1O13A

Crystal structure of a putative dinitrogenase iron-molybdenum cofactor (tm1816) from thermotoga maritima at 1.83 a resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
107
structure length
107
Chain Sequence
MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFVKEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords probable NifB protein
publication title Crystal structure of probable NifB protein that is involved in FeMo-Co biosynthesis TM1816 from Thermotoga maritima at 1.83 A resolution
rcsb
source organism Thermotoga maritima
total genus 28
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2002-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1o13A00
1P90A 2WFBA 2YX6A 1T3VA 2QTDA 2KLAA 1O13A 2RE2A 1EO1A 1RDUA
chains in the Genus database with same CATH superfamily
4DR2K 1QVGM 1WLJA 3SBTA 2ASOA 3U9ZA 1RT5A 2QXFA 4OVLA 2GUPA 4AF1A 4BRMA 3PSFA 3C6UA 4FLTA 3C6HA 2D0OA 4CJSA 3CCVN 3CM5A 2UXDK 1J9AA 1NU0A 4CEFA 4Z4FA 2HHQA 1E4FT 4FWKA 4WYBA 4M41A 4B3SK 3A5LC 3EKSA 3LPTA 3M8RA 3AVGA 1HJOA 3OS1A 1BDGA 3R6MA 5F2RA 2KLAA 3L8BA 4KH4A 3VQ6A 1DT9A 3J8AA 4GVMA 3OYLA 4I2PA 4NO7A 3CFPA 1HJRA 4JI4K 2NZTA 2KFZA 1NGJA 1WN7A 4MO4A 3ZSYA 3LAMA 1KRPA 3HO1A 1NGCA 4DFMA 2HNZA 3AO4A 4OKEA 2PY5A 3RTVA 2QEXN 4JKFA 4FPBA 3VTHA 3CCRN 2P51A 1YVNA 5GINA 4BRIA 2CGLA 2PAVA 1RDUA 5DM7L 3SPYA 3U3GA 5BPNA 4CF8A 2I5JA 4IFYA 4MDAA 3K5LA 1NMNA 3DOLA 3CC2N 1HPMA 1RBVA 2VGNA 1JCGA 4FJ7A 3SNNA 3PX4A 3M6GA 4OGCA 1X3NA 1T7PA 1BG3A 3WT0A 4JK9A 2HF3A 5AQOA 3O3HA 4FWLA 2O8DA 4XH1A 5KTQA 4CBXA 5K14A 3HT3A 2JWKA 1NGEA 3WEEB 4LH5A 1XMOK 2VWKA 1BISA 3ZX3A 1VQNN 4RCHA 3IDHA 5EX5A 3TARA 4A59A 4OPKA 3EKUA 1RGIA 5AQVA 2J4RA 1VQ6N 2Q36A 4FWSA 3KK3A 5AZIA 2P9LA 3VQ4A 4A61A 3FR0A 3I0RA 4ISFA 4CZHA 4F8RA 4HHTA 1TL1A 3HM8A 3K58A 1C0UA 1W0HA 3K57A 4N41A 1VSKA 1FXXA 1TUUA 2A1RA 3M8PA 1KCFA 3ALYA 3SZ2A 3ZX2A 1XI1A 1TYQA 4BGBA 4DQIA 2PYLA 4PQUA 3G0ZA 1A5VA 1JLGA 3DLEA 4JLHA 2HSTA 1U2VA 1P90A 1RNHA 1VSMA 3LZIA 3D2EB 3IG1A 1ASWA 5BPLA 3VESA 4OGEA 4KHYA 3KKRA 5SZTA 2P9SB 1TUYA 4DR7K 2YX6A 3FE1A 4DSIA 3DRPA 1C0MA 1QHTA 4C8OA 3TWHA 4LY7A 3S3OA 3KJVA 1SV5A 2ZD1A 3MCPA 1MWMA 3OYNA 3WNGA 4FZXC 3QEXA 3KWGA 4CJ4A 1KD1O 4E3SA 1LAVA 3NH0A 3TPQA 2A1SA 1X9SA 3B8AX 3CJAA 2OZSA 3LP3A 4CJWA 2QWPA 1ZXOA 4DKWA 1BU6O 1VQMN 3D45A 2Q3SA 3VEZA 4NCAA 2QWMA 5KRTA 2F4VK 4DFKA 3S3NA 1YF5L 1GLCG 3O8MA 3CQYA 3PV8A 3KLIA 1HPZA 1GLBG 1LW0A 2XY7A 3RMAA 1BI4B 1HKBA 3LP1A 2OCEA 5DM6L 1BOTO 2FLOA 3U3YA 1QVFM 4CJPA 3AGKA 3S3MA 3UKRB 2I7PA 1C0FA 1RCHA 4FJ5A 3OW2M 2FXUA 3SQ2A 2FSJA 3CPEA 1RDAA 3H46O 3RR7A 2NRZA 1GOAA 4FW2A 2FBXA 3AARA 3CI5A 1JKHA 4FL9A 3BUZB 4FWRA 2F96A 1I39A 2W6KA 1S1TA 4JKCA 4W5NA 3AY9A 4C8LA 5CYMA 2XY5A 2BH1A 5HROA 1RTHA 5HP1A 1L5UA 2E5LK 1ZYQA 3F9KA 3CF5L 2A41A 3H3OB 3VEXA 3THWB 4ELVA 3B6PA 3C7NA 1XMQK 2O8BA 4O44A 5C15A 3LP2A 4M42A 4AHUA 2P5GA 1VSJA 4DV5K 3HSTB 3K5MA 5J2MA 2Z1JA 5FROA 5AZJB 5HRRA 3G10A 3TSQA 3AVBA 4KTWA 4BR7A 5HRSA 3L4IA 4CF1A 2NNWA 1NKCA 1NK4A 2V7YA 4J8FA 3DXMA 1QQMA 3EO3A 2O8EB 3AAPA 3PO4A 3MX5A 4B9QA 5JICA 4DTMA 3VQ5A 4FK2A 3E9LA 1HQUA 3VQ9A 1REVA 3F9MA 4G1QA 1Q86O 2G8VA 5AQMA 1O13A 3MEGA 2V7ZA 1YTUA 3HP6A 4O0JA 4FOEA 1RBRA 1W2BM 4DHYA 4IEEA 2EHGA 5CYQA 1S1XA 1Q8IA 4JI1K 1VSIA 4AM6A 1TAQA 3CYMA 1BUPA 1XQSC 1Z05A 1RT4A 2P9NB 1G99A 4DFPA 3CC7N 4IO9L 3OYGA 4GMJB 3AO1A 4H0YB 4DTPA 4M7XA 5F1XA 3VF2A 4QCLA 4IOXA 4DB3A 3NFAA 1IKWA 2R7YA 4BRGA 4GW6A 4CHZA 1HNVA 4A2AA 1KC8O 2QK9A 3TAMA 3AVCA 5BN9A 3OYHA 4BC4A 1MA9B 4WQ5A 5B8HA 1XNRK 5CZ1A 1NJZA 2YHWA 1LWFA 2OTJN 4JI6K 4DU4A 5CY4A 4R5PA 5FDLA 1NK8A 1KVAA 5FPDA 1U47A 4FWOA 4BC3A 4CJVA 2JGUA 4Z4EA 3CPWM 1YXQA 1VQ8N 3TSPA 3ZSVA 4K8XA 5FPNA 3PIOL 5AQJA 2F9TA 3P83D 5LY3A 4Z4GA 4NLBA 4KV8A 5F0XA 3K9JA 3ULEB 2P9PA 4FWQA 5LMNK 3QESA 4YOVA 4Y0WA 4EHUA 2QXLA 3NE6A 4LSLA 3PIPL 5DK5A 1GLDG 4BR2A 2V51B 1B92A 1QSLA 4IJNA 3P31A 5C24A 4IBNA 4FM1A 3QDKA 1T44A 3THYB 2YHXA 3V9ZA 5H1SQ 3ZETB 2YJFA 2GWKA 4CZJA 4CE9A 2Q1NA 1JLBA 1S72N 3CC4N 3TSUA 5GIPA 4CEZA 4X62K 4O8UA 3F73A 1IBMK 3O9RA 1J5EK 3O3GA 2G8UA 3RRHA 1Q81O 2GTDA 3R9PA 1BO5O 4H8KA 4MO5A 1HX1A 4B1ZA 1SKWA 4LD0A 4NCBA 3NCIA 1R0AA 1GLEG 2OPSA 1U49A 4DSKA 4F2SA 4H0VB 3L2UA 4YORA 4YHHK 4JKGA 3VQPA 3HBTA 4I6MB 4FWPA 3SUQA 4M3TA 1NG9A 2Z1GA 5AQXA 4A57A 3JXUA 4H5VA 5HRNA 1J5OA 4IZ9A 1XWLA 4YOWA 3RWUA 4RW6A 3MN5A 4WE1A 3AA2A 3WQUA 4HVJA 3ZEUA 2P9KB 3AAQA 4BACA 1X9MA 3AGRA 4B3MK 4AILC 2KZZA 5D3GA 3EZ5A 4B3RK 4H5RA 1L3SA 5JMVA 3IRXA 2VYPA 4B9VA 3PY8A 4CECA 4CJ5A 2BTFA 1C1BA 4FVMA 4LF6K 5KRSA 2VWJA 4DV4K 2JLEA 1C6VA 4M3WA 4JKEA 4WF9L 1I94K 1JXBA 2GELA 2RKIA 1VK0A 2EX3A 2NRTA 3KK7A 4CGIA 1D5AA 4DTJA 3F2KA 4PL7A 3ID6A 4CHPA 3TABA 1CXQA 1J54A 3V1QA 2UU9K 1HNXK 4IFVA 5AQFA 5LJVA 3AVIA 3CXCM 5SWMA 4FZYA 3T7ZA 1ESVA 2FSNA 4AH9A 1RDDA 1BQMA 3O4WA 1X9JA 4GY2B 4JYAK 1HNWK 3ZEUB 2HF4A 3FFKB 2D0CA 4A5BA 3HP9A 2NRVA 4EZ6A 4J2EA 3IAYA 3THXB 4M3YA 3KWIA 4A62A 4ZTFA 4CEDA 5FRNA 3EY1A 1YJ9N 4OLAA 3AVLA 4KTZA 3QINA 3AVNA 2WBNA 4N5SA 3D7EO 3C65A 4PY5A 1CLQA 4OPAA 2WONA 4EP5A 3RSEB 1TKZA 2E4LA 1VSLA 3T1AA 3QBWA 2VG7A 3ASMA 3HJFA 4CJ7A 2ZJPL 3O08A 4H5TA 3AO5A 1VQ5N 3HI0A 4OX9K 5CR4A 2GWJA 4PHTX 4DS4A 1K8KB 4YDUA 4XEIA 3MK6A 1RFQA 5AQTA 5AJ3K 3AO2A 1HLUA 4KREA 3FZLA 3QLHA 3IUCA 3DLHA 3BDPA 3CJ7A 4RG8A 1EXQA 5AQRA 2H3GX 1CZBA 1HKGA 1HRHA 3SAHA 1LCUA 4BRKA 1RBSA 4PA1A 3HVRA 1SQKA 4CZIA 1NM1A 2O4GA 3CJCA 1SL1A 3BZKA 3VERA 4WQ4A 5EOYA 1NK6A 3DYAA 1NK9A 1MWKA 4AHRA 3ISNC 4PL8A 3VQBA 2KZMA 1LOTB 4DTNA 2YNGA 1NGHA 5I42A 1BIUA 3VGLA 2XHBA 1WNSA 3TR8A 3AVAA 3LWLA 3CFRA 4BVPA 3BP8A 3QICA 4BR5A 2WC9A 2RPIA 3ENHA 3QEPA 4FK0A 2VG6A 3MN6A 3O9UA 3ENOA 3R8EA 1DTTA 2GV9A 3LM9A 5HRPA 1D8YA 4YNQA 4RW8A 1S1UA 1CZ9A 3WNHA 3NH1A 4N76A 1HMVA 1HR0K 5AQIA 2E1YA 2PYJA 5BR9A 5GIOA 5FPEA 1XHZA 2KQ2A 4CF2A 1IV0A 4CBUA 3OYIA 2B6AA 1WBDA 1ZBHA 4GV6A 3FZHA 4C23A 2IOCA 3OY9A 1N36K 4GV9A 3OYBA 4M3UA 2W40A 3OYMA 3SV3A 4OPJA 4DTOA 3FLCO 3TTDA 4KHWA 4CFDA 5M1KA 4JS4A 2KHOA 1NK7A 4LFCK 1VQPN 3HOTA 3FGUA 4BROA 4BY9C 3EZWA 1TGOA 3SYZA 3OS0A 1RTJA 1JLCA 4CW7B 4B9UA 3CMEN 1FKOA 4KHUA 3LPUA 2UXCK 1YITN 2O8FA 1VQ4N 3A8YA 3WEEA 4YFUA 1YAGA 1BIZA 2ASPA 3C0BA 4CJTA 5C10A 3AVKA 3CETA 1ASVA 4JV5K 4CZFA 4CJEA 3OJSA 2HBKA 1B9FA 3WQTA 2ZJRL 4DF4A 1RDBA 2YHBA 3DI6A 4IG3A 1UA1A 1RTDA 2D5RA 4CJ3A 1TL3A 4JN4A 2OPRA 3L6QA 4O55A 1JXEA 4DTUA 1NKEA 2YNIA 4FO0A 3GBTA 3ATUA 3BF3A 4E1JA 1VSHA 4BR9A 2XRIA 4DFJA 5C25A 3SUPA 1U4BA 3ZSZA 1ZBIA 3D6RA 3KD1E 4GKJK 4IKFA 1KVCA 2BE2A 4DSJA 2RE2A 3QO9A 3SBGA 3TAPA 2O8FB 3D2EA 1OH5A 4JS5A 2Q2RA 4CFCA 2P9SA 4LF4K 3HRGA 1WSEA 3H6EA 4F3TA 4M45A 4CD3A 5M1FA 3KD5E 4FJLA 1NJYA 4DV6K 3OJUA 4BDYA 3FZKA 3M5RA 4I2QA 3VENA 4M7YA 3OYCA 2CH6A 3O6WA 4H4OA 1KFSA 2E1ZA 3CJ1A 2ZF5O 3O9QA 4BGAA 2G8HA 4LH4A 2YKMA 2IGIA 1XNQK 3AVJA 4CZEA 2F8TA 1S6PA 3SQ4A 4CERA 1UAXA 4I7FA 2D1KA 3KLEA 4ELUA 3A2FA 4FSVA 5HL7L 5FLXO 4CIGA 1C0TA 3OHRA 2BANA 3ITHA 4WCEL 1YT3A 1GLJO 4H0OA 2YJEA 3QEWA 3MEEA 4RW7A 4FJKA 2RN2A 2VGMA 1NGAA 1D4XA 4XIUA 1KTQA 1BI4A 5JS2A 2ATQA 1SUQA 1SS6A 1Z25A 5M1OA 5TKYA 3PLAA 3UKRA 1ATRA 2CH5A 5E41A 4FOIA 3CCLN 5FPMA 3J80O 1HNIA 2W42A 1SL2A 2HVIA 1S1VA 3NH2A 1T03A 2WOMA 5TKWA 1YTAA 2ZJQL 3DLBA 4JHDB 1ZC6A 3ENBA 4FJMA 3EL2A 1ZBSA 4CJQA 1SKSA 1NGIA 4LFAK 4KHPK 4DG1A 1JCEA 4OKKA 2P9UB 3UKUB 3NDKA 1DTQA 2VCPA 3DM2A 1JLEA 5AQWA 3ZSRA 4E7JA 4GVEA 1X1PA 3OBWA 3THWA 2Z1IA 3W3DA 4J2BA 4LF8K 3O4QA 4NXNK 1N8RO 1S3XA 4CEAA 1XHXA 4JI7K 3VQ8A 1TK0A 2D0PA 5AZJA 3K5OA 4CF9A 1JL2A 1X9WA 4OPHA 4CD1A 4W5QA 1BA0A 5CHIA 2HBJA 1L3VA 4CFBA 4E7LA 4MDBA 3VF4A 4FCYA 3LZJA 1JLAA 2O8EA 3H3NO 1NK5A 3IFRA 1K8AO 2HBLA 4ID1A 4FLUA 2E2QA 3V9XA 4XH5A 2HVHA 3LP0A 1NJIO 4LSNA 3CMAN 3SAFA 1DLOA 1FKPA 3VQEA 4MLEA 2DY4A 1NOZA 4LC9B 4Z0UA 3FZFA 2IC3A 3C6AA 4DQ8A 2O8CB 2P9NA 2P9IB 3ZSXA 4HCCA 1GOBA 1WOQA 2E6LA 2YKNA 5HBMA 5C0YA 2GEMA 3G71N 1TK8A 1KSPA 3QETA 3JYTA 3WNFA 3SAGA 4QAGA 3NGZA 1UWBA 3CCMN 1V4TA 4FJIA 3L3VA 3P5JA 4B9LA 2HW3A 2G8WA 3EE9A 3NVMA 4KPYA 2F8SA 4X64K 1TAUA 2IS3A 4HUEA 4F9OA 1S1WA 2DFFA 3M8QA 2HNYA 3TAGA 2E2OA 4CK2A 1SL0A 3M3ZA 1XUPO 2W41A 1OVYA 1EO1A 3OYEA 3SLCA 3ULEA 3N4PA 5AFUA 5C42A 4BRNA 4FWNA 4QS9A 4FK4A 3VQCA 4FJXA 5AR0A 2ASMA 4DR6K 1BCMA 4ID5A 1BCOA 1EWQA 4MQ3A 5BRHA 3VEYA 2QKBA 2DFHA 3THYA 4I9LA 4F2RA 3ZETA 3R3LA 4CGDA 3UIQA 4L3QA 2UUAK 1XC3A 4A5AA 3OYKA 5FRMA 3CCQN 4KKOA 3TI0A 4FJHA 3KKSA 2JWLA 5KPTA 4B8CA 3O9SA 2HHHK 3L2WA 1DEJA 2QM1A 3SPZA 2KKZA 3MX2A 4Y1DA 3MECA 2NRWA 4DLGA 1QE1A 1TV6A 3BGRA 3SUOA 3DLRA 4CCHA 3CCUN 3QNOA 1JL1A 5BR8K 4JKHA 1EP4A 3HL8A 2D0AA 5J2NA 1RT2A 4IOAL 4I6MA 2HHSA 4CFAA 3VMFB 2XY8A 4RW9A 4KO0A 3OYAA 4K41A 2ZGZA 4GKKK 1N32K 3PX0A 4B8AB 1HYZA 5C2DA 3H08A 4DQRA 2E88A 2ZM6K 3KLHA 3KHYA 2P9KA 4BE2A 3SV4A 4BRCA 3WXJA 4O5FA 3K59A 1WAFA 1YHQN 4CEOA 3C6TA 4JI2K 3SMPA 4CGHA 3T19A 3EEQA 1X3MA 2HHVA 3GDQA 3WUHA 1ATNA 4YOTA 2WTUA 4I9QA 3QERA 2HNDA 3TANA 3NBPA 4GV3A 1RDCA 3D0PA 5EY4A 3QBXA 3T1HK 4BQLA 4JD2A 1OKJA 4B3OA 4DV2K 1OH7A 3MN9A 4WFAL 3KIOA 3HPHA 2ITGA 4IDKA 3GG4A 4Q0BA 2HHWA 2FF6A 1K73O 2HHTA 3DOKA 3QFUA 3H1QA 4F3OA 1VRTA 4DR5K 3THXA 3WNEA 5AQYA 1QHAA 3DAWA 4U67L 1QQOA 1QZ5A 5KQ8A 3HPGA 5KGXA 4NXMK 4YOYA 3QEVA 3NF7A 3ZSWA 4EIAA 3J7AP 2HOEA 4WFNL 1Q7YO 3OYJA 4PWDA 4TSXA 2KFNA 1D9DA 3DMJA 3RSEA 4PKIA 4W5OA 5AFUH 1MU2A 4BR0A 3TAFA 3GE1A 4AQYK 3R1XA 4H5WA 4HTLA 3CHWA 4JD2B 5AQLA 3RMDA 2Q97A 2G8FA 4IJAA 1TKXA 3DLKA 1K8KA 1MDUB 3MAQA 1RTIA 4BC2A 2ITMA 4W5RA 3MN7A 4NYFA 3G6EN 1LW2A 1NGDA 3VEWA 3MXJA 1VQLN 2QTDA 3DLGA 4NLCA 3VA0A 3L2QA 1J6ZA 2HB5A 4CIEA 1QQCA 4CEEA 1NBWA 4DTRA 1N33K 3ULDA 5JLHA 3TTCA 4EAHD 4RTFD 2QWNA 4Z4CA 3VTIA 4O8KA 4IDHA 4N47A 1NLVA 4KHQA 4EFHA 1G15A 4FJGA 1IKXA 5HLFA 3QEIA 2HHXA 4JAXA 4KB0A 5DMRA 3AV9A 1WSHA 3I0SA 5KQDA 1U45A 4FJ9A 4JEPA 4E7IA 3LALA 2FC0A 3VN5A 3LDLA 2G8KA 2AA4A 4PUOA 1ITGA 4JK7A 3OBYA 5JVGL 2HMIA 4B9SA 2ZWHA 4FM0A 4FJNA 3F5TA 3K0SA 2NRRA 4YY3K 3A5OC 1ILYA 4KH5A 3KTQA 2E2PA 1VQON 2XO7A 2QI2A 4DSFA 1GOCA 1UA0A 3WXLA 4JRPA 2CGKA 2OANA 1EX4A 4DV1K 4ISGA 1VHXA 3TAEA 3CIPA 4DU1A 1JJ2M 1GLLO 3SK3A 3I56N 3QIOA 3J7ZO 3LWMA 4HCBA 2Q0RA 3L3UA 4FYDA 5GAEP 2Q0UA 1WSFA 4FLZA 3ZX0A 5E26A 2QA4N 3I8DA 3HTVA 1N34K 3BEXA 1EKEA 3IMXA 3PO5A 4CZLA 2QW9A 3JSMA 4KFBA 4F4KA 3D2FB 3RMBA 5AQUA 4BDPA 3M1FA 4AHVA 2OZMA 1RT6A 3QNNA 3HM9A 4CF0A 4U7BA 1WSJA 3V1RA 1SZ2A 2QWQA 4DTSA 4K8ZA 2IVOA 4KBOA 2HHUA 1HKCA 2FBYA 3GOIA 4KAZA 3G25A 4M3RA 1KAYA 1DKGD 3O1WA 4IXCA 3SJJA 4CHNA 4L8RB 5BN8A 1FJGK 3GL1A 3KK1A 4JI5K 3I33A 4ELTA 1NOYA 4ILGB 1K6YA 4K43A 3OYDA 4H4MA 1Z26A 4HUGA 4YOUA 5KGWA 1IBKK 3RMCA 3A0IX 2ZQBA 1RBUA 2PBDA 3DXKA 1WBBA 1QZ6A 4B1YB 3SQ1A 4IEIA 4WQ5C 4FVUA 4CGFA 3KZBA 3VQAA 3DJCA 4HTUA 3G4SN 1OVQA 2BUPA 1ZBFA 2A5XA 3EYZA 2P5OA 3NF9A 3HSCA 1Y64A 4E19A 4FLVA 3ZSQA 1NNEA 3VPZA 1HNZK 3ZT1A 1J53A 3VGMA 2P1JA 1V4SA 3KK2A 3V4IA 4NB4A 4CK1A 4FW1A 4KHSA 3UB5A 4JI3K 4C8KA 4Z94A 3K9KA 3V81A 4BG8A 4Q5VA 3LDOA 2IVNA 3I8BA 4QS8A 4UQGA 2WUSA 4AM7A 4B1XB 3QB0A 4Y1CA 1BGXT 3CJ9A 3DXKB 1LWEA 4X65K 4E89A 3V9SA 1N5YA 1KAZA 3HK2A 3UE5A 5GAHP 3VA3A 4C8MA 4R79A 3A5NC 4BRAA 1IKYA 3P38A 5J2QA 5ELZA 5EVZA 3CCJN 4BG9A 3CG7A 2NRXA 1SAZA 3KLFA 4DSLA 4K25A 3HXMA 1K9MO 1R59O 3V9UA 3SCXA 3E9PA 3T69A 1BA1A 3HOSA 3RR8A 3OS2A 1NGBA 5JVHL 3PX6A 5M1PA 4FJ8A 4C1NK 1WSIA 4CHQA 3E9OA 1JLQA 1WAJA 3LL3A 4CZMA 3LDQA 2NLXA 4FLWA 1S5JA 3HZ6A 4DSEA 3OYFA 3NF8A 3CQ8A 1VSEA 1C0GA 1EWRA 4IOCL 4JI0K 4JHDA 3TU5A 4CZGA 4MFBA 2NUBA 2NRHA 3O9TA 3S41A 1VSFA 5AQSA 2ETJA 3KLGA 3K5NA 3NHGA 2PZSA 3VOVA 2VQFK 1T05A 5EU7A 2P9UA 3UKUA 1LAWA 4CBWA 3CD6N 5JLFA 2OYQA 3E1YA 4N56A 4J2AA 1Q18A 1Q82O 4CJKA 3VETA 3RVCA 4GNIA 4FXDA 2BDPA 5E84A 2QWOA 1KFDA 3TAQA 4FWMA 2O8DB 3FZMA 4CESA 4DWIA 1C1AA 3KVGA 3RRGA 2QWRA 3ZLJA 3ZSOA 3ZT0A 4FLXA 1ATSA 2IVPA 2E6MA 3OA9A 3OTOK 4DF8A 3AA4A 3C94A 4CI6A 4WFBL 1H1VA 4B9TA 4AHCA 5AZIB 2P9LB 1YUWA 4CJLA 3AA3A 4JKAA 4DR1K 2OA8A 1T6CA 1OH8A 3WXKA 3EN9A 4KH6A 4E7KA 3NVKA 3AVMA 3O80A 4CZKA 4H0PA 4BRHA 2O8CA 4B9NA 4FZZA 1RDWX 1TYQB 2P9IA 5J1EA 4DR4K 1HQEA 1ASUA 1NWKA 1QSYA 2V52B 2ZE2A 3NGYA 3CCSN 1U2VB 2UYTA 1RT3A 3O4NA 3CFOA 2D4WA 4CVNE 4FM2A 4DV0K 2HBMA 4QOZB 2X74A 2RHKA 4H0XB 4YDUC 5AQPA 3J81O 3HYFA 1Q9YA 5IWAK 1T6DA 2XY6A 5BRDA 3ZT4A 1L3UA 2YNHA 4X66K 5CZ2A 2E20A 4EZ9A 3T3FA 1KXPA 5I9EB 5MLCQ 4B9MA 2D0BA 4WQ4C 2QWLA 1S9EA 4C8NA 4CIFA 1T3VA 1GLAG 4O4GA 3LM2A 1DGKN 3V9WA 4M3ZA 4ILJA 3AVHA 2X6SA 4H0TB 3EE8A 4QS7A 3N4QA 3OVNA 5AQNA 2X78A 4H5NA 1EETA 1B9DA 5KPRA 4JKDA 4CHYA 2VG5A 3AO3A 5LJWA 1L3TA 1VQ9N 4JRQA 3WXIA 4DTXA 1QS4A 3MMVA 4M63C 2F7TA 1F21A 4BREA 3DLLL 1S9GA 1NJWA 1IO2A 1QQNA 3ZCMA 4RW4A 3PUFA 3A5MC 5AQGA 5EXWA 3V1OA 1N6QA 2AJQA 5BREA 4Z4HA 4V19S 5BRFA 1U04A 2UUCK 4BRDA 4M3XA 1M1KO 5C12A 2B4JA 3TTFA 4DU3A 4MLHA 1HUXA 2EWSA 4BRLA 3VQ7A 4BQZA 4DS5A 1IG8A 3NAEA 4DR3K 3VQDA 1JCFA 4KI6A 1Q9XA 1ZBUA 4AHSA 2OTLN 5GADP 1A5XA 1BWFO 4BE0A 1Y97A 4IWVA 2AP1A 2KTQA 3VGKA 2UUBK 3U6FA 3JAMO 2OPQA 3IS9A 3U8XA 4DQQA 3L4QA 3Q7BA 3C7NB 2O8BB 1FK9A 2FF3B 5LL6Z 1BQNA 3J7YP 3QFPA 1W7AA 2DFEA 3ZT3A 1U48A 1D9FA 1RBTA 3SJHA 2HMPA 3CM6A 4BVOA 3MXIA 4B1UB 2PFUA 2E8AA 3QMLA 5KI6A 3V6DA 3DXMB 3MWTA 2UXBK 2LSNA 3E01A 3LDPA 4DUZK 3BF1A 4IFEA 2O4IA 2FSKA 2FBTA 3WXMB 1Z6RA 5AQQA 1TKTA 1S22A 2YI1A 5I3UA 3QIPA 1W97L 4CK3A 4B08A 2BGGA 1E3MA 4OLBA 4B1VA 4BE1A 3CERA 1W9HA 2DTUA 4DQPA 1GLFO 2IIRA 4DUYK 2ZGYA 4O5BA 1RT1A 4BR4A 5GAGP 1IBLK 3Q7CA 3LDSA 2YHYA 3O3FA 2X6NA 3MWPA 2Y1IA 4DCHA 1P8ZA 4NYNA 4CJRA 3S9HA 1IJJA 3C95A 2A42A 3NF6A 1HYVA 3I55N 1KVBA 1I3AA 3VEOA 4LF9K 2GBZA 2YV0X 5BPMA 3B6OA 3AVFA 1TK5A 3LAKA 3L0QA 4ILHA 4JNEA 5M1QA 1NJXA 2P9PB 1VQKN 1M90O 4CJFA 1WSGA 4OO1J 1FW6A 4CHOA 5HOOA 3O5BA 5IT9O 3CCEN 3P4IA 4FPAA 5ADXA 3VF6A 4OKJA 1CZAN 4ISEA 4ICLA 3P1GA 2A6AA 1SKRA 4B1WB 5C2FA 1IG9A 3VEVA 2YHAA 4KB1A 3K2PA 1TKDA 3E66A 4KI4A 4AHTA 3LANA 1A5WA 4CEBA 1OH6A 4E0DA 1BL3A 5CE3A 1QTMA 1RILA 4H03B 3HPOA 3SMSA 3DWLA 5LMUK 3O1BA 4BDZA 4RWTA 1ZBLA 3FFIA 2B5JA 4BWMA 3H1VX 1VAZA 1YI2N 1UOCA 1LV5A 4JKGB 1VQ7N 2YCHA 2IDOA 4BRPA 5AQZA 4W5TA 3NGIA 3CQXA 4CGGA 4JKBA 4ZHRA 5T7BA 4BWJA 2A3ZA 4HUFA 1VSDA 3BY5A 3CJBA 1NK0A 3ATVA 4FJJA 1BHLA 2I7NA 1NGGA 4BRFA 3L2VA 3SQ0A 4CGJA 3L2RA 5AQHA 2F9WA 4UY8O 1IH7A 1T8EA 4XH4A 4DV3K 4IG0A 2VQEK 1VRUA 4BRQA 2QKKA 3DRSA 2CGJA 4K0KK 4EHTA 3MEDA 4HWIA 4IO8A 4DMNA 3JS6A 2GUIA 3HVTA 2IAJA 2DPNA 3D2FA 2E2NA 4PKHA 3SUNA 1NGFA 4LF7K 1NMDA 5KPZA 4G9ZA 2A40A 3PSIA 1KLNA 2G8IA 3MXMA 1QSSA 3W0LA 3AA5X 3H45C 3MDQA 4J2DA 1KAXA 4CEQA 3ID8A 1YJWN 3VQQA 2FBVA 3THVA 1XC9A 4E7HA 5JS1A 4FLYA 1TVRA 4OJRA 4DQSA 2Y1JA 3T1YK 1HYSA 2VWBA 1IKVA 1NKBA 5J2PA 1KLMA 2GX9A 1WB9A 1U6ZA 3LDNA 2Q31A 1EQYA 2KW4A 3ZT2A 4BC5A 3P39A 3SI6A 3NMUA 2OPPA 4A2BA 4E1NA 5M1NA 2W6LA 1JLFA 1KQSM 4LF5K 1E4GT 3MCAB 4DV7K 3DRRA 2RF2A 4ZTJA 4LFBK 4JI8K 4EP4A 4Z4IA 3U4LA 1C1CA 3U9DA 3ZYYX 2YNFA 4NCGA 5ADXH 4KRFA 4B3TK 3IKMA 4C1NI 3BZCA 4E1MA 1YVUA 5A2QO 4JK8A 4PKGA 3M8SA 5AQKA 4KTQA 4O0IA 2WFBA 1YIJN 1O1WA 4YOXA 4K42A 4KHNA 1RT7A 4CJUA 2Z1HA 1CXUA 1WUAA 1S6QA 4DLEA 1LWCA 1YJNN
chains in the Genus database with same CATH topology
3F2KA 4PL7A 3KVGA 5AR0A 3ID6A 2ASMA 1QVGM 2QWRA 3SBTA 2ASOA 5AQFA 3U9ZA 5LJVA 1ATSA 2IVPA 2GUPA 4AF1A 3CXCM 3OA9A 4BRMA 5BRHA 3VEYA 4CI6A 4WFBL 1H1VA 3T7ZA 1ESVA 2FSNA 3ZETA 3R3LA 3C6HA 4L3QA 2D0OA 3O4WA 5AZIB 2P9LB 1XC3A 3CCVN 4A5AA 1X9JA 1YUWA 3CCQN 4JKAA 4GY2B 1T6CA 2JWLA 3ZEUB 2HF4A 3FFKB 5DM7L 4A5BA 5KPTA 3WXKA 2NRVA 3O9SA 1E4FT 4FWKA 3EN9A 4KH6A 4WYBA 3NVKA 3A5LC 3EKSA 3KWIA 4A62A 3O80A 1DEJA 2QM1A 2KKZA 1YJ9N 3MX2A 4CZKA 4H0PA 4BRHA 1HJOA 1BDGA 3R6MA 5F2RA 2KLAA 2NRWA 4KH4A 1DT9A 3J8AA 2WBNA 1RDWX 1TYQB 2P9IA 3D7EO 3C65A 4NO7A 3CCUN 1NWKA 2V52B 4OPAA 3CCSN 1U2VB 2NZTA 2UYTA 4JKHA 3RSEB 4IOAL 1NGJA 4MO4A 4I6MA 2D4WA 3QBWA 2HBMA 1NGCA 4CJ7A 2ZJPL 2RHKA 4H0XB 4YDUC 3VMFB 5AQPA 3O08A 2QEXN 4H5TA 4JKFA 4FPBA 1VQ5N 1T6DA 4K41A 3HI0A 3VTHA 3CCRN 2ZGZA 5CR4A 1YVNA 2GWJA 4BRIA 2CGLA 2PAVA 1RDUA 4PHTX 5GINA 1K8KB 4YDUA 4XEIA 5BRDA 3MK6A 1RFQA 5AQTA 5BPNA 1HLUA 5C2DA 2E88A 4MDAA 3KHYA 2P9KA 3FZLA 3IUCA 4BRCA 3CJ7A 2E20A 3CC2N 1HPMA 3WXJA 5AQRA 2H3GX 1HKGA 4O5FA 3SAHA 1LCUA 2VGNA 4BRKA 1JCGA 1YHQN 1KXPA 3SMPA 3M6GA 5I9EB 1X3NA 1X3MA 1SQKA 5MLCQ 3GDQA 1BG3A 3WT0A 3WUHA 1ATNA 4WQ4C 4CZIA 2QWLA 1NM1A 4JK9A 2HF3A 5AQOA 4YOTA 4FWLA 3CJCA 1T3VA 4XH1A 1GLAG 3LM2A 1DGKN 4CBXA 4ILJA 4WQ4A 3VERA 5EOYA 4H0TB 1MWKA 2JWKA 3EE8A 1NGEA 4PL8A 3WEEB 4QS7A 3N4QA 5AQNA 4H5NA 4GV3A 1LOTB 5KPRA 5EY4A 3QBXA 4JKDA 1NGHA 3ZX3A 1VQNN 4RCHA 3IDHA 5EX5A 5LJWA 1VQ9N 4BQLA 3WXIA 4A59A 4JD2A 3MMVA 1OKJA 3EKUA 1RGIA 4M63C 5AQVA 2F7TA 2J4RA 3VGLA 1VQ6N 2Q36A 3MN9A 4FWSA 4BREA 4WFAL 3DLLL 5AZIA 2P9LA 4A61A 1QQNA 3GG4A 3FR0A 4BVPA 3BP8A 4ISFA 3QICA 4BR5A 2FF6A 2WC9A 4CZHA 1K73O 3ENHA 3QFUA 3A5MC 3H1QA 5AQGA 5EXWA 3MN6A 3O9UA 5BREA 3HM8A 5AQYA 1QHAA 3DAWA 3ENOA 3R8EA 5BRFA 4BRDA 1TUUA 3LM9A 4U67L 5C12A 1M1KO 1QQOA 1QZ5A 5KQ8A 3TTFA 4MLHA 1HUXA 2EWSA 4YOYA 4BRLA 3ZX2A 4BQZA 1IG8A 1TYQA 4BGBA 1JCFA 4EIAA 2HOEA 5AQIA 2E1YA 4WFNL 1Q7YO 2HSTA 5BR9A 5FPEA 1U2VA 5GIOA 1P90A 2OTLN 3RSEA 5GADP 3D2EB 4PKIA 5BPLA 3VESA 4CBUA 1BWFO 5AFUH 4BR0A 2P9SB 3GE1A 4GV6A 3FZHA 4C23A 1TUYA 4GV9A 4IWVA 2YX6A 3FE1A 3R1XA 2AP1A 4H5WA 3VGKA 4HTLA 3CHWA 4JD2B 5AQLA 2Q97A 2W40A 4IJAA 3U8XA 1K8KA 1MDUB 3L4QA 3Q7BA 3C7NB 2FF3B 4BC2A 2ITMA 3MN7A 3FLCO 3G6EN 3MCPA 1NGDA 1MWMA 3VEWA 3QFPA 3TTDA 5M1KA 3KWGA 2KHOA 1KD1O 1VQLN 1VQPN 3HOTA 2QTDA 3FGUA 4BROA 3SJHA 2HMPA 4BVOA 4NLCA 3EZWA 4BY9C 3TPQA 4B1UB 1J6ZA 3B8AX 2PFUA 3CJAA 2E8AA 3QMLA 3DXMB 3MWTA 1NBWA 2QWPA 1ZXOA 4DKWA 3CMEN 1BU6O 1VQMN 3LDPA 3BF1A 4IFEA 5JLHA 3VEZA 3TTCA 4EAHD 4RTFD 2FSKA 2QWNA 3WXMB 1YITN 1VQ4N 2QWMA 1Z6RA 3A8YA 5AQQA 3WEEA 1S22A 3VTIA 4O8KA 2YI1A 1YF5L 4IDHA 1GLCG 1NLVA 1YAGA 2ASPA 3O8MA 4EFHA 3CQYA 3C0BA 1W97L 5C10A 3CETA 1GLBG 4JAXA 4CZFA 4B1VA 2HBKA 3CERA 5KQDA 3WQTA 2ZJRL 1GLFO 4JEPA 2IIRA 1HKBA 2ZGYA 3LDLA 5DM6L 2AA4A 1BOTO 2FLOA 1QVFM 4JK7A 4JN4A 3L6QA 3OBYA 3AGKA 5JVGL 2ZWHA 2I7PA 3UKRB 4BR4A 5GAGP 1C0FA 3Q7CA 3OW2M 3F5TA 2YHYA 2FXUA 2NRRA 3A5OC 2FSJA 3CPEA 3H46O 4FO0A 4KH5A 1ILYA 2E2PA 2NRZA 3GBTA 1VQON 3MWPA 2QI2A 3AARA 3ATUA 3BF3A 4E1JA 4BR9A 4DCHA 1P8ZA 3CI5A 3WXLA 4FL9A 3BUZB 1IJJA 2CGKA 2OANA 2A42A 3I55N 4FWRA 3D6RA 4ISGA 3CIPA 4JKCA 1JJ2M 3AY9A 1GLLO 3SK3A 3I56N 2RE2A 3VEOA 3SBGA 3J7ZO 2BH1A 2Q0RA 3D2EA 5GAEP 2Q0UA 2Q2RA 2P9SA 3ZX0A 5BPMA 3HRGA 3CF5L 3H6EA 2A41A 3L0QA 5E26A 4ILHA 4CD3A 5M1FA 2QA4N 3H3OB 3HTVA 3VEXA 3BEXA 4JNEA 3C7NA 3FZKA 3IMXA 3M5RA 3VENA 4M7YA 5C15A 4CZLA 5M1QA 2CH6A 2P9PB 3O6WA 1VQKN 1M90O 2QW9A 2E1ZA 3D2FB 3CJ1A 2ZF5O 3O9QA 4BGAA 4OO1J 5AZJB 5AQUA 3M1FA 4CZEA 5HOOA 3TSQA 3O5BA 4U7BA 4BR7A 3CCEN 3P4IA 1SZ2A 2QWQA 3L4IA 2NNWA 2D1KA 4FPAA 2IVOA 4KBOA 1YJNN 1HKCA 2V7YA 3GOIA 4J8FA 3DXMA 1QQMA 3EO3A 5ADXA 3VF6A 3G25A 1CZAN 3AAPA 4FSVA 1KAYA 4ISEA 3MX5A 4B9QA 5JICA 5HL7L 2A6AA 3E9LA 4B1WB 5C2FA 3F9MA 1DKGD 3O1WA 3OHRA 4IXCA 1Q86O 5AQMA 1O13A 4WCEL 3VEVA 1GLJO 4H0OA 2YJEA 2V7ZA 3E66A 5BN8A 4FOEA 1W2BM 3GL1A 4DHYA 4IEEA 2VGMA 1NGAA 3I33A 1D4XA 5CE3A 4AM6A 4H03B 1BUPA 1XQSC 4ILGB 3SMSA 1SS6A 1Z05A 3DWLA 5M1OA 5TKYA 3O1BA 2P9NB 4K43A 3UKRA 1ATRA 1G99A 4RWTA 3PLAA 4YOUA 3CC7N 4IO9L 2CH5A 3A0IX 2PBDA 3DXKA 4FOIA 3CCLN 3H1VX 1VAZA 1YI2N 4H0YB 1QZ6A 4M7XA 5FPMA 5F1XA 4JKGB 3VF2A 4B1YB 4IOXA 1VQ7N 4DB3A 2YCHA 4IEIA 4WQ5C 4FVUA 4BRPA 4BRGA 5AQZA 5TKWA 4A2AA 1KC8O 3KZBA 3CQXA 4JKBA 2ZJQL 3DJCA 5BN9A 3G4SN 4JHDB 2BUPA 1ZC6A 2A5XA 3ENBA 3EL2A 1MA9B 1ZBSA 3HSCA 4WQ5A 4BC4A 2A3ZA 5B8HA 1Y64A 3CJBA 2YHWA 1NGIA 2OTJN 3ATVA 1JCEA 2I7NA 1NGGA 3VPZA 4BRFA 5FPDA 2P9UB 3UKUB 4FWOA 2VCPA 4BC3A 3VGMA 5AQHA 1V4SA 2F9WA 4NB4A 1YXQA 5AQWA 3CPWM 4UY8O 1VQ8N 3TSPA 4XH4A 4GVEA 4BRQA 3OBWA 3UB5A 2CGJA 3K9KA 5FPNA 4Z94A 3PIOL 3W3DA 5AQJA 4BG8A 2F9TA 4EHTA 5LY3A 4IO8A 4HWIA 3LDOA 4NLBA 5F0XA 3K9JA 2IVNA 2P9PA 3JS6A 1S3XA 4FWQA 3I8BA 3ULEB 4YOVA 4Y0WA 4QS8A 2DPNA 3D2FA 2WUSA 4AM7A 2E2NA 4B1XB 2D0PA 3QB0A 4EHUA 5AZJA 4PKHA 2QXLA 1NGFA 3CJ9A 3DXKB 3PIPL 4BR2A 1GLDG 1NMDA 4OPHA 2V51B 4CD1A 5KPZA 1BA0A 1KAZA 5CHIA 2A40A 3UE5A 1N8RO 4G9ZA 5GAHP 2HBJA 4IJNA 4R79A 3P31A 3W0LA 3H45C 3A5NC 4MDBA 3P38A 3VF4A 3QDKA 3MDQA 4BRAA 1T44A 1KAXA 2YHXA 3H3NO 5ELZA 5EVZA 5H1SQ 3ID8A 3ZETB 3CCJN 1YJWN 2YJFA 2GWKA 3IFRA 4BG9A 2NRXA 4CZJA 1SAZA 2Q1NA 1K8AO 2HBLA 4K25A 1S72N 3CC4N 2E2QA 3TSUA 5GIPA 1K9MO 1R59O 4XH5A 2VWBA 3E9PA 3T69A 1BA1A 4O8UA 3HOSA 1NJIO 3O9RA 3CMAN 3SAFA 2GX9A 1NGBA 1U6ZA 4MLEA 1Q81O 4LC9B 2GTDA 3LDNA 2Q31A 1EQYA 3R9PA 5JVHL 1BO5O 5M1PA 3FZFA 4MO5A 4C1NK 1HX1A 4BC5A 3P39A 4B1ZA 3C6AA 4DQ8A 3NMUA 4A2BA 3E9OA 5M1NA 2P9NA 3LL3A 2P9IB 4CZMA 3LDQA 2NLXA 1GLEG 1WOQA 4H0VB 3HZ6A 4YORA 4JKGA 1KQSM 3HBTA 5C0YA 2GEMA 4I6MB 3G71N 1E4GT 3MCAB 4FWPA 1C0GA 5AQXA 4A57A 4IOCL 3SAGA 4JHDA 3TU5A 4CZGA 3JXUA 3CCMN 1V4TA 4H5VA 4IZ9A 2NRHA 3O9TA 3S41A 4YOWA 3U4LA 5AQSA 3MN5A 3EE9A 3NVMA 3U9DA 3ZYYX 3WQUA 3VOVA 3ZEUA 5ADXH 2P9KB 3AAQA 2P9UA 3UKUA 3IKMA 3AGRA 4C1NI 4CBWA 3CD6N 5JLFA 4F9OA 4H5RA 5JMVA 3E1YA 4JK8A 2VYPA 4PKGA 5AQKA 1Q18A 2E2OA 2WFBA 1Q82O 1YIJN 2BTFA 3VETA 3RVCA 4YOXA 3M3ZA 1XUPO 4GNIA 2W41A 1OVYA 4K42A 1EO1A 5E84A 3SLCA 2QWOA 3ULEA 3N4PA 1WUAA 5AFUA 4JKEA 4WF9L 2GELA 4FWMA 4BRNA 3FZMA 2NRTA 3KK7A 4FWNA 4QS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P90 A;  2WFB A;  2YX6 A;  1T3V A;  2QTD A;  2KLA A;  1O13 A;  2RE2 A;  1EO1 A;  1RDU A; 
#chains in the Genus database with same CATH topology
 4DR2 K;  1QVG M;  1WLJ A;  3SBT A;  2ASO A;  3U9Z A;  1RT5 A;  2QXF A;  4OVL A;  2GUP A;  4AF1 A;  4BRM A;  3PSF A;  3C6U A;  4FLT A;  3C6H A;  2D0O A;  4CJS A;  3CCV N;  3CM5 A;  2UXD K;  1J9A A;  1NU0 A;  4CEF A;  4Z4F A;  2HHQ A;  1E4F T;  4FWK A;  4WYB A;  4M41 A;  4B3S K;  3A5L C;  3EKS A;  3LPT A;  3M8R A;  3AVG A;  1HJO A;  3OS1 A;  1BDG A;  3R6M A;  5F2R A;  2KLA A;  3L8B A;  4KH4 A;  3VQ6 A;  1DT9 A;  3J8A A;  4GVM A;  3OYL A;  4I2P A;  4NO7 A;  3CFP A;  1HJR A;  4JI4 K;  2NZT A;  2KFZ A;  1NGJ A;  1WN7 A;  4MO4 A;  3ZSY A;  3LAM A;  1KRP A;  3HO1 A;  1NGC A;  4DFM A;  2HNZ A;  3AO4 A;  4OKE A;  2PY5 A;  3RTV A;  2QEX N;  4JKF A;  4FPB A;  3VTH A;  3CCR N;  2P51 A;  1YVN A;  5GIN A;  4BRI A;  2CGL A;  2PAV A;  1RDU A;  5DM7 L;  3SPY A;  3U3G A;  5BPN A;  4CF8 A;  2I5J A;  4IFY A;  4MDA A;  3K5L A;  1NMN A;  3DOL A;  3CC2 N;  1HPM A;  1RBV A;  2VGN A;  1JCG A;  4FJ7 A;  3SNN A;  3PX4 A;  3M6G A;  4OGC A;  1X3N A;  1T7P A;  1BG3 A;  3WT0 A;  4JK9 A;  2HF3 A;  5AQO A;  3O3H A;  4FWL A;  2O8D A;  4XH1 A;  5KTQ A;  4CBX A;  5K14 A;  3HT3 A;  2JWK A;  1NGE A;  3WEE B;  4LH5 A;  1XMO K;  2VWK A;  1BIS A;  3ZX3 A;  1VQN N;  4RCH A;  3IDH A;  5EX5 A;  3TAR A;  4A59 A;  4OPK A;  3EKU A;  1RGI A;  5AQV A;  2J4R A;  1VQ6 N;  2Q36 A;  4FWS A;  3KK3 A;  5AZI A;  2P9L A;  3VQ4 A;  4A61 A;  3FR0 A;  3I0R A;  4ISF A;  4CZH A;  4F8R A;  4HHT A;  1TL1 A;  3HM8 A;  3K58 A;  1C0U A;  1W0H A;  3K57 A;  4N41 A;  1VSK A;  1FXX A;  1TUU A;  2A1R A;  3M8P A;  1KCF A;  3ALY A;  3SZ2 A;  3ZX2 A;  1XI1 A;  1TYQ A;  4BGB A;  4DQI A;  2PYL A;  4PQU A;  3G0Z A;  1A5V A;  1JLG A;  3DLE A;  4JLH A;  2HST A;  1U2V A;  1P90 A;  1RNH A;  1VSM A;  3LZI A;  3D2E B;  3IG1 A;  1ASW A;  5BPL A;  3VES A;  4OGE A;  4KHY A;  3KKR A;  5SZT A;  2P9S B;  1TUY A;  4DR7 K;  2YX6 A;  3FE1 A;  4DSI A;  3DRP A;  1C0M A;  1QHT A;  4C8O A;  3TWH A;  4LY7 A;  3S3O A;  3KJV A;  1SV5 A;  2ZD1 A;  3MCP A;  1MWM A;  3OYN A;  3WNG A;  4FZX C;  3QEX A;  3KWG A;  4CJ4 A;  1KD1 O;  4E3S A;  1LAV A;  3NH0 A;  3TPQ A;  2A1S A;  1X9S A;  3B8A X;  3CJA A;  2OZS A;  3LP3 A;  4CJW A;  2QWP A;  1ZXO A;  4DKW A;  1BU6 O;  1VQM N;  3D45 A;  2Q3S A;  3VEZ A;  4NCA A;  2QWM A;  5KRT A;  2F4V K;  4DFK A;  3S3N A;  1YF5 L;  1GLC G;  3O8M A;  3CQY A;  3PV8 A;  3KLI A;  1HPZ A;  1GLB G;  1LW0 A;  2XY7 A;  3RMA A;  1BI4 B;  1HKB A;  3LP1 A;  2OCE A;  5DM6 L;  1BOT O;  2FLO A;  3U3Y A;  1QVF M;  4CJP A;  3AGK A;  3S3M A;  3UKR B;  2I7P A;  1C0F A;  1RCH A;  4FJ5 A;  3OW2 M;  2FXU A;  3SQ2 A;  2FSJ A;  3CPE A;  1RDA A;  3H46 O;  3RR7 A;  2NRZ A;  1GOA A;  4FW2 A;  2FBX A;  3AAR A;  3CI5 A;  1JKH A;  4FL9 A;  3BUZ B;  4FWR A;  2F96 A;  1I39 A;  2W6K A;  1S1T A;  4JKC A;  4W5N A;  3AY9 A;  4C8L A;  5CYM A;  2XY5 A;  2BH1 A;  5HRO A;  1RTH A;  5HP1 A;  1L5U A;  2E5L K;  1ZYQ A;  3F9K A;  3CF5 L;  2A41 A;  3H3O B;  3VEX A;  3THW B;  4ELV A;  3B6P A;  3C7N A;  1XMQ K;  2O8B A;  4O44 A;  5C15 A;  3LP2 A;  4M42 A;  4AHU A;  2P5G A;  1VSJ A;  4DV5 K;  3HST B;  3K5M A;  5J2M A;  2Z1J A;  5FRO A;  5AZJ B;  5HRR A;  3G10 A;  3TSQ A;  3AVB A;  4KTW A;  4BR7 A;  5HRS A;  3L4I A;  4CF1 A;  2NNW A;  1NKC A;  1NK4 A;  2V7Y A;  4J8F A;  3DXM A;  1QQM A;  3EO3 A;  2O8E B;  3AAP A;  3PO4 A;  3MX5 A;  4B9Q A;  5JIC A;  4DTM A;  3VQ5 A;  4FK2 A;  3E9L A;  1HQU A;  3VQ9 A;  1REV A;  3F9M A;  4G1Q A;  1Q86 O;  2G8V A;  5AQM A;  1O13 A;  3MEG A;  2V7Z A;  1YTU A;  3HP6 A;  4O0J A;  4FOE A;  1RBR A;  1W2B M;  4DHY A;  4IEE A;  2EHG A;  5CYQ A;  1S1X A;  1Q8I A;  4JI1 K;  1VSI A;  4AM6 A;  1TAQ A;  3CYM A;  1BUP A;  1XQS C;  1Z05 A;  1RT4 A;  2P9N B;  1G99 A;  4DFP A;  3CC7 N;  4IO9 L;  3OYG A;  4GMJ B;  3AO1 A;  4H0Y B;  4DTP A;  4M7X A;  5F1X A;  3VF2 A;  4QCL A;  4IOX A;  4DB3 A;  3NFA A;  1IKW A;  2R7Y A;  4BRG A;  4GW6 A;  4CHZ A;  1HNV A;  4A2A A;  1KC8 O;  2QK9 A;  3TAM A;  3AVC A;  5BN9 A;  3OYH A;  4BC4 A;  1MA9 B;  4WQ5 A;  5B8H A;  1XNR K;  5CZ1 A;  1NJZ A;  2YHW A;  1LWF A;  2OTJ N;  4JI6 K;  4DU4 A;  5CY4 A;  4R5P A;  5FDL A;  1NK8 A;  1KVA A;  5FPD A;  1U47 A;  4FWO A;  4BC3 A;  4CJV A;  2JGU A;  4Z4E A;  3CPW M;  1YXQ A;  1VQ8 N;  3TSP A;  3ZSV A;  4K8X A;  5FPN A;  3PIO L;  5AQJ A;  2F9T A;  3P83 D;  5LY3 A;  4Z4G A;  4NLB A;  4KV8 A;  5F0X A;  3K9J A;  3ULE B;  2P9P A;  4FWQ A;  5LMN K;  3QES A;  4YOV A;  4Y0W A;  4EHU A;  2QXL A;  3NE6 A;  4LSL A;  3PIP L;  5DK5 A;  1GLD G;  4BR2 A;  2V51 B;  1B92 A;  1QSL A;  4IJN A;  3P31 A;  5C24 A;  4IBN A;  4FM1 A;  3QDK A;  1T44 A;  3THY B;  2YHX A;  3V9Z A;  5H1S Q;  3ZET B;  2YJF A;  2GWK A;  4CZJ A;  4CE9 A;  2Q1N A;  1JLB A;  1S72 N;  3CC4 N;  3TSU A;  5GIP A;  4CEZ A;  4X62 K;  4O8U A;  3F73 A;  1IBM K;  3O9R A;  1J5E K;  3O3G A;  2G8U A;  3RRH A;  1Q81 O;  2GTD A;  3R9P A;  1BO5 O;  4H8K A;  4MO5 A;  1HX1 A;  4B1Z A;  1SKW A;  4LD0 A;  4NCB A;  3NCI A;  1R0A A;  1GLE G;  2OPS A;  1U49 A;  4DSK A;  4F2S A;  4H0V B;  3L2U A;  4YOR A;  4YHH K;  4JKG A;  3VQP A;  3HBT A;  4I6M B;  4FWP A;  3SUQ A;  4M3T A;  1NG9 A;  2Z1G A;  5AQX A;  4A57 A;  3JXU A;  4H5V A;  5HRN A;  1J5O A;  4IZ9 A;  1XWL A;  4YOW A;  3RWU A;  4RW6 A;  3MN5 A;  4WE1 A;  3AA2 A;  3WQU A;  4HVJ A;  3ZEU A;  2P9K B;  3AAQ A;  4BAC A;  1X9M A;  3AGR A;  4B3M K;  4AIL C;  2KZZ A;  5D3G A;  3EZ5 A;  4B3R K;  4H5R A;  1L3S A;  5JMV A;  3IRX A;  2VYP A;  4B9V A;  3PY8 A;  4CEC A;  4CJ5 A;  2BTF A;  1C1B A;  4FVM A;  4LF6 K;  5KRS A;  2VWJ A;  4DV4 K;  2JLE A;  1C6V A;  4M3W A;  4JKE A;  4WF9 L;  1I94 K;  1JXB A;  2GEL A;  2RKI A;  1VK0 A;  2EX3 A;  2NRT A;  3KK7 A;  4CGI A;  1D5A A;  4DTJ A;  3F2K A;  4PL7 A;  3ID6 A;  4CHP A;  3TAB A;  1CXQ A;  1J54 A;  3V1Q A;  2UU9 K;  1HNX K;  4IFV A;  5AQF A;  5LJV A;  3AVI A;  3CXC M;  5SWM A;  4FZY A;  3T7Z A;  1ESV A;  2FSN A;  4AH9 A;  1RDD A;  1BQM A;  3O4W A;  1X9J A;  4GY2 B;  4JYA K;  1HNW K;  3ZEU B;  2HF4 A;  3FFK B;  2D0C A;  4A5B A;  3HP9 A;  2NRV A;  4EZ6 A;  4J2E A;  3IAY A;  3THX B;  4M3Y A;  3KWI A;  4A62 A;  4ZTF A;  4CED A;  5FRN A;  3EY1 A;  1YJ9 N;  4OLA A;  3AVL A;  4KTZ A;  3QIN A;  3AVN A;  2WBN A;  4N5S A;  3D7E O;  3C65 A;  4PY5 A;  1CLQ A;  4OPA A;  2WON A;  4EP5 A;  3RSE B;  1TKZ A;  2E4L A;  1VSL A;  3T1A A;  3QBW A;  2VG7 A;  3ASM A;  3HJF A;  4CJ7 A;  2ZJP L;  3O08 A;  4H5T A;  3AO5 A;  1VQ5 N;  3HI0 A;  4OX9 K;  5CR4 A;  2GWJ A;  4PHT X;  4DS4 A;  1K8K B;  4YDU A;  4XEI A;  3MK6 A;  1RFQ A;  5AQT A;  5AJ3 K;  3AO2 A;  1HLU A;  4KRE A;  3FZL A;  3QLH A;  3IUC A;  3DLH A;  3BDP A;  3CJ7 A;  4RG8 A;  1EXQ A;  5AQR A;  2H3G X;  1CZB A;  1HKG A;  1HRH A;  3SAH A;  1LCU A;  4BRK A;  1RBS A;  4PA1 A;  3HVR A;  1SQK A;  4CZI A;  1NM1 A;  2O4G A;  3CJC A;  1SL1 A;  3BZK A;  3VER A;  4WQ4 A;  5EOY A;  1NK6 A;  3DYA A;  1NK9 A;  1MWK A;  4AHR A;  3ISN C;  4PL8 A;  3VQB A;  2KZM A;  1LOT B;  4DTN A;  2YNG A;  1NGH A;  5I42 A;  1BIU A;  3VGL A;  2XHB A;  1WNS A;  3TR8 A;  3AVA A;  3LWL A;  3CFR A;  4BVP A;  3BP8 A;  3QIC A;  4BR5 A;  2WC9 A;  2RPI A;  3ENH A;  3QEP A;  4FK0 A;  2VG6 A;  3MN6 A;  3O9U A;  3ENO A;  3R8E A;  1DTT A;  2GV9 A;  3LM9 A;  5HRP A;  1D8Y A;  4YNQ A;  4RW8 A;  1S1U A;  1CZ9 A;  3WNH A;  3NH1 A;  4N76 A;  1HMV A;  1HR0 K;  5AQI A;  2E1Y A;  2PYJ A;  5BR9 A;  5GIO A;  5FPE A;  1XHZ A;  2KQ2 A;  4CF2 A;  1IV0 A;  4CBU A;  3OYI A;  2B6A A;  1WBD A;  1ZBH A;  4GV6 A;  3FZH A;  4C23 A;  2IOC A;  3OY9 A;  1N36 K;  4GV9 A;  3OYB A;  4M3U A;  2W40 A;  3OYM A;  3SV3 A;  4OPJ A;  4DTO A;  3FLC O;  3TTD A;  4KHW A;  4CFD A;  5M1K A;  4JS4 A;  2KHO A;  1NK7 A;  4LFC K;  1VQP N;  3HOT A;  3FGU A;  4BRO A;  4BY9 C;  3EZW A;  1TGO A;  3SYZ A;  3OS0 A;  1RTJ A;  1JLC A;  4CW7 B;  4B9U A;  3CME N;  1FKO A;  4KHU A;  3LPU A;  2UXC K;  1YIT N;  2O8F A;  1VQ4 N;  3A8Y A;  3WEE A;  4YFU A;  1YAG A;  1BIZ A;  2ASP A;  3C0B A;  4CJT A;  5C10 A;  3AVK A;  3CET A;  1ASV A;  4JV5 K;  4CZF A;  4CJE A;  3OJS A;  2HBK A;  1B9F A;  3WQT A;  2ZJR L;  4DF4 A;  1RDB A;  2YHB A;  3DI6 A;  4IG3 A;  1UA1 A;  1RTD A;  2D5R A;  4CJ3 A;  1TL3 A;  4JN4 A;  2OPR A;  3L6Q A;  4O55 A;  1JXE A;  4DTU A;  1NKE A;  2YNI A;  4FO0 A;  3GBT A;  3ATU A;  3BF3 A;  4E1J A;  1VSH A;  4BR9 A;  2XRI A;  4DFJ A;  5C25 A;  3SUP A;  1U4B A;  3ZSZ A;  1ZBI A;  3D6R A;  3KD1 E;  4GKJ K;  4IKF A;  1KVC A;  2BE2 A;  4DSJ A;  2RE2 A;  3QO9 A;  3SBG A;  3TAP A;  2O8F B;  3D2E A;  1OH5 A;  4JS5 A;  2Q2R A;  4CFC A;  2P9S A;  4LF4 K;  3HRG A;  1WSE A;  3H6E A;  4F3T A;  4M45 A;  4CD3 A;  5M1F A;  3KD5 E;  4FJL A;  1NJY A;  4DV6 K;  3OJU A;  4BDY A;  3FZK A;  3M5R A;  4I2Q A;  3VEN A;  4M7Y A;  3OYC A;  2CH6 A;  3O6W A;  4H4O A;  1KFS A;  2E1Z A;  3CJ1 A;  2ZF5 O;  3O9Q A;  4BGA A;  2G8H A;  4LH4 A;  2YKM A;  2IGI A;  1XNQ K;  3AVJ A;  4CZE A;  2F8T A;  1S6P A;  3SQ4 A;  4CER A;  1UAX A;  4I7F A;  2D1K A;  3KLE A;  4ELU A;  3A2F A;  4FSV A;  5HL7 L;  5FLX O;  4CIG A;  1C0T A;  3OHR A;  2BAN A;  3ITH A;  4WCE L;  1YT3 A;  1GLJ O;  4H0O A;  2YJE A;  3QEW A;  3MEE A;  4RW7 A;  4FJK A;  2RN2 A;  2VGM A;  1NGA A;  1D4X A;  4XIU A;  1KTQ A;  1BI4 A;  5JS2 A;  2ATQ A;  1SUQ A;  1SS6 A;  1Z25 A;  5M1O A;  5TKY A;  3PLA A;  3UKR A;  1ATR A;  2CH5 A;  5E41 A;  4FOI A;  3CCL N;  5FPM A;  3J80 O;  1HNI A;  2W42 A;  1SL2 A;  2HVI A;  1S1V A;  3NH2 A;  1T03 A;  2WOM A;  5TKW A;  1YTA A;  2ZJQ L;  3DLB A;  4JHD B;  1ZC6 A;  3ENB A;  4FJM A;  3EL2 A;  1ZBS A;  4CJQ A;  1SKS A;  1NGI A;  4LFA K;  4KHP K;  4DG1 A;  1JCE A;  4OKK A;  2P9U B;  3UKU B;  3NDK A;  1DTQ A;  2VCP A;  3DM2 A;  1JLE A;  5AQW A;  3ZSR A;  4E7J A;  4GVE A;  1X1P A;  3OBW A;  3THW A;  2Z1I A;  3W3D A;  4J2B A;  4LF8 K;  3O4Q A;  4NXN K;  1N8R O;  1S3X A;  4CEA A;  1XHX A;  4JI7 K;  3VQ8 A;  1TK0 A;  2D0P A;  5AZJ A;  3K5O A;  4CF9 A;  1JL2 A;  1X9W A;  4OPH A;  4CD1 A;  4W5Q A;  1BA0 A;  5CHI A;  2HBJ A;  1L3V A;  4CFB A;  4E7L A;  4MDB A;  3VF4 A;  4FCY A;  3LZJ A;  1JLA A;  2O8E A;  3H3N O;  1NK5 A;  3IFR A;  1K8A O;  2HBL A;  4ID1 A;  4FLU A;  2E2Q A;  3V9X A;  4XH5 A;  2HVH A;  3LP0 A;  1NJI O;  4LSN A;  3CMA N;  3SAF A;  1DLO A;  1FKP A;  3VQE A;  4MLE A;  2DY4 A;  1NOZ A;  4LC9 B;  4Z0U A;  3FZF A;  2IC3 A;  3C6A A;  4DQ8 A;  2O8C B;  2P9N A;  2P9I B;  3ZSX A;  4HCC A;  1GOB A;  1WOQ A;  2E6L A;  2YKN A;  5HBM A;  5C0Y A;  2GEM A;  3G71 N;  1TK8 A;  1KSP A;  3QET A;  3JYT A;  3WNF A;  3SAG A;  4QAG A;  3NGZ A;  1UWB A;  3CCM N;  1V4T A;  4FJI A;  3L3V A;  3P5J A;  4B9L A;  2HW3 A;  2G8W A;  3EE9 A;  3NVM A;  4KPY A;  2F8S A;  4X64 K;  1TAU A;  2IS3 A;  4HUE A;  4F9O A;  1S1W A;  2DFF A;  3M8Q A;  2HNY A;  3TAG A;  2E2O A;  4CK2 A;  1SL0 A;  3M3Z A;  1XUP O;  2W41 A;  1OVY A;  1EO1 A;  3OYE A;  3SLC A;  3ULE A;  3N4P A;  5AFU A;  5C42 A;  4BRN A;  4FWN A;  4QS9 A;  4FK4 A;  3VQC A;  4FJX A;  5AR0 A;  2ASM A;  4DR6 K;  1BCM A;  4ID5 A;  1BCO A;  1EWQ A;  4MQ3 A;  5BRH A;  3VEY A;  2QKB A;  2DFH A;  3THY A;  4I9L A;  4F2R A;  3ZET A;  3R3L A;  4CGD A;  3UIQ A;  4L3Q A;  2UUA K;  1XC3 A;  4A5A A;  3OYK A;  5FRM A;  3CCQ N;  4KKO A;  3TI0 A;  4FJH A;  3KKS A;  2JWL A;  5KPT A;  4B8C A;  3O9S A;  2HHH K;  3L2W A;  1DEJ A;  2QM1 A;  3SPZ A;  2KKZ A;  3MX2 A;  4Y1D A;  3MEC A;  2NRW A;  4DLG A;  1QE1 A;  1TV6 A;  3BGR A;  3SUO A;  3DLR A;  4CCH A;  3CCU N;  3QNO A;  1JL1 A;  5BR8 K;  4JKH A;  1EP4 A;  3HL8 A;  2D0A A;  5J2N A;  1RT2 A;  4IOA L;  4I6M A;  2HHS A;  4CFA A;  3VMF B;  2XY8 A;  4RW9 A;  4KO0 A;  3OYA A;  4K41 A;  2ZGZ A;  4GKK K;  1N32 K;  3PX0 A;  4B8A B;  1HYZ A;  5C2D A;  3H08 A;  4DQR A;  2E88 A;  2ZM6 K;  3KLH A;  3KHY A;  2P9K A;  4BE2 A;  3SV4 A;  4BRC A;  3WXJ A;  4O5F A;  3K59 A;  1WAF A;  1YHQ N;  4CEO A;  3C6T A;  4JI2 K;  3SMP A;  4CGH A;  3T19 A;  3EEQ A;  1X3M A;  2HHV A;  3GDQ A;  3WUH A;  1ATN A;  4YOT A;  2WTU A;  4I9Q A;  3QER A;  2HND A;  3TAN A;  3NBP A;  4GV3 A;  1RDC A;  3D0P A;  5EY4 A;  3QBX A;  3T1H K;  4BQL A;  4JD2 A;  1OKJ A;  4B3O A;  4DV2 K;  1OH7 A;  3MN9 A;  4WFA L;  3KIO A;  3HPH A;  2ITG A;  4IDK A;  3GG4 A;  4Q0B A;  2HHW A;  2FF6 A;  1K73 O;  2HHT A;  3DOK A;  3QFU A;  3H1Q A;  4F3O A;  1VRT A;  4DR5 K;  3THX A;  3WNE A;  5AQY A;  1QHA A;  3DAW A;  4U67 L;  1QQO A;  1QZ5 A;  5KQ8 A;  3HPG A;  5KGX A;  4NXM K;  4YOY A;  3QEV A;  3NF7 A;  3ZSW A;  4EIA A;  3J7A P;  2HOE A;  4WFN L;  1Q7Y O;  3OYJ A;  4PWD A;  4TSX A;  2KFN A;  1D9D A;  3DMJ A;  3RSE A;  4PKI A;  4W5O A;  5AFU H;  1MU2 A;  4BR0 A;  3TAF A;  3GE1 A;  4AQY K;  3R1X A;  4H5W A;  4HTL A;  3CHW A;  4JD2 B;  5AQL A;  3RMD A;  2Q97 A;  2G8F A;  4IJA A;  1TKX A;  3DLK A;  1K8K A;  1MDU B;  3MAQ A;  1RTI A;  4BC2 A;  2ITM A;  4W5R A;  3MN7 A;  4NYF A;  3G6E N;  1LW2 A;  1NGD A;  3VEW A;  3MXJ A;  1VQL N;  2QTD A;  3DLG A;  4NLC A;  3VA0 A;  3L2Q A;  1J6Z A;  2HB5 A;  4CIE A;  1QQC A;  4CEE A;  1NBW A;  4DTR A;  1N33 K;  3ULD A;  5JLH A;  3TTC A;  4EAH D;  4RTF D;  2QWN A;  4Z4C A;  3VTI A;  4O8K A;  4IDH A;  4N47 A;  1NLV A;  4KHQ A;  4EFH A;  1G15 A;  4FJG A;  1IKX A;  5HLF A;  3QEI A;  2HHX A;  4JAX A;  4KB0 A;  5DMR A;  3AV9 A;  1WSH A;  3I0S A;  5KQD A;  1U45 A;  4FJ9 A;  4JEP A;  4E7I A;  3LAL A;  2FC0 A;  3VN5 A;  3LDL A;  2G8K A;  2AA4 A;  4PUO A;  1ITG A;  4JK7 A;  3OBY A;  5JVG L;  2HMI A;  4B9S A;  2ZWH A;  4FM0 A;  4FJN A;  3F5T A;  3K0S A;  2NRR A;  4YY3 K;  3A5O C;  1ILY A;  4KH5 A;  3KTQ A;  2E2P A;  1VQO N;  2XO7 A;  2QI2 A;  4DSF A;  1GOC A;  1UA0 A;  3WXL A;  4JRP A;  2CGK A;  2OAN A;  1EX4 A;  4DV1 K;  4ISG A;  1VHX A;  3TAE A;  3CIP A;  4DU1 A;  1JJ2 M;  1GLL O;  3SK3 A;  3I56 N;  3QIO A;  3J7Z O;  3LWM A;  4HCB A;  2Q0R A;  3L3U A;  4FYD A;  5GAE P;  2Q0U A;  1WSF A;  4FLZ A;  3ZX0 A;  5E26 A;  2QA4 N;  3I8D A;  3HTV A;  1N34 K;  3BEX A;  1EKE A;  3IMX A;  3PO5 A;  4CZL A;  2QW9 A;  3JSM A;  4KFB A;  4F4K A;  3D2F B;  3RMB A;  5AQU A;  4BDP A;  3M1F A;  4AHV A;  2OZM A;  1RT6 A;  3QNN A;  3HM9 A;  4CF0 A;  4U7B A;  1WSJ A;  3V1R A;  1SZ2 A;  2QWQ A;  4DTS A;  4K8Z A;  2IVO A;  4KBO A;  2HHU A;  1HKC A;  2FBY A;  3GOI A;  4KAZ A;  3G25 A;  4M3R A;  1KAY A;  1DKG D;  3O1W A;  4IXC A;  3SJJ A;  4CHN A;  4L8R B;  5BN8 A;  1FJG K;  3GL1 A;  3KK1 A;  4JI5 K;  3I33 A;  4ELT A;  1NOY A;  4ILG B;  1K6Y A;  4K43 A;  3OYD A;  4H4M A;  1Z26 A;  4HUG A;  4YOU A;  5KGW A;  1IBK K;  3RMC A;  3A0I X;  2ZQB A;  1RBU A;  2PBD A;  3DXK A;  1WBB A;  1QZ6 A;  4B1Y B;  3SQ1 A;  4IEI A;  4WQ5 C;  4FVU A;  4CGF A;  3KZB A;  3VQA A;  3DJC A;  4HTU A;  3G4S N;  1OVQ A;  2BUP A;  1ZBF A;  2A5X A;  3EYZ A;  2P5O A;  3NF9 A;  3HSC A;  1Y64 A;  4E19 A;  4FLV A;  3ZSQ A;  1NNE A;  3VPZ A;  1HNZ K;  3ZT1 A;  1J53 A;  3VGM A;  2P1J A;  1V4S A;  3KK2 A;  3V4I A;  4NB4 A;  4CK1 A;  4FW1 A;  4KHS A;  3UB5 A;  4JI3 K;  4C8K A;  4Z94 A;  3K9K A;  3V81 A;  4BG8 A;  4Q5V A;  3LDO A;  2IVN A;  3I8B A;  4QS8 A;  4UQG A;  2WUS A;  4AM7 A;  4B1X B;  3QB0 A;  4Y1C A;  1BGX T;  3CJ9 A;  3DXK B;  1LWE A;  4X65 K;  4E89 A;  3V9S A;  1N5Y A;  1KAZ A;  3HK2 A;  3UE5 A;  5GAH P;  3VA3 A;  4C8M A;  4R79 A;  3A5N C;  4BRA A;  1IKY A;  3P38 A;  5J2Q A;  5ELZ A;  5EVZ A;  3CCJ N;  4BG9 A;  3CG7 A;  2NRX A;  1SAZ A;  3KLF A;  4DSL A;  4K25 A;  3HXM A;  1K9M O;  1R59 O;  3V9U A;  3SCX A;  3E9P A;  3T69 A;  1BA1 A;  3HOS A;  3RR8 A;  3OS2 A;  1NGB A;  5JVH L;  3PX6 A;  5M1P A;  4FJ8 A;  4C1N K;  1WSI A;  4CHQ A;  3E9O A;  1JLQ A;  1WAJ A;  3LL3 A;  4CZM A;  3LDQ A;  2NLX A;  4FLW A;  1S5J A;  3HZ6 A;  4DSE A;  3OYF A;  3NF8 A;  3CQ8 A;  1VSE A;  1C0G A;  1EWR A;  4IOC L;  4JI0 K;  4JHD A;  3TU5 A;  4CZG A;  4MFB A;  2NUB A;  2NRH A;  3O9T A;  3S41 A;  1VSF A;  5AQS A;  2ETJ A;  3KLG A;  3K5N A;  3NHG A;  2PZS A;  3VOV A;  2VQF K;  1T05 A;  5EU7 A;  2P9U A;  3UKU A;  1LAW A;  4CBW A;  3CD6 N;  5JLF A;  2OYQ A;  3E1Y A;  4N56 A;  4J2A A;  1Q18 A;  1Q82 O;  4CJK A;  3VET A;  3RVC A;  4GNI A;  4FXD A;  2BDP A;  5E84 A;  2QWO A;  1KFD A;  3TAQ A;  4FWM A;  2O8D B;  3FZM A;  4CES A;  4DWI A;  1C1A A;  3KVG A;  3RRG A;  2QWR A;  3ZLJ A;  3ZSO A;  3ZT0 A;  4FLX A;  1ATS A;  2IVP A;  2E6M A;  3OA9 A;  3OTO K;  4DF8 A;  3AA4 A;  3C94 A;  4CI6 A;  4WFB L;  1H1V A;  4B9T A;  4AHC A;  5AZI B;  2P9L B;  1YUW A;  4CJL A;  3AA3 A;  4JKA A;  4DR1 K;  2OA8 A;  1T6C A;  1OH8 A;  3WXK A;  3EN9 A;  4KH6 A;  4E7K A;  3NVK A;  3AVM A;  3O80 A;  4CZK A;  4H0P A;  4BRH A;  2O8C A;  4B9N A;  4FZZ A;  1RDW X;  1TYQ B;  2P9I A;  5J1E A;  4DR4 K;  1HQE A;  1ASU A;  1NWK A;  1QSY A;  2V52 B;  2ZE2 A;  3NGY A;  3CCS N;  1U2V B;  2UYT A;  1RT3 A;  3O4N A;  3CFO A;  2D4W A;  4CVN E;  4FM2 A;  4DV0 K;  2HBM A;  4QOZ B;  2X74 A;  2RHK A;  4H0X B;  4YDU C;  5AQP A;  3J81 O;  3HYF A;  1Q9Y A;  5IWA K;  1T6D A;  2XY6 A;  5BRD A;  3ZT4 A;  1L3U A;  2YNH A;  4X66 K;  5CZ2 A;  2E20 A;  4EZ9 A;  3T3F A;  1KXP A;  5I9E B;  5MLC Q;  4B9M A;  2D0B A;  4WQ4 C;  2QWL A;  1S9E A;  4C8N A;  4CIF A;  1T3V A;  1GLA G;  4O4G A;  3LM2 A;  1DGK N;  3V9W A;  4M3Z A;  4ILJ A;  3AVH A;  2X6S A;  4H0T B;  3EE8 A;  4QS7 A;  3N4Q A;  3OVN A;  5AQN A;  2X78 A;  4H5N A;  1EET A;  1B9D A;  5KPR A;  4JKD A;  4CHY A;  2VG5 A;  3AO3 A;  5LJW A;  1L3T A;  1VQ9 N;  4JRQ A;  3WXI A;  4DTX A;  1QS4 A;  3MMV A;  4M63 C;  2F7T A;  1F21 A;  4BRE A;  3DLL L;  1S9G A;  1NJW A;  1IO2 A;  1QQN A;  3ZCM A;  4RW4 A;  3PUF A;  3A5M C;  5AQG A;  5EXW A;  3V1O A;  1N6Q A;  2AJQ A;  5BRE A;  4Z4H A;  4V19 S;  5BRF A;  1U04 A;  2UUC K;  4BRD A;  4M3X A;  1M1K O;  5C12 A;  2B4J A;  3TTF A;  4DU3 A;  4MLH A;  1HUX A;  2EWS A;  4BRL A;  3VQ7 A;  4BQZ A;  4DS5 A;  1IG8 A;  3NAE A;  4DR3 K;  3VQD A;  1JCF A;  4KI6 A;  1Q9X A;  1ZBU A;  4AHS A;  2OTL N;  5GAD P;  1A5X A;  1BWF O;  4BE0 A;  1Y97 A;  4IWV A;  2AP1 A;  2KTQ A;  3VGK A;  2UUB K;  3U6F A;  3JAM O;  2OPQ A;  3IS9 A;  3U8X A;  4DQQ A;  3L4Q A;  3Q7B A;  3C7N B;  2O8B B;  1FK9 A;  2FF3 B;  5LL6 Z;  1BQN A;  3J7Y P;  3QFP A;  1W7A A;  2DFE A;  3ZT3 A;  1U48 A;  1D9F A;  1RBT A;  3SJH A;  2HMP A;  3CM6 A;  4BVO A;  3MXI A;  4B1U B;  2PFU A;  2E8A A;  3QML A;  5KI6 A;  3V6D A;  3DXM B;  3MWT A;  2UXB K;  2LSN A;  3E01 A;  3LDP A;  4DUZ K;  3BF1 A;  4IFE A;  2O4I A;  2FSK A;  2FBT A;  3WXM B;  1Z6R A;  5AQQ A;  1TKT A;  1S22 A;  2YI1 A;  5I3U A;  3QIP A;  1W97 L;  4CK3 A;  4B08 A;  2BGG A;  1E3M A;  4OLB A;  4B1V A;  4BE1 A;  3CER A;  1W9H A;  2DTU A;  4DQP A;  1GLF O;  2IIR A;  4DUY K;  2ZGY A;  4O5B A;  1RT1 A;  4BR4 A;  5GAG P;  1IBL K;  3Q7C A;  3LDS A;  2YHY A;  3O3F A;  2X6N A;  3MWP A;  2Y1I A;  4DCH A;  1P8Z A;  4NYN A;  4CJR A;  3S9H A;  1IJJ A;  3C95 A;  2A42 A;  3NF6 A;  1HYV A;  3I55 N;  1KVB A;  1I3A A;  3VEO A;  4LF9 K;  2GBZ A;  2YV0 X;  5BPM A;  3B6O A;  3AVF A;  1TK5 A;  3LAK A;  3L0Q A;  4ILH A;  4JNE A;  5M1Q A;  1NJX A;  2P9P B;  1VQK N;  1M90 O;  4CJF A;  1WSG A;  4OO1 J;  1FW6 A;  4CHO A;  5HOO A;  3O5B A;  5IT9 O;  3CCE N;  3P4I A;  4FPA A;  5ADX A;  3VF6 A;  4OKJ A;  1CZA N;  4ISE A;  4ICL A;  3P1G A;  2A6A A;  1SKR A;  4B1W B;  5C2F A;  1IG9 A;  3VEV A;  2YHA A;  4KB1 A;  3K2P A;  1TKD A;  3E66 A;  4KI4 A;  4AHT A;  3LAN A;  1A5W A;  4CEB A;  1OH6 A;  4E0D A;  1BL3 A;  5CE3 A;  1QTM A;  1RIL A;  4H03 B;  3HPO A;  3SMS A;  3DWL A;  5LMU K;  3O1B A;  4BDZ A;  4RWT A;  1ZBL A;  3FFI A;  2B5J A;  4BWM A;  3H1V X;  1VAZ A;  1YI2 N;  1UOC A;  1LV5 A;  4JKG B;  1VQ7 N;  2YCH A;  2IDO A;  4BRP A;  5AQZ A;  4W5T A;  3NGI A;  3CQX A;  4CGG A;  4JKB A;  4ZHR A;  5T7B A;  4BWJ A;  2A3Z A;  4HUF A;  1VSD A;  3BY5 A;  3CJB A;  1NK0 A;  3ATV A;  4FJJ A;  1BHL A;  2I7N A;  1NGG A;  4BRF A;  3L2V A;  3SQ0 A;  4CGJ A;  3L2R A;  5AQH A;  2F9W A;  4UY8 O;  1IH7 A;  1T8E A;  4XH4 A;  4DV3 K;  4IG0 A;  2VQE K;  1VRU A;  4BRQ A;  2QKK A;  3DRS A;  2CGJ A;  4K0K K;  4EHT A;  3MED A;  4HWI A;  4IO8 A;  4DMN A;  3JS6 A;  2GUI A;  3HVT A;  2IAJ A;  2DPN A;  3D2F A;  2E2N A;  4PKH A;  3SUN A;  1NGF A;  4LF7 K;  1NMD A;  5KPZ A;  4G9Z A;  2A40 A;  3PSI A;  1KLN A;  2G8I A;  3MXM A;  1QSS A;  3W0L A;  3AA5 X;  3H45 C;  3MDQ A;  4J2D A;  1KAX A;  4CEQ A;  3ID8 A;  1YJW N;  3VQQ A;  2FBV A;  3THV A;  1XC9 A;  4E7H A;  5JS1 A;  4FLY A;  1TVR A;  4OJR A;  4DQS A;  2Y1J A;  3T1Y K;  1HYS A;  2VWB A;  1IKV A;  1NKB A;  5J2P A;  1KLM A;  2GX9 A;  1WB9 A;  1U6Z A;  3LDN A;  2Q31 A;  1EQY A;  2KW4 A;  3ZT2 A;  4BC5 A;  3P39 A;  3SI6 A;  3NMU A;  2OPP A;  4A2B A;  4E1N A;  5M1N A;  2W6L A;  1JLF A;  1KQS M;  4LF5 K;  1E4G T;  3MCA B;  4DV7 K;  3DRR A;  2RF2 A;  4ZTJ A;  4LFB K;  4JI8 K;  4EP4 A;  4Z4I A;  3U4L A;  1C1C A;  3U9D A;  3ZYY X;  2YNF A;  4NCG A;  5ADX H;  4KRF A;  4B3T K;  3IKM A;  4C1N I;  3BZC A;  4E1M A;  1YVU A;  5A2Q O;  4JK8 A;  4PKG A;  3M8S A;  5AQK A;  4KTQ A;  4O0I A;  2WFB A;  1YIJ N;  1O1W A;  4YOX A;  4K42 A;  4KHN A;  1RT7 A;  4CJU A;  2Z1H A;  1CXU A;  1WUA A;  1S6Q A;  4DLE A;  1LWC A;  1YJN N; 
#chains in the Genus database with same CATH homology
 3F2K A;  4PL7 A;  3KVG A;  5AR0 A;  3ID6 A;  2ASM A;  1QVG M;  2QWR A;  3SBT A;  2ASO A;  5AQF A;  3U9Z A;  5LJV A;  1ATS A;  2IVP A;  2GUP A;  4AF1 A;  3CXC M;  3OA9 A;  4BRM A;  5BRH A;  3VEY A;  4CI6 A;  4WFB L;  1H1V A;  3T7Z A;  1ESV A;  2FSN A;  3ZET A;  3R3L A;  3C6H A;  4L3Q A;  2D0O A;  3O4W A;  5AZI B;  2P9L B;  1XC3 A;  3CCV N;  4A5A A;  1X9J A;  1YUW A;  3CCQ N;  4JKA A;  4GY2 B;  1T6C A;  2JWL A;  3ZEU B;  2HF4 A;  3FFK B;  5DM7 L;  4A5B A;  5KPT A;  3WXK A;  2NRV A;  3O9S A;  1E4F T;  4FWK A;  3EN9 A;  4KH6 A;  4WYB A;  3NVK A;  3A5L C;  3EKS A;  3KWI A;  4A62 A;  3O80 A;  1DEJ A;  2QM1 A;  2KKZ A;  1YJ9 N;  3MX2 A;  4CZK A;  4H0P A;  4BRH A;  1HJO A;  1BDG A;  3R6M A;  5F2R A;  2KLA A;  2NRW A;  4KH4 A;  1DT9 A;  3J8A A;  2WBN A;  1RDW X;  1TYQ B;  2P9I A;  3D7E O;  3C65 A;  4NO7 A;  3CCU N;  1NWK A;  2V52 B;  4OPA A;  3CCS N;  1U2V B;  2NZT A;  2UYT A;  4JKH A;  3RSE B;  4IOA L;  1NGJ A;  4MO4 A;  4I6M A;  2D4W A;  3QBW A;  2HBM A;  1NGC A;  4CJ7 A;  2ZJP L;  2RHK A;  4H0X B;  4YDU C;  3VMF B;  5AQP A;  3O08 A;  2QEX N;  4H5T A;  4JKF A;  4FPB A;  1VQ5 N;  1T6D A;  4K41 A;  3HI0 A;  3VTH A;  3CCR N;  2ZGZ A;  5CR4 A;  1YVN A;  2GWJ A;  4BRI A;  2CGL A;  2PAV A;  1RDU A;  4PHT X;  5GIN A;  1K8K B;  4YDU A;  4XEI A;  5BRD A;  3MK6 A;  1RFQ A;  5AQT A;  5BPN A;  1HLU A;  5C2D A;  2E88 A;  4MDA A;  3KHY A;  2P9K A;  3FZL A;  3IUC A;  4BRC A;  3CJ7 A;  2E20 A;  3CC2 N;  1HPM A;  3WXJ A;  5AQR A;  2H3G X;  1HKG A;  4O5F A;  3SAH A;  1LCU A;  2VGN A;  4BRK A;  1JCG A;  1YHQ N;  1KXP A;  3SMP A;  3M6G A;  5I9E B;  1X3N A;  1X3M A;  1SQK A;  5MLC Q;  3GDQ A;  1BG3 A;  3WT0 A;  3WUH A;  1ATN A;  4WQ4 C;  4CZI A;  2QWL A;  1NM1 A;  4JK9 A;  2HF3 A;  5AQO A;  4YOT A;  4FWL A;  3CJC A;  1T3V A;  4XH1 A;  1GLA G;  3LM2 A;  1DGK N;  4CBX A;  4ILJ A;  4WQ4 A;  3VER A;  5EOY A;  4H0T B;  1MWK A;  2JWK A;  3EE8 A;  1NGE A;  4PL8 A;  3WEE B;  4QS7 A;  3N4Q A;  5AQN A;  4H5N A;  4GV3 A;  1LOT B;  5KPR A;  5EY4 A;  3QBX A;  4JKD A;  1NGH A;  3ZX3 A;  1VQN N;  4RCH A;  3IDH A;  5EX5 A;  5LJW A;  1VQ9 N;  4BQL A;  3WXI A;  4A59 A;  4JD2 A;  3MMV A;  1OKJ A;  3EKU A;  1RGI A;  4M63 C;  5AQV A;  2F7T A;  2J4R A;  3VGL A;  1VQ6 N;  2Q36 A;  3MN9 A;  4FWS A;  4BRE A;  4WFA L;  3DLL L;  5AZI A;  2P9L A;  4A61 A;  1QQN A;  3GG4 A;  3FR0 A;  4BVP A;  3BP8 A;  4ISF A;  3QIC A;  4BR5 A;  2FF6 A;  2WC9 A;  4CZH A;  1K73 O;  3ENH A;  3QFU A;  3A5M C;  3H1Q A;  5AQG A;  5EXW A;  3MN6 A;  3O9U A;  5BRE A;  3HM8 A;  5AQY A;  1QHA A;  3DAW A;  3ENO A;  3R8E A;  5BRF A;  4BRD A;  1TUU A;  3LM9 A;  4U67 L;  5C12 A;  1M1K O;  1QQO A;  1QZ5 A;  5KQ8 A;  3TTF A;  4MLH A;  1HUX A;  2EWS A;  4YOY A;  4BRL A;  3ZX2 A;  4BQZ A;  1IG8 A;  1TYQ A;  4BGB A;  1JCF A;  4EIA A;  2HOE A;  5AQI A;  2E1Y A;  4WFN L;  1Q7Y O;  2HST A;  5BR9 A;  5FPE A;  1U2V A;  5GIO A;  1P90 A;  2OTL N;  3RSE A;  5GAD P;  3D2E B;  4PKI A;  5BPL A;  3VES A;  4CBU A;  1BWF O;  5AFU H;  4BR0 A;  2P9S B;  3GE1 A;  4GV6 A;  3FZH A;  4C23 A;  1TUY A;  4GV9 A;  4IWV A;  2YX6 A;  3FE1 A;  3R1X A;  2AP1 A;  4H5W A;  3VGK A;  4HTL A;  3CHW A;  4JD2 B;  5AQL A;  2Q97 A;  2W40 A;  4IJA A;  3U8X A;  1K8K A;  1MDU B;  3L4Q A;  3Q7B A;  3C7N B;  2FF3 B;  4BC2 A;  2ITM A;  3MN7 A;  3FLC O;  3G6E N;  3MCP A;  1NGD A;  1MWM A;  3VEW A;  3QFP A;  3TTD A;  5M1K A;  3KWG A;  2KHO A;  1KD1 O;  1VQL N;  1VQP N;  3HOT A;  2QTD A;  3FGU A;  4BRO A;  3SJH A;  2HMP A;  4BVO A;  4NLC A;  3EZW A;  4BY9 C;  3TPQ A;  4B1U B;  1J6Z A;  3B8A X;  2PFU A;  3CJA A;  2E8A A;  3QML A;  3DXM B;  3MWT A;  1NBW A;  2QWP A;  1ZXO A;  4DKW A;  3CME N;  1BU6 O;  1VQM N;  3LDP A;  3BF1 A;  4IFE A;  5JLH A;  3VEZ A;  3TTC A;  4EAH D;  4RTF D;  2FSK A;  2QWN A;  3WXM B;  1YIT N;  1VQ4 N;  2QWM A;  1Z6R A;  3A8Y A;  5AQQ A;  3WEE A;  1S22 A;  3VTI A;  4O8K A;  2YI1 A;  1YF5 L;  4IDH A;  1GLC G;  1NLV A;  1YAG A;  2ASP A;  3O8M A;  4EFH A;  3CQY A;  3C0B A;  1W97 L;  5C10 A;  3CET A;  1GLB G;  4JAX A;  4CZF A;  4B1V A;  2HBK A;  3CER A;  5KQD A;  3WQT A;  2ZJR L;  1GLF O;  4JEP A;  2IIR A;  1HKB A;  2ZGY A;  3LDL A;  5DM6 L;  2AA4 A;  1BOT O;  2FLO A;  1QVF M;  4JK7 A;  4JN4 A;  3L6Q A;  3OBY A;  3AGK A;  5JVG L;  2ZWH A;  2I7P A;  3UKR B;  4BR4 A;  5GAG P;  1C0F A;  3Q7C A;  3OW2 M;  3F5T A;  2YHY A;  2FXU A;  2NRR A;  3A5O C;  2FSJ A;  3CPE A;  3H46 O;  4FO0 A;  4KH5 A;  1ILY A;  2E2P A;  2NRZ A;  3GBT A;  1VQO N;  3MWP A;  2QI2 A;  3AAR A;  3ATU A;  3BF3 A;  4E1J A;  4BR9 A;  4DCH A;  1P8Z A;  3CI5 A;  3WXL A;  4FL9 A;  3BUZ B;  1IJJ A;  2CGK A;  2OAN A;  2A42 A;  3I55 N;  4FWR A;  3D6R A;  4ISG A;  3CIP A;  4JKC A;  1JJ2 M;  3AY9 A;  1GLL O;  3SK3 A;  3I56 N;  2RE2 A;  3VEO A;  3SBG A;  3J7Z O;  2BH1 A;  2Q0R A;  3D2E A;  5GAE P;  2Q0U A;  2Q2R A;  2P9S A;  3ZX0 A;  5BPM A;  3HRG A;  3CF5 L;  3H6E A;  2A41 A;  3L0Q A;  5E26 A;  4ILH A;  4CD3 A;  5M1F A;  2QA4 N;  3H3O B;  3HTV A;  3VEX A;  3BEX A;  4JNE A;  3C7N A;  3FZK A;  3IMX A;  3M5R A;  3VEN A;  4M7Y A;  5C15 A;  4CZL A;  5M1Q A;  2CH6 A;  2P9P B;  3O6W A;  1VQK N;  1M90 O;  2QW9 A;  2E1Z A;  3D2F B;  3CJ1 A;  2ZF5 O;  3O9Q A;  4BGA A;  4OO1 J;  5AZJ B;  5AQU A;  3M1F A;  4CZE A;  5HOO A;  3TSQ A;  3O5B A;  4U7B A;  4BR7 A;  3CCE N;  3P4I A;  1SZ2 A;  2QWQ A;  3L4I A;  2NNW A;  2D1K A;  4FPA A;  2IVO A;  4KBO A;  1YJN N;  1HKC A;  2V7Y A;  3GOI A;  4J8F A;  3DXM A;  1QQM A;  3EO3 A;  5ADX A;  3VF6 A;  3G25 A;  1CZA N;  3AAP A;  4FSV A;  1KAY A;  4ISE A;  3MX5 A;  4B9Q A;  5JIC A;  5HL7 L;  2A6A A;  3E9L A;  4B1W B;  5C2F A;  3F9M A;  1DKG D;  3O1W A;  3OHR A;  4IXC A;  1Q86 O;  5AQM A;  1O13 A;  4WCE L;  3VEV A;  1GLJ O;  4H0O A;  2YJE A;  2V7Z A;  3E66 A;  5BN8 A;  4FOE A;  1W2B M;  3GL1 A;  4DHY A;  4IEE A;  2VGM A;  1NGA A;  3I33 A;  1D4X A;  5CE3 A;  4AM6 A;  4H03 B;  1BUP A;  1XQS C;  4ILG B;  3SMS A;  1SS6 A;  1Z05 A;  3DWL A;  5M1O A;  5TKY A;  3O1B A;  2P9N B;  4K43 A;  3UKR A;  1ATR A;  1G99 A;  4RWT A;  3PLA A;  4YOU A;  3CC7 N;  4IO9 L;  2CH5 A;  3A0I X;  2PBD A;  3DXK A;  4FOI A;  3CCL N;  3H1V X;  1VAZ A;  1YI2 N;  4H0Y B;  1QZ6 A;  4M7X A;  5FPM A;  5F1X A;  4JKG B;  3VF2 A;  4B1Y B;  4IOX A;  1VQ7 N;  4DB3 A;  2YCH A;  4IEI A;  4WQ5 C;  4FVU A;  4BRP A;  4BRG A;  5AQZ A;  5TKW A;  4A2A A;  1KC8 O;  3KZB A;  3CQX A;  4JKB A;  2ZJQ L;  3DJC A;  5BN9 A;  3G4S N;  4JHD B;  2BUP A;  1ZC6 A;  2A5X A;  3ENB A;  3EL2 A;  1MA9 B;  1ZBS A;  3HSC A;  4WQ5 A;  4BC4 A;  2A3Z A;  5B8H A;  1Y64 A;  3CJB A;  2YHW A;  1NGI A;  2OTJ N;  3ATV A;  1JCE A;  2I7N A;  1NGG A;  3VPZ A;  4BRF A;  5FPD A;  2P9U B;  3UKU B;  4FWO A;  2VCP A;  4BC3 A;  3VGM A;  5AQH A;  1V4S A;  2F9W A;  4NB4 A;  1YXQ A;  5AQW A;  3CPW M;  4UY8 O;  1VQ8 N;  3TSP A;  4XH4 A;  4GVE A;  4BRQ A;  3OBW A;  3UB5 A;  2CGJ A;  3K9K A;  5FPN A;  4Z94 A;  3PIO L;  3W3D A;  5AQJ A;  4BG8 A;  2F9T A;  4EHT A;  5LY3 A;  4IO8 A;  4HWI A;  3LDO A;  4NLB A;  5F0X A;  3K9J A;  2IVN A;  2P9P A;  3JS6 A;  1S3X A;  4FWQ A;  3I8B A;  3ULE B;  4YOV A;  4Y0W A;  4QS8 A;  2DPN A;  3D2F A;  2WUS A;  4AM7 A;  2E2N A;  4B1X B;  2D0P A;  3QB0 A;  4EHU A;  5AZJ A;  4PKH A;  2QXL A;  1NGF A;  3CJ9 A;  3DXK B;  3PIP L;  4BR2 A;  1GLD G;  1NMD A;  4OPH A;  2V51 B;  4CD1 A;  5KPZ A;  1BA0 A;  1KAZ A;  5CHI A;  2A40 A;  3UE5 A;  1N8R O;  4G9Z A;  5GAH P;  2HBJ A;  4IJN A;  4R79 A;  3P31 A;  3W0L A;  3H45 C;  3A5N C;  4MDB A;  3P38 A;  3VF4 A;  3QDK A;  3MDQ A;  4BRA A;  1T44 A;  1KAX A;  2YHX A;  3H3N O;  5ELZ A;  5EVZ A;  5H1S Q;  3ID8 A;  3ZET B;  3CCJ N;  1YJW N;  2YJF A;  2GWK A;  3IFR A;  4BG9 A;  2NRX A;  4CZJ A;  1SAZ A;  2Q1N A;  1K8A O;  2HBL A;  4K25 A;  1S72 N;  3CC4 N;  2E2Q A;  3TSU A;  5GIP A;  1K9M O;  1R59 O;  4XH5 A;  2VWB A;  3E9P A;  3T69 A;  1BA1 A;  4O8U A;  3HOS A;  1NJI O;  3O9R A;  3CMA N;  3SAF A;  2GX9 A;  1NGB A;  1U6Z A;  4MLE A;  1Q81 O;  4LC9 B;  2GTD A;  3LDN A;  2Q31 A;  1EQY A;  3R9P A;  5JVH L;  1BO5 O;  5M1P A;  3FZF A;  4MO5 A;  4C1N K;  1HX1 A;  4BC5 A;  3P39 A;  4B1Z A;  3C6A A;  4DQ8 A;  3NMU A;  4A2B A;  3E9O A;  5M1N A;  2P9N A;  3LL3 A;  2P9I B;  4CZM A;  3LDQ A;  2NLX A;  1GLE G;  1WOQ A;  4H0V B;  3HZ6 A;  4YOR A;  4JKG A;  1KQS M;  3HBT A;  5C0Y A;  2GEM A;  4I6M B;  3G71 N;  1E4G T;  3MCA B;  4FWP A;  1C0G A;  5AQX A;  4A57 A;  4IOC L;  3SAG A;  4JHD A;  3TU5 A;  4CZG A;  3JXU A;  3CCM N;  1V4T A;  4H5V A;  4IZ9 A;  2NRH A;  3O9T A;  3S41 A;  4YOW A;  3U4L A;  5AQS A;  3MN5 A;  3EE9 A;  3NVM A;  3U9D A;  3ZYY X;  3WQU A;  3VOV A;  3ZEU A;  5ADX H;  2P9K B;  3AAQ A;  2P9U A;  3UKU A;  3IKM A;  3AGR A;  4C1N I;  4CBW A;  3CD6 N;  5JLF A;  4F9O A;  4H5R A;  5JMV A;  3E1Y A;  4JK8 A;  2VYP A;  4PKG A;  5AQK A;  1Q18 A;  2E2O A;  2WFB A;  1Q82 O;  1YIJ N;  2BTF A;  3VET A;  3RVC A;  4YOX A;  3M3Z A;  1XUP O;  4GNI A;  2W41 A;  1OVY A;  4K42 A;  1EO1 A;  5E84 A;  3SLC A;  2QWO A;  3ULE A;  3N4P A;  1WUA A;  5AFU A;  4JKE A;  4WF9 L;  2GEL A;  4FWM A;  4BRN A;  3FZM A;  2NRT A;  3KK7 A;  4FWN A;  4QS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...