3KLGA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
total genus 105
structure length 554
sequence length 554
chains with identical sequence E
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klgA05
2YKNB 4OL8A 3PW7A 4RW4A 2GIQA 3AVBA 2RN2A 4FJ5A 5JS1A 1JLFB 4ZP8A 4Y3CA 3CDEA 1C1AA 3B6PA 3DM2A 4YR3A 2GIRA 3KHLA 1JL1A 3FFIB 3ZSOA 1WLJA 2IMWP 3NF9A 2BRKA 3NH1A 1LW2A 3KLEB 3NGDA 4M3ZA 3I5AA 2VG7B 4O3SA 4KO0A 4B8AB 2G8KA 4FW1A 2R8GA 2AWZA 4IFVA 3I0SB 3UPFA 3BQ2A 1QS4A 3K58A 4QWCA 1B9FA 3DLRA 3VQDA 5DGBA 3DYAA 1IH7A 1KVBA 1R0AB 3QEPA 1XR6A 4RW7B 1BISA 3P1GA 4HHTA 4FM0A 2AX1A 1TV6B 3I0SA 1O1WA 3TARA 3VQ8A 5KFXA 4MK7A 4M3RA 3M9OB 3DRPB 4I2QB 3NAIA 4OPJA 3MAQA 2WHOA 4HUEA 3DYAB 5KT2A 3GYNA 4DS4A 4U7CA 4LH5A 1WNSA 2D0AA 3ZT2A 2IC3B 3QEWA 4ID5B 5DLGA 5KFJA 2IA6A 3LDSA 4DFJA 2WONB 2E4LA 2WTFA 2FVPA 1S0MA 4CF8A 4FJLA 4J9KA 4RNOA 5KI6A 5FDLA 4F2RA 5JS2A 4NCGA 4RNMA 4KTZA 3CM5A 3DOKA 1VK0A 3HVAA 1HQUB 4Q0BB 3G10A 3OYMA 3LZJA 3BQ1A 3NBPB 3RRHA 4FJ8A 4ZPCA 1SUQB 2WOMB 4FBUA 2UVRA 4MQ3A 3QIOA 1T03A 1RNHA 2KZMA 3LPUA 4JV1A 4BE1A 2E6LA 1HYVA 1UA0A 4CJSA 1T94A 4YR2A 4XIUA 2E6MA 4N5SA 2FBVA 4CHZA 1REVA 4FLWA 3N6LA 1GX5A 3HPHA 2W9CB 3KKSA 1RYSA 1W25A 1HQUA 4Q0BA 3V9ZA 3V1RA 3HSTB 3AA4A 3BSCA 1ZBFA 1T03B 5KFIA 3UQSA 3S3MA 2OPRA 3HL8A 3KLVA 2O4IA 3T5LA 1L5UA 5KFLA 4TQRA 4J9QA 5DGAA 5DLFA 4KI4A 5J1EA 3CQ8A 1CXQA 4Z4HA 2EHGA 2HNZB 5HLFA 4J9LA 2IS3A 3OL8A 5KFBA 1KLMB 4DTRA 5J2PA 4NYFA 4MKAA 3JSMB 5J2NA 4Z4GA 1D5AA 2BRLA 3RB3A 3LWMA 4DF4A 1FKOA 5F8MA 5E41A 3B6OA 4QOZB 4DLEA 2KFNA 3T5JA 1HQEA 4F4KA 3E01B 4TYBA 3KIOA 3NL0A 4NYZA 2RDIA 1L3VA 5HRNA 4GMJB 2F8TA 1JX4A 3PV8A 2RPIA 4OKJA 1Q8IA 5T7BA 2A1RA 3U6FA 5KRTA 5EWGA 4J9PA 3L2VA 5CZ2A 3PX4A 4B9LA 4K4SA 2Y1IA 1HPZB 3GV8B 3KOAA 5F8HA 5KFKA 3SI6A 1LWCB 1RCHA 4FCYA 1B92A 4NLTA 4ID5A 4CJEA 3SI8A 1HARA 3H59A 3SQ4A 1MU2A 4HCBA 4QWBA 2ASLA 3RB6A 1MMLA 1D1UA 3UIQA 3KJVA 1C2PA 4HVJA 4CHNA 1N56A 3P83D 1VSIA 1QTMA 5FRNA 3NF7A 3NBPA 4O4RA 5F9NA 4C8OA 4FJJA 3C6UA 3RMBA 4CFBA 1IM4A 3HVWA 4I9QA 5DMRA 2RKIB 5EWEA 3VQAA 2ZE2B 3QO9B 3SUOA 1S1VB 1REVB 1X9WA 1IKYA 4NLYA 1ZETA 3DLHA 2YNIA 1NK7A 3IGVA 4IG0A 3TVKA 1QE1A 3NH0A 2YNFB 5SZTA 1QSSA 3CJ4A 5I42B 4Y1DA 1CLQA 3D28A 1RT3A 1S0NA 1RBVA 2YV0X 5DQIA 4BWJA 1C0UA 5KFFA 3MR2A 4IDKA 4IOBA 3C94A 4CFDA 4FJNA 1IKYB 2HHTA 2DTUA 1YTUA 5F8JA 1S4FA 3DMJA 3NHGA 3FQLA 2AGOA 4QWDA 4KV8B 4Y2AA 1RT6B 3KLFA 4R8UA 5I42A 4LH4A 1RTHB 1JLEA 3S3NA 4IR1A 4B9UA 3ASMA 4CJRA 3RWUA 4CF9A 2XCPA 3KLHB 3C95A 1S6PA 3AO5A 3AVMA 4DL2A 3NF6A 4CFCA 1U04A 3IRXA 5KG7A 4ZP9A 1TAQA 4CEBA 4DFPA 2P1JA 4CCHA 4CK2A 3SPZA 4MFBA 3NFAA 1RTIB 3H5UA 3RMDA 4MK9A 1SKSA 4DMNA 4O0JA 3K59A 1RTHA 3RRGA 3QGHA 4JV2A 4Q8FA 2XCAA 4KAZA 1HJRA 3VA0A 1IKXB 3T1AA 1JLBA 4DS5A 3RMCA 1IO2A 4ED6A 4TY8A 2JEFA 3GQCA 2FBTA 3BGRA 5CYMB 1Z25A 1JLGA 3MEGA 3ALYA 1ZYQA 4M41A 1TK0A 4B08A 2DFFA 2BE2B 1TVRA 3OS1A 4GW6A 4DTNA 4DL4A 3TANA 4ECVA 5HBMB 5C42B 2Z1IA 2JEIA 3DM2B 2VWJA 1XR7A 3HP6A 4TY8B 3I0RB 2IM0A 4Y34A 4CEAA 1BHLA 3KLIA 4G3IA 1U48A 2FJXA 1ZBIA 5DQHA 1C1CB 3MECA 3RB4A 2W9BB 2ZQBA 4DSFA 3AVCA 1BCOA 4KKOB 3LANA 4QW9A 3PW5A 1L3SA 4DL6A 4RNNA 4DEZA 2VG5B 3V9WA 4O3PA 1TKTB 5KG2A 2C22A 4H4OB 1XHZA 3ZSYA 4IFVB 1S1TA 1RDRA 3QERA 3OL6A 4E3SA 1DLOB 3KNAA 2W9BA 3NGZA 3M8PA 4Z4IA 1A5WA 3QNNA 2BANB 3KTQA 2B6AB 4NLWA 4EYHB 4URGA 2QKBA 4OJRA 4WZMA 3TAMA 4ZPDA 1S9EA 1TKTA 1IKVB 3ZT1A 5KRSA 4PWDB 2VG6B 2WCXA 3FRZA 3KLGA 1TGOA 4UQGA 1KFSA 4PUOA 4DL7A 4C8MA 1RAJA 4O3NA 3M8PB 5KG4A 3OLAA 4M3XA 4FBTA 3K57A 1WSHA 4ED8A 4M3YA 1JIHA 3TAMB 2KQ2A 3VQQA 1RTJA 3O3HA 4FLXA 5J2MA 2IGIA 3ZSVA 2YNHB 4PWDA 4RG8A 3OHBA 2VG6A 4RW9B 3OS2A 4CIGA 2I5JA 3DI6B 4FJKA 4KAIA 5HP1B 3JYTA 1JLFA 5KFWA 3DRRB 3VQ5A 1VSHA 1SH0A 5KFGA 4ECYA 4XO0A 4ZP7A 2DPIA 1JKHB 1S6QA 3L3UA 1SL2A 3V6JA 1KRPA 4W5OA 4ECZA 4J2AA 1VRUB 2HMIB 2HAIA 4LSLA 5L1KA 1NJWA 3N6NA 5KTQA 5KG6A 1KHVA 4MIBA 2QV6A 3BSNA 3LP2B 4J9MA 3HM9A 1RT4A 5HBMA 3ITHA 3H08A 2FC0A 4PQUB 3DLKA 1ZBHA 1SKWA 1QSLA 1K1SA 4WZQA 1EETA 3HJFA 1QHTA 4DL3A 4M94A 3ICLA 1BCMA 4KKOA 4DQPA 2PZSA 3LP0A 3LP2A 4TXSA 3BQ0A 3OYNA 4AILC 4Q8EA 2UUWA 4G1QA 4RNHA 3GILA 1JLQB 1EKEA 1XHXA 1S1TB 1HMVA 1U45A 3V9UA 1RBTA 3LP1B 4IRDA 2O4GA 1T05A 4OKKA 2V4RA 4BE0A 1TAUA 3L3VA 4LSNA 2XY5A 2OPPB 2P5GA 2B6AA 2XGQA 3SNNA 4NLOA 3KHGA 4CIFA 3OJUA 2FVQA 1JLQA 3Q8SB 1S1WB 4ICLB 3ZT4A 2W8KA 3NCIA 1VSLA 2IAJA 1TL3A 4CF0A 3H98A 3HXMA 3DLBA 2JEGA 2OPPA 3AVLA 4JLHA 1RT5B 3KK1A 3IN5A 4AHTA 1ZBUA 1LWFA 2ITGA 4FZXC 2G8IA 4W5RA 4FM2A 3A2FA 4O44A 3QIDA 3SQ0A 5D3GA 3K5OA 4Z4EA 4DQRA 4FW2A 4IG3A 3VN5A 5HROB 4MIAA 2D0CA 4OKEA 1NKEA 4MK8A 1NOYA 4FLZA 3TAEA 2D3ZA 1KFDA 1NNDA 4HCCA 2ALZA 5DG8A 1QAJA 5F8LA 1JXLA 1JKHA 4WFXA 4J2DA 3LWLA 3PJXA 5KFOA 2HHUA 1LAWA 4I7FA 5KFDA 4LSLB 3TQ1A 2FBXA 5J1EB 1D8YA 3CM6A 4IFYB 5KFSA 4F8RA 1GOCA 3RBEA 3CIZA 3C6TB 1DTTA 1UA1A 4BDPA 4KHUA 4K4VA 4FLYA 5CYQB 4F2SA 4E0DA 4FM1A 4O3OA 2Z1GA 3U3GA 2W8LA 1XI1A 4B9NA 1BI4B 1NKBA 2W9AA 5KFEA 2W9CA 4DWIA 1LW2B 3KLEA 3MF5A 3D45A 1N5YA 3UR0A 4EZ6A 3OYJA 3ULDA 2GBZA 1RT6A 3KLFB 4R5PA 1ZTWA 3O3GA 4YMEA 4ZTJA 2J6SA 3QIPB 2OPRB 4KBIA 3HVRA 4EEYA 1J9AA 1Y97A 4ZVEA 4CGFA 1YVFA 2R2RA 2HNZA 4KFBB 3PW0A 3CWJA 1G15A 4CERA 4WE1B 1DTQB 2X78A 1FXXA 2OYQA 4ED7A 1TV6A 4ICLA 3PR4A 3GIMA 1NK6A 3AV9A 4EBDA 1RT2B 1N4LA 3HPGA 1NHVA 3TAFA 1ASVA 1YT3A 4FJHA 2ATQA 1U49A 3KK1B 4CECA 1S5JA 3M8QA 1X9SA 2HNDB 2HHVA 4WE1A 3VQ7A 3KMQA 4M3UA 3Q8RB 2HHWA 2QK9A 2QXFA 4CGGA 4Z4FA 1S1VA 4RW8A 2VG7A 3MFIA 4I2PB 2JEJA 4EBEA 2E9ZA 2YNIB 3EZ5A 1BL3A 1NKCA 1NHUA 4TSXA 1SKRA 2DY4A 4YQWA 1SUQA 2WOMA 1N48A 3PHEA 3RB0A 3HP9A 4O3RA 3DRSB 3AVNA 1EP4B 3G6YA 3TAGA 4HYKA 3OL9A 4W5TA 1NK0A 3Q8PB 2O5DA 2ILYA 3HK2A 1S48A 5HRRA 4M3WA 3BDPA 1XC9A 2XGPA 3MR3A 1K6YA 4CE9A 2UVWA 1CZ9A 4W5QA 4B9MA 1EP4A 2BANA 4XPEA 4IKFA 3ZSQA 4E7JA 3DOLB 3V6DA 1ASUA 5KGWA 4CEFA 5KG3A 4KPYA 3IG1B 1N6QB 2Z1HA 4KSEB 3PO4A 4F3TA 2X6NA 4CJ3A 4WXOA 1I6JA 5KT3A 4JRPA 2V4QA 4OVLA 4MFBB 1KLNA 3DLGB 3ZSRA 2XI3A 1VSMA 2V9WA 1NK4A 3BREA 5CY4A 3PVXA 1NJZA 1F21A 3RAQA 2BQUA 2OA8A 3IG1A 4DF8A 4RW9A 4NLQA 4NLPA 3EPIA 2G8VA 2XC9A 2R2TA 1RA7A 4ECQA 2Q3SA 3E01A 2OPQA 3CFRA 3CJ3A 4N56A 3H4DA 1YVUA 4ED1A 2RF2A 2R8KA 3G6XA 3D0PA 4NLDA 1LW0A 3BSOA 3LAMA 2C2EA 2DFHA 4HUGA 1S10A 2UVUA 1X9MA 1RT2A 1J53A 3KLHA 5JUMA 3GV7B 2D7SA 3AA3A 3SZ2A 4Q45A 4NCAA 4F4WA 4AHSA 1S0OA 1FK9B 1I3AA 2CKWA 4Z4CA 3KK3A 3VQ4A 4TY9A 1LAVA 1JXBA 2YKNA 1BQNA 1IKXA 3ZT3A 5FROA 2HW3A 4PQUA 2IM2A 2D5RA 1W9HA 1Z26A 4F50A 4DFMA 2NUBA 4E19A 2R2UA 2HWIA 3HPOA 2JGUA 4FVMA 3FFIA 1S9GA 5KFRA 2IOCA 1NK8A 2XO7A 4K8XA 3KK3B 5L1LA 5J2QA 2YKMA 4QAGA 3PX0A 2F8SA 4RNFA 5KFVA 5HRPA 2C28A 3LZIA 5EWFA 3WNGA 5DG7A 1C6VA 2FLLA 3V9SA 1HQEB 2BQRA 4CHQA 4QWAA 1RA6A 1RT7B 4ELUA 2ATLA 4NRUA 2Y1JA 4IG0B 4ID1A 1QE1B 1UWBA 1UAXA 2UVVA 5KFAA 3T5HA 4FJ9A 3SFGA 2W7OA 3THVA 5J2QB 4BDZA 2G8WA 4ELTA 5C24A 3TR8A 3PJWA 1S97A 4RW7A 3AVFA 1LWEA 3SV4A 3VQPA 3ISNC 4AHRA 4BWMA 3RR7A 3WNHA 4IRCA 4ZVFA 2UUTA 4CGIA 3CFOA 1WSEA 4DTPA 3V6KA 3VQCA 4DLGA 3JYTB 3KJVB 2FLPA 1GOAA 1RT5A 3OYFA 3T5KA 4YNQA 3GIKA 4ZPBA 4K4YA 2OZMA 3VQ6A 4J9SA 1XWLA 4J2BA 2JLEA 4XPCA 1HYSB 5EUHA 2D41A 5F8IA 5D3GB 1K1QA 1QQCA 3IRXB 4FJ7A 1T7PA 3DLEB 4EO8A 1S1UA 5F8GA 5FDLB 4OLBA 4KRFA 5C25A 4CIEA 3CJ2A 1IKWB 4O5BA 3HHKA 4DFKA 4GVMA 4DTUA 4C8NA 1S9FA 4IH7A 1RDAA 1Q9XA 3QLHB 3SQ1A 1EETB 3ZSXA 1JLGB 1KHWA 3QZ7A 3AVGA 5KG5A 1Z4UA 1TP7A 1RDDA 3RBDA 3DRRA 3HKWA 1BQNB 2XI2A 4YFUA 3NAEA 2RDJA 1BIZA 3MXJA 1HMVB 1ZBLA 3HO1A 3MEDA 2HNYB 2KFZA 4J9NA 3V1QA 2IJFA 1KVAA 2FVRA 3NH2A 1GX6A 1VRUA 2E9RX 3SJJA 4DSLA 1BQMA 1LV5A 4B9VA 3TAPA 3VA3A 1RT4B 3GIIA 1RT1A 3BJYA 5HRSA 3MR6A 2DPJA 4H4OA 4NYNA 3L2RA 4FLVA 1KLMA 4F4ZA 4WFZA 2XY8A 3MEDB 2IAJB 1EXQA 5J2PB 1TL3B 5DQGA 4W5NA 2HHSA 4J9RA 3AO4A 3PZPA 2R7YA 2VA3A 1FKOB 3CDWA 4DQSA 4E7LA 1A5XA 1S1XB 3IGNA 3KD5E 4CESA 1VSKA 4AHVA 3OYKA 1NJXA 3KK2B 1LWEB 3CJ0A 3AA5X 3HYFA 3P5JA 4FS2A 2EX3A 4CJKA 3L2QA 4JRQA 4FJGA 3KLGB 3VQEA 4HUFA 1T8EA 4CF1A 1TVRB 1D0EA 1CSJA 3QEIA 4H4MA 2VWKA 3M9NB 4DG1B 4M3TA 3OLBA 1TK5A 3PO5A 2ZD1B 1JXEA 4OPKA 3F73A 2B5JB 2GC8A 2GUIA 1D9DA 3MFHA 3EPGA 3V81A 1C1CA 3MECB 3QESA 3UDLA 3N6MA 1TKXB 2YHBA 1TL1B 4K8ZA 2R8IA 4KB7A 4RW6B 1RDCA 3SV3A 4I2QA 5KT4A 4H4MB 2PY5A 4K4UA 3NKYA 2P51A 5KG1A 2ZD1A 4FLUA 2ETJA 4F3OA 1I39A 2XHBA 1DTTB 2IC3A 1J54A 4X2BA 3E51A 1DLOA 3KD1E 3Q8QB 4FZZA 2RKIA 4ECWA 3GIJA 3HT3A 2FBYA 2AX0A 3CG7A 2YNGA 5EDWA 1WSFA 3ZSWA 5KG0A 1WAFA 4EZ9A 3O4QA 4WYLA 3SPYA 3ITHB 3CDUA 2YNFA 3OVNA 3OYIA 3D5MA 1WAJA 4R5PB 4EBCA 4CJWA 4FK4A 4CJVA 4NZ0A 3F9KA 4DSIA 4Q43A 3QEXA 2OPSB 2YHAA 4RU9A 4H54A 3VQBA 1SH3A 4KTQA 4ECRA 2KZZA 3IS9A 4F4XA 1RTJB 4R0EA 1NK5A 4DTJA 3OYBA 4QPXA 4YR0A 4OGCA 3DMJB 1NK9A 1VSEA 3CO9A 3NAHA 4N76A 4EYIB 5KFUA 3ZT0A 3RR8A 5HP1A 3V1OA 4AH9A 3O3FA 4WFYA 3OS0A 1RTDA 3GV5B 5L1JA 2I1RA 3QZ8A 1TKDA 4DSEA 4CJLA 1S49A 1HNIA 1TKZB 1S6PB 4DL5A 3M9MB 2HNDA 4TYAA 1HNVA 4DQIA 4N41A 2HMIA 1RTIA 4O4GA 4CK3A 1S1WA 4NCGB 4NLUA 2F8EX 3KKRA 3K5MA 3H2LA 3DLKB 5KFZA 2IM1A 2W7PA 3QYYA 3KHHA 4CJPA 2EC0A 1C1BA 3V4IA 3FQKA 4KI6A 4E7HA 3V81B 1TQLA 2AU0A 1BIUA 2C2RA 4KHQA 2IM3A 1L3TA 2VA2A 3MTKA 1TK8A 4FYDA 2HB5A 2FVSA 2WB4A 2R2SA 2CJQA 3NGYA 3CVKA 1S9GB 1JLAA 4N47A 3H40A 3V4IB 3KLIB 1C0MA 1ZTTA 4JV0A 4E7KA 4HTUA 3SYZA 4I7FB 3DOLA 4LD0A 4ZHRA 3PR5B 1WSGA 1L3UA 4NLRA 4RW8B 5HLFB 2X6SA 2YNGB 4CJFA 3QGGA 5KT6A 4IFYA 1U47A 3CFPA 1ITGA 4BACA 1RT7A 5KFMA 3FDSA 1JLAB 1UWBB 2V0NA 3I5CA 1J5OA 3H4BA 4E1NA 3H5SA 1SL1A 4DTXA 5CYQA 3KMSA 4ZVHA 3K5LA 3ZCMA 2R8HA 4ZHRB 5KT5A 1UOCA 4AHUA 2FLNA 5T14A 3IS9B 4RUAA 4LQ3A 3NE6A 3EZUA 3O4NA 4M95A 4I9LA 3I5BA 2WONA 4Y1CA 3U3YA 5JXSA 5HROA 1C0TB 2Z1JA 3OY9A 2LSNA 4IH5A 1R0AA 2KW4A 3QGIA 1HPZA 2E9TA 3M8SA 4TLRA 4CJUA 4F4YA 4E1MA 4DSKA 5KFQA 3AO3A 4EO6A 2YNHA 2HVIA 3NDKA 4Q44A 3AVAA 4CEZA 4IR9A 4FLTA 1HNVB 1VRTB 2J6UA 4R8UB 4FZYA 3DRPA 3MXMA 1SL0A 2PYLA 1C0TA 4DTMA 4GC7A 3OHAA 4FJIA 1VSFA 4WXWA 3MR5A 2AQ4A 4GC6A 3C6TA 4B9TA 2A1SA 3QLHA 3BR9A 5EU7A 4M42A 2WK4A 3OYHA 4ECXA 4E7IA 4TN2A 4URSA 1D9FA 4FK0A 2QKKA 1RBRA 2F96A 4ZMMA 5L1IA 1B9DA 3SUPA 2BGGA 4KHRA 4DU1A 4FXDA 3NMAA 1FK9A 1RT3B 4DU4A 3TABA 4CHYA 1C0UB 3SUNA 4ZP6A 4MH8A 4NLSA 1QSYA 4IBNA 1RBSA 3PW2A 4KFBA 1RT1B 5C42A 1W0HA 4G1QB 1RDBA 1GOBA 3QEVA 4KHMA 3LP1A 5KFHA 2P5OA 2D3UA 2C2DA 4CEOA 2HVHA 4CGJA 4B3OB 4ED0A 3LPTA 5DK5A 4KREA 4EP4A 4Y2CA 3ISND 3AO2A 5CZ1A 1S1XA 4DTSA 4NCBA 4OLAA 3KK2A 2FJWA 3PUFA 3AVIA 1ASWA 4JS4A 4MKBA 3DLEA 4ECTA 1MU2B 3OYAA 4B3OA 1U4BA 5J2NB 3JSMA 4Z0UA 5C25B 3G0ZA 3RTVA 1KTQA 1IKWA 3M8RA 2B5JA 3OL7A 2IBKA 4CJ5A 1YTAA 2HHXA 4M45A 5K14A 1IG9A 3AVHA 3MEGB 4YP3A 1SV5A 4TQSA 3QNOA 4RW6A 2AGPA 3S9HA 4IG3B 4LQ9A 4KB1A 3LAKA 2ASDA 4CEEA 3FSIA 1LW0B 3OSPA 1EX4A 4ZTFA 3G6VA 3OYCA 5K14B 1U09A 5J2MB 1LWCA 1Q9YA 3WNFA 4J9OA 3OJSA 4JS5A 1SV5B 5DG9A 2HNYA 4HKQA 2B4JA 4BE2A 4ED3A 3VQ9A 3DI6A 4CEQA 5I3UA 3AVKA 4JUZA 3V6DB 4CJ4A 2IJNA 3TWHA 4C8KA 4O0IA 3TAQA 3S3OA 3G86A 4CGDA 4KV8A 4CK1A 4KHWA 4OGEA 4CFAA 3C6UB 1KCFA 4QW8A 4LY7A 4O3QA 5KFPA 5I3UB 4PA1A 2X74A 4K4TA 4KHNA 3WNEA 2XY7A 1BI4A 3I8DA 4U6PA 5KFTA 4K4WA 4NLVA 1N5YB 4Q5VA 4DU3A 3OYDA 4NRTA 1QUVA 4FJXA 3MXIA 3H5XA 3QIPA 2AJQA 4K4ZA 4ELVA 3SCXA 4DSJA 4IQXA 3KHRA 1WNEA 4L8RB 5KFCA 3OYEA 1KSPA 1HNIB 4KE5A 3L2UA 2IDOA 3L2WA 3K2PA 5C24B 4E89A 3OYLA 2I5JB 2ASJA 4DTOA 4CJTA 5C5JA 2BDPA 1TKXA 3PY8A 1DTQA 4EP5A 1NJYA 4FK2A 4FJMA 1WSJA 4CF2A 3TI0A 1T05B 1JLEB 2BE2A 4C8LA 2ZKUA 3DDKA 4ED2A 4LSNB 1OS5A 1X1PA 4IKAA 3NGIA 4KHSA 1S6QB 3QINA 2HHQA 2DFEA 1C1BB 5FRMA 3M8QB 2KTQA 3CYMA 3SQ2A 3CJ5A 1SH2A 3HVTB 5KT7A 2YKMB 2PYJA 4KHYA 2WRMA 1JL2A 4KB0A 4ZPAA 4CEDA 4I2PA 1JLCA 5F8NA 5KFNA 4QCLA 4QWEA 1LWFB 1RILA 5KFYA 4O44B 3HVTA 2G8HA 3V9XA 2XY6A 3DRSA 1TL1A 4URQU 3T3FA 2JC1A 3T19A 4ZVGA 3LP3A 3LALA 3LP0B 2ZE2A 3QO9A 4KO0B 4O55A 1S9EB 3MEEB 4IH6A 1RYRA 2XRIA 4CGHA 1JLCB 1HYZA 2ILZA 2AGQA 3EYZA 4B9SA 5SWMA 3ZSZA 3K5NA 3H5YA 3I0RA 2JC0A 1J5OB 3AA2A 4PUOB 2GV9A 4IRKA 3QETA 2QE5A 1BGXT 1KVCA 2W42A 4RZRA 3AVJA 3BSAA 3AO1A 3OSNA 1CZBA 1RTDB 2BR0A 1VSDA 1N6QA 4IDKB 4AHCA 2VG5A 3MEEA 4CHPA 1TKZA 1A5VA 1QAIA 1BQMB 1WN7A 1HYSA 5L9XA 4CJQA 4FS1A 4NLXA 4J2EA 2B43A 4NLGA 1S1UB 4CHOA 3VQSA 4H8KA 3DLGA 4O4GB 4KTWA 4WYWA 2R8JA 1RBUA 2D0BA 2HWHA 4BDYA 4B8CA 1T3NA 4RUCA 2OPSA 3PX6A 3EY1A 4ECSA 1IKVA 2J6TA 4ECUA 3RAXA 3SUQA 2OPQB 3IAYA 1VRTA 1HRHA 2RF2B 1FKPA 3SFUA 2BQ3A 5F9LA 4DQQA 3V6HA 2OH2A 1XR5A 4RW4B 3RMAA 3DOKB 3PW4A 1NOZA 1CXUA 2FVCA 3NF8A 4DG1A 3OYGA 2XWYA 1JLBB 2OZSA 4K50A 2FJVA 4PY5A 1WSIA 4K4XA 3BGRB 5CYMA 3L8BA 2G8FA 1FKPB 1VSJA 5KGXA 2G8UA
chains in the Genus database with same CATH superfamily
3WC0A 1NSQA 2RN2A 4FJ5A 5JS1A 2HFZA 1C1AA 4NZ7A 3GB0A 4OZ0A 1JL1A 4G65A 3NF9A 2ZGZA 3T6JA 3MAHA 5A8RB 4PXBA 2PA8D 2IY5B 1LW2A 3KLEB 3VENA 2ZEJA 3NGDA 1RB0A 4M3ZA 2L9WA 3I5AA 3FEYB 4OX7A 2BXJA 2CJBA 4V1Ak 4LSZB 4U8VA 2Y1RI 2C3MA 2R8GA 2PGCA 4IFVA 3I0SB 3CJAA 2QWMA 4QWCA 1EWRA 1OY9A 5GINA 4B3TF 4A5AA 3W60A 3BO3A 4DXLA 2GV1A 2V52B 4GVEA 1HLUA 1ZAVA 2ZJQL 5A8KB 4DV1J 1BISA 2ROEA 5A8WB 1Y3JA 4MK7A 3B6BA 5DJBA 4A8XA 3VVUA 4M3RA 1Q8LA 1CJTB 2RS2A 3DRPB 2QYCA 4OPJA 3OFGA 2XLKA 5M1KA 4HUEA 3DYAB 1VQNN 2DK2A 2EW9A 4OZJA 3ZEUB 3M2RB 4DV1K 2D0AA 2F9JA 5M1OA 5KFJA 2XSJB 5AQIA 3OXLA 2M7SA 2W40A 5BXIA 1N5VA 4J9KA 1WBDA 2B4PA 2ASMA 2L41A 2G0JA 3QICA 4F2RA 4NCGA 4C3LA 3CD0A 4YDUA 1TL7B 3DOKA 3ENVA 2GEMA 3HVAA 4Q0BB 2EWSA 5BJRA 2WOMB 4I6AA 4MQ3A 3CCVS 3QIOA 4ED4A 3LPUA 3QGPA 4FOEA 4BE1A 2A6OA 4NPOA 4CJSA 1T94A 3PKYA 4PL8A 2A3ZA 1HKCA 3M1VA 3HPHA 5D4OA 3KKSA 1VGYA 1UEKA 3V9ZA 3KUEA 2JLGA 3AA4A 5E3QA 2Q79A 5B0EA 3I56S 2CADA 1ZBFA 1T03B 4HR2A 4BR0A 3UQSA 4M5DA 1H6KX 2Q1LA 2NNWA 2O4IA 3HL8A 3MHYA 3GJSB 5E3AA 3HD2A 1KN6A 2W2PP 3FSYA 4CZMA 2EHGA 5HLFA 3UO0A 2A10A 1T6CA 4CH1A 2HSTA 3OL8A 3BS9A 4NYFA 1RU1A 1D5AA 1SC3B 2UUCK 3VAFA 3RB3A 1IBLJ 3J7A1 1FKOA 4BROA 3OW2M 3VF4A 3E9OA 1EHWA 2NLWA 2ZH7A 4H5NA 2LDYA 5I3PA 4TYBA 1UZDA 5HRNA 4GMJB 2VH7A 1T11A 3PV8A 3CDBA 1N34K 2BKPA 5T7BA 2A1RA 1JJ4A 4J9PA 2IVFB 3L2VA 3ZZOA 3T1HJ 1T95A 4B9LA 3HHNB 4K4SA 2GX8A 1FTRA 2N3OA 3GV8B 1LWCB 2NRWA 1YGYA 2E1MC 4NLTA 4ID5A 4TU9A 4HTLA 3H59A 1XQIA 2N4DA 3FC9A 3MTJA 4QWBA 2ASLA 2BZ2A 1D1UA 1N56A 3FSXA 3VPZA 3NF7A 4DR7J 4CFBA 2OFGX 2ROPA 2DNQA 2ZE2B 5AQYA 4A47A 4IO9Q 5F0UA 4NLYA 4KYZA 2DH8A 4PG8A 4IG0A 1QE1A 1OSDA 5SZTA 3FKBA 1N0UA 1T3OA 1NGCA 2GELA 3CIPA 3D28A 1RT3A 2YV0X 2ADBA 5KFFA 1F5BA 4CFDA 5TKWA 1S4FA 4I6WA 2ZH6A 2P2CB 4KV8B 1NSPA 4X4TA 2I38A 4HT7A 2V67A 3TEHB 3D2WA 2W1BA 2DD8S 2GQQA 4CJRA 2J0SD 5K8MA 4CF9A 2XCPA 1S3XA 2HFVA 3R5BA 3VESA 3HKZD 3US5A 1S6PA 5DDRC 3AO5A 2BOPA 4DL2A 5AJ3F 4ZDNA 4CFCA 3VGVA 2QL7B 4JI0J 3O6QA 1TAQA 4DR1J 3CCJN 4GV3A 2BJEA 4DFPA 4CK2A 2O8DA 3SPZA 2CJKA 2OEJA 3NFAA 1KQFB 2EFQA 3AAWB 3RRGA 1HJRA 3T1AA 4DR4K 4GV9A 1H3DA 1NDPA 4CYUB 5E3PA 4TY8A 2JEFA 4OX9K 3BGRA 1G7CB 2YQ0A 4J5OA 1YTYA 1JLGA 3ALYA 1C4AA 1ZYQA 2FYXA 2DISA 3OD2A 4USTA 3H8YA 3UD3P 4IEEA 2F9DA 3OS1A 3Q8YA 4HH0A 5AQLA 4ECVA 5HBMB 3Q86A 2Z1IA 2JEIA 3HOSA 1EQYA 3KJNB 2CG8A 2QMWA 2AYBA 4Z7CA 3I0RB 3GFYA 1NJIT 3W3SA 4ZVPB 1BHLA 2V51B 1B0VA 5DQHA 2ZQBA 2UP1A 3AVCA 4D3GA 1VYAA 1GMUA 4MMOA 1DQ9A 3DC2A 1MROB 4DL6A 4RNNA 4DEZA 5BPLA 1VJQA 4PG7A 2YQ1A 3V9WA 2H5IB 3DOMB 3FMWA 3FVYA 1Y10A 5L8RC 1ULRA 3ZSYA 1Y0HA 3PKMA 2QIFA 3OL6A 4HACB 5G4DA 3TX8A 3KNAA 4A59A 2W9BA 3NGZA 5M1NA 3M8PA 1Q86T 1A5WA 3KTQA 2B6AB 4NLWA 2CFXA 4FSVA 5HAOA 1NU4A 4PWDB 4C11B 2WCXA 3FRZA 3KLGA 1KFSA 3R9LA 2M52A 1RDUA 4C8MA 2VZ9A 5EY4A 1B7FA 2QN6B 4HDGA 2GMLA 3VTHA 1YG0A 4ED8A 2E29A 3TAMB 1VQ4N 3BPSP 1WHWA 1JJCB 3BZQA 2I5JA 4UF4A 1FESA 5HP1B 3GSIA 3E9PA 2OKQA 3O9RA 2H3GX 5KFWA 3DRRB 3VQ5A 4EFAC 5AQRA 1VSHA 3NY0A 4B3TK 2RHKA 3G8QA 2KU7A 1NGFA 2Y9HA 3R5JB 1S6QA 1JJHA 3V6JA 1KRPA 1N32K 5HSPA 3KHYA 4UW2A 5BR8F 2HMIB 1FNMA 5KG6A 1NSKL 2QV6A 3HHEA 3E1YA 3BSNA 3HM9A 5HBMA 3CCUS 2KYXA 2Z2ZA 3OFHA 1SKWA 1Q8BA 3SIPB 2GMJA 1PYTA 3U4LA 4DL3A 2X1GA 3OBYA 3E3XA 1T9WA 3JXUA 2GJFA 3THYA 1OQ6A 2CJ9A 3MXHP 2VQFF 2KXNB 4RNHA 1U6ZA 3M2UB 1XHXA 2GFFA 2P5VA 4WF9L 3ILIA 1RBTA 2MKYA 4NXMF 4OKKA 4DR2F 1TAUA 4BE0A 3FEXB 2C3OA 4LSNA 2HGMA 2OPPB 1SCJB 1K73T 2B6AA 1OH6A 4CDIA 2XGQA 1FKAF 1VRQC 3VZIA 3OJUA 2O01C 3JAMO 3F5TA 1D8ZA 5J1NA 4ICLB 2HGLA 1ATNA 1NZAA 3I96A 3BO2A 4FXWA 1HJOA 1S12A 2GHVC 2GW8A 1RT5B 3KK1A 2H9ZA 4AHTA 1LWFA 4C0BA 4W5RA 3BKFA 2E5LJ 3H1VX 4DQRA 2GCFA 2HBLA 1J2VA 4MIAA 4OYMA 2HKEA 4OKEA 3H6EA 4MK8A 1NOYA 4FLZA 1GLCG 2D3ZA 4HCCA 3CIMA 1QAJA 1RKJA 5A6PA 3PJXA 2XLIA 5L9NA 3PIOL 1LAWA 4I7FA 2L9NA 3E2EA 5KFDA 2FBXA 1XMQK 4OYBA 1SKUB 5IM0B 4F8RA 1GOCA 4JP8A 2HK2A 1ZZFA 2JWNA 2E88A 1DTTA 3I55N 4LF2A 4WQ5A 3ENWA 2HBRB 4K4VA 4OYWA 5CYQB 4C3KA 4E0DA 4OQJA 2MMYA 3MN6A 2Z1GA 4HDHA 1RLDA 4B9NA 2BUNA 5IT0A 2O1PA 1LW2B 3KLEA 3L4BC 2Y3YA 3UR0A 4EZ6A 2ZF5O 3PYGA 3ULDA 2GBZA 1N32J 2J6SA 2LA6A 2C42A 3GPAA 2O3DA 4OFZA 2DNZA 4JHDB 2F40A 2CH5A 2OP5A 1J9AA 4ED5A 5ETTA 1F6TA 4X4SA 4CGFA 1YVFA 2R2RA 3MX5A 2HNZA 4KFBB 1QDUB 1VFJA 2V8VA 3EJMA 3A8KA 1SJ4P 4ICLA 1DY3A 2GTDA 3AV9A 3O3LA 1SPBP 1RT2B 5U47A 3AOCA 3TAFA 1V4TA 1GMWA 1S5JA 2XM3A 3M8QA 4QJVA 2HNDB 2IJRA 3OXFA 4FYVB 3KMQA 4M3UA 2HFSA 2HHWA 4TVAB 3ZC4A 4B1XB 3Q24A 1YRUA 2WZ1A 3CJCA 1Y00A 2QK9A 2QXFA 4CGGA 1DFDA 3VERA 1VIXA 4QIFA 3POTA 1S72N 1TL7A 2R7UA 3UE2A 2J9DE 1BL3A 6AT1B 3SDEB 3OW2R 3DXBA 3E66A 2O8CA 2DY4A 4CNYA 2WOMA 3UNGC 4AL6A 4EWTA 3HP9A 3DRSB 3HHLA 4KRWA 4RWWA 1K8KB 2GQ2A 4HYKA 4OZ5A 1VQOS 3D1HA 4JI4J 3RU0A 5GAEU 3Q8PB 2BM1A 1PGZA 2K7KA 3C19A 1XMOF 3FGVA 4JI5K 1YSJA 2ILYA 5I9EB 3J81j 1VDHA 3G8TA 2YKQA 1OY8A 5HRRA 4M3WA 3BDPA 3MR3A 2FQQB 2XLJA 1FEHA 3UI3A 2UVWA 2B4UA 5DM6Q 2LECA 1N88A 5ADZA 3DOLB 4B1UB 3V6DA 1UFWA 4KPYA 4CEFA 3GJRB 3A12A 3IG1B 2CQ4A 2DNPA 2XULA 4HVZA 2BACA 3SSRA 5FLXO 4LT6A 5KT3A 2V8PA 3F9MA 1N34J 4OX9J 4LF6J 1YJUA 2N82B 3CCZA 2V9WA 3M6XA 3D54A 4UOHA 2HHHJ 4I6MA 3FZKA 4IWVA 4DF8A 2G8VA 2R2TA 5BREA 3WQUA 2OPQA 3CFRA 2NZCA 2MZTA 2Y1LB 3H4DA 2NQPA 4ED1A 2ASOA 4AXIA 3HMJG 1LW0A 1RE1B 3BSOA 2UU9K 2UVUA 1VC6A 2D7SA 2NRVA 3SZ2A 4Q45A 4X62K 4U67Q 4LF5J 1I3AA 4CI0B 3KK3A 4H0TB 3VQ4A 4DV2J 4BVOA 1RWXB 4DHVA 1IBMF 2BE7D 1IKXA 2WVFA 2D5RA 2WTUA 2AHOB 1Z26A 1DBDA 4OV6A 1X5OA 4KJIA 2R2UA 3HPOA 2JGUA 1S9GA 1NK8A 1FRLA 2QA2A 3IP0A 3TQEA 5J2QA 4RPFA 2CPJA 4ZIWA 2KH9A 4RNFA 5KFVA 4OLOA 2GHPA 1C6VA 1WKKA 4OI1A 1X7VA 3QFWA 4CHQA 3I87A 4DR6F 1MWMA 2NZ4A 4PXCA 2PDAA 1U1LA 4IG0B 1SS6A 1QE1B 1UWBA 1UAXA 4CTAA 5KFAA 3T5HA 1RU2A 1PBAA 3I31A 4DCPB 2JVOA 3THVA 4BDZA 5HMYA 2G8WA 3SEOA 1JK9B 4I68A 5FPDA 5AR0A 1W26A 4ELTA 1XBWA 2CQIA 2L48A 4QOTA 4PKDB 3QDKA 1NAQA 1LWEA 1VQ7S 2VOPA 2CZ9A 3IR6B 1K0VA 3PG9A 2D3O1 2XMUA 1NMEB 3WNHA 2QT7A 2M2BA 1YK9A 1DHMA 3VQCA 5DM7Q 4DUYF 5GAHP 4IQMA 3CF5Q 1RT5A 3GIKA 4ZPBA 2CPXA 2KLAA 1HYSB 2QC3A 2XZTB 4J9VA 1K1QA 2GVDA 1QQCA 1KQGB 1EJ7L 4FJ7A 3DLEB 4EO8A 1S1UA 3D6MB 2UV8A 3UN2A 2RUSA 4WCEL 2ZUAA 4H4KC 4CIEA 4IDHA 3ELHA 3H2VE 4WKRA 4O5BA 1MMDA 2OTJN 3G87A 4DFKA 4QPTA 4C8NA 3UE5A 5BYRA 3T1HF 1S9FA 4LF8F 4CLTA 3SQ1A 2PFUA 4NO7A 3ZSXA 1KHWA 4OIXA 5F3TA 5KG5A 1LQ9A 3KUGA 2G0CA 1T9UA 2LQ8A 2B9XA 2NRTA 4YFUA 3HSZA 1ZC6A 3QSYB 3NAEA 2HQCA 1GLAG 2GGPA 1UAWA 1J5EF 3TA2A 1IJEB 1HMVB 1HR0J 2CH6A 1ZBLA 3EE9A 2P9NA 4FWKA 2X3DA 1KVAA 2FVRA 1GX6A 4J37A 1TUUA 3VV2B 2CWKA 4F0HA 3D66A 3QPIA 4B9VA 4KPCA 2LVWA 3GIIA 5HRSA 2HZCA 4OI4A 1Q7YT 4H4OA 3TTFA 2KFYA 3L9ZA 1WOSA 2XY8A 2IAJB 1EXQA 3M05A 2OMLA 4GKJF 4B3RK 2XMVA 1LNQA 3BEGB 5CAAA 4A8YA 3FZLA 3PZPA 3PSFA 4CYUA 4DQSA 4ZPVR 1A5XA 1S1XB 5LMUK 3EZOA 4CESA 4LF4J 1LWEB 2PA3A 3P5JA 4CJKA 3I9V9 3KLGB 1T8EA 1Q78A 3JXOA 4PEOA 3UVJA 1CSJA 1D0EA 5C0YA 2ZBPA 4QU7A 3SAFA 1EWQA 1T6DA 1X8DA 2GUIA 1C1CA 1TKXB 2F3JA 4K8ZA 2R8IA 1HBUB 3CEDA 2N3LA 5KT4A 5LMUJ 4K4UA 1O13A 4K42A 2P51A 4OHYA 3ZX0A 3QFPA 3NGRA 2ETJA 4FLUA 2F63A 1I39A 2CXEA 1J54A 2J0XA 1VQNS 4HACA 4BR2A 3ZZUA 3KD1E 4KBOA 2Z57B 4L6V3 3MPVA 1XIQA 1OY6A 3HT3A 5HMWA 1U1NA 1HKGA 3MUMP 1WSFA 2QTDA 1TUVA 3MMVA 1BHNA 3MPYA 4EZ9A 1WAFA 4DV5F 2RRBA 3ITHB 3DU5A 1HUXA 3D5MA 1WAJA 3AB2B 2Q3PA 2U2FA 4YHHF 2KM8C 1UEUA 5HVHA 1ESVA 4WYBA 3SAHA 2KT5A 1XMQF 1UVMA 3VEZA 3W66A 2KVQE 2LCWA 3LGMA 4B3MF 1U8SA 3HHDA 1B0TA 1RKIA 1SH3A 4KTQA 3HZ6A 1NK5A 1X5TA 3L7PA 2G4BA 1WG5A 2DT9A 2XO6A 4DV3F 3ZO7A 4NX9A 2J0WA 3EDRB 3CMQA 3RR8A 4JI5J 3OS0A 3MCOA 3QZ8A 3B4MA 3HJVA 1HNIA 1TKZB 3MMBB 3DRYA 4DL5A 2HHPA 3O1LA 1HNVA 4N41A 1NB7A 1RGVA 4H5TA 3AJ1A 4CK3A 1KTVA 4USVA 1PAEX 1P1LA 1U1PA 1JJ2R 4WQ5C 4EGLA 5AZIB 4LRAA 4Y2MA 4K0KF 2LKZA 3QYYA 5KPRA 5F0WA 5T41A 2K06A 2DNLA 4KI6A 2AV5A 4BQZA 2AU0A 2EPIA 3EO3A 4YOYA 2XMTA 1J6ZA 1R8CA 1X4CA 3MTKA 2FXUA 3LTOA 4A61A 2F7VA 2WB4A 3NGYA 2R2SA 2CJQA 2GAHC 2CGLA 2BUPA 1S9GB 3RYLA 3SMZA 1KVJA 4RKUC 1VQ9N 3KLIB 1FE0A 1PYSB 1ZTTA 3W5YA 3IAS9 2JL9A 4BC9A 3PR5B 1L3UA 4RW8B 3ATUA 1T9YA 2P9UB 4LF9K 4IFYA 1ITGA 1LKZA 1KQSM 3UKRB 4E1NA 1J5OA 5JLFA 3CJ8A 5BPMA 1EIYB 4ZLLA 3SCIE 3OHRA 3FCHA 4WFBQ 3VGMA 4AHUA 3M2VA 2ZNYA 3R3LA 3T69A 3OTOF 4RUAA 2V4JB 3EZUA 2ZH9A 3HFVA 4I9LA 2B4VA 3MWBA 5JXSA 1U8WA 2EFGA 4LRBA 4X4UA 4HEA9 4DV0K 1Q95G 2KW4A 1E6YA 2GJ2A 1HPZA 1SC4B 4F3MA 4E1MA 3AO3A 1GNKA 5GIPA 2YKAA 2YNHA 3AVAA 5GMEA 1VRTB 1N33F 2ZH8A 2J6UA 4R8UB 2BV3A 4AUKA 4MJKA 3MXMA 4NEZA 4DTMA 3KDOA 3PYFA 3MD1A 3MR5A 2WBRA 3R3TA 5B0DA 4NOHA 4PXEA 4DV4K 1XEZA 3OTOK 3G96A 3AQOA 2A1SA 3QLHA 1R3NA 1ATSA 4M42A 3KWGA 1UFLA 2I2YA 3CCQS 3OYHA 4UT4A 3GU0A 2BE9B 5AQTA 4E7IA 3GR0A 4URSA 3ZZPA 4FK0A 3NS7B 3IBWA 2UYTA 2NSCA 1WHVA 2MKJA 2QKKA 4N8NA 1IQZA 4ZMMA 4JKAA 1SAZA 3T7ZA 4KHRA 5AQQA 4JI4K 3T6BA 4DU4A 3TABA 3IWLA 3SUNA 4ZP6A 3QBCA 1WC3A 4P74A 5ETLA 4ZLPA 1M1KT 3V2UC 2QO3A 4ZK7M 3O9UA 3FE1A 3L95X 2CQDA 4QR2A 1GOBA 2CNKB 3R7BB 4ZA1A 4CEOA 4CGJA 3ZZYA 2CJYB 3EGVA 3OPKA 5DK5A 1EARA 4KREA 4Y2CA 3J7ZO 4GVBA 4IO9L 3ISND 3AO2A 1S1XA 4DTSA 2DHAA 4NCBA 2OSQA 4K0KK 4OLAA 3C14A 3OQ2A 2FJWA 1NZ8A 1U0HA 4WFAL 3NEKA 2XWXA 2DHXA 3OYAA 4Z0UA 3BDEA 4OV1A 2B5JA 2Z30B 5HL7Q 3LDQA 3BM7A 1SQGA 2IBKA 1E6YB 2K3KA 2IDLA 4M45A 1IG9A 3MEGB 4YP3A 3H3NO 2ZC3A 1FF2A 1SV5A 3MM8A 3QNOA 3GJTB 1FJ7A 3S9HA 2XNRA 5AQVA 3O4WA 1HD1A 4PAAA 5HL7L 4CEEA 2LXFA 1ATRA 2J7WA 1IWAA 3G6VA 1U09A 4OI0A 2DKOB 3D1OA 1LWCA 1Q9YA 3WNFA 4JS5A 2QZ8A 5DG9A 4BE2A 4ED3A 2B3TB 3WIVA 2RU9A 3AVKA 3KXDA 3MEKA 4DI6A 2FHMA 4KV8A 4M7YA 4ZPTR 4CZEA 4HL9A 2YWKA 2NPFA 5HJYA 4O3QA 5KAKA 4OO1J 4PA1A 2X74A 2DGTA 3ZZRA 3B78A 3WNEA 2Q43A 4U6PA 5KFTA 1PO6A 1CVJA 1KR4A 4DDFA 2M4MA 1VHIA 4FJXA 1XMOJ 2OTLS 5GMDA 2VV5A 4DSJA 2KDOA 3KWMA 3RZAA 1JB0C 1WNEA 1O0PA 3L2UA 2IDOA 1YJRA 4QIGA 1BDGA 1C0FA 3L2WA 3K2PA 4E89A 5C5JA 2BDPA 4IEIA 2DPNA 4F4AA 1DTQA 3TSPA 4ZCLA 3A8IA 1V5IB 3TI0A 2ZHBA 1T05B 1JLEB 3KK7A 5A0YB 4CO4A 2I6WA 3DDKA 4IXCA 1OS5A 2A6MA 1RUSA 1SB6A 4KHSA 2E8AA 3TVYA 2R7QA 3LGNA 1BWEA 5FRMA 2KTQA 3CJ5A 4JOUA 1SH2A 3VHQA 1UKUA 2VQEF 1U6FA 2PYJA 3TJ8A 4GKJK 5GADU 2WRMA 2QEXS 4ZKAA 1OH7A 1I5OB 1JLCA 4I56A 4TKTA 1PBUA 4CLYA 2AF6A 2V8DA 3SDEA 2EFNA 4QWEA 2KT2A 2IVYA 3J80U 2EG2A 3CMES 4O44B 1VLOA 3HHLB 2FPHX 4BS2A 4YORA 1T0TV 2MZSA 2H54B 3GG4A 3I32A 1WC1A 3T19A 4ETZA 1UJ5A 3LALA 3BPDA 3LP0B 4O55A 3MEEB 4IH6A 3MCPA 1RBAA 1HYZA 2ILZA 3EYZA 3ISZA 3K5NA 1F5AA 3I0RA 3RBXA 1NBEB 3S7RA 3MMAB 3J7YU 2GV9A 1RGIA 2QSWA 3N5BA 1KVCA 4A8FA 3U1MA 1Y3KA 3CJQA 3X1LB 2UUBJ 4V19X 2DNMA 1VSDA 2EKYA 2CUYA 2VG5A 3R8YA 2V4JA 4NI2A 1QAIA 1HYSA 5L9XA 3BN4A 2AKWB 1P27B 4LFAF 3EMTA 2B43A 1S1UB 1GXLA 3CC4S 1Z6RA 4KTWA 3EWGA 1ELOA 3IWXA 4JBCA 4WJBA 4H5VA 3O9TA 4BDYA 4NA3A 4B8CA 2RQMA 2MQOA 4RUCA 1SQKA 4NWBA 4NMXA 5LL6d 2HRTA 3N5FA 4RX6A 1R27B 2ZZNA 3TX0A 2V8GA 2RF2B 1YQHA 4DUYK 2LU1A 2BQ3A 3V6HA 2OH2A 3MUTP 3DGPA 2AEJA 3RMAA 3E8OA 3ENBA 3I8BA 1OH8A 3OYGA 2HFNA 4K50A 4WFNL 4B3RJ 3BBFA 2V69A 1SC1B 1EKRA 2VF3A 4K4XA 3P4UB 4JKGA 5CYMA 2AJ2A 3GE1A 1NGHA 1VSJA 2WC9A 5LM7E 2G8UA 5A8RA 1B70B 3JTNA 2YKNB 2MQNA 3PW7A 4RW4A 4ZP8A 2ERRA 1CJVA 2HK3A 4MIWA 2OD4A 4CZCA 2GIRA 3ENHA 1TL4A 2MGZB 2EG1A 5LMNJ 3FFIB 3ZSOA 1WLJA 5AQUA 2PAVA 4ZOSA 3RUBL 4ILLA 4RUBA 2F5GA 5H9FK 2GQCA 4O3SA 4KO0A 2G8KA 3UKUB 4W90B 2QX0A 2XZWA 4FW1A 3UPFA 1QS4A 3DLRA 1UJ6A 2YX7A 2MYFA 4AQYF 1MW7A 3DYAA 1VQ9S 3KDNA 1RTZA 3GG1A 4X4OA 4BRGA 4P72A 3RW6A 2D69A 5IV4A 4FM0A 2AX1A 2FZCB 1TV6B 4F67A 3TARA 1QY7A 4XK8C 3M9OB 2UUCF 4DV0F 4FPIA 1EQMA 1FVSA 4LH5A 3ZT2A 2IC3B 2PEBA 5DLGA 1S4EA 2BABA 4DFJA 2W2QP 2E4LA 4CF8A 2FF6A 4GV6A 4FJLA 1XNQF 4RWTA 1D09B 3ATVA 3K17A 1NMDA 3G10A 1HQUB 5F1XA 2MKCA 3BQ1A 3MMCA 1RAFB 4ZPCA 1SIZA 1SUQB 4USJC 3JAMU 3ZZZA 4FPBA 2DRDA 5GAGU 1R59O 4BR4A 3DDNA 2O8BB 4XIUA 3CD7A 1SBRA 4CBUA 1GX5A 4ILMA 1RYSA 4LR9A 1XTZA 3D6FB 4M5GA 3HSTB 3D6HB 4OPAA 5JMVA 5KFIA 3QBXA 1V5VA 1W7WA 4UOCA 3L4QA 3KLVA 1TUYA 2J76E 5DGAA 3O8WA 5J1EA 5MLCV 3Q23A 1CXQA 3WXJA 1IBLK 2HNZB 2FSJA 3ZETA 1ROFA 4OZ1A 5KFBA 2RQKA 1KLMB 4DTRA 3H20A 5EX5A 4OI3A 2ZHOA 4MKAA 5J2NA 3W9IA 2BRLA 3L0QA 3LWMA 3N4PA 4DF4A 5F8MA 3B6OA 1WG4A 4QOZB 2KFNA 3EGZA 4OZLA 4X64J 1HQEA 4F4KA 1BMQB 1L3VA 2RDIA 1SJRA 2F8TA 5EX0A 4OKJA 1B3TA 1TUGB 3AA8A 4ERDA 4R79A 1U2FA 3PYDA 2JWKA 4JI8F 2NXEA 3KG4A 3QWPA 2MJUA 3SBGA 2PI4A 5F2RA 1L3KA 2CPDA 3KOAA 5KFKA 3SI6A 1RCHA 2MZJA 2UUBK 2GHWA 3AHPA 4CJEA 1GEHA 1BQXA 2JH3A 3BF1A 4XH5A 3SQ4A 2VBYA 4NXMJ 3HBTA 3CJTA 3KJVA 2WVBA 3JS9A 3NS6A 2MY7A 4JK9A 5F9NA 4O4RA 5KQ8A 4C8OA 3C6UA 1UL3A 1KOOA 4K0KJ 1QHAA 2LLZA 3GYGA 4I9QA 4JI6F 3SUOA 1S1VB 2P9SB 1Y7PA 2YNIA 2ZH2A 3IGVA 5I3QA 1X5SA 4KY3A 2O66A 3H90A 1QSSA 2ZH5A 3IXQA 4Y1DA 4RBUA 4BC4A 5FPMA 1S0NA 1EB0A 5DQIA 2AEFA 2V2QA 2GO9A 1HHQA 4IOBA 3AGRA 2IVOA 2HHTA 1U2VB 4IOCQ 5LSRA 5F8JA 3NHGA 1YHQS 4QWDA 1X4BA 4Y2AA 4R8UA 5CXTA 4X4NA 2E7XA 3KJFB 3S3NA 5GAEI 4B9UA 2B7CB 3MM6B 2DH9A 1GFWB 3LDNA 3NF6A 2KN4A 1U04A 4M5JA 4U9RA 1H98A 2OUGA 1Q86O 1RTIB 5B7WA 3BEXA 1HKAA 3QGHA 4JV2A 4Q8FA 1MWQA 4DX5A 4AL7A 4DS5A 1F60B 1E3MA 4LF7K 4JN4A 3QRQA 2YJEA 1QVFR 1X4FA 4GVLA 3OTBA 5CYMB 1LCUA 1Q16B 3MEGA 1QQMA 3GG0A 1RWWB 3CDAA 5GVQA 4M41A 1TK0A 2DFFA 1BA1A 3CCEN 3HX9A 3IM9A 2BE2B 1TVRA 1N33J 4GW6A 2G2ZA 5DZ7A 3TANA 1S22A 1CBKA 1I51B 2ZWPA 3DM2B 2GJIA 1YRTA 3G9CA 2VWJA 3CCSS 3DXKA 3C46A 4TY8B 2IM0A 3T1YF 4LIWA 3VMFB 3KLIA 1BU6O 1D4XA 1ZBIA 2YX6A 4DSFA 3RB4A 4RL1A 1M90T 4UY85 4ES3A 3T9ZA 1BCOA 2BJ3A 2CAJA 2X1BA 4KKOB 4QW9A 3PW5A 1L3SA 3BBCA 4RBTA 3N0VA 4L74A 4UOFA 3L7OA 4U67L 1XHZA 2J7KA 1DT9A 2C2NA 6FD1A 4LF8K 1ACMB 1DLOB 1GK8A 3TU5A 4QIVA 2GIFA 4WK3A 4Z4IA 2BANB 1HFEL 1VHFA 4C7QA 4ER8A 2QKBA 4OJRA 3TAMA 2OTLN 2JZ5A 4WP9A 4MKYA 5IT4A 1IKVB 3KZBA 5CYJA 2R9LA 4DN9A 2OFHX 4S0MA 1HL6A 1HNWJ 3QWUA 4UQGA 4JI7F 1UTAA 1VK3A 2R7VA 3M8PB 3N4QA 5KG4A 3OLAA 2QLXA 1CQMA 5HANA 1JIHA 2KQ2A 3VQQA 2IGIA 2YNHB 4B9QA 1H38A 4YB6A 2HLTA 1Q7LB 2D1KA 4NXNJ 2BM0A 2YX4A 3CC4N 3AJDA 3UCZP 4PYDA 3QAEA 3EKUA 3NXZA 4CRJA 1Z05A 1HW8A 4ZP7A 2PFFB 1JKHB 1M1KO 3CJKA 1FVQA 3L3UA 1Q18A 5EHHA 3WQTA 1U6BA 4ANCA 4ECZA 4J2AA 1GT8A 1KHVA 5E2QA 1SI9A 3LDLA 2V7YA 1KVIA 2ZOGA 1LXJA 3DLKA 2EKNA 4ISGA 3FBBA 1QSLA 5G0RB 3I9ZA 1RACB 4BCAA 1QHTA 5AE3A 1HNZF 4LBPA 4KKOA 1Y5IB 3LP0A 1HIYA 5B0FA 4QYZK 4NMLA 2MHNA 4PPDA 2UXCF 3AGKA 1HMVA 4P9SA 4X62F 4ISEA 4JV5F 5JLHA 2ZH3A 2MKKA 2DO4A 4L3NA 4F0MA 3VGKA 1OH5A 2UU9F 5AQKA 3CCMN 3Q8UA 1VBKA 4CIFA 2YXLA 3OUYA 3EE8A 5H1SV 1JLQA 3Q8SB 4DR1K 2XQCA 2AJFE 1S1WB 1VSLA 4ETXA 1X0FA 4CF0A 4C6AA 2ZOFA 4EAHD 3PLAA 2JEGA 1TFYA 4LFBF 2OPPA 3AVLA 4JI3K 2VUGA 3IN5A 1F1BB 4FZXC 3BKTA 4O44A 2YWHA 3SQ0A 3TZZA 5D3GA 1Y64A 3WEEB 4C4WA 2GWKA 4LF6K 5HROB 2D0CA 1NKEA 5IM0A 4M5IA 4KHPF 4U95A 4USKA 3C15B 1AFJA 1Y5NB 2RVJA 1H2TZ 5F8LA 3AY0A 4J2DA 5LJ3Y 2MKHA 2E5LK 4Z94A 1PAUB 2K8GA 3TPQA 5KPZA 2B8PA 3QFUA 5M2UA 3CM6A 4RBVA 2JLFA 4UY8T 3CIZA 3B8AX 3RG6A 4DU7A 1RP5A 2VDHA 5ETMA 4KHUA 1RHJB 5CHIA 4FLYA 4JYAF 4AD6A 4A2AA 2W24A 2W8LA 5AE1A 2R7SA 1BI4B 1NKBA 3CC2N 1H0HB 4DWIA 1AYEA 2QL5B 1CQNA 4K41A 3D45A 4ZVQB 1VQMS 5C12A 2MSSA 1HR0K 2CJXB 2HEKA 3VGLA 1RT6A 3KLFB 5HATA 2NUHA 4YMEA 1MMNA 1FRIA 3TZYA 2OJ3A 4DV4J 1XNRJ 2JJ4D 4KBIA 3PEHA 4ZVEA 4FWRA 2AEMA 4LIRA 3CD6N 4JI7K 4FKXA 5AQOA 1Y9OA 3JTPA 3PW0A 4LF9J 1HBNB 2HRUA 4WE1B 2ZNZA 2X78A 4JI1F 1VQLS 2OYQA 2CPFA 3PR4A 3GIMA 4PG6A 5BYQA 1JMTA 1KC8T 4EBDA 3FNNA 2VCPA 1N4LA 3TUZC 1NHVA 4DBQA 1N33K 1JNRB 1R43A 2IA0A 1M1GA 1YITS 3G2XA 3MPUB 4XDCA 2HHVA 3O1WA 3TO8A 3EGWB 2B9EA 3ZTSA 4OX6A 3WEEA 4FPAA 4YY3K 4RW8A 2Z2YB 3MFIA 5A6WA 4I2PB 2W4CA 4LREA 3EZ5A 3U1NA 4LR7A 5AXMA 3H1QA 2YQ3A 1PJ7A 1N48A 1M5OC 2F65A 1URRA 1WACA 1TYQA 2BJ8A 1CJKA 3G4SN 1YX2A 1D9AA 3ZLJA 2O5DA 1EX8A 2RAQA 4ZCIA 3P8BB 3HK2A 1S48A 2WAQD 1WDDA 4USMA 1XC9A 4ANEA 2P9IB 4LF7F 1Y4ZB 4B9MA 4W5QA 4JI2F 1S59A 1WI6A 2BANA 4YOWA 1MA9B 2J0QD 1LK5A 3CXCM 3AODA 5KGWA 3FZMA 1N6QB 2Z1HA 4E98A 3PO4A 2QW9A 4CZFA 1ZM2A 2KJWA 3HSDA 3U7JA 2PI5A 3NOCA 4HI1A 4OVLA 1RWMB 4H5RA 2AA4A 3DLGB 2XI3A 1NK4A 5BR9A 3BREA 5JJBA 3M8WA 2ZWHA 3PVXA 4KC5A 2IYIA 2QLBB 2BQUA 3G25A 2I8EA 3EPIA 3E01A 4YHHJ 4N56A 2RIJA 2CRLA 3AOBA 3W2WB 4NLDA 2C2EA 1U1OA 4I6MB 5ETKA 2QM1A 1J53A 2UUAK 3GCXP 4CLLA 1KAZA 4F4WA 2ZZMA 5C2CA 1S0OA 4YN3B 3ZZ0A 1WF2A 4Z4CA 2J9DA 2KYZA 2VBZA 1ZBSA 4M63A 1AW0A 1NRKA 5LSLA 4F9OA 2AJ1A 1LAVA 1BQNA 3AARA 3FEZA 3GJQB 1FJEB 5GMKa 2IOCA 1R6VA 4K8XA 4W92B 3KK3B 5L1LA 1A7GE 4F36A 2YKMA 1YKWA 4CO1A 2G2OA 4QAGA 5L46A 1TYQB 3JSRA 4LRDA 4ID8A 2Q6BA 1YJTA 2UXDF 2M8HA 3RRKA 1HQEB 3UKUA 3R1LA 3HSGA 1LFWA 1RA6A 2QYGA 2V50A 4NRUA 4DR3F 2Y1JA 3M6WA 1JWWA 2UVVA 4DPWA 2AYGA 4FJ9A 3SFGA 2QWQA 3U1LA 2MEWA 3N4WA 4ILRA 2WB1D 3UWTA 2BX6A 3CCLS 3AVFA 4CLUA 2LEBA 1RAHB 3SV4A 3VQPA 2RQ4A 2ZKTA 4CT8A 1CJUB 1M1HA 3ZX2A 2UUTA 1R8AA 1NGAA 3CFOA 3PRVA 3V6KA 2Y0SD 3OYFA 2E20A 3BH7B 4YNQA 5FLXU 3R6GB 3ZEUA 1XWLA 4J2BA 1S76D 4XPCA 2DXEA 5EUHA 4H0PA 3IRXB 1G99A 1P9QC 3D3BJ 2E7WA 4OLBA 4KRFA 1ZA1B 2Q66A 2PN6A 1IKWB 2XS2A 5AQXA 2LA4A 4CVNE 2KL8A 4ES1A 3ID6A 1U7LA 4K2XA 3JSYA 1K8AT 1RDAA 4HTIA 1Q9XA 1ICEB 1Z4UA 1K44A 2WSEC 1TP7A 1LFPA 3QJLA 3DRRA 2CYYA 1BQNB 4MT1A 1X0PA 4X66J 4DB3A 3NGTA 1CULB 3MXJA 1DARA 3JSBA 3MEDA 2HNYB 3V1QA 2VDIA 3NH2A 1VRUA 2VB6A 2E9RX 4BRNA 1FRJA 2PO4A 1QVGR 2CQ1A 3SJJA 3CO0P 3TRGA 1LEOA 2C3PA 4FKYA 1P9YA 1RT1A 4DV2K 3QMQA 3QNWB 2R4FA 1HBMB 2DPJA 2NZTA 4NYNA 3W64A 3R6LB 4F4ZA 1N54B 2IRXA 3VZHA 3N9UC 3D3CJ 4YY3F 5DS7A 2HURA 3WT0A 1FKOB 3NNCA 2P9KA 5HVGA 1KAXA 7AT1B 4BVPA 3CJ0A 1VQ6N 5LXRA 5ETPA 2CGKA 1P8GA 1FXRA 1TMJA 3L2QA 4JRQA 3TZWA 4FJGA 3HZEA 3PFEA 3CGIA 1TVRB 4CBWA 4M3TA 1RBLA 3OLBA 4JI1K 2DNOA 3QT7A 4A57A 4XTTA 5C2GA 2GC8A 4YB5A 3EPGA 3V81A 2P9PA 3UDLA 3N6MA 2L3MA 4ISFA 2CQHA 2RRAA 4H0XB 1RHRB 2XMKA 2PFDA 3CETA 3DU6A 2BVZA 2J9EA 2E1ZA 4PXDA 4LBHA 3HD1A 2VL1A 3BGOP 1N52B 5KG1A 2ZD1A 4F3OA 1RLCL 2MLYA 1YZ7A 2XHBA 5ETQA 3GIJA 3AD9C 4ZVTB 3BZCA 2PC6A 5BN8A 1YJWS 3CG7A 2YNGA 2NS1B 5EDWA 1KDNA 1ZZNA 3ZSWA 3D0HE 3SPYA 1NWKA 2YNFA 4EBCA 4LC9B 1NGDA 1FRHA 3OFEA 5CCLA 4Q43A 3VEYA 1WWHA 4RU9A 3VQBA 4M5LA 1U2VA 4P7TA 1QQNA 2Q97A 2BKOA 4DKWA 3DMJB 1VSEA 4B02A 2E5GA 3CO9A 3DKDA 3NAHA 4N76A 5ELZA 5KFUA 3ZT0A 2JHEA 2PMWA 1P8ZA 1IBMK 2F7TA 4WFYA 2VFVA 3N01A 4P10A 2I1RA 4PR6A 1B4SA 4DUTA 2QSFA 3SLCA 1S6PB 4YEAA 2DHGA 5D8HB 2KB2A 4LFAK 5CABA 2VOOA 2YJFA 1RTIA 5LMUF 4DPUA 2CPHA 3M30B 2H5JB 2WUSA 3VALA 2IM1A 3MM9A 2W7PA 4CJPA 2AJ0A 2OIHA 1JXVA 4E7HA 3V81B 2YY3A 1TQLA 2C2RA 8ATCB 3FBFA 1K8KA 5D0GA 2ZHAA 4WKYA 4USUA 3DRXA 4FL9A 3WC2A 4V19S 4CW7B 1NDKA 2HB5A 4FVCA 1XERA 1FFGB 3H40A 1J5EK 2RJZA 4B3MJ 3MCAB 1ZA2B 2O8EB 4JV0A 1RK8A 4E7KA 4YOVA 3SYZA 3KVGA 3DOLA 4ZHRA 3RAMA 3A1YG 4NLRA 5HLFB 2YNGB 3J7YP 3CFPA 1YUWA 2FHJA 5ADXH 2V0NA 3I5CA 1VBYA 3H4BA 4FN5A 2GS8A 3CNQP 2R42A 4DTXA 2QMXA 4P75A 3R1XA 3KMSA 4ZVHA 4PABA 5AQFA 1UCNA 5T14A 5EGYA 1HBOA 3NE6A 4AFFA 3O4NA 4BRHA 4DR2J 3I5BA 1CJUA 4Y1CA 2HFOA 5AQJA 3U3YA 3MCSA 4K7QA 1WEZA 3EM1A 2Z1JA 5B09A 3OY9A 3FK4A 2LSNA 4F0KA 2FGOA 1FHTA 1CG2A 3M8SA 4KR0B 4KGMA 4CJUA 4DSKA 4Y0WA 5KFQA 3NDKA 4Q44A 4IR9A 4RJVA 2O8BA 3Q89A 4M1KA 1SL0A 1FRXA 3V4MA 2CDRB 5LJWA 2CQ2A 4FJIA 7FD1A 2AQ4A 5JVGL 1OVQA 4LRCA 4ZJOA 1VQ8N 1PILA 3BR9A 5EU7A 2WK4A 2FZGB 2MKSA 1V6HA 3EXYA 3OR2B 3LO3A 2E1YA 4BRAA 4ECXA 2VPZB 3GWCA 3G82B 2Q0UA 2Z2LA 1RADB 2H3EB 3UFCX 2F96A 3MMCB 1Q79A 3MCNA 1PIEA 2B9YA 4KGKA 1GLEG 2UUAJ 3SJHA 3NMAA 1RT3B 2CA9A 2Y0BB 1C0UB 2C3UA 2NREA 2C1EB 4FXVA 4NLSA 1QSYA 1CJKB 4IBNA 2DH7A 5C42A 1XQSC 4CBXA 3CCES 1KQKA 1GLBG 4CZKA 1RDBA 1WKLA 5CZVA 1U24A 5KFHA 1T9VA 2D3UA 2JNJA 2C2DA 4XH4A 2DNYA 4A8SA 4EP4A 3J8AA 2PIIA 5CZ1A 5A2QY 1VK8A 4CZHA 4GY2B 1RISA 4PWUA 2DYAA 4DR1F 3ZETB 2NXCA 4QR1A 3HSCA 3W63A 4ECTA 4DUZK 3JSMA 1SJQA 1RAIB 2ZJQQ 3RTVA 1XNRF 2XHCA 3VAIA 3M8RA 3UN3A 5AE2A 1DZ5A 3AVHA 3BBBA 2M0GB 3PDNA 4IG3B 3DWLA 4KB1A 2QA4S 4HHHA 4BRKA 3GP9A 3OSPA 3R9PA 3OYCA 4BR5A 2OMOA 1UMJA 2EFVA 1F9HA 3VEWA 3DI6A 1CC8A 3D2FB 2GX9A 5LJ5Y 1GLJO 4DV0J 3W2VB 4GKKJ 1PC4A 1WOPA 2DGQA 1IG8A 4O0IA 3TAQA 3CB4A 3S3OA 2P9CA 1IUJA 3UCGA 3HTVA 1IXKA 1R8BA 4OGEA 4CFAA 2HRYA 4LY7A 5IV3A 5KFPA 3A8YA 3M7VA 5D4NA 2HPUA 2VPWB 3TWZA 3I8DA 4OMFG 2V34A 1N5YB 4XDDA 4Q5VA 4DU3A 3OYDA 4NRTA 4LF5F 3J81U 4Y0FA 3H5XA 4K4ZA 1HNXF 2ZH4A 3SCXA 3CCLN 2DB1A 5JVHL 4FP9A 4IO8A 2J4RA 5KFCA 1KSPA 3OYEA 2NSBA 2GWJA 4BRPA 4DX8H 5C24B 3HHLD 2ZWOA 5JMNA 2I5JB 2HFUA 4FZVA 1NEEA 1RXOB 2ZJPL 1FERA 2LEAA 4EP5A 4JI8K 4FK2A 4C8LA 2F4VF 2GO8A 5D4LA 2A2CA 4LSNB 1N36K 4IKAA 1MWKA 3CTRA 1WUUA 1S6QB 3VEOA 2HHQA 3M8QB 3NNAA 1B99A 3HVTB 2IIHA 3M6VA 4ZJQA 2F8HA 2MZRA 4KHYA 1JL2A 2D0OA 4KB0A 4ZPAA 2KKHA 1H7XA 3BR8A 1PG5B 4DV2F 2R7TA 4X64F 5B08A 1RILA 2KXHA 5KFYA 4ZVRB 1U1KA 3ENQA 3V9XA 1ZBTA 1FX4A 4URQU 1W2BM 1EQ0A 1IV0A 2F1FA 1NLKL 4J8FA 5T7LA 2RHSB 1HBUA 3EEQA 3GFHA 2ZE2A 2XRIA 3SSSA 1JLCB 2OEKA 2VFRA 2WSCC 1HKBA 2AGQA 4B9SA 5SWMA 3THPA 4BHQA 3JTOA 4IRKA 4WU2A 2QE5A 1WTBA 1X4DA 5ADXA 4RZRA 3AVJA 3MMJA 3DCAA 4O8UA 2A40A 3AO1A 1CZBA 1RTDB 2UV8G 2I9SA 1BWFO 4IDKB 2XZDB 3A3OB 1RWNB 3PIPQ 1BQMB 1WN7A 1AB8A 1ZXOA 5CR4A 4CJQA 2VPXB 4FS1A 4NLXA 1HLWA 2V94A 4NLGA 3NGUA 5SUHA 2DY1A 3EZWA 4WYWA 1RBUA 2HWHA 2GUPA 1T3NA 2OPSA 4OJGA 5BN9A 2ZDPA 4DUZF 4F26A 5GAGI 2NXUA 3R7SB 4YDDB 4NXNK 2DNGA 3IAYA 1MG7A 1HRHA 1VI7A 3WBZA 2JRSA 4JHDA 3DOKB 3ULEA 4ZIVA 3L6QA 1X60A 1VQ5N 4FF3A 1JLBB 2OZSA 3HHLC 4JKHA 1WSIA 5G0RA 2XYHB 3WQPA 1VAZA 3BGRB 2VC1A 2G8FA 1NNEA 4RLEA 5LY3A 5KGXA 2GA7A 3OVAA 4V19J 3O2IA 3PEJA 4X4RA 3FZBA 1JLFB 5LJVA 2R3VA 4I4BA 4Y3CA 3CDEA 1HPMA 4PL7A 1PCAA 4YR3A 1W2BR 3K9JA 3DXMB 3FGUA 2IMWP 3CMAN 3ZTRA 2WW8A 5GAHU 1UJ4A 1J5EJ 2VFUA 2VG7B 1E4FT 4ILHA 1N32F 5ETRA 2AWZA 1M90O 1VBXA 4Y6IA 2O8CB 3K58A 3SSQA 1B9FA 4X4QA 3BGFA 4ZVOB 4CZLA 5DGBA 3DDIA 1IH7A 1KVBA 4M5MA 1R0AB 3QEPA 1XR6A 5D6GA 4X65K 1NM2A 3K8VA 3IWNC 5A76A 1VOMA 2X1AA 4WQ4A 4USHA 3VQ8A 2E1AA 3IRWP 5KFXA 4EI2A 3VTIA 4A8MP 4I2QB 1FXDA 3NAIA 2V68A 4LF4F 2WHOA 1SQFA 4DS4A 2Z0GA 4P6QA 5IWAF 4ID5B 2IA6A 2MB0B 2WTFA 4Q2LA 1FFSB 3H2UB 3WX8A 4RNOA 3HM8A 5FDLA 2KI2A 3CM5A 1Q7YO 2NPIA 3LZJA 2OCEA 4B1ZA 3Q83A 5LMNF 2UVRA 4UY8O 1WELA 3CSKA 2LYVA 2KZMA 1IR1A 3NWGA 1HYVA 1XC3A 3C65A 3GE9A 1E6VB 4YR2A 2E6MA 4N5SA 2FBVA 3SK3A 2CNLB 4IJNA 4CHZA 4FLWA 3N6LA 4C1NI 4Z2XA 3O6WA 1W25A 3TSUA 1HQUA 3GIRA 4UZBA 3BSCA 3ETOA 3CCTA 3MX2A 2OPRA 1V3SA 3ENAA 3T5LA 4TQRA 2MQ8A 2DEIA 3TA0A 3CQ8A 5EN1A 4JKFA 4Z4HA 3AH6A 1WF1A 4OZ2A 3GTYX 2CNNB 3THYB 3P4IA 1HX1A 2WFBA 2W2OP 2IS3A 2GVZA 2COLA 1W7AA 2AT1B 1ZM3A 1EKSA 4Z4GA 1OYEA 3CJ9A 1WSRA 3JS6A 5E41A 4C2MA 3HI9A 4OYPA 3NS5A 4BRCA 1KS2A 1H72C 4M5KA 1HBOB 3KIOA 5GADI 4NYZA 1MLAA 2GMHA 1JX4A 3LW5C 4CM0A 5AJ3K 4BR9A 2RPIA 4UUWA 5H1SQ 1Q8IA 3U6FA 1HNZJ 5EWGA 3TW0A 5CZ2A 3G8SA 2QFIA 3PX4A 3C7NB 2DRAA 2CJAA 3M8YA 1FJGJ 3IM8A 2EI5A 1HBNA 1B92A 2BYCA 2XSJA 3H25A 4DR6K 3SI8A 3T9NA 3AAPA 4E1JA 1MU2A 3R5DA 4O0NA 3RB6A 1MMLA 1C2PA 5CD4H 4AE5A 4HVJA 4CHNA 3P83D 4J91A 2XB2D 2VICA 2L08A 4X65F 2NRXA 4C97A 1FFWB 5DDPC 1ZPVA 1V3ZA 1QJHA 1IKYA 3TVZA 1K9MT 3MWPA 2RE2A 5AQMA 4BC5A 3JB9k 1NK7A 4IOCL 3NH0A 3MD3A 2FGCA 1WG1A 1R7IA 1TL5A 3CJ4A 1FE4A 5I42B 3SXLA 3Q2TC 2DY9A 3R97A 1DGKN 1VQ4S 1RBVA 4BWJA 4OYIA 1C0UA 4ATNA 2MZ1A 3FMBA 4IDKA 3SCJE 3HSJA 4OYOA 3JQJA 2R7OA 3G71N 5BRFA 3DMJA 2WW4A 4OHZA 4CT9A 1HD0A 3MN5A 2AGOA 3ZYYX 5LL6Z 2E5HA 2MHEA 2QFJA 4HI2A 1JLEA 4H0YB 3QT6A 4IR1A 2RUGA 3RWUA 4BG9A 2ALYB 5K9FA 1DEJA 3AVMA 4C0OC 1VR6A 1M5VC 1Q8KA 2IFXA 5KG7A 4ZP9A 4CEBA 2E1PA 2P1JA 2NYIA 4CCHA 4MFBA 3H5UA 1SKSA 3WIUA 3SCLE 7FDRA 4DMNA 1RTHA 5MAOA 4KAZA 3ZX3A 1Q81O 1Q5YA 2CQPA 1JLBA 2DVIA 3PNIA 1IO2A 1TTHB 1X9JA 4DV6F 2FBTA 2IVMA 1Z25A 1FD2A 2AJ4A 1YWXA 5C15A 5AQGA 2CVEA 2DTJA 2E2NA 3GSDA 1CEZA 4RCHA 2W01A 3LGHA 4JV5K 4L3QA 3TNVA 3WUHA 4YOTA 5C42B 1URNA 1UP1A 1BC6A 1OSCA 3BGUA 1XR7A 3HP6A 3D67A 2FTRA 2C2MB 4Y34A 1R8PA 5D4PA 2FJXA 3EDQB 1C1CB 5E26A 3WZ0A 4DV7J 3M1FA 1S57A 5IZHA 2VG5B 5H9FJ 4WK1A 2P9LB 5KG2A 1ZM4A 4JKDA 4YB1P 4YDUC 1FD8A 2C22A 1N0VC 3BO4A 4H4OB 4IFVB 3VGTA 1U1RA 3TZXA 3QERA 1XMOK 2AZ1A 3A5MC 4QBUA 3IR7B 2HF3A 1NHKL 2VODA 3QNNA 1AFIA 1YLXA 1YAGA 2V7ZA 4ZPDA 1TKTA 2K7JA 5KRSA 2VG6B 4P71A 4X64K 3SMPA 4FWQA 1W97L 1RWPB 3TEGA 4M3XA 3K57A 4PKHA 1WSHA 1FDAA 1IBKJ 2Z4PA 3O3HA 4FLXA 5J2MA 3ZSVA 3OHBA 2ZM6F 3OS2A 5H9EK 2B9WA 2Z2MA 3THWA 3DI6B 4FJKA 4MKVA 5HOOA 4KAIA 4IJAA 1NLVA 3MM7B 4CH0S 4I69A 3JYTA 5CD4A 2AD9A 1SH0A 5KFGA 3JQKA 5DRKA 3DAWA 3GLJA 1FTCA 2VKZG 2PT0A 4ITSA 2C2KB 3QBWA 2VBXA 2DPIA 1CPZA 3K89A 1AZSB 1SL2A 3MI7X 4QYZJ 1VRUB 5L1KA 2HAIA 3J7AN 1YF5L 2CQGA 3LP2B 2VONA 4J9MA 5M2PA 4LF5K 3ITHA 3H08A 2FC0A 5AFUH 1OPIA 4JI3J 4DHYA 1FNOA 4M5DB 1N36J 4WZQA 1EETA 3HJFA 3FCVA 4M94A 4Y28C 4NASA 4DQPA 3CC7N 4DR5F 2PZSA 3BQ0A 4TXSA 4AILC 4Q8EA 2UUWA 3V5RA 1HWLA 4G1QA 3BH6B 1U02A 2HIYA 4FNIA 1JLQB 4IOAL 2G1DA 1U45A 3V9UA 2HQGA 4MAKA 3PIPL 4AYBD 2E2PA 3HULA 2DITA 2M3DA 2V4RA 1RQ0A 5H9EJ 1FI4A 2P5GA 3D6RA 2VGMA 1FJCA 1WHYA 4OX8A 9ATCB 3QB0A 4CO3A 3CJ7A 2FVQA 4C11A 4NXNF 1I3OB 3ZT4A 2V8HA 1UFKA 5HK4A 2J5AA 1TL3A 3TOQA 2BJ1A 4WPAA 3HXMA 3DLBA 3VF6A 1YBAA 2P9EA 3BY5A 4NXMK 3C7NA 4FWSA 2JDJA 4EHTA 2YVSA 3NWRA 3LDPA 1XN9A 3VAKA 4YOXA 3A2FA 8AT1B 1M5KC 5ETSA 3QIDA 3K5OA 1KP6A 2FY1A 5AQPA 2MXYA 1S7HA 4FW2A 1JCFA 2N4CA 1KFDA 4JI2K 3ETMA 2HG4A 2O8FB 1JXLA 4WFXA 3AY9A 3FJ2A 5KFOA 2HHUA 1T3VA 3R7NB 2IDEA 5F3ZA 2QWNA 3GR1A 5J1EB 5FJ4A 1D8YA 1H2VZ 4IFYB 5KFSA 4BBYA 3RBEA 3C6TB 4J90A 1UA1A 3LM9A 1IVZA 3BYRA 2ZGYA 3GYXB 4FM1A 3I82A 2LQJA 2W25A 3H7HB 3M2VB 3IO1A 1XI1A 1QZ5A 5KFEA 2W9CA 1FRKA 4B3SJ 4NEYA 2QWRA 1SVDA 4R5PA 4LF1A 2DBBA 3QIPB 3DJCA 2FJDB 5B0AA 4EEYA 2XEXA 1Y97A 4B3TJ 4JYAJ 2ROGA 2I7PA 4JD2A 3CUNA 3CWJA 1G15A 2O8DB 1FXXA 2QEXN 4ED7A 1IR2A 4DQ8A 3VGSA 2M5YA 1CJTA 3K7RA 4OJHA 3HPGA 3ZTPA 1ASVA 4C23A 4FJHA 2ATQA 2A0FB 3CMEN 1U49A 3KK1B 1Q5VA 3KG0A 1HNXK 3RVCA 3W8GA 4WE1A 3C14B 3Q8RB 1FCAA 1WUAA 3B82A 1KEKA 4B3RF 4AQYJ 2POKA 4Z4FA 1S1VA 2P9SA 2D4WA 2VG7A 2JEJA 3R27A 1YJ9S 3R8EA 3FLCO 5C10A 2YNIB 1RAEB 1NKCA 1NHUA 2YPZA 2R7WA 1SKRA 4YQWA 4CWBA 5DO2A 3PHEA 3RB0A 2O8FA 3AVNA 1EP4B 3TAGA 2CQ3A 2A41A 3DN9A 3OL9A 5K20B 4NLCA 1R89A 4KH4A 3UDCA 1X31C 4B17A 2XGPA 4BC3A 4WIIA 4CE9A 3D0GE 3QT5A 1QZ6A 1U2CA 2J7UA 3O44A 1HNWK 1CZ9A 1NJIO 4M5NA 1X5PA 4IKFA 4GVBB 3ZSQA 1ASUA 4LF6F 4WF9Q 4KSEB 1ZPWX 2X6NA 2Z58B 4JI1J 4WXOA 1I6JA 1U0HB 3W62A 4BGBA 4JRPA 4CLPA 2DR9A 3OBIA 4CO0A 1DJ0A 1F3FA 1VSMA 1X4GA 3BZKA 1DQ8A 5CY4A 4WP8A 3RGIA 4WFAQ 1I94F 4OX9F 4NLPA 3GCWP 2XC9A 1RA7A 4ECQA 2Q3SA 3CCSN 2UXBJ 5IC6B 3FRYA 1YVUA 2RF2A 2YCHA 3G6XA 2F9WA 2GAGC 3P49B 3LAMA 5CH7B 4RTFD 1RT2A 3PSIA 3KLHA 4QIEA 5LT5A 1UW9A 3W5ZA 3GV7B 5THWA 1KNZA 5C2FA 5L38A 4YHHK 4Y2KA 1FK9B 2CKWA 1OWXA 1N8RO 2Q31A 1Q0NA 2V2KA 5E0OA 3M3ZA 4TY9A 4R25A 1UVNA 2YKNA 3JAMY 2HW3A 1BY9A 2IM2A 1GLLO 3MUVP 1W9HA 3UCUP 4DU8A 3HFKA 4DFMA 2NUBA 2DR7A 3DLLQ 4RUHA 4FVMA 3DXMA 2MGZA 2XO7A 2QWPA 2ATCB 1VJWA 1YVNA 2F8SA 4A5BA 5EWFA 3WNGA 2RH3A 3EE3A 3D68A 3MCMA 1BOTO 6FDRA 4ELUA 1IBKK 4ID1A 3EICA 5AZJB 2LQ9A 2PD1A 3ILJA 1PKUA 5HJXA 2CPIA 1HQ2A 3R2CJ 2NYHA 4OPHA 3CCRS 4IFEA 1S99A 3TR8A 3GMGA 2FLOA 3MPWA 5A8KA 1RI7A 5M1QA 3VF2A 4RW7A 4K25A 3AOAA 3ILOA 1UPPA 3QT8A 4AHRA 2DCUB 4BWMA 3RR7A 4IRCA 4ZVFA 2YHXA 2LP4A 4DLGA 1WEXA 4LMZA 2FLPA 1GOAA 1ILYA 2OZMA 2QGFB 3VQ6A 4J9SA 1H7WA 5M1FA 2D9OA 4DMZA 3Q0AA 1KD1O 1FDNA 3J81Y 2HAFA 4Y00A 1T7PA 2Q1NA 2ZVSA 2XSFA 5F8GA 5FDLB 2DGOA 4F04B 3R2DJ 3MWTA 3UR3C 2DXDA 2BBEA 2ZBQA 3IKMA 3CJ2A 2RSQA 4CIOA 1Y5LB 4GVMA 4DTUA 3ZNJ1 4BC2A 1Y11A 4P2SA 1IJFB 4FWNA 4LFCF 3QLHB 3A0IX 2ADCA 1JLGB 3BN7A 3AVGA 3NLCA 4LVOP 2IRYA 4BRQA 1UVIA 5E3RA 4YDXA 3W9JA 1RDDA 1VLYA 2P8IA 5E84A 2YKOA 3SQGB 4TNOA 5IQQA 2RDJA 3DHWC 1BIZA 2V2VA 3MN9A 2KFZA 2IJFA 3CCVN 2RQCA 3K0JA 3A5LC 2KO1A 2QRRA 3LDOA 3IBFB 5HI7A 1RT4B 3BYPA 3MAAB 4NL5A 3L2RA 4FLVA 3LA0A