3LPTA

Hiv integrase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
142
Chain Sequence
DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rational design of small-molecule inhibitors of the LEDGF/p75-integrase interaction and HIV replication.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Integrase
total genus 45
structure length 142
sequence length 155
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lptA00
1BI4B 4B3OA 1TV6A 3LAKA 5JS1A 3NGYA 4QCLA 4CJWA 3SUPA 4M3WA 3C94A 3MEDA 2XY5A 1QS4A 2RN2A 4J2AA 3O4QA 3ITHA 2BE2A 3OS1A 3PV8A 1QHTA 4FJ9A 5DK5A 3QERA 4Z4CA 1ZBIA 4JLHA 1S1UA 4HTUA 4J2BA 4O4GA 3H08A 1EX4A 3ZT0A 1I3AA 3SJJA 1NJYA 4PQUA 3IS9A 4OJRA 2KZMA 3TARA 3OJSA 3PX6A 1CZ9A 2O4GA 1ASVA 1UA1A 3C6TA 5KGWA 4C8KA 2HHWA 3O4NA 3NF6A 3S9HA 4OLAA 4ELVA 2HNDA 1IKVA 3CFPA 1BL3A 3LZIA 1D8YA 3E01A 1TVRA 4IFVA 4Q5VA 4IDKA 3LWLA 4EZ6A 4DFPA 2G8IA 3HVRA 5CYQA 3NH0A 4DU1A 1RT2A 4KB1A 3SPYA 2QKBA 1S6PA 1Q9XA 2E6MA 2OPSA 5E41A 3OVNA 4O5BA 2XY7A 1R0AA 2KFZA 1TKTA 3KLGA 4LH4A 3ZSRA 4CJ4A 1NKCA 3S3MA 2ATQA 2Z1HA 4FZYA 1NKBA 3OS0A 5SWMA 4CECA 4KRFA 4CEDA 1IO2A 3ISNC 1X9WA 4RW4A 3RRHA 1U04A 5D3GA 1TGOA 4L8RB 3OYAA 3SQ0A 4KTZA 1U4BA 4BDZA 4N5SA 1NJXA 3HK2A 4CGHA 3AVHA 2DFFA 4DFMA 1SL2A 1SL0A 3MECA 1VSJA 4CE9A 5SZTA 3MXIA 1L3TA 1JXBA 4JRPA 4FJ7A 4PUOA 2X6NA 4CJLA 4YNQA 1JLEA 2I5JA 1GOBA 4RW9A 3VQ6A 5K14A 2Z1IA 1GOAA 3G0ZA 3QINA 1DTTA 1IKXA 3CYMA 1IKWA 4LSNA 1C1BA 4E3SA 1FK9A 3TAEA 1TKZA 3AVNA 5CZ1A 1SKWA 1QTMA 4FM1A 3HP9A 5DMRA 1LAVA 4CJEA 1VSMA 4E7JA 3V9ZA 4B9UA 2IGIA 3HYFA 4B9SA 4DSLA 2YNHA 3NH2A 3TAMA 3DLBA 2XY6A 3I0SA 4CCHA 2VG6A 1LAWA 2Z1JA 2OPQA 5KRSA 4CF1A 3RR7A 4FLWA 1RT4A 4NCAA 4DU3A 2VWJA 5J2QA 1ZBHA 4KHQA 3AO3A 4DWIA 3NDKA 3AA5X 5EU7A 2XHBA 1RT6A 3RRGA 1VRUA 1JL2A 4FJNA 2IC3A 3BGRA 4H4OA 3EZ5A 3V81A 3TAFA 3K59A 4KREA 4EZ9A 4J2EA 4F3OA 5KRTA 1HNVA 3DLKA 3F9KA 3OYFA 2HW3A 3EYZA 3RMDA 3AV9A 3CM6A 4RW6A 4CFDA 3OYMA 1KLNA 3LP0A 1JLAA 3LAMA 3QO9A 2B4JA 3LP3A 3DM2A 4Z0UA 1NK8A 3OYCA 4KO0A 1WLJA 1ZYQA 5C24A 3T3FA 3QNNA 3V9UA 4FYDA 2VG7A 4DQQA 1RT7A 4ELTA 1RBVA 1DLOA 4BDPA 2YNGA 3QEPA 4CIEA 4M3XA 4KAZA 1G15A 2X78A 5C42A 4MQ3A 4DTSA 5J2MA 3ZT4A 1I39A 3KLFA 1BQMA 4DTMA 5I42A 4DQRA 1BCOA 1NK7A 3LPUA 4Y1CA 2YNIA 4QOZB 1VSIA 3AO2A 3KTQA 4I9QA 4O0JA 5FROA 3NGZA 3QESA 3K5LA 3VQDA 4E0DA 2YNFA 4RW7A 1TL3A 3MXJA 1WNSA 1X9MA 2HVIA 3HT3A 3ZSVA 3OY9A 4IFYA 4B08A 3OYIA 3ASMA 3IG1A 3HM9A 1W9HA 1NK5A 3RR8A 2KZZA 2NUBA 5CZ2A 2BANA 3OYGA 3LDSA 4AH9A 4CJ5A 3VN5A 1C6VA 5I3UA 3KD1E 1RDDA 1REVA 4GW6A 4Z4GA 4J2DA 3V6DA 4KV8A 4PWDA 2D0AA 3QLHA 4M3YA 1L3UA 4BE2A 3HPOA 1U49A 1VSEA 1WSJA 3HPHA 1Y97A 2FBYA 4CHPA 4KB0A 4FJLA 3P1GA 2Q3SA 3VQ9A 3DRPA 4B8AB 2XY8A 4F4KA 5HBMA 4IG3A 4CHQA 3ZSYA 4KPYA 4FCYA 2P1JA 2WOMA 4DTXA 4FXDA 4CJSA 4I9LA 5CYMA 1BI4A 1FKOA 1YTUA 4I2PA 3AVKA 4W5TA 3NGIA 2IDOA 3CFRA 3A2FA 4DSKA 4N47A 1HYVA 1HJRA 3L8BA 1IH7A 4B9NA 2OYQA 3AA3A 3DMJA 3FFIA 1SKRA 2G8VA 1KSPA 4H4MA 1QSYA 1TK8A 4BACA 1RDBA 2FBVA 1WSGA 2HVHA 3ZSOA 3VQEA 3MXMA 1NK6A 3AVAA 3RTVA 3IRXA 4DTNA 4FJJA 4FJKA 2D0CA 4DFKA 3TI0A 1L5UA 3OYJA 4LY7A 4N76A 4M42A 1KFDA 3NF7A 4IG0A 4AHVA 4HHTA 4FK4A 1EXQA 4FLZA 1UA0A 3HXMA 3G10A 4CEQA 1J54A 1BISA 4FW2A 3V4IA 4EP5A 2BGGA 4DSFA 3UIQA 3L2RA 3KK1A 3OJUA 2PZSA 1ITGA 1FXXA 2P5GA 4CJKA 4KHUA 3LP2A 4OPJA 2ZQBA 1MU2A 1W0HA 1A5WA 2RKIA 1JLFA 3SUOA 4DS4A 4FK0A 3SV4A 4DMNA 4KHYA 4B9TA 4DQSA 4E1MA 1J5OA 3KJVA 1S5JA 4DTPA 3AVFA 4B9MA 1HYSA 4BWMA 4FJ8A 4CK3A 3C6UA 1TKXA 1BGXT 3D45A 4LH5A 4BE1A 4CEOA 1N5YA 4CF0A 1SKSA 2G8UA 1RCHA 3AO4A 3VQ4A 4DTUA 5J2PA 3KLHA 4CJRA 3AVJA 1WSFA 3SZ2A 1QQCA 4CJUA 4CGDA 4DF8A 2A1RA 1KTQA 1HPZA 1C0TA 4I2QA 3B6OA 3NCIA 4NCBA 1JLQA 1RNHA 3AVLA 4AHSA 4OKKA 1T8EA 1LV5A 4C8OA 4Z4IA 2QKKA 4AILC 4BDYA 1S1VA 1D9FA 4B9LA 4FZXC 4CGJA 1TL1A 1XWLA 3I0RA 1U47A 5HRRA 2X74A 3O3GA 4ICLA 4FK2A 3AVBA 1L3SA 2B5JA 4CK2A 3OYEA 1VSKA 2FC0A 1YTAA 3AO1A 4CGIA 4CFBA 5HROA 1BIZA 4W5RA 4Y1DA 3V9SA 1QSSA 4CEZA 5HRSA 3K5MA 5HLFA 3ZT1A 4K8ZA 4KKOA 3PO4A 3ZSWA 3HP6A 1A5XA 2DY4A 5KI6A 1YVUA 3DLRA 1Z26A 1LWFA 3VQQA 1RBUA 3CM5A 2EHGA 3LP1A 4HVJA 3SPZA 4IKFA 3NF9A 4PA1A 1C1CA 1ZBLA 3DOKA 1C1AA 1Q8IA 3VQ8A 4CF2A 3NHGA 1SL1A 1KFSA 2XRIA 2WONA 4CHOA 3QEXA 1NK0A 3OYKA 4FJMA 3PUFA 1RDAA 2YKNA 4M3TA 3AVIA 2G8WA 4N41A 3MEEA 1S1WA 4M45A 3SYZA 1JLCA 4C8MA 4DS5A 2JLEA 3THVA 4ZTJA 1U45A 2P5OA 4QAGA 3SI6A 2X6SA 1VSLA 4KTWA 4I7FA 2E6LA 2R7YA 2HHVA 4C8NA 1BIUA 4CJPA 1O1WA 2A1SA 3QIOA 1F21A 3AA4A 3DYAA 2YHBA 3NF8A 3V9WA 4NCGA 3TAGA 4ZTFA 1QE1A 4CFAA 1TK0A 2G8FA 4HCBA 2RF2A 4E7HA 4DTOA 3D0PA 2Y1JA 3KIOA 3V9XA 3CFOA 3CG7A 1J53A 4OGEA 3QEIA 4DSEA 1VSDA 3PX4A 3KK3A 3I8DA 4FM0A 4DFJA 4DSIA 1S9EA 4CF8A 2GBZA 1S1XA 3LWMA 4WE1A 1FKPA 3OYHA 1KRPA 2HHUA 2FBXA 2QXFA 1XHXA 1HMVA 1WSHA 2G8KA 4OVLA 2W42A 1B9FA 5T7BA 4ID1A 3NH1A 1WN7A 3VA3A 1HQEA 4F2SA 4W5OA 3QIPA 3OS2A 1RDCA 3DI6A 1UAXA 4DTRA 4LD0A 4AHCA 3RWUA 1Z25A 2AJQA 4OLBA 4CJFA 2O4IA 1LW2A 3HL8A 1JLBA 1IKYA 4CGGA 4AHRA 4UQGA 4FM2A 1RBTA 1WAFA 3LANA 4FJHA 3ALYA 4DU4A 4CHZA 1RTIA 4HUFA 3RMAA 1XI1A 3TR8A 1RT5A 3NBPA 2G8HA 4DLEA 4G1QA 1RTJA 3TAQA 2PY5A 4FW1A 4GVMA 5KGXA 1S6QA 2HNYA 3SUNA 4RG8A 1NJWA 3OYLA 1N6QA 5FRNA 2QK9A 3SQ2A 1KVAA 3DRSA 4M41A 4Q0BA 3L3UA 4JS4A 5J2NA 4KHNA 1S9GA 4OPKA 4KHSA 1VRTA 1NOYA 1BHLA 1LWEA 1T05A 3VQBA 4AHUA 1CXUA 3B6PA 3ZCMA 3MAQA 1UOCA 3V1QA 3K5OA 3K58A 1D5AA 3ZSQA 4DQPA 3KKRA 4O44A 2OZMA 4ELUA 2F8TA 4CJTA 2RPIA 1X1PA 1L3VA 4F3TA 4E7LA 1EP4A 1NKEA 4E19A 2OPPA 1DTQA 3F73A 2YV0X 4FLTA 3VQPA 1TAQA 4F8RA 4ZHRA 2XO7A 3WNHA 1IG9A 3TWHA 4CHNA 3S3OA 1NJZA 2ZD1A 3AVMA 3M8QA 4CIFA 2HMIA 5HP1A 1SUQA 3AO5A 3TAPA 1T03A 2HHSA 2ZE2A 4CFCA 3SUQA 3AVCA 5C25A 1TK5A 2ITGA 1ZBUA 3P5JA 4CEEA 1XC9A 1NK9A 1U48A 3S3NA 4CEAA 2KW4A 4FVMA 3VQ5A 4FLXA 2PYLA 2PYJA 4C8LA 1KVCA 3DLEA 2Y1IA 2KQ2A 1RT3A 1EETA 1WSEA 2Z1GA 3WNEA 4DQIA 1ASUA 3PX0A 3LPTA 1X9SA 2HHQA 1TKDA 4K8XA 1S1TA 3CQ8A 4HUEA 3SQ4A 4FJXA 1J9AA 2B6AA 1RTDA 4FJ5A 5JS2A 3QETA 1HQUA 1D9DA 1KVBA 2HHTA 1JXEA 3HJFA 4CIGA 2ETJA 1CLQA 4DSJA 1JKHA 4GMJB 1JL1A 3KKSA 1VSHA 3O3HA 3PO5A 2DTUA 1RTHA 3VQAA 4CJ3A 5HRNA 1B92A 3RMCA 4B9VA 4DG1A 5FRMA 2D0BA 4XIUA 4DF4A 3TANA 3M8SA 1C0MA 3OYDA 3SQ1A 3HO1A 2IAJA 4CK1A 2VG5A 2YKMA 4CEFA 4O0IA 3MEGA 4YFUA 3O3FA 3ULDA 2HNZA 1NK4A 3HSTB 3AA2A 1WSIA 3K2PA 5J1EA 1LWCA 4E7IA 3RMBA 4M3RA 3NE6A 3JYTA 4E89A 3P83D 3ZSZA 1UWBA 4DTJA 3U6FA 1Q9YA 4KI4A 2IOCA 3EY1A 4M3ZA 1HYZA 4IBNA 4MFBA 4FJGA 2KTQA 3DOLA 1BCMA 3L2QA 1T7PA 1XHZA 3NAEA 1B9DA 2VWKA 4CEBA 5KTQA 1QSLA 3KLIA 3DLHA 4Z4FA 3KK2A 3VQCA 4JS5A 3LZJA 3QNOA 3KLEA 3SV3A 5HRPA 3LALA 1RBRA 3U3YA 4CHYA 4JRQA 4AHTA 4FZZA 2YHAA 4OGCA 2D5RA 4CF9A 3V1OA 1VK0A 4E7KA 2IS3A 3DRRA 3L2VA 4LSLA 1EKEA 4CJQA 3PY8A 1GOCA 4FLYA 3TABA 2OPRA 3OYNA 2GV9A 2KFNA 4KTQA 3ZT2A 4OKJA 1RBSA 2FBTA 1BQNA 3T1AA 3OYBA 2OZSA 4CERA 4E1NA 2LSNA 3KD5E 4FLUA 4W5NA 3HPGA 3QEVA 1YT3A 4Z4EA 3DLGA 4KFBA 4EP4A 3QEWA 1JLGA 3T19A 3L3VA 4FJIA 2HHXA 3VQ7A 5FDLA 3SNNA 4KI6A 4BE0A 1A5VA 1KLMA 1TAUA 4BWJA 3V1RA 3M8PA 4CESA 3L2UA 2F96A 2EX3A 4W5QA 4HUGA 1RT1A 2GUIA 3K57A 2P51A 2DFHA 4HCCA 4R5PA 1RILA 3L2WA 4NYNA 4H8KA 3K5NA 4OKEA 4TSXA 1CZBA 4FLVA 4M3UA 4KHWA 4PY5A 2BDPA 3U3GA 3ZT3A 4Z4HA 3IAYA 1C0UA 1KCFA 2E4LA 2F8SA 1ZBFA 1VSFA 4NYFA 3BDPA 4CJVA 4ID5A 1CXQA 3NFAA 1LW0A 3WNFA 2DFEA 3WNGA 1HRHA 1HNIA 3HVTA 3C95A 3SCXA 4B8CA 3ZSXA 1WAJA 3JSMA 1ASWA 1K6YA 4O55A 3VA0A 2OA8A 4F2RA 4CGFA 2JGUA 3AVGA 5CY4A 2HB5A 4RW8A 1NOZA 4N56A 4DLGA 3M8RA 1SV5A
chains in the Genus database with same CATH superfamily
4QCLA 1QVFM 2QTDA 3A0IX 3C94A 2HOEA 2ZWHA 3MEDA 4J2AA 4YOUA 3O4QA 3PV8A 3VTHA 3QERA 4HTUA 4OJRA 4IXCA 4IJAA 5KGWA 4BGAA 3J81O 3O4NA 3S9HA 1NGIA 3E01A 4IFVA 4Q5VA 4L3QA 4DU1A 3SBTA 5ADXA 2QKBA 3SPYA 1S6PA 3HSCA 2OPSA 3KLGA 4CJ4A 3P31A 2Z1HA 1NKBA 5SWMA 4KRFA 4DR1K 2P9SA 4CEDA 1X9WA 4K42A 4XH5A 1TGOA 3OYAA 5AQRA 4BDZA 3O9RA 3HK2A 3AVHA 3MECA 3MXIA 5GADP 1XQSC 5IT9O 2X6NA 4YNQA 3CCSN 1GOBA 3GE1A 2Z1IA 3WQUA 1GOAA 2Q36A 3SAFA 4B3RK 1DTTA 1C1BA 2E2NA 1LAVA 3V9ZA 4CBUA 1NGAA 2O8DB 2Q31A 2XY6A 3I0SA 4FOIA 2E88A 3M1FA 5KRSA 2OPQA 2KLAA 4CF1A 4AM6A 3THXB 1QQMA 1ZBHA 5AQZA 3AA5X 5AQKA 2HHHK 5GAGP 3M6GA 4FJNA 2IC3A 3BGRA 5AQTA 1H1VA 4J2EA 3TSPA 3DLKA 3F9KA 3CM6A 1JLAA 2JWKA 3LP3A 3DM2A 1NK8A 3VEZA 4KO0A 3QNNA 1KC8O 4FYDA 4DQQA 4ELTA 4GV9A 1RBVA 3QEPA 4IJNA 2W6LA 1OKJA 3R9PA 5AQXA 3VMFB 3KTQA 3DXKB 5FROA 1WNSA 4B08A 2RHKA 3ASMA 5AQHA 4AQYK 1W9HA 3LDSA 1C6VA 3AGKA 3T69A 2A41A 4KV8A 1GLEG 4PWDA 3QLHA 4CHPA 1WSJA 3EE9A 3HPHA 3KK7A 4FJLA 3I55N 1EQYA 4DR6K 3ZEUB 2WOMA 4FCYA 4K43A 4CJSA 4I9LA 1BI4A 1YTUA 4W5TA 4DSKA 2IDOA 3CFRA 1VQLN 3CCQN 3DMJA 4YORA 4G9ZA 1KSPA 4H4MA 3KZBA 4BACA 5BREA 4BY9C 5LJWA 5DM7L 3MXMA 3TI0A 3VPZA 1KFDA 4AHVA 4FK4A 1EXQA 1UA0A 4CEQA 4DSFA 3L2RA 2AP1A 3OJUA 2PZSA 1ITGA 1FXXA 4UY8O 3LP2A 1A5WA 2RKIA 1VQ9N 3SV4A 4DQSA 1J5OA 4DTPA 3KWIA 4BWMA 2PAVA 4BR5A 4CZGA 4CEOA 1T6CA 3FFKB 4CF0A 2G8UA 1WB9A 5J2PA 3KLHA 3AVJA 4ILHA 3SZ2A 3FLCO 4BRNA 1QHAA 2W6KA 2A1RA 3B6OA 3LM2A 4Z4IA 4JD2B 2QKKA 4BDYA 1D9FA 4FZXC 1XWLA 3I0RA 1U47A 3F9MA 1EWRA 3P39A 2E2PA 1VSKA 2FC0A 3AO1A 4CGIA 5HROA 1BIZA 1WUAA 1QSSA 4I6MA 4GKKK 3ZSWA 4JV5K 1A5XA 3C7NB 1FJGK 4H0PA 1YVUA 1Z26A 3VQQA 2EHGA 1Q7YO 1MWKA 1ZBLA 3MN6A 1Q8IA 1SL1A 4JN4A 2P9LB 2WONA 4CHOA 3G6EN 3ULEB 3DAWA 4N41A 5E84A 5FPDA 4M45A 4B1XB 5AQOA 4DV3K 1VSLA 1M90O 2E6LA 5AQSA 1O1WA 2A1SA 3NF8A 3MK6A 5AZJA 1BG3A 5I9EB 1TK0A 1QE1A 3MX2A 4E7HA 3CG7A 3QEIA 1Z6RA 2GEMA 3ZYYX 1GLFO 4CF8A 4LF8K 3T1HK 4WE1A 1FKPA 1DGKN 2FBXA 4WYBA 4NXMK 2G8KA 4OVLA 5T7BA 4ID1A 2O8EA 1WN7A 3ZETB 4DV0K 2QWOA 4R79A 3RWUA 3HL8A 1JLBA 1IKYA 2ZGZA 4AHRA 2FXUA 4IO9L 3LANA 4E1JA 3ALYA 5TKYA 4LF5K 4JI7K 3KHYA 2P9UB 4G1QA 3VEOA 2ITMA 3TAQA 2PY5A 3IKMA 5JVHL 3SUNA 5FRNA 4RG8A 3OYLA 3SQ2A 3L3UA 4JS4A 1HNZK 4KHNA 4PKGA 1NOYA 1LWEA 4FWLA 3VQBA 1YVNA 2FLOA 4BREA 1UOCA 3K58A 1T3VA 4K25A 1X1PA 1L3VA 1EP4A 1NKEA 4E19A 2OPPA 4NLBA 2YV0X 3TTFA 4FLTA 4BRFA 1TAQA 2CGLA 4M7XA 2XO7A 3WNHA 3TWHA 3QBWA 1GLCG 2HMIA 5HP1A 3DLLL 3TAPA 4BR9A 3SJHA 3LL3A 5C25A 1ZBUA 3MX5A 1U48A 2PYJA 2GELA 4DR4K 2QWPA 1ZC6A 3BZKA 1KVCA 2KQ2A 1WBBA 3LPTA 5AQQA 1X9SA 2W41A 4X64K 4K8XA 3IFRA 1LOTB 2V51B 5GAEP 5JS2A 1U6ZA 2HHTA 4CIGA 1KAZA 3W3DA 4GMJB 2W40A 5AFUA 3PO5A 3C65A 4DG1A 4KBOA 4XIUA 3J7ZO 3VEWA 4CBWA 3MN9A 3OYDA 4O0IA 2YKMA 4CEFA 1RDWX 3K2PA 1Y64A 1WSIA 3AA2A 3O9QA 3H1QA 4M3RA 3ZSZA 4DTJA 1NGJA 1HYZA 2UXDK 3WXLA 3SAHA 3L2QA 2HSTA 3NAEA 1U2VB 3DLHA 4BVOA 3VQCA 3QNOA 3LZJA 3KLEA 3SV3A 4CHYA 4JRQA 4AHTA 1VQNN 2YHAA 3V1OA 4E7KA 3O4WA 5BRHA 3L2VA 1OH5A 5ADXH 2OPRA 4NO7A 2GV9A 3OYNA 2KFNA 3GL1A 1RBSA 2FBTA 4CERA 3QEVA 3VESA 3WXKA 3BZCA 4EP4A 3QEWA 3HZ6A 3T19A 1TYQB 3L3VA 3L6QA 2HHXA 3VQ7A 4BC3A 3THWA 1NMNA 1NGGA 4DR2K 3M8PA 4JKGB 2GUIA 4HCCA 3FZKA 4R5PA 3L2WA 2P9IA 3H3NO 4NYNA 3K5NA 4TSXA 4M3UA 4ISEA 4IWVA 1C0UA 1KCFA 2E4LA 5AQVA 4KH6A 2F8SA 2F7TA 4NYFA 4ID5A 2A6AA 3WNGA 1KAXA 1N8RO 4PL8A 4BRPA 4CGFA 3H1VX 2HB5A 2D0OA 4DLGA 2ASMA 1BI4B 4JKHA 1YIJN 3CD6N 1TV6A 3O08A 4CJWA 3O80A 4M3WA 5KPTA 3UKRA 1QS4A 5GAHP 3OS1A 1ZBIA 4JLHA 2HBLA 1EX4A 4FOEA 1I3AA 3SJJA 3ZLJA 1NJYA 3IS9A 1IJJA 4A59A 3TARA 3OJSA 3PX6A 2O4GA 4B1YB 2IVPA 3C6TA 1UA1A 5C2FA 5C15A 4ELVA 4LF9K 4Z94A 1IKVA 3CFPA 3LZIA 1HKBA 3CC4N 1X3NA 4BR0A 4IDKA 4DFPA 2G8IA 4BQZA 3NH0A 3CCRN 4KB1A 5E41A 3OVNA 2KFZA 1TKTA 4FZYA 3S3MA 4HTLA 4CECA 3VETA 3CCUN 4RW4A 1NLVA 3SQ0A 4KTZA 1U4BA 1OH7A 4N5SA 2DFFA 4DFMA 1SL0A 1XNRK 1JXBA 4OPHA 3CETA 4RW9A 3VQ6A 2IVNA 3UE5A 3G0ZA 3L4IA 4LSNA 1QTMA 1FK9A 4B9QA 1TKZA 5CZ1A 3TAEA 3HP9A 5DMRA 5AQYA 4B9UA 2IGIA 3HYFA 1HUXA 3DLBA 3OBYA 2Z1JA 4QS9A 2NRTA 1NGFA 1RT4A 5J2QA 2VWJA 3P4IA 4BG9A 4DWIA 4V19S 3E66A 1YHQN 2HBJA 3RRGA 1VRUA 1JL2A 3MCAB 3V81A 4BR7A 3TSUA 3K59A 5KRTA 1HNVA 2HW3A 5JLFA 2D0PA 3RMDA 3AV9A 5EOYA 4RW6A 3OYMA 2B4JA 3WXIA 4Z0UA 1ZYQA 4JK8A 3V9UA 1XMOK 1DLOA 4M3XA 4KAZA 1G15A 2X78A 4DTSA 4MQ3A 3S41A 4O8UA 5I42A 4FSVA 4Y1CA 4QOZB 1VSIA 4C1NK 4MO4A 3NGZA 2JWLA 3VQDA 4ISFA 4CZHA 1TL3A 2FF6A 3SBGA 1GLLO 3OY9A 3IG1A 2NUBA 2BANA 3WXMB 4QS8A 3AY9A 5I3UA 1RDDA 3A5OC 2ZJRL 1REVA 4J2DA 3V6DA 4M3YA 1NWKA 5AQNA 5M1OA 4BE2A 1U49A 5M1FA 4KB0A 2Q3SA 4B8AB 5HBMA 5H1SQ 5BN8A 3ZSYA 4KPYA 2P1JA 3ZX3A 3JS6A 1FKOA 2OTLN 4I2PA 3NGIA 4N47A 1HYVA 1HJRA 2GWKA 4MDBA 1Q18A 4B9NA 2HBKA 2OYQA 1DT9A 4JKCA 2G8VA 1QSYA 1TK8A 1RDBA 1N34K 3THYB 2FBVA 3R8EA 2HVHA 1NK6A 3VQEA 4FJKA 4KI6A 4CZJA 4FJJA 2D0CA 3PLAA 1RFQA 3NF7A 4IG0A 4HHTA 3FE1A 1J54A 1BISA 2NRWA 3KK1A 1NGEA 1SS6A 1MU2A 1JLFA 4DS4A 1YUWA 4FK0A 4DMNA 3OBWA 3KJVA 3AVFA 1HYSA 4BRHA 2CH5A 4FJ8A 4BE1A 5HL7L 4JI6K 1SKSA 4DTUA 2QA4N 1WSFA 3CERA 4CGDA 2NRVA 4DF8A 1NGHA 5TKWA 4M7YA 1JLQA 3EEQA 2QM1A 5AJ3K 2O8DA 4CGJA 3GG4A 4H03B 5AZIB 4CJ7A 3CC7N 3O3GA 4KH5A 4JHDA 2B5JA 4DQ8A 3ID8A 1X3MA 2Q1NA 2VGMA 4H5NA 4Y1DA 2Q2RA 3K5MA 4KKOA 1IG8A 5AQLA 2O8FA 3HP6A 2YI1A 1LWFA 5AQJA 4LF6K 2UUAK 3LP1A 4HVJA 4B1ZA 4IKFA 4PA1A 1C1CA 3ENOA 1KFSA 4YOYA 3PSFA 2XRIA 3R1XA 1NK0A 3PUFA 1RDAA 2YKNA 2G8WA 3DJCA 3O6WA 3MN5A 3SYZA 1JLCA 1ZXOA 4DS5A 2JLEA 3THVA 4ZTJA 3DXMA 3NVKA 4QAGA 2H3GX 4JAXA 4PKHA 2R7YA 2E2OA 1BIUA 1O13A 4O8KA 3AA4A 3V9WA 1W97L 4FWKA 4CFAA 4HCBA 3D0PA 3A8YA 4GVEA 4CBXA 3JXUA 4BRMA 1J53A 3ULEA 3VTIA 3PX4A 1VSDA 3WEEA 3KK3A 4DFJA 4FM0A 4A61A 4DSIA 1S9EA 2GBZA 3LWMA 1J6ZA 1T6DA 3GDQA 1XHXA 4H0TB 1WSHA 3CQXA 3IUCA 3O8MA 1HQEA 4F2SA 3A5MC 1RDCA 3DI6A 1XUPO 2OCEA 2UYTA 5B8HA 4DR7K 3M5RA 2O8CB 4LC9B 1QZ6A 1HR0K 1BOTO 4UQGA 4FM2A 2P9KA 4HUFA 3TR8A 1RT5A 5C2DA 5CHIA 1NM1A 4FW1A 5KGXA 3F2KA 3FR0A 4H0VB 2QK9A 3MCPA 1QVGM 3D2EA 5J2NA 4OPKA 1ZBSA 2FSJA 1BHLA 1T05A 1V4SA 4CW7B 4AHUA 4BR2A 1CXUA 3AARA 3KKRA 3LDLA 4CZLA 2OZMA 4HWIA 3F73A 1DTQA 3FGUA 4DR3K 2WUSA 5GINA 1IG9A 1BUPA 2I7NA 4CHNA 1NJZA 3M8QA 3AVMA 4CIFA 2HHSA 4MDAA 4CFCA 4JD2A 1TK5A 3K0SA 1NK9A 1QQNA 3S3NA 1S22A 2HF4A 3VQ5A 2YJEA 2Y1IA 1OH8A 1RT3A 1WSEA 1ASUA 1ATSA 2HHQA 1TKDA 4HUEA 3K9JA 4FJXA 1VQ6N 1E4FT 3QETA 5LY3A 3O3HA 2DTUA 3VQAA 5HRNA 1Q81O 4IZ9A 2D0BA 3A5LC 2NRHA 2BTFA 3SQ1A 4DV2K 3NMUA 4J8FA 4H0OA 3L4QA 1LWCA 2VQFK 3UKUB 4E7IA 2A3ZA 4E89A 4KI4A 5BR8K 4MFBA 4FJGA 2KTQA 3DOLA 1BCMA 1XHZA 3FZMA 5FPMA 4CEBA 4Z4FA 4CVNE 3KK2A 4JS5A 5BPLA 3LALA 1WOQA 1GLJO 4IFEA 3RSEB 4K0KK 2IS3A 3BUZB 4LSLA 3LDNA 1VQON 2ASPA 4EAHD 2OZSA 1BQNA 3OYBA 4LF4K 2LSNA 5LMNK 4FLUA 3KD5E 4W5NA 3G71N 1YT3A 2NZTA 4Z4EA 3DLGA 3ID6A 4FJIA 5FDLA 2O8BB 1A5VA 1KLMA 3V1RA 4YHHK 4RWTA 1OH6A 4HUGA 3K57A 2P51A 2V7ZA 3VF2A 3I33A 1RILA 5M1NA 3J7YP 1N36K 1V4TA 1K8KA 1Q82O 1NJIO 4OPAA 4FLVA 2BDPA 2E1ZA 3KVGA 3R3LA 4H5WA 4QS7A 1VSFA 3VF6A 1CXQA 3MWTA 1LW0A 2GWJA 3OW2M 3U9ZA 3HVTA 3C95A 3SCXA 3ZSXA 1WAJA 2NNWA 3JSMA 1ASWA 3DWLA 3VA0A 2OA8A 3SMSA 3QMLA 3M8RA 3SUPA 1FW6A 3U4LA 1R59O 2P9PB 4FJ9A 3RVCA 2OTJN 4J2BA 4DV6K 3OA9A 1KAYA 4X62K 3MDQA 3UB5A 1ASVA 1HNWK 3NF6A 4XEIA 3SK3A 1TVRA 2ZM6K 3LWLA 1VQ4N 4EZ6A 5AQPA 3HVRA 5CYQA 1MDUB 1RT2A 5BR9A 3HOTA 1Q9XA 4JKAA 2XY7A 4O5BA 2QXLA 4IEIA 2A42A 3ZSRA 1N33K 1NKCA 1QQOA 3OS0A 3WT0A 5D3GA 3RRHA 1K73O 4L8RB 1NJXA 4CGHA 4JEPA 4CE9A 1VSJA 4MLHA 5SZTA 1W7AA 3CCVN 4H0XB 4C23A 4PUOA 4CJLA 2GX9A 1JLEA 2VYPA 2ASOA 2I5JA 3MMVA 3AAQA 3B8AX 2QWLA 1IKXA 1IKWA 3CYMA 4ILGB 4YDUC 4RCHA 1SKWA 4I6MB 2IIRA 2NRZA 4WFNL 2Q0UA 2P9NA 3NH2A 1E4GT 4B3TK 2UXCK 4CCHA 4A2AA 4LFBK 4FLWA 4NCAA 2V52B 4DU3A 4IOAL 1T44A 1NG9A 3AO3A 3CMAN 3CCLN 3NDKA 2XHBA 4IOXA 3I8BA 3CPEA 4H4OA 3TAFA 3EZ5A 4KREA 2BUPA 4BG8A 3AAPA 4F3OA 4CFDA 3ZX2A 3LDPA 1WLJA 3T3FA 2ZJQL 3CJBA 4CIEA 5C42A 1YJNN 3ZT4A 5M1PA 4DTMA 3GOIA 4B1WB 3LPUA 4I9QA 3QESA 3K5LA 4E0DA 2E20A 1IV0A 2YNFA 4RW7A 3MXJA 3TTDA 1KD1O 4NCBA 4IFYA 3ZEUA 3RR8A 2KZZA 5CZ2A 4NLCA 1XNQK 3J7AP 4AH9A 4CJ5A 2UXBK 3FZLA 3VN5A 3C6AA 5JICA 4GW6A 2WFBA 4Z4GA 3DXKA 2D0AA 1L3UA 3HPOA 4LFAK 1VSEA 1Y97A 2FBYA 3DRPA 2XY8A 4IG3A 4CHQA 4A2BA 4DTXA 5EY4A 4FXDA 2Q97A 4FPAA 3A2FA 1K8AO 3L8BA 4RTFD 1I94K 4MLEA 2E1YA 1SKRA 1BA0A 5EXWA 3QFPA 3D2EB 4DUYK 1WSGA 1WBDA 3AVAA 3RTVA 3IRXA 4DTNA 4CI6A 4DV7K 3OYJA 4IEEA 4LY7A 3HXMA 3G10A 4FW2A 3V4IA 3UIQA 3Q7BA 4CJKA 4OPJA 3SUOA 3NVMA 4BC5A 4B9MA 4E1MA 4AF1A 3C6UA 3D45A 1BA1A 1BGXT 2VGNA 3KWGA 4CK3A 2IVOA 1RCHA 3AO4A 3VQ4A 4H5VA 4JI2K 3CJ7A 1QQCA 4CJUA 3VF4A 1C0TA 5C0YA 3CHWA 1RNHA 3AVLA 4AHSA 1T8EA 1ATRA 1LV5A 4C8OA 3R6MA 3CI5A 3HBTA 4AILC 5GIOA 2FSKA 2X74A 4JKDA 1HX1A 1JJ2M 1MA9B 1L3SA 4CK2A 3OYEA 4CD1A 3G4SN 2UU9K 4W5RA 3QFUA 3VGKA 3V9SA 5CR4A 3ZT1A 3PO4A 2DY4A 5KI6A 5LJVA 1RBUA 1VQMN 2EWSA 3NF9A 4O5FA 4CF2A 1K9MO 3VEYA 4JKGA 5KPZA 4FJMA 3BF1A 3CC2N 4F9OA 3MEEA 2CH6A 4C8MA 1BWFO 4GY2B 4LFCK 3SI6A 4FPBA 1JCFA 4I7FA 3TSQA 3ZX0A 2HHVA 4CJPA 5FPEA 1F21A 3O5BA 3DYAA 3I56N 2G8FA 4ZTFA 3QB0A 2RF2A 2Y1JA 5F0XA 1NGBA 3KIOA 3V9XA 4H5RA 4IDHA 2D4WA 4FWPA 1OVYA 4OGEA 4DSEA 3D2FA 1TYQA 1S1XA 3EO3A 4FVUA 2HHUA 2QXFA 4PKIA 1HMVA 3VEVA 3SLCA 3VA3A 4YOVA 4W5OA 4DTRA 1UAXA 4GNIA 4AHCA 1JCGA 1Z25A 5AQUA 4JKEA 4OLBA 4CJFA 2AJQA 1NGCA 1WAFA 1NGDA 4CHZA 1RTIA 3RMAA 3T1YK 1HKCA 3M3ZA 4GVMA 1N6QA 1NU0A 1KVAA 4WFBL 4M41A 4Q0BA 4KHSA 1TUYA 1VRTA 1IBLK 2V7YA 3EKSA 3B6PA 3ZCMA 2CGKA 3D7EO 4JI8K 3K5OA 4DQPA 2P9PA 3AGRA 4O44A 4ELUA 4F3TA 4E7LA 2P9LA 3IDHA 2F9WA 4ZHRA 4GKJK 2I7PA 2NRRA 3S3OA 1NNEA 2ZD1A 4A62A 1P90A 2HBMA 3AO5A 5FPNA 2QWQA 3SUQA 3AVCA 3L0QA 4B3MK 1X9JA 4CEEA 2J4RA 1GLAG 5ELZA 4CEAA 2KW4A 4FVMA 3OTOK 3DLEA 4Y0WA 1VQPN 5GIPA 3PX0A 2ZGYA 3Q7CA 1S1TA 3CQ8A 2B6AA 2KKZA 1HQUA 4ILJA 1KVBA 5KQDA 2CGJA 3THYA 1D9DA 2ETJA 2E2QA 1CLQA 4DSJA 1NMDA 1CZAN 1JKHA 3JAMO 1JL1A 3KKSA 4FL9A 4DV1K 3A5NC 2O8EB 4DUZK 3J80O 4DF4A 2P9SB 3TANA 3M8SA 2OANA 2IAJA 4CK1A 2VG5A 3UKRB 4M63C 3O3FA 1NK4A 4BRAA 4JI3K 1YI2N 3RMBA 3NE6A 3JYTA 1Q9YA 2IOCA 3TU5A 1S72N 1T7PA 4NB4A 5KTQA 1QSLA 1RBRA 1VQ8N 3U3YA 1YJ9N 1YF5L 4CF9A 3CF5L 3PY8A 4FLYA 1C0FA 1GLBG 3LDOA 3ZT2A 5AQIA 4OKJA 2GTDA 3H3OB 4E1NA 2QEXN 3FZFA 3CJAA 3C7NA 1JLGA 3CJ9A 2QWNA 4WQ5C 3CJCA 4BE0A 4WCEL 1TAUA 4CESA 3L2UA 1JCEA 4W5QA 3W0LA 1RT1A 2DFHA 1ATNA 4OKEA 3J8AA 1CZBA 2WBNA 3ZT3A 1D4XA 4JYAK 4B3SK 4C1NI 1ZBFA 4CJVA 5AZJB 3NFAA 3WNFA 2DFEA 1HNIA 1HNXK 4PL7A 2YHWA 4EIAA 4B8CA 1K6YA 4F2RA 4O55A 5EVZA 5CY4A 4RW8A 2WC9A 5HOOA 4B3OA 3O1WA 5JS1A 3LAKA 3NGYA 4FWNA 3CPWM 2XY5A 2RN2A 1HPMA 3ITHA 2BE2A 1QHTA 5DK5A 4Z4CA 3PIOL 4OO1J 1S1UA 4KH4A 5AQMA 4O4GA 3H08A 3ZT0A 4PQUA 2KZMA 4BRQA 4NXNK 1CZ9A 4C8KA 2HHWA 2PBDA 1U2VA 4YDUA 4OLAA 2HNDA 5BPMA 1BL3A 2F4VK 1EO1A 1E3MA 1D8YA 2A40A 3O9SA 5CE3A 3VENA 2E6MA 1R0AA 4LH4A 5IWAK 2ATQA 4DV4K 2FF3B 1IO2A 3ISNC 3CCJN 1U04A 3EN9A 1SL2A 2HVIA 1L3TA 4FJ7A 4CD3A 4X66K 4JRPA 3UKUA 1S3XA 3EKUA 1YAGA 4BRKA 2D1KA 2F9TA 4JHDB 5K14A 4JI5K 3QINA 4E3SA 3AVNA 4ISGA 4X65K 4FM1A 3BY5A 4CJEA 1VSMA 4E7JA 1J5EK 4XH4A 4B9SA 4DSLA 4WF9L 2YNHA 1RGIA 3H6EA 3TAMA 3GBTA 2VG6A 1LAWA 4A57A 3RR7A 3MN7A 5KQ8A 4KHQA 5LMUK 5EU7A 4EHTA 1RT6A 4A5AA 3FZHA 4EZ9A 5E26A 3QBXA 3OYFA 3H45C 3EYZA 4OX9K 4MO5A 4XH1A 3EZWA 5F2RA 4JI1K 1KLNA 3D6RA 3LP0A 3LAMA 3VOVA 3QO9A 1DEJA 5AQGA 3OYCA 2P9KB 2Q0RA 5C24A 2VG7A 1RT7A 1K8KB 4BROA 4BDPA 2YNGA 1KXPA 1TUUA 2UUCK 5J2MA 1I39A 3KLFA 1BQMA 4DQRA 1BCOA 3ATUA 1OVQA 1NK7A 3D2FB 2YNIA 3HTVA 4BVPA 3AO2A 3BP8A 4B1VA 3TTCA 4O0JA 4FWQA 3SMPA 4IOCL 1X9MA 3HT3A 3ZSVA 3OYIA 3N4QA 1NK5A 3HM9A 4BGBA 3OYGA 1KQSM 4GV3A 4WQ4C 3KD1E 2O8FB 2YHYA 5M1QA 3SAGA 1EWQA 4JI4K 4JNEA 1QZ5A 3G25A 3P1GA 3VQ9A 4F4KA 4DHYA 3ZETA 1C0GA 3K9KA 4JK7A 5CYMA 3ATVA 3MWPA 3AVKA 4DR5K 3H46O 3DXMB 1IH7A 4FWMA 3QICA 3AA3A 3FFIA 2O8BA 2YJFA 3EE8A 3ZSOA 3U8XA 1L5UA 4DFKA 4M42A 4N76A 4BR4A 4FLZA 2VWBA 4EHUA 4BRCA 4EP5A 2BGGA 2P5GA 2VQEK 4H5TA 3PIPL 4KHUA 2ZQBA 1W0HA 5DM6L 4KHYA 4B9TA 1S5JA 1HJOA 1SZ2A 1N5YA 4LH5A 1TKXA 1P8ZA 3P38A 1VHXA 2NLXA 5LL6Z 4CJRA 5C10A 5EX5A 1KTQA 1HPZA 2YHXA 4FWSA 4I2QA 4FWRA 3NCIA 4PHTX 4OKKA 4WQ4A 2QI2A 4B9LA 1S1VA 3IMXA 1TL1A 5HRRA 2YX6A 4BRDA 4ICLA 2WTUA 4FK2A 3AVBA 4WFAL 1YTAA 4FWOA 4CFBA 4CEZA 5HRSA 4JKFA 2AA4A 5HLFA 1VQ7N 4K8ZA 3CIPA 3DLRA 3VEXA 2DPNA 3THXA 3CM5A 3E9PA 3SPZA 3VQ8A 3DOKA 1C1AA 3O9UA 3NHGA 2P9IB 5BRDA 3QEXA 3OYKA 4CZFA 4M3TA 3AVIA 1S1WA 4CZEA 2P5OA 3U9DA 1U45A 2X6SA 4KTWA 3RSEA 1XMQK 1YXQA 4H0YB 5C12A 1SAZA 4C8NA 3F5TA 3QIOA 1T03A 2YHBA 4NCGA 3TAGA 5KPRA 4IO8A 4DTOA 3CFOA 4YOTA 1VAZA 2YCHA 3I8DA 4BC2A 2O8CA 4CZKA 3OYHA 1KRPA 2P9NB 1BDGA 2P9UA 2ZJPL 2W42A 1B9FA 5AFUH 3NH1A 3O1BA 1G99A 1ESVA 3QIPA 3OS2A 4LD0A 1IBMK 2ZF5O 4KHPK 3HOSA 2O4IA 1LW2A 4CGGA 3VGLA 3BEXA 1NBWA 5FLXO 3BF3A 4BQLA 1RBTA 1RDUA 4FJHA 4DU4A 1XI1A 5BRFA 4YOWA 3NBPA 5JVGL 5JLHA 2G8HA 4DCHA 4DLEA 1RTJA 1S6QA 1DKGD 2HNYA 3O9TA 3CXCM 1NJWA 3EL2A 2HF3A 5MLCQ 3DRSA 4CZMA 3E9OA 1S9GA 2PFUA 4B1UB 1MWMA 3MAQA 1Q86O 3V1QA 2E8AA 1D5AA 3ZSQA 2F8TA 3ENHA 4CJTA 2RPIA 3TPQA 5F1XA 4WQ5A 1SQKA 1GLDG 2HMPA 4A5BA 1YITN 3VQPA 4U7BA 4F8RA 2QW9A 1SUQA 2BH1A 2ZE2A 4DB3A 2ITGA 3CMEN 3P5JA 1BO5O 1HLUA 1XC9A 3E9LA 5BPNA 4FLXA 2PYLA 4C8LA 4DQIA 2Z1GA 1EETA 3WNEA 4DKWA 1Z05A 5BN9A 3C6HA 3SQ4A 1J9AA 4FJ5A 1RTDA 1JXEA 3HJFA 5AQFA 1VSHA 1RTHA 3RMCA 4CJ3A 1B92A 4B9VA 1N32K 5FRMA 3E1YA 1LCUA 1C0MA 3HO1A 2UUBK 2FSNA 3MEGA 4JKBA 3QDKA 4YFUA 5A2QO 3ULDA 2HNZA 4EFHA 3WXJA 2VCPA 3HSTB 3T7ZA 5J1EA 3ENBA 3P83D 4YY3K 1UWBA 3U6FA 2RE2A 3EY1A 4M3ZA 4BRLA 4IBNA 1VQKN 5AR0A 4BRGA 1B9DA 2VWKA 4K41A 3KLIA 3LDQA 3C0BA 3THWB 5HRPA 1HKGA 4FZZA 4OGCA 2D5RA 2NRXA 5AZIA 1VK0A 1BU6O 3DRRA 3WUHA 4CJQA 1EKEA 4FO0A 1GOCA 3TABA 4KTQA 3T1AA 1IBKK 4DV5K 3PSIA 3HI0A 3HPGA 2QWMA 4KFBA 3WEEB 2A5XA 1M1KO 3SNNA 1VQ5N 2GUPA 4BWJA 3VERA 4JI0K 1ILYA 2F96A 2EX3A 2KHOA 4JK9A 3OHRA 4LF7K 4H8KA 4U67L 1XC3A 5AQWA 4KHWA 4PY5A 4BRIA 3U3GA 4AM7A 4Z4HA 3CCMN 3CCEN 3WQTA 3IAYA 5JMVA 1W2BM 3N4PA 4CZIA 3VGMA 3BDPA 1YJWN 2E5LK 3HRGA 1HRHA 3CQYA 2QWRA 4BC4A 3CJ1A 2JGUA 3AVGA 4YOXA 4N56A 4GV6A 1NOZA 3LM9A 5M1KA 3HM8A 1SV5A
chains in the Genus database with same CATH topology
1BI4B 4B3OA 1TV6A 3LAKA 5JS1A 3NGYA 4QCLA 4CJWA 3SUPA 4M3WA 3C94A 3MEDA 2XY5A 1QS4A 2RN2A 4J2AA 3O4QA 3ITHA 2BE2A 3OS1A 3PV8A 1QHTA 4FJ9A 5DK5A 3QERA 4Z4CA 1ZBIA 4JLHA 1S1UA 4HTUA 4J2BA 4O4GA 3H08A 1EX4A 3ZT0A 1I3AA 3SJJA 1NJYA 4PQUA 3IS9A 4OJRA 2KZMA 3TARA 3OJSA 3PX6A 1CZ9A 2O4GA 1ASVA 1UA1A 3C6TA 5KGWA 4C8KA 2HHWA 3O4NA 3NF6A 3S9HA 4OLAA 4ELVA 2HNDA 1IKVA 3CFPA 1BL3A 3LZIA 1D8YA 3E01A 1TVRA 4IFVA 4Q5VA 4IDKA 3LWLA 4EZ6A 4DFPA 2G8IA 3HVRA 5CYQA 3NH0A 4DU1A 1RT2A 4KB1A 3SPYA 2QKBA 1S6PA 1Q9XA 2E6MA 2OPSA 5E41A 3OVNA 4O5BA 2XY7A 1R0AA 2KFZA 1TKTA 3KLGA 4LH4A 3ZSRA 4CJ4A 1NKCA 3S3MA 2ATQA 2Z1HA 4FZYA 1NKBA 3OS0A 5SWMA 4CECA 4KRFA 4CEDA 1IO2A 3ISNC 1X9WA 4RW4A 3RRHA 1U04A 5D3GA 1TGOA 4L8RB 3OYAA 3SQ0A 4KTZA 1U4BA 4BDZA 4N5SA 1NJXA 3HK2A 4CGHA 3AVHA 2DFFA 4DFMA 1SL2A 1SL0A 3MECA 1VSJA 4CE9A 5SZTA 3MXIA 1L3TA 1JXBA 4JRPA 4FJ7A 4PUOA 2X6NA 4CJLA 4YNQA 1JLEA 2I5JA 1GOBA 4RW9A 3VQ6A 5K14A 2Z1IA 1GOAA 3G0ZA 3QINA 1DTTA 1IKXA 3CYMA 1IKWA 4LSNA 1C1BA 4E3SA 1FK9A 3TAEA 1TKZA 3AVNA 5CZ1A 1SKWA 1QTMA 4FM1A 3HP9A 5DMRA 1LAVA 4CJEA 1VSMA 4E7JA 3V9ZA 4B9UA 2IGIA 3HYFA 4B9SA 4DSLA 2YNHA 3NH2A 3TAMA 3DLBA 2XY6A 3I0SA 4CCHA 2VG6A 1LAWA 2Z1JA 2OPQA 5KRSA 4CF1A 3RR7A 4FLWA 1RT4A 4NCAA 4DU3A 2VWJA 5J2QA 1ZBHA 4KHQA 3AO3A 4DWIA 3NDKA 3AA5X 5EU7A 2XHBA 1RT6A 3RRGA 1VRUA 1JL2A 4FJNA 2IC3A 3BGRA 4H4OA 3EZ5A 3V81A 3TAFA 3K59A 4KREA 4EZ9A 4J2EA 4F3OA 5KRTA 1HNVA 3DLKA 3F9KA 3OYFA 2HW3A 3EYZA 3RMDA 3AV9A 3CM6A 4RW6A 4CFDA 3OYMA 1KLNA 3LP0A 1JLAA 3LAMA 3QO9A 2B4JA 3LP3A 3DM2A 4Z0UA 1NK8A 3OYCA 4KO0A 1WLJA 1ZYQA 5C24A 3T3FA 3QNNA 3V9UA 4FYDA 2VG7A 4DQQA 1RT7A 4ELTA 1RBVA 1DLOA 4BDPA 2YNGA 3QEPA 4CIEA 4M3XA 4KAZA 1G15A 2X78A 5C42A 4MQ3A 4DTSA 5J2MA 3ZT4A 1I39A 3KLFA 1BQMA 4DTMA 5I42A 4DQRA 1BCOA 1NK7A 3LPUA 4Y1CA 2YNIA 4QOZB 1VSIA 3AO2A 3KTQA 4I9QA 4O0JA 5FROA 3NGZA 3QESA 3K5LA 3VQDA 4E0DA 2YNFA 4RW7A 1TL3A 3MXJA 1WNSA 1X9MA 2HVIA 3HT3A 3ZSVA 3OY9A 4IFYA 4B08A 3OYIA 3ASMA 3IG1A 3HM9A 1W9HA 1NK5A 3RR8A 2KZZA 2NUBA 5CZ2A 2BANA 3OYGA 3LDSA 4AH9A 4CJ5A 3VN5A 1C6VA 5I3UA 3KD1E 1RDDA 1REVA 4GW6A 4Z4GA 4J2DA 3V6DA 4KV8A 4PWDA 2D0AA 3QLHA 4M3YA 1L3UA 4BE2A 3HPOA 1U49A 1VSEA 1WSJA 3HPHA 1Y97A 2FBYA 4CHPA 4KB0A 4FJLA 3P1GA 2Q3SA 3VQ9A 3DRPA 4B8AB 2XY8A 4F4KA 5HBMA 4IG3A 4CHQA 3ZSYA 4KPYA 4FCYA 2P1JA 2WOMA 4DTXA 4FXDA 4CJSA 4I9LA 5CYMA 1BI4A 1FKOA 1YTUA 4I2PA 3AVKA 4W5TA 3NGIA 2IDOA 3CFRA 3A2FA 4DSKA 4N47A 1HYVA 1HJRA 3L8BA 1IH7A 4B9NA 2OYQA 3AA3A 3DMJA 3FFIA 1SKRA 2G8VA 1KSPA 4H4MA 1QSYA 1TK8A 4BACA 1RDBA 2FBVA 1WSGA 2HVHA 3ZSOA 3VQEA 3MXMA 1NK6A 3AVAA 3RTVA 3IRXA 4DTNA 4FJJA 4FJKA 2D0CA 4DFKA 3TI0A 1L5UA 3OYJA 4LY7A 4N76A 4M42A 1KFDA 3NF7A 4IG0A 4AHVA 4HHTA 4FK4A 1EXQA 4FLZA 1UA0A 3HXMA 3G10A 4CEQA 1J54A 1BISA 4FW2A 3V4IA 4EP5A 2BGGA 4DSFA 3UIQA 3L2RA 3KK1A 3OJUA 2PZSA 1ITGA 1FXXA 2P5GA 4CJKA 4KHUA 3LP2A 4OPJA 2ZQBA 1MU2A 1W0HA 1A5WA 2RKIA 1JLFA 3SUOA 4DS4A 4FK0A 3SV4A 4DMNA 4KHYA 4B9TA 4DQSA 4E1MA 1J5OA 3KJVA 1S5JA 4DTPA 3AVFA 4B9MA 1HYSA 4BWMA 4FJ8A 4CK3A 3C6UA 1TKXA 1BGXT 3D45A 4LH5A 4BE1A 4CEOA 1N5YA 4CF0A 1SKSA 2G8UA 1RCHA 3AO4A 3VQ4A 4DTUA 5J2PA 3KLHA 4CJRA 3AVJA 1WSFA 3SZ2A 1QQCA 4CJUA 4CGDA 4DF8A 2A1RA 1KTQA 1HPZA 1C0TA 4I2QA 3B6OA 3NCIA 4NCBA 1JLQA 1RNHA 3AVLA 4AHSA 4OKKA 1T8EA 1LV5A 4C8OA 4Z4IA 2QKKA 4AILC 4BDYA 1S1VA 1D9FA 4B9LA 4FZXC 4CGJA 1TL1A 1XWLA 3I0RA 1U47A 5HRRA 2X74A 3O3GA 4ICLA 4FK2A 3AVBA 1L3SA 2B5JA 4CK2A 3OYEA 1VSKA 2FC0A 1YTAA 3AO1A 4CGIA 4CFBA 5HROA 1BIZA 4W5RA 4Y1DA 3V9SA 1QSSA 4CEZA 5HRSA 3K5MA 5HLFA 3ZT1A 4K8ZA 4KKOA 3PO4A 3ZSWA 3HP6A 1A5XA 2DY4A 5KI6A 1YVUA 3DLRA 1Z26A 1LWFA 3VQQA 1RBUA 3CM5A 2EHGA 3LP1A 4HVJA 3SPZA 4IKFA 3NF9A 4PA1A 1C1CA 1ZBLA 3DOKA 1C1AA 1Q8IA 3VQ8A 4CF2A 3NHGA 1SL1A 1KFSA 2XRIA 2WONA 4CHOA 3QEXA 1NK0A 3OYKA 4FJMA 3PUFA 1RDAA 2YKNA 4M3TA 3AVIA 2G8WA 4N41A 3MEEA 1S1WA 4M45A 3SYZA 1JLCA 4C8MA 4DS5A 2JLEA 3THVA 4ZTJA 1U45A 2P5OA 4QAGA 3SI6A 2X6SA 1VSLA 4KTWA 4I7FA 2E6LA 2R7YA 2HHVA 4C8NA 1BIUA 4CJPA 1O1WA 2A1SA 3QIOA 1F21A 3AA4A 3DYAA 2YHBA 3NF8A 3V9WA 4NCGA 3TAGA 4ZTFA 1QE1A 4CFAA 1TK0A 2G8FA 4HCBA 2RF2A 4E7HA 4DTOA 3D0PA 2Y1JA 3KIOA 3V9XA 3CFOA 3CG7A 1J53A 4OGEA 3QEIA 4DSEA 1VSDA 3PX4A 3KK3A 3I8DA 4FM0A 4DFJA 4DSIA 1S9EA 4CF8A 2GBZA 1S1XA 3LWMA 4WE1A 1FKPA 3OYHA 1KRPA 2HHUA 2FBXA 2QXFA 1XHXA 1HMVA 1WSHA 2G8KA 4OVLA 2W42A 1B9FA 5T7BA 4ID1A 3NH1A 1WN7A 3VA3A 1HQEA 4F2SA 4W5OA 3QIPA 3OS2A 1RDCA 3DI6A 1UAXA 4DTRA 4LD0A 4AHCA 3RWUA 1Z25A 2AJQA 4OLBA 4CJFA 2O4IA 1LW2A 3HL8A 1JLBA 1IKYA 4CGGA 4AHRA 4UQGA 4FM2A 1RBTA 1WAFA 3LANA 4FJHA 3ALYA 4DU4A 4CHZA 1RTIA 4HUFA 3RMAA 1XI1A 3TR8A 1RT5A 3NBPA 2G8HA 4DLEA 4G1QA 1RTJA 3TAQA 2PY5A 4FW1A 4GVMA 5KGXA 1S6QA 2HNYA 3SUNA 4RG8A 1NJWA 3OYLA 1N6QA 5FRNA 2QK9A 3SQ2A 1KVAA 3DRSA 4M41A 4Q0BA 3L3UA 4JS4A 5J2NA 4KHNA 1S9GA 4OPKA 4KHSA 1VRTA 1NOYA 1BHLA 1LWEA 1T05A 3VQBA 4AHUA 1CXUA 3B6PA 3ZCMA 3MAQA 1UOCA 3V1QA 3K5OA 3K58A 1D5AA 3ZSQA 4DQPA 3KKRA 4O44A 2OZMA 4ELUA 2F8TA 4CJTA 2RPIA 1X1PA 1L3VA 4F3TA 4E7LA 1EP4A 1NKEA 4E19A 2OPPA 1DTQA 3F73A 2YV0X 4FLTA 3VQPA 1TAQA 4F8RA 4ZHRA 2XO7A 3WNHA 1IG9A 3TWHA 4CHNA 3S3OA 1NJZA 2ZD1A 3AVMA 3M8QA 4CIFA 2HMIA 5HP1A 1SUQA 3AO5A 3TAPA 1T03A 2HHSA 2ZE2A 4CFCA 3SUQA 3AVCA 5C25A 1TK5A 2ITGA 1ZBUA 3P5JA 4CEEA 1XC9A 1NK9A 1U48A 3S3NA 4CEAA 2KW4A 4FVMA 3VQ5A 4FLXA 2PYLA 2PYJA 4C8LA 1KVCA 3DLEA 2Y1IA 2KQ2A 1RT3A 1EETA 1WSEA 2Z1GA 3WNEA 4DQIA 1ASUA 3PX0A 3LPTA 1X9SA 2HHQA 1TKDA 4K8XA 1S1TA 3CQ8A 4HUEA 3SQ4A 4FJXA 1J9AA 2B6AA 1RTDA 4FJ5A 5JS2A 3QETA 1HQUA 1D9DA 1KVBA 2HHTA 1JXEA 3HJFA 4CIGA 2ETJA 1CLQA 4DSJA 1JKHA 4GMJB 1JL1A 3KKSA 1VSHA 3O3HA 3PO5A 2DTUA 1RTHA 3VQAA 4CJ3A 5HRNA 1B92A 3RMCA 4B9VA 4DG1A 5FRMA 2D0BA 4XIUA 4DF4A 3TANA 3M8SA 1C0MA 3OYDA 3SQ1A 3HO1A 2IAJA 4CK1A 2VG5A 2YKMA 4CEFA 4O0IA 3MEGA 4YFUA 3O3FA 3ULDA 2HNZA 1NK4A 3HSTB 3AA2A 1WSIA 3K2PA 5J1EA 1LWCA 4E7IA 3RMBA 4M3RA 3NE6A 3JYTA 4E89A 3P83D 3ZSZA 1UWBA 4DTJA 3U6FA 1Q9YA 4KI4A 2IOCA 3EY1A 4M3ZA 1HYZA 4IBNA 4MFBA 4FJGA 2KTQA 3DOLA 1BCMA 3L2QA 1T7PA 1XHZA 3NAEA 1B9DA 2VWKA 4CEBA 5KTQA 1QSLA 3KLIA 3DLHA 4Z4FA 3KK2A 3VQCA 4JS5A 3LZJA 3QNOA 3KLEA 3SV3A 5HRPA 3LALA 1RBRA 3U3YA 4CHYA 4JRQA 4AHTA 4FZZA 2YHAA 4OGCA 2D5RA 4CF9A 3V1OA 1VK0A 4E7KA 2IS3A 3DRRA 3L2VA 4LSLA 1EKEA 4CJQA 3PY8A 1GOCA 4FLYA 3TABA 2OPRA 3OYNA 2GV9A 2KFNA 4KTQA 3ZT2A 4OKJA 1RBSA 2FBTA 1BQNA 3T1AA 3OYBA 2OZSA 4CERA 4E1NA 2LSNA 3KD5E 4FLUA 4W5NA 3HPGA 3QEVA 1YT3A 4Z4EA 3DLGA 4KFBA 4EP4A 3QEWA 1JLGA 3T19A 3L3VA 4FJIA 2HHXA 3VQ7A 5FDLA 3SNNA 4KI6A 4BE0A 1A5VA 1KLMA 1TAUA 4BWJA 3V1RA 3M8PA 4CESA 3L2UA 2F96A 2EX3A 4W5QA 4HUGA 1RT1A 2GUIA 3K57A 2P51A 2DFHA 4HCCA 4R5PA 1RILA 3L2WA 4NYNA 4H8KA 3K5NA 4OKEA 4TSXA 1CZBA 4FLVA 4M3UA 4KHWA 4PY5A 2BDPA 3U3GA 3ZT3A 4Z4HA 3IAYA 1C0UA 1KCFA 2E4LA 2F8SA 1ZBFA 1VSFA 4NYFA 3BDPA 4CJVA 4ID5A 1CXQA 3NFAA 1LW0A 3WNFA 2DFEA 3WNGA 1HRHA 1HNIA 3HVTA 3C95A 3SCXA 4B8CA 3ZSXA 1WAJA 3JSMA 1ASWA 1K6YA 4O55A 3VA0A 2OA8A 4F2RA 4CGFA 2JGUA 3AVGA 5CY4A 2HB5A 4RW8A 1NOZA 4N56A 4DLGA 3M8RA 1SV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI4 B;  4B3O A;  1TV6 A;  3LAK A;  5JS1 A;  3NGY A;  4QCL A;  4CJW A;  3SUP A;  4M3W A;  3C94 A;  3MED A;  2XY5 A;  1QS4 A;  2RN2 A;  4J2A A;  3O4Q A;  3ITH A;  2BE2 A;  3OS1 A;  3PV8 A;  1QHT A;  4FJ9 A;  5DK5 A;  3QER A;  4Z4C A;  1ZBI A;  4JLH A;  1S1U A;  4HTU A;  4J2B A;  4O4G A;  3H08 A;  1EX4 A;  3ZT0 A;  1I3A A;  3SJJ A;  1NJY A;  4PQU A;  3IS9 A;  4OJR A;  2KZM A;  3TAR A;  3OJS A;  3PX6 A;  1CZ9 A;  2O4G A;  1ASV A;  1UA1 A;  3C6T A;  5KGW A;  4C8K A;  2HHW A;  3O4N A;  3NF6 A;  3S9H A;  4OLA A;  4ELV A;  2HND A;  1IKV A;  3CFP A;  1BL3 A;  3LZI A;  1D8Y A;  3E01 A;  1TVR A;  4IFV A;  4Q5V A;  4IDK A;  3LWL A;  4EZ6 A;  4DFP A;  2G8I A;  3HVR A;  5CYQ A;  3NH0 A;  4DU1 A;  1RT2 A;  4KB1 A;  3SPY A;  2QKB A;  1S6P A;  1Q9X A;  2E6M A;  2OPS A;  5E41 A;  3OVN A;  4O5B A;  2XY7 A;  1R0A A;  2KFZ A;  1TKT A;  3KLG A;  4LH4 A;  3ZSR A;  4CJ4 A;  1NKC A;  3S3M A;  2ATQ A;  2Z1H A;  4FZY A;  1NKB A;  3OS0 A;  5SWM A;  4CEC A;  4KRF A;  4CED A;  1IO2 A;  3ISN C;  1X9W A;  4RW4 A;  3RRH A;  1U04 A;  5D3G A;  1TGO A;  4L8R B;  3OYA A;  3SQ0 A;  4KTZ A;  1U4B A;  4BDZ A;  4N5S A;  1NJX A;  3HK2 A;  4CGH A;  3AVH A;  2DFF A;  4DFM A;  1SL2 A;  1SL0 A;  3MEC A;  1VSJ A;  4CE9 A;  5SZT A;  3MXI A;  1L3T A;  1JXB A;  4JRP A;  4FJ7 A;  4PUO A;  2X6N A;  4CJL A;  4YNQ A;  1JLE A;  2I5J A;  1GOB A;  4RW9 A;  3VQ6 A;  5K14 A;  2Z1I A;  1GOA A;  3G0Z A;  3QIN A;  1DTT A;  1IKX A;  3CYM A;  1IKW A;  4LSN A;  1C1B A;  4E3S A;  1FK9 A;  3TAE A;  1TKZ A;  3AVN A;  5CZ1 A;  1SKW A;  1QTM A;  4FM1 A;  3HP9 A;  5DMR A;  1LAV A;  4CJE A;  1VSM A;  4E7J A;  3V9Z A;  4B9U A;  2IGI A;  3HYF A;  4B9S A;  4DSL A;  2YNH A;  3NH2 A;  3TAM A;  3DLB A;  2XY6 A;  3I0S A;  4CCH A;  2VG6 A;  1LAW A;  2Z1J A;  2OPQ A;  5KRS A;  4CF1 A;  3RR7 A;  4FLW A;  1RT4 A;  4NCA A;  4DU3 A;  2VWJ A;  5J2Q A;  1ZBH A;  4KHQ A;  3AO3 A;  4DWI A;  3NDK A;  3AA5 X;  5EU7 A;  2XHB A;  1RT6 A;  3RRG A;  1VRU A;  1JL2 A;  4FJN A;  2IC3 A;  3BGR A;  4H4O A;  3EZ5 A;  3V81 A;  3TAF A;  3K59 A;  4KRE A;  4EZ9 A;  4J2E A;  4F3O A;  5KRT A;  1HNV A;  3DLK A;  3F9K A;  3OYF A;  2HW3 A;  3EYZ A;  3RMD A;  3AV9 A;  3CM6 A;  4RW6 A;  4CFD A;  3OYM A;  1KLN A;  3LP0 A;  1JLA A;  3LAM A;  3QO9 A;  2B4J A;  3LP3 A;  3DM2 A;  4Z0U A;  1NK8 A;  3OYC A;  4KO0 A;  1WLJ A;  1ZYQ A;  5C24 A;  3T3F A;  3QNN A;  3V9U A;  4FYD A;  2VG7 A;  4DQQ A;  1RT7 A;  4ELT A;  1RBV A;  1DLO A;  4BDP A;  2YNG A;  3QEP A;  4CIE A;  4M3X A;  4KAZ A;  1G15 A;  2X78 A;  5C42 A;  4MQ3 A;  4DTS A;  5J2M A;  3ZT4 A;  1I39 A;  3KLF A;  1BQM A;  4DTM A;  5I42 A;  4DQR A;  1BCO A;  1NK7 A;  3LPU A;  4Y1C A;  2YNI A;  4QOZ B;  1VSI A;  3AO2 A;  3KTQ A;  4I9Q A;  4O0J A;  5FRO A;  3NGZ A;  3QES A;  3K5L A;  3VQD A;  4E0D A;  2YNF A;  4RW7 A;  1TL3 A;  3MXJ A;  1WNS A;  1X9M A;  2HVI A;  3HT3 A;  3ZSV A;  3OY9 A;  4IFY A;  4B08 A;  3OYI A;  3ASM A;  3IG1 A;  3HM9 A;  1W9H A;  1NK5 A;  3RR8 A;  2KZZ A;  2NUB A;  5CZ2 A;  2BAN A;  3OYG A;  3LDS A;  4AH9 A;  4CJ5 A;  3VN5 A;  1C6V A;  5I3U A;  3KD1 E;  1RDD A;  1REV A;  4GW6 A;  4Z4G A;  4J2D A;  3V6D A;  4KV8 A;  4PWD A;  2D0A A;  3QLH A;  4M3Y A;  1L3U A;  4BE2 A;  3HPO A;  1U49 A;  1VSE A;  1WSJ A;  3HPH A;  1Y97 A;  2FBY A;  4CHP A;  4KB0 A;  4FJL A;  3P1G A;  2Q3S A;  3VQ9 A;  3DRP A;  4B8A B;  2XY8 A;  4F4K A;  5HBM A;  4IG3 A;  4CHQ A;  3ZSY A;  4KPY A;  4FCY A;  2P1J A;  2WOM A;  4DTX A;  4FXD A;  4CJS A;  4I9L A;  5CYM A;  1BI4 A;  1FKO A;  1YTU A;  4I2P A;  3AVK A;  4W5T A;  3NGI A;  2IDO A;  3CFR A;  3A2F A;  4DSK A;  4N47 A;  1HYV A;  1HJR A;  3L8B A;  1IH7 A;  4B9N A;  2OYQ A;  3AA3 A;  3DMJ A;  3FFI A;  1SKR A;  2G8V A;  1KSP A;  4H4M A;  1QSY A;  1TK8 A;  4BAC A;  1RDB A;  2FBV A;  1WSG A;  2HVH A;  3ZSO A;  3VQE A;  3MXM A;  1NK6 A;  3AVA A;  3RTV A;  3IRX A;  4DTN A;  4FJJ A;  4FJK A;  2D0C A;  4DFK A;  3TI0 A;  1L5U A;  3OYJ A;  4LY7 A;  4N76 A;  4M42 A;  1KFD A;  3NF7 A;  4IG0 A;  4AHV A;  4HHT A;  4FK4 A;  1EXQ A;  4FLZ A;  1UA0 A;  3HXM A;  3G10 A;  4CEQ A;  1J54 A;  1BIS A;  4FW2 A;  3V4I A;  4EP5 A;  2BGG A;  4DSF A;  3UIQ A;  3L2R A;  3KK1 A;  3OJU A;  2PZS A;  1ITG A;  1FXX A;  2P5G A;  4CJK A;  4KHU A;  3LP2 A;  4OPJ A;  2ZQB A;  1MU2 A;  1W0H A;  1A5W A;  2RKI A;  1JLF A;  3SUO A;  4DS4 A;  4FK0 A;  3SV4 A;  4DMN A;  4KHY A;  4B9T A;  4DQS A;  4E1M A;  1J5O A;  3KJV A;  1S5J A;  4DTP A;  3AVF A;  4B9M A;  1HYS A;  4BWM A;  4FJ8 A;  4CK3 A;  3C6U A;  1TKX A;  1BGX T;  3D45 A;  4LH5 A;  4BE1 A;  4CEO A;  1N5Y A;  4CF0 A;  1SKS A;  2G8U A;  1RCH A;  3AO4 A;  3VQ4 A;  4DTU A;  5J2P A;  3KLH A;  4CJR A;  3AVJ A;  1WSF A;  3SZ2 A;  1QQC A;  4CJU A;  4CGD A;  4DF8 A;  2A1R A;  1KTQ A;  1HPZ A;  1C0T A;  4I2Q A;  3B6O A;  3NCI A;  4NCB A;  1JLQ A;  1RNH A;  3AVL A;  4AHS A;  4OKK A;  1T8E A;  1LV5 A;  4C8O A;  4Z4I A;  2QKK A;  4AIL C;  4BDY A;  1S1V A;  1D9F A;  4B9L A;  4FZX C;  4CGJ A;  1TL1 A;  1XWL A;  3I0R A;  1U47 A;  5HRR A;  2X74 A;  3O3G A;  4ICL A;  4FK2 A;  3AVB A;  1L3S A;  2B5J A;  4CK2 A;  3OYE A;  1VSK A;  2FC0 A;  1YTA A;  3AO1 A;  4CGI A;  4CFB A;  5HRO A;  1BIZ A;  4W5R A;  4Y1D A;  3V9S A;  1QSS A;  4CEZ A;  5HRS A;  3K5M A;  5HLF A;  3ZT1 A;  4K8Z A;  4KKO A;  3PO4 A;  3ZSW A;  3HP6 A;  1A5X A;  2DY4 A;  5KI6 A;  1YVU A;  3DLR A;  1Z26 A;  1LWF A;  3VQQ A;  1RBU A;  3CM5 A;  2EHG A;  3LP1 A;  4HVJ A;  3SPZ A;  4IKF A;  3NF9 A;  4PA1 A;  1C1C A;  1ZBL A;  3DOK A;  1C1A A;  1Q8I A;  3VQ8 A;  4CF2 A;  3NHG A;  1SL1 A;  1KFS A;  2XRI A;  2WON A;  4CHO A;  3QEX A;  1NK0 A;  3OYK A;  4FJM A;  3PUF A;  1RDA A;  2YKN A;  4M3T A;  3AVI A;  2G8W A;  4N41 A;  3MEE A;  1S1W A;  4M45 A;  3SYZ A;  1JLC A;  4C8M A;  4DS5 A;  2JLE A;  3THV A;  4ZTJ A;  1U45 A;  2P5O A;  4QAG A;  3SI6 A;  2X6S A;  1VSL A;  4KTW A;  4I7F A;  2E6L A;  2R7Y A;  2HHV A;  4C8N A;  1BIU A;  4CJP A;  1O1W A;  2A1S A;  3QIO A;  1F21 A;  3AA4 A;  3DYA A;  2YHB A;  3NF8 A;  3V9W A;  4NCG A;  3TAG A;  4ZTF A;  1QE1 A;  4CFA A;  1TK0 A;  2G8F A;  4HCB A;  2RF2 A;  4E7H A;  4DTO A;  3D0P A;  2Y1J A;  3KIO A;  3V9X A;  3CFO A;  3CG7 A;  1J53 A;  4OGE A;  3QEI A;  4DSE A;  1VSD A;  3PX4 A;  3KK3 A;  3I8D A;  4FM0 A;  4DFJ A;  4DSI A;  1S9E A;  4CF8 A;  2GBZ A;  1S1X A;  3LWM A;  4WE1 A;  1FKP A;  3OYH A;  1KRP A;  2HHU A;  2FBX A;  2QXF A;  1XHX A;  1HMV A;  1WSH A;  2G8K A;  4OVL A;  2W42 A;  1B9F A;  5T7B A;  4ID1 A;  3NH1 A;  1WN7 A;  3VA3 A;  1HQE A;  4F2S A;  4W5O A;  3QIP A;  3OS2 A;  1RDC A;  3DI6 A;  1UAX A;  4DTR A;  4LD0 A;  4AHC A;  3RWU A;  1Z25 A;  2AJQ A;  4OLB A;  4CJF A;  2O4I A;  1LW2 A;  3HL8 A;  1JLB A;  1IKY A;  4CGG A;  4AHR A;  4UQG A;  4FM2 A;  1RBT A;  1WAF A;  3LAN A;  4FJH A;  3ALY A;  4DU4 A;  4CHZ A;  1RTI A;  4HUF A;  3RMA A;  1XI1 A;  3TR8 A;  1RT5 A;  3NBP A;  2G8H A;  4DLE A;  4G1Q A;  1RTJ A;  3TAQ A;  2PY5 A;  4FW1 A;  4GVM A;  5KGX A;  1S6Q A;  2HNY A;  3SUN A;  4RG8 A;  1NJW A;  3OYL A;  1N6Q A;  5FRN A;  2QK9 A;  3SQ2 A;  1KVA A;  3DRS A;  4M41 A;  4Q0B A;  3L3U A;  4JS4 A;  5J2N A;  4KHN A;  1S9G A;  4OPK A;  4KHS A;  1VRT A;  1NOY A;  1BHL A;  1LWE A;  1T05 A;  3VQB A;  4AHU A;  1CXU A;  3B6P A;  3ZCM A;  3MAQ A;  1UOC A;  3V1Q A;  3K5O A;  3K58 A;  1D5A A;  3ZSQ A;  4DQP A;  3KKR A;  4O44 A;  2OZM A;  4ELU A;  2F8T A;  4CJT A;  2RPI A;  1X1P A;  1L3V A;  4F3T A;  4E7L A;  1EP4 A;  1NKE A;  4E19 A;  2OPP A;  1DTQ A;  3F73 A;  2YV0 X;  4FLT A;  3VQP A;  1TAQ A;  4F8R A;  4ZHR A;  2XO7 A;  3WNH A;  1IG9 A;  3TWH A;  4CHN A;  3S3O A;  1NJZ A;  2ZD1 A;  3AVM A;  3M8Q A;  4CIF A;  2HMI A;  5HP1 A;  1SUQ A;  3AO5 A;  3TAP A;  1T03 A;  2HHS A;  2ZE2 A;  4CFC A;  3SUQ A;  3AVC A;  5C25 A;  1TK5 A;  2ITG A;  1ZBU A;  3P5J A;  4CEE A;  1XC9 A;  1NK9 A;  1U48 A;  3S3N A;  4CEA A;  2KW4 A;  4FVM A;  3VQ5 A;  4FLX A;  2PYL A;  2PYJ A;  4C8L A;  1KVC A;  3DLE A;  2Y1I A;  2KQ2 A;  1RT3 A;  1EET A;  1WSE A;  2Z1G A;  3WNE A;  4DQI A;  1ASU A;  3PX0 A;  3LPT A;  1X9S A;  2HHQ A;  1TKD A;  4K8X A;  1S1T A;  3CQ8 A;  4HUE A;  3SQ4 A;  4FJX A;  1J9A A;  2B6A A;  1RTD A;  4FJ5 A;  5JS2 A;  3QET A;  1HQU A;  1D9D A;  1KVB A;  2HHT A;  1JXE A;  3HJF A;  4CIG A;  2ETJ A;  1CLQ A;  4DSJ A;  1JKH A;  4GMJ B;  1JL1 A;  3KKS A;  1VSH A;  3O3H A;  3PO5 A;  2DTU A;  1RTH A;  3VQA A;  4CJ3 A;  5HRN A;  1B92 A;  3RMC A;  4B9V A;  4DG1 A;  5FRM A;  2D0B A;  4XIU A;  4DF4 A;  3TAN A;  3M8S A;  1C0M A;  3OYD A;  3SQ1 A;  3HO1 A;  2IAJ A;  4CK1 A;  2VG5 A;  2YKM A;  4CEF A;  4O0I A;  3MEG A;  4YFU A;  3O3F A;  3ULD A;  2HNZ A;  1NK4 A;  3HST B;  3AA2 A;  1WSI A;  3K2P A;  5J1E A;  1LWC A;  4E7I A;  3RMB A;  4M3R A;  3NE6 A;  3JYT A;  4E89 A;  3P83 D;  3ZSZ A;  1UWB A;  4DTJ A;  3U6F A;  1Q9Y A;  4KI4 A;  2IOC A;  3EY1 A;  4M3Z A;  1HYZ A;  4IBN A;  4MFB A;  4FJG A;  2KTQ A;  3DOL A;  1BCM A;  3L2Q A;  1T7P A;  1XHZ A;  3NAE A;  1B9D A;  2VWK A;  4CEB A;  5KTQ A;  1QSL A;  3KLI A;  3DLH A;  4Z4F A;  3KK2 A;  3VQC A;  4JS5 A;  3LZJ A;  3QNO A;  3KLE A;  3SV3 A;  5HRP A;  3LAL A;  1RBR A;  3U3Y A;  4CHY A;  4JRQ A;  4AHT A;  4FZZ A;  2YHA A;  4OGC A;  2D5R A;  4CF9 A;  3V1O A;  1VK0 A;  4E7K A;  2IS3 A;  3DRR A;  3L2V A;  4LSL A;  1EKE A;  4CJQ A;  3PY8 A;  1GOC A;  4FLY A;  3TAB A;  2OPR A;  3OYN A;  2GV9 A;  2KFN A;  4KTQ A;  3ZT2 A;  4OKJ A;  1RBS A;  2FBT A;  1BQN A;  3T1A A;  3OYB A;  2OZS A;  4CER A;  4E1N A;  2LSN A;  3KD5 E;  4FLU A;  4W5N A;  3HPG A;  3QEV A;  1YT3 A;  4Z4E A;  3DLG A;  4KFB A;  4EP4 A;  3QEW A;  1JLG A;  3T19 A;  3L3V A;  4FJI A;  2HHX A;  3VQ7 A;  5FDL A;  3SNN A;  4KI6 A;  4BE0 A;  1A5V A;  1KLM A;  1TAU A;  4BWJ A;  3V1R A;  3M8P A;  4CES A;  3L2U A;  2F96 A;  2EX3 A;  4W5Q A;  4HUG A;  1RT1 A;  2GUI A;  3K57 A;  2P51 A;  2DFH A;  4HCC A;  4R5P A;  1RIL A;  3L2W A;  4NYN A;  4H8K A;  3K5N A;  4OKE A;  4TSX A;  1CZB A;  4FLV A;  4M3U A;  4KHW A;  4PY5 A;  2BDP A;  3U3G A;  3ZT3 A;  4Z4H A;  3IAY A;  1C0U A;  1KCF A;  2E4L A;  2F8S A;  1ZBF A;  1VSF A;  4NYF A;  3BDP A;  4CJV A;  4ID5 A;  1CXQ A;  3NFA A;  1LW0 A;  3WNF A;  2DFE A;  3WNG A;  1HRH A;  1HNI A;  3HVT A;  3C95 A;  3SCX A;  4B8C A;  3ZSX A;  1WAJ A;  3JSM A;  1ASW A;  1K6Y A;  4O55 A;  3VA0 A;  2OA8 A;  4F2R A;  4CGF A;  2JGU A;  3AVG A;  5CY4 A;  2HB5 A;  4RW8 A;  1NOZ A;  4N56 A;  4DLG A;  3M8R A;  1SV5 A; 
#chains in the Genus database with same CATH topology
 4QCL A;  1QVF M;  2QTD A;  3A0I X;  3C94 A;  2HOE A;  2ZWH A;  3MED A;  4J2A A;  4YOU A;  3O4Q A;  3PV8 A;  3VTH A;  3QER A;  4HTU A;  4OJR A;  4IXC A;  4IJA A;  5KGW A;  4BGA A;  3J81 O;  3O4N A;  3S9H A;  1NGI A;  3E01 A;  4IFV A;  4Q5V A;  4L3Q A;  4DU1 A;  3SBT A;  5ADX A;  2QKB A;  3SPY A;  1S6P A;  3HSC A;  2OPS A;  3KLG A;  4CJ4 A;  3P31 A;  2Z1H A;  1NKB A;  5SWM A;  4KRF A;  4DR1 K;  2P9S A;  4CED A;  1X9W A;  4K42 A;  4XH5 A;  1TGO A;  3OYA A;  5AQR A;  4BDZ A;  3O9R A;  3HK2 A;  3AVH A;  3MEC A;  3MXI A;  5GAD P;  1XQS C;  5IT9 O;  2X6N A;  4YNQ A;  3CCS N;  1GOB A;  3GE1 A;  2Z1I A;  3WQU A;  1GOA A;  2Q36 A;  3SAF A;  4B3R K;  1DTT A;  1C1B A;  2E2N A;  1LAV A;  3V9Z A;  4CBU A;  1NGA A;  2O8D B;  2Q31 A;  2XY6 A;  3I0S A;  4FOI A;  2E88 A;  3M1F A;  5KRS A;  2OPQ A;  2KLA A;  4CF1 A;  4AM6 A;  3THX B;  1QQM A;  1ZBH A;  5AQZ A;  3AA5 X;  5AQK A;  2HHH K;  5GAG P;  3M6G A;  4FJN A;  2IC3 A;  3BGR A;  5AQT A;  1H1V A;  4J2E A;  3TSP A;  3DLK A;  3F9K A;  3CM6 A;  1JLA A;  2JWK A;  3LP3 A;  3DM2 A;  1NK8 A;  3VEZ A;  4KO0 A;  3QNN A;  1KC8 O;  4FYD A;  4DQQ A;  4ELT A;  4GV9 A;  1RBV A;  3QEP A;  4IJN A;  2W6L A;  1OKJ A;  3R9P A;  5AQX A;  3VMF B;  3KTQ A;  3DXK B;  5FRO A;  1WNS A;  4B08 A;  2RHK A;  3ASM A;  5AQH A;  4AQY K;  1W9H A;  3LDS A;  1C6V A;  3AGK A;  3T69 A;  2A41 A;  4KV8 A;  1GLE G;  4PWD A;  3QLH A;  4CHP A;  1WSJ A;  3EE9 A;  3HPH A;  3KK7 A;  4FJL A;  3I55 N;  1EQY A;  4DR6 K;  3ZEU B;  2WOM A;  4FCY A;  4K43 A;  4CJS A;  4I9L A;  1BI4 A;  1YTU A;  4W5T A;  4DSK A;  2IDO A;  3CFR A;  1VQL N;  3CCQ N;  3DMJ A;  4YOR A;  4G9Z A;  1KSP A;  4H4M A;  3KZB A;  4BAC A;  5BRE A;  4BY9 C;  5LJW A;  5DM7 L;  3MXM A;  3TI0 A;  3VPZ A;  1KFD A;  4AHV A;  4FK4 A;  1EXQ A;  1UA0 A;  4CEQ A;  4DSF A;  3L2R A;  2AP1 A;  3OJU A;  2PZS A;  1ITG A;  1FXX A;  4UY8 O;  3LP2 A;  1A5W A;  2RKI A;  1VQ9 N;  3SV4 A;  4DQS A;  1J5O A;  4DTP A;  3KWI A;  4BWM A;  2PAV A;  4BR5 A;  4CZG A;  4CEO A;  1T6C A;  3FFK B;  4CF0 A;  2G8U A;  1WB9 A;  5J2P A;  3KLH A;  3AVJ A;  4ILH A;  3SZ2 A;  3FLC O;  4BRN A;  1QHA A;  2W6K A;  2A1R A;  3B6O A;  3LM2 A;  4Z4I A;  4JD2 B;  2QKK A;  4BDY A;  1D9F A;  4FZX C;  1XWL A;  3I0R A;  1U47 A;  3F9M A;  1EWR A;  3P39 A;  2E2P A;  1VSK A;  2FC0 A;  3AO1 A;  4CGI A;  5HRO A;  1BIZ A;  1WUA A;  1QSS A;  4I6M A;  4GKK K;  3ZSW A;  4JV5 K;  1A5X A;  3C7N B;  1FJG K;  4H0P A;  1YVU A;  1Z26 A;  3VQQ A;  2EHG A;  1Q7Y O;  1MWK A;  1ZBL A;  3MN6 A;  1Q8I A;  1SL1 A;  4JN4 A;  2P9L B;  2WON A;  4CHO A;  3G6E N;  3ULE B;  3DAW A;  4N41 A;  5E84 A;  5FPD A;  4M45 A;  4B1X B;  5AQO A;  4DV3 K;  1VSL A;  1M90 O;  2E6L A;  5AQS A;  1O1W A;  2A1S A;  3NF8 A;  3MK6 A;  5AZJ A;  1BG3 A;  5I9E B;  1TK0 A;  1QE1 A;  3MX2 A;  4E7H A;  3CG7 A;  3QEI A;  1Z6R A;  2GEM A;  3ZYY X;  1GLF O;  4CF8 A;  4LF8 K;  3T1H K;  4WE1 A;  1FKP A;  1DGK N;  2FBX A;  4WYB A;  4NXM K;  2G8K A;  4OVL A;  5T7B A;  4ID1 A;  2O8E A;  1WN7 A;  3ZET B;  4DV0 K;  2QWO A;  4R79 A;  3RWU A;  3HL8 A;  1JLB A;  1IKY A;  2ZGZ A;  4AHR A;  2FXU A;  4IO9 L;  3LAN A;  4E1J A;  3ALY A;  5TKY A;  4LF5 K;  4JI7 K;  3KHY A;  2P9U B;  4G1Q A;  3VEO A;  2ITM A;  3TAQ A;  2PY5 A;  3IKM A;  5JVH L;  3SUN A;  5FRN A;  4RG8 A;  3OYL A;  3SQ2 A;  3L3U A;  4JS4 A;  1HNZ K;  4KHN A;  4PKG A;  1NOY A;  1LWE A;  4FWL A;  3VQB A;  1YVN A;  2FLO A;  4BRE A;  1UOC A;  3K58 A;  1T3V A;  4K25 A;  1X1P A;  1L3V A;  1EP4 A;  1NKE A;  4E19 A;  2OPP A;  4NLB A;  2YV0 X;  3TTF A;  4FLT A;  4BRF A;  1TAQ A;  2CGL A;  4M7X A;  2XO7 A;  3WNH A;  3TWH A;  3QBW A;  1GLC G;  2HMI A;  5HP1 A;  3DLL L;  3TAP A;  4BR9 A;  3SJH A;  3LL3 A;  5C25 A;  1ZBU A;  3MX5 A;  1U48 A;  2PYJ A;  2GEL A;  4DR4 K;  2QWP A;  1ZC6 A;  3BZK A;  1KVC A;  2KQ2 A;  1WBB A;  3LPT A;  5AQQ A;  1X9S A;  2W41 A;  4X64 K;  4K8X A;  3IFR A;  1LOT B;  2V51 B;  5GAE P;  5JS2 A;  1U6Z A;  2HHT A;  4CIG A;  1KAZ A;  3W3D A;  4GMJ B;  2W40 A;  5AFU A;  3PO5 A;  3C65 A;  4DG1 A;  4KBO A;  4XIU A;  3J7Z O;  3VEW A;  4CBW A;  3MN9 A;  3OYD A;  4O0I A;  2YKM A;  4CEF A;  1RDW X;  3K2P A;  1Y64 A;  1WSI A;  3AA2 A;  3O9Q A;  3H1Q A;  4M3R A;  3ZSZ A;  4DTJ A;  1NGJ A;  1HYZ A;  2UXD K;  3WXL A;  3SAH A;  3L2Q A;  2HST A;  3NAE A;  1U2V B;  3DLH A;  4BVO A;  3VQC A;  3QNO A;  3LZJ A;  3KLE A;  3SV3 A;  4CHY A;  4JRQ A;  4AHT A;  1VQN N;  2YHA A;  3V1O A;  4E7K A;  3O4W A;  5BRH A;  3L2V A;  1OH5 A;  5ADX H;  2OPR A;  4NO7 A;  2GV9 A;  3OYN A;  2KFN A;  3GL1 A;  1RBS A;  2FBT A;  4CER A;  3QEV A;  3VES A;  3WXK A;  3BZC A;  4EP4 A;  3QEW A;  3HZ6 A;  3T19 A;  1TYQ B;  3L3V A;  3L6Q A;  2HHX A;  3VQ7 A;  4BC3 A;  3THW A;  1NMN A;  1NGG A;  4DR2 K;  3M8P A;  4JKG B;  2GUI A;  4HCC A;  3FZK A;  4R5P A;  3L2W A;  2P9I A;  3H3N O;  4NYN A;  3K5N A;  4TSX A;  4M3U A;  4ISE A;  4IWV A;  1C0U A;  1KCF A;  2E4L A;  5AQV A;  4KH6 A;  2F8S A;  2F7T A;  4NYF A;  4ID5 A;  2A6A A;  3WNG A;  1KAX A;  1N8R O;  4PL8 A;  4BRP A;  4CGF A;  3H1V X;  2HB5 A;  2D0O A;  4DLG A;  2ASM A;  1BI4 B;  4JKH A;  1YIJ N;  3CD6 N;  1TV6 A;  3O08 A;  4CJW A;  3O80 A;  4M3W A;  5KPT A;  3UKR A;  1QS4 A;  5GAH P;  3OS1 A;  1ZBI A;  4JLH A;  2HBL A;  1EX4 A;  4FOE A;  1I3A A;  3SJJ A;  3ZLJ A;  1NJY A;  3IS9 A;  1IJJ A;  4A59 A;  3TAR A;  3OJS A;  3PX6 A;  2O4G A;  4B1Y B;  2IVP A;  3C6T A;  1UA1 A;  5C2F A;  5C15 A;  4ELV A;  4LF9 K;  4Z94 A;  1IKV A;  3CFP A;  3LZI A;  1HKB A;  3CC4 N;  1X3N A;  4BR0 A;  4IDK A;  4DFP A;  2G8I A;  4BQZ A;  3NH0 A;  3CCR N;  4KB1 A;  5E41 A;  3OVN A;  2KFZ A;  1TKT A;  4FZY A;  3S3M A;  4HTL A;  4CEC A;  3VET A;  3CCU N;  4RW4 A;  1NLV A;  3SQ0 A;  4KTZ A;  1U4B A;  1OH7 A;  4N5S A;  2DFF A;  4DFM A;  1SL0 A;  1XNR K;  1JXB A;  4OPH A;  3CET A;  4RW9 A;  3VQ6 A;  2IVN A;  3UE5 A;  3G0Z A;  3L4I A;  4LSN A;  1QTM A;  1FK9 A;  4B9Q A;  1TKZ A;  5CZ1 A;  3TAE A;  3HP9 A;  5DMR A;  5AQY A;  4B9U A;  2IGI A;  3HYF A;  1HUX A;  3DLB A;  3OBY A;  2Z1J A;  4QS9 A;  2NRT A;  1NGF A;  1RT4 A;  5J2Q A;  2VWJ A;  3P4I A;  4BG9 A;  4DWI A;  4V19 S;  3E66 A;  1YHQ N;  2HBJ A;  3RRG A;  1VRU A;  1JL2 A;  3MCA B;  3V81 A;  4BR7 A;  3TSU A;  3K59 A;  5KRT A;  1HNV A;  2HW3 A;  5JLF A;  2D0P A;  3RMD A;  3AV9 A;  5EOY A;  4RW6 A;  3OYM A;  2B4J A;  3WXI A;  4Z0U A;  1ZYQ A;  4JK8 A;  3V9U A;  1XMO K;  1DLO A;  4M3X A;  4KAZ A;  1G15 A;  2X78 A;  4DTS A;  4MQ3 A;  3S41 A;  4O8U A;  5I42 A;  4FSV A;  4Y1C A;  4QOZ B;  1VSI A;  4C1N K;  4MO4 A;  3NGZ A;  2JWL A;  3VQD A;  4ISF A;  4CZH A;  1TL3 A;  2FF6 A;  3SBG A;  1GLL O;  3OY9 A;  3IG1 A;  2NUB A;  2BAN A;  3WXM B;  4QS8 A;  3AY9 A;  5I3U A;  1RDD A;  3A5O C;  2ZJR L;  1REV A;  4J2D A;  3V6D A;  4M3Y A;  1NWK A;  5AQN A;  5M1O A;  4BE2 A;  1U49 A;  5M1F A;  4KB0 A;  2Q3S A;  4B8A B;  5HBM A;  5H1S Q;  5BN8 A;  3ZSY A;  4KPY A;  2P1J A;  3ZX3 A;  3JS6 A;  1FKO A;  2OTL N;  4I2P A;  3NGI A;  4N47 A;  1HYV A;  1HJR A;  2GWK A;  4MDB A;  1Q18 A;  4B9N A;  2HBK A;  2OYQ A;  1DT9 A;  4JKC A;  2G8V A;  1QSY A;  1TK8 A;  1RDB A;  1N34 K;  3THY B;  2FBV A;  3R8E A;  2HVH A;  1NK6 A;  3VQE A;  4FJK A;  4KI6 A;  4CZJ A;  4FJJ A;  2D0C A;  3PLA A;  1RFQ A;  3NF7 A;  4IG0 A;  4HHT A;  3FE1 A;  1J54 A;  1BIS A;  2NRW A;  3KK1 A;  1NGE A;  1SS6 A;  1MU2 A;  1JLF A;  4DS4 A;  1YUW A;  4FK0 A;  4DMN A;  3OBW A;  3KJV A;  3AVF A;  1HYS A;  4BRH A;  2CH5 A;  4FJ8 A;  4BE1 A;  5HL7 L;  4JI6 K;  1SKS A;  4DTU A;  2QA4 N;  1WSF A;  3CER A;  4CGD A;  2NRV A;  4DF8 A;  1NGH A;  5TKW A;  4M7Y A;  1JLQ A;  3EEQ A;  2QM1 A;  5AJ3 K;  2O8D A;  4CGJ A;  3GG4 A;  4H03 B;  5AZI B;  4CJ7 A;  3CC7 N;  3O3G A;  4KH5 A;  4JHD A;  2B5J A;  4DQ8 A;  3ID8 A;  1X3M A;  2Q1N A;  2VGM A;  4H5N A;  4Y1D A;  2Q2R A;  3K5M A;  4KKO A;  1IG8 A;  5AQL A;  2O8F A;  3HP6 A;  2YI1 A;  1LWF A;  5AQJ A;  4LF6 K;  2UUA K;  3LP1 A;  4HVJ A;  4B1Z A;  4IKF A;  4PA1 A;  1C1C A;  3ENO A;  1KFS A;  4YOY A;  3PSF A;  2XRI A;  3R1X A;  1NK0 A;  3PUF A;  1RDA A;  2YKN A;  2G8W A;  3DJC A;  3O6W A;  3MN5 A;  3SYZ A;  1JLC A;  1ZXO A;  4DS5 A;  2JLE A;  3THV A;  4ZTJ A;  3DXM A;  3NVK A;  4QAG A;  2H3G X;  4JAX A;  4PKH A;  2R7Y A;  2E2O A;  1BIU A;  1O13 A;  4O8K A;  3AA4 A;  3V9W A;  1W97 L;  4FWK A;  4CFA A;  4HCB A;  3D0P A;  3A8Y A;  4GVE A;  4CBX A;  3JXU A;  4BRM A;  1J53 A;  3ULE A;  3VTI A;  3PX4 A;  1VSD A;  3WEE A;  3KK3 A;  4DFJ A;  4FM0 A;  4A61 A;  4DSI A;  1S9E A;  2GBZ A;  3LWM A;  1J6Z A;  1T6D A;  3GDQ A;  1XHX A;  4H0T B;  1WSH A;  3CQX A;  3IUC A;  3O8M A;  1HQE A;  4F2S A;  3A5M C;  1RDC A;  3DI6 A;  1XUP O;  2OCE A;  2UYT A;  5B8H A;  4DR7 K;  3M5R A;  2O8C B;  4LC9 B;  1QZ6 A;  1HR0 K;  1BOT O;  4UQG A;  4FM2 A;  2P9K A;  4HUF A;  3TR8 A;  1RT5 A;  5C2D A;  5CHI A;  1NM1 A;  4FW1 A;  5KGX A;  3F2K A;  3FR0 A;  4H0V B;  2QK9 A;  3MCP A;  1QVG M;  3D2E A;  5J2N A;  4OPK A;  1ZBS A;  2FSJ A;  1BHL A;  1T05 A;  1V4S A;  4CW7 B;  4AHU A;  4BR2 A;  1CXU A;  3AAR A;  3KKR A;  3LDL A;  4CZL A;  2OZM A;  4HWI A;  3F73 A;  1DTQ A;  3FGU A;  4DR3 K;  2WUS A;  5GIN A;  1IG9 A;  1BUP A;  2I7N A;  4CHN A;  1NJZ A;  3M8Q A;  3AVM A;  4CIF A;  2HHS A;  4MDA A;  4CFC A;  4JD2 A;  1TK5 A;  3K0S A;  1NK9 A;  1QQN A;  3S3N A;  1S22 A;  2HF4 A;  3VQ5 A;  2YJE A;  2Y1I A;  1OH8 A;  1RT3 A;  1WSE A;  1ASU A;  1ATS A;  2HHQ A;  1TKD A;  4HUE A;  3K9J A;  4FJX A;  1VQ6 N;  1E4F T;  3QET A;  5LY3 A;  3O3H A;  2DTU A;  3VQA A;  5HRN A;  1Q81 O;  4IZ9 A;  2D0B A;  3A5L C;  2NRH A;  2BTF A;  3SQ1 A;  4DV2 K;  3NMU A;  4J8F A;  4H0O A;  3L4Q A;  1LWC A;  2VQF K;  3UKU B;  4E7I A;  2A3Z A;  4E89 A;  4KI4 A;  5BR8 K;  4MFB A;  4FJG A;  2KTQ A;  3DOL A;  1BCM A;  1XHZ A;  3FZM A;  5FPM A;  4CEB A;  4Z4F A;  4CVN E;  3KK2 A;  4JS5 A;  5BPL A;  3LAL A;  1WOQ A;  1GLJ O;  4IFE A;  3RSE B;  4K0K K;  2IS3 A;  3BUZ B;  4LSL A;  3LDN A;  1VQO N;  2ASP A;  4EAH D;  2OZS A;  1BQN A;  3OYB A;  4LF4 K;  2LSN A;  5LMN K;  4FLU A;  3KD5 E;  4W5N A;  3G71 N;  1YT3 A;  2NZT A;  4Z4E A;  3DLG A;  3ID6 A;  4FJI A;  5FDL A;  2O8B B;  1A5V A;  1KLM A;  3V1R A;  4YHH K;  4RWT A;  1OH6 A;  4HUG A;  3K57 A;  2P51 A;  2V7Z A;  3VF2 A;  3I33 A;  1RIL A;  5M1N A;  3J7Y P;  1N36 K;  1V4T A;  1K8K A;  1Q82 O;  1NJI O;  4OPA A;  4FLV A;  2BDP A;  2E1Z A;  3KVG A;  3R3L A;  4H5W A;  4QS7 A;  1VSF A;  3VF6 A;  1CXQ A;  3MWT A;  1LW0 A;  2GWJ A;  3OW2 M;  3U9Z A;  3HVT A;  3C95 A;  3SCX A;  3ZSX A;  1WAJ A;  2NNW A;  3JSM A;  1ASW A;  3DWL A;  3VA0 A;  2OA8 A;  3SMS A;  3QML A;  3M8R A;  3SUP A;  1FW6 A;  3U4L A;  1R59 O;  2P9P B;  4FJ9 A;  3RVC A;  2OTJ N;  4J2B A;  4DV6 K;  3OA9 A;  1KAY A;  4X62 K;  3MDQ A;  3UB5 A;  1ASV A;  1HNW K;  3NF6 A;  4XEI A;  3SK3 A;  1TVR A;  2ZM6 K;  3LWL A;  1VQ4 N;  4EZ6 A;  5AQP A;  3HVR A;  5CYQ A;  1MDU B;  1RT2 A;  5BR9 A;  3HOT A;  1Q9X A;  4JKA A;  2XY7 A;  4O5B A;  2QXL A;  4IEI A;  2A42 A;  3ZSR A;  1N33 K;  1NKC A;  1QQO A;  3OS0 A;  3WT0 A;  5D3G A;  3RRH A;  1K73 O;  4L8R B;  1NJX A;  4CGH A;  4JEP A;  4CE9 A;  1VSJ A;  4MLH A;  5SZT A;  1W7A A;  3CCV N;  4H0X B;  4C23 A;  4PUO A;  4CJL A;  2GX9 A;  1JLE A;  2VYP A;  2ASO A;  2I5J A;  3MMV A;  3AAQ A;  3B8A X;  2QWL A;  1IKX A;  1IKW A;  3CYM A;  4ILG B;  4YDU C;  4RCH A;  1SKW A;  4I6M B;  2IIR A;  2NRZ A;  4WFN L;  2Q0U A;  2P9N A;  3NH2 A;  1E4G T;  4B3T K;  2UXC K;  4CCH A;  4A2A A;  4LFB K;  4FLW A;  4NCA A;  2V52 B;  4DU3 A;  4IOA L;  1T44 A;  1NG9 A;  3AO3 A;  3CMA N;  3CCL N;  3NDK A;  2XHB A;  4IOX A;  3I8B A;  3CPE A;  4H4O A;  3TAF A;  3EZ5 A;  4KRE A;  2BUP A;  4BG8 A;  3AAP A;  4F3O A;  4CFD A;  3ZX2 A;  3LDP A;  1WLJ A;  3T3F A;  2ZJQ L;  3CJB A;  4CIE A;  5C42 A;  1YJN N;  3ZT4 A;  5M1P A;  4DTM A;  3GOI A;  4B1W B;  3LPU A;  4I9Q A;  3QES A;  3K5L A;  4E0D A;  2E20 A;  1IV0 A;  2YNF A;  4RW7 A;  3MXJ A;  3TTD A;  1KD1 O;  4NCB A;  4IFY A;  3ZEU A;  3RR8 A;  2KZZ A;  5CZ2 A;  4NLC A;  1XNQ K;  3J7A P;  4AH9 A;  4CJ5 A;  2UXB K;  3FZL A;  3VN5 A;  3C6A A;  5JIC A;  4GW6 A;  2WFB A;  4Z4G A;  3DXK A;  2D0A A;  1L3U A;  3HPO A;  4LFA K;  1VSE A;  1Y97 A;  2FBY A;  3DRP A;  2XY8 A;  4IG3 A;  4CHQ A;  4A2B A;  4DTX A;  5EY4 A;  4FXD A;  2Q97 A;  4FPA A;  3A2F A;  1K8A O;  3L8B A;  4RTF D;  1I94 K;  4MLE A;  2E1Y A;  1SKR A;  1BA0 A;  5EXW A;  3QFP A;  3D2E B;  4DUY K;  1WSG A;  1WBD A;  3AVA A;  3RTV A;  3IRX A;  4DTN A;  4CI6 A;  4DV7 K;  3OYJ A;  4IEE A;  4LY7 A;  3HXM A;  3G10 A;  4FW2 A;  3V4I A;  3UIQ A;  3Q7B A;  4CJK A;  4OPJ A;  3SUO A;  3NVM A;  4BC5 A;  4B9M A;  4E1M A;  4AF1 A;  3C6U A;  3D45 A;  1BA1 A;  1BGX T;  2VGN A;  3KWG A;  4CK3 A;  2IVO A;  1RCH A;  3AO4 A;  3VQ4 A;  4H5V A;  4JI2 K;  3CJ7 A;  1QQC A;  4CJU A;  3VF4 A;  1C0T A;  5C0Y A;  3CHW A;  1RNH A;  3AVL A;  4AHS A;  1T8E A;  1ATR A;  1LV5 A;  4C8O A;  3R6M A;  3CI5 A;  3HBT A;  4AIL C;  5GIO A;  2FSK A;  2X74 A;  4JKD A;  1HX1 A;  1JJ2 M;  1MA9 B;  1L3S A;  4CK2 A;  3OYE A;  4CD1 A;  3G4S N;  2UU9 K;  4W5R A;  3QFU A;  3VGK A;  3V9S A;  5CR4 A;  3ZT1 A;  3PO4 A;  2DY4 A;  5KI6 A;  5LJV A;  1RBU A;  1VQM N;  2EWS A;  3NF9 A;  4O5F A;  4CF2 A;  1K9M O;  3VEY A;  4JKG A;  5KPZ A;  4FJM A;  3BF1 A;  3CC2 N;  4F9O A;  3MEE A;  2CH6 A;  4C8M A;  1BWF O;  4GY2 B;  4LFC K;  3SI6 A;  4FPB A;  1JCF A;  4I7F A;  3TSQ A;  3ZX0 A;  2HHV A;  4CJP A;  5FPE A;  1F21 A;  3O5B A;  3DYA A;  3I56 N;  2G8F A;  4ZTF A;  3QB0 A;  2RF2 A;  2Y1J A;  5F0X A;  1NGB A;  3KIO A;  3V9X A;  4H5R A;  4IDH A;  2D4W A;  4FWP A;  1OVY A;  4OGE A;  4DSE A;  3D2F A;  1TYQ A;  1S1X A;  3EO3 A;  4FVU A;  2HHU A;  2QXF A;  4PKI A;  1HMV A;  3VEV A;  3SLC A;  3VA3 A;  4YOV A;  4W5O A;  4DTR A;  1UAX A;  4GNI A;  4AHC A;  1JCG A;  1Z25 A;  5AQU A;  4JKE A;  4OLB A;  4CJF A;  2AJQ A;  1NGC A;  1WAF A;  1NGD A;  4CHZ A;  1RTI A;  3RMA A;  3T1Y K;  1HKC A;  3M3Z A;  4GVM A;  1N6Q A;  1NU0 A;  1KVA A;  4WFB L;  4M41 A;  4Q0B A;  4KHS A;  1TUY A;  1VRT A;  1IBL K;  2V7Y A;  3EKS A;  3B6P A;  3ZCM A;  2CGK A;  3D7E O;  4JI8 K;  3K5O A;  4DQP A;  2P9P A;  3AGR A;  4O44 A;  4ELU A;  4F3T A;  4E7L A;  2P9L A;  3IDH A;  2F9W A;  4ZHR A;  4GKJ K;  2I7P A;  2NRR A;  3S3O A;  1NNE A;  2ZD1 A;  4A62 A;  1P90 A;  2HBM A;  3AO5 A;  5FPN A;  2QWQ A;  3SUQ A;  3AVC A;  3L0Q A;  4B3M K;  1X9J A;  4CEE A;  2J4R A;  1GLA G;  5ELZ A;  4CEA A;  2KW4 A;  4FVM A;  3OTO K;  3DLE A;  4Y0W A;  1VQP N;  5GIP A;  3PX0 A;  2ZGY A;  3Q7C A;  1S1T A;  3CQ8 A;  2B6A A;  2KKZ A;  1HQU A;  4ILJ A;  1KVB A;  5KQD A;  2CGJ A;  3THY A;  1D9D A;  2ETJ A;  2E2Q A;  1CLQ A;  4DSJ A;  1NMD A;  1CZA N;  1JKH A;  3JAM O;  1JL1 A;  3KKS A;  4FL9 A;  4DV1 K;  3A5N C;  2O8E B;  4DUZ K;  3J80 O;  4DF4 A;  2P9S B;  3TAN A;  3M8S A;  2OAN A;  2IAJ A;  4CK1 A;  2VG5 A;  3UKR B;  4M63 C;  3O3F A;  1NK4 A;  4BRA A;  4JI3 K;  1YI2 N;  3RMB A;  3NE6 A;  3JYT A;  1Q9Y A;  2IOC A;  3TU5 A;  1S72 N;  1T7P A;  4NB4 A;  5KTQ A;  1QSL A;  1RBR A;  1VQ8 N;  3U3Y A;  1YJ9 N;  1YF5 L;  4CF9 A;  3CF5 L;  3PY8 A;  4FLY A;  1C0F A;  1GLB G;  3LDO A;  3ZT2 A;  5AQI A;  4OKJ A;  2GTD A;  3H3O B;  4E1N A;  2QEX N;  3FZF A;  3CJA A;  3C7N A;  1JLG A;  3CJ9 A;  2QWN A;  4WQ5 C;  3CJC A;  4BE0 A;  4WCE L;  1TAU A;  4CES A;  3L2U A;  1JCE A;  4W5Q A;  3W0L A;  1RT1 A;  2DFH A;  1ATN A;  4OKE A;  3J8A A;  1CZB A;  2WBN A;  3ZT3 A;  1D4X A;  4JYA K;  4B3S K;  4C1N I;  1ZBF A;  4CJV A;  5AZJ B;  3NFA A;  3WNF A;  2DFE A;  1HNI A;  1HNX K;  4PL7 A;  2YHW A;  4EIA A;  4B8C A;  1K6Y A;  4F2R A;  4O55 A;  5EVZ A;  5CY4 A;  4RW8 A;  2WC9 A;  5HOO A;  4B3O A;  3O1W A;  5JS1 A;  3LAK A;  3NGY A;  4FWN A;  3CPW M;  2XY5 A;  2RN2 A;  1HPM A;  3ITH A;  2BE2 A;  1QHT A;  5DK5 A;  4Z4C A;  3PIO L;  4OO1 J;  1S1U A;  4KH4 A;  5AQM A;  4O4G A;  3H08 A;  3ZT0 A;  4PQU A;  2KZM A;  4BRQ A;  4NXN K;  1CZ9 A;  4C8K A;  2HHW A;  2PBD A;  1U2V A;  4YDU A;  4OLA A;  2HND A;  5BPM A;  1BL3 A;  2F4V K;  1EO1 A;  1E3M A;  1D8Y A;  2A40 A;  3O9S A;  5CE3 A;  3VEN A;  2E6M A;  1R0A A;  4LH4 A;  5IWA K;  2ATQ A;  4DV4 K;  2FF3 B;  1IO2 A;  3ISN C;  3CCJ N;  1U04 A;  3EN9 A;  1SL2 A;  2HVI A;  1L3T A;  4FJ7 A;  4CD3 A;  4X66 K;  4JRP A;  3UKU A;  1S3X A;  3EKU A;  1YAG A;  4BRK A;  2D1K A;  2F9T A;  4JHD B;  5K14 A;  4JI5 K;  3QIN A;  4E3S A;  3AVN A;  4ISG A;  4X65 K;  4FM1 A;  3BY5 A;  4CJE A;  1VSM A;  4E7J A;  1J5E K;  4XH4 A;  4B9S A;  4DSL A;  4WF9 L;  2YNH A;  1RGI A;  3H6E A;  3TAM A;  3GBT A;  2VG6 A;  1LAW A;  4A57 A;  3RR7 A;  3MN7 A;  5KQ8 A;  4KHQ A;  5LMU K;  5EU7 A;  4EHT A;  1RT6 A;  4A5A A;  3FZH A;  4EZ9 A;  5E26 A;  3QBX A;  3OYF A;  3H45 C;  3EYZ A;  4OX9 K;  4MO5 A;  4XH1 A;  3EZW A;  5F2R A;  4JI1 K;  1KLN A;  3D6R A;  3LP0 A;  3LAM A;  3VOV A;  3QO9 A;  1DEJ A;  5AQG A;  3OYC A;  2P9K B;  2Q0R A;  5C24 A;  2VG7 A;  1RT7 A;  1K8K B;  4BRO A;  4BDP A;  2YNG A;  1KXP A;  1TUU A;  2UUC K;  5J2M A;  1I39 A;  3KLF A;  1BQM A;  4DQR A;  1BCO A;  3ATU A;  1OVQ A;  1NK7 A;  3D2F B;  2YNI A;  3HTV A;  4BVP A;  3AO2 A;  3BP8 A;  4B1V A;  3TTC A;  4O0J A;  4FWQ A;  3SMP A;  4IOC L;  1X9M A;  3HT3 A;  3ZSV A;  3OYI A;  3N4Q A;  1NK5 A;  3HM9 A;  4BGB A;  3OYG A;  1KQS M;  4GV3 A;  4WQ4 C;  3KD1 E;  2O8F B;  2YHY A;  5M1Q A;  3SAG A;  1EWQ A;  4JI4 K;  4JNE A;  1QZ5 A;  3G25 A;  3P1G A;  3VQ9 A;  4F4K A;  4DHY A;  3ZET A;  1C0G A;  3K9K A;  4JK7 A;  5CYM A;  3ATV A;  3MWP A;  3AVK A;  4DR5 K;  3H46 O;  3DXM B;  1IH7 A;  4FWM A;  3QIC A;  3AA3 A;  3FFI A;  2O8B A;  2YJF A;  3EE8 A;  3ZSO A;  3U8X A;  1L5U A;  4DFK A;  4M42 A;  4N76 A;  4BR4 A;  4FLZ A;  2VWB A;  4EHU A;  4BRC A;  4EP5 A;  2BGG A;  2P5G A;  2VQE K;  4H5T A;  3PIP L;  4KHU A;  2ZQB A;  1W0H A;  5DM6 L;  4KHY A;  4B9T A;  1S5J A;  1HJO A;  1SZ2 A;  1N5Y A;  4LH5 A;  1TKX A;  1P8Z A;  3P38 A;  1VHX A;  2NLX A;  5LL6 Z;  4CJR A;  5C10 A;  5EX5 A;  1KTQ A;  1HPZ A;  2YHX A;  4FWS A;  4I2Q A;  4FWR A;  3NCI A;  4PHT X;  4OKK A;  4WQ4 A;  2QI2 A;  4B9L A;  1S1V A;  3IMX A;  1TL1 A;  5HRR A;  2YX6 A;  4BRD A;  4ICL A;  2WTU A;  4FK2 A;  3AVB A;  4WFA L;  1YTA A;  4FWO A;  4CFB A;  4CEZ A;  5HRS A;  4JKF A;  2AA4 A;  5HLF A;  1VQ7 N;  4K8Z A;  3CIP A;  3DLR A;  3VEX A;  2DPN A;  3THX A;  3CM5 A;  3E9P A;  3SPZ A;  3VQ8 A;  3DOK A;  1C1A A;  3O9U A;  3NHG A;  2P9I B;  5BRD A;  3QEX A;  3OYK A;  4CZF A;  4M3T A;  3AVI A;  1S1W A;  4CZE A;  2P5O A;  3U9D A;  1U45 A;  2X6S A;  4KTW A;  3RSE A;  1XMQ K;  1YXQ A;  4H0Y B;  5C12 A;  1SAZ A;  4C8N A;  3F5T A;  3QIO A;  1T03 A;  2YHB A;  4NCG A;  3TAG A;  5KPR A;  4IO8 A;  4DTO A;  3CFO A;  4YOT A;  1VAZ A;  2YCH A;  3I8D A;  4BC2 A;  2O8C A;  4CZK A;  3OYH A;  1KRP A;  2P9N B;  1BDG A;  2P9U A;  2ZJP L;  2W42 A;  1B9F A;  5AFU H;  3NH1 A;  3O1B A;  1G99 A;  1ESV A;  3QIP A;  3OS2 A;  4LD0 A;  1IBM K;  2ZF5 O;  4KHP K;  3HOS A;  2O4I A;  1LW2 A;  4CGG A;  3VGL A;  3BEX A;  1NBW A;  5FLX O;  3BF3 A;  4BQL A;  1RBT A;  1RDU A;  4FJH A;  4DU4 A;  1XI1 A;  5BRF A;  4YOW A;  3NBP A;  5JVG L;  5JLH A;  2G8H A;  4DCH A;  4DLE A;  1RTJ A;  1S6Q A;  1DKG D;  2HNY A;  3O9T A;  3CXC M;  1NJW A;  3EL2 A;  2HF3 A;  5MLC Q;  3DRS A;  4CZM A;  3E9O A;  1S9G A;  2PFU A;  4B1U B;  1MWM A;  3MAQ A;  1Q86 O;  3V1Q A;  2E8A A;  1D5A A;  3ZSQ A;  2F8T A;  3ENH A;  4CJT A;  2RPI A;  3TPQ A;  5F1X A;  4WQ5 A;  1SQK A;  1GLD G;  2HMP A;  4A5B A;  1YIT N;  3VQP A;  4U7B A;  4F8R A;  2QW9 A;  1SUQ A;  2BH1 A;  2ZE2 A;  4DB3 A;  2ITG A;  3CME N;  3P5J A;  1BO5 O;  1HLU A;  1XC9 A;  3E9L A;  5BPN A;  4FLX A;  2PYL A;  4C8L A;  4DQI A;  2Z1G A;  1EET A;  3WNE A;  4DKW A;  1Z05 A;  5BN9 A;  3C6H A;  3SQ4 A;  1J9A A;  4FJ5 A;  1RTD A;  1JXE A;  3HJF A;  5AQF A;  1VSH A;  1RTH A;  3RMC A;  4CJ3 A;  1B92 A;  4B9V A;  1N32 K;  5FRM A;  3E1Y A;  1LCU A;  1C0M A;  3HO1 A;  2UUB K;  2FSN A;  3MEG A;  4JKB A;  3QDK A;  4YFU A;  5A2Q O;  3ULD A;  2HNZ A;  4EFH A;  3WXJ A;  2VCP A;  3HST B;  3T7Z A;  5J1E A;  3ENB A;  3P83 D;  4YY3 K;  1UWB A;  3U6F A;  2RE2 A;  3EY1 A;  4M3Z A;  4BRL A;  4IBN A;  1VQK N;  5AR0 A;  4BRG A;  1B9D A;  2VWK A;  4K41 A;  3KLI A;  3LDQ A;  3C0B A;  3THW B;  5HRP A;  1HKG A;  4FZZ A;  4OGC A;  2D5R A;  2NRX A;  5AZI A;  1VK0 A;  1BU6 O;  3DRR A;  3WUH A;  4CJQ A;  1EKE A;  4FO0 A;  1GOC A;  3TAB A;  4KTQ A;  3T1A A;  1IBK K;  4DV5 K;  3PSI A;  3HI0 A;  3HPG A;  2QWM A;  4KFB A;  3WEE B;  2A5X A;  1M1K O;  3SNN A;  1VQ5 N;  2GUP A;  4BWJ A;  3VER A;  4JI0 K;  1ILY A;  2F96 A;  2EX3 A;  2KHO A;  4JK9 A;  3OHR A;  4LF7 K;  4H8K A;  4U67 L;  1XC3 A;  5AQW A;  4KHW A;  4PY5 A;  4BRI A;  3U3G A;  4AM7 A;  4Z4H A;  3CCM N;  3CCE N;  3WQT A;  3IAY A;  5JMV A;  1W2B M;  3N4P A;  4CZI A;  3VGM A;  3BDP A;  1YJW N;  2E5L K;  3HRG A;  1HRH A;  3CQY A;  2QWR A;  4BC4 A;  3CJ1 A;  2JGU A;  3AVG A;  4YOX A;  4N56 A;  4GV6 A;  1NOZ A;  3LM9 A;  5M1K A;  3HM8 A;  1SV5 A; 
#chains in the Genus database with same CATH homology
 1BI4 B;  4B3O A;  1TV6 A;  3LAK A;  5JS1 A;  3NGY A;  4QCL A;  4CJW A;  3SUP A;  4M3W A;  3C94 A;  3MED A;  2XY5 A;  1QS4 A;  2RN2 A;  4J2A A;  3O4Q A;  3ITH A;  2BE2 A;  3OS1 A;  3PV8 A;  1QHT A;  4FJ9 A;  5DK5 A;  3QER A;  4Z4C A;  1ZBI A;  4JLH A;  1S1U A;  4HTU A;  4J2B A;  4O4G A;  3H08 A;  1EX4 A;  3ZT0 A;  1I3A A;  3SJJ A;  1NJY A;  4PQU A;  3IS9 A;  4OJR A;  2KZM A;  3TAR A;  3OJS A;  3PX6 A;  1CZ9 A;  2O4G A;  1ASV A;  1UA1 A;  3C6T A;  5KGW A;  4C8K A;  2HHW A;  3O4N A;  3NF6 A;  3S9H A;  4OLA A;  4ELV A;  2HND A;  1IKV A;  3CFP A;  1BL3 A;  3LZI A;  1D8Y A;  3E01 A;  1TVR A;  4IFV A;  4Q5V A;  4IDK A;  3LWL A;  4EZ6 A;  4DFP A;  2G8I A;  3HVR A;  5CYQ A;  3NH0 A;  4DU1 A;  1RT2 A;  4KB1 A;  3SPY A;  2QKB A;  1S6P A;  1Q9X A;  2E6M A;  2OPS A;  5E41 A;  3OVN A;  4O5B A;  2XY7 A;  1R0A A;  2KFZ A;  1TKT A;  3KLG A;  4LH4 A;  3ZSR A;  4CJ4 A;  1NKC A;  3S3M A;  2ATQ A;  2Z1H A;  4FZY A;  1NKB A;  3OS0 A;  5SWM A;  4CEC A;  4KRF A;  4CED A;  1IO2 A;  3ISN C;  1X9W A;  4RW4 A;  3RRH A;  1U04 A;  5D3G A;  1TGO A;  4L8R B;  3OYA A;  3SQ0 A;  4KTZ A;  1U4B A;  4BDZ A;  4N5S A;  1NJX A;  3HK2 A;  4CGH A;  3AVH A;  2DFF A;  4DFM A;  1SL2 A;  1SL0 A;  3MEC A;  1VSJ A;  4CE9 A;  5SZT A;  3MXI A;  1L3T A;  1JXB A;  4JRP A;  4FJ7 A;  4PUO A;  2X6N A;  4CJL A;  4YNQ A;  1JLE A;  2I5J A;  1GOB A;  4RW9 A;  3VQ6 A;  5K14 A;  2Z1I A;  1GOA A;  3G0Z A;  3QIN A;  1DTT A;  1IKX A;  3CYM A;  1IKW A;  4LSN A;  1C1B A;  4E3S A;  1FK9 A;  3TAE A;  1TKZ A;  3AVN A;  5CZ1 A;  1SKW A;  1QTM A;  4FM1 A;  3HP9 A;  5DMR A;  1LAV A;  4CJE A;  1VSM A;  4E7J A;  3V9Z A;  4B9U A;  2IGI A;  3HYF A;  4B9S A;  4DSL A;  2YNH A;  3NH2 A;  3TAM A;  3DLB A;  2XY6 A;  3I0S A;  4CCH A;  2VG6 A;  1LAW A;  2Z1J A;  2OPQ A;  5KRS A;  4CF1 A;  3RR7 A;  4FLW A;  1RT4 A;  4NCA A;  4DU3 A;  2VWJ A;  5J2Q A;  1ZBH A;  4KHQ A;  3AO3 A;  4DWI A;  3NDK A;  3AA5 X;  5EU7 A;  2XHB A;  1RT6 A;  3RRG A;  1VRU A;  1JL2 A;  4FJN A;  2IC3 A;  3BGR A;  4H4O A;  3EZ5 A;  3V81 A;  3TAF A;  3K59 A;  4KRE A;  4EZ9 A;  4J2E A;  4F3O A;  5KRT A;  1HNV A;  3DLK A;  3F9K A;  3OYF A;  2HW3 A;  3EYZ A;  3RMD A;  3AV9 A;  3CM6 A;  4RW6 A;  4CFD A;  3OYM A;  1KLN A;  3LP0 A;  1JLA A;  3LAM A;  3QO9 A;  2B4J A;  3LP3 A;  3DM2 A;  4Z0U A;  1NK8 A;  3OYC A;  4KO0 A;  1WLJ A;  1ZYQ A;  5C24 A;  3T3F A;  3QNN A;  3V9U A;  4FYD A;  2VG7 A;  4DQQ A;  1RT7 A;  4ELT A;  1RBV A;  1DLO A;  4BDP A;  2YNG A;  3QEP A;  4CIE A;  4M3X A;  4KAZ A;  1G15 A;  2X78 A;  5C42 A;  4MQ3 A;  4DTS A;  5J2M A;  3ZT4 A;  1I39 A;  3KLF A;  1BQM A;  4DTM A;  5I42 A;  4DQR A;  1BCO A;  1NK7 A;  3LPU A;  4Y1C A;  2YNI A;  4QOZ B;  1VSI A;  3AO2 A;  3KTQ A;  4I9Q A;  4O0J A;  5FRO A;  3NGZ A;  3QES A;  3K5L A;  3VQD A;  4E0D A;  2YNF A;  4RW7 A;  1TL3 A;  3MXJ A;  1WNS A;  1X9M A;  2HVI A;  3HT3 A;  3ZSV A;  3OY9 A;  4IFY A;  4B08 A;  3OYI A;  3ASM A;  3IG1 A;  3HM9 A;  1W9H A;  1NK5 A;  3RR8 A;  2KZZ A;  2NUB A;  5CZ2 A;  2BAN A;  3OYG A;  3LDS A;  4AH9 A;  4CJ5 A;  3VN5 A;  1C6V A;  5I3U A;  3KD1 E;  1RDD A;  1REV A;  4GW6 A;  4Z4G A;  4J2D A;  3V6D A;  4KV8 A;  4PWD A;  2D0A A;  3QLH A;  4M3Y A;  1L3U A;  4BE2 A;  3HPO A;  1U49 A;  1VSE A;  1WSJ A;  3HPH A;  1Y97 A;  2FBY A;  4CHP A;  4KB0 A;  4FJL A;  3P1G A;  2Q3S A;  3VQ9 A;  3DRP A;  4B8A B;  2XY8 A;  4F4K A;  5HBM A;  4IG3 A;  4CHQ A;  3ZSY A;  4KPY A;  4FCY A;  2P1J A;  2WOM A;  4DTX A;  4FXD A;  4CJS A;  4I9L A;  5CYM A;  1BI4 A;  1FKO A;  1YTU A;  4I2P A;  3AVK A;  4W5T A;  3NGI A;  2IDO A;  3CFR A;  3A2F A;  4DSK A;  4N47 A;  1HYV A;  1HJR A;  3L8B A;  1IH7 A;  4B9N A;  2OYQ A;  3AA3 A;  3DMJ A;  3FFI A;  1SKR A;  2G8V A;  1KSP A;  4H4M A;  1QSY A;  1TK8 A;  4BAC A;  1RDB A;  2FBV A;  1WSG A;  2HVH A;  3ZSO A;  3VQE A;  3MXM A;  1NK6 A;  3AVA A;  3RTV A;  3IRX A;  4DTN A;  4FJJ A;  4FJK A;  2D0C A;  4DFK A;  3TI0 A;  1L5U A;  3OYJ A;  4LY7 A;  4N76 A;  4M42 A;  1KFD A;  3NF7 A;  4IG0 A;  4AHV A;  4HHT A;  4FK4 A;  1EXQ A;  4FLZ A;  1UA0 A;  3HXM A;  3G10 A;  4CEQ A;  1J54 A;  1BIS A;  4FW2 A;  3V4I A;  4EP5 A;  2BGG A;  4DSF A;  3UIQ A;  3L2R A;  3KK1 A;  3OJU A;  2PZS A;  1ITG A;  1FXX A;  2P5G A;  4CJK A;  4KHU A;  3LP2 A;  4OPJ A;  2ZQB A;  1MU2 A;  1W0H A;  1A5W A;  2RKI A;  1JLF A;  3SUO A;  4DS4 A;  4FK0 A;  3SV4 A;  4DMN A;  4KHY A;  4B9T A;  4DQS A;  4E1M A;  1J5O A;  3KJV A;  1S5J A;  4DTP A;  3AVF A;  4B9M A;  1HYS A;  4BWM A;  4FJ8 A;  4CK3 A;  3C6U A;  1TKX A;  1BGX T;  3D45 A;  4LH5 A;  4BE1 A;  4CEO A;  1N5Y A;  4CF0 A;  1SKS A;  2G8U A;  1RCH A;  3AO4 A;  3VQ4 A;  4DTU A;  5J2P A;  3KLH A;  4CJR A;  3AVJ A;  1WSF A;  3SZ2 A;  1QQC A;  4CJU A;  4CGD A;  4DF8 A;  2A1R A;  1KTQ A;  1HPZ A;  1C0T A;  4I2Q A;  3B6O A;  3NCI A;  4NCB A;  1JLQ A;  1RNH A;  3AVL A;  4AHS A;  4OKK A;  1T8E A;  1LV5 A;  4C8O A;  4Z4I A;  2QKK A;  4AIL C;  4BDY A;  1S1V A;  1D9F A;  4B9L A;  4FZX C;  4CGJ A;  1TL1 A;  1XWL A;  3I0R A;  1U47 A;  5HRR A;  2X74 A;  3O3G A;  4ICL A;  4FK2 A;  3AVB A;  1L3S A;  2B5J A;  4CK2 A;  3OYE A;  1VSK A;  2FC0 A;  1YTA A;  3AO1 A;  4CGI A;  4CFB A;  5HRO A;  1BIZ A;  4W5R A;  4Y1D A;  3V9S A;  1QSS A;  4CEZ A;  5HRS A;  3K5M A;  5HLF A;  3ZT1 A;  4K8Z A;  4KKO A;  3PO4 A;  3ZSW A;  3HP6 A;  1A5X A;  2DY4 A;  5KI6 A;  1YVU A;  3DLR A;  1Z26 A;  1LWF A;  3VQQ A;  1RBU A;  3CM5 A;  2EHG A;  3LP1 A;  4HVJ A;  3SPZ A;  4IKF A;  3NF9 A;  4PA1 A;  1C1C A;  1ZBL A;  3DOK A;  1C1A A;  1Q8I A;  3VQ8 A;  4CF2 A;  3NHG A;  1SL1 A;  1KFS A;  2XRI A;  2WON A;  4CHO A;  3QEX A;  1NK0 A;  3OYK A;  4FJM A;  3PUF A;  1RDA A;  2YKN A;  4M3T A;  3AVI A;  2G8W A;  4N41 A;  3MEE A;  1S1W A;  4M45 A;  3SYZ A;  1JLC A;  4C8M A;  4DS5 A;  2JLE A;  3THV A;  4ZTJ A;  1U45 A;  2P5O A;  4QAG A;  3SI6 A;  2X6S A;  1VSL A;  4KTW A;  4I7F A;  2E6L A;  2R7Y A;  2HHV A;  4C8N A;  1BIU A;  4CJP A;  1O1W A;  2A1S A;  3QIO A;  1F21 A;  3AA4 A;  3DYA A;  2YHB A;  3NF8 A;  3V9W A;  4NCG A;  3TAG A;  4ZTF A;  1QE1 A;  4CFA A;  1TK0 A;  2G8F A;  4HCB A;  2RF2 A;  4E7H A;  4DTO A;  3D0P A;  2Y1J A;  3KIO A;  3V9X A;  3CFO A;  3CG7 A;  1J53 A;  4OGE A;  3QEI A;  4DSE A;  1VSD A;  3PX4 A;  3KK3 A;  3I8D A;  4FM0 A;  4DFJ A;  4DSI A;  1S9E A;  4CF8 A;  2GBZ A;  1S1X A;  3LWM A;  4WE1 A;  1FKP A;  3OYH A;  1KRP A;  2HHU A;  2FBX A;  2QXF A;  1XHX A;  1HMV A;  1WSH A;  2G8K A;  4OVL A;  2W42 A;  1B9F A;  5T7B A;  4ID1 A;  3NH1 A;  1WN7 A;  3VA3 A;  1HQE A;  4F2S A;  4W5O A;  3QIP A;  3OS2 A;  1RDC A;  3DI6 A;  1UAX A;  4DTR A;  4LD0 A;  4AHC A;  3RWU A;  1Z25 A;  2AJQ A;  4OLB A;  4CJF A;  2O4I A;  1LW2 A;  3HL8 A;  1JLB A;  1IKY A;  4CGG A;  4AHR A;  4UQG A;  4FM2 A;  1RBT A;  1WAF A;  3LAN A;  4FJH A;  3ALY A;  4DU4 A;  4CHZ A;  1RTI A;  4HUF A;  3RMA A;  1XI1 A;  3TR8 A;  1RT5 A;  3NBP A;  2G8H A;  4DLE A;  4G1Q A;  1RTJ A;  3TAQ A;  2PY5 A;  4FW1 A;  4GVM A;  5KGX A;  1S6Q A;  2HNY A;  3SUN A;  4RG8 A;  1NJW A;  3OYL A;  1N6Q A;  5FRN A;  2QK9 A;  3SQ2 A;  1KVA A;  3DRS A;  4M41 A;  4Q0B A;  3L3U A;  4JS4 A;  5J2N A;  4KHN A;  1S9G A;  4OPK A;  4KHS A;  1VRT A;  1NOY A;  1BHL A;  1LWE A;  1T05 A;  3VQB A;  4AHU A;  1CXU A;  3B6P A;  3ZCM A;  3MAQ A;  1UOC A;  3V1Q A;  3K5O A;  3K58 A;  1D5A A;  3ZSQ A;  4DQP A;  3KKR A;  4O44 A;  2OZM A;  4ELU A;  2F8T A;  4CJT A;  2RPI A;  1X1P A;  1L3V A;  4F3T A;  4E7L A;  1EP4 A;  1NKE A;  4E19 A;  2OPP A;  1DTQ A;  3F73 A;  2YV0 X;  4FLT A;  3VQP A;  1TAQ A;  4F8R A;  4ZHR A;  2XO7 A;  3WNH A;  1IG9 A;  3TWH A;  4CHN A;  3S3O A;  1NJZ A;  2ZD1 A;  3AVM A;  3M8Q A;  4CIF A;  2HMI A;  5HP1 A;  1SUQ A;  3AO5 A;  3TAP A;  1T03 A;  2HHS A;  2ZE2 A;  4CFC A;  3SUQ A;  3AVC A;  5C25 A;  1TK5 A;  2ITG A;  1ZBU A;  3P5J A;  4CEE A;  1XC9 A;  1NK9 A;  1U48 A;  3S3N A;  4CEA A;  2KW4 A;  4FVM A;  3VQ5 A;  4FLX A;  2PYL A;  2PYJ A;  4C8L A;  1KVC A;  3DLE A;  2Y1I A;  2KQ2 A;  1RT3 A;  1EET A;  1WSE A;  2Z1G A;  3WNE A;  4DQI A;  1ASU A;  3PX0 A;  3LPT A;  1X9S A;  2HHQ A;  1TKD A;  4K8X A;  1S1T A;  3CQ8 A;  4HUE A;  3SQ4 A;  4FJX A;  1J9A A;  2B6A A;  1RTD A;  4FJ5 A;  5JS2 A;  3QET A;  1HQU A;  1D9D A;  1KVB A;  2HHT A;  1JXE A;  3HJF A;  4CIG A;  2ETJ A;  1CLQ A;  4DSJ A;  1JKH A;  4GMJ B;  1JL1 A;  3KKS A;  1VSH A;  3O3H A;  3PO5 A;  2DTU A;  1RTH A;  3VQA A;  4CJ3 A;  5HRN A;  1B92 A;  3RMC A;  4B9V A;  4DG1 A;  5FRM A;  2D0B A;  4XIU A;  4DF4 A;  3TAN A;  3M8S A;  1C0M A;  3OYD A;  3SQ1 A;  3HO1 A;  2IAJ A;  4CK1 A;  2VG5 A;  2YKM A;  4CEF A;  4O0I A;  3MEG A;  4YFU A;  3O3F A;  3ULD A;  2HNZ A;  1NK4 A;  3HST B;  3AA2 A;  1WSI A;  3K2P A;  5J1E A;  1LWC A;  4E7I A;  3RMB A;  4M3R A;  3NE6 A;  3JYT A;  4E89 A;  3P83 D;  3ZSZ A;  1UWB A;  4DTJ A;  3U6F A;  1Q9Y A;  4KI4 A;  2IOC A;  3EY1 A;  4M3Z A;  1HYZ A;  4IBN A;  4MFB A;  4FJG A;  2KTQ A;  3DOL A;  1BCM A;  3L2Q A;  1T7P A;  1XHZ A;  3NAE A;  1B9D A;  2VWK A;  4CEB A;  5KTQ A;  1QSL A;  3KLI A;  3DLH A;  4Z4F A;  3KK2 A;  3VQC A;  4JS5 A;  3LZJ A;  3QNO A;  3KLE A;  3SV3 A;  5HRP A;  3LAL A;  1RBR A;  3U3Y A;  4CHY A;  4JRQ A;  4AHT A;  4FZZ A;  2YHA A;  4OGC A;  2D5R A;  4CF9 A;  3V1O A;  1VK0 A;  4E7K A;  2IS3 A;  3DRR A;  3L2V A;  4LSL A;  1EKE A;  4CJQ A;  3PY8 A;  1GOC A;  4FLY A;  3TAB A;  2OPR A;  3OYN A;  2GV9 A;  2KFN A;  4KTQ A;  3ZT2 A;  4OKJ A;  1RBS A;  2FBT A;  1BQN A;  3T1A A;  3OYB A;  2OZS A;  4CER A;  4E1N A;  2LSN A;  3KD5 E;  4FLU A;  4W5N A;  3HPG A;  3QEV A;  1YT3 A;  4Z4E A;  3DLG A;  4KFB A;  4EP4 A;  3QEW A;  1JLG A;  3T19 A;  3L3V A;  4FJI A;  2HHX A;  3VQ7 A;  5FDL A;  3SNN A;  4KI6 A;  4BE0 A;  1A5V A;  1KLM A;  1TAU A;  4BWJ A;  3V1R A;  3M8P A;  4CES A;  3L2U A;  2F96 A;  2EX3 A;  4W5Q A;  4HUG A;  1RT1 A;  2GUI A;  3K57 A;  2P51 A;  2DFH A;  4HCC A;  4R5P A;  1RIL A;  3L2W A;  4NYN A;  4H8K A;  3K5N A;  4OKE A;  4TSX A;  1CZB A;  4FLV A;  4M3U A;  4KHW A;  4PY5 A;  2BDP A;  3U3G A;  3ZT3 A;  4Z4H A;  3IAY A;  1C0U A;  1KCF A;  2E4L A;  2F8S A;  1ZBF A;  1VSF A;  4NYF A;  3BDP A;  4CJV A;  4ID5 A;  1CXQ A;  3NFA A;  1LW0 A;  3WNF A;  2DFE A;  3WNG A;  1HRH A;  1HNI A;  3HVT A;  3C95 A;  3SCX A;  4B8C A;  3ZSX A;  1WAJ A;  3JSM A;  1ASW A;  1K6Y A;  4O55 A;  3VA0 A;  2OA8 A;  4F2R A;  4CGF A;  2JGU A;  3AVG A;  5CY4 A;  2HB5 A;  4RW8 A;  1NOZ A;  4N56 A;  4DLG A;  3M8R A;  1SV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...