1O13A

Crystal structure of a putative dinitrogenase iron-molybdenum cofactor (tm1816) from thermotoga maritima at 1.83 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords probable NifB protein
publication title Crystal structure of probable NifB protein that is involved in FeMo-Co biosynthesis TM1816 from Thermotoga maritima at 1.83 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Biosynthetic protein
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2002-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1o13A00
1T3VA 1RDUA 1P90A 1O13A 2KLAA 2YX6A 2QTDA 2WFBA 1EO1A 2RE2A
chains in the Genus database with same CATH superfamily
3SBGA 3ZYYX 5M1FA 2YCHA 3S3OA 3DAWA 3J7AP 1RT4A 2QKKA 3WQTA 1YIJN 4CESA 4BR5A 5E26A 4JKFA 1WSIA 3K5MA 4H0XB 3MXMA 4FJHA 3DMJA 5AQKA 3U3YA 4PKIA 4AHVA 4M41A 1CZAN 3CCRN 1VSHA 2DPNA 3HSCA 3QMLA 4DSKA 2HF4A 2Q2RA 2G8HA 3CCQN 3L2WA 4IWVA 5HRPA 3M5RA 4DQRA 2EHGA 3WT0A 4WYBA 3LAKA 4FM0A 3WXJA 1FK9A 1TGOA 3BF1A 1TKXA 4AM7A 4FM1A 1L3UA 3VQQA 2BANA 1EXQA 3DXKB 4KHNA 4CD1A 4CEOA 1VSJA 3VQCA 2QWQA 2W6KA 3SPYA 3ZSYA 1T44A 3CCSN 2KHOA 1WOQA 2A5XA 5BRHA 4FWMA 4IDKA 5AZJA 3I56N 2QW9A 3DYAA 4CIGA 4IOAL 4B9SA 5D3GA 3NFAA 3WEEB 4O0JA 1HQEA 4CFBA 1RT3A 3PSFA 3E9LA 1VHXA 3UKUA 4OKJA 3P5JA 4CJRA 1T6DA 2ETJA 4YOYA 3HXMA 2RE2A 1RGIA 4RG8A 4CGIA 1HPMA 1RT2A 3BGRA 1M1KO 3G4SN 3QO9A 4K43A 4RCHA 4XH5A 2NLXA 1RDUA 5HROA 3SV4A 1V4SA 3NF7A 4FJIA 3QFPA 4CW7B 1RBTA 3AVHA 1YVNA 4CERA 4QCLA 4N5SA 4FW1A 3IUCA 1TK5A 4CZJA 3HTVA 5AQPA 1MU2A 4NYFA 1JLAA 4GV3A 5LMNK 4DLGA 3OTOK 4JKBA 3KKRA 5GAGP 1Z25A 3KKSA 2ZJQL 3BP8A 1KRPA 2WBNA 3RMCA 3D7EO 4BRQA 5HOOA 1VSIA 2EWSA 4WFBL 3BZCA 3CMAN 3S41A 4DV5K 2P9LB 2XO7A 2Z1HA 3QEVA 3AO3A 4CE9A 1GLCG 5FDLA 2HHVA 1NJYA 2FBXA 3RWUA 4YNQA 2XY5A 1NU0A 3DRRA 4C1NK 4CEFA 4OKKA 1YAGA 3NMUA 1LAWA 4CJQA 4EIAA 1VSFA 4Z4IA 4BACA 3V9WA 5FROA 3QDKA 3K59A 1VQLN 4BGBA 1QSYA 4FCYA 4F4KA 1WSEA 1N6QA 3R8EA 1Q9YA 4CJWA 1JLCA 4I2QA 1T6CA 3KWIA 4PL7A 4XEIA 3TTFA 4CEEA 2OCEA 1JLQA 4I6MB 1NMNA 4JK9A 1YI2N 4AHCA 4E7JA 2OPQA 3AARA 2QWPA 5C2DA 3ZLJA 2EX3A 3PY8A 3DM2A 3CC4N 3MECA 4CZKA 4IJAA 4O5FA 3K57A 3TTCA 3L3UA 2YNHA 3VTHA 2W42A 4BRPA 4ISGA 3VQ4A 4IG3A 1L5UA 2PZSA 2Z1JA 2VWKA 3F5TA 4CZIA 4CEDA 2G8KA 1KCFA 4B3SK 3J80O 2UUBK 3AVKA 1QSSA 1IBMK 2CGJA 1UA1A 3M8SA 1X9WA 1IKYA 1D9DA 4OVLA 4DR3K 4CBXA 4CZEA 3LDNA 5BRFA 3SQ0A 1S6PA 1QTMA 1ZXOA 1W97L 1XHZA 4JI5K 3QBXA 4DTOA 3QESA 5BR9A 4KB1A 2UUCK 1QZ5A 5T7BA 4EHTA 1REVA 1OVQA 3TWHA 4H5WA 1RDAA 4OJRA 4EP5A 3VF6A 4WFAL 2Y1IA 2BH1A 4YOVA 3HP6A 3KWGA 5DM7L 3NGZA 4X65K 3U9ZA 3L8BA 4O8KA 3VQDA 3OW2M 3HL8A 1XNRK 4CECA 5C24A 4O44A 1TL1A 1UOCA 3PX6A 1EETA 1YF5L 1NKCA 4FJMA 3AAQA 3C6AA 3O5BA 4NO7A 3ZEUB 3SQ2A 4LF7K 3OJSA 4IO8A 2HF3A 2GV9A 3CI5A 5EU7A 4CJPA 1T3VA 3CG7A 4JV5K 4GW6A 4DV4K 5HRRA 1U48A 3LP0A 4YOXA 4FJ8A 1MDUB 4C23A 1VQ5N 3CC7N 3L6QA 4RW9A 2A1SA 3WNHA 1KFDA 2X78A 4BWJA 4GV6A 3HPGA 5A2QO 5JVGL 3KLGA 2FSJA 5B8HA 2F8TA 4DTXA 3OYAA 2YNIA 3VQ5A 1QQCA 5ELZA 1LCUA 2NRWA 1NMDA 1LW2A 3TARA 2A1RA 1B9DA 4OPKA 3DLBA 3D6RA 1XC9A 1HUXA 3ULDA 1NOZA 1TKTA 1VQPN 2XY8A 2HNDA 1BI4B 4CGJA 3AAPA 4JI0K 3G10A 1YT3A 2PFUA 3W3DA 1RCHA 3HPOA 2D0BA 4DWIA 1NGIA 3D2FA 4FJKA 4BRMA 4LF5K 1TUYA 3L4QA 4AM6A 2P9PB 4KFBA 2I5JA 2P5OA 4DTPA 4OPHA 1RTJA 1ESVA 2IVOA 3WXMB 2HMPA 3ZEUA 3D0PA 3FZHA 1I94K 4IBNA 4Y0WA 3JSMA 1IKVA 2FF6A 5C42A 3BUZB 4CGDA 3AA3A 3V9SA 4EAHD 3R9PA 4R5PA 2NRXA 1KC8O 4CZMA 1G99A 3SYZA 3NVMA 1TYQA 1JKHA 4A59A 3VN5A 3EN9A 2FBYA 4CJLA 3AO4A 4ELUA 3U8XA 2KFNA 1CXQA 1GLAG 1P90A 2D0CA 4IG0A 3KD1E 1SUQA 3VEOA 2NRVA 3ZT2A 1KAZA 4DTSA 1TK8A 4HUFA 4NCBA 4KHUA 2O8CA 1HLUA 2O4GA 4EZ6A 3KTQA 4B3OA 1XUPO 4X62K 3ZT0A 1JCEA 2P9IB 1JL2A 2VQEK 2JGUA 3UE5A 1SZ2A 2QTDA 4BRLA 2OPSA 4DR6K 2OZSA 4FWKA 1ASUA 3HSTB 4LF9K 4JN4A 4OLAA 5BPNA 1ZBLA 4YOTA 3DI6A 4CF2A 4CJUA 5AQXA 4M7XA 4CHPA 4OPJA 4K42A 1KVAA 4E19A 3THWB 4RTFD 3DLEA 4H0YB 4E3SA 3UKRB 1MA9B 3MK6A 1NGGA 3CCUN 5KTQA 2D4WA 3QETA 3RMBA 3ZSRA 4OX9K 4GNIA 4KHYA 1NGEA 4J2BA 4GKKK 1KTQA 4CJ3A 4MFBA 1I39A 4Z94A 2HHWA 3MDQA 1DTQA 1VQON 3K9KA 4QS7A 1YUWA 3FZKA 3CC2N 3QEWA 4JNEA 3CFPA 2QWRA 3MXJA 1QE1A 4B8AB 2YI1A 3VA0A 4KREA 4KTQA 3E9PA 1VQ4N 1X1PA 3LM9A 4HWIA 4BRHA 1ZBFA 3PSIA 2O8DA 2E5LK 1BUPA 1SL1A 3CD6N 3ZSZA 3AVNA 1K73O 4FWQA 3O6WA 3ZETB 4BRGA 2P9IA 1JL1A 4JI4K 3SCXA 3VQ7A 5M1QA 1ZBHA 1C0TA 5J2MA 1J5OA 3T69A 3U6FA 1J5EK 3MWPA 3QICA 2E4LA 3VQ8A 3EZWA 2D0PA 3OYHA 2D0AA 3K5LA 4JHDB 4PA1A 4DQSA 3TAPA 3SZ2A 3O3FA 4A2BA 1RT5A 4FJLA 3VPZA 5BRDA 3PIOL 2NZTA 4IEEA 3P4IA 4YY3K 5TKYA 4BDZA 2WUSA 3SAHA 4CJEA 4H5NA 3TAGA 2YJFA 3AV9A 1YJ9N 2UXDK 3LDPA 3OYEA 4DU3A 4DV3K 2JWKA 4M63C 4Y1CA 3UKRA 4OGCA 2PAVA 3AVGA 4DU1A 1DT9A 4DV2K 1U49A 4BE1A 4W5TA 1IG9A 1GLJO 1NK8A 1C0GA 2BGGA 3O9TA 3F9KA 3HVRA 3L2VA 3OYBA 1NOYA 2ZF5O 1NKEA 1GLEG 2HVHA 4FLXA 4JD2B 4FLZA 1X9MA 1RNHA 3KK2A 3OYKA 1TUUA 4H5VA 4O8UA 3THXA 5CHIA 1NGJA 4FJJA 3FFIA 4CIEA 2O8FA 3R1XA 3OYLA 3AVJA 2GUIA 3MCAB 2FBVA 1A5VA 3ZETA 2F7TA 5GIPA 1KLMA 1EWRA 3VEXA 3CFRA 3R6MA 1D5AA 5LY3A 3VEWA 3K0SA 1YHQN 1XQSC 4DR2K 3DLRA 3CJAA 4PWDA 4CBUA 1ZC6A 3VF4A 5DM6L 2W40A 2WC9A 4IXCA 5DK5A 4BR2A 3B6PA 4CEZA 2E8AA 2VQFK 3FZLA 1RDDA 2OZMA 2E2NA 4BREA 1U04A 3WQUA 1RBVA 3NBPA 1E4GT 5BR8K 3L2UA 3VGMA 1NNEA 1WNSA 4BDYA 1LWFA 5FPEA 2G8WA 3DRPA 3O1WA 4CJ5A 4FJNA 1NGHA 1SKWA 4B9NA 4KV8A 2UXBK 3JS6A 4DQ8A 5FLXO 3K5NA 3U9DA 3J8AA 4FLWA 1FKOA 4A2AA 4DU4A 2P9SB 1NK4A 3PIPL 4NXNK 2IGIA 3O9SA 4DV0K 2YKMA 4B1VA 2X6NA 1RDBA 1L3TA 2YHBA 2YHWA 3CCVN 3RSEB 4FJ9A 1T03A 4L3QA 2VGMA 3AVMA 4JI6K 3C7NA 3VQBA 4QAGA 3ID8A 2P9UA 2UYTA 3VMFB 4CZLA 4BQZA 1BOTO 1W2BM 3H45C 1FJGK 3ATVA 3OHRA 3O3HA 4PY5A 4DTUA 2O8EB 5JS2A 5KRTA 3NGIA 5EVZA 3OS1A 1F21A 1GOCA 4KHPK 4AF1A 1OH7A 1XHXA 1UWBA 2OTLN 5KPRA 5AQTA 5JVHL 1JLEA 3O4NA 3ASMA 4XH1A 3RR7A 4DKWA 5AQIA 4DR1K 1JCGA 3THYB 1BU6O 4N56A 5M1OA 5AQOA 5HP1A 4FLUA 1QZ6A 1Q81O 4A61A 1N8RO 3C95A 1NGCA 1N34K 2E88A 4FJ7A 2Q97A 4EFHA 1HRHA 1HNIA 4FVMA 4JKCA 2ZD1A 4DSLA 4CJKA 3KHYA 1L3SA 3IRXA 2YV0X 4H0TB 4BRIA 1SL2A 2E6LA 5AQGA 1JLGA 3HOSA 2Q1NA 3CCJN 5FRMA 2ZJPL 1TVRA 3MWTA 5KPZA 3DXMB 2FSKA 2F4VK 3M6GA 3HM9A 3LZJA 2NNWA 2WFBA 3DOLA 4YFUA 4KB0A 3GDQA 3DXKA 4I9QA 1V4TA 3O4WA 4FLVA 3DJCA 4FK0A 3HRGA 2XRIA 5JS1A 2GUPA 4B8CA 3O9RA 2UXCK 3M3ZA 1S1TA 3HI0A 4WQ5A 4KAZA 3PLAA 4CF8A 4AHUA 4BROA 4PUOA 3NE6A 3HJFA 3O1BA 4A62A 1IBKK 5EX5A 4NLBA 4DS4A 4YOWA 4B08A 3WEEA 2VWBA 5GADP 1RDCA 4CEBA 4E89A 3HVTA 5GINA 3KD5E 4HTUA 4B9VA 3I55N 2VG7A 3LP1A 3MMVA 1JJ2M 2AJQA 1KAXA 4E1JA 1RBRA 3KIOA 1T7PA 2P9NB 4KH4A 3NVKA 1BGXT 5K14A 4DV6K 1M90O 3TANA 4JI1K 3TTDA 4QS8A 4K0KK 2E1YA 2IVNA 2D1KA 5KI6A 4FWOA 4DFMA 2RN2A 3NF8A 4OLBA 4ILJA 4Z0UA 3OBWA 3V81A 5HLFA 3SK3A 3ZT3A 2WONA 1B9FA 2X74A 4A5AA 3A5LC 1HKGA 3DXMA 3EKSA 2HHUA 2AA4A 1GLDG 2E2PA 4H03B 1SKRA 3IAYA 3AVFA 3VQEA 3EZ5A 2P9LA 3LPUA 2A40A 4AHTA 4L8RB 4YORA 2YKNA 3I33A 3K2PA 3P38A 1QS4A 4OO1J 2V7YA 3ZX2A 1D4XA 4DQQA 1EQYA 1O1WA 1IV0A 4HVJA 4H5TA 1J53A 4M3TA 1S1VA 3ZSXA 2G8UA 3AA2A 3B6OA 3VA3A 3SJHA 4DFJA 4DTRA 1LWCA 1C0UA 1DTTA 5E84A 4IFYA 2QKBA 1BHLA 4BR4A 1S9EA 3PO5A 4ID1A 2E20A 4H4MA 3JAMO 5HRNA 2PYJA 4M45A 4DHYA 1VQMN 1CZ9A 3MEEA 5I42A 4GKJK 4I6MA 2H3GX 1U47A 1FXXA 5ADXA 2HNYA 4WFNL 4DTJA 4ZTJA 2E2QA 2KW4A 4F3OA 3C65A 2P9KB 3SBTA 3TAMA 1NKBA 5C15A 2IIRA 2Q3SA 4DF8A 3F9MA 2HHXA 4KPYA 5KGWA 4DSEA 1RT1A 2ZWHA 2KZZA 1ASWA 4DFKA 3N4PA 1DLOA 1RTHA 2DFHA 5JMVA 3QEIA 1Q9XA 3VF2A 4DCHA 1C0FA 1R0AA 4KTZA 4LF8K 4C8NA 3QNNA 1IKXA 3MEGA 3AO2A 1NGFA 3IS9A 3HP9A 3RMAA 3KK1A 2D0OA 2HBJA 1Q86O 3AVAA 3CPWM 4ISEA 4IDHA 4XH4A 4JK7A 2G8IA 4BVOA 3HM8A 4N47A 2HOEA 5F0XA 4DR5K 3T1YK 4LFCK 4YHHK 1YITN 4KI6A 3H1QA 4ILGB 3ENHA 3TSPA 3GBTA 4DV1K 3QIPA 1BL3A 3EY1A 4DMNA 4LF4K 3DLHA 4H0VB 4QOZB 3G71N 3CFOA 4UY8O 3MXIA 1VSKA 1C1AA 3SAGA 3MEDA 3TAQA 4W5OA 1IBLK 3SJJA 3D2EB 4HCCA 3VGKA 3WXKA 1HX1A 4FZXC 4ZHRA 2OA8A 4DR4K 2QWOA 4LSLA 3VQAA 2A3ZA 3EE9A 5AQLA 1HNZK 1SAZA 2P9KA 3VETA 3JXUA 4ISFA 2F96A 2VWJA 5AQQA 4O5BA 1E3MA 2NRHA 2DTUA 1WBBA 5AQFA 5CZ1A 3NF9A 3OS2A 4JI3K 2O4IA 4LFBK 3DOKA 1NJXA 3O08A 4Y1DA 4E7HA 4DQPA 3OYNA 1CXUA 4JS4A 3A5OC 1KAYA 1DGKN 1YXQA 4CF1A 2QM1A 3NAEA 4N41A 5FPMA 3V1QA 1HNXK 3ZX3A 2HBLA 1HYVA 3VEZA 1RBSA 1TKDA 4E1MA 3MX2A 4MO5A 3MN5A 5AQYA 3T3FA 1U4BA 1QVGM 4LH4A 4F3TA 1L3VA 1X3MA 4AH9A 1BI4A 3C6UA 4FL9A 3VESA 4DR7K 2NRTA 2IS3A 1S22A 3GL1A 4FOIA 1NLVA 1VRUA 5BN9A 3T19A 3WNEA 1WAFA 4DUZK 1NK7A 4M3RA 2KFZA 3KJVA 4CHYA 3VTIA 1WSFA 4J2EA 2P9PA 3CJBA 1WAJA 1VAZA 1IKWA 3O9QA 4WE1A 4I2PA 2ZQBA 1KQSM 4M3YA 4N76A 4B9QA 1ZYQA 4DTMA 3O4QA 4FZYA 3CQYA 3DLGA 4B9LA 3TABA 4ICLA 4JKGB 4X64K 4CK3A 4PHTX 1HKBA 4KTWA 4KH5A 1HYZA 2FXUA 4B9UA 4DV7K 4CHZA 4CD3A 1RTDA 1YTUA 2VG6A 3BZKA 1BWFO 3EL2A 1VRTA 2IOCA 4PKGA 1GLBG 3ULEB 3OBYA 1QHTA 3AA4A 1K8AO 2HHQA 1Q18A 3MX5A 1ATRA 3G25A 3LWLA 4TSXA 4YOUA 1LOTB 3K9JA 4B1WB 3ISNC 3ID6A 3QBWA 4CHOA 2O8BB 2WTUA 4JI8K 4HHTA 4BQLA 3OYFA 3O9UA 2AP1A 4F8RA 1XMOK 2ATQA 5BPLA 2PY5A 1XI1A 4Q0BA 2GBZA 5I9EB 4K25A 4H8KA 2X6SA 4I9LA 3C94A 3W0LA 3SI6A 2YHAA 5HRSA 3TSQA 4B3MK 2UUAK 4DF4A 2E1ZA 1JXBA 3QEXA 5JICA 4BWMA 3RRGA 4YDUA 5HBMA 4BC2A 2XY7A 5CZ2A 3SV3A 2I7NA 2OTJN 5J2QA 1N36K 3QB0A 1S5JA 4PQUA 3H3OB 5AFUA 4U67L 3DWLA 3CF5L 3THWA 5IWAK 4RW8A 1TK0A 5JLFA 3CJ1A 2KQ2A 4HUGA 2ITGA 3VQPA 1BCMA 4EHUA 3CJ7A 1IH7A 3ZSWA 2VG5A 3Q7BA 3CJ9A 4B3RK 2HNZA 2VGNA 4ID5A 2Q31A 3MN7A 1S9GA 3OJUA 3VENA 1I3AA 1N33K 4F2RA 4B1UB 3WXLA 3FE1A 2D5RA 2F9WA 5FPDA 3HPHA 1GLLO 1K9MO 3IKMA 4DLEA 3P1GA 1KXPA 3E9OA 1JLBA 3I8DA 2A41A 4WQ5C 4HUEA 3SQ1A 1QVFM 4CF9A 2ASOA 4CFCA 1Z6RA 3C0BA 4BDPA 3M8PA 4MDBA 5AZJB 1NG9A 5IT9O 3AVBA 3M1FA 3J81O 4C8KA 3IG1A 4BRKA 3QINA 4CBWA 3H08A 4Z4CA 4FWLA 4CFDA 1QHAA 4RWTA 1YVUA 3A2FA 1A5WA 4A57A 3AGRA 3V1OA 4BC3A 1ILYA 2ZM6K 3S3MA 1QQMA 1DKGD 2B5JA 2QWMA 2OPRA 4JHDA 4IKFA 5AQZA 4BG8A 4FWNA 2CH6A 1GOAA 2FC0A 4Q5VA 4MDAA 3CIPA 3AVIA 4CHQA 5AQMA 1NK9A 4JRQA 1VQ7N 4KO0A 3NH0A 3CHWA 4F9OA 5J2NA 1YJWN 4KI4A 3BDPA 3LWMA 3ENBA 2E2OA 2NRRA 4DFPA 5J2PA 1WSHA 1BG3A 3OS0A 3OVNA 5CY4A 3NGYA 1RILA 4R79A 4G1QA 5MLCQ 2BTFA 1TL3A 3DRSA 4CCHA 3LANA 1Z05A 2NRZA 3A5MC 3VEYA 3FLCO 4BVPA 1GOBA 2VCPA 2V52B 2CGLA 2F9TA 4BR7A 3IMXA 2QI2A 3ZSVA 2CH5A 1ZBUA 2FBTA 4JD2A 1ASVA 1J6ZA 3HZ6A 4E7KA 5CYQA 1NGBA 3QLHA 1X9JA 3AO5A 2QWNA 2YHXA 3V1RA 3I0SA 3A5NC 5EOYA 3EEQA 4DTNA 3RTVA 4AHRA 5EY4A 1VQ8N 4ZTFA 4LSNA 4MQ3A 3NHGA 1Q7YO 4FPAA 4E1NA 5M1PA 1EKEA 1Q8IA 4NYNA 3ZX0A 1QQNA 1HPZA 1XC3A 4DG1A 4WF9L 4KHQA 4FJXA 1HKCA 4J2DA 1K8KB 4KBOA 2Q0UA 1GLFO 2A42A 5AJ3K 3OYCA 3LDSA 1J54A 1NK0A 3E66A 1WSJA 3OYIA 3PX0A 2W6LA 2RHKA 3MCPA 4K8XA 3IFRA 1D9FA 4C8MA 1VQKN 5ADXH 3RMDA 3K58A 1A5XA 4GVEA 4AHSA 2OANA 4JAXA 3AVCA 3LAMA 1HYSA 3QFUA 4IJNA 4Z4FA 1VSDA 4OPAA 4NCAA 4LF6K 4JRPA 2FF3B 1N5YA 3HT3A 1OH5A 4NXMK 3L4IA 3BY5A 2P9SA 2HVIA 1C1CA 3F2KA 3OA9A 3LDLA 2P5GA 4B3TK 4LD0A 5EXWA 3SUNA 1S3XA 1W9HA 5FRNA 3RSEA 3LPTA 4FLTA 4DSIA 1OVYA 4KRFA 3NH2A 1NJIO 4B9TA 4BY9C 4JS5A 4IFEA 2LSNA 1SS6A 2O8EA 2ZGZA 4JKHA 1LAVA 1Y64A 1BA0A 4QS9A 1S1WA 3JYTA 4GV9A 1OH6A 1C1BA 2IAJA 5AR0A 2P1JA 3CERA 3VEVA 4AILC 3L2RA 1LWEA 3H1VX 2WOMA 3THYA 1DEJA 4EP4A 2Z1GA 1TAQA 1BIZA 2RF2A 1EWQA 2QXFA 2KKZA 2RPIA 4FWRA 3SUOA 2V7ZA 4C1NI 3L2QA 4Z4EA 1SV5A 3VOVA 4KHSA 4FK4A 1K8KA 5H1SQ 5CE3A 3LP2A 4U7BA 3CMEN 2DY4A 3TI0A 1ZBIA 4BGAA 1WSGA 4IOXA 2HHHK 3CYMA 4M3UA 1NM1A 4CGFA 2GWJA 3T1AA 4J8FA 1JXEA 4LH5A 1X9SA 1WUAA 5CR4A 4O4GA 2NUBA 4LY7A 3H46O 4BR0A 1NJWA 4I7FA 4CFAA 2A6AA 2BDPA 5AQHA 2RKIA 3LDOA 5GAHP 2HBKA 1R59O 5TKWA 2YHYA 4CZHA 1HQUA 4FK2A 1NGDA 4CJFA 1LV5A 3ZSQA 3CETA 3CCEN 3P83D 3CCMN 3FZMA 3S3NA 4GMJB 4UQGA 1BCOA 3TAEA 1UAXA 4HTLA 2HBMA 3ITHA 4WQ4C 1ZBSA 2B4JA 3I8BA 3O3GA 2QWLA 4BRCA 1S1XA 4CJ7A 2GTDA 3P31A 4JK8A 1XWLA 4PL8A 3EKUA 1IG8A 2Y1JA 4FVUA 3KVGA 2HHTA 1VQNN 4C8OA 4J2AA 5KRSA 2J4RA 3CPEA 1OH8A 3LZIA 3SUQA 2F8SA 1W0HA 1CZBA 3UIQA 2KTQA 2P9NA 3DLLL 3D2FB 1FW6A 4EZ9A 2YNGA 3HBTA 3CM5A 4B1ZA 5AZIB 4AQYK 1BIUA 2HB5A 3SMSA 2FSNA 3H6EA 3KLFA 1E4FT 3B8AX 2ZJRL 1FKPA 3OYJA 1G15A 1BQMA 5LMUK 1NWKA 5KGXA 3GG4A 1ITGA 2Q36A 4GY2B 3BEXA 1YJNN 4M3ZA 4CVNE 4NLCA 2Q0RA 1HNWK 1C0MA 3HYFA 3MN6A 3T7ZA 3HOTA 3V4IA 3DLKA 3OYGA 3C6HA 1VSEA 2QXLA 1TYQB 1KVCA 1IJJA 1U2VB 5F2RA 2I7PA 4CI6A 2XHBA 1ATSA 1D8YA 5SWMA 1SQKA 1SKSA 4ELVA 3F73A 4IFVA 2QEXN 3BF3A 3VQ9A 5M1KA 4KH6A 4BRDA 1UA0A 3O8MA 3FFKB 1BO5O 4PKHA 2DFFA 3CQXA 4A5BA 4JKDA 3AO1A 1C6VA 1LW0A 3LDQA 1WB9A 2OPPA 1RFQA 4IEIA 2XY6A 1TAUA 5I3UA 3AGKA 1VK0A 5C25A 1HR0K 3KLIA 2O8CB 4ILHA 3I0RA 2GWKA 1HMVA 1O13A 1QQOA 1P8ZA 1HJRA 2CGKA 3CQ8A 3FR0A 3ZSOA 3ATUA 5DMRA 3CJCA 3ZT1A 4CK1A 4JI7K 5C12A 4CHNA 5BPMA 1EX4A 4MLHA 3G0ZA 4BG9A 4YDUC 3WNGA 5AZIA 3A8YA 3TSUA 3HO1A 3V6DA 3KK7A 3LL3A 3CCLN 2GELA 4CZGA 3KLHA 2IC3A 4IOCL 2QA4N 2JLEA 4LFAK 1B92A 4LC9B 2ASPA 3NCIA 3J7YP 4MLEA 4RW7A 3VERA 3MN9A 5KQ8A 4CGGA 4DSFA 4CEQA 2HMIA 2HW3A 5AFUH 3WNFA 5M1NA 1BA1A 3H3NO 4H4OA 4JYAK 1IO2A 4V19S 3EYZA 1OKJA 5C2FA 5BN8A 1U2VA 3Q7CA 3PUFA 2GX9A 4DQIA 3AY9A 5LJWA 4OGEA 2V51B 1VSLA 4WQ4A 4CEAA 4E7IA 3EE8A 3CXCM 4DSJA 1T05A 1RT6A 4WCEL 4RW4A 5F1XA 2PBDA 3AA5X 3VQ6A 4FXDA 3OYMA 2PYLA 3P39A 4GVMA 4B9MA 1RT7A 3SAFA 3V9XA 5C0YA 4CJ4A 4BC4A 2O8DB 4JKEA 2R7YA 1VSMA 2UU9K 4DS5A 4FPBA 4KHWA 4FZZA 3D2EA 3LP3A 3SUPA 3ENOA 4BRNA 1NJZA 1VQ6N 3ZT4A 3U4LA 1RBUA 3HK2A 4BR9A 4CJVA 1NK5A 3TAFA 1EP4A 5KPTA 3K5OA 3KZBA 1JLFA 4X66K 5AQSA 1NBWA 2Z1IA 1Z26A 4C8LA 3GE1A 3SQ4A 4JI2K 1Q82O 3V9ZA 3U3GA 3KK3A 1SL0A 1U6ZA 2BE2A 3MAQA 1W7AA 4CF0A 4FLYA 1NK6A 4M7YA 4HCBA 3L3VA 2IVPA 4FSVA 1HJOA 2ITMA 3IDHA 4IO9L 4W5RA 3TR8A 3THVA 1Y97A 5LL6Z 1S6QA 3KLEA 1QSLA 3D45A 4BRAA 2DFEA 3TU5A 4G9ZA 2HHSA 4CK2A 4F2SA 2VYPA 1RTIA 1ATNA 4DB3A 3V9UA 1MWMA 4B1YB 5AQWA 4BE0A 1NGAA 4NB4A 2OYQA 4CJSA 3WUHA 2P51A 4FW2A 2W41A 2IDOA 3EO3A 4FWSA 1N32K 2BUPA 4H0OA 2B6AA 1HNVA 4FJGA 3L0QA 5AQVA 2G8FA 3THXB 3NDKA 3ALYA 3QIOA 3QEPA 3LALA 5E41A 2GEMA 2O8FB 4JKAA 1BQNA 1XNQK 1TKZA 2G8VA 1U45A 1KSPA 3QNOA 3VGLA 1X3NA 3FZFA 4Z4GA 3QERA 3E1YA 1S1UA 2ZGYA 5BREA 4CIFA 3LM2A 3RR8A 4M42A 2ASMA 5JLHA 4B1XB 5AQNA 3WXIA 4JKGA 5AQUA 4KKOA 1EO1A 5FPNA 3RVCA 4FWPA 1K6YA 4FO0A 3M8QA 4E0DA 4E7LA 5LJVA 1T8EA 4K41A 4BE2A 3PV8A 4Z4HA 1MWKA 4MO4A 1H1VA 1WBDA 4CZFA 3NF6A 1BISA 3ULEA 4FYDA 1WN7A 1J9AA 3SPZA 2E6MA 1S72N 3O80A 5C10A 1YTAA 2YJEA 1XMQK 4O55A 3TPQA 4OKEA 4FJ5A 1KVBA 4JLHA 3M8RA 4DUYK 4H0PA 3FGUA 4O0IA 2FLOA 3SLCA 3G6EN 5HL7L 3S9HA 4W5QA 1VQ9N 4W5NA 2JWLA 1KLNA 4M3WA 1KFSA 1TV6A 5AQJA 2QK9A 2ZE2A 2O8BA 3GOIA 1KD1O 3OY9A 3R3LA 3ZCMA 3E01A 5CYMA 3C6TA 4NCGA 2KLAA 4FOEA 5GIOA 3C7NB 5SZTA 3T1HK 2P9UB 3AVLA 1JCFA 5AQRA 5J1EA 4IZ9A 3N4QA 3SNNA 3OYDA 4BRFA 4CJTA 3PO4A 4XIUA 4BC5A 3SMPA 3A0IX 5KQDA 2YX6A 3UKUB 4K8ZA 3RRHA 4CGHA 1CLQA 2HSTA 2YNFA 4H5RA 4JEPA 3CM6A 5GAEP 1BDGA 3J7ZO 4M3XA 2KZMA 3UB5A 4RW6A 3NH1A 4FM2A 3PX4A 4ELTA 1RDWX 1WLJA
chains in the Genus database with same CATH topology
1NGGA 3SBGA 3CCUN 5AR0A 3CERA 1YITN 3ZYYX 2D4WA 5M1FA 2YCHA 3H1QA 3VEVA 4ILGB 3DAWA 3ENHA 3WQTA 4GNIA 3H1VX 3TSPA 1YIJN 1DEJA 1NGEA 3GBTA 4BR5A 5E26A 4JKFA 4Z94A 2KKZA 3MDQA 1VQON 4H0XB 4FWRA 3K9KA 2V7ZA 4QS7A 4C1NI 3VOVA 1YUWA 3FZKA 5AQKA 1K8KA 3CC2N 5H1SQ 5CE3A 4U7BA 3CMEN 4JNEA 4PKIA 2QWRA 1CZAN 2YI1A 4BGAA 3CCRN 4H0VB 4IOXA 3G71N 2DPNA 3QMLA 3HSCA 4UY8O 1NM1A 2HF4A 2Q2RA 3CCQN 3E9PA 3SAGA 2GWJA 1VQ4N 4IWVA 4J8FA 3D2EB 3M5RA 3VGKA 3LM9A 1WUAA 4HWIA 5CR4A 3WT0A 4BRHA 3WXKA 4WYBA 1HX1A 1BUPA 3H46O 3WXJA 4BR0A 3CD6N 2QWOA 3BF1A 1K73O 4AM7A 4FWQA 3O6WA 2A6AA 3ZETB 2A3ZA 5AQHA 4BRGA 2P9IA 3EE9A 3DXKB 5AQLA 4CD1A 1SAZA 3LDOA 5GAHP 2HBKA 2P9KA 1R59O 5M1QA 3VETA 2QWQA 3JXUA 2YHYA 5TKWA 4CZHA 4ISFA 1T44A 1NGDA 3CCSN 2KHOA 1WOQA 2A5XA 5BRHA 4FWMA 3T69A 5AQQA 5AZJA 3I56N 3MWPA 2QW9A 3QICA 3EZWA 3CETA 2NRHA 4IOAL 2D0PA 3CCEN 5AQFA 4JHDB 3CCMN 3FZMA 3WEEB 4A2BA 4HTLA 2HBMA 3E9LA 3VPZA 5BRDA 3PIOL 2NZTA 3O08A 1ZBSA 4IEEA 4WQ4C 3UKUA 3P4IA 3I8BA 1T6DA 2QWLA 4BRCA 4YOYA 2RE2A 5TKYA 3A5OC 1KAYA 1DGKN 1RGIA 1YXQA 1HPMA 2QM1A 2WUSA 4CJ7A 2GTDA 3P31A 4JK8A 4PL8A 3SAHA 3EKUA 4H5NA 5FPMA 3G4SN 1M1KO 1YJ9N 2YJFA 1IG8A 4K43A 4RCHA 3LDPA 4FVUA 3KVGA 2JWKA 4M63C 4XH5A 2NLXA 1VQNN 1RDUA 3UKRA 3ZX3A 2HBLA 2PAVA 3VEZA 1V4SA 1DT9A 2J4RA 3QFPA 3CPEA 3MX2A 4MO5A 3MN5A 5AQYA 1QVGM 1YVNA 2P9NA 3DLLL 3D2FB 1X3MA 3IUCA 1GLJO 3HBTA 4FL9A 4B1ZA 1C0GA 5AZIB 3VESA 2NRTA 4CZJA 3HTVA 1S22A 3GL1A 3O9TA 5AQPA 4FOIA 1NLVA 3SMSA 2FSNA 4GV3A 5BN9A 3H6EA 2ZF5O 1E4FT 4JKBA 3B8AX 1GLEG 5GAGP 2ZJQL 3BP8A 3VTIA 4JD2B 2ZJRL 2WBNA 2P9PA 1TUUA 3CJBA 4H5VA 1VAZA 3O9QA 3D7EO 4O8UA 4BRQA 5HOOA 1KQSM 1NWKA 3GG4A 5CHIA 2EWSA 1NGJA 4WFBL 4B9QA 2Q36A 3CMAN 3S41A 4GY2B 3BEXA 3R1XA 3CQYA 1YJNN 2P9LB 4NLCA 2Q0RA 3MCAB 4JKGB 3T7ZA 3MN6A 3ZETA 2F7TA 4PHTX 3HOTA 1HKBA 5GIPA 3C6HA 2QXLA 3VEXA 4KH5A 1GLCG 1TYQB 3R6MA 5LY3A 1IJJA 2FXUA 1U2VB 5F2RA 2I7PA 3VEWA 4CI6A 1YHQN 1ATSA 1XQSC 1SQKA 4C1NK 4CD3A 3CJAA 1YAGA 3NMUA 4CBUA 1BWFO 1ZC6A 3VF4A 4EIAA 3BF3A 5DM6L 2QEXN 2W40A 2WC9A 4KH6A 4BRDA 5M1KA 3EL2A 3O8MA 4IXCA 3QDKA 3FFKB 4PKGA 4BR2A 1VQLN 1GLBG 4BGBA 3ULEB 1BO5O 2E8AA 4PKHA 3FZLA 3CQXA 4A5BA 4JKDA 3OBYA 2E2NA 3LDQA 4BREA 3WQUA 1K8AO 1E4GT 1Q18A 3R8EA 3MX5A 3VGMA 1ATRA 3G25A 1RFQA 4IEIA 1T6CA 5FPEA 3AGKA 3KWIA 4PL7A 4XEIA 3O1WA 4ILHA 4YOUA 2GWKA 3TTFA 1LOTB 3K9JA 4I6MB 1O13A 1NGHA 1QQOA 4JK9A 4B1WB 1P8ZA 2CGKA 1YI2N 3ID6A 3FR0A 3ATUA 3AARA 3QBWA 2QWPA 5C2DA 3JS6A 3CJCA 4DQ8A 4BQLA 5C12A 3CC4N 4CZKA 4IJAA 3O9UA 2AP1A 4O5FA 3U9DA 3J8AA 3TTCA 5BPMA 4MLHA 4A2AA 5BPLA 2P9SB 3VTHA 4BRPA 3PIPL 4BG9A 4ISGA 4YDUC 3O9SA 5I9EB 4K25A 5AZIA 4B1VA 3F5TA 2YHWA 3A8YA 3TSUA 4CZIA 3CCVN 3RSEB 4L3QA 3W0LA 2VGMA 3KK7A 3C7NA 3LL3A 3ID8A 2P9UA 2UYTA 3TSQA 3CCLN 2GELA 3VMFB 4BQZA 4CZLA 1BOTO 4CZGA 1W2BM 3H45C 2CGJA 2E1ZA 3ATVA 3OHRA 4IOCL 2QA4N 4LC9B 2ASPA 5JICA 4MLEA 5EVZA 3VERA 3MN9A 5KQ8A 4YDUA 4BC2A 4CBXA 4AF1A 4CZEA 3LDNA 2I7NA 2OTLN 5AFUH 5BRFA 5KPRA 5AQTA 2OTJN 5JVHL 3QB0A 5M1NA 1ZXOA 1W97L 4XH1A 3H3OB 5AQIA 4DKWA 4U67L 1BA1A 3DWLA 3QBXA 3H3NO 5AFUA 3CF5L 1JCGA 1OKJA 5C2FA 5BN8A 1BU6O 1U2VA 5M1OA 5AQOA 1QZ6A 5BR9A 3Q7CA 4A61A 5JLFA 3CJ1A 1Q81O 1N8RO 2GX9A 1QZ5A 4EHTA 1NGCA 3AY9A 5LJWA 2E88A 4H5WA 2V51B 4WQ4A 2Q97A 3EE8A 4EFHA 4EHUA 3VF6A 4WFAL 3CXCM 2BH1A 3CJ7A 4YOVA 3KWGA 4WCEL 4JKCA 5DM7L 5F1XA 3Q7BA 2PBDA 3CJ9A 4O8KA 3U9ZA 2VGNA 2Q31A 3KHYA 3MN7A 3P39A 3OW2M 3VENA 3SAFA 4H0TB 4BRIA 1YF5L 5C0YA 4B1UB 3WXLA 5AQGA 3FE1A 3HOSA 2Q1NA 4BC4A 2F9WA 3AAQA 3C6AA 3O5BA 4JKEA 1GLLO 4NO7A 3ZEUB 5FPDA 3CCJN 1K9MO 2ZJPL 4IO8A 4FPBA 3IKMA 2HF3A 3MWTA 5KPZA 3DXMB 2FSKA 3D2EA 1KXPA 3E9OA 3M6GA 3CI5A 2A41A 4WQ5C 1T3VA 1QVFM 2ASOA 3ENOA 4BRNA 2NNWA 2WFBA 1Z6RA 1VQ6N 3U4LA 3C0BA 4YOXA 4MDBA 5AZJB 4BR9A 3GDQA 1MDUB 3M1FA 4C23A 1VQ5N 3DXKA 3CC7N 3L6QA 1V4TA 4BRKA 3O4WA 4CBWA 5KPTA 3DJCA 3HRGA 3KZBA 2GUPA 4GV6A 4FWLA 3O9RA 1QHAA 3M3ZA 5JVGL 5AQSA 4RWTA 1NBWA 3HI0A 4WQ5A 4A57A 3GE1A 3PLAA 4BROA 3AGRA 2FSJA 4BC3A 1ILYA 1QQMA 1DKGD 3O1BA 1Q82O 2QWMA 4A62A 5EX5A 4NLBA 4JHDA 5B8HA 4YOWA 3WEEA 2VWBA 5GADP 1U6ZA 5AQZA 4BG8A 4FWNA 5GINA 5ELZA 1LCUA 2NRWA 2CH6A 1NMDA 3I55N 4M7YA 3MMVA 4MDAA 3CIPA 1JJ2M 2IVPA 5AQMA 4FSVA 1HJOA 1KAXA 1VQ7N 2ITMA 4E1JA 3CHWA 3IDHA 4F9OA 3D6RA 4IO9L 1YJWN 1HUXA 3ENBA 2E2OA 2NRRA 1VQPN 2P9NB 1BG3A 4BRAA 3TU5A 4G9ZA 4KH4A 3AAPA 4R79A 2VYPA 4DB3A 1ATNA 3NVKA 1MWMA 4B1YB 2PFUA 5AQWA 3W3DA 5MLCQ 1M90O 2BTFA 1NGAA 4NB4A 3TTDA 1NGIA 4QS8A 3WUHA 3D2FA 2W41A 1Z05A 4BRMA 2NRZA 2E1YA 2IVNA 3A5MC 3VEYA 3FLCO 1TUYA 2D1KA 3L4QA 4BVPA 4AM6A 3EO3A 2P9PB 4FWSA 2VCPA 2V52B 2CGLA 2F9TA 4FWOA 2BUPA 4H0OA 4BR7A 3L0QA 3IMXA 4OPHA 4ILJA 5AQVA 2QI2A 1ESVA 2IVOA 3WXMB 3OBWA 2CH5A 2HMPA 4JD2A 3ZEUA 1J6ZA 3HZ6A 2GEMA 3SK3A 3FZHA 4JKAA 1NGBA 1X9JA 4A5AA 3A5LC 4Y0WA 1HKGA 1X3NA 2QWNA 2YHXA 3DXMA 3EKSA 3FZFA 3VGLA 3E1YA 2AA4A 2FF6A 2ZGYA 5BREA 1GLDG 2E2PA 3LM2A 4H03B 3BUZB 3A5NC 5EOYA 2ASMA 5JLHA 2P9LA 5EY4A 4B1XB 4EAHD 5AQNA 3WXIA 3R9PA 4JKGA 5AQUA 2NRXA 1VQ8N 2A40A 1EO1A 1KC8O 4YORA 3I33A 3P38A 5FPNA 4CZMA 1G99A 4OO1J 3NVMA 1TYQA 3RVCA 2V7YA 4FWPA 4FO0A 3ZX2A 4A59A 1Q7YO 1D4XA 4FPAA 1EQYA 5M1PA 3EN9A 4H5TA 3ZX0A 5LJVA 4WF9L 1QQNA 1XC3A 4K41A 1HKCA 3U8XA 1K8KB 4KBOA 2Q0UA 1GLFO 1MWKA 1GLAG 4MO4A 1H1VA 1P90A 3SJHA 4CZFA 2A42A 3ULEA 3E66A 1S72N 3O80A 5E84A 5C10A 2YJEA 3VEOA 2NRVA 3TPQA 1KAZA 2RHKA 3MCPA 4BR4A 4H0PA 3IFRA 2E20A 3FGUA 4DHYA 2FLOA 1VQMN 3SLCA 3G6EN 1VQKN 5ADXH 5HL7L 1HLUA 4I6MA 1VQ9N 2H3GX 1XUPO 2JWLA 5ADXA 4GVEA 4WFNL 1JCEA 2OANA 2E2QA 2P9IB 5AQJA 3C65A 4JAXA 2P9KB 3SBTA 3QFUA 3UE5A 1SZ2A 4IJNA 2QTDA 4BRLA 5C15A 3GOIA 2IIRA 1KD1O 3R3LA 4OPAA 3F9MA 5F0XA 2FF3B 2KLAA 3L4IA 4FOEA 5GIOA 3C7NB 4FWKA 2P9SA 2P9UB 4JN4A 2ZWHA 1JCFA 3F2KA 5AQRA 3OA9A 3LDLA 4IZ9A 3N4QA 5EXWA 1S3XA 3N4PA 5BPNA 4YOTA 4BRFA 5JMVA 3RSEA 1OVYA 3VF2A 4BC5A 1C0FA 3SMPA 3A0IX 4DCHA 1NJIO 5KQDA 2YX6A 4BY9C 5AQXA 3UKUB 4M7XA 1NGFA 4IFEA 2HSTA 4H5RA 4JEPA 1SS6A 4K42A 2D0OA 2HBJA 1Q86O 2ZGZA 3CPWM 5GAEP 4ISEA 1BDGA 4IDHA 4JK7A 4XH4A 3J7ZO 4BVOA 3UB5A 3HM8A 4JKHA 1Y64A 1BA0A 4QS9A 4RTFD 1RDWX 4H0YB 4GV9A 3UKRB 1MA9B 2HOEA 3MK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3V A;  1RDU A;  1P90 A;  1O13 A;  2KLA A;  2YX6 A;  2QTD A;  2WFB A;  1EO1 A;  2RE2 A; 
#chains in the Genus database with same CATH topology
 3SBG A;  3ZYY X;  5M1F A;  2YCH A;  3S3O A;  3DAW A;  3J7A P;  1RT4 A;  2QKK A;  3WQT A;  1YIJ N;  4CES A;  4BR5 A;  5E26 A;  4JKF A;  1WSI A;  3K5M A;  4H0X B;  3MXM A;  4FJH A;  3DMJ A;  5AQK A;  3U3Y A;  4PKI A;  4AHV A;  4M41 A;  1CZA N;  3CCR N;  1VSH A;  2DPN A;  3HSC A;  3QML A;  4DSK A;  2HF4 A;  2Q2R A;  2G8H A;  3CCQ N;  3L2W A;  4IWV A;  5HRP A;  3M5R A;  4DQR A;  2EHG A;  3WT0 A;  4WYB A;  3LAK A;  4FM0 A;  3WXJ A;  1FK9 A;  1TGO A;  3BF1 A;  1TKX A;  4AM7 A;  4FM1 A;  1L3U A;  3VQQ A;  2BAN A;  1EXQ A;  3DXK B;  4KHN A;  4CD1 A;  4CEO A;  1VSJ A;  3VQC A;  2QWQ A;  2W6K A;  3SPY A;  3ZSY A;  1T44 A;  3CCS N;  2KHO A;  1WOQ A;  2A5X A;  5BRH A;  4FWM A;  4IDK A;  5AZJ A;  3I56 N;  2QW9 A;  3DYA A;  4CIG A;  4IOA L;  4B9S A;  5D3G A;  3NFA A;  3WEE B;  4O0J A;  1HQE A;  4CFB A;  1RT3 A;  3PSF A;  3E9L A;  1VHX A;  3UKU A;  4OKJ A;  3P5J A;  4CJR A;  1T6D A;  2ETJ A;  4YOY A;  3HXM A;  2RE2 A;  1RGI A;  4RG8 A;  4CGI A;  1HPM A;  1RT2 A;  3BGR A;  1M1K O;  3G4S N;  3QO9 A;  4K43 A;  4RCH A;  4XH5 A;  2NLX A;  1RDU A;  5HRO A;  3SV4 A;  1V4S A;  3NF7 A;  4FJI A;  3QFP A;  4CW7 B;  1RBT A;  3AVH A;  1YVN A;  4CER A;  4QCL A;  4N5S A;  4FW1 A;  3IUC A;  1TK5 A;  4CZJ A;  3HTV A;  5AQP A;  1MU2 A;  4NYF A;  1JLA A;  4GV3 A;  5LMN K;  4DLG A;  3OTO K;  4JKB A;  3KKR A;  5GAG P;  1Z25 A;  3KKS A;  2ZJQ L;  3BP8 A;  1KRP A;  2WBN A;  3RMC A;  3D7E O;  4BRQ A;  5HOO A;  1VSI A;  2EWS A;  4WFB L;  3BZC A;  3CMA N;  3S41 A;  4DV5 K;  2P9L B;  2XO7 A;  2Z1H A;  3QEV A;  3AO3 A;  4CE9 A;  1GLC G;  5FDL A;  2HHV A;  1NJY A;  2FBX A;  3RWU A;  4YNQ A;  2XY5 A;  1NU0 A;  3DRR A;  4C1N K;  4CEF A;  4OKK A;  1YAG A;  3NMU A;  1LAW A;  4CJQ A;  4EIA A;  1VSF A;  4Z4I A;  4BAC A;  3V9W A;  5FRO A;  3QDK A;  3K59 A;  1VQL N;  4BGB A;  1QSY A;  4FCY A;  4F4K A;  1WSE A;  1N6Q A;  3R8E A;  1Q9Y A;  4CJW A;  1JLC A;  4I2Q A;  1T6C A;  3KWI A;  4PL7 A;  4XEI A;  3TTF A;  4CEE A;  2OCE A;  1JLQ A;  4I6M B;  1NMN A;  4JK9 A;  1YI2 N;  4AHC A;  4E7J A;  2OPQ A;  3AAR A;  2QWP A;  5C2D A;  3ZLJ A;  2EX3 A;  3PY8 A;  3DM2 A;  3CC4 N;  3MEC A;  4CZK A;  4IJA A;  4O5F A;  3K57 A;  3TTC A;  3L3U A;  2YNH A;  3VTH A;  2W42 A;  4BRP A;  4ISG A;  3VQ4 A;  4IG3 A;  1L5U A;  2PZS A;  2Z1J A;  2VWK A;  3F5T A;  4CZI A;  4CED A;  2G8K A;  1KCF A;  4B3S K;  3J80 O;  2UUB K;  3AVK A;  1QSS A;  1IBM K;  2CGJ A;  1UA1 A;  3M8S A;  1X9W A;  1IKY A;  1D9D A;  4OVL A;  4DR3 K;  4CBX A;  4CZE A;  3LDN A;  5BRF A;  3SQ0 A;  1S6P A;  1QTM A;  1ZXO A;  1W97 L;  1XHZ A;  4JI5 K;  3QBX A;  4DTO A;  3QES A;  5BR9 A;  4KB1 A;  2UUC K;  1QZ5 A;  5T7B A;  4EHT A;  1REV A;  1OVQ A;  3TWH A;  4H5W A;  1RDA A;  4OJR A;  4EP5 A;  3VF6 A;  4WFA L;  2Y1I A;  2BH1 A;  4YOV A;  3HP6 A;  3KWG A;  5DM7 L;  3NGZ A;  4X65 K;  3U9Z A;  3L8B A;  4O8K A;  3VQD A;  3OW2 M;  3HL8 A;  1XNR K;  4CEC A;  5C24 A;  4O44 A;  1TL1 A;  1UOC A;  3PX6 A;  1EET A;  1YF5 L;  1NKC A;  4FJM A;  3AAQ A;  3C6A A;  3O5B A;  4NO7 A;  3ZEU B;  3SQ2 A;  4LF7 K;  3OJS A;  4IO8 A;  2HF3 A;  2GV9 A;  3CI5 A;  5EU7 A;  4CJP A;  1T3V A;  3CG7 A;  4JV5 K;  4GW6 A;  4DV4 K;  5HRR A;  1U48 A;  3LP0 A;  4YOX A;  4FJ8 A;  1MDU B;  4C23 A;  1VQ5 N;  3CC7 N;  3L6Q A;  4RW9 A;  2A1S A;  3WNH A;  1KFD A;  2X78 A;  4BWJ A;  4GV6 A;  3HPG A;  5A2Q O;  5JVG L;  3KLG A;  2FSJ A;  5B8H A;  2F8T A;  4DTX A;  3OYA A;  2YNI A;  3VQ5 A;  1QQC A;  5ELZ A;  1LCU A;  2NRW A;  1NMD A;  1LW2 A;  3TAR A;  2A1R A;  1B9D A;  4OPK A;  3DLB A;  3D6R A;  1XC9 A;  1HUX A;  3ULD A;  1NOZ A;  1TKT A;  1VQP N;  2XY8 A;  2HND A;  1BI4 B;  4CGJ A;  3AAP A;  4JI0 K;  3G10 A;  1YT3 A;  2PFU A;  3W3D A;  1RCH A;  3HPO A;  2D0B A;  4DWI A;  1NGI A;  3D2F A;  4FJK A;  4BRM A;  4LF5 K;  1TUY A;  3L4Q A;  4AM6 A;  2P9P B;  4KFB A;  2I5J A;  2P5O A;  4DTP A;  4OPH A;  1RTJ A;  1ESV A;  2IVO A;  3WXM B;  2HMP A;  3ZEU A;  3D0P A;  3FZH A;  1I94 K;  4IBN A;  4Y0W A;  3JSM A;  1IKV A;  2FF6 A;  5C42 A;  3BUZ B;  4CGD A;  3AA3 A;  3V9S A;  4EAH D;  3R9P A;  4R5P A;  2NRX A;  1KC8 O;  4CZM A;  1G99 A;  3SYZ A;  3NVM A;  1TYQ A;  1JKH A;  4A59 A;  3VN5 A;  3EN9 A;  2FBY A;  4CJL A;  3AO4 A;  4ELU A;  3U8X A;  2KFN A;  1CXQ A;  1GLA G;  1P90 A;  2D0C A;  4IG0 A;  3KD1 E;  1SUQ A;  3VEO A;  2NRV A;  3ZT2 A;  1KAZ A;  4DTS A;  1TK8 A;  4HUF A;  4NCB A;  4KHU A;  2O8C A;  1HLU A;  2O4G A;  4EZ6 A;  3KTQ A;  4B3O A;  1XUP O;  4X62 K;  3ZT0 A;  1JCE A;  2P9I B;  1JL2 A;  2VQE K;  2JGU A;  3UE5 A;  1SZ2 A;  2QTD A;  4BRL A;  2OPS A;  4DR6 K;  2OZS A;  4FWK A;  1ASU A;  3HST B;  4LF9 K;  4JN4 A;  4OLA A;  5BPN A;  1ZBL A;  4YOT A;  3DI6 A;  4CF2 A;  4CJU A;  5AQX A;  4M7X A;  4CHP A;  4OPJ A;  4K42 A;  1KVA A;  4E19 A;  3THW B;  4RTF D;  3DLE A;  4H0Y B;  4E3S A;  3UKR B;  1MA9 B;  3MK6 A;  1NGG A;  3CCU N;  5KTQ A;  2D4W A;  3QET A;  3RMB A;  3ZSR A;  4OX9 K;  4GNI A;  4KHY A;  1NGE A;  4J2B A;  4GKK K;  1KTQ A;  4CJ3 A;  4MFB A;  1I39 A;  4Z94 A;  2HHW A;  3MDQ A;  1DTQ A;  1VQO N;  3K9K A;  4QS7 A;  1YUW A;  3FZK A;  3CC2 N;  3QEW A;  4JNE A;  3CFP A;  2QWR A;  3MXJ A;  1QE1 A;  4B8A B;  2YI1 A;  3VA0 A;  4KRE A;  4KTQ A;  3E9P A;  1VQ4 N;  1X1P A;  3LM9 A;  4HWI A;  4BRH A;  1ZBF A;  3PSI A;  2O8D A;  2E5L K;  1BUP A;  1SL1 A;  3CD6 N;  3ZSZ A;  3AVN A;  1K73 O;  4FWQ A;  3O6W A;  3ZET B;  4BRG A;  2P9I A;  1JL1 A;  4JI4 K;  3SCX A;  3VQ7 A;  5M1Q A;  1ZBH A;  1C0T A;  5J2M A;  1J5O A;  3T69 A;  3U6F A;  1J5E K;  3MWP A;  3QIC A;  2E4L A;  3VQ8 A;  3EZW A;  2D0P A;  3OYH A;  2D0A A;  3K5L A;  4JHD B;  4PA1 A;  4DQS A;  3TAP A;  3SZ2 A;  3O3F A;  4A2B A;  1RT5 A;  4FJL A;  3VPZ A;  5BRD A;  3PIO L;  2NZT A;  4IEE A;  3P4I A;  4YY3 K;  5TKY A;  4BDZ A;  2WUS A;  3SAH A;  4CJE A;  4H5N A;  3TAG A;  2YJF A;  3AV9 A;  1YJ9 N;  2UXD K;  3LDP A;  3OYE A;  4DU3 A;  4DV3 K;  2JWK A;  4M63 C;  4Y1C A;  3UKR A;  4OGC A;  2PAV A;  3AVG A;  4DU1 A;  1DT9 A;  4DV2 K;  1U49 A;  4BE1 A;  4W5T A;  1IG9 A;  1GLJ O;  1NK8 A;  1C0G A;  2BGG A;  3O9T A;  3F9K A;  3HVR A;  3L2V A;  3OYB A;  1NOY A;  2ZF5 O;  1NKE A;  1GLE G;  2HVH A;  4FLX A;  4JD2 B;  4FLZ A;  1X9M A;  1RNH A;  3KK2 A;  3OYK A;  1TUU A;  4H5V A;  4O8U A;  3THX A;  5CHI A;  1NGJ A;  4FJJ A;  3FFI A;  4CIE A;  2O8F A;  3R1X A;  3OYL A;  3AVJ A;  2GUI A;  3MCA B;  2FBV A;  1A5V A;  3ZET A;  2F7T A;  5GIP A;  1KLM A;  1EWR A;  3VEX A;  3CFR A;  3R6M A;  1D5A A;  5LY3 A;  3VEW A;  3K0S A;  1YHQ N;  1XQS C;  4DR2 K;  3DLR A;  3CJA A;  4PWD A;  4CBU A;  1ZC6 A;  3VF4 A;  5DM6 L;  2W40 A;  2WC9 A;  4IXC A;  5DK5 A;  4BR2 A;  3B6P A;  4CEZ A;  2E8A A;  2VQF K;  3FZL A;  1RDD A;  2OZM A;  2E2N A;  4BRE A;  1U04 A;  3WQU A;  1RBV A;  3NBP A;  1E4G T;  5BR8 K;  3L2U A;  3VGM A;  1NNE A;  1WNS A;  4BDY A;  1LWF A;  5FPE A;  2G8W A;  3DRP A;  3O1W A;  4CJ5 A;  4FJN A;  1NGH A;  1SKW A;  4B9N A;  4KV8 A;  2UXB K;  3JS6 A;  4DQ8 A;  5FLX O;  3K5N A;  3U9D A;  3J8A A;  4FLW A;  1FKO A;  4A2A A;  4DU4 A;  2P9S B;  1NK4 A;  3PIP L;  4NXN K;  2IGI A;  3O9S A;  4DV0 K;  2YKM A;  4B1V A;  2X6N A;  1RDB A;  1L3T A;  2YHB A;  2YHW A;  3CCV N;  3RSE B;  4FJ9 A;  1T03 A;  4L3Q A;  2VGM A;  3AVM A;  4JI6 K;  3C7N A;  3VQB A;  4QAG A;  3ID8 A;  2P9U A;  2UYT A;  3VMF B;  4CZL A;  4BQZ A;  1BOT O;  1W2B M;  3H45 C;  1FJG K;  3ATV A;  3OHR A;  3O3H A;  4PY5 A;  4DTU A;  2O8E B;  5JS2 A;  5KRT A;  3NGI A;  5EVZ A;  3OS1 A;  1F21 A;  1GOC A;  4KHP K;  4AF1 A;  1OH7 A;  1XHX A;  1UWB A;  2OTL N;  5KPR A;  5AQT A;  5JVH L;  1JLE A;  3O4N A;  3ASM A;  4XH1 A;  3RR7 A;  4DKW A;  5AQI A;  4DR1 K;  1JCG A;  3THY B;  1BU6 O;  4N56 A;  5M1O A;  5AQO A;  5HP1 A;  4FLU A;  1QZ6 A;  1Q81 O;  4A61 A;  1N8R O;  3C95 A;  1NGC A;  1N34 K;  2E88 A;  4FJ7 A;  2Q97 A;  4EFH A;  1HRH A;  1HNI A;  4FVM A;  4JKC A;  2ZD1 A;  4DSL A;  4CJK A;  3KHY A;  1L3S A;  3IRX A;  2YV0 X;  4H0T B;  4BRI A;  1SL2 A;  2E6L A;  5AQG A;  1JLG A;  3HOS A;  2Q1N A;  3CCJ N;  5FRM A;  2ZJP L;  1TVR A;  3MWT A;  5KPZ A;  3DXM B;  2FSK A;  2F4V K;  3M6G A;  3HM9 A;  3LZJ A;  2NNW A;  2WFB A;  3DOL A;  4YFU A;  4KB0 A;  3GDQ A;  3DXK A;  4I9Q A;  1V4T A;  3O4W A;  4FLV A;  3DJC A;  4FK0 A;  3HRG A;  2XRI A;  5JS1 A;  2GUP A;  4B8C A;  3O9R A;  2UXC K;  3M3Z A;  1S1T A;  3HI0 A;  4WQ5 A;  4KAZ A;  3PLA A;  4CF8 A;  4AHU A;  4BRO A;  4PUO A;  3NE6 A;  3HJF A;  3O1B A;  4A62 A;  1IBK K;  5EX5 A;  4NLB A;  4DS4 A;  4YOW A;  4B08 A;  3WEE A;  2VWB A;  5GAD P;  1RDC A;  4CEB A;  4E89 A;  3HVT A;  5GIN A;  3KD5 E;  4HTU A;  4B9V A;  3I55 N;  2VG7 A;  3LP1 A;  3MMV A;  1JJ2 M;  2AJQ A;  1KAX A;  4E1J A;  1RBR A;  3KIO A;  1T7P A;  2P9N B;  4KH4 A;  3NVK A;  1BGX T;  5K14 A;  4DV6 K;  1M90 O;  3TAN A;  4JI1 K;  3TTD A;  4QS8 A;  4K0K K;  2E1Y A;  2IVN A;  2D1K A;  5KI6 A;  4FWO A;  4DFM A;  2RN2 A;  3NF8 A;  4OLB A;  4ILJ A;  4Z0U A;  3OBW A;  3V81 A;  5HLF A;  3SK3 A;  3ZT3 A;  2WON A;  1B9F A;  2X74 A;  4A5A A;  3A5L C;  1HKG A;  3DXM A;  3EKS A;  2HHU A;  2AA4 A;  1GLD G;  2E2P A;  4H03 B;  1SKR A;  3IAY A;  3AVF A;  3VQE A;  3EZ5 A;  2P9L A;  3LPU A;  2A40 A;  4AHT A;  4L8R B;  4YOR A;  2YKN A;  3I33 A;  3K2P A;  3P38 A;  1QS4 A;  4OO1 J;  2V7Y A;  3ZX2 A;  1D4X A;  4DQQ A;  1EQY A;  1O1W A;  1IV0 A;  4HVJ A;  4H5T A;  1J53 A;  4M3T A;  1S1V A;  3ZSX A;  2G8U A;  3AA2 A;  3B6O A;  3VA3 A;  3SJH A;  4DFJ A;  4DTR A;  1LWC A;  1C0U A;  1DTT A;  5E84 A;  4IFY A;  2QKB A;  1BHL A;  4BR4 A;  1S9E A;  3PO5 A;  4ID1 A;  2E20 A;  4H4M A;  3JAM O;  5HRN A;  2PYJ A;  4M45 A;  4DHY A;  1VQM N;  1CZ9 A;  3MEE A;  5I42 A;  4GKJ K;  4I6M A;  2H3G X;  1U47 A;  1FXX A;  5ADX A;  2HNY A;  4WFN L;  4DTJ A;  4ZTJ A;  2E2Q A;  2KW4 A;  4F3O A;  3C65 A;  2P9K B;  3SBT A;  3TAM A;  1NKB A;  5C15 A;  2IIR A;  2Q3S A;  4DF8 A;  3F9M A;  2HHX A;  4KPY A;  5KGW A;  4DSE A;  1RT1 A;  2ZWH A;  2KZZ A;  1ASW A;  4DFK A;  3N4P A;  1DLO A;  1RTH A;  2DFH A;  5JMV A;  3QEI A;  1Q9X A;  3VF2 A;  4DCH A;  1C0F A;  1R0A A;  4KTZ A;  4LF8 K;  4C8N A;  3QNN A;  1IKX A;  3MEG A;  3AO2 A;  1NGF A;  3IS9 A;  3HP9 A;  3RMA A;  3KK1 A;  2D0O A;  2HBJ A;  1Q86 O;  3AVA A;  3CPW M;  4ISE A;  4IDH A;  4XH4 A;  4JK7 A;  2G8I A;  4BVO A;  3HM8 A;  4N47 A;  2HOE A;  5F0X A;  4DR5 K;  3T1Y K;  4LFC K;  4YHH K;  1YIT N;  4KI6 A;  3H1Q A;  4ILG B;  3ENH A;  3TSP A;  3GBT A;  4DV1 K;  3QIP A;  1BL3 A;  3EY1 A;  4DMN A;  4LF4 K;  3DLH A;  4H0V B;  4QOZ B;  3G71 N;  3CFO A;  4UY8 O;  3MXI A;  1VSK A;  1C1A A;  3SAG A;  3MED A;  3TAQ A;  4W5O A;  1IBL K;  3SJJ A;  3D2E B;  4HCC A;  3VGK A;  3WXK A;  1HX1 A;  4FZX C;  4ZHR A;  2OA8 A;  4DR4 K;  2QWO A;  4LSL A;  3VQA A;  2A3Z A;  3EE9 A;  5AQL A;  1HNZ K;  1SAZ A;  2P9K A;  3VET A;  3JXU A;  4ISF A;  2F96 A;  2VWJ A;  5AQQ A;  4O5B A;  1E3M A;  2NRH A;  2DTU A;  1WBB A;  5AQF A;  5CZ1 A;  3NF9 A;  3OS2 A;  4JI3 K;  2O4I A;  4LFB K;  3DOK A;  1NJX A;  3O08 A;  4Y1D A;  4E7H A;  4DQP A;  3OYN A;  1CXU A;  4JS4 A;  3A5O C;  1KAY A;  1DGK N;  1YXQ A;  4CF1 A;  2QM1 A;  3NAE A;  4N41 A;  5FPM A;  3V1Q A;  1HNX K;  3ZX3 A;  2HBL A;  1HYV A;  3VEZ A;  1RBS A;  1TKD A;  4E1M A;  3MX2 A;  4MO5 A;  3MN5 A;  5AQY A;  3T3F A;  1U4B A;  1QVG M;  4LH4 A;  4F3T A;  1L3V A;  1X3M A;  4AH9 A;  1BI4 A;  3C6U A;  4FL9 A;  3VES A;  4DR7 K;  2NRT A;  2IS3 A;  1S22 A;  3GL1 A;  4FOI A;  1NLV A;  1VRU A;  5BN9 A;  3T19 A;  3WNE A;  1WAF A;  4DUZ K;  1NK7 A;  4M3R A;  2KFZ A;  3KJV A;  4CHY A;  3VTI A;  1WSF A;  4J2E A;  2P9P A;  3CJB A;  1WAJ A;  1VAZ A;  1IKW A;  3O9Q A;  4WE1 A;  4I2P A;  2ZQB A;  1KQS M;  4M3Y A;  4N76 A;  4B9Q A;  1ZYQ A;  4DTM A;  3O4Q A;  4FZY A;  3CQY A;  3DLG A;  4B9L A;  3TAB A;  4ICL A;  4JKG B;  4X64 K;  4CK3 A;  4PHT X;  1HKB A;  4KTW A;  4KH5 A;  1HYZ A;  2FXU A;  4B9U A;  4DV7 K;  4CHZ A;  4CD3 A;  1RTD A;  1YTU A;  2VG6 A;  3BZK A;  1BWF O;  3EL2 A;  1VRT A;  2IOC A;  4PKG A;  1GLB G;  3ULE B;  3OBY A;  1QHT A;  3AA4 A;  1K8A O;  2HHQ A;  1Q18 A;  3MX5 A;  1ATR A;  3G25 A;  3LWL A;  4TSX A;  4YOU A;  1LOT B;  3K9J A;  4B1W B;  3ISN C;  3ID6 A;  3QBW A;  4CHO A;  2O8B B;  2WTU A;  4JI8 K;  4HHT A;  4BQL A;  3OYF A;  3O9U A;  2AP1 A;  4F8R A;  1XMO K;  2ATQ A;  5BPL A;  2PY5 A;  1XI1 A;  4Q0B A;  2GBZ A;  5I9E B;  4K25 A;  4H8K A;  2X6S A;  4I9L A;  3C94 A;  3W0L A;  3SI6 A;  2YHA A;  5HRS A;  3TSQ A;  4B3M K;  2UUA K;  4DF4 A;  2E1Z A;  1JXB A;  3QEX A;  5JIC A;  4BWM A;  3RRG A;  4YDU A;  5HBM A;  4BC2 A;  2XY7 A;  5CZ2 A;  3SV3 A;  2I7N A;  2OTJ N;  5J2Q A;  1N36 K;  3QB0 A;  1S5J A;  4PQU A;  3H3O B;  5AFU A;  4U67 L;  3DWL A;  3CF5 L;  3THW A;  5IWA K;  4RW8 A;  1TK0 A;  5JLF A;  3CJ1 A;  2KQ2 A;  4HUG A;  2ITG A;  3VQP A;  1BCM A;  4EHU A;  3CJ7 A;  1IH7 A;  3ZSW A;  2VG5 A;  3Q7B A;  3CJ9 A;  4B3R K;  2HNZ A;  2VGN A;  4ID5 A;  2Q31 A;  3MN7 A;  1S9G A;  3OJU A;  3VEN A;  1I3A A;  1N33 K;  4F2R A;  4B1U B;  3WXL A;  3FE1 A;  2D5R A;  2F9W A;  5FPD A;  3HPH A;  1GLL O;  1K9M O;  3IKM A;  4DLE A;  3P1G A;  1KXP A;  3E9O A;  1JLB A;  3I8D A;  2A41 A;  4WQ5 C;  4HUE A;  3SQ1 A;  1QVF M;  4CF9 A;  2ASO A;  4CFC A;  1Z6R A;  3C0B A;  4BDP A;  3M8P A;  4MDB A;  5AZJ B;  1NG9 A;  5IT9 O;  3AVB A;  3M1F A;  3J81 O;  4C8K A;  3IG1 A;  4BRK A;  3QIN A;  4CBW A;  3H08 A;  4Z4C A;  4FWL A;  4CFD A;  1QHA A;  4RWT A;  1YVU A;  3A2F A;  1A5W A;  4A57 A;  3AGR A;  3V1O A;  4BC3 A;  1ILY A;  2ZM6 K;  3S3M A;  1QQM A;  1DKG D;  2B5J A;  2QWM A;  2OPR A;  4JHD A;  4IKF A;  5AQZ A;  4BG8 A;  4FWN A;  2CH6 A;  1GOA A;  2FC0 A;  4Q5V A;  4MDA A;  3CIP A;  3AVI A;  4CHQ A;  5AQM A;  1NK9 A;  4JRQ A;  1VQ7 N;  4KO0 A;  3NH0 A;  3CHW A;  4F9O A;  5J2N A;  1YJW N;  4KI4 A;  3BDP A;  3LWM A;  3ENB A;  2E2O A;  2NRR A;  4DFP A;  5J2P A;  1WSH A;  1BG3 A;  3OS0 A;  3OVN A;  5CY4 A;  3NGY A;  1RIL A;  4R79 A;  4G1Q A;  5MLC Q;  2BTF A;  1TL3 A;  3DRS A;  4CCH A;  3LAN A;  1Z05 A;  2NRZ A;  3A5M C;  3VEY A;  3FLC O;  4BVP A;  1GOB A;  2VCP A;  2V52 B;  2CGL A;  2F9T A;  4BR7 A;  3IMX A;  2QI2 A;  3ZSV A;  2CH5 A;  1ZBU A;  2FBT A;  4JD2 A;  1ASV A;  1J6Z A;  3HZ6 A;  4E7K A;  5CYQ A;  1NGB A;  3QLH A;  1X9J A;  3AO5 A;  2QWN A;  2YHX A;  3V1R A;  3I0S A;  3A5N C;  5EOY A;  3EEQ A;  4DTN A;  3RTV A;  4AHR A;  5EY4 A;  1VQ8 N;  4ZTF A;  4LSN A;  4MQ3 A;  3NHG A;  1Q7Y O;  4FPA A;  4E1N A;  5M1P A;  1EKE A;  1Q8I A;  4NYN A;  3ZX0 A;  1QQN A;  1HPZ A;  1XC3 A;  4DG1 A;  4WF9 L;  4KHQ A;  4FJX A;  1HKC A;  4J2D A;  1K8K B;  4KBO A;  2Q0U A;  1GLF O;  2A42 A;  5AJ3 K;  3OYC A;  3LDS A;  1J54 A;  1NK0 A;  3E66 A;  1WSJ A;  3OYI A;  3PX0 A;  2W6L A;  2RHK A;  3MCP A;  4K8X A;  3IFR A;  1D9F A;  4C8M A;  1VQK N;  5ADX H;  3RMD A;  3K58 A;  1A5X A;  4GVE A;  4AHS A;  2OAN A;  4JAX A;  3AVC A;  3LAM A;  1HYS A;  3QFU A;  4IJN A;  4Z4F A;  1VSD A;  4OPA A;  4NCA A;  4LF6 K;  4JRP A;  2FF3 B;  1N5Y A;  3HT3 A;  1OH5 A;  4NXM K;  3L4I A;  3BY5 A;  2P9S A;  2HVI A;  1C1C A;  3F2K A;  3OA9 A;  3LDL A;  2P5G A;  4B3T K;  4LD0 A;  5EXW A;  3SUN A;  1S3X A;  1W9H A;  5FRN A;  3RSE A;  3LPT A;  4FLT A;  4DSI A;  1OVY A;  4KRF A;  3NH2 A;  1NJI O;  4B9T A;  4BY9 C;  4JS5 A;  4IFE A;  2LSN A;  1SS6 A;  2O8E A;  2ZGZ A;  4JKH A;  1LAV A;  1Y64 A;  1BA0 A;  4QS9 A;  1S1W A;  3JYT A;  4GV9 A;  1OH6 A;  1C1B A;  2IAJ A;  5AR0 A;  2P1J A;  3CER A;  3VEV A;  4AIL C;  3L2R A;  1LWE A;  3H1V X;  2WOM A;  3THY A;  1DEJ A;  4EP4 A;  2Z1G A;  1TAQ A;  1BIZ A;  2RF2 A;  1EWQ A;  2QXF A;  2KKZ A;  2RPI A;  4FWR A;  3SUO A;  2V7Z A;  4C1N I;  3L2Q A;  4Z4E A;  1SV5 A;  3VOV A;  4KHS A;  4FK4 A;  1K8K A;  5H1S Q;  5CE3 A;  3LP2 A;  4U7B A;  3CME N;  2DY4 A;  3TI0 A;  1ZBI A;  4BGA A;  1WSG A;  4IOX A;  2HHH K;  3CYM A;  4M3U A;  1NM1 A;  4CGF A;  2GWJ A;  3T1A A;  4J8F A;  1JXE A;  4LH5 A;  1X9S A;  1WUA A;  5CR4 A;  4O4G A;  2NUB A;  4LY7 A;  3H46 O;  4BR0 A;  1NJW A;  4I7F A;  4CFA A;  2A6A A;  2BDP A;  5AQH A;  2RKI A;  3LDO A;  5GAH P;  2HBK A;  1R59 O;  5TKW A;  2YHY A;  4CZH A;  1HQU A;  4FK2 A;  1NGD A;  4CJF A;  1LV5 A;  3ZSQ A;  3CET A;  3CCE N;  3P83 D;  3CCM N;  3FZM A;  3S3N A;  4GMJ B;  4UQG A;  1BCO A;  3TAE A;  1UAX A;  4HTL A;  2HBM A;  3ITH A;  4WQ4 C;  1ZBS A;  2B4J A;  3I8B A;  3O3G A;  2QWL A;  4BRC A;  1S1X A;  4CJ7 A;  2GTD A;  3P31 A;  4JK8 A;  1XWL A;  4PL8 A;  3EKU A;  1IG8 A;  2Y1J A;  4FVU A;  3KVG A;  2HHT A;  1VQN N;  4C8O A;  4J2A A;  5KRS A;  2J4R A;  3CPE A;  1OH8 A;  3LZI A;  3SUQ A;  2F8S A;  1W0H A;  1CZB A;  3UIQ A;  2KTQ A;  2P9N A;  3DLL L;  3D2F B;  1FW6 A;  4EZ9 A;  2YNG A;  3HBT A;  3CM5 A;  4B1Z A;  5AZI B;  4AQY K;  1BIU A;  2HB5 A;  3SMS A;  2FSN A;  3H6E A;  3KLF A;  1E4F T;  3B8A X;  2ZJR L;  1FKP A;  3OYJ A;  1G15 A;  1BQM A;  5LMU K;  1NWK A;  5KGX A;  3GG4 A;  1ITG A;  2Q36 A;  4GY2 B;  3BEX A;  1YJN N;  4M3Z A;  4CVN E;  4NLC A;  2Q0R A;  1HNW K;  1C0M A;  3HYF A;  3MN6 A;  3T7Z A;  3HOT A;  3V4I A;  3DLK A;  3OYG A;  3C6H A;  1VSE A;  2QXL A;  1TYQ B;  1KVC A;  1IJJ A;  1U2V B;  5F2R A;  2I7P A;  4CI6 A;  2XHB A;  1ATS A;  1D8Y A;  5SWM A;  1SQK A;  1SKS A;  4ELV A;  3F73 A;  4IFV A;  2QEX N;  3BF3 A;  3VQ9 A;  5M1K A;  4KH6 A;  4BRD A;  1UA0 A;  3O8M A;  3FFK B;  1BO5 O;  4PKH A;  2DFF A;  3CQX A;  4A5B A;  4JKD A;  3AO1 A;  1C6V A;  1LW0 A;  3LDQ A;  1WB9 A;  2OPP A;  1RFQ A;  4IEI A;  2XY6 A;  1TAU A;  5I3U A;  3AGK A;  1VK0 A;  5C25 A;  1HR0 K;  3KLI A;  2O8C B;  4ILH A;  3I0R A;  2GWK A;  1HMV A;  1O13 A;  1QQO A;  1P8Z A;  1HJR A;  2CGK A;  3CQ8 A;  3FR0 A;  3ZSO A;  3ATU A;  5DMR A;  3CJC A;  3ZT1 A;  4CK1 A;  4JI7 K;  5C12 A;  4CHN A;  5BPM A;  1EX4 A;  4MLH A;  3G0Z A;  4BG9 A;  4YDU C;  3WNG A;  5AZI A;  3A8Y A;  3TSU A;  3HO1 A;  3V6D A;  3KK7 A;  3LL3 A;  3CCL N;  2GEL A;  4CZG A;  3KLH A;  2IC3 A;  4IOC L;  2QA4 N;  2JLE A;  4LFA K;  1B92 A;  4LC9 B;  2ASP A;  3NCI A;  3J7Y P;  4MLE A;  4RW7 A;  3VER A;  3MN9 A;  5KQ8 A;  4CGG A;  4DSF A;  4CEQ A;  2HMI A;  2HW3 A;  5AFU H;  3WNF A;  5M1N A;  1BA1 A;  3H3N O;  4H4O A;  4JYA K;  1IO2 A;  4V19 S;  3EYZ A;  1OKJ A;  5C2F A;  5BN8 A;  1U2V A;  3Q7C A;  3PUF A;  2GX9 A;  4DQI A;  3AY9 A;  5LJW A;  4OGE A;  2V51 B;  1VSL A;  4WQ4 A;  4CEA A;  4E7I A;  3EE8 A;  3CXC M;  4DSJ A;  1T05 A;  1RT6 A;  4WCE L;  4RW4 A;  5F1X A;  2PBD A;  3AA5 X;  3VQ6 A;  4FXD A;  3OYM A;  2PYL A;  3P39 A;  4GVM A;  4B9M A;  1RT7 A;  3SAF A;  3V9X A;  5C0Y A;  4CJ4 A;  4BC4 A;  2O8D B;  4JKE A;  2R7Y A;  1VSM A;  2UU9 K;  4DS5 A;  4FPB A;  4KHW A;  4FZZ A;  3D2E A;  3LP3 A;  3SUP A;  3ENO A;  4BRN A;  1NJZ A;  1VQ6 N;  3ZT4 A;  3U4L A;  1RBU A;  3HK2 A;  4BR9 A;  4CJV A;  1NK5 A;  3TAF A;  1EP4 A;  5KPT A;  3K5O A;  3KZB A;  1JLF A;  4X66 K;  5AQS A;  1NBW A;  2Z1I A;  1Z26 A;  4C8L A;  3GE1 A;  3SQ4 A;  4JI2 K;  1Q82 O;  3V9Z A;  3U3G A;  3KK3 A;  1SL0 A;  1U6Z A;  2BE2 A;  3MAQ A;  1W7A A;  4CF0 A;  4FLY A;  1NK6 A;  4M7Y A;  4HCB A;  3L3V A;  2IVP A;  4FSV A;  1HJO A;  2ITM A;  3IDH A;  4IO9 L;  4W5R A;  3TR8 A;  3THV A;  1Y97 A;  5LL6 Z;  1S6Q A;  3KLE A;  1QSL A;  3D45 A;  4BRA A;  2DFE A;  3TU5 A;  4G9Z A;  2HHS A;  4CK2 A;  4F2S A;  2VYP A;  1RTI A;  1ATN A;  4DB3 A;  3V9U A;  1MWM A;  4B1Y B;  5AQW A;  4BE0 A;  1NGA A;  4NB4 A;  2OYQ A;  4CJS A;  3WUH A;  2P51 A;  4FW2 A;  2W41 A;  2IDO A;  3EO3 A;  4FWS A;  1N32 K;  2BUP A;  4H0O A;  2B6A A;  1HNV A;  4FJG A;  3L0Q A;  5AQV A;  2G8F A;  3THX B;  3NDK A;  3ALY A;  3QIO A;  3QEP A;  3LAL A;  5E41 A;  2GEM A;  2O8F B;  4JKA A;  1BQN A;  1XNQ K;  1TKZ A;  2G8V A;  1U45 A;  1KSP A;  3QNO A;  3VGL A;  1X3N A;  3FZF A;  4Z4G A;  3QER A;  3E1Y A;  1S1U A;  2ZGY A;  5BRE A;  4CIF A;  3LM2 A;  3RR8 A;  4M42 A;  2ASM A;  5JLH A;  4B1X B;  5AQN A;  3WXI A;  4JKG A;  5AQU A;  4KKO A;  1EO1 A;  5FPN A;  3RVC A;  4FWP A;  1K6Y A;  4FO0 A;  3M8Q A;  4E0D A;  4E7L A;  5LJV A;  1T8E A;  4K41 A;  4BE2 A;  3PV8 A;  4Z4H A;  1MWK A;  4MO4 A;  1H1V A;  1WBD A;  4CZF A;  3NF6 A;  1BIS A;  3ULE A;  4FYD A;  1WN7 A;  1J9A A;  3SPZ A;  2E6M A;  1S72 N;  3O80 A;  5C10 A;  1YTA A;  2YJE A;  1XMQ K;  4O55 A;  3TPQ A;  4OKE A;  4FJ5 A;  1KVB A;  4JLH A;  3M8R A;  4DUY K;  4H0P A;  3FGU A;  4O0I A;  2FLO A;  3SLC A;  3G6E N;  5HL7 L;  3S9H A;  4W5Q A;  1VQ9 N;  4W5N A;  2JWL A;  1KLN A;  4M3W A;  1KFS A;  1TV6 A;  5AQJ A;  2QK9 A;  2ZE2 A;  2O8B A;  3GOI A;  1KD1 O;  3OY9 A;  3R3L A;  3ZCM A;  3E01 A;  5CYM A;  3C6T A;  4NCG A;  2KLA A;  4FOE A;  5GIO A;  3C7N B;  5SZT A;  3T1H K;  2P9U B;  3AVL A;  1JCF A;  5AQR A;  5J1E A;  4IZ9 A;  3N4Q A;  3SNN A;  3OYD A;  4BRF A;  4CJT A;  3PO4 A;  4XIU A;  4BC5 A;  3SMP A;  3A0I X;  5KQD A;  2YX6 A;  3UKU B;  4K8Z A;  3RRH A;  4CGH A;  1CLQ A;  2HST A;  2YNF A;  4H5R A;  4JEP A;  3CM6 A;  5GAE P;  1BDG A;  3J7Z O;  4M3X A;  2KZM A;  3UB5 A;  4RW6 A;  3NH1 A;  4FM2 A;  3PX4 A;  4ELT A;  1RDW X;  1WLJ A; 
#chains in the Genus database with same CATH homology
 1NGG A;  3SBG A;  3CCU N;  5AR0 A;  3CER A;  1YIT N;  3ZYY X;  2D4W A;  5M1F A;  2YCH A;  3H1Q A;  3VEV A;  4ILG B;  3DAW A;  3ENH A;  3WQT A;  4GNI A;  3H1V X;  3TSP A;  1YIJ N;  1DEJ A;  1NGE A;  3GBT A;  4BR5 A;  5E26 A;  4JKF A;  4Z94 A;  2KKZ A;  3MDQ A;  1VQO N;  4H0X B;  4FWR A;  3K9K A;  2V7Z A;  4QS7 A;  4C1N I;  3VOV A;  1YUW A;  3FZK A;  5AQK A;  1K8K A;  3CC2 N;  5H1S Q;  5CE3 A;  4U7B A;  3CME N;  4JNE A;  4PKI A;  2QWR A;  1CZA N;  2YI1 A;  4BGA A;  3CCR N;  4H0V B;  4IOX A;  3G71 N;  2DPN A;  3QML A;  3HSC A;  4UY8 O;  1NM1 A;  2HF4 A;  2Q2R A;  3CCQ N;  3E9P A;  3SAG A;  2GWJ A;  1VQ4 N;  4IWV A;  4J8F A;  3D2E B;  3M5R A;  3VGK A;  3LM9 A;  1WUA A;  4HWI A;  5CR4 A;  3WT0 A;  4BRH A;  3WXK A;  4WYB A;  1HX1 A;  1BUP A;  3H46 O;  3WXJ A;  4BR0 A;  3CD6 N;  2QWO A;  3BF1 A;  1K73 O;  4AM7 A;  4FWQ A;  3O6W A;  2A6A A;  3ZET B;  2A3Z A;  5AQH A;  4BRG A;  2P9I A;  3EE9 A;  3DXK B;  5AQL A;  4CD1 A;  1SAZ A;  3LDO A;  5GAH P;  2HBK A;  2P9K A;  1R59 O;  5M1Q A;  3VET A;  2QWQ A;  3JXU A;  2YHY A;  5TKW A;  4CZH A;  4ISF A;  1T44 A;  1NGD A;  3CCS N;  2KHO A;  1WOQ A;  2A5X A;  5BRH A;  4FWM A;  3T69 A;  5AQQ A;  5AZJ A;  3I56 N;  3MWP A;  2QW9 A;  3QIC A;  3EZW A;  3CET A;  2NRH A;  4IOA L;  2D0P A;  3CCE N;  5AQF A;  4JHD B;  3CCM N;  3FZM A;  3WEE B;  4A2B A;  4HTL A;  2HBM A;  3E9L A;  3VPZ A;  5BRD A;  3PIO L;  2NZT A;  3O08 A;  1ZBS A;  4IEE A;  4WQ4 C;  3UKU A;  3P4I A;  3I8B A;  1T6D A;  2QWL A;  4BRC A;  4YOY A;  2RE2 A;  5TKY A;  3A5O C;  1KAY A;  1DGK N;  1RGI A;  1YXQ A;  1HPM A;  2QM1 A;  2WUS A;  4CJ7 A;  2GTD A;  3P31 A;  4JK8 A;  4PL8 A;  3SAH A;  3EKU A;  4H5N A;  5FPM A;  3G4S N;  1M1K O;  1YJ9 N;  2YJF A;  1IG8 A;  4K43 A;  4RCH A;  3LDP A;  4FVU A;  3KVG A;  2JWK A;  4M63 C;  4XH5 A;  2NLX A;  1VQN N;  1RDU A;  3UKR A;  3ZX3 A;  2HBL A;  2PAV A;  3VEZ A;  1V4S A;  1DT9 A;  2J4R A;  3QFP A;  3CPE A;  3MX2 A;  4MO5 A;  3MN5 A;  5AQY A;  1QVG M;  1YVN A;  2P9N A;  3DLL L;  3D2F B;  1X3M A;  3IUC A;  1GLJ O;  3HBT A;  4FL9 A;  4B1Z A;  1C0G A;  5AZI B;  3VES A;  2NRT A;  4CZJ A;  3HTV A;  1S22 A;  3GL1 A;  3O9T A;  5AQP A;  4FOI A;  1NLV A;  3SMS A;  2FSN A;  4GV3 A;  5BN9 A;  3H6E A;  2ZF5 O;  1E4F T;  4JKB A;  3B8A X;  1GLE G;  5GAG P;  2ZJQ L;  3BP8 A;  3VTI A;  4JD2 B;  2ZJR L;  2WBN A;  2P9P A;  1TUU A;  3CJB A;  4H5V A;  1VAZ A;  3O9Q A;  3D7E O;  4O8U A;  4BRQ A;  5HOO A;  1KQS M;  1NWK A;  3GG4 A;  5CHI A;  2EWS A;  1NGJ A;  4WFB L;  4B9Q A;  2Q36 A;  3CMA N;  3S41 A;  4GY2 B;  3BEX A;  3R1X A;  3CQY A;  1YJN N;  2P9L B;  4NLC A;  2Q0R A;  3MCA B;  4JKG B;  3T7Z A;  3MN6 A;  3ZET A;  2F7T A;  4PHT X;  3HOT A;  1HKB A;  5GIP A;  3C6H A;  2QXL A;  3VEX A;  4KH5 A;  1GLC G;  1TYQ B;  3R6M A;  5LY3 A;  1IJJ A;  2FXU A;  1U2V B;  5F2R A;  2I7P A;  3VEW A;  4CI6 A;  1YHQ N;  1ATS A;  1XQS C;  1SQK A;  4C1N K;  4CD3 A;  3CJA A;  1YAG A;  3NMU A;  4CBU A;  1BWF O;  1ZC6 A;  3VF4 A;  4EIA A;  3BF3 A;  5DM6 L;  2QEX N;  2W40 A;  2WC9 A;  4KH6 A;  4BRD A;  5M1K A;  3EL2 A;  3O8M A;  4IXC A;  3QDK A;  3FFK B;  4PKG A;  4BR2 A;  1VQL N;  1GLB G;  4BGB A;  3ULE B;  1BO5 O;  2E8A A;  4PKH A;  3FZL A;  3CQX A;  4A5B A;  4JKD A;  3OBY A;  2E2N A;  3LDQ A;  4BRE A;  3WQU A;  1K8A O;  1E4G T;  1Q18 A;  3R8E A;  3MX5 A;  3VGM A;  1ATR A;  3G25 A;  1RFQ A;  4IEI A;  1T6C A;  5FPE A;  3AGK A;  3KWI A;  4PL7 A;  4XEI A;  3O1W A;  4ILH A;  4YOU A;  2GWK A;  3TTF A;  1LOT B;  3K9J A;  4I6M B;  1O13 A;  1NGH A;  1QQO A;  4JK9 A;  4B1W B;  1P8Z A;  2CGK A;  1YI2 N;  3ID6 A;  3FR0 A;  3ATU A;  3AAR A;  3QBW A;  2QWP A;  5C2D A;  3JS6 A;  3CJC A;  4DQ8 A;  4BQL A;  5C12 A;  3CC4 N;  4CZK A;  4IJA A;  3O9U A;  2AP1 A;  4O5F A;  3U9D A;  3J8A A;  3TTC A;  5BPM A;  4MLH A;  4A2A A;  5BPL A;  2P9S B;  3VTH A;  4BRP A;  3PIP L;  4BG9 A;  4ISG A;  4YDU C;  3O9S A;  5I9E B;  4K25 A;  5AZI A;  4B1V A;  3F5T A;  2YHW A;  3A8Y A;  3TSU A;  4CZI A;  3CCV N;  3RSE B;  4L3Q A;  3W0L A;  2VGM A;  3KK7 A;  3C7N A;  3LL3 A;  3ID8 A;  2P9U A;  2UYT A;  3TSQ A;  3CCL N;  2GEL A;  3VMF B;  4BQZ A;  4CZL A;  1BOT O;  4CZG A;  1W2B M;  3H45 C;  2CGJ A;  2E1Z A;  3ATV A;  3OHR A;  4IOC L;  2QA4 N;  4LC9 B;  2ASP A;  5JIC A;  4MLE A;  5EVZ A;  3VER A;  3MN9 A;  5KQ8 A;  4YDU A;  4BC2 A;  4CBX A;  4AF1 A;  4CZE A;  3LDN A;  2I7N A;  2OTL N;  5AFU H;  5BRF A;  5KPR A;  5AQT A;  2OTJ N;  5JVH L;  3QB0 A;  5M1N A;  1ZXO A;  1W97 L;  4XH1 A;  3H3O B;  5AQI A;  4DKW A;  4U67 L;  1BA1 A;  3DWL A;  3QBX A;  3H3N O;  5AFU A;  3CF5 L;  1JCG A;  1OKJ A;  5C2F A;  5BN8 A;  1BU6 O;  1U2V A;  5M1O A;  5AQO A;  1QZ6 A;  5BR9 A;  3Q7C A;  4A61 A;  5JLF A;  3CJ1 A;  1Q81 O;  1N8R O;  2GX9 A;  1QZ5 A;  4EHT A;  1NGC A;  3AY9 A;  5LJW A;  2E88 A;  4H5W A;  2V51 B;  4WQ4 A;  2Q97 A;  3EE8 A;  4EFH A;  4EHU A;  3VF6 A;  4WFA L;  3CXC M;  2BH1 A;  3CJ7 A;  4YOV A;  3KWG A;  4WCE L;  4JKC A;  5DM7 L;  5F1X A;  3Q7B A;  2PBD A;  3CJ9 A;  4O8K A;  3U9Z A;  2VGN A;  2Q31 A;  3KHY A;  3MN7 A;  3P39 A;  3OW2 M;  3VEN A;  3SAF A;  4H0T B;  4BRI A;  1YF5 L;  5C0Y A;  4B1U B;  3WXL A;  5AQG A;  3FE1 A;  3HOS A;  2Q1N A;  4BC4 A;  2F9W A;  3AAQ A;  3C6A A;  3O5B A;  4JKE A;  1GLL O;  4NO7 A;  3ZEU B;  5FPD A;  3CCJ N;  1K9M O;  2ZJP L;  4IO8 A;  4FPB A;  3IKM A;  2HF3 A;  3MWT A;  5KPZ A;  3DXM B;  2FSK A;  3D2E A;  1KXP A;  3E9O A;  3M6G A;  3CI5 A;  2A41 A;  4WQ5 C;  1T3V A;  1QVF M;  2ASO A;  3ENO A;  4BRN A;  2NNW A;  2WFB A;  1Z6R A;  1VQ6 N;  3U4L A;  3C0B A;  4YOX A;  4MDB A;  5AZJ B;  4BR9 A;  3GDQ A;  1MDU B;  3M1F A;  4C23 A;  1VQ5 N;  3DXK A;  3CC7 N;  3L6Q A;  1V4T A;  4BRK A;  3O4W A;  4CBW A;  5KPT A;  3DJC A;  3HRG A;  3KZB A;  2GUP A;  4GV6 A;  4FWL A;  3O9R A;  1QHA A;  3M3Z A;  5JVG L;  5AQS A;  4RWT A;  1NBW A;  3HI0 A;  4WQ5 A;  4A57 A;  3GE1 A;  3PLA A;  4BRO A;  3AGR A;  2FSJ A;  4BC3 A;  1ILY A;  1QQM A;  1DKG D;  3O1B A;  1Q82 O;  2QWM A;  4A62 A;  5EX5 A;  4NLB A;  4JHD A;  5B8H A;  4YOW A;  3WEE A;  2VWB A;  5GAD P;  1U6Z A;  5AQZ A;  4BG8 A;  4FWN A;  5GIN A;  5ELZ A;  1LCU A;  2NRW A;  2CH6 A;  1NMD A;  3I55 N;  4M7Y A;  3MMV A;  4MDA A;  3CIP A;  1JJ2 M;  2IVP A;  5AQM A;  4FSV A;  1HJO A;  1KAX A;  1VQ7 N;  2ITM A;  4E1J A;  3CHW A;  3IDH A;  4F9O A;  3D6R A;  4IO9 L;  1YJW N;  1HUX A;  3ENB A;  2E2O A;  2NRR A;  1VQP N;  2P9N B;  1BG3 A;  4BRA A;  3TU5 A;  4G9Z A;  4KH4 A;  3AAP A;  4R79 A;  2VYP A;  4DB3 A;  1ATN A;  3NVK A;  1MWM A;  4B1Y B;  2PFU A;  5AQW A;  3W3D A;  5MLC Q;  1M90 O;  2BTF A;  1NGA A;  4NB4 A;  3TTD A;  1NGI A;  4QS8 A;  3WUH A;  3D2F A;  2W41 A;  1Z05 A;  4BRM A;  2NRZ A;  2E1Y A;  2IVN A;  3A5M C;  3VEY A;  3FLC O;  1TUY A;  2D1K A;  3L4Q A;  4BVP A;  4AM6 A;  3EO3 A;  2P9P B;  4FWS A;  2VCP A;  2V52 B;  2CGL A;  2F9T A;  4FWO A;  2BUP A;  4H0O A;  4BR7 A;  3L0Q A;  3IMX A;  4OPH A;  4ILJ A;  5AQV A;  2QI2 A;  1ESV A;  2IVO A;  3WXM B;  3OBW A;  2CH5 A;  2HMP A;  4JD2 A;  3ZEU A;  1J6Z A;  3HZ6 A;  2GEM A;  3SK3 A;  3FZH A;  4JKA A;  1NGB A;  1X9J A;  4A5A A;  3A5L C;  4Y0W A;  1HKG A;  1X3N A;  2QWN A;  2YHX A;  3DXM A;  3EKS A;  3FZF A;  3VGL A;  3E1Y A;  2AA4 A;  2FF6 A;  2ZGY A;  5BRE A;  1GLD G;  2E2P A;  3LM2 A;  4H03 B;  3BUZ B;  3A5N C;  5EOY A;  2ASM A;  5JLH A;  2P9L A;  5EY4 A;  4B1X B;  4EAH D;  5AQN A;  3WXI A;  3R9P A;  4JKG A;  5AQU A;  2NRX A;  1VQ8 N;  2A40 A;  1EO1 A;  1KC8 O;  4YOR A;  3I33 A;  3P38 A;  5FPN A;  4CZM A;  1G99 A;  4OO1 J;  3NVM A;  1TYQ A;  3RVC A;  2V7Y A;  4FWP A;  4FO0 A;  3ZX2 A;  4A59 A;  1Q7Y O;  1D4X A;  4FPA A;  1EQY A;  5M1P A;  3EN9 A;  4H5T A;  3ZX0 A;  5LJV A;  4WF9 L;  1QQN A;  1XC3 A;  4K41 A;  1HKC A;  3U8X A;  1K8K B;  4KBO A;  2Q0U A;  1GLF O;  1MWK A;  1GLA G;  4MO4 A;  1H1V A;  1P90 A;  3SJH A;  4CZF A;  2A42 A;  3ULE A;  3E66 A;  1S72 N;  3O80 A;  5E84 A;  5C10 A;  2YJE A;  3VEO A;  2NRV A;  3TPQ A;  1KAZ A;  2RHK A;  3MCP A;  4BR4 A;  4H0P A;  3IFR A;  2E20 A;  3FGU A;  4DHY A;  2FLO A;  1VQM N;  3SLC A;  3G6E N;  1VQK N;  5ADX H;  5HL7 L;  1HLU A;  4I6M A;  1VQ9 N;  2H3G X;  1XUP O;  2JWL A;  5ADX A;  4GVE A;  4WFN L;  1JCE A;  2OAN A;  2E2Q A;  2P9I B;  5AQJ A;  3C65 A;  4JAX A;  2P9K B;  3SBT A;  3QFU A;  3UE5 A;  1SZ2 A;  4IJN A;  2QTD A;  4BRL A;  5C15 A;  3GOI A;  2IIR A;  1KD1 O;  3R3L A;  4OPA A;  3F9M A;  5F0X A;  2FF3 B;  2KLA A;  3L4I A;  4FOE A;  5GIO A;  3C7N B;  4FWK A;  2P9S A;  2P9U B;  4JN4 A;  2ZWH A;  1JCF A;  3F2K A;  5AQR A;  3OA9 A;  3LDL A;  4IZ9 A;  3N4Q A;  5EXW A;  1S3X A;  3N4P A;  5BPN A;  4YOT A;  4BRF A;  5JMV A;  3RSE A;  1OVY A;  3VF2 A;  4BC5 A;  1C0F A;  3SMP A;  3A0I X;  4DCH A;  1NJI O;  5KQD A;  2YX6 A;  4BY9 C;  5AQX A;  3UKU B;  4M7X A;  1NGF A;  4IFE A;  2HST A;  4H5R A;  4JEP A;  1SS6 A;  4K42 A;  2D0O A;  2HBJ A;  1Q86 O;  2ZGZ A;  3CPW M;  5GAE P;  4ISE A;  1BDG A;  4IDH A;  4JK7 A;  4XH4 A;  3J7Z O;  4BVO A;  3UB5 A;  3HM8 A;  4JKH A;  1Y64 A;  1BA0 A;  4QS9 A;  4RTF D;  1RDW X;  4H0Y B;  4GV9 A;  3UKR B;  1MA9 B;  2HOE A;  3MK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...