5HL7L

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
ISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel pleuromutilin antibacterial compound, its binding mode and selectivity mechanism.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
total genus 16
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5hl7L01
1OVYA 3G6EN 4IOCL 3G4SN 1YITN 2OTLN 3CCVN 1KQSM 1Q81O 3CMEN 2ZJPL 4WFBL 3CC4N 1KC8O 3OW2M 1W2BM 3CF5L 3CPWM 5MLCQ 3CCQN 5GAHP 4U67L 3I55N 1YIJN 1N8RO 5HL7L 1VQ8N 1VQ7N 1M1KO 1YJNN 2ZJQL 3CCRN 3G71N 3J7ZO 1YI2N 4IOAL 1YHQN 1Q7YO 1YJ9N 1ILYA 1VQ6N 2ZJRL 2QEXN 1VQON 3CCSN 3CCMN 4UY8O 1VQPN 1QVFM 5JVGL 3DLLL 5GAEP 1JJ2M 5GAGP 3CC2N 4WFAL 1VQ5N 3CMAN 4WCEL 2OTJN 3CCLN 1S72N 3PIPL 1KD1O 1VQLN 5JVHL 5DM6L 3CD6N 1VQNN 3CXCM 4WF9L 1K73O 3CCJN 1VQKN 1Q86O 3CC7N 5H1SQ 1QVGM 5GADP 1M90O 1K8AO 1VQMN 3I56N 4IO9L 2QA4N 1VQ9N 1Q82O 3CCEN 1NJIO 1K9MO 3CCUN 4WFNL 5DM7L 3PIOL 1VQ4N 1YJWN
chains in the Genus database with same CATH superfamily
4Z4HA 4X64K 4BC3A 3M5RA 1BCMA 4MO5A 4DSKA 2YHBA 4Y1CA 2RE2A 3SI6A 2G8FA 2A6AA 1X3NA 1T6DA 3VGMA 2ZM6K 3V9WA 3ENHA 3TPQA 1QZ6A 3DXMB 3CCVN 3CYMA 2P9PB 3J80O 5AQRA 1SKRA 3GOIA 4RW4A 2KZMA 3H45C 4K41A 3U3GA 3ZT2A 1BIUA 2A3ZA 5KPZA 4I9LA 4GV3A 3J7YP 2QWMA 2BANA 1G99A 1NNEA 4DU3A 4B9MA 4F2RA 1N6QA 1RTDA 3DLEA 2O8EB 1RTIA 1VQ8N 2PFUA 2R7YA 5IWAK 3PY8A 1ASWA 1NKBA 1JLEA 3AO5A 3QETA 4DTPA 1C0MA 3LP0A 1CZ9A 2HB5A 3K9KA 1FJGK 3WXJA 1JXEA 4E7JA 2BDPA 2P1JA 1SAZA 4CEFA 3O9UA 3L2VA 3D2EA 4B9TA 3IMXA 5AQKA 4H5NA 3L2WA 2O8CA 4DTXA 4B1WB 2CH5A 3C7NB 1RT4A 4HCBA 2HBMA 1VQPN 4CF2A 2AJQA 1BG3A 4EHUA 1TVRA 5AFUA 3C95A 4BQZA 4O8KA 4BRNA 1K6YA 4CZIA 2Q1NA 5M1QA 1NJZA 3CXCM 5ADXH 4DQRA 4DSIA 1YT3A 3KHYA 3A5NC 4FWKA 1N32K 2IDOA 3DLKA 3S41A 3OYCA 4F3OA 3TWHA 3E1YA 4CHPA 3OS1A 3O4QA 4A5AA 5BRHA 4J8FA 1DKGD 3QB0A 1IKYA 1S1UA 4YOXA 3AA3A 3ZT3A 5M1FA 3WXIA 4JKBA 3VTHA 3VQ5A 3RR8A 4CERA 1N34K 3PIOL 3MECA 3SQ4A 1QQCA 4IO8A 4CJVA 2OCEA 2PYJA 3OJSA 3MEDA 5HBMA 4J2BA 3ZETB 3ATUA 4KTQA 3KWIA 3MXJA 3I8BA 3L8BA 5GINA 1N5YA 2B6AA 1OH8A 2UU9K 1MU2A 3OYHA 2FBYA 1MA9B 1U47A 4O5FA 3VMFB 4DR1K 2ITMA 1DEJA 4M41A 4F9OA 4CIEA 2QXFA 5TKYA 2RF2A 5HRPA 5KQ8A 3L3UA 3PV8A 1LWFA 3A2FA 2HNYA 3HYFA 1JLAA 1BI4A 4W5TA 4ELTA 2F7TA 2VYPA 3LDQA 2E1YA 2ZJQL 5GIOA 3ZX3A 4CESA 4RW8A 4RG8A 4FJLA 3MN5A 1TL3A 4CGDA 1HX1A 4DFPA 4FWMA 2E88A 1HRHA 5AQPA 4A57A 4KB1A 4FLYA 4CGGA 3O08A 2YNIA 4BG8A 3OYAA 5K14A 3ATVA 1Z6RA 5AZIA 2G8VA 4FK0A 1EQYA 2HHUA 4RTFD 3AA2A 1RDAA 1HPMA 3Q7BA 3QESA 4R79A 1XNQK 1IO2A 3DXKA 2GV9A 4N56A 3KKRA 3TAEA 3VEWA 3TSQA 4EP4A 3HVRA 5H1SQ 4FJMA 1NLVA 5GADP 3MXMA 3SK3A 4IXCA 1D4XA 4O4GA 3RMDA 4CFAA 3VQBA 4IO9L 1RGIA 3IS9A 3VQCA 1U2VA 1X3MA 3KWGA 4M3XA 2NRTA 1NOZA 3WT0A 3TAQA 1NJXA 4QAGA 1NGHA 4BR0A 3H3NO 4FK2A 3FLCO 4B3TK 2NRZA 2D1KA 4CEZA 4FJHA 3WNFA 1K8KA 3NHGA 1OVYA 3G10A 4AHUA 1BA1A 4LF8K 1NGDA 5EU7A 4IDKA 4GKKK 5KGWA 3KKSA 4KV8A 3CMEN 5J2QA 1TV6A 2Q97A 1YXQA 4MQ3A 4IG3A 2Q36A 1C1AA 3KLIA 1NU0A 1WAFA 4FJNA 3LPTA 4RW7A 4JK8A 4DV4K 2OZSA 4FWRA 4BRAA 3OY9A 4BRKA 4CZFA 4FOEA 2IVNA 2BTFA 1KCFA 2OA8A 4BRLA 1GOBA 1S5JA 1HPZA 3OYDA 3D0PA 4DV3K 4CEAA 1Q8IA 3OYGA 3O80A 1SL1A 3HP6A 1KFDA 3HJFA 1DGKN 4LF5K 3C94A 3AO1A 4NYFA 5JS1A 1VRTA 3CETA 3KIOA 3OA9A 2ETJA 4QS9A 4BREA 4CGIA 4BR2A 1MDUB 1NBWA 2E2QA 4HVJA 3OJUA 3CFOA 3WNEA 4DV5K 5LMUK 1U04A 3THXB 3PIPL 3ENOA 3ULDA 2NRWA 1HKCA 2UUAK 4M3UA 3M1FA 3VQDA 2QTDA 1JCGA 4C8KA 2O4IA 1Q86O 4QCLA 4NXNK 3VQ9A 1C1CA 4FM1A 1JLQA 5FPEA 1IBMK 1ZYQA 2VWKA 1NGIA 2YKNA 4DQIA 3SUPA 1ZBHA 1MWMA 4GMJB 3RTVA 4DLGA 2HOEA 3SQ1A 2HHHK 3E66A 3M8SA 4BGAA 4EZ6A 4CGHA 3I8DA 4FWPA 3EYZA 1S9GA 3O9SA 2Q0UA 5M1KA 3QERA 3HM8A 1IBKK 5A2QO 4DR5K 1V4TA 5CZ1A 2Z1HA 5LJWA 5DK5A 5BPLA 5SWMA 4PKIA 2KW4A 4J2DA 3O5BA 4HUFA 3P83D 3FZKA 3VOVA 4GV6A 2QWNA 5AZJB 4J2EA 3MWTA 5HOOA 2YHAA 3ZEUA 3VA0A 3SQ0A 4E19A 4LF6K 4B3RK 4QOZB 4CJSA 3V81A 3MEGA 1LAVA 4CVNE 1RDWX 3LDOA 3C0BA 3K58A 1Q9XA 4JI4K 4DUZK 1NGFA 4B9UA 1U4BA 3THWB 3VQ7A 4B1ZA 3C6AA 1NWKA 3QDKA 2W41A 1VSEA 4OO1J 4HUEA 4KI4A 4CBXA 3F73A 4BGBA 2VWJA 4BE0A 4JKDA 3VA3A 2KKZA 1Q18A 2O8CB 3QFPA 3U8XA 3OYFA 4FWSA 3EY1A 4CIFA 4HHTA 2F8TA 2HBLA 3CG7A 1NMDA 2E2OA 4B9NA 4IEEA 1NK4A 3T69A 4B3MK 2O8DA 1Z05A 3L2UA 3M8QA 1M90O 1DTQA 4FJ8A 1YVNA 3VGLA 1ZBSA 2WUSA 4E1NA 4DTNA 3TAGA 5HRSA 1WBBA 3KK2A 3IAYA 4FLUA 2G8UA 3DLGA 1KAXA 4NYNA 1XI1A 1J5OA 3EKSA 4JKGA 4KHYA 3P1GA 4DQSA 1VQ4N 2I7NA 2HHVA 4BQLA 3C6UA 3T7ZA 3EEQA 3TTCA 4DQQA 4DKWA 3QLHA 5IT9O 3PX4A 3DXKB 1L3UA 1IKWA 4JHDB 4I9QA 4CD3A 4CI6A 2QKKA 3FZMA 5I9EB 3CI5A 4O8UA 2WONA 4AHTA 1LV5A 2D4WA 1QHTA 4ZHRA 1HQEA 3LP2A 3NH0A 4GKJK 1X9SA 4H4MA 4BR5A 3NCIA 3QIOA 1UOCA 3JXUA 5M1NA 4O44A 2XY7A 1D8YA 3V1RA 3P38A 2UYTA 1HNZK 4IKFA 1GLFO 4NO7A 1JCEA 3TSPA 3J81O 1QE1A 3VF6A 1F21A 2AP1A 3L4IA 3J7ZO 1QHAA 1XMQK 1WUAA 2E6MA 2E1ZA 1HQUA 2Q3SA 3SUQA 3UKUB 4B8AB 4UY8O 4MO4A 1X9JA 4B9SA 1YTAA 4GVMA 3CJCA 3KK1A 1VSDA 3L4QA 3MMVA 3SBTA 3AVMA 4BR4A 4AH9A 4G1QA 4X65K 4G9ZA 3CCLN 3ALYA 1LWEA 2O8BB 1EX4A 1JKHA 4YOUA 2FBTA 1HLUA 1VQNN 5BRDA 5AZJA 1GOCA 5LMNK 1OH5A 1BU6O 3QIPA 5ELZA 5I3UA 1FXXA 4XH5A 4H0TB 4BC4A 1NGJA 4FO0A 3DLHA 1C0TA 3GBTA 2PZSA 2NRVA 2ZD1A 4IWVA 2YJFA 3THWA 5AQHA 4WYBA 4FPBA 5M1PA 2GBZA 1SKWA 4WQ5C 4ID5A 2P9NB 5C10A 4Z0UA 3V1QA 1X9WA 1GLJO 4JS5A 2Q0RA 4DFMA 4BDZA 3K57A 3WXKA 3NH1A 1TL1A 4W5QA 3KLGA 1JL1A 2VQEK 4YDUA 4CEDA 3AGRA 3OS2A 4ZTFA 4I7FA 1FKOA 1Q81O 1WSHA 5B8HA 3KK7A 1KSPA 1T44A 3D6RA 4KTZA 3OW2M 4JI7K 4BDPA 3I33A 4PUOA 4V19S 4FLTA 5MLCQ 4X62K 4CZJA 3SMSA 5BN9A 2ZGZA 4FJ5A 4B9LA 1NK9A 1BQNA 1R0AA 1IKVA 3M8PA 1ASUA 3HK2A 4CHYA 1U45A 1NGEA 4KTWA 2GUIA 5C25A 3NAEA 3HP9A 3A5MC 3EZWA 4KH5A 2I5JA 4OLBA 1LOTB 5FLXO 4WQ4A 3DLRA 3T19A 3VETA 3C7NA 3MAQA 1ZC6A 1YHQN 4JI0K 4MLEA 5FRNA 2ATQA 4AQYK 1Q7YO 4YOTA 5SZTA 1ZBUA 2D0AA 3FE1A 4DSLA 5F1XA 4CGJA 2OPRA 4JKCA 4CFDA 3DAWA 2E20A 1S6QA 1Y97A 1VSKA 3QNNA 1WSGA 1XUPO 1RT6A 3G0ZA 4BC2A 3H08A 3LANA 3LDLA 4DCHA 2YI1A 4JRQA 3HOTA 1TGOA 4KH6A 1RT1A 3NGYA 4FM0A 3TAMA 4CFBA 2VCPA 3U3YA 4JI2K 2D0OA 4M3ZA 3OVNA 3PSFA 3L0QA 4CK1A 1W0HA 2W40A 3A5OC 2A1RA 2BUPA 4BRDA 2X6SA 4FWQA 4KBOA 4BG9A 3L6QA 5C15A 4WFNL 4CEOA 3R1XA 2G8HA 3PO5A 1QQOA 4OPHA 4TSXA 5AQNA 3C65A 2LSNA 3NDKA 4FK4A 2QWPA 4FWLA 2UUCK 3ZETA 1U48A 3G6EN 3UE5A 2BGGA 2E8AA 3TTFA 3SPYA 2OPPA 2XY6A 2PAVA 3CHWA 1RBSA 3EZ5A 4OPJA 2HNDA 2YNGA 1RDCA 3BZCA 1BA0A 4RWTA 4KHPK 2NNWA 4KREA 3CF5L 1TAUA 3JYTA 4B1VA 4W5NA 1HR0K 3QEXA 3TABA 1HKBA 3D2FB 1XHXA 3MN6A 1HUXA 3H1VX 1EKEA 3CIPA 4FJJA 3O9RA 2YKMA 4JNEA 1BL3A 3SAHA 3VQ6A 5EOYA 4AHRA 1VQ7N 1CLQA 4BR9A 3SJJA 3TI0A 1C0UA 3RMBA 2HHQA 3AVKA 3SUNA 2UXBK 2DTUA 2YHXA 4CZMA 3ZSYA 3UKRA 1IH7A 1CZBA 2XY8A 4OKJA 4FJGA 3QEVA 4XH4A 1S1VA 1HNWK 3VQPA 3W3DA 1WSJA 2QEXN 2IVOA 4ISGA 3KZBA 1CXUA 1N36K 3LDNA 3TTDA 1KAZA 4CK3A 1A5XA 2HHXA 2VG7A 4ELUA 2BH1A 1HJOA 2FC0A 4W5RA 3UB5A 5FROA 2HVIA 2HVHA 2HSTA 1A5WA 2DFEA 4CZHA 4CHQA 3ZSVA 4BRCA 1BWFO 2ZGYA 1KAYA 3OYKA 2P9UA 1VQKN 4DF8A 1J6ZA 3AVLA 3D7EO 4C1NI 2X74A 3O4NA 1J9AA 1I3AA 4OVLA 4PQUA 1K8AO 3HI0A 2P9SB 3AY9A 3L2RA 3DMJA 3NVKA 3R9PA 2VGMA 4DUYK 4YOWA 3HT3A 5T7BA 4E3SA 4H5TA 4ISFA 1VSLA 2D0BA 3MWPA 2ZQBA 3UKUA 4FJIA 2W6LA 4K8ZA 3TR8A 2DPNA 1E4FT 2RHKA 3WXMB 1C0FA 4PKHA 3ENBA 2QWQA 4DFKA 1SQKA 3MEEA 4LSLA 1KQSM 4JKAA 1IV0A 4PA1A 1QTMA 4I6MA 5AJ3K 3MX2A 4DR3K 5E41A 3DXMA 4H0PA 1W2BM 3CERA 4H0XB 3MN9A 2NLXA 1XC3A 3DYAA 2E2NA 4BWJA 4JD2A 5GAHP 4HUGA 4DV2K 5KGXA 1NK0A 5I42A 3LDSA 5JICA 3VQ4A 4DTMA 3QBWA 3N4PA 1IBLK 1RTJA 2NRXA 1EWRA 3SNNA 2NRHA 2VGNA 1TKXA 2GEMA 3FZHA 4KKOA 4EIAA 3WNHA 5AQXA 3D45A 1NGBA 4C8NA 1GLCG 1LCUA 1WSIA 5AQVA 5C42A 4FWNA 4CEBA 3OYLA 4BC5A 3LWLA 3H46O 3R6MA 3THXA 1REVA 1S1TA 4BWMA 2Q2RA 1A5VA 5AQFA 3OHRA 4K43A 1RT5A 4H03B 3IRXA 3H6EA 3AVAA 4EZ9A 5DM6L 3ISNC 4WF9L 4FJXA 4FZXC 5J2NA 1W97L 3J7AP 4ZTJA 4R5PA 4XH1A 2O8BA 5C0YA 2KTQA 2IGIA 5CY4A 3OBYA 2J4RA 2KHOA 1U6ZA 3IFRA 3ZSRA 4DR2K 3JS6A 2EWSA 4HWIA 3OYMA 3CCUN 5AQWA 1TK8A 2JWKA 2WTUA 3MCAB 4FZZA 5DM7L 3T1AA 2ASOA 3NGIA 3MXIA 3QINA 4JS4A 3HM9A 4O0IA 3LWMA 2A1SA 4FLZA 4CFCA 4BY9C 3PSIA 2CGJA 3KD5E 1YITN 3M3ZA 3NF9A 1ATRA 3TSUA 5HP1A 5C12A 4CF8A 3O3HA 3ZX2A 3CJ9A 4FVUA 1S1WA 3O9QA 5KPRA 4FJKA 1YTUA 2VG6A 2V52B 5JLHA 3SLCA 4HTUA 3U9ZA 3DWLA 3E9PA 3H3OB 2ZF5O 1L3TA 3WEEB 4AHVA 3OYBA 2PBDA 3CFRA 3PLAA 3VTIA 4ISEA 1N8RO 2YHWA 3W0LA 3O1BA 5AQTA 4H0OA 1BGXT 1HMVA 3A5LC 1XC9A 4H5VA 1QSSA 4C8MA 3B6OA 1B92A 4DG1A 3KLFA 2HF4A 3CFPA 4KPYA 2QK9A 5EX5A 3CQYA 3BUZB 3O8MA 4JI6K 2QWLA 4JI1K 3DLBA 2KFNA 4ILHA 1UAXA 3OTOK 1J5EK 3K5LA 4OKEA 1LW0A 1IG9A 1C0GA 2P9KA 3NF8A 2Y1JA 4YORA 1VSFA 3E9OA 3OS0A 4DTSA 4CECA 3LL3A 3RRGA 1VHXA 4N47A 2Q31A 3CC7N 1GLAG 5F0XA 3DOLA 1JLCA 4C8OA 1VQMN 1KVAA 1O1WA 3MCPA 1QQNA 4B1YB 4AM6A 5BPNA 3AVCA 2H3GX 3VESA 2F8SA 4A59A 4FVMA 4YOVA 5BR9A 3I0RA 5FDLA 5KPTA 4I2QA 4B8CA 2IIRA 4CZKA 4NCGA 4YFUA 4IG0A 1NK8A 2P9PA 3JAMO 3NMUA 1WSEA 1I94K 3K5OA 1D9DA 2UXDK 4YY3K 1RDUA 5FPMA 4WE1A 2D5RA 2ZJPL 1BQMA 4CEEA 3LP1A 1RTHA 3CPEA 3PUFA 3NF7A 3LDPA 1T3VA 3TARA 3M8RA 3ZT0A 2OPSA 3DOKA 4FLXA 4KRFA 2FF6A 3TU5A 3F5TA 3BY5A 4KHQA 1TK5A 1GOAA 3EE9A 5HRNA 2RKIA 4Q5VA 3LAMA 1RBVA 2FF3B 4FPAA 1W7AA 4BE1A 3LAKA 2AA4A 4PL8A 4FSVA 1UA1A 3UIQA 4CJ7A 3THVA 4E89A 5CYQA 1HNIA 3DRSA 3GDQA 1RDBA 2I7PA 1KVCA 5CZ2A 4CD1A 2KLAA 1H1VA 4CZGA 1ILYA 5FPNA 1NJYA 4LF4K 4JKEA 4E7KA 1NMNA 4GW6A 4XEIA 3ZT4A 4PKGA 5JVGL 4JN4A 3ITHA 4CHOA 3AVBA 5AQYA 2BE2A 2DFFA 2IS3A 3L3VA 2WBNA 2GELA 3V9ZA 3HSTB 3AVNA 4DWIA 3SMPA 3RWUA 3BF3A 4GVEA 2UUBK 1ZBFA 3FR0A 3AA5X 4A5BA 1XQSC 4W5OA 2E5LK 4Q0BA 4NXMK 5BPMA 4CCHA 4FJ9A 1EXQA 2FSJA 2P5GA 4BRPA 1Z25A 5C2DA 3SQ2A 4LSNA 1NG9A 4LF7K 3CCEN 2ASPA 1WAJA 3HBTA 1NJIO 3PO4A 4DV1K 3WNGA 3SZ2A 1BCOA 4LFCK 5F2RA 3ZSOA 4J2AA 3HOSA 4DHYA 3LZJA 2Y1IA 1ATSA 3ULEB 3NBPA 3SPZA 4IOCL 4EFHA 2RN2A 1P90A 3HZ6A 4NB4A 1WOQA 2OTLN 1LW2A 2HHTA 5KTQA 4DU1A 3CC4N 4KHSA 2P9IB 4M45A 3CPWM 1EO1A 4KO0A 4BVOA 3K2PA 1YUWA 3QEIA 4LH4A 3RMAA 4CJLA 4NCBA 1SV5A 5LJVA 4B08A 3NVMA 1EETA 1XNRK 4MDBA 3ZCMA 1YIJN 1DLOA 3VQAA 3SJHA 4A2AA 3SYZA 4KH4A 5AR0A 1WBDA 2ITGA 4JRPA 4FOIA 4JI3K 2FSNA 4DF4A 1QSYA 4CJFA 5BN8A 3OYIA 3TAFA 4DV7K 5AQZA 3VQEA 5AZIB 1YI2N 4GNIA 3VF2A 4Y1DA 3N4QA 1X9MA 4B3OA 1YJ9N 1G15A 2ZJRL 4OPAA 1YAGA 1KXPA 4CE9A 3RSEB 1IG8A 4KAZA 5FRMA 2JGUA 1U49A 5GAGP 3AO3A 3T3FA 2VG5A 4M7XA 3BZKA 2OTJN 3O3GA 4DR4K 5JVHL 1WLJA 3S3OA 1ZXOA 4ILJA 3ID8A 3ZSXA 3VQ8A 4HTLA 5BREA 4YNQA 3THYA 1QQMA 3MK6A 2ZE2A 4IFVA 1R59O 3V9UA 1CXQA 3HPHA 3GE1A 3KVGA 5C24A 4Y0WA 1QSLA 3DI6A 2B4JA 3ULEA 4I2PA 3VEVA 1I39A 5BRFA 3IUCA 2OANA 3OBWA 1YJWN 4BR7A 1OVQA 2WFBA 4XIUA 1SS6A 3G4SN 3ZSQA 4DSEA 2O4GA 5AQJA 3VF4A 3WQUA 3K5MA 5J2MA 3E9LA 3NH2A 4EAHD 4M3YA 4DB3A 1UA0A 5EXWA 4Z4IA 4AM7A 3BF1A 4CF0A 5JLFA 1KC8O 3V1OA 4K8XA 4QS8A 3SUOA 4AILC 4BRHA 4KFBA 4FW2A 2HHWA 3WQTA 4CJKA 3S3NA 1EWQA 3I0SA 1RBRA 1TYQA 4FCYA 4CHZA 2X6NA 4IDHA 2F9TA 3I55N 3U9DA 1RT7A 3U6FA 4CBWA 3WEEA 1XHZA 5HL7L 1M1KO 4LY7A 2Z1GA 3S3MA 1YF5L 1ASVA 2O8EA 4DQ8A 3G71N 3P4IA 4IOAL 3Q7CA 3AA4A 3RSEA 4BRFA 4AF1A 4MDAA 2HF3A 3LM2A 1BOTO 2EX3A 3L2QA 4BRIA 4FW1A 2V7YA 2GUPA 3F9MA 2GTDA 4H8KA 4WFAL 1S1XA 3AVJA 2KQ2A 4IFYA 4LD0A 3GG4A 1WN7A 4DV0K 3AVGA 2P9IA 3EN9A 1HJRA 2Z1IA 4H5RA 3VN5A 2F4VK 2HMPA 4OLAA 4DSJA 1J53A 1TAQA 4M7YA 2FXUA 3R8EA 4FWOA 1GLBG 3SV4A 2P9LA 2QXLA 4E0DA 1VAZA 1NGGA 1FK9A 4DV6K 1BISA 1KVBA 2GWKA 4RCHA 3ASMA 1E3MA 4E7HA 2JWLA 1QZ5A 2HNZA 3CM5A 4L8RB 4DTRA 4OGEA 3MN7A 4PHTX 4GV9A 1T7PA 2NRRA 2YHYA 2WOMA 3VEYA 4DU4A 3HPGA 4JI5K 1S3XA 4E1JA 4FLWA 4JK7A 2FLOA 2GWJA 4CK2A 5TKWA 1ZBLA 2YCHA 1JLGA 1TK0A 1OH7A 4B1UB 4WFBL 3NF6A 4OPKA 2VQFK 2VWBA 2A40A 4C1NK 1L5UA 1OKJA 2CGKA 3QEWA 2QKBA 4CJWA 3SAGA 4B1XB 5AQLA 1RNHA 3VERA 4DS5A 1GLDG 5J1EA 3DM2A 5AQSA 4A2BA 3IG1A 1ESVA 4U67L 4AHCA 5J2PA 3C6HA 4RW6A 3OYJA 1VSHA 4JYAK 2YV0X 3QFUA 4CJ5A 3QO9A 4B9QA 3R3LA 1YJNN 5LL6Z 5E26A 4WQ5A 4CJ4A 4BDYA 1HNXK 2XO7A 1K8KB 1C1BA 4H0VB 3P5JA 3LPUA 1DTTA 4CJ3A 3TAPA 3K0SA 3CCSN 5AQIA 3ZLJA 4CJRA 4CJPA 4YDUC 3RR7A 3PX0A 1JJ2M 2HHSA 4F4KA 2HBJA 4JK9A 2OYQA 4O0JA 3RVCA 4C23A 4I6MB 4BRMA 1T8EA 3KK3A 3D2FA 3QNOA 3KTQA 3VEXA 4JKFA 2XY5A 2UXCK 4DR7K 2O8FA 4JD2B 1NJWA 5D3GA 1TYQB 3QICA 4CGFA 3OYNA 1P8ZA 3CQ8A 2F96A 4GY2B 4KB0A 3NGZA 1VQ9N 3AO4A 4JKHA 3PX6A 4JEPA 4CZLA 5KRSA 4OJRA 1NOYA 2V7ZA 1KTQA 3CJBA 2E2PA 3HPOA 2NUBA 4F2SA 4IFEA 3C6TA 4UQGA 1JL2A 1IJJA 1ATNA 1SZ2A 4IEIA 4X66K 2D0PA 1WNSA 2XRIA 3S9HA 3A0IX 3V9SA 2YJEA 4OGCA 3CQXA 1XWLA 2EHGA 1T03A 4N76A 4FYDA 1BO5O 1SL0A 4NLBA 3K59A 3HTVA 1FKPA 3P31A 3DRPA 1KFSA 4DR6K 4E7IA 2DFHA 1TKDA 3FZFA 4E1MA 4JAXA 3CCQN 3CJ1A 1RCHA 2P9SA 4H0YB 3WUHA 3ZSWA 1V4SA 4BE2A 3SCXA 3BP8A 4CJEA 1SUQA 2KFZA 5KI6A 3AAPA 2W42A 5C2FA 3VQQA 3LZIA 4Z4EA 2P51A 1RT3A 5AQGA 3BEXA 4DFJA 4LH5A 4NLCA 1KLNA 3O9TA 1RILA 4M3RA 1C6VA 3JSMA 5CYMA 1NKCA 5AQUA 2V51B 2RPIA 2ASMA 1S6PA 2A5XA 4LFAK 1WSFA 4E7LA 5CHIA 4CJUA 2IC3A 3CCMN 4IOXA 1S9EA 1QVFM 3DLLL 4M3WA 3ZYYX 1X1PA 3CC2N 4FJ7A 5E84A 4LC9B 1VQ5N 3VEZA 4JHDA 4F3TA 4U7BA 5HLFA 1TUYA 1KD1O 3ZEUB 5AQOA 4FLVA 5KQDA 2QWOA 2ZWHA 1VRUA 3CJ7A 2A41A 2QM1A 1GLLO 5AFUH 2HW3A 3VENA 4IBNA 2DY4A 5AQMA 3CJAA 4JLHA 2P9UB 3I56N 4HCCA 4KHNA 1BDGA 3QBXA 5M1OA 2A42A 3AVIA 2YX6A 1KLMA 1NK5A 3EKUA 4H4OA 4M3TA 4RW9A 4WQ4C 4CHNA 4Z4GA 1JCFA 5JS2A 2HMIA 4H5WA 1Y64A 3AV9A 3VGKA 1RBTA 3OYEA 1NM1A 5ADXA 4O5BA 4PY5A 3BDPA 1QS4A 4A62A 4EP5A 4CEQA 1NGCA 4MFBA 1Z26A 2YNFA 3ID6A 4QS7A 1VSJA 4CBUA 4BVPA 4KI6A 4FXDA 1BIZA 1JLBA 3HRGA 3EO3A 2O8DB 3LALA 4DQPA 4KHUA 5LY3A 1L3VA 2B5JA 2P9LB 4CF9A 1OH6A 4JI8K 4AHSA 2XHBA 4BRQA 1VSIA 1VSMA 1O13A 1TUUA 5CE3A 3T1HK 2IAJA 2FSKA 2JLEA 3H1QA 1LWCA 3NE6A 4ID1A 4K25A 4N5SA 3BGRA 5EY4A 2PYLA 3KLEA 3CCRN 5HROA 2E6LA 4F8RA 3QMLA 2P9NA 4N41A 2IOCA 4Z4CA 1JXBA 3K9JA 4EHTA 5KRTA 3ZX0A 2F9WA 3MX5A 4DTUA 1SKSA 4PWDA 4O55A 4K0KK 2G8IA 3AVHA 1SL2A 4Z4FA 5JMVA 2NZTA 1CZAN 3HO1A 1D5AA 3U4LA 3WXLA 3CD6N 3CCJN 2KZZA 4CJQA 1QVGM 3A8YA 4K42A 3V9XA 1U2VB 4OX9K 1T6CA 3O3FA 1T05A 2CGLA 1ZBIA 3F2KA 1FW6A 3KD1E 1J54A 3TANA 1BI4B 1HYZA 5CR4A 4Z94A 4DMNA 3LM9A 5GIPA 1UWBA 2W6KA 3GL1A 3D2EB 1LAWA 3MDQA 3HL8A 2FBVA 4LFBK 1L3SA 2CH6A 2D0CA 2YNHA 4CZEA 1Q9YA 3O4WA 4YOYA 4CJTA 4C8LA 4JKGB 3HSCA 4DSFA 1B9FA 3EL2A 1HYVA 3B8AX 4FZYA 1XMOK 3FGUA 3G25A 3FZLA 3HVTA 3AARA 1VK0A 1JLFA 2OPQA 4CIGA 3E01A 3DRRA 2Z1JA 2QI2A 1HNVA 3F9KA 3LP3A 5FPDA 2X78A 4BACA 1GLEG 1BUPA 1S22A 3FFKB 4ELVA 2IVPA 3IDHA 3P39A 1W9HA 3SV3A 1IKXA 4IZ9A 5HRRA 3ZT1A 1TKTA 2QWRA 4DTOA 1B9DA 4BROA 4PL7A 3HXMA 1KRPA 4A61A 3UKRB 3SBGA 3KJVA 1N33K 3KLHA 3EE8A 3RMCA 2PY5A 1DT9A 2WC9A 1NGAA 4CF1A 3SAFA 2G8WA 4OKKA 1BHLA 2QW9A 3AVFA 1D9FA 1VQ6N 1VQON 4NCAA 3RRHA 2HBKA 1NK6A 1MWKA 3QEPA 3AGKA 3NFAA 3J8AA 5GAEP 3CM6A 5BR8K 2OZMA 3O6WA 3B6PA 3M6GA 4DTJA 4IJNA 2GX9A 4BRGA 4CW7B 2P5OA 3VEOA 3VPZA 1HKGA 3CMAN 4WCEL 1S72N 4LF9K 4KHWA 1VQLN 4IJAA 1WB9A 4FL9A 1K73O 4FM2A 3THYB 2P9KB 4JV5K 4B3SK 3K5NA 4ILGB 1RBUA 5DMRA 3V6DA 1E4GT 1RFQA 2FBXA 3IKMA 3ZSZA 4DLEA 4M42A 1EP4A 3FFIA 1NKEA 3O1WA 1RDDA 2QA4N 4YHHK 4DS4A 1HYSA 2E4LA 4ICLA 4M63C 4MLHA 2O8FB 1Q82O 1K9MO 4L3QA 1YVUA 2G8KA 5EVZA 1NK7A 1RT2A 3V4IA 1ITGA 4B9VA 5AQQA 3AAQA 1TKZA 3T1YK 3AO2A 3DJCA
chains in the Genus database with same CATH topology
4BC3A 3M5RA 4MO5A 3VEYA 4BQLA 3T7ZA 1S3XA 4E1JA 2RE2A 4JK7A 3TTCA 2A6AA 4BY9C 1X3NA 1T6DA 3VGMA 4DKWA 2CGJA 2FLOA 2GWJA 3ENHA 1YITN 5TKWA 2YCHA 3TPQA 1QZ6A 3DXMB 3CCVN 3DXKB 3M3ZA 4JHDB 2P9PB 4CD3A 1ATRA 3TSUA 4B1UB 5AQRA 4CI6A 3FZMA 4WFBL 5C12A 5I9EB 3CI5A 2VWBA 4O8UA 2A40A 3GOIA 3ZX2A 4C1NK 3CJ9A 4FVUA 3O9QA 1OKJA 2CGKA 5KPRA 2D4WA 3SAGA 4B1XB 2V52B 5JLHA 3SLCA 3H45C 4K41A 5AQLA 3DWLA 3U9ZA 3VERA 3E9PA 3H3OB 1GLDG 2ZF5O 5KPZA 2A3ZA 4BR5A 3WEEB 4GV3A 5AQSA 2PBDA 4A2BA 2QWMA 1ESVA 3JXUA 4U67L 1G99A 5M1NA 3PLAA 3VTIA 4ISEA 1N8RO 2YHWA 3W0LA 3P38A 2UYTA 1GLFO 3C6HA 3O1BA 2PFUA 1VQ8N 4NO7A 3QFUA 1YJNN 5AQTA 4B9QA 1JCEA 3R3LA 3A5LC 4H0OA 3TSPA 5E26A 4H5VA 3VF6A 3K9KA 4WQ5A 3WXJA 2AP1A 3L4IA 3J7ZO 1QHAA 1SAZA 3O9UA 3D2EA 1WUAA 3IMXA 1K8KB 5AQKA 4H5NA 2HF4A 4H0VB 2E1ZA 3UKUB 4B1WB 2CH5A 3C7NB 5EX5A 3CCSN 3CQYA 5AQIA 4UY8O 3BUZB 1X9JA 3O8MA 2QWLA 2HBMA 4MO4A 4YDUC 1VQPN 3CJCA 1JJ2M 2HBJA 4ILHA 4JK9A 1BG3A 4EHUA 3L4QA 3MMVA 5AFUA 3SBTA 4BR4A 4BQZA 4O8KA 1C0GA 2P9KA 3RVCA 4BRNA 4YORA 4CZIA 3CCLN 4G9ZA 2Q1NA 5M1QA 3E9OA 4C23A 4I6MB 4YOUA 4BRMA 1HLUA 1VQNN 5BRDA 3LL3A 3CXCM 5AZJA 3D2FA 5ADXH 1BU6O 2Q31A 3CC7N 5ELZA 1GLAG 3KHYA 5F0XA 3A5NC 4XH5A 3VEXA 4FWKA 4JKFA 4H0TB 4BC4A 1NGJA 3S41A 4FO0A 1VQMN 4JD2B 3GBTA 1TYQB 3QICA 3E1YA 1P8ZA 2NRVA 4A5AA 4IWVA 4GY2B 2YJFA 1VQ9N 5AQHA 3MCPA 1QQNA 4JKHA 4WYBA 4J8FA 4AM6A 4B1YB 5BRHA 4FPBA 5M1PA 4JEPA 4CZLA 1DKGD 3QB0A 5BPNA 2V7ZA 2H3GX 3VESA 4YOXA 4A59A 3CJBA 5M1FA 4WQ5C 2P9NB 3WXIA 4YOVA 4JKBA 2E2PA 3VTHA 5BR9A 5C10A 5KPTA 1GLJO 2IIRA 3PIOL 4IFEA 4CZKA 2Q0RA 4IO8A 1IJJA 1ATNA 1SZ2A 4IEIA 3WXKA 2D0PA 2P9PA 4YDUA 3A0IX 3AGRA 2YJEA 3NMUA 3CQXA 3ZETB 3ATUA 1BO5O 3KWIA 1Q81O 1RDUA 5FPMA 3I8BA 2ZJPL 5B8HA 4NLBA 3KK7A 3HTVA 1T44A 3D6RA 3P31A 3OW2M 3I33A 5GINA 3CPEA 1MA9B 3LDPA 1T3VA 5MLCQ 4O5FA 3VMFB 4CZJA 2ITMA 3FZFA 1DEJA 3SMSA 2FF6A 4JAXA 3CJ1A 5BN9A 4F9OA 3CCQN 3TU5A 3F5TA 2P9SA 4H0YB 3WUHA 1V4SA 2ZGZA 5TKYA 3BP8A 5KQ8A 3EE9A 3AAPA 5C2FA 5AQGA 3BEXA 2FF3B 4FPAA 4NLCA 3O9TA 2F7TA 2VYPA 1NGEA 2AA4A 4PL8A 4FSVA 3A5MC 3EZWA 2E1YA 3LDQA 4KH5A 2ZJQL 5GIOA 1LOTB 3ZX3A 4CJ7A 4WQ4A 5AQUA 3MN5A 3GDQA 3VETA 2V51B 1HX1A 3C7NA 2I7PA 2ASMA 2E88A 2A5XA 4FWMA 5AQPA 4A57A 1ZC6A 1YHQN 4MLEA 4CD1A 3O08A 4BG8A 2KLAA 1H1VA 4YOTA 1Q7YO 4CZGA 5CHIA 1ILYA 5FPNA 3ATVA 3FE1A 1Z6RA 4JKEA 5AZIA 4XEIA 5F1XA 1EQYA 4IOXA 4PKGA 3CCMN 4JKCA 1QVFM 5JVGL 3DAWA 4JN4A 2E20A 3DLLL 3ZYYX 1XUPO 4RTFD 3CC2N 5E84A 4LC9B 4BC2A 5AQYA 1HPMA 3Q7BA 4R79A 1VQ5N 2WBNA 2GELA 3VEZA 3DXKA 4JHDA 3SMPA 3LDLA 4DCHA 2YI1A 4U7BA 1TUYA 3HOTA 1KD1O 3BF3A 4GVEA 3ZEUB 5AQOA 5KQDA 2QWOA 4KH6A 2ZWHA 3FR0A 4A5BA 3CJ7A 1XQSC 3VEWA 3TSQA 2A41A 2VCPA 2QM1A 5BPMA 1GLLO 5H1SQ 5AFUH 1NLVA 5GADP 2D0OA 3VENA 3SK3A 4IXCA 5AQMA 3CJAA 3L0QA 1D4XA 2P9UB 3I56N 2FSJA 4IO9L 1BDGA 1RGIA 3QBXA 4BRPA 5M1OA 2W40A 2A42A 3A5OC 5C2DA 1U2VA 1X3MA 2YX6A 2BUPA 4FWQA 4KBOA 3EKUA 4BRDA 3KWGA 3CCEN 2ASPA 4BG9A 2NRTA 3HBTA 3WT0A 1NJIO 3L6QA 4WQ4C 5C15A 4WFNL 5F2RA 3R1XA 1NGHA 1JCFA 3HOSA 4BR0A 4DHYA 3H3NO 1QQOA 4OPHA 3FLCO 5AQNA 4H5WA 1Y64A 2D1KA 2NRZA 3C65A 3VGKA 2QWPA 1ATSA 4FWLA 3ZETA 3ULEB 1K8KA 1NM1A 5ADXA 1OVYA 3G6EN 4IOCL 3UE5A 1BA1A 2E8AA 4EFHA 3TTFA 4A62A 1NGDA 1P90A 1NGCA 3HZ6A 4NB4A 1WOQA 2OTLN 2PAVA 3CHWA 3ID6A 4QS7A 4CBUA 3CMEN 3CC4N 2P9IB 4BVPA 2Q97A 1YXQA 1BA0A 4RWTA 3HRGA 2NNWA 2Q36A 3CF5L 3EO3A 4B1VA 3CPWM 1EO1A 4BVOA 5LY3A 1YUWA 2P9LB 1HKBA 3D2FB 3MN6A 4JK8A 5LJVA 1HUXA 3NVMA 3H1VX 4MDBA 3CIPA 4FWRA 4BRQA 4BRAA 3O9RA 1YIJN 1O13A 3SJHA 4JNEA 1TUUA 4A2AA 5CE3A 3SAHA 4BRKA 4CZFA 4FOEA 4KH4A 5EOYA 2IVNA 2BTFA 5AR0A 1VQ7N 2FSKA 4FOIA 4BR9A 2FSNA 3H1QA 4BRLA 4K25A 5BN8A 5EY4A 5AQZA 2YHXA 3CCRN 4CZMA 5AZIB 3UKRA 1YI2N 4GNIA 3QMLA 2P9NA 3O80A 3VF2A 4XH4A 3N4QA 3K9JA 1DGKN 1YJ9N 3W3DA 4EHTA 2ZJRL 2QEXN 4OPAA 3CETA 3ZX0A 1YAGA 1KXPA 2IVOA 2F9WA 4ISGA 3RSEB 1IG8A 3KZBA 3OA9A 3MX5A 3LDNA 5GAGP 4QS9A 4BREA 4BR2A 3TTDA 1MDUB 1KAZA 1NBWA 2E2QA 5JMVA 2NZTA 4M7XA 1CZAN 2BH1A 1HJOA 2OTJN 3UB5A 3U4LA 3PIPL 3ENOA 2HSTA 2NRWA 3WXLA 5JVHL 1HKCA 4CZHA 3CD6N 1ZXOA 4ILJA 4BRCA 3CCJN 1BWFO 2ZGYA 3ID8A 3M1FA 1KAYA 2QTDA 1JCGA 2P9UA 1VQKN 1Q86O 1J6ZA 3D7EO 4C1NI 1QVGM 3A8YA 4K42A 4HTLA 5BREA 1K8AO 3HI0A 1U2VB 1QQMA 1T6CA 2P9SB 3MK6A 5FPEA 3AY9A 2CGLA 1R59O 3NVKA 1NGIA 3R9PA 2VGMA 3F2KA 3GE1A 3KVGA 4Y0WA 5CR4A 4Z94A 4YOWA 1MWMA 3LM9A 2HOEA 5GIPA 3E66A 4H5TA 4ISFA 4BGAA 3ULEA 3GL1A 3VEVA 3D2EB 3MWPA 3MDQA 4FWPA 5BRFA 3IUCA 2OANA 3O9SA 3OBWA 3UKUA 2Q0UA 1YJWN 4BR7A 5M1KA 2DPNA 3HM8A 1E4FT 2WFBA 2CH6A 1V4TA 4CZEA 1SS6A 2RHKA 3WXMB 3G4SN 3O4WA 4YOYA 5LJWA 4JKGB 3HSCA 5AQJA 3VF4A 3WQUA 1C0FA 5BPLA 4PKHA 3EL2A 3B8AX 3E9LA 3ENBA 2QWQA 4EAHD 1SQKA 3FGUA 3G25A 3FZLA 4PKIA 4DB3A 1KQSM 3AARA 3O5BA 4JKAA 5EXWA 4AM7A 3BF1A 4I6MA 5JLFA 1KC8O 3FZKA 3MX2A 3VOVA 4GV6A 2QWNA 2QI2A 5AZJB 5FPDA 3MWTA 4QS8A 5HOOA 3DXMA 4H0PA 1W2BM 3CERA 1GLEG 4H0XB 1BUPA 3ZEUA 1S22A 3FFKB 3MN9A 4BRHA 2NLXA 1XC3A 2IVPA 3IDHA 3P39A 2E2NA 3WQTA 4JD2A 5GAHP 1RDWX 3LDOA 1TYQA 3C0BA 4IZ9A 1NGFA 4IDHA 2F9TA 5JICA 2QWRA 3I55N 3U9DA 4BROA 3QBWA 4CBWA 3N4PA 4PL7A 3WEEA 5HL7L 4A61A 2NRXA 3UKRB 4B1ZA 3C6AA 3SBGA 1M1KO 2NRHA 2VGNA 1NWKA 3QDKA 2GEMA 2W41A 3FZHA 3EE8A 4EIAA 1DT9A 2WC9A 5AQXA 1NGAA 1YF5L 3SAFA 4OO1J 4DQ8A 3G71N 3P4IA 1NGBA 4IOAL 1GLCG 1LCUA 5AQVA 4CBXA 3Q7CA 4BRFA 3RSEA 4FWNA 4AF1A 4MDAA 4BGBA 2QW9A 4BC5A 2HF3A 3LM2A 1VQ6N 1BOTO 1VQON 4JKDA 3H46O 2HBKA 3R6MA 1MWKA 3AGKA 4BRIA 2KKZA 1Q18A 2V7YA 3J8AA 3QFPA 5GAEP 3U8XA 2GUPA 2Q2RA 3F9MA 2GTDA 5AQFA 3O6WA 3OHRA 3M6GA 4K43A 4WFAL 4IJNA 2GX9A 4FWSA 4BRGA 4H03B 3VEOA 3VPZA 1HKGA 3CMAN 3GG4A 3H6EA 4WCEL 1S72N 2HBLA 1NMDA 1VQLN 2P9IA 3EN9A 5DM6L 4IJAA 2E2OA 4FL9A 4H5RA 4WF9L 1K73O 4IEEA 2HMPA 1W97L 2P9KB 4ILGB 3T69A 4M7YA 4XH1A 5C0YA 1Z05A 2FXUA 3R8EA 1E4GT 1RFQA 1M90O 4FWOA 1GLBG 3IKMA 2P9LA 1YVNA 2QXLA 3OBYA 2J4RA 2KHOA 3VGLA 2WUSA 1ZBSA 1U6ZA 1VAZA 3IFRA 1NGGA 3O1WA 2QA4N 4M63C 4MLHA 2GWKA 3JS6A 2EWSA 4HWIA 4RCHA 1Q82O 1K9MO 4L3QA 3CCUN 5AQWA 2JWKA 2JWLA 3MCAB 5EVZA 1KAXA 1QZ5A 5DM7L 5AQQA 3EKSA 4GV9A 3AAQA 3MN7A 2ASOA 4PHTX 4JKGA 1VQ4N 2I7NA 3DJCA 2NRRA 2YHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVY A;  3G6E N;  4IOC L;  3G4S N;  1YIT N;  2OTL N;  3CCV N;  1KQS M;  1Q81 O;  3CME N;  2ZJP L;  4WFB L;  3CC4 N;  1KC8 O;  3OW2 M;  1W2B M;  3CF5 L;  3CPW M;  5MLC Q;  3CCQ N;  5GAH P;  4U67 L;  3I55 N;  1YIJ N;  1N8R O;  5HL7 L;  1VQ8 N;  1VQ7 N;  1M1K O;  1YJN N;  2ZJQ L;  3CCR N;  3G71 N;  3J7Z O;  1YI2 N;  4IOA L;  1YHQ N;  1Q7Y O;  1YJ9 N;  1ILY A;  1VQ6 N;  2ZJR L;  2QEX N;  1VQO N;  3CCS N;  3CCM N;  4UY8 O;  1VQP N;  1QVF M;  5JVG L;  3DLL L;  5GAE P;  1JJ2 M;  5GAG P;  3CC2 N;  4WFA L;  1VQ5 N;  3CMA N;  4WCE L;  2OTJ N;  3CCL N;  1S72 N;  3PIP L;  1KD1 O;  1VQL N;  5JVH L;  5DM6 L;  3CD6 N;  1VQN N;  3CXC M;  4WF9 L;  1K73 O;  3CCJ N;  1VQK N;  1Q86 O;  3CC7 N;  5H1S Q;  1QVG M;  5GAD P;  1M90 O;  1K8A O;  1VQM N;  3I56 N;  4IO9 L;  2QA4 N;  1VQ9 N;  1Q82 O;  3CCE N;  1NJI O;  1K9M O;  3CCU N;  4WFN L;  5DM7 L;  3PIO L;  1VQ4 N;  1YJW N; 
#chains in the Genus database with same CATH topology
 4Z4H A;  4X64 K;  4BC3 A;  3M5R A;  1BCM A;  4MO5 A;  4DSK A;  2YHB A;  4Y1C A;  2RE2 A;  3SI6 A;  2G8F A;  2A6A A;  1X3N A;  1T6D A;  3VGM A;  2ZM6 K;  3V9W A;  3ENH A;  3TPQ A;  1QZ6 A;  3DXM B;  3CCV N;  3CYM A;  2P9P B;  3J80 O;  5AQR A;  1SKR A;  3GOI A;  4RW4 A;  2KZM A;  3H45 C;  4K41 A;  3U3G A;  3ZT2 A;  1BIU A;  2A3Z A;  5KPZ A;  4I9L A;  4GV3 A;  3J7Y P;  2QWM A;  2BAN A;  1G99 A;  1NNE A;  4DU3 A;  4B9M A;  4F2R A;  1N6Q A;  1RTD A;  3DLE A;  2O8E B;  1RTI A;  1VQ8 N;  2PFU A;  2R7Y A;  5IWA K;  3PY8 A;  1ASW A;  1NKB A;  1JLE A;  3AO5 A;  3QET A;  4DTP A;  1C0M A;  3LP0 A;  1CZ9 A;  2HB5 A;  3K9K A;  1FJG K;  3WXJ A;  1JXE A;  4E7J A;  2BDP A;  2P1J A;  1SAZ A;  4CEF A;  3O9U A;  3L2V A;  3D2E A;  4B9T A;  3IMX A;  5AQK A;  4H5N A;  3L2W A;  2O8C A;  4DTX A;  4B1W B;  2CH5 A;  3C7N B;  1RT4 A;  4HCB A;  2HBM A;  1VQP N;  4CF2 A;  2AJQ A;  1BG3 A;  4EHU A;  1TVR A;  5AFU A;  3C95 A;  4BQZ A;  4O8K A;  4BRN A;  1K6Y A;  4CZI A;  2Q1N A;  5M1Q A;  1NJZ A;  3CXC M;  5ADX H;  4DQR A;  4DSI A;  1YT3 A;  3KHY A;  3A5N C;  4FWK A;  1N32 K;  2IDO A;  3DLK A;  3S41 A;  3OYC A;  4F3O A;  3TWH A;  3E1Y A;  4CHP A;  3OS1 A;  3O4Q A;  4A5A A;  5BRH A;  4J8F A;  1DKG D;  3QB0 A;  1IKY A;  1S1U A;  4YOX A;  3AA3 A;  3ZT3 A;  5M1F A;  3WXI A;  4JKB A;  3VTH A;  3VQ5 A;  3RR8 A;  4CER A;  1N34 K;  3PIO L;  3MEC A;  3SQ4 A;  1QQC A;  4IO8 A;  4CJV A;  2OCE A;  2PYJ A;  3OJS A;  3MED A;  5HBM A;  4J2B A;  3ZET B;  3ATU A;  4KTQ A;  3KWI A;  3MXJ A;  3I8B A;  3L8B A;  5GIN A;  1N5Y A;  2B6A A;  1OH8 A;  2UU9 K;  1MU2 A;  3OYH A;  2FBY A;  1MA9 B;  1U47 A;  4O5F A;  3VMF B;  4DR1 K;  2ITM A;  1DEJ A;  4M41 A;  4F9O A;  4CIE A;  2QXF A;  5TKY A;  2RF2 A;  5HRP A;  5KQ8 A;  3L3U A;  3PV8 A;  1LWF A;  3A2F A;  2HNY A;  3HYF A;  1JLA A;  1BI4 A;  4W5T A;  4ELT A;  2F7T A;  2VYP A;  3LDQ A;  2E1Y A;  2ZJQ L;  5GIO A;  3ZX3 A;  4CES A;  4RW8 A;  4RG8 A;  4FJL A;  3MN5 A;  1TL3 A;  4CGD A;  1HX1 A;  4DFP A;  4FWM A;  2E88 A;  1HRH A;  5AQP A;  4A57 A;  4KB1 A;  4FLY A;  4CGG A;  3O08 A;  2YNI A;  4BG8 A;  3OYA A;  5K14 A;  3ATV A;  1Z6R A;  5AZI A;  2G8V A;  4FK0 A;  1EQY A;  2HHU A;  4RTF D;  3AA2 A;  1RDA A;  1HPM A;  3Q7B A;  3QES A;  4R79 A;  1XNQ K;  1IO2 A;  3DXK A;  2GV9 A;  4N56 A;  3KKR A;  3TAE A;  3VEW A;  3TSQ A;  4EP4 A;  3HVR A;  5H1S Q;  4FJM A;  1NLV A;  5GAD P;  3MXM A;  3SK3 A;  4IXC A;  1D4X A;  4O4G A;  3RMD A;  4CFA A;  3VQB A;  4IO9 L;  1RGI A;  3IS9 A;  3VQC A;  1U2V A;  1X3M A;  3KWG A;  4M3X A;  2NRT A;  1NOZ A;  3WT0 A;  3TAQ A;  1NJX A;  4QAG A;  1NGH A;  4BR0 A;  3H3N O;  4FK2 A;  3FLC O;  4B3T K;  2NRZ A;  2D1K A;  4CEZ A;  4FJH A;  3WNF A;  1K8K A;  3NHG A;  1OVY A;  3G10 A;  4AHU A;  1BA1 A;  4LF8 K;  1NGD A;  5EU7 A;  4IDK A;  4GKK K;  5KGW A;  3KKS A;  4KV8 A;  3CME N;  5J2Q A;  1TV6 A;  2Q97 A;  1YXQ A;  4MQ3 A;  4IG3 A;  2Q36 A;  1C1A A;  3KLI A;  1NU0 A;  1WAF A;  4FJN A;  3LPT A;  4RW7 A;  4JK8 A;  4DV4 K;  2OZS A;  4FWR A;  4BRA A;  3OY9 A;  4BRK A;  4CZF A;  4FOE A;  2IVN A;  2BTF A;  1KCF A;  2OA8 A;  4BRL A;  1GOB A;  1S5J A;  1HPZ A;  3OYD A;  3D0P A;  4DV3 K;  4CEA A;  1Q8I A;  3OYG A;  3O80 A;  1SL1 A;  3HP6 A;  1KFD A;  3HJF A;  1DGK N;  4LF5 K;  3C94 A;  3AO1 A;  4NYF A;  5JS1 A;  1VRT A;  3CET A;  3KIO A;  3OA9 A;  2ETJ A;  4QS9 A;  4BRE A;  4CGI A;  4BR2 A;  1MDU B;  1NBW A;  2E2Q A;  4HVJ A;  3OJU A;  3CFO A;  3WNE A;  4DV5 K;  5LMU K;  1U04 A;  3THX B;  3PIP L;  3ENO A;  3ULD A;  2NRW A;  1HKC A;  2UUA K;  4M3U A;  3M1F A;  3VQD A;  2QTD A;  1JCG A;  4C8K A;  2O4I A;  1Q86 O;  4QCL A;  4NXN K;  3VQ9 A;  1C1C A;  4FM1 A;  1JLQ A;  5FPE A;  1IBM K;  1ZYQ A;  2VWK A;  1NGI A;  2YKN A;  4DQI A;  3SUP A;  1ZBH A;  1MWM A;  4GMJ B;  3RTV A;  4DLG A;  2HOE A;  3SQ1 A;  2HHH K;  3E66 A;  3M8S A;  4BGA A;  4EZ6 A;  4CGH A;  3I8D A;  4FWP A;  3EYZ A;  1S9G A;  3O9S A;  2Q0U A;  5M1K A;  3QER A;  3HM8 A;  1IBK K;  5A2Q O;  4DR5 K;  1V4T A;  5CZ1 A;  2Z1H A;  5LJW A;  5DK5 A;  5BPL A;  5SWM A;  4PKI A;  2KW4 A;  4J2D A;  3O5B A;  4HUF A;  3P83 D;  3FZK A;  3VOV A;  4GV6 A;  2QWN A;  5AZJ B;  4J2E A;  3MWT A;  5HOO A;  2YHA A;  3ZEU A;  3VA0 A;  3SQ0 A;  4E19 A;  4LF6 K;  4B3R K;  4QOZ B;  4CJS A;  3V81 A;  3MEG A;  1LAV A;  4CVN E;  1RDW X;  3LDO A;  3C0B A;  3K58 A;  1Q9X A;  4JI4 K;  4DUZ K;  1NGF A;  4B9U A;  1U4B A;  3THW B;  3VQ7 A;  4B1Z A;  3C6A A;  1NWK A;  3QDK A;  2W41 A;  1VSE A;  4OO1 J;  4HUE A;  4KI4 A;  4CBX A;  3F73 A;  4BGB A;  2VWJ A;  4BE0 A;  4JKD A;  3VA3 A;  2KKZ A;  1Q18 A;  2O8C B;  3QFP A;  3U8X A;  3OYF A;  4FWS A;  3EY1 A;  4CIF A;  4HHT A;  2F8T A;  2HBL A;  3CG7 A;  1NMD A;  2E2O A;  4B9N A;  4IEE A;  1NK4 A;  3T69 A;  4B3M K;  2O8D A;  1Z05 A;  3L2U A;  3M8Q A;  1M90 O;  1DTQ A;  4FJ8 A;  1YVN A;  3VGL A;  1ZBS A;  2WUS A;  4E1N A;  4DTN A;  3TAG A;  5HRS A;  1WBB A;  3KK2 A;  3IAY A;  4FLU A;  2G8U A;  3DLG A;  1KAX A;  4NYN A;  1XI1 A;  1J5O A;  3EKS A;  4JKG A;  4KHY A;  3P1G A;  4DQS A;  1VQ4 N;  2I7N A;  2HHV A;  4BQL A;  3C6U A;  3T7Z A;  3EEQ A;  3TTC A;  4DQQ A;  4DKW A;  3QLH A;  5IT9 O;  3PX4 A;  3DXK B;  1L3U A;  1IKW A;  4JHD B;  4I9Q A;  4CD3 A;  4CI6 A;  2QKK A;  3FZM A;  5I9E B;  3CI5 A;  4O8U A;  2WON A;  4AHT A;  1LV5 A;  2D4W A;  1QHT A;  4ZHR A;  1HQE A;  3LP2 A;  3NH0 A;  4GKJ K;  1X9S A;  4H4M A;  4BR5 A;  3NCI A;  3QIO A;  1UOC A;  3JXU A;  5M1N A;  4O44 A;  2XY7 A;  1D8Y A;  3V1R A;  3P38 A;  2UYT A;  1HNZ K;  4IKF A;  1GLF O;  4NO7 A;  1JCE A;  3TSP A;  3J81 O;  1QE1 A;  3VF6 A;  1F21 A;  2AP1 A;  3L4I A;  3J7Z O;  1QHA A;  1XMQ K;  1WUA A;  2E6M A;  2E1Z A;  1HQU A;  2Q3S A;  3SUQ A;  3UKU B;  4B8A B;  4UY8 O;  4MO4 A;  1X9J A;  4B9S A;  1YTA A;  4GVM A;  3CJC A;  3KK1 A;  1VSD A;  3L4Q A;  3MMV A;  3SBT A;  3AVM A;  4BR4 A;  4AH9 A;  4G1Q A;  4X65 K;  4G9Z A;  3CCL N;  3ALY A;  1LWE A;  2O8B B;  1EX4 A;  1JKH A;  4YOU A;  2FBT A;  1HLU A;  1VQN N;  5BRD A;  5AZJ A;  1GOC A;  5LMN K;  1OH5 A;  1BU6 O;  3QIP A;  5ELZ A;  5I3U A;  1FXX A;  4XH5 A;  4H0T B;  4BC4 A;  1NGJ A;  4FO0 A;  3DLH A;  1C0T A;  3GBT A;  2PZS A;  2NRV A;  2ZD1 A;  4IWV A;  2YJF A;  3THW A;  5AQH A;  4WYB A;  4FPB A;  5M1P A;  2GBZ A;  1SKW A;  4WQ5 C;  4ID5 A;  2P9N B;  5C10 A;  4Z0U A;  3V1Q A;  1X9W A;  1GLJ O;  4JS5 A;  2Q0R A;  4DFM A;  4BDZ A;  3K57 A;  3WXK A;  3NH1 A;  1TL1 A;  4W5Q A;  3KLG A;  1JL1 A;  2VQE K;  4YDU A;  4CED A;  3AGR A;  3OS2 A;  4ZTF A;  4I7F A;  1FKO A;  1Q81 O;  1WSH A;  5B8H A;  3KK7 A;  1KSP A;  1T44 A;  3D6R A;  4KTZ A;  3OW2 M;  4JI7 K;  4BDP A;  3I33 A;  4PUO A;  4V19 S;  4FLT A;  5MLC Q;  4X62 K;  4CZJ A;  3SMS A;  5BN9 A;  2ZGZ A;  4FJ5 A;  4B9L A;  1NK9 A;  1BQN A;  1R0A A;  1IKV A;  3M8P A;  1ASU A;  3HK2 A;  4CHY A;  1U45 A;  1NGE A;  4KTW A;  2GUI A;  5C25 A;  3NAE A;  3HP9 A;  3A5M C;  3EZW A;  4KH5 A;  2I5J A;  4OLB A;  1LOT B;  5FLX O;  4WQ4 A;  3DLR A;  3T19 A;  3VET A;  3C7N A;  3MAQ A;  1ZC6 A;  1YHQ N;  4JI0 K;  4MLE A;  5FRN A;  2ATQ A;  4AQY K;  1Q7Y O;  4YOT A;  5SZT A;  1ZBU A;  2D0A A;  3FE1 A;  4DSL A;  5F1X A;  4CGJ A;  2OPR A;  4JKC A;  4CFD A;  3DAW A;  2E20 A;  1S6Q A;  1Y97 A;  1VSK A;  3QNN A;  1WSG A;  1XUP O;  1RT6 A;  3G0Z A;  4BC2 A;  3H08 A;  3LAN A;  3LDL A;  4DCH A;  2YI1 A;  4JRQ A;  3HOT A;  1TGO A;  4KH6 A;  1RT1 A;  3NGY A;  4FM0 A;  3TAM A;  4CFB A;  2VCP A;  3U3Y A;  4JI2 K;  2D0O A;  4M3Z A;  3OVN A;  3PSF A;  3L0Q A;  4CK1 A;  1W0H A;  2W40 A;  3A5O C;  2A1R A;  2BUP A;  4BRD A;  2X6S A;  4FWQ A;  4KBO A;  4BG9 A;  3L6Q A;  5C15 A;  4WFN L;  4CEO A;  3R1X A;  2G8H A;  3PO5 A;  1QQO A;  4OPH A;  4TSX A;  5AQN A;  3C65 A;  2LSN A;  3NDK A;  4FK4 A;  2QWP A;  4FWL A;  2UUC K;  3ZET A;  1U48 A;  3G6E N;  3UE5 A;  2BGG A;  2E8A A;  3TTF A;  3SPY A;  2OPP A;  2XY6 A;  2PAV A;  3CHW A;  1RBS A;  3EZ5 A;  4OPJ A;  2HND A;  2YNG A;  1RDC A;  3BZC A;  1BA0 A;  4RWT A;  4KHP K;  2NNW A;  4KRE A;  3CF5 L;  1TAU A;  3JYT A;  4B1V A;  4W5N A;  1HR0 K;  3QEX A;  3TAB A;  1HKB A;  3D2F B;  1XHX A;  3MN6 A;  1HUX A;  3H1V X;  1EKE A;  3CIP A;  4FJJ A;  3O9R A;  2YKM A;  4JNE A;  1BL3 A;  3SAH A;  3VQ6 A;  5EOY A;  4AHR A;  1VQ7 N;  1CLQ A;  4BR9 A;  3SJJ A;  3TI0 A;  1C0U A;  3RMB A;  2HHQ A;  3AVK A;  3SUN A;  2UXB K;  2DTU A;  2YHX A;  4CZM A;  3ZSY A;  3UKR A;  1IH7 A;  1CZB A;  2XY8 A;  4OKJ A;  4FJG A;  3QEV A;  4XH4 A;  1S1V A;  1HNW K;  3VQP A;  3W3D A;  1WSJ A;  2QEX N;  2IVO A;  4ISG A;  3KZB A;  1CXU A;  1N36 K;  3LDN A;  3TTD A;  1KAZ A;  4CK3 A;  1A5X A;  2HHX A;  2VG7 A;  4ELU A;  2BH1 A;  1HJO A;  2FC0 A;  4W5R A;  3UB5 A;  5FRO A;  2HVI A;  2HVH A;  2HST A;  1A5W A;  2DFE A;  4CZH A;  4CHQ A;  3ZSV A;  4BRC A;  1BWF O;  2ZGY A;  1KAY A;  3OYK A;  2P9U A;  1VQK N;  4DF8 A;  1J6Z A;  3AVL A;  3D7E O;  4C1N I;  2X74 A;  3O4N A;  1J9A A;  1I3A A;  4OVL A;  4PQU A;  1K8A O;  3HI0 A;  2P9S B;  3AY9 A;  3L2R A;  3DMJ A;  3NVK A;  3R9P A;  2VGM A;  4DUY K;  4YOW A;  3HT3 A;  5T7B A;  4E3S A;  4H5T A;  4ISF A;  1VSL A;  2D0B A;  3MWP A;  2ZQB A;  3UKU A;  4FJI A;  2W6L A;  4K8Z A;  3TR8 A;  2DPN A;  1E4F T;  2RHK A;  3WXM B;  1C0F A;  4PKH A;  3ENB A;  2QWQ A;  4DFK A;  1SQK A;  3MEE A;  4LSL A;  1KQS M;  4JKA A;  1IV0 A;  4PA1 A;  1QTM A;  4I6M A;  5AJ3 K;  3MX2 A;  4DR3 K;  5E41 A;  3DXM A;  4H0P A;  1W2B M;  3CER A;  4H0X B;  3MN9 A;  2NLX A;  1XC3 A;  3DYA A;  2E2N A;  4BWJ A;  4JD2 A;  5GAH P;  4HUG A;  4DV2 K;  5KGX A;  1NK0 A;  5I42 A;  3LDS A;  5JIC A;  3VQ4 A;  4DTM A;  3QBW A;  3N4P A;  1IBL K;  1RTJ A;  2NRX A;  1EWR A;  3SNN A;  2NRH A;  2VGN A;  1TKX A;  2GEM A;  3FZH A;  4KKO A;  4EIA A;  3WNH A;  5AQX A;  3D45 A;  1NGB A;  4C8N A;  1GLC G;  1LCU A;  1WSI A;  5AQV A;  5C42 A;  4FWN A;  4CEB A;  3OYL A;  4BC5 A;  3LWL A;  3H46 O;  3R6M A;  3THX A;  1REV A;  1S1T A;  4BWM A;  2Q2R A;  1A5V A;  5AQF A;  3OHR A;  4K43 A;  1RT5 A;  4H03 B;  3IRX A;  3H6E A;  3AVA A;  4EZ9 A;  5DM6 L;  3ISN C;  4WF9 L;  4FJX A;  4FZX C;  5J2N A;  1W97 L;  3J7A P;  4ZTJ A;  4R5P A;  4XH1 A;  2O8B A;  5C0Y A;  2KTQ A;  2IGI A;  5CY4 A;  3OBY A;  2J4R A;  2KHO A;  1U6Z A;  3IFR A;  3ZSR A;  4DR2 K;  3JS6 A;  2EWS A;  4HWI A;  3OYM A;  3CCU N;  5AQW A;  1TK8 A;  2JWK A;  2WTU A;  3MCA B;  4FZZ A;  5DM7 L;  3T1A A;  2ASO A;  3NGI A;  3MXI A;  3QIN A;  4JS4 A;  3HM9 A;  4O0I A;  3LWM A;  2A1S A;  4FLZ A;  4CFC A;  4BY9 C;  3PSI A;  2CGJ A;  3KD5 E;  1YIT N;  3M3Z A;  3NF9 A;  1ATR A;  3TSU A;  5HP1 A;  5C12 A;  4CF8 A;  3O3H A;  3ZX2 A;  3CJ9 A;  4FVU A;  1S1W A;  3O9Q A;  5KPR A;  4FJK A;  1YTU A;  2VG6 A;  2V52 B;  5JLH A;  3SLC A;  4HTU A;  3U9Z A;  3DWL A;  3E9P A;  3H3O B;  2ZF5 O;  1L3T A;  3WEE B;  4AHV A;  3OYB A;  2PBD A;  3CFR A;  3PLA A;  3VTI A;  4ISE A;  1N8R O;  2YHW A;  3W0L A;  3O1B A;  5AQT A;  4H0O A;  1BGX T;  1HMV A;  3A5L C;  1XC9 A;  4H5V A;  1QSS A;  4C8M A;  3B6O A;  1B92 A;  4DG1 A;  3KLF A;  2HF4 A;  3CFP A;  4KPY A;  2QK9 A;  5EX5 A;  3CQY A;  3BUZ B;  3O8M A;  4JI6 K;  2QWL A;  4JI1 K;  3DLB A;  2KFN A;  4ILH A;  1UAX A;  3OTO K;  1J5E K;  3K5L A;  4OKE A;  1LW0 A;  1IG9 A;  1C0G A;  2P9K A;  3NF8 A;  2Y1J A;  4YOR A;  1VSF A;  3E9O A;  3OS0 A;  4DTS A;  4CEC A;  3LL3 A;  3RRG A;  1VHX A;  4N47 A;  2Q31 A;  3CC7 N;  1GLA G;  5F0X A;  3DOL A;  1JLC A;  4C8O A;  1VQM N;  1KVA A;  1O1W A;  3MCP A;  1QQN A;  4B1Y B;  4AM6 A;  5BPN A;  3AVC A;  2H3G X;  3VES A;  2F8S A;  4A59 A;  4FVM A;  4YOV A;  5BR9 A;  3I0R A;  5FDL A;  5KPT A;  4I2Q A;  4B8C A;  2IIR A;  4CZK A;  4NCG A;  4YFU A;  4IG0 A;  1NK8 A;  2P9P A;  3JAM O;  3NMU A;  1WSE A;  1I94 K;  3K5O A;  1D9D A;  2UXD K;  4YY3 K;  1RDU A;  5FPM A;  4WE1 A;  2D5R A;  2ZJP L;  1BQM A;  4CEE A;  3LP1 A;  1RTH A;  3CPE A;  3PUF A;  3NF7 A;  3LDP A;  1T3V A;  3TAR A;  3M8R A;  3ZT0 A;  2OPS A;  3DOK A;  4FLX A;  4KRF A;  2FF6 A;  3TU5 A;  3F5T A;  3BY5 A;  4KHQ A;  1TK5 A;  1GOA A;  3EE9 A;  5HRN A;  2RKI A;  4Q5V A;  3LAM A;  1RBV A;  2FF3 B;  4FPA A;  1W7A A;  4BE1 A;  3LAK A;  2AA4 A;  4PL8 A;  4FSV A;  1UA1 A;  3UIQ A;  4CJ7 A;  3THV A;  4E89 A;  5CYQ A;  1HNI A;  3DRS A;  3GDQ A;  1RDB A;  2I7P A;  1KVC A;  5CZ2 A;  4CD1 A;  2KLA A;  1H1V A;  4CZG A;  1ILY A;  5FPN A;  1NJY A;  4LF4 K;  4JKE A;  4E7K A;  1NMN A;  4GW6 A;  4XEI A;  3ZT4 A;  4PKG A;  5JVG L;  4JN4 A;  3ITH A;  4CHO A;  3AVB A;  5AQY A;  2BE2 A;  2DFF A;  2IS3 A;  3L3V A;  2WBN A;  2GEL A;  3V9Z A;  3HST B;  3AVN A;  4DWI A;  3SMP A;  3RWU A;  3BF3 A;  4GVE A;  2UUB K;  1ZBF A;  3FR0 A;  3AA5 X;  4A5B A;  1XQS C;  4W5O A;  2E5L K;  4Q0B A;  4NXM K;  5BPM A;  4CCH A;  4FJ9 A;  1EXQ A;  2FSJ A;  2P5G A;  4BRP A;  1Z25 A;  5C2D A;  3SQ2 A;  4LSN A;  1NG9 A;  4LF7 K;  3CCE N;  2ASP A;  1WAJ A;  3HBT A;  1NJI O;  3PO4 A;  4DV1 K;  3WNG A;  3SZ2 A;  1BCO A;  4LFC K;  5F2R A;  3ZSO A;  4J2A A;  3HOS A;  4DHY A;  3LZJ A;  2Y1I A;  1ATS A;  3ULE B;  3NBP A;  3SPZ A;  4IOC L;  4EFH A;  2RN2 A;  1P90 A;  3HZ6 A;  4NB4 A;  1WOQ A;  2OTL N;  1LW2 A;  2HHT A;  5KTQ A;  4DU1 A;  3CC4 N;  4KHS A;  2P9I B;  4M45 A;  3CPW M;  1EO1 A;  4KO0 A;  4BVO A;  3K2P A;  1YUW A;  3QEI A;  4LH4 A;  3RMA A;  4CJL A;  4NCB A;  1SV5 A;  5LJV A;  4B08 A;  3NVM A;  1EET A;  1XNR K;  4MDB A;  3ZCM A;  1YIJ N;  1DLO A;  3VQA A;  3SJH A;  4A2A A;  3SYZ A;  4KH4 A;  5AR0 A;  1WBD A;  2ITG A;  4JRP A;  4FOI A;  4JI3 K;  2FSN A;  4DF4 A;  1QSY A;  4CJF A;  5BN8 A;  3OYI A;  3TAF A;  4DV7 K;  5AQZ A;  3VQE A;  5AZI B;  1YI2 N;  4GNI A;  3VF2 A;  4Y1D A;  3N4Q A;  1X9M A;  4B3O A;  1YJ9 N;  1G15 A;  2ZJR L;  4OPA A;  1YAG A;  1KXP A;  4CE9 A;  3RSE B;  1IG8 A;  4KAZ A;  5FRM A;  2JGU A;  1U49 A;  5GAG P;  3AO3 A;  3T3F A;  2VG5 A;  4M7X A;  3BZK A;  2OTJ N;  3O3G A;  4DR4 K;  5JVH L;  1WLJ A;  3S3O A;  1ZXO A;  4ILJ A;  3ID8 A;  3ZSX A;  3VQ8 A;  4HTL A;  5BRE A;  4YNQ A;  3THY A;  1QQM A;  3MK6 A;  2ZE2 A;  4IFV A;  1R59 O;  3V9U A;  1CXQ A;  3HPH A;  3GE1 A;  3KVG A;  5C24 A;  4Y0W A;  1QSL A;  3DI6 A;  2B4J A;  3ULE A;  4I2P A;  3VEV A;  1I39 A;  5BRF A;  3IUC A;  2OAN A;  3OBW A;  1YJW N;  4BR7 A;  1OVQ A;  2WFB A;  4XIU A;  1SS6 A;  3G4S N;  3ZSQ A;  4DSE A;  2O4G A;  5AQJ A;  3VF4 A;  3WQU A;  3K5M A;  5J2M A;  3E9L A;  3NH2 A;  4EAH D;  4M3Y A;  4DB3 A;  1UA0 A;  5EXW A;  4Z4I A;  4AM7 A;  3BF1 A;  4CF0 A;  5JLF A;  1KC8 O;  3V1O A;  4K8X A;  4QS8 A;  3SUO A;  4AIL C;  4BRH A;  4KFB A;  4FW2 A;  2HHW A;  3WQT A;  4CJK A;  3S3N A;  1EWQ A;  3I0S A;  1RBR A;  1TYQ A;  4FCY A;  4CHZ A;  2X6N A;  4IDH A;  2F9T A;  3I55 N;  3U9D A;  1RT7 A;  3U6F A;  4CBW A;  3WEE A;  1XHZ A;  5HL7 L;  1M1K O;  4LY7 A;  2Z1G A;  3S3M A;  1YF5 L;  1ASV A;  2O8E A;  4DQ8 A;  3G71 N;  3P4I A;  4IOA L;  3Q7C A;  3AA4 A;  3RSE A;  4BRF A;  4AF1 A;  4MDA A;  2HF3 A;  3LM2 A;  1BOT O;  2EX3 A;  3L2Q A;  4BRI A;  4FW1 A;  2V7Y A;  2GUP A;  3F9M A;  2GTD A;  4H8K A;  4WFA L;  1S1X A;  3AVJ A;  2KQ2 A;  4IFY A;  4LD0 A;  3GG4 A;  1WN7 A;  4DV0 K;  3AVG A;  2P9I A;  3EN9 A;  1HJR A;  2Z1I A;  4H5R A;  3VN5 A;  2F4V K;  2HMP A;  4OLA A;  4DSJ A;  1J53 A;  1TAQ A;  4M7Y A;  2FXU A;  3R8E A;  4FWO A;  1GLB G;  3SV4 A;  2P9L A;  2QXL A;  4E0D A;  1VAZ A;  1NGG A;  1FK9 A;  4DV6 K;  1BIS A;  1KVB A;  2GWK A;  4RCH A;  3ASM A;  1E3M A;  4E7H A;  2JWL A;  1QZ5 A;  2HNZ A;  3CM5 A;  4L8R B;  4DTR A;  4OGE A;  3MN7 A;  4PHT X;  4GV9 A;  1T7P A;  2NRR A;  2YHY A;  2WOM A;  3VEY A;  4DU4 A;  3HPG A;  4JI5 K;  1S3X A;  4E1J A;  4FLW A;  4JK7 A;  2FLO A;  2GWJ A;  4CK2 A;  5TKW A;  1ZBL A;  2YCH A;  1JLG A;  1TK0 A;  1OH7 A;  4B1U B;  4WFB L;  3NF6 A;  4OPK A;  2VQF K;  2VWB A;  2A40 A;  4C1N K;  1L5U A;  1OKJ A;  2CGK A;  3QEW A;  2QKB A;  4CJW A;  3SAG A;  4B1X B;  5AQL A;  1RNH A;  3VER A;  4DS5 A;  1GLD G;  5J1E A;  3DM2 A;  5AQS A;  4A2B A;  3IG1 A;  1ESV A;  4U67 L;  4AHC A;  5J2P A;  3C6H A;  4RW6 A;  3OYJ A;  1VSH A;  4JYA K;  2YV0 X;  3QFU A;  4CJ5 A;  3QO9 A;  4B9Q A;  3R3L A;  1YJN N;  5LL6 Z;  5E26 A;  4WQ5 A;  4CJ4 A;  4BDY A;  1HNX K;  2XO7 A;  1K8K B;  1C1B A;  4H0V B;  3P5J A;  3LPU A;  1DTT A;  4CJ3 A;  3TAP A;  3K0S A;  3CCS N;  5AQI A;  3ZLJ A;  4CJR A;  4CJP A;  4YDU C;  3RR7 A;  3PX0 A;  1JJ2 M;  2HHS A;  4F4K A;  2HBJ A;  4JK9 A;  2OYQ A;  4O0J A;  3RVC A;  4C23 A;  4I6M B;  4BRM A;  1T8E A;  3KK3 A;  3D2F A;  3QNO A;  3KTQ A;  3VEX A;  4JKF A;  2XY5 A;  2UXC K;  4DR7 K;  2O8F A;  4JD2 B;  1NJW A;  5D3G A;  1TYQ B;  3QIC A;  4CGF A;  3OYN A;  1P8Z A;  3CQ8 A;  2F96 A;  4GY2 B;  4KB0 A;  3NGZ A;  1VQ9 N;  3AO4 A;  4JKH A;  3PX6 A;  4JEP A;  4CZL A;  5KRS A;  4OJR A;  1NOY A;  2V7Z A;  1KTQ A;  3CJB A;  2E2P A;  3HPO A;  2NUB A;  4F2S A;  4IFE A;  3C6T A;  4UQG A;  1JL2 A;  1IJJ A;  1ATN A;  1SZ2 A;  4IEI A;  4X66 K;  2D0P A;  1WNS A;  2XRI A;  3S9H A;  3A0I X;  3V9S A;  2YJE A;  4OGC A;  3CQX A;  1XWL A;  2EHG A;  1T03 A;  4N76 A;  4FYD A;  1BO5 O;  1SL0 A;  4NLB A;  3K59 A;  3HTV A;  1FKP A;  3P31 A;  3DRP A;  1KFS A;  4DR6 K;  4E7I A;  2DFH A;  1TKD A;  3FZF A;  4E1M A;  4JAX A;  3CCQ N;  3CJ1 A;  1RCH A;  2P9S A;  4H0Y B;  3WUH A;  3ZSW A;  1V4S A;  4BE2 A;  3SCX A;  3BP8 A;  4CJE A;  1SUQ A;  2KFZ A;  5KI6 A;  3AAP A;  2W42 A;  5C2F A;  3VQQ A;  3LZI A;  4Z4E A;  2P51 A;  1RT3 A;  5AQG A;  3BEX A;  4DFJ A;  4LH5 A;  4NLC A;  1KLN A;  3O9T A;  1RIL A;  4M3R A;  1C6V A;  3JSM A;  5CYM A;  1NKC A;  5AQU A;  2V51 B;  2RPI A;  2ASM A;  1S6P A;  2A5X A;  4LFA K;  1WSF A;  4E7L A;  5CHI A;  4CJU A;  2IC3 A;  3CCM N;  4IOX A;  1S9E A;  1QVF M;  3DLL L;  4M3W A;  3ZYY X;  1X1P A;  3CC2 N;  4FJ7 A;  5E84 A;  4LC9 B;  1VQ5 N;  3VEZ A;  4JHD A;  4F3T A;  4U7B A;  5HLF A;  1TUY A;  1KD1 O;  3ZEU B;  5AQO A;  4FLV A;  5KQD A;  2QWO A;  2ZWH A;  1VRU A;  3CJ7 A;  2A41 A;  2QM1 A;  1GLL O;  5AFU H;  2HW3 A;  3VEN A;  4IBN A;  2DY4 A;  5AQM A;  3CJA A;  4JLH A;  2P9U B;  3I56 N;  4HCC A;  4KHN A;  1BDG A;  3QBX A;  5M1O A;  2A42 A;  3AVI A;  2YX6 A;  1KLM A;  1NK5 A;  3EKU A;  4H4O A;  4M3T A;  4RW9 A;  4WQ4 C;  4CHN A;  4Z4G A;  1JCF A;  5JS2 A;  2HMI A;  4H5W A;  1Y64 A;  3AV9 A;  3VGK A;  1RBT A;  3OYE A;  1NM1 A;  5ADX A;  4O5B A;  4PY5 A;  3BDP A;  1QS4 A;  4A62 A;  4EP5 A;  4CEQ A;  1NGC A;  4MFB A;  1Z26 A;  2YNF A;  3ID6 A;  4QS7 A;  1VSJ A;  4CBU A;  4BVP A;  4KI6 A;  4FXD A;  1BIZ A;  1JLB A;  3HRG A;  3EO3 A;  2O8D B;  3LAL A;  4DQP A;  4KHU A;  5LY3 A;  1L3V A;  2B5J A;  2P9L B;  4CF9 A;  1OH6 A;  4JI8 K;  4AHS A;  2XHB A;  4BRQ A;  1VSI A;  1VSM A;  1O13 A;  1TUU A;  5CE3 A;  3T1H K;  2IAJ A;  2FSK A;  2JLE A;  3H1Q A;  1LWC A;  3NE6 A;  4ID1 A;  4K25 A;  4N5S A;  3BGR A;  5EY4 A;  2PYL A;  3KLE A;  3CCR N;  5HRO A;  2E6L A;  4F8R A;  3QML A;  2P9N A;  4N41 A;  2IOC A;  4Z4C A;  1JXB A;  3K9J A;  4EHT A;  5KRT A;  3ZX0 A;  2F9W A;  3MX5 A;  4DTU A;  1SKS A;  4PWD A;  4O55 A;  4K0K K;  2G8I A;  3AVH A;  1SL2 A;  4Z4F A;  5JMV A;  2NZT A;  1CZA N;  3HO1 A;  1D5A A;  3U4L A;  3WXL A;  3CD6 N;  3CCJ N;  2KZZ A;  4CJQ A;  1QVG M;  3A8Y A;  4K42 A;  3V9X A;  1U2V B;  4OX9 K;  1T6C A;  3O3F A;  1T05 A;  2CGL A;  1ZBI A;  3F2K A;  1FW6 A;  3KD1 E;  1J54 A;  3TAN A;  1BI4 B;  1HYZ A;  5CR4 A;  4Z94 A;  4DMN A;  3LM9 A;  5GIP A;  1UWB A;  2W6K A;  3GL1 A;  3D2E B;  1LAW A;  3MDQ A;  3HL8 A;  2FBV A;  4LFB K;  1L3S A;  2CH6 A;  2D0C A;  2YNH A;  4CZE A;  1Q9Y A;  3O4W A;  4YOY A;  4CJT A;  4C8L A;  4JKG B;  3HSC A;  4DSF A;  1B9F A;  3EL2 A;  1HYV A;  3B8A X;  4FZY A;  1XMO K;  3FGU A;  3G25 A;  3FZL A;  3HVT A;  3AAR A;  1VK0 A;  1JLF A;  2OPQ A;  4CIG A;  3E01 A;  3DRR A;  2Z1J A;  2QI2 A;  1HNV A;  3F9K A;  3LP3 A;  5FPD A;  2X78 A;  4BAC A;  1GLE G;  1BUP A;  1S22 A;  3FFK B;  4ELV A;  2IVP A;  3IDH A;  3P39 A;  1W9H A;  3SV3 A;  1IKX A;  4IZ9 A;  5HRR A;  3ZT1 A;  1TKT A;  2QWR A;  4DTO A;  1B9D A;  4BRO A;  4PL7 A;  3HXM A;  1KRP A;  4A61 A;  3UKR B;  3SBG A;  3KJV A;  1N33 K;  3KLH A;  3EE8 A;  3RMC A;  2PY5 A;  1DT9 A;  2WC9 A;  1NGA A;  4CF1 A;  3SAF A;  2G8W A;  4OKK A;  1BHL A;  2QW9 A;  3AVF A;  1D9F A;  1VQ6 N;  1VQO N;  4NCA A;  3RRH A;  2HBK A;  1NK6 A;  1MWK A;  3QEP A;  3AGK A;  3NFA A;  3J8A A;  5GAE P;  3CM6 A;  5BR8 K;  2OZM A;  3O6W A;  3B6P A;  3M6G A;  4DTJ A;  4IJN A;  2GX9 A;  4BRG A;  4CW7 B;  2P5O A;  3VEO A;  3VPZ A;  1HKG A;  3CMA N;  4WCE L;  1S72 N;  4LF9 K;  4KHW A;  1VQL N;  4IJA A;  1WB9 A;  4FL9 A;  1K73 O;  4FM2 A;  3THY B;  2P9K B;  4JV5 K;  4B3S K;  3K5N A;  4ILG B;  1RBU A;  5DMR A;  3V6D A;  1E4G T;  1RFQ A;  2FBX A;  3IKM A;  3ZSZ A;  4DLE A;  4M42 A;  1EP4 A;  3FFI A;  1NKE A;  3O1W A;  1RDD A;  2QA4 N;  4YHH K;  4DS4 A;  1HYS A;  2E4L A;  4ICL A;  4M63 C;  4MLH A;  2O8F B;  1Q82 O;  1K9M O;  4L3Q A;  1YVU A;  2G8K A;  5EVZ A;  1NK7 A;  1RT2 A;  3V4I A;  1ITG A;  4B9V A;  5AQQ A;  3AAQ A;  1TKZ A;  3T1Y K;  3AO2 A;  3DJC A; 
#chains in the Genus database with same CATH homology
 4BC3 A;  3M5R A;  4MO5 A;  3VEY A;  4BQL A;  3T7Z A;  1S3X A;  4E1J A;  2RE2 A;  4JK7 A;  3TTC A;  2A6A A;  4BY9 C;  1X3N A;  1T6D A;  3VGM A;  4DKW A;  2CGJ A;  2FLO A;  2GWJ A;  3ENH A;  1YIT N;  5TKW A;  2YCH A;  3TPQ A;  1QZ6 A;  3DXM B;  3CCV N;  3DXK B;  3M3Z A;  4JHD B;  2P9P B;  4CD3 A;  1ATR A;  3TSU A;  4B1U B;  5AQR A;  4CI6 A;  3FZM A;  4WFB L;  5C12 A;  5I9E B;  3CI5 A;  2VWB A;  4O8U A;  2A40 A;  3GOI A;  3ZX2 A;  4C1N K;  3CJ9 A;  4FVU A;  3O9Q A;  1OKJ A;  2CGK A;  5KPR A;  2D4W A;  3SAG A;  4B1X B;  2V52 B;  5JLH A;  3SLC A;  3H45 C;  4K41 A;  5AQL A;  3DWL A;  3U9Z A;  3VER A;  3E9P A;  3H3O B;  1GLD G;  2ZF5 O;  5KPZ A;  2A3Z A;  4BR5 A;  3WEE B;  4GV3 A;  5AQS A;  2PBD A;  4A2B A;  2QWM A;  1ESV A;  3JXU A;  4U67 L;  1G99 A;  5M1N A;  3PLA A;  3VTI A;  4ISE A;  1N8R O;  2YHW A;  3W0L A;  3P38 A;  2UYT A;  1GLF O;  3C6H A;  3O1B A;  2PFU A;  1VQ8 N;  4NO7 A;  3QFU A;  1YJN N;  5AQT A;  4B9Q A;  1JCE A;  3R3L A;  3A5L C;  4H0O A;  3TSP A;  5E26 A;  4H5V A;  3VF6 A;  3K9K A;  4WQ5 A;  3WXJ A;  2AP1 A;  3L4I A;  3J7Z O;  1QHA A;  1SAZ A;  3O9U A;  3D2E A;  1WUA A;  3IMX A;  1K8K B;  5AQK A;  4H5N A;  2HF4 A;  4H0V B;  2E1Z A;  3UKU B;  4B1W B;  2CH5 A;  3C7N B;  5EX5 A;  3CCS N;  3CQY A;  5AQI A;  4UY8 O;  3BUZ B;  1X9J A;  3O8M A;  2QWL A;  2HBM A;  4MO4 A;  4YDU C;  1VQP N;  3CJC A;  1JJ2 M;  2HBJ A;  4ILH A;  4JK9 A;  1BG3 A;  4EHU A;  3L4Q A;  3MMV A;  5AFU A;  3SBT A;  4BR4 A;  4BQZ A;  4O8K A;  1C0G A;  2P9K A;  3RVC A;  4BRN A;  4YOR A;  4CZI A;  3CCL N;  4G9Z A;  2Q1N A;  5M1Q A;  3E9O A;  4C23 A;  4I6M B;  4YOU A;  4BRM A;  1HLU A;  1VQN N;  5BRD A;  3LL3 A;  3CXC M;  5AZJ A;  3D2F A;  5ADX H;  1BU6 O;  2Q31 A;  3CC7 N;  5ELZ A;  1GLA G;  3KHY A;  5F0X A;  3A5N C;  4XH5 A;  3VEX A;  4FWK A;  4JKF A;  4H0T B;  4BC4 A;  1NGJ A;  3S41 A;  4FO0 A;  1VQM N;  4JD2 B;  3GBT A;  1TYQ B;  3QIC A;  3E1Y A;  1P8Z A;  2NRV A;  4A5A A;  4IWV A;  4GY2 B;  2YJF A;  1VQ9 N;  5AQH A;  3MCP A;  1QQN A;  4JKH A;  4WYB A;  4J8F A;  4AM6 A;  4B1Y B;  5BRH A;  4FPB A;  5M1P A;  4JEP A;  4CZL A;  1DKG D;  3QB0 A;  5BPN A;  2V7Z A;  2H3G X;  3VES A;  4YOX A;  4A59 A;  3CJB A;  5M1F A;  4WQ5 C;  2P9N B;  3WXI A;  4YOV A;  4JKB A;  2E2P A;  3VTH A;  5BR9 A;  5C10 A;  5KPT A;  1GLJ O;  2IIR A;  3PIO L;  4IFE A;  4CZK A;  2Q0R A;  4IO8 A;  1IJJ A;  1ATN A;  1SZ2 A;  4IEI A;  3WXK A;  2D0P A;  2P9P A;  4YDU A;  3A0I X;  3AGR A;  2YJE A;  3NMU A;  3CQX A;  3ZET B;  3ATU A;  1BO5 O;  3KWI A;  1Q81 O;  1RDU A;  5FPM A;  3I8B A;  2ZJP L;  5B8H A;  4NLB A;  3KK7 A;  3HTV A;  1T44 A;  3D6R A;  3P31 A;  3OW2 M;  3I33 A;  5GIN A;  3CPE A;  1MA9 B;  3LDP A;  1T3V A;  5MLC Q;  4O5F A;  3VMF B;  4CZJ A;  2ITM A;  3FZF A;  1DEJ A;  3SMS A;  2FF6 A;  4JAX A;  3CJ1 A;  5BN9 A;  4F9O A;  3CCQ N;  3TU5 A;  3F5T A;  2P9S A;  4H0Y B;  3WUH A;  1V4S A;  2ZGZ A;  5TKY A;  3BP8 A;  5KQ8 A;  3EE9 A;  3AAP A;  5C2F A;  5AQG A;  3BEX A;  2FF3 B;  4FPA A;  4NLC A;  3O9T A;  2F7T A;  2VYP A;  1NGE A;  2AA4 A;  4PL8 A;  4FSV A;  3A5M C;  3EZW A;  2E1Y A;  3LDQ A;  4KH5 A;  2ZJQ L;  5GIO A;  1LOT B;  3ZX3 A;  4CJ7 A;  4WQ4 A;  5AQU A;  3MN5 A;  3GDQ A;  3VET A;  2V51 B;  1HX1 A;  3C7N A;  2I7P A;  2ASM A;  2E88 A;  2A5X A;  4FWM A;  5AQP A;  4A57 A;  1ZC6 A;  1YHQ N;  4MLE A;  4CD1 A;  3O08 A;  4BG8 A;  2KLA A;  1H1V A;  4YOT A;  1Q7Y O;  4CZG A;  5CHI A;  1ILY A;  5FPN A;  3ATV A;  3FE1 A;  1Z6R A;  4JKE A;  5AZI A;  4XEI A;  5F1X A;  1EQY A;  4IOX A;  4PKG A;  3CCM N;  4JKC A;  1QVF M;  5JVG L;  3DAW A;  4JN4 A;  2E20 A;  3DLL L;  3ZYY X;  1XUP O;  4RTF D;  3CC2 N;  5E84 A;  4LC9 B;  4BC2 A;  5AQY A;  1HPM A;  3Q7B A;  4R79 A;  1VQ5 N;  2WBN A;  2GEL A;  3VEZ A;  3DXK A;  4JHD A;  3SMP A;  3LDL A;  4DCH A;  2YI1 A;  4U7B A;  1TUY A;  3HOT A;  1KD1 O;  3BF3 A;  4GVE A;  3ZEU B;  5AQO A;  5KQD A;  2QWO A;  4KH6 A;  2ZWH A;  3FR0 A;  4A5B A;  3CJ7 A;  1XQS C;  3VEW A;  3TSQ A;  2A41 A;  2VCP A;  2QM1 A;  5BPM A;  1GLL O;  5H1S Q;  5AFU H;  1NLV A;  5GAD P;  2D0O A;  3VEN A;  3SK3 A;  4IXC A;  5AQM A;  3CJA A;  3L0Q A;  1D4X A;  2P9U B;  3I56 N;  2FSJ A;  4IO9 L;  1BDG A;  1RGI A;  3QBX A;  4BRP A;  5M1O A;  2W40 A;  2A42 A;  3A5O C;  5C2D A;  1U2V A;  1X3M A;  2YX6 A;  2BUP A;  4FWQ A;  4KBO A;  3EKU A;  4BRD A;  3KWG A;  3CCE N;  2ASP A;  4BG9 A;  2NRT A;  3HBT A;  3WT0 A;  1NJI O;  3L6Q A;  4WQ4 C;  5C15 A;  4WFN L;  5F2R A;  3R1X A;  1NGH A;  1JCF A;  3HOS A;  4BR0 A;  4DHY A;  3H3N O;  1QQO A;  4OPH A;  3FLC O;  5AQN A;  4H5W A;  1Y64 A;  2D1K A;  2NRZ A;  3C65 A;  3VGK A;  2QWP A;  1ATS A;  4FWL A;  3ZET A;  3ULE B;  1K8K A;  1NM1 A;  5ADX A;  1OVY A;  3G6E N;  4IOC L;  3UE5 A;  1BA1 A;  2E8A A;  4EFH A;  3TTF A;  4A62 A;  1NGD A;  1P90 A;  1NGC A;  3HZ6 A;  4NB4 A;  1WOQ A;  2OTL N;  2PAV A;  3CHW A;  3ID6 A;  4QS7 A;  4CBU A;  3CME N;  3CC4 N;  2P9I B;  4BVP A;  2Q97 A;  1YXQ A;  1BA0 A;  4RWT A;  3HRG A;  2NNW A;  2Q36 A;  3CF5 L;  3EO3 A;  4B1V A;  3CPW M;  1EO1 A;  4BVO A;  5LY3 A;  1YUW A;  2P9L B;  1HKB A;  3D2F B;  3MN6 A;  4JK8 A;  5LJV A;  1HUX A;  3NVM A;  3H1V X;  4MDB A;  3CIP A;  4FWR A;  4BRQ A;  4BRA A;  3O9R A;  1YIJ N;  1O13 A;  3SJH A;  4JNE A;  1TUU A;  4A2A A;  5CE3 A;  3SAH A;  4BRK A;  4CZF A;  4FOE A;  4KH4 A;  5EOY A;  2IVN A;  2BTF A;  5AR0 A;  1VQ7 N;  2FSK A;  4FOI A;  4BR9 A;  2FSN A;  3H1Q A;  4BRL A;  4K25 A;  5BN8 A;  5EY4 A;  5AQZ A;  2YHX A;  3CCR N;  4CZM A;  5AZI B;  3UKR A;  1YI2 N;  4GNI A;  3QML A;  2P9N A;  3O80 A;  3VF2 A;  4XH4 A;  3N4Q A;  3K9J A;  1DGK N;  1YJ9 N;  3W3D A;  4EHT A;  2ZJR L;  2QEX N;  4OPA A;  3CET A;  3ZX0 A;  1YAG A;  1KXP A;  2IVO A;  2F9W A;  4ISG A;  3RSE B;  1IG8 A;  3KZB A;  3OA9 A;  3MX5 A;  3LDN A;  5GAG P;  4QS9 A;  4BRE A;  4BR2 A;  3TTD A;  1MDU B;  1KAZ A;  1NBW A;  2E2Q A;  5JMV A;  2NZT A;  4M7X A;  1CZA N;  2BH1 A;  1HJO A;  2OTJ N;  3UB5 A;  3U4L A;  3PIP L;  3ENO A;  2HST A;  2NRW A;  3WXL A;  5JVH L;  1HKC A;  4CZH A;  3CD6 N;  1ZXO A;  4ILJ A;  4BRC A;  3CCJ N;  1BWF O;  2ZGY A;  3ID8 A;  3M1F A;  1KAY A;  2QTD A;  1JCG A;  2P9U A;  1VQK N;  1Q86 O;  1J6Z A;  3D7E O;  4C1N I;  1QVG M;  3A8Y A;  4K42 A;  4HTL A;  5BRE A;  1K8A O;  3HI0 A;  1U2V B;  1QQM A;  1T6C A;  2P9S B;  3MK6 A;  5FPE A;  3AY9 A;  2CGL A;  1R59 O;  3NVK A;  1NGI A;  3R9P A;  2VGM A;  3F2K A;  3GE1 A;  3KVG A;  4Y0W A;  5CR4 A;  4Z94 A;  4YOW A;  1MWM A;  3LM9 A;  2HOE A;  5GIP A;  3E66 A;  4H5T A;  4ISF A;  4BGA A;  3ULE A;  3GL1 A;  3VEV A;  3D2E B;  3MWP A;  3MDQ A;  4FWP A;  5BRF A;  3IUC A;  2OAN A;  3O9S A;  3OBW A;  3UKU A;  2Q0U A;  1YJW N;  4BR7 A;  5M1K A;  2DPN A;  3HM8 A;  1E4F T;  2WFB A;  2CH6 A;  1V4T A;  4CZE A;  1SS6 A;  2RHK A;  3WXM B;  3G4S N;  3O4W A;  4YOY A;  5LJW A;  4JKG B;  3HSC A;  5AQJ A;  3VF4 A;  3WQU A;  1C0F A;  5BPL A;  4PKH A;  3EL2 A;  3B8A X;  3E9L A;  3ENB A;  2QWQ A;  4EAH D;  1SQK A;  3FGU A;  3G25 A;  3FZL A;  4PKI A;  4DB3 A;  1KQS M;  3AAR A;  3O5B A;  4JKA A;  5EXW A;  4AM7 A;  3BF1 A;  4I6M A;  5JLF A;  1KC8 O;  3FZK A;  3MX2 A;  3VOV A;  4GV6 A;  2QWN A;  2QI2 A;  5AZJ B;  5FPD A;  3MWT A;  4QS8 A;  5HOO A;  3DXM A;  4H0P A;  1W2B M;  3CER A;  1GLE G;  4H0X B;  1BUP A;  3ZEU A;  1S22 A;  3FFK B;  3MN9 A;  4BRH A;  2NLX A;  1XC3 A;  2IVP A;  3IDH A;  3P39 A;  2E2N A;  3WQT A;  4JD2 A;  5GAH P;  1RDW X;  3LDO A;  1TYQ A;  3C0B A;  4IZ9 A;  1NGF A;  4IDH A;  2F9T A;  5JIC A;  2QWR A;  3I55 N;  3U9D A;  4BRO A;  3QBW A;  4CBW A;  3N4P A;  4PL7 A;  3WEE A;  5HL7 L;  4A61 A;  2NRX A;  3UKR B;  4B1Z A;  3C6A A;  3SBG A;  1M1K O;  2NRH A;  2VGN A;  1NWK A;  3QDK A;  2GEM A;  2W41 A;  3FZH A;  3EE8 A;  4EIA A;  1DT9 A;  2WC9 A;  5AQX A;  1NGA A;  1YF5 L;  3SAF A;  4OO1 J;  4DQ8 A;  3G71 N;  3P4I A;  1NGB A;  4IOA L;  1GLC G;  1LCU A;  5AQV A;  4CBX A;  3Q7C A;  4BRF A;  3RSE A;  4FWN A;  4AF1 A;  4MDA A;  4BGB A;  2QW9 A;  4BC5 A;  2HF3 A;  3LM2 A;  1VQ6 N;  1BOT O;  1VQO N;  4JKD A;  3H46 O;  2HBK A;  3R6M A;  1MWK A;  3AGK A;  4BRI A;  2KKZ A;  1Q18 A;  2V7Y A;  3J8A A;  3QFP A;  5GAE P;  3U8X A;  2GUP A;  2Q2R A;  3F9M A;  2GTD A;  5AQF A;  3O6W A;  3OHR A;  3M6G A;  4K43 A;  4WFA L;  4IJN A;  2GX9 A;  4FWS A;  4BRG A;  4H03 B;  3VEO A;  3VPZ A;  1HKG A;  3CMA N;  3GG4 A;  3H6E A;  4WCE L;  1S72 N;  2HBL A;  1NMD A;  1VQL N;  2P9I A;  3EN9 A;  5DM6 L;  4IJA A;  2E2O A;  4FL9 A;  4H5R A;  4WF9 L;  1K73 O;  4IEE A;  2HMP A;  1W97 L;  2P9K B;  4ILG B;  3T69 A;  4M7Y A;  4XH1 A;  5C0Y A;  1Z05 A;  2FXU A;  3R8E A;  1E4G T;  1RFQ A;  1M90 O;  4FWO A;  1GLB G;  3IKM A;  2P9L A;  1YVN A;  2QXL A;  3OBY A;  2J4R A;  2KHO A;  3VGL A;  2WUS A;  1ZBS A;  1U6Z A;  1VAZ A;  3IFR A;  1NGG A;  3O1W A;  2QA4 N;  4M63 C;  4MLH A;  2GWK A;  3JS6 A;  2EWS A;  4HWI A;  4RCH A;  1Q82 O;  1K9M O;  4L3Q A;  3CCU N;  5AQW A;  2JWK A;  2JWL A;  3MCA B;  5EVZ A;  1KAX A;  1QZ5 A;  5DM7 L;  5AQQ A;  3EKS A;  4GV9 A;  3AAQ A;  3MN7 A;  2ASO A;  4PHT X;  4JKG A;  1VQ4 N;  2I7N A;  3DJC A;  2NRR A;  2YHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...