4YFUA

Crystal structure of open bacillus fragment dna polymerase bound to dna and dttp
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
578
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title The Closing Mechanism of DNA Polymerase I at Atomic Resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 578
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4yfuA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yfuA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4yfuA01
1RT5A 2D0BA 1D9FA 1SUQA 3CM5A 2D5RA 1IG9A 2HHSA 4ZTFA 1YTAA 2XO7A 2YNIA 3AVIA 1VSMA 1BQMA 4LH5A 1CZ9A 4CF1A 3AVCA 4QAGA 4IG0A 3MXIA 4J2EA 3HP9A 4CESA 4OGCA 3MXJA 4R5PA 4DFKA 4Q0BA 2IC3A 2WOMA 3ZT2A 4FZYA 4PY5A 5SZTA 1TVRA 4NCAA 4E19A 4FCYA 3QO9A 4C8MA 1TV6A 4PQUA 3SNNA 4E7HA 4CJEA 3AVMA 4BDZA 4FJLA 4E7JA 4FM1A 1U4BA 3O3HA 1QHTA 4FW1A 3SQ0A 3LAKA 4BDYA 3K57A 1S1XA 2GV9A 1SL0A 1KVBA 3MXMA 4FJ5A 3NH1A 3PO5A 1QLNA 3OS2A 5E41A 4DFJA 4CJPA 3HXMA 3HL8A 3VN5A 4FK2A 1J5OA 3LP0A 5CZ2A 3ZSVA 1QSLA 4CEAA 4CF9A 3KLEA 4MFBA 1HNVA 3RR8A 2D0AA 3QEXA 4CHNA 1ASWA 4Z4CA 3TI0A 1HYSA 4DU4A 4DTSA 5HRPA 5KTQA 3AVNA 1L3UA 3K5MA 1L3TA 3AVBA 1TKTA 4KPYA 1KSPA 4B9TA 4BWMA 3VQCA 1XI1A 4LY7A 4B9MA 2XY6A 3QESA 1C0TA 1FKPA 4KB0A 1S0VA 2NUBA 3DRRA 3VQBA 3C6TA 4N41A 3KKRA 2R7YA 1W0HA 3PX0A 3KLGA 1S9GA 3AV9A 1JXEA 4N56A 4XIUA 1EX4A 1RBRA 4DSJA 2ETJA 3VQ5A 4BDPA 1RTIA 4B9VA 3KJVA 1VSIA 4KTQA 2X78A 1ZBLA 1VRUA 3AVGA 2KW4A 4N76A 3LP2A 3ZSQA 5FDLA 1X9MA 3S3OA 4HCBA 1NJWA 3HPGA 4J2DA 4OKKA 3HK2A 4CJ5A 2BGGA 4WE1A 2OPSA 2ATQA 1HJRA 2Z1HA 3AVFA 5JS2A 2VG5A 3AO3A 4O55A 4DTNA 4M3RA 1NOZA 4KREA 3NBPA 1RDAA 5DMRA 2X6SA 3NF8A 3HVRA 2B5JA 2YV0X 4CGIA 1KVCA 4DLEA 4B9SA 1CXQA 3C6UA 4RW8A 1VSLA 4IFYA 3CG7A 1HQUA 3M8PA 3OYBA 3TR8A 4M3TA 4QOZB 4I2PA 4NCGA 3KLFA 1ASUA 4Z4FA 4DTOA 1WSGA 3SQ4A 1T7PA 1RCHA 3PUFA 1NOYA 1X1PA 4F2RA 4GVMA 2DTUA 3IAYA 2Z1IA 1RDBA 4M45A 4DLGA 1JLGA 4H4MA 4Z4EA 1D8YA 4J2BA 4ID1A 2P51A 4DQPA 3NH2A 4Z0UA 3UIQA 3SI6A 3ALYA 1WNSA 3VQ6A 3SJJA 3A2FA 2G8KA 2IDOA 1SKWA 1O1WA 1BL3A 4DSIA 4CEFA 1HMVA 4FJ8A 3ITHA 4FJIA 1EKEA 2PI4A 2HNDA 1D5AA 4DTMA 4FLVA 4B9UA 1C0MA 3LANA 5FROA 4JS4A 4B8AB 3OYAA 4F2SA 1RT2A 1Y97A 3DLRA 5FRMA 3TAMA 4CGFA 1ZBHA 1WSIA 4DTXA 3PV8A 2HB5A 1LW2A 3K5NA 4FJJA 3DMJA 2RKIA 4YFUA 3BDPA 1WLJA 2HNYA 2HHUA 1HPZA 3AO2A 3NF9A 4OKEA 3LWMA 3ZSXA 5HRSA 4FVMA 5CYMA 4DQQA 1REVA 3KK2A 1EXQA 3RTVA 4CGDA 1UA1A 1RBSA 3OYJA 2E6LA 4CJTA 4EP5A 1BHLA 1J53A 3P1GA 3H08A 3QEVA 2XY8A 1S1VA 4IBNA 2G8HA 4NCBA 3ULDA 1NKBA 2HMIA 4CEZA 4KHUA 3MECA 2VG7A 1FXXA 1NKEA 4NYFA 4HHTA 3PX4A 3CFOA 4DU3A 3MEEA 4CHYA 3QIOA 3B6OA 4CHPA 1RTHA 4HVJA 4TSXA 1ZBFA 1Q9XA 3KTQA 4J2AA 1VSDA 4BE2A 3V9SA 4E7LA 1UOCA 3U3GA 4EP4A 1GOCA 2DFHA 2HHTA 4FZZA 3VQ9A 3DRSA 3DOLA 3ZSWA 1VRTA 2YHBA 1TKZA 1K6YA 1RILA 2A1SA 3ZT4A 3D0PA 4FLYA 4DSEA 1UA0A 3QERA 5HLFA 3HP6A 2RF2A 5KGWA 4I9LA 4KI6A 1WN7A 2HHWA 5HBMA 2BE2A 1RTDA 3LPTA 3TAGA 3S3NA 3AVHA 2DY4A 4RW6A 2FBXA 4FJKA 5FRNA 2F8SA 1IKWA 4CFDA 3CQ8A 4FLXA 3U3YA 4CJWA 1JLFA 4IFVA 2B4JA 3RMDA 3MEDA 3CM6A 3TAQA 5C24A 5J2NA 3OYMA 4GW6A 1XHXA 1X9WA 3OS0A 5HRRA 3CFRA 4DMNA 4CJ3A 5KGXA 3OYHA 1EETA 3VQAA 3VA0A 1VSFA 4FJNA 4I9QA 3ZSZA 1Z26A 4DF4A 3DYAA 1TL1A 1LW0A 1ASVA 2O4GA 3NGYA 1B9DA 2XHBA 4FJHA 4Z4IA 4Z4HA 3VQQA 4IKFA 4OLAA 2BDPA 1BI4A 1JL1A 1S6QA 3CYMA 3V9ZA 1RT7A 1QSYA 1C0UA 3HSTB 3LP1A 1U04A 1LWFA 3DLGA 1HQEA 2F96A 3BGRA 3L2QA 3THVA 2YNFA 3NF6A 3WNHA 1R0AA 1NK5A 4MQ3A 4AHTA 4E3SA 5J2QA 4JRPA 4KHWA 3LALA 1N6QA 4FK4A 2QK9A 1ZBUA 1S1TA 3I8DA 4C8OA 1CZBA 4LD0A 3VQPA 1JLBA 4CERA 1RBVA 3HM9A 2IS3A 4W5QA 3ISNC 3V9WA 1JXBA 3SPZA 4F4KA 1S9EA 2G8IA 4CF8A 4IG3A 1LAWA 1WSFA 1A5VA 1YTUA 4OVLA 5CZ1A 1HRHA 3O4QA 4O5BA 1NK4A 1KCFA 4RG8A 3WNGA 3FFIA 4HUGA 3SV4A 1TAQA 3OS1A 3L2UA 2P1JA 1VK0A 3G10A 3P5JA 4UQGA 1LAVA 3DRPA 3V1QA 1XWLA 4KTWA 1QTMA 4B3OA 1BIZA 3VA3A 1XC9A 3L3UA 2EX3A 3KK3A 3M8RA 4CF2A 1TK8A 3AVJA 1XHZA 2X6NA 3DM2A 4HTUA 4OGEA 2W42A 3SQ2A 1C6VA 3C95A 2HW3A 4DTUA 2FC0A 5HROA 4CIFA 4O4GA 1NK6A 4Z4GA 1TK0A 4FZXC 1BIUA 3G0ZA 3DLKA 2PY5A 3HO1A 1AROP 3HT3A 2KZZA 1B92A 2IGIA 3HYFA 3ZSYA 3OJUA 2FBYA 3SUNA 3ASMA 4CJ4A 1JLCA 4FLUA 3SUOA 3C94A 1F21A 1SKSA 3B6PA 3O4NA 1YT3A 3DI6A 4HUEA 4M3UA 1RT4A 1C1AA 1HNIA 3ZT0A 4I7FA 3ZCMA 2G8FA 4M3ZA 3DLBA 1NJZA 1KLNA 3NAEA 3AVLA 4JS5A 1KFDA 2GBZA 3RMCA 4AHVA 3EZ5A 4ID5A 3NH0A 4N47A 4OJRA 3L2WA 1WAFA 1LV5A 4C8NA 1QQCA 3VQ4A 4M3WA 5C42A 2X74A 3OYIA 1NJYA 1JLEA 1Q9YA 3SYZA 3SPYA 4CEQA 2OZMA 3SV3A 1ITGA 5KRTA 3JSMA 2XY5A 4DFPA 2D0CA 3D45A 3PX6A 1RDDA 2O4IA 1BISA 3OY9A 4CF0A 2OZSA 4OPKA 3ZT1A 4BACA 2DFEA 1BCMA 1QSSA 2Z1JA 3AA3A 1H38A 3K59A 1EP4A 3S9HA 2QKBA 4FYDA 1NK9A 4DSKA 4DU1A 3LAMA 2FBVA 1UWBA 4FLTA 3HPOA 1BQNA 3VQDA 4DQSA 3KK1A 3V9UA 2QKKA 3ZT3A 4DQIA 2ZD1A 4B08A 2YKMA 2HHXA 1DTTA 1B9FA 4CFCA 2FBTA 4CHZA 4CJQA 2G8UA 2E4LA 4EZ6A 3QETA 4FJ9A 5EU7A 1U49A 5K14A 4AHSA 1BI4B 5J1EA 1J54A 3S3MA 1J9AA 4H8KA 3TANA 3DOKA 4OPJA 3E2EA 4EZ9A 1SKRA 4CEOA 3HPHA 1ZYQA 1IKYA 2E6MA 2YKNA 1U45A 3V4IA 3T19A 3EYZA 2KTQA 4RW4A 3U6FA 1WSJA 3KLIA 4JRQA 1QS4A 2XY7A 4KO0A 4AILC 3DLHA 3OYCA 4FXDA 3K5LA 4FLZA 2WONA 3NGIA 5HRNA 5J2PA 3OYNA 4FK0A 3VQ7A 1G15A 3L2RA 3PY8A 1IO2A 3M8QA 4DTPA 4E7KA 1TKDA 4KV8A 4G1QA 3K5OA 3LP3A 1IKVA 4F3TA 1RDCA 3V6DA 3JYTA 1IH7A 1S1UA 5C25A 4CEBA 2ITGA 4DS4A 1SV5A 3IG1A 1KFSA 2JLEA 2P5GA 4M41A 3CFPA 1TK5A 1FK9A 2Z1GA 3OVNA 1A5XA 4B8CA 3F9KA 3LZIA 1TGOA 4CHQA 2Y1JA 1TKXA 1S76D 1NK8A 3AA4A 4C8LA 4KKOA 4ELUA 4Y1CA 4CEEA 4BWJA 4DSLA 4DFMA 3V1OA 5I3UA 4FJMA 1T03A 5JS1A 3AA5X 1KTQA 2YNGA 5KI6A 1JLAA 3TAEA 4KHYA 1S5JA 4DG1A 3OYKA 3HJFA 3E01A 4LH4A 4CIGA 4CGHA 4AHCA 3T1AA 4CGGA 2B6AA 2OA8A 1CXUA 4C8KA 1NKCA 4CHOA 3KLHA 2JGUA 3EY1A 2OYQA 1LWCA 4KB1A 1A5WA 1VSKA 1JL2A 2VG6A 4CCHA 2A1RA 3F73A 3NDKA 3TWHA 3SUPA 3K2PA 5CY4A 3WNEA 4CJSA 1MU2A 3HVTA 3NHGA 1HYZA 3AVAA 1Q8IA 2VWJA 1T8EA 1L5UA 3OYGA 4PUOA 1U47A 3O3FA 5SWMA 5T7BA 3QNNA 3TARA 1JKHA 1U48A 4ELVA 3PO4A 1DTQA 4AHUA 2PYLA 3KIOA 3QEPA 4O44A 4KHSA 1I39A 2VWKA 3LZJA 4KHNA 2KFNA 1TL3A 3AO5A 4W5TA 4IDKA 4W5OA 3LDSA 4CJVA 3NF7A 3RR7A 1W9HA 1NK7A 1Z25A 2Y1IA 2IOCA 1TAUA 4CK3A 3MAQA 3SCXA 3QLHA 2PI5A 4L8RB 3NFAA 2LSNA 1SL2A 1VSEA 4KRFA 3SZ2A 3OJSA 2XRIA 4DTJA 3WNFA 1C1CA 4DWIA 1RNHA 2EHGA 2ZQBA 3NCIA 3O3GA 3L8BA 3AVKA 4O0IA 3LWLA 4FM2A 5I42A 4CK2A 4F3OA 1WSHA 2IAJA 1S77D 1CEZA 4O0JA 4KHQA 1RT3A 4DS5A 1WSEA 1S1WA 4W5NA 5D3GA 1ZBIA 1RT1A 3KD5E 2RN2A 4KAZA 1KRPA 2AJQA 2KZMA 1NK0A 3VQEA 3TAPA 4BE0A 1CLQA 3AO4A 2P5OA 2G8WA 3MEGA 4F8RA 1I3AA 4PA1A 3V81A 3V1RA 4H4OA 2PYJA 4M3XA 1GOBA 4E1NA 1N5YA 4PWDA 1RT6A 2QXFA 1NJXA 1WAJA 2DFFA 1YVUA 1LWEA 4ELTA 1VSJA 4LSNA 5DK5A 4B9LA 1HYVA 4FM0A 1MSWD 1L3VA 4RW9A 1IKXA 4E1MA 1UAXA 3VQ8A 3ZSRA 4CECA 3NGZA 1BCOA 4Q5VA 3OYEA 3RMAA 4QCLA 2RPIA 4ZHRA 4DTRA 5J2MA 3KD1E 4AHRA 3TABA 2OPRA 4JLHA 5HP1A 3M8SA 3TAFA 3QINA 1D9DA 3QEIA 3OYDA 2BANA 1X9SA 1KLMA 1KVAA 2OPPA 1FKOA 1RTJA 4FW2A 4ICLA 4FLWA 1DLOA 2YNHA 4CJKA 4FJGA 4KI4A 3QIPA 3L2VA 4CFBA 4DF8A 3I0SA 2HVIA 1RBTA 2ZE2A 3P83D 4GMJB 3QNOA 4CIEA 4CFAA 4K8XA 1GOAA 2F8TA 4DQRA 4ZTJA 1RBUA 1S6PA 4CEDA 4CJUA 3AA2A 2KFZA 2GUIA 3KKSA 4CE9A 4M42A 3LPUA 3SUQA 4B9NA 3OYFA 2Q3SA 3AO1A 4FJ7A 4KFBA 4FJXA 3RWUA 4CK1A 3DLEA 4E0DA 5KRSA 2HNZA 1SL1A 3RRGA 4CJFA 4K8ZA 4M3YA 1JLQA 4OLBA 4E7IA 2KQ2A 2HVHA 4N5SA 4HCCA 2OPQA 4KTZA 4CJLA 4BE1A 3QEWA 2YHAA 5CYQA 4AH9A 4YNQA 4Y1DA 4I2QA 1VSHA 4LSLA 1T05A 3ZSOA 4OKJA 4NYNA 4DSFA 2I5JA 2HHVA 2HHQA 4W5RA 3V9XA 2PZSA 4RW7A 3IRXA 3L3VA 1L3SA 3RMBA 3RRHA 3NE6A 1BGXT 1C1BA 4CJRA 3I0RA 2G8VA 3T3FA 4CGJA 4E89A 3OYLA 4HUFA 3K58A 3IS9A 3SQ1A 1QE1A
chains in the Genus database with same CATH superfamily
1NH7A 2P9IB 1Q79A 3MI7X 3OL7A 5AJ3F 4QAGA 3PRVA 4DFKA 4DL5A 2ABYA 4U8YA 4IUFA 4PCQA 2E2NA 1ZTTA 2OSQA 4FJLA 1VQPS 4JI8K 4DUYK 3MUMP 4OLPA 1OVQA 2JWKA 1SL0A 3AD8C 1TL7B 4JV2A 1TUVA 1J5EJ 4O3OA 4MFBA 1B0VA 4CNZA 3PSFA 1QAXA 1BG3A 4JI1J 4W4MA 1N36J 2YWFA 2DR6A 1S5ZA 2KJVA 3OL9A 3AV9A 3WHIA 1P6TA 1VCTA 4WJBA 4DHVA 1PBAA 2C2DA 1U2CA 2APOA 4P73A 4JEPA 4H4KA 4IFEA 3S3OA 2YHYA 2RDJA 2V8GA 1NGDA 5A6PA 3GJQB 3PYFA 3BGUA 3L0QA 3G4SN 4DTOA 1EQYA 3PW5A 3OBYA 2ADBA 2M52A 4BY9C 4ALZA 1GX5A 2B56A 3KZBA 4DSIA 1Q86O 1HMVA 5HLFB 4FJIA 1MWYA 3SAFA 2MQMA 2JSXA 5KT4A 1I94J 2KU7A 3R7BB 1PAUB 3CT9A 4PKDB 4FJJA 4P2XA 3DMJA 4LJMA 2C42A 1HNWK 4RBVA 2PT0A 4IDHA 2YHWA 2L9NA 2RQMA 1NB2A 1X4GA 5CYMA 4DQQA 3WBZA 3WC2A 4CZMA 3R5CA 4HLBA 1RBSA 5J1PA 1UVIA 4GNIA 2OUGA 4PRFA 3MDFA 2NRHA 4FS2A 2C2EA 4KQZA 2XS7A 3PX4A 1HQEB 3TJ9A 2DGWA 5F8GA 1PILA 1E4FT 2C2NA 1SJ4P 4OYPA 3FJ2A 1TKZA 2A1SA 1HNZF 2E1CA 3NGTA 1W97L 1T11A 2BE2A 3EPGA 2YBVA 2OO4A 4IFYB 1JIHA 4RBUA 2NR0A 1U25A 4CJWA 3W8GA 4BR4A 2G0CA 3MMCA 4JI0K 2AGQA 1HBUA 1ZZNA 3VA0A 4DHYA 4LIWA 2CJQA 1Q18A 1WHYA 1ASVA 4A47A 3I87A 1V3RA 4Q43A 1QSYA 2OH2A 5EX0A 5EDWA 3V6JA 3Q7CA 5HJYA 2HAFA 1R0AA 1NK5A 2ALZA 2FJXA 1N6QA 4LD0A 4DZ6A 4CF8A 1LAWA 2R2UA 2R7SA 2ZHBA 2XWYA 4WTYA 4DKWA 2MKJA 4DR2F 1G4CA 3UR0A 5B0GA 5BRDA 3C95A 2FC0A 1NK6A 4LSZB 2DH9A 4ZPTR 3ZSYA 2JZ5A 2IM3A 1N52B 1SKSA 4ZP9A 3O4NA 1UFKA 1RT4A 4NLYA 2J7UA 4I7FA 2AMCB 2H4WB 3AT1B 4GKJK 4H5VA 1SV5B 1RKJA 3DAWA 1ITGA 5B09A 2QA1A 3AAQA 4DV7F 3Q83A 4M5DA 4OPKA 3TJ8A 1EHWA 4FLTA 3OHAA 1VQ7S 2YKMA 3ZZPA 1YIJN 4J9KA 3S3MA 4I0WA 3A3PB 3E2EA 2BXJA 1XIQA 3EYZA 1MU2B 2O5DA 1HI0P 3Q8SB 4HT5A 3UD5A 2E88A 4MLHA 1RK8A 1IJJA 3NVMA 4G1QA 1VQLS 4NRUA 2KXHA 1IH7A 1QQOA 1T3VA 5FLXO 4ETZA 3AB4B 3BN7A 4M41A 1OYEA 4RNNA 2H5EA 3LZIA 1F9EB 3SCIE 2FF6A 4KKOA 4BRDA 4UW2A 3AA5X 1JLCB 2F3JA 3P6YC 3E01A 4CIGA 3MEGB 5F8LA 1LWXA 3SUPA 1ZXOA 2CG4A 4CJSA 2QO3A 1XMOK 5AJ3J 5CHCB 4H54A 1NNEA 1NB7A 2XWXA 1TUWA 4H0VB 2AJ0A 4KHNA 3N6MA 4FVUA 4X4VA 4R0EA 3N01A 3CMQA 1W9HA 2YJEA 4WF9Q 3I4PA 1Z1ZA 5GIPA 3NFAA 1NDCA 4JI4K 2P9PB 5BPLA 1NU0A 2KI2A 2N3OA 5AQYA 1DHMA 4GC6A 4LRBA 1IKYB 4RW4B 4KE5A 2ZJQL 4KAZA 2E1AA 2D4WA 2J0XA 2BUNA 4JI8J 4DUYJ 1N5YA 4PABA 4A8MP 4ELTA 3CCES 2OJ3A 3M9MB 4Z2XA 2ASDA 3T9NA 4Q5VA 2LECA 3RGIA 3O5BA 1OSCA 4YOUA 3ZLJA 4K2JA 5DDQC 3ILIA 4ICLA 3GOIA 4RBTA 4YY3F 5CD4H 3H40A 4GV9A 4MTPA 3PJXA 4ED6A 3R2DJ 4K8XA 1GOAA 1LWCB 4BGAA 4CJUA 4J5OA 4BR5A 2ZVSA 5GADU 4H0OA 3IA0A 2KQ2A 3DU6A 4XPCA 1S48A 4O44B 4ZMMA 2ZBCA 4DPWA 5GADI 3IM9A 2VJUA 3GE1A 2ZOGA 1OY9A 1YRTA 2ASMA 1R7IA 5L1IA 4EHTA 4HVZA 1S9GB 2RD5C 4BRAA 2JHEA 1OQ3A 2DNZA 4LF6F 1RT5A 1HIYA 5AQOA 1HL6A 2GGPB 2HHSA 3ET6B 4A5AA 5FIIA 3L95X 2RRNA 4BVOA 3MXJA 1RT1B 4WP8A 3OT9A 4DUZF 3W66A 1Q78A 4L75A 5HMYA 2E8AA 3W60A 1ZS6A 2FVRA 1IKXB 1JK9B 5E41A 5J2MB 1HNZJ 3QFUA 3DC2A 4RZRA 3RR8A 2JFDA 5D15A 4Z4CA 4CO5A 3NCRA 4OHZA 2BANB 1KLMB 1JQGA 2R8HA 2QEXN 1L3TA 1RDRA 5EUHA 2XY6A 4DOZA 4YHHF 2BBEA 3CC2S 2R9LA 3C15A 3QWPA 3C6TA 4DMZA 2IJNA 2ZHAA 3MAAA 4B9VA 3MAHA 3VGMA 4LF9F 2HLUA 2OI2A 3ZSQA 4LRCA 3ILJA 2MJNA 1HJRA 2Z1HA 2IA6A 3TSQA 1RDAA 4YS2A 2CPEA 4LSLB 3DLJA 1VBYA 5ETLA 4AT1B 4JI0J 1DKGD 2VH7A 2R8KA 4P10A 1DQ8A 3GIMA 2G8KA 3I6PA 2DNKA 1BL3A 4R5PB 3M6VA 4Q0BB 3KWMA 3LM2A 3PG9A 2P9GA 4YDUA 2GNKA 2ZJPQ 2XMVA 3QFHA 1RHMB 2Z4PA 2UUWA 3Q0AA 2W2MP 1NLVA 1WLJA 2YI1A 2HHUA 5HVFA 1REVA 4V19S 2PN6A 2BJEA 3KHGA 1MG7A 1J53A 3P1GA 5C5JA 3BBBA 1C0TB 1CZAN 5AZJA 4JI7J 3PLAA 3DDIA 1WG4A 2G1DA 2BH1A 3CCUN 2FVCA 2KG0A 1G6BA 5J2QB 1K0TA 2UV8G 2IPOB 5AQPA 2Q1NA 1MN9A 4C3MA 3DOLA 1P27B 4NLOA 3CD6N 4USHA 1QD1A 2RF2A 4CNYA 1NDKA 2ZITA 4I2PB 4NLQA 5B0AA 4FJKA 1RABB 3DM2B 3HT0A 2BQUA 4BS2A 5C2DA 2ZBQA 3CQ8A 2XMJA 4IFVA 1X0FA 2B4JA 3MEDA 1LKZA 1EETA 2NXNA 3EN9A 3BB5A 1TL1A 1T9YA 4W98A 4OLAA 4ANCA 2F8HA 3HSTB 3UWTA 2GHWA 4C8ZA 2D3ZA 2F9TA 3VAFA 3KUGA 3MR2A 3HRGA 5D0EA 2HVDA 2LQJA 3VGVA 2GMHA 3JQMA 5KG0A 2IS3A 1N54B 4LF1A 3O4QA 2I38A 4LFCF 4A57A 1RDWX 1S79A 3V1QA 4KTWA 3GG4A 4HTUA 1Q5YA 3HO1A 3OXGA 4JKAA 3MN7A 3B6PA 3EDRB 1KLNA 1KQKA 2GBZA 4ID5A 1U2FA 2JEFA 5HBMB 3SPYA 3PX6A 5DM6Q 3CJ5A 1RDDA 2J0WA 4FWKA 2OLWA 5J2NB 2XGQA 2BQ3A 5GAEP 4JD2B 4ECVA 3L7PA 3KKFA 1FTRA 4C0OC 1Q1KA 4B08A 2HHXA 1DTTA 4UOCA 8ATCB 4C97A 4JK8A 4QW9A 2WBRA 5KFSA 5HANA 1U2VB 4BRCA 3KWGA 2J76E 1K8AT 2ZC4A 1S10A 2QLWA 4JK9A 2XC9A 3PW0A 1JWWA 2LU1A 3SDEB 1LEOA 3JXUA 4E7KA 3RJMB 1ATSA 2PMZD 3OTDA 3IR6B 1V3ZA 5EWGA 5RUBA 2P5GA 2IRYA 1HKAA 2WTUA 1EWQA 1YDLA 3F9KA 3THTA 1NK8A 4AXJA 5LMNK 3EICA 3D6TB 1U1NA 4E98A 3M2RB 2B6AA 2GX8A 2JGUA 5BREA 3SJHA 1JB0C 2JEIA 1YUWA 4CCHA 1H98A 4LRAA 4K4WA 4LF6J 3K2PA 3AVAA 5J1NA 2RJZA 3VOVA 3LGNA 2W6KA 2PYLA 4ZPCA 1VQON 1RQ0A 2UXBK 1UVJA 1R59O 4W5OA 1Z25A 3TZYA 4IOBA 3CPEA 4LREA 5IT9O 2EHGA 2GA7A 3R8YA 3VEVA 4J91A 3KLIB 3GIRA 2R42A 2F63A 3MWPA 3JAMU 3CERA 4BE0A 3AO4A 4H4OA 4U7BA 3HSCA 2Q6CA 1RT6A 4LF9J 1K1QA 1MSWD 1P8ZA 2XSJA 2ACYA 5EHHA 4CLUA 4XPEA 2J0QD 1DLOA 1VBZA 1M0SA 4NZ7A 5AR0A 1RBUA 3TUIC 4TY9A 2QI2A 3KKSA 5CYJA 4ED7A 3AO1A 4ZDNA 3L4IA 3DLEA 1T3NA 4M3YA 3J7A1 4JYAK 5M2UA 4PUOB 4DV6K 3C19A 4YNQA 2DJWA 1VSHA 1T05A 2GIRA 3V9XA 2MKHA 2CUYA 4HACA 4BC4A 4HDGA 3SLCA 3SK3A 1YBTA 4IEEA 7FDRA 3AHPA 1SUQA 2R7TA 4ZTFA 2DR8A 2IAJB 2XEXA 1BQXA 1SPBP 4CF1A 4P72A 4FF3A 4A8WA 5B0EA 2DXDA 2DGTA 4C8MA 2GQCA 1Z2ZA 3M8PB 5AQGA 3LL3A 1A9NB 4CJEA 3TQ1A 2CQ0A 2V68A 3PTWA 3JXOA 3S41A 3A5MC 4AQYK 2GV9A 1HBMA 2XM3A 4CJPA 4RUHA 4NE9C 5CZ2A 1R43A 4CF9A 4A8QA 3QEXA 5M1PA 4LF8K 4NLRA 2KHOA 4B9TA 1S49A 1XI1A 1FJCA 3GR0A 3NGUA 3IWNC 2GS8A 1EJ7L 2JFKA 3KXDA 2VL1A 2WMMA 1SC6A 2IM0A 2CZ9A 1YRUA 1VSIA 2UYTA 1HBOA 3AVGA 1V3SA 3LP2A 1VI7A 4HCBA 2DNGA 5LL6d 1GXUA 2XO6A 3J7AN 1KQFB 4K25A 4OI0A 4CGIA 1KVCA 1UAWA 3M05A 3M5RA 4NCGA 3CULA 6AT1B 2ZH1A 3UN2A 5K8NA 3CD5A 4NXNK 1BUXA 5K5MA 3VZIA 5JVGQ 4LFCJ 2RMLA 4BHQA 3DOMB 3NEKA 1BA1A 1TL5A 4B1UB 5JMVA 3H20A 3RSEA 3KJNB 1UEVA 1UETA 4LQ9A 1C0MA 1H2VZ 5K20B 4YR2A 2XMMA 2Z2ZA 1WSIA 5C24B 1NDPA 2PE8A 1U24A 3GV5B 2HNYA 1VOMA 1REGX 4ZIVA 1M5VC 4IZ9A 2K8GA 3D0HE 4G1PA 2MY7A 4NCBA 1PBUA 2A5XA 2RHQB 3TWZA 4DU3A 4OHVA 3PKMA 2M5YA 4IH7A 5LOQA 2VBXA 3MM8A 2E5JA 2PC6A 4O3NA 4OX9K 2M88A 1GLCG 3CCWA 4URQU 3BF3A 4DSEA 1K47A 2XMUA 5KGWA 3NVKA 4BVPA 2NLXA 5HN0A 5AQFA 3KVGA 4JHDA 5KG7A 5FPMA 4I6MB 1YSJA 2FSNA 3C16B 3OXFA 3BO2A 1H2UX 3DWLA 3IKMA 2V2QA 4DMNA 4X2BA 4M5HA 1QTNB 2ZOMA 2NXEA 4KHPF 1IBMK 3SBTA 3VWSA 4CH0S 3NKYA 4QZVB 2HNDB 4DV5F 5GAGP 1SC3B 1VQ6N 2YNFA 3LALA 1WF1A 2G8IA 1LW2B 3CJ8A 1BOTO 2XNRA 1HRHA 2M9KA 3OTOF 2P1JA 3ULEB 1VK0A 3ZTQA 5SUHA 1FNOA 3WEEA 2UUCK 4ZOSA 1NMDA 4BRPA 3MMAB 5LSOA 1RWVB 2VBWA 1PKUA 4BRHA 3HT3A 2IGIA 1WWHA 3HYFA 2Z2YB 2YKOA 4CO1A 3HOTA 1BDGA 2VGNA 4M5NA 4WTOB 3QWUA 3PR5B 3DI6A 3QAUA 1W2BR 1F2HA 1PJ7A 4I6WA 3QT8A 1AUDA 3AVLA 1AW0A 4MT1A 5KFAA 4QYZJ 3HX9A 1H7XA 1BWEA 2RDDA 3RW7A 3FEYB 4X64F 2O4IA 2XGPA 1JLFB 2PAVA 4H5NA 1I1GA 3CCJS 2Q97A 4A61A 4H8KA 3TANA 3C14A 3G9CA 4AL6A 4DV4F 4ZVQB 2E6MA 3PW2A 3W62A 1WSJA 2CGKA 2YPZA 4AILC 4MO5A 2ZUAA 5J2PA 4FK0A 4HT7A 2V4JA 3BGLA 1IKVA 4F3TA 4USIA 3THXB 4KGXB 4DS4A 2VFUA 4C2MA 4FF1A 2VQEF 1UMJA 2YWEA 1AYEA 1AFIA 2LEPA 3THYA 1M5OC 3GWCA 3W2WB 1TMMA 4ELUA 5KFZA 2N7YA 1T03A 3DXMA 2YNGA 2OTLN 2MHNA 3VALA 3A8KA 4AFFA 1QVFM 3AARA 1IR0A 2VIHA 3ETOA 3I9ZA 4RW9B 4PG7A 4JAXA 3NHGA 5KPRA 3T5KA 1FD2A 1X31C 1XNRK 3KIOA 4KHSA 3K17A 4PPZA 3A4TA 1E6YA 3MM7B 1CJVA 4P2MA 1NBEB 3QGIA 3UDLA 1NDLA 4DTJA 2H51B 3DRYA 3OLBA 3ZETA 1NGAA 4LFAK 5KFBA 3ZZYA 2Z0GA 1IR2A 4O0IA 1W7AA 2L9WA 4F3OA 1CPZA 1GLBG 4TXSA 2MJUA 3PIPL 4O8UA 3NWGA 4FYXB 2W7PA 2W2PP 4AE5A 4AXIA 1OWXA 1LWEA 3EO3A 1RCXB 1L3VA 2XULA 3ID8A 3M8WA 3S01A 2VGMA 5KFNA 3HZ6A 2DGQA 2GAGC 2V8HA 1RTJA 4FW2A 1KNZA 4WQ5C 5ETMA 3EUNA 2IC3B 2LXUA 2WOMB 4CLZA 3G25A 1HHSA 1RWPB 2F1FA 3IGVA 4LBHA 2VQFF 4DL6A 4CEDA 2QMXA 2DRDA 3OHRA 1HARA 1RKIA 3EZWA 4KGVB 1D3WA 1Q53A 4JKFA 1HUXA 2AD9A 1RE1B 3O1BA 2V2ZA 3PDNA 3RRGA 4C6AA 3RB4A 2V7YA 1T0TV 1U1LA 4M95A 2AKWB 2B4PA 4P7TA 4I2QA 3R1XA 2RS2A 4BRLA 2ZM6K 4G6VB 3CMAN 1N32K 3CJ7A 4DPXA 2VICA 4KH4A 5C2GA 4IRKA 5TKWA 2G8VA 4CGJA 3VF0B 1C0FA 3SQ1A 2CPDA 1IG9A 5G0RA 1IBKK 2YY3A 3RAMA 2BEFA 3HHLB 4NL5A 3AVIA 1RXOB 2F40A 2VHGA 4JK7A 1S22A 2JC1A 4FCYA 3H2UB 1KHVA 1QHTA 2YCHA 1YVFA 3K57A 4FWPA 1S1XA 2CQGA 2J7KA 1KVBA 2NRTA 2JDJA 3HL8A 2QL5B 2CVEA 4CEAA 3KLEA 4LT6A 3K7RA 5A8WA 4CHNA 3CMES 4DTSA 4NLPA 4M5LA 3MM5A 1ZA2B 2XLIA 1FKPA 2R7RA 3VQBA 2NS1B 1NZ8A 1LOTB 3G71S 4N76A 1NJWA 3FBCA 3M6XA 1X5SA 2CWXA 2MMYA 2HF4A 1MROB 3KK2B 4DV5J 1RBLA 4OYIA 1RBOB 2CNKB 3Q8VA 5TKYA 1H3DA 3N79A 2QL9B 3MECB 2WBMA 1YJTA 3IAYA 4RW7B 2R7UA 3CIPA 4YOTA 4PG6A 1MMNA 4CJ7A 1D8YA 3LDPA 3OTOJ 4ID1A 4RL1A 2P9EA 4NYPA 2ZDPA 5M2RA 3ALYA 1IBMJ 1A7GE 4TY8A 5KG6A 4JOUA 3A3OB 3D66A 1O1WA 4EYIB 4ECRA 3BQ0A 1DAXA 3M9OB 2LQ5A 1D5AA 2VASA 2HS4A 4MLEA 1QQNA 3UW1A 1HWIA 3ZYYX 4F2SA 2VBYA 4FWRA 1XEZA 3G96A 2R7XA 5T7LB 4YQWA 2UUCJ 2AHOB 4OKEA 3LPEA 1RP5A 5C2CA 3DJCA 1HWLA 3MEKA 4TU7A 4EYHB 1H0HB 2EFVA 4EP5A 2CQPA 4X64J 1OPZA 2G8HA 3EX7B 2HMIA 3HHEA 3PFOA 2CH6A 1G3OA 2QLBB 1GLEG 4WYWA 2B3TB 3M32A 4YOVA 4MYUA 4CD1A 4FPIA 2HRYA 2IDEA 1LFPA 2KXFA 2JEGA 5D0GA 1DY3A 4I9LA 1RU2A 2R7QA 2B4UA 1SH0A 5KT6A 2ZJQQ 1NSPA 4JUZA 2MQ8A 4LF4F 4ITSA 2QYCA 2MZTA 4B3MF 1VSFA 1T95A 3EZUA 3ZSZA 5DGBA 1IBLJ 3NGYA 4ZN1A 4IOCL 3LH2S 3RUBL 4I67A 2XLJA 2B43A 1NO8A 3VGTA 1HMVB 1CS4A 2DKOB 5BYSA 3BGRA 3W5YA 4E3SA 1HHQA 3V9WA 1VR6A 4Q8EA 3DMJB 2PFDA 1UWBB 4U7UK 1TAQA 2VA2A 1RGIA 1U1PA 3P5JA 5CYMB 3CEDA 1X4EA 3ZO7A 3L3UA 4J9UE 3RB0A 2RAQA 2YQ1A 2HW3A 1YWXA 2HMPA 1YG0A 3CCQS 3U9ZA 4CM2A 2OP5A 4K5RA 3C94A 3EMTA 2WONB 3ISZA 1C1AA 2ITMA 2JWLA 3G86A 2XB2D 4JI6F 3NS5A 3KDOA 3WX8A 3NH0A 4KBOA 2UXDF 1WAFA 2BE2B 4O4RA 2CQHA 2C2OB 1ZTWA 1Q9YA 5H9FJ 1XNRJ 2GC8A 1BISA 5KT5A 4B17A 4OI1A 3MMCB 2BKPA 5I3UB 1HBUB 5E3QA 3VQDA 1EKRA 1KD1T 5CCMA 3VZHA 2E5LF 2ZEJA 1Z4UA 1NXIA 1EB0A 3UN5A 1RB0A 5BN9A 4DR3J 4OPJA 2CPHA 3V4IA 4DL3A 1R0AB 4KH1B 1N6QB 3R7NB 2FJEB 2CXEA 1G15A 1B0PA 1ULRA 1TKDA 5DJBA 1MMDA 2VQFJ 2PFFB 2KH9A 3F0NA 5DLGA 3PYGA 3RBXA 1TTHB 3UDCA 3UNYA 1BE4A 1S76D 3AOAA 2GJFA 2P9SA 4CEEA 4DCJB 3ILLA 4BWJA 3SQOP 3JQJA 2LEAA 3PNIA 1FJGK 3D1HA 4KHYA 1NGFA 1K8AO 1Q0NA 4CGGA 1RT4B 4I7FB 4KB1A 1GTHA 1VLOA 2VG6A 4FPAA 4P6QA 3NDKA 3B8HA 3WNEA 1RWNB 1V4TA 4FOEA 4F0KA 1KP6A 1T8EA 1KTVA 1L5UA 2W40A 5DQGA 3TARA 3EKSA 4IO9L 4WFNL 1TP7A 4KC5A 1HX1A 1VQNN 2YQ3A 3RR7A 1NMEB 3TOQA 2Q3PA 3QLHA 2LSNA 4ANEA 3UPFA 3FUYA 8RUCA 3L8BA 3CCMS 1IBKJ 1FDDA 5EGYA 3TTDA 4ZCMA 3A8JA 4C11A 1GT8A 4TVAB 5KQDA 5D3GA 3WIVA 1KRPA 3HLUA 2AJ4A 3R3LA 4G1QB 4URGA 2YQ0A 4IRCA 1WAJA 1HYVA 1HR0F 4QWBA 3FBBA 3MCSA 3IS9B 2DPIA 3GFZA 4A8SA 4KKOB 3QEIA 2HBRB 3QIPA 2OTJS 2QLFB 3E01B 1G1XA 2JLGA 1KWMA 4ZLJA 1FX2A 1FDAA 2DGSA 3PRDA 2R2TA 4QBUA 3GV7B 4AM7A 1Z05A 4CK1A 1U2RA 2H4YB 2RQCA 5C10A 2WCXA 3V2UC 2ILYA 2DIUA 3OFHA 4FWOA 4JI2K 1E4GT 4XO0A 9RUBA 1V5VA 4RLEA 5F9LA 4JV0A 2O8BB 1BWFO 4LC9B 3BR9A 1ATNA 5KFTA 3B82A 3CXCM 4X4PA 1XMBA 3I0RA 2VFSA 3THWA 3TSUA 1UJ5A 3K2YA 2GELA 4DV2F 4FP9A 2CYYA 4IQXA 3ZT2A 4I68A 4Y0WA 4KR0B 3VR1A 1T6CA 2PEHA 4CWBA 2QW9A 4E7JA 3GYXB 1N5YB 1NM1A 3O3HA 4M63A 2ZH2A 3R5JB 4OL8A 3NH1A 4CLPA 4H0TB 1HYSA 4CH1A 4U7CA 5DS7A 2FLNA 3KWIA 2YH1A 3M30A 2NUBA 5KFVA 3UD3P 2R7YA 3PX0A 3BV8A 4N56A 2ETJA 3VQ5A 4B3MJ 5HAOA 2EFGA 2XZDB 4K5SA 4GO7X 4DL7A 2DD8S 4EO6A 2E2OA 4NLUA 2OPSA 3IR5B 5CA5A 4WK1A 2XZTB 2B5JA 3MR7A 1WELA 3CCVN 1GXLA 3PUFA 1NOYA 2FZGB 5F41A 3IM8A 1T9XA 4FOIA 3SI6A 1RT5B 4KHRA 1SBRA 2Q66A 4LF7K 4LRFA 2HSEB 3A2FA 5FPEA 4USTA 1UJ4A 3U1MA 1TYQA 2DNQA 1EKEA 4ILRA 3K8WA 3LANA 4PYAA 1QDUB 4QPXA 3J7ZT 3OYAA 1SXLA 4ED8A 2QN6B 2V51B 2MQQA 2ALYB 2OELA 1CJTA 2C2RA 3P96A 4OI4A 5BR8K 1S7IA 5AT1B 2HRTA 2IVMA 5KFYA 3A5NC 4KHUA 3O2IA 5GMDA 4NLVA 1ZA1B 3C15B 2KT3A 3EL2A 2CWKA 3MAAB 3KTQA 2Y1LB 2DPJA 4E7LA 3GL1A 1VRTA 4R8UA 3QERA 3R1LA 3LPTA 3KLVA 3OR1B 2FBXA 4DI6A 5AZIA 4OYMA 2H9ZA 3DXKB 3OV7A 2NRZA 2P9KA 2EBEA 1FI4A 3TSPA 5KFRA 3WXMB 1GLDG 4IQMA 4Z4HA 4A62A 1W26A 3J7Z5 1U04A 1LWFA 1XQSC 2B9WA 3FC9A 3JSMB 4KHWA 3GIIA 1SIZA 3ISNC 3NAIA 3SPZA 1S9EA 1EP4B 4IG3A 2X7IA 4OVLA 4RG8A 4O5BA 1YZ7A 3PHEA 1SKUB 2IA0A 5CAAA 1REVB 1LAVA 3QZ7A 3MD3A 1BIZA 1YRXA 4CF2A 3ATUA 2QFJA 3AAPA 1FKAF 5E2QA 5IOLA 5AZJB 4FZXC 1U26A 2YKNB 5AQWA 3ASMA 5IM0A 1PAEX 2HSTA 4R79A 4M3UA 2X3DA 2NRWA 3DOLB 4R0JA 2M4MA 4AHVA 4RR5A 3IP0A 2RF2B 2HBLA 4ECUA 4OFZA 3NCPA 2W8LA 2C3OA 4IFVB 1QUVA 3MEDB 3J7YP 1KVKA 4DR4K 1EETB 4GVEA 4UOHA 3G4SS 5JLHA 1B9FA 2DRBA 2HBKA 2E4LA 5KFGA 1WORA 3QETA 1UKUA 4FJ9A 4KGZB 4QJVA 4EZ9A 3OTCA 2U2FA 3NG8A 4JKEA 2K7JA 3EKUA 3OYNA 4JYAF 2XCAA 3M8QA 1IM6A 3VQSA 4DV6F 3CJ3A 4Y34A 3V6DA 3U02A 1SJQA 1SS6A 5C25A 4DR6K 3G2XA 3IG1A 2J6SA 3FZMA 2W4CA 3DHWC 4DR7F 1U02A 3OUYA 2ASYA 2MEWA 2F4VK 3VQTA 1PG5B 2RRBA 3CPWR 2IVPA 3NCQA 2M70A 5JS1A 4CZGA 4YDUC 1RHQB 3CUNA 3T1AA 2FJWA 2AYGA 3EY1A 4J37A 3DXSX 2R3VA 4ID5B 4PWDB 1N5SA 5F3TA 3Q8RB 2DNMA 3HVTA 3CCSN 2XMTA 1ZAWA 1TUGB 3N4WA 3OYGA 1EO1A 4JI2J 4YB1P 2VDIA 4A2BA 1FKOB 1WC0A 1NK7A 1RISA 1DTTB 1BWVA 4M1KA 3SZ2A 1C1CA 4BR7A 2NYIA 3UB5A 2Z56B 1IN0A 5I42A 4CK2A 4JI3K 4KYZA 4KHQA 2V9WA 4W5NA 3Q8YA 1RYSA 1LK7A 1R8AA 4F3QA 5AFUA 2FF3B 2IJRA 1CLQA 2P5OA 4QIWD 2O8CA 1I3AA 5C2FA 5AQSA 2QXFA 1NJXA 4M42A 3O08A 2PSZA 4N77A 5LJ3Y 1KONA 3QINA 3J8AA 1C4CA 3GJSB 3D68A 5FLXY 5D8HB 5BYRA 2ZE2A 5B0DA 2CPYA 2ZFHA 5I9EB 2B6AB 2F8TA 4MK8A 1VQKN 4DV3F 3SFGA 2XYPB 4CE9A 4K41A 1X5PA 3B78A 3G6YA 4EMDA 1FF2A 4CI0B 4Y6IA 4D3HA 1N88A 5HQMA 1RBAA 4N5SA 5A8KA 2W9BA 1UVKA 3WDOA 4FWMA 3T6JA 1TZ0A 5HK4A 4V19J 2H3EB 4LVNP 2P6TA 3T3FA 3NAHA 3A8EA 3Q2SC 2PD1A 3QT7A 4LF7J 2WTFA 3TX8A 3BZQA 1E6VA 1YTAA 3C7NB 4MH8A 1CZ9A 1V9OA 5HMWA 2GIQA 4DR5K 4CBWA 3SSQA 4NCAA 1YIJS 1BLUA 3LW5C 1WOPA 3EXCX 3R5BA 4H4OB 3AVMA 3CO0P 4M5IA 3AH6A 1P1LA 4ZIWA 1CVJA 4DN0A 1HNVA 5AQQA 2DK2A 5CQGA 2KKZA 3K5MA 5KFJA 1KSPA 4LY7A 2H5IB 4FKYA 3QESA 4ZPBA 2V8PA 1IWGA 3J80O 1NGGA 3KKRA 3QQCD 3ENWA 2MTLA 2XSFA 2AU0A 5KFHA 5F1XA 2RUSA 1S4EA 1VRUA 1A0OB 1H72C 3HPGA 1RHUB 2FVPA 1HPZB 4NLSA 2Q36A 1VQ5N 5IC6B 4X84A 2ZH9A 4RW8A 4JRPA 2FSJA 3X1LB 3CG7A 2YWKA 3MR5A 1ASUA 3KG4A 1ACMB 4HACB 4WFBL 4Z4EA 2IYGA 1IUJA 4Z0UA 3QB0A 3UIQA 1SUQB 4MJKA 5A2QO 3H5UA 4F4ZA 2ZOFA 1HW9A 3IMQJ 4X66K 2NZ4A 2D9OA 3W64A 4RW6B 4B1WB 2ROGA 1Y97A 3QRPA 5CZXA 4GV6A 2RKIA 1HBMB 3VF2A 5IWAF 1B0TA 2GHPA 3AO2A 4Y0FA 4FVMA 3D6MB 3H08A 5M1OA 2VG7A 2P9LA 4F3MA 4FNIA 2V52B 5KOWA 4ECYA 3MHYA 4DXLA 3SXLA 3A5OC 3MPWA 3V9SA 4NI2A 1UOCA 3LP2B 1GOCA 2DFHA 3ZZUA 3W5XA 3CMEN 2K2PA 4M7XA 1KDNA 1S3XA 2VPXB 2QMWA 3G6ES 1T02A 3NS6A 3D2EB 2AJ1A 2CJYB 4NCGB 1IKWA 5KFXA 4ZKAA 1D09B 2EK1A 3PIPQ 4JKGB 1X9WA 3FEXB 3E51A 1OIAA 3J7YU 4IKFA 2BDPA 1JL1A 3V9ZA 1SJ3P 1F5CA 2GVDA 3RSEB 2ZF5O 3C66A 3W1YC 4AHTA 5THWA 2ZH3A 1JLBA 4CERA 4HWIA 1QZ5A 2HURA 1XTZA 5JVHL 2AYEA 3BJYA 4NB4A 2HNYB 4HKQA 1IQZA 2Y0BB 3JTPA 3BO4A 2W8KA 1H74A 1XC9A 1FFSB 3DOKB 4PXCA 2KXNB 4ISEA 1XR6A 4N8NA 4KO0B 5KFLA 5AQXA 4FPBA 4WU3A 2HHHF 3O6QA 4HUEA 4YORA 4NYZA 3MTJA 3NAEA 3RMCA 2AYMA 1FNMA 1FT8A 5KG2A 1EQMA 1ZBSA 1V6HA 4OZ1A 2X74A 2UUAK 4NASA 3U8XA 2D69A 2X1FA 5E3AA 2LFVA 3SAGA 4QQBA 2MYFA 2FLLA 1NK9A 3OL8A 3S6EA 1KOOA 2CKWA 2V8VA 3CO9A 3AD7C 5L1LA 3UDVA 5EU7A 5J1EA 4JI3J 4UTGA 3H45C 3RAXA 4JV5F 2KTQA 4DPUA 1NLKL 1LCUA 4B1YB 4LBPA 5A0YA 2D3O1 5HRNA 1N48A 4ZCLA 3VQ7A 3L2RA 1YX2A 3DXBA 2MKCA 3K5OA 3WXJA 1JMTA 3EE3A 3JYTA 5LJWA 1S1UA 5K9FA 5BJRA 2ITGA 1KD1O 3BF1A 2JLEA 2RILA 3CJBA 3D0IE 1FK9A 2UUBK 4FWNA 2IJFA 3PR4A 1FW6A 4JP8A 1R89A 3Q23A 4A8OA 4PWWA 4KY3A 1NJIT 3D7SB 4D3GA 3FZBA 1HD0A 3GU0A 2K1RB 3DI6B 4CHOA 4L3KA 1WI8A 2A1RA 2WUSA 4RU2A 3AA9A 1JNRB 3D3CJ 3CCUS 4F4XA 3GYNA 1Q8IA 3HFKA 3PO4A 4M7YA 3JS9A 4UF4A 3QEPA 3ENHA 4ZVRB 1M1KO 3M6UA 1GMWD 3BSAA 2HFVA 3N6NA 2OSRA 3HHDA 2VCPA 1CQNA 3AFGA 4FSVA 3PEHA 2ZKUA 2P5VA 3NL0A 1CULA 1UTAA 4KRFA 4IO8A 3NCIA 3PACA 2MQNA 3C14B 4ILJA 4Y28C 1K9MT 1S77D 2EKYA 5KFKA 3VTHA 3GSDA 4TLQA 4ED2A 4XDDA 3DN9A 2B9YA 3KHLA 1HNXJ 3E9PA 2WW4A 4FWLA 4A8YA 3V81A 4PA1A 1IKVB 2C3UA 2HRUA 3NGKA 2DFFA 1YVUA 4LSNA 4QR2A 1R0BG 4K4ZA 1N34K 1CG2A 3QFPA 4RUBA 3THYB 3CIZA 2E5HA 3IR7B 5HP1A 4A4JA 1D9DA 3RB6A 1T03B 2YNGB 4CFBA 1RBTA 1KOHA 2EC0A 1Q7LB 1TVRB 1HFEL 1F6TA 4I69A 1OVYA 4CTAA 1T3OA 3M2UA 4IXCA 2EFQA 2Q3SA 3AJ1A 2ZGZA 1X60A 4NLCA 2KO1A 4E0DA 2FGOA 4ILHA 1SL1A 4IOCQ 3FNNA 3NMAA 4HCCA 3QEWA 5CYQA 3ZZZA 1Y5LB 4K4XA 2DYAA 4EBCA 1IM4A 1E6YB 4JV1A 4DSFA 2I5JA 1D1UA 2BKOA 4JI1K 2HZCA 4W5RA 1N36K 4F9OA 1TFYA 2AEFA 4FS1A 4HUFA 3K58A 4CZKA 4GC7A 2ASPA 4OHWA 4NXMF 4EAHD 3NY0A 5FDLB 4IWVA 4X66J 2EW9A 4J2EA 4IG0A 3HP9A 2VG5B 3FSXA 5ETTA 4OZ0A 2VWBA 5IT9Y 3W9JA 2XMWA 3CJ0A 5D6GA 5LSRA 4LIRA 2FVQA 2JC0A 3FQLA 4C3LA 1UJ6A 2Q1LA 1R8HA 2VOOA 1ASWA 2XZWA 3G8QA 1WC5A 3AVNA 1L3UA 1TKTA 1RFQA 2H1YA 3KLGA 1NPRA 1ZBLA 4UUXA 5HQ8A 4X65F 3MM9B 2AYBA 4V19X 2KW4A 4RWWA 4A5BA 4FBTA 2FHJA 4NOHA 3AVFA 5T41A 5HOOA 4P7VA 4I2QB 7FD1A 2CZ4A 3NOCA 4WK3A 1KAZA 1K73O 2AWZA 4ECSA 4GVMA 2ZUGA 3H5XA 1JX4A 2VYPA 1BD6A 2EK6A 2YH0A 3M8YA 1VQOS 2H5JB 5G0RB 1J2VA 1OJ4A 3J81O 3QFWA 1NUEA 2HYIB 3PM9A 5F3ZA 2GIFA 1QAIA 2ADCA 2RB7A 1Y11A 3UFCX 2CGJA 3R1HA 1RT2A 4HR2A 3PJ9A 3CI5A 3CW2C 3KDNA 1B4SA 4MK9A 2R8IA 3DYAB 5A8WB 3O6WA 4CJTA 1M5SA 2J6UA 2V5HG 4HHTA 3HD2A 3V5RA 4IO9Q 4WFNQ 5H1SQ 1GLAG 1JCFA 4U96A 1I5OB 4J2AA 4FVCA 4PL8A 3M6GA 4AYBD 4NZ6A 4CQ1A 4KHMA 2CQ2A 5HLFA 4CDIA 3PYEA 1VFJA 4JV5J 3VV2B 3OFFA 2QWLA 3PJWA 3MD1A 3Q2TC 3BUZB 2FGCA 2P9CA 5HRRA 3ILOA 4I9QA 2HWHA 4LFBJ 2XHBA 1MA9B 4TY8B 4DV1F 4JI5K 2GMJA 4F26A 1S6QA 5L8RC 4USWA 3PW4A 3LP1A 3DLGA 1HQEA 2F96A 2COLA 3FRZA 5G4DA 3AY0A 2MSTA 1ZBUA 1F5AA 1JCGA 1RBVA 3TNVA 4ECQA 4C3KA 1WSFA 4DEZA 1N4LA 3SV4A 1TMJA 2I7NA 1Q16B 3IBPA 2CQIA 2E2QA 1XWLA 2IM2A 3R7SB 1FCAA 1VMBA 3GIJA 3GCWP 2XYHB 3U1LA 3THPA 1B92A 4HDHA 3M32B 2DHGA 3EVMA 4CJ4A 4FLUA 5HL7L 4IKAA 3CC4N 2BKNA 3HI0A 1KFDA 3OFGA 2EPIA 3TYTA 1XNQK 3TZWA 1DRZA 3OYIA 3AOBA 4DFPA 2ATCB 3OY9A 2NREA 4FYDA 4BC2A 3IFEA 5DDOC 5D77A 3R27A 4CP5A 2DH7A 1GLFO 2F7TA 5KPTA 2IYIA 3H0PA 1UVMA 4OHXA 4USKA 3KLHB 2AJFE 4UZCA 1FTCA 3EDQB 3MOJB 1CS4B 3BGRB 4X4OA 5DM7L 5GAHP 3GB0A 5AJ3K 2CRLA 2DXEA 1TL3B 4IDKB 2EC2A 5AXLA 3VEYA 5M2PA 3LQVA 3W8PA 1SV5A 1K8KA 1RAEB 3IAM9 2BW7A 5KG3A 4JN4A 1MWQA 2FZKB 4IOAL 3SCJE 2QWOA 1RT3B 1GMUA 4YOXA 4B3RF 4CZJA 2OA8A 1VBKA 1HBNA 1DEJA 2CJBA 3QSYB 3MX5A 4NXMJ 4TQSA 3TEGA 2RHKA 1MU2A 5T7BA 2A2DA 5AE3A 3QNNA 2JNJA 4DR1F 3OA9A 3HVWA 5KT3A 5CXTA 2HQIA 3I0SB 1AXQA 4L8RB 3H1VX 2OEKA 1VSEA 2LDYA 1RNHA 3MPDA 3LWLA 5CH7B 2YJFA 5IFMA 1JLQB 1DURA 1GFWB 2HFZA 1IQTA 1NK0A 3U9DA 1JJ2R 3MEGA 4HI1A 2MZ1A 3VENA 1YJWN 4E1NA 4IJNA 4JBCA 3L09A 4MKYA 4FM0A 2YX1A 4BCAA 1VQ6S 3N9UC 3ENQA 3OYEA 4QCLA 2I1RA 4OZLA 5KG1A 2QSWA 1UPPA 3KD1E 2B9XA 2VF3A 2P9SB 3AB2B 1FEHA 2OPPA 3P45B 2CDQA 3E9LA 1HHTP 2V69A 2GTDA 1HJOA 4OZ5A 2HFOA 4ZTJA 2MQLA 2KFZA 1JJ4A 1HI8A 3QPIA 3RWUA 1O13A 5M1NA 3HHNB 1AA1B 4Y65A 2UVWA 2YHAA 1HNZK 2NLWA 4BRFA 3CD7A 2DCUB 3TUPA 2FHMA 2K3IA 2AA4A 1IBCB 4NYNA 3GSIA 1OYDA 1HA1A 3QLHB 2DRAA 3KYLA 5MAOA 3SQGA 2NYHA 1ZETA 1Q8BA 2KN4A 2YNIA 1BQMA 4C11B 3AVCA 5D3GB 1RYRA 1KAXA 1RAIB 2BVZA 1S0MA 1U4BA 4X62F 3DDKA 2MLYA 3T5LA 2KG1A 4DR2K 2W9CA 3U27A 3QIPB 1DT9A 4BLGA 1WDTA 4KB0A 2N7CA 4N41A 1S9GA 4CK3A 3GG1A 4XIUA 3WQUA 1SAZA 5EOYA 1T9VA 1HWKA 5E3RA 4ECXA 2UU9F 3ET6A 2AJ2A 4DV1J 5IZHA 3T1YF 2BGGA 1T94A 5AE2A 3CCTA 4OLOA 2OTLS 5FJ4A 5JS2A 4PZVA 4M3RA 2ZVIA 1SB6A 3NF8A 3ETMA 4B9SA 1UEKA 3NNHA 4CZFA 4M3TA 1EAYC 1WSGA 1Q82O 4DV7K 3I0RB 3TA0A 3THWB 4NEYA 4JI7K 5K8OA 3PEJA 4JI5J 1ZBTA 1S97A 2IDOA 2F8MA 2QA4G 1Q4RA 1R6YA 3R6MA 4B8AB 4I64A 3MURP 3UE5A 3GFHA 3VMFB 3TAMA 1QY7A 5CD4A 2GAHC 3HDSA 4UOGA 2IVYA 2BZ2A 4C0BA 3LWMA 1HYSB 3QEVA 1NM2A 2HFNA 2OAUA 3M30B 1NKEA 3CSKA 2CQDA 1RTHA 1C2PA 4FZZA 3GQCA 2MQOA 2OPSB 4FLYA 1XNQJ 3FCHA 3D0PA 3UO0A 5LMUF 4KAIA 1UVLA 2HHWA 1RTDA 3QZ8A 4C0HA 3AVHA 3QBXA 3HHLD 2DY4A 1S72N 2D3UA 3KNGA 5HVGA 4GW6A 3DLKB 3OYMA 3GFYA 3VQAA 4B1XB 2O4GA 4H0XB 2GHVC 4OJHA 4F50A 2J0SD 3CMAS 4Y3CA 5AE1A 1TYQB 1C0UA 3QT5A 4X4TA 5F8JA 1TFWA 3WNHA 3SCKE 1FRXA 3K5PA 5J2QA 1WTFA 3EGZA 2XTJP 1CZBA 3T7ZA 2BQRA 5HMZA 1H1VA 2O66A 1D8ZA 1Q86T 3SUOA 4ZPVR 2KJWA 5BR9A 3DRPA 4U6PA 4WU2A 2KVQE 3DM2A 4OZJA 3SQ2A 5HROA 3L6QA 2WVFA 4DR1J 3G0ZA 3Q8PB 1AROP 4EWTA 3A8YA 4M63C 4X4NA 1X9JA 4NMXA 5A8RB 1WUAA 2XHWA 2PA3A 5DDPC 2G8FA 3N5FA 1VRTB 4R8UB 5KT2A 2AGPA 2FY8A 5AQVA 3EZ5A 3L2WA 3HFVA 1D4XA 3GBTA 1OH7A 3BY5A 1M5PC 2E1RA 1OSDA 3CD0A 1HWUA 5EN1A 4CF0A 3S9HA 1QSSA 1RLCL 5F9NA 2P9KB 1VQ4N 2MB0B 4K0KF 2I9SA 3CJ4A 1WC3A 3C6AA 3KHHA 4CHZA 2O8EB 2JVOA 2ZH8A 3G6EN 3BKUA 4I1TA 2LP4A 2CA9A 4QYRA 3KK7A 2FHOB 1SKRA 3PXGa 2AIRB 1FRMA 1LWFB 3S8SA 4LF6K 4BR9A 3LGMA 3HM8A 3WXLA 4K4TA 1S9EB 4ZVUB 4IG3B 2QLJB 2UZAA 4DUZK 3MPYA 2NQPA 3E3XA 2AZ1A 4ZVTB 4WXOA 2BM0A 4PXEA 5FLXU 1A5XA 5ADXA 4NYOA 4EBDA 1WHWA 1WUUA 4QW8A 1WEYA 4L3NA 2HQGA 1S5JA 4IYQA 2GWKA 2E7XA 3FBFA 4ILLA 2CPJA 1RGVA 2H65B 4YHHK 1AUSL 2OYQA 4ZJQA 1VSKA 5AQHA 4WFBQ 4DDFA 2QRRA 3CB4A 3CCLN 2FYXA 3QYYA 4LF9K 4X4RA 3CQXA 3NS7B 3D6FB 3O3FA 3LOUA 2O8DA 4MDBA 1YJVA 2R2SA 2QYGA 1U8WA 1OH5A 3GLJA 4GMKA 2A2CA 1NJIO 1B64A 3CC7N 2C3MA 3C6HA 1Y5NB 4W90B 3OJSA 3T5HA 2XRIA 4DWIA 4DQ8A 2HG4A 1UZHA 1LFWA 4RJVA 5MLCQ 1Y5IB 4ENOA 4YOYA 3M2RA 3R9PA 2R7VA 1G2EA 3M8QB 3V6DB 2F8EX 4E1JA 1NNDA 5C25B 3IG1B 4B9LA 1FXRA 1GLLO 4E1MA 1GLJO 1VQ8N 3ZSRA 3T1YJ 2G4BA 3OUYB 3RMAA 2GVZA 3OHBA 1GX6A 4DR2J 2OPRA 3K0SA 1K9MO 2V8DA 4CLWA 4K7QA 3QNOA 3CETA 5E5NA 3DNCA 3WXKA 4ZVPB 3FCWA 3AJDA 5L9XA 2A6OA 1PYTA 3IN5A 3L7UA 4DB3A 4QWCA 4CO3A 5AQRA 2QX0A 2GUIA 1YBUA 4RO0A 1ZM3A 2VONA 3HVTB 1X4AA 4WKYA 2DO4A 5H1SV 2D1CA 2FVSA 4PHTX 2EFOA 1OH6A 1SH3A 2EFPA 4ECWA 4IR1A 4DV7J 2C1EB 1F1BB 4L76A 3NE6A 2IRXA 2EVZA 1C1CB 5JVHQ 5L46A 1QE1A 3RBEA 4O3RA 4OYOA 2H3GX 3OBIA 3D4JA 3KG0A 2GZOA 5ETPA 1SQFA 1K0VA 4JNEA 1HQUB 2OIHA 2FB0A 3D28A 2ASOA 1SQKA 3DGPA 2AP6A 2JL9A 1NGIA 4H4MB 2R2RA 2UVVA 4LFCK 5T14A 4Y2MA 1VISA 3UI3A 2DITA 4ZA1A 2Y8WA 2VPYB 3O9QA 5BYQA 2GUPA 2HWIA 3P3DA 3KJVA 2HK3A 2YWWA 3BGFA 3U1NA 3I33A 2CQ1A 4CJ5A 4MK7A 1X4DA 1HPMA 2MZRA 5DQIA 4BRQA 4KREA 1WD6A 3NBPA 5A8KB 2W9BB 1YI2N 1ZPVA 2OMOA 3M8PA 3TR8A 1HW8A 1FRHA 3MPUB 1RCHA 4M45A 2HHPA 2BJ9A 1RHRB 4DQPA 2IMWP 1KVIA 4DX7A 1E6VB 2LQBA 2FY1A 4GVLA 4ED4A 1VQNS 3UCZP 2AT1B 2YHXA 4NLTA 4Q2LA 1UW4A 2FTRA 2KM8C 2UUAF 4RNMA 1N33F 3J7AP 3K5NA 3E66A 2QC3A 4YFUA 3ZZOA 4DV0F 1WKJA 1LW0B 2V2VA 1F2GA 1HNVB 4LMZA 1CLFA 4BC5A 1U0HB 1N8RT 1S1VA 3ULDA 1KEKA 5H9EK 2CIMA 4H5WA 2Z2MA 5KPZA 1APSA 1K44A 4UY8O 4LF5F 4UOFA 1NBWA 4U67L 4K0KJ 4YY3J 2HF3A 2YX6A 4EP4A 5L9NA 4MMOA 3W0LA 1U0SA 3MN9A 5E0OA 4KI6A 4QOTA 4B3SF 1NHUA 3NRBA 2F8SA 5EVZA 3MOZA 5C24A 2CG8A 3CFRA 1Y4ZB 4FJNA 2D41A 4DF4A 3HCXA 3DKDA 2ZH7A 3CIMA 2DCLA 2XS2A 2QA2A 2DR9A 2XQCA 4QYZK 4MQ3A 2DIVA 5F8HA 2IMOA 4K4YA 3VQPA 4DUZJ 4PYDA 2EI5A 4FO0A 4R25A 1U1RA 1NK4A 3WNGA 1X5TA 4K42A 1U6BA 3G10A 2MHEA 1RWUA 4MKVA 2X1BA 2B4VA 2F7VA 3M8RA 2F9JA 4USMA 3GR1A 1ROFA 4H5RA 3W2VA 3OVBA 4GKKF 2P9LB 3C2PA 1BIUA 2QFIA 2ZWOA 3JSRA 3OJUA 1NPKA 1YJ7A 5FPDA 4YHHJ 4NI2B 3ENOA 2L08A 2BW2A 3ISND 3HVAA 2DHXA 2J6TA 5KG4A 2HPUA 2NPIA 3SYZA 3Q89A 2KKHA 3MUVP 2JVRA 4PAAA 4B3TF 3F44A 2RE2A 4QIGA 2V6AA 4XTTA 1N34F 3AA3A 2OEJA 3MCPA 1YLXA 2GJIA 3IO1A 3V9UA 3L7OA 3QNWB 3ULEA 4NZ0A 4DQIA 2OFHX 1FWKA 3CCVS 4XH5A 2KT5A 2EFNA 5K14A 4FBUA 4F4YA 1VAZA 3G6XA 3T19A 1QS4A 3DLHA 2E1ZA 3K5LA 4XK8C 3FSYA 3DGVA 1XMQF 1J5EF 3NMUA 1ZAVA 3FMWA 1AB8A 1KFSA 1WACA 3CFPA 2YXLA 1NGHA 2Z1GA 3I9V9 4OMFG 1TKXA 3ULHA 1L3KA 3TTCA 3LDQA 2GFFA 2SXLA 3OBWA 1KTQA 1VIOA 1WKKA 4C8KA 4YEAA 1FDBA 1I51B 1Z6RA 2G2ZA 2QWPA 1X4FA 1F5BA 3GCXP 4WPAA 5EX5A 1FVQA 1WDDA 4DJBA 2YKAA 4ZHRB 5SWMA 2UXCF 2B7CB 4KJIA 2Y3YA 3LZJA 1VDHA 2E7WA 3THXA 1M90T 2X1GA 3IC1A 4OPAA 1VRQC 1HQ2A 3EXYA 5IT9U 2XMKA 4DS5A 1I94F 1UPMB 3BDEA 5A0YB 1FEEA 2GQ2A 3T69A 3VTIA 2V34A 2ZWPA 4BROA 3CNQP 3R5AA 3JYTB 4Z94A 3F2KA 1GTEA 2QM1A 4WIQA 1MLAA 4RW9A 2NCKL 1FK9B 4G9ZA 4RWXA 5B0BA 4MKAA 1U09A 3KHRA 1CJKA 4KI4A 3PVXA 2KYZA 3MM7A 4GMJB 2ILZA 4J8FA 4OX7A 2MXYA 3O1LA 2UV8A 4DN9A 1NGCA 3VEOA 3OYFA 5BPNA 4PXDA 4FJXA 4ILGB 1WHXA 5DETA 2DR7A 2HNZA 1N5TA 3FZLA 4OLBA 4CLTA 2CNOB 3CE8A 1T9WA 1VJQA 3ZSOA 1RA6A 2N4DA 2ERRA 3VAHA 4C9DA 3DRRB 1ZOTA 2B7BB 3P5TL 3CCRS 3AXKA 1D9FA 2ZH6A 3E1YA 2GX9A 5KFOA 2G2YA 3DLLL 3Q22A 3WQTA 4KHPK 2IC3A 2WOMA 4ISFA 4PY5A 2O8FA 3POTA 1F9FA 1TV6A 2M8HA 3SNNA 4DV5K 4BDZA 4USVA 3TEHB 1JXLA 1CSJA 1WSRA 4PEOA 5HL7Q 4LSNB 3WXIA 4CBUA 4FJ5A 3LA0A 4DFJA 3VN5A 4FK2A 4J9SA 3MTKA 3LP0A 1YQHA 3FRYA 2OFGX 2WC9A 2VOPA 3OTOK 3QAEA 2D0AA 5HP1B 4B3SJ 3H90A 5H9EJ 1U1QA 4WFAL 2BRLA 1QAJA 5GAEU 2HVZA 1WEXA 4CLFA 3M3ZA 4C8YA 1WI6A 4CTAB 4BR2A 3ID6A 4BRMA 4KTQA 1V5IB 3MMJA 2HS0A 4EU0A 3HHLA 5GAEI 3NGRA 4DTNA 1DQAA 5DMRA 3HVRA 4DLEA 3H3NO 4XEIA 2E44A 2BRKA 1PYOB 2I5JB 3BREA 5DM7Q 3SQ4A 4X64K 2Z1IA 3CCSS 4YOEA 3MEEB 4URSA 5AQJA 1T9UA 1LXJA 2ZNZA 2Q31A 4QR0A 3WUHA 4IG0B 2IIHA 2RHSB 4BC3A 1VQ9N 3ITHA 3B8AX 3HI9A 4DU8A 4FLVA 4IOAQ 2HIQA 3FKBA 4DV4K 2FDNA 3OLAA 3TUZC 1D0EA 4DTXA 4LR9A 3T1HF 3NMRA 3R97A 2P2CB 1CC8A 3KK2A 3O3LA 1EXQA 5B7WA 1YJNN 3OYJA 1IBLK 1Z2LA 3IUCA 1TKTB 1NSKL 4B3TJ 4EEYA 2VQEK 1O51A 1RT7B 4F04B 3MECA 3AOCA 3BPDA 3KLGB 4CHYA 2RS8A 5DG7A 2P9UB 3VEXA 1VSDA 3CDBA 2D9PA 2HHTA 4WZQA 3OD2A 3ZEUB 2YHBA 5IXUA 4RX6A 1K6YA 1RILA 3ZT4A 3J80Y 3BBCA 2K06A 1VQKS 2DB1A 2DBBA 2BACA 4IEIA 2D0PA 3H42A 4FLXA 3U3YA 2QSFA 5I3QA 5T7LA 5LJ5Y 3BYRA 4J90A 5D4LA 4CJ3A 1XMQJ 2NXCA 1AZSA 3GPAA 4MIBA 3VQQA 2YWHA 3CYMA 3WT0A 4HH0A 3PW7A 3LTOA 1WHVA 3AODA 4ZLLA 5GADP 5E7OB 1VIXA 5E33A 2CQCA 1Q81T 3NF6A 2DNHA 4JI8F 4DUYF 3QJPA 5H9FK 1RT2B 3W65A 4DTUA 5A2QY 4AD6A 2PO4A 5CZ1A 5GMKa 2HGMA 3IFRA 1BQNB 3OS1A 1XJWB 3DU5A 4OIXA 3V6HA 2ZD1B 3H5YA 5MLCV 3VA3A 3KK3A 4OYWA 2DHHA 4CIFA 2UXCJ 4I56A 4DR3K 2PY5A 2KZZA 2CPXA 3M1VA 4H5TA 1F21A 5DQHA 5D4NA 2N3LA 4HTIA 3O9TA 1HNIA 3CJRA 4YR3A 1YTYA 3ZCMA 2A0FB 4PL7A 3CJ9A 3FZFA 4CBXA 1XUPO 2VQFK 1LV5A 1CJUB 5C42A 3QJLA 4K2XA 1I6JA 3ZNJ1 2XY5A 2QGFB 1SC1B 1FFWB 4BRGA 1RADB 3FLCO 2RDIA 2FC8A 1UWBA 1VQ5S 2AF6A 4E2FB 4BRNA 3GP9A 4RU9A 2W7AA 3W5ZA 2CZVC 1S6QB 1PC5A 2RUGA 5JXSA 1FJEB 3LP1B 2C22A 1PJ5A 3DLGB 3EGVA 2ASLA 4NLXA 4Y2KA 2CNNB 3F9MA 3U6FA 1R0CB 2WONA 3NGIA 1QVFR 1JKHB 1HNWF 2EWHA 2IVFB 1X7VA 2WZ1A 1RDCA 4CEBA 2BJ1A 5F0XA 3P4UB 2GW8A 2I6WA 4CHQA 1XR7A 4OYAA 4KH6A 4P2FA 4Y1CA 5DZ6A 5I3UA 2V2KA 2CVIA 1BXNA 3ZX0A 3T5JA 1JLAA 4DL2A 1CXUA 5JJBA 4YDDB 1JL2A 2VD3A 3VF4A 1OY8A 2V7ZA 4WFXA 3GILA 3V6KA 4WCEL 4JI0F 4AM6A 6FDRA 3H25A 1FXLA 2VZ9A 3MAQA 2NXJA 3DFEA 3SMPA 4FWSA 3MZIA 2PBDA 3PFEA 4FDFA 3FFKB 4FM2A 4CI6A 1Y3JA 2FJBB 4KHPJ 3VEWA 4Z37A 3Q86A 3ZC4A 3JTOA 5A6WA 4M3XA 3V1RA 4UUWA 3W3DA 1K8KB 2XI3A 1UVNA 2N4CA 1BCOA 2E9TA 3M8SA 5B0FA 4JI7F 3D0GE 5IS2A 3W9IA 1Y9OA 1KAYA 4CJKA 2VBZA 1VQYA 3P83D 3GJRB 1HBNB 2DGOA 2WAQD 2CJKA 3IBFB 4GKJF 1BMQB 1HD1A 2EXUA 3SUQA 3WC0A 3MWBA 3W7BA 5GAGU 1TUYA 3WX4A 2HVHA 3ZZRA 1WG1A 3GMGA 4OI2A 2OPQA 3AY9A 2AQ4A 4KTZA 4MFBB 4WBFA 1X4CA 4OKJA 1U7LA 4J9RA 1LOUA 3FMBA 2RVJA 5GAGI 4CZIA 2HHQA 4WQ4A 5B8HA 3T1HJ 3IS9A 3I5CA 4LF4K 3VGKA 2IBOA 3MCMA 2ZHOA 1P1TA 4B3MK 1ZM9A 2XO7A 4TN2A 4LH5A 1AFJA 5KG5A 3AD9C 1ZPWX 2CADA 4DV4J 4E19A 4JKHA 4PQUA 2ZH5A 4FM1A 2RNEA 4FW1A 3LAKA 3D9BA 4BDYA 3BO3A 3MXMA 3HXMA 1T44A 1J5OA 5GIOA 3CJSA 4QS7A 2VQEJ 2OPPB 2O8BA 4ED5A 3VQCA 1NEEA 3HSJA 2BJDA 2F9DA 3O80A 1VHIA 4EI2A 4ZVGA 1EX4A 2JWNA 1XMOF 1Q7YT 4BR0A 4KT0C 4JI6K 2ZZNA 5ETNA 3C6UA 1VSLA 2UXDK 5EY4A 3NP5A 3BPSP 4JI4F 5F0WA 1X1PA 3HZGA 3SQGB 3K8VA 4FF2A 1MDUB 2DHAA 2XI2A 4RCHA 3QMQA 2E5LK 2YNIB 2B8PA 1BQMB 5C15A 3LDOA 1TKZB 3FDSA 3UQSA 4IRDA 1QQMA 2QWRA 2W4DA 5FROA 1T9TA 1SZ2A 2E7VA 3VAGA 3VAKA 1ZBHA 3VVTA 2A6MA 1O8BA 4H4KC 3ZSXA 5DO2A 2VC1A 4QPTA 3RTVA 3ZTSA 1NCLA 2W9CB 3B4DA 1RWOB 4CEZA 4OJ1A 4TSXA 2Z30B 3I55N 3UR3C 4TNOA 2Y1RI 3DRSA 3IRWP 3ZSWA 5KFIA 1PO6A 5HVHA 5HI7A 4J9NA 4UQTA 3Q24A 3PIOL 4ZP6A 3GG0A 1N8RO 1HNWJ 4BQLA 3RB3A 4LF2A 3TAQA 2WVEA 5KGXA 3I5BA 3OYHA 5F8IA 1Q95G 4ZPWR 2HLTA 1B9DA 1YJ9N 3RZAA 3MGJA 1BI4A 2VB6A 2Z2LA 3WZ0A 1AT1B 1RCOB 3BS9A 4J9LA 2WB4A 3P31A 1BC6A 3I82A 3J81Y 3TAMB 4Q45A 4M5DB 4W5QA 1JXBA 4F4KA 1GH8A 1XN9A 3H2LA 1A5VA 3I32A 3BGOP 2ZH4A 3FFIA 5U47A 4BBYA 3L2UA 2YKMB 3Q8QB 1W25A 2CQ3A 4B3OA 1UFWA 3OR1A 1JJHA 5HO4A 1TK8A 2AV5A 1HR0K 3TZZA 4OGEA 2W42A 3DXKA 2MZJA 3I56N 1PCAA 3G6VA 2FBYA 3LO3A 1RTHB 2QG9B 3IWXA 3FEZA 1YAGA 4CT9A 3UKUA 4MO4A 2L41A 1RTDB 3G82A 1KC8T 3BN4A 2DH8A 5KRTA 4PKGA 3JSMA 1H2TZ 1RDUA 2NRRA 4DCOB 3ZT1A 4F25A 1H38A 1EP4A 3VCDA 1K1SA 4BREA 2NSBA 4ZP7A 2QKKA 2FBTA 2G8UA 4DBQA 1P8GA 2HZAA 5LM7E 4AHSA 3R8EA 1C0UB 4CEOA 1N56A 4S0MA 2YKNA 3G87A 4DV2K 1DJ0A 4FXDA 1QVGM 4A2AA 2M3DA 4F67A 1IO2A 5ADXH 3MPVA 4DTPA 1P9QC 2LA4A 2R4FA 3LP3A 4GKJJ 2XYGB 3DRPB 1TK5A 1HLUA 4DX5A 1W2IA 4C98A 5HROB 1X3MA 2A18A 1UWAA 5KFMA 1NAQA 1FFGB 2DXFA 1A5WA 2HQFA 4BC7A 3QBCA 3C46A 3KMSA 4OQJA 4WFZA 4ELVA 4IJAA 4FKXA 4ICLB 1NG9A 1ZAXA 1QZ6A 2RIJA 3HTVA 5E84A 2DGXA 1SIWB 1R3NA 4WP9A 4AF1A 2PA8D 3BKFA 4K4VA 4LF4J 4FYYB 2QZ8A 4P9SA 1MMLA 4MN4C 2YPYA 2WBNA 3JAMO 4DX8H 2IY5B 3P39A 4UT4A 1MNEA 2GQQA 1I3OB 4ED1A 2MLXA 4U67Q 4PWDA 1QVGR 1XMOJ 2ZC3A 1M90O 2B51A 3VQ8A 2E5GA 4DTRA 4HYKA 3CXCR 2I8EA 2MKIA 1KVAA 1FKOA 3Q7BA 4BRIA 4KPCA 2R8GA 4JI4J 2IHR1 1S6PA 1X5OA 4DPYA 1OH8A 4KFBA 1GK8A 3PCOB 4JI6J 3MUTP 2FLPA 2M2BA 1WC4A 5CE3A 3CC4S 2UXDJ 2M8DB 2O8DB 5AXMA 3NWRA 1C0GA 2E9ZA 3RU0A 4MIWA 3UE2A 4KGKA 2LKZA 2HHVA 3LUYA 4BC9A 2FJDB 3L3VA 3C6TB 3RMBA 2X51A 1C1BA 3EWGA 1TELA 3VAMA 2E5LJ 4JKCA 2D0BA 4JKDA 5KOXA 1FNXH 2VODA 2D5RA 1CQMA 2BJ7A 2LQ8A 5F8NA 4FZYA 2POKA 4B1ZA 3QO9A 1EIYB 4E7HA 5B08A 1VC0A 4X4QA 2FC9A 3N5BA 3OS2A 5LMNF 2GVZB 1WC1A 3WQPA 1TQLA 4NLBA 2OPRB 3TI0A 4DU4A 5LSLA 1GNKA 3HD1A 1RAGB 5GMEA 3M7VA 3SBGA 2QTDA 1RTIA 2QA4N 2X78A 2CPIA 1FJ7A 3S1TA 1NZAA 1X8DA 3C7NA 1ILYA 1IJEB 3FGUA 1PIEA 5LXYA 2MGZA 3HHKA 1WG5A 2E66A 4WE1A 3TZXA 1NOZA 4ECZA 5M1QA 2UXBF 3UVJA 1CXQA 4Z7CA 4QOZB 1VQMN 3TX0A 2PMWA 3CHWA 4TYAA 1H73A 3KLFA 3A12A 4F2RA 3W3SA 1RDBA 3MR6A 1WNEA 4KH0B 4J2BA 2MZSA 1QE1B 1M5KC 2PEBA 3SBMA 3PYDA 1VLYA 2CPFA 2AP1A 2BMBA 1KKHA 2D0OA 4B9UA 3CDWA 2IFXA 1RZMA 4YOWA 3BQ1A 4CGFA 3CCRN 2GMLA 3FBEA 3PV8A 3NLCA 3DGPB 3ADAC 3FGVA 4WXWA 1HPZA 1TL1B 1LXNA 2KLAA 4A46A 1HR0J 3MMBA 5DG8A 4K4SA 4C48A 1YJWS 5KFEA 4K8RA 3A3NB 1NKBA 4DR7K 2VFTA 4LUBA 3ZTPA 4K59A 4CHPA 1ZBFA 3KJVB 3U3GA 2EWSA 4ZITA 4RUAA 4CYUA 4QS9A 1Q8LA 1UA0A 2KB2A 3I8BA 3NNCA 3NBPB 2Q0RA 3HP6A 1KR4A 2HBJA 3RG6A 4RW6A 3J81j 5FRNA 4CFDA 4HHJA 3FK4A 3R5GA 5EXWA 1TR0A 3SCLE 3KMQA 1FA0A 5L1KA 4X4UA 1OKJA 3BEXA 5AXNA 4HTLA 2GCFA 2VU5A 4DV2J 1QUPA 2OKQA 4K50A 1B7FA 4A8XA 4F36A 4TKTA 4AQYF 4ZLNA 3QRRA 4RUCA 3LDNA 3HM9A 3UKRA 4OZ3A 2DGUA 1RU1A 4FYVB 1YHQN 1YTUA 3M6WA 1RAJA 2DEJA 3OVSA 5BRHA 2G0IA 4LF8F 1KVJA 3D2FA 3HSGA 4ED0A 3BZCA 3D2EA 2EX3A 1DQ9A 3AVJA 2W4PA 1S1VB 4CVNE 4Z4GA 2MZQA 2QLXA 1TK0A 4JKGA 2E5IA 3OFEA 4CZLA 2HIYA 2AW0A 1Q81O 3DRXA 2DNLA 4F7VA 3ZT0A 1DARA 1GQEA 4Y2AA 3B6BA 2E1YA 3BKTA 4DV3K 4M3WA 3CJ2A 1JLEA 2EEYA 2J9DA 1S7HA 2XCPA 4NXNF 1Y10A 3DLLQ 1QM9A 3MCOA 4O3SA 1BCMA 2DFEA 3K9JA 1XBWA 3SMSA 4DU1A 2E2PA 1HLWA 2FBVA 3OXLA 3KK1A 4BQZA 4YR0A 1VS3A 2W01A 3PKYA 1EARA 4QIEA 1S12A 1J54A 2PFUA 1J9AA 3DOKA 1VQPN 1W2BM 1ZYQA 3M1FA 4KO0A 3ICLA 4WFAQ 1PC4A 2CPZA 3CWJA 1WJ9A 1YBAA 2ZDOA 1TU0B 1S59A 1IG8A 1RHKB 2V50A 1IR1A 1R8CA 2LLZA 4I6YA 2R7OA 3WIUA 4K43A 4Q44A 2OANA 3W2VB 2JH3A 3H2VE 3TRGA 2L48A 4L74A 3OR2A 4EGLA 2YWGA 2W7OA 5KI6A 1XQIA 2UVRA 1GAOA 4OX9F 4LH4A 4AHCA 4J9VA 2W2QP 2BM1A 2KRBA 1HNXK 4EFHA 2I0XA 2JOQA 4CLLA 1RT6B 5BRFA 3N6LA 4G1IA 5CY4A 2J8SA 2D74B 1R8BA 1U47A 3ZX2A 1Y0HA 2ACMA 1DTQA 4AHUA 2XSJB 3V4MA 2VWKA 2AEMA 4W5TA 3LDSA 1DLOB 2Y1IA 3KJFB 1TAUA 3SCXA 1IBMF 2FHKA 4Y2IA 1S72S 5CABA 5K14B 1PGZA 3WNFA 5LMNJ 2ZQBA 5E3PA 3CDEA 4BGBA 2JRSA 1FE0A 2DR5A 4O0JA 3BM7A 4ZPDA 3DLEB 3CJKA 1S1WA 3VGUA 3VAJA 2RN2A 4ED3A 2K1RA 1NWKA 5C0YA 1DFDA 2G8WA 1T05B 2UUCF 1VSJA 1NHVA 4J7CA 3RAQA 3US5A 4B9QA 4PG4A 2MKYA 2W25A 1TKXB 3AXMA 4TYBA 2UXBJ 5IWAK 1FD8A 3TAFA 8AT1B 4ES1A 1WB9A 2YNHA 4FJGA 2Y9HA 4MKBA 3SIPB 1Y64A 3JSYA 3SEOA 1GEHA 2LVWA 4WYBA 1RAAB 3LPUA 2W2NP 1N5VA 3CJAA 4PWUA 3D2WA 1YK9A 4DL0C 1U1KA 4BE1A 4Y1DA 2JEJA 3UCUP 5KAKA 1IBLF 2NSCA 3IRXA 3RRHA 1BGXT 2F5GA 3R5DA 1HBOB 3CM5A 2AZ3A 3SSRA 1JNZB 3BEGB 3DCAA 1VQ4S 2FSKA 3F56A 3MXIA 4OV6A 1TVRA 3O9RA 2ZJRL 1QHAA 4DPOA 2LEBA 1YITS 3SQ0A 4N8OA 3JSBA 4NA2A 1RLDA 3EPIA 4JYAJ 4RWTA 4DV6J 4WKRA 1LK5A 5HSPA 2OD6A 1O0PA 3ZSVA 2WSCC 3EVWA 1CJKB 4DR7J 4GVBA 1IWAA 5KFQA 3NGSA 5DLFA 1UL3A 1FE4A 3J80U 2VJVA 2M7SA 2E9RX 4HI2A 4TU8A 3J7YI 2O67A 4CO2A 2RT3A 5FDLA 5IV3A 3ELHA 1Q8KA 3HK2A 2HNZB 2HHHK 1XNRF 3EZOA 2ATQA 2VG5A 3TW0A 1WF2A 1VQ7N 3VPZA 4JB8B 2ROPA 3LF0A 4AQYJ 1H6KX 3BBFA 1T7PA 3CCLS 4LFAF 1JLGA 4DR3F 1NRKA 1NU4A 5KFFA 1YF5L 4M5KA 3BSOA 3GIKA 3VETA 4CO0A 2DT9A 4LF8J 3MM8B 2C2MB 4PKIA 2QJ3A 2ZGYA 1NGBA 4O23A 1M1HA 1DBDA 1Q7YO 1SKWA 4USUA 5A2QU 1VQLN 4CEFA 3CC7S 4ES2A 3K89A 2O8FB 3LGHA 3POTB 4YN3B 3T9ZA 1TV6B 2DNYA 3P4IA 1FWLA 4JHDB 3QICA 3GV8B 2FUG9 4JV5K 2V4QA 3MM9A 1RWMB 2JLFA 2BYCA 2HB5A 2WRMA 2IVOA 3CJ1A 3BDPA 3LP0B 1U8SA 2CJAA 5LJVA 3QJJA