3KLGA

Crystal structure of azt-resistant hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis of HIV-1 resistance to AZT by excision.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 105
structure length 554
sequence length 554
chains with identical sequence E
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3klgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3klgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3klgA05
2RPIA 3JSMA 4URQU 5JUMA 1IG9A 1HNVA 5E41A 4W5NA 3DRPA 4ZMMA 1RBRA 4DL2A 4Z4HA 4DF8A 2FBVA 2HWHA 4TY8B 4ELUA 4BDPA 2ASLA 1UAXA 4ECWA 3HXMA 3BR9A 1KSPA 1CSJA 4CGDA 3DLEB 1RYSA 2G8HA 4KHUA 4CEOA 4EZ9A 2VWJA 3CM5A 3OS0A 2E9TA 1NHUA 1JLEA 3O4QA 3VQDA 3IAYA 3H2LA 2YV0X 2IAJB 4NLRA 3IN5A 4B9VA 1R0AB 2JC1A 3D28A 2R8IA 4FJIA 4M3YA 3SQ0A 4Z4IA 1S49A 3TAFA 3AA2A 2YNHA 4U6PA 1NHVA 1YTAA 1S1UB 5J2NB 4U7CA 2OZSA 2D3UA 3RB3A 4I2PB 2XI3A 4B9MA 3MR3A 2HNYA 4R8UA 4NYNA 4KE5A 5KT4A 2HMIB 1VRTB 3NGIA 2OPSB 1FK9A 4KO0A 2DFFA 3V6JA 3CJ0A 4ZPDA 5K14A 3DM2A 1QQCA 2ILYA 2HW3A 4DLGA 3OVNA 3V81B 3KNAA 4DSIA 4FK0A 4DSFA 3T1AA 5KFFA 3QINA 4LQ3A 4DTPA 3KD5E 1TKZB 1RDRA 4KI6A 1UWBB 1SH2A 3DLRA 3MAQA 4KSEB 3WNHA 2HAIA 3LWLA 2Y1JA 2DPIA 3KLIA 3KJVA 2LSNA 1ASVA 3KLEA 1ITGA 2HHUA 3OS1A 2IC3B 4F4XA 1XR7A 2BE2B 4CEQA 4JLHA 5CYQB 3BREA 3CQ8A 2R2UA 1S48A 4FJLA 3NE6A 4HUEA 2OA8A 2ZQBA 5DG7A 3CWJA 4N5SA 3MR2A 4NZ0A 4CHPA 4FXDA 1Z26A 1SV5B 1IKWA 2OYQA 2X6SA 2D0AA 3ASMA 2OPPB 3TARA 3NF6A 3PW4A 3FSIA 1UA1A 1IKVA 1RTJB 1VRUA 3AVFA 3KLGA 2HHSA 1S1VB 3U6FA 1S6QA 2WONB 4B8AB 4FS1A 3DLGB 2I5JB 4K4SA 4RUCA 4ED0A 2HNDA 1S97A 2GIRA 2R8JA 2XO7A 3OHAA 3KK3A 5HLFA 2C2EA 2XI2A 1VSDA 4O3SA 3OYIA 4DTMA 2ETJA 2BGGA 3I5BA 3VQ6A 4E7KA 1QE1B 4K8ZA 4RU9A 2YNGB 1NNDA 1TKXA 3LP0A 2VA3A 4RW7B 1LW0B 4DFPA 2KZZA 3LP2A 4Q5VA 1RT5A 5F8LA 4IR1A 1TAUA 4LQ9A 1LWFA 3OYAA 2IJNA 4ZP6A 3IS9B 2IM3A 1XR6A 3QO9B 1HPZB 3M8PB 3ZSYA 1TVRB 3AVCA 3KK2A 2BQUA 3CYMA 3VQ5A 4DS5A 4ZP7A 2FJVA 1YVFA 4O3PA 1WSHA 4E0DA 5KTQA 3WNFA 3NFAA 1K1SA 3UIQA 4RUAA 3HVWA 5I3UB 1U09A 3GIMA 1S1XA 4DQQA 3KK1B 3HVTA 4ZTJA 1JLGB 3QLHB 5F8IA 1QHTA 1SKSA 4C8LA 4BWMA 1WSGA 2J6UA 3NGYA 3L2QA 5KG3A 3THVA 5F8NA 1SH3A 5KFVA 3GQCA 3P5JA 1S0NA 4J9PA 5C5JA 3RB6A 1VK0A 4IR9A 5KFKA 4WE1B 1L3TA 3LAKA 3IG1B 2G8FA 1NJZA 3NL0A 4WFXA 3L2RA 4CHQA 3H4BA 2YHAA 2JGUA 3DDKA 1RDAA 1GOCA 3M8QA 3N6NA 2W8KA 1K6YA 4DF4A 1IO2A 3AO4A 1BCMA 1RNHA 1S6PA 3TAQA 1ZBHA 2P1JA 5KT7A 2R7YA 4IG3A 3QEIA 3NGDA 2RKIA 2W9BB 4IQXA 2PY5A 2VG5A 4NLGA 5FDLA 4RNHA 3KLHB 2OPRB 5CYMB 4K4YA 1NK9A 2DFEA 5HRSA 2GBZA 1DTQA 1I3AA 1DTTB 4ED7A 1TKTA 3PO4A 3NMAA 1IKYB 3QEVA 3Q8SB 1EETA 2G8WA 1RT7B 4IH7A 4WZMA 1O1WA 5F9LA 1D8YA 3CG7A 2AJQA 1LAVA 4ICLA 2D0BA 4KAZA 5F8MA 5F8JA 5C24B 3RR8A 3LP1A 4IFYA 4EO6A 4ID5B 3VQ9A 4M3UA 3SQ4A 2VG7A 2C22A 1QSYA 5J2QB 4F2SA 2B4JA 1JIHA 3KMSA 2FVQA 4I9QA 1N4LA 4M3XA 4EP5A 2RN2A 4Q8EA 2CJQA 4CJLA 2KTQA 5HRNA 5DQGA 4Q0BB 2AX1A 3RB0A 5J1EA 4I2QB 4GW6A 4LSNB 5T7BA 1RA6A 2DY4A 1SUQA 3L3VA 4LD0A 3QESA 3V6KA 3DI6B 2RF2B 3VQEA 3N6LA 3RR7A 1BGXT 4G3IA 3RMDA 5FRNA 5KFJA 2O4IA 1J53A 2FVCA 2FVPA 3MFHA 5C42A 4GC7A 2R2SA 1JLAB 1YVUA 2JC0A 3D5MA 4Z4GA 2QXFA 1ASUA 4CEFA 3SV4A 2WRMA 2W42A 1C1AA 4BWJA 4CEAA 1ZETA 4CEBA 5HROB 4O55A 4HVJA 4MIAA 4DTJA 3SCXA 1JX4A 4ECZA 4CF0A 3QZ8A 3MECB 2ASDA 4J2BA 1S5JA 1LWEB 1C2PA 3KKSA 3KHGA 1A5XA 1TL1A 2JEFA 3LDSA 4HCBA 3KOAA 3BGRA 4ECSA 4K8XA 5KFMA 3PW2A 4HUFA 1S1WB 4O4GA 3P83D 1REVB 5C25A 4KKOA 3CFOA 2HHWA 4FJXA 4IDKA 5EU7A 4KB0A 4ECYA 4O44B 4AILC 3SJJA 4FK2A 1IKXA 3H5XA 3MTKA 1BQMB 4OPJA 3GYNA 5KFZA 1JLBB 3P1GA 4YQWA 2HWIA 4ECVA 3V9SA 1T3NA 3V1OA 2B5JB 4TSXA 4K50A 4OKEA 1B92A 2XY5A 4CGHA 1U49A 3QNOA 1QAJA 3V6DA 4FM2A 4B9UA 1RTHB 4ZPAA 4HUGA 1LW2B 4FJMA 4KV8B 2F8EX 2BRLA 2OPQA 4CK3A 2XC9A 1MU2A 4NLOA 1XWLA 2VG6B 2FVRA 3QZ7A 1RT3B 3ISND 1C0TB 4C8MA 3FDSA 1EP4A 1BI4B 3FFIA 3QIPB 5L1LA 4M3RA 1D9DA 4Z4CA 3ZSVA 4RW4A 4RW8B 4KRFA 3UQSA 3LALA 1KVCA 4JRQA 1S10A 4FJHA 4G1QB 3PW0A 4CECA 4LSLA 3QYYA 4PWDB 5L1KA 4O4RA 1ZBFA 2IDOA 1ZTWA 3DMJA 1A5WA 3AVNA 1S9EA 1CZBA 3T5HA 1HARA 4URSA 2BANB 4CERA 3BSAA 3O3HA 3HO1A 5F9NA 3AA4A 4NLQA 3GV8B 1SKWA 1YTUA 3MFIA 1S1TB 4Q44A 4KTWA 2IOCA 5KT6A 4KI4A 4E1MA 1T03A 3CJ5A 3C6UA 3KD1E 3V1QA 5DLGA 4QAGA 2YNFB 2JEGA 2O4GA 1TP7A 1EX4A 3SI6A 4OL8A 3K5LA 2GIQA 1LWCA 2ZKUA 1ZTTA 1N6QB 3QGGA 2C2DA 1DLOB 1BIUA 1RDCA 1UA0A 4NLVA 2C2RA 3MF5A 3MR5A 3I8DA 2QV6A 4O3QA 1NK6A 4DG1B 4IH5A 3H98A 2XHBA 4WZQA 4R5PB 4B3OB 2BQ3A 3HKWA 4M41A 3DLEA 2R2TA 1HYZA 4MK8A 3CDUA 1VSEA 4Q43A 4F50A 4TXSA 3L2VA 4IFVA 5J2PA 3K5OA 4CE9A 3OLAA 1SKRA 3H08A 1ASWA 2XGQA 3EZUA 4B08A 4YR0A 3I0RB 2IAJA 4YFUA 4PQUB 2ATLA 4B9LA 5DQHA 1NK4A 3BJYA 4CIGA 5HP1B 3MEDA 3CDWA 4ELTA 1JLQA 4WFZA 1RYRA 3A2FA 1HQUB 1B9FA 5J2NA 2QE5A 3C6TA 1ZBLA 1HNIA 2HHQA 1TL3B 4AHSA 4H4OA 1KLMA 1TQLA 3SI8A 3H5YA 1RT1B 2G8KA 3V81A 2W9CA 3MXMA 2P5OA 1VSFA 4KB7A 2J6SA 3G6YA 4CFCA 3HL8A 2BRKA 2R2RA 4M45A 4CJUA 4IBNA 2F8TA 3PZPA 4J2DA 4IKFA 1T7PA 3RB4A 1K1QA 4YR2A 4DTRA 3SUNA 2ZE2A 4K4UA 3T5KA 4QPXA 3NH1A 4OJRA 3F9KA 1HMVA 3SV3A 4WXOA 2WOMA 1NOYA 1U47A 3JSMB 4HCCA 1FXXA 4IRKA 4DL4A 3DRPB 3PJXA 2IM0A 3RBEA 1L3SA 4KHYA 4ELVA 1C1BA 3KIOA 2FBYA 1KVBA 4B9SA 4J9MA 3G86A 3GIJA 4K4ZA 4CFDA 4FS2A 4QWDA 3OYFA 2HB5A 3OYCA 1JKHB 4ZVEA 4CHNA 1RDBA 2BR0A 3OJSA 3MXIA 2X74A 1QS4A 4J2AA 3NGZA 1JLEB 1IM4A 3H5UA 4ZVHA 5DGBA 4CK1A 1XC9A 4ECXA 4DTSA 3SPYA 3KHRA 1RTJA 4CEDA 4AHCA 3AVLA 3NCIA 3S9HA 3OYMA 5KFEA 4PA1A 4NYZA 1EXQA 3DLGA 3ZT1A 2I5JA 3QIDA 2YNHB 3OL6A 3HM9A 4K4TA 2I1RA 3LZIA 1S9GA 1C1CA 3GV5B 2IGIA 3IGVA 1KTQA 2YKNA 1WSIA 2HNYB 1TKDA 3H5SA 4RNFA 4R8UB 2WCXA 1VSJA 3MEEA 3AO5A 1FK9B 4KO0B 1X9WA 3DM2B 4KB1A 4J9NA 3K5MA 3D45A 1C0MA 4RW7A 3SYZA 4FZXC 1JL1A 4EO8A 4Y1DA 3QO9A 1RT6A 5I42A 3F73A 4FLWA 1HQEB 4XIUA 1Q9YA 3M8PA 3RMCA 1TVRA 3I5AA 3E51A 1VSIA 1HYSA 3KLIB 3DRRA 3KJVB 1W25A 4OKKA 4KHQA 3AA5X 5DK5A 3KLEB 3NDKA 1SL2A 4CF9A 3DOLA 4UQGA 1LAWA 3VQAA 2JEIA 4NRUA 3BDPA 1FKOA 3QERA 3OYNA 1KHWA 2XCAA 4FYDA 3D0PA 5J2MA 3QNNA 3PR4A 2FBTA 3CJ2A 5KG6A 4JRPA 2B43A 3HPOA 1Q8IA 3VA0A 4FBTA 3HP6A 4ECRA 2XWYA 3VQQA 3BSCA 5KFCA 4YNQA 3LWMA 1IKWB 4PUOB 4F3OA 3ZSRA 4XPCA 4NCGB 3TI0A 3K5NA 3IGNA 1NKBA 1BQNB 2VA2A 3TAGA 2G8VA 1VRUB 5JS2A 3PUFA 2YKMA 4OGCA 4ZP8A 1S6QB 3DLHA 3TR8A 4DSJA 1TV6A 1RT2A 4EBDA 3TQ1A 3ZSWA 4DTUA 4CCHA 4MK7A 2HNDB 3OYDA 3DOKB 3KK3B 5KFOA 4KTQA 4I7FB 4H4MA 3T5LA 3OYHA 5HLFB 2HHXA 1QAIA 1RDDA 2E4LA 5KFTA 5DG8A 3WNGA 2W9BA 3RTVA 1NKEA 2YNIA 2HHVA 1IH7A 1Y97A 4M95A 4ZHRA 3PX0A 3OLBA 2W7OA 3HK2A 3MEGB 4AHTA 2HNZA 3HJFA 3EY1A 2AGPA 1TKXB 3V9ZA 3LZJA 3VA3A 1HJRA 3DLKA 3LP2B 1BL3A 3CVKA 1RT5B 1ZBIA 3S3NA 2WHOA 4LH4A 4YR3A 1LWFB 4CK2A 1RAJA 2O5DA 1RT7A 4HHTA 3Q8PB 4IH6A 4H8KA 5KT3A 4DQSA 1B9DA 1U04A 4KBIA 4HKQA 5T14A 5EWGA 3QIOA 5C24A 2ASJA 4FJKA 1KLNA 3V9WA 3HVRA 4CJEA 3CFPA 1SL1A 4CGGA 5F8HA 2UVRA 4NCBA 1QUVA 4F8RA 2JLEA 4QW9A 4O0IA 1D5AA 3NF7A 2ZD1B 2A1RA 4ED8A 2B6AA 3H4DA 3U3GA 4CGIA 3M9OB 1N56A 1I39A 4Q0BA 4I2QA 3CFRA 3PVXA 4MKAA 2R8KA 3M9MB 4FW2A 2KFNA 2BDPA 4DL5A 2GC8A 2FLNA 4MFBB 4TLRA 5KFIA 3EPIA 4NLXA 3I0SA 5KFWA 1CXQA 4CFAA 3GIIA 1VSMA 5EUHA 3WNEA 3DYAA 4H54A 3DLBA 3IRXA 3H40A 3OY9A 1GOBA 3KMQA 5KFDA 1JLCA 5KRTA 4X2BA 4KHRA 4FVMA 2A1SA 3BQ0A 1S6PB 4K4VA 4EZ6A 2D7SA 2RKIB 3RBDA 2VG5B 4IG0A 5FDLB 3MECA 1LWEA 1Q9XA 3HSTB 3PJWA 3OSPA 2Z1JA 1DTQB 2W7PA 2PYLA 1T05A 5HBMA 1EETB 4RW9A 4QCLA 4URGA 1ZBUA 4FLXA 4O44A 2W9AA 3V4IA 1X9SA 3TAMA 1C0UA 4ICLB 4DL7A 1JLBA 4IOBA 4Z4FA 5SZTA 4O3RA 3H59A 4MH8A 3LP1B 3KLFA 4ECQA 4OPKA 3E01B 5KGXA 3SQ1A 1I6JA 3ZCMA 4N56A 1J5OB 1WN7A 1FKPA 2FLPA 4OLBA 4O5BA 2WK4A 1XR5A 3G6VA 4FLTA 3CJ4A 4CEEA 5J1EB 4EBEA 4JUZA 3AVGA 4AHUA 3SZ2A 4FJ7A 1SUQB 2QKKA 2KW4A 4DMNA 4IKAA 2J6TA 1GOAA 1F21A 3AVMA 2GV9A 3ZSXA 1WSEA 3T5JA 1BI4A 1NKCA 3QIPA 3G6XA 5C42B 5EWFA 4CJKA 3AA3A 2P5GA 4R0EA 4Z4EA 3OYBA 4KAIA 3VQ4A 4G1QA 2FJXA 3EYZA 4NLWA 2AWZA 3NAIA 3RAXA 2QK9A 4CGFA 1TL1B 1NJYA 4NLUA 3KLVA 4CHOA 4RW6B 5D3GA 2F8SA 3BGRB 1D1UA 3HVAA 1S0MA 4O4GB 5C25B 3DRSA 4IDKB 2OZMA 3NKYA 3LAMA 2CKWA 1N5YA 4F3TA 4WFYA 4FZZA 3V9XA 1JLFA 1IKXB 1VSLA 4Y2CA 1WNEA 3FQLA 2V9WA 4AH9A 5KG7A 4O0JA 4M3WA 4NLTA 3AVHA 4KFBB 4IRDA 1WAFA 3SNNA 4DG1A 2AX0A 4RNMA 3ZT0A 2IM2A 4R5PA 1RTIA 3V9UA 4B3OA 4CJ3A 3V6DB 4FLUA 3ITHB 5DG9A 3ISNC 3NBPA 3OYLA 5JXSA 2PYJA 2Z1GA 2YHBA 4JS4A 3OHBA 3V1RA 1MU2B 3NAEA 4KHWA 2QKBA 3BSNA 1RILA 4TY8A 1EP4B 4EYIB 4CF2A 3ZSQA 3ZT4A 1BCOA 3QEPA 3SFUA 3AVBA 1TL3A 1L3VA 4CF1A 4EP4A 4E7LA 1U48A 3VQ7A 1RT1A 4NLDA 5KG1A 3S3OA 4LSLB 4I9LA 4EEYA 3LPTA 4AHRA 3DMJB 5KG2A 1WLJA 1EKEA 1S9EB 3OS2A 4NLSA 1RTDB 4DSEA 1R0AA 1CLQA 3SUQA 4QWBA 4CJWA 2FVSA 1OS5A 4LY7A 3L2UA 5KFBA 3O3FA 2D0CA 5L9XA 1W9HA 3RMAA 4O3NA 4YP3A 4NLYA 1S1UA 3PW5A 4I2PA 4DSKA 1T03B 4BACA 3C6UB 1D0EA 2D3ZA 5KG5A 1VSKA 2HMIA 4QWEA 1VRTA 2OPSA 2HVIA 1LWCB 1S0OA 2HVHA 4C8KA 1RBVA 2RDIA 4J9QA 4CF8A 3LPUA 1TKZA 3EPGA 5KFSA 2D5RA 1UWBA 5EWEA 3SQ2A 1RT4B 1JKHA 3JYTB 5HRPA 4TYBA 2OH2A 2E9RX 1J9AA 2EX3A 2Z1HA 4IFVB 5J2PB 4EYHB 1SH0A 1HNVB 3NF9A 2Q3SA 4QWCA 3MEDB 4N41A 2IC3A 4Y1CA 4FJNA 1JLQB 4BE1A 4E7IA 2BE2A 3K58A 3PX6A 4J9OA 5CYQA 3Q8QB 4B8CA 4JV1A 4ZVGA 3C6TB 2D41A 4ED1A 4CJTA 3NF8A 1HNIB 4J9SA 1W0HA 1SV5A 4DTOA 3O3GA 2FLLA 4H4OB 1KLMB 3M8SA 3HP9A 3RWUA 2OPPA 4BE2A 1XHXA 2W9CB 5FRMA 3OJUA 1S1VA 4TYAA 2WONA 3PR5B 4JV2A 4J9LA 5CZ2A 5CY4A 2GUIA 2PZSA 4QOZB 5KG4A 2IMWP 1HQEA 1LV5A 1KHVA 1TK8A 4FCYA 4OGEA 4OKJA 2ZE2B 3OYKA 3G0ZA 2HHTA 4DQRA 3CJ3A 1XHZA 1HMVB 1NJWA 2WOMB 5KFUA 4DQPA 3RRHA 3VQ8A 4JS5A 2F96A 3EZ5A 5K14B 1QE1A 2YNGA 2W8LA 3RRGA 4OLAA 4N47A 1KFSA 4F4WA 4JV0A 1C1BB 1NK8A 1LW0A 2XY8A 4NCAA 3KHHA 3SFGA 3IS9A 4CHYA 4DTXA 2DPJA 4MKBA 1KRPA 1CZ9A 1SL0A 3UPFA 1WSJA 3OSNA 1HPZA 4PUOA 4ED2A 4NCGA 4W5OA 4RNOA 4E1NA 4TN2A 1BQNA 4E89A 3HPGA 3AVAA 3TAEA 3VQCA 4K4WA 5FROA 2FBXA 1QTMA 4GMJB 1TK0A 5I3UA 1S9FA 3Q8RB 4BDYA 2UUWA 4HYKA 4L8RB 2KFZA 4RZRA 4B9TA 3KK1A 2EHGA 5KI6A 3QEWA 3DOKA 1C6VA 3T19A 1JLGA 4I7FA 4K4XA 3C94A 1S9GB 3QLHA 1C1CB 3TANA 2YKNB 4E7HA 3MXJA 2Y1IA 1BHLA 1WSFA 3MEEB 3MEGA 3QEXA 4KHNA 1D9FA 2DTUA 1T94A 2XY6A 2EC0A 4MQ3A 1IKVB 4F4YA 4WE1A 3QGIA 3KLGB 1X1PA 3TABA 3IG1A 3HPHA 4BE0A 1YT3A 4KHMA 4YMEA 5L1IA 1RT6B 5I42B 1KVAA 2WTFA 4CJVA 4DWIA 1ZYQA 2XRIA 4CJPA 5DQIA 3AVKA 3K2PA 1NJXA 2AGQA 2IBKA 1HYSB 3DRRB 1JL2A 3SUOA 1NK0A 1L5UA 3NH0A 3DOLB 1WAJA 3B6OA 2UVWA 3GIKA 4DSLA 4CJ5A 1FKOB 4Y34A 3KLHA 2OPRA 3B6PA 5CYMA 3LP0B 5J2MB 4W5QA 1QSLA 2ZD1A 2XGPA 3SPZA 1DTTA 1IKYA 2ITGA 3KTQA 2NUBA 4DFKA 4Y3CA 3SUPA 2X6NA 1XI1A 1KCFA 1TK5A 3TVKA 5KGWA 4Q8FA 4ZVFA 2IJFA 3KK2B 4CGJA 4MFBA 2IM1A 3ZT3A 3LANA 3OL9A 4TQRA 4FM1A 2E9ZA 2YKMB 5F8GA 4QWAA 4ID5A 4ECUA 3AVIA 1S1XB 2C28A 4NRTA 4IRCA 4DU1A 1TV6B 4N76A 5J2QA 1RT2B 1A5VA 4Y2AA 2KQ2A 3OL7A 3OYGA 3HVTB 4CFBA 4WYLA 1GX6A 4H4MB 3GILA 2YNIB 1NOZA 4LSNA 4ZHRB 2HNZB 4FLZA 4FLVA 2AU0A 3DI6A 3QETA 2RF2A 3DLKB 3TAPA 3HT3A 3NHGA 3L8BA 4KREA 5HRRA 2X78A 4J9KA 4W5RA 4DQIA 3MR6A 3CIZA 5KFPA 5JS1A 1JLAA 3KKRA 4RG8A 5KFAA 3M8QB 1TAQA 4DTNA 3OL8A 3BSOA 4M42A 4WXWA 1VSHA 2P51A 4FZYA 4J2EA 3ZSZA 4KPYA 1S4FA 1CXUA 3VQBA 5HROA 4IG3B 1RBSA 5KFYA 3VN5A 3AO2A 2ATQA 4Z0UA 3E01A 3G10A 1QSSA 4ZPBA 4FW1A 4M94A 1J5OA 2ILZA 2DFHA 4Q45A 2RDJA 3FQKA 4RNNA 1TKTB 3PV8A 2B6AB 4WYWA 1S1WA 1REVA 4C8NA 2E6LA 1Z4UA 3CDEA 3U3YA 2G8UA 4FJGA 3NAHA 5KFGA 3PY8A 4E7JA 1Z25A 4DU4A 4FJ9A 2V0NA 1X9MA 3KHLA 5KFNA 4DLEA 1BQMA 3ICLA 2UVVA 3AV9A 4CJ4A 3I0SB 3L2WA 3OYEA 4IFYB 3BQ2A 2B5JA 2IA6A 2FC0A 4ED3A 5KFXA 3DYAB 3NH2A 1N48A 2R8HA 3IRXB 3K59A 2VG7B 4F4KA 3PO5A 1JLCB 1RTHA 2Z1IA 1LW2A 4XO0A 5DMRA 4DU3A 4KV8A 4O3OA 2V4QA 4B9NA 1HRHA 4FK4A 4CHZA 1G15A 3VQPA 4IG0B 1U4BA 4LH5A 5KFQA 1MMLA 3HYFA 2R8GA 5KG0A 5SWMA 2VG6A 3M9NB 2XCPA 4EBCA 4DEZA 4RW6A 3OYJA 1RT3A 1C0TA 4ED6A 2AGOA 3AO1A 1RBUA 1T05B 5HBMB 5KFRA 4RW9B 4MK9A 2KZMA 1HYVA 3AVJA 3TWHA 4RW8A 4CIFA 2UUTA 3V4IB 5DLFA 4CEZA 3TAMB 4DFJA 1C0UB 1GX5A 3RAQA 5EDWA 1J54A 3M8RA 1UOCA 5DGAA 3AO3A 2VWKA 3I5CA 1JXBA 4ZPCA 4PWDA 3S3MA 2FJWA 4KFBA 1JXEA 4E3SA 3N6MA 3KLFB 4ID1A 4CIEA 2BANA 4ZTFA 2G8IA 2WB4A 5KFLA 4CJFA 4CESA 1FKPB 4KHSA 4CJSA 3ITHA 1S1TA 3UR0A 3BQ1A 4GVMA 3PX4A 3O4NA 4KKOB 4GC6A 3C95A 4DFMA 4J9RA 4W5TA 3ALYA 2YNFA 4NYFA 4E19A 1N6QA 4DS4A 3RMBA 1DLOA 1BISA 5L1JA 1NK7A 2UVUA 1T8EA 3V6HA 2JEJA 5KT5A 4AHVA 3L3UA 4F4ZA 4M3ZA 4F2RA 4MIBA 3GV7B 1RCHA 1U45A 2OPQB 4M3TA 4PY5A 3I0RA 4PQUA 1RTDA 5KT2A 2E6MA 4OVLA 5HP1A 1WNSA 3CO9A 4ZP9A 5D3GB 4CJQA 4DL3A 1HQUA 4HTUA 4TQSA 3DRSB 2XY7A 5KRSA 4TY9A 3FFIB 1RA7A 1NK5A 3QGHA 3HHKA 3LP3A 1N5YB 4RW4B 5KFHA 3ZSOA 3PHEA 3ZT2A 3PW7A 1JLFB 2AQ4A 4CJRA 1L3UA 4ECTA 4KTZA 3T3FA 4FBUA 4XPEA 2IS3A 3K57A 1KFDA 4NLPA 4QW8A 2BQRA 3ULDA 4FJ8A 3CM6A 1TGOA 4FJJA 3UDLA 4FLYA 1JXLA 4FM0A 1RT4A 4FJ5A 3FRZA 1RTIB 3JYTA 1BIZA 4BDZA 4C8OA 4DL6A 3VQSA 2V4RA 3NBPB 1RBTA 2ALZA 5CZ1A
chains in the Genus database with same CATH superfamily
4YDUA 5JUMA 3NCPA 1HA1A 2WBRA 5E41A 1FJEB 4KGZB 3HBTA 4ILJA 4I1TA 2BW7A 2VFTA 2DH9A 3A8KA 1RBRA 4DF8A 2FBVA 4TY8B 4ES2A 5I3QA 2B9WA 2HBLA 3HXMA 5M2RA 4USHA 2Y8WA 1WKLA 2AYEA 3BR9A 3HLUA 3J8AA 1KOHA 1K0VA 3O44A 1RYSA 4KHUA 2VWJA 2JLGA 2E9TA 4IJNA 1NHUA 1JLEA 2UV8G 3H2LA 5EX3A 1H72C 1SAZA 4JI2K 4B9VA 4UUWA 5C2DA 1FRMA 2M2BA 3DKDA 2P9PA 3TUJC 4Z4IA 1S49A 1SC3B 5FPNA 1X31C 2EG1A 1S1UB 4AT1B 1FESA 5LJ5Y 5J2NB 2OZSA 2D3UA 4U9RA 3HKZD 2XI3A 1Y3JA 2HLUA 3T41A 2ZH5A 2LEAA 1SJFA 3NGIA 2OPSB 4KO0A 3CJ0A 2RRNA 1APSA 1ITPA 3DM2A 1QQCA 4XH5A 2ILYA 3RAMA 4DLGA 3BM7A 4MO5A 1S72N 3OVNA 4DSIA 3IMQJ 2HQDA 1TKZB 2MMYA 1RAIB 1UWBB 1IR2A 5IM0B 1SH2A 4KSEB 3LWLA 4QIFA 3SSQA 2XLJA 3BZCA 3K89A 3M2RA 2RRAA 2A2CA 2IMOA 5C2FA 2HS3A 3AOBA 3ZZUA 2CWKA 1QUPA 2IC3B 2OO4A 4C11A 2BJDA 2LQ5A 1NMDA 2XHCA 1W7AA 2BE2B 1NLKL 4F3MA 3LGMA 2Z30B 4CLTA 4I68A 1WC4A 4LF4K 3W2WB 2R2UA 4FJLA 3A5LC 4CTAB 4HUEA 1ZC6A 5DG7A 4NZ0A 2ZGZA 4RUBA 4O8KA 4DV7J 4QIGA 2ZVSA 2N3OA 1OH8A 3ASMA 2OPPB 3FZBA 4FPIA 2IVYA 3ENVA 2HHSA 3H20A 1MSWD 1S6QA 5T7LB 2IRXA 5HVGA 4PKGA 3AA9A 4K4SA 5G0RA 2R8JA 3DJCA 2OHDA 1O5JA 2UXBK 1W97L 2IY5B 2C2EA 5GAEI 2AJ0A 2K8GA 4O3SA 3OYIA 2PN6A 5HL7L 2ETJA 3I5BA 5CD4A 4WPAA 2ZBCA 1URRA 4K8ZA 1HI0P 4CVNE 3LP0A 1ATSA 3R97A 4DFPA 2W40A 2LXIA 3QWPA 2DXDA 5F8LA 2XS7A 4P2MA 2A6AA 3IS9B 2NXEA 2ZBPA 2VQFJ 1GT8A 4NA1A 4FWOA 3M8PB 3NP5A 1G4CA 3CYMA 3DLLQ 1YVFA 3WNFA 3ETOA 2MY8A 5LMUF 2GGPA 3NFAA 3TUPA 4ZK7M 3J7AP 2XYPB 1SZ2A 5A6PA 3KK1B 4F4AA 1N36K 2XNRA 1HBNA 1UZHA 3OTOF 3KUHA 1WC1A 3TSQA 4OMFG 4BWMA 1WSGA 3NGYA 5F8NA 3QFHA 3GQCA 2NSBA 2BUNA 4PYAA 4IR9A 3K17A 3SQGA 1SVDA 1CJKA 5ETPA 1SPBP 4M5JA 3J7ZT 2G8FA 3BGOP 4QQBA 1KOOA 3BKUA 3NL0A 3L2RA 3H4BA 2JGUA 2M70A 3N6NA 2W8KA 1K6YA 2C3OA 3GSDA 4OZJA 4DUTA 3VPZA 1BCMA 1S76D 2V52B 2KT5A 4IG3A 4IQXA 2W9BB 4BQZA 1NJIO 4X4PA 5B8HA 2N7YA 1NRKA 4RNHA 2DGQA 5CYMB 4K4YA 1RTZA 5EY4A 2AP6A 1TYQA 4BY9C 1I3AA 1TKTA 1VISA 3NMAA 1IKYB 4LR9A 2V67A 5DDQC 3SAFA 3TWZA 4ID8A 2EKNA 2R7SA 1O1WA 4JD2A 4HH1A 4F36A 1D8YA 3ENAA 4RBTA 1EQYA 4ZVSB 1RU1A 4FWLA 2D0BA 2QX0A 3OQ2A 4IO8A 3HI9A 2O1PA 4NXNK 5F8MA 3VGKA 4UW2A 3LP1A 3ZZZA 4EO6A 4ID5B 2NNWA 2YHYA 2DGWA 3I55N 2VG7A 5J2QB 2B4JA 3KMSA 5FJ4A 4GKKJ 3Q2TC 2RN2A 2V2VA 2VDIA 2KTQA 5DQGA 4WKRA 3QPIA 4IO1A 3M2VA 1VHFA 4GW6A 5T7BA 5E0OA 3QBCA 1AXQA 4LFBK 3DI6B 4M5DB 3CEDA 3RR7A 4DV1K 3M7VA 2OGUA 2FVPA 3MFHA 4QIVA 2R2SA 1YVUA 2C2NA 3MMAA 1KQSR 5B09A 2QXFA 1QVFM 3LDPA 1BD6A 5HATA 1Q82T 1MMNA 2H3GX 4ILGB 4MIAA 1XC3A 1JX4A 2ZH7A 4CF0A 2DEIA 4P7TA 1LWEB 1C2PA 3KKSA 4ZS6A 3OV7A 1R31A 1TL1A 3MUVP 2JEFA 4DR4K 3LDSA 3IC1A 3KOAA 2YBVA 4K8XA 5KFMA 5J1PA 1QD1A 3P83D 3MTJA 5C25A 3H3NO 4KKOA 3K8VA 2GO8A 1WDDA 2XMAA 4KB0A 3IAM9 4B3RK 5DM6Q 2MLYA 1IKXA 2KVQE 5AQOA 3GYNA 1JLBB 4B1ZA 1OO0B 3OR2A 3V9SA 4ILMA 1T3NA 3SBGA 3D7EO 1VGYA 4CDIA 4K50A 2VFVA 1B92A 3O9RA 4FKYA 2WW4A 1U49A 3QNOA 4PG8A 2CQPA 4FM2A 2HGMA 1RTHB 3IM8A 4EFAC 1LW2B 1GAOA 2HRYA 3BZQA 2F8EX 2L9NA 2OPQA 5BRDA 1P9QC 4USVA 3FSXA 1VQKN 3HSZA 1P90A 5AFUA 4NLOA 1YVNA 3QZ7A 2DK2A 1RT3B 3UW1A 4P2SA 3ISND 4RBVA 2YH1A 3J80O 4C8MA 1Q86T 4KGXB 2BE9B 2PEHA 3UQSA 3D2FB 3ZC4A 4U8YA 1XMQK 5D77A 2VDHA 4G1QB 2V69A 3PW0A 3NVKA 4LSLA 3QYYA 2XMKA 4O4RA 1ZBFA 5IT4A 2MQOA 3DMJA 1S9EA 2OSQA 1MWZA 4DUYF 1Q5VA 2N3LA 1WOPA 4CERA 2OTJS 1YUWA 4J90A 4NLQA 4X4UA 1SKWA 2M7SA 2G2OA 5B0GA 4Q44A 3BN4A 4A5BA 3CTRA 5KQDA 1WORA 3KD1E 2MEWA 3M8WA 2X1BA 3M1FA 3ULEB 4EWTA 1V5IB 5AQSA 3ZZOA 3SI6A 2VKZG 2KH9A 3VGTA 2QV6A 4IH5A 3I9V9 2XHBA 1NZ8A 2EEYA 4LF4F 2KL8A 3DLEA 1HYZA 1CS4B 4DI6A 3RG6A 5J2PA 1VQMS 2G2YA 3DU6A 3DGPA 2XGQA 2IAJA 3OT9A 4DV4J 4WQ4A 2Q1NA 4ELTA 1B4SA 5D8HB 4WFZA 3G9CA 3A2FA 2ZBIA 1HQUB 5BR9A 1VK3A 3RW6A 1HW8A 1M90O 2HIYA 3SBTA 2GVDB 2XYHB 1WUAA 1X9JA 5AJ3F 1WG1A 3HL8A 2BRKA 4LIWA 4DPTA 2F8TA 4AXIA 1JWWA 4YR2A 4DTRA 3FMWA 5JLHA 2WOMA 1NOYA 2XMVA 3WXIA 3JSMB 2P9LA 4ENOA 2ZF5O 3KJNB 4GRSA 3A5MC 2WBMA 1EWRA 3MR7A 4JI8J 3MM6A 3KG0A 3M30B 4OJGA 3RBEA 1L3SA 1Y64A 2ZNZA 1KVBA 3GIJA 3G86A 2XMWA 4FS2A 1V3RA 2ZC3A 3OYFA 3OYCA 3T1HJ 5AXNA 4A8KA 3ISZA 2F1FA 2BR0A 3GZ7A 3ZYYX 2E88A 2X74A 5U47A 1FWKA 3PIOQ 4M5MA 3NGZA 5DGBA 4CZKA 1XC9A 4AQYJ 1A9NB 4DTSA 3EM1A 3KHRA 4CEDA 5KFEA 4CLWA 1S6OA 3LF0A 2C2MB 2YNHB 3CJ1A 3ZZTA 1I94K 4N8OA 2FB0A 2I1RA 1S9GA 5HAOA 1C1CA 3GV5B 2YKNA 1WSIA 1H73A 1X5PA 3H5SA 3TJAA 2NLXA 4DR6F 1VSJA 1UJ6A 1U0SA 5IS2A 2A18A 2AEFA 3RRKA 2AYMA 3D45A 2A6OA 1ZS6A 1NSKL 4JK7A 1C0MA 5A6WA 3W64A 4Y2IA 1SQKA 5ETOA 3DOMA 4ED4A 4JV5K 3QO9A 1HWUA 1RT6A 2W24A 3PLAA 3CCES 4FLWA 1HQEB 2CQBA 3KDNA 5KPZA 3E51A 3MPWA 3WX4A 1R43A 4OKKA 2KVIA 1VQ8S 2EWHA 1YHQN 1LAWA 3VQAA 3DXMA 5DDOC 2DRDA 4NRUA 4YORA 2E5LK 3KJQB 2XCAA 2MKYA 1VQ5N 3D0PA 1GXUA 5J2MA 4CLPA 1X5OA 2JNJA 4KR0B 2FBTA 3CJ2A 1FXDA 3HPOA 4CI0B 2CNOB 5AQVA 4BRPA 1R8BA 2DIVA 2QA4S 2I38A 3HZEA 2EK1A 2L9DA 3HP6A 1ZBSA 4ECRA 3VQQA 3P8BB 3CCLN 5LXYA 2ZM6K 1MMDA 1AW0A 2DNKA 3NS5A 4F3OA 4OO1J 3ZSRA 3IR6B 3E2EA 4NCGB 5HN0A 1S6UA 2HQCA 1N5TA 3N4WA 2FHKA 2BKPA 3ZZPA 4BVOA 1OYEA 3QICA 2YKMA 4OGCA 5E3QA 1HW9A 5MLCV 4NPOA 4ZPTR 3TR8A 3CT9A 1TV6A 1JNRB 4DSJA 1TL7B 2DO0A 4DTUA 2MQPA 3DOKB 5KFOA 5AQWA 1P9YA 4ZDNA 5GADP 4BR4A 5IXUA 1RBOB 5DG8A 1NKEA 2OMLA 2VWBA 2NUHA 1IH7A 4ZHRA 3PX0A 3HK2A 3MEGB 2HAFA 5TKYA 3EY1A 1SC4B 2DGTA 2EK6A 1UVNA 3V9ZA 3VA3A 5IWAJ 1O8BA 2MJUA 2WVDA 3CVKA 4KT0C 3NS7B 2KRBA 3S3NA 3MM9B 4YR3A 1RT7A 4KH0B 3ZEUB 3LA0A 4USTA 2VPYB 5KT3A 1U04A 1IBMF 5T14A 4Z2XA 4B3RF 5C24A 2ASJA 4A5AA 4CGGA 5F8HA 4UY8T 3L4QA 2CPIA 2VJUA 2UVRA 4DPOA 3Q7BA 3I33A 1R8AA 3OBIA 2DITA 4QW9A 3NF7A 3C8YA 3HI0A 1NUEA 1WI8A 2B6AA 3PJ9A 2MKIA 1SXLA 4O0NA 4BRDA 4QYZJ 3AAWB 3TQEA 4DX8H 5BRFA 3UCUP 3SDEA 1IR0A 4ZJLA 4DL5A 1F0XA 3TJ8A 5IC6B 3AD7C 5KFWA 2GQCA 5GAGI 2RIJA 2DRBA 3GIIA 1ZZFA 5EUHA 2KRRA 1RDUA 4KGKA 1FE0A 3IRXA 1KQKA 1JLCA 5KRTA 4DV6K 3ET6B 3EO3A 3TYTA 3OR1A 4MJKA 3LPEA 2MZJA 3FBBA 4Q7AA 1GLDG 2DGOA 3CDAA 1VOMA 2VG5B 4IG0A 3MECA 2HK3A 4JI6K 3MGJA 4A8SA 4DV3K 3HSTB 4I4BA 1XIQA 3OSPA 3N4PA 4MLEA 3G87A 2ZH4A 4YOEA 5HBMA 2R7OA 1R27B 1YJNN 2HQFA 5HJYA 3CJBA 4RW9A 4QCLA 4NA2A 4FLXA 4PG7A 1XQSC 3GYXB 4O44A 1Q78A 3EE8A 3V4IA 1X9SA 3DCAA 3TAMA 4OX9K 2DIUA 4DL7A 1N8RO 2CAJA 1YSJA 1BOTO 5HO4A 2MJNA 2I7PA 3H59A 2I6WA 1BHNA 1B70B 4I6YA 4DU8A 2DNMA 5KGXA 4JI4K 4W4MA 4A8FA 1LK5A 1PC4A 4N56A 1J5OB 1WN7A 3HX9A 3PYGA 4OX7A 1XR5A 3BV8A 4FLTA 3PM9A 5GMDA 4UQTA 1NGDA 3J7YI 1F3VA 4CEEA 2ZJRL 4DPUA 4DX6A 1H38A 2WTUA 4H0XB 1HR0J 4IZ9A 2IDEA 4B3SK 2QKKA 1PILA 2KW4A 3P31A 2VCPA 3J7ZO 4IKAA 2J6TA 1QHAA 2Q0RA 2GV9A 3ZSXA 3W1YC 1BI4A 1NKCA 1EX8A 4PAAA 3CERA 3LOUA 2P9NB 1HL6A 2XO6A 3PSIA 2JH3A 3AA3A 2P5GA 2GWJA 2ZUGA 1UW4A 3IFRA 3MDFA 4Z4EA 4YOXA 3OYBA 4I67A 1SJQA 1ELOA 4I0WA 4X62K 1Y3KA 4NLWA 1XK8A 2AWZA 3BDEA 1FJGK 1IQZA 2KO1A 3PSFA 1NJYA 3BO4A 4B3TK 1YJ9S 2J76E 2F8SA 1S0MA 4LBPA 3CC2S 5GVQA 3AOAA 3AHPA 1PIEA 5EHHA 4WP3A 1RE1B 1DFDA 1JLFA 2LU2A 4DV5J 2V7ZA 2CPXA 3FQLA 4R25A 4A46A 3S6EA 4M3WA 4KFBB 2FGOA 3JSBA 4DG1A 3ZT0A 1N34J 3MMCA 3OXLA 4PG5A 1W2BR 1RTIA 4DV7F 2QEXN 3G25A 3ITHB 4JS4A 4HL9A 3BY5A 1TMJA 3QT8A 2LECA 3GBTA 4C7QA 4KH4A 1FNOA 3WXLA 2QKBA 2Q36A 3H45C 4DCPB 3PIPL 3PKMA 1RILA 1EP4B 1TUVA 1FWPA 3W2VB 1T9VA 2UUAJ 2DGUA 3DFEA 3ZSQA 1BCOA 1T0TV 1XNRJ 3QEPA 3FEYB 1TL3A 4DX5A 3I82A 3ELHA 1U48A 1FERA 3RJMB 4M5LA 2YKPA 5KG2A 2QWOA 3MAHA 2LEBA 4DSEA 1CLQA 4CJWA 1S77D 4WP9A 3G71S 2VQFF 5FPDA 3KJFB 5L9XA 4NLBA 3I56S 4BG9A 1I5OB 1RWXB 4Z94A 4JV5F 2Q43A 4I2PA 4DSKA 4DUZJ 5H9FJ 1T03B 5B0EA 3C6UB 2D3ZA 5KG5A 3QAUA 1VSKA 4FOIA 4FNIA 4QWEA 5JMVA 3IDHA 2HVIA 4JAXA 1IM6A 2HVHA 2K1RB 3EJMA 2UP1A 1HWIA 5AQZA 3MM7B 2O8DA 2W25A 4CF8A 2VHGA 5GIPA 5KFSA 3AD8C 3GLJA 2D5RA 3CPWM 2WC9A 3SQ2A 1UP1A 1RT4B 1JKHA 1R0BG 4TYBA 3TR5A 4FXWA 2ZNYA 2J8AA 3FBCA 4KH5A 3NXZA 2LVWA 5AQTA 2ZHAA 4EYHB 1VFJA 1SH0A 4DU7A 4UZBA 3CSKA 9ATCB 4N41A 3W63A 1Q86O 5IQ6A 4FJNA 1JLQB 2NPIA 2WSEC 3A5NC 4J9OA 4BRHA 2ZJRQ 2CVEA 1HI8A 2A42A 3L4IA 4ED1A 3OTCA 1PKUA 3GIRA 3HJVA 3CXCM 1NB2A 1F5BA 1KLMB 3M8SA 1PC5A 2HS4A 4OZ5A 5F0WA 4HI1A 5GAEP 1YZ6A 3LDLA 4BC4A 3OBWA 4OI3A 4TYAA 4JV2A 3U9ZA 2P9PB 2PZSA 1F60B 1XNQK 1LV5A 2QYGA 4LRAA 1AA1B 4OYZA 2O8FB 3VVUA 3OYKA 1RHKB 3CJ3A 1XHZA 3LUYA 5KFUA 4DQPA 5ETVA 4CO4A 2BKNA 3DRYA 4K59A 1X8DA 2EC2A 4OPHA 4GKKF 1G3OA 1LW0A 1YRUA 2JWKA 1U2CA 2IVNA 4NLCA 1OJ4A 4HVZA 2CDRB 2ZWHA 4FPAA 2GUPA 3EDRB 5K20B 1SL0A 4PUOA 3KG1A 3CC4N 1H2VZ 1Q95G 1FFSB 1K8AO 4E89A 3AVAA 4CZLA 5FROA 1N0UA 2W01A 4FSVA 1OH6A 1FWLA 2Q66A 3CDBA 4BDYA 4IO9L 1ZM3A 4PZVA 4L8RB 1VQYA 2EHGA 2GMJA 2ZH6A 4CRJA 1JLGA 3QLHA 1S7IA 4NMLA 3MXJA 4DV6F 3MEEB 3O2IA 3QEXA 2P9SB 1IJEB 4ILHA 3M2UA 1CULA 1U6ZA 3BGLA 3AD9C 2Z8QA 1MWYA 4JI6F 5DETA 4DR5J 2EC0A 3GFZA 3CD6S 4F4YA 3JTOA 3KYLA 4ZN1A 1X4HA 1YAGA 1DBDA 3IG1A 1OPIA 3R6LB 5I42B 2J0SD 2HHHK 1DZ5A 3QMLA 4DWIA 1ZYQA 2XRIA 3RVCA 4CJPA 2Y3YA 2E20A 4X4SA 1VS3A 2E5LJ 3O08A 2AV5A 3NH0A 1WAJA 3B6OA 3WEEB 2UVWA 2YWEA 2ASOA 4DSLA 1FKOB 3KZBA 4Y34A 3SMZA 3B6PA 2XZWA 4RTFD 2UUCK 3LP0B 3QBXA 2ZD1A 5K8OA 4HR2A 4MDAA 4C3MA 2HYIB 4JI4F 2LEPA 4NEZA 2NUBA 4DFKA 3SUPA 4L72B 5L46A 2X6NA 3GE1A 4HTLA 3TVKA 1PJ5A 2WW8A 4ZVFA 1HUXA 2A6MA 2IM1A 2E1RA 4L74A 4FM1A 1IBLJ 2EW9A 2NRRA 3AQPA 1FD8A 1S79A 2LYVA 3TX8A 4BRGA 2CH5A 3VWSA 2JL9A 4NRTA 1ZA2B 4HDGA 4N76A 4RU2A 1RT2B 4WK1A 4Y2AA 1A5VA 3UKRA 1FJCA 4WYLA 2QWMA 4DR1F 4HTIA 3U4LA 1HBNB 2HGLA 1MG7A 2YNIB 3O6QA 4B3MK 3B6BA 3ZNJ1 3E8OA 3QT6A 4I69A 3JSRA 5JMNA 2VPWB 1URNA 3FLCO 4PRFA 1VMBA 1P8GA 2RF2A 3TAPA 3WXJA 4JP8A 1FRHA 2RT3A 2VF3A 3O9SA 3U1MA 3MX2A 4DQIA 1P27B 3D1OA 1PBAA 1QQNA 1LFPA 5EVZA 2B3TB 1X5TA 3WX8A 1RQ0A 1VSHA 4KPYA 4XK8C 5JVHL 5HROA 1JK9B 4IG3B 3TJ9A 1RBSA 3JAMU 2WUSA 3VN5A 5D4OA 3J7A1 1U2VA 1HKCA 1QSSA 4X4NA 4ZPBA 4EU0A 4N77A 3IFEA 3R3LA 4AM7A 2ILZA 4RNNA 3MUMP 1TKTB 3QJJA 4WYWA 2YQ1A 4CNYA 1S1WA 1REVA 2XMJA 1M5PC 3U3YA 1ATRA 3PY8A 2BACA 3MM5B 4JD2B 4DU4A 4DV4F 2V0NA 2W6KA 4JI7J 3KHLA 4F67A 2VONA 2Y8YA 1VQ7N 4WF9Q 2F8MA 3G8QA 4C1NI 1Q8KA 4P75A 2B5JA 2QL7B 2PFUA 3DWLA 3CD7A 2ABYA 2R8HA 4PQAA 3K59A 2VG7B 4MMOA 5FPEA 4F4KA 2GEMA 1KN6A 1RAEB 1RUSA 2ZDOA 4KV8A 2V4QA 4DV3J 2QWRA 2XBPA 3TPQA 4B9NA 3OXFA 1HRHA 4LH5A 1MMLA 3H8YA 1D9AA 2VG6A 2VH7A 5B0BA 1X5SA 1HD1A 4ED6A 5AE1A 2AGOA 2POKA 1XMOJ 3M8ZA 2ROEA 5KFRA 3CCUN 1RHQB 4MK9A 2HBZB 1VQPN 1RBLA 4C0OC 3OTDA 3M8RA 4JI8F 4JKEA 3I5CA 3SK3A 3S3MA 4UY8O 4PWDA 4HHJA 1HBMB 1Q8LA 1YJWN 4ID1A 3HTVA 4KHPJ 2FIUA 3T1HF 1FCAA 4BLGA 2KHOA 4CESA 5B0CA 1S3XA 4CJSA 1DURA 4ZLPA 1PYOB 3NCRA 3TVYA 4KKOB 4DFMA 1FKAF 4LRDA 4AQYF 2E5HA 2V6AA 1EIYB 4WQ5C 5A8KB 5IC4B 3ALYA 2RRBA 1N6QA 1DLOA 4CBWA 1MNEA 2ZBRA 3PCOB 3V6HA 1H2UX 3PEJA 3R27A 4J8FA 3L7PA 4JI5K 1FF2A 4BR7A 3L3UA 4F4ZA 4OZNA 1WOQA 4MIBA 1FJGJ 1WF2A 2OPQB 4L6V3 4PY5A 3BS9A 3I0RA 1CG2A 5KT2A 5CH7B 5JICA 1W7WA 3BBFA 5HP1A 3R8EA 1HPMA 1U1RA 4ZP9A 2VJVA 5D3GB 3D6MB 1LXNA 3HFZB 4HACA 3QB0A 5KRSA 1OY6A 1XNQF 1V9OA 4LF9J 3HHKA 4GMKA 3ZT2A 2AQ4A 4ECTA 5M1PA 4FBUA 3P6YC 3K57A 5SUHA 2H1YA 2BQRA 4FPBA 2BW2A 5DRKA 3M32A 4FJ8A 3UDLA 4K42A 1JXLA 2KB2A 4FM0A 2DGSA 4FJ5A 2LA4A 3VQSA 2YX6A 2QMUB 2QN6B 2E8AA 1NSAA 2V51B 1WDTA 3GPAA 3LM2A 2RB7A 1WSRA 1KNZA 4W5NA 3DRPA 2LDYA 1NMNA 4K7QA 4PCQA 3NLCA 5LJWA 1KONA 1UAXA 4H0OA 4LF5J 3CPWR 3U1NA 3EXCX 5HQ8A 1ZAWA 3DLEB 4CEOA 4M5NA 1G6BA 1N33J 4LSZB 3O4QA 1B7YB 4H5VA 1WC0A 1DGKN 2YV0X 2IAJB 3MPYA 3IN5A 1NBEB 4LF2A 2VQEK 1R0AB 2ZHBA 2JC1A 1YJUA 4FZVA 1D4XA 4M3YA 3AB4B 1BXNA 4X66K 3CMAN 3E1YA 4MO4A 1X4CA 4YB1P 2M88A 4H0TB 2P5VA 2XMUA 2R7UA 4ES3A 2PDAA 2GJIA 3MR3A 2HNYA 3PRVA 3T6BA 4HHHA 1X60A 3F44A 4WTOB 3UD4P 4ZPDA 4IEEA 2NQPA 3KNAA 5KFFA 4LQ3A 3KD5E 4E8UA 2UUCF 4DV2K 2RAQA 3HOTA 3UNYA 3CHWA 2HAIA 1UJ5A 2AHOB 1KAXA 2HQIA 3KJVA 4IJAA 2KXHA 1ASVA 3WQUA 3FSYA 1ITGA 2HHUA 3OS1A 1IUJA 3THYA 1XMBA 1HNZK 2AJ1A 2F7TA 3ZTOA 4CEQA 4ZCMA 5K8NA 5CYQB 5EGYA 3BREA 4LFCJ 3CCQN 4YOVA 1SV5B 2MY7A 5DM7L 2H4WB 1IKWA 2X6SA 2QFIA 1QZ6A 2VPXB 4QBUA 4JNEA 4FF2A 1UA1A 1UPPA 1VRUA 1S1VB 4MTPA 4XTTA 3VF0B 2RD5C 3R1HA 4M63C 4Q2MA 4B8AB 3AT1B 4FS1A 4ZKAA 2UU9J 4WFNL 4QPTA 1U1KA 3JQKA 2YWFA 3KK3A 2FZGB 2PA3A 3W3SA 2XI2A 3ID6A 3V2UC 4AFFA 4CLFA 3W0LA 1QE1B 1VRQC 2YNGB 4RU9A 1RHUB 1HHQA 2VA3A 4IR1A 4BRLA 1TAUA 4LQ9A 3OYAA 1WEXA 2IJNA 4BC9A 5GMEA 1VQ6N 1U8WA 2IM3A 1XR6A 3QO9B 2B9XA 1CBKA 3D6HB 1HPZB 1M5OC 2HBJA 2BQUA 3O3LA 4DS5A 1JQGA 2FJVA 2B8PA 2DNNA 3OFEA 4E0DA 5KTQA 5FD1A 3GJTB 4C2MA 1SJRA 1HNWK 1BUPA 3HVWA 5I3UB 3MCMA 2RHQB 1F2HA 5GAGP 3M6UA 1BA1A 2J0QD 5F8IA 2MSSA 1E4FT 3L2QA 3BZKA 3WQPA 4QIWD 1WBDA 3P5JA 5C5JA 3RB6A 2ZVIA 1T02A 2EI5A 5KFKA 2OD6A 4WE1B 4H0YB 2RILA 3VMFB 3MWTA 3U7JA 2MZSA 3VAFA 1YKWA 4R0JA 1G7CB 1RDAA 4DV5F 1NSQA 4GKJK 4DF4A 5DS7A 4LRFA 1IO2A 3GG4A 1S6PA 3MAAA 1ZBHA 5KT7A 2MHEA 2RKIA 3TNVA 4NLGA 1CLFA 2MDAA 1RI7A 2AEJA 3CJKA 3JXUA 3AAQA 3CCVN 3THPA 2OPRB 3R6MA 2QA1A 2DFEA 2WVCA 2FF6A 2FUG9 1DTQA 2BOAA 3FMBA 3ID8A 2VODA 3QEVA 5HI7A 3EDQB 1RT7B 4IH7A 4WZMA 3C15B 2J4RA 1BG3A 2M9KA 3CG7A 3PG9A 2AJQA 3MCSA 2MB0B 1LAVA 4ICLA 3DXKA 5C24B 3J7YP 2EKYA 3CC4S 3I9ZA 2E7WA 3N5BA 2J9DE 3D4JA 3VQ9A 5T41A 3SQ4A 4F2SA 1JIHA 2CG8A 2HIQA 1KQGB 1Q7YO 4M3XA 2R9LA 4EP5A 4CJLA 4K5RA 3FEXB 4DB3A 5J1EA 5KPTA 3SDEB 1BE4A 4F9OA 1RA6A 2DY4A 1ZM9A 2V2QA 3NS6A 3VQEA 1OPZA 3O5BA 2IPOB 4G3IA 5KFJA 2CRLA 1J53A 3I87A 5CD4H 2OEJA 1YRXA 1EJ7L 5C42A 4LF7K 3OUYA 1OMSA 2N82B 3CCWA 3VEWA 4CEFA 1T3VA 2W42A 1C1AA 4BWJA 1ZA1B 1ZETA 4BR5A 2GIFA 5DJBA 4DTJA 3SCXA 3MECB 3MPVA 4J2BA 1S5JA 2BM0A 3KHGA 5L38A 1A5XA 3GMGA 2W7AA 3T9ZA 2WVEA 2OFGX 4DR7J 2H54B 4AL5A 4OHZA 4HUFA 4O4GA 3CFOA 2QFJA 1J5EJ 5EU7A 3CC7N 4O44B 5F0UA 3THWA 3SCLE 4AILC 2QA4G 2D4WA 4FK2A 3H5XA 4OPJA 1X4DA 5KFZA 3OA9A 4TSXA 2KDOA 1HBOB 2XY5A 4CGHA 2CJ9A 4K2XA 1Q53A 4LVOP 3Q83A 4NI2A 2AW0A 3I4PA 4B9UA 3V6DA 5A2QY 4HUGA 4FJMA 4E98A 4BG8A 5M1QA 1HX1A 1FE4A 1MU2A 4Y65A 2P9UB 4N7TA 3JTPA 2UUBJ 3P3DA 4F3QA 2ZUAA 3JAMO 3R5CA 1C0TB 2XLIA 3HD2A 3EZWA 3FDSA 1VBXA 1BI4B 4UF4A 3ZSVA 4KRFA 2BUPA 2KXFA 3ZETA 1NO8A 2DHSA 1WB9A 2J9EA 2EBEA 4IOCL 2QTDA 3VESA 3SAGA 4FJHA 3GU0A 4Z7YA 4FDFA 1GLCG 3UO0A 3MCOA 1CZBA 1HARA 5D0EA 2BANB 3MM8A 2QWQA 2VC1A 2PIIA 5F9NA 3AA4A 5AQQA 3GV8B 1VI7A 4NE9C 2IOCA 5KT6A 2BMBA 1KD1T 3CJ5A 3UDEA 5DLGA 3KWIA 1TP7A 1YZ7A 1LWCA 3VVTA 3QGGA 1VHXA 4K2JA 1UA0A 4JKCA 1HLUA 1GFWB 2DHAA 2DHGA 1R7IA 3MF5A 1WHYA 4DG1B 1Q16B 4B9QA 4YB5A 3MMCB 3KFWX 1BMQB 2NXJA 2QLXA 3OXGA 2BQ3A 5E2QA 2XS2A 4MK8A 2JDJA 1CEZA 4TXSA 3L2VA 4IFVA 2F5GA 3K5OA 1SKRA 3H08A 4DR5F 5HMYA 4B08A 4PQUB 2ATLA 5DQHA 3BJYA 1LKZA 5IV3A 3MWBA 4CIGA 3MEDA 2GW8A 4FYYB 1YIJS 3LDNA 5AXKA 3BH7B 3O8WA 1RYRA 4JN4A 2N4CA 3P39A 1NLVA 3GTYX 4A4JA 1VCTA 3BP8A 4QS8A 3C6TA 2YHXA 3MD1A 2PEBA 3T9NA 2HHQA 1TL3B 4H4OA 1TQLA 4V19X 2NRZA 3G6EN 4UOFA 1T6CA 3N79A 4OI2A 2Z2ZA 3VQTA 1NWKA 4JKGB 1UL3A 3H1VX 5CCMA 3EUNA 1S99A 3HSCA 2EFPA 1V3SA 2R2RA 3WIUA 3T6JA 4IBNA 3PZPA 1KS2A 3THXB 3NGSA 1KTVA 3RB4A 3T1YK 1K1QA 3MWPA 2BKOA 2O67A 2YXLA 3M8YA 3EVOA 4U7BA 4OJRA 5LMNK 1IBLF 3SV3A 4WXOA 1YTYA 5ETRA 3H2UB 1U47A 3JS9A 3U02A 2OTLS 1R59O 1FXXA 4CM2A 2RHSB 3PJXA 2IM0A 4KHYA 1C1BA 2FBYA 2AZ1A 2O8DB 5AFUH 4CFDA 4LF8K 2CPZA 1GMWA 3RSEA 1JKHB 3VAHA 4BREA 1RAAB 1IXKA 1IM4A 3CJ8A 2JJ4D 3D9BA 1X4AA 2IHR1 3OTBA 2Y9HA 4DX7A 4AHCA 2CQ2A 4ZJOA 1A6LA 3S9HA 2L08A 2QXLA 2LKZA 1T9WA 3DLGA 4CYUB 3QIDA 3LM9A 2BJ7A 4J9UE 3AXMA 3OL6A 4KQZA 4FWMA 4NEYA 3TZYA 4A61A 2IGIA 1TKDA 4RNFA 4R8UB 3D6TB 1FK9B 2E7VA 1R8HA 4KB1A 4J9NA 2FTRA 4DV2J 1VQLN 2DXEA 3SYZA 3HFVA 5BR8K 4FZXC 2UXCK 4IOCQ 1JL1A 5EX0A 4Y1DA 2CA9A 1BU6O 4L3NA 1U1OA 1YI2N 4ZIVA 3VALA 2B0GA 1Q9YA 1RKIA 4B17A 3TO8A 2V7YA 3KLIB 3DRRA 1HBUA 4DV0J 3AA5X 2NZCA 5DK5A 3KLEB 5J1NA 1ICEB 4GV3A 1YX2A 5AZJA 4K0KF 2CNLB 2KLAA 3EGZA 5B0FA 3EZOA 2R4FA 3QNNA 3H7HB 5KG6A 2P9KA 4U95A 2VZ9A 3VA0A 4KIAA 3WDOA 7AT1B 4PUOB 1HKBA 1FO1A 1X4FA 3K5NA 1B64A 2F65A 5AT1B 2EFGA 4C97A 2VA2A 1XMOF 2G8VA 4V19S 3DLHA 4YHHK 4CO1A 3TQ1A 4X64F 2HNDB 1TFYA 2W2PP 4H4MA 5HLFB 1QAIA 2J9CA 2V5HG 3SEOA 3RTVA 5DZ7A 4WWSA 3WNGA 2K3KA 2HHVA 2M8DB 3OLBA 2W7OA 4AHTA 4WFAL 1GLEG 2MZTA 3A8EA 1TKXB 3BEXA 5TKWA 2CVIA 1HJRA 4A47A 4ZJQA 3X1LB 3LP2B 3BR8A 1RT5B 2NPFA 1LWFB 4CK2A 1RAJA 2O5DA 4H8KA 2E2NA 4BC5A 4DQSA 1N0VC 1HNWJ 4KBIA 3VOVA 5EWGA 2C2KB 1KLNA 3A1YG 4CJEA 1SL1A 2DGXA 4BC7A 1FDNA 4F8RA 2HZVA 5M1KA 2R7RA 2ZD1B 4ED8A 3IR5B 4JYAJ 1N52B 4C0BA 3IUCA 1I39A 3CJSA 1IJJA 3O6WA 4ED5A 1NZAA 3VGSA 4I2QA 4WK3A 3M9MB 2QO3A 4W90B 3CJ7A 1C4CA 3R1XA 2B7CB 3I0SA 4PXBA 1EZZB 3ZX0A 5GADI 4LF9F 3WNEA 2N4DA 3H40A 1GOBA 5KFDA 3K9KA 2FC8A 2I0XA 4JEPA 3SLCA 2EFVA 1UAWA 3HHLA 1VJQA 1OVQA 3GG1A 4NA3A 3RBDA 3W61A 1UVLA 5FDLB 5GINA 1K73T 4U7UK 1GEHA 2PYLA 3H0PA 1S5ZA 1NEEA 2H48B 1T05A 2OD4A 4EFHA 1EETB 4P52A 3VEOA 2XSJA 1ZBUA 3J81U 2D74B 2HFSA 4DJBA 3Q2SC 2RMLA 2FLOA 5L9NA 3WHIA 4USMA 1PGZA 1ZZNA 3SSSA 4IOBA 4Z4FA 1GLJO 2AYGA 2MGZA 3KLFA 2B7BB 3P5BP 3UDCA 2L3MA 2BJ3A 3M05A 3OTOK 1L3KA 2CQGA 1SB6A 4OLBA 2WK4A 1N33F 2RQ4A 4CLSA 4CO5A 5AQFA 3ZXWA 2AP1A 2FYXA 2F8HA 5LSRA 4AHUA 1MW7A 3CIPA 4KYZA 2FHJA 1VC5A 1SUQB 2ZJPL 3O9TA 4LF7J 1AZSA 1E6YB 5JVGL 4AL7A 3CB4A 1F21A 1H6KX 2IVPA 4F25A 2LMIA 3CF5Q 5EWFA 3NY0A 4XDCA 4CJKA 4V1Ak 4R0EA 2RE2A 2W4CA 5BREA 2CQ3A 4QU6A 4CO3A 3QJLA 2QI2A 1N32J 1Q7LB 4JI0F 2X1FA 1RGVA 1TR0A 5GAHI 1NH7A 4RBUA 4BBYA 5AQKA 4DPXA 5C12A 3BGRB 1D1UA 2KJWA 3HVAA 1WOOA 4IDKB 4WFAQ 1IBKJ 1ZXOA 2BXJA 2ITMA 1QVGR 1RABB 4FZZA 1PCAA 1AYEA 2ASYA 1CZAN 4PWWA 3MEKA 4A59A 4AH9A 4H5TA 1LOTB 3AVHA 4IRDA 4BVPA 2Z2YB 3SNNA 4WCEQ 3NG8A 4X65J 4RNMA 3DDIA 1BC6A 2IM2A 3D3CJ 4DPYA 2A10A 4CJ3A 3UKUA 2O8BB 1HNXJ 4DBQA 4BRIA 4OI4A 1Z05A 1FTRA 3I4HX 3ISNC 4Q2LA 5JXSA 4I6MA 1WBBA 1DY3A 5EXWA 4LRCA 1TUWA 1RZMA 4K25A 2UU9F 3AGRA 2Q6CA 3BSNA 3N0VA 2B51A 4CH0S 2CNNB 4TY8A 4EYIB 5LL6Z 3MCNA 3PKYA 3FBFA 4I64A 1NU4A 2VOOA 2ACMA 4L75A 4EP4A 4E7LA 4KH6A 1FX4A 1RT1A 3S3OA 1UPMB 3LPTA 3CMES 2QM1A 3ADAC 1WLJA 4LFAF 3F0NA 3CCMN 1WELA 3OS2A 4NLSA 2FHOB 2O66A 2CQCA 1FX2A 4QWBA 3TUZC 3ATVA 2RQMA 3L2UA 2UXCF 2FC9A 3O3FA 4BRNA 2NYIA 3GDQA 1S1UA 3PW5A 3B82A 4BRCA 1PAUB 4GV6A 2PI4A 2OPSA 1S0OA 4C8KA 3TW0A 2G1HA 2NRHA 5B0AA 3RGIA 2M0GB 3NGTA 3LPUA 1TKZA 2PMZD 1UWBA 5IM0A 2G0CA 1YITS 1EKSA 3QFUA 2BYCA 3K2YA 3NNCA 2EX3A 2W4PA 2QLJB 2V8DA 3IBCB 3FRYA 1RSCA 2MKJA 2GX8A 4FYXB 3MXHP 2DY1A 3PYEA 4G6VB 3DHXA 2IC3A 1MROB 4FNHA 4E7IA 2BE2A 3Q8QB 2GHWA 4YHHF 3MN6A 1FFGB 2GJ2A 5D4PA 2XHWA 4CTAA 1MN9A 1HNIB 2DNLA 4DUYK 5DZ6A 2OPPA 1XHXA 3IO1A 2KFYA 2W9CB 1EO1A 4H4KC 5AE3A 4YEAA 1RXOB 4NXMK 4YN3B 5T7LA 4YUDA 1Y5IB 3CJ9A 4OGEA 2ZE2B 1V6HA 1HMVB 3T7ZA 2CPYA 3NOGA 3RRHA 3BUZB 2F96A 4DZDA 1SS6A 3PYDA 1AFJA 4PEOA 2PAVA 3RRGA 4OLAA 2F7VA 4N47A 1KFSA 3CJRA 3CCSN 4OV6A 1I3OB 1H7XA 1KAZA 1UTAA 1XERA 5EOYA 3IS9A 2DPJA 2VKRA 1VQOS 1KRPA 3AY0A 1WSJA 4YOWA 3OSNA 4ED2A 3BO2A 4E1NA 4TN2A 5ETTA 1NGCA 4CZJA 4BR2A 4CLLA 5CABA 4FWKA 3THYB 1S9FA 5LSLA 3Q8RB 3HHNB 2PI5A 4X4TA 2FSJA 3KK1A 3KWMA 3QEWA 1T6DA 3T19A 4I7FA 3C94A 3GG0A 4P72A 3W9JA 2ZJQQ 4LF6K 3MMBA 1BHLA 4RWXA 4KHNA 5AJ3K 3GR1A 2X1GA 4DR7F 3FVYA 2ZWPA 3BGUA 4MQ3A 3C16B 3TABA 1J5EF 3HPHA 2MKSA 1YT3A 4KHMA 4YMEA 1VQ4N 4QS9A 2WTFA 5C10A 1Y5NB 1C0FA 1NJXA 2AGQA 2IBKA 1HYSB 2QSWA 1JL2A 3E9LA 2BJ8A 3DOLB 2BOPA 1U6BA 3GIKA 5HVHA 3W7BA 4DR3F 2CQHA 3CETA 2BVZA 1YBUA 1NGHA 5CYMA 2FSNA 2V2ZA 3P45B 2XGPA 3SPZA 4NMXA 2IVFB 4TKTA 3DN9A 1IKYA 2ITGA 4Z7CA 1P1TA 4JI1J 1F1BB 2IIHA 1XI1A 3R7SB 1N54B 1NGJA 2DCUB 2ZH9A 3EL2A 4MFBA 3OL9A 2OLWA 1BUXA 1ZBTA 4A8WA 2F9DA 1ZAVA 3VTIA 5F8GA 4ID5A 4ECUA 3AVIA 2C28A 2FZKB 2JVRA 1QY7A 4AYBD 5J2QA 2V63A 2KQ2A 3OYGA 2W2MP 4DR6K 1VQNN 4QOTA 2GWKA 3HZ6A 1YBTA 5HOOA 4LIRA 1DJ0A 1WTBA 2HNZB 6FDRA 1ZM4A 2V34A 4FLZA 1I51B 3D0GE 3DI6A 3DLKB 4M5DA 1RACB 4J9KA 3OW2R 3CIZA 5KFPA 5JS1A 5CXTA 3GL1A 1Q5YA 2ZH8A 5D0GA 3ZSZA 3EWGA 4JK8A 1S4FA 3VCDA 2OSRA 3OD2A 2ATQA 3C0BA 3E01A 2Y0BB 4B1YB 1D8ZA 4FW1A 4M94A 2DFHA 3CULA 2JWNA 2RDJA 3ILIA 2M3DA 3DDNA 4ES1A 2XZTB 5GADU 3P38A 2BM1A 4YY3J 2G8UA 3N5FA 1RLDA 3NAHA 4E7JA 4IYQA 4FJ9A 4JB8B 2Q6BA 2HVDA 2P9IB 2DJWA 4IOAL 4P7VA 5E3RA 1QAXA 3BQ2A 3Q0AA 1JJ2M 2IA6A 4ED3A 3DYAB 2NRTA 5JLFA 1RAHB 2V2KA 1PJ6A 5CAAA 2D9PA 1RTHA 1LW2A 4XO0A 4DU3A 4I6AA 3FZ2A 3VQPA 5A76A 2MZ1A 1GXTA 2YJEA 2DNHA 1WG5A 5A8WB 2R8GA 2VFRA 5KG0A 5SWMA 3UE5A 3L0QA 3M9NB 4A8YA 4DEZA 4RW6A 3OYJA 1RT3A 2AJ4A 2XWXA 2OKQA 2GNKA 5HL7Q 2OCEA 5LMUJ 1IBMK 4C3KA 1FTCA 3D2FA 3FK4A 1C0UB 3G82A 1J54A 3PXGa 3G4SS 1E6VB 2XLKA 4E3SA 5EN1A 1MWMA 2X51A 3W9IA 2CJXB 2ZHOA 5IT9Y 4YDUC 2G8IA 1C4AA 4EAHD 3EVWA 1FKPB 4KHSA 3SSRA 3QATA 3PYFA 4GVMA 4CZHA 4H03B 4FOEA 1T44A 4ETZA 3C95A 4GC6A 4JI3J 2VU5A 1YG0A 1QZ5A 4DR2J 3THWB 3CUNA 1CC8A 4DS4A 2F4VJ 4CZCA 3BH6B 3BYRA 1FEEA 3RBXA 2K7KA 2FJEB 2IDLA 1GMWD 2YKOA 1WUUA 5KT5A 2NZTA 1CS4A 3M1VB 2DT9A 3CW2C 1HWKA 4NZ6A 3EX7B 1U45A 4EUVA 3FGUA 1K73O 2IA0A 3H46O 5F3ZA 4XH1A 3OHRA 1O6XA 2W1BA 2X7IA 1CJUB 1W2BM 4CJQA 4DL3A 3UN5A 4NXMF 1SIWB 1HQUA 5KOXA 3DRSB 4ZITA 1NK5A 1M5SA 4ZLNA 4DV0F 3QGHA 3LP3A 3C2PA 1N5YB 5KFHA 2DYAA 1GTEA 3ZETB 4BROA 1Y7PA 2GVDA 2D1KA 4KTZA 4XPEA 1KFDA 4ILLA 4CM0A 2Q31A 5H9EJ 4MDBA 1Z6RA 4FJJA 1VQ9N 2V8VA 2YX4A 5CHIA 3JYTA 3UCZP 4BC3A 1KWMA 2K2PA 4BDZA 4DL6A 1T11A 4QYRA 3NBPB 6AT1B 1M5KC 3W5XA 4F26A 5CZ1A 3JSMA 1HNVA 4C1NK 3F56A 2UXDJ 4ZMMA 4LF1A 1K8KA 1U2FA 2JX2A 4PXEA 2HWHA 3VHQA 4ELUA 4BDPA 1IV0A 2HURA 2IRUA 1YJRA 3C65A 1KC8O 4B1XB 5I9EB 4CGDA 1H7WA 4OYPA 4U67L 2FY8A 4EZ9A 3CM5A 4LF6F 3OS0A 1HIYA 3IAYA 2V94A 2DEJA 4QZVB 2QLFB 2R42A 2F9WA 2GMHA 3MD3A 2Z56B 2R8IA 4S0MA 1CJVA 4YDXA 3SQ0A 3NGUA 1OQ6A 1WC6A 2OJ3A 4WBFA 4OFZA 3IRWP 2KKZA 3L6QA 2DR6A 3TAFA 2YNHA 4CT8A 2XG8A 3GR0A 4U7CA 5DO2A 3SCJE 3VAMA 3CJQA 1GMUA 3VEZA 4NYNA 4C48A 1FFWB 5KT4A 3QGPA 2HMIB 2V9KA 1VRTB 3FR0A 3V6JA 5K14A 1CJTB 3ATUA 4OZ2A 1NM1A 4DSFA 3T1AA 3UD3P 1RKJA 4JYAF 3O1LA 2HOEA 2VD3A 4DV7K 1RWOB 3H6EA 4DTPA 1RDRA 2Q0UA 5CA5A 2PMWA 4ZOSA 1OQ3A 2F9TA 3QMQA 4JI2J 4RLEA 4MKYA 5F41A 3U27A 3WNHA 4GVLA 2JRSA 2DPIA 1W2IA 2JZ5A 3P4IA 4UTGA 4BS2A 3FBEA 2FZCB 2EXUA 2YY3A 3E3XA 4FF1A 4EK2A 4Y0FA 2H5JB 2OMOA 4EHUA 1XR7A 5E5NA 4TVAB 4Y2MA 1NJIT 3AJDA 4PYDA 2MHNA 3CQ8A 1S48A 1NGBA 3NE6A 2KHDA 2OA8A 2DNZA 3CWJA 4XDDA 4N5SA 4CHPA 3VAIA 2IJRA 6FD1A 2D0AA 1Y9OA 1VHIA 1YRTA 2ZOGA 4ZPWR 3PW4A 2HFUA 2VQFK 3RU0A 1TTHB 1U1NA 1IKVA 3AVFA 3KLGA 4FWPA 5ETLA 2WONB 3DLGB 4A2BA 2OUGA 1TL7A 3HHLD 1S97A 2GIRA 3D6FB 3NNAA 3QAEA 2YKQA 4KJIA 2DPNA 3DXSX 3A12A 3ZZ0A 4LF4J 4DKWA 3DGVA 3PNIA 1HKGA 1NNDA 1TUGB 2D0PA 1XN9A 1WHVA 3P96A 3MPUB 3MM9A 3VZHA 3SCKE 3ZEUA 3US5A 3VAJA 4LT6A 2DGVA 2EPIA 3R5AA 3AVCA 3KK2A 2YWHA 1A7GE 3BYPA 3VQ5A 4ZP7A 3S01A 1HBUB 1FDAA 2GV1A 4O3PA 3G8SA 1BWFO 1WSHA 1LXJA 3HF5A 2G9OA 5GAEU 5ADXA 1MA9B 3BO3A 1WC5A 3GIMA 1OH7A 2UXBJ 1IWGA 3HVTA 3JXOA 3GJSB 3K0SA 3AOCA 4PXDA 4OYAA 3VGLA 2GAHC 1NPRA 2J7UA 1QHTA 5KG3A 3THVA 2FHJD 3OTEA 1NPPA 1U02A 2FD2A 3J81Y 1L3TA 1S72S 2VUGA 5FLXY 2FJAB 4KRWA 4WFXA 2QSFA 1RWNB 3DDKA 4C23A 1GOCA 4KGVB 2CGLA 3GCWP 1JJHA 3M8QA 2AKWB 3BBCA 3ET6A 3AXKA 1UJ4A 3AO4A 3PEHA 4I6WA 1RNHA 4ISFA 3TAQA 4WFBL 1TL4A 3ZX3A 3NGDA 2LA6A 2C3PA 4GKKK 2VG5A 1UETA 1N36J 4OJ1A 4X65F 2O01C 2RE1A 4MYUA 2MQ8A 1NGGA 3KLHB 1NK9A 4OPAA 5HRSA 1HNXF 4FN5A 2GBZA 1FXRA 1DTTB 1X4BA 4ED7A 4P9SA 2I7NA 3JB9k 3LL3A 2G8WA 2C3MA 3L3CA 4U96A 5BJRA 5AZIB 2KHCA 5HANA 2NR0A 3ULHA 4KAZA 2BV3A 2E2OA 1JCFA 3RR8A 1X4GA 4OHWA 2OTJN 1H74A 1IBCB 4GVEA 2CQ4A 2L9WA 5LOQA 4M3UA 2I9SA 4RPFA 3LDQA 3Q22A 4K5SA 3VGUA 2QZ8A 4Q8EA 2CJQA 1RWWB 4EGLA 1UFWA 4I2QB 2IRYA 3C66A 4LSNB 2O8EB 1K47A 2EFNA 3V6KA 3IWNC 4H0VB 1JJ2R 1BGXT 3RMDA 2NXCA 2FVCA 4NXNJ 4QR1A 5GAHP 1JLAB 2BJ1A 1VQMN 4KBOA 3SV4A 1NXIA 2H51B 1NGEA 4PABA 4WU2A 3CE8A 4CEBA 2RQKA 1XUPO 4FKXA 4ECZA 1WF1A 1CQMA 1O0PA 3O9QA 3FCHA 4HCBA 1AUSL 4ECSA 3ENOA 1T9UA 4P2FA 1U0HB 2WZ1A 3BGFA 1RWVB 3HHEA 4LFBJ 2RS8A 1RJJA 4ECYA 2DB1A 2RJZA 4L3QA 4DV1J 4ISEA 3CMQA 3MTKA 1BQMB 4TNOA 1ZPVA 1WKJA 4YQWA 2HWIA 1YXQA 4ECVA 4AUKA 4DR1K 3LGNA 4WQ4C 3J7Z5 1AFIA 3EICA 3K0JA 2BRLA 4DR4J 1NDPA 4LUBA 2XC9A 2ZOMA 2YHWA 1XWLA 2ZH1A 2HWTA 2FVRA 4LR7A 5F3TA 4ANCA 4B3RJ 1R3NA 1LK7A 1EP4A 2HHPA 3E9OA 3W2VA 2KT2A 2HFZA 3FFIA 4Z4CA 3BF1A 4CZEA 4RW8B 5M1FA 4PKDB 2LQ8A 1KVCA 3FZFA 1S10A 2DNRA 3CCZA 3MOJB 3UNGC 1ZTWA 2GMLA 2VFSA 1A5WA 3IBWA 3AVNA 3C7NB 3ENHA 1OH5A 3BKFA 3EGWB 3R6GB 4URSA 3POTB 3O3HA 3HO1A 2ZKTA 3OVBA 2KU7A 3IAS9 2LCWA 2XQCA 4DQ8A 3MFIA 1S1TB 3I55S 4KTWA 4DV4K 4KI4A 3H90A 4E1MA 2Q1LA 1T03A 3HCXA 3NOCA 3A4TA 3C6UA 4Z37A 3A13A 4QAGA 2YNFB 2JEGA 2HBYB 3BEGB 3TTCA 2ZC4A 1EX4A 1VAZA 4OL8A 3K5LA 2ZKUA 1ZTTA 4WU3A 2BA9A 1AT1B 2K1RA 2WFBA 1RDCA 3FFKB 4NLVA 5AQRA 4CW7B 3ENQA 1KEKA 1KXPA 3MM7A 3MN5A 3MR5A 3JQJA 2BZ2A 5AQJA 1XMQJ 1NK6A 3CCEN 4FVUA 4FXVA 3DLLL 4LRBA 2DNQA 1EQ0A 3UKUB 4M41A 2R2TA 1VSEA 1Q82O 4Q43A 4F50A 1VQ8N 2NXUA 3L95X 1IVZA 2NRVA 3K9JA 4I6MB 4CE9A 1S7HA 4NOHA 5A2QU 2O8CB 3D2WA 4YR0A 5M1OA 1B3TA 1NK4A 4B9LA 1S22A 4QJVA 3O1BA 3WC0A 3CDWA 4HH0A 3HHDA 1PBUA 1JLQA 2QA4N 1V4TA 3LPYA 4DL0C 2CJYB 3KVGA 1IN0A 2F40A 2K3IA 1RGIA 2ZEJA 1B9FA 4A8OA 4M5KA 2QE5A 3MI7X 4JI8K 5K8MA 1ZBLA 1EQMA 2R3VA 2G1DA 4PG6A 1J6ZA 1KLMA 5H1SQ 1BDGA 3H5YA 1RT1B 3V81A 4RX6A 3T1HK 2IYIA 2P5OA 2KI2A 2J6SA 3G6YA 2ALYB 4JI1F 4G9ZA 3MCAB 3TEGA 2AYBA 4AQYK 2PGCA 1U1PA 1Q1KA 2NXNA 5LM7E 3SUNA 3UCGA 3D2EA 2O8FA 4QPXA 1T3OA 3F9KA 1RFQA 4ZLJA 2QWLA 2DNGA 3VTHA 3WC2A 4HCCA 1KBRA 3FUYA 3QJPA 4DL4A 3A8YA 3IMXA 1PO6A 3DXBA 4ELVA 1FJ7A 1VQKS 2YQ3A 1V4SA 1A0OB 5ITHA 1C0GA 2FSKA 1SKUB 4J9MA 5C2GA 4ISGA 2HB5A 3Q23A 1G2EA 1RHMB 1Y10A 4CHNA 1RDBA 4GNIA 2WBNA 1QS4A 4J2AA 1JLEB 3H5UA 4ZVHA 1KP6A 2P6SA 1OY8A 1UW9A 4CK1A 2G2ZA 4RR5A 4ECXA 1GLFO 3SPYA 1RTJA 4CD1A 1NGAA 3AVLA 2Q97A 1MWKA 3OYMA 1KVJA 3FKBA 4NYZA 3AJ1A 1EXQA 3ZT1A 2I5JA 4ER8A 5ETQA 4NB4A 3LZIA 1KTQA 2OAUA 1NB7A 2FY1A 2HEKA 3PHTA 3K7RA 3MEEA 3A5OC 2NRWA 3AO5A 1B0PA 4KO0B 2DR9A 1X9WA 1RCXB 3N9UC 2P9SA 4I56A 3DM2B 1UFKA 2LXFA 4NYOA 4RW7A 3TUIC 1IG8A 2W2OP 4HI2A 2Y1LB 4LVNP 3CNQP 4WJBA 4YY3F 3VR1A 1W26A 1DQ8A 4EO8A 2DRAA 3Q8VA 5I42A 3F73A 1VQ9S 4XIUA 4IOXA 4ZPVR 1TVRA 4ZVTB 3I5AA 3M2RB 5I3PA 2WVFA 1VSIA 1OSDA 4DMZA 2ZWOA 3O5TB 2VICA 1YDLA 3NDKA 4RWTA 1F9EB 1SL2A 4CF9A 3TTDA 1I94J 3WEEA 2OEKA 2JEIA 4C11B 3BDPA 1FKOA 3QERA 4LMZA 3OYNA 4FYDA 5DM6L 1X3NA 2B43A 1Q8IA 3W9HA 1VIOA 3BSCA 5IWAK 3KWGA 3PIPQ 3LDOA 3AFGA 2GFFA 1YBAA 3IGNA 1NKBA 4JV5J 5AQIA 1KR4A 1N8RT 1B0TA 3PUFA 4ZP8A 2KYZA 1S6QB 4PXCA 1QAYA 1RT2A 3C14A 4EBDA 2G0JA 5G0RB 4CCHA 4MK7A 2MYFA 3OYDA 4OX8A 3L9ZA 4KTQA 4I7FB 1GLAG 4JOUA 3T5LA 3OYHA 2HHXA 3W5YA 1RDDA 3OBYA 5KFTA 3MMBB 2YNIA 2G4BA 1Y97A 4M95A 3WIVA 2AGPA 3TTFA 2I8EA 4QYZK 2ACYA 3LZJA 2ZM6J 4G1IA 1Y5LB 1BLUA 2WHOA 4LH4A 4R79A 2YCHA 2F63A 4JI3F 3MN9A 4DR2F 4HHTA 3Q8PB 2GX9A 4F0KA 2P9EA 2YWKA 4AL6A 2NYHA 1EKRA 1X0PA 3ONQA 4HKQA 1J27A 4M5HA 2F4VF 3R2DJ 1M1KT 2AA4A 2FPHX 3QIOA 1X4EA 3GB0A 1Y11A 2JOQA 3HVRA 2GGPB 3CFPA 1YJ9N 3O80A 1QUVA 2JLEA 1UVJA 2EFQA 4CQ1A 3CC2N 1VYAA 1TZ0A 2NUUG 3K8WA 1D5AA 4CLYA 3MHYA 4EIAA 1G99A 4H5NA 2V8GA 3U3GA 4CGIA 1RAGB 1HD0A 3M9OB 4Q0BA 3MM5A 3PVXA 4MKAA 2R8KA 1FVSA 4IQMA 2KFNA 1JCEA 5F1XA 2E1YA 4MFBB 5D6GA 3EPIA 2DISA 3SQGB 3GP9A 4CFAA 1CJKB 3HSDA 5HK4A 4H54A 2DXFA 2B56A 3PTWA 3D0HE 3OY9A 2E44A 2GA7A 3ILJA 3D0IE 5BXIA 4HTJA 4FVMA 4PL7A 4K4VA 3IWXA 2LQJA 4BGAA 4LJMA 3QSIA 1NG9A 5HVFA 2RNEA 1YHQS 1TYQB 3Q8YA 2CPEA 5GAGU 3O4WA 4NL5A 2L41A 1EAYC 2HKEA 4OYMA 4OI1A 1HR0K 1VQ5S 4ITSA 1XEZA 2W9AA 5IZHA 2ZH3A 3JSYA 2UXDF 1KVKA 3CCLS 4M5GA 4KC5A 1HBMA 4O3RA 1X0FA 4WTYA 1Q81T 3G71N 4MH8A 1WHWA 3LP1B 2HK2A 2DBBA 4DV6J 3I56N 2ZH2A 3E01B 2B9YA 1LNQA 3U8XA 1M0SA 3SQ1A 2D9OA 3ZCMA 3OVAA 2EG2A 2UV8A 3GWCA 4O5BA 4JI6J 2CDQA 1Y00A 3QRRA 3CJ4A 4IO9Q 3FNNA 3M2VB 2XSFA 4EBEA 2VV5A 5A8KA 3O1WA 3ZTPA 3SZ2A 3ZTSA 3PFOA 5ETKA 3I96A 4V19J 3AVMA 4OX9J 1RWMB 4USIA 3T5JA 5G4DA 5AXLA 3QIPA 2MPUA 4YOUA 3PIOL 1F6TA 4DV5K 2Z2MA 1IWAA 3MMAB 4DHVA 1SJ4P 2CPHA 2DVIA 1N34K 3VQ4A