3LPTA

Hiv integrase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
142
Chain Sequence
DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Integrase
publication title Rational design of small-molecule inhibitors of the LEDGF/p75-integrase interaction and HIV replication.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 45
structure length 142
sequence length 155
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lptA00
3TWHA 4M45A 3L3UA 4KFBA 4CFCA 2D5RA 4FVMA 1ZBLA 2KFNA 1ASWA 1NJWA 2OZMA 2WONA 4CGDA 4ID1A 2GV9A 1EX4A 4RW6A 4FJ9A 1RBVA 5CZ1A 3L2UA 3ZT1A 1HNIA 2HHWA 3H08A 1HYVA 3FFIA 1YTAA 3LANA 3VQDA 3NCIA 4FLXA 4CK2A 4DTRA 1XC9A 1KLNA 2QXFA 1VSHA 4Y1CA 4I9QA 1BIZA 4FZZA 4Z4EA 2HHSA 4CJQA 2IOCA 2HHTA 3KD1E 3DRSA 1LWCA 3IS9A 1F21A 2Z1IA 5C42A 1KLMA 2HNZA 4NCBA 4M3TA 3S3MA 3ULDA 4CJPA 2YHBA 5HRNA 4DLGA 1NOZA 3T1AA 3SPZA 3TAQA 2JGUA 4BE2A 1HMVA 3KIOA 5JS1A 4DS5A 2HB5A 1XHXA 3NDKA 1R0AA 2HHXA 4FW1A 3DLHA 1HYZA 4KB1A 4NYFA 1D9FA 3JSMA 4FJKA 2X6NA 1SUQA 2DFHA 1S1TA 3HPOA 3KK3A 3VA3A 1Q9XA 3DMJA 4FCYA 1WSIA 2IAJA 1KCFA 1BGXT 2YKMA 4E1NA 4DU1A 2D0AA 1UWBA 4B8AB 3OYGA 3DRPA 3ZSRA 4FLWA 3RTVA 4ZTJA 2FBXA 1RT2A 3KLHA 2XO7A 1T03A 1TAUA 3VQCA 4W5OA 4CJSA 4K8ZA 4DQRA 1JLBA 4DTXA 3OYEA 3K5LA 2P1JA 4WE1A 3OVNA 4CHOA 1RDBA 3ZT0A 1T7PA 2OA8A 3PY8A 4Y1DA 3RRGA 3MEDA 4KTZA 5J1EA 4O0JA 3OYNA 2VWJA 1U49A 3OYCA 3E01A 4JS5A 4FK0A 3CFPA 4DSEA 4O0IA 1S6PA 2I5JA 2X78A 1HQEA 3V9ZA 4DQPA 1TVRA 3O3GA 2FC0A 1S1UA 4CEEA 5C25A 1JL1A 2FBYA 4CFBA 1JLGA 2P51A 3LAMA 3LAKA 1X9SA 4LY7A 4AHVA 1NK9A 3DI6A 3LWMA 3VQ6A 1VSDA 4ZHRA 4CF9A 4ID5A 4J2DA 2VG6A 1JL2A 1RTJA 3OS0A 4CJ4A 1T05A 2EHGA 3ZSZA 4CJRA 4B3OA 3VQAA 4CFAA 3ITHA 3AO4A 4KTQA 3AVLA 4W5TA 2ETJA 3HP9A 4CIEA 5SZTA 2XY6A 1W9HA 4DTJA 4CK3A 5D3GA 4R5PA 1TGOA 1NJZA 1SL1A 3ZSQA 2HHQA 1ZBFA 3S3NA 3NF9A 4BWJA 4I2PA 3QERA 1NKEA 3TI0A 2HHVA 3EY1A 4DFJA 1SL0A 4DMNA 3QEVA 3PX6A 1J53A 3UIQA 1S1VA 3V9SA 5K14A 4FLVA 1HNVA 5HRSA 5KGXA 4OKJA 4CJKA 1CZ9A 3L2WA 1RT6A 3ZCMA 4CECA 2Y1IA 1RTDA 3KJVA 3K58A 4FJMA 4K8XA 2OPPA 4FJ5A 1SV5A 4FJGA 3MXJA 4DTUA 1KTQA 4QAGA 1WN7A 3P5JA 3D45A 4E7LA 1ASUA 3SQ1A 4KB0A 3CM5A 1IH7A 3F9KA 3VQ4A 1O1WA 3OS2A 3M8SA 3AVBA 4KHYA 3G10A 4MFBA 5E41A 2VG7A 4DWIA 1S9EA 2NUBA 3KLGA 4KAZA 1A5XA 1JLFA 3AO2A 4H4OA 4G1QA 4IG3A 3HK2A 1B9FA 3C95A 5KRTA 1C0TA 3NF8A 4KHNA 3DYAA 4FJIA 2Q3SA 4OGCA 4CF2A 4BWMA 4FJHA 2DTUA 3NGYA 3NH0A 4IG0A 3NF7A 1UA0A 2G8FA 2DFEA 3BGRA 4L8RB 3MECA 3HYFA 3JYTA 4DQSA 3QETA 1GOAA 5DMRA 1S9GA 3RR7A 3DM2A 4CEQA 3V9XA 2PZSA 4RW8A 3V1QA 3TAFA 3VQBA 5HP1A 4BACA 2F8TA 2ZD1A 1ITGA 3K59A 4FLUA 4FJ7A 4M3WA 1ZBIA 4KHUA 1FXXA 1BCOA 1ZBUA 4O44A 3O3HA 4E7KA 2HVIA 4HCCA 3SUNA 3KK2A 1VSLA 1JLCA 3OYHA 3K5NA 3SUQA 4CGJA 2OPRA 2BE2A 2E4LA 1U04A 1NK7A 1LWFA 1JLAA 4CJUA 3ZT3A 3U3GA 3I8DA 1QSYA 4B9TA 4B08A 4PUOA 4NYNA 4DU4A 2KZMA 4BE0A 4CFDA 1EXQA 4E7JA 1RBTA 3CQ8A 4DTMA 2BANA 4ZTFA 4KREA 2ZQBA 4PA1A 3QEXA 3AO5A 3DOKA 1QSSA 4KHQA 3AVJA 4KV8A 1NJXA 2KFZA 2AJQA 2ZE2A 3HPHA 2E6LA 1X9WA 2G8IA 4I7FA 1LW2A 4KI6A 3DLEA 4N47A 3HM9A 1CZBA 3NGZA 3IRXA 3DOLA 3TAPA 4F8RA 3ZT4A 3F73A 1RCHA 1RT1A 1FK9A 2F8SA 2IDOA 1W0HA 1NKBA 4CGFA 4LSLA 3KLFA 3K2PA 3HPGA 2RKIA 1D5AA 3SI6A 3TARA 1CXQA 4FLYA 4GVMA 1IO2A 3AO1A 1BCMA 3L3VA 3QINA 4OPKA 1A5WA 3AVGA 2YV0X 3KKRA 4OKKA 3NHGA 5KRSA 1RT7A 3KLEA 4C8OA 4CEDA 3T3FA 3ISNC 4FM2A 4B9SA 1CLQA 4IDKA 3LPTA 4QOZB 4AHTA 2OPQA 1GOBA 1IG9A 3ZSVA 3ALYA 2PYLA 1K6YA 4AHRA 3QIOA 1RDDA 3OJSA 3L2QA 3LWLA 5HLFA 1G15A 4M3UA 2HHUA 4FYDA 1Z26A 3KLIA 1RT4A 3LP0A 3LZJA 3SV4A 3MAQA 4RW9A 4Q0BA 4OKEA 3ZSOA 3OJUA 3BDPA 4HHTA 3NE6A 1RT5A 3NFAA 3V81A 4CF8A 1C1CA 3HL8A 4ELVA 4Z0UA 3QEIA 3V9UA 3RR8A 4Z4FA 5J2QA 3DLBA 3OYIA 4FLTA 4M3XA 3HVTA 1QTMA 2G8KA 2F96A 2X74A 1J5OA 3KD5E 4DFPA 1BI4B 4RG8A 3WNEA 4CCHA 1N6QA 1JXBA 2O4IA 2KW4A 1B9DA 4ICLA 2GUIA 1ASVA 3LALA 4PY5A 1BL3A 3B6OA 1DLOA 4B9UA 3U3YA 4FJJA 1KVBA 1U45A 1VK0A 3MXIA 3A2FA 1IKWA 3HJFA 1VRTA 4CEZA 4CF0A 3HVRA 1L3SA 1BQMA 4C8NA 1TKXA 2YNGA 3WNFA 2XY5A 4EP4A 4CHYA 2B5JA 1TK8A 1RDAA 3SCXA 4CK1A 2YKNA 3AVNA 4CEBA 3OYAA 4DU3A 4DSJA 1XHZA 3P1GA 3VQPA 3RMBA 1FKPA 1EP4A 4B9LA 3NF6A 4JLHA 4DS4A 1NK8A 3T19A 4JS4A 4HTUA 3NBPA 1S6QA 4GW6A 3OYDA 3OY9A 1UA1A 2HVHA 1IKXA 1RTHA 4CIGA 3AA5X 3ZSWA 4J2AA 3VQEA 3VA0A 5FRMA 1X1PA 3VN5A 4DF4A 2DFFA 4W5NA 4O4GA 3V1RA 4OVLA 4GMJB 1KVAA 3THVA 1VSJA 5CZ2A 5J2NA 5I42A 1NK6A 1WNSA 1DTQA 4M41A 4FM1A 3V4IA 2PY5A 3AVAA 1VSKA 2D0CA 4OJRA 2FBTA 1C1AA 4N56A 4OLAA 1WSFA 3QNNA 4C8KA 4DTOA 1VRUA 3C6UA 1KVCA 3QESA 3PO4A 1Q8IA 3ZT2A 1L3TA 4LH5A 4F2RA 5CY4A 5I3UA 3ZSYA 1T8EA 4AILC 2X6SA 3AO3A 4CF1A 2ATQA 2W42A 5HRRA 3V6DA 3SQ4A 1NK4A 1LWEA 1U4BA 4QCLA 4CJLA 2QKKA 3DRRA 3LPUA 4CERA 5HROA 4Z4HA 4CHPA 4FK2A 2EX3A 2YNFA 2RPIA 4RW4A 3SUPA 3PO5A 1RBUA 4KPYA 1U47A 3AA2A 1J9AA 1WLJA 2O4GA 4YFUA 4M3RA 3AA3A 2Y1JA 4KHWA 2QK9A 1TKZA 4CJ5A 2XRIA 3P83D 1KRPA 1TK0A 3O4NA 3C94A 4RW7A 4CJFA 3CG7A 3OYJA 4FM0A 3HP6A 1UOCA 2B6AA 1RBRA 4O55A 3TR8A 4NCAA 3KK1A 3AVMA 3AVHA 5KTQA 4BE1A 1IKYA 3QEPA 3QNOA 3NAEA 1WSGA 2VG5A 1HJRA 3CM6A 3OYKA 1JLEA 1SKSA 3SYZA 4DTNA 3SJJA 4EZ6A 3QEWA 4CESA 2QKBA 3CFRA 4LSNA 2XY8A 1WSEA 4M3YA 3MEGA 3M8QA 4CEFA 2VWKA 3G0ZA 3MXMA 1S1WA 4IFYA 3IAYA 4DLEA 4KKOA 1JLQA 4FXDA 1Y97A 1LV5A 3TAEA 4KHSA 1JKHA 4DFMA 4BDYA 1NKCA 1REVA 4B9MA 4O5BA 3QIPA 1SKWA 2DY4A 4DSIA 4DQQA 1EKEA 3O3FA 4F4KA 1Q9YA 4CJEA 3VQ9A 2KQ2A 1EETA 4IKFA 1JXEA 5FDLA 3HO1A 4C8MA 3PX0A 4OLBA 4HVJA 4CEOA 1LAVA 3HSTB 4OPJA 4DF8A 3SUOA 3AVFA 4JRPA 3DLGA 3RMAA 1BIUA 1D8YA 4BDZA 1L5UA 4F2SA 4DTPA 2HNYA 3V9WA 1RDCA 4CGHA 4N41A 3AA4A 5FROA 2A1SA 3OS1A 4E89A 2PYJA 1FKOA 4UQGA 4CEAA 4BDPA 4KTWA 1BISA 4CHNA 1BI4A 1QE1A 4FJNA 4CHZA 5KGWA 3RRHA 4ELUA 1SKRA 2OPSA 2G8VA 1KFDA 4I9LA 1A5VA 3WNGA 5SWMA 3OYMA 1RNHA 1ZBHA 3LP2A 4E7HA 2B4JA 3O4QA 1TK5A 1S5JA 3EYZA 4CJWA 1HYSA 3CFOA 4FJXA 1SL2A 3HXMA 4PQUA 1VSIA 1BHLA 1BQNA 4AH9A 4DFKA 3DLRA 1S1XA 2YHAA 2IC3A 3WNHA 2OZSA 4FZYA 1C0MA 4NCGA 2OYQA 3AVIA 2GBZA 3PX4A 4KI4A 3ASMA 3OYFA 3D0PA 4CJTA 2JLEA 3PV8A 2RN2A 4DTSA 3M8PA 3U6FA 1KFSA 2HMIA 1B92A 2YNIA 1TV6A 1TKTA 1HQUA 4Q5VA 1RT3A 4Z4CA 1XI1A 3TAMA 1ZYQA 2BDPA 3SQ2A 3KTQA 4EZ9A 2D0BA 3L8BA 1MU2A 1VSMA 4W5QA 2LSNA 3SPYA 3M8RA 4FW2A 5CYMA 1C6VA 4M42A 3HT3A 3B6PA 5JS2A 1LW0A 3SZ2A 1J54A 2IGIA 4CHQA 3SNNA 4FZXC 5T7BA 1NK5A 4HUFA 1WAJA 4LD0A 1YTUA 3L2VA 4J2EA 3QO9A 5C24A 1QSLA 5KI6A 3PUFA 2E6MA 4H4MA 4E19A 3NGIA 2ITGA 1TL1A 4LH4A 2R7YA 4B8CA 1DTTA 3SQ0A 3VQ7A 3RWUA 1U48A 2XY7A 4DSLA 4XIUA 4YNQA 5FRNA 4HUEA 4CGIA 2HNDA 3AVKA 1RILA 1VSEA 3CYMA 3I0RA 4MQ3A 4E1MA 3L2RA 4B9NA 1TL3A 3ZSXA 4JRQA 1HPZA 3TAGA 2G8UA 4F3OA 4FJ8A 2XHBA 3VQQA 2Z1JA 4FK4A 4KRFA 2FBVA 2RF2A 3SV3A 4DSKA 1D9DA 4E0DA 3I0SA 5J2PA 1Z25A 1XWLA 3S3OA 4FJLA 4Z4IA 4KO0A 4OGEA 4J2BA 3IG1A 1QHTA 3V1OA 3LDSA 1TKDA 1QS4A 4FLZA 1LAWA 1TAQA 5HBMA 1N5YA 1I39A 1RTIA 4DQIA 1WAFA 4W5RA 4HUGA 3AVCA 3LP1A 3K5OA 3TANA 1QQCA 4DSFA 4IFVA 4IBNA 1C1BA 4C8LA 2BGGA 4F3TA 3OYBA 4N76A 4EP5A 2KTQA 1HRHA 2Z1HA 2G8WA 4E7IA 1CXUA 4TSXA 4N5SA 5DK5A 3K57A 3TABA 3RMCA 4B9VA 2HW3A 2KZZA 3C6TA 4M3ZA 1I3AA 3NH1A 2WOMA 4CGGA 3S9HA 2P5OA 4H8KA 5CYQA 4CE9A 4CIFA 1WSJA 3MEEA 2YNHA 4AHUA 1UAXA 4I2QA 4CJVA 3K5MA 1VSFA 2A1RA 1IKVA 2G8HA 2P5GA 1NOYA 3NH2A 1GOCA 1C0UA 1KSPA 2IS3A 1WSHA 4AHSA 2Z1GA 5HRPA 3LZIA 4E3SA 4ELTA 4PWDA 1YT3A 3OYLA 1NJYA 1X9MA 3AV9A 3KKSA 3LP3A 3RMDA 3DLKA 1NK0A 4Z4GA 3QLHA 4HCBA 3VQ8A 1L3VA 1YVUA 5EU7A 4CJ3A 3EZ5A 5J2MA 4AHCA 1L3UA 4DG1A 3VQ5A 1RBSA
chains in the Genus database with same CATH superfamily
5EXWA 3VF2A 4CFCA 3CPEA 5BPNA 3H45C 1NJWA 2OZMA 4ID1A 1EX4A 5AZJB 1KAYA 3ZT1A 3A0IX 2HHWA 1HYVA 4DTRA 4CK2A 3HOSA 1QQOA 4JI5K 3L4QA 3DRSA 3S41A 4NO7A 4R79A 3ULDA 1S22A 2YHBA 3T1AA 2JGUA 1HMVA 4DV7K 4DS5A 4DV3K 2HHXA 4FJKA 4RWTA 3JSMA 2X6NA 2DFHA 3C7NB 1JCEA 3NVKA 3P39A 2IAJA 3THXB 1NGAA 4L3QA 4B8AB 5FLXO 4NXNK 3DRPA 3RTVA 3CCUN 2YI1A 4W5OA 3I55N 1JLBA 4JKEA 4CBWA 3VF4A 4LF4K 1T7PA 4GVEA 4AM6A 3OYNA 2FLOA 2VWBA 3E01A 3EZWA 4JS5A 4B3TK 2I5JA 5M1KA 2X78A 1HQEA 3V9ZA 3E9OA 1TVRA 2O8EB 4BR7A 4BREA 5C25A 4X66K 1X9SA 1NK9A 4H5TA 3FE1A 1M1KO 3BF1A 3BEXA 4JK7A 3C65A 3ZLJA 4B1WB 4CK3A 4B3MK 4J8FA 1SL1A 5AZIA 4JNEA 3AY9A 1ZBFA 1SAZA 3MCAB 3S3NA 4FOEA 4WQ4A 3LDLA 2KLAA 3O9RA 4YHHK 4DFJA 2GWJA 4IO8A 2IVPA 3CI5A 4GY2B 3V9SA 2QI2A 5HRSA 5KGXA 3D2FA 3ZCMA 2QWRA 3EKUA 3F5TA 4H03B 3N4QA 4FJGA 3MXJA 4QAGA 3H3OB 2VGNA 5M1NA 1ASUA 1GLFO 4DR5K 1IH7A 5FPDA 4YDUA 4BY9C 4KHYA 1YITN 3G10A 4Y0WA 4DWIA 1A5XA 4IG3A 3HK2A 5EVZA 4DUYK 4FPBA 4OGCA 3R1XA 3NH0A 4IO9L 4A62A 4IG0A 2YCHA 1UA0A 3BGRA 3HOTA 3MECA 3HYFA 4WQ5A 1IBKK 3IKMA 2PZSA 2CH5A 5C10A 3V1QA 3CCVN 3TAFA 3VQBA 2WTUA 3LDPA 4O5FA 5AZJA 3K59A 3FZHA 4C1NK 4M3WA 3O3HA 1IBLK 2NRRA 4HCCA 5LMUK 1YIJN 1GLEG 3MMVA 1U04A 3MDQA 1LWFA 1JLAA 4IWVA 3A5NC 3U3GA 1QSYA 4B08A 4BE0A 1EXQA 1XMOK 1ESVA 5BR9A 4PA1A 4H5RA 4DR7K 3AO5A 1QSSA 1NJXA 4KV8A 3C7NA 4I7FA 5C12A 4N47A 3HM9A 1CZBA 3UE5A 5AQNA 3DOLA 3TAPA 3F73A 1RCHA 1RT1A 1FK9A 2IDOA 1G99A 2V51B 3GG4A 2CH6A 3K2PA 5LJWA 5LL6Z 3HPGA 2YX6A 3AO1A 1BCMA 3L3VA 4IOCL 3AVGA 4ILGB 2FF3B 1FW6A 4CEDA 3T3FA 1N33K 4FM2A 1QVGM 3LPTA 4AHTA 2OPQA 3ALYA 4AHRA 5HLFA 1TUYA 5JLHA 4BRCA 5ADXH 4V19S 2HHUA 3ZETB 3LZJA 3MAQA 3N4PA 3ZSOA 3BDPA 3ENHA 3NE6A 5JMVA 4WYBA 3TU5A 4GNIA 4Z0UA 4BG8A 5J2QA 2ZWHA 1BDGA 1XMQK 3CC7N 2G8KA 3WNEA 3EN9A 1RGIA 2O4IA 1B9DA 4BGAA 1NWKA 1W2BM 2QWNA 3U3YA 4A59A 2O8BB 3MX2A 4FJJA 3ID6A 5AQJA 5A2QO 1VK0A 3T1YK 3WXLA 2ZGZA 2XY5A 2YNGA 3SCXA 2HSTA 4DSJA 3NF6A 3QICA 4DS4A 1BG3A 4B9QA 3NBPA 4PKGA 4DB3A 3AA5X 3UKRB 3VF6A 3OHRA 4O4GA 1KVAA 3THVA 5I42A 4FOIA 4XH1A 1WNSA 4GV3A 5F2RA 2ZJQL 1HNWK 3AVAA 3QFUA 4YDUC 3R9PA 4C8KA 1KVCA 1W7AA 1Q8IA 3ZT2A 5I3UA 4CF1A 3FZKA 4KH6A 5HRRA 1LWEA 3UKUB 4CJLA 2Q0UA 4CERA 4FK2A 3L0QA 4YOVA 4KBOA 4CZLA 1U47A 3FR0A 3VETA 2QK9A 2Y1JA 1N32K 1Q82O 3O4NA 3J81O 3I8BA 1DEJA 4DR1K 3CCQN 3HP6A 2WBNA 2B6AA 1RBRA 4O55A 2D0PA 4NXMK 3AVMA 3QEPA 1KC8O 1HJRA 1P90A 3SJJA 2HBLA 3WXKA 2VQFK 3K9KA 2QKBA 4LSNA 2XY8A 4M3YA 4FWSA 3M8QA 4CZGA 1SZ2A 4DR3K 1LV5A 1E4GT 2EWSA 1RDUA 4XH5A 4DFMA 1GLCG 3TAEA 5KPTA 1DT9A 3O3FA 4AF1A 4WCEL 5BRHA 1Q9YA 1EETA 3JS6A 1JXEA 4LF9K 4C8MA 1LAVA 3HSTB 3DLGA 3RMAA 5GADP 3TPQA 3C6AA 2HNYA 3WT0A 3O08A 3OS1A 4E89A 3TSUA 4UQGA 3FZLA 4KTWA 3MCPA 5KGWA 3RRHA 3J8AA 4MLHA 3E1YA 3WNGA 4KH4A 5SWMA 1RNHA 1ZBHA 4H0VB 4E7HA 2O8BA 4EHTA 1TK5A 4PQUA 1BHLA 4DFKA 1S1XA 2IC3A 2OZSA 4FZYA 1IG8A 3AVIA 3PX4A 3OYFA 2P9UA 3M8PA 1KFSA 1GLLO 1B92A 4WFAL 3K0SA 2YNIA 1TV6A 1VAZA 4BR2A 1ZYQA 3SQ2A 2D0BA 3MWPA 1VSMA 3M8RA 3JXUA 5CYMA 3ULEB 1C6VA 3SNNA 2IGIA 2E2PA 5T7BA 4OX9K 4LD0A 1YTUA 4BROA 1OVYA 5KI6A 2E6MA 4BRNA 5EY4A 2ITGA 2R7YA 4B8CA 3SQ0A 3VQ7A 2NNWA 4DSLA 4IZ9A 4HUEA 3I0RA 1HPZA 2BTFA 3TAGA 4FJ8A 4JI0K 2Z1JA 4FK4A 1HPMA 4KRFA 4IFEA 1D9DA 2Q2RA 3WQUA 4KO0A 1QZ5A 1QHTA 1TKDA 2Q1NA 1GLBG 1LAWA 3UKUA 4JKDA 1WAFA 4XH4A 2HBMA 2YHXA 1QQCA 2ZM6K 3CXCM 4EIAA 4IEIA 3QMLA 1TYQB 1HKCA 4IBNA 3FLCO 3VTHA 4K25A 5EOYA 3K57A 3RMCA 5AFUA 3ZEUA 2P5OA 2E8AA 1XNQK 4DQ8A 3CJAA 3KZBA 1IJJA 2P5GA 1GOCA 4AHSA 4ELTA 4YOYA 1HJOA 3DWLA 4CBUA 2ZJRL 1X9MA 4LF7K 3KKSA 3LP3A 2QWQA 4CJ3A 3EZ5A 3TSPA 4AHCA 2Q36A 3DXKB 3D2EA 1E3MA 4M45A 4DV1K 2PBDA 2D5RA 3G71N 2KFNA 2WONA 4CGDA 3OW2M 2GV9A 3H08A 5FPEA 3LANA 1HNZK 3NCIA 2HHHK 1KLNA 4I9QA 1VSHA 1BIZA 3CHWA 1BOTO 4CJQA 1O13A 1LWCA 2Z1IA 4NCBA 1ATSA 3S3MA 1NOZA 3U8XA 4DUZK 3E9PA 3SPZA 4FO0A 3NDKA 4FW1A 3SAHA 3DLHA 4KB1A 3Q7CA 4NYFA 3IUCA 1SUQA 3VA3A 4NLCA 4E1NA 1BGXT 2UUCK 3OYGA 3ZSRA 3KLHA 1RT2A 3E66A 5AQUA 1T03A 4CJSA 3OYEA 2P1JA 4WE1A 3TTCA 4DV0K 3OVNA 2OA8A 4OPHA 3RRGA 4YOUA 1T44A 3WXIA 5AQVA 1NGFA 4B1YB 3CFPA 4DSEA 1S6PA 5GAHP 3ULEA 1S1UA 2I7NA 3THYA 1EQYA 1JLGA 2P51A 3LAKA 1WUAA 4AHVA 3O1WA 3O9QA 3VQ6A 3LWMA 1VSDA 4ZHRA 1T05A 3ZSZA 1T6CA 4CJRA 5AQKA 4B3OA 4CFAA 1IBMK 3AO4A 4KHPK 2ETJA 3CETA 4CIEA 1W9HA 4IXCA 4DTJA 4BRPA 4X64K 3ZSQA 1Z05A 2P9PB 3NF9A 3A5OC 3QERA 2HHVA 4ISEA 1S1VA 4LF5K 4OKJA 4CJKA 4RCHA 3L2WA 4DV6K 1RTDA 1JJ2M 1TYQA 2OPPA 4ILJA 3T1HK 4G9ZA 3QDKA 4GKKK 1SV5A 4DTUA 1U6ZA 1WN7A 1XUPO 3D45A 4E7LA 4FL9A 3CM5A 1BU6O 5E41A 3O9TA 3QB0A 2NUBA 1HR0K 1JLFA 1SS6A 4G1QA 2V7ZA 1B9FA 4JKAA 1C0TA 4KHNA 3DYAA 4FJIA 2DTUA 3NGYA 3GE1A 1H1VA 4FWOA 4KH5A 3JYTA 2QW9A 5AQLA 3QETA 4PHTX 3DXKA 2QXLA 4BC4A 5KPZA 3GBTA 4BACA 2ZD1A 1ITGA 1ZBIA 3VESA 4KHUA 1FXXA 1BCOA 1ZBUA 2HVIA 2ZGYA 3SUQA 2OPRA 2BE2A 5BN8A 4JD2B 1NK7A 4CJUA 3LL3A 3I8DA 4DU4A 2KZMA 3Q7BA 1RBTA 3IFRA 3CQ8A 2BANA 4ZTFA 1OH5A 3OTOK 2DPNA 3T7ZA 3HPHA 3H3NO 3DLEA 3M5RA 1DGKN 4JKGB 3NGZA 4F8RA 3ZT4A 4CZIA 3J7ZO 1W0HA 4WF9L 3EKSA 4FWRA 3KLFA 3SI6A 4GVMA 2AA4A 2E2NA 1A5WA 3NHGA 5KRSA 3ATUA 2W41A 3LDQA 1T6DA 3DAWA 4JN4A 1JCFA 2PYLA 3QIOA 1RDDA 3L2QA 4YOXA 1G15A 3KK7A 3MX5A 1Q7YO 4M3UA 1Z26A 3KLIA 4DHYA 3LP0A 3DXMB 4RW9A 3PIPL 3MN6A 2UYTA 3KHYA 3NFAA 1TUUA 3ZX2A 3V81A 3HL8A 4ELVA 4Z4FA 3V9UA 1K9MO 3RR8A 2W40A 3CCRN 2NRTA 3HVTA 2X74A 4K42A 1BI4B 4RG8A 4DFPA 2GUIA 2P9PA 2NZTA 3LALA 3KVGA 1BL3A 2A42A 1YXQA 1IKWA 3HJFA 1VRTA 3HVRA 4CF0A 1L3SA 4C8NA 5LJVA 3WNFA 3P38A 1RDAA 3G6EN 4CK1A 2YKNA 3AVNA 2WUSA 4CEBA 3OYAA 2AP1A 2F4VK 5GINA 2O8FB 3VQPA 3H1VX 1FKPA 3GDQA 1EP4A 1K8KA 3CJCA 4A61A 1HKGA 1S6QA 3OYDA 1UA1A 3OY9A 2HVHA 1IKXA 4CIGA 3ZSWA 3VQEA 5FRMA 1X1PA 3VN5A 4W5NA 4OVLA 4GMJB 4EFHA 4LF8K 3O5BA 1QZ6A 5M1QA 2QA4N 4A2BA 5KQ8A 4N56A 5AQGA 5M1PA 3VGLA 1NMNA 4F2RA 2H3GX 4AILC 2X6SA 2O8CA 1WOQA 4JD2A 3SQ4A 2V7YA 4QCLA 3NVMA 5AQTA 3DRRA 2YNFA 4H0PA 4O8KA 3JAMO 1VQ5N 3EEQA 3PO5A 3AA2A 1WLJA 4YFUA 3AA3A 1YJNN 2HOEA 2XRIA 4QS9A 4JKGA 2HMPA 1UOCA 3WUHA 3NAEA 1V4SA 3OYKA 1JLEA 4DTNA 4JI2K 3THXA 3CFRA 4BC2A 3W0LA 4CEFA 2Q97A 3MXMA 1S1WA 4K43A 4LFBK 4FXDA 1Y97A 2BH1A 4KHSA 1NKCA 1SKWA 2F9WA 4F4KA 3VQ9A 2KQ2A 4IDHA 5FDLA 3J80O 4JHDB 3ZX0A 4HVJA 4DF8A 2O8EA 4BDZA 1NU0A 5AQWA 4F2SA 4DTPA 1RFQA 1RDCA 1X3MA 3O80A 4HTLA 3FZMA 4FWPA 4BRQA 5M1FA 4CEAA 1BI4A 4ELUA 1KAXA 1SKRA 3EL2A 3CJ9A 1KFDA 4I9LA 1A5VA 4BQZA 3OYMA 3LP2A 2B4JA 3O4QA 1S5JA 3EYZA 4CJWA 3CFOA 1SL2A 4DKWA 1VQKN 4AQYK 1NLVA 3WNHA 2GBZA 3ASMA 3R8EA 4JV5K 2O8FA 4MDAA 5BPLA 2HMIA 1I94K 1TKTA 3HSCA 4Q5VA 3VGMA 2BDPA 3TAMA 4EZ9A 4W5QA 5ADXA 5AQMA 3CF5L 4FZXC 4DCHA 4E19A 1TL1A 1KXPA 1U48A 4GKJK 4YNQA 1VQ9N 4B1VA 2HNDA 3AVKA 1RILA 4B9NA 4MQ3A 3L2RA 4EAHD 4YOTA 4CJ7A 5TKWA 5GAGP 1J6ZA 2G8UA 1NJIO 1OH6A 3VQQA 5DM6L 2FBVA 3CMEN 4OGEA 4J2BA 3V1OA 3LDSA 4FLZA 1WBBA 1RTIA 4DQIA 4W5RA 3TANA 4DSFA 5AQRA 4FSVA 2BGGA 1C1BA 4F3TA 3OYBA 4X65K 4M7XA 1HRHA 3TSQA 1D4XA 5DK5A 1S3XA 5HOOA 3VERA 2VGMA 4CE9A 1WSJA 4H0OA 4AHUA 4MDBA 1UAXA 4CJVA 4LFAK 3VOVA 1VSFA 2G8HA 5GIOA 3NH2A 2ITMA 5HRPA 4E3SA 3LZIA 5CR4A 1YJ9N 1YT3A 3OYLA 2UU9K 3P4IA 1L3VA 1YVUA 2QWOA 3AGKA 1J5EK 3VQ5A 1C0GA 2Q0RA 5AQOA 4KFBA 4FVMA 4FJ9A 1RBVA 5CZ1A 3L2UA 2KTQA 1YTAA 3BF3A 4Y1CA 4FZZA 4QS8A 2IIRA 2HHTA 2QWPA 4GV6A 3W3DA 3SBTA 5C42A 1KLMA 2HNZA 3ZETA 4BE2A 3KIOA 5JS1A 5GIPA 1XHXA 3WEEB 1S1TA 3HPOA 3KK3A 3MN7A 1Q9XA 3DMJA 3CCLN 2YKMA 1KCFA 2JWKA 1ILYA 3MK6A 4BC5A 2CGJA 2OANA 4Z94A 4ZTJA 2FBXA 4A5BA 2XO7A 1TAUA 3VQCA 4FWMA 4K8ZA 4BQLA 2NRZA 2W6KA 5AQFA 3ZT0A 3E9LA 3MEDA 3TTDA 2VWJA 4O0JA 1U49A 3OYCA 2GEMA 2PFUA 4WFBL 4FK0A 3M3ZA 1EO1A 2FC0A 1JL1A 3BY5A 3EO3A 1NG9A 5AR0A 3AAQA 3LAMA 3DI6A 3RVCA 4J2DA 4CF9A 3UKRA 1JL2A 1RTJA 3OS0A 5AQSA 3AVLA 4W5TA 4JKCA 4R5PA 1TGOA 1NJZA 2HHQA 4I2PA 1M90O 1NKEA 3TI0A 3PX6A 4A57A 4FLVA 1HNVA 2Y1IA 1YJWN 2FSJA 3KJVA 4FJ5A 4PKIA 4H0TB 3M1FA 1KTQA 2YHYA 3P5JA 3SQ1A 3BUZB 2D4WA 3VQ4A 3RSEB 4NB4A 3OS2A 4BRGA 3M8SA 3AVBA 4MFBA 3G4SN 3IDHA 2IVOA 3O6WA 5KRTA 2Q3SA 5BN9A 4BWMA 1OH8A 2E5LK 4FJHA 3B8AX 3O8MA 1WBDA 4L8RB 4CZMA 3O9UA 3RR7A 3DM2A 3V9XA 2VQEK 2F8TA 4FLUA 4O44A 4E7KA 3MWTA 3KK2A 1JLCA 3OYHA 4H0YB 4CGJA 3DLLL 1NGJA 4H5VA 5BPMA 4PUOA 4NYNA 4C23A 4M63C 4E7JA 1KAZA 1VQ7N 2ZQBA 1QQNA 3QEXA 2CGKA 2E2QA 3DOKA 4KHQA 3WEEA 2E6LA 1X9WA 2G8IA 1W97L 1NKBA 4FVUA 1U2VB 1CXQA 5C2FA 4OPKA 3KLEA 1RT7A 1BA0A 4CW7B 4BRAA 1T3VA 2YJFA 2V52B 3SK3A 4B9SA 1CLQA 4IDKA 2RHKA 3CD6N 4QOZB 3CQYA 3ENBA 2GWKA 5EX5A 3ZSVA 1SQKA 1K6YA 3THWB 5F1XA 3M6GA 4UY8O 3SJHA 4FYDA 1Q86O 3SV4A 4Q0BA 1NBWA 4OKEA 3OJUA 5H1SQ 1QVFM 3OYIA 4JAXA 3KD5E 4CCHA 2GTDA 4CZEA 2JWLA 1JXBA 2KW4A 4ICLA 5BR8K 1ASVA 3B6OA 4B9UA 1U45A 1ATRA 3MXIA 3ATVA 3A2FA 1BQMA 1LOTB 3LM2A 4EP4A 4CHYA 2QWLA 1TK8A 2GX9A 1JCGA 3P1GA 3RMBA 1YF5L 4JLHA 3RSEA 1NK8A 3T19A 4CI6A 4IOAL 3H6EA 1BUPA 4FWKA 3EE9A 4FPAA 3BZKA 1VSJA 5CZ2A 5J2NA 2P9KB 3VEZA 4BRKA 3V4IA 4FM1A 3GL1A 2PY5A 5AZIB 2D0CA 2FBTA 1C1AA 1HNXK 5I9EB 2WC9A 4OLAA 3QNNA 1E4FT 4DTOA 3C6UA 2NRXA 3CJ1A 5AQZA 1L3TA 1FJGK 2KKZA 3ZSYA 1T8EA 3V6DA 3VTIA 2ATQA 1NK4A 2BUPA 2D1KA 5HROA 4JK9A 4CHPA 4Z4HA 2EX3A 4RW4A 5MLCQ 5AQXA 4I6MB 2QWMA 2FF6A 4BG9A 2Q31A 2OCEA 3CPWM 3CCMN 1TK0A 2E20A 2FSKA 3C94A 4H5WA 4NCAA 3KK1A 1U2VA 3C6HA 1IKYA 4BE1A 3QNOA 1WSGA 1LCUA 2VG5A 3CM6A 2D0OA 3D6RA 3VGKA 3K9JA 1WSEA 4QS7A 2VWKA 3ID8A 4OPAA 1VQPN 2UXDK 2P9IB 4IFYA 4BRDA 3IAYA 4DLEA 3CCEN 2ASPA 1QHAA 3R3LA 1JKHA 3CMAN 4BDYA 5AJ3K 4O5BA 3QIPA 2O8DB 3THWA 4DQQA 1EKEA 1VQNN 3G25A 1EWRA 4IKFA 3HO1A 2UUBK 4BR0A 3PX0A 4OLBA 4CEOA 3ENOA 4JEPA 3AVFA 2QEXN 1L5UA 4JI7K 3V9WA 1BWFO 2A1SA 4MO5A 2PYJA 4LFCK 5JLFA 4BDPA 1BISA 4JKHA 4CHNA 1QE1A 4FJNA 3WQTA 2OPSA 2G8VA 1YAGA 4FWNA 4DV2K 2NLXA 2ASMA 3SAGA 1HYSA 4FJXA 3HXMA 2HBKA 1VSIA 1BQNA 4AH9A 5JVGL 2OYQA 4KI4A 1VQ6N 2JLEA 2RN2A 4B1XB 2FXUA 5LMNK 1RT3A 3TTFA 4Z4CA 4IOXA 3KTQA 3L8BA 1HUXA 1GLAG 2LSNA 4B3SK 4ILHA 1Z6RA 4MO4A 3HT3A 5AQYA 5JS2A 4M42A 1NK5A 3FZFA 1KD1O 3L6QA 3L2VA 4J2EA 5C24A 4BR5A 2P9KA 3PUFA 4H4MA 3NGIA 2XY7A 3WXMB 4JYAK 3QFPA 3F9MA 4E1MA 2J4RA 2NRWA 3AAPA 3P31A 2XHBA 4B1ZA 1K73O 4DSKA 4E0DA 1MWKA 3I0SA 3LDNA 1Z25A 3QBXA 4BGBA 4GV9A 4FJLA 1TAQA 3CJBA 1I39A 4HUGA 3C0BA 5IT9O 1QQMA 5AQHA 1VQ4N 3KWIA 3WXJA 5TKYA 4I6MA 3OBWA 3SLCA 4DR4K 4E7IA 4TSXA 4B9VA 3H46O 4N5SA 2HW3A 4BRLA 2KZZA 3C6TA 1I3AA 3A5LC 2WOMA 4H8KA 5CYQA 1OH7A 2YNHA 3VEVA 1Q81O 1VQMN 3K5MA 1IKVA 1NOYA 4AM7A 1C0UA 1KSPA 4B1UB 4PWDA 1NJYA 1NGIA 1VQLN 3LDOA 4Z4GA 3QLHA 2ZF5O 3VQ8A 4HCBA 3U9ZA 5IWAK 4H0XB 5J2MA 4DG1A 3L4IA 2P9IA 2P9LB 4IJAA 3O9SA 4PL8A 4A5AA 3TWHA 1ATNA 5B8HA 3L3UA 1NGHA 2O8DA 1ZBLA 1ASWA 4RW6A 4DR6K 1HNIA 3O1BA 4ISGA 3FFIA 3OA9A 3VQDA 3VEYA 4FLXA 1EWQA 1XC9A 2QXFA 4BVOA 4Z4EA 2E88A 2HHSA 4CD1A 2IOCA 3KD1E 3IS9A 1F21A 4M3TA 4CZJA 4CJPA 3DXMA 5HRNA 4DLGA 3TAQA 4FWQA 5FPMA 2HB5A 1R0AA 1HYZA 4JI1K 1D9FA 4JI4K 5JICA 2QTDA 4FCYA 1WSIA 4DU1A 2YJEA 2HF4A 2D0AA 1UWBA 1ZXOA 4FLWA 1NGGA 1V4TA 4BR9A 4DQRA 4DTXA 3K5LA 2NRHA 4CHOA 1RDBA 3PY8A 4Y1DA 4KTZA 5J1EA 3CCJN 4WFNL 4O0IA 5JVHL 4DQPA 2E1ZA 3O3GA 4CEEA 2FBYA 3PSIA 2F7TA 4CFBA 1N36K 4LY7A 5C15A 1NGBA 1OKJA 4ID5A 2VG6A 4DR2K 4CJ4A 2EHGA 3VQAA 3GOIA 1P8ZA 1X3NA 3A5MC 3ITHA 4KTQA 3HP9A 5SZTA 2XY6A 1DKGD 5D3GA 1VHXA 2W6LA 4BWJA 5CHIA 4B3RK 4LF6K 3EY1A 1SL0A 4DMNA 4DV5K 3QEVA 1J53A 3UIQA 3CC4N 2P9UB 1HX1A 5K14A 1CZ9A 1RT6A 4BC3A 4CECA 2HBJA 5AQQA 3K58A 4FJMA 3IMXA 4K8XA 4FWLA 2A40A 4WQ4C 5F0XA 1NNEA 3LM9A 4BRMA 4KB0A 3A8YA 4U67L 3F9KA 1O1WA 1N34K 5E26A 1HKBA 5M1OA 2VG7A 3EE8A 1S9EA 3MN9A 3KLGA 4KAZA 3AO2A 4H4OA 3VPZA 4XEIA 3C95A 3NF8A 3U4LA 3VMFB 4CF2A 4YOWA 3KWGA 4LC9B 3NF7A 2G8FA 2DFEA 4DQSA 3U9DA 1GOAA 4RTFD 2P9LA 4K41A 5DMRA 1S9GA 4CEQA 2CGLA 4RW8A 3VEXA 1CZAN 2VCPA 5HP1A 4FJ7A 4CZHA 5DM7L 4WQ5C 3SUNA 1VSLA 3K5NA 2E4LA 1XC3A 3CQXA 3ZT3A 4B9TA 5C0YA 4JHDA 3ZEUB 2P9SB 4CFDA 4DTMA 4HWIA 4KREA 4IJNA 4JKBA 3FFKB 3AVJA 2KFZA 2AJQA 2ZE2A 1LW2A 4KI6A 3IRXA 1C0FA 3FGUA 2F8SA 2UUAK 4CGFA 4LSLA 2RKIA 1D5AA 3TARA 3D2EB 4FLYA 1IO2A 3QINA 3SBGA 2YV0X 3KKRA 4OKKA 1NGCA 4C8OA 2OTJN 4BRHA 5ELZA 3ISNC 4E1JA 1GOBA 1IG9A 3HI0A 3OJSA 3LWLA 1RT4A 5C2DA 4HHTA 3PSFA 1RT5A 1YUWA 1MWMA 1X9JA 4CF8A 1C1CA 1ZBSA 4IEEA 3QEIA 3DLBA 4FLTA 4M3XA 2ASOA 1QTMA 2F96A 1J5OA 3CERA 1N6QA 3OBYA 5AQIA 4BVPA 2OTLN 4PY5A 4CBXA 3AARA 1DLOA 3I33A 4JI8K 2A6AA 1KVBA 1YVNA 1NMDA 4U7BA 4ISFA 4CEZA 3J7AP 2IVNA 1TKXA 2B5JA 4DU3A 1HLUA 1XHZA 2GELA 1XNRK 1NGDA 4B9LA 3THYB 4JS4A 3PLAA 4HTUA 3VENA 4GW6A 2GUPA 4EHUA 5AFUH 1RTHA 3CCSN 4J2AA 3VA0A 4DF4A 2DFFA 3PIOL 2P9NB 3V1RA 1NK6A 3MN5A 3BP8A 3VEWA 1DTQA 4M41A 1Q18A 4JK8A 4CZKA 2RE2A 1VSKA 3R6MA 4OJRA 5AQPA 4OO1J 4YORA 2UXCK 1WSFA 1VRUA 3QESA 3PO4A 1NGEA 1VQON 4LH5A 5LY3A 5CY4A 3AO3A 2W42A 2PAVA 1U4BA 4A2AA 2QKKA 4O8UA 3LPUA 3HZ6A 1BO5O 2RPIA 3CC2N 2P9SA 3SUPA 4F9OA 1RBUA 1OVQA 4CZFA 5BRDA 4KPYA 1J9AA 2O4GA 4M3RA 3I56N 4KHWA 1TKZA 2VYPA 1GLDG 4CJ5A 1S72N 4CVNE 3P83D 1KRPA 4C1NI 4RW7A 4CJFA 3OYJA 3CG7A 4FM0A 3BZCA 3AGRA 1Y64A 3TR8A 3AVHA 5KTQA 1SKSA 3HRGA 4BRIA 3SYZA 4EZ6A 3QEWA 4CESA 3QBWA 5BREA 1MA9B 2WFBA 3MEGA 5GAEP 3G0ZA 2O8CB 4KKOA 1JLQA 4B9MA 1REVA 2DY4A 4DSIA 2A5XA 4CJEA 4BR4A 4JKFA 3CIPA 3F2KA 2A3ZA 4OPJA 3SUOA 4JRPA 1D8YA 4DV4K 1BIUA 4CGHA 4N41A 2KHOA 3AA4A 5FROA 1FKOA 1WB9A 3H1QA 2E2OA 1XQSC 4CHZA 3NMUA 4CD3A 1GLJO 4PL7A 3HBTA 5FPNA 3DLRA 2YHAA 5HL7L 5BRFA 4X62K 1C0MA 4NCGA 3VEOA 3D0PA 4CJTA 3PV8A 2YHWA 4DTSA 3U6FA 3CJ7A 5KPRA 1HQUA 3O4WA 1XI1A 3SAFA 1KQSM 1MU2A 4JI6K 3SPYA 4FW2A 1R59O 4H5NA 3B6PA 1K8AO 2P9NA 1LW0A 4NLBA 1J54A 4CHQA 3J7YP 3SZ2A 3HTVA 4HUFA 1WAJA 4BRFA 3QO9A 1QSLA 4LH4A 1DTTA 3RWUA 4XIUA 5FRNA 2ZJPL 1NM1A 1RDWX 4CGIA 1VSEA 3CYMA 2E1YA 1TL3A 3ZSXA 1N8RO 4JRQA 1YHQN 4F3OA 2UXBK 4JI3K 2RF2A 1MDUB 3SV3A 5J2PA 1XWLA 3S3OA 4Z4IA 4M7YA 3IG1A 1QS4A 3HM8A 1YI2N 1N5YA 5HBMA 5CE3A 3AVCA 3LP1A 3D7EO 3K5OA 4MLEA 1IV0A 1K8KB 2HF3A 2QM1A 5E84A 3D2FB 4IFVA 3ZX3A 1BA1A 4C8LA 3DJCA 4N76A 4YY3K 4EP5A 2FSNA 4PKHA 1VQ8N 2Z1HA 2A41A 3UB5A 2G8WA 1CXUA 3ZYYX 3TABA 4M3ZA 3NH1A 2I7PA 4CGGA 3S9HA 4K0KK 4CIFA 5KQDA 3MEEA 4I2QA 2NRVA 2A1RA 3SMSA 2IS3A 1WSHA 2Z1GA 3AV9A 3SMPA 2F9TA 3RMDA 3DLKA 1ZC6A 1NK0A 5EU7A 3T69A 1L3UA 1RBSA
chains in the Genus database with same CATH topology
3TWHA 4M45A 3L3UA 4KFBA 4CFCA 2D5RA 4FVMA 1ZBLA 2KFNA 1ASWA 1NJWA 2OZMA 2WONA 4CGDA 4ID1A 2GV9A 1EX4A 4RW6A 4FJ9A 1RBVA 5CZ1A 3L2UA 3ZT1A 1HNIA 2HHWA 3H08A 1HYVA 3FFIA 1YTAA 3LANA 3VQDA 3NCIA 4FLXA 4CK2A 4DTRA 1XC9A 1KLNA 2QXFA 1VSHA 4Y1CA 4I9QA 1BIZA 4FZZA 4Z4EA 2HHSA 4CJQA 2IOCA 2HHTA 3KD1E 3DRSA 1LWCA 3IS9A 1F21A 2Z1IA 5C42A 1KLMA 2HNZA 4NCBA 4M3TA 3S3MA 3ULDA 4CJPA 2YHBA 5HRNA 4DLGA 1NOZA 3T1AA 3SPZA 3TAQA 2JGUA 4BE2A 1HMVA 3KIOA 5JS1A 4DS5A 2HB5A 1XHXA 3NDKA 1R0AA 2HHXA 4FW1A 3DLHA 1HYZA 4KB1A 4NYFA 1D9FA 3JSMA 4FJKA 2X6NA 1SUQA 2DFHA 1S1TA 3HPOA 3KK3A 3VA3A 1Q9XA 3DMJA 4FCYA 1WSIA 2IAJA 1KCFA 1BGXT 2YKMA 4E1NA 4DU1A 2D0AA 1UWBA 4B8AB 3OYGA 3DRPA 3ZSRA 4FLWA 3RTVA 4ZTJA 2FBXA 1RT2A 3KLHA 2XO7A 1T03A 1TAUA 3VQCA 4W5OA 4CJSA 4K8ZA 4DQRA 1JLBA 4DTXA 3OYEA 3K5LA 2P1JA 4WE1A 3OVNA 4CHOA 1RDBA 3ZT0A 1T7PA 2OA8A 3PY8A 4Y1DA 3RRGA 3MEDA 4KTZA 5J1EA 4O0JA 3OYNA 2VWJA 1U49A 3OYCA 3E01A 4JS5A 4FK0A 3CFPA 4DSEA 4O0IA 1S6PA 2I5JA 2X78A 1HQEA 3V9ZA 4DQPA 1TVRA 3O3GA 2FC0A 1S1UA 4CEEA 5C25A 1JL1A 2FBYA 4CFBA 1JLGA 2P51A 3LAMA 3LAKA 1X9SA 4LY7A 4AHVA 1NK9A 3DI6A 3LWMA 3VQ6A 1VSDA 4ZHRA 4CF9A 4ID5A 4J2DA 2VG6A 1JL2A 1RTJA 3OS0A 4CJ4A 1T05A 2EHGA 3ZSZA 4CJRA 4B3OA 3VQAA 4CFAA 3ITHA 3AO4A 4KTQA 3AVLA 4W5TA 2ETJA 3HP9A 4CIEA 5SZTA 2XY6A 1W9HA 4DTJA 4CK3A 5D3GA 4R5PA 1TGOA 1NJZA 1SL1A 3ZSQA 2HHQA 1ZBFA 3S3NA 3NF9A 4BWJA 4I2PA 3QERA 1NKEA 3TI0A 2HHVA 3EY1A 4DFJA 1SL0A 4DMNA 3QEVA 3PX6A 1J53A 3UIQA 1S1VA 3V9SA 5K14A 4FLVA 1HNVA 5HRSA 5KGXA 4OKJA 4CJKA 1CZ9A 3L2WA 1RT6A 3ZCMA 4CECA 2Y1IA 1RTDA 3KJVA 3K58A 4FJMA 4K8XA 2OPPA 4FJ5A 1SV5A 4FJGA 3MXJA 4DTUA 1KTQA 4QAGA 1WN7A 3P5JA 3D45A 4E7LA 1ASUA 3SQ1A 4KB0A 3CM5A 1IH7A 3F9KA 3VQ4A 1O1WA 3OS2A 3M8SA 3AVBA 4KHYA 3G10A 4MFBA 5E41A 2VG7A 4DWIA 1S9EA 2NUBA 3KLGA 4KAZA 1A5XA 1JLFA 3AO2A 4H4OA 4G1QA 4IG3A 3HK2A 1B9FA 3C95A 5KRTA 1C0TA 3NF8A 4KHNA 3DYAA 4FJIA 2Q3SA 4OGCA 4CF2A 4BWMA 4FJHA 2DTUA 3NGYA 3NH0A 4IG0A 3NF7A 1UA0A 2G8FA 2DFEA 3BGRA 4L8RB 3MECA 3HYFA 3JYTA 4DQSA 3QETA 1GOAA 5DMRA 1S9GA 3RR7A 3DM2A 4CEQA 3V9XA 2PZSA 4RW8A 3V1QA 3TAFA 3VQBA 5HP1A 4BACA 2F8TA 2ZD1A 1ITGA 3K59A 4FLUA 4FJ7A 4M3WA 1ZBIA 4KHUA 1FXXA 1BCOA 1ZBUA 4O44A 3O3HA 4E7KA 2HVIA 4HCCA 3SUNA 3KK2A 1VSLA 1JLCA 3OYHA 3K5NA 3SUQA 4CGJA 2OPRA 2BE2A 2E4LA 1U04A 1NK7A 1LWFA 1JLAA 4CJUA 3ZT3A 3U3GA 3I8DA 1QSYA 4B9TA 4B08A 4PUOA 4NYNA 4DU4A 2KZMA 4BE0A 4CFDA 1EXQA 4E7JA 1RBTA 3CQ8A 4DTMA 2BANA 4ZTFA 4KREA 2ZQBA 4PA1A 3QEXA 3AO5A 3DOKA 1QSSA 4KHQA 3AVJA 4KV8A 1NJXA 2KFZA 2AJQA 2ZE2A 3HPHA 2E6LA 1X9WA 2G8IA 4I7FA 1LW2A 4KI6A 3DLEA 4N47A 3HM9A 1CZBA 3NGZA 3IRXA 3DOLA 3TAPA 4F8RA 3ZT4A 3F73A 1RCHA 1RT1A 1FK9A 2F8SA 2IDOA 1W0HA 1NKBA 4CGFA 4LSLA 3KLFA 3K2PA 3HPGA 2RKIA 1D5AA 3SI6A 3TARA 1CXQA 4FLYA 4GVMA 1IO2A 3AO1A 1BCMA 3L3VA 3QINA 4OPKA 1A5WA 3AVGA 2YV0X 3KKRA 4OKKA 3NHGA 5KRSA 1RT7A 3KLEA 4C8OA 4CEDA 3T3FA 3ISNC 4FM2A 4B9SA 1CLQA 4IDKA 3LPTA 4QOZB 4AHTA 2OPQA 1GOBA 1IG9A 3ZSVA 3ALYA 2PYLA 1K6YA 4AHRA 3QIOA 1RDDA 3OJSA 3L2QA 3LWLA 5HLFA 1G15A 4M3UA 2HHUA 4FYDA 1Z26A 3KLIA 1RT4A 3LP0A 3LZJA 3SV4A 3MAQA 4RW9A 4Q0BA 4OKEA 3ZSOA 3OJUA 3BDPA 4HHTA 3NE6A 1RT5A 3NFAA 3V81A 4CF8A 1C1CA 3HL8A 4ELVA 4Z0UA 3QEIA 3V9UA 3RR8A 4Z4FA 5J2QA 3DLBA 3OYIA 4FLTA 4M3XA 3HVTA 1QTMA 2G8KA 2F96A 2X74A 1J5OA 3KD5E 4DFPA 1BI4B 4RG8A 3WNEA 4CCHA 1N6QA 1JXBA 2O4IA 2KW4A 1B9DA 4ICLA 2GUIA 1ASVA 3LALA 4PY5A 1BL3A 3B6OA 1DLOA 4B9UA 3U3YA 4FJJA 1KVBA 1U45A 1VK0A 3MXIA 3A2FA 1IKWA 3HJFA 1VRTA 4CEZA 4CF0A 3HVRA 1L3SA 1BQMA 4C8NA 1TKXA 2YNGA 3WNFA 2XY5A 4EP4A 4CHYA 2B5JA 1TK8A 1RDAA 3SCXA 4CK1A 2YKNA 3AVNA 4CEBA 3OYAA 4DU3A 4DSJA 1XHZA 3P1GA 3VQPA 3RMBA 1FKPA 1EP4A 4B9LA 3NF6A 4JLHA 4DS4A 1NK8A 3T19A 4JS4A 4HTUA 3NBPA 1S6QA 4GW6A 3OYDA 3OY9A 1UA1A 2HVHA 1IKXA 1RTHA 4CIGA 3AA5X 3ZSWA 4J2AA 3VQEA 3VA0A 5FRMA 1X1PA 3VN5A 4DF4A 2DFFA 4W5NA 4O4GA 3V1RA 4OVLA 4GMJB 1KVAA 3THVA 1VSJA 5CZ2A 5J2NA 5I42A 1NK6A 1WNSA 1DTQA 4M41A 4FM1A 3V4IA 2PY5A 3AVAA 1VSKA 2D0CA 4OJRA 2FBTA 1C1AA 4N56A 4OLAA 1WSFA 3QNNA 4C8KA 4DTOA 1VRUA 3C6UA 1KVCA 3QESA 3PO4A 1Q8IA 3ZT2A 1L3TA 4LH5A 4F2RA 5CY4A 5I3UA 3ZSYA 1T8EA 4AILC 2X6SA 3AO3A 4CF1A 2ATQA 2W42A 5HRRA 3V6DA 3SQ4A 1NK4A 1LWEA 1U4BA 4QCLA 4CJLA 2QKKA 3DRRA 3LPUA 4CERA 5HROA 4Z4HA 4CHPA 4FK2A 2EX3A 2YNFA 2RPIA 4RW4A 3SUPA 3PO5A 1RBUA 4KPYA 1U47A 3AA2A 1J9AA 1WLJA 2O4GA 4YFUA 4M3RA 3AA3A 2Y1JA 4KHWA 2QK9A 1TKZA 4CJ5A 2XRIA 3P83D 1KRPA 1TK0A 3O4NA 3C94A 4RW7A 4CJFA 3CG7A 3OYJA 4FM0A 3HP6A 1UOCA 2B6AA 1RBRA 4O55A 3TR8A 4NCAA 3KK1A 3AVMA 3AVHA 5KTQA 4BE1A 1IKYA 3QEPA 3QNOA 3NAEA 1WSGA 2VG5A 1HJRA 3CM6A 3OYKA 1JLEA 1SKSA 3SYZA 4DTNA 3SJJA 4EZ6A 3QEWA 4CESA 2QKBA 3CFRA 4LSNA 2XY8A 1WSEA 4M3YA 3MEGA 3M8QA 4CEFA 2VWKA 3G0ZA 3MXMA 1S1WA 4IFYA 3IAYA 4DLEA 4KKOA 1JLQA 4FXDA 1Y97A 1LV5A 3TAEA 4KHSA 1JKHA 4DFMA 4BDYA 1NKCA 1REVA 4B9MA 4O5BA 3QIPA 1SKWA 2DY4A 4DSIA 4DQQA 1EKEA 3O3FA 4F4KA 1Q9YA 4CJEA 3VQ9A 2KQ2A 1EETA 4IKFA 1JXEA 5FDLA 3HO1A 4C8MA 3PX0A 4OLBA 4HVJA 4CEOA 1LAVA 3HSTB 4OPJA 4DF8A 3SUOA 3AVFA 4JRPA 3DLGA 3RMAA 1BIUA 1D8YA 4BDZA 1L5UA 4F2SA 4DTPA 2HNYA 3V9WA 1RDCA 4CGHA 4N41A 3AA4A 5FROA 2A1SA 3OS1A 4E89A 2PYJA 1FKOA 4UQGA 4CEAA 4BDPA 4KTWA 1BISA 4CHNA 1BI4A 1QE1A 4FJNA 4CHZA 5KGWA 3RRHA 4ELUA 1SKRA 2OPSA 2G8VA 1KFDA 4I9LA 1A5VA 3WNGA 5SWMA 3OYMA 1RNHA 1ZBHA 3LP2A 4E7HA 2B4JA 3O4QA 1TK5A 1S5JA 3EYZA 4CJWA 1HYSA 3CFOA 4FJXA 1SL2A 3HXMA 4PQUA 1VSIA 1BHLA 1BQNA 4AH9A 4DFKA 3DLRA 1S1XA 2YHAA 2IC3A 3WNHA 2OZSA 4FZYA 1C0MA 4NCGA 2OYQA 3AVIA 2GBZA 3PX4A 4KI4A 3ASMA 3OYFA 3D0PA 4CJTA 2JLEA 3PV8A 2RN2A 4DTSA 3M8PA 3U6FA 1KFSA 2HMIA 1B92A 2YNIA 1TV6A 1TKTA 1HQUA 4Q5VA 1RT3A 4Z4CA 1XI1A 3TAMA 1ZYQA 2BDPA 3SQ2A 3KTQA 4EZ9A 2D0BA 3L8BA 1MU2A 1VSMA 4W5QA 2LSNA 3SPYA 3M8RA 4FW2A 5CYMA 1C6VA 4M42A 3HT3A 3B6PA 5JS2A 1LW0A 3SZ2A 1J54A 2IGIA 4CHQA 3SNNA 4FZXC 5T7BA 1NK5A 4HUFA 1WAJA 4LD0A 1YTUA 3L2VA 4J2EA 3QO9A 5C24A 1QSLA 5KI6A 3PUFA 2E6MA 4H4MA 4E19A 3NGIA 2ITGA 1TL1A 4LH4A 2R7YA 4B8CA 1DTTA 3SQ0A 3VQ7A 3RWUA 1U48A 2XY7A 4DSLA 4XIUA 4YNQA 5FRNA 4HUEA 4CGIA 2HNDA 3AVKA 1RILA 1VSEA 3CYMA 3I0RA 4MQ3A 4E1MA 3L2RA 4B9NA 1TL3A 3ZSXA 4JRQA 1HPZA 3TAGA 2G8UA 4F3OA 4FJ8A 2XHBA 3VQQA 2Z1JA 4FK4A 4KRFA 2FBVA 2RF2A 3SV3A 4DSKA 1D9DA 4E0DA 3I0SA 5J2PA 1Z25A 1XWLA 3S3OA 4FJLA 4Z4IA 4KO0A 4OGEA 4J2BA 3IG1A 1QHTA 3V1OA 3LDSA 1TKDA 1QS4A 4FLZA 1LAWA 1TAQA 5HBMA 1N5YA 1I39A 1RTIA 4DQIA 1WAFA 4W5RA 4HUGA 3AVCA 3LP1A 3K5OA 3TANA 1QQCA 4DSFA 4IFVA 4IBNA 1C1BA 4C8LA 2BGGA 4F3TA 3OYBA 4N76A 4EP5A 2KTQA 1HRHA 2Z1HA 2G8WA 4E7IA 1CXUA 4TSXA 4N5SA 5DK5A 3K57A 3TABA 3RMCA 4B9VA 2HW3A 2KZZA 3C6TA 4M3ZA 1I3AA 3NH1A 2WOMA 4CGGA 3S9HA 2P5OA 4H8KA 5CYQA 4CE9A 4CIFA 1WSJA 3MEEA 2YNHA 4AHUA 1UAXA 4I2QA 4CJVA 3K5MA 1VSFA 2A1RA 1IKVA 2G8HA 2P5GA 1NOYA 3NH2A 1GOCA 1C0UA 1KSPA 2IS3A 1WSHA 4AHSA 2Z1GA 5HRPA 3LZIA 4E3SA 4ELTA 4PWDA 1YT3A 3OYLA 1NJYA 1X9MA 3AV9A 3KKSA 3LP3A 3RMDA 3DLKA 1NK0A 4Z4GA 3QLHA 4HCBA 3VQ8A 1L3VA 1YVUA 5EU7A 4CJ3A 3EZ5A 5J2MA 4AHCA 1L3UA 4DG1A 3VQ5A 1RBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWH A;  4M45 A;  3L3U A;  4KFB A;  4CFC A;  2D5R A;  4FVM A;  1ZBL A;  2KFN A;  1ASW A;  1NJW A;  2OZM A;  2WON A;  4CGD A;  4ID1 A;  2GV9 A;  1EX4 A;  4RW6 A;  4FJ9 A;  1RBV A;  5CZ1 A;  3L2U A;  3ZT1 A;  1HNI A;  2HHW A;  3H08 A;  1HYV A;  3FFI A;  1YTA A;  3LAN A;  3VQD A;  3NCI A;  4FLX A;  4CK2 A;  4DTR A;  1XC9 A;  1KLN A;  2QXF A;  1VSH A;  4Y1C A;  4I9Q A;  1BIZ A;  4FZZ A;  4Z4E A;  2HHS A;  4CJQ A;  2IOC A;  2HHT A;  3KD1 E;  3DRS A;  1LWC A;  3IS9 A;  1F21 A;  2Z1I A;  5C42 A;  1KLM A;  2HNZ A;  4NCB A;  4M3T A;  3S3M A;  3ULD A;  4CJP A;  2YHB A;  5HRN A;  4DLG A;  1NOZ A;  3T1A A;  3SPZ A;  3TAQ A;  2JGU A;  4BE2 A;  1HMV A;  3KIO A;  5JS1 A;  4DS5 A;  2HB5 A;  1XHX A;  3NDK A;  1R0A A;  2HHX A;  4FW1 A;  3DLH A;  1HYZ A;  4KB1 A;  4NYF A;  1D9F A;  3JSM A;  4FJK A;  2X6N A;  1SUQ A;  2DFH A;  1S1T A;  3HPO A;  3KK3 A;  3VA3 A;  1Q9X A;  3DMJ A;  4FCY A;  1WSI A;  2IAJ A;  1KCF A;  1BGX T;  2YKM A;  4E1N A;  4DU1 A;  2D0A A;  1UWB A;  4B8A B;  3OYG A;  3DRP A;  3ZSR A;  4FLW A;  3RTV A;  4ZTJ A;  2FBX A;  1RT2 A;  3KLH A;  2XO7 A;  1T03 A;  1TAU A;  3VQC A;  4W5O A;  4CJS A;  4K8Z A;  4DQR A;  1JLB A;  4DTX A;  3OYE A;  3K5L A;  2P1J A;  4WE1 A;  3OVN A;  4CHO A;  1RDB A;  3ZT0 A;  1T7P A;  2OA8 A;  3PY8 A;  4Y1D A;  3RRG A;  3MED A;  4KTZ A;  5J1E A;  4O0J A;  3OYN A;  2VWJ A;  1U49 A;  3OYC A;  3E01 A;  4JS5 A;  4FK0 A;  3CFP A;  4DSE A;  4O0I A;  1S6P A;  2I5J A;  2X78 A;  1HQE A;  3V9Z A;  4DQP A;  1TVR A;  3O3G A;  2FC0 A;  1S1U A;  4CEE A;  5C25 A;  1JL1 A;  2FBY A;  4CFB A;  1JLG A;  2P51 A;  3LAM A;  3LAK A;  1X9S A;  4LY7 A;  4AHV A;  1NK9 A;  3DI6 A;  3LWM A;  3VQ6 A;  1VSD A;  4ZHR A;  4CF9 A;  4ID5 A;  4J2D A;  2VG6 A;  1JL2 A;  1RTJ A;  3OS0 A;  4CJ4 A;  1T05 A;  2EHG A;  3ZSZ A;  4CJR A;  4B3O A;  3VQA A;  4CFA A;  3ITH A;  3AO4 A;  4KTQ A;  3AVL A;  4W5T A;  2ETJ A;  3HP9 A;  4CIE A;  5SZT A;  2XY6 A;  1W9H A;  4DTJ A;  4CK3 A;  5D3G A;  4R5P A;  1TGO A;  1NJZ A;  1SL1 A;  3ZSQ A;  2HHQ A;  1ZBF A;  3S3N A;  3NF9 A;  4BWJ A;  4I2P A;  3QER A;  1NKE A;  3TI0 A;  2HHV A;  3EY1 A;  4DFJ A;  1SL0 A;  4DMN A;  3QEV A;  3PX6 A;  1J53 A;  3UIQ A;  1S1V A;  3V9S A;  5K14 A;  4FLV A;  1HNV A;  5HRS A;  5KGX A;  4OKJ A;  4CJK A;  1CZ9 A;  3L2W A;  1RT6 A;  3ZCM A;  4CEC A;  2Y1I A;  1RTD A;  3KJV A;  3K58 A;  4FJM A;  4K8X A;  2OPP A;  4FJ5 A;  1SV5 A;  4FJG A;  3MXJ A;  4DTU A;  1KTQ A;  4QAG A;  1WN7 A;  3P5J A;  3D45 A;  4E7L A;  1ASU A;  3SQ1 A;  4KB0 A;  3CM5 A;  1IH7 A;  3F9K A;  3VQ4 A;  1O1W A;  3OS2 A;  3M8S A;  3AVB A;  4KHY A;  3G10 A;  4MFB A;  5E41 A;  2VG7 A;  4DWI A;  1S9E A;  2NUB A;  3KLG A;  4KAZ A;  1A5X A;  1JLF A;  3AO2 A;  4H4O A;  4G1Q A;  4IG3 A;  3HK2 A;  1B9F A;  3C95 A;  5KRT A;  1C0T A;  3NF8 A;  4KHN A;  3DYA A;  4FJI A;  2Q3S A;  4OGC A;  4CF2 A;  4BWM A;  4FJH A;  2DTU A;  3NGY A;  3NH0 A;  4IG0 A;  3NF7 A;  1UA0 A;  2G8F A;  2DFE A;  3BGR A;  4L8R B;  3MEC A;  3HYF A;  3JYT A;  4DQS A;  3QET A;  1GOA A;  5DMR A;  1S9G A;  3RR7 A;  3DM2 A;  4CEQ A;  3V9X A;  2PZS A;  4RW8 A;  3V1Q A;  3TAF A;  3VQB A;  5HP1 A;  4BAC A;  2F8T A;  2ZD1 A;  1ITG A;  3K59 A;  4FLU A;  4FJ7 A;  4M3W A;  1ZBI A;  4KHU A;  1FXX A;  1BCO A;  1ZBU A;  4O44 A;  3O3H A;  4E7K A;  2HVI A;  4HCC A;  3SUN A;  3KK2 A;  1VSL A;  1JLC A;  3OYH A;  3K5N A;  3SUQ A;  4CGJ A;  2OPR A;  2BE2 A;  2E4L A;  1U04 A;  1NK7 A;  1LWF A;  1JLA A;  4CJU A;  3ZT3 A;  3U3G A;  3I8D A;  1QSY A;  4B9T A;  4B08 A;  4PUO A;  4NYN A;  4DU4 A;  2KZM A;  4BE0 A;  4CFD A;  1EXQ A;  4E7J A;  1RBT A;  3CQ8 A;  4DTM A;  2BAN A;  4ZTF A;  4KRE A;  2ZQB A;  4PA1 A;  3QEX A;  3AO5 A;  3DOK A;  1QSS A;  4KHQ A;  3AVJ A;  4KV8 A;  1NJX A;  2KFZ A;  2AJQ A;  2ZE2 A;  3HPH A;  2E6L A;  1X9W A;  2G8I A;  4I7F A;  1LW2 A;  4KI6 A;  3DLE A;  4N47 A;  3HM9 A;  1CZB A;  3NGZ A;  3IRX A;  3DOL A;  3TAP A;  4F8R A;  3ZT4 A;  3F73 A;  1RCH A;  1RT1 A;  1FK9 A;  2F8S A;  2IDO A;  1W0H A;  1NKB A;  4CGF A;  4LSL A;  3KLF A;  3K2P A;  3HPG A;  2RKI A;  1D5A A;  3SI6 A;  3TAR A;  1CXQ A;  4FLY A;  4GVM A;  1IO2 A;  3AO1 A;  1BCM A;  3L3V A;  3QIN A;  4OPK A;  1A5W A;  3AVG A;  2YV0 X;  3KKR A;  4OKK A;  3NHG A;  5KRS A;  1RT7 A;  3KLE A;  4C8O A;  4CED A;  3T3F A;  3ISN C;  4FM2 A;  4B9S A;  1CLQ A;  4IDK A;  3LPT A;  4QOZ B;  4AHT A;  2OPQ A;  1GOB A;  1IG9 A;  3ZSV A;  3ALY A;  2PYL A;  1K6Y A;  4AHR A;  3QIO A;  1RDD A;  3OJS A;  3L2Q A;  3LWL A;  5HLF A;  1G15 A;  4M3U A;  2HHU A;  4FYD A;  1Z26 A;  3KLI A;  1RT4 A;  3LP0 A;  3LZJ A;  3SV4 A;  3MAQ A;  4RW9 A;  4Q0B A;  4OKE A;  3ZSO A;  3OJU A;  3BDP A;  4HHT A;  3NE6 A;  1RT5 A;  3NFA A;  3V81 A;  4CF8 A;  1C1C A;  3HL8 A;  4ELV A;  4Z0U A;  3QEI A;  3V9U A;  3RR8 A;  4Z4F A;  5J2Q A;  3DLB A;  3OYI A;  4FLT A;  4M3X A;  3HVT A;  1QTM A;  2G8K A;  2F96 A;  2X74 A;  1J5O A;  3KD5 E;  4DFP A;  1BI4 B;  4RG8 A;  3WNE A;  4CCH A;  1N6Q A;  1JXB A;  2O4I A;  2KW4 A;  1B9D A;  4ICL A;  2GUI A;  1ASV A;  3LAL A;  4PY5 A;  1BL3 A;  3B6O A;  1DLO A;  4B9U A;  3U3Y A;  4FJJ A;  1KVB A;  1U45 A;  1VK0 A;  3MXI A;  3A2F A;  1IKW A;  3HJF A;  1VRT A;  4CEZ A;  4CF0 A;  3HVR A;  1L3S A;  1BQM A;  4C8N A;  1TKX A;  2YNG A;  3WNF A;  2XY5 A;  4EP4 A;  4CHY A;  2B5J A;  1TK8 A;  1RDA A;  3SCX A;  4CK1 A;  2YKN A;  3AVN A;  4CEB A;  3OYA A;  4DU3 A;  4DSJ A;  1XHZ A;  3P1G A;  3VQP A;  3RMB A;  1FKP A;  1EP4 A;  4B9L A;  3NF6 A;  4JLH A;  4DS4 A;  1NK8 A;  3T19 A;  4JS4 A;  4HTU A;  3NBP A;  1S6Q A;  4GW6 A;  3OYD A;  3OY9 A;  1UA1 A;  2HVH A;  1IKX A;  1RTH A;  4CIG A;  3AA5 X;  3ZSW A;  4J2A A;  3VQE A;  3VA0 A;  5FRM A;  1X1P A;  3VN5 A;  4DF4 A;  2DFF A;  4W5N A;  4O4G A;  3V1R A;  4OVL A;  4GMJ B;  1KVA A;  3THV A;  1VSJ A;  5CZ2 A;  5J2N A;  5I42 A;  1NK6 A;  1WNS A;  1DTQ A;  4M41 A;  4FM1 A;  3V4I A;  2PY5 A;  3AVA A;  1VSK A;  2D0C A;  4OJR A;  2FBT A;  1C1A A;  4N56 A;  4OLA A;  1WSF A;  3QNN A;  4C8K A;  4DTO A;  1VRU A;  3C6U A;  1KVC A;  3QES A;  3PO4 A;  1Q8I A;  3ZT2 A;  1L3T A;  4LH5 A;  4F2R A;  5CY4 A;  5I3U A;  3ZSY A;  1T8E A;  4AIL C;  2X6S A;  3AO3 A;  4CF1 A;  2ATQ A;  2W42 A;  5HRR A;  3V6D A;  3SQ4 A;  1NK4 A;  1LWE A;  1U4B A;  4QCL A;  4CJL A;  2QKK A;  3DRR A;  3LPU A;  4CER A;  5HRO A;  4Z4H A;  4CHP A;  4FK2 A;  2EX3 A;  2YNF A;  2RPI A;  4RW4 A;  3SUP A;  3PO5 A;  1RBU A;  4KPY A;  1U47 A;  3AA2 A;  1J9A A;  1WLJ A;  2O4G A;  4YFU A;  4M3R A;  3AA3 A;  2Y1J A;  4KHW A;  2QK9 A;  1TKZ A;  4CJ5 A;  2XRI A;  3P83 D;  1KRP A;  1TK0 A;  3O4N A;  3C94 A;  4RW7 A;  4CJF A;  3CG7 A;  3OYJ A;  4FM0 A;  3HP6 A;  1UOC A;  2B6A A;  1RBR A;  4O55 A;  3TR8 A;  4NCA A;  3KK1 A;  3AVM A;  3AVH A;  5KTQ A;  4BE1 A;  1IKY A;  3QEP A;  3QNO A;  3NAE A;  1WSG A;  2VG5 A;  1HJR A;  3CM6 A;  3OYK A;  1JLE A;  1SKS A;  3SYZ A;  4DTN A;  3SJJ A;  4EZ6 A;  3QEW A;  4CES A;  2QKB A;  3CFR A;  4LSN A;  2XY8 A;  1WSE A;  4M3Y A;  3MEG A;  3M8Q A;  4CEF A;  2VWK A;  3G0Z A;  3MXM A;  1S1W A;  4IFY A;  3IAY A;  4DLE A;  4KKO A;  1JLQ A;  4FXD A;  1Y97 A;  1LV5 A;  3TAE A;  4KHS A;  1JKH A;  4DFM A;  4BDY A;  1NKC A;  1REV A;  4B9M A;  4O5B A;  3QIP A;  1SKW A;  2DY4 A;  4DSI A;  4DQQ A;  1EKE A;  3O3F A;  4F4K A;  1Q9Y A;  4CJE A;  3VQ9 A;  2KQ2 A;  1EET A;  4IKF A;  1JXE A;  5FDL A;  3HO1 A;  4C8M A;  3PX0 A;  4OLB A;  4HVJ A;  4CEO A;  1LAV A;  3HST B;  4OPJ A;  4DF8 A;  3SUO A;  3AVF A;  4JRP A;  3DLG A;  3RMA A;  1BIU A;  1D8Y A;  4BDZ A;  1L5U A;  4F2S A;  4DTP A;  2HNY A;  3V9W A;  1RDC A;  4CGH A;  4N41 A;  3AA4 A;  5FRO A;  2A1S A;  3OS1 A;  4E89 A;  2PYJ A;  1FKO A;  4UQG A;  4CEA A;  4BDP A;  4KTW A;  1BIS A;  4CHN A;  1BI4 A;  1QE1 A;  4FJN A;  4CHZ A;  5KGW A;  3RRH A;  4ELU A;  1SKR A;  2OPS A;  2G8V A;  1KFD A;  4I9L A;  1A5V A;  3WNG A;  5SWM A;  3OYM A;  1RNH A;  1ZBH A;  3LP2 A;  4E7H A;  2B4J A;  3O4Q A;  1TK5 A;  1S5J A;  3EYZ A;  4CJW A;  1HYS A;  3CFO A;  4FJX A;  1SL2 A;  3HXM A;  4PQU A;  1VSI A;  1BHL A;  1BQN A;  4AH9 A;  4DFK A;  3DLR A;  1S1X A;  2YHA A;  2IC3 A;  3WNH A;  2OZS A;  4FZY A;  1C0M A;  4NCG A;  2OYQ A;  3AVI A;  2GBZ A;  3PX4 A;  4KI4 A;  3ASM A;  3OYF A;  3D0P A;  4CJT A;  2JLE A;  3PV8 A;  2RN2 A;  4DTS A;  3M8P A;  3U6F A;  1KFS A;  2HMI A;  1B92 A;  2YNI A;  1TV6 A;  1TKT A;  1HQU A;  4Q5V A;  1RT3 A;  4Z4C A;  1XI1 A;  3TAM A;  1ZYQ A;  2BDP A;  3SQ2 A;  3KTQ A;  4EZ9 A;  2D0B A;  3L8B A;  1MU2 A;  1VSM A;  4W5Q A;  2LSN A;  3SPY A;  3M8R A;  4FW2 A;  5CYM A;  1C6V A;  4M42 A;  3HT3 A;  3B6P A;  5JS2 A;  1LW0 A;  3SZ2 A;  1J54 A;  2IGI A;  4CHQ A;  3SNN A;  4FZX C;  5T7B A;  1NK5 A;  4HUF A;  1WAJ A;  4LD0 A;  1YTU A;  3L2V A;  4J2E A;  3QO9 A;  5C24 A;  1QSL A;  5KI6 A;  3PUF A;  2E6M A;  4H4M A;  4E19 A;  3NGI A;  2ITG A;  1TL1 A;  4LH4 A;  2R7Y A;  4B8C A;  1DTT A;  3SQ0 A;  3VQ7 A;  3RWU A;  1U48 A;  2XY7 A;  4DSL A;  4XIU A;  4YNQ A;  5FRN A;  4HUE A;  4CGI A;  2HND A;  3AVK A;  1RIL A;  1VSE A;  3CYM A;  3I0R A;  4MQ3 A;  4E1M A;  3L2R A;  4B9N A;  1TL3 A;  3ZSX A;  4JRQ A;  1HPZ A;  3TAG A;  2G8U A;  4F3O A;  4FJ8 A;  2XHB A;  3VQQ A;  2Z1J A;  4FK4 A;  4KRF A;  2FBV A;  2RF2 A;  3SV3 A;  4DSK A;  1D9D A;  4E0D A;  3I0S A;  5J2P A;  1Z25 A;  1XWL A;  3S3O A;  4FJL A;  4Z4I A;  4KO0 A;  4OGE A;  4J2B A;  3IG1 A;  1QHT A;  3V1O A;  3LDS A;  1TKD A;  1QS4 A;  4FLZ A;  1LAW A;  1TAQ A;  5HBM A;  1N5Y A;  1I39 A;  1RTI A;  4DQI A;  1WAF A;  4W5R A;  4HUG A;  3AVC A;  3LP1 A;  3K5O A;  3TAN A;  1QQC A;  4DSF A;  4IFV A;  4IBN A;  1C1B A;  4C8L A;  2BGG A;  4F3T A;  3OYB A;  4N76 A;  4EP5 A;  2KTQ A;  1HRH A;  2Z1H A;  2G8W A;  4E7I A;  1CXU A;  4TSX A;  4N5S A;  5DK5 A;  3K57 A;  3TAB A;  3RMC A;  4B9V A;  2HW3 A;  2KZZ A;  3C6T A;  4M3Z A;  1I3A A;  3NH1 A;  2WOM A;  4CGG A;  3S9H A;  2P5O A;  4H8K A;  5CYQ A;  4CE9 A;  4CIF A;  1WSJ A;  3MEE A;  2YNH A;  4AHU A;  1UAX A;  4I2Q A;  4CJV A;  3K5M A;  1VSF A;  2A1R A;  1IKV A;  2G8H A;  2P5G A;  1NOY A;  3NH2 A;  1GOC A;  1C0U A;  1KSP A;  2IS3 A;  1WSH A;  4AHS A;  2Z1G A;  5HRP A;  3LZI A;  4E3S A;  4ELT A;  4PWD A;  1YT3 A;  3OYL A;  1NJY A;  1X9M A;  3AV9 A;  3KKS A;  3LP3 A;  3RMD A;  3DLK A;  1NK0 A;  4Z4G A;  3QLH A;  4HCB A;  3VQ8 A;  1L3V A;  1YVU A;  5EU7 A;  4CJ3 A;  3EZ5 A;  5J2M A;  4AHC A;  1L3U A;  4DG1 A;  3VQ5 A;  1RBS A; 
#chains in the Genus database with same CATH topology
 5EXW A;  3VF2 A;  4CFC A;  3CPE A;  5BPN A;  3H45 C;  1NJW A;  2OZM A;  4ID1 A;  1EX4 A;  5AZJ B;  1KAY A;  3ZT1 A;  3A0I X;  2HHW A;  1HYV A;  4DTR A;  4CK2 A;  3HOS A;  1QQO A;  4JI5 K;  3L4Q A;  3DRS A;  3S41 A;  4NO7 A;  4R79 A;  3ULD A;  1S22 A;  2YHB A;  3T1A A;  2JGU A;  1HMV A;  4DV7 K;  4DS5 A;  4DV3 K;  2HHX A;  4FJK A;  4RWT A;  3JSM A;  2X6N A;  2DFH A;  3C7N B;  1JCE A;  3NVK A;  3P39 A;  2IAJ A;  3THX B;  1NGA A;  4L3Q A;  4B8A B;  5FLX O;  4NXN K;  3DRP A;  3RTV A;  3CCU N;  2YI1 A;  4W5O A;  3I55 N;  1JLB A;  4JKE A;  4CBW A;  3VF4 A;  4LF4 K;  1T7P A;  4GVE A;  4AM6 A;  3OYN A;  2FLO A;  2VWB A;  3E01 A;  3EZW A;  4JS5 A;  4B3T K;  2I5J A;  5M1K A;  2X78 A;  1HQE A;  3V9Z A;  3E9O A;  1TVR A;  2O8E B;  4BR7 A;  4BRE A;  5C25 A;  4X66 K;  1X9S A;  1NK9 A;  4H5T A;  3FE1 A;  1M1K O;  3BF1 A;  3BEX A;  4JK7 A;  3C65 A;  3ZLJ A;  4B1W B;  4CK3 A;  4B3M K;  4J8F A;  1SL1 A;  5AZI A;  4JNE A;  3AY9 A;  1ZBF A;  1SAZ A;  3MCA B;  3S3N A;  4FOE A;  4WQ4 A;  3LDL A;  2KLA A;  3O9R A;  4YHH K;  4DFJ A;  2GWJ A;  4IO8 A;  2IVP A;  3CI5 A;  4GY2 B;  3V9S A;  2QI2 A;  5HRS A;  5KGX A;  3D2F A;  3ZCM A;  2QWR A;  3EKU A;  3F5T A;  4H03 B;  3N4Q A;  4FJG A;  3MXJ A;  4QAG A;  3H3O B;  2VGN A;  5M1N A;  1ASU A;  1GLF O;  4DR5 K;  1IH7 A;  5FPD A;  4YDU A;  4BY9 C;  4KHY A;  1YIT N;  3G10 A;  4Y0W A;  4DWI A;  1A5X A;  4IG3 A;  3HK2 A;  5EVZ A;  4DUY K;  4FPB A;  4OGC A;  3R1X A;  3NH0 A;  4IO9 L;  4A62 A;  4IG0 A;  2YCH A;  1UA0 A;  3BGR A;  3HOT A;  3MEC A;  3HYF A;  4WQ5 A;  1IBK K;  3IKM A;  2PZS A;  2CH5 A;  5C10 A;  3V1Q A;  3CCV N;  3TAF A;  3VQB A;  2WTU A;  3LDP A;  4O5F A;  5AZJ A;  3K59 A;  3FZH A;  4C1N K;  4M3W A;  3O3H A;  1IBL K;  2NRR A;  4HCC A;  5LMU K;  1YIJ N;  1GLE G;  3MMV A;  1U04 A;  3MDQ A;  1LWF A;  1JLA A;  4IWV A;  3A5N C;  3U3G A;  1QSY A;  4B08 A;  4BE0 A;  1EXQ A;  1XMO K;  1ESV A;  5BR9 A;  4PA1 A;  4H5R A;  4DR7 K;  3AO5 A;  1QSS A;  1NJX A;  4KV8 A;  3C7N A;  4I7F A;  5C12 A;  4N47 A;  3HM9 A;  1CZB A;  3UE5 A;  5AQN A;  3DOL A;  3TAP A;  3F73 A;  1RCH A;  1RT1 A;  1FK9 A;  2IDO A;  1G99 A;  2V51 B;  3GG4 A;  2CH6 A;  3K2P A;  5LJW A;  5LL6 Z;  3HPG A;  2YX6 A;  3AO1 A;  1BCM A;  3L3V A;  4IOC L;  3AVG A;  4ILG B;  2FF3 B;  1FW6 A;  4CED A;  3T3F A;  1N33 K;  4FM2 A;  1QVG M;  3LPT A;  4AHT A;  2OPQ A;  3ALY A;  4AHR A;  5HLF A;  1TUY A;  5JLH A;  4BRC A;  5ADX H;  4V19 S;  2HHU A;  3ZET B;  3LZJ A;  3MAQ A;  3N4P A;  3ZSO A;  3BDP A;  3ENH A;  3NE6 A;  5JMV A;  4WYB A;  3TU5 A;  4GNI A;  4Z0U A;  4BG8 A;  5J2Q A;  2ZWH A;  1BDG A;  1XMQ K;  3CC7 N;  2G8K A;  3WNE A;  3EN9 A;  1RGI A;  2O4I A;  1B9D A;  4BGA A;  1NWK A;  1W2B M;  2QWN A;  3U3Y A;  4A59 A;  2O8B B;  3MX2 A;  4FJJ A;  3ID6 A;  5AQJ A;  5A2Q O;  1VK0 A;  3T1Y K;  3WXL A;  2ZGZ A;  2XY5 A;  2YNG A;  3SCX A;  2HST A;  4DSJ A;  3NF6 A;  3QIC A;  4DS4 A;  1BG3 A;  4B9Q A;  3NBP A;  4PKG A;  4DB3 A;  3AA5 X;  3UKR B;  3VF6 A;  3OHR A;  4O4G A;  1KVA A;  3THV A;  5I42 A;  4FOI A;  4XH1 A;  1WNS A;  4GV3 A;  5F2R A;  2ZJQ L;  1HNW K;  3AVA A;  3QFU A;  4YDU C;  3R9P A;  4C8K A;  1KVC A;  1W7A A;  1Q8I A;  3ZT2 A;  5I3U A;  4CF1 A;  3FZK A;  4KH6 A;  5HRR A;  1LWE A;  3UKU B;  4CJL A;  2Q0U A;  4CER A;  4FK2 A;  3L0Q A;  4YOV A;  4KBO A;  4CZL A;  1U47 A;  3FR0 A;  3VET A;  2QK9 A;  2Y1J A;  1N32 K;  1Q82 O;  3O4N A;  3J81 O;  3I8B A;  1DEJ A;  4DR1 K;  3CCQ N;  3HP6 A;  2WBN A;  2B6A A;  1RBR A;  4O55 A;  2D0P A;  4NXM K;  3AVM A;  3QEP A;  1KC8 O;  1HJR A;  1P90 A;  3SJJ A;  2HBL A;  3WXK A;  2VQF K;  3K9K A;  2QKB A;  4LSN A;  2XY8 A;  4M3Y A;  4FWS A;  3M8Q A;  4CZG A;  1SZ2 A;  4DR3 K;  1LV5 A;  1E4G T;  2EWS A;  1RDU A;  4XH5 A;  4DFM A;  1GLC G;  3TAE A;  5KPT A;  1DT9 A;  3O3F A;  4AF1 A;  4WCE L;  5BRH A;  1Q9Y A;  1EET A;  3JS6 A;  1JXE A;  4LF9 K;  4C8M A;  1LAV A;  3HST B;  3DLG A;  3RMA A;  5GAD P;  3TPQ A;  3C6A A;  2HNY A;  3WT0 A;  3O08 A;  3OS1 A;  4E89 A;  3TSU A;  4UQG A;  3FZL A;  4KTW A;  3MCP A;  5KGW A;  3RRH A;  3J8A A;  4MLH A;  3E1Y A;  3WNG A;  4KH4 A;  5SWM A;  1RNH A;  1ZBH A;  4H0V B;  4E7H A;  2O8B A;  4EHT A;  1TK5 A;  4PQU A;  1BHL A;  4DFK A;  1S1X A;  2IC3 A;  2OZS A;  4FZY A;  1IG8 A;  3AVI A;  3PX4 A;  3OYF A;  2P9U A;  3M8P A;  1KFS A;  1GLL O;  1B92 A;  4WFA L;  3K0S A;  2YNI A;  1TV6 A;  1VAZ A;  4BR2 A;  1ZYQ A;  3SQ2 A;  2D0B A;  3MWP A;  1VSM A;  3M8R A;  3JXU A;  5CYM A;  3ULE B;  1C6V A;  3SNN A;  2IGI A;  2E2P A;  5T7B A;  4OX9 K;  4LD0 A;  1YTU A;  4BRO A;  1OVY A;  5KI6 A;  2E6M A;  4BRN A;  5EY4 A;  2ITG A;  2R7Y A;  4B8C A;  3SQ0 A;  3VQ7 A;  2NNW A;  4DSL A;  4IZ9 A;  4HUE A;  3I0R A;  1HPZ A;  2BTF A;  3TAG A;  4FJ8 A;  4JI0 K;  2Z1J A;  4FK4 A;  1HPM A;  4KRF A;  4IFE A;  1D9D A;  2Q2R A;  3WQU A;  4KO0 A;  1QZ5 A;  1QHT A;  1TKD A;  2Q1N A;  1GLB G;  1LAW A;  3UKU A;  4JKD A;  1WAF A;  4XH4 A;  2HBM A;  2YHX A;  1QQC A;  2ZM6 K;  3CXC M;  4EIA A;  4IEI A;  3QML A;  1TYQ B;  1HKC A;  4IBN A;  3FLC O;  3VTH A;  4K25 A;  5EOY A;  3K57 A;  3RMC A;  5AFU A;  3ZEU A;  2P5O A;  2E8A A;  1XNQ K;  4DQ8 A;  3CJA A;  3KZB A;  1IJJ A;  2P5G A;  1GOC A;  4AHS A;  4ELT A;  4YOY A;  1HJO A;  3DWL A;  4CBU A;  2ZJR L;  1X9M A;  4LF7 K;  3KKS A;  3LP3 A;  2QWQ A;  4CJ3 A;  3EZ5 A;  3TSP A;  4AHC A;  2Q36 A;  3DXK B;  3D2E A;  1E3M A;  4M45 A;  4DV1 K;  2PBD A;  2D5R A;  3G71 N;  2KFN A;  2WON A;  4CGD A;  3OW2 M;  2GV9 A;  3H08 A;  5FPE A;  3LAN A;  1HNZ K;  3NCI A;  2HHH K;  1KLN A;  4I9Q A;  1VSH A;  1BIZ A;  3CHW A;  1BOT O;  4CJQ A;  1O13 A;  1LWC A;  2Z1I A;  4NCB A;  1ATS A;  3S3M A;  1NOZ A;  3U8X A;  4DUZ K;  3E9P A;  3SPZ A;  4FO0 A;  3NDK A;  4FW1 A;  3SAH A;  3DLH A;  4KB1 A;  3Q7C A;  4NYF A;  3IUC A;  1SUQ A;  3VA3 A;  4NLC A;  4E1N A;  1BGX T;  2UUC K;  3OYG A;  3ZSR A;  3KLH A;  1RT2 A;  3E66 A;  5AQU A;  1T03 A;  4CJS A;  3OYE A;  2P1J A;  4WE1 A;  3TTC A;  4DV0 K;  3OVN A;  2OA8 A;  4OPH A;  3RRG A;  4YOU A;  1T44 A;  3WXI A;  5AQV A;  1NGF A;  4B1Y B;  3CFP A;  4DSE A;  1S6P A;  5GAH P;  3ULE A;  1S1U A;  2I7N A;  3THY A;  1EQY A;  1JLG A;  2P51 A;  3LAK A;  1WUA A;  4AHV A;  3O1W A;  3O9Q A;  3VQ6 A;  3LWM A;  1VSD A;  4ZHR A;  1T05 A;  3ZSZ A;  1T6C A;  4CJR A;  5AQK A;  4B3O A;  4CFA A;  1IBM K;  3AO4 A;  4KHP K;  2ETJ A;  3CET A;  4CIE A;  1W9H A;  4IXC A;  4DTJ A;  4BRP A;  4X64 K;  3ZSQ A;  1Z05 A;  2P9P B;  3NF9 A;  3A5O C;  3QER A;  2HHV A;  4ISE A;  1S1V A;  4LF5 K;  4OKJ A;  4CJK A;  4RCH A;  3L2W A;  4DV6 K;  1RTD A;  1JJ2 M;  1TYQ A;  2OPP A;  4ILJ A;  3T1H K;  4G9Z A;  3QDK A;  4GKK K;  1SV5 A;  4DTU A;  1U6Z A;  1WN7 A;  1XUP O;  3D45 A;  4E7L A;  4FL9 A;  3CM5 A;  1BU6 O;  5E41 A;  3O9T A;  3QB0 A;  2NUB A;  1HR0 K;  1JLF A;  1SS6 A;  4G1Q A;  2V7Z A;  1B9F A;  4JKA A;  1C0T A;  4KHN A;  3DYA A;  4FJI A;  2DTU A;  3NGY A;  3GE1 A;  1H1V A;  4FWO A;  4KH5 A;  3JYT A;  2QW9 A;  5AQL A;  3QET A;  4PHT X;  3DXK A;  2QXL A;  4BC4 A;  5KPZ A;  3GBT A;  4BAC A;  2ZD1 A;  1ITG A;  1ZBI A;  3VES A;  4KHU A;  1FXX A;  1BCO A;  1ZBU A;  2HVI A;  2ZGY A;  3SUQ A;  2OPR A;  2BE2 A;  5BN8 A;  4JD2 B;  1NK7 A;  4CJU A;  3LL3 A;  3I8D A;  4DU4 A;  2KZM A;  3Q7B A;  1RBT A;  3IFR A;  3CQ8 A;  2BAN A;  4ZTF A;  1OH5 A;  3OTO K;  2DPN A;  3T7Z A;  3HPH A;  3H3N O;  3DLE A;  3M5R A;  1DGK N;  4JKG B;  3NGZ A;  4F8R A;  3ZT4 A;  4CZI A;  3J7Z O;  1W0H A;  4WF9 L;  3EKS A;  4FWR A;  3KLF A;  3SI6 A;  4GVM A;  2AA4 A;  2E2N A;  1A5W A;  3NHG A;  5KRS A;  3ATU A;  2W41 A;  3LDQ A;  1T6D A;  3DAW A;  4JN4 A;  1JCF A;  2PYL A;  3QIO A;  1RDD A;  3L2Q A;  4YOX A;  1G15 A;  3KK7 A;  3MX5 A;  1Q7Y O;  4M3U A;  1Z26 A;  3KLI A;  4DHY A;  3LP0 A;  3DXM B;  4RW9 A;  3PIP L;  3MN6 A;  2UYT A;  3KHY A;  3NFA A;  1TUU A;  3ZX2 A;  3V81 A;  3HL8 A;  4ELV A;  4Z4F A;  3V9U A;  1K9M O;  3RR8 A;  2W40 A;  3CCR N;  2NRT A;  3HVT A;  2X74 A;  4K42 A;  1BI4 B;  4RG8 A;  4DFP A;  2GUI A;  2P9P A;  2NZT A;  3LAL A;  3KVG A;  1BL3 A;  2A42 A;  1YXQ A;  1IKW A;  3HJF A;  1VRT A;  3HVR A;  4CF0 A;  1L3S A;  4C8N A;  5LJV A;  3WNF A;  3P38 A;  1RDA A;  3G6E N;  4CK1 A;  2YKN A;  3AVN A;  2WUS A;  4CEB A;  3OYA A;  2AP1 A;  2F4V K;  5GIN A;  2O8F B;  3VQP A;  3H1V X;  1FKP A;  3GDQ A;  1EP4 A;  1K8K A;  3CJC A;  4A61 A;  1HKG A;  1S6Q A;  3OYD A;  1UA1 A;  3OY9 A;  2HVH A;  1IKX A;  4CIG A;  3ZSW A;  3VQE A;  5FRM A;  1X1P A;  3VN5 A;  4W5N A;  4OVL A;  4GMJ B;  4EFH A;  4LF8 K;  3O5B A;  1QZ6 A;  5M1Q A;  2QA4 N;  4A2B A;  5KQ8 A;  4N56 A;  5AQG A;  5M1P A;  3VGL A;  1NMN A;  4F2R A;  2H3G X;  4AIL C;  2X6S A;  2O8C A;  1WOQ A;  4JD2 A;  3SQ4 A;  2V7Y A;  4QCL A;  3NVM A;  5AQT A;  3DRR A;  2YNF A;  4H0P A;  4O8K A;  3JAM O;  1VQ5 N;  3EEQ A;  3PO5 A;  3AA2 A;  1WLJ A;  4YFU A;  3AA3 A;  1YJN N;  2HOE A;  2XRI A;  4QS9 A;  4JKG A;  2HMP A;  1UOC A;  3WUH A;  3NAE A;  1V4S A;  3OYK A;  1JLE A;  4DTN A;  4JI2 K;  3THX A;  3CFR A;  4BC2 A;  3W0L A;  4CEF A;  2Q97 A;  3MXM A;  1S1W A;  4K43 A;  4LFB K;  4FXD A;  1Y97 A;  2BH1 A;  4KHS A;  1NKC A;  1SKW A;  2F9W A;  4F4K A;  3VQ9 A;  2KQ2 A;  4IDH A;  5FDL A;  3J80 O;  4JHD B;  3ZX0 A;  4HVJ A;  4DF8 A;  2O8E A;  4BDZ A;  1NU0 A;  5AQW A;  4F2S A;  4DTP A;  1RFQ A;  1RDC A;  1X3M A;  3O80 A;  4HTL A;  3FZM A;  4FWP A;  4BRQ A;  5M1F A;  4CEA A;  1BI4 A;  4ELU A;  1KAX A;  1SKR A;  3EL2 A;  3CJ9 A;  1KFD A;  4I9L A;  1A5V A;  4BQZ A;  3OYM A;  3LP2 A;  2B4J A;  3O4Q A;  1S5J A;  3EYZ A;  4CJW A;  3CFO A;  1SL2 A;  4DKW A;  1VQK N;  4AQY K;  1NLV A;  3WNH A;  2GBZ A;  3ASM A;  3R8E A;  4JV5 K;  2O8F A;  4MDA A;  5BPL A;  2HMI A;  1I94 K;  1TKT A;  3HSC A;  4Q5V A;  3VGM A;  2BDP A;  3TAM A;  4EZ9 A;  4W5Q A;  5ADX A;  5AQM A;  3CF5 L;  4FZX C;  4DCH A;  4E19 A;  1TL1 A;  1KXP A;  1U48 A;  4GKJ K;  4YNQ A;  1VQ9 N;  4B1V A;  2HND A;  3AVK A;  1RIL A;  4B9N A;  4MQ3 A;  3L2R A;  4EAH D;  4YOT A;  4CJ7 A;  5TKW A;  5GAG P;  1J6Z A;  2G8U A;  1NJI O;  1OH6 A;  3VQQ A;  5DM6 L;  2FBV A;  3CME N;  4OGE A;  4J2B A;  3V1O A;  3LDS A;  4FLZ A;  1WBB A;  1RTI A;  4DQI A;  4W5R A;  3TAN A;  4DSF A;  5AQR A;  4FSV A;  2BGG A;  1C1B A;  4F3T A;  3OYB A;  4X65 K;  4M7X A;  1HRH A;  3TSQ A;  1D4X A;  5DK5 A;  1S3X A;  5HOO A;  3VER A;  2VGM A;  4CE9 A;  1WSJ A;  4H0O A;  4AHU A;  4MDB A;  1UAX A;  4CJV A;  4LFA K;  3VOV A;  1VSF A;  2G8H A;  5GIO A;  3NH2 A;  2ITM A;  5HRP A;  4E3S A;  3LZI A;  5CR4 A;  1YJ9 N;  1YT3 A;  3OYL A;  2UU9 K;  3P4I A;  1L3V A;  1YVU A;  2QWO A;  3AGK A;  1J5E K;  3VQ5 A;  1C0G A;  2Q0R A;  5AQO A;  4KFB A;  4FVM A;  4FJ9 A;  1RBV A;  5CZ1 A;  3L2U A;  2KTQ A;  1YTA A;  3BF3 A;  4Y1C A;  4FZZ A;  4QS8 A;  2IIR A;  2HHT A;  2QWP A;  4GV6 A;  3W3D A;  3SBT A;  5C42 A;  1KLM A;  2HNZ A;  3ZET A;  4BE2 A;  3KIO A;  5JS1 A;  5GIP A;  1XHX A;  3WEE B;  1S1T A;  3HPO A;  3KK3 A;  3MN7 A;  1Q9X A;  3DMJ A;  3CCL N;  2YKM A;  1KCF A;  2JWK A;  1ILY A;  3MK6 A;  4BC5 A;  2CGJ A;  2OAN A;  4Z94 A;  4ZTJ A;  2FBX A;  4A5B A;  2XO7 A;  1TAU A;  3VQC A;  4FWM A;  4K8Z A;  4BQL A;  2NRZ A;  2W6K A;  5AQF A;  3ZT0 A;  3E9L A;  3MED A;  3TTD A;  2VWJ A;  4O0J A;  1U49 A;  3OYC A;  2GEM A;  2PFU A;  4WFB L;  4FK0 A;  3M3Z A;  1EO1 A;  2FC0 A;  1JL1 A;  3BY5 A;  3EO3 A;  1NG9 A;  5AR0 A;  3AAQ A;  3LAM A;  3DI6 A;  3RVC A;  4J2D A;  4CF9 A;  3UKR A;  1JL2 A;  1RTJ A;  3OS0 A;  5AQS A;  3AVL A;  4W5T A;  4JKC A;  4R5P A;  1TGO A;  1NJZ A;  2HHQ A;  4I2P A;  1M90 O;  1NKE A;  3TI0 A;  3PX6 A;  4A57 A;  4FLV A;  1HNV A;  2Y1I A;  1YJW N;  2FSJ A;  3KJV A;  4FJ5 A;  4PKI A;  4H0T B;  3M1F A;  1KTQ A;  2YHY A;  3P5J A;  3SQ1 A;  3BUZ B;  2D4W A;  3VQ4 A;  3RSE B;  4NB4 A;  3OS2 A;  4BRG A;  3M8S A;  3AVB A;  4MFB A;  3G4S N;  3IDH A;  2IVO A;  3O6W A;  5KRT A;  2Q3S A;  5BN9 A;  4BWM A;  1OH8 A;  2E5L K;  4FJH A;  3B8A X;  3O8M A;  1WBD A;  4L8R B;  4CZM A;  3O9U A;  3RR7 A;  3DM2 A;  3V9X A;  2VQE K;  2F8T A;  4FLU A;  4O44 A;  4E7K A;  3MWT A;  3KK2 A;  1JLC A;  3OYH A;  4H0Y B;  4CGJ A;  3DLL L;  1NGJ A;  4H5V A;  5BPM A;  4PUO A;  4NYN A;  4C23 A;  4M63 C;  4E7J A;  1KAZ A;  1VQ7 N;  2ZQB A;  1QQN A;  3QEX A;  2CGK A;  2E2Q A;  3DOK A;  4KHQ A;  3WEE A;  2E6L A;  1X9W A;  2G8I A;  1W97 L;  1NKB A;  4FVU A;  1U2V B;  1CXQ A;  5C2F A;  4OPK A;  3KLE A;  1RT7 A;  1BA0 A;  4CW7 B;  4BRA A;  1T3V A;  2YJF A;  2V52 B;  3SK3 A;  4B9S A;  1CLQ A;  4IDK A;  2RHK A;  3CD6 N;  4QOZ B;  3CQY A;  3ENB A;  2GWK A;  5EX5 A;  3ZSV A;  1SQK A;  1K6Y A;  3THW B;  5F1X A;  3M6G A;  4UY8 O;  3SJH A;  4FYD A;  1Q86 O;  3SV4 A;  4Q0B A;  1NBW A;  4OKE A;  3OJU A;  5H1S Q;  1QVF M;  3OYI A;  4JAX A;  3KD5 E;  4CCH A;  2GTD A;  4CZE A;  2JWL A;  1JXB A;  2KW4 A;  4ICL A;  5BR8 K;  1ASV A;  3B6O A;  4B9U A;  1U45 A;  1ATR A;  3MXI A;  3ATV A;  3A2F A;  1BQM A;  1LOT B;  3LM2 A;  4EP4 A;  4CHY A;  2QWL A;  1TK8 A;  2GX9 A;  1JCG A;  3P1G A;  3RMB A;  1YF5 L;  4JLH A;  3RSE A;  1NK8 A;  3T19 A;  4CI6 A;  4IOA L;  3H6E A;  1BUP A;  4FWK A;  3EE9 A;  4FPA A;  3BZK A;  1VSJ A;  5CZ2 A;  5J2N A;  2P9K B;  3VEZ A;  4BRK A;  3V4I A;  4FM1 A;  3GL1 A;  2PY5 A;  5AZI B;  2D0C A;  2FBT A;  1C1A A;  1HNX K;  5I9E B;  2WC9 A;  4OLA A;  3QNN A;  1E4F T;  4DTO A;  3C6U A;  2NRX A;  3CJ1 A;  5AQZ A;  1L3T A;  1FJG K;  2KKZ A;  3ZSY A;  1T8E A;  3V6D A;  3VTI A;  2ATQ A;  1NK4 A;  2BUP A;  2D1K A;  5HRO A;  4JK9 A;  4CHP A;  4Z4H A;  2EX3 A;  4RW4 A;  5MLC Q;  5AQX A;  4I6M B;  2QWM A;  2FF6 A;  4BG9 A;  2Q31 A;  2OCE A;  3CPW M;  3CCM N;  1TK0 A;  2E20 A;  2FSK A;  3C94 A;  4H5W A;  4NCA A;  3KK1 A;  1U2V A;  3C6H A;  1IKY A;  4BE1 A;  3QNO A;  1WSG A;  1LCU A;  2VG5 A;  3CM6 A;  2D0O A;  3D6R A;  3VGK A;  3K9J A;  1WSE A;  4QS7 A;  2VWK A;  3ID8 A;  4OPA A;  1VQP N;  2UXD K;  2P9I B;  4IFY A;  4BRD A;  3IAY A;  4DLE A;  3CCE N;  2ASP A;  1QHA A;  3R3L A;  1JKH A;  3CMA N;  4BDY A;  5AJ3 K;  4O5B A;  3QIP A;  2O8D B;  3THW A;  4DQQ A;  1EKE A;  1VQN N;  3G25 A;  1EWR A;  4IKF A;  3HO1 A;  2UUB K;  4BR0 A;  3PX0 A;  4OLB A;  4CEO A;  3ENO A;  4JEP A;  3AVF A;  2QEX N;  1L5U A;  4JI7 K;  3V9W A;  1BWF O;  2A1S A;  4MO5 A;  2PYJ A;  4LFC K;  5JLF A;  4BDP A;  1BIS A;  4JKH A;  4CHN A;  1QE1 A;  4FJN A;  3WQT A;  2OPS A;  2G8V A;  1YAG A;  4FWN A;  4DV2 K;  2NLX A;  2ASM A;  3SAG A;  1HYS A;  4FJX A;  3HXM A;  2HBK A;  1VSI A;  1BQN A;  4AH9 A;  5JVG L;  2OYQ A;  4KI4 A;  1VQ6 N;  2JLE A;  2RN2 A;  4B1X B;  2FXU A;  5LMN K;  1RT3 A;  3TTF A;  4Z4C A;  4IOX A;  3KTQ A;  3L8B A;  1HUX A;  1GLA G;  2LSN A;  4B3S K;  4ILH A;  1Z6R A;  4MO4 A;  3HT3 A;  5AQY A;  5JS2 A;  4M42 A;  1NK5 A;  3FZF A;  1KD1 O;  3L6Q A;  3L2V A;  4J2E A;  5C24 A;  4BR5 A;  2P9K A;  3PUF A;  4H4M A;  3NGI A;  2XY7 A;  3WXM B;  4JYA K;  3QFP A;  3F9M A;  4E1M A;  2J4R A;  2NRW A;  3AAP A;  3P31 A;  2XHB A;  4B1Z A;  1K73 O;  4DSK A;  4E0D A;  1MWK A;  3I0S A;  3LDN A;  1Z25 A;  3QBX A;  4BGB A;  4GV9 A;  4FJL A;  1TAQ A;  3CJB A;  1I39 A;  4HUG A;  3C0B A;  5IT9 O;  1QQM A;  5AQH A;  1VQ4 N;  3KWI A;  3WXJ A;  5TKY A;  4I6M A;  3OBW A;  3SLC A;  4DR4 K;  4E7I A;  4TSX A;  4B9V A;  3H46 O;  4N5S A;  2HW3 A;  4BRL A;  2KZZ A;  3C6T A;  1I3A A;  3A5L C;  2WOM A;  4H8K A;  5CYQ A;  1OH7 A;  2YNH A;  3VEV A;  1Q81 O;  1VQM N;  3K5M A;  1IKV A;  1NOY A;  4AM7 A;  1C0U A;  1KSP A;  4B1U B;  4PWD A;  1NJY A;  1NGI A;  1VQL N;  3LDO A;  4Z4G A;  3QLH A;  2ZF5 O;  3VQ8 A;  4HCB A;  3U9Z A;  5IWA K;  4H0X B;  5J2M A;  4DG1 A;  3L4I A;  2P9I A;  2P9L B;  4IJA A;  3O9S A;  4PL8 A;  4A5A A;  3TWH A;  1ATN A;  5B8H A;  3L3U A;  1NGH A;  2O8D A;  1ZBL A;  1ASW A;  4RW6 A;  4DR6 K;  1HNI A;  3O1B A;  4ISG A;  3FFI A;  3OA9 A;  3VQD A;  3VEY A;  4FLX A;  1EWQ A;  1XC9 A;  2QXF A;  4BVO A;  4Z4E A;  2E88 A;  2HHS A;  4CD1 A;  2IOC A;  3KD1 E;  3IS9 A;  1F21 A;  4M3T A;  4CZJ A;  4CJP A;  3DXM A;  5HRN A;  4DLG A;  3TAQ A;  4FWQ A;  5FPM A;  2HB5 A;  1R0A A;  1HYZ A;  4JI1 K;  1D9F A;  4JI4 K;  5JIC A;  2QTD A;  4FCY A;  1WSI A;  4DU1 A;  2YJE A;  2HF4 A;  2D0A A;  1UWB A;  1ZXO A;  4FLW A;  1NGG A;  1V4T A;  4BR9 A;  4DQR A;  4DTX A;  3K5L A;  2NRH A;  4CHO A;  1RDB A;  3PY8 A;  4Y1D A;  4KTZ A;  5J1E A;  3CCJ N;  4WFN L;  4O0I A;  5JVH L;  4DQP A;  2E1Z A;  3O3G A;  4CEE A;  2FBY A;  3PSI A;  2F7T A;  4CFB A;  1N36 K;  4LY7 A;  5C15 A;  1NGB A;  1OKJ A;  4ID5 A;  2VG6 A;  4DR2 K;  4CJ4 A;  2EHG A;  3VQA A;  3GOI A;  1P8Z A;  1X3N A;  3A5M C;  3ITH A;  4KTQ A;  3HP9 A;  5SZT A;  2XY6 A;  1DKG D;  5D3G A;  1VHX A;  2W6L A;  4BWJ A;  5CHI A;  4B3R K;  4LF6 K;  3EY1 A;  1SL0 A;  4DMN A;  4DV5 K;  3QEV A;  1J53 A;  3UIQ A;  3CC4 N;  2P9U B;  1HX1 A;  5K14 A;  1CZ9 A;  1RT6 A;  4BC3 A;  4CEC A;  2HBJ A;  5AQQ A;  3K58 A;  4FJM A;  3IMX A;  4K8X A;  4FWL A;  2A40 A;  4WQ4 C;  5F0X A;  1NNE A;  3LM9 A;  4BRM A;  4KB0 A;  3A8Y A;  4U67 L;  3F9K A;  1O1W A;  1N34 K;  5E26 A;  1HKB A;  5M1O A;  2VG7 A;  3EE8 A;  1S9E A;  3MN9 A;  3KLG A;  4KAZ A;  3AO2 A;  4H4O A;  3VPZ A;  4XEI A;  3C95 A;  3NF8 A;  3U4L A;  3VMF B;  4CF2 A;  4YOW A;  3KWG A;  4LC9 B;  3NF7 A;  2G8F A;  2DFE A;  4DQS A;  3U9D A;  1GOA A;  4RTF D;  2P9L A;  4K41 A;  5DMR A;  1S9G A;  4CEQ A;  2CGL A;  4RW8 A;  3VEX A;  1CZA N;  2VCP A;  5HP1 A;  4FJ7 A;  4CZH A;  5DM7 L;  4WQ5 C;  3SUN A;  1VSL A;  3K5N A;  2E4L A;  1XC3 A;  3CQX A;  3ZT3 A;  4B9T A;  5C0Y A;  4JHD A;  3ZEU B;  2P9S B;  4CFD A;  4DTM A;  4HWI A;  4KRE A;  4IJN A;  4JKB A;  3FFK B;  3AVJ A;  2KFZ A;  2AJQ A;  2ZE2 A;  1LW2 A;  4KI6 A;  3IRX A;  1C0F A;  3FGU A;  2F8S A;  2UUA K;  4CGF A;  4LSL A;  2RKI A;  1D5A A;  3TAR A;  3D2E B;  4FLY A;  1IO2 A;  3QIN A;  3SBG A;  2YV0 X;  3KKR A;  4OKK A;  1NGC A;  4C8O A;  2OTJ N;  4BRH A;  5ELZ A;  3ISN C;  4E1J A;  1GOB A;  1IG9 A;  3HI0 A;  3OJS A;  3LWL A;  1RT4 A;  5C2D A;  4HHT A;  3PSF A;  1RT5 A;  1YUW A;  1MWM A;  1X9J A;  4CF8 A;  1C1C A;  1ZBS A;  4IEE A;  3QEI A;  3DLB A;  4FLT A;  4M3X A;  2ASO A;  1QTM A;  2F96 A;  1J5O A;  3CER A;  1N6Q A;  3OBY A;  5AQI A;  4BVP A;  2OTL N;  4PY5 A;  4CBX A;  3AAR A;  1DLO A;  3I33 A;  4JI8 K;  2A6A A;  1KVB A;  1YVN A;  1NMD A;  4U7B A;  4ISF A;  4CEZ A;  3J7A P;  2IVN A;  1TKX A;  2B5J A;  4DU3 A;  1HLU A;  1XHZ A;  2GEL A;  1XNR K;  1NGD A;  4B9L A;  3THY B;  4JS4 A;  3PLA A;  4HTU A;  3VEN A;  4GW6 A;  2GUP A;  4EHU A;  5AFU H;  1RTH A;  3CCS N;  4J2A A;  3VA0 A;  4DF4 A;  2DFF A;  3PIO L;  2P9N B;  3V1R A;  1NK6 A;  3MN5 A;  3BP8 A;  3VEW A;  1DTQ A;  4M41 A;  1Q18 A;  4JK8 A;  4CZK A;  2RE2 A;  1VSK A;  3R6M A;  4OJR A;  5AQP A;  4OO1 J;  4YOR A;  2UXC K;  1WSF A;  1VRU A;  3QES A;  3PO4 A;  1NGE A;  1VQO N;  4LH5 A;  5LY3 A;  5CY4 A;  3AO3 A;  2W42 A;  2PAV A;  1U4B A;  4A2A A;  2QKK A;  4O8U A;  3LPU A;  3HZ6 A;  1BO5 O;  2RPI A;  3CC2 N;  2P9S A;  3SUP A;  4F9O A;  1RBU A;  1OVQ A;  4CZF A;  5BRD A;  4KPY A;  1J9A A;  2O4G A;  4M3R A;  3I56 N;  4KHW A;  1TKZ A;  2VYP A;  1GLD G;  4CJ5 A;  1S72 N;  4CVN E;  3P83 D;  1KRP A;  4C1N I;  4RW7 A;  4CJF A;  3OYJ A;  3CG7 A;  4FM0 A;  3BZC A;  3AGR A;  1Y64 A;  3TR8 A;  3AVH A;  5KTQ A;  1SKS A;  3HRG A;  4BRI A;  3SYZ A;  4EZ6 A;  3QEW A;  4CES A;  3QBW A;  5BRE A;  1MA9 B;  2WFB A;  3MEG A;  5GAE P;  3G0Z A;  2O8C B;  4KKO A;  1JLQ A;  4B9M A;  1REV A;  2DY4 A;  4DSI A;  2A5X A;  4CJE A;  4BR4 A;  4JKF A;  3CIP A;  3F2K A;  2A3Z A;  4OPJ A;  3SUO A;  4JRP A;  1D8Y A;  4DV4 K;  1BIU A;  4CGH A;  4N41 A;  2KHO A;  3AA4 A;  5FRO A;  1FKO A;  1WB9 A;  3H1Q A;  2E2O A;  1XQS C;  4CHZ A;  3NMU A;  4CD3 A;  1GLJ O;  4PL7 A;  3HBT A;  5FPN A;  3DLR A;  2YHA A;  5HL7 L;  5BRF A;  4X62 K;  1C0M A;  4NCG A;  3VEO A;  3D0P A;  4CJT A;  3PV8 A;  2YHW A;  4DTS A;  3U6F A;  3CJ7 A;  5KPR A;  1HQU A;  3O4W A;  1XI1 A;  3SAF A;  1KQS M;  1MU2 A;  4JI6 K;  3SPY A;  4FW2 A;  1R59 O;  4H5N A;  3B6P A;  1K8A O;  2P9N A;  1LW0 A;  4NLB A;  1J54 A;  4CHQ A;  3J7Y P;  3SZ2 A;  3HTV A;  4HUF A;  1WAJ A;  4BRF A;  3QO9 A;  1QSL A;  4LH4 A;  1DTT A;  3RWU A;  4XIU A;  5FRN A;  2ZJP L;  1NM1 A;  1RDW X;  4CGI A;  1VSE A;  3CYM A;  2E1Y A;  1TL3 A;  3ZSX A;  1N8R O;  4JRQ A;  1YHQ N;  4F3O A;  2UXB K;  4JI3 K;  2RF2 A;  1MDU B;  3SV3 A;  5J2P A;  1XWL A;  3S3O A;  4Z4I A;  4M7Y A;  3IG1 A;  1QS4 A;  3HM8 A;  1YI2 N;  1N5Y A;  5HBM A;  5CE3 A;  3AVC A;  3LP1 A;  3D7E O;  3K5O A;  4MLE A;  1IV0 A;  1K8K B;  2HF3 A;  2QM1 A;  5E84 A;  3D2F B;  4IFV A;  3ZX3 A;  1BA1 A;  4C8L A;  3DJC A;  4N76 A;  4YY3 K;  4EP5 A;  2FSN A;  4PKH A;  1VQ8 N;  2Z1H A;  2A41 A;  3UB5 A;  2G8W A;  1CXU A;  3ZYY X;  3TAB A;  4M3Z A;  3NH1 A;  2I7P A;  4CGG A;  3S9H A;  4K0K K;  4CIF A;  5KQD A;  3MEE A;  4I2Q A;  2NRV A;  2A1R A;  3SMS A;  2IS3 A;  1WSH A;  2Z1G A;  3AV9 A;  3SMP A;  2F9T A;  3RMD A;  3DLK A;  1ZC6 A;  1NK0 A;  5EU7 A;  3T69 A;  1L3U A;  1RBS A; 
#chains in the Genus database with same CATH homology
 3TWH A;  4M45 A;  3L3U A;  4KFB A;  4CFC A;  2D5R A;  4FVM A;  1ZBL A;  2KFN A;  1ASW A;  1NJW A;  2OZM A;  2WON A;  4CGD A;  4ID1 A;  2GV9 A;  1EX4 A;  4RW6 A;  4FJ9 A;  1RBV A;  5CZ1 A;  3L2U A;  3ZT1 A;  1HNI A;  2HHW A;  3H08 A;  1HYV A;  3FFI A;  1YTA A;  3LAN A;  3VQD A;  3NCI A;  4FLX A;  4CK2 A;  4DTR A;  1XC9 A;  1KLN A;  2QXF A;  1VSH A;  4Y1C A;  4I9Q A;  1BIZ A;  4FZZ A;  4Z4E A;  2HHS A;  4CJQ A;  2IOC A;  2HHT A;  3KD1 E;  3DRS A;  1LWC A;  3IS9 A;  1F21 A;  2Z1I A;  5C42 A;  1KLM A;  2HNZ A;  4NCB A;  4M3T A;  3S3M A;  3ULD A;  4CJP A;  2YHB A;  5HRN A;  4DLG A;  1NOZ A;  3T1A A;  3SPZ A;  3TAQ A;  2JGU A;  4BE2 A;  1HMV A;  3KIO A;  5JS1 A;  4DS5 A;  2HB5 A;  1XHX A;  3NDK A;  1R0A A;  2HHX A;  4FW1 A;  3DLH A;  1HYZ A;  4KB1 A;  4NYF A;  1D9F A;  3JSM A;  4FJK A;  2X6N A;  1SUQ A;  2DFH A;  1S1T A;  3HPO A;  3KK3 A;  3VA3 A;  1Q9X A;  3DMJ A;  4FCY A;  1WSI A;  2IAJ A;  1KCF A;  1BGX T;  2YKM A;  4E1N A;  4DU1 A;  2D0A A;  1UWB A;  4B8A B;  3OYG A;  3DRP A;  3ZSR A;  4FLW A;  3RTV A;  4ZTJ A;  2FBX A;  1RT2 A;  3KLH A;  2XO7 A;  1T03 A;  1TAU A;  3VQC A;  4W5O A;  4CJS A;  4K8Z A;  4DQR A;  1JLB A;  4DTX A;  3OYE A;  3K5L A;  2P1J A;  4WE1 A;  3OVN A;  4CHO A;  1RDB A;  3ZT0 A;  1T7P A;  2OA8 A;  3PY8 A;  4Y1D A;  3RRG A;  3MED A;  4KTZ A;  5J1E A;  4O0J A;  3OYN A;  2VWJ A;  1U49 A;  3OYC A;  3E01 A;  4JS5 A;  4FK0 A;  3CFP A;  4DSE A;  4O0I A;  1S6P A;  2I5J A;  2X78 A;  1HQE A;  3V9Z A;  4DQP A;  1TVR A;  3O3G A;  2FC0 A;  1S1U A;  4CEE A;  5C25 A;  1JL1 A;  2FBY A;  4CFB A;  1JLG A;  2P51 A;  3LAM A;  3LAK A;  1X9S A;  4LY7 A;  4AHV A;  1NK9 A;  3DI6 A;  3LWM A;  3VQ6 A;  1VSD A;  4ZHR A;  4CF9 A;  4ID5 A;  4J2D A;  2VG6 A;  1JL2 A;  1RTJ A;  3OS0 A;  4CJ4 A;  1T05 A;  2EHG A;  3ZSZ A;  4CJR A;  4B3O A;  3VQA A;  4CFA A;  3ITH A;  3AO4 A;  4KTQ A;  3AVL A;  4W5T A;  2ETJ A;  3HP9 A;  4CIE A;  5SZT A;  2XY6 A;  1W9H A;  4DTJ A;  4CK3 A;  5D3G A;  4R5P A;  1TGO A;  1NJZ A;  1SL1 A;  3ZSQ A;  2HHQ A;  1ZBF A;  3S3N A;  3NF9 A;  4BWJ A;  4I2P A;  3QER A;  1NKE A;  3TI0 A;  2HHV A;  3EY1 A;  4DFJ A;  1SL0 A;  4DMN A;  3QEV A;  3PX6 A;  1J53 A;  3UIQ A;  1S1V A;  3V9S A;  5K14 A;  4FLV A;  1HNV A;  5HRS A;  5KGX A;  4OKJ A;  4CJK A;  1CZ9 A;  3L2W A;  1RT6 A;  3ZCM A;  4CEC A;  2Y1I A;  1RTD A;  3KJV A;  3K58 A;  4FJM A;  4K8X A;  2OPP A;  4FJ5 A;  1SV5 A;  4FJG A;  3MXJ A;  4DTU A;  1KTQ A;  4QAG A;  1WN7 A;  3P5J A;  3D45 A;  4E7L A;  1ASU A;  3SQ1 A;  4KB0 A;  3CM5 A;  1IH7 A;  3F9K A;  3VQ4 A;  1O1W A;  3OS2 A;  3M8S A;  3AVB A;  4KHY A;  3G10 A;  4MFB A;  5E41 A;  2VG7 A;  4DWI A;  1S9E A;  2NUB A;  3KLG A;  4KAZ A;  1A5X A;  1JLF A;  3AO2 A;  4H4O A;  4G1Q A;  4IG3 A;  3HK2 A;  1B9F A;  3C95 A;  5KRT A;  1C0T A;  3NF8 A;  4KHN A;  3DYA A;  4FJI A;  2Q3S A;  4OGC A;  4CF2 A;  4BWM A;  4FJH A;  2DTU A;  3NGY A;  3NH0 A;  4IG0 A;  3NF7 A;  1UA0 A;  2G8F A;  2DFE A;  3BGR A;  4L8R B;  3MEC A;  3HYF A;  3JYT A;  4DQS A;  3QET A;  1GOA A;  5DMR A;  1S9G A;  3RR7 A;  3DM2 A;  4CEQ A;  3V9X A;  2PZS A;  4RW8 A;  3V1Q A;  3TAF A;  3VQB A;  5HP1 A;  4BAC A;  2F8T A;  2ZD1 A;  1ITG A;  3K59 A;  4FLU A;  4FJ7 A;  4M3W A;  1ZBI A;  4KHU A;  1FXX A;  1BCO A;  1ZBU A;  4O44 A;  3O3H A;  4E7K A;  2HVI A;  4HCC A;  3SUN A;  3KK2 A;  1VSL A;  1JLC A;  3OYH A;  3K5N A;  3SUQ A;  4CGJ A;  2OPR A;  2BE2 A;  2E4L A;  1U04 A;  1NK7 A;  1LWF A;  1JLA A;  4CJU A;  3ZT3 A;  3U3G A;  3I8D A;  1QSY A;  4B9T A;  4B08 A;  4PUO A;  4NYN A;  4DU4 A;  2KZM A;  4BE0 A;  4CFD A;  1EXQ A;  4E7J A;  1RBT A;  3CQ8 A;  4DTM A;  2BAN A;  4ZTF A;  4KRE A;  2ZQB A;  4PA1 A;  3QEX A;  3AO5 A;  3DOK A;  1QSS A;  4KHQ A;  3AVJ A;  4KV8 A;  1NJX A;  2KFZ A;  2AJQ A;  2ZE2 A;  3HPH A;  2E6L A;  1X9W A;  2G8I A;  4I7F A;  1LW2 A;  4KI6 A;  3DLE A;  4N47 A;  3HM9 A;  1CZB A;  3NGZ A;  3IRX A;  3DOL A;  3TAP A;  4F8R A;  3ZT4 A;  3F73 A;  1RCH A;  1RT1 A;  1FK9 A;  2F8S A;  2IDO A;  1W0H A;  1NKB A;  4CGF A;  4LSL A;  3KLF A;  3K2P A;  3HPG A;  2RKI A;  1D5A A;  3SI6 A;  3TAR A;  1CXQ A;  4FLY A;  4GVM A;  1IO2 A;  3AO1 A;  1BCM A;  3L3V A;  3QIN A;  4OPK A;  1A5W A;  3AVG A;  2YV0 X;  3KKR A;  4OKK A;  3NHG A;  5KRS A;  1RT7 A;  3KLE A;  4C8O A;  4CED A;  3T3F A;  3ISN C;  4FM2 A;  4B9S A;  1CLQ A;  4IDK A;  3LPT A;  4QOZ B;  4AHT A;  2OPQ A;  1GOB A;  1IG9 A;  3ZSV A;  3ALY A;  2PYL A;  1K6Y A;  4AHR A;  3QIO A;  1RDD A;  3OJS A;  3L2Q A;  3LWL A;  5HLF A;  1G15 A;  4M3U A;  2HHU A;  4FYD A;  1Z26 A;  3KLI A;  1RT4 A;  3LP0 A;  3LZJ A;  3SV4 A;  3MAQ A;  4RW9 A;  4Q0B A;  4OKE A;  3ZSO A;  3OJU A;  3BDP A;  4HHT A;  3NE6 A;  1RT5 A;  3NFA A;  3V81 A;  4CF8 A;  1C1C A;  3HL8 A;  4ELV A;  4Z0U A;  3QEI A;  3V9U A;  3RR8 A;  4Z4F A;  5J2Q A;  3DLB A;  3OYI A;  4FLT A;  4M3X A;  3HVT A;  1QTM A;  2G8K A;  2F96 A;  2X74 A;  1J5O A;  3KD5 E;  4DFP A;  1BI4 B;  4RG8 A;  3WNE A;  4CCH A;  1N6Q A;  1JXB A;  2O4I A;  2KW4 A;  1B9D A;  4ICL A;  2GUI A;  1ASV A;  3LAL A;  4PY5 A;  1BL3 A;  3B6O A;  1DLO A;  4B9U A;  3U3Y A;  4FJJ A;  1KVB A;  1U45 A;  1VK0 A;  3MXI A;  3A2F A;  1IKW A;  3HJF A;  1VRT A;  4CEZ A;  4CF0 A;  3HVR A;  1L3S A;  1BQM A;  4C8N A;  1TKX A;  2YNG A;  3WNF A;  2XY5 A;  4EP4 A;  4CHY A;  2B5J A;  1TK8 A;  1RDA A;  3SCX A;  4CK1 A;  2YKN A;  3AVN A;  4CEB A;  3OYA A;  4DU3 A;  4DSJ A;  1XHZ A;  3P1G A;  3VQP A;  3RMB A;  1FKP A;  1EP4 A;  4B9L A;  3NF6 A;  4JLH A;  4DS4 A;  1NK8 A;  3T19 A;  4JS4 A;  4HTU A;  3NBP A;  1S6Q A;  4GW6 A;  3OYD A;  3OY9 A;  1UA1 A;  2HVH A;  1IKX A;  1RTH A;  4CIG A;  3AA5 X;  3ZSW A;  4J2A A;  3VQE A;  3VA0 A;  5FRM A;  1X1P A;  3VN5 A;  4DF4 A;  2DFF A;  4W5N A;  4O4G A;  3V1R A;  4OVL A;  4GMJ B;  1KVA A;  3THV A;  1VSJ A;  5CZ2 A;  5J2N A;  5I42 A;  1NK6 A;  1WNS A;  1DTQ A;  4M41 A;  4FM1 A;  3V4I A;  2PY5 A;  3AVA A;  1VSK A;  2D0C A;  4OJR A;  2FBT A;  1C1A A;  4N56 A;  4OLA A;  1WSF A;  3QNN A;  4C8K A;  4DTO A;  1VRU A;  3C6U A;  1KVC A;  3QES A;  3PO4 A;  1Q8I A;  3ZT2 A;  1L3T A;  4LH5 A;  4F2R A;  5CY4 A;  5I3U A;  3ZSY A;  1T8E A;  4AIL C;  2X6S A;  3AO3 A;  4CF1 A;  2ATQ A;  2W42 A;  5HRR A;  3V6D A;  3SQ4 A;  1NK4 A;  1LWE A;  1U4B A;  4QCL A;  4CJL A;  2QKK A;  3DRR A;  3LPU A;  4CER A;  5HRO A;  4Z4H A;  4CHP A;  4FK2 A;  2EX3 A;  2YNF A;  2RPI A;  4RW4 A;  3SUP A;  3PO5 A;  1RBU A;  4KPY A;  1U47 A;  3AA2 A;  1J9A A;  1WLJ A;  2O4G A;  4YFU A;  4M3R A;  3AA3 A;  2Y1J A;  4KHW A;  2QK9 A;  1TKZ A;  4CJ5 A;  2XRI A;  3P83 D;  1KRP A;  1TK0 A;  3O4N A;  3C94 A;  4RW7 A;  4CJF A;  3CG7 A;  3OYJ A;  4FM0 A;  3HP6 A;  1UOC A;  2B6A A;  1RBR A;  4O55 A;  3TR8 A;  4NCA A;  3KK1 A;  3AVM A;  3AVH A;  5KTQ A;  4BE1 A;  1IKY A;  3QEP A;  3QNO A;  3NAE A;  1WSG A;  2VG5 A;  1HJR A;  3CM6 A;  3OYK A;  1JLE A;  1SKS A;  3SYZ A;  4DTN A;  3SJJ A;  4EZ6 A;  3QEW A;  4CES A;  2QKB A;  3CFR A;  4LSN A;  2XY8 A;  1WSE A;  4M3Y A;  3MEG A;  3M8Q A;  4CEF A;  2VWK A;  3G0Z A;  3MXM A;  1S1W A;  4IFY A;  3IAY A;  4DLE A;  4KKO A;  1JLQ A;  4FXD A;  1Y97 A;  1LV5 A;  3TAE A;  4KHS A;  1JKH A;  4DFM A;  4BDY A;  1NKC A;  1REV A;  4B9M A;  4O5B A;  3QIP A;  1SKW A;  2DY4 A;  4DSI A;  4DQQ A;  1EKE A;  3O3F A;  4F4K A;  1Q9Y A;  4CJE A;  3VQ9 A;  2KQ2 A;  1EET A;  4IKF A;  1JXE A;  5FDL A;  3HO1 A;  4C8M A;  3PX0 A;  4OLB A;  4HVJ A;  4CEO A;  1LAV A;  3HST B;  4OPJ A;  4DF8 A;  3SUO A;  3AVF A;  4JRP A;  3DLG A;  3RMA A;  1BIU A;  1D8Y A;  4BDZ A;  1L5U A;  4F2S A;  4DTP A;  2HNY A;  3V9W A;  1RDC A;  4CGH A;  4N41 A;  3AA4 A;  5FRO A;  2A1S A;  3OS1 A;  4E89 A;  2PYJ A;  1FKO A;  4UQG A;  4CEA A;  4BDP A;  4KTW A;  1BIS A;  4CHN A;  1BI4 A;  1QE1 A;  4FJN A;  4CHZ A;  5KGW A;  3RRH A;  4ELU A;  1SKR A;  2OPS A;  2G8V A;  1KFD A;  4I9L A;  1A5V A;  3WNG A;  5SWM A;  3OYM A;  1RNH A;  1ZBH A;  3LP2 A;  4E7H A;  2B4J A;  3O4Q A;  1TK5 A;  1S5J A;  3EYZ A;  4CJW A;  1HYS A;  3CFO A;  4FJX A;  1SL2 A;  3HXM A;  4PQU A;  1VSI A;  1BHL A;  1BQN A;  4AH9 A;  4DFK A;  3DLR A;  1S1X A;  2YHA A;  2IC3 A;  3WNH A;  2OZS A;  4FZY A;  1C0M A;  4NCG A;  2OYQ A;  3AVI A;  2GBZ A;  3PX4 A;  4KI4 A;  3ASM A;  3OYF A;  3D0P A;  4CJT A;  2JLE A;  3PV8 A;  2RN2 A;  4DTS A;  3M8P A;  3U6F A;  1KFS A;  2HMI A;  1B92 A;  2YNI A;  1TV6 A;  1TKT A;  1HQU A;  4Q5V A;  1RT3 A;  4Z4C A;  1XI1 A;  3TAM A;  1ZYQ A;  2BDP A;  3SQ2 A;  3KTQ A;  4EZ9 A;  2D0B A;  3L8B A;  1MU2 A;  1VSM A;  4W5Q A;  2LSN A;  3SPY A;  3M8R A;  4FW2 A;  5CYM A;  1C6V A;  4M42 A;  3HT3 A;  3B6P A;  5JS2 A;  1LW0 A;  3SZ2 A;  1J54 A;  2IGI A;  4CHQ A;  3SNN A;  4FZX C;  5T7B A;  1NK5 A;  4HUF A;  1WAJ A;  4LD0 A;  1YTU A;  3L2V A;  4J2E A;  3QO9 A;  5C24 A;  1QSL A;  5KI6 A;  3PUF A;  2E6M A;  4H4M A;  4E19 A;  3NGI A;  2ITG A;  1TL1 A;  4LH4 A;  2R7Y A;  4B8C A;  1DTT A;  3SQ0 A;  3VQ7 A;  3RWU A;  1U48 A;  2XY7 A;  4DSL A;  4XIU A;  4YNQ A;  5FRN A;  4HUE A;  4CGI A;  2HND A;  3AVK A;  1RIL A;  1VSE A;  3CYM A;  3I0R A;  4MQ3 A;  4E1M A;  3L2R A;  4B9N A;  1TL3 A;  3ZSX A;  4JRQ A;  1HPZ A;  3TAG A;  2G8U A;  4F3O A;  4FJ8 A;  2XHB A;  3VQQ A;  2Z1J A;  4FK4 A;  4KRF A;  2FBV A;  2RF2 A;  3SV3 A;  4DSK A;  1D9D A;  4E0D A;  3I0S A;  5J2P A;  1Z25 A;  1XWL A;  3S3O A;  4FJL A;  4Z4I A;  4KO0 A;  4OGE A;  4J2B A;  3IG1 A;  1QHT A;  3V1O A;  3LDS A;  1TKD A;  1QS4 A;  4FLZ A;  1LAW A;  1TAQ A;  5HBM A;  1N5Y A;  1I39 A;  1RTI A;  4DQI A;  1WAF A;  4W5R A;  4HUG A;  3AVC A;  3LP1 A;  3K5O A;  3TAN A;  1QQC A;  4DSF A;  4IFV A;  4IBN A;  1C1B A;  4C8L A;  2BGG A;  4F3T A;  3OYB A;  4N76 A;  4EP5 A;  2KTQ A;  1HRH A;  2Z1H A;  2G8W A;  4E7I A;  1CXU A;  4TSX A;  4N5S A;  5DK5 A;  3K57 A;  3TAB A;  3RMC A;  4B9V A;  2HW3 A;  2KZZ A;  3C6T A;  4M3Z A;  1I3A A;  3NH1 A;  2WOM A;  4CGG A;  3S9H A;  2P5O A;  4H8K A;  5CYQ A;  4CE9 A;  4CIF A;  1WSJ A;  3MEE A;  2YNH A;  4AHU A;  1UAX A;  4I2Q A;  4CJV A;  3K5M A;  1VSF A;  2A1R A;  1IKV A;  2G8H A;  2P5G A;  1NOY A;  3NH2 A;  1GOC A;  1C0U A;  1KSP A;  2IS3 A;  1WSH A;  4AHS A;  2Z1G A;  5HRP A;  3LZI A;  4E3S A;  4ELT A;  4PWD A;  1YT3 A;  3OYL A;  1NJY A;  1X9M A;  3AV9 A;  3KKS A;  3LP3 A;  3RMD A;  3DLK A;  1NK0 A;  4Z4G A;  3QLH A;  4HCB A;  3VQ8 A;  1L3V A;  1YVU A;  5EU7 A;  4CJ3 A;  3EZ5 A;  5J2M A;  4AHC A;  1L3U A;  4DG1 A;  3VQ5 A;  1RBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...