5HL7L

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
ISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2
publication title A novel pleuromutilin antibacterial compound, its binding mode and selectivity mechanism.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5hl7L01
4UY8O 1YJNN 1VQ7N 4WFNL 1JJ2M 3CCRN 3DLLL 3G71N 2QEXN 5GAEP 1M90O 1VQ6N 3CC4N 3CCSN 1K73O 2ZJPL 1YJ9N 1VQMN 3CCUN 1VQLN 1K8AO 3I55N 1VQ5N 1VQ9N 3CMEN 4U67L 5H1SQ 5GADP 3CCLN 1KC8O 5JVGL 3CCVN 1KQSM 3G4SN 1KD1O 1YI2N 1NJIO 1YHQN 3CXCM 3I56N 4IOCL 5HL7L 2QA4N 3CCEN 1QVGM 1S72N 4IOAL 1Q81O 5DM7L 1Q82O 3G6EN 3CC2N 4WFAL 2ZJRL 5DM6L 1QVFM 1YITN 5MLCQ 4WF9L 5JVHL 2OTLN 1ILYA 5GAHP 3J7ZO 3CC7N 1YJWN 1VQ4N 4IO9L 3CCQN 1VQ8N 3PIPL 3CD6N 1N8RO 3PIOL 2OTJN 3CCJN 4WCEL 3CPWM 2ZJQL 3OW2M 1K9MO 1W2BM 3CCMN 4WFBL 1OVYA 1Q7YO 1YIJN 1VQKN 1VQON 3CF5L 1Q86O 1VQNN 1M1KO 3CMAN 1VQPN 5GAGP
chains in the Genus database with same CATH superfamily
4B1XB 4N41A 2VG7A 3TARA 3DOLA 4E3SA 4JV5K 1ZBSA 2P9UA 4RW9A 4AHUA 3E66A 3AARA 3DLLL 1KVAA 4BDYA 3HXMA 3CCSN 3QDKA 2YKNA 4DQIA 4KHSA 4DU3A 4F8RA 3EO3A 1IKYA 1E4GT 3ZSZA 3U9DA 4DTPA 4DSKA 3DOKA 4JKFA 4DV7K 2YNGA 5HOOA 4OPAA 1FXXA 1FW6A 2D0CA 4CI6A 3MCAB 2QW9A 2F8SA 4M3YA 4H4OA 3VERA 3CXCM 1UA1A 4ISFA 4OPJA 2HVIA 4N5SA 3CYMA 3V1QA 2A40A 4DV3K 4LFAK 3GOIA 3LP2A 2HVHA 1TVRA 1T6CA 3IDHA 3LP0A 2FLOA 1IV0A 4B1VA 3CJ7A 4RW4A 2OPPA 1QVFM 3OYFA 4AM7A 2CGJA 3KK7A 4IG3A 1WB9A 2OTLN 1RBRA 4OPHA 5AQVA 4PKHA 3SAHA 2O8CA 5FPMA 4B1UB 4QS9A 1VQ8N 3PO4A 4C1NI 4FLWA 2UU9K 3CJ1A 4NB4A 1XMQK 4YHHK 2O8BB 4FM2A 1J9AA 5J1EA 4A59A 4CZKA 3CPWM 3J8AA 2RHKA 4HUGA 4B08A 3HP9A 1W97L 4JLHA 1KAZA 1CZBA 5AQOA 4KB1A 4RCHA 4CFAA 4KAZA 4IG0A 1U2VB 2I7PA 2HMIA 1D8YA 4YNQA 2HF3A 3ENBA 4DG1A 4KO0A 3OVNA 3A5NC 1TKXA 3VEYA 3IMXA 3KK1A 4M42A 4OLAA 2HHWA 2YI1A 4LSLA 4JI3K 1KRPA 3O3HA 1TKTA 3SPYA 3HVTA 4JI6K 2E2NA 5LL6Z 4NCGA 4IZ9A 3NGYA 4JKEA 2QWOA 4CZEA 3KVGA 1NOZA 1A5WA 2JWLA 3BZKA 1HUXA 1S3XA 4JI4K 1KCFA 5SWMA 1XNRK 1X9WA 3KK2A 4DUZK 1QZ6A 3K9KA 5EXWA 2V7ZA 1KD1O 2KW4A 4CJEA 3D2FA 3TAMA 4BWMA 2QWQA 2CH5A 1SL1A 4B9SA 3TWHA 3FFIA 4KHNA 2HBJA 5DK5A 3NF7A 1Q81O 4KRFA 2FBYA 1GLJO 4HCCA 4W5NA 3HO1A 4KH4A 1Y97A 1RT5A 1GLFO 3OYCA 5E84A 4JI8K 4BRQA 1BL3A 5KPRA 4CK2A 2BDPA 3AVJA 1N6QA 1TAUA 1NJXA 1G99A 4IBNA 1YTUA 4I6MB 1GLBG 2XO7A 3B6PA 3SUQA 2CH6A 3D2EA 3EKUA 5ADXH 4CHQA 1OKJA 5AQZA 3VPZA 1RDAA 3L8BA 3GG4A 3M1FA 3NMUA 4A2BA 1RTJA 5BRHA 3DXKB 5E26A 4BR9A 4YOXA 4FZXC 4NO7A 4CJVA 4UQGA 3KHYA 4B3MK 3LPTA 2BE2A 1HPMA 3V9SA 3O9SA 1UWBA 1VQKN 1VQON 4M3UA 5CHIA 1E3MA 1NKBA 4CFBA 4B1YB 4BC5A 1VSLA 4F2SA 5HRSA 5GAGP 4JYAK 1EXQA 3I0SA 5KPZA 3VQ8A 4WFNL 5CR4A 5GINA 3EZ5A 3R6MA 3VQBA 4DR3K 4FW1A 1QHTA 1GLEG 1G15A 5AQMA 1K73O 4CJ5A 5M1NA 2YCHA 4C8OA 1K8AO 3HI0A 2HHSA 4DSIA 1LV5A 4CF1A 2YNIA 3SAGA 2OPSA 3CCLN 4CEQA 3J81O 5JVGL 1ASVA 4BGBA 5AJ3K 1RBVA 2F7TA 2BGGA 3V9ZA 4H0VB 3WUHA 4CHZA 3UKUB 3RVCA 2QKBA 3CM5A 1RT2A 3CERA 4AHRA 3LZIA 4DV5K 1VSKA 3VQAA 4JKGB 1RBSA 2RE2A 1JXEA 1RDBA 3D6RA 4PHTX 1JL1A 4C8NA 3H1QA 3RR7A 4AH9A 4FLZA 3VEZA 5J2NA 1TL3A 4CEZA 4PUOA 4EHTA 2P51A 4W5QA 3WNGA 4BR0A 1YITN 3EE9A 4WYBA 1S6QA 2WUSA 1HQEA 4H03B 3IUCA 3AO4A 4JKCA 3HP6A 1ZBUA 3L3VA 4O44A 4H5NA 4FJ9A 3PX4A 2GUPA 5DMRA 3DLEA 3BP8A 1DEJA 4FVUA 2GWJA 1YXQA 3AVLA 3EL2A 2P9KB 3CCMN 2UUBK 4WFBL 3AAQA 1WAFA 1QQOA 3L2VA 3QEVA 5AQUA 1HLUA 2W6LA 3ZYYX 2ITMA 3CF5L 4IFVA 1HYVA 4H0OA 4EZ6A 3VGKA 3QNNA 4FJ5A 1BG3A 1A5VA 1Q86O 2LSNA 4H4MA 3CMAN 1VAZA 4LF4K 3R1XA 4CGDA 4FK4A 4E19A 1RDCA 4IEEA 5AQHA 3QIOA 4QOZB 1NGJA 1WSEA 3HTVA 3TTDA 4ZHRA 1SKWA 3T1HK 3HJFA 4CEFA 4J2EA 4GMJB 1NGDA 3UE5A 2E4LA 4FOEA 3CI5A 3ZSYA 5HROA 3VGLA 3OA9A 2O8EB 3WXLA 1K8KB 2A5XA 1SS6A 1IBLK 1LWCA 4FSVA 3O3FA 4BRHA 3SZ2A 1QE1A 1B9DA 2O8EA 4X65K 2VQEK 4KH6A 3OY9A 1W7AA 3R9PA 3A2FA 4DTSA 3DM2A 3ZSXA 3O9QA 4OKJA 2IGIA 4KBOA 4FWRA 2E1YA 1ZYQA 5CZ2A 4CZIA 1X1PA 2JLEA 3ZX0A 5CYMA 3DLKA 2KZZA 4BRCA 4BDZA 4BR2A 1U4BA 3VQ5A 1OH7A 4AQYK 3I8BA 1XQSC 3BY5A 4CIGA 1TL1A 4IO9L 3HSTB 4LF9K 3AA2A 5JS1A 4OO1J 3O9TA 4J2BA 1EETA 3KKSA 4LH4A 3ULEB 2P5GA 1SUQA 3K5LA 3B8AX 2YHYA 3CCJN 4QAGA 2QKKA 1N32K 5BN8A 2FSKA 4CEOA 2NNWA 1C0GA 3O4WA 1Q7YO 5AFUA 1YAGA 3T7ZA 1CZ9A 1GOCA 4IXCA 1L3TA 4K25A 1MU2A 1RTIA 1Y64A 3P4IA 4IDHA 3QINA 3T3FA 1HQUA 3AO2A 4OGCA 4CHYA 4GY2B 2O8DA 2G8VA 4N47A 1JCGA 4BRIA 3DXMB 3SQ2A 5BPMA 1TAQA 2AJQA 3CCUN 4RTFD 4JHDB 2FC0A 2HBKA 3LDLA 5GADP 1TGOA 4B3OA 4U7BA 3BGRA 3DLHA 5ELZA 3SCXA 2GTDA 3U4LA 3HZ6A 1NK9A 3AA4A 3M3ZA 4CIFA 4GW6A 4DU1A 5EX5A 4BRNA 3L2WA 4JKDA 1RDUA 4WE1A 1S6PA 5I9EB 4JI5K 1NMDA 4A5BA 1XI1A 1RGIA 1QSLA 5FLXO 2Q31A 5SZTA 3G6EN 5EU7A 3SJJA 1L3UA 2ZM6K 2GX9A 2P9SB 3V81A 5AZJB 5AQNA 2ATQA 3THXB 4BR7A 3I8DA 4FWQA 2HNYA 3C7NB 4CJUA 4FJKA 4CBWA 3OYAA 3D7EO 3KLEA 4A57A 2ZE2A 3J7ZO 5E41A 3THXA 4B9QA 1TUUA 3AAPA 4OJRA 3J7YP 4CBUA 4ID1A 4X66K 4BE1A 3ZT3A 1S9EA 1QSSA 2VG5A 4M41A 5HLFA 1WBDA 2RPIA 4YOWA 4K8ZA 3VQ4A 3MK6A 4E0DA 4EZ9A 4FJLA 3MEDA 4PA1A 3D0PA 3V9XA 3THWB 1WOQA 1BISA 3OS2A 4R79A 3U6FA 1QSYA 1U45A 4KHYA 3HL8A 5F1XA 4Z0UA 3PO5A 4N56A 1OH6A 4BRPA 4CESA 3N4QA 1IKWA 5FRMA 3HPHA 2OANA 1M1KO 1QZ5A 1BI4B 3SV4A 4H5VA 4WQ4C 3H08A 3LPUA 1XUPO 1K6YA 3LZJA 3DMJA 3H46O 4KPYA 2F9WA 2O4GA 3B6OA 4Z4CA 1WBBA 3ZEUA 3RMAA 4MQ3A 3AVCA 4JI7K 3FZKA 2FXUA 3VQ7A 4DMNA 4CD1A 3OJSA 2NUBA 4FCYA 2P9UB 4HTLA 3CJCA 3EE8A 2Y1IA 1GLLO 4Z4EA 4IJAA 4DFJA 1X9SA 3DAWA 4B3TK 4XH4A 2VWJA 4KTQA 4OKEA 3QFUA 1SKSA 5FDLA 4DR6K 4M3TA 4H0YB 4H0TB 4C8KA 3THVA 1NGFA 2VGMA 2ASOA 3G0ZA 4WFAL 1D9FA 3DLBA 3BF3A 2I5JA 3MCPA 1DLOA 1WSHA 4EAHD 4WF9L 4N76A 2WC9A 4IDKA 1NK7A 3CM6A 1C1BA 1I39A 4CHPA 3NE6A 2E2QA 3ENOA 4K0KK 3F9KA 4Z4FA 3SAFA 1NJYA 1OH8A 4B1WB 3L6QA 5I42A 4PY5A 3ZETA 4FVMA 4ILHA 5KPTA 4Y0WA 1Q9YA 3T1AA 4E1MA 2UXCK 2KKZA 3QETA 1SV5A 3R3LA 5BPLA 3C6UA 4B3RK 2O8CB 4CZFA 3L2RA 2EWSA 3QIPA 3N4PA 3ZSQA 4DS4A 4FJXA 4O4GA 4W5RA 3PUFA 1SQKA 4FZZA 1WUAA 4JNEA 2PYJA 5AQRA 2GWKA 4BRFA 4FLVA 3G71N 3QLHA 4IEIA 1E4FT 4W5OA 4FO0A 3KLHA 5AQTA 3MN7A 2NRWA 3O9UA 3DI6A 4HUFA 3BEXA 5AQKA 4RW8A 2Q2RA 3AO1A 3ATVA 4F3OA 2ASMA 4M3WA 4FXDA 2Z1GA 3M8SA 4LC9B 2HNDA 1MDUB 4CEDA 3K0SA 3OYNA 5JS2A 4FL9A 4BRDA 3G4SN 4DR1K 4BQLA 2P9IA 5B8HA 3GE1A 1QQNA 3VN5A 1QVGM 4JK9A 3CPEA 2O8FA 4IOAL 1L3SA 2G8IA 5KQDA 3V1OA 3WEEA 4PWDA 3RRHA 5C15A 1WSFA 3ZT4A 1JCFA 3KLIA 4GV3A 4CECA 2QWRA 3D2FB 3LDQA 4CK1A 3HK2A 3NDKA 4CFDA 5MLCQ 5JVHL 2BTFA 1NK6A 1XMOK 3FZLA 1HR0K 1QS4A 4DTXA 4AF1A 3H3NO 5BRFA 4KFBA 2V7YA 3RSEA 3PIPL 1XC9A 2QWNA 3KJVA 3BF1A 2D0BA 4EP5A 4G9ZA 4M63C 3L0QA 1WAJA 4LFCK 1S1UA 3SV3A 4CJ3A 3S9HA 1BA0A 1A5XA 4JD2A 4YORA 4E7HA 2IDOA 3DRPA 1C0TA 3IFRA 4ELUA 3O9RA 4WQ5C 3V9UA 3NVMA 1Q9XA 4CZGA 4CCHA 4BWJA 1KAYA 1R0AA 4CW7B 4HHTA 3D2EB 3W0LA 3LP1A 3DYAA 3JSMA 1BHLA 3H3OB 3RRGA 2HHXA 1XNQK 4JKHA 1TYQA 2NRZA 1U47A 3IRXA 1WN7A 4I2PA 4PL7A 3O4NA 3TSPA 1J54A 4ISEA 1HJOA 3CIPA 3O4QA 3VEWA 2A41A 4DLEA 3OYEA 2A1SA 1BWFO 1CXQA 3ASMA 4CFCA 4PKIA 4X64K 2W42A 3AA3A 4XH5A 1TK5A 1VQMN 1D4XA 1SAZA 4YOYA 4DV2K 3AVAA 3NF8A 1BUPA 4FJJA 2YJFA 1UAXA 1KFSA 3VF2A 3TSQA 2A3ZA 1KLNA 4JK7A 3GDQA 1WNSA 2FSNA 3FZFA 2ITGA 4HCBA 3C95A 3RWUA 5DM7L 4RWTA 1IJJA 4DV0K 1Q82O 3C6TA 4MLHA 1I94K 1NKEA 2ZF5O 4BC2A 1S1VA 3R8EA 4GNIA 3MXJA 1VRTA 2XY5A 4J8FA 2D1KA 4GKJK 1TKDA 3CHWA 3DLGA 1NMNA 1BOTO 5HP1A 1NJWA 1BU6O 3CC7N 4E7KA 4FJ8A 2CGKA 5A2QO 4FYDA 4NLBA 4G1QA 4Z4HA 3SYZA 4XH1A 4FM1A 1BGXT 4K43A 1NK8A 2WBNA 3OS0A 4MO4A 4GV9A 3AVGA 3ZX2A 1SL0A 4DLGA 4ISGA 2WFBA 4ILGB 4BR5A 4F9OA 1CZAN 1IH7A 3NH0A 3LWMA 1HKCA 3AVIA 1GOAA 4BGAA 3FFKB 1VQNN 4KKOA 1L5UA 1WSGA 3UIQA 1RNHA 3CQ8A 3TTCA 4F2RA 1T6DA 1KLMA 2HBLA 4V19S 4DTOA 5AQJA 1ATSA 4DFMA 4A61A 4DFPA 3SPZA 1JLGA 1SZ2A 1JLBA 2JGUA 5AFUH 3K59A 3MXMA 4CJFA 3LM9A 3AVNA 4DTJA 2Q0UA 4JS5A 4BC3A 2QI2A 2NRHA 5AZIB 1BCOA 3E01A 4PL8A 4C1NK 2NZTA 3QBXA 4QS7A 1XC3A 4DSLA 5CY4A 5AZIA 3F73A 3NH1A 3I56N 1NGAA 3KTQA 2QA4N 1S72N 5HBMA 3QBWA 3CJBA 3EN9A 4CJRA 4FWSA 3MECA 4IFEA 3MMVA 1EP4A 3QEWA 3QICA 4KH5A 3K5MA 4JKAA 1TK8A 1FK9A 2D0AA 1CLQA 5DM6L 2WOMA 4DR4K 4GVEA 3VEVA 4BRLA 3LP3A 3UKRA 4J2DA 5GAHP 1ATRA 4FLUA 4CZHA 4I9LA 4B9NA 4O5FA 5AQLA 5IWAK 4JI2K 1RCHA 1ZBIA 4CZLA 1Z05A 1TUYA 2WONA 4KTWA 5IT9O 2GUIA 2P9NA 4KHUA 1W0HA 2NRTA 3CG7A 1HNXK 4HTUA 4EHUA 5JMVA 3VQEA 4IOXA 1QQCA 3L2UA 1DGKN 4DFKA 1P8ZA 4ZTFA 1N34K 4DF8A 3QB0A 1HYSA 2NLXA 3PLAA 2KTQA 1C1AA 3KIOA 2F9TA 5I3UA 3EZWA 2Z1IA 2DPNA 4FPAA 3ENHA 3RR8A 1VSEA 3EEQA 4DQ8A 4B1ZA 1KVBA 1VQPN 1S1TA 2E6LA 1ASWA 3G25A 1VSHA 4CHOA 1SL2A 4KV8A 1ZBHA 1ZC6A 4M7XA 4E1NA 3TI0A 3SBGA 3NFAA 4AHTA 1YJ9N 3LL3A 1VQLN 5M1QA 3ZT0A 1BIUA 4CD3A 4ID5A 4U67L 2VGNA 1BA1A 3V4IA 5AQWA 3QNOA 3AY9A 1LWFA 3O1BA 3OHRA 1HX1A 2O8DB 2KHOA 3CQXA 2OYQA 1NGGA 4WQ4A 2P9PA 3DWLA 2RF2A 5KQ8A 3IG1A 3THYA 1UA0A 5AQGA 3HOSA 2Z1JA 3A5MC 1C0MA 2FSJA 2B6AA 3C65A 4H5WA 4MLEA 1TKZA 4E7IA 3WXIA 2ZD1A 1RT6A 3ZCMA 3SI6A 2A6AA 3CC2N 3H1VX 3SLCA 1Q18A 2ZJRL 3SUNA 4JKBA 1HNWK 3VQQA 4PQUA 4DWIA 1LAVA 1VRUA 3AO3A 5GIPA 1X9JA 4DTNA 4K8XA 2JWKA 3VQ9A 5FPNA 3GBTA 3MN6A 1YJWN 4O0JA 3W3DA 4FWKA 3WNHA 1S9GA 3VTHA 2X6NA 5D3GA 4CERA 3O1WA 5F0XA 4E7LA 3TPQA 1ASUA 4MO5A 2KLAA 4CGFA 5LMUK 2BANA 3AVMA 4AHCA 4WCEL 2DY4A 3EKSA 2UXDK 1K9MO 3EY1A 3ISNC 2VWKA 2DFEA 1MWKA 1WSIA 3M5RA 1KTQA 3RTVA 5TKWA 2Q97A 3VENA 4FWMA 4DF4A 3QFPA 1HJRA 2X74A 1YIJN 1VSIA 2YX6A 1F21A 4DCHA 3L4IA 4NCBA 4FOIA 1EKEA 3E9LA 3OBWA 3RMDA 4CF9A 5KGXA 2A42A 2P9LA 5HRRA 4AILC 4IFYA 1JJ2M 4IO8A 1FKOA 2QEXN 1JLEA 3WXMB 1N5YA 1IBKK 3K2PA 3S3MA 3CC4N 4CF0A 4BRMA 3SQ4A 2PY5A 5C12A 3A0IX 3CETA 3I55N 2G8KA 1VQ5N 2B4JA 4O55A 1ZBFA 3HRGA 3ZSRA 2XY6A 1RT1A 1OVQA 1NBWA 3TANA 3JS6A 4CK3A 3O80A 4DQPA 2I7NA 3ZEUB 2GELA 1YI2N 4DTMA 1VHXA 4DR2K 3TAPA 2EX3A 4B8AB 4KREA 1LAWA 3HBTA 3LWLA 4BREA 4YOTA 4LD0A 4CJTA 3U3YA 2YHXA 1KSPA 4DHYA 5C0YA 1NKCA 4CJLA 4C8LA 1BDGA 4CJ4A 3QEPA 1JCEA 4I9QA 2ETJA 2XY8A 3T69A 4DUYK 1NOYA 1ILYA 5FPEA 1NGCA 1IG9A 2V51B 4JS4A 4DU4A 5GIOA 2UUAK 3NGZA 3OYLA 2HHVA 4FWOA 4K42A 5LY3A 1ZBLA 3CCQN 1YVUA 3MEGA 3KWGA 1NGBA 3A8YA 4NXNK 3CD6N 4RW6A 1C1CA 3LDNA 5TKYA 3TABA 5KI6A 1ITGA 5CE3A 3WT0A 2FBTA 4CGJA 3NAEA 1NLVA 3JYTA 1LWEA 3I0RA 2DTUA 1Z26A 3SNNA 2J4RA 4BACA 4CVNE 4ELVA 1LOTB 3AVKA 3A5LC 3KK3A 3K5NA 1J5OA 2QWPA 5AQYA 3ZETB 3WXJA 3ZLJA 3LANA 3LM2A 4MDAA 5BR9A 3H6EA 4CJWA 3AVBA 2DFFA 3O08A 2UXBK 4B9UA 4UY8O 1YJNN 5JLHA 1OH5A 3I33A 3UB5A 5KRSA 3ATUA 3HOTA 5J2MA 2GBZA 5EVZA 2CGLA 3CCRN 4LF8K 4WQ5A 1J5EK 2R7YA 4DV4K 1I3AA 3J80O 4CJQA 4YDUC 5AQXA 3MWTA 4L8RB 4OGEA 2P5OA 4OPKA 1W9HA 1Q8IA 3CFRA 5C2FA 3SBTA 3CMEN 4R5PA 2IOCA 4CGHA 4BDPA 3MAQA 1JLCA 1WSJA 3H45C 1NWKA 3L2QA 3MXIA 4Q0BA 4FWNA 1NJIO 1X3MA 5C2DA 4DTRA 1P90A 2G8UA 3O6WA 4NYNA 2G8FA 4KI4A 3U3GA 3V1RA 3BZCA 5C10A 1BO5O 3M8QA 4QS8A 3ZSWA 4LH5A 4AHSA 1Z6RA 4K41A 4A5AA 2AA4A 3ALYA 3LAKA 1NU0A 2P9IB 2H3GX 3TAQA 2O8BA 1ZXOA 3MX2A 2WTUA 2O8FB 2KFNA 2NRRA 1RT4A 2QWLA 3WNEA 1VQ4N 1DT9A 2OPQA 2YV0X 1NM1A 3GL1A 3WEEB 1LW2A 4FPBA 3NBPA 3OYKA 1U2VA 3PY8A 3PIOL 2D0OA 5C25A 4O5BA 4FWPA 3IAYA 4OKKA 2OZMA 2G8WA 4DS5A 1DTQA 1YVNA 3AA5X 1NGHA 5C24A 3RMBA 2BH1A 2ZQBA 4FK2A 1YUWA 1W2BM 4JAXA 4FLTA 3RSEB 4B9LA 4DR7K 1NGEA 4FJHA 1HPZA 5CYQA 3SUPA 2FF3B 2HNZA 2OA8A 4BG9A 3AVHA 4Y1CA 5JICA 4LF6K 1Z25A 3VQDA 1R59O 4W5TA 3Q7CA 2QXLA 1MA9B 4JD2B 3FZHA 1JL2A 1MWMA 1O13A 1YT3A 3ZSVA 4CJ7A 2HMPA 3TAFA 1S22A 4I2QA 4M3RA 3LAMA 5C42A 3HYFA 4BVPA 3PSIA 4H5RA 3FGUA 4IWVA 4CBXA 1IO2A 4CE9A 3KD5E 4DSJA 1XWLA 4NCAA 2W40A 3IKMA 5AR0A 2RN2A 3P31A 4YOUA 4CF2A 3VQPA 2NRVA 2VYPA 1TYQB 2EHGA 3KWIA 3IS9A 4DQRA 4CIEA 3AGRA 4DQSA 3VA3A 3VA0A 1N33K 4CEEA 4F4KA 1HNIA 1NNEA 4A62A 4AHVA 1KQSM 4C8MA 3ZX3A 3DRSA 4KHPK 3P1GA 2VG6A 3FLCO 4CZMA 3FZMA 3E9PA 3O3GA 3FE1A 3TAGA 1RILA 3CJAA 3O5BA 3SJHA 2QK9A 4BVOA 3Q7BA 1KFDA 4E1JA 1QQMA 1LCUA 3DJCA 3HPGA 3ZT1A 3VOVA 4I6MA 5AQIA 4DV1K 1GLDG 1TV6A 5K14A 2YHAA 1KAXA 3QESA 4JK8A 3QMLA 4KTZA 2YHBA 2QTDA 3DXKA 2X78A 4BR4A 4ZTJA 1CXUA 3OYJA 2HHUA 4BRKA 1N36K 4FJIA 4MDBA 3WXKA 1IKVA 2D4WA 1VSDA 1N8RO 5LJVA 3HM9A 4AM6A 3QEXA 3K58A 1VSFA 5BREA 3F9MA 4LFBK 1FKPA 1HRHA 1NJZA 3SUOA 1X3NA 2Q1NA 2IAJA 1S1XA 3PX0A 1FJGK 1H1VA 4CJSA 5JLFA 4LSNA 4M3ZA 4O0IA 2E1ZA 3V6DA 4IKFA 4KB0A 3OYDA 1EX4A 4FW2A 4JRPA 1KVCA 3J7AP 4GKKK 3S41A 3T19A 4CGIA 3JXUA 2HHTA 3ULDA 1VQ7N 5CZ1A 2XRIA 1D9DA 2VCPA 3U8XA 5LJWA 5BRDA 1S1WA 4B8CA 3K5OA 4DSEA 5LMNK 1GLAG 4KHWA 3TU5A 4JRQA 4Z94A 3KKRA 2FF6A 2ZJPL 3UKUA 3KZBA 1T03A 4FJMA 4M3XA 1T44A 2UUCK 1EQYA 2F96A 5EOYA 4JKGA 1HKBA 2GV9A 2O4IA 2AP1A 2IVNA 5M1PA 3NCIA 3DLRA 1DKGD 4FM0A 5AQSA 3RMCA 2QWMA 4FWLA 4EIAA 5FROA 2P1JA 4GVMA 3VEOA 3F5TA 4H5TA 2XHBA 4MFBA 1JLFA 2HSTA 1QTMA 5ADXA 3MWPA 4BE0A 1KXPA 5M1OA 1NGIA 1VSMA 3C0BA 3WQUA 1U49A 4HUEA 3PX6A 3HSCA 3OS1A 3PV8A 3DRRA 4CHNA 1BQMA 3ID8A 4B3SK 2P9KA 5EY4A 3SMPA 1T05A 1J6ZA 3K57A 4OLBA 3VETA 4HWIA 1BCMA 5M1KA 4RG8A 3C6HA 3UKRB 4EFHA 2ZWHA 2QXFA 3MN9A 4BC4A 5AQPA 1HNZK 1EO1A 1OVYA 5KRTA 3LALA 3SMSA 3C6AA 3OYBA 1HMVA 4KI6A 3OTOK 4CZJA 1IBMK 2IIRA 2HHQA 4PKGA 3NVKA 2P9NB 1RFQA 1REVA 4BROA 3L4QA 1UOCA 5BR8K 1T7PA 1C0UA 3WNFA 4YFUA 1BIZA 2KQ2A 5FRNA 4B9MA 4DSFA 3TR8A 4X62K 3P83D 2VQFK 2DFHA 3F2KA 4TSXA 4CGGA 3LDSA 1K8KA 2D0PA 3MN5A 4JI1K 1RBUA 3FR0A 1M90O 4BY9C 1DTTA 2YKMA 1GOBA 5T7BA 4CJPA 3TAEA 5M1FA 4B9VA 1QHAA 1VSJA 3NF9A 3PSFA 3MDQA 2HF4A 3ITHA 4RW7A 3NH2A 3QO9A 2E8AA 4JN4A 4HVJA 1V4SA 1NK5A 1HNVA 3CCVN 3KLFA 4DKWA 1EWRA 4A2AA 3D45A 1YHQN 3S3NA 4IOCL 3O8MA 3TTFA 3U9ZA 2PFUA 3WQTA 4GV6A 1JLAA 1RDDA 2G8HA 2HB5A 3KD1E 2KZMA 2E2OA 1HKGA 5HRNA 1ESVA 3M6GA 1X9MA 1JLQA 4B9TA 1J53A 3BUZB 2P9PB 5F2RA 2PBDA 5KGWA 1SKRA 3ULEA 3G10A 2GEMA 2YJEA 3THYB 3M8PA 3OYHA 5AQQA 1T3VA 4LF7K 3QERA 2YHWA 3QEIA 3MEEA 4O8UA 4BQZA 1YTAA 3JAMO 4KHQA 3ZSOA 3VF4A 3S3OA 2HW3A 2OTJN 3CFOA 3AO5A 2IS3A 2IC3A 4F3TA 3CFPA 2PZSA 4H8KA 2ZJQL 4LY7A 4DTUA 4XEIA 5KTQA 3OW2M 1C0FA 1RTHA 2W6KA 4ELTA 1U04A 1U48A 1T8EA 2OPRA 2ASPA 3CJ9A 3V9WA 3NF6A 4CEAA 3VEXA 1TK0A 1VK0A 1JKHA 4Y1DA 2HHHK 1O1WA 2Z1HA 4H0PA 3DXMA 3P39A 4FJ7A 3VESA 4M45A 2D5RA 4JHDA 2HOEA 1RT7A 2UYTA 1JXBA 5J2QA 1ATNA 1GLCG 4E89A 3ZT2A 2QM1A 4NLCA 2F8TA 3T1YK 3SQ1A 2YNHA 4CEBA 4JEPA 3HT3A 5FPDA 4EP4A 5GAEP 1VQ6N 4BRAA 3M8RA 2E5LK 4FZYA 3HM8A 1LW0A 4E7JA 1NG9A 2BUPA 4ICLA 4M7YA 5AQFA 4BG8A 1VQ9N 3L3UA 1XHZA 5H1SQ 3VQCA 2P9LB 4C23A 1KC8O 3OYIA 4YOVA 2F4VK 2ZGYA 3AGKA 3NGIA 2A1RA 2Y1JA 2E20A 1D5AA 3ID6A 2RKIA 4O8KA 1IKXA 4OVLA 2P9SA 1RBTA 3LDOA 4ILJA 4XIUA 5AZJA 2IVPA 1B92A 5HL7L 4FJNA 3CCEN 4Z4GA 3C7NA 2E6MA 3AV9A 3BDPA 4YDUA 3LDPA 1NK0A 1U6ZA 3TSUA 4QCLA 4DV6K 2HBMA 2VWBA 1S5JA 1RT3A 2FBVA 5J2PA 3CQYA 4FJGA 4BRGA 2OZSA 2Q36A 4CF8A 2XY7A 2KFZA 4I7FA 3KLGA 3VTIA 2ZGZA 3P5JA 1C6VA 1V4TA 2IVOA 3SK3A 1NK4A 3AVFA 3K9JA 3VQ6A 4BE2A 2X6SA 3OBYA 2NRXA 2E88A 4DQQA 3THWA 5BPNA 3MX5A 1XHXA 1HYZA 2E2PA 2YNFA 1RTDA 3NHGA 4Z4IA 4IJNA 3E9OA 3OYGA 2B5JA 3HVRA 4YY3K 1EWQA 4L3QA 3EYZA 2Q3SA 3SQ0A 3A5OC 2PYLA 4FLXA 1BI4A 2V52B 3OYMA 1YF5L 3VF6A 1L3VA 2W41A 4FK0A 4J2AA 1B9FA 4JI0K 2Q0RA 4NYFA 4CJKA 3OJUA 4H0XB 3C94A 3E1YA 4Q5VA 3HPOA 4LF5K 3VGMA 4NXMK 1RDWX 5HRPA 4DR5K 1BQNA 2OCEA 3P38A 4DB3A 4OX9K 5BN9A 1IG8A 4FLYA 1WLJA 3VMFB 2FBXA 2PAVA
chains in the Genus database with same CATH topology
4IDHA 4B1XB 3TTCA 4BVPA 4H5RA 3FGUA 4IWVA 4CBXA 1T6DA 1ZBSA 2HBLA 2P9UA 3E66A 3AARA 2W40A 3IKMA 5AR0A 3DLLL 4GY2B 1ATSA 5AQJA 3P31A 4YOUA 4A61A 3CCSN 1JCGA 1SZ2A 3QDKA 2NRVA 5AFUH 4BRIA 2VYPA 3DXMB 5BPMA 1TYQB 3LM9A 3KWIA 3CCUN 4RTFD 3AGRA 2Q0UA 3EO3A 1E4GT 4JHDB 4BC3A 2HBKA 2QI2A 3U9DA 2NRHA 3LDLA 5AZIB 5GADP 4U7BA 4PL8A 4JKFA 4C1NK 4A62A 2NZTA 3QBXA 4QS7A 4OPAA 5ELZA 5HOOA 1XC3A 3ZX3A 1KQSM 2GTDA 4CI6A 3MCAB 3U4LA 2QW9A 3FLCO 5AZIA 4CZMA 3HZ6A 3FZMA 3E9PA 3M3ZA 3VERA 3CXCM 3I56N 1NGAA 3FE1A 3CJAA 4ISFA 5EX5A 4BRNA 2QA4N 4JKDA 1RDUA 3O5BA 5I9EB 3SJHA 1S72N 1NMDA 4BVOA 3Q7BA 4A5BA 2A40A 3QBWA 4E1JA 3CJBA 3GOIA 1RGIA 3EN9A 1QQMA 1LCUA 4FWSA 1T6CA 2Q31A 4IFEA 3DJCA 3MMVA 3IDHA 3VOVA 3G6EN 2FLOA 3QICA 4KH5A 4I6MA 5AQIA 1GLDG 2GX9A 2P9SB 4JKAA 4B1VA 3CJ7A 5AZJB 5DM6L 5AQNA 1KAXA 1QVFM 4GVEA 4BR7A 3VEVA 4AM7A 4FWQA 4BRLA 2CGJA 3C7NB 3KK7A 4JK8A 3UKRA 4CBWA 2OTLN 3D7EO 5GAHP 3QMLA 4A57A 1ATRA 4OPHA 3J7ZO 4CZHA 2QTDA 5AQVA 3DXKA 4BR4A 4PKHA 4B9QA 3SAHA 1TUUA 3AAPA 5FPMA 4O5FA 5AQLA 4B1UB 4QS9A 4BRKA 4CBUA 1VQ8N 4MDBA 3WXKA 4C1NI 4CZLA 2D4WA 3CJ1A 4NB4A 1Z05A 1TUYA 1N8RO 5LJVA 4AM6A 2P9NA 4YOWA 4A59A 3F9MA 5BREA 2NRTA 3MK6A 4CZKA 3CPWM 3J8AA 2RHKA 4EHUA 5JMVA 1W97L 1KAZA 1X3NA 2Q1NA 4IOXA 5AQOA 1DGKN 4RCHA 1U2VB 1WOQA 2I7PA 1P8ZA 1H1VA 5JLFA 4R79A 3QB0A 2NLXA 3PLAA 2HF3A 3ENBA 5F1XA 2E1ZA 4BRPA 2F9TA 3A5NC 3N4QA 3VEYA 3EZWA 3IMXA 2DPNA 3S41A 4FPAA 3ENHA 2YI1A 4DQ8A 4B1ZA 2OANA 3JXUA 1M1KO 1QZ5A 1VQPN 4H5VA 3G25A 4WQ4C 1VQ7N 1ZC6A 1XUPO 2VCPA 4M7XA 3U8XA 5LJWA 5BRDA 3H46O 2F9WA 2E2NA 1GLAG 3TU5A 4Z94A 3ZEUA 2FF6A 2ZJPL 3SBGA 3UKUA 3KZBA 3LL3A 1YJ9N 3FZKA 4IZ9A 1VQLN 2FXUA 5M1QA 1T44A 4CD3A 4CD1A 1EQYA 4JKEA 4U67L 2VGNA 1BA1A 2QWOA 5AQWA 3KVGA 5EOYA 4CZEA 2JWLA 4JKGA 1HKBA 3AY9A 1HUXA 1S3XA 2P9UB 3O1BA 3OHRA 2AP1A 1HX1A 4HTLA 3CJCA 3EE8A 1GLLO 2KHOA 3CQXA 1NGGA 1QZ6A 3K9KA 2IVNA 2P9PA 3DWLA 4IJAA 4WQ4A 5EXWA 2V7ZA 5M1PA 3DAWA 5KQ8A 1KD1O 4XH4A 1DKGD 5AQSA 3D2FA 3QFUA 2QWMA 4UY8O 2QWQA 4FWLA 2CH5A 4EIAA 5AQGA 4H0YB 2HBJA 3HOSA 3VEOA 4H0TB 3A5MC 2FSJA 4H5WA 3C65A 4MLEA 1Q81O 1GLJO 3F5TA 4H5TA 3WXIA 1NGFA 2A6AA 2HSTA 2VGMA 5ADXA 2ASOA 4KH4A 3MWPA 3H1VX 4WFAL 3CC2N 3SLCA 1Q18A 1GLFO 5E84A 2ZJRL 4JKBA 1KXPA 3BF3A 5M1OA 3MCPA 1NGIA 3C0BA 4BRQA 4EAHD 5GIPA 1X9JA 3WQUA 5KPRA 2WC9A 4WF9L 2JWKA 3HSCA 5FPNA 3GBTA 3MN6A 1YJWN 2E2QA 3ENOA 1G99A 3W3DA 4FWKA 3ID8A 2P9KA 5EY4A 3VTHA 3SMPA 3SAFA 4I6MB 1J6ZA 1GLBG 3L6QA 4B1WB 3O1WA 3VETA 5F0XA 2CH6A 3D2EA 3EKUA 3TPQA 4MO5A 5ADXH 4HWIA 5M1KA 2KLAA 3ZETA 1OKJA 5AQZA 3VPZA 3C6HA 3UKRB 4ILHA 4EFHA 2ZWHA 5KPTA 3GG4A 3M1FA 4Y0WA 4WCEL 3NMUA 3MN9A 3EKSA 4A2BA 2KKZA 3R3LA 4BC4A 5BPLA 5BRHA 3DXKB 1K9MO 5E26A 4BR9A 4CZFA 5AQPA 4YOXA 1EO1A 1OVYA 4NO7A 1MWKA 3KHYA 3C6AA 3M5RA 3SMSA 5TKWA 2Q97A 3VENA 4FWMA 1HPMA 4CZJA 3QFPA 2EWSA 2IIRA 3N4PA 3O9SA 4PKGA 1YIJN 2YX6A 3NVKA 2P9NB 1VQKN 1RFQA 1VQON 4DCHA 3L4IA 4BROA 5CHIA 4FOIA 3E9LA 3L4QA 1SQKA 3OBWA 4B1YB 4BC5A 1WUAA 4JNEA 5AQRA 5GAGP 5KPZA 2A42A 2GWKA 4WFNL 2P9LA 5CR4A 5GINA 3R6MA 4BRFA 1JJ2M 3F2KA 4IO8A 3G71N 2QEXN 1K8KA 1E4FT 4IEIA 2D0PA 3WXMB 3MN5A 4BY9C 3FR0A 1GLEG 1M90O 3CC4N 5AQMA 4BRMA 1K73O 4FO0A 5AQTA 5M1FA 3MN7A 2NRWA 3O9UA 1QHAA 5C12A 2YCHA 5M1NA 3A0IX 3MDQA 3CETA 3HI0A 2HF4A 3I55N 1K8AO 1VQ5N 3BEXA 5AQKA 3SAGA 2Q2RA 2E8AA 4JN4A 3ATVA 3HRGA 2ASMA 3CCLN 5JVGL 1V4SA 4BGBA 3CCVN 4LC9B 1NBWA 1MDUB 4DKWA 2F7TA 3JS6A 4FL9A 4BRDA 3O80A 2I7NA 3ZEUB 2GELA 4H0VB 3WUHA 4A2AA 3G4SN 1YI2N 1YHQN 3UKUB 4BQLA 3RVCA 2P9IA 4IOCL 3CERA 5B8HA 3GE1A 1QQNA 3O8MA 3TTFA 1QVGM 3U9ZA 4JK9A 2PFUA 3WQTA 4GV6A 3CPEA 4IOAL 3HBTA 4JKGB 4BREA 2E2OA 2RE2A 1HKGA 4YOTA 5KQDA 1ESVA 3M6GA 2YHXA 3WEEA 3D6RA 4PHTX 4DHYA 5C15A 5C0YA 3BUZB 3H1QA 2P9PB 1JCFA 1BDGA 2PBDA 5F2RA 3VEZA 3ULEA 2GEMA 4GV3A 4EHTA 1JCEA 2QWRA 3D2FB 3LDQA 2YJEA 4BR0A 5AQQA 3T69A 1YITN 5MLCQ 1T3VA 3EE9A 5JVHL 1ILYA 2BTFA 2YHWA 4WYBA 5FPEA 2WUSA 1NGCA 2V51B 4H03B 4O8UA 5GIOA 3FZLA 4BQZA 3IUCA 4FWOA 4K42A 4JKCA 4AF1A 5LY3A 3H3NO 5BRFA 3CCQN 2V7YA 3RSEA 3KWGA 3PIPL 1NGBA 3A8YA 3VF4A 2QWNA 3CD6N 4H5NA 2OTJN 3BF1A 4G9ZA 4M63C 3L0QA 2GUPA 3LDNA 1BA0A 5TKYA 4JD2A 4YORA 5CE3A 3WT0A 2ZJQL 3BP8A 4XEIA 1DEJA 3OW2M 1NLVA 2GWJA 1C0FA 4FVUA 1YXQA 3IFRA 3EL2A 2P9KB 3O9RA 4WQ5C 3CCMN 4WFBL 3NVMA 4CZGA 2J4RA 3AAQA 1QQOA 1KAYA 5AQUA 1HLUA 1LOTB 2ASPA 3CJ9A 3D2EB 3W0LA 3A5LC 3ZYYX 2QWPA 5AQYA 3ZETB 2ITMA 3VEXA 3CF5L 4H0OA 3H3OB 4H0PA 3WXJA 3VGKA 3DXMA 4JKHA 1TYQA 1BG3A 2NRZA 3LM2A 3P39A 4MDAA 3H6EA 3VESA 5BR9A 4PL7A 1Q86O 3TSPA 3O08A 4ISEA 3VEWA 1HJOA 3CIPA 4JHDA 2HOEA 3CMAN 1VAZA 2UYTA 2A41A 1YJNN 5JLHA 1ATNA 1GLCG 3I33A 3R1XA 2QM1A 3ATUA 4NLCA 3UB5A 3HOTA 1BWFO 4IEEA 5EVZA 5AQHA 2CGLA 3CCRN 4PKIA 4JEPA 4WQ5A 5FPDA 1NGJA 3HTVA 5GAEP 3TTDA 1VQ6N 4YDUC 5AQXA 3MWTA 4BRAA 3HM8A 4XH5A 1VQMN 2BUPA 1D4XA 1NGDA 1SAZA 4M7YA 5AQFA 4BG8A 4YOYA 1VQ9N 3UE5A 5C2FA 3SBTA 3CMEN 5H1SQ 4FOEA 2P9LB 3CI5A 4C23A 1KC8O 3VGLA 1BUPA 3OA9A 4YOVA 2ZGYA 3AGKA 2YJFA 3WXLA 3VF2A 1K8KB 2A5XA 1SS6A 2E20A 3ID6A 4FSVA 3TSQA 2A3ZA 4BRHA 4O8KA 4JK7A 3H45C 2P9SA 1NWKA 3LDOA 4ILJA 3GDQA 4FWNA 2FSNA 1X3MA 5AZJA 5C2DA 3FZFA 1NJIO 2IVPA 4KH6A 1P90A 5HL7L 3CCEN 3C7NA 3R9PA 3O6WA 4YDUA 3O9QA 3LDPA 1BO5O 1U6ZA 5C10A 3TSUA 5DM7L 4KBOA 4RWTA 1IJJA 4QS8A 1Q82O 4FWRA 4MLHA 2E1YA 2HBMA 2ZF5O 2VWBA 4BC2A 1Z6RA 4K41A 3R8EA 4GNIA 3CQYA 4CZIA 4J8FA 2AA4A 2D1KA 4A5AA 4BRGA 2Q36A 2P9IB 2H3GX 3ZX0A 3VTIA 2ZGZA 4BRCA 4BR2A 3CHWA 1ZXOA 1V4TA 3MX2A 2IVOA 3SK3A 1BOTO 2NRRA 1BU6O 3I8BA 3CC7N 3K9JA 2QWLA 1VQ4N 1DT9A 1XQSC 3GL1A 1NM1A 3OBYA 3WEEB 2CGKA 2NRXA 4IO9L 2E88A 5BPNA 3MX5A 4OO1J 4FPBA 3O9TA 4NLBA 1U2VA 3ULEB 2E2PA 3PIOL 2D0OA 4XH1A 3B8AX 4IJNA 4K43A 3E9OA 4FWPA 2WBNA 2YHYA 3CCJN 4L3QA 4MO4A 1YVNA 1NGHA 5BN8A 2BH1A 2FSKA 3A5OC 2NNWA 4GV9A 1YUWA 1W2BM 4JAXA 1C0GA 3RSEB 3ZX2A 3O4WA 1NGEA 2V52B 1Q7YO 1YF5L 3VF6A 2FF3B 4ISGA 2WFBA 2W41A 4ILGB 4BR5A 4F9OA 1CZAN 4BG9A 2Q0RA 5JICA 4H0XB 5AFUA 1YAGA 3E1YA 1R59O 3VGMA 3Q7CA 1RDWX 3T7ZA 2QXLA 1MA9B 1HKCA 4JD2B 3P38A 3FZHA 4DB3A 4IXCA 5BN9A 1IG8A 1MWMA 1O13A 4BGAA 3FFKB 3VMFB 4CJ7A 1VQNN 4K25A 2PAVA 2HMPA 1Y64A 1S22A 3P4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UY8 O;  1YJN N;  1VQ7 N;  4WFN L;  1JJ2 M;  3CCR N;  3DLL L;  3G71 N;  2QEX N;  5GAE P;  1M90 O;  1VQ6 N;  3CC4 N;  3CCS N;  1K73 O;  2ZJP L;  1YJ9 N;  1VQM N;  3CCU N;  1VQL N;  1K8A O;  3I55 N;  1VQ5 N;  1VQ9 N;  3CME N;  4U67 L;  5H1S Q;  5GAD P;  3CCL N;  1KC8 O;  5JVG L;  3CCV N;  1KQS M;  3G4S N;  1KD1 O;  1YI2 N;  1NJI O;  1YHQ N;  3CXC M;  3I56 N;  4IOC L;  5HL7 L;  2QA4 N;  3CCE N;  1QVG M;  1S72 N;  4IOA L;  1Q81 O;  5DM7 L;  1Q82 O;  3G6E N;  3CC2 N;  4WFA L;  2ZJR L;  5DM6 L;  1QVF M;  1YIT N;  5MLC Q;  4WF9 L;  5JVH L;  2OTL N;  1ILY A;  5GAH P;  3J7Z O;  3CC7 N;  1YJW N;  1VQ4 N;  4IO9 L;  3CCQ N;  1VQ8 N;  3PIP L;  3CD6 N;  1N8R O;  3PIO L;  2OTJ N;  3CCJ N;  4WCE L;  3CPW M;  2ZJQ L;  3OW2 M;  1K9M O;  1W2B M;  3CCM N;  4WFB L;  1OVY A;  1Q7Y O;  1YIJ N;  1VQK N;  1VQO N;  3CF5 L;  1Q86 O;  1VQN N;  1M1K O;  3CMA N;  1VQP N;  5GAG P; 
#chains in the Genus database with same CATH topology
 4B1X B;  4N41 A;  2VG7 A;  3TAR A;  3DOL A;  4E3S A;  4JV5 K;  1ZBS A;  2P9U A;  4RW9 A;  4AHU A;  3E66 A;  3AAR A;  3DLL L;  1KVA A;  4BDY A;  3HXM A;  3CCS N;  3QDK A;  2YKN A;  4DQI A;  4KHS A;  4DU3 A;  4F8R A;  3EO3 A;  1IKY A;  1E4G T;  3ZSZ A;  3U9D A;  4DTP A;  4DSK A;  3DOK A;  4JKF A;  4DV7 K;  2YNG A;  5HOO A;  4OPA A;  1FXX A;  1FW6 A;  2D0C A;  4CI6 A;  3MCA B;  2QW9 A;  2F8S A;  4M3Y A;  4H4O A;  3VER A;  3CXC M;  1UA1 A;  4ISF A;  4OPJ A;  2HVI A;  4N5S A;  3CYM A;  3V1Q A;  2A40 A;  4DV3 K;  4LFA K;  3GOI A;  3LP2 A;  2HVH A;  1TVR A;  1T6C A;  3IDH A;  3LP0 A;  2FLO A;  1IV0 A;  4B1V A;  3CJ7 A;  4RW4 A;  2OPP A;  1QVF M;  3OYF A;  4AM7 A;  2CGJ A;  3KK7 A;  4IG3 A;  1WB9 A;  2OTL N;  1RBR A;  4OPH A;  5AQV A;  4PKH A;  3SAH A;  2O8C A;  5FPM A;  4B1U B;  4QS9 A;  1VQ8 N;  3PO4 A;  4C1N I;  4FLW A;  2UU9 K;  3CJ1 A;  4NB4 A;  1XMQ K;  4YHH K;  2O8B B;  4FM2 A;  1J9A A;  5J1E A;  4A59 A;  4CZK A;  3CPW M;  3J8A A;  2RHK A;  4HUG A;  4B08 A;  3HP9 A;  1W97 L;  4JLH A;  1KAZ A;  1CZB A;  5AQO A;  4KB1 A;  4RCH A;  4CFA A;  4KAZ A;  4IG0 A;  1U2V B;  2I7P A;  2HMI A;  1D8Y A;  4YNQ A;  2HF3 A;  3ENB A;  4DG1 A;  4KO0 A;  3OVN A;  3A5N C;  1TKX A;  3VEY A;  3IMX A;  3KK1 A;  4M42 A;  4OLA A;  2HHW A;  2YI1 A;  4LSL A;  4JI3 K;  1KRP A;  3O3H A;  1TKT A;  3SPY A;  3HVT A;  4JI6 K;  2E2N A;  5LL6 Z;  4NCG A;  4IZ9 A;  3NGY A;  4JKE A;  2QWO A;  4CZE A;  3KVG A;  1NOZ A;  1A5W A;  2JWL A;  3BZK A;  1HUX A;  1S3X A;  4JI4 K;  1KCF A;  5SWM A;  1XNR K;  1X9W A;  3KK2 A;  4DUZ K;  1QZ6 A;  3K9K A;  5EXW A;  2V7Z A;  1KD1 O;  2KW4 A;  4CJE A;  3D2F A;  3TAM A;  4BWM A;  2QWQ A;  2CH5 A;  1SL1 A;  4B9S A;  3TWH A;  3FFI A;  4KHN A;  2HBJ A;  5DK5 A;  3NF7 A;  1Q81 O;  4KRF A;  2FBY A;  1GLJ O;  4HCC A;  4W5N A;  3HO1 A;  4KH4 A;  1Y97 A;  1RT5 A;  1GLF O;  3OYC A;  5E84 A;  4JI8 K;  4BRQ A;  1BL3 A;  5KPR A;  4CK2 A;  2BDP A;  3AVJ A;  1N6Q A;  1TAU A;  1NJX A;  1G99 A;  4IBN A;  1YTU A;  4I6M B;  1GLB G;  2XO7 A;  3B6P A;  3SUQ A;  2CH6 A;  3D2E A;  3EKU A;  5ADX H;  4CHQ A;  1OKJ A;  5AQZ A;  3VPZ A;  1RDA A;  3L8B A;  3GG4 A;  3M1F A;  3NMU A;  4A2B A;  1RTJ A;  5BRH A;  3DXK B;  5E26 A;  4BR9 A;  4YOX A;  4FZX C;  4NO7 A;  4CJV A;  4UQG A;  3KHY A;  4B3M K;  3LPT A;  2BE2 A;  1HPM A;  3V9S A;  3O9S A;  1UWB A;  1VQK N;  1VQO N;  4M3U A;  5CHI A;  1E3M A;  1NKB A;  4CFB A;  4B1Y B;  4BC5 A;  1VSL A;  4F2S A;  5HRS A;  5GAG P;  4JYA K;  1EXQ A;  3I0S A;  5KPZ A;  3VQ8 A;  4WFN L;  5CR4 A;  5GIN A;  3EZ5 A;  3R6M A;  3VQB A;  4DR3 K;  4FW1 A;  1QHT A;  1GLE G;  1G15 A;  5AQM A;  1K73 O;  4CJ5 A;  5M1N A;  2YCH A;  4C8O A;  1K8A O;  3HI0 A;  2HHS A;  4DSI A;  1LV5 A;  4CF1 A;  2YNI A;  3SAG A;  2OPS A;  3CCL N;  4CEQ A;  3J81 O;  5JVG L;  1ASV A;  4BGB A;  5AJ3 K;  1RBV A;  2F7T A;  2BGG A;  3V9Z A;  4H0V B;  3WUH A;  4CHZ A;  3UKU B;  3RVC A;  2QKB A;  3CM5 A;  1RT2 A;  3CER A;  4AHR A;  3LZI A;  4DV5 K;  1VSK A;  3VQA A;  4JKG B;  1RBS A;  2RE2 A;  1JXE A;  1RDB A;  3D6R A;  4PHT X;  1JL1 A;  4C8N A;  3H1Q A;  3RR7 A;  4AH9 A;  4FLZ A;  3VEZ A;  5J2N A;  1TL3 A;  4CEZ A;  4PUO A;  4EHT A;  2P51 A;  4W5Q A;  3WNG A;  4BR0 A;  1YIT N;  3EE9 A;  4WYB A;  1S6Q A;  2WUS A;  1HQE A;  4H03 B;  3IUC A;  3AO4 A;  4JKC A;  3HP6 A;  1ZBU A;  3L3V A;  4O44 A;  4H5N A;  4FJ9 A;  3PX4 A;  2GUP A;  5DMR A;  3DLE A;  3BP8 A;  1DEJ A;  4FVU A;  2GWJ A;  1YXQ A;  3AVL A;  3EL2 A;  2P9K B;  3CCM N;  2UUB K;  4WFB L;  3AAQ A;  1WAF A;  1QQO A;  3L2V A;  3QEV A;  5AQU A;  1HLU A;  2W6L A;  3ZYY X;  2ITM A;  3CF5 L;  4IFV A;  1HYV A;  4H0O A;  4EZ6 A;  3VGK A;  3QNN A;  4FJ5 A;  1BG3 A;  1A5V A;  1Q86 O;  2LSN A;  4H4M A;  3CMA N;  1VAZ A;  4LF4 K;  3R1X A;  4CGD A;  4FK4 A;  4E19 A;  1RDC A;  4IEE A;  5AQH A;  3QIO A;  4QOZ B;  1NGJ A;  1WSE A;  3HTV A;  3TTD A;  4ZHR A;  1SKW A;  3T1H K;  3HJF A;  4CEF A;  4J2E A;  4GMJ B;  1NGD A;  3UE5 A;  2E4L A;  4FOE A;  3CI5 A;  3ZSY A;  5HRO A;  3VGL A;  3OA9 A;  2O8E B;  3WXL A;  1K8K B;  2A5X A;  1SS6 A;  1IBL K;  1LWC A;  4FSV A;  3O3F A;  4BRH A;  3SZ2 A;  1QE1 A;  1B9D A;  2O8E A;  4X65 K;  2VQE K;  4KH6 A;  3OY9 A;  1W7A A;  3R9P A;  3A2F A;  4DTS A;  3DM2 A;  3ZSX A;  3O9Q A;  4OKJ A;  2IGI A;  4KBO A;  4FWR A;  2E1Y A;  1ZYQ A;  5CZ2 A;  4CZI A;  1X1P A;  2JLE A;  3ZX0 A;  5CYM A;  3DLK A;  2KZZ A;  4BRC A;  4BDZ A;  4BR2 A;  1U4B A;  3VQ5 A;  1OH7 A;  4AQY K;  3I8B A;  1XQS C;  3BY5 A;  4CIG A;  1TL1 A;  4IO9 L;  3HST B;  4LF9 K;  3AA2 A;  5JS1 A;  4OO1 J;  3O9T A;  4J2B A;  1EET A;  3KKS A;  4LH4 A;  3ULE B;  2P5G A;  1SUQ A;  3K5L A;  3B8A X;  2YHY A;  3CCJ N;  4QAG A;  2QKK A;  1N32 K;  5BN8 A;  2FSK A;  4CEO A;  2NNW A;  1C0G A;  3O4W A;  1Q7Y O;  5AFU A;  1YAG A;  3T7Z A;  1CZ9 A;  1GOC A;  4IXC A;  1L3T A;  4K25 A;  1MU2 A;  1RTI A;  1Y64 A;  3P4I A;  4IDH A;  3QIN A;  3T3F A;  1HQU A;  3AO2 A;  4OGC A;  4CHY A;  4GY2 B;  2O8D A;  2G8V A;  4N47 A;  1JCG A;  4BRI A;  3DXM B;  3SQ2 A;  5BPM A;  1TAQ A;  2AJQ A;  3CCU N;  4RTF D;  4JHD B;  2FC0 A;  2HBK A;  3LDL A;  5GAD P;  1TGO A;  4B3O A;  4U7B A;  3BGR A;  3DLH A;  5ELZ A;  3SCX A;  2GTD A;  3U4L A;  3HZ6 A;  1NK9 A;  3AA4 A;  3M3Z A;  4CIF A;  4GW6 A;  4DU1 A;  5EX5 A;  4BRN A;  3L2W A;  4JKD A;  1RDU A;  4WE1 A;  1S6P A;  5I9E B;  4JI5 K;  1NMD A;  4A5B A;  1XI1 A;  1RGI A;  1QSL A;  5FLX O;  2Q31 A;  5SZT A;  3G6E N;  5EU7 A;  3SJJ A;  1L3U A;  2ZM6 K;  2GX9 A;  2P9S B;  3V81 A;  5AZJ B;  5AQN A;  2ATQ A;  3THX B;  4BR7 A;  3I8D A;  4FWQ A;  2HNY A;  3C7N B;  4CJU A;  4FJK A;  4CBW A;  3OYA A;  3D7E O;  3KLE A;  4A57 A;  2ZE2 A;  3J7Z O;  5E41 A;  3THX A;  4B9Q A;  1TUU A;  3AAP A;  4OJR A;  3J7Y P;  4CBU A;  4ID1 A;  4X66 K;  4BE1 A;  3ZT3 A;  1S9E A;  1QSS A;  2VG5 A;  4M41 A;  5HLF A;  1WBD A;  2RPI A;  4YOW A;  4K8Z A;  3VQ4 A;  3MK6 A;  4E0D A;  4EZ9 A;  4FJL A;  3MED A;  4PA1 A;  3D0P A;  3V9X A;  3THW B;  1WOQ A;  1BIS A;  3OS2 A;  4R79 A;  3U6F A;  1QSY A;  1U45 A;  4KHY A;  3HL8 A;  5F1X A;  4Z0U A;  3PO5 A;  4N56 A;  1OH6 A;  4BRP A;  4CES A;  3N4Q A;  1IKW A;  5FRM A;  3HPH A;  2OAN A;  1M1K O;  1QZ5 A;  1BI4 B;  3SV4 A;  4H5V A;  4WQ4 C;  3H08 A;  3LPU A;  1XUP O;  1K6Y A;  3LZJ A;  3DMJ A;  3H46 O;  4KPY A;  2F9W A;  2O4G A;  3B6O A;  4Z4C A;  1WBB A;  3ZEU A;  3RMA A;  4MQ3 A;  3AVC A;  4JI7 K;  3FZK A;  2FXU A;  3VQ7 A;  4DMN A;  4CD1 A;  3OJS A;  2NUB A;  4FCY A;  2P9U B;  4HTL A;  3CJC A;  3EE8 A;  2Y1I A;  1GLL O;  4Z4E A;  4IJA A;  4DFJ A;  1X9S A;  3DAW A;  4B3T K;  4XH4 A;  2VWJ A;  4KTQ A;  4OKE A;  3QFU A;  1SKS A;  5FDL A;  4DR6 K;  4M3T A;  4H0Y B;  4H0T B;  4C8K A;  3THV A;  1NGF A;  2VGM A;  2ASO A;  3G0Z A;  4WFA L;  1D9F A;  3DLB A;  3BF3 A;  2I5J A;  3MCP A;  1DLO A;  1WSH A;  4EAH D;  4WF9 L;  4N76 A;  2WC9 A;  4IDK A;  1NK7 A;  3CM6 A;  1C1B A;  1I39 A;  4CHP A;  3NE6 A;  2E2Q A;  3ENO A;  4K0K K;  3F9K A;  4Z4F A;  3SAF A;  1NJY A;  1OH8 A;  4B1W B;  3L6Q A;  5I42 A;  4PY5 A;  3ZET A;  4FVM A;  4ILH A;  5KPT A;  4Y0W A;  1Q9Y A;  3T1A A;  4E1M A;  2UXC K;  2KKZ A;  3QET A;  1SV5 A;  3R3L A;  5BPL A;  3C6U A;  4B3R K;  2O8C B;  4CZF A;  3L2R A;  2EWS A;  3QIP A;  3N4P A;  3ZSQ A;  4DS4 A;  4FJX A;  4O4G A;  4W5R A;  3PUF A;  1SQK A;  4FZZ A;  1WUA A;  4JNE A;  2PYJ A;  5AQR A;  2GWK A;  4BRF A;  4FLV A;  3G71 N;  3QLH A;  4IEI A;  1E4F T;  4W5O A;  4FO0 A;  3KLH A;  5AQT A;  3MN7 A;  2NRW A;  3O9U A;  3DI6 A;  4HUF A;  3BEX A;  5AQK A;  4RW8 A;  2Q2R A;  3AO1 A;  3ATV A;  4F3O A;  2ASM A;  4M3W A;  4FXD A;  2Z1G A;  3M8S A;  4LC9 B;  2HND A;  1MDU B;  4CED A;  3K0S A;  3OYN A;  5JS2 A;  4FL9 A;  4BRD A;  3G4S N;  4DR1 K;  4BQL A;  2P9I A;  5B8H A;  3GE1 A;  1QQN A;  3VN5 A;  1QVG M;  4JK9 A;  3CPE A;  2O8F A;  4IOA L;  1L3S A;  2G8I A;  5KQD A;  3V1O A;  3WEE A;  4PWD A;  3RRH A;  5C15 A;  1WSF A;  3ZT4 A;  1JCF A;  3KLI A;  4GV3 A;  4CEC A;  2QWR A;  3D2F B;  3LDQ A;  4CK1 A;  3HK2 A;  3NDK A;  4CFD A;  5MLC Q;  5JVH L;  2BTF A;  1NK6 A;  1XMO K;  3FZL A;  1HR0 K;  1QS4 A;  4DTX A;  4AF1 A;  3H3N O;  5BRF A;  4KFB A;  2V7Y A;  3RSE A;  3PIP L;  1XC9 A;  2QWN A;  3KJV A;  3BF1 A;  2D0B A;  4EP5 A;  4G9Z A;  4M63 C;  3L0Q A;  1WAJ A;  4LFC K;  1S1U A;  3SV3 A;  4CJ3 A;  3S9H A;  1BA0 A;  1A5X A;  4JD2 A;  4YOR A;  4E7H A;  2IDO A;  3DRP A;  1C0T A;  3IFR A;  4ELU A;  3O9R A;  4WQ5 C;  3V9U A;  3NVM A;  1Q9X A;  4CZG A;  4CCH A;  4BWJ A;  1KAY A;  1R0A A;  4CW7 B;  4HHT A;  3D2E B;  3W0L A;  3LP1 A;  3DYA A;  3JSM A;  1BHL A;  3H3O B;  3RRG A;  2HHX A;  1XNQ K;  4JKH A;  1TYQ A;  2NRZ A;  1U47 A;  3IRX A;  1WN7 A;  4I2P A;  4PL7 A;  3O4N A;  3TSP A;  1J54 A;  4ISE A;  1HJO A;  3CIP A;  3O4Q A;  3VEW A;  2A41 A;  4DLE A;  3OYE A;  2A1S A;  1BWF O;  1CXQ A;  3ASM A;  4CFC A;  4PKI A;  4X64 K;  2W42 A;  3AA3 A;  4XH5 A;  1TK5 A;  1VQM N;  1D4X A;  1SAZ A;  4YOY A;  4DV2 K;  3AVA A;  3NF8 A;  1BUP A;  4FJJ A;  2YJF A;  1UAX A;  1KFS A;  3VF2 A;  3TSQ A;  2A3Z A;  1KLN A;  4JK7 A;  3GDQ A;  1WNS A;  2FSN A;  3FZF A;  2ITG A;  4HCB A;  3C95 A;  3RWU A;  5DM7 L;  4RWT A;  1IJJ A;  4DV0 K;  1Q82 O;  3C6T A;  4MLH A;  1I94 K;  1NKE A;  2ZF5 O;  4BC2 A;  1S1V A;  3R8E A;  4GNI A;  3MXJ A;  1VRT A;  2XY5 A;  4J8F A;  2D1K A;  4GKJ K;  1TKD A;  3CHW A;  3DLG A;  1NMN A;  1BOT O;  5HP1 A;  1NJW A;  1BU6 O;  3CC7 N;  4E7K A;  4FJ8 A;  2CGK A;  5A2Q O;  4FYD A;  4NLB A;  4G1Q A;  4Z4H A;  3SYZ A;  4XH1 A;  4FM1 A;  1BGX T;  4K43 A;  1NK8 A;  2WBN A;  3OS0 A;  4MO4 A;  4GV9 A;  3AVG A;  3ZX2 A;  1SL0 A;  4DLG A;  4ISG A;  2WFB A;  4ILG B;  4BR5 A;  4F9O A;  1CZA N;  1IH7 A;  3NH0 A;  3LWM A;  1HKC A;  3AVI A;  1GOA A;  4BGA A;  3FFK B;  1VQN N;  4KKO A;  1L5U A;  1WSG A;  3UIQ A;  1RNH A;  3CQ8 A;  3TTC A;  4F2R A;  1T6D A;  1KLM A;  2HBL A;  4V19 S;  4DTO A;  5AQJ A;  1ATS A;  4DFM A;  4A61 A;  4DFP A;  3SPZ A;  1JLG A;  1SZ2 A;  1JLB A;  2JGU A;  5AFU H;  3K59 A;  3MXM A;  4CJF A;  3LM9 A;  3AVN A;  4DTJ A;  2Q0U A;  4JS5 A;  4BC3 A;  2QI2 A;  2NRH A;  5AZI B;  1BCO A;  3E01 A;  4PL8 A;  4C1N K;  2NZT A;  3QBX A;  4QS7 A;  1XC3 A;  4DSL A;  5CY4 A;  5AZI A;  3F73 A;  3NH1 A;  3I56 N;  1NGA A;  3KTQ A;  2QA4 N;  1S72 N;  5HBM A;  3QBW A;  3CJB A;  3EN9 A;  4CJR A;  4FWS A;  3MEC A;  4IFE A;  3MMV A;  1EP4 A;  3QEW A;  3QIC A;  4KH5 A;  3K5M A;  4JKA A;  1TK8 A;  1FK9 A;  2D0A A;  1CLQ A;  5DM6 L;  2WOM A;  4DR4 K;  4GVE A;  3VEV A;  4BRL A;  3LP3 A;  3UKR A;  4J2D A;  5GAH P;  1ATR A;  4FLU A;  4CZH A;  4I9L A;  4B9N A;  4O5F A;  5AQL A;  5IWA K;  4JI2 K;  1RCH A;  1ZBI A;  4CZL A;  1Z05 A;  1TUY A;  2WON A;  4KTW A;  5IT9 O;  2GUI A;  2P9N A;  4KHU A;  1W0H A;  2NRT A;  3CG7 A;  1HNX K;  4HTU A;  4EHU A;  5JMV A;  3VQE A;  4IOX A;  1QQC A;  3L2U A;  1DGK N;  4DFK A;  1P8Z A;  4ZTF A;  1N34 K;  4DF8 A;  3QB0 A;  1HYS A;  2NLX A;  3PLA A;  2KTQ A;  1C1A A;  3KIO A;  2F9T A;  5I3U A;  3EZW A;  2Z1I A;  2DPN A;  4FPA A;  3ENH A;  3RR8 A;  1VSE A;  3EEQ A;  4DQ8 A;  4B1Z A;  1KVB A;  1VQP N;  1S1T A;  2E6L A;  1ASW A;  3G25 A;  1VSH A;  4CHO A;  1SL2 A;  4KV8 A;  1ZBH A;  1ZC6 A;  4M7X A;  4E1N A;  3TI0 A;  3SBG A;  3NFA A;  4AHT A;  1YJ9 N;  3LL3 A;  1VQL N;  5M1Q A;  3ZT0 A;  1BIU A;  4CD3 A;  4ID5 A;  4U67 L;  2VGN A;  1BA1 A;  3V4I A;  5AQW A;  3QNO A;  3AY9 A;  1LWF A;  3O1B A;  3OHR A;  1HX1 A;  2O8D B;  2KHO A;  3CQX A;  2OYQ A;  1NGG A;  4WQ4 A;  2P9P A;  3DWL A;  2RF2 A;  5KQ8 A;  3IG1 A;  3THY A;  1UA0 A;  5AQG A;  3HOS A;  2Z1J A;  3A5M C;  1C0M A;  2FSJ A;  2B6A A;  3C65 A;  4H5W A;  4MLE A;  1TKZ A;  4E7I A;  3WXI A;  2ZD1 A;  1RT6 A;  3ZCM A;  3SI6 A;  2A6A A;  3CC2 N;  3H1V X;  3SLC A;  1Q18 A;  2ZJR L;  3SUN A;  4JKB A;  1HNW K;  3VQQ A;  4PQU A;  4DWI A;  1LAV A;  1VRU A;  3AO3 A;  5GIP A;  1X9J A;  4DTN A;  4K8X A;  2JWK A;  3VQ9 A;  5FPN A;  3GBT A;  3MN6 A;  1YJW N;  4O0J A;  3W3D A;  4FWK A;  3WNH A;  1S9G A;  3VTH A;  2X6N A;  5D3G A;  4CER A;  3O1W A;  5F0X A;  4E7L A;  3TPQ A;  1ASU A;  4MO5 A;  2KLA A;  4CGF A;  5LMU K;  2BAN A;  3AVM A;  4AHC A;  4WCE L;  2DY4 A;  3EKS A;  2UXD K;  1K9M O;  3EY1 A;  3ISN C;  2VWK A;  2DFE A;  1MWK A;  1WSI A;  3M5R A;  1KTQ A;  3RTV A;  5TKW A;  2Q97 A;  3VEN A;  4FWM A;  4DF4 A;  3QFP A;  1HJR A;  2X74 A;  1YIJ N;  1VSI A;  2YX6 A;  1F21 A;  4DCH A;  3L4I A;  4NCB A;  4FOI A;  1EKE A;  3E9L A;  3OBW A;  3RMD A;  4CF9 A;  5KGX A;  2A42 A;  2P9L A;  5HRR A;  4AIL C;  4IFY A;  1JJ2 M;  4IO8 A;  1FKO A;  2QEX N;  1JLE A;  3WXM B;  1N5Y A;  1IBK K;  3K2P A;  3S3M A;  3CC4 N;  4CF0 A;  4BRM A;  3SQ4 A;  2PY5 A;  5C12 A;  3A0I X;  3CET A;  3I55 N;  2G8K A;  1VQ5 N;  2B4J A;  4O55 A;  1ZBF A;  3HRG A;  3ZSR A;  2XY6 A;  1RT1 A;  1OVQ A;  1NBW A;  3TAN A;  3JS6 A;  4CK3 A;  3O80 A;  4DQP A;  2I7N A;  3ZEU B;  2GEL A;  1YI2 N;  4DTM A;  1VHX A;  4DR2 K;  3TAP A;  2EX3 A;  4B8A B;  4KRE A;  1LAW A;  3HBT A;  3LWL A;  4BRE A;  4YOT A;  4LD0 A;  4CJT A;  3U3Y A;  2YHX A;  1KSP A;  4DHY A;  5C0Y A;  1NKC A;  4CJL A;  4C8L A;  1BDG A;  4CJ4 A;  3QEP A;  1JCE A;  4I9Q A;  2ETJ A;  2XY8 A;  3T69 A;  4DUY K;  1NOY A;  1ILY A;  5FPE A;  1NGC A;  1IG9 A;  2V51 B;  4JS4 A;  4DU4 A;  5GIO A;  2UUA K;  3NGZ A;  3OYL A;  2HHV A;  4FWO A;  4K42 A;  5LY3 A;  1ZBL A;  3CCQ N;  1YVU A;  3MEG A;  3KWG A;  1NGB A;  3A8Y A;  4NXN K;  3CD6 N;  4RW6 A;  1C1C A;  3LDN A;  5TKY A;  3TAB A;  5KI6 A;  1ITG A;  5CE3 A;  3WT0 A;  2FBT A;  4CGJ A;  3NAE A;  1NLV A;  3JYT A;  1LWE A;  3I0R A;  2DTU A;  1Z26 A;  3SNN A;  2J4R A;  4BAC A;  4CVN E;  4ELV A;  1LOT B;  3AVK A;  3A5L C;  3KK3 A;  3K5N A;  1J5O A;  2QWP A;  5AQY A;  3ZET B;  3WXJ A;  3ZLJ A;  3LAN A;  3LM2 A;  4MDA A;  5BR9 A;  3H6E A;  4CJW A;  3AVB A;  2DFF A;  3O08 A;  2UXB K;  4B9U A;  4UY8 O;  1YJN N;  5JLH A;  1OH5 A;  3I33 A;  3UB5 A;  5KRS A;  3ATU A;  3HOT A;  5J2M A;  2GBZ A;  5EVZ A;  2CGL A;  3CCR N;  4LF8 K;  4WQ5 A;  1J5E K;  2R7Y A;  4DV4 K;  1I3A A;  3J80 O;  4CJQ A;  4YDU C;  5AQX A;  3MWT A;  4L8R B;  4OGE A;  2P5O A;  4OPK A;  1W9H A;  1Q8I A;  3CFR A;  5C2F A;  3SBT A;  3CME N;  4R5P A;  2IOC A;  4CGH A;  4BDP A;  3MAQ A;  1JLC A;  1WSJ A;  3H45 C;  1NWK A;  3L2Q A;  3MXI A;  4Q0B A;  4FWN A;  1NJI O;  1X3M A;  5C2D A;  4DTR A;  1P90 A;  2G8U A;  3O6W A;  4NYN A;  2G8F A;  4KI4 A;  3U3G A;  3V1R A;  3BZC A;  5C10 A;  1BO5 O;  3M8Q A;  4QS8 A;  3ZSW A;  4LH5 A;  4AHS A;  1Z6R A;  4K41 A;  4A5A A;  2AA4 A;  3ALY A;  3LAK A;  1NU0 A;  2P9I B;  2H3G X;  3TAQ A;  2O8B A;  1ZXO A;  3MX2 A;  2WTU A;  2O8F B;  2KFN A;  2NRR A;  1RT4 A;  2QWL A;  3WNE A;  1VQ4 N;  1DT9 A;  2OPQ A;  2YV0 X;  1NM1 A;  3GL1 A;  3WEE B;  1LW2 A;  4FPB A;  3NBP A;  3OYK A;  1U2V A;  3PY8 A;  3PIO L;  2D0O A;  5C25 A;  4O5B A;  4FWP A;  3IAY A;  4OKK A;  2OZM A;  2G8W A;  4DS5 A;  1DTQ A;  1YVN A;  3AA5 X;  1NGH A;  5C24 A;  3RMB A;  2BH1 A;  2ZQB A;  4FK2 A;  1YUW A;  1W2B M;  4JAX A;  4FLT A;  3RSE B;  4B9L A;  4DR7 K;  1NGE A;  4FJH A;  1HPZ A;  5CYQ A;  3SUP A;  2FF3 B;  2HNZ A;  2OA8 A;  4BG9 A;  3AVH A;  4Y1C A;  5JIC A;  4LF6 K;  1Z25 A;  3VQD A;  1R59 O;  4W5T A;  3Q7C A;  2QXL A;  1MA9 B;  4JD2 B;  3FZH A;  1JL2 A;  1MWM A;  1O13 A;  1YT3 A;  3ZSV A;  4CJ7 A;  2HMP A;  3TAF A;  1S22 A;  4I2Q A;  4M3R A;  3LAM A;  5C42 A;  3HYF A;  4BVP A;  3PSI A;  4H5R A;  3FGU A;  4IWV A;  4CBX A;  1IO2 A;  4CE9 A;  3KD5 E;  4DSJ A;  1XWL A;  4NCA A;  2W40 A;  3IKM A;  5AR0 A;  2RN2 A;  3P31 A;  4YOU A;  4CF2 A;  3VQP A;  2NRV A;  2VYP A;  1TYQ B;  2EHG A;  3KWI A;  3IS9 A;  4DQR A;  4CIE A;  3AGR A;  4DQS A;  3VA3 A;  3VA0 A;  1N33 K;  4CEE A;  4F4K A;  1HNI A;  1NNE A;  4A62 A;  4AHV A;  1KQS M;  4C8M A;  3ZX3 A;  3DRS A;  4KHP K;  3P1G A;  2VG6 A;  3FLC O;  4CZM A;  3FZM A;  3E9P A;  3O3G A;  3FE1 A;  3TAG A;  1RIL A;  3CJA A;  3O5B A;  3SJH A;  2QK9 A;  4BVO A;  3Q7B A;  1KFD A;  4E1J A;  1QQM A;  1LCU A;  3DJC A;  3HPG A;  3ZT1 A;  3VOV A;  4I6M A;  5AQI A;  4DV1 K;  1GLD G;  1TV6 A;  5K14 A;  2YHA A;  1KAX A;  3QES A;  4JK8 A;  3QML A;  4KTZ A;  2YHB A;  2QTD A;  3DXK A;  2X78 A;  4BR4 A;  4ZTJ A;  1CXU A;  3OYJ A;  2HHU A;  4BRK A;  1N36 K;  4FJI A;  4MDB A;  3WXK A;  1IKV A;  2D4W A;  1VSD A;  1N8R O;  5LJV A;  3HM9 A;  4AM6 A;  3QEX A;  3K58 A;  1VSF A;  5BRE A;  3F9M A;  4LFB K;  1FKP A;  1HRH A;  1NJZ A;  3SUO A;  1X3N A;  2Q1N A;  2IAJ A;  1S1X A;  3PX0 A;  1FJG K;  1H1V A;  4CJS A;  5JLF A;  4LSN A;  4M3Z A;  4O0I A;  2E1Z A;  3V6D A;  4IKF A;  4KB0 A;  3OYD A;  1EX4 A;  4FW2 A;  4JRP A;  1KVC A;  3J7A P;  4GKK K;  3S41 A;  3T19 A;  4CGI A;  3JXU A;  2HHT A;  3ULD A;  1VQ7 N;  5CZ1 A;  2XRI A;  1D9D A;  2VCP A;  3U8X A;  5LJW A;  5BRD A;  1S1W A;  4B8C A;  3K5O A;  4DSE A;  5LMN K;  1GLA G;  4KHW A;  3TU5 A;  4JRQ A;  4Z94 A;  3KKR A;  2FF6 A;  2ZJP L;  3UKU A;  3KZB A;  1T03 A;  4FJM A;  4M3X A;  1T44 A;  2UUC K;  1EQY A;  2F96 A;  5EOY A;  4JKG A;  1HKB A;  2GV9 A;  2O4I A;  2AP1 A;  2IVN A;  5M1P A;  3NCI A;  3DLR A;  1DKG D;  4FM0 A;  5AQS A;  3RMC A;  2QWM A;  4FWL A;  4EIA A;  5FRO A;  2P1J A;  4GVM A;  3VEO A;  3F5T A;  4H5T A;  2XHB A;  4MFB A;  1JLF A;  2HST A;  1QTM A;  5ADX A;  3MWP A;  4BE0 A;  1KXP A;  5M1O A;  1NGI A;  1VSM A;  3C0B A;  3WQU A;  1U49 A;  4HUE A;  3PX6 A;  3HSC A;  3OS1 A;  3PV8 A;  3DRR A;  4CHN A;  1BQM A;  3ID8 A;  4B3S K;  2P9K A;  5EY4 A;  3SMP A;  1T05 A;  1J6Z A;  3K57 A;  4OLB A;  3VET A;  4HWI A;  1BCM A;  5M1K A;  4RG8 A;  3C6H A;  3UKR B;  4EFH A;  2ZWH A;  2QXF A;  3MN9 A;  4BC4 A;  5AQP A;  1HNZ K;  1EO1 A;  1OVY A;  5KRT A;  3LAL A;  3SMS A;  3C6A A;  3OYB A;  1HMV A;  4KI6 A;  3OTO K;  4CZJ A;  1IBM K;  2IIR A;  2HHQ A;  4PKG A;  3NVK A;  2P9N B;  1RFQ A;  1REV A;  4BRO A;  3L4Q A;  1UOC A;  5BR8 K;  1T7P A;  1C0U A;  3WNF A;  4YFU A;  1BIZ A;  2KQ2 A;  5FRN A;  4B9M A;  4DSF A;  3TR8 A;  4X62 K;  3P83 D;  2VQF K;  2DFH A;  3F2K A;  4TSX A;  4CGG A;  3LDS A;  1K8K A;  2D0P A;  3MN5 A;  4JI1 K;  1RBU A;  3FR0 A;  1M90 O;  4BY9 C;  1DTT A;  2YKM A;  1GOB A;  5T7B A;  4CJP A;  3TAE A;  5M1F A;  4B9V A;  1QHA A;  1VSJ A;  3NF9 A;  3PSF A;  3MDQ A;  2HF4 A;  3ITH A;  4RW7 A;  3NH2 A;  3QO9 A;  2E8A A;  4JN4 A;  4HVJ A;  1V4S A;  1NK5 A;  1HNV A;  3CCV N;  3KLF A;  4DKW A;  1EWR A;  4A2A A;  3D45 A;  1YHQ N;  3S3N A;  4IOC L;  3O8M A;  3TTF A;  3U9Z A;  2PFU A;  3WQT A;  4GV6 A;  1JLA A;  1RDD A;  2G8H A;  2HB5 A;  3KD1 E;  2KZM A;  2E2O A;  1HKG A;  5HRN A;  1ESV A;  3M6G A;  1X9M A;  1JLQ A;  4B9T A;  1J53 A;  3BUZ B;  2P9P B;  5F2R A;  2PBD A;  5KGW A;  1SKR A;  3ULE A;  3G10 A;  2GEM A;  2YJE A;  3THY B;  3M8P A;  3OYH A;  5AQQ A;  1T3V A;  4LF7 K;  3QER A;  2YHW A;  3QEI A;  3MEE A;  4O8U A;  4BQZ A;  1YTA A;  3JAM O;  4KHQ A;  3ZSO A;  3VF4 A;  3S3O A;  2HW3 A;  2OTJ N;  3CFO A;  3AO5 A;  2IS3 A;  2IC3 A;  4F3T A;  3CFP A;  2PZS A;  4H8K A;  2ZJQ L;  4LY7 A;  4DTU A;  4XEI A;  5KTQ A;  3OW2 M;  1C0F A;  1RTH A;  2W6K A;  4ELT A;  1U04 A;  1U48 A;  1T8E A;  2OPR A;  2ASP A;  3CJ9 A;  3V9W A;  3NF6 A;  4CEA A;  3VEX A;  1TK0 A;  1VK0 A;  1JKH A;  4Y1D A;  2HHH K;  1O1W A;  2Z1H A;  4H0P A;  3DXM A;  3P39 A;  4FJ7 A;  3VES A;  4M45 A;  2D5R A;  4JHD A;  2HOE A;  1RT7 A;  2UYT A;  1JXB A;  5J2Q A;  1ATN A;  1GLC G;  4E89 A;  3ZT2 A;  2QM1 A;  4NLC A;  2F8T A;  3T1Y K;  3SQ1 A;  2YNH A;  4CEB A;  4JEP A;  3HT3 A;  5FPD A;  4EP4 A;  5GAE P;  1VQ6 N;  4BRA A;  3M8R A;  2E5L K;  4FZY A;  3HM8 A;  1LW0 A;  4E7J A;  1NG9 A;  2BUP A;  4ICL A;  4M7Y A;  5AQF A;  4BG8 A;  1VQ9 N;  3L3U A;  1XHZ A;  5H1S Q;  3VQC A;  2P9L B;  4C23 A;  1KC8 O;  3OYI A;  4YOV A;  2F4V K;  2ZGY A;  3AGK A;  3NGI A;  2A1R A;  2Y1J A;  2E20 A;  1D5A A;  3ID6 A;  2RKI A;  4O8K A;  1IKX A;  4OVL A;  2P9S A;  1RBT A;  3LDO A;  4ILJ A;  4XIU A;  5AZJ A;  2IVP A;  1B92 A;  5HL7 L;  4FJN A;  3CCE N;  4Z4G A;  3C7N A;  2E6M A;  3AV9 A;  3BDP A;  4YDU A;  3LDP A;  1NK0 A;  1U6Z A;  3TSU A;  4QCL A;  4DV6 K;  2HBM A;  2VWB A;  1S5J A;  1RT3 A;  2FBV A;  5J2P A;  3CQY A;  4FJG A;  4BRG A;  2OZS A;  2Q36 A;  4CF8 A;  2XY7 A;  2KFZ A;  4I7F A;  3KLG A;  3VTI A;  2ZGZ A;  3P5J A;  1C6V A;  1V4T A;  2IVO A;  3SK3 A;  1NK4 A;  3AVF A;  3K9J A;  3VQ6 A;  4BE2 A;  2X6S A;  3OBY A;  2NRX A;  2E88 A;  4DQQ A;  3THW A;  5BPN A;  3MX5 A;  1XHX A;  1HYZ A;  2E2P A;  2YNF A;  1RTD A;  3NHG A;  4Z4I A;  4IJN A;  3E9O A;  3OYG A;  2B5J A;  3HVR A;  4YY3 K;  1EWQ A;  4L3Q A;  3EYZ A;  2Q3S A;  3SQ0 A;  3A5O C;  2PYL A;  4FLX A;  1BI4 A;  2V52 B;  3OYM A;  1YF5 L;  3VF6 A;  1L3V A;  2W41 A;  4FK0 A;  4J2A A;  1B9F A;  4JI0 K;  2Q0R A;  4NYF A;  4CJK A;  3OJU A;  4H0X B;  3C94 A;  3E1Y A;  4Q5V A;  3HPO A;  4LF5 K;  3VGM A;  4NXM K;  1RDW X;  5HRP A;  4DR5 K;  1BQN A;  2OCE A;  3P38 A;  4DB3 A;  4OX9 K;  5BN9 A;  1IG8 A;  4FLY A;  1WLJ A;  3VMF B;  2FBX A;  2PAV A; 
#chains in the Genus database with same CATH homology
 4IDH A;  4B1X B;  3TTC A;  4BVP A;  4H5R A;  3FGU A;  4IWV A;  4CBX A;  1T6D A;  1ZBS A;  2HBL A;  2P9U A;  3E66 A;  3AAR A;  2W40 A;  3IKM A;  5AR0 A;  3DLL L;  4GY2 B;  1ATS A;  5AQJ A;  3P31 A;  4YOU A;  4A61 A;  3CCS N;  1JCG A;  1SZ2 A;  3QDK A;  2NRV A;  5AFU H;  4BRI A;  2VYP A;  3DXM B;  5BPM A;  1TYQ B;  3LM9 A;  3KWI A;  3CCU N;  4RTF D;  3AGR A;  2Q0U A;  3EO3 A;  1E4G T;  4JHD B;  4BC3 A;  2HBK A;  2QI2 A;  3U9D A;  2NRH A;  3LDL A;  5AZI B;  5GAD P;  4U7B A;  4PL8 A;  4JKF A;  4C1N K;  4A62 A;  2NZT A;  3QBX A;  4QS7 A;  4OPA A;  5ELZ A;  5HOO A;  1XC3 A;  3ZX3 A;  1KQS M;  2GTD A;  4CI6 A;  3MCA B;  3U4L A;  2QW9 A;  3FLC O;  5AZI A;  4CZM A;  3HZ6 A;  3FZM A;  3E9P A;  3M3Z A;  3VER A;  3CXC M;  3I56 N;  1NGA A;  3FE1 A;  3CJA A;  4ISF A;  5EX5 A;  4BRN A;  2QA4 N;  4JKD A;  1RDU A;  3O5B A;  5I9E B;  3SJH A;  1S72 N;  1NMD A;  4BVO A;  3Q7B A;  4A5B A;  2A40 A;  3QBW A;  4E1J A;  3CJB A;  3GOI A;  1RGI A;  3EN9 A;  1QQM A;  1LCU A;  4FWS A;  1T6C A;  2Q31 A;  4IFE A;  3DJC A;  3MMV A;  3IDH A;  3VOV A;  3G6E N;  2FLO A;  3QIC A;  4KH5 A;  4I6M A;  5AQI A;  1GLD G;  2GX9 A;  2P9S B;  4JKA A;  4B1V A;  3CJ7 A;  5AZJ B;  5DM6 L;  5AQN A;  1KAX A;  1QVF M;  4GVE A;  4BR7 A;  3VEV A;  4AM7 A;  4FWQ A;  4BRL A;  2CGJ A;  3C7N B;  3KK7 A;  4JK8 A;  3UKR A;  4CBW A;  2OTL N;  3D7E O;  5GAH P;  3QML A;  4A57 A;  1ATR A;  4OPH A;  3J7Z O;  4CZH A;  2QTD A;  5AQV A;  3DXK A;  4BR4 A;  4PKH A;  4B9Q A;  3SAH A;  1TUU A;  3AAP A;  5FPM A;  4O5F A;  5AQL A;  4B1U B;  4QS9 A;  4BRK A;  4CBU A;  1VQ8 N;  4MDB A;  3WXK A;  4C1N I;  4CZL A;  2D4W A;  3CJ1 A;  4NB4 A;  1Z05 A;  1TUY A;  1N8R O;  5LJV A;  4AM6 A;  2P9N A;  4YOW A;  4A59 A;  3F9M A;  5BRE A;  2NRT A;  3MK6 A;  4CZK A;  3CPW M;  3J8A A;  2RHK A;  4EHU A;  5JMV A;  1W97 L;  1KAZ A;  1X3N A;  2Q1N A;  4IOX A;  5AQO A;  1DGK N;  4RCH A;  1U2V B;  1WOQ A;  2I7P A;  1P8Z A;  1H1V A;  5JLF A;  4R79 A;  3QB0 A;  2NLX A;  3PLA A;  2HF3 A;  3ENB A;  5F1X A;  2E1Z A;  4BRP A;  2F9T A;  3A5N C;  3N4Q A;  3VEY A;  3EZW A;  3IMX A;  2DPN A;  3S41 A;  4FPA A;  3ENH A;  2YI1 A;  4DQ8 A;  4B1Z A;  2OAN A;  3JXU A;  1M1K O;  1QZ5 A;  1VQP N;  4H5V A;  3G25 A;  4WQ4 C;  1VQ7 N;  1ZC6 A;  1XUP O;  2VCP A;  4M7X A;  3U8X A;  5LJW A;  5BRD A;  3H46 O;  2F9W A;  2E2N A;  1GLA G;  3TU5 A;  4Z94 A;  3ZEU A;  2FF6 A;  2ZJP L;  3SBG A;  3UKU A;  3KZB A;  3LL3 A;  1YJ9 N;  3FZK A;  4IZ9 A;  1VQL N;  2FXU A;  5M1Q A;  1T44 A;  4CD3 A;  4CD1 A;  1EQY A;  4JKE A;  4U67 L;  2VGN A;  1BA1 A;  2QWO A;  5AQW A;  3KVG A;  5EOY A;  4CZE A;  2JWL A;  4JKG A;  1HKB A;  3AY9 A;  1HUX A;  1S3X A;  2P9U B;  3O1B A;  3OHR A;  2AP1 A;  1HX1 A;  4HTL A;  3CJC A;  3EE8 A;  1GLL O;  2KHO A;  3CQX A;  1NGG A;  1QZ6 A;  3K9K A;  2IVN A;  2P9P A;  3DWL A;  4IJA A;  4WQ4 A;  5EXW A;  2V7Z A;  5M1P A;  3DAW A;  5KQ8 A;  1KD1 O;  4XH4 A;  1DKG D;  5AQS A;  3D2F A;  3QFU A;  2QWM A;  4UY8 O;  2QWQ A;  4FWL A;  2CH5 A;  4EIA A;  5AQG A;  4H0Y B;  2HBJ A;  3HOS A;  3VEO A;  4H0T B;  3A5M C;  2FSJ A;  4H5W A;  3C65 A;  4MLE A;  1Q81 O;  1GLJ O;  3F5T A;  4H5T A;  3WXI A;  1NGF A;  2A6A A;  2HST A;  2VGM A;  5ADX A;  2ASO A;  4KH4 A;  3MWP A;  3H1V X;  4WFA L;  3CC2 N;  3SLC A;  1Q18 A;  1GLF O;  5E84 A;  2ZJR L;  4JKB A;  1KXP A;  3BF3 A;  5M1O A;  3MCP A;  1NGI A;  3C0B A;  4BRQ A;  4EAH D;  5GIP A;  1X9J A;  3WQU A;  5KPR A;  2WC9 A;  4WF9 L;  2JWK A;  3HSC A;  5FPN A;  3GBT A;  3MN6 A;  1YJW N;  2E2Q A;  3ENO A;  1G99 A;  3W3D A;  4FWK A;  3ID8 A;  2P9K A;  5EY4 A;  3VTH A;  3SMP A;  3SAF A;  4I6M B;  1J6Z A;  1GLB G;  3L6Q A;  4B1W B;  3O1W A;  3VET A;  5F0X A;  2CH6 A;  3D2E A;  3EKU A;  3TPQ A;  4MO5 A;  5ADX H;  4HWI A;  5M1K A;  2KLA A;  3ZET A;  1OKJ A;  5AQZ A;  3VPZ A;  3C6H A;  3UKR B;  4ILH A;  4EFH A;  2ZWH A;  5KPT A;  3GG4 A;  3M1F A;  4Y0W A;  4WCE L;  3NMU A;  3MN9 A;  3EKS A;  4A2B A;  2KKZ A;  3R3L A;  4BC4 A;  5BPL A;  5BRH A;  3DXK B;  1K9M O;  5E26 A;  4BR9 A;  4CZF A;  5AQP A;  4YOX A;  1EO1 A;  1OVY A;  4NO7 A;  1MWK A;  3KHY A;  3C6A A;  3M5R A;  3SMS A;  5TKW A;  2Q97 A;  3VEN A;  4FWM A;  1HPM A;  4CZJ A;  3QFP A;  2EWS A;  2IIR A;  3N4P A;  3O9S A;  4PKG A;  1YIJ N;  2YX6 A;  3NVK A;  2P9N B;  1VQK N;  1RFQ A;  1VQO N;  4DCH A;  3L4I A;  4BRO A;  5CHI A;  4FOI A;  3E9L A;  3L4Q A;  1SQK A;  3OBW A;  4B1Y B;  4BC5 A;  1WUA A;  4JNE A;  5AQR A;  5GAG P;  5KPZ A;  2A42 A;  2GWK A;  4WFN L;  2P9L A;  5CR4 A;  5GIN A;  3R6M A;  4BRF A;  1JJ2 M;  3F2K A;  4IO8 A;  3G71 N;  2QEX N;  1K8K A;  1E4F T;  4IEI A;  2D0P A;  3WXM B;  3MN5 A;  4BY9 C;  3FR0 A;  1GLE G;  1M90 O;  3CC4 N;  5AQM A;  4BRM A;  1K73 O;  4FO0 A;  5AQT A;  5M1F A;  3MN7 A;  2NRW A;  3O9U A;  1QHA A;  5C12 A;  2YCH A;  5M1N A;  3A0I X;  3MDQ A;  3CET A;  3HI0 A;  2HF4 A;  3I55 N;  1K8A O;  1VQ5 N;  3BEX A;  5AQK A;  3SAG A;  2Q2R A;  2E8A A;  4JN4 A;  3ATV A;  3HRG A;  2ASM A;  3CCL N;  5JVG L;  1V4S A;  4BGB A;  3CCV N;  4LC9 B;  1NBW A;  1MDU B;  4DKW A;  2F7T A;  3JS6 A;  4FL9 A;  4BRD A;  3O80 A;  2I7N A;  3ZEU B;  2GEL A;  4H0V B;  3WUH A;  4A2A A;  3G4S N;  1YI2 N;  1YHQ N;  3UKU B;  4BQL A;  3RVC A;  2P9I A;  4IOC L;  3CER A;  5B8H A;  3GE1 A;  1QQN A;  3O8M A;  3TTF A;  1QVG M;  3U9Z A;  4JK9 A;  2PFU A;  3WQT A;  4GV6 A;  3CPE A;  4IOA L;  3HBT A;  4JKG B;  4BRE A;  2E2O A;  2RE2 A;  1HKG A;  4YOT A;  5KQD A;  1ESV A;  3M6G A;  2YHX A;  3WEE A;  3D6R A;  4PHT X;  4DHY A;  5C15 A;  5C0Y A;  3BUZ B;  3H1Q A;  2P9P B;  1JCF A;  1BDG A;  2PBD A;  5F2R A;  3VEZ A;  3ULE A;  2GEM A;  4GV3 A;  4EHT A;  1JCE A;  2QWR A;  3D2F B;  3LDQ A;  2YJE A;  4BR0 A;  5AQQ A;  3T69 A;  1YIT N;  5MLC Q;  1T3V A;  3EE9 A;  5JVH L;  1ILY A;  2BTF A;  2YHW A;  4WYB A;  5FPE A;  2WUS A;  1NGC A;  2V51 B;  4H03 B;  4O8U A;  5GIO A;  3FZL A;  4BQZ A;  3IUC A;  4FWO A;  4K42 A;  4JKC A;  4AF1 A;  5LY3 A;  3H3N O;  5BRF A;  3CCQ N;  2V7Y A;  3RSE A;  3KWG A;  3PIP L;  1NGB A;  3A8Y A;  3VF4 A;  2QWN A;  3CD6 N;  4H5N A;  2OTJ N;  3BF1 A;  4G9Z A;  4M63 C;  3L0Q A;  2GUP A;  3LDN A;  1BA0 A;  5TKY A;  4JD2 A;  4YOR A;  5CE3 A;  3WT0 A;  2ZJQ L;  3BP8 A;  4XEI A;  1DEJ A;  3OW2 M;  1NLV A;  2GWJ A;  1C0F A;  4FVU A;  1YXQ A;  3IFR A;  3EL2 A;  2P9K B;  3O9R A;  4WQ5 C;  3CCM N;  4WFB L;  3NVM A;  4CZG A;  2J4R A;  3AAQ A;  1QQO A;  1KAY A;  5AQU A;  1HLU A;  1LOT B;  2ASP A;  3CJ9 A;  3D2E B;  3W0L A;  3A5L C;  3ZYY X;  2QWP A;  5AQY A;  3ZET B;  2ITM A;  3VEX A;  3CF5 L;  4H0O A;  3H3O B;  4H0P A;  3WXJ A;  3VGK A;  3DXM A;  4JKH A;  1TYQ A;  1BG3 A;  2NRZ A;  3LM2 A;  3P39 A;  4MDA A;  3H6E A;  3VES A;  5BR9 A;  4PL7 A;  1Q86 O;  3TSP A;  3O08 A;  4ISE A;  3VEW A;  1HJO A;  3CIP A;  4JHD A;  2HOE A;  3CMA N;  1VAZ A;  2UYT A;  2A41 A;  1YJN N;  5JLH A;  1ATN A;  1GLC G;  3I33 A;  3R1X A;  2QM1 A;  3ATU A;  4NLC A;  3UB5 A;  3HOT A;  1BWF O;  4IEE A;  5EVZ A;  5AQH A;  2CGL A;  3CCR N;  4PKI A;  4JEP A;  4WQ5 A;  5FPD A;  1NGJ A;  3HTV A;  5GAE P;  3TTD A;  1VQ6 N;  4YDU C;  5AQX A;  3MWT A;  4BRA A;  3HM8 A;  4XH5 A;  1VQM N;  2BUP A;  1D4X A;  1NGD A;  1SAZ A;  4M7Y A;  5AQF A;  4BG8 A;  4YOY A;  1VQ9 N;  3UE5 A;  5C2F A;  3SBT A;  3CME N;  5H1S Q;  4FOE A;  2P9L B;  3CI5 A;  4C23 A;  1KC8 O;  3VGL A;  1BUP A;  3OA9 A;  4YOV A;  2ZGY A;  3AGK A;  2YJF A;  3WXL A;  3VF2 A;  1K8K B;  2A5X A;  1SS6 A;  2E20 A;  3ID6 A;  4FSV A;  3TSQ A;  2A3Z A;  4BRH A;  4O8K A;  4JK7 A;  3H45 C;  2P9S A;  1NWK A;  3LDO A;  4ILJ A;  3GDQ A;  4FWN A;  2FSN A;  1X3M A;  5AZJ A;  5C2D A;  3FZF A;  1NJI O;  2IVP A;  4KH6 A;  1P90 A;  5HL7 L;  3CCE N;  3C7N A;  3R9P A;  3O6W A;  4YDU A;  3O9Q A;  3LDP A;  1BO5 O;  1U6Z A;  5C10 A;  3TSU A;  5DM7 L;  4KBO A;  4RWT A;  1IJJ A;  4QS8 A;  1Q82 O;  4FWR A;  4MLH A;  2E1Y A;  2HBM A;  2ZF5 O;  2VWB A;  4BC2 A;  1Z6R A;  4K41 A;  3R8E A;  4GNI A;  3CQY A;  4CZI A;  4J8F A;  2AA4 A;  2D1K A;  4A5A A;  4BRG A;  2Q36 A;  2P9I B;  2H3G X;  3ZX0 A;  3VTI A;  2ZGZ A;  4BRC A;  4BR2 A;  3CHW A;  1ZXO A;  1V4T A;  3MX2 A;  2IVO A;  3SK3 A;  1BOT O;  2NRR A;  1BU6 O;  3I8B A;  3CC7 N;  3K9J A;  2QWL A;  1VQ4 N;  1DT9 A;  1XQS C;  3GL1 A;  1NM1 A;  3OBY A;  3WEE B;  2CGK A;  2NRX A;  4IO9 L;  2E88 A;  5BPN A;  3MX5 A;  4OO1 J;  4FPB A;  3O9T A;  4NLB A;  1U2V A;  3ULE B;  2E2P A;  3PIO L;  2D0O A;  4XH1 A;  3B8A X;  4IJN A;  4K43 A;  3E9O A;  4FWP A;  2WBN A;  2YHY A;  3CCJ N;  4L3Q A;  4MO4 A;  1YVN A;  1NGH A;  5BN8 A;  2BH1 A;  2FSK A;  3A5O C;  2NNW A;  4GV9 A;  1YUW A;  1W2B M;  4JAX A;  1C0G A;  3RSE B;  3ZX2 A;  3O4W A;  1NGE A;  2V52 B;  1Q7Y O;  1YF5 L;  3VF6 A;  2FF3 B;  4ISG A;  2WFB A;  2W41 A;  4ILG B;  4BR5 A;  4F9O A;  1CZA N;  4BG9 A;  2Q0R A;  5JIC A;  4H0X B;  5AFU A;  1YAG A;  3E1Y A;  1R59 O;  3VGM A;  3Q7C A;  1RDW X;  3T7Z A;  2QXL A;  1MA9 B;  1HKC A;  4JD2 B;  3P38 A;  3FZH A;  4DB3 A;  4IXC A;  5BN9 A;  1IG8 A;  1MWM A;  1O13 A;  4BGA A;  3FFK B;  3VMF B;  4CJ7 A;  1VQN N;  4K25 A;  2PAV A;  2HMP A;  1Y64 A;  1S22 A;  3P4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...