4GMJB

Structure of human not1 mif4g domain co-crystallized with caf1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
271
structure length
264
Chain Sequence
QRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSGNAYEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords CCR4-NOT transcription complex subunit 1
publication title The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 264
sequence length 271
chains with identical sequence D, F
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gmjB00
3WNFA 2I5JA 2IAJA 3SPYA 4BE1A 3CG7A 3DMJA 1JLQA 1FXXA 4CGDA 1SV5A 2A1SA 4PQUA 5JS1A 1U04A 3NF9A 4M3XA 2P1JA 3HSTB 3NH2A 4CJKA 3TI0A 1LWEA 4F2SA 5FRMA 2NUBA 1QSLA 1GOAA 1WN7A 4FJXA 4KI4A 4BACA 3D0PA 1XI1A 4EP4A 3H08A 4CEAA 1XHXA 4B9LA 3HPGA 3OVNA 4K8XA 2IC3A 2GBZA 4Z4GA 4CHOA 3NCIA 3C6UA 3NGYA 4KO0A 3OS0A 3OS2A 1LV5A 2Y1IA 3PX6A 3S3MA 1D9DA 3AA2A 1BQNA 4FK2A 4BE2A 2FBVA 1QQCA 1EX4A 3AO4A 3QINA 2DY4A 1NK5A 4KI6A 2DTUA 1FKOA 2G8HA 3KLIA 1VSEA 1REVA 1DLOA 2ETJA 4CHZA 3LAKA 1CZBA 2EX3A 3NE6A 3NGIA 3NAEA 4FJ9A 4OGEA 4I9LA 4AHTA 5EU7A 2F8SA 3ZSQA 4KTZA 4UQGA 1HYVA 2OZMA 3KLEA 1J9AA 1YVUA 3HT3A 4KAZA 1IKVA 1IKWA 1ITGA 2YV0X 3NF7A 2KZZA 3A2FA 5CY4A 3LDSA 3KD5E 3M8QA 4DWIA 4CHPA 1TKZA 2HHTA 3VQPA 4HCCA 3AVLA 3WNGA 4M3RA 4E89A 4KTWA 4E1NA 3VQDA 1W9HA 1NKCA 1ZBHA 2HHUA 1XHZA 2IOCA 4PUOA 3KK1A 4Z4IA 1RBUA 4M45A 3K5LA 4CJ4A 3HVTA 3OYIA 3PX4A 1IKXA 3RMDA 4IG3A 1ASVA 3M8PA 2YHBA 4DFKA 1T03A 4LSNA 4FM1A 1S1UA 1NOZA 4CF9A 4JRQA 1U45A 4M41A 2JLEA 3ZT4A 4ICLA 4CF0A 3SQ4A 1BHLA 4FJLA 2X6SA 4MFBA 3JSMA 2E6MA 3ZT2A 3VQBA 4RW4A 3O3HA 3SQ2A 4F8RA 3AO1A 4BWMA 1CXQA 5E41A 2G8IA 1HPZA 1EXQA 1VSDA 1A5VA 3U6FA 1YTAA 3P1GA 4DFMA 4PWDA 3AA3A 3CYMA 3SUPA 1C0MA 4M3ZA 3NF8A 4DU4A 3DRPA 3VN5A 4AH9A 3HJFA 4ELVA 1YT3A 3NGZA 2YNHA 4FLXA 4FZZA 1RBRA 4LY7A 3AVFA 4M3UA 4DFJA 4NCAA 1KFDA 1VRTA 3HK2A 4B3OA 1L3VA 1SUQA 1QSYA 3ZSVA 4HUGA 4M3TA 4FLZA 1JKHA 3RRHA 5J2NA 4Z0UA 3M8RA 1W0HA 4DQPA 3OJUA 3NDKA 3IAYA 4FZYA 4ELTA 2XHBA 2G8VA 3DLGA 2D0CA 3O4QA 3V6DA 2P5OA 3LANA 4WE1A 4CFDA 3U3GA 3AVCA 4Y1CA 1SKRA 3RR7A 3QEPA 1TV6A 3K57A 3TWHA 3TARA 3QO9A 1D8YA 3KD1E 2LSNA 3DRSA 3DI6A 1UWBA 4FLVA 3AVJA 4CEBA 3IS9A 4CERA 1FKPA 5J2PA 1Q9YA 1RDAA 1Z25A 3MXIA 2Z1JA 4M3WA 4L8RB 4DTPA 2DFEA 4RG8A 4W5RA 3SYZA 3SQ1A 1EKEA 3VQ5A 4CHQA 3L8BA 4CJTA 4E7LA 5DMRA 3TABA 2QKKA 1X1PA 2PZSA 4JRPA 3HP9A 3VA0A 3RMBA 3V1QA 1Q8IA 3QEIA 4FJ7A 1VSIA 4CEDA 4CJ5A 3KLHA 3DLKA 3O3FA 2BE2A 4N47A 3S3NA 3ZSRA 4CEFA 1QTMA 2HW3A 2HVIA 1HMVA 4OPKA 4ZTJA 5KGWA 4B8CA 3OYGA 1J54A 4FJ5A 3AVNA 3OYHA 3SZ2A 1Q9XA 5SWMA 5J1EA 2QXFA 1BGXT 3QERA 2X6NA 4G1QA 2XY7A 3E01A 4FM0A 1C0UA 1WSGA 3NH0A 4B9NA 4CIEA 1NJYA 1YTUA 3ZT1A 3KKRA 3DLBA 3AA4A 4CJLA 3LALA 4KRFA 2OPQA 5KGXA 3QNOA 4CK1A 4DQRA 3PO4A 3SCXA 4IFVA 4CEEA 4O44A 1EETA 4CEOA 1ZBUA 3SNNA 3KK3A 1QHTA 4CK2A 2VWJA 5CZ2A 2A1RA 4DSIA 3SI6A 3DOKA 4KV8A 3WNHA 3HPOA 1BCMA 4IBNA 2QKBA 1TVRA 4CJQA 3SUNA 1RDDA 1S9GA 1UAXA 2G8WA 3V1RA 4IKFA 4CGJA 3C94A 3CM6A 2GV9A 3IG1A 4HCBA 4BDZA 4FW2A 1SL2A 1B92A 2P5GA 4KPYA 1U48A 3QIPA 1UA0A 4HUEA 1NK6A 4DTSA 3P83D 4R5PA 4CHNA 2WOMA 1I39A 4DLGA 2OYQA 3V9XA 1S1VA 1O1WA 4DF4A 3ULDA 3NH1A 3VQ8A 4ELUA 3LWMA 3OYEA 1S1TA 3MXJA 4W5QA 4I2PA 1C0TA 1J5OA 3K5OA 1S6QA 2Z1IA 4J2AA 2HHXA 3OS1A 3VA3A 1WNSA 4C8LA 3DRRA 2IGIA 4QOZB 4Z4HA 3RMAA 1RTDA 3KKSA 2KQ2A 3L2QA 4AHRA 4CEZA 1L3SA 4J2BA 2ZE2A 3TAEA 2ZD1A 4AILC 3OJSA 5KRSA 1RT2A 1SL0A 3QEXA 1KVAA 1FK9A 3ZSXA 4PA1A 1F21A 1WSFA 3QNNA 1JLEA 4OKEA 4C8NA 4CGIA 4OPJA 1KLMA 1HYZA 1BIUA 2HHWA 2VG5A 3HXMA 4FJNA 3O4NA 3KLFA 3RRGA 1GOBA 4OKKA 3CFPA 2XY5A 1RT1A 2VG6A 3MEGA 4XIUA 4E7JA 4DS4A 4CF2A 3L2VA 3LPTA 4AHCA 2X74A 2XO7A 1SKWA 3VQ9A 4JS4A 1QE1A 3BGRA 4BDPA 3EYZA 4J2EA 2BANA 1S1XA 2RPIA 4FW1A 1WAJA 4KFBA 1LW0A 1MU2A 3DOLA 4GVMA 4H4OA 1I3AA 3ZSWA 5HRSA 3AO2A 3MAQA 4DSJA 4FJHA 3HVRA 3TAGA 4NCBA 3QIOA 4DTMA 4ZHRA 2ATQA 3JYTA 4K8ZA 4FXDA 4QCLA 4CGFA 1HQUA 2QK9A 3L2WA 5I3UA 1LWCA 3VQ4A 3MEEA 4N41A 3EY1A 3D45A 1VSJA 4B9MA 1R0AA 2G8UA 4DLEA 2WONA 1S5JA 4DS5A 4FM2A 3IRXA 1JLFA 2XRIA 5K14A 4M3YA 1BL3A 1JLBA 3VQCA 2FC0A 1NJZA 5FRNA 2B4JA 4HHTA 4KTQA 4EZ6A 3C6TA 1VSKA 4CF1A 3I8DA 2HMIA 3TAMA 3CQ8A 4I9QA 1CZ9A 3SV3A 1B9DA 4C8KA 1XWLA 4DTJA 3QETA 3K5MA 4HTUA 2PY5A 1XC9A 3NBPA 4CF8A 1S6PA 1RT4A 4CJUA 1RILA 3KLGA 3K5NA 4CK3A 3HM9A 3AA5X 4CCHA 1TGOA 1UA1A 1RTJA 3I0SA 4ID5A 4AHUA 4CJFA 1NOYA 3TAFA 4CE9A 1ASWA 2HNDA 4N56A 4DQIA 1EP4A 4Y1DA 4GW6A 1RTHA 1WSJA 4DMNA 1WAFA 2F96A 3DLRA 1T05A 1L3UA 4KHWA 3OYFA 1C1AA 1C1BA 1L5UA 4DSFA 4KHNA 1JXBA 3ASMA 4KB0A 5FDLA 4FJMA 3AVMA 3G0ZA 1B9FA 3FFIA 4EZ9A 4OLBA 1Z26A 1NK9A 2YKNA 2OZSA 4OLAA 5KTQA 3WNEA 4FJGA 2PYLA 1NK8A 2XY6A 1RT6A 1RBTA 1HQEA 4DSLA 3P5JA 3QESA 1K6YA 2VWKA 4CJWA 1KTQA 1VSHA 4IG0A 3AVGA 2OPRA 1TKTA 3LPUA 4OJRA 1JLGA 4CEQA 2XY8A 5HRRA 4FLWA 4E7KA 4E3SA 4E0DA 5HP1A 4CFAA 3UIQA 4CJEA 2PYJA 2KFZA 4KHSA 1QS4A 3LZIA 3V9ZA 1IG9A 5D3GA 3PUFA 1VSLA 4H4MA 4DFPA 3S3OA 3SPZA 4B9TA 1T7PA 1LW2A 1BIZA 3MEDA 3RR8A 4LH4A 1NK4A 5KI6A 2ITGA 3QLHA 2G8FA 2GUIA 1KVBA 4MQ3A 4FLYA 2BGGA 2E4LA 2VG7A 3HPHA 3L2UA 4KHUA 2HHSA 1ZBFA 1WSHA 3DLEA 3OYNA 4FJJA 1BCOA 1VSFA 3HL8A 3PO5A 4RW7A 1NJXA 4LD0A 4M42A 2E6LA 4RW6A 4DSKA 4KHQA 1KSPA 5CZ1A 1KLNA 4KHYA 2Y1JA 4O4GA 4DF8A 4F3OA 1JL1A 4IDKA 2KZMA 4IFYA 1C6VA 2FBTA 1N5YA 4DTNA 3KTQA 3OY9A 1KFSA 3M8SA 3LWLA 1TL3A 3ITHA 3ZSZA 4ID1A 4HVJA 4B9SA 4B9UA 5J2QA 2YHAA 3KK2A 4CGGA 3OYDA 4PY5A 1CLQA 4FVMA 3V9WA 2HNZA 2HHVA 1LAWA 1WSEA 2Z1HA 4CHYA 4C8MA 3L3UA 2O4GA 1ASUA 3CFRA 4KREA 1LAVA 4NCGA 1HJRA 1RCHA 3AO3A 4I7FA 1JLAA 3TR8A 5HRPA 4DSEA 5J2MA 1KRPA 2B5JA 1KVCA 1TK8A 3B6PA 4DU1A 1S9EA 3LP0A 2KTQA 4CGHA 1KCFA 3T3FA 5KRTA 3SQ0A 4HUFA 1BI4B 1U49A 3PX0A 2Z1GA 2RKIA 1NKEA 4O0JA 1BISA 3CFOA 1HNIA 4E19A 4FLTA 3ZCMA 4OVLA 1UOCA 5CYMA 4CECA 4FK0A 4YNQA 1G15A 1ZYQA 3K59A 4AHSA 3V9SA 1NK7A 1DTQA 3BDPA 1LWFA 3EZ5A 4F3TA 4W5NA 4W5OA 3NF6A 4OGCA 4B9VA 1BQMA 5JS2A 3ZSYA 2YNGA 4CIFA 3KJVA 2OA8A 4N5SA 3AVKA 3S9HA 2G8KA 3K58A 2KW4A 3LP3A 3RMCA 1TAUA 1S1WA 1N6QA 4DTOA 5C24A 2YKMA 2HVHA 1TL1A 3DYAA 1CXUA 4LH5A 4F4KA 3TAPA 2AJQA 2D0BA 4EP5A 4E1MA 2Q3SA 4J2DA 4NYNA 4B08A 3LP1A 1TK0A 1X9WA 4FJ8A 3TANA 2IS3A 4O5BA 2OPPA 1NK0A 3AVIA 4DU3A 3LZJA 2BDPA 2FBYA 1VK0A 4DG1A 4O55A 4JS5A 3ZSOA 5HBMA 5CYQA 1JXEA 4F2RA 4CFBA 4FJKA 1JL2A 3VQ6A 3LAMA 2IDOA 3OYJA 4E7HA 3T19A 4RW9A 3HP6A 3F9KA 5FROA 1C1CA 4FJIA 4Z4FA 4CJVA 1J53A 3KIOA 4DTXA 3QEVA 3G10A 2HNYA 4DTRA 1L3TA 2DFHA 4Q0BA 1VRUA 4DQSA 1QSSA 1NKBA 2KFNA 4JLHA 2P51A 4KB1A 2FBXA 4RW8A 2X78A 5C42A 1RNHA 1RT3A 5SZTA 5C25A 3NHGA 5HLFA 2O4IA 1TAQA 3AV9A 1A5WA 1ZBLA 2DFFA 4TSXA 1RTIA 1SKSA 1RT5A 5DK5A 4BDYA 4C8OA 1DTTA 4CIGA 2HB5A 4Q5VA 1D5AA 3RTVA 3AO5A 5T7BA 4CJPA 2B6AA 2D5RA 3AVHA 4CFCA 3PV8A 2W42A 3RWUA 4N76A 3ALYA 4AHVA 4OKJA 2YNIA 4FLUA 4DQQA 3AVBA 3SUOA 4KKOA 3HO1A 4CJRA 4Z4EA 3AVAA 1RT7A 1U47A 1T8EA 1JLCA 1TKXA 1GOCA 1IO2A 3SV4A 3V81A 3OYAA 2OPSA 3OYCA 4DTUA 5HRNA 1NJWA 1RDCA 3TAQA 4BWJA 3THVA 5HROA 3QEWA 2YNFA 1IH7A 1U4BA 2HHQA 3LP2A 3VQ7A 1D9FA 4YFUA 3PY8A 1HYSA 3VQQA 1VSMA 4I2QA 3L2RA 1TKDA 5I42A 4LSLA 3VQEA 1A5XA 2JGUA 4Z4CA 3V4IA 3VQAA 3C95A 2RN2A 4B8AB 1WSIA 3U3YA 3OYMA 4ZTFA 3ZT0A 2RF2A 4GMJB 1IKYA 4NYFA 4CJSA 4O0IA 3V9UA 3SUQA 1HRHA 3HYFA 3OYLA 3K2PA 3O3GA 4FK4A 3T1AA 3ZT3A 3CM5A 4FCYA 3MECA 1HNVA 1RBSA 4BE0A 2ZQBA 4CJ3A 2R7YA 2F8TA 4QAGA 3OYBA 3DM2A 1ZBIA 3F73A 1RBVA 3V1OA 3SJJA 4FZXC 3OYKA 3I0RA 4CESA 1SL1A 1X9MA 4FYDA 4W5TA 2D0AA 3ISNC 1TK5A 1BI4A 4E7IA 1RDBA 1X9SA 3B6OA 3NFAA 3MXMA 1Y97A 2EHGA 1WLJA 3DLHA 4H8KA 3L3VA
chains in the Genus database with same CATH superfamily
3LM2A 2P9LB 1JLQA 1FXXA 4CGDA 1SV5A 4PQUA 3CXCM 5JS1A 5AQWA 2QM1A 5FRMA 2V7YA 2NUBA 1QSLA 1WN7A 2Q2RA 4EP4A 4CEAA 1XHXA 4K8XA 5CE3A 2IC3A 2GBZA 4CHOA 4KO0A 3OS0A 1BQNA 3PIOL 4FK2A 4BE2A 2FBVA 5GIPA 4JKEA 1NK5A 3KLIA 1VSEA 1DLOA 1VQ4N 2UU9K 1CZBA 2EX3A 4I9LA 4AHTA 5EU7A 1HYVA 3KLEA 4YOWA 1ITGA 5CY4A 4YOUA 5ADXH 1TKZA 2Q1NA 3VQPA 4E1NA 5GIOA 4NLBA 1W9HA 1NKCA 2QA4N 1XHZA 4PUOA 1RGIA 4YOTA 4M45A 3OYIA 3OA9A 2GEMA 4IG3A 4Z94A 4JRQA 4M41A 3SQ4A 1BHLA 3DXMB 3ZEUA 2X6SA 2Q0UA 3JSMA 3ZT2A 4RW4A 4JI1K 3E9PA 4BWMA 3SBTA 2G8IA 2QWOA 1VSDA 1MDUB 4BGBA 3U6FA 1VQNN 4PWDA 1HKGA 4JN4A 5ELZA 3SUPA 1O13A 1C0MA 4JKFA 4ELVA 2D0OA 4M7XA 4FLXA 4LY7A 3AVFA 3ZLJA 4DFJA 4NCAA 1VRTA 1SUQA 3ZSVA 3VEYA 4M3TA 4FLZA 3R8EA 4BRFA 3ZEUB 4H0PA 3V6DA 3UE5A 4CFDA 3AVCA 3QEPA 3K57A 3QO9A 3TTCA 3DRSA 2OTJN 4FLVA 4DHYA 1RDAA 1GLDG 5I9EB 2Z1JA 3CJAA 5KPZA 5AQFA 4M3WA 4W5RA 3AARA 2AP1A 1VQMN 4E7LA 5AQIA 2QKKA 1X1PA 4JRPA 3HP9A 3QEIA 4BRKA 3QFUA 4N47A 3S3NA 3QFPA 3OBWA 1NLVA 4RCHA 4BQLA 5C2FA 4FJ5A 3T1YK 3SZ2A 2QXFA 2X6NA 2YJEA 1NJYA 1Q81O 3VEXA 3KVGA 3HBTA 5BRDA 1BA0A 4KRFA 5AQNA 1WB9A 4O44A 1EETA 1QHTA 3ZETA 4HWIA 4CK2A 4B3OA 3SI6A 3HPOA 5CR4A 4BROA 4CJQA 5M1FA 3SUNA 3VEOA 4WFAL 2P9IA 5C0YA 1SL2A 3CJ7A 2P5GA 1NK6A 4DLGA 4CHNA 2E2PA 4A62A 5GAGP 4A57A 4BRGA 3ULDA 5JVHL 3VQ8A 3CC2N 3LWMA 1M1KO 1J5OA 2P9PA 4I2PA 3NVKA 2HHXA 3KHYA 3K0SA 4C8LA 4H5NA 3RMAA 3ZETB 3KKSA 1Q18A 2KQ2A 1L3SA 4JD2A 3DLLL 2P9IB 3D2EA 1JLEA 4OKEA 2HBKA 4C8NA 1JCGA 1XNRK 4OPJA 1KLMA 3HXMA 4FJNA 2XY5A 3CFPA 2P9PB 4XIUA 1QZ5A 3MEGA 4E7JA 4DS4A 3L2VA 4AHCA 4BDPA 4YOXA 2RPIA 3AGRA 4JD2B 1WAJA 5HRSA 3MAQA 3D2EB 3ID6A 3E1YA 3EN9A 3LDPA 4ZHRA 3I56N 3JYTA 1K9MO 3CJBA 3EY1A 1VSJA 1BUPA 5BRFA 4FPBA 4DLEA 4FM2A 3IRXA 4ISGA 2GWJA 2ZJPL 4JK7A 4LF5K 1JLBA 3MN5A 5FPNA 4O5FA 1VSKA 3KWIA 4G9ZA 1CZ9A 1B9DA 4C1NI 4CJ7A 1XC9A 4CD3A 1S6PA 2CGKA 1BU6O 4CJUA 1SQKA 1RILA 3K5NA 1J6ZA 4JKHA 3AA5X 4FSVA 3VPZA 1TGOA 3I0SA 4ID5A 3TSQA 5C12A 1NOYA 4CE9A 5AQZA 3L0QA 1EP4A 4B1ZA 1BO5O 4YHHK 4GW6A 1C1AA 1C1BA 1MWMA 4EFHA 1XNQK 4KHNA 4KB0A 4FJMA 1VQ9N 2HBJA 4FWQA 4HTLA 2DPNA 4CBUA 1GLCG 4K25A 2PYLA 1XC3A 1NGEA 1RBTA 1HQEA 3C6AA 4AF1A 1K6YA 2VWKA 4KH4A 1TKTA 4M7YA 3THYB 1YVNA 4MO4A 5HRRA 4E3SA 2PYJA 1HKCA 4H4MA 4DFPA 1HJOA 4H5WA 2O8FA 1LW2A 1BIZA 3RR8A 4LH4A 1NK4A 3H3NO 2I7NA 1KVBA 4FLYA 2E4LA 1ZBFA 1WSHA 4RW7A 1NJXA 2QW9A 3QBXA 4DKWA 4M63C 3PIPL 1C6VA 4DTNA 3I8BA 3OY9A 1KFSA 4B9SA 3LWLA 2KTQA 3MN7A 2BH1A 4B9UA 5BREA 4FVMA 2HHVA 1LAWA 3W0LA 2Z1HA 3FE1A 1ASUA 3GDQA 1V4SA 3TR8A 4I7FA 2UUCK 4DSEA 1KRPA 1EWQA 3F5TA 3VTIA 4CGHA 4HUFA 4NB4A 3MWTA 3H6EA 4BVPA 2RKIA 3CFOA 4WF9L 4BREA 2IIRA 4CZIA 3MN6A 3K59A 1JJ2M 3W3DA 4WYBA 4DV4K 4JKCA 1LWFA 2ZM6K 2FSNA 4F3TA 4W5NA 3A5MC 3MCPA 2QEXN 3FFKB 2OA8A 3AVKA 2G8KA 2KW4A 1DT9A 3LP3A 4H0TB 3FZHA 3D2FA 5BR9A 3WXMB 2AJQA 2D0BA 1YJWN 3VGLA 1XMQK 4J2DA 3O4WA 3QICA 1BA1A 2P9SA 4FJ8A 4I6MA 2OPPA 2BDPA 4DU3A 1LOTB 3WXKA 2FBYA 3ZSOA 1JXEA 4FJKA 5AFUH 1I94K 4E7HA 3VF4A 1QHAA 5AQKA 4Z4FA 3ENOA 3KIOA 4WCEL 1NMDA 3D2FB 4Q0BA 4DQSA 1QSSA 2P51A 3ENHA 1VQ8N 4KB1A 2X78A 4EIAA 1RT3A 5SZTA 2P9SB 3EL2A 3M3ZA 5MLCQ 4I6MB 3O5BA 4BDYA 4C8OA 3NMUA 1DTTA 4NO7A 4CIGA 4Q5VA 4DUZK 3AO5A 3PV8A 3VF2A 4CFCA 3Q7CA 4N76A 4OKJA 4ISEA 3K9KA 4FLUA 4DQQA 4KKOA 1U47A 2Q0RA 3V81A 3TAQA 3C0BA 2FSJA 1KQSM 1U4BA 1FJGK 4YFUA 3VQQA 2O8DA 4I2QA 1TKDA 2E5LK 2NNWA 3VEZA 1A5XA 3C95A 1WSIA 3U3YA 3L4IA 3ZT0A 3HSCA 4GMJB 1IKYA 1HUXA 5AQHA 2O8BA 3K2PA 3O3GA 4FK4A 3U8XA 2V52B 3CM5A 3DAWA 1RBSA 3N4PA 4H03B 4BE0A 3HM8A 4CJ3A 1OVQA 3R1XA 3OW2M 4QAGA 3U9DA 4JI8K 1ZBIA 3BP8A 2O8DB 4KH6A 1SAZA 3I0RA 2D0AA 1TK5A 4E7IA 1RDBA 4BGAA 4CZLA 3B6OA 1X9SA 1ASVA 1S1UA 2P9KA 3CCRN 4H8KA 3DLHA 4FO0A 5C10A 2E88A 4DV0K 2NRTA 3O9RA 3FR0A 2A1SA 4CZJA 1U04A 3D6RA 2YJFA 4CJKA 4GV6A 4ILGB 4K43A 4FJXA 4DR4K 3VGKA 4R79A 4B9LA 3HPGA 3OVNA 3O80A 1YJ9N 3NGYA 4IEEA 3PX6A 3VF6A 3AA2A 4BRMA 2P9KB 1T44A 2DY4A 3E9LA 3NE6A 1REVA 3J81O 3LAKA 3NAEA 1DEJA 1BG3A 2F8SA 3ZSQA 2A42A 4QS7A 3MDQA 2OZMA 3SMSA 3HT3A 2W41A 1S72N 3CIPA 5B8HA 3KD5E 4BRAA 4HCCA 3H3OB 3AVLA 3BF1A 4M3RA 4KTWA 1VQ6N 5AQTA 4Z4IA 1RBUA 5LJVA 3PX4A 1IKXA 1T03A 4LSNA 3H1QA 4JKAA 1U45A 4U67L 4ICLA 4FJLA 3VQBA 3SQ2A 3O1BA 4B1UB 4V19S 3C7NA 5E41A 1HPZA 1GLLO 3P1GA 3AA3A 3WXLA 1OH7A 4IJNA 3NF8A 4DU4A 3J7YP 1U2VA 1RBRA 2P9NB 4M3UA 1KFDA 4H0VB 1JKHA 4Z0UA 3OJUA 4PHTX 4FZYA 1SS6A 2G8VA 3O4QA 1IBLK 4WE1A 2NLXA 3C7NB 1SKRA 4KHPK 3R3LA 1D8YA 4DR6K 1UWBA 2H3GX 3AVJA 1FKPA 1Z25A 3JS6A 4KBOA 3MXIA 2E1YA 4JAXA 4LF6K 2DFEA 4RG8A 3SYZA 3SQ1A 5DMRA 3CCQN 3TABA 4LF4K 3RMBA 4X66K 5AFUA 4IJAA 1P90A 5EOYA 2P9LA 4ILJA 1DGKN 4NXNK 5M1KA 4BRHA 3ZSRA 4GKJK 1GLFO 4B8CA 4DV2K 2AA4A 5J1EA 3QERA 4IOAL 3E01A 4CIEA 1YTUA 1IJJA 2OANA 2Q36A 3KKRA 4O8UA 1G99A 4CJLA 2OPQA 3QNOA 4DQRA 3SCXA 4CEOA 3SNNA 2A3ZA 3KK3A 4B1VA 1HX1A 3DOKA 1HNXK 1S9GA 3P4IA 3I55N 4IKFA 3C94A 2W6KA 3IG1A 4BDZA 4FW2A 3VEWA 3QIPA 3TU5A 1UA0A 3KK7A 4R5PA 2GWKA 2CGLA 3QBWA 3NH1A 4FWRA 2UXDK 4H5RA 4W5QA 3K5OA 3CJCA 2Z1IA 1NBWA 3THWB 1NG9A 1RTDA 4CEZA 4B1XB 2YCHA 4AILC 3DXMA 1RT2A 2HBLA 1KVAA 4BRPA 3T7ZA 4PA1A 1F21A 3QNNA 2OCEA 3GG4A 4CGIA 4OX9K 1HNZK 3PSIA 3E9OA 3KLFA 4OKKA 4AM6A 2OYQA 4CF2A 3CETA 4JS4A 3BGRA 2BANA 2PAVA 4BRCA 1E4FT 3CCSN 1LW0A 4GVMA 4CI6A 4BY9C 4H4OA 4NCBA 4FJHA 3U4LA 2ATQA 1HQUA 5JLHA 1MWKA 4N41A 3A5NC 4B9MA 4GY2B 1R0AA 4DS5A 1S5JA 3VOVA 1JLFA 4CZKA 2XRIA 1BL3A 2GUPA 1NJZA 2FC0A 5FRNA 2VYPA 2B4JA 4AQYK 2HMPA 3I8DA 1E4GT 3P38A 3A8YA 5EVZA 3QETA 2WUSA 5M1OA 4FOIA 4CCHA 1KAXA 4AHUA 2E1ZA 4N56A 3J8AA 4DQIA 4PL7A 3ID8A 4DMNA 4LFBK 2NRRA 1JXBA 3GE1A 1XMOK 3P39A 4OLBA 1OVYA 4JI2K 4OLAA 2NRXA 5KTQA 4JHDA 3LDQA 4IDHA 4DSLA 3P5JA 4CJWA 4H5TA 3HOSA 5C15A 1JLGA 4FLWA 3CJ1A 3UIQA 2KFZA 1NWKA 5JVGL 4KHSA 1QQMA 5D3GA 1IG9A 3NVMA 1Z6RA 1EQYA 5KI6A 1K73O 4JHDB 3AAQA 2G8FA 3CCUN 4L3QA 3HPHA 4FWKA 2BTFA 2NRVA 4BRNA 3CMEN 4K0KK 2RHKA 2E6LA 1KSPA 2Y1JA 4IFYA 4CBWA 3KTQA 1YJNN 1RFQA 3M8SA 3LDLA 2WFBA 4PY5A 1QQOA 5J2QA 4CGGA 3OYDA 1X9JA 4WQ5C 1WSEA 3G25A 1HKBA 4C8MA 3CFRA 3CQXA 2O8EA 4NCGA 3AO3A 1JLAA 5J2MA 2B5JA 3B6PA 1WBBA 1S9EA 1KCFA 3IFRA 3SQ0A 3GOIA 2O8CB 1U49A 2Z1GA 4E1JA 5CYMA 4FK0A 4AHSA 3V9SA 3L6QA 3EZ5A 4W5OA 3NF6A 4B9VA 1BQMA 3ZSYA 2YNGA 3EZWA 4CIFA 3KJVA 2O8EB 5CHIA 4WQ4A 4DTOA 3DYAA 3TAPA 2CH6A 4JI4K 3SMPA 4YDUC 2Q3SA 3TTFA 4NYNA 1RDUA 3A5OC 4BR4A 4O5BA 2A41A 3AVIA 3DXKA 2NRHA 1NGHA 1H1VA 3EKUA 3LAMA 2IDOA 1NGGA 2E2NA 4RW9A 3HP6A 1C1CA 3ENBA 1J53A 3QEVA 3P31A 1VRUA 4JLHA 1C0FA 4AM7A 1N34K 3VETA 5C25A 3CERA 2O4IA 1TAQA 4MLHA 1QZ6A 5BN9A 1ZBLA 2DFFA 3IUCA 5AQSA 3DXKB 5ADXA 3CF5L 1NGDA 5AQVA 1RT5A 2HB5A 4DR5K 1GLBG 3G4SN 2GX9A 3THYA 5T7BA 3HOTA 4JKBA 5M1QA 1GOCA 1IO2A 3OYAA 3UKUA 3CCLN 3WT0A 4WFNL 1VQ5N 1IH7A 2IVNA 3LP2A 3EE8A 1D9FA 3PY8A 2ASPA 1N33K 5F0XA 3CD6N 1FW6A 3V4IA 3M6GA 4BQZA 4F9OA 4ZTFA 5AQOA 4NYFA 4O0IA 1VQPN 1XQSC 2YHXA 5H1SQ 3UKUB 2YHYA 2F8TA 3GL1A 3OYBA 3VMFB 2ASOA 4XH1A 1RBVA 3BEXA 4CESA 1SL1A 4FYDA 4CBXA 4W5TA 2EHGA 5KQDA 4YOVA 3WNFA 2I5JA 3SPYA 3DMJA 4OPHA 1K8AO 3NF9A 4XH4A 5GAHP 1NGFA 3HSTB 3O6WA 3NH2A 3TI0A 1LWEA 3HI0A 4X64K 4KI4A 3EKSA 3JXUA 2FXUA 3D0PA 4BACA 3SJHA 3C6UA 1NMNA 3OS2A 1LV5A 4IFEA 1D9DA 3S3MA 3F2KA 4YORA 2A5XA 1EWRA 4JI6K 4KI6A 2DTUA 4LFCK 3NGIA 4FJ9A 4OGEA 4B3MK 1NGCA 1GLEG 4KTZA 4UQGA 1ESVA 1WUAA 1J9AA 4KAZA 1RDWX 1N32K 1IKVA 2VGNA 2KZZA 3A2FA 4DV7K 3M8QA 3CCJN 3WNGA 5AQXA 4QS9A 1LCUA 3CPEA 2ASMA 2IOCA 3SAFA 4CJ4A 3HVTA 3RMDA 2Q31A 3ATVA 3OHRA 4FM1A 3BUZB 1Q7YO 4MFBA 5TKWA 2E6MA 3O3HA 4F8RA 1WOQA 3AO1A 2YI1A 3MK6A 3MCAB 5C2DA 3CYMA 4M3ZA 4X65K 3DRPA 3VN5A 4AH9A 4H0XB 1YT3A 4YOYA 3NGZA 3CJ9A 3CCMN 3WQUA 1W97L 3HZ6A 3THXA 3D7EO 3ZX0A 3IAYA 3NDKA 3ZX3A 2XHBA 5EX5A 3LANA 3U3GA 3TARA 2IVOA 3TWHA 3BF3A 2HF4A 3KD1E 2LSNA 2ZJQL 4CEBA 4CERA 1Q9YA 3JAMO 3AY9A 3IMXA 4CJTA 4UY8O 3LDNA 3C6HA 3THXB 3TSUA 3VA0A 2Q97A 2E20A 3FLCO 4CJ5A 2JWLA 3KLHA 3DLKA 1W2BM 5BPNA 4FWOA 1VQ7N 3E66A 4ISFA 4CEFA 1QTMA 2ZGZA 2HVIA 1HMVA 4ZTJA 4LF7K 3OYHA 2V7ZA 5SWMA 4JI7K 1BGXT 4G1QA 1C0UA 1WSGA 2EWSA 4B9NA 1T6CA 3ZT1A 3AA4A 4A5BA 5KGXA 3PO4A 4RWTA 5F2RA 4IFVA 4CEEA 3O1WA 3VENA 4B1WB 2VWJA 5CZ2A 4DSIA 3WNHA 1BCMA 1IBKK 1TVRA 1UAXA 3V1RA 4CGJA 3CM6A 4JKDA 4HCBA 1B92A 3CI5A 4BR9A 4HUEA 4DTSA 4MO5A 3CQYA 1T3VA 4GV9A 2WOMA 1I39A 4DB3A 4DF4A 3VERA 3ZYYX 4GVEA 1S1TA 3MXJA 3OYEA 1C0TA 3CPWM 4J2AA 3OS1A 3VA3A 3DRRA 2IGIA 4QOZB 4Z4HA 3A0IX 5KQ8A 4J2BA 5EY4A 5LL6Z 2ZD1A 5AQLA 3OJSA 4DCHA 5KRSA 1SL0A 3QEXA 1FK9A 1WSFA 1MA9B 1N8RO 4PKGA 3DWLA 1BIUA 2VG5A 3O9QA 5AQUA 3RRGA 1RT1A 3LM9A 4PKHA 4JNEA 1R59O 3ATUA 2X74A 1SKWA 3EYZA 1S1XA 2P9NA 1YIJN 4FW1A 4KFBA 4CZEA 1MU2A 1Q82O 1I3AA 3ZSWA 3AO2A 4NLCA 3SAHA 4KH5A 3HVRA 3TAGA 3QIOA 4DTMA 1NU0A 3L2WA 3VQ4A 3D45A 2D0PA 2G8UA 2WONA 2E2OA 5K14A 3FZMA 1BWFO 3VQCA 1OKJA 4HHTA 4KTQA 4EZ6A 3C6TA 4YDUA 4CF1A 5AQPA 1OH6A 2HMIA 3TAMA 3CQ8A 4JKGB 3SV3A 4C8KA 4DTJA 4BC3A 1WBDA 3K5MA 2FLOA 3T1HK 4FL9A 2PY5A 4CF8A 3HM9A 1XUPO 1UA1A 4EAHD 1ASWA 2HNDA 1RTHA 4FWNA 1WSJA 4KHWA 1WAFA 1T05A 4B1YB 4DSFA 2F9WA 4DV1K 3G0ZA 3FZFA 3FFIA 1Q86O 2QWRA 4XEIA 1Z26A 4H5VA 5A2QO 4IOCL 4GV3A 3WNEA 4FJGA 1NK8A 2XY6A 2V51B 1KTQA 1VSHA 4IG0A 2OPRA 3CC4N 3LPUA 4OJRA 4CEQA 4E7KA 4E0DA 5HP1A 4CFAA 1K8KA 4CJEA 3HRGA 3MX5A 1S22A 3OBYA 3V9ZA 3S3OA 5AR0A 4B9TA 4FWLA 1NM1A 3MEDA 3THWA 3QLHA 3VGMA 1ATRA 2HF3A 1BCOA 1VSFA 2KLAA 3DJCA 2QWPA 4M42A 2A40A 4DSKA 1IV0A 1K8KB 4KHYA 4B9QA 1JL1A 3FZLA 4IEIA 4IDKA 2FBTA 1OH5A 1TL3A 2YHWA 2E8AA 2YHAA 4LF9K 2HNZA 2GELA 2F4VK 5AQQA 2O4GA 4KREA 1LAVA 1ILYA 1KVCA 1TK8A 4DU1A 5AQRA 4CVNE 4O8KA 3T3FA 5KRTA 5GINA 1BI4B 3IDHA 1W7AA 1NKEA 3A5LC 4O0JA 1BISA 1OH8A 4A2BA 1UOCA 3M5RA 1G15A 1ZYQA 5AQMA 3R6MA 3LL3A 4K42A 3WUHA 5TKYA 4OGCA 5AJ3K 3GBTA 2HBMA 4BR0A 3EO3A 3J80O 1ZBSA 4N5SA 3S9HA 1VQLN 3O9TA 1TAUA 1S1WA 1N6QA 2CH5A 2YKMA 4LH5A 1CXUA 4F4KA 3MWPA 1EO1A 4JK9A 4EP5A 4E1MA 5HOOA 4B08A 3LP1A 4DV6K 1X9WA 3TANA 2W6LA 5F1XA 1NK0A 5FPDA 4BC5A 1VK0A 4DG1A 4O55A 4JS5A 4F2RA 5FPMA 2FSKA 1D4XA 3T19A 2QTDA 5FROA 4FJIA 3AAPA 4FOEA 5E26A 3G10A 2HNYA 1L3TA 1NKBA 5LMUK 4RW8A 5C42A 4BRLA 1YHQN 3NHGA 5HLFA 3AV9A 1A5WA 3QB0A 5AQJA 5DK5A 1NGJA 4GNIA 5JICA 1D5AA 2KHOA 2B6AA 3AVHA 2W42A 3RWUA 5BR8K 3AVBA 3SUOA 3HO1A 4ILHA 1RT7A 2ZGYA 1HPMA 4MDAA 1T8EA 3PLAA 3SV4A 2OPSA 3UKRA 3OYCA 4DTUA 5HRNA 1NJWA 1RDCA 1NNEA 5HROA 1DKGD 2YNFA 3QEWA 2NZTA 2HHQA 2D1KA 3BZCA 3KWGA 4LSLA 3VQEA 2RN2A 3OYMA 4PL8A 4FVUA 5DM6L 4EHUA 5IT9O 3SUQA 1HRHA 3HYFA 1KD1O 3T1AA 3ZT3A 4FWMA 3UKRB 1GLAG 2ZQBA 2R7YA 1HR0K 1ATNA 1TUUA 4FZXC 2VCPA 3SJJA 4BG9A 3ISNC 2BUPA 4QS8A 3H45C 2O8CA 3MXMA 1WLJA 4CJVA 3NF7A 3L3VA 2IAJA 4BE1A 3CG7A 1X3MA 5AQYA 3C65A 4M3XA 2P1JA 4CZHA 4F2SA 1GOAA 5BPLA 1XI1A 1IG8A 3H08A 4BC4A 4LC9B 4Z4GA 2Y1IA 4DV3K 1QQCA 1EX4A 3AO4A 3QINA 4RTFD 2FF6A 1FKOA 2G8HA 4CHZA 2ETJA 4BR2A 4DR3K 4C23A 4CW7B 1YVUA 1IKWA 2YV0X 3TPQA 2J4RA 3N4QA 4FWSA 4A61A 4WFBL 3LDSA 2HHHK 3FZKA 1TYQA 5M1NA 4BVOA 4DWIA 4CHPA 2HHTA 3SK3A 4E89A 3UB5A 3VQDA 2HHUA 4DUYK 1ZBHA 3ZX2A 5IWAK 3KK1A 4IZ9A 3K5LA 1SZ2A 3M8PA 2YHBA 4DFKA 3CCEN 4DR2K 1NOZA 4CF9A 2E2QA 4CF0A 2JLEA 3ZT4A 5KPTA 3G71N 4B3RK 4JI0K 2A6AA 1TYQB 2VWBA 3VEVA 1CXQA 3LDOA 1ZXOA 1EXQA 1A5VA 1YTAA 4DFMA 4DQ8A 4IXCA 3HJFA 2ZF5O 2YNHA 3SAGA 3QDKA 4FZZA 4LF8K 1KC8O 3HK2A 1L3VA 3MX2A 1QSYA 3F9MA 4HUGA 5LMNK 1YXQA 3VTHA 4DQPA 3RRHA 5J2NA 3M8RA 1W0HA 1VQON 1BDGA 4ELTA 2P5OA 3DLGA 2D0CA 2F9TA 3FGUA 4Y1CA 3RR7A 1TV6A 3CCVN 3DI6A 4DR1K 3IS9A 5J2PA 5FPEA 1P8ZA 2PFUA 3L4QA 2NRZA 1V4TA 4DTPA 1X3NA 4L8RB 1EKEA 3VQ5A 4Y0WA 4CHQA 3L8BA 4JI5K 1NGAA 2PZSA 4MLEA 3V1QA 1Q8IA 4FJ7A 3EEQA 1VSIA 3BZKA 4CEDA 1T6DA 3O3FA 2BE2A 2HW3A 4OPKA 5KGWA 2WC9A 3OYGA 1J54A 3AVNA 1Q9XA 3S41A 1C0GA 2XY7A 1ZC6A 4FM0A 3NH0A 5JLFA 1JCEA 3DLBA 4C1NK 3LALA 2QWQA 4CK1A 2PBDA 3CHWA 1YUWA 1ZBUA 2ZJRL 2A1RA 4H0OA 4OPAA 4KV8A 2QKBA 4IBNA 3WEEA 1RDDA 2G8WA 2GV9A 4KPYA 1U48A 1YAGA 2GTDA 1KXPA 2YX6A 3P83D 3V9XA 1S1VA 1O1WA 4A5AA 1N36K 3OTOK 4ELUA 2O8FB 1S6QA 1WNSA 2P9UA 3L2QA 4AHRA 3WEEB 3HTVA 2ZE2A 4JEPA 3TAEA 4BC2A 3ZSXA 1NJIO 2F7TA 3EE9A 1HYZA 3H1VX 3Q7BA 1YF5L 3ULEA 5LY3A 2HHWA 4DV5K 3O4NA 1GOBA 5BN8A 2VG6A 2CGJA 2WBNA 3I33A 3LPTA 2XO7A 4J2EA 3VQ9A 1QE1A 4BG8A 2P9UB 3O8MA 4JI3K 3NCIA 3DOLA 3WXJA 1M90O 3K9JA 4DSJA 2UXBK 1QVGM 4QCLA 4K8ZA 4FXDA 4CGFA 2QK9A 5I3UA 5M1PA 1LWCA 5JMVA 2VGMA 3MEEA 3ULEB 4CZGA 4J8FA 4U7BA 4M3YA 2QWMA 4FWPA 1YITN 1ATSA 2QXLA 4I9QA 4EHTA 4BR7A 1XWLA 1NGIA 4HTUA 4IWVA 3NBPA 1RT4A 3KLGA 4CK3A 1YI2N 1RTJA 4CJFA 5AZJA 3TAFA 3G6EN 1KAYA 4XH5A 2ITMA 4Y1DA 1L3UA 3DLRA 2F96A 3OYFA 2W40A 1L5UA 3ASMA 5AQGA 5FDLA 3AVMA 4PKIA 2QWLA 3QMLA 1B9FA 4EZ9A 3SLCA 1NK9A 2YKNA 2OZSA 4CZFA 4OO1J 3B8AX 1BOTO 3H46O 1RT6A 2IVPA 3U9ZA 3QESA 3CC7N 5AZJB 3AVGA 3IKMA 3O08A 2XY8A 3PSFA 2ZWHA 4YY3K 1JCFA 1QS4A 3J7ZO 3LZIA 3PUFA 1VSLA 4GKKK 3O9UA 3SPZA 1T7PA 3VESA 1HLUA 4BRDA 2ITGA 1U6ZA 1HNWK 2GUIA 4MQ3A 3TTDA 2BGGA 4MDBA 2VG7A 4LFAK 2HHSA 2NRWA 3L2UA 4KHUA 3DLEA 3OYNA 5KPRA 4FJJA 5FLXO 3BY5A 3HL8A 4K41A 3PO5A 4B3TK 4LD0A 2UYTA 3MMVA 4RW6A 4KHQA 4IOXA 5CZ1A 1KLNA 4BRQA 2KZMA 4O4GA 4DF8A 4F3OA 1N5YA 2VQFK 4DR7K 2O8BB 3ITHA 3ZSZA 4ID1A 4HVJA 1CLQA 3KK2A 4FPAA 5GAEP 3V9WA 1Z05A 4CHYA 5BPMA 3L3UA 3RSEA 1HJRA 1RCHA 1TUYA 5HRPA 1VAZA 3LP0A 4X62K 3PX0A 2VQEK 1IBMK 4H0YB 4WQ4C 4WQ5A 4E19A 1HNIA 4FLTA 3ZCMA 4OVLA 4CECA 4IO9L 4YNQA 4BRIA 4JK8A 3M1FA 4IO8A 3O9SA 1NK7A 1DTQA 3BDPA 3J7AP 1QVFM 2I7PA 5JS2A 3RSEB 3K58A 3SBGA 3RMCA 4JKGA 5C24A 2HVHA 1TL1A 1CZAN 4CZMA 3R9PA 4JV5K 3MN9A 3T69A 5AZIA 1TK0A 2IS3A 3LZJA 4B3SK 3TSPA 4BR5A 5HBMA 1J5EK 1QQNA 5CYQA 4CD1A 5LJWA 4A59A 2QWNA 4CFBA 1JL2A 1VQKN 1VHXA 3VQ6A 3OYJA 2QI2A 3F9KA 2D4WA 4NXMK 2FF3B 4DTXA 4DTRA 2DFHA 2HSTA 2RE2A 2KFNA 3CMAN 2FBXA 5AZIB 1RNHA 1GLJO 2OTLN 3RVCA 4TSXA 1RTIA 1SKSA 2UUAK 1Y64A 1NGBA 3RTVA 3WXIA 4CJPA 5E84A 2D5RA 2HOEA 3ALYA 4AHVA 2YNIA 2UXCK 4CJRA 4Z4EA 3AVAA 1JLCA 1TKXA 4JYAK 5DM7L 5GADP 1S3XA 3KZBA 5EXWA 2UUBK 4BWJA 3THVA 3VQ7A 1HYSA 1VSMA 3L2RA 1U2VB 5I42A 1KAZA 4Z4CA 2JGUA 3VQAA 2JWKA 4B8AB 3AGKA 2WTUA 2RF2A 4CJSA 3V9UA 2KKZA 3OYLA 4FCYA 3MECA 1HNVA 5BRHA 4A2AA 3DM2A 3F73A 3V1OA 3OYKA 1E3MA 1X9MA 1BI4A 3WQTA 3NFAA 1Y97A 5HL7L
chains in the Genus database with same CATH topology
3WNFA 2I5JA 2IAJA 3SPYA 4BE1A 3CG7A 3DMJA 1JLQA 1FXXA 4CGDA 1SV5A 2A1SA 4PQUA 5JS1A 1U04A 3NF9A 4M3XA 2P1JA 3HSTB 3NH2A 4CJKA 3TI0A 1LWEA 4F2SA 5FRMA 2NUBA 1QSLA 1GOAA 1WN7A 4FJXA 4KI4A 4BACA 3D0PA 1XI1A 4EP4A 3H08A 4CEAA 1XHXA 4B9LA 3HPGA 3OVNA 4K8XA 2IC3A 2GBZA 4Z4GA 4CHOA 3NCIA 3C6UA 3NGYA 4KO0A 3OS0A 3OS2A 1LV5A 2Y1IA 3PX6A 3S3MA 1D9DA 3AA2A 1BQNA 4FK2A 4BE2A 2FBVA 1QQCA 1EX4A 3AO4A 3QINA 2DY4A 1NK5A 4KI6A 2DTUA 1FKOA 2G8HA 3KLIA 1VSEA 1REVA 1DLOA 2ETJA 4CHZA 3LAKA 1CZBA 2EX3A 3NE6A 3NGIA 3NAEA 4FJ9A 4OGEA 4I9LA 4AHTA 5EU7A 2F8SA 3ZSQA 4KTZA 4UQGA 1HYVA 2OZMA 3KLEA 1J9AA 1YVUA 3HT3A 4KAZA 1IKVA 1IKWA 1ITGA 2YV0X 3NF7A 2KZZA 3A2FA 5CY4A 3LDSA 3KD5E 3M8QA 4DWIA 4CHPA 1TKZA 2HHTA 3VQPA 4HCCA 3AVLA 3WNGA 4M3RA 4E89A 4KTWA 4E1NA 3VQDA 1W9HA 1NKCA 1ZBHA 2HHUA 1XHZA 2IOCA 4PUOA 3KK1A 4Z4IA 1RBUA 4M45A 3K5LA 4CJ4A 3HVTA 3OYIA 3PX4A 1IKXA 3RMDA 4IG3A 1ASVA 3M8PA 2YHBA 4DFKA 1T03A 4LSNA 4FM1A 1S1UA 1NOZA 4CF9A 4JRQA 1U45A 4M41A 2JLEA 3ZT4A 4ICLA 4CF0A 3SQ4A 1BHLA 4FJLA 2X6SA 4MFBA 3JSMA 2E6MA 3ZT2A 3VQBA 4RW4A 3O3HA 3SQ2A 4F8RA 3AO1A 4BWMA 1CXQA 5E41A 2G8IA 1HPZA 1EXQA 1VSDA 1A5VA 3U6FA 1YTAA 3P1GA 4DFMA 4PWDA 3AA3A 3CYMA 3SUPA 1C0MA 4M3ZA 3NF8A 4DU4A 3DRPA 3VN5A 4AH9A 3HJFA 4ELVA 1YT3A 3NGZA 2YNHA 4FLXA 4FZZA 1RBRA 4LY7A 3AVFA 4M3UA 4DFJA 4NCAA 1KFDA 1VRTA 3HK2A 4B3OA 1L3VA 1SUQA 1QSYA 3ZSVA 4HUGA 4M3TA 4FLZA 1JKHA 3RRHA 5J2NA 4Z0UA 3M8RA 1W0HA 4DQPA 3OJUA 3NDKA 3IAYA 4FZYA 4ELTA 2XHBA 2G8VA 3DLGA 2D0CA 3O4QA 3V6DA 2P5OA 3LANA 4WE1A 4CFDA 3U3GA 3AVCA 4Y1CA 1SKRA 3RR7A 3QEPA 1TV6A 3K57A 3TWHA 3TARA 3QO9A 1D8YA 3KD1E 2LSNA 3DRSA 3DI6A 1UWBA 4FLVA 3AVJA 4CEBA 3IS9A 4CERA 1FKPA 5J2PA 1Q9YA 1RDAA 1Z25A 3MXIA 2Z1JA 4M3WA 4L8RB 4DTPA 2DFEA 4RG8A 4W5RA 3SYZA 3SQ1A 1EKEA 3VQ5A 4CHQA 3L8BA 4CJTA 4E7LA 5DMRA 3TABA 2QKKA 1X1PA 2PZSA 4JRPA 3HP9A 3VA0A 3RMBA 3V1QA 1Q8IA 3QEIA 4FJ7A 1VSIA 4CEDA 4CJ5A 3KLHA 3DLKA 3O3FA 2BE2A 4N47A 3S3NA 3ZSRA 4CEFA 1QTMA 2HW3A 2HVIA 1HMVA 4OPKA 4ZTJA 5KGWA 4B8CA 3OYGA 1J54A 4FJ5A 3AVNA 3OYHA 3SZ2A 1Q9XA 5SWMA 5J1EA 2QXFA 1BGXT 3QERA 2X6NA 4G1QA 2XY7A 3E01A 4FM0A 1C0UA 1WSGA 3NH0A 4B9NA 4CIEA 1NJYA 1YTUA 3ZT1A 3KKRA 3DLBA 3AA4A 4CJLA 3LALA 4KRFA 2OPQA 5KGXA 3QNOA 4CK1A 4DQRA 3PO4A 3SCXA 4IFVA 4CEEA 4O44A 1EETA 4CEOA 1ZBUA 3SNNA 3KK3A 1QHTA 4CK2A 2VWJA 5CZ2A 2A1RA 4DSIA 3SI6A 3DOKA 4KV8A 3WNHA 3HPOA 1BCMA 4IBNA 2QKBA 1TVRA 4CJQA 3SUNA 1RDDA 1S9GA 1UAXA 2G8WA 3V1RA 4IKFA 4CGJA 3C94A 3CM6A 2GV9A 3IG1A 4HCBA 4BDZA 4FW2A 1SL2A 1B92A 2P5GA 4KPYA 1U48A 3QIPA 1UA0A 4HUEA 1NK6A 4DTSA 3P83D 4R5PA 4CHNA 2WOMA 1I39A 4DLGA 2OYQA 3V9XA 1S1VA 1O1WA 4DF4A 3ULDA 3NH1A 3VQ8A 4ELUA 3LWMA 3OYEA 1S1TA 3MXJA 4W5QA 4I2PA 1C0TA 1J5OA 3K5OA 1S6QA 2Z1IA 4J2AA 2HHXA 3OS1A 3VA3A 1WNSA 4C8LA 3DRRA 2IGIA 4QOZB 4Z4HA 3RMAA 1RTDA 3KKSA 2KQ2A 3L2QA 4AHRA 4CEZA 1L3SA 4J2BA 2ZE2A 3TAEA 2ZD1A 4AILC 3OJSA 5KRSA 1RT2A 1SL0A 3QEXA 1KVAA 1FK9A 3ZSXA 4PA1A 1F21A 1WSFA 3QNNA 1JLEA 4OKEA 4C8NA 4CGIA 4OPJA 1KLMA 1HYZA 1BIUA 2HHWA 2VG5A 3HXMA 4FJNA 3O4NA 3KLFA 3RRGA 1GOBA 4OKKA 3CFPA 2XY5A 1RT1A 2VG6A 3MEGA 4XIUA 4E7JA 4DS4A 4CF2A 3L2VA 3LPTA 4AHCA 2X74A 2XO7A 1SKWA 3VQ9A 4JS4A 1QE1A 3BGRA 4BDPA 3EYZA 4J2EA 2BANA 1S1XA 2RPIA 4FW1A 1WAJA 4KFBA 1LW0A 1MU2A 3DOLA 4GVMA 4H4OA 1I3AA 3ZSWA 5HRSA 3AO2A 3MAQA 4DSJA 4FJHA 3HVRA 3TAGA 4NCBA 3QIOA 4DTMA 4ZHRA 2ATQA 3JYTA 4K8ZA 4FXDA 4QCLA 4CGFA 1HQUA 2QK9A 3L2WA 5I3UA 1LWCA 3VQ4A 3MEEA 4N41A 3EY1A 3D45A 1VSJA 4B9MA 1R0AA 2G8UA 4DLEA 2WONA 1S5JA 4DS5A 4FM2A 3IRXA 1JLFA 2XRIA 5K14A 4M3YA 1BL3A 1JLBA 3VQCA 2FC0A 1NJZA 5FRNA 2B4JA 4HHTA 4KTQA 4EZ6A 3C6TA 1VSKA 4CF1A 3I8DA 2HMIA 3TAMA 3CQ8A 4I9QA 1CZ9A 3SV3A 1B9DA 4C8KA 1XWLA 4DTJA 3QETA 3K5MA 4HTUA 2PY5A 1XC9A 3NBPA 4CF8A 1S6PA 1RT4A 4CJUA 1RILA 3KLGA 3K5NA 4CK3A 3HM9A 3AA5X 4CCHA 1TGOA 1UA1A 1RTJA 3I0SA 4ID5A 4AHUA 4CJFA 1NOYA 3TAFA 4CE9A 1ASWA 2HNDA 4N56A 4DQIA 1EP4A 4Y1DA 4GW6A 1RTHA 1WSJA 4DMNA 1WAFA 2F96A 3DLRA 1T05A 1L3UA 4KHWA 3OYFA 1C1AA 1C1BA 1L5UA 4DSFA 4KHNA 1JXBA 3ASMA 4KB0A 5FDLA 4FJMA 3AVMA 3G0ZA 1B9FA 3FFIA 4EZ9A 4OLBA 1Z26A 1NK9A 2YKNA 2OZSA 4OLAA 5KTQA 3WNEA 4FJGA 2PYLA 1NK8A 2XY6A 1RT6A 1RBTA 1HQEA 4DSLA 3P5JA 3QESA 1K6YA 2VWKA 4CJWA 1KTQA 1VSHA 4IG0A 3AVGA 2OPRA 1TKTA 3LPUA 4OJRA 1JLGA 4CEQA 2XY8A 5HRRA 4FLWA 4E7KA 4E3SA 4E0DA 5HP1A 4CFAA 3UIQA 4CJEA 2PYJA 2KFZA 4KHSA 1QS4A 3LZIA 3V9ZA 1IG9A 5D3GA 3PUFA 1VSLA 4H4MA 4DFPA 3S3OA 3SPZA 4B9TA 1T7PA 1LW2A 1BIZA 3MEDA 3RR8A 4LH4A 1NK4A 5KI6A 2ITGA 3QLHA 2G8FA 2GUIA 1KVBA 4MQ3A 4FLYA 2BGGA 2E4LA 2VG7A 3HPHA 3L2UA 4KHUA 2HHSA 1ZBFA 1WSHA 3DLEA 3OYNA 4FJJA 1BCOA 1VSFA 3HL8A 3PO5A 4RW7A 1NJXA 4LD0A 4M42A 2E6LA 4RW6A 4DSKA 4KHQA 1KSPA 5CZ1A 1KLNA 4KHYA 2Y1JA 4O4GA 4DF8A 4F3OA 1JL1A 4IDKA 2KZMA 4IFYA 1C6VA 2FBTA 1N5YA 4DTNA 3KTQA 3OY9A 1KFSA 3M8SA 3LWLA 1TL3A 3ITHA 3ZSZA 4ID1A 4HVJA 4B9SA 4B9UA 5J2QA 2YHAA 3KK2A 4CGGA 3OYDA 4PY5A 1CLQA 4FVMA 3V9WA 2HNZA 2HHVA 1LAWA 1WSEA 2Z1HA 4CHYA 4C8MA 3L3UA 2O4GA 1ASUA 3CFRA 4KREA 1LAVA 4NCGA 1HJRA 1RCHA 3AO3A 4I7FA 1JLAA 3TR8A 5HRPA 4DSEA 5J2MA 1KRPA 2B5JA 1KVCA 1TK8A 3B6PA 4DU1A 1S9EA 3LP0A 2KTQA 4CGHA 1KCFA 3T3FA 5KRTA 3SQ0A 4HUFA 1BI4B 1U49A 3PX0A 2Z1GA 2RKIA 1NKEA 4O0JA 1BISA 3CFOA 1HNIA 4E19A 4FLTA 3ZCMA 4OVLA 1UOCA 5CYMA 4CECA 4FK0A 4YNQA 1G15A 1ZYQA 3K59A 4AHSA 3V9SA 1NK7A 1DTQA 3BDPA 1LWFA 3EZ5A 4F3TA 4W5NA 4W5OA 3NF6A 4OGCA 4B9VA 1BQMA 5JS2A 3ZSYA 2YNGA 4CIFA 3KJVA 2OA8A 4N5SA 3AVKA 3S9HA 2G8KA 3K58A 2KW4A 3LP3A 3RMCA 1TAUA 1S1WA 1N6QA 4DTOA 5C24A 2YKMA 2HVHA 1TL1A 3DYAA 1CXUA 4LH5A 4F4KA 3TAPA 2AJQA 2D0BA 4EP5A 4E1MA 2Q3SA 4J2DA 4NYNA 4B08A 3LP1A 1TK0A 1X9WA 4FJ8A 3TANA 2IS3A 4O5BA 2OPPA 1NK0A 3AVIA 4DU3A 3LZJA 2BDPA 2FBYA 1VK0A 4DG1A 4O55A 4JS5A 3ZSOA 5HBMA 5CYQA 1JXEA 4F2RA 4CFBA 4FJKA 1JL2A 3VQ6A 3LAMA 2IDOA 3OYJA 4E7HA 3T19A 4RW9A 3HP6A 3F9KA 5FROA 1C1CA 4FJIA 4Z4FA 4CJVA 1J53A 3KIOA 4DTXA 3QEVA 3G10A 2HNYA 4DTRA 1L3TA 2DFHA 4Q0BA 1VRUA 4DQSA 1QSSA 1NKBA 2KFNA 4JLHA 2P51A 4KB1A 2FBXA 4RW8A 2X78A 5C42A 1RNHA 1RT3A 5SZTA 5C25A 3NHGA 5HLFA 2O4IA 1TAQA 3AV9A 1A5WA 1ZBLA 2DFFA 4TSXA 1RTIA 1SKSA 1RT5A 5DK5A 4BDYA 4C8OA 1DTTA 4CIGA 2HB5A 4Q5VA 1D5AA 3RTVA 3AO5A 5T7BA 4CJPA 2B6AA 2D5RA 3AVHA 4CFCA 3PV8A 2W42A 3RWUA 4N76A 3ALYA 4AHVA 4OKJA 2YNIA 4FLUA 4DQQA 3AVBA 3SUOA 4KKOA 3HO1A 4CJRA 4Z4EA 3AVAA 1RT7A 1U47A 1T8EA 1JLCA 1TKXA 1GOCA 1IO2A 3SV4A 3V81A 3OYAA 2OPSA 3OYCA 4DTUA 5HRNA 1NJWA 1RDCA 3TAQA 4BWJA 3THVA 5HROA 3QEWA 2YNFA 1IH7A 1U4BA 2HHQA 3LP2A 3VQ7A 1D9FA 4YFUA 3PY8A 1HYSA 3VQQA 1VSMA 4I2QA 3L2RA 1TKDA 5I42A 4LSLA 3VQEA 1A5XA 2JGUA 4Z4CA 3V4IA 3VQAA 3C95A 2RN2A 4B8AB 1WSIA 3U3YA 3OYMA 4ZTFA 3ZT0A 2RF2A 4GMJB 1IKYA 4NYFA 4CJSA 4O0IA 3V9UA 3SUQA 1HRHA 3HYFA 3OYLA 3K2PA 3O3GA 4FK4A 3T1AA 3ZT3A 3CM5A 4FCYA 3MECA 1HNVA 1RBSA 4BE0A 2ZQBA 4CJ3A 2R7YA 2F8TA 4QAGA 3OYBA 3DM2A 1ZBIA 3F73A 1RBVA 3V1OA 3SJJA 4FZXC 3OYKA 3I0RA 4CESA 1SL1A 1X9MA 4FYDA 4W5TA 2D0AA 3ISNC 1TK5A 1BI4A 4E7IA 1RDBA 1X9SA 3B6OA 3NFAA 3MXMA 1Y97A 2EHGA 1WLJA 3DLHA 4H8KA 3L3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNF A;  2I5J A;  2IAJ A;  3SPY A;  4BE1 A;  3CG7 A;  3DMJ A;  1JLQ A;  1FXX A;  4CGD A;  1SV5 A;  2A1S A;  4PQU A;  5JS1 A;  1U04 A;  3NF9 A;  4M3X A;  2P1J A;  3HST B;  3NH2 A;  4CJK A;  3TI0 A;  1LWE A;  4F2S A;  5FRM A;  2NUB A;  1QSL A;  1GOA A;  1WN7 A;  4FJX A;  4KI4 A;  4BAC A;  3D0P A;  1XI1 A;  4EP4 A;  3H08 A;  4CEA A;  1XHX A;  4B9L A;  3HPG A;  3OVN A;  4K8X A;  2IC3 A;  2GBZ A;  4Z4G A;  4CHO A;  3NCI A;  3C6U A;  3NGY A;  4KO0 A;  3OS0 A;  3OS2 A;  1LV5 A;  2Y1I A;  3PX6 A;  3S3M A;  1D9D A;  3AA2 A;  1BQN A;  4FK2 A;  4BE2 A;  2FBV A;  1QQC A;  1EX4 A;  3AO4 A;  3QIN A;  2DY4 A;  1NK5 A;  4KI6 A;  2DTU A;  1FKO A;  2G8H A;  3KLI A;  1VSE A;  1REV A;  1DLO A;  2ETJ A;  4CHZ A;  3LAK A;  1CZB A;  2EX3 A;  3NE6 A;  3NGI A;  3NAE A;  4FJ9 A;  4OGE A;  4I9L A;  4AHT A;  5EU7 A;  2F8S A;  3ZSQ A;  4KTZ A;  4UQG A;  1HYV A;  2OZM A;  3KLE A;  1J9A A;  1YVU A;  3HT3 A;  4KAZ A;  1IKV A;  1IKW A;  1ITG A;  2YV0 X;  3NF7 A;  2KZZ A;  3A2F A;  5CY4 A;  3LDS A;  3KD5 E;  3M8Q A;  4DWI A;  4CHP A;  1TKZ A;  2HHT A;  3VQP A;  4HCC A;  3AVL A;  3WNG A;  4M3R A;  4E89 A;  4KTW A;  4E1N A;  3VQD A;  1W9H A;  1NKC A;  1ZBH A;  2HHU A;  1XHZ A;  2IOC A;  4PUO A;  3KK1 A;  4Z4I A;  1RBU A;  4M45 A;  3K5L A;  4CJ4 A;  3HVT A;  3OYI A;  3PX4 A;  1IKX A;  3RMD A;  4IG3 A;  1ASV A;  3M8P A;  2YHB A;  4DFK A;  1T03 A;  4LSN A;  4FM1 A;  1S1U A;  1NOZ A;  4CF9 A;  4JRQ A;  1U45 A;  4M41 A;  2JLE A;  3ZT4 A;  4ICL A;  4CF0 A;  3SQ4 A;  1BHL A;  4FJL A;  2X6S A;  4MFB A;  3JSM A;  2E6M A;  3ZT2 A;  3VQB A;  4RW4 A;  3O3H A;  3SQ2 A;  4F8R A;  3AO1 A;  4BWM A;  1CXQ A;  5E41 A;  2G8I A;  1HPZ A;  1EXQ A;  1VSD A;  1A5V A;  3U6F A;  1YTA A;  3P1G A;  4DFM A;  4PWD A;  3AA3 A;  3CYM A;  3SUP A;  1C0M A;  4M3Z A;  3NF8 A;  4DU4 A;  3DRP A;  3VN5 A;  4AH9 A;  3HJF A;  4ELV A;  1YT3 A;  3NGZ A;  2YNH A;  4FLX A;  4FZZ A;  1RBR A;  4LY7 A;  3AVF A;  4M3U A;  4DFJ A;  4NCA A;  1KFD A;  1VRT A;  3HK2 A;  4B3O A;  1L3V A;  1SUQ A;  1QSY A;  3ZSV A;  4HUG A;  4M3T A;  4FLZ A;  1JKH A;  3RRH A;  5J2N A;  4Z0U A;  3M8R A;  1W0H A;  4DQP A;  3OJU A;  3NDK A;  3IAY A;  4FZY A;  4ELT A;  2XHB A;  2G8V A;  3DLG A;  2D0C A;  3O4Q A;  3V6D A;  2P5O A;  3LAN A;  4WE1 A;  4CFD A;  3U3G A;  3AVC A;  4Y1C A;  1SKR A;  3RR7 A;  3QEP A;  1TV6 A;  3K57 A;  3TWH A;  3TAR A;  3QO9 A;  1D8Y A;  3KD1 E;  2LSN A;  3DRS A;  3DI6 A;  1UWB A;  4FLV A;  3AVJ A;  4CEB A;  3IS9 A;  4CER A;  1FKP A;  5J2P A;  1Q9Y A;  1RDA A;  1Z25 A;  3MXI A;  2Z1J A;  4M3W A;  4L8R B;  4DTP A;  2DFE A;  4RG8 A;  4W5R A;  3SYZ A;  3SQ1 A;  1EKE A;  3VQ5 A;  4CHQ A;  3L8B A;  4CJT A;  4E7L A;  5DMR A;  3TAB A;  2QKK A;  1X1P A;  2PZS A;  4JRP A;  3HP9 A;  3VA0 A;  3RMB A;  3V1Q A;  1Q8I A;  3QEI A;  4FJ7 A;  1VSI A;  4CED A;  4CJ5 A;  3KLH A;  3DLK A;  3O3F A;  2BE2 A;  4N47 A;  3S3N A;  3ZSR A;  4CEF A;  1QTM A;  2HW3 A;  2HVI A;  1HMV A;  4OPK A;  4ZTJ A;  5KGW A;  4B8C A;  3OYG A;  1J54 A;  4FJ5 A;  3AVN A;  3OYH A;  3SZ2 A;  1Q9X A;  5SWM A;  5J1E A;  2QXF A;  1BGX T;  3QER A;  2X6N A;  4G1Q A;  2XY7 A;  3E01 A;  4FM0 A;  1C0U A;  1WSG A;  3NH0 A;  4B9N A;  4CIE A;  1NJY A;  1YTU A;  3ZT1 A;  3KKR A;  3DLB A;  3AA4 A;  4CJL A;  3LAL A;  4KRF A;  2OPQ A;  5KGX A;  3QNO A;  4CK1 A;  4DQR A;  3PO4 A;  3SCX A;  4IFV A;  4CEE A;  4O44 A;  1EET A;  4CEO A;  1ZBU A;  3SNN A;  3KK3 A;  1QHT A;  4CK2 A;  2VWJ A;  5CZ2 A;  2A1R A;  4DSI A;  3SI6 A;  3DOK A;  4KV8 A;  3WNH A;  3HPO A;  1BCM A;  4IBN A;  2QKB A;  1TVR A;  4CJQ A;  3SUN A;  1RDD A;  1S9G A;  1UAX A;  2G8W A;  3V1R A;  4IKF A;  4CGJ A;  3C94 A;  3CM6 A;  2GV9 A;  3IG1 A;  4HCB A;  4BDZ A;  4FW2 A;  1SL2 A;  1B92 A;  2P5G A;  4KPY A;  1U48 A;  3QIP A;  1UA0 A;  4HUE A;  1NK6 A;  4DTS A;  3P83 D;  4R5P A;  4CHN A;  2WOM A;  1I39 A;  4DLG A;  2OYQ A;  3V9X A;  1S1V A;  1O1W A;  4DF4 A;  3ULD A;  3NH1 A;  3VQ8 A;  4ELU A;  3LWM A;  3OYE A;  1S1T A;  3MXJ A;  4W5Q A;  4I2P A;  1C0T A;  1J5O A;  3K5O A;  1S6Q A;  2Z1I A;  4J2A A;  2HHX A;  3OS1 A;  3VA3 A;  1WNS A;  4C8L A;  3DRR A;  2IGI A;  4QOZ B;  4Z4H A;  3RMA A;  1RTD A;  3KKS A;  2KQ2 A;  3L2Q A;  4AHR A;  4CEZ A;  1L3S A;  4J2B A;  2ZE2 A;  3TAE A;  2ZD1 A;  4AIL C;  3OJS A;  5KRS A;  1RT2 A;  1SL0 A;  3QEX A;  1KVA A;  1FK9 A;  3ZSX A;  4PA1 A;  1F21 A;  1WSF A;  3QNN A;  1JLE A;  4OKE A;  4C8N A;  4CGI A;  4OPJ A;  1KLM A;  1HYZ A;  1BIU A;  2HHW A;  2VG5 A;  3HXM A;  4FJN A;  3O4N A;  3KLF A;  3RRG A;  1GOB A;  4OKK A;  3CFP A;  2XY5 A;  1RT1 A;  2VG6 A;  3MEG A;  4XIU A;  4E7J A;  4DS4 A;  4CF2 A;  3L2V A;  3LPT A;  4AHC A;  2X74 A;  2XO7 A;  1SKW A;  3VQ9 A;  4JS4 A;  1QE1 A;  3BGR A;  4BDP A;  3EYZ A;  4J2E A;  2BAN A;  1S1X A;  2RPI A;  4FW1 A;  1WAJ A;  4KFB A;  1LW0 A;  1MU2 A;  3DOL A;  4GVM A;  4H4O A;  1I3A A;  3ZSW A;  5HRS A;  3AO2 A;  3MAQ A;  4DSJ A;  4FJH A;  3HVR A;  3TAG A;  4NCB A;  3QIO A;  4DTM A;  4ZHR A;  2ATQ A;  3JYT A;  4K8Z A;  4FXD A;  4QCL A;  4CGF A;  1HQU A;  2QK9 A;  3L2W A;  5I3U A;  1LWC A;  3VQ4 A;  3MEE A;  4N41 A;  3EY1 A;  3D45 A;  1VSJ A;  4B9M A;  1R0A A;  2G8U A;  4DLE A;  2WON A;  1S5J A;  4DS5 A;  4FM2 A;  3IRX A;  1JLF A;  2XRI A;  5K14 A;  4M3Y A;  1BL3 A;  1JLB A;  3VQC A;  2FC0 A;  1NJZ A;  5FRN A;  2B4J A;  4HHT A;  4KTQ A;  4EZ6 A;  3C6T A;  1VSK A;  4CF1 A;  3I8D A;  2HMI A;  3TAM A;  3CQ8 A;  4I9Q A;  1CZ9 A;  3SV3 A;  1B9D A;  4C8K A;  1XWL A;  4DTJ A;  3QET A;  3K5M A;  4HTU A;  2PY5 A;  1XC9 A;  3NBP A;  4CF8 A;  1S6P A;  1RT4 A;  4CJU A;  1RIL A;  3KLG A;  3K5N A;  4CK3 A;  3HM9 A;  3AA5 X;  4CCH A;  1TGO A;  1UA1 A;  1RTJ A;  3I0S A;  4ID5 A;  4AHU A;  4CJF A;  1NOY A;  3TAF A;  4CE9 A;  1ASW A;  2HND A;  4N56 A;  4DQI A;  1EP4 A;  4Y1D A;  4GW6 A;  1RTH A;  1WSJ A;  4DMN A;  1WAF A;  2F96 A;  3DLR A;  1T05 A;  1L3U A;  4KHW A;  3OYF A;  1C1A A;  1C1B A;  1L5U A;  4DSF A;  4KHN A;  1JXB A;  3ASM A;  4KB0 A;  5FDL A;  4FJM A;  3AVM A;  3G0Z A;  1B9F A;  3FFI A;  4EZ9 A;  4OLB A;  1Z26 A;  1NK9 A;  2YKN A;  2OZS A;  4OLA A;  5KTQ A;  3WNE A;  4FJG A;  2PYL A;  1NK8 A;  2XY6 A;  1RT6 A;  1RBT A;  1HQE A;  4DSL A;  3P5J A;  3QES A;  1K6Y A;  2VWK A;  4CJW A;  1KTQ A;  1VSH A;  4IG0 A;  3AVG A;  2OPR A;  1TKT A;  3LPU A;  4OJR A;  1JLG A;  4CEQ A;  2XY8 A;  5HRR A;  4FLW A;  4E7K A;  4E3S A;  4E0D A;  5HP1 A;  4CFA A;  3UIQ A;  4CJE A;  2PYJ A;  2KFZ A;  4KHS A;  1QS4 A;  3LZI A;  3V9Z A;  1IG9 A;  5D3G A;  3PUF A;  1VSL A;  4H4M A;  4DFP A;  3S3O A;  3SPZ A;  4B9T A;  1T7P A;  1LW2 A;  1BIZ A;  3MED A;  3RR8 A;  4LH4 A;  1NK4 A;  5KI6 A;  2ITG A;  3QLH A;  2G8F A;  2GUI A;  1KVB A;  4MQ3 A;  4FLY A;  2BGG A;  2E4L A;  2VG7 A;  3HPH A;  3L2U A;  4KHU A;  2HHS A;  1ZBF A;  1WSH A;  3DLE A;  3OYN A;  4FJJ A;  1BCO A;  1VSF A;  3HL8 A;  3PO5 A;  4RW7 A;  1NJX A;  4LD0 A;  4M42 A;  2E6L A;  4RW6 A;  4DSK A;  4KHQ A;  1KSP A;  5CZ1 A;  1KLN A;  4KHY A;  2Y1J A;  4O4G A;  4DF8 A;  4F3O A;  1JL1 A;  4IDK A;  2KZM A;  4IFY A;  1C6V A;  2FBT A;  1N5Y A;  4DTN A;  3KTQ A;  3OY9 A;  1KFS A;  3M8S A;  3LWL A;  1TL3 A;  3ITH A;  3ZSZ A;  4ID1 A;  4HVJ A;  4B9S A;  4B9U A;  5J2Q A;  2YHA A;  3KK2 A;  4CGG A;  3OYD A;  4PY5 A;  1CLQ A;  4FVM A;  3V9W A;  2HNZ A;  2HHV A;  1LAW A;  1WSE A;  2Z1H A;  4CHY A;  4C8M A;  3L3U A;  2O4G A;  1ASU A;  3CFR A;  4KRE A;  1LAV A;  4NCG A;  1HJR A;  1RCH A;  3AO3 A;  4I7F A;  1JLA A;  3TR8 A;  5HRP A;  4DSE A;  5J2M A;  1KRP A;  2B5J A;  1KVC A;  1TK8 A;  3B6P A;  4DU1 A;  1S9E A;  3LP0 A;  2KTQ A;  4CGH A;  1KCF A;  3T3F A;  5KRT A;  3SQ0 A;  4HUF A;  1BI4 B;  1U49 A;  3PX0 A;  2Z1G A;  2RKI A;  1NKE A;  4O0J A;  1BIS A;  3CFO A;  1HNI A;  4E19 A;  4FLT A;  3ZCM A;  4OVL A;  1UOC A;  5CYM A;  4CEC A;  4FK0 A;  4YNQ A;  1G15 A;  1ZYQ A;  3K59 A;  4AHS A;  3V9S A;  1NK7 A;  1DTQ A;  3BDP A;  1LWF A;  3EZ5 A;  4F3T A;  4W5N A;  4W5O A;  3NF6 A;  4OGC A;  4B9V A;  1BQM A;  5JS2 A;  3ZSY A;  2YNG A;  4CIF A;  3KJV A;  2OA8 A;  4N5S A;  3AVK A;  3S9H A;  2G8K A;  3K58 A;  2KW4 A;  3LP3 A;  3RMC A;  1TAU A;  1S1W A;  1N6Q A;  4DTO A;  5C24 A;  2YKM A;  2HVH A;  1TL1 A;  3DYA A;  1CXU A;  4LH5 A;  4F4K A;  3TAP A;  2AJQ A;  2D0B A;  4EP5 A;  4E1M A;  2Q3S A;  4J2D A;  4NYN A;  4B08 A;  3LP1 A;  1TK0 A;  1X9W A;  4FJ8 A;  3TAN A;  2IS3 A;  4O5B A;  2OPP A;  1NK0 A;  3AVI A;  4DU3 A;  3LZJ A;  2BDP A;  2FBY A;  1VK0 A;  4DG1 A;  4O55 A;  4JS5 A;  3ZSO A;  5HBM A;  5CYQ A;  1JXE A;  4F2R A;  4CFB A;  4FJK A;  1JL2 A;  3VQ6 A;  3LAM A;  2IDO A;  3OYJ A;  4E7H A;  3T19 A;  4RW9 A;  3HP6 A;  3F9K A;  5FRO A;  1C1C A;  4FJI A;  4Z4F A;  4CJV A;  1J53 A;  3KIO A;  4DTX A;  3QEV A;  3G10 A;  2HNY A;  4DTR A;  1L3T A;  2DFH A;  4Q0B A;  1VRU A;  4DQS A;  1QSS A;  1NKB A;  2KFN A;  4JLH A;  2P51 A;  4KB1 A;  2FBX A;  4RW8 A;  2X78 A;  5C42 A;  1RNH A;  1RT3 A;  5SZT A;  5C25 A;  3NHG A;  5HLF A;  2O4I A;  1TAQ A;  3AV9 A;  1A5W A;  1ZBL A;  2DFF A;  4TSX A;  1RTI A;  1SKS A;  1RT5 A;  5DK5 A;  4BDY A;  4C8O A;  1DTT A;  4CIG A;  2HB5 A;  4Q5V A;  1D5A A;  3RTV A;  3AO5 A;  5T7B A;  4CJP A;  2B6A A;  2D5R A;  3AVH A;  4CFC A;  3PV8 A;  2W42 A;  3RWU A;  4N76 A;  3ALY A;  4AHV A;  4OKJ A;  2YNI A;  4FLU A;  4DQQ A;  3AVB A;  3SUO A;  4KKO A;  3HO1 A;  4CJR A;  4Z4E A;  3AVA A;  1RT7 A;  1U47 A;  1T8E A;  1JLC A;  1TKX A;  1GOC A;  1IO2 A;  3SV4 A;  3V81 A;  3OYA A;  2OPS A;  3OYC A;  4DTU A;  5HRN A;  1NJW A;  1RDC A;  3TAQ A;  4BWJ A;  3THV A;  5HRO A;  3QEW A;  2YNF A;  1IH7 A;  1U4B A;  2HHQ A;  3LP2 A;  3VQ7 A;  1D9F A;  4YFU A;  3PY8 A;  1HYS A;  3VQQ A;  1VSM A;  4I2Q A;  3L2R A;  1TKD A;  5I42 A;  4LSL A;  3VQE A;  1A5X A;  2JGU A;  4Z4C A;  3V4I A;  3VQA A;  3C95 A;  2RN2 A;  4B8A B;  1WSI A;  3U3Y A;  3OYM A;  4ZTF A;  3ZT0 A;  2RF2 A;  4GMJ B;  1IKY A;  4NYF A;  4CJS A;  4O0I A;  3V9U A;  3SUQ A;  1HRH A;  3HYF A;  3OYL A;  3K2P A;  3O3G A;  4FK4 A;  3T1A A;  3ZT3 A;  3CM5 A;  4FCY A;  3MEC A;  1HNV A;  1RBS A;  4BE0 A;  2ZQB A;  4CJ3 A;  2R7Y A;  2F8T A;  4QAG A;  3OYB A;  3DM2 A;  1ZBI A;  3F73 A;  1RBV A;  3V1O A;  3SJJ A;  4FZX C;  3OYK A;  3I0R A;  4CES A;  1SL1 A;  1X9M A;  4FYD A;  4W5T A;  2D0A A;  3ISN C;  1TK5 A;  1BI4 A;  4E7I A;  1RDB A;  1X9S A;  3B6O A;  3NFA A;  3MXM A;  1Y97 A;  2EHG A;  1WLJ A;  3DLH A;  4H8K A;  3L3V A; 
#chains in the Genus database with same CATH topology
 3LM2 A;  2P9L B;  1JLQ A;  1FXX A;  4CGD A;  1SV5 A;  4PQU A;  3CXC M;  5JS1 A;  5AQW A;  2QM1 A;  5FRM A;  2V7Y A;  2NUB A;  1QSL A;  1WN7 A;  2Q2R A;  4EP4 A;  4CEA A;  1XHX A;  4K8X A;  5CE3 A;  2IC3 A;  2GBZ A;  4CHO A;  4KO0 A;  3OS0 A;  1BQN A;  3PIO L;  4FK2 A;  4BE2 A;  2FBV A;  5GIP A;  4JKE A;  1NK5 A;  3KLI A;  1VSE A;  1DLO A;  1VQ4 N;  2UU9 K;  1CZB A;  2EX3 A;  4I9L A;  4AHT A;  5EU7 A;  1HYV A;  3KLE A;  4YOW A;  1ITG A;  5CY4 A;  4YOU A;  5ADX H;  1TKZ A;  2Q1N A;  3VQP A;  4E1N A;  5GIO A;  4NLB A;  1W9H A;  1NKC A;  2QA4 N;  1XHZ A;  4PUO A;  1RGI A;  4YOT A;  4M45 A;  3OYI A;  3OA9 A;  2GEM A;  4IG3 A;  4Z94 A;  4JRQ A;  4M41 A;  3SQ4 A;  1BHL A;  3DXM B;  3ZEU A;  2X6S A;  2Q0U A;  3JSM A;  3ZT2 A;  4RW4 A;  4JI1 K;  3E9P A;  4BWM A;  3SBT A;  2G8I A;  2QWO A;  1VSD A;  1MDU B;  4BGB A;  3U6F A;  1VQN N;  4PWD A;  1HKG A;  4JN4 A;  5ELZ A;  3SUP A;  1O13 A;  1C0M A;  4JKF A;  4ELV A;  2D0O A;  4M7X A;  4FLX A;  4LY7 A;  3AVF A;  3ZLJ A;  4DFJ A;  4NCA A;  1VRT A;  1SUQ A;  3ZSV A;  3VEY A;  4M3T A;  4FLZ A;  3R8E A;  4BRF A;  3ZEU B;  4H0P A;  3V6D A;  3UE5 A;  4CFD A;  3AVC A;  3QEP A;  3K57 A;  3QO9 A;  3TTC A;  3DRS A;  2OTJ N;  4FLV A;  4DHY A;  1RDA A;  1GLD G;  5I9E B;  2Z1J A;  3CJA A;  5KPZ A;  5AQF A;  4M3W A;  4W5R A;  3AAR A;  2AP1 A;  1VQM N;  4E7L A;  5AQI A;  2QKK A;  1X1P A;  4JRP A;  3HP9 A;  3QEI A;  4BRK A;  3QFU A;  4N47 A;  3S3N A;  3QFP A;  3OBW A;  1NLV A;  4RCH A;  4BQL A;  5C2F A;  4FJ5 A;  3T1Y K;  3SZ2 A;  2QXF A;  2X6N A;  2YJE A;  1NJY A;  1Q81 O;  3VEX A;  3KVG A;  3HBT A;  5BRD A;  1BA0 A;  4KRF A;  5AQN A;  1WB9 A;  4O44 A;  1EET A;  1QHT A;  3ZET A;  4HWI A;  4CK2 A;  4B3O A;  3SI6 A;  3HPO A;  5CR4 A;  4BRO A;  4CJQ A;  5M1F A;  3SUN A;  3VEO A;  4WFA L;  2P9I A;  5C0Y A;  1SL2 A;  3CJ7 A;  2P5G A;  1NK6 A;  4DLG A;  4CHN A;  2E2P A;  4A62 A;  5GAG P;  4A57 A;  4BRG A;  3ULD A;  5JVH L;  3VQ8 A;  3CC2 N;  3LWM A;  1M1K O;  1J5O A;  2P9P A;  4I2P A;  3NVK A;  2HHX A;  3KHY A;  3K0S A;  4C8L A;  4H5N A;  3RMA A;  3ZET B;  3KKS A;  1Q18 A;  2KQ2 A;  1L3S A;  4JD2 A;  3DLL L;  2P9I B;  3D2E A;  1JLE A;  4OKE A;  2HBK A;  4C8N A;  1JCG A;  1XNR K;  4OPJ A;  1KLM A;  3HXM A;  4FJN A;  2XY5 A;  3CFP A;  2P9P B;  4XIU A;  1QZ5 A;  3MEG A;  4E7J A;  4DS4 A;  3L2V A;  4AHC A;  4BDP A;  4YOX A;  2RPI A;  3AGR A;  4JD2 B;  1WAJ A;  5HRS A;  3MAQ A;  3D2E B;  3ID6 A;  3E1Y A;  3EN9 A;  3LDP A;  4ZHR A;  3I56 N;  3JYT A;  1K9M O;  3CJB A;  3EY1 A;  1VSJ A;  1BUP A;  5BRF A;  4FPB A;  4DLE A;  4FM2 A;  3IRX A;  4ISG A;  2GWJ A;  2ZJP L;  4JK7 A;  4LF5 K;  1JLB A;  3MN5 A;  5FPN A;  4O5F A;  1VSK A;  3KWI A;  4G9Z A;  1CZ9 A;  1B9D A;  4C1N I;  4CJ7 A;  1XC9 A;  4CD3 A;  1S6P A;  2CGK A;  1BU6 O;  4CJU A;  1SQK A;  1RIL A;  3K5N A;  1J6Z A;  4JKH A;  3AA5 X;  4FSV A;  3VPZ A;  1TGO A;  3I0S A;  4ID5 A;  3TSQ A;  5C12 A;  1NOY A;  4CE9 A;  5AQZ A;  3L0Q A;  1EP4 A;  4B1Z A;  1BO5 O;  4YHH K;  4GW6 A;  1C1A A;  1C1B A;  1MWM A;  4EFH A;  1XNQ K;  4KHN A;  4KB0 A;  4FJM A;  1VQ9 N;  2HBJ A;  4FWQ A;  4HTL A;  2DPN A;  4CBU A;  1GLC G;  4K25 A;  2PYL A;  1XC3 A;  1NGE A;  1RBT A;  1HQE A;  3C6A A;  4AF1 A;  1K6Y A;  2VWK A;  4KH4 A;  1TKT A;  4M7Y A;  3THY B;  1YVN A;  4MO4 A;  5HRR A;  4E3S A;  2PYJ A;  1HKC A;  4H4M A;  4DFP A;  1HJO A;  4H5W A;  2O8F A;  1LW2 A;  1BIZ A;  3RR8 A;  4LH4 A;  1NK4 A;  3H3N O;  2I7N A;  1KVB A;  4FLY A;  2E4L A;  1ZBF A;  1WSH A;  4RW7 A;  1NJX A;  2QW9 A;  3QBX A;  4DKW A;  4M63 C;  3PIP L;  1C6V A;  4DTN A;  3I8B A;  3OY9 A;  1KFS A;  4B9S A;  3LWL A;  2KTQ A;  3MN7 A;  2BH1 A;  4B9U A;  5BRE A;  4FVM A;  2HHV A;  1LAW A;  3W0L A;  2Z1H A;  3FE1 A;  1ASU A;  3GDQ A;  1V4S A;  3TR8 A;  4I7F A;  2UUC K;  4DSE A;  1KRP A;  1EWQ A;  3F5T A;  3VTI A;  4CGH A;  4HUF A;  4NB4 A;  3MWT A;  3H6E A;  4BVP A;  2RKI A;  3CFO A;  4WF9 L;  4BRE A;  2IIR A;  4CZI A;  3MN6 A;  3K59 A;  1JJ2 M;  3W3D A;  4WYB A;  4DV4 K;  4JKC A;  1LWF A;  2ZM6 K;  2FSN A;  4F3T A;  4W5N A;  3A5M C;  3MCP A;  2QEX N;  3FFK B;  2OA8 A;  3AVK A;  2G8K A;  2KW4 A;  1DT9 A;  3LP3 A;  4H0T B;  3FZH A;  3D2F A;  5BR9 A;  3WXM B;  2AJQ A;  2D0B A;  1YJW N;  3VGL A;  1XMQ K;  4J2D A;  3O4W A;  3QIC A;  1BA1 A;  2P9S A;  4FJ8 A;  4I6M A;  2OPP A;  2BDP A;  4DU3 A;  1LOT B;  3WXK A;  2FBY A;  3ZSO A;  1JXE A;  4FJK A;  5AFU H;  1I94 K;  4E7H A;  3VF4 A;  1QHA A;  5AQK A;  4Z4F A;  3ENO A;  3KIO A;  4WCE L;  1NMD A;  3D2F B;  4Q0B A;  4DQS A;  1QSS A;  2P51 A;  3ENH A;  1VQ8 N;  4KB1 A;  2X78 A;  4EIA A;  1RT3 A;  5SZT A;  2P9S B;  3EL2 A;  3M3Z A;  5MLC Q;  4I6M B;  3O5B A;  4BDY A;  4C8O A;  3NMU A;  1DTT A;  4NO7 A;  4CIG A;  4Q5V A;  4DUZ K;  3AO5 A;  3PV8 A;  3VF2 A;  4CFC A;  3Q7C A;  4N76 A;  4OKJ A;  4ISE A;  3K9K A;  4FLU A;  4DQQ A;  4KKO A;  1U47 A;  2Q0R A;  3V81 A;  3TAQ A;  3C0B A;  2FSJ A;  1KQS M;  1U4B A;  1FJG K;  4YFU A;  3VQQ A;  2O8D A;  4I2Q A;  1TKD A;  2E5L K;  2NNW A;  3VEZ A;  1A5X A;  3C95 A;  1WSI A;  3U3Y A;  3L4I A;  3ZT0 A;  3HSC A;  4GMJ B;  1IKY A;  1HUX A;  5AQH A;  2O8B A;  3K2P A;  3O3G A;  4FK4 A;  3U8X A;  2V52 B;  3CM5 A;  3DAW A;  1RBS A;  3N4P A;  4H03 B;  4BE0 A;  3HM8 A;  4CJ3 A;  1OVQ A;  3R1X A;  3OW2 M;  4QAG A;  3U9D A;  4JI8 K;  1ZBI A;  3BP8 A;  2O8D B;  4KH6 A;  1SAZ A;  3I0R A;  2D0A A;  1TK5 A;  4E7I A;  1RDB A;  4BGA A;  4CZL A;  3B6O A;  1X9S A;  1ASV A;  1S1U A;  2P9K A;  3CCR N;  4H8K A;  3DLH A;  4FO0 A;  5C10 A;  2E88 A;  4DV0 K;  2NRT A;  3O9R A;  3FR0 A;  2A1S A;  4CZJ A;  1U04 A;  3D6R A;  2YJF A;  4CJK A;  4GV6 A;  4ILG B;  4K43 A;  4FJX A;  4DR4 K;  3VGK A;  4R79 A;  4B9L A;  3HPG A;  3OVN A;  3O80 A;  1YJ9 N;  3NGY A;  4IEE A;  3PX6 A;  3VF6 A;  3AA2 A;  4BRM A;  2P9K B;  1T44 A;  2DY4 A;  3E9L A;  3NE6 A;  1REV A;  3J81 O;  3LAK A;  3NAE A;  1DEJ A;  1BG3 A;  2F8S A;  3ZSQ A;  2A42 A;  4QS7 A;  3MDQ A;  2OZM A;  3SMS A;  3HT3 A;  2W41 A;  1S72 N;  3CIP A;  5B8H A;  3KD5 E;  4BRA A;  4HCC A;  3H3O B;  3AVL A;  3BF1 A;  4M3R A;  4KTW A;  1VQ6 N;  5AQT A;  4Z4I A;  1RBU A;  5LJV A;  3PX4 A;  1IKX A;  1T03 A;  4LSN A;  3H1Q A;  4JKA A;  1U45 A;  4U67 L;  4ICL A;  4FJL A;  3VQB A;  3SQ2 A;  3O1B A;  4B1U B;  4V19 S;  3C7N A;  5E41 A;  1HPZ A;  1GLL O;  3P1G A;  3AA3 A;  3WXL A;  1OH7 A;  4IJN A;  3NF8 A;  4DU4 A;  3J7Y P;  1U2V A;  1RBR A;  2P9N B;  4M3U A;  1KFD A;  4H0V B;  1JKH A;  4Z0U A;  3OJU A;  4PHT X;  4FZY A;  1SS6 A;  2G8V A;  3O4Q A;  1IBL K;  4WE1 A;  2NLX A;  3C7N B;  1SKR A;  4KHP K;  3R3L A;  1D8Y A;  4DR6 K;  1UWB A;  2H3G X;  3AVJ A;  1FKP A;  1Z25 A;  3JS6 A;  4KBO A;  3MXI A;  2E1Y A;  4JAX A;  4LF6 K;  2DFE A;  4RG8 A;  3SYZ A;  3SQ1 A;  5DMR A;  3CCQ N;  3TAB A;  4LF4 K;  3RMB A;  4X66 K;  5AFU A;  4IJA A;  1P90 A;  5EOY A;  2P9L A;  4ILJ A;  1DGK N;  4NXN K;  5M1K A;  4BRH A;  3ZSR A;  4GKJ K;  1GLF O;  4B8C A;  4DV2 K;  2AA4 A;  5J1E A;  3QER A;  4IOA L;  3E01 A;  4CIE A;  1YTU A;  1IJJ A;  2OAN A;  2Q36 A;  3KKR A;  4O8U A;  1G99 A;  4CJL A;  2OPQ A;  3QNO A;  4DQR A;  3SCX A;  4CEO A;  3SNN A;  2A3Z A;  3KK3 A;  4B1V A;  1HX1 A;  3DOK A;  1HNX K;  1S9G A;  3P4I A;  3I55 N;  4IKF A;  3C94 A;  2W6K A;  3IG1 A;  4BDZ A;  4FW2 A;  3VEW A;  3QIP A;  3TU5 A;  1UA0 A;  3KK7 A;  4R5P A;  2GWK A;  2CGL A;  3QBW A;  3NH1 A;  4FWR A;  2UXD K;  4H5R A;  4W5Q A;  3K5O A;  3CJC A;  2Z1I A;  1NBW A;  3THW B;  1NG9 A;  1RTD A;  4CEZ A;  4B1X B;  2YCH A;  4AIL C;  3DXM A;  1RT2 A;  2HBL A;  1KVA A;  4BRP A;  3T7Z A;  4PA1 A;  1F21 A;  3QNN A;  2OCE A;  3GG4 A;  4CGI A;  4OX9 K;  1HNZ K;  3PSI A;  3E9O A;  3KLF A;  4OKK A;  4AM6 A;  2OYQ A;  4CF2 A;  3CET A;  4JS4 A;  3BGR A;  2BAN A;  2PAV A;  4BRC A;  1E4F T;  3CCS N;  1LW0 A;  4GVM A;  4CI6 A;  4BY9 C;  4H4O A;  4NCB A;  4FJH A;  3U4L A;  2ATQ A;  1HQU A;  5JLH A;  1MWK A;  4N41 A;  3A5N C;  4B9M A;  4GY2 B;  1R0A A;  4DS5 A;  1S5J A;  3VOV A;  1JLF A;  4CZK A;  2XRI A;  1BL3 A;  2GUP A;  1NJZ A;  2FC0 A;  5FRN A;  2VYP A;  2B4J A;  4AQY K;  2HMP A;  3I8D A;  1E4G T;  3P38 A;  3A8Y A;  5EVZ A;  3QET A;  2WUS A;  5M1O A;  4FOI A;  4CCH A;  1KAX A;  4AHU A;  2E1Z A;  4N56 A;  3J8A A;  4DQI A;  4PL7 A;  3ID8 A;  4DMN A;  4LFB K;  2NRR A;  1JXB A;  3GE1 A;  1XMO K;  3P39 A;  4OLB A;  1OVY A;  4JI2 K;  4OLA A;  2NRX A;  5KTQ A;  4JHD A;  3LDQ A;  4IDH A;  4DSL A;  3P5J A;  4CJW A;  4H5T A;  3HOS A;  5C15 A;  1JLG A;  4FLW A;  3CJ1 A;  3UIQ A;  2KFZ A;  1NWK A;  5JVG L;  4KHS A;  1QQM A;  5D3G A;  1IG9 A;  3NVM A;  1Z6R A;  1EQY A;  5KI6 A;  1K73 O;  4JHD B;  3AAQ A;  2G8F A;  3CCU N;  4L3Q A;  3HPH A;  4FWK A;  2BTF A;  2NRV A;  4BRN A;  3CME N;  4K0K K;  2RHK A;  2E6L A;  1KSP A;  2Y1J A;  4IFY A;  4CBW A;  3KTQ A;  1YJN N;  1RFQ A;  3M8S A;  3LDL A;  2WFB A;  4PY5 A;  1QQO A;  5J2Q A;  4CGG A;  3OYD A;  1X9J A;  4WQ5 C;  1WSE A;  3G25 A;  1HKB A;  4C8M A;  3CFR A;  3CQX A;  2O8E A;  4NCG A;  3AO3 A;  1JLA A;  5J2M A;  2B5J A;  3B6P A;  1WBB A;  1S9E A;  1KCF A;  3IFR A;  3SQ0 A;  3GOI A;  2O8C B;  1U49 A;  2Z1G A;  4E1J A;  5CYM A;  4FK0 A;  4AHS A;  3V9S A;  3L6Q A;  3EZ5 A;  4W5O A;  3NF6 A;  4B9V A;  1BQM A;  3ZSY A;  2YNG A;  3EZW A;  4CIF A;  3KJV A;  2O8E B;  5CHI A;  4WQ4 A;  4DTO A;  3DYA A;  3TAP A;  2CH6 A;  4JI4 K;  3SMP A;  4YDU C;  2Q3S A;  3TTF A;  4NYN A;  1RDU A;  3A5O C;  4BR4 A;  4O5B A;  2A41 A;  3AVI A;  3DXK A;  2NRH A;  1NGH A;  1H1V A;  3EKU A;  3LAM A;  2IDO A;  1NGG A;  2E2N A;  4RW9 A;  3HP6 A;  1C1C A;  3ENB A;  1J53 A;  3QEV A;  3P31 A;  1VRU A;  4JLH A;  1C0F A;  4AM7 A;  1N34 K;  3VET A;  5C25 A;  3CER A;  2O4I A;  1TAQ A;  4MLH A;  1QZ6 A;  5BN9 A;  1ZBL A;  2DFF A;  3IUC A;  5AQS A;  3DXK B;  5ADX A;  3CF5 L;  1NGD A;  5AQV A;  1RT5 A;  2HB5 A;  4DR5 K;  1GLB G;  3G4S N;  2GX9 A;  3THY A;  5T7B A;  3HOT A;  4JKB A;  5M1Q A;  1GOC A;  1IO2 A;  3OYA A;  3UKU A;  3CCL N;  3WT0 A;  4WFN L;  1VQ5 N;  1IH7 A;  2IVN A;  3LP2 A;  3EE8 A;  1D9F A;  3PY8 A;  2ASP A;  1N33 K;  5F0X A;  3CD6 N;  1FW6 A;  3V4I A;  3M6G A;  4BQZ A;  4F9O A;  4ZTF A;  5AQO A;  4NYF A;  4O0I A;  1VQP N;  1XQS C;  2YHX A;  5H1S Q;  3UKU B;  2YHY A;  2F8T A;  3GL1 A;  3OYB A;  3VMF B;  2ASO A;  4XH1 A;  1RBV A;  3BEX A;  4CES A;  1SL1 A;  4FYD A;  4CBX A;  4W5T A;  2EHG A;  5KQD A;  4YOV A;  3WNF A;  2I5J A;  3SPY A;  3DMJ A;  4OPH A;  1K8A O;  3NF9 A;  4XH4 A;  5GAH P;  1NGF A;  3HST B;  3O6W A;  3NH2 A;  3TI0 A;  1LWE A;  3HI0 A;  4X64 K;  4KI4 A;  3EKS A;  3JXU A;  2FXU A;  3D0P A;  4BAC A;  3SJH A;  3C6U A;  1NMN A;  3OS2 A;  1LV5 A;  4IFE A;  1D9D A;  3S3M A;  3F2K A;  4YOR A;  2A5X A;  1EWR A;  4JI6 K;  4KI6 A;  2DTU A;  4LFC K;  3NGI A;  4FJ9 A;  4OGE A;  4B3M K;  1NGC A;  1GLE G;  4KTZ A;  4UQG A;  1ESV A;  1WUA A;  1J9A A;  4KAZ A;  1RDW X;  1N32 K;  1IKV A;  2VGN A;  2KZZ A;  3A2F A;  4DV7 K;  3M8Q A;  3CCJ N;  3WNG A;  5AQX A;  4QS9 A;  1LCU A;  3CPE A;  2ASM A;  2IOC A;  3SAF A;  4CJ4 A;  3HVT A;  3RMD A;  2Q31 A;  3ATV A;  3OHR A;  4FM1 A;  3BUZ B;  1Q7Y O;  4MFB A;  5TKW A;  2E6M A;  3O3H A;  4F8R A;  1WOQ A;  3AO1 A;  2YI1 A;  3MK6 A;  3MCA B;  5C2D A;  3CYM A;  4M3Z A;  4X65 K;  3DRP A;  3VN5 A;  4AH9 A;  4H0X B;  1YT3 A;  4YOY A;  3NGZ A;  3CJ9 A;  3CCM N;  3WQU A;  1W97 L;  3HZ6 A;  3THX A;  3D7E O;  3ZX0 A;  3IAY A;  3NDK A;  3ZX3 A;  2XHB A;  5EX5 A;  3LAN A;  3U3G A;  3TAR A;  2IVO A;  3TWH A;  3BF3 A;  2HF4 A;  3KD1 E;  2LSN A;  2ZJQ L;  4CEB A;  4CER A;  1Q9Y A;  3JAM O;  3AY9 A;  3IMX A;  4CJT A;  4UY8 O;  3LDN A;  3C6H A;  3THX B;  3TSU A;  3VA0 A;  2Q97 A;  2E20 A;  3FLC O;  4CJ5 A;  2JWL A;  3KLH A;  3DLK A;  1W2B M;  5BPN A;  4FWO A;  1VQ7 N;  3E66 A;  4ISF A;  4CEF A;  1QTM A;  2ZGZ A;  2HVI A;  1HMV A;  4ZTJ A;  4LF7 K;  3OYH A;  2V7Z A;  5SWM A;  4JI7 K;  1BGX T;  4G1Q A;  1C0U A;  1WSG A;  2EWS A;  4B9N A;  1T6C A;  3ZT1 A;  3AA4 A;  4A5B A;  5KGX A;  3PO4 A;  4RWT A;  5F2R A;  4IFV A;  4CEE A;  3O1W A;  3VEN A;  4B1W B;  2VWJ A;  5CZ2 A;  4DSI A;  3WNH A;  1BCM A;  1IBK K;  1TVR A;  1UAX A;  3V1R A;  4CGJ A;  3CM6 A;  4JKD A;  4HCB A;  1B92 A;  3CI5 A;  4BR9 A;  4HUE A;  4DTS A;  4MO5 A;  3CQY A;  1T3V A;  4GV9 A;  2WOM A;  1I39 A;  4DB3 A;  4DF4 A;  3VER A;  3ZYY X;  4GVE A;  1S1T A;  3MXJ A;  3OYE A;  1C0T A;  3CPW M;  4J2A A;  3OS1 A;  3VA3 A;  3DRR A;  2IGI A;  4QOZ B;  4Z4H A;  3A0I X;  5KQ8 A;  4J2B A;  5EY4 A;  5LL6 Z;  2ZD1 A;  5AQL A;  3OJS A;  4DCH A;  5KRS A;  1SL0 A;  3QEX A;  1FK9 A;  1WSF A;  1MA9 B;  1N8R O;  4PKG A;  3DWL A;  1BIU A;  2VG5 A;  3O9Q A;  5AQU A;  3RRG A;  1RT1 A;  3LM9 A;  4PKH A;  4JNE A;  1R59 O;  3ATU A;  2X74 A;  1SKW A;  3EYZ A;  1S1X A;  2P9N A;  1YIJ N;  4FW1 A;  4KFB A;  4CZE A;  1MU2 A;  1Q82 O;  1I3A A;  3ZSW A;  3AO2 A;  4NLC A;  3SAH A;  4KH5 A;  3HVR A;  3TAG A;  3QIO A;  4DTM A;  1NU0 A;  3L2W A;  3VQ4 A;  3D45 A;  2D0P A;  2G8U A;  2WON A;  2E2O A;  5K14 A;  3FZM A;  1BWF O;  3VQC A;  1OKJ A;  4HHT A;  4KTQ A;  4EZ6 A;  3C6T A;  4YDU A;  4CF1 A;  5AQP A;  1OH6 A;  2HMI A;  3TAM A;  3CQ8 A;  4JKG B;  3SV3 A;  4C8K A;  4DTJ A;  4BC3 A;  1WBD A;  3K5M A;  2FLO A;  3T1H K;  4FL9 A;  2PY5 A;  4CF8 A;  3HM9 A;  1XUP O;  1UA1 A;  4EAH D;  1ASW A;  2HND A;  1RTH A;  4FWN A;  1WSJ A;  4KHW A;  1WAF A;  1T05 A;  4B1Y B;  4DSF A;  2F9W A;  4DV1 K;  3G0Z A;  3FZF A;  3FFI A;  1Q86 O;  2QWR A;  4XEI A;  1Z26 A;  4H5V A;  5A2Q O;  4IOC L;  4GV3 A;  3WNE A;  4FJG A;  1NK8 A;  2XY6 A;  2V51 B;  1KTQ A;  1VSH A;  4IG0 A;  2OPR A;  3CC4 N;  3LPU A;  4OJR A;  4CEQ A;  4E7K A;  4E0D A;  5HP1 A;  4CFA A;  1K8K A;  4CJE A;  3HRG A;  3MX5 A;  1S22 A;  3OBY A;  3V9Z A;  3S3O A;  5AR0 A;  4B9T A;  4FWL A;  1NM1 A;  3MED A;  3THW A;  3QLH A;  3VGM A;  1ATR A;  2HF3 A;  1BCO A;  1VSF A;  2KLA A;  3DJC A;  2QWP A;  4M42 A;  2A40 A;  4DSK A;  1IV0 A;  1K8K B;  4KHY A;  4B9Q A;  1JL1 A;  3FZL A;  4IEI A;  4IDK A;  2FBT A;  1OH5 A;  1TL3 A;  2YHW A;  2E8A A;  2YHA A;  4LF9 K;  2HNZ A;  2GEL A;  2F4V K;  5AQQ A;  2O4G A;  4KRE A;  1LAV A;  1ILY A;  1KVC A;  1TK8 A;  4DU1 A;  5AQR A;  4CVN E;  4O8K A;  3T3F A;  5KRT A;  5GIN A;  1BI4 B;  3IDH A;  1W7A A;  1NKE A;  3A5L C;  4O0J A;  1BIS A;  1OH8 A;  4A2B A;  1UOC A;  3M5R A;  1G15 A;  1ZYQ A;  5AQM A;  3R6M A;  3LL3 A;  4K42 A;  3WUH A;  5TKY A;  4OGC A;  5AJ3 K;  3GBT A;  2HBM A;  4BR0 A;  3EO3 A;  3J80 O;  1ZBS A;  4N5S A;  3S9H A;  1VQL N;  3O9T A;  1TAU A;  1S1W A;  1N6Q A;  2CH5 A;  2YKM A;  4LH5 A;  1CXU A;  4F4K A;  3MWP A;  1EO1 A;  4JK9 A;  4EP5 A;  4E1M A;  5HOO A;  4B08 A;  3LP1 A;  4DV6 K;  1X9W A;  3TAN A;  2W6L A;  5F1X A;  1NK0 A;  5FPD A;  4BC5 A;  1VK0 A;  4DG1 A;  4O55 A;  4JS5 A;  4F2R A;  5FPM A;  2FSK A;  1D4X A;  3T19 A;  2QTD A;  5FRO A;  4FJI A;  3AAP A;  4FOE A;  5E26 A;  3G10 A;  2HNY A;  1L3T A;  1NKB A;  5LMU K;  4RW8 A;  5C42 A;  4BRL A;  1YHQ N;  3NHG A;  5HLF A;  3AV9 A;  1A5W A;  3QB0 A;  5AQJ A;  5DK5 A;  1NGJ A;  4GNI A;  5JIC A;  1D5A A;  2KHO A;  2B6A A;  3AVH A;  2W42 A;  3RWU A;  5BR8 K;  3AVB A;  3SUO A;  3HO1 A;  4ILH A;  1RT7 A;  2ZGY A;  1HPM A;  4MDA A;  1T8E A;  3PLA A;  3SV4 A;  2OPS A;  3UKR A;  3OYC A;  4DTU A;  5HRN A;  1NJW A;  1RDC A;  1NNE A;  5HRO A;  1DKG D;  2YNF A;  3QEW A;  2NZT A;  2HHQ A;  2D1K A;  3BZC A;  3KWG A;  4LSL A;  3VQE A;  2RN2 A;  3OYM A;  4PL8 A;  4FVU A;  5DM6 L;  4EHU A;  5IT9 O;  3SUQ A;  1HRH A;  3HYF A;  1KD1 O;  3T1A A;  3ZT3 A;  4FWM A;  3UKR B;  1GLA G;  2ZQB A;  2R7Y A;  1HR0 K;  1ATN A;  1TUU A;  4FZX C;  2VCP A;  3SJJ A;  4BG9 A;  3ISN C;  2BUP A;  4QS8 A;  3H45 C;  2O8C A;  3MXM A;  1WLJ A;  4CJV A;  3NF7 A;  3L3V A;  2IAJ A;  4BE1 A;  3CG7 A;  1X3M A;  5AQY A;  3C65 A;  4M3X A;  2P1J A;  4CZH A;  4F2S A;  1GOA A;  5BPL A;  1XI1 A;  1IG8 A;  3H08 A;  4BC4 A;  4LC9 B;  4Z4G A;  2Y1I A;  4DV3 K;  1QQC A;  1EX4 A;  3AO4 A;  3QIN A;  4RTF D;  2FF6 A;  1FKO A;  2G8H A;  4CHZ A;  2ETJ A;  4BR2 A;  4DR3 K;  4C23 A;  4CW7 B;  1YVU A;  1IKW A;  2YV0 X;  3TPQ A;  2J4R A;  3N4Q A;  4FWS A;  4A61 A;  4WFB L;  3LDS A;  2HHH K;  3FZK A;  1TYQ A;  5M1N A;  4BVO A;  4DWI A;  4CHP A;  2HHT A;  3SK3 A;  4E89 A;  3UB5 A;  3VQD A;  2HHU A;  4DUY K;  1ZBH A;  3ZX2 A;  5IWA K;  3KK1 A;  4IZ9 A;  3K5L A;  1SZ2 A;  3M8P A;  2YHB A;  4DFK A;  3CCE N;  4DR2 K;  1NOZ A;  4CF9 A;  2E2Q A;  4CF0 A;  2JLE A;  3ZT4 A;  5KPT A;  3G71 N;  4B3R K;  4JI0 K;  2A6A A;  1TYQ B;  2VWB A;  3VEV A;  1CXQ A;  3LDO A;  1ZXO A;  1EXQ A;  1A5V A;  1YTA A;  4DFM A;  4DQ8 A;  4IXC A;  3HJF A;  2ZF5 O;  2YNH A;  3SAG A;  3QDK A;  4FZZ A;  4LF8 K;  1KC8 O;  3HK2 A;  1L3V A;  3MX2 A;  1QSY A;  3F9M A;  4HUG A;  5LMN K;  1YXQ A;  3VTH A;  4DQP A;  3RRH A;  5J2N A;  3M8R A;  1W0H A;  1VQO N;  1BDG A;  4ELT A;  2P5O A;  3DLG A;  2D0C A;  2F9T A;  3FGU A;  4Y1C A;  3RR7 A;  1TV6 A;  3CCV N;  3DI6 A;  4DR1 K;  3IS9 A;  5J2P A;  5FPE A;  1P8Z A;  2PFU A;  3L4Q A;  2NRZ A;  1V4T A;  4DTP A;  1X3N A;  4L8R B;  1EKE A;  3VQ5 A;  4Y0W A;  4CHQ A;  3L8B A;  4JI5 K;  1NGA A;  2PZS A;  4MLE A;  3V1Q A;  1Q8I A;  4FJ7 A;  3EEQ A;  1VSI A;  3BZK A;  4CED A;  1T6D A;  3O3F A;  2BE2 A;  2HW3 A;  4OPK A;  5KGW A;  2WC9 A;  3OYG A;  1J54 A;  3AVN A;  1Q9X A;  3S41 A;  1C0G A;  2XY7 A;  1ZC6 A;  4FM0 A;  3NH0 A;  5JLF A;  1JCE A;  3DLB A;  4C1N K;  3LAL A;  2QWQ A;  4CK1 A;  2PBD A;  3CHW A;  1YUW A;  1ZBU A;  2ZJR L;  2A1R A;  4H0O A;  4OPA A;  4KV8 A;  2QKB A;  4IBN A;  3WEE A;  1RDD A;  2G8W A;  2GV9 A;  4KPY A;  1U48 A;  1YAG A;  2GTD A;  1KXP A;  2YX6 A;  3P83 D;  3V9X A;  1S1V A;  1O1W A;  4A5A A;  1N36 K;  3OTO K;  4ELU A;  2O8F B;  1S6Q A;  1WNS A;  2P9U A;  3L2Q A;  4AHR A;  3WEE B;  3HTV A;  2ZE2 A;  4JEP A;  3TAE A;  4BC2 A;  3ZSX A;  1NJI O;  2F7T A;  3EE9 A;  1HYZ A;  3H1V X;  3Q7B A;  1YF5 L;  3ULE A;  5LY3 A;  2HHW A;  4DV5 K;  3O4N A;  1GOB A;  5BN8 A;  2VG6 A;  2CGJ A;  2WBN A;  3I33 A;  3LPT A;  2XO7 A;  4J2E A;  3VQ9 A;  1QE1 A;  4BG8 A;  2P9U B;  3O8M A;  4JI3 K;  3NCI A;  3DOL A;  3WXJ A;  1M90 O;  3K9J A;  4DSJ A;  2UXB K;  1QVG M;  4QCL A;  4K8Z A;  4FXD A;  4CGF A;  2QK9 A;  5I3U A;  5M1P A;  1LWC A;  5JMV A;  2VGM A;  3MEE A;  3ULE B;  4CZG A;  4J8F A;  4U7B A;  4M3Y A;  2QWM A;  4FWP A;  1YIT N;  1ATS A;  2QXL A;  4I9Q A;  4EHT A;  4BR7 A;  1XWL A;  1NGI A;  4HTU A;  4IWV A;  3NBP A;  1RT4 A;  3KLG A;  4CK3 A;  1YI2 N;  1RTJ A;  4CJF A;  5AZJ A;  3TAF A;  3G6E N;  1KAY A;  4XH5 A;  2ITM A;  4Y1D A;  1L3U A;  3DLR A;  2F96 A;  3OYF A;  2W40 A;  1L5U A;  3ASM A;  5AQG A;  5FDL A;  3AVM A;  4PKI A;  2QWL A;  3QML A;  1B9F A;  4EZ9 A;  3SLC A;  1NK9 A;  2YKN A;  2OZS A;  4CZF A;  4OO1 J;  3B8A X;  1BOT O;  3H46 O;  1RT6 A;  2IVP A;  3U9Z A;  3QES A;  3CC7 N;  5AZJ B;  3AVG A;  3IKM A;  3O08 A;  2XY8 A;  3PSF A;  2ZWH A;  4YY3 K;  1JCF A;  1QS4 A;  3J7Z O;  3LZI A;  3PUF A;  1VSL A;  4GKK K;  3O9U A;  3SPZ A;  1T7P A;  3VES A;  1HLU A;  4BRD A;  2ITG A;  1U6Z A;  1HNW K;  2GUI A;  4MQ3 A;  3TTD A;  2BGG A;  4MDB A;  2VG7 A;  4LFA K;  2HHS A;  2NRW A;  3L2U A;  4KHU A;  3DLE A;  3OYN A;  5KPR A;  4FJJ A;  5FLX O;  3BY5 A;  3HL8 A;  4K41 A;  3PO5 A;  4B3T K;  4LD0 A;  2UYT A;  3MMV A;  4RW6 A;  4KHQ A;  4IOX A;  5CZ1 A;  1KLN A;  4BRQ A;  2KZM A;  4O4G A;  4DF8 A;  4F3O A;  1N5Y A;  2VQF K;  4DR7 K;  2O8B B;  3ITH A;  3ZSZ A;  4ID1 A;  4HVJ A;  1CLQ A;  3KK2 A;  4FPA A;  5GAE P;  3V9W A;  1Z05 A;  4CHY A;  5BPM A;  3L3U A;  3RSE A;  1HJR A;  1RCH A;  1TUY A;  5HRP A;  1VAZ A;  3LP0 A;  4X62 K;  3PX0 A;  2VQE K;  1IBM K;  4H0Y B;  4WQ4 C;  4WQ5 A;  4E19 A;  1HNI A;  4FLT A;  3ZCM A;  4OVL A;  4CEC A;  4IO9 L;  4YNQ A;  4BRI A;  4JK8 A;  3M1F A;  4IO8 A;  3O9S A;  1NK7 A;  1DTQ A;  3BDP A;  3J7A P;  1QVF M;  2I7P A;  5JS2 A;  3RSE B;  3K58 A;  3SBG A;  3RMC A;  4JKG A;  5C24 A;  2HVH A;  1TL1 A;  1CZA N;  4CZM A;  3R9P A;  4JV5 K;  3MN9 A;  3T69 A;  5AZI A;  1TK0 A;  2IS3 A;  3LZJ A;  4B3S K;  3TSP A;  4BR5 A;  5HBM A;  1J5E K;  1QQN A;  5CYQ A;  4CD1 A;  5LJW A;  4A59 A;  2QWN A;  4CFB A;  1JL2 A;  1VQK N;  1VHX A;  3VQ6 A;  3OYJ A;  2QI2 A;  3F9K A;  2D4W A;  4NXM K;  2FF3 B;  4DTX A;  4DTR A;  2DFH A;  2HST A;  2RE2 A;  2KFN A;  3CMA N;  2FBX A;  5AZI B;  1RNH A;  1GLJ O;  2OTL N;  3RVC A;  4TSX A;  1RTI A;  1SKS A;  2UUA K;  1Y64 A;  1NGB A;  3RTV A;  3WXI A;  4CJP A;  5E84 A;  2D5R A;  2HOE A;  3ALY A;  4AHV A;  2YNI A;  2UXC K;  4CJR A;  4Z4E A;  3AVA A;  1JLC A;  1TKX A;  4JYA K;  5DM7 L;  5GAD P;  1S3X A;  3KZB A;  5EXW A;  2UUB K;  4BWJ A;  3THV A;  3VQ7 A;  1HYS A;  1VSM A;  3L2R A;  1U2V B;  5I42 A;  1KAZ A;  4Z4C A;  2JGU A;  3VQA A;  2JWK A;  4B8A B;  3AGK A;  2WTU A;  2RF2 A;  4CJS A;  3V9U A;  2KKZ A;  3OYL A;  4FCY A;  3MEC A;  1HNV A;  5BRH A;  4A2A A;  3DM2 A;  3F73 A;  3V1O A;  3OYK A;  1E3M A;  1X9M A;  1BI4 A;  3WQT A;  3NFA A;  1Y97 A;  5HL7 L; 
#chains in the Genus database with same CATH homology
 3WNF A;  2I5J A;  2IAJ A;  3SPY A;  4BE1 A;  3CG7 A;  3DMJ A;  1JLQ A;  1FXX A;  4CGD A;  1SV5 A;  2A1S A;  4PQU A;  5JS1 A;  1U04 A;  3NF9 A;  4M3X A;  2P1J A;  3HST B;  3NH2 A;  4CJK A;  3TI0 A;  1LWE A;  4F2S A;  5FRM A;  2NUB A;  1QSL A;  1GOA A;  1WN7 A;  4FJX A;  4KI4 A;  4BAC A;  3D0P A;  1XI1 A;  4EP4 A;  3H08 A;  4CEA A;  1XHX A;  4B9L A;  3HPG A;  3OVN A;  4K8X A;  2IC3 A;  2GBZ A;  4Z4G A;  4CHO A;  3NCI A;  3C6U A;  3NGY A;  4KO0 A;  3OS0 A;  3OS2 A;  1LV5 A;  2Y1I A;  3PX6 A;  3S3M A;  1D9D A;  3AA2 A;  1BQN A;  4FK2 A;  4BE2 A;  2FBV A;  1QQC A;  1EX4 A;  3AO4 A;  3QIN A;  2DY4 A;  1NK5 A;  4KI6 A;  2DTU A;  1FKO A;  2G8H A;  3KLI A;  1VSE A;  1REV A;  1DLO A;  2ETJ A;  4CHZ A;  3LAK A;  1CZB A;  2EX3 A;  3NE6 A;  3NGI A;  3NAE A;  4FJ9 A;  4OGE A;  4I9L A;  4AHT A;  5EU7 A;  2F8S A;  3ZSQ A;  4KTZ A;  4UQG A;  1HYV A;  2OZM A;  3KLE A;  1J9A A;  1YVU A;  3HT3 A;  4KAZ A;  1IKV A;  1IKW A;  1ITG A;  2YV0 X;  3NF7 A;  2KZZ A;  3A2F A;  5CY4 A;  3LDS A;  3KD5 E;  3M8Q A;  4DWI A;  4CHP A;  1TKZ A;  2HHT A;  3VQP A;  4HCC A;  3AVL A;  3WNG A;  4M3R A;  4E89 A;  4KTW A;  4E1N A;  3VQD A;  1W9H A;  1NKC A;  1ZBH A;  2HHU A;  1XHZ A;  2IOC A;  4PUO A;  3KK1 A;  4Z4I A;  1RBU A;  4M45 A;  3K5L A;  4CJ4 A;  3HVT A;  3OYI A;  3PX4 A;  1IKX A;  3RMD A;  4IG3 A;  1ASV A;  3M8P A;  2YHB A;  4DFK A;  1T03 A;  4LSN A;  4FM1 A;  1S1U A;  1NOZ A;  4CF9 A;  4JRQ A;  1U45 A;  4M41 A;  2JLE A;  3ZT4 A;  4ICL A;  4CF0 A;  3SQ4 A;  1BHL A;  4FJL A;  2X6S A;  4MFB A;  3JSM A;  2E6M A;  3ZT2 A;  3VQB A;  4RW4 A;  3O3H A;  3SQ2 A;  4F8R A;  3AO1 A;  4BWM A;  1CXQ A;  5E41 A;  2G8I A;  1HPZ A;  1EXQ A;  1VSD A;  1A5V A;  3U6F A;  1YTA A;  3P1G A;  4DFM A;  4PWD A;  3AA3 A;  3CYM A;  3SUP A;  1C0M A;  4M3Z A;  3NF8 A;  4DU4 A;  3DRP A;  3VN5 A;  4AH9 A;  3HJF A;  4ELV A;  1YT3 A;  3NGZ A;  2YNH A;  4FLX A;  4FZZ A;  1RBR A;  4LY7 A;  3AVF A;  4M3U A;  4DFJ A;  4NCA A;  1KFD A;  1VRT A;  3HK2 A;  4B3O A;  1L3V A;  1SUQ A;  1QSY A;  3ZSV A;  4HUG A;  4M3T A;  4FLZ A;  1JKH A;  3RRH A;  5J2N A;  4Z0U A;  3M8R A;  1W0H A;  4DQP A;  3OJU A;  3NDK A;  3IAY A;  4FZY A;  4ELT A;  2XHB A;  2G8V A;  3DLG A;  2D0C A;  3O4Q A;  3V6D A;  2P5O A;  3LAN A;  4WE1 A;  4CFD A;  3U3G A;  3AVC A;  4Y1C A;  1SKR A;  3RR7 A;  3QEP A;  1TV6 A;  3K57 A;  3TWH A;  3TAR A;  3QO9 A;  1D8Y A;  3KD1 E;  2LSN A;  3DRS A;  3DI6 A;  1UWB A;  4FLV A;  3AVJ A;  4CEB A;  3IS9 A;  4CER A;  1FKP A;  5J2P A;  1Q9Y A;  1RDA A;  1Z25 A;  3MXI A;  2Z1J A;  4M3W A;  4L8R B;  4DTP A;  2DFE A;  4RG8 A;  4W5R A;  3SYZ A;  3SQ1 A;  1EKE A;  3VQ5 A;  4CHQ A;  3L8B A;  4CJT A;  4E7L A;  5DMR A;  3TAB A;  2QKK A;  1X1P A;  2PZS A;  4JRP A;  3HP9 A;  3VA0 A;  3RMB A;  3V1Q A;  1Q8I A;  3QEI A;  4FJ7 A;  1VSI A;  4CED A;  4CJ5 A;  3KLH A;  3DLK A;  3O3F A;  2BE2 A;  4N47 A;  3S3N A;  3ZSR A;  4CEF A;  1QTM A;  2HW3 A;  2HVI A;  1HMV A;  4OPK A;  4ZTJ A;  5KGW A;  4B8C A;  3OYG A;  1J54 A;  4FJ5 A;  3AVN A;  3OYH A;  3SZ2 A;  1Q9X A;  5SWM A;  5J1E A;  2QXF A;  1BGX T;  3QER A;  2X6N A;  4G1Q A;  2XY7 A;  3E01 A;  4FM0 A;  1C0U A;  1WSG A;  3NH0 A;  4B9N A;  4CIE A;  1NJY A;  1YTU A;  3ZT1 A;  3KKR A;  3DLB A;  3AA4 A;  4CJL A;  3LAL A;  4KRF A;  2OPQ A;  5KGX A;  3QNO A;  4CK1 A;  4DQR A;  3PO4 A;  3SCX A;  4IFV A;  4CEE A;  4O44 A;  1EET A;  4CEO A;  1ZBU A;  3SNN A;  3KK3 A;  1QHT A;  4CK2 A;  2VWJ A;  5CZ2 A;  2A1R A;  4DSI A;  3SI6 A;  3DOK A;  4KV8 A;  3WNH A;  3HPO A;  1BCM A;  4IBN A;  2QKB A;  1TVR A;  4CJQ A;  3SUN A;  1RDD A;  1S9G A;  1UAX A;  2G8W A;  3V1R A;  4IKF A;  4CGJ A;  3C94 A;  3CM6 A;  2GV9 A;  3IG1 A;  4HCB A;  4BDZ A;  4FW2 A;  1SL2 A;  1B92 A;  2P5G A;  4KPY A;  1U48 A;  3QIP A;  1UA0 A;  4HUE A;  1NK6 A;  4DTS A;  3P83 D;  4R5P A;  4CHN A;  2WOM A;  1I39 A;  4DLG A;  2OYQ A;  3V9X A;  1S1V A;  1O1W A;  4DF4 A;  3ULD A;  3NH1 A;  3VQ8 A;  4ELU A;  3LWM A;  3OYE A;  1S1T A;  3MXJ A;  4W5Q A;  4I2P A;  1C0T A;  1J5O A;  3K5O A;  1S6Q A;  2Z1I A;  4J2A A;  2HHX A;  3OS1 A;  3VA3 A;  1WNS A;  4C8L A;  3DRR A;  2IGI A;  4QOZ B;  4Z4H A;  3RMA A;  1RTD A;  3KKS A;  2KQ2 A;  3L2Q A;  4AHR A;  4CEZ A;  1L3S A;  4J2B A;  2ZE2 A;  3TAE A;  2ZD1 A;  4AIL C;  3OJS A;  5KRS A;  1RT2 A;  1SL0 A;  3QEX A;  1KVA A;  1FK9 A;  3ZSX A;  4PA1 A;  1F21 A;  1WSF A;  3QNN A;  1JLE A;  4OKE A;  4C8N A;  4CGI A;  4OPJ A;  1KLM A;  1HYZ A;  1BIU A;  2HHW A;  2VG5 A;  3HXM A;  4FJN A;  3O4N A;  3KLF A;  3RRG A;  1GOB A;  4OKK A;  3CFP A;  2XY5 A;  1RT1 A;  2VG6 A;  3MEG A;  4XIU A;  4E7J A;  4DS4 A;  4CF2 A;  3L2V A;  3LPT A;  4AHC A;  2X74 A;  2XO7 A;  1SKW A;  3VQ9 A;  4JS4 A;  1QE1 A;  3BGR A;  4BDP A;  3EYZ A;  4J2E A;  2BAN A;  1S1X A;  2RPI A;  4FW1 A;  1WAJ A;  4KFB A;  1LW0 A;  1MU2 A;  3DOL A;  4GVM A;  4H4O A;  1I3A A;  3ZSW A;  5HRS A;  3AO2 A;  3MAQ A;  4DSJ A;  4FJH A;  3HVR A;  3TAG A;  4NCB A;  3QIO A;  4DTM A;  4ZHR A;  2ATQ A;  3JYT A;  4K8Z A;  4FXD A;  4QCL A;  4CGF A;  1HQU A;  2QK9 A;  3L2W A;  5I3U A;  1LWC A;  3VQ4 A;  3MEE A;  4N41 A;  3EY1 A;  3D45 A;  1VSJ A;  4B9M A;  1R0A A;  2G8U A;  4DLE A;  2WON A;  1S5J A;  4DS5 A;  4FM2 A;  3IRX A;  1JLF A;  2XRI A;  5K14 A;  4M3Y A;  1BL3 A;  1JLB A;  3VQC A;  2FC0 A;  1NJZ A;  5FRN A;  2B4J A;  4HHT A;  4KTQ A;  4EZ6 A;  3C6T A;  1VSK A;  4CF1 A;  3I8D A;  2HMI A;  3TAM A;  3CQ8 A;  4I9Q A;  1CZ9 A;  3SV3 A;  1B9D A;  4C8K A;  1XWL A;  4DTJ A;  3QET A;  3K5M A;  4HTU A;  2PY5 A;  1XC9 A;  3NBP A;  4CF8 A;  1S6P A;  1RT4 A;  4CJU A;  1RIL A;  3KLG A;  3K5N A;  4CK3 A;  3HM9 A;  3AA5 X;  4CCH A;  1TGO A;  1UA1 A;  1RTJ A;  3I0S A;  4ID5 A;  4AHU A;  4CJF A;  1NOY A;  3TAF A;  4CE9 A;  1ASW A;  2HND A;  4N56 A;  4DQI A;  1EP4 A;  4Y1D A;  4GW6 A;  1RTH A;  1WSJ A;  4DMN A;  1WAF A;  2F96 A;  3DLR A;  1T05 A;  1L3U A;  4KHW A;  3OYF A;  1C1A A;  1C1B A;  1L5U A;  4DSF A;  4KHN A;  1JXB A;  3ASM A;  4KB0 A;  5FDL A;  4FJM A;  3AVM A;  3G0Z A;  1B9F A;  3FFI A;  4EZ9 A;  4OLB A;  1Z26 A;  1NK9 A;  2YKN A;  2OZS A;  4OLA A;  5KTQ A;  3WNE A;  4FJG A;  2PYL A;  1NK8 A;  2XY6 A;  1RT6 A;  1RBT A;  1HQE A;  4DSL A;  3P5J A;  3QES A;  1K6Y A;  2VWK A;  4CJW A;  1KTQ A;  1VSH A;  4IG0 A;  3AVG A;  2OPR A;  1TKT A;  3LPU A;  4OJR A;  1JLG A;  4CEQ A;  2XY8 A;  5HRR A;  4FLW A;  4E7K A;  4E3S A;  4E0D A;  5HP1 A;  4CFA A;  3UIQ A;  4CJE A;  2PYJ A;  2KFZ A;  4KHS A;  1QS4 A;  3LZI A;  3V9Z A;  1IG9 A;  5D3G A;  3PUF A;  1VSL A;  4H4M A;  4DFP A;  3S3O A;  3SPZ A;  4B9T A;  1T7P A;  1LW2 A;  1BIZ A;  3MED A;  3RR8 A;  4LH4 A;  1NK4 A;  5KI6 A;  2ITG A;  3QLH A;  2G8F A;  2GUI A;  1KVB A;  4MQ3 A;  4FLY A;  2BGG A;  2E4L A;  2VG7 A;  3HPH A;  3L2U A;  4KHU A;  2HHS A;  1ZBF A;  1WSH A;  3DLE A;  3OYN A;  4FJJ A;  1BCO A;  1VSF A;  3HL8 A;  3PO5 A;  4RW7 A;  1NJX A;  4LD0 A;  4M42 A;  2E6L A;  4RW6 A;  4DSK A;  4KHQ A;  1KSP A;  5CZ1 A;  1KLN A;  4KHY A;  2Y1J A;  4O4G A;  4DF8 A;  4F3O A;  1JL1 A;  4IDK A;  2KZM A;  4IFY A;  1C6V A;  2FBT A;  1N5Y A;  4DTN A;  3KTQ A;  3OY9 A;  1KFS A;  3M8S A;  3LWL A;  1TL3 A;  3ITH A;  3ZSZ A;  4ID1 A;  4HVJ A;  4B9S A;  4B9U A;  5J2Q A;  2YHA A;  3KK2 A;  4CGG A;  3OYD A;  4PY5 A;  1CLQ A;  4FVM A;  3V9W A;  2HNZ A;  2HHV A;  1LAW A;  1WSE A;  2Z1H A;  4CHY A;  4C8M A;  3L3U A;  2O4G A;  1ASU A;  3CFR A;  4KRE A;  1LAV A;  4NCG A;  1HJR A;  1RCH A;  3AO3 A;  4I7F A;  1JLA A;  3TR8 A;  5HRP A;  4DSE A;  5J2M A;  1KRP A;  2B5J A;  1KVC A;  1TK8 A;  3B6P A;  4DU1 A;  1S9E A;  3LP0 A;  2KTQ A;  4CGH A;  1KCF A;  3T3F A;  5KRT A;  3SQ0 A;  4HUF A;  1BI4 B;  1U49 A;  3PX0 A;  2Z1G A;  2RKI A;  1NKE A;  4O0J A;  1BIS A;  3CFO A;  1HNI A;  4E19 A;  4FLT A;  3ZCM A;  4OVL A;  1UOC A;  5CYM A;  4CEC A;  4FK0 A;  4YNQ A;  1G15 A;  1ZYQ A;  3K59 A;  4AHS A;  3V9S A;  1NK7 A;  1DTQ A;  3BDP A;  1LWF A;  3EZ5 A;  4F3T A;  4W5N A;  4W5O A;  3NF6 A;  4OGC A;  4B9V A;  1BQM A;  5JS2 A;  3ZSY A;  2YNG A;  4CIF A;  3KJV A;  2OA8 A;  4N5S A;  3AVK A;  3S9H A;  2G8K A;  3K58 A;  2KW4 A;  3LP3 A;  3RMC A;  1TAU A;  1S1W A;  1N6Q A;  4DTO A;  5C24 A;  2YKM A;  2HVH A;  1TL1 A;  3DYA A;  1CXU A;  4LH5 A;  4F4K A;  3TAP A;  2AJQ A;  2D0B A;  4EP5 A;  4E1M A;  2Q3S A;  4J2D A;  4NYN A;  4B08 A;  3LP1 A;  1TK0 A;  1X9W A;  4FJ8 A;  3TAN A;  2IS3 A;  4O5B A;  2OPP A;  1NK0 A;  3AVI A;  4DU3 A;  3LZJ A;  2BDP A;  2FBY A;  1VK0 A;  4DG1 A;  4O55 A;  4JS5 A;  3ZSO A;  5HBM A;  5CYQ A;  1JXE A;  4F2R A;  4CFB A;  4FJK A;  1JL2 A;  3VQ6 A;  3LAM A;  2IDO A;  3OYJ A;  4E7H A;  3T19 A;  4RW9 A;  3HP6 A;  3F9K A;  5FRO A;  1C1C A;  4FJI A;  4Z4F A;  4CJV A;  1J53 A;  3KIO A;  4DTX A;  3QEV A;  3G10 A;  2HNY A;  4DTR A;  1L3T A;  2DFH A;  4Q0B A;  1VRU A;  4DQS A;  1QSS A;  1NKB A;  2KFN A;  4JLH A;  2P51 A;  4KB1 A;  2FBX A;  4RW8 A;  2X78 A;  5C42 A;  1RNH A;  1RT3 A;  5SZT A;  5C25 A;  3NHG A;  5HLF A;  2O4I A;  1TAQ A;  3AV9 A;  1A5W A;  1ZBL A;  2DFF A;  4TSX A;  1RTI A;  1SKS A;  1RT5 A;  5DK5 A;  4BDY A;  4C8O A;  1DTT A;  4CIG A;  2HB5 A;  4Q5V A;  1D5A A;  3RTV A;  3AO5 A;  5T7B A;  4CJP A;  2B6A A;  2D5R A;  3AVH A;  4CFC A;  3PV8 A;  2W42 A;  3RWU A;  4N76 A;  3ALY A;  4AHV A;  4OKJ A;  2YNI A;  4FLU A;  4DQQ A;  3AVB A;  3SUO A;  4KKO A;  3HO1 A;  4CJR A;  4Z4E A;  3AVA A;  1RT7 A;  1U47 A;  1T8E A;  1JLC A;  1TKX A;  1GOC A;  1IO2 A;  3SV4 A;  3V81 A;  3OYA A;  2OPS A;  3OYC A;  4DTU A;  5HRN A;  1NJW A;  1RDC A;  3TAQ A;  4BWJ A;  3THV A;  5HRO A;  3QEW A;  2YNF A;  1IH7 A;  1U4B A;  2HHQ A;  3LP2 A;  3VQ7 A;  1D9F A;  4YFU A;  3PY8 A;  1HYS A;  3VQQ A;  1VSM A;  4I2Q A;  3L2R A;  1TKD A;  5I42 A;  4LSL A;  3VQE A;  1A5X A;  2JGU A;  4Z4C A;  3V4I A;  3VQA A;  3C95 A;  2RN2 A;  4B8A B;  1WSI A;  3U3Y A;  3OYM A;  4ZTF A;  3ZT0 A;  2RF2 A;  4GMJ B;  1IKY A;  4NYF A;  4CJS A;  4O0I A;  3V9U A;  3SUQ A;  1HRH A;  3HYF A;  3OYL A;  3K2P A;  3O3G A;  4FK4 A;  3T1A A;  3ZT3 A;  3CM5 A;  4FCY A;  3MEC A;  1HNV A;  1RBS A;  4BE0 A;  2ZQB A;  4CJ3 A;  2R7Y A;  2F8T A;  4QAG A;  3OYB A;  3DM2 A;  1ZBI A;  3F73 A;  1RBV A;  3V1O A;  3SJJ A;  4FZX C;  3OYK A;  3I0R A;  4CES A;  1SL1 A;  1X9M A;  4FYD A;  4W5T A;  2D0A A;  3ISN C;  1TK5 A;  1BI4 A;  4E7I A;  1RDB A;  1X9S A;  3B6O A;  3NFA A;  3MXM A;  1Y97 A;  2EHG A;  1WLJ A;  3DLH A;  4H8K A;  3L3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...