3LPTA

Hiv integrase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
142
Chain Sequence
b'DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Rational design of small-molecule inhibitors of the LEDGF/p75-integrase interaction and HIV replication.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 45
structure length 142
sequence length 155
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lptA00
2DFFA 1F21A 3OYAA 2O4GA 1XI1A 2HMIA 1BGXT 1JL2A 4CHQA 2YNIA 4DFJA 1RDDA 3G10A 1C0TA 1RTHA 1XWLA 2YNFA 4FJGA 4Z4IA 3K59A 1NK5A 4Z4GA 1TGOA 4CJWA 1QSSA 1HPZA 3CFPA 4DQSA 3TARA 4RW4A 2BE2A 4Y1CA 4M3RA 4FJ8A 4QCLA 1GOCA 4HUFA 5CYMA 2HNDA 2PYLA 1UA1A 1A5WA 4W5OA 3NF8A 4CEZA 2HVHA 3IG1A 3CYMA 4KKOA 3AO1A 1S1UA 4HUEA 1KLMA 1LW2A 1S9GA 1N5YA 1RT6A 4FYDA 1ZYQA 3B6OA 4N47A 1TL1A 1RTDA 1TK8A 3RR8A 3ZCMA 2FC0A 3VQEA 2OPSA 1RT3A 1A5VA 4BWJA 4CGIA 1NOYA 3HT3A 2XY8A 2Y1JA 3RRGA 4AHSA 1NJZA 4DQIA 4E7HA 3DI6A 4DTSA 1HYVA 5KTQA 5J2NA 1VSDA 3WNHA 1W0HA 4CF9A 3QERA 1KFSA 4Z4EA 2JGUA 4GW6A 4FLZA 4KTZA 3JSMA 1ZBHA 4ELUA 3DRPA 3RMCA 4C8NA 3SUOA 1SL1A 1IG9A 1VK0A 3I0RA 3AVFA 2Z1HA 2GBZA 3HPHA 5CZ1A 1EETA 4FM0A 3KJVA 4DQRA 4OGCA 2ETJA 4AHVA 4Y1DA 3V9XA 3LANA 2G8FA 1TVRA 3S3NA 4M3UA 2HHTA 4M3ZA 4FK2A 1VRUA 3SUQA 3P5JA 4I2PA 2X78A 1R0AA 4HCCA 2F8TA 3AVCA 3QESA 3NGZA 3E01A 3V9ZA 3SQ2A 1TK5A 4KTQA 4DQQA 2AJQA 3KKRA 3LP0A 3AVIA 2VG7A 5J1EA 3HP6A 1X9SA 4OPJA 3SQ0A 4KAZA 2B6AA 1RBTA 2XY6A 4M3XA 4IDKA 3KLGA 3TAMA 3NH2A 1NKBA 1S1TA 4RW8A 1J53A 4CFDA 4FJ9A 3LDSA 3RR7A 3P83D 3VQAA 3F73A 1LWEA 3WNEA 1NKEA 4QOZB 1NK7A 1X9WA 3L3UA 5T7BA 1HNIA 1NKCA 3DRRA 3QINA 4ZHRA 4CK3A 3NCIA 3MAQA 4DTUA 4DF8A 1U47A 4KHUA 3DYAA 4RW9A 4DTNA 4CJQA 4KI6A 3AVLA 1QTMA 2QKBA 1D9DA 1HRHA 4BDPA 1RT7A 3OYHA 4KB0A 3MXJA 4PY5A 4KHNA 4PWDA 3PX4A 3KKSA 1EP4A 2VWJA 3NE6A 2G8UA 4CF0A 2YKMA 4K8ZA 2E4LA 4F3OA 2QXFA 3LPTA 3RMAA 4ID1A 4CGFA 4CJTA 3RWUA 2FBTA 2X6NA 4IFVA 4CHZA 4AHRA 4DFMA 2F8SA 3CFRA 2KW4A 3TAQA 3AV9A 3OJUA 4JRPA 2DTUA 5KGWA 3L2QA 3RTVA 4FJJA 2GV9A 3OS0A 3ITHA 3DLEA 1J54A 4WE1A 1D8YA 4IG0A 4Z0UA 4ICLA 3SQ4A 3MXIA 3QEIA 1ZBIA 5CYQA 3V1RA 4CIEA 3AA3A 3VA0A 5HBMA 4IBNA 4J2AA 4AH9A 1S1WA 2IC3A 4CJ4A 4BE2A 4FLVA 3PY8A 3I0SA 4CEFA 2D0CA 1LWCA 3NBPA 4TSXA 4FLWA 2OPPA 3AVJA 2OZMA 5KGXA 1YTUA 3LPUA 2BANA 1I3AA 5J2QA 1WSGA 4CJEA 4B9UA 5FRMA 1RBRA 2RF2A 4CEDA 4OVLA 1S5JA 4H4MA 3HM9A 4FJXA 2KZZA 3CQ8A 3K5OA 1ZBLA 2HHWA 1WN7A 4IG3A 3SNNA 1U49A 4FVMA 4DS5A 1T03A 1J9AA 3V1QA 3BGRA 1BHLA 4FLYA 3F9KA 1WSHA 3KLFA 5HRRA 3QEXA 4OKEA 1X1PA 3SQ1A 4W5RA 4B08A 1T05A 3M8RA 4FLXA 1T7PA 4KFBA 4CHNA 1NK8A 3DM2A 2DY4A 1QSYA 1FKPA 3TWHA 1DTTA 1ASUA 3MEGA 4CJFA 4M45A 3OYEA 3HP9A 1WSEA 3S3MA 3ZSWA 2VG6A 3HVTA 3SJJA 3VQ8A 3PV8A 4GMJB 2G8WA 3HJFA 2KTQA 1IKVA 2WONA 1CLQA 3VQ9A 3VQPA 5HROA 3ZSXA 4NYNA 4W5QA 4E7LA 1RDAA 4CIFA 3OYFA 3O3FA 4KPYA 2NUBA 4H8KA 4CERA 1BQMA 2B5JA 1VSIA 4KO0A 4B9VA 4ELTA 2Z1JA 3AA4A 5E41A 2G8KA 4FCYA 2O4IA 4B3OA 4CESA 4FLTA 3S9HA 4I2QA 1MU2A 4DLGA 3QEWA 4DMNA 5K14A 3TAPA 3OJSA 2D5RA 1SV5A 3SV4A 1O1WA 3QEPA 1D5AA 1HNVA 1VSKA 1WAFA 4E3SA 4KI4A 1ZBFA 4KHSA 3VQBA 1SUQA 4CFBA 3OYLA 4FJNA 3MEDA 3OS1A 3K58A 4KHWA 2HNYA 3AO5A 3ZSRA 4FJHA 3V9WA 4E19A 3VQ5A 1IH7A 3OYGA 1G15A 4HHTA 4M42A 2XO7A 3DLGA 2YHBA 1REVA 4LD0A 1C0UA 2Z1IA 4DU3A 1XHZA 4AILC 1LWFA 3OS2A 2OPQA 2ZQBA 4R5PA 1BI4B 3KLHA 1KRPA 3C95A 1J5OA 1BIZA 1FKOA 4C8OA 4DQPA 3TR8A 2D0AA 4HVJA 3ULDA 1A5XA 2IDOA 3SPZA 2HHQA 1L3SA 1ASWA 3OYBA 4I9QA 1BCOA 1NK4A 4FK0A 2FBXA 4M41A 3JYTA 3LZJA 4E1MA 3AO2A 1QS4A 3ZSYA 2QKKA 3DLHA 3CFOA 3O4QA 4DSJA 3KD1E 4AHUA 2OYQA 3TAEA 5DMRA 3KIOA 4F4KA 4CK1A 1N6QA 5C25A 3V9UA 4DTMA 3M8SA 3DLRA 3HPOA 3KD5E 1L3VA 1C6VA 3L8BA 1HYSA 4B9MA 1S1XA 4PUOA 3NDKA 4CK2A 4OKKA 3NF6A 4N56A 3OYDA 1EKEA 3QIPA 1NK9A 4G1QA 3LP2A 4Z4CA 1YTAA 1BI4A 2YNHA 3ZT2A 4UQGA 3OY9A 2IAJA 3S3OA 4E0DA 4BE0A 4N41A 2XRIA 2ZE2A 4FK4A 1VSJA 4LSNA 4NYFA 4FJ7A 2HVIA 1RT5A 2P1JA 1FXXA 3VQQA 4BDYA 3DOKA 1HQEA 1RDCA 3CM5A 3M8PA 4W5NA 4C8LA 3SUNA 3HXMA 1HQUA 3ZSZA 3TANA 3L2VA 3AVNA 3MECA 4BWMA 1BIUA 4BDZA 5HP1A 3AVAA 4FZXC 2HHVA 4DTXA 5HRPA 4FJMA 4CJKA 1HMVA 1KSPA 3IS9A 4FM1A 1XHXA 2YV0X 3AA2A 1TKDA 3ZSQA 1S6PA 3ZT4A 4CJRA 1ASVA 2RKIA 4ID5A 3DLBA 4FJIA 1JLCA 3LWMA 1SKRA 1DLOA 1IO2A 1BCMA 3AVMA 4O0IA 1RNHA 2DFEA 3OYKA 3K5NA 1IKXA 3NH1A 5J2MA 3OYMA 3TAGA 1SKSA 3NGYA 2G8IA 4GVMA 2Z1GA 1SL0A 3VQ4A 3ZSVA 4E1NA 3LZIA 1NJYA 2YKNA 3LP3A 3V9SA 4O5BA 1LV5A 4E7IA 3ISNC 3SPYA 3CM6A 3K2PA 3NF7A 5I42A 1JXBA 1UA0A 3OYJA 4B9TA 2E6LA 2IGIA 4CJVA 4DG1A 2BGGA 1GOBA 3O3GA 1JXEA 4L8RB 1RILA 3LAMA 2KFZA 4I7FA 1IKYA 1VSLA 3V81A 4RW7A 3B6PA 3O4NA 2D0BA 4DS4A 1EX4A 3K5MA 2GUIA 5I3UA 2G8HA 5SWMA 4CECA 4DWIA 3UIQA 4J2EA 3HYFA 1VSEA 1Q8IA 2F96A 4CGJA 4DLEA 4DU1A 1TKZA 4FJLA 4E89A 3AVGA 1U45A 3NF9A 4KV8A 2WOMA 2VG5A 3C94A 4HCBA 3LALA 2HHXA 4CGGA 1TK0A 4CEEA 4DFPA 2P5GA 1C1AA 3KK1A 3QETA 3SUPA 4KREA 3VQ7A 1RTIA 3AA5X 3AVKA 3AVBA 4I9LA 4DU4A 4CCHA 5D3GA 4O0JA 3T1AA 3D0PA 2BDPA 1YT3A 4CJLA 3NGIA 3IAYA 4DSIA 2E6MA 2HHUA 3KLEA 1RBUA 2JLEA 1NJXA 1JKHA 1Z25A 4KHQA 5HRSA 3U3GA 3P1GA 3EYZA 3U3YA 4ZTJA 2FBVA 4AHTA 4E7JA 4F8RA 1S6QA 4Z4FA 1U04A 4ELVA 1WSFA 4NCBA 1CZBA 3O3HA 1TAUA 3G0ZA 3RRHA 1XC9A 1KLNA 4B9LA 4FZYA 3AO4A 3WNGA 4CEBA 4M3TA 2YNGA 4KRFA 2IS3A 4FJKA 3V4IA 4O44A 3OYNA 3ZT0A 3SZ2A 5CZ2A 3HSTB 3ZSOA 1UOCA 4FW2A 4CJSA 3RMBA 4KHYA 1RBSA 3M8QA 1KVCA 1TAQA 4JS5A 4JRQA 2P5OA 2OZSA 2X6SA 1S9EA 3V1OA 4XIUA 1DTQA 4FZZA 2X74A 1KVAA 4EZ9A 3EY1A 4HTUA 1L3UA 4J2DA 5JS2A 4CGHA 4IKFA 5FDLA 4BE1A 1LW0A 3A2FA 3VN5A 2PY5A 4NCAA 3T3FA 1WLJA 3BDPA 3EZ5A 2PZSA 1RT2A 5J2PA 4C8KA 3DMJA 3RMDA 3VA3A 1Z26A 1KFDA 3DOLA 2IOCA 3QO9A 4CE9A 2OPRA 1NK0A 3KTQA 4CJ5A 2ATQA 1QE1A 1LAWA 3HK2A 1C1BA 3KK3A 1RBVA 4E7KA 4B9NA 1ZBUA 4F3TA 4RW6A 4CJPA 4CFCA 4M3WA 4MFBA 4LSLA 3T19A 1U48A 1X9MA 3KLIA 5KI6A 4ZTFA 4LH4A 2OA8A 3IRXA 4F2SA 1LAVA 3SCXA 4H4OA 3L2RA 4CF8A 2RN2A 3KK2A 3QIOA 2ITGA 3TAFA 3QNNA 1QSLA 3CG7A 3THVA 3LP1A 5DK5A 1QQCA 1BQNA 4C8MA 4QAGA 2KZMA 4OKJA 3C6UA 2RPIA 4OLAA 3NFAA 3PX6A 3L2WA 1VSFA 3H08A 4DTRA 1L3TA 4B8CA 4CIGA 5CY4A 1WSJA 4CGDA 4OLBA 1FK9A 1QHTA 3K5LA 1GOAA 4FW1A 3MEEA 1TKXA 3AVHA 4O55A 4CF2A 4AHCA 1RT1A 3LAKA 4JLHA 3WNFA 4EP5A 1HYZA 4YFUA 4B9SA 2QK9A 2XY7A 4K8XA 4CHOA 4Q0BA 1W9HA 2YHAA 4IFYA 4DSLA 3SI6A 2I5JA 1JLBA 1KCFA 3HPGA 5KRTA 3PX0A 4DTJA 4DTPA 1D9FA 4F2RA 4KB1A 2DFHA 1RDBA 4PQUA 1JLEA 3OVNA 3PO5A 1CXQA 4LH5A 4MQ3A 4NCGA 4CEAA 3I8DA 2HNZA 2A1RA 1I39A 5JS1A 4CHPA 3K57A 4FM2A 2PYJA 4CHYA 1SKWA 5HRNA 4OPKA 2FBYA 3SV3A 1TV6A 3ASMA 4KTWA 4DSEA 3QEVA 3TI0A 3MXMA 1L5UA 1HJRA 4N76A 4CJ3A 3C6TA 4Q5VA 5EU7A 4LY7A 1JLQA 3ZT1A 4CEOA 2LSNA 2ZD1A 4JS4A 2KFNA 3U6FA 2R7YA 1VSHA 4CF1A 5HLFA 1JLFA 1ITGA 3ALYA 4BACA 3PO4A 1VSMA 4DSFA 2EX3A 3D45A 4CEQA 3HO1A 3L2UA 1JLAA 1VRTA 2P51A 4FLUA 1SL2A 4DSKA 4FXDA 4B8AB 4W5TA 2A1SA 4EZ6A 4EP4A 1BL3A 4YNQA 1RCHA 4DTOA 2HW3A 1B9DA 4HUGA 2KQ2A 4DF4A 1T8EA 1CZ9A 1UAXA 1TKTA 3QLHA 4O4GA 4J2BA 3V6DA 5FROA 1S1VA 1RTJA 3HVRA 4N5SA 2EHGA 5SZTA 1Y97A 4Z4HA 1JL1A 2XY5A 1CXUA 4CFAA 4CJUA 2XHBA 1RT4A 1B9FA 3AO3A 3DLKA 2B4JA 1WSIA 5C42A 1NOZA 3HL8A 3NHGA 3ZT3A 1C0MA 3NAEA 1NK6A 1U4BA 3VQDA 1B92A 5C24A 3OYCA 2HHSA 3FFIA 4PA1A 2W42A 4M3YA 4OJRA 3VQCA 1Q9XA 1UWBA 3NH0A 2Y1IA 1BISA 4OGEA 2Q3SA 4RG8A 1KVBA 1C1CA 3TABA 3L3VA 1WNSA 1K6YA 1TL3A 3PUFA 3OYIA 2VWKA 3DRSA 3QNOA 5FRNA 1YVUA 5KRSA 1IKWA 1EXQA 3LWLA 4DFKA 1Q9YA 4FJ5A 3SYZA 2HB5A 1KTQA 1WAJA 3VQ6A 1JLGA 1NJWA 2G8VA
chains in the Genus database with same CATH superfamily
2DFFA 1XI1A 1JL2A 2YNIA 4DFJA 4JV5K 4Z4GA 1NK5A 1HPZA 5BRDA 1IG8A 2Q31A 2P9PA 2A42A 3CFPA 4RW4A 1NNEA 1GOCA 4HUFA 1VQPN 3CQXA 3IG1A 3MCPA 3AO1A 1S1UA 3CCRN 1N5YA 1RT6A 5FPEA 1TL1A 3AGKA 3VF6A 2NZTA 3VQEA 2OPSA 4BWJA 4B1VA 3THWA 3DI6A 1HYVA 3I8BA 3QERA 2O8CB 2NLXA 3SUOA 1VK0A 3BP8A 3MX5A 3VGMA 3HPHA 5CZ1A 3R3LA 4FM0A 4DQRA 2ETJA 4FPBA 5EY4A 4M3UA 1FJGK 4FK2A 3HI0A 3P5JA 1BA1A 2AJQA 3FZMA 3CQYA 5AQKA 4KH5A 3ID6A 3R8EA 1DEJA 4BRLA 4KAZA 2XY6A 1Q7YO 4IDKA 1NKBA 1S1TA 4B3RK 3WNEA 4QOZB 1QQOA 3A8YA 4H0PA 5T7BA 3NCIA 3GL1A 4DTNA 3WEEB 4KI6A 2OANA 1HRHA 4BDPA 3OYHA 4M63C 3KKSA 4WYBA 1YJWN 2P9IB 4K8ZA 4CJTA 1CZAN 1YJNN 2FBTA 4DFMA 3TAQA 2KW4A 4XH1A 3AV9A 2QWOA 3DLEA 2HF3A 4BR2A 4ICLA 3V1RA 4IBNA 3QFUA 4CJ4A 1S1WA 1LWCA 3NBPA 4O8KA 1YTUA 5KGXA 3LPUA 3G4SN 4CJEA 1BWFO 3NMUA 4FJXA 2E88A 3CQ8A 4JI7K 4IG3A 5M1OA 4FVMA 3L4QA 4DS5A 2KHOA 1QVGM 3F9KA 2YHWA 3SQ1A 2W6LA 4OKEA 1X1PA 4BQZA 4KFBA 1NK8A 4CJ7A 3VETA 4DR7K 1ASUA 4DR5K 5AQIA 2UXCK 3HP9A 3HBTA 3PV8A 2E20A 3HJFA 2KTQA 3EO3A 5HROA 4IJAA 2VQFK 4NYNA 1RDAA 4CIFA 3OYFA 4JKGB 3WT0A 2YJEA 3O3FA 1NGFA 2B5JA 2Z1JA 1E4FT 1KAXA 3JXUA 4PKIA 5E41A 4CESA 1MU2A 3O9UA 3OJSA 2D5RA 1SV5A 1O1WA 4H5NA 1D5AA 1WAFA 2VWBA 3QEPA 1LOTB 1ZBFA 4CFBA 3OYLA 4FJNA 3OS1A 4ILGB 4B1WB 4EAHD 2HNYA 3WUHA 2E1ZA 4E19A 1BU6O 1G15A 1VHXA 1MWMA 5M1NA 4HHTA 5BR8K 2HBJA 1REVA 2FF3B 2Z1IA 4DU3A 1LWFA 1NG9A 4R5PA 1BI4B 3O5BA 1BIZA 4DQPA 1XMQK 3TR8A 2D0AA 3FLCO 1IBLK 1GLBG 2HHQA 3CPEA 1L3SA 3K0SA 1ASWA 2E2PA 2P9UB 1BCOA 4FK0A 2FBXA 4E1MA 4WCEL 4OPAA 2HMPA 4DSJA 4AHUA 1BDGA 3V9UA 4DV3K 1WBDA 3HPOA 4A57A 1NBWA 1L3VA 3KD5E 4BVOA 5KPTA 4PUOA 3W0LA 3OYDA 3QIPA 4Z4CA 1YTAA 2YNHA 3CERA 2XRIA 3J7YP 4FK4A 4GVEA 4OO1J 3ID8A 4L3QA 2ZWHA 4NYFA 4FJ7A 3FZFA 2ZJPL 1RDCA 1HPMA 3TANA 4GKJK 5B8HA 5HP1A 2HHVA 4DTXA 2VGMA 3DWLA 1X9JA 4PL7A 4CJKA 3CCLN 5KQ8A 2YV0X 3AA2A 4JKFA 2RKIA 4FJIA 1OKJA 2HBKA 3J8AA 1U6ZA 3E9LA 1IO2A 1IKXA 1SKSA 3NGYA 1S72N 4H0OA 3E66A 4BRNA 2Z1GA 1SL0A 4E1NA 2YKNA 4CBUA 4E7IA 3CM6A 4B3TK 3WXMB 1RGIA 3E9OA 2HF4A 3LAMA 3O1BA 3CF5L 5AQFA 4BR9A 2GUIA 5I3UA 5JLHA 3HYFA 1VSEA 4DLEA 4BY9C 4ISEA 4X65K 1TKZA 3T7ZA 1M1KO 2PAVA 3NF9A 2VG5A 4CGGA 4CEEA 5LMNK 3OHRA 3SUPA 4JKDA 4I9LA 4CCHA 5D3GA 2Q97A 4O0JA 1YT3A 4DSIA 2E6MA 5C2DA 3DAWA 3H6EA 4BRAA 3NVMA 4KHQA 3CMAN 1EWRA 4E7JA 2ASPA 4DUYK 4LF7K 3O3HA 1KLNA 2IS3A 3OYNA 3SZ2A 3ZT0A 3HSTB 3ZSOA 1UOCA 4KHYA 1RBSA 5AQXA 1QVFM 4JRQA 4CZHA 2X6SA 1S9EA 2GWKA 4XIUA 4DR1K 4DV4K 5JS2A 4CGHA 3H45C 5FDLA 2GUPA 3VN5A 4MDBA 1HNXK 2PZSA 3IUCA 5J2PA 3RMDA 2NRHA 4CE9A 2IOCA 4DQ8A 3QB0A 3KTQA 1D4XA 3KK3A 4E7KA 4F3TA 4AQYK 4CJPA 2OTLN 4MFBA 4FOIA 1RFQA 1U48A 4H5RA 3IRXA 4LFBK 4YORA 1X3MA 3TAFA 1QSLA 1E4GT 3LP1A 2QWLA 2RPIA 1YF5L 3NFAA 3H08A 4DTRA 5GIOA 5CY4A 1WSJA 4OLBA 2P9SB 4LF5K 1QHTA 4UY8O 1GOAA 3AAQA 4O55A 4AHCA 3WNFA 1TYQB 4Q0BA 3CD6N 4DSLA 1JLBA 1KCFA 3DXKA 5AZIA 1OH5A 4CZFA 1RDBA 1JLEA 3LDPA 4QS7A 2HNZA 3K57A 5CHIA 3SV3A 3ASMA 3H1QA 4DSEA 1ILYA 3MXMA 1HJRA 1JJ2M 5EU7A 1JLQA 3B8AX 3ZT1A 3J7AP 2ZD1A 2O8FA 3U6FA 4C1NK 3VTHA 5HLFA 1JLFA 3THXA 2UUAK 1ITGA 1HKBA 3FZKA 4CEQA 3T1YK 3ULEB 4ISFA 2P51A 4FLUA 4FXDA 4B8AB 3EKSA 2V51B 4BC2A 3CETA 2GEMA 2UUCK 3U9DA 4DTOA 2HW3A 4HUGA 4DF4A 5C10A 4O4GA 3RSEA 4J2BA 5GAHP 4DCHA 1S1VA 1RTJA 3HVRA 3KVGA 1JL1A 1CXUA 4CFAA 4YHHK 3AO3A 4JD2B 5AQPA 1NMDA 2ZGZA 3HL8A 2HHHK 3NHGA 4DKWA 3NAEA 3P39A 3OYCA 2W42A 3ENBA 5AQMA 4OJRA 3VQCA 1Q9XA 4B3MK 2Y1IA 4RG8A 3TABA 4WF9L 3OYIA 3PUFA 3QBWA 5KRSA 4DFKA 3SYZA 3VQ6A 1JLGA 2W41A 3TU5A 2HMIA 1BGXT 4EFHA 3G10A 1C0TA 2F9WA 4YDUC 4DQSA 1Q81O 1YJ9N 4Y1CA 2ZJRL 2PYLA 1A5WA 3NF8A 4CEZA 3JAMO 1KLMA 5AQOA 1TUYA 2HSTA 5F2RA 1NOYA 3HT3A 1NGEA 4AHSA 3CC7N 4IO8A 3DXKB 1VSDA 1NJIO 1W0HA 3LDLA 2V7YA 4A62A 4GW6A 4FLZA 3U4LA 3TSUA 3CCQN 3DRPA 2WTUA 3RMCA 4C8NA 1SL1A 4O5FA 4JI1K 2Z1HA 4K41A 3KJVA 3EKUA 4OGCA 4WQ5C 4AHVA 1YI2N 3V9XA 3LANA 4RWTA 3S3NA 2HHTA 3OA9A 1VRUA 3I55N 4I2PA 2X78A 2VQEK 4HCCA 4R79A 3QESA 3NGZA 1JCGA 4DQQA 3KKRA 3LP0A 3THXB 4JK9A 2VG7A 2P9LB 1X9SA 3BF3A 5EVZA 2B6AA 1BG3A 3TAMA 5DM7L 5C0YA 1XC3A 2AA4A 4CFDA 4FJ9A 2NRWA 4FWNA 3P83D 4XH4A 3VQAA 2QXLA 3VPZA 3F73A 1J5EK 1Q18A 1NK7A 1X9WA 1HNIA 1NKCA 3QINA 4ISGA 2O8CA 5IT9O 3GG4A 4YDUA 1D9DA 3RSEB 1RT7A 3H1VX 1N33K 4KHNA 4PWDA 3NE6A 3CCUN 5AQHA 2GELA 3RMAA 3G6EN 4CGFA 2BUPA 3C6HA 4PHTX 3C6AA 4CHZA 3D2FB 5KGWA 1XQSC 3L2QA 4FJJA 3ITHA 3ATVA 3QEIA 1BUPA 3J7ZO 1HNZK 1EQYA 4J2AA 4BQLA 2IC3A 3I0SA 4CEFA 3WEEA 4FLWA 2OPPA 3TTCA 3AVJA 4WQ5A 4IO9L 2QI2A 3HM9A 1V4TA 2P9IA 3KHYA 3VMFB 3CXCM 3K5OA 1ZBLA 1WN7A 4FWKA 1J9AA 3V1QA 3BGRA 4BRCA 1WSHA 3KLFA 1K8KB 3QEXA 4W5RA 4JHDB 4JEPA 1T7PA 4CHNA 1T6CA 3DM2A 1MA9B 4X62K 1QSYA 2NRZA 1NM1A 4CJFA 3MEGA 3OYEA 4BRMA 2H3GX 2UXBK 3Q7BA 1WSEA 3S3MA 2VG6A 1JCFA 5KPZA 1K73O 2WONA 2I7PA 5BREA 4WFBL 2VCPA 3ZSXA 4CERA 1BQMA 4BR4A 3UE5A 2O4IA 4FLTA 4BGBA 4DLGA 3QEWA 4DMNA 3CIPA 1HNVA 4DR2K 3FZHA 3K58A 4LF6K 2V52B 5CR4A 3ZSRA 2E2QA 3SLCA 1Q86O 3FR0A 4LD0A 1C0UA 1XHZA 1X3NA 2Q0UA 3OS2A 4JKHA 4JI3K 3SK3A 3KLHA 4JKGA 1FKOA 3ULDA 4B3SK 4A2AA 4K25A 1NK4A 3LZJA 4GKKK 1NGDA 4IFEA 1VQON 5KPRA 3O4QA 3KD1E 3CJ1A 2OYQA 3TAEA 1OVQA 1RDUA 5DMRA 1J6ZA 2JWKA 2OCEA 3VEXA 4F4KA 4IOXA 3DLRA 2IVNA 1IV0A 3M5RA 3FZLA 4CK2A 3NF6A 1EKEA 5AFUA 3LP2A 1BI4A 4JKAA 4JI8K 1NGAA 1VSJA 1HNWK 1BO5O 4NB4A 4LSNA 1RT5A 3VQQA 2P9UA 4H0VB 3CM5A 5H1SQ 3A0IX 3M8PA 3HXMA 4DB3A 3L2VA 4BWMA 2CGLA 3ZX3A 4FZXC 5HRPA 5FPNA 4FJMA 3SAFA 3QDKA 4CD3A 3ZSQA 1S6PA 2GWJA 1ASVA 3DLBA 1DLOA 3AVMA 2DFEA 2GTDA 3NH1A 4F9OA 3VQ4A 3O80A 3D6RA 3LP3A 3V9SA 3CCSN 3K2PA 4DR3K 2IGIA 2BGGA 4CZGA 3QFPA 1GOBA 4JNEA 1JXEA 4BVPA 3O3GA 4L8RB 2CH6A 3WXIA 3V81A 3D7EO 3B6PA 1EX4A 1HJOA 4LFAK 4DWIA 4E89A 1VQKN 1JCEA 4DFPA 3KK1A 3QETA 4FPAA 4B1ZA 4QS9A 3T1AA 3NGIA 3UKUB 5BN8A 3KLEA 1RBUA 2E1YA 1NJXA 4CI6A 2A3ZA 3P1GA 3U3YA 2NNWA 1SS6A 4AHTA 4Z4FA 3K9JA 3U9ZA 3I56N 1WSFA 4NCBA 1CZBA 4FWOA 3GBTA 4HWIA 2WBNA 2YNGA 1GLJO 3BUZB 4PKGA 3RMBA 1KVCA 1LCUA 5LMUK 4A2BA 2P5OA 4C23A 2OZSA 3F2KA 2A40A 4FZZA 3LDQA 2X74A 1KVAA 3EY1A 4BE1A 4K0KK 1YVNA 2WFBA 2PY5A 3BDPA 4NCAA 4C8KA 3QO9A 4G9ZA 3IKMA 4A5AA 1NK0A 1LAWA 1ATNA 4B9NA 1RBVA 2WC9A 3T19A 4I6MB 1FW6A 4M7YA 4ZTFA 2OA8A 1LAVA 1K9MO 4RTFD 4H03B 4C1NI 1SQKA 2ITGA 3QNNA 1YHQN 5BN9A 1GLEG 4C8MA 5DK5A 1QQCA 1BQNA 4OKJA 3PX6A 3L2WA 4XH5A 1YAGA 5AQSA 4YFUA 1RT1A 5EXWA 4YOUA 1OH6A 2I5JA 3PX0A 1D9FA 5KRTA 5TKYA 4JI2K 5GIPA 4NLCA 1WBBA 3PO5A 4U67L 3DXMB 4NXNK 1E3MA 5JS1A 4IEIA 4FM2A 4CHYA 5HRNA 4OPKA 1L5UA 3ZETB 2KLAA 4OPHA 1KD1O 3SAGA 4JS4A 3J81O 3O9SA 4LF8K 1VSHA 4CF1A 4BR7A 3ALYA 2P9SA 4GNIA 3D45A 2QWNA 3HO1A 4ILJA 2QWQA 2J4RA 4WFNL 1VRTA 1TYQA 3A5LC 4DSKA 3HOTA 2KQ2A 1T8EA 1UAXA 2UYTA 5FROA 4N5SA 4Z4HA 5AQWA 4CJUA 2P9NB 1RT4A 2B4JA 2HBMA 4CZJA 3O9TA 4DV2K 2ZF5O 3LM2A 3ZT3A 5AR0A 1C0MA 3EN9A 1B92A 5I9EB 4LF9K 1W7AA 1T44A 4JI0K 1UWBA 1DKGD 3ULEA 1QQNA 3HTVA 1BISA 3R1XA 4BRKA 3GE1A 3BEXA 1K6YA 3DRSA 4IXCA 1XNQK 2HB5A 1KTQA 3LL3A 2G8VA 1I94K 1NGBA 3OYAA 3VF2A 2QWMA 2O4GA 1QQMA 1RTHA 1XWLA 2YNFA 3EL2A 4JKEA 4JD2A 3BZCA 3K59A 1TGOA 4Z4IA 4KHPK 3TARA 3DLLL 1RDWX 2BE2A 4M3RA 4A61A 3FFKB 1UA1A 4W5OA 3CC2N 1ZXOA 3CYMA 4KKOA 4NLBA 4FYDA 1ZYQA 3RR8A 2FC0A 4JI6K 4FWMA 2E5LK 3ZX0A 4JI5K 4CGIA 4PL8A 4E7HA 3G71N 4DTSA 5J2NA 3WNHA 5E84A 3SBGA 5LL6Z 4CF9A 4Z4EA 2E2OA 3VEVA 2O8BB 4YOWA 4ELUA 4BRGA 3CCVN 1IG9A 3AVFA 2KKZA 4H0YB 4WQ4C 1NGHA 1U2VB 4B1YB 4Y1DA 4FSVA 4JI4K 3SUQA 1OH8A 1R0AA 1KC8O 3O08A 1TK5A 4YOTA 4NO7A 2QM1A 4DV1K 1RBTA 3SJHA 3KLGA 3NH2A 1Z6RA 2D4WA 1VQMN 2VYPA 4RW8A 1J53A 5LJVA 2ZM6K 3LDSA 4BG9A 3RR7A 1LWEA 2O8EB 4MDAA 3WXKA 2RE2A 3UB5A 4DF8A 4DTUA 3ZEUB 4KHUA 3DYAA 3WXLA 3AVLA 1QTMA 2QKBA 5TKWA 1Y64A 3M6GA 4FWPA 2NRXA 4KB0A 1NGIA 3MXJA 4PY5A 3AAPA 2VWJA 2O8DB 3J80O 2G8UA 3KWGA 1IBMK 4F3OA 5FLXO 2X6NA 5AQUA 5DM6L 4AHRA 3MWPA 3O9QA 2P9LA 3ZLJA 2GV9A 3OS0A 2VGNA 1D8YA 3SQ4A 3MXIA 5GADP 5ELZA 1GLDG 2A41A 4BE2A 3IMXA 4WQ4A 5BRHA 1S22A 1H1VA 2OZMA 4O8UA 2ASMA 1I3AA 1RBRA 2KZZA 1S5JA 4BR0A 4YOVA 2HOEA 3C65A 1U49A 2F7TA 3D2FA 2CGJA 1BHLA 4FLYA 3T69A 1TUUA 5HRRA 2Q1NA 1NU0A 4B08A 5BPNA 4BG8A 3M8RA 3THYB 1T05A 2YHYA 4EHUA 1DTTA 3SJJA 3HVTA 3VQ8A 1KQSM 4GMJB 2G8WA 4IDHA 1CLQA 3VQPA 4W5QA 2BH1A 3D2EA 3CMEN 2NUBA 4KO0A 5BPLA 4ELTA 4DV6K 2CGKA 3MN6A 1ATRA 2G8KA 3CJ9A 3S9HA 5C12A 4I2QA 3PSIA 5K14A 1K8KA 3CJBA 1VSKA 2QWPA 3MWTA 4JHDA 1SUQA 5LY3A 3MEDA 4KHWA 1MWKA 5JMVA 3V9WA 3VQ5A 2HBLA 2V7ZA 3OTOK 3A5OC 2XO7A 4CVNE 2NRVA 4AILC 3C95A 4MLHA 1J5OA 4BC5A 4YOXA 2WUSA 2W40A 4EIAA 4BRQA 4M41A 3W3DA 3ZSYA 3DLHA 1NMNA 4X64K 3KIOA 4CK1A 1N6QA 5C25A 4DTMA 3M8SA 1C6VA 3TTFA 3L8BA 1VQ6N 5GAGP 3NDKA 1GLAG 2FSKA 4OKKA 3O8MA 4N56A 4CBWA 3K9KA 4G1QA 3ZT2A 5AZJB 4UQGA 2IAJA 4E0DA 4N41A 2E8AA 2ZE2A 3UKRB 2QA4N 2P1JA 4BDYA 1HQEA 3CHWA 4K42A 4C8LA 5AFUH 1HQUA 1T3VA 2FSNA 1W97L 3AVNA 3MECA 1HX1A 2D0PA 1VAZA 1HMVA 3P38A 2ITMA 4U7BA 4FM1A 4J8FA 1TKDA 4GY2B 5BR9A 4ID5A 3N4QA 1BA0A 1JLCA 3LWMA 1DT9A 1SKRA 1BCMA 3OYKA 3K5NA 1X9MA 2IVPA 3OYMA 5J2MA 2G8IA 2D0OA 3ZSVA 3D2EB 4FVUA 4O5BA 3NF7A 1UA0A 1JXBA 3WXJA 2E6LA 4DG1A 3G25A 4A5BA 2P9KA 2KFZA 4I7FA 1IKYA 4RW7A 2EWSA 2D0BA 4DS4A 2G8HA 3S41A 5SWMA 3UIQA 4J2EA 2F96A 3MN5A 1U45A 3LM9A 4KV8A 1C1AA 4KREA 3VQ7A 4JYAK 3AVBA 4RCHA 3D0PA 4CJLA 3F9MA 1WUAA 3CC4N 3CCJN 2YCHA 1JKHA 1Z25A 4QS8A 3EYZA 1C0FA 5HL7L 3MN9A 1S6QA 1KXPA 4ELVA 3PLAA 1MDUB 4BREA 1WB9A 2GX9A 4M3TA 3AO4A 3WNGA 1XNRK 5A2QO 3V4IA 5CZ2A 3GDQA 5AQRA 4B1UB 1C0GA 3Q7CA 3QBXA 1DTQA 4GV6A 4K43A 4WFAL 5AQVA 1L3UA 4J2DA 4IKFA 1BOTO 1LW0A 3A2FA 3UKUA 3FGUA 1WLJA 1P90A 3T3FA 1N32K 3C0BA 3SMPA 3VEZA 3DMJA 3VA3A 4BC3A 3WQUA 1Z26A 1KFDA 4FWQA 1QE1A 2ATQA 4BC4A 1C1BA 1ZBUA 1V4SA 4IWVA 1YUWA 4CFCA 3HOSA 4M3WA 4LSLA 3KLIA 2UU9K 4Z94A 1SZ2A 1EWQA 2UXDK 3C7NA 3L2RA 4KH6A 3KK2A 1EO1A 3THVA 2KZMA 5AQGA 3C6UA 4OLAA 4H5WA 1VSFA 1L3TA 4CIGA 4CGDA 5ADXA 4DR6K 3HRGA 3K5LA 3R9PA 4MO4A 3O4WA 4JLHA 4B9SA 4EP5A 2QK9A 2XY7A 4K8XA 4CHOA 2E2NA 2ZGYA 2YHAA 4IFYA 2P9KB 4DTPA 4F2RA 4I6MA 4LF4K 3CJCA 3OVNA 1CXQA 4NCGA 4LH5A 2A1RA 4CEAA 4DR4K 2PYJA 1SKWA 5AQLA 2FBYA 1TV6A 2IIRA 4KTWA 5CE3A 4N76A 3N4PA 3C6TA 3P4IA 4CJ3A 4CZLA 4LY7A 2ZJQL 3O1WA 5LJWA 2LSNA 2KFNA 4H0TB 1VSMA 4DSFA 2EX3A 1R59O 4FO0A 3MN7A 3HZ6A 1SL2A 4W5TA 2AP1A 4YNQA 4CZMA 2YHXA 1RCHA 3SMSA 5F1XA 1ZC6A 3DXMA 3QLHA 1TKTA 3V6DA 5SZTA 1Y97A 1N34K 3ZETA 2XY5A 2XHBA 1SAZA 4AM6A 2W6KA 3DLKA 1WSIA 3JS6A 5AQNA 2P9PB 1NOZA 1U4BA 3VQDA 1GLCG 3QMLA 2HHSA 3FFIA 3T1HK 5BPMA 3ENOA 4BRIA 4OGEA 1VQ8N 5AQZA 3L3VA 5FRNA 3THWB 1O13A 3QNOA 1VQ9N 3PIOL 1YVUA 1IKWA 3LWLA 1QZ6A 4FJ5A 1WAJA 3PSFA 1NJWA 1F21A 4JKCA 2FLOA 3IFRA 4CHQA 1VQLN 2Q0RA 4FJGA 2P9NA 1RDDA 3LDNA 2QTDA 5M1PA 3C7NB 4CJWA 1QSSA 2F4VK 3KWIA 3R6MA 3KK7A 4CBXA 5CYMA 2HNDA 2HVHA 4HUEA 1LW2A 1S9GA 1RTDA 3B6OA 4N47A 1TK8A 3OBYA 3ZCMA 1RT3A 1A5VA 4JK8A 3H46O 4H5VA 2XY8A 2Y1JA 3RRGA 1NJZA 4DQIA 5KTQA 3CCMN 1KFSA 4GV3A 2JGUA 2JWLA 4CZIA 5IWAK 4KTZA 3H3NO 3JSMA 1ZBHA 3I0RA 1GLLO 5AQTA 5E26A 1NGCA 2GBZA 3I33A 1EETA 3A5NC 4M7XA 2G8FA 1TVRA 2CH5A 4DV5K 4M3ZA 2F8TA 3AVCA 4KTQA 3E01A 3V9ZA 3SQ2A 3LDOA 1N8RO 3AVIA 5J1EA 3HP6A 4OPJA 3SQ0A 4ILHA 3VGKA 4M3XA 5JVHL 5GAEP 2UUBK 1NKEA 4YOYA 3L3UA 1W2BM 3DRRA 4CK3A 4ZHRA 1XMOK 1U47A 3L6QA 3MAQA 1HR0K 2O8BA 4RW9A 4CJQA 4DHYA 3NVKA 1U2VA 3PX4A 1EP4A 1VQ5N 4CF0A 2YKMA 3VF4A 2E4LA 2QXFA 4LC9B 3LPTA 4ID1A 3RWUA 4IFVA 2F8SA 3CFRA 3OJUA 4JRPA 2DTUA 3RTVA 1J54A 4WE1A 4IG0A 4Z0UA 1G99A 1ZBIA 5CYQA 1YITN 4CIEA 3AA3A 3RVCA 3VA0A 5HBMA 2O8EA 3CI5A 1IBKK 4AH9A 3PY8A 4FLVA 3ZEUA 3TSQA 2NRTA 2D0CA 4TSXA 4CD1A 4FL9A 2BANA 5J2QA 1WSGA 4B9UA 5FRMA 4NXMK 2RF2A 4CEDA 2O8DA 4OVLA 4H4MA 1YIJN 3OBWA 2HHWA 3F5TA 4AF1A 4GV9A 4AM7A 3SNNA 2Q36A 1T03A 3OW2M 3VGLA 3BY5A 3VESA 4FWSA 4JKBA 4BRFA 4FLXA 2DPNA 4FOEA 2DY4A 1FKPA 3TWHA 3L4IA 4LFCK 4M45A 4B1XB 2YI1A 3ZSWA 4BGAA 1ESVA 2I7NA 1IKVA 3VQ9A 4E7LA 4KPYA 4H8KA 1VSIA 4B9VA 3AA4A 4FCYA 1DGKN 4B3OA 1HLUA 4IZ9A 3U8XA 4IEEA 3TAPA 5KQDA 3SV4A 4E3SA 4KI4A 4KHSA 2NRRA 3VENA 3THYA 3VQBA 3MCAB 3TSPA 3AO5A 4FJHA 1NGJA 1IH7A 3OYGA 3HM8A 4M42A 3VEWA 3DLGA 2YHBA 3E1YA 1HKGA 2OPQA 2ZQBA 4KBOA 1KRPA 4FJ8A 4C8OA 4QCLA 4OX9K 4HVJA 1A5XA 5BRFA 2IDOA 3SPZA 1T6DA 3IDHA 3VEYA 3OYBA 4I9QA 3P31A 3L0QA 3JYTA 3SBTA 3AO2A 1QS4A 3MK6A 5GINA 2QKKA 3CFOA 2PFUA 3M1FA 3TTDA 3EZWA 1HYSA 4B9MA 1S1XA 3AY9A 5EOYA 5EX5A 4MLEA 3TPQA 3OY9A 1KAYA 3S3OA 5AQJA 4BE0A 4MO5A 5M1QA 3M3ZA 2HVIA 1FXXA 3DOKA 4W5NA 3SUNA 4PKHA 4BRHA 5MLCQ 4CZEA 2FF6A 3MDQA 3ZSZA 1WOQA 1BIUA 4BDZA 3AVAA 3ZX2A 1KSPA 3IS9A 3KZBA 4BR5A 4DV0K 1XHXA 1QHAA 3SAHA 3ZT4A 4CJRA 4H5TA 4YY3K 4O0IA 1RNHA 3TAGA 5AZJA 2IVOA 4GVMA 3BF1A 4BROA 1NJYA 3LZIA 3UKRA 2A5XA 2BTFA 1LV5A 1QZ5A 5F0XA 3SPYA 3ISNC 2YX6A 3VTIA 5I42A 4B9TA 3WQTA 3OYJA 4CJVA 1P8ZA 2ASOA 1RILA 3AGRA 1VSLA 3O4NA 1Z05A 3K5MA 2QW9A 3PIPL 5M1KA 4CECA 4IOCL 1Q8IA 4CGJA 4DU1A 3VERA 1OVYA 3DJCA 4FJLA 3AVGA 4V19S 2WOMA 1GLFO 3C94A 4HCBA 3LALA 2HHXA 1TK0A 2P5GA 1ATSA 1RTIA 3AA5X 3AVKA 4DU4A 2BDPA 3IAYA 4IJNA 5AQYA 2HHUA 2JLEA 3ATUA 3MMVA 4B9QA 5HRSA 3U3GA 4ZTJA 1YXQA 2FBVA 3QICA 4F8RA 1U04A 1TAUA 3G0ZA 3RRHA 1XC9A 4B9LA 4FZYA 4KRFA 2QEXN 4CEBA 2FXUA 4FJKA 4O44A 5M1FA 4FW2A 3VOVA 4CJSA 3EE9A 2OTJN 3M8QA 1NWKA 1TAQA 4JS5A 4FWRA 3V1OA 4BRDA 2Q2RA 4HTLA 4EZ9A 2FSJA 1OH7A 4HTUA 2QWRA 4JAXA 3H3OB 3EZ5A 1RT2A 1KAZA 5JVGL 4KH4A 3DOLA 2OPRA 4CJ5A 3GOIA 5C2FA 3HK2A 1N36K 1Q82O 1HUXA 2F9TA 4RW6A 5AZIB 1NGGA 4A59A 1K8AO 5KI6A 4JK7A 4LH4A 4F2SA 3SCXA 2D1KA 4H4OA 3EE8A 1ZBSA 3AARA 4CF8A 2RN2A 3QIOA 3CG7A 5HOOA 1M90O 4QAGA 2O8FB 4BRPA 2A6AA 4B8CA 1NLVA 5AJ3K 1FK9A 4FW1A 1VQNN 2YJFA 3MEEA 1TKXA 3AVHA 3EEQA 4XEIA 4CF2A 3LAKA 3CCEN 4Y0WA 1HYZA 1W9HA 3SI6A 3HPGA 5FPMA 4DTJA 4CZKA 5ADXH 4KB1A 2DFHA 4PQUA 3CJ7A 1VQ4N 4MQ3A 4H0XB 3I8DA 4FWLA 1I39A 3O9RA 3CJAA 4CHPA 3CPWM 3TI0A 3QEVA 4X66K 4Q5VA 4CEOA 2R7YA 4BACA 5FPDA 3PO4A 1VQ7N 3E9PA 5AQQA 3L2UA 1JLAA 3VEOA 2PBDA 4E1JA 2A1SA 4EZ6A 1IJJA 4EP4A 1BL3A 5C15A 3ZYYX 4EHTA 1B9DA 1CZ9A 3BZKA 1XUPO 2EHGA 3A5MC 3O6WA 4IOAL 1B9FA 3FE1A 2RHKA 5C42A 1NK6A 1HKCA 3ENHA 3MX2A 5C24A 1S3XA 4PA1A 4M3YA 4DV7K 3NH0A 4CW7B 2Q3SA 1KVBA 1C1CA 4DUZK 1WNSA 1TL3A 2VWKA 5JICA 3HSCA 1EXQA 1Q9YA 4JN4A 1NK9A 5JLFA
chains in the Genus database with same CATH topology
2DFFA 1F21A 3OYAA 2O4GA 1XI1A 2HMIA 1BGXT 1JL2A 4CHQA 2YNIA 4DFJA 1RDDA 3G10A 1C0TA 1RTHA 1XWLA 2YNFA 4FJGA 4Z4IA 3K59A 1NK5A 4Z4GA 1TGOA 4CJWA 1QSSA 1HPZA 3CFPA 4DQSA 3TARA 4RW4A 2BE2A 4Y1CA 4M3RA 4FJ8A 4QCLA 1GOCA 4HUFA 5CYMA 2HNDA 2PYLA 1UA1A 1A5WA 4W5OA 3NF8A 4CEZA 2HVHA 3IG1A 3CYMA 4KKOA 3AO1A 1S1UA 4HUEA 1KLMA 1LW2A 1S9GA 1N5YA 1RT6A 4FYDA 1ZYQA 3B6OA 4N47A 1TL1A 1RTDA 1TK8A 3RR8A 3ZCMA 2FC0A 3VQEA 2OPSA 1RT3A 1A5VA 4BWJA 4CGIA 1NOYA 3HT3A 2XY8A 2Y1JA 3RRGA 4AHSA 1NJZA 4DQIA 4E7HA 3DI6A 4DTSA 1HYVA 5KTQA 5J2NA 1VSDA 3WNHA 1W0HA 4CF9A 3QERA 1KFSA 4Z4EA 2JGUA 4GW6A 4FLZA 4KTZA 3JSMA 1ZBHA 4ELUA 3DRPA 3RMCA 4C8NA 3SUOA 1SL1A 1IG9A 1VK0A 3I0RA 3AVFA 2Z1HA 2GBZA 3HPHA 5CZ1A 1EETA 4FM0A 3KJVA 4DQRA 4OGCA 2ETJA 4AHVA 4Y1DA 3V9XA 3LANA 2G8FA 1TVRA 3S3NA 4M3UA 2HHTA 4M3ZA 4FK2A 1VRUA 3SUQA 3P5JA 4I2PA 2X78A 1R0AA 4HCCA 2F8TA 3AVCA 3QESA 3NGZA 3E01A 3V9ZA 3SQ2A 1TK5A 4KTQA 4DQQA 2AJQA 3KKRA 3LP0A 3AVIA 2VG7A 5J1EA 3HP6A 1X9SA 4OPJA 3SQ0A 4KAZA 2B6AA 1RBTA 2XY6A 4M3XA 4IDKA 3KLGA 3TAMA 3NH2A 1NKBA 1S1TA 4RW8A 1J53A 4CFDA 4FJ9A 3LDSA 3RR7A 3P83D 3VQAA 3F73A 1LWEA 3WNEA 1NKEA 4QOZB 1NK7A 1X9WA 3L3UA 5T7BA 1HNIA 1NKCA 3DRRA 3QINA 4ZHRA 4CK3A 3NCIA 3MAQA 4DTUA 4DF8A 1U47A 4KHUA 3DYAA 4RW9A 4DTNA 4CJQA 4KI6A 3AVLA 1QTMA 2QKBA 1D9DA 1HRHA 4BDPA 1RT7A 3OYHA 4KB0A 3MXJA 4PY5A 4KHNA 4PWDA 3PX4A 3KKSA 1EP4A 2VWJA 3NE6A 2G8UA 4CF0A 2YKMA 4K8ZA 2E4LA 4F3OA 2QXFA 3LPTA 3RMAA 4ID1A 4CGFA 4CJTA 3RWUA 2FBTA 2X6NA 4IFVA 4CHZA 4AHRA 4DFMA 2F8SA 3CFRA 2KW4A 3TAQA 3AV9A 3OJUA 4JRPA 2DTUA 5KGWA 3L2QA 3RTVA 4FJJA 2GV9A 3OS0A 3ITHA 3DLEA 1J54A 4WE1A 1D8YA 4IG0A 4Z0UA 4ICLA 3SQ4A 3MXIA 3QEIA 1ZBIA 5CYQA 3V1RA 4CIEA 3AA3A 3VA0A 5HBMA 4IBNA 4J2AA 4AH9A 1S1WA 2IC3A 4CJ4A 4BE2A 4FLVA 3PY8A 3I0SA 4CEFA 2D0CA 1LWCA 3NBPA 4TSXA 4FLWA 2OPPA 3AVJA 2OZMA 5KGXA 1YTUA 3LPUA 2BANA 1I3AA 5J2QA 1WSGA 4CJEA 4B9UA 5FRMA 1RBRA 2RF2A 4CEDA 4OVLA 1S5JA 4H4MA 3HM9A 4FJXA 2KZZA 3CQ8A 3K5OA 1ZBLA 2HHWA 1WN7A 4IG3A 3SNNA 1U49A 4FVMA 4DS5A 1T03A 1J9AA 3V1QA 3BGRA 1BHLA 4FLYA 3F9KA 1WSHA 3KLFA 5HRRA 3QEXA 4OKEA 1X1PA 3SQ1A 4W5RA 4B08A 1T05A 3M8RA 4FLXA 1T7PA 4KFBA 4CHNA 1NK8A 3DM2A 2DY4A 1QSYA 1FKPA 3TWHA 1DTTA 1ASUA 3MEGA 4CJFA 4M45A 3OYEA 3HP9A 1WSEA 3S3MA 3ZSWA 2VG6A 3HVTA 3SJJA 3VQ8A 3PV8A 4GMJB 2G8WA 3HJFA 2KTQA 1IKVA 2WONA 1CLQA 3VQ9A 3VQPA 5HROA 3ZSXA 4NYNA 4W5QA 4E7LA 1RDAA 4CIFA 3OYFA 3O3FA 4KPYA 2NUBA 4H8KA 4CERA 1BQMA 2B5JA 1VSIA 4KO0A 4B9VA 4ELTA 2Z1JA 3AA4A 5E41A 2G8KA 4FCYA 2O4IA 4B3OA 4CESA 4FLTA 3S9HA 4I2QA 1MU2A 4DLGA 3QEWA 4DMNA 5K14A 3TAPA 3OJSA 2D5RA 1SV5A 3SV4A 1O1WA 3QEPA 1D5AA 1HNVA 1VSKA 1WAFA 4E3SA 4KI4A 1ZBFA 4KHSA 3VQBA 1SUQA 4CFBA 3OYLA 4FJNA 3MEDA 3OS1A 3K58A 4KHWA 2HNYA 3AO5A 3ZSRA 4FJHA 3V9WA 4E19A 3VQ5A 1IH7A 3OYGA 1G15A 4HHTA 4M42A 2XO7A 3DLGA 2YHBA 1REVA 4LD0A 1C0UA 2Z1IA 4DU3A 1XHZA 4AILC 1LWFA 3OS2A 2OPQA 2ZQBA 4R5PA 1BI4B 3KLHA 1KRPA 3C95A 1J5OA 1BIZA 1FKOA 4C8OA 4DQPA 3TR8A 2D0AA 4HVJA 3ULDA 1A5XA 2IDOA 3SPZA 2HHQA 1L3SA 1ASWA 3OYBA 4I9QA 1BCOA 1NK4A 4FK0A 2FBXA 4M41A 3JYTA 3LZJA 4E1MA 3AO2A 1QS4A 3ZSYA 2QKKA 3DLHA 3CFOA 3O4QA 4DSJA 3KD1E 4AHUA 2OYQA 3TAEA 5DMRA 3KIOA 4F4KA 4CK1A 1N6QA 5C25A 3V9UA 4DTMA 3M8SA 3DLRA 3HPOA 3KD5E 1L3VA 1C6VA 3L8BA 1HYSA 4B9MA 1S1XA 4PUOA 3NDKA 4CK2A 4OKKA 3NF6A 4N56A 3OYDA 1EKEA 3QIPA 1NK9A 4G1QA 3LP2A 4Z4CA 1YTAA 1BI4A 2YNHA 3ZT2A 4UQGA 3OY9A 2IAJA 3S3OA 4E0DA 4BE0A 4N41A 2XRIA 2ZE2A 4FK4A 1VSJA 4LSNA 4NYFA 4FJ7A 2HVIA 1RT5A 2P1JA 1FXXA 3VQQA 4BDYA 3DOKA 1HQEA 1RDCA 3CM5A 3M8PA 4W5NA 4C8LA 3SUNA 3HXMA 1HQUA 3ZSZA 3TANA 3L2VA 3AVNA 3MECA 4BWMA 1BIUA 4BDZA 5HP1A 3AVAA 4FZXC 2HHVA 4DTXA 5HRPA 4FJMA 4CJKA 1HMVA 1KSPA 3IS9A 4FM1A 1XHXA 2YV0X 3AA2A 1TKDA 3ZSQA 1S6PA 3ZT4A 4CJRA 1ASVA 2RKIA 4ID5A 3DLBA 4FJIA 1JLCA 3LWMA 1SKRA 1DLOA 1IO2A 1BCMA 3AVMA 4O0IA 1RNHA 2DFEA 3OYKA 3K5NA 1IKXA 3NH1A 5J2MA 3OYMA 3TAGA 1SKSA 3NGYA 2G8IA 4GVMA 2Z1GA 1SL0A 3VQ4A 3ZSVA 4E1NA 3LZIA 1NJYA 2YKNA 3LP3A 3V9SA 4O5BA 1LV5A 4E7IA 3ISNC 3SPYA 3CM6A 3K2PA 3NF7A 5I42A 1JXBA 1UA0A 3OYJA 4B9TA 2E6LA 2IGIA 4CJVA 4DG1A 2BGGA 1GOBA 3O3GA 1JXEA 4L8RB 1RILA 3LAMA 2KFZA 4I7FA 1IKYA 1VSLA 3V81A 4RW7A 3B6PA 3O4NA 2D0BA 4DS4A 1EX4A 3K5MA 2GUIA 5I3UA 2G8HA 5SWMA 4CECA 4DWIA 3UIQA 4J2EA 3HYFA 1VSEA 1Q8IA 2F96A 4CGJA 4DLEA 4DU1A 1TKZA 4FJLA 4E89A 3AVGA 1U45A 3NF9A 4KV8A 2WOMA 2VG5A 3C94A 4HCBA 3LALA 2HHXA 4CGGA 1TK0A 4CEEA 4DFPA 2P5GA 1C1AA 3KK1A 3QETA 3SUPA 4KREA 3VQ7A 1RTIA 3AA5X 3AVKA 3AVBA 4I9LA 4DU4A 4CCHA 5D3GA 4O0JA 3T1AA 3D0PA 2BDPA 1YT3A 4CJLA 3NGIA 3IAYA 4DSIA 2E6MA 2HHUA 3KLEA 1RBUA 2JLEA 1NJXA 1JKHA 1Z25A 4KHQA 5HRSA 3U3GA 3P1GA 3EYZA 3U3YA 4ZTJA 2FBVA 4AHTA 4E7JA 4F8RA 1S6QA 4Z4FA 1U04A 4ELVA 1WSFA 4NCBA 1CZBA 3O3HA 1TAUA 3G0ZA 3RRHA 1XC9A 1KLNA 4B9LA 4FZYA 3AO4A 3WNGA 4CEBA 4M3TA 2YNGA 4KRFA 2IS3A 4FJKA 3V4IA 4O44A 3OYNA 3ZT0A 3SZ2A 5CZ2A 3HSTB 3ZSOA 1UOCA 4FW2A 4CJSA 3RMBA 4KHYA 1RBSA 3M8QA 1KVCA 1TAQA 4JS5A 4JRQA 2P5OA 2OZSA 2X6SA 1S9EA 3V1OA 4XIUA 1DTQA 4FZZA 2X74A 1KVAA 4EZ9A 3EY1A 4HTUA 1L3UA 4J2DA 5JS2A 4CGHA 4IKFA 5FDLA 4BE1A 1LW0A 3A2FA 3VN5A 2PY5A 4NCAA 3T3FA 1WLJA 3BDPA 3EZ5A 2PZSA 1RT2A 5J2PA 4C8KA 3DMJA 3RMDA 3VA3A 1Z26A 1KFDA 3DOLA 2IOCA 3QO9A 4CE9A 2OPRA 1NK0A 3KTQA 4CJ5A 2ATQA 1QE1A 1LAWA 3HK2A 1C1BA 3KK3A 1RBVA 4E7KA 4B9NA 1ZBUA 4F3TA 4RW6A 4CJPA 4CFCA 4M3WA 4MFBA 4LSLA 3T19A 1U48A 1X9MA 3KLIA 5KI6A 4ZTFA 4LH4A 2OA8A 3IRXA 4F2SA 1LAVA 3SCXA 4H4OA 3L2RA 4CF8A 2RN2A 3KK2A 3QIOA 2ITGA 3TAFA 3QNNA 1QSLA 3CG7A 3THVA 3LP1A 5DK5A 1QQCA 1BQNA 4C8MA 4QAGA 2KZMA 4OKJA 3C6UA 2RPIA 4OLAA 3NFAA 3PX6A 3L2WA 1VSFA 3H08A 4DTRA 1L3TA 4B8CA 4CIGA 5CY4A 1WSJA 4CGDA 4OLBA 1FK9A 1QHTA 3K5LA 1GOAA 4FW1A 3MEEA 1TKXA 3AVHA 4O55A 4CF2A 4AHCA 1RT1A 3LAKA 4JLHA 3WNFA 4EP5A 1HYZA 4YFUA 4B9SA 2QK9A 2XY7A 4K8XA 4CHOA 4Q0BA 1W9HA 2YHAA 4IFYA 4DSLA 3SI6A 2I5JA 1JLBA 1KCFA 3HPGA 5KRTA 3PX0A 4DTJA 4DTPA 1D9FA 4F2RA 4KB1A 2DFHA 1RDBA 4PQUA 1JLEA 3OVNA 3PO5A 1CXQA 4LH5A 4MQ3A 4NCGA 4CEAA 3I8DA 2HNZA 2A1RA 1I39A 5JS1A 4CHPA 3K57A 4FM2A 2PYJA 4CHYA 1SKWA 5HRNA 4OPKA 2FBYA 3SV3A 1TV6A 3ASMA 4KTWA 4DSEA 3QEVA 3TI0A 3MXMA 1L5UA 1HJRA 4N76A 4CJ3A 3C6TA 4Q5VA 5EU7A 4LY7A 1JLQA 3ZT1A 4CEOA 2LSNA 2ZD1A 4JS4A 2KFNA 3U6FA 2R7YA 1VSHA 4CF1A 5HLFA 1JLFA 1ITGA 3ALYA 4BACA 3PO4A 1VSMA 4DSFA 2EX3A 3D45A 4CEQA 3HO1A 3L2UA 1JLAA 1VRTA 2P51A 4FLUA 1SL2A 4DSKA 4FXDA 4B8AB 4W5TA 2A1SA 4EZ6A 4EP4A 1BL3A 4YNQA 1RCHA 4DTOA 2HW3A 1B9DA 4HUGA 2KQ2A 4DF4A 1T8EA 1CZ9A 1UAXA 1TKTA 3QLHA 4O4GA 4J2BA 3V6DA 5FROA 1S1VA 1RTJA 3HVRA 4N5SA 2EHGA 5SZTA 1Y97A 4Z4HA 1JL1A 2XY5A 1CXUA 4CFAA 4CJUA 2XHBA 1RT4A 1B9FA 3AO3A 3DLKA 2B4JA 1WSIA 5C42A 1NOZA 3HL8A 3NHGA 3ZT3A 1C0MA 3NAEA 1NK6A 1U4BA 3VQDA 1B92A 5C24A 3OYCA 2HHSA 3FFIA 4PA1A 2W42A 4M3YA 4OJRA 3VQCA 1Q9XA 1UWBA 3NH0A 2Y1IA 1BISA 4OGEA 2Q3SA 4RG8A 1KVBA 1C1CA 3TABA 3L3VA 1WNSA 1K6YA 1TL3A 3PUFA 3OYIA 2VWKA 3DRSA 3QNOA 5FRNA 1YVUA 5KRSA 1IKWA 1EXQA 3LWLA 4DFKA 1Q9YA 4FJ5A 3SYZA 2HB5A 1KTQA 1WAJA 3VQ6A 1JLGA 1NJWA 2G8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFF A;  1F21 A;  3OYA A;  2O4G A;  1XI1 A;  2HMI A;  1BGX T;  1JL2 A;  4CHQ A;  2YNI A;  4DFJ A;  1RDD A;  3G10 A;  1C0T A;  1RTH A;  1XWL A;  2YNF A;  4FJG A;  4Z4I A;  3K59 A;  1NK5 A;  4Z4G A;  1TGO A;  4CJW A;  1QSS A;  1HPZ A;  3CFP A;  4DQS A;  3TAR A;  4RW4 A;  2BE2 A;  4Y1C A;  4M3R A;  4FJ8 A;  4QCL A;  1GOC A;  4HUF A;  5CYM A;  2HND A;  2PYL A;  1UA1 A;  1A5W A;  4W5O A;  3NF8 A;  4CEZ A;  2HVH A;  3IG1 A;  3CYM A;  4KKO A;  3AO1 A;  1S1U A;  4HUE A;  1KLM A;  1LW2 A;  1S9G A;  1N5Y A;  1RT6 A;  4FYD A;  1ZYQ A;  3B6O A;  4N47 A;  1TL1 A;  1RTD A;  1TK8 A;  3RR8 A;  3ZCM A;  2FC0 A;  3VQE A;  2OPS A;  1RT3 A;  1A5V A;  4BWJ A;  4CGI A;  1NOY A;  3HT3 A;  2XY8 A;  2Y1J A;  3RRG A;  4AHS A;  1NJZ A;  4DQI A;  4E7H A;  3DI6 A;  4DTS A;  1HYV A;  5KTQ A;  5J2N A;  1VSD A;  3WNH A;  1W0H A;  4CF9 A;  3QER A;  1KFS A;  4Z4E A;  2JGU A;  4GW6 A;  4FLZ A;  4KTZ A;  3JSM A;  1ZBH A;  4ELU A;  3DRP A;  3RMC A;  4C8N A;  3SUO A;  1SL1 A;  1IG9 A;  1VK0 A;  3I0R A;  3AVF A;  2Z1H A;  2GBZ A;  3HPH A;  5CZ1 A;  1EET A;  4FM0 A;  3KJV A;  4DQR A;  4OGC A;  2ETJ A;  4AHV A;  4Y1D A;  3V9X A;  3LAN A;  2G8F A;  1TVR A;  3S3N A;  4M3U A;  2HHT A;  4M3Z A;  4FK2 A;  1VRU A;  3SUQ A;  3P5J A;  4I2P A;  2X78 A;  1R0A A;  4HCC A;  2F8T A;  3AVC A;  3QES A;  3NGZ A;  3E01 A;  3V9Z A;  3SQ2 A;  1TK5 A;  4KTQ A;  4DQQ A;  2AJQ A;  3KKR A;  3LP0 A;  3AVI A;  2VG7 A;  5J1E A;  3HP6 A;  1X9S A;  4OPJ A;  3SQ0 A;  4KAZ A;  2B6A A;  1RBT A;  2XY6 A;  4M3X A;  4IDK A;  3KLG A;  3TAM A;  3NH2 A;  1NKB A;  1S1T A;  4RW8 A;  1J53 A;  4CFD A;  4FJ9 A;  3LDS A;  3RR7 A;  3P83 D;  3VQA A;  3F73 A;  1LWE A;  3WNE A;  1NKE A;  4QOZ B;  1NK7 A;  1X9W A;  3L3U A;  5T7B A;  1HNI A;  1NKC A;  3DRR A;  3QIN A;  4ZHR A;  4CK3 A;  3NCI A;  3MAQ A;  4DTU A;  4DF8 A;  1U47 A;  4KHU A;  3DYA A;  4RW9 A;  4DTN A;  4CJQ A;  4KI6 A;  3AVL A;  1QTM A;  2QKB A;  1D9D A;  1HRH A;  4BDP A;  1RT7 A;  3OYH A;  4KB0 A;  3MXJ A;  4PY5 A;  4KHN A;  4PWD A;  3PX4 A;  3KKS A;  1EP4 A;  2VWJ A;  3NE6 A;  2G8U A;  4CF0 A;  2YKM A;  4K8Z A;  2E4L A;  4F3O A;  2QXF A;  3LPT A;  3RMA A;  4ID1 A;  4CGF A;  4CJT A;  3RWU A;  2FBT A;  2X6N A;  4IFV A;  4CHZ A;  4AHR A;  4DFM A;  2F8S A;  3CFR A;  2KW4 A;  3TAQ A;  3AV9 A;  3OJU A;  4JRP A;  2DTU A;  5KGW A;  3L2Q A;  3RTV A;  4FJJ A;  2GV9 A;  3OS0 A;  3ITH A;  3DLE A;  1J54 A;  4WE1 A;  1D8Y A;  4IG0 A;  4Z0U A;  4ICL A;  3SQ4 A;  3MXI A;  3QEI A;  1ZBI A;  5CYQ A;  3V1R A;  4CIE A;  3AA3 A;  3VA0 A;  5HBM A;  4IBN A;  4J2A A;  4AH9 A;  1S1W A;  2IC3 A;  4CJ4 A;  4BE2 A;  4FLV A;  3PY8 A;  3I0S A;  4CEF A;  2D0C A;  1LWC A;  3NBP A;  4TSX A;  4FLW A;  2OPP A;  3AVJ A;  2OZM A;  5KGX A;  1YTU A;  3LPU A;  2BAN A;  1I3A A;  5J2Q A;  1WSG A;  4CJE A;  4B9U A;  5FRM A;  1RBR A;  2RF2 A;  4CED A;  4OVL A;  1S5J A;  4H4M A;  3HM9 A;  4FJX A;  2KZZ A;  3CQ8 A;  3K5O A;  1ZBL A;  2HHW A;  1WN7 A;  4IG3 A;  3SNN A;  1U49 A;  4FVM A;  4DS5 A;  1T03 A;  1J9A A;  3V1Q A;  3BGR A;  1BHL A;  4FLY A;  3F9K A;  1WSH A;  3KLF A;  5HRR A;  3QEX A;  4OKE A;  1X1P A;  3SQ1 A;  4W5R A;  4B08 A;  1T05 A;  3M8R A;  4FLX A;  1T7P A;  4KFB A;  4CHN A;  1NK8 A;  3DM2 A;  2DY4 A;  1QSY A;  1FKP A;  3TWH A;  1DTT A;  1ASU A;  3MEG A;  4CJF A;  4M45 A;  3OYE A;  3HP9 A;  1WSE A;  3S3M A;  3ZSW A;  2VG6 A;  3HVT A;  3SJJ A;  3VQ8 A;  3PV8 A;  4GMJ B;  2G8W A;  3HJF A;  2KTQ A;  1IKV A;  2WON A;  1CLQ A;  3VQ9 A;  3VQP A;  5HRO A;  3ZSX A;  4NYN A;  4W5Q A;  4E7L A;  1RDA A;  4CIF A;  3OYF A;  3O3F A;  4KPY A;  2NUB A;  4H8K A;  4CER A;  1BQM A;  2B5J A;  1VSI A;  4KO0 A;  4B9V A;  4ELT A;  2Z1J A;  3AA4 A;  5E41 A;  2G8K A;  4FCY A;  2O4I A;  4B3O A;  4CES A;  4FLT A;  3S9H A;  4I2Q A;  1MU2 A;  4DLG A;  3QEW A;  4DMN A;  5K14 A;  3TAP A;  3OJS A;  2D5R A;  1SV5 A;  3SV4 A;  1O1W A;  3QEP A;  1D5A A;  1HNV A;  1VSK A;  1WAF A;  4E3S A;  4KI4 A;  1ZBF A;  4KHS A;  3VQB A;  1SUQ A;  4CFB A;  3OYL A;  4FJN A;  3MED A;  3OS1 A;  3K58 A;  4KHW A;  2HNY A;  3AO5 A;  3ZSR A;  4FJH A;  3V9W A;  4E19 A;  3VQ5 A;  1IH7 A;  3OYG A;  1G15 A;  4HHT A;  4M42 A;  2XO7 A;  3DLG A;  2YHB A;  1REV A;  4LD0 A;  1C0U A;  2Z1I A;  4DU3 A;  1XHZ A;  4AIL C;  1LWF A;  3OS2 A;  2OPQ A;  2ZQB A;  4R5P A;  1BI4 B;  3KLH A;  1KRP A;  3C95 A;  1J5O A;  1BIZ A;  1FKO A;  4C8O A;  4DQP A;  3TR8 A;  2D0A A;  4HVJ A;  3ULD A;  1A5X A;  2IDO A;  3SPZ A;  2HHQ A;  1L3S A;  1ASW A;  3OYB A;  4I9Q A;  1BCO A;  1NK4 A;  4FK0 A;  2FBX A;  4M41 A;  3JYT A;  3LZJ A;  4E1M A;  3AO2 A;  1QS4 A;  3ZSY A;  2QKK A;  3DLH A;  3CFO A;  3O4Q A;  4DSJ A;  3KD1 E;  4AHU A;  2OYQ A;  3TAE A;  5DMR A;  3KIO A;  4F4K A;  4CK1 A;  1N6Q A;  5C25 A;  3V9U A;  4DTM A;  3M8S A;  3DLR A;  3HPO A;  3KD5 E;  1L3V A;  1C6V A;  3L8B A;  1HYS A;  4B9M A;  1S1X A;  4PUO A;  3NDK A;  4CK2 A;  4OKK A;  3NF6 A;  4N56 A;  3OYD A;  1EKE A;  3QIP A;  1NK9 A;  4G1Q A;  3LP2 A;  4Z4C A;  1YTA A;  1BI4 A;  2YNH A;  3ZT2 A;  4UQG A;  3OY9 A;  2IAJ A;  3S3O A;  4E0D A;  4BE0 A;  4N41 A;  2XRI A;  2ZE2 A;  4FK4 A;  1VSJ A;  4LSN A;  4NYF A;  4FJ7 A;  2HVI A;  1RT5 A;  2P1J A;  1FXX A;  3VQQ A;  4BDY A;  3DOK A;  1HQE A;  1RDC A;  3CM5 A;  3M8P A;  4W5N A;  4C8L A;  3SUN A;  3HXM A;  1HQU A;  3ZSZ A;  3TAN A;  3L2V A;  3AVN A;  3MEC A;  4BWM A;  1BIU A;  4BDZ A;  5HP1 A;  3AVA A;  4FZX C;  2HHV A;  4DTX A;  5HRP A;  4FJM A;  4CJK A;  1HMV A;  1KSP A;  3IS9 A;  4FM1 A;  1XHX A;  2YV0 X;  3AA2 A;  1TKD A;  3ZSQ A;  1S6P A;  3ZT4 A;  4CJR A;  1ASV A;  2RKI A;  4ID5 A;  3DLB A;  4FJI A;  1JLC A;  3LWM A;  1SKR A;  1DLO A;  1IO2 A;  1BCM A;  3AVM A;  4O0I A;  1RNH A;  2DFE A;  3OYK A;  3K5N A;  1IKX A;  3NH1 A;  5J2M A;  3OYM A;  3TAG A;  1SKS A;  3NGY A;  2G8I A;  4GVM A;  2Z1G A;  1SL0 A;  3VQ4 A;  3ZSV A;  4E1N A;  3LZI A;  1NJY A;  2YKN A;  3LP3 A;  3V9S A;  4O5B A;  1LV5 A;  4E7I A;  3ISN C;  3SPY A;  3CM6 A;  3K2P A;  3NF7 A;  5I42 A;  1JXB A;  1UA0 A;  3OYJ A;  4B9T A;  2E6L A;  2IGI A;  4CJV A;  4DG1 A;  2BGG A;  1GOB A;  3O3G A;  1JXE A;  4L8R B;  1RIL A;  3LAM A;  2KFZ A;  4I7F A;  1IKY A;  1VSL A;  3V81 A;  4RW7 A;  3B6P A;  3O4N A;  2D0B A;  4DS4 A;  1EX4 A;  3K5M A;  2GUI A;  5I3U A;  2G8H A;  5SWM A;  4CEC A;  4DWI A;  3UIQ A;  4J2E A;  3HYF A;  1VSE A;  1Q8I A;  2F96 A;  4CGJ A;  4DLE A;  4DU1 A;  1TKZ A;  4FJL A;  4E89 A;  3AVG A;  1U45 A;  3NF9 A;  4KV8 A;  2WOM A;  2VG5 A;  3C94 A;  4HCB A;  3LAL A;  2HHX A;  4CGG A;  1TK0 A;  4CEE A;  4DFP A;  2P5G A;  1C1A A;  3KK1 A;  3QET A;  3SUP A;  4KRE A;  3VQ7 A;  1RTI A;  3AA5 X;  3AVK A;  3AVB A;  4I9L A;  4DU4 A;  4CCH A;  5D3G A;  4O0J A;  3T1A A;  3D0P A;  2BDP A;  1YT3 A;  4CJL A;  3NGI A;  3IAY A;  4DSI A;  2E6M A;  2HHU A;  3KLE A;  1RBU A;  2JLE A;  1NJX A;  1JKH A;  1Z25 A;  4KHQ A;  5HRS A;  3U3G A;  3P1G A;  3EYZ A;  3U3Y A;  4ZTJ A;  2FBV A;  4AHT A;  4E7J A;  4F8R A;  1S6Q A;  4Z4F A;  1U04 A;  4ELV A;  1WSF A;  4NCB A;  1CZB A;  3O3H A;  1TAU A;  3G0Z A;  3RRH A;  1XC9 A;  1KLN A;  4B9L A;  4FZY A;  3AO4 A;  3WNG A;  4CEB A;  4M3T A;  2YNG A;  4KRF A;  2IS3 A;  4FJK A;  3V4I A;  4O44 A;  3OYN A;  3ZT0 A;  3SZ2 A;  5CZ2 A;  3HST B;  3ZSO A;  1UOC A;  4FW2 A;  4CJS A;  3RMB A;  4KHY A;  1RBS A;  3M8Q A;  1KVC A;  1TAQ A;  4JS5 A;  4JRQ A;  2P5O A;  2OZS A;  2X6S A;  1S9E A;  3V1O A;  4XIU A;  1DTQ A;  4FZZ A;  2X74 A;  1KVA A;  4EZ9 A;  3EY1 A;  4HTU A;  1L3U A;  4J2D A;  5JS2 A;  4CGH A;  4IKF A;  5FDL A;  4BE1 A;  1LW0 A;  3A2F A;  3VN5 A;  2PY5 A;  4NCA A;  3T3F A;  1WLJ A;  3BDP A;  3EZ5 A;  2PZS A;  1RT2 A;  5J2P A;  4C8K A;  3DMJ A;  3RMD A;  3VA3 A;  1Z26 A;  1KFD A;  3DOL A;  2IOC A;  3QO9 A;  4CE9 A;  2OPR A;  1NK0 A;  3KTQ A;  4CJ5 A;  2ATQ A;  1QE1 A;  1LAW A;  3HK2 A;  1C1B A;  3KK3 A;  1RBV A;  4E7K A;  4B9N A;  1ZBU A;  4F3T A;  4RW6 A;  4CJP A;  4CFC A;  4M3W A;  4MFB A;  4LSL A;  3T19 A;  1U48 A;  1X9M A;  3KLI A;  5KI6 A;  4ZTF A;  4LH4 A;  2OA8 A;  3IRX A;  4F2S A;  1LAV A;  3SCX A;  4H4O A;  3L2R A;  4CF8 A;  2RN2 A;  3KK2 A;  3QIO A;  2ITG A;  3TAF A;  3QNN A;  1QSL A;  3CG7 A;  3THV A;  3LP1 A;  5DK5 A;  1QQC A;  1BQN A;  4C8M A;  4QAG A;  2KZM A;  4OKJ A;  3C6U A;  2RPI A;  4OLA A;  3NFA A;  3PX6 A;  3L2W A;  1VSF A;  3H08 A;  4DTR A;  1L3T A;  4B8C A;  4CIG A;  5CY4 A;  1WSJ A;  4CGD A;  4OLB A;  1FK9 A;  1QHT A;  3K5L A;  1GOA A;  4FW1 A;  3MEE A;  1TKX A;  3AVH A;  4O55 A;  4CF2 A;  4AHC A;  1RT1 A;  3LAK A;  4JLH A;  3WNF A;  4EP5 A;  1HYZ A;  4YFU A;  4B9S A;  2QK9 A;  2XY7 A;  4K8X A;  4CHO A;  4Q0B A;  1W9H A;  2YHA A;  4IFY A;  4DSL A;  3SI6 A;  2I5J A;  1JLB A;  1KCF A;  3HPG A;  5KRT A;  3PX0 A;  4DTJ A;  4DTP A;  1D9F A;  4F2R A;  4KB1 A;  2DFH A;  1RDB A;  4PQU A;  1JLE A;  3OVN A;  3PO5 A;  1CXQ A;  4LH5 A;  4MQ3 A;  4NCG A;  4CEA A;  3I8D A;  2HNZ A;  2A1R A;  1I39 A;  5JS1 A;  4CHP A;  3K57 A;  4FM2 A;  2PYJ A;  4CHY A;  1SKW A;  5HRN A;  4OPK A;  2FBY A;  3SV3 A;  1TV6 A;  3ASM A;  4KTW A;  4DSE A;  3QEV A;  3TI0 A;  3MXM A;  1L5U A;  1HJR A;  4N76 A;  4CJ3 A;  3C6T A;  4Q5V A;  5EU7 A;  4LY7 A;  1JLQ A;  3ZT1 A;  4CEO A;  2LSN A;  2ZD1 A;  4JS4 A;  2KFN A;  3U6F A;  2R7Y A;  1VSH A;  4CF1 A;  5HLF A;  1JLF A;  1ITG A;  3ALY A;  4BAC A;  3PO4 A;  1VSM A;  4DSF A;  2EX3 A;  3D45 A;  4CEQ A;  3HO1 A;  3L2U A;  1JLA A;  1VRT A;  2P51 A;  4FLU A;  1SL2 A;  4DSK A;  4FXD A;  4B8A B;  4W5T A;  2A1S A;  4EZ6 A;  4EP4 A;  1BL3 A;  4YNQ A;  1RCH A;  4DTO A;  2HW3 A;  1B9D A;  4HUG A;  2KQ2 A;  4DF4 A;  1T8E A;  1CZ9 A;  1UAX A;  1TKT A;  3QLH A;  4O4G A;  4J2B A;  3V6D A;  5FRO A;  1S1V A;  1RTJ A;  3HVR A;  4N5S A;  2EHG A;  5SZT A;  1Y97 A;  4Z4H A;  1JL1 A;  2XY5 A;  1CXU A;  4CFA A;  4CJU A;  2XHB A;  1RT4 A;  1B9F A;  3AO3 A;  3DLK A;  2B4J A;  1WSI A;  5C42 A;  1NOZ A;  3HL8 A;  3NHG A;  3ZT3 A;  1C0M A;  3NAE A;  1NK6 A;  1U4B A;  3VQD A;  1B92 A;  5C24 A;  3OYC A;  2HHS A;  3FFI A;  4PA1 A;  2W42 A;  4M3Y A;  4OJR A;  3VQC A;  1Q9X A;  1UWB A;  3NH0 A;  2Y1I A;  1BIS A;  4OGE A;  2Q3S A;  4RG8 A;  1KVB A;  1C1C A;  3TAB A;  3L3V A;  1WNS A;  1K6Y A;  1TL3 A;  3PUF A;  3OYI A;  2VWK A;  3DRS A;  3QNO A;  5FRN A;  1YVU A;  5KRS A;  1IKW A;  1EXQ A;  3LWL A;  4DFK A;  1Q9Y A;  4FJ5 A;  3SYZ A;  2HB5 A;  1KTQ A;  1WAJ A;  3VQ6 A;  1JLG A;  1NJW A;  2G8V A; 
#chains in the Genus database with same CATH topology
 2DFF A;  1XI1 A;  1JL2 A;  2YNI A;  4DFJ A;  4JV5 K;  4Z4G A;  1NK5 A;  1HPZ A;  5BRD A;  1IG8 A;  2Q31 A;  2P9P A;  2A42 A;  3CFP A;  4RW4 A;  1NNE A;  1GOC A;  4HUF A;  1VQP N;  3CQX A;  3IG1 A;  3MCP A;  3AO1 A;  1S1U A;  3CCR N;  1N5Y A;  1RT6 A;  5FPE A;  1TL1 A;  3AGK A;  3VF6 A;  2NZT A;  3VQE A;  2OPS A;  4BWJ A;  4B1V A;  3THW A;  3DI6 A;  1HYV A;  3I8B A;  3QER A;  2O8C B;  2NLX A;  3SUO A;  1VK0 A;  3BP8 A;  3MX5 A;  3VGM A;  3HPH A;  5CZ1 A;  3R3L A;  4FM0 A;  4DQR A;  2ETJ A;  4FPB A;  5EY4 A;  4M3U A;  1FJG K;  4FK2 A;  3HI0 A;  3P5J A;  1BA1 A;  2AJQ A;  3FZM A;  3CQY A;  5AQK A;  4KH5 A;  3ID6 A;  3R8E A;  1DEJ A;  4BRL A;  4KAZ A;  2XY6 A;  1Q7Y O;  4IDK A;  1NKB A;  1S1T A;  4B3R K;  3WNE A;  4QOZ B;  1QQO A;  3A8Y A;  4H0P A;  5T7B A;  3NCI A;  3GL1 A;  4DTN A;  3WEE B;  4KI6 A;  2OAN A;  1HRH A;  4BDP A;  3OYH A;  4M63 C;  3KKS A;  4WYB A;  1YJW N;  2P9I B;  4K8Z A;  4CJT A;  1CZA N;  1YJN N;  2FBT A;  4DFM A;  3TAQ A;  2KW4 A;  4XH1 A;  3AV9 A;  2QWO A;  3DLE A;  2HF3 A;  4BR2 A;  4ICL A;  3V1R A;  4IBN A;  3QFU A;  4CJ4 A;  1S1W A;  1LWC A;  3NBP A;  4O8K A;  1YTU A;  5KGX A;  3LPU A;  3G4S N;  4CJE A;  1BWF O;  3NMU A;  4FJX A;  2E88 A;  3CQ8 A;  4JI7 K;  4IG3 A;  5M1O A;  4FVM A;  3L4Q A;  4DS5 A;  2KHO A;  1QVG M;  3F9K A;  2YHW A;  3SQ1 A;  2W6L A;  4OKE A;  1X1P A;  4BQZ A;  4KFB A;  1NK8 A;  4CJ7 A;  3VET A;  4DR7 K;  1ASU A;  4DR5 K;  5AQI A;  2UXC K;  3HP9 A;  3HBT A;  3PV8 A;  2E20 A;  3HJF A;  2KTQ A;  3EO3 A;  5HRO A;  4IJA A;  2VQF K;  4NYN A;  1RDA A;  4CIF A;  3OYF A;  4JKG B;  3WT0 A;  2YJE A;  3O3F A;  1NGF A;  2B5J A;  2Z1J A;  1E4F T;  1KAX A;  3JXU A;  4PKI A;  5E41 A;  4CES A;  1MU2 A;  3O9U A;  3OJS A;  2D5R A;  1SV5 A;  1O1W A;  4H5N A;  1D5A A;  1WAF A;  2VWB A;  3QEP A;  1LOT B;  1ZBF A;  4CFB A;  3OYL A;  4FJN A;  3OS1 A;  4ILG B;  4B1W B;  4EAH D;  2HNY A;  3WUH A;  2E1Z A;  4E19 A;  1BU6 O;  1G15 A;  1VHX A;  1MWM A;  5M1N A;  4HHT A;  5BR8 K;  2HBJ A;  1REV A;  2FF3 B;  2Z1I A;  4DU3 A;  1LWF A;  1NG9 A;  4R5P A;  1BI4 B;  3O5B A;  1BIZ A;  4DQP A;  1XMQ K;  3TR8 A;  2D0A A;  3FLC O;  1IBL K;  1GLB G;  2HHQ A;  3CPE A;  1L3S A;  3K0S A;  1ASW A;  2E2P A;  2P9U B;  1BCO A;  4FK0 A;  2FBX A;  4E1M A;  4WCE L;  4OPA A;  2HMP A;  4DSJ A;  4AHU A;  1BDG A;  3V9U A;  4DV3 K;  1WBD A;  3HPO A;  4A57 A;  1NBW A;  1L3V A;  3KD5 E;  4BVO A;  5KPT A;  4PUO A;  3W0L A;  3OYD A;  3QIP A;  4Z4C A;  1YTA A;  2YNH A;  3CER A;  2XRI A;  3J7Y P;  4FK4 A;  4GVE A;  4OO1 J;  3ID8 A;  4L3Q A;  2ZWH A;  4NYF A;  4FJ7 A;  3FZF A;  2ZJP L;  1RDC A;  1HPM A;  3TAN A;  4GKJ K;  5B8H A;  5HP1 A;  2HHV A;  4DTX A;  2VGM A;  3DWL A;  1X9J A;  4PL7 A;  4CJK A;  3CCL N;  5KQ8 A;  2YV0 X;  3AA2 A;  4JKF A;  2RKI A;  4FJI A;  1OKJ A;  2HBK A;  3J8A A;  1U6Z A;  3E9L A;  1IO2 A;  1IKX A;  1SKS A;  3NGY A;  1S72 N;  4H0O A;  3E66 A;  4BRN A;  2Z1G A;  1SL0 A;  4E1N A;  2YKN A;  4CBU A;  4E7I A;  3CM6 A;  4B3T K;  3WXM B;  1RGI A;  3E9O A;  2HF4 A;  3LAM A;  3O1B A;  3CF5 L;  5AQF A;  4BR9 A;  2GUI A;  5I3U A;  5JLH A;  3HYF A;  1VSE A;  4DLE A;  4BY9 C;  4ISE A;  4X65 K;  1TKZ A;  3T7Z A;  1M1K O;  2PAV A;  3NF9 A;  2VG5 A;  4CGG A;  4CEE A;  5LMN K;  3OHR A;  3SUP A;  4JKD A;  4I9L A;  4CCH A;  5D3G A;  2Q97 A;  4O0J A;  1YT3 A;  4DSI A;  2E6M A;  5C2D A;  3DAW A;  3H6E A;  4BRA A;  3NVM A;  4KHQ A;  3CMA N;  1EWR A;  4E7J A;  2ASP A;  4DUY K;  4LF7 K;  3O3H A;  1KLN A;  2IS3 A;  3OYN A;  3SZ2 A;  3ZT0 A;  3HST B;  3ZSO A;  1UOC A;  4KHY A;  1RBS A;  5AQX A;  1QVF M;  4JRQ A;  4CZH A;  2X6S A;  1S9E A;  2GWK A;  4XIU A;  4DR1 K;  4DV4 K;  5JS2 A;  4CGH A;  3H45 C;  5FDL A;  2GUP A;  3VN5 A;  4MDB A;  1HNX K;  2PZS A;  3IUC A;  5J2P A;  3RMD A;  2NRH A;  4CE9 A;  2IOC A;  4DQ8 A;  3QB0 A;  3KTQ A;  1D4X A;  3KK3 A;  4E7K A;  4F3T A;  4AQY K;  4CJP A;  2OTL N;  4MFB A;  4FOI A;  1RFQ A;  1U48 A;  4H5R A;  3IRX A;  4LFB K;  4YOR A;  1X3M A;  3TAF A;  1QSL A;  1E4G T;  3LP1 A;  2QWL A;  2RPI A;  1YF5 L;  3NFA A;  3H08 A;  4DTR A;  5GIO A;  5CY4 A;  1WSJ A;  4OLB A;  2P9S B;  4LF5 K;  1QHT A;  4UY8 O;  1GOA A;  3AAQ A;  4O55 A;  4AHC A;  3WNF A;  1TYQ B;  4Q0B A;  3CD6 N;  4DSL A;  1JLB A;  1KCF A;  3DXK A;  5AZI A;  1OH5 A;  4CZF A;  1RDB A;  1JLE A;  3LDP A;  4QS7 A;  2HNZ A;  3K57 A;  5CHI A;  3SV3 A;  3ASM A;  3H1Q A;  4DSE A;  1ILY A;  3MXM A;  1HJR A;  1JJ2 M;  5EU7 A;  1JLQ A;  3B8A X;  3ZT1 A;  3J7A P;  2ZD1 A;  2O8F A;  3U6F A;  4C1N K;  3VTH A;  5HLF A;  1JLF A;  3THX A;  2UUA K;  1ITG A;  1HKB A;  3FZK A;  4CEQ A;  3T1Y K;  3ULE B;  4ISF A;  2P51 A;  4FLU A;  4FXD A;  4B8A B;  3EKS A;  2V51 B;  4BC2 A;  3CET A;  2GEM A;  2UUC K;  3U9D A;  4DTO A;  2HW3 A;  4HUG A;  4DF4 A;  5C10 A;  4O4G A;  3RSE A;  4J2B A;  5GAH P;  4DCH A;  1S1V A;  1RTJ A;  3HVR A;  3KVG A;  1JL1 A;  1CXU A;  4CFA A;  4YHH K;  3AO3 A;  4JD2 B;  5AQP A;  1NMD A;  2ZGZ A;  3HL8 A;  2HHH K;  3NHG A;  4DKW A;  3NAE A;  3P39 A;  3OYC A;  2W42 A;  3ENB A;  5AQM A;  4OJR A;  3VQC A;  1Q9X A;  4B3M K;  2Y1I A;  4RG8 A;  3TAB A;  4WF9 L;  3OYI A;  3PUF A;  3QBW A;  5KRS A;  4DFK A;  3SYZ A;  3VQ6 A;  1JLG A;  2W41 A;  3TU5 A;  2HMI A;  1BGX T;  4EFH A;  3G10 A;  1C0T A;  2F9W A;  4YDU C;  4DQS A;  1Q81 O;  1YJ9 N;  4Y1C A;  2ZJR L;  2PYL A;  1A5W A;  3NF8 A;  4CEZ A;  3JAM O;  1KLM A;  5AQO A;  1TUY A;  2HST A;  5F2R A;  1NOY A;  3HT3 A;  1NGE A;  4AHS A;  3CC7 N;  4IO8 A;  3DXK B;  1VSD A;  1NJI O;  1W0H A;  3LDL A;  2V7Y A;  4A62 A;  4GW6 A;  4FLZ A;  3U4L A;  3TSU A;  3CCQ N;  3DRP A;  2WTU A;  3RMC A;  4C8N A;  1SL1 A;  4O5F A;  4JI1 K;  2Z1H A;  4K41 A;  3KJV A;  3EKU A;  4OGC A;  4WQ5 C;  4AHV A;  1YI2 N;  3V9X A;  3LAN A;  4RWT A;  3S3N A;  2HHT A;  3OA9 A;  1VRU A;  3I55 N;  4I2P A;  2X78 A;  2VQE K;  4HCC A;  4R79 A;  3QES A;  3NGZ A;  1JCG A;  4DQQ A;  3KKR A;  3LP0 A;  3THX B;  4JK9 A;  2VG7 A;  2P9L B;  1X9S A;  3BF3 A;  5EVZ A;  2B6A A;  1BG3 A;  3TAM A;  5DM7 L;  5C0Y A;  1XC3 A;  2AA4 A;  4CFD A;  4FJ9 A;  2NRW A;  4FWN A;  3P83 D;  4XH4 A;  3VQA A;  2QXL A;  3VPZ A;  3F73 A;  1J5E K;  1Q18 A;  1NK7 A;  1X9W A;  1HNI A;  1NKC A;  3QIN A;  4ISG A;  2O8C A;  5IT9 O;  3GG4 A;  4YDU A;  1D9D A;  3RSE B;  1RT7 A;  3H1V X;  1N33 K;  4KHN A;  4PWD A;  3NE6 A;  3CCU N;  5AQH A;  2GEL A;  3RMA A;  3G6E N;  4CGF A;  2BUP A;  3C6H A;  4PHT X;  3C6A A;  4CHZ A;  3D2F B;  5KGW A;  1XQS C;  3L2Q A;  4FJJ A;  3ITH A;  3ATV A;  3QEI A;  1BUP A;  3J7Z O;  1HNZ K;  1EQY A;  4J2A A;  4BQL A;  2IC3 A;  3I0S A;  4CEF A;  3WEE A;  4FLW A;  2OPP A;  3TTC A;  3AVJ A;  4WQ5 A;  4IO9 L;  2QI2 A;  3HM9 A;  1V4T A;  2P9I A;  3KHY A;  3VMF B;  3CXC M;  3K5O A;  1ZBL A;  1WN7 A;  4FWK A;  1J9A A;  3V1Q A;  3BGR A;  4BRC A;  1WSH A;  3KLF A;  1K8K B;  3QEX A;  4W5R A;  4JHD B;  4JEP A;  1T7P A;  4CHN A;  1T6C A;  3DM2 A;  1MA9 B;  4X62 K;  1QSY A;  2NRZ A;  1NM1 A;  4CJF A;  3MEG A;  3OYE A;  4BRM A;  2H3G X;  2UXB K;  3Q7B A;  1WSE A;  3S3M A;  2VG6 A;  1JCF A;  5KPZ A;  1K73 O;  2WON A;  2I7P A;  5BRE A;  4WFB L;  2VCP A;  3ZSX A;  4CER A;  1BQM A;  4BR4 A;  3UE5 A;  2O4I A;  4FLT A;  4BGB A;  4DLG A;  3QEW A;  4DMN A;  3CIP A;  1HNV A;  4DR2 K;  3FZH A;  3K58 A;  4LF6 K;  2V52 B;  5CR4 A;  3ZSR A;  2E2Q A;  3SLC A;  1Q86 O;  3FR0 A;  4LD0 A;  1C0U A;  1XHZ A;  1X3N A;  2Q0U A;  3OS2 A;  4JKH A;  4JI3 K;  3SK3 A;  3KLH A;  4JKG A;  1FKO A;  3ULD A;  4B3S K;  4A2A A;  4K25 A;  1NK4 A;  3LZJ A;  4GKK K;  1NGD A;  4IFE A;  1VQO N;  5KPR A;  3O4Q A;  3KD1 E;  3CJ1 A;  2OYQ A;  3TAE A;  1OVQ A;  1RDU A;  5DMR A;  1J6Z A;  2JWK A;  2OCE A;  3VEX A;  4F4K A;  4IOX A;  3DLR A;  2IVN A;  1IV0 A;  3M5R A;  3FZL A;  4CK2 A;  3NF6 A;  1EKE A;  5AFU A;  3LP2 A;  1BI4 A;  4JKA A;  4JI8 K;  1NGA A;  1VSJ A;  1HNW K;  1BO5 O;  4NB4 A;  4LSN A;  1RT5 A;  3VQQ A;  2P9U A;  4H0V B;  3CM5 A;  5H1S Q;  3A0I X;  3M8P A;  3HXM A;  4DB3 A;  3L2V A;  4BWM A;  2CGL A;  3ZX3 A;  4FZX C;  5HRP A;  5FPN A;  4FJM A;  3SAF A;  3QDK A;  4CD3 A;  3ZSQ A;  1S6P A;  2GWJ A;  1ASV A;  3DLB A;  1DLO A;  3AVM A;  2DFE A;  2GTD A;  3NH1 A;  4F9O A;  3VQ4 A;  3O80 A;  3D6R A;  3LP3 A;  3V9S A;  3CCS N;  3K2P A;  4DR3 K;  2IGI A;  2BGG A;  4CZG A;  3QFP A;  1GOB A;  4JNE A;  1JXE A;  4BVP A;  3O3G A;  4L8R B;  2CH6 A;  3WXI A;  3V81 A;  3D7E O;  3B6P A;  1EX4 A;  1HJO A;  4LFA K;  4DWI A;  4E89 A;  1VQK N;  1JCE A;  4DFP A;  3KK1 A;  3QET A;  4FPA A;  4B1Z A;  4QS9 A;  3T1A A;  3NGI A;  3UKU B;  5BN8 A;  3KLE A;  1RBU A;  2E1Y A;  1NJX A;  4CI6 A;  2A3Z A;  3P1G A;  3U3Y A;  2NNW A;  1SS6 A;  4AHT A;  4Z4F A;  3K9J A;  3U9Z A;  3I56 N;  1WSF A;  4NCB A;  1CZB A;  4FWO A;  3GBT A;  4HWI A;  2WBN A;  2YNG A;  1GLJ O;  3BUZ B;  4PKG A;  3RMB A;  1KVC A;  1LCU A;  5LMU K;  4A2B A;  2P5O A;  4C23 A;  2OZS A;  3F2K A;  2A40 A;  4FZZ A;  3LDQ A;  2X74 A;  1KVA A;  3EY1 A;  4BE1 A;  4K0K K;  1YVN A;  2WFB A;  2PY5 A;  3BDP A;  4NCA A;  4C8K A;  3QO9 A;  4G9Z A;  3IKM A;  4A5A A;  1NK0 A;  1LAW A;  1ATN A;  4B9N A;  1RBV A;  2WC9 A;  3T19 A;  4I6M B;  1FW6 A;  4M7Y A;  4ZTF A;  2OA8 A;  1LAV A;  1K9M O;  4RTF D;  4H03 B;  4C1N I;  1SQK A;  2ITG A;  3QNN A;  1YHQ N;  5BN9 A;  1GLE G;  4C8M A;  5DK5 A;  1QQC A;  1BQN A;  4OKJ A;  3PX6 A;  3L2W A;  4XH5 A;  1YAG A;  5AQS A;  4YFU A;  1RT1 A;  5EXW A;  4YOU A;  1OH6 A;  2I5J A;  3PX0 A;  1D9F A;  5KRT A;  5TKY A;  4JI2 K;  5GIP A;  4NLC A;  1WBB A;  3PO5 A;  4U67 L;  3DXM B;  4NXN K;  1E3M A;  5JS1 A;  4IEI A;  4FM2 A;  4CHY A;  5HRN A;  4OPK A;  1L5U A;  3ZET B;  2KLA A;  4OPH A;  1KD1 O;  3SAG A;  4JS4 A;  3J81 O;  3O9S A;  4LF8 K;  1VSH A;  4CF1 A;  4BR7 A;  3ALY A;  2P9S A;  4GNI A;  3D45 A;  2QWN A;  3HO1 A;  4ILJ A;  2QWQ A;  2J4R A;  4WFN L;  1VRT A;  1TYQ A;  3A5L C;  4DSK A;  3HOT A;  2KQ2 A;  1T8E A;  1UAX A;  2UYT A;  5FRO A;  4N5S A;  4Z4H A;  5AQW A;  4CJU A;  2P9N B;  1RT4 A;  2B4J A;  2HBM A;  4CZJ A;  3O9T A;  4DV2 K;  2ZF5 O;  3LM2 A;  3ZT3 A;  5AR0 A;  1C0M A;  3EN9 A;  1B92 A;  5I9E B;  4LF9 K;  1W7A A;  1T44 A;  4JI0 K;  1UWB A;  1DKG D;  3ULE A;  1QQN A;  3HTV A;  1BIS A;  3R1X A;  4BRK A;  3GE1 A;  3BEX A;  1K6Y A;  3DRS A;  4IXC A;  1XNQ K;  2HB5 A;  1KTQ A;  3LL3 A;  2G8V A;  1I94 K;  1NGB A;  3OYA A;  3VF2 A;  2QWM A;  2O4G A;  1QQM A;  1RTH A;  1XWL A;  2YNF A;  3EL2 A;  4JKE A;  4JD2 A;  3BZC A;  3K59 A;  1TGO A;  4Z4I A;  4KHP K;  3TAR A;  3DLL L;  1RDW X;  2BE2 A;  4M3R A;  4A61 A;  3FFK B;  1UA1 A;  4W5O A;  3CC2 N;  1ZXO A;  3CYM A;  4KKO A;  4NLB A;  4FYD A;  1ZYQ A;  3RR8 A;  2FC0 A;  4JI6 K;  4FWM A;  2E5L K;  3ZX0 A;  4JI5 K;  4CGI A;  4PL8 A;  4E7H A;  3G71 N;  4DTS A;  5J2N A;  3WNH A;  5E84 A;  3SBG A;  5LL6 Z;  4CF9 A;  4Z4E A;  2E2O A;  3VEV A;  2O8B B;  4YOW A;  4ELU A;  4BRG A;  3CCV N;  1IG9 A;  3AVF A;  2KKZ A;  4H0Y B;  4WQ4 C;  1NGH A;  1U2V B;  4B1Y B;  4Y1D A;  4FSV A;  4JI4 K;  3SUQ A;  1OH8 A;  1R0A A;  1KC8 O;  3O08 A;  1TK5 A;  4YOT A;  4NO7 A;  2QM1 A;  4DV1 K;  1RBT A;  3SJH A;  3KLG A;  3NH2 A;  1Z6R A;  2D4W A;  1VQM N;  2VYP A;  4RW8 A;  1J53 A;  5LJV A;  2ZM6 K;  3LDS A;  4BG9 A;  3RR7 A;  1LWE A;  2O8E B;  4MDA A;  3WXK A;  2RE2 A;  3UB5 A;  4DF8 A;  4DTU A;  3ZEU B;  4KHU A;  3DYA A;  3WXL A;  3AVL A;  1QTM A;  2QKB A;  5TKW A;  1Y64 A;  3M6G A;  4FWP A;  2NRX A;  4KB0 A;  1NGI A;  3MXJ A;  4PY5 A;  3AAP A;  2VWJ A;  2O8D B;  3J80 O;  2G8U A;  3KWG A;  1IBM K;  4F3O A;  5FLX O;  2X6N A;  5AQU A;  5DM6 L;  4AHR A;  3MWP A;  3O9Q A;  2P9L A;  3ZLJ A;  2GV9 A;  3OS0 A;  2VGN A;  1D8Y A;  3SQ4 A;  3MXI A;  5GAD P;  5ELZ A;  1GLD G;  2A41 A;  4BE2 A;  3IMX A;  4WQ4 A;  5BRH A;  1S22 A;  1H1V A;  2OZM A;  4O8U A;  2ASM A;  1I3A A;  1RBR A;  2KZZ A;  1S5J A;  4BR0 A;  4YOV A;  2HOE A;  3C65 A;  1U49 A;  2F7T A;  3D2F A;  2CGJ A;  1BHL A;  4FLY A;  3T69 A;  1TUU A;  5HRR A;  2Q1N A;  1NU0 A;  4B08 A;  5BPN A;  4BG8 A;  3M8R A;  3THY B;  1T05 A;  2YHY A;  4EHU A;  1DTT A;  3SJJ A;  3HVT A;  3VQ8 A;  1KQS M;  4GMJ B;  2G8W A;  4IDH A;  1CLQ A;  3VQP A;  4W5Q A;  2BH1 A;  3D2E A;  3CME N;  2NUB A;  4KO0 A;  5BPL A;  4ELT A;  4DV6 K;  2CGK A;  3MN6 A;  1ATR A;  2G8K A;  3CJ9 A;  3S9H A;  5C12 A;  4I2Q A;  3PSI A;  5K14 A;  1K8K A;  3CJB A;  1VSK A;  2QWP A;  3MWT A;  4JHD A;  1SUQ A;  5LY3 A;  3MED A;  4KHW A;  1MWK A;  5JMV A;  3V9W A;  3VQ5 A;  2HBL A;  2V7Z A;  3OTO K;  3A5O C;  2XO7 A;  4CVN E;  2NRV A;  4AIL C;  3C95 A;  4MLH A;  1J5O A;  4BC5 A;  4YOX A;  2WUS A;  2W40 A;  4EIA A;  4BRQ A;  4M41 A;  3W3D A;  3ZSY A;  3DLH A;  1NMN A;  4X64 K;  3KIO A;  4CK1 A;  1N6Q A;  5C25 A;  4DTM A;  3M8S A;  1C6V A;  3TTF A;  3L8B A;  1VQ6 N;  5GAG P;  3NDK A;  1GLA G;  2FSK A;  4OKK A;  3O8M A;  4N56 A;  4CBW A;  3K9K A;  4G1Q A;  3ZT2 A;  5AZJ B;  4UQG A;  2IAJ A;  4E0D A;  4N41 A;  2E8A A;  2ZE2 A;  3UKR B;  2QA4 N;  2P1J A;  4BDY A;  1HQE A;  3CHW A;  4K42 A;  4C8L A;  5AFU H;  1HQU A;  1T3V A;  2FSN A;  1W97 L;  3AVN A;  3MEC A;  1HX1 A;  2D0P A;  1VAZ A;  1HMV A;  3P38 A;  2ITM A;  4U7B A;  4FM1 A;  4J8F A;  1TKD A;  4GY2 B;  5BR9 A;  4ID5 A;  3N4Q A;  1BA0 A;  1JLC A;  3LWM A;  1DT9 A;  1SKR A;  1BCM A;  3OYK A;  3K5N A;  1X9M A;  2IVP A;  3OYM A;  5J2M A;  2G8I A;  2D0O A;  3ZSV A;  3D2E B;  4FVU A;  4O5B A;  3NF7 A;  1UA0 A;  1JXB A;  3WXJ A;  2E6L A;  4DG1 A;  3G25 A;  4A5B A;  2P9K A;  2KFZ A;  4I7F A;  1IKY A;  4RW7 A;  2EWS A;  2D0B A;  4DS4 A;  2G8H A;  3S41 A;  5SWM A;  3UIQ A;  4J2E A;  2F96 A;  3MN5 A;  1U45 A;  3LM9 A;  4KV8 A;  1C1A A;  4KRE A;  3VQ7 A;  4JYA K;  3AVB A;  4RCH A;  3D0P A;  4CJL A;  3F9M A;  1WUA A;  3CC4 N;  3CCJ N;  2YCH A;  1JKH A;  1Z25 A;  4QS8 A;  3EYZ A;  1C0F A;  5HL7 L;  3MN9 A;  1S6Q A;  1KXP A;  4ELV A;  3PLA A;  1MDU B;  4BRE A;  1WB9 A;  2GX9 A;  4M3T A;  3AO4 A;  3WNG A;  1XNR K;  5A2Q O;  3V4I A;  5CZ2 A;  3GDQ A;  5AQR A;  4B1U B;  1C0G A;  3Q7C A;  3QBX A;  1DTQ A;  4GV6 A;  4K43 A;  4WFA L;  5AQV A;  1L3U A;  4J2D A;  4IKF A;  1BOT O;  1LW0 A;  3A2F A;  3UKU A;  3FGU A;  1WLJ A;  1P90 A;  3T3F A;  1N32 K;  3C0B A;  3SMP A;  3VEZ A;  3DMJ A;  3VA3 A;  4BC3 A;  3WQU A;  1Z26 A;  1KFD A;  4FWQ A;  1QE1 A;  2ATQ A;  4BC4 A;  1C1B A;  1ZBU A;  1V4S A;  4IWV A;  1YUW A;  4CFC A;  3HOS A;  4M3W A;  4LSL A;  3KLI A;  2UU9 K;  4Z94 A;  1SZ2 A;  1EWQ A;  2UXD K;  3C7N A;  3L2R A;  4KH6 A;  3KK2 A;  1EO1 A;  3THV A;  2KZM A;  5AQG A;  3C6U A;  4OLA A;  4H5W A;  1VSF A;  1L3T A;  4CIG A;  4CGD A;  5ADX A;  4DR6 K;  3HRG A;  3K5L A;  3R9P A;  4MO4 A;  3O4W A;  4JLH A;  4B9S A;  4EP5 A;  2QK9 A;  2XY7 A;  4K8X A;  4CHO A;  2E2N A;  2ZGY A;  2YHA A;  4IFY A;  2P9K B;  4DTP A;  4F2R A;  4I6M A;  4LF4 K;  3CJC A;  3OVN A;  1CXQ A;  4NCG A;  4LH5 A;  2A1R A;  4CEA A;  4DR4 K;  2PYJ A;  1SKW A;  5AQL A;  2FBY A;  1TV6 A;  2IIR A;  4KTW A;  5CE3 A;  4N76 A;  3N4P A;  3C6T A;  3P4I A;  4CJ3 A;  4CZL A;  4LY7 A;  2ZJQ L;  3O1W A;  5LJW A;  2LSN A;  2KFN A;  4H0T B;  1VSM A;  4DSF A;  2EX3 A;  1R59 O;  4FO0 A;  3MN7 A;  3HZ6 A;  1SL2 A;  4W5T A;  2AP1 A;  4YNQ A;  4CZM A;  2YHX A;  1RCH A;  3SMS A;  5F1X A;  1ZC6 A;  3DXM A;  3QLH A;  1TKT A;  3V6D A;  5SZT A;  1Y97 A;  1N34 K;  3ZET A;  2XY5 A;  2XHB A;  1SAZ A;  4AM6 A;  2W6K A;  3DLK A;  1WSI A;  3JS6 A;  5AQN A;  2P9P B;  1NOZ A;  1U4B A;  3VQD A;  1GLC G;  3QML A;  2HHS A;  3FFI A;  3T1H K;  5BPM A;  3ENO A;  4BRI A;  4OGE A;  1VQ8 N;  5AQZ A;  3L3V A;  5FRN A;  3THW B;  1O13 A;  3QNO A;  1VQ9 N;  3PIO L;  1YVU A;  1IKW A;  3LWL A;  1QZ6 A;  4FJ5 A;  1WAJ A;  3PSF A;  1NJW A;  1F21 A;  4JKC A;  2FLO A;  3IFR A;  4CHQ A;  1VQL N;  2Q0R A;  4FJG A;  2P9N A;  1RDD A;  3LDN A;  2QTD A;  5M1P A;  3C7N B;  4CJW A;  1QSS A;  2F4V K;  3KWI A;  3R6M A;  3KK7 A;  4CBX A;  5CYM A;  2HND A;  2HVH A;  4HUE A;  1LW2 A;  1S9G A;  1RTD A;  3B6O A;  4N47 A;  1TK8 A;  3OBY A;  3ZCM A;  1RT3 A;  1A5V A;  4JK8 A;  3H46 O;  4H5V A;  2XY8 A;  2Y1J A;  3RRG A;  1NJZ A;  4DQI A;  5KTQ A;  3CCM N;  1KFS A;  4GV3 A;  2JGU A;  2JWL A;  4CZI A;  5IWA K;  4KTZ A;  3H3N O;  3JSM A;  1ZBH A;  3I0R A;  1GLL O;  5AQT A;  5E26 A;  1NGC A;  2GBZ A;  3I33 A;  1EET A;  3A5N C;  4M7X A;  2G8F A;  1TVR A;  2CH5 A;  4DV5 K;  4M3Z A;  2F8T A;  3AVC A;  4KTQ A;  3E01 A;  3V9Z A;  3SQ2 A;  3LDO A;  1N8R O;  3AVI A;  5J1E A;  3HP6 A;  4OPJ A;  3SQ0 A;  4ILH A;  3VGK A;  4M3X A;  5JVH L;  5GAE P;  2UUB K;  1NKE A;  4YOY A;  3L3U A;  1W2B M;  3DRR A;  4CK3 A;  4ZHR A;  1XMO K;  1U47 A;  3L6Q A;  3MAQ A;  1HR0 K;  2O8B A;  4RW9 A;  4CJQ A;  4DHY A;  3NVK A;  1U2V A;  3PX4 A;  1EP4 A;  1VQ5 N;  4CF0 A;  2YKM A;  3VF4 A;  2E4L A;  2QXF A;  4LC9 B;  3LPT A;  4ID1 A;  3RWU A;  4IFV A;  2F8S A;  3CFR A;  3OJU A;  4JRP A;  2DTU A;  3RTV A;  1J54 A;  4WE1 A;  4IG0 A;  4Z0U A;  1G99 A;  1ZBI A;  5CYQ A;  1YIT N;  4CIE A;  3AA3 A;  3RVC A;  3VA0 A;  5HBM A;  2O8E A;  3CI5 A;  1IBK K;  4AH9 A;  3PY8 A;  4FLV A;  3ZEU A;  3TSQ A;  2NRT A;  2D0C A;  4TSX A;  4CD1 A;  4FL9 A;  2BAN A;  5J2Q A;  1WSG A;  4B9U A;  5FRM A;  4NXM K;  2RF2 A;  4CED A;  2O8D A;  4OVL A;  4H4M A;  1YIJ N;  3OBW A;  2HHW A;  3F5T A;  4AF1 A;  4GV9 A;  4AM7 A;  3SNN A;  2Q36 A;  1T03 A;  3OW2 M;  3VGL A;  3BY5 A;  3VES A;  4FWS A;  4JKB A;  4BRF A;  4FLX A;  2DPN A;  4FOE A;  2DY4 A;  1FKP A;  3TWH A;  3L4I A;  4LFC K;  4M45 A;  4B1X B;  2YI1 A;  3ZSW A;  4BGA A;  1ESV A;  2I7N A;  1IKV A;  3VQ9 A;  4E7L A;  4KPY A;  4H8K A;  1VSI A;  4B9V A;  3AA4 A;  4FCY A;  1DGK N;  4B3O A;  1HLU A;  4IZ9 A;  3U8X A;  4IEE A;  3TAP A;  5KQD A;  3SV4 A;  4E3S A;  4KI4 A;  4KHS A;  2NRR A;  3VEN A;  3THY A;  3VQB A;  3MCA B;  3TSP A;  3AO5 A;  4FJH A;  1NGJ A;  1IH7 A;  3OYG A;  3HM8 A;  4M42 A;  3VEW A;  3DLG A;  2YHB A;  3E1Y A;  1HKG A;  2OPQ A;  2ZQB A;  4KBO A;  1KRP A;  4FJ8 A;  4C8O A;  4QCL A;  4OX9 K;  4HVJ A;  1A5X A;  5BRF A;  2IDO A;  3SPZ A;  1T6D A;  3IDH A;  3VEY A;  3OYB A;  4I9Q A;  3P31 A;  3L0Q A;  3JYT A;  3SBT A;  3AO2 A;  1QS4 A;  3MK6 A;  5GIN A;  2QKK A;  3CFO A;  2PFU A;  3M1F A;  3TTD A;  3EZW A;  1HYS A;  4B9M A;  1S1X A;  3AY9 A;  5EOY A;  5EX5 A;  4MLE A;  3TPQ A;  3OY9 A;  1KAY A;  3S3O A;  5AQJ A;  4BE0 A;  4MO5 A;  5M1Q A;  3M3Z A;  2HVI A;  1FXX A;  3DOK A;  4W5N A;  3SUN A;  4PKH A;  4BRH A;  5MLC Q;  4CZE A;  2FF6 A;  3MDQ A;  3ZSZ A;  1WOQ A;  1BIU A;  4BDZ A;  3AVA A;  3ZX2 A;  1KSP A;  3IS9 A;  3KZB A;  4BR5 A;  4DV0 K;  1XHX A;  1QHA A;  3SAH A;  3ZT4 A;  4CJR A;  4H5T A;  4YY3 K;  4O0I A;  1RNH A;  3TAG A;  5AZJ A;  2IVO A;  4GVM A;  3BF1 A;  4BRO A;  1NJY A;  3LZI A;  3UKR A;  2A5X A;  2BTF A;  1LV5 A;  1QZ5 A;  5F0X A;  3SPY A;  3ISN C;  2YX6 A;  3VTI A;  5I42 A;  4B9T A;  3WQT A;  3OYJ A;  4CJV A;  1P8Z A;  2ASO A;  1RIL A;  3AGR A;  1VSL A;  3O4N A;  1Z05 A;  3K5M A;  2QW9 A;  3PIP L;  5M1K A;  4CEC A;  4IOC L;  1Q8I A;  4CGJ A;  4DU1 A;  3VER A;  1OVY A;  3DJC A;  4FJL A;  3AVG A;  4V19 S;  2WOM A;  1GLF O;  3C94 A;  4HCB A;  3LAL A;  2HHX A;  1TK0 A;  2P5G A;  1ATS A;  1RTI A;  3AA5 X;  3AVK A;  4DU4 A;  2BDP A;  3IAY A;  4IJN A;  5AQY A;  2HHU A;  2JLE A;  3ATU A;  3MMV A;  4B9Q A;  5HRS A;  3U3G A;  4ZTJ A;  1YXQ A;  2FBV A;  3QIC A;  4F8R A;  1U04 A;  1TAU A;  3G0Z A;  3RRH A;  1XC9 A;  4B9L A;  4FZY A;  4KRF A;  2QEX N;  4CEB A;  2FXU A;  4FJK A;  4O44 A;  5M1F A;  4FW2 A;  3VOV A;  4CJS A;  3EE9 A;  2OTJ N;  3M8Q A;  1NWK A;  1TAQ A;  4JS5 A;  4FWR A;  3V1O A;  4BRD A;  2Q2R A;  4HTL A;  4EZ9 A;  2FSJ A;  1OH7 A;  4HTU A;  2QWR A;  4JAX A;  3H3O B;  3EZ5 A;  1RT2 A;  1KAZ A;  5JVG L;  4KH4 A;  3DOL A;  2OPR A;  4CJ5 A;  3GOI A;  5C2F A;  3HK2 A;  1N36 K;  1Q82 O;  1HUX A;  2F9T A;  4RW6 A;  5AZI B;  1NGG A;  4A59 A;  1K8A O;  5KI6 A;  4JK7 A;  4LH4 A;  4F2S A;  3SCX A;  2D1K A;  4H4O A;  3EE8 A;  1ZBS A;  3AAR A;  4CF8 A;  2RN2 A;  3QIO A;  3CG7 A;  5HOO A;  1M90 O;  4QAG A;  2O8F B;  4BRP A;  2A6A A;  4B8C A;  1NLV A;  5AJ3 K;  1FK9 A;  4FW1 A;  1VQN N;  2YJF A;  3MEE A;  1TKX A;  3AVH A;  3EEQ A;  4XEI A;  4CF2 A;  3LAK A;  3CCE N;  4Y0W A;  1HYZ A;  1W9H A;  3SI6 A;  3HPG A;  5FPM A;  4DTJ A;  4CZK A;  5ADX H;  4KB1 A;  2DFH A;  4PQU A;  3CJ7 A;  1VQ4 N;  4MQ3 A;  4H0X B;  3I8D A;  4FWL A;  1I39 A;  3O9R A;  3CJA A;  4CHP A;  3CPW M;  3TI0 A;  3QEV A;  4X66 K;  4Q5V A;  4CEO A;  2R7Y A;  4BAC A;  5FPD A;  3PO4 A;  1VQ7 N;  3E9P A;  5AQQ A;  3L2U A;  1JLA A;  3VEO A;  2PBD A;  4E1J A;  2A1S A;  4EZ6 A;  1IJJ A;  4EP4 A;  1BL3 A;  5C15 A;  3ZYY X;  4EHT A;  1B9D A;  1CZ9 A;  3BZK A;  1XUP O;  2EHG A;  3A5M C;  3O6W A;  4IOA L;  1B9F A;  3FE1 A;  2RHK A;  5C42 A;  1NK6 A;  1HKC A;  3ENH A;  3MX2 A;  5C24 A;  1S3X A;  4PA1 A;  4M3Y A;  4DV7 K;  3NH0 A;  4CW7 B;  2Q3S A;  1KVB A;  1C1C A;  4DUZ K;  1WNS A;  1TL3 A;  2VWK A;  5JIC A;  3HSC A;  1EXQ A;  1Q9Y A;  4JN4 A;  1NK9 A;  5JLF A; 
#chains in the Genus database with same CATH homology
 2DFF A;  1F21 A;  3OYA A;  2O4G A;  1XI1 A;  2HMI A;  1BGX T;  1JL2 A;  4CHQ A;  2YNI A;  4DFJ A;  1RDD A;  3G10 A;  1C0T A;  1RTH A;  1XWL A;  2YNF A;  4FJG A;  4Z4I A;  3K59 A;  1NK5 A;  4Z4G A;  1TGO A;  4CJW A;  1QSS A;  1HPZ A;  3CFP A;  4DQS A;  3TAR A;  4RW4 A;  2BE2 A;  4Y1C A;  4M3R A;  4FJ8 A;  4QCL A;  1GOC A;  4HUF A;  5CYM A;  2HND A;  2PYL A;  1UA1 A;  1A5W A;  4W5O A;  3NF8 A;  4CEZ A;  2HVH A;  3IG1 A;  3CYM A;  4KKO A;  3AO1 A;  1S1U A;  4HUE A;  1KLM A;  1LW2 A;  1S9G A;  1N5Y A;  1RT6 A;  4FYD A;  1ZYQ A;  3B6O A;  4N47 A;  1TL1 A;  1RTD A;  1TK8 A;  3RR8 A;  3ZCM A;  2FC0 A;  3VQE A;  2OPS A;  1RT3 A;  1A5V A;  4BWJ A;  4CGI A;  1NOY A;  3HT3 A;  2XY8 A;  2Y1J A;  3RRG A;  4AHS A;  1NJZ A;  4DQI A;  4E7H A;  3DI6 A;  4DTS A;  1HYV A;  5KTQ A;  5J2N A;  1VSD A;  3WNH A;  1W0H A;  4CF9 A;  3QER A;  1KFS A;  4Z4E A;  2JGU A;  4GW6 A;  4FLZ A;  4KTZ A;  3JSM A;  1ZBH A;  4ELU A;  3DRP A;  3RMC A;  4C8N A;  3SUO A;  1SL1 A;  1IG9 A;  1VK0 A;  3I0R A;  3AVF A;  2Z1H A;  2GBZ A;  3HPH A;  5CZ1 A;  1EET A;  4FM0 A;  3KJV A;  4DQR A;  4OGC A;  2ETJ A;  4AHV A;  4Y1D A;  3V9X A;  3LAN A;  2G8F A;  1TVR A;  3S3N A;  4M3U A;  2HHT A;  4M3Z A;  4FK2 A;  1VRU A;  3SUQ A;  3P5J A;  4I2P A;  2X78 A;  1R0A A;  4HCC A;  2F8T A;  3AVC A;  3QES A;  3NGZ A;  3E01 A;  3V9Z A;  3SQ2 A;  1TK5 A;  4KTQ A;  4DQQ A;  2AJQ A;  3KKR A;  3LP0 A;  3AVI A;  2VG7 A;  5J1E A;  3HP6 A;  1X9S A;  4OPJ A;  3SQ0 A;  4KAZ A;  2B6A A;  1RBT A;  2XY6 A;  4M3X A;  4IDK A;  3KLG A;  3TAM A;  3NH2 A;  1NKB A;  1S1T A;  4RW8 A;  1J53 A;  4CFD A;  4FJ9 A;  3LDS A;  3RR7 A;  3P83 D;  3VQA A;  3F73 A;  1LWE A;  3WNE A;  1NKE A;  4QOZ B;  1NK7 A;  1X9W A;  3L3U A;  5T7B A;  1HNI A;  1NKC A;  3DRR A;  3QIN A;  4ZHR A;  4CK3 A;  3NCI A;  3MAQ A;  4DTU A;  4DF8 A;  1U47 A;  4KHU A;  3DYA A;  4RW9 A;  4DTN A;  4CJQ A;  4KI6 A;  3AVL A;  1QTM A;  2QKB A;  1D9D A;  1HRH A;  4BDP A;  1RT7 A;  3OYH A;  4KB0 A;  3MXJ A;  4PY5 A;  4KHN A;  4PWD A;  3PX4 A;  3KKS A;  1EP4 A;  2VWJ A;  3NE6 A;  2G8U A;  4CF0 A;  2YKM A;  4K8Z A;  2E4L A;  4F3O A;  2QXF A;  3LPT A;  3RMA A;  4ID1 A;  4CGF A;  4CJT A;  3RWU A;  2FBT A;  2X6N A;  4IFV A;  4CHZ A;  4AHR A;  4DFM A;  2F8S A;  3CFR A;  2KW4 A;  3TAQ A;  3AV9 A;  3OJU A;  4JRP A;  2DTU A;  5KGW A;  3L2Q A;  3RTV A;  4FJJ A;  2GV9 A;  3OS0 A;  3ITH A;  3DLE A;  1J54 A;  4WE1 A;  1D8Y A;  4IG0 A;  4Z0U A;  4ICL A;  3SQ4 A;  3MXI A;  3QEI A;  1ZBI A;  5CYQ A;  3V1R A;  4CIE A;  3AA3 A;  3VA0 A;  5HBM A;  4IBN A;  4J2A A;  4AH9 A;  1S1W A;  2IC3 A;  4CJ4 A;  4BE2 A;  4FLV A;  3PY8 A;  3I0S A;  4CEF A;  2D0C A;  1LWC A;  3NBP A;  4TSX A;  4FLW A;  2OPP A;  3AVJ A;  2OZM A;  5KGX A;  1YTU A;  3LPU A;  2BAN A;  1I3A A;  5J2Q A;  1WSG A;  4CJE A;  4B9U A;  5FRM A;  1RBR A;  2RF2 A;  4CED A;  4OVL A;  1S5J A;  4H4M A;  3HM9 A;  4FJX A;  2KZZ A;  3CQ8 A;  3K5O A;  1ZBL A;  2HHW A;  1WN7 A;  4IG3 A;  3SNN A;  1U49 A;  4FVM A;  4DS5 A;  1T03 A;  1J9A A;  3V1Q A;  3BGR A;  1BHL A;  4FLY A;  3F9K A;  1WSH A;  3KLF A;  5HRR A;  3QEX A;  4OKE A;  1X1P A;  3SQ1 A;  4W5R A;  4B08 A;  1T05 A;  3M8R A;  4FLX A;  1T7P A;  4KFB A;  4CHN A;  1NK8 A;  3DM2 A;  2DY4 A;  1QSY A;  1FKP A;  3TWH A;  1DTT A;  1ASU A;  3MEG A;  4CJF A;  4M45 A;  3OYE A;  3HP9 A;  1WSE A;  3S3M A;  3ZSW A;  2VG6 A;  3HVT A;  3SJJ A;  3VQ8 A;  3PV8 A;  4GMJ B;  2G8W A;  3HJF A;  2KTQ A;  1IKV A;  2WON A;  1CLQ A;  3VQ9 A;  3VQP A;  5HRO A;  3ZSX A;  4NYN A;  4W5Q A;  4E7L A;  1RDA A;  4CIF A;  3OYF A;  3O3F A;  4KPY A;  2NUB A;  4H8K A;  4CER A;  1BQM A;  2B5J A;  1VSI A;  4KO0 A;  4B9V A;  4ELT A;  2Z1J A;  3AA4 A;  5E41 A;  2G8K A;  4FCY A;  2O4I A;  4B3O A;  4CES A;  4FLT A;  3S9H A;  4I2Q A;  1MU2 A;  4DLG A;  3QEW A;  4DMN A;  5K14 A;  3TAP A;  3OJS A;  2D5R A;  1SV5 A;  3SV4 A;  1O1W A;  3QEP A;  1D5A A;  1HNV A;  1VSK A;  1WAF A;  4E3S A;  4KI4 A;  1ZBF A;  4KHS A;  3VQB A;  1SUQ A;  4CFB A;  3OYL A;  4FJN A;  3MED A;  3OS1 A;  3K58 A;  4KHW A;  2HNY A;  3AO5 A;  3ZSR A;  4FJH A;  3V9W A;  4E19 A;  3VQ5 A;  1IH7 A;  3OYG A;  1G15 A;  4HHT A;  4M42 A;  2XO7 A;  3DLG A;  2YHB A;  1REV A;  4LD0 A;  1C0U A;  2Z1I A;  4DU3 A;  1XHZ A;  4AIL C;  1LWF A;  3OS2 A;  2OPQ A;  2ZQB A;  4R5P A;  1BI4 B;  3KLH A;  1KRP A;  3C95 A;  1J5O A;  1BIZ A;  1FKO A;  4C8O A;  4DQP A;  3TR8 A;  2D0A A;  4HVJ A;  3ULD A;  1A5X A;  2IDO A;  3SPZ A;  2HHQ A;  1L3S A;  1ASW A;  3OYB A;  4I9Q A;  1BCO A;  1NK4 A;  4FK0 A;  2FBX A;  4M41 A;  3JYT A;  3LZJ A;  4E1M A;  3AO2 A;  1QS4 A;  3ZSY A;  2QKK A;  3DLH A;  3CFO A;  3O4Q A;  4DSJ A;  3KD1 E;  4AHU A;  2OYQ A;  3TAE A;  5DMR A;  3KIO A;  4F4K A;  4CK1 A;  1N6Q A;  5C25 A;  3V9U A;  4DTM A;  3M8S A;  3DLR A;  3HPO A;  3KD5 E;  1L3V A;  1C6V A;  3L8B A;  1HYS A;  4B9M A;  1S1X A;  4PUO A;  3NDK A;  4CK2 A;  4OKK A;  3NF6 A;  4N56 A;  3OYD A;  1EKE A;  3QIP A;  1NK9 A;  4G1Q A;  3LP2 A;  4Z4C A;  1YTA A;  1BI4 A;  2YNH A;  3ZT2 A;  4UQG A;  3OY9 A;  2IAJ A;  3S3O A;  4E0D A;  4BE0 A;  4N41 A;  2XRI A;  2ZE2 A;  4FK4 A;  1VSJ A;  4LSN A;  4NYF A;  4FJ7 A;  2HVI A;  1RT5 A;  2P1J A;  1FXX A;  3VQQ A;  4BDY A;  3DOK A;  1HQE A;  1RDC A;  3CM5 A;  3M8P A;  4W5N A;  4C8L A;  3SUN A;  3HXM A;  1HQU A;  3ZSZ A;  3TAN A;  3L2V A;  3AVN A;  3MEC A;  4BWM A;  1BIU A;  4BDZ A;  5HP1 A;  3AVA A;  4FZX C;  2HHV A;  4DTX A;  5HRP A;  4FJM A;  4CJK A;  1HMV A;  1KSP A;  3IS9 A;  4FM1 A;  1XHX A;  2YV0 X;  3AA2 A;  1TKD A;  3ZSQ A;  1S6P A;  3ZT4 A;  4CJR A;  1ASV A;  2RKI A;  4ID5 A;  3DLB A;  4FJI A;  1JLC A;  3LWM A;  1SKR A;  1DLO A;  1IO2 A;  1BCM A;  3AVM A;  4O0I A;  1RNH A;  2DFE A;  3OYK A;  3K5N A;  1IKX A;  3NH1 A;  5J2M A;  3OYM A;  3TAG A;  1SKS A;  3NGY A;  2G8I A;  4GVM A;  2Z1G A;  1SL0 A;  3VQ4 A;  3ZSV A;  4E1N A;  3LZI A;  1NJY A;  2YKN A;  3LP3 A;  3V9S A;  4O5B A;  1LV5 A;  4E7I A;  3ISN C;  3SPY A;  3CM6 A;  3K2P A;  3NF7 A;  5I42 A;  1JXB A;  1UA0 A;  3OYJ A;  4B9T A;  2E6L A;  2IGI A;  4CJV A;  4DG1 A;  2BGG A;  1GOB A;  3O3G A;  1JXE A;  4L8R B;  1RIL A;  3LAM A;  2KFZ A;  4I7F A;  1IKY A;  1VSL A;  3V81 A;  4RW7 A;  3B6P A;  3O4N A;  2D0B A;  4DS4 A;  1EX4 A;  3K5M A;  2GUI A;  5I3U A;  2G8H A;  5SWM A;  4CEC A;  4DWI A;  3UIQ A;  4J2E A;  3HYF A;  1VSE A;  1Q8I A;  2F96 A;  4CGJ A;  4DLE A;  4DU1 A;  1TKZ A;  4FJL A;  4E89 A;  3AVG A;  1U45 A;  3NF9 A;  4KV8 A;  2WOM A;  2VG5 A;  3C94 A;  4HCB A;  3LAL A;  2HHX A;  4CGG A;  1TK0 A;  4CEE A;  4DFP A;  2P5G A;  1C1A A;  3KK1 A;  3QET A;  3SUP A;  4KRE A;  3VQ7 A;  1RTI A;  3AA5 X;  3AVK A;  3AVB A;  4I9L A;  4DU4 A;  4CCH A;  5D3G A;  4O0J A;  3T1A A;  3D0P A;  2BDP A;  1YT3 A;  4CJL A;  3NGI A;  3IAY A;  4DSI A;  2E6M A;  2HHU A;  3KLE A;  1RBU A;  2JLE A;  1NJX A;  1JKH A;  1Z25 A;  4KHQ A;  5HRS A;  3U3G A;  3P1G A;  3EYZ A;  3U3Y A;  4ZTJ A;  2FBV A;  4AHT A;  4E7J A;  4F8R A;  1S6Q A;  4Z4F A;  1U04 A;  4ELV A;  1WSF A;  4NCB A;  1CZB A;  3O3H A;  1TAU A;  3G0Z A;  3RRH A;  1XC9 A;  1KLN A;  4B9L A;  4FZY A;  3AO4 A;  3WNG A;  4CEB A;  4M3T A;  2YNG A;  4KRF A;  2IS3 A;  4FJK A;  3V4I A;  4O44 A;  3OYN A;  3ZT0 A;  3SZ2 A;  5CZ2 A;  3HST B;  3ZSO A;  1UOC A;  4FW2 A;  4CJS A;  3RMB A;  4KHY A;  1RBS A;  3M8Q A;  1KVC A;  1TAQ A;  4JS5 A;  4JRQ A;  2P5O A;  2OZS A;  2X6S A;  1S9E A;  3V1O A;  4XIU A;  1DTQ A;  4FZZ A;  2X74 A;  1KVA A;  4EZ9 A;  3EY1 A;  4HTU A;  1L3U A;  4J2D A;  5JS2 A;  4CGH A;  4IKF A;  5FDL A;  4BE1 A;  1LW0 A;  3A2F A;  3VN5 A;  2PY5 A;  4NCA A;  3T3F A;  1WLJ A;  3BDP A;  3EZ5 A;  2PZS A;  1RT2 A;  5J2P A;  4C8K A;  3DMJ A;  3RMD A;  3VA3 A;  1Z26 A;  1KFD A;  3DOL A;  2IOC A;  3QO9 A;  4CE9 A;  2OPR A;  1NK0 A;  3KTQ A;  4CJ5 A;  2ATQ A;  1QE1 A;  1LAW A;  3HK2 A;  1C1B A;  3KK3 A;  1RBV A;  4E7K A;  4B9N A;  1ZBU A;  4F3T A;  4RW6 A;  4CJP A;  4CFC A;  4M3W A;  4MFB A;  4LSL A;  3T19 A;  1U48 A;  1X9M A;  3KLI A;  5KI6 A;  4ZTF A;  4LH4 A;  2OA8 A;  3IRX A;  4F2S A;  1LAV A;  3SCX A;  4H4O A;  3L2R A;  4CF8 A;  2RN2 A;  3KK2 A;  3QIO A;  2ITG A;  3TAF A;  3QNN A;  1QSL A;  3CG7 A;  3THV A;  3LP1 A;  5DK5 A;  1QQC A;  1BQN A;  4C8M A;  4QAG A;  2KZM A;  4OKJ A;  3C6U A;  2RPI A;  4OLA A;  3NFA A;  3PX6 A;  3L2W A;  1VSF A;  3H08 A;  4DTR A;  1L3T A;  4B8C A;  4CIG A;  5CY4 A;  1WSJ A;  4CGD A;  4OLB A;  1FK9 A;  1QHT A;  3K5L A;  1GOA A;  4FW1 A;  3MEE A;  1TKX A;  3AVH A;  4O55 A;  4CF2 A;  4AHC A;  1RT1 A;  3LAK A;  4JLH A;  3WNF A;  4EP5 A;  1HYZ A;  4YFU A;  4B9S A;  2QK9 A;  2XY7 A;  4K8X A;  4CHO A;  4Q0B A;  1W9H A;  2YHA A;  4IFY A;  4DSL A;  3SI6 A;  2I5J A;  1JLB A;  1KCF A;  3HPG A;  5KRT A;  3PX0 A;  4DTJ A;  4DTP A;  1D9F A;  4F2R A;  4KB1 A;  2DFH A;  1RDB A;  4PQU A;  1JLE A;  3OVN A;  3PO5 A;  1CXQ A;  4LH5 A;  4MQ3 A;  4NCG A;  4CEA A;  3I8D A;  2HNZ A;  2A1R A;  1I39 A;  5JS1 A;  4CHP A;  3K57 A;  4FM2 A;  2PYJ A;  4CHY A;  1SKW A;  5HRN A;  4OPK A;  2FBY A;  3SV3 A;  1TV6 A;  3ASM A;  4KTW A;  4DSE A;  3QEV A;  3TI0 A;  3MXM A;  1L5U A;  1HJR A;  4N76 A;  4CJ3 A;  3C6T A;  4Q5V A;  5EU7 A;  4LY7 A;  1JLQ A;  3ZT1 A;  4CEO A;  2LSN A;  2ZD1 A;  4JS4 A;  2KFN A;  3U6F A;  2R7Y A;  1VSH A;  4CF1 A;  5HLF A;  1JLF A;  1ITG A;  3ALY A;  4BAC A;  3PO4 A;  1VSM A;  4DSF A;  2EX3 A;  3D45 A;  4CEQ A;  3HO1 A;  3L2U A;  1JLA A;  1VRT A;  2P51 A;  4FLU A;  1SL2 A;  4DSK A;  4FXD A;  4B8A B;  4W5T A;  2A1S A;  4EZ6 A;  4EP4 A;  1BL3 A;  4YNQ A;  1RCH A;  4DTO A;  2HW3 A;  1B9D A;  4HUG A;  2KQ2 A;  4DF4 A;  1T8E A;  1CZ9 A;  1UAX A;  1TKT A;  3QLH A;  4O4G A;  4J2B A;  3V6D A;  5FRO A;  1S1V A;  1RTJ A;  3HVR A;  4N5S A;  2EHG A;  5SZT A;  1Y97 A;  4Z4H A;  1JL1 A;  2XY5 A;  1CXU A;  4CFA A;  4CJU A;  2XHB A;  1RT4 A;  1B9F A;  3AO3 A;  3DLK A;  2B4J A;  1WSI A;  5C42 A;  1NOZ A;  3HL8 A;  3NHG A;  3ZT3 A;  1C0M A;  3NAE A;  1NK6 A;  1U4B A;  3VQD A;  1B92 A;  5C24 A;  3OYC A;  2HHS A;  3FFI A;  4PA1 A;  2W42 A;  4M3Y A;  4OJR A;  3VQC A;  1Q9X A;  1UWB A;  3NH0 A;  2Y1I A;  1BIS A;  4OGE A;  2Q3S A;  4RG8 A;  1KVB A;  1C1C A;  3TAB A;  3L3V A;  1WNS A;  1K6Y A;  1TL3 A;  3PUF A;  3OYI A;  2VWK A;  3DRS A;  3QNO A;  5FRN A;  1YVU A;  5KRS A;  1IKW A;  1EXQ A;  3LWL A;  4DFK A;  1Q9Y A;  4FJ5 A;  3SYZ A;  2HB5 A;  1KTQ A;  1WAJ A;  3VQ6 A;  1JLG A;  1NJW A;  2G8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...