4YFUA

Crystal structure of open bacillus fragment dna polymerase bound to dna and dttp
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
578
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
molecule tags Transferase/dna
source organism Geobacillus stearothermophilus
publication title The Closing Mechanism of DNA Polymerase I at Atomic Resolution.
pubmed doi rcsb
total genus 210
structure length 578
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4yfuA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yfuA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4yfuA01
5FDLA 4OPJA 4FJXA 4K8XA 4KI4A 3QESA 4AHTA 1FKPA 3D0PA 2QK9A 3PX0A 3NHGA 3O3GA 4CK3A 3HJFA 2A1SA 2IGIA 1X9SA 3QEPA 4FJKA 2OPPA 3O4NA 4MQ3A 3O3HA 2G8UA 3ISNC 5JS2A 1VK0A 2YNHA 4N56A 1L3SA 4K8ZA 4M45A 2Q3SA 3TAPA 2X6NA 3DOLA 4CJQA 4KRFA 2HHQA 1RBVA 2XY5A 4IG0A 4CEAA 3PX6A 3VQ8A 1Q9YA 4F2SA 1GOAA 1LW2A 4DTRA 3IAYA 1ZBIA 1JLFA 3AO1A 1Y97A 3RMBA 3IS9A 3CG7A 1N5YA 1L3UA 1X1PA 4ZTJA 3LZIA 3HYFA 1S0VA 1UAXA 4DTOA 2QKBA 4BDPA 1XWLA 4BWJA 1RT5A 1H38A 4KKOA 3AVMA 1IO2A 1KRPA 4JLHA 3TAMA 3V9ZA 4N76A 4PUOA 2HNDA 2GBZA 4QOZB 3CFPA 3OYIA 3DLHA 4DFJA 4QCLA 1ASVA 1IKYA 1YVUA 2IC3A 3KK2A 1FKOA 4CGFA 3NCIA 3NAEA 3LPTA 3G0ZA 1NJYA 1EETA 2DFFA 3ZSYA 3CFRA 2KQ2A 4RW4A 3K58A 4DU1A 1TKXA 4CHZA 4YNQA 3KKSA 4DMNA 3EYZA 3CFOA 2R7YA 4DTXA 2FBTA 4FLUA 2YNGA 3DMJA 3NFAA 1Q8IA 4M3UA 4CF2A 3LZJA 1RTDA 4ID5A 3RTVA 4NCBA 2ETJA 3M8RA 2BDPA 3MEEA 3NE6A 4B3OA 1TV6A 2Z1GA 1NK9A 3KLGA 5CY4A 4F3TA 1CZBA 3NF9A 3LAMA 1Z26A 3SQ1A 3NGYA 4I7FA 4Z4GA 1UWBA 2RKIA 1VSKA 1J54A 2HB5A 5T7BA 4Q0BA 2VWJA 2O4IA 3S3OA 3ZSRA 1BQMA 4KPYA 4RW6A 3ZSZA 2HMIA 1TAUA 4E1MA 3QERA 4CHYA 4FM2A 3HPGA 3HSTB 2A1RA 5FRNA 1VSIA 3NDKA 4CECA 3DLRA 3OYKA 2LSNA 3OS1A 3IRXA 4H4MA 4DSIA 2W42A 1X9WA 3NF8A 5JS1A 1BHLA 4M41A 4R5PA 3SJJA 4DFKA 1RTJA 4FJ7A 4DS5A 4M3TA 5SZTA 4OKJA 4OPKA 3MXIA 1UA1A 2YV0X 3SNNA 1REVA 4FJ5A 3TR8A 1BCMA 1TVRA 4DLEA 1DTTA 2F96A 1QQCA 3A2FA 3ZSOA 3O3FA 2IOCA 3O4QA 1VSFA 4NCAA 3AVGA 3V1OA 1NK0A 2OA8A 1DTQA 3I0RA 3S3MA 3V9UA 4G1QA 1S9GA 3C94A 4CHPA 1D8YA 4FJNA 4CK1A 3VQ7A 1T05A 1ASWA 4DQPA 2KZZA 4KB0A 1Z25A 3DRPA 1JLBA 4W5TA 1W9HA 4CHOA 1RT3A 4DTJA 2DFEA 4E19A 4DQQA 1LWCA 2HHUA 4I2PA 2AJQA 2OZMA 3AVCA 2RN2A 3C95A 3NGIA 2ZE2A 3LALA 3PY8A 4XIUA 2YNFA 3KIOA 1L3VA 1QS4A 2JLEA 4CJRA 1JKHA 1NJWA 3B6OA 4FJGA 2X6SA 3V9SA 1J5OA 4FJ9A 4HUEA 1RDBA 4BDYA 2HNZA 1HYSA 4CHQA 3L2UA 1K6YA 3ZT2A 3OYDA 4M3XA 1KSPA 2ZQBA 1QTMA 2G8IA 4Z4HA 3AVFA 4BE2A 3SPYA 1SKRA 1TL1A 3BGRA 3DLKA 3DRSA 1B92A 2JGUA 2VG6A 1WN7A 1B9DA 4W5OA 3QETA 3ZT0A 4DSEA 1RTHA 4MFBA 4DTSA 3DYAA 4FVMA 3ZT4A 4RW7A 4M3ZA 3HPOA 3SI6A 2E6LA 4DTPA 1VSJA 1NK7A 1KFSA 3PUFA 3ULDA 3V81A 3PO4A 1BISA 1HPZA 4ELUA 3LAKA 2XHBA 4CE9A 1JLGA 3HT3A 3KTQA 2KFNA 1S1TA 2B6AA 3OYNA 3L8BA 4J2AA 3HK2A 4OGCA 3AA2A 4CIFA 3OYHA 3SUPA 1JL1A 1VSEA 4M3WA 3LWLA 1BGXT 1KTQA 2YKMA 4KHNA 1VRTA 5HBMA 2PYJA 4DSLA 5KRSA 2B5JA 4CEDA 4E7IA 3V6DA 2HW3A 3SZ2A 4F3OA 4CEZA 1WSEA 3E01A 4C8MA 3ALYA 3V9XA 3DI6A 1WLJA 2HHVA 3TARA 4RW9A 3VQ9A 4CJ4A 3OYJA 4DU3A 5J2QA 1NK6A 5D3GA 2DFHA 4DTNA 4FJIA 1GOBA 4FZZA 3L2WA 4BE1A 1NJZA 3NBPA 3KK1A 3LP2A 4H8KA 4HCBA 4CGIA 3ITHA 1S1UA 4Z4IA 1NK8A 4KO0A 4FJJA 3JSMA 1WSFA 4JRQA 3NH0A 4O4GA 2P51A 4NCGA 4LH5A 4CJ3A 3OYLA 4DQSA 2BANA 3HVRA 3THVA 3U3GA 3NH1A 3VA0A 4B9MA 3RRHA 4C8KA 4C8LA 4EZ9A 3UIQA 2Z1JA 3MECA 1QSLA 4GW6A 2B4JA 2YHBA 4AHCA 2D0CA 1KLNA 3TAGA 3S9HA 3DLEA 1UOCA 3L3VA 4KHQA 1NOZA 4DTUA 1RT1A 1AROP 1IKWA 4DG1A 3LDSA 4HUFA 2XY6A 3ZSQA 4I9QA 2OPSA 3K5MA 1WSIA 4KHYA 4B9SA 3WNFA 1XC9A 4PA1A 1T03A 1WSJA 3MXJA 4FK4A 1YTUA 1JL2A 1BCOA 3PO5A 3WNHA 4FM1A 5I42A 1VRUA 4CERA 5HROA 1C1BA 3VN5A 2VG5A 3QLHA 2D0AA 4C8NA 1EKEA 1HRHA 1S9EA 4TSXA 3OYBA 4KHUA 3QNNA 3LANA 4DTMA 5KTQA 1NKEA 4I2QA 2X74A 3DRRA 1U48A 2G8VA 3KD5E 4FZYA 2IS3A 5CZ2A 1CXUA 3SPZA 4IG3A 4B9TA 3VQ4A 4FLZA 4E0DA 1ZBLA 4O0IA 1C0TA 1RBTA 3OYEA 2F8SA 1S76D 4KTZA 3JYTA 2HNYA 1NKBA 2NUBA 4AHSA 4CGDA 3HL8A 1JLEA 3V9WA 4BE0A 5CYQA 2G8KA 3FFIA 4FM0A 4HVJA 1BIZA 4NYNA 3HP9A 3TAEA 1QLNA 3I0SA 4IDKA 4CJPA 3AVNA 3U3YA 4DQIA 3KK3A 3M8SA 4Y1CA 3QEIA 3AA4A 4CJ5A 1C6VA 1CEZA 1R0AA 1A5WA 1TL3A 1HYVA 4AILC 1HQUA 1TKZA 3TWHA 1SKSA 1C1AA 1RT7A 3P1GA 1Q9XA 1SV5A 4E89A 4CF8A 3F9KA 2XO7A 3LWMA 2BE2A 3CM6A 1IKXA 1GOCA 4DSKA 3G10A 1KVBA 4IFVA 4AHRA 1U45A 3OJUA 2RF2A 1G15A 3OYGA 2WOMA 3RWUA 1TK5A 2PI5A 3HP6A 1RDAA 3AVHA 4Z4EA 1RNHA 2QXFA 3NF6A 1NJXA 4Z4CA 4OLAA 1SL2A 1WNSA 4DQRA 1CXQA 4CIGA 2YHAA 3F73A 3HXMA 1TK0A 4RG8A 3HVTA 2Z1HA 4HHTA 3QEVA 2P5OA 4M3YA 3KKRA 3P83D 2DTUA 1BL3A 3QEWA 4ID1A 4L8RB 2F8TA 1XI1A 3AVIA 5FROA 3OYAA 1WSHA 4B9VA 1BIUA 1D5AA 4W5NA 2HHTA 3VA3A 3OVNA 4M3RA 4ICLA 3E2EA 4AHUA 2FBXA 3KLEA 1TK8A 3SV4A 4FLWA 1ASUA 4PQUA 3VQ5A 2XY8A 3EZ5A 3LP3A 4E7HA 4JRPA 1ZBHA 2I5JA 5HP1A 4FCYA 2HVHA 2IAJA 2KZMA 1KCFA 4HTUA 5J2MA 2PI4A 4JS4A 4ELTA 4FLVA 4N5SA 4NYFA 4KHWA 5K14A 4B8CA 3AVAA 5HRPA 2DY4A 1UA0A 1TKDA 5SWMA 2FBYA 1JXEA 4O55A 4CFCA 2VWKA 5C42A 4W5RA 3ZT3A 2G8HA 3SCXA 2XY7A 1LW0A 4IFYA 5J2NA 1QSYA 4N41A 1NK5A 4CFBA 3ZSVA 3M8PA 3H08A 3TANA 4M42A 4CGHA 4DS4A 1S6PA 4ZTFA 1KLMA 4O5BA 1SUQA 1EXQA 4CGJA 4PWDA 4LY7A 1JLCA 2KFZA 3TABA 1O1WA 4Z0UA 3K5LA 1S1XA 1IKVA 3AVBA 1HQEA 3K2PA 3K5OA 1JLQA 3AVJA 3QINA 1QHTA 4YFUA 3T1AA 3VQBA 4CEQA 1LWEA 4Q5VA 4DLGA 3L2VA 4KI6A 5FRMA 3AO3A 4LSLA 4Y1DA 4DFMA 1QSSA 4IBNA 3TAFA 1NK4A 2YKNA 2Z1IA 3KD1E 4CEOA 4KAZA 4OLBA 5KRTA 3V1QA 4C8OA 1A5XA 4BDZA 2Y1JA 4F8RA 2GUIA 3CM5A 3DM2A 1A5VA 1ZYQA 3LPUA 4FJLA 1U4BA 1XHXA 3U6FA 4FW2A 4KTWA 4PY5A 3AV9A 4AHVA 1RILA 3BDPA 4CEBA 4ELVA 1FXXA 2OPRA 2PZSA 3RRGA 3D45A 2HHWA 3MEDA 5HRRA 1ZBUA 3T3FA 3KLHA 4FK2A 3RR8A 1D9FA 4LSNA 5DK5A 3L2RA 2P1JA 1BQNA 4CFDA 3KJVA 1WAJA 1EX4A 4CJFA 3VQPA 4BWMA 4OJRA 2KW4A 3CYMA 1SL0A 1LWFA 2X78A 1VSLA 1S6QA 1RCHA 1YTAA 3AVKA 1XHZA 2D5RA 3KLFA 4E3SA 3DLBA 3KLIA 4WE1A 4FW1A 4FXDA 1T7PA 1D9DA 1L3TA 3VQDA 3C6UA 5CYMA 3RMDA 1L5UA 3AO4A 3SV3A 3VQAA 3OYMA 1HMVA 1RDCA 4KB1A 4E1NA 3SYZA 5HRSA 2OYQA 4QAGA 4CF1A 1VSMA 1C0UA 2P5GA 4CGGA 2EHGA 4FJHA 1VSHA 3SUOA 3ZT1A 4KFBA 1RDDA 3AO5A 4J2DA 4KV8A 3VQEA 4CCHA 1TKTA 4B9UA 3NH2A 4HUGA 1HNIA 3DOKA 1RT2A 4CJLA 4CFAA 4E7KA 2FBVA 4BACA 3PV8A 1WAFA 3HO1A 4N47A 1C0MA 2VG7A 4CESA 1RT4A 4EZ6A 1SL1A 3AVLA 4CIEA 3WNEA 1LAWA 2HHSA 4OKEA 5HRNA 4FYDA 3HM9A 3B6PA 2D0BA 1N6QA 3WNGA 3TI0A 2E6MA 5KI6A 3QNOA 1ZBFA 3OJSA 1F21A 5C24A 3C6TA 4CJTA 4B08A 1NKCA 4RW8A 5KGXA 4J2BA 3QO9A 4CJKA 1J53A 4OKKA 1JXBA 1S5JA 4IKFA 4KHSA 4W5QA 2KTQA 1RBUA 1RBRA 2GV9A 1X9MA 3NF7A 3QIOA 3AA3A 2XRIA 3V1RA 3OY9A 5HLFA 2G8FA 3K59A 5I3UA 3NGZA 3MAQA 4OGEA 3QEXA 3L2QA 4FJ8A 3S3NA 4KREA 3RMCA 4O44A 2Y1IA 1TAQA 1VSDA 1MU2A 2WONA 3AO2A 1I3AA 5DMRA 3T19A 1DLOA 3VQCA 4CEEA 4CF9A 3SQ4A 3OYCA 3AA5X 2ITGA 4KTQA 4CJSA 3L3UA 1SKWA 2QKKA 1J9AA 1RBSA 1YT3A 3OS0A 4JS5A 3LP0A 1TGOA 1JLAA 1W0HA 1HNVA 1U47A 1U04A 5J1EA 3DLGA 4GVMA 4FLXA 4E7JA 3SQ2A 4FZXC 5J2PA 4Z4FA 1HJRA 1U49A 3OS2A 1S1WA 3PX4A 1CZ9A 1RT6A 4F4KA 3VQQA 5E41A 5CZ1A 5EU7A 1S77D 3CQ8A 4AH9A 4DFPA 4CJWA 4LH4A 4CJVA 3OYFA 4DSJA 1BI4B 4E7LA 1B9FA 3MXMA 2PYLA 2YNIA 3ZSWA 4DSFA 4CHNA 2BGGA 4EP4A 3ZCMA 4F2RA 2E4LA 3RMAA 1KVAA 4B8AB 4B9NA 3VQ6A 4CF0A 2PY5A 1HYZA 4ZHRA 2ZD1A 2ATQA 3K5NA 1IG9A 4GMJB 4FK0A 1C1CA 3TAQA 2EX3A 3ZSXA 4DF8A 4CEFA 3EY1A 1I39A 4J2EA 5C25A 3RR7A 1LV5A 2HHXA 4DU4A 3MEGA 3SUQA 2G8WA 3K57A 2FC0A 4FLTA 4FLYA 4O0JA 3IG1A 4CJUA 4LD0A 3P5JA 1KFDA 1CLQA 3ASMA 4CJEA 3LP1A 2RPIA 4HCCA 1NOYA 2OPQA 1RTIA 4H4OA 3SUNA 3I8DA 1S1VA 5KGWA 4B9LA 2OZSA 2IDOA 1WSGA 1BI4A 4I9LA 1EP4A 1IH7A 1MSWD 4UQGA 1T8EA 1FK9A 1LAVA 4DF4A 2HVIA 2O4GA 4OVLA 3SQ0A 4CK2A 4FJMA 3V4IA 3QIPA 3M8QA 1QE1A 4EP5A 4DWIA 3HPHA 1KVCA 1ITGA
chains in the Genus database with same CATH superfamily
2M8HA 2B51A 1PIEA 4IFYB 4USHA 2WB1D 2AQ4A 2CKWA 2BBEA 4FJKA 3ISZA 5JS2A 4K8ZA 1NNDA 2XYPB 1RBVA 5AQYA 5CAAA 2JEFA 1JLFA 3N0VA 1CVJA 3PEJA 1Q0NA 5D0HA 2ZHBA 1VQYA 3LZIA 3ET6A 4JI3J 2QKBA 2BJ7A 2XMTA 3TAMA 2HNDA 3MR3A 4DFJA 2DGOA 4WJBA 5AT1B 1EETA 2F4FA 2CJBA 5M1QA 4DU1A 3MM5B 4RLEA 2OIHA 4AF1A 4F4WA 2A42A 3U8XA 3FBBA 2BDPA 2E5LK 1FFSB 5B7WA 3KLGA 4OO1J 5CY4A 2AYGA 3I6PA 3PG9A 1HWJA 2QWPA 1UWBA 1U26A 1Q7YT 4CHYA 1NZAA 2DGSA 3ZETB 4K7QA 4CNYA 3I0SB 4TU9A 4RX6A 4Q43A 5DRKA 2DGWA 3G6EN 3QICA 1X9WA 5LMUF 4HDGA 2QWQA 3OLBA 1JJCB 1A6LA 3MXIA 3M4XA 3CJCA 4BG8A 3UN2A 4WXOA 3N4PA 3CJQA 4U6PA 5A6PA 1G4CA 4B3MJ 3OL6A 3UR3C 2PA8D 2F9TA 3JAMU 1WOOA 2UVUA 4IR1A 1NO8A 2ZE2A 4B3SF 4FBUA 2YNFA 2WBMA 2HBRB 5JLFA 1RDBA 4ZVSB 2APOA 1KSPA 1QVFM 4BE2A 3GJRB 3I4PA 3C8YA 4CLKA 3D6HB 2ACYA 3F44A 5DG7A 4IQMA 3ZT4A 4RW7A 2E6LA 2IA0A 4LR7A 1KFSA 2DR9A 4LFAF 4YOWA 4GC7A 1NU0A 1N56A 3BYPA 1VBYA 3M2UB 3VEXA 1S1TA 2OTJN 3H5XA 3AA2A 3MEDB 3W62A 3MMCB 4KHMA 5HBMA 3ULEB 3E01A 5FLXO 1TV6B 3V9XA 1NMNA 5GAGU 1FERA 4DU3A 3PM9A 2E7VA 4MFBB 4OHXA 2CJQA 2V4JB 4Z4IA 1NK8A 4P2FA 3OYLA 5IV3A 3SCKE 5B08A 4GW6A 2FTRA 2ACMA 1MMLA 2EKYA 2NRWA 2MKIA 3FGUA 2RSQA 2OH2A 1WSIA 2QA4N 3PO5A 2LEPA 4FM1A 2CPEA 3KFWX 4LF8F 3SI8A 3Q86A 2D0AA 2B3TB 3C0BA 3M5RA 3WEEA 2IS3A 1CS4B 4PKHA 1IM6A 1U25A 4KO0B 4R79A 3PTWA 4OYIA 8AT1B 3V9WA 2QZ8A 2AIRB 2ZC3A 2HFZA 2CPZA 3U3YA 2V8VA 2I1RA 1MDUB 1RWMB 3CCJS 2IMWP 1TKZA 4Q8EA 2R7UA 2B7CB 1GOCA 5EXWA 5A8WA 2HFSA 2UYTA 2BJ1A 1BC6A 2VQFK 1NJXA 1W25A 3HXMA 2P5OA 4IRDA 1UL3A 1U1MA 5DGBA 1WSRA 4KH0B 2AEFA 3MPDA 2XMMA 4JD2A 1B64A 5BYQA 1NXIA 2MKKA 2HGLA 2KLAA 1U1PA 4YN3B 2VQEK 3W0LA 2DO4A 5I3QA 3ENVA 4OV1A 5SWMA 4X4TA 2RH3A 3ENHA 5L1JA 2HPUA 1QE1B 3TABA 1TZ0A 2ILZA 1W2IA 2ZH1A 1KQFB 1R8PA 2J0WA 3CIZA 3CDBA 3CM5A 1K9MT 4NLTA 3EGZA 2VF3A 4ELVA 2MJUA 3FCWA 5CCMA 5KFIA 3TUZC 4I56A 3RB3A 3EE8A 1A0OB 2YWEA 4DR1J 2FIUA 1SL0A 1XHZA 4MK9A 3BYRA 3GE1A 4LSLB 4DU8A 2UVRA 2AKWB 2E29A 4JK7A 4X62F 4DDFA 4J2DA 3VQEA 1X3MA 2NS1B 4P7TA 3VF6A 4CJLA 5HQLA 3PV8A 3HO1A 5E26A 4C8YA 4CZEA 4JV5J 3MMAA 2VPYB 5IQQA 3S8SA 1U1OA 1NKCA 4WIIA 3PJWA 4KHSA 4CQ1A 3V1RA 2OTLS 3UVJB 4BRMA 1Q4RA 3L2QA 3ICLA 2K7KA 2GIRA 1TAQA 4BQLA 4J9LA 1V6HA 4NB4A 1R27B 4CJSA 3WX4A 2J0QD 4KE5A 2NNWA 1Q82O 1M90O 3KNGA 4A5AA 1HWIA 2XSJB 3H2VE 3OBYA 4GVMA 3N6LA 1S79A 5DJBA 4KH6A 4R8UB 2H65B 2PBDA 2FQQB 2CA9A 3VEWA 4K43A 3CQ8A 2XGQA 2J5AA 4YP3A 3CEDA 2CPYA 3CI5A 2GHWA 3ZCMA 1UW4A 1W7WA 5EUHA 4O0NA 3HHKA 4U8YA 4GNIA 3UKRA 3ZSXA 1EX8A 1VQ5N 5LMUJ 5C25A 1ZM9A 1FNMA 4H0XB 4DUTA 3KUGA 2E5JA 4PQAA 3PW7A 4CLLA 3MCPA 1SV5B 5L1IA 1OVYA 4YHHJ 4F4XA 2IC3B 4H5WA 2O4GA 2E8AA 2XO6A 3RUBL 3Q8UA 3FFIB 4HTLA 5JVGQ 3MM6A 3PX0A 4F0HA 1LQ9A 2BX6A 1UVJA 2WFBA 2W4PA 4OYXA 4OQJA 2VG5B 3OFHA 2MPUA 3MR2A 4BRLA 3CCUS 3V2UC 2W9CA 3RVCA 1U2CA 4CT8A 2ZUGA 4HR2A 1UAXA 3BR9A 1Y3JA 4DTOA 4BDPA 3AAQA 4Z94A 4PUOA 3AVMA 3KLEB 4PYDA 4QOZB 1XNQF 3LOUA 4A5BA 1DT9A 2OI2A 1IKYA 3HTVA 2PN6A 2VFVA 2AZ1A 3ZSYA 1RLCL 4GV9A 2KQ2A 2MQLA 4YNQA 4IQXA 4MK8A 2FXUA 2R42A 2YX1A 2DY1A 4B3OA 3AOCA 3FZLA 3TRGA 1KC8T 1S57A 3DM2B 1LNQA 2JOQA 5T7BA 3CDUA 4WP3A 1HKAA 2VL1A 4ZVTB 3DLRA 5CHIA 1R8AA 5D77A 5D0GA 2GUPA 4DFKA 3PYEA 1UA1A 1Q18A 1T3VA 4EMDA 4BQZA 1FRHA 1P9YA 2AD9A 2VFRA 1ASWA 4DQPA 3L3CA 3DRPA 5I42B 4CHOA 4DTJA 1N33K 2FHKA 2DNKA 1S9FA 4ZVOB 4H0PA 1ESVA 3IMQJ 1BWEA 4LF7K 2QL9B 4RUAA 1Q86T 4CH1A 2JLEA 2IAJB 1NJWA 4DXLA 1MWMA 4G9ZA 2R2UA 3IAM9 3GL1A 3GFZA 5GAHU 4DL5A 2YKQA 3PJ9A 1OSCA 1GFWB 4B1WB 5KFRA 3NNAA 4K50A 4O8UA 4B1ZA 4DQ8A 2XMKA 3FZ2A 1H0HB 4RL1A 2FC9A 2YH0A 3MMCA 4CE9A 3DHWC 5K8OA 5T7LB 2A2DA 2YX6A 3D6FB 1VSEA 2GQ2A 2UUBF 1CJKA 3NOGA 3ALYA 4RW9A 1NK6A 1HYSB 3DYAB 1XK8A 4XH4A 5AQFA 3NBPA 2Y0BB 3MOZA 3K9JA 2XULA 4JI6J 4BCAA 1DGKN 2W25A 1P9QC 4O4GA 4GVBA 3NEKA 4B9MA 5GAHP 3KHLA 3PW5A 1KLNA 5A0YB 2MGZB 1NOZA 4JV1A 4B9SA 1TR0A 2DD8S 2QWNA 4Y3CA 2R7QA 5IT9O 3QLHA 2MGZA 4DV3K 3O3LA 3P39A 3BGOP 2B8PA 1WHVA 4DV2F 3VQ4A 5KPZA 4O0IA 2KVIA 1RBTA 2P5VA 4C3KA 3CQXA 1KC8O 3PIPL 1JLEA 4KJIA 3A0IX 2W2QP 3DFEA 2E1PA 4JAXA 2V2ZA 3KUEA 4JOUA 3G86A 3GQCA 1YTYA 2XM3A 3DI6B 3D6RA 4BRDA 1K1SA 1I6JA 3EGWB 4USIA 1S3XA 4AHRA 5KG4A 2RF2A 1E4FT 4ID8A 4IO8A 4OLAA 4Z4CA 1SL2A 4BY9C 4CIGA 3O9RA 2O8DA 4P71A 2W9AA 3I56S 3G4SS 3GIIA 4QIVA 2YI1A 4AHUA 2CPXA 4E7HA 4BRPA 1HNVB 2W8LA 4ECWA 1T05B 3MTJA 3QT5A 1ULRA 4LFAK 4L3NA 4N5SA 2UUCK 5KFMA 4LF5F 2VPWB 5C10A 1RWNB 4MO4A 4W5RA 3FUYA 5C42A 3US5A 5LL6Z 1DRZA 5GMEA 5D8HB 3O6WA 4DV6F 2WVFA 4G1QB 4BR5A 4HDHA 4TY9A 1KXPA 3OTOK 4Y34A 1FNXH 4R0JA 1O1WA 3K5LA 1HIYA 1S1XA 2D7SA 3VAGA 1HQEA 4FKYA 4IFEA 4FJMA 1FFGB 3NLCA 3L2VA 3KD1E 4KB7A 4C8OA 2CZVC 2PFUA 2KN4A 4ZLNA 2YJEA 5AQPA 3RRGA 4NA3A 1WC4A 3I32A 5K20B 2P1JA 1WAJA 2IVFB 2XEXA 2QLWA 3VQPA 2PMZD 4AD6A 2XYHB 3KYLA 3KLFA 3DLBA 5KPTA 1T7PA 5F8JA 2G2YA 4DZ6A 1RDCA 2AWZA 1BUXA 4TY8B 4E2FB 3MWPA 4FWMA 3M1FA 3NH2A 4F4YA 4CFAA 3J7YP 4NI2A 1WAFA 2ALZA 3AVLA 1T6DA 3R7SB 1X8DA 3AAWB 1SJRA 1X7VA 4FYDA 3POTA 5KI6A 4LF8J 1HBUB 2ZKUA 4J2BA 1WC3A 3A5MC 1JXBA 4O44B 3NF7A 3AA3A 4JI2J 2ZH2A 2NYIA 5BRHA 1X5OA 1NSKL 2BRLA 1DLOA 4CF9A 3OYCA 4DUYK 4WYBA 2QSWA 4W4MA 2DRDA 1T9XA 5DQHA 1T02A 2FUG9 1WB9A 4O3PA 4FBTA 1RT6A 1ZM3A 2H9ZA 1S77D 3KJFB 4OI4A 5IXUA 4MKAA 3RJMB 2AEMA 4B1YB 3BN4A 2OMLA 2UXDK 2NRVA 4J2EA 3R6GB 2F4VF 1NOYA 3TSPA 2M4MA 2C3OA 4DX7A 4WQ5C 4RNFA 1FD2A 1IH7A 4UQGA 1XERA 3PNIA 5AQTA 1IR1A 1XQSC 3C15B 3K17A 3HHNB 1J5OB 3BZKA 1R8HA 4DR6J 3VQTA 3QSYB 4ATNA 2DNGA 4QIFA 4JI1F 4C3MA 2YKOA 2YNHA 3QJJA 4LF6K 2BV3A 3LUYA 5J2MB 5M1NA 3BPSP 3R5DA 3DOMB 4IUFA 2P6TA 1RHQB 2DR7A 3V9ZA 3T1HK 3G96A 4B3MF 1U24A 2M0GB 1QUVA 2EWHA 2HZVA 1G2EA 1ASVA 1OVQA 1D09B 4DU7A 1TKXA 3L9ZA 4PPZA 3KKSA 3CFOA 4DR3K 1AFIA 4CF2A 4YB1P 3TTCA 2BQUA 4LRAA 3LAMA 1Z26A 3L7OA 4KC5A 3BP8A 5HO4A 1X5PA 3CJ5A 5T7LA 3QB0A 3WDOA 3ZSZA 1TAUA 2UXDF 4DSIA 3K2YA 4X66K 1TMMA 3GFXA 2YKNB 2Q0UA 1RT5B 2HBYB 2HRYA 2PC6A 2E2OA 1BCMA 3IS9B 2Q66A 3ZSOA 3GBTA 4ISFA 2DVIA 4NCAA 3SBMA 4J9PA 4O3QA 4HT7A 2QEXN 2V69A 2KZZA 3DLEB 4DUZK 4L3KA 2QT7A 3NCPA 4GRSA 2ASMA 3PIOL 1CQMA 3G8SA 4XIUA 2CFXA 4RU2A 3KIOA 3GV5B 1JKHA 3B6OA 3AARA 4HUEA 3L2UA 4LR9A 2P9EA 1BA1A 2UU9K 4LF7F 4M95A 4E98A 2RQKA 2HHHJ 4DTSA 5KFEA 3ZLJA 3HPOA 4L6V3 1NGHA 5AE3A 3QRRA 2B6AA 2Z58B 2AF6A 2RMLA 4AQYF 2DB1A 4M3WA 5C2GA 3OTEA 1UEUA 1UVIA 4ED3A 2DYAA 4JKGB 3KHRA 4RNOA 4PABA 2COLA 4ZVRB 4FJJA 3P6YC 4NMXA 2AW0A 4NCGA 4FF2A 5KFPA 3Q23A 2FZCB 4S0MA 1NSAA 4PG4A 1DLOB 3WIUA 3CC2S 2IM0A 3CJ9A 3MECA 3CJKA 3NAIA 5KT4A 4ED1A 4FKXA 4I9QA 2F8HA 1HKCA 3WNFA 2VWBA 1WSJA 3B4MA 4Q7AA 4H4KA 3UD5A 4YY3K 1VOMA 2LECA 3QNNA 5KTQA 3PKMA 3W5XA 2V9KA 1FXLA 2M5YA 4RWXA 4EEYA 4KTZA 3HL8A 3FFIA 2Q36A 3C6UB 3EGVA 2AP6A 2Q43A 4IDKA 4JKGA 3CPEA 4Y1CA 1IJEB 4OZ1A 4FWPA 2FJEB 2AJ2A 3SAFA 4YEAA 2K06A 2N7CA 2XO7A 2FJXA 2E9TA 4L74A 4BR0A 4KY3A 1RAAB 3CCMS 3QWPA 2UU9J 1XR5A 2J8AA 5AFUA 1IKYB 2MZQA 3CCMN 2P2CB 1TK0A 2AGPA 4RW7B 4LF7J 5ITHA 3JYTB 3V4MA 5ETTA 3MPYA 3OYAA 4DV4J 5EX3A 2JWLA 3DGPB 3OVNA 3Q8RB 2FYXA 1TK8A 2JC1A 1DURA 1N5SA 3FQLA 2HVHA 4YHHK 5HLFB 1OYEA 4LF9K 3QAEA 4NEYA 2Y3YA 1S48A 2VONA 4WFNQ 1R6YA 5K14A 4NWBA 1LWCB 4NLOA 2FBYA 3ZX3A 1D0EA 4CFCA 1H2UX 2XY7A 4CW7B 3OL7A 4DS4A 3L7PA 2A2CA 3D1QA 3ULHA 3M7VA 1H98A 1CJTB 4X64F 3AY0A 1XBWA 1QHTA 4BC2A 3DRYA 4DLGA 4FYXB 4OI1A 4Y1DA 2Z1IA 4IEIA 1CC8A 4H5RA 2V2VA 1HBNB 4JI0K 1T9UA 1G6BA 4ED8A 5KFUA 2BE2B 3CCRS 5IC4B 4LR8A 2W8KA 5LL6d 3T69A 2X78A 1XNRJ 3SSRA 2Z8QA 4UOHA 1B0PA 4FXDA 1D9DA 3K0JA 5DDQC 4K2JA 5J1EB 5HRSA 4CF1A 3DLJA 3ZT1A 4KFBA 4K59A 4Y65A 3MWTA 3PRDA 4F50A 1TKTA 2F1FA 5HMXA 2V6AA 2ZWPA 2FBVA 3ZZPA 4CIEA 4LBPA 5KOXA 4ZIWA 2HHSA 1YJ9S 1DY3A 4NZ7A 3UO0A 1JJ4A 3VEZA 4PG6A 2NXNA 4DV4K 1R3NA 3AO2A 1O6XA 1I3AA 4CEEA 3A3PB 3BBFA 4ECTA 1JNRB 4QS9A 1N36F 1BD6A 3FK4A 4IOCL 1TGOA 4QWCA 4LF9J 4WPAA 2E9RX 4YR0A 3O9UA 3TVKA 4ECUA 4DFPA 4AH9A 4JYAK 2LQJA 4E7LA 1OS5A 3MXMA 2LDYA 4F4ZA 4DL0C 4J9MA 2W2NP 3M2VA 3EE9A 1YKWA 1AW0A 1UJ6A 2NSBA 3H0PA 4XH5A 2G8WA 3K57A 3IG1A 1KFDA 3TO8A 5GINA 3GR1A 1BXNA 4NLVA 4HCCA 1IR0A 1S1VA 1ZAWA 4G6VB 4WFXA 2BW7A 1FK9A 5KG3A 5LMUK 2P9SA 3V4IA 1RBOB 1QE1A 3CMAN 2QG9B 3SJHA 2WUSA 4K8RA 3LP0B 4AYBD 5D15A 1YRTA 2CWKA 2E5IA 4MQ3A 4I69A 3V6JA 4URQU 1FRMA 3TJ9A 3NWRA 4KRFA 2VOPA 3ZX2A 3WIVA 4KHPK 3VQ8A 3DDKA 2VA3A 2N82B 2ASJA 3NCQA 5KAKA 3P5BP 4RW8B 1ZBIA 1B0VA 2QIFA 3DU6A 1N5YA 4GC6A 1X1PA 3PR4A 3A3OB 4RWWA 3J7YU 2R2RA 4N76A 1IO2A 5L46A 5ETMA 3KK2A 1FRIA 3NCIA 3TA1A 1OYDA 2NRZA 3G0ZA 4ZCIA 2PSZA 1GEHA 1SQFA 5IM0B 2N4CA 1U8WA 1YLXA 1R6VA 3GILA 4ID5A 2M52A 3MEEA 2O3DA 1X5SA 4OYPA 3J7A1 3H2LA 3SQ1A 2R9LA 1LEOA 2YQ1A 4PG7A 3Q8QB 2HMIA 3RB0A 4PG8A 3DWLA 3UW1A 3A8YA 3VVTA 2KRRA 2HQCA 1BHLA 3SJJA 1PAUB 4OPKA 3VF0B 2YQ0A 1IG8A 1VBXA 1FDBA 3QMQA 3H3OB 3H2UB 2UXBJ 3IUCA 2KXFA 3IBPA 3V1OA 2GX9A 1FX4A 4DUZJ 4FJNA 3D66A 3WZ0A 1J5EK 1NGGA 2OSRA 3I0RB 4DV5F 3KG4A 2W01A 4LF2A 1JIHA 2P9IA 3NGIA 2MSSA 4K4TA 3G87A 1NHUA 5AQMA 2VBZA 5GADU 2BQRA 1OQ3A 3R1LA 4BDYA 4K0KJ 2OTLN 5KFVA 2HNZA 4RUHA 4Y2KA 4JKEA 5F8IA 2EG1A 3ZT2A 1T6CA 3CJRA 4LQ9A 4M5NA 3SPYA 1B92A 1D4XA 4FP9A 1S1VB 4AL7A 1HJOA 1H3DA 1NRKA 1HLWA 4DTPA 1Y5IB 4UTGA 3ULDA 3MXHP 1RAOA 2BE9B 3S1TA 3WXIA 3TZWA 1S0MA 1KTQA 3KK7A 2GMHA 3G71S 2RQMA 1EAYC 3NMUA 4PYAA 5J2QA 5D3GA 1N8RO 2ZNYA 5LSOA 4PKDB 3UD4P 2D4WA 2W9BB 4JHDB 4H8KA 2OD4A 2WW8A 4HCBA 1XJWB 3ITHA 2KO1A 4UT4A 3MTKA 4OYZA 3A13A 4ZA1A 3TX0A 1NMEB 1BDGA 2BANA 1S6OA 4C8KA 4AHCA 2MDAA 1VQMS 4HUFA 2R7OA 3MDFA 5A2QU 5EVZA 4DPOA 3FSIA 1CJVB 4JBCA 5F8GA 1JX4A 3NGTA 6FD1A 3D4JA 2R7VA 4KHUA 1W7AA 1S9GB 2DNYA 3L4IA 2B9EA 2G8VA 3O08A 3CJ2A 3MF5A 5CZ2A 1MN7A 3M8WA 3SAHA 2WW4A 1REGX 4KH1B 2F8SA 4DR7J 3QFWA 5IQ6A 5CYMB 3HHLB 2IMOA 1GX6A 2V8DA 1R0AA 5D4OA 4H54A 1NGBA 3EDQB 4RBTA 2DHAA 3CJ4A 4ZMMA 3QPIA 4LMZA 1M5OC 3THPA 3AVHA 4BVOA 1MLAA 1MROB 3F73A 1P90A 2YHAA 5BRDA 1SKUB 3CCWA 3RSEB 1TQLA 4M3YA 2HNDB 3RBXA 2IY5B 3H59A 1RWXB 3QEWA 4L8RB 3AVIA 2XS7A 4ANCA 4JKCA 1BIUA 1RP5A 2HQIA 2HHTA 2J9DA 1RT6B 4FLWA 1S1WB 2FD2A 1LW2B 3LDLA 1IQZA 5HL7L 2GCFA 1N33J 3TJ8A 2IM2A 3GJQB 3BZCA 1XNQK 3EX7B 2R8IA 1F2GA 1N88A 5B8HA 1ZZFA 2MB0B 4M5JA 1XIQA 2G8HA 1LW0A 2BYCA 3CJ3A 3IWXA 4N41A 4ZP8A 1SUQA 4PWDA 1HD1A 1FI4A 4OMFG 2VJVA 5DETA 3BF3A 4I68A 4E8UA 3J80U 4IOAL 1JJ2M 4RZRA 3LGMA 3PZPA 1YSJA 2CQ2A 4URGA 3MN5A 4KTWA 2RILA 1RILA 2P9PB 1C1CB 1WWHA 1N8RT 2NRRA 4QS8A 2Z2ZA 2LLZA 2YNIB 4OJRA 5HOOA 4DV7F 2C2NA 3RB4A 3R5JB 7FD1A 3ID6A 5F0XA 4FW1A 5H9FJ 4LF9F 1WEXA 4DCHA 5B0DA 2MJNA 1EQ0A 3BN7A 4OYWA 2UXCF 2GHVC 5EOYA 5AQWA 1KTVA 2ZOMA 5LOQA 3MUTP 1ZBFA 4CJTA 4X66J 1VQ8N 4QIWD 4EUVA 4PPDA 1IJJA 3H4DA 3OY9A 4ES3A 2F65A 1V9OA 3VHQA 2E66A 3I55S 3ZC4A 5ETRA 2H3EB 3RU0A 3RB6A 3ZZTA 4YHHF 1FO1A 1SC6A 1HNXF 4YOEA 3H7HB 2RT3A 5LJ5Y 4ZJLA 1FEHA 5E5NA 2W2OP 5EU7A 3FZBA 1VBKA 5EY4A 3TPQA 4DR5K 4WK1A 2BGGA 2ATLA 3BQ1A 4ZVUB 1VC6A 4IJAA 3UWTA 2QGFB 4U8VA 5KG6A 1C1CA 1WKJA 3MEGA 2CYYA 2W6KA 4LREA 1JJHA 4YB5A 5GVQA 3LP1A 2YJFA 1RTIA 1NH7A 4GVLA 4YS2A 4PR6A 4OVLA 4J5OA 2BUNA 3QT8A 3C19A 1NDLA 4V19X 1S9EB 1ITGA 5FDLA 1LW0B 1N5YB 1WF2A 3N28A 2QWOA 2P9KA 1RADB 2XG8A 3VOVA 4N8NA 3O8MA 3X3UA 2VKRA 4K0KF 3MX2A 4FL9A 3BKUA 5AQZA 1BA0A 3PX6A 4NLUA 1GOAA 4CT9A 4DTRA 4YDUC 3BEGB 4IR9A 1S72S 3F41A 2CPIA 3IS9A 1FKPB 3MMBB 2V7ZA 4O3SA 4DUYF 3HX9A 4AM7A 2CPJA 2C2MB 2KHCA 2UV8G 4QCLA 1UMJA 4CGFA 5GAEI 3VESA 1HL6A 2QSFA 4DV4F 3LW5C 3CFRA 1FXRA 3MR7A 4DN9A 4DTXA 2DXEA 3OLAA 3J81U 1P6TA 1QVFR 3M8RA 3F5TA 3IAS9 3NE6A 4L72B 2DNMA 2FLNA 4CJ7A 2K7JA 3GDQA 2W1BA 4IYQA 4NA2A 3R97A 3JXUA 4GKJF 3W2WB 3VGKA 2ZH5A 3NGKA 4YB7A 1YRXA 3HPGA 2A40A 2BH1A 1K8KB 1YJWS 4LT6A 1NHKL 1REVA 1CULB 2F96A 1HNWF 1QTNB 1QQCA 4DR3F 3QBWA 3SCJE 4OZ2A 1WHYA 3Q8PB 3TR5A 3R5AA 5AQSA 3PACA 3AJDA 4E19A 2RHQB 3TVZA 3BO2A 3GG4A 3CSKA 4DMZA 4X4NA 3NL0A 5CABA 3W5ZA 3ZTPA 1MMDA 4JI8F 4M3XA 4MT1A 2CQIA 4XDDA 2ZJPQ 1TL1A 4DSEA 1RTHA 4M3ZA 4F4AA 4B17A 3HHLD 2V51B 3VZIA 3MHYA 3PUFA 1BISA 1X4DA 1NG9A 1PJ5A 5AXMA 4OGCA 3OYHA 1JCEA 4F3MA 1TKZB 2HW3A 4F3OA 4ER8A 2IYIA 4BE1A 4X4VA 1HNZJ 2GEMA 3BGRB 3IMXA 4ZVHA 2BE7D 3KK2B 2KL8A 4DPUA 4DQSA 2H5IB 2VKZG 3QFUA 2Z1JA 2IBOA 2GMJA 4H5NA 4KHQA 4UOCA 3LQVA 4QWAA 2OPSA 1Y00A 4OI0A 3WNHA 2EC0A 6FDRA 2C3UA 2HVDA 2KHOA 1NGJA 1EKEA 4PKIA 4TSXA 3THXA 4DR4K 2MQOA 4FOIA 1YDLA 4FO0A 2VFSA 1GXLA 4RPFA 2DNNA 1DQ9A 3CUNA 4B9TA 4FYWB 2IYGA 3A8IA 3L09A 2UXDJ 1S76D 4RW6B 2NUBA 5IT9Y 4WZQA 2G8KA 3V4IB 3ZZUA 3L6QA 4Y6IA 2CZ4A 3BSOA 3EE3A 1VC0A 1EP4B 5H9EJ 2W41A 1TL7B 3GOIA 4CF8A 2OP5A 1DZ5A 2WTFA 3C46A 5AXLA 2VYPA 2J7KA 4DV2J 1G15A 2KYXA 4GKKJ 5AQVA 3UKUB 5CYJA 3EKUA 4M1KA 1GLLO 1XI1A 3S6EA 4XK8C 4KHRA 4ICLA 4LF6J 3BQ2A 2F40A 4O5FA 4X4SA 4LFBK 3EL2A 4QQBA 4CBXA 2P9LB 4JKBA 4Y2CA 1U09A 5AQKA 6AT1B 1F5BA 4B3MK 4HLBA 3LGHA 3QGHA 3D54A 4JI6F 3CTRA 1WHXA 5GAEU 4Y2MA 3H08A 2FGOA 1I51B 2UXCJ 3PEHA 4OX9J 1S0OA 2HIQA 5AQGA 4ECYA 1O5JA 1TL5A 1ZYQA 3DXKA 4PY5A 3D7SB 2LEAA 2VC0A 1DARA 2FZGB 3M8ZA 2HQ3A 4FK2A 2HFUA 5BN9A 2VHGA 4CJFA 2KW4A 5B09A 4DL7A 3AO4A 4BRAA 5CCLA 2Q97A 1FJCA 3SYZA 2OYQA 1TKXB 4QAGA 3I96A 2EHGA 2K8GA 3QGGA 3WXMB 4B9UA 4RUBA 3R1HA 4E7KA 3MI7X 2FVPA 3BSCA 4JUZA 5HRNA 3B6PA 2OFGX 2E6MA 4JV2A 2RS2A 1RWVB 3CWJA 3PIOQ 3CXCM 2EK6A 3RRKA 3OR2B 3NGZA 2QRRA 1N33F 4PAAA 3TWZA 5E2QA 4EYHB 3V6KA 4OPAA 4KTQA 2VBXA 4BC5A 3KDNA 1PAEX 4JKFA 1C0UB 1WDTA 4KPCA 3PX4A 2R7WA 1ZBTA 3OYFA 1JWWA 1G7CB 1S49A 4QWBA 4EP4A 1UWBB 4ALZA 1RTIB 3J8AA 1KVAA 4IJNA 2BABA 2A3JA 3TAQA 4UOFA 3GYGA 1IXKA 2CJKA 4RWTA 2VQFJ 4F02A 3P5JA 1CLQA 3OR1B 4H4OA 3SUNA 3OTOJ 3SMPA 1HBMB 4B9LA 1GLAG 2LU1A 3ZO7A 3O4WA 3GONA 3CMAS 4OPJA 3TNVA 3BSNA 1VRUB 1FKPA 2H4WB 3W3DA 3NHGA 3BH7B 5HL7Q 2OPPA 4I6YA 4LF5J 3QFHA 4ERDA 4K5RA 1FHTA 4I2QB 1CJUA 2YQ3A 2UV8A 2XZDB 5LXRA 4MDAA 4CLYA 1NLVA 2QLJB 3W2VB 2V52B 4O4GB 2CNOB 3AD9C 1F5AA 2A6AA 2FF6A 3HFVA 3VF4A 3P45B 1HR0K 3BDEA 3MPUB 2GWJA 4JK8A 2LEBA 1QAJA 2I7NA 5DS7A 3I5BA 1XUPO 1YIJS 3CC7S 2OPRB 3DMJA 1AFJA 1LFWA 1Q8IA 1WJ9A 1JLGB 1XMBA 4QW8A 3NFAA 1WC5A 5E84A 1TV6A 2BRKA 2GQCA 4ILMA 3VVUA 3EDRB 1RACB 1VSKA 2O4IA 4YR3A 3O6QA 4C3LA 1RA6A 5K8PA 5FRNA 1FT8A 3IRXA 3K9KA 1YJWN 1GAOA 4NRUA 4MYTA 1RKJA 1XN9A 2FHJD 4TLQA 3JSRA 1SC1B 1OH7A 2RJZA 3AAPA 3M2RA 2HZAA 4Q2MA 1FJ7A 4DLEA 2DISA 2VJUA 4BRFA 4WYWA 5IT9U 3FCVA 3J7ZO 1D8YA 1OJ4A 2EFVA 3BS9A 4KH4A 4NL5A 4IEEA 4IZ9A 1WTFA 2JFKA 2CRLA 5BXIA 2OZMA 5HAOA 3C95A 1H72C 2E1MC 2OTJS 3AT1B 4ZJOA 4ECRA 4BRGA 2MZTA 2I8EA 3M9MB 1H7XA 1VHIA 2CQ1A 1K6YA 3OYDA 4A59A 4DR1K 5M2UA 3CF5Q 4JI5F 1SKRA 5J1PA 3A8JA 1HBMA 4RNNA 4FWSA 3P96A 3VCDA 1SH2A 3KNAA 4ILJA 1DEJA 2WVEA 4ILRA 4FDFA 4X65K 3GZ7A 2WVDA 2GQQA 3PO4A 4OIXA 1JLGA 2KKZA 5C5JA 2PEBA 4B3RK 3N79A 3HK2A 4CYUA 1GMWA 4NPOA 5TKYA 2VG6B 2CG8A 2Z2LA 1RCOB 4CJ4A 1T9YA 4JKDA 5IT0A 4X4PA 1Q53A 2HBKA 4YMEA 3O1BA 5AQRA 2LU2A 3M6WA 3W2VA 2JH3A 5JXSA 5EX5A 1AROP 3U4LA 4CLTA 5HQ8A 3T6JA 1HWLA 1JL2A 3MM6B 4CERA 2JL9A 5AQHA 4ZPAA 2XCAA 1JCGA 1M5HA 3PXGa 2AGOA 3EZOA 5D4NA 1HI0P 4G3IA 1T9VA 2J6SA 3OTDA 4FLZA 2AT1B 4DCPB 2DGQA 5HANA 2OPQB 3NGSA 4BE0A 3CCQS 4HACA 3RAMA 3M05A 3I0SA 3QEIA 3AA4A 1C6VA 2LCWA 3UKRB 4LBHA 4AILC 5HMWA 3JS6A 3LWMA 1FKAF 1QZ5A 2WOMA 2HZCA 1HD0A 5M2PA 2PA3A 4KGMA 3HP6A 1UVKA 4RBUA 1CXQA 2VICA 5CYQB 2Z1HA 1JKHB 2DTUA 2OFHX 1EETB 3CO0P 2AJFE 4ANDA 2W7AA 2WAQD 1IBLF 1XMQJ 2L9WA 3M3ZA 4DKWA 2JWNA 3VGVA 2HHHK 1QD1A 1KP6A 4RKUC 1Q7YO 3O5TB 4K4VA 3CCZA 3FMWA 1UA0A 2VH7A 2RAQA 1YVFA 1QSYA 1WTBA 4GV6A 2PFDA 3M8PA 4M42A 1W2BR 5C2CA 4JEPA 3ZFVA 1N48A 1VMBA 3ISND 4ENOA 3JTOA 4LF6F 2ZGYA 1QDUB 4FCYA 1R89A 4DFMA 3T5LA 3ZTQA 2NZ4A 3I5CA 5J2QB 1LK5A 3VAHA 3LPUA 3ZXWA 2FJDB 3OUYB 3P4IA 3AV9A 3G82B 2CJ9A 4M5MA 4FWRA 4X84A 3BSAA 4GV3A 2D3O1 3KJVA 1M1GA 1UTAA 1YF5L 4TN2A 3NKYA 1CSJA 2OEJA 3VQDA 2EFQA 1VQ9N 3OFFA 2VFTA 4OJGA 2E44A 2HF4A 4O3OA 1IUJA 2EBEA 1RSCA 1HNIA 3HCXA 5CZXA 4BLGA 1GTHA 3KMSA 4BR9A 1F21A 4PWDB 2VASA 4H4KC 4X66F 4OKKA 4ZOSA 4JK9A 5DZ7A 2XRIA 4USTA 3JSYA 1MNEA 2AYEA 1B3TA 3GYNA 4NLSA 3RMCA 2WONA 1MU2A 3SQ4A 4F26A 2K2PA 4XO0A 5C24B 1RXOB 4JS5A 2E7WA 1SB6A 1DJ0A 1UPPA 2DGXA 2CADA 2U1AA 4FZXC 2G0CA 3LDNA 5LXYA 2C28A 3TP2A 1Q81T 3QRPA 2YTCA 2ZD1A 2NRXA 1HNZF 4EBDA 3FRZA 3ZEUB 3EY1A 2DNOA 3CCUN 2UU9F 3KXDA 2ZGZA 4Y28C 4EGLA 1RAFB 3QZ8A 2HOEA 2CUYA 1LAVA 2HVIA 2D69A 2DHHA 1F0XA 1YK9A 2YPZA 3QIPA 3M8PB 1KN6A 1KVCA 2JLFA 3BZQA 1XNQJ 4FJXA 1X0PA 4AHTA 3HHEA 4OI2A 2JVOA 2KT5A 2EC2A 2ZH6A 2M70A 1D3WA 4N56A 1RT3B 1WG1A 4CJQA 4CZKA 5CXTA 3O9TA 3PRBA 1LW2A 3DKDA 3AO1A 3RMBA 5F8HA 2ZH7A 1RISA 2HVZA 5MLCV 1F60B 1X0FA 5KG2A 2FZKB 4EHTA 2IC3A 2DBBA 1FKOA 3NVMA 2J9CA 4ZPTR 1JB0C 1MG7A 4YY3F 4KQZA 1YZ6A 3GIRA 4DMNA 1YJTA 3OR1A 3VV2B 2YNGA 2QEXS 2CWXA 4X4QA 2NREA 3W63A 2FY1A 1CZBA 2N3OA 1WUAA 2GS8A 2NPFA 4MLHA 2VWJA 2XQCA 5E3AA 4DL4A 3G8TA 1Q8LA 4WWSA 2KG1A 3TEGA 3NDKA 3EXCX 3BEXA 2PO4A 3HOTA 2HIYA 2R8GA 3ZZ0A 4R0EA 4DS5A 2CJAA 1FW6A 3SFGA 2QYGA 2IOCA 1NK0A 3HSZA 1WC0A 4DHVA 1RTZA 1SIZA 5A0YA 1KQGB 4USUA 4DR2J 1Z25A 4NASA 1RK8A 1RT3A 1RWWB 2N4DA 1SJ1A 1TMJA 5K14B 4OX9F 2C3PA 3UCUP 4DI6A 4KBOA 4BRKA 2DITA 1L3VA 4CJRA 3I55N 1MA9B 3D1HA 3DJCA 4WQ4A 2CXEA 1UEKA 4Z4HA 3DRSA 1N32F 2VG6A 3H42A 2LYVA 2ADCA 3Q2TC 2PIIA 5I9EB 3FSYA 3DYAA 3W1YC 3SI6A 5E3RA 5GMKa 5BPNA 4ELUA 3HT3A 2ZJPL 2YVSA 3ZX0A 4I4BA 5L1KA 3SUPA 3PHEA 1JL1A 3ENBA 2O8EA 4GKKK 5HMZA 3EZUA 1ZA1B 1N34K 1WLJA 5EX0A 4BGAA 3OYJA 2QLBB 4FZZA 4UZCA 5THWA 1E6YA 4LRDA 3MMBA 3QLHB 1WSFA 2D3ZA 3NH0A 2P51A 2RE1A 2GGPA 3CD5A 3H4BA 3B82A 2IVMA 1SS6A 1QSLA 1QHAA 2B4JA 1WEZA 4IH6A 2DEJA 4CLWA 5I3UB 3U27A 3ZZZA 3T1YF 4KHYA 2CJYB 2ROGA 4FK4A 1BCOA 2YHXA 5HROA 4EAHD 1C1BA 2DNRA 1Q81O 2J9DE 4FZYA 4WF9Q 2CQPA 5AE1A 2E7XA 3P8BB 3L7UA 2AYMA 1XMQF 4J9KA 2UUCJ 4O3NA 4CYUB 3RG6A 3BO4A 3G2XA 3DNCA 4CJ5A 1RQ0A 1F6TA 1HQUA 4N77A 4LBIA 2WMMA 3CMEN 1NB7A 2X1AA 3G10A 4IFVA 3OYGA 1RLDA 5BREA 3QYYA 3MAAB 2PI5A 4LIRA 3E8OA 3SCIE 4M5LA 3MR6A 2JX2A 4ID5B 1YWXA 3AHPA 3HVTA 3KKRA 2ZUAA 3FBFA 1WSHA 4MN4C 5E7OB 2QWLA 5H9FK 2AMCB 3VAIA 2H4YB 4M3RA 1S6PB 1VJWA 3MGJA 2R8JA 5HP1A 2PMHA 1Q8KA 4L75A 4FSVA 4UZBA 1HBUA 4PXEA 4TU8A 2V94A 4H0OA 2F8MA 2KG0A 5J2NA 2XMWA 3MUVP 4KIAA 5EWEA 4ZTFA 2CDRB 3CCVN 5JJBA 3D3BJ 4JI7K 5U47A 4G1PA 3MX5A 2VQEF 3P38A 1S10A 1PBAA 4EHUA 5D78A 4MYUA 2GUIA 2Y0SD 2D9PA 1NSQA 4FJLA 4WFZA 3U6FA 4YOXA 3OBIA 1KVJA 1IKXB 3J81O 1HI1A 2GVDA 3KLHA 3RR8A 3S41A 1BQNA 2PDAA 4R25A 4WKRA 3LPEA 1RWPB 4E3SA 4EO8A 1L5UA 3MM5A 3H45C 3JAMY 2EI5A 2P5GA 1GLDG 2UUCF 1C4AA 1VSHA 2ZC4A 4RJVA 3TEHB 2V2KA 1UFWA 4EWTA 2VG7A 4P2SA 1OH6A 2E5LJ 4IKFA 2V50A 4OYMA 2DIUA 4FJ8A 1EKRA 3HDSA 2IRUA 2UUAK 5A2QO 1XC3A 3TVYA 1FRLA 3UD3P 1VLOA 2M8DB 3DGVA 5AXNA 4QPTA 4YDXA 2J6TA 4DR6K 1M5PC 4FLXA 3BGFA 1J6ZA 5KPRA 2C3MA 3DGPA 4AQYK 3OVBA 4DSJA 1VQPS 5B0AA 2WOMB 1VRTB 5DG8A 1Y5NB 2AA4A 1EARA 3CJ0A 2QMWA 4GMJB 2CGJA 4IDHA 3TUIC 5ETVA 2QM1A 1SJQA 3P3DA 1F5CA 3ZYYX 1ZA2B 3CXCR 2CQHA 5AZJB 2D41A 1BI4A 2DXDA 3THYA 4CLUA 3TUJC 3DXSX 4DUYJ 4ZPCA 2YWFA 4HTIA 1T3OA 3PCOB 2KDOA 3OBWA 4CZFA 2PT0A 3QESA 3L4QA 2V7YA 2OEKA 3EZWA 2MZSA 4DR4J 5DM7Q 4M45A 4ZCLA 2BACA 4QYRA 1G99A 4K5SA 3OL8A 2O8BB 1GLJO 2MMYA 2XWXA 1AT1B 2HBQB 1I94F 1NGFA 3QGIA 3R2DJ 1OO0B 4CH7A 4JLHA 1D8ZA 3NAEA 1FEEA 3ZTSA 3NXZA 2IBKA 1S1UB 4XPCA 4PZVA 1B0TA 2FBTA 1IBCB 1NPRA 2RU3A 4QIGA 2MQNA 2OLWA 1AUDA 3A1YG 2ETJA 2XLJA 2QWMA 3UDCA 1Z4UA 5BN8A 1UZHA 3SBGA 5G4DA 1NGCA 3F9MA 2ZBRA 1J54A 1GNKA 5A8RA 2CAJA 3ZSRA 3QERA 2VU5A 3B8HA 4QWDA 3MR5A 2YX4A 4OV6A 1YBTA 2LSNA 5MLCQ 2W42A 4BVPA 3OTBA 2DCLA 4QR0A 3F2KA 3IBWA 4OKJA 2HBZB 3V6HA 3JXOA 2KI2A 3W3SA 1MU2B 3ILJA 3I0RA 3S3MA 4MIWA 1RAGB 3VQ7A 4FF3A 3KMQA 2MY8A 3UDEA 4W5TA 2F9WA 2HHUA 2RN2A 4NXMK 2HWIA 5JMVA 5AE2A 1HNWJ 3Q8YA 3G6XA 4LFCF 4BBYA 4ECZA 2Q2RA 1B70B 4CO0A 2XMUA 4URSA 4AL5A 4B1XB 4WTOB 1XR6A 4BC9A 4LRBA 5KG0A 1RU1A 3E01B 3AVFA 1O13A 1WBDA 2V4JA 1Q5VA 2WBRA 4MFBA 1BO5O 4FVMA 2HKEA 2O8DB 1VSJA 4J9NA 3T41A 1MROA 3QATA 4OJ3A 4P9SA 1HPZA 3DDNA 1KEKA 3KTQA 3L8BA 3O5BA 3SMZA 1TL4A 4K42A 4F3QA 3EVOA 2PYJA 2XI2A 1Y11A 4H03B 2PAVA 4DTNA 1GOBA 3MCMA 5G0RA 2O8CA 4XEIA 4R8UA 2ZNZA 4KGXB 4DPXA 3NMRA 4LFCJ 4JN4A 8ATCB 4JRQA 4DR5F 2MY7A 3HVRA 3THVA 1VQNN 3RRHA 3VWSA 3HFZB 4ZPVR 3TAGA 5C42B 3S9HA 2HS0A 1ZC6A 4MKBA 4DTUA 3ZSQA 3IC1A 4NA1A 2FHOB 2HGMA 3MXJA 2Q31A 4DV0K 4OI3A 1VRUA 2RHSB 3LANA 1KDNA 1U48A 5CQGA 1K8KA 2Y1RI 2KRBA 5GIOA 4ED7A 3SPZA 1QVGM 3O9QA 4ZCKA 4I67A 2MKJA 2YKMB 4OYOA 2YBVA 1N32K 4KYZA 2RQ4A 4FM0A 2W7PA 1N34F 4CJPA 4LRCA 5AR0A 3LPYA 3GIMA 2B5JB 3SIPB 2DEIA 3F9KA 4I7FB 4JI4J 1RAJA 2BE2A 2NZTA 4USKA 3CM6A 4NLXA 3OVSA 3SCLE 1J27A 1M1HA 2BJ9A 3NF6A 5AQOA 2HK3A 5MAOA 3A12A 3H5UA 1YX2A 2G13A 4JI5J 4KHPJ 1SJ3P 2FSJA 2WSFC 4DJBA 4DL2A 2KZMA 1Y10A 3GIJA 1AYEA 4G65A 4NYFA 2J8SA 4V19J 2VWKA 4WP9A 2HQGA 4QZVB 2B4VA 4GKKF 3FE1A 4JI7J 1EXQA 5DM7L 1LOTB 2HAIA 3M2RB 3NS6A 1JLQA 2G1HA 3M8QB 4LSLA 5G0RB 5BYSA 3TAFA 4OLBA 1P8GA 2KJVA 1Y5LB 4ECXA 4DV7J 1LK7A 1YJ7A 2BOAA 2BUPA 5HRRA 1P8ZA 4W98A 4NE9C 2M7SA 4BWMA 1RCHA 2CQ3A 2MEWA 4NLYA 3M32A 3VGLA 2OD6A 4BRQA 4KGZB 1J5EJ 3PR5B 1YHQS 1U6ZA 5AZIA 1HW8A 4CZIA 8RUCA 4CWBA 3FQKA 2RUGA 4C7QA 3CT9A 3QBXA 4BACA 2GVZB 2P8IA 4OKEA 3HM9A 4NXNJ 3I87A 3CCJN 4RW8A 4GVEA 3SBTA 1J53A 2HGNA 3ILIA 2NRTA 3QFPA 3C16A 1JNZB 4JI3K 4ED6A 4LF5K 4KREA 4ZIVA 3C16B 1FJEB 3O3GA 2ROPA 2UUBJ 4ISGA 1M5KC 4KSEB 4NCGB 2F5GA 1X4FA 3PRVA 3I8BA 1SKWA 3IN5A 1GLCG 1HNVA 1RT2B 4M5DB 3CJSA 3FZFA 2BM0A 4BR4A 3TX8A 5ADXA 3JQJA 2IVPA 3E3XA 2PYLA 2C2DA 1U1RA 4F2RA 2DCUB 4CF0A 1IV0A 2KXHA 2HQDA 1LWFB 1YQHA 1KAXA 3P4UB 3UE5A 4Q44A 3SUQA 4LRFA 4FLYA 2L41A 2QX0A 5J2PB 2VUGA 3NNHA 2VGMA 4ILLA 2FB0A 3D5MA 3I8DA 1YHQN 4BC7A 5KFDA 4I9LA 1MSWD 3ZZYA 4DX8H 3HT0A 4WCEQ 1RBLA 1APSA 3CMQA 5KG7A 5F0UA 3Q7BA 4EIAA 2BJEA 2I2YA 2YWGA 4A8SA 3DOLA 2DJWA 3VEOA 4FPRA 5KT7A 2Z56B 5FLXU 3RW6A 2GGPB 1LKZA 1TUUA 3FFKB 1FDAA 2AYBA 2L48A 3CC4S 4RU9A 2F8EX 1O0PA 2YCHA 4USJC 2EK1A 1RT5A 3CDEA 1X4HA 2GBZA 3CFPA 1NCLA 1WC1A 4CLZA 4KFBB 1LOUA 2DFFA 3EO3A 1QQOA 1D1UA 3BGUA 5HVFA 3EYZA 1TUYA 3FZKA 4WXWA 4RW9B 2QTDA 1NK9A 3KJNB 2HG4A 3NF9A 3W66A 3S3OA 2LQBA 4OHZA 2OEMA 1U0HB 5HVGA 2HS3A 5KFKA 2A1RA 3VAFA 1Q78A 1HWUA 3KWGA 3NF8A 2UZAA 3O8WA 3DN9A 3UI3A 4X4RA 2HFVA 2W2MP 1VLYA 1C0TB 1M5SA 1PG5B 3QZ7A 2ASOA 1XNRK 2IVOA 4ETZA 2HNZB 3AVGA 3MMJA 4EK2A 3KDOA 3UVJA 3PJXA 3UDLA 1IVZA 3E9OA 2BEFA 2F63A 1X4GA 3QO9B 2AJQA 4FPIA 3AVCA 3HOSA 3QDKA 3EEQA 1I94K 2CNLB 1S99A 1Z1ZA 2DNZA 1HBOB 2X6SA 3GTYX 4BRIA 4OHYA 1HYSA 3AODA 2EKNA 1QTMA 3SK3A 4FWLA 1UJ4A 3ITHB 4C8ZA 1B9DA 2EXUA 2B43A 4WE1B 4BR2A 1URNA 4G1IA 1LFPA 2RKIB 4DX5A 4FVCA 4NZ6A 2CZ9A 2EEYA 2JNJA 3H20A 1T3NA 2HBJA 1IBKK 1WUUA 2E1YA 3TARA 4ZJQA 4U95A 2DHSA 1UW9A 4DV5K 3VERA 3OQ2A 2D74B 1CS4A 2VQEJ 1RJJA 2P9IB 4LH5A 3UCZP 3U3GA 3UIQA 5H1SV 3OHAA 1UOCA 4DG1A 3LDSA 1FE4A 5F2RA 4X4OA 3MEKA 2GAHC 2ZJRL 1NPKA 4F9OA 4F7VA 3B6BA 3H5YA 5E0OA 2VODA 4C8NA 3I5AA 1S9EA 4U9RA 3VENA 4WFAL 1VQ6N 4IH5A 4M5GA 4B02A 2YXLA 3KD5E 2DH7A 3N6MA 1RYRA 3IXQA 3TZXA 4E0DA 3MM9B 1VS3A 1RBAA 4DV0F 3OYEA 5GIPA 1NKBA 2HMIB 5EGYA 3TAEA 3OV7A 3ATUA 2GWKA 3MEGB 2FVQA 4PXDA 4Y0WA 4J91A 3T6BA 3MM7B 3M9OB 1WF0A 3HZEA 1VQ8S 1RNHA 2C2EA 3ENAA 1WNSA 3G25A 4C48A 5M1PA 1T95A 4A47A 5K5MA 3UNGC 5E3QA 2RDIA 4JI8J 1H73A 1D5AA 4W5NA 1YGYA 4PQUA 4HVZA 3GU0A 2MHEA 2DR8A 3AGRA 2PI4A 3EXYA 2OPPB 1SQEA 1JXEA 4AL6A 4D3GA 2ZJRQ 3ZT3A 4H0YB 4AFFA 1HKBA 2POKA 4ILHA 4CFBA 3EPGA 3RBDA 5ETQA 2G1DA 3C6TB 3JSMB 4JKHA 1TVRB 3LH2S 4K4ZA 4J9OA 3BV8A 3T1AA 5L9NA 2VGNA 3D2FB 3V1QA 1FK9B 4GKJK 3DM2A 1A5VA 2NUUG 1BHNA 1KVKA 3HZ6A 1XHXA 2C2KB 1U0HA 1NSPA 1PC4A 1Y0HA 2Z2MA 1BQMB 3D45A 2E5HA 3R2CJ 3THWA 1RDRA 4A8FA 3Q24A 4YDDB 1C4CA 2P9NA 5F41A 1ZPVA 3BF4A 2P9NB 3MN6A 1B99A 3CJ1A 1RE1B 4DV0J 4KGVB 3VQAA 2XS2A 1I94J 5KT2A 3VEVA 2W4CA 2Y8YA 1RDDA 4FYYB 5F3ZA 2HEKA 4M94A 4LFAJ 1VHXA 2WC9A 3CC2N 4FXWA 4C11A 3MDQA 1HHSA 2D0BA 4NYPA 3AA8A 3GCXP 4ZKAA 4B08A 2KM8C 1S5JA 1N6QB 4M5KA 5A76A 5GAGI 4KR0B 3S3NA 1IM4A 1NGIA 3BBBA 5DMRA 1TKTB 3CNQP 2QKKA 2UXBF 2PFFB 4A61A 1VAZA 3VGTA 3SQ2A 2XHCA 1VR6A 2UVWA 1CZ9A 1CBKA 5CZ1A 2MHNA 1BWFO 3WT0A 2ZH9A 1WG4A 3WQTA 1HMVB 3FBEA 1N36K 3AD8C 4ZDNA 3W2WA 2XB2D 1TU0B 2N7YA 4CEFA 1ZTWA 2YKAA 1GX5A 4WU2A 3MFIA 3GG1A 3C2PA 3CF5L 2C1EB 2HFOA 1EP4A 2DXFA 4B3RF 2GV1A 2NUHA 3HPHA 3THTA 1WKLA 3OR2A 1X4BA 2QK9A 1FFWB 2CNKB 3MWBA 4C9DA 4P10A 2P9CA 4GY2B 3GMGA 4PWUA 3TAPA 1K8AO 1T0TV 2CH6A 1FTCA 3UNYA 4CO3A 4HKQA 1SBRA 3CIMA 1WOQA 3IAYA 3QIDA 4ZTJA 3IKMA 3H98A 3JS9A 1KRPA 2DR6A 3CPWR 1FDDA 1IBLJ 1VQKS 3IM9A 4IRCA 1YIJN 3CC7N 3MD1A 1FWLA 1OWXA 1MWQA 4JYAF 3FZMA 2FVSA 3ZNJ1 3MCSA 2KVQE 4DEZA 4AXJA 2QFIA 5FPNA 1NHVA 2RD5C 1SZ2A 5KFXA 2HB5A 4Q0BA 3GFYA 5C12A 4KPYA 1ZH5A 4E1MA 1HHQA 3ZTRA 4DV3F 2LQ9A 3GJSB 3JQKA 2WCXA 1FDNA 5DM6Q 5AJ3F 5JS1A 3M6VA 4R5PA 1X3NA 5SZTA 1JLQB 4JB8B 3GYXB 3GE9A 3A2FA 4DN0A 4NYOA 1T11A 1FXDA 4ZPWR 5AQXA 4MMOA 2KB2A 4CTAB 3HM8A 1R0CB 3HVAA 4NI2B 2ZWHA 2EFPA 3IFEA 4BS2A 2QN6B 3AJ2A 1OY8A 4K41A 3X1LB 5A8WB 1WN7A 4K2XA 3ZT0A 1F9EB 4QPXA 3Q22A 3J7Z5 1KAZA 1SXLA 3O44A 2WRMA 4Y2AA 1OMSA 2KFNA 4AXIA 1R0BG 2HFNA 1WBBA 1Q5YA 2I7PA 1VHFA 3W64A 2YPYA 3IP0A 4CEZA 1WSEA 3UE2A 3U1MA 4ZN3A 1I5OB 3CD7A 4J8FA 5EWFA 2R7SA 2ZZMA 2OELA 5A6WA 2HNYB 2UUAF 3TUPA 3MAHA 4OJ1A 5K8NA 4CJ3A 5D4PA 3NH1A 4DPTA 1HBOA 2DY9A 2MKHA 4M63C 3HZGA 1GTEA 2D3OR 2QA1A 2VC1A 2XY6A 2EWSA 2XMAA 1S6UA 4XDCA 4QIEA 3MD3A 4MKVA 5DG9A 4PG5A 2JLGA 5DQGA 1DFDA 3DU5A 1VC5A 1WI8A 4P52A 4NMLA 5C7PA 2X7IA 4IG3A 2F7TA 3BF1A 1WACA 4BROA 4GO5X 4PXCA 3HF5A 4AHSA 1BE4A 1U6FA 3M8SA 1N52B 3R5CA 4Z7YA 2XCPA 1T9WA 3KLGB 3G6VA 3H90A 1KHVA 3R7BB 3TYTA 3KHHA 2V8PA 3BR8A 1BQNB 2QA4S 5AJ3K 2DNHA 2DO0A 4QR2A 1IKXA 1N32J 4H0VB 1CC7A 3RAXA 1ZM4A 3OA9A 5L38A 2FJBB 1Y7PA 2X1GA 1Z2LA 5SUHA 1H2VZ 3WUHA 3FRYA 4MIBA 3R8YA 1F3FA 5B0FA 2F8TA 3NS5A 1S59A 1EWQA 4JV5F 1CJTA 3CD0A 1RAHB 3VQ5A 3EZ5A 5A8KA 2DNPA 2JEIA 5LMNK 3FJ2A 4HTUA 5BR8J 5ETPA 1JQGA 1JLFB 4KHWA 2NXCA 3IBFB 5F8LA 1YAGA 4B8CA 4QS7A 4O55A 4C11B 2RIJA 3DRPB 1BWVA 2UUBK 1F3VA 3R6MA 2F4VK 3HMJG 4OZLA 3BPDA 3N9UC 2KFZA 3C14A 1Y9OA 4DR6F 5EN1A 3FR0A 2O8CB 2XZTB 3LP1B 5JUMA 2JDJA 3CCLN 4CZLA 2QWRA 1XEZA 3BDPA 4QW9A 1B7FA 3BGLA 5KFTA 1GXTA 2XSFA 4FN5A 1RFQA 1D9FA 4LSNA 3H1VX 3L2RA 1P1TA 1PJ7A 4HEA9 1VSLA 2Z2YB 4CBWA 3C6UA 2L08A 2FF3B 4FPAA 3OYMA 4E1NA 3OPKA 3KOAA 5F3TA 3IM8A 3DOKA 1XMOJ 4PUOB 2ZM6K 2DR5A 4NOHA 3SFUA 4HTJA 2YNHB 3FNNA 3OJSA 5C24A 4CO1A 4BG9A 5FIIA 2KTQA 1RBRA 3QIOA 4J9SA 5HLFA 5M2RA 2Z30B 4DR5J 5I3UA 3VTHA 2QL5B 4RBVA 4ICLB 5DQIA 3W9HA 1YUWA 2ATCB 1UWAA 1N0VC 2CPDA 2C22A 1RBSA 4FWNA 5AZIB 1JLAA 4LVNP 3B54A 3QSIA 1SI9A 5IS2A 4LC9B 3OS2A 1S1WA 4CO5A 2MTLA 3M32B 5E41A 4HH0A 3NGRA 4A8YA 2X3DA 2F9DA 1YZ7A 2R7RA 2UXBK 4YORA 2PY5A 4ZHRA 3GV7B 3LF0A 5GADI 1I39A 4Y0FA 3UCGA 4CJUA 4LD0A 3RBEA 1S12A 2RPIA 1PO6A 5CA5A 5KGWA 4X2BA 1YJNN 1EB0A 2IDOA 4C0BA 4K0KK 1PKUA 3KK3B 1XMQK 4BC4A 3WXJA 4EP5A 2E1CA 3N4QA 5GAEP 2WSEC 2LVWA 1R43A 3TQEA 2AHOB 3HKWA 1EKSA 4N8OA 4BRNA 2B4PA 4Q45A 3Q89A 3W9IA 4FZVA 1VIXA 1Y4ZB 1GQEA 3T9NA 1VJQA 2QYCA 1RGIA 2YKPA 2ZM6F 1HNXJ 1ZZNA 1XMOK 4YB6A 3D2EA 1ACMB 5BR8F 2HK2A 4U67Q 2VG7B 4HT5A 1H38A 2ASLA 3K8WA 3QJLA 5BJRA 2JFDA 4IO1A 3OYIA 2JC0A 3V6DB 4AE5A 3CJ7A 3TJAA 3AQOA 1N5VA 4EBEA 4NLDA 2FLLA 3R5GA 2EFGA 3KK1B 3HSCA 4M3UA 1B7YB 3RTVA 5BR9A 3D7EO 1ZPWX 5BPMA 1R0AB 4F3TA 1ZM2A 4BC3A 3M2VB 4JI0J 4MDBA 4Z4GA 3H6EA 1MWYA 2MZRA 2FLPA 4J9RA 4CECA 3DXKB 3OYKA 2RS8A 3OS1A 2QC3A 1PYSB 2IDEA 3NGUA 4L76A 4UUXA 3A5NC 3T1YK 2E2NA 4X64J 3U7JA 2E5GA 1TVRA 3O3FA 1VSFA 1WC6A 3SSQA 5GAHI 1VQ9S 4CK1A 1T05A 3TQ1A 3SDEB 1DTQB 5RUBA 1LWCA 2NXJA 2ZF5O 4OJHA 3PY8A 3L0QA 2ZBQA 2MQQA 2AEJA 4IXCA 4F0KA 4DOZA 4CHQA 1L3KA 4RTFD 1OY9A 4OX6A 3MN9A 3D0HE 1BU6O 2BKNA 4U7BA 4LSZB 3V81A 1Q82T 1M90T 2PEHA 2MQPA 1NEEA 3C7NB 3W7BA 4XPEA 2V67A 4CIFA 3U02A 2YKMA 2DHXA 4OZ0A 1HPZB 4DSLA 3SZ2A 3E51A 3NP5A 2K1RB 3VQ9A 4B3OB 4PL8A 3MEEB 1G1XA 3HD1A 3DRRB 3R3TA 1NJZA 1M1KO 4CO4A 1V5IB 3G4SN 4KO0A 4LF4F 4ZN1A 2Q0RA 1VQLS 1HW9A 2CPHA 5FJ4A 4ETXA 2NYHA 3BKFA 1XMOF 2K3KA 2YHWA 4KBIA 4V1Ak 5FD1A 3MCOA 2GJFA 5LJWA 4DV6J 1XC9A 4D3HA 5KFHA 4Z2XA 5H9EK 2VQFF 1R8BA 3CPWM 4NLQA 3IBCB 2B4UA 4QJVA 3T5JA 2ASPA 5KFAA 1Q7LB 3JYTA 2BJ8A 3JB9k 5I3PA 5AQLA 2RB7A 1VISA 1U2VA 2FGCA 1F9HA 2EW9A 3WXLA 2LQ5A 2LXIA 2XYGB 4AQYJ 3KJVB 1SV5A 4ZVPB 4E89A 1NM2A 3PFEA 4WYLA 2GO8A 4AT1B 4DR7F 1C0GA 1U45A 3EGNA 3OJUA 2AU0A 3C7NA 1YRUA 2B6AB 4NXMJ 5JICA 2WHOA 4M5DA 1SPBP 2IJFA 4ID1A 2W4DA 3MM9A 1TL1B 5KG1A 4CD3A 1OIAA 4WP8A 3VA3A 5BYRA 2WVCA 3NG8A 4FOEA 4ZP9A 3N5FA 2XY8A 2W7OA 3LP3A 4JRPA 2I5JA 2J7WA 1X4EA 2D0OA 2W9CB 2HMPA 4ES2A 2QLFB 5F8NA 2B7BB 3G8QA 3AVAA 1C0FA 3J7AP 1WORA 4KH5A 1BQXA 4HI2A 2BMBA 1NK5A 4P72A 4CGHA 2YWWA 2RVJA 2HRTA 4J37A 1RHMB 1OQ6A 4KI6A 4JI6K 1LWEA 3AO3A 1NK4A 4CEOA 5AQQA 1CG2A 2IFXA 1ILYA 4CEBA 2GMLA 2B4OA 4WCEL 1DBDA 2GIFA 2PZSA 4C2MA 4Z37A 3EVWA 3MEDA 3G9CA 1IBLK 1M5VC 2DIVA 5IT4A 1RCXB 3R9LA 1HFEL 2KKHA 2JZ5A 4WE1A 1VQ6S 1L3TA 1E4GT 4KKOB 5CYMA 1HMVA 4KB1A 3DLKB 1OH8A 1VSMA 4JI4F 3ZZRA 4KV8A 2R4FA 2JRSA 2B8QA 3KG0A 1SL1A 5I4MA 3TI0A 2MKYA 3C6TA 4TQSA 2CNNB 1X9MA 3FZHA 3K59A 3A8KA 1RT4B 3LDPA 2BW2A 2OJ3A 2ASYA 3AA5X 4TVAB 3U9ZA 4EFHA 3D67A 4BR7A 4E7JA 3ENWA 4CZJA 3J7AN 3OL9A 4WKYA 1B9FA 2R7TA 2GX8A 4DSFA 3EN9A 4OYAA 2E4LA 1M1KT 3QWUA 1C2PA 3HSGA 4DV1F 4BRHA 1HBNA 3HHLA 3ASMA 2OPQA 4O23A 3B8AX 9ATCB 4F04B 2BA9A 2OZSA 4M5HA 3N01A 1RI7A 1ZOTA 3CJAA 1D9AA 3FEZA 3VR1A 2H3GX 3CGIA 3N6NA 1JXVA 2EFOA 3Q2SC 4I6MA 1H74A 4YY3J 1EIYB 3NAHA 3L4BC 3VGMA 1VRQC 4A2AA 2X6NA 4KAIA 4ZVFA 3VZHA 4C4WA 3ELHA 3CCTA 4EO6A 2NXUA 3PYGA 4WQ5A 3KWIA 3D6TB 2MLXA 1RHRB 3PW0A 4C6AA 3H3NO 4OLPA 4USMA 2IVYA 1CJKB 1UEVA 4USWA 1ROFA 4CHZA 1PYOB 2A18A 1AUSL 2QTWA 3PIPQ 2JEJA 4J90A 2WTUA 4DPWA 5B0EA 1VSIA 4QR1A 9RUBA 4UY8T 1KLMB 2OHDA 2H51B 3NY0A 4X64K 3MCAB 3G6ES 3A5LC 4OZJA 4TKTA 1K73T 1HQEB 2C42A 3TR8A 5BRFA 3DRXA 2JWKA 4OLOA 4NXNF 3HLUA 1FJGF 2GJ2A 1ICEB 3C94A 3DC2A 5IWAF 3M9NB 2OO4A 5CH7B 1DAXA 2KHDA 2BJDA 4DQQA 2X51A 3FSXA 1FVQA 4I2PA 4CD1A 1BLUA 3HBTA 5BR8K 3R27A 3HHLC 4C0HA 3DOKB 1HARA 3IRXB 2Q3PA 3AD7C 5HMYA 3BGRA 1E6YB 2D9OA 4OZ5A 2MQMA 3QETA 4LFBJ 5D6GA 2GC8A 3CQYA 5AQJA 2H5EA 2JSXA 3MM7A 2G0JA 3LO3A 1UKUA 2JVRA 4HWIA 5C25B 2V4QA 2IVNA 2XHBA 3M30B 7FDRA 3OYNA 1YBUA 3O1WA 3ZNUA 1ZXOA 4DR1F 2X1FA 1S1TB 4CI0B 1VRTA 4KHNA 4LIWA 2B5JA 4E7IA 4ZLJA 2Q1LA 2IA6A 1HNXK 4FJIA 2VDIA 3LP2A 3C14B 2AGQA 1DQ8A 3HHDA 1K8AT 1SAZA 2FJAB 4TYBA 1VQ4S 2QA4G 1XR7A 2OKQA 1NGEA 3QT6A 3IO1A 1RABB 3PYDA 4X62J 1RT1A 3D2EB 1TFWA 3K5MA 1KOHA 1ZS6A 2YH1A 4KHPF 2P6SA 2ZM6J 4DZDA 3R1XA 1HUXA 5A8KB 2B9XA 1U1NA 3VMFB 2P9UA 5ETNA 1KQSR 1CXUA 3AXKA 3LGNA 1C0TA 4AM6A 2G4BA 5KFCA 1K0TA 2CG4A 4TU7A 3N4WA 3IG1B 2MXYA 3KK3A 4A62A 1NZ8A 3CJBA 1CEZA 3I31A 1A5WA 1TL3A 1YJ9N 2I38A 5AXKA 1QAYA 4DV2K 2GVDB 5JLHA 2PGCA 1GMUA 2U2FA 2GTDA 1TL3B 3RWUA 1TK5A 4MH8A 4FVUA 1RDAA 4C23A 3ONQA 2QXFA 1K73O 3IR5B 2ZHOA 5T14A 4RG8A 2E5LF 2R8HA 3I82A 2E88A 4H5VA 3FMBA 2V34A 1SIWB 1RHKB 1TFYA 1VQ4N 5T41A 3GLJA 3MURP 3IA0A 1VK8A 3SV4A 2H5JB 1URRA 4NEZA 2JJ4D 3FLCO 4PRFA 4C98A 2V9WA 4ILGB 5J2MA 3AQPA 3WHIA 2DY4A 4NLWA 1TKDA 4NYZA 1S4EA 2M88A 1HNWK 1YJVA 3Q83A 3K7RA 4LY7A 5ETOA 5C15A 1JXLA 1KQKA 3AB2B 1O51A 1NJIT 3VQBA 4Q5VA 2R8KA 2ZH3A 1FA0A 2W24A 3AVJA 1QSSA 4IBNA 5ETKA 4IOXA 5LSLA 4UF4A 3PYFA 3IGNA 5LMNF 4UY8O 4Z7CA 4MKYA 4JYAJ 3M1VA 3BM7A 3KHGA 2GO9A 1PSDA 5TKWA 2O8FB 2VBWA 2BR0A 1LWFA 4RNHA 1A9NB 4ZITA 2CDQA 3OT9A 3ETMA 2D5RA 1UVNA 1TUWA 1YJRA 3SV3A 3DLGB 3AJ1A 2NR0A 4CI6A 1TUGB 1HR0J 4FJHA 4LJMA 4DCJB 4ECQA 3K89A 1EWRA 4EZ6A 2R2TA 2Y9HA 5KFGA 1SC4B 1X9JA 1IBMJ 4CJKA 2QXLA 2A3ZA 2VPXB 3ID8A 5CR4A 4W5QA 1RBUA 1U7LA 4B3TJ 1HQ2A 4OGEA 5L9XA 1QQNA 4QBUA 1EZZB 1VSDA 2HLTA 1Q95G 5HJXA 5KFZA 4L3QA 2AP1A 2NPIA 1VBZA 3POTB 2CIMA 1UP1A 1FESA 3OS0A 4CP5A 5ETLA 3HVTB 4JI8K 1HJRA 1U49A 4IRKA 1KONA 4CNZA 3ZTOA 1BMQB 2KT2A 3MN7A 3VQQA 2E9ZA 3O2IA 4CZHA 3CE8A 3ZSWA 1NBWA 2AJ4A 4C1NI 3VQ6A 2NZCA 2IJNA 1IG9A 1RT7B 3O1LA 3OVAA 5CD4H 5DLFA 1WG5A 4KGKA 4ECSA 1GXUA 4A4JA 1KQSM 3RR7A 2HHXA 1UVMA 2FC0A 3WQUA 1KOOA 1NDPA 2WSCC 5L8RC 4B3SJ 3KLVA 2FVRA 3LTOA 2AX0A 3CW2C 4J7CA 4EBCA 5FLXY 2G0IA 1MW7A 1T8EA 1R7IA 2K3IA 3WQPA 1U2FA 4EU0A 4MIAA 1JJ2R 4Y00A 2RUSA 2X1BA 1MMNA 1WEYA 3S01A 4KI4A 3D0PA 4K25A 4W92B 4MLEA 1RUSA 3QEPA 2OPSB 4DG1B 4FXVA 2O8BA 4CM0A 3BQ0A 2UUTA 1UCNA 2FVCA 2XY5A 3EVMA 4IG0A 1NJIO 1NNEA 3QBCA 1N54B 1Q9YA 3L95X 3IWLA 1Y97A 1LXNA 3VAJA 3CG7A 4ECVA 1S0VA 1Y64A 2BXJA 1RTJB 2MZ1A 2XTJP 2LXUA 3SAGA 2LP4A 2NXEA 1IBMK 5ADXH 4DB3A 3RZAA 3THYB 2IRXA 4LFBF 5AJ3J 3LPTA 1PC5A 3HJVA 2DGUA 2ZDOA 2ZVIA 1KR4A 2R7YA 2A1BA 3NBPB 4FLUA 4ZP6A 4PHTX 2ZH8A 1RTDA 5B0GA 2NRHA 3OUYA 3LDOA 1N5QA 4WTYA 3HRGA 4C1NK 2E1RA 1BQMA 4DBQA 1K9MO 1RZMA 3HSTB 3P31A 4WFAQ 4H4MA 4C0OC 4WFBQ 4CLSA 4M41A 3HVWA 4M3TA 2YV0X 3RYLA 1CJVA 2Y8WA 2H1YA 3DXMA 3A5OC 2I0XA 1S9GA 3LM9A 4P73A 4YOUA 1BG3A 5B0BA 1VQKN 4GVBB 4NLRA 1JCFA 4OHVA 1H6KX 3JTPA 2QV6A 1J5OA 3AFGA 5KOWA 4CDIA 2CQGA 3ILLA 4I6WA 1UAWA 2GHPA 3T9ZA 3TZYA 3DLKA 3GCWP 3KLIB 2KYZA 4HHUA 3OTCA 3P49B 5KFSA 4GMKA 1RTDB 2HWTA 1JLEB 1DHMA 3V6DA 2ZWOA 2YY3A 3J80O 1FKOB 1NAQA 1RB0A 4K4XA 2DKOB 2XS5A 1UJ5A 5DLGA 1IWGA 5KQDA 4CGIA 2BVZA 1GH8A 4PEOA 3MMVA 3I4HX