3VQDA

Hiv-1 in core domain in complex with 5-methyl-3-phenyl-1,2-oxazole-4-carboxylic acid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
151
structure length
141
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPSMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 49
structure length 141
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqdA00
3HSTB 4CK1A 3QEVA 4CK3A 2IOCA 4M45A 2OPSA 3T19A 3AVKA 2G8KA 5D3GA 4Z4FA 3V6DA 1BQNA 3DYAA 4CF1A 1WSGA 1WSIA 2OZSA 4IFYA 3KD1E 4CEBA 3B6OA 2PZSA 1TKDA 3NGZA 3V1RA 3SUNA 1NJXA 4Z4EA 4C8LA 3VQCA 3VQ8A 3DMJA 4HHTA 4L8RB 1XHXA 4NCBA 4ELVA 1S5JA 2XY8A 2DFHA 2WONA 5DK5A 4KAZA 4DTXA 3QO9A 3K59A 3RRHA 4DFPA 4FK0A 1JLGA 3DM2A 4K8XA 4FVMA 4KHWA 4CCHA 4F4KA 4FJHA 4FJ9A 3TWHA 4CHNA 1FKOA 1TAQA 3VQAA 4CHOA 1NK4A 1DTTA 3M8PA 3UIQA 1N5YA 1KSPA 4FZZA 4DQPA 1HMVA 4CEZA 3ZSRA 4FLWA 1U48A 3HJFA 1BIUA 4I2QA 3HT3A 2EX3A 1X9SA 2X74A 1JLAA 1VSKA 4BDYA 3K5LA 5J1EA 3SCXA 3ASMA 3LANA 1SV5A 3O4QA 2QKKA 2QKBA 3QNNA 1EP4A 3U3YA 4DLEA 4FZYA 4H4MA 1RILA 3OYGA 4DF4A 1VSIA 3SUQA 2IGIA 4FJJA 3AVFA 4Y1CA 3L2RA 4F3OA 1HNVA 1RTHA 3DLRA 3IAYA 3VN5A 3DRPA 4CEOA 2I5JA 1ZBUA 4F2RA 1WAJA 3NF7A 4OKJA 2O4GA 1TAUA 4LH5A 4CJ3A 1C0TA 4CJ5A 4HUFA 4Z4IA 3DLKA 4NYNA 4J2BA 2HHVA 2JLEA 3SUPA 3V4IA 2YNIA 4CIEA 2HNDA 4EZ9A 1TKZA 2A1SA 3AO3A 4NCAA 1JL2A 3L2QA 3NGYA 4RW8A 3EY1A 1ZBLA 1IG9A 2ZD1A 1RCHA 3OYKA 1TK0A 1X9MA 4I9QA 5J2NA 1BCMA 1HPZA 1QHTA 3LWMA 3MECA 4OLAA 2G8WA 3BDPA 4CEFA 3PY8A 3RR8A 4KKOA 4CEAA 4DTUA 3K2PA 3OYHA 1U47A 4B3OA 3ZSOA 1VSHA 4ZTJA 3NCIA 2G8HA 2OPPA 4CFAA 3OYCA 3PO4A 1BCOA 2FBVA 1NKEA 4I2PA 3ISNC 1NKBA 3KLIA 3VQ5A 3NH2A 3OY9A 4BE1A 1SKRA 1W0HA 1RDCA 4ZTFA 3QINA 1LV5A 3DLBA 1ZBHA 3RMDA 4FJ7A 2YNGA 4KTZA 5JS2A 1U49A 3MXJA 1NK7A 4FYDA 1XWLA 3L3VA 4M3TA 4CJKA 4N47A 4C8MA 4CFDA 1JXEA 1D5AA 2P5OA 4CECA 4DFJA 1FXXA 4BACA 1NJYA 1I3AA 4EP5A 4DTNA 4FW2A 1LWFA 1YTAA 5SWMA 3WNFA 4PQUA 4HUGA 4E1MA 5I3UA 1RT2A 4CGFA 4BE2A 2YHBA 4DMNA 1C1BA 3RWUA 5CYQA 4FJ5A 4AHTA 3OYMA 3VQ4A 3V9SA 1T03A 4KHYA 1UAXA 1RDAA 4CFBA 1CXUA 1TL3A 3LP3A 5I42A 3AVBA 3ZT4A 2FBTA 3QEXA 4KTQA 4KO0A 3M8QA 2IC3A 4E7LA 4DQQA 2ZE2A 3VQ9A 3C6TA 1R0AA 3AO1A 4FJNA 4Z4GA 1RTJA 4FM0A 1HNIA 2F8TA 1Z26A 3VQEA 3HXMA 2YKNA 4NCGA 3EYZA 4DQSA 3SPYA 3L2WA 4C8NA 2Z1GA 1FK9A 5CY4A 3KK2A 4HCCA 1RDDA 2VG7A 3PUFA 1TKXA 4ELTA 4OKKA 4OPKA 1KFSA 2XY7A 1J54A 3TARA 4O0IA 1BL3A 1CZBA 3NH0A 3V81A 4W5OA 4CF8A 1QSLA 3C6UA 4I7FA 4PWDA 2Z1IA 1S1VA 1U45A 1KRPA 3CFRA 4MFBA 2GBZA 5FRNA 1UWBA 3NF8A 4O55A 3PX0A 4B9NA 4YFUA 1UOCA 2EHGA 3AVGA 2W42A 4C8KA 4KHSA 4Z0UA 1BQMA 1RTDA 3TI0A 1RT6A 3IS9A 3KLGA 4PY5A 4Q5VA 2BDPA 1GOCA 2BE2A 4CJSA 4QOZB 3TAEA 3OYJA 3WNGA 1CXQA 1RBRA 1REVA 3OYNA 2OA8A 2X78A 1RBUA 3AVJA 5DMRA 4FW1A 4DFKA 3LP1A 3OYFA 1YVUA 1B9DA 2GV9A 1VSDA 3HPHA 4AHSA 2VWKA 4CJEA 1G15A 3NDKA 1SUQA 4CGGA 4FLUA 1NK6A 3K58A 4DU4A 3I8DA 3TAQA 3AO5A 1BIZA 1VSEA 4DTMA 4M3WA 3NAEA 2F8SA 3V1QA 5HP1A 3PV8A 4RW4A 4N56A 3L2VA 2VG5A 1JLBA 4K8ZA 4FCYA 3OS2A 2G8UA 1RNHA 3HYFA 2KZZA 4E89A 3AVMA 5EU7A 1KVCA 4CE9A 5KRSA 4E0DA 3DRSA 1Q8IA 2E4LA 3ZT0A 2P5GA 4I9LA 2RPIA 4FK4A 4DS5A 1IKWA 3HK2A 4H8KA 4CJTA 1UA0A 1SL1A 1MU2A 4E19A 4CIFA 3NH1A 3QNOA 4CK2A 3QETA 1T05A 2XY5A 4JS5A 1KLMA 1XC9A 3AVAA 2PY5A 3KLFA 4W5QA 1J53A 3ZSQA 4EP4A 5KI6A 2ITGA 1WNSA 3AVNA 3L3UA 1TK8A 1C1AA 4KI6A 4CIGA 3G0ZA 3TAPA 1EXQA 1BI4A 4M3YA 5C42A 1S6QA 4B9TA 1LW2A 3O4NA 4XIUA 3K5MA 3QESA 4E7IA 1WSHA 3P83D 1QQCA 2HMIA 3SNNA 4FJXA 1SL0A 4AHRA 1Z25A 2ZQBA 3AVIA 1ZBFA 4C8OA 3B6PA 3I0RA 4B9UA 1T8EA 3ITHA 1RT7A 2G8FA 3NGIA 1TKTA 3SYZA 2YKMA 1J9AA 3V9WA 3MEGA 3TAGA 1Y97A 3RRGA 3F73A 3LAMA 3ZSXA 1TGOA 3ZSYA 4E3SA 2BANA 1C0MA 3NF9A 3MEEA 4CERA 2HW3A 4B9SA 1CLQA 1LAVA 3ZSVA 4F3TA 1LW0A 4OVLA 4Z4CA 5HRPA 3MAQA 4E7JA 3S9HA 4KI4A 4CESA 1BI4B 1LWCA 4DG1A 4FLTA 1NK8A 2DFEA 4W5NA 3DOLA 2E6LA 3SQ0A 1O1WA 3TR8A 1YT3A 1ASUA 2VG6A 4NYFA 3SJJA 4ID1A 2YHAA 4KFBA 4HVJA 4IG0A 3SV3A 2XY6A 3DLHA 4DFMA 1NKCA 4FJ8A 3OVNA 2A1RA 1VSLA 1LWEA 1EKEA 4CGIA 1S9EA 4N41A 4CGHA 1I39A 2YNHA 2P51A 2HHWA 1SKSA 4QCLA 4QAGA 1KVAA 4DSLA 3HP9A 4HCBA 4CHYA 3T1AA 1S1UA 2WOMA 1ASVA 2NUBA 5HLFA 1CZ9A 3MXIA 4JLHA 4CJRA 4G1QA 4OKEA 1VSMA 3CQ8A 1JXBA 4FM1A 3AVLA 1SL2A 3SPZA 1D9DA 3ALYA 1S1TA 4CJ4A 3RTVA 1HQUA 3O3HA 2KFNA 1EX4A 2HNYA 1RBVA 3HL8A 3D0PA 3DRRA 3K57A 3MEDA 4JRQA 3G10A 4DTOA 4M3ZA 3K5NA 1W9HA 1ITGA 3WNEA 4M3UA 2KFZA 5K14A 3VQPA 3L8BA 2D0AA 4Z4HA 3SZ2A 1RT5A 1A5VA 4E7KA 4M3RA 3CYMA 1BHLA 3LP2A 3I0SA 4M41A 1NOZA 3MXMA 3LALA 1HRHA 3LZJA 2XHBA 4MQ3A 1ASWA 1IKYA 1C0UA 2OPQA 3V1OA 3RMCA 2QK9A 3SV4A 2Y1IA 1WSEA 3P1GA 2HHTA 1JKHA 1L3TA 1WN7A 3LDSA 3K5OA 3TABA 4M3XA 3IRXA 3O3FA 4W5RA 4J2AA 4ZHRA 1KFDA 5HROA 1C1CA 5HRSA 2RF2A 1NK5A 5JS1A 2DFFA 4GW6A 3HM9A 3LZIA 3S3OA 3OYAA 2OYQA 1VSJA 1B92A 2D5RA 3FFIA 3T3FA 4LD0A 4EZ6A 3ZCMA 5FRMA 1TL1A 4H4OA 1Q9YA 2PYJA 1GOAA 4FJLA 3AO4A 1KVBA 2HHQA 1QSSA 1X1PA 3SUOA 3OJSA 3EZ5A 1NJZA 2JGUA 4DS4A 5HRRA 3ZT3A 4BWMA 4CHZA 3OJUA 1J5OA 1T7PA 4UQGA 3E01A 4FM2A 3HO1A 2AJQA 3NF6A 4RW6A 4PUOA 4DU3A 4FLZA 2YV0X 5HBMA 1VRUA 1UA1A 1TK5A 2OZMA 4GMJB 4CHQA 1S9GA 3CM5A 2PYLA 4FXDA 3CFOA 1SKWA 3KTQA 3VQ6A 3PX6A 5CZ2A 4CF9A 1Q9XA 1NK9A 1C6VA 4FLXA 3DLGA 2G8IA 4OPJA 3HVRA 2B5JA 3SQ4A 1VSFA 5FROA 3M8RA 4JRPA 4N76A 3AA2A 3P5JA 3KKSA 4W5TA 3WNHA 1GOBA 5KTQA 3OYIA 3V9ZA 4KHNA 4CJQA 3ZT1A 1L5UA 1NOYA 4Q0BA 2RKIA 3DI6A 3V9UA 1KLNA 4B8CA 1XHZA 3LPUA 1HYVA 3NFAA 4OJRA 4DSJA 1ZBIA 4ELUA 5E41A 3V9XA 4N5SA 1L3SA 4B9VA 1A5XA 4CGDA 1RT1A 4CJPA 1WSFA 4HTUA 1ZYQA 1VK0A 4J2EA 2Z1HA 4CHPA 1JL1A 5KGWA 1KCFA 3S3NA 4DQIA 4FZXC 4FLVA 3DLEA 1HYSA 4TSXA 4O0JA 3KK3A 4KB1A 1JLEA 4KPYA 3NE6A 3AV9A 1S6PA 3OYDA 1B9FA 4IKFA 5KRTA 1RBSA 4GVMA 1D8YA 1A5WA 4CF0A 4E7HA 1KTQA 1IKXA 1WSJA 3O3GA 3LWLA 4OLBA 3DOKA 4LY7A 4CEQA 4B08A 4CJVA 3AA5X 3PX4A 3QIPA 1X9WA 4DF8A 2HHSA 4KRFA 3NHGA 3AA4A 4F2SA 2IS3A 3VA0A 5J2QA 2HB5A 3KIOA 4IDKA 2KW4A 4DTJA 1U04A 3AO2A 3QIOA 4CEEA 3ZSWA 4DSFA 3QERA 3AA3A 2HVHA 4DSIA 2KQ2A 2LSNA 3QEWA 1RTIA 2Z1JA 4F8RA 1TV6A 4IFVA 3M8SA 4AH9A 4FLYA 4BWJA 3QLHA 3RMBA 3NBPA 5KGXA 5T7BA 1IKVA 4FJGA 4ID5A 4LSLA 3VQQA 4CJFA 4AHVA 1NK0A 1BGXT 4WE1A 1JLCA 1VRTA 3VQ7A 2X6SA 4ICLA 1EETA 4FJIA 1NJWA 4M42A 2HVIA 4DLGA 2RN2A 1N6QA 4FJKA 3C94A 1IH7A 4RG8A 3ZSZA 4KV8A 3OS0A 3THVA 4KTWA 1YTUA 3S3MA 2D0CA 3CG7A 3HPOA 4FK2A 3TANA 4CJUA 4E1NA 2R7YA 4AHUA 3IG1A 5SZTA 3AVHA 1WAFA 3F9KA 3LP0A 5CYMA 4OGEA 4J2DA 3VQBA 2P1JA 4DTSA 1TVRA 2DTUA 4B9LA 3KD5E 1FKPA 2HNZA 2Y1JA 4DSKA 4CF2A 1JLQA 4B8AB 3LAKA 4KREA 4AILC 4B9MA 3KKRA 4CGJA 4DTPA 3TAFA 1QSYA 2IAJA 3SI6A 2KZMA 3H08A 4OGCA 2O4IA 3TAMA 1QTMA 4IG3A 4KHQA 1BISA 5C25A 2ATQA 1K6YA 2IDOA 3ZT2A 4CFCA 3HVTA 4KB0A 2DY4A 4YNQA 1U4BA 4O5BA 3VA3A 4LH4A 3PO5A 5FDLA 3HP6A 3OYEA 4DSEA 1F21A 4FJMA 3CM6A 3ULDA 2FBXA 1S1XA 1RT3A 5CZ1A 3JYTA 2QXFA 4LSNA 3OYBA 1DTQA 4R5PA 3A2FA 4CJWA 2HHXA 3VQDA 4CEDA 2F96A 2BGGA 1S1WA 1IO2A 2X6NA 1HYZA 3KLEA 2D0BA 3KK1A 4DTRA 3KJVA 1RDBA 5HRNA 3OYLA 3RR7A 3LPTA 1DLOA 2B4JA 4RW7A 2G8VA 4IBNA 3OS1A 3BGRA 1L3UA 4DWIA 1RT4A 2ETJA 5J2MA 1LAWA 1XI1A 3SQ2A 3JSMA 4JS4A 1JLFA 2XO7A 4BE0A 3SQ1A 3RMAA 2OPRA 3U6FA 3HPGA 3L2UA 4BDZA 2FBYA 4PA1A 2Q3SA 4O44A 3QEIA 2HHUA 1HJRA 2YNFA 1WLJA 4CJLA 4DU1A 1QE1A 4DQRA 3D45A 1D9FA 3C95A 4O4GA 3AVCA 3CFPA 3QEPA 4AHCA 4HUEA 4KHUA 1HQEA 1QS4A 2FC0A 2VWJA 5J2PA 2GUIA 3KLHA 2B6AA 1RBTA 1L3VA 4BDPA 5C24A 4Y1DA 4RW9A 3U3GA 2XRIA 2KTQA 2E6MA
chains in the Genus database with same CATH superfamily
2GELA 4CK3A 4M45A 4FPBA 3AVKA 3V6DA 3TTFA 3SJHA 4JD2A 4U7BA 1D4XA 3NGZA 4Z4EA 4CZGA 1KAYA 4C8LA 1S5JA 2YX6A 2DFHA 3J8AA 4IJAA 4PKGA 4CZFA 4KAZA 1FJGK 3K59A 1NMDA 3RRHA 5AQTA 4FK0A 4K8XA 4KHWA 4F4KA 4JKHA 3TWHA 3DXKA 4CHNA 1TAQA 1JJ2M 4DUZK 1NK4A 1DTTA 3M8PA 1N5YA 3ZSRA 3HJFA 2E5LK 4I2QA 4LFBK 4DR6K 1JLAA 4A61A 3SCXA 3EO3A 3OBWA 2IVPA 2QKKA 4MO4A 1EP4A 1RILA 4DF4A 3L2RA 4CEOA 1ZBUA 4F2RA 3WEEA 3NF7A 4OKJA 1TAUA 4CJ5A 4KBOA 4B1WB 3V4IA 5ADXA 1SS6A 2OTLN 2NLXA 2A1SA 3AO3A 3EY1A 4NO7A 2A42A 2G8WA 3RR8A 4KKOA 1U47A 4WQ4C 1VSHA 2YI1A 3ATUA 1EO1A 1BCOA 1BDGA 3EL2A 3ISNC 3OY9A 3EZWA 1XUPO 4ZTFA 2E8AA 1LV5A 2W6KA 2YNGA 4EFHA 1JCFA 3FZFA 3H45C 4C8MA 1DKGD 1VQ7N 4CFDA 1JXEA 3A5NC 2P5OA 4DFJA 2E20A 4EP5A 3WNFA 1VQ4N 4HUGA 1DT9A 1RT2A 4XH1A 4BE2A 5JVGL 3O4WA 3CJCA 5CYQA 2VYPA 1RDWX 3OYMA 1T03A 5GADP 4KHYA 1UAXA 1CXUA 4GKJK 1TL3A 1YJ9N 3LP3A 3BF1A 4X62K 3GOIA 3QEXA 4KO0A 2IC3A 1R0AA 5I9EB 3C6TA 3AO1A 1VQ6N 4Z4GA 3CD6N 4FM0A 1HNIA 3VQEA 3L2WA 1K8KB 5CY4A 3KK2A 2VG7A 5AQWA 1TKXA 1OH8A 4CZIA 1J54A 5EY4A 4CD3A 1QSLA 2CGKA 3C6UA 5KQDA 3THWA 3UKUB 5GIOA 3I56N 1VQKN 2GBZA 4B9NA 1UOCA 2O8CA 3M5RA 1GOCA 2E2NA 2W41A 1Z6RA 1REVA 4JKFA 1RBUA 5DMRA 4DFKA 5AQRA 5F2RA 1VSDA 5FPMA 5IT9O 4CJEA 3NDKA 1SUQA 2Q97A 3K58A 3DJCA 4GKKK 5HP1A 3PV8A 4N56A 2NRRA 4CBXA 2G8UA 2O8DB 2HF3A 5AQVA 1IKWA 3HK2A 4H8KA 4CJTA 4JI3K 4CIFA 5AFUH 3NH1A 1T05A 2XY5A 4JS5A 2Q0RA 3L3UA 3G25A 4DKWA 3G0ZA 4DR1K 5C42A 2E1YA 4B9TA 2Q1NA 2ZM6K 3QBWA 4FJXA 1CZAN 5BPNA 4AHRA 1Z25A 4BROA 3I0RA 4O8KA 2NZTA 3SYZA 2A5XA 1J5EK 3ZSXA 1M1KO 4A2AA 4BVOA 4V19S 4OVLA 4GY2B 5HRPA 4DG1A 4FLTA 4NYFA 3CCQN 3SJJA 4AQYK 3CQXA 2A1RA 1LWEA 1EKEA 1RGIA 1S9EA 4FWPA 4IJNA 4CGHA 1I39A 4N41A 2P51A 2ZGZA 4QCLA 4QAGA 4DB3A 2YCHA 3H6EA 4CHYA 4YOTA 2BH1A 2NUBA 3MXIA 3P4IA 4JI0K 1D9DA 1KD1O 3AVLA 1SL2A 3RTVA 1HQUA 2KFNA 1RBVA 3VEVA 3UKRB 4M3ZA 5A2QO 3WNEA 4BC3A 4M3UA 3VQPA 1BHLA 3O80A 1YXQA 5AQGA 4M41A 3LALA 3V1OA 1IKYA 3RMCA 3N4PA 3SV4A 2Y1IA 3MMVA 1JKHA 3CF5L 1NGIA 2FLOA 4IWVA 5HROA 1C1CA 3RSEB 4DV4K 5JS1A 2IVOA 2DFFA 4GW6A 3HM9A 1B92A 5FRMA 4LD0A 2PYJA 4JKGB 5JLFA 2P9SA 1JCEA 3D2EA 3EZ5A 3OJUA 3ENBA 3HO1A 5LL6Z 1GLJO 2QWMA 4DQ8A 5HBMA 3IKMA 1S9GA 5AQJA 4YOXA 5CZ2A 4CF9A 1XNRK 1NK9A 4M63C 2HMPA 1YUWA 3AA2A 2KLAA 4W5TA 5KTQA 3CCJN 5AQZA 1NOYA 4B8CA 3B8AX 4JN4A 1OKJA 3CIPA 3OTOK 1HR0K 3AARA 2JWLA 4HTUA 5KPTA 4C23A 4CHPA 1GLDG 4DQIA 4FZXC 1BUPA 5AQFA 4GNIA 3AGRA 2QWNA 3HM8A 3ZETB 3E9PA 3AV9A 1S6PA 3OYDA 4Y0WA 1RBSA 1D8YA 1A5WA 4E7HA 1KTQA 3O3GA 4LY7A 5JMVA 3AA5X 3QIPA 2HHSA 4IO9L 2WUSA 3F9MA 3NHGA 3AA4A 4DTJA 1U04A 2ZF5O 1BU6O 2LSNA 3QEWA 4F8RA 2P9UB 1V4SA 4BWJA 3QLHA 1NLVA 3LDOA 1IKVA 5CE3A 3I33A 5E26A 4YORA 4WE1A 4DV5K 1VRTA 4FJIA 3FE1A 4FJKA 1GLLO 3AY9A 1IG8A 1HUXA 3CG7A 2OTJN 2F9TA 3UE5A 1Q7YO 3MCPA 1YI2N 3E9LA 1BG3A 2P1JA 1TVRA 4KREA 4AILC 4NXNK 4CGJA 3E9OA 3ZEUB 3TSPA 1QSYA 2KZMA 5BRFA 3CPWM 1GLEG 2IDOA 4CFCA 3DXMB 4KB0A 4O5BA 2WC9A 3HP6A 1S1XA 1RT3A 4JEPA 2F7TA 4JI2K 3A2FA 2P9IA 4K43A 5AQPA 3VQDA 4CEDA 3MN6A 1IO2A 3KLEA 1RDBA 5M1FA 3LPTA 1NGJA 2EWSA 1HKBA 5FPNA 1ATNA 1LAWA 2FF3B 5H1SQ 3JSMA 3LDNA 4JS4A 2VGNA 1WUAA 3SQ1A 3QEIA 4O44A 3IFRA 3THYB 1WLJA 5KPZA 4DQRA 3D45A 3PLAA 3BZKA 3AVCA 1HQEA 2VWJA 1WBBA 1RBTA 5LY3A 3L4IA 2UYTA 1P90A 5M1QA 2IOCA 4BRPA 4FOEA 2G8KA 1BQNA 3DYAA 4KHPK 2O8BB 1OVYA 3B6OA 4O5FA 2GTDA 3V1RA 3SUNA 3ID8A 3VQCA 3CETA 3VQ8A 4L8RB 1X3MA 5KQ8A 3IMXA 5FPEA 2A40A 2DPNA 1JLGA 1TYQB 3DM2A 4FJ9A 5BR9A 1FKOA 3FZHA 2QM1A 4JI6K 4IOCL 4FZZA 4DQPA 3D2FB 4CEZA 4FLWA 3BUZB 1BIUA 2EX3A 1VSKA 1RFQA 5AR0A 3R8EA 4CZLA 2QKBA 2IGIA 5AFUA 4F3OA 4BR2A 2RE2A 2I5JA 1WAJA 4LH5A 4PKHA 4HUFA 4Z4IA 4NYNA 4BRFA 4KH5A 4J2BA 3O8MA 5M1PA 2YNIA 1TKZA 3FZKA 2O8EA 1JL2A 3NGYA 1ZBLA 1TK0A 1T3VA 1NGHA 4DHYA 2UUAK 1QHTA 3J7YP 4OLAA 2NRXA 4IEEA 4CBWA 5GAEP 4NB4A 4B3OA 3ZSOA 1YAGA 5DM7L 1NGCA 3G71N 2OPPA 2NRHA 4I2PA 3KLIA 3VQ5A 1K8AO 1W0HA 2Q2RA 3QINA 3H3NO 3TTDA 4FJ7A 2UUCK 1J6ZA 1U49A 3HZ6A 4FYDA 1XWLA 3L3VA 1QZ5A 1D5AA 4JI5K 5F0XA 4BACA 1I3AA 4FW2A 4OO1J 3UKUA 3OA9A 2P9NB 3O9QA 4BGBA 4B3RK 3T1YK 3W0LA 4DQQA 3TPQA 4BC4A 3NVMA 1Z26A 3MN9A 3HXMA 3EYZA 4YHHK 1KXPA 4DQSA 3PUFA 3KWGA 4OKKA 3TSQA 4LF5K 1KFSA 3TARA 1T6CA 3NH0A 4CF8A 4IXCA 4PWDA 3KK7A 2O8DA 1S1VA 1U2VB 5AQNA 4MFBA 4K0KK 3O9RA 3NF8A 4O55A 3CC7N 3AVGA 2OANA 4C8KA 4Z0UA 5AQKA 4Q5VA 2BDPA 2BE2A 4CJSA 3TAEA 3OYJA 1CXQA 4FW1A 3LP1A 3WQUA 1B9DA 2GV9A 3GG4A 4FLUA 2A6AA 1N32K 5M1OA 3I8DA 3TAQA 1BIZA 4M3WA 5GAHP 5EXWA 5AZJB 1K9MO 3HYFA 5KRSA 3AVMA 1Q8IA 4I9LA 2A3ZA 3WUHA 2UXCK 3C65A 1IBLK 1MU2A 4NXMK 4E19A 4DV6K 3QNOA 3QETA 3MN7A 1SAZA 3HSCA 4JI8K 3D7EO 2GX9A 3VEYA 4WF9L 2PY5A 1EWRA 4WFAL 3ZLJA 2Q36A 4FWMA 3I55N 3U8XA 4BREA 4PKIA 4M3YA 3C0BA 5F1XA 4E7IA 4FWRA 3SNNA 2HBLA 4WYBA 3AVIA 1ZBFA 3B6PA 1T8EA 4IOAL 1RT7A 3MWTA 2YHXA 1TKTA 2D0PA 1N8RO 3TAGA 3F73A 1HJOA 3ZSYA 4E3SA 2BANA 4BRQA 1X9JA 3QFUA 2AP1A 2HW3A 1CLQA 4IEIA 2PAVA 4Z4CA 3VESA 4H5WA 3UKRA 4KI4A 4RTFD 2DFEA 4DV2K 1MA9B 3SQ0A 2VG6A 4ILHA 3N4QA 2E2QA 4YOYA 4FWQA 1NU0A 4DFMA 4B3SK 4CGIA 4DV3K 2HHWA 3IUCA 4K25A 5EOYA 1QQNA 3T1AA 1S1UA 4JYAK 5BRDA 1IV0A 3CQ8A 4CJRA 4G1QA 4OKEA 1JXBA 5MLCQ 1S1TA 4JKGA 2FSJA 1HNZK 4DV1K 4BRAA 1I94K 2NNWA 2KFZA 1GLAG 4H0PA 3L8BA 2FSKA 3QBXA 4Z4HA 5AZIA 3LDPA 4M3RA 1O13A 3LP2A 3I0SA 3MXMA 3LZJA 1ASWA 1C0UA 3Q7CA 3CCSN 3BP8A 2HHTA 3LDSA 3IRXA 3VPZA 3O3FA 4H5RA 1Q82O 3CJ7A 3OYAA 4HTLA 4EZ6A 3T3FA 3ZCMA 5JLHA 2GWKA 4EHTA 4EIAA 5TKYA 4WFNL 1QVFM 3OJSA 2JGUA 2P9KA 4LF7K 1HNWK 3E01A 2AJQA 4FWSA 3VTHA 3NF6A 4PUOA 1UA1A 4A2BA 3TSUA 4FXDA 3KTQA 2NRWA 2P9LB 1Q9XA 3CC4N 3CCEN 2E88A 4OPJA 4JKBA 3M8RA 4N76A 2QXLA 3P5JA 5AQUA 3V9ZA 1XNQK 3T1HK 1L5UA 3V9UA 4C1NK 4DSJA 1HYVA 3NFAA 3O1WA 1YJNN 4ELUA 1W97L 5LMUK 1A5XA 4CJPA 1RT1A 1VK0A 3WQTA 4J2EA 2Z1HA 5AQQA 2IVNA 5KGWA 1KCFA 3S3NA 3KK3A 4KPYA 2OCEA 1OH5A 5KRTA 3PIOL 3CQYA 1WSJA 4OLBA 1QVGM 4B08A 1TUUA 1X9WA 4JD2B 4KH6A 4ISEA 2Q0UA 4F2SA 2IS3A 3VA0A 5J2QA 3KIOA 1KLNA 1YTUA 3QIOA 4CEEA 2HBKA 3QERA 3G6EN 3SK3A 1C0FA 1YHQN 1NGEA 2BUPA 3RMBA 3ZEUA 4I6MB 5BR8K 1R59O 5C0YA 2QWPA 4LF8K 1KQSM 1XMQK 2X6SA 4ICLA 1M90O 4B3MK 1NMNA 3DXMA 2RN2A 3C94A 1U6ZA 4A57A 3ZSZA 4KV8A 3THVA 3SBGA 3TTCA 4MO5A 2R7YA 3MK6A 4OGEA 4J2DA 4BC5A 4BR5A 5JVHL 3SLCA 3KD5E 3WEEB 5KPRA 4B8AB 4B9MA 3EEQA 3H08A 2O4IA 3TAMA 4IG3A 3KHYA 1BISA 5C10A 1HKCA 5AQYA 3THYA 3ZT2A 3HVTA 3QDKA 3PO5A 2RHKA 3OYEA 1F21A 3HTVA 4R79A 3CM6A 4LSNA 4XH4A 4B1UB 4R5PA 1HNXK 3C6HA 2BGGA 1HYZA 2D0BA 3KJVA 5HRNA 3RR7A 1DLOA 4RW7A 2G8VA 1RT4A 2ETJA 2UU9K 2O8BA 5J2MA 1ATRA 2VGMA 2O8FA 5JICA 4PA1A 3KVGA 1HJRA 4DU1A 3ZX0A 1D9FA 2CGJA 4IOXA 2ZGYA 3QEPA 4HUEA 1QS4A 3GE1A 2GUIA 3THXB 4FWKA 1L3VA 4BDPA 4Y1DA 1VQMN 3CC2N 3QEVA 4QS7A 4B1XB 3U9DA 2OPSA 3T19A 4PHTX 5D3GA 4CF1A 1WSGA 1WSIA 3KD1E 4IFYA 4CEBA 2PZSA 1DEJA 4DR2K 3CI5A 1WOQA 4HHTA 3DMJA 4NCBA 4ELVA 2XY8A 5DK5A 4DTXA 3S41A 2Q31A 4OX9K 2NRVA 3THWB 4CHOA 3UIQA 3VTIA 5BPLA 4DR4K 4ILJA 3L0QA 2WBNA 1X9SA 1MWMA 2X74A 4FVUA 3A5LC 2F4VK 3ASMA 3O4QA 1SV5A 4DLEA 3CPEA 3OYGA 1VSIA 2KKZA 3AVFA 4Y1CA 2QWLA 3FZMA 1HNVA 3DLRA 3VN5A 3ENHA 2JWKA 2O4GA 5AQMA 1C0TA 2JLEA 4CIEA 2HNDA 4EZ9A 4NCAA 1IG9A 4RW8A 3DAWA 3F2KA 1RCHA 4I9QA 5J2NA 1VQON 1HPZA 2P9PB 2V52B 1EWQA 3LWMA 3MECA 5E84A 1VHXA 3PY8A 4JV5K 4DTUA 3K2PA 3VERA 2P9NA 3A8YA 1T44A 4O8UA 5M1NA 2G8HA 2ITMA 3OYCA 4CFAA 3PO4A 1ESVA 2FBVA 1NKEA 1YIJN 4G9ZA 1C0GA 3FFKB 1RDCA 1LCUA 1ZBHA 3DLBA 3RMDA 1S22A 4CVNE 3QICA 4FPAA 4H0TB 4AM6A 2A41A 4WQ5A 1NK7A 4YOWA 4M3TA 1ILYA 4CECA 3CJ1A 1NJYA 2V7ZA 3CCRN 4DTNA 3K0SA 1YTAA 4PQUA 2E1ZA 3KZBA 5I3UA 3C6AA 2YHBA 1GLCG 3VOVA 5AQXA 5I42A 4BRGA 4CZEA 1W2BM 2FBTA 4X65K 3M8QA 1H1VA 4JKEA 4B1YB 4E7LA 4LF9K 3TU5A 4X64K 3AGKA 1RTJA 2F8TA 4BRLA 3D6RA 1FK9A 1NGFA 4Z94A 4HCCA 4B9QA 4OPKA 2XY7A 5AZJA 2ZJPL 1CZBA 4J8FA 3V81A 4W5OA 4DV0K 1U45A 5C15A 2QI2A 3CFRA 1UWBA 2EHGA 4KHSA 1BQMA 1RTDA 4JKCA 4PY5A 3A5OC 4QOZB 2YJFA 3OYNA 2X78A 3AVJA 1YVUA 4CD1A 4ISFA 3HPHA 1NK6A 1G15A 4DTMA 4YOUA 4RW4A 1JLBA 3NVKA 4FWNA 4K8ZA 2ZWHA 1E4FT 1S3XA 4E89A 5EU7A 1KVCA 4E0DA 3W3DA 3PSFA 1P8ZA 2P5GA 2RPIA 4DS5A 1HKGA 4H5NA 3PSIA 4MLHA 1E3MA 2P9SB 2ASMA 3SMPA 3D2EB 4BRIA 3AVAA 4BRMA 3KLFA 4W5QA 1QHAA 3ZSQA 4EP4A 4CZKA 1WNSA 3K9JA 4XEIA 1TK8A 4M7YA 1RDUA 3DWLA 4BR9A 4CZMA 4CIGA 3LL3A 1VQLN 1LW2A 3O4NA 2VQFK 3MN5A 3SAHA 3QESA 1QQCA 2HMIA 1SL0A 3OW2M 3VETA 3L6QA 4C8OA 4B9UA 2G8FA 3VF2A 3NGIA 4NLBA 2YKMA 3V9WA 3MEGA 1SQKA 1Y97A 2FXUA 5C12A 4YOVA 3RRGA 2I7NA 3LAMA 1C0MA 3O9TA 3NF9A 4B9SA 1LAVA 2VQEK 3ZYYX 1LW0A 2CGLA 3S9HA 3MAQA 4A62A 1BI4B 4CBUA 1NK8A 3EE8A 1O1WA 3TR8A 1YT3A 1ASUA 1Q18A 2YHAA 4JHDB 3SV3A 4FWOA 3DLHA 1WB9A 3P39A 1NKCA 1BA1A 3OVNA 1K8KA 1VSLA 4BR4A 2HBJA 4GV6A 1BA0A 4LF4K 1KVAA 2QWQA 4FWLA 4DSLA 4BQZA 4QS8A 1ASVA 1N34K 3ID6A 1CZ9A 4K41A 4JLHA 3GDQA 1VSMA 3SPZA 4CJ4A 3O3HA 2E2PA 3HL8A 4JRQA 3D0PA 3DRRA 3K57A 3SBTA 5K14A 4IFEA 1ATSA 3G4SN 3SZ2A 1RT5A 3C7NB 5BN9A 5B8HA 3CYMA 1NOZA 4PL8A 1HRHA 1L3UA 2XHBA 4MQ3A 3P1GA 4JI4K 2VWBA 4BG9A 3TABA 3H46O 2P9LA 4J2AA 5HRSA 2NRTA 4CW7B 2CH5A 3HOSA 3MWPA 4BG8A 3LZIA 3S3OA 2OYQA 1VSJA 2D5RA 3FFIA 1TL1A 4DR3K 4ILGB 1Q9YA 1BWFO 4MDAA 1KVBA 1QSSA 4A5AA 3M1FA 1NJZA 4BWMA 1T7PA 3VEWA 4OPHA 4UQGA 4H0OA 4YY3K 4FM2A 3EE9A 1TK5A 1VRUA 4LFAK 4CHQA 3MDQA 1YITN 2P9IB 3VF6A 4YDUA 3VQ6A 3PX6A 4BY9C 1C6VA 1WBDA 3DLGA 2G8IA 3HOTA 2QTDA 3VGKA 2J4RA 1VSFA 3KKSA 3CJAA 1VQ9N 3OYIA 4FOIA 4CJQA 5AQOA 3ZT1A 2HOEA 3DI6A 2V51B 1XHZA 1ZBIA 5E41A 3V9XA 4N5SA 4B9VA 4CGDA 1ZYQA 1NG9A 1KC8O 4QS9A 2F9WA 5M1KA 3VENA 4I6MA 4TSXA 1KAZA 1JLEA 1ZXOA 4FL9A 1B9FA 4X66K 3LWLA 2ZJQL 4CEQA 5TKWA 4LFCK 1LOTB 1NJIO 4KRFA 2QEXN 3ULEB 1VQ8N 5DM6L 4IDKA 2KW4A 4UY8O 3AO2A 4DSFA 2CH6A 2KQ2A 5FLXO 1RTIA 1TV6A 1VQ5N 4IFVA 3O6WA 3WXLA 1X3NA 4AH9A 4FLYA 2KHOA 3NBPA 1XMOK 4DR7K 4ID5A 3LDQA 3VQQA 4CJFA 3CCUN 1BGXT 3R6MA 1JLCA 3JS6A 5AJ3K 3VQ7A 1SZ2A 2HVIA 1N6QA 1E4GT 4KTWA 3S3MA 3H1QA 4FK2A 3TANA 1NM1A 4CJUA 4E1NA 1QZ6A 1K73O 3IG1A 3AVHA 3F9KA 3LP0A 5CYMA 4DTSA 4B9LA 3R9PA 3RSEA 2HNZA 5IWAK 4DSKA 1JLQA 3CCVN 1GLBG 2NRZA 4OGCA 1IBMK 1MDUB 1N36K 5EVZA 2O8EB 4JKAA 5C25A 2ATQA 3O5BA 1T6DA 2DY4A 4YNQA 1U4BA 4LH4A 4DSEA 3ULDA 2FBXA 3JYTA 5CZ1A 3THXA 1Q81O 1NBWA 2GUPA 1DTQA 4M7XA 3WXIA 2HHXA 2F96A 1S1WA 4BVPA 3GBTA 3KK1A 3J7AP 3OYLA 4IBNA 3OS1A 3BGRA 4LF6K 4DWIA 4H0XB 1XI1A 3CMEN 5LJWA 1XQSC 2XO7A 4L3QA 1VAZA 4BE0A 3HPGA 3L2UA 3T69A 2FBYA 2HHUA 2YNFA 2V7YA 1QE1A 3CJBA 3C95A 4O4GA 3VGLA 4AHCA 4KHUA 5J2PA 3WXKA 3KLHA 2B6AA 4WCEL 3FR0A 1IBKK 3ZETA 4RW9A 2E6MA 2WTUA 3HSTB 4CK1A 3QFPA 4Z4FA 2OZSA 4GV3A 1TKDA 3M3ZA 3SAGA 1NJXA 1GLFO 2D1KA 1XHXA 2P9UA 2WONA 3QO9A 5GINA 4WFBL 4AM7A 3MX5A 4DFPA 3WXJA 1XC3A 1Q86O 5AQHA 4FVMA 4CCHA 4FJHA 3CCLN 2HSTA 3VQAA 1KSPA 1HMVA 1S72N 1U48A 2P9PA 3HT3A 1N33K 3O9UA 3RVCA 1G99A 4BDYA 3K5LA 5J1EA 3LANA 3QNNA 3U3YA 4FZYA 3HBTA 4JK9A 4H4MA 3CMAN 3SUQA 4FJJA 1RTHA 3IAYA 3R3LA 3DRPA 3VF4A 4CJ3A 3L4QA 1W7AA 3DLKA 4YDUC 2QW9A 2HHVA 3SUPA 3DXKB 4B1VA 4BR0A 2E2OA 3L2QA 2ZD1A 3OYKA 1V4TA 1X9MA 1BCMA 1Z05A 3O1BA 4CJ7A 1BO5O 4GVEA 4DR5K 3AAPA 2H3GX 3MCAB 3BDPA 4CEFA 4FSVA 4CEAA 4DUYK 3OYHA 3F5TA 2W40A 4ZTJA 2GEMA 3NCIA 1ZC6A 1NKBA 4BE1A 3NH2A 1SKRA 2YHYA 4KTZA 5JS2A 3SMSA 3EKSA 4BRDA 3A5MC 3MXJA 4CJKA 4N47A 4PL7A 4DCHA 1FXXA 3EKUA 3H1VX 1LWFA 5SWMA 3J80O 4E1MA 3AAQA 4B1ZA 4CGFA 4DMNA 1C1BA 3RWUA 4FJ5A 4AHTA 3VQ4A 3V9SA 1RDAA 3LDLA 3VEXA 4CFBA 3AVBA 3ZT4A 4KTQA 4AF1A 4JI7K 2ZE2A 3VQ9A 2PFUA 4FJNA 2FSNA 5LMNK 5GIPA 4BRCA 1NGBA 2YKNA 3R1XA 4NCGA 2GWJA 3SPYA 4C8NA 2Z1GA 1RDDA 3ATVA 4ELTA 1TYQA 4O0IA 1BL3A 4BRKA 4I7FA 2BTFA 2Z1IA 1KRPA 3D2FA 1NWKA 5FRNA 3PX0A 4E1JA 1Y64A 4YFUA 5ELZA 2W42A 1FW6A 4BRNA 3TI0A 1RT6A 3IS9A 4MDBA 3KLGA 3OBYA 3WNGA 1RBRA 1OH7A 3K9KA 4MLEA 2OA8A 3CCMN 5AZIB 3OYFA 3DLLL 3UB5A 4AHSA 2VWKA 4CGGA 4DU4A 4A5BA 3AO5A 1VSEA 2F8SA 3CJ9A 3NAEA 1QQOA 3V1QA 4JK7A 3L2VA 2VG5A 3CHWA 2HHHK 4FCYA 3OS2A 4BC2A 4H03B 1RNHA 3QB0A 2KZZA 4CE9A 4CZJA 3DRSA 2E4LA 3ZT0A 1BOTO 3BY5A 4FK4A 1YF5L 2O8CB 1UA0A 1SL1A 4CK2A 1KLMA 1XC9A 1DGKN 2P9KB 1J53A 3HI0A 3JXUA 4RWTA 5KI6A 2ITGA 4EAHD 3AVNA 1C1AA 4KI6A 4H5TA 3TAPA 1EXQA 3O08A 5ADXH 1BI4A 5BPMA 3QMLA 1S6QA 4EHUA 2QWOA 4XIUA 3K5MA 3ZX3A 2UUBK 1WSHA 3OHRA 3P83D 4JHDA 2ZQBA 5C2FA 3M6GA 3FGUA 3ITHA 1TUYA 2QA4N 3E1YA 3E66A 1HX1A 1J9AA 2PBDA 1TGOA 3MEEA 4CERA 3FLCO 3ZSVA 4F3TA 1KAXA 4E7JA 4CESA 1LWCA 4W5NA 3DOLA 2E6LA 2W6LA 3C7NA 2YHWA 4ID1A 4KFBA 4HVJA 3BEXA 4IG0A 5GAGP 3FZLA 5CHIA 2XY6A 4FJ8A 2YNHA 1SKSA 3HP9A 2HBMA 4HCBA 2WOMA 1U2VA 5HLFA 4FM1A 4FJLA 1VQPN 4JNEA 3ALYA 4IO8A 2WFBA 1EX4A 5LJVA 2HNYA 3WXMB 3MEDA 4LC9B 3G10A 4DTOA 4U67L 3K5NA 1W9HA 1ITGA 2D0AA 1A5VA 4E7KA 4H0VB 4XH5A 2OPQA 2QK9A 3PIPL 1WSEA 4IDHA 1L3TA 1WN7A 3K5OA 4M3XA 2D0OA 2IIRA 4W5RA 3NMUA 3H3OB 3LM9A 1KFDA 4ZHRA 3P38A 3P31A 2RF2A 1NK5A 3KWIA 3U4LA 4H4OA 4JI1K 1GOAA 3AO4A 2HHQA 4BR7A 1X1PA 4GV9A 3SUOA 1QQMA 4DS4A 5HRRA 3ZT3A 4CHZA 1J5OA 1JCGA 4JK8A 2D4WA 2HF4A 5FPDA 4RW6A 1EQYA 4DU3A 4FLZA 2YV0X 2OZMA 4GMJB 3CM5A 2PYLA 3CFOA 1SKWA 4FLXA 1NGGA 1OVQA 2VCPA 3WT0A 3HVRA 2B5JA 3SQ4A 5FROA 4JRPA 4BRHA 4CZHA 3WNHA 4C1NI 1GOBA 2O8FB 3ULEA 4KHNA 4Q0BA 1NGAA 2QWRA 2RKIA 5AQLA 3LPUA 4OJRA 2ASOA 1YVNA 1L3SA 5BRHA 4WQ4A 3CXCM 1WSFA 5EX5A 2UXBK 1JL1A 3ZX2A 4JKDA 1NGDA 3J81O 5AQIA 3DLEA 4FLVA 1HYSA 4KB1A 4O0JA 3CERA 3NE6A 3VEZA 5HOOA 4IKFA 4NLCA 4IZ9A 4GVMA 4CF0A 1IKXA 2FF6A 5BN8A 3DOKA 3O9SA 4CJVA 3PX4A 4DF8A 2UXDK 2HB5A 3IDHA 3J7ZO 3VMFB 2HVHA 3ZSWA 3AA3A 4DSIA 2Z1JA 3HRGA 3A0IX 3M8SA 3T7ZA 4BGAA 1HLUA 2ASPA 5KGXA 5T7BA 4FJGA 5HL7L 4LSLA 4FO0A 4AHVA 1NK0A 4DV7K 3Q7BA 1EETA 3BZCA 1YJWN 1NJWA 4M42A 4DLGA 1VQNN 1IH7A 4RG8A 3OS0A 2D0CA 3HPOA 5BREA 4AHUA 3MX2A 5SZTA 1WAFA 2AA4A 3U9ZA 3VQBA 4K42A 2DTUA 3GL1A 3SAFA 1FKPA 2I7PA 3BF3A 4BQLA 2Y1JA 3VGMA 1ZBSA 4H0YB 4CF2A 3LAKA 3KKRA 4DTPA 3TAFA 2IAJA 3SI6A 1QTMA 4KHQA 4KH4A 1K6YA 4OPAA 4H5VA 4JAXA 2YJEA 3VA3A 5FDLA 4FJMA 3LM2A 5CR4A 2QXFA 5AQSA 3OYBA 1OH6A 4CJWA 4DTRA 2X6NA 2B4JA 2ZJRL 1MWKA 3SQ2A 1NNEA 5C2DA 1JLFA 4A59A 3RMAA 2OPRA 4ISGA 3U6FA 4WQ5C 3EN9A 4BDZA 2Q3SA 3I8BA 4CJLA 1HPMA 4B3TK 3JAMO 3CFPA 1IJJA 2FC0A 4HWIA 4F9OA 4CI6A 4RCHA 5C24A 3ENOA 3U3GA 2XRIA 3VEOA 2KTQA
chains in the Genus database with same CATH topology
3HSTB 4CK1A 3QEVA 4CK3A 2IOCA 4M45A 2OPSA 3T19A 3AVKA 2G8KA 5D3GA 4Z4FA 3V6DA 1BQNA 3DYAA 4CF1A 1WSGA 1WSIA 2OZSA 4IFYA 3KD1E 4CEBA 3B6OA 2PZSA 1TKDA 3NGZA 3V1RA 3SUNA 1NJXA 4Z4EA 4C8LA 3VQCA 3VQ8A 3DMJA 4HHTA 4L8RB 1XHXA 4NCBA 4ELVA 1S5JA 2XY8A 2DFHA 2WONA 5DK5A 4KAZA 4DTXA 3QO9A 3K59A 3RRHA 4DFPA 4FK0A 1JLGA 3DM2A 4K8XA 4FVMA 4KHWA 4CCHA 4F4KA 4FJHA 4FJ9A 3TWHA 4CHNA 1FKOA 1TAQA 3VQAA 4CHOA 1NK4A 1DTTA 3M8PA 3UIQA 1N5YA 1KSPA 4FZZA 4DQPA 1HMVA 4CEZA 3ZSRA 4FLWA 1U48A 3HJFA 1BIUA 4I2QA 3HT3A 2EX3A 1X9SA 2X74A 1JLAA 1VSKA 4BDYA 3K5LA 5J1EA 3SCXA 3ASMA 3LANA 1SV5A 3O4QA 2QKKA 2QKBA 3QNNA 1EP4A 3U3YA 4DLEA 4FZYA 4H4MA 1RILA 3OYGA 4DF4A 1VSIA 3SUQA 2IGIA 4FJJA 3AVFA 4Y1CA 3L2RA 4F3OA 1HNVA 1RTHA 3DLRA 3IAYA 3VN5A 3DRPA 4CEOA 2I5JA 1ZBUA 4F2RA 1WAJA 3NF7A 4OKJA 2O4GA 1TAUA 4LH5A 4CJ3A 1C0TA 4CJ5A 4HUFA 4Z4IA 3DLKA 4NYNA 4J2BA 2HHVA 2JLEA 3SUPA 3V4IA 2YNIA 4CIEA 2HNDA 4EZ9A 1TKZA 2A1SA 3AO3A 4NCAA 1JL2A 3L2QA 3NGYA 4RW8A 3EY1A 1ZBLA 1IG9A 2ZD1A 1RCHA 3OYKA 1TK0A 1X9MA 4I9QA 5J2NA 1BCMA 1HPZA 1QHTA 3LWMA 3MECA 4OLAA 2G8WA 3BDPA 4CEFA 3PY8A 3RR8A 4KKOA 4CEAA 4DTUA 3K2PA 3OYHA 1U47A 4B3OA 3ZSOA 1VSHA 4ZTJA 3NCIA 2G8HA 2OPPA 4CFAA 3OYCA 3PO4A 1BCOA 2FBVA 1NKEA 4I2PA 3ISNC 1NKBA 3KLIA 3VQ5A 3NH2A 3OY9A 4BE1A 1SKRA 1W0HA 1RDCA 4ZTFA 3QINA 1LV5A 3DLBA 1ZBHA 3RMDA 4FJ7A 2YNGA 4KTZA 5JS2A 1U49A 3MXJA 1NK7A 4FYDA 1XWLA 3L3VA 4M3TA 4CJKA 4N47A 4C8MA 4CFDA 1JXEA 1D5AA 2P5OA 4CECA 4DFJA 1FXXA 4BACA 1NJYA 1I3AA 4EP5A 4DTNA 4FW2A 1LWFA 1YTAA 5SWMA 3WNFA 4PQUA 4HUGA 4E1MA 5I3UA 1RT2A 4CGFA 4BE2A 2YHBA 4DMNA 1C1BA 3RWUA 5CYQA 4FJ5A 4AHTA 3OYMA 3VQ4A 3V9SA 1T03A 4KHYA 1UAXA 1RDAA 4CFBA 1CXUA 1TL3A 3LP3A 5I42A 3AVBA 3ZT4A 2FBTA 3QEXA 4KTQA 4KO0A 3M8QA 2IC3A 4E7LA 4DQQA 2ZE2A 3VQ9A 3C6TA 1R0AA 3AO1A 4FJNA 4Z4GA 1RTJA 4FM0A 1HNIA 2F8TA 1Z26A 3VQEA 3HXMA 2YKNA 4NCGA 3EYZA 4DQSA 3SPYA 3L2WA 4C8NA 2Z1GA 1FK9A 5CY4A 3KK2A 4HCCA 1RDDA 2VG7A 3PUFA 1TKXA 4ELTA 4OKKA 4OPKA 1KFSA 2XY7A 1J54A 3TARA 4O0IA 1BL3A 1CZBA 3NH0A 3V81A 4W5OA 4CF8A 1QSLA 3C6UA 4I7FA 4PWDA 2Z1IA 1S1VA 1U45A 1KRPA 3CFRA 4MFBA 2GBZA 5FRNA 1UWBA 3NF8A 4O55A 3PX0A 4B9NA 4YFUA 1UOCA 2EHGA 3AVGA 2W42A 4C8KA 4KHSA 4Z0UA 1BQMA 1RTDA 3TI0A 1RT6A 3IS9A 3KLGA 4PY5A 4Q5VA 2BDPA 1GOCA 2BE2A 4CJSA 4QOZB 3TAEA 3OYJA 3WNGA 1CXQA 1RBRA 1REVA 3OYNA 2OA8A 2X78A 1RBUA 3AVJA 5DMRA 4FW1A 4DFKA 3LP1A 3OYFA 1YVUA 1B9DA 2GV9A 1VSDA 3HPHA 4AHSA 2VWKA 4CJEA 1G15A 3NDKA 1SUQA 4CGGA 4FLUA 1NK6A 3K58A 4DU4A 3I8DA 3TAQA 3AO5A 1BIZA 1VSEA 4DTMA 4M3WA 3NAEA 2F8SA 3V1QA 5HP1A 3PV8A 4RW4A 4N56A 3L2VA 2VG5A 1JLBA 4K8ZA 4FCYA 3OS2A 2G8UA 1RNHA 3HYFA 2KZZA 4E89A 3AVMA 5EU7A 1KVCA 4CE9A 5KRSA 4E0DA 3DRSA 1Q8IA 2E4LA 3ZT0A 2P5GA 4I9LA 2RPIA 4FK4A 4DS5A 1IKWA 3HK2A 4H8KA 4CJTA 1UA0A 1SL1A 1MU2A 4E19A 4CIFA 3NH1A 3QNOA 4CK2A 3QETA 1T05A 2XY5A 4JS5A 1KLMA 1XC9A 3AVAA 2PY5A 3KLFA 4W5QA 1J53A 3ZSQA 4EP4A 5KI6A 2ITGA 1WNSA 3AVNA 3L3UA 1TK8A 1C1AA 4KI6A 4CIGA 3G0ZA 3TAPA 1EXQA 1BI4A 4M3YA 5C42A 1S6QA 4B9TA 1LW2A 3O4NA 4XIUA 3K5MA 3QESA 4E7IA 1WSHA 3P83D 1QQCA 2HMIA 3SNNA 4FJXA 1SL0A 4AHRA 1Z25A 2ZQBA 3AVIA 1ZBFA 4C8OA 3B6PA 3I0RA 4B9UA 1T8EA 3ITHA 1RT7A 2G8FA 3NGIA 1TKTA 3SYZA 2YKMA 1J9AA 3V9WA 3MEGA 3TAGA 1Y97A 3RRGA 3F73A 3LAMA 3ZSXA 1TGOA 3ZSYA 4E3SA 2BANA 1C0MA 3NF9A 3MEEA 4CERA 2HW3A 4B9SA 1CLQA 1LAVA 3ZSVA 4F3TA 1LW0A 4OVLA 4Z4CA 5HRPA 3MAQA 4E7JA 3S9HA 4KI4A 4CESA 1BI4B 1LWCA 4DG1A 4FLTA 1NK8A 2DFEA 4W5NA 3DOLA 2E6LA 3SQ0A 1O1WA 3TR8A 1YT3A 1ASUA 2VG6A 4NYFA 3SJJA 4ID1A 2YHAA 4KFBA 4HVJA 4IG0A 3SV3A 2XY6A 3DLHA 4DFMA 1NKCA 4FJ8A 3OVNA 2A1RA 1VSLA 1LWEA 1EKEA 4CGIA 1S9EA 4N41A 4CGHA 1I39A 2YNHA 2P51A 2HHWA 1SKSA 4QCLA 4QAGA 1KVAA 4DSLA 3HP9A 4HCBA 4CHYA 3T1AA 1S1UA 2WOMA 1ASVA 2NUBA 5HLFA 1CZ9A 3MXIA 4JLHA 4CJRA 4G1QA 4OKEA 1VSMA 3CQ8A 1JXBA 4FM1A 3AVLA 1SL2A 3SPZA 1D9DA 3ALYA 1S1TA 4CJ4A 3RTVA 1HQUA 3O3HA 2KFNA 1EX4A 2HNYA 1RBVA 3HL8A 3D0PA 3DRRA 3K57A 3MEDA 4JRQA 3G10A 4DTOA 4M3ZA 3K5NA 1W9HA 1ITGA 3WNEA 4M3UA 2KFZA 5K14A 3VQPA 3L8BA 2D0AA 4Z4HA 3SZ2A 1RT5A 1A5VA 4E7KA 4M3RA 3CYMA 1BHLA 3LP2A 3I0SA 4M41A 1NOZA 3MXMA 3LALA 1HRHA 3LZJA 2XHBA 4MQ3A 1ASWA 1IKYA 1C0UA 2OPQA 3V1OA 3RMCA 2QK9A 3SV4A 2Y1IA 1WSEA 3P1GA 2HHTA 1JKHA 1L3TA 1WN7A 3LDSA 3K5OA 3TABA 4M3XA 3IRXA 3O3FA 4W5RA 4J2AA 4ZHRA 1KFDA 5HROA 1C1CA 5HRSA 2RF2A 1NK5A 5JS1A 2DFFA 4GW6A 3HM9A 3LZIA 3S3OA 3OYAA 2OYQA 1VSJA 1B92A 2D5RA 3FFIA 3T3FA 4LD0A 4EZ6A 3ZCMA 5FRMA 1TL1A 4H4OA 1Q9YA 2PYJA 1GOAA 4FJLA 3AO4A 1KVBA 2HHQA 1QSSA 1X1PA 3SUOA 3OJSA 3EZ5A 1NJZA 2JGUA 4DS4A 5HRRA 3ZT3A 4BWMA 4CHZA 3OJUA 1J5OA 1T7PA 4UQGA 3E01A 4FM2A 3HO1A 2AJQA 3NF6A 4RW6A 4PUOA 4DU3A 4FLZA 2YV0X 5HBMA 1VRUA 1UA1A 1TK5A 2OZMA 4GMJB 4CHQA 1S9GA 3CM5A 2PYLA 4FXDA 3CFOA 1SKWA 3KTQA 3VQ6A 3PX6A 5CZ2A 4CF9A 1Q9XA 1NK9A 1C6VA 4FLXA 3DLGA 2G8IA 4OPJA 3HVRA 2B5JA 3SQ4A 1VSFA 5FROA 3M8RA 4JRPA 4N76A 3AA2A 3P5JA 3KKSA 4W5TA 3WNHA 1GOBA 5KTQA 3OYIA 3V9ZA 4KHNA 4CJQA 3ZT1A 1L5UA 1NOYA 4Q0BA 2RKIA 3DI6A 3V9UA 1KLNA 4B8CA 1XHZA 3LPUA 1HYVA 3NFAA 4OJRA 4DSJA 1ZBIA 4ELUA 5E41A 3V9XA 4N5SA 1L3SA 4B9VA 1A5XA 4CGDA 1RT1A 4CJPA 1WSFA 4HTUA 1ZYQA 1VK0A 4J2EA 2Z1HA 4CHPA 1JL1A 5KGWA 1KCFA 3S3NA 4DQIA 4FZXC 4FLVA 3DLEA 1HYSA 4TSXA 4O0JA 3KK3A 4KB1A 1JLEA 4KPYA 3NE6A 3AV9A 1S6PA 3OYDA 1B9FA 4IKFA 5KRTA 1RBSA 4GVMA 1D8YA 1A5WA 4CF0A 4E7HA 1KTQA 1IKXA 1WSJA 3O3GA 3LWLA 4OLBA 3DOKA 4LY7A 4CEQA 4B08A 4CJVA 3AA5X 3PX4A 3QIPA 1X9WA 4DF8A 2HHSA 4KRFA 3NHGA 3AA4A 4F2SA 2IS3A 3VA0A 5J2QA 2HB5A 3KIOA 4IDKA 2KW4A 4DTJA 1U04A 3AO2A 3QIOA 4CEEA 3ZSWA 4DSFA 3QERA 3AA3A 2HVHA 4DSIA 2KQ2A 2LSNA 3QEWA 1RTIA 2Z1JA 4F8RA 1TV6A 4IFVA 3M8SA 4AH9A 4FLYA 4BWJA 3QLHA 3RMBA 3NBPA 5KGXA 5T7BA 1IKVA 4FJGA 4ID5A 4LSLA 3VQQA 4CJFA 4AHVA 1NK0A 1BGXT 4WE1A 1JLCA 1VRTA 3VQ7A 2X6SA 4ICLA 1EETA 4FJIA 1NJWA 4M42A 2HVIA 4DLGA 2RN2A 1N6QA 4FJKA 3C94A 1IH7A 4RG8A 3ZSZA 4KV8A 3OS0A 3THVA 4KTWA 1YTUA 3S3MA 2D0CA 3CG7A 3HPOA 4FK2A 3TANA 4CJUA 4E1NA 2R7YA 4AHUA 3IG1A 5SZTA 3AVHA 1WAFA 3F9KA 3LP0A 5CYMA 4OGEA 4J2DA 3VQBA 2P1JA 4DTSA 1TVRA 2DTUA 4B9LA 3KD5E 1FKPA 2HNZA 2Y1JA 4DSKA 4CF2A 1JLQA 4B8AB 3LAKA 4KREA 4AILC 4B9MA 3KKRA 4CGJA 4DTPA 3TAFA 1QSYA 2IAJA 3SI6A 2KZMA 3H08A 4OGCA 2O4IA 3TAMA 1QTMA 4IG3A 4KHQA 1BISA 5C25A 2ATQA 1K6YA 2IDOA 3ZT2A 4CFCA 3HVTA 4KB0A 2DY4A 4YNQA 1U4BA 4O5BA 3VA3A 4LH4A 3PO5A 5FDLA 3HP6A 3OYEA 4DSEA 1F21A 4FJMA 3CM6A 3ULDA 2FBXA 1S1XA 1RT3A 5CZ1A 3JYTA 2QXFA 4LSNA 3OYBA 1DTQA 4R5PA 3A2FA 4CJWA 2HHXA 3VQDA 4CEDA 2F96A 2BGGA 1S1WA 1IO2A 2X6NA 1HYZA 3KLEA 2D0BA 3KK1A 4DTRA 3KJVA 1RDBA 5HRNA 3OYLA 3RR7A 3LPTA 1DLOA 2B4JA 4RW7A 2G8VA 4IBNA 3OS1A 3BGRA 1L3UA 4DWIA 1RT4A 2ETJA 5J2MA 1LAWA 1XI1A 3SQ2A 3JSMA 4JS4A 1JLFA 2XO7A 4BE0A 3SQ1A 3RMAA 2OPRA 3U6FA 3HPGA 3L2UA 4BDZA 2FBYA 4PA1A 2Q3SA 4O44A 3QEIA 2HHUA 1HJRA 2YNFA 1WLJA 4CJLA 4DU1A 1QE1A 4DQRA 3D45A 1D9FA 3C95A 4O4GA 3AVCA 3CFPA 3QEPA 4AHCA 4HUEA 4KHUA 1HQEA 1QS4A 2FC0A 2VWJA 5J2PA 2GUIA 3KLHA 2B6AA 1RBTA 1L3VA 4BDPA 5C24A 4Y1DA 4RW9A 3U3GA 2XRIA 2KTQA 2E6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HST B;  4CK1 A;  3QEV A;  4CK3 A;  2IOC A;  4M45 A;  2OPS A;  3T19 A;  3AVK A;  2G8K A;  5D3G A;  4Z4F A;  3V6D A;  1BQN A;  3DYA A;  4CF1 A;  1WSG A;  1WSI A;  2OZS A;  4IFY A;  3KD1 E;  4CEB A;  3B6O A;  2PZS A;  1TKD A;  3NGZ A;  3V1R A;  3SUN A;  1NJX A;  4Z4E A;  4C8L A;  3VQC A;  3VQ8 A;  3DMJ A;  4HHT A;  4L8R B;  1XHX A;  4NCB A;  4ELV A;  1S5J A;  2XY8 A;  2DFH A;  2WON A;  5DK5 A;  4KAZ A;  4DTX A;  3QO9 A;  3K59 A;  3RRH A;  4DFP A;  4FK0 A;  1JLG A;  3DM2 A;  4K8X A;  4FVM A;  4KHW A;  4CCH A;  4F4K A;  4FJH A;  4FJ9 A;  3TWH A;  4CHN A;  1FKO A;  1TAQ A;  3VQA A;  4CHO A;  1NK4 A;  1DTT A;  3M8P A;  3UIQ A;  1N5Y A;  1KSP A;  4FZZ A;  4DQP A;  1HMV A;  4CEZ A;  3ZSR A;  4FLW A;  1U48 A;  3HJF A;  1BIU A;  4I2Q A;  3HT3 A;  2EX3 A;  1X9S A;  2X74 A;  1JLA A;  1VSK A;  4BDY A;  3K5L A;  5J1E A;  3SCX A;  3ASM A;  3LAN A;  1SV5 A;  3O4Q A;  2QKK A;  2QKB A;  3QNN A;  1EP4 A;  3U3Y A;  4DLE A;  4FZY A;  4H4M A;  1RIL A;  3OYG A;  4DF4 A;  1VSI A;  3SUQ A;  2IGI A;  4FJJ A;  3AVF A;  4Y1C A;  3L2R A;  4F3O A;  1HNV A;  1RTH A;  3DLR A;  3IAY A;  3VN5 A;  3DRP A;  4CEO A;  2I5J A;  1ZBU A;  4F2R A;  1WAJ A;  3NF7 A;  4OKJ A;  2O4G A;  1TAU A;  4LH5 A;  4CJ3 A;  1C0T A;  4CJ5 A;  4HUF A;  4Z4I A;  3DLK A;  4NYN A;  4J2B A;  2HHV A;  2JLE A;  3SUP A;  3V4I A;  2YNI A;  4CIE A;  2HND A;  4EZ9 A;  1TKZ A;  2A1S A;  3AO3 A;  4NCA A;  1JL2 A;  3L2Q A;  3NGY A;  4RW8 A;  3EY1 A;  1ZBL A;  1IG9 A;  2ZD1 A;  1RCH A;  3OYK A;  1TK0 A;  1X9M A;  4I9Q A;  5J2N A;  1BCM A;  1HPZ A;  1QHT A;  3LWM A;  3MEC A;  4OLA A;  2G8W A;  3BDP A;  4CEF A;  3PY8 A;  3RR8 A;  4KKO A;  4CEA A;  4DTU A;  3K2P A;  3OYH A;  1U47 A;  4B3O A;  3ZSO A;  1VSH A;  4ZTJ A;  3NCI A;  2G8H A;  2OPP A;  4CFA A;  3OYC A;  3PO4 A;  1BCO A;  2FBV A;  1NKE A;  4I2P A;  3ISN C;  1NKB A;  3KLI A;  3VQ5 A;  3NH2 A;  3OY9 A;  4BE1 A;  1SKR A;  1W0H A;  1RDC A;  4ZTF A;  3QIN A;  1LV5 A;  3DLB A;  1ZBH A;  3RMD A;  4FJ7 A;  2YNG A;  4KTZ A;  5JS2 A;  1U49 A;  3MXJ A;  1NK7 A;  4FYD A;  1XWL A;  3L3V A;  4M3T A;  4CJK A;  4N47 A;  4C8M A;  4CFD A;  1JXE A;  1D5A A;  2P5O A;  4CEC A;  4DFJ A;  1FXX A;  4BAC A;  1NJY A;  1I3A A;  4EP5 A;  4DTN A;  4FW2 A;  1LWF A;  1YTA A;  5SWM A;  3WNF A;  4PQU A;  4HUG A;  4E1M A;  5I3U A;  1RT2 A;  4CGF A;  4BE2 A;  2YHB A;  4DMN A;  1C1B A;  3RWU A;  5CYQ A;  4FJ5 A;  4AHT A;  3OYM A;  3VQ4 A;  3V9S A;  1T03 A;  4KHY A;  1UAX A;  1RDA A;  4CFB A;  1CXU A;  1TL3 A;  3LP3 A;  5I42 A;  3AVB A;  3ZT4 A;  2FBT A;  3QEX A;  4KTQ A;  4KO0 A;  3M8Q A;  2IC3 A;  4E7L A;  4DQQ A;  2ZE2 A;  3VQ9 A;  3C6T A;  1R0A A;  3AO1 A;  4FJN A;  4Z4G A;  1RTJ A;  4FM0 A;  1HNI A;  2F8T A;  1Z26 A;  3VQE A;  3HXM A;  2YKN A;  4NCG A;  3EYZ A;  4DQS A;  3SPY A;  3L2W A;  4C8N A;  2Z1G A;  1FK9 A;  5CY4 A;  3KK2 A;  4HCC A;  1RDD A;  2VG7 A;  3PUF A;  1TKX A;  4ELT A;  4OKK A;  4OPK A;  1KFS A;  2XY7 A;  1J54 A;  3TAR A;  4O0I A;  1BL3 A;  1CZB A;  3NH0 A;  3V81 A;  4W5O A;  4CF8 A;  1QSL A;  3C6U A;  4I7F A;  4PWD A;  2Z1I A;  1S1V A;  1U45 A;  1KRP A;  3CFR A;  4MFB A;  2GBZ A;  5FRN A;  1UWB A;  3NF8 A;  4O55 A;  3PX0 A;  4B9N A;  4YFU A;  1UOC A;  2EHG A;  3AVG A;  2W42 A;  4C8K A;  4KHS A;  4Z0U A;  1BQM A;  1RTD A;  3TI0 A;  1RT6 A;  3IS9 A;  3KLG A;  4PY5 A;  4Q5V A;  2BDP A;  1GOC A;  2BE2 A;  4CJS A;  4QOZ B;  3TAE A;  3OYJ A;  3WNG A;  1CXQ A;  1RBR A;  1REV A;  3OYN A;  2OA8 A;  2X78 A;  1RBU A;  3AVJ A;  5DMR A;  4FW1 A;  4DFK A;  3LP1 A;  3OYF A;  1YVU A;  1B9D A;  2GV9 A;  1VSD A;  3HPH A;  4AHS A;  2VWK A;  4CJE A;  1G15 A;  3NDK A;  1SUQ A;  4CGG A;  4FLU A;  1NK6 A;  3K58 A;  4DU4 A;  3I8D A;  3TAQ A;  3AO5 A;  1BIZ A;  1VSE A;  4DTM A;  4M3W A;  3NAE A;  2F8S A;  3V1Q A;  5HP1 A;  3PV8 A;  4RW4 A;  4N56 A;  3L2V A;  2VG5 A;  1JLB A;  4K8Z A;  4FCY A;  3OS2 A;  2G8U A;  1RNH A;  3HYF A;  2KZZ A;  4E89 A;  3AVM A;  5EU7 A;  1KVC A;  4CE9 A;  5KRS A;  4E0D A;  3DRS A;  1Q8I A;  2E4L A;  3ZT0 A;  2P5G A;  4I9L A;  2RPI A;  4FK4 A;  4DS5 A;  1IKW A;  3HK2 A;  4H8K A;  4CJT A;  1UA0 A;  1SL1 A;  1MU2 A;  4E19 A;  4CIF A;  3NH1 A;  3QNO A;  4CK2 A;  3QET A;  1T05 A;  2XY5 A;  4JS5 A;  1KLM A;  1XC9 A;  3AVA A;  2PY5 A;  3KLF A;  4W5Q A;  1J53 A;  3ZSQ A;  4EP4 A;  5KI6 A;  2ITG A;  1WNS A;  3AVN A;  3L3U A;  1TK8 A;  1C1A A;  4KI6 A;  4CIG A;  3G0Z A;  3TAP A;  1EXQ A;  1BI4 A;  4M3Y A;  5C42 A;  1S6Q A;  4B9T A;  1LW2 A;  3O4N A;  4XIU A;  3K5M A;  3QES A;  4E7I A;  1WSH A;  3P83 D;  1QQC A;  2HMI A;  3SNN A;  4FJX A;  1SL0 A;  4AHR A;  1Z25 A;  2ZQB A;  3AVI A;  1ZBF A;  4C8O A;  3B6P A;  3I0R A;  4B9U A;  1T8E A;  3ITH A;  1RT7 A;  2G8F A;  3NGI A;  1TKT A;  3SYZ A;  2YKM A;  1J9A A;  3V9W A;  3MEG A;  3TAG A;  1Y97 A;  3RRG A;  3F73 A;  3LAM A;  3ZSX A;  1TGO A;  3ZSY A;  4E3S A;  2BAN A;  1C0M A;  3NF9 A;  3MEE A;  4CER A;  2HW3 A;  4B9S A;  1CLQ A;  1LAV A;  3ZSV A;  4F3T A;  1LW0 A;  4OVL A;  4Z4C A;  5HRP A;  3MAQ A;  4E7J A;  3S9H A;  4KI4 A;  4CES A;  1BI4 B;  1LWC A;  4DG1 A;  4FLT A;  1NK8 A;  2DFE A;  4W5N A;  3DOL A;  2E6L A;  3SQ0 A;  1O1W A;  3TR8 A;  1YT3 A;  1ASU A;  2VG6 A;  4NYF A;  3SJJ A;  4ID1 A;  2YHA A;  4KFB A;  4HVJ A;  4IG0 A;  3SV3 A;  2XY6 A;  3DLH A;  4DFM A;  1NKC A;  4FJ8 A;  3OVN A;  2A1R A;  1VSL A;  1LWE A;  1EKE A;  4CGI A;  1S9E A;  4N41 A;  4CGH A;  1I39 A;  2YNH A;  2P51 A;  2HHW A;  1SKS A;  4QCL A;  4QAG A;  1KVA A;  4DSL A;  3HP9 A;  4HCB A;  4CHY A;  3T1A A;  1S1U A;  2WOM A;  1ASV A;  2NUB A;  5HLF A;  1CZ9 A;  3MXI A;  4JLH A;  4CJR A;  4G1Q A;  4OKE A;  1VSM A;  3CQ8 A;  1JXB A;  4FM1 A;  3AVL A;  1SL2 A;  3SPZ A;  1D9D A;  3ALY A;  1S1T A;  4CJ4 A;  3RTV A;  1HQU A;  3O3H A;  2KFN A;  1EX4 A;  2HNY A;  1RBV A;  3HL8 A;  3D0P A;  3DRR A;  3K57 A;  3MED A;  4JRQ A;  3G10 A;  4DTO A;  4M3Z A;  3K5N A;  1W9H A;  1ITG A;  3WNE A;  4M3U A;  2KFZ A;  5K14 A;  3VQP A;  3L8B A;  2D0A A;  4Z4H A;  3SZ2 A;  1RT5 A;  1A5V A;  4E7K A;  4M3R A;  3CYM A;  1BHL A;  3LP2 A;  3I0S A;  4M41 A;  1NOZ A;  3MXM A;  3LAL A;  1HRH A;  3LZJ A;  2XHB A;  4MQ3 A;  1ASW A;  1IKY A;  1C0U A;  2OPQ A;  3V1O A;  3RMC A;  2QK9 A;  3SV4 A;  2Y1I A;  1WSE A;  3P1G A;  2HHT A;  1JKH A;  1L3T A;  1WN7 A;  3LDS A;  3K5O A;  3TAB A;  4M3X A;  3IRX A;  3O3F A;  4W5R A;  4J2A A;  4ZHR A;  1KFD A;  5HRO A;  1C1C A;  5HRS A;  2RF2 A;  1NK5 A;  5JS1 A;  2DFF A;  4GW6 A;  3HM9 A;  3LZI A;  3S3O A;  3OYA A;  2OYQ A;  1VSJ A;  1B92 A;  2D5R A;  3FFI A;  3T3F A;  4LD0 A;  4EZ6 A;  3ZCM A;  5FRM A;  1TL1 A;  4H4O A;  1Q9Y A;  2PYJ A;  1GOA A;  4FJL A;  3AO4 A;  1KVB A;  2HHQ A;  1QSS A;  1X1P A;  3SUO A;  3OJS A;  3EZ5 A;  1NJZ A;  2JGU A;  4DS4 A;  5HRR A;  3ZT3 A;  4BWM A;  4CHZ A;  3OJU A;  1J5O A;  1T7P A;  4UQG A;  3E01 A;  4FM2 A;  3HO1 A;  2AJQ A;  3NF6 A;  4RW6 A;  4PUO A;  4DU3 A;  4FLZ A;  2YV0 X;  5HBM A;  1VRU A;  1UA1 A;  1TK5 A;  2OZM A;  4GMJ B;  4CHQ A;  1S9G A;  3CM5 A;  2PYL A;  4FXD A;  3CFO A;  1SKW A;  3KTQ A;  3VQ6 A;  3PX6 A;  5CZ2 A;  4CF9 A;  1Q9X A;  1NK9 A;  1C6V A;  4FLX A;  3DLG A;  2G8I A;  4OPJ A;  3HVR A;  2B5J A;  3SQ4 A;  1VSF A;  5FRO A;  3M8R A;  4JRP A;  4N76 A;  3AA2 A;  3P5J A;  3KKS A;  4W5T A;  3WNH A;  1GOB A;  5KTQ A;  3OYI A;  3V9Z A;  4KHN A;  4CJQ A;  3ZT1 A;  1L5U A;  1NOY A;  4Q0B A;  2RKI A;  3DI6 A;  3V9U A;  1KLN A;  4B8C A;  1XHZ A;  3LPU A;  1HYV A;  3NFA A;  4OJR A;  4DSJ A;  1ZBI A;  4ELU A;  5E41 A;  3V9X A;  4N5S A;  1L3S A;  4B9V A;  1A5X A;  4CGD A;  1RT1 A;  4CJP A;  1WSF A;  4HTU A;  1ZYQ A;  1VK0 A;  4J2E A;  2Z1H A;  4CHP A;  1JL1 A;  5KGW A;  1KCF A;  3S3N A;  4DQI A;  4FZX C;  4FLV A;  3DLE A;  1HYS A;  4TSX A;  4O0J A;  3KK3 A;  4KB1 A;  1JLE A;  4KPY A;  3NE6 A;  3AV9 A;  1S6P A;  3OYD A;  1B9F A;  4IKF A;  5KRT A;  1RBS A;  4GVM A;  1D8Y A;  1A5W A;  4CF0 A;  4E7H A;  1KTQ A;  1IKX A;  1WSJ A;  3O3G A;  3LWL A;  4OLB A;  3DOK A;  4LY7 A;  4CEQ A;  4B08 A;  4CJV A;  3AA5 X;  3PX4 A;  3QIP A;  1X9W A;  4DF8 A;  2HHS A;  4KRF A;  3NHG A;  3AA4 A;  4F2S A;  2IS3 A;  3VA0 A;  5J2Q A;  2HB5 A;  3KIO A;  4IDK A;  2KW4 A;  4DTJ A;  1U04 A;  3AO2 A;  3QIO A;  4CEE A;  3ZSW A;  4DSF A;  3QER A;  3AA3 A;  2HVH A;  4DSI A;  2KQ2 A;  2LSN A;  3QEW A;  1RTI A;  2Z1J A;  4F8R A;  1TV6 A;  4IFV A;  3M8S A;  4AH9 A;  4FLY A;  4BWJ A;  3QLH A;  3RMB A;  3NBP A;  5KGX A;  5T7B A;  1IKV A;  4FJG A;  4ID5 A;  4LSL A;  3VQQ A;  4CJF A;  4AHV A;  1NK0 A;  1BGX T;  4WE1 A;  1JLC A;  1VRT A;  3VQ7 A;  2X6S A;  4ICL A;  1EET A;  4FJI A;  1NJW A;  4M42 A;  2HVI A;  4DLG A;  2RN2 A;  1N6Q A;  4FJK A;  3C94 A;  1IH7 A;  4RG8 A;  3ZSZ A;  4KV8 A;  3OS0 A;  3THV A;  4KTW A;  1YTU A;  3S3M A;  2D0C A;  3CG7 A;  3HPO A;  4FK2 A;  3TAN A;  4CJU A;  4E1N A;  2R7Y A;  4AHU A;  3IG1 A;  5SZT A;  3AVH A;  1WAF A;  3F9K A;  3LP0 A;  5CYM A;  4OGE A;  4J2D A;  3VQB A;  2P1J A;  4DTS A;  1TVR A;  2DTU A;  4B9L A;  3KD5 E;  1FKP A;  2HNZ A;  2Y1J A;  4DSK A;  4CF2 A;  1JLQ A;  4B8A B;  3LAK A;  4KRE A;  4AIL C;  4B9M A;  3KKR A;  4CGJ A;  4DTP A;  3TAF A;  1QSY A;  2IAJ A;  3SI6 A;  2KZM A;  3H08 A;  4OGC A;  2O4I A;  3TAM A;  1QTM A;  4IG3 A;  4KHQ A;  1BIS A;  5C25 A;  2ATQ A;  1K6Y A;  2IDO A;  3ZT2 A;  4CFC A;  3HVT A;  4KB0 A;  2DY4 A;  4YNQ A;  1U4B A;  4O5B A;  3VA3 A;  4LH4 A;  3PO5 A;  5FDL A;  3HP6 A;  3OYE A;  4DSE A;  1F21 A;  4FJM A;  3CM6 A;  3ULD A;  2FBX A;  1S1X A;  1RT3 A;  5CZ1 A;  3JYT A;  2QXF A;  4LSN A;  3OYB A;  1DTQ A;  4R5P A;  3A2F A;  4CJW A;  2HHX A;  3VQD A;  4CED A;  2F96 A;  2BGG A;  1S1W A;  1IO2 A;  2X6N A;  1HYZ A;  3KLE A;  2D0B A;  3KK1 A;  4DTR A;  3KJV A;  1RDB A;  5HRN A;  3OYL A;  3RR7 A;  3LPT A;  1DLO A;  2B4J A;  4RW7 A;  2G8V A;  4IBN A;  3OS1 A;  3BGR A;  1L3U A;  4DWI A;  1RT4 A;  2ETJ A;  5J2M A;  1LAW A;  1XI1 A;  3SQ2 A;  3JSM A;  4JS4 A;  1JLF A;  2XO7 A;  4BE0 A;  3SQ1 A;  3RMA A;  2OPR A;  3U6F A;  3HPG A;  3L2U A;  4BDZ A;  2FBY A;  4PA1 A;  2Q3S A;  4O44 A;  3QEI A;  2HHU A;  1HJR A;  2YNF A;  1WLJ A;  4CJL A;  4DU1 A;  1QE1 A;  4DQR A;  3D45 A;  1D9F A;  3C95 A;  4O4G A;  3AVC A;  3CFP A;  3QEP A;  4AHC A;  4HUE A;  4KHU A;  1HQE A;  1QS4 A;  2FC0 A;  2VWJ A;  5J2P A;  2GUI A;  3KLH A;  2B6A A;  1RBT A;  1L3V A;  4BDP A;  5C24 A;  4Y1D A;  4RW9 A;  3U3G A;  2XRI A;  2KTQ A;  2E6M A; 
#chains in the Genus database with same CATH topology
 2GEL A;  4CK3 A;  4M45 A;  4FPB A;  3AVK A;  3V6D A;  3TTF A;  3SJH A;  4JD2 A;  4U7B A;  1D4X A;  3NGZ A;  4Z4E A;  4CZG A;  1KAY A;  4C8L A;  1S5J A;  2YX6 A;  2DFH A;  3J8A A;  4IJA A;  4PKG A;  4CZF A;  4KAZ A;  1FJG K;  3K59 A;  1NMD A;  3RRH A;  5AQT A;  4FK0 A;  4K8X A;  4KHW A;  4F4K A;  4JKH A;  3TWH A;  3DXK A;  4CHN A;  1TAQ A;  1JJ2 M;  4DUZ K;  1NK4 A;  1DTT A;  3M8P A;  1N5Y A;  3ZSR A;  3HJF A;  2E5L K;  4I2Q A;  4LFB K;  4DR6 K;  1JLA A;  4A61 A;  3SCX A;  3EO3 A;  3OBW A;  2IVP A;  2QKK A;  4MO4 A;  1EP4 A;  1RIL A;  4DF4 A;  3L2R A;  4CEO A;  1ZBU A;  4F2R A;  3WEE A;  3NF7 A;  4OKJ A;  1TAU A;  4CJ5 A;  4KBO A;  4B1W B;  3V4I A;  5ADX A;  1SS6 A;  2OTL N;  2NLX A;  2A1S A;  3AO3 A;  3EY1 A;  4NO7 A;  2A42 A;  2G8W A;  3RR8 A;  4KKO A;  1U47 A;  4WQ4 C;  1VSH A;  2YI1 A;  3ATU A;  1EO1 A;  1BCO A;  1BDG A;  3EL2 A;  3ISN C;  3OY9 A;  3EZW A;  1XUP O;  4ZTF A;  2E8A A;  1LV5 A;  2W6K A;  2YNG A;  4EFH A;  1JCF A;  3FZF A;  3H45 C;  4C8M A;  1DKG D;  1VQ7 N;  4CFD A;  1JXE A;  3A5N C;  2P5O A;  4DFJ A;  2E20 A;  4EP5 A;  3WNF A;  1VQ4 N;  4HUG A;  1DT9 A;  1RT2 A;  4XH1 A;  4BE2 A;  5JVG L;  3O4W A;  3CJC A;  5CYQ A;  2VYP A;  1RDW X;  3OYM A;  1T03 A;  5GAD P;  4KHY A;  1UAX A;  1CXU A;  4GKJ K;  1TL3 A;  1YJ9 N;  3LP3 A;  3BF1 A;  4X62 K;  3GOI A;  3QEX A;  4KO0 A;  2IC3 A;  1R0A A;  5I9E B;  3C6T A;  3AO1 A;  1VQ6 N;  4Z4G A;  3CD6 N;  4FM0 A;  1HNI A;  3VQE A;  3L2W A;  1K8K B;  5CY4 A;  3KK2 A;  2VG7 A;  5AQW A;  1TKX A;  1OH8 A;  4CZI A;  1J54 A;  5EY4 A;  4CD3 A;  1QSL A;  2CGK A;  3C6U A;  5KQD A;  3THW A;  3UKU B;  5GIO A;  3I56 N;  1VQK N;  2GBZ A;  4B9N A;  1UOC A;  2O8C A;  3M5R A;  1GOC A;  2E2N A;  2W41 A;  1Z6R A;  1REV A;  4JKF A;  1RBU A;  5DMR A;  4DFK A;  5AQR A;  5F2R A;  1VSD A;  5FPM A;  5IT9 O;  4CJE A;  3NDK A;  1SUQ A;  2Q97 A;  3K58 A;  3DJC A;  4GKK K;  5HP1 A;  3PV8 A;  4N56 A;  2NRR A;  4CBX A;  2G8U A;  2O8D B;  2HF3 A;  5AQV A;  1IKW A;  3HK2 A;  4H8K A;  4CJT A;  4JI3 K;  4CIF A;  5AFU H;  3NH1 A;  1T05 A;  2XY5 A;  4JS5 A;  2Q0R A;  3L3U A;  3G25 A;  4DKW A;  3G0Z A;  4DR1 K;  5C42 A;  2E1Y A;  4B9T A;  2Q1N A;  2ZM6 K;  3QBW A;  4FJX A;  1CZA N;  5BPN A;  4AHR A;  1Z25 A;  4BRO A;  3I0R A;  4O8K A;  2NZT A;  3SYZ A;  2A5X A;  1J5E K;  3ZSX A;  1M1K O;  4A2A A;  4BVO A;  4V19 S;  4OVL A;  4GY2 B;  5HRP A;  4DG1 A;  4FLT A;  4NYF A;  3CCQ N;  3SJJ A;  4AQY K;  3CQX A;  2A1R A;  1LWE A;  1EKE A;  1RGI A;  1S9E A;  4FWP A;  4IJN A;  4CGH A;  1I39 A;  4N41 A;  2P51 A;  2ZGZ A;  4QCL A;  4QAG A;  4DB3 A;  2YCH A;  3H6E A;  4CHY A;  4YOT A;  2BH1 A;  2NUB A;  3MXI A;  3P4I A;  4JI0 K;  1D9D A;  1KD1 O;  3AVL A;  1SL2 A;  3RTV A;  1HQU A;  2KFN A;  1RBV A;  3VEV A;  3UKR B;  4M3Z A;  5A2Q O;  3WNE A;  4BC3 A;  4M3U A;  3VQP A;  1BHL A;  3O80 A;  1YXQ A;  5AQG A;  4M41 A;  3LAL A;  3V1O A;  1IKY A;  3RMC A;  3N4P A;  3SV4 A;  2Y1I A;  3MMV A;  1JKH A;  3CF5 L;  1NGI A;  2FLO A;  4IWV A;  5HRO A;  1C1C A;  3RSE B;  4DV4 K;  5JS1 A;  2IVO A;  2DFF A;  4GW6 A;  3HM9 A;  1B92 A;  5FRM A;  4LD0 A;  2PYJ A;  4JKG B;  5JLF A;  2P9S A;  1JCE A;  3D2E A;  3EZ5 A;  3OJU A;  3ENB A;  3HO1 A;  5LL6 Z;  1GLJ O;  2QWM A;  4DQ8 A;  5HBM A;  3IKM A;  1S9G A;  5AQJ A;  4YOX A;  5CZ2 A;  4CF9 A;  1XNR K;  1NK9 A;  4M63 C;  2HMP A;  1YUW A;  3AA2 A;  2KLA A;  4W5T A;  5KTQ A;  3CCJ N;  5AQZ A;  1NOY A;  4B8C A;  3B8A X;  4JN4 A;  1OKJ A;  3CIP A;  3OTO K;  1HR0 K;  3AAR A;  2JWL A;  4HTU A;  5KPT A;  4C23 A;  4CHP A;  1GLD G;  4DQI A;  4FZX C;  1BUP A;  5AQF A;  4GNI A;  3AGR A;  2QWN A;  3HM8 A;  3ZET B;  3E9P A;  3AV9 A;  1S6P A;  3OYD A;  4Y0W A;  1RBS A;  1D8Y A;  1A5W A;  4E7H A;  1KTQ A;  3O3G A;  4LY7 A;  5JMV A;  3AA5 X;  3QIP A;  2HHS A;  4IO9 L;  2WUS A;  3F9M A;  3NHG A;  3AA4 A;  4DTJ A;  1U04 A;  2ZF5 O;  1BU6 O;  2LSN A;  3QEW A;  4F8R A;  2P9U B;  1V4S A;  4BWJ A;  3QLH A;  1NLV A;  3LDO A;  1IKV A;  5CE3 A;  3I33 A;  5E26 A;  4YOR A;  4WE1 A;  4DV5 K;  1VRT A;  4FJI A;  3FE1 A;  4FJK A;  1GLL O;  3AY9 A;  1IG8 A;  1HUX A;  3CG7 A;  2OTJ N;  2F9T A;  3UE5 A;  1Q7Y O;  3MCP A;  1YI2 N;  3E9L A;  1BG3 A;  2P1J A;  1TVR A;  4KRE A;  4AIL C;  4NXN K;  4CGJ A;  3E9O A;  3ZEU B;  3TSP A;  1QSY A;  2KZM A;  5BRF A;  3CPW M;  1GLE G;  2IDO A;  4CFC A;  3DXM B;  4KB0 A;  4O5B A;  2WC9 A;  3HP6 A;  1S1X A;  1RT3 A;  4JEP A;  2F7T A;  4JI2 K;  3A2F A;  2P9I A;  4K43 A;  5AQP A;  3VQD A;  4CED A;  3MN6 A;  1IO2 A;  3KLE A;  1RDB A;  5M1F A;  3LPT A;  1NGJ A;  2EWS A;  1HKB A;  5FPN A;  1ATN A;  1LAW A;  2FF3 B;  5H1S Q;  3JSM A;  3LDN A;  4JS4 A;  2VGN A;  1WUA A;  3SQ1 A;  3QEI A;  4O44 A;  3IFR A;  3THY B;  1WLJ A;  5KPZ A;  4DQR A;  3D45 A;  3PLA A;  3BZK A;  3AVC A;  1HQE A;  2VWJ A;  1WBB A;  1RBT A;  5LY3 A;  3L4I A;  2UYT A;  1P90 A;  5M1Q A;  2IOC A;  4BRP A;  4FOE A;  2G8K A;  1BQN A;  3DYA A;  4KHP K;  2O8B B;  1OVY A;  3B6O A;  4O5F A;  2GTD A;  3V1R A;  3SUN A;  3ID8 A;  3VQC A;  3CET A;  3VQ8 A;  4L8R B;  1X3M A;  5KQ8 A;  3IMX A;  5FPE A;  2A40 A;  2DPN A;  1JLG A;  1TYQ B;  3DM2 A;  4FJ9 A;  5BR9 A;  1FKO A;  3FZH A;  2QM1 A;  4JI6 K;  4IOC L;  4FZZ A;  4DQP A;  3D2F B;  4CEZ A;  4FLW A;  3BUZ B;  1BIU A;  2EX3 A;  1VSK A;  1RFQ A;  5AR0 A;  3R8E A;  4CZL A;  2QKB A;  2IGI A;  5AFU A;  4F3O A;  4BR2 A;  2RE2 A;  2I5J A;  1WAJ A;  4LH5 A;  4PKH A;  4HUF A;  4Z4I A;  4NYN A;  4BRF A;  4KH5 A;  4J2B A;  3O8M A;  5M1P A;  2YNI A;  1TKZ A;  3FZK A;  2O8E A;  1JL2 A;  3NGY A;  1ZBL A;  1TK0 A;  1T3V A;  1NGH A;  4DHY A;  2UUA K;  1QHT A;  3J7Y P;  4OLA A;  2NRX A;  4IEE A;  4CBW A;  5GAE P;  4NB4 A;  4B3O A;  3ZSO A;  1YAG A;  5DM7 L;  1NGC A;  3G71 N;  2OPP A;  2NRH A;  4I2P A;  3KLI A;  3VQ5 A;  1K8A O;  1W0H A;  2Q2R A;  3QIN A;  3H3N O;  3TTD A;  4FJ7 A;  2UUC K;  1J6Z A;  1U49 A;  3HZ6 A;  4FYD A;  1XWL A;  3L3V A;  1QZ5 A;  1D5A A;  4JI5 K;  5F0X A;  4BAC A;  1I3A A;  4FW2 A;  4OO1 J;  3UKU A;  3OA9 A;  2P9N B;  3O9Q A;  4BGB A;  4B3R K;  3T1Y K;  3W0L A;  4DQQ A;  3TPQ A;  4BC4 A;  3NVM A;  1Z26 A;  3MN9 A;  3HXM A;  3EYZ A;  4YHH K;  1KXP A;  4DQS A;  3PUF A;  3KWG A;  4OKK A;  3TSQ A;  4LF5 K;  1KFS A;  3TAR A;  1T6C A;  3NH0 A;  4CF8 A;  4IXC A;  4PWD A;  3KK7 A;  2O8D A;  1S1V A;  1U2V B;  5AQN A;  4MFB A;  4K0K K;  3O9R A;  3NF8 A;  4O55 A;  3CC7 N;  3AVG A;  2OAN A;  4C8K A;  4Z0U A;  5AQK A;  4Q5V A;  2BDP A;  2BE2 A;  4CJS A;  3TAE A;  3OYJ A;  1CXQ A;  4FW1 A;  3LP1 A;  3WQU A;  1B9D A;  2GV9 A;  3GG4 A;  4FLU A;  2A6A A;  1N32 K;  5M1O A;  3I8D A;  3TAQ A;  1BIZ A;  4M3W A;  5GAH P;  5EXW A;  5AZJ B;  1K9M O;  3HYF A;  5KRS A;  3AVM A;  1Q8I A;  4I9L A;  2A3Z A;  3WUH A;  2UXC K;  3C65 A;  1IBL K;  1MU2 A;  4NXM K;  4E19 A;  4DV6 K;  3QNO A;  3QET A;  3MN7 A;  1SAZ A;  3HSC A;  4JI8 K;  3D7E O;  2GX9 A;  3VEY A;  4WF9 L;  2PY5 A;  1EWR A;  4WFA L;  3ZLJ A;  2Q36 A;  4FWM A;  3I55 N;  3U8X A;  4BRE A;  4PKI A;  4M3Y A;  3C0B A;  5F1X A;  4E7I A;  4FWR A;  3SNN A;  2HBL A;  4WYB A;  3AVI A;  1ZBF A;  3B6P A;  1T8E A;  4IOA L;  1RT7 A;  3MWT A;  2YHX A;  1TKT A;  2D0P A;  1N8R O;  3TAG A;  3F73 A;  1HJO A;  3ZSY A;  4E3S A;  2BAN A;  4BRQ A;  1X9J A;  3QFU A;  2AP1 A;  2HW3 A;  1CLQ A;  4IEI A;  2PAV A;  4Z4C A;  3VES A;  4H5W A;  3UKR A;  4KI4 A;  4RTF D;  2DFE A;  4DV2 K;  1MA9 B;  3SQ0 A;  2VG6 A;  4ILH A;  3N4Q A;  2E2Q A;  4YOY A;  4FWQ A;  1NU0 A;  4DFM A;  4B3S K;  4CGI A;  4DV3 K;  2HHW A;  3IUC A;  4K25 A;  5EOY A;  1QQN A;  3T1A A;  1S1U A;  4JYA K;  5BRD A;  1IV0 A;  3CQ8 A;  4CJR A;  4G1Q A;  4OKE A;  1JXB A;  5MLC Q;  1S1T A;  4JKG A;  2FSJ A;  1HNZ K;  4DV1 K;  4BRA A;  1I94 K;  2NNW A;  2KFZ A;  1GLA G;  4H0P A;  3L8B A;  2FSK A;  3QBX A;  4Z4H A;  5AZI A;  3LDP A;  4M3R A;  1O13 A;  3LP2 A;  3I0S A;  3MXM A;  3LZJ A;  1ASW A;  1C0U A;  3Q7C A;  3CCS N;  3BP8 A;  2HHT A;  3LDS A;  3IRX A;  3VPZ A;  3O3F A;  4H5R A;  1Q82 O;  3CJ7 A;  3OYA A;  4HTL A;  4EZ6 A;  3T3F A;  3ZCM A;  5JLH A;  2GWK A;  4EHT A;  4EIA A;  5TKY A;  4WFN L;  1QVF M;  3OJS A;  2JGU A;  2P9K A;  4LF7 K;  1HNW K;  3E01 A;  2AJQ A;  4FWS A;  3VTH A;  3NF6 A;  4PUO A;  1UA1 A;  4A2B A;  3TSU A;  4FXD A;  3KTQ A;  2NRW A;  2P9L B;  1Q9X A;  3CC4 N;  3CCE N;  2E88 A;  4OPJ A;  4JKB A;  3M8R A;  4N76 A;  2QXL A;  3P5J A;  5AQU A;  3V9Z A;  1XNQ K;  3T1H K;  1L5U A;  3V9U A;  4C1N K;  4DSJ A;  1HYV A;  3NFA A;  3O1W A;  1YJN N;  4ELU A;  1W97 L;  5LMU K;  1A5X A;  4CJP A;  1RT1 A;  1VK0 A;  3WQT A;  4J2E A;  2Z1H A;  5AQQ A;  2IVN A;  5KGW A;  1KCF A;  3S3N A;  3KK3 A;  4KPY A;  2OCE A;  1OH5 A;  5KRT A;  3PIO L;  3CQY A;  1WSJ A;  4OLB A;  1QVG M;  4B08 A;  1TUU A;  1X9W A;  4JD2 B;  4KH6 A;  4ISE A;  2Q0U A;  4F2S A;  2IS3 A;  3VA0 A;  5J2Q A;  3KIO A;  1KLN A;  1YTU A;  3QIO A;  4CEE A;  2HBK A;  3QER A;  3G6E N;  3SK3 A;  1C0F A;  1YHQ N;  1NGE A;  2BUP A;  3RMB A;  3ZEU A;  4I6M B;  5BR8 K;  1R59 O;  5C0Y A;  2QWP A;  4LF8 K;  1KQS M;  1XMQ K;  2X6S A;  4ICL A;  1M90 O;  4B3M K;  1NMN A;  3DXM A;  2RN2 A;  3C94 A;  1U6Z A;  4A57 A;  3ZSZ A;  4KV8 A;  3THV A;  3SBG A;  3TTC A;  4MO5 A;  2R7Y A;  3MK6 A;  4OGE A;  4J2D A;  4BC5 A;  4BR5 A;  5JVH L;  3SLC A;  3KD5 E;  3WEE B;  5KPR A;  4B8A B;  4B9M A;  3EEQ A;  3H08 A;  2O4I A;  3TAM A;  4IG3 A;  3KHY A;  1BIS A;  5C10 A;  1HKC A;  5AQY A;  3THY A;  3ZT2 A;  3HVT A;  3QDK A;  3PO5 A;  2RHK A;  3OYE A;  1F21 A;  3HTV A;  4R79 A;  3CM6 A;  4LSN A;  4XH4 A;  4B1U B;  4R5P A;  1HNX K;  3C6H A;  2BGG A;  1HYZ A;  2D0B A;  3KJV A;  5HRN A;  3RR7 A;  1DLO A;  4RW7 A;  2G8V A;  1RT4 A;  2ETJ A;  2UU9 K;  2O8B A;  5J2M A;  1ATR A;  2VGM A;  2O8F A;  5JIC A;  4PA1 A;  3KVG A;  1HJR A;  4DU1 A;  3ZX0 A;  1D9F A;  2CGJ A;  4IOX A;  2ZGY A;  3QEP A;  4HUE A;  1QS4 A;  3GE1 A;  2GUI A;  3THX B;  4FWK A;  1L3V A;  4BDP A;  4Y1D A;  1VQM N;  3CC2 N;  3QEV A;  4QS7 A;  4B1X B;  3U9D A;  2OPS A;  3T19 A;  4PHT X;  5D3G A;  4CF1 A;  1WSG A;  1WSI A;  3KD1 E;  4IFY A;  4CEB A;  2PZS A;  1DEJ A;  4DR2 K;  3CI5 A;  1WOQ A;  4HHT A;  3DMJ A;  4NCB A;  4ELV A;  2XY8 A;  5DK5 A;  4DTX A;  3S41 A;  2Q31 A;  4OX9 K;  2NRV A;  3THW B;  4CHO A;  3UIQ A;  3VTI A;  5BPL A;  4DR4 K;  4ILJ A;  3L0Q A;  2WBN A;  1X9S A;  1MWM A;  2X74 A;  4FVU A;  3A5L C;  2F4V K;  3ASM A;  3O4Q A;  1SV5 A;  4DLE A;  3CPE A;  3OYG A;  1VSI A;  2KKZ A;  3AVF A;  4Y1C A;  2QWL A;  3FZM A;  1HNV A;  3DLR A;  3VN5 A;  3ENH A;  2JWK A;  2O4G A;  5AQM A;  1C0T A;  2JLE A;  4CIE A;  2HND A;  4EZ9 A;  4NCA A;  1IG9 A;  4RW8 A;  3DAW A;  3F2K A;  1RCH A;  4I9Q A;  5J2N A;  1VQO N;  1HPZ A;  2P9P B;  2V52 B;  1EWQ A;  3LWM A;  3MEC A;  5E84 A;  1VHX A;  3PY8 A;  4JV5 K;  4DTU A;  3K2P A;  3VER A;  2P9N A;  3A8Y A;  1T44 A;  4O8U A;  5M1N A;  2G8H A;  2ITM A;  3OYC A;  4CFA A;  3PO4 A;  1ESV A;  2FBV A;  1NKE A;  1YIJ N;  4G9Z A;  1C0G A;  3FFK B;  1RDC A;  1LCU A;  1ZBH A;  3DLB A;  3RMD A;  1S22 A;  4CVN E;  3QIC A;  4FPA A;  4H0T B;  4AM6 A;  2A41 A;  4WQ5 A;  1NK7 A;  4YOW A;  4M3T A;  1ILY A;  4CEC A;  3CJ1 A;  1NJY A;  2V7Z A;  3CCR N;  4DTN A;  3K0S A;  1YTA A;  4PQU A;  2E1Z A;  3KZB A;  5I3U A;  3C6A A;  2YHB A;  1GLC G;  3VOV A;  5AQX A;  5I42 A;  4BRG A;  4CZE A;  1W2B M;  2FBT A;  4X65 K;  3M8Q A;  1H1V A;  4JKE A;  4B1Y B;  4E7L A;  4LF9 K;  3TU5 A;  4X64 K;  3AGK A;  1RTJ A;  2F8T A;  4BRL A;  3D6R A;  1FK9 A;  1NGF A;  4Z94 A;  4HCC A;  4B9Q A;  4OPK A;  2XY7 A;  5AZJ A;  2ZJP L;  1CZB A;  4J8F A;  3V81 A;  4W5O A;  4DV0 K;  1U45 A;  5C15 A;  2QI2 A;  3CFR A;  1UWB A;  2EHG A;  4KHS A;  1BQM A;  1RTD A;  4JKC A;  4PY5 A;  3A5O C;  4QOZ B;  2YJF A;  3OYN A;  2X78 A;  3AVJ A;  1YVU A;  4CD1 A;  4ISF A;  3HPH A;  1NK6 A;  1G15 A;  4DTM A;  4YOU A;  4RW4 A;  1JLB A;  3NVK A;  4FWN A;  4K8Z A;  2ZWH A;  1E4F T;  1S3X A;  4E89 A;  5EU7 A;  1KVC A;  4E0D A;  3W3D A;  3PSF A;  1P8Z A;  2P5G A;  2RPI A;  4DS5 A;  1HKG A;  4H5N A;  3PSI A;  4MLH A;  1E3M A;  2P9S B;  2ASM A;  3SMP A;  3D2E B;  4BRI A;  3AVA A;  4BRM A;  3KLF A;  4W5Q A;  1QHA A;  3ZSQ A;  4EP4 A;  4CZK A;  1WNS A;  3K9J A;  4XEI A;  1TK8 A;  4M7Y A;  1RDU A;  3DWL A;  4BR9 A;  4CZM A;  4CIG A;  3LL3 A;  1VQL N;  1LW2 A;  3O4N A;  2VQF K;  3MN5 A;  3SAH A;  3QES A;  1QQC A;  2HMI A;  1SL0 A;  3OW2 M;  3VET A;  3L6Q A;  4C8O A;  4B9U A;  2G8F A;  3VF2 A;  3NGI A;  4NLB A;  2YKM A;  3V9W A;  3MEG A;  1SQK A;  1Y97 A;  2FXU A;  5C12 A;  4YOV A;  3RRG A;  2I7N A;  3LAM A;  1C0M A;  3O9T A;  3NF9 A;  4B9S A;  1LAV A;  2VQE K;  3ZYY X;  1LW0 A;  2CGL A;  3S9H A;  3MAQ A;  4A62 A;  1BI4 B;  4CBU A;  1NK8 A;  3EE8 A;  1O1W A;  3TR8 A;  1YT3 A;  1ASU A;  1Q18 A;  2YHA A;  4JHD B;  3SV3 A;  4FWO A;  3DLH A;  1WB9 A;  3P39 A;  1NKC A;  1BA1 A;  3OVN A;  1K8K A;  1VSL A;  4BR4 A;  2HBJ A;  4GV6 A;  1BA0 A;  4LF4 K;  1KVA A;  2QWQ A;  4FWL A;  4DSL A;  4BQZ A;  4QS8 A;  1ASV A;  1N34 K;  3ID6 A;  1CZ9 A;  4K41 A;  4JLH A;  3GDQ A;  1VSM A;  3SPZ A;  4CJ4 A;  3O3H A;  2E2P A;  3HL8 A;  4JRQ A;  3D0P A;  3DRR A;  3K57 A;  3SBT A;  5K14 A;  4IFE A;  1ATS A;  3G4S N;  3SZ2 A;  1RT5 A;  3C7N B;  5BN9 A;  5B8H A;  3CYM A;  1NOZ A;  4PL8 A;  1HRH A;  1L3U A;  2XHB A;  4MQ3 A;  3P1G A;  4JI4 K;  2VWB A;  4BG9 A;  3TAB A;  3H46 O;  2P9L A;  4J2A A;  5HRS A;  2NRT A;  4CW7 B;  2CH5 A;  3HOS A;  3MWP A;  4BG8 A;  3LZI A;  3S3O A;  2OYQ A;  1VSJ A;  2D5R A;  3FFI A;  1TL1 A;  4DR3 K;  4ILG B;  1Q9Y A;  1BWF O;  4MDA A;  1KVB A;  1QSS A;  4A5A A;  3M1F A;  1NJZ A;  4BWM A;  1T7P A;  3VEW A;  4OPH A;  4UQG A;  4H0O A;  4YY3 K;  4FM2 A;  3EE9 A;  1TK5 A;  1VRU A;  4LFA K;  4CHQ A;  3MDQ A;  1YIT N;  2P9I B;  3VF6 A;  4YDU A;  3VQ6 A;  3PX6 A;  4BY9 C;  1C6V A;  1WBD A;  3DLG A;  2G8I A;  3HOT A;  2QTD A;  3VGK A;  2J4R A;  1VSF A;  3KKS A;  3CJA A;  1VQ9 N;  3OYI A;  4FOI A;  4CJQ A;  5AQO A;  3ZT1 A;  2HOE A;  3DI6 A;  2V51 B;  1XHZ A;  1ZBI A;  5E41 A;  3V9X A;  4N5S A;  4B9V A;  4CGD A;  1ZYQ A;  1NG9 A;  1KC8 O;  4QS9 A;  2F9W A;  5M1K A;  3VEN A;  4I6M A;  4TSX A;  1KAZ A;  1JLE A;  1ZXO A;  4FL9 A;  1B9F A;  4X66 K;  3LWL A;  2ZJQ L;  4CEQ A;  5TKW A;  4LFC K;  1LOT B;  1NJI O;  4KRF A;  2QEX N;  3ULE B;  1VQ8 N;  5DM6 L;  4IDK A;  2KW4 A;  4UY8 O;  3AO2 A;  4DSF A;  2CH6 A;  2KQ2 A;  5FLX O;  1RTI A;  1TV6 A;  1VQ5 N;  4IFV A;  3O6W A;  3WXL A;  1X3N A;  4AH9 A;  4FLY A;  2KHO A;  3NBP A;  1XMO K;  4DR7 K;  4ID5 A;  3LDQ A;  3VQQ A;  4CJF A;  3CCU N;  1BGX T;  3R6M A;  1JLC A;  3JS6 A;  5AJ3 K;  3VQ7 A;  1SZ2 A;  2HVI A;  1N6Q A;  1E4G T;  4KTW A;  3S3M A;  3H1Q A;  4FK2 A;  3TAN A;  1NM1 A;  4CJU A;  4E1N A;  1QZ6 A;  1K73 O;  3IG1 A;  3AVH A;  3F9K A;  3LP0 A;  5CYM A;  4DTS A;  4B9L A;  3R9P A;  3RSE A;  2HNZ A;  5IWA K;  4DSK A;  1JLQ A;  3CCV N;  1GLB G;  2NRZ A;  4OGC A;  1IBM K;  1MDU B;  1N36 K;  5EVZ A;  2O8E B;  4JKA A;  5C25 A;  2ATQ A;  3O5B A;  1T6D A;  2DY4 A;  4YNQ A;  1U4B A;  4LH4 A;  4DSE A;  3ULD A;  2FBX A;  3JYT A;  5CZ1 A;  3THX A;  1Q81 O;  1NBW A;  2GUP A;  1DTQ A;  4M7X A;  3WXI A;  2HHX A;  2F96 A;  1S1W A;  4BVP A;  3GBT A;  3KK1 A;  3J7A P;  3OYL A;  4IBN A;  3OS1 A;  3BGR A;  4LF6 K;  4DWI A;  4H0X B;  1XI1 A;  3CME N;  5LJW A;  1XQS C;  2XO7 A;  4L3Q A;  1VAZ A;  4BE0 A;  3HPG A;  3L2U A;  3T69 A;  2FBY A;  2HHU A;  2YNF A;  2V7Y A;  1QE1 A;  3CJB A;  3C95 A;  4O4G A;  3VGL A;  4AHC A;  4KHU A;  5J2P A;  3WXK A;  3KLH A;  2B6A A;  4WCE L;  3FR0 A;  1IBK K;  3ZET A;  4RW9 A;  2E6M A;  2WTU A;  3HST B;  4CK1 A;  3QFP A;  4Z4F A;  2OZS A;  4GV3 A;  1TKD A;  3M3Z A;  3SAG A;  1NJX A;  1GLF O;  2D1K A;  1XHX A;  2P9U A;  2WON A;  3QO9 A;  5GIN A;  4WFB L;  4AM7 A;  3MX5 A;  4DFP A;  3WXJ A;  1XC3 A;  1Q86 O;  5AQH A;  4FVM A;  4CCH A;  4FJH A;  3CCL N;  2HST A;  3VQA A;  1KSP A;  1HMV A;  1S72 N;  1U48 A;  2P9P A;  3HT3 A;  1N33 K;  3O9U A;  3RVC A;  1G99 A;  4BDY A;  3K5L A;  5J1E A;  3LAN A;  3QNN A;  3U3Y A;  4FZY A;  3HBT A;  4JK9 A;  4H4M A;  3CMA N;  3SUQ A;  4FJJ A;  1RTH A;  3IAY A;  3R3L A;  3DRP A;  3VF4 A;  4CJ3 A;  3L4Q A;  1W7A A;  3DLK A;  4YDU C;  2QW9 A;  2HHV A;  3SUP A;  3DXK B;  4B1V A;  4BR0 A;  2E2O A;  3L2Q A;  2ZD1 A;  3OYK A;  1V4T A;  1X9M A;  1BCM A;  1Z05 A;  3O1B A;  4CJ7 A;  1BO5 O;  4GVE A;  4DR5 K;  3AAP A;  2H3G X;  3MCA B;  3BDP A;  4CEF A;  4FSV A;  4CEA A;  4DUY K;  3OYH A;  3F5T A;  2W40 A;  4ZTJ A;  2GEM A;  3NCI A;  1ZC6 A;  1NKB A;  4BE1 A;  3NH2 A;  1SKR A;  2YHY A;  4KTZ A;  5JS2 A;  3SMS A;  3EKS A;  4BRD A;  3A5M C;  3MXJ A;  4CJK A;  4N47 A;  4PL7 A;  4DCH A;  1FXX A;  3EKU A;  3H1V X;  1LWF A;  5SWM A;  3J80 O;  4E1M A;  3AAQ A;  4B1Z A;  4CGF A;  4DMN A;  1C1B A;  3RWU A;  4FJ5 A;  4AHT A;  3VQ4 A;  3V9S A;  1RDA A;  3LDL A;  3VEX A;  4CFB A;  3AVB A;  3ZT4 A;  4KTQ A;  4AF1 A;  4JI7 K;  2ZE2 A;  3VQ9 A;  2PFU A;  4FJN A;  2FSN A;  5LMN K;  5GIP A;  4BRC A;  1NGB A;  2YKN A;  3R1X A;  4NCG A;  2GWJ A;  3SPY A;  4C8N A;  2Z1G A;  1RDD A;  3ATV A;  4ELT A;  1TYQ A;  4O0I A;  1BL3 A;  4BRK A;  4I7F A;  2BTF A;  2Z1I A;  1KRP A;  3D2F A;  1NWK A;  5FRN A;  3PX0 A;  4E1J A;  1Y64 A;  4YFU A;  5ELZ A;  2W42 A;  1FW6 A;  4BRN A;  3TI0 A;  1RT6 A;  3IS9 A;  4MDB A;  3KLG A;  3OBY A;  3WNG A;  1RBR A;  1OH7 A;  3K9K A;  4MLE A;  2OA8 A;  3CCM N;  5AZI B;  3OYF A;  3DLL L;  3UB5 A;  4AHS A;  2VWK A;  4CGG A;  4DU4 A;  4A5B A;  3AO5 A;  1VSE A;  2F8S A;  3CJ9 A;  3NAE A;  1QQO A;  3V1Q A;  4JK7 A;  3L2V A;  2VG5 A;  3CHW A;  2HHH K;  4FCY A;  3OS2 A;  4BC2 A;  4H03 B;  1RNH A;  3QB0 A;  2KZZ A;  4CE9 A;  4CZJ A;  3DRS A;  2E4L A;  3ZT0 A;  1BOT O;  3BY5 A;  4FK4 A;  1YF5 L;  2O8C B;  1UA0 A;  1SL1 A;  4CK2 A;  1KLM A;  1XC9 A;  1DGK N;  2P9K B;  1J53 A;  3HI0 A;  3JXU A;  4RWT A;  5KI6 A;  2ITG A;  4EAH D;  3AVN A;  1C1A A;  4KI6 A;  4H5T A;  3TAP A;  1EXQ A;  3O08 A;  5ADX H;  1BI4 A;  5BPM A;  3QML A;  1S6Q A;  4EHU A;  2QWO A;  4XIU A;  3K5M A;  3ZX3 A;  2UUB K;  1WSH A;  3OHR A;  3P83 D;  4JHD A;  2ZQB A;  5C2F A;  3M6G A;  3FGU A;  3ITH A;  1TUY A;  2QA4 N;  3E1Y A;  3E66 A;  1HX1 A;  1J9A A;  2PBD A;  1TGO A;  3MEE A;  4CER A;  3FLC O;  3ZSV A;  4F3T A;  1KAX A;  4E7J A;  4CES A;  1LWC A;  4W5N A;  3DOL A;  2E6L A;  2W6L A;  3C7N A;  2YHW A;  4ID1 A;  4KFB A;  4HVJ A;  3BEX A;  4IG0 A;  5GAG P;  3FZL A;  5CHI A;  2XY6 A;  4FJ8 A;  2YNH A;  1SKS A;  3HP9 A;  2HBM A;  4HCB A;  2WOM A;  1U2V A;  5HLF A;  4FM1 A;  4FJL A;  1VQP N;  4JNE A;  3ALY A;  4IO8 A;  2WFB A;  1EX4 A;  5LJV A;  2HNY A;  3WXM B;  3MED A;  4LC9 B;  3G10 A;  4DTO A;  4U67 L;  3K5N A;  1W9H A;  1ITG A;  2D0A A;  1A5V A;  4E7K A;  4H0V B;  4XH5 A;  2OPQ A;  2QK9 A;  3PIP L;  1WSE A;  4IDH A;  1L3T A;  1WN7 A;  3K5O A;  4M3X A;  2D0O A;  2IIR A;  4W5R A;  3NMU A;  3H3O B;  3LM9 A;  1KFD A;  4ZHR A;  3P38 A;  3P31 A;  2RF2 A;  1NK5 A;  3KWI A;  3U4L A;  4H4O A;  4JI1 K;  1GOA A;  3AO4 A;  2HHQ A;  4BR7 A;  1X1P A;  4GV9 A;  3SUO A;  1QQM A;  4DS4 A;  5HRR A;  3ZT3 A;  4CHZ A;  1J5O A;  1JCG A;  4JK8 A;  2D4W A;  2HF4 A;  5FPD A;  4RW6 A;  1EQY A;  4DU3 A;  4FLZ A;  2YV0 X;  2OZM A;  4GMJ B;  3CM5 A;  2PYL A;  3CFO A;  1SKW A;  4FLX A;  1NGG A;  1OVQ A;  2VCP A;  3WT0 A;  3HVR A;  2B5J A;  3SQ4 A;  5FRO A;  4JRP A;  4BRH A;  4CZH A;  3WNH A;  4C1N I;  1GOB A;  2O8F B;  3ULE A;  4KHN A;  4Q0B A;  1NGA A;  2QWR A;  2RKI A;  5AQL A;  3LPU A;  4OJR A;  2ASO A;  1YVN A;  1L3S A;  5BRH A;  4WQ4 A;  3CXC M;  1WSF A;  5EX5 A;  2UXB K;  1JL1 A;  3ZX2 A;  4JKD A;  1NGD A;  3J81 O;  5AQI A;  3DLE A;  4FLV A;  1HYS A;  4KB1 A;  4O0J A;  3CER A;  3NE6 A;  3VEZ A;  5HOO A;  4IKF A;  4NLC A;  4IZ9 A;  4GVM A;  4CF0 A;  1IKX A;  2FF6 A;  5BN8 A;  3DOK A;  3O9S A;  4CJV A;  3PX4 A;  4DF8 A;  2UXD K;  2HB5 A;  3IDH A;  3J7Z O;  3VMF B;  2HVH A;  3ZSW A;  3AA3 A;  4DSI A;  2Z1J A;  3HRG A;  3A0I X;  3M8S A;  3T7Z A;  4BGA A;  1HLU A;  2ASP A;  5KGX A;  5T7B A;  4FJG A;  5HL7 L;  4LSL A;  4FO0 A;  4AHV A;  1NK0 A;  4DV7 K;  3Q7B A;  1EET A;  3BZC A;  1YJW N;  1NJW A;  4M42 A;  4DLG A;  1VQN N;  1IH7 A;  4RG8 A;  3OS0 A;  2D0C A;  3HPO A;  5BRE A;  4AHU A;  3MX2 A;  5SZT A;  1WAF A;  2AA4 A;  3U9Z A;  3VQB A;  4K42 A;  2DTU A;  3GL1 A;  3SAF A;  1FKP A;  2I7P A;  3BF3 A;  4BQL A;  2Y1J A;  3VGM A;  1ZBS A;  4H0Y B;  4CF2 A;  3LAK A;  3KKR A;  4DTP A;  3TAF A;  2IAJ A;  3SI6 A;  1QTM A;  4KHQ A;  4KH4 A;  1K6Y A;  4OPA A;  4H5V A;  4JAX A;  2YJE A;  3VA3 A;  5FDL A;  4FJM A;  3LM2 A;  5CR4 A;  2QXF A;  5AQS A;  3OYB A;  1OH6 A;  4CJW A;  4DTR A;  2X6N A;  2B4J A;  2ZJR L;  1MWK A;  3SQ2 A;  1NNE A;  5C2D A;  1JLF A;  4A59 A;  3RMA A;  2OPR A;  4ISG A;  3U6F A;  4WQ5 C;  3EN9 A;  4BDZ A;  2Q3S A;  3I8B A;  4CJL A;  1HPM A;  4B3T K;  3JAM O;  3CFP A;  1IJJ A;  2FC0 A;  4HWI A;  4F9O A;  4CI6 A;  4RCH A;  5C24 A;  3ENO A;  3U3G A;  2XRI A;  3VEO A;  2KTQ A; 
#chains in the Genus database with same CATH homology
 3HST B;  4CK1 A;  3QEV A;  4CK3 A;  2IOC A;  4M45 A;  2OPS A;  3T19 A;  3AVK A;  2G8K A;  5D3G A;  4Z4F A;  3V6D A;  1BQN A;  3DYA A;  4CF1 A;  1WSG A;  1WSI A;  2OZS A;  4IFY A;  3KD1 E;  4CEB A;  3B6O A;  2PZS A;  1TKD A;  3NGZ A;  3V1R A;  3SUN A;  1NJX A;  4Z4E A;  4C8L A;  3VQC A;  3VQ8 A;  3DMJ A;  4HHT A;  4L8R B;  1XHX A;  4NCB A;  4ELV A;  1S5J A;  2XY8 A;  2DFH A;  2WON A;  5DK5 A;  4KAZ A;  4DTX A;  3QO9 A;  3K59 A;  3RRH A;  4DFP A;  4FK0 A;  1JLG A;  3DM2 A;  4K8X A;  4FVM A;  4KHW A;  4CCH A;  4F4K A;  4FJH A;  4FJ9 A;  3TWH A;  4CHN A;  1FKO A;  1TAQ A;  3VQA A;  4CHO A;  1NK4 A;  1DTT A;  3M8P A;  3UIQ A;  1N5Y A;  1KSP A;  4FZZ A;  4DQP A;  1HMV A;  4CEZ A;  3ZSR A;  4FLW A;  1U48 A;  3HJF A;  1BIU A;  4I2Q A;  3HT3 A;  2EX3 A;  1X9S A;  2X74 A;  1JLA A;  1VSK A;  4BDY A;  3K5L A;  5J1E A;  3SCX A;  3ASM A;  3LAN A;  1SV5 A;  3O4Q A;  2QKK A;  2QKB A;  3QNN A;  1EP4 A;  3U3Y A;  4DLE A;  4FZY A;  4H4M A;  1RIL A;  3OYG A;  4DF4 A;  1VSI A;  3SUQ A;  2IGI A;  4FJJ A;  3AVF A;  4Y1C A;  3L2R A;  4F3O A;  1HNV A;  1RTH A;  3DLR A;  3IAY A;  3VN5 A;  3DRP A;  4CEO A;  2I5J A;  1ZBU A;  4F2R A;  1WAJ A;  3NF7 A;  4OKJ A;  2O4G A;  1TAU A;  4LH5 A;  4CJ3 A;  1C0T A;  4CJ5 A;  4HUF A;  4Z4I A;  3DLK A;  4NYN A;  4J2B A;  2HHV A;  2JLE A;  3SUP A;  3V4I A;  2YNI A;  4CIE A;  2HND A;  4EZ9 A;  1TKZ A;  2A1S A;  3AO3 A;  4NCA A;  1JL2 A;  3L2Q A;  3NGY A;  4RW8 A;  3EY1 A;  1ZBL A;  1IG9 A;  2ZD1 A;  1RCH A;  3OYK A;  1TK0 A;  1X9M A;  4I9Q A;  5J2N A;  1BCM A;  1HPZ A;  1QHT A;  3LWM A;  3MEC A;  4OLA A;  2G8W A;  3BDP A;  4CEF A;  3PY8 A;  3RR8 A;  4KKO A;  4CEA A;  4DTU A;  3K2P A;  3OYH A;  1U47 A;  4B3O A;  3ZSO A;  1VSH A;  4ZTJ A;  3NCI A;  2G8H A;  2OPP A;  4CFA A;  3OYC A;  3PO4 A;  1BCO A;  2FBV A;  1NKE A;  4I2P A;  3ISN C;  1NKB A;  3KLI A;  3VQ5 A;  3NH2 A;  3OY9 A;  4BE1 A;  1SKR A;  1W0H A;  1RDC A;  4ZTF A;  3QIN A;  1LV5 A;  3DLB A;  1ZBH A;  3RMD A;  4FJ7 A;  2YNG A;  4KTZ A;  5JS2 A;  1U49 A;  3MXJ A;  1NK7 A;  4FYD A;  1XWL A;  3L3V A;  4M3T A;  4CJK A;  4N47 A;  4C8M A;  4CFD A;  1JXE A;  1D5A A;  2P5O A;  4CEC A;  4DFJ A;  1FXX A;  4BAC A;  1NJY A;  1I3A A;  4EP5 A;  4DTN A;  4FW2 A;  1LWF A;  1YTA A;  5SWM A;  3WNF A;  4PQU A;  4HUG A;  4E1M A;  5I3U A;  1RT2 A;  4CGF A;  4BE2 A;  2YHB A;  4DMN A;  1C1B A;  3RWU A;  5CYQ A;  4FJ5 A;  4AHT A;  3OYM A;  3VQ4 A;  3V9S A;  1T03 A;  4KHY A;  1UAX A;  1RDA A;  4CFB A;  1CXU A;  1TL3 A;  3LP3 A;  5I42 A;  3AVB A;  3ZT4 A;  2FBT A;  3QEX A;  4KTQ A;  4KO0 A;  3M8Q A;  2IC3 A;  4E7L A;  4DQQ A;  2ZE2 A;  3VQ9 A;  3C6T A;  1R0A A;  3AO1 A;  4FJN A;  4Z4G A;  1RTJ A;  4FM0 A;  1HNI A;  2F8T A;  1Z26 A;  3VQE A;  3HXM A;  2YKN A;  4NCG A;  3EYZ A;  4DQS A;  3SPY A;  3L2W A;  4C8N A;  2Z1G A;  1FK9 A;  5CY4 A;  3KK2 A;  4HCC A;  1RDD A;  2VG7 A;  3PUF A;  1TKX A;  4ELT A;  4OKK A;  4OPK A;  1KFS A;  2XY7 A;  1J54 A;  3TAR A;  4O0I A;  1BL3 A;  1CZB A;  3NH0 A;  3V81 A;  4W5O A;  4CF8 A;  1QSL A;  3C6U A;  4I7F A;  4PWD A;  2Z1I A;  1S1V A;  1U45 A;  1KRP A;  3CFR A;  4MFB A;  2GBZ A;  5FRN A;  1UWB A;  3NF8 A;  4O55 A;  3PX0 A;  4B9N A;  4YFU A;  1UOC A;  2EHG A;  3AVG A;  2W42 A;  4C8K A;  4KHS A;  4Z0U A;  1BQM A;  1RTD A;  3TI0 A;  1RT6 A;  3IS9 A;  3KLG A;  4PY5 A;  4Q5V A;  2BDP A;  1GOC A;  2BE2 A;  4CJS A;  4QOZ B;  3TAE A;  3OYJ A;  3WNG A;  1CXQ A;  1RBR A;  1REV A;  3OYN A;  2OA8 A;  2X78 A;  1RBU A;  3AVJ A;  5DMR A;  4FW1 A;  4DFK A;  3LP1 A;  3OYF A;  1YVU A;  1B9D A;  2GV9 A;  1VSD A;  3HPH A;  4AHS A;  2VWK A;  4CJE A;  1G15 A;  3NDK A;  1SUQ A;  4CGG A;  4FLU A;  1NK6 A;  3K58 A;  4DU4 A;  3I8D A;  3TAQ A;  3AO5 A;  1BIZ A;  1VSE A;  4DTM A;  4M3W A;  3NAE A;  2F8S A;  3V1Q A;  5HP1 A;  3PV8 A;  4RW4 A;  4N56 A;  3L2V A;  2VG5 A;  1JLB A;  4K8Z A;  4FCY A;  3OS2 A;  2G8U A;  1RNH A;  3HYF A;  2KZZ A;  4E89 A;  3AVM A;  5EU7 A;  1KVC A;  4CE9 A;  5KRS A;  4E0D A;  3DRS A;  1Q8I A;  2E4L A;  3ZT0 A;  2P5G A;  4I9L A;  2RPI A;  4FK4 A;  4DS5 A;  1IKW A;  3HK2 A;  4H8K A;  4CJT A;  1UA0 A;  1SL1 A;  1MU2 A;  4E19 A;  4CIF A;  3NH1 A;  3QNO A;  4CK2 A;  3QET A;  1T05 A;  2XY5 A;  4JS5 A;  1KLM A;  1XC9 A;  3AVA A;  2PY5 A;  3KLF A;  4W5Q A;  1J53 A;  3ZSQ A;  4EP4 A;  5KI6 A;  2ITG A;  1WNS A;  3AVN A;  3L3U A;  1TK8 A;  1C1A A;  4KI6 A;  4CIG A;  3G0Z A;  3TAP A;  1EXQ A;  1BI4 A;  4M3Y A;  5C42 A;  1S6Q A;  4B9T A;  1LW2 A;  3O4N A;  4XIU A;  3K5M A;  3QES A;  4E7I A;  1WSH A;  3P83 D;  1QQC A;  2HMI A;  3SNN A;  4FJX A;  1SL0 A;  4AHR A;  1Z25 A;  2ZQB A;  3AVI A;  1ZBF A;  4C8O A;  3B6P A;  3I0R A;  4B9U A;  1T8E A;  3ITH A;  1RT7 A;  2G8F A;  3NGI A;  1TKT A;  3SYZ A;  2YKM A;  1J9A A;  3V9W A;  3MEG A;  3TAG A;  1Y97 A;  3RRG A;  3F73 A;  3LAM A;  3ZSX A;  1TGO A;  3ZSY A;  4E3S A;  2BAN A;  1C0M A;  3NF9 A;  3MEE A;  4CER A;  2HW3 A;  4B9S A;  1CLQ A;  1LAV A;  3ZSV A;  4F3T A;  1LW0 A;  4OVL A;  4Z4C A;  5HRP A;  3MAQ A;  4E7J A;  3S9H A;  4KI4 A;  4CES A;  1BI4 B;  1LWC A;  4DG1 A;  4FLT A;  1NK8 A;  2DFE A;  4W5N A;  3DOL A;  2E6L A;  3SQ0 A;  1O1W A;  3TR8 A;  1YT3 A;  1ASU A;  2VG6 A;  4NYF A;  3SJJ A;  4ID1 A;  2YHA A;  4KFB A;  4HVJ A;  4IG0 A;  3SV3 A;  2XY6 A;  3DLH A;  4DFM A;  1NKC A;  4FJ8 A;  3OVN A;  2A1R A;  1VSL A;  1LWE A;  1EKE A;  4CGI A;  1S9E A;  4N41 A;  4CGH A;  1I39 A;  2YNH A;  2P51 A;  2HHW A;  1SKS A;  4QCL A;  4QAG A;  1KVA A;  4DSL A;  3HP9 A;  4HCB A;  4CHY A;  3T1A A;  1S1U A;  2WOM A;  1ASV A;  2NUB A;  5HLF A;  1CZ9 A;  3MXI A;  4JLH A;  4CJR A;  4G1Q A;  4OKE A;  1VSM A;  3CQ8 A;  1JXB A;  4FM1 A;  3AVL A;  1SL2 A;  3SPZ A;  1D9D A;  3ALY A;  1S1T A;  4CJ4 A;  3RTV A;  1HQU A;  3O3H A;  2KFN A;  1EX4 A;  2HNY A;  1RBV A;  3HL8 A;  3D0P A;  3DRR A;  3K57 A;  3MED A;  4JRQ A;  3G10 A;  4DTO A;  4M3Z A;  3K5N A;  1W9H A;  1ITG A;  3WNE A;  4M3U A;  2KFZ A;  5K14 A;  3VQP A;  3L8B A;  2D0A A;  4Z4H A;  3SZ2 A;  1RT5 A;  1A5V A;  4E7K A;  4M3R A;  3CYM A;  1BHL A;  3LP2 A;  3I0S A;  4M41 A;  1NOZ A;  3MXM A;  3LAL A;  1HRH A;  3LZJ A;  2XHB A;  4MQ3 A;  1ASW A;  1IKY A;  1C0U A;  2OPQ A;  3V1O A;  3RMC A;  2QK9 A;  3SV4 A;  2Y1I A;  1WSE A;  3P1G A;  2HHT A;  1JKH A;  1L3T A;  1WN7 A;  3LDS A;  3K5O A;  3TAB A;  4M3X A;  3IRX A;  3O3F A;  4W5R A;  4J2A A;  4ZHR A;  1KFD A;  5HRO A;  1C1C A;  5HRS A;  2RF2 A;  1NK5 A;  5JS1 A;  2DFF A;  4GW6 A;  3HM9 A;  3LZI A;  3S3O A;  3OYA A;  2OYQ A;  1VSJ A;  1B92 A;  2D5R A;  3FFI A;  3T3F A;  4LD0 A;  4EZ6 A;  3ZCM A;  5FRM A;  1TL1 A;  4H4O A;  1Q9Y A;  2PYJ A;  1GOA A;  4FJL A;  3AO4 A;  1KVB A;  2HHQ A;  1QSS A;  1X1P A;  3SUO A;  3OJS A;  3EZ5 A;  1NJZ A;  2JGU A;  4DS4 A;  5HRR A;  3ZT3 A;  4BWM A;  4CHZ A;  3OJU A;  1J5O A;  1T7P A;  4UQG A;  3E01 A;  4FM2 A;  3HO1 A;  2AJQ A;  3NF6 A;  4RW6 A;  4PUO A;  4DU3 A;  4FLZ A;  2YV0 X;  5HBM A;  1VRU A;  1UA1 A;  1TK5 A;  2OZM A;  4GMJ B;  4CHQ A;  1S9G A;  3CM5 A;  2PYL A;  4FXD A;  3CFO A;  1SKW A;  3KTQ A;  3VQ6 A;  3PX6 A;  5CZ2 A;  4CF9 A;  1Q9X A;  1NK9 A;  1C6V A;  4FLX A;  3DLG A;  2G8I A;  4OPJ A;  3HVR A;  2B5J A;  3SQ4 A;  1VSF A;  5FRO A;  3M8R A;  4JRP A;  4N76 A;  3AA2 A;  3P5J A;  3KKS A;  4W5T A;  3WNH A;  1GOB A;  5KTQ A;  3OYI A;  3V9Z A;  4KHN A;  4CJQ A;  3ZT1 A;  1L5U A;  1NOY A;  4Q0B A;  2RKI A;  3DI6 A;  3V9U A;  1KLN A;  4B8C A;  1XHZ A;  3LPU A;  1HYV A;  3NFA A;  4OJR A;  4DSJ A;  1ZBI A;  4ELU A;  5E41 A;  3V9X A;  4N5S A;  1L3S A;  4B9V A;  1A5X A;  4CGD A;  1RT1 A;  4CJP A;  1WSF A;  4HTU A;  1ZYQ A;  1VK0 A;  4J2E A;  2Z1H A;  4CHP A;  1JL1 A;  5KGW A;  1KCF A;  3S3N A;  4DQI A;  4FZX C;  4FLV A;  3DLE A;  1HYS A;  4TSX A;  4O0J A;  3KK3 A;  4KB1 A;  1JLE A;  4KPY A;  3NE6 A;  3AV9 A;  1S6P A;  3OYD A;  1B9F A;  4IKF A;  5KRT A;  1RBS A;  4GVM A;  1D8Y A;  1A5W A;  4CF0 A;  4E7H A;  1KTQ A;  1IKX A;  1WSJ A;  3O3G A;  3LWL A;  4OLB A;  3DOK A;  4LY7 A;  4CEQ A;  4B08 A;  4CJV A;  3AA5 X;  3PX4 A;  3QIP A;  1X9W A;  4DF8 A;  2HHS A;  4KRF A;  3NHG A;  3AA4 A;  4F2S A;  2IS3 A;  3VA0 A;  5J2Q A;  2HB5 A;  3KIO A;  4IDK A;  2KW4 A;  4DTJ A;  1U04 A;  3AO2 A;  3QIO A;  4CEE A;  3ZSW A;  4DSF A;  3QER A;  3AA3 A;  2HVH A;  4DSI A;  2KQ2 A;  2LSN A;  3QEW A;  1RTI A;  2Z1J A;  4F8R A;  1TV6 A;  4IFV A;  3M8S A;  4AH9 A;  4FLY A;  4BWJ A;  3QLH A;  3RMB A;  3NBP A;  5KGX A;  5T7B A;  1IKV A;  4FJG A;  4ID5 A;  4LSL A;  3VQQ A;  4CJF A;  4AHV A;  1NK0 A;  1BGX T;  4WE1 A;  1JLC A;  1VRT A;  3VQ7 A;  2X6S A;  4ICL A;  1EET A;  4FJI A;  1NJW A;  4M42 A;  2HVI A;  4DLG A;  2RN2 A;  1N6Q A;  4FJK A;  3C94 A;  1IH7 A;  4RG8 A;  3ZSZ A;  4KV8 A;  3OS0 A;  3THV A;  4KTW A;  1YTU A;  3S3M A;  2D0C A;  3CG7 A;  3HPO A;  4FK2 A;  3TAN A;  4CJU A;  4E1N A;  2R7Y A;  4AHU A;  3IG1 A;  5SZT A;  3AVH A;  1WAF A;  3F9K A;  3LP0 A;  5CYM A;  4OGE A;  4J2D A;  3VQB A;  2P1J A;  4DTS A;  1TVR A;  2DTU A;  4B9L A;  3KD5 E;  1FKP A;  2HNZ A;  2Y1J A;  4DSK A;  4CF2 A;  1JLQ A;  4B8A B;  3LAK A;  4KRE A;  4AIL C;  4B9M A;  3KKR A;  4CGJ A;  4DTP A;  3TAF A;  1QSY A;  2IAJ A;  3SI6 A;  2KZM A;  3H08 A;  4OGC A;  2O4I A;  3TAM A;  1QTM A;  4IG3 A;  4KHQ A;  1BIS A;  5C25 A;  2ATQ A;  1K6Y A;  2IDO A;  3ZT2 A;  4CFC A;  3HVT A;  4KB0 A;  2DY4 A;  4YNQ A;  1U4B A;  4O5B A;  3VA3 A;  4LH4 A;  3PO5 A;  5FDL A;  3HP6 A;  3OYE A;  4DSE A;  1F21 A;  4FJM A;  3CM6 A;  3ULD A;  2FBX A;  1S1X A;  1RT3 A;  5CZ1 A;  3JYT A;  2QXF A;  4LSN A;  3OYB A;  1DTQ A;  4R5P A;  3A2F A;  4CJW A;  2HHX A;  3VQD A;  4CED A;  2F96 A;  2BGG A;  1S1W A;  1IO2 A;  2X6N A;  1HYZ A;  3KLE A;  2D0B A;  3KK1 A;  4DTR A;  3KJV A;  1RDB A;  5HRN A;  3OYL A;  3RR7 A;  3LPT A;  1DLO A;  2B4J A;  4RW7 A;  2G8V A;  4IBN A;  3OS1 A;  3BGR A;  1L3U A;  4DWI A;  1RT4 A;  2ETJ A;  5J2M A;  1LAW A;  1XI1 A;  3SQ2 A;  3JSM A;  4JS4 A;  1JLF A;  2XO7 A;  4BE0 A;  3SQ1 A;  3RMA A;  2OPR A;  3U6F A;  3HPG A;  3L2U A;  4BDZ A;  2FBY A;  4PA1 A;  2Q3S A;  4O44 A;  3QEI A;  2HHU A;  1HJR A;  2YNF A;  1WLJ A;  4CJL A;  4DU1 A;  1QE1 A;  4DQR A;  3D45 A;  1D9F A;  3C95 A;  4O4G A;  3AVC A;  3CFP A;  3QEP A;  4AHC A;  4HUE A;  4KHU A;  1HQE A;  1QS4 A;  2FC0 A;  2VWJ A;  5J2P A;  2GUI A;  3KLH A;  2B6A A;  1RBT A;  1L3V A;  4BDP A;  5C24 A;  4Y1D A;  4RW9 A;  3U3G A;  2XRI A;  2KTQ A;  2E6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...