4YFUA

Crystal structure of open bacillus fragment dna polymerase bound to dna and dttp
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
578
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase
publication title The Closing Mechanism of DNA Polymerase I at Atomic Resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 210
structure length 578
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4yfuA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yfuA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4yfuA01
3HT3A 2AJQA 4HCCA 3KIOA 4CF0A 2X6NA 2KQ2A 3B6OA 3KTQA 3K57A 3RR8A 4FCYA 1IO2A 4FM1A 3V9XA 1Q9YA 4FJ7A 4AHUA 1VSHA 2W42A 3V9ZA 4FJJA 3AVHA 2PZSA 1EP4A 4CIFA 3SQ4A 4DFMA 4CHZA 3OY9A 3WNGA 3DM2A 1GOBA 2IC3A 4J2BA 4CFCA 4RW4A 1BISA 1C1AA 2P51A 4DTPA 4JRQA 1X9SA 3L3VA 3NGYA 3IS9A 1NOZA 3OYBA 4FLUA 1QLNA 1RT6A 3AVKA 3T1AA 4LH5A 1IKXA 4CESA 4CGIA 3SUPA 1L5UA 2VWJA 4FVMA 3KD5E 2JGUA 3KLFA 2Q3SA 3SV4A 3TABA 3ISNC 5HLFA 1QSSA 1WSEA 3LANA 4DFPA 3HPGA 3V1QA 1S1WA 1JLCA 2X74A 1LV5A 4LH4A 3CM5A 4DQPA 4E7KA 2D0BA 1KVBA 1SL2A 3CFOA 1JXBA 2F8TA 3KLIA 3LPUA 4KTWA 4B9NA 3LP3A 1U48A 3OYDA 4JLHA 4O44A 3PV8A 2G8HA 1KTQA 2OYQA 3HO1A 2GV9A 1S9GA 4Z4HA 2HNZA 3ZSXA 2OPPA 4FLTA 1UA0A 1DTQA 3SV3A 4B9UA 4N56A 1RBTA 2JLEA 2G8VA 1TK8A 3ZT4A 2QKKA 4F8RA 2HHXA 4MFBA 3L2VA 4DSIA 1U49A 1IG9A 3RRGA 4M3TA 4B9VA 4C8LA 4O4GA 4AHRA 2Z1JA 3K58A 1S6PA 3I0RA 3F9KA 4CJLA 2XY7A 3HYFA 4Y1DA 2PI4A 2EX3A 1Q8IA 3DRPA 1CZBA 3FFIA 3ZSZA 4OLBA 3RTVA 2Z1HA 3LDSA 2PYLA 1F21A 4O55A 1NK5A 4FJXA 1ASWA 3LAMA 1VSJA 2ZD1A 3AA4A 3V9UA 4ZTJA 3ULDA 2YKMA 4PA1A 4DSFA 2X6SA 4CK1A 5FRMA 1SKRA 3VQ4A 4CGHA 4C8KA 3HVTA 3OYGA 4CEEA 3VA0A 1ZBLA 1XC9A 1HMVA 2IDOA 1ZBFA 3QIOA 2G8FA 3TWHA 4FLXA 3IG1A 4BWMA 4CJSA 4Q5VA 4W5NA 1KRPA 3AO3A 3OYNA 4WE1A 2WOMA 1BQMA 3LWMA 1D5AA 1JXEA 4FJHA 4CF8A 1EX4A 2HNYA 4HVJA 4KI6A 1TGOA 4CJVA 3L3UA 1BIZA 4RW9A 3VQCA 3SYZA 5I3UA 2IGIA 4CCHA 3NHGA 3THVA 4I7FA 1CXUA 4DQQA 4FLZA 1LAWA 4RG8A 3VQ5A 3NBPA 2PY5A 1TV6A 1BI4A 1KCFA 3RMBA 1FKOA 4W5QA 1XHXA 1A5VA 1KFDA 1RDAA 1TK0A 3OJSA 1TL1A 3SCXA 1D9FA 1BHLA 1W0HA 1J5OA 3QNNA 4PWDA 2BGGA 1JLBA 2IOCA 3PUFA 1BL3A 3MEGA 1YTAA 5DMRA 3SPZA 3K59A 1XI1A 1KLNA 3O4QA 1NK7A 1BCMA 4G1QA 2G8WA 2PYJA 1HPZA 2E4LA 1S1VA 1RDDA 4FK4A 4EZ9A 3LWLA 5CYMA 4GMJB 2XO7A 4CJFA 3PO4A 3AO4A 2PI5A 3DLBA 3QEVA 3SI6A 3NAEA 3AVGA 4FK0A 4BDPA 1WSGA 4CGJA 3C6TA 1VRTA 3QNOA 4DTSA 4FJNA 4CHNA 4I9LA 5CZ1A 1BQNA 1NKBA 1RT3A 3LAKA 4Z4IA 3OYHA 3P1GA 4CEDA 3IRXA 2Y1IA 3L2WA 4HUGA 4B08A 4IG3A 4CK2A 4QOZB 5C24A 4CJ5A 3ASMA 5CY4A 4M3XA 3OYAA 4CJ3A 1G15A 2X78A 3ZT0A 1UWBA 4CJPA 4W5TA 3ZT2A 3CQ8A 3V9SA 3QEWA 4ID5A 3TARA 2XY6A 4FW2A 1RT4A 2D5RA 3CYMA 3DMJA 4ID1A 1T7PA 3AV9A 1W9HA 3QIPA 3K5OA 4QAGA 4CE9A 4LSNA 1S1XA 3VQEA 4CECA 3NE6A 4E7JA 1NKCA 3AVAA 1D8YA 4NCBA 1DLOA 1TKZA 1WSJA 1T8EA 1QS4A 2XRIA 4FXDA 3ITHA 4F4KA 3JYTA 1HNVA 5EU7A 1GOAA 3WNHA 4CEFA 4DSKA 3OYMA 3OYLA 5J2MA 3KLEA 3NGIA 1WSHA 1U45A 3G10A 3K2PA 4KREA 3AO2A 3LP0A 2E6LA 4CF9A 3VQAA 3OS0A 3NH2A 3QERA 2D0AA 3ZSOA 2P5OA 4BWJA 4DF4A 1TAUA 4C8NA 4PUOA 2A1SA 2HHWA 3KLHA 1HYSA 3HM9A 3JSMA 1T03A 3AVNA 4JS5A 1TKXA 3M8PA 1HJRA 4O0IA 1REVA 4F3OA 3RMAA 4IBNA 1NJYA 5CYQA 1TK5A 2QKBA 1LWFA 1S77D 4H4OA 1J54A 1RBUA 3AVJA 4CIEA 4PY5A 3V1RA 1FK9A 3QESA 4B3OA 3K5NA 1B92A 1RT7A 1C0TA 3NF6A 1A5WA 4NCGA 4IFYA 4M3RA 3HP9A 4AHTA 3DRSA 4CHOA 5HRPA 4N5SA 4DFJA 3IAYA 4FJIA 2B6AA 4FJMA 1MU2A 4B9LA 3AA2A 4KHSA 1Y97A 2OPRA 3HP6A 2XY5A 3K5MA 2KFZA 3V4IA 1QSLA 1JLFA 1NK9A 3ZSQA 4IKFA 1ZBHA 4M42A 3SZ2A 1C1CA 5J2NA 1TAQA 4N47A 2P1JA 1JL1A 3SQ0A 1J9AA 3V6DA 3NH1A 3RRHA 4DG1A 4CHPA 3SPYA 1HYZA 4KKOA 4H8KA 4E19A 5E41A 3EY1A 3QO9A 3C94A 1NK4A 4J2DA 4FM2A 3QETA 2XY8A 4FJGA 5SZTA 1NJXA 3PY8A 4E89A 4EP5A 3K5LA 4DTXA 4KV8A 4DSJA 3AVIA 1N6QA 4CGFA 3ALYA 1WAFA 3F73A 4M41A 1TVRA 5KI6A 4CEAA 1U04A 1L3UA 1EETA 4FJ8A 5T7BA 2OPSA 3BDPA 3MXIA 3MXMA 4AILC 4J2AA 4Y1CA 3OS2A 5KTQA 5HBMA 1DTTA 4HTUA 3UIQA 2HB5A 3E01A 3L8BA 1RTHA 3AA5X 4E3SA 4FZZA 3MECA 4DTOA 1FXXA 3DLRA 2RF2A 4I2PA 1Q9XA 4AHVA 1WN7A 4C8MA 4ELVA 3LP2A 2ITGA 5J2PA 1SUQA 4KHWA 3SUQA 2YV0X 2HVIA 5I42A 1YTUA 3S3NA 4O5BA 1LW0A 3C6UA 1FKPA 5KRSA 1HYVA 1SL0A 1S5JA 3TI0A 1UAXA 2EHGA 3DLHA 3AA3A 1CZ9A 4FLWA 4FM0A 1LW2A 4BACA 3S9HA 2QK9A 1L3TA 1NK0A 3NF8A 1LWEA 4B8CA 1TKDA 3QLHA 3OYEA 4TSXA 4W5OA 3O4NA 1RT2A 4Z4EA 4FJLA 3CFPA 3RWUA 1ZBIA 2OZSA 1NK6A 1HNIA 2YHAA 2Z1IA 5HROA 2B5JA 1KFSA 5HRRA 3PO5A 4CGGA 4FLVA 1VSDA 4EP4A 1SKWA 3KJVA 3KK2A 4I9QA 3PX0A 4CHYA 1U4BA 4ELTA 1S1UA 1WSIA 3T3FA 1BIUA 4RW7A 4AHCA 3VQPA 1SL1A 4OPKA 5KGXA 5HP1A 1CEZA 1KVCA 1RBVA 1IKWA 1ASVA 2DFHA 3AVFA 4IDKA 3TR8A 3ZCMA 4AH9A 4CFAA 2XHBA 3D0PA 2YNFA 3NH0A 4BDZA 4PQUA 2VG6A 4HUFA 2Z1GA 4DU3A 1KVAA 3AO1A 3HPOA 3U6FA 1RTDA 4LD0A 4ICLA 3MAQA 4BE0A 1X9MA 1I3AA 2BDPA 3KD1E 4CJUA 4FLYA 1QQCA 1JLGA 4DQRA 3MEDA 1VSLA 3M8SA 1RBSA 1S9EA 2BE2A 5J2QA 4Z4GA 2RN2A 3QEPA 2HW3A 4B8AB 4FYDA 4E0DA 2FBYA 1ZYQA 4HHTA 4DS4A 3P5JA 4CGDA 3L2QA 2RPIA 5KGWA 4NYFA 1N5YA 4K8ZA 1WSFA 3L2UA 3SUNA 4CEZA 1L3VA 1VRUA 4OJRA 1D9DA 3ZT1A 4CJKA 1XWLA 1S0VA 3QEIA 3OYFA 2DFFA 3V81A 3LPTA 2KTQA 3HVRA 2DY4A 3M8RA 2HHUA 1ZBUA 3PX6A 1SKSA 4B9TA 3CM6A 4N41A 3ZSWA 4DTUA 1YT3A 4OVLA 2F96A 4OGCA 5KRTA 3BGRA 4KAZA 2KZZA 4W5RA 3V9WA 4KB1A 3DLKA 4GW6A 1IKYA 3OS1A 4DS5A 2O4GA 1RTJA 5D3GA 4EZ6A 4CEOA 3DLEA 1JL2A 4KO0A 3VN5A 3O3HA 2E6MA 3TAEA 3HK2A 3OYJA 4DQIA 1J53A 3P83D 1QE1A 4I2QA 4UQGA 4CJ4A 3RMCA 2HMIA 3V1OA 1C1BA 1TL3A 2Y1JA 2D0CA 1S6QA 3DOLA 3ZSRA 2HHVA 3HXMA 4J2EA 1H38A 3AVBA 1VSMA 3D45A 3SUOA 4FK2A 1C0MA 1HRHA 3OYCA 2A1RA 5C42A 2NUBA 1CXQA 1AROP 1WLJA 4KTZA 1QHTA 2G8KA 4CHQA 3VQ7A 4ZTFA 4Q0BA 4E1NA 3VA3A 2FBVA 2HHSA 1S76D 3B6PA 4OKKA 4DTMA 4F2SA 3QEXA 1VSEA 3RR7A 4CFDA 1RCHA 1JLAA 4DQSA 3TAMA 1Z25A 3DYAA 3AO5A 5HRNA 2G8UA 1WAJA 4OKJA 1X9WA 3OYKA 3MXJA 4LSLA 2ZQBA 2F8SA 4O0JA 4E1MA 2R7YA 4F2RA 4Z0UA 4DLGA 1GOCA 1RDBA 4FJKA 3TANA 1A5XA 1MSWD 4FZYA 4KI4A 1WNSA 1BCOA 4DWIA 1UOCA 2FC0A 4E7HA 2KFNA 5FDLA 4DFKA 4CEBA 3MEEA 3O3GA 1S1TA 3PX4A 3VQ8A 3EYZA 1IKVA 1YVUA 3VQBA 3WNEA 4DTJA 3U3YA 3SQ1A 3M8QA 4CJWA 4FW1A 4CERA 4KHNA 3OJUA 2G8IA 5HRSA 3NDKA 5SWMA 4KHQA 2IS3A 3HJFA 4F3TA 3G0ZA 4FJ5A 2HNDA 3TAPA 2O4IA 5K14A 5J1EA 4E7IA 1RDCA 3AVLA 5FROA 3SNNA 3U3GA 4DTNA 1O1WA 1RNHA 4BE1A 4GVMA 3LZJA 4RW8A 1I39A 3T19A 3E2EA 1JKHA 3NF7A 3I0SA 3TAGA 1NK8A 4C8OA 4CJEA 1Z26A 4L8RB 2GBZA 3NF9A 2HVHA 2P5GA 3KK1A 1KLMA 2FBTA 4XIUA 2KZMA 1HQEA 2YNGA 4CK3A 4ELUA 1EKEA 2GUIA 4IG0A 4AHSA 2YNIA 4H4MA 3DRRA 3VQ6A 4CJQA 3DLGA 3NGZA 4M3WA 2I5JA 2YHBA 2ZE2A 2YKNA 1VSFA 5DK5A 3OYIA 1RT5A 5C25A 2HHQA 1JLQA 4HCBA 3A2FA 4Z4CA 3HL8A 3LZIA 4DLEA 1L3SA 4OKEA 1U47A 4OPJA 4NYNA 4R5PA 2ETJA 4K8XA 3C95A 3L2RA 3NFAA 4DSLA 4DMNA 4CJRA 3SJJA 3CG7A 5JS1A 4DU4A 4DU1A 1K6YA 2VG5A 1SV5A 2OPQA 3AVCA 4KB0A 4KHUA 5FRNA 2KW4A 1B9DA 4M45A 3AVMA 3VQQA 4MQ3A 1NJWA 4KFBA 3LP1A 3S3MA 4OGEA 4DTRA 1KSPA 1ITGA 1RILA 1CLQA 2YNHA 1BGXT 3H08A 3ZSVA 1R0AA 1NJZA 3TAFA 4CF2A 1QTMA 1BI4B 1EXQA 1VSIA 4B9MA 1IH7A 1B9FA 4CF1A 3KK3A 4M3ZA 3KKSA 3HPHA 4E7LA 4QCLA 4NCAA 1VSKA 4DF8A 2HHTA 2RKIA 5CZ2A 4BE2A 4M3UA 1NOYA 4HUEA 4ZHRA 4YFUA 3CFRA 4FZXC 1HQUA 1T05A 3SQ2A 3WNFA 1UA1A 3HSTB 2ATQA 2FBXA 3EZ5A 4JS4A 5JS2A 4RW6A 4CIGA 3KKRA 3O3FA 4CFBA 3DOKA 1XHZA 2OA8A 1RT1A 2WONA 3KLGA 1X1PA 1LAVA 3ZT3A 4KPYA 4OLAA 3VQDA 2VWKA 4BDYA 4IFVA 4B9SA 1QSYA 4FJ9A 4KTQA 4CJTA 2BANA 2OZMA 1RTIA 3ZSYA 2IAJA 3RMDA 1RBRA 1VK0A 3LALA 1NKEA 2DFEA 3OVNA 3DI6A 3TAQA 4LY7A 1JLEA 2VG7A 2LSNA 1TKTA 3VQ9A 3I8DA 4KRFA 2QXFA 3QINA 3NCIA 4KHYA 4JRPA 3S3OA 2B4JA 1C6VA 4N76A 4CEQA 1ASUA 4Z4FA 1C0UA 4DSEA 2DTUA 4YNQA 1LWCA 4M3YA
chains in the Genus database with same CATH superfamily
1KBRA 4QOTA 4Y2KA 5D0HA 3HFZB 2E5JA 3M2VB 4USUA 4UY85 3UE2A 4G6VB 3DM2A 4DR3J 5J2MB 4CZIA 2JEIA 2VQEF 3AVKA 3POTA 3DLLQ 2M9KA 4ZMMA 4DR5K 4BY9C 1EP4B 5ETNA 1X9JA 4PUOB 1FDNA 1VQMS 2FHMA 3OYDA 3PDNA 1S9GA 3Q83A 2HG4A 3QRRA 1RKIA 1D1UA 4H4OB 3NGKA 2HHXA 3UKUB 2P9SA 1NSQA 3DRSB 1Q8IA 4AT1B 4ZPBA 3D3CJ 4AE5A 4NI2A 4R0EA 1NK5A 3LAMA 2QYGA 3ZTQA 2PA3A 4TQSA 3DCAA 1RCOB 4NE9C 3HHLB 1EQYA 3BQ0A 4NXMF 3I5AA 2DGXA 1ZETA 1TQLA 1UVLA 1Z05A 5EWFA 3GE1A 4CF8A 1C2PA 3NOGA 1FXRA 3I5CA 3CERA 1K1QA 3NNHA 2ATCB 4RCHA 3VQ5A 1MW7A 2B9EA 3D7SB 1HPMA 3AB2B 1RAJA 2W7OA 5F9LA 3UN5A 1J5OA 4JYAF 5FLXY 1TUYA 3EKSA 1Y3JA 3L95X 1JJ2M 2PYJA 1HPZA 5GADP 3PFOA 5G4DA 4HI1A 3CCLS 3SI6A 2FLLA 4LFCK 1FDBA 4WIIA 3Q8PB 3C6TA 2ZUGA 2D1CA 4M63C 3JXUA 3OYHA 5HSPA 1RZMA 4CJ5A 4LQ3A 3QEWA 3QFHA 2XY6A 2E88A 5KFEA 1NPRA 2BVZA 2CPIA 2JC1A 4J9PA 1G1XA 1O6XA 5LOQA 2JSXA 4I69A 1BWVA 2GAGC 2QZ8A 4NLCA 1F60B 3ZNJ1 1RB0A 2XBPA 5HMXA 1HWIA 4ZVPB 4CF9A 3M1VB 4DL4A 2E9TA 1W7AA 2HLUA 2WSEC 1TMJA 1BU6O 1HYSA 2AHOB 1VQOS 3B54A 4KT0C 3Q22A 2FZGB 2X3GA 1V3SA 3MM8B 3CJ1A 1RQ0A 3SAFA 2JC0A 2X1BA 5KT4A 3AA2A 4K2XA 2QN6B 4IOAQ 4YOTA 1W7WA 3SZ2A 5AQNA 3TW0A 1DBDA 1FNMA 3HX9A 4B3SJ 4JI3J 3SPYA 4KKOA 5AQKA 2CVIA 3QO9A 3CJSA 4DTXA 4DUZJ 4Q0BB 3M5RA 2E5IA 1YK9A 1SQKA 3T5HA 2AZ1A 3MXIA 1RE1B 2F1FA 2HOEA 4J2AA 4FWOA 3J80O 1RTHA 2QSWA 4QS8A 1D4XA 4FZZA 2J9EA 2D0PA 3KK7A 1VC6A 1RHUB 3T9ZA 4KHWA 1HLUA 5F3TA 4CVNE 3UCUP 2QK9A 1F3FA 3T5JA 2XYPB 4M7XA 4W5OA 2ILZA 3D54A 3OTBA 3W3SA 4RUAA 1Z2ZA 3ZLJA 4C97A 1DGKN 3KK2A 4WQ4A 1YVFA 4KB7A 1S1UA 1KLMB 2VL1A 1FTRA 2VGNA 2FC8A 1IBKF 4DKWA 2R8JA 4CFAA 4YORA 3C2PA 2XMWA 2VG6A 2XGPA 4R5PB 3GJQB 4KGZB 4CZMA 4B1YB 3AGRA 3GG1A 4H5RA 1F9HA 4FLYA 3BN7A 1KXPA 1VSLA 2GAHC 2GGPB 4IO8A 2XWYA 1NPPA 5KT6A 2H3GX 3HBTA 4DR7F 1RDUA 2AYMA 3NMRA 4OHVA 3NGTA 2RE2A 4K4TA 4V19J 1YT3A 3PLAA 3BGRA 4C4WA 1T05B 3CC7N 1LKZA 2O4GA 5FPDA 1H7WA 4M5DB 4J2EA 1A0OB 3JTOA 2OEJA 2HMPA 5M1NA 5IS2A 4LF6F 4DN9A 4DV1J 4CWBA 4ECQA 1BA0A 4F2SA 2Y8WA 3OFGA 4CO5A 4MLEA 4QWDA 1GMVA 4F9OA 4LVNP 3MXJA 3PW7A 3KWMA 3IM9A 4OHZA 1XMQJ 1BCOA 3S7RA 4GKJJ 5D6GA 1T9XA 2P9KA 2FQQB 5SWMA 4H4KA 2IS3A 2R7SA 3K0JA 1X3NA 1HR0K 3AOCA 3C14B 4FP9A 4LJMA 1TYQA 2GV1A 4I6WA 2YKOA 3NF9A 3Q2SC 4YOVA 2OD6A 1S0NA 4XH1A 3DRRA 3T1HK 5B7WA 4A8XA 2XQCA 3FMBA 2EI5A 2IY5B 1E6VA 1HMVB 1EB0A 2KW4A 3VQQA 3SCJE 5LXRA 5KFOA 4C48A 1BGXT 2M70A 4FYYB 1J5EJ 4A2BA 3MPWA 4Q8EA 2XGQA 2AD9A 5B0GA 3H3OB 2H4WB 2IVPA 1Y00A 3MEGB 2KJVA 2QA1A 2K8GA 5A8WA 2YHYA 4CFBA 2ZVIA 3PHEA 3VQDA 1FNXH 3J80U 2MZRA 3Q8QB 2VA2A 4FVUA 2BX6A 4NLDA 3BREA 1Y0HA 3MM7A 4KH4A 3R2CJ 2X6NA 3DMJB 3D2FB 4X4QA 5DM7Q 3M4XA 1RLCL 1JLEB 4CIFA 4HWIA 2DISA 4G65A 4HI2A 1FRMA 3EGZA 1G3OA 1RDWX 3TZYA 4DL6A 1IKXA 2WBRA 1L5UA 2VD3A 1R89A 4K7QA 1M1HA 2MY7A 4CZLA 5HO4A 3BKTA 3UQSA 2ZM6F 4URSA 4MLHA 2B4PA 2RU9A 1SJ3P 1QY7A 1VBZA 2V52B 4DCHA 1RT7B 2NZ4A 2L08A 3ZTRA 4X66K 2FZCB 3UE5A 4IZ9A 5MLCV 3D6RA 4M7YA 4OJ3A 5BJRA 4FYWB 4B3RJ 3UNGC 2P9NB 3VEZA 3D2EA 4MK7A 3QIOA 2MEWA 1KRPA 4DEZA 4Y6IA 4GKKK 3VWSA 4NRTA 1P6TA 1VOMA 2LCWA 3EGNA 4K43A 2FUG9 4FLZA 1JNZB 4L3QA 2PY5A 1DTTB 3BYPA 2OSQA 3ONQA 2EWSA 3H40A 3GONA 3LP2B 1XMOK 2DR7A 1TZ0A 4MH8A 3KLVA 3PNIA 3LL3A 4OL8A 3QEVA 2UUAJ 3GIMA 2DNMA 3MDFA 4FJNA 4RWXA 3A5MC 1HNXK 3EXCX 4B08A 4M3XA 4CJPA 1UWBA 4F3MA 1S72S 1WSRA 5HQLA 4MJKA 1J5EK 1W9HA 3P8BB 4O4RA 4USMA 4K4XA 3OXGA 5CD4A 1HARA 2B4OA 3ITHA 1OS5A 4IOXA 3H98A 3NGIA 3GMGA 2DHHA 2WHOA 2IVFB 2WW4A 4KREA 3H2LA 3LP0A 1RWXB 2BE2B 1GFWB 4OZ0A 5HMWA 4BWJA 1TAUA 1NGAA 5DG7A 3OLAA 3I4HX 4O0IA 3RMAA 1LWFA 3V81B 3W2WB 2IYIA 2RD5C 2WSCC 4PY5A 2OGUA 1FK9A 1VQYA 3UDCA 3K5NA 2OANA 2ACYA 1YITS 1CJVB 2Y1RI 3IWXA 3OVAA 2XMMA 5L9XA 2E29A 5M2UA 1Y97A 1PBUA 2H5IB 2HMIB 4M5IA 1TL3B 2HQFA 1FA0A 2RNEA 1OPIA 2WVBA 5EGYA 3CUNA 1Q81O 3L7UA 2E5LJ 4RU9A 3QBWA 5HL7L 3CDEA 2KKZA 1NNDA 1WDTA 4ATNA 5HBMA 3AT1B 3QO9B 3EICA 2GMHA 2WVDA 4WPAA 2RF2A 4AHVA 3J7ZT 1IG8A 5J2PA 1GTHA 3IBCB 2HVIA 2MDAA 1IKVB 1ZM3A 3LPYA 1LW2A 3M7VA 1S5ZA 1RTHB 2EG2A 3FZHA 4B3RK 1XNRK 4FZVA 2QL9B 5AJ3K 2ZH4A 1WTBA 2Z1IA 3MX5A 3OR1B 4EP4A 3KKFA 4FWLA 2E9RX 4DXLA 4LIRA 4CHYA 4ELTA 1WSIA 4B02A 5E5NA 3R27A 2KO1A 1R0CB 3VERA 2JWLA 2ALYB 3EGVA 4J8FA 4B3TK 2FSNA 1T44A 2YNFA 2VQFF 3KK2B 5KFWA 3AO1A 4I56A 2LU2A 4OYWA 3MPUB 3MMVA 4CJUA 1N5TA 4OJGA 3QEPA 1VR6A 3OVSA 1VI7A 2UUAK 4E0DA 2YKQA 4ZA1A 4JAXA 5AQLA 4HHTA 3P5JA 4CGDA 2RPIA 5THWA 5KGWA 1F5AA 3C19A 1WSFA 3D9BA 4CJKA 2N4CA 3THXA 1N32K 4ES1A 3RW6A 5AQIA 3D2WA 4KAZA 1UPPA 2EFOA 2NLWA 1Q0NA 1KOOA 4KO0A 5LSRA 1QE1A 3KLGB 3RMCA 2Y1JA 3G9CA 4QU6A 2A1RA 2F4FA 3JB9k 1W26A 1AROP 2QEXN 2A3ZA 3BEXA 1FTCA 2B4VA 2GEMA 5GAHU 3J7AP 3ADAC 4KH5A 5KG1A 2H3EB 1NNEA 4X2BA 1D3WA 2P9PB 4F2RA 3TANA 4YOYA 4NLBA 4CT8A 3JQJA 1T02A 1UETA 4CIOA 2E1AA 2LLZA 2DHXA 4DL3A 3CCWA 3P39A 1M5OC 2JJ4D 2GS8A 4FNHA 1T6CA 1T9VA 1M0SA 1CLFA 5H9FK 5ETLA 2DGWA 1DHMA 1X5OA 5HJXA 3SMZA 5H1SQ 3C16B 3QQCD 5ETRA 4CO1A 3QZ8A 5FPEA 4CK3A 2AV5A 4CJQA 3MN7A 2YKNA 4OI3A 4F04B 4QIWD 2MMYA 4EO8A 1T11A 1TYQB 3EO3A 2DEJA 1UAWA 2EPIA 3Q8YA 2KLAA 2WOMB 3M9OB 3PRBA 2BJ3A 1KSPA 2Q36A 3OL8A 2C3YA 4FF1A 5E84A 2Q1NA 4E7LA 2EW9A 1I6JA 1SQEA 4M3UA 2HVZA 4USIA 2E2QA 2YQ1A 2VF3A 3HSTB 4KBOA 1HBUB 3PSIA 5JS2A 2YX4A 3DRXA 2ZBQA 1X1PA 1HWUA 2G1HA 3LALA 1VK0A 5A8WB 4FWRA 2BV3A 4JRPA 5BREA 4DSEA 3MTJA 1CQMA 1S1XB 2W42A 4BR0A 1V3RA 1NDPA 2IC3A 4ER8A 2D3O1 3IS9A 1QLNA 4LQ9A 3ISNC 5L1LA 3N79A 1GLDG 2V8VA 4UUXA 4XK8C 2OJ3A 4RZRA 2VA3A 1KTQA 4CZFA 5IXUA 1G2EA 4N56A 4PXCA 2OLWA 4F8RA 3KG4A 2XHCA 4K8RA 2BACA 1Q53A 3AAPA 4PXDA 1JLFB 2PYLA 3SI8A 1VSJA 4ETZA 5FRMA 1WSVA 4Q5VA 2Q6CA 1U09A 3TX0A 2ZKTA 3UCZP 5KG6A 1TGOA 3ILOA 4PHTX 4K5SA 1HKAA 3VETA 1U25A 1TL1A 3QAUA 3N28A 3R5CA 4Y0WA 2W9BA 3AQOA 3O80A 2AJ0A 1FKPB 5IT0A 3BUZB 4CBWA 4GMJB 2KJWA 1OMSA 2M5YA 5B0CA 5KT7A 1APSA 3MFHA 3CCEN 1WUUA 1KWMA 2OEKA 3KHGA 3C3LA 3OL9A 3CETA 4NWBA 4KHPF 4QOZB 3ASMA 1X4CA 2BH1A 1PJ6A 2ZKUA 3VGSA 3I6PA 4OYXA 2QJ3A 3MWPA 1NKCA 1H2UX 3O44A 1DLOA 1Q18A 4FXDA 4F4KA 2OHDA 3CCSN 5HJYA 1NGDA 2O3DA 3Q2TC 5C2GA 4DF4A 2LECA 3ITHB 4PPDA 1H98A 1TKXA 1YWXA 1AZSA 1KP6A 5IWAJ 5IOLA 3NMAA 4WCEL 3FNNA 2IMOA 2J7UA 2BJEA 3LGNA 2DNOA 3IAS9 1DQAA 4ZJOA 2J9DE 4IKFA 1YQHA 1LWFB 4I2QB 1YAGA 4FWKA 5EX5A 1Q82T 3WT0A 1GLAG 3A8YA 1JB0C 4J37A 4KV8A 2CJKA 2CQ1A 3IDHA 4LF9K 3MXMA 4HH1A 1DZ5A 3K8WA 3L8BA 2V2QA 1WEZA 3MCAB 2WAQD 5C2DA 4KH6A 3NEKA 2CNOB 2YV0X 1SC3B 2HFZA 5KRSA 3AA3A 5HBMB 3G6EN 3GFZA 1XN9A 4LREA 3GCXP 4BVPA 4IO1A 4FJLA 3GQCA 4OX7A 1QD1A 1NK6A 5J2PB 1HNIA 2YHAA 3H45C 3RB3A 5AZJA 2QWOA 1UVMA 4C8ZA 1SS6A 2GQQA 3RG6A 2CPDA 3VEXA 2WTFA 1FW6A 4O3RA 4RW7A 4ZVSB 4AHCA 4C0OC 4W90B 2E66A 4IDKA 4CYUA 1ASVA 3AVFA 4JI4F 3GTYX 4DU3A 4BRLA 4GRSA 1ITPA 4OYOA 4JI8F 2R2RA 4DL5A 1S9EA 4Z4GA 3GCWP 4X65K 2P9EA 3HOSA 2AYGA 5AQSA 5AFUH 1Y64A 1BLUA 2VASA 1XWLA 1S0VA 1WC4A 4DUTA 3M2RA 3MR3A 3QATA 4WP3A 4B9TA 4EFAC 4F0HA 4ZHRB 5KFNA 4PQAA 4YOXA 5CYJA 2XULA 2RUGA 1VQLN 2HFSA 2ZH3A 2R7QA 3TJ8A 4EO6A 4KC5A 2D0CA 2HHVA 1T9WA 4DR5F 1C4AA 2H4YB 2NUBA 1CXQA 3VA3A 3CJ7A 3CC4S 5BPLA 3GJSB 3O4WA 4ED0A 2UU9K 2G8UA 4DV7K 2JVOA 2GZOA 4ZVUB 1QAJA 2Y3YA 5IWAK 2NXJA 2HBJA 3WIVA 2KFNA 3M8YA 5AQMA 4DFKA 3QJPA 1BDGA 3HI0A 3EVOA 3FZMA 3M8QA 5RUBA 5HLFB 2O8BA 1JLCB 2HS0A 2OSRA 1RDCA 3FGUA 2BJ7A 3KYLA 1E4GT 3FVYA 4GVMA 3T19A 1JKHA 1VQNN 1ATSA 3OTOK 3GOIA 2Q0UA 5HVFA 4ELUA 3FDSA 5F41A 4DV3J 2GUIA 4GVBA 5CCMA 3M1FA 2ZE2A 3ZZRA 4USJC 2ZD1B 1QVGM 3O9SA 3LTOA 2O8DB 1UWAA 3FSIA 5BYRA 3G8QA 2OPQA 3UWTA 1YJWS 6AT1B 4LFCF 3OR2B 4TYBA 4MQ3A 3SEOA 3S3MA 4F0MA 2CQ3A 3RSEB 1AB8A 1RGVA 3NBPB 4OX9J 4B9MA 3L09A 4RNFA 2UXCK 1MROB 1VSKA 3PIOQ 2VFVA 4DPXA 1K0VA 2MKIA 3ZX0A 4AL7A 3A8KA 4ILGB 4AXJA 3UKRA 3CB4A 1SC6A 4PRFA 4OYBA 3SSSA 5D0EA 2BANA 1T95A 2W2NP 2YH0A 3FQKA 3QBXA 1BQNB 4RKUC 3ICLA 4X4SA 4P9SA 2LSNA 3H7HB 3VCDA 4CEQA 3WUHA 1AUDA 3MGJA 3VAFA 3D0HE 4QIEA 2W1BA 1RT4B 3J7ZO 1M5VC 5LMUJ 1Q9YA 4QS9A 2ZJQL 1Q8BA 4FJJA 4N77A 3Q23A 3ZTPA 1FO1A 3RAMA 5KFJA 1Q86T 4JRQA 5AQVA 2ALZA 5KFRA 2NZCA 2KVQE 2ATLA 3HRGA 2ZH1A 4J9QA 2GC8A 1FJCA 5FPNA 4DQPA 1TFWA 3CFOA 3KLIA 4OZNA 4B9NA 2FJAB 3LW5C 4Z4HA 1P1LA 3ZSXA 2XM3A 5HOOA 1VQPN 1JWWA 2VBWA 4PABA 2HFOA 4U7UD 2N4DA 2B6AB 2VV5A 1CZBA 2C2EA 3LA0A 2J0WA 4CD1A 1I94J 4O55A 1H73A 3ZEUB 4RUHA 3WQUA 3N5BA 3N01A 5AQJA 4CGHA 4CJSA 2IJNA 1VQ9N 4YHHJ 2PMZD 5CH7B 3HT0A 3IN5A 1MWMA 3C7NB 3VQCA 2R8IA 5F3ZA 4OV1A 1FKOA 3I96A 1VHIA 3R7NB 2KT2A 2ZUAA 4HDGA 2XMUA 4JEPA 2MPUA 2V69A 3PKMA 3EKUA 4F4ZA 4DV3K 4BR7A 1LOTB 2AP1A 2QA4S 4BR2A 4FK0A 4PYAA 3QNOA 2RJZA 2PN6A 3CCRN 4DV2J 2CGLA 4EUVA 3SQGB 2G2ZA 1YRXA 1WOOA 5CY4A 3CQ8A 1Z1ZA 1BE4A 3TTDA 5JUMA 3M6UA 4F26A 5LJVA 2H9ZA 5KPRA 1MWZA 2CRLA 4LF7J 2H5EA 2XRIA 4YB5A 4V1Ak 5JVHQ 3CDUA 1U45A 4U96A 2ERRA 1R59O 1FXLA 2N7CA 2V4RA 3WHIA 2NRXA 3QGPA 5A8KA 1FRKA 2P5OA 3HHLC 1DLOB 1S48A 1T03A 2UUWA 3MUVP 1V6HA 2MZ1A 2R8HA 1UVIA 1RBUA 1AYEA 4MIBA 1XNQK 4NASA 3CIPA 2XC9A 4A8OA 5HN0A 1NG9A 4IFYA 4WF9Q 3VAKA 3CDBA 4EEYA 3NLCA 2X1FA 3DLKB 1TKXB 3KG0A 3PRDA 2IYGA 3MM5A 5G0RA 3MCNA 3P6YC 4OIXA 2E20A 2ABYA 4WKYA 4TU7A 2PFFB 4J2DA 4FM2A 5C42B 2CJ9A 3CD7A 4WQ5A 4EP5A 4B3SF 3D1OA 5KI6A 4JI1J 3Q8RB 1NPKA 3TAMB 1DY3A 3DYAB 2ASYA 4DUZF 5KFYA 1PYTA 3K0SA 3T1HF 1YTUA 5M1QA 4FPIA 1LW0A 3C6UA 2VHGA 4ZK7M 3IFRA 3N4WA 1RT2A 4TLRA 3V5RA 3AFGA 2QSFA 4LFAJ 5HRRA 1VSDA 4RW8B 3I0SB 3HHDA 2HSEB 3MPDA 3LF0A 1UZDA 4IEIA 2BZ2A 2E1ZA 2DFHA 2WBMA 3ZZUA 5AZJB 2CGKA 3CJRA 2DY1A 3J7AN 1RABB 2Z1GA 3BO2A 4LD0A 4ZN3A 1ZAVA 2PMWA 4A61A 4H0XB 3U1NA 3GSIA 4RW7B 1FWPA 2QWLA 3P96A 3M8SA 2UUBK 1X8DA 1SQFA 5J2QA 3BSOA 4PWWA 4N7TA 1YIJN 5IFMA 1V4SA 4ZVOB 4UZBA 3HHNB 3I8BA 2AIRB 3CMEN 4YOEA 1L3VA 3ZT1A 4OJRA 1D9DA 5IV4A 1CS4B 1ULRA 3D3BJ 3ENBA 2F8HA 4LMZA 4D3HA 4LF4K 1SC4B 4DUYJ 2QL7B 3O3HA 3DLEA 4DR2K 2E6MA 3M2RB 2P9UA 2NUHA 3HXMA 3CEDA 4RNNA 2FJWA 3PW0A 2J6TA 2OO4A 3FEZA 4KHRA 1NM1A 1CJUA 5JMNA 4CLZA 1HKBA 3VQ7A 1C0UB 2GIFA 2CKWA 2QL5B 1N48A 1RCHA 2Q3PA 4DV6K 5HRNA 2J7KA 3M8WA 2ZQBA 2FF6A 4X66F 4DWIA 1FNOA 1D0EA 3GG4A 3PX4A 1YVUA 2I7NA 4JI5J 4CJWA 4CERA 2B9WA 2OFGX 1XMQF 2HNDA 2XSJA 4GKJF 2O4IA 5K14A 1GEHA 1TU0B 4NXMJ 4GKKF 3BV8A 3U3GA 5GAEI 3I31A 1XUPO 3TP2A 4JI2J 2MKCA 2CQ2A 2O8BB 4JI1K 3ID8A 4IG0A 3PM9A 2YNIA 3OBWA 2R2UA 1RT5A 4KIAA 1XMOF 1JKHB 4OX8A 1U47A 1S10A 3T1YJ 2VG5A 5FRNA 5GMKa 3FCHA 4OZJA 1TUVA 1RILA 5IZHA 2ZVSA 4H5WA 1HNXF 4HT5A 1BI4B 4LFAK 1HHQA 4QCLA 2P9IA 3RYLA 1J5EF 4BE2A 2QLWA 3ENAA 2V50A 1XR6A 3SMSA 1Q82O 3PW4A 1IBMK 4CIGA 3KKRA 3KUEA 3WX8A 3PEJA 4EI2A 3JXOA 4ILRA 1SZ2A 5MLCQ 5I4MA 1NMNA 2M8HA 2PT0A 2QE5A 2DR6A 3UDVA 2J5AA 2XSFA 4YR2A 2Z2ZA 4HACB 2V63A 3CIMA 3PYEA 2PZSA 9RUBA 2Z57B 2K06A 4X62K 4IOCQ 4JKAA 4ZP7A 1I5OB 1HI0P 2KM8B 4TXSA 4FLUA 4CESA 4MIWA 4FVMA 3KLFA 3SV4A 4ZIVA 3R7BB 3K89A 1EWQA 5AQUA 2CNNB 3HPGA 4DDFA 3UN3A 1KVBA 1N5VA 5DM6Q 4ILMA 2G8HA 3CMAN 2V0NA 4LF5J 1UA0A 2W4PA 1RBTA 2VCPA 3FUYA 2AEFA 3CJ5A 1RWKB 3MDQA 1HKGA 5ADZA 2DO0A 3OFHA 1KKHA 2FVPA 4LF8J 2X51A 1DFDA 4H0TB 3FFKB 4IOBA 2YKMA 2E7VA 3MHYA 2I38A 2R4FA 1XIQA 4FLXA 3CD6N 4B3RF 2LQ8A 3Q0AA 1N6QB 2R3VA 5AJ3F 4RW9A 4HHJA 4QYZK 1JMTA 3KJFB 4S0MA 1KCFA 2PGCA 4BROA 2M0GB 1KFDA 2P6TA 2W25A 2FHJA 3TUJC 5D78A 4B3TF 5E33A 1FT8A 3O4QA 4JK9A 3WXLA 2Z2YB 4ES3A 2I1RA 1UJ6A 2GELA 2GX9A 3HMJG 1YRTA 3M30B 1VFJA 4YQWA 3RU0A 3TZWA 2UUAF 4IG3A 1ESVA 4G1PA 3OYAA 3KG1A 4W5TA 3R9PA 5ETOA 1ZTWA 4DR7J 4B3MJ 4ID1A 1B0TA 1U0HA 4KH1B 3WC2A 4BR5A 3GP9A 3HKZD 1N32F 4ZPDA 1SI9A 3T6JA 3VGVA 2HFUA 2IA6A 3IA0A 4USTA 4WTYA 3J7A1 4M5NA 3OBIA 2PFUA 4FPRA 4RLEA 1KVKA 3KDNA 2HHWA 3JSMA 1A9NB 1CJKA 4ANDA 1WOPA 1SCJB 1VRUB 5CYQA 4DL0C 4LF6J 3ILIA 2BTFA 1C0TA 5HRPA 4CHOA 4O3OA 2B9XA 3LOUA 3WQTA 1X4EA 3K5MA 5HQMA 1IR1A 1NHUA 2Y0SD 3V6DA 3W5XA 2LP4A 2VZ9A 4E89A 3NAHA 5K20B 2J4RA 5E0OA 4DPOA 2J6SA 1U04A 2FHOB 4U7UK 3DAWA 2E5LF 1QVFM 5KTQA 3C8YA 2L9WA 1P27B 4MIAA 4LRDA 1YX2A 5JLFA 2V34A 2NLXA 1HWKA 4NL5A 5AXKA 1XERA 4IO9Q 3MOJB 3ZZPA 3DLHA 3TI0A 4LF8K 1XJWB 1ATNA 1SAZA 3AAQA 4B8CA 3QLHA 1MN9A 2JLFA 3FCVA 3V6KA 4P7VA 2QWQA 1KFSA 4FLVA 2B51A 4I9QA 3HSZA 2W9CA 2JWKA 5KG5A 4YR0A 1Q86O 4ZLPA 2AGQA 1WI8A 1VQ7S 3MN9A 2C2ZB 2LQBA 1FD2A 3RAQA 2YCHA 5D4OA 4J9SA 1ZAWA 3FBCA 1TR0A 2LDYA 3JSBA 3G2XA 1S4EA 4OI6A 4CW7B 4CJ7A 1ELOA 5GAHI 1NLVA 2BYCA 4MMOA 2KTQA 2Z8QA 5A8RA 1NB7A 5F8LA 4WFYA 2UXDK 4OVLA 5E3AA 1S6UA 2QYCA 3RRKA 1IKYA 3KMQA 1ZA1B 5JMVA 3ULEA 3CCVN 1RT1B 3BBBA 2KI2A 1JXVA 5A6PA 3KXDA 3W0LA 3SUOA 3Q7BA 3IGVA 1HRHA 4RNOA 3GIKA 3FZKA 1N0UA 3KJQB 2G8KA 4CHQA 4OLOA 3ET6A 4OKKA 2HFNA 5BPMA 2NXNA 3RR7A 2J0SD 2NYIA 2LQ5A 5JVGQ 1YDLA 3CGIA 4KE5A 5IQ6A 1LFWA 2AZ3A 2DNKA 4OKJA 2M88A 3CC2N 1R8BA 3VF2A 3DNCA 3SIPB 4H0YB 4M1KA 4KI4A 1HNZJ 1YF5L 3MEEA 3O3GA 3ETOA 3EYZA 4TU8A 2XNQA 2W4CA 2DH7A 2NSBA 3G96A 3BGLA 4CRJA 4X4UA 1HBMA 4DR1J 3ELHA 2QC3A 2CG8A 3D4JA 3PXGa 5EWEA 4ED1A 1RNHA 4BE1A 3E2EA 2ACMA 3UR3C 2HYIB 4L8RB 4LRCA 2P5GA 2XSJB 1JCEA 1Q5YA 4QIVA 4H4MA 3LO3A 4HKQA 4NYNA 5BRHA 2ADBA 2K1RA 4J9VA 4DTRA 3RUBL 3RZAA 4CF1A 3ZZOA 1B9FA 3C66A 4NCAA 3G82B 2HHTA 1QUVA 5I9EB 4R8UA 4HUEA 1KQKA 3D1HA 2RQCA 2FJXA 4YFUA 3UW1A 1RHJB 4O3NA 4RUBA 2QV6A 3GFYA 4RW6A 4IQMA 1XHZA 2OA8A 1UPMB 2EG1A 4IOCL 2AF6A 3NGRA 4CJTA 3CDWA 1TKTA 4MDAA 3TVYA 4CZCA 3PIPQ 4N76A 3M2UA 3QPIA 4YNQA 4HCCA 2HHHK 2CNKB 1NDKA 2DO4A 3V9XA 3SSQA 3QIPB 4ZCIA 2J8AA 2KFYA 3NGSA 1TKZB 3IFEA 1K1SA 4QBUA 4PKGA 4J2BA 4NMXA 1X9SA 1M5HA 1IV0A 3TR5A 3T1AA 4CGIA 4UOFA 2JFDA 2W24A 4ECZA 1P9QC 2OEMA 2F8TA 3LDQA 2YX7A 5CHCB 4LRAA 3R1LA 3CCZA 2HF3A 2DGSA 3HF5A 2GV9A 2CQ0A 2F8MA 1VQ6N 3EPIA 5EX0A 4PXEA 1F1BB 4ZVFA 3L0QA 3CPWR 2BKOA 4B3OB 4Y2CA 4FL9A 3D67A 4LFBK 5ADXH 1MU2B 2V7YA 4R25A 2G1DA 4O3SA 1SH0A 1HD0A 3RTVA 3U9ZA 2LKZA 4OYZA 1FEHA 2PDAA 1FJGJ 4ZTJA 1C0GA 4C11A 3ULDA 1QAXA 4CNYA 4CK1A 3MWBA 3VQ4A 3HVTA 2P8IA 2OI2A 3CJTA 3IG1A 4Y2MA 2DR9A 1S7HA 4P10A 2JVRA 2AX1A 3IR6B 4H5VA 2BE7D 5ETQA 2APOA 2WVCA 1GQEA 5CZVA 1EJ7L 1X5TA 2YKMB 1MMLA 1N5QA 2QEXS 4C9DA 3SCXA 3WDOA 2RS2A 2ZWHA 3V2UC 4GV9A 3CJCA 3HVWA 4NLGA 5B09A 3R8EA 3O5BA 1UP1A 1S1VA 5CE3A 4EZ9A 1VQ5N 4USWA 1UVJA 2UVVA 3AVGA 2DRDA 3D68A 1REGX 5HROB 2B5JB 3JQKA 5IC6B 3R2DJ 3IRXA 2Y1IA 4I0WA 4YDUC 5C24A 3GV5B 2ZBRA 3U9DA 4IUFA 3P38A 3QAEA 1WHXA 3J81U 3V6JA 3AV9A 5AXLA 3CCMN 1IWGA 3K5OA 4CE9A 4E7JA 3BSCA 1IKWB 1T9YA 2EC0A 3CF5Q 2QA4G 3QSIA 1U0HB 3AO2A 1YJNN 3EN9A 2EFNA 4DX5A 3H46O 1G6BA 4XDDA 1KVIA 5E3QA 3W8PA 4RL1A 3QIDA 3AH6A 1RWPB 4H54A 2UU9F 1RA6A 1P90A 3OUYA 4A8KA 4I4BA 2O8EB 5IWAF 3P5BP 4KPCA 2IM2A 4N47A 4BRFA 4HLBA 1WHVA 3PRVA 3PCOB 4H8KA 1FE0A 5E41A 4I67A 3HDSA 4GV3A 3VENA 3SJHA 4IO9L 2QLJB 2XMJA 3M32A 5KFIA 1TVRA 4LR9A 3V6DB 5KPZA 1VQKS 3OTOF 2KHCA 4O23A 2I6WA 2IM1A 4L73A 2D74B 3DDNA 4ZJLA 1N88A 2JEJA 1S5JA 2NRVA 4FM0A 3CD0A 5AZIA 4TSXA 1WOQA 2VDHA 2I7PA 1TUGB 5IT9U 2DEIA 2F4VJ 1SKUB 2HQ3A 2YNGB 2UXCF 2G2YA 1DJ0A 3EMTA 1ZTTA 3VQPA 3DLGB 4IRCA 1NJIT 1ROFA 2R7VA 2XHBA 3NH0A 1ILYA 4DHYA 4P2FA 3RBXA 2BW7A 2W9CB 2BQRA 4JI6J 1SV5B 3KMSA 4WYLA 4KFBB 3LP1B 1FESA 4ETXA 2M8DB 3RB6A 4B8AB 1NSAA 4KSEB 4Q43A 1ZYQA 2ZEJA 1KVJA 3VF6A 2DK2A 3O9RA 2K3KA 4NYFA 1CQNA 5D4PA 1LNQA 3OYFA 2E2OA 2RKIB 1E6YA 2DNQA 4N41A 2FLOA 5KRTA 1HQUB 1S57A 3V9WA 2GA7A 4IH5A 3OS1A 5D3GA 4CEOA 4K0KK 2YH1A 1FRIA 5JVGL 1S59A 4ID8A 3BF3A 4ZOSA 4IFVB 2W41A 5L46A 3MURP 5FD1A 2VG7B 1B64A 2HK2A 4WBFA 3ULEB 3A5NC 2IIHA 3FLCO 1H1VA 1NU4A 1VISA 3EX7B 1JLAA 4DQSA 1BA1A 4QWAA 3AO5A 1YJTA 3H3NO 2YKPA 1XR5A 3THYA 5LM7E 1UFWA 4UT4A 3AA8A 2UVWA 3VQBA 1J27A 2GHPA 3U3YA 4KGVB 3DU5A 2V6AA 7FD1A 4IYQA 8ATCB 3CCSS 3CCUS 1XMBA 5DS7A 3AVLA 5FROA 4FVCA 3CI5A 4NX9A 4RJVA 4LR8A 4NXNK 1OY8A 5KFVA 1Z26A 1HBMB 3KK1A 1S6PB 3CPEA 1HIYA 3VQ6A 1SIZA 5BR8J 4FN5A 5C25A 1JLQA 3HFVA 4EHTA 2ETJA 1NCLA 2YWKA 1NSPA 4DV3F 2WTUA 5M1FA 2LEPA 5KFDA 3K7RA 4DOZA 4KB0A 4KHUA 3SCLE 4ED7A 3RAXA 4H4MB 2CJBA 2RHSB 1GMWA 1N34K 4HHUA 3ZSVA 5F9NA 1VQMN 3IR7B 1WKJA 2VBZA 2HHPA 4OX9F 4NLYA 3OXLA 1PC4A 2KT3A 3EZ5A 2MKSA 2ROPA 3FSXA 4B9SA 3MMCA 3GL1A 2HRYA 1B0VA 2IAJA 4WU2A 2XZWA 4KRFA 4RW6B 1C4CA 3O2IA 3FEXB 4RNMA 4AD6A 4K4UA 2KQ2A 4NLXA 1DQ8A 1NDCA 1X4HA 5FPMA 2ZHOA 4UW2A 3V9ZA 1TKTB 3OT9A 1X4BA 3Q8VA 1YJ7A 2MQMA 3WNGA 3GV8B 5LMUF 5B0AA 4RW4A 3KLEB 2P5VA 1BISA 1IR0A 1GNKA 3CNQP 4NLWA 4UOHA 5DZ6A 1M5PC 3THWB 1NMEB 2GQ2A 4DFPA 5CABA 1IBLK 1S1WA 3Q24A 2Q31A 3ZETB 3PV8A 2HNZA 5CQGA 5IT9Y 4ZP9A 3DHWC 1GLCG 5LJ5Y 3OV7A 2WVEA 4CM2A 3FCWA 4FWNA 2WFBA 3I0RA 4CJLA 3BY5A 4DV5K 3DRPA 2AYBA 3IMXA 2OPRB 2PIIA 2FD2A 2Z1HA 3LDSA 1GXUA 3CJKB 1RXOB 5EDWA 2DGQA 4FKYA 1TL7B 4FPAA 5KAKA 4M5HA 1FD8A 3N5FA 3RBDA 3QDKA 5GAGI 2G8FA 4ISFA 4Z94A 3GYXB 4WE1A 4FJHA 1JXEA 2GO8A 3THTA 3CJ8A 2R7TA 2MHEA 4E98A 4ZVGA 3GIJA 4C11B 3M6VA 1LAWA 4ECVA 4IKAA 4KY3A 2Z0GA 2FTRA 6FD1A 1M5SA 3DLJA 1BL3A 3VGTA 2B3TB 3SPZA 2U2FA 4G1QA 1KR4A 3MR5A 2E4LA 1R6YA 3CT9A 3CTRA 5BR8K 5E3PA 1ATRA 2XO7A 2RDJA 1K47A 3M9NB 2BM0A 1WSGA 1F9FA 4DTSA 3LAKA 3VF0B 4FS1A 4HUGA 4PR6A 3NWGA 3A8JA 3TQ1A 2YI1A 1S1VB 3D66A 1I51B 3TOQA 1JQGA 4DV2F 2V7ZA 4C3KA 5HAOA 1VQNS 4WFBL 2D3UA 2QLXA 3IRXB 1T8EA 1QS4A 4OO1J 5C24B 3MMBB 3QFUA 1HNVA 4L6V3 1RTDB 3J81j 4LF4F 8RUCA 4WFAL 3R6MA 1Q8KA 2D4WA 2QA2A 4USVA 2GHWA 1OH8A 5ETKA 3T5KA 2IPOB 2DXFA 3PEHA 3S1TA 1N5YB 3Q7CA 1REVA 4QWEA 4DR5J 1J54A 3AVJA 2QFJA 4DV6F 3DXBA 4WFNQ 3HZ6A 2UYTA 4H0OA 1RAHB 5KFQA 2NRZA 1YVNA 1Y5NB 4OJHA 3VQSA 3GWCA 5J2NA 1KN6A 3J8AA 4CTAA 1JL1A 1J9AA 2J6UA 1HL6A 4JKGA 3BP8A 3WXIA 2RU3A 5DLFA 1EETA 4MDBA 4TY8B 3BDPA 5AXMA 3UIQA 3JAMU 4DR4K 3MUMP 4JI1F 1EKRA 3O08A 4DV4K 4EYIB 5FDLB 5I42A 4O5BA 5D4LA 4ED3A 4PCQA 1E4FT 3GSDA 3G8TA 2P2CB 2XI2A 1WORA 1Y4ZB 1GXTA 3PO5A 2QIFA 5KG4A 4NLUA 3M05A 4LFCJ 1L3KA 3AHPA 2IMWP 2YKAA 2W7AA 1U4BA 4LFAF 2C3PA 1V9OA 2DPNA 1OJ4A 2FPHX 2DRAA 2E9ZA 3GB0A 1KVCA 3TR8A 5JJBA 2CZ4A 2ZF5O 4AH9A 4PQUA 3AQPA 2J0QD 2V94A 2UP1A 1X0FA 1IBMF 1ZBTA 1NB2A 1V5IB 4JHDA 2DT9A 5DQIA 1M1KT 3BYRA 2XCPA 4F67A 4JV0A 4DQRA 3F0NA 1XEZA 1RBSA 2HW3A 4MK8A 1BQXA 2YNHB 2O8CB 1VQ9S 1VAZA 3LPTA 2HHUA 2JFKA 3TA2A 3O5TB 2F96A 3O9UA 4KB1A 4F7VA 1BXNA 4ZVQB 2KHOA 4DQIA 1J53A 2NXUA 1GLBG 2DH9A 5ETMA 1E6YB 2DGTA 3AJDA 2SXLA 4OHWA 5LY3A 1CJTB 5D4NA 1RTIB 4DUYF 4E1JA 2CH6A 4RO0A 1RLDA 4ZTFA 4LF2A 1JIHA 4JV1A 4EGLA 4WIQA 4CFDA 4JD2B 3CCRS 1Z25A 3SBMA 2I8EA 1ZZFA 2HQCA 1AFIA 5A0YB 5M2PA 4E1MA 4Y00A 4FJKA 2E44A 1O5JA 1VK8A 4CEBA 1RAFB 4IRDA 2PAVA 2E2NA 2O66A 5J1EA 3VQTA 5F0WA 3DXMB 4JI5F 2QWPA 4J9UE 2OPPB 4A57A 4XIUA 2VIHA 4CZGA 3FFIB 4ZPCA 3RBEA 4WXWA 4JI2F 1VSFA 1URNA 2O01C 3A2FA 4A8SA 2EKNA 4KH0B 1Y7PA 1YBAA 4EBCA 3NFAA 4CJRA 3PYFA 4TU9A 3KK1B 2VFSA 4CI6A 1NAQA 4DX6A 3H0PA 1OYDA 3AVMA 5A2QY 1RKJA 3VAJA 4H0VB 2D3OR 4OI0A 3T1YF 2ZJPL 1OIAA 1S0OA 4WFXA 4U67L 1HBNA 2X1AA 5K8OA 3KK3A 3LM2A 1PKUA 3SQ2A 3KDOA 3WNFA 1WG1A 3DHXA 3TZZA 4J90A 2VYPA 1NHVA 2Y9HA 3DOKA 3IUCA 4JK8A 4YOWA 2CJXB 3D6HB 4KTQA 3CIZA 3I8DA 5KOXA 3L7OA 1KQSM 3DRYA 4MAKA 1C6VA 2G4BA 1ASUA 1F3VA 2FF3B 2IDEA 2NRRA 3MR6A 1UFKA 2LXUA 3BH6B 3K57A 3RR8A 4I6MA 2E7XA 4LSNB 4CQ1A 3D7EO 4U8YA 2UVUA 4H5NA 4CHZA 2W8KA 4QW8A 1EAYC 1SH2A 4CFCA 1A6LA 1EQMA 2GO9A 3OHBA 1A7GE 4Q44A 3FQLA 1JXBA 1CC7A 3M8PB 1VYAA 3HO1A 4F4AA 1YIJS 1NLKL 1X4AA 1TK8A 3QRPA 1NJIO 1VRQC 2CWXA 2ZJRL 1HR0J 3CJ2A 2JHEA 1S72N 3QFPA 4LF5F 4RU2A 4WZMA 3W62A 5IM0B 3V9UA 4CLPA 2B8PA 3U27A 4LF8F 2HBQB 3QGHA 3T1HJ 3DU6A 3I0RB 2LDIA 3DXSX 1BQMA 2MSTA 3IKMA 3AJ2A 4DMZA 2HNYA 2RQ4A 3NNAA 2CA9A 5I3UA 1IJJA 3THVA 3H5UA 2YXLA 3IRWP 3E9OA 4YY3K 4EYHB 4C0HA 4OZ2A 3K59A 1XI1A 1KLNA 1YITN 2G8WA 2CQCA 5EN1A 4YB7A 5CYMA 4CJFA 1IBKK 3CO0P 3TEGA 5F2RA 3W8GA 1FRHA 1W2IA 2KM8C 3Q86A 1VRTA 1NKBA 4P72A 1KHVA 3KJVB 4F4YA 2D5RA 1FWKA 4ZVRB 2CDQA 4YN3B 3A8EA 4CECA 5HP1B 4BHQA 3AVAA 3W9HA 2QGFB 2YWGA 5T7LB 2VPZB 2B0GA 4B3MF 3JYTA 1WHYA 4DSKA 2OUGA 3SSRA 3DXKA 1WACA 4NYPA 2JX2A 2KDOA 4FXVA 3T9NA 3W5ZA 9ATCB 1CULA 4CLWA 1NJYA 3D5MA 4WYBA 1G99A 4LR7A 4NCGA 4M3RA 1TUWA 4EBDA 2MQ8A 1NGBA 2NRWA 4NEYA 4X66J 3NH1A 3A3OB 1PAUB 1T3VA 4K4ZA 2XZDB 5TKWA 4BC7A 1MA9B 4FJGA 3K5LA 1HWLA 1JCGA 4DZ6A 1WAFA 2R7WA 2I9SA 1RP5A 2OPSA 2BQUA 1R8PA 1GTEA 3OS2A 4GKKJ 3WXKA 1U2VB 1U1NA 3E01A 1S12A 2J8SA 3F5TA 4C8MA 2ITGA 2FHJD 5EUHA 1EETB 2KXHA 1CZ9A 4JKBA 3S9HA 1K8KA 3KWIA 3S8SA 2JH3A 1XMOJ 1AXQA 2W4DA 2FVSA 8AT1B 2YPYA 4CM0A 3RWUA 1ZBIA 3OVBA 3DOMA 5KFHA 3G4SS 4CGGA 1N5SA 4A48A 2W2MP 1S97A 1U6FA 2H54B 5D15A 4ECSA 1HNXJ 3JS6A 2E8AA 1TTHB 4OQJA 2I5JB 4JOUA 3HJVA 1VBKA 4BDZA 2MLXA 2CXEA 1OQ3A 3GYGA 5GAEU 3U6FA 1U02A 1WF1A 1HW8A 4JI0K 4CD3A 1RAOA 2ZNZA 4ZP6A 1KS2A 1R27B 3SCIE 2JLGA 4BRMA 1JLGA 4EBEA 3CJ4A 3MEDA 2RN2A 4PQUB 4ZIWA 3CD6S 1HA1A 4JHDB 5LL6d 2DFFA 2NREA 4A8FA 1T6DA 3M8RA 5EY4A 1OPZA 3LDPA 1HNWK 2B9YA 3DGPA 4JP8A 2WVFA 1LK5A 1RACB 4PPZA 2K3IA 1RTJA 3DLLL 3VN5A 2DCUB 4UY8T 3DOLA 3IO1A 1VSMA 3OHRA 2MSSA 3ZZ0A 4J9RA 2D41A 3FRYA 2J0XA 1S76D 2EKYA 4CLFA 3QT6A 2ZZMA 3MUTP 4A8YA 3KWGA 1VJWA 4LF1A 4MN4C 3NS5A 4LFBF 2YPZA 4B17A 3MK6A 3DM2B 4FZYA 3ATVA 5AQTA 3POTB 2Q79A 3NDKA 3LDLA 4F3TA 2R8KA 1HNZF 4LC9B 3N4QA 2A41A 4DTNA 2D3ZA 1S9GB 2CGJA 4FKXA 3TSPA 4BRIA 2DNHA 3TO8A 5AQPA 1XNRJ 4DR1F 5EX3A 1VIOA 2GBZA 1WC3A 5AJ3J 2NRHA 2P9SB 2IBOA 4FSVA 2GJIA 1SIWB 1NZAA 4AHSA 4NI2B 4ZVHA 2YHBA 4UUWA 4ZVTB 3R5AA 2LQJA 3TX8A 2CPHA 3C95A 2A6OA 4DU1A 4B3TJ 2Z2MA 4TQRA 1SPBP 5LSOA 1TFYA 5IT4A 4R79A 2C2OB 2DTJA 3HPHA 3M9MB 3I33A 3MAAA 1J5OB 4LBPA 2DNZA 1B3TA 1NOYA 2VB6A 2HPUA 1IQTA 1UA1A 2ATQA 1HPZB 1WKKA 1N32J 3EZWA 3UDEA 3C6HA 3C6TB 3ZSYA 1RBRA 1WG4A 1VBYA 2RRNA 1U1QA 3DI6A 1X31C 2QXFA 4KHYA 3FEYB 4PKHA 3HT3A 1WBBA 1CVJA 3KTQA 4IOAL 1VSHA 1F9EB 3AVHA 3EUNA 2CDRB 1GOBA 2L48A 1X4FA 4LH5A 5AXNA 4I6MB 5ETPA 2IM3A 2FZKB 1HYSB 5DG8A 4TYAA 4O44A 3TJAA 1DTQA 2BOAA 3A13A 1RUSA 3NNCA 3WEEA 4B9VA 1S79A 1RBAA 5C7PA 4CI0B 2XY7A 3HYFA 3GLJA 5H9FJ 3I56N 2J9DA 4BBYA 1M1KO 3NOCA 4J91A 2J9CA 4PAAA 5A76A 2ASMA 4KKOB 3WC0A 1V5VA 1NEEA 3ILLA 4USKA 4K4VA 2UUCJ 1FJGF 3U02A 2ZH6A 4KI6A 4U7CA 4CJVA 3BZQA 2KYZA 4HR2A 2QLFB 4X4OA 1TK0A 3EWGA 3G6VA 1D9FA 1BWFO 2AMCB 3J80Y 4KAIA 1JLBA 4RR5A 3U7JA 2IOCA 1F5BA 5DGBA 2V4JA 1VHXA 1NK7A 1BCMA 3U1MA 2ZOFA 1JX4A 3HVAA 4CLLA 1R6VA 2GVDA 2PSZA 1IQZA 4PYDA 2BRLA 3HHEA 2VQFK 4CHNA 4ENOA 2F40A 2CPZA 2VONA 2X78A 4K2JA 2PEBA 3QMLA 1S1UB 4FW2A 1T7PA 3I87A 1VRTB 1HD1A 1Q4RA 3M2VA 4Q45A 2VG6B 4YDXA 3W9IA 4A8QA 4CEFA 5J2MA 2IRUA 3OBYA 2MKYA 2EFVA 4WP8A 3OS0A 1HLWA 3QERA 3ZX2A 3UNYA 4U6PA 4PUOA 2A1SA 3A0IX 2Q2RA 4M5MA 5HVHA 5AQWA 4H4OA 1YKWA 2LU1A 3IWLA 3UKUA 2F8EX 2HWHA 3DRSA 3BGRB 3C65A 3HP6A 2VU5A 3ZSQA 1C1CA 1V4TA 3MF5A 3E1YA 3SQ0A 4KRWA 1HYZA 4BC4A 2ASOA 4AL5A 3BF1A 2RT3A 2D0OA 2YX6A 3HSDA 4CLUA 4P6QA 5SZTA 5KT2A 1LEOA 1VBXA 2GIQA 2HWTA 4YEAA 4JK7A 1UMJA 5A2QO 2Q0RA 4U95A 5FLXO 2F65A 2Q1LA 3ZZZA 5DZ7A 1WJ9A 4I2PA 3DLRA 2FVQA 1ZBSA 3KFWX 5C2FA 3W61A 1C0FA 2OPSB 3OXFA 2RQMA 5H9EJ 4AF1A 2P9KB 1NK0A 3M6WA 1LWEA 1PYSB 3PW2A 2AT1B 1N34F 2UUCK 4CO3A 4QR0A 1TP7A 4H03B 1T0TV 2CADA 3VGMA 2HQGA 3T3FA 2BJDA 1R8HA 3E9PA 1WUAA 3F44A 4NA2A 3CC4N 3PSFA 3DOMB 3DRRB 2VOOA 2KU7A 1B7FA 2F4VF 3H4BA 3SCKE 1GLJO 1E6VB 4PG5A 4IFEA 1QQCA 2PE8A 3M1VA 2A5XA 1KQFB 1UFLA 3EE9A 4JI6F 3DWLA 3H5YA 5GMEA 4CH0S 3LGHA 3UI3A 5B0FA 2H51B 3TYTA 5DM7L 3QEIA 3MOZA 3MM8A 4I64A 3MEDB 1SKSA 3D28A 5KG2A 3CCQS 2Q43A 4FNIA 4W5RA 3J7YI 2OP5A 3A3PB 3MEKA 2AEJA 4ZP8A 1Q78A 3Q89A 2EBGA 2UZAA 4H0PA 3VZIA 4YDDB 1C0MA 3OYCA 4C3LA 1IBLF 4A47A 4PWUA 1VQ5S 4F02A 2QXLA 1RTJB 1YJWN 3B8HA 4Q0BA 4E1NA 3S6EA 2MZTA 3MM7B 2F63A 4DTMA 3VGUA 3IR5B 1FX4A 3OLBA 3CQXA 3UVJA 1WAJA 2A2CA 5ETVA 1R31A 4NRUA 4LF9J 2WC9A 2R7YA 1EO1A 2KRRA 4DV5F 2CUYA 3CCMS 1UOCA 5KFBA 2DHAA 3H4DA 1IKXB 4OI1A 3HJFA 2VKZG 1O1WA 1BOTO 3GR1A 2MB0B 3QGGA 3WZ0A 1X4DA 3BPSP 2B56A 3L6QA 2HVHA 5CHIA 1KLMA 2MQPA 4I6YA 4Y2AA 2Q66A 1DEJA 2LA6A 2ASJA 1ZOTA 3L4IA 4R5PA 3VEOA 3SJJA 3D2EB 5BR8F 1HFEL 1K6YA 3AVCA 1B9DA 2BXJA 1SH3A 2EFQA 2GGPA 5H9EK 2PFDA 4X4TA 3G71S 3OTDA 2AEMA 3H42A 4X65J 2LXFA 3TUZC 4IR1A 2ZH7A 2VPYB 3OQ2A 3AXMA 4I1TA 3W9JA 1T05A 4KHPK 3CJ0A 3THPA 1X0PA 3HM8A 4B1ZA 3RGIA 3ZZYA 2ZHBA 2B7BB 2WONA 4OLAA 1N56A 5CD4H 4BDYA 4M5DA 2DXDA 1MN7A 1SVDA 3BBCA 4UOGA 2B43A 2MJUA 5HQ8A 2E1YA 2QMUB 4Z4FA 1UWBB 4M5GA 3L7PA 5B0EA 2XLKA 4FYXB 4FCYA 1WC1A 4FYVB 4M95A 1IN0A 1IJEB 4DFMA 3OY9A 1NGHA 3TVZA 4X64J 1OSDA 4DTPA 2UU9J 3CJBA 4DV7J 3FC9A 2PEHA 1DT9A 3LP0B 3BR8A 4NLQA 1QSSA 4NOHA 3LANA 2QA4N 4LH4A 2RQKA 4OYPA 1NZ8A 2OELA 1X5PA 3C14A 1FK9B 2CPFA 5AE3A 2F9DA 4M3TA 4O4GA 2Z1JA 1UJ4A 2F5GA 4OLBA 3HCXA 4L72B 3OTOJ 4O44B 4DV4F 2HSTA 4FJXA 2PA8D 4PA1A 2KG1A 4WP9A 3WEEB 2CWKA 1HMVA 2AGPA 5DDOC 4OZLA 3E8OA 2MQNA 1T9UA 4OLPA 2A3JA 1BWEA 1GMWD 3IC1A 4CCHA 1UCNA 5ETTA 2GTDA 1W0HA 4PWDA 2RF2B 1G7CB 2M3DA 3MEGA 4UY8O 3V4MA 2UXCJ 3PYDA 5KG3A 3R1XA 1YI2S 3N4PA 3EZUA 1LW2B 2C2KB 3K9KA 3AO4A 3M6XA 1VGYA 1FE4A 1OY6A 3Q8SB 5KFLA 4I9LA 1EKSA 2F9WA 4BVOA 2V4JB 4CEDA 4Y0FA 5K9FA 2MQLA 1G15A 1ZBLA 2RILA 4JI8K 3DMJA 4WK1A 3CYMA 1UEVA 4BRGA 1O51A 3D2FA 3EEQA 3PW5A 3D0GE 2BKPA 4ZPWR 1RBOB 4BR9A 4BCAA 2YNFB 4RPFA 2HS3A 4B1VA 1IBCB 2YBVA 2G2OA 2QMWA 2AJ4A 4HTJA 1NSKL 1PIEA 3QT5A 3DC2A 2NNWA 1KAXA 3NL0A 3KLHA 1R8AA 3UPFA 3GZ7A 4AQYJ 5GAEP 4JKDA 1UL3A 1S99A 5AE2A 5KQDA 4WYWA 1TK5A 2N82B 2EEYA 1S77D 5L1KA 1EQ0A 2C2RA 1RT7A 3THXB 4RBVA 3CHWA 4AHTA 2P9LA 4DU8A 1D9AA 3FBFA 1OVYA 3FZFA 4EU0A 3RBZA 4KO0B 3M3ZA 2MKHA 3TSQA 2P1JA 1QE1B 1RTZA 4B1UB 2P9NA 2VBYA 3RRHA 1IR2A 4X64K 3O1LA 2HURA 1NJXA 3RW7A 4F4XA 1WELA 2CQPA 4CDIA 2W2OP 4CGFA 3ALYA 1C1CB 4PG6A 4F4WA 2R2TA 3QJJA 2BQ3A 4JUZA 2R7XA 1DTTA 4FF2A 2HLTA 3MECA 5KFTA 4X4VA 3VHQA 3LP2A 3HZEA 2LFVA 4PKIA 1U2RA 1U24A 2V8PA 4ZKAA 3NF8A 5M1KA 2VC1A 1TKDA 4DZDA 1GX5A 4I2PB 4FF3A 3HKWA 2W9AA 3B78A 4Q2MA 3CQYA 3F9MA 1LWEB 4BC2A 5JXSA 5C0YA 4FBUA 1VJQA 3B6BA 2YKNB 2PBDA 1GX6A 4GMKA 5T14A 1R8CA 4DV0J 2CIMA 3PHTA 4ERDA 2BE2A 3QFWA 5BN9A 3O6QA 1U8SA 4JI7J 4CEZA 5LJWA 4ED2A 3W2WA 3V81A 1P8GA 1RFQA 5BPNA 5K8MA 1N33K 5DDPC 4DTUA 1CJVA 2KZZA 2VBXA 4BGAA 2DNGA 4GW6A 1XNQJ 3OW2R 3C6AA 3AD9C 2HMIA 1TL3A 4UF4A 3MMAA 3VVTA 3VOVA 4C23A 2ZH8A 5C10A 2OTLN 3GIIA 4NZ6A 1B4SA 2E1PA 1JK9B 3HTVA 3IWNC 3QEXA 1VLYA 2NZTA 4DR3K 4AQYK 1YBTA 2D9OA 4LSLA 1GOCA 2EFGA 3WX4A 2IC3B 4OI4A 4QWCA 3IS9B 2BE9B 2JDJA 1IKVA 4A2AA 3W65A 3NRBA 4KHNA 3UVJB 5HRSA 3G0ZA 3R5JB 5E2QA 1K8AT 3DGVA 4MO5A 3TTCA 3OR1A 5HL7Q 3J7Z5 2MQQA 4AFFA 1N8RT 3K17A 1RAAB 4YY3F 4M94A 5E26A 1E3MA 3W1YC 3GU0A 1ZH5A 1GLEG 1PILA 5DK5A 2XCAA 4J9MA 4OPJA 3HD1A 2P9GA 1QJHA 1YLXA 4DU4A 3LM9A 4FF4A 4Y2IA 4WKRA 2FDNA 1H3DA 2DXEA 3H08A 1R0AA 2MLYA 2QWNA 2UUBJ 4DR6J 3U8XA 4M3ZA 4OI2A 1TL1B 3W5YA 3BQ2A 5D0GA 2W9BB 4MKVA 5GAGU 4O0NA 4P74A 4CLKA 2HS4A 1HKCA 1FXDA 3H1QA 3KLGA 1LAVA 3FBBA 3IMQJ 4LF4J 4QJVA 4DR2J 3G25A 3R3LA 3OSPA 3KOAA 4DV0K 4XEIA 5F8JA 2GCFA 1HI1A 1I3OB 3S3OA 4CNZA 1O8BA 3ETMA 2WONB 3NVMA 4CF0A 2FXUA 4OX6A 2XMTA 3JTNA 4JI7K 3EGWB 3W66A 3PR4A 2P9PA 1NGJA 4DV6J 4B1WB 2GX8A 3NGYA 1RT6A 2VWJA 3U4LA 2JGUA 3KD5E 3GDQA 2Q3SA 4QQBA 1IVZA 4FDFA 2AGOA 1DQ9A 2JZ5A 5KFAA 2MXYA 1RWMB 5KFZA 1YSJA 4JLHA 3CCJS 1AZSB 3B4MA 1TMMA 4B9UA 5A6WA 2WBNA 3BZKA 4DSIA 3C16A 4AHRA 2MJNA 3F9KA 4B3SK 4JI3K 5DDQC 1NBEB 3AGKA 1RHQB 2DB1A 2FVRA 3AA4A 3ENWA 2IJFA 1HR0F 4Q2LA 2OFHX 2GMJA 4DUZK 2X6SA 1SKRA 3OYGA 4O4GB 1XC9A 2IDOA 2WOMA 4KV8B 2DNNA 2HIQA 2GWJA 1WF0A 3VV2B 3NY0A 4JKFA 5GAHP 2B4UA 4HHHA 3HZGA 4W5QA 1XHXA 1A5VA 1NBWA 5KT3A 2V8HA 3VF4A 2ZWPA 1X60A 4WK3A 3PUFA 2C2NA 2JL9A 3KVGA 2HQDA 3E66A 4B1XB 3VEWA 2UV8G 4C1NI 5DRKA 2BKNA 1LXJA 2W2QP 1HBUA 4TN2A 1U2CA 4CH7A 5BN8A 3OL7A 4JI0F 2J7WA 1FFWB 2GJ2A 3QZ7A 4PWDB 2IA0A 4CGJA 1HUXA 2BOPA 1IBMJ 3VGLA 1HNIB 2O8FA 4Z4IA 3QRQA 4CK2A 3OW2M 4CJ3A 2Y8YA 3V9SA 2N3OA 4QAGA 1S1XA 3VQEA 4IDKB 4CYUB 4DR6K 4IR9A 2HKEA 1HNWF 3EXYA 3O8MA 3MFIA 5EU7A 4FOIA 3OYMA 3OYLA 3HSJA 1F2HA 2E5HA 5IC4B 5AQQA 4F50A 4RTFD 4X62J 1WNEA 4YDUA 1S9EB 2A1BA 2QG9B 4PKDB 4DPWA 2HBRB 3HM9A 2HZCA 4IBNA 3VAIA 1U1MA 4DX7A 4AL6A 1I1GA 1ZPWX 4B9LA 3KLHB 4FJMA 2MHNA 3V4IA 1JLFA 2W7PA 1ZBHA 4M42A 1TAQA 4Q7AA 3ISND 2BJ1A 4DG1A 4DV1K 4QZVB 3R1HA 1VQ7N 2HK3A 2P9LB 2ZH2A 1O0PA 1OKJA 4DSJA 3VEVA 4ZCLA 5HVGA 4CEAA 2HBKA 3LGMA 1YJ9N 3HI9A 4BRPA 4FBTA 3ZXWA 1XMQK 2RRAA 1HW9A 4GKJK 3KHHA 1B70B 3G6XA 1FI4A 2KKHA 4QYZJ 3MXHP 1SUQA 1BC6A 2BW2A 1FKPA 3NMUA 3M8QB 4CT9A 2R8GA 5BXIA 3OYEA 3F41A 3MECB 4N8NA 1WEYA 4NLRA 5KT5A 4ALZA 1ZM2A 4RWTA 2O5DA 3BQ1A 4DQ8A 4ZITA 1X5SA 4C7QA 3PIOL 1SJRA 3SDEA 4GVBB 4KHMA 4RBTA 2ZHAA 1NM2A 1RBVA 4CJ4A 3OYJA 2ZE2B 4L3KA 4HUFA 2MQOA 2AYEA 2QTWA 3MAQA 4ICLA 2OPQB 5KFUA 1VQ8N 2VUGA 5F8HA 1FCAA 2EWHA 4DS4A 2GNKA 3QJLA 2IDLA 1YG0A 3BDEA 3SUNA 1UEUA 2EXUA 4J9KA 3MM9A 3SBTA 2W6KA 1SBRA 2BUNA 4CP5A 3AY0A 1RHRB 3AOBA 7AT1B 3UKRB 4OV6A 2GQCA 1S0MA 5GADI 4I2QA 3SQOP 4DHVA 4KYZA 1S6QA 1RU1A 4QW9A 2BANB 2IVNA 4FK2A 1QHTA 4LBHA 3AJ1A 2FBVA 2HHSA 3L9ZA 2ZBCA 2OH2A 1Q7YT 4E2FB 3MMAB 1WWHA 1SXLA 3BO3A 3N9UC 3Q8UA 4WCEQ 4HT7A 2WCXA 1RDBA 3B8AX 5KFSA 2HWIA 1S1TA 3WNEA 1CG2A 1OO0B 3ENVA 5KFFA 2M4MA 4QPTA 3GE9A 4LSLB 2VC0A 3T7ZA 2Z30B 2C28A 3KLIB 1SJ1A 3MTKA 5CZXA 3LZJA 4ISEA 3NF7A 4V19X 1U6BA 3PZPA 4OYMA 5LSLA 4NB4A 4DL2A 2D7SA 5BR9A 3CC7S 2FSKA 2KZMA 1RYSA 1RSCA 3EPGA 4NZ7A 1XNRF 5HATA 1S9FA 1H0HB 3ZX3A 4EAHD 3SFGA 3CG7A 3F2KA 3M8ZA 3NGDA 3H8YA 2VGMA 3GIRA 2IVOA 1QTMA 4I68A 1FKOB 3BPDA 2HBYB 4IH6A 3JTPA 4PL8A 4ZHRA 1MDUB 5JVHL 1R0AB 5DQHA 1YGYA 2NSCA 7FDRA 2UXDJ 5AFUA 1JCFA 2WRMA 2J76E 3OVNA 1Q5VA 4LY7A 3HOTA 2A10A 3KZBA 4ZDNA 2YQ3A 3SAGA 4HEA9 1LWCA 5AQHA 2RS8A 3AXKA 4WF9L 1OH6A 1IO2A 3IP0A 4FJ7A 4JBCA 4AHUA 2MZJA 3VTIA 2BMBA 2VICA 2IHR1 4NYZA 2ZOGA 4KBIA 1C1AA 1S3XA 2P51A 1FWLA 2RHKA 2OD4A 5HLFA 5A8KB 3W63A 1JJ4A 2FGOA 1JLCA 2AU0A 3P3DA 1SL2A 1M90T 1T03B 4KTWA 2QO3A 1RT6B 1IM6A 4FWPA 2JLEA 3SV3A 2FY1A 2IVMA 2EC2A 2RDDA 5KFKA 1KNZA 1U49A 3RRGA 4C8LA 1H6KX 4IFYB 4UZCA 1QAYA 3QICA 1YZ7A 2RRBA 2VFRA 3MM5B 5G0RB 2ZD1A 3MD1A 2E5LK 2MZQA 2DR5A 2O8DA 1OWXA 2HAIA 4CEEA 3C15A 3TWHA 4F0KA 3OYNA 3OR2A 1D5AA 4JNEA 3L3UA 3RSEA 2AJ2A 5K8PA 3KJNB 4IRKA 4MKYA 4I7FA 1CXUA 1FRLA 2UUCF 3NBPA 2E5GA 3N6LA 3RMBA 3DN9A 4YMEA 1RDAA 2RAQA 3OJSA 1FVSA 1MROA 3QNNA 4ILJA 3HSCA 3V6HA 3GFXA 4DBQA 1LW0B 3C6UB 2EK6A 3TJ9A 1PJ5A 3H90A 3PO4A 1DRZA 3NAEA 1PBAA 1RT2B 4BDPA 3ENOA 2ZBPA 3E9LA 3NAIA 1BQNA 1RT3A 2WSFC 2HZAA 1YJRA 3BGFA 4C98A 1WKLA 4NO7A 3GBTA 3O3LA 4ID5A 3HULA 1RT4A 3IGNA 3NE6A 2O8FB 2LXIA 2QMXA 1U2FA 1EX8A 1VQKN 2CNLB 4NCBA 2L3MA 4M5LA 4YR3A 2HHHJ 1GAOA 2FC9A 4UTGA 1K8AO 2CZVC 5KFMA 5DG9A 3NH2A 5J2QB 2V9KA 3ZSOA 1B0PA 1N8RO 3D6TB 2R7OA 4IWVA 3VTHA 5GIOA 4CIEA 1EIYB 2V4QA 1FVQA 3NS7B 4MTPA 4FJIA 4DL7A 5AT1B 3NP5A 4KHSA 1ACMB 2B6AA 2ZJQQ 3ULHA 1WF2A 5M1PA 1QSLA 3W3DA 3DLEB 3ZEUA 4LFBJ 2P9UB 3IAM9 2N3LA 4ZJQA 1NK4A 3QETA 1CJUB 2V9WA 3PY8A 3V4IB 2O67A 3AVIA 2AQ4A 4BC5A 4BC9A 3C7NA 1PAEX 1NGFA 3MCOA 1VK3A 4DG1B 4AILC 4Y1CA 1QTNB 4E3SA 1U6ZA 4WQ4C 4BLGA 1CC8A 2BM1A 1Q16B 2LEBA 4ELVA 3MM6A 4BRQA 3BSAA 1SL0A 2MYFA 2MY8A 1XQSC 2R42A 4BACA 4H5TA 3OFFA 2HNDB 5K14B 4U7BA 1MNEA 2XMAA 1Q7LB 1SUQB 4M8LA 2FJDB 2HAFA 4JB8B 3SQGA 2KRBA 4A4JA 1Z4UA 3PX0A 2V5HG 4PXBA 2RSQA 1LXNA 4IG0B 3MD3A 1FHTA 2KN4A 2YNIB 1SL1A 2CPYA 1RT5B 3D0PA 1QVGR 4OPAA 3K8VA 1N4LA 1WOSA 3R8YA 5F8NA 5L1IA 3I56S 2GMLA 1Z2LA 2VG5B 2BDPA 3KD1E 3SDEB 1MMNA 1RYRA 5D8HB 4OHYA 4RWWA 4O3PA 4FYDA 1HBOA 1EHWA 3ISZA 4K8ZA 4ICLB 3PKYA 3CCUN 3BJYA 2DY4A 3HVRA 2P9IB 3T6BA 1ZBUA 2NPIA 2U1AA 4GO7X 2YWFA 3QT7A 3E3XA 3WXMB 3OTEA 1H7XA 2C2DA 3DJCA 3DLKA 3HLUA 2HGNA 2W6LA 1QZ5A 4QS7A 3IBFB 1C1BA 3MM9B 1R7IA 4ED5A 3HHLD 5C2CA 5GAGP 2LMIA 5E3RA 3AVBA 4NLSA 5DM6L 3KNAA 3VR1A 1NWKA 2QFIA 5C42A 4BRDA 3H5SA 4Z7YA 3TA0A 4H4KC 3PJXA 1OQ6A 3FZLA 1WD6A 4BG9A 1S6QB 3TAMA 4QWBA 3DYAA 3NS6A 2OTJN 4DLGA 1MSWD 1DKGD 4K59A 2NCKL 4ZPTR 4LF9F 3VQ8A 3SQ1A 3KLFB 4P73A 3OJUA 5C15A 2V68A 4PZVA 2VPXB 5F8GA 1SC1B 1Y5LB 4LVOP 4J9NA 4K42A 2XB2D 1ZPVA 4RW8A 2ADCA 1S1TB 3MN5A 3I0SA 3TAGA 2IM0A 5KOWA 4BGBA 3X3UA 4ZLJA 1EKEA 2VWBA 4MKAA 1RWOB 1CSJA 1JJHA 5LMNJ 3LZIA 1KDNA 3OSNA 1NGGA 2KVIA 5JS1A 4MT1A 2DNYA 1NGEA 1FERA 4NLVA 3H1VX 4RW9B 1NJZA 4CF2A 1KEKA 3EE8A 1CS4A 5DGAA 3D6FB 1VMBA 2XLIA 4K5RA 4FZXC 1R3NA 2EBEA 4X65F 1OSCA 3I55N 4F3QA 4JS4A 4XPEA 4URQU 1RWNB 2ZGYA 3ZT3A 3DFEA 2DHSA 5IV3A 2OZMA 2DHGA 3HHKA 1FEEA 3FK4A 4K0KJ 3BKFA 3NXZA 2Z4PA 4IG3B 1XTZA 1C0UA 2XMVA 2ROEA 2ILYA 1QM9A 1Q8LA 2Y1LB 4XDCA 3KHYA 3KIOA 1D09B 4M63A 2DY9A 2F9TA 4X4PA 3US5A 1RWWB 3SQ4A 1QAIA 5M2RA 1LWCB 1Y5IB 2DGOA 2H5JB 2EFPA 1NOZA 4AM6A 2KB2A 4TVAB 2AX0A 2BEFA 2CAJA 1U1PA 2G0CA 4ANCA 4X64F 4DV7F 1LV5A 2A42A 3VVUA 3MMJA 2D0BA 1VQ4N 3LPUA 5L39A 3JSMB 1CJKB 3L4BC 5CYQB 2XZTB 4FLTA 2MKKA 4MFBA 1T3OA 1XBWA 1C0TB 1IG9A 3K58A 4U9RA 2FGCA 4NXNJ 2ZC3A 2EX3A 4PEOA 4DX8H 2AJ1A 2R7UA 1ZC6A 5EXWA 1UKUA 4USHA 3UR0A 4K4WA 5D0RA 2DGVA 1P1TA 3CSKA 2O1PA 1XQIA 2DGUA 3VEYA 3B4DA 5L8RC 2Z58B 1BIZA 3SYZA 4MO4A 2KL8A 2IGIA 4DQQA 3AODA 4RG8A 2B8QA 1TV6A 3BGUA 1BI4A 4R0JA 3QBCA 3C15B 4OFZA 3UD3P 2V2VA 1N34J 4OYAA 5FIIA 5AR0A 1GMUA 1LQ9A 2UXBJ 1KHWA 1RK8A 2C3MA 2EK1A 1RWVB 4I7FB 4O8UA 4C0BA 2XG8A 5LMNK 3QLHB 4ECWA 4HYKA 2UUTA 4OZ3A 1F2GA 2CYYA 2I0XA 5MAOA 1Q7YO 1BY9A 5KFXA 2NXCA 3OL6A 4A5AA 5DQGA 4HACA 4YOUA 2QX0A 4RUCA 3EVMA 4PG8A 1N33F 4GV6A 1RT3B 3ATUA 3KHRA 1TL5A 2V2KA 2HBMA 2XLJA 3BR9A 3WNHA 3P4IA 3CULA 4ID5B 1ZS6A 3G10A