5HL7L

The crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with lefamulin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
ISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKGVTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYLYHGRVKALAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2
publication title A novel pleuromutilin antibacterial compound, its binding mode and selectivity mechanism.
pubmed doi rcsb
total genus 16
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2016-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.100 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 5hl7L01
3CCVN 3CCLN 1YITN 1KQSM 1N8RO 5GAEP 1NJIO 3CMAN 1VQ8N 1M1KO 3CD6N 1Q81O 1KD1O 3CCRN 4WFNL 4WCEL 3PIOL 2ZJQL 1YJ9N 3I55N 3OW2M 5JVHL 2QA4N 3PIPL 1QVGM 5GAGP 4U67L 5GADP 1VQPN 1W2BM 1K73O 2ZJPL 1VQON 3CC7N 1VQ4N 1Q86O 3CC2N 3CXCM 3I56N 2QEXN 1S72N 4WFAL 3CPWM 3CCEN 1VQ6N 1VQ5N 1YI2N 5H1SQ 3CCSN 3CMEN 3DLLL 3CCMN 3CCQN 4UY8O 1YJWN 1K8AO 1ILYA 5DM6L 1K9MO 1VQLN 1VQKN 1KC8O 1OVYA 3G4SN 4WFBL 1YJNN 1VQNN 3CC4N 3CCJN 5HL7L 2OTLN 3J7ZO 3CCUN 1VQ7N 1Q7YO 1VQ9N 1QVFM 2ZJRL 1VQMN 1YHQN 4IOCL 1JJ2M 5JVGL 3G71N 5MLCQ 2OTJN 4IOAL 1M90O 5GAHP 4WF9L 1Q82O 5DM7L 1YIJN 4IO9L 3CF5L 3G6EN
chains in the Genus database with same CATH superfamily
3AVFA 3ZT4A 3L0QA 4H4OA 5AQLA 3V81A 2B6AA 3MWTA 4M7YA 1HLUA 3KWGA 1BI4B 3RR8A 2YNFA 2I7PA 3MN7A 4M3TA 4LF9K 3F5TA 2FSJA 3TPQA 3GE1A 4YORA 5HROA 1IG8A 1QVGM 4F2SA 2PBDA 5I9EB 1EX4A 3WQUA 3U9ZA 3DXKB 3JAMO 1ZBIA 1RTHA 4N5SA 1Z25A 3TARA 4CEFA 1NMDA 5HRSA 5GADP 4ZTFA 4FZYA 4OGCA 4CF8A 4YFUA 1ASWA 3DJCA 3DMJA 1VQON 2V51B 4B1VA 1Q86O 3NF6A 1XMOK 4ISGA 4DTOA 1JLQA 4N56A 1J5OA 3G25A 1EXQA 3SLCA 5LMUK 1L3TA 4FPAA 1TAQA 4M3UA 3DLLL 1Q9YA 4A61A 3ISNC 3VQ6A 5AQFA 3ZT0A 3RWUA 4YOTA 5JLFA 1VQKN 5IT9O 1UOCA 4LFAK 3V6DA 4KPYA 1VQNN 1VSKA 4BDYA 2OTLN 1VQ7N 2JWKA 3S3NA 3IFRA 4M45A 3VESA 2X74A 4OKKA 4KHWA 2GWKA 4PL7A 3OYMA 4N76A 3CIPA 4C8MA 1JLAA 4FJGA 5AZJB 1VSIA 2FF3B 4XEIA 3OYHA 4H5TA 1KAXA 5ELZA 4PY5A 2Q3SA 2VGNA 4CIGA 4M3YA 3TTDA 3AVCA 1RT2A 1JKHA 2VG6A 3AVNA 3ID6A 1HQEA 4OVLA 5GIPA 2W6KA 1X9MA 3H1QA 2ZF5O 5BN9A 2YHAA 4JI3K 3EE8A 3H08A 3K2PA 5BN8A 4W5OA 4DU3A 3V4IA 3AA2A 1WSJA 3ZSOA 1KFSA 3VQ5A 3CCRN 3QEWA 1RDBA 4FWKA 5AQMA 1S1WA 1MWKA 3DWLA 3C65A 1TKXA 1U2VA 4FLWA 4FJKA 3PIPL 5AJ3K 1S1VA 4KREA 1HMVA 3WXIA 1T7PA 1QZ6A 1B9FA 1J6ZA 1VRUA 3LDNA 4OGEA 3LDOA 5BRHA 2FSKA 1BHLA 3E01A 4FJLA 1BG3A 3CJAA 4CJQA 4CEOA 2UXDK 2VQFK 3QEVA 5J2QA 4FJNA 3CC2N 1IG9A 2FBYA 2HBMA 1S72N 2GTDA 1Z6RA 3UKRA 3ZX2A 1NLVA 2OPSA 2YJEA 3H3OB 4YHHK 5H1SQ 3EZ5A 4CJWA 3THWA 3A8YA 1VSEA 5GIOA 2HBKA 2OANA 4PA1A 3IS9A 1D8YA 4BGBA 1RDWX 2NRVA 3O8MA 5BPLA 3LP3A 1OVYA 5C15A 4KH6A 3P38A 4DUZK 4DS4A 1WAJA 3C7NB 3RSEA 1TVRA 4FLTA 3TAGA 1TV6A 4BGAA 4BRAA 2PZSA 3ZT2A 3PLAA 3CCJN 2IC3A 5CR4A 4EAHD 1QS4A 3CFRA 1RGIA 3I0SA 1X3MA 1XUPO 5AQWA 3CQ8A 5E41A 4IOCL 3VEXA 1HJOA 4B1YB 3AVAA 1P90A 4E7HA 3SI6A 1RBTA 4JKFA 2FBTA 4DWIA 4ZHRA 4A57A 4AHSA 1R0AA 4F3TA 4FZZA 3DOLA 4ZTJA 4DB3A 4X66K 5KPTA 5C10A 3I8DA 1JLEA 4KB1A 1IV0A 4J2BA 4IFVA 1LWFA 4BRIA 3HJFA 3KTQA 2NNWA 1NOZA 4DTSA 3KLIA 3AVHA 1B9DA 4WQ4A 1A5XA 4JI7K 2I5JA 2YNGA 1D9DA 1WN7A 4BROA 4O5FA 1QQMA 1U4BA 4J2EA 5EOYA 2P9IA 4WCEL 4JRPA 1ZBLA 3CQXA 3MX2A 2E2NA 4FW1A 4YDUC 4JKDA 4JLHA 2VWBA 2CH6A 5JS2A 4QOZB 3AA4A 1SKRA 2YKMA 2GEMA 3A5LC 3R6MA 1VQ4N 1RBVA 3DRRA 3TWHA 3FR0A 4PHTX 1T3VA 1FKOA 3THXA 1A5WA 5C25A 2IS3A 3G10A 3TAFA 4CZLA 3P1GA 5AQYA 5AQSA 3RMCA 1KSPA 4E1NA 2G8KA 3AVBA 3ZSYA 2E20A 2D0PA 2OPRA 3A5MC 1DEJA 2YHWA 1RDAA 2W41A 4BE1A 4FWRA 1TKZA 4O8KA 1NKCA 2UXBK 3VEOA 2V52B 4IZ9A 5HL7L 4NCGA 3PSIA 1YTUA 2O8EB 2KW4A 4IEEA 4DV4K 4KB0A 1R59O 2EHGA 1RBUA 4B08A 3EY1A 2QTDA 1BGXT 5JVGL 5AQKA 3UKRB 1FW6A 1Q9XA 1GLLO 4BR9A 2O4GA 5IWAK 2A41A 4AM7A 3WQTA 3FFKB 1B92A 2P9LB 4B9NA 1HKBA 1N5YA 3OYCA 3OYBA 4DU1A 3SUNA 2ATQA 4LF4K 3Q7CA 3EL2A 4N47A 3UKUA 4JKHA 3PY8A 1XQSC 2P9SA 1YUWA 4CW7B 1BCOA 2FBVA 3TTFA 4MO5A 1TYQA 4M63C 1EWQA 1FXXA 5GAEP 2FC0A 1I39A 4BDPA 3RRGA 3EN9A 2NRRA 2J4RA 1LAWA 4BWJA 1Q81O 4F3OA 1WSIA 4V19S 1JCFA 4C23A 1TUYA 3AA5X 1JLBA 2E1ZA 4CJ5A 3EKUA 4JK8A 3OYJA 3WEEB 1LV5A 3I33A 1KLNA 2UUCK 2IDOA 2ZJPL 1REVA 3LP0A 4JV5K 1CLQA 3V9XA 2HHXA 2HHWA 2DFHA 4W5NA 1IKXA 4CFAA 3JSMA 2KHOA 4E7IA 3L2WA 3M3ZA 5LJWA 3K59A 1NGHA 2O8CA 3DLGA 2UUAK 1IKWA 3TTCA 1YI2N 2R7YA 2HMIA 3OS2A 5AFUA 3NMUA 3HPHA 2HHHK 3CCMN 2Q36A 2ZWHA 2P9IB 4CFBA 4ILGB 5I42A 4JI0K 3CCQN 3SQ4A 1RBRA 1W9HA 3F9MA 1KCFA 1K8AO 4DSKA 3U3GA 1NK7A 3O9UA 1KC8O 1BO5O 3HPOA 1ATSA 3QETA 3AVLA 3CC4N 4I9QA 5FPMA 4QS8A 3D2FA 4G1QA 3J7ZO 1SAZA 3P4IA 4GV6A 3L4IA 4I6MA 3V1RA 5AQGA 1Q7YO 1DGKN 3MAQA 1NJWA 5HP1A 1YHQN 4MDBA 4H0XB 3LL3A 2QWLA 3BEXA 4AILC 5BPNA 1RDCA 3B6PA 2GBZA 4DSLA 1YVUA 1YIJN 1HYVA 1TGOA 4LH4A 4BACA 4UQGA 2Q31A 1JLCA 2GWJA 3OJSA 3HO1A 4RG8A 5AFUH 1E4GT 4W5TA 3DXMB 4N41A 1KVBA 4FK2A 4BC4A 4BRMA 4CJVA 1I94K 4DR5K 1NU0A 1RTIA 1N8RO 3TU5A 4HTUA 4DSJA 2FXUA 1XNQK 1NJIO 4B3SK 3BP8A 1RT7A 1NGCA 4FWOA 2VCPA 3VEZA 1EP4A 1KVAA 5AQNA 2GX9A 2UYTA 4CJKA 4AM6A 2QKBA 3ZSWA 2O8DA 3EE9A 3C6UA 5GAGP 5TKYA 4C1NK 2OPPA 3AVMA 4AHTA 3Q7BA 3VENA 1SZ2A 4CZKA 1OH5A 1GLEG 4IDHA 4JKGA 3IDHA 2OA8A 2BTFA 1GLAG 4DV3K 3UKUB 1Y64A 1HNVA 1JXBA 2P9SB 1U45A 4ELUA 4Y1CA 4DTRA 5I3UA 4NO7A 1TYQB 1C0FA 2Q2RA 1NK0A 3L3UA 1QSSA 2HHUA 3OHRA 4J2DA 3VF2A 4JN4A 3MN9A 5C0YA 3QMLA 5C24A 1ATRA 4CGIA 1XNRK 4CZEA 1VSDA 3BF1A 2IAJA 3CM5A 5BRFA 3QERA 5AQIA 2W40A 1O13A 1L5UA 4CD1A 1KVCA 4IXCA 4RW7A 1VQLN 4OLBA 3CJ9A 4O0JA 4WFBL 4BVPA 4H0VB 1U6ZA 2VWJA 3VA3A 1L3SA 3MXMA 2RKIA 1SS6A 2AP1A 2D1KA 1SUQA 5M1QA 1XC3A 2HF4A 3JYTA 3M8RA 1ZC6A 2UU9K 4FJ5A 1YVNA 4CGHA 2XHBA 4CBUA 4KHNA 4NYFA 1BCMA 3KIOA 1WOQA 4FJMA 1S6QA 1IBKK 3MX5A 2HHSA 4B1UB 3TAMA 1NK9A 4FM0A 3PX0A 3K5NA 3AGKA 1NGJA 4KH5A 3ZSZA 3ENBA 1W0HA 1EETA 2QXFA 3VGKA 3DLBA 1TK0A 2E88A 1Y97A 3AA3A 3O4NA 3L8BA 3BUZB 5AQJA 2RPIA 3KK2A 3M6GA 1HKCA 5F0XA 1OH6A 4I6MB 1NGGA 4GVEA 3LDQA 3SQ2A 1YJ9N 2XO7A 1V4TA 3MCAB 4Z4FA 2BE2A 3V1QA 5T7BA 3VEYA 5K14A 4G9ZA 3SJJA 3AY9A 3BF3A 3K58A 4FVMA 5M1FA 1ZBUA 3OS0A 1WSFA 2IVPA 3KLEA 1W7AA 4CBXA 1K73O 1WUAA 2NLXA 1SV5A 3ATVA 4BE0A 3KK1A 3EYZA 4W5RA 3CPWM 4Z4IA 3F73A 3O3GA 3CG7A 4FM1A 3MECA 3CCSN 1BA1A 1KLMA 4Z0UA 3CMEN 4CF9A 3FZHA 3WT0A 3ATUA 4MQ3A 4CE9A 5AQTA 3T19A 3CM6A 4A5BA 4M42A 3KKRA 2P9UA 4IG3A 1HKGA 4RW9A 2ETJA 3L2QA 2X78A 4H0YB 4FZXC 1T8EA 3L3VA 3LM2A 3FZFA 3LDLA 1HPZA 3HVRA 4DSIA 2PYJA 3ENHA 4BQLA 3CJBA 1JJ2M 3NH0A 5FPNA 4R79A 1TK5A 3V1OA 5BRDA 4FWPA 5J2PA 1WBDA 3ZETB 3MEGA 1DKGD 1DT9A 2NUBA 5F1XA 4JD2A 2LSNA 3LZJA 3VQAA 3HSTB 1CXUA 3DI6A 3WNEA 3NBPA 4YDUA 2E8AA 3SAFA 4I2QA 4IFYA 1N33K 4JAXA 2KQ2A 4B3OA 2QWOA 4DR1K 3L2VA 5TKWA 5E26A 1MA9B 3ULEA 3CD6N 4CZHA 3VMFB 4CVNE 3K9KA 2Q1NA 3HP6A 3I55N 3OW2M 1LW0A 4FWQA 2KZZA 4DF8A 3WXMB 2KFZA 3VQ8A 4I7FA 1J53A 5KRTA 3PX4A 3HI0A 4DTJA 1E3MA 2ASMA 5A2QO 3H1VX 3P5JA 2G8HA 1BDGA 3P83D 2IVNA 2KTQA 4A5AA 4CZIA 3J81O 4BRNA 4CJTA 3L2UA 1WSHA 3LP1A 4LFBK 2P9NB 2IIRA 4KTQA 3RRHA 3O9QA 3MDQA 3QINA 4ISEA 4LF5K 3R3LA 4RWTA 5KPRA 1CZ9A 1HNXK 3ZT1A 3SV4A 1XMQK 1V4SA 2Z1IA 4FSVA 4UY8O 4JKCA 2YV0X 4XIUA 1ILYA 5AQRA 4R5PA 1S22A 2ZGYA 3H46O 4FLVA 1IO2A 4XH4A 4E7KA 4EP4A 3UB5A 4RCHA 4O44A 5DMRA 4Z4CA 3AO3A 2P9PA 3WUHA 2XRIA 4H0TB 1N6QA 5F2RA 2CGLA 2NRHA 3G0ZA 4CHPA 1UA1A 1BA0A 1N36K 4CF1A 1HYZA 4L8RB 5MLCQ 1NK5A 4BG8A 4B9LA 1SL2A 3DRSA 4YOUA 3PV8A 1RT1A 4BQZA 2BDPA 5DM7L 5FRMA 3BDPA 1QTMA 2HBJA 3CFPA 1D4XA 2P1JA 4BRHA 1NGIA 3VEVA 2HVHA 2FSNA 3WNFA 1RDDA 1HNIA 4PQUA 2F7TA 3NGYA 3S3OA 3KWIA 2O8FA 2WC9A 3SAHA 2HW3A 3O4QA 1IBLK 5BREA 2XY6A 3QICA 3WXLA 4WFNL 3ULDA 1VSJA 4DV0K 2W6LA 4DF4A 4BE2A 1RDUA 2QWMA 4IO8A 5CYMA 3A0IX 4KHYA 5SZTA 3AVGA 3VQBA 3GG4A 4DV6K 2YCHA 4DTMA 3OYDA 4AHUA 2XY5A 2F8TA 4M3WA 5AQOA 3PUFA 4CJLA 5BR9A 5J2MA 3CC7N 3KD5E 2G8UA 5FPDA 3AVIA 4BRPA 3TR8A 3HZ6A 4WQ5C 3K0SA 3NH2A 1N34K 1X1PA 2PY5A 4CF0A 4KHPK 3P39A 3SZ2A 2PYLA 3T69A 1JCEA 3MWPA 3LPTA 4JI4K 3DLEA 4BREA 4CECA 3KLHA 4FJ8A 4CERA 1EQYA 1MU2A 4EP5A 3TAPA 1T6CA 3RMBA 3T7ZA 1JCGA 3AO5A 4FWSA 4JHDA 3TI0A 3T1YK 4HWIA 3LPUA 3VQ9A 1C0MA 3LWLA 1VHXA 4CJEA 1NWKA 3PSFA 4JS4A 3BGRA 1NGDA 1U2VB 4CEAA 1C0TA 2VYPA 1BQNA 3GDQA 3O1BA 2BUPA 3VERA 4IOXA 1G15A 3D0PA 3RVCA 3NH1A 1S3XA 2F96A 3O9SA 4FXDA 2GUPA 2Q0RA 3CPEA 1X9WA 1CZBA 1YITN 4H03B 5C2FA 4CK1A 2HHTA 2P9PB 4OPAA 1J9AA 4FM2A 4FPBA 3THWB 2D0BA 1IBMK 4BC3A 4DCHA 1QSLA 4CHQA 3ENOA 3QFUA 3HPGA 2A40A 4H8KA 2ZQBA 4CHOA 4K25A 1UWBA 3LALA 4M41A 3RSEB 1VQPN 4O8UA 2OZMA 4M3ZA 2WBNA 4DUYK 2E1YA 3QBWA 4WE1A 3TSPA 3HBTA 4YOYA 4WYBA 5FRNA 2HF3A 4CHYA 1ZXOA 2QEXN 3FZKA 4IDKA 2KZMA 1QE1A 1NK4A 4FJXA 2AJQA 3OBWA 1YT3A 4KHQA 3HOSA 2DFEA 4DTUA 4FOEA 4ID1A 4OLAA 3NAEA 3AAQA 1IKYA 4FYDA 4J8FA 1VK0A 4C8NA 2E4LA 1MWMA 5KGWA 3DLKA 3QO9A 2QK9A 3V9ZA 4FK0A 3MXJA 5LL6Z 3V9WA 3QEPA 3U8XA 1SKSA 4BR4A 4BRCA 4E19A 4OX9K 5AQPA 4XH1A 1S5JA 1WAFA 1U47A 4GMJB 4DR3K 4DLGA 1C1BA 1C1CA 1RT3A 3IRXA 4DR2K 2KFNA 1IJJA 2P9KA 3AV9A 2F4VK 3IG1A 5JICA 3LANA 1BUPA 5AQQA 1Q82O 1TAUA 4BRFA 3U4LA 1NKEA 5HOOA 3MCPA 3LAMA 1XWLA 2JLEA 4IBNA 3RTVA 2Q97A 1NJXA 3IKMA 3VPZA 3CCLN 2O8BA 1CZAN 3DM2A 4EIAA 1KXPA 1U49A 4FL9A 1J54A 3AVKA 2YNHA 2E2QA 3THXB 4JK9A 3K9JA 3GL1A 3TSUA 3U3YA 4EHTA 1S6PA 4GKJK 4BR2A 3PIOL 4DR7K 4KBOA 3O5BA 3VGLA 3VGMA 2QW9A 3ZCMA 3TANA 4CEZA 1HQUA 2Z1GA 4EZ9A 4CGJA 3SYZA 3THYA 4U67L 3LZIA 4CIFA 1QQOA 1GLJO 1SQKA 5EVZA 3AGRA 3QB0A 2YHYA 4DFJA 2QI2A 4K43A 1VSMA 3C6TA 3ZYYX 1NJYA 3CXCM 1F21A 4KFBA 4FLZA 2A1RA 2XY8A 4LFCK 1BI4A 3AO4A 3VN5A 4NLCA 2VG7A 2CGJA 4BR5A 4B8CA 4F2RA 1QQCA 4M3XA 2P51A 5JS1A 5CE3A 3LDSA 4C1NI 3CQYA 3M5RA 3V9UA 4B1WB 3NGZA 5DM6L 4IJNA 1GOBA 4FWMA 2FF6A 3O1WA 3SAGA 4KTZA 3J7YP 2ZD1A 3U9DA 3NVMA 1XI1A 3GBTA 4BR0A 3DOKA 2ASPA 3EZWA 2YNIA 1I3AA 3A2FA 3O9RA 3K5LA 4PUOA 1FKPA 1NGBA 1QSYA 4PKGA 4Q5VA 1JXEA 4JS5A 3VQ7A 1X9JA 4X62K 1FK9A 5CZ2A 3R8EA 4LC9B 1L3UA 5CZ1A 3M8PA 5M1OA 4Z94A 3IUCA 4YY3K 4KO0A 3LAKA 3G71N 3PO5A 2G8FA 4FWNA 4YOWA 2E2PA 4IFEA 4HUEA 4RW4A 3OYFA 3O6WA 1VAZA 3L6QA 4TSXA 4A59A 3VA0A 4NCAA 4CEQA 1C1AA 4B3TK 1S9EA 3E9PA 3RMAA 4K41A 4NLBA 3CCVN 2UXCK 2BGGA 2O8CB 2HSTA 1OVQA 3M1FA 1KD1O 4DTNA 3RR7A 4CZJA 2YX6A 5BR8K 2GELA 5AZJA 2QA4N 4OPKA 5AQVA 1UA0A 1JLGA 5JLHA 2Y1JA 2NRZA 4I9LA 2D0AA 1JLFA 2P9KB 4X65K 1WLJA 3FFIA 5E84A 4RW8A 4DV7K 2FBXA 3DRPA 3DLHA 2RE2A 2KLAA 2G8VA 2DFFA 4B9UA 3J7AP 3D2FB 4DQSA 3F2KA 2UUBK 4MO4A 4A2BA 2E2OA 1S1UA 4DQIA 2B4JA 1EWRA 4CZFA 2NRTA 1VQ5N 2HBLA 4DHYA 1GLFO 3QIPA 4DFMA 4GKKK 4CIEA 1BWFO 3SCXA 3HSCA 4KH4A 1T44A 1BQMA 4BC5A 3OBYA 1NK6A 1K9MO 4AH9A 2EX3A 3K57A 4ILJA 3G4SN 5ADXA 4B9VA 1T6DA 3THYB 1D9FA 1RFQA 4FK4A 5SWMA 1TUUA 3T1HK 3ID8A 4FLUA 3F9KA 5HRNA 4CGFA 3EKSA 4DQRA 2KKZA 4F9OA 5KRSA 4CJ4A 2WFBA 3K5MA 1YTAA 3FLCO 3SBTA 2QXLA 3SPZA 3WNHA 2OTJN 4FCYA 3BZKA 2VWKA 1P8ZA 1HX1A 2O8DB 2ZM6K 4WF9L 1DTQA 4H5RA 4DKWA 3UE5A 1TKTA 4FLXA 4CESA 1E4FT 4IG0A 2ASOA 3CF5L 1S1XA 5KQDA 3C7NA 4JKBA 4JKGB 4KRFA 2BANA 4JI6K 1QHAA 4A2AA 3AO2A 3MEDA 4CJFA 2JWLA 2PFUA 2F9TA 1VQ8N 4CBWA 4JK7A 1M1KO 4FVUA 4A62A 5ADXH 2WUSA 2F8SA 1RTJA 4BRLA 4BRGA 3AVJA 1YXQA 4M3RA 4JI5K 3R1XA 1VSLA 4LSLA 3SUPA 4GVMA 5KI6A 2IVOA 4LSNA 4WQ5A 2NRXA 5FDLA 3E9OA 3VOVA 5FPEA 1TL3A 3NDKA 4F4KA 2PAVA 4QAGA 4MLEA 3O4WA 3OTOK 1Q18A 1SL0A 3WXKA 4LY7A 4B9MA 1S1TA 3WNGA 1ASVA 1LWEA 4O55A 4JI1K 5FLXO 3V9SA 2JGUA 1DLOA 1C6VA 4FJHA 2O4IA 1T03A 2Z1HA 4JEPA 3HT3A 1RNHA 3O3HA 2D0CA 5J2NA 4DSEA 1HNWK 1TL1A 3VQ4A 3FZMA 1YF5L 1ZYQA 3O3FA 1RILA 3QDKA 1HJRA 1VSFA 3OY9A 5LMNK 4DTPA 4FJ7A 2DPNA 3DLRA 4OPJA 5AQHA 1FJGK 3NF8A 3QEIA 4ELTA 3DYAA 2RN2A 3I0RA 1GLCG 4K42A 1QQNA 2A6AA 3OA9A 3OYIA 1VQ9N 2CH5A 4C8KA 2E6LA 2G8IA 4KHSA 3LP2A 1X9SA 4AHRA 1KAZA 4ISFA 4JKAA 4LD0A 3OYKA 3NF9A 3QLHA 4ILHA 4H5NA 3SBGA 4DTXA 3T3FA 3OVNA 3QNNA 5M1PA 3R9PA 4LH5A 4C8LA 1QZ5A 5KTQA 2O8EA 1XC9A 3LDPA 3E66A 4CI6A 1HUXA 3CMAN 1DTTA 3CETA 3W3DA 5D3GA 1QHTA 2GUIA 5JVHL 4CHNA 1GLBG 1HPMA 1GLDG 1ZBSA 3C95A 1ZBHA 4BY9C 4PKIA 3SUOA 2P9LA 3NHGA 5EU7A 3TSQA 2P9UB 3ZLJA 3HP9A 2HMPA 4M7XA 4C8OA 4E7JA 4JNEA 4J2AA 3HM9A 3VTIA 1NGFA 2AA4A 2Z1JA 1A5VA 3OYNA 2A1SA 4CJ7A 1U48A 2QWQA 4DSFA 5AQUA 2GV9A 1HYSA 3SQ1A 4CFCA 1WSEA 1C0UA 4BRDA 1Q8IA 4JD2B 4H0PA 4BVOA 2HVIA 3KLFA 3E9LA 3ASMA 3QFPA 4NXNK 2YKNA 1RT4A 3WEEA 2HNDA 3KHYA 3VF4A 4AHCA 4CFDA 3VQEA 1HRHA 4DG1A 5BPMA 1HR0K 3O80A 3H6EA 5AQXA 3S9HA 4CHZA 2QWNA 4I2PA 4GV9A 3HK2A 3CJ1A 3ULEB 3SNNA 4JRQA 1VQMN 2OPQA 4JI2K 4BRKA 5EXWA 2YI1A 1OKJA 3BZCA 4DMNA 4IOAL 1J5EK 5KPZA 3VEWA 4CJSA 4B9TA 3D2EA 4KI6A 4HTLA 4FW2A 4QS7A 4BRQA 2A5XA 2B5JA 2NRWA 4FJ9A 4L3QA 1OH8A 4EHUA 3LM9A 2QWPA 4HHTA 5KQ8A 3ZSRA 1T05A 4Z4HA 3HXMA 3NGIA 4B9SA 4H0OA 4ELVA 2D0OA 4B8AB 1LWCA 3HYFA 4AQYK 2DTUA 1NBWA 4HUGA 2V7ZA 4Y1DA 3MMVA 1LOTB 2VQEK 2ZJQL 2I7NA 3L4QA 2HHVA 1L3VA 4FLYA 4CD3A 3HTVA 3TAEA 2XY7A 3T1AA 4CJ3A 2CGKA 1MDUB 3ZEUA 4DS5A 1NGEA 2WONA 3CJCA 4CJPA 4X64K 5B8HA 3QIOA 1XHZA 3DXMA 2YHXA 3C0BA 3MN5A 1ZBFA 3I8BA 5EY4A 4HVJA 1CXQA 2YJFA 3H3NO 5JMVA 3CCEN 3O08A 1VQ6N 2VGMA 1JL2A 4Q0BA 2ITMA 4FJJA 3B6OA 3HL8A 1RT6A 4YNQA 4BR7A 3NF7A 4B1XB 3VF6A 4YOXA 4PKHA 2P5OA 1JL1A 4BC2A 4H5WA 1WB9A 1GOCA 3IMXA 2HB5A 4DQPA 4E0DA 1S9GA 3S3MA 1D5AA 4O5BA 2E6MA 3SPYA 1ITGA 3CCUN 4GY2B 2O8FB 3VQPA 3THVA 1G99A 3L2RA 3KKSA 3ZSVA 3IAYA 1K6YA 4HCBA 5C2DA 1ESVA 1XHXA 4OO1J 1NJZA 2DY4A 3CFOA 4JI8K 3OYLA 4KI4A 3CI5A 3O9TA 1WBBA 3JS6A 3C94A 5GAHP 4K8XA 2NZTA 3JXUA 4KV8A 3ZT3A 4DLEA 4B3RK 2YHBA 3QBXA 2HNZA 2OZSA 3CERA 4EZ6A 3SQ0A 4FO0A 5GINA 1KRPA 4B1ZA 4BG9A 5KGXA 3D6RA 3FZLA 1UAXA 1X3NA 2WOMA 1NGAA 4OKEA 3TAQA 4DR6K 1K8KA 3VTHA 1TKDA 4MDAA 2V7YA 4W5QA 1BIZA 3A5NC 3KVGA 4DQ8A 1BISA 4O0IA 3OJUA 3MXIA 3ALYA 4U7BA 2Q0UA 3NCIA 3DAWA 4JKEA 3SMSA 3HOTA 4DV2K 1OH7A 2QWRA 1IKVA 2W42A 2Y1IA 3ITHA 3PO4A 1LAVA 4WQ4C 4B3MK 1LCUA 1RBSA 3D2EB 4GV3A 1BU6O 1Z26A 4XH5A 4CK2A 3SK3A 4CCHA 3B8AX 4GNIA 5J1EA 5HBMA 5AZIA 3GOIA 5EX5A 2A42A 4IJAA 5AR0A 4JHDB 4QCLA 3SJHA 3TABA 4K0KK 2IOCA 1VSHA 2X6SA 2QKKA 4ID5A 4Z4GA 4WFAL 4CJUA 4CZGA 4DU4A 2IGIA 4FWLA 3OS1A 2A3ZA 4E89A 3J80O 2F9WA 2VG5A 4RW6A 2WTUA 4AF1A 3P31A 4CEDA 3KD1E 4Z4EA 4PL8A 4MFBA 4IEIA 1N32K 1ASUA 1RCHA 3J8AA 1KFDA 4KHUA 1WNSA 3ZEUB 2ZE2A 4KTWA 3NFAA 4RTFD 4B9QA 4CGGA 3SV3A 3MN6A 3HVTA 4KAZA 2OCEA 4DFPA 1RTDA 1VRTA 1SKWA 1NNEA 3AARA 3QESA 3LWMA 1HNZK 3VETA 1TK8A 3WXJA 4F8RA 2ZJRL 4E7LA 5AQZA 3KLGA 1BIUA 3S41A 1M90O 3DXKA 4E3SA 4CK3A 3OYAA 4DV5K 2HHQA 3EO3A 4E1MA 3VQDA 3QEXA 3OYGA 1GOAA 1YAGA 2RHKA 4CZMA 3G6EN 3HRGA 1LW2A 4LF6K 2BH1A 1KQSM 3ZX3A 4DR4K 5HRRA 3AAPA 1NKBA 3VQCA 3HM8A 3CJ7A 1Z05A 3EEQA 1IH7A 3AO1A 3QNOA 5DK5A 4CJRA 4GW6A 3M8QA 4Y0WA 3ZSQA 5M1NA 3VQQA 3OYEA 4NCBA 3NE6A 4IKFA 3KJVA 3MEEA 5FROA 1BOTO 4BDZA 3ZETA 3KK3A 3M8SA 1KAYA 3KZBA 3ZSXA 3MK6A 4NXMK 5CHIA 4K8ZA 5HLFA 3D7EO 3U6FA 3FGUA 1W2BM 3N4QA 4QS9A 3ZX0A 4DFKA 2X6NA 1SL1A 3RMDA 4CF2A 2HNYA 4FOIA 3SUQA 5CYQA 4H5VA 3I56N 4H4MA 4HCCA 2E5LK 3C6AA 4OPHA 1NM1A 3BY5A 1BL3A 3H45C 1K8KB 3FE1A 4IWVA 1WSGA 3C6HA 3NVKA 4O4GA 2HOEA 4CEBA 2OYQA 4AHVA 3CYMA 1YJWN 4LF8K 1C0GA 3D45A 1W97L 4JYAK 4OJRA 3PX6A 1YJNN 4FJIA 2RF2A 5LJVA 1O1WA 5M1KA 3KK7A 2O8BB 4NB4A 1ATNA 4OKJA 4CEEA 4LF7K 1NG9A 4NYNA 2H3GX 3A5OC 3E1YA 1NOYA 2G8WA 5AZIB 1U04A 4HUFA 1EO1A 3SMPA 2P5GA 2FLOA 2P9NA 1QVFM 2D4WA 1H1VA 3N4PA 1RT5A 1NK8A 4MLHA 3UIQA 4DQQA 3K5OA 2QM1A 4E1JA 3W0LA 5C12A 3CHWA 5HRPA 1EKEA 1NMNA 2EWSA 5CY4A 4CGDA 1KTQA 4EFHA 4BWMA 4KKOA 5C42A 4IO9L 5LY3A 4DV1K 4YOVA 4PWDA 2ITGA 4ICLA 2ZGZA 2D5RA
chains in the Genus database with same CATH topology
4BC4A 4BRMA 2Q0RA 3CPEA 3R9PA 1YITN 1N8RO 3L0QA 4H03B 5AQLA 3TU5A 1QZ5A 5C2FA 3MWTA 2FXUA 4M7YA 1HLUA 3KWGA 3LDPA 3E66A 4CI6A 1HUXA 3CMAN 1NJIO 3BP8A 2I7PA 1NGCA 4FWOA 2P9PB 2VCPA 3CETA 3MN7A 4OPAA 3VEZA 3W3DA 4FPBA 3F5TA 2FSJA 5JVHL 5AQNA 1GLBG 4BC3A 2GX9A 4DCHA 1HPMA 3TPQA 2UYTA 1GLDG 1ZBSA 3GE1A 4AM6A 3ENOA 4YORA 3QFUA 1IG8A 1QVGM 2A40A 4BY9C 2PBDA 4PKIA 3EE9A 5I9EB 3WQUA 5GAGP 5TKYA 3U9ZA 2P9LA 4K25A 3DXKB 4C1NK 3Q7BA 3TSQA 3VENA 5GADP 1NMDA 3RSEB 1SZ2A 2P9UB 4CZKA 1VQPN 1GLEG 4O8UA 2HMPA 4IDHA 2WBNA 4M7XA 2E1YA 3DJCA 3QBWA 3TSPA 1VQON 4JKGA 3IDHA 4JNEA 3HBTA 4OO1J 4YOYA 2BTFA 1GLAG 4WYBA 3UKUB 1Y64A 2V51B 2HF3A 1NGFA 2AA4A 3VTIA 4B1VA 1Q86O 1ZXOA 2P9SB 2QEXN 3FZKA 4NO7A 1TYQB 4ISGA 1C0FA 2Q2RA 4CJ7A 2QWQA 3OBWA 3OHRA 3HOSA 5AQUA 3VF2A 4JN4A 3G25A 3MN9A 3SLCA 4FPAA 3QMLA 5C0YA 1ATRA 3DLLL 4FOEA 4A61A 4CZEA 3BF1A 4BRDA 3AAQA 5AQFA 5BRFA 5AQIA 4JD2B 2W40A 1O13A 4H0PA 4BVOA 4CD1A 4IXCA 3E9LA 4YOTA 5JLFA 3QFPA 1VQLN 4J8FA 1VQKN 3CJ9A 4WFBL 1MWMA 3WEEA 4BVPA 3KHYA 4H0VB 3VF4A 1U6ZA 1VQNN 3U8XA 5BPMA 4BR4A 4BRCA 2OTLN 1VQ7N 1SS6A 2AP1A 2D1KA 2JWKA 3O80A 4XH1A 5AQPA 3H6EA 5AQXA 2QWNA 3IFRA 3VESA 5M1QA 4GV9A 2GWKA 3CJ1A 1XC3A 2HF4A 3ULEB 4PL7A 1ZC6A 1YVNA 3CIPA 1VQMN 4CBUA 5AZJB 4BRKA 5EXWA 2YI1A 1WOQA 1IJJA 2FF3B 1OKJA 4XEIA 4H5TA 1KAXA 4IOAL 3MX5A 2P9KA 5ELZA 5KPZA 4B1UB 5JICA 2VGNA 3VEWA 1BUPA 3AGKA 3TTDA 1NGJA 3D2EA 5AQQA 1Q82O 4HTLA 4QS7A 4KH5A 4BRFA 4BRQA 2A5XA 2NRWA 4L3QA 3U4LA 3ENBA 5HOOA 3MCPA 3VGKA 4EHUA 3LM9A 2QWPA 3ID6A 5KQ8A 2E88A 5GIPA 2Q97A 3H1QA 3IKMA 2ZF5O 3VPZA 5BN9A 3CCLN 1CZAN 4EIAA 4H0OA 1KXPA 3EE8A 2D0OA 4FL9A 5BN8A 3BUZB 5AQJA 3M6GA 1HKCA 1NBWA 2E2QA 2V7ZA 5F0XA 4JK9A 3K9JA 3MMVA 1LOTB 3GL1A 3TSUA 3CCRN 4I6MB 1NGGA 4FWKA 4GVEA 4EHTA 5AQMA 3LDQA 4BR2A 3PIOL 2ZJQL 1YJ9N 4KBOA 1MWKA 3DWLA 3O5BA 1V4TA 2I7NA 3MCAB 3L4QA 3C65A 3VGLA 3VGMA 1U2VA 2QW9A 4CD3A 3VEYA 4G9ZA 3HTVA 3PIPL 2CGKA 3AY9A 1MDUB 3BF3A 3WXIA 1QZ6A 3ZEUA 1J6ZA 1NGEA 5M1FA 2IVPA 4U67L 3CJCA 3LDNA 1QQOA 3LDOA 5B8HA 1GLJO 1SQKA 5EVZA 3AGRA 3QB0A 2FSKA 2YHYA 2QI2A 4CBXA 5BRHA 4K43A 1BG3A 1K73O 1WUAA 3CJAA 2NLXA 3DXMA 2YHXA 3C0BA 3MN5A 3ZYYX 3I8BA 3CC2N 5EY4A 3CXCM 3ATVA 2HBMA 2YJFA 1S72N 3H3NO 5JMVA 2GTDA 3CPWM 3CCEN 1Z6RA 3O08A 3UKRA 1VQ6N 4NLCA 3ZX2A 1NLVA 2YJEA 3H3OB 2CGJA 2VGMA 5H1SQ 4BR5A 1BA1A 3CCSN 2ITMA 3CMEN 3A8YA 5GIOA 3FZHA 3WT0A 2HBKA 5CE3A 2OANA 4C1NI 4BR7A 3ATUA 3CQYA 3M5RA 4B1WB 4B1XB 5AQTA 3VF6A 4BGBA 5DM6L 1RDWX 2NRVA 3O8MA 4IJNA 4FWMA 2FF6A 5BPLA 3O1WA 3SAGA 1OVYA 4A5BA 4YOXA 4PKHA 5C15A 4KH6A 3P38A 4BC2A 4H5WA 3U9DA 3NVMA 3C7NB 3IMXA 3RSEA 2P9UA 3GBTA 4BGAA 4BRAA 1HKGA 4BR0A 2ASPA 4H0YB 3PLAA 3EZWA 3CCJN 3O9RA 3LM2A 3CCUN 4GY2B 3FZFA 3LDLA 1NGBA 5CR4A 4PKGA 4EAHD 1RGIA 1G99A 1X3MA 1XUPO 5AQWA 1X9JA 3R8EA 1ESVA 3ENHA 4LC9B 5M1OA 3CJBA 4BQLA 5C2DA 4Z94A 3VEXA 1HJOA 4IOCL 3IUCA 1JJ2M 5FPNA 4R79A 3G71N 4B1YB 3CI5A 3O9TA 4FWNA 5BRDA 3JS6A 5M1PA 4FWPA 2E2PA 1P90A 4YOWA 4IFEA 4JKFA 5GAHP 3ZETB 2NZTA 3O6WA 1VAZA 4A57A 1DKGD 3JXUA 1DT9A 3L6QA 5F1XA 4JD2A 4A59A 3QBXA 4DB3A 3CERA 5KPTA 5C10A 4FO0A 5GINA 4B1ZA 4BRIA 4BG9A 3E9PA 4YDUA 2E8AA 3D6RA 2NNWA 4K41A 4NLBA 3SAFA 3FZLA 3CCVN 1X3NA 4JAXA 1NGAA 4WQ4A 1K8KA 3VTHA 2QWOA 4BROA 4MDAA 2HSTA 2V7YA 4O5FA 5TKWA 5E26A 1MA9B 3A5NC 3KVGA 3ULEA 3M1FA 4DQ8A 4CZHA 1KD1O 3VMFB 3CD6N 1QQMA 3K9KA 4CZJA 2YX6A 2P9IA 5EOYA 2Q1NA 4WCEL 2GELA 5AZJA 3I55N 3OW2M 4U7BA 2QA4N 4FWQA 2Q0UA 3CQXA 3MX2A 5AQVA 3DAWA 2E2NA 4JKEA 3SMSA 3WXMB 3HOTA 4YDUC 4JKDA 2QWRA 5JLHA 2VWBA 2NRZA 2P9KB 4WQ4C 2CH6A 1LCUA 3HI0A 5E84A 3D2EB 2ASMA 4GV3A 3H1VX 1BU6O 2GEMA 4XH5A 2RE2A 3A5LC 3SK3A 1BDGA 2KLAA 3B8AX 4GNIA 2IVNA 3R6MA 4A5AA 5AZIA 3D2FB 4CZIA 3GOIA 5EX5A 2A42A 1VQ4N 4IJAA 5AR0A 4JHDB 4BRNA 3SJHA 3F2KA 3FR0A 4MO4A 4A2BA 4PHTX 2E2OA 1T3VA 4WFAL 4CZGA 2P9NB 2IIRA 4CZFA 2NRTA 3O9QA 3MDQA 4FWLA 1VQ5N 2HBLA 4DHYA 1GLFO 4ISEA 3R3LA 4RWTA 5KPRA 2A3ZA 2F9WA 4CZLA 5AQYA 5AQSA 1BWFO 3HSCA 4KH4A 1T44A 1V4SA 4FSVA 4AF1A 4UY8O 3P31A 4JKCA 4BC5A 4PL8A 3OBYA 4IEIA 1ILYA 1K9MO 5AQRA 2E20A 3J8AA 2D0PA 4ILJA 3A5MC 3G4SN 1DEJA 2YHWA 1S22A 5ADXA 2ZGYA 1T6DA 2W41A 3H46O 4XH4A 3ZEUB 4RTFD 4B9QA 4FWRA 4O8KA 1RFQA 3MN6A 3UB5A 3VEOA 2V52B 4IZ9A 4RCHA 5HL7L 1TUUA 3ID8A 2P9PA 4IEEA 3WUHA 3AARA 3EKSA 3VETA 4H0TB 1R59O 3WXJA 2KKZA 5F2RA 2ZJRL 2CGLA 2NRHA 4F9OA 5AQZA 1BA0A 2QTDA 5JVGL 2WFBA 5AQKA 3S41A 3FLCO 3SBTA 3UKRB 2QXLA 5MLCQ 4BG8A 2OTJN 1GLLO 4BR9A 1M90O 3DXKA 1P8ZA 1HX1A 2A41A 4AM7A 4YOUA 3EO3A 3WQTA 4WF9L 3FFKB 2P9LB 4H5RA 4DKWA 1HKBA 3UE5A 4BQZA 5DM7L 1E4FT 1YAGA 2ASOA 2HBJA 1D4XA 3CF5L 2RHKA 4CZMA 4BRHA 1NGIA 3Q7CA 5KQDA 3EL2A 3G6EN 3UKUA 3HRGA 4JKHA 3C7NA 3VEVA 1XQSC 4JKBA 2P9SA 4JKGB 1YUWA 2FSNA 3TTFA 2BH1A 4MO5A 1TYQA 4M63C 2F7TA 1KQSM 1QHAA 3ZX3A 4A2AA 3KWIA 3AAPA 5GAEP 2WC9A 2JWLA 2PFUA 3SAHA 3EN9A 2F9TA 1VQ8N 2NRRA 3HM8A 4CBWA 2J4RA 4JK7A 5BREA 1M1KO 4FVUA 3CJ7A 1Z05A 3QICA 3WXLA 1Q81O 4A62A 4WFNL 5ADXH 2WUSA 4BRLA 4BRGA 1JCFA 4C23A 1TUYA 4Y0WA 5M1NA 1YXQA 2E1ZA 3R1XA 1RDUA 2QWMA 4IO8A 3EKUA 4JK8A 1BOTO 3A0IX 2IVOA 4WQ5A 2NRXA 3ZETA 3E9OA 3VOVA 1KAYA 5FPEA 3GG4A 3KZBA 3WEEB 3I33A 2YCHA 3MK6A 5CHIA 3D7EO 3FGUA 1W2BM 2PAVA 3N4QA 2ZJPL 4QS9A 5AQOA 3ZX0A 5BR9A 4MLEA 3CC7N 3O4WA 1Q18A 3WXKA 5FPDA 4FOIA 4BRPA 4H5VA 2KHOA 3I56N 3M3ZA 5LJWA 3HZ6A 3C6AA 4WQ5C 1NGHA 4OPHA 1NM1A 3TTCA 3H45C 1YI2N 1K8KB 3FE1A 4IWVA 5AFUA 3NMUA 3C6HA 3NVKA 3CCMN 2Q36A 2ZWHA 2P9IB 3P39A 2HOEA 4ILGB 3CCQN 1YJWN 3T69A 3F9MA 1C0GA 1JCEA 4JEPA 1K8AO 1W97L 3MWPA 3O9UA 1KC8O 1BO5O 4BREA 1ATSA 1YJNN 3FZMA 1EQYA 1YF5L 5LJVA 3CC4N 3QDKA 5M1KA 3KK7A 1T6CA 5FPMA 4NB4A 4QS8A 1JCGA 3T7ZA 3D2FA 2DPNA 3J7ZO 1ATNA 4FWSA 5AQHA 4JHDA 1SAZA 3P4IA 2H3GX 3L4IA 3A5OC 3E1YA 4HWIA 4I6MA 4GV6A 5AZIB 5AQGA 1EO1A 1Q7YO 1DGKN 3SMPA 1GLCG 4K42A 1QQNA 2A6AA 2FLOA 2P9NA 3OA9A 1VQ9N 2D4WA 1QVFM 1H1VA 1NWKA 2CH5A 3N4PA 1YHQN 4MDBA 4MLHA 1NGDA 4H0XB 1U2VB 3LL3A 2QM1A 4E1JA 3W0LA 1KAZA 2QWLA 2VYPA 3CHWA 4ISFA 3BEXA 4JKAA 5C12A 3GDQA 5BPNA 3O1BA 2EWSA 2BUPA 3VERA 4EFHA 4IOXA 1YIJN 4IO9L 2Q31A 5LY3A 3RVCA 4YOVA 1S3XA 2GWJA 4ILHA 4H5NA 5AFUH 3SBGA 1E4GT 3DXMB 2ZGZA 3O9SA 2GUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV N;  3CCL N;  1YIT N;  1KQS M;  1N8R O;  5GAE P;  1NJI O;  3CMA N;  1VQ8 N;  1M1K O;  3CD6 N;  1Q81 O;  1KD1 O;  3CCR N;  4WFN L;  4WCE L;  3PIO L;  2ZJQ L;  1YJ9 N;  3I55 N;  3OW2 M;  5JVH L;  2QA4 N;  3PIP L;  1QVG M;  5GAG P;  4U67 L;  5GAD P;  1VQP N;  1W2B M;  1K73 O;  2ZJP L;  1VQO N;  3CC7 N;  1VQ4 N;  1Q86 O;  3CC2 N;  3CXC M;  3I56 N;  2QEX N;  1S72 N;  4WFA L;  3CPW M;  3CCE N;  1VQ6 N;  1VQ5 N;  1YI2 N;  5H1S Q;  3CCS N;  3CME N;  3DLL L;  3CCM N;  3CCQ N;  4UY8 O;  1YJW N;  1K8A O;  1ILY A;  5DM6 L;  1K9M O;  1VQL N;  1VQK N;  1KC8 O;  1OVY A;  3G4S N;  4WFB L;  1YJN N;  1VQN N;  3CC4 N;  3CCJ N;  5HL7 L;  2OTL N;  3J7Z O;  3CCU N;  1VQ7 N;  1Q7Y O;  1VQ9 N;  1QVF M;  2ZJR L;  1VQM N;  1YHQ N;  4IOC L;  1JJ2 M;  5JVG L;  3G71 N;  5MLC Q;  2OTJ N;  4IOA L;  1M90 O;  5GAH P;  4WF9 L;  1Q82 O;  5DM7 L;  1YIJ N;  4IO9 L;  3CF5 L;  3G6E N; 
#chains in the Genus database with same CATH topology
 3AVF A;  3ZT4 A;  3L0Q A;  4H4O A;  5AQL A;  3V81 A;  2B6A A;  3MWT A;  4M7Y A;  1HLU A;  3KWG A;  1BI4 B;  3RR8 A;  2YNF A;  2I7P A;  3MN7 A;  4M3T A;  4LF9 K;  3F5T A;  2FSJ A;  3TPQ A;  3GE1 A;  4YOR A;  5HRO A;  1IG8 A;  1QVG M;  4F2S A;  2PBD A;  5I9E B;  1EX4 A;  3WQU A;  3U9Z A;  3DXK B;  3JAM O;  1ZBI A;  1RTH A;  4N5S A;  1Z25 A;  3TAR A;  4CEF A;  1NMD A;  5HRS A;  5GAD P;  4ZTF A;  4FZY A;  4OGC A;  4CF8 A;  4YFU A;  1ASW A;  3DJC A;  3DMJ A;  1VQO N;  2V51 B;  4B1V A;  1Q86 O;  3NF6 A;  1XMO K;  4ISG A;  4DTO A;  1JLQ A;  4N56 A;  1J5O A;  3G25 A;  1EXQ A;  3SLC A;  5LMU K;  1L3T A;  4FPA A;  1TAQ A;  4M3U A;  3DLL L;  1Q9Y A;  4A61 A;  3ISN C;  3VQ6 A;  5AQF A;  3ZT0 A;  3RWU A;  4YOT A;  5JLF A;  1VQK N;  5IT9 O;  1UOC A;  4LFA K;  3V6D A;  4KPY A;  1VQN N;  1VSK A;  4BDY A;  2OTL N;  1VQ7 N;  2JWK A;  3S3N A;  3IFR A;  4M45 A;  3VES A;  2X74 A;  4OKK A;  4KHW A;  2GWK A;  4PL7 A;  3OYM A;  4N76 A;  3CIP A;  4C8M A;  1JLA A;  4FJG A;  5AZJ B;  1VSI A;  2FF3 B;  4XEI A;  3OYH A;  4H5T A;  1KAX A;  5ELZ A;  4PY5 A;  2Q3S A;  2VGN A;  4CIG A;  4M3Y A;  3TTD A;  3AVC A;  1RT2 A;  1JKH A;  2VG6 A;  3AVN A;  3ID6 A;  1HQE A;  4OVL A;  5GIP A;  2W6K A;  1X9M A;  3H1Q A;  2ZF5 O;  5BN9 A;  2YHA A;  4JI3 K;  3EE8 A;  3H08 A;  3K2P A;  5BN8 A;  4W5O A;  4DU3 A;  3V4I A;  3AA2 A;  1WSJ A;  3ZSO A;  1KFS A;  3VQ5 A;  3CCR N;  3QEW A;  1RDB A;  4FWK A;  5AQM A;  1S1W A;  1MWK A;  3DWL A;  3C65 A;  1TKX A;  1U2V A;  4FLW A;  4FJK A;  3PIP L;  5AJ3 K;  1S1V A;  4KRE A;  1HMV A;  3WXI A;  1T7P A;  1QZ6 A;  1B9F A;  1J6Z A;  1VRU A;  3LDN A;  4OGE A;  3LDO A;  5BRH A;  2FSK A;  1BHL A;  3E01 A;  4FJL A;  1BG3 A;  3CJA A;  4CJQ A;  4CEO A;  2UXD K;  2VQF K;  3QEV A;  5J2Q A;  4FJN A;  3CC2 N;  1IG9 A;  2FBY A;  2HBM A;  1S72 N;  2GTD A;  1Z6R A;  3UKR A;  3ZX2 A;  1NLV A;  2OPS A;  2YJE A;  3H3O B;  4YHH K;  5H1S Q;  3EZ5 A;  4CJW A;  3THW A;  3A8Y A;  1VSE A;  5GIO A;  2HBK A;  2OAN A;  4PA1 A;  3IS9 A;  1D8Y A;  4BGB A;  1RDW X;  2NRV A;  3O8M A;  5BPL A;  3LP3 A;  1OVY A;  5C15 A;  4KH6 A;  3P38 A;  4DUZ K;  4DS4 A;  1WAJ A;  3C7N B;  3RSE A;  1TVR A;  4FLT A;  3TAG A;  1TV6 A;  4BGA A;  4BRA A;  2PZS A;  3ZT2 A;  3PLA A;  3CCJ N;  2IC3 A;  5CR4 A;  4EAH D;  1QS4 A;  3CFR A;  1RGI A;  3I0S A;  1X3M A;  1XUP O;  5AQW A;  3CQ8 A;  5E41 A;  4IOC L;  3VEX A;  1HJO A;  4B1Y B;  3AVA A;  1P90 A;  4E7H A;  3SI6 A;  1RBT A;  4JKF A;  2FBT A;  4DWI A;  4ZHR A;  4A57 A;  4AHS A;  1R0A A;  4F3T A;  4FZZ A;  3DOL A;  4ZTJ A;  4DB3 A;  4X66 K;  5KPT A;  5C10 A;  3I8D A;  1JLE A;  4KB1 A;  1IV0 A;  4J2B A;  4IFV A;  1LWF A;  4BRI A;  3HJF A;  3KTQ A;  2NNW A;  1NOZ A;  4DTS A;  3KLI A;  3AVH A;  1B9D A;  4WQ4 A;  1A5X A;  4JI7 K;  2I5J A;  2YNG A;  1D9D A;  1WN7 A;  4BRO A;  4O5F A;  1QQM A;  1U4B A;  4J2E A;  5EOY A;  2P9I A;  4WCE L;  4JRP A;  1ZBL A;  3CQX A;  3MX2 A;  2E2N A;  4FW1 A;  4YDU C;  4JKD A;  4JLH A;  2VWB A;  2CH6 A;  5JS2 A;  4QOZ B;  3AA4 A;  1SKR A;  2YKM A;  2GEM A;  3A5L C;  3R6M A;  1VQ4 N;  1RBV A;  3DRR A;  3TWH A;  3FR0 A;  4PHT X;  1T3V A;  1FKO A;  3THX A;  1A5W A;  5C25 A;  2IS3 A;  3G10 A;  3TAF A;  4CZL A;  3P1G A;  5AQY A;  5AQS A;  3RMC A;  1KSP A;  4E1N A;  2G8K A;  3AVB A;  3ZSY A;  2E20 A;  2D0P A;  2OPR A;  3A5M C;  1DEJ A;  2YHW A;  1RDA A;  2W41 A;  4BE1 A;  4FWR A;  1TKZ A;  4O8K A;  1NKC A;  2UXB K;  3VEO A;  2V52 B;  4IZ9 A;  5HL7 L;  4NCG A;  3PSI A;  1YTU A;  2O8E B;  2KW4 A;  4IEE A;  4DV4 K;  4KB0 A;  1R59 O;  2EHG A;  1RBU A;  4B08 A;  3EY1 A;  2QTD A;  1BGX T;  5JVG L;  5AQK A;  3UKR B;  1FW6 A;  1Q9X A;  1GLL O;  4BR9 A;  2O4G A;  5IWA K;  2A41 A;  4AM7 A;  3WQT A;  3FFK B;  1B92 A;  2P9L B;  4B9N A;  1HKB A;  1N5Y A;  3OYC A;  3OYB A;  4DU1 A;  3SUN A;  2ATQ A;  4LF4 K;  3Q7C A;  3EL2 A;  4N47 A;  3UKU A;  4JKH A;  3PY8 A;  1XQS C;  2P9S A;  1YUW A;  4CW7 B;  1BCO A;  2FBV A;  3TTF A;  4MO5 A;  1TYQ A;  4M63 C;  1EWQ A;  1FXX A;  5GAE P;  2FC0 A;  1I39 A;  4BDP A;  3RRG A;  3EN9 A;  2NRR A;  2J4R A;  1LAW A;  4BWJ A;  1Q81 O;  4F3O A;  1WSI A;  4V19 S;  1JCF A;  4C23 A;  1TUY A;  3AA5 X;  1JLB A;  2E1Z A;  4CJ5 A;  3EKU A;  4JK8 A;  3OYJ A;  3WEE B;  1LV5 A;  3I33 A;  1KLN A;  2UUC K;  2IDO A;  2ZJP L;  1REV A;  3LP0 A;  4JV5 K;  1CLQ A;  3V9X A;  2HHX A;  2HHW A;  2DFH A;  4W5N A;  1IKX A;  4CFA A;  3JSM A;  2KHO A;  4E7I A;  3L2W A;  3M3Z A;  5LJW A;  3K59 A;  1NGH A;  2O8C A;  3DLG A;  2UUA K;  1IKW A;  3TTC A;  1YI2 N;  2R7Y A;  2HMI A;  3OS2 A;  5AFU A;  3NMU A;  3HPH A;  2HHH K;  3CCM N;  2Q36 A;  2ZWH A;  2P9I B;  4CFB A;  4ILG B;  5I42 A;  4JI0 K;  3CCQ N;  3SQ4 A;  1RBR A;  1W9H A;  3F9M A;  1KCF A;  1K8A O;  4DSK A;  3U3G A;  1NK7 A;  3O9U A;  1KC8 O;  1BO5 O;  3HPO A;  1ATS A;  3QET A;  3AVL A;  3CC4 N;  4I9Q A;  5FPM A;  4QS8 A;  3D2F A;  4G1Q A;  3J7Z O;  1SAZ A;  3P4I A;  4GV6 A;  3L4I A;  4I6M A;  3V1R A;  5AQG A;  1Q7Y O;  1DGK N;  3MAQ A;  1NJW A;  5HP1 A;  1YHQ N;  4MDB A;  4H0X B;  3LL3 A;  2QWL A;  3BEX A;  4AIL C;  5BPN A;  1RDC A;  3B6P A;  2GBZ A;  4DSL A;  1YVU A;  1YIJ N;  1HYV A;  1TGO A;  4LH4 A;  4BAC A;  4UQG A;  2Q31 A;  1JLC A;  2GWJ A;  3OJS A;  3HO1 A;  4RG8 A;  5AFU H;  1E4G T;  4W5T A;  3DXM B;  4N41 A;  1KVB A;  4FK2 A;  4BC4 A;  4BRM A;  4CJV A;  1I94 K;  4DR5 K;  1NU0 A;  1RTI A;  1N8R O;  3TU5 A;  4HTU A;  4DSJ A;  2FXU A;  1XNQ K;  1NJI O;  4B3S K;  3BP8 A;  1RT7 A;  1NGC A;  4FWO A;  2VCP A;  3VEZ A;  1EP4 A;  1KVA A;  5AQN A;  2GX9 A;  2UYT A;  4CJK A;  4AM6 A;  2QKB A;  3ZSW A;  2O8D A;  3EE9 A;  3C6U A;  5GAG P;  5TKY A;  4C1N K;  2OPP A;  3AVM A;  4AHT A;  3Q7B A;  3VEN A;  1SZ2 A;  4CZK A;  1OH5 A;  1GLE G;  4IDH A;  4JKG A;  3IDH A;  2OA8 A;  2BTF A;  1GLA G;  4DV3 K;  3UKU B;  1Y64 A;  1HNV A;  1JXB A;  2P9S B;  1U45 A;  4ELU A;  4Y1C A;  4DTR A;  5I3U A;  4NO7 A;  1TYQ B;  1C0F A;  2Q2R A;  1NK0 A;  3L3U A;  1QSS A;  2HHU A;  3OHR A;  4J2D A;  3VF2 A;  4JN4 A;  3MN9 A;  5C0Y A;  3QML A;  5C24 A;  1ATR A;  4CGI A;  1XNR K;  4CZE A;  1VSD A;  3BF1 A;  2IAJ A;  3CM5 A;  5BRF A;  3QER A;  5AQI A;  2W40 A;  1O13 A;  1L5U A;  4CD1 A;  1KVC A;  4IXC A;  4RW7 A;  1VQL N;  4OLB A;  3CJ9 A;  4O0J A;  4WFB L;  4BVP A;  4H0V B;  1U6Z A;  2VWJ A;  3VA3 A;  1L3S A;  3MXM A;  2RKI A;  1SS6 A;  2AP1 A;  2D1K A;  1SUQ A;  5M1Q A;  1XC3 A;  2HF4 A;  3JYT A;  3M8R A;  1ZC6 A;  2UU9 K;  4FJ5 A;  1YVN A;  4CGH A;  2XHB A;  4CBU A;  4KHN A;  4NYF A;  1BCM A;  3KIO A;  1WOQ A;  4FJM A;  1S6Q A;  1IBK K;  3MX5 A;  2HHS A;  4B1U B;  3TAM A;  1NK9 A;  4FM0 A;  3PX0 A;  3K5N A;  3AGK A;  1NGJ A;  4KH5 A;  3ZSZ A;  3ENB A;  1W0H A;  1EET A;  2QXF A;  3VGK A;  3DLB A;  1TK0 A;  2E88 A;  1Y97 A;  3AA3 A;  3O4N A;  3L8B A;  3BUZ B;  5AQJ A;  2RPI A;  3KK2 A;  3M6G A;  1HKC A;  5F0X A;  1OH6 A;  4I6M B;  1NGG A;  4GVE A;  3LDQ A;  3SQ2 A;  1YJ9 N;  2XO7 A;  1V4T A;  3MCA B;  4Z4F A;  2BE2 A;  3V1Q A;  5T7B A;  3VEY A;  5K14 A;  4G9Z A;  3SJJ A;  3AY9 A;  3BF3 A;  3K58 A;  4FVM A;  5M1F A;  1ZBU A;  3OS0 A;  1WSF A;  2IVP A;  3KLE A;  1W7A A;  4CBX A;  1K73 O;  1WUA A;  2NLX A;  1SV5 A;  3ATV A;  4BE0 A;  3KK1 A;  3EYZ A;  4W5R A;  3CPW M;  4Z4I A;  3F73 A;  3O3G A;  3CG7 A;  4FM1 A;  3MEC A;  3CCS N;  1BA1 A;  1KLM A;  4Z0U A;  3CME N;  4CF9 A;  3FZH A;  3WT0 A;  3ATU A;  4MQ3 A;  4CE9 A;  5AQT A;  3T19 A;  3CM6 A;  4A5B A;  4M42 A;  3KKR A;  2P9U A;  4IG3 A;  1HKG A;  4RW9 A;  2ETJ A;  3L2Q A;  2X78 A;  4H0Y B;  4FZX C;  1T8E A;  3L3V A;  3LM2 A;  3FZF A;  3LDL A;  1HPZ A;  3HVR A;  4DSI A;  2PYJ A;  3ENH A;  4BQL A;  3CJB A;  1JJ2 M;  3NH0 A;  5FPN A;  4R79 A;  1TK5 A;  3V1O A;  5BRD A;  4FWP A;  5J2P A;  1WBD A;  3ZET B;  3MEG A;  1DKG D;  1DT9 A;  2NUB A;  5F1X A;  4JD2 A;  2LSN A;  3LZJ A;  3VQA A;  3HST B;  1CXU A;  3DI6 A;  3WNE A;  3NBP A;  4YDU A;  2E8A A;  3SAF A;  4I2Q A;  4IFY A;  1N33 K;  4JAX A;  2KQ2 A;  4B3O A;  2QWO A;  4DR1 K;  3L2V A;  5TKW A;  5E26 A;  1MA9 B;  3ULE A;  3CD6 N;  4CZH A;  3VMF B;  4CVN E;  3K9K A;  2Q1N A;  3HP6 A;  3I55 N;  3OW2 M;  1LW0 A;  4FWQ A;  2KZZ A;  4DF8 A;  3WXM B;  2KFZ A;  3VQ8 A;  4I7F A;  1J53 A;  5KRT A;  3PX4 A;  3HI0 A;  4DTJ A;  1E3M A;  2ASM A;  5A2Q O;  3H1V X;  3P5J A;  2G8H A;  1BDG A;  3P83 D;  2IVN A;  2KTQ A;  4A5A A;  4CZI A;  3J81 O;  4BRN A;  4CJT A;  3L2U A;  1WSH A;  3LP1 A;  4LFB K;  2P9N B;  2IIR A;  4KTQ A;  3RRH A;  3O9Q A;  3MDQ A;  3QIN A;  4ISE A;  4LF5 K;  3R3L A;  4RWT A;  5KPR A;  1CZ9 A;  1HNX K;  3ZT1 A;  3SV4 A;  1XMQ K;  1V4S A;  2Z1I A;  4FSV A;  4UY8 O;  4JKC A;  2YV0 X;  4XIU A;  1ILY A;  5AQR A;  4R5P A;  1S22 A;  2ZGY A;  3H46 O;  4FLV A;  1IO2 A;  4XH4 A;  4E7K A;  4EP4 A;  3UB5 A;  4RCH A;  4O44 A;  5DMR A;  4Z4C A;  3AO3 A;  2P9P A;  3WUH A;  2XRI A;  4H0T B;  1N6Q A;  5F2R A;  2CGL A;  2NRH A;  3G0Z A;  4CHP A;  1UA1 A;  1BA0 A;  1N36 K;  4CF1 A;  1HYZ A;  4L8R B;  5MLC Q;  1NK5 A;  4BG8 A;  4B9L A;  1SL2 A;  3DRS A;  4YOU A;  3PV8 A;  1RT1 A;  4BQZ A;  2BDP A;  5DM7 L;  5FRM A;  3BDP A;  1QTM A;  2HBJ A;  3CFP A;  1D4X A;  2P1J A;  4BRH A;  1NGI A;  3VEV A;  2HVH A;  2FSN A;  3WNF A;  1RDD A;  1HNI A;  4PQU A;  2F7T A;  3NGY A;  3S3O A;  3KWI A;  2O8F A;  2WC9 A;  3SAH A;  2HW3 A;  3O4Q A;  1IBL K;  5BRE A;  2XY6 A;  3QIC A;  3WXL A;  4WFN L;  3ULD A;  1VSJ A;  4DV0 K;  2W6L A;  4DF4 A;  4BE2 A;  1RDU A;  2QWM A;  4IO8 A;  5CYM A;  3A0I X;  4KHY A;  5SZT A;  3AVG A;  3VQB A;  3GG4 A;  4DV6 K;  2YCH A;  4DTM A;  3OYD A;  4AHU A;  2XY5 A;  2F8T A;  4M3W A;  5AQO A;  3PUF A;  4CJL A;  5BR9 A;  5J2M A;  3CC7 N;  3KD5 E;  2G8U A;  5FPD A;  3AVI A;  4BRP A;  3TR8 A;  3HZ6 A;  4WQ5 C;  3K0S A;  3NH2 A;  1N34 K;  1X1P A;  2PY5 A;  4CF0 A;  4KHP K;  3P39 A;  3SZ2 A;  2PYL A;  3T69 A;  1JCE A;  3MWP A;  3LPT A;  4JI4 K;  3DLE A;  4BRE A;  4CEC A;  3KLH A;  4FJ8 A;  4CER A;  1EQY A;  1MU2 A;  4EP5 A;  3TAP A;  1T6C A;  3RMB A;  3T7Z A;  1JCG A;  3AO5 A;  4FWS A;  4JHD A;  3TI0 A;  3T1Y K;  4HWI A;  3LPU A;  3VQ9 A;  1C0M A;  3LWL A;  1VHX A;  4CJE A;  1NWK A;  3PSF A;  4JS4 A;  3BGR A;  1NGD A;  1U2V B;  4CEA A;  1C0T A;  2VYP A;  1BQN A;  3GDQ A;  3O1B A;  2BUP A;  3VER A;  4IOX A;  1G15 A;  3D0P A;  3RVC A;  3NH1 A;  1S3X A;  2F96 A;  3O9S A;  4FXD A;  2GUP A;  2Q0R A;  3CPE A;  1X9W A;  1CZB A;  1YIT N;  4H03 B;  5C2F A;  4CK1 A;  2HHT A;  2P9P B;  4OPA A;  1J9A A;  4FM2 A;  4FPB A;  3THW B;  2D0B A;  1IBM K;  4BC3 A;  4DCH A;  1QSL A;  4CHQ A;  3ENO A;  3QFU A;  3HPG A;  2A40 A;  4H8K A;  2ZQB A;  4CHO A;  4K25 A;  1UWB A;  3LAL A;  4M41 A;  3RSE B;  1VQP N;  4O8U A;  2OZM A;  4M3Z A;  2WBN A;  4DUY K;  2E1Y A;  3QBW A;  4WE1 A;  3TSP A;  3HBT A;  4YOY A;  4WYB A;  5FRN A;  2HF3 A;  4CHY A;  1ZXO A;  2QEX N;  3FZK A;  4IDK A;  2KZM A;  1QE1 A;  1NK4 A;  4FJX A;  2AJQ A;  3OBW A;  1YT3 A;  4KHQ A;  3HOS A;  2DFE A;  4DTU A;  4FOE A;  4ID1 A;  4OLA A;  3NAE A;  3AAQ A;  1IKY A;  4FYD A;  4J8F A;  1VK0 A;  4C8N A;  2E4L A;  1MWM A;  5KGW A;  3DLK A;  3QO9 A;  2QK9 A;  3V9Z A;  4FK0 A;  3MXJ A;  5LL6 Z;  3V9W A;  3QEP A;  3U8X A;  1SKS A;  4BR4 A;  4BRC A;  4E19 A;  4OX9 K;  5AQP A;  4XH1 A;  1S5J A;  1WAF A;  1U47 A;  4GMJ B;  4DR3 K;  4DLG A;  1C1B A;  1C1C A;  1RT3 A;  3IRX A;  4DR2 K;  2KFN A;  1IJJ A;  2P9K A;  3AV9 A;  2F4V K;  3IG1 A;  5JIC A;  3LAN A;  1BUP A;  5AQQ A;  1Q82 O;  1TAU A;  4BRF A;  3U4L A;  1NKE A;  5HOO A;  3MCP A;  3LAM A;  1XWL A;  2JLE A;  4IBN A;  3RTV A;  2Q97 A;  1NJX A;  3IKM A;  3VPZ A;  3CCL N;  2O8B A;  1CZA N;  3DM2 A;  4EIA A;  1KXP A;  1U49 A;  4FL9 A;  1J54 A;  3AVK A;  2YNH A;  2E2Q A;  3THX B;  4JK9 A;  3K9J A;  3GL1 A;  3TSU A;  3U3Y A;  4EHT A;  1S6P A;  4GKJ K;  4BR2 A;  3PIO L;  4DR7 K;  4KBO A;  3O5B A;  3VGL A;  3VGM A;  2QW9 A;  3ZCM A;  3TAN A;  4CEZ A;  1HQU A;  2Z1G A;  4EZ9 A;  4CGJ A;  3SYZ A;  3THY A;  4U67 L;  3LZI A;  4CIF A;  1QQO A;  1GLJ O;  1SQK A;  5EVZ A;  3AGR A;  3QB0 A;  2YHY A;  4DFJ A;  2QI2 A;  4K43 A;  1VSM A;  3C6T A;  3ZYY X;  1NJY A;  3CXC M;  1F21 A;  4KFB A;  4FLZ A;  2A1R A;  2XY8 A;  4LFC K;  1BI4 A;  3AO4 A;  3VN5 A;  4NLC A;  2VG7 A;  2CGJ A;  4BR5 A;  4B8C A;  4F2R A;  1QQC A;  4M3X A;  2P51 A;  5JS1 A;  5CE3 A;  3LDS A;  4C1N I;  3CQY A;  3M5R A;  3V9U A;  4B1W B;  3NGZ A;  5DM6 L;  4IJN A;  1GOB A;  4FWM A;  2FF6 A;  3O1W A;  3SAG A;  4KTZ A;  3J7Y P;  2ZD1 A;  3U9D A;  3NVM A;  1XI1 A;  3GBT A;  4BR0 A;  3DOK A;  2ASP A;  3EZW A;  2YNI A;  1I3A A;  3A2F A;  3O9R A;  3K5L A;  4PUO A;  1FKP A;  1NGB A;  1QSY A;  4PKG A;  4Q5V A;  1JXE A;  4JS5 A;  3VQ7 A;  1X9J A;  4X62 K;  1FK9 A;  5CZ2 A;  3R8E A;  4LC9 B;  1L3U A;  5CZ1 A;  3M8P A;  5M1O A;  4Z94 A;  3IUC A;  4YY3 K;  4KO0 A;  3LAK A;  3G71 N;  3PO5 A;  2G8F A;  4FWN A;  4YOW A;  2E2P A;  4IFE A;  4HUE A;  4RW4 A;  3OYF A;  3O6W A;  1VAZ A;  3L6Q A;  4TSX A;  4A59 A;  3VA0 A;  4NCA A;  4CEQ A;  1C1A A;  4B3T K;  1S9E A;  3E9P A;  3RMA A;  4K41 A;  4NLB A;  3CCV N;  2UXC K;  2BGG A;  2O8C B;  2HST A;  1OVQ A;  3M1F A;  1KD1 O;  4DTN A;  3RR7 A;  4CZJ A;  2YX6 A;  5BR8 K;  2GEL A;  5AZJ A;  2QA4 N;  4OPK A;  5AQV A;  1UA0 A;  1JLG A;  5JLH A;  2Y1J A;  2NRZ A;  4I9L A;  2D0A A;  1JLF A;  2P9K B;  4X65 K;  1WLJ A;  3FFI A;  5E84 A;  4RW8 A;  4DV7 K;  2FBX A;  3DRP A;  3DLH A;  2RE2 A;  2KLA A;  2G8V A;  2DFF A;  4B9U A;  3J7A P;  3D2F B;  4DQS A;  3F2K A;  2UUB K;  4MO4 A;  4A2B A;  2E2O A;  1S1U A;  4DQI A;  2B4J A;  1EWR A;  4CZF A;  2NRT A;  1VQ5 N;  2HBL A;  4DHY A;  1GLF O;  3QIP A;  4DFM A;  4GKK K;  4CIE A;  1BWF O;  3SCX A;  3HSC A;  4KH4 A;  1T44 A;  1BQM A;  4BC5 A;  3OBY A;  1NK6 A;  1K9M O;  4AH9 A;  2EX3 A;  3K57 A;  4ILJ A;  3G4S N;  5ADX A;  4B9V A;  1T6D A;  3THY B;  1D9F A;  1RFQ A;  4FK4 A;  5SWM A;  1TUU A;  3T1H K;  3ID8 A;  4FLU A;  3F9K A;  5HRN A;  4CGF A;  3EKS A;  4DQR A;  2KKZ A;  4F9O A;  5KRS A;  4CJ4 A;  2WFB A;  3K5M A;  1YTA A;  3FLC O;  3SBT A;  2QXL A;  3SPZ A;  3WNH A;  2OTJ N;  4FCY A;  3BZK A;  2VWK A;  1P8Z A;  1HX1 A;  2O8D B;  2ZM6 K;  4WF9 L;  1DTQ A;  4H5R A;  4DKW A;  3UE5 A;  1TKT A;  4FLX A;  4CES A;  1E4F T;  4IG0 A;  2ASO A;  3CF5 L;  1S1X A;  5KQD A;  3C7N A;  4JKB A;  4JKG B;  4KRF A;  2BAN A;  4JI6 K;  1QHA A;  4A2A A;  3AO2 A;  3MED A;  4CJF A;  2JWL A;  2PFU A;  2F9T A;  1VQ8 N;  4CBW A;  4JK7 A;  1M1K O;  4FVU A;  4A62 A;  5ADX H;  2WUS A;  2F8S A;  1RTJ A;  4BRL A;  4BRG A;  3AVJ A;  1YXQ A;  4M3R A;  4JI5 K;  3R1X A;  1VSL A;  4LSL A;  3SUP A;  4GVM A;  5KI6 A;  2IVO A;  4LSN A;  4WQ5 A;  2NRX A;  5FDL A;  3E9O A;  3VOV A;  5FPE A;  1TL3 A;  3NDK A;  4F4K A;  2PAV A;  4QAG A;  4MLE A;  3O4W A;  3OTO K;  1Q18 A;  1SL0 A;  3WXK A;  4LY7 A;  4B9M A;  1S1T A;  3WNG A;  1ASV A;  1LWE A;  4O55 A;  4JI1 K;  5FLX O;  3V9S A;  2JGU A;  1DLO A;  1C6V A;  4FJH A;  2O4I A;  1T03 A;  2Z1H A;  4JEP A;  3HT3 A;  1RNH A;  3O3H A;  2D0C A;  5J2N A;  4DSE A;  1HNW K;  1TL1 A;  3VQ4 A;  3FZM A;  1YF5 L;  1ZYQ A;  3O3F A;  1RIL A;  3QDK A;  1HJR A;  1VSF A;  3OY9 A;  5LMN K;  4DTP A;  4FJ7 A;  2DPN A;  3DLR A;  4OPJ A;  5AQH A;  1FJG K;  3NF8 A;  3QEI A;  4ELT A;  3DYA A;  2RN2 A;  3I0R A;  1GLC G;  4K42 A;  1QQN A;  2A6A A;  3OA9 A;  3OYI A;  1VQ9 N;  2CH5 A;  4C8K A;  2E6L A;  2G8I A;  4KHS A;  3LP2 A;  1X9S A;  4AHR A;  1KAZ A;  4ISF A;  4JKA A;  4LD0 A;  3OYK A;  3NF9 A;  3QLH A;  4ILH A;  4H5N A;  3SBG A;  4DTX A;  3T3F A;  3OVN A;  3QNN A;  5M1P A;  3R9P A;  4LH5 A;  4C8L A;  1QZ5 A;  5KTQ A;  2O8E A;  1XC9 A;  3LDP A;  3E66 A;  4CI6 A;  1HUX A;  3CMA N;  1DTT A;  3CET A;  3W3D A;  5D3G A;  1QHT A;  2GUI A;  5JVH L;  4CHN A;  1GLB G;  1HPM A;  1GLD G;  1ZBS A;  3C95 A;  1ZBH A;  4BY9 C;  4PKI A;  3SUO A;  2P9L A;  3NHG A;  5EU7 A;  3TSQ A;  2P9U B;  3ZLJ A;  3HP9 A;  2HMP A;  4M7X A;  4C8O A;  4E7J A;  4JNE A;  4J2A A;  3HM9 A;  3VTI A;  1NGF A;  2AA4 A;  2Z1J A;  1A5V A;  3OYN A;  2A1S A;  4CJ7 A;  1U48 A;  2QWQ A;  4DSF A;  5AQU A;  2GV9 A;  1HYS A;  3SQ1 A;  4CFC A;  1WSE A;  1C0U A;  4BRD A;  1Q8I A;  4JD2 B;  4H0P A;  4BVO A;  2HVI A;  3KLF A;  3E9L A;  3ASM A;  3QFP A;  4NXN K;  2YKN A;  1RT4 A;  3WEE A;  2HND A;  3KHY A;  3VF4 A;  4AHC A;  4CFD A;  3VQE A;  1HRH A;  4DG1 A;  5BPM A;  1HR0 K;  3O80 A;  3H6E A;  5AQX A;  3S9H A;  4CHZ A;  2QWN A;  4I2P A;  4GV9 A;  3HK2 A;  3CJ1 A;  3ULE B;  3SNN A;  4JRQ A;  1VQM N;  2OPQ A;  4JI2 K;  4BRK A;  5EXW A;  2YI1 A;  1OKJ A;  3BZC A;  4DMN A;  4IOA L;  1J5E K;  5KPZ A;  3VEW A;  4CJS A;  4B9T A;  3D2E A;  4KI6 A;  4HTL A;  4FW2 A;  4QS7 A;  4BRQ A;  2A5X A;  2B5J A;  2NRW A;  4FJ9 A;  4L3Q A;  1OH8 A;  4EHU A;  3LM9 A;  2QWP A;  4HHT A;  5KQ8 A;  3ZSR A;  1T05 A;  4Z4H A;  3HXM A;  3NGI A;  4B9S A;  4H0O A;  4ELV A;  2D0O A;  4B8A B;  1LWC A;  3HYF A;  4AQY K;  2DTU A;  1NBW A;  4HUG A;  2V7Z A;  4Y1D A;  3MMV A;  1LOT B;  2VQE K;  2ZJQ L;  2I7N A;  3L4Q A;  2HHV A;  1L3V A;  4FLY A;  4CD3 A;  3HTV A;  3TAE A;  2XY7 A;  3T1A A;  4CJ3 A;  2CGK A;  1MDU B;  3ZEU A;  4DS5 A;  1NGE A;  2WON A;  3CJC A;  4CJP A;  4X64 K;  5B8H A;  3QIO A;  1XHZ A;  3DXM A;  2YHX A;  3C0B A;  3MN5 A;  1ZBF A;  3I8B A;  5EY4 A;  4HVJ A;  1CXQ A;  2YJF A;  3H3N O;  5JMV A;  3CCE N;  3O08 A;  1VQ6 N;  2VGM A;  1JL2 A;  4Q0B A;  2ITM A;  4FJJ A;  3B6O A;  3HL8 A;  1RT6 A;  4YNQ A;  4BR7 A;  3NF7 A;  4B1X B;  3VF6 A;  4YOX A;  4PKH A;  2P5O A;  1JL1 A;  4BC2 A;  4H5W A;  1WB9 A;  1GOC A;  3IMX A;  2HB5 A;  4DQP A;  4E0D A;  1S9G A;  3S3M A;  1D5A A;  4O5B A;  2E6M A;  3SPY A;  1ITG A;  3CCU N;  4GY2 B;  2O8F B;  3VQP A;  3THV A;  1G99 A;  3L2R A;  3KKS A;  3ZSV A;  3IAY A;  1K6Y A;  4HCB A;  5C2D A;  1ESV A;  1XHX A;  4OO1 J;  1NJZ A;  2DY4 A;  3CFO A;  4JI8 K;  3OYL A;  4KI4 A;  3CI5 A;  3O9T A;  1WBB A;  3JS6 A;  3C94 A;  5GAH P;  4K8X A;  2NZT A;  3JXU A;  4KV8 A;  3ZT3 A;  4DLE A;  4B3R K;  2YHB A;  3QBX A;  2HNZ A;  2OZS A;  3CER A;  4EZ6 A;  3SQ0 A;  4FO0 A;  5GIN A;  1KRP A;  4B1Z A;  4BG9 A;  5KGX A;  3D6R A;  3FZL A;  1UAX A;  1X3N A;  2WOM A;  1NGA A;  4OKE A;  3TAQ A;  4DR6 K;  1K8K A;  3VTH A;  1TKD A;  4MDA A;  2V7Y A;  4W5Q A;  1BIZ A;  3A5N C;  3KVG A;  4DQ8 A;  1BIS A;  4O0I A;  3OJU A;  3MXI A;  3ALY A;  4U7B A;  2Q0U A;  3NCI A;  3DAW A;  4JKE A;  3SMS A;  3HOT A;  4DV2 K;  1OH7 A;  2QWR A;  1IKV A;  2W42 A;  2Y1I A;  3ITH A;  3PO4 A;  1LAV A;  4WQ4 C;  4B3M K;  1LCU A;  1RBS A;  3D2E B;  4GV3 A;  1BU6 O;  1Z26 A;  4XH5 A;  4CK2 A;  3SK3 A;  4CCH A;  3B8A X;  4GNI A;  5J1E A;  5HBM A;  5AZI A;  3GOI A;  5EX5 A;  2A42 A;  4IJA A;  5AR0 A;  4JHD B;  4QCL A;  3SJH A;  3TAB A;  4K0K K;  2IOC A;  1VSH A;  2X6S A;  2QKK A;  4ID5 A;  4Z4G A;  4WFA L;  4CJU A;  4CZG A;  4DU4 A;  2IGI A;  4FWL A;  3OS1 A;  2A3Z A;  4E89 A;  3J80 O;  2F9W A;  2VG5 A;  4RW6 A;  2WTU A;  4AF1 A;  3P31 A;  4CED A;  3KD1 E;  4Z4E A;  4PL8 A;  4MFB A;  4IEI A;  1N32 K;  1ASU A;  1RCH A;  3J8A A;  1KFD A;  4KHU A;  1WNS A;  3ZEU B;  2ZE2 A;  4KTW A;  3NFA A;  4RTF D;  4B9Q A;  4CGG A;  3SV3 A;  3MN6 A;  3HVT A;  4KAZ A;  2OCE A;  4DFP A;  1RTD A;  1VRT A;  1SKW A;  1NNE A;  3AAR A;  3QES A;  3LWM A;  1HNZ K;  3VET A;  1TK8 A;  3WXJ A;  4F8R A;  2ZJR L;  4E7L A;  5AQZ A;  3KLG A;  1BIU A;  3S41 A;  1M90 O;  3DXK A;  4E3S A;  4CK3 A;  3OYA A;  4DV5 K;  2HHQ A;  3EO3 A;  4E1M A;  3VQD A;  3QEX A;  3OYG A;  1GOA A;  1YAG A;  2RHK A;  4CZM A;  3G6E N;  3HRG A;  1LW2 A;  4LF6 K;  2BH1 A;  1KQS M;  3ZX3 A;  4DR4 K;  5HRR A;  3AAP A;  1NKB A;  3VQC A;  3HM8 A;  3CJ7 A;  1Z05 A;  3EEQ A;  1IH7 A;  3AO1 A;  3QNO A;  5DK5 A;  4CJR A;  4GW6 A;  3M8Q A;  4Y0W A;  3ZSQ A;  5M1N A;  3VQQ A;  3OYE A;  4NCB A;  3NE6 A;  4IKF A;  3KJV A;  3MEE A;  5FRO A;  1BOT O;  4BDZ A;  3ZET A;  3KK3 A;  3M8S A;  1KAY A;  3KZB A;  3ZSX A;  3MK6 A;  4NXM K;  5CHI A;  4K8Z A;  5HLF A;  3D7E O;  3U6F A;  3FGU A;  1W2B M;  3N4Q A;  4QS9 A;  3ZX0 A;  4DFK A;  2X6N A;  1SL1 A;  3RMD A;  4CF2 A;  2HNY A;  4FOI A;  3SUQ A;  5CYQ A;  4H5V A;  3I56 N;  4H4M A;  4HCC A;  2E5L K;  3C6A A;  4OPH A;  1NM1 A;  3BY5 A;  1BL3 A;  3H45 C;  1K8K B;  3FE1 A;  4IWV A;  1WSG A;  3C6H A;  3NVK A;  4O4G A;  2HOE A;  4CEB A;  2OYQ A;  4AHV A;  3CYM A;  1YJW N;  4LF8 K;  1C0G A;  3D45 A;  1W97 L;  4JYA K;  4OJR A;  3PX6 A;  1YJN N;  4FJI A;  2RF2 A;  5LJV A;  1O1W A;  5M1K A;  3KK7 A;  2O8B B;  4NB4 A;  1ATN A;  4OKJ A;  4CEE A;  4LF7 K;  1NG9 A;  4NYN A;  2H3G X;  3A5O C;  3E1Y A;  1NOY A;  2G8W A;  5AZI B;  1U04 A;  4HUF A;  1EO1 A;  3SMP A;  2P5G A;  2FLO A;  2P9N A;  1QVF M;  2D4W A;  1H1V A;  3N4P A;  1RT5 A;  1NK8 A;  4MLH A;  3UIQ A;  4DQQ A;  3K5O A;  2QM1 A;  4E1J A;  3W0L A;  5C12 A;  3CHW A;  5HRP A;  1EKE A;  1NMN A;  2EWS A;  5CY4 A;  4CGD A;  1KTQ A;  4EFH A;  4BWM A;  4KKO A;  5C42 A;  4IO9 L;  5LY3 A;  4DV1 K;  4YOV A;  4PWD A;  2ITG A;  4ICL A;  2ZGZ A;  2D5R A; 
#chains in the Genus database with same CATH homology
 4BC4 A;  4BRM A;  2Q0R A;  3CPE A;  3R9P A;  1YIT N;  1N8R O;  3L0Q A;  4H03 B;  5AQL A;  3TU5 A;  1QZ5 A;  5C2F A;  3MWT A;  2FXU A;  4M7Y A;  1HLU A;  3KWG A;  3LDP A;  3E66 A;  4CI6 A;  1HUX A;  3CMA N;  1NJI O;  3BP8 A;  2I7P A;  1NGC A;  4FWO A;  2P9P B;  2VCP A;  3CET A;  3MN7 A;  4OPA A;  3VEZ A;  3W3D A;  4FPB A;  3F5T A;  2FSJ A;  5JVH L;  5AQN A;  1GLB G;  4BC3 A;  2GX9 A;  4DCH A;  1HPM A;  3TPQ A;  2UYT A;  1GLD G;  1ZBS A;  3GE1 A;  4AM6 A;  3ENO A;  4YOR A;  3QFU A;  1IG8 A;  1QVG M;  2A40 A;  4BY9 C;  2PBD A;  4PKI A;  3EE9 A;  5I9E B;  3WQU A;  5GAG P;  5TKY A;  3U9Z A;  2P9L A;  4K25 A;  3DXK B;  4C1N K;  3Q7B A;  3TSQ A;  3VEN A;  5GAD P;  1NMD A;  3RSE B;  1SZ2 A;  2P9U B;  4CZK A;  1VQP N;  1GLE G;  4O8U A;  2HMP A;  4IDH A;  2WBN A;  4M7X A;  2E1Y A;  3DJC A;  3QBW A;  3TSP A;  1VQO N;  4JKG A;  3IDH A;  4JNE A;  3HBT A;  4OO1 J;  4YOY A;  2BTF A;  1GLA G;  4WYB A;  3UKU B;  1Y64 A;  2V51 B;  2HF3 A;  1NGF A;  2AA4 A;  3VTI A;  4B1V A;  1Q86 O;  1ZXO A;  2P9S B;  2QEX N;  3FZK A;  4NO7 A;  1TYQ B;  4ISG A;  1C0F A;  2Q2R A;  4CJ7 A;  2QWQ A;  3OBW A;  3OHR A;  3HOS A;  5AQU A;  3VF2 A;  4JN4 A;  3G25 A;  3MN9 A;  3SLC A;  4FPA A;  3QML A;  5C0Y A;  1ATR A;  3DLL L;  4FOE A;  4A61 A;  4CZE A;  3BF1 A;  4BRD A;  3AAQ A;  5AQF A;  5BRF A;  5AQI A;  4JD2 B;  2W40 A;  1O13 A;  4H0P A;  4BVO A;  4CD1 A;  4IXC A;  3E9L A;  4YOT A;  5JLF A;  3QFP A;  1VQL N;  4J8F A;  1VQK N;  3CJ9 A;  4WFB L;  1MWM A;  3WEE A;  4BVP A;  3KHY A;  4H0V B;  3VF4 A;  1U6Z A;  1VQN N;  3U8X A;  5BPM A;  4BR4 A;  4BRC A;  2OTL N;  1VQ7 N;  1SS6 A;  2AP1 A;  2D1K A;  2JWK A;  3O80 A;  4XH1 A;  5AQP A;  3H6E A;  5AQX A;  2QWN A;  3IFR A;  3VES A;  5M1Q A;  4GV9 A;  2GWK A;  3CJ1 A;  1XC3 A;  2HF4 A;  3ULE B;  4PL7 A;  1ZC6 A;  1YVN A;  3CIP A;  1VQM N;  4CBU A;  5AZJ B;  4BRK A;  5EXW A;  2YI1 A;  1WOQ A;  1IJJ A;  2FF3 B;  1OKJ A;  4XEI A;  4H5T A;  1KAX A;  4IOA L;  3MX5 A;  2P9K A;  5ELZ A;  5KPZ A;  4B1U B;  5JIC A;  2VGN A;  3VEW A;  1BUP A;  3AGK A;  3TTD A;  1NGJ A;  3D2E A;  5AQQ A;  1Q82 O;  4HTL A;  4QS7 A;  4KH5 A;  4BRF A;  4BRQ A;  2A5X A;  2NRW A;  4L3Q A;  3U4L A;  3ENB A;  5HOO A;  3MCP A;  3VGK A;  4EHU A;  3LM9 A;  2QWP A;  3ID6 A;  5KQ8 A;  2E88 A;  5GIP A;  2Q97 A;  3H1Q A;  3IKM A;  2ZF5 O;  3VPZ A;  5BN9 A;  3CCL N;  1CZA N;  4EIA A;  4H0O A;  1KXP A;  3EE8 A;  2D0O A;  4FL9 A;  5BN8 A;  3BUZ B;  5AQJ A;  3M6G A;  1HKC A;  1NBW A;  2E2Q A;  2V7Z A;  5F0X A;  4JK9 A;  3K9J A;  3MMV A;  1LOT B;  3GL1 A;  3TSU A;  3CCR N;  4I6M B;  1NGG A;  4FWK A;  4GVE A;  4EHT A;  5AQM A;  3LDQ A;  4BR2 A;  3PIO L;  2ZJQ L;  1YJ9 N;  4KBO A;  1MWK A;  3DWL A;  3O5B A;  1V4T A;  2I7N A;  3MCA B;  3L4Q A;  3C65 A;  3VGL A;  3VGM A;  1U2V A;  2QW9 A;  4CD3 A;  3VEY A;  4G9Z A;  3HTV A;  3PIP L;  2CGK A;  3AY9 A;  1MDU B;  3BF3 A;  3WXI A;  1QZ6 A;  3ZEU A;  1J6Z A;  1NGE A;  5M1F A;  2IVP A;  4U67 L;  3CJC A;  3LDN A;  1QQO A;  3LDO A;  5B8H A;  1GLJ O;  1SQK A;  5EVZ A;  3AGR A;  3QB0 A;  2FSK A;  2YHY A;  2QI2 A;  4CBX A;  5BRH A;  4K43 A;  1BG3 A;  1K73 O;  1WUA A;  3CJA A;  2NLX A;  3DXM A;  2YHX A;  3C0B A;  3MN5 A;  3ZYY X;  3I8B A;  3CC2 N;  5EY4 A;  3CXC M;  3ATV A;  2HBM A;  2YJF A;  1S72 N;  3H3N O;  5JMV A;  2GTD A;  3CPW M;  3CCE N;  1Z6R A;  3O08 A;  3UKR A;  1VQ6 N;  4NLC A;  3ZX2 A;  1NLV A;  2YJE A;  3H3O B;  2CGJ A;  2VGM A;  5H1S Q;  4BR5 A;  1BA1 A;  3CCS N;  2ITM A;  3CME N;  3A8Y A;  5GIO A;  3FZH A;  3WT0 A;  2HBK A;  5CE3 A;  2OAN A;  4C1N I;  4BR7 A;  3ATU A;  3CQY A;  3M5R A;  4B1W B;  4B1X B;  5AQT A;  3VF6 A;  4BGB A;  5DM6 L;  1RDW X;  2NRV A;  3O8M A;  4IJN A;  4FWM A;  2FF6 A;  5BPL A;  3O1W A;  3SAG A;  1OVY A;  4A5B A;  4YOX A;  4PKH A;  5C15 A;  4KH6 A;  3P38 A;  4BC2 A;  4H5W A;  3U9D A;  3NVM A;  3C7N B;  3IMX A;  3RSE A;  2P9U A;  3GBT A;  4BGA A;  4BRA A;  1HKG A;  4BR0 A;  2ASP A;  4H0Y B;  3PLA A;  3EZW A;  3CCJ N;  3O9R A;  3LM2 A;  3CCU N;  4GY2 B;  3FZF A;  3LDL A;  1NGB A;  5CR4 A;  4PKG A;  4EAH D;  1RGI A;  1G99 A;  1X3M A;  1XUP O;  5AQW A;  1X9J A;  3R8E A;  1ESV A;  3ENH A;  4LC9 B;  5M1O A;  3CJB A;  4BQL A;  5C2D A;  4Z94 A;  3VEX A;  1HJO A;  4IOC L;  3IUC A;  1JJ2 M;  5FPN A;  4R79 A;  3G71 N;  4B1Y B;  3CI5 A;  3O9T A;  4FWN A;  5BRD A;  3JS6 A;  5M1P A;  4FWP A;  2E2P A;  1P90 A;  4YOW A;  4IFE A;  4JKF A;  5GAH P;  3ZET B;  2NZT A;  3O6W A;  1VAZ A;  4A57 A;  1DKG D;  3JXU A;  1DT9 A;  3L6Q A;  5F1X A;  4JD2 A;  4A59 A;  3QBX A;  4DB3 A;  3CER A;  5KPT A;  5C10 A;  4FO0 A;  5GIN A;  4B1Z A;  4BRI A;  4BG9 A;  3E9P A;  4YDU A;  2E8A A;  3D6R A;  2NNW A;  4K41 A;  4NLB A;  3SAF A;  3FZL A;  3CCV N;  1X3N A;  4JAX A;  1NGA A;  4WQ4 A;  1K8K A;  3VTH A;  2QWO A;  4BRO A;  4MDA A;  2HST A;  2V7Y A;  4O5F A;  5TKW A;  5E26 A;  1MA9 B;  3A5N C;  3KVG A;  3ULE A;  3M1F A;  4DQ8 A;  4CZH A;  1KD1 O;  3VMF B;  3CD6 N;  1QQM A;  3K9K A;  4CZJ A;  2YX6 A;  2P9I A;  5EOY A;  2Q1N A;  4WCE L;  2GEL A;  5AZJ A;  3I55 N;  3OW2 M;  4U7B A;  2QA4 N;  4FWQ A;  2Q0U A;  3CQX A;  3MX2 A;  5AQV A;  3DAW A;  2E2N A;  4JKE A;  3SMS A;  3WXM B;  3HOT A;  4YDU C;  4JKD A;  2QWR A;  5JLH A;  2VWB A;  2NRZ A;  2P9K B;  4WQ4 C;  2CH6 A;  1LCU A;  3HI0 A;  5E84 A;  3D2E B;  2ASM A;  4GV3 A;  3H1V X;  1BU6 O;  2GEM A;  4XH5 A;  2RE2 A;  3A5L C;  3SK3 A;  1BDG A;  2KLA A;  3B8A X;  4GNI A;  2IVN A;  3R6M A;  4A5A A;  5AZI A;  3D2F B;  4CZI A;  3GOI A;  5EX5 A;  2A42 A;  1VQ4 N;  4IJA A;  5AR0 A;  4JHD B;  4BRN A;  3SJH A;  3F2K A;  3FR0 A;  4MO4 A;  4A2B A;  4PHT X;  2E2O A;  1T3V A;  4WFA L;  4CZG A;  2P9N B;  2IIR A;  4CZF A;  2NRT A;  3O9Q A;  3MDQ A;  4FWL A;  1VQ5 N;  2HBL A;  4DHY A;  1GLF O;  4ISE A;  3R3L A;  4RWT A;  5KPR A;  2A3Z A;  2F9W A;  4CZL A;  5AQY A;  5AQS A;  1BWF O;  3HSC A;  4KH4 A;  1T44 A;  1V4S A;  4FSV A;  4AF1 A;  4UY8 O;  3P31 A;  4JKC A;  4BC5 A;  4PL8 A;  3OBY A;  4IEI A;  1ILY A;  1K9M O;  5AQR A;  2E20 A;  3J8A A;  2D0P A;  4ILJ A;  3A5M C;  3G4S N;  1DEJ A;  2YHW A;  1S22 A;  5ADX A;  2ZGY A;  1T6D A;  2W41 A;  3H46 O;  4XH4 A;  3ZEU B;  4RTF D;  4B9Q A;  4FWR A;  4O8K A;  1RFQ A;  3MN6 A;  3UB5 A;  3VEO A;  2V52 B;  4IZ9 A;  4RCH A;  5HL7 L;  1TUU A;  3ID8 A;  2P9P A;  4IEE A;  3WUH A;  3AAR A;  3EKS A;  3VET A;  4H0T B;  1R59 O;  3WXJ A;  2KKZ A;  5F2R A;  2ZJR L;  2CGL A;  2NRH A;  4F9O A;  5AQZ A;  1BA0 A;  2QTD A;  5JVG L;  2WFB A;  5AQK A;  3S41 A;  3FLC O;  3SBT A;  3UKR B;  2QXL A;  5MLC Q;  4BG8 A;  2OTJ N;  1GLL O;  4BR9 A;  1M90 O;  3DXK A;  1P8Z A;  1HX1 A;  2A41 A;  4AM7 A;  4YOU A;  3EO3 A;  3WQT A;  4WF9 L;  3FFK B;  2P9L B;  4H5R A;  4DKW A;  1HKB A;  3UE5 A;  4BQZ A;  5DM7 L;  1E4F T;  1YAG A;  2ASO A;  2HBJ A;  1D4X A;  3CF5 L;  2RHK A;  4CZM A;  4BRH A;  1NGI A;  3Q7C A;  5KQD A;  3EL2 A;  3G6E N;  3UKU A;  3HRG A;  4JKH A;  3C7N A;  3VEV A;  1XQS C;  4JKB A;  2P9S A;  4JKG B;  1YUW A;  2FSN A;  3TTF A;  2BH1 A;  4MO5 A;  1TYQ A;  4M63 C;  2F7T A;  1KQS M;  1QHA A;  3ZX3 A;  4A2A A;  3KWI A;  3AAP A;  5GAE P;  2WC9 A;  2JWL A;  2PFU A;  3SAH A;  3EN9 A;  2F9T A;  1VQ8 N;  2NRR A;  3HM8 A;  4CBW A;  2J4R A;  4JK7 A;  5BRE A;  1M1K O;  4FVU A;  3CJ7 A;  1Z05 A;  3QIC A;  3WXL A;  1Q81 O;  4A62 A;  4WFN L;  5ADX H;  2WUS A;  4BRL A;  4BRG A;  1JCF A;  4C23 A;  1TUY A;  4Y0W A;  5M1N A;  1YXQ A;  2E1Z A;  3R1X A;  1RDU A;  2QWM A;  4IO8 A;  3EKU A;  4JK8 A;  1BOT O;  3A0I X;  2IVO A;  4WQ5 A;  2NRX A;  3ZET A;  3E9O A;  3VOV A;  1KAY A;  5FPE A;  3GG4 A;  3KZB A;  3WEE B;  3I33 A;  2YCH A;  3MK6 A;  5CHI A;  3D7E O;  3FGU A;  1W2B M;  2PAV A;  3N4Q A;  2ZJP L;  4QS9 A;  5AQO A;  3ZX0 A;  5BR9 A;  4MLE A;  3CC7 N;  3O4W A;  1Q18 A;  3WXK A;  5FPD A;  4FOI A;  4BRP A;  4H5V A;  2KHO A;  3I56 N;  3M3Z A;  5LJW A;  3HZ6 A;  3C6A A;  4WQ5 C;  1NGH A;  4OPH A;  1NM1 A;  3TTC A;  3H45 C;  1YI2 N;  1K8K B;  3FE1 A;  4IWV A;  5AFU A;  3NMU A;  3C6H A;  3NVK A;  3CCM N;  2Q36 A;  2ZWH A;  2P9I B;  3P39 A;  2HOE A;  4ILG B;  3CCQ N;  1YJW N;  3T69 A;  3F9M A;  1C0G A;  1JCE A;  4JEP A;  1K8A O;  1W97 L;  3MWP A;  3O9U A;  1KC8 O;  1BO5 O;  4BRE A;  1ATS A;  1YJN N;  3FZM A;  1EQY A;  1YF5 L;  5LJV A;  3CC4 N;  3QDK A;  5M1K A;  3KK7 A;  1T6C A;  5FPM A;  4NB4 A;  4QS8 A;  1JCG A;  3T7Z A;  3D2F A;  2DPN A;  3J7Z O;  1ATN A;  4FWS A;  5AQH A;  4JHD A;  1SAZ A;  3P4I A;  2H3G X;  3L4I A;  3A5O C;  3E1Y A;  4HWI A;  4I6M A;  4GV6 A;  5AZI B;  5AQG A;  1EO1 A;  1Q7Y O;  1DGK N;  3SMP A;  1GLC G;  4K42 A;  1QQN A;  2A6A A;  2FLO A;  2P9N A;  3OA9 A;  1VQ9 N;  2D4W A;  1QVF M;  1H1V A;  1NWK A;  2CH5 A;  3N4P A;  1YHQ N;  4MDB A;  4MLH A;  1NGD A;  4H0X B;  1U2V B;  3LL3 A;  2QM1 A;  4E1J A;  3W0L A;  1KAZ A;  2QWL A;  2VYP A;  3CHW A;  4ISF A;  3BEX A;  4JKA A;  5C12 A;  3GDQ A;  5BPN A;  3O1B A;  2EWS A;  2BUP A;  3VER A;  4EFH A;  4IOX A;  1YIJ N;  4IO9 L;  2Q31 A;  5LY3 A;  3RVC A;  4YOV A;  1S3X A;  2GWJ A;  4ILH A;  4H5N A;  5AFU H;  3SBG A;  1E4G T;  3DXM B;  2ZGZ A;  3O9S A;  2GUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...