4YFUA

Crystal structure of open bacillus fragment dna polymerase bound to dna and dttp
Total Genus 210
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
210
sequence length
579
structure length
578
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase
publication title The Closing Mechanism of DNA Polymerase I at Atomic Resolution.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 210
structure length 578
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 4yfuA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yfuA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4yfuA01
2HHTA 2FC0A 4RW7A 3V6DA 4BDPA 2RN2A 4KHYA 4Z0UA 1NK9A 1VSFA 3IG1A 5C24A 1ZYQA 1HYVA 4M41A 4C8NA 2RPIA 4FLZA 4CIGA 4CJKA 3SQ2A 4NYFA 2P51A 3VQAA 1RTDA 2O4IA 1BI4B 1CXUA 4IFVA 4HCCA 1RBVA 3P5JA 4CJTA 2XY6A 4DF8A 3VQCA 3LP3A 4BWMA 1KSPA 1ASWA 2IOCA 3HPGA 1NJZA 4DU1A 3NGZA 3AVLA 1BI4A 3VQ5A 4IDKA 2ITGA 1C6VA 5C42A 2X6SA 3KLGA 3K57A 3HK2A 1NK6A 4ZTJA 2O4GA 1CZ9A 4KB0A 4C8MA 3LZIA 4FM0A 2KFZA 3AA4A 2A1RA 3AVBA 5KTQA 3ULDA 4TSXA 3SUNA 4ICLA 5C25A 4LD0A 4B9SA 2PI5A 2FBXA 4FJXA 4DMNA 3OY9A 1RTHA 4LH4A 1D5AA 1X9WA 4B8CA 3NH2A 2HVIA 1L3VA 1DTTA 4OLBA 1VSKA 2OZSA 4AILC 3VQDA 1UAXA 4FW2A 3OS2A 3C95A 4DFMA 3G0ZA 3LAKA 4I2PA 4FJJA 4EZ9A 3OYBA 1S1VA 4BWJA 1HYSA 3DOKA 2XY8A 4CF0A 4Z4CA 3LP2A 4FJMA 3B6OA 3QO9A 3AVFA 4DSEA 3MAQA 1VSEA 4CHZA 5CYQA 4J2AA 1ASUA 1S1TA 3V9SA 3PUFA 4LSNA 1ZBLA 4PWDA 2FBYA 5J2MA 1QTMA 3V9ZA 3HVTA 4DLEA 1WSHA 2Z1HA 4O5BA 5KGXA 3AVAA 3HJFA 3ZT0A 2Y1IA 1VSHA 4CF8A 5HBMA 4DQSA 2LSNA 4BE0A 1WAJA 3ZSQA 4N41A 4Z4EA 3I8DA 3F73A 4FJIA 5SZTA 4CFCA 4KAZA 4O4GA 1W0HA 2XY5A 4KI4A 4FZZA 4FXDA 3D0PA 2JGUA 3AVCA 1ITGA 2HB5A 4DQIA 4Z4IA 4CE9A 1EX4A 3HO1A 4OPJA 3SUOA 1KVAA 1SL2A 2Z1IA 3DLKA 5HRRA 3SI6A 1LW0A 2XO7A 1D8YA 3CFPA 3WNEA 3NF8A 1IKXA 2EX3A 1IKYA 3T1AA 1QHTA 4KV8A 1LAVA 3V1OA 4CHQA 4FVMA 2XRIA 4DTSA 4FLUA 1XC9A 1WNSA 3HT3A 2Q3SA 1J54A 1WAFA 3C94A 1N6QA 4IG3A 4DFJA 1WSJA 2VWJA 5CZ2A 4O44A 4JS4A 1NOYA 1LW2A 4AH9A 4M3YA 2QKBA 1RDBA 3O3FA 2B6AA 1FKOA 4OJRA 4OPKA 4RW4A 3KLHA 1J5OA 4O0JA 2XHBA 4M3TA 2F8SA 1IG9A 3HVRA 1T7PA 3AVJA 2DFHA 4E1NA 3TAPA 1T03A 4FM1A 1U04A 4CGHA 1G15A 4K8ZA 1TKZA 2YKNA 3OVNA 1RT7A 2GBZA 3C6TA 3DRSA 1BQMA 4CJSA 3QERA 3QIOA 1HNIA 3AO4A 4AHRA 4CK1A 1IO2A 1D9FA 1S77D 4HUFA 1QLNA 3TABA 3SPZA 3ZSZA 2HHWA 1ZBHA 3OYGA 4FJ5A 3S3OA 2Z1GA 3ALYA 4NCBA 3SNNA 4Z4GA 5D3GA 2AJQA 4W5TA 3F9KA 4ID1A 4DFPA 1KLMA 3KK1A 5J2NA 3UIQA 2ZD1A 2YKMA 4FW1A 4LY7A 1WN7A 2VG7A 2BGGA 3SV4A 1S0VA 1JLEA 3NH1A 4I9QA 4C8LA 1L5UA 4KI6A 5HRPA 2IGIA 1NK4A 3RRHA 2ZQBA 2I5JA 3VQBA 4NCGA 1IKWA 3K5MA 3MEEA 1IH7A 4CK3A 4CF2A 2G8HA 1YTAA 2KFNA 1A5VA 3LANA 4FCYA 5I3UA 4DG1A 4CJPA 2OPQA 3DYAA 2P1JA 2RKIA 1BQNA 4DSLA 1VSIA 3HYFA 3VQ4A 4KTZA 4CHYA 4FM2A 3PX0A 1KCFA 3DRPA 3QINA 3SQ1A 3ASMA 3K59A 4RW9A 4B08A 4ZHRA 2HHXA 1CXQA 4OGCA 4E3SA 4QCLA 1S1WA 4DTPA 5KRSA 2F96A 4JRPA 4CGFA 3AA2A 3NGYA 3HXMA 1NK7A 4B9VA 1TAQA 4JRQA 3TAGA 4B3OA 3NF6A 4N5SA 2YNHA 3E01A 3ISNC 3MECA 3KLEA 1ZBFA 4CESA 3JYTA 4CJ4A 3SJJA 1HYZA 4E0DA 4N56A 4PA1A 1RT6A 2HHVA 3WNFA 3SUPA 4CGGA 4CEDA 4G1QA 5KGWA 1KLNA 3QEIA 3LZJA 2G8FA 1NJWA 1QSSA 3SYZA 1FXXA 4WE1A 1BGXT 3OYJA 4FLVA 3OYKA 4OVLA 4CHOA 4DTXA 3TAMA 1RT3A 4FJ7A 1RDCA 3AVKA 3OS1A 3L2UA 1YT3A 1VK0A 3NF7A 3ZSVA 3OYLA 4KPYA 3MXMA 3PV8A 2VG5A 2B5JA 3AA5X 3O4NA 4CEZA 1C0TA 4HVJA 1RDAA 4OKJA 4DTJA 1J9AA 3OYAA 1Z25A 1EXQA 1VSLA 4FJLA 1R0AA 1HNVA 4KHUA 1EP4A 4AHCA 1C0UA 2KZMA 4GMJB 4F4KA 2HW3A 4DU4A 4CEOA 4CGDA 4B9LA 4OKKA 4HUEA 4DTNA 1RTJA 5CYMA 3AVIA 2D5RA 4DS4A 4BDYA 4CJ3A 5I42A 3VQ7A 1TL1A 4CJEA 3VQ9A 2QXFA 2NUBA 4OGEA 4KHNA 1WLJA 4IG0A 3O3HA 4C8OA 1X9MA 5EU7A 2KW4A 4M3RA 1RDDA 4CK2A 4CIFA 5FRNA 5T7BA 4E7JA 4QOZB 1BIUA 2E6LA 2HNZA 3OJUA 1QS4A 1JLFA 2X6NA 3DLHA 1RBSA 3SQ4A 3QESA 4E7IA 1D9DA 1RT2A 3OYHA 3K58A 4F2RA 3L8BA 4XIUA 1UA1A 3P83D 3V9XA 1CLQA 1U49A 3OYFA 1JLAA 4CEEA 3ZT3A 4AHUA 1S9GA 1KVCA 1WSFA 4FYDA 4LH5A 3VA3A 1S6PA 1HPZA 3T19A 1J53A 5KRTA 3SCXA 3AV9A 1WSEA 3S9HA 1TKDA 2G8VA 4BE2A 1JLGA 2DFEA 4CJRA 3TR8A 5E41A 3LPUA 2DY4A 1FKPA 3AO5A 3KIOA 4CF9A 3AVGA 5DMRA 1DTQA 1XHXA 1U47A 2D0CA 4MQ3A 1RBTA 3V1QA 3HM9A 2G8KA 3ZSWA 4IKFA 4ELUA 3V9UA 4F3OA 3VQ6A 4OKEA 4CIEA 1KFSA 4MFBA 1SL0A 3OYCA 3V81A 1RT1A 1A5XA 4CEQA 3TAEA 4KHSA 5JS1A 3QEVA 3QEPA 4KTQA 3M8PA 3LAMA 5J2PA 2G8IA 3AO1A 1U45A 4GW6A 1TAUA 3V9WA 1LAWA 4GVMA 4KTWA 4YNQA 3NH0A 1VSDA 3OYIA 2PZSA 4FZYA 3OYEA 1S5JA 1VRTA 3QEXA 4DTRA 1XI1A 1RILA 4OLAA 3D45A 2QK9A 1C1CA 3M8SA 3HSTB 4KFBA 3WNGA 4KREA 2HHUA 4RW8A 1YVUA 1UOCA 4FLWA 4M3UA 2HNDA 3A2FA 3C6UA 1RNHA 2D0AA 3VA0A 3SUQA 5FDLA 3RTVA 4CCHA 1RCHA 2JLEA 4R5PA 4DTMA 4AHTA 3B6PA 1NJXA 3CG7A 1LWCA 1W9HA 3LP0A 3AVMA 3CFOA 3KLFA 3TWHA 5DK5A 2OA8A 3QLHA 2IC3A 3DLEA 3MXJA 3QEWA 2YHAA 5CY4A 1KVBA 4RG8A 1VSMA 1NKEA 4Q0BA 4E7KA 3I0SA 4O0IA 3EYZA 1TV6A 1SV5A 4E19A 3QETA 1RBRA 5HLFA 1I3AA 1A5WA 2OPRA 1UWBA 1RBUA 3AA3A 2YHBA 2E6MA 3OJSA 4FJNA 2GUIA 3HL8A 3KKRA 3KTQA 1TKXA 1C0MA 4EP5A 2FBVA 3AVHA 4CJWA 3KD5E 3ITHA 2Z1JA 1B92A 4CHPA 1NOZA 1DLOA 4B9MA 4JLHA 1JL2A 3RR8A 4CJUA 2FBTA 1N5YA 1X9SA 4M42A 3CQ8A 4FLTA 3ZSXA 1ZBUA 3NFAA 1C1AA 3RMCA 1IKVA 5J1EA 1Z26A 4PY5A 4AHSA 4CERA 2WOMA 1T05A 4Y1DA 4FJHA 3M8RA 2XY7A 1EKEA 1NKBA 1B9FA 2E4LA 1QSLA 4DLGA 3P1GA 1S6QA 4HUGA 1NK8A 4B9NA 4YFUA 3NDKA 4HCBA 2BANA 1NK0A 4ELTA 3CFRA 3SPYA 2DTUA 1U4BA 4QAGA 2VG6A 1QQCA 3ZT1A 2OPPA 1KFDA 4DTOA 3WNHA 1NJYA 3ZSOA 2R7YA 4L8RB 3BDPA 3HPHA 3TI0A 1FK9A 4ZTFA 1TK5A 4M3WA 1YTUA 4DSFA 4DQQA 3G10A 1LV5A 4CFBA 2G8WA 3S3MA 4FLYA 3I0RA 3AO3A 1X1PA 3KD1E 4ID5A 1SUQA 4I2QA 4CFDA 3DM2A 1XWLA 4EZ6A 4DU3A 5FROA 4E89A 1S76D 4NYNA 3CM5A 4I7FA 3DLGA 2VWKA 5JS2A 2A1SA 3QIPA 4KB1A 2G8UA 3IS9A 3DLBA 1I39A 4CECA 3KJVA 4E7LA 1XHZA 3S3NA 3EZ5A 4FJKA 2GV9A 3OYDA 3IAYA 5HRNA 4BDZA 2PYLA 2PY5A 3TAFA 4M45A 3PO5A 4DSKA 3E2EA 4IFYA 2PI4A 4DSIA 4NCAA 1HRHA 4KO0A 4H8KA 2IS3A 3IRXA 3SZ2A 4B9UA 3NHGA 4M3XA 4M3ZA 3SV3A 3OYNA 2B4JA 3T3FA 3L2WA 3LWLA 2DFFA 2P5GA 1T8EA 4CHNA 1VSJA 3RMAA 3PO4A 1HJRA 3NCIA 5HP1A 2YNIA 4EP4A 2IDOA 2HHQA 1HMVA 3L2QA 3NAEA 2P5OA 4J2BA 3KLIA 3DI6A 2X78A 1F21A 2YNGA 3LP1A 4CF1A 4CJVA 4B9TA 4FK2A 4FK0A 1TVRA 1RTIA 3NBPA 4IBNA 1TL3A 4K8XA 3ZSYA 1GOAA 4FJGA 3K5NA 1BISA 1U48A 3LPTA 1TK8A 2KTQA 3PX4A 1CZBA 3L3VA 4ELVA 1ASVA 1TGOA 2RF2A 1JLBA 3O3GA 3V4IA 3RMDA 3RMBA 1Y97A 3SQ0A 3L2RA 4KHWA 3O4QA 2YNFA 2F8TA 4O55A 2ETJA 2YV0X 3MEGA 1SKWA 3NE6A 4J2DA 3L2VA 1L3UA 1S9EA 4UQGA 1JL1A 1L3TA 1L3SA 4N47A 1WSIA 5SWMA 4CJLA 3KK3A 4J2EA 4FJ8A 2Y1JA 4JS5A 3PY8A 1QE1A 4KRFA 4B8AB 3U3GA 3CM6A 3TARA 4DS5A 3KK2A 3H08A 3M8QA 1S1XA 2ZE2A 3ZT2A 4Q5VA 1HQUA 4N76A 1KRPA 1UA0A 5HROA 3DMJA 3ZT4A 1SL1A 3U3YA 3MEDA 3FFIA 5CZ1A 4W5OA 4CGIA 3RWUA 4E7HA 1ZBIA 5FRMA 4PQUA 3JSMA 3VQPA 4E1MA 1S1UA 2OZMA 4W5RA 3LALA 2ATQA 2PYJA 4H4OA 3BGRA 3DLRA 4FJ9A 4FZXC 1C1BA 4CFAA 3THVA 1MSWD 1GOBA 3MXIA 3CYMA 3K5LA 3AVNA 2BE2A 2BDPA 3VQEA 4BE1A 5K14A 1BCOA 4F2SA 1O1WA 2OPSA 4CJQA 3DRRA 3AO2A 3EY1A 2W42A 3U6FA 1SKRA 4Z4HA 4HTUA 3QNOA 1BHLA 1HQEA 1KTQA 1QSYA 3RRGA 4DF4A 4DFKA 3RR7A 2KZZA 1REVA 2HVHA 4DTUA 1BIZA 3OS0A 1LWEA 1JXBA 2HNYA 3K5OA 1H38A 2HHSA 4LSLA 4Y1CA 4HHTA 5J2QA 1Q9YA 2HMIA 1K6YA 4F3TA 1JKHA 1BL3A 3ZSRA 4DQPA 3TAQA 1RT4A 3HP9A 4AHVA 1BCMA 4I9LA 4DWIA 4CEAA 1NKCA 4DSJA 1MU2A 3V1RA 4CEBA 4FK4A 3OYMA 3PX6A 1TK0A 2X74A 1RT5A 3L3UA 1Q9XA 4W5NA 4CJ5A 1TKTA 1EETA 2OYQA 4BACA 2EHGA 1B9DA 5HRSA 1LWFA 3K2PA 3VN5A 4CJFA 3LDSA 1JLQA 2D0BA 1AROP 1NK5A 4FLXA 3KKSA 1WSGA 4CEFA 3ZCMA 1VRUA 3NF9A 5KI6A 3LWMA 2KQ2A 3TANA 1CEZA 4C8KA 1Q8IA 4CGJA 4H4MA 3VQ8A 4F8RA 4DQRA 1GOCA 1SKSA 3NGIA 3HP6A 4RW6A 4PUOA 4KHQA 2WONA 4KKOA 3VQQA 4W5QA 3DOLA 3HPOA 3QNNA 1JXEA 2IAJA 4Z4FA 1JLCA 2QKKA
chains in the Genus database with same CATH superfamily
3ZO7A 4O3PA 5KPTA 2AV5A 5A8RB 4FF4A 5KG1A 4CZMA 1F1BB 2KDOA 4IDKB 1E6YA 5C42B 3KLGB 3VQCA 5HATA 2W9CA 2H48B 4ICLB 3AXKA 2HBKA 2MB0B 2G2YA 1BA0A 5KTQA 3SUNA 1U1LA 1X60A 1B0TA 5F8GA 4YDUC 2NRTA 4F3QA 2BH1A 2F65A 3G0ZA 3OYBA 5KFBA 1GT8A 3FKBA 3CTRA 2MLXA 2V4JA 3SK3A 1HWUA 2OGUA 5HBMB 3UN2A 4PWDA 1HHQA 3QJPA 3HVTA 3CERA 2FVQA 5TKWA 1SC6A 1XJWB 2ZBIA 4PXEA 5L1IA 1N0UA 4N41A 3AOAA 3GBTA 3I8DA 4JI2F 4KAZA 3SAGA 2JGUA 3T1YF 2CADA 4GKKF 1FW6A 3HO1A 3SUOA 2P5VA 1LW0A 3PXGa 5EWFA 1LW2B 3FMBA 4B1XB 5M1NA 1ZA1B 4PHTX 3HT3A 2KKZA 1T03B 4DFJA 5CZ2A 3LL3A 3O3FA 2EKNA 1IVZA 1BU6O 2F9WA 4J9UE 3OUYB 5L8RC 2EWHA 3QERA 2AYGA 3CCQN 2UUAK 4OI1A 2HAIA 3OYGA 3QSYB 3S3OA 2BOPA 4MYTA 1HNXK 4Y65A 3KJFB 4BRMA 4FXWA 4CI0B 4X4VA 4OX7A 3Q22A 1KQSM 3BBFA 3ID6A 3UNYA 2OPQA 3QEXA 3VQ4A 2ZH8A 4KTZA 2MHNA 4WYLA 4IOAQ 3TJ8A 4DR3F 5DO2A 1RHKB 2L9WA 4C23A 3H5SA 2NYHA 4WE1B 3J80Y 3CCLN 1XERA 3DXKA 1KNZA 1YK9A 3VPZA 3IGNA 2ZJRL 3NGUA 4X62F 3SYZA 4OVLA 2GFFA 3R7BB 3U1LA 1T95A 1XEZA 4LRFA 1R0AB 3RG6A 3A8IA 3MXMA 3BGOP 3PV8A 4HVJA 4J37A 2GV1A 1C4AA 4DTJA 1EXQA 2UUBJ 1QZ6A 2E9ZA 3NKYA 3RB4A 3AQPA 3D67A 5E33A 4CEOA 3SCIE 5I42A 3FSIA 5KG4A 3VTHA 4ILMA 2IY5B 1DT9A 1S59A 3OVBA 3FVYA 3VGSA 3OSPA 4ZITA 1RBSA 3O4WA 3PHTA 2LEAA 1WEYA 1FDDA 1WBBA 1KVCA 4FWOA 3P4IA 3T19A 2HQGA 2DNLA 2P2CB 3U1MA 3K0JA 4NMXA 5DMRA 2HWIA 4RPFA 3EX7B 2CZVC 2AJ2A 1E3MA 3H8YA 4MT1A 4USUA 4KGXB 3KVGA 2J9EA 3JSBA 3NH0A 4GVMA 2X3GA 2C3UA 2MQPA 3TEHB 2EXUA 5KFDA 1RWUA 3LP0B 3OHBA 2HHUA 1WC1A 2UU9J 1VMBA 4LRAA 4FLWA 1VQ9S 2PMZD 4AHTA 5IT9Y 4PL8A 1XR7A 1TV6B 4WWSA 1U1OA 3DLLQ 3VETA 2K06A 4ZVPB 4E19A 3QETA 1V3ZA 1HNWK 4O23A 5D4OA 4LF4K 1LFWA 1UKUA 1DLOB 4KRWA 4U95A 5F0WA 1PILA 2GW8A 3H46O 2MQMA 4JK9A 1OSDA 2WOMA 4ZPCA 5LMUK 5L1LA 1FCAA 2A2CA 3SJHA 2MJUA 2BANA 1HJOA 1M5HA 3A13A 5IXUA 1NJYA 4A5AA 3UKUB 2IRUA 5CAAA 4UQTA 3Q8RB 2QM1A 1FJEB 4I2QA 3KJVB 1M1KO 4CFDA 3EZOA 2X1GA 2Z2LA 4C9DA 3K9JA 1I39A 2MY8A 1LK7A 3OYDA 1DHMA 1X4GA 1U2FA 3UVJA 4CTAA 4EIAA 3TVZA 3IRXA 2LVWA 1FRKA 1SJFA 3PW7A 2E5LJ 3NHGA 4M3XA 1F9FA 1HJRA 4Z94A 2DNZA 4HEA9 1HQ2A 3TR5A 4CLUA 2ASLA 3NNHA 2Y1LB 1TK8A 3V4IA 5KFQA 5KT3A 3NCPA 3M2UA 4O55A 3GSIA 1T3VA 1ZAWA 2QV6A 2CVIA 3H59A 1HD0A 3TU5A 3Q89A 1XMOK 3CHWA 2ATCB 5DLFA 4P75A 1SL1A 3NWGA 1VQSA 3JTOA 2PYJA 1Q0NA 3P49B 1MDUB 3EXYA 2BE2A 2IVYA 2BDPA 4IH5A 3Q83A 1IWGA 4CZGA 1BHLA 1QSYA 3PRVA 1BIZA 3HBTA 4DX8H 1PO6A 8RUCA 5CD4H 1RT5B 2AT1B 4DMZA 3F2KA 2ZKTA 2C2OB 4B02A 2ALYB 3PX6A 3B4DA 1DAXA 2IRYA 1SIWB 3AY9A 3E3XA 2D3ZA 2MZJA 3EE8A 1B3TA 2DGWA 4G6VB 3H4BA 3NEKA 4M8LA 4QR1A 4CEFA 3DXMB 1T9WA 3I5CA 1ITPA 2O3DA 1KVIA 3DXBA 2WONB 4ED4A 4EHUA 4RW7B 1FFSB 3ENQA 1SKSA 4A8XA 1FXDA 4PUOA 4YS2A 3ZLJA 2K1RB 1IBLK 3T1HF 3MMVA 3MAAB 3Q8SB 1Q79A 1NM2A 2MSSA 1UFKA 5HVHA 2WVEA 4H0TB 1CXUA 2F4VJ 1XUPO 5F3ZA 3LP3A 3L95X 3UB5A 1HI1A 3HI9A 3LZIA 3AA4A 3ULDA 1R8PA 3D6TB 4ZKAA 4FJXA 3G6ES 4LF5K 1MMNA 3PTWA 2CYYA 2OZSA 1ACMB 4ID8A 3L09A 4CF0A 2BRLA 2MGZB 2ZGZA 2DO4A 5BXIA 2V4RA 3EVMA 4LF7F 3UKRB 5F9NA 2Z1HA 3DJCA 3AVAA 5F8NA 4LUBA 3M7VA 3O1WA 4EBEA 2LSNA 2ZNYA 1KTVA 1Z6RA 3OVAA 2I7NA 2XY5A 3D3BJ 4OI6A 1XNRJ 1ZPWX 1IKYB 4CE9A 3W0LA 3ATUA 4K5SA 2V9WA 1E6VA 2X1AA 3NF8A 4BC7A 4HI2A 5B8HA 3CJ3A 3GFYA 3KDNA 2VFSA 4CO5A 1U1NA 2R7RA 1P90A 2AZ1A 1CQNA 1HNIB 3VV2B 3R5CA 2VASA 4NX9A 3Q8VA 1TKZA 2DNQA 2WW4A 1BQMA 4JHDA 3GJSB 1IM6A 1IO2A 1S77D 2N3LA 4X66J 3C6AA 1N52B 3F9KA 1BY9A 4DFPA 5J2NA 2L9NA 3QBCA 2QA1A 3SQGB 2E1MC 3TVKA 1FKAF 4C8LA 3OBYA 2CPHA 4Y6IA 4CK3A 1A5VA 1GX6A 4DG1A 1S4FA 3W1YC 4R5PA 2RKIA 1FRHA 2EWSA 2P6TA 1D9AA 2YXLA 1X5TA 1T44A 3ASMA 3MECB 2DJWA 3TX8A 4DTPA 4OYZA 3H98A 2IIHA 2A41A 3HHKA 1U09A 3TAMB 4MAKA 4CGGA 4TY9A 3N4QA 4FN5A 4X4UA 1CPZA 2OTJN 3LA0A 1SC1B 2OSRA 3OS1A 4KPYA 4I6YA 2RIJA 2R42A 3MD3A 4LF8K 2F9JA 1VSLA 1NSKL 2KZMA 4DTNA 4DS4A 3O3HA 1RT2B 2E8AA 2ILYA 3BKUA 3P8BB 2X6NA 3MR3A 4OZ5A 1YLXA 2R7SA 5IC6B 2BJEA 4OX9F 5AE2A 2RDIA 2X51A 4A8OA 3FBEA 1D1UA 3CVKA 1GXTA 3VAIA 4TU8A 3AV9A 1FX2A 4LFBF 2KI2A 1YJ9S 4FP9A 4DR4F 3V1QA 5J2PB 2VFRA 1F60B 3RRKA 2O8FB 4MKYA 2X1BA 1O0PA 1SJ4P 4EHTA 1HWJA 4BG9A 4LBPA 1SQGA 2PZSA 2XZWA 4FZYA 5L1KA 4CZHA 1VRTA 5HSPA 1RILA 1QVGR 2CDRB 4AM7A 3A1YG 1N54B 3QLHB 4NMLA 3AY0A 3RTVA 5F1XA 1VQOS 2B9WA 3F56A 4OJ3A 4XDDA 4F50A 4AYBD 5ETSA 1SV5B 3MXJA 1ZBTA 2JHEA 4LREA 3HSZA 2F40A 2DYAA 1RBRA 5HMZA 2ADBA 3AA3A 4V19J 4K42A 4LFAF 3FRYA 4BRNA 1FRXA 2HEKA 2I1RA 2QO3A 4DV7J 3HL8A 2IVPA 1U6FA 5H9EJ 4HI1A 1IKVB 1TL4A 4K4UA 1B92A 4K0KK 3A8EA 4TKTA 5K8OA 2FVRA 3HZ6A 4GVBA 1NKBA 3EGZA 5D6GA 1IBKK 3N79A 5E84A 4Q8FA 1TP7A 2YH0A 4HCBA 4LF6F 2HBMA 1WHWA 2QLXA 2Y8YA 1XC3A 4ZOSA 2N82B 1LV5A 4DR5F 3IS9B 4R0EA 3GLJA 3BO2A 3KD1E 1I94K 4EZ6A 5H9FJ 1S10A 3M9NB 4CO3A 3GL1A 4UW2A 3OSNA 4F26A 3D2FA 5C15A 3OFGA 3TW0A 2HHHK 3ETOA 4NEYA 3M2RA 3NMUA 3LP1B 1YGYA 2DBBA 2GELA 3R6MA 3PCOB 4HACB 1IBMJ 3KWGA 4BGAA 1TL3A 3K5NA 2HS0A 2COLA 1ROFA 3MUVP 1RHMB 2Q66A 4DV6K 4M5DB 2P9UB 3ONQA 3NE6A 4Q8EA 4UQGA 5K5MA 4OPAA 1FNXH 1FA0A 4FS1A 1YJ9N 1U2VA 3PM9A 5BN8A 1MROA 2HF4A 1Q5YA 5GAEU 4PG8A 2BJ9A 4O5FA 3RWUA 1GFWB 4JV0A 2GMLA 2OTLN 2MKSA 1Q8KA 4DN9A 1NBWA 3RUBL 4NLXA 1FDAA 4Z4HA 4HTUA 2EG1A 1FT8A 2QX0A 1HKBA 4Y1CA 1VQON 2WSCC 2O8CA 1EJ7L 4J9RA 2IYIA 4ATNA 2JH3A 4RUCA 4KHMA 2V51B 3MHYA 2LXIA 1SC3B 1QAIA 3MN5A 2E7WA 2Z58B 3ZZYA 2ZJPL 1VRUB 2OEJA 5FPDA 3VN5A 3KG1A 3T5KA 4JOUA 3HTVA 1RAJA 4YY3K 2JVOA 4CGJA 3BSAA 1Q7LB 2MZTA 3WDOA 5F0UA 1JXEA 2WUSA 4Z4FA 4RBUA 5HMWA 1KS2A 1Q95G 1HYVA 1YRXA 3L3CA 1NDPA 2WFBA 1KC8O 2VV5A 3UE2A 3HZEA 4NZ6A 1BE4A 3O8MA 4AD6A 4U7CA 3P5JA 3FRZA 2CQIA 4NB4A 1VQ8S 4D3GA 2NYIA 2C3MA 5B08A 2Y0BB 1N34J 2NSBA 5C25B 3LM9A 3ZETA 3CCTA 2GC8A 3UWTA 3CQYA 4M95A 3F41A 2XMMA 1RTHA 3DOKB 1E4GT 4WYBA 1HW8A 1BQXA 1RBLA 3S01A 4CVNE 1SH3A 4NXMF 2VPZB 2KJWA 3P5TL 2B7BB 5IOLA 4DPXA 1KR4A 2XI3A 3BDEA 4B1WB 2DR9A 3HDSA 2H54B 1WSHA 2C2MB 4C7QA 5K8MA 4DR1K 4I56A 3GB0A 3R7SB 3ZSQA 2IVOA 1WOSA 3P31A 1XTZA 4FXDA 2W40A 2P9PA 1WC0A 1Y0HA 1WC5A 1RWPB 3QYYA 1WEZA 1N32J 1IKXA 4M63C 4YR3A 1J5OB 4FLUA 4YDDB 4ECTA 4JS4A 2IM2A 2OJ3A 3H3NO 4M3YA 4A61A 3M8YA 1RDBA 3POTA 3ZZ0A 1YBAA 1VQ6N 2U2FA 4H4KA 2Z57B 2BX6A 4AHRA 2YWFA 1EQ0A 1RAFB 3PYEA 4FJ5A 4Z4GA 5D3GA 1DY3A 3MN7A 4W5TA 4WZMA 3AJ1A 4M5GA 2C1EB 2ZD1A 4BC2A 2VG7A 3QMQA 3GQCA 2IBKA 1HPMA 4CF2A 3MAHA 4JYAF 1VSIA 1P8GA 2UUAJ 3JYTB 3KLEB 2ZJQQ 3WT0A 2WB1D 4WK3A 1MN7A 3THWA 3QDKA 3NF6A 2VFUA 4MLHA 5EN1A 3SJJA 4X84A 1O51A 2BV3A 2LQ5A 4Q45A 3CW2C 3EE3A 2HURA 3MOJB 1WSRA 2L48A 2JC0A 4YDXA 2L41A 2CQBA 5AQZA 3DU5A 1C0TA 3OYAA 4CO2A 4ECUA 3GIMA 3UI3A 3UVJB 3THPA 3SAHA 5CYMA 3J81Y 1QY7A 1TL1A 3VQ9A 2QXFA 2DGSA 4DR7K 4DCJB 1BIUA 4DV5F 1S9GB 3PEHA 1YIJS 4DZDA 3QESA 3WIUA 1VQLN 3P83D 1NGAA 3PSFA 3TUJC 3WXJA 1I1GA 4B1UB 4UZBA 1RDUA 2BYCA 2DEJA 4IOXA 4ZVGA 3M8ZA 4JI7F 3ZSWA 2W24A 4ELUA 3W2VA 4MFBA 3V81A 3O6QA 1QQMA 3QEVA 1SJQA 2DPJA 2UUCF 3M8PA 4BCAA 4ED7A 3Q8UA 5KFHA 3CUNA 5C5JA 3QWPA 5HK4A 2EFPA 3CJ9A 2ZF5O 4YMEA 4JI4K 2D7SA 3L7PA 4RW8A 2P9NB 1YVNA 4M3UA 3C15A 4QS9A 3MD1A 2AKWB 1KD1T 5AT1B 4YOWA 2V34A 4FOIA 2W4PA 4GRSA 4QWCA 1FVQA 4M5MA 4RG8A 4OYPA 1UWBA 2E6MA 2Q3PA 4RUBA 2R8IA 3JAMO 2FBVA 2O8BB 3ITHA 1HW9A 2A6AA 2AQ4A 3J7YU 4IFEA 4BVPA 2EFGA 1S0MA 3ZSXA 2YVSA 4JI6F 4GKJF 3FEZA 2E4LA 1HNWJ 1NK8A 2VFVA 5IZHA 4QU6A 4P2MA 5LXYA 4DTOA 2DHXA 1Y00A 1JJ2M 2QEXS 3AFGA 5LY3A 4JI0F 3BUZB 3AO3A 1X1PA 3O5BA 1FI4A 3G9CA 2RRBA 4QIGA 5F8HA 4DUYK 3IN5A 4NWBA 5KFYA 5E5NA 4QWEA 3R5AA 5ETNA 3EZ5A 3BF3A 1FESA 3CC2S 4BDZA 5HP1B 2PI4A 4C3LA 2CNLB 2FJXA 4EUVA 3SV3A 3T9ZA 3L2WA 3OFFA 2FJBB 2KT5A 2VKZG 3NBPB 3RAMA 1Y5LB 1N5TA 2IDOA 3KFWX 1HMVA 2CXEA 3HCXA 2RF2B 3UR3C 4AQYK 2GWKA 3BR9A 3FDSA 1U48A 4E2FB 1YIJN 1JLBA 1T9VA 1V5VA 3L4BC 3I33A 2E5HA 3MFHA 1WF0A 4RR5A 1LEOA 2GX8A 4IR9A 1RDRA 2OAUA 4UOCA 3ZTOA 2MSTA 3VF0B 3KK2A 2DTJA 4DS5A 2CPFA 4FYWB 1N33J 1OIAA 2W01A 5KFAA 1B7YB 2DR5A 2R7TA 3MUTP 2U1AA 3PYDA 2XSJB 5F41A 4AL5A 2BOAA 3AAWB 1REVB 4IRDA 3EEQA 3RYLA 1NEEA 1MWKA 4LC9B 1OQ3A 5D15A 1XMOJ 4HH0A 3RRGA 5LT5A 1KAYA 3MM6A 4MKAA 3K5OA 2VC1A 1T9XA 4QPXA 3OYMA 2YPZA 2KXFA 2CDQA 4P7TA 2G4BA 1Q4RA 1SC4B 4RZRA 3K2YA 1ZAVA 1Y5IB 4BY9C 3OBWA 1NK5A 4CIOA 3OV7A 1IXKA 1NLVA 2VQEK 3RU0A 5GMKa 2QRRA 3BREA 1N8RT 3QJLA 5D0RA 2PGCA 1R8AA 2UUTA 3M32B 5AQNA 4CJ7A 4C8NA 4FLZA 4B3RJ 4CD1A 3T6BA 4F7VA 3C65A 3TSUA 1BO5O 5IWAK 2QEXN 3F44A 3C7NA 2ABYA 1WI8A 2ASMA 4F4WA 1VJWA 2XYGB 1IBLJ 5HOOA 3A5OC 4GV3A 3HSCA 4IQXA 2JC1A 1VQPS 2JVRA 3CCRS 3HHNB 1CJUA 4ECYA 4FJJA 2P9CA 3HMJG 5CYQB 4DV0K 2VA3A 3CMAS 4ZCKA 4CHZA 2B7CB 3R5DA 2R7WA 4ILJA 4DLEA 2JEGA 5M1FA 1ZH5A 3TPQA 2H65B 1K73T 4BE0A 4FJIA 3DLKB 1M90T 4ILGB 2CQ2A 1WG1A 3HHLC 5EUHA 1H6KX 2CQCA 1R8BA 3TZXA 3CFPA 4IO9Q 4CHQA 3V1OA 4KV8A 4RW4B 3UN5A 4RJVA 3UD4P 1N6QA 3C94A 4WF9L 2ZWHA 4IJNA 1W7WA 1HWLA 5DLGA 5KPRA 2QE5A 3O8WA 4FDFA 4CM2A 1OJ4A 1N5QA 2ROEA 1R6VA 3D54A 2GJIA 5HMYA 5KFVA 2P9EA 1ATSA 4DUZJ 3KHYA 3I56S 3NH1A 4DR2J 2DXDA 2I5JA 4WFZA 3J7A1 4ZHRB 1BXNA 4B17A 3SDEB 4GMKA 5AQYA 4PQAA 3K59A 2W25A 3CC4N 4WJBA 1JJHA 2N4CA 5KFZA 3IBWA 2MZSA 5AQGA 2F4FA 4CESA 1JCEA 4G1QA 1BC6A 4DI6A 3NRBA 3Q2SC 4W4MA 2B5JB 4P10A 3VOVA 2M0GB 2E44A 4JV2A 1PYTA 2QA4G 5CXTA 2DGOA 1DJ0A 1Q53A 2VDIA 4YB5A 4QS8A 2HVDA 2UVVA 1RTJA 4IOBA 2D0OA 3FZLA 2DHSA 3WXKA 1YUWA 2NUBA 2NXNA 1V4TA 1VGYA 4CIFA 1SQEA 2XYHB 1PAEX 5HL7Q 3UN3A 4CLPA 5E7OB 2FPHX 2NUHA 3CCRN 3N28A 3SBTA 4ZDNA 2FB0A 3S9HA 2XQCA 3CMAN 4FYVB 1LXNA 3DXSX 4B3SK 4EEYA 1J5EK 3MM5B 1RBTA 4PKDB 2A5XA 2ZOGA 4CLKA 4Y2MA 2RHSB 1RHJB 2DRAA 2YWWA 4IO1A 4FF1A 4ECVA 4JI3K 3W2WA 1N36K 4J5OA 2HQIA 1C1CA 1UEKA 2YJEA 3WNGA 4F0KA 5FDLA 1YJVA 1W97L 4ECQA 3CG7A 3CULA 2KHCA 4Q0BB 3T7ZA 4X4OA 3OTEA 1DFDA 3GOIA 1OPZA 3R5GA 2WCXA 2KG0A 1S5ZA 3VAMA 1HHTP 3J7AN 1TKXB 3VQTA 2OPRA 2GVDA 2DEIA 1T02A 1RBUA 4OZ1A 3FZBA 4IYQA 5EDWA 1RP5A 3R1XA 2WVDA 3HM8A 1TL5A 2WBRA 2N3OA 3HSJA 1HL6A 5AQOA 4CHPA 3PACA 1QVGM 2AX0A 5DG7A 5F9LA 4FLTA 2P9LB 4BRAA 3NFAA 1QAXA 1VS3A 1EKEA 2WBNA 3QQCD 2O8EA 2DTUA 1SUQB 2ZDPA 3HPHA 4YOXA 1TK5A 4LFCF 5AR0A 1FF2A 2G8WA 4P2SA 3PYFA 1TELA 2ZJRQ 5T41A 2DISA 4XK8C 5JS2A 3QIPA 4OX8A 4QWAA 2V63A 1U02A 2ILZA 5E3QA 3PW0A 2KYXA 4NCAA 2UVWA 4OJGA 2FUG9 2X7IA 4N8NA 1NGHA 1IG8A 2MXYA 2I7PA 3KLIB 4NLCA 3GR1A 1OS5A 2VBZA 4J8FA 1RTIB 3VQSA 2YNIA 3S8SA 3P96A 3AH6A 2YNGA 1NSPA 4MIAA 3FFKB 3MCSA 3M1VA 4K8XA 4L3QA 1GOAA 1UL3A 1MNEA 3O3GA 2LFVA 3A12A 4UUWA 2F8TA 3Q7BA 3N6LA 2HAFA 2R8KA 4BS2A 4B3MJ 3GIRA 2B8PA 4KIAA 5ADXA 2UXDF 4G1IA 2D9PA 4CO0A 1Z05A 4WTYA 1F9EB 3MEDA 4DU8A 2RQMA 1ZBIA 1MWZA 4PQUA 4CFAA 2MEWA 2W9BB 1F5AA 4PWWA 4CJQA 4IUFA 5J2QB 3THYA 2DGVA 2BKNA 2FIUA 1AA1B 3OTOJ 1KN6A 4WXWA 4JI5F 5GAGU 4K50A 4I9LA 1IQZA 2UYTA 3V1RA 4CEBA 4CLWA 3ET6A 1RGVA 3FZ2A 1N48A 1Q9XA 2C22A 1U2RA 4CZIA 1LWFA 3ID8A 2HPUA 2HGMA 4H4MB 2C3YA 4F04B 2QLWA 3EGVA 3OL9A 1CEZA 5BRFA 3MMBA 4DQRA 4DR6J 3IG1B 4W5QA 2QKKA 1S3XA 4WFNL 1RTDB 4BDPA 3WEEB 4C1NI 2LDIA 4EFHA 3HOTA 4P7VA 4DL2A 1RBVA 1YHQN 3M4XA 3MMAA 4DF8A 4X4TA 5D4PA 1ASWA 2HK3A 1TUVA 1F3VA 5GVQA 1W2BR 2X6SA 1WOPA 2F8HA 2HYIB 1R59O 3Q24A 3QBXA 5G0RA 3G6XA 3JB9k 4ANEA 3MOZA 5A2QU 1R31A 5E0OA 4GC6A 5MLCQ 4LF9K 5J2MB 1B70B 4ED8A 5AFUA 3GPAA 1XIQA 1L3KA 2ZZTA 4FO0A 3CJ1A 3G4SN 4DV3K 3HFZB 4FZZA 5SZTA 3G96A 5KG0A 1VQNN 4QWDA 5HO4A 2ZM6J 2AZ3A 4TU7A 3TO8A 1FJGF 2BJ3A 5A8KA 2B6AB 1CSJA 2XRIA 3DFEA 2GHWA 2YI1A 4OJRA 5T7LB 4M3TA 4WFBL 4O0JA 4TY8B 3CJAA 3ZFVA 2YKNA 4CJSA 3J7ZO 1KLMB 4Q2MA 1ZBHA 2QWQA 2ZFHA 1ATNA 4CZJA 1V3SA 2HS4A 5C2DA 3DYAB 3THXA 2N7YA 4FSVA 1NK4A 4D3HA 3VQBA 4BRPA 1HLWA 2EC2A 2KFNA 2WB4A 4HDHA 2ZH9A 3DRPA 2DPNA 5KRSA 3HHLD 4EYHB 4JRPA 4CGFA 3HXMA 2M5YA 4I6MB 4N5SA 1CJTB 1RT6A 4KSEB 1T9UA 3BGFA 2QWRA 4EWTA 3MM7B 2H51B 4L75A 4CHOA 1RT3A 3AA9A 3HRGA 3L2UA 3O4NA 4OKJA 1J9AA 1G4CA 4AHCA 3RAQA 1QVFR 3JXOA 4BDYA 2OANA 3GDQA 5FPMA 4IG0A 1WLJA 3SSRA 4C8OA 1OQ6A 2XWYA 4ILHA 1RDDA 2NSCA 3IGVA 2J0SD 4E7JA 3B82A 1ZXOA 4X65K 2ZH5A 4FF2A 1S6PB 2PE8A 2Z0GA 3MPWA 3V5RA 1FKPB 5BPMA 4DHYA 3SCXA 2IIRA 5AXKA 4CJRA 2QC3A 5D8HB 1RAGB 2K7KA 1XMQJ 1QAJA 3BM7A 2CJYB 2LCWA 2HFNA 2QN6B 1SB6A 1SAZA 1SIZA 3E9PA 3EGWB 4OQJA 2ZH1A 2GGPA 4FWQA 3PJ9A 3FQLA 4KFBB 1KVJA 2F7TA 5AZJB 2ZNZA 1S5JA 1HNXF 3KJQB 2HBRB 1C2PA 4OV1A 1HKGA 3GR0A 3C6UA 3QFHA 4USJC 5HQ8A 4HTIA 3TWHA 4NRTA 1FERA 4JKGB 3QEWA 3M6VA 1UAWA 1F3FA 4YHHK 4KHPJ 4EAHD 3G82B 3DNCA 1I3AA 4JI4J 1FJCA 3U02A 1N5YB 3TX0A 4IOCL 2ASDA 3C16A 3Q8QB 1JL2A 1SJ1A 5KPZA 4LR8A 5J1EA 1DQAA 3K7RA 2ZHAA 3WHIA 4Z7YA 2JLGA 2E5GA 4JV5J 1WDDA 3SPYA 4KH1B 4YUDA 4HTLA 1P6TA 4OYWA 2MJNA 3QT5A 2QJ3A 2LQ8A 5IT0A 2VJVA 3CJ7A 2WHOA 3W5YA 3HHLB 4I7FA 2PFFB 1Z4UA 2QIFA 1F5CA 1U6ZA 2WBMA 1RDWX 4RNHA 4ZVEA 3E2EA 3S1TA 3I82A 4KO0A 3A5LC 2H9ZA 3PW4A 3DI6B 3NGKA 3ZTSA 3UD5A 1QJHA 1GTEA 2D3UA 4CLSA 3W9JA 3MDQA 4DUYJ 4FK2A 2DXEA 3F9MA 2JDJA 3SQ0A 2RJZA 4WP3A 5A0YB 4GY2B 2RE1A 2ETJA 2NRHA 5GIPA 4N8OA 2FC8A 2ZE2B 1WJ9A 4FBUA 2Y1JA 3GYXB 1YJWS 2DKOB 3PY8A 2XMKA 3CCEN 2MZ1A 3M8QA 4AQYJ 1S1XA 5HROA 5F2RA 3U3YA 3FFIA 2A2DA 3V2UC 5HVFA 2ZUGA 2QG9B 3BGRA 3B8HA 3D66A 1MSWD 4LF4F 4ITSA 5ETKA 3U9ZA 2C2KB 4BRDA 4MK8A 4CLLA 2AJFE 3QNOA 4NO7A 3A3PB 1MU2B 3NLCA 4LSLA 5LJWA 1Q9YA 1JKHA 3HULA 1BL3A 1DBDA 4RWXA 2DNNA 1KD1O 1RXOB 4ZN1A 3K8VA 4UUXA 5LMUF 2FY8A 3W66A 3CCSN 3ZZPA 4Z37A 3OA9A 3BGLA 3D2WA 3RAXA 3L9ZA 4OZLA 3CCUS 5GAHP 4ES2A 3IXQA 3CCJN 2J0XA 1Q82T 1Q8IA 4YQWA 4LIWA 5TKYA 2RHQB 3D0HE 1YJNS 2J7KA 2UXBJ 3CJ8A 2GJ2A 5CCLA 1X5OA 2B4VA 2VKRA 3G8TA 4IFVB 2UUBK 1NNDA 4ZP8A 1JXVA 1HLUA 4IRCA 1GMWD 3W8PA 4FWSA 5EWGA 2BJ1A 3D1OA 5A8RA 2VQEJ 3NGZA 2YX1A 3AVLA 4IDKA 2ITGA 5C42A 3KLGA 3HK2A 2BW2A 4C0HA 2O4GA 1JXLA 2A3ZA 3H42A 1DTTB 4ICLA 1W7AA 4UY8T 1HYSB 1ZM4A 1OYEA 3L0QA 1PSDA 3VQDA 4FW2A 3QO9B 1S72S 1H0HB 1S1TB 1BOTO 3RBZA 5AQSA 2NRVA 3RBDA 4FJMA 3RZAA 4K2JA 5HJYA 2OHDA 2XG8A 4ZVTB 2ZZMA 4JK7A 2N7CA 1NSAA 3KXDA 4JI8J 4O4GB 1RGIA 1ESVA 5HBMA 1HBMB 2UU9K 2E1CA 5AZIB 3CSKA 4BRGA 2O01C 2Z1IA 3M6GA 4DQ8A 3T1AA 2QL7B 1OY9A 3W65A 4JI2K 2FLLA 1MG7A 1SI9A 1YVFA 1LW2A 3H40A 3DRSB 4DV4F 3TQEA 3T1YK 4FPRA 1T03A 3W60A 2NZCA 2CJBA 4Y28C 5KFLA 4CK1A 4J9KA 3D7SB 4DL6A 1JLEB 3OUYA 1HNZJ 4FKXA 3VVTA 3UDEA 4IWVA 2FZGB 3SV4A 3QT8A 1S0VA 2EBEA 1BQNB 5HRPA 2GZOA 1GTHA 5D0HA 4FCYA 4OI2A 3SFUA 4WYWA 2KFYA 1H2UX 4PKIA 3CPEA 3MGJA 5I3PA 2YNHB 5MAOA 3NGYA 3NCQA 2ZH6A 3SMSA 1FRIA 4I68A 1GAOA 2KRBA 2XMWA 3UW1A 1N8RO 3LZJA 3CJQA 4LF5F 5GADP 2HBZB 4ZPDA 4WE1A 1FXXA 2WSEC 2PD1A 1WHYA 3RBXA 4M5NA 4BR5A 2CQHA 1VK0A 4FS2A 3NP5A 5DM6L 4CEZA 2PEBA 1RAOA 3VMFB 5AXNA 1Z25A 4FOEA 3GFHA 3SCJE 3GYNA 1R0AA 2B51A 2HW3A 4FL9A 4HUEA 1ZZNA 2NRXA 4ISEA 1R0CB 2W41A 1UZHA 3CF5Q 3D9BA 3CPWM 2QMUB 4E7IA 3DDKA 2IA6A 3CJTA 4JAXA 4CEEA 4ECRA 2RS8A 4NI2B 4LH5A 2QLBB 2J7UA 5KRTA 4U67L 1TKDA 3T9NA 3WXIA 1RT1B 3T69A 2HHPA 1X4BA 3VGLA 4A59A 4QS7A 4MJKA 1WWHA 4HYKA 3QEPA 5BPLA 1SXLA 4YB7A 4YNQA 3PYGA 2RDDA 1JJ4A 3LDLA 3HSTB 1Z2ZA 2PDAA 2DNKA 1J5EJ 3G86A 3UDLA 5CR4A 6FDRA 4L6V3 3LP0A 1IR0A 3EZUA 5DK5A 4NPOA 3QGPA 5HLFB 4BR0A 5DJBA 2QWPA 1N36J 4USWA 1TV6A 1NGGA 3VTIA 3EGNA 2AP1A 2NRWA 2YHWA 2CQDA 2UXCJ 4F4XA 5BJRA 3W5ZA 2FQQB 5AQPA 3L6QA 1HARA 2FHOB 1T05B 1DLOA 5JJBA 4LRBA 4Y3CA 1T3OA 1C1AA 2ZBQA 3PNIA 4PY5A 2F4VK 4UOHA 4LF8F 3IDHA 1RAHB 3FCVA 1SQKA 4XO0A 3MM9B 4KBOA 3TI0A 5C2GA 3MR5A 4DQQA 3DLGB 5BRHA 3N4WA 1FXLA 4NYNA 3UKUA 3C6HA 4IFYB 2VIHA 3CD6N 2GVZB 3KJVA 1K8KB 1UPPA 2WZ1A 4CI6A 3N01A 1S4EA 2FVCA 5A2QO 2PY5A 2EFQA 4ZP6A 1GH8A 3MZIA 2DNYA 2IS3A 4H8KA 3NS7B 2WW8A 4CLTA 3OYNA 2J9CA 4JK8A 4OJ1A 2OLWA 4DZ6A 1WSVA 3RSEB 3KWMA 1V5IB 2LA4A 2VPYB 2BXJA 3QB0A 1NU0A 4TXSA 1S9EB 3RMDA 1XNRK 3WX8A 3CDWA 3C3LA 2XYPB 1QE1B 1S22A 2KHOA 5AQLA 4ZVRB 4F36A 2J6TA 4P2XA 4DB3A 3TARA 3JSMB 2QSWA 3CJRA 2A18A 2ATQA 3DRRB 3LO3A 3LPEA 4X66K 2HNYB 3W63A 3WQUA 3AO2A 2W42A 1AT1B 2E7VA 2M52A 1X5PA 1RT4B 4K0KF 2VHGA 1JIHA 3CDUA 3QGIA 1U7LA 1REGX 4DQPA 5KFUA 1KOHA 2CPDA 1RYSA 1IBKF 1RT5A 2BBEA 2CA9A 1UVKA 3BPDA 5BYRA 4BRKA 4LT6A 1ZETA 3FZFA 4CJFA 1H2VZ 3J81O 1EO1A 3JXUA 2QYCA 5GAHU 3VERA 1I51B 1I94F 4KKOB 1ICEB 2RQKA 4DDFA 4HKQA 3V6DB 1DGKN 5LMNJ 1VOMA 3DXMA 2BUNA 2FHKA 2VONA 2WONA 3SMPA 2OFHX 3HPOA 1JNZB 3VAKA 4RW7A 1K9MT 3W3SA 2HQFA 4KHYA 3BO3A 2HHHF 2O8DB 2XS2A 4I6AA 3LTOA 4CIGA 2K1RA 3WXLA 4AM6A 2VA2A 3MAAA 5HAOA 4HCCA 2P9KB 4BWMA 1VQKS 4DU1A 3PJXA 4J7CA 3UQSA 5AQHA 2H4WB 3KHRA 1U1KA 3OR2B 1IR1A 1YAGA 3EPIA 2EVZA 5KOXA 4KH4A 4DV6F 1NK6A 4L3NA 3C8YA 2OP5A 1Q8BA 2Y9HA 1VC6A 2FBXA 3MWTA 1S1VB 1X9WA 2Q0RA 4RWTA 3C95A 4DFMA 2E2PA 2QA4S 1GLFO 2V6AA 3QAUA 4ISGA 2RT3A 4ZP7A 5KFIA 3CMQA 4F4YA 3QNWB 1ZBLA 2MGZA 1FDNA 3VHQA 1NPPA 1JB0C 4NA3A 5F8MA 2E2QA 2RD5C 2DGQA 1H74A 1M5KC 3QRRA 3UKRA 2VODA 1DURA 3R2CJ 1W0HA 4P71A 2APOA 4Z4IA 3FLCO 1EX4A 3K17A 1IR2A 1CULB 1YJ7A 3WNEA 4NXNJ 5AE3A 3NNCA 1IKYA 2P8IA 4DTSA 2CNNB 1RBAA 2CPJA 2I38A 3S6EA 3PIPL 4DPTA 5RUBA 1WF2A 2V8DA 4DV7K 2FJDB 4YY3F 4BRQA 5H9EK 1EHWA 2KXNB 1TUWA 1OSCA 1HNIA 1LOTB 3JQJA 1RWWB 2YKMB 3ZSZA 3GYGA 1Q78A 3AAPA 4NCBA 3C0BA 5K8NA 4DPWA 3FEXB 3G8SA 4NCGB 2Y1RI 3IMXA 2VBXA 4TQRA 2OD4A 1PCAA 1L5UA 4H0VB 2V4QA 2ZQBA 2VGNA 3CIZA 3SQGA 2JZ5A 2J6UA 2P1JA 3NWRA 4RNMA 2BJ7A 2O67A 1BHNA 3UDVA 4PG5A 4BGBA 3U9DA 3MECA 4CJ4A 3MR7A 1K1QA 4CEDA 1Z2LA 4OZ3A 3GV5B 8AT1B 3OYJA 5GADU 1U1PA 4FLVA 3TAMA 2XWXA 1NAQA 3VF4A 2LU2A 1VQKN 3J7AP 1Q86O 3DLBA 3R97A 1CBKA 2V5HG 3NVKA 4UT4A 4DR1F 5AQQA 4M3RA 4CK2A 4QOZB 4UOGA 4CZFA 2BM0A 1D9DA 1RT2A 2V68A 4F2RA 1RISA 2EK6A 3V9XA 4EO6A 4FWPA 2OEKA 1R8HA 2HQCA 2A0FB 5ETQA 4DPUA 4K7QA 1X4AA 2XEXA 3M6UA 4IKFA 4OKEA 2F9DA 4E1JA 1QVFM 3TZYA 5HROB 4MIWA 4W90B 1WKLA 2R7QA 5J2PA 4LFBK 4UY85 2O8FA 1AW0A 4NLTA 4C0BA 1SBRA 2ALZA 3M8SA 4CNZA 3QRQA 1LWCB 3DLLL 2RU9A 1RWVB 3TVYA 2IC3B 3NY0A 1U8SA 4CCHA 1V4SA 2VGMA 4WF9Q 1GLLO 1NG9A 3QLHA 4Y2KA 4HHHA 2MY7A 2HWTA 2EBGA 4MDAA 2ATLA 1SV5A 4P6QA 5EX0A 1RKJA 2I9SA 4GO7X 2XTJP 2GO9A 4EP5A 4CYUB 2QWLA 4H5RA 4YDUA 2VOOA 2J5AA 2FBTA 2ZBPA 4PEOA 3MUMP 1IKVA 4TN2A 2VG6B 4YHHJ 2E88A 2ZH3A 1FK9B 2IHR1 3EWGA 3MN6A 3CWJA 2DGUA 2M8DB 2W8LA 3ZT1A 2GA7A 1QQCA 1T6DA 1JJCB 2O66A 2LDYA 2ZITA 3HSDA 1PBUA 4FLYA 4CRJA 4DR7F 1GNKA 3TUZC 2ZOMA 3IBCB 1FO1A 3GONA 2A1SA 1NZAA 2KHDA 4KB1A 3IS9A 4O4RA 4P2FA 1DQ9A 4CECA 4MN4C 1Y3KA 3BZCA 1VIOA 5CHCB 1HRHA 4X64J 4DR5K 4ECWA 2B4JA 2P9GA 1TVRB 2JNJA 1TMMA 3K0SA 4NA2A 2D0PA 2NXCA 1B4SA 3LP1A 3BYPA 4FK0A 4DV1F 3I5AA 3LQVA 4IBNA 3VGKA 4FJGA 1S48A 1BISA 3HSGA 4URSA 4FWKA 4HACA 1ASVA 1Y9OA 3O4QA 2FSNA 3KK3B 4P73A 1N32K 2EPIA 1JL1A 4M5DA 1L3SA 2P9UA 2OIHA 3DMJB 4HLBA 4URGA 3H5YA 2BTFA 5B0AA 3W3DA 1XNQF 2YKOA 4Y2IA 5CZXA 4H0OA 1LWXA 4PXCA 3TSPA 3VQPA 2OZMA 3CGIA 4AFFA 3IWXA 3CC7N 3KHLA 1WD6A 2PAVA 1HQEB 1FFWB 4BR4A 1X4EA 5B7WA 1LWEB 1EQYA 3TUIC 2LECA 2FGCA 3LGNA 1C0GA 1EETB 3GE9A 4LR7A 1NSQA 3AOBA 3L3UA 1AZSB 3HFKA 3UNGC 2QMWA 3VEYA 5HJXA 4OYOA 5K20B 4RTFD 4J90A 1VQMN 1WTFA 1VRUA 5KI6A 4IJAA 4DUYF 2KQ2A 3QGHA 2ZH2A 3K8WA 1BUXA 1C1BB 3G6YA 2MMYA 1V9OA 2JEIA 1D8ZA 1DARA 4ZN3A 3EN9A 2PEHA 2R2TA 2OH2A 1FRJA 1S0OA 4EYIB 4CJKA 2L08A 3VQAA 4EMDA 5DDOC 4I67A 2UP1A 5GAHI 1HR0K 3PDNA 3O1LA 2IOCA 3VQ5A 3EKUA 3FBCA 3A3OB 5KT6A 4TNOA 4QIFA 5C25A 1KXPA 2QL5B 1X7VA 4FKYA 1UAXA 1V3RA 2XS7A 3DOKA 1S12A 4LSNB 5B0EA 3VGTA 5ETVA 3MAQA 3AD7C 1ASUA 4K4XA 2KH9A 1RZMA 4O5BA 2VF3A 5KGXA 3WC2A 1I6JA 4NXMK 2QFJA 4C98A 1BWEA 2CJKA 4Z4EA 5LJ5Y 4YOYA 1VC0A 1Q16B 2B3TB 4KPCA 3MI7X 1KVAA 1RB0A 2YKPA 4O44B 2W4DA 1RBOB 2CGLA 4YB1P 1FKOB 1QHTA 2Q3SA 2VWJA 2PFDA 2W6KA 2BACA 5B0CA 1DRZA 4AE5A 3GG0A 1YX2A 1J5OA 4KH5A 4KGMA 4DKWA 4YN3B 4FVCA 1G15A 2GBZA 3MTJA 2BA9A 1T9YA 1ZTTA 3AO4A 2G2OA 2VQEF 4TYBA 1PAUB 4RX6A 3SNNA 1JJ2R 1P1LA 1IKWB 2RRAA 2VPXB 4JI2J 2BGGA 5C0YA 5D0GA 5AQVA 1HWKA 2CJQA 3T1YJ 4GKKJ 1S1WB 2Q1NA 2PO4A 1PJ6A 4CW7B 5IWAF 4A2AA 2HHXA 4G9ZA 2VL1A 1IJEB 2WVBA 4EBCA 1QTNB 3A5NC 1RKIA 3JYTA 1Q82O 3KLEA 5KFWA 1QZ5A 3CJ5A 2Q36A 2GEMA 3DU6A 1YJTA 2VG5B 3OYKA 2ZZNA 3AVKA 3HD1A 2BW7A 4DV0F 3ZTPA 3OBIA 4USKA 3LW5C 5LOQA 3KOAA 1P9YA 4CJ3A 1UVLA 5GADI 1FD8A 3LUYA 2E6LA 1JLAB 4DR3J 3DLHA 2GHVC 3IC1A 1H7WA 3BYRA 1HPZB 3K58A 2AGPA 2WC9A 2V2ZA 4UY8O 1N33K 1I5OB 5JMNA 1S9GA 2JWKA 3MCPA 3ZT3A 5CA5A 5KFJA 4X62J 3GJTB 2RUGA 1WSEA 3U1NA 4WFYA 4WKRA 3K9KA 4B1VA 4DV5K 5LXRA 2DY4A 3SBGA 3CIPA 4NOHA 2JSXA 3V9UA 2YWGA 5F8LA 3BV8A 1RSCA 3KHHA 2PFUA 2EI5A 3FJ2A 2V2KA 5L1JA 3OYIA 5IM0B 2VICA 2NRZA 1VFJA 1PJ5A 4FYXB 1UCNA 5LJ3Y 3QAEA 5E2QA 5DM7L 2B8QA 3D6HB 3B6BA 3NAIA 3DLEB 5BYQA 2UUCK 1NJXA 1W9HA 2ZVSA 2ZC3A 2P9NA 3I0SB 2R2SA 2ADCA 1QUPA 4WFBQ 1YRUA 3Q0AA 5DZ6A 1PC5A 1VQ9N 2BRKA 4PXBA 4BVOA 2M88A 2X3DA 4NRUA 3TTCA 3CJBA 4EBDA 3TA1A 2IM1A 5JXSA 4CJWA 4AXIA 2GMHA 3V6HA 4J9SA 4B3RK 3CCWA 2HSEB 2O8BA 4FJHA 3P1GA 4DLGA 2V52B 3UO0A 2HFOA 7AT1B 4B9NA 1SJRA 4M1KA 1RHRB 3I0RB 3ZSOA 3A8YA 4L8RB 3JAMU 1YITS 3DM2B 4P9SA 4Z7CA 1TTHB 1TUGB 4JI6K 5KT7A 3VR1A 3I32A 4IQMA 2RS2A 5F8JA 3SIPB 4XPEA 1B99A 3S7RA 4M45A 3PO5A 4ED1A 1CJKB 3ZXWA 4U9RA 1S7HA 1PGZA 3PJWA 3SZ2A 2FLPA 2MKCA 3ILLA 2P5GA 4B3SF 1VSJA 5HP1A 2HHQA 2MPUA 1EZZB 1F21A 4CF1A 3NBPA 3ZSYA 3ZTRA 3N6NA 1CC8A 4JI3F 2F63A 2J76E 1KHVA 2RF2A 2EG2A 1KAXA 3M5RA 1Y97A 1Y11A 4S0MA 4OLPA 1SS6A 3MCAB 3L2VA 2BMBA 1HQUB 2W2PP 1WSIA 4FJ8A 4EK2A 2VB6A 3ZZUA 4B3TK 4H4OB 2C3OA 1Q5VA 1BWFO 3EVOA 4ZA1A 1JWWA 3MR6A 1U26A 3DLRA 4FJ9A 3MPYA 3R3LA 2XSJA 4F2SA 1O1WA 3ENBA 3BBBA 2HMIB 4NLRA 3OTBA 4LIRA 1GQEA 4DUZK 1REVA 3TP2A 2FHJA 4DX5A 4DR2K 3HVAA 1URNA 3ZSRA 4FNIA 3TAQA 3ENHA 4M5LA 4DWIA 3MEKA 5AQIA 3I9ZA 2AD9A 3RBEA 3J81j 4FWLA 3HHEA 2V7ZA 1GK8A 4PYDA 2Z56B 3QT6A 3TANA 3DOLB 3MWPA 3M2VB 3IP0A 1NBEB 3KNAA 2HFUA 3QFPA 3CCVS 4QW8A 1P9QC 1ZYQA 4KGKA 3BSNA 5BPNA 3KUGA 5C12A 2ZEJA 3GV8B 3GCXP 2E66A 1RABB 3M32A 3M30B 1YITN 4MO5A 4BLGA 2M3DA 4X2BA 2DHHA 2J8AA 1YI2S 1C6VA 2CKWA 3NGSA 4QPTA 4DV2F 2DCLA 2DNPA 2NNWA 3AVBA 4LD0A 1FD2A 4CNYA 4Y2AA 3LP2B 4OLBA 4CH1A 4AILC 5DG8A 4KYZA 4OPHA 3N6MA 4QJVA 1UVJA 3T1HJ 6FD1A 5KAKA 1NHKL 2BABA 4OZNA 3G6EN 3B6OA 1U8WA 3H45C 1YXQA 4YR0A 5CYQA 1QTMA 1VDHA 5ETRA 5AJ3F 2E20A 4PWUA 2Y1IA 4CF8A 5MLCV 4DPYA 3D1QA 2FVSA 3W9HA 1WF1A 3EUNA 5AQTA 2GMJA 5E3PA 3DLKA 2W8KA 4XH5A 4IG3A 1X8DA 1NOYA 2AU0A 4RW4A 3HI0A 3SSQA 5KG7A 4TLQA 3BQ1A 3QIOA 4LF7J 3QNNA 1W2IA 3SPZA 3V4MA 5T14A 3RJMB 2LYVA 2NCKL 4R25A 3MEEB 3SI8A 3ZNUA 4ZPVR 2IPOB 3RRHA 4RW9B 5A6WA 2OMOA 4CJPA 4DSLA 4ZVHA 3PR4A 4ZHRA 3E01B 4C97A 2LEBA 4E3SA 3CJKB 4O3OA 2QW9A 3SDEA 2CPZA 3U7JA 3WUHA 3O2IA 2F3JA 4Y0WA 3QICA 3ZZZA 3PKYA 1F0XA 3EICA 4L76A 4ZVOB 4URQU 3CXCM 1VBZA 3CCVN 3QEIA 1LXJA 4PG6A 1BGXT 4C48A 1FTCA 2VWBA 3BO4A 5ETOA 2AJ4A 3LDQA 3MURP 1K9MO 3CJCA 1WDTA 1OWXA 1EP4B 1C0UB 1NPRA 4HR2A 2B5JA 4U8YA 4LF9F 5FLXU 2PA3A 3B4MA 4KGZB 5BR8F 1YI2N 2HNZB 3H5UA 4CZCA 4WFAL 5EU7A 4FPBA 4B3MK 4DV3F 4CH7A 2H5EA 3GJQB 3TEGA 5KFEA 3OR1B 1JLGB 1M1GA 3VA3A 4JI1F 1DTQB 2I8EA 4EGLA 1EARA 5CCMA 4WFXA 5CE3A 4H5WA 1SVDA 3D6MB 2HVEA 2W2MP 2VQFF 3N5FA 2BM1A 2DHGA 5JS1A 2F9TA 1QAYA 3MM5A 4ES3A 1X3NA 1KQFB 1X31C 5F0XA 1A0OB 3AO1A 1U45A 2B4UA 3V9WA 3MF5A 1WOOA 4USVA 2Q6BA 3A0IX 5EX3A 3OTOK 4X4RA 1BDGA 4JD2B 3VEWA 4OLAA 3H6EA 1NWKA 3NGDA 3NVMA 3TZWA 3KLFB 1SPBP 4IXCA 5K8PA 4C3KA 3VA0A 2HZAA 5ADXH 2RSQA 4GC7A 4OX9J 3CFOA 3BN4A 1AUSL 2GHPA 4A5BA 4OZ0A 4LFBJ 1NKEA 3SXLA 4Q0BA 1AUDA 4DR4J 1WORA 4G65A 1JMTA 4DR6K 3UPFA 4GNIA 4FJNA 1FEEA 1TKXA 4H5VA 3CEDA 1C0MA 4KQZA 4Q43A 5L9NA 1H3DA 2IJFA 3FR0A 4JKEA 2ZWPA 2OPPB 2EKYA 2LLZA 3US5A 4USHA 5KFTA 2P9LA 4MO4A 1U6BA 2IRXA 5L46A 3MFIA 4PKHA 1ELOA 1KFDA 4USMA 1YTUA 4GVEA 4NA1A 3GU0A 4LBIA 1SUQA 3CETA 1ZOTA 4DU3A 4X65F 4E89A 2IBOA 1CS4B 2V69A 5M1OA 4LFAJ 4GVLA 5KFFA 1XR5A 5DM6Q 2ZVIA 4LFCK 3W5XA 4M63A 4NZ0A 1R43A 4FPIA 4H54A 4DL0C 2IYGA 3NCIA 1RLDA 4J2BA 4V19X 3KLIA 3CD5A 1MA9B 4NLVA 2QXLA 1RTIA 2IA0A 2YNFB 4LF6J 1GLBG 4FWMA 1FDBA 2ASOA 3NG8A 1R3NA 2CPEA 3ZZTA 3L3VA 3OPKA 2ZM6K 5CQGA 5JICA 4DR5J 3PW2A 4CLFA 2K3IA 5KT4A 1L3UA 4U67Q 2XI2A 3R9PA 3HF5A 4JNEA 4MMOA 5BYSA 4QOTA 1MLAA 3WIVA 1CG2A 3H20A 4TVAB 3ZT4A 2R7VA 2D4WA 5CZ1A 2ZUAA 3EL2A 5K14B 3DOMB 4E1MA 5KG5A 4Q7AA 4RUAA 3THVA 5AFUH 3K5LA 3AVNA 5DETA 2R7UA 3EY1A 2HQ3A 4KT0C 1BD6A 3AD9C 2W9BA 4TQSA 4DF4A 4DFKA 1FEHA 4YR2A 3V6JA 5J2QA 3IFEA 1GX5A 5KFRA 2K3KA 3QMLA 2POKA 3J80U 3GWCA 3MK6A 5HRSA 5JMVA 4F4ZA 2D0BA 3KKSA 1NGEA 2FVPA 3BZKA 1UEUA 4RW6B 5AQFA 4H4MA 4F8RA 2XGQA 2J6SA 3AAQA 4XDCA 5ELZA 5C24B 3FGUA 2IAJA 4DN0A 1N56A 3AJDA 4C2MA 3PIOL 2CWKA 1NK9A 3IG1A 1GMVA 3A8KA 3DLJA 1RTDA 4A2BA 1BI4B 3EKSA 3WEEA 3HPGA 4JKBA 2LXUA 4OI3A 5EOYA 4C8MA 4FM0A 2A1RA 1VQ8N 4KH0B 4B9SA 1Y10A 3NOGA 2NQPA 3OY9A 1XBWA 1NB7A 1HR0J 1XMQK 4KB7A 2BKPA 2C42A 2Q97A 4CDIA 4QIWD 4DOZA 3SAFA 1PYSB 2XS5A 2J8SA 5J2MA 1U0HB 3V9ZA 5AQRA 2J7WA 1UPMB 2DT9A 2XB2D 5BR9A 4RU9A 4WIQA 5IT9U 4CT8A 4KI4A 3JS9A 4LRCA 3THTA 1VHXA 5KFXA 4AF1A 2FHJD 5M1QA 3CQXA 4K4YA 2QLJB 2LP4A 2RDJA 4CZLA 2DPIA 3KYLA 2EX3A 2WRMA 5A8WB 3CCQS 4KHPK 2OI2A 4AH9A 3O5TB 3GIJA 4NXMJ 2B6AA 3C6TB 2E9RX 2ROGA 4O0NA 1FJGK 4G3IA 1HIYA 4CGHA 3MMCB 4LF1A 1YTYA 5T7LA 1NUEA 4TY8A 1EKSA 3ALYA 2KM8C 3ENOA 4ID1A 1KLMA 1CZAN 3IR7B 4ES1A 5I3UB 1WN7A 2YHYA 4CP5A 3WZ0A 3CT9A 2UUBF 1FNOA 4JV5K 2JL9A 3L7UA 1ZM9A 1WEXA 3HVWA 4IEIA 3DYAA 5CHIA 4B3OB 4BREA 3VZIA 2W7AA 4J9PA 3VVUA 1ZBFA 4E0DA 2GIQA 5KGWA 2P9SB 1NDKA 4I6MA 2KB2A 1CJTA 1YT3A 4ED6A 3MM7A 3OW2M 5HL7L 5KFCA 2C2RA 1FNMA 2LEPA 4JYAJ 2F5GA 1JLFB 3D6FB 5AXMA 2NLWA 1H2TZ 4XPCA 2UU9F 4ZVQB 4DL7A 2DCUB 3P38A 3M8WA 3SQ4A 9ATCB 1FHTA 2VU5A 3L8BA 5H1SQ 1UA1A 2AP6A 3Q23A 1CLQA 4ED2A 2XO6A 3D6RA 1S6PA 5KFNA 3VEXA 4YEAA 2DFEA 2MZQA 1FKPA 2OSQA 3AVGA 4NYPA 2XGPA 4CIEA 4PG7A 2R4FA 3BQ2A 5KFMA 3JSYA 4GW6A 2AW0A 2HQDA 2G1HA 2HNDB 1TR0A 5JUMA 3ENWA 3SSSA 4ZIVA 2QK9A 4KFBA 4KREA 4H0PA 5AZJA 1YVUA 1UOCA 4DV5J 1UJ4A 3ZX2A 1K8AT 3K89A 2A42A 3PIPQ 3VAJA 1C4CA 5HQLA 2CUYA 5CY4A 1OYDA 3QGGA 2DH7A 1HBNB 2AJ0A 3M6XA 4JI7J 4LF2A 5K9FA 1UW4A 4JKGA 4WU2A 2GUIA 2RQ4A 2UXBK 3G82A 2KLAA 3KTQA 3NMAA 2UUCJ 3B8AX 2I2YA 3BR8A 3H25A 2IM3A 3QT7A 1T3NA 2XBPA 2E5LF 2H5IB 1NOZA 2P6SA 2K2PA 3Q8YA 1N5YA 1X9SA 3QFUA 4K4SA 3IBFB 3RMCA 5IC4B 4AHSA 4CERA 4Y1DA 4HUGA 3IR5B 4WXOA 2KN4A 2FZKB 3SBMA 1H73A 4ID5B 2HG4A 3ZX3A 2D9OA 3VAFA 4JKCA 3PVXA 3TA0A 2E9TA 4ZLNA 2HBJA 3HHLA 2PYLA 4ZJLA 1SZ2A 2Q6CA 2V50A 3CJ0A 1RCXB 3BSCA 1TUYA 5D78A 2B9XA 3I4HX 4DL3A 2ZHOA 3CB4A 5LSRA 2GJFA 4JI6J 4GKJJ 2RNEA 3CC2N 3DI6A 4JI8K 2WVFA 4UOFA 3G2XA 7FD1A 2YWHA 3LPTA 1PG5B 1HX1A 1VLYA 3RMBA 2V2VA 3WQPA 4JI0J 2HWHA 1SKWA 3IM9A 3AA8A 4J2EA 5A0YA 3MM8B 1D0EA 3I55S 2HBLA 2B56A 2HF3A 1S1UB 2ZE2A 3AB2B 4H0YB 1J27A 3IO1A 1N0VC 4X4PA 3VWSA 4OL8A 4LR9A 4CBUA 2OPSB 3O80A 1QQOA 3TJ9A 2B9EA 3IAS9 2AYEA 1F2HA 4IG3B 3OLBA 3RB6A 1D09B 2BJ8A 1HNZK 2XMAA 4DTUA 4B3TJ 4NLQA 2Z2MA 4AHVA 2CAJA 2F4VF 1NKCA 1MU2A 5ITHA 4FK4A 5ADZA 1JLQB 3HOSA 3AB4B 2NR0A 1HBUB 3BJYA 3CO0P 4BQZA 3FCHA 2QSFA 3LDSA 4FLXA 1TFYA 3IM8A 3GCWP 3ZCMA 9RUBA 1GEHA 4ZCMA 2XLIA 1JLCB 1C0FA 4F02A 1HBOB 4WIIA 3VQQA 1VQ4S 4ZJOA 2P9IB 1WG4A 5FLXO 3EDQB 2ZWOA 3FGVA 1EKRA 3CPWR 2P51A 4IFVA 4EI2A 4CJTA 3M6WA 1XQSC 4A47A 1YF5L 1NHUA 5EHHA 2YQ1A 2LXFA 2Q0UA 3DGPB 1XNRF 2FTRA 3R3TA 1VC5A 2HOEA 3EO3A 2RQCA 5LSLA 3TYTA 4I2PB 3ULEB 4LH4A 3NH2A 4HVZA 1GLDG 1DTTA 1ZM3A 5GINA 1HWIA 3S41A 2FJAB 1WOQA 3OS2A 5FIIA 1HA1A 1HYSA 3DDNA 3QO9A 5M2PA 3AVFA 1VQPN 4DSEA 1RUSA 1S1TA 3D4JA 1S6UA 3FZKA 3TTFA 2FBYA 4C11B 4X66F 2BUPA 5KFGA 5GAEP 3BS9A 2MQOA 1BG3A 1FXRA 1UFWA 3F73A 4O4GA 4A8KA 3QZ7A 2CZ4A 2G0CA 1YBUA 1HBMA 3I55N 1AXQA 3SI6A 4NASA 5AZIA 2H5JB 2KO1A 1Q81T 4I4BA 3KLHB 2CPIA 3X1LB 4GO5X 4NLWA 1RT7B 2ITMA 4ZK7M 1XN9A 2UXCK 4FM1A 3P39A 2OKQA 4DX7A 3DRSA 3E51A 3KK1B 3TABA 3C14B 4HUFA 1QLNA 5AXLA 1J6ZA 3D2EB 4C0OC 2JX2A 4AT1B 4DV4K 3ELHA 3VESA 2WK4A 3GIKA 1JLEA 2FXUA 3MR2A 4RBVA 2IMWP 3W61A 4PRFA 4ZMMA 3AJ2A 1BQNA 1OO0B 2GTDA 3QINA 3LOUA 3QZ8A 3EXCX 2YY3A 3I56N 4K59A 2OTJS 1NK7A 1YG0A 2YNHA 2VH7A 1VBXA 4YB6A 3OL7A 1VQ4N 2G8FA 1VAZA 1HD1A 2JEJA 2FLOA 3MDFA 3JS6A 1HNVB 4PG4A 1KWMA 3NF7A 3OYLA 1LKZA 4OYBA 4ZCLA 2NS1B 2GQ2A 4OKKA 3OL6A 3VQ7A 4KHNA 1IUJA 1WKKA 3ZZRA 2ROPA 2KW4A 5T7BA 3G6VA 1AFJA 5D0EA 1GMWA 2Y8WA 2RH3A 4LQ9A 1U49A 3OYFA 3BEXA 5DRKA 3DCAA 1X4DA 1CJVB 3OTDA 4PPZA 4NI2A 3TR8A 2BQUA 3AO5A 4YOTA 4CM0A 2D0CA 4PXDA 1T11A 2HGNA 1RT1A 3AD8C 4DV7F 1YRTA 3LAMA 2A40A 1PYOB 5EWEA 3OYEA 2KKHA 1UETA 4KGVB 4A8SA 2DK2A 4XTTA 3B6PA 2SXLA 2QGFB 4N7TA 1RU1A 3J80O 2OA8A 4RNNA 3CD7A 3HD2A 1WNEA 1VSMA 3PKMA 1RACB 5HLFA 1UZDA 2YHBA 2R2RA 5LMNK 5HANA 5M1PA 4MKBA 3K5PA 1BA1A 4HH1A 3OFEA 1FVSA 2RRNA 1HKCA 4NLPA 4JLHA 1S6QB 2M9KA 5J1NA 2UV8A 3CQ8A 1B7FA 4R8UB 1IBMF 2D1CA 1MWQA 1T05A 4XH4A 2CPXA 4NYOA 4BRIA 1U4BA 3NMRA 2DH8A 3W62A 4NLYA 2R3VA 5C2CA 3MM9A 1X4HA 4DCOB 1ZS6A 5I4MA 3L7OA 1S76D 4TLRA 3DLGA 3QSIA 4RKUC 4ED3A 4E7LA 2A6MA 1NGIA 4IFYA 4JKAA 3F0NA 2GVZA 2HFVA 1K8KA 4ZPAA 1SH2A 1U1MA 2NPFA 1ILYA 3JQKA 3ZYYX 4OHWA 4HHUA 1N88A 2XNQA 3VENA 4Q44A 3RSEA 4LQ3A 3MEGB 3PX4A 2KM8B 5IT9O 4LFCJ 3FZHA 3OL8A 3VEVA 2NLXA 1S9EA 1H72C 4NXNK 2DGXA 1K0VA 4OV6A 2E1PA 2OTLS 4JS5A 1QE1A 4KRFA 2KG1A 3GZ7A 3H08A 2AGQA 4IR1A 4N76A 1KRPA 4B1ZA 5KOWA 1ZZFA 3HFVA 2HZVA 3JSMA 2DNGA 1YWXA 3D7EO 1GOBA 2R8JA 2MKYA 3DRRA 1TYQB 2C2EA 3VAHA 5DM7Q 2FD2A 1KTQA 3ZEUA 3BGUA 1U25A 2HNYA 4IH7A 4WQ4A 1RT4A 3IFRA 1TKTB 1GLAG 4TYAA 1IQTA 1JX4A 4GV6A 1VLOA 4U7UK 5KFPA 2FSKA 1HUXA 2UXDJ 2QWOA 2C2DA 3J7YP 2EHGA 1N34F 3ZZOA 3O9RA 4YOUA 3U4LA 3ZC4A 3FE1A 4K2XA 2AGOA 2Y3YA 1ZAXA 2IAJB 3VQ8A 3BEGB 3VGUA 4KKOA 3R1HA 2LU1A 2Q79A 5D77A 2FC0A 3V6DA 2YPYA 3J81U 3TRGA 1E6YB 5FD1A 2BR0A 2W9CB 4JI5J 3MCMA 3R8YA 2O8DA 3I5BA 4MLEA 4JKDA 4F0HA 2DD8S 4ZIWA 1T0TV 2FYXA 3DAWA 4WQ4C 2E1RA 4QYZK 2P9KA 4PYAA 3CDBA 3N0VA 1CZ9A 4J9MA 2R7XA 2IFXA 4ZVUB 4HDGA 3OR2A 1VK3A 1N32F 3FSXA 4QR2A 4F4AA 4BR9A 1OH6A 1DZ5A 2IVNA 4WP8A 5LM7E 2V4JB 4OYAA 1S1VA 4BWJA 5DGBA 3M9OB 3RVCA 4Z4CA 3HHDA 4L3KA 4PWDB 3HVTB 4F3MA 2E29A 2CH6A 4J2AA 5IQQA 4CO1A 2CQGA 3HJFA 4USTA 1G7CB 3BZQA 2PC6A 1LW0B 3LH2S 4AL6A 4OPJA 3CJ4A 1FE4A 4H5NA 3J7ZT 1VQ6S 2UUAF 1LQ9A 1JQGA 1XC9A 1G99A 4NZ7A 1WNSA 4F25A 1CULA 2YHXA 5B0GA 4OPKA 5L38A 2OUGA 1IG9A 3TAPA 4OZJA 4K8ZA 4A8WA 3OTCA 2YX7A 2HHWA 3GSDA 2L3MA 2YKMA 1WACA 3IKMA 4IDHA 3ISZA 2OPQB 2DR7A 3F5TA 4A8YA 2XMJA 4NCGA 3K5MA 1CQMA 3N5BA 1FJGJ 4FNHA 5JVHL 4WQ5A 1HR0F 3PX0A 4FYYB 1CXQA 1VQ7S 3FK4A 2W2NP 1NHVA 3DXKB 1VBYA 3D5MA 4FWNA 3DRXA 2H4YB 3ISNC 3IBPA 3A4TA 1I3OB 1XK8A 1HYZA 4XAKA 5DZ7A 3H1VX 1OPIA 2CVEA 1NJWA 2O1PA 4X64K 2GAHC 3GMGA 2ZH4A 1M5VC 3N9UC 1O8BA 2RVJA 1N4LA 2ZGYA 4OHYA 5B0BA 5I42B 1RE1B 1U0SA 3O9UA 3FBFA 4KHUA 2AJ1A 3CF5L 4DU4A 4B9LA 1VQLS 1F6TA 2BQRA 4CJEA 3FUYA 4DX6A 2MKHA 2V8GA 2D3OR 1UVNA 2NREA 1WB9A 2CQ4A 3OQ2A 4WQ5C 3IRWP 4ANCA 3QRPA 4QIEA 1GMUA 3QWUA 1NMDA 2G8VA 1VBKA 2V8VA 1RFQA 2Q43A 5IS2A 3I9V9 2G8KA 2UV8G 4M7YA 4WCEL 2E5IA 1KFSA 2C28A 5A2QY 4RNFA 2MKIA 4CEQA 3TAEA 2FGOA 3O44A 3C2PA 3O3LA 3X3UA 2DNRA 1LAWA 2CG4A 1VSDA 4C1NK 2NRRA 4OMFG 4Q2LA 3R5BA 3CDAA 1YBTA 3SFGA 4Z2XA 1HNWF 2ZKUA 2LKZA 1F5BA 4ER8A 1LWCA 2GQCA 2I0XA 2QZ8A 2IC3A 5M2UA 1TZ0A 3RW6A 5IV4A 3KJNB 1NZ8A 3PLAA 1YZ6A 3T41A 3EYZA 4ILLA 2PIIA 1K0TA 1NMEB 3PSIA 3G71S 3LGMA 1BMQB 3HKZD 2B43A 2VPWB 2ZOFA 2WOMB 3MMJA 3HLUA 3RR8A 2W4CA 4DXLA 1HNXJ 4CYUA 4ZVSB 4GV9A 2BANB 2XMUA 5FJ4A 1QSLA 4HT7A 4CLYA 3TWZA 3V6KA 3MCOA 1VQ7N 2VG6A 4I2QB 2R7YA 2CQ3A 1FK9A 2YBVA 1T6CA 4H4KC 1RAIB 1R6YA 1XWLA 5M2RA 4CTAB 3IRXB 1Q1KA 1N33F 4FJKA 4M5HA 3CCMS 1G3OA 2OMLA 3CMES 4BRLA 5AE1A 3PO4A 4ALZA 2P5OA 4CJVA 3RGIA 3V4IB 1TVRA 4WFAQ 4CQ1A 3ULHA 3M2UB 4F67A 1XMOF 1IWAA 4KHWA 3EJMA 2Z2YB 4K43A 4RCHA 4EO8A 3FBBA 4DV1K 3KK3A 2GNKA 3CM6A 1VQ5S 3DMJA 4C8ZA 1B0VA 2G0JA 2BE2B 5E3RA 4W5RA 5KG3A 1YJWN 2RAQA 4ZPBA 1RWMB 3CYMA 3VQEA 3I4PA 1BCOA 1P1TA 4LSZB 1XNQK 4ECZA 2AYBA 1HQEA 4FPAA 1S79A 4NLUA 1LWEA 3KUHA 2HHSA 4B3RF 2MQLA 4HWIA 4GKKK 1H1VA 5EY4A 1K8AO 4NLDA 4CEAA 1X4FA 2FF6A 2PMWA 1RU2A 1YKWA 3U27A 4B9QA 1EETA 3W7BA 2UZAA 2IVMA 1B9DA 1MMDA 4AUKA 1IBLF 1UVIA 2AA4A 1AZSA 1KAZA 3ENVA 5LSOA 5C2FA 3G71N 2YWEA 2BKOA 3VZHA 4PUOB 4C8KA 3DWLA 2ZJPQ 1T94A 4LF4J 2PN6A 1GOCA 5JVGL 3CCUN 4KHQA 1C1BA 2RMLA 2V8HA 4Z0UA 2J0WA 3C66A 2CJXB 3ICLA 4A46A 5D4NA 1YJNN 2ASJA 3SLCA 5LMUJ 4P52A 2XY6A 1KSPA 4ECXA 5AQKA 3WXMB 5KFSA 2WTUA 4DR3K 1ZBSA 2AX1A 3K57A 3OHAA 2W2QP 3MPDA 1PC4A 1VISA 2KFZA 3FQKA 1WC6A 4YP3A 3RB3A 3CCMN 3OD2A 4X62K 4DCHA 2GS8A 2DIUA 2DVIA 5IQ6A 3CMEN 1TFWA 4MK7A 3LAKA 4V19S 4EZ9A 4B3TF 3D1HA 3SMZA 3BF4A 2FJWA 2ZH7A 3QPIA 2IVFB 2GX9A 3BPSP 1KKHA 2YH1A 1NGCA 2KU7A 2W2OP 2DY9A 2M70A 4PR6A 4ED5A 4LSNA 2YTCA 4LVOP 1S72N 1NH7A 2KYZA 3E9OA 2HS3A 3L4QA 1VSHA 4IZ9A 4DQSA 3NGTA 2I6WA 1WAJA 3AT1B 4DUZF 3FMWA 1Y4ZB 2M7SA 1E6VB 4DR2F 5CD4A 3AVCA 1ITGA 3GP9A 3JSRA 1YDLA 2OCEA 2N4DA 4FBTA 2QA2A 4NYZA 5HRRA 1VQ5N 2BVZA 1D8YA 2JFKA 2Q2RA 4CZKA 2W1BA 1K73O 1NNEA 1J54A 1WAFA 1PJ7A 4DBQA 4O44A 3UR0A 1M90O 1TKZB 2Y0SD 1FKOA 5GAGP 1BQMB 5GAEI 4JHDB 1OH8A 4QIVA 2WSFC 1T7PA 3AVJA 2DFHA 4E1NA 4XH1A 3OVNA 4A48A 4QR0A 4R0JA 4OYMA 5J2NB 4UF4A 1SH0A 1OH7A 2AJQA 2XMVA 4DG1B 4DUTA 3CC4S 4R5PB 2RKIB 1RCOB 2E5JA 1IKWA 4JEPA 1P8ZA 1YTAA 4G1PA 2PMHA 2IJRA 1KCFA 4K25A 4B08A 1S1WA 3AA2A 5GIOA 5LL6Z 3TAGA 4DV4J 2OELA 4PA1A 2DXFA 2MHEA 2VD3A 3PIOQ 1EQMA 3KMSA 3OT9A 5IV3A 4L74A 4DTXA 4FJ7A 3PEJA 3ZSVA 2VG5A 2GO8A 5IFMA 4CO4A 4FJLA 4GMJB 1XMBA 4F4KA 1UEVA 1RYRA <