4GMJB

Structure of human not1 mif4g domain co-crystallized with caf1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
271
structure length
264
Chain Sequence
QRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSGNAYEEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCR4-NOT transcription complex subunit 1
publication title The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 83
structure length 264
sequence length 271
chains with identical sequence D, F
ec nomenclature ec 3.1.13.4: Poly(A)-specific ribonuclease.
pdb deposition date 2012-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04857 CAF1 CAF1 family ribonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4gmjB00
4GVMA 4FW1A 4IBNA 4CJ3A 1WAFA 4CEBA 4FLTA 2Z1HA 1WSEA 3DI6A 3SNNA 3ZSZA 3K5MA 3VA0A 4YNQA 3VQBA 4C8NA 5CY4A 2VWKA 3HVRA 3ULDA 3NHGA 1XI1A 4F2RA 2RKIA 4Z4EA 1KCFA 4M3UA 2Y1JA 4FJLA 1N6QA 3K57A 2YKNA 4CJVA 4DFKA 3QESA 3HP9A 1U47A 3VN5A 4Z0UA 4BWJA 3AVAA 4JLHA 1S1XA 4KKOA 3OYHA 4E3SA 4J2DA 3VQQA 3SQ4A 5FRMA 3OJSA 1BQMA 3OYAA 3KD5E 3HP6A 3ALYA 1KSPA 3SPZA 2HVIA 1QHTA 1RT2A 4N41A 4DSJA 3PUFA 2VG7A 1RT7A 2PZSA 1S5JA 2XY8A 1XC9A 2GV9A 2PY5A 1RBUA 3K58A 4E7JA 1QTMA 2X78A 2X6NA 3LP1A 3LWLA 3AVBA 4FJNA 3RMAA 2ATQA 5FRNA 2Z1IA 1TKTA 4O0JA 4R5PA 1LWFA 1RTIA 3LPTA 3HT3A 4FLXA 3QETA 3TARA 3PO4A 1WLJA 1KFSA 4KI4A 3PX4A 3E01A 3AVLA 3V6DA 1Q9YA 2BGGA 1U04A 3CFOA 3D45A 4K8ZA 1J53A 4RW8A 4W5RA 3SYZA 4CIFA 3VQ6A 3SUPA 1S9EA 3KLGA 1L3VA 1YTAA 2X6SA 3P5JA 4GMJB 5SWMA 1NKBA 2HHXA 3SV3A 3HXMA 3QNOA 3KLFA 2VG6A 1BIZA 4KPYA 4M3WA 5E41A 4JRQA 2I5JA 3V9UA 4OGCA 2R7YA 1T05A 1G15A 1HYSA 2D0BA 3HPHA 4HCBA 1U45A 4CK3A 4DTUA 4CGJA 1C1CA 3OYCA 4K8XA 1EETA 2E6MA 3AVKA 4E7KA 1VSMA 4AHSA 3WNHA 3OS1A 1JLBA 4UQGA 1U49A 1ASUA 3OYNA 1KLMA 2VG5A 3L2UA 3U3YA 2BDPA 1W9HA 4LH5A 1IH7A 4PA1A 4B9VA 2E4LA 3DLGA 4FLWA 1REVA 2F96A 4C8KA 3T1AA 3L2QA 4DSKA 4PWDA 3AVCA 4RG8A 3SQ0A 3P1GA 3MAQA 4JS5A 4Y1CA 4CJ5A 1VRUA 4B8CA 2ETJA 2IDOA 1NKEA 1LV5A 3EZ5A 3AA4A 4FJKA 3AVGA 3K2PA 3ZT0A 3ZCMA 3TANA 1NJZA 3WNFA 4CGIA 1U48A 4KREA 3AVIA 3P83D 4RW4A 4B8AB 3L2WA 3TAGA 3HPGA 1JL2A 3PV8A 3AO4A 1F21A 2P51A 1D5AA 1NJWA 3L3UA 4N47A 1X1PA 2D0AA 4Z4HA 2QXFA 4M3YA 4Z4FA 3ASMA 1WSHA 1TK8A 4AHCA 1WSIA 3ZSWA 3NE6A 3SZ2A 1CZBA 4CF9A 4CHPA 2ZQBA 1NKCA 2HMIA 4Y1DA 4CFAA 3NH0A 1D8YA 1NK9A 1L3UA 4E19A 4I9QA 3CFRA 4CCHA 3QEWA 3QO9A 3QEVA 4CGDA 4CEZA 3SPYA 1VSDA 2G8FA 5KGWA 4CJFA 4KB0A 3HM9A 4CJPA 1S6PA 3D0PA 4CEOA 1DTQA 3SUNA 3VQ9A 1XHZA 5J2QA 1TKDA 2HNYA 3AVMA 5KTQA 4DTMA 4DU1A 1UOCA 3O4NA 4DFJA 3V81A 4WE1A 2OZMA 1SKSA 3L8BA 4B08A 2WOMA 4BE1A 4OLAA 1S6QA 4CJWA 2YNFA 3AA3A 4IG0A 4CF0A 4CHZA 3LALA 4FJ7A 1S1VA 2RPIA 3KKRA 4Q0BA 1TVRA 3KIOA 1Q8IA 2FBVA 4KTZA 4DFMA 2KQ2A 2QK9A 4DSLA 4NYNA 3VQ7A 2P5OA 4FZZA 1RTHA 3DLBA 4BACA 4CJLA 1BI4B 1TKZA 4KB1A 4DS4A 3TABA 1IKYA 1MU2A 1C6VA 2JLEA 3ZSYA 1ZBFA 3AO5A 3NGIA 3V9ZA 4CF1A 4CHQA 3C6UA 4EZ9A 1KVBA 4CGFA 5FROA 3WNGA 3SUQA 1RDAA 1RTJA 2D5RA 2EX3A 3C6TA 3QINA 1Y97A 1TK0A 1SKWA 3OYKA 4CJQA 2G8IA 1L3TA 1S1UA 1UA1A 3QIOA 4DSEA 4DF4A 1BHLA 1CLQA 4CEAA 2OPQA 2YNIA 1FK9A 3G0ZA 1A5VA 1IO2A 4DLGA 1KVCA 1LAVA 4NCAA 3RTVA 4F3OA 4B3OA 4OKEA 1VSHA 4O0IA 3ITHA 4CEQA 1SL1A 1ASVA 1HYZA 3V1RA 4FM1A 3L2VA 5J2PA 4KHWA 1ZBLA 4Z4IA 1CZ9A 3SJJA 1T8EA 1RT5A 4LSLA 3CFPA 3KD1E 1GOCA 5JS2A 3S9HA 4IG3A 5CYQA 4EP5A 3LANA 1YVUA 5I42A 4B9MA 2KTQA 1KFDA 3TAQA 4ELTA 3V9WA 4KTQA 3VQDA 4KHUA 4DQQA 2B6AA 4CJRA 1NOYA 3PO5A 4M3TA 4E7IA 1ZBUA 4M45A 1QQCA 1I39A 3CQ8A 3MEGA 5DMRA 5C24A 1VSLA 1X9WA 1DLOA 1ITGA 1C0UA 1JXBA 4CFBA 3VA3A 3MXMA 3KTQA 3B6OA 3LP2A 4BDYA 4TSXA 1FKPA 4O5BA 1TAQA 1S9GA 1QSLA 1RT6A 3BDPA 1VRTA 4I9LA 3SCXA 1NOZA 5J2NA 1I3AA 2RN2A 5C25A 5HRPA 4PQUA 2IGIA 1HPZA 4E89A 3F73A 3SI6A 3T3FA 1FKOA 3G10A 3KK2A 4N5SA 3LWMA 4ID5A 4OGEA 3NF9A 3VQEA 4FJXA 4CESA 4FCYA 1D9DA 1VSFA 3OYIA 4J2AA 3HK2A 4HHTA 1HMVA 1B9FA 1IKVA 1VSJA 3DLHA 3M8QA 1RBTA 2E6LA 3AO2A 4CEEA 1CXUA 2QKBA 1BQNA 1QE1A 3ISNC 3OYEA 3KK1A 3CM5A 1NK4A 2YHAA 4N76A 1WSGA 2KZZA 2XRIA 4W5QA 4DU4A 4N56A 1X9SA 5K14A 3SQ2A 2HHWA 1X9MA 2DTUA 3AA2A 1RNHA 1C0MA 1JLFA 3O4QA 3OS2A 4HUGA 4DTJA 1CXQA 2XY5A 3QEXA 1L3SA 3LAMA 3NGYA 2HNZA 4QCLA 1WAJA 2B4JA 5KGXA 1VSEA 3F9KA 3HSTB 4OKKA 4MFBA 1RILA 4KAZA 4CJKA 2HHUA 3A2FA 4IDKA 3TI0A 4JS4A 2BANA 3KKSA 4F4KA 2KFZA 1DTTA 1WSFA 3RMCA 3DMJA 3NH2A 2IC3A 1BIUA 1NK6A 4G1QA 4E7HA 4W5NA 4QAGA 1RT4A 5C42A 4W5OA 4BDPA 4F8RA 3V9SA 4AH9A 3NH1A 1S1TA 2G8HA 5HROA 4KHQA 4BWMA 1SL2A 3AV9A 3RR8A 3NF6A 3TAEA 4ELUA 2KZMA 4HVJA 3MXJA 1JLEA 3OYMA 1JXEA 3NCIA 2DY4A 2A1RA 5JS1A 4FLUA 3ZT2A 4J2BA 3CYMA 3KLIA 3LZIA 2OPSA 2OZSA 1WN7A 4J2EA 4O4GA 3NF8A 2W42A 3QIPA 1EKEA 2P5GA 4CEFA 4HUEA 2HNDA 1FXXA 4FM0A 3PX6A 1NJYA 2YHBA 1SUQA 3MEEA 3QNNA 3MECA 1T03A 5D3GA 4DS5A 4KO0A 1SV5A 3OYGA 4DTSA 1O1WA 1Z25A 1NK7A 4DLEA 4ZHRA 3K5OA 3TR8A 3ZT4A 4DTOA 4AILC 3NGZA 1TL3A 3TAPA 2PYJA 4E0DA 1BGXT 4M3XA 4QOZB 4AHTA 1VSIA 4KHSA 3VQAA 1TV6A 3IS9A 5I3UA 1KVAA 3RMDA 2X74A 1KLNA 1R0AA 5CZ1A 4DMNA 4O55A 2ZE2A 3NFAA 4CF2A 3KJVA 2XO7A 3QERA 4KHYA 1JL1A 2OPRA 4LY7A 2G8KA 1VK0A 4CEDA 5J1EA 3JSMA 3C95A 4HUFA 2BE2A 4FLYA 3MXIA 2O4IA 1TAUA 1LAWA 4C8OA 2GUIA 3ZSQA 3ZSXA 1RT1A 4C8MA 2DFEA 2HB5A 2OA8A 1RDBA 4BE0A 2HVHA 1GOAA 1KRPA 1RCHA 3L2RA 1S1WA 3DLKA 1QS4A 1JLAA 3TWHA 5DK5A 4CGGA 4DSFA 1HNVA 4E1MA 1IKXA 1LWEA 4KRFA 2Y1IA 2B5JA 1TGOA 4NCGA 4FM2A 3DLEA 3PY8A 1RBSA 1D9FA 4CK1A 3OYLA 1Z26A 5J2MA 1KTQA 4FZXC 3NBPA 1BI4A 3UIQA 4OLBA 1B9DA 2HHVA 3OYJA 1C1BA 1EX4A 1JLCA 3M8RA 4IFVA 3I0RA 2PYLA 4DQRA 5HLFA 3B6PA 3RMBA 1J5OA 3VQ5A 2ZD1A 4CHNA 4Q5VA 3OS0A 4KTWA 4CECA 4FJJA 4FK0A 1LW2A 3THVA 4FJMA 2FBTA 2VWJA 4FJ8A 4DU3A 1BCOA 4I2PA 1HQUA 5HRSA 3OY9A 1XWLA 2GBZA 2Z1JA 5FDLA 4DG1A 4KV8A 1RDCA 4DQIA 3RWUA 4C8LA 3H08A 3ZSVA 1ASWA 2FBYA 4CJEA 4CJTA 1UWBA 2YKMA 4ICLA 4CHYA 3EY1A 3HL8A 4EZ6A 4BE2A 2YNHA 1A5WA 3WNEA 4FK2A 3O3FA 3K5LA 4CIGA 3HJFA 4FYDA 3ZT1A 3QEPA 3AO1A 4DWIA 1A5XA 2G8UA 1C0TA 3MEDA 5EU7A 1XHXA 1WSJA 3TAMA 1QSSA 2FC0A 3OYDA 2IOCA 4H8KA 3CM6A 4YFUA 3JYTA 2Z1GA 4FLVA 2NUBA 5CYMA 1TKXA 3ZSRA 3S3OA 1RDDA 1K6YA 3DM2A 4HCCA 3FFIA 1LWCA 2IAJA 1EP4A 4IFYA 4OPJA 3O3GA 2HW3A 2A1SA 3HPOA 3I8DA 4IKFA 4JRPA 2EHGA 1JKHA 2ITGA 4M3RA 2IS3A 3VQCA 1B92A 5KI6A 3KLHA 4FZYA 4FJIA 4PUOA 3KK3A 1IG9A 2JGUA 1TL1A 3SV4A 5HP1A 3AVFA 3AVNA 4KI6A 4M42A 1NK0A 4B9UA 4M41A 1J9AA 3L3VA 4XIUA 4I2QA 4BDZA 3DLRA 3HVTA 3AVHA 4NYFA 3EYZA 4E7LA 4CERA 4DTRA 2AJQA 3SUOA 2OPPA 1LW0A 2F8SA 3DRSA 3AO3A 2G8VA 3T19A 4B9LA 4DTPA 5KRTA 3U3GA 1JLGA 1HJRA 1UA0A 1T7PA 4FJ5A 2P1JA 3VQPA 1GOBA 1ZBIA 2HHSA 4O44A 3V1QA 4CJUA 4L8RB 2RF2A 3S3NA 4ZTFA 4AHUA 4CIEA 4HTUA 2OYQA 2LSNA 4DSIA 3LAKA 3NDKA 1C1AA 1BCMA 3LP0A 3QLHA 4CE9A 3LZJA 1IKWA 3U6FA 3KLEA 3C94A 4CJ4A 4B9TA 2DFHA 1RT3A 2D0CA 4FLZA 2YNGA 2KFNA 4KHNA 4Z4CA 4OVLA 4DF8A 3ZT3A 4ELVA 4FW2A 4FJHA 3SQ1A 3RRHA 4RW7A 3O3HA 1Q9XA 3RR7A 4CGHA 2XY7A 3IRXA 2XY6A 1BL3A 2G8WA 2F8TA 5SZTA 3V9XA 2WONA 5HBMA 3HO1A 3VQ4A 2HHTA 1NJXA 4FJGA 1QSYA 4CJSA 3RRGA 1ZYQA 4MQ3A 4CFDA 5T7BA 1UAXA 4AHRA 4FJ9A 3DRRA 4CFCA 3V4IA 1U4BA 4B9NA 3NF7A 1L5UA 4B9SA 1HRHA 3BGRA 2DFFA 4OJRA 1EXQA 4NCBA 4FK4A 4DQPA 4M3ZA 4EP4A 1WNSA 2Q3SA 3NAEA 1HYVA 4RW6A 4F3TA 4CHOA 1SL0A 3PX0A 3LP3A 4H4MA 3S3MA 3IG1A 4LSNA 4CK2A 1NK8A 3DRPA 4KFBA 3OYBA 3HYFA 1SKRA 3AA5X 1J54A 3DYAA 4FVMA 5KRSA 1HQEA 4OPKA 4DTXA 1NK5A 4GW6A 5HRRA 1RBVA 1VSKA 3ZSOA 3QEIA 4I7FA 3OJUA 3OVNA 3VQ8A 1RBRA 4AHVA 4Z4GA 3CG7A 1YTUA 4RW9A 4F2SA 3I0SA 5CZ2A 1ZBHA 3OYFA 4ID1A 3TAFA 4CF8A 4ZTJA 1TK5A 1N5YA 2XHBA 3V1OA 4OKJA 4E1NA 3M8SA 1JLQA 3M8PA 3LPUA 4LD0A 2QKKA 4PY5A 1BISA 4DTNA 2HHQA 3LDSA 4DQSA 4DFPA 4W5TA 4H4OA 3DOLA 5HRNA 3IAYA 1HNIA 1RTDA 2O4GA 3K5NA 4FXDA 3DOKA 3K59A 2FBXA 2KW4A 3AVJA 2YV0X 4LH4A 1W0HA 1YT3A
chains in the Genus database with same CATH superfamily
3IDHA 4B3RK 4IBNA 3CC7N 3K5MA 2BH1A 1KC8O 1VHXA 5CY4A 3GBTA 5E26A 2AP1A 3ULDA 2O8DB 3VOVA 2ZJQL 4JHDB 5AFUH 1MDUB 2QWLA 4M3UA 1NGIA 1N6QA 4EHTA 4BWJA 3OYHA 1YJWN 3VQQA 3SQ4A 5FRMA 3KD5E 4N41A 4WFBL 4DSJA 3WXJA 2VG7A 2CH5A 3O08A 1S5JA 3SMSA 1QTMA 3EN9A 3TSPA 4FJNA 3AVBA 3OBWA 2FXUA 5LJWA 3VGKA 5JICA 3DAWA 3QETA 4PQUA 4FLXA 3LPTA 3PO4A 2YJFA 4KI4A 1NG9A 1T6DA 1ILYA 1VQNN 1IBKK 3VQ6A 1S9EA 4JKAA 2HHXA 3HXMA 3JXUA 4M3WA 3AAPA 2I5JA 1JCEA 4Z94A 3CXCM 4JI3K 1T05A 1EWQA 3DXKB 1ATSA 1C1CA 4K8XA 2NRVA 1EETA 1VSMA 1U49A 2RHKA 2GWJA 2VG5A 3OYNA 3U3YA 4JNEA 3QFUA 3VTIA 4B9VA 3E9LA 4DSKA 4K42A 4RG8A 4BRKA 3P1GA 3TTCA 3MAQA 4Y1CA 1VRUA 4B8CA 1NKEA 1O13A 1LV5A 4FJKA 3K2PA 4A62A 3P39A 3CF5L 4BR5A 3DXMA 3P83D 4RW4A 3QMLA 2QWMA 3THYB 3OTOK 2D0AA 2QXFA 3THWA 3WT0A 3TTFA 4H03B 3MN6A 4JI4K 1MA9B 4CBWA 1JJ2M 3UKUB 1D8YA 4YOXA 1L3UA 2QA4N 3Q7BA 1OH5A 5JLFA 1RDUA 4CGDA 3SPYA 4BRMA 5M1KA 3AARA 4GY2B 3KZBA 5KTQA 3A5OC 4B08A 2WOMA 4BE1A 2YNFA 4OX9K 2Q2RA 4CHZA 3LALA 3ENOA 4KTZA 2FBVA 4JI2K 5BN8A 4DFMA 2QK9A 4DSLA 2QI2A 3EE8A 4G9ZA 1WUAA 2A3ZA 4KB1A 4DR2K 3TABA 2NNWA 1SZ2A 2JLEA 3AO5A 3KWIA 4BRIA 1Q86O 2AA4A 1NGCA 4OPAA 4B3SK 3MX5A 2NLXA 1SKWA 2P9LB 2G8IA 4DV3K 1GLLO 1A5VA 1KVCA 1LAVA 4H5RA 4PHTX 5FPEA 1Q81O 1HYZA 2F4VK 4X62K 4CD1A 4CZKA 4LSLA 4DQ8A 5JS2A 4IG3A 3CJAA 4B9MA 2P9IB 1HKGA 1KFDA 4FWKA 3TAQA 3V9WA 2Q0UA 3ULEB 4KTQA 1OVQA 2W41A 3P4IA 5GINA 5GAHP 1YAGA 1GLFO 4BRFA 4E7IA 1ZBUA 1X9WA 1YJ9N 3VA3A 4O5BA 1TAQA 2O8EA 2RN2A 4DV5K 1LOTB 3QBWA 3C0BA 1FKOA 3KK2A 3LWMA 3VGMA 2ZGZA 4ID5A 1WB9A 3VQEA 4MO5A 4FCYA 1D9DA 3OYIA 2FF3B 4JI8K 4J2AA 4IDHA 1HNZK 1IKVA 3DLHA 1RBTA 3KK1A 4DV6K 5KQ8A 1CZAN 4BRNA 1FJGK 4DU4A 1X9SA 3WUHA 2UXBK 4QS7A 3CCMN 3O4QA 4DTJA 1CXQA 3HBTA 2HNZA 3BUZB 5KGXA 5AQXA 3ZX3A 3LDQA 3J7AP 3A2FA 4JS4A 1U6ZA 4U7BA 1ATNA 4E7HA 3FFKB 4W5NA 5M1PA 2GTDA 1RT4A 4EHUA 3V9SA 1S1TA 2G8HA 3R1XA 5HROA 4KHQA 3TAEA 3MXJA 4YDUC 1JXEA 5DM6L 3O9TA 2P9NB 4J2BA 3KLIA 1WN7A 4PKIA 2HNDA 1E3MA 1FXXA 4AM7A 4FM0A 3PX6A 1VQLN 3VF2A 3C6AA 3MEEA 2YX6A 3MECA 3QNNA 5AQNA 4DS5A 1SV5A 4DLEA 3EE9A 3K5OA 4AILC 3TAPA 4DTOA 3VEYA 1YIJN 3IS9A 4I6MA 1NBWA 4IOAL 5CZ1A 2FLOA 2XO7A 2ZWHA 4K25A 4KHYA 2OPRA 4LY7A 1VK0A 2KZMA 4FLYA 2O4IA 1VQPN 4FWRA 4X64K 3DWLA 4JKFA 3RSEA 1RCHA 4XEIA 4BVPA 1S1WA 3A8YA 3CERA 3TWHA 4CGGA 4DSFA 2WFBA 2PAVA 1TGOA 4DCHA 1D9FA 1Z26A 4FZXC 5KPTA 3NBPA 4OLBA 5GAEP 3OYJA 1C1BA 1EX4A 3M8RA 1YHQN 4B3MK 3B6PA 1MWMA 4BROA 2ZD1A 4C1NK 1KD1O 4FJJA 4WQ5C 2I7PA 2VWJA 4ISGA 4FJ8A 2HBMA 3J80O 3E66A 2O8FB 1ESVA 5EXWA 3ZSVA 1NU0A 3EY1A 4ICLA 4EZ6A 4BE2A 4FK2A 3K5LA 4BGAA 4CIGA 3ZT1A 4DWIA 3UKRA 1A5XA 2G8UA 3HI0A 1XHXA 1WBBA 3LDNA 3OYDA 4C8LA 1M1KO 3ZSRA 1K6YA 4B1VA 2P9UA 3FFIA 3O3GA 3CCVN 1W7AA 1WBDA 4JAXA 3O9RA 2ITGA 4M3RA 4FZYA 3VQCA 5KI6A 3SJHA 4FJIA 1N8RO 4NLCA 3EZWA 1NWKA 5AQZA 3MCAB 4M41A 1I94K 5KPZA 1DKGD 4XIUA 2D1KA 4I2QA 3HVTA 2F8SA 3DRSA 4B9LA 1JLGA 1T7PA 4FJ5A 1ZBIA 1ZXOA 3VQPA 4O44A 4CJUA 3S3NA 4ZTFA 4HTUA 3HRGA 3LAKA 3HM8A 4NXMK 3QLHA 1KAYA 4CE9A 4B9TA 3C94A 2YNGA 5EOYA 3W0LA 4Z4CA 4DF8A 1P90A 5HOOA 3ZEUB 3ZT3A 3O1BA 4RW7A 4CGHA 2XY6A 1NM1A 2QXLA 1BL3A 4RTFD 3L0QA 2WONA 1Y64A 5MLCQ 4M7XA 1ZYQA 4MQ3A 4AHRA 4JKDA 3V4IA 2DPNA 3CPWM 3F5TA 3QICA 5KQDA 2DFFA 4OJRA 4BG8A 5CR4A 4FK4A 2ASPA 4DQPA 4EP4A 3VESA 1WNSA 2Q3SA 1HYVA 1QQOA 3A5LC 4B1YB 4F3TA 4H4MA 3DRPA 4KFBA 4A2BA 4FVMA 1SAZA 1NK5A 4GW6A 1RBVA 1VSKA 3QEIA 4I7FA 3OJUA 3VQ8A 2CGLA 3IFRA 3O9SA 4ID1A 3TAFA 4DKWA 1TK5A 1HNWK 3V1OA 4OKJA 3B8AX 3M8PA 3LPUA 3QDKA 2QKKA 2NZTA 2CGJA 2P9PA 3K59A 3ZETA 4WE1A 1YT3A 4BRLA 1SS6A 5BR9A 2YHYA 4CEBA 4JD2B 4F9OA 2Z1HA 3ZSZA 1RFQA 4JK8A 4AM6A 4C8NA 1E4FT 2QM1A 1X3NA 2VWKA 4BG9A 3HVRA 2IVNA 2ZJPL 4DV1K 4Z4EA 3FGUA 3T1HK 3K57A 4CJVA 4DFKA 3QESA 3VN5A 1VQ5N 3C7NB 3OJSA 1BQMA 3OYAA 5AQPA 2NRTA 3MN9A 3HP6A 4DUZK 1KSPA 2HVIA 3PUFA 2PZSA 2XY8A 1XC9A 2PY5A 4PKGA 4E7JA 3I8BA 5FRNA 3LWLA 3LP1A 3RMAA 2Z1IA 4BRGA 1TKTA 4R5PA 1NJWA 1LWFA 3H6EA 1BA0A 2O8BB 3OHRA 3AVLA 3PSIA 3D45A 4K8ZA 1J53A 3ENBA 4RW8A 4W5RA 4JKCA 4CIFA 2YCHA 3SUPA 2X6SA 1NKBA 5SWMA 3FE1A 3QNOA 2VG6A 4IWVA 4DB3A 4O8UA 1HYSA 5TKYA 2JWKA 3WEEA 4H5TA 4WCEL 3OYCA 3SBGA 3AVKA 5BPMA 4AHSA 2HBJA 1JLBA 4UQGA 3CMEN 3C6HA 3L2UA 4LH5A 3VMFB 2E4LA 4WFAL 3DLGA 3L2QA 5AQQA 3THXA 5IT9O 3ZT0A 3ZCMA 3TANA 1U48A 3WNFA 1XQSC 4H5VA 4B8AB 3EL2A 1JL2A 1F21A 3AO4A 1XNQK 4N47A 1X1PA 4Z4HA 2O8CB 3IUCA 5AQJA 3R3LA 1TK8A 4AHCA 3WQTA 3ZSWA 5BPNA 4CZFA 4CFAA 3NH0A 4EIAA 4E19A 3CFRA 3QEWA 3QO9A 3QEVA 3LL3A 4DV2K 5KGWA 4CJFA 3SUNA 3VQ9A 1BWFO 2HNYA 1TUUA 4DTMA 3WXIA 5BRHA 5AZJA 4JI5K 4OLAA 3AA3A 4IG0A 4DR6K 2KLAA 1S1VA 4NYNA 1NGAA 3VQ7A 2P5OA 4FZZA 3DLBA 2F9TA 4BACA 1BI4B 4JI7K 1IKYA 1P8ZA 1C6VA 3I33A 3D2EA 4WYBA 4RWTA 4EZ9A 4CHQA 3C6UA 4JYAK 4EFHA 1IJJA 1KVBA 1LCUA 3SUQA 2D5RA 3UE5A 3D2FB 3QINA 1Y97A 4IEIA 3H1QA 3Q7CA 4CJQA 1HKCA 1UA1A 1OVYA 2GELA 1BHLA 1CLQA 5JLHA 4YOTA 4DHYA 4DLGA 1YXQA 4OKEA 4LF9K 3ITHA 4A5AA 3V1RA 2E1ZA 5ELZA 3L2VA 4IO9L 3KD1E 5CYQA 4EP5A 3I56N 1YVUA 2WBNA 4ELTA 4JHDA 4KHUA 2F7TA 2QWPA 4O8KA 2OANA 5DMRA 3O80A 1DLOA 1ITGA 4CFBA 3MXMA 3B6OA 4YOVA 4TSXA 1FKPA 1S9GA 1GLAG 1RT6A 4I9LA 1XUPO 1J5EK 4KHPK 1I3AA 5C25A 4E89A 3VERA 1GLDG 3F73A 1OKJA 3SI6A 3T3FA 5AQUA 1BU6O 1VSFA 3HK2A 4HHTA 4FWPA 4PL7A 1NLVA 1BQNA 1QE1A 4GNIA 3OYEA 4FWNA 1OH7A 1NK4A 2YHAA 5F1XA 2KZZA 2XRIA 4W5QA 4N56A 4DR5K 5K14A 3SQ2A 1X9MA 2DTUA 1RNHA 5AQVA 1JLFA 4DV7K 5BRDA 4QCLA 3SAHA 2VGNA 3F9KA 1RILA 2BANA 4LF5K 1DTTA 3H3OB 4WQ4C 5CHIA 1WSFA 2F9WA 4LFBK 3RMCA 1BIUA 4FVUA 1R59O 4G1QA 1VQKN 3O6WA 4CZJA 4W5OA 4F8RA 5JMVA 1U2VA 3VGLA 3ZX2A 3OA9A 1SL2A 2E88A 2V7YA 2Q0RA 3KK7A 1JLEA 5JS1A 4KH5A 3ZT2A 2Q36A 4YDUA 4K41A 1Q7YO 2UYTA 2P5GA 4HUEA 3THYA 2KHOA 1NJYA 2YHBA 1K9MO 3MCPA 4MDBA 3VENA 4BR4A 2BUPA 2ZGYA 4ZHRA 3TR8A 2PFUA 4XH1A 1TL3A 1QHAA 3UKUA 1VSIA 1TV6A 1KVAA 1KLNA 1R0AA 4KRFA 4O55A 1JL1A 3C95A 2D0PA 4LFAK 1LAWA 3BZKA 1D4XA 1GLEG 3ATUA 4C8OA 3ZSXA 3HZ6A 1RDBA 4BE0A 2HVHA 1GOAA 3DLKA 1LWEA 4NCGA 1KTQA 3UIQA 2HHVA 4JN4A 1NMNA 1JLCA 3I0RA 3EO3A 5GADP 3LDOA 4MDAA 1J5OA 3VQ5A 5GAGP 4Q5VA 3R9PA 4FOEA 2FBTA 2P9LA 5EVZA 1BCOA 4I2PA 2VQEK 3ZLJA 1YVNA 4WQ5A 3H45C 1YJNN 3BZCA 4KV8A 3VEXA 4CJTA 3A5NC 4CHYA 1Z05A 3GOIA 2YNHA 3PIOL 3QEPA 1KXPA 4DUYK 2FC0A 4H8KA 1HJOA 4YFUA 2HSTA 3HSCA 4LFCK 3S3OA 3ULEA 3DM2A 2IAJA 1EP4A 2HW3A 5LMUK 3HPOA 3I8DA 5DM7L 3OBYA 2YHXA 1QZ6A 1IG9A 4WFNL 1N32K 4KI6A 3AVFA 1E4GT 4B9UA 5AQIA 3RWUA 3AVHA 2AJQA 1V4SA 3SUOA 5FLXO 1Z6RA 3AO3A 2G8VA 2YI1A 3VF4A 2UUAK 4CIEA 3O9UA 3K9JA 1C1AA 3D6RA 1BCMA 4JKGB 4FL9A 3E1YA 3U6FA 4CJ4A 2D0CA 4FLZA 2KFNA 4J8FA 4FJHA 1NJIO 3RRHA 3O3HA 1Q9XA 3RR7A 4FPAA 5AQRA 3V9XA 1VQON 2FSKA 1NGHA 4FJGA 3CCJN 1QSYA 1VQMN 3CCUN 5T7BA 3A0IX 1L5UA 4B9SA 2HF3A 1EXQA 3TTDA 3O1WA 1EQYA 2Q1NA 3O4WA 1SL0A 3LP3A 4CK2A 4GVEA 3OYBA 1SKRA 3DYAA 5H1SQ 5KRSA 4JV5K 1HQEA 4CZMA 4OPKA 1NGFA 1QQMA 2P9NA 5AQYA 3OVNA 1RBRA 4CI6A 1YTUA 4FOIA 4RW9A 5GIOA 1YI2N 3OYFA 1ZBHA 4ZTJA 1N36K 1JCGA 2XHBA 3M8SA 4E1NA 1JLQA 4FO0A 5LY3A 4PY5A 4DTNA 4DQSA 4W5TA 3NMUA 3DOLA 5HRNA 1RTDA 3BP8A 3K5NA 1HNXK 4FXDA 3DLLL 1EO1A 2KW4A 4NB4A 2YV0X 2GX9A 4B1XB 3SPZA 4BDZA 3AGRA 4FW1A 4GVMA 1RGIA 1WAFA 3DI6A 5KPRA 3SNNA 1BDGA 3VA0A 3L4QA 3TSUA 4CD3A 1XI1A 4F2RA 2RKIA 2V52B 3VEZA 2FF6A 2Y1JA 4FJLA 2IVPA 2VQFK 2QWOA 3HP9A 1U47A 4NXNK 3AVAA 4JLHA 1S1XA 4J2DA 3SMPA 4M63C 4OPHA 3K9KA 3ALYA 3HOSA 1RT2A 2VWBA 2RE2A 4YY3K 1C0FA 5AQGA 3QFPA 4LF6K 4DR4K 4ILHA 4O0JA 3HT3A 4A57A 3DJCA 1KFSA 2O8FA 3R6MA 3PX4A 3E01A 1Q9YA 1U04A 4ILJA 3SYZA 1YITN 1L3VA 1YTAA 3P5JA 4C1NI 4CVNE 3CPEA 3KLFA 4KPYA 4IJNA 4JRQA 3KWGA 2NRHA 4OGCA 2R7YA 2D0BA 4DTUA 4CGJA 2E6MA 1HUXA 3WNHA 4NO7A 3IKMA 1ASUA 1KLMA 3CC4N 2YJEA 1W9HA 1REVA 4JI6K 3T1AA 5AQLA 3AVCA 1X9JA 4GV6A 4JS5A 4CJ5A 2IDOA 3EZ5A 3AA4A 1NJZA 4KH6A 4CGIA 1OH8A 4KREA 2YHWA 3T69A 4FWMA 3L2WA 3PV8A 1D5AA 4M3YA 2ASMA 3ASMA 1WSHA 2OTLN 1K8KB 3QB0A 5AQOA 3M5RA 3SZ2A 1NKCA 1YF5L 4CHPA 2ZQBA 4CF9A 1NK9A 4M7YA 4CCHA 1S22A 3VPZA 4YOWA 1VSDA 3FZMA 5AZIB 4KB0A 3U8XA 4CJPA 3HM9A 3D0PA 4CEOA 1DTQA 5AQWA 3J8AA 1XHZA 4A61A 5J2QA 4DFJA 4X65K 1VQ6N 3L8BA 3CIPA 4CJWA 3GL1A 3J7YP 4CF0A 3WXMB 3KKRA 4BR0A 1RTHA 1TKZA 4DS4A 3ZSYA 4CF1A 4YOUA 1NGDA 4IOXA 5FROA 3WNGA 3C6TA 4MO4A 3CI5A 1TK0A 1SQKA 3QIOA 4DSEA 4DF4A 4CEAA 3G0ZA 5C0YA 4NCAA 1IO2A 3RTVA 3P31A 4B3OA 4IOCL 1VSHA 4CEQA 1ASVA 3A5MC 4FWOA 3EKUA 4FM1A 4JD2A 5J2PA 4KHWA 3F2KA 4Z4IA 3SJJA 1T8EA 1RT5A 2ASOA 3CFPA 3CC2N 2HMPA 2QW9A 2KTQA 5I42A 2NRZA 2UXCK 4H0TB 3CJ9A 5AQMA 2E8AA 5C2FA 1IG8A 2B6AA 4CJRA 3PO5A 4M3TA 1I39A 5C24A 5C12A 3C7NA 3BY5A 1JXBA 2V7ZA 4FSVA 1QSLA 4A59A 3FLCO 1VRTA 3SCXA 5AQFA 5J2NA 4BVOA 2UUBK 4BRDA 4A5BA 3VEWA 3MK6A 4BQLA 4OGEA 4BGBA 3PIPL 4CESA 3G4SN 1JCFA 1YUWA 3MN7A 1HMVA 2D0OA 1B9FA 2E2PA 3T1YK 3AO2A 4CEEA 1CXUA 3FZFA 3J7ZO 3ISNC 3CM5A 3O8MA 1TYQB 3C65A 2HHWA 1C0MA 3OS2A 4HUGA 5ADXH 2XY5A 3QEXA 3LAMA 4DR7K 3PLAA 3NGYA 5TKWA 1VSEA 3CD6N 3HSTB 4MFBA 5BPLA 4IDKA 3TI0A 5BN9A 5AJ3K 3KKSA 2KFZA 4GKJK 1V4TA 3H3NO 1WOQA 4WQ4A 4FPBA 3G6EN 3FZLA 5JVGL 2ZM6K 3JS6A 5C42A 4BDPA 3O9QA 3NH1A 3VETA 2P9KB 4BWMA 3ATVA 3AV9A 3RR8A 3NF6A 2QWQA 4ELUA 3NCIA 3OYMA 2DY4A 4FLUA 3CYMA 2OZSA 3CJ7A 2OPSA 4FWLA 4X66K 4J2EA 4O4GA 5LJVA 4B1WB 5AZJB 1S72N 3MN5A 1HR0K 2O8CA 1T03A 5D3GA 4KO0A 3OYGA 4DTSA 1NGGA 1O1WA 1Z25A 3FR0A 1NK7A 2PYJA 2E2OA 3E9PA 4MLHA 3NGZA 4DV0K 4E0DA 1EWRA 3RMDA 2P9SB 3NVKA 4DMNA 2ZE2A 3O5BA 2G8KA 4CEDA 5C2DA 3NVMA 5J1EA 3JSMA 2BE2A 3MXIA 1TAUA 3CCQN 3ZSQA 5LMNK 2DFEA 2HB5A 3ENHA 4JI1K 2OA8A 3N4QA 4CJ7A 1KRPA 2NRXA 4UY8O 2ZJRL 1QS4A 1JLAA 4E1MA 1IKXA 2B5JA 3CJBA 3L4IA 4H0OA 4FM2A 3L6QA 4CK1A 4BC5A 2Q31A 1QQNA 1BI4A 1B9DA 5M1QA 4B1ZA 3GDQA 2PYLA 4DQRA 5ADXA 3H46O 3RMBA 2O8DA 4CHNA 3OS0A 3D2FA 4KTWA 4CECA 1H1VA 4FK0A 3THVA 4FJMA 3BEXA 4AQYK 4DU3A 1HQUA 1NMDA 1XWLA 1ASWA 2FBYA 2HHHK 1NGJA 3HL8A 3WNEA 3O3FA 3HJFA 4FYDA 2FSJA 4NLBA 1VQ8N 5B8HA 4IO8A 4BC3A 3TAMA 3CCSN 1FW6A 3JYTA 2Z1GA 2NUBA 1HLUA 1RDDA 2W40A 1LWCA 5AR0A 4OPJA 1NNEA 2A1SA 4LF4K 4IKFA 4JRPA 2IS3A 1B92A 4PUOA 3RVCA 4WF9L 3KK3A 1BUPA 2QEXN 3SV4A 3MMVA 1NK0A 3LDLA 4OO1J 3LDPA 5FPMA 4E7LA 3WXLA 4NYFA 4DTRA 4BREA 2OPPA 1LW0A 3W3DA 4AF1A 4DTPA 5KRTA 1KQSM 4R79A 2P1JA 2HHSA 1GOBA 3DXMB 3DXKA 3V1QA 2RF2A 2VCPA 4A2AA 4AHUA 3NDKA 2GUPA 1C0GA 3LP0A 2WTUA 3THWB 3LZJA 1IKWA 3GG4A 4CZHA 3FZHA 1XMQK 2DFHA 3CJCA 1U2VB 3QBXA 4CZGA 4ELVA 4FW2A 4CBXA 3SAGA 4C23A 1IBMK 2XY7A 2F8TA 4H5WA 5SZTA 3VQ4A 2HHTA 1NJXA 1XC3A 4CJSA 3RRGA 1UAXA 3DRRA 4CFCA 4JK9A 2A5XA 1U4BA 4B9NA 3NF7A 1HRHA 3BGRA 1BG3A 5AFUA 3NAEA 4CHOA 3IG1A 4LSNA 4IJAA 2PBDA 4JKEA 4L3QA 3AA5X 4DTXA 5HRRA 4GV9A 3CG7A 1BA1A 3I0SA 4V19S 4CF8A 1N5YA 3CHWA 1QVGM 4LD0A 3CMAN 2HHQA 4H0YB 4H5NA 4XH4A 1HNIA 2W6LA 2OCEA 3AVJA 4LH4A 1W0HA 4CJ3A 3OW2M 4FLTA 2A6AA 1WSEA 3MWPA 2E2NA 4YNQA 3VQBA 2HOEA 2W6KA 3NHGA 1VAZA 4IXCA 1KCFA 3AY9A 4CBUA 4BR2A 3S41A 2YKNA 4Z0UA 4PKHA 3U4LA 4KKOA 3HTVA 2UU9K 1K73O 1NGEA 5BREA 1QHTA 4B1UB 3MDQA 1RT7A 2O8EB 3T7ZA 2GV9A 4K43A 2H3GX 1RBUA 3K58A 1XMOK 2X78A 2X6NA 1GLJO 2P9IA 2ATQA 5IWAK 1RTIA 5EX5A 3TARA 1VQ4N 1WLJA 3G25A 4YHHK 3V6DA 4CZLA 2BGGA 5M1OA 3CFOA 2E5LK 2UXDK 3KLGA 1N33K 2JWLA 4GMJB 3HOTA 3SAFA 3SV3A 2V51B 1BIZA 4EAHD 5E41A 3VF6A 3V9UA 4YORA 1G15A 3HPHA 4PL8A 4HCBA 1U45A 4CK3A 4B9QA 3TU5A 4E7KA 3OS1A 2BDPA 1IH7A 4PA1A 1N34K 5GIPA 1IV0A 1K8AO 4FLWA 4HWIA 2F96A 4C8KA 4PWDA 3SQ0A 2ETJA 3AVGA 4GKKK 2Q97A 3AVIA 1VQ7N 3TAGA 3HPGA 2P51A 3L3UA 5A2QO 4JKGA 5LL6Z 4Z4FA 4BY9C 2CGKA 3ID8A 2FSNA 1W97L 1VQ9N 1WSIA 4RCHA 3NE6A 1CZBA 2HMIA 4Y1DA 4I6MB 4I9QA 2UUCK 1IBLK 4CEZA 2G8FA 4QS9A 1S6PA 1BOTO 2CH6A 4U67L 1TKDA 3AGKA 3AVMA 4LF7K 4DU1A 1UOCA 3O4NA 3V81A 2OZMA 1SKSA 3RSEB 1S6QA 5FPNA 5F2RA 3H1VX 4FJ7A 2RPIA 4Q0BA 1TVRA 3KIOA 1Q8IA 3IMXA 2KQ2A 3VEOA 3EEQA 2I7NA 5FPDA 4BC4A 4CJLA 4JEPA 1MU2A 2WUSA 1ZBFA 3CJ1A 3NGIA 3V9ZA 4QS8A 2BTFA 4CGFA 5AQSA 1RDAA 1RTJA 2EX3A 4BRHA 3MWTA 5JVHL 3OYKA 1L3TA 1S1UA 3I55N 3M3ZA 2OPQA 2YNIA 1FK9A 2GEMA 4F3OA 2EWSA 4O0IA 3D7EO 5BR8K 1SL1A 4B3TK 2E1YA 1ZBLA 1CZ9A 4FWQA 3UKRB 1GOCA 3S9HA 3LANA 1G99A 2HBKA 4LF8K 1T6CA 3VQDA 2P9UB 2A42A 4DQQA 3CQYA 1NOYA 3E9OA 4M45A 2GWKA 1QQCA 2WC9A 3MEGA 3CQ8A 1VSLA 1C0UA 3KTQA 1GLBG 3LP2A 4BDYA 4IZ9A 3ZX0A 3BDPA 1T3VA 1TUYA 1NOZA 3LM2A 5HRPA 2D4WA 1HPZA 2IGIA 1Q82O 3G10A 4N5SA 3NF9A 4FJXA 4JK7A 4H0VB 4MLEA 5BRFA 1VSJA 5EY4A 3M8QA 2E6LA 5C10A 2QKBA 4JKBA 5AQKA 1ZBSA 4N76A 1WSGA 2NRWA 3AA2A 1L3SA 3ID6A 1WAJA 2B4JA 4H0XB 4OKKA 4KAZA 3F9MA 4CJKA 1KAXA 1QVFM 4F4KA 4BRCA 2A40A 5M1NA 4XH5A 3DMJA 3NH2A 2IC3A 1NK6A 1BO5O 2IIRA 4QAGA 4AH9A 3ZEUA 4BRAA 4DR3K 4HVJA 4YOYA 3BF3A 3CETA 2A1RA 3LZIA 3NF8A 2W42A 3QIPA 1EKEA 4CEFA 2J4RA 1M90O 1SUQA 2IVOA 1K8KA 2HHUA 1HKBA 3ZT4A 3KHYA 2ZF5O 4M3XA 1BGXT 4QOZB 4AHTA 4KHSA 3VQAA 5I3UA 2P9PB 2X74A 4KH4A 3ZETB 4CF2A 3AAQA 3NFAA 3KJVA 3QERA 5AZIA 2ITMA 4HUFA 2GUIA 1RT1A 4C8MA 3L2RA 3SLCA 5DK5A 1GLCG 4FWSA 1HNVA 3CCLN 4O5FA 2Y1IA 4CZEA 3DLEA 3PY8A 5AQHA 1RBSA 5I9EB 5J2MA 3OYLA 4H0PA 1RDWX 4IFVA 3P38A 5HLFA 2KKZA 3U9DA 1QZ5A 2HF4A 4LC9B 3PSFA 1LW2A 1W2BM 3VEVA 5HRSA 3OY9A 2GBZA 2Z1JA 5FDLA 4DG1A 1RDCA 3CCEN 4DQIA 2NRRA 3H08A 4E3SA 4CJEA 3G71N 1UWBA 2YKMA 2VGMA 1A5WA 3TSQA 3AO1A 4JI0K 1C0TA 3MEDA 2HBLA 5EU7A 1WSJA 1ZC6A 4K0KK 1QSSA 2IOCA 3CM6A 4FLVA 5CYMA 1TKXA 3CQXA 3EKSA 3WEEB 4HCCA 4IFYA 1KAZA 1XNRK 2O8BA 2EHGA 1JKHA 2A41A 3KLHA 4BC2A 5CE3A 2JGUA 4CZIA 1TL1A 4M42A 5HP1A 3AVNA 4IFEA 4HTLA 4Y0WA 1J9AA 3L3VA 3DLRA 4ISEA 3EYZA 4CERA 3THXB 4ISFA 5AQTA 1J6ZA 3UB5A 3T19A 3VTHA 2QWNA 1HJRA 3U3GA 1UA0A 1S3XA 5C15A 4L8RB 3R8EA 3SBTA 5F0XA 2OYQA 2LSNA 4DSIA 1DEJA 4ILGB 1OH6A 5E84A 3KLEA 1TYQA 1RT3A 3GE1A 4KHNA 3N4PA 4OVLA 3TPQA 3WQUA 3SQ1A 3BF1A 4JKHA 4BRQA 3SK3A 3IRXA 3J81O 3JAMO 3KVGA 2G8WA 5HBMA 3HO1A 1DT9A 3WXKA 1NGBA 1DGKN 4FJ9A 4CFDA 4E1JA 3K0SA 1HPMA 1MWKA 2VYPA 2E20A 4NCBA 2OTJN 4DR1K 4RW6A 2P9KA 1ATRA 3PX0A 3S3MA 1NK8A 3FZKA 4M3ZA 3HYFA 4BQZA 1J54A 2E2QA 3ZSOA 1HX1A 5HL7L 4AHVA 4Z4GA 4IEEA 4F2SA 3U9ZA 3D2EB 4GV3A 5CZ2A 3CCRN 3LM9A 3ZYYX 2QWRA 1Q18A 1BISA 4BR7A 3LDSA 3M6GA 4CW7B 4DFPA 1T44A 1X3MA 3M1FA 3MX2A 4H4OA 4BR9A 4BRPA 3IAYA 4KBOA 2O4GA 4DV4K 2P9SA 3DOKA 2FBXA 2QTDA 5M1FA
chains in the Genus database with same CATH topology
4GVMA 4FW1A 4IBNA 4CJ3A 1WAFA 4CEBA 4FLTA 2Z1HA 1WSEA 3DI6A 3SNNA 3ZSZA 3K5MA 3VA0A 4YNQA 3VQBA 4C8NA 5CY4A 2VWKA 3HVRA 3ULDA 3NHGA 1XI1A 4F2RA 2RKIA 4Z4EA 1KCFA 4M3UA 2Y1JA 4FJLA 1N6QA 3K57A 2YKNA 4CJVA 4DFKA 3QESA 3HP9A 1U47A 3VN5A 4Z0UA 4BWJA 3AVAA 4JLHA 1S1XA 4KKOA 3OYHA 4E3SA 4J2DA 3VQQA 3SQ4A 5FRMA 3OJSA 1BQMA 3OYAA 3KD5E 3HP6A 3ALYA 1KSPA 3SPZA 2HVIA 1QHTA 1RT2A 4N41A 4DSJA 3PUFA 2VG7A 1RT7A 2PZSA 1S5JA 2XY8A 1XC9A 2GV9A 2PY5A 1RBUA 3K58A 4E7JA 1QTMA 2X78A 2X6NA 3LP1A 3LWLA 3AVBA 4FJNA 3RMAA 2ATQA 5FRNA 2Z1IA 1TKTA 4O0JA 4R5PA 1LWFA 1RTIA 3LPTA 3HT3A 4FLXA 3QETA 3TARA 3PO4A 1WLJA 1KFSA 4KI4A 3PX4A 3E01A 3AVLA 3V6DA 1Q9YA 2BGGA 1U04A 3CFOA 3D45A 4K8ZA 1J53A 4RW8A 4W5RA 3SYZA 4CIFA 3VQ6A 3SUPA 1S9EA 3KLGA 1L3VA 1YTAA 2X6SA 3P5JA 4GMJB 5SWMA 1NKBA 2HHXA 3SV3A 3HXMA 3QNOA 3KLFA 2VG6A 1BIZA 4KPYA 4M3WA 5E41A 4JRQA 2I5JA 3V9UA 4OGCA 2R7YA 1T05A 1G15A 1HYSA 2D0BA 3HPHA 4HCBA 1U45A 4CK3A 4DTUA 4CGJA 1C1CA 3OYCA 4K8XA 1EETA 2E6MA 3AVKA 4E7KA 1VSMA 4AHSA 3WNHA 3OS1A 1JLBA 4UQGA 1U49A 1ASUA 3OYNA 1KLMA 2VG5A 3L2UA 3U3YA 2BDPA 1W9HA 4LH5A 1IH7A 4PA1A 4B9VA 2E4LA 3DLGA 4FLWA 1REVA 2F96A 4C8KA 3T1AA 3L2QA 4DSKA 4PWDA 3AVCA 4RG8A 3SQ0A 3P1GA 3MAQA 4JS5A 4Y1CA 4CJ5A 1VRUA 4B8CA 2ETJA 2IDOA 1NKEA 1LV5A 3EZ5A 3AA4A 4FJKA 3AVGA 3K2PA 3ZT0A 3ZCMA 3TANA 1NJZA 3WNFA 4CGIA 1U48A 4KREA 3AVIA 3P83D 4RW4A 4B8AB 3L2WA 3TAGA 3HPGA 1JL2A 3PV8A 3AO4A 1F21A 2P51A 1D5AA 1NJWA 3L3UA 4N47A 1X1PA 2D0AA 4Z4HA 2QXFA 4M3YA 4Z4FA 3ASMA 1WSHA 1TK8A 4AHCA 1WSIA 3ZSWA 3NE6A 3SZ2A 1CZBA 4CF9A 4CHPA 2ZQBA 1NKCA 2HMIA 4Y1DA 4CFAA 3NH0A 1D8YA 1NK9A 1L3UA 4E19A 4I9QA 3CFRA 4CCHA 3QEWA 3QO9A 3QEVA 4CGDA 4CEZA 3SPYA 1VSDA 2G8FA 5KGWA 4CJFA 4KB0A 3HM9A 4CJPA 1S6PA 3D0PA 4CEOA 1DTQA 3SUNA 3VQ9A 1XHZA 5J2QA 1TKDA 2HNYA 3AVMA 5KTQA 4DTMA 4DU1A 1UOCA 3O4NA 4DFJA 3V81A 4WE1A 2OZMA 1SKSA 3L8BA 4B08A 2WOMA 4BE1A 4OLAA 1S6QA 4CJWA 2YNFA 3AA3A 4IG0A 4CF0A 4CHZA 3LALA 4FJ7A 1S1VA 2RPIA 3KKRA 4Q0BA 1TVRA 3KIOA 1Q8IA 2FBVA 4KTZA 4DFMA 2KQ2A 2QK9A 4DSLA 4NYNA 3VQ7A 2P5OA 4FZZA 1RTHA 3DLBA 4BACA 4CJLA 1BI4B 1TKZA 4KB1A 4DS4A 3TABA 1IKYA 1MU2A 1C6VA 2JLEA 3ZSYA 1ZBFA 3AO5A 3NGIA 3V9ZA 4CF1A 4CHQA 3C6UA 4EZ9A 1KVBA 4CGFA 5FROA 3WNGA 3SUQA 1RDAA 1RTJA 2D5RA 2EX3A 3C6TA 3QINA 1Y97A 1TK0A 1SKWA 3OYKA 4CJQA 2G8IA 1L3TA 1S1UA 1UA1A 3QIOA 4DSEA 4DF4A 1BHLA 1CLQA 4CEAA 2OPQA 2YNIA 1FK9A 3G0ZA 1A5VA 1IO2A 4DLGA 1KVCA 1LAVA 4NCAA 3RTVA 4F3OA 4B3OA 4OKEA 1VSHA 4O0IA 3ITHA 4CEQA 1SL1A 1ASVA 1HYZA 3V1RA 4FM1A 3L2VA 5J2PA 4KHWA 1ZBLA 4Z4IA 1CZ9A 3SJJA 1T8EA 1RT5A 4LSLA 3CFPA 3KD1E 1GOCA 5JS2A 3S9HA 4IG3A 5CYQA 4EP5A 3LANA 1YVUA 5I42A 4B9MA 2KTQA 1KFDA 3TAQA 4ELTA 3V9WA 4KTQA 3VQDA 4KHUA 4DQQA 2B6AA 4CJRA 1NOYA 3PO5A 4M3TA 4E7IA 1ZBUA 4M45A 1QQCA 1I39A 3CQ8A 3MEGA 5DMRA 5C24A 1VSLA 1X9WA 1DLOA 1ITGA 1C0UA 1JXBA 4CFBA 3VA3A 3MXMA 3KTQA 3B6OA 3LP2A 4BDYA 4TSXA 1FKPA 4O5BA 1TAQA 1S9GA 1QSLA 1RT6A 3BDPA 1VRTA 4I9LA 3SCXA 1NOZA 5J2NA 1I3AA 2RN2A 5C25A 5HRPA 4PQUA 2IGIA 1HPZA 4E89A 3F73A 3SI6A 3T3FA 1FKOA 3G10A 3KK2A 4N5SA 3LWMA 4ID5A 4OGEA 3NF9A 3VQEA 4FJXA 4CESA 4FCYA 1D9DA 1VSFA 3OYIA 4J2AA 3HK2A 4HHTA 1HMVA 1B9FA 1IKVA 1VSJA 3DLHA 3M8QA 1RBTA 2E6LA 3AO2A 4CEEA 1CXUA 2QKBA 1BQNA 1QE1A 3ISNC 3OYEA 3KK1A 3CM5A 1NK4A 2YHAA 4N76A 1WSGA 2KZZA 2XRIA 4W5QA 4DU4A 4N56A 1X9SA 5K14A 3SQ2A 2HHWA 1X9MA 2DTUA 3AA2A 1RNHA 1C0MA 1JLFA 3O4QA 3OS2A 4HUGA 4DTJA 1CXQA 2XY5A 3QEXA 1L3SA 3LAMA 3NGYA 2HNZA 4QCLA 1WAJA 2B4JA 5KGXA 1VSEA 3F9KA 3HSTB 4OKKA 4MFBA 1RILA 4KAZA 4CJKA 2HHUA 3A2FA 4IDKA 3TI0A 4JS4A 2BANA 3KKSA 4F4KA 2KFZA 1DTTA 1WSFA 3RMCA 3DMJA 3NH2A 2IC3A 1BIUA 1NK6A 4G1QA 4E7HA 4W5NA 4QAGA 1RT4A 5C42A 4W5OA 4BDPA 4F8RA 3V9SA 4AH9A 3NH1A 1S1TA 2G8HA 5HROA 4KHQA 4BWMA 1SL2A 3AV9A 3RR8A 3NF6A 3TAEA 4ELUA 2KZMA 4HVJA 3MXJA 1JLEA 3OYMA 1JXEA 3NCIA 2DY4A 2A1RA 5JS1A 4FLUA 3ZT2A 4J2BA 3CYMA 3KLIA 3LZIA 2OPSA 2OZSA 1WN7A 4J2EA 4O4GA 3NF8A 2W42A 3QIPA 1EKEA 2P5GA 4CEFA 4HUEA 2HNDA 1FXXA 4FM0A 3PX6A 1NJYA 2YHBA 1SUQA 3MEEA 3QNNA 3MECA 1T03A 5D3GA 4DS5A 4KO0A 1SV5A 3OYGA 4DTSA 1O1WA 1Z25A 1NK7A 4DLEA 4ZHRA 3K5OA 3TR8A 3ZT4A 4DTOA 4AILC 3NGZA 1TL3A 3TAPA 2PYJA 4E0DA 1BGXT 4M3XA 4QOZB 4AHTA 1VSIA 4KHSA 3VQAA 1TV6A 3IS9A 5I3UA 1KVAA 3RMDA 2X74A 1KLNA 1R0AA 5CZ1A 4DMNA 4O55A 2ZE2A 3NFAA 4CF2A 3KJVA 2XO7A 3QERA 4KHYA 1JL1A 2OPRA 4LY7A 2G8KA 1VK0A 4CEDA 5J1EA 3JSMA 3C95A 4HUFA 2BE2A 4FLYA 3MXIA 2O4IA 1TAUA 1LAWA 4C8OA 2GUIA 3ZSQA 3ZSXA 1RT1A 4C8MA 2DFEA 2HB5A 2OA8A 1RDBA 4BE0A 2HVHA 1GOAA 1KRPA 1RCHA 3L2RA 1S1WA 3DLKA 1QS4A 1JLAA 3TWHA 5DK5A 4CGGA 4DSFA 1HNVA 4E1MA 1IKXA 1LWEA 4KRFA 2Y1IA 2B5JA 1TGOA 4NCGA 4FM2A 3DLEA 3PY8A 1RBSA 1D9FA 4CK1A 3OYLA 1Z26A 5J2MA 1KTQA 4FZXC 3NBPA 1BI4A 3UIQA 4OLBA 1B9DA 2HHVA 3OYJA 1C1BA 1EX4A 1JLCA 3M8RA 4IFVA 3I0RA 2PYLA 4DQRA 5HLFA 3B6PA 3RMBA 1J5OA 3VQ5A 2ZD1A 4CHNA 4Q5VA 3OS0A 4KTWA 4CECA 4FJJA 4FK0A 1LW2A 3THVA 4FJMA 2FBTA 2VWJA 4FJ8A 4DU3A 1BCOA 4I2PA 1HQUA 5HRSA 3OY9A 1XWLA 2GBZA 2Z1JA 5FDLA 4DG1A 4KV8A 1RDCA 4DQIA 3RWUA 4C8LA 3H08A 3ZSVA 1ASWA 2FBYA 4CJEA 4CJTA 1UWBA 2YKMA 4ICLA 4CHYA 3EY1A 3HL8A 4EZ6A 4BE2A 2YNHA 1A5WA 3WNEA 4FK2A 3O3FA 3K5LA 4CIGA 3HJFA 4FYDA 3ZT1A 3QEPA 3AO1A 4DWIA 1A5XA 2G8UA 1C0TA 3MEDA 5EU7A 1XHXA 1WSJA 3TAMA 1QSSA 2FC0A 3OYDA 2IOCA 4H8KA 3CM6A 4YFUA 3JYTA 2Z1GA 4FLVA 2NUBA 5CYMA 1TKXA 3ZSRA 3S3OA 1RDDA 1K6YA 3DM2A 4HCCA 3FFIA 1LWCA 2IAJA 1EP4A 4IFYA 4OPJA 3O3GA 2HW3A 2A1SA 3HPOA 3I8DA 4IKFA 4JRPA 2EHGA 1JKHA 2ITGA 4M3RA 2IS3A 3VQCA 1B92A 5KI6A 3KLHA 4FZYA 4FJIA 4PUOA 3KK3A 1IG9A 2JGUA 1TL1A 3SV4A 5HP1A 3AVFA 3AVNA 4KI6A 4M42A 1NK0A 4B9UA 4M41A 1J9AA 3L3VA 4XIUA 4I2QA 4BDZA 3DLRA 3HVTA 3AVHA 4NYFA 3EYZA 4E7LA 4CERA 4DTRA 2AJQA 3SUOA 2OPPA 1LW0A 2F8SA 3DRSA 3AO3A 2G8VA 3T19A 4B9LA 4DTPA 5KRTA 3U3GA 1JLGA 1HJRA 1UA0A 1T7PA 4FJ5A 2P1JA 3VQPA 1GOBA 1ZBIA 2HHSA 4O44A 3V1QA 4CJUA 4L8RB 2RF2A 3S3NA 4ZTFA 4AHUA 4CIEA 4HTUA 2OYQA 2LSNA 4DSIA 3LAKA 3NDKA 1C1AA 1BCMA 3LP0A 3QLHA 4CE9A 3LZJA 1IKWA 3U6FA 3KLEA 3C94A 4CJ4A 4B9TA 2DFHA 1RT3A 2D0CA 4FLZA 2YNGA 2KFNA 4KHNA 4Z4CA 4OVLA 4DF8A 3ZT3A 4ELVA 4FW2A 4FJHA 3SQ1A 3RRHA 4RW7A 3O3HA 1Q9XA 3RR7A 4CGHA 2XY7A 3IRXA 2XY6A 1BL3A 2G8WA 2F8TA 5SZTA 3V9XA 2WONA 5HBMA 3HO1A 3VQ4A 2HHTA 1NJXA 4FJGA 1QSYA 4CJSA 3RRGA 1ZYQA 4MQ3A 4CFDA 5T7BA 1UAXA 4AHRA 4FJ9A 3DRRA 4CFCA 3V4IA 1U4BA 4B9NA 3NF7A 1L5UA 4B9SA 1HRHA 3BGRA 2DFFA 4OJRA 1EXQA 4NCBA 4FK4A 4DQPA 4M3ZA 4EP4A 1WNSA 2Q3SA 3NAEA 1HYVA 4RW6A 4F3TA 4CHOA 1SL0A 3PX0A 3LP3A 4H4MA 3S3MA 3IG1A 4LSNA 4CK2A 1NK8A 3DRPA 4KFBA 3OYBA 3HYFA 1SKRA 3AA5X 1J54A 3DYAA 4FVMA 5KRSA 1HQEA 4OPKA 4DTXA 1NK5A 4GW6A 5HRRA 1RBVA 1VSKA 3ZSOA 3QEIA 4I7FA 3OJUA 3OVNA 3VQ8A 1RBRA 4AHVA 4Z4GA 3CG7A 1YTUA 4RW9A 4F2SA 3I0SA 5CZ2A 1ZBHA 3OYFA 4ID1A 3TAFA 4CF8A 4ZTJA 1TK5A 1N5YA 2XHBA 3V1OA 4OKJA 4E1NA 3M8SA 1JLQA 3M8PA 3LPUA 4LD0A 2QKKA 4PY5A 1BISA 4DTNA 2HHQA 3LDSA 4DQSA 4DFPA 4W5TA 4H4OA 3DOLA 5HRNA 3IAYA 1HNIA 1RTDA 2O4GA 3K5NA 4FXDA 3DOKA 3K59A 2FBXA 2KW4A 3AVJA 2YV0X 4LH4A 1W0HA 1YT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GVM A;  4FW1 A;  4IBN A;  4CJ3 A;  1WAF A;  4CEB A;  4FLT A;  2Z1H A;  1WSE A;  3DI6 A;  3SNN A;  3ZSZ A;  3K5M A;  3VA0 A;  4YNQ A;  3VQB A;  4C8N A;  5CY4 A;  2VWK A;  3HVR A;  3ULD A;  3NHG A;  1XI1 A;  4F2R A;  2RKI A;  4Z4E A;  1KCF A;  4M3U A;  2Y1J A;  4FJL A;  1N6Q A;  3K57 A;  2YKN A;  4CJV A;  4DFK A;  3QES A;  3HP9 A;  1U47 A;  3VN5 A;  4Z0U A;  4BWJ A;  3AVA A;  4JLH A;  1S1X A;  4KKO A;  3OYH A;  4E3S A;  4J2D A;  3VQQ A;  3SQ4 A;  5FRM A;  3OJS A;  1BQM A;  3OYA A;  3KD5 E;  3HP6 A;  3ALY A;  1KSP A;  3SPZ A;  2HVI A;  1QHT A;  1RT2 A;  4N41 A;  4DSJ A;  3PUF A;  2VG7 A;  1RT7 A;  2PZS A;  1S5J A;  2XY8 A;  1XC9 A;  2GV9 A;  2PY5 A;  1RBU A;  3K58 A;  4E7J A;  1QTM A;  2X78 A;  2X6N A;  3LP1 A;  3LWL A;  3AVB A;  4FJN A;  3RMA A;  2ATQ A;  5FRN A;  2Z1I A;  1TKT A;  4O0J A;  4R5P A;  1LWF A;  1RTI A;  3LPT A;  3HT3 A;  4FLX A;  3QET A;  3TAR A;  3PO4 A;  1WLJ A;  1KFS A;  4KI4 A;  3PX4 A;  3E01 A;  3AVL A;  3V6D A;  1Q9Y A;  2BGG A;  1U04 A;  3CFO A;  3D45 A;  4K8Z A;  1J53 A;  4RW8 A;  4W5R A;  3SYZ A;  4CIF A;  3VQ6 A;  3SUP A;  1S9E A;  3KLG A;  1L3V A;  1YTA A;  2X6S A;  3P5J A;  4GMJ B;  5SWM A;  1NKB A;  2HHX A;  3SV3 A;  3HXM A;  3QNO A;  3KLF A;  2VG6 A;  1BIZ A;  4KPY A;  4M3W A;  5E41 A;  4JRQ A;  2I5J A;  3V9U A;  4OGC A;  2R7Y A;  1T05 A;  1G15 A;  1HYS A;  2D0B A;  3HPH A;  4HCB A;  1U45 A;  4CK3 A;  4DTU A;  4CGJ A;  1C1C A;  3OYC A;  4K8X A;  1EET A;  2E6M A;  3AVK A;  4E7K A;  1VSM A;  4AHS A;  3WNH A;  3OS1 A;  1JLB A;  4UQG A;  1U49 A;  1ASU A;  3OYN A;  1KLM A;  2VG5 A;  3L2U A;  3U3Y A;  2BDP A;  1W9H A;  4LH5 A;  1IH7 A;  4PA1 A;  4B9V A;  2E4L A;  3DLG A;  4FLW A;  1REV A;  2F96 A;  4C8K A;  3T1A A;  3L2Q A;  4DSK A;  4PWD A;  3AVC A;  4RG8 A;  3SQ0 A;  3P1G A;  3MAQ A;  4JS5 A;  4Y1C A;  4CJ5 A;  1VRU A;  4B8C A;  2ETJ A;  2IDO A;  1NKE A;  1LV5 A;  3EZ5 A;  3AA4 A;  4FJK A;  3AVG A;  3K2P A;  3ZT0 A;  3ZCM A;  3TAN A;  1NJZ A;  3WNF A;  4CGI A;  1U48 A;  4KRE A;  3AVI A;  3P83 D;  4RW4 A;  4B8A B;  3L2W A;  3TAG A;  3HPG A;  1JL2 A;  3PV8 A;  3AO4 A;  1F21 A;  2P51 A;  1D5A A;  1NJW A;  3L3U A;  4N47 A;  1X1P A;  2D0A A;  4Z4H A;  2QXF A;  4M3Y A;  4Z4F A;  3ASM A;  1WSH A;  1TK8 A;  4AHC A;  1WSI A;  3ZSW A;  3NE6 A;  3SZ2 A;  1CZB A;  4CF9 A;  4CHP A;  2ZQB A;  1NKC A;  2HMI A;  4Y1D A;  4CFA A;  3NH0 A;  1D8Y A;  1NK9 A;  1L3U A;  4E19 A;  4I9Q A;  3CFR A;  4CCH A;  3QEW A;  3QO9 A;  3QEV A;  4CGD A;  4CEZ A;  3SPY A;  1VSD A;  2G8F A;  5KGW A;  4CJF A;  4KB0 A;  3HM9 A;  4CJP A;  1S6P A;  3D0P A;  4CEO A;  1DTQ A;  3SUN A;  3VQ9 A;  1XHZ A;  5J2Q A;  1TKD A;  2HNY A;  3AVM A;  5KTQ A;  4DTM A;  4DU1 A;  1UOC A;  3O4N A;  4DFJ A;  3V81 A;  4WE1 A;  2OZM A;  1SKS A;  3L8B A;  4B08 A;  2WOM A;  4BE1 A;  4OLA A;  1S6Q A;  4CJW A;  2YNF A;  3AA3 A;  4IG0 A;  4CF0 A;  4CHZ A;  3LAL A;  4FJ7 A;  1S1V A;  2RPI A;  3KKR A;  4Q0B A;  1TVR A;  3KIO A;  1Q8I A;  2FBV A;  4KTZ A;  4DFM A;  2KQ2 A;  2QK9 A;  4DSL A;  4NYN A;  3VQ7 A;  2P5O A;  4FZZ A;  1RTH A;  3DLB A;  4BAC A;  4CJL A;  1BI4 B;  1TKZ A;  4KB1 A;  4DS4 A;  3TAB A;  1IKY A;  1MU2 A;  1C6V A;  2JLE A;  3ZSY A;  1ZBF A;  3AO5 A;  3NGI A;  3V9Z A;  4CF1 A;  4CHQ A;  3C6U A;  4EZ9 A;  1KVB A;  4CGF A;  5FRO A;  3WNG A;  3SUQ A;  1RDA A;  1RTJ A;  2D5R A;  2EX3 A;  3C6T A;  3QIN A;  1Y97 A;  1TK0 A;  1SKW A;  3OYK A;  4CJQ A;  2G8I A;  1L3T A;  1S1U A;  1UA1 A;  3QIO A;  4DSE A;  4DF4 A;  1BHL A;  1CLQ A;  4CEA A;  2OPQ A;  2YNI A;  1FK9 A;  3G0Z A;  1A5V A;  1IO2 A;  4DLG A;  1KVC A;  1LAV A;  4NCA A;  3RTV A;  4F3O A;  4B3O A;  4OKE A;  1VSH A;  4O0I A;  3ITH A;  4CEQ A;  1SL1 A;  1ASV A;  1HYZ A;  3V1R A;  4FM1 A;  3L2V A;  5J2P A;  4KHW A;  1ZBL A;  4Z4I A;  1CZ9 A;  3SJJ A;  1T8E A;  1RT5 A;  4LSL A;  3CFP A;  3KD1 E;  1GOC A;  5JS2 A;  3S9H A;  4IG3 A;  5CYQ A;  4EP5 A;  3LAN A;  1YVU A;  5I42 A;  4B9M A;  2KTQ A;  1KFD A;  3TAQ A;  4ELT A;  3V9W A;  4KTQ A;  3VQD A;  4KHU A;  4DQQ A;  2B6A A;  4CJR A;  1NOY A;  3PO5 A;  4M3T A;  4E7I A;  1ZBU A;  4M45 A;  1QQC A;  1I39 A;  3CQ8 A;  3MEG A;  5DMR A;  5C24 A;  1VSL A;  1X9W A;  1DLO A;  1ITG A;  1C0U A;  1JXB A;  4CFB A;  3VA3 A;  3MXM A;  3KTQ A;  3B6O A;  3LP2 A;  4BDY A;  4TSX A;  1FKP A;  4O5B A;  1TAQ A;  1S9G A;  1QSL A;  1RT6 A;  3BDP A;  1VRT A;  4I9L A;  3SCX A;  1NOZ A;  5J2N A;  1I3A A;  2RN2 A;  5C25 A;  5HRP A;  4PQU A;  2IGI A;  1HPZ A;  4E89 A;  3F73 A;  3SI6 A;  3T3F A;  1FKO A;  3G10 A;  3KK2 A;  4N5S A;  3LWM A;  4ID5 A;  4OGE A;  3NF9 A;  3VQE A;  4FJX A;  4CES A;  4FCY A;  1D9D A;  1VSF A;  3OYI A;  4J2A A;  3HK2 A;  4HHT A;  1HMV A;  1B9F A;  1IKV A;  1VSJ A;  3DLH A;  3M8Q A;  1RBT A;  2E6L A;  3AO2 A;  4CEE A;  1CXU A;  2QKB A;  1BQN A;  1QE1 A;  3ISN C;  3OYE A;  3KK1 A;  3CM5 A;  1NK4 A;  2YHA A;  4N76 A;  1WSG A;  2KZZ A;  2XRI A;  4W5Q A;  4DU4 A;  4N56 A;  1X9S A;  5K14 A;  3SQ2 A;  2HHW A;  1X9M A;  2DTU A;  3AA2 A;  1RNH A;  1C0M A;  1JLF A;  3O4Q A;  3OS2 A;  4HUG A;  4DTJ A;  1CXQ A;  2XY5 A;  3QEX A;  1L3S A;  3LAM A;  3NGY A;  2HNZ A;  4QCL A;  1WAJ A;  2B4J A;  5KGX A;  1VSE A;  3F9K A;  3HST B;  4OKK A;  4MFB A;  1RIL A;  4KAZ A;  4CJK A;  2HHU A;  3A2F A;  4IDK A;  3TI0 A;  4JS4 A;  2BAN A;  3KKS A;  4F4K A;  2KFZ A;  1DTT A;  1WSF A;  3RMC A;  3DMJ A;  3NH2 A;  2IC3 A;  1BIU A;  1NK6 A;  4G1Q A;  4E7H A;  4W5N A;  4QAG A;  1RT4 A;  5C42 A;  4W5O A;  4BDP A;  4F8R A;  3V9S A;  4AH9 A;  3NH1 A;  1S1T A;  2G8H A;  5HRO A;  4KHQ A;  4BWM A;  1SL2 A;  3AV9 A;  3RR8 A;  3NF6 A;  3TAE A;  4ELU A;  2KZM A;  4HVJ A;  3MXJ A;  1JLE A;  3OYM A;  1JXE A;  3NCI A;  2DY4 A;  2A1R A;  5JS1 A;  4FLU A;  3ZT2 A;  4J2B A;  3CYM A;  3KLI A;  3LZI A;  2OPS A;  2OZS A;  1WN7 A;  4J2E A;  4O4G A;  3NF8 A;  2W42 A;  3QIP A;  1EKE A;  2P5G A;  4CEF A;  4HUE A;  2HND A;  1FXX A;  4FM0 A;  3PX6 A;  1NJY A;  2YHB A;  1SUQ A;  3MEE A;  3QNN A;  3MEC A;  1T03 A;  5D3G A;  4DS5 A;  4KO0 A;  1SV5 A;  3OYG A;  4DTS A;  1O1W A;  1Z25 A;  1NK7 A;  4DLE A;  4ZHR A;  3K5O A;  3TR8 A;  3ZT4 A;  4DTO A;  4AIL C;  3NGZ A;  1TL3 A;  3TAP A;  2PYJ A;  4E0D A;  1BGX T;  4M3X A;  4QOZ B;  4AHT A;  1VSI A;  4KHS A;  3VQA A;  1TV6 A;  3IS9 A;  5I3U A;  1KVA A;  3RMD A;  2X74 A;  1KLN A;  1R0A A;  5CZ1 A;  4DMN A;  4O55 A;  2ZE2 A;  3NFA A;  4CF2 A;  3KJV A;  2XO7 A;  3QER A;  4KHY A;  1JL1 A;  2OPR A;  4LY7 A;  2G8K A;  1VK0 A;  4CED A;  5J1E A;  3JSM A;  3C95 A;  4HUF A;  2BE2 A;  4FLY A;  3MXI A;  2O4I A;  1TAU A;  1LAW A;  4C8O A;  2GUI A;  3ZSQ A;  3ZSX A;  1RT1 A;  4C8M A;  2DFE A;  2HB5 A;  2OA8 A;  1RDB A;  4BE0 A;  2HVH A;  1GOA A;  1KRP A;  1RCH A;  3L2R A;  1S1W A;  3DLK A;  1QS4 A;  1JLA A;  3TWH A;  5DK5 A;  4CGG A;  4DSF A;  1HNV A;  4E1M A;  1IKX A;  1LWE A;  4KRF A;  2Y1I A;  2B5J A;  1TGO A;  4NCG A;  4FM2 A;  3DLE A;  3PY8 A;  1RBS A;  1D9F A;  4CK1 A;  3OYL A;  1Z26 A;  5J2M A;  1KTQ A;  4FZX C;  3NBP A;  1BI4 A;  3UIQ A;  4OLB A;  1B9D A;  2HHV A;  3OYJ A;  1C1B A;  1EX4 A;  1JLC A;  3M8R A;  4IFV A;  3I0R A;  2PYL A;  4DQR A;  5HLF A;  3B6P A;  3RMB A;  1J5O A;  3VQ5 A;  2ZD1 A;  4CHN A;  4Q5V A;  3OS0 A;  4KTW A;  4CEC A;  4FJJ A;  4FK0 A;  1LW2 A;  3THV A;  4FJM A;  2FBT A;  2VWJ A;  4FJ8 A;  4DU3 A;  1BCO A;  4I2P A;  1HQU A;  5HRS A;  3OY9 A;  1XWL A;  2GBZ A;  2Z1J A;  5FDL A;  4DG1 A;  4KV8 A;  1RDC A;  4DQI A;  3RWU A;  4C8L A;  3H08 A;  3ZSV A;  1ASW A;  2FBY A;  4CJE A;  4CJT A;  1UWB A;  2YKM A;  4ICL A;  4CHY A;  3EY1 A;  3HL8 A;  4EZ6 A;  4BE2 A;  2YNH A;  1A5W A;  3WNE A;  4FK2 A;  3O3F A;  3K5L A;  4CIG A;  3HJF A;  4FYD A;  3ZT1 A;  3QEP A;  3AO1 A;  4DWI A;  1A5X A;  2G8U A;  1C0T A;  3MED A;  5EU7 A;  1XHX A;  1WSJ A;  3TAM A;  1QSS A;  2FC0 A;  3OYD A;  2IOC A;  4H8K A;  3CM6 A;  4YFU A;  3JYT A;  2Z1G A;  4FLV A;  2NUB A;  5CYM A;  1TKX A;  3ZSR A;  3S3O A;  1RDD A;  1K6Y A;  3DM2 A;  4HCC A;  3FFI A;  1LWC A;  2IAJ A;  1EP4 A;  4IFY A;  4OPJ A;  3O3G A;  2HW3 A;  2A1S A;  3HPO A;  3I8D A;  4IKF A;  4JRP A;  2EHG A;  1JKH A;  2ITG A;  4M3R A;  2IS3 A;  3VQC A;  1B92 A;  5KI6 A;  3KLH A;  4FZY A;  4FJI A;  4PUO A;  3KK3 A;  1IG9 A;  2JGU A;  1TL1 A;  3SV4 A;  5HP1 A;  3AVF A;  3AVN A;  4KI6 A;  4M42 A;  1NK0 A;  4B9U A;  4M41 A;  1J9A A;  3L3V A;  4XIU A;  4I2Q A;  4BDZ A;  3DLR A;  3HVT A;  3AVH A;  4NYF A;  3EYZ A;  4E7L A;  4CER A;  4DTR A;  2AJQ A;  3SUO A;  2OPP A;  1LW0 A;  2F8S A;  3DRS A;  3AO3 A;  2G8V A;  3T19 A;  4B9L A;  4DTP A;  5KRT A;  3U3G A;  1JLG A;  1HJR A;  1UA0 A;  1T7P A;  4FJ5 A;  2P1J A;  3VQP A;  1GOB A;  1ZBI A;  2HHS A;  4O44 A;  3V1Q A;  4CJU A;  4L8R B;  2RF2 A;  3S3N A;  4ZTF A;  4AHU A;  4CIE A;  4HTU A;  2OYQ A;  2LSN A;  4DSI A;  3LAK A;  3NDK A;  1C1A A;  1BCM A;  3LP0 A;  3QLH A;  4CE9 A;  3LZJ A;  1IKW A;  3U6F A;  3KLE A;  3C94 A;  4CJ4 A;  4B9T A;  2DFH A;  1RT3 A;  2D0C A;  4FLZ A;  2YNG A;  2KFN A;  4KHN A;  4Z4C A;  4OVL A;  4DF8 A;  3ZT3 A;  4ELV A;  4FW2 A;  4FJH A;  3SQ1 A;  3RRH A;  4RW7 A;  3O3H A;  1Q9X A;  3RR7 A;  4CGH A;  2XY7 A;  3IRX A;  2XY6 A;  1BL3 A;  2G8W A;  2F8T A;  5SZT A;  3V9X A;  2WON A;  5HBM A;  3HO1 A;  3VQ4 A;  2HHT A;  1NJX A;  4FJG A;  1QSY A;  4CJS A;  3RRG A;  1ZYQ A;  4MQ3 A;  4CFD A;  5T7B A;  1UAX A;  4AHR A;  4FJ9 A;  3DRR A;  4CFC A;  3V4I A;  1U4B A;  4B9N A;  3NF7 A;  1L5U A;  4B9S A;  1HRH A;  3BGR A;  2DFF A;  4OJR A;  1EXQ A;  4NCB A;  4FK4 A;  4DQP A;  4M3Z A;  4EP4 A;  1WNS A;  2Q3S A;  3NAE A;  1HYV A;  4RW6 A;  4F3T A;  4CHO A;  1SL0 A;  3PX0 A;  3LP3 A;  4H4M A;  3S3M A;  3IG1 A;  4LSN A;  4CK2 A;  1NK8 A;  3DRP A;  4KFB A;  3OYB A;  3HYF A;  1SKR A;  3AA5 X;  1J54 A;  3DYA A;  4FVM A;  5KRS A;  1HQE A;  4OPK A;  4DTX A;  1NK5 A;  4GW6 A;  5HRR A;  1RBV A;  1VSK A;  3ZSO A;  3QEI A;  4I7F A;  3OJU A;  3OVN A;  3VQ8 A;  1RBR A;  4AHV A;  4Z4G A;  3CG7 A;  1YTU A;  4RW9 A;  4F2S A;  3I0S A;  5CZ2 A;  1ZBH A;  3OYF A;  4ID1 A;  3TAF A;  4CF8 A;  4ZTJ A;  1TK5 A;  1N5Y A;  2XHB A;  3V1O A;  4OKJ A;  4E1N A;  3M8S A;  1JLQ A;  3M8P A;  3LPU A;  4LD0 A;  2QKK A;  4PY5 A;  1BIS A;  4DTN A;  2HHQ A;  3LDS A;  4DQS A;  4DFP A;  4W5T A;  4H4O A;  3DOL A;  5HRN A;  3IAY A;  1HNI A;  1RTD A;  2O4G A;  3K5N A;  4FXD A;  3DOK A;  3K59 A;  2FBX A;  2KW4 A;  3AVJ A;  2YV0 X;  4LH4 A;  1W0H A;  1YT3 A; 
#chains in the Genus database with same CATH topology
 3IDH A;  4B3R K;  4IBN A;  3CC7 N;  3K5M A;  2BH1 A;  1KC8 O;  1VHX A;  5CY4 A;  3GBT A;  5E26 A;  2AP1 A;  3ULD A;  2O8D B;  3VOV A;  2ZJQ L;  4JHD B;  5AFU H;  1MDU B;  2QWL A;  4M3U A;  1NGI A;  1N6Q A;  4EHT A;  4BWJ A;  3OYH A;  1YJW N;  3VQQ A;  3SQ4 A;  5FRM A;  3KD5 E;  4N41 A;  4WFB L;  4DSJ A;  3WXJ A;  2VG7 A;  2CH5 A;  3O08 A;  1S5J A;  3SMS A;  1QTM A;  3EN9 A;  3TSP A;  4FJN A;  3AVB A;  3OBW A;  2FXU A;  5LJW A;  3VGK A;  5JIC A;  3DAW A;  3QET A;  4PQU A;  4FLX A;  3LPT A;  3PO4 A;  2YJF A;  4KI4 A;  1NG9 A;  1T6D A;  1ILY A;  1VQN N;  1IBK K;  3VQ6 A;  1S9E A;  4JKA A;  2HHX A;  3HXM A;  3JXU A;  4M3W A;  3AAP A;  2I5J A;  1JCE A;  4Z94 A;  3CXC M;  4JI3 K;  1T05 A;  1EWQ A;  3DXK B;  1ATS A;  1C1C A;  4K8X A;  2NRV A;  1EET A;  1VSM A;  1U49 A;  2RHK A;  2GWJ A;  2VG5 A;  3OYN A;  3U3Y A;  4JNE A;  3QFU A;  3VTI A;  4B9V A;  3E9L A;  4DSK A;  4K42 A;  4RG8 A;  4BRK A;  3P1G A;  3TTC A;  3MAQ A;  4Y1C A;  1VRU A;  4B8C A;  1NKE A;  1O13 A;  1LV5 A;  4FJK A;  3K2P A;  4A62 A;  3P39 A;  3CF5 L;  4BR5 A;  3DXM A;  3P83 D;  4RW4 A;  3QML A;  2QWM A;  3THY B;  3OTO K;  2D0A A;  2QXF A;  3THW A;  3WT0 A;  3TTF A;  4H03 B;  3MN6 A;  4JI4 K;  1MA9 B;  4CBW A;  1JJ2 M;  3UKU B;  1D8Y A;  4YOX A;  1L3U A;  2QA4 N;  3Q7B A;  1OH5 A;  5JLF A;  1RDU A;  4CGD A;  3SPY A;  4BRM A;  5M1K A;  3AAR A;  4GY2 B;  3KZB A;  5KTQ A;  3A5O C;  4B08 A;  2WOM A;  4BE1 A;  2YNF A;  4OX9 K;  2Q2R A;  4CHZ A;  3LAL A;  3ENO A;  4KTZ A;  2FBV A;  4JI2 K;  5BN8 A;  4DFM A;  2QK9 A;  4DSL A;  2QI2 A;  3EE8 A;  4G9Z A;  1WUA A;  2A3Z A;  4KB1 A;  4DR2 K;  3TAB A;  2NNW A;  1SZ2 A;  2JLE A;  3AO5 A;  3KWI A;  4BRI A;  1Q86 O;  2AA4 A;  1NGC A;  4OPA A;  4B3S K;  3MX5 A;  2NLX A;  1SKW A;  2P9L B;  2G8I A;  4DV3 K;  1GLL O;  1A5V A;  1KVC A;  1LAV A;  4H5R A;  4PHT X;  5FPE A;  1Q81 O;  1HYZ A;  2F4V K;  4X62 K;  4CD1 A;  4CZK A;  4LSL A;  4DQ8 A;  5JS2 A;  4IG3 A;  3CJA A;  4B9M A;  2P9I B;  1HKG A;  1KFD A;  4FWK A;  3TAQ A;  3V9W A;  2Q0U A;  3ULE B;  4KTQ A;  1OVQ A;  2W41 A;  3P4I A;  5GIN A;  5GAH P;  1YAG A;  1GLF O;  4BRF A;  4E7I A;  1ZBU A;  1X9W A;  1YJ9 N;  3VA3 A;  4O5B A;  1TAQ A;  2O8E A;  2RN2 A;  4DV5 K;  1LOT B;  3QBW A;  3C0B A;  1FKO A;  3KK2 A;  3LWM A;  3VGM A;  2ZGZ A;  4ID5 A;  1WB9 A;  3VQE A;  4MO5 A;  4FCY A;  1D9D A;  3OYI A;  2FF3 B;  4JI8 K;  4J2A A;  4IDH A;  1HNZ K;  1IKV A;  3DLH A;  1RBT A;  3KK1 A;  4DV6 K;  5KQ8 A;  1CZA N;  4BRN A;  1FJG K;  4DU4 A;  1X9S A;  3WUH A;  2UXB K;  4QS7 A;  3CCM N;  3O4Q A;  4DTJ A;  1CXQ A;  3HBT A;  2HNZ A;  3BUZ B;  5KGX A;  5AQX A;  3ZX3 A;  3LDQ A;  3J7A P;  3A2F A;  4JS4 A;  1U6Z A;  4U7B A;  1ATN A;  4E7H A;  3FFK B;  4W5N A;  5M1P A;  2GTD A;  1RT4 A;  4EHU A;  3V9S A;  1S1T A;  2G8H A;  3R1X A;  5HRO A;  4KHQ A;  3TAE A;  3MXJ A;  4YDU C;  1JXE A;  5DM6 L;  3O9T A;  2P9N B;  4J2B A;  3KLI A;  1WN7 A;  4PKI A;  2HND A;  1E3M A;  1FXX A;  4AM7 A;  4FM0 A;  3PX6 A;  1VQL N;  3VF2 A;  3C6A A;  3MEE A;  2YX6 A;  3MEC A;  3QNN A;  5AQN A;  4DS5 A;  1SV5 A;  4DLE A;  3EE9 A;  3K5O A;  4AIL C;  3TAP A;  4DTO A;  3VEY A;  1YIJ N;  3IS9 A;  4I6M A;  1NBW A;  4IOA L;  5CZ1 A;  2FLO A;  2XO7 A;  2ZWH A;  4K25 A;  4KHY A;  2OPR A;  4LY7 A;  1VK0 A;  2KZM A;  4FLY A;  2O4I A;  1VQP N;  4FWR A;  4X64 K;  3DWL A;  4JKF A;  3RSE A;  1RCH A;  4XEI A;  4BVP A;  1S1W A;  3A8Y A;  3CER A;  3TWH A;  4CGG A;  4DSF A;  2WFB A;  2PAV A;  1TGO A;  4DCH A;  1D9F A;  1Z26 A;  4FZX C;  5KPT A;  3NBP A;  4OLB A;  5GAE P;  3OYJ A;  1C1B A;  1EX4 A;  3M8R A;  1YHQ N;  4B3M K;  3B6P A;  1MWM A;  4BRO A;  2ZD1 A;  4C1N K;  1KD1 O;  4FJJ A;  4WQ5 C;  2I7P A;  2VWJ A;  4ISG A;  4FJ8 A;  2HBM A;  3J80 O;  3E66 A;  2O8F B;  1ESV A;  5EXW A;  3ZSV A;  1NU0 A;  3EY1 A;  4ICL A;  4EZ6 A;  4BE2 A;  4FK2 A;  3K5L A;  4BGA A;  4CIG A;  3ZT1 A;  4DWI A;  3UKR A;  1A5X A;  2G8U A;  3HI0 A;  1XHX A;  1WBB A;  3LDN A;  3OYD A;  4C8L A;  1M1K O;  3ZSR A;  1K6Y A;  4B1V A;  2P9U A;  3FFI A;  3O3G A;  3CCV N;  1W7A A;  1WBD A;  4JAX A;  3O9R A;  2ITG A;  4M3R A;  4FZY A;  3VQC A;  5KI6 A;  3SJH A;  4FJI A;  1N8R O;  4NLC A;  3EZW A;  1NWK A;  5AQZ A;  3MCA B;  4M41 A;  1I94 K;  5KPZ A;  1DKG D;  4XIU A;  2D1K A;  4I2Q A;  3HVT A;  2F8S A;  3DRS A;  4B9L A;  1JLG A;  1T7P A;  4FJ5 A;  1ZBI A;  1ZXO A;  3VQP A;  4O44 A;  4CJU A;  3S3N A;  4ZTF A;  4HTU A;  3HRG A;  3LAK A;  3HM8 A;  4NXM K;  3QLH A;  1KAY A;  4CE9 A;  4B9T A;  3C94 A;  2YNG A;  5EOY A;  3W0L A;  4Z4C A;  4DF8 A;  1P90 A;  5HOO A;  3ZEU B;  3ZT3 A;  3O1B A;  4RW7 A;  4CGH A;  2XY6 A;  1NM1 A;  2QXL A;  1BL3 A;  4RTF D;  3L0Q A;  2WON A;  1Y64 A;  5MLC Q;  4M7X A;  1ZYQ A;  4MQ3 A;  4AHR A;  4JKD A;  3V4I A;  2DPN A;  3CPW M;  3F5T A;  3QIC A;  5KQD A;  2DFF A;  4OJR A;  4BG8 A;  5CR4 A;  4FK4 A;  2ASP A;  4DQP A;  4EP4 A;  3VES A;  1WNS A;  2Q3S A;  1HYV A;  1QQO A;  3A5L C;  4B1Y B;  4F3T A;  4H4M A;  3DRP A;  4KFB A;  4A2B A;  4FVM A;  1SAZ A;  1NK5 A;  4GW6 A;  1RBV A;  1VSK A;  3QEI A;  4I7F A;  3OJU A;  3VQ8 A;  2CGL A;  3IFR A;  3O9S A;  4ID1 A;  3TAF A;  4DKW A;  1TK5 A;  1HNW K;  3V1O A;  4OKJ A;  3B8A X;  3M8P A;  3LPU A;  3QDK A;  2QKK A;  2NZT A;  2CGJ A;  2P9P A;  3K59 A;  3ZET A;  4WE1 A;  1YT3 A;  4BRL A;  1SS6 A;  5BR9 A;  2YHY A;  4CEB A;  4JD2 B;  4F9O A;  2Z1H A;  3ZSZ A;  1RFQ A;  4JK8 A;  4AM6 A;  4C8N A;  1E4F T;  2QM1 A;  1X3N A;  2VWK A;  4BG9 A;  3HVR A;  2IVN A;  2ZJP L;  4DV1 K;  4Z4E A;  3FGU A;  3T1H K;  3K57 A;  4CJV A;  4DFK A;  3QES A;  3VN5 A;  1VQ5 N;  3C7N B;  3OJS A;  1BQM A;  3OYA A;  5AQP A;  2NRT A;  3MN9 A;  3HP6 A;  4DUZ K;  1KSP A;  2HVI A;  3PUF A;  2PZS A;  2XY8 A;  1XC9 A;  2PY5 A;  4PKG A;  4E7J A;  3I8B A;  5FRN A;  3LWL A;  3LP1 A;  3RMA A;  2Z1I A;  4BRG A;  1TKT A;  4R5P A;  1NJW A;  1LWF A;  3H6E A;  1BA0 A;  2O8B B;  3OHR A;  3AVL A;  3PSI A;  3D45 A;  4K8Z A;  1J53 A;  3ENB A;  4RW8 A;  4W5R A;  4JKC A;  4CIF A;  2YCH A;  3SUP A;  2X6S A;  1NKB A;  5SWM A;  3FE1 A;  3QNO A;  2VG6 A;  4IWV A;  4DB3 A;  4O8U A;  1HYS A;  5TKY A;  2JWK A;  3WEE A;  4H5T A;  4WCE L;  3OYC A;  3SBG A;  3AVK A;  5BPM A;  4AHS A;  2HBJ A;  1JLB A;  4UQG A;  3CME N;  3C6H A;  3L2U A;  4LH5 A;  3VMF B;  2E4L A;  4WFA L;  3DLG A;  3L2Q A;  5AQQ A;  3THX A;  5IT9 O;  3ZT0 A;  3ZCM A;  3TAN A;  1U48 A;  3WNF A;  1XQS C;  4H5V A;  4B8A B;  3EL2 A;  1JL2 A;  1F21 A;  3AO4 A;  1XNQ K;  4N47 A;  1X1P A;  4Z4H A;  2O8C B;  3IUC A;  5AQJ A;  3R3L A;  1TK8 A;  4AHC A;  3WQT A;  3ZSW A;  5BPN A;  4CZF A;  4CFA A;  3NH0 A;  4EIA A;  4E19 A;  3CFR A;  3QEW A;  3QO9 A;  3QEV A;  3LL3 A;  4DV2 K;  5KGW A;  4CJF A;  3SUN A;  3VQ9 A;  1BWF O;  2HNY A;  1TUU A;  4DTM A;  3WXI A;  5BRH A;  5AZJ A;  4JI5 K;  4OLA A;  3AA3 A;  4IG0 A;  4DR6 K;  2KLA A;  1S1V A;  4NYN A;  1NGA A;  3VQ7 A;  2P5O A;  4FZZ A;  3DLB A;  2F9T A;  4BAC A;  1BI4 B;  4JI7 K;  1IKY A;  1P8Z A;  1C6V A;  3I33 A;  3D2E A;  4WYB A;  4RWT A;  4EZ9 A;  4CHQ A;  3C6U A;  4JYA K;  4EFH A;  1IJJ A;  1KVB A;  1LCU A;  3SUQ A;  2D5R A;  3UE5 A;  3D2F B;  3QIN A;  1Y97 A;  4IEI A;  3H1Q A;  3Q7C A;  4CJQ A;  1HKC A;  1UA1 A;  1OVY A;  2GEL A;  1BHL A;  1CLQ A;  5JLH A;  4YOT A;  4DHY A;  4DLG A;  1YXQ A;  4OKE A;  4LF9 K;  3ITH A;  4A5A A;  3V1R A;  2E1Z A;  5ELZ A;  3L2V A;  4IO9 L;  3KD1 E;  5CYQ A;  4EP5 A;  3I56 N;  1YVU A;  2WBN A;  4ELT A;  4JHD A;  4KHU A;  2F7T A;  2QWP A;  4O8K A;  2OAN A;  5DMR A;  3O80 A;  1DLO A;  1ITG A;  4CFB A;  3MXM A;  3B6O A;  4YOV A;  4TSX A;  1FKP A;  1S9G A;  1GLA G;  1RT6 A;  4I9L A;  1XUP O;  1J5E K;  4KHP K;  1I3A A;  5C25 A;  4E89 A;  3VER A;  1GLD G;  3F73 A;  1OKJ A;  3SI6 A;  3T3F A;  5AQU A;  1BU6 O;  1VSF A;  3HK2 A;  4HHT A;  4FWP A;  4PL7 A;  1NLV A;  1BQN A;  1QE1 A;  4GNI A;  3OYE A;  4FWN A;  1OH7 A;  1NK4 A;  2YHA A;  5F1X A;  2KZZ A;  2XRI A;  4W5Q A;  4N56 A;  4DR5 K;  5K14 A;  3SQ2 A;  1X9M A;  2DTU A;  1RNH A;  5AQV A;  1JLF A;  4DV7 K;  5BRD A;  4QCL A;  3SAH A;  2VGN A;  3F9K A;  1RIL A;  2BAN A;  4LF5 K;  1DTT A;  3H3O B;  4WQ4 C;  5CHI A;  1WSF A;  2F9W A;  4LFB K;  3RMC A;  1BIU A;  4FVU A;  1R59 O;  4G1Q A;  1VQK N;  3O6W A;  4CZJ A;  4W5O A;  4F8R A;  5JMV A;  1U2V A;  3VGL A;  3ZX2 A;  3OA9 A;  1SL2 A;  2E88 A;  2V7Y A;  2Q0R A;  3KK7 A;  1JLE A;  5JS1 A;  4KH5 A;  3ZT2 A;  2Q36 A;  4YDU A;  4K41 A;  1Q7Y O;  2UYT A;  2P5G A;  4HUE A;  3THY A;  2KHO A;  1NJY A;  2YHB A;  1K9M O;  3MCP A;  4MDB A;  3VEN A;  4BR4 A;  2BUP A;  2ZGY A;  4ZHR A;  3TR8 A;  2PFU A;  4XH1 A;  1TL3 A;  1QHA A;  3UKU A;  1VSI A;  1TV6 A;  1KVA A;  1KLN A;  1R0A A;  4KRF A;  4O55 A;  1JL1 A;  3C95 A;  2D0P A;  4LFA K;  1LAW A;  3BZK A;  1D4X A;  1GLE G;  3ATU A;  4C8O A;  3ZSX A;  3HZ6 A;  1RDB A;  4BE0 A;  2HVH A;  1GOA A;  3DLK A;  1LWE A;  4NCG A;  1KTQ A;  3UIQ A;  2HHV A;  4JN4 A;  1NMN A;  1JLC A;  3I0R A;  3EO3 A;  5GAD P;  3LDO A;  4MDA A;  1J5O A;  3VQ5 A;  5GAG P;  4Q5V A;  3R9P A;  4FOE A;  2FBT A;  2P9L A;  5EVZ A;  1BCO A;  4I2P A;  2VQE K;  3ZLJ A;  1YVN A;  4WQ5 A;  3H45 C;  1YJN N;  3BZC A;  4KV8 A;  3VEX A;  4CJT A;  3A5N C;  4CHY A;  1Z05 A;  3GOI A;  2YNH A;  3PIO L;  3QEP A;  1KXP A;  4DUY K;  2FC0 A;  4H8K A;  1HJO A;  4YFU A;  2HST A;  3HSC A;  4LFC K;  3S3O A;  3ULE A;  3DM2 A;  2IAJ A;  1EP4 A;  2HW3 A;  5LMU K;  3HPO A;  3I8D A;  5DM7 L;  3OBY A;  2YHX A;  1QZ6 A;  1IG9 A;  4WFN L;  1N32 K;  4KI6 A;  3AVF A;  1E4G T;  4B9U A;  5AQI A;  3RWU A;  3AVH A;  2AJQ A;  1V4S A;  3SUO A;  5FLX O;  1Z6R A;  3AO3 A;  2G8V A;  2YI1 A;  3VF4 A;  2UUA K;  4CIE A;  3O9U A;  3K9J A;  1C1A A;  3D6R A;  1BCM A;  4JKG B;  4FL9 A;  3E1Y A;  3U6F A;  4CJ4 A;  2D0C A;  4FLZ A;  2KFN A;  4J8F A;  4FJH A;  1NJI O;  3RRH A;  3O3H A;  1Q9X A;  3RR7 A;  4FPA A;  5AQR A;  3V9X A;  1VQO N;  2FSK A;  1NGH A;  4FJG A;  3CCJ N;  1QSY A;  1VQM N;  3CCU N;  5T7B A;  3A0I X;  1L5U A;  4B9S A;  2HF3 A;  1EXQ A;  3TTD A;  3O1W A;  1EQY A;  2Q1N A;  3O4W A;  1SL0 A;  3LP3 A;  4CK2 A;  4GVE A;  3OYB A;  1SKR A;  3DYA A;  5H1S Q;  5KRS A;  4JV5 K;  1HQE A;  4CZM A;  4OPK A;  1NGF A;  1QQM A;  2P9N A;  5AQY A;  3OVN A;  1RBR A;  4CI6 A;  1YTU A;  4FOI A;  4RW9 A;  5GIO A;  1YI2 N;  3OYF A;  1ZBH A;  4ZTJ A;  1N36 K;  1JCG A;  2XHB A;  3M8S A;  4E1N A;  1JLQ A;  4FO0 A;  5LY3 A;  4PY5 A;  4DTN A;  4DQS A;  4W5T A;  3NMU A;  3DOL A;  5HRN A;  1RTD A;  3BP8 A;  3K5N A;  1HNX K;  4FXD A;  3DLL L;  1EO1 A;  2KW4 A;  4NB4 A;  2YV0 X;  2GX9 A;  4B1X B;  3SPZ A;  4BDZ A;  3AGR A;  4FW1 A;  4GVM A;  1RGI A;  1WAF A;  3DI6 A;  5KPR A;  3SNN A;  1BDG A;  3VA0 A;  3L4Q A;  3TSU A;  4CD3 A;  1XI1 A;  4F2R A;  2RKI A;  2V52 B;  3VEZ A;  2FF6 A;  2Y1J A;  4FJL A;  2IVP A;  2VQF K;  2QWO A;  3HP9 A;  1U47 A;  4NXN K;  3AVA A;  4JLH A;  1S1X A;  4J2D A;  3SMP A;  4M63 C;  4OPH A;  3K9K A;  3ALY A;  3HOS A;  1RT2 A;  2VWB A;  2RE2 A;  4YY3 K;  1C0F A;  5AQG A;  3QFP A;  4LF6 K;  4DR4 K;  4ILH A;  4O0J A;  3HT3 A;  4A57 A;  3DJC A;  1KFS A;  2O8F A;  3R6M A;  3PX4 A;  3E01 A;  1Q9Y A;  1U04 A;  4ILJ A;  3SYZ A;  1YIT N;  1L3V A;  1YTA A;  3P5J A;  4C1N I;  4CVN E;  3CPE A;  3KLF A;  4KPY A;  4IJN A;  4JRQ A;  3KWG A;  2NRH A;  4OGC A;  2R7Y A;  2D0B A;  4DTU A;  4CGJ A;  2E6M A;  1HUX A;  3WNH A;  4NO7 A;  3IKM A;  1ASU A;  1KLM A;  3CC4 N;  2YJE A;  1W9H A;  1REV A;  4JI6 K;  3T1A A;  5AQL A;  3AVC A;  1X9J A;  4GV6 A;  4JS5 A;  4CJ5 A;  2IDO A;  3EZ5 A;  3AA4 A;  1NJZ A;  4KH6 A;  4CGI A;  1OH8 A;  4KRE A;  2YHW A;  3T69 A;  4FWM A;  3L2W A;  3PV8 A;  1D5A A;  4M3Y A;  2ASM A;  3ASM A;  1WSH A;  2OTL N;  1K8K B;  3QB0 A;  5AQO A;  3M5R A;  3SZ2 A;  1NKC A;  1YF5 L;  4CHP A;  2ZQB A;  4CF9 A;  1NK9 A;  4M7Y A;  4CCH A;  1S22 A;  3VPZ A;  4YOW A;  1VSD A;  3FZM A;  5AZI B;  4KB0 A;  3U8X A;  4CJP A;  3HM9 A;  3D0P A;  4CEO A;  1DTQ A;  5AQW A;  3J8A A;  1XHZ A;  4A61 A;  5J2Q A;  4DFJ A;  4X65 K;  1VQ6 N;  3L8B A;  3CIP A;  4CJW A;  3GL1 A;  3J7Y P;  4CF0 A;  3WXM B;  3KKR A;  4BR0 A;  1RTH A;  1TKZ A;  4DS4 A;  3ZSY A;  4CF1 A;  4YOU A;  1NGD A;  4IOX A;  5FRO A;  3WNG A;  3C6T A;  4MO4 A;  3CI5 A;  1TK0 A;  1SQK A;  3QIO A;  4DSE A;  4DF4 A;  4CEA A;  3G0Z A;  5C0Y A;  4NCA A;  1IO2 A;  3RTV A;  3P31 A;  4B3O A;  4IOC L;  1VSH A;  4CEQ A;  1ASV A;  3A5M C;  4FWO A;  3EKU A;  4FM1 A;  4JD2 A;  5J2P A;  4KHW A;  3F2K A;  4Z4I A;  3SJJ A;  1T8E A;  1RT5 A;  2ASO A;  3CFP A;  3CC2 N;  2HMP A;  2QW9 A;  2KTQ A;  5I42 A;  2NRZ A;  2UXC K;  4H0T B;  3CJ9 A;  5AQM A;  2E8A A;  5C2F A;  1IG8 A;  2B6A A;  4CJR A;  3PO5 A;  4M3T A;  1I39 A;  5C24 A;  5C12 A;  3C7N A;  3BY5 A;  1JXB A;  2V7Z A;  4FSV A;  1QSL A;  4A59 A;  3FLC O;  1VRT A;  3SCX A;  5AQF A;  5J2N A;  4BVO A;  2UUB K;  4BRD A;  4A5B A;  3VEW A;  3MK6 A;  4BQL A;  4OGE A;  4BGB A;  3PIP L;  4CES A;  3G4S N;  1JCF A;  1YUW A;  3MN7 A;  1HMV A;  2D0O A;  1B9F A;  2E2P A;  3T1Y K;  3AO2 A;  4CEE A;  1CXU A;  3FZF A;  3J7Z O;  3ISN C;  3CM5 A;  3O8M A;  1TYQ B;  3C65 A;  2HHW A;  1C0M A;  3OS2 A;  4HUG A;  5ADX H;  2XY5 A;  3QEX A;  3LAM A;  4DR7 K;  3PLA A;  3NGY A;  5TKW A;  1VSE A;  3CD6 N;  3HST B;  4MFB A;  5BPL A;  4IDK A;  3TI0 A;  5BN9 A;  5AJ3 K;  3KKS A;  2KFZ A;  4GKJ K;  1V4T A;  3H3N O;  1WOQ A;  4WQ4 A;  4FPB A;  3G6E N;  3FZL A;  5JVG L;  2ZM6 K;  3JS6 A;  5C42 A;  4BDP A;  3O9Q A;  3NH1 A;  3VET A;  2P9K B;  4BWM A;  3ATV A;  3AV9 A;  3RR8 A;  3NF6 A;  2QWQ A;  4ELU A;  3NCI A;  3OYM A;  2DY4 A;  4FLU A;  3CYM A;  2OZS A;  3CJ7 A;  2OPS A;  4FWL A;  4X66 K;  4J2E A;  4O4G A;  5LJV A;  4B1W B;  5AZJ B;  1S72 N;  3MN5 A;  1HR0 K;  2O8C A;  1T03 A;  5D3G A;  4KO0 A;  3OYG A;  4DTS A;  1NGG A;  1O1W A;  1Z25 A;  3FR0 A;  1NK7 A;  2PYJ A;  2E2O A;  3E9P A;  4MLH A;  3NGZ A;  4DV0 K;  4E0D A;  1EWR A;  3RMD A;  2P9S B;  3NVK A;  4DMN A;  2ZE2 A;  3O5B A;  2G8K A;  4CED A;  5C2D A;  3NVM A;  5J1E A;  3JSM A;  2BE2 A;  3MXI A;  1TAU A;  3CCQ N;  3ZSQ A;  5LMN K;  2DFE A;  2HB5 A;  3ENH A;  4JI1 K;  2OA8 A;  3N4Q A;  4CJ7 A;  1KRP A;  2NRX A;  4UY8 O;  2ZJR L;  1QS4 A;  1JLA A;  4E1M A;  1IKX A;  2B5J A;  3CJB A;  3L4I A;  4H0O A;  4FM2 A;  3L6Q A;  4CK1 A;  4BC5 A;  2Q31 A;  1QQN A;  1BI4 A;  1B9D A;  5M1Q A;  4B1Z A;  3GDQ A;  2PYL A;  4DQR A;  5ADX A;  3H46 O;  3RMB A;  2O8D A;  4CHN A;  3OS0 A;  3D2F A;  4KTW A;  4CEC A;  1H1V A;  4FK0 A;  3THV A;  4FJM A;  3BEX A;  4AQY K;  4DU3 A;  1HQU A;  1NMD A;  1XWL A;  1ASW A;  2FBY A;  2HHH K;  1NGJ A;  3HL8 A;  3WNE A;  3O3F A;  3HJF A;  4FYD A;  2FSJ A;  4NLB A;  1VQ8 N;  5B8H A;  4IO8 A;  4BC3 A;  3TAM A;  3CCS N;  1FW6 A;  3JYT A;  2Z1G A;  2NUB A;  1HLU A;  1RDD A;  2W40 A;  1LWC A;  5AR0 A;  4OPJ A;  1NNE A;  2A1S A;  4LF4 K;  4IKF A;  4JRP A;  2IS3 A;  1B92 A;  4PUO A;  3RVC A;  4WF9 L;  3KK3 A;  1BUP A;  2QEX N;  3SV4 A;  3MMV A;  1NK0 A;  3LDL A;  4OO1 J;  3LDP A;  5FPM A;  4E7L A;  3WXL A;  4NYF A;  4DTR A;  4BRE A;  2OPP A;  1LW0 A;  3W3D A;  4AF1 A;  4DTP A;  5KRT A;  1KQS M;  4R79 A;  2P1J A;  2HHS A;  1GOB A;  3DXM B;  3DXK A;  3V1Q A;  2RF2 A;  2VCP A;  4A2A A;  4AHU A;  3NDK A;  2GUP A;  1C0G A;  3LP0 A;  2WTU A;  3THW B;  3LZJ A;  1IKW A;  3GG4 A;  4CZH A;  3FZH A;  1XMQ K;  2DFH A;  3CJC A;  1U2V B;  3QBX A;  4CZG A;  4ELV A;  4FW2 A;  4CBX A;  3SAG A;  4C23 A;  1IBM K;  2XY7 A;  2F8T A;  4H5W A;  5SZT A;  3VQ4 A;  2HHT A;  1NJX A;  1XC3 A;  4CJS A;  3RRG A;  1UAX A;  3DRR A;  4CFC A;  4JK9 A;  2A5X A;  1U4B A;  4B9N A;  3NF7 A;  1HRH A;  3BGR A;  1BG3 A;  5AFU A;  3NAE A;  4CHO A;  3IG1 A;  4LSN A;  4IJA A;  2PBD A;  4JKE A;  4L3Q A;  3AA5 X;  4DTX A;  5HRR A;  4GV9 A;  3CG7 A;  1BA1 A;  3I0S A;  4V19 S;  4CF8 A;  1N5Y A;  3CHW A;  1QVG M;  4LD0 A;  3CMA N;  2HHQ A;  4H0Y B;  4H5N A;  4XH4 A;  1HNI A;  2W6L A;  2OCE A;  3AVJ A;  4LH4 A;  1W0H A;  4CJ3 A;  3OW2 M;  4FLT A;  2A6A A;  1WSE A;  3MWP A;  2E2N A;  4YNQ A;  3VQB A;  2HOE A;  2W6K A;  3NHG A;  1VAZ A;  4IXC A;  1KCF A;  3AY9 A;  4CBU A;  4BR2 A;  3S41 A;  2YKN A;  4Z0U A;  4PKH A;  3U4L A;  4KKO A;  3HTV A;  2UU9 K;  1K73 O;  1NGE A;  5BRE A;  1QHT A;  4B1U B;  3MDQ A;  1RT7 A;  2O8E B;  3T7Z A;  2GV9 A;  4K43 A;  2H3G X;  1RBU A;  3K58 A;  1XMO K;  2X78 A;  2X6N A;  1GLJ O;  2P9I A;  2ATQ A;  5IWA K;  1RTI A;  5EX5 A;  3TAR A;  1VQ4 N;  1WLJ A;  3G25 A;  4YHH K;  3V6D A;  4CZL A;  2BGG A;  5M1O A;  3CFO A;  2E5L K;  2UXD K;  3KLG A;  1N33 K;  2JWL A;  4GMJ B;  3HOT A;  3SAF A;  3SV3 A;  2V51 B;  1BIZ A;  4EAH D;  5E41 A;  3VF6 A;  3V9U A;  4YOR A;  1G15 A;  3HPH A;  4PL8 A;  4HCB A;  1U45 A;  4CK3 A;  4B9Q A;  3TU5 A;  4E7K A;  3OS1 A;  2BDP A;  1IH7 A;  4PA1 A;  1N34 K;  5GIP A;  1IV0 A;  1K8A O;  4FLW A;  4HWI A;  2F96 A;  4C8K A;  4PWD A;  3SQ0 A;  2ETJ A;  3AVG A;  4GKK K;  2Q97 A;  3AVI A;  1VQ7 N;  3TAG A;  3HPG A;  2P51 A;  3L3U A;  5A2Q O;  4JKG A;  5LL6 Z;  4Z4F A;  4BY9 C;  2CGK A;  3ID8 A;  2FSN A;  1W97 L;  1VQ9 N;  1WSI A;  4RCH A;  3NE6 A;  1CZB A;  2HMI A;  4Y1D A;  4I6M B;  4I9Q A;  2UUC K;  1IBL K;  4CEZ A;  2G8F A;  4QS9 A;  1S6P A;  1BOT O;  2CH6 A;  4U67 L;  1TKD A;  3AGK A;  3AVM A;  4LF7 K;  4DU1 A;  1UOC A;  3O4N A;  3V81 A;  2OZM A;  1SKS A;  3RSE B;  1S6Q A;  5FPN A;  5F2R A;  3H1V X;  4FJ7 A;  2RPI A;  4Q0B A;  1TVR A;  3KIO A;  1Q8I A;  3IMX A;  2KQ2 A;  3VEO A;  3EEQ A;  2I7N A;  5FPD A;  4BC4 A;  4CJL A;  4JEP A;  1MU2 A;  2WUS A;  1ZBF A;  3CJ1 A;  3NGI A;  3V9Z A;  4QS8 A;  2BTF A;  4CGF A;  5AQS A;  1RDA A;  1RTJ A;  2EX3 A;  4BRH A;  3MWT A;  5JVH L;  3OYK A;  1L3T A;  1S1U A;  3I55 N;  3M3Z A;  2OPQ A;  2YNI A;  1FK9 A;  2GEM A;  4F3O A;  2EWS A;  4O0I A;  3D7E O;  5BR8 K;  1SL1 A;  4B3T K;  2E1Y A;  1ZBL A;  1CZ9 A;  4FWQ A;  3UKR B;  1GOC A;  3S9H A;  3LAN A;  1G99 A;  2HBK A;  4LF8 K;  1T6C A;  3VQD A;  2P9U B;  2A42 A;  4DQQ A;  3CQY A;  1NOY A;  3E9O A;  4M45 A;  2GWK A;  1QQC A;  2WC9 A;  3MEG A;  3CQ8 A;  1VSL A;  1C0U A;  3KTQ A;  1GLB G;  3LP2 A;  4BDY A;  4IZ9 A;  3ZX0 A;  3BDP A;  1T3V A;  1TUY A;  1NOZ A;  3LM2 A;  5HRP A;  2D4W A;  1HPZ A;  2IGI A;  1Q82 O;  3G10 A;  4N5S A;  3NF9 A;  4FJX A;  4JK7 A;  4H0V B;  4MLE A;  5BRF A;  1VSJ A;  5EY4 A;  3M8Q A;  2E6L A;  5C10 A;  2QKB A;  4JKB A;  5AQK A;  1ZBS A;  4N76 A;  1WSG A;  2NRW A;  3AA2 A;  1L3S A;  3ID6 A;  1WAJ A;  2B4J A;  4H0X B;  4OKK A;  4KAZ A;  3F9M A;  4CJK A;  1KAX A;  1QVF M;  4F4K A;  4BRC A;  2A40 A;  5M1N A;  4XH5 A;  3DMJ A;  3NH2 A;  2IC3 A;  1NK6 A;  1BO5 O;  2IIR A;  4QAG A;  4AH9 A;  3ZEU A;  4BRA A;  4DR3 K;  4HVJ A;  4YOY A;  3BF3 A;  3CET A;  2A1R A;  3LZI A;  3NF8 A;  2W42 A;  3QIP A;  1EKE A;  4CEF A;  2J4R A;  1M90 O;  1SUQ A;  2IVO A;  1K8K A;  2HHU A;  1HKB A;  3ZT4 A;  3KHY A;  2ZF5 O;  4M3X A;  1BGX T;  4QOZ B;  4AHT A;  4KHS A;  3VQA A;  5I3U A;  2P9P B;  2X74 A;  4KH4 A;  3ZET B;  4CF2 A;  3AAQ A;  3NFA A;  3KJV A;  3QER A;  5AZI A;  2ITM A;  4HUF A;  2GUI A;  1RT1 A;  4C8M A;  3L2R A;  3SLC A;  5DK5 A;  1GLC G;  4FWS A;  1HNV A;  3CCL N;  4O5F A;  2Y1I A;  4CZE A;  3DLE A;  3PY8 A;  5AQH A;  1RBS A;  5I9E B;  5J2M A;  3OYL A;  4H0P A;  1RDW X;  4IFV A;  3P38 A;  5HLF A;  2KKZ A;  3U9D A;  1QZ5 A;  2HF4 A;  4LC9 B;  3PSF A;  1LW2 A;  1W2B M;  3VEV A;  5HRS A;  3OY9 A;  2GBZ A;  2Z1J A;  5FDL A;  4DG1 A;  1RDC A;  3CCE N;  4DQI A;  2NRR A;  3H08 A;  4E3S A;  4CJE A;  3G71 N;  1UWB A;  2YKM A;  2VGM A;  1A5W A;  3TSQ A;  3AO1 A;  4JI0 K;  1C0T A;  3MED A;  2HBL A;  5EU7 A;  1WSJ A;  1ZC6 A;  4K0K K;  1QSS A;  2IOC A;  3CM6 A;  4FLV A;  5CYM A;  1TKX A;  3CQX A;  3EKS A;  3WEE B;  4HCC A;  4IFY A;  1KAZ A;  1XNR K;  2O8B A;  2EHG A;  1JKH A;  2A41 A;  3KLH A;  4BC2 A;  5CE3 A;  2JGU A;  4CZI A;  1TL1 A;  4M42 A;  5HP1 A;  3AVN A;  4IFE A;  4HTL A;  4Y0W A;  1J9A A;  3L3V A;  3DLR A;  4ISE A;  3EYZ A;  4CER A;  3THX B;  4ISF A;  5AQT A;  1J6Z A;  3UB5 A;  3T19 A;  3VTH A;  2QWN A;  1HJR A;  3U3G A;  1UA0 A;  1S3X A;  5C15 A;  4L8R B;  3R8E A;  3SBT A;  5F0X A;  2OYQ A;  2LSN A;  4DSI A;  1DEJ A;  4ILG B;  1OH6 A;  5E84 A;  3KLE A;  1TYQ A;  1RT3 A;  3GE1 A;  4KHN A;  3N4P A;  4OVL A;  3TPQ A;  3WQU A;  3SQ1 A;  3BF1 A;  4JKH A;  4BRQ A;  3SK3 A;  3IRX A;  3J81 O;  3JAM O;  3KVG A;  2G8W A;  5HBM A;  3HO1 A;  1DT9 A;  3WXK A;  1NGB A;  1DGK N;  4FJ9 A;  4CFD A;  4E1J A;  3K0S A;  1HPM A;  1MWK A;  2VYP A;  2E20 A;  4NCB A;  2OTJ N;  4DR1 K;  4RW6 A;  2P9K A;  1ATR A;  3PX0 A;  3S3M A;  1NK8 A;  3FZK A;  4M3Z A;  3HYF A;  4BQZ A;  1J54 A;  2E2Q A;  3ZSO A;  1HX1 A;  5HL7 L;  4AHV A;  4Z4G A;  4IEE A;  4F2S A;  3U9Z A;  3D2E B;  4GV3 A;  5CZ2 A;  3CCR N;  3LM9 A;  3ZYY X;  2QWR A;  1Q18 A;  1BIS A;  4BR7 A;  3LDS A;  3M6G A;  4CW7 B;  4DFP A;  1T44 A;  1X3M A;  3M1F A;  3MX2 A;  4H4O A;  4BR9 A;  4BRP A;  3IAY A;  4KBO A;  2O4G A;  4DV4 K;  2P9S A;  3DOK A;  2FBX A;  2QTD A;  5M1F A; 
#chains in the Genus database with same CATH homology
 4GVM A;  4FW1 A;  4IBN A;  4CJ3 A;  1WAF A;  4CEB A;  4FLT A;  2Z1H A;  1WSE A;  3DI6 A;  3SNN A;  3ZSZ A;  3K5M A;  3VA0 A;  4YNQ A;  3VQB A;  4C8N A;  5CY4 A;  2VWK A;  3HVR A;  3ULD A;  3NHG A;  1XI1 A;  4F2R A;  2RKI A;  4Z4E A;  1KCF A;  4M3U A;  2Y1J A;  4FJL A;  1N6Q A;  3K57 A;  2YKN A;  4CJV A;  4DFK A;  3QES A;  3HP9 A;  1U47 A;  3VN5 A;  4Z0U A;  4BWJ A;  3AVA A;  4JLH A;  1S1X A;  4KKO A;  3OYH A;  4E3S A;  4J2D A;  3VQQ A;  3SQ4 A;  5FRM A;  3OJS A;  1BQM A;  3OYA A;  3KD5 E;  3HP6 A;  3ALY A;  1KSP A;  3SPZ A;  2HVI A;  1QHT A;  1RT2 A;  4N41 A;  4DSJ A;  3PUF A;  2VG7 A;  1RT7 A;  2PZS A;  1S5J A;  2XY8 A;  1XC9 A;  2GV9 A;  2PY5 A;  1RBU A;  3K58 A;  4E7J A;  1QTM A;  2X78 A;  2X6N A;  3LP1 A;  3LWL A;  3AVB A;  4FJN A;  3RMA A;  2ATQ A;  5FRN A;  2Z1I A;  1TKT A;  4O0J A;  4R5P A;  1LWF A;  1RTI A;  3LPT A;  3HT3 A;  4FLX A;  3QET A;  3TAR A;  3PO4 A;  1WLJ A;  1KFS A;  4KI4 A;  3PX4 A;  3E01 A;  3AVL A;  3V6D A;  1Q9Y A;  2BGG A;  1U04 A;  3CFO A;  3D45 A;  4K8Z A;  1J53 A;  4RW8 A;  4W5R A;  3SYZ A;  4CIF A;  3VQ6 A;  3SUP A;  1S9E A;  3KLG A;  1L3V A;  1YTA A;  2X6S A;  3P5J A;  4GMJ B;  5SWM A;  1NKB A;  2HHX A;  3SV3 A;  3HXM A;  3QNO A;  3KLF A;  2VG6 A;  1BIZ A;  4KPY A;  4M3W A;  5E41 A;  4JRQ A;  2I5J A;  3V9U A;  4OGC A;  2R7Y A;  1T05 A;  1G15 A;  1HYS A;  2D0B A;  3HPH A;  4HCB A;  1U45 A;  4CK3 A;  4DTU A;  4CGJ A;  1C1C A;  3OYC A;  4K8X A;  1EET A;  2E6M A;  3AVK A;  4E7K A;  1VSM A;  4AHS A;  3WNH A;  3OS1 A;  1JLB A;  4UQG A;  1U49 A;  1ASU A;  3OYN A;  1KLM A;  2VG5 A;  3L2U A;  3U3Y A;  2BDP A;  1W9H A;  4LH5 A;  1IH7 A;  4PA1 A;  4B9V A;  2E4L A;  3DLG A;  4FLW A;  1REV A;  2F96 A;  4C8K A;  3T1A A;  3L2Q A;  4DSK A;  4PWD A;  3AVC A;  4RG8 A;  3SQ0 A;  3P1G A;  3MAQ A;  4JS5 A;  4Y1C A;  4CJ5 A;  1VRU A;  4B8C A;  2ETJ A;  2IDO A;  1NKE A;  1LV5 A;  3EZ5 A;  3AA4 A;  4FJK A;  3AVG A;  3K2P A;  3ZT0 A;  3ZCM A;  3TAN A;  1NJZ A;  3WNF A;  4CGI A;  1U48 A;  4KRE A;  3AVI A;  3P83 D;  4RW4 A;  4B8A B;  3L2W A;  3TAG A;  3HPG A;  1JL2 A;  3PV8 A;  3AO4 A;  1F21 A;  2P51 A;  1D5A A;  1NJW A;  3L3U A;  4N47 A;  1X1P A;  2D0A A;  4Z4H A;  2QXF A;  4M3Y A;  4Z4F A;  3ASM A;  1WSH A;  1TK8 A;  4AHC A;  1WSI A;  3ZSW A;  3NE6 A;  3SZ2 A;  1CZB A;  4CF9 A;  4CHP A;  2ZQB A;  1NKC A;  2HMI A;  4Y1D A;  4CFA A;  3NH0 A;  1D8Y A;  1NK9 A;  1L3U A;  4E19 A;  4I9Q A;  3CFR A;  4CCH A;  3QEW A;  3QO9 A;  3QEV A;  4CGD A;  4CEZ A;  3SPY A;  1VSD A;  2G8F A;  5KGW A;  4CJF A;  4KB0 A;  3HM9 A;  4CJP A;  1S6P A;  3D0P A;  4CEO A;  1DTQ A;  3SUN A;  3VQ9 A;  1XHZ A;  5J2Q A;  1TKD A;  2HNY A;  3AVM A;  5KTQ A;  4DTM A;  4DU1 A;  1UOC A;  3O4N A;  4DFJ A;  3V81 A;  4WE1 A;  2OZM A;  1SKS A;  3L8B A;  4B08 A;  2WOM A;  4BE1 A;  4OLA A;  1S6Q A;  4CJW A;  2YNF A;  3AA3 A;  4IG0 A;  4CF0 A;  4CHZ A;  3LAL A;  4FJ7 A;  1S1V A;  2RPI A;  3KKR A;  4Q0B A;  1TVR A;  3KIO A;  1Q8I A;  2FBV A;  4KTZ A;  4DFM A;  2KQ2 A;  2QK9 A;  4DSL A;  4NYN A;  3VQ7 A;  2P5O A;  4FZZ A;  1RTH A;  3DLB A;  4BAC A;  4CJL A;  1BI4 B;  1TKZ A;  4KB1 A;  4DS4 A;  3TAB A;  1IKY A;  1MU2 A;  1C6V A;  2JLE A;  3ZSY A;  1ZBF A;  3AO5 A;  3NGI A;  3V9Z A;  4CF1 A;  4CHQ A;  3C6U A;  4EZ9 A;  1KVB A;  4CGF A;  5FRO A;  3WNG A;  3SUQ A;  1RDA A;  1RTJ A;  2D5R A;  2EX3 A;  3C6T A;  3QIN A;  1Y97 A;  1TK0 A;  1SKW A;  3OYK A;  4CJQ A;  2G8I A;  1L3T A;  1S1U A;  1UA1 A;  3QIO A;  4DSE A;  4DF4 A;  1BHL A;  1CLQ A;  4CEA A;  2OPQ A;  2YNI A;  1FK9 A;  3G0Z A;  1A5V A;  1IO2 A;  4DLG A;  1KVC A;  1LAV A;  4NCA A;  3RTV A;  4F3O A;  4B3O A;  4OKE A;  1VSH A;  4O0I A;  3ITH A;  4CEQ A;  1SL1 A;  1ASV A;  1HYZ A;  3V1R A;  4FM1 A;  3L2V A;  5J2P A;  4KHW A;  1ZBL A;  4Z4I A;  1CZ9 A;  3SJJ A;  1T8E A;  1RT5 A;  4LSL A;  3CFP A;  3KD1 E;  1GOC A;  5JS2 A;  3S9H A;  4IG3 A;  5CYQ A;  4EP5 A;  3LAN A;  1YVU A;  5I42 A;  4B9M A;  2KTQ A;  1KFD A;  3TAQ A;  4ELT A;  3V9W A;  4KTQ A;  3VQD A;  4KHU A;  4DQQ A;  2B6A A;  4CJR A;  1NOY A;  3PO5 A;  4M3T A;  4E7I A;  1ZBU A;  4M45 A;  1QQC A;  1I39 A;  3CQ8 A;  3MEG A;  5DMR A;  5C24 A;  1VSL A;  1X9W A;  1DLO A;  1ITG A;  1C0U A;  1JXB A;  4CFB A;  3VA3 A;  3MXM A;  3KTQ A;  3B6O A;  3LP2 A;  4BDY A;  4TSX A;  1FKP A;  4O5B A;  1TAQ A;  1S9G A;  1QSL A;  1RT6 A;  3BDP A;  1VRT A;  4I9L A;  3SCX A;  1NOZ A;  5J2N A;  1I3A A;  2RN2 A;  5C25 A;  5HRP A;  4PQU A;  2IGI A;  1HPZ A;  4E89 A;  3F73 A;  3SI6 A;  3T3F A;  1FKO A;  3G10 A;  3KK2 A;  4N5S A;  3LWM A;  4ID5 A;  4OGE A;  3NF9 A;  3VQE A;  4FJX A;  4CES A;  4FCY A;  1D9D A;  1VSF A;  3OYI A;  4J2A A;  3HK2 A;  4HHT A;  1HMV A;  1B9F A;  1IKV A;  1VSJ A;  3DLH A;  3M8Q A;  1RBT A;  2E6L A;  3AO2 A;  4CEE A;  1CXU A;  2QKB A;  1BQN A;  1QE1 A;  3ISN C;  3OYE A;  3KK1 A;  3CM5 A;  1NK4 A;  2YHA A;  4N76 A;  1WSG A;  2KZZ A;  2XRI A;  4W5Q A;  4DU4 A;  4N56 A;  1X9S A;  5K14 A;  3SQ2 A;  2HHW A;  1X9M A;  2DTU A;  3AA2 A;  1RNH A;  1C0M A;  1JLF A;  3O4Q A;  3OS2 A;  4HUG A;  4DTJ A;  1CXQ A;  2XY5 A;  3QEX A;  1L3S A;  3LAM A;  3NGY A;  2HNZ A;  4QCL A;  1WAJ A;  2B4J A;  5KGX A;  1VSE A;  3F9K A;  3HST B;  4OKK A;  4MFB A;  1RIL A;  4KAZ A;  4CJK A;  2HHU A;  3A2F A;  4IDK A;  3TI0 A;  4JS4 A;  2BAN A;  3KKS A;  4F4K A;  2KFZ A;  1DTT A;  1WSF A;  3RMC A;  3DMJ A;  3NH2 A;  2IC3 A;  1BIU A;  1NK6 A;  4G1Q A;  4E7H A;  4W5N A;  4QAG A;  1RT4 A;  5C42 A;  4W5O A;  4BDP A;  4F8R A;  3V9S A;  4AH9 A;  3NH1 A;  1S1T A;  2G8H A;  5HRO A;  4KHQ A;  4BWM A;  1SL2 A;  3AV9 A;  3RR8 A;  3NF6 A;  3TAE A;  4ELU A;  2KZM A;  4HVJ A;  3MXJ A;  1JLE A;  3OYM A;  1JXE A;  3NCI A;  2DY4 A;  2A1R A;  5JS1 A;  4FLU A;  3ZT2 A;  4J2B A;  3CYM A;  3KLI A;  3LZI A;  2OPS A;  2OZS A;  1WN7 A;  4J2E A;  4O4G A;  3NF8 A;  2W42 A;  3QIP A;  1EKE A;  2P5G A;  4CEF A;  4HUE A;  2HND A;  1FXX A;  4FM0 A;  3PX6 A;  1NJY A;  2YHB A;  1SUQ A;  3MEE A;  3QNN A;  3MEC A;  1T03 A;  5D3G A;  4DS5 A;  4KO0 A;  1SV5 A;  3OYG A;  4DTS A;  1O1W A;  1Z25 A;  1NK7 A;  4DLE A;  4ZHR A;  3K5O A;  3TR8 A;  3ZT4 A;  4DTO A;  4AIL C;  3NGZ A;  1TL3 A;  3TAP A;  2PYJ A;  4E0D A;  1BGX T;  4M3X A;  4QOZ B;  4AHT A;  1VSI A;  4KHS A;  3VQA A;  1TV6 A;  3IS9 A;  5I3U A;  1KVA A;  3RMD A;  2X74 A;  1KLN A;  1R0A A;  5CZ1 A;  4DMN A;  4O55 A;  2ZE2 A;  3NFA A;  4CF2 A;  3KJV A;  2XO7 A;  3QER A;  4KHY A;  1JL1 A;  2OPR A;  4LY7 A;  2G8K A;  1VK0 A;  4CED A;  5J1E A;  3JSM A;  3C95 A;  4HUF A;  2BE2 A;  4FLY A;  3MXI A;  2O4I A;  1TAU A;  1LAW A;  4C8O A;  2GUI A;  3ZSQ A;  3ZSX A;  1RT1 A;  4C8M A;  2DFE A;  2HB5 A;  2OA8 A;  1RDB A;  4BE0 A;  2HVH A;  1GOA A;  1KRP A;  1RCH A;  3L2R A;  1S1W A;  3DLK A;  1QS4 A;  1JLA A;  3TWH A;  5DK5 A;  4CGG A;  4DSF A;  1HNV A;  4E1M A;  1IKX A;  1LWE A;  4KRF A;  2Y1I A;  2B5J A;  1TGO A;  4NCG A;  4FM2 A;  3DLE A;  3PY8 A;  1RBS A;  1D9F A;  4CK1 A;  3OYL A;  1Z26 A;  5J2M A;  1KTQ A;  4FZX C;  3NBP A;  1BI4 A;  3UIQ A;  4OLB A;  1B9D A;  2HHV A;  3OYJ A;  1C1B A;  1EX4 A;  1JLC A;  3M8R A;  4IFV A;  3I0R A;  2PYL A;  4DQR A;  5HLF A;  3B6P A;  3RMB A;  1J5O A;  3VQ5 A;  2ZD1 A;  4CHN A;  4Q5V A;  3OS0 A;  4KTW A;  4CEC A;  4FJJ A;  4FK0 A;  1LW2 A;  3THV A;  4FJM A;  2FBT A;  2VWJ A;  4FJ8 A;  4DU3 A;  1BCO A;  4I2P A;  1HQU A;  5HRS A;  3OY9 A;  1XWL A;  2GBZ A;  2Z1J A;  5FDL A;  4DG1 A;  4KV8 A;  1RDC A;  4DQI A;  3RWU A;  4C8L A;  3H08 A;  3ZSV A;  1ASW A;  2FBY A;  4CJE A;  4CJT A;  1UWB A;  2YKM A;  4ICL A;  4CHY A;  3EY1 A;  3HL8 A;  4EZ6 A;  4BE2 A;  2YNH A;  1A5W A;  3WNE A;  4FK2 A;  3O3F A;  3K5L A;  4CIG A;  3HJF A;  4FYD A;  3ZT1 A;  3QEP A;  3AO1 A;  4DWI A;  1A5X A;  2G8U A;  1C0T A;  3MED A;  5EU7 A;  1XHX A;  1WSJ A;  3TAM A;  1QSS A;  2FC0 A;  3OYD A;  2IOC A;  4H8K A;  3CM6 A;  4YFU A;  3JYT A;  2Z1G A;  4FLV A;  2NUB A;  5CYM A;  1TKX A;  3ZSR A;  3S3O A;  1RDD A;  1K6Y A;  3DM2 A;  4HCC A;  3FFI A;  1LWC A;  2IAJ A;  1EP4 A;  4IFY A;  4OPJ A;  3O3G A;  2HW3 A;  2A1S A;  3HPO A;  3I8D A;  4IKF A;  4JRP A;  2EHG A;  1JKH A;  2ITG A;  4M3R A;  2IS3 A;  3VQC A;  1B92 A;  5KI6 A;  3KLH A;  4FZY A;  4FJI A;  4PUO A;  3KK3 A;  1IG9 A;  2JGU A;  1TL1 A;  3SV4 A;  5HP1 A;  3AVF A;  3AVN A;  4KI6 A;  4M42 A;  1NK0 A;  4B9U A;  4M41 A;  1J9A A;  3L3V A;  4XIU A;  4I2Q A;  4BDZ A;  3DLR A;  3HVT A;  3AVH A;  4NYF A;  3EYZ A;  4E7L A;  4CER A;  4DTR A;  2AJQ A;  3SUO A;  2OPP A;  1LW0 A;  2F8S A;  3DRS A;  3AO3 A;  2G8V A;  3T19 A;  4B9L A;  4DTP A;  5KRT A;  3U3G A;  1JLG A;  1HJR A;  1UA0 A;  1T7P A;  4FJ5 A;  2P1J A;  3VQP A;  1GOB A;  1ZBI A;  2HHS A;  4O44 A;  3V1Q A;  4CJU A;  4L8R B;  2RF2 A;  3S3N A;  4ZTF A;  4AHU A;  4CIE A;  4HTU A;  2OYQ A;  2LSN A;  4DSI A;  3LAK A;  3NDK A;  1C1A A;  1BCM A;  3LP0 A;  3QLH A;  4CE9 A;  3LZJ A;  1IKW A;  3U6F A;  3KLE A;  3C94 A;  4CJ4 A;  4B9T A;  2DFH A;  1RT3 A;  2D0C A;  4FLZ A;  2YNG A;  2KFN A;  4KHN A;  4Z4C A;  4OVL A;  4DF8 A;  3ZT3 A;  4ELV A;  4FW2 A;  4FJH A;  3SQ1 A;  3RRH A;  4RW7 A;  3O3H A;  1Q9X A;  3RR7 A;  4CGH A;  2XY7 A;  3IRX A;  2XY6 A;  1BL3 A;  2G8W A;  2F8T A;  5SZT A;  3V9X A;  2WON A;  5HBM A;  3HO1 A;  3VQ4 A;  2HHT A;  1NJX A;  4FJG A;  1QSY A;  4CJS A;  3RRG A;  1ZYQ A;  4MQ3 A;  4CFD A;  5T7B A;  1UAX A;  4AHR A;  4FJ9 A;  3DRR A;  4CFC A;  3V4I A;  1U4B A;  4B9N A;  3NF7 A;  1L5U A;  4B9S A;  1HRH A;  3BGR A;  2DFF A;  4OJR A;  1EXQ A;  4NCB A;  4FK4 A;  4DQP A;  4M3Z A;  4EP4 A;  1WNS A;  2Q3S A;  3NAE A;  1HYV A;  4RW6 A;  4F3T A;  4CHO A;  1SL0 A;  3PX0 A;  3LP3 A;  4H4M A;  3S3M A;  3IG1 A;  4LSN A;  4CK2 A;  1NK8 A;  3DRP A;  4KFB A;  3OYB A;  3HYF A;  1SKR A;  3AA5 X;  1J54 A;  3DYA A;  4FVM A;  5KRS A;  1HQE A;  4OPK A;  4DTX A;  1NK5 A;  4GW6 A;  5HRR A;  1RBV A;  1VSK A;  3ZSO A;  3QEI A;  4I7F A;  3OJU A;  3OVN A;  3VQ8 A;  1RBR A;  4AHV A;  4Z4G A;  3CG7 A;  1YTU A;  4RW9 A;  4F2S A;  3I0S A;  5CZ2 A;  1ZBH A;  3OYF A;  4ID1 A;  3TAF A;  4CF8 A;  4ZTJ A;  1TK5 A;  1N5Y A;  2XHB A;  3V1O A;  4OKJ A;  4E1N A;  3M8S A;  1JLQ A;  3M8P A;  3LPU A;  4LD0 A;  2QKK A;  4PY5 A;  1BIS A;  4DTN A;  2HHQ A;  3LDS A;  4DQS A;  4DFP A;  4W5T A;  4H4O A;  3DOL A;  5HRN A;  3IAY A;  1HNI A;  1RTD A;  2O4G A;  3K5N A;  4FXD A;  3DOK A;  3K59 A;  2FBX A;  2KW4 A;  3AVJ A;  2YV0 X;  4LH4 A;  1W0H A;  1YT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...