3KLGA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
molecule tags Transferase/dna
source organism Human immunodeficiency virus type 1
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
total genus 105
structure length 554
sequence length 554
chains with identical sequence E
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klgA05
4I9LA 1S6PA 1KLMB 2FVQA 4JUZA 2FLPA 1DLOB 4CE9A 2XY8A 4FM2A 1BHLA 4F4XA 2YHAA 5FRMA 4FJ9A 4EO6A 2IS3A 2YNHA 4RW9B 4WE1A 1GX6A 1HPZB 2VG7A 3KHLA 1RTJA 4NLQA 1JX4A 3OYNA 1QE1A 3HK2A 2HNZB 1T05B 1S1WA 2Q3SA 2OPSA 2IJFA 2G8WA 1T94A 4RNNA 3GIIA 2HWIA 1QS4A 2IDOA 5DQHA 3OJSA 2XCPA 1BQNA 1RT6B 4FM1A 4NRUA 1IKYA 4AHSA 1BIZA 4H4OB 4TSXA 4CCHA 1BQMA 2OPRA 2UVWA 4N56A 4H54A 3BQ2A 3LP0B 4IDKA 4H8KA 3M8SA 3S3OA 4OL8A 3MFIA 4I9QA 3PR4A 3RMDA 3C6TB 4CIGA 1RT7B 1JIHA 3H5YA 3KKRA 4WFZA 3ZSZA 4EO8A 1JXEA 4CEZA 3WNFA 4B3OB 3VA3A 4OGCA 5JXSA 1VRUB 1RTDB 2IM1A 1IKXB 3LP1A 5HP1A 2FVRA 2AJQA 4TQSA 3AA3A 3GV7B 1CZ9A 4ZVFA 4W5QA 2R7YA 5KFVA 5J2QB 2XI3A 4M3WA 4QWDA 3LP0A 4IDKB 3NCIA 3ZCMA 3CO9A 5F9NA 1RA7A 1RYSA 1IKWA 4H4OA 3TVKA 1VSMA 2HMIB 4G1QA 5L9XA 1BCOA 2UVVA 4KSEB 5KI6A 2RF2B 4BDZA 1UA0A 3PO5A 1TV6B 4ZMMA 4J9QA 3HP9A 2QKKA 1JLBA 3ISNC 3IS9B 2ASJA 1S5JA 4ZPBA 5EWGA 2P5OA 3QEVA 2F8TA 2V4RA 4HUEA 1LW2B 5C5JA 2HHXA 4M45A 4IG3A 3OVNA 1SUQA 4B8AB 4K4WA 1S1UA 3DRPA 4Y2CA 4ECXA 2AGQA 4YR0A 1WLJA 4DS4A 5KT3A 3LANA 3VQQA 4E1MA 3QYYA 1HRHA 5K14B 1WSFA 4ZVGA 3BSAA 4CHQA 1GX5A 3O3FA 2RF2A 1J5OA 1NKEA 1ASWA 3GV5B 2AGPA 4ECVA 1UAXA 2JLEA 3RB0A 4BE0A 1RT3A 1NHUA 3RB6A 3KLHA 4CF9A 1NK4A 3N6LA 4BE1A 2WONA 1JL2A 3AVFA 3M9OB 3CFPA 4CJ3A 3QNOA 1RDDA 4RNMA 3KLGA 3FFIB 2HHVA 1JLEB 4B9NA 1RTHB 4AHUA 3JYTB 3ZSXA 1S4FA 4CJLA 2OYQA 3ITHB 2R8IA 2C28A 4EZ9A 5KFLA 1ZBFA 5F8MA 5C25A 4W5NA 4Y2AA 2LSNA 4FJGA 3AVCA 3QZ7A 1NJXA 4OVLA 1LWEB 1TGOA 4CJPA 1L5UA 2W7OA 1RTIA 3C95A 3E01B 3AVLA 1HYSA 2O4IA 1WSIA 3NHGA 4M3RA 4EP4A 4JV0A 4ELVA 4DL6A 2C2EA 3DMJB 1S1WB 1WSHA 4DSIA 4URGA 1FKPB 2W8LA 4CFCA 4CF1A 3QETA 3OS2A 4ELUA 3T5JA 5KG2A 4NLSA 3VQ6A 2EC0A 4DTNA 4FLZA 3QERA 1REVA 4DQQA 4KTQA 3I0RA 4KFBB 1Z25A 3KHRA 4FS2A 1JLAB 4Z4EA 5KGWA 4NLRA 2FBTA 1NOZA 3PVXA 4NYFA 5DG8A 1TVRB 1KSPA 1C2PA 3VQPA 3T1AA 4ECQA 2HMIA 2YNFA 1QUVA 1RDAA 3DOLB 4RW7A 3BGRA 2AWZA 2QXFA 4KI4A 2VA3A 1NJYA 5KFCA 3CIZA 4NZ0A 5KG5A 2E6MA 4QWBA 2WB4A 4K4XA 5KFUA 2VG5A 3LP1B 2QK9A 2WCXA 4K4VA 4IG0A 2HNDA 3UIQA 2IM2A 1JLEA 1N6QB 4DWIA 5HRSA 4FJJA 5KFXA 4AILC 1K6YA 4WYWA 2JEGA 3TAGA 3CJ4A 3ZT0A 4ECYA 4ICLA 4DTSA 2VG5B 1S1TA 1LWCA 4M94A 4FZYA 1X9WA 4CGFA 4CGGA 3C6UA 1EX4A 3KD5E 1S1XA 4IR1A 5F8JA 2XCAA 3OYFA 3OYBA 4DL4A 4H4MA 3I5BA 1TKXB 5DGAA 1I39A 3NGZA 3QEWA 3I5AA 4HVJA 4Q45A 3SQ1A 4M3YA 3MEEB 1NK6A 4ZPAA 4GW6A 4OKKA 3KJVB 3PW2A 4GMJB 3BQ1A 2C2RA 5DQGA 3Q8SB 4EYIB 3H08A 4DFPA 4RW9A 1SUQB 4GC7A 4IG3B 4J9SA 2HB5A 4C8LA 3HKWA 3TAQA 4DTRA 2ASLA 3KLFA 3VQ9A 2XHBA 5DQIA 1S9EB 4K4TA 1UA1A 5KG7A 4FJMA 3TANA 1JLBB 1RBSA 3LAKA 4DQIA 4MK7A 3SI6A 5FDLA 5KFDA 1MMLA 4LSNB 1SH2A 4RNHA 3HSTB 3AVIA 3U3YA 3IG1A 2D41A 4FM0A 4CESA 4J2EA 4AHVA 5EUHA 1U4BA 3RBEA 3N6MA 3V6JA 1L3VA 2FLNA 5JUMA 1RT4B 1W25A 1EKEA 4M3UA 4JV1A 1TL1A 2CKWA 4DU1A 3RWUA 3NFAA 1CXUA 3QESA 2R8JA 3H5UA 4DTXA 3H4DA 4FJXA 1L3SA 4K4ZA 3BQ0A 3A2FA 4J9NA 1RAJA 3TAMA 3GYNA 2RDIA 2B6AB 1XHZA 3QO9A 4IBNA 1HJRA 2BRLA 3HJFA 4KRFA 1RA6A 3O3HA 3QGGA 1IKYB 5KFEA 4KHUA 3I8DA 1S10A 5FROA 5KT7A 4CGHA 3NL0A 2P1JA 1NK8A 4E7IA 4FVMA 1TK0A 1A5WA 1DTTA 3C94A 4J2BA 4RUCA 1BGXT 4ID1A 2E9ZA 4PY5A 4U7CA 4DSEA 4KPYA 3OSNA 1TL3A 4RW8A 1S9EA 1S97A 2E9RX 2AX0A 1U04A 4NYZA 4RG8A 4KHWA 2ZE2A 3PW5A 1S0MA 1HMVA 5HROA 4MIBA 2NUBA 4TLRA 3HVWA 4J9MA 3PX6A 5KFQA 2F8SA 4CJEA 1J9AA 3F9KA 1TAQA 4CF0A 2RKIB 3KK2A 3K59A 1EP4A 5F9LA 4WYLA 3N6NA 4MFBB 1TK5A 4R8UB 5KFWA 3QIDA 4PQUA 1VSLA 4GC6A 3GIMA 1S9GA 4IH6A 5SZTA 5HRPA 4CF2A 1IKWB 3SCXA 4CJKA 5KFJA 5C24A 4CHOA 4KAZA 2JC0A 4CEDA 4O55A 3SNNA 1CZBA 5KFMA 3AO3A 3MEEA 3SYZA 4DSKA 2EX3A 2YNGA 2XC9A 3ZSVA 3OHAA 3CJ5A 3ZT1A 2O5DA 4FLYA 2OPPA 3U3GA 1VSKA 3RB4A 4OJRA 4OLBA 3K2PA 4I2QB 2KW4A 4ZVEA 1VSDA 1TKZB 2FLLA 3OLAA 1LW0A 4NLVA 2IC3A 4EBDA 1RT2A 2W9CA 2ASDA 1REVB 3RRGA 3PHEA 3SUOA 4CECA 2R2RA 3TABA 4EP5A 3B6PA 4KV8B 4IOBA 1WAJA 1R0AA 4F8RA 2E9TA 1X1PA 1JLQB 3CVKA 2R2TA 3QNNA 3TAEA 5I42B 4KBIA 3I0RB 4FJ5A 4FJ8A 1UOCA 4M3TA 4PUOA 4W5RA 2YNHB 1XC9A 2IAJA 2AQ4A 2FVCA 2J6UA 1RNHA 2KFZA 3KMQA 5D3GA 1WAFA 4JV2A 4NYNA 3PV8A 1S6QB 5KFYA 2IC3B 1JLAA 4FJIA 1FXXA 2BGGA 2R2SA 4NLWA 3HHKA 5CZ1A 2HHUA 4CEAA 2XI2A 4I2QA 3ICLA 3T5HA 4FW2A 4KKOA 1ZBLA 4JRQA 4OKJA 3M9MB 3SV4A 4DMNA 4B8CA 4KO0B 3HL8A 3BREA 1ITGA 4J9PA 2AGOA 1SL0A 2BQRA 4XIUA 3GQCA 3L2WA 4DSFA 3O4QA 4NLXA 1LAVA 1FK9B 4N5SA 3KIOA 4J9KA 3PZPA 3AVHA 4PA1A 3DOKA 2HVIA 3FFIA 4GVMA 4CK3A 3NBPB 1TKTA 3L3VA 1YTUA 3PX4A 4FW1A 1ZBUA 4NLUA 3T19A 3Q8PB 1C0TA 3KLIA 4O3QA 3PJWA 3NF8A 1WN7A 4LH5A 3QIOA 3AO1A 2OZMA 3PR5B 1KHVA 3K5OA 4E7HA 3MEGB 3KK1B 1IM4A 4B9UA 3UQSA 3PW7A 1BISA 2HVHA 4URQU 1HYVA 3KLVA 4PUOB 4CFBA 4ELTA 5EU7A 3VQ5A 1RT3B 1SV5A 1TV6A 2HHWA 3V9SA 1CLQA 4F2SA 4O3SA 3DYAB 4FCYA 3DDKA 4KHMA 1W9HA 4CJSA 4KTZA 4F3OA 3V6KA 3NH2A 4CJVA 3AO4A 1RT5A 2B5JA 4QWEA 5KFGA 4RZRA 2FBVA 4CEQA 2IM0A 2Z1HA 3LZIA 4FBUA 2B6AA 4CIFA 3E51A 3LWLA 3EPGA 4O5BA 3V6DB 2F96A 5D3GB 2YHBA 4KREA 4FLWA 3QLHA 3L2QA 4CF8A 1A5VA 1IG9A 1JKHB 4DL5A 4K8XA 1UWBB 2F8EX 1TK8A 3AO5A 1TL1B 4O44B 5J2PA 1YVFA 1RT4A 5C42B 4MK8A 3BSOA 4ZVHA 4ZP9A 5KFOA 1RBTA 2WK4A 2V4QA 4Y34A 3NF7A 3BDPA 1S9GB 1T03A 1B9DA 3KK3B 3RR8A 4CHYA 3FRZA 4LSNA 2C22A 2IJNA 4B9SA 3Q8QB 3SUNA 3PY8A 4E1NA 1LAWA 4TYAA 4EBCA 2R8HA 2OPRB 4OPKA 2E6LA 3K57A 5HROB 4K4UA 2BANA 1J54A 1BQNB 1RT6A 4TQRA 4O4GB 1VSEA 2HW3A 3OLBA 3H5XA 5FRNA 1WNSA 1C1CB 2PYJA 2W9BB 4E3SA 1KVAA 4ZTJA 3MR6A 2VG6B 3D5MA 4FK0A 4IFYB 1U47A 5HBMB 3HXMA 4CK1A 1X9SA 4KHQA 1XR6A 2BANB 3MR3A 3V9ZA 1ZBIA 5KG6A 1C1BA 4TY8B 3CFRA 2B43A 2HNYA 1NNDA 4UQGA 3OYAA 1I6JA 4DFJA 1HMVB 1YT3A 1JLCB 4DQSA 3KK3A 3DLRA 4EEYA 1JL1A 4WXWA 4CJRA 4CHPA 3S3MA 4N76A 1D5AA 2JEJA 3DRSB 1VSHA 5KFFA 3BR9A 5F8HA 1DTTB 4M3XA 3OL9A 1TAUA 4QOZB 5F8NA 2X74A 3HT3A 3QZ8A 1JLGB 1SL2A 4Z4CA 4YFUA 4B9MA 1TKXA 3VA0A 3CFOA 3AA2A 1S1VB 4ED6A 4CGDA 4XO0A 4DLEA 2KQ2A 3TI0A 4C8NA 5FDLB 3V6DA 5KFHA 3DLEA 2XY6A 4ICLB 3CJ3A 2I5JB 3G0ZA 5C42A 1LV5A 1TP7A 1NOYA 1ZYQA 1HNIA 4I2PA 5CYMA 4K4YA 3HPHA 3HP6A 3VQAA 5F8IA 2GC8A 1JKHA 4NCAA 3LPUA 3K5NA 4NCGB 3PW0A 4ECSA 3AVAA 4DTUA 4M3ZA 4CEOA 2JEIA 4FJNA 3SQ2A 2D3UA 3FQKA 2YKMB 3NAIA 3NGDA 4NLDA 3MXMA 3O4NA 1VK0A 2I1RA 5DLGA 3IG1B 4RW7B 4J9LA 3ULDA 1KTQA 4I7FA 3RMAA 1QAIA 4W5OA 5F8GA 3DYAA 3DLGB 2AX1A 3V9UA 1S0OA 1SV5B 4F4KA 2FBYA 5J2MB 1LWCB 3V1RA 2QV6A 4Q8EA 4DFMA 2D0BA 3G6XA 3KTQA 2YKNB 3G6YA 3OYEA 3G86A 3H40A 2DFHA 4C8MA 3HPGA 3OYMA 4CJUA 1ZBHA 3IAYA 3IRXB 4DTMA 4DL3A 1RT1A 3D45A 4B9VA 4EYHB 3CM5A 3CDWA 1N5YA 3EPIA 4M41A 3SQ0A 3KJVA 2R8KA 1A5XA 3V9XA 1Z4UA 3JSMA 2B4JA 4Q43A 4QW9A 1C0TB 3KLIB 1KCFA 4NLYA 3SI8A 4MKBA 1DTQB 1VSFA 4HUFA 3HPOA 4WFXA 2JGUA 4QWAA 3VQ4A 3BGRB 4DG1A 2IA6A 4ECRA 4FJLA 5DLFA 3ZT3A 2KTQA 5KG1A 4CFDA 1TKDA 3CDUA 1NJZA 2ILYA 3VQ8A 3AA4A 3HVTA 4YQWA 1QSLA 2R8GA 3OHBA 1N5YB 2FVPA 4FJKA 3DRPB 2AU0A 1BL3A 2V0NA 3OL6A 5E41A 2BE2B 4DF4A 5KFPA 3FSIA 4IG0B 4FZZA 3RB3A 3CM6A 4AH9A 2WTFA 1CXQA 3H5SA 3HM9A 3I0SB 4IQXA 1YVUA 3KLEA 1W0HA 1C1BB 4TY8A 3L2VA 1S6QA 3DMJA 1WSJA 4ED7A 2BDPA 3VQDA 3LP2A 3NAEA 2FJVA 3DLGA 1Z26A 2P5GA 1S9FA 1Q9XA 1HQUB 2Y1JA 4DS5A 4NLGA 4FZXC 4KB0A 2UUWA 1TVRA 3MECA 2XGQA 2RPIA 2YKMA 4AHCA 4KB7A 3QGIA 3AV9A 5I42A 2BQ3A 4CEFA 1NK9A 3RTVA 3IN5A 4NCGA 5HP1B 4E7LA 4YNQA 4Q0BA 5J1EB 1RILA 4DL2A 5HLFA 1HARA 2D0CA 4F2RA 1LW2A 1IO2A 2W9AA 4IKFA 3MXJA 2ZKUA 3M8RA 3LP3A 4FYDA 5KFIA 1RT2B 3IS9A 3V81A 1YTAA 3KLHB 3DLEB 1RBRA 4K4SA 3AVNA 4ID5B 3MAQA 1T03B 1SH0A 3AVMA 1IKVB 4WZMA 1D1UA 4URSA 4EBEA 4F50A 4FS1A 4Q5VA 1QHTA 1JLGA 4F4ZA 4E0DA 4HTUA 5CZ2A 3TWHA 3G10A 2OPQA 3HYFA 4IR9A 2BR0A 4PWDA 3LDSA 1T05A 4B08A 3IGNA 3D28A 4RU9A 3EZUA 1NK7A 1RTJB 1RTHA 1XR7A 1S1UB 3BSNA 1NJWA 5HLFB 4IH7A 1XHXA 4R8UA 2IGIA 4J2AA 1D9FA 5KGXA 2G8HA 1NKCA 4MKAA 4JS5A 5SWMA 3SV3A 1LWFB 1C0UB 3TAPA 3O3GA 1NK0A 4KHRA 2ATQA 3K5MA 4I7FB 3P1GA 1BIUA 4BWMA 1NKBA 2WHOA 4MFBA 4F3TA 1Y97A 4ZTFA 3UPFA 1NK5A 2DY4A 3NMAA 3LP2B 4CGJA 3DLKA 1TL3B 5DG7A 4O3OA 5EWFA 2IMWP 1RDBA 3ZT4A 2VG7B 1IKXA 4ED0A 3V4IA 4BE2A 4LY7A 3IGVA 1U09A 4NRTA 2HAIA 3DLBA 5L1JA 3MEGA 3KK1A 3SJJA 4CIEA 2OZSA 4LQ9A 1K1QA 4WZQA 5HRRA 4DQPA 1S6PB 2GIRA 3OYDA 4ECWA 4PWDB 1KFSA 1VRTA 3LWMA 3WNGA 3VQBA 3NGIA 2PYLA 5T14A 3CDEA 1HQEB 2DFEA 4LSLB 2VWKA 3S9HA 5KT4A 1TKTB 1JXBA 3KOAA 2Y1IA 3L2UA 3NH1A 4RNOA 1J53A 2UVRA 4CJQA 3KD1E 3HO1A 3SPYA 4KO0A 3T5KA 1WNEA 1T7PA 3OYGA 4CERA 4IRKA 2Z1IA 3MXIA 1GOAA 2HHTA 2XRIA 3NGYA 4DU4A 2VA2A 2YV0X 3KLFB 4R5PA 3FDSA 5J1EA 2G8KA 3QEXA 2RN2A 2YKNA 1JLCA 5KFTA 4FJHA 4NLTA 2X6NA 1N48A 1WSGA 2G8FA 3G6VA 1Q9YA 2D3ZA 4FLTA 4N47A 2HNYB 1ZTWA 3WNEA 1SKRA 1HNVA 3ZSOA 4CJ5A 5J2NB 4RW6A 2G8VA 1X9MA 3K58A 4IFYA 2IAJB 1HYZA 2QKBA 2ZD1A 4CEEA 5HRNA 4NLPA 3AO2A 1S0NA 2IM3A 1C1CA 4ZHRA 1OS5A 3NF6A 3HVAA 1N56A 3ISND 3KHHA 4CEBA 2BE2A 4O4GA 3LZJA 3EYZA 4FLVA 4YP3A 3QGHA 3Q8RB 4HHTA 1HNIB 5KT5A 3MEDA 4M42A 1S1XB 4QAGA 2FBXA 2R2UA 1N4LA 1B9FA 1GOBA 3HVTB 3UDLA 4E7KA 4MQ3A 2ALZA 4RUAA 4O0JA 4DEZA 3VQSA 3NKYA 2OPQB 3PJXA 4ZPCA 4Q44A 5KFRA 1TKZA 1B92A 4HUGA 1U49A 3V9WA 4BACA 3NBPA 1IKVA 4HYKA 2QE5A 1QSYA 3OL8A 4B9TA 3QEPA 2ZQBA 4N41A 4YMEA 2UVUA 1S1TB 5KFZA 3ZT2A 4OKEA 3MEDB 4O44A 4KKOB 3OYCA 2RDJA 1UWBA 5L1LA 2UUTA 4ZP6A 2YNFB 3L3UA 4ECUA 2XY7A 4RNFA 3CQ8A 4ECTA 4BWJA 2RKIA 3KK2B 1RBVA 4KI6A 5JS1A 2BRKA 2DPIA 4Z4FA 4E89A 2HHSA 3OYHA 3H98A 1VSJA 3AVKA 2ZD1B 3M8PB 1ASUA 5HBMA 3E01A 2ZE2B 1T3NA 1BI4B 2FJWA 1K1SA 4KHSA 4FBTA 5DK5A 3P83D 2D0AA 4RW6B 2WOMB 5J2NA 1KVCA 4W5TA 3OS1A 3OYJA 2W9BA 3VQEA 1QSSA 1RDCA 3TQ1A 2GUIA 4KFBA 4XPCA 3LPTA 3AA5X 2DPJA 3V1QA 4J2DA 2YNIA 4O3RA 1RTIB 2C2DA 4Y1CA 3TAFA 4I2PB 5CYMB 2W8KA 2X6SA 1FKPA 3TARA 2W9CB 1HNVB 4JLHA 1FKOA 4K8ZA 2WONB 2BQUA 5C25B 4QWCA 4BDPA 5CY4A 5KG4A 4X2BA 1LW0B 4KHNA 1HYSB 1WSEA 4YR3A 2KZMA 3ZSQA 3JYTA 1S1VA 4FK4A 4DG1B 4O3PA 4DL7A 3NF9A 1KFDA 3PX0A 3RMCA 3OY9A 4LSLA 3DOKB 1GOCA 3KHGA 3K5LA 3SUPA 1FK9A 3VN5A 1Q8IA 2D5RA 5K14A 2J6TA 4FLXA 4ED1A 3ITHA 4U6PA 5EDWA 5KFNA 4TY9A 3DRSA 3GILA 3M8QA 5C24B 4IFVA 1RT1B 4CFAA 5I3UA 3IRXA 3KKSA 1S48A 3ZSYA 3CWJA 2PY5A 4QPXA 1KVBA 4Q8FA 3NDKA 3DM2B 4TYBA 1LWFA 3CJ2A 4LH4A 4Z4IA 3DLKB 2W42A 4OLAA 3RAXA 4DU3A 4AHRA 4QW8A 4BDYA 1QTMA 2KFNA 4E19A 4DTJA 4G3IA 3OL7A 5KFSA 3KNAA 4NLOA 2JC1A 1C0UA 4RW8B 3M8QB 2WRMA 5KFBA 3AVGA 4FK2A 2DTUA 2Z1GA 4F4WA 3EY1A 3OYKA 2GBZA 4CK2A 4ZP8A 2A1SA 3GIKA 4ECZA 4DSJA 4CJ4A 3SPZA 4KV8A 4H4MB 4B3OA 1D0EA 2PZSA 3GIJA 1U48A 3NH0A 4DQRA 1KRPA 2FJXA 3QIPA 1RT7A 3CJ0A 4QCLA 4WXOA 4CJWA 3FQLA 4R0EA 2IOCA 3QINA 3H4BA 1EETA 3MTKA 3TR8A 3ZSWA 4O0IA 5KG3A 1JXLA 1TQLA 4G1QB 1XWLA 1D8YA 3OYIA 1EXQA 4F4YA 4K50A 3DRRA 3BJYA 4ID5A 2HNDB 4MIAA 3RMBA 4KHYA 2D7SA 4AHTA 3V1OA 4IH5A 4MH8A 3V81B 4IKAA 2DFFA 1ZTTA 1BCMA 3F73A 1SKSA 3DRRB 3MECB 4NCBA 2ATLA 2XGPA 4FLUA 3MR5A 1T8EA 3ASMA 1BI4A 5L1IA 4Q0BB 4PQUB 4KE5A 1KLMA 1EETB 2IBKA 3LAMA 1C1AA 3OYLA 3DLHA 5KT6A 3I0SA 1RT5B 1BQMB 2B5JB 1QE1B 4CHZA 3QIPB 4TXSA 3B6OA 2XO7A 3DM2A 3QEIA 1HPZA 5DMRA 3CG7A 1QQCA 2GIQA 4WE1B 4O3NA 5KT2A 1ZETA 3H59A 2YNIB 3PUFA 1D9DA 5I3UB 4DTPA 4IFVB 1NHVA 4OPJA 2EHGA 2XWYA 1DLOA 3I5CA 4Z4GA 2HNZA 4MK9A 4ED8A 4KB1A 1JLQA 2VWJA 3V6HA 2WOMA 1SL1A 3DI6A 3BSCA 3PW4A 1HQUA 1SH3A 3AVJA 1LWEA 3WNHA 4DLGA 1O1WA 3THVA 3L2RA 1JLFB 3QO9B 1RCHA 3KLEB 4ZPDA 4DTOA 1FKOB 4LQ3A 3T3FA 3EZ5A 4CJTA 3AVBA 2A1RA 2OPPB 3T5LA 1N6QA 1MU2B 3MFHA 4C8OA 4TN2A 2YNGB 3OJUA 2HWHA 4ZP7A 5DGBA 4KAIA 2FC0A 5JS2A 4DFKA 4EZ6A 1QAJA 4JRPA 3U6FA 1VSIA 2ETJA 5CYQB 4C8KA 3VQCA 2G8UA 4FJ7A 5J2PB 2J6SA 4KTWA 3VQ7A 5KFAA 3HVRA 4XPEA 1KLNA 4OGEA 4IRDA 1ASVA 2E4LA 3GV8B 4IRCA 3L8BA 1DTQA 1J5OB 2G8IA 3M8PA 1G15A 4ED2A 3QLHB 4HCBA 3JSMB 3MF5A 4FXDA 2V9WA 4CGIA 4RW4A 3NAHA 1L3UA 1RYRA 1F21A 1C6VA 4ED3A 3CYMA 3S3NA 3P5JA 2GV9A 2JEFA 5DG9A 4Y3CA 3SUQA 2ILZA 1XR5A 4JS4A 4M95A 2ITGA 5CYQA 5J2MA 1L3TA 4Z4HA 3UR0A 5KTQA 2FVSA 4HCCA 1CSJA 1R0AB 5KFKA 4HKQA 2Z1JA 4J9OA 5F8LA 3ZSRA 1RBUA 3RRHA 4O4RA 2O4GA 1SKWA 1U45A 3OSPA 5KRSA 4RW4B 4LD0A 4E7JA 2I5JA 3C6UB 5J2QA 2OA8A 2W7PA 4Z0UA 1RDRA 4DF8A 3TAMB 3RAQA 1VRTB 1I3AA 3PO4A 3ALYA 1C0MA 1VRUA 1RTDA 3SFGA 2OH2A 3H2LA 3OS0A 5T7BA 4R5PB 2P51A 3SQ4A 1MU2A 5KRTA 2HHQA 3KLGB 3SZ2A 3DI6B 5EWEA 3KMSA 3V4IB 3C6TA 3RBDA 4CJFA 4Y1DA 4B9LA 4CHNA 3M9NB 4WFYA 4ZHRB 5KG0A 1JLFA 4YR2A 3NE6A 2KZZA 2X78A 3SFUA 3RR7A 4DSLA 3DOLA 3D0PA 4L8RB 3LALA 1EP4B 2VG6A 1KHWA 1HQEA 2XY5A 1XI1A 4J9RA 1IH7A 2OPSB 2CJQA 1S49A 5L1KA 3MR2A
chains in the Genus database with same CATH superfamily
4I9LA 1DLOB 2EFPA 1BWEA 4FM2A 2ZHAA 3DLJA 2DKOB 2HFSA 3TTDA 3TA2A 3SAHA 4EO6A 4PRFA 3RRKA 1HNZK 3G82B 2A5XA 2O8CB 2LMIA 3KHLA 1JX4A 1H2VZ 2XMTA 3BKTA 4C0OC 4A59A 5JVHL 1S1WA 3TUZC 2OPSA 2IJFA 2G8WA 3IM8A 4RNNA 3MCPA 2G1DA 2XCPA 1BQNA 2UUBJ 3LL3A 4NRUA 2ZWHA 2KVIA 4USUA 1NLVA 4M5GA 1HIYA 4N56A 3TTCA 3BQ2A 1VQKS 4PXBA 2UXBK 4WF9Q 2IDLA 2P9SB 5AXNA 4I9QA 4ZCMA 3RMDA 2PO4A 1VQSA 4ES1A 4WFZA 3ZSZA 3WNFA 4B3OB 1H74A 4OGCA 3BGUA 5JXSA 1RTDB 1YJ7A 3LP1A 2AJQA 3CCLS 2KHOA 1WHWA 2VPXB 2CJBA 2R7YA 2IVMA 4FF4A 2XI3A 3MDQA 4M3WA 4IDKB 3NCIA 3ZCMA 3ZETA 1RA7A 1IKWA 3DDIA 4ENOA 3W2WB 4H4OA 3VEWA 2HMIB 4G1QA 1WEXA 2AW0A 5LT5A 4B9QA 5HMYA 1KQSR 2LECA 3I8BA 4M1KA 2RF2B 2L41A 3G87A 3PO5A 4OHXA 3ISNC 3I9V9 2ASJA 3ZZOA 4A5BA 4BRQA 2XMAA 2QL5B 3SAGA 4ZJOA 3UI3A 1IJJA 3AXMA 4PEOA 1FERA 2V4RA 4HUEA 1LW2B 5C5JA 2CJXB 4IG3A 2V2ZA 4P10A 4K4WA 1Y10A 5G0RA 4Y2CA 3OFFA 5KT3A 2HFVA 5EX3A 1ZH5A 3LANA 4E1MA 2E66A 2B4PA 3HLUA 2O1PA 3BSAA 1GX5A 1NKEA 4WQ5A 1VQ4N 3PACA 3D2EB 2AGPA 5BREA 4ISEA 2O3DA 4ECVA 3OTBA 1UAXA 1YHQS 2OKQA 3QWPA 4NXNF 1VRQC 3R6GB 3CQYA 3RB6A 2MLYA 2GGPB 4OYPA 3N6LA 2ZM6J 3CF5L 2NR0A 2VZ9A 3BN4A 3MUMP 5DM7Q 3KLGA 3FFIB 2HHVA 1JLEB 1MA9B 2V68A 3VGUA 1Y0HA 1Y5NB 1S4FA 3C2PA 3U9ZA 3ITHB 2ZC4A 2R8IA 2C28A 4FYXB 2HFOA 7FDRA 3L7PA 3AVCA 3M1FA 2QTWA 3WIVA 3D0IE 2GVDB 3M8ZA 1L5UA 2J7KA 2DCUB 2MKHA 2VL1A 1X5OA 1RE1B 3AVLA 3D2FA 2O4IA 1H3DA 3NHGA 4M3RA 4EP4A 2HKEA 1WELA 4JV0A 3DMJB 3MM5A 1S1WB 2MSTA 4URGA 2W8LA 2DR9A 1WDTA 3FZKA 2BZ2A 3QETA 2V63A 3T5JA 1YBTA 1FVQA 2EC0A 5BR8F 3FZMA 3QERA 2MJNA 4EGLA 4DQQA 3KHRA 2FJAB 1JLAB 4HH0A 2B7CB 4Z4EA 4NMLA 4NLRA 2OMOA 5BR8J 3HX9A 3CERA 5DG8A 2P9EA 1XNRK 1REGX 4H4KC 2HZAA 3SIPB 3VQPA 4UT4A 4B02A 3TA0A 1RDAA 1IR2A 1S76D 4DCOB 1NJYA 3EL2A 1LOTB 3CIZA 4WBFA 3CDBA 3MMAA 4K2JA 3CJ9A 1OWXA 2D0PA 2VG5A 1K8AT 3DXKA 3T69A 2WCXA 3R97A 3U1LA 1YJNN 1I94J 1JLEA 4DCPB 2DRAA 2OTJS 4QS8A 5HRSA 4KHPK 4WYWA 3TAGA 1X3MA 3ZT0A 3Q23A 4ECYA 4DTSA 2VG5B 3DXKB 3MZIA 3MOZA 2G4BA 1LWCA 4M94A 4P73A 1P1LA 1PJ7A 4LFAJ 4CGFA 4CGGA 1U02A 1EX4A 3H2UB 2LQ8A 5F8JA 3OYBA 2HLUA 1TKXB 5DGAA 3NGZA 3QEWA 4KGMA 2D0OA 2V69A 3SQ1A 1NK6A 4LR9A 4ZPAA 4CT9A 5HMXA 4ZCLA 4DUZJ 3PW2A 2L9WA 5DQGA 2HMPA 2V6AA 2W41A 1HKBA 1D8ZA 5GAHI 5C15A 4A8WA 6FD1A 4OI0A 4GC7A 4IG3B 1DEJA 2HB5A 3TAQA 1OH7A 4UY85 1NSPA 5IC6B 1Q16B 3BV8A 1UA1A 1Q81O 5F0XA 2DITA 4Y0FA 5HQMA 1QTNB 1UJ4A 2C1EB 1N54B 4MK7A 2VQEJ 1GTHA 5FDLA 4LIWA 5KFDA 2DNOA 2ZZTA 4LSNB 1UW9A 2OGUA 4RNHA 4B3MF 2ROPA 1RAGB 4ZVRB 5FLXY 4ED5A 2D41A 5M2PA 4YOXA 1FD8A 1U4BA 3JQMA 4H4KA 4KH6A 2H5IB 5L39A 1R0CB 1V9OA 1E6YA 1UW4A 2CKWA 3T6JA 5A76A 3CMES 1N34F 1CXUA 3QESA 3X1LB 2HBZB 1T9YA 3V4MA 4FJXA 1L3SA 1RAJA 1XBWA 3TAMA 5A2QY 1FFGB 2B6AB 2MB0B 4BC3A 3QO9A 4IBNA 4OX9K 1HJRA 3HJFA 4XDCA 2V7ZA 4DUTA 1IKYB 5AJ3J 2E2OA 4AUKA 2DH9A 3I8DA 4FWPA 4CD1A 3AJ2A 2W7AA 4LFBK 3BY5A 1DTTA 4RUCA 4ID1A 5E3RA 4ID8A 3P8BB 1HWLA 1XNQK 1XMQK 1XMOJ 2O8CA 1S9EA 1S97A 1U04A 4CH7A 2QLWA 4KHWA 4DR7F 4K0KJ 3VWSA 1Q95G 3FJ2A 1JNZB 5HROA 3GONA 2F3JA 4UF4A 2QLFB 4YOYA 5BJRA 4OX7A 4TVAB 4X64K 5A8WA 1T3VA 3QIDA 3QAEA 1VSLA 1VJQA 2LKZA 3VESA 4CJKA 5KFJA 4I4BA 4KAZA 2HBLA 2JC0A 2R42A 1PYSB 1SAZA 5KFMA 4ZS6A 3K9KA 1F5AA 5DM6L 4H0TB 3ATUA 3TZZA 1VC6A 4FLYA 4ZCIA 2DNMA 3OXFA 4ZVEA 1HHQA 3VGTA 2FGCA 1YJTA 2G2YA 3G6ES 3I33A 1GLDG 3P96A 4NLVA 1A0OB 2MPUA 2N3LA 2W9CA 3ZC4A 1YUWA 4KGVB 4K25A 4DDFA 2DJWA 3PHEA 3HHLC 4OLPA 1WOOA 3TABA 3RZAA 1I3OB 3MCSA 4J8FA 1JLQB 4C98A 3CVKA 4DZDA 4KH1B 3TSPA 3O6QA 4KBIA 2KRBA 3PRVA 2LQJA 1WTBA 1UOCA 2KRRA 2C2KB 2ADCA 3HSJA 1IJFB 1RI7A 5HL7L 3OBYA 4UOGA 2HYIB 5ETMA 3ZO7A 3FRYA 1CS4B 2B9YA 1BA1A 3JAMU 1X9JA 2BGGA 4NLWA 1N36J 4FPIA 2XI2A 3UD4P 2YQ3A 4L3NA 2DXEA 1NB2A 4KKOA 2IHR1 1B0VA 4NI2A 3G71N 2QA2A 1Q86T 4B8CA 5CH7B 3BREA 2AGOA 3N0VA 1AXQA 2HQFA 4DSFA 3L2WA 4ES2A 1GLAG 4N5SA 4XH1A 3G6EN 4J9KA 3PZPA 3AVHA 1Q1KA 2E44A 3NBPB 1PC4A 1M5HA 3C16B 4PPDA 2G2ZA 3CD6S 3HSDA 4JK9A 4FW1A 3C15B 3KG4A 4C1NI 1EKSA 3O5BA 2AMCB 2EEYA 4KGZB 3LW5C 1H73A 3P49B 5EX0A 2CGKA 1LK7A 2W2QP 3FR0A 5ETVA 2YY3A 2EFOA 3PW7A 1BISA 3D2EA 1LNQA 5HI7A 3T1YJ 2J0QD 6AT1B 1WC3A 5T41A 4C4WA 4CFBA 2E1CA 3M1VA 2DXDA 4WQ4C 2QA1A 4YS2A 1NU0A 1TTHB 2HHWA 3V9SA 4X65K 1CJUB 4DX6A 5LMNF 5EY4A 4KHMA 2QWLA 4ILLA 2BOPA 1MMNA 4KTZA 1FWLA 3K8WA 3V6KA 4NXNJ 4CJVA 4DHYA 2MGZA 3AO4A 1T9UA 3KYLA 4JKGA 5KFGA 1T9WA 1F9EB 2IM0A 3VF6A 2B6AA 3D66A 3E51A 3EPGA 4O5BA 5B0EA 4ZN3A 4KREA 3ZTRA 3JS6A 4CF8A 1GFWB 4YOWA 2H3GX 1RCXB 3R5AA 4CO5A 2F8EX 1O13A 3AO5A 4DR6J 4FF3A 4FYYB 2YWGA 4P2MA 4HR2A 4RL1A 1NDKA 4CLPA 3HFZB 2P9SA 4PKDB 4DV3J 1M5KC 3G8QA 2WK4A 2JSXA 4H5TA 3SCKE 1M5SA 1F2GA 2V4QA 5GAHP 2M52A 1Y3JA 3NF7A 3U4LA 4LFAF 2NYHA 2F9DA 1S9GB 4BC2A 1T03A 3RR8A 1R6VA 3M2RB 3FRZA 4LSNA 1J27A 3Q8QB 4DHVA 3SUNA 4IEEA 4C11B 3W9HA 3GCXP 1U7LA 4IOXA 3UDCA 2R8HA 2OPRB 3THTA 3QJPA 2CADA 3K57A 2MQPA 3US5A 2BANA 2GMLA 3MMJA 1J54A 4UZBA 3RW7A 5IS2A 1BQNB 4U9RA 5KPZA 5DDPC 1WSRA 2E2PA 3EVWA 2CIMA 1Y00A 2HW3A 3TNVA 5IOLA 1KS2A 3CCMN 5BR9A 3TO8A 4DR2J 1B7YB 1FRMA 1RDUA 2W9BB 4CTAA 2EFVA 4FN5A 3D5MA 4IYQA 1U47A 4A8FA 2H1YA 4KHQA 3CULA 4OI1A 2LYVA 3JB9k 1SS6A 3ENOA 3CFRA 3NCQA 4FKYA 2E7VA 1I6JA 4YY3J 2N7CA 4DQSA 3CCJS 3KK3A 4X65F 2OCEA 2QGFB 3D6HB 1RWWB 4OYIA 1YRXA 4DV0K 2V50A 2FZKB 4CO2A 3I31A 4LT6A 3HTVA 1SJQA 5A8RB 4B1YB 4B9MA 3LPEA 4MLHA 2UU9K 3VA0A 3FFKB 4RPFA 1P8GA 1S1VB 4XO0A 1ZPWX 3R9LA 1M1KO 2MJUA 1E4GT 1IUJA 3V6DA 3G25A 1DQ9A 2CNKB 1RGVA 4OJ1A 1D4XA 3OHRA 4JI8F 3MURP 3CJ3A 5MLCQ 2XMVA 4K4YA 3J81U 3HPHA 1WC0A 2BM1A 5F8IA 4CYUB 1WWHA 4ECSA 2E5LF 4DTUA 2KHDA 1JNRB 3AB2B 4M7XA 4FJNA 5CHIA 2D3UA 1YVNA 3M6XA 1U6ZA 4NLDA 3MXMA 1VK0A 4RW7B 1B0PA 3EMTA 1QAIA 4IUFA 1EIYB 4W5OA 2ZJPL 4UUWA 5CCLA 4K7QA 4F0HA 4WP8A 3QMLA 2DD8S 4YDUC 3W0LA 3V1RA 1FWKA 3AGRA 3B4DA 2CG4A 3O2IA 3G6YA 2EC2A 2QJ3A 1NPRA 1KVKA 3G86A 3EKSA 2HQDA 4C8MA 4H5NA 1UZDA 4CJUA 5EOYA 3IAYA 3AODA 3EVMA 3IRXB 4DTMA 4OYMA 3D45A 4B9VA 4EYHB 1KNZA 4CNYA 3CDWA 1N5YA 2QSFA 2FB0A 4BC4A 2OUGA 2R8KA 1A5XA 2XLJA 4GKKK 1RAFB 2B4JA 4Q43A 4QW9A 4FWQA 1WI6A 4DV6F 1DTQB 5F0UA 3UVJB 2I9SA 4WFXA 2DPNA 3FEXB 4QWAA 3H2VE 2IA6A 4N77A 4H0OA 3AY0A 4JI6J 1NWKA 4M5HA 1Q5YA 1MN7A 2B7BB 4RBVA 2BJ8A 1VQ9S 4CFDA 2V8GA 2A2CA 5THWA 1K8AO 2DNGA 3HVTA 3QFWA 1QSLA 3OHBA 2VPWB 2IJRA 4CBUA 3FZBA 1PSDA 2OIHA 1Y7PA 4U7BA 4DF4A 3FSIA 1BY9A 3RB3A 3CM6A 4OLOA 2J0SD 1YVUA 3KLEA 2CRLA 1KVIA 1C1BB 2FHMA 5D0RA 3OTOJ 1WSJA 2BDPA 3LP2A 2QWMA 2B3TB 4OQJA 4GKJJ 4FWNA 1LOUA 4DUZF 1HQUB 1Q9XA 3ZTSA 3PYDA 1QVGM 1H2TZ 5GVQA 1TVRA 3MECA 1LXJA 4G6VB 1VHIA 2C42A 3QGIA 3AV9A 2DGVA 3PRBA 2Q6CA 2E20A 4KJIA 3RTVA 2R7UA 3IN5A 2ZGYA 4E7LA 5EX5A 3WHIA 2GO9A 3BP8A 4BC7A 3MXJA 3M8RA 2CQPA 2DH8A 3V81A 3M6GA 4CBXA 4WP3A 2NCKL 5IT0A 1RBRA 4K4SA 3F56A 2OP5A 2W2PP 4ID5B 1HBOB 1R6YA 3GYGA 1T03B 2F7VA 2I7NA 4ITSA 1SH0A 4A57A 4A61A 4F50A 3DWLA 2ALYB 4DQ8A 3NLCA 2VPZB 2V5HG 3Q83A 1MROA 2K1RA 1F9FA 4B08A 3IGNA 2E2NA 4RU9A 3EZUA 1NK7A 1XR7A 4I68A 3PYGA 2AP1A 1FNOA 3O9QA 4AF1A 1OQ3A 4MDAA 1U1KA 2G8HA 4BRFA 2SXLA 5SWMA 1VIOA 5CA5A 4DPYA 2PDAA 3H6EA 2ATQA 1NDLA 4BWMA 1XN9A 3CCJN 1RUSA 3KNGA 4A62A 2MZTA 3ZEUA 4E1JA 4N8NA 3ZT4A 4YN3B 1OY8A 1BUPA 1UVLA 1IKXA 3V4IA 3QFUA 5B0GA 3LDLA 4NRTA 4C3KA 1K1QA 3PDNA 4WZQA 5HRRA 1S6PB 3OYDA 4ECWA 2H51B 3DNCA 1VRTA 1K0VA 3ZZRA 3NGIA 2PYLA 4J7CA 1CJKA 1HQEB 2LP4A 4DR5K 5GADI 3PFOA 3VAMA 4UZCA 4EAHD 3D6TB 2EXUA 4CJQA 5JMVA 1N33F 3T5KA 1UP1A 2U1AA 2BKNA 4CERA 1GOAA 4WJBA 3NGYA 1VMBA 1BE4A 1NGGA 2D74B 5A2QO 3TYTA 5J1EA 5AQPA 1HWKA 3IA0A 2G8KA 5B0AA 4M5NA 1JLCA 4FJHA 4NLTA 2X6NA 3TUIC 1WSGA 1R0BG 1BHNA 1HKAA 1HNVA 1VISA 1XTZA 5IQQA 1YX2A 2G8VA 4JKBA 2VC1A 2GWJA 4X4VA 3C19A 4JI1J 1IN0A 2OELA 4CRJA 5GMEA 2HPUA 3AO2A 5ADXA 1S0NA 2AZ1A 1C1CA 1B64A 3GPAA 1SC3B 3HVAA 1N56A 3VZIA 3IXQA 3KHHA 1F5CA 4J90A 3G82A 5BPNA 2IY5B 4E2FB 3MCMA 4O4GA 3EYZA 2BW2A 4UW2A 4UQTA 3AOCA 4DV4K 1YXQA 1C0FA 4ZVTB 3MEDA 4XH4A 3LM2A 3WXIA 2W4DA 2FBXA 2APOA 1B9FA 5F41A 4WPAA 4DEZA 2W4PA 4ZPCA 1B92A 4FPAA 2R7QA 4JI3K 2M5YA 3MHYA 1U49A 3NBPA 1IKVA 4FWRA 9RUBA 5KOXA 1QSYA 4ZKAA 3OL8A 3QEPA 2H5JB 3W62A 2ZHOA 2UVUA 4QBUA 1NB7A 2W2OP 1GLCG 2A1BA 3AD7C 3A8JA 5T7LB 1F3VA 4CP5A 1N88A 2AKWB 1FEHA 2KH9A 3BN7A 2UV8G 3HZGA 1YF5L 1XERA 2RDJA 3TW0A 3TX8A 3DXBA 3L3UA 2C2NA 4RNFA 4ECTA 3O6WA 1CBKA 3CJQA 2GO8A 2HHSA 3OTDA 1RAOA 4LFCF 1RHUB 4QIGA 1HNXJ 3VV2B 1Y5IB 1WC1A 3E01A 1T3NA 4PL7A 4KHSA 4FBTA 2W25A 3WEEB 2WOMB 2P6SA 3VQEA 1QSSA 1RDCA 3TQ1A 3E9OA 3AA5X 1KWMA 2DPJA 3V1QA 3TPQA 2EKNA 4Y1CA 1VQOS 1T6DA 3TAFA 2CQ2A 4KC5A 3TARA 2W9CB 1HNVB 1NAQA 4BRGA 4K8ZA 2WONB 2BQUA 3CJKB 4XAKA 2QFIA 5C25B 3IUCA 3AQPA 5H9EK 1ZM4A 2XMUA 1LW0B 3FBCA 1WSEA 2RDDA 1SQKA 2OI2A 4BHQA 3ZSQA 1OYDA 2KI2A 3A1YG 2QYGA 1WG4A 3NF9A 4DN9A 3PX0A 2RE2A 4LSLA 3J7ZT 1VQ8S 2XWXA 1EWRA 2FC8A 3DN9A 2D5RA 5K14A 1UZHA 2J6TA 2LXUA 4WP9A 4FLXA 2DHAA 4U6PA 3CCEN 2F7TA 4TY9A 4DUYJ 3DRSA 3GILA 3KWIA 4Z7YA 1EX8A 1NGHA 4IFVA 1RT1B 4JKFA 3KWMA 3ZSYA 5C2DA 2F4VF 2MZJA 4Q8FA 2YJFA 4KQZA 3UNGC 5GAGU 2B8PA 2G9OA 3AXKA 4LH4A 4Z4IA 2BABA 3GSIA 4OLAA 1EJ7L 4DU3A 3JTOA 4QW8A 4BDYA 1BC6A 5G0RB 4RU2A 1W97L 3R8EA 1SQEA 4G3IA 3A12A 5KFSA 1F1BB 4ZJQA 4HT7A 4RW8B 3M8QB 3A4TA 4X84A 5KFBA 2VFRA 3AVGA 1C0GA 5ETQA 2GBZA 3GIKA 4X4UA 4ECZA 2UUAK 2PZSA 3GIJA 2AV5A 4KR0B 3NH0A 4DQRA 4UOFA 3QIPA 2D69A 2HBRB 4PG8A 3CJ0A 4CJWA 1DURA 1JJ2M 1NPPA 3J7ZO 2PIIA 1EETA 3H4BA 2FJDB 3LGMA 4GV3A 4O0IA 1R8CA 3BF3A 1GT8A 4DV3F 3QBWA 2VPYB 4G1QB 2ZBQA 1D8YA 1IV0A 3PHTA 2DR6A 1X5TA 2Z4PA 4R25A 5IV4A 4PABA 4IKAA 2K1RB 3GJTB 1VC0A 1Q7LB 3M7VA 5JVGQ 3N4WA 4LF4F 2ATLA 4FLUA 3FZ2A 3CMEN 1K0TA 1T8EA 3ASMA 3M4XA 1Q53A 5HQLA 4LF7J 1N52B 2WUSA 1KLMA 2ZF5O 4GV9A 4EFHA 3I0SA 1JK9B 1BQMB 3B6OA 2HS4A 2J0WA 2NRWA 1BMQB 3PUFA 3ID8A 4IFVB 4I64A 2UUBK 2E88A 1XNRF 4F9OA 3CCRS 2CWXA 4ED8A 5B0FA 5LJ3Y 3VF2A 2WOMA 2XSJB 2GCFA 4ZLJA 3TEGA 2UXBJ 2KU7A 1SIZA 3DI6A 1YJUA 4RUBA 3H1VX 3BPDA 2XMJA 1HQUA 4CI0B 3AVJA 2ZH4A 3N5FA 1LWEA 3D6RA 4DLGA 1LQ9A 5AQHA 1IQZA 1D9AA 4X4OA 3U9DA 4LQ3A 1ULRA 4ZJLA 1V4SA 3T5LA 2LA6A 7AT1B 3MFHA 4JV5F 4RKUC 1Q7YO 2C3MA 3OJUA 4ZP7A 5JS2A 1JQGA 4X62F 3J7Z5 3UD3P 4JRPA 3W3SA 3RAMA 1I94F 5GADP 3ZNUA 5J2PB 1V5VA 1KQGB 2UUCK 4CZJA 2NRRA 4XPEA 4HHHA 1IBLF 1U6BA 2Q0RA 4OGEA 4EMDA 3O1LA 1ASVA 1JCGA 4JI0K 2XSFA 2HAFA 4ED2A 5AQWA 3QLHB 1MWQA 2NXCA 2PC6A 3OTEA 4NA1A 3MXHP 2CDQA 4WFAL 1W26A 2V8DA 4P9SA 4BCAA 2UV8A 2LU1A 3HKZD 5E3PA 4DR1J 1C6VA 1X5SA 2BJ7A 4BQZA 2UZAA 4WKRA 5DG9A 4Y3CA 2OHDA 1FI4A 3UR3C 2VOPA 2IRYA 2ZNZA 2WFBA 1CSJA 1FNMA 2EFQA 1RGIA 1FNXH 5ADXH 4J9OA 5I3PA 2F9TA 1SKWA 2VDIA 3PFEA 1YITS 1VQNN 4JI1F 1G99A 2OA8A 5J2QA 4Z0UA 1QZ6A 2NZ4A 2LQ9A 2ZC3A 4BRIA 3P5TL 2IVYA 5DZ6A 1FTCA 3ALYA 1U2RA 4RCHA 3KLGB 1BUXA 4B3RK 3DI6B 5EWEA 2OEMA 4CM2A 5CQGA 4Y1DA 2XEXA 2GGPA 3V5RA 1V6HA 3FGVA 3WXMB 1JLFA 1NGAA 1GNKA 3OXGA 1VR6A 2KZZA 4F02A 3W3DA 3DOLA 2MQ8A 2VG6A 1HQEA 3O44A 4C6AA 3VAGA 2XY5A 1J6ZA 5EVZA 1X0PA 5GAHU 1IH7A 2OPSB 3CXCM 2CJQA 2OFHX 1S49A 3MR2A 1S6PA 2ZH6A 1YHQN 3Q7BA 2KT5A 4JP8A 2YNHA 4ES3A 4WE1A 1HPZB 2VG7A 5IT9U 2O8EA 4OJGA 4NO7A 3OYNA 1QE1A 5G4DA 2HNZB 3HK2A 3IRWP 3SSSA 2HQIA 5D0HA 2VJVA 2IDOA 5DQHA 4DXLA 4B3TJ 2NNWA 3KZBA 5LL6d 2AEJA 4H4OB 2UVWA 3QPIA 3M8SA 4OL8A 4MO5A 3HOSA 3CF5Q 2JVOA 4C23A 1FFSB 3MGJA 3HI9A 2VQFJ 4CIGA 2IBOA 3KKRA 1JXEA 3VA3A 4CI6A 4BC5A 1HWIA 2Y0BB 2IM1A 2FVRA 5HK4A 2K3IA 4X66F 4TQSA 3GV7B 2HVZA 2J9DA 2QL9B 4AXIA 1HFEL 4DUZK 1UFLA 4IO9Q 3TVKA 1VSMA 3MI7X 1BCOA 1SC1B 3MM9B 2UVVA 4KSEB 5KI6A 1NGDA 2I8EA 2LQBA 3AA9A 3VEZA 3IS9B 1FDBA 2DIVA 2VDHA 1RBAA 2F8TA 4H0XB 2VQEK 4UY8O 2KB2A 3OVNA 1SUQA 4YR0A 1WLJA 2BH1A 3ILIA 1XIQA 2ZJPQ 5IWAJ 4H0YB 2E5GA 2W1BA 5K14B 1S6OA 4ZVGA 2C2MB 4CHQA 3O3FA 3DGPA 4XTTA 3OV7A 1F5BA 2HGLA 3MM7A 2W24A 2JLEA 1WKLA 3Q2TC 2YHXA 3L4BC 5HO4A 1FKAF 4BE0A 1NHUA 1KOHA 1H38A 1RBOB 4CF9A 4BE1A 2QLXA 3AVFA 1Y64A 3M9OB 3CFPA 3QNOA 2BJ9A 1RDDA 3ATVA 1VQON 2GAGC 4IO9L 4JI7F 2RMLA 4B9NA 1RTHB 4ZN1A 1P9QC 4Z94A 2QSWA 1M90T 3WQTA 4W5NA 2VFTA 4QR1A 2LSNA 4FJGA 3QZ7A 2PN6A 1XNQJ 1OKJA 1XMOK 1RTIA 3C95A 2H4YB 3NNHA 3E01B 3SQGA 3CC2N 3CSKA 2DRBA 4QIVA 4NXMF 4N7TA 2O67A 3GYXB 4RTFD 5D4OA 5LJ5Y 2YH1A 1FKPB 1Z1ZA 3POTB 4AM7A 1UVIA 1N0VC 2DRDA 3R7NB 1RKIA 4BR7A 4NLSA 3ZZZA 1TL7A 1TFWA 1REVA 4DV0F 1ATNA 4FS2A 1Z25A 4CLYA 4DPTA 1NGJA 1EZZB 3F44A 4USIA 4LC9B 4DZ6A 5M2UA 5KGWA 3CB4A 3PVXA 3F41A 1KSPA 2J8AA 4RWTA 3THXB 1C2PA 4DV5J 1UMJA 4ECQA 2HMIA 1QUVA 3K89A 3DOLB 2BVZA 4Z2XA 4YB6A 2ZVSA 3SCIE 2YXLA 4QIWD 1S77D 5JICA 1A7GE 5M2RA 4QWBA 2WB4A 1UVMA 3A5NC 5KFUA 1VQ9N 3LP1B 4DL0C 2NUHA 4IG0A 3U02A 2MY7A 3MMCB 3ELHA 1N6QB 4PCQA 4FJJA 2IYIA 2A18A 2XB2D 3CJ4A 4ICLA 4HI2A 3R3TA 1RCOB 1S1TA 2W40A 2Y9HA 3A5LC 5SUHA 3NWRA 2XQCA 1S1XA 4IR1A 4X4TA 5AE2A 2XCAA 4KRWA 3BKUA 4DR4K 1I39A 3W9JA 1RLDA 1HJOA 2WB1D 1OY6A 4ANEA 4HVJA 2MKYA 3EXCX 4Q45A 2HOEA 1U1OA 3SMSA 2C2RA 3EE8A 2R7WA 2DGOA 4DFPA 1NLKL 3HKWA 3OVBA 4JNEA 1GTEA 4DTRA 3KLFA 1GQEA 2XHBA 4KPCA 5IWAF 1Q0NA 2YHYA 2P9KB 1DZ5A 4OZ0A 3TANA 1JLBB 1RBSA 4DQIA 2R3VA 2CVIA 4PQAA 4CDIA 3SI6A 4DU8A 4HHJA 2ZJRL 1CJVB 1MMLA 3HSTB 3AVIA 3T6BA 4MKVA 2Z2LA 1QM9A 5EUHA 3V6JA 2JH3A 2FLNA 2W6LA 5JUMA 1W25A 3CCZA 1EKEA 1ZZNA 2B8QA 3NFAA 2OTLS 4DV2J 2E1AA 5K8PA 4DTXA 3BQ0A 3A2FA 4J9NA 2RDIA 1RAEB 3PTWA 1XHZA 2V9KA 4KRFA 3L09A 4TKTA 1XQSC 1HNWJ 3LO3A 2JX2A 4K2XA 3QGGA 5KFEA 2R7VA 5LMNK 2RU3A 3MM7B 5IC4B 5LOQA 1WHYA 5KT7A 4P7TA 3M5RA 2P1JA 4ZVQB 4E7IA 1N34J 4AL7A 1TK0A 3C94A 4J2BA 2MKCA 1XUPO 1XC3A 4U7CA 4EK2A 4KPYA 3RGIA 2J0XA 4CZMA 1WC5A 2NRHA 3WXJA 2E9RX 3FUYA 1BU6O 4DV1J 3NP5A 5BXIA 4RG8A 2UYTA 2DR5A 1OH6A 3K9JA 2L9DA 4QR2A 3R9PA 3NWGA 4FZVA 1S0MA 1HMVA 2NUBA 5IZHA 1CZAN 3HVWA 3M2UB 4J9MA 3PX6A 1S7IA 2F8SA 2FGOA 4KH5A 2RKIB 3KK2A 4C11A 3VTHA 2V4JA 5E5NA 3K59A 1EP4A 1TK5A 4R8UB 5KFWA 5JLHA 3FSXA 4GC6A 3R6MA 4GO7X 3JAMO 4IH6A 3C7NA 2M2BA 3I32A 4DV6K 2R7RA 4FXVA 2CQDA 4O55A 4I6MB 4WCEL 4JI3F 5BN9A 3SNNA 2KYXA 1CZBA 3O9RA 3VALA 5HMWA 3MEEA 5LMUJ 2AYBA 2QX0A 5DJBA 4O8KA 2YNGA 3A8KA 2LEPA 1W2BM 3OVAA 2DEIA 2O5DA 3CC2S 3MM6B 4D3GA 2HBKA 4OLBA 2Q1NA 3K2PA 4I2QB 3UNYA 4IEIA 2YQ1A 2FLLA 2R7TA 4PKHA 4M63A 2GV1A 3OLAA 1IBKJ 2KKZA 3HHDA 2GHWA 1Q86O 2XNQA 1VQKN 3RBZA 1REVB 4X62K 4DR2K 3R1HA 4CECA 1BXNA 3I55S 4EP5A 3DC2A 4YB7A 1RFQA 1PYOB 3L9ZA 1QJHA 4KV8B 3UW1A 1EHWA 1CG2A 2E9TA 1AB8A 2VCPA 1TUUA 1UTAA 4L72B 2R2TA 3QNNA 3TAEA 3C14B 3AT1B 2JL9A 3EKUA 1X4CA 2E1MC 4M3TA 3PKYA 4WQ5C 2YNHB 5LSOA 2IAJA 1W2IA 3FNNA 4OZJA 2KFZA 3KMQA 1PCAA 1F2HA 3CCVN 2DYAA 4NYNA 4WCEQ 1NMEB 4IJNA 4JI8K 1MLAA 4JI2K 2R2SA 3HHLB 4YEAA 3I56S 5CZ1A 2HHUA 3EO3A 4KGXB 4CLFA 3Q8YA 3T5HA 4MJKA 4FW2A 3SAFA 1ZBLA 3LQVA 4JRQA 4OKJA 3M9MB 3SV4A 3TA1A 5GAGI 3SBTA 3B6BA 4KO0B 2ZZMA 4FWLA 2M9KA 2BQRA 4LRAA 1LAVA 1QDUB 5I9EB 2HVIA 5AQIA 4K41A 2DR8A 4GVMA 3L3VA 1X5PA 1YTUA 3PX4A 2JFKA 4FPBA 4JK7A 1ZM2A 2Y1LB 4DPOA 2JWLA 4OHVA 3MPVA 2OZMA 2NUUG 4NYPA 1KHVA 5AQOA 1FRHA 4B9UA 3UQSA 2K06A 2CPFA 2ZVIA 1HYVA 3DGPB 4OHYA 3EXYA 4PUOB 4CQ1A 4JI7J 3IWLA 3E9PA 1NM2A 1SV5A 1TV6A 4QS7A 3IWNC 1CLQA 3J80Y 4O3SA 3DYAB 4FCYA 4BR0A 2UUCF 4CJSA 4IOCL 5HN0A 2EVZA 4F3OA 1M5OC 3MPUB 1QVFM 3T1YF 1RT5A 2B5JA 4P2FA 2FBVA 3CETA 5AQTA 4FBUA 4H5RA 3V6DB 1U0HA 3D3CJ 1ROFA 3L2QA 4GKKJ 2BKPA 3LPYA 4DL5A 4KH4A 1IBMJ 4K8XA 1UWBB 2KVQE 4JV5K 2V34A 1FX2A 1TK8A 4LF9F 1YDLA 2FF6A 2JLFA 2NXNA 3M8YA 3ZX0A 3ILJA 4ZOSA 1IWAA 4ZP9A 2X1BA 5KFOA 4OO1J 3HSGA 4OI4A 4Y6IA 4ISGA 1DJ0A 4Y34A 1AZSB 2QN6B 2YBVA 3IWXA 5AQZA 3KK3B 1K47A 1P27B 4CHYA 4NA3A 3PCOB 4OYZA 2HF4A 3H45C 1FDDA 3UWTA 4E1NA 3KUHA 2M0GB 2DNKA 2E7WA 1A9NB 3CIPA 4DR1F 5HROB 3CJRA 4H0VB 3IO1A 4M5IA 3DXSX 1VQNS 4NLBA 1FRLA 2Y3YA 2DTJA 1Q4RA 3OLBA 3C66A 3DRYA 3H5XA 2QTDA 1YIJS 5FRNA 1C1CB 4CZLA 4E3SA 4ZTJA 4ZIWA 1GMWD 2CJ9A 2XYGB 3L4IA 2VG6B 1U1LA 1DGKN 1ATSA 1DRZA 2BANB 3MR3A 3V9ZA 4XEIA 4BGBA 1ZBIA 2KT2A 5KG6A 4TY8B 1FJGJ 1S0VA 1ZPVA 3KJFB 1NNDA 1LWXA 1O6XA 3F9MA 3TSUA 3HD1A 3ZX3A 1YT3A 1JLCB 1U2FA 3VTIA 3L6QA 1JL1A 2MSSA 5IFMA 4CJRA 4OZ3A 3DCAA 3VZHA 2ZUAA 3KXDA 1OJ4A 3D6FB 1VSHA 3LDQA 5KFFA 3T9NA 5AQNA 3BR9A 3LDNA 4IZ9A 3S41A 3CPWR 4M3XA 4QOZB 1XNQF 1RAAB 2ZBPA 3SSQA 3E2EA 2GHPA 4KHPF 2RRNA 5C10A 1T9XA 3UDVA 1TELA 1OPIA 3C8YA 2K8GA 5B7WA 3AA2A 4ED6A 2GS8A 5CAAA 4C8NA 1CJKB 5FDLB 3NNAA 1VI7A 1WOPA 1LV5A 1YI2S 5E33A 5H1SV 3HP6A 2GC8A 2QL7B 4NA2A 3H0PA 4K0KF 3LPUA 3K5NA 4NCGB 3EDRB 1VQ5N 2QLBB 4CEOA 4FOIA 1Y3KA 3CJAA 3NGDA 3Q24A 3NAIA 1B4SA 2J9EA 3W5ZA 4JKCA 3O4NA 2I1RA 1R43A 3IG1B 5DLGA 4P2XA 2PMZD 1KTQA 4AQYK 3DLGB 1MDUB 2VC0A 4RBTA 4JYAJ 1S0OA 2CUYA 1S57A 5J2MB 1LWCB 1ZBTA 3M30A 3ET6A 1QY7A 4LRDA 4Q8EA 4DFMA 4ISFA 3G6XA 3KTQA 2YKNB 4OFZA 2DH7A 3HPGA 3OYMA 3C16A 2ACYA 1ZBHA 2YJEA 3SJHA 4DL3A 4B1ZA 4WIQA 3T1HF 3GBTA 2FJEB 2PFDA 3B82A 4M41A 3NRBA 3NCPA 4BQLA 3MCOA 4NLYA 3SI8A 3HPOA 4P6QA 3VQ4A 4S0MA 4CZIA 3BGRB 3T1HJ 4ECRA 4FJLA 5BYQA 5DLFA 3ZT3A 2GJFA 4DR3F 5LSLA 4BRCA 5HANA 1NJZA 4IDHA 3TUJC 1W2BR 4B3MJ 2VV5A 1KBRA 3TZWA 4ETZA 3A8YA 4YOUA 1JB0C 2AU0A 1BL3A 2H9ZA 2YHWA 3OL6A 2LVWA 1B3TA 3B8AX 4H5VA 1OSDA 1CXQA 3VQTA 3LGHA 2UXCK 1WHXA 3CCQN 3I0SB 4JI4K 3GDQA 3L2VA 3DMJA 3W5YA 1E3MA 3C6AA 4NB4A 5L8RC 2FJVA 2X1GA 4LF8F 2Y1JA 4A46A 2HBYB 4NLGA 3THXA 2UUWA 2XGQA 2YKMA 1G4CA 3KG1A 2UXDF 2HZCA 3C14A 5I42A 2BQ3A 1OIAA 2AD9A 1IVZA 2ABYA 1FVSA 4NCGA 5F3TA 1RWOB 5HP1B 2MQLA 2BA9A 3ZZ0A 2DB1A 3R2DJ 1LW2A 1R89A 2KO1A 1XNRJ 4ZDNA 1FD2A 1K73O 5AQMA 4JI3J 5AQUA 3HSZA 2RE1A 4QYRA 2I0XA 2ZKUA 3LP3A 1HI1A 7FD1A 4ZVOB 5KFIA 1EAYC 1RT2B 4OYOA 2FHKA 5LL6Z 1PILA 1YTAA 3KLHB 2ZZNA 2NPFA 2B9EA 2VASA 3R7SB 3W8GA 2GJIA 1QVGR 3AVNA 2Y8YA 3SQGB 3VAJA 4CWBA 3PLAA 2QT7A 5LXYA 1CJTA 3IR6B 3AVMA 1IKVB 3MPWA 2IFXA 1D1UA 2FY8A 3OFGA 3A8IA 4URSA 2ROEA 4LMZA 5FJ4A 4Q5VA 1Q18A 5A8WB 4F4ZA 2NS1B 2VUGA 5CZ2A 4HTUA 3G10A 2OPQA 1LKZA 3FK4A 1PBAA 4IR9A 3WQUA 1GK8A 2E1YA 1RHRB 1S1UB 5GIOA 1N32J 1TR0A 5HMZA 4J2AA 3FCVA 2QEXN 3NGRA 1NKCA 1EQ0A 4W98A 3SV3A 1PKUA 3VGLA 5ETLA 2HSEB 4GO5X 3CD5A 4KHRA 1HQ2A 1BIUA 1NKBA 2V51B 3W2WA 1Y97A 4DR4F 2DY4A 4NL5A 1NRKA 4JKEA 1V5IB 2ASYA 2HGMA 3ILLA 4JI4F 1UJ5A 2CXEA 2IMWP 1RDBA 4ED0A 4BE2A 4B1UB 3OUYA 2N4CA 2HAIA 3DLBA 5AQLA 5L1JA 4JYAF 3SJJA 2OZSA 1N8RT 2QG9B 4H03B 4JI5J 2GIRA 1HBNB 2PMWA 4WTYA 2Y1RI 2IMOA 4KIAA 1S6UA 2DNPA 3CDEA 1FX4A 2UUBF 3EM1A 2VWKA 4LSLB 3WQPA 2G2OA 2NXUA 2KHCA 1TKTB 3J8AA 1JXBA 2CJYB 3KOAA 4OHWA 2A0FB 3L2UA 3NH1A 3LDPA 3KD1E 1GXLA 3JQKA 3WXKA 4KO0A 4QR0A 2HHTA 4OX9J 1URRA 1WD6A 1VCTA 4R5PA 3FDSA 4M5MA 2RN2A 2LCWA 2YWFA 1N48A 2QW9A 2D3ZA 2ERRA 4FLTA 4N47A 3WNEA 2IA0A 4WU2A 3ZSOA 4CJ5A 5LJVA 2LDYA 4RW6A 2HWTA 1X9MA 1XMQJ 2OTLN 4CIOA 2IRXA 4ANCA 1FXLA 1Z6RA 4IFYA 5M1PA 2QKBA 3NEKA 2P9NA 4CEEA 1IM6A 2ZOGA 1P9YA 4JI2F 4ZLPA 3CJ1A 3WX8A 3NNCA 4ZHRA 1OS5A 4RJVA 1YG0A 2XNRA 4GVLA 4FLVA 4YP3A 3QGHA 4X64J 1MWMA 4DN0A 2EK1A 1TYQA 4HHTA 1HNIB 2HF3A 4O23A 5A6PA 2R2UA 1N4LA 3M32A 3QDKA 2XM3A 3HVTB 2EK6A 3UDLA 4E7KA 5T7LA 3ULEA 1RB0A 3O1WA 3NKYA 5C2CA 3PJXA 4AL6A 5HVGA 1RHMB 5KFRA 1TKZA 4HUGA 3C0BA 3KWGA 3QRQA 4BVOA 3V9WA 1NSKL 3Q8VA 2QE5A 2JLGA 3BO2A 1RKJA 2ZQBA 3S01A 2DCLA 4BR4A 4JK8A 2KJWA 4LF7K 3BKFA 4GRSA 1A6LA 4OJHA 4MAKA 1FF2A 2XY7A 1GMVA 2BOAA 2RKIA 3KK2B 4KI6A 3HHLA 2VJUA 4E89A 3ULHA 1N32F 1SQGA 2C2OB 3H98A 2ZBIA 1VSJA 1ASUA 5HBMA 1F0XA 3AQOA 3W61A 3VAHA 2D0AA 1DBDA 3W63A 1X4BA 3WZ0A 1KVCA 4CZKA 2FD2A 4FDFA 1LFPA 3THWB 5CZXA 2BBEA 2WC9A 3BH6B 1VYAA 4GKKF 2NSCA 3CD7A 2IIRA 3LUYA 2BXJA 3ZXWA 4F04B 3E8OA 2YNIA 2YPYA 4O3RA 1RTIB 1N36K 3FCHA 5TKYA 3CUNA 1URNA 3C3LA 1VQLN 5ITHA 2BM0A 4BRMA 2RD5C 1HWJA 1RWPB 3ZZTA 5A6WA 5HJXA 3ETMA 1WORA 5CY4A 5KG4A 1KN6A 4EUVA 4X2BA 3Q8UA 1KAZA 2KZMA 3JYTA 1S1VA 1UEVA 3G2XA 1IQTA 1KFDA 4FWKA 4JI0F 2LA4A 3OY9A 3UVJA 3KHGA 2WAQD 2E8AA 4BR5A 3SUPA 3OXLA 2HQCA 1Q8IA 3PM9A 4JI0J 4ED1A 2M3DA 1VHXA 3FE1A 2YWEA 2V52B 1QLNA 3M8QA 1PBUA 1SI9A 5I3UA 3KKSA 1S48A 2GX9A 5FLXU 4QPXA 3GJQB 4DR1K 1KVBA 1VQ5S 3MDFA 2L9NA 4RR5A 1APSA 1LWFA 3OTCA 2GA7A 3DLKB 2MHEA 3M2UA 1FESA 3VGMA 1NJIT 2GMHA 2VKZG 4M5DB 2KFNA 4USKA 2ZH5A 3OW2M 4H0PA 3J80U 1WOQA 2BV3A 4NLOA 1HW9A 2JC1A 4B3SK 4I6YA 2WRMA 2PI5A 3J81O 2CQGA 3TEHB 1R31A 2Z1GA 3EY1A 3OYKA 3N4PA 5DM6Q 4CK2A 3CXCR 1FJ7A 1Y9OA 4CJ4A 1KQFB 1D0EA 4JBCA 3DJCA 1KD1O 4CLSA 1U48A 2PFUA 4ERDA 1KRPA 2W2MP 1MMDA 4KT0C 2FJXA 4L73A 4QCLA 4WXOA 4DR6K 3FQLA 1AUDA 4U95A 2OEKA 2GHVC 1VBXA 5A0YB 2Z2MA 1EXQA 2J9CA 2XYHB 1UVJA 4F4YA 4DR7K 2BX6A 3BJYA 4ID5A 1HBOA 2AIRB 5D0EA 4LF9J 3NMRA 2WBRA 2YKOA 3DFEA 3V81B 4QIFA 1KKHA 2NZTA 4OYWA 2OJ3A 1R7IA 3GL1A 3MR5A 2DNYA 3ADAC 3QAUA 1HPMA 3VMFB 1LK5A 3QIPB 2XO7A 3GJRB 3TTFA 3QEIA 1HPZA 1CQMA 2MQNA 2GUPA 3BF1A 2LFVA 4WE1B 1LEOA 1ZETA 2HFNA 4YOVA 4WFNL 5I3UB 4X4PA 4YUDA 2XWYA 2YX1A 2FQQB 4Z4GA 2HNZA 4LR8A 4QU7A 2MZSA 5K8NA 3V6HA 3H90A 1CEZA 1UPMB 2HBQB 4M8LA 3PW4A 4YY3K 2VODA 2NQPA 1SH3A 2AYGA 3WNHA 4UTGA 1NMNA 2VYPA 5C12A 2XLIA 1YJ9S 3Q7CA 4A8XA 1VGYA 1RCHA 4GKJF 3DDNA 3I4PA 3J81j 1FKOB 1M1HA 3T3FA 5M1OA 1GAOA 1U8WA 3AVBA 3OVSA 5AXKA 3CEDA 3JQJA 2F8HA 1MU2B 5FD1A 4C8OA 2UU9J 2HRTA 2YNGB 1X0FA 2GVZB 1KAYA 5DGBA 3UB5A 1RK8A 1VSIA 2CYYA 2G8UA 3HRGA 4USJC 4IQMA 4PYDA 4IRDA 4DR3J 3M6WA 1YI2N 1J5OB 3IBCB 3P4UB 4JI6F 4DV7K 3JSMB 4HCBA 1CS4A 3NXZA 4FXDA 4CGIA 5AJ3F 5IWAK 4K8RA 2BTFA 1L3UA 1RYRA 1TL7B 4ED3A 3EX7B 3CYMA 3EZWA 3S3NA 2JEFA 4CZGA 3SUQA 2ILZA 4JS4A 4X64F 4M95A 2ITGA 4WYBA 5CYQA 5J2MA 4Q2LA 2DHXA 1SJFA 5KTQA 4BRDA 4B17A 1SC4B 3J7YI 2CPJA 2C3OA 3JXOA 2RAQA 1M1GA 2AT1B 2GFFA 2LXFA 1RJJA 2Z1JA 3HT0A 1H72C 4YDUA 3RRHA 3IMXA 2MQOA 3QNWB 2O4GA 5KRSA 4OPAA 2ZH9A 4RW4B 4LD0A 2XULA 4JHDB 3OBIA 2W7PA 3AOBA 2J5AA 4BG8A 3MEKA 3VAKA 2NPIA 1VRTB 1I51B 3QFPA 1VRUA 2OH2A 1IR0A 1FE0A 1QD1A 3GE9A 4AE5A 3C65A 3SQ4A 1UCNA 1N33K 5KRTA 4C3MA 4F3MA 4U96A 2HEKA 3V4IB 1U1RA 2EWSA 2VIHA 3DXMA 1R8HA 3DAWA 4B9LA 1AT1B 4CHNA 3LTOA 3M9NB 4ZHRB 4LFCK 1X4GA 4OMFG 2ACMA 2CPYA 3BEXA 2KG0A 2GWKA 4DSLA 3TZYA 3LALA 5HAOA 1KHWA 2JVRA 1XI1A 4J9RA 3IR5B 2HFUA 5AE1A 1QQNA 1NG9A 2FVQA 4CE9A 4JUZA 2XY8A 3OTOK 3R5DA 4C3LA 1VQLS 5E7OB 4CVNE 4F4XA 1VS3A 4CLTA 5FRMA 2DNQA 4DV5K 3M3ZA 3UKUB 4I6WA 3SQOP 4NLQA 2Q3SA 4DV5F 3CI5A 3IC1A 3MWPA 4C0HA 3GIIA 5IXUA 2JWKA 3BBBA 3M2RA 1YZ7A 2BW7A 3QT8A 1RT6B 1FJGF 4FM1A 1IKYA 2W2NP 3CCUN 2JWNA 4CCHA 2BE7D 1BQMA 2OPRA 4H54A 3LP0B 4H8KA 5ETTA 1B7FA 3S3OA 2RVJA 2F1FA 2VF3A 3PR4A 2P9CA 2D1KA 3C6TB 2QMUB 5DM7L 1RT7B 2F5GA 1JIHA 3THPA 3CC4S 2F4FA 3LF0A 5DS7A 3T7ZA 3CQXA 4JB8B 3LDOA 3CC7S 2WVBA 4K43A 4DR4J 1V3SA 2B56A 2RS8A 1CZ9A 5KFVA 5J2QB 5GAEP 4OZNA 3CO9A 1HL6A 5F9NA 1RYSA 5AQRA 1Q81T 2VQFF 4O8UA 2OSRA 5HATA 4U7UK 1RABB 2E29A 4ANDA 1YJWN 1JWWA 2ZJRQ 4ZMMA 3HP9A 3O8MA 2QKKA 5EWGA 4ILRA 2MGZB 5IM0A 2LQ5A 3D7SB 2HHXA 1CJUA 1S1UA 4W4MA 3DRPA 2FZGB 4ECXA 2ATCB 1IBLK 1WHVA 4C8YA 1AROP 2JOQA 3ENAA 3QYYA 1HRHA 3IR7B 4XDDA 1WSFA 3CCQS 3E66A 1HWUA 2RF2A 1Z05A 1WBDA 1RISA 4CLUA 3LH2S 2M8DB 5AQSA 5I3QA 3RB0A 4ED4A 3KLHA 1UVNA 1NK4A 5ETNA 2Z8QA 4K59A 2VU5A 2BKOA 3D9BA 1Q8LA 4DR5J 2UXDJ 2MQQA 2GW8A 2XMWA 3VHQA 2Q2RA 5KFLA 5F8MA 2ZH3A 5C25A 1QHAA 3BZQA 1HNZF 3EE9A 1NJXA 4OVLA 1LWEB 4YB1P 1TGOA 3GG4A 3SDEB 5TKWA 3VAFA 3RSEA 1VIXA 2P2CB 4GY2B 3IP0A 1WF0A 3MD3A 1WSIA 1ATRA 4ELVA 2COLA 4B3RF 1WKJA 4NPOA 1WSHA 4DSIA 1BG3A 4L6V3 3VVTA 4CFCA 1HA1A 3OS2A 4GVBA 4DTNA 2RIJA 1HI0P 3FBEA 4CLKA 4CO3A 4KTQA 4KFBB 2GZOA 1X31C 2A42A 1X7VA 2DBBA 3SK3A 1M0SA 3BDEA 2WSEC 1TVRB 4FYVB 1DT9A 5J1NA 3T1AA 2M8HA 5AFUA 2BEFA 1M5VC 3BGRA 4E8UA 5KFCA 1N0UA 2HRUA 1WUAA 4DV4J 3P5BP 4NZ0A 3DHWC 3ZTPA 5KG5A 2HGNA 4Y2KA 2E6MA 2H54B 1GXUA 4K4XA 1M1KT 2QK9A 4K4VA 2HNDA 2ZH7A 2IM2A 3CCUS 1MW7A 2WSCC 1WBBA 4DWIA 2G0CA 5KFXA 1FDAA 5AQGA 4OIXA 4X62J 3NGTA 1K6YA 2CPHA 1KOOA 2JEGA 4FVUA 3K17A 2Q79A 2WVCA 3B78A 1Q8KA 1S3XA 4FZYA 3H1QA 1X9WA 4CZCA 2WW8A 1YAGA 3MM6A 4H4MA 2FHJD 1FRXA 4LF5K 2PFFB 1VQMN 4UY8T 3I5AA 4HH1A 3HBTA 4M3YA 3MEEB 4QPTA 1NUEA 4GW6A 1SJ1A 4M7YA 3N28A 3Q8SB 4EYIB 1BOTO 4RW9A 4NLCA 3FZLA 4C8LA 4J9SA 2HBJA 3ENHA 2ASLA 4JD2A 3VQ9A 2OEJA 1HNXK 2OMLA 1S9EB 2E5HA 4DPUA 2ADBA 5EHHA 5KG7A 2I2YA 1AW0A 4FJMA 2NRVA 3LAKA 4NZ6A 3R5GA 5MAOA 2X7IA 3G71S 2XMMA 1SH2A 1S4EA 3ZYYX 2ZBCA 4X66J 5IV3A 3U3YA 4WWSA 4FM0A 2MKSA 4CESA 4AHVA 2NRTA 4W90B 4L74A 3RBEA 2RNEA 5C2FA 3N6MA 4YHHK 4HLBA 1L3VA 3KDOA 3N4QA 4DV1F 1WKKA 2Q66A 1N5SA 3ID6A 1RT4B 3CGIA 4USTA 4M3UA 2MDAA 2GELA 4FL9A 4DU1A 4OZ5A 3RWUA 3OUYB 2R8JA 5E3QA 3H20A 1J2VA 4K4ZA 3MMBA 2KM8C 1PJ6A 2DY1A 1BWFO 2BJDA 1NDPA 2BRLA 4PAAA 1HR0K 4M5LA 1RA6A 2FF3B 3CCSS 2E5IA 5AQKA 2B4VA 1S10A 5FROA 3NL0A 1NK8A 4FVMA 4E98A 1GEHA 1A5WA 1BGXT 2DIUA 4P74A 1TL3A 3BGLA 4RW8A 1ZM9A 2AX0A 4NYZA 1UWAA 3JXUA 3IFRA 3RU0A 3PW5A 2F4VJ 5CD4H 4ZPTR 3FSYA 3PEJA 1J5EF 3ZEUB 5KFQA 5KPTA 2CZVC 4CJEA 1J9AA 1FE4A 1TAQA 4CF0A 4RBUA 1NO8A 3PSIA 5F9LA 1FJEB 3GIMA 1R27B 2HHHK 2D3OR 3J7YP 3JS9A 3U1MA 4CF2A 1IKWB 3SCXA 1VFJA 5C24A 2E5JA 4CHOA 1NPKA 4ZPWR 1IBCB 2KKHA 1EQMA 4EI2A 3SYZA 4DSKA 3ZSVA 3OHAA 3F0NA 3CJ5A 3SCJE 4NXMK 2OPPA 2FSJA 1T9VA 4OJRA 2KT3A 3BBFA 4JKHA 3WUHA 2KW4A 1VSDA 5A0YA 4PXCA 1LW0A 4QIEA 3MMAB 2HBMA 4EBDA 3N9UC 4M5JA 3F2KA 2J7UA 3CE8A 4UOHA 3RRGA 3PIOQ 2BMBA 5AQQA 2OTJN 2R2RA 1VOMA 4ATNA 3B6PA 1WAJA 4F8RA 3MCAB 5AQXA 1FJCA 1YK9A 1KDNA 2J9DE 4BRNA 2QA4G 5FLXO 5JVGL 2CJKA 2ASMA 4OHZA 1FJGK 4IOCQ 4PUOA 4W5RA 1XC9A 2AQ4A 4DV4F 5AR0A 1FTRA 4DMZA 2J6UA 4JI5F 5BN8A 4HWIA 4TLQA 5D3GA 2KLAA 2A41A 1WAFA 3MM8B 4JN4A 4LF6K 1R8BA 4JV2A 1G2EA 3FEYB 4FJIA 5DDOC 1MG7A 3HHKA 2HS0A 4CEAA 3KUGA 2R4FA 2OSQA 1RWVB 4QZVB 4ILHA 1NH8A 4DMNA 4HEA9 1Q82O 1ITGA 4J9PA 4XIUA 3GQCA 3MAHA 2NXJA 3KIOA 3HHLD 2YX4A 4C1NK 2L08A 1TUWA 3CPWM 3TWZA 3FFIA 4CK3A 3CC7N 1NM1A 4PKGA 1Z2ZA 1ZBUA 4NLUA 3T19A 3Q8PB 4O3QA 3PJWA 1HW8A 3NF8A 2ZJQL 2CPEA 1UETA 3CCMS 1WC6A 4Y28C 3QIOA 3VERA 4E7HA 2W01A 1IM4A 3W65A 2GIFA 4OJ3A 2OLWA 4URQU 3KLVA 2LXIA 3JSRA 3QRPA 1UEUA 2CQCA 4FPRA 1W7AA 1RT3B 3MWBA 2B0GA 3P3DA 4F2SA 3D4JA 3ZLJA 3DDKA 1W9HA 4LUBA 3CC4N 4BC9A 4WF9L 3UN3A 4QWEA 4RZRA 2Z1HA 3LZIA 1EO1A 4CIFA 2VD3A 2E1RA 5D3GB 2YHBA 4FLWA 4CO4A 1A5VA 2RRBA 4CH0S 1S22A 3TVYA 1KAXA 3I87A 1DHMA 2Q6BA 2MQMA 3A0IX 4F25A 1RT4A 5C42B 4OI3A 3T1HK 4LF7F 1U24A 1FRJA 4B1VA 1G7CB 4BRPA 3MAAB 2VICA 3OFHA 1UJ6A 2CPZA 1B9DA 4X4NA 2A2DA 2J8SA 1J5EJ 2E1PA 4JOUA 2C22A 1JMTA 1LFWA 2DNLA 4TYAA 4EBCA 1NZ8A 3ULEB 4Y2MA 4OPKA 2E6LA 3VVUA 4JI4J 4K4UA 1VLYA 3W2VA 1TYQB 1RT6A 4TQRA 2NREA 1CC8A 1VSEA 4V19J 5BYSA 4LVNP 3JSBA 3UKUA 1K44A 3HSCA 1TL5A 3FBFA 2P9NB 1N36F 5M1KA 4IFYB 1X3NA 2DK2A 1X9SA 1XR6A 3L7OA 5M1QA 1Y5LB 1C1BA 1O5JA 8AT1B 2B43A 2HNYA 2NRZA 3NOCA 3THYB 4G1IA 4UQGA 4DFJA 4PWWA 1U0SA 3OBWA 3R5CA 2JDJA 4WXWA 4CHPA 2WBNA 2XMKA 1EB0A 4GMKA 4B3TK 3S3MA 2YX7A 4N76A 1D5AA 2LU2A 1VQ7S 4F4AA 3BYRA 1UEKA 1DTTB 2XHCA 1TAUA 3OA9A 1IBMF 2X74A 2QMWA 3ZTQA 2CNLB 1SJ4P 4U67Q 1JLGB 5E2QA 1SL2A 4Z4CA 1Q79A 1RHKB 2VKRA 5F0WA 4PHTX 3DU6A 4CGDA 3CJSA 2KQ2A 3VGVA 3BH7B 1FWPA 3TI0A 5KFHA 4J91A 2QZ8A 5CABA 2GQCA 2XY6A 4ICLB 3H3OB 1NHKL 4CLZA 3G0ZA 5C42A 1TP7A 1H6KX 5ETKA 1NOYA 1ZYQA 5E26A 4I2PA 5CYMA 5GADU 2V8VA 4DV7F 5KAKA 2WVDA 3VQAA 2P9LA 2YKQA 3SEOA 3Q22A 3GFZA 3NCRA 3PW0A 3AVAA 2Z30B 4FXWA 2MKIA 3FQKA 1K73T 4OV1A 1I5OB 5D4NA 1VBYA 4J9LA 3ULDA 3TP2A 3RMAA 2YTCA 1NSAA 2AX1A 3V9UA 2DNNA 4F4KA 2M88A 2FBYA 3PKMA 2G1HA 1YITN 2D9PA 2D0BA 4LF8J 3OYEA 3P45B 3KJNB 2ZH1A 2DFHA 1NU4A 3HCXA 3J7AP 2FZCB 3CM5A 2N3OA 5M1NA 3SQ0A 1CULB 5I4MA 3ZZUA 2ZWPA 4MKBA 1VSFA 4DR2F 4HUFA 1Q5VA 4O0NA 5RUBA 4DG1A 1YQHA 2P9IB 2R7XA 2KTQA 5KG1A 1XMBA 1TKDA 2YCHA 4A4JA 2A6MA 4CD3A 2ILYA 4YQWA 2R8GA 1N5YB 3C15A 3U7JA 2FVPA 4OYBA 4FJKA 3DRPB 3KJQB 2B9XA 3ZNJ1 2D4WA 2ZNYA 1F60B 1ZAWA 2BE2B 5KFPA 2PD1A 4AH9A 4MT1A 4AM6A 4WK1A 4IQXA 2HQ3A 1QQMA 4ED7A 3OT9A 3CMAS 3SSRA 3D7EO 3E9LA 2DGSA 4B3SF 2NYIA 2V2QA 1Z26A 1UVKA 3H42A 1S9FA 1HNZJ 2ZITA 3Q2SC 2XYPB 3D67A 4KB0A 1Y4ZB 3EGVA 4BRHA 2RPIA 3W9IA 4KB7A 4HDHA 4DR5F 4PG7A 4CEFA