4YFUA

Crystal structure of open bacillus fragment dna polymerase bound to dna and dttp
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
578
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Closing Mechanism of DNA Polymerase I at Atomic Resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase
total genus 210
structure length 578
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4yfuA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yfuA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4yfuA01
3QNNA 1AROP 4O55A 1JL1A 5DMRA 4FJJA 1TVRA 3KK3A 4FM2A 1BCOA 2IC3A 2P5OA 3ZSOA 3C6UA 4OKEA 1RBVA 1S1WA 3NH0A 3T1AA 4K8ZA 1JLEA 1KVCA 2RPIA 4CF0A 3QINA 4FLUA 4R5PA 1RT5A 4ICLA 4LH5A 4H8KA 4NYNA 4O4GA 1MSWD 4CFAA 5C24A 3G10A 4DSLA 5HRNA 4RW4A 1RBUA 1G15A 5T7BA 4CJVA 3G0ZA 1L5UA 5CYQA 4CJKA 4DTOA 3TABA 3MECA 4CF8A 2NUBA 2PYJA 1H38A 2HHUA 3AVKA 4E7LA 1B9DA 4M3UA 4CEFA 4M3RA 2BGGA 1EETA 1KRPA 1SKRA 4CHOA 4E89A 5I42A 3QESA 4CCHA 3OYJA 3ZSZA 1BGXT 4CGJA 3PO4A 4O0IA 1MU2A 3C95A 5K14A 3L2QA 4W5RA 4DTUA 5J1EA 2YNGA 4WE1A 4B9SA 4NYFA 4AHCA 4C8MA 2Z1HA 4DQPA 1SL0A 4E0DA 1J53A 4CGDA 3V9WA 3LP1A 3LDSA 4ZTFA 4FK0A 3AO4A 1SL2A 1L3VA 2E6LA 1LWCA 4KB1A 4CK3A 2DY4A 3TWHA 4B08A 2HHWA 1TAUA 4DU3A 4DS5A 4FJIA 3SCXA 1UAXA 2Z1JA 4DQSA 4ID1A 4ZTJA 3AO1A 4M3WA 4M42A 1FXXA 2Z1GA 3NE6A 1X9WA 3SYZA 4F3OA 1C1AA 3S3MA 4FJNA 3TAPA 3ITHA 4DLGA 3NAEA 1VSDA 4PA1A 4OKJA 4E1NA 2XY7A 4AHVA 2WOMA 2VG7A 3JSMA 3V9UA 1KTQA 4BDZA 1EX4A 5CYMA 1TKDA 4HUEA 4Z4GA 5KTQA 4EP4A 1S9GA 4HUGA 2XY8A 4EZ9A 1N5YA 4FK2A 4KHWA 4Z4IA 1IKXA 4CHZA 4J2EA 4M3YA 2B6AA 2XRIA 2HNDA 3DOLA 1C1BA 3CM5A 1RTDA 3HT3A 4FM0A 4E19A 1S76D 2YKNA 3ZCMA 2YHBA 4DSIA 1QLNA 2P1JA 3OY9A 2D5RA 1IH7A 3AVNA 3L2UA 4N56A 3U6FA 3OYGA 1IKVA 4KTWA 1RT1A 1QSSA 1IKWA 1CZBA 3LP2A 4KV8A 1Q8IA 2IOCA 3AO2A 3K5MA 3CQ8A 3PX0A 4GVMA 2A1RA 3SUOA 3DLBA 1HYVA 1NJWA 2G8HA 4FK4A 1D8YA 3OYCA 3S3OA 3U3YA 3ZSWA 4DG1A 4KTQA 3I0RA 1S0VA 1HYZA 3SV3A 3HPGA 3RWUA 3KTQA 3E01A 3DLHA 3LP3A 4RW8A 2Z1IA 4OGEA 2B5JA 4DU4A 1VSFA 4JS5A 1J9AA 1RDDA 1YT3A 4RW9A 4AHSA 3OYLA 4CEZA 3DRRA 4ELVA 3KKRA 3SZ2A 3MXJA 4DQIA 1C6VA 2DFHA 1RTIA 4KAZA 4CFBA 1I3AA 3DRSA 1U49A 4Z4HA 1U48A 4DFMA 5HRSA 3QEWA 4CIFA 4FLZA 1KVBA 2LSNA 3DYAA 1RNHA 1EKEA 1ZBIA 1VSLA 1U4BA 3CFOA 4NCBA 3FFIA 4DFKA 1JLCA 1ZYQA 3K2PA 1VRUA 3VQBA 1FKPA 3U3GA 1NK4A 1RT6A 2G8IA 3D0PA 5CZ1A 3QEXA 5SWMA 4KREA 3V6DA 4B8AB 1T05A 4DTMA 1S1VA 3B6PA 1X9MA 3HYFA 3AA2A 4FJLA 3V1OA 3RMAA 3RR7A 3OYBA 3EYZA 2HHTA 1KLNA 1HNVA 3AVLA 1WSJA 2ITGA 1YTUA 2RN2A 4W5OA 3OS2A 4E7HA 3VQ8A 4W5NA 1HYSA 4DF4A 4FYDA 2BANA 5EU7A 4M3XA 5JS1A 4CESA 4ZHRA 4CJWA 1UOCA 5JS2A 1RT2A 2JLEA 3T19A 3HL8A 3KJVA 2QXFA 3ZSXA 4B9LA 4RG8A 4LSNA 1C1CA 3LZIA 1C0TA 1XI1A 4PQUA 4Q0BA 1TGOA 3VQPA 1RDCA 4BDYA 3SNNA 1RILA 4CIEA 2ETJA 3NF7A 1J5OA 4PUOA 2ZD1A 2HVHA 2YKMA 1NKEA 2FBYA 3TAFA 4B3OA 4OLBA 3ZT3A 3HP9A 2AJQA 1RT7A 1Q9YA 4HCBA 3VN5A 1RTHA 4C8NA 2P51A 2JGUA 2HHQA 4KTZA 1WNSA 2FBVA 4E7KA 4HVJA 4CEOA 2KZZA 2A1SA 3ALYA 1HJRA 1Y97A 3AVFA 3L3UA 4OVLA 3ULDA 3SPZA 5I3UA 1IG9A 1A5VA 3HXMA 4FJGA 3O3GA 3PX4A 5D3GA 3VQEA 1Z25A 1D9DA 3CFPA 5J2QA 1GOBA 4FZZA 4FXDA 1U47A 4DWIA 1S6QA 3I0SA 4LY7A 2XHBA 3AVCA 3L3VA 2YNFA 2ZQBA 4DSKA 2Y1IA 2HHSA 1NOZA 4DTPA 2B4JA 1VSHA 4KHSA 4AH9A 2DFEA 3O4NA 4CHQA 2X74A 4IFVA 3CM6A 3TAQA 3M8QA 4Y1CA 1U45A 3AVJA 3KKSA 4DU1A 4L8RB 1QHTA 4M45A 2QKBA 3ASMA 1CXQA 1EP4A 4DTJA 4ELUA 1TKZA 2PYLA 4MQ3A 4J2DA 4O44A 2KW4A 4Z4FA 3DM2A 1HRHA 1S6PA 3AVBA 3NH2A 2IGIA 3DLKA 2HHVA 1Q9XA 1LV5A 3BDPA 2G8VA 1GOAA 5C42A 4CJQA 1SL1A 4IG3A 4O0JA 4CJSA 4KPYA 4LH4A 3SQ2A 3JYTA 3SQ1A 4IG0A 1VSKA 2XO7A 4FJ7A 1CXUA 1BIUA 1KFSA 3PO5A 2FBXA 4KO0A 1U04A 3AVHA 1BQMA 1REVA 1BQNA 4CGHA 4EP5A 4E3SA 3RMDA 3ZT0A 3SPYA 4KI6A 3PV8A 4DQQA 1R0AA 4CJ4A 3QIPA 3HO1A 2E4LA 1QSLA 1JLAA 1DLOA 3KLHA 3K59A 4BE2A 3ZT2A 3LZJA 3KD1E 5KGWA 3DRPA 4DSJA 3AVIA 3VQ5A 3K58A 4YFUA 4CERA 3PY8A 1N6QA 1A5WA 3KD5E 1NKBA 5DK5A 3TI0A 1RTJA 3TR8A 1C0UA 3VQ6A 2KFZA 3OYAA 3L2RA 3NHGA 1B9FA 1WAFA 1CZ9A 3HJFA 3AA5X 4FW2A 4AHUA 4DS4A 1BCMA 1FK9A 4E7IA 4DTRA 3LANA 3B6OA 1J54A 2EHGA 3NF6A 1UA1A 4ID5A 3CYMA 4N47A 3D45A 5CY4A 3ZSYA 5J2NA 3SI6A 1WAJA 1XWLA 3DOKA 4CGFA 4PY5A 3HSTB 3QIOA 4KHNA 2G8UA 2F8SA 5HRPA 1BI4B 1XHXA 4C8LA 1QQCA 1JXEA 3OJUA 4B9VA 3ZT4A 3QO9A 4CFDA 3MXMA 5FRMA 4CF1A 4FM1A 2YNIA 3HPHA 3P5JA 5HRRA 3NF9A 3SUNA 4N41A 3SV4A 4JRQA 5KRTA 1LWEA 3S3NA 1ZBLA 3RMBA 4BWJA 3SQ0A 1T7PA 1CLQA 1TKTA 1W0HA 1D9FA 2XY6A 4HTUA 4CJEA 3H08A 3OYDA 3LWMA 1D5AA 3LWLA 2FBTA 1SKWA 4BE1A 1NKCA 3VQDA 2O4IA 4F2RA 1C0MA 1KSPA 3DLRA 3ZSRA 3OYFA 3VQQA 3C94A 4CJPA 2F96A 1RT3A 4YNQA 1LWFA 4NCGA 3UIQA 2QK9A 1IO2A 3SUPA 1LAWA 3VQ4A 3MXIA 2I5JA 2PI4A 5FDLA 2PI5A 3O3FA 2Y1JA 3LALA 4TSXA 3LAKA 1W9HA 1YTAA 4CEQA 4CJ3A 1T8EA 4JLHA 1QS4A 4CHPA 3OYKA 1S1TA 5J2MA 3HVTA 2X6NA 4FJHA 4CGGA 1B92A 2Q3SA 3BGRA 3VQAA 3AV9A 4FZYA 1FKOA 1QE1A 1S9EA 3WNFA 3NGZA 3K5LA 1WN7A 4CJTA 3DMJA 3LP0A 4IKFA 1KCFA 1TKXA 2HNZA 5J2PA 1QSYA 3AVMA 1JLFA 1TK0A 3NBPA 4FJKA 4Q5VA 1SKSA 1O1WA 2GUIA 3QEVA 3S9HA 1S1XA 4I9LA 3O3HA 4CEAA 3V9ZA 1TK5A 3KIOA 4O5BA 2GBZA 3TAEA 2PZSA 3F9KA 3HP6A 3IS9A 1NJZA 2OPSA 1NJXA 3V1RA 4FLVA 4DMNA 2KTQA 4OPJA 4OPKA 3KLIA 1ZBUA 4UQGA 2D0CA 3TANA 2RKIA 4H4MA 1IKYA 4LSLA 4CIGA 4CF2A 1XHZA 4DQRA 4Y1DA 1RBSA 4AHTA 1HQEA 1K6YA 1S1UA 3SQ4A 4F3TA 2OPQA 2E6MA 1ITGA 3VA3A 3QETA 1NK8A 3V1QA 1NJYA 4GW6A 2VG6A 2R7YA 3NF8A 4DFPA 2EX3A 2VWKA 2YV0X 4CE9A 4KHQA 5SZTA 1SV5A 3V81A 3WNGA 3KLGA 3OYNA 3A2FA 4CEBA 1KLMA 4I2PA 4IBNA 1F21A 3OS1A 4FZXC 2X78A 2PY5A 2HB5A 1WLJA 2O4GA 4OJRA 3DI6A 4CJLA 4DTXA 1VSIA 3NCIA 3RRHA 4RW6A 2HW3A 1HMVA 1JLGA 4DTNA 1NK5A 3V9XA 1VSMA 3K5NA 1ZBFA 4I7FA 3RR8A 3OS0A 2VG5A 2OYQA 3DLEA 2HHXA 4DSEA 3PUFA 1TL3A 4GMJB 3ISNC 2GV9A 5HLFA 5HROA 2BE2A 3OYHA 2KFNA 4CK2A 3L8BA 2RF2A 3K57A 4B9MA 4HUFA 2HMIA 2FC0A 1A5XA 2X6SA 2OPRA 3K5OA 4MFBA 1KVAA 2W42A 1NOYA 4KHUA 4IFYA 3ZT1A 4FW1A 4FLWA 4B9TA 3L2WA 2DFFA 4C8KA 2HNYA 1NK9A 4ELTA 1LAVA 5HBMA 5KI6A 1BHLA 1VK0A 4FJXA 1NK7A 1RDAA 1WSHA 4XIUA 5KGXA 1SUQA 4CHYA 4CGIA 3OYEA 2KZMA 4FVMA 4FJ5A 1BI4A 1HPZA 1JXBA 3OYIA 1BISA 4EZ6A 3M8SA 1RBTA 1UWBA 2OA8A 2XY5A 1VSEA 1DTQA 2KQ2A 2OPPA 3IG1A 3KK2A 2HVIA 3O4QA 1TAQA 1NK0A 4BWMA 3HPOA 4QAGA 3VQCA 3AA4A 4B8CA 3OYMA 3OJSA 4G1QA 3WNHA 3L2VA 3SJJA 4OGCA 4HCCA 4KRFA 3HK2A 4CF9A 4N76A 1X9SA 2IAJA 4DLEA 1EXQA 1TL1A 3QEIA 4H4OA 1XC9A 1I39A 4CJFA 3IAYA 2YHAA 5HP1A 1WSGA 4CEDA 1T03A 1S77D 4F8RA 3QEPA 4M3TA 1JLQA 1HQUA 1RCHA 3NFAA 4JRPA 4RW7A 4J2AA 4DSFA 1TK8A 2P5GA 4FJ8A 4FJ9A 2VWJA 4KHYA 1DTTA 1WSIA 4FLYA 1YVUA 1KFDA 4F2SA 3MEEA 3IRXA 4LD0A 3C6TA 3WNEA 3KLEA 2YNHA 1L3TA 4AILC 4OLAA 5FROA 4Z4CA 1RDBA 1BIZA 3QLHA 4CK1A 3OVNA 4I9QA 1JLBA 4W5QA 1CEZA 1ASUA 1HNIA 3MEDA 4FLTA 2OZSA 4BDPA 2BDPA 1JKHA 3SUQA 1WSFA 2D0BA 1ZBHA 4KI4A 3P1GA 3T3FA 3TARA 4QOZB 1S5JA 2ZE2A 3AO3A 3LPTA 3RRGA 1JL2A 3CG7A 3LPUA 3ZSVA 4E1MA 1VSJA 4M3ZA 2D0AA 1RBRA 4AHRA 4JS4A 1L3SA 3DLGA 3KK1A 5KRSA 3HM9A 3LAMA 2G8FA 3PX6A 3VA0A 3NGIA 4OKKA 3MEGA 3ZSQA 4F4KA 3I8DA 4CHNA 1BL3A 2DTUA 5C25A 4K8XA 4CECA 3QNOA 5FRNA 4DF8A 1LW2A 3AA3A 4IDKA 4C8OA 2ATQA 4CJ5A 3CFRA 1ASWA 1LW0A 3V4IA 1ASVA 4KKOA 1L3UA 1VRTA 3TAMA 4M41A 4NCAA 1QTMA 2WONA 4PWDA 4QCLA 1NK6A 2G8KA 1WSEA 4I2QA 3NDKA 3P83D 1Z26A 3EY1A 2F8TA 4DTSA 3M8PA 3TAGA 3RTVA 4B9UA 4CJRA 1RT4A 4BACA 3V9SA 1GOCA 1UA0A 2IDOA 2QKKA 4W5TA 4Z0UA 2G8WA 5E41A 1X1PA 2IS3A 4CEEA 4FCYA 2OZMA 3NH1A 4DFJA 3VQ7A 4FJMA 4Z4EA 3AO5A 3F73A 4KFBA 3THVA 4CJUA 3KLFA 3QERA 3RMCA 4E7JA 3M8RA 3EZ5A 4N5SA 4FLXA 4KB0A 4J2BA 1TV6A 3AVGA 3VQ9A 3MAQA 3HVRA 4HHTA 4BE0A 5CZ2A 3E2EA 3AVAA 4B9NA 4CFCA 3NGYA
chains in the Genus database with same CATH superfamily
3QNNA 3KJVB 1N5TA 3AB4B 5B09A 3J7ZO 3NH0A 4NRUA 3ATUA 3D66A 4ICLA 2F9TA 1G15A 2GO8A 5T7BA 2XWYA 1Q16B 5BR8J 3FZLA 4O0IA 4JI3J 3GYXB 2UU9F 4LFCK 1BQXA 3QO9B 2EW9A 4ZTJA 3AO1A 2QWQA 3NE6A 1PBUA 3FZFA 2I2YA 4CLLA 5F3TA 1VBXA 1GLDG 2FC8A 2NLWA 4CLKA 4DPXA 3R3LA 1LWEB 2HS4A 4MKAA 1SC4B 4L76A 1IKWA 1V6HA 3ZYYX 3AO2A 3A3NB 4I64A 5A2QO 2B6AB 2IIRA 1MMDA 1PO6A 2UUCK 3CCSS 2Z1IA 1WF2A 2ZM6F 2KLAA 1GLJO 4Q7AA 2RQCA 1JJ4A 3KG1A 5JMNA 3T1HJ 1C6VA 3JXUA 5HQMA 1RT6B 2CQGA 3FCWA 2MQQA 2FHJA 4WIIA 3W5XA 4PRFA 2YKQA 1AB8A 2QWMA 2DPNA 2FLLA 3MD1A 5KT2A 3ZZUA 3VETA 3H2VE 3CCVN 4PWUA 2DPJA 1E4FT 1PG5B 4ZCKA 3IXQA 4DUZF 1HNVA 4URGA 5FLXO 4WXWA 4QZVB 1O8BA 2QTDA 4W5OA 4DV3J 4LR7A 4M3XA 1UMJA 2IY5B 4MYUA 2MZ1A 1FX2A 1TGOA 1TL7A 3VQPA 4G9ZA 3FZBA 5EHHA 4J8FA 5ETSA 3Q24A 2VG6B 2Z30B 1T9UA 1PILA 3OXGA 2YX1A 1RT7B 1Z1ZA 2PFUA 2WONB 1S0OA 2PC6A 1NOZA 3ULEA 1OH5A 1MROA 1G99A 2JX2A 3KZBA 2HLUA 2KDOA 4IFVA 2OTJS 3TAQA 2D3ZA 3SCKE 2L9DA 3S8SA 4DTJA 1EP4A 1X7VA 4ELUA 1TKZA 5KFGA 3FGVA 4Q8FA 1XNQK 2LA6A 3RW6A 1VR6A 4O0JA 4USWA 2UYTA 3JYTA 3VGSA 4HHJA 1VSKA 3VEWA 5LSOA 2O8EB 2W41A 4LF5F 3T1HF 1F60B 2YNIB 3MM9B 1VQ5S 3EX7B 3H3OB 3ZX0A 4USMA 3UFCX 2UUWA 3VAIA 3OYAA 3VQ6A 4ECXA 2JEFA 3KKFA 4E7IA 4N47A 3R1LA 3GG1A 4CO4A 3HSTB 3NVKA 1VCTA 1N34K 3H7HB 2IVOA 4DR1F 3N9UC 1QUVA 1W0HA 4PG8A 2HQ3A 3H08A 4RWTA 5D0EA 3FBEA 1SKWA 4BE1A 3OYFA 3WXLA 2ZJQL 3UR3C 2PI4A 4TSXA 3CCEN 4LF2A 1JLAB 5I4MA 3NBPB 2RU3A 3R27A 3ILLA 1KD1O 1E4GT 3DMJA 4LF5K 4LSZB 4DUTA 2Y1LB 3OT9A 3NBPA 2HRTA 4F4ZA 1XN9A 3ZTRA 3MWBA 4C3MA 1OY6A 5AQSA 3CC7S 4M63A 3G71S 2QWOA 1G7CB 1HQEA 4F3TA 2HK2A 2VC1A 4L3QA 4DCOB 2OANA 3BJYA 3GQCA 3RG6A 1X4GA 5KT4A 1XMQK 2M0GB 2UVWA 4IBNA 5EWFA 4Q2LA 5F8NA 4JKAA 4IO9L 4M94A 4C1NK 3V9XA 1MWZA 2G0CA 1VSMA 5LL6Z 1I94J 1G3OA 1PYSB 1QM9A 1N5VA 3BSCA 3CJSA 1NHUA 4ZPAA 3J7A1 3LGNA 5CZXA 3HSJA 1UFLA 4H0XB 3P3DA 2RE2A 3CD5A 1SJ1A 3HCXA 4W98A 2UUAF 4FPBA 3OYIA 5ETTA 1QJHA 4USHA 1QVFR 3MOJB 2KQ2A 2H1YA 5D0RA 3HPOA 3AA4A 5I42B 4FF3A 2BVZA 5C42B 4C9DA 3UD3P 1PCAA 4A59A 4FF2A 1IM6A 5BJRA 2MZTA 3AHPA 3QEPA 3D4JA 2HAIA 2WAQD 3NAIA 1WSIA 2DPIA 1MDUB 4Z4CA 2IM3A 4W5QA 5HSPA 5KOXA 3SUQA 4KH1B 2RRNA 2PD1A 4E1MA 2MKKA 4ES1A 2M8HA 2IVYA 3KK1A 5AJ3F 3NS6A 5KFSA 2QEXS 3F41A 3ZSQA 4MH8A 1XC3A 4R0JA 4OX9F 4CJ5A 4C11A 2JWKA 3BZKA 4ZN1A 1FERA 4YOWA 4WWSA 3CJTA 4A8QA 3L6QA 2IDOA 3CMES 4OZ5A 2G8WA 3GL1A 1XMOJ 2AP6A 1T94A 2V69A 1Z4UA 1NGIA 4CFCA 2FYXA 2RB7A 3ZZYA 4FYXB 2QFIA 4FLUA 5C24A 5HRNA 4GKJK 5AT1B 1VQON 4E7LA 4LRDA 4WFAL 1RACB 3CCMS 4E89A 1K1QA 3I55S 3TRGA 3AOAA 4B9SA 5L9NA 3PRBA 3M8PB 1RI7A 6FDRA 1X31C 2E44A 4WFBQ 4MLEA 1M1KT 4RBVA 4V19X 2R42A 4A4JA 2PIIA 5AQKA 3PSFA 4Y2MA 2C3UA 2X1AA 1UAXA 2HNYB 4J9UE 4WFNL 3OTOK 2AYGA 2H4WB 4B1YB 2XY7A 3D6HB 4BDZA 2IRYA 4Z4GA 4EZ9A 3MPYA 4ETZA 1NBWA 3KWMA 4B3OB 1OWXA 4FM0A 1S76D 5D78A 5KT3A 1RABB 3AVNA 4BRNA 4ZVSB 2R2SA 4P75A 3LPYA 5DS7A 1Q8IA 2NQPA 4GVMA 5AXNA 3B8AX 3OYCA 1KS2A 3S3OA 3CSKA 4DG1A 1HHTP 1S0VA 3CJBA 1VSFA 1VHFA 4NYZA 5KFNA 3M5RA 1LK7A 2NXJA 2LLZA 5C2DA 2IHR1 3SEOA 5DQGA 1RNHA 1VSLA 4DJBA 4DFKA 3R6GB 3QEXA 3T69A 4FJLA 4LFAF 4H5WA 4NA3A 2ZH3A 2CDQA 1FEEA 3TSQA 4DF4A 4MMOA 1D8ZA 4GKJJ 4CJWA 1Y3KA 1HNZF 1RT2A 2J0SD 3TAMB 3HL8A 1ZM4A 1U1RA 4PQUA 4BDYA 3VF0B 4GC6A 3NF7A 4B3SF 4CZHA 1FHTA 1MN9A 1Q9YA 2VASA 2R8HA 2YHWA 3H20A 1EO1A 3K0SA 1RTHA 2MQMA 4FOIA 4JI2K 2W6LA 4HVJA 3L3UA 3ULDA 3PYEA 2P9GA 1XUPO 2BJ9A 3OTCA 5BXIA 2Y1IA 2GAHC 1VSHA 3U02A 2X74A 3M3ZA 3SBGA 3VEZA 5A2QU 1S9FA 3RAMA 2E66A 4L8RB 4LMZA 1QHTA 4ZPBA 4O44A 3R97A 3C6AA 3OUYA 2ATLA 4DR7K 3AVBA 4KHPF 5LSRA 4KPYA 4AM6A 3KG0A 2OH2A 4OYMA 2ZJPL 1NGGA 1NB2A 1PJ5A 1KQSM 1XQIA 3GIRA 4EP5A 3NMRA 4E3SA 3M7VA 4X4UA 1W2BM 3OTOF 3MMJA 3CWJA 1RYSA 5LMNJ 1KN6A 3NHGA 4ZP8A 3GJTB 2DR5A 5CYMB 3G8QA 3B6OA 1TL3B 1J54A 1I51B 5JMVA 2UUTA 3GIKA 4LF5J 4M5NA 2G8UA 2FD2A 3PM9A 2DJWA 4BVPA 4CFDA 3MM9A 3NF9A 4H0TB 1ZBLA 3H5XA 3LP1B 4P10A 1U6FA 4C0HA 3BGUA 2Q3PA 2F3JA 3OYDA 3O9TA 1HNWJ 3EPIA 5AE3A 2LA4A 5IT9U 2KJVA 4C8YA 2XYPB 1WF0A 2I5JA 4FXWA 2A18A 2Y1JA 3LAKA 1YTAA 4JI0K 1XR7A 2E1AA 2EWSA 2H3EB 2Q0RA 4UTGA 2CQBA 2QFJA 2ILYA 2E7WA 2OPQB 4ANDA 2GVDB 2ZZMA 4BG8A 1XMQJ 3Q8QB 3NOCA 1XBWA 4X65J 2CVIA 3F9KA 4B3SJ 1NJXA 4NYOA 2PEBA 2QV6A 5B0GA 4H4MA 1A9NB 4IOCL 4G1IA 5C15A 2NRWA 1QHAA 5A8KA 4RUHA 1RE1B 5EX3A 3WNGA 2EFOA 4RCHA 2K7KA 1TL7B 3KNAA 4QJVA 3B6BA 2VIHA 1AZSA 2L41A 1HW8A 4LFAJ 1KD1T 4MDBA 3K5NA 4TU9A 2QL5B 3ISNC 5ETVA 3OYHA 1RAFB 1Q78A 3RU0A 1FJ7A 1K73O 2P9SA 3CHWA 3CDEA 3AAQA 5HBMA 3RBZA 1VK0A 1Q1KA 1SQFA 2VQFF 1N56A 2KZMA 4Q43A 1BISA 4TLQA 2OA8A 3KHRA 2CH6A 2OPPA 4DHYA 3BSNA 3KLVA 4EBCA 3KVGA 1KAXA 3D1HA 4H0YB 3QEIA 3ETOA 4Y2IA 2E88A 2W4PA 4E8UA 4S0MA 2QRRA 1OH8A 1JLQA 2EK1A 2ZFHA 4TNOA 3TA1A 2P5GA 1TK8A 4FJ9A 1K47A 1N48A 2CQ4A 3KYLA 1WBBA 3MR3A 3M8YA 3CJRA 1L3TA 2UZAA 1BIZA 3EE9A 4XDCA 2F4VF 5AQFA 4AL5A 5AZIA 2V94A 2E5IA 3JSRA 2HZAA 1RWNB 2GWJA 2I0XA 1RUSA 2D0AA 2G8FA 5DM7Q 1FKAF 4BBYA 1VRQC 4DR6K 2FLOA 3CCUS 1J2VA 2H5JB 3ZZ0A 4QOTA 3MR7A 1VRTA 4EMDA 5DM7L 2AQ4A 4MAKA 2ZBIA 1S99A 3MCNA 4CM2A 2ZBPA 3IBWA 2JOQA 3GJRB 4JYAJ 3NNAA 4MKYA 4B3RF 1AZSB 4ICLB 2DTJA 1HBOB 1S0MA 5CXTA 2NXEA 1EQ0A 1WC0A 2UXCF 3AJ1A 1S1WB 2KXHA 5CA5A 3VHQA 4ZA1A 2WSFC 1FESA 3BDEA 1KEKA 4GNIA 4YDUC 2E1ZA 1BU6O 4H8KA 1RFQA 1JMTA 3G71N 2W24A 3KXDA 3WQPA 4TQSA 3TABA 1CVJA 1J5EJ 2AHOB 3IR7B 2BGGA 3SAHA 2R2TA 5I42A 4X62J 1HI0P 4HDGA 1LFPA 5AQGA 3C95A 4IH7A 4WE1A 4QW8A 4ZDNA 1B70B 3ZTSA 3GOIA 4KGXB 2DKOB 2AJ4A 4ZTFA 3AO4A 3C15B 3MCOA 4JV2A 3NGUA 1SUQB 2P9NB 3C0BA 4LR8A 1X5TA 2Z1JA 1KR4A 1EWRA 1V5VA 1CJTB 1VSDA 4XH5A 1YQHA 2NS1B 1R43A 1P8ZA 4JHDA 2OTLS 3SQOP 2B6AA 5KG0A 3CW2C 1X60A 5GAHU 4KKOB 3J7AP 2WVBA 4C0OC 4DPTA 3SUOA 4N7TA 2JSXA 3NY0A 1GMWA 4X4TA 3FSXA 2IM0A 3B4MA 5CYJA 4RW9A 2QGFB 4FVUA 1XQSC 5BPMA 2P9KB 1YJTA 1BC6A 4JUZA 1T9XA 3KK2B 1MW7A 3DN9A 4CBXA 1B0VA 3W8GA 3K2PA 1VRUA 1NRKA 2WBNA 1HBOA 1NPRA 2P9KA 1HUXA 4USTA 4P74A 4A46A 4M95A 3I5BA 3MDQA 2ZWPA 1MG7A 4ED7A 4A5AA 2HMIB 2HHTA 3BBFA 4LF6K 2CG4A 1WSJA 2ITGA 2AA4A 5DG7A 2BANA 3OBYA 4JV5K 2W2NP 2OP5A 3KJVA 1NB7A 1C1CA 2M88A 3LZIA 1GK8A 4CIEA 3JSYA 2WVCA 5JICA 1VFJA 3OVSA 3UDVA 2VWBA 4DU8A 2B7CB 2KT5A 3FFKB 3CDUA 1XR6A 1O5JA 3MI7X 5TKYA 2AZ3A 1S97A 1T3VA 3HXMA 5D3GA 1A5VA 4RUCA 3VQEA 2GUPA 3FBBA 2DR7A 4FYYB 5E3AA 1BG3A 3CC4N 2YNFA 2OGUA 3J7YU 2ZM6K 2F8EX 5T7LB 3Q8SB 2VBWA 1IVZA 3M8QA 4XO0A 2UVVA 1MU2B 2QKBA 4B1ZA 4QYRA 4QPXA 3BBBA 2KW4A 1IBMK 2ZVIA 1S6PA 3BEXA 2QWNA 3H0PA 3EPGA 2G8VA 3CCVS 1ZH5A 4I6MB 3MX5A 2HHHF 1FDBA 4ITSA 1CXUA 1KFSA 4Y2AA 1OSDA 1Q81O 1QAYA 1Y0HA 3C19A 3C65A 2A5XA 3ZT0A 4LRBA 3HO1A 4JI7F 5HMZA 3KMSA 3CCLS 5GMDA 3DRRB 3PY8A 2P9SB 3CJ9A 4DKWA 2Y0BB 2VONA 1HI8A 1RWXB 3TEHB 3SI6A 4YS2A 1TTHB 2GFFA 1T44A 4BREA 3NS5A 2D4WA 2B9XA 4NB4A 2Y3YA 3M9MB 2IM2A 1IR0A 1SB6A 4PPZA 3OXFA 2F7TA 2QA4G 4NASA 3Q8YA 5AQTA 1D9FA 1A0OB 3MHYA 3VQDA 3THPA 1DHMA 1EETB 2W2MP 1TYQB 1CULA 2HFSA 3EZOA 1IO2A 2HQFA 4CO3A 1IBKJ 4B3MF 3DU5A 4JLHA 4MKVA 3VWSA 2IDLA 2QIFA 4FJHA 3M2VB 2QM1A 5C5JA 3G86A 3LP0A 2RIJA 1FE0A 1TKXA 1PKUA 2BBEA 2EKYA 2GS8A 5J2PA 1JLFA 1U0HB 1W97L 1SKSA 2GUIA 3QEVA 2GX8A 4O4RA 4O5BA 1FFSB 2MKJA 2OPSA 3J7YP 1ZS6A 3RAXA 3HVWA 3SQ4A 1HI1A 1VK8A 4I0WA 3NF8A 4QIFA 3S6EA 5SZTA 1ZZFA 5M1NA 1SXLA 2UUBK 1SIZA 4LT6A 2V63A 3HDSA 4X84A 2F7VA 2CQ3A 2MGZB 2QWPA 4RBUA 4RTFD 3PRDA 1XNRF 2HHXA 4DSEA 2VB6A 2JLGA 4WP9A 2MKSA 3UD4P 4USJC 4JI6F 3UW1A 5IQ6A 1OPZA 3CI5A 4CYUB 3WX4A 2OFGX 3I5CA 1I5OB 3CTRA 1FWLA 1MA9B 4YB1P 2XHWA 2CPIA 1IJJA 3TZWA 3M1FA 5HOOA 2XSJA 5KFUA 2HVIA 1OH7A 2RU9A 1Q0NA 3R3TA 2E8AA 2N4DA 2E2OA 3VR1A 1Y11A 3IS9B 3IAYA 3MMBB 3IBCB 3DU6A 1S77D 5LMNK 4DSFA 4OPHA 1QUPA 4A62A 4DL2A 3IRXA 4DV2F 4X65F 2YNHA 2YQ0A 5FROA 3QLHA 3SJHA 1FNMA 2E2PA 1UAWA 3OVNA 3OFFA 5D4LA 5FDLB 2I5JB 2RSQA 3R5GA 2A40A 3RBEA 1L3SA 3H40A 4BRHA 4OYPA 4CHNA 2DTUA 4K8XA 2ZWHA 1LW2A 4DV6J 4ZMMA 2Z8QA 1F5AA 3HULA 4QR0A 1I94F 5DQIA 2HQCA 4OHVA 3PEHA 2BW2A 3F73A 3THVA 1YBAA 1FX4A 4EI2A 5M2UA 3EZ5A 3KDOA 2FF6A 4O55A 1ACMB 1SQEA 3CB4A 1NGCA 3ZSOA 1RBVA 4JN4A 4HI1A 4K8RA 3K9KA 2RPIA 3FBFA 1RHMB 1Y10A 4FS1A 1IQZA 2QMUB 1NDLA 2RQMA 2AF6A 3C46A 4CT8A 2QO3A 4M3UA 4M3RA 4F0HA 3D2EA 4DL3A 5HMXA 2VOOA 3PXGa 2QJ3A 3GIJA 2C2RA 2EFVA 2HHWA 1LW0B 1DZ5A 4ID1A 4DQSA 5B7WA 4AE5A 2P6SA 2NR0A 2VOPA 3V6JA 4FJNA 1MWYA 3UI3A 3ITHA 4BR2A 3NAEA 3R5AA 4LC9B 3JSMA 4IOCQ 3V9UA 1VQ9S 5EVZA 5KTQA 2VL1A 1F5CA 4K2XA 4QWDA 5GAGU 1KP6A 1C1BA 3KHYA 4H4KC 4K50A 4H5TA 2Y9HA 3GV5B 1EWQA 2J0QD 3VGTA 3T5LA 3P39A 1IG8A 3SFUA 2K8GA 3QATA 4YOYA 5M1OA 3LP2A 1HW9A 3LTOA 2UXBK 2ZJRL 4ZHRB 4A61A 4Y2CA 1D8YA 2F4VJ 2KKHA 4FPIA 4JP8A 3VVUA 2QL9B 3HPGA 2NUUG 2NNWA 1ZA1B 3BBCA 4RW8A 1YRXA 5EDWA 5HVFA 3DM2B 4X4SA 4A2AA 5C24B 4KAZA 1W7AA 2U1AA 4LF6J 3D0HE 4OYIA 4WTYA 3NGKA 3VQBA 2RQKA 2BUPA 2G8IA 3PW2A 2AP1A 5SWMA 1RLDA 1V5IB 2UU9J 2HS3A 3V1OA 3D6RA 2Q1NA 2XNQA 3EYZA 2K06A 4X4QA 1WG4A 2LVWA 2FVQA 2V8VA 2OTJN 2FVSA 4B3RJ 2JLEA 5E7OB 1RKJA 1NZ8A 3HI0A 4BR5A 2V4JA 4IOAL 3OXLA 4B3OA 1RT7A 1QZ5A 4BGAA 3D9BA 2HHQA 5EGYA 3OSPA 5BRDA 3BM7A 3DRPB 4LF8F 1FJGJ 3I4PA 3I31A 4C97A 1RHQB 2CPDA 3WZ0A 2K2PA 4L74A 2NXUA 2UU9K 2B4OA 4KH4A 3CJ2A 3DM2A 4HKQA 1S10A 5DM6L 2WZ1A 3E9OA 3BUZB 5KFFA 3UNYA 5C7PA 2UUCJ 2NXNA 1NG9A 1DTQB 5L39A 1F3FA 3TO8A 4D3HA 4CGHA 5DM6Q 3P31A 2HKEA 4C48A 3KK3B 4X64F 4WFNQ 1QSLA 2K7JA 3KLHA 2F9WA 2WBMA 3G82B 3ZT2A 1NKBA 2J7WA 3W61A 2F40A 1WAFA 3AA5X 3G9CA 1OY9A 3WHIA 1LK5A 4DTRA 4P9SA 5D4OA 1ZM2A 5D15A 3O9QA 2W2PP 2ASYA 4JI8F 4QW9A 4FM1A 3UE2A 1FVQA 1YX2A 2X7IA 2CGLA 2WVDA 2R7TA 3A5LC 4A47A 1X5SA 1NJIO 1D5AA 1S9GB 1OPIA 4FKXA 4MTPA 4ZIVA 4LF9F 4WK1A 3CJAA 3EKUA 1LWFA 4B1XB 2YKPA 1F2HA 1JLGB 3GV8B 1PBAA 3FCHA 1YITN 8ATCB 1N54B 3HFVA 5KFJA 3E1YA 4ZVPB 4LF7K 4PL7A 1T9YA 4DZ6A 1D0EA 3R6MA 1TK0A 4Q5VA 4OJGA 4U9RA 4G6VB 4NA1A 2DNKA 3HSDA 1BUPA 3Q22A 2RKIA 3N6NA 2RRAA 4C0BA 2OPQA 1SIWB 3VA3A 3FEXB 4GW6A 4UUXA 2R7YA 2ACYA 1U1MA 3KLGA 4I2PA 3H1VX 2AMCB 4KB7A 2ILZA 4CJLA 2KFYA 1BA0A 5J2QB 3OS0A 4DB3A 1VQ4N 3VAFA 3DFEA 4LFCJ 2WB4A 1VQKS 3TTCA 3Q0AA 3TTDA 3MAHA 2OPRA 4MFBA 5BN8A 3O8WA 3P45B 4U67Q 5KFCA 1ZM9A 1DURA 1DAXA 2DNNA 3QLHB 1SUQA 3EGZA 4A8OA 4DV0F 4RU2A 4PABA 4F4XA 3IG1A 4F04B 1UEUA 4U95A 5IQQA 2R8IA 3GILA 4OGCA 4CBWA 2Y1RI 1EXQA 4CJFA 3PTWA 2V68A 3MUMP 4JK8A 1WSGA 3ENWA 5B0EA 3ENVA 2H3GX 4I4BA 4YB5A 4A8FA 3AB2B 3EEQA 3CCES 3VEOA 2E5HA 4KV8B 2D41A 3PIPQ 1MROB 2Q6BA 1XMOF 3QWPA 2VJUA 3I0SB 2OD6A 2CPZA 2HBJA 3EKSA 2VKRA 3P1GA 1KOHA 4RUAA 4G1QB 4EK2A 5KFPA 4CTAB 2XMUA 1CJKA 4WBFA 2CQIA 3CFRA 1ASWA 3OVBA 4RX6A 2I8EA 2G1HA 3QJJA 1L3UA 2FGOA 1QTMA 2G8KA 3NDKA 2WRMA 3M8PA 3RTVA 5I3UB 5KFKA 1O51A 1VQ7N 3HZEA 4DFJA 1TFYA 4AYBD 4KFBA 4M5KA 4UZBA 3V6KA 4A5BA 4J2BA 2VUGA 3MCSA 2B4PA 4BCAA 3EVOA 3ENOA 2LQ8A 4BE0A 2XZDB 3KK3A 3QBCA 2M8DB 4WZQA 1Q82O 1YBTA 5CYQA 2HHUA 3NWRA 1EETA 1QD1A 3M6GA 1SKRA 2K1RB 3IP0A 2VQEJ 2A41A 5A0YA 3L2QA 4NYFA 2Z1HA 4PG7A 4P6QA 5K8NA 2HURA 4DS5A 2DH8A 5FLXY 1GQEA 4F3OA 3BY5A 4NLYA 4GKKK 2QLXA 2QT7A 1TYQA 4FF4A 1U24A 3TVKA 4OQJA 2CPEA 1IKXA 4DV5F 2HVDA 4K4YA 2HGLA 4E19A 3CQXA 3U6FA 5BPNA 3OYGA 4LF1A 3POTB 4HH0A 3LPEA 1NNEA 4KO0B 2GIQA 6AT1B 3AY9A 3CJ4A 4H4MB 4X64J 4BQZA 3DRRA 4DR3J 3FZMA 2DFHA 1ZXOA 3ZEUB 4BRGA 3PW7A 4FLZA 1EKEA 1RWPB 2E1MC 3OTEA 1ZYQA 1OVYA 3GSDA 5KOWA 2UUAJ 3FNNA 4GO5X 2XZWA 2O1PA 4NCGB 3L95X 2J5AA 3KWIA 4FYDA 2P9PB 2VFTA 4ZHRA 3I56S 4QS8A 2YVSA 4BQLA 2O8BA 1UEVA 1RDCA 4M5MA 2B51A 3PKYA 3HP9A 2AJQA 2AGQA 3CCQN 1JWWA 2JGUA 2ROEA 5K9FA 5LJVA 5I3UA 3P6YC 2FJBB 2XMJA 1Q5VA 2HG4A 5DZ7A 4E98A 4N77A 2J6TA 2XI2A 2ZQBA 5LSLA 4HHUA 1I94K 1KLMB 1JB0C 3TR5A 5CE3A 4PYDA 4M8LA 3SMZA 3P4UB 3BPDA 3HFZB 4USVA 2ZZNA 3H59A 3BF1A 3JSBA 1MN7A 2QI2A 1YVFA 3Q8PB 4M63C 3LDNA 2C3PA 1GOAA 5A8WA 2IBKA 4LH4A 3HRGA 2XO7A 3GONA 1HBMA 1HKAA 1SQGA 2HGNA 2XCAA 3PV8A 1EKRA 2HFNA 3TU5A 4USKA 1TP7A 3PSIA 4C6AA 2DH7A 3PVXA 5EOYA 3L2RA 2HBRB 2NZTA 5HLFB 4K4UA 1HWLA 4M7XA 4J9QA 4JRQA 3C15A 3C14A 3IWNC 3RMBA 2JRSA 1BQMB 3H25A 5F9NA 3TSUA 4LFAK 4JHDB 5EX0A 2FZCB 4NMLA 3VQQA 3UIQA 2QW9A 5JVGL 1DQAA 1TUVA 2HF4A 5HAOA 4BHQA 1QS4A 2Q3SA 3CULA 3AFGA 1Q53A 1Y9OA 3V5RA 2G2OA 3VCDA 3LL3A 2MZRA 4Y0FA 3TOQA 1KCFA 4IKFA 5AQIA 1UEKA 5JXSA 2H4YB 2B8QA 3NRBA 1SBRA 3V1RA 1ZBUA 2HSTA 3GLJA 3U7JA 2DD8S 3N01A 4GO7X 3KHHA 4N8NA 2HWIA 2EX3A 1SV5A 3KG4A 3GJSB 3KJNB 4OI4A 3QPIA 2HQDA 2HB5A 2O4GA 2E2NA 2DNMA 3ATVA 4IJAA 3OA9A 4L73A 2BE2A 3E8OA 2DCLA 2C3MA 4PHTX 1SH0A 3J81O 2XTJP 1T05B 2B4VA 4KRWA 3TUPA 2XGQA 3GE1A 2L9WA 1RBTA 3M8SA 2CA9A 2PA3A 3W2WA 2RNEA 3SJJA 3OJSA 5AXKA 3HK2A 3OHRA 3CEDA 1HHSA 2WMMA 2VBZA 4O3PA 3O9RA 1P1TA 4DPUA 2B5JB 2C2EA 3C7NA 3PW0A 5B0BA 4M3TA 1RCHA 4RW7A 1DJ0A 1BUXA 1EX8A 3LP0B 3C6TA 2IVFB 2YQ3A 4OLAA 2HWHA 1WEZA 3M6XA 1HJOA 3MEDA 3ZEUA 3SQGB 4BDPA 3TQEA 4QOZB 2B3TB 1VSJA 4AHRA 1HFEL 4YDXA 3DXMA 2JZ5A 4B3MJ 1RA7A 4LIRA 1ITPA 2CPJA 1YHQN 4F4KA 4EO6A 3QNWB 4CECA 3UN5A 4QIGA 2Z2YB 1VQ7S 1J5OB 1YJ9S 2L08A 4C11B 1ZM3A 4I2QA 5AQNA 2PDAA 2MKIA 3P83D 4B9UA 3HHKA 1RT4A 2WW4A 1VQPS 2I6WA 1X4FA 4JB8B 3THXA 3UKUA 1YHQS 4R0EA 3P49B 2V4JB 3AVAA 4B9NA 1HNXJ 2FJEB 3FEYB 2EG2A 2LU1A 2V2QA 1HPMA 3PEJA 2KXNB 1RT5A 1MSWD 5IC4B 4CJKA 1RJJA 4OYXA 2W9CB 1WTFA 2MQNA 4OZNA 4LF6F 2QA4S 4W5RA 4O8UA 4ED6A 1M5PC 3O1LA 1SL0A 1J53A 4BC7A 1YTYA 2ZDOA 4FJIA 4JKHA 1GAOA 1F9FA 4QIEA 4M5IA 5CYMA 2EXUA 4O3RA 1NWKA 4Z4IA 4J2EA 2XRIA 2ROPA 2A0FB 4W4MA 4PAAA 3K17A 1FWKA 5AQLA 5TKWA 3PG9A 2N7CA 4DQ8A 2CPHA 4FZVA 4ZJOA 2DISA 4JV5F 2RKIB 3C66A 3SSRA 1WOQA 4OGEA 1NNDA 4JS5A 2LQBA 4KHMA 1PYTA 4AHSA 3I9V9 2WW8A 1RTIA 4HACA 4Z4HA 2DHGA 3CD6S 3RUBL 2FUG9 3JTOA 5DLFA 2H54B 4ZLJA 4ES2A 5CZ1A 3BQ2A 2XQCA 4CYUA 4ZPVR 2WK4A 2UXDF 3RMAA 1LWFB 2GW8A 4DOZA 3IM9A 2VPZB 2XLJA 2D0PA 2RQ4A 2GX9A 2MQLA 1FXLA 2VFRA 3T19A 4QBUA 4O3QA 1C0TA 1RDWX 2LXIA 2HVHA 1NKEA 1R6VA 2H51B 2UXCK 3VGKA 3JAMU 4BC3A 3VN5A 3VENA 3LM2A 1BHNA 5IWAJ 5F9LA 4NE9C 1WEXA 2XYHB 3W3SA 4B3RK 2GGPB 2QYCA 1LXNA 4IDKB 4BRLA 2B4UA 1ZTWA 4CNZA 1U45A 3E3XA 4DU1A 1WOSA 5E84A 4IG0B 4MQ3A 3HFKA 2CDRB 2OIHA 4BC2A 2ZE2B 5CHCB 1KBRA 2HHVA 4DR6F 1LV5A 4TYBA 2BRLA 1OO0B 2ZJPQ 2ZGZA 4ER8A 1NAQA 2XMMA 2NRVA 4KY3A 4KO0A 1WELA 4FWPA 4KT0C 4NWBA 4EWTA 3MEEB 1F9EB 3SPYA 1KNZA 2KKZA 3CD7A 4GVEA 2M5YA 5AQJA 1NZAA 2MYFA 3TR8A 5AXMA 4PKGA 2ASLA 4ZVRB 3BO4A 2CJ9A 3M1VB 5L46A 3M1VA 2IYIA 1UA1A 5CY4A 2BUNA 3DOKA 1XMBA 4CGFA 2YQ1A 1HMVB 4B3TJ 4HH1A 4C8LA 1TUYA 1P6TA 4A48A 1BMQB 3BN4A 3HPHA 2XSFA 1NXIA 1PAUB 2JJ4D 3DGPB 2XY6A 4DUZK 4CJEA 2VQFK 5GIPA 3I32A 4OV6A 2DCUB 2PT0A 4ANCA 4F2RA 1C0MA 3ZSRA 1KONA 1LAWA 1VQOS 4FBUA 3WEEA 1NU0A 3CO9A 4PKDB 3BKFA 4CJ3A 2E29A 4NLWA 3W63A 4F0MA 2NRXA 1S1TA 2X6NA 2LQJA 3BR8A 1JLEB 1ILYA 3WQUA 3G6EN 3W0LA 5J1EB 1NSQA 4F9OA 3M6WA 2BE7D 1OSCA 5MLCV 3O4WA 1UWAA 2K3IA 2PZSA 3CJ0A 2OPSB 3OFEA 1NJZA 1AYEA 1C4CA 4OPKA 1VQ8S 4RW8B 4YR0A 4CF2A 2AU0A 1HLUA 1ITGA 1H74A 1NK8A 2VF3A 2GJFA 2VWKA 1Q8KA 3LP2B 2HIYA 3OS1A 3IGNA 5DGAA 3L09A 4DTNA 5KFBA 5HJYA 3MN6A 3DLEA 3DJCA 2GO9A 2MXYA 2X6SA 3R9LA 5JJBA 3BF3A 3A13A 4B9TA 2ZD1B 3NS7B 3NVMA 3F0NA 4ZK7M 3SDEA 2AYEA 3JS9A 3IWLA 2F8HA 2IFXA 3AY0A 3HHLB 3V4MA 2BW7A 3HX9A 2RVJA 4GVLA 5KFEA 4ZIWA 4YOEA 4M5DA 2OSQA 4WFBL 1NU4A 5IT0A 3G6ES 1NLVA 5HP1A 3N28A 2L9NA 1MLAA 3U1LA 5HMWA 3MEEA 2DITA 1HBUA 2DXDA 3WDOA 4CK1A 4FF1A 4OX8A 4DV1F 1JKHA 4M5JA 4X66K 2HQIA 4IJNA 2YKAA 4JI0F 2R3VA 2Q43A 4JS4A 4XTTA 3LAMA 5ETOA 5FJ4A 4KHPK 3QBWA 4IDKA 2P9NA 3ZFVA 2K3KA 1EIYB 2XB2D 1VLYA 4ILHA 2H9ZA 1DY3A 4OZ1A 3CJ1A 2W7OA 4RU9A 4EBEA 3QFWA 4JYAK 1OY8A 4O3SA 3AVGA 2BKNA 3E2EA 2KO1A 2V34A 5LY3A 2HVZA 1S1WA 4NX9A 2KU7A 4MIWA 1XNRJ 4JI3K 3ET6B 3IM8A 5IFMA 2W2QP 1MWMA 2KRRA 3G10A 4NZ0A 4KBIA 4H5NA 4CHOA 3P4IA 3ET6A 3CIPA 1LQ9A 2HBKA 2UXDJ 1RK8A 5KFYA 3TWHA 2G0JA 4KH6A 4M3WA 1S6QB 1YLXA 3H46O 2Z1GA 2NSCA 2LEAA 4BS2A 3LH2S 4EYIB 4PA1A 1U1QA 1WWHA 1KTQA 4WIQA 1BA1A 4M3YA 3LDPA 2I7PA 3DOMB 2ADBA 3CM5A 2FJWA 2HSEB 3OY9A 5H9EJ 1F2GA 4N56A 2R8JA 4BRQA 3TWZA 3M2UA 1CC7A 1QY7A 4UOFA 3NOGA 3GU0A 4YY3J 2ZJRQ 2DIVA 2G8HA 5DDRC 2D3O1 2RE1A 3PNIA 3Q8UA 4O3NA 4J9VA 2B5JA 3FRYA 1J9AA 3ZETA 4PYAA 4K43A 4DCPB 1GLCG 2VH7A 4EYHB 3MXJA 3K7RA 2BACA 4K4WA 1RAOA 1EP4B 1U49A 4ZP9A 2WC9A 4FWOA 3VPZA 2EVZA 4QIWD 2IMOA 1M90T 4B8AB 5HBMB 2X1GA 4CO0A 1R8CA 2NRRA 4LQ9A 2IAJB 2XULA 4Y65A 1KLNA 4O8KA 2KXFA 1JJ2R 1FRIA 3BZQA 3VAGA 4K0KK 1UOCA 1YJWN 2VODA 4OLOA 2C1EB 3EE8A 3ULEB 1WC6A 4DPYA 4Q0BA 4CH0S 3OSNA 1RILA 2XMTA 2ETJA 4PUOA 5GAEP 4WTOB 3GTYX 5KFQA 2BM0A 4PKIA 2XM3A 4NLVA 2A1SA 3ALYA 1WHYA 3PZPA 4FO0A 3DC2A 4DV1K 3AVCA 4CO2A 3I55N 2DFEA 5HK4A 1BQNB 2HBLA 1H3DA 4NA2A 4NLRA 5HJXA 4OX9K 1S5ZA 4Y3CA 3U1NA 1TL1B 2AW0A 2GHVC 4G65A 4QU7A 2FBXA 3MUTP 1S4FA 4LF8K 1TVRB 2AEJA 3QRQA 4B1VA 1Q5YA 3A5MC 3C7NB 1N6QA 3GFXA 4OYAA 5KAKA 5DK5A 2DGTA 2AIRB 1UP1A 3W9IA 1FD8A 4NLGA 1FK9B 1BCMA 3D6MB 1T3NA 3O3LA 2EHGA 3EICA 2OO4A 3IBFB 1RWVB 2HS0A 1QDUB 2ZDPA 1JXEA 4B9VA 4IO9Q 4BRFA 1C1CB 2BJ7A 3CO0P 1LWEA 2OKQA 4HTUA 1W2BR 2B9WA 3DLRA 1N32J 4CJPA 2AGPA 1KQKA 2QK9A 2J6SA 4MLHA 1T0TV 1WHWA 4OYBA 4X62F 2MY8A 2BABA 1VRUB 2W7AA 1KVKA 3BO2A 3WNFA 4B1WB 2F63A 4LF4F 2O8FB 2QXLA 5U47A 1RDRA 1CQMA 4TXSA 2VBYA 4I6MA 3TAEA 1OYEA 2CWXA 2LDYA 1D9AA 3KLIA 3T1YJ 4USUA 3O5BA 4NZ7A 2E6MA 1F3VA 3LGHA 5KT7A 4F36A 1WKJA 3ILOA 4ZCIA 1FNOA 3UVJB 4NLPA 4JV5J 4CEBA 1F21A 1MMNA 1N33J 2VFUA 4B1UB 4PQAA 4Y00A 4M5LA 1FFWB 2KFNA 2FLNA 1K8AT 1YKWA 2DGSA 1HL6A 4HVZA 2P9UB 2EC2A 1NOYA 3CJ8A 4FLWA 1SCJB 4CLYA 5KI6A 3CJQA 1FRJA 3W5YA 1H72C 3W7BA 4X66J 2VA2A 1N52B 3PJ9A 1S72S 3CC7N 5C2GA 2O8CA 2RJZA 1WUUA 1S1UB 4L3NA 4HCCA 1QAXA 2RMLA 1Z2LA 1Q8BA 1FRKA 5AQQA 2CJBA 1AFJA 1DT9A 3UN2A 2BOPA 2ASPA 2P9CA 3NFAA 3TA2A 5RUBA 1KTVA 4Q44A 2DVIA 2VWJA 2P5VA 1KFDA 4DL4A 3KLEA 2PE8A 4DR4J 3NMAA 1JLBA 2JHEA 4IG3B 1U7LA 2C2KB 3GIMA 3W65A 1BE4A 2ZBRA 3D0GE 3WX8A 1FDDA 1L3KA 4YQWA 1VQKN 3FBCA 2VQFJ 3I0RB 2GZOA 1M0SA 4JI8J 4XAKA 2MZSA 5C25A 4IOAQ 3T1YF 3QAUA 4I69A 1M1KO 2GAGC 2YBVA 2F1FA 4JNEA 1V9OA 3SLCA 4M41A 2OAUA 1YXQA 3L4BC 1BWEA 1WSEA 4DV3K 1UA0A 2RF2B 4CZCA 2QKKA 4Z0UA 2D3OR 4FJMA 3VQ7A 4H0OA 4Z4EA 4X4PA 4AF1A 2MB0B 2UXDK 3SI8A 3KLFA 1SJ3P 5CYQB 1U2RA 1TV6A 3R2DJ 3HKWA 1G1XA 2KYXA 1IM4A 1RAEB 1TVRA 3BYRA 1BCOA 4LBIA 1JLEA 3QINA 4FN5A 1UVNA 5AQZA 3UKRB 1RBUA 4CJVA 4CZFA 2NUBA 3AVKA 2Z56B 4NI2B 2DBBA 2ATCB 2RUGA 2W6KA 3HBTA 1M5SA 1E6VA 1XNQF 3Q86A 1XTZA 4YR2A 4JI3F 2YNGA 3AODA 4JKFA 2FQQB 1UVJA 2X3DA 3QT7A 3CCRS 1U8WA 4M42A 2YPYA 2YPZA 3IAS9 2Q66A 3L0QA 4Z94A 2HNDB 3EL2A 2FGCA 3KK1B 4LF7F 3TVZA 2FXUA 4JKBA 2HNDA 2WSEC 1NEEA 2MQ8A 3CCLN 3CGIA 2WHOA 3L2UA 1QSSA 4I6YA 2C22A 2BE9B 5LOQA 1VGYA 4XDDA 8AT1B 4KQZA 2DXFA 3PIOQ 1CSJA 2I1RA 3NAHA 3JAMY 4KTQA 2Q1LA 2EPIA 1E6VB 1QQNA 1J5EK 3WQTA 3N0VA 3R6LB 2D9PA 1VMBA 1S6PB 1RTZA 1VK3A 4F3QA 4WCEQ 2ZITA 1FXRA 4FWLA 2GHPA 5HQ8A 2JVRA 4NXMJ 4J9NA 4OHXA 1ZBIA 5ETPA 1U4BA 4DV4J 1R8BA 3U3GA 1NK4A 1PSDA 3ZX2A 3DRYA 2LP4A 5AQWA 3MPWA 1U2CA 5D3GB 2HRYA 3RR7A 1YI2S 3PACA 3W3DA 2CPFA 5ELZA 4Q8EA 5C12A 4IYQA 1X3NA 4W5NA 3VQ8A 2PSZA 5JS1A 4LJMA 1UZHA 2HQGA 2QXFA 2FVPA 4DPOA 1OIAA 3QGIA 3ZNUA 1XI1A 5IZHA 1S0NA 3A3OB 4TY8B 3JQJA 4DN9A 3VGMA 3BQ0A 4F50A 1BWFO 2HIQA 5HI7A 2P51A 2H48B 1WNSA 1AT1B 2J9CA 1Q7LB 3GG0A 3QT8A 2KZZA 4AD6A 3ITHB 3PX4A 1HWIA 2UVRA 2CJKA 4RW6B 4CJ7A 4LY7A 4ZJLA 4JI4F 4BR0A 2DIUA 1H7XA 4U8YA 4HT5A 1IR1A 2B8PA 2XG8A 3K9JA 1S4EA 1Q86O 5A8KB 4CD1A 4HACB 3N4QA 4JI5F 3QAEA 2PO4A 4XPCA 3US5A 4YHHJ 3QMLA 4ED5A 2ASOA 4CJQA 1SL1A 4K4ZA 4IQMA 3FQKA 4FJ7A 3IG1B 2HGMA 1VC5A 4DUYJ 4KH0B 3W62A 2J0XA 4KI6A 3I9ZA 3T6BA 1IKVB 1H1VA 1S6OA 3MR2A 4YY3F 4Y2KA 3ISZA 2A6AA 2P9UA 1RHRB 2OPRB 4MFBB 3TI0A 1N5YB 1B9FA 2UXBJ 1BLUA 4UZCA 3CUNA 2ZUGA 4J9MA 3OR2B 3F44A 3KFWX 1HPZB 5GADP 3F9MA 3W64A 4FDFA 4XH1A 3RRKA 3M2UB 3MXMA 3QIPB 3O8MA 4NLDA 1LW2B 2IJRA 3SQ0A 2Z4PA 4ECTA 1B0TA 3GIIA 1N36F 3L7OA 5HROB 2IRUA 3SCLE 1VLOA 2AZ1A 2O66A 4WJBA 2YJEA 5IT9O 3DDIA 3VQ4A 3LALA 4CHPA 1EKSA 2DO4A 2JDJA 1DQ9A 3TZYA 1Z6RA 3DXKB 3MN9A 2ERRA 4FJKA 3E66A 2V7ZA 4O23A 2L48A 3NKYA 3KK7A 5L9XA 3SSQA 1UVLA 3THXB 1VISA 5K8OA 4UQGA 1XHZA 2FHJD 3MK6A 2PMHA 3M6VA 4FS2A 1RWWB 1UPPA 1NGJA 1RT4B 4ED0A 2E5LF 4V1Ak 4YHHK 2FHKA 4CE9A 3JTPA 2QMXA 3OYNA 1KLMA 4FZXC 3OBIA 4RW6A 2HW3A 1JLGA 2N3LA 4FPAA 5AQPA 2W4DA 2CVEA 2BX6A 5IV3A 2C42A 4IKAA 1RTHB 1UVIA 1R3NA 1JK9B 4ANEA 1QAIA 1A5XA 3EZWA 4LF9K 3DXSX 4B3TF 2IBOA 1NK7A 2JFDA 3BYPA 4WXOA 3A8YA 3MD3A 1WBDA 5ETNA 1UWBA 2DHXA 2XY5A 1WKKA 4A2BA 4CVNE 4YB6A 2ZJQQ 3WNHA 4ECQA 5CABA 3CMAN 1TL1A 4EEYA 3OL7A 2BQRA 1LOTB 4IO1A 4Z2XA 1HQUA 2ZNZA 1GH8A 3J81j 3M4XA 2VHGA 2MZJA 2QLWA 2FC9A 4DR5K 3A3PB 3QFHA 3BGRB 1RDBA 4C98A 3H5YA 1S79A 4DR4K 2YCHA 5KFTA 3MUVP 1D3WA 1KOOA 3CG7A 4QWBA 3Q2SC 4RWWA 4ZVUB 4CH1A 3DGPA 3RGIA 3PLAA 1SH2A 4CH7A 2CJAA 4H54A 2E9RX 1ASVA 1M90O 3G8TA 3IO1A 2YTCA 4KPCA 3O2IA 4UF4A 4JEPA 2DR8A 1H6KX 4OJ3A 1Z2ZA 2GVZB 3DLGB 1VQ5N 4FCYA 4OYZA 1CG2A 1FDNA 2B0GA 4O0NA 4PWWA 3VQ9A 3HHNB 3L8BA 4JI6K 3VTHA 4P71A 3V81B 3SBTA 2FSKA 4LF9J 4J91A 4K8ZA 7FDRA 1WDTA 2R7UA 2V2VA 5JLFA 4M5GA 2DEJA 5E5NA 3L4QA 2GIFA 2N3OA 5H9FK 3MM6B 4CGJA 1MU2A 3QRPA 4AHCA 5A8RB 5CZVA 3VVTA 1OQ6A 4E0DA 2IJFA 1ZTTA 1L3VA 4DR7J 2AV5A 3PIPL 1JJCB 2F5GA 1LNQA 3UD5A 3FE1A 4MYTA 1RZMA 2FHOB 4DLGA 1X4AA 3VEVA 4PG4A 1VQMS 2KM8B 2D1CA 4BRAA 3JSMB 1GLLO 1HD0A 3AXMA 1N5YA 3C2PA 5J1NA 3TEGA 4B3MK 2P1JA 2XZTB 1FA0A 1CZBA 4RNMA 2VD3A 1CJKB 5E3QA 2A1RA 3KTQA 4WU3A 3DLHA 2CZVC 1OJ4A 5SUHA 3E51A 3KKRA 4EBDA 4RBTA 4Y28C 4CFBA 2NRHA 1I3AA 4P7TA 2Z2MA 1R0AB 2PA8D 3KLEB 3K89A 5GAGP 3UPFA 4WYWA 3DHXA 1JLCA 3I87A 4OHWA 5F8IA 5T14A 3VALA 2RHKA 3CCSN 4BRKA 5H9EK 5HQLA 1O6XA 1ZZNA 1X9MA 4JI7K 2ZOMA 2MLXA 3DLKB 5G4DA 5IOLA 3OYBA 1DGKN 3OFHA 3AVLA 5M1FA 2MKHA 1GX6A 1DFDA 2VDIA 2YX6A 5AJ3J 3S41A 1Y4ZB 3VTIA 3HT0A 4LVNP 2AX1A 2CWKA 4QWCA 4BGBA 1YJWS 3TAFA 3ZT3A 4ED1A 4JI2J 4OX7A 4DI6A 1KQGB 4QS7A 4H0PA 5F8LA 4IRCA 1Z25A 1QZ6A 1VHXA 4RPFA 5LM7E 1OMSA 4FWMA 4RWXA 2EC0A 1C0TB 1SC1B 4MN4C 4JKGB 2X1BA 4OPAA 3VESA 3LO3A 4I2PB 1I3OB 4P2SA 5KG7A 4G3IA 4JI7J 1CXQA 3ASMA 4DUYK 4CZIA 3BDPA 1V4TA 5EUHA 5M2RA 3V6DB 1WI6A 1UVMA 2CG8A 3PO5A 3P5TL 2XSJB 4DV0K 3AVHA 4F4WA 1S49A 4JI5J 3QT5A 4OI0A 1JLAA 3MM8B 4JI2F 4N8OA 4DV2K 4QR2A 2LCWA 3GCXP 1A5WA 1E3MA 2RRBA 3D2FA 2XO6A 1CZ9A 1R8AA 4FW2A 2Z0GA 2FJXA 4ZP7A 4ECSA 4ID5A 3ZSYA 3IC1A 3OR1A 5B0CA 2KVQE 2YWKA 3U27A 5HRPA 1C0FA 3P5BP 2A42A 4ISFA 3ZT4A 3A4TA 2D7SA 5G0RA 4N41A 1NSAA 1CBKA 4NLXA 3UCZP 3AA9A 4FXVA 2ZHBA 5J1PA 1CLQA 1REVB 5HL7L 2VPWB 3OV7A 1ZBSA 3S7RA 1KQFB 5CD4H 1RU2A 1U25A 5AZIB 2VQEF 4UY8O 4MK9A 4JI6J 1G6BA 1NBEB 5J2MA 2MJUA 2R7VA 2QA1A 2GMJA 1B92A 3HD1A 3K5LA 2BQUA 4TYAA 5KFRA 4NLSA 3DWLA 3HM8A 4FWNA 4DX6A 5IWAF 1QSYA 1TMJA 3EUNA 3KIOA 2JC1A 4FKYA 3FQLA 2QA2A 2NYHA 5JVHL 4DUYF 2CQHA 1SJ4P 4ZVOB 1NJYA 5K8PA 1PGZA 3M32B 1DQ8A 2VC0A 1IKWB 2MLYA 3MN5A 1RBAA 3H5SA 1NGBA 1SI9A 1HMVA 2ZVSA 4QR1A 1R6YA 2J9DE 1EZZB 2KHDA 4CLPA 4NLUA 4QU6A 2BE2B 4FP9A 1CC8A 4Q45A 3AOBA 3W2VA 4YMEA 2WB1D 4KHUA 4A8YA 4PWDB 3L2WA 2FTRA 1TR0A 4IZ9A 1GTEA 4C23A 5KGXA 3RVCA 3OYEA 2B56A 4FJ5A 4LUBA 2KHCA 3KK2A 2BKOA 3QYYA 2DT9A 4CZGA 1HNVB 3PCOB 3BH7B 2YWFA 5KFOA 2BH1A 1YUWA 2Z2ZA 1U26A 3O44A 3LDLA 3L7PA 4CEDA 4OZ3A 3CDAA 3NP5A 4EIAA 2JLFA 4NLTA 3TYTA 4F2SA 2DYAA 3BO3A 4PKHA 3EGVA 5JVHQ 2HEKA 3MURP 4K7QA 5ETQA 4NL5A 2RDJA 5BYRA 3BPSP 4HR2A 4OX9J 4PEOA 3T9NA 2VFSA 1UWBB 3I8DA 3HHDA 1IBMF 3C14B 5L1IA 4NLQA 3GDQA 4WYLA 3KLGB 2D9OA 1NSKL 3AD9C 4DU7A 5E41A 4DV6F 2P2CB 3PYGA 3NXZA 4CJUA 4E7JA 1LXJA 2VCPA 3GCWP 4CP5A 1R89A 3D68A 5GAEI 2HZVA 3J81Y 4FJJA 1SV5B 3T1AA 4LVOP 5HL7Q 4PXCA 2GCFA 2DH9A 1HR0J 2E9TA 4WU2A 4NYNA 5ETKA 4DSLA 3R8YA 2ZNYA 2C2MB 5B0AA 1L5UA 3MECA 4FWRA 1SJRA 4RW9B 1TL5A 3CIMA 1VS3A 1FXDA 2HFZA 1BGXT 3PO4A 4NXMF 3MGJA 4IR1A 5MLCQ 4C8MA 2DXEA 3M9OB 1YG0A 3PFEA 3FSIA 1U1PA 4ZVQB 2QWRA 4CGDA 4ILRA 4DR3F 2AWZA 3RAQA 4UY85 5EXWA 3B4DA 2IM1A 5K8MA 1T6DA 3U4LA 2CADA 3SYZA 3V6HA 2Q0UA 4OKJA 2DNPA 4AHVA 2BZ2A 3L4IA 4KHWA 4IDHA 3P38A 1HNZJ 2FY8A 2KM8C 3ZZRA 2A2CA 2YKNA 3BREA 2M4MA 3BEGB 3BSOA 3UVJA 4CLUA 3K5MA 4DUZJ 1FT8A 1FDAA 1NJWA 4PG5A 3D0IE 4HHHA 3HZ6A 3LOUA 2HBMA 2MTLA 3E01A 2CGKA 2ZEJA 1YK9A 1YT3A 1RDDA 3CIZA 2R7WA 3SZ2A 4DQIA 1RA6A 1T11A 4UW2A 3A8KA 2COLA 2VYPA 2E2QA 1QQOA 5HRSA 2V9WA 1KHVA 4CZKA 4J9RA 5F0XA 2AX0A 1FKPA 3HLUA 3SAFA 1RHKB 4QPTA 3VGVA 3AGRA 3AA2A 5AFUA 5A6WA 3FR0A 3OHBA 2AJ1A 1FJGK 3FJ2A 4Y6IA 1QTNB 3OS2A 1WC5A 1IBKK 1ZAVA 4DV3F 3HSZA 3S1TA 4ED4A 4LF8J 1FJGF 4WYBA 1VRTB 2WFBA 1TZ0A 3JTNA 3AAWB 3TQ1A 4PCQA 3G6XA 3I56N 4IXCA 2GMLA 3N5BA 1SH3A 2VPXB 4P2FA 4NZ6A 2NRTA 4ZCLA 1HWJA 3DLEB 5AE1A 2ZC4A 3GR0A 2JL9A 4ZLLA 3L3VA 4DSKA 3ID6A 1D4XA 3ZC4A 5LXYA 4CHQA 3HOSA 5H9FJ 4YHHF 1IR2A 1JNZB 1IUJA 3I96A 1X3MA 1I1GA 1FTRA 3VZHA 1YGYA 4ED2A 3NH2A 4DZDA 1FFGB 1NUEA 1NDKA 4JBCA 4FYWB 3Q7BA 1REVA 2M9KA 4OO1J 1O0PA 1U02A 3N4WA 5I9EB 3RBXA 4CJ4A 3CNQP 2DHHA 2E4LA 5GADI 3TX8A 4BE2A 3LZJA 1RYRA 1C1BB 3TUIC 2MSTA 1NMEB 4WQ5A 1U1LA 4IH6A 2YHXA 5KFVA 3FMWA 2V2KA 4G1PA 1U0SA 2E9ZA 1NPKA 3QO9A 4C2MA 3M30B 4FOEA 4CF1A 2G2YA 3SUNA 3SV4A 1CJUB 5KT6A 3NNHA 4K4SA 1ZPWX 2CPYA 2DGOA 4UQTA 4K59A 4YP3A 1KSPA 3IFRA 1YJRA 1RT3A 4YNQA 4CO5A 5KG1A 2E1YA 4A8XA 2V8PA 3PYDA 4LF4K 1HWUA 2VBXA 3NGZA 3OW2M 4DV1J 4HLBA 2ADCA 3S9HA 3G4SN 4XH4A 4I9LA 2G9OA 2IDEA 4ED3A 4FLVA 3MMVA 5JVGQ 1IKYA 1XK8A 1NMNA 1XIQA 2J9DA 3BV8A 2GVDA 4QS9A 3A8JA 2YV0X 5F8JA 1H7WA 1IJEB 4PQUB 2I38A 5F8GA 3QRRA 5ADXH 2X78A 4DX8H 4OZLA 2YKNB 1SJFA 3NCIA 1RT2B 1NDPA 1NK5A 1TMMA 5AZJA 1WKLA 4OYWA 3PUFA 1TL3A 1IQTA 2V52B 1T9WA 2VGNA 2VZ9A 2BTFA 3AJ2A 4LRFA 5A6PA 2W42A 5LJWA 4CO1A 2V9KA 3NMUA 2NLXA 2ZF5O 4ATNA 5BPLA 4P2XA 3OL6A 1WHVA 3X3UA 2JEIA 3WXJA 1JXBA 5C25B 5LT5A 5IT9Y 2F9JA 3FVYA 3WXMB 1TAQA 4J5OA 4M5HA 4B8CA 2VJVA 3VQCA 1HQEB 5D77A 1UJ4A 4CIOA 4DPWA 4N76A 3SMSA 1Y5IB 4ZPTR 3R5DA 4O44B 3RJMB 3IWXA 3J7Z5 3KJFB 2O8DA 4JRPA 3MM7A 1U1OA 4FJ8A 1GLBG 1DTTA 4FLYA 4M7YA 1X4HA 4URQU 2MSSA 1NPPA 5EY4A 1NHVA 2W2OP 1YAGA 4AILC 3HVTB 1UZDA 3I6PA 2FHMA 4KGZB 2CGJA 2BA9A 1W26A 4TKTA 1N88A 4P2MA 3MWPA 2D0BA 3RSEB 2N7YA 3AO3A 3LPTA 3RRGA 3LPUA 2Q6CA 2WVFA 3G8SA 2RH3A 1EHWA 3WC0A 2Z58B 1W7WA 5DLGA 4GVBB 1EJ7L 4DV7K 2FVCA 4UUWA 4KKOA 2DEIA 2R7XA 3TAMA 2HWTA 2F8TA 3AH6A 1RADB 2CKWA 2GJIA 2ZH1A 1BO5O 2HOEA 1X1PA 2IS3A 4CEEA 2R7QA 3N5FA 3QFUA 1RTJB 3NCRA 4HI2A 1KXPA 5AZJB 4EHUA 4K2JA 4KB0A 1S48A 1TUUA 3G82A 4R79A 2V8DA 5DMRA 4JI1J 4BVOA 2CQ2A 1U09A 2P9EA 1K8KB 3M2RA 3TJ9A 3CCWA 1UTAA 5M1QA 2RS8A 4DTOA 4MT1A 1B9DA 3KDNA 4LFBK 3R8EA 4FSVA 5LMUF 2ABYA 5FPDA 2G0IA 2IJNA 3LDSA 3DYAB 4FK0A 4RNOA 1SL2A 4FPRA 2OHDA 2CNKB 1T6CA 3V4IB 4DU3A 2Z57B 2Q31A 4H5RA 1KC8T 1FXXA 4NEYA 2OD4A 4GV9A 1PJ7A 2VG7A 4NLOA 3M8ZA 1NGAA 4EP4A 2XY8A 1GX5A 1O13A 4DCHA 3ZCMA 2E7XA 1R8PA 2GQ2A 4RNNA 3HSGA 1H98A 2J6UA 3CQ8A 5AQXA 3ENHA 4C7QA 1NH7A 3CMQA 4ECUA 1HNWF 3GZ7A 5D6GA 2KJWA 5GAGI 1HYZA 3GFYA 1P9QC 3GPAA 2DNGA 3LP3A 3EVWA 4ZP6A 2OELA 3IKMA 3T5KA 3HD2A 2QX0A 4CEZA 4ELVA 1H73A 2GWKA 3D54A 4YORA 3AOCA 4DFMA 3QEWA 3J7ZT 2DY9A 4CIFA 2LSNA 4NEZA 2VV5A 4NCBA 2CNOB 1UFKA 2B7BB 3WXIA 1UFWA 1ULRA 2CNLB 5LMNF 3VAMA 5E26A 1JIHA 3D0PA 3EMTA 3AQPA 1NHKL 3J80O 2D3UA 4DL5A 1NDCA 3TZXA 4RW4B 1IN0A 1FRXA 1JXVA 4Y0WA 3W2WB 2OPPB 1RB0A 2Y0SD 4CESA 5E33A 4GKJF 4O5FA 4QQBA 1IBCB 1UJ6A 3PYFA 4PXEA 4B9LA 2E5LK 4LSNB 3H42A 4O3OA 1NLKL 3W60A 1PC5A 2MZQA 2AJFE 2YKMA 1NM2A 4ZITA 2XS7A 1OH6A 3L3CA 2C2DA 4Z37A 2BMBA 4YUDA 1GTHA 1B4SA 4E7KA 1N33K 5E3PA 3OL8A 4I67A 1Y97A 3PIOL 1PIEA 3Q2TC 1VQLS 1X9JA 3CFPA 4FZZA 3I0SA 3WIVA 3Q23A 3KUGA 2MY7A 2P9IA 5AQOA 4PL8A 5EWGA 1RGVA 1IV0A 2DNYA 2BKPA 1RGIA 1TFWA 2EBGA 1Q4RA 1HD1A 4CQ1A 2JVOA 2RDDA 2AYBA 4ETXA 2ZOGA 2XMAA 5KQ8A 3SQ2A 2J8SA 4DV5K 2O8CB 2BJ8A 1U04A 2RDIA 3B54A 3RMDA 2QLBB 2A6OA 4DQQA 2GHWA 3D1QA 3OLAA 3QIPA 4GKKF 4R25A 5KPTA 3VGUA 4YOVA 1UPMB 2R7SA 2DHAA 4U67L 5GIOA 4DMZA 1RTJA 5KFZA 3HJFA 4AL7A 3E01B 3R1HA 4YY3K 1RBOB 2MQOA 1RCXB 3CYMA 1VQLN 5J2NA 3D45A 1BI4B 1ZETA 3I82A 2YJFA 2MMYA 3PW5A 2YNIA 4ECVA 3VERA 4ZLNA 1TKTA 2KN4A 2CPXA 1QVFM 4WE1B 2QTWA 4MKBA 3GYGA 1M1GA 5M2PA 5AQMA 1A6LA 1RAGB 4JI5K 2LU2A 3C94A 4EUVA 3MXIA 5FDLA 2XMKA 4I68A 3OYKA 3QQCD 5GVQA 3HVTA 4F67A 3QZ8A 4WP3A 4HWIA 2V5HG 4BG9A 3M6UA 5HN0A 2GNKA 4MO4A 2Y8WA 3AVMA 1YZ6A 1S1XA 3W8PA 1XMQF 4YOTA 2IMWP 2PFDA 1R31A 1ZAXA 3IS9A 2H5EA 4DMNA 2KTQA 2ZUAA 4PG6A 4Y1DA 3ZZTA 2LFVA 4ISGA 3QETA 4WKYA 3BF4A 4UY8T 2VG6A 5L8RC 1OS5A 5HVHA 3DMJB 2NYIA 2IC3B 2EFQA 2F8MA 1VBYA 3TJAA 1WORA 1JCEA 2MJNA 4CLSA 2XLIA 1NCLA 3NLCA 3J7YI 3CPWM 4AFFA 5IM0B 1XMOK 2VG5A 3PR5B 1YVNA 3H5UA 2MHEA 4GMJB 2GV9A 3DNCA 1HKCA 4DR5F 3VF4A 2KI2A 3CD0A 5I3QA 2BJDA 2MGZA 3CXCM 5DDPC 3B78A 4FJXA 5LJ3Y 4XIUA 3MX2A 3VF6A 5C0YA 1HPZA 1K9MT 4ZVEA 3PHTA 4EZ6A 1VSEA 1YIJN 3IDHA 4X4RA 3PR4A 4QAGA 1D1UA 4K42A 3OPKA 4OZ0A 1X9SA 4GKKJ 3BP8A 3U1MA 2NZ4A 3MMAA 2Y8YA 3CJ5A 3UCGA 5FPMA 5CHIA 4A8WA 2XLKA 1YF5L 2QLFB 1YVUA 4RNHA 4WQ4C 4XK8C 5D4NA 2HK3A 2XS2A 5CQGA 1N36J 2W25A 3A5NC 4GC7A 1SS6A 5D8HB 4I56A 3MEKA 4QWAA 5AFUH 5AQYA 1HQ2A 5KRSA 2CFXA 3VA0A 4OKKA 5CAAA 3HHLA 1BL3A 4QYZJ 1FWPA 2XMVA 3S01A 2XGPA 2P9IB 5BR8F 2E20A 4WKRA 5F0UA 2ZM6J 1FO1A 3MFIA 2WONA 4DDFA 4PWDA 5CCLA 4IFYB 3W2VB 1M5HA 2JEGA 1LOUA 5K5MA 1RXOB 3H98A 4W5TA 2ZKUA 1A7GE 4RUBA 1Q7YT 4BR9A 4LSLB 3OTDA 3AO5A 3SXLA 3QERA 1ZA2B 2WBRA 4OZJA 4I6AA 3HJVA 1RHUB 1JL1A 4OIXA 1CLFA 3AT1B 3DGVA 1N36K 3IGVA 1WC4A 2W4CA 1KVCA 2J9EA 3MXHP 4BLGA 4ILLA 1DKGD 4ZVHA 4ECWA 2B43A 4RW4A 1G2EA 3SAGA 3H2UB 1K1SA 1N4LA 3VEXA 2Z2LA 3MPDA 1KRPA 1RBLA 1FJEB 2JEJA 3G2XA 5J1EA 3A5OC 4YR3A 1B99A 2CQ1A 3BN7A 1VBZA 5E3RA 4LREA 2DY4A 3VOVA 2XMWA 1UCNA 5AQVA 3CCQS 2GMHA 4KR0B 4NLCA 1UVKA 3F56A 2XWXA 3KJQB 1W25A 1PJ6A 3RSEA 4CHZA 4K5RA 3TNVA 1VBKA 3ZX3A 3HT3A 3T5HA 1QLNA 1SPBP 3AJDA 4NOHA 2EI5A 4NXNK 2YWWA 5M1PA 4CTAA 3FZHA 1NJIT 2BJ1A 3CJKA 3I4HX 1VQ6S 1Q8LA 3I0RA 5BREA 2VG7B 3CF5Q 2P8IA 2LXUA 2HRUA 3I33A 2NPFA 3ULHA 4X66F 2AT1B 3CD6N 4E2FB 2RHSB 2KT3A 4DX5A 2QWLA 3CFOA 4HEA9 2ASJA 2XYGB 4OHZA 1RP5A 3IR5B 4LBPA 1FE4A 3KHLA 1GMWD 3V6DA 3E9PA 1S1VA 4EFAC 4ZKAA 5CH7B 1RCOB 1RU1A 2QSFA 2JH3A 2J76E 1RHJB 3HHLD 4BRPA 4ILMA 3R1XA 1P90A 4K4TA 3Q89A 2IA6A 5JS2A 5B0DA 2AD9A 2QLJB 3A12A 4OI2A 4B17A 3ZSXA 3OW2R 1U2FA 1FW6A 4JKGA 2O8BB 2YNFB 2LKZA 2BR0A 3QT6A 3IMQJ 4LIWA 1VQMN 2OMLA 4RR5A 4X4VA 3BSAA 2FBVA 2EEYA 3AARA 4CEOA 1IKYB 1APSA 4OYOA 1VC6A 1CJTA 4HYKA 1S22A 2IVMA 2CRLA 5J2QA 4DWIA 1CJVB 2YNHB 3O4NA 4C3LA 4X62K 2M7SA 3DLLQ 3AVJA 3KKSA 5DZ6A 5CCMA 1Y64A 3THWB 4J2DA 4RNFA 2FLPA 3CCTA 4Z4FA 2GEMA 2O5DA 1HRHA 5FLXU 2ZH2A 1KAZA 1N8RO 3GB0A 4IG3A 3DLLL 1HBNB 2HHPA 3JB9k 5DDOC 3LM9A 1CS4A 4LBHA 1RWKB 2FVRA 4LFBJ 5H1SQ 5AXLA 5B08A 1AUDA 3C6HA 1R0AA 2YWEA 2HZCA 3GWCA 3KD1E 1M5VC 5KGWA 2WUSA 5KPRA 3VQ5A 2OSRA 1GLEG 3PFOA 2YXLA 4DS4A 3VQTA 1FK9A 1U1KA 2W9BB 1WAJA 4PY5A 4KHNA 1JQGA 4NLBA 5FRMA 3TA0A 3P5JA 5HRRA 3GSIA 3H3NO 1NGEA 5KRTA 2VGMA 1YSJA 5CR4A 3LWMA 4FVCA 1R8HA 3SBMA 4K41A 1X4DA 3BGFA 4HTIA 1RSCA 5IXUA 2V51B 4CEQA 1T8EA 3ILJA 3KLHB 3CCRN 2CQDA 5DG8A 5ETRA 3AV9A 4CJTA 1YJNS 5C2FA 1HKGA 5DGBA 1ROFA 3WT0A 1N33F 3TPQA 1Z05A 2FY1A 2GBZA 3G6VA 4PZVA 1BD6A 3HP6A 4KFBB 4LQ3A 4U7UD 5AQHA 2A2DA 4LSLA 3H2LA 1WSRA 3CC2S 1ICEB 1TKZB 2MKCA 2IVPA 1EARA 2HBYB 3V81A 5E0OA 1ATNA 1WF1A 4CDIA 5GINA 1D09B 1B7YB 3H90A 3ZZZA 2PY5A 2HAFA 4DTXA 2LXFA 2QG9B 1CPZA 1K9MO 1XJWB 3JQKA 2R8KA 5F2RA 3RR8A 9RUBA 4ZPCA 1M1HA 1R27B 2UVUA 1B0PA 5ETMA 2MEWA 2GVZA 5LJ5Y 3K57A 4B9MA 5HMYA 4MIAA 3AAPA 3QZ7A 1OVQA 1GNKA 4IFYA 4JKEA 1LAVA 4ED8A 1U2VB 5LMUK 5E2QA 3GJQB 3LF0A 2G2ZA 3UO0A 1NK0A 1FD2A 4JV1A 1ZPVA 3GG4A 1RAJA 1K8AO 2HLTA 2IAJA 5THWA 2YHAA 4H0VB 1YJNN 2QA4N 2ZGYA 3THYB 2DY1A 1WTBA 2I7NA 4U8VA 5DJBA 2VFVA 3M05A 3M2RB 3FC9A 3M8QB 4KSEB 1URRA 1U6ZA 1NO8A 1XNRK 2JWLA 1MNEA 4EHTA 2YH0A 1HNIA 4FLTA 2X3GA 1TL4A 2BDPA 3NGDA 5DO2A 3GYNA 4M3ZA 4CLZA 1H2TZ 1VQNN 5B8HA 2J8AA 5ADXA 5FRNA 1AA1B 3CMEN 3K8WA 3AA3A 4FWSA 1MWKA 4IOXA 4L75A 3CDBA 3EZUA 1LWCB 4CWBA 3HMJG 1WC1A 4ZVTB 4KJIA 5DRKA 4QCLA 2CIMA 4DHVA 1WB9A 1E6YB 3D1OA 5GMEA 4E1JA 2OZMA 3NH1A 4WZMA 2XCPA 1Q95G 2ROGA 3MAAA 5GMKa 2HYIB 4ISEA 3C16B 3AD8C 4PUOB 2W1BA 1S59A 5CZ2A 2HHHJ 2IC3A 4ILGB 4ENOA 4JKCA 1K44A 1X5OA 5KG2A 3MM7B 2NSBA 5C10A 4CFAA 1FF2A 1WEYA 2NREA 4A8KA 1IJFB 3L9ZA 3NGRA 4K4VA 4EGLA 4KBOA 2QL7B 4CEFA 2CNNB 2UUCF 1Y7PA 3NL0A 2W01A 3OYJA 3ZXWA 3ZSZA 5F0WA 3MFHA 3J81U 3W9HA 4NMXA 3MCMA 4I1TA 1LWCA 4KGMA 4CK3A 1TAUA 1YITS 4YDDB 4WF9Q 4PXBA 3TAPA 2VKZG 3WXKA 4OL8A 2XHCA 3TTFA 4JI4K 3G6YA 3U9ZA 4E1NA 4RLEA 2WOMB 1X4BA 5M1KA 2QC3A 1JNRB 4JAXA 3DOLA 2FPHX 2HHHK 3HHEA 3PRVA 4LFCF 1EB0A 4F26A 1GMVA 3FGUA 3FSYA 3T9ZA 2HMPA 3DOMA 3MTKA 2LEPA 3DLBA 2ALZA 2O8EA 2FZGB 1ZOTA 5J2NB 2Q79A 3ZSWA 2W9AA 3H4DA 4OMFG 2EFPA 3UQSA 4J9KA 3GFZA 3GR1A 1MMLA 1KAYA 3QSIA 4O4GB 1U48A 2ZBCA 1EQMA 3O6QA 3BKUA 1WI8A 2PMWA 2ZKTA 2B9YA 2FJVA 3DRXA 1QE1B 3B8HA 3FFIA 1ZAWA 4DR5J 3I8BA 3O1WA 1R7IA 1QAJA 3MMBA 1HWKA 2BRKA 1X8DA 5BYQA 1Q18A 4M5DB 1SVDA 1NH8A 1DRZA 1Y3JA 3ZZOA 1YTUA 1T3OA 5EU7A 3L7UA 1J5EF 2G1DA 1SZ2A 3T6JA 2DRAA 3MM5B 1YZ7A 3EO3A 1J27A 2KG1A 3QICA 2ZD1A 3C16A 2O01C 2CH5A 2PFFB 2CZ4A 3NGTA 4HCBA 4HDHA 1RWMB 4C8NA 5KG5A 1HJRA 3AVFA 3G25A 3SPZA 5ETLA 1IG9A 3FZKA 2E5LJ 1OKJA 3CCJS