4GMJB

Structure of human not1 mif4g domain co-crystallized with caf1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
271
structure length
264
Chain Sequence
QRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSGNAYEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCR4-NOT transcription complex subunit 1
publication title The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 83
structure length 264
sequence length 271
chains with identical sequence D, F
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gmjB00
1O1WA 2E4LA 4PWDA 1ZBIA 3TABA 2VG6A 4ELUA 3AVLA 1C6VA 3OYJA 5HP1A 4J2AA 2HHSA 1JXBA 3AVFA 4OKJA 1EP4A 3NBPA 4Y1CA 3OYCA 1C0TA 2FC0A 3D45A 3AVNA 2KFZA 2YHBA 4IG3A 1X9WA 3OYHA 5J2MA 4QOZB 3LZIA 4BE0A 4E0DA 1VSEA 1HPZA 1TKZA 3M8PA 3NF7A 1TL1A 3ZT4A 3AA5X 4NYNA 4CJKA 3OS2A 3SQ2A 3NGZA 3TAQA 3HO1A 4M42A 3K57A 1RT7A 3ZT2A 1NOYA 3RR8A 3OYDA 4DLEA 1SKWA 1K6YA 4FJ8A 5T7BA 4C8OA 5CY4A 3L2RA 4CHYA 2Z1IA 1NK5A 4DTMA 1J54A 2D5RA 2IGIA 2LSNA 3C6UA 2HMIA 4B9TA 4I9QA 4DLGA 1YT3A 4IBNA 4B9SA 3HL8A 2RPIA 4CK1A 5EU7A 1EX4A 1RCHA 3WNFA 2P5GA 3VQBA 4EP5A 2HHWA 1WSJA 1KVCA 3NGIA 5KI6A 3DLBA 3KD5E 4KREA 1SV5A 3DM2A 4H4OA 2QKBA 1WAFA 2XY6A 4CFBA 3SJJA 4CJSA 4DSJA 1C1AA 4CEOA 1RTHA 4LY7A 4CHOA 2FBYA 1HNVA 3HVRA 3AA4A 3V81A 3CFOA 2QXFA 3V6DA 3IRXA 3QEVA 1J9AA 4FM2A 3SUOA 2FBVA 4FLWA 4KB1A 1VSLA 2YNHA 4CEBA 4BDZA 5DK5A 2WOMA 3VQQA 1U48A 4EZ6A 4CJ5A 1Z26A 3AV9A 3D0PA 4AHRA 1IKYA 2D0CA 3MEGA 3OJUA 4HUFA 4I2QA 1ASVA 4HTUA 4CEDA 1RTDA 3ZT1A 2KQ2A 3OYMA 3K5NA 4DU3A 1WLJA 4FJMA 1JLBA 2G8FA 4FJ7A 5FRNA 4DQPA 3AO2A 3MECA 5C25A 1CZBA 1L3SA 2B6AA 1TK8A 4TSXA 1KSPA 4CF2A 2Q3SA 3ZT0A 4HHTA 1VSDA 4CIGA 4HVJA 4KO0A 2DFHA 4E1MA 5SWMA 3AVKA 3OYFA 2PYLA 3KIOA 3WNGA 5KGWA 1XWLA 4FCYA 1D9DA 4KI6A 3HT3A 3VA0A 3RRHA 3S3OA 1TVRA 2D0AA 3DLKA 3HPOA 1ASWA 3S3NA 1BIUA 3NAEA 3ISNC 3LZJA 3LAKA 2BDPA 4B9VA 3ZCMA 2PZSA 4N47A 1JLQA 1W0HA 5SZTA 1HYVA 1EKEA 3IG1A 3UIQA 4DU1A 4I2PA 3OY9A 1KVAA 5J1EA 5KTQA 1L5UA 4PQUA 4QCLA 4BE2A 1S5JA 4DFKA 4AH9A 1ASUA 3AA3A 4WE1A 4CGDA 4CJEA 4AILC 1W9HA 4DF4A 4B9MA 4FM1A 1YTUA 2QK9A 3C95A 2G8HA 4K8XA 3RR7A 4DTXA 4Z4GA 4CJPA 1N5YA 3L2UA 1T7PA 1BISA 1WSHA 1KVBA 3K5MA 5FROA 3VQAA 3TAGA 4W5OA 4AHSA 3VQ9A 5J2PA 1NK4A 3ZSWA 3QEXA 2OYQA 1UOCA 4LD0A 1HRHA 1QE1A 1LWFA 3T3FA 4BWJA 1TK0A 1JLAA 3AVMA 4UQGA 4FYDA 1RDDA 1S6PA 3ITHA 4JLHA 1HYZA 1IH7A 4DF8A 3MXMA 2KFNA 3LWMA 2O4GA 2E6LA 1EXQA 3LDSA 3SUNA 4CJWA 2HB5A 1B92A 1JKHA 4B08A 1XHZA 1IKVA 3P5JA 1Q8IA 4HUEA 1WN7A 4CGJA 3VQ6A 5C42A 1IKXA 3OYKA 2IOCA 4FK4A 4LSLA 3OJSA 4E7JA 4DTJA 3DMJA 1WSFA 3U3YA 2G8WA 4BDYA 2G8KA 4DWIA 4M3UA 1NK8A 1VRUA 4QAGA 3SNNA 1S6QA 2E6MA 3DRRA 4CEFA 2Y1JA 4C8LA 1JLEA 1VSMA 1MU2A 1GOCA 1TKDA 4OKEA 5CYMA 1SL2A 1X1PA 4DFMA 4BDPA 3CQ8A 1JLGA 1RBRA 3ZSYA 1X9MA 3LAMA 1Q9YA 2RF2A 1RBVA 2Z1JA 4PA1A 3RMCA 3HK2A 1REVA 5J2NA 2XY7A 4KI4A 1BIZA 3C94A 1U47A 1HYSA 4MFBA 1JLCA 1S1TA 4LH4A 2KTQA 4OVLA 1BI4A 1NOZA 4BWMA 4KHYA 1C0UA 4CHPA 1TAUA 3V9WA 3RTVA 1WSEA 2X78A 3BGRA 3DLRA 5HRPA 1X9SA 1A5VA 4DTUA 1SL0A 3QO9A 4HUGA 3EY1A 4M41A 2BGGA 1XHXA 2XY8A 3I0SA 2FBXA 1QSLA 1VRTA 4O44A 4JRQA 1IO2A 4Z4CA 3M8QA 3QETA 3SPZA 4RW7A 5E41A 3KLIA 4O0IA 4CJRA 3ZT3A 3KLFA 4KHQA 3U3GA 3TAPA 1U4BA 1NK9A 4W5QA 3LP0A 4FM0A 3PO5A 1NK7A 1S1XA 3PUFA 3B6PA 4ID5A 1HNIA 2YNFA 1JXEA 5JS2A 4M45A 4E1NA 3CFRA 3DI6A 4CGGA 4ZTJA 4DQIA 4KB0A 1N6QA 4Z0UA 2AJQA 4F4KA 2B4JA 1S9GA 4FLXA 3JYTA 2O4IA 1C1CA 3ZSVA 1BI4B 4FJIA 3ZSXA 1KFDA 1QHTA 5FRMA 1JLFA 4R5PA 4E19A 2G8IA 2YNGA 2YKNA 2Z1HA 4ZHRA 4CEQA 3EYZA 1I3AA 3KLHA 3VA3A 5JS1A 1NJXA 3VQEA 3V1OA 3QESA 4CK3A 3V9ZA 1VSHA 3SQ1A 1BCMA 3HPHA 5CZ2A 3V1RA 3QNNA 4FZZA 2OPPA 3HP6A 3K5OA 1HMVA 1VSFA 3JSMA 3K5LA 4BACA 4CIEA 4DTNA 3NF8A 1VSKA 3VN5A 2DY4A 1F21A 3OYIA 3ALYA 3VQ4A 5HROA 1HQEA 2IAJA 1B9FA 1TKTA 3HSTB 1CXUA 1NJYA 4FZYA 3KK3A 2JLEA 2X74A 2ZQBA 1S9EA 2IS3A 1KLMA 4DU4A 5KRTA 3L2VA 3CYMA 1LWEA 3PX6A 4FW2A 3G0ZA 4CECA 4CFCA 3SI6A 3PO4A 3NDKA 4CJ3A 4FK2A 4CERA 4DQQA 3LPUA 2P1JA 3QERA 1RDAA 2RKIA 4FJ9A 4ELTA 4PY5A 3QINA 5KGXA 3OYEA 3DRSA 4RW9A 1LWCA 1A5WA 1VK0A 3EZ5A 3NCIA 3RMBA 4N76A 1VSJA 4N56A 1LW2A 3NF9A 3OYBA 3VQ8A 4CFAA 1WSGA 4ZTFA 2KZMA 3QEWA 4FK0A 4F3TA 3LWLA 4KTWA 4M3TA 1CLQA 4HCBA 4BE1A 4AHUA 4W5TA 3RMDA 3SQ0A 3M8RA 5HRSA 3AA2A 4RW8A 4FLYA 3V1QA 3TANA 4DSFA 1L3UA 1S1UA 3MXIA 1KFSA 4FJNA 1NJZA 1ZBHA 2VWJA 3NF6A 2HW3A 3K58A 1RT3A 4DTRA 4CJQA 1CXQA 5K14A 3KLEA 1LAWA 4CJ4A 1NK6A 1SKRA 4L8RB 4OLBA 2ATQA 4B8CA 1U04A 3OS1A 3NE6A 4JS5A 4E7LA 1LV5A 1DTTA 1G15A 1RT2A 3AVHA 4C8NA 1FK9A 4AHCA 1TKXA 4CHNA 4E3SA 3SCXA 3LPTA 2HHUA 4LSNA 3ZSRA 3TAMA 1WSIA 4KPYA 1HQUA 1T05A 1DLOA 1WAJA 1BL3A 1JL2A 3KKSA 2PY5A 2OPRA 2XRIA 3PV8A 2F8SA 1QSSA 1BQMA 2P5OA 4DMNA 4CJUA 1U45A 4C8KA 3RWUA 3LP2A 3O4NA 4OPKA 3HM9A 3QEIA 3SZ2A 3DLEA 3CM5A 4KTZA 3OS0A 3OYLA 3MEEA 3T19A 2OZSA 1B9DA 2BANA 3V9UA 2JGUA 3K59A 1SKSA 3LP1A 3F9KA 1SUQA 4AHVA 3A2FA 4OKKA 4RW6A 1Q9XA 4CGIA 3TWHA 3I8DA 4OLAA 1Z25A 4CEZA 4EZ9A 5HRRA 1RT5A 3MXJA 3DYAA 1NK0A 4CESA 3HJFA 2HVIA 4M3RA 3ZSZA 2F96A 1C1BA 4CGHA 1RT4A 3ZSQA 3PY8A 3TAFA 4M3XA 3HP9A 3F73A 2BE2A 2W42A 1ZBUA 4NYFA 5HRNA 3WNHA 4CK2A 1BQNA 2HNYA 4O55A 4FJLA 3SV3A 1UWBA 4DFJA 1QS4A 1RBUA 3QEPA 3RRGA 2YKMA 2I5JA 3TAEA 1D8YA 4F2SA 3VQ7A 3TR8A 1L3TA 3L2QA 4FJXA 2EX3A 2X6NA 3O3GA 4FJHA 4FXDA 3NH2A 2HVHA 2WONA 3OVNA 1XC9A 1I39A 3AVCA 4CHQA 1KCFA 2R7YA 1TAQA 3G10A 2QKKA 4F3OA 1YVUA 4Q0BA 1QTMA 4FJ5A 3VQPA 2A1SA 2OZMA 2IDOA 4O5BA 1JL1A 3IAYA 2HHQA 1ITGA 3SUPA 4G1QA 2B5JA 3O3FA 3LP3A 4DFPA 4DSLA 2OPQA 4JRPA 2HNDA 3HYFA 3V9SA 1LW0A 2GV9A 2KW4A 4FW1A 4DQRA 4B9NA 1RDBA 2XY5A 4FVMA 3OYNA 1UA0A 1L3VA 1IKWA 4CF8A 1GOAA 4XIUA 4OPJA 4E7HA 4YNQA 3KJVA 4AHTA 2VWKA 4NCGA 4KV8A 4FLUA 4O0JA 1FXXA 3RMAA 4HCCA 3L2WA 4J2BA 1QSYA 3ASMA 3NFAA 3O4QA 4RW4A 1TK5A 3LANA 3L3UA 3BDPA 2VG7A 3KD1E 4CF1A 3AO3A 4B3OA 4DTOA 3L3VA 3KKRA 2HHTA 3KTQA 4IFVA 5J2QA 1T03A 2FBTA 4IG0A 4GVMA 1BHLA 4RG8A 4I9LA 2G8VA 3NH0A 4Q5VA 2OA8A 4PUOA 2GUIA 3SPYA 1YTAA 3H08A 4K8ZA 5CYQA 4ID1A 4DS4A 1ZBLA 5I3UA 1J5OA 4B9LA 2G8UA 1HJRA 3HPGA 4ELVA 1Y97A 1U49A 2XHBA 4E89A 3ZSOA 1KRPA 2YV0X 4LH5A 4B9UA 5D3GA 3CFPA 4Z4EA 4CHZA 2D0BA 4B8AB 3S3MA 1UA1A 4CCHA 4CF9A 3CG7A 1NKEA 4IFYA 3DLGA 1RBTA 4FLTA 2Z1GA 3NH1A 4JS4A 3WNEA 2A1RA 4O4GA 4IKFA 1D5AA 3PX4A 3SV4A 3AVAA 4Y1DA 3KK2A 5HLFA 4FJJA 4DTSA 1S1VA 3B6OA 4KRFA 3P83D 1D9FA 4F8RA 2XO7A 1KTQA 4IDKA 4CFDA 4N5SA 3U6FA 1NKBA 3K2PA 1RT1A 3P1GA 3QIPA 4DS5A 2X6SA 5FDLA 1RT6A 3VQDA 4W5RA 5C24A 3DRPA 3V9XA 2Y1IA 4J2DA 2KZZA 3M8SA 1CZ9A 3TI0A 4F2RA 2YNIA 4CEAA 3HXMA 3FFIA 4CEEA 4NCBA 3AVJA 3I0RA 3O3HA 1RDCA 4NCAA 5DMRA 2ITGA 4CJTA 3KLGA 4FLZA 3S9HA 4KHSA 1TL3A 3E01A 4H4MA 1J53A 4DSEA 2RN2A 2PYJA 4KTQA 4KFBA 3CM6A 4FJKA 4OGCA 4KHWA 1T8EA 2OPSA 4KHUA 4W5NA 4CIFA 1ZBFA 4MQ3A 4ICLA 4YFUA 3DLHA 2ZE2A 3AVBA 1RTJA 5KRSA 3OYGA 4M3YA 3HVTA 3V4IA 1RNHA 4E7KA 3MEDA 1RILA 5CZ1A 4CJLA 4EP4A 2HHXA 4KKOA 3C6TA 3L8BA 1A5XA 1DTQA 3TARA 2YHAA 3VQ5A 3DOKA 4OGEA 2DTUA 4H8KA 5I42A 4KAZA 4DTPA 4DSIA 4DG1A 2NUBA 2VG5A 1LAVA 4FJGA 3AO4A 2P51A 4FZXC 4CF0A 3SQ4A 1TGOA 4Z4IA 3AVIA 4E7IA 1XI1A 4J2EA 1TV6A 2DFFA 3AO5A 4OJRA 3SUQA 1UAXA 2HHVA 3NHGA 4KHNA 2EHGA 2ETJA 1NJWA 1RTIA 3NGYA 1GOBA 4DSKA 1EETA 1RBSA 1S1WA 4CGFA 4Z4HA 2F8TA 1QQCA 1R0AA 4GW6A 1FKPA 3IS9A 4Z4FA 1C0MA 4GMJB 2DFEA 3OYAA 1WNSA 3DOLA 3T1AA 3VQCA 3QIOA 3ULDA 1IG9A 4M3ZA 3QLHA 4CJVA 2GBZA 3AO1A 1FKOA 1BCOA 2HNZA 3SYZA 1VSIA 3PX0A 5HBMA 3THVA 1KLNA 4CE9A 3QNOA 1NKCA 4I7FA 3AVGA 3MAQA 3KK1A 4DQSA 1ZYQA 2IC3A 4CJFA 3LALA 4C8MA 4FLVA 4N41A 2ZD1A 4M3WA 1SL1A 1BGXT
chains in the Genus database with same CATH superfamily
3UE5A 2WC9A 4BRGA 4EHTA 2A5XA 3AVLA 2UXBK 3OYJA 5HP1A 3C6HA 4OKJA 1EP4A 4C1NK 4Y1CA 3KVGA 3OYCA 3VEWA 4ISEA 2YHBA 3OYHA 3GOIA 4E0DA 4CJKA 3EO3A 3NF7A 3OS2A 4KH4A 3SQ2A 3AA5X 3HO1A 3VEYA 4DLEA 4C8OA 1J6ZA 1J54A 3ENBA 1NGAA 2IGIA 3C6UA 4M7XA 1NMDA 4DLGA 3LDOA 5EU7A 2P9UA 1EX4A 2P5GA 3NGIA 3KD5E 4K25A 2XY6A 3CI5A 2YX6A 2FBYA 1HNVA 2Q1NA 3CFOA 4JAXA 1Q81O 3P38A 4IXCA 4FLWA 5FPMA 4BDZA 5GAEP 4EZ6A 1Z26A 3AV9A 3D0PA 4JKGB 4WQ4A 1S22A 1YF5L 2D0CA 3OJUA 3FZHA 2NRXA 3ZT1A 1XMOK 2G8FA 5FRNA 4DQPA 1L3SA 2B6AA 1IV0A 4CIGA 5SWMA 3AVKA 5KGWA 1XWLA 4FCYA 3MCAB 3ULEA 3S3NA 4JI3K 4YDUC 3THXB 3ZCMA 5FPNA 4BGAA 1JLQA 1HYVA 3IG1A 3UIQA 3U9ZA 5GADP 3OY9A 1KVAA 1T44A 5KTQA 3THYA 1S5JA 5AQGA 4DFKA 1ASUA 2QK9A 4B9MA 4FM1A 1IBKK 3O5BA 2A3ZA 4K8XA 5IT9O 3RR7A 4CZHA 4DV0K 1GLLO 4PHTX 5FROA 3TAGA 4W5OA 4AHSA 3RVCA 3ZSWA 1KQSM 2WFBA 1HRHA 1QE1A 3T3FA 1KAZA 4FWPA 1KD1O 5JLFA 1VQ6N 4IOXA 2Q0UA 1IH7A 1BO5O 3SUNA 1JKHA 3P5JA 1Q8IA 4HUEA 3SBTA 4JKHA 4JHDB 4K43A 4FK4A 4E7JA 2G8KA 1Y64A 3DRRA 2D1KA 1Q82O 3CC2N 4OKEA 3N4QA 1Q9YA 3WQUA 1GLCG 3HK2A 2O8EA 1BIZA 3LDNA 4FWQA 4DHYA 1NOZA 4BWMA 1C0UA 1HKCA 3BF1A 3V9WA 1P8ZA 3QDKA 5AQSA 4DTUA 1SL0A 3AGKA 3EY1A 4M41A 1OVYA 2P9NB 3I0SA 4BR9A 2ZGYA 4BR2A 2IVOA 4FWKA 2VGMA 4Z4CA 3ZT3A 3U3GA 3TAPA 4DV6K 3O4WA 4W5QA 3I33A 4FM0A 1S1XA 2UXDK 4Z94A 1JXEA 4IEEA 3GG4A 3DI6A 4CJ7A 4ZTJA 1N6QA 3NVMA 4O8KA 1S9GA 4WYBA 1ATNA 3A8YA 3ZSVA 1D4XA 4FJIA 3ZSXA 1QHTA 5FRMA 4CEQA 3KLHA 5ADXA 2P9PA 4CK3A 1VSHA 1BCMA 3HPHA 5CZ2A 2NRTA 2OCEA 4XH5A 3JSMA 4BRQA 2WTUA 3D6RA 3NF8A 1VSKA 5AFUA 2F9WA 4FZYA 3E66A 3KK3A 3A5LC 2X74A 1S9EA 3I55N 3UKRB 3L2VA 3H1VX 3CYMA 3WQTA 4CFCA 3SI6A 3VEXA 4IDHA 4PY5A 5AQFA 3DRSA 1MWMA 1LWCA 4G9ZA 1VK0A 2V7YA 4IOCL 1KXPA 1VSJA 3NF9A 4ZTFA 4KH5A 1DGKN 3QEWA 5HOOA 4RWTA 1YJNN 1CLQA 3SQ0A 4W5TA 3RMDA 3LDPA 4NLCA 4CW7B 3TANA 1S1UA 1KFSA 1NJZA 1ZBHA 3NF6A 2HW3A 4DTRA 3CCQN 4CJQA 5K14A 4IWVA 3KLEA 2RHKA 3SAGA 2ATQA 1JCFA 3NE6A 3OS1A 4JS5A 4R79A 1FK9A 3H6EA 4MDAA 3TAMA 1HQUA 5BRFA 3PIOL 1DLOA 3OHRA 2PY5A 3MDQA 4DMNA 3LP2A 5AZIB 4OPKA 1X9JA 3DLEA 3CM5A 3OS0A 1VQ7N 2BANA 2A41A 5EX5A 4CGIA 4BRKA 3DWLA 3TWHA 1O13A 2E1YA 3MXJA 2F96A 3TAFA 3HP9A 4JI5K 2BE2A 3KWGA 4CK2A 2P9LB 4YOUA 4H5TA 2QM1A 4F2SA 1NBWA 3VQ7A 3TR8A 3L2QA 3BZCA 3O3GA 2HVHA 2R7YA 2QKKA 3CPWM 4BRHA 1YVUA 1QTMA 4FJ5A 2A1SA 4JKCA 1QHAA 2IDOA 3WXJA 4H0XB 4WFBL 1ITGA 3SUPA 4G1QA 5F2RA 4MLEA 1NGEA 5AQLA 3HYFA 5EOYA 4QS8A 1LW0A 4FWRA 4CZEA 2XY5A 1L3VA 4FSVA 1IKWA 3H3NO 4XIUA 4E7HA 4NCGA 4O0JA 4DQ8A 4RW4A 4A2BA 4DTOA 4DB3A 1ESVA 3KTQA 2HHTA 1NGIA 4RG8A 3NH0A 4BQLA 2GUIA 3SPYA 1XC3A 4DS4A 5I3UA 4B9LA 4LF8K 3ZETB 4EFHA 1U49A 3RSEA 1KRPA 3BF3A 3CFPA 1XNQK 3VEOA 3L4IA 4Z4EA 3VETA 3J80O 2YI1A 4K42A 3HRGA 4O4GA 3CCLN 1D5AA 3Q7CA 3SV4A 3AVAA 4DTSA 3B6OA 3E1YA 4JI4K 1KTQA 2XO7A 1W2BM 1YJWN 3U6FA 1W7AA 3G4SN 2W40A 4B3RK 2BH1A 1RT6A 2Y1IA 4GVEA 3Q7BA 2YNIA 3AVJA 3I0RA 3O3HA 4PKIA 3ZX3A 3S9HA 3E01A 4OGCA 4MQ3A 3CCJN 2P9KA 4PKHA 1VQKN 3CMEN 4BRAA 5KRSA 1WBBA 4YDUA 2KKZA 2WUSA 4DKWA 4BRDA 3QMLA 3D2EB 4I6MA 4KKOA 3C6TA 3TARA 4OGEA 2ZWHA 4U67L 3CCRN 5E26A 2P51A 5AQNA 1MA9B 1TGOA 3AVIA 4E7IA 1UAXA 4KHNA 2J4RA 2ETJA 1NJWA 3HSCA 1GOBA 4BG8A 3M1FA 4K41A 3CPEA 2W41A 3O80A 4BR5A 3QIOA 1IG9A 4V19S 5AQTA 3PX0A 1T6DA 3QNOA 4DQSA 3H3OB 4FLVA 2ZD1A 1BGXT 1VQON 4PWDA 1ZBIA 3TABA 2VG6A 4ELUA 5KPZA 3GDQA 2FC0A 4OPAA 3AVNA 2KFZA 1X9WA 4JK8A 4GY2B 3ZEUA 1VSEA 2QWQA 4DR3K 2YJFA 4LF7K 3KHYA 4M42A 1RT7A 3ZT2A 3OYDA 1K6YA 5EXWA 2YHWA 2LSNA 2HMIA 4MLHA 4H5VA 3I56N 4B9SA 3HL8A 2RPIA 4CK1A 5F0XA 3WNFA 3VQBA 4WF9L 3DLBA 1S72N 4CBWA 3AGRA 4CFBA 3SJJA 4DSJA 5TKWA 4CEOA 1RTHA 4DV3K 3AA4A 2UUAK 2NLXA 1J9AA 3SUOA 1MDUB 5KQDA 2YCHA 4B9QA 3KK7A 4CEBA 1M90O 5LMUK 1OH5A 4DUYK 2BUPA 1RTDA 4HUFA 1ASVA 4CEDA 1BDGA 1U2VB 3MECA 1N34K 1S3XA 2P9SA 4TSXA 1KSPA 4CF2A 5KQ8A 3OYFA 3KIOA 1G99A 2Q36A 3S3OA 1ASWA 3KZBA 4Y0WA 3LZJA 3LAKA 5M1NA 4B9VA 4C1NI 2CGLA 2AP1A 3F2KA 5BRDA 1FJGK 1W0HA 1EKEA 1N32K 4PQUA 4QCLA 4BE2A 4AH9A 3AA3A 4CJEA 4AILC 1YTUA 4BRPA 1OH8A 2YJEA 3C95A 2ZF5O 4DTXA 3FZMA 3MK6A 1T7PA 1BISA 1NK4A 3HI0A 1NGCA 3VQAA 3K5MA 5J2PA 3CCEN 3WXKA 3QEXA 4JI0K 4LD0A 1LWFA 1TK0A 3AVMA 1NLVA 3BP8A 1RDDA 3L6QA 1WB9A 4KH6A 1C0GA 3DXMB 3MXMA 2V52B 1HKGA 3LWMA 1EXQA 4B08A 2CH5A 1WN7A 1IKXA 3OYKA 2IOCA 1NG9A 3U3YA 3DMJA 4M3UA 3SNNA 1S6QA 3CQYA 3CD6N 1JLEA 1MU2A 3J7YP 1IBMK 5CYMA 4BDPA 1JLGA 1RBRA 3EKSA 2FSKA 2RF2A 5AZJB 1N8RO 1RBVA 4PA1A 3RMCA 5J2NA 3C94A 3HZ6A 4MFBA 4LH4A 4JD2A 1BI4A 3IMXA 1ZBSA 1T3VA 1YJ9N 3PLAA 4CHPA 2CH6A 1WSEA 1Z05A 3BGRA 1X9SA 3IDHA 5BPMA 2PAVA 3DJCA 3E9PA 4BC4A 2FBXA 3BZKA 4O44A 4JRQA 1OVQA 3M8QA 3QETA 3KLIA 4O0IA 3KLFA 1HR0K 2O8BA 4BRIA 4B1UB 1NK9A 3VGMA 3LP0A 4IEIA 3B6PA 4ID5A 4OPHA 4M45A 4E1NA 2JWKA 2W6LA 1TYQA 4CGGA 4DQIA 4Z0UA 2AJQA 5AR0A 5GAGP 4YOYA 2O8CB 4DR4K 3FFKB 4R5PA 3DXKB 4E19A 2YKNA 2H3GX 4QS9A 3VQEA 3V1OA 4JI6K 3V9ZA 2QI2A 4FL9A 3SQ1A 3V1RA 4BRNA 4FZZA 3HP6A 4IJAA 3K5LA 3O9UA 4DTNA 4K0KK 4FOIA 2DY4A 4EAHD 5HROA 2P9IA 2IAJA 1TKTA 2HF4A 4BR7A 2JLEA 2RE2A 2IS3A 5KRTA 1XMQK 5FPEA 5AQHA 3O08A 2HOEA 4BC5A 4FW2A 2OTJN 4CJ3A 2P1JA 3HOTA 3P4IA 2RKIA 4ELTA 4BGBA 5KGXA 1OKJA 3EZ5A 3G6EN 3NCIA 3OYBA 3O8MA 3CJCA 1NGDA 4H5RA 3LM2A 4AQYK 4YOVA 4XH4A 1GLBG 3LWLA 2F7TA 4KTWA 2F4VK 3VTIA 2EWSA 4FLYA 5JVGL 2VWJA 3JAMO 1RT3A 1CXQA 3C7NA 4PL7A 1LAWA 4L8RB 1YAGA 1SKRA 4B8CA 4B3MK 1DEJA 1RT2A 3GE1A 4C8NA 3SCXA 1TKXA 4E3SA 3D2FB 4KPYA 3CCMN 4BY9C 2I7PA 1BL3A 3KKSA 2F8SA 2OPRA 4KHPK 1QZ6A 3HM9A 1HX1A 4KTZA 5AQVA 3MN6A 3MEEA 3T19A 4MO5A 2HBMA 3LM9A 3VPZA 2JGUA 3OA9A 4BRLA 1SKSA 3F9KA 1SUQA 4AHVA 4RW6A 2VQEK 1Z25A 4EZ9A 5HRRA 5GIOA 1NK0A 4CESA 4M3RA 4CGHA 3PY8A 1RT4A 5AQUA 3SBGA 3PSIA 2O8DA 3L4QA 4JN4A 4NYFA 3K9JA 5HRNA 1BQNA 2QWOA 3IUCA 1UWBA 1GLDG 3RRGA 2AA4A 2YKMA 2I5JA 3TAEA 2P9KB 3O9RA 3I8BA 2WONA 1I39A 1KCFA 4F3OA 3QFPA 2GELA 3O1BA 4O5BA 4I6MB 5LMNK 4X65K 3IAYA 3LP3A 4DSLA 3OBWA 2OPQA 1XQSC 3V9SA 4FW1A 3O9SA 4DQRA 1RDBA 4WCEL 5M1OA 3OYNA 1UA0A 4OPJA 4RCHA 4YNQA 4AHTA 1ATSA 4KV8A 1NGGA 4J2BA 1QSYA 5BN8A 1GLJO 3NFAA 1TK5A 1NGFA 3L0QA 5BRHA 1BWFO 3D7EO 2VG7A 3AO3A 2D0PA 3KKRA 2ZJQL 4IFVA 4GVMA 4BVPA 3CJ1A 5KPTA 3MN7A 3SMSA 2ZJPL 4LF6K 1GLFO 1OH6A 1HJRA 4E89A 3ZSOA 5D3GA 4M7YA 1NU0A 3CJ7A 4CHZA 3S3MA 4CCHA 4CF9A 5M1QA 3H46O 3DLGA 1RBTA 1EWQA 1Z6RA 2IVNA 2Z1GA 2UYTA 4ISGA 3TSUA 5AQIA 2Q2RA 1S1VA 2UU9K 3AARA 4H03B 5CR4A 3SMPA 4A2AA 4E1JA 2ITMA 4CFDA 4LF4K 3P1GA 3QIPA 4DS5A 2X6SA 3VQDA 1RDUA 4A61A 4DV1K 3QFUA 3M8SA 2UXCK 3O9QA 4IO8A 3R1XA 4FWNA 4NCBA 3KWIA 5DMRA 1J53A 3T69A 2RN2A 2PYJA 4KTQA 4KHWA 2FLOA 4DCHA 1TUUA 4W5NA 4CIFA 3HBTA 1NGHA 1SAZA 3DLHA 4GV3A 1RDWX 3MEDA 4CD1A 3L8BA 1DTQA 2P9SB 2DTUA 3DOKA 3M3ZA 4DV5K 4BC2A 3WEEB 4H8KA 4KAZA 3AY9A 3K9KA 3AAPA 3CF5L 1SS6A 1IBLK 4CF0A 4Z4IA 4J2EA 3AO5A 4OJRA 2VYPA 4LC9B 4QS7A 4B1XB 1RTIA 4DSKA 4HWIA 1S1WA 1FKPA 4Z4FA 3TTFA 3DOLA 3QBXA 1W97L 3ULDA 4M3ZA 3IFRA 4YHHK 2GBZA 1FKOA 2HNZA 4WFNL 3SYZA 1VSIA 3THVA 4CE9A 1NKCA 3AVGA 1ZYQA 3KK1A 4CJFA 4C8MA 1QVGM 4N41A 3MX5A 5EVZA 1SL1A 5AQXA 4IZ9A 2VCPA 4A59A 1C6VA 4WQ5C 4J2AA 1JXBA 3MN9A 3NBPA 4A57A 4IG3A 5J2MA 4U7BA 3LZIA 4JKEA 4F9OA 1HPZA 3M6GA 1T03A 4JKGA 1K8KB 2GX9A 3TAQA 3VTHA 3K57A 3RR8A 4YOWA 1SKWA 4FJ8A 4CZLA 3L2RA 4CHYA 2UUBK 4B9TA 2NRZA 1CZAN 4CZKA 1N33K 1RCHA 3EN9A 2HHWA 3EEQA 5C2FA 4LF5K 5KI6A 3UKUB 4H4OA 1ILYA 4IOAL 2QWNA 4LY7A 3THXA 3BEXA 3V81A 2QXFA 3EE8A 3V6DA 3C0BA 3IRXA 4FM2A 2FBVA 1VSLA 2YNHA 5AQWA 2O8FA 5DK5A 2Q97A 3SAHA 3VQQA 4X62K 2ZJRL 1U48A 4CJ5A 1IKYA 3MEGA 3JS6A 2PBDA 3WUHA 3K5NA 3CJ9A 3MCPA 4DU3A 1WLJA 5AQJA 4FJMA 1VAZA 3NMUA 4NXMK 5C25A 1TK8A 3VENA 4HHTA 2Q3SA 1EO1A 4CBXA 1VSDA 2P9UB 4KO0A 2PYLA 5BPLA 5AJ3K 3HT3A 3RRHA 2D0AA 4RTFD 3HPOA 3ISNC 3PSFA 2BDPA 2E2PA 4JHDA 5SZTA 3FR0A 5M1KA 4BREA 5J1EA 4BRFA 5AQOA 1L5UA 2E1ZA 2FSJA 4CGDA 2HBLA 4DF4A 1W9HA 2G8HA 1HNXK 2V7ZA 4CJPA 4O5FA 1N5YA 4JV5K 4A5BA 3VQ9A 1BUPA 3ZX0A 4H0VB 5AQMA 2CGJA 2E88A 3CJBA 3CJAA 3W3DA 4JLHA 1KC8O 3CCVN 4GKJK 3R6MA 2KFNA 3ULEB 2O4GA 4YOTA 2HB5A 1B92A 1XHZA 2P9NA 3U8XA 3VQ6A 1K9MO 2DPNA 3VERA 5C42A 2D0OA 4LSLA 4DTJA 3THYB 1VRUA 4QAGA 3TPQA 3UB5A 2E6MA 4CEFA 2KHOA 4C8LA 1VSMA 5CE3A 1GOCA 3CQ8A 4H0OA 2W6KA 2Z1JA 1REVA 2NRWA 1U47A 1S1TA 3VEZA 4KHYA 5C15A 3RTVA 2X78A 1ZC6A 3DLRA 5HRPA 1A5VA 3QO9A 4HUGA 1XHXA 2XY8A 1NGJA 1VRTA 1HNWK 3FE1A 4H5NA 1IO2A 1NMNA 1QQNA 4RW7A 5E41A 4CJRA 1N36K 4KHQA 1U4BA 5JLHA 3PO5A 1NK7A 4OX9K 2YNFA 5JS2A 3UKRA 4AM7A 1VQ9N 4KB0A 4F4KA 2B4JA 4FLXA 2O8DB 2O8EB 4JI2K 2O4IA 1I94K 2V51B 3F9MA 1JLFA 3THWA 2G8IA 2YNGA 3VGLA 4ZHRA 1I3AA 4CZIA 5JS1A 3QESA 2NRVA 2E8AA 4A5AA 4H5WA 1HMVA 1VSFA 4GNIA 1ATRA 4CIEA 4FPBA 1F21A 3VQ4A 1B9FA 3HSTB 2HHHK 1QQOA 1NJYA 3FLCO 2ZQBA 4DU4A 3EZWA 5M1PA 5B8HA 3CETA 1LWEA 3G0ZA 3PO4A 3NDKA 2FF3B 3LPUA 3QERA 1V4TA 3OYEA 1P90A 1A5WA 3A5MC 3RMBA 4N56A 1LW2A 4CZMA 3VQ8A 4CFAA 4JYAK 2P9PB 2PFUA 5AZIA 4DR5K 1EWRA 4FK0A 4FOEA 4M3TA 4JKBA 4FVUA 4BE1A 3VESA 4B1YB 3CQXA 4FWMA 4B1WB 1L3UA 1JCGA 3WT0A 3K58A 1BA0A 4JK7A 3TSPA 3NVKA 1V4SA 3MX2A 2A40A 4CJ4A 3DLLL 4OLBA 2P9LA 3AVHA 4CHNA 4MO4A 3LPTA 2HHUA 1BOTO 1DKGD 2HBJA 1T05A 1WAJA 4LFAK 1JL2A 3MN5A 3PV8A 4H0YB 2P5OA 4DR6K 4CJUA 3RWUA 3O4NA 1SZ2A 3P39A 5JVHL 2OZSA 3V9UA 4BR0A 3A2FA 4OKKA 2OANA 4CI6A 1RT5A 4O8UA 3ZSZA 1C1BA 1BU6O 3F73A 5LJWA 2W42A 3CC7N 4FPAA 3WNHA 4YY3K 2HNYA 4O55A 3FZKA 4FJLA 4DFJA 4NB4A 1L3TA 2X6NA 3NH2A 3OVNA 1XC9A 4YORA 1TAQA 4EIAA 5I9EB 3HOSA 4YOXA 3O1WA 3J81O 3ENHA 3MMVA 2FF6A 2B5JA 3ZETA 1HJOA 4NLBA 1BG3A 4JRPA 2HNDA 5C12A 1T6CA 5IWAK 3PIPL 4IO9L 4FVMA 3VGKA 3T1YK 3KJVA 2VWKA 3BUZB 3BY5A 4HCCA 1FXXA 3L2WA 4FWLA 2WBNA 4GKKK 3L3UA 3BDPA 3J7ZO 4B3OA 4WQ5A 4DR2K 3L3VA 2HBKA 2FBTA 2G8VA 2OA8A 4PUOA 4JEPA 1YTAA 3H08A 4K8ZA 5CYQA 1ZBLA 2G8UA 3HPGA 1Y97A 5FPDA 2QWLA 2VWBA 2GWJA 1HKBA 2D0BA 3R8EA 1UA1A 1XUPO 1NKEA 4FLTA 3NH1A 4JS4A 2A1RA 3DAWA 4JK9A 4Y1DA 3KK2A 4FJJA 2ZGZA 5A2QO 3P83D 1D9FA 3W0LA 4F8RA 4IDKA 4JI1K 2QA4N 1NKBA 1RT1A 3D2EA 5FDLA 4W5RA 5C24A 1XNRK 2E2OA 1CZ9A 1NM1A 3P31A 3TI0A 1X3MA 1HLUA 1RDCA 3RSEB 4NCAA 5C2DA 3KLGA 4FLZA 4KHSA 1TL3A 4H4MA 4JKDA 5AQQA 4DSEA 4KFBA 4FJKA 3SJHA 1ZXOA 2OPSA 4KHUA 1ZBFA 4CVNE 2O8FB 4YFUA 2ZE2A 3CIPA 2NRHA 2QWMA 3OYGA 1NGBA 4M3YA 3ENOA 1RNHA 3O6WA 5CZ1A 4CJLA 5ADXH 2YHAA 3VQ5A 3GL1A 3OBYA 5I42A 4BRCA 4ISFA 4DTPA 1YUWA 4PL8A 4WFAL 1LAVA 3MWTA 3AO4A 3SQ4A 3N4PA 5AFUH 2DFFA 2HHVA 5BR8K 4Z4HA 4GW6A 3IS9A 1C0MA 2F9TA 5E84A 4GMJB 2DFEA 2E2QA 5AQKA 1WNSA 3VQCA 5JICA 3R9PA 3QLHA 3VOVA 3VF2A 5HBMA 3HM8A 4LFCK 4I7FA 3LL3A 1U6ZA 3LALA 3LDQA 1QSSA 4F2RA 1O1WA 2E4LA 3IKMA 3ID8A 4X64K 2HHSA 3AVFA 1JCEA 4DR1K 1C0TA 3D45A 1IJJA 3C6AA 1KAXA 4QOZB 4BE0A 1TKZA 3M8PA 3T1HK 1TL1A 5AQPA 4NYNA 3ZT4A 1WBDA 3NGZA 5AQZA 3G25A 1NOYA 1VQ4N 1U2VA 5LY3A 5T7BA 5CY4A 2Z1IA 1NK5A 3U4LA 4DTMA 2D5RA 4JI8K 1YI2N 4I9QA 1YT3A 4IBNA 1YHQN 1VHXA 3EL2A 4X66K 4EP5A 4BC3A 1WSJA 1KVCA 1GLAG 1SV5A 3DM2A 2QKBA 1WAFA 2E2NA 4CJSA 1C0FA 1C1AA 3HVRA 4CHOA 3AAQA 3LDLA 3QEVA 4KB1A 4LF9K 4IJNA 2WOMA 1VQNN 3ZEUB 3TSQA 4AHRA 4KREA 4I2QA 4HTUA 3OYMA 2KQ2A 1LCUA 1JLBA 4FJ7A 1J5EK 3AO2A 1CZBA 5KPRA 2D4WA 3ZT0A 1NWKA 4HVJA 2DFHA 4E1MA 3WNGA 1D9DA 5HL7L 3DXMA 3VA0A 4KI6A 5BREA 1TVRA 3DLKA 4FWSA 1BIUA 3NAEA 3THWB 2KLAA 2PZSA 4N47A 3O9TA 4NO7A 3ZX2A 2GEMA 4DR7K 4DU1A 4I2PA 1SQKA 4NXNK 2BTFA 1K8AO 1HUXA 4FO0A 4WE1A 3B8AX 1Q18A 5DM7L 3CCSN 4Z4GA 1WUAA 3L2UA 1WSHA 1KVBA 3TU5A 5AZJA 4FWOA 2ASPA 2OYQA 1UOCA 1VQMN 4BWJA 4LFBK 1JLAA 4UQGA 4FYDA 1S6PA 4CZJA 3ITHA 1VQ8N 4B3SK 1HYZA 2E5LK 4DF8A 2ASOA 2GUPA 2E6LA 3LDSA 4CJWA 1IKVA 4CGJA 3HTVA 5C10A 4DV4K 3OJSA 2G8WA 1E4FT 1WSFA 4BDYA 4DWIA 1NK8A 2Y1JA 2YHXA 4HTLA 1RFQA 2UUCK 2QTDA 1TKDA 1SL2A 1X1PA 5H1SQ 4DFMA 4ILHA 1X9MA 5FLXO 3ZSYA 3LAMA 4KI4A 2XY7A 1HYSA 4H0PA 1JLCA 4XH1A 1NNEA 2KTQA 4OVLA 4CD3A 1IG8A 2O8CA 3ATVA 3ZYYX 1TAUA 3DXKA 4AF1A 3OTOK 2IIRA 3A0IX 2BGGA 5AQRA 1QSLA 2QXLA 3SPZA 3QBWA 2A6AA 5ELZA 2NRRA 3PUFA 3GBTA 3E9LA 1HNIA 2HSTA 3J7AP 3CFRA 1LOTB 4DV2K 3JYTA 4CZGA 1C1CA 4JD2B 1BI4B 1WOQA 4WQ4C 1KFDA 1VQLN 5GINA 3OW2M 2Z1HA 3EYZA 3VA3A 1NJXA 2NNWA 3QNNA 5M1FA 2OPPA 4A62A 3K5OA 4BACA 1Q86O 4L3QA 3VN5A 5C0YA 3ID6A 3OYIA 4B1VA 2O8BB 3ALYA 1HQEA 3VMFB 1CXUA 3ATUA 1KLMA 1TYQB 5MLCQ 3PX6A 4CECA 4BRMA 4FK2A 4CERA 4DQQA 2HMPA 3J8AA 3FZLA 1RDAA 4FJ9A 1MWKA 3QINA 4RW9A 1HNZK 2QEXN 3D2FA 4N76A 3H45C 4MDBA 1WSGA 4GV6A 2KZMA 3M5RA 4BR4A 4F3TA 1X3NA 4HCBA 4AHUA 1YVNA 3SK3A 2FSNA 1VQ5N 3M8RA 5HRSA 3AA2A 4RW8A 3CC4N 4IFEA 3V1QA 4DSFA 2P9IB 3MXIA 4FJNA 4JI7K 4B3TK 1HPMA 4GV9A 1QQMA 1NK6A 3U9DA 3VF6A 3WXLA 1U04A 5AQYA 4E7LA 1TUYA 2QWPA 4BG9A 1LV5A 1DTTA 4JKFA 1G15A 4AHCA 4LSNA 3ZSRA 1WSIA 2QW9A 5BR9A 3CXCM 1QVFM 2XRIA 1BQMA 4C8KA 1U45A 3QEIA 3SZ2A 3EE9A 3FZFA 2GWKA 2HF3A 3OYLA 1B9DA 4C23A 5BN9A 3K59A 1BA1A 3LP1A 1Q9XA 2Q31A 5EY4A 3CCUN 3I8DA 4OLAA 5GAHP 4CEZA 1YIJN 2HVIA 3DYAA 3HJFA 3ZSQA 4M3XA 3C7NB 4OO1J 1ZBUA 5GIPA 5LL6Z 3G71N 4CBUA 3SV3A 1QS4A 1RBUA 3QEPA 1D8YA 3ZLJA 2FXUA 4FJXA 2EX3A 4CZFA 4FJHA 4FXDA 2GTDA 4H0TB 3AVCA 4CHQA 4Q0BA 3G10A 3A5OC 3TTCA 3VQPA 2OZMA 1JL1A 2HHQA 4ILGB 1VQPN 3O3FA 4DFPA 3WXIA 4DV7K 2GV9A 2KW4A 4B9NA 1QZ5A 3EKUA 1FW6A 4CF8A 4UY8O 1GOAA 2IVPA 5DM6L 4PKGA 4FLUA 3RMAA 1H1VA 3ASMA 3O4QA 3LANA 2VQFK 1YXQA 1RGIA 3KD1E 3A5NC 4CF1A 3FGUA 4J8FA 1EQYA 4KBOA 3TTDA 4JKAA 5J2QA 5F1XA 4IG0A 1BHLA 4I9LA 4Q5VA 4BQZA 2ASMA 3R3LA 4ID1A 1J5OA 3T7ZA 4ELVA 2XHBA 2YV0X 4LH5A 4B9UA 2YHYA 4B8AB 1R59O 3JXUA 3CG7A 4IFYA 2A42A 4XEIA 3WNEA 2JWLA 1E3MA 4IKFA 3PX4A 5HLFA 3H1QA 4KRFA 1GLEG 3QB0A 4JNEA 1K73O 3E9OA 3F5TA 4N5SA 3K2PA 3K0SA 3V9XA 2KZZA 4BVOA 3DRPA 4J2DA 3WEEA 5LJVA 2QWRA 4CEAA 5JMVA 3FFIA 4CEEA 3HXMA 2Q0RA 2E20A 1Q7YO 1OH7A 2ITGA 4CJTA 3C65A 3S41A 3CHWA 3WXMB 3CM6A 1T8EA 1YITN 1E4GT 3CERA 4ICLA 3AVBA 1RTJA 4AM6A 2NZTA 5TKYA 3HVTA 3V4IA 1KAYA 5BPNA 3SAFA 4E7KA 1RILA 4EP4A 1JJ2M 2HHXA 1M1KO 4EHUA 1A5XA 2CGKA 3QICA 4BROA 4DSIA 3VF4A 2ZM6K 4DG1A 2NUBA 2VG5A 3MWPA 5CHIA 4DUZK 1NJIO 4FJGA 4B1ZA 4FZXC 2I7NA 1XI1A 4M63C 1TV6A 3SUQA 3NHGA 2OTLN 2EHGA 3CMAN 3NGYA 1EETA 1RBSA 1K8KA 4CGFA 2F8TA 1DT9A 1QQCA 1R0AA 3SLCA 3OYAA 3T1AA 4CJVA 4ILJA 2VGNA 3AO1A 1BCOA 1KLNA 3MAQA 2IC3A 3VEVA 3UKUA 4M3WA
chains in the Genus database with same CATH topology
1O1WA 2E4LA 4PWDA 1ZBIA 3TABA 2VG6A 4ELUA 3AVLA 1C6VA 3OYJA 5HP1A 4J2AA 2HHSA 1JXBA 3AVFA 4OKJA 1EP4A 3NBPA 4Y1CA 3OYCA 1C0TA 2FC0A 3D45A 3AVNA 2KFZA 2YHBA 4IG3A 1X9WA 3OYHA 5J2MA 4QOZB 3LZIA 4BE0A 4E0DA 1VSEA 1HPZA 1TKZA 3M8PA 3NF7A 1TL1A 3ZT4A 3AA5X 4NYNA 4CJKA 3OS2A 3SQ2A 3NGZA 3TAQA 3HO1A 4M42A 3K57A 1RT7A 3ZT2A 1NOYA 3RR8A 3OYDA 4DLEA 1SKWA 1K6YA 4FJ8A 5T7BA 4C8OA 5CY4A 3L2RA 4CHYA 2Z1IA 1NK5A 4DTMA 1J54A 2D5RA 2IGIA 2LSNA 3C6UA 2HMIA 4B9TA 4I9QA 4DLGA 1YT3A 4IBNA 4B9SA 3HL8A 2RPIA 4CK1A 5EU7A 1EX4A 1RCHA 3WNFA 2P5GA 3VQBA 4EP5A 2HHWA 1WSJA 1KVCA 3NGIA 5KI6A 3DLBA 3KD5E 4KREA 1SV5A 3DM2A 4H4OA 2QKBA 1WAFA 2XY6A 4CFBA 3SJJA 4CJSA 4DSJA 1C1AA 4CEOA 1RTHA 4LY7A 4CHOA 2FBYA 1HNVA 3HVRA 3AA4A 3V81A 3CFOA 2QXFA 3V6DA 3IRXA 3QEVA 1J9AA 4FM2A 3SUOA 2FBVA 4FLWA 4KB1A 1VSLA 2YNHA 4CEBA 4BDZA 5DK5A 2WOMA 3VQQA 1U48A 4EZ6A 4CJ5A 1Z26A 3AV9A 3D0PA 4AHRA 1IKYA 2D0CA 3MEGA 3OJUA 4HUFA 4I2QA 1ASVA 4HTUA 4CEDA 1RTDA 3ZT1A 2KQ2A 3OYMA 3K5NA 4DU3A 1WLJA 4FJMA 1JLBA 2G8FA 4FJ7A 5FRNA 4DQPA 3AO2A 3MECA 5C25A 1CZBA 1L3SA 2B6AA 1TK8A 4TSXA 1KSPA 4CF2A 2Q3SA 3ZT0A 4HHTA 1VSDA 4CIGA 4HVJA 4KO0A 2DFHA 4E1MA 5SWMA 3AVKA 3OYFA 2PYLA 3KIOA 3WNGA 5KGWA 1XWLA 4FCYA 1D9DA 4KI6A 3HT3A 3VA0A 3RRHA 3S3OA 1TVRA 2D0AA 3DLKA 3HPOA 1ASWA 3S3NA 1BIUA 3NAEA 3ISNC 3LZJA 3LAKA 2BDPA 4B9VA 3ZCMA 2PZSA 4N47A 1JLQA 1W0HA 5SZTA 1HYVA 1EKEA 3IG1A 3UIQA 4DU1A 4I2PA 3OY9A 1KVAA 5J1EA 5KTQA 1L5UA 4PQUA 4QCLA 4BE2A 1S5JA 4DFKA 4AH9A 1ASUA 3AA3A 4WE1A 4CGDA 4CJEA 4AILC 1W9HA 4DF4A 4B9MA 4FM1A 1YTUA 2QK9A 3C95A 2G8HA 4K8XA 3RR7A 4DTXA 4Z4GA 4CJPA 1N5YA 3L2UA 1T7PA 1BISA 1WSHA 1KVBA 3K5MA 5FROA 3VQAA 3TAGA 4W5OA 4AHSA 3VQ9A 5J2PA 1NK4A 3ZSWA 3QEXA 2OYQA 1UOCA 4LD0A 1HRHA 1QE1A 1LWFA 3T3FA 4BWJA 1TK0A 1JLAA 3AVMA 4UQGA 4FYDA 1RDDA 1S6PA 3ITHA 4JLHA 1HYZA 1IH7A 4DF8A 3MXMA 2KFNA 3LWMA 2O4GA 2E6LA 1EXQA 3LDSA 3SUNA 4CJWA 2HB5A 1B92A 1JKHA 4B08A 1XHZA 1IKVA 3P5JA 1Q8IA 4HUEA 1WN7A 4CGJA 3VQ6A 5C42A 1IKXA 3OYKA 2IOCA 4FK4A 4LSLA 3OJSA 4E7JA 4DTJA 3DMJA 1WSFA 3U3YA 2G8WA 4BDYA 2G8KA 4DWIA 4M3UA 1NK8A 1VRUA 4QAGA 3SNNA 1S6QA 2E6MA 3DRRA 4CEFA 2Y1JA 4C8LA 1JLEA 1VSMA 1MU2A 1GOCA 1TKDA 4OKEA 5CYMA 1SL2A 1X1PA 4DFMA 4BDPA 3CQ8A 1JLGA 1RBRA 3ZSYA 1X9MA 3LAMA 1Q9YA 2RF2A 1RBVA 2Z1JA 4PA1A 3RMCA 3HK2A 1REVA 5J2NA 2XY7A 4KI4A 1BIZA 3C94A 1U47A 1HYSA 4MFBA 1JLCA 1S1TA 4LH4A 2KTQA 4OVLA 1BI4A 1NOZA 4BWMA 4KHYA 1C0UA 4CHPA 1TAUA 3V9WA 3RTVA 1WSEA 2X78A 3BGRA 3DLRA 5HRPA 1X9SA 1A5VA 4DTUA 1SL0A 3QO9A 4HUGA 3EY1A 4M41A 2BGGA 1XHXA 2XY8A 3I0SA 2FBXA 1QSLA 1VRTA 4O44A 4JRQA 1IO2A 4Z4CA 3M8QA 3QETA 3SPZA 4RW7A 5E41A 3KLIA 4O0IA 4CJRA 3ZT3A 3KLFA 4KHQA 3U3GA 3TAPA 1U4BA 1NK9A 4W5QA 3LP0A 4FM0A 3PO5A 1NK7A 1S1XA 3PUFA 3B6PA 4ID5A 1HNIA 2YNFA 1JXEA 5JS2A 4M45A 4E1NA 3CFRA 3DI6A 4CGGA 4ZTJA 4DQIA 4KB0A 1N6QA 4Z0UA 2AJQA 4F4KA 2B4JA 1S9GA 4FLXA 3JYTA 2O4IA 1C1CA 3ZSVA 1BI4B 4FJIA 3ZSXA 1KFDA 1QHTA 5FRMA 1JLFA 4R5PA 4E19A 2G8IA 2YNGA 2YKNA 2Z1HA 4ZHRA 4CEQA 3EYZA 1I3AA 3KLHA 3VA3A 5JS1A 1NJXA 3VQEA 3V1OA 3QESA 4CK3A 3V9ZA 1VSHA 3SQ1A 1BCMA 3HPHA 5CZ2A 3V1RA 3QNNA 4FZZA 2OPPA 3HP6A 3K5OA 1HMVA 1VSFA 3JSMA 3K5LA 4BACA 4CIEA 4DTNA 3NF8A 1VSKA 3VN5A 2DY4A 1F21A 3OYIA 3ALYA 3VQ4A 5HROA 1HQEA 2IAJA 1B9FA 1TKTA 3HSTB 1CXUA 1NJYA 4FZYA 3KK3A 2JLEA 2X74A 2ZQBA 1S9EA 2IS3A 1KLMA 4DU4A 5KRTA 3L2VA 3CYMA 1LWEA 3PX6A 4FW2A 3G0ZA 4CECA 4CFCA 3SI6A 3PO4A 3NDKA 4CJ3A 4FK2A 4CERA 4DQQA 3LPUA 2P1JA 3QERA 1RDAA 2RKIA 4FJ9A 4ELTA 4PY5A 3QINA 5KGXA 3OYEA 3DRSA 4RW9A 1LWCA 1A5WA 1VK0A 3EZ5A 3NCIA 3RMBA 4N76A 1VSJA 4N56A 1LW2A 3NF9A 3OYBA 3VQ8A 4CFAA 1WSGA 4ZTFA 2KZMA 3QEWA 4FK0A 4F3TA 3LWLA 4KTWA 4M3TA 1CLQA 4HCBA 4BE1A 4AHUA 4W5TA 3RMDA 3SQ0A 3M8RA 5HRSA 3AA2A 4RW8A 4FLYA 3V1QA 3TANA 4DSFA 1L3UA 1S1UA 3MXIA 1KFSA 4FJNA 1NJZA 1ZBHA 2VWJA 3NF6A 2HW3A 3K58A 1RT3A 4DTRA 4CJQA 1CXQA 5K14A 3KLEA 1LAWA 4CJ4A 1NK6A 1SKRA 4L8RB 4OLBA 2ATQA 4B8CA 1U04A 3OS1A 3NE6A 4JS5A 4E7LA 1LV5A 1DTTA 1G15A 1RT2A 3AVHA 4C8NA 1FK9A 4AHCA 1TKXA 4CHNA 4E3SA 3SCXA 3LPTA 2HHUA 4LSNA 3ZSRA 3TAMA 1WSIA 4KPYA 1HQUA 1T05A 1DLOA 1WAJA 1BL3A 1JL2A 3KKSA 2PY5A 2OPRA 2XRIA 3PV8A 2F8SA 1QSSA 1BQMA 2P5OA 4DMNA 4CJUA 1U45A 4C8KA 3RWUA 3LP2A 3O4NA 4OPKA 3HM9A 3QEIA 3SZ2A 3DLEA 3CM5A 4KTZA 3OS0A 3OYLA 3MEEA 3T19A 2OZSA 1B9DA 2BANA 3V9UA 2JGUA 3K59A 1SKSA 3LP1A 3F9KA 1SUQA 4AHVA 3A2FA 4OKKA 4RW6A 1Q9XA 4CGIA 3TWHA 3I8DA 4OLAA 1Z25A 4CEZA 4EZ9A 5HRRA 1RT5A 3MXJA 3DYAA 1NK0A 4CESA 3HJFA 2HVIA 4M3RA 3ZSZA 2F96A 1C1BA 4CGHA 1RT4A 3ZSQA 3PY8A 3TAFA 4M3XA 3HP9A 3F73A 2BE2A 2W42A 1ZBUA 4NYFA 5HRNA 3WNHA 4CK2A 1BQNA 2HNYA 4O55A 4FJLA 3SV3A 1UWBA 4DFJA 1QS4A 1RBUA 3QEPA 3RRGA 2YKMA 2I5JA 3TAEA 1D8YA 4F2SA 3VQ7A 3TR8A 1L3TA 3L2QA 4FJXA 2EX3A 2X6NA 3O3GA 4FJHA 4FXDA 3NH2A 2HVHA 2WONA 3OVNA 1XC9A 1I39A 3AVCA 4CHQA 1KCFA 2R7YA 1TAQA 3G10A 2QKKA 4F3OA 1YVUA 4Q0BA 1QTMA 4FJ5A 3VQPA 2A1SA 2OZMA 2IDOA 4O5BA 1JL1A 3IAYA 2HHQA 1ITGA 3SUPA 4G1QA 2B5JA 3O3FA 3LP3A 4DFPA 4DSLA 2OPQA 4JRPA 2HNDA 3HYFA 3V9SA 1LW0A 2GV9A 2KW4A 4FW1A 4DQRA 4B9NA 1RDBA 2XY5A 4FVMA 3OYNA 1UA0A 1L3VA 1IKWA 4CF8A 1GOAA 4XIUA 4OPJA 4E7HA 4YNQA 3KJVA 4AHTA 2VWKA 4NCGA 4KV8A 4FLUA 4O0JA 1FXXA 3RMAA 4HCCA 3L2WA 4J2BA 1QSYA 3ASMA 3NFAA 3O4QA 4RW4A 1TK5A 3LANA 3L3UA 3BDPA 2VG7A 3KD1E 4CF1A 3AO3A 4B3OA 4DTOA 3L3VA 3KKRA 2HHTA 3KTQA 4IFVA 5J2QA 1T03A 2FBTA 4IG0A 4GVMA 1BHLA 4RG8A 4I9LA 2G8VA 3NH0A 4Q5VA 2OA8A 4PUOA 2GUIA 3SPYA 1YTAA 3H08A 4K8ZA 5CYQA 4ID1A 4DS4A 1ZBLA 5I3UA 1J5OA 4B9LA 2G8UA 1HJRA 3HPGA 4ELVA 1Y97A 1U49A 2XHBA 4E89A 3ZSOA 1KRPA 2YV0X 4LH5A 4B9UA 5D3GA 3CFPA 4Z4EA 4CHZA 2D0BA 4B8AB 3S3MA 1UA1A 4CCHA 4CF9A 3CG7A 1NKEA 4IFYA 3DLGA 1RBTA 4FLTA 2Z1GA 3NH1A 4JS4A 3WNEA 2A1RA 4O4GA 4IKFA 1D5AA 3PX4A 3SV4A 3AVAA 4Y1DA 3KK2A 5HLFA 4FJJA 4DTSA 1S1VA 3B6OA 4KRFA 3P83D 1D9FA 4F8RA 2XO7A 1KTQA 4IDKA 4CFDA 4N5SA 3U6FA 1NKBA 3K2PA 1RT1A 3P1GA 3QIPA 4DS5A 2X6SA 5FDLA 1RT6A 3VQDA 4W5RA 5C24A 3DRPA 3V9XA 2Y1IA 4J2DA 2KZZA 3M8SA 1CZ9A 3TI0A 4F2RA 2YNIA 4CEAA 3HXMA 3FFIA 4CEEA 4NCBA 3AVJA 3I0RA 3O3HA 1RDCA 4NCAA 5DMRA 2ITGA 4CJTA 3KLGA 4FLZA 3S9HA 4KHSA 1TL3A 3E01A 4H4MA 1J53A 4DSEA 2RN2A 2PYJA 4KTQA 4KFBA 3CM6A 4FJKA 4OGCA 4KHWA 1T8EA 2OPSA 4KHUA 4W5NA 4CIFA 1ZBFA 4MQ3A 4ICLA 4YFUA 3DLHA 2ZE2A 3AVBA 1RTJA 5KRSA 3OYGA 4M3YA 3HVTA 3V4IA 1RNHA 4E7KA 3MEDA 1RILA 5CZ1A 4CJLA 4EP4A 2HHXA 4KKOA 3C6TA 3L8BA 1A5XA 1DTQA 3TARA 2YHAA 3VQ5A 3DOKA 4OGEA 2DTUA 4H8KA 5I42A 4KAZA 4DTPA 4DSIA 4DG1A 2NUBA 2VG5A 1LAVA 4FJGA 3AO4A 2P51A 4FZXC 4CF0A 3SQ4A 1TGOA 4Z4IA 3AVIA 4E7IA 1XI1A 4J2EA 1TV6A 2DFFA 3AO5A 4OJRA 3SUQA 1UAXA 2HHVA 3NHGA 4KHNA 2EHGA 2ETJA 1NJWA 1RTIA 3NGYA 1GOBA 4DSKA 1EETA 1RBSA 1S1WA 4CGFA 4Z4HA 2F8TA 1QQCA 1R0AA 4GW6A 1FKPA 3IS9A 4Z4FA 1C0MA 4GMJB 2DFEA 3OYAA 1WNSA 3DOLA 3T1AA 3VQCA 3QIOA 3ULDA 1IG9A 4M3ZA 3QLHA 4CJVA 2GBZA 3AO1A 1FKOA 1BCOA 2HNZA 3SYZA 1VSIA 3PX0A 5HBMA 3THVA 1KLNA 4CE9A 3QNOA 1NKCA 4I7FA 3AVGA 3MAQA 3KK1A 4DQSA 1ZYQA 2IC3A 4CJFA 3LALA 4C8MA 4FLVA 4N41A 2ZD1A 4M3WA 1SL1A 1BGXT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O1W A;  2E4L A;  4PWD A;  1ZBI A;  3TAB A;  2VG6 A;  4ELU A;  3AVL A;  1C6V A;  3OYJ A;  5HP1 A;  4J2A A;  2HHS A;  1JXB A;  3AVF A;  4OKJ A;  1EP4 A;  3NBP A;  4Y1C A;  3OYC A;  1C0T A;  2FC0 A;  3D45 A;  3AVN A;  2KFZ A;  2YHB A;  4IG3 A;  1X9W A;  3OYH A;  5J2M A;  4QOZ B;  3LZI A;  4BE0 A;  4E0D A;  1VSE A;  1HPZ A;  1TKZ A;  3M8P A;  3NF7 A;  1TL1 A;  3ZT4 A;  3AA5 X;  4NYN A;  4CJK A;  3OS2 A;  3SQ2 A;  3NGZ A;  3TAQ A;  3HO1 A;  4M42 A;  3K57 A;  1RT7 A;  3ZT2 A;  1NOY A;  3RR8 A;  3OYD A;  4DLE A;  1SKW A;  1K6Y A;  4FJ8 A;  5T7B A;  4C8O A;  5CY4 A;  3L2R A;  4CHY A;  2Z1I A;  1NK5 A;  4DTM A;  1J54 A;  2D5R A;  2IGI A;  2LSN A;  3C6U A;  2HMI A;  4B9T A;  4I9Q A;  4DLG A;  1YT3 A;  4IBN A;  4B9S A;  3HL8 A;  2RPI A;  4CK1 A;  5EU7 A;  1EX4 A;  1RCH A;  3WNF A;  2P5G A;  3VQB A;  4EP5 A;  2HHW A;  1WSJ A;  1KVC A;  3NGI A;  5KI6 A;  3DLB A;  3KD5 E;  4KRE A;  1SV5 A;  3DM2 A;  4H4O A;  2QKB A;  1WAF A;  2XY6 A;  4CFB A;  3SJJ A;  4CJS A;  4DSJ A;  1C1A A;  4CEO A;  1RTH A;  4LY7 A;  4CHO A;  2FBY A;  1HNV A;  3HVR A;  3AA4 A;  3V81 A;  3CFO A;  2QXF A;  3V6D A;  3IRX A;  3QEV A;  1J9A A;  4FM2 A;  3SUO A;  2FBV A;  4FLW A;  4KB1 A;  1VSL A;  2YNH A;  4CEB A;  4BDZ A;  5DK5 A;  2WOM A;  3VQQ A;  1U48 A;  4EZ6 A;  4CJ5 A;  1Z26 A;  3AV9 A;  3D0P A;  4AHR A;  1IKY A;  2D0C A;  3MEG A;  3OJU A;  4HUF A;  4I2Q A;  1ASV A;  4HTU A;  4CED A;  1RTD A;  3ZT1 A;  2KQ2 A;  3OYM A;  3K5N A;  4DU3 A;  1WLJ A;  4FJM A;  1JLB A;  2G8F A;  4FJ7 A;  5FRN A;  4DQP A;  3AO2 A;  3MEC A;  5C25 A;  1CZB A;  1L3S A;  2B6A A;  1TK8 A;  4TSX A;  1KSP A;  4CF2 A;  2Q3S A;  3ZT0 A;  4HHT A;  1VSD A;  4CIG A;  4HVJ A;  4KO0 A;  2DFH A;  4E1M A;  5SWM A;  3AVK A;  3OYF A;  2PYL A;  3KIO A;  3WNG A;  5KGW A;  1XWL A;  4FCY A;  1D9D A;  4KI6 A;  3HT3 A;  3VA0 A;  3RRH A;  3S3O A;  1TVR A;  2D0A A;  3DLK A;  3HPO A;  1ASW A;  3S3N A;  1BIU A;  3NAE A;  3ISN C;  3LZJ A;  3LAK A;  2BDP A;  4B9V A;  3ZCM A;  2PZS A;  4N47 A;  1JLQ A;  1W0H A;  5SZT A;  1HYV A;  1EKE A;  3IG1 A;  3UIQ A;  4DU1 A;  4I2P A;  3OY9 A;  1KVA A;  5J1E A;  5KTQ A;  1L5U A;  4PQU A;  4QCL A;  4BE2 A;  1S5J A;  4DFK A;  4AH9 A;  1ASU A;  3AA3 A;  4WE1 A;  4CGD A;  4CJE A;  4AIL C;  1W9H A;  4DF4 A;  4B9M A;  4FM1 A;  1YTU A;  2QK9 A;  3C95 A;  2G8H A;  4K8X A;  3RR7 A;  4DTX A;  4Z4G A;  4CJP A;  1N5Y A;  3L2U A;  1T7P A;  1BIS A;  1WSH A;  1KVB A;  3K5M A;  5FRO A;  3VQA A;  3TAG A;  4W5O A;  4AHS A;  3VQ9 A;  5J2P A;  1NK4 A;  3ZSW A;  3QEX A;  2OYQ A;  1UOC A;  4LD0 A;  1HRH A;  1QE1 A;  1LWF A;  3T3F A;  4BWJ A;  1TK0 A;  1JLA A;  3AVM A;  4UQG A;  4FYD A;  1RDD A;  1S6P A;  3ITH A;  4JLH A;  1HYZ A;  1IH7 A;  4DF8 A;  3MXM A;  2KFN A;  3LWM A;  2O4G A;  2E6L A;  1EXQ A;  3LDS A;  3SUN A;  4CJW A;  2HB5 A;  1B92 A;  1JKH A;  4B08 A;  1XHZ A;  1IKV A;  3P5J A;  1Q8I A;  4HUE A;  1WN7 A;  4CGJ A;  3VQ6 A;  5C42 A;  1IKX A;  3OYK A;  2IOC A;  4FK4 A;  4LSL A;  3OJS A;  4E7J A;  4DTJ A;  3DMJ A;  1WSF A;  3U3Y A;  2G8W A;  4BDY A;  2G8K A;  4DWI A;  4M3U A;  1NK8 A;  1VRU A;  4QAG A;  3SNN A;  1S6Q A;  2E6M A;  3DRR A;  4CEF A;  2Y1J A;  4C8L A;  1JLE A;  1VSM A;  1MU2 A;  1GOC A;  1TKD A;  4OKE A;  5CYM A;  1SL2 A;  1X1P A;  4DFM A;  4BDP A;  3CQ8 A;  1JLG A;  1RBR A;  3ZSY A;  1X9M A;  3LAM A;  1Q9Y A;  2RF2 A;  1RBV A;  2Z1J A;  4PA1 A;  3RMC A;  3HK2 A;  1REV A;  5J2N A;  2XY7 A;  4KI4 A;  1BIZ A;  3C94 A;  1U47 A;  1HYS A;  4MFB A;  1JLC A;  1S1T A;  4LH4 A;  2KTQ A;  4OVL A;  1BI4 A;  1NOZ A;  4BWM A;  4KHY A;  1C0U A;  4CHP A;  1TAU A;  3V9W A;  3RTV A;  1WSE A;  2X78 A;  3BGR A;  3DLR A;  5HRP A;  1X9S A;  1A5V A;  4DTU A;  1SL0 A;  3QO9 A;  4HUG A;  3EY1 A;  4M41 A;  2BGG A;  1XHX A;  2XY8 A;  3I0S A;  2FBX A;  1QSL A;  1VRT A;  4O44 A;  4JRQ A;  1IO2 A;  4Z4C A;  3M8Q A;  3QET A;  3SPZ A;  4RW7 A;  5E41 A;  3KLI A;  4O0I A;  4CJR A;  3ZT3 A;  3KLF A;  4KHQ A;  3U3G A;  3TAP A;  1U4B A;  1NK9 A;  4W5Q A;  3LP0 A;  4FM0 A;  3PO5 A;  1NK7 A;  1S1X A;  3PUF A;  3B6P A;  4ID5 A;  1HNI A;  2YNF A;  1JXE A;  5JS2 A;  4M45 A;  4E1N A;  3CFR A;  3DI6 A;  4CGG A;  4ZTJ A;  4DQI A;  4KB0 A;  1N6Q A;  4Z0U A;  2AJQ A;  4F4K A;  2B4J A;  1S9G A;  4FLX A;  3JYT A;  2O4I A;  1C1C A;  3ZSV A;  1BI4 B;  4FJI A;  3ZSX A;  1KFD A;  1QHT A;  5FRM A;  1JLF A;  4R5P A;  4E19 A;  2G8I A;  2YNG A;  2YKN A;  2Z1H A;  4ZHR A;  4CEQ A;  3EYZ A;  1I3A A;  3KLH A;  3VA3 A;  5JS1 A;  1NJX A;  3VQE A;  3V1O A;  3QES A;  4CK3 A;  3V9Z A;  1VSH A;  3SQ1 A;  1BCM A;  3HPH A;  5CZ2 A;  3V1R A;  3QNN A;  4FZZ A;  2OPP A;  3HP6 A;  3K5O A;  1HMV A;  1VSF A;  3JSM A;  3K5L A;  4BAC A;  4CIE A;  4DTN A;  3NF8 A;  1VSK A;  3VN5 A;  2DY4 A;  1F21 A;  3OYI A;  3ALY A;  3VQ4 A;  5HRO A;  1HQE A;  2IAJ A;  1B9F A;  1TKT A;  3HST B;  1CXU A;  1NJY A;  4FZY A;  3KK3 A;  2JLE A;  2X74 A;  2ZQB A;  1S9E A;  2IS3 A;  1KLM A;  4DU4 A;  5KRT A;  3L2V A;  3CYM A;  1LWE A;  3PX6 A;  4FW2 A;  3G0Z A;  4CEC A;  4CFC A;  3SI6 A;  3PO4 A;  3NDK A;  4CJ3 A;  4FK2 A;  4CER A;  4DQQ A;  3LPU A;  2P1J A;  3QER A;  1RDA A;  2RKI A;  4FJ9 A;  4ELT A;  4PY5 A;  3QIN A;  5KGX A;  3OYE A;  3DRS A;  4RW9 A;  1LWC A;  1A5W A;  1VK0 A;  3EZ5 A;  3NCI A;  3RMB A;  4N76 A;  1VSJ A;  4N56 A;  1LW2 A;  3NF9 A;  3OYB A;  3VQ8 A;  4CFA A;  1WSG A;  4ZTF A;  2KZM A;  3QEW A;  4FK0 A;  4F3T A;  3LWL A;  4KTW A;  4M3T A;  1CLQ A;  4HCB A;  4BE1 A;  4AHU A;  4W5T A;  3RMD A;  3SQ0 A;  3M8R A;  5HRS A;  3AA2 A;  4RW8 A;  4FLY A;  3V1Q A;  3TAN A;  4DSF A;  1L3U A;  1S1U A;  3MXI A;  1KFS A;  4FJN A;  1NJZ A;  1ZBH A;  2VWJ A;  3NF6 A;  2HW3 A;  3K58 A;  1RT3 A;  4DTR A;  4CJQ A;  1CXQ A;  5K14 A;  3KLE A;  1LAW A;  4CJ4 A;  1NK6 A;  1SKR A;  4L8R B;  4OLB A;  2ATQ A;  4B8C A;  1U04 A;  3OS1 A;  3NE6 A;  4JS5 A;  4E7L A;  1LV5 A;  1DTT A;  1G15 A;  1RT2 A;  3AVH A;  4C8N A;  1FK9 A;  4AHC A;  1TKX A;  4CHN A;  4E3S A;  3SCX A;  3LPT A;  2HHU A;  4LSN A;  3ZSR A;  3TAM A;  1WSI A;  4KPY A;  1HQU A;  1T05 A;  1DLO A;  1WAJ A;  1BL3 A;  1JL2 A;  3KKS A;  2PY5 A;  2OPR A;  2XRI A;  3PV8 A;  2F8S A;  1QSS A;  1BQM A;  2P5O A;  4DMN A;  4CJU A;  1U45 A;  4C8K A;  3RWU A;  3LP2 A;  3O4N A;  4OPK A;  3HM9 A;  3QEI A;  3SZ2 A;  3DLE A;  3CM5 A;  4KTZ A;  3OS0 A;  3OYL A;  3MEE A;  3T19 A;  2OZS A;  1B9D A;  2BAN A;  3V9U A;  2JGU A;  3K59 A;  1SKS A;  3LP1 A;  3F9K A;  1SUQ A;  4AHV A;  3A2F A;  4OKK A;  4RW6 A;  1Q9X A;  4CGI A;  3TWH A;  3I8D A;  4OLA A;  1Z25 A;  4CEZ A;  4EZ9 A;  5HRR A;  1RT5 A;  3MXJ A;  3DYA A;  1NK0 A;  4CES A;  3HJF A;  2HVI A;  4M3R A;  3ZSZ A;  2F96 A;  1C1B A;  4CGH A;  1RT4 A;  3ZSQ A;  3PY8 A;  3TAF A;  4M3X A;  3HP9 A;  3F73 A;  2BE2 A;  2W42 A;  1ZBU A;  4NYF A;  5HRN A;  3WNH A;  4CK2 A;  1BQN A;  2HNY A;  4O55 A;  4FJL A;  3SV3 A;  1UWB A;  4DFJ A;  1QS4 A;  1RBU A;  3QEP A;  3RRG A;  2YKM A;  2I5J A;  3TAE A;  1D8Y A;  4F2S A;  3VQ7 A;  3TR8 A;  1L3T A;  3L2Q A;  4FJX A;  2EX3 A;  2X6N A;  3O3G A;  4FJH A;  4FXD A;  3NH2 A;  2HVH A;  2WON A;  3OVN A;  1XC9 A;  1I39 A;  3AVC A;  4CHQ A;  1KCF A;  2R7Y A;  1TAQ A;  3G10 A;  2QKK A;  4F3O A;  1YVU A;  4Q0B A;  1QTM A;  4FJ5 A;  3VQP A;  2A1S A;  2OZM A;  2IDO A;  4O5B A;  1JL1 A;  3IAY A;  2HHQ A;  1ITG A;  3SUP A;  4G1Q A;  2B5J A;  3O3F A;  3LP3 A;  4DFP A;  4DSL A;  2OPQ A;  4JRP A;  2HND A;  3HYF A;  3V9S A;  1LW0 A;  2GV9 A;  2KW4 A;  4FW1 A;  4DQR A;  4B9N A;  1RDB A;  2XY5 A;  4FVM A;  3OYN A;  1UA0 A;  1L3V A;  1IKW A;  4CF8 A;  1GOA A;  4XIU A;  4OPJ A;  4E7H A;  4YNQ A;  3KJV A;  4AHT A;  2VWK A;  4NCG A;  4KV8 A;  4FLU A;  4O0J A;  1FXX A;  3RMA A;  4HCC A;  3L2W A;  4J2B A;  1QSY A;  3ASM A;  3NFA A;  3O4Q A;  4RW4 A;  1TK5 A;  3LAN A;  3L3U A;  3BDP A;  2VG7 A;  3KD1 E;  4CF1 A;  3AO3 A;  4B3O A;  4DTO A;  3L3V A;  3KKR A;  2HHT A;  3KTQ A;  4IFV A;  5J2Q A;  1T03 A;  2FBT A;  4IG0 A;  4GVM A;  1BHL A;  4RG8 A;  4I9L A;  2G8V A;  3NH0 A;  4Q5V A;  2OA8 A;  4PUO A;  2GUI A;  3SPY A;  1YTA A;  3H08 A;  4K8Z A;  5CYQ A;  4ID1 A;  4DS4 A;  1ZBL A;  5I3U A;  1J5O A;  4B9L A;  2G8U A;  1HJR A;  3HPG A;  4ELV A;  1Y97 A;  1U49 A;  2XHB A;  4E89 A;  3ZSO A;  1KRP A;  2YV0 X;  4LH5 A;  4B9U A;  5D3G A;  3CFP A;  4Z4E A;  4CHZ A;  2D0B A;  4B8A B;  3S3M A;  1UA1 A;  4CCH A;  4CF9 A;  3CG7 A;  1NKE A;  4IFY A;  3DLG A;  1RBT A;  4FLT A;  2Z1G A;  3NH1 A;  4JS4 A;  3WNE A;  2A1R A;  4O4G A;  4IKF A;  1D5A A;  3PX4 A;  3SV4 A;  3AVA A;  4Y1D A;  3KK2 A;  5HLF A;  4FJJ A;  4DTS A;  1S1V A;  3B6O A;  4KRF A;  3P83 D;  1D9F A;  4F8R A;  2XO7 A;  1KTQ A;  4IDK A;  4CFD A;  4N5S A;  3U6F A;  1NKB A;  3K2P A;  1RT1 A;  3P1G A;  3QIP A;  4DS5 A;  2X6S A;  5FDL A;  1RT6 A;  3VQD A;  4W5R A;  5C24 A;  3DRP A;  3V9X A;  2Y1I A;  4J2D A;  2KZZ A;  3M8S A;  1CZ9 A;  3TI0 A;  4F2R A;  2YNI A;  4CEA A;  3HXM A;  3FFI A;  4CEE A;  4NCB A;  3AVJ A;  3I0R A;  3O3H A;  1RDC A;  4NCA A;  5DMR A;  2ITG A;  4CJT A;  3KLG A;  4FLZ A;  3S9H A;  4KHS A;  1TL3 A;  3E01 A;  4H4M A;  1J53 A;  4DSE A;  2RN2 A;  2PYJ A;  4KTQ A;  4KFB A;  3CM6 A;  4FJK A;  4OGC A;  4KHW A;  1T8E A;  2OPS A;  4KHU A;  4W5N A;  4CIF A;  1ZBF A;  4MQ3 A;  4ICL A;  4YFU A;  3DLH A;  2ZE2 A;  3AVB A;  1RTJ A;  5KRS A;  3OYG A;  4M3Y A;  3HVT A;  3V4I A;  1RNH A;  4E7K A;  3MED A;  1RIL A;  5CZ1 A;  4CJL A;  4EP4 A;  2HHX A;  4KKO A;  3C6T A;  3L8B A;  1A5X A;  1DTQ A;  3TAR A;  2YHA A;  3VQ5 A;  3DOK A;  4OGE A;  2DTU A;  4H8K A;  5I42 A;  4KAZ A;  4DTP A;  4DSI A;  4DG1 A;  2NUB A;  2VG5 A;  1LAV A;  4FJG A;  3AO4 A;  2P51 A;  4FZX C;  4CF0 A;  3SQ4 A;  1TGO A;  4Z4I A;  3AVI A;  4E7I A;  1XI1 A;  4J2E A;  1TV6 A;  2DFF A;  3AO5 A;  4OJR A;  3SUQ A;  1UAX A;  2HHV A;  3NHG A;  4KHN A;  2EHG A;  2ETJ A;  1NJW A;  1RTI A;  3NGY A;  1GOB A;  4DSK A;  1EET A;  1RBS A;  1S1W A;  4CGF A;  4Z4H A;  2F8T A;  1QQC A;  1R0A A;  4GW6 A;  1FKP A;  3IS9 A;  4Z4F A;  1C0M A;  4GMJ B;  2DFE A;  3OYA A;  1WNS A;  3DOL A;  3T1A A;  3VQC A;  3QIO A;  3ULD A;  1IG9 A;  4M3Z A;  3QLH A;  4CJV A;  2GBZ A;  3AO1 A;  1FKO A;  1BCO A;  2HNZ A;  3SYZ A;  1VSI A;  3PX0 A;  5HBM A;  3THV A;  1KLN A;  4CE9 A;  3QNO A;  1NKC A;  4I7F A;  3AVG A;  3MAQ A;  3KK1 A;  4DQS A;  1ZYQ A;  2IC3 A;  4CJF A;  3LAL A;  4C8M A;  4FLV A;  4N41 A;  2ZD1 A;  4M3W A;  1SL1 A;  1BGX T; 
#chains in the Genus database with same CATH topology
 3UE5 A;  2WC9 A;  4BRG A;  4EHT A;  2A5X A;  3AVL A;  2UXB K;  3OYJ A;  5HP1 A;  3C6H A;  4OKJ A;  1EP4 A;  4C1N K;  4Y1C A;  3KVG A;  3OYC A;  3VEW A;  4ISE A;  2YHB A;  3OYH A;  3GOI A;  4E0D A;  4CJK A;  3EO3 A;  3NF7 A;  3OS2 A;  4KH4 A;  3SQ2 A;  3AA5 X;  3HO1 A;  3VEY A;  4DLE A;  4C8O A;  1J6Z A;  1J54 A;  3ENB A;  1NGA A;  2IGI A;  3C6U A;  4M7X A;  1NMD A;  4DLG A;  3LDO A;  5EU7 A;  2P9U A;  1EX4 A;  2P5G A;  3NGI A;  3KD5 E;  4K25 A;  2XY6 A;  3CI5 A;  2YX6 A;  2FBY A;  1HNV A;  2Q1N A;  3CFO A;  4JAX A;  1Q81 O;  3P38 A;  4IXC A;  4FLW A;  5FPM A;  4BDZ A;  5GAE P;  4EZ6 A;  1Z26 A;  3AV9 A;  3D0P A;  4JKG B;  4WQ4 A;  1S22 A;  1YF5 L;  2D0C A;  3OJU A;  3FZH A;  2NRX A;  3ZT1 A;  1XMO K;  2G8F A;  5FRN A;  4DQP A;  1L3S A;  2B6A A;  1IV0 A;  4CIG A;  5SWM A;  3AVK A;  5KGW A;  1XWL A;  4FCY A;  3MCA B;  3ULE A;  3S3N A;  4JI3 K;  4YDU C;  3THX B;  3ZCM A;  5FPN A;  4BGA A;  1JLQ A;  1HYV A;  3IG1 A;  3UIQ A;  3U9Z A;  5GAD P;  3OY9 A;  1KVA A;  1T44 A;  5KTQ A;  3THY A;  1S5J A;  5AQG A;  4DFK A;  1ASU A;  2QK9 A;  4B9M A;  4FM1 A;  1IBK K;  3O5B A;  2A3Z A;  4K8X A;  5IT9 O;  3RR7 A;  4CZH A;  4DV0 K;  1GLL O;  4PHT X;  5FRO A;  3TAG A;  4W5O A;  4AHS A;  3RVC A;  3ZSW A;  1KQS M;  2WFB A;  1HRH A;  1QE1 A;  3T3F A;  1KAZ A;  4FWP A;  1KD1 O;  5JLF A;  1VQ6 N;  4IOX A;  2Q0U A;  1IH7 A;  1BO5 O;  3SUN A;  1JKH A;  3P5J A;  1Q8I A;  4HUE A;  3SBT A;  4JKH A;  4JHD B;  4K43 A;  4FK4 A;  4E7J A;  2G8K A;  1Y64 A;  3DRR A;  2D1K A;  1Q82 O;  3CC2 N;  4OKE A;  3N4Q A;  1Q9Y A;  3WQU A;  1GLC G;  3HK2 A;  2O8E A;  1BIZ A;  3LDN A;  4FWQ A;  4DHY A;  1NOZ A;  4BWM A;  1C0U A;  1HKC A;  3BF1 A;  3V9W A;  1P8Z A;  3QDK A;  5AQS A;  4DTU A;  1SL0 A;  3AGK A;  3EY1 A;  4M41 A;  1OVY A;  2P9N B;  3I0S A;  4BR9 A;  2ZGY A;  4BR2 A;  2IVO A;  4FWK A;  2VGM A;  4Z4C A;  3ZT3 A;  3U3G A;  3TAP A;  4DV6 K;  3O4W A;  4W5Q A;  3I33 A;  4FM0 A;  1S1X A;  2UXD K;  4Z94 A;  1JXE A;  4IEE A;  3GG4 A;  3DI6 A;  4CJ7 A;  4ZTJ A;  1N6Q A;  3NVM A;  4O8K A;  1S9G A;  4WYB A;  1ATN A;  3A8Y A;  3ZSV A;  1D4X A;  4FJI A;  3ZSX A;  1QHT A;  5FRM A;  4CEQ A;  3KLH A;  5ADX A;  2P9P A;  4CK3 A;  1VSH A;  1BCM A;  3HPH A;  5CZ2 A;  2NRT A;  2OCE A;  4XH5 A;  3JSM A;  4BRQ A;  2WTU A;  3D6R A;  3NF8 A;  1VSK A;  5AFU A;  2F9W A;  4FZY A;  3E66 A;  3KK3 A;  3A5L C;  2X74 A;  1S9E A;  3I55 N;  3UKR B;  3L2V A;  3H1V X;  3CYM A;  3WQT A;  4CFC A;  3SI6 A;  3VEX A;  4IDH A;  4PY5 A;  5AQF A;  3DRS A;  1MWM A;  1LWC A;  4G9Z A;  1VK0 A;  2V7Y A;  4IOC L;  1KXP A;  1VSJ A;  3NF9 A;  4ZTF A;  4KH5 A;  1DGK N;  3QEW A;  5HOO A;  4RWT A;  1YJN N;  1CLQ A;  3SQ0 A;  4W5T A;  3RMD A;  3LDP A;  4NLC A;  4CW7 B;  3TAN A;  1S1U A;  1KFS A;  1NJZ A;  1ZBH A;  3NF6 A;  2HW3 A;  4DTR A;  3CCQ N;  4CJQ A;  5K14 A;  4IWV A;  3KLE A;  2RHK A;  3SAG A;  2ATQ A;  1JCF A;  3NE6 A;  3OS1 A;  4JS5 A;  4R79 A;  1FK9 A;  3H6E A;  4MDA A;  3TAM A;  1HQU A;  5BRF A;  3PIO L;  1DLO A;  3OHR A;  2PY5 A;  3MDQ A;  4DMN A;  3LP2 A;  5AZI B;  4OPK A;  1X9J A;  3DLE A;  3CM5 A;  3OS0 A;  1VQ7 N;  2BAN A;  2A41 A;  5EX5 A;  4CGI A;  4BRK A;  3DWL A;  3TWH A;  1O13 A;  2E1Y A;  3MXJ A;  2F96 A;  3TAF A;  3HP9 A;  4JI5 K;  2BE2 A;  3KWG A;  4CK2 A;  2P9L B;  4YOU A;  4H5T A;  2QM1 A;  4F2S A;  1NBW A;  3VQ7 A;  3TR8 A;  3L2Q A;  3BZC A;  3O3G A;  2HVH A;  2R7Y A;  2QKK A;  3CPW M;  4BRH A;  1YVU A;  1QTM A;  4FJ5 A;  2A1S A;  4JKC A;  1QHA A;  2IDO A;  3WXJ A;  4H0X B;  4WFB L;  1ITG A;  3SUP A;  4G1Q A;  5F2R A;  4MLE A;  1NGE A;  5AQL A;  3HYF A;  5EOY A;  4QS8 A;  1LW0 A;  4FWR A;  4CZE A;  2XY5 A;  1L3V A;  4FSV A;  1IKW A;  3H3N O;  4XIU A;  4E7H A;  4NCG A;  4O0J A;  4DQ8 A;  4RW4 A;  4A2B A;  4DTO A;  4DB3 A;  1ESV A;  3KTQ A;  2HHT A;  1NGI A;  4RG8 A;  3NH0 A;  4BQL A;  2GUI A;  3SPY A;  1XC3 A;  4DS4 A;  5I3U A;  4B9L A;  4LF8 K;  3ZET B;  4EFH A;  1U49 A;  3RSE A;  1KRP A;  3BF3 A;  3CFP A;  1XNQ K;  3VEO A;  3L4I A;  4Z4E A;  3VET A;  3J80 O;  2YI1 A;  4K42 A;  3HRG A;  4O4G A;  3CCL N;  1D5A A;  3Q7C A;  3SV4 A;  3AVA A;  4DTS A;  3B6O A;  3E1Y A;  4JI4 K;  1KTQ A;  2XO7 A;  1W2B M;  1YJW N;  3U6F A;  1W7A A;  3G4S N;  2W40 A;  4B3R K;  2BH1 A;  1RT6 A;  2Y1I A;  4GVE A;  3Q7B A;  2YNI A;  3AVJ A;  3I0R A;  3O3H A;  4PKI A;  3ZX3 A;  3S9H A;  3E01 A;  4OGC A;  4MQ3 A;  3CCJ N;  2P9K A;  4PKH A;  1VQK N;  3CME N;  4BRA A;  5KRS A;  1WBB A;  4YDU A;  2KKZ A;  2WUS A;  4DKW A;  4BRD A;  3QML A;  3D2E B;  4I6M A;  4KKO A;  3C6T A;  3TAR A;  4OGE A;  2ZWH A;  4U67 L;  3CCR N;  5E26 A;  2P51 A;  5AQN A;  1MA9 B;  1TGO A;  3AVI A;  4E7I A;  1UAX A;  4KHN A;  2J4R A;  2ETJ A;  1NJW A;  3HSC A;  1GOB A;  4BG8 A;  3M1F A;  4K41 A;  3CPE A;  2W41 A;  3O80 A;  4BR5 A;  3QIO A;  1IG9 A;  4V19 S;  5AQT A;  3PX0 A;  1T6D A;  3QNO A;  4DQS A;  3H3O B;  4FLV A;  2ZD1 A;  1BGX T;  1VQO N;  4PWD A;  1ZBI A;  3TAB A;  2VG6 A;  4ELU A;  5KPZ A;  3GDQ A;  2FC0 A;  4OPA A;  3AVN A;  2KFZ A;  1X9W A;  4JK8 A;  4GY2 B;  3ZEU A;  1VSE A;  2QWQ A;  4DR3 K;  2YJF A;  4LF7 K;  3KHY A;  4M42 A;  1RT7 A;  3ZT2 A;  3OYD A;  1K6Y A;  5EXW A;  2YHW A;  2LSN A;  2HMI A;  4MLH A;  4H5V A;  3I56 N;  4B9S A;  3HL8 A;  2RPI A;  4CK1 A;  5F0X A;  3WNF A;  3VQB A;  4WF9 L;  3DLB A;  1S72 N;  4CBW A;  3AGR A;  4CFB A;  3SJJ A;  4DSJ A;  5TKW A;  4CEO A;  1RTH A;  4DV3 K;  3AA4 A;  2UUA K;  2NLX A;  1J9A A;  3SUO A;  1MDU B;  5KQD A;  2YCH A;  4B9Q A;  3KK7 A;  4CEB A;  1M90 O;  5LMU K;  1OH5 A;  4DUY K;  2BUP A;  1RTD A;  4HUF A;  1ASV A;  4CED A;  1BDG A;  1U2V B;  3MEC A;  1N34 K;  1S3X A;  2P9S A;  4TSX A;  1KSP A;  4CF2 A;  5KQ8 A;  3OYF A;  3KIO A;  1G99 A;  2Q36 A;  3S3O A;  1ASW A;  3KZB A;  4Y0W A;  3LZJ A;  3LAK A;  5M1N A;  4B9V A;  4C1N I;  2CGL A;  2AP1 A;  3F2K A;  5BRD A;  1FJG K;  1W0H A;  1EKE A;  1N32 K;  4PQU A;  4QCL A;  4BE2 A;  4AH9 A;  3AA3 A;  4CJE A;  4AIL C;  1YTU A;  4BRP A;  1OH8 A;  2YJE A;  3C95 A;  2ZF5 O;  4DTX A;  3FZM A;  3MK6 A;  1T7P A;  1BIS A;  1NK4 A;  3HI0 A;  1NGC A;  3VQA A;  3K5M A;  5J2P A;  3CCE N;  3WXK A;  3QEX A;  4JI0 K;  4LD0 A;  1LWF A;  1TK0 A;  3AVM A;  1NLV A;  3BP8 A;  1RDD A;  3L6Q A;  1WB9 A;  4KH6 A;  1C0G A;  3DXM B;  3MXM A;  2V52 B;  1HKG A;  3LWM A;  1EXQ A;  4B08 A;  2CH5 A;  1WN7 A;  1IKX A;  3OYK A;  2IOC A;  1NG9 A;  3U3Y A;  3DMJ A;  4M3U A;  3SNN A;  1S6Q A;  3CQY A;  3CD6 N;  1JLE A;  1MU2 A;  3J7Y P;  1IBM K;  5CYM A;  4BDP A;  1JLG A;  1RBR A;  3EKS A;  2FSK A;  2RF2 A;  5AZJ B;  1N8R O;  1RBV A;  4PA1 A;  3RMC A;  5J2N A;  3C94 A;  3HZ6 A;  4MFB A;  4LH4 A;  4JD2 A;  1BI4 A;  3IMX A;  1ZBS A;  1T3V A;  1YJ9 N;  3PLA A;  4CHP A;  2CH6 A;  1WSE A;  1Z05 A;  3BGR A;  1X9S A;  3IDH A;  5BPM A;  2PAV A;  3DJC A;  3E9P A;  4BC4 A;  2FBX A;  3BZK A;  4O44 A;  4JRQ A;  1OVQ A;  3M8Q A;  3QET A;  3KLI A;  4O0I A;  3KLF A;  1HR0 K;  2O8B A;  4BRI A;  4B1U B;  1NK9 A;  3VGM A;  3LP0 A;  4IEI A;  3B6P A;  4ID5 A;  4OPH A;  4M45 A;  4E1N A;  2JWK A;  2W6L A;  1TYQ A;  4CGG A;  4DQI A;  4Z0U A;  2AJQ A;  5AR0 A;  5GAG P;  4YOY A;  2O8C B;  4DR4 K;  3FFK B;  4R5P A;  3DXK B;  4E19 A;  2YKN A;  2H3G X;  4QS9 A;  3VQE A;  3V1O A;  4JI6 K;  3V9Z A;  2QI2 A;  4FL9 A;  3SQ1 A;  3V1R A;  4BRN A;  4FZZ A;  3HP6 A;  4IJA A;  3K5L A;  3O9U A;  4DTN A;  4K0K K;  4FOI A;  2DY4 A;  4EAH D;  5HRO A;  2P9I A;  2IAJ A;  1TKT A;  2HF4 A;  4BR7 A;  2JLE A;  2RE2 A;  2IS3 A;  5KRT A;  1XMQ K;  5FPE A;  5AQH A;  3O08 A;  2HOE A;  4BC5 A;  4FW2 A;  2OTJ N;  4CJ3 A;  2P1J A;  3HOT A;  3P4I A;  2RKI A;  4ELT A;  4BGB A;  5KGX A;  1OKJ A;  3EZ5 A;  3G6E N;  3NCI A;  3OYB A;  3O8M A;  3CJC A;  1NGD A;  4H5R A;  3LM2 A;  4AQY K;  4YOV A;  4XH4 A;  1GLB G;  3LWL A;  2F7T A;  4KTW A;  2F4V K;  3VTI A;  2EWS A;  4FLY A;  5JVG L;  2VWJ A;  3JAM O;  1RT3 A;  1CXQ A;  3C7N A;  4PL7 A;  1LAW A;  4L8R B;  1YAG A;  1SKR A;  4B8C A;  4B3M K;  1DEJ A;  1RT2 A;  3GE1 A;  4C8N A;  3SCX A;  1TKX A;  4E3S A;  3D2F B;  4KPY A;  3CCM N;  4BY9 C;  2I7P A;  1BL3 A;  3KKS A;  2F8S A;  2OPR A;  4KHP K;  1QZ6 A;  3HM9 A;  1HX1 A;  4KTZ A;  5AQV A;  3MN6 A;  3MEE A;  3T19 A;  4MO5 A;  2HBM A;  3LM9 A;  3VPZ A;  2JGU A;  3OA9 A;  4BRL A;  1SKS A;  3F9K A;  1SUQ A;  4AHV A;  4RW6 A;  2VQE K;  1Z25 A;  4EZ9 A;  5HRR A;  5GIO A;  1NK0 A;  4CES A;  4M3R A;  4CGH A;  3PY8 A;  1RT4 A;  5AQU A;  3SBG A;  3PSI A;  2O8D A;  3L4Q A;  4JN4 A;  4NYF A;  3K9J A;  5HRN A;  1BQN A;  2QWO A;  3IUC A;  1UWB A;  1GLD G;  3RRG A;  2AA4 A;  2YKM A;  2I5J A;  3TAE A;  2P9K B;  3O9R A;  3I8B A;  2WON A;  1I39 A;  1KCF A;  4F3O A;  3QFP A;  2GEL A;  3O1B A;  4O5B A;  4I6M B;  5LMN K;  4X65 K;  3IAY A;  3LP3 A;  4DSL A;  3OBW A;  2OPQ A;  1XQS C;  3V9S A;  4FW1 A;  3O9S A;  4DQR A;  1RDB A;  4WCE L;  5M1O A;  3OYN A;  1UA0 A;  4OPJ A;  4RCH A;  4YNQ A;  4AHT A;  1ATS A;  4KV8 A;  1NGG A;  4J2B A;  1QSY A;  5BN8 A;  1GLJ O;  3NFA A;  1TK5 A;  1NGF A;  3L0Q A;  5BRH A;  1BWF O;  3D7E O;  2VG7 A;  3AO3 A;  2D0P A;  3KKR A;  2ZJQ L;  4IFV A;  4GVM A;  4BVP A;  3CJ1 A;  5KPT A;  3MN7 A;  3SMS A;  2ZJP L;  4LF6 K;  1GLF O;  1OH6 A;  1HJR A;  4E89 A;  3ZSO A;  5D3G A;  4M7Y A;  1NU0 A;  3CJ7 A;  4CHZ A;  3S3M A;  4CCH A;  4CF9 A;  5M1Q A;  3H46 O;  3DLG A;  1RBT A;  1EWQ A;  1Z6R A;  2IVN A;  2Z1G A;  2UYT A;  4ISG A;  3TSU A;  5AQI A;  2Q2R A;  1S1V A;  2UU9 K;  3AAR A;  4H03 B;  5CR4 A;  3SMP A;  4A2A A;  4E1J A;  2ITM A;  4CFD A;  4LF4 K;  3P1G A;  3QIP A;  4DS5 A;  2X6S A;  3VQD A;  1RDU A;  4A61 A;  4DV1 K;  3QFU A;  3M8S A;  2UXC K;  3O9Q A;  4IO8 A;  3R1X A;  4FWN A;  4NCB A;  3KWI A;  5DMR A;  1J53 A;  3T69 A;  2RN2 A;  2PYJ A;  4KTQ A;  4KHW A;  2FLO A;  4DCH A;  1TUU A;  4W5N A;  4CIF A;  3HBT A;  1NGH A;  1SAZ A;  3DLH A;  4GV3 A;  1RDW X;  3MED A;  4CD1 A;  3L8B A;  1DTQ A;  2P9S B;  2DTU A;  3DOK A;  3M3Z A;  4DV5 K;  4BC2 A;  3WEE B;  4H8K A;  4KAZ A;  3AY9 A;  3K9K A;  3AAP A;  3CF5 L;  1SS6 A;  1IBL K;  4CF0 A;  4Z4I A;  4J2E A;  3AO5 A;  4OJR A;  2VYP A;  4LC9 B;  4QS7 A;  4B1X B;  1RTI A;  4DSK A;  4HWI A;  1S1W A;  1FKP A;  4Z4F A;  3TTF A;  3DOL A;  3QBX A;  1W97 L;  3ULD A;  4M3Z A;  3IFR A;  4YHH K;  2GBZ A;  1FKO A;  2HNZ A;  4WFN L;  3SYZ A;  1VSI A;  3THV A;  4CE9 A;  1NKC A;  3AVG A;  1ZYQ A;  3KK1 A;  4CJF A;  4C8M A;  1QVG M;  4N41 A;  3MX5 A;  5EVZ A;  1SL1 A;  5AQX A;  4IZ9 A;  2VCP A;  4A59 A;  1C6V A;  4WQ5 C;  4J2A A;  1JXB A;  3MN9 A;  3NBP A;  4A57 A;  4IG3 A;  5J2M A;  4U7B A;  3LZI A;  4JKE A;  4F9O A;  1HPZ A;  3M6G A;  1T03 A;  4JKG A;  1K8K B;  2GX9 A;  3TAQ A;  3VTH A;  3K57 A;  3RR8 A;  4YOW A;  1SKW A;  4FJ8 A;  4CZL A;  3L2R A;  4CHY A;  2UUB K;  4B9T A;  2NRZ A;  1CZA N;  4CZK A;  1N33 K;  1RCH A;  3EN9 A;  2HHW A;  3EEQ A;  5C2F A;  4LF5 K;  5KI6 A;  3UKU B;  4H4O A;  1ILY A;  4IOA L;  2QWN A;  4LY7 A;  3THX A;  3BEX A;  3V81 A;  2QXF A;  3EE8 A;  3V6D A;  3C0B A;  3IRX A;  4FM2 A;  2FBV A;  1VSL A;  2YNH A;  5AQW A;  2O8F A;  5DK5 A;  2Q97 A;  3SAH A;  3VQQ A;  4X62 K;  2ZJR L;  1U48 A;  4CJ5 A;  1IKY A;  3MEG A;  3JS6 A;  2PBD A;  3WUH A;  3K5N A;  3CJ9 A;  3MCP A;  4DU3 A;  1WLJ A;  5AQJ A;  4FJM A;  1VAZ A;  3NMU A;  4NXM K;  5C25 A;  1TK8 A;  3VEN A;  4HHT A;  2Q3S A;  1EO1 A;  4CBX A;  1VSD A;  2P9U B;  4KO0 A;  2PYL A;  5BPL A;  5AJ3 K;  3HT3 A;  3RRH A;  2D0A A;  4RTF D;  3HPO A;  3ISN C;  3PSF A;  2BDP A;  2E2P A;  4JHD A;  5SZT A;  3FR0 A;  5M1K A;  4BRE A;  5J1E A;  4BRF A;  5AQO A;  1L5U A;  2E1Z A;  2FSJ A;  4CGD A;  2HBL A;  4DF4 A;  1W9H A;  2G8H A;  1HNX K;  2V7Z A;  4CJP A;  4O5F A;  1N5Y A;  4JV5 K;  4A5B A;  3VQ9 A;  1BUP A;  3ZX0 A;  4H0V B;  5AQM A;  2CGJ A;  2E88 A;  3CJB A;  3CJA A;  3W3D A;  4JLH A;  1KC8 O;  3CCV N;  4GKJ K;  3R6M A;  2KFN A;  3ULE B;  2O4G A;  4YOT A;  2HB5 A;  1B92 A;  1XHZ A;  2P9N A;  3U8X A;  3VQ6 A;  1K9M O;  2DPN A;  3VER A;  5C42 A;  2D0O A;  4LSL A;  4DTJ A;  3THY B;  1VRU A;  4QAG A;  3TPQ A;  3UB5 A;  2E6M A;  4CEF A;  2KHO A;  4C8L A;  1VSM A;  5CE3 A;  1GOC A;  3CQ8 A;  4H0O A;  2W6K A;  2Z1J A;  1REV A;  2NRW A;  1U47 A;  1S1T A;  3VEZ A;  4KHY A;  5C15 A;  3RTV A;  2X78 A;  1ZC6 A;  3DLR A;  5HRP A;  1A5V A;  3QO9 A;  4HUG A;  1XHX A;  2XY8 A;  1NGJ A;  1VRT A;  1HNW K;  3FE1 A;  4H5N A;  1IO2 A;  1NMN A;  1QQN A;  4RW7 A;  5E41 A;  4CJR A;  1N36 K;  4KHQ A;  1U4B A;  5JLH A;  3PO5 A;  1NK7 A;  4OX9 K;  2YNF A;  5JS2 A;  3UKR A;  4AM7 A;  1VQ9 N;  4KB0 A;  4F4K A;  2B4J A;  4FLX A;  2O8D B;  2O8E B;  4JI2 K;  2O4I A;  1I94 K;  2V51 B;  3F9M A;  1JLF A;  3THW A;  2G8I A;  2YNG A;  3VGL A;  4ZHR A;  1I3A A;  4CZI A;  5JS1 A;  3QES A;  2NRV A;  2E8A A;  4A5A A;  4H5W A;  1HMV A;  1VSF A;  4GNI A;  1ATR A;  4CIE A;  4FPB A;  1F21 A;  3VQ4 A;  1B9F A;  3HST B;  2HHH K;  1QQO A;  1NJY A;  3FLC O;  2ZQB A;  4DU4 A;  3EZW A;  5M1P A;  5B8H A;  3CET A;  1LWE A;  3G0Z A;  3PO4 A;  3NDK A;  2FF3 B;  3LPU A;  3QER A;  1V4T A;  3OYE A;  1P90 A;  1A5W A;  3A5M C;  3RMB A;  4N56 A;  1LW2 A;  4CZM A;  3VQ8 A;  4CFA A;  4JYA K;  2P9P B;  2PFU A;  5AZI A;  4DR5 K;  1EWR A;  4FK0 A;  4FOE A;  4M3T A;  4JKB A;  4FVU A;  4BE1 A;  3VES A;  4B1Y B;  3CQX A;  4FWM A;  4B1W B;  1L3U A;  1JCG A;  3WT0 A;  3K58 A;  1BA0 A;  4JK7 A;  3TSP A;  3NVK A;  1V4S A;  3MX2 A;  2A40 A;  4CJ4 A;  3DLL L;  4OLB A;  2P9L A;  3AVH A;  4CHN A;  4MO4 A;  3LPT A;  2HHU A;  1BOT O;  1DKG D;  2HBJ A;  1T05 A;  1WAJ A;  4LFA K;  1JL2 A;  3MN5 A;  3PV8 A;  4H0Y B;  2P5O A;  4DR6 K;  4CJU A;  3RWU A;  3O4N A;  1SZ2 A;  3P39 A;  5JVH L;  2OZS A;  3V9U A;  4BR0 A;  3A2F A;  4OKK A;  2OAN A;  4CI6 A;  1RT5 A;  4O8U A;  3ZSZ A;  1C1B A;  1BU6 O;  3F73 A;  5LJW A;  2W42 A;  3CC7 N;  4FPA A;  3WNH A;  4YY3 K;  2HNY A;  4O55 A;  3FZK A;  4FJL A;  4DFJ A;  4NB4 A;  1L3T A;  2X6N A;  3NH2 A;  3OVN A;  1XC9 A;  4YOR A;  1TAQ A;  4EIA A;  5I9E B;  3HOS A;  4YOX A;  3O1W A;  3J81 O;  3ENH A;  3MMV A;  2FF6 A;  2B5J A;  3ZET A;  1HJO A;  4NLB A;  1BG3 A;  4JRP A;  2HND A;  5C12 A;  1T6C A;  5IWA K;  3PIP L;  4IO9 L;  4FVM A;  3VGK A;  3T1Y K;  3KJV A;  2VWK A;  3BUZ B;  3BY5 A;  4HCC A;  1FXX A;  3L2W A;  4FWL A;  2WBN A;  4GKK K;  3L3U A;  3BDP A;  3J7Z O;  4B3O A;  4WQ5 A;  4DR2 K;  3L3V A;  2HBK A;  2FBT A;  2G8V A;  2OA8 A;  4PUO A;  4JEP A;  1YTA A;  3H08 A;  4K8Z A;  5CYQ A;  1ZBL A;  2G8U A;  3HPG A;  1Y97 A;  5FPD A;  2QWL A;  2VWB A;  2GWJ A;  1HKB A;  2D0B A;  3R8E A;  1UA1 A;  1XUP O;  1NKE A;  4FLT A;  3NH1 A;  4JS4 A;  2A1R A;  3DAW A;  4JK9 A;  4Y1D A;  3KK2 A;  4FJJ A;  2ZGZ A;  5A2Q O;  3P83 D;  1D9F A;  3W0L A;  4F8R A;  4IDK A;  4JI1 K;  2QA4 N;  1NKB A;  1RT1 A;  3D2E A;  5FDL A;  4W5R A;  5C24 A;  1XNR K;  2E2O A;  1CZ9 A;  1NM1 A;  3P31 A;  3TI0 A;  1X3M A;  1HLU A;  1RDC A;  3RSE B;  4NCA A;  5C2D A;  3KLG A;  4FLZ A;  4KHS A;  1TL3 A;  4H4M A;  4JKD A;  5AQQ A;  4DSE A;  4KFB A;  4FJK A;  3SJH A;  1ZXO A;  2OPS A;  4KHU A;  1ZBF A;  4CVN E;  2O8F B;  4YFU A;  2ZE2 A;  3CIP A;  2NRH A;  2QWM A;  3OYG A;  1NGB A;  4M3Y A;  3ENO A;  1RNH A;  3O6W A;  5CZ1 A;  4CJL A;  5ADX H;  2YHA A;  3VQ5 A;  3GL1 A;  3OBY A;  5I42 A;  4BRC A;  4ISF A;  4DTP A;  1YUW A;  4PL8 A;  4WFA L;  1LAV A;  3MWT A;  3AO4 A;  3SQ4 A;  3N4P A;  5AFU H;  2DFF A;  2HHV A;  5BR8 K;  4Z4H A;  4GW6 A;  3IS9 A;  1C0M A;  2F9T A;  5E84 A;  4GMJ B;  2DFE A;  2E2Q A;  5AQK A;  1WNS A;  3VQC A;  5JIC A;  3R9P A;  3QLH A;  3VOV A;  3VF2 A;  5HBM A;  3HM8 A;  4LFC K;  4I7F A;  3LL3 A;  1U6Z A;  3LAL A;  3LDQ A;  1QSS A;  4F2R A;  1O1W A;  2E4L A;  3IKM A;  3ID8 A;  4X64 K;  2HHS A;  3AVF A;  1JCE A;  4DR1 K;  1C0T A;  3D45 A;  1IJJ A;  3C6A A;  1KAX A;  4QOZ B;  4BE0 A;  1TKZ A;  3M8P A;  3T1H K;  1TL1 A;  5AQP A;  4NYN A;  3ZT4 A;  1WBD A;  3NGZ A;  5AQZ A;  3G25 A;  1NOY A;  1VQ4 N;  1U2V A;  5LY3 A;  5T7B A;  5CY4 A;  2Z1I A;  1NK5 A;  3U4L A;  4DTM A;  2D5R A;  4JI8 K;  1YI2 N;  4I9Q A;  1YT3 A;  4IBN A;  1YHQ N;  1VHX A;  3EL2 A;  4X66 K;  4EP5 A;  4BC3 A;  1WSJ A;  1KVC A;  1GLA G;  1SV5 A;  3DM2 A;  2QKB A;  1WAF A;  2E2N A;  4CJS A;  1C0F A;  1C1A A;  3HVR A;  4CHO A;  3AAQ A;  3LDL A;  3QEV A;  4KB1 A;  4LF9 K;  4IJN A;  2WOM A;  1VQN N;  3ZEU B;  3TSQ A;  4AHR A;  4KRE A;  4I2Q A;  4HTU A;  3OYM A;  2KQ2 A;  1LCU A;  1JLB A;  4FJ7 A;  1J5E K;  3AO2 A;  1CZB A;  5KPR A;  2D4W A;  3ZT0 A;  1NWK A;  4HVJ A;  2DFH A;  4E1M A;  3WNG A;  1D9D A;  5HL7 L;  3DXM A;  3VA0 A;  4KI6 A;  5BRE A;  1TVR A;  3DLK A;  4FWS A;  1BIU A;  3NAE A;  3THW B;  2KLA A;  2PZS A;  4N47 A;  3O9T A;  4NO7 A;  3ZX2 A;  2GEM A;  4DR7 K;  4DU1 A;  4I2P A;  1SQK A;  4NXN K;  2BTF A;  1K8A O;  1HUX A;  4FO0 A;  4WE1 A;  3B8A X;  1Q18 A;  5DM7 L;  3CCS N;  4Z4G A;  1WUA A;  3L2U A;  1WSH A;  1KVB A;  3TU5 A;  5AZJ A;  4FWO A;  2ASP A;  2OYQ A;  1UOC A;  1VQM N;  4BWJ A;  4LFB K;  1JLA A;  4UQG A;  4FYD A;  1S6P A;  4CZJ A;  3ITH A;  1VQ8 N;  4B3S K;  1HYZ A;  2E5L K;  4DF8 A;  2ASO A;  2GUP A;  2E6L A;  3LDS A;  4CJW A;  1IKV A;  4CGJ A;  3HTV A;  5C10 A;  4DV4 K;  3OJS A;  2G8W A;  1E4F T;  1WSF A;  4BDY A;  4DWI A;  1NK8 A;  2Y1J A;  2YHX A;  4HTL A;  1RFQ A;  2UUC K;  2QTD A;  1TKD A;  1SL2 A;  1X1P A;  5H1S Q;  4DFM A;  4ILH A;  1X9M A;  5FLX O;  3ZSY A;  3LAM A;  4KI4 A;  2XY7 A;  1HYS A;  4H0P A;  1JLC A;  4XH1 A;  1NNE A;  2KTQ A;  4OVL A;  4CD3 A;  1IG8 A;  2O8C A;  3ATV A;  3ZYY X;  1TAU A;  3DXK A;  4AF1 A;  3OTO K;  2IIR A;  3A0I X;  2BGG A;  5AQR A;  1QSL A;  2QXL A;  3SPZ A;  3QBW A;  2A6A A;  5ELZ A;  2NRR A;  3PUF A;  3GBT A;  3E9L A;  1HNI A;  2HST A;  3J7A P;  3CFR A;  1LOT B;  4DV2 K;  3JYT A;  4CZG A;  1C1C A;  4JD2 B;  1BI4 B;  1WOQ A;  4WQ4 C;  1KFD A;  1VQL N;  5GIN A;  3OW2 M;  2Z1H A;  3EYZ A;  3VA3 A;  1NJX A;  2NNW A;  3QNN A;  5M1F A;  2OPP A;  4A62 A;  3K5O A;  4BAC A;  1Q86 O;  4L3Q A;  3VN5 A;  5C0Y A;  3ID6 A;  3OYI A;  4B1V A;  2O8B B;  3ALY A;  1HQE A;  3VMF B;  1CXU A;  3ATU A;  1KLM A;  1TYQ B;  5MLC Q;  3PX6 A;  4CEC A;  4BRM A;  4FK2 A;  4CER A;  4DQQ A;  2HMP A;  3J8A A;  3FZL A;  1RDA A;  4FJ9 A;  1MWK A;  3QIN A;  4RW9 A;  1HNZ K;  2QEX N;  3D2F A;  4N76 A;  3H45 C;  4MDB A;  1WSG A;  4GV6 A;  2KZM A;  3M5R A;  4BR4 A;  4F3T A;  1X3N A;  4HCB A;  4AHU A;  1YVN A;  3SK3 A;  2FSN A;  1VQ5 N;  3M8R A;  5HRS A;  3AA2 A;  4RW8 A;  3CC4 N;  4IFE A;  3V1Q A;  4DSF A;  2P9I B;  3MXI A;  4FJN A;  4JI7 K;  4B3T K;  1HPM A;  4GV9 A;  1QQM A;  1NK6 A;  3U9D A;  3VF6 A;  3WXL A;  1U04 A;  5AQY A;  4E7L A;  1TUY A;  2QWP A;  4BG9 A;  1LV5 A;  1DTT A;  4JKF A;  1G15 A;  4AHC A;  4LSN A;  3ZSR A;  1WSI A;  2QW9 A;  5BR9 A;  3CXC M;  1QVF M;  2XRI A;  1BQM A;  4C8K A;  1U45 A;  3QEI A;  3SZ2 A;  3EE9 A;  3FZF A;  2GWK A;  2HF3 A;  3OYL A;  1B9D A;  4C23 A;  5BN9 A;  3K59 A;  1BA1 A;  3LP1 A;  1Q9X A;  2Q31 A;  5EY4 A;  3CCU N;  3I8D A;  4OLA A;  5GAH P;  4CEZ A;  1YIJ N;  2HVI A;  3DYA A;  3HJF A;  3ZSQ A;  4M3X A;  3C7N B;  4OO1 J;  1ZBU A;  5GIP A;  5LL6 Z;  3G71 N;  4CBU A;  3SV3 A;  1QS4 A;  1RBU A;  3QEP A;  1D8Y A;  3ZLJ A;  2FXU A;  4FJX A;  2EX3 A;  4CZF A;  4FJH A;  4FXD A;  2GTD A;  4H0T B;  3AVC A;  4CHQ A;  4Q0B A;  3G10 A;  3A5O C;  3TTC A;  3VQP A;  2OZM A;  1JL1 A;  2HHQ A;  4ILG B;  1VQP N;  3O3F A;  4DFP A;  3WXI A;  4DV7 K;  2GV9 A;  2KW4 A;  4B9N A;  1QZ5 A;  3EKU A;  1FW6 A;  4CF8 A;  4UY8 O;  1GOA A;  2IVP A;  5DM6 L;  4PKG A;  4FLU A;  3RMA A;  1H1V A;  3ASM A;  3O4Q A;  3LAN A;  2VQF K;  1YXQ A;  1RGI A;  3KD1 E;  3A5N C;  4CF1 A;  3FGU A;  4J8F A;  1EQY A;  4KBO A;  3TTD A;  4JKA A;  5J2Q A;  5F1X A;  4IG0 A;  1BHL A;  4I9L A;  4Q5V A;  4BQZ A;  2ASM A;  3R3L A;  4ID1 A;  1J5O A;  3T7Z A;  4ELV A;  2XHB A;  2YV0 X;  4LH5 A;  4B9U A;  2YHY A;  4B8A B;  1R59 O;  3JXU A;  3CG7 A;  4IFY A;  2A42 A;  4XEI A;  3WNE A;  2JWL A;  1E3M A;  4IKF A;  3PX4 A;  5HLF A;  3H1Q A;  4KRF A;  1GLE G;  3QB0 A;  4JNE A;  1K73 O;  3E9O A;  3F5T A;  4N5S A;  3K2P A;  3K0S A;  3V9X A;  2KZZ A;  4BVO A;  3DRP A;  4J2D A;  3WEE A;  5LJV A;  2QWR A;  4CEA A;  5JMV A;  3FFI A;  4CEE A;  3HXM A;  2Q0R A;  2E20 A;  1Q7Y O;  1OH7 A;  2ITG A;  4CJT A;  3C65 A;  3S41 A;  3CHW A;  3WXM B;  3CM6 A;  1T8E A;  1YIT N;  1E4G T;  3CER A;  4ICL A;  3AVB A;  1RTJ A;  4AM6 A;  2NZT A;  5TKY A;  3HVT A;  3V4I A;  1KAY A;  5BPN A;  3SAF A;  4E7K A;  1RIL A;  4EP4 A;  1JJ2 M;  2HHX A;  1M1K O;  4EHU A;  1A5X A;  2CGK A;  3QIC A;  4BRO A;  4DSI A;  3VF4 A;  2ZM6 K;  4DG1 A;  2NUB A;  2VG5 A;  3MWP A;  5CHI A;  4DUZ K;  1NJI O;  4FJG A;  4B1Z A;  4FZX C;  2I7N A;  1XI1 A;  4M63 C;  1TV6 A;  3SUQ A;  3NHG A;  2OTL N;  2EHG A;  3CMA N;  3NGY A;  1EET A;  1RBS A;  1K8K A;  4CGF A;  2F8T A;  1DT9 A;  1QQC A;  1R0A A;  3SLC A;  3OYA A;  3T1A A;  4CJV A;  4ILJ A;  2VGN A;  3AO1 A;  1BCO A;  1KLN A;  3MAQ A;  2IC3 A;  3VEV A;  3UKU A;  4M3W A; 
#chains in the Genus database with same CATH homology
 1O1W A;  2E4L A;  4PWD A;  1ZBI A;  3TAB A;  2VG6 A;  4ELU A;  3AVL A;  1C6V A;  3OYJ A;  5HP1 A;  4J2A A;  2HHS A;  1JXB A;  3AVF A;  4OKJ A;  1EP4 A;  3NBP A;  4Y1C A;  3OYC A;  1C0T A;  2FC0 A;  3D45 A;  3AVN A;  2KFZ A;  2YHB A;  4IG3 A;  1X9W A;  3OYH A;  5J2M A;  4QOZ B;  3LZI A;  4BE0 A;  4E0D A;  1VSE A;  1HPZ A;  1TKZ A;  3M8P A;  3NF7 A;  1TL1 A;  3ZT4 A;  3AA5 X;  4NYN A;  4CJK A;  3OS2 A;  3SQ2 A;  3NGZ A;  3TAQ A;  3HO1 A;  4M42 A;  3K57 A;  1RT7 A;  3ZT2 A;  1NOY A;  3RR8 A;  3OYD A;  4DLE A;  1SKW A;  1K6Y A;  4FJ8 A;  5T7B A;  4C8O A;  5CY4 A;  3L2R A;  4CHY A;  2Z1I A;  1NK5 A;  4DTM A;  1J54 A;  2D5R A;  2IGI A;  2LSN A;  3C6U A;  2HMI A;  4B9T A;  4I9Q A;  4DLG A;  1YT3 A;  4IBN A;  4B9S A;  3HL8 A;  2RPI A;  4CK1 A;  5EU7 A;  1EX4 A;  1RCH A;  3WNF A;  2P5G A;  3VQB A;  4EP5 A;  2HHW A;  1WSJ A;  1KVC A;  3NGI A;  5KI6 A;  3DLB A;  3KD5 E;  4KRE A;  1SV5 A;  3DM2 A;  4H4O A;  2QKB A;  1WAF A;  2XY6 A;  4CFB A;  3SJJ A;  4CJS A;  4DSJ A;  1C1A A;  4CEO A;  1RTH A;  4LY7 A;  4CHO A;  2FBY A;  1HNV A;  3HVR A;  3AA4 A;  3V81 A;  3CFO A;  2QXF A;  3V6D A;  3IRX A;  3QEV A;  1J9A A;  4FM2 A;  3SUO A;  2FBV A;  4FLW A;  4KB1 A;  1VSL A;  2YNH A;  4CEB A;  4BDZ A;  5DK5 A;  2WOM A;  3VQQ A;  1U48 A;  4EZ6 A;  4CJ5 A;  1Z26 A;  3AV9 A;  3D0P A;  4AHR A;  1IKY A;  2D0C A;  3MEG A;  3OJU A;  4HUF A;  4I2Q A;  1ASV A;  4HTU A;  4CED A;  1RTD A;  3ZT1 A;  2KQ2 A;  3OYM A;  3K5N A;  4DU3 A;  1WLJ A;  4FJM A;  1JLB A;  2G8F A;  4FJ7 A;  5FRN A;  4DQP A;  3AO2 A;  3MEC A;  5C25 A;  1CZB A;  1L3S A;  2B6A A;  1TK8 A;  4TSX A;  1KSP A;  4CF2 A;  2Q3S A;  3ZT0 A;  4HHT A;  1VSD A;  4CIG A;  4HVJ A;  4KO0 A;  2DFH A;  4E1M A;  5SWM A;  3AVK A;  3OYF A;  2PYL A;  3KIO A;  3WNG A;  5KGW A;  1XWL A;  4FCY A;  1D9D A;  4KI6 A;  3HT3 A;  3VA0 A;  3RRH A;  3S3O A;  1TVR A;  2D0A A;  3DLK A;  3HPO A;  1ASW A;  3S3N A;  1BIU A;  3NAE A;  3ISN C;  3LZJ A;  3LAK A;  2BDP A;  4B9V A;  3ZCM A;  2PZS A;  4N47 A;  1JLQ A;  1W0H A;  5SZT A;  1HYV A;  1EKE A;  3IG1 A;  3UIQ A;  4DU1 A;  4I2P A;  3OY9 A;  1KVA A;  5J1E A;  5KTQ A;  1L5U A;  4PQU A;  4QCL A;  4BE2 A;  1S5J A;  4DFK A;  4AH9 A;  1ASU A;  3AA3 A;  4WE1 A;  4CGD A;  4CJE A;  4AIL C;  1W9H A;  4DF4 A;  4B9M A;  4FM1 A;  1YTU A;  2QK9 A;  3C95 A;  2G8H A;  4K8X A;  3RR7 A;  4DTX A;  4Z4G A;  4CJP A;  1N5Y A;  3L2U A;  1T7P A;  1BIS A;  1WSH A;  1KVB A;  3K5M A;  5FRO A;  3VQA A;  3TAG A;  4W5O A;  4AHS A;  3VQ9 A;  5J2P A;  1NK4 A;  3ZSW A;  3QEX A;  2OYQ A;  1UOC A;  4LD0 A;  1HRH A;  1QE1 A;  1LWF A;  3T3F A;  4BWJ A;  1TK0 A;  1JLA A;  3AVM A;  4UQG A;  4FYD A;  1RDD A;  1S6P A;  3ITH A;  4JLH A;  1HYZ A;  1IH7 A;  4DF8 A;  3MXM A;  2KFN A;  3LWM A;  2O4G A;  2E6L A;  1EXQ A;  3LDS A;  3SUN A;  4CJW A;  2HB5 A;  1B92 A;  1JKH A;  4B08 A;  1XHZ A;  1IKV A;  3P5J A;  1Q8I A;  4HUE A;  1WN7 A;  4CGJ A;  3VQ6 A;  5C42 A;  1IKX A;  3OYK A;  2IOC A;  4FK4 A;  4LSL A;  3OJS A;  4E7J A;  4DTJ A;  3DMJ A;  1WSF A;  3U3Y A;  2G8W A;  4BDY A;  2G8K A;  4DWI A;  4M3U A;  1NK8 A;  1VRU A;  4QAG A;  3SNN A;  1S6Q A;  2E6M A;  3DRR A;  4CEF A;  2Y1J A;  4C8L A;  1JLE A;  1VSM A;  1MU2 A;  1GOC A;  1TKD A;  4OKE A;  5CYM A;  1SL2 A;  1X1P A;  4DFM A;  4BDP A;  3CQ8 A;  1JLG A;  1RBR A;  3ZSY A;  1X9M A;  3LAM A;  1Q9Y A;  2RF2 A;  1RBV A;  2Z1J A;  4PA1 A;  3RMC A;  3HK2 A;  1REV A;  5J2N A;  2XY7 A;  4KI4 A;  1BIZ A;  3C94 A;  1U47 A;  1HYS A;  4MFB A;  1JLC A;  1S1T A;  4LH4 A;  2KTQ A;  4OVL A;  1BI4 A;  1NOZ A;  4BWM A;  4KHY A;  1C0U A;  4CHP A;  1TAU A;  3V9W A;  3RTV A;  1WSE A;  2X78 A;  3BGR A;  3DLR A;  5HRP A;  1X9S A;  1A5V A;  4DTU A;  1SL0 A;  3QO9 A;  4HUG A;  3EY1 A;  4M41 A;  2BGG A;  1XHX A;  2XY8 A;  3I0S A;  2FBX A;  1QSL A;  1VRT A;  4O44 A;  4JRQ A;  1IO2 A;  4Z4C A;  3M8Q A;  3QET A;  3SPZ A;  4RW7 A;  5E41 A;  3KLI A;  4O0I A;  4CJR A;  3ZT3 A;  3KLF A;  4KHQ A;  3U3G A;  3TAP A;  1U4B A;  1NK9 A;  4W5Q A;  3LP0 A;  4FM0 A;  3PO5 A;  1NK7 A;  1S1X A;  3PUF A;  3B6P A;  4ID5 A;  1HNI A;  2YNF A;  1JXE A;  5JS2 A;  4M45 A;  4E1N A;  3CFR A;  3DI6 A;  4CGG A;  4ZTJ A;  4DQI A;  4KB0 A;  1N6Q A;  4Z0U A;  2AJQ A;  4F4K A;  2B4J A;  1S9G A;  4FLX A;  3JYT A;  2O4I A;  1C1C A;  3ZSV A;  1BI4 B;  4FJI A;  3ZSX A;  1KFD A;  1QHT A;  5FRM A;  1JLF A;  4R5P A;  4E19 A;  2G8I A;  2YNG A;  2YKN A;  2Z1H A;  4ZHR A;  4CEQ A;  3EYZ A;  1I3A A;  3KLH A;  3VA3 A;  5JS1 A;  1NJX A;  3VQE A;  3V1O A;  3QES A;  4CK3 A;  3V9Z A;  1VSH A;  3SQ1 A;  1BCM A;  3HPH A;  5CZ2 A;  3V1R A;  3QNN A;  4FZZ A;  2OPP A;  3HP6 A;  3K5O A;  1HMV A;  1VSF A;  3JSM A;  3K5L A;  4BAC A;  4CIE A;  4DTN A;  3NF8 A;  1VSK A;  3VN5 A;  2DY4 A;  1F21 A;  3OYI A;  3ALY A;  3VQ4 A;  5HRO A;  1HQE A;  2IAJ A;  1B9F A;  1TKT A;  3HST B;  1CXU A;  1NJY A;  4FZY A;  3KK3 A;  2JLE A;  2X74 A;  2ZQB A;  1S9E A;  2IS3 A;  1KLM A;  4DU4 A;  5KRT A;  3L2V A;  3CYM A;  1LWE A;  3PX6 A;  4FW2 A;  3G0Z A;  4CEC A;  4CFC A;  3SI6 A;  3PO4 A;  3NDK A;  4CJ3 A;  4FK2 A;  4CER A;  4DQQ A;  3LPU A;  2P1J A;  3QER A;  1RDA A;  2RKI A;  4FJ9 A;  4ELT A;  4PY5 A;  3QIN A;  5KGX A;  3OYE A;  3DRS A;  4RW9 A;  1LWC A;  1A5W A;  1VK0 A;  3EZ5 A;  3NCI A;  3RMB A;  4N76 A;  1VSJ A;  4N56 A;  1LW2 A;  3NF9 A;  3OYB A;  3VQ8 A;  4CFA A;  1WSG A;  4ZTF A;  2KZM A;  3QEW A;  4FK0 A;  4F3T A;  3LWL A;  4KTW A;  4M3T A;  1CLQ A;  4HCB A;  4BE1 A;  4AHU A;  4W5T A;  3RMD A;  3SQ0 A;  3M8R A;  5HRS A;  3AA2 A;  4RW8 A;  4FLY A;  3V1Q A;  3TAN A;  4DSF A;  1L3U A;  1S1U A;  3MXI A;  1KFS A;  4FJN A;  1NJZ A;  1ZBH A;  2VWJ A;  3NF6 A;  2HW3 A;  3K58 A;  1RT3 A;  4DTR A;  4CJQ A;  1CXQ A;  5K14 A;  3KLE A;  1LAW A;  4CJ4 A;  1NK6 A;  1SKR A;  4L8R B;  4OLB A;  2ATQ A;  4B8C A;  1U04 A;  3OS1 A;  3NE6 A;  4JS5 A;  4E7L A;  1LV5 A;  1DTT A;  1G15 A;  1RT2 A;  3AVH A;  4C8N A;  1FK9 A;  4AHC A;  1TKX A;  4CHN A;  4E3S A;  3SCX A;  3LPT A;  2HHU A;  4LSN A;  3ZSR A;  3TAM A;  1WSI A;  4KPY A;  1HQU A;  1T05 A;  1DLO A;  1WAJ A;  1BL3 A;  1JL2 A;  3KKS A;  2PY5 A;  2OPR A;  2XRI A;  3PV8 A;  2F8S A;  1QSS A;  1BQM A;  2P5O A;  4DMN A;  4CJU A;  1U45 A;  4C8K A;  3RWU A;  3LP2 A;  3O4N A;  4OPK A;  3HM9 A;  3QEI A;  3SZ2 A;  3DLE A;  3CM5 A;  4KTZ A;  3OS0 A;  3OYL A;  3MEE A;  3T19 A;  2OZS A;  1B9D A;  2BAN A;  3V9U A;  2JGU A;  3K59 A;  1SKS A;  3LP1 A;  3F9K A;  1SUQ A;  4AHV A;  3A2F A;  4OKK A;  4RW6 A;  1Q9X A;  4CGI A;  3TWH A;  3I8D A;  4OLA A;  1Z25 A;  4CEZ A;  4EZ9 A;  5HRR A;  1RT5 A;  3MXJ A;  3DYA A;  1NK0 A;  4CES A;  3HJF A;  2HVI A;  4M3R A;  3ZSZ A;  2F96 A;  1C1B A;  4CGH A;  1RT4 A;  3ZSQ A;  3PY8 A;  3TAF A;  4M3X A;  3HP9 A;  3F73 A;  2BE2 A;  2W42 A;  1ZBU A;  4NYF A;  5HRN A;  3WNH A;  4CK2 A;  1BQN A;  2HNY A;  4O55 A;  4FJL A;  3SV3 A;  1UWB A;  4DFJ A;  1QS4 A;  1RBU A;  3QEP A;  3RRG A;  2YKM A;  2I5J A;  3TAE A;  1D8Y A;  4F2S A;  3VQ7 A;  3TR8 A;  1L3T A;  3L2Q A;  4FJX A;  2EX3 A;  2X6N A;  3O3G A;  4FJH A;  4FXD A;  3NH2 A;  2HVH A;  2WON A;  3OVN A;  1XC9 A;  1I39 A;  3AVC A;  4CHQ A;  1KCF A;  2R7Y A;  1TAQ A;  3G10 A;  2QKK A;  4F3O A;  1YVU A;  4Q0B A;  1QTM A;  4FJ5 A;  3VQP A;  2A1S A;  2OZM A;  2IDO A;  4O5B A;  1JL1 A;  3IAY A;  2HHQ A;  1ITG A;  3SUP A;  4G1Q A;  2B5J A;  3O3F A;  3LP3 A;  4DFP A;  4DSL A;  2OPQ A;  4JRP A;  2HND A;  3HYF A;  3V9S A;  1LW0 A;  2GV9 A;  2KW4 A;  4FW1 A;  4DQR A;  4B9N A;  1RDB A;  2XY5 A;  4FVM A;  3OYN A;  1UA0 A;  1L3V A;  1IKW A;  4CF8 A;  1GOA A;  4XIU A;  4OPJ A;  4E7H A;  4YNQ A;  3KJV A;  4AHT A;  2VWK A;  4NCG A;  4KV8 A;  4FLU A;  4O0J A;  1FXX A;  3RMA A;  4HCC A;  3L2W A;  4J2B A;  1QSY A;  3ASM A;  3NFA A;  3O4Q A;  4RW4 A;  1TK5 A;  3LAN A;  3L3U A;  3BDP A;  2VG7 A;  3KD1 E;  4CF1 A;  3AO3 A;  4B3O A;  4DTO A;  3L3V A;  3KKR A;  2HHT A;  3KTQ A;  4IFV A;  5J2Q A;  1T03 A;  2FBT A;  4IG0 A;  4GVM A;  1BHL A;  4RG8 A;  4I9L A;  2G8V A;  3NH0 A;  4Q5V A;  2OA8 A;  4PUO A;  2GUI A;  3SPY A;  1YTA A;  3H08 A;  4K8Z A;  5CYQ A;  4ID1 A;  4DS4 A;  1ZBL A;  5I3U A;  1J5O A;  4B9L A;  2G8U A;  1HJR A;  3HPG A;  4ELV A;  1Y97 A;  1U49 A;  2XHB A;  4E89 A;  3ZSO A;  1KRP A;  2YV0 X;  4LH5 A;  4B9U A;  5D3G A;  3CFP A;  4Z4E A;  4CHZ A;  2D0B A;  4B8A B;  3S3M A;  1UA1 A;  4CCH A;  4CF9 A;  3CG7 A;  1NKE A;  4IFY A;  3DLG A;  1RBT A;  4FLT A;  2Z1G A;  3NH1 A;  4JS4 A;  3WNE A;  2A1R A;  4O4G A;  4IKF A;  1D5A A;  3PX4 A;  3SV4 A;  3AVA A;  4Y1D A;  3KK2 A;  5HLF A;  4FJJ A;  4DTS A;  1S1V A;  3B6O A;  4KRF A;  3P83 D;  1D9F A;  4F8R A;  2XO7 A;  1KTQ A;  4IDK A;  4CFD A;  4N5S A;  3U6F A;  1NKB A;  3K2P A;  1RT1 A;  3P1G A;  3QIP A;  4DS5 A;  2X6S A;  5FDL A;  1RT6 A;  3VQD A;  4W5R A;  5C24 A;  3DRP A;  3V9X A;  2Y1I A;  4J2D A;  2KZZ A;  3M8S A;  1CZ9 A;  3TI0 A;  4F2R A;  2YNI A;  4CEA A;  3HXM A;  3FFI A;  4CEE A;  4NCB A;  3AVJ A;  3I0R A;  3O3H A;  1RDC A;  4NCA A;  5DMR A;  2ITG A;  4CJT A;  3KLG A;  4FLZ A;  3S9H A;  4KHS A;  1TL3 A;  3E01 A;  4H4M A;  1J53 A;  4DSE A;  2RN2 A;  2PYJ A;  4KTQ A;  4KFB A;  3CM6 A;  4FJK A;  4OGC A;  4KHW A;  1T8E A;  2OPS A;  4KHU A;  4W5N A;  4CIF A;  1ZBF A;  4MQ3 A;  4ICL A;  4YFU A;  3DLH A;  2ZE2 A;  3AVB A;  1RTJ A;  5KRS A;  3OYG A;  4M3Y A;  3HVT A;  3V4I A;  1RNH A;  4E7K A;  3MED A;  1RIL A;  5CZ1 A;  4CJL A;  4EP4 A;  2HHX A;  4KKO A;  3C6T A;  3L8B A;  1A5X A;  1DTQ A;  3TAR A;  2YHA A;  3VQ5 A;  3DOK A;  4OGE A;  2DTU A;  4H8K A;  5I42 A;  4KAZ A;  4DTP A;  4DSI A;  4DG1 A;  2NUB A;  2VG5 A;  1LAV A;  4FJG A;  3AO4 A;  2P51 A;  4FZX C;  4CF0 A;  3SQ4 A;  1TGO A;  4Z4I A;  3AVI A;  4E7I A;  1XI1 A;  4J2E A;  1TV6 A;  2DFF A;  3AO5 A;  4OJR A;  3SUQ A;  1UAX A;  2HHV A;  3NHG A;  4KHN A;  2EHG A;  2ETJ A;  1NJW A;  1RTI A;  3NGY A;  1GOB A;  4DSK A;  1EET A;  1RBS A;  1S1W A;  4CGF A;  4Z4H A;  2F8T A;  1QQC A;  1R0A A;  4GW6 A;  1FKP A;  3IS9 A;  4Z4F A;  1C0M A;  4GMJ B;  2DFE A;  3OYA A;  1WNS A;  3DOL A;  3T1A A;  3VQC A;  3QIO A;  3ULD A;  1IG9 A;  4M3Z A;  3QLH A;  4CJV A;  2GBZ A;  3AO1 A;  1FKO A;  1BCO A;  2HNZ A;  3SYZ A;  1VSI A;  3PX0 A;  5HBM A;  3THV A;  1KLN A;  4CE9 A;  3QNO A;  1NKC A;  4I7F A;  3AVG A;  3MAQ A;  3KK1 A;  4DQS A;  1ZYQ A;  2IC3 A;  4CJF A;  3LAL A;  4C8M A;  4FLV A;  4N41 A;  2ZD1 A;  4M3W A;  1SL1 A;  1BGX T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...