLUA 3QERA 4E7LA 4DSFA 2LSNA 1D9DA 2AJQA 4NYFA 3PO4A 4FZXC 4KRFA 4CHZA 3KIOA 3T3FA 5E41A 4DWIA 4CJEA 4M45A 2DFHA 1N6QA 4B9MA 4HCCA 1S5JA 1BCMA 3AA2A 4N47A 3V9SA 1HNVA 1YTAA 1SUQA 2ITGA 2WONA 4RW9A 1SL1A 2O4IA 1C6VA 2HHSA 3NH2A 4KAZA 1RDDA 2DY4A 2FBXA 1A5WA 3SUOA 4B9UA 3HP9A 3ULDA 2PY5A 2OPRA 1ZBLA 4B8AB 4CFAA 4PWDA 5CZ2A 3LZJA 5J2NA 4ZHRA 4L8RB 3SI6A 2Z1GA 2P5OA 4KB1A 3NH0A 2VG6A 3VQ6A 3MEDA 1LAVA 1HJRA 3CQ8A 1RT4A 4ELVA 1A5XA 1KVAA 3T1AA 4OKJA 2X78A 3AVCA 3VQBA 2HHQA 4M3UA 1J9AA 1RDCA 4DS5A 4CJ5A 1TKDA 1FK9A 3AVBA 4DTXA 1IH7A 4FM0A 1BL3A 2HNZA 1ASVA 2HMIA 3KD5E 2X6NA 4B8CA 4CEQA 3NH1A 3OYCA 1T8EA 4DTJA 3ITHA 2KTQA 3ZSOA 1Q9XA 2FBYA 2Y1IA 1Z26A 3EZ5A 1NK9A 1RDAA 5DK5A 3SUPA 4KI6A 1KSPA 1HYZA 4E1NA 1NJZA 2ZQBA 3OVNA 1VK0A 4AHSA 3NHGA 3K5MA 1KFDA 3DMJA 4HUGA 3TAEA 1RTDA 4IG0A 3ZSXA 3ZT2A 2XO7A 2D0AA 4C8OA 3IAYA 4CFBA 1NK0A 4PQUA 4CHPA 3HJFA 1SKWA 4FJ8A 2W42A 1XHZA 3VN5A 4CF8A 4DSLA 4IKFA 3OYLA 2HW3A 3ALYA 3K58A 1VSIA 1Q9YA 1VSDA 1Y97A 1T05A 4CJQA 3OYFA 2KQ2A 4I2PA 3LWMA 4F3TA 5HRRA 4PY5A 4YFUA 3L3VA 1NOZA 2RN2A 3TR8A 4CERA 4DU4A 1FKPA 1CZBA 1YVUA 3KK1A 3RMDA 3MXMA 2P1JA 3QEWA 3SV3A 5HP1A 2ATQA 1ZYQA 4KHWA 3AO4A 4FK4A 3S9HA 3NGYA 3KK3A 5KRSA 4HUFA 3O4NA 3ZSRA 3SV4A 2G8FA 4J2AA 1RILA 3V4IA 4BE2A 3LPTA 3QIPA 3RMCA 4KHUA 4BACA 2HB5A 1BHLA 4KO0A 1WAFA 4CK1A 3OYHA 3V1RA 3LZIA 4CF1A 2YV0X 1VSFA 1ZBHA 4C8LA 1WAJA 4RW4A 2XY6A 2YKNA 2HHVA 1ASWA 3V1QA 4FZYA 4CECA 4CGDA 1JKHA 2NUBA 3VQDA 1ZBIA 5CY4A 4CJLA 4FJMA 4KHNA 3SUQA 4QOZB 1BGXT 3SQ4A 4AHUA 4CEBA 2KZMA 4KTZA 2XY5A 1NK7A 3DOLA 4F2RA 4NYNA 1WSEA 2BE2A 1EXQA 1TK0A 3SYZA 1S6QA 3AO5A 3LP3A 1TAQA 3AO1A 3ISNC 2PYJA 3PY8A 4FJ7A 4TSXA 3ZT4A 1CLQA 4CCHA 1L3TA 3BGRA 3LP0A 5J2QA 2ZE2A 4KTWA 1T03A 3ZSVA 3CM6A 3U6FA 4AHRA 1EP4A 2Z1HA 4Z0UA 4DLEA 4EP4A 3B6OA 5FRNA 1TKXA 1X9SA 4EZ6A 4QCLA 3DRPA 1B9FA 4FJJA 2XY8A 3AVAA 1RBVA 1UA0A 4Z4GA 3QEVA 4O44A 4DTOA 4B9LA 3DRSA 4FM2A 4HTUA 1EETA 4W5QA 4CHNA 1CXUA 4FLVA 1S6PA 3VA0A 1KFSA 4M3RA 4NCAA 1B92A 1ZBFA 3IG1A 3AVMA 3B6PA 4CJRA 4CEFA 1NK6A 1TAUA 3HVTA 4DQSA 1QTMA 1J54A 2XY7A 1CZ9A 4CJ4A 3VQ8A 4J2EA 2E6MA 4F8RA 4NCGA 2G8VA 3AO3A 3ZSYA 3TWHA 2HHTA 1TV6A 4AH9A 3VQ7A 4DTUA 5I3UA 5EU7A 4OLAA 3M8SA 1WSJA 3MEGA 3K59A 4CEEA 3CM5A 3QESA 1RDBA 1RBSA 4DS4A 1XI1A 1X9WA 1RCHA 3L2VA 4OKEA 2E6LA 1L3UA 4Z4FA 1HRHA 3E01A 3KLIA 3AA3A 1TVRA 2QK9A 1IO2A 1SV5A 5JS2A 4KHYA 2PZSA 1JLQA 3L2QA 1BI4B 1WNSA 4B08A 2X6SA 3AVFA 4AHTA 3CFOA 1U48A 2IDOA 1VSLA 4DTNA 2DFEA 1WSHA 3LDSA 1VSEA 5J2MA 4ELUA 3HP6A 4KKOA 3C6TA 1ASUA 4RW8A 2R7YA 3DLBA 4O5BA 4CEZA 2HVIA 1KLMA 4JRPA 1IKYA 4JS4A 3OYKA 2B6AA 4HHTA 3L2UA 4UQGA 1NJYA 4W5TA 1NKBA 1VSJA 3VQ5A 1R0AA 3K57A 2IOCA 3LP2A 3TAFA 2D0BA 3THVA 4FM1A 4O55A 3L3UA 4DF8A 2KFNA 1IG9A 3AV9A 1JXEA 1JXBA 4CF9A 5KRTA 4C8KA 1JLAA 3DM2A 2F8TA 2EHGA 3P5JA 4HUEA 4DFPA 1GOCA 4N5SA 3AVIA 4OGCA 3K5NA 2X74A 3WNGA 2FBVA 3S3NA 3NBPA 3V6DA 2GV9A 3QINA 4LH4A 4Y1CA 3VQ9A 4OVLA 4CJFA 1NKEA 2GUIA 4BE1A 3QEXA 3KLEA 4CJUA 2F96A 3QO9A 4Z4CA 3HT3A 3NE6A 2P51A 3DI6A 3LPUA 4IG3A 4O0IA 4DFMA 1VSMA 1RT1A 2OPPA 4MQ3A 4CGGA 3NDKA 4JRQA 4C8MA 4E7HA 3ASMA 2HVHA 4CGFA 4FLWA 1NOYA 3QLHA 3NF9A 1BQNA 3HXMA 3HPHA 1UWBA 4JS5A 4AILC 2P5GA 4DQPA 2DTUA 1C0MA 4FZZA 4CF2A 3SZ2A 4KHQA 2KZZA 1J53A 2OZMA 1C1CA 4FLYA 4G1QA 3KKSA 4IBNA 1J5OA 1NK4A 3S3OA 1LW2A 3K5LA 1XHXA 1WLJA 3OYEA 1VSHA 3DLKA 4IFYA 3SUNA 4FK2A 4F3OA 1NJWA 2DFFA 4ID5A 4M3WA 2RKIA 4Y1DA 4FJGA 1B9DA 4CHYA 5CYQA 2G8WA 1HQEA 5HRPA 3PX4A 3WNEA 3JYTA 4R5PA 3TAQA 3HK2A 1L5UA 5KGXA 2BANA 2IS3A 3A2FA 3LANA 1BIZA 4FXDA 3SPYA 1WSGA 4DF4A 3S3MA 3EYZA 4CJKA 3HVRA 3AO2A 4FW1A 2WOMA 1SKSA 3OY9A 3RMBA 2HNYA 5HLFA 4KTQA 1HMVA 4DQRA 5J2PA 3SQ1A 1HYSA 5T7BA 4W5OA 3I0RA 1RTIA 3TAGA 3TI0A 3QETA 3ZSZA 3IS9A 3NF8A 1IKWA 1JL1A 1NK8A 5HRSA 2BDPA 4FJXA 4E3SA 1LWFA 1REVA 4AHCA 4CIGA 5K14A 1JLEA 4OKKA 4ICLA 1RT6A 2YNIA 4M3XA 1Q8IA 1VSKA 1WSFA 4F2SA 2EX3A 5FROA 3OJSA 3KTQA 3RTVA 3FFIA 4HVJA 1JLBA 4DTSA 3SCXA 4Q5VA 3DRRA 4FLTA 4DSEA 4I2QA 4K8ZA 4LH5A 4N56A 1RT2A 1W0HA 3EY1A 1C0TA 4DQQA 5JS1A 3OYJA 2IGIA 4DU1A 1HQUA 1HPZA 3RR7A 4M3ZA 3DLHA 4FCYA 1QS4A 1F21A 1RTJA 2QKBA 4B3OA 4ELTA 2Q3SA 4RW7A 3OYMA 4OGEA 5I42A 4F4KA 4H8KA 1XWLA 4I9LA 1RBTA 3CYMA 4W5RA 3H08A 4E7IA 4YNQA 3I0SA 2FBTA 3KD1E 4W5NA 3CG7A 1T7PA 2QKKA 4LY7A 4DMNA 3VA3A 1TGOA 4ZTFA 4DTPA 1RBUA 1S1TA 4BWJA 1SL0A 4BDPA 5C24A 4FJ9A 3PUFA 4E7KA 1UA1A 4M41A 3OYAA 1FXXA 3RR8A 4FLXA 3LALA 2G8HA 4I7FA 3OS2A 3CFRA 4BDYA 4FK0A 2VG7A 5D3GA 1D9FA 1NK5A 1DLOA 4DSKA 3I8DA 2F8SA 3LWLA 5KI6A 4Q0BA 4N41A 3QEIA 1WSIA 5DMRA 1YTUA 1W9HA 5SZTA 4BE0A 3K2PA 4E19A 3O3FA 3D0PA 3OJUA 3SNNA 4DQIA 3HL8A 3L2RA 1C0UA 2XRIA 3U3GA 1S1UA 1XC9A 3TAMA 1X9MA 1KRPA 4DSIA 2JGUA 4PA1A 1A5VA 1KCFA 4E1MA 4B9SA 3CFPA 2HHUA 3NFAA 3PO5A 2VWKA 4EP5A 3HO1A 1G15A 4CGJA 4Z4IA 3SPZA 4EZ9A 3TANA 4C8NA 3ZT1A 3UIQA 2OPSA 2VWJA 3M8RA 3LAKA 3U3YA 1BI4A 4FW2A 1TL1A 3WNFA 4LSLA 3D45A 2KW4A 1TK5A 2RF2A 1JLCA 4PUOA 4GMJB 3PV8A 3P1GA 3VQCA 5HRNA 4CJ3A 1K6YA 3SJJA 1RT3A 4IFVA 3K5OA 4CFCA 4ID1A 1JLGA 1UAXA 3LAMA 4E0DA 3ZSWA 3OYGA 1L3VA 1QSSA 1D8YA 1ZBUA 1RBRA 1CXQA 4ZTJA 3AVLA 4OLBA 1U4BA 3M8QA 4IDKA 2B5JA 3NAEA 4DTMA 3BDPA 4CK3A 3HPOA 2B4JA 4CIFA 4H4OA 4OJRA 2D0CA 2YNGA 4H4MA 5J1EA 3AVNA 1SL2A 4CESA 4FJIA 2OZSA 4Z4EA 5SWMA 3OS0A 2BGGA 3MEEA 3O3HA 3VQAA 2IC3A 1RTHA 4CGIA 4CIEA 3L8BA 1SKRA 1RNHA 2XHBA 4M3YA 2HHXA 3ZCMA 4KI4A 4K8XA 1U47A 1QE1A 4E7JA 1C1AA 3KLHA 4DLGA 4O0JA 1QSYA 2G8UA 4CJWA 1TKTA 4FJLA 3V9XA 1LV5A 1ITGA 3ZSQA 1Z25A 3F9KA 1O1WA 4DFJA 1DTTA 3AA4A 4O4GA 2O4GA 3C94A 3KLGA 1TK8A 3RRGA 4CHOA 4DFKA 1S9EA 1RT5A 4GVMA 4KV8A 3MXJA 3V9UA 1BISA 3V81A 3OYDA 4DSJA 1U04A 2RPIA 1EX4A 3C95A 1BCOA 4CK2A 3OYIA 1KLNA 4KB0A 3KLFA 3DLRA 3WNHA 5KGWA 4E89A 2IAJA 1C1BA 3OYBA 1LAWA 2OYQA 5KTQA 4FJ5A 4RW6A 2OA8A 3HPGA 3DOKA 1S1XA 2GBZA 2I5JA 4DU3A 4M42A 3KKRA 1X1PA 4CFDA 1TL3A 3NCIA 3MECA 3AVKA 4FYDA 5FDLA 1VRUA 4CF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKZ A;  3MXI A;  3JSM A;  3PX6 A;  3AVH A;  3NF6 A;  4GW6 A;  4CJS A;  4CED A;  2QXF A;  1NJX A;  5FRM A;  2G8K A;  1LWE A;  1HYV A;  2VG5 A;  4CE9 A;  1QQC A;  3OS1 A;  2A1R A;  1IKX A;  1FKO A;  3VQE A;  4CJV A;  4KPY A;  1WN7 A;  3QNO A;  3KJV A;  3TAR A;  1S9G A;  4FJK A;  1JL2 A;  4I9Q A;  3AVJ A;  1GOA A;  1HNI A;  3DLG A;  2Y1J A;  1DTQ A;  4B9N A;  3O4Q A;  3VQP A;  2HHW A;  1D5A A;  4RG8 A;  4KRE A;  4OPK A;  4DTR A;  1KVB A;  3PX0 A;  1KVC A;  3IRX A;  4J2B A;  1IKV A;  1N5Y A;  3L2W A;  4CEA A;  2OPQ A;  4M3T A;  3HYF A;  2YNF A;  2YHB A;  5HBM A;  1KTQ A;  1QHT A;  4FLZ A;  3RWU A;  4XIU A;  1UOC A;  4N76 A;  1I39 A;  4FJN A;  2ZD1 A;  4CEO A;  1YT3 A;  3KK2 A;  3VQQ A;  3RMA A;  1QSL A;  3RRH A;  2E4L A;  3HST B;  4BWM A;  3V9Z A;  5C25 A;  1MU2 A;  1BQM A;  1L3S A;  4CJP A;  3OYN A;  1JLF A;  1LWC A;  3DLE A;  3NGZ A;  2G8I A;  4KFB A;  3QNN A;  1NKC A;  4HCB A;  3TAB A;  4AHV A;  3VQ4 A;  4FJH A;  1VRT A;  3HM9 A;  4Z4H A;  4J2D A;  3NF7 A;  4CGH A;  1BIU A;  4MFB A;  4KHS A;  1S1W A;  2YHA A;  2YKM A;  1LW0 A;  2YNH A;  3P83 D;  3G10 A;  2KFZ A;  3LP1 A;  3DYA A;  1EKE A;  3ZT3 A;  4DG1 A;  2HND A;  2D5R A;  5CZ1 A;  3ZT0 A;  4BDZ A;  1U49 A;  3AA5 X;  3NGI A;  3G0Z A;  4LD0 A;  3V9W A;  3SQ2 A;  2FC0 A;  2Z1J A;  4B9T A;  3MAQ A;  4CHQ A;  2Z1I A;  1GOB A;  3TAP A;  2PYL A;  2ETJ A;  1I3A A;  3QEP A;  4CJT A;  2A1S A;  1RT7 A;  3AVG A;  4NCB A;  5HRO A;  3SQ0 A;  4OPJ A;  4FVM A;  3O3G A;  3F73 A;  1U45 A;  3T19 A;  4B9V A;  4JLH A;  3QIO A;  3C6U A;  5CYM A;  1S1V A;  2JLE A;  4LSN A;  4WE1 A;  5C42 A;  3V1O A;  3M8P A;  4QAG A;  4FLU A;  3QER A;  4E7L A;  4DSF A;  2LSN A;  1D9D A;  2AJQ A;  4NYF A;  3PO4 A;  4FZX C;  4KRF A;  4CHZ A;  3KIO A;  3T3F A;  5E41 A;  4DWI A;  4CJE A;  4M45 A;  2DFH A;  1N6Q A;  4B9M A;  4HCC A;  1S5J A;  1BCM A;  3AA2 A;  4N47 A;  3V9S A;  1HNV A;  1YTA A;  1SUQ A;  2ITG A;  2WON A;  4RW9 A;  1SL1 A;  2O4I A;  1C6V A;  2HHS A;  3NH2 A;  4KAZ A;  1RDD A;  2DY4 A;  2FBX A;  1A5W A;  3SUO A;  4B9U A;  3HP9 A;  3ULD A;  2PY5 A;  2OPR A;  1ZBL A;  4B8A B;  4CFA A;  4PWD A;  5CZ2 A;  3LZJ A;  5J2N A;  4ZHR A;  4L8R B;  3SI6 A;  2Z1G A;  2P5O A;  4KB1 A;  3NH0 A;  2VG6 A;  3VQ6 A;  3MED A;  1LAV A;  1HJR A;  3CQ8 A;  1RT4 A;  4ELV A;  1A5X A;  1KVA A;  3T1A A;  4OKJ A;  2X78 A;  3AVC A;  3VQB A;  2HHQ A;  4M3U A;  1J9A A;  1RDC A;  4DS5 A;  4CJ5 A;  1TKD A;  1FK9 A;  3AVB A;  4DTX A;  1IH7 A;  4FM0 A;  1BL3 A;  2HNZ A;  1ASV A;  2HMI A;  3KD5 E;  2X6N A;  4B8C A;  4CEQ A;  3NH1 A;  3OYC A;  1T8E A;  4DTJ A;  3ITH A;  2KTQ A;  3ZSO A;  1Q9X A;  2FBY A;  2Y1I A;  1Z26 A;  3EZ5 A;  1NK9 A;  1RDA A;  5DK5 A;  3SUP A;  4KI6 A;  1KSP A;  1HYZ A;  4E1N A;  1NJZ A;  2ZQB A;  3OVN A;  1VK0 A;  4AHS A;  3NHG A;  3K5M A;  1KFD A;  3DMJ A;  4HUG A;  3TAE A;  1RTD A;  4IG0 A;  3ZSX A;  3ZT2 A;  2XO7 A;  2D0A A;  4C8O A;  3IAY A;  4CFB A;  1NK0 A;  4PQU A;  4CHP A;  3HJF A;  1SKW A;  4FJ8 A;  2W42 A;  1XHZ A;  3VN5 A;  4CF8 A;  4DSL A;  4IKF A;  3OYL A;  2HW3 A;  3ALY A;  3K58 A;  1VSI A;  1Q9Y A;  1VSD A;  1Y97 A;  1T05 A;  4CJQ A;  3OYF A;  2KQ2 A;  4I2P A;  3LWM A;  4F3T A;  5HRR A;  4PY5 A;  4YFU A;  3L3V A;  1NOZ A;  2RN2 A;  3TR8 A;  4CER A;  4DU4 A;  1FKP A;  1CZB A;  1YVU A;  3KK1 A;  3RMD A;  3MXM A;  2P1J A;  3QEW A;  3SV3 A;  5HP1 A;  2ATQ A;  1ZYQ A;  4KHW A;  3AO4 A;  4FK4 A;  3S9H A;  3NGY A;  3KK3 A;  5KRS A;  4HUF A;  3O4N A;  3ZSR A;  3SV4 A;  2G8F A;  4J2A A;  1RIL A;  3V4I A;  4BE2 A;  3LPT A;  3QIP A;  3RMC A;  4KHU A;  4BAC A;  2HB5 A;  1BHL A;  4KO0 A;  1WAF A;  4CK1 A;  3OYH A;  3V1R A;  3LZI A;  4CF1 A;  2YV0 X;  1VSF A;  1ZBH A;  4C8L A;  1WAJ A;  4RW4 A;  2XY6 A;  2YKN A;  2HHV A;  1ASW A;  3V1Q A;  4FZY A;  4CEC A;  4CGD A;  1JKH A;  2NUB A;  3VQD A;  1ZBI A;  5CY4 A;  4CJL A;  4FJM A;  4KHN A;  3SUQ A;  4QOZ B;  1BGX T;  3SQ4 A;  4AHU A;  4CEB A;  2KZM A;  4KTZ A;  2XY5 A;  1NK7 A;  3DOL A;  4F2R A;  4NYN A;  1WSE A;  2BE2 A;  1EXQ A;  1TK0 A;  3SYZ A;  1S6Q A;  3AO5 A;  3LP3 A;  1TAQ A;  3AO1 A;  3ISN C;  2PYJ A;  3PY8 A;  4FJ7 A;  4TSX A;  3ZT4 A;  1CLQ A;  4CCH A;  1L3T A;  3BGR A;  3LP0 A;  5J2Q A;  2ZE2 A;  4KTW A;  1T03 A;  3ZSV A;  3CM6 A;  3U6F A;  4AHR A;  1EP4 A;  2Z1H A;  4Z0U A;  4DLE A;  4EP4 A;  3B6O A;  5FRN A;  1TKX A;  1X9S A;  4EZ6 A;  4QCL A;  3DRP A;  1B9F A;  4FJJ A;  2XY8 A;  3AVA A;  1RBV A;  1UA0 A;  4Z4G A;  3QEV A;  4O44 A;  4DTO A;  4B9L A;  3DRS A;  4FM2 A;  4HTU A;  1EET A;  4W5Q A;  4CHN A;  1CXU A;  4FLV A;  1S6P A;  3VA0 A;  1KFS A;  4M3R A;  4NCA A;  1B92 A;  1ZBF A;  3IG1 A;  3AVM A;  3B6P A;  4CJR A;  4CEF A;  1NK6 A;  1TAU A;  3HVT A;  4DQS A;  1QTM A;  1J54 A;  2XY7 A;  1CZ9 A;  4CJ4 A;  3VQ8 A;  4J2E A;  2E6M A;  4F8R A;  4NCG A;  2G8V A;  3AO3 A;  3ZSY A;  3TWH A;  2HHT A;  1TV6 A;  4AH9 A;  3VQ7 A;  4DTU A;  5I3U A;  5EU7 A;  4OLA A;  3M8S A;  1WSJ A;  3MEG A;  3K59 A;  4CEE A;  3CM5 A;  3QES A;  1RDB A;  1RBS A;  4DS4 A;  1XI1 A;  1X9W A;  1RCH A;  3L2V A;  4OKE A;  2E6L A;  1L3U A;  4Z4F A;  1HRH A;  3E01 A;  3KLI A;  3AA3 A;  1TVR A;  2QK9 A;  1IO2 A;  1SV5 A;  5JS2 A;  4KHY A;  2PZS A;  1JLQ A;  3L2Q A;  1BI4 B;  1WNS A;  4B08 A;  2X6S A;  3AVF A;  4AHT A;  3CFO A;  1U48 A;  2IDO A;  1VSL A;  4DTN A;  2DFE A;  1WSH A;  3LDS A;  1VSE A;  5J2M A;  4ELU A;  3HP6 A;  4KKO A;  3C6T A;  1ASU A;  4RW8 A;  2R7Y A;  3DLB A;  4O5B A;  4CEZ A;  2HVI A;  1KLM A;  4JRP A;  1IKY A;  4JS4 A;  3OYK A;  2B6A A;  4HHT A;  3L2U A;  4UQG A;  1NJY A;  4W5T A;  1NKB A;  1VSJ A;  3VQ5 A;  1R0A A;  3K57 A;  2IOC A;  3LP2 A;  3TAF A;  2D0B A;  3THV A;  4FM1 A;  4O55 A;  3L3U A;  4DF8 A;  2KFN A;  1IG9 A;  3AV9 A;  1JXE A;  1JXB A;  4CF9 A;  5KRT A;  4C8K A;  1JLA A;  3DM2 A;  2F8T A;  2EHG A;  3P5J A;  4HUE A;  4DFP A;  1GOC A;  4N5S A;  3AVI A;  4OGC A;  3K5N A;  2X74 A;  3WNG A;  2FBV A;  3S3N A;  3NBP A;  3V6D A;  2GV9 A;  3QIN A;  4LH4 A;  4Y1C A;  3VQ9 A;  4OVL A;  4CJF A;  1NKE A;  2GUI A;  4BE1 A;  3QEX A;  3KLE A;  4CJU A;  2F96 A;  3QO9 A;  4Z4C A;  3HT3 A;  3NE6 A;  2P51 A;  3DI6 A;  3LPU A;  4IG3 A;  4O0I A;  4DFM A;  1VSM A;  1RT1 A;  2OPP A;  4MQ3 A;  4CGG A;  3NDK A;  4JRQ A;  4C8M A;  4E7H A;  3ASM A;  2HVH A;  4CGF A;  4FLW A;  1NOY A;  3QLH A;  3NF9 A;  1BQN A;  3HXM A;  3HPH A;  1UWB A;  4JS5 A;  4AIL C;  2P5G A;  4DQP A;  2DTU A;  1C0M A;  4FZZ A;  4CF2 A;  3SZ2 A;  4KHQ A;  2KZZ A;  1J53 A;  2OZM A;  1C1C A;  4FLY A;  4G1Q A;  3KKS A;  4IBN A;  1J5O A;  1NK4 A;  3S3O A;  1LW2 A;  3K5L A;  1XHX A;  1WLJ A;  3OYE A;  1VSH A;  3DLK A;  4IFY A;  3SUN A;  4FK2 A;  4F3O A;  1NJW A;  2DFF A;  4ID5 A;  4M3W A;  2RKI A;  4Y1D A;  4FJG A;  1B9D A;  4CHY A;  5CYQ A;  2G8W A;  1HQE A;  5HRP A;  3PX4 A;  3WNE A;  3JYT A;  4R5P A;  3TAQ A;  3HK2 A;  1L5U A;  5KGX A;  2BAN A;  2IS3 A;  3A2F A;  3LAN A;  1BIZ A;  4FXD A;  3SPY A;  1WSG A;  4DF4 A;  3S3M A;  3EYZ A;  4CJK A;  3HVR A;  3AO2 A;  4FW1 A;  2WOM A;  1SKS A;  3OY9 A;  3RMB A;  2HNY A;  5HLF A;  4KTQ A;  1HMV A;  4DQR A;  5J2P A;  3SQ1 A;  1HYS A;  5T7B A;  4W5O A;  3I0R A;  1RTI A;  3TAG A;  3TI0 A;  3QET A;  3ZSZ A;  3IS9 A;  3NF8 A;  1IKW A;  1JL1 A;  1NK8 A;  5HRS A;  2BDP A;  4FJX A;  4E3S A;  1LWF A;  1REV A;  4AHC A;  4CIG A;  5K14 A;  1JLE A;  4OKK A;  4ICL A;  1RT6 A;  2YNI A;  4M3X A;  1Q8I A;  1VSK A;  1WSF A;  4F2S A;  2EX3 A;  5FRO A;  3OJS A;  3KTQ A;  3RTV A;  3FFI A;  4HVJ A;  1JLB A;  4DTS A;  3SCX A;  4Q5V A;  3DRR A;  4FLT A;  4DSE A;  4I2Q A;  4K8Z A;  4LH5 A;  4N56 A;  1RT2 A;  1W0H A;  3EY1 A;  1C0T A;  4DQQ A;  5JS1 A;  3OYJ A;  2IGI A;  4DU1 A;  1HQU A;  1HPZ A;  3RR7 A;  4M3Z A;  3DLH A;  4FCY A;  1QS4 A;  1F21 A;  1RTJ A;  2QKB A;  4B3O A;  4ELT A;  2Q3S A;  4RW7 A;  3OYM A;  4OGE A;  5I42 A;  4F4K A;  4H8K A;  1XWL A;  4I9L A;  1RBT A;  3CYM A;  4W5R A;  3H08 A;  4E7I A;  4YNQ A;  3I0S A;  2FBT A;  3KD1 E;  4W5N A;  3CG7 A;  1T7P A;  2QKK A;  4LY7 A;  4DMN A;  3VA3 A;  1TGO A;  4ZTF A;  4DTP A;  1RBU A;  1S1T A;  4BWJ A;  1SL0 A;  4BDP A;  5C24 A;  4FJ9 A;  3PUF A;  4E7K A;  1UA1 A;  4M41 A;  3OYA A;  1FXX A;  3RR8 A;  4FLX A;  3LAL A;  2G8H A;  4I7F A;  3OS2 A;  3CFR A;  4BDY A;  4FK0 A;  2VG7 A;  5D3G A;  1D9F A;  1NK5 A;  1DLO A;  4DSK A;  3I8D A;  2F8S A;  3LWL A;  5KI6 A;  4Q0B A;  4N41 A;  3QEI A;  1WSI A;  5DMR A;  1YTU A;  1W9H A;  5SZT A;  4BE0 A;  3K2P A;  4E19 A;  3O3F A;  3D0P A;  3OJU A;  3SNN A;  4DQI A;  3HL8 A;  3L2R A;  1C0U A;  2XRI A;  3U3G A;  1S1U A;  1XC9 A;  3TAM A;  1X9M A;  1KRP A;  4DSI A;  2JGU A;  4PA1 A;  1A5V A;  1KCF A;  4E1M A;  4B9S A;  3CFP A;  2HHU A;  3NFA A;  3PO5 A;  2VWK A;  4EP5 A;  3HO1 A;  1G15 A;  4CGJ A;  4Z4I A;  3SPZ A;  4EZ9 A;  3TAN A;  4C8N A;  3ZT1 A;  3UIQ A;  2OPS A;  2VWJ A;  3M8R A;  3LAK A;  3U3Y A;  1BI4 A;  4FW2 A;  1TL1 A;  3WNF A;  4LSL A;  3D45 A;  2KW4 A;  1TK5 A;  2RF2 A;  1JLC A;  4PUO A;  4GMJ B;  3PV8 A;  3P1G A;  3VQC A;  5HRN A;  4CJ3 A;  1K6Y A;  3SJJ A;  1RT3 A;  4IFV A;  3K5O A;  4CFC A;  4ID1 A;  1JLG A;  1UAX A;  3LAM A;  4E0D A;  3ZSW A;  3OYG A;  1L3V A;  1QSS A;  1D8Y A;  1ZBU A;  1RBR A;  1CXQ A;  4ZTJ A;  3AVL A;  4OLB A;  1U4B A;  3M8Q A;  4IDK A;  2B5J A;  3NAE A;  4DTM A;  3BDP A;  4CK3 A;  3HPO A;  2B4J A;  4CIF A;  4H4O A;  4OJR A;  2D0C A;  2YNG A;  4H4M A;  5J1E A;  3AVN A;  1SL2 A;  4CES A;  4FJI A;  2OZS A;  4Z4E A;  5SWM A;  3OS0 A;  2BGG A;  3MEE A;  3O3H A;  3VQA A;  2IC3 A;  1RTH A;  4CGI A;  4CIE A;  3L8B A;  1SKR A;  1RNH A;  2XHB A;  4M3Y A;  2HHX A;  3ZCM A;  4KI4 A;  4K8X A;  1U47 A;  1QE1 A;  4E7J A;  1C1A A;  3KLH A;  4DLG A;  4O0J A;  1QSY A;  2G8U A;  4CJW A;  1TKT A;  4FJL A;  3V9X A;  1LV5 A;  1ITG A;  3ZSQ A;  1Z25 A;  3F9K A;  1O1W A;  4DFJ A;  1DTT A;  3AA4 A;  4O4G A;  2O4G A;  3C94 A;  3KLG A;  1TK8 A;  3RRG A;  4CHO A;  4DFK A;  1S9E A;  1RT5 A;  4GVM A;  4KV8 A;  3MXJ A;  3V9U A;  1BIS A;  3V81 A;  3OYD A;  4DSJ A;  1U04 A;  2RPI A;  1EX4 A;  3C95 A;  1BCO A;  4CK2 A;  3OYI A;  1KLN A;  4KB0 A;  3KLF A;  3DLR A;  3WNH A;  5KGW A;  4E89 A;  2IAJ A;  1C1B A;  3OYB A;  1LAW A;  2OYQ A;  5KTQ A;  4FJ5 A;  4RW6 A;  2OA8 A;  3HPG A;  3DOK A;  1S1X A;  2GBZ A;  2I5J A;  4DU3 A;  4M42 A;  3KKR A;  1X1P A;  4CFD A;  1TL3 A;  3NCI A;  3MEC A;  3AVK A;  4FYD A;  5FDL A;  1VRU A;  4CF0 A; 
#chains in the Genus database with same CATH topology
 3MN7 A;  3MXI A;  3JSM A;  5AQG A;  4IJA A;  2QWO A;  3NF6 A;  4CED A;  2O8C A;  1LWE A;  5AQZ A;  1IKX A;  3THY B;  4CJV A;  1OH7 A;  4KPY A;  1WN7 A;  3QNO A;  3TAR A;  2OTL N;  3WXM B;  1VQM N;  1DTQ A;  3O4Q A;  3CCU N;  4KRE A;  3IRX A;  1IKV A;  3MK6 A;  5LJV A;  5M1F A;  3AAP A;  4DUY K;  2QWM A;  1UOC A;  5JLF A;  4CEO A;  1YT3 A;  4BR4 A;  2UUA K;  3RRH A;  1VQK N;  2E4L A;  1YVN A;  3V9Z A;  3KWG A;  4CJP A;  3OYN A;  1LWC A;  3DLE A;  5AQL A;  3NGZ A;  4AHV A;  3VQ4 A;  4BVO A;  2ZJR L;  1QQN A;  2HND A;  4DR4 K;  5CZ1 A;  3ZT0 A;  1U49 A;  5IT9 O;  2Z1J A;  3MAQ A;  4QS8 A;  3G4S N;  2A1S A;  3TTF A;  3T19 A;  3C6U A;  5C42 A;  3M8P A;  3QER A;  2BUP A;  5KPR A;  2AJQ A;  4NYF A;  3SLC A;  4JI1 K;  3T3F A;  5E41 A;  4DWI A;  4HCC A;  5BPN A;  3N4Q A;  4B9M A;  1S5J A;  1BCM A;  3AA2 A;  1HNV A;  2ITG A;  2HHS A;  1SL1 A;  3CCL N;  1C6V A;  4KAZ A;  3VEZ A;  2RE2 A;  1HPM A;  1A5W A;  4B9U A;  3ULD A;  5J2N A;  1BO5 O;  4MLH A;  4KB1 A;  5GIP A;  2P9I A;  1HJR A;  1KVA A;  3T1A A;  2X78 A;  1J9A A;  1RDC A;  1RDU A;  3ZX3 A;  2D1K A;  4MO4 A;  4FM0 A;  2HBL A;  2HMI A;  3KD5 E;  4H5T A;  3OYC A;  4DTJ A;  3KWI A;  1VQP N;  2Y1I A;  3EZ5 A;  1NK9 A;  3MCA B;  5DK5 A;  4BRA A;  4E1N A;  2ZGZ A;  3OVN A;  3K5M A;  3NHG A;  1KFD A;  3DMJ A;  3GL1 A;  3TPQ A;  4CZE A;  3THX B;  3I33 A;  4FWL A;  4BRM A;  2D0A A;  4CFB A;  4B9Q A;  4CHP A;  1GLF O;  1HX1 A;  4PKI A;  2GUP A;  3HM8 A;  4H0O A;  4LC9 B;  4KH6 A;  3CER A;  1VSI A;  1W7A A;  5LMU K;  4CJQ A;  4I2P A;  4YDU A;  2RN2 A;  3ATU A;  1BU6 O;  3VGK A;  1ZYQ A;  3S9H A;  3KK3 A;  4HUF A;  3SV4 A;  3ZSR A;  1RDW X;  4KHU A;  3ZX0 A;  3R3L A;  2O8B A;  4BAC A;  2O8C B;  5EXW A;  1WAF A;  2E8A A;  1XMO K;  2W41 A;  2YV0 X;  1VSF A;  4BR0 A;  3TTC A;  4C8L A;  4PKH A;  4CGD A;  2NUB A;  1YXQ A;  4CJL A;  4FJM A;  4A59 A;  1QQM A;  4QOZ B;  4CEB A;  2QW9 A;  4X62 K;  2XY5 A;  3CI5 A;  1NK7 A;  3GDQ A;  1U2V A;  2A41 A;  5MLC Q;  1S6Q A;  3B8A X;  3K9J A;  3CET A;  3ISN C;  5GIO A;  4KHP K;  4H0T B;  4TSX A;  1IBL K;  3EKU A;  3K0S A;  3VET A;  3LP0 A;  1MDU B;  2ZE2 A;  1T03 A;  1SAZ A;  1EP4 A;  3ZEU B;  3NVK A;  4JKB A;  4EP4 A;  4QCL A;  4ILG B;  4FWQ A;  3LDO A;  4FOI A;  2KHO A;  1NMD A;  3QIC A;  2A42 A;  4B9L A;  1LOT B;  4HTU A;  3U9D A;  1EET A;  4FLV A;  2D0O A;  3VA0 A;  1S6P A;  3VF4 A;  3L4Q A;  1ZBF A;  1TAU A;  1QTM A;  1CZ9 A;  1D4X A;  4CJ4 A;  3VQ8 A;  4J2E A;  1QZ6 A;  3AO3 A;  3ZSY A;  1TV6 A;  4AH9 A;  3VQ7 A;  5EU7 A;  4ISG A;  3MEG A;  3SK3 A;  4IO8 A;  2QTD A;  1X9W A;  4DS4 A;  1XI1 A;  3AA3 A;  1TVR A;  4KHY A;  3L2Q A;  1BI4 B;  1WNS A;  1BUP A;  1U48 A;  2IDO A;  4HTL A;  4ELU A;  1VSE A;  4WYB A;  3HP6 A;  3C6T A;  4NXN K;  2HHH K;  4RW8 A;  4BR9 A;  3DLB A;  2QWN A;  4CEZ A;  1IKY A;  4JS4 A;  3H6E A;  2WBN A;  4W5T A;  1VSJ A;  1YUW A;  3Q7B A;  5ELZ A;  3TAF A;  4IEI A;  3O9U A;  3L3U A;  4CZK A;  2F4V K;  2KFN A;  3AV9 A;  5TKW A;  3C6H A;  5KRT A;  3AAR A;  1I94 K;  5C10 A;  3P5J A;  1GOC A;  3K5N A;  2FBV A;  3RVC A;  3NBP A;  3V6D A;  3S3N A;  3QIN A;  1LCU A;  4LH4 A;  4JI5 K;  4EAH D;  3ULE A;  4CJF A;  4JK8 A;  3PIP L;  2GUI A;  4X66 K;  5M1N A;  4DV6 K;  4DR6 K;  4GV6 A;  4Z4C A;  4O0I A;  4L3Q A;  4E7H A;  4JKC A;  4C8M A;  2HVH A;  4CGF A;  4FLW A;  2O8D B;  3E9O A;  1Q18 A;  3NF9 A;  1BQN A;  4IZ9 A;  5FPM A;  2O8E B;  5AQF A;  4AIL C;  2P5G A;  4FZZ A;  2KZZ A;  3RSE B;  4G1Q A;  3KKS A;  4DV3 K;  3CQX A;  2EWS A;  1KAZ A;  1XHX A;  4LFA K;  1WLJ A;  3OYE A;  4FK2 A;  1NJW A;  4M3W A;  4Y1D A;  2GEL A;  3PX4 A;  4R5P A;  4CZI A;  1YIJ N;  3CJ1 A;  4JKD A;  4BRL A;  3AO2 A;  2O8B B;  2YJF A;  4DV4 K;  4W5O A;  2ZWH A;  1E4G T;  3ZSZ A;  1JL1 A;  5F2R A;  1Q82 O;  1LWF A;  5K14 A;  1JLE A;  3WXJ A;  1RT6 A;  3H3O B;  2EX3 A;  5F1X A;  4K25 A;  5FRO A;  3J7Y P;  4DV0 K;  3TSQ A;  3WQU A;  3GOI A;  3EL2 A;  1JLB A;  2NRT A;  4FLT A;  3DRR A;  2P9P A;  3SCX A;  4K8Z A;  1RT2 A;  2O8F A;  4DQQ A;  5JS1 A;  4DU1 A;  3DLH A;  1VQ4 N;  4GKJ K;  2NRX A;  1RTJ A;  4B3O A;  3OYM A;  2IVO A;  1NU0 A;  1XWL A;  4I9L A;  1RBT A;  4E7I A;  4YNQ A;  4M7Y A;  2YHW A;  4Y0W A;  5AZI A;  1TGO A;  3L0Q A;  4ZTF A;  3C7N A;  1K73 O;  4DTP A;  3CCJ N;  2YHY A;  1KXP A;  4WQ4 C;  4E7K A;  4FLX A;  4I7F A;  4DB3 A;  3OS2 A;  2VG7 A;  3BZK A;  4Q0B A;  3EKS A;  3QEI A;  2V7Y A;  3KK7 A;  2NLX A;  4E19 A;  3O3F A;  3OJU A;  4DQI A;  1S72 N;  1XC9 A;  3TAM A;  1KRP A;  3D6R A;  2CH6 A;  4XH4 A;  2E1Z A;  2GX9 A;  3IUC A;  4EZ9 A;  4BR5 A;  3ZT1 A;  2JWK A;  3U3Y A;  2QEX N;  1TL1 A;  3BY5 A;  3K9K A;  4RWT A;  4BC4 A;  1EWQ A;  2KW4 A;  3PLA A;  4PUO A;  4QS9 A;  1K6Y A;  5JMV A;  2HBM A;  3OTO K;  1RT3 A;  3N4P A;  3K5O A;  1M90 O;  3A0I X;  4CFC A;  5AQS A;  4EHU A;  1JLG A;  3ZSW A;  3OYG A;  1QSS A;  2Q2R A;  4ZTJ A;  3AVL A;  3NAE A;  2B5J A;  3BF3 A;  4H5V A;  4JI3 K;  3AVN A;  2QWQ A;  3P38 A;  2J4R A;  3OS0 A;  4WQ5 C;  4CIE A;  1SKR A;  3ULE B;  4Z94 A;  2QA4 N;  4BC5 A;  1QE1 A;  3KLH A;  3HI0 A;  3SJH A;  4EHT A;  4FJL A;  3V9X A;  1LV5 A;  1ITG A;  3CJB A;  3F9K A;  4DFJ A;  2H3G X;  3C94 A;  3RRG A;  1S9E A;  3D7E O;  4KV8 A;  3BUZ B;  1BIS A;  3OYD A;  1EX4 A;  3C95 A;  5AZJ A;  1KLN A;  2NRH A;  2HBK A;  3KLF A;  5KGW A;  4K42 A;  4E89 A;  1C1B A;  1LAW A;  5C12 A;  4GV9 A;  4FJ5 A;  3DOK A;  2I5J A;  2GBZ A;  4M42 A;  3KKR A;  4CFD A;  3NCI A;  3ID8 A;  5BN8 A;  5FDL A;  4CF0 A;  1Q86 O;  3CHW A;  3AVH A;  4CJS A;  1X9J A;  5FRM A;  4YHH K;  3H1Q A;  5BN9 A;  1S9G A;  2Y1J A;  1ATS A;  2V7Z A;  1HR0 K;  4RG8 A;  2UXC K;  1YJ9 N;  4J2B A;  2QXL A;  1N5Y A;  2P9P B;  3O8M A;  3HYF A;  2QWR A;  1BG3 A;  4FLZ A;  4N76 A;  3O9S A;  2WTU A;  3RMA A;  3LDN A;  3HST B;  4BWM A;  5AFU H;  5EOY A;  1JLF A;  4HCB A;  4KH4 A;  3ZET A;  4AM6 A;  3LM2 A;  1VRT A;  3HM9 A;  4OPH A;  4J2D A;  1BIU A;  5GAE P;  2YHA A;  2YNH A;  5ADX A;  3G10 A;  3LP1 A;  2D5R A;  1RGI A;  1YF5 L;  3SQ2 A;  3NGI A;  1T44 A;  2FC0 A;  3SBT A;  3TAP A;  2PYL A;  4JI7 K;  3ZX2 A;  1RT7 A;  4NCB A;  5HRO A;  3CCM N;  4AQY K;  3SQ0 A;  4FVM A;  3QIO A;  2JLE A;  4WE1 A;  1BA1 A;  1S3X A;  2ITM A;  3PO4 A;  4H03 B;  3E66 A;  2F9T A;  3KIO A;  2P9N A;  4CJE A;  4M45 A;  2DFH A;  4BRN A;  4JV5 K;  1YTA A;  1SUQ A;  4NO7 A;  1NGJ A;  1RDD A;  2FBX A;  3A5L C;  3HP9 A;  1VQL N;  1ZBL A;  4H5N A;  4CFA A;  5CZ2 A;  3MX2 A;  5GAD P;  2P5O A;  2VG6 A;  1A5X A;  1FJG K;  4K41 A;  4M3U A;  4DS5 A;  1TKD A;  5EX5 A;  3AVB A;  3LM9 A;  1BL3 A;  4JD2 B;  4CEQ A;  3ITH A;  4DR2 K;  2YHX A;  1Q9X A;  1W97 L;  2FBY A;  1NBW A;  1OH6 A;  4BC2 A;  3PSI A;  1NMN A;  5GAG P;  1RTD A;  4IG0 A;  4H0V B;  3ZSX A;  3ZT2 A;  2XO7 A;  1NK0 A;  4LF7 K;  3CJC A;  4FJ8 A;  2AP1 A;  2UYT A;  3LL3 A;  3ALY A;  5AZJ B;  3K58 A;  1Q9Y A;  3OYF A;  2Q1N A;  2KQ2 A;  5M1O A;  5C15 A;  4MDA A;  3J7A P;  3SBG A;  3L3V A;  1NOZ A;  1NLV A;  2FF6 A;  1QVF M;  1FKP A;  4WQ4 A;  1K8K A;  1YVU A;  3KK1 A;  3ENO A;  3QEW A;  4KHW A;  4OX9 K;  3E1Y A;  3ZYY X;  5KRS A;  2W40 A;  2G8F A;  3JAM O;  4BE2 A;  4DR3 K;  4JI6 K;  5BPL A;  3LZI A;  4BR7 A;  3W0L A;  4B1Z A;  3CC7 N;  1WAJ A;  4RW4 A;  2XY6 A;  3MWP A;  4FZY A;  1ILY A;  4B1V A;  1ZBS A;  3VQD A;  2UXD K;  3EE8 A;  3SUQ A;  5I9E B;  2KZM A;  2FF3 B;  4F2R A;  3DJC A;  4FJ7 A;  1TAQ A;  1OVQ A;  5AQW A;  2PYJ A;  3F5T A;  4YOW A;  1IBK K;  3WQT A;  4Z0U A;  4DLE A;  2HMP A;  3ZLJ A;  2DPN A;  4YOR A;  3QBX A;  1TKX A;  1X9S A;  4H0X B;  3DRP A;  4FJJ A;  2XY8 A;  3AVA A;  3ZET B;  4Z4G A;  4EIA A;  2NRV A;  4DTO A;  4LF9 K;  3DRS A;  4W5Q A;  4FO0 A;  1KFS A;  2P9U A;  4WQ5 A;  4IOA L;  3AVM A;  4CEF A;  1HKC A;  2NRR A;  4BRE A;  5BRH A;  3TWH A;  3WXI A;  2ZJP L;  3UKR A;  1QZ5 A;  4OLA A;  1WSJ A;  4CEE A;  3ENH A;  1L3U A;  1HRH A;  1GLD G;  5JS2 A;  5IWA K;  3VF6 A;  3CFO A;  2P9N B;  1YJW N;  1VSL A;  4DTN A;  3LDS A;  2R7Y A;  4O5B A;  1V4T A;  4BGB A;  4EFH A;  3OYK A;  3L2U A;  1NKB A;  1R0A A;  3CF5 L;  4DV7 K;  3LP2 A;  2D0B A;  5AQY A;  3SAF A;  4DF8 A;  1JXB A;  4CF9 A;  4C8K A;  3WEE A;  3DM2 A;  3GG4 A;  1H1V A;  4DFP A;  3QB0 A;  2X74 A;  1OVY A;  4Y1C A;  1NKE A;  3DLL L;  1Y64 A;  1Z6R A;  4CJU A;  2F96 A;  3EO3 A;  4LF5 K;  3QO9 A;  1NGA A;  2FLO A;  4IG3 A;  4A5A A;  3NDK A;  1RT1 A;  2OPP A;  4CGG A;  3O08 A;  1QQO A;  5B8H A;  5AJ3 K;  2FSK A;  3QML A;  4JS5 A;  2DTU A;  4JKG A;  1N33 K;  1DEJ A;  3MCP A;  4CF2 A;  4JEP A;  1J53 A;  2OZM A;  4IBN A;  1J5O A;  3DWL A;  1NK4 A;  3S3O A;  1LW2 A;  3K5L A;  3VES A;  4FOE A;  2DFF A;  3VOV A;  3MDQ A;  4B1U B;  3WUH A;  1B9D A;  4CHY A;  5CYQ A;  2G8W A;  5HRP A;  4YY3 K;  3HK2 A;  5KGX A;  1VQ7 N;  2KKZ A;  3CD6 N;  2VYP A;  3A2F A;  3LAN A;  1BIZ A;  2P9S A;  4FXD A;  4DF4 A;  3H3N O;  2D4W A;  4O8K A;  4FW1 A;  4KTQ A;  3M6G A;  3OY9 A;  2HNY A;  4B3M K;  5J2P A;  3G71 N;  3SQ1 A;  3EN9 A;  1N34 K;  3QET A;  3O9T A;  1NK8 A;  3NF8 A;  1P90 A;  2BDP A;  5HRS A;  4E3S A;  1NGC A;  1WUA A;  3QFU A;  4DR7 K;  4OKK A;  1Q8I A;  4A57 A;  3FGU A;  3KTQ A;  3RTV A;  4IJN A;  4Q5V A;  4I2Q A;  1W0H A;  3KZB A;  3EY1 A;  1HNX K;  1TUY A;  2F7T A;  4M3Z A;  1QHA A;  4GV3 A;  1QS4 A;  2QKB A;  1ESV A;  1KC8 O;  2ZF5 O;  5CR4 A;  4RW7 A;  4BRC A;  4W5R A;  3H08 A;  3KD1 E;  4DR1 K;  4DMN A;  4JHD A;  5BRD A;  2WC9 A;  3R9P A;  1SL0 A;  3MN5 A;  4M63 C;  3CFR A;  4BDY A;  2P9U B;  5D3G A;  3QDK A;  4DSK A;  4CZH A;  3I8D A;  3LWL A;  3NMU A;  1YTU A;  1NG9 A;  4BY9 C;  1HKB A;  5SZT A;  1TYQ A;  3A5O C;  1KD1 O;  3UKR B;  5FPN A;  2ASM A;  3SNN A;  4YOY A;  3L2R A;  1X9M A;  1X3M A;  4E1M A;  3CFP A;  2HHU A;  1G15 A;  3KVG A;  4CJ7 A;  3M3Z A;  3M8R A;  3WNF A;  4LSL A;  4AM7 A;  4LF4 K;  1XNQ K;  4GMJ B;  4WFA L;  2P9I B;  5HRN A;  3SJJ A;  4IFV A;  1S22 A;  2NRZ A;  2VCP A;  4ID1 A;  3LAM A;  1ZBU A;  2IIR A;  4BRK A;  3M8Q A;  4IDK A;  1U4B A;  1NGB A;  4F9O A;  4CK3 A;  3HPO A;  4OJR A;  1KQS M;  5J1E A;  1SL2 A;  4FJI A;  1VQ6 N;  4M7X A;  4Z4E A;  5M1K A;  4JK9 A;  1TUU A;  3MEE A;  3VQA A;  3L8B A;  1RTH A;  3UKU A;  2W6L A;  1GLE G;  3SAG A;  3H1V X;  4DLG A;  1QSY A;  1TKT A;  3R1X A;  3MMV A;  4DCH A;  1HNZ K;  1Z25 A;  4PL7 A;  3AA4 A;  4O4G A;  4B3S K;  3KLG A;  1TK8 A;  4JKG B;  1RT5 A;  3VEX A;  3MXJ A;  1BCO A;  4WFB L;  5AQQ A;  2E2Q A;  3VTI A;  3GBT A;  2I7P A;  2OA8 A;  2P9L A;  1BOT O;  1X1P A;  4MLE A;  4DV2 K;  4FYD A;  3OBY A;  1YAG A;  1MWK A;  3VEY A;  3PX6 A;  2P9S B;  4H0P A;  4FVU A;  4JN4 A;  3CCE N;  1HYV A;  3TSU A;  3OS1 A;  2A1R A;  3VQE A;  4GKK K;  1JL2 A;  4I9Q A;  2Q31 A;  1HNI A;  1U2V B;  3DLG A;  4B9N A;  3O9Q A;  1D5A A;  4OPK A;  4DTR A;  1KVB A;  3R6M A;  1KVC A;  2YX6 A;  3L2W A;  4CEA A;  4M3T A;  5HBM A;  1KTQ A;  1QHT A;  4XIU A;  1I39 A;  2ZD1 A;  1NGI A;  3KK2 A;  2CGK A;  2FXU A;  3U4L A;  3KHY A;  1MU2 A;  5AQI A;  4FWP A;  4OPA A;  2G8I A;  4KFB A;  3QNN A;  1NKC A;  1HUX A;  3TAB A;  2A5X A;  4ISF A;  1ATN A;  5AQV A;  2PAV A;  2NZT A;  3NF7 A;  4MFB A;  4B1X B;  2YKM A;  3P83 D;  3ZT3 A;  1EKE A;  4DG1 A;  2BH1 A;  4U7B A;  4BDZ A;  2OAN A;  4A2A A;  4NXM K;  3V9W A;  4QS7 A;  4CHQ A;  1E4F T;  5AR0 A;  2ETJ A;  1I3A A;  3QEP A;  3C0B A;  3AVG A;  4OPJ A;  4B9V A;  5CYM A;  4LSN A;  3VER A;  1YI2 N;  1BDG A;  3V1O A;  4QAG A;  3CJA A;  1KAX A;  4FWS A;  3IFR A;  4K43 A;  4FZX C;  4KRF A;  4MDB A;  4C1N I;  2UXB K;  5AQP A;  1MA9 B;  1N6Q A;  2CGL A;  1JCG A;  3V9S A;  4N47 A;  1EWR A;  2WON A;  3O4W A;  4RW9 A;  3THW A;  4B1Y B;  4BRQ A;  1XMQ K;  1VHX A;  2OPR A;  3DXM A;  4B8A B;  4PWD A;  4L8R B;  2Z1G A;  3NH0 A;  3VQ6 A;  3MED A;  1LAV A;  3CQ8 A;  3CCS N;  3VQB A;  2FSN A;  3AVC A;  4CJ5 A;  1FK9 A;  1HNW K;  2HNZ A;  1ASV A;  4GNI A;  2JWL A;  3NH1 A;  1T8E A;  5GIN A;  1K9M O;  4DR5 K;  3ZSO A;  3UKU B;  3T69 A;  3D2F A;  1Z26 A;  4R79 A;  5JVG L;  2I7N A;  1Q7Y O;  4KI6 A;  1NNE A;  1VK0 A;  4HUG A;  3TAE A;  1NJI O;  2E2O A;  5LY3 A;  3IAY A;  4IOX A;  3R8E A;  1WBD A;  4FPA A;  1YJN N;  3HJF A;  1XHZ A;  4BRO A;  4DSL A;  4IKF A;  3OYL A;  1OKJ A;  3E9L A;  1N32 K;  2HW3 A;  1Y97 A;  4A5B A;  1T05 A;  3VGL A;  3LWM A;  5HRR A;  2P9L B;  3TR8 A;  4ISE A;  4CER A;  4DU4 A;  4XEI A;  1CZB A;  3RMD A;  3MXM A;  2P1J A;  2YI1 A;  5HP1 A;  2E88 A;  1ATR A;  4FK4 A;  5KPT A;  3BP8 A;  3O4N A;  1WBB A;  4J2A A;  1RIL A;  1SZ2 A;  3LPT A;  2ASO A;  3IDH A;  1XQS C;  1BHL A;  4KO0 A;  4CK1 A;  1JCE A;  3V1R A;  1QVG M;  2YKN A;  2HHV A;  3THY A;  5EVZ A;  1ZBI A;  1JKH A;  5CY4 A;  1JCF A;  4KHN A;  2VWB A;  2O8F B;  4E1J A;  1BGX T;  3SQ4 A;  4AHU A;  3FZH A;  3DOL A;  4NYN A;  3HTV A;  1WSE A;  1TK0 A;  5TKY A;  3AO5 A;  3AO1 A;  3PY8 A;  2A3Z A;  3ZT4 A;  1CLQ A;  4CCH A;  4JI0 K;  3BGR A;  1GLB G;  3ZSV A;  3CM6 A;  4AHR A;  5AZI B;  3T7Z A;  1RFQ A;  1OH8 A;  2ZM6 K;  2PBD A;  2Z1H A;  2ZGY A;  3C7N B;  5AQU A;  4CW7 B;  5H1S Q;  5FRN A;  3J81 O;  1B9F A;  5FLX O;  1UA0 A;  1RBV A;  5AQX A;  3QEV A;  4O44 A;  2Q97 A;  3G6E N;  4M3R A;  4NCA A;  4IO9 L;  3HVT A;  1J54 A;  2XY7 A;  4LF6 K;  3EZW A;  4NCG A;  3CIP A;  4DTU A;  5I3U A;  4LF8 K;  3VF2 A;  3CM5 A;  1RDB A;  1RBS A;  1RCH A;  4OKE A;  2E6L A;  3E01 A;  3KLI A;  2QK9 A;  4IEE A;  3MN9 A;  4B08 A;  5CE3 A;  2X6S A;  4AHT A;  4IXC A;  5ADX H;  2DFE A;  1G99 A;  3CJ7 A;  3THW B;  1ASU A;  2Q0R A;  2HVI A;  4O8U A;  3QFP A;  4IFE A;  3DXM B;  2B6A A;  4UQG A;  4C23 A;  3VQ5 A;  2IOC A;  2BTF A;  4CD1 A;  3D2E A;  4CZG A;  3THV A;  4O55 A;  2YJE A;  1JXE A;  2OCE A;  1NM1 A;  2F8T A;  3E9P A;  2EHG A;  2A6A A;  4OGC A;  3WNG A;  2GV9 A;  4CVN E;  4RTF D;  4U67 L;  1NGH A;  3CXC M;  3G25 A;  3OA9 A;  2HF3 A;  4BE1 A;  3QEX A;  3D2F B;  5C2D A;  3NE6 A;  2P51 A;  3DI6 A;  3HSC A;  4H0Y B;  4JRQ A;  3HO1 A;  3LDQ A;  3ASM A;  1Z05 A;  3EE9 A;  3QLH A;  3HXM A;  3HPH A;  1VQ9 N;  3WXL A;  1C1C A;  4FLY A;  5AQO A;  2UUC K;  4IFY A;  3SUN A;  4JK7 A;  4F3O A;  3MX5 A;  4ID5 A;  2RKI A;  4FJG A;  5AQT A;  4ILH A;  1HQE A;  3C65 A;  3TAQ A;  1L5U A;  4MO5 A;  2PFU A;  2BAN A;  2IS3 A;  3SPY A;  5JIC A;  2KLA A;  3O9R A;  3LDL A;  2WOM A;  1SKS A;  5KQ8 A;  5HLF A;  4DQR A;  1HYS A;  1U6Z A;  5T7B A;  2NRW A;  1RTI A;  3VEW A;  3TAG A;  3TI0 A;  1IKW A;  2F9W A;  4FJX A;  1REV A;  4H5W A;  4RCH A;  4KH5 A;  4YOX A;  4ICL A;  2YNI A;  4M3X A;  4UY8 O;  1VSK A;  1WSF A;  4CBW A;  4F2S A;  2E20 A;  5HOO A;  2HOE A;  4BGA A;  3FFI A;  4HVJ A;  4BRF A;  1IBM K;  4LH5 A;  1C0T A;  1ZXO A;  2IGI A;  1HPZ A;  3P4I A;  4PL8 A;  3RR7 A;  1F21 A;  3JS6 A;  2Q3S A;  3FZM A;  5I42 A;  4H8K A;  2IVN A;  1DT9 A;  3VGM A;  5C2F A;  4WF9 L;  2FBT A;  4DHY A;  1J5E K;  1MWM A;  1T7P A;  4LY7 A;  3VA3 A;  3ZEU A;  3P39 A;  1GLC G;  4JI8 K;  2CGJ A;  1S1T A;  4BWJ A;  3FZK A;  4J8F A;  4FJ9 A;  1UA1 A;  4M41 A;  3OYA A;  1FXX A;  4ILJ A;  2G8H A;  2ZJQ L;  4O5F A;  4FK0 A;  5DM6 L;  3HOS A;  1VQO N;  1NK5 A;  1DLO A;  5AQJ A;  1XUP O;  2V52 B;  2F8S A;  3A5M C;  5KI6 A;  2E2N A;  4N41 A;  5DMR A;  3ID6 A;  1W9H A;  5BR9 A;  3TSP A;  1T6D A;  3K2P A;  3D0P A;  4FWO A;  5CHI A;  5GAH P;  1YHQ N;  2XRI A;  1S1U A;  2JGU A;  4PA1 A;  4B9S A;  5KQD A;  1WOQ A;  3NFA A;  2VWK A;  4EP5 A;  3L6Q A;  4DKW A;  4DV1 K;  4CGJ A;  2VQF K;  3AY9 A;  2RHK A;  3TAN A;  2P9K A;  3AAQ A;  3UIQ A;  2OPS A;  3WT0 A;  2VWJ A;  3LAK A;  1BI4 A;  1GLA G;  1IV0 A;  3FFK B;  1TK5 A;  2RF2 A;  3SMS A;  3PV8 A;  1CZA N;  3M5R A;  1BA0 A;  3D2E B;  4E0D A;  1X3N A;  1D8Y A;  1RBR A;  1CXQ A;  2FSJ A;  2B4J A;  4H4O A;  2D0C A;  2YNG A;  4H4M A;  5E84 A;  4CES A;  5C0Y A;  2IVP A;  3J7Z O;  3O6W A;  2QWL A;  2XHB A;  4K8X A;  4BRP A;  4O0J A;  3VEO A;  2G8U A;  4CJW A;  3A5N C;  5AQK A;  2Q0U A;  1O1W A;  4XH1 A;  1DTT A;  4CHO A;  2NNW A;  4DFK A;  4BQZ A;  4GVM A;  2O8D A;  2RPI A;  2O8E A;  4CZJ A;  4DQ8 A;  4BRH A;  4A61 A;  3WNH A;  3CQY A;  3DXK A;  1K8K B;  3RSE A;  4CZL A;  3OYB A;  5KTQ A;  4RW6 A;  3A8Y A;  3HPG A;  4DU3 A;  1GLL O;  2YCH A;  4PKG A;  3O5B A;  1V4S A;  2E2P A;  1TKZ A;  1O13 A;  4GW6 A;  5BRE A;  2QXF A;  3O1W A;  1NJX A;  1KAY A;  2G8K A;  5BPM A;  2VG5 A;  4CE9 A;  1QQC A;  3ENB A;  1FKO A;  3S41 A;  1K8A O;  3KJV A;  3T1H K;  4FJK A;  3HOT A;  3AVJ A;  1GOA A;  2HHW A;  3VQP A;  1NWK A;  1Q81 O;  3PX0 A;  3H46 O;  3CPW M;  2OPQ A;  5DM7 L;  2YNF A;  2YHB A;  4HWI A;  3RWU A;  3AGR A;  4C1N K;  4FJN A;  3VQQ A;  4K0K K;  1QSL A;  1NGE A;  5E26 A;  1HLU A;  5C25 A;  1BQM A;  1L3S A;  2QM1 A;  3J8A A;  4FJH A;  5FPE A;  4Z4H A;  5JVH L;  4KHS A;  4CGH A;  1S1W A;  1LW0 A;  3CCQ N;  2KFZ A;  3DYA A;  1M1K O;  3AA5 X;  3G0Z A;  4LD0 A;  4B9T A;  4GVE A;  2Z1I A;  1GOB A;  1SS6 A;  5AQH A;  2UU9 K;  4CJT A;  1C0F A;  3O3G A;  3J80 O;  3F73 A;  1XNR K;  1U45 A;  2WUS A;  3QBW A;  4JLH A;  1S1V A;  3MWT A;  4FLU A;  5AQN A;  4E7L A;  1EQY A;  3FZF A;  4DSF A;  3O80 A;  2LSN A;  1D9D A;  4CHZ A;  4G9Z A;  5LMN K;  2P9K B;  3F2K A;  2O4I A;  4IOC L;  2GEM A;  3NH2 A;  4NLC A;  2DY4 A;  3SUO A;  3PIO L;  2PY5 A;  3LZJ A;  2HST A;  4ZHR A;  3UE5 A;  3SI6 A;  3WEE B;  3CC2 N;  4I6M A;  5FPD A;  4JYA K;  1RT4 A;  4ELV A;  2HHQ A;  4OKJ A;  4YOV A;  3NVM A;  2ASP A;  4DTX A;  1IH7 A;  4JKF A;  2X6N A;  4B8C A;  2KTQ A;  4GY2 B;  3BF1 A;  5BRF A;  4B3T K;  1RDA A;  3EEQ A;  5BR8 K;  3SUP A;  1KSP A;  1HYZ A;  3M1F A;  2W6K A;  3GE1 A;  2ZQB A;  4AHS A;  2GTD A;  1NJZ A;  4C8O A;  4PQU A;  1HJO A;  4JKE A;  1SKW A;  2W42 A;  3VN5 A;  4CF8 A;  2AA4 A;  1VSD A;  4F3T A;  3DXK B;  4PY5 A;  4YFU A;  3TU5 A;  3SV3 A;  2ATQ A;  1NGF A;  2Q36 A;  3AO4 A;  1DGK N;  3NGY A;  3P31 A;  3LDP A;  2OTJ N;  3V4I A;  3BEX A;  3QIP A;  3RMC A;  4CBX A;  2HB5 A;  3VEN A;  3OYH A;  2VQE K;  4CF1 A;  1ZBH A;  1VQN N;  1ASW A;  3V1Q A;  3JXU A;  4CEC A;  1BWF O;  1SQK A;  3IMX A;  4KTZ A;  4BRG A;  4V19 S;  4NLB A;  2BE2 A;  1EXQ A;  3SYZ A;  3LP3 A;  1YIT N;  3IKM A;  1L3T A;  5J2Q A;  4KTW A;  1NGD A;  3L4I A;  2HF4 A;  3U6F A;  4JHD B;  3I56 N;  3B6O A;  4BG8 A;  3CCV N;  4EZ6 A;  4B1W B;  4A62 A;  4CBU A;  3ATV A;  1ZC6 A;  4JKH A;  3OBW A;  4JI4 K;  4FM2 A;  4CHN A;  1CXU A;  3O1B A;  3CCR N;  4IWV A;  1B92 A;  3IG1 A;  4YOT A;  4XH5 A;  3B6P A;  1TYQ B;  4CJR A;  1NK6 A;  4DQS A;  4BRD A;  4LFB K;  1VQ5 N;  2E6M A;  4F8R A;  4KBO A;  2G8V A;  5M1Q A;  2D0P A;  3DAW A;  2HHT A;  3AGK A;  4LFC K;  2WFB A;  3M8S A;  3U9Z A;  3K59 A;  3QES A;  3HRG A;  3L2V A;  4Z4F A;  4JAX A;  2E1Y A;  1IO2 A;  1SV5 A;  4CZF A;  2PZS A;  1JLQ A;  3AVF A;  3WXK A;  1JJ2 M;  1WSH A;  5J2M A;  4KKO A;  4BRI A;  4X64 K;  3UB5 A;  1KLM A;  3U8X A;  4JRP A;  3H45 C;  5LL6 Z;  4HHT A;  1NJY A;  2CH5 A;  3K57 A;  1C0G A;  4FM1 A;  1IG9 A;  1XC3 A;  2GWK A;  4I6M B;  4CD3 A;  1JLA A;  2E5L K;  3SAH A;  3CMA N;  4HUE A;  2QWP A;  4N5S A;  3AVI A;  1WB9 A;  3OHR A;  4JI2 K;  3VQ9 A;  1VQ8 N;  4OVL A;  4JD2 A;  3KLE A;  4DFM A;  3HT3 A;  3LPU A;  3HBT A;  1VSM A;  4MQ3 A;  2GWJ A;  1NOY A;  1UWB A;  4DQP A;  1C0M A;  3SZ2 A;  4KHQ A;  4DUZ K;  3Q7C A;  4AF1 A;  1VSH A;  3DLK A;  3FE1 A;  2QI2 A;  3TTD A;  1FW6 A;  3WNE A;  5AQR A;  3JYT A;  2V51 B;  4FWK A;  5KPZ A;  3MN6 A;  1WSG A;  3W3D A;  3S3M A;  3EYZ A;  3FLC O;  4CJK A;  3HVR A;  4JKA A;  3RMB A;  1HMV A;  3VTH A;  3I0R A;  3IS9 A;  5AFU A;  4CIG A;  4AHC A;  3PSF A;  1W2B M;  3OJS A;  4WCE L;  1DKG D;  4DTS A;  4FWN A;  1IJJ A;  4BQL A;  4DSE A;  4N56 A;  4BR2 A;  5AQM A;  4FL9 A;  4BVP A;  3OYJ A;  1HQU A;  1N8R O;  4FCY A;  4BG9 A;  5F0X A;  4ELT A;  3HZ6 A;  4FSV A;  1T6C A;  1P8Z A;  4OGE A;  4F4K A;  4PHT X;  5JLH A;  3CYM A;  4W5N A;  3I0S A;  1R59 O;  3CG7 A;  4YDU C;  1VAZ A;  1N36 K;  2QKK A;  4JNE A;  3FR0 A;  1RBU A;  1EO1 A;  4WFN L;  4BDP A;  2VGN A;  5C24 A;  3PUF A;  4BC3 A;  3RR8 A;  3F9M A;  3LAL A;  4FWR A;  4CZM A;  3C6A A;  1D9F A;  5LJW A;  4X65 K;  1HKG A;  4FWM A;  1WSI A;  3OW2 M;  4H5R A;  5EY4 A;  4BE0 A;  5HL7 L;  3HL8 A;  3I55 N;  1C0U A;  3CME N;  3U3G A;  3FZL A;  2VGM A;  4DSI A;  4A2B A;  1A5V A;  1KCF A;  3PO5 A;  4Z4I A;  3SPZ A;  4C8N A;  4FW2 A;  3D45 A;  1JLC A;  3P1G A;  3VQC A;  4CJ3 A;  4YOU A;  1UAX A;  1L3V A;  1NGG A;  4OLB A;  1J6Z A;  3VPZ A;  5A2Q O;  4DTM A;  3BDP A;  3VEV A;  1E3M A;  4CIF A;  2OZS A;  5SWM A;  2BGG A;  3BZC A;  3O3H A;  4CGI A;  2IC3 A;  4M3Y A;  1RNH A;  2HHX A;  3ZCM A;  4KI4 A;  1U47 A;  4E7J A;  4B3R K;  1C1A A;  4NB4 A;  2A40 A;  3T1Y K;  3THX A;  3ZSQ A;  4DV5 K;  1IG8 A;  1GLJ O;  2O4G A;  3V9U A;  5M1P A;  3V81 A;  4DSJ A;  1U04 A;  2UUB K;  3SMP A;  4CK2 A;  3OYI A;  3CC4 N;  4KB0 A;  1T3V A;  3DLR A;  4FPB A;  2IAJ A;  2OYQ A;  1OH5 A;  1S1X A;  1TL3 A;  3VMF B;  3MEC A;  3AVK A;  3CJ9 A;  4CI6 A;  3CPE A;  2HBJ A;  3I8B A;  4OO1 J;  1VRU A;  4IDH A; 
#chains in the Genus database with same CATH homology
 1TKZ A;  3MXI A;  3JSM A;  3PX6 A;  3AVH A;  3NF6 A;  4GW6 A;  4CJS A;  4CED A;  2QXF A;  1NJX A;  5FRM A;  2G8K A;  1LWE A;  1HYV A;  2VG5 A;  4CE9 A;  1QQC A;  3OS1 A;  2A1R A;  1IKX A;  1FKO A;  3VQE A;  4CJV A;  4KPY A;  1WN7 A;  3QNO A;  3KJV A;  3TAR A;  1S9G A;  4FJK A;  1JL2 A;  4I9Q A;  3AVJ A;  1GOA A;  1HNI A;  3DLG A;  2Y1J A;  1DTQ A;  4B9N A;  3O4Q A;  3VQP A;  2HHW A;  1D5A A;  4RG8 A;  4KRE A;  4OPK A;  4DTR A;  1KVB A;  3PX0 A;  1KVC A;  3IRX A;  4J2B A;  1IKV A;  1N5Y A;  3L2W A;  4CEA A;  2OPQ A;  4M3T A;  3HYF A;  2YNF A;  2YHB A;  5HBM A;  1KTQ A;  1QHT A;  4FLZ A;  3RWU A;  4XIU A;  1UOC A;  4N76 A;  1I39 A;  4FJN A;  2ZD1 A;  4CEO A;  1YT3 A;  3KK2 A;  3VQQ A;  3RMA A;  1QSL A;  3RRH A;  2E4L A;  3HST B;  4BWM A;  3V9Z A;  5C25 A;  1MU2 A;  1BQM A;  1L3S A;  4CJP A;  3OYN A;  1JLF A;  1LWC A;  3DLE A;  3NGZ A;  2G8I A;  4KFB A;  3QNN A;  1NKC A;  4HCB A;  3TAB A;  4AHV A;  3VQ4 A;  4FJH A;  1VRT A;  3HM9 A;  4Z4H A;  4J2D A;  3NF7 A;  4CGH A;  1BIU A;  4MFB A;  4KHS A;  1S1W A;  2YHA A;  2YKM A;  1LW0 A;  2YNH A;  3P83 D;  3G10 A;  2KFZ A;  3LP1 A;  3DYA A;  1EKE A;  3ZT3 A;  4DG1 A;  2HND A;  2D5R A;  5CZ1 A;  3ZT0 A;  4BDZ A;  1U49 A;  3AA5 X;  3NGI A;  3G0Z A;  4LD0 A;  3V9W A;  3SQ2 A;  2FC0 A;  2Z1J A;  4B9T A;  3MAQ A;  4CHQ A;  2Z1I A;  1GOB A;  3TAP A;  2PYL A;  2ETJ A;  1I3A A;  3QEP A;  4CJT A;  2A1S A;  1RT7 A;  3AVG A;  4NCB A;  5HRO A;  3SQ0 A;  4OPJ A;  4FVM A;  3O3G A;  3F73 A;  1U45 A;  3T19 A;  4B9V A;  4JLH A;  3QIO A;  3C6U A;  5CYM A;  1S1V A;  2JLE A;  4LSN A;  4WE1 A;  5C42 A;  3V1O A;  3M8P A;  4QAG A;  4FLU A;  3QER A;  4E7L A;  4DSF A;  2LSN A;  1D9D A;  2AJQ A;  4NYF A;  3PO4 A;  4FZX C;  4KRF A;  4CHZ A;  3KIO A;  3T3F A;  5E41 A;  4DWI A;  4CJE A;  4M45 A;  2DFH A;  1N6Q A;  4B9M A;  4HCC A;  1S5J A;  1BCM A;  3AA2 A;  4N47 A;  3V9S A;  1HNV A;  1YTA A;  1SUQ A;  2ITG A;  2WON A;  4RW9 A;  1SL1 A;  2O4I A;  1C6V A;  2HHS A;  3NH2 A;  4KAZ A;  1RDD A;  2DY4 A;  2FBX A;  1A5W A;  3SUO A;  4B9U A;  3HP9 A;  3ULD A;  2PY5 A;  2OPR A;  1ZBL A;  4B8A B;  4CFA A;  4PWD A;  5CZ2 A;  3LZJ A;  5J2N A;  4ZHR A;  4L8R B;  3SI6 A;  2Z1G A;  2P5O A;  4KB1 A;  3NH0 A;  2VG6 A;  3VQ6 A;  3MED A;  1LAV A;  1HJR A;  3CQ8 A;  1RT4 A;  4ELV A;  1A5X A;  1KVA A;  3T1A A;  4OKJ A;  2X78 A;  3AVC A;  3VQB A;  2HHQ A;  4M3U A;  1J9A A;  1RDC A;  4DS5 A;  4CJ5 A;  1TKD A;  1FK9 A;  3AVB A;  4DTX A;  1IH7 A;  4FM0 A;  1BL3 A;  2HNZ A;  1ASV A;  2HMI A;  3KD5 E;  2X6N A;  4B8C A;  4CEQ A;  3NH1 A;  3OYC A;  1T8E A;  4DTJ A;  3ITH A;  2KTQ A;  3ZSO A;  1Q9X A;  2FBY A;  2Y1I A;  1Z26 A;  3EZ5 A;  1NK9 A;  1RDA A;  5DK5 A;  3SUP A;  4KI6 A;  1KSP A;  1HYZ A;  4E1N A;  1NJZ A;  2ZQB A;  3OVN A;  1VK0 A;  4AHS A;  3NHG A;  3K5M A;  1KFD A;  3DMJ A;  4HUG A;  3TAE A;  1RTD A;  4IG0 A;  3ZSX A;  3ZT2 A;  2XO7 A;  2D0A A;  4C8O A;  3IAY A;  4CFB A;  1NK0 A;  4PQU A;  4CHP A;  3HJF A;  1SKW A;  4FJ8 A;  2W42 A;  1XHZ A;  3VN5 A;  4CF8 A;  4DSL A;  4IKF A;  3OYL A;  2HW3 A;  3ALY A;  3K58 A;  1VSI A;  1Q9Y A;  1VSD A;  1Y97 A;  1T05 A;  4CJQ A;  3OYF A;  2KQ2 A;  4I2P A;  3LWM A;  4F3T A;  5HRR A;  4PY5 A;  4YFU A;  3L3V A;  1NOZ A;  2RN2 A;  3TR8 A;  4CER A;  4DU4 A;  1FKP A;  1CZB A;  1YVU A;  3KK1 A;  3RMD A;  3MXM A;  2P1J A;  3QEW A;  3SV3 A;  5HP1 A;  2ATQ A;  1ZYQ A;  4KHW A;  3AO4 A;  4FK4 A;  3S9H A;  3NGY A;  3KK3 A;  5KRS A;  4HUF A;  3O4N A;  3ZSR A;  3SV4 A;  2G8F A;  4J2A A;  1RIL A;  3V4I A;  4BE2 A;  3LPT A;  3QIP A;  3RMC A;  4KHU A;  4BAC A;  2HB5 A;  1BHL A;  4KO0 A;  1WAF A;  4CK1 A;  3OYH A;  3V1R A;  3LZI A;  4CF1 A;  2YV0 X;  1VSF A;  1ZBH A;  4C8L A;  1WAJ A;  4RW4 A;  2XY6 A;  2YKN A;  2HHV A;  1ASW A;  3V1Q A;  4FZY A;  4CEC A;  4CGD A;  1JKH A;  2NUB A;  3VQD A;  1ZBI A;  5CY4 A;  4CJL A;  4FJM A;  4KHN A;  3SUQ A;  4QOZ B;  1BGX T;  3SQ4 A;  4AHU A;  4CEB A;  2KZM A;  4KTZ A;  2XY5 A;  1NK7 A;  3DOL A;  4F2R A;  4NYN A;  1WSE A;  2BE2 A;  1EXQ A;  1TK0 A;  3SYZ A;  1S6Q A;  3AO5 A;  3LP3 A;  1TAQ A;  3AO1 A;  3ISN C;  2PYJ A;  3PY8 A;  4FJ7 A;  4TSX A;  3ZT4 A;  1CLQ A;  4CCH A;  1L3T A;  3BGR A;  3LP0 A;  5J2Q A;  2ZE2 A;  4KTW A;  1T03 A;  3ZSV A;  3CM6 A;  3U6F A;  4AHR A;  1EP4 A;  2Z1H A;  4Z0U A;  4DLE A;  4EP4 A;  3B6O A;  5FRN A;  1TKX A;  1X9S A;  4EZ6 A;  4QCL A;  3DRP A;  1B9F A;  4FJJ A;  2XY8 A;  3AVA A;  1RBV A;  1UA0 A;  4Z4G A;  3QEV A;  4O44 A;  4DTO A;  4B9L A;  3DRS A;  4FM2 A;  4HTU A;  1EET A;  4W5Q A;  4CHN A;  1CXU A;  4FLV A;  1S6P A;  3VA0 A;  1KFS A;  4M3R A;  4NCA A;  1B92 A;  1ZBF A;  3IG1 A;  3AVM A;  3B6P A;  4CJR A;  4CEF A;  1NK6 A;  1TAU A;  3HVT A;  4DQS A;  1QTM A;  1J54 A;  2XY7 A;  1CZ9 A;  4CJ4 A;  3VQ8 A;  4J2E A;  2E6M A;  4F8R A;  4NCG A;  2G8V A;  3AO3 A;  3ZSY A;  3TWH A;  2HHT A;  1TV6 A;  4AH9 A;  3VQ7 A;  4DTU A;  5I3U A;  5EU7 A;  4OLA A;  3M8S A;  1WSJ A;  3MEG A;  3K59 A;  4CEE A;  3CM5 A;  3QES A;  1RDB A;  1RBS A;  4DS4 A;  1XI1 A;  1X9W A;  1RCH A;  3L2V A;  4OKE A;  2E6L A;  1L3U A;  4Z4F A;  1HRH A;  3E01 A;  3KLI A;  3AA3 A;  1TVR A;  2QK9 A;  1IO2 A;  1SV5 A;  5JS2 A;  4KHY A;  2PZS A;  1JLQ A;  3L2Q A;  1BI4 B;  1WNS A;  4B08 A;  2X6S A;  3AVF A;  4AHT A;  3CFO A;  1U48 A;  2IDO A;  1VSL A;  4DTN A;  2DFE A;  1WSH A;  3LDS A;  1VSE A;  5J2M A;  4ELU A;  3HP6 A;  4KKO A;  3C6T A;  1ASU A;  4RW8 A;  2R7Y A;  3DLB A;  4O5B A;  4CEZ A;  2HVI A;  1KLM A;  4JRP A;  1IKY A;  4JS4 A;  3OYK A;  2B6A A;  4HHT A;  3L2U A;  4UQG A;  1NJY A;  4W5T A;  1NKB A;  1VSJ A;  3VQ5 A;  1R0A A;  3K57 A;  2IOC A;  3LP2 A;  3TAF A;  2D0B A;  3THV A;  4FM1 A;  4O55 A;  3L3U A;  4DF8 A;  2KFN A;  1IG9 A;  3AV9 A;  1JXE A;  1JXB A;  4CF9 A;  5KRT A;  4C8K A;  1JLA A;  3DM2 A;  2F8T A;  2EHG A;  3P5J A;  4HUE A;  4DFP A;  1GOC A;  4N5S A;  3AVI A;  4OGC A;  3K5N A;  2X74 A;  3WNG A;  2FBV A;  3S3N A;  3NBP A;  3V6D A;  2GV9 A;  3QIN A;  4LH4 A;  4Y1C A;  3VQ9 A;  4OVL A;  4CJF A;  1NKE A;  2GUI A;  4BE1 A;  3QEX A;  3KLE A;  4CJU A;  2F96 A;  3QO9 A;  4Z4C A;  3HT3 A;  3NE6 A;  2P51 A;  3DI6 A;  3LPU A;  4IG3 A;  4O0I A;  4DFM A;  1VSM A;  1RT1 A;  2OPP A;  4MQ3 A;  4CGG A;  3NDK A;  4JRQ A;  4C8M A;  4E7H A;  3ASM A;  2HVH A;  4CGF A;  4FLW A;  1NOY A;  3QLH A;  3NF9 A;  1BQN A;  3HXM A;  3HPH A;  1UWB A;  4JS5 A;  4AIL C;  2P5G A;  4DQP A;  2DTU A;  1C0M A;  4FZZ A;  4CF2 A;  3SZ2 A;  4KHQ A;  2KZZ A;  1J53 A;  2OZM A;  1C1C A;  4FLY A;  4G1Q A;  3KKS A;  4IBN A;  1J5O A;  1NK4 A;  3S3O A;  1LW2 A;  3K5L A;  1XHX A;  1WLJ A;  3OYE A;  1VSH A;  3DLK A;  4IFY A;  3SUN A;  4FK2 A;  4F3O A;  1NJW A;  2DFF A;  4ID5 A;  4M3W A;  2RKI A;  4Y1D A;  4FJG A;  1B9D A;  4CHY A;  5CYQ A;  2G8W A;  1HQE A;  5HRP A;  3PX4 A;  3WNE A;  3JYT A;  4R5P A;  3TAQ A;  3HK2 A;  1L5U A;  5KGX A;  2BAN A;  2IS3 A;  3A2F A;  3LAN A;  1BIZ A;  4FXD A;  3SPY A;  1WSG A;  4DF4 A;  3S3M A;  3EYZ A;  4CJK A;  3HVR A;  3AO2 A;  4FW1 A;  2WOM A;  1SKS A;  3OY9 A;  3RMB A;  2HNY A;  5HLF A;  4KTQ A;  1HMV A;  4DQR A;  5J2P A;  3SQ1 A;  1HYS A;  5T7B A;  4W5O A;  3I0R A;  1RTI A;  3TAG A;  3TI0 A;  3QET A;  3ZSZ A;  3IS9 A;  3NF8 A;  1IKW A;  1JL1 A;  1NK8 A;  5HRS A;  2BDP A;  4FJX A;  4E3S A;  1LWF A;  1REV A;  4AHC A;  4CIG A;  5K14 A;  1JLE A;  4OKK A;  4ICL A;  1RT6 A;  2YNI A;  4M3X A;  1Q8I A;  1VSK A;  1WSF A;  4F2S A;  2EX3 A;  5FRO A;  3OJS A;  3KTQ A;  3RTV A;  3FFI A;  4HVJ A;  1JLB A;  4DTS A;  3SCX A;  4Q5V A;  3DRR A;  4FLT A;  4DSE A;  4I2Q A;  4K8Z A;  4LH5 A;  4N56 A;  1RT2 A;  1W0H A;  3EY1 A;  1C0T A;  4DQQ A;  5JS1 A;  3OYJ A;  2IGI A;  4DU1 A;  1HQU A;  1HPZ A;  3RR7 A;  4M3Z A;  3DLH A;  4FCY A;  1QS4 A;  1F21 A;  1RTJ A;  2QKB A;  4B3O A;  4ELT A;  2Q3S A;  4RW7 A;  3OYM A;  4OGE A;  5I42 A;  4F4K A;  4H8K A;  1XWL A;  4I9L A;  1RBT A;  3CYM A;  4W5R A;  3H08 A;  4E7I A;  4YNQ A;  3I0S A;  2FBT A;  3KD1 E;  4W5N A;  3CG7 A;  1T7P A;  2QKK A;  4LY7 A;  4DMN A;  3VA3 A;  1TGO A;  4ZTF A;  4DTP A;  1RBU A;  1S1T A;  4BWJ A;  1SL0 A;  4BDP A;  5C24 A;  4FJ9 A;  3PUF A;  4E7K A;  1UA1 A;  4M41 A;  3OYA A;  1FXX A;  3RR8 A;  4FLX A;  3LAL A;  2G8H A;  4I7F A;  3OS2 A;  3CFR A;  4BDY A;  4FK0 A;  2VG7 A;  5D3G A;  1D9F A;  1NK5 A;  1DLO A;  4DSK A;  3I8D A;  2F8S A;  3LWL A;  5KI6 A;  4Q0B A;  4N41 A;  3QEI A;  1WSI A;  5DMR A;  1YTU A;  1W9H A;  5SZT A;  4BE0 A;  3K2P A;  4E19 A;  3O3F A;  3D0P A;  3OJU A;  3SNN A;  4DQI A;  3HL8 A;  3L2R A;  1C0U A;  2XRI A;  3U3G A;  1S1U A;  1XC9 A;  3TAM A;  1X9M A;  1KRP A;  4DSI A;  2JGU A;  4PA1 A;  1A5V A;  1KCF A;  4E1M A;  4B9S A;  3CFP A;  2HHU A;  3NFA A;  3PO5 A;  2VWK A;  4EP5 A;  3HO1 A;  1G15 A;  4CGJ A;  4Z4I A;  3SPZ A;  4EZ9 A;  3TAN A;  4C8N A;  3ZT1 A;  3UIQ A;  2OPS A;  2VWJ A;  3M8R A;  3LAK A;  3U3Y A;  1BI4 A;  4FW2 A;  1TL1 A;  3WNF A;  4LSL A;  3D45 A;  2KW4 A;  1TK5 A;  2RF2 A;  1JLC A;  4PUO A;  4GMJ B;  3PV8 A;  3P1G A;  3VQC A;  5HRN A;  4CJ3 A;  1K6Y A;  3SJJ A;  1RT3 A;  4IFV A;  3K5O A;  4CFC A;  4ID1 A;  1JLG A;  1UAX A;  3LAM A;  4E0D A;  3ZSW A;  3OYG A;  1L3V A;  1QSS A;  1D8Y A;  1ZBU A;  1RBR A;  1CXQ A;  4ZTJ A;  3AVL A;  4OLB A;  1U4B A;  3M8Q A;  4IDK A;  2B5J A;  3NAE A;  4DTM A;  3BDP A;  4CK3 A;  3HPO A;  2B4J A;  4CIF A;  4H4O A;  4OJR A;  2D0C A;  2YNG A;  4H4M A;  5J1E A;  3AVN A;  1SL2 A;  4CES A;  4FJI A;  2OZS A;  4Z4E A;  5SWM A;  3OS0 A;  2BGG A;  3MEE A;  3O3H A;  3VQA A;  2IC3 A;  1RTH A;  4CGI A;  4CIE A;  3L8B A;  1SKR A;  1RNH A;  2XHB A;  4M3Y A;  2HHX A;  3ZCM A;  4KI4 A;  4K8X A;  1U47 A;  1QE1 A;  4E7J A;  1C1A A;  3KLH A;  4DLG A;  4O0J A;  1QSY A;  2G8U A;  4CJW A;  1TKT A;  4FJL A;  3V9X A;  1LV5 A;  1ITG A;  3ZSQ A;  1Z25 A;  3F9K A;  1O1W A;  4DFJ A;  1DTT A;  3AA4 A;  4O4G A;  2O4G A;  3C94 A;  3KLG A;  1TK8 A;  3RRG A;  4CHO A;  4DFK A;  1S9E A;  1RT5 A;  4GVM A;  4KV8 A;  3MXJ A;  3V9U A;  1BIS A;  3V81 A;  3OYD A;  4DSJ A;  1U04 A;  2RPI A;  1EX4 A;  3C95 A;  1BCO A;  4CK2 A;  3OYI A;  1KLN A;  4KB0 A;  3KLF A;  3DLR A;  3WNH A;  5KGW A;  4E89 A;  2IAJ A;  1C1B A;  3OYB A;  1LAW A;  2OYQ A;  5KTQ A;  4FJ5 A;  4RW6 A;  2OA8 A;  3HPG A;  3DOK A;  1S1X A;  2GBZ A;  2I5J A;  4DU3 A;  4M42 A;  3KKR A;  1X1P A;  4CFD A;  1TL3 A;  3NCI A;  3MEC A;  3AVK A;  4FYD A;  5FDL A;  1VRU A;  4CF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...