3VQDA

Hiv-1 in core domain in complex with 5-methyl-3-phenyl-1,2-oxazole-4-carboxylic acid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
141
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 49
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqdA00
5HP1A 2Y1JA 2ZE2A 4TSXA 4DSJA 1S1WA 2D0BA 4CJTA 1QSYA 5J2MA 4HVJA 4FJIA 1SKRA 2GV9A 4CCHA 1Z26A 2XY6A 4BDZA 3RRHA 1LWEA 3ZSRA 3PX6A 4I9QA 4CFCA 1NJWA 3QIPA 1QTMA 1TK0A 3K5NA 1S1UA 2VG5A 3OYGA 2BDPA 3NH0A 2HHWA 1QHTA 3AV9A 4AILC 1X9SA 4IKFA 3VQ9A 3CFPA 3JYTA 4AH9A 3SV4A 3RR7A 1A5VA 4FJLA 3CFOA 3K57A 3HJFA 4DTSA 1YT3A 3DRSA 4O44A 3MXMA 1KLNA 3AVLA 1KVCA 1CZ9A 1WAJA 3QNOA 1WN7A 3VQ6A 4DSIA 1HPZA 4AHRA 4CEEA 4B3OA 1T7PA 4E7KA 4OLBA 3MEGA 5FRNA 2KFZA 3LZJA 5E41A 4JRPA 3LWLA 4FJ8A 1TKXA 4CJUA 3MXJA 5CZ2A 1IKWA 4HCCA 4Z4EA 4Y1CA 4YFUA 1RT7A 3NH1A 4B9VA 2F8SA 2XHBA 3MEDA 4IBNA 1RTJA 1FK9A 1C0UA 3OYFA 5CY4A 3V9WA 4E0DA 2P1JA 4DQIA 2PY5A 1KFDA 3C6UA 1B9FA 4EZ6A 4AHTA 3PX4A 1LWFA 1QE1A 1RBRA 1VSJA 4Z4HA 3NCIA 2RF2A 1RNHA 3AA4A 4R5PA 3KLHA 3V9ZA 4F8RA 4KHWA 4KRFA 1KVAA 1WSIA 1RDCA 3ITHA 2Z1IA 3S3OA 4AHVA 4CECA 1J54A 2G8KA 3KD1E 1WLJA 3VQ8A 1G15A 4I9LA 3K5LA 5EU7A 1U48A 1BCOA 4WE1A 3NGIA 2YKNA 3QEPA 2G8WA 1LW2A 4CGIA 4O4GA 4C8KA 4PQUA 2HHXA 4M3XA 1HYZA 4KAZA 4M45A 3TABA 1JL2A 4Q5VA 4FJMA 1HQEA 1VSDA 4UQGA 1BHLA 4DTJA 4BWJA 3KD5E 1BQNA 2A1RA 4C8NA 3IAYA 4CGFA 4NYFA 5CYMA 1TAUA 3ZT2A 3A2FA 3U6FA 3CFRA 3IRXA 2NUBA 3AVKA 3AO3A 4B8AB 3S3NA 1T03A 3L2UA 4FM2A 3HK2A 4E19A 5I3UA 1BCMA 1BIZA 2P5GA 2HW3A 2KTQA 1CXUA 4KHQA 1RT3A 1HNIA 2XY8A 1BIUA 3OYJA 2PYLA 4KV8A 3VQ4A 1S9EA 3AVHA 4CK2A 4PY5A 4CHYA 2P51A 4CJRA 4FLTA 2X6SA 3FFIA 4B9MA 2OYQA 4FJGA 1JLAA 3OYDA 4DTOA 1UAXA 3AVMA 3OY9A 2AJQA 3V81A 4KKOA 3OJSA 3NF9A 3LALA 3OYNA 3VN5A 3HP9A 5KRSA 2DFFA 4CF1A 2YNIA 3QINA 3G0ZA 2FBTA 3OS0A 1R0AA 1JLCA 3SV3A 4ICLA 4KTZA 4OGCA 2HNZA 5HRSA 2ZD1A 4DU4A 5CYQA 1GOCA 3VQQA 3OYLA 4W5NA 4HTUA 1WSEA 3KLIA 5J2NA 1N5YA 3D0PA 1RT2A 3B6OA 3HO1A 3CM5A 3SYZA 4CJWA 3M8QA 2KZMA 4CJFA 3THVA 2JGUA 2EHGA 4OKKA 3CYMA 4CJ4A 4C8LA 1LW0A 4M3RA 3OYMA 4DFKA 1EKEA 3ZT4A 4DF8A 1WSHA 4DFPA 4FLYA 3E01A 4ID1A 3AVJA 4CIEA 3DLHA 4FXDA 3LP1A 1I3AA 4CHQA 3V9UA 4M3UA 2KZZA 2Q3SA 3RMDA 3I8DA 1RCHA 1VRUA 3ZSXA 4CHZA 4FJNA 4KREA 4QCLA 2Y1IA 4K8XA 1EETA 1F21A 4IG3A 4ZTJA 3HP6A 1A5WA 2E6LA 3B6PA 4I2QA 4E7LA 3C95A 1U49A 3L3VA 1YTAA 2FBVA 3VQ5A 1W9HA 4RW9A 4CGJA 3V1OA 3ZSWA 1RTIA 1KFSA 3TANA 1X9WA 4JRQA 3H08A 1B92A 1QSLA 3RMBA 4DS4A 4KHUA 4CGDA 1HYVA 1BL3A 3QLHA 1NKCA 5K14A 4B9NA 3RWUA 3AA2A 1NOZA 1YVUA 4CGGA 4Q0BA 2QKBA 3QEWA 1VRTA 3MXIA 1S6QA 4FW2A 4FW1A 3KJVA 3PO4A 2DFHA 2ZQBA 4EP5A 4E7IA 4CF0A 4N41A 3CG7A 4H4OA 4XIUA 2O4IA 1BI4A 4BE2A 4FJHA 3SQ0A 1IG9A 3AO2A 4GVMA 3ZSQA 2DTUA 2QK9A 1KSPA 2W42A 1K6YA 3C6TA 4CK1A 2YNHA 3KK2A 1L3SA 1BGXT 2B5JA 4B8CA 4CIGA 1VSFA 3QEVA 1JXBA 3SUOA 2YNFA 4HCBA 2YKMA 4RW4A 3S3MA 3OYIA 5D3GA 3EZ5A 4FZXC 4JS5A 1ZBIA 3O4NA 4ELUA 4O0IA 1Q9XA 4F4KA 1LWCA 1S6PA 3HPHA 4H4MA 4ZTFA 4KPYA 2OPSA 4B08A 4RW8A 2FBYA 4JS4A 3SZ2A 1XHXA 2I5JA 4MFBA 1HYSA 3QNNA 2X78A 4PA1A 3T3FA 1QSSA 3O3FA 3LDSA 4DTXA 4FJ5A 4CE9A 3NF7A 1RTDA 3VQAA 3SQ2A 3LANA 1WNSA 5FDLA 2WOMA 3T19A 4FK4A 1NJZA 1JLBA 1IKVA 4FJKA 3VQEA 3PX0A 1KVBA 4DSLA 5I42A 4FVMA 3C94A 4W5QA 3K59A 1NJXA 4CF8A 1KRPA 3ZT1A 1RILA 1RT1A 3KTQA 4HUFA 1WSGA 3PV8A 3IG1A 4IDKA 2PZSA 4BDPA 4E1MA 4DSEA 1CZBA 3OYKA 2P5OA 5HRRA 4DFMA 4FLXA 1RBTA 1D9DA 1XC9A 5C24A 5SZTA 3AA3A 1HNVA 4FJ7A 2HHSA 1MU2A 3QERA 4CFBA 3VA3A 4CJ5A 4CHPA 1JXEA 4DQQA 3OS2A 4FM1A 4DS5A 5SWMA 3TAMA 3AVFA 3NDKA 3HPOA 1ITGA 3HPGA 4FJJA 1X1PA 4PUOA 4O55A 4KB1A 3HT3A 3LPTA 4FJXA 1VSHA 3WNEA 1KCFA 1WAFA 4J2BA 2IC3A 3LAKA 2X6NA 1JLFA 3NGYA 3HM9A 1Z25A 1NK0A 1NJYA 3K5MA 4GMJB 1TKDA 3KKSA 4B9TA 1HQUA 1RTHA 3F9KA 3SQ1A 3PY8A 3ZSVA 2GBZA 3RR8A 2G8UA 3U3GA 1TL1A 1ZBLA 2HVIA 4CK3A 3M8RA 1BI4B 4L8RB 1WSFA 3MECA 4CEDA 4OPKA 4B9SA 2E4LA 4DQPA 1VK0A 5JS1A 2YV0X 4DTNA 1RT5A 1C1CA 3HL8A 3QETA 1L3VA 1L5UA 4J2DA 4FK0A 2FBXA 1S5JA 1JLQA 1VSMA 1EX4A 3G10A 1Q9YA 4GW6A 2Z1HA 3WNFA 3AVGA 1RBSA 3DOKA 5HLFA 3L2QA 3KK1A 1ASWA 1IKXA 4BDYA 1JKHA 2DFEA 3DOLA 1J53A 2WONA 3KKRA 4CERA 4CGHA 1LV5A 2G8FA 1RBVA 4CF9A 3HVRA 4N56A 1RBUA 4DU1A 4IFYA 4FLZA 3UIQA 1T8EA 3LPUA 4LD0A 3L2RA 4F3TA 1QQCA 1Q8IA 3TAQA 4KO0A 1SV5A 4FZYA 3V6DA 4E89A 4DSFA 4CJLA 4CEZA 5FRMA 1S9GA 4FZZA 1ASUA 3MAQA 3F73A 3L8BA 3QEXA 1KLMA 3ZSZA 2ATQA 5C42A 3SCXA 2QKKA 1RDAA 1IKYA 5CZ1A 3TAPA 2G8VA 4DG1A 4ID5A 4KTWA 4B9LA 4KHSA 4E1NA 1VSEA 1JLGA 3TAGA 4FLVA 3K2PA 3NHGA 4H8KA 3AO5A 3VQBA 2IDOA 2D0AA 3OYHA 4N47A 4E3SA 3QESA 4CJQA 1NK5A 3O4QA 4C8OA 1FKOA 1C1AA 3ISNC 3LP3A 2F96A 3AA5X 3VQPA 5KGXA 1NK7A 4M3TA 3TR8A 2HHVA 3RRGA 3QIOA 1SL0A 5HBMA 4LSNA 3NFAA 3WNGA 4HHTA 3KIOA 1BQMA 4CEFA 4CEAA 1RT6A 4CEQA 4CJKA 4CHOA 2KW4A 4OPJA 3OYCA 1L3TA 3NF6A 1REVA 1TK8A 3HYFA 3O3GA 4AHCA 4AHSA 4QOZB 1O1WA 3QEIA 1ASVA 4KHNA 1NK4A 1IO2A 4FLUA 3SUNA 3VQ7A 4Z4GA 1RDDA 4OKJA 4ZHRA 3ZCMA 3V9XA 4KFBA 1HJRA 1JL1A 3DLEA 3V1RA 1D9FA 1D5AA 3KK3A 3AVAA 1JLEA 4JLHA 3SPYA 3AVCA 3SUPA 3IS9A 4CESA 4DFJA 4DLGA 4F3OA 3JSMA 2VG6A 2G8HA 5KI6A 1ZBHA 2GUIA 3DYAA 1VSLA 3AO4A 1C6VA 1QS4A 2OPPA 2YHBA 4DQSA 4CJEA 1KTQA 2YNGA 5FROA 1J5OA 5KTQA 1ZBFA 1LAWA 4RW6A 3SI6A 4EZ9A 4Z4FA 2OA8A 3DLBA 2HHQA 3I0SA 3NE6A 4OJRA 1TKTA 1ZYQA 1U47A 4CF2A 1DLOA 2F8TA 1NKBA 3K58A 4LH4A 1TL3A 3KLEA 1EXQA 3VQCA 1C1BA 2D5RA 4IFVA 3HVTA 5KRTA 3OYBA 1NK9A 4FK2A 4LH5A 4LSLA 1HMVA 3OYEA 4CJVA 1NKEA 5DMRA 4N76A 1D8YA 4W5TA 4BACA 4MQ3A 2HHTA 3RTVA 4KB0A 5J1EA 2HHUA 4M41A 4FCYA 1T05A 3LZIA 4KHYA 4Z4CA 1C0TA 1TGOA 3ZSOA 2RKIA 4RG8A 3OJUA 1TAQA 1S1TA 2D0CA 4LY7A 3AVBA 4F2RA 3T1AA 2G8IA 1FXXA 3EYZA 1L3UA 2VWJA 2RN2A 4BWMA 1Y97A 4DTPA 4M3YA 2XY5A 2A1SA 3LWMA 3D45A 5C25A 1CLQA 4OGEA 3U3YA 4DLEA 3HXMA 4FYDA 3L2VA 1SKWA 2PYJA 4CHNA 3SJJA 1RDBA 5KGWA 4BE1A 3L2WA 4NCGA 2BE2A 4CIFA 2O4GA 1U04A 4QAGA 4M42A 3AVNA 3LAMA 3OYAA 1TV6A 2ITGA 3LP2A 4O0JA 1FKPA 1VSKA 2Z1JA 4CFDA 3OVNA 4BE0A 1SL1A 1UA1A 3ZT3A 3ASMA 3TI0A 2EX3A 2OPQA 1U45A 1W0HA 2E6MA 1NK8A 4E7JA 3O3HA 1TVRA 3RMCA 1X9MA 2DY4A 4J2AA 1TK5A 3DLGA 2HNDA 4DU3A 2HMIA 4FLWA 3ULDA 3SPZA 3V4IA 3ALYA 4DTRA 2OZSA 3NGZA 5JS2A 4NYNA 4F2SA 2BGGA 2X74A 4O5BA 5HRNA 3SNNA 2KQ2A 3BGRA 1NOYA 3L3UA 3M8PA 1UWBA 3NF8A 3TAEA 4CEBA 1XI1A 1IH7A 4DTUA 4CJ3A 2HVHA 4Z4IA 1NK6A 3ZT0A 2XRIA 3M8SA 3HSTB 4HUEA 3SQ4A 4E7HA 3QO9A 3DRPA 3PUFA 2IS3A 4CFAA 4DSKA 3AO1A 4N5SA 3CM6A 2ETJA 5J2QA 2JLEA 1C0MA 4EP4A 3DLKA 3NH2A 3PO5A 2Z1GA 3BDPA 1DTQA 4IG0A 1EP4A 4C8MA 1U4BA 3WNHA 3I0RA 4W5RA 2XO7A 3S9HA 3EY1A 1TKZA 4YNQA 4W5OA 4I7FA 4DQRA 4RW7A 3VA0A 3TARA 3V1QA 4KI6A 4OKEA 1B9DA 1UA0A 1CXQA 2IGIA 1SKSA 4ELTA 4OVLA 3TAFA 1ZBUA 3KLGA 2B4JA 1DTTA 4CEOA 4B9UA 3AVIA 3P83D 1GOAA 5DK5A 2R7YA 3LP0A 1YTUA 3K5OA 2RPIA 4NCBA 2YHAA 2KFNA 4KI4A 4M3WA 3CQ8A 5HRPA 4KTQA 3DMJA 4CJSA 2B6AA 1A5XA 4AHUA 2VWKA 3DRRA 3NBPA 4FJ9A 1BISA 3P1GA 2OZMA 4DMNA 5J2PA 3DI6A 1N6QA 1WSJA 1J9AA 4HUGA 3V9SA 2OPRA 4PWDA 5T7BA 2FC0A 4K8ZA 4M3ZA 3SUQA 2HNYA 4Z0UA 2LSNA 1XHZA 1SL2A 4DTMA 3TWHA 3P5JA 1GOBA 2BANA 3RMAA 3VQDA 1I39A 4I2PA 3ZSYA 1HRHA 4Y1DA 4OLAA 4CJPA 1XWLA 3KLFA 3NAEA 1UOCA 4DWIA 3MEEA 4J2EA 1S1XA 1LAVA 1S1VA 2QXFA 2VG7A 3OS1A 4ELVA 1RT4A 5HROA 2IAJA 3DLRA 4DF4A 1VSIA 2HB5A 4NCAA 2IOCA 4G1QA 2XY7A 3DM2A 4FM0A 1SUQA
chains in the Genus database with same CATH superfamily
3MK6A 2JWLA 2Y1JA 1S72N 1MDUB 1YF5L 4BDZA 3RRHA 1MWKA 2QTDA 3MN6A 1NJWA 5ADXA 1TK0A 3WQTA 4JKGA 3AV9A 1X9SA 4FJLA 3JYTA 3WEEB 3SV4A 3RR7A 3CFOA 3K57A 1YT3A 3AVLA 1KVCA 4BGBA 3QNOA 4AHRA 4CEEA 3CCQN 1T7PA 4OLBA 4JV5K 4BRKA 1JCEA 5E41A 2E2PA 3J7AP 1TKXA 4CJUA 4PHTX 5EOYA 3A5OC 4U67L 4Z4EA 3WT0A 1RT7A 3OA9A 1C0UA 1P8ZA 4LF6K 1B9FA 4Z4HA 4KRFA 1RNHA 3AA4A 2ASPA 3AARA 3W0LA 4CECA 1J54A 1WLJA 1G15A 4I9LA 4YDUC 2O8BB 1BCOA 3QEPA 2YKNA 3QICA 4PQUA 2P9PB 4M3XA 1HYZA 1X3MA 1X3NA 5FPNA 1HQEA 5KQ8A 3A0IX 4IO8A 3KD5E 1BUPA 4CGFA 1K8KB 2ZWHA 3AVKA 2F9WA 5AQXA 3HK2A 4E19A 2VQEK 2FLOA 2KTQA 3CF5L 3CPEA 3PSIA 3JAMO 1RT3A 1BIUA 4PY5A 4CJRA 4FLTA 4FJGA 4DTOA 3A8YA 5BRDA 2CGKA 3OJSA 3LDOA 1SAZA 1Q18A 3HP9A 5KRSA 1VQ4N 3LDLA 1R0AA 4IEIA 3SV3A 4BG9A 4KTZA 4DR4K 1NGAA 4LC9B 5AQOA 2VCPA 4W5NA 5J2NA 4H0VB 1BG3A 5M1NA 1N5YA 1D4XA 4IWVA 2W40A 1Z6RA 3THVA 4OKKA 4CJ4A 1OH6A 2GELA 4DF8A 4K25A 4FLYA 3DLHA 3AVJA 1GLDG 3ENHA 1I3AA 3LP1A 3V9UA 2KZZA 5C0YA 2Q3SA 3I8DA 1VRUA 3ZSXA 4IOXA 5LMUK 4K8XA 1EETA 1VQMN 1V4TA 1U49A 3N4PA 4JI7K 3WXMB 2DPNA 1KQSM 1YTAA 4RW9A 5MLCQ 2UUCK 1T44A 4FWNA 4WQ4A 3H08A 4GY2B 3QLHA 4DR3K 5CR4A 1NOZA 4Q0BA 1VRTA 3MXIA 1S6QA 3K9KA 4N41A 2QWPA 4XIUA 4H0XB 5CE3A 4BR4A 1K6YA 3KK2A 1L3SA 1BGXT 1VSFA 2GEMA 3S3MA 3HBTA 5HOOA 1ZBIA 3I55N 4LF5K 4H4MA 5AQFA 4B08A 3SZ2A 4A2AA 1XHXA 1HYSA 3QNNA 4PA1A 3SBGA 1QSSA 3LDSA 3TTFA 4CE9A 3NF7A 4DV4K 3LANA 4A5AA 1HKCA 4CZFA 4BR2A 2P9SA 4DSLA 1WBBA 3VEWA 1NJXA 4X66K 4CF8A 3ZT1A 1OKJA 3FE1A 2P9KA 3OYKA 1YITN 1QVGM 5HRRA 4BQLA 2P5OA 1KC8O 4CZGA 2IVOA 4RWTA 4WF9L 4CJ5A 5C2DA 3OS2A 4IXCA 2PBDA 2V52B 4JN4A 2E8AA 4KB1A 3HT3A 3LPTA 1VSHA 5BN8A 4I6MA 4BRNA 1NK0A 1ZXOA 1TKDA 3UKRB 1IBLK 1RTHA 2OTLN 4JYAK 5BR9A 2GBZA 3OBYA 1TL1A 1ATNA 4XH5A 3M8RA 4L8RB 1WSFA 3A5MC 4CEDA 4OPKA 2E4LA 5KPZA 2YV0X 1C1CA 1L5UA 3QETA 4LF9K 3ID6A 4YOWA 1HKBA 3G10A 5BR8K 4FO0A 4DQ8A 3WNFA 2NZTA 1G99A 3TU5A 3DOKA 5HLFA 1YI2N 1ASWA 3KKRA 3E66A 4JKDA 4CERA 1NGBA 2G8FA 3HVRA 1Y64A 4IFYA 3GE1A 2O8EB 1T8EA 1EQYA 1Q8IA 4KO0A 3H1QA 1NGFA 2WUSA 1NG9A 2KLAA 4CJLA 4LF7K 4MO4A 3F73A 3QEXA 2D0OA 1YJ9N 2ATQA 4JEPA 1IKYA 4B9LA 4ID5A 4KHSA 2HBMA 4ISGA 1JLGA 3VF4A 4FLVA 3PIOL 3CXCM 3O9RA 4WQ4C 1DEJA 3QESA 3K9JA 4CJQA 5H1SQ 4MDBA 3LP3A 2F96A 3AA5X 4H5RA 3QIOA 3RVCA 4LSNA 1N36K 3WNGA 1RT6A 4OPJA 1L3TA 4C1NI 4CW7B 3CETA 4WCEL 5GIPA 1NWKA 2PAVA 4NXNK 4JKEA 3ZCMA 4GKJK 3KK3A 1JLEA 3F9MA 3SUPA 4F3OA 2G8HA 5KI6A 3DYAA 4NLCA 5FROA 5KTQA 2OA8A 3DXMB 4CJ7A 3I0SA 2HHQA 1TKTA 1U47A 5M1KA 3UKUB 4IFVA 4DV1K 3HVTA 3OYEA 4CJVA 5DMRA 2P9UA 4CBWA 1D8YA 1BOTO 5AJ3K 3RTVA 4KB0A 5BPMA 5J1EA 4M41A 4JK8A 4KHYA 4Z4CA 1HUXA 4KH4A 3OJUA 4CZLA 4LY7A 2G8IA 2VWJA 2RN2A 3PLAA 4A57A 1Y97A 3CCRN 4DTPA 2A1SA 3I56N 3P39A 3HXMA 1HKGA 1SKWA 1HPMA 4JI8K 4CIFA 2E2QA 5AZIB 4CBUA 3BF1A 4BR9A 4A61A 3OYAA 3VPZA 1TV6A 2ITGA 5AQGA 1YUWA 2Z1JA 4EHUA 3OVNA 1OH5A 3H46O 5BPNA 1XNRK 2EX3A 2E6MA 4E7JA 4G9ZA 5AQMA 2HNDA 1IJJA 2HMIA 1SS6A 3ALYA 5JS2A 2Q2RA 2GWJA 5AFUH 3VESA 1UWBA 2I7NA 3NF8A 4FWMA 4DTUA 3KVGA 2A6AA 3M8SA 3VF6A 3CCLN 4E7HA 1TYQB 4EFHA 2QA4N 3AO1A 3CJAA 3CM6A 3THYA 4EP4A 1VQPN 3DLKA 3PO5A 5JMVA 3L4IA 5CHIA 1DTQA 1EP4A 4CVNE 3I0RA 2P9NB 4X62K 1BWFO 4YNQA 4I7FA 3O8MA 3VA0A 3V1QA 4OKEA 1WUAA 5AQHA 1SKSA 1E4FT 4EIAA 4OVLA 2ASOA 5AQJA 4YY3K 3ATUA 2NNWA 2R7YA 1GOAA 5AQKA 2RPIA 2ZM6K 2B6AA 3J80O 4AHUA 5ELZA 2ZGYA 1KD1O 3KHYA 4DMNA 3DI6A 4K41A 4HUGA 3VMFB 4PWDA 4K8ZA 2FC0A 4M3ZA 2HBLA 2HNYA 3EL2A 1SL2A 4JHDA 4DTMA 3SJHA 2O8DA 3G25A 4GV3A 4LF4K 3KLFA 4DWIA 3MEEA 4LF8K 1S1XA 1S1VA 2QXFA 1RT4A 5HROA 4JKHA 2HB5A 2IOCA 1SUQA 5M1FA 3CJCA 4DR2K 4M7XA 2QEXN 2CH6A 2YJEA 2GV9A 2XY6A 3R8EA 5DM6L 3J7ZO 4CFCA 2Q31A 3G4SN 1S1UA 2VG5A 1LCUA 3OYGA 3W3DA 4IDHA 2HHWA 4DV5K 1QHTA 3R1XA 4AILC 3TSPA 3VQ9A 5JLFA 4O44A 1KLNA 1WN7A 3ZETB 4E7KA 1W97L 3GL1A 4JRPA 3LWLA 1JCGA 3NH1A 4B9VA 4X65K 2XHBA 3MEDA 3V9WA 3OYFA 2HBKA 4E0DA 1ILYA 1C0FA 1KFDA 3C6UA 4EZ6A 1ESVA 1VSJA 4KHWA 2RF2A 4F8RA 1KVAA 3ITHA 2G8KA 4BGAA 5EU7A 3VETA 3ENOA 3D2EA 3NGIA 2AP1A 2HHXA 1BU6O 2FSJA 1JL2A 3WXIA 4DTJA 5M1OA 1NGEA 4AQYK 2A1RA 4C8NA 3IAYA 3O9TA 3U6FA 3VENA 3IRXA 3CFRA 3AO3A 3S3NA 3EEQA 5I3UA 4BR0A 1BCMA 2YHWA 3PIPL 4H5VA 2P5GA 1CXUA 4KHQA 3OYJA 1HNIA 2XY8A 2PYLA 3VQ4A 4FWPA 4CHYA 2F9TA 2X6SA 3FFIA 2OYQA 3OYDA 3E9LA 3NF9A 5HL7L 2DFFA 4JKGB 3QINA 3E9PA 4NXMK 5E84A 4JI4K 5FPMA 1WSEA 3U9DA 4JKAA 3SYZA 4B3TK 1RFQA 3M8QA 4E1JA 2EHGA 4M3RA 3NVKA 3OYMA 2ZF5O 4DFPA 5AQQA 2HOEA 4GV6A 4QCLA 1RCHA 4KREA 3THXA 1SZ2A 3M5RA 1JCFA 4FSVA 3C95A 3U4LA 2HBJA 4CGJA 3V1OA 1K9MO 1RTIA 4JRQA 1B92A 4JNEA 2NRVA 1NKCA 5K14A 4AF1A 3VEYA 4CGGA 3KJVA 4FW2A 2DFHA 4BRGA 2ZQBA 3ENBA 4A2BA 1NMNA 1WOQA 4H4OA 2WC9A 5M1PA 5JVHL 3DWLA 4BRHA 4GVMA 3ZSQA 2DTUA 2W42A 3C6TA 3MX2A 2B5JA 4HCBA 1JXBA 2YKMA 4RW4A 5D3GA 3UE5A 4JS5A 5LJVA 4MLHA 5AQNA 4FWOA 3HPHA 4KPYA 3VTIA 4JS4A 1XUPO 3T3FA 4PL7A 1RTDA 3EN9A 3JS6A 1E3MA 1Q86O 2O8FB 2D1KA 3T19A 4FJKA 1QQOA 3CCUN 3DLLL 3PX0A 5I42A 3IMXA 3J8AA 3C94A 4FVMA 3ZYYX 1KRPA 4DKWA 3H3NO 1WSGA 4ILHA 3DXKB 3IG1A 4IDKA 4E1MA 4KBOA 3VOVA 1K73O 4FLXA 1XC9A 2UXBK 3VERA 3VA3A 4DQQA 5AZJA 2E1YA 3TAMA 3AVFA 3HPOA 1ITGA 1NGJA 3HPGA 3CMEN 3CJBA 4FJXA 5LL6Z 1KCFA 3LAKA 2X6NA 1JLFA 3HSCA 4B9TA 1HQUA 1KAYA 3MDQA 3PY8A 3RR8A 4DCHA 2G8UA 3U3GA 2HVIA 5JLHA 1BI4B 2P9LB 3MECA 4B9SA 5JS1A 1GLCG 1L3VA 4J2DA 2FXUA 1JLQA 3MN9A 1VSMA 1Q9YA 4GW6A 2Z1HA 5C2FA 3THWB 3VEXA 3R9PA 3L2QA 1IKXA 3DOLA 2DFEA 3FZKA 3ZX0A 2WONA 1LV5A 4N56A 3EKUA 4FLZA 3LPUA 3L2RA 1QQCA 5AQWA 4BRFA 1SV5A 4DSFA 4CEZA 3ZEUB 3B8AX 3L8BA 1KLMA 5C42A 1BA1A 3TAPA 3C6AA 4DG1A 4KTWA 2J4RA 4JI3K 4YORA 4BVPA 4H8KA 3CC2N 3AO5A 3VQBA 4E3SA 4N47A 2P9KB 3O80A 3RSEA 1IG8A 4YOXA 3NFAA 5AR0A 4CHOA 1QQMA 1REVA 1TK8A 2O8BA 4IZ9A 4AHCA 2BUPA 3T69A 2P9PA 1ASVA 5C10A 2UXCK 4I6MB 3OBWA 4FLUA 3SUNA 4OO1J 1VAZA 4DB3A 3V9XA 1JL1A 1D5AA 2A3ZA 3AVAA 2FSNA 3IDHA 4JLHA 4JI5K 3IS9A 4CESA 4DFJA 4PKIA 2GUIA 4CZMA 2YHBA 2ZJRL 2YNGA 1N33K 4RW6A 2BTFA 1QZ5A 3DLBA 3NE6A 1ZYQA 2QW9A 2F8TA 3KLEA 1VQ6N 3VQCA 1C1BA 4FK2A 3BZCA 4N76A 4BACA 1J6ZA 2HHUA 4FCYA 3AAQA 1C0TA 1TGOA 3MWTA 4RG8A 1TAQA 1RDUA 2VQFK 4F2RA 1V4SA 3L4QA 1FXXA 2H3GX 3T7ZA 4M3YA 3MN5A 2XY5A 5C25A 3OHRA 3L2VA 2PYJA 5GADP 3Q7BA 1NGHA 3AVNA 3H1VX 2FF6A 3G6EN 1FKPA 4QS7A 1SL1A 3FR0A 5IT9O 1T3VA 3ZT3A 4RCHA 5GAGP 3TI0A 4JAXA 1W0HA 1TVRA 1YHQN 1NM1A 1X9MA 3DLGA 3LDPA 5F2RA 4DU3A 4YOUA 3V4IA 4F2SA 4B1YB 3NGZA 4NYNA 2QXLA 5HRNA 1NOYA 4B3RK 3G71N 5BN9A 4CJ3A 2HVHA 3ZT0A 1OH7A 3DRPA 2IS3A 4A5BA 5DM7L 1Q7YO 3GOIA 1C0MA 2ITMA 4YHHK 3ZLJA 2Z1GA 4IG0A 1ATRA 4JI6K 3EY1A 4DV7K 1GLAG 4DQRA 3TARA 4KI6A 2NRZA 1EO1A 4ELTA 3CCEN 4DR7K 4GKKK 1ZBUA 1Q81O 4X64K 2B4JA 5DK5A 3MX5A 3CMAN 4NCBA 2QWRA 2KFNA 1YAGA 4KI4A 4M3WA 3CQ8A 5HRPA 4KTQA 3DMJA 3CCMN 4B1WB 3NBPA 5B8HA 1M1KO 4FJ9A 2HMPA 1J9AA 2UYTA 5AQPA 3IFRA 1YJWN 1QVFM 2ZJQL 1GOBA 2CH5A 3C6HA 2BANA 4HTLA 4I2PA 3ZSYA 4OLAA 4Y1DA 2KHOA 1VQNN 1UOCA 4J2EA 4BC4A 1LAVA 4ELVA 3DLRA 3MWPA 4NCAA 1NGIA 3OTOK 4H0YB 2XY7A 4FM0A 2IVPA 3LDNA 1P90A 2ZE2A 2P9IB 1S1WA 2D0BA 4CJTA 3O6WA 5J2MA 1QSYA 4FJIA 4CCHA 1Z26A 5AQLA 2VGNA 1LWEA 3ZSRA 3LM2A 5C15A 4I9QA 1H1VA 5FLXO 3QIPA 4PKHA 5AQTA 5AQRA 3NH0A 4IKFA 4B3SK 1GLEG 1A5VA 3THYB 4DTSA 3DRSA 2O8EA 4BQZA 4DSIA 2UU9K 4V19S 3MEGA 3ULEB 4QS9A 4HCCA 4YFUA 2F4VK 4IBNA 1RTJA 2A41A 3CI5A 5CY4A 5FPDA 2PY5A 4BC2A 4AHTA 1T6CA 3HOSA 1QE1A 1RBRA 3V9ZA 4R5PA 2VGMA 1WSIA 1RDCA 2Z1IA 4AHVA 3VQ8A 3CQXA 3K5LA 5LMNK 1U48A 1WBDA 2G8WA 1N8RO 4O4GA 2JWKA 4KAZA 5BREA 1VSDA 4BWJA 4MLEA 3C7NB 3NMUA 4NYFA 5CYMA 1YJNN 1T03A 4FM2A 2HW3A 4FWSA 4KV8A 4CK2A 3AVHA 2E5LK 2VWBA 2HHHK 2NRXA 4J8FA 4B9MA 1JLAA 2A5XA 1XMQK 1IV0A 1UAXA 3AVMA 4JK9A 3OY9A 5JVGL 1FW6A 4KKOA 3DXMA 3SBTA 3LALA 3OYNA 1OVYA 1SQKA 3UKUA 1ATSA 2RE2A 3G0ZA 3OS0A 4OGCA 2HNZA 5AFUA 5BPLA 3TPQA 5HRSA 5CYQA 2UUAK 3OYLA 4HTUA 5AQSA 3D0PA 1RT2A 3SMPA 3HO1A 4HWIA 4CJWA 4CJFA 2V7ZA 3CYMA 2RHKA 4IEEA 4CD3A 4C8LA 2Q0UA 3ZT4A 4CIEA 4FXDA 4CHQA 4M63C 4JD2B 3H45C 3SK3A 4FJNA 4CHZA 1N34K 1F21A 4IG3A 1NGDA 3B6PA 4I2QA 4IO9L 3L3VA 1X9JA 5AZIA 1MWMA 1VQ8N 3D2FA 3TANA 3C65A 3QDKA 3RMBA 4DS4A 4KHUA 4CGDA 4B9QA 1HYVA 4B9NA 3RWUA 3AA2A 1YVUA 3P4IA 3H6EA 1GLFO 3QEWA 5KPTA 1Q82O 4EP5A 2ZJPL 3CG7A 2UXDK 2YI1A 2O4IA 3AO2A 4K43A 5GINA 2QK9A 4DV2K 3FZHA 4CK1A 4JI0K 2O8CB 3GBTA 4CIGA 3QEVA 3E9OA 3SUOA 2WTUA 3OYIA 3EZ5A 3CPWM 1TYQA 4O0IA 4F4KA 1LWCA 1S6PA 4ZTFA 2OPSA 1I94K 4RW8A 2FBYA 2I5JA 4MFBA 4FJ5A 5TKWA 2P9NA 4H0TB 3SQ2A 2WOMA 3EZWA 1IKVA 3VQEA 1W2BM 2Q97A 3KTQA 1RILA 1RT1A 4HUFA 3PV8A 3D7EO 3OW2M 1D9DA 1KXPA 4CZJA 5C24A 4BREA 5SZTA 3AGRA 4FL9A 1MU2A 3QERA 4CFBA 4KHPK 1JXEA 5SWMA 1X1PA 3THXB 4FWRA 4O55A 4Z94A 1QZ6A 3WNEA 1WAFA 4J2BA 1LOTB 3O1WA 4JKFA 2EWSA 3NGYA 3HM9A 3K5MA 4GMJB 3KKSA 3MCPA 1VQ9N 1ZBLA 4R79A 4DQPA 3SAHA 1VK0A 3Q7CA 2QWMA 4BRCA 3QBXA 4FK0A 1WB9A 1NJIO 4O8KA 4GVEA 4IOAL 1R59O 3O08A 5TKYA 3AVGA 3KK1A 1ZC6A 4OPAA 3NVMA 1VQKN 1VQON 4CGHA 2OANA 4CF9A 3P38A 4NB4A 4IOCL 2PFUA 4LD0A 4F3TA 4FZYA 4E89A 5FRMA 4FZZA 3U9ZA 4H0PA 5LJWA 3MAQA 3ZETA 4CBXA 4B1VA 3ZSZA 4BRAA 4JK7A 2G8VA 4E1NA 3TAGA 3K2PA 3CD6N 3J7YP 3CJ9A 3OYHA 3HI0A 2D0AA 3KZBA 4LFCK 2HF3A 1NK5A 3O4QA 4C8OA 4UY8O 1C1AA 3ISNC 5KGXA 1NK7A 3TR8A 3RRGA 4NO7A 1ZBSA 4A59A 1BQMA 4CEFA 2NLXA 4CEAA 4CJKA 2KW4A 4C1NK 3OYCA 3WUHA 1YIJN 3CQYA 5GIOA 5C12A 3HYFA 3WXKA 3O3GA 4AHSA 5ADXH 5GAEP 1E4GT 1RDDA 4KFBA 1HJRA 3DLEA 4DUYK 1GLBG 2OCEA 3ATVA 2HHSA 4DLGA 4YOYA 1ZBHA 2VG6A 4CI6A 1QS4A 2OPPA 1HNXK 4OX9K 1XQSC 1KTQA 4PKGA 4EZ9A 3VEVA 4OJRA 2GTDA 3AY9A 3BEXA 2HF4A 1TL3A 1NK9A 1EXQA 4LSLA 1HMVA 3FGUA 3O9UA 1NKEA 4MQ3A 2HHTA 2E88A 3VF2A 4LFAK 5KQDA 3IUCA 3ZSOA 4B3MK 1S1TA 2D0CA 3T1AA 4DUZK 4K0KK 3EYZA 1K8AO 2GWKA 2V7YA 3LWMA 1QQNA 3O1BA 4OGEA 4ISEA 2Q36A 4DLEA 3U3YA 2CGJA 4FYDA 5BRFA 1U2VA 4CHNA 1Z05A 4MO5A 1RDBA 5KGWA 3RSEB 4BE1A 2BE2A 3HOTA 2O4GA 1U04A 4QAGA 4M42A 4BY9C 1CZAN 4O0JA 4CFDA 4BE0A 2OPQA 1NK8A 3T1YK 2DY4A 3C0BA 2E20A 2KKZA 3N4QA 3ULDA 4F9OA 1NBWA 4FOIA 2OZSA 4BC5A 2CGLA 4O5BA 1BDGA 1XNQK 3SNNA 4DR5K 5A2QO 4U7BA 4JI2K 1XI1A 4Z4IA 3A5LC 3HSTB 4KH5A 4HUEA 2A42A 3SQ4A 1S22A 3WQUA 3PUFA 3WEEA 4XH1A 4ILGB 4Y0WA 1U4BA 1TKZA 3M3ZA 5IWAK 3TSUA 2UUBK 2P9SB 1UA0A 2O8FA 1DKGD 3KLGA 1W7AA 1M90O 4LFBK 1DTTA 3AVIA 1NLVA 3P83D 5F1XA 4DHYA 1RGIA 4CZHA 4B1XB 2YHAA 3DXKA 2YJFA 4CJSA 3R6MA 1A5XA 2VYPA 3SLCA 1BISA 3P1GA 2OZMA 5J2PA 3SUQA 1JJ2M 3ZX3A 2WBNA 1IBKK 3VTHA 3HRGA 3CERA 3RMAA 3VQDA 1I39A 1NMDA 1K8KA 1XWLA 3NAEA 3QBWA 3OS1A 2VG7A 5AQUA 4DF4A 1VSIA 2YX6A 4G1QA 4RTFD 2P9LA 1BI4A 4YOVA 5HP1A 3H3OB 3EE8A 4TSXA 4XH4A 4A62A 4DSJA 4HVJA 4H5WA 1SKRA 2Q0RA 3CIPA 3WXJA 1OH8A 3PX6A 3CCVN 2D4WA 4WFBL 3EO3A 4O5FA 1QTMA 4OPHA 3THWA 3K5NA 3CC7N 1KAXA 2BDPA 1BA0A 3CFPA 4AH9A 4L3QA 3HJFA 3MXMA 2HHVA 1WAJA 1CZ9A 3L0QA 4B1UB 3VQ6A 1HPZA 4B3OA 3QFPA 5FRNA 2KFZA 3LZJA 3ZEUA 1HR0K 4BG8A 4FJ8A 3MXJA 5CZ2A 1IKWA 5EX5A 4Y1CA 5BRHA 2F8SA 1FK9A 2P1JA 4DQIA 1HLUA 3PX4A 2NRRA 1LWFA 3NCIA 1J5EK 2QWNA 3KLHA 3S3OA 2ASMA 3KD1E 3JXUA 3VGMA 1YVNA 3BP8A 4WE1A 4ISFA 1LW2A 4CGIA 1BO5O 4C8KA 1C0GA 3GDQA 4M45A 4BRLA 4Q5VA 3TABA 4FJMA 2IIRA 4UQGA 1BHLA 3TTCA 1BQNA 1TAUA 2V51B 4WYBA 3ZT2A 3A2FA 2NUBA 3LL3A 4B8AB 2OTJN 3L2UA 1BIZA 1S9EA 3O4WA 2P51A 3TSQA 1TUUA 2NRTA 2AJQA 2F7TA 5EXWA 3V81A 1S3XA 3VN5A 2QWQA 4CF1A 2YNIA 2P9UB 2FBTA 4AM7A 1JLCA 4ICLA 3AAPA 3QB0A 2I7PA 4EHTA 2ZD1A 4DU4A 3O5BA 1GOCA 3VQQA 3KLIA 3B6OA 3CM5A 4KH6A 1U6ZA 2KZMA 2JGUA 1LW0A 4DFKA 1EKEA 1WSHA 3MN7A 3E01A 4ID1A 4WQ5A 3S41A 4M3UA 3RMDA 2Y1IA 2YCHA 1TUYA 4ZTJA 3HP6A 1A5WA 2E6LA 4E7LA 3T1HK 4JKCA 2E2OA 2FBVA 3VQ5A 1W9HA 3ZSWA 3UKRA 4XEIA 2QWOA 3AGKA 1KFSA 1X9WA 1QSLA 3L6QA 1EWQA 1BL3A 3LDQA 4EAHD 2QKBA 4PL8A 4FW1A 3PO4A 4E7IA 5EY4A 4CF0A 4BE2A 4FJHA 1O13A 3SQ0A 1IG9A 2A40A 1KSPA 1VHXA 2FF3B 2YNHA 5EVZA 4B8CA 4BR5A 2YNFA 4JKBA 4FZXC 2YHYA 3O4NA 4ELUA 1Q9XA 1OVQA 4DV0K 3BZKA 5F0XA 3CJ1A 2WFBA 5KPRA 2X78A 3O9SA 3O3FA 4DTXA 3VQAA 3F2KA 2QI2A 4BRIA 1WNSA 3LM9A 5FDLA 4FK4A 1NJZA 1JLBA 3CC4N 1KVBA 3K59A 4W5QA 3DJCA 3U8XA 4BC3A 4FPAA 5M1QA 2W41A 2PZSA 4BDPA 3FZFA 1CZBA 4DSEA 4DFMA 1RBTA 3VEZA 3BUZB 4FJ7A 3AA3A 1HNVA 3TTDA 4FOEA 4CHPA 2GUPA 3BF3A 4BRDA 4CZIA 4FM1A 1GLLO 3A5NC 4DS5A 3NDKA 4FJJA 4C23A 4PUOA 4JHDB 3VGLA 2O8DB 3P31A 2E2NA 2IC3A 3CHWA 1Z25A 1NJYA 3GG4A 3D2FB 3F9KA 3SQ1A 3ZSVA 3M6GA 4CZEA 1HJOA 4CK3A 4O8UA 4H5TA 4FVUA 3SMSA 3F5TA 4FWQA 2Q1NA 2NRWA 1RT5A 4DTNA 3EE9A 3HL8A 3D6RA 2FBXA 5GAHP 1S5JA 3ZX2A 1EX4A 2P9IA 1QHAA 1HNZK 3MMVA 3VGKA 3FZLA 1RBSA 3HM8A 4BDYA 4DR1K 1JKHA 4ILJA 1J53A 1RBVA 3EKSA 1RBUA 4DU1A 3UIQA 3TAQA 2W6LA 4WQ5C 3V6DA 4WFNL 1S9GA 1ASUA 4NLBA 3MCAB 2QKKA 5AQIA 3SCXA 1RDAA 5CZ1A 3ULEA 5I9EB 1VSEA 3NHGA 1NNEA 2IDOA 3FZMA 1HNWK 1FKOA 3VQPA 4M3TA 4CZKA 3HTVA 1SL0A 5HBMA 4HHTA 3KIOA 4IFEA 4CEQA 3O9QA 2IVNA 3D2EB 2E1ZA 4FPBA 2QM1A 3NF6A 4BRMA 4BRPA 3SAGA 3ID8A 3VEOA 1DGKN 3M1FA 4QOZB 1O1WA 1NGCA 3QEIA 2AA4A 4KHNA 1NK4A 4QS8A 1IO2A 3J81O 3VQ7A 4Z4GA 4OKJA 4AM6A 4ZHRA 3C7NA 1D9FA 3V1RA 3BY5A 3SPYA 4FWKA 3AVCA 4K42A 4DR6K 3JSMA 1DT9A 5AQYA 2HSTA 1T6DA 1VSLA 3AO4A 1C6VA 1XC3A 1GLJO 4DQSA 4CJEA 1J5OA 1ZBFA 1LAWA 3SI6A 4Z4FA 4CF2A 1DLOA 3SAFA 1NKBA 3K58A 4BRQA 1VQLN 4LH4A 5KRTA 2D5RA 3OYBA 4LH5A 5AQVA 4W5TA 1T05A 3LZIA 3CCSN 3PSFA 3FFKB 1N32K 3KK7A 2RKIA 3IKMA 4GNIA 3KWGA 3AVBA 1IBMK 3FLCO 1L3UA 3DAWA 4BWMA 4GV9A 3D45A 1FJGK 1CLQA 2BH1A 4IJNA 4JD2A 3WXLA 2FSKA 3SJJA 1MA9B 4IJAA 3L2WA 4NCGA 3LAMA 2W6KA 3LP2A 4M7YA 1VSKA 1UA1A 3ASMA 1U45A 3O3HA 4H03B 3RMCA 4J2AA 1TK5A 2ZGZA 4FLWA 1NU0A 3SPZA 1XMOK 3KWIA 4B1ZA 4DTRA 2BGGA 1NGGA 2X74A 4YDUA 2KQ2A 3BGRA 3L3UA 3M8PA 3TAEA 4CEBA 1IH7A 3E1YA 4BVOA 1NK6A 2XRIA 2O8CA 3QO9A 4DSKA 4H5NA 4BR7A 4CFAA 3CJ7A 4DV6K 4N5SA 2GX9A 3CCJN 2ETJA 3K0SA 5J2QA 2JLEA 1YXQA 3NH2A 4CD1A 3BDPA 4C8MA 3WNHA 4W5RA 2XO7A 3S9HA 2NRHA 4W5OA 4RW7A 4DV3K 5AQZA 1RDWX 1B9DA 1EWRA 1CXQA 2IGIA 4BROA 4H0OA 3QMLA 3TAFA 4YOTA 4CEOA 4B9UA 3HZ6A 3LP0A 1YTUA 5E26A 3K5OA 4MDAA 2QWLA 3I8BA 5AZJB 2VWKA 3DRRA 3QFUA 4JI1K 2YHXA 4FWLA 1HX1A 1N6QA 1WSJA 3V9SA 2OPRA 1U2VB 5T7BA 4Z0UA 1KAZA 2LSNA 1XHZA 5JICA 3TWHA 3P5JA 2D0PA 1VQ7N 3I33A 3R3LA 1HRHA 4CJPA 1VQ5N 4WFAL 2IAJA 5FPEA 5LY3A 3DM2A 3UB5A
chains in the Genus database with same CATH topology
5HP1A 2Y1JA 2ZE2A 4TSXA 4DSJA 1S1WA 2D0BA 4CJTA 1QSYA 5J2MA 4HVJA 4FJIA 1SKRA 2GV9A 4CCHA 1Z26A 2XY6A 4BDZA 3RRHA 1LWEA 3ZSRA 3PX6A 4I9QA 4CFCA 1NJWA 3QIPA 1QTMA 1TK0A 3K5NA 1S1UA 2VG5A 3OYGA 2BDPA 3NH0A 2HHWA 1QHTA 3AV9A 4AILC 1X9SA 4IKFA 3VQ9A 3CFPA 3JYTA 4AH9A 3SV4A 3RR7A 1A5VA 4FJLA 3CFOA 3K57A 3HJFA 4DTSA 1YT3A 3DRSA 4O44A 3MXMA 1KLNA 3AVLA 1KVCA 1CZ9A 1WAJA 3QNOA 1WN7A 3VQ6A 4DSIA 1HPZA 4AHRA 4CEEA 4B3OA 1T7PA 4E7KA 4OLBA 3MEGA 5FRNA 2KFZA 3LZJA 5E41A 4JRPA 3LWLA 4FJ8A 1TKXA 4CJUA 3MXJA 5CZ2A 1IKWA 4HCCA 4Z4EA 4Y1CA 4YFUA 1RT7A 3NH1A 4B9VA 2F8SA 2XHBA 3MEDA 4IBNA 1RTJA 1FK9A 1C0UA 3OYFA 5CY4A 3V9WA 4E0DA 2P1JA 4DQIA 2PY5A 1KFDA 3C6UA 1B9FA 4EZ6A 4AHTA 3PX4A 1LWFA 1QE1A 1RBRA 1VSJA 4Z4HA 3NCIA 2RF2A 1RNHA 3AA4A 4R5PA 3KLHA 3V9ZA 4F8RA 4KHWA 4KRFA 1KVAA 1WSIA 1RDCA 3ITHA 2Z1IA 3S3OA 4AHVA 4CECA 1J54A 2G8KA 3KD1E 1WLJA 3VQ8A 1G15A 4I9LA 3K5LA 5EU7A 1U48A 1BCOA 4WE1A 3NGIA 2YKNA 3QEPA 2G8WA 1LW2A 4CGIA 4O4GA 4C8KA 4PQUA 2HHXA 4M3XA 1HYZA 4KAZA 4M45A 3TABA 1JL2A 4Q5VA 4FJMA 1HQEA 1VSDA 4UQGA 1BHLA 4DTJA 4BWJA 3KD5E 1BQNA 2A1RA 4C8NA 3IAYA 4CGFA 4NYFA 5CYMA 1TAUA 3ZT2A 3A2FA 3U6FA 3CFRA 3IRXA 2NUBA 3AVKA 3AO3A 4B8AB 3S3NA 1T03A 3L2UA 4FM2A 3HK2A 4E19A 5I3UA 1BCMA 1BIZA 2P5GA 2HW3A 2KTQA 1CXUA 4KHQA 1RT3A 1HNIA 2XY8A 1BIUA 3OYJA 2PYLA 4KV8A 3VQ4A 1S9EA 3AVHA 4CK2A 4PY5A 4CHYA 2P51A 4CJRA 4FLTA 2X6SA 3FFIA 4B9MA 2OYQA 4FJGA 1JLAA 3OYDA 4DTOA 1UAXA 3AVMA 3OY9A 2AJQA 3V81A 4KKOA 3OJSA 3NF9A 3LALA 3OYNA 3VN5A 3HP9A 5KRSA 2DFFA 4CF1A 2YNIA 3QINA 3G0ZA 2FBTA 3OS0A 1R0AA 1JLCA 3SV3A 4ICLA 4KTZA 4OGCA 2HNZA 5HRSA 2ZD1A 4DU4A 5CYQA 1GOCA 3VQQA 3OYLA 4W5NA 4HTUA 1WSEA 3KLIA 5J2NA 1N5YA 3D0PA 1RT2A 3B6OA 3HO1A 3CM5A 3SYZA 4CJWA 3M8QA 2KZMA 4CJFA 3THVA 2JGUA 2EHGA 4OKKA 3CYMA 4CJ4A 4C8LA 1LW0A 4M3RA 3OYMA 4DFKA 1EKEA 3ZT4A 4DF8A 1WSHA 4DFPA 4FLYA 3E01A 4ID1A 3AVJA 4CIEA 3DLHA 4FXDA 3LP1A 1I3AA 4CHQA 3V9UA 4M3UA 2KZZA 2Q3SA 3RMDA 3I8DA 1RCHA 1VRUA 3ZSXA 4CHZA 4FJNA 4KREA 4QCLA 2Y1IA 4K8XA 1EETA 1F21A 4IG3A 4ZTJA 3HP6A 1A5WA 2E6LA 3B6PA 4I2QA 4E7LA 3C95A 1U49A 3L3VA 1YTAA 2FBVA 3VQ5A 1W9HA 4RW9A 4CGJA 3V1OA 3ZSWA 1RTIA 1KFSA 3TANA 1X9WA 4JRQA 3H08A 1B92A 1QSLA 3RMBA 4DS4A 4KHUA 4CGDA 1HYVA 1BL3A 3QLHA 1NKCA 5K14A 4B9NA 3RWUA 3AA2A 1NOZA 1YVUA 4CGGA 4Q0BA 2QKBA 3QEWA 1VRTA 3MXIA 1S6QA 4FW2A 4FW1A 3KJVA 3PO4A 2DFHA 2ZQBA 4EP5A 4E7IA 4CF0A 4N41A 3CG7A 4H4OA 4XIUA 2O4IA 1BI4A 4BE2A 4FJHA 3SQ0A 1IG9A 3AO2A 4GVMA 3ZSQA 2DTUA 2QK9A 1KSPA 2W42A 1K6YA 3C6TA 4CK1A 2YNHA 3KK2A 1L3SA 1BGXT 2B5JA 4B8CA 4CIGA 1VSFA 3QEVA 1JXBA 3SUOA 2YNFA 4HCBA 2YKMA 4RW4A 3S3MA 3OYIA 5D3GA 3EZ5A 4FZXC 4JS5A 1ZBIA 3O4NA 4ELUA 4O0IA 1Q9XA 4F4KA 1LWCA 1S6PA 3HPHA 4H4MA 4ZTFA 4KPYA 2OPSA 4B08A 4RW8A 2FBYA 4JS4A 3SZ2A 1XHXA 2I5JA 4MFBA 1HYSA 3QNNA 2X78A 4PA1A 3T3FA 1QSSA 3O3FA 3LDSA 4DTXA 4FJ5A 4CE9A 3NF7A 1RTDA 3VQAA 3SQ2A 3LANA 1WNSA 5FDLA 2WOMA 3T19A 4FK4A 1NJZA 1JLBA 1IKVA 4FJKA 3VQEA 3PX0A 1KVBA 4DSLA 5I42A 4FVMA 3C94A 4W5QA 3K59A 1NJXA 4CF8A 1KRPA 3ZT1A 1RILA 1RT1A 3KTQA 4HUFA 1WSGA 3PV8A 3IG1A 4IDKA 2PZSA 4BDPA 4E1MA 4DSEA 1CZBA 3OYKA 2P5OA 5HRRA 4DFMA 4FLXA 1RBTA 1D9DA 1XC9A 5C24A 5SZTA 3AA3A 1HNVA 4FJ7A 2HHSA 1MU2A 3QERA 4CFBA 3VA3A 4CJ5A 4CHPA 1JXEA 4DQQA 3OS2A 4FM1A 4DS5A 5SWMA 3TAMA 3AVFA 3NDKA 3HPOA 1ITGA 3HPGA 4FJJA 1X1PA 4PUOA 4O55A 4KB1A 3HT3A 3LPTA 4FJXA 1VSHA 3WNEA 1KCFA 1WAFA 4J2BA 2IC3A 3LAKA 2X6NA 1JLFA 3NGYA 3HM9A 1Z25A 1NK0A 1NJYA 3K5MA 4GMJB 1TKDA 3KKSA 4B9TA 1HQUA 1RTHA 3F9KA 3SQ1A 3PY8A 3ZSVA 2GBZA 3RR8A 2G8UA 3U3GA 1TL1A 1ZBLA 2HVIA 4CK3A 3M8RA 1BI4B 4L8RB 1WSFA 3MECA 4CEDA 4OPKA 4B9SA 2E4LA 4DQPA 1VK0A 5JS1A 2YV0X 4DTNA 1RT5A 1C1CA 3HL8A 3QETA 1L3VA 1L5UA 4J2DA 4FK0A 2FBXA 1S5JA 1JLQA 1VSMA 1EX4A 3G10A 1Q9YA 4GW6A 2Z1HA 3WNFA 3AVGA 1RBSA 3DOKA 5HLFA 3L2QA 3KK1A 1ASWA 1IKXA 4BDYA 1JKHA 2DFEA 3DOLA 1J53A 2WONA 3KKRA 4CERA 4CGHA 1LV5A 2G8FA 1RBVA 4CF9A 3HVRA 4N56A 1RBUA 4DU1A 4IFYA 4FLZA 3UIQA 1T8EA 3LPUA 4LD0A 3L2RA 4F3TA 1QQCA 1Q8IA 3TAQA 4KO0A 1SV5A 4FZYA 3V6DA 4E89A 4DSFA 4CJLA 4CEZA 5FRMA 1S9GA 4FZZA 1ASUA 3MAQA 3F73A 3L8BA 3QEXA 1KLMA 3ZSZA 2ATQA 5C42A 3SCXA 2QKKA 1RDAA 1IKYA 5CZ1A 3TAPA 2G8VA 4DG1A 4ID5A 4KTWA 4B9LA 4KHSA 4E1NA 1VSEA 1JLGA 3TAGA 4FLVA 3K2PA 3NHGA 4H8KA 3AO5A 3VQBA 2IDOA 2D0AA 3OYHA 4N47A 4E3SA 3QESA 4CJQA 1NK5A 3O4QA 4C8OA 1FKOA 1C1AA 3ISNC 3LP3A 2F96A 3AA5X 3VQPA 5KGXA 1NK7A 4M3TA 3TR8A 2HHVA 3RRGA 3QIOA 1SL0A 5HBMA 4LSNA 3NFAA 3WNGA 4HHTA 3KIOA 1BQMA 4CEFA 4CEAA 1RT6A 4CEQA 4CJKA 4CHOA 2KW4A 4OPJA 3OYCA 1L3TA 3NF6A 1REVA 1TK8A 3HYFA 3O3GA 4AHCA 4AHSA 4QOZB 1O1WA 3QEIA 1ASVA 4KHNA 1NK4A 1IO2A 4FLUA 3SUNA 3VQ7A 4Z4GA 1RDDA 4OKJA 4ZHRA 3ZCMA 3V9XA 4KFBA 1HJRA 1JL1A 3DLEA 3V1RA 1D9FA 1D5AA 3KK3A 3AVAA 1JLEA 4JLHA 3SPYA 3AVCA 3SUPA 3IS9A 4CESA 4DFJA 4DLGA 4F3OA 3JSMA 2VG6A 2G8HA 5KI6A 1ZBHA 2GUIA 3DYAA 1VSLA 3AO4A 1C6VA 1QS4A 2OPPA 2YHBA 4DQSA 4CJEA 1KTQA 2YNGA 5FROA 1J5OA 5KTQA 1ZBFA 1LAWA 4RW6A 3SI6A 4EZ9A 4Z4FA 2OA8A 3DLBA 2HHQA 3I0SA 3NE6A 4OJRA 1TKTA 1ZYQA 1U47A 4CF2A 1DLOA 2F8TA 1NKBA 3K58A 4LH4A 1TL3A 3KLEA 1EXQA 3VQCA 1C1BA 2D5RA 4IFVA 3HVTA 5KRTA 3OYBA 1NK9A 4FK2A 4LH5A 4LSLA 1HMVA 3OYEA 4CJVA 1NKEA 5DMRA 4N76A 1D8YA 4W5TA 4BACA 4MQ3A 2HHTA 3RTVA 4KB0A 5J1EA 2HHUA 4M41A 4FCYA 1T05A 3LZIA 4KHYA 4Z4CA 1C0TA 1TGOA 3ZSOA 2RKIA 4RG8A 3OJUA 1TAQA 1S1TA 2D0CA 4LY7A 3AVBA 4F2RA 3T1AA 2G8IA 1FXXA 3EYZA 1L3UA 2VWJA 2RN2A 4BWMA 1Y97A 4DTPA 4M3YA 2XY5A 2A1SA 3LWMA 3D45A 5C25A 1CLQA 4OGEA 3U3YA 4DLEA 3HXMA 4FYDA 3L2VA 1SKWA 2PYJA 4CHNA 3SJJA 1RDBA 5KGWA 4BE1A 3L2WA 4NCGA 2BE2A 4CIFA 2O4GA 1U04A 4QAGA 4M42A 3AVNA 3LAMA 3OYAA 1TV6A 2ITGA 3LP2A 4O0JA 1FKPA 1VSKA 2Z1JA 4CFDA 3OVNA 4BE0A 1SL1A 1UA1A 3ZT3A 3ASMA 3TI0A 2EX3A 2OPQA 1U45A 1W0HA 2E6MA 1NK8A 4E7JA 3O3HA 1TVRA 3RMCA 1X9MA 2DY4A 4J2AA 1TK5A 3DLGA 2HNDA 4DU3A 2HMIA 4FLWA 3ULDA 3SPZA 3V4IA 3ALYA 4DTRA 2OZSA 3NGZA 5JS2A 4NYNA 4F2SA 2BGGA 2X74A 4O5BA 5HRNA 3SNNA 2KQ2A 3BGRA 1NOYA 3L3UA 3M8PA 1UWBA 3NF8A 3TAEA 4CEBA 1XI1A 1IH7A 4DTUA 4CJ3A 2HVHA 4Z4IA 1NK6A 3ZT0A 2XRIA 3M8SA 3HSTB 4HUEA 3SQ4A 4E7HA 3QO9A 3DRPA 3PUFA 2IS3A 4CFAA 4DSKA 3AO1A 4N5SA 3CM6A 2ETJA 5J2QA 2JLEA 1C0MA 4EP4A 3DLKA 3NH2A 3PO5A 2Z1GA 3BDPA 1DTQA 4IG0A 1EP4A 4C8MA 1U4BA 3WNHA 3I0RA 4W5RA 2XO7A 3S9HA 3EY1A 1TKZA 4YNQA 4W5OA 4I7FA 4DQRA 4RW7A 3VA0A 3TARA 3V1QA 4KI6A 4OKEA 1B9DA 1UA0A 1CXQA 2IGIA 1SKSA 4ELTA 4OVLA 3TAFA 1ZBUA 3KLGA 2B4JA 1DTTA 4CEOA 4B9UA 3AVIA 3P83D 1GOAA 5DK5A 2R7YA 3LP0A 1YTUA 3K5OA 2RPIA 4NCBA 2YHAA 2KFNA 4KI4A 4M3WA 3CQ8A 5HRPA 4KTQA 3DMJA 4CJSA 2B6AA 1A5XA 4AHUA 2VWKA 3DRRA 3NBPA 4FJ9A 1BISA 3P1GA 2OZMA 4DMNA 5J2PA 3DI6A 1N6QA 1WSJA 1J9AA 4HUGA 3V9SA 2OPRA 4PWDA 5T7BA 2FC0A 4K8ZA 4M3ZA 3SUQA 2HNYA 4Z0UA 2LSNA 1XHZA 1SL2A 4DTMA 3TWHA 3P5JA 1GOBA 2BANA 3RMAA 3VQDA 1I39A 4I2PA 3ZSYA 1HRHA 4Y1DA 4OLAA 4CJPA 1XWLA 3KLFA 3NAEA 1UOCA 4DWIA 3MEEA 4J2EA 1S1XA 1LAVA 1S1VA 2QXFA 2VG7A 3OS1A 4ELVA 1RT4A 5HROA 2IAJA 3DLRA 4DF4A 1VSIA 2HB5A 4NCAA 2IOCA 4G1QA 2XY7A 3DM2A 4FM0A 1SUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HP1 A;  2Y1J A;  2ZE2 A;  4TSX A;  4DSJ A;  1S1W A;  2D0B A;  4CJT A;  1QSY A;  5J2M A;  4HVJ A;  4FJI A;  1SKR A;  2GV9 A;  4CCH A;  1Z26 A;  2XY6 A;  4BDZ A;  3RRH A;  1LWE A;  3ZSR A;  3PX6 A;  4I9Q A;  4CFC A;  1NJW A;  3QIP A;  1QTM A;  1TK0 A;  3K5N A;  1S1U A;  2VG5 A;  3OYG A;  2BDP A;  3NH0 A;  2HHW A;  1QHT A;  3AV9 A;  4AIL C;  1X9S A;  4IKF A;  3VQ9 A;  3CFP A;  3JYT A;  4AH9 A;  3SV4 A;  3RR7 A;  1A5V A;  4FJL A;  3CFO A;  3K57 A;  3HJF A;  4DTS A;  1YT3 A;  3DRS A;  4O44 A;  3MXM A;  1KLN A;  3AVL A;  1KVC A;  1CZ9 A;  1WAJ A;  3QNO A;  1WN7 A;  3VQ6 A;  4DSI A;  1HPZ A;  4AHR A;  4CEE A;  4B3O A;  1T7P A;  4E7K A;  4OLB A;  3MEG A;  5FRN A;  2KFZ A;  3LZJ A;  5E41 A;  4JRP A;  3LWL A;  4FJ8 A;  1TKX A;  4CJU A;  3MXJ A;  5CZ2 A;  1IKW A;  4HCC A;  4Z4E A;  4Y1C A;  4YFU A;  1RT7 A;  3NH1 A;  4B9V A;  2F8S A;  2XHB A;  3MED A;  4IBN A;  1RTJ A;  1FK9 A;  1C0U A;  3OYF A;  5CY4 A;  3V9W A;  4E0D A;  2P1J A;  4DQI A;  2PY5 A;  1KFD A;  3C6U A;  1B9F A;  4EZ6 A;  4AHT A;  3PX4 A;  1LWF A;  1QE1 A;  1RBR A;  1VSJ A;  4Z4H A;  3NCI A;  2RF2 A;  1RNH A;  3AA4 A;  4R5P A;  3KLH A;  3V9Z A;  4F8R A;  4KHW A;  4KRF A;  1KVA A;  1WSI A;  1RDC A;  3ITH A;  2Z1I A;  3S3O A;  4AHV A;  4CEC A;  1J54 A;  2G8K A;  3KD1 E;  1WLJ A;  3VQ8 A;  1G15 A;  4I9L A;  3K5L A;  5EU7 A;  1U48 A;  1BCO A;  4WE1 A;  3NGI A;  2YKN A;  3QEP A;  2G8W A;  1LW2 A;  4CGI A;  4O4G A;  4C8K A;  4PQU A;  2HHX A;  4M3X A;  1HYZ A;  4KAZ A;  4M45 A;  3TAB A;  1JL2 A;  4Q5V A;  4FJM A;  1HQE A;  1VSD A;  4UQG A;  1BHL A;  4DTJ A;  4BWJ A;  3KD5 E;  1BQN A;  2A1R A;  4C8N A;  3IAY A;  4CGF A;  4NYF A;  5CYM A;  1TAU A;  3ZT2 A;  3A2F A;  3U6F A;  3CFR A;  3IRX A;  2NUB A;  3AVK A;  3AO3 A;  4B8A B;  3S3N A;  1T03 A;  3L2U A;  4FM2 A;  3HK2 A;  4E19 A;  5I3U A;  1BCM A;  1BIZ A;  2P5G A;  2HW3 A;  2KTQ A;  1CXU A;  4KHQ A;  1RT3 A;  1HNI A;  2XY8 A;  1BIU A;  3OYJ A;  2PYL A;  4KV8 A;  3VQ4 A;  1S9E A;  3AVH A;  4CK2 A;  4PY5 A;  4CHY A;  2P51 A;  4CJR A;  4FLT A;  2X6S A;  3FFI A;  4B9M A;  2OYQ A;  4FJG A;  1JLA A;  3OYD A;  4DTO A;  1UAX A;  3AVM A;  3OY9 A;  2AJQ A;  3V81 A;  4KKO A;  3OJS A;  3NF9 A;  3LAL A;  3OYN A;  3VN5 A;  3HP9 A;  5KRS A;  2DFF A;  4CF1 A;  2YNI A;  3QIN A;  3G0Z A;  2FBT A;  3OS0 A;  1R0A A;  1JLC A;  3SV3 A;  4ICL A;  4KTZ A;  4OGC A;  2HNZ A;  5HRS A;  2ZD1 A;  4DU4 A;  5CYQ A;  1GOC A;  3VQQ A;  3OYL A;  4W5N A;  4HTU A;  1WSE A;  3KLI A;  5J2N A;  1N5Y A;  3D0P A;  1RT2 A;  3B6O A;  3HO1 A;  3CM5 A;  3SYZ A;  4CJW A;  3M8Q A;  2KZM A;  4CJF A;  3THV A;  2JGU A;  2EHG A;  4OKK A;  3CYM A;  4CJ4 A;  4C8L A;  1LW0 A;  4M3R A;  3OYM A;  4DFK A;  1EKE A;  3ZT4 A;  4DF8 A;  1WSH A;  4DFP A;  4FLY A;  3E01 A;  4ID1 A;  3AVJ A;  4CIE A;  3DLH A;  4FXD A;  3LP1 A;  1I3A A;  4CHQ A;  3V9U A;  4M3U A;  2KZZ A;  2Q3S A;  3RMD A;  3I8D A;  1RCH A;  1VRU A;  3ZSX A;  4CHZ A;  4FJN A;  4KRE A;  4QCL A;  2Y1I A;  4K8X A;  1EET A;  1F21 A;  4IG3 A;  4ZTJ A;  3HP6 A;  1A5W A;  2E6L A;  3B6P A;  4I2Q A;  4E7L A;  3C95 A;  1U49 A;  3L3V A;  1YTA A;  2FBV A;  3VQ5 A;  1W9H A;  4RW9 A;  4CGJ A;  3V1O A;  3ZSW A;  1RTI A;  1KFS A;  3TAN A;  1X9W A;  4JRQ A;  3H08 A;  1B92 A;  1QSL A;  3RMB A;  4DS4 A;  4KHU A;  4CGD A;  1HYV A;  1BL3 A;  3QLH A;  1NKC A;  5K14 A;  4B9N A;  3RWU A;  3AA2 A;  1NOZ A;  1YVU A;  4CGG A;  4Q0B A;  2QKB A;  3QEW A;  1VRT A;  3MXI A;  1S6Q A;  4FW2 A;  4FW1 A;  3KJV A;  3PO4 A;  2DFH A;  2ZQB A;  4EP5 A;  4E7I A;  4CF0 A;  4N41 A;  3CG7 A;  4H4O A;  4XIU A;  2O4I A;  1BI4 A;  4BE2 A;  4FJH A;  3SQ0 A;  1IG9 A;  3AO2 A;  4GVM A;  3ZSQ A;  2DTU A;  2QK9 A;  1KSP A;  2W42 A;  1K6Y A;  3C6T A;  4CK1 A;  2YNH A;  3KK2 A;  1L3S A;  1BGX T;  2B5J A;  4B8C A;  4CIG A;  1VSF A;  3QEV A;  1JXB A;  3SUO A;  2YNF A;  4HCB A;  2YKM A;  4RW4 A;  3S3M A;  3OYI A;  5D3G A;  3EZ5 A;  4FZX C;  4JS5 A;  1ZBI A;  3O4N A;  4ELU A;  4O0I A;  1Q9X A;  4F4K A;  1LWC A;  1S6P A;  3HPH A;  4H4M A;  4ZTF A;  4KPY A;  2OPS A;  4B08 A;  4RW8 A;  2FBY A;  4JS4 A;  3SZ2 A;  1XHX A;  2I5J A;  4MFB A;  1HYS A;  3QNN A;  2X78 A;  4PA1 A;  3T3F A;  1QSS A;  3O3F A;  3LDS A;  4DTX A;  4FJ5 A;  4CE9 A;  3NF7 A;  1RTD A;  3VQA A;  3SQ2 A;  3LAN A;  1WNS A;  5FDL A;  2WOM A;  3T19 A;  4FK4 A;  1NJZ A;  1JLB A;  1IKV A;  4FJK A;  3VQE A;  3PX0 A;  1KVB A;  4DSL A;  5I42 A;  4FVM A;  3C94 A;  4W5Q A;  3K59 A;  1NJX A;  4CF8 A;  1KRP A;  3ZT1 A;  1RIL A;  1RT1 A;  3KTQ A;  4HUF A;  1WSG A;  3PV8 A;  3IG1 A;  4IDK A;  2PZS A;  4BDP A;  4E1M A;  4DSE A;  1CZB A;  3OYK A;  2P5O A;  5HRR A;  4DFM A;  4FLX A;  1RBT A;  1D9D A;  1XC9 A;  5C24 A;  5SZT A;  3AA3 A;  1HNV A;  4FJ7 A;  2HHS A;  1MU2 A;  3QER A;  4CFB A;  3VA3 A;  4CJ5 A;  4CHP A;  1JXE A;  4DQQ A;  3OS2 A;  4FM1 A;  4DS5 A;  5SWM A;  3TAM A;  3AVF A;  3NDK A;  3HPO A;  1ITG A;  3HPG A;  4FJJ A;  1X1P A;  4PUO A;  4O55 A;  4KB1 A;  3HT3 A;  3LPT A;  4FJX A;  1VSH A;  3WNE A;  1KCF A;  1WAF A;  4J2B A;  2IC3 A;  3LAK A;  2X6N A;  1JLF A;  3NGY A;  3HM9 A;  1Z25 A;  1NK0 A;  1NJY A;  3K5M A;  4GMJ B;  1TKD A;  3KKS A;  4B9T A;  1HQU A;  1RTH A;  3F9K A;  3SQ1 A;  3PY8 A;  3ZSV A;  2GBZ A;  3RR8 A;  2G8U A;  3U3G A;  1TL1 A;  1ZBL A;  2HVI A;  4CK3 A;  3M8R A;  1BI4 B;  4L8R B;  1WSF A;  3MEC A;  4CED A;  4OPK A;  4B9S A;  2E4L A;  4DQP A;  1VK0 A;  5JS1 A;  2YV0 X;  4DTN A;  1RT5 A;  1C1C A;  3HL8 A;  3QET A;  1L3V A;  1L5U A;  4J2D A;  4FK0 A;  2FBX A;  1S5J A;  1JLQ A;  1VSM A;  1EX4 A;  3G10 A;  1Q9Y A;  4GW6 A;  2Z1H A;  3WNF A;  3AVG A;  1RBS A;  3DOK A;  5HLF A;  3L2Q A;  3KK1 A;  1ASW A;  1IKX A;  4BDY A;  1JKH A;  2DFE A;  3DOL A;  1J53 A;  2WON A;  3KKR A;  4CER A;  4CGH A;  1LV5 A;  2G8F A;  1RBV A;  4CF9 A;  3HVR A;  4N56 A;  1RBU A;  4DU1 A;  4IFY A;  4FLZ A;  3UIQ A;  1T8E A;  3LPU A;  4LD0 A;  3L2R A;  4F3T A;  1QQC A;  1Q8I A;  3TAQ A;  4KO0 A;  1SV5 A;  4FZY A;  3V6D A;  4E89 A;  4DSF A;  4CJL A;  4CEZ A;  5FRM A;  1S9G A;  4FZZ A;  1ASU A;  3MAQ A;  3F73 A;  3L8B A;  3QEX A;  1KLM A;  3ZSZ A;  2ATQ A;  5C42 A;  3SCX A;  2QKK A;  1RDA A;  1IKY A;  5CZ1 A;  3TAP A;  2G8V A;  4DG1 A;  4ID5 A;  4KTW A;  4B9L A;  4KHS A;  4E1N A;  1VSE A;  1JLG A;  3TAG A;  4FLV A;  3K2P A;  3NHG A;  4H8K A;  3AO5 A;  3VQB A;  2IDO A;  2D0A A;  3OYH A;  4N47 A;  4E3S A;  3QES A;  4CJQ A;  1NK5 A;  3O4Q A;  4C8O A;  1FKO A;  1C1A A;  3ISN C;  3LP3 A;  2F96 A;  3AA5 X;  3VQP A;  5KGX A;  1NK7 A;  4M3T A;  3TR8 A;  2HHV A;  3RRG A;  3QIO A;  1SL0 A;  5HBM A;  4LSN A;  3NFA A;  3WNG A;  4HHT A;  3KIO A;  1BQM A;  4CEF A;  4CEA A;  1RT6 A;  4CEQ A;  4CJK A;  4CHO A;  2KW4 A;  4OPJ A;  3OYC A;  1L3T A;  3NF6 A;  1REV A;  1TK8 A;  3HYF A;  3O3G A;  4AHC A;  4AHS A;  4QOZ B;  1O1W A;  3QEI A;  1ASV A;  4KHN A;  1NK4 A;  1IO2 A;  4FLU A;  3SUN A;  3VQ7 A;  4Z4G A;  1RDD A;  4OKJ A;  4ZHR A;  3ZCM A;  3V9X A;  4KFB A;  1HJR A;  1JL1 A;  3DLE A;  3V1R A;  1D9F A;  1D5A A;  3KK3 A;  3AVA A;  1JLE A;  4JLH A;  3SPY A;  3AVC A;  3SUP A;  3IS9 A;  4CES A;  4DFJ A;  4DLG A;  4F3O A;  3JSM A;  2VG6 A;  2G8H A;  5KI6 A;  1ZBH A;  2GUI A;  3DYA A;  1VSL A;  3AO4 A;  1C6V A;  1QS4 A;  2OPP A;  2YHB A;  4DQS A;  4CJE A;  1KTQ A;  2YNG A;  5FRO A;  1J5O A;  5KTQ A;  1ZBF A;  1LAW A;  4RW6 A;  3SI6 A;  4EZ9 A;  4Z4F A;  2OA8 A;  3DLB A;  2HHQ A;  3I0S A;  3NE6 A;  4OJR A;  1TKT A;  1ZYQ A;  1U47 A;  4CF2 A;  1DLO A;  2F8T A;  1NKB A;  3K58 A;  4LH4 A;  1TL3 A;  3KLE A;  1EXQ A;  3VQC A;  1C1B A;  2D5R A;  4IFV A;  3HVT A;  5KRT A;  3OYB A;  1NK9 A;  4FK2 A;  4LH5 A;  4LSL A;  1HMV A;  3OYE A;  4CJV A;  1NKE A;  5DMR A;  4N76 A;  1D8Y A;  4W5T A;  4BAC A;  4MQ3 A;  2HHT A;  3RTV A;  4KB0 A;  5J1E A;  2HHU A;  4M41 A;  4FCY A;  1T05 A;  3LZI A;  4KHY A;  4Z4C A;  1C0T A;  1TGO A;  3ZSO A;  2RKI A;  4RG8 A;  3OJU A;  1TAQ A;  1S1T A;  2D0C A;  4LY7 A;  3AVB A;  4F2R A;  3T1A A;  2G8I A;  1FXX A;  3EYZ A;  1L3U A;  2VWJ A;  2RN2 A;  4BWM A;  1Y97 A;  4DTP A;  4M3Y A;  2XY5 A;  2A1S A;  3LWM A;  3D45 A;  5C25 A;  1CLQ A;  4OGE A;  3U3Y A;  4DLE A;  3HXM A;  4FYD A;  3L2V A;  1SKW A;  2PYJ A;  4CHN A;  3SJJ A;  1RDB A;  5KGW A;  4BE1 A;  3L2W A;  4NCG A;  2BE2 A;  4CIF A;  2O4G A;  1U04 A;  4QAG A;  4M42 A;  3AVN A;  3LAM A;  3OYA A;  1TV6 A;  2ITG A;  3LP2 A;  4O0J A;  1FKP A;  1VSK A;  2Z1J A;  4CFD A;  3OVN A;  4BE0 A;  1SL1 A;  1UA1 A;  3ZT3 A;  3ASM A;  3TI0 A;  2EX3 A;  2OPQ A;  1U45 A;  1W0H A;  2E6M A;  1NK8 A;  4E7J A;  3O3H A;  1TVR A;  3RMC A;  1X9M A;  2DY4 A;  4J2A A;  1TK5 A;  3DLG A;  2HND A;  4DU3 A;  2HMI A;  4FLW A;  3ULD A;  3SPZ A;  3V4I A;  3ALY A;  4DTR A;  2OZS A;  3NGZ A;  5JS2 A;  4NYN A;  4F2S A;  2BGG A;  2X74 A;  4O5B A;  5HRN A;  3SNN A;  2KQ2 A;  3BGR A;  1NOY A;  3L3U A;  3M8P A;  1UWB A;  3NF8 A;  3TAE A;  4CEB A;  1XI1 A;  1IH7 A;  4DTU A;  4CJ3 A;  2HVH A;  4Z4I A;  1NK6 A;  3ZT0 A;  2XRI A;  3M8S A;  3HST B;  4HUE A;  3SQ4 A;  4E7H A;  3QO9 A;  3DRP A;  3PUF A;  2IS3 A;  4CFA A;  4DSK A;  3AO1 A;  4N5S A;  3CM6 A;  2ETJ A;  5J2Q A;  2JLE A;  1C0M A;  4EP4 A;  3DLK A;  3NH2 A;  3PO5 A;  2Z1G A;  3BDP A;  1DTQ A;  4IG0 A;  1EP4 A;  4C8M A;  1U4B A;  3WNH A;  3I0R A;  4W5R A;  2XO7 A;  3S9H A;  3EY1 A;  1TKZ A;  4YNQ A;  4W5O A;  4I7F A;  4DQR A;  4RW7 A;  3VA0 A;  3TAR A;  3V1Q A;  4KI6 A;  4OKE A;  1B9D A;  1UA0 A;  1CXQ A;  2IGI A;  1SKS A;  4ELT A;  4OVL A;  3TAF A;  1ZBU A;  3KLG A;  2B4J A;  1DTT A;  4CEO A;  4B9U A;  3AVI A;  3P83 D;  1GOA A;  5DK5 A;  2R7Y A;  3LP0 A;  1YTU A;  3K5O A;  2RPI A;  4NCB A;  2YHA A;  2KFN A;  4KI4 A;  4M3W A;  3CQ8 A;  5HRP A;  4KTQ A;  3DMJ A;  4CJS A;  2B6A A;  1A5X A;  4AHU A;  2VWK A;  3DRR A;  3NBP A;  4FJ9 A;  1BIS A;  3P1G A;  2OZM A;  4DMN A;  5J2P A;  3DI6 A;  1N6Q A;  1WSJ A;  1J9A A;  4HUG A;  3V9S A;  2OPR A;  4PWD A;  5T7B A;  2FC0 A;  4K8Z A;  4M3Z A;  3SUQ A;  2HNY A;  4Z0U A;  2LSN A;  1XHZ A;  1SL2 A;  4DTM A;  3TWH A;  3P5J A;  1GOB A;  2BAN A;  3RMA A;  3VQD A;  1I39 A;  4I2P A;  3ZSY A;  1HRH A;  4Y1D A;  4OLA A;  4CJP A;  1XWL A;  3KLF A;  3NAE A;  1UOC A;  4DWI A;  3MEE A;  4J2E A;  1S1X A;  1LAV A;  1S1V A;  2QXF A;  2VG7 A;  3OS1 A;  4ELV A;  1RT4 A;  5HRO A;  2IAJ A;  3DLR A;  4DF4 A;  1VSI A;  2HB5 A;  4NCA A;  2IOC A;  4G1Q A;  2XY7 A;  3DM2 A;  4FM0 A;  1SUQ A; 
#chains in the Genus database with same CATH topology
 3MK6 A;  2JWL A;  2Y1J A;  1S72 N;  1MDU B;  1YF5 L;  4BDZ A;  3RRH A;  1MWK A;  2QTD A;  3MN6 A;  1NJW A;  5ADX A;  1TK0 A;  3WQT A;  4JKG A;  3AV9 A;  1X9S A;  4FJL A;  3JYT A;  3WEE B;  3SV4 A;  3RR7 A;  3CFO A;  3K57 A;  1YT3 A;  3AVL A;  1KVC A;  4BGB A;  3QNO A;  4AHR A;  4CEE A;  3CCQ N;  1T7P A;  4OLB A;  4JV5 K;  4BRK A;  1JCE A;  5E41 A;  2E2P A;  3J7A P;  1TKX A;  4CJU A;  4PHT X;  5EOY A;  3A5O C;  4U67 L;  4Z4E A;  3WT0 A;  1RT7 A;  3OA9 A;  1C0U A;  1P8Z A;  4LF6 K;  1B9F A;  4Z4H A;  4KRF A;  1RNH A;  3AA4 A;  2ASP A;  3AAR A;  3W0L A;  4CEC A;  1J54 A;  1WLJ A;  1G15 A;  4I9L A;  4YDU C;  2O8B B;  1BCO A;  3QEP A;  2YKN A;  3QIC A;  4PQU A;  2P9P B;  4M3X A;  1HYZ A;  1X3M A;  1X3N A;  5FPN A;  1HQE A;  5KQ8 A;  3A0I X;  4IO8 A;  3KD5 E;  1BUP A;  4CGF A;  1K8K B;  2ZWH A;  3AVK A;  2F9W A;  5AQX A;  3HK2 A;  4E19 A;  2VQE K;  2FLO A;  2KTQ A;  3CF5 L;  3CPE A;  3PSI A;  3JAM O;  1RT3 A;  1BIU A;  4PY5 A;  4CJR A;  4FLT A;  4FJG A;  4DTO A;  3A8Y A;  5BRD A;  2CGK A;  3OJS A;  3LDO A;  1SAZ A;  1Q18 A;  3HP9 A;  5KRS A;  1VQ4 N;  3LDL A;  1R0A A;  4IEI A;  3SV3 A;  4BG9 A;  4KTZ A;  4DR4 K;  1NGA A;  4LC9 B;  5AQO A;  2VCP A;  4W5N A;  5J2N A;  4H0V B;  1BG3 A;  5M1N A;  1N5Y A;  1D4X A;  4IWV A;  2W40 A;  1Z6R A;  3THV A;  4OKK A;  4CJ4 A;  1OH6 A;  2GEL A;  4DF8 A;  4K25 A;  4FLY A;  3DLH A;  3AVJ A;  1GLD G;  3ENH A;  1I3A A;  3LP1 A;  3V9U A;  2KZZ A;  5C0Y A;  2Q3S A;  3I8D A;  1VRU A;  3ZSX A;  4IOX A;  5LMU K;  4K8X A;  1EET A;  1VQM N;  1V4T A;  1U49 A;  3N4P A;  4JI7 K;  3WXM B;  2DPN A;  1KQS M;  1YTA A;  4RW9 A;  5MLC Q;  2UUC K;  1T44 A;  4FWN A;  4WQ4 A;  3H08 A;  4GY2 B;  3QLH A;  4DR3 K;  5CR4 A;  1NOZ A;  4Q0B A;  1VRT A;  3MXI A;  1S6Q A;  3K9K A;  4N41 A;  2QWP A;  4XIU A;  4H0X B;  5CE3 A;  4BR4 A;  1K6Y A;  3KK2 A;  1L3S A;  1BGX T;  1VSF A;  2GEM A;  3S3M A;  3HBT A;  5HOO A;  1ZBI A;  3I55 N;  4LF5 K;  4H4M A;  5AQF A;  4B08 A;  3SZ2 A;  4A2A A;  1XHX A;  1HYS A;  3QNN A;  4PA1 A;  3SBG A;  1QSS A;  3LDS A;  3TTF A;  4CE9 A;  3NF7 A;  4DV4 K;  3LAN A;  4A5A A;  1HKC A;  4CZF A;  4BR2 A;  2P9S A;  4DSL A;  1WBB A;  3VEW A;  1NJX A;  4X66 K;  4CF8 A;  3ZT1 A;  1OKJ A;  3FE1 A;  2P9K A;  3OYK A;  1YIT N;  1QVG M;  5HRR A;  4BQL A;  2P5O A;  1KC8 O;  4CZG A;  2IVO A;  4RWT A;  4WF9 L;  4CJ5 A;  5C2D A;  3OS2 A;  4IXC A;  2PBD A;  2V52 B;  4JN4 A;  2E8A A;  4KB1 A;  3HT3 A;  3LPT A;  1VSH A;  5BN8 A;  4I6M A;  4BRN A;  1NK0 A;  1ZXO A;  1TKD A;  3UKR B;  1IBL K;  1RTH A;  2OTL N;  4JYA K;  5BR9 A;  2GBZ A;  3OBY A;  1TL1 A;  1ATN A;  4XH5 A;  3M8R A;  4L8R B;  1WSF A;  3A5M C;  4CED A;  4OPK A;  2E4L A;  5KPZ A;  2YV0 X;  1C1C A;  1L5U A;  3QET A;  4LF9 K;  3ID6 A;  4YOW A;  1HKB A;  3G10 A;  5BR8 K;  4FO0 A;  4DQ8 A;  3WNF A;  2NZT A;  1G99 A;  3TU5 A;  3DOK A;  5HLF A;  1YI2 N;  1ASW A;  3KKR A;  3E66 A;  4JKD A;  4CER A;  1NGB A;  2G8F A;  3HVR A;  1Y64 A;  4IFY A;  3GE1 A;  2O8E B;  1T8E A;  1EQY A;  1Q8I A;  4KO0 A;  3H1Q A;  1NGF A;  2WUS A;  1NG9 A;  2KLA A;  4CJL A;  4LF7 K;  4MO4 A;  3F73 A;  3QEX A;  2D0O A;  1YJ9 N;  2ATQ A;  4JEP A;  1IKY A;  4B9L A;  4ID5 A;  4KHS A;  2HBM A;  4ISG A;  1JLG A;  3VF4 A;  4FLV A;  3PIO L;  3CXC M;  3O9R A;  4WQ4 C;  1DEJ A;  3QES A;  3K9J A;  4CJQ A;  5H1S Q;  4MDB A;  3LP3 A;  2F96 A;  3AA5 X;  4H5R A;  3QIO A;  3RVC A;  4LSN A;  1N36 K;  3WNG A;  1RT6 A;  4OPJ A;  1L3T A;  4C1N I;  4CW7 B;  3CET A;  4WCE L;  5GIP A;  1NWK A;  2PAV A;  4NXN K;  4JKE A;  3ZCM A;  4GKJ K;  3KK3 A;  1JLE A;  3F9M A;  3SUP A;  4F3O A;  2G8H A;  5KI6 A;  3DYA A;  4NLC A;  5FRO A;  5KTQ A;  2OA8 A;  3DXM B;  4CJ7 A;  3I0S A;  2HHQ A;  1TKT A;  1U47 A;  5M1K A;  3UKU B;  4IFV A;  4DV1 K;  3HVT A;  3OYE A;  4CJV A;  5DMR A;  2P9U A;  4CBW A;  1D8Y A;  1BOT O;  5AJ3 K;  3RTV A;  4KB0 A;  5BPM A;  5J1E A;  4M41 A;  4JK8 A;  4KHY A;  4Z4C A;  1HUX A;  4KH4 A;  3OJU A;  4CZL A;  4LY7 A;  2G8I A;  2VWJ A;  2RN2 A;  3PLA A;  4A57 A;  1Y97 A;  3CCR N;  4DTP A;  2A1S A;  3I56 N;  3P39 A;  3HXM A;  1HKG A;  1SKW A;  1HPM A;  4JI8 K;  4CIF A;  2E2Q A;  5AZI B;  4CBU A;  3BF1 A;  4BR9 A;  4A61 A;  3OYA A;  3VPZ A;  1TV6 A;  2ITG A;  5AQG A;  1YUW A;  2Z1J A;  4EHU A;  3OVN A;  1OH5 A;  3H46 O;  5BPN A;  1XNR K;  2EX3 A;  2E6M A;  4E7J A;  4G9Z A;  5AQM A;  2HND A;  1IJJ A;  2HMI A;  1SS6 A;  3ALY A;  5JS2 A;  2Q2R A;  2GWJ A;  5AFU H;  3VES A;  1UWB A;  2I7N A;  3NF8 A;  4FWM A;  4DTU A;  3KVG A;  2A6A A;  3M8S A;  3VF6 A;  3CCL N;  4E7H A;  1TYQ B;  4EFH A;  2QA4 N;  3AO1 A;  3CJA A;  3CM6 A;  3THY A;  4EP4 A;  1VQP N;  3DLK A;  3PO5 A;  5JMV A;  3L4I A;  5CHI A;  1DTQ A;  1EP4 A;  4CVN E;  3I0R A;  2P9N B;  4X62 K;  1BWF O;  4YNQ A;  4I7F A;  3O8M A;  3VA0 A;  3V1Q A;  4OKE A;  1WUA A;  5AQH A;  1SKS A;  1E4F T;  4EIA A;  4OVL A;  2ASO A;  5AQJ A;  4YY3 K;  3ATU A;  2NNW A;  2R7Y A;  1GOA A;  5AQK A;  2RPI A;  2ZM6 K;  2B6A A;  3J80 O;  4AHU A;  5ELZ A;  2ZGY A;  1KD1 O;  3KHY A;  4DMN A;  3DI6 A;  4K41 A;  4HUG A;  3VMF B;  4PWD A;  4K8Z A;  2FC0 A;  4M3Z A;  2HBL A;  2HNY A;  3EL2 A;  1SL2 A;  4JHD A;  4DTM A;  3SJH A;  2O8D A;  3G25 A;  4GV3 A;  4LF4 K;  3KLF A;  4DWI A;  3MEE A;  4LF8 K;  1S1X A;  1S1V A;  2QXF A;  1RT4 A;  5HRO A;  4JKH A;  2HB5 A;  2IOC A;  1SUQ A;  5M1F A;  3CJC A;  4DR2 K;  4M7X A;  2QEX N;  2CH6 A;  2YJE A;  2GV9 A;  2XY6 A;  3R8E A;  5DM6 L;  3J7Z O;  4CFC A;  2Q31 A;  3G4S N;  1S1U A;  2VG5 A;  1LCU A;  3OYG A;  3W3D A;  4IDH A;  2HHW A;  4DV5 K;  1QHT A;  3R1X A;  4AIL C;  3TSP A;  3VQ9 A;  5JLF A;  4O44 A;  1KLN A;  1WN7 A;  3ZET B;  4E7K A;  1W97 L;  3GL1 A;  4JRP A;  3LWL A;  1JCG A;  3NH1 A;  4B9V A;  4X65 K;  2XHB A;  3MED A;  3V9W A;  3OYF A;  2HBK A;  4E0D A;  1ILY A;  1C0F A;  1KFD A;  3C6U A;  4EZ6 A;  1ESV A;  1VSJ A;  4KHW A;  2RF2 A;  4F8R A;  1KVA A;  3ITH A;  2G8K A;  4BGA A;  5EU7 A;  3VET A;  3ENO A;  3D2E A;  3NGI A;  2AP1 A;  2HHX A;  1BU6 O;  2FSJ A;  1JL2 A;  3WXI A;  4DTJ A;  5M1O A;  1NGE A;  4AQY K;  2A1R A;  4C8N A;  3IAY A;  3O9T A;  3U6F A;  3VEN A;  3IRX A;  3CFR A;  3AO3 A;  3S3N A;  3EEQ A;  5I3U A;  4BR0 A;  1BCM A;  2YHW A;  3PIP L;  4H5V A;  2P5G A;  1CXU A;  4KHQ A;  3OYJ A;  1HNI A;  2XY8 A;  2PYL A;  3VQ4 A;  4FWP A;  4CHY A;  2F9T A;  2X6S A;  3FFI A;  2OYQ A;  3OYD A;  3E9L A;  3NF9 A;  5HL7 L;  2DFF A;  4JKG B;  3QIN A;  3E9P A;  4NXM K;  5E84 A;  4JI4 K;  5FPM A;  1WSE A;  3U9D A;  4JKA A;  3SYZ A;  4B3T K;  1RFQ A;  3M8Q A;  4E1J A;  2EHG A;  4M3R A;  3NVK A;  3OYM A;  2ZF5 O;  4DFP A;  5AQQ A;  2HOE A;  4GV6 A;  4QCL A;  1RCH A;  4KRE A;  3THX A;  1SZ2 A;  3M5R A;  1JCF A;  4FSV A;  3C95 A;  3U4L A;  2HBJ A;  4CGJ A;  3V1O A;  1K9M O;  1RTI A;  4JRQ A;  1B92 A;  4JNE A;  2NRV A;  1NKC A;  5K14 A;  4AF1 A;  3VEY A;  4CGG A;  3KJV A;  4FW2 A;  2DFH A;  4BRG A;  2ZQB A;  3ENB A;  4A2B A;  1NMN A;  1WOQ A;  4H4O A;  2WC9 A;  5M1P A;  5JVH L;  3DWL A;  4BRH A;  4GVM A;  3ZSQ A;  2DTU A;  2W42 A;  3C6T A;  3MX2 A;  2B5J A;  4HCB A;  1JXB A;  2YKM A;  4RW4 A;  5D3G A;  3UE5 A;  4JS5 A;  5LJV A;  4MLH A;  5AQN A;  4FWO A;  3HPH A;  4KPY A;  3VTI A;  4JS4 A;  1XUP O;  3T3F A;  4PL7 A;  1RTD A;  3EN9 A;  3JS6 A;  1E3M A;  1Q86 O;  2O8F B;  2D1K A;  3T19 A;  4FJK A;  1QQO A;  3CCU N;  3DLL L;  3PX0 A;  5I42 A;  3IMX A;  3J8A A;  3C94 A;  4FVM A;  3ZYY X;  1KRP A;  4DKW A;  3H3N O;  1WSG A;  4ILH A;  3DXK B;  3IG1 A;  4IDK A;  4E1M A;  4KBO A;  3VOV A;  1K73 O;  4FLX A;  1XC9 A;  2UXB K;  3VER A;  3VA3 A;  4DQQ A;  5AZJ A;  2E1Y A;  3TAM A;  3AVF A;  3HPO A;  1ITG A;  1NGJ A;  3HPG A;  3CME N;  3CJB A;  4FJX A;  5LL6 Z;  1KCF A;  3LAK A;  2X6N A;  1JLF A;  3HSC A;  4B9T A;  1HQU A;  1KAY A;  3MDQ A;  3PY8 A;  3RR8 A;  4DCH A;  2G8U A;  3U3G A;  2HVI A;  5JLH A;  1BI4 B;  2P9L B;  3MEC A;  4B9S A;  5JS1 A;  1GLC G;  1L3V A;  4J2D A;  2FXU A;  1JLQ A;  3MN9 A;  1VSM A;  1Q9Y A;  4GW6 A;  2Z1H A;  5C2F A;  3THW B;  3VEX A;  3R9P A;  3L2Q A;  1IKX A;  3DOL A;  2DFE A;  3FZK A;  3ZX0 A;  2WON A;  1LV5 A;  4N56 A;  3EKU A;  4FLZ A;  3LPU A;  3L2R A;  1QQC A;  5AQW A;  4BRF A;  1SV5 A;  4DSF A;  4CEZ A;  3ZEU B;  3B8A X;  3L8B A;  1KLM A;  5C42 A;  1BA1 A;  3TAP A;  3C6A A;  4DG1 A;  4KTW A;  2J4R A;  4JI3 K;  4YOR A;  4BVP A;  4H8K A;  3CC2 N;  3AO5 A;  3VQB A;  4E3S A;  4N47 A;  2P9K B;  3O80 A;  3RSE A;  1IG8 A;  4YOX A;  3NFA A;  5AR0 A;  4CHO A;  1QQM A;  1REV A;  1TK8 A;  2O8B A;  4IZ9 A;  4AHC A;  2BUP A;  3T69 A;  2P9P A;  1ASV A;  5C10 A;  2UXC K;  4I6M B;  3OBW A;  4FLU A;  3SUN A;  4OO1 J;  1VAZ A;  4DB3 A;  3V9X A;  1JL1 A;  1D5A A;  2A3Z A;  3AVA A;  2FSN A;  3IDH A;  4JLH A;  4JI5 K;  3IS9 A;  4CES A;  4DFJ A;  4PKI A;  2GUI A;  4CZM A;  2YHB A;  2ZJR L;  2YNG A;  1N33 K;  4RW6 A;  2BTF A;  1QZ5 A;  3DLB A;  3NE6 A;  1ZYQ A;  2QW9 A;  2F8T A;  3KLE A;  1VQ6 N;  3VQC A;  1C1B A;  4FK2 A;  3BZC A;  4N76 A;  4BAC A;  1J6Z A;  2HHU A;  4FCY A;  3AAQ A;  1C0T A;  1TGO A;  3MWT A;  4RG8 A;  1TAQ A;  1RDU A;  2VQF K;  4F2R A;  1V4S A;  3L4Q A;  1FXX A;  2H3G X;  3T7Z A;  4M3Y A;  3MN5 A;  2XY5 A;  5C25 A;  3OHR A;  3L2V A;  2PYJ A;  5GAD P;  3Q7B A;  1NGH A;  3AVN A;  3H1V X;  2FF6 A;  3G6E N;  1FKP A;  4QS7 A;  1SL1 A;  3FR0 A;  5IT9 O;  1T3V A;  3ZT3 A;  4RCH A;  5GAG P;  3TI0 A;  4JAX A;  1W0H A;  1TVR A;  1YHQ N;  1NM1 A;  1X9M A;  3DLG A;  3LDP A;  5F2R A;  4DU3 A;  4YOU A;  3V4I A;  4F2S A;  4B1Y B;  3NGZ A;  4NYN A;  2QXL A;  5HRN A;  1NOY A;  4B3R K;  3G71 N;  5BN9 A;  4CJ3 A;  2HVH A;  3ZT0 A;  1OH7 A;  3DRP A;  2IS3 A;  4A5B A;  5DM7 L;  1Q7Y O;  3GOI A;  1C0M A;  2ITM A;  4YHH K;  3ZLJ A;  2Z1G A;  4IG0 A;  1ATR A;  4JI6 K;  3EY1 A;  4DV7 K;  1GLA G;  4DQR A;  3TAR A;  4KI6 A;  2NRZ A;  1EO1 A;  4ELT A;  3CCE N;  4DR7 K;  4GKK K;  1ZBU A;  1Q81 O;  4X64 K;  2B4J A;  5DK5 A;  3MX5 A;  3CMA N;  4NCB A;  2QWR A;  2KFN A;  1YAG A;  4KI4 A;  4M3W A;  3CQ8 A;  5HRP A;  4KTQ A;  3DMJ A;  3CCM N;  4B1W B;  3NBP A;  5B8H A;  1M1K O;  4FJ9 A;  2HMP A;  1J9A A;  2UYT A;  5AQP A;  3IFR A;  1YJW N;  1QVF M;  2ZJQ L;  1GOB A;  2CH5 A;  3C6H A;  2BAN A;  4HTL A;  4I2P A;  3ZSY A;  4OLA A;  4Y1D A;  2KHO A;  1VQN N;  1UOC A;  4J2E A;  4BC4 A;  1LAV A;  4ELV A;  3DLR A;  3MWP A;  4NCA A;  1NGI A;  3OTO K;  4H0Y B;  2XY7 A;  4FM0 A;  2IVP A;  3LDN A;  1P90 A;  2ZE2 A;  2P9I B;  1S1W A;  2D0B A;  4CJT A;  3O6W A;  5J2M A;  1QSY A;  4FJI A;  4CCH A;  1Z26 A;  5AQL A;  2VGN A;  1LWE A;  3ZSR A;  3LM2 A;  5C15 A;  4I9Q A;  1H1V A;  5FLX O;  3QIP A;  4PKH A;  5AQT A;  5AQR A;  3NH0 A;  4IKF A;  4B3S K;  1GLE G;  1A5V A;  3THY B;  4DTS A;  3DRS A;  2O8E A;  4BQZ A;  4DSI A;  2UU9 K;  4V19 S;  3MEG A;  3ULE B;  4QS9 A;  4HCC A;  4YFU A;  2F4V K;  4IBN A;  1RTJ A;  2A41 A;  3CI5 A;  5CY4 A;  5FPD A;  2PY5 A;  4BC2 A;  4AHT A;  1T6C A;  3HOS A;  1QE1 A;  1RBR A;  3V9Z A;  4R5P A;  2VGM A;  1WSI A;  1RDC A;  2Z1I A;  4AHV A;  3VQ8 A;  3CQX A;  3K5L A;  5LMN K;  1U48 A;  1WBD A;  2G8W A;  1N8R O;  4O4G A;  2JWK A;  4KAZ A;  5BRE A;  1VSD A;  4BWJ A;  4MLE A;  3C7N B;  3NMU A;  4NYF A;  5CYM A;  1YJN N;  1T03 A;  4FM2 A;  2HW3 A;  4FWS A;  4KV8 A;  4CK2 A;  3AVH A;  2E5L K;  2VWB A;  2HHH K;  2NRX A;  4J8F A;  4B9M A;  1JLA A;  2A5X A;  1XMQ K;  1IV0 A;  1UAX A;  3AVM A;  4JK9 A;  3OY9 A;  5JVG L;  1FW6 A;  4KKO A;  3DXM A;  3SBT A;  3LAL A;  3OYN A;  1OVY A;  1SQK A;  3UKU A;  1ATS A;  2RE2 A;  3G0Z A;  3OS0 A;  4OGC A;  2HNZ A;  5AFU A;  5BPL A;  3TPQ A;  5HRS A;  5CYQ A;  2UUA K;  3OYL A;  4HTU A;  5AQS A;  3D0P A;  1RT2 A;  3SMP A;  3HO1 A;  4HWI A;  4CJW A;  4CJF A;  2V7Z A;  3CYM A;  2RHK A;  4IEE A;  4CD3 A;  4C8L A;  2Q0U A;  3ZT4 A;  4CIE A;  4FXD A;  4CHQ A;  4M63 C;  4JD2 B;  3H45 C;  3SK3 A;  4FJN A;  4CHZ A;  1N34 K;  1F21 A;  4IG3 A;  1NGD A;  3B6P A;  4I2Q A;  4IO9 L;  3L3V A;  1X9J A;  5AZI A;  1MWM A;  1VQ8 N;  3D2F A;  3TAN A;  3C65 A;  3QDK A;  3RMB A;  4DS4 A;  4KHU A;  4CGD A;  4B9Q A;  1HYV A;  4B9N A;  3RWU A;  3AA2 A;  1YVU A;  3P4I A;  3H6E A;  1GLF O;  3QEW A;  5KPT A;  1Q82 O;  4EP5 A;  2ZJP L;  3CG7 A;  2UXD K;  2YI1 A;  2O4I A;  3AO2 A;  4K43 A;  5GIN A;  2QK9 A;  4DV2 K;  3FZH A;  4CK1 A;  4JI0 K;  2O8C B;  3GBT A;  4CIG A;  3QEV A;  3E9O A;  3SUO A;  2WTU A;  3OYI A;  3EZ5 A;  3CPW M;  1TYQ A;  4O0I A;  4F4K A;  1LWC A;  1S6P A;  4ZTF A;  2OPS A;  1I94 K;  4RW8 A;  2FBY A;  2I5J A;  4MFB A;  4FJ5 A;  5TKW A;  2P9N A;  4H0T B;  3SQ2 A;  2WOM A;  3EZW A;  1IKV A;  3VQE A;  1W2B M;  2Q97 A;  3KTQ A;  1RIL A;  1RT1 A;  4HUF A;  3PV8 A;  3D7E O;  3OW2 M;  1D9D A;  1KXP A;  4CZJ A;  5C24 A;  4BRE A;  5SZT A;  3AGR A;  4FL9 A;  1MU2 A;  3QER A;  4CFB A;  4KHP K;  1JXE A;  5SWM A;  1X1P A;  3THX B;  4FWR A;  4O55 A;  4Z94 A;  1QZ6 A;  3WNE A;  1WAF A;  4J2B A;  1LOT B;  3O1W A;  4JKF A;  2EWS A;  3NGY A;  3HM9 A;  3K5M A;  4GMJ B;  3KKS A;  3MCP A;  1VQ9 N;  1ZBL A;  4R79 A;  4DQP A;  3SAH A;  1VK0 A;  3Q7C A;  2QWM A;  4BRC A;  3QBX A;  4FK0 A;  1WB9 A;  1NJI O;  4O8K A;  4GVE A;  4IOA L;  1R59 O;  3O08 A;  5TKY A;  3AVG A;  3KK1 A;  1ZC6 A;  4OPA A;  3NVM A;  1VQK N;  1VQO N;  4CGH A;  2OAN A;  4CF9 A;  3P38 A;  4NB4 A;  4IOC L;  2PFU A;  4LD0 A;  4F3T A;  4FZY A;  4E89 A;  5FRM A;  4FZZ A;  3U9Z A;  4H0P A;  5LJW A;  3MAQ A;  3ZET A;  4CBX A;  4B1V A;  3ZSZ A;  4BRA A;  4JK7 A;  2G8V A;  4E1N A;  3TAG A;  3K2P A;  3CD6 N;  3J7Y P;  3CJ9 A;  3OYH A;  3HI0 A;  2D0A A;  3KZB A;  4LFC K;  2HF3 A;  1NK5 A;  3O4Q A;  4C8O A;  4UY8 O;  1C1A A;  3ISN C;  5KGX A;  1NK7 A;  3TR8 A;  3RRG A;  4NO7 A;  1ZBS A;  4A59 A;  1BQM A;  4CEF A;  2NLX A;  4CEA A;  4CJK A;  2KW4 A;  4C1N K;  3OYC A;  3WUH A;  1YIJ N;  3CQY A;  5GIO A;  5C12 A;  3HYF A;  3WXK A;  3O3G A;  4AHS A;  5ADX H;  5GAE P;  1E4G T;  1RDD A;  4KFB A;  1HJR A;  3DLE A;  4DUY K;  1GLB G;  2OCE A;  3ATV A;  2HHS A;  4DLG A;  4YOY A;  1ZBH A;  2VG6 A;  4CI6 A;  1QS4 A;  2OPP A;  1HNX K;  4OX9 K;  1XQS C;  1KTQ A;  4PKG A;  4EZ9 A;  3VEV A;  4OJR A;  2GTD A;  3AY9 A;  3BEX A;  2HF4 A;  1TL3 A;  1NK9 A;  1EXQ A;  4LSL A;  1HMV A;  3FGU A;  3O9U A;  1NKE A;  4MQ3 A;  2HHT A;  2E88 A;  3VF2 A;  4LFA K;  5KQD A;  3IUC A;  3ZSO A;  4B3M K;  1S1T A;  2D0C A;  3T1A A;  4DUZ K;  4K0K K;  3EYZ A;  1K8A O;  2GWK A;  2V7Y A;  3LWM A;  1QQN A;  3O1B A;  4OGE A;  4ISE A;  2Q36 A;  4DLE A;  3U3Y A;  2CGJ A;  4FYD A;  5BRF A;  1U2V A;  4CHN A;  1Z05 A;  4MO5 A;  1RDB A;  5KGW A;  3RSE B;  4BE1 A;  2BE2 A;  3HOT A;  2O4G A;  1U04 A;  4QAG A;  4M42 A;  4BY9 C;  1CZA N;  4O0J A;  4CFD A;  4BE0 A;  2OPQ A;  1NK8 A;  3T1Y K;  2DY4 A;  3C0B A;  2E20 A;  2KKZ A;  3N4Q A;  3ULD A;  4F9O A;  1NBW A;  4FOI A;  2OZS A;  4BC5 A;  2CGL A;  4O5B A;  1BDG A;  1XNQ K;  3SNN A;  4DR5 K;  5A2Q O;  4U7B A;  4JI2 K;  1XI1 A;  4Z4I A;  3A5L C;  3HST B;  4KH5 A;  4HUE A;  2A42 A;  3SQ4 A;  1S22 A;  3WQU A;  3PUF A;  3WEE A;  4XH1 A;  4ILG B;  4Y0W A;  1U4B A;  1TKZ A;  3M3Z A;  5IWA K;  3TSU A;  2UUB K;  2P9S B;  1UA0 A;  2O8F A;  1DKG D;  3KLG A;  1W7A A;  1M90 O;  4LFB K;  1DTT A;  3AVI A;  1NLV A;  3P83 D;  5F1X A;  4DHY A;  1RGI A;  4CZH A;  4B1X B;  2YHA A;  3DXK A;  2YJF A;  4CJS A;  3R6M A;  1A5X A;  2VYP A;  3SLC A;  1BIS A;  3P1G A;  2OZM A;  5J2P A;  3SUQ A;  1JJ2 M;  3ZX3 A;  2WBN A;  1IBK K;  3VTH A;  3HRG A;  3CER A;  3RMA A;  3VQD A;  1I39 A;  1NMD A;  1K8K A;  1XWL A;  3NAE A;  3QBW A;  3OS1 A;  2VG7 A;  5AQU A;  4DF4 A;  1VSI A;  2YX6 A;  4G1Q A;  4RTF D;  2P9L A;  1BI4 A;  4YOV A;  5HP1 A;  3H3O B;  3EE8 A;  4TSX A;  4XH4 A;  4A62 A;  4DSJ A;  4HVJ A;  4H5W A;  1SKR A;  2Q0R A;  3CIP A;  3WXJ A;  1OH8 A;  3PX6 A;  3CCV N;  2D4W A;  4WFB L;  3EO3 A;  4O5F A;  1QTM A;  4OPH A;  3THW A;  3K5N A;  3CC7 N;  1KAX A;  2BDP A;  1BA0 A;  3CFP A;  4AH9 A;  4L3Q A;  3HJF A;  3MXM A;  2HHV A;  1WAJ A;  1CZ9 A;  3L0Q A;  4B1U B;  3VQ6 A;  1HPZ A;  4B3O A;  3QFP A;  5FRN A;  2KFZ A;  3LZJ A;  3ZEU A;  1HR0 K;  4BG8 A;  4FJ8 A;  3MXJ A;  5CZ2 A;  1IKW A;  5EX5 A;  4Y1C A;  5BRH A;  2F8S A;  1FK9 A;  2P1J A;  4DQI A;  1HLU A;  3PX4 A;  2NRR A;  1LWF A;  3NCI A;  1J5E K;  2QWN A;  3KLH A;  3S3O A;  2ASM A;  3KD1 E;  3JXU A;  3VGM A;  1YVN A;  3BP8 A;  4WE1 A;  4ISF A;  1LW2 A;  4CGI A;  1BO5 O;  4C8K A;  1C0G A;  3GDQ A;  4M45 A;  4BRL A;  4Q5V A;  3TAB A;  4FJM A;  2IIR A;  4UQG A;  1BHL A;  3TTC A;  1BQN A;  1TAU A;  2V51 B;  4WYB A;  3ZT2 A;  3A2F A;  2NUB A;  3LL3 A;  4B8A B;  2OTJ N;  3L2U A;  1BIZ A;  1S9E A;  3O4W A;  2P51 A;  3TSQ A;  1TUU A;  2NRT A;  2AJQ A;  2F7T A;  5EXW A;  3V81 A;  1S3X A;  3VN5 A;  2QWQ A;  4CF1 A;  2YNI A;  2P9U B;  2FBT A;  4AM7 A;  1JLC A;  4ICL A;  3AAP A;  3QB0 A;  2I7P A;  4EHT A;  2ZD1 A;  4DU4 A;  3O5B A;  1GOC A;  3VQQ A;  3KLI A;  3B6O A;  3CM5 A;  4KH6 A;  1U6Z A;  2KZM A;  2JGU A;  1LW0 A;  4DFK A;  1EKE A;  1WSH A;  3MN7 A;  3E01 A;  4ID1 A;  4WQ5 A;  3S41 A;  4M3U A;  3RMD A;  2Y1I A;  2YCH A;  1TUY A;  4ZTJ A;  3HP6 A;  1A5W A;  2E6L A;  4E7L A;  3T1H K;  4JKC A;  2E2O A;  2FBV A;  3VQ5 A;  1W9H A;  3ZSW A;  3UKR A;  4XEI A;  2QWO A;  3AGK A;  1KFS A;  1X9W A;  1QSL A;  3L6Q A;  1EWQ A;  1BL3 A;  3LDQ A;  4EAH D;  2QKB A;  4PL8 A;  4FW1 A;  3PO4 A;  4E7I A;  5EY4 A;  4CF0 A;  4BE2 A;  4FJH A;  1O13 A;  3SQ0 A;  1IG9 A;  2A40 A;  1KSP A;  1VHX A;  2FF3 B;  2YNH A;  5EVZ A;  4B8C A;  4BR5 A;  2YNF A;  4JKB A;  4FZX C;  2YHY A;  3O4N A;  4ELU A;  1Q9X A;  1OVQ A;  4DV0 K;  3BZK A;  5F0X A;  3CJ1 A;  2WFB A;  5KPR A;  2X78 A;  3O9S A;  3O3F A;  4DTX A;  3VQA A;  3F2K A;  2QI2 A;  4BRI A;  1WNS A;  3LM9 A;  5FDL A;  4FK4 A;  1NJZ A;  1JLB A;  3CC4 N;  1KVB A;  3K59 A;  4W5Q A;  3DJC A;  3U8X A;  4BC3 A;  4FPA A;  5M1Q A;  2W41 A;  2PZS A;  4BDP A;  3FZF A;  1CZB A;  4DSE A;  4DFM A;  1RBT A;  3VEZ A;  3BUZ B;  4FJ7 A;  3AA3 A;  1HNV A;  3TTD A;  4FOE A;  4CHP A;  2GUP A;  3BF3 A;  4BRD A;  4CZI A;  4FM1 A;  1GLL O;  3A5N C;  4DS5 A;  3NDK A;  4FJJ A;  4C23 A;  4PUO A;  4JHD B;  3VGL A;  2O8D B;  3P31 A;  2E2N A;  2IC3 A;  3CHW A;  1Z25 A;  1NJY A;  3GG4 A;  3D2F B;  3F9K A;  3SQ1 A;  3ZSV A;  3M6G A;  4CZE A;  1HJO A;  4CK3 A;  4O8U A;  4H5T A;  4FVU A;  3SMS A;  3F5T A;  4FWQ A;  2Q1N A;  2NRW A;  1RT5 A;  4DTN A;  3EE9 A;  3HL8 A;  3D6R A;  2FBX A;  5GAH P;  1S5J A;  3ZX2 A;  1EX4 A;  2P9I A;  1QHA A;  1HNZ K;  3MMV A;  3VGK A;  3FZL A;  1RBS A;  3HM8 A;  4BDY A;  4DR1 K;  1JKH A;  4ILJ A;  1J53 A;  1RBV A;  3EKS A;  1RBU A;  4DU1 A;  3UIQ A;  3TAQ A;  2W6L A;  4WQ5 C;  3V6D A;  4WFN L;  1S9G A;  1ASU A;  4NLB A;  3MCA B;  2QKK A;  5AQI A;  3SCX A;  1RDA A;  5CZ1 A;  3ULE A;  5I9E B;  1VSE A;  3NHG A;  1NNE A;  2IDO A;  3FZM A;  1HNW K;  1FKO A;  3VQP A;  4M3T A;  4CZK A;  3HTV A;  1SL0 A;  5HBM A;  4HHT A;  3KIO A;  4IFE A;  4CEQ A;  3O9Q A;  2IVN A;  3D2E B;  2E1Z A;  4FPB A;  2QM1 A;  3NF6 A;  4BRM A;  4BRP A;  3SAG A;  3ID8 A;  3VEO A;  1DGK N;  3M1F A;  4QOZ B;  1O1W A;  1NGC A;  3QEI A;  2AA4 A;  4KHN A;  1NK4 A;  4QS8 A;  1IO2 A;  3J81 O;  3VQ7 A;  4Z4G A;  4OKJ A;  4AM6 A;  4ZHR A;  3C7N A;  1D9F A;  3V1R A;  3BY5 A;  3SPY A;  4FWK A;  3AVC A;  4K42 A;  4DR6 K;  3JSM A;  1DT9 A;  5AQY A;  2HST A;  1T6D A;  1VSL A;  3AO4 A;  1C6V A;  1XC3 A;  1GLJ O;  4DQS A;  4CJE A;  1J5O A;  1ZBF A;  1LAW A;  3SI6 A;  4Z4F A;  4CF2 A;  1DLO A;  3SAF A;  1NKB A;  3K58 A;  4BRQ A;  1VQL N;  4LH4 A;  5KRT A;  2D5R A;  3OYB A;  4LH5 A;  5AQV A;  4W5T A;  1T05 A;  3LZI A;  3CCS N;  3PSF A;  3FFK B;  1N32 K;  3KK7 A;  2RKI A;  3IKM A;  4GNI A;  3KWG A;  3AVB A;  1IBM K;  3FLC O;  1L3U A;  3DAW A;  4BWM A;  4GV9 A;  3D45 A;  1FJG K;  1CLQ A;  2BH1 A;  4IJN A;  4JD2 A;  3WXL A;  2FSK A;  3SJJ A;  1MA9 B;  4IJA A;  3L2W A;  4NCG A;  3LAM A;  2W6K A;  3LP2 A;  4M7Y A;  1VSK A;  1UA1 A;  3ASM A;  1U45 A;  3O3H A;  4H03 B;  3RMC A;  4J2A A;  1TK5 A;  2ZGZ A;  4FLW A;  1NU0 A;  3SPZ A;  1XMO K;  3KWI A;  4B1Z A;  4DTR A;  2BGG A;  1NGG A;  2X74 A;  4YDU A;  2KQ2 A;  3BGR A;  3L3U A;  3M8P A;  3TAE A;  4CEB A;  1IH7 A;  3E1Y A;  4BVO A;  1NK6 A;  2XRI A;  2O8C A;  3QO9 A;  4DSK A;  4H5N A;  4BR7 A;  4CFA A;  3CJ7 A;  4DV6 K;  4N5S A;  2GX9 A;  3CCJ N;  2ETJ A;  3K0S A;  5J2Q A;  2JLE A;  1YXQ A;  3NH2 A;  4CD1 A;  3BDP A;  4C8M A;  3WNH A;  4W5R A;  2XO7 A;  3S9H A;  2NRH A;  4W5O A;  4RW7 A;  4DV3 K;  5AQZ A;  1RDW X;  1B9D A;  1EWR A;  1CXQ A;  2IGI A;  4BRO A;  4H0O A;  3QML A;  3TAF A;  4YOT A;  4CEO A;  4B9U A;  3HZ6 A;  3LP0 A;  1YTU A;  5E26 A;  3K5O A;  4MDA A;  2QWL A;  3I8B A;  5AZJ B;  2VWK A;  3DRR A;  3QFU A;  4JI1 K;  2YHX A;  4FWL A;  1HX1 A;  1N6Q A;  1WSJ A;  3V9S A;  2OPR A;  1U2V B;  5T7B A;  4Z0U A;  1KAZ A;  2LSN A;  1XHZ A;  5JIC A;  3TWH A;  3P5J A;  2D0P A;  1VQ7 N;  3I33 A;  3R3L A;  1HRH A;  4CJP A;  1VQ5 N;  4WFA L;  2IAJ A;  5FPE A;  5LY3 A;  3DM2 A;  3UB5 A; 
#chains in the Genus database with same CATH homology
 5HP1 A;  2Y1J A;  2ZE2 A;  4TSX A;  4DSJ A;  1S1W A;  2D0B A;  4CJT A;  1QSY A;  5J2M A;  4HVJ A;  4FJI A;  1SKR A;  2GV9 A;  4CCH A;  1Z26 A;  2XY6 A;  4BDZ A;  3RRH A;  1LWE A;  3ZSR A;  3PX6 A;  4I9Q A;  4CFC A;  1NJW A;  3QIP A;  1QTM A;  1TK0 A;  3K5N A;  1S1U A;  2VG5 A;  3OYG A;  2BDP A;  3NH0 A;  2HHW A;  1QHT A;  3AV9 A;  4AIL C;  1X9S A;  4IKF A;  3VQ9 A;  3CFP A;  3JYT A;  4AH9 A;  3SV4 A;  3RR7 A;  1A5V A;  4FJL A;  3CFO A;  3K57 A;  3HJF A;  4DTS A;  1YT3 A;  3DRS A;  4O44 A;  3MXM A;  1KLN A;  3AVL A;  1KVC A;  1CZ9 A;  1WAJ A;  3QNO A;  1WN7 A;  3VQ6 A;  4DSI A;  1HPZ A;  4AHR A;  4CEE A;  4B3O A;  1T7P A;  4E7K A;  4OLB A;  3MEG A;  5FRN A;  2KFZ A;  3LZJ A;  5E41 A;  4JRP A;  3LWL A;  4FJ8 A;  1TKX A;  4CJU A;  3MXJ A;  5CZ2 A;  1IKW A;  4HCC A;  4Z4E A;  4Y1C A;  4YFU A;  1RT7 A;  3NH1 A;  4B9V A;  2F8S A;  2XHB A;  3MED A;  4IBN A;  1RTJ A;  1FK9 A;  1C0U A;  3OYF A;  5CY4 A;  3V9W A;  4E0D A;  2P1J A;  4DQI A;  2PY5 A;  1KFD A;  3C6U A;  1B9F A;  4EZ6 A;  4AHT A;  3PX4 A;  1LWF A;  1QE1 A;  1RBR A;  1VSJ A;  4Z4H A;  3NCI A;  2RF2 A;  1RNH A;  3AA4 A;  4R5P A;  3KLH A;  3V9Z A;  4F8R A;  4KHW A;  4KRF A;  1KVA A;  1WSI A;  1RDC A;  3ITH A;  2Z1I A;  3S3O A;  4AHV A;  4CEC A;  1J54 A;  2G8K A;  3KD1 E;  1WLJ A;  3VQ8 A;  1G15 A;  4I9L A;  3K5L A;  5EU7 A;  1U48 A;  1BCO A;  4WE1 A;  3NGI A;  2YKN A;  3QEP A;  2G8W A;  1LW2 A;  4CGI A;  4O4G A;  4C8K A;  4PQU A;  2HHX A;  4M3X A;  1HYZ A;  4KAZ A;  4M45 A;  3TAB A;  1JL2 A;  4Q5V A;  4FJM A;  1HQE A;  1VSD A;  4UQG A;  1BHL A;  4DTJ A;  4BWJ A;  3KD5 E;  1BQN A;  2A1R A;  4C8N A;  3IAY A;  4CGF A;  4NYF A;  5CYM A;  1TAU A;  3ZT2 A;  3A2F A;  3U6F A;  3CFR A;  3IRX A;  2NUB A;  3AVK A;  3AO3 A;  4B8A B;  3S3N A;  1T03 A;  3L2U A;  4FM2 A;  3HK2 A;  4E19 A;  5I3U A;  1BCM A;  1BIZ A;  2P5G A;  2HW3 A;  2KTQ A;  1CXU A;  4KHQ A;  1RT3 A;  1HNI A;  2XY8 A;  1BIU A;  3OYJ A;  2PYL A;  4KV8 A;  3VQ4 A;  1S9E A;  3AVH A;  4CK2 A;  4PY5 A;  4CHY A;  2P51 A;  4CJR A;  4FLT A;  2X6S A;  3FFI A;  4B9M A;  2OYQ A;  4FJG A;  1JLA A;  3OYD A;  4DTO A;  1UAX A;  3AVM A;  3OY9 A;  2AJQ A;  3V81 A;  4KKO A;  3OJS A;  3NF9 A;  3LAL A;  3OYN A;  3VN5 A;  3HP9 A;  5KRS A;  2DFF A;  4CF1 A;  2YNI A;  3QIN A;  3G0Z A;  2FBT A;  3OS0 A;  1R0A A;  1JLC A;  3SV3 A;  4ICL A;  4KTZ A;  4OGC A;  2HNZ A;  5HRS A;  2ZD1 A;  4DU4 A;  5CYQ A;  1GOC A;  3VQQ A;  3OYL A;  4W5N A;  4HTU A;  1WSE A;  3KLI A;  5J2N A;  1N5Y A;  3D0P A;  1RT2 A;  3B6O A;  3HO1 A;  3CM5 A;  3SYZ A;  4CJW A;  3M8Q A;  2KZM A;  4CJF A;  3THV A;  2JGU A;  2EHG A;  4OKK A;  3CYM A;  4CJ4 A;  4C8L A;  1LW0 A;  4M3R A;  3OYM A;  4DFK A;  1EKE A;  3ZT4 A;  4DF8 A;  1WSH A;  4DFP A;  4FLY A;  3E01 A;  4ID1 A;  3AVJ A;  4CIE A;  3DLH A;  4FXD A;  3LP1 A;  1I3A A;  4CHQ A;  3V9U A;  4M3U A;  2KZZ A;  2Q3S A;  3RMD A;  3I8D A;  1RCH A;  1VRU A;  3ZSX A;  4CHZ A;  4FJN A;  4KRE A;  4QCL A;  2Y1I A;  4K8X A;  1EET A;  1F21 A;  4IG3 A;  4ZTJ A;  3HP6 A;  1A5W A;  2E6L A;  3B6P A;  4I2Q A;  4E7L A;  3C95 A;  1U49 A;  3L3V A;  1YTA A;  2FBV A;  3VQ5 A;  1W9H A;  4RW9 A;  4CGJ A;  3V1O A;  3ZSW A;  1RTI A;  1KFS A;  3TAN A;  1X9W A;  4JRQ A;  3H08 A;  1B92 A;  1QSL A;  3RMB A;  4DS4 A;  4KHU A;  4CGD A;  1HYV A;  1BL3 A;  3QLH A;  1NKC A;  5K14 A;  4B9N A;  3RWU A;  3AA2 A;  1NOZ A;  1YVU A;  4CGG A;  4Q0B A;  2QKB A;  3QEW A;  1VRT A;  3MXI A;  1S6Q A;  4FW2 A;  4FW1 A;  3KJV A;  3PO4 A;  2DFH A;  2ZQB A;  4EP5 A;  4E7I A;  4CF0 A;  4N41 A;  3CG7 A;  4H4O A;  4XIU A;  2O4I A;  1BI4 A;  4BE2 A;  4FJH A;  3SQ0 A;  1IG9 A;  3AO2 A;  4GVM A;  3ZSQ A;  2DTU A;  2QK9 A;  1KSP A;  2W42 A;  1K6Y A;  3C6T A;  4CK1 A;  2YNH A;  3KK2 A;  1L3S A;  1BGX T;  2B5J A;  4B8C A;  4CIG A;  1VSF A;  3QEV A;  1JXB A;  3SUO A;  2YNF A;  4HCB A;  2YKM A;  4RW4 A;  3S3M A;  3OYI A;  5D3G A;  3EZ5 A;  4FZX C;  4JS5 A;  1ZBI A;  3O4N A;  4ELU A;  4O0I A;  1Q9X A;  4F4K A;  1LWC A;  1S6P A;  3HPH A;  4H4M A;  4ZTF A;  4KPY A;  2OPS A;  4B08 A;  4RW8 A;  2FBY A;  4JS4 A;  3SZ2 A;  1XHX A;  2I5J A;  4MFB A;  1HYS A;  3QNN A;  2X78 A;  4PA1 A;  3T3F A;  1QSS A;  3O3F A;  3LDS A;  4DTX A;  4FJ5 A;  4CE9 A;  3NF7 A;  1RTD A;  3VQA A;  3SQ2 A;  3LAN A;  1WNS A;  5FDL A;  2WOM A;  3T19 A;  4FK4 A;  1NJZ A;  1JLB A;  1IKV A;  4FJK A;  3VQE A;  3PX0 A;  1KVB A;  4DSL A;  5I42 A;  4FVM A;  3C94 A;  4W5Q A;  3K59 A;  1NJX A;  4CF8 A;  1KRP A;  3ZT1 A;  1RIL A;  1RT1 A;  3KTQ A;  4HUF A;  1WSG A;  3PV8 A;  3IG1 A;  4IDK A;  2PZS A;  4BDP A;  4E1M A;  4DSE A;  1CZB A;  3OYK A;  2P5O A;  5HRR A;  4DFM A;  4FLX A;  1RBT A;  1D9D A;  1XC9 A;  5C24 A;  5SZT A;  3AA3 A;  1HNV A;  4FJ7 A;  2HHS A;  1MU2 A;  3QER A;  4CFB A;  3VA3 A;  4CJ5 A;  4CHP A;  1JXE A;  4DQQ A;  3OS2 A;  4FM1 A;  4DS5 A;  5SWM A;  3TAM A;  3AVF A;  3NDK A;  3HPO A;  1ITG A;  3HPG A;  4FJJ A;  1X1P A;  4PUO A;  4O55 A;  4KB1 A;  3HT3 A;  3LPT A;  4FJX A;  1VSH A;  3WNE A;  1KCF A;  1WAF A;  4J2B A;  2IC3 A;  3LAK A;  2X6N A;  1JLF A;  3NGY A;  3HM9 A;  1Z25 A;  1NK0 A;  1NJY A;  3K5M A;  4GMJ B;  1TKD A;  3KKS A;  4B9T A;  1HQU A;  1RTH A;  3F9K A;  3SQ1 A;  3PY8 A;  3ZSV A;  2GBZ A;  3RR8 A;  2G8U A;  3U3G A;  1TL1 A;  1ZBL A;  2HVI A;  4CK3 A;  3M8R A;  1BI4 B;  4L8R B;  1WSF A;  3MEC A;  4CED A;  4OPK A;  4B9S A;  2E4L A;  4DQP A;  1VK0 A;  5JS1 A;  2YV0 X;  4DTN A;  1RT5 A;  1C1C A;  3HL8 A;  3QET A;  1L3V A;  1L5U A;  4J2D A;  4FK0 A;  2FBX A;  1S5J A;  1JLQ A;  1VSM A;  1EX4 A;  3G10 A;  1Q9Y A;  4GW6 A;  2Z1H A;  3WNF A;  3AVG A;  1RBS A;  3DOK A;  5HLF A;  3L2Q A;  3KK1 A;  1ASW A;  1IKX A;  4BDY A;  1JKH A;  2DFE A;  3DOL A;  1J53 A;  2WON A;  3KKR A;  4CER A;  4CGH A;  1LV5 A;  2G8F A;  1RBV A;  4CF9 A;  3HVR A;  4N56 A;  1RBU A;  4DU1 A;  4IFY A;  4FLZ A;  3UIQ A;  1T8E A;  3LPU A;  4LD0 A;  3L2R A;  4F3T A;  1QQC A;  1Q8I A;  3TAQ A;  4KO0 A;  1SV5 A;  4FZY A;  3V6D A;  4E89 A;  4DSF A;  4CJL A;  4CEZ A;  5FRM A;  1S9G A;  4FZZ A;  1ASU A;  3MAQ A;  3F73 A;  3L8B A;  3QEX A;  1KLM A;  3ZSZ A;  2ATQ A;  5C42 A;  3SCX A;  2QKK A;  1RDA A;  1IKY A;  5CZ1 A;  3TAP A;  2G8V A;  4DG1 A;  4ID5 A;  4KTW A;  4B9L A;  4KHS A;  4E1N A;  1VSE A;  1JLG A;  3TAG A;  4FLV A;  3K2P A;  3NHG A;  4H8K A;  3AO5 A;  3VQB A;  2IDO A;  2D0A A;  3OYH A;  4N47 A;  4E3S A;  3QES A;  4CJQ A;  1NK5 A;  3O4Q A;  4C8O A;  1FKO A;  1C1A A;  3ISN C;  3LP3 A;  2F96 A;  3AA5 X;  3VQP A;  5KGX A;  1NK7 A;  4M3T A;  3TR8 A;  2HHV A;  3RRG A;  3QIO A;  1SL0 A;  5HBM A;  4LSN A;  3NFA A;  3WNG A;  4HHT A;  3KIO A;  1BQM A;  4CEF A;  4CEA A;  1RT6 A;  4CEQ A;  4CJK A;  4CHO A;  2KW4 A;  4OPJ A;  3OYC A;  1L3T A;  3NF6 A;  1REV A;  1TK8 A;  3HYF A;  3O3G A;  4AHC A;  4AHS A;  4QOZ B;  1O1W A;  3QEI A;  1ASV A;  4KHN A;  1NK4 A;  1IO2 A;  4FLU A;  3SUN A;  3VQ7 A;  4Z4G A;  1RDD A;  4OKJ A;  4ZHR A;  3ZCM A;  3V9X A;  4KFB A;  1HJR A;  1JL1 A;  3DLE A;  3V1R A;  1D9F A;  1D5A A;  3KK3 A;  3AVA A;  1JLE A;  4JLH A;  3SPY A;  3AVC A;  3SUP A;  3IS9 A;  4CES A;  4DFJ A;  4DLG A;  4F3O A;  3JSM A;  2VG6 A;  2G8H A;  5KI6 A;  1ZBH A;  2GUI A;  3DYA A;  1VSL A;  3AO4 A;  1C6V A;  1QS4 A;  2OPP A;  2YHB A;  4DQS A;  4CJE A;  1KTQ A;  2YNG A;  5FRO A;  1J5O A;  5KTQ A;  1ZBF A;  1LAW A;  4RW6 A;  3SI6 A;  4EZ9 A;  4Z4F A;  2OA8 A;  3DLB A;  2HHQ A;  3I0S A;  3NE6 A;  4OJR A;  1TKT A;  1ZYQ A;  1U47 A;  4CF2 A;  1DLO A;  2F8T A;  1NKB A;  3K58 A;  4LH4 A;  1TL3 A;  3KLE A;  1EXQ A;  3VQC A;  1C1B A;  2D5R A;  4IFV A;  3HVT A;  5KRT A;  3OYB A;  1NK9 A;  4FK2 A;  4LH5 A;  4LSL A;  1HMV A;  3OYE A;  4CJV A;  1NKE A;  5DMR A;  4N76 A;  1D8Y A;  4W5T A;  4BAC A;  4MQ3 A;  2HHT A;  3RTV A;  4KB0 A;  5J1E A;  2HHU A;  4M41 A;  4FCY A;  1T05 A;  3LZI A;  4KHY A;  4Z4C A;  1C0T A;  1TGO A;  3ZSO A;  2RKI A;  4RG8 A;  3OJU A;  1TAQ A;  1S1T A;  2D0C A;  4LY7 A;  3AVB A;  4F2R A;  3T1A A;  2G8I A;  1FXX A;  3EYZ A;  1L3U A;  2VWJ A;  2RN2 A;  4BWM A;  1Y97 A;  4DTP A;  4M3Y A;  2XY5 A;  2A1S A;  3LWM A;  3D45 A;  5C25 A;  1CLQ A;  4OGE A;  3U3Y A;  4DLE A;  3HXM A;  4FYD A;  3L2V A;  1SKW A;  2PYJ A;  4CHN A;  3SJJ A;  1RDB A;  5KGW A;  4BE1 A;  3L2W A;  4NCG A;  2BE2 A;  4CIF A;  2O4G A;  1U04 A;  4QAG A;  4M42 A;  3AVN A;  3LAM A;  3OYA A;  1TV6 A;  2ITG A;  3LP2 A;  4O0J A;  1FKP A;  1VSK A;  2Z1J A;  4CFD A;  3OVN A;  4BE0 A;  1SL1 A;  1UA1 A;  3ZT3 A;  3ASM A;  3TI0 A;  2EX3 A;  2OPQ A;  1U45 A;  1W0H A;  2E6M A;  1NK8 A;  4E7J A;  3O3H A;  1TVR A;  3RMC A;  1X9M A;  2DY4 A;  4J2A A;  1TK5 A;  3DLG A;  2HND A;  4DU3 A;  2HMI A;  4FLW A;  3ULD A;  3SPZ A;  3V4I A;  3ALY A;  4DTR A;  2OZS A;  3NGZ A;  5JS2 A;  4NYN A;  4F2S A;  2BGG A;  2X74 A;  4O5B A;  5HRN A;  3SNN A;  2KQ2 A;  3BGR A;  1NOY A;  3L3U A;  3M8P A;  1UWB A;  3NF8 A;  3TAE A;  4CEB A;  1XI1 A;  1IH7 A;  4DTU A;  4CJ3 A;  2HVH A;  4Z4I A;  1NK6 A;  3ZT0 A;  2XRI A;  3M8S A;  3HST B;  4HUE A;  3SQ4 A;  4E7H A;  3QO9 A;  3DRP A;  3PUF A;  2IS3 A;  4CFA A;  4DSK A;  3AO1 A;  4N5S A;  3CM6 A;  2ETJ A;  5J2Q A;  2JLE A;  1C0M A;  4EP4 A;  3DLK A;  3NH2 A;  3PO5 A;  2Z1G A;  3BDP A;  1DTQ A;  4IG0 A;  1EP4 A;  4C8M A;  1U4B A;  3WNH A;  3I0R A;  4W5R A;  2XO7 A;  3S9H A;  3EY1 A;  1TKZ A;  4YNQ A;  4W5O A;  4I7F A;  4DQR A;  4RW7 A;  3VA0 A;  3TAR A;  3V1Q A;  4KI6 A;  4OKE A;  1B9D A;  1UA0 A;  1CXQ A;  2IGI A;  1SKS A;  4ELT A;  4OVL A;  3TAF A;  1ZBU A;  3KLG A;  2B4J A;  1DTT A;  4CEO A;  4B9U A;  3AVI A;  3P83 D;  1GOA A;  5DK5 A;  2R7Y A;  3LP0 A;  1YTU A;  3K5O A;  2RPI A;  4NCB A;  2YHA A;  2KFN A;  4KI4 A;  4M3W A;  3CQ8 A;  5HRP A;  4KTQ A;  3DMJ A;  4CJS A;  2B6A A;  1A5X A;  4AHU A;  2VWK A;  3DRR A;  3NBP A;  4FJ9 A;  1BIS A;  3P1G A;  2OZM A;  4DMN A;  5J2P A;  3DI6 A;  1N6Q A;  1WSJ A;  1J9A A;  4HUG A;  3V9S A;  2OPR A;  4PWD A;  5T7B A;  2FC0 A;  4K8Z A;  4M3Z A;  3SUQ A;  2HNY A;  4Z0U A;  2LSN A;  1XHZ A;  1SL2 A;  4DTM A;  3TWH A;  3P5J A;  1GOB A;  2BAN A;  3RMA A;  3VQD A;  1I39 A;  4I2P A;  3ZSY A;  1HRH A;  4Y1D A;  4OLA A;  4CJP A;  1XWL A;  3KLF A;  3NAE A;  1UOC A;  4DWI A;  3MEE A;  4J2E A;  1S1X A;  1LAV A;  1S1V A;  2QXF A;  2VG7 A;  3OS1 A;  4ELV A;  1RT4 A;  5HRO A;  2IAJ A;  3DLR A;  4DF4 A;  1VSI A;  2HB5 A;  4NCA A;  2IOC A;  4G1Q A;  2XY7 A;  3DM2 A;  4FM0 A;  1SUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...