3LPTA

Hiv integrase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
155
structure length
142
Chain Sequence
DCSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Rational design of small-molecule inhibitors of the LEDGF/p75-integrase interaction and HIV replication.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 45
structure length 142
sequence length 155
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3lptA00
2PYLA 4IFYA 1W0HA 1CXQA 3NF8A 3M8QA 1A5VA 4ID1A 1ITGA 3P83D 2ITGA 1GOBA 3ZCMA 3ZSXA 1BIZA 3TAEA 1BI4B 3VQ4A 4CF2A 4ELVA 4GMJB 4CGHA 1B9DA 4FM1A 1SL0A 2XY8A 1QHTA 4B9VA 1TL3A 1EX4A 3QEVA 3QNNA 2VG6A 1C0MA 3AO1A 5E41A 2A1RA 3K2PA 4AHVA 5HROA 3DLRA 5C25A 1IG9A 1I3AA 1T8EA 2HHXA 4LH5A 3VQ7A 4M3UA 5CZ1A 1QTMA 4CIGA 1BIUA 1S6QA 4AHTA 3CFPA 3RTVA 1UA0A 1DTQA 3NH1A 4DQRA 3U6FA 1LW2A 2YKMA 3VQAA 2KTQA 4AHUA 3SYZA 3DMJA 5FROA 3TI0A 1U48A 1D8YA 1VSJA 1FK9A 4AILC 1X1PA 3AVNA 2HHSA 4O4GA 1HPZA 2Y1JA 2OZSA 4CJPA 5CY4A 1ASUA 1HYZA 4OKKA 2HHVA 4LD0A 3MXMA 1WSHA 1CZBA 2RF2A 4FM0A 4MFBA 4NCBA 4DU4A 2XY6A 3TANA 4E1MA 3AVJA 3SCXA 1JLAA 4CJUA 4FJ9A 1JLQA 3NE6A 3V4IA 1LW0A 3ZT4A 4KV8A 3WNHA 3OJUA 3VQ9A 4FLTA 1KSPA 4FXDA 3S3OA 5HRSA 1BHLA 2GBZA 3LP1A 3LPTA 4OLBA 4B8CA 4M3RA 4CK1A 4BDZA 4O0JA 3TAFA 3SQ2A 2QKBA 4OJRA 5SZTA 1KCFA 4CEEA 4F2SA 3QESA 3NF9A 2XO7A 4N56A 3TAQA 3RWUA 4RW8A 4FJHA 3H08A 1TV6A 2BE2A 5I3UA 1BQMA 4KHYA 4B3OA 1KRPA 1S6PA 3ISNC 4DS5A 3KK3A 3LWMA 3ZT2A 4FJNA 2P51A 2E6MA 1C1AA 1TK5A 1B9FA 1NJZA 1IO2A 1NKBA 4Z4HA 4DU3A 2EHGA 3T3FA 3C95A 1NK0A 3RR8A 4DSKA 3B6PA 1L3UA 1RTHA 4F2RA 3LDSA 3P1GA 1SKRA 1ASVA 2FBVA 4Z0UA 5HRRA 4DTOA 2G8FA 4L8RB 4CJWA 4RG8A 3AO4A 4OGCA 3O4NA 4FJXA 4CESA 3TR8A 3K5MA 4BE0A 1TAQA 3UIQA 1WSJA 2HHQA 1LAVA 4C8MA 3TABA 3RMCA 1ASWA 3LP3A 4B8AB 2X6SA 4I7FA 4J2BA 4Z4GA 3ZSOA 4AH9A 4KTQA 3SJJA 2JGUA 1TKDA 4W5TA 1JLCA 2HNDA 5KGWA 1U45A 4IG0A 4EZ9A 4ZHRA 4H4OA 3KD5E 1KVAA 5J2PA 1NK8A 2HW3A 4JS4A 3V81A 1WSFA 4CHYA 4CEAA 4DU1A 3RMAA 3HJFA 3HK2A 3OJSA 2YHBA 1WSEA 1NK6A 3AVKA 3HO1A 1RDAA 1X9SA 4DG1A 3TAPA 4DMNA 1RT5A 4CFBA 4NYFA 4AHRA 3I8DA 1DLOA 3S9HA 1NK9A 3K58A 3CFRA 3KIOA 2XHBA 3MEDA 1TKZA 4C8NA 4FM2A 4Z4FA 3QEXA 4EZ6A 2VWKA 1S9GA 2GV9A 4I2QA 1Q8IA 4ZTJA 1KLNA 4KB1A 2QK9A 5K14A 3K57A 4CJLA 2G8IA 3KLFA 4I9LA 1K6YA 1VSHA 1O1WA 1WSIA 3KLGA 4I9QA 3ASMA 2F8TA 1RBRA 3BGRA 3VQ8A 4DTSA 3CM5A 3CG7A 3LAKA 3MEEA 1KTQA 4DSFA 4Z4EA 3AV9A 3NF6A 3ZSZA 2FBYA 4FJ7A 1RBVA 4FZXC 5DK5A 1S1XA 2A1SA 3PO5A 1A5WA 1RDCA 1VSMA 3JYTA 4F4KA 5D3GA 3V9WA 4CEOA 4E7IA 1BISA 1BQNA 3JSMA 2G8HA 3DLHA 1S1WA 5KGXA 4FYDA 4KTWA 3MAQA 4N41A 2R7YA 4K8XA 1J9AA 3HP6A 1VRUA 2B6AA 4KKOA 4DSIA 1S1UA 3ZSRA 4JLHA 4BWJA 3RRHA 3V9UA 1SL1A 3M8RA 4C8KA 3HVTA 2IDOA 3O3GA 3VQPA 3VQEA 1QSLA 3LP0A 5SWMA 3DRSA 4KHUA 1HYVA 4DTMA 4FJJA 1UA1A 2XRIA 4CGDA 4FLZA 2P1JA 4CJEA 3EY1A 4DFJA 1IKXA 4CJFA 1DTTA 1TL1A 2IC3A 1C0TA 3O3FA 2OZMA 3THVA 3K59A 4C8LA 3V1RA 3NBPA 3KLEA 3MXIA 2X74A 3ZSYA 4FLWA 4E3SA 1UAXA 4DFKA 1BGXT 3PO4A 4F8RA 2HHTA 5CZ2A 1RT4A 4CEBA 4YNQA 3NF7A 3G0ZA 2YNGA 4CFDA 3CFOA 4IFVA 5KTQA 2BDPA 4LY7A 4KRFA 1NKCA 3S3MA 2YV0X 4CE9A 4Z4CA 3SV3A 3OS0A 1RCHA 3I0SA 3QERA 1T05A 3SZ2A 2KZZA 3LALA 4N76A 3M8SA 1KFSA 3AO3A 4O44A 4KFBA 3OYBA 1XWLA 1D9DA 5CYMA 4FVMA 1RT6A 1KLMA 4ID5A 1N6QA 3DM2A 4CJRA 1Q9XA 2E4LA 2ZD1A 4CF9A 3SNNA 4DF4A 3MXJA 3SQ1A 2X6NA 4CFCA 3EZ5A 4FZZA 4DTXA 1ZBIA 1IKYA 4OPJA 3L2VA 3KLIA 3QIOA 4JS5A 1LV5A 1RBTA 4E0DA 3QNOA 4LH4A 3L3VA 2Z1JA 3O3HA 3SUQA 1GOAA 4HUEA 3OYKA 2BANA 1JL2A 4E7KA 4CIEA 4AHSA 1B92A 4DTPA 3HVRA 1TGOA 1VK0A 2NUBA 1BL3A 4GW6A 3DRRA 4FJKA 3HXMA 3QEWA 1G15A 1LWEA 3F73A 3OYFA 4OKEA 1VSLA 5J2QA 1F21A 5JS2A 2Q3SA 1ZBFA 3L8BA 1VSKA 2AJQA 3AA5X 4E89A 4CK3A 4IBNA 3KKRA 2IAJA 4KHNA 4XIUA 4N5SA 2B5JA 3CYMA 3DRPA 3F9KA 1S9EA 3LWLA 4CCHA 2QXFA 4CJTA 4ICLA 3D45A 4E1NA 3AVFA 3NGIA 1SKSA 5CYQA 1CXUA 4CFAA 4E7JA 5FRMA 3AO5A 1TK0A 4DLGA 4CHZA 2ATQA 4CEQA 4DTJA 1REVA 4IG3A 4CHNA 1U49A 4CGGA 1WN7A 1JXBA 3SPZA 3SUPA 3SUNA 3IG1A 2Z1IA 2YNIA 3AA4A 3AO2A 2WOMA 4CJ5A 4DQSA 2HHWA 1CLQA 3WNFA 3AVAA 1YT3A 3DLGA 5I42A 1U47A 5HLFA 4DQPA 4F3TA 1L3TA 2DY4A 4Y1CA 1HJRA 4W5QA 2JLEA 4CGFA 1XC9A 3B6OA 5KI6A 1RT3A 3MEGA 1VSEA 3OYLA 4DWIA 1BCOA 4OPKA 4FJ5A 1RNHA 2DFFA 3AVHA 1QQCA 4O5BA 2PY5A 3KTQA 4BDPA 4E19A 3VQQA 3NH2A 1NK7A 4CJKA 3L2RA 2I5JA 4UQGA 3VQ6A 4O55A 4CK2A 4FK2A 2ZQBA 3M8PA 2E6LA 4CERA 3PV8A 2OYQA 3T19A 2RN2A 4QOZB 1ZBLA 4Z4IA 1Z25A 5HRNA 4HHTA 4FJLA 3VQ5A 4RW4A 1HNIA 1C6VA 1A5XA 1C1BA 1I39A 3QIPA 2OPQA 3QINA 3KLHA 3SQ4A 4HVJA 2RKIA 3P5JA 1NOYA 2HVHA 3OYHA 4CHOA 3SPYA 2D0BA 3DLKA 2VG7A 1VRTA 3LZIA 4DTRA 2D0CA 4LSNA 3KK1A 4CF1A 1JLFA 2ZE2A 4H8KA 3QEPA 3I0RA 1C0UA 4CF8A 3OYGA 1U4BA 4J2DA 4M3XA 1UOCA 3C94A 3ZT3A 3LZJA 4B9UA 3U3GA 3HPOA 1BCMA 4RW6A 2P5GA 4OLAA 3DOLA 1JXEA 1QS4A 4PA1A 4Q5VA 4QAGA 1NJXA 3K5NA 3PY8A 4QCLA 3HYFA 4MQ3A 3PUFA 1LAWA 3AVMA 1TVRA 3U3YA 3MECA 4HUFA 4W5RA 2HNYA 1IKVA 1T7PA 1Z26A 2D5RA 1XHZA 3ALYA 2VWJA 1RBSA 3AA2A 1NJWA 4PWDA 5J2NA 4IKFA 2X78A 3IRXA 3VQBA 3V1QA 1VSIA 3LANA 4E7LA 1D9FA 1EETA 1RDDA 2DFHA 3BDPA 2HHUA 1LWCA 1KVBA 4I2PA 3V6DA 3VN5A 3L2WA 3ZSQA 4O0IA 4KI4A 3NGZA 2G8WA 1YTUA 1HQEA 1D5AA 4KO0A 3AVCA 1X9MA 4B9TA 2IGIA 4J2EA 1EXQA 5J1EA 3O4QA 3ITHA 4N47A 2D0AA 3ULDA 3OYJA 4W5NA 1UWBA 3V9SA 3SQ0A 3ZSWA 2KZMA 1HNVA 3V9ZA 3LPUA 4DQQA 4NCGA 3A2FA 4FLUA 3OYMA 3RRGA 1XHXA 3AVBA 3QO9A 4BDYA 1HYSA 1RILA 4DSEA 1RT2A 4BE1A 4CHQA 5HBMA 3NCIA 1L5UA 1VSFA 3HPHA 3NAEA 2O4GA 4CJ3A 1QSYA 4M3ZA 4B08A 1HQUA 1SKWA 1ZBUA 2EX3A 3PX4A 4TSXA 3ZT0A 4JRPA 1Q9YA 1S1VA 4FLXA 4FZYA 4CEDA 4CF0A 5J2MA 3DYAA 5FDLA 2QKKA 3C6TA 2PYJA 4HCCA 4FLYA 1J5OA 3D0PA 3DOKA 5C24A 1RTDA 3NH0A 4DFPA 3QLHA 1WNSA 4B9LA 4M3TA 1RBUA 2OPRA 3K5OA 4HCBA 2F8SA 3SUOA 1TKXA 3LAMA 2G8KA 3OS2A 3E01A 1SV5A 2O4IA 1SL2A 1FXXA 1TAUA 3OYCA 5DMRA 3PX0A 2FBXA 1R0AA 1QSSA 4HTUA 2KW4A 3HSTB 4Y1DA 4H4MA 4FK0A 5JS1A 3DLBA 2YNFA 1KVCA 4B9MA 3RMDA 3L2QA 4BWMA 4FCYA 3OVNA 2OPSA 4CJSA 2KQ2A 3EYZA 1KFDA 1SUQA 3KKSA 3SI6A 1ZYQA 4CGIA 2LSNA 5KRTA 4B9NA 1JLGA 2HMIA 4CHPA 2OA8A 2PZSA 1ZBHA 4Q0BA 1IH7A 1NKEA 3S3NA 2KFNA 3SV4A 1J54A 1RT1A 3VA3A 3LP2A 4CECA 4PUOA 4C8OA 1RTIA 3KD1E 4OGEA 4DS4A 1RTJA 4F3OA 4FK4A 3IS9A 3L3UA 3AVIA 4OKJA 1YVUA 1JKHA 3V9XA 5C42A 2B4JA 1YTAA 1S5JA 2VG5A 3QEIA 4DSJA 1C1CA 4W5OA 1X9WA 4M45A 4AHCA 5FRNA 3OYEA 2Z1HA 2HVIA 4G1QA 3K5LA 1IKWA 2YKNA 4ZTFA 1WLJA 1RT7A 2OPPA 2Z1GA 3TAMA 3TARA 4M42A 3AVGA 1WSGA 3KJVA 3V1OA 4RW7A 4JRQA 4J2AA 2FBTA 5HRPA 4KI6A 4WE1A 4GVMA 2HB5A 1XI1A 4PY5A 1JLBA 2GUIA 1L3VA 1J53A 4ELUA 4M3WA 1GOCA 3CM6A 4DF8A 4KREA 3WNEA 1EP4A 4NYNA 4FJGA 4FW1A 4KHSA 4YFUA 3ZT1A 3DLEA 1N5YA 4FJIA 4ELTA 3NGYA 2ETJA 3RMBA 3C6UA 1FKPA 4IDKA 2G8VA 3VA0A 4BACA 3OYAA 4CEZA 1NK4A 1T03A 4B9SA 4DLEA 1TK8A 4DTNA 1S1TA 2HNZA 4PQUA 3NFAA 4EP4A 1Y97A 2KFZA 3RR7A 1L3SA 3OY9A 4CJQA 3VQDA 2P5OA 3CQ8A 2DFEA 2YHAA 2XY5A 3NHGA 4KHWA 3FFIA 4KAZA 2G8UA 1BI4A 3KK2A 2FC0A 3IAYA 4KB0A 4DSLA 1JL1A 5KRSA 1NOZA 3OYIA 2Y1IA 1NJYA 4KPYA 3DI6A 4CGJA 4HUGA 1WAJA 3OS1A 5HP1A 2RPIA 1HRHA 1MU2A 3TAGA 4DQIA 4KHQA 4NCAA 1QE1A 4FJMA 4KTZA 4CJVA 4FJ8A 1FKOA 3HL8A 3L2UA 1RDBA 1W9HA 3HP9A 3WNGA 4R5PA 4BE2A 4CJ4A 4FLVA 3NDKA 3VQCA 2YNHA 4OVLA 2WONA 3HM9A 3ZSVA 5T7BA 3OYNA 2XY7A 2BGGA 1WAFA 4RW9A 3QETA 3TWHA 1VSDA 3PX6A 2DTUA 2F96A 3HT3A 1EKEA 4FW2A 2W42A 1JLEA 1TKTA 3AA3A 1HMVA 3G10A 3T1AA 4DTUA 2IS3A 5EU7A 1CZ9A 1U04A 3OYDA 4CIFA 4K8ZA 4E7HA 1LWFA 4EP5A 1NK5A 4M3YA 3HPGA 4DFMA 4LSLA 4CEFA 4M41A 2IOCA 3AVLA
chains in the Genus database with same CATH superfamily
1ZBSA 3MCPA 3HTVA 1S22A 4L3QA 5CHIA 3M8QA 4ID1A 1ITGA 3EKUA 3VPZA 3ZCMA 3ZSXA 1VAZA 1BIZA 3DXKB 1BI4B 4CF2A 5JMVA 1N8RO 4CGHA 1SL0A 2XY8A 1QHTA 5HROA 3DLRA 5C25A 2WFBA 1IG9A 4JKBA 4LH5A 1QTMA 2QI2A 3NH1A 3U6FA 4U7BA 4JKFA 1U48A 1VSJA 3R1XA 4BVOA 4BVPA 4CJPA 5CE3A 3WXKA 1CZBA 2RF2A 4NCBA 4MFBA 4O8KA 4BRFA 3CCUN 2A5XA 4DV3K 3C6AA 1JLAA 4FJ9A 4A57A 3V4IA 3ZT4A 2W6LA 5KQ8A 4CZFA 4FLTA 4FXDA 3CCEN 1EWRA 4B8CA 3MN5A 3SQ2A 1N33K 3MN6A 3M1FA 1NNEA 3QESA 3NF9A 4N56A 4I6MA 3RWUA 3CJ7A 5I3UA 2BE2A 4EFHA 1KRPA 1S6PA 3C65A 3UKRA 3LWMA 1YJ9N 3ZT2A 1TK5A 1NBWA 1NKBA 4DV1K 1QVGM 1M90O 3QDKA 4H5RA 4H0XB 1ASVA 2FBVA 1OH6A 3WQUA 1SAZA 2HHHK 1MWMA 3TR8A 4CESA 3K5MA 4BE0A 4DR7K 2YHYA 4RTFD 3LP3A 4FWOA 2FLOA 4Y0WA 4PHTX 3O6WA 3CMEN 2JGUA 1BO5O 4EZ9A 5E26A 4IG0A 4ZHRA 2HW3A 1NK8A 4JS4A 3V81A 4CHYA 2YI1A 4DU1A 3OJSA 4WQ4A 2P9SB 3VEZA 1RDAA 1K8AO 1BDGA 2ASPA 1RT5A 4CFBA 4FPAA 3S9HA 2IIRA 3NVMA 1NM1A 3KIOA 2D4WA 1VQLN 1T6DA 1S9GA 4I2QA 4ZTJA 3K57A 2G8IA 4I9LA 3KLGA 3BGRA 3VQ8A 4DTSA 3CM5A 4GVEA 1W2BM 3LAKA 2ZGYA 3AV9A 3ZSZA 2FBYA 1RBVA 1S1XA 2A1SA 1A5WA 1RDCA 3JYTA 1V4SA 1BISA 4RCHA 2G8HA 1S1WA 4CI6A 4KTWA 2O8FA 4N41A 1KAZA 3HP6A 1NGDA 4DSIA 2I7NA 3HOSA 3RRHA 2UYTA 5AQLA 3P4IA 1QQOA 3A5OC 5SWMA 2ZJRL 4KHUA 1HYVA 4YOUA 3CD6N 3EY1A 4DFJA 4H0TB 4IO9L 2OZMA 4C8LA 3V1RA 3KLEA 4KI4A 3ID6A 4FLWA 1UAXA 4DFKA 4DCHA 2HHTA 4A61A 5EX5A 4CEBA 4YNQA 3G0ZA 4IFVA 4KRFA 2YJEA 4LY7A 3L0QA 1YITN 3S3MA 2KZZA 5HL7L 3SV3A 1XNQK 2JWLA 3SZ2A 3VTIA 3BP8A 4JYAK 5CYMA 3CCQN 4NXNK 3DM2A 4CJRA 1Q9XA 2E4LA 4CF9A 3SNNA 3ZX0A 4DF4A 2Q1NA 3MXJA 3SQ1A 1ZBIA 4OPJA 4H0OA 1RFQA 1LV5A 4BRDA 3SUQA 3L3VA 4MO5A 4HUEA 4UY8O 1B92A 4DR5K 1VK0A 4BC4A 2NRHA 2Q2RA 1H1VA 1FW6A 5AQMA 1VSLA 5J2QA 1F21A 3AA5X 1KD1O 4B1YB 1NMNA 3W0LA 4KHNA 3ULEA 2P9SA 4N5SA 1NGFA 3LWLA 3DRPA 3VTHA 4ICLA 4CJTA 2O8BA 3NGIA 1TK0A 1RDWX 2V7YA 2ATQA 1VQ9N 3IG1A 2Z1IA 3AA4A 3AGRA 2WOMA 2O8DB 4K42A 4X66K 4WFAL 3DLGA 1K73O 4DQPA 1L3TA 1HJRA 3B6OA 5KI6A 4B9QA 1RT3A 5KPZA 3D7EO 3T7ZA 1QQCA 2FXUA 3QB0A 4DR6K 2FSNA 3SAGA 3NH2A 1NK7A 2E5LK 1BU6O 3EE9A 4O55A 3GOIA 5AQQA 4FVUA 2NLXA 2RN2A 4QOZB 1ZBLA 5HRNA 4EAHD 1HNZK 3N4PA 3VQ5A 4RW4A 1C6VA 1A5XA 3QINA 2RKIA 2HVHA 3GE1A 2VQFK 4CHOA 3EE8A 3CETA 3LZIA 1VRTA 4LSNA 3DAWA 4CF1A 3CHWA 3I0RA 3E9OA 2FF6A 3HBTA 4M3XA 1UOCA 3C94A 2P5GA 3U3GA 4MDAA 1JXEA 1NJXA 3PY8A 4BROA 3CXCM 5JVHL 2V7ZA 4MQ3A 5C2FA 3FR0A 1YUWA 3MECA 4HUFA 4BRNA 4W5RA 2E8AA 3ZYYX 2D5RA 1XHZA 5F0XA 3ALYA 1RBSA 3AA2A 1XQSC 4IKFA 1JCFA 3IRXA 3VQBA 1D9FA 2A40A 3MX2A 2HHUA 3FGUA 2F9TA 3WEEA 2E20A 3VN5A 3H45C 4O0IA 4DKWA 4KO0A 4H5NA 4CD3A 4J2EA 3O4QA 2D0AA 3CCMN 1UWBA 1HNVA 3ATVA 3RRGA 3QO9A 2CH6A 4BDYA 1RILA 4DSEA 3SBGA 3P38A 5TKYA 3NCIA 4IOCL 2O4GA 4H5TA 4BRKA 4KH4A 1X3NA 1HQUA 1SKWA 3PX4A 4JRPA 4FLXA 1NGCA 4CF0A 5AQHA 4OLBA 4FLYA 3O9QA 5M1KA 2W41A 1RTDA 4M3TA 3QLHA 3FFKB 4WFNL 2G8KA 5AQSA 3ENOA 3OS2A 4JK8A 1FXXA 1NGJA 5DMRA 1R0AA 4HTUA 2KW4A 4MLHA 3DLBA 2YNFA 5TKWA 3R9PA 1HPMA 2OPSA 4CJSA 2KQ2A 3FZLA 1SUQA 1U2VA 3SI6A 4CGIA 5KRTA 3CJAA 4B9NA 2PZSA 3AGKA 3S3NA 3SV4A 3ENHA 3C7NB 4C8OA 3KD1E 1VQ8N 1RTJA 3IS9A 3IKMA 1YVUA 3D2EB 1JKHA 3ZEUB 1XNRK 2B4JA 3ZX3A 4DSJA 2VG5A 2OCEA 3OYEA 1IKWA 2YKNA 4M42A 4JRQA 3V1OA 4J2AA 4KI6A 4FWNA 3OBYA 1YF5L 4FOIA 3AAPA 2QXLA 1T44A 2CH5A 3WNEA 2P9LA 4KHSA 4BC5A 3DLEA 1DEJA 4ELTA 3UB5A 1FKPA 3JAMO 3OYAA 4CEZA 1T03A 4B9SA 1GLEG 3J7ZO 4FWKA 4B1VA 3O9RA 1L3SA 4CBXA 2ZGZA 1Q81O 3E66A 2P5OA 4HTLA 2DFEA 5HOOA 1HNWK 5E84A 1KAYA 3WQTA 1OH8A 4BY9C 4R79A 4XH1A 2G8UA 1KAXA 1GLJO 1JL1A 5KRSA 4JI0K 4EHUA 1NJYA 4PKGA 3ZLJA 4BRHA 5M1FA 5HP1A 4DB3A 5AZJB 4CBUA 4YHHK 4KHQA 4DQIA 2YX6A 5H1SQ 4FJMA 4CJVA 3HL8A 2YCHA 3L2UA 1RDBA 1W9HA 4YOXA 5F1XA 5M1OA 4BE2A 4CJ4A 4FLVA 2WONA 3BF1A 4XH5A 1RDUA 5GADP 3HT3A 2FSKA 3KK7A 3EKSA 3OYDA 3WXMB 4LC9B 1YVNA 2QWLA 4ISEA 4LSLA 4CEFA 5M1NA 2IOCA 2PYLA 3LM2A 1CXQA 4A5BA 3MCAB 4JK7A 3P83D 5DM7L 3TAEA 4ELVA 3VF2A 3VQ4A 3TPQA 4A62A 1GLLO 2KKZA 5AZIA 3SAFA 4B9VA 3QNNA 2A1RA 2VG6A 5E41A 3K2PA 4FL9A 4FSVA 2HHXA 5BR9A 3BF3A 3CC7N 4CIGA 1BIUA 1DTQA 4DQRA 3DMJA 5FROA 3TI0A 3LDNA 2DPNA 1DKGD 1X1PA 4BC2A 3NMUA 4YDUA 1OVYA 1ESVA 1HYZA 4BR9A 4OKKA 2P9UB 2HHVA 4JKAA 3R8EA 1JLQA 4LFAK 4KV8A 3VEVA 4H0PA 2GBZA 5JLHA 4CK1A 4DR4K 2QKBA 4G9ZA 1KCFA 4CEEA 4V19S 3SMSA 1XUPO 4F2SA 4GKJK 5AZJA 1HUXA 1U6ZA 5JLFA 2GUPA 2E6MA 1N34K 1B9FA 5CR4A 1NJZA 4X62K 3I56N 1CZAN 5AQGA 4Z4HA 2QWPA 2EHGA 2UXDK 1OH7A 4DSKA 1L3UA 3VEWA 1JCEA 3P1GA 5HRRA 3VEOA 4CJWA 4LF6K 3E9PA 4OGCA 3KZBA 3UIQA 1TAQA 3LL3A 2BUPA 4MDBA 4I7FA 3MX5A 4BRIA 4AH9A 3G71N 3SJJA 2QWRA 1U45A 1KVAA 1X3MA 4BG9A 4CEAA 3HJFA 4I6MB 3HRGA 2YHBA 4BRCA 1X9SA 4DG1A 3TAPA 1IV0A 2UU9K 4J8FA 3I8DA 5LY3A 1DLOA 3UKRB 2XHBA 3F9MA 4YOTA 4C8NA 2F7TA 3CJ9A 4KB1A 2OTJN 4CJLA 3U8XA 1K6YA 1VSHA 2QTDA 4A5AA 1EO1A 3VEXA 1BA1A 4KHPK 3CG7A 2BH1A 3VGKA 3ZX2A 5D3GA 4F4KA 3FE1A 4LF7K 3V9WA 4CEOA 2NNWA 4E7IA 3JSMA 5KGXA 5GAHP 1J9AA 1VRUA 2B6AA 5BR8K 4JLHA 3V9UA 3M8RA 3HVTA 3O3GA 3VQEA 3LP0A 3DRSA 2UUBK 3P39A 1UA1A 5M1QA 2P1JA 3GL1A 4MO4A 4BGAA 1DTTA 2IC3A 1C0TA 2AP1A 3LDPA 3O3FA 3MXIA 2X74A 3ZSYA 4F8RA 1BGXT 5CZ2A 3NF7A 1Q82O 2YNGA 1QZ6A 1NKCA 4Z4CA 3S41A 3I0SA 3QERA 1T05A 2HF4A 3LALA 4N76A 1KFSA 1D9DA 4C1NK 1KLMA 3BEXA 3UE5A 5AJ3K 3IDHA 3CC2N 2O8EA 2O8FB 1NLVA 4FWSA 1KC8O 2P9IA 2Z1JA 4WQ5C 3O3HA 1JL2A 3H3OB 4AHSA 3CCJN 4DTPA 4Z94A 5AQPA 3DRRA 3HM8A 1LWEA 4AM7A 5JS2A 1BG3A 2AJQA 4E89A 4CK3A 1TYQA 3KKRA 1SZ2A 3QBXA 4IO8A 2B5JA 4LF8K 2QXFA 3A5MC 3D45A 4E1NA 3AVFA 4FO0A 1W7AA 2RE2A 4DTJA 1X9JA 4CEQA 1REVA 1Z05A 4CHNA 4CGGA 1SQKA 3F2KA 4NLCA 1VQ6N 3VOVA 4DV0K 3SUNA 2YNIA 3WNFA 3AVAA 1U47A 5I42A 2DY4A 4F3TA 3CPEA 4Y1CA 5C0YA 4W5QA 1XC9A 1M1KO 2P9KB 3MEGA 2PAVA 1BCOA 3J7AP 4OPKA 4FJ5A 3H3NO 3I8BA 4A2AA 4CJKA 3L2RA 4CK2A 2OTLN 5C15A 3T19A 1VQNN 2ZM6K 4JAXA 4HHTA 3ULEB 1I39A 3KLHA 3SQ4A 3OW2M 3EN9A 3P5JA 2O8BB 3SPYA 3DLKA 4BRMA 2VG7A 1NGAA 4H8KA 4CF8A 4NLBA 3LZJA 4B9UA 4OLAA 2QA4N 3HPOA 1BCMA 1VHXA 4H03B 4PA1A 1LCUA 1LAWA 2HNYA 3AY9A 1BA0A 3OTOK 5LJVA 5GIOA 4K41A 3BDPA 4KH6A 1DT9A 1KVBA 3ZSQA 1YTUA 4LFBK 1J5EK 2GWJA 1X9MA 1LOTB 4ISFA 4F9OA 3ULDA 3OYJA 2UUCK 3SQ0A 3ZSWA 4U67L 3M6GA 4FLUA 1Z6RA 3OYMA 3AVBA 3VMFB 4CHQA 4RWTA 2NRZA 3HPHA 3NAEA 4M3ZA 4B08A 1ZBUA 2EX3A 4TSXA 2VQEK 1BUPA 5C2DA 4CEDA 5J2MA 1QHAA 3CCRN 3D0PA 3O08A 1RBUA 3K5OA 2P9KA 4HCBA 2F8SA 1TKXA 2NZTA 5EOYA 4JKEA 3CC4N 1TAUA 1QSSA 3WEEB 4B3SK 4FK0A 1VQON 4FOEA 4B9MA 3RSEB 4JV5K 3RMDA 1KFDA 1MDUB 1ILYA 3KKSA 4CZGA 5KQDA 3GBTA 4JI5K 4YOVA 1ZYQA 4X64K 3R6MA 4CHPA 4Q0BA 3CERA 2KFNA 4DR1K 4BR5A 3CIPA 3VA3A 4CECA 4PUOA 1VQKN 4F3OA 1BWFO 2A3ZA 4EHTA 3AVIA 3WUHA 3QEIA 1S5JA 3L4QA 1C1CA 1X9WA 4AHCA 3IFRA 2HVIA 4G1QA 3K5LA 3QICA 3H6EA 1WLJA 2Z1GA 3TARA 1EQYA 4ZTFA 3KJVA 4JHDA 5BN8A 3OHRA 2FBTA 4WE1A 4IWVA 1MA9B 1XI1A 4PY5A 1JLBA 1J53A 4ELUA 4M3WA 3ZETA 3CM6A 5FPEA 1EP4A 2AA4A 4FW1A 1N5YA 4FJIA 4JK9A 3SBTA 2ETJA 4JI3K 2ASOA 3LDLA 3C6UA 4IDKA 1NK4A 4BACA 4DLEA 3CI5A 1TK8A 4M7YA 1S1TA 1U2VB 2HNZA 1Y97A 3RR7A 3TTDA 4YDUC 2GELA 1K8KA 2NRRA 5BRDA 3TSQA 2PBDA 3CQ8A 1HKBA 2YHAA 2ZF5O 5AQVA 4KAZA 5I9EB 3KK2A 5AQFA 3IAYA 1RGIA 4MLEA 5C10A 3DI6A 5JVGL 3TAGA 4NCAA 1VQMN 1QZ5A 3HP9A 2P9LB 2WTUA 3VQCA 1QVFM 3HM9A 2BGGA 5GINA 3BUZB 4RW9A 3QETA 3F5TA 3TWHA 3PX6A 2P9NA 2F96A 3RSEA 4FW2A 1NGHA 1TKTA 3AA3A 1HMVA 4JNEA 1YXQA 1DGKN 1U04A 3KWGA 5EU7A 3R3LA 2E2OA 4K8ZA 4EP5A 1NK5A 4M3YA 3HPGA 3VF4A 2OANA 4JKDA 1W0HA 5LMUK 3NF8A 1A5VA 3THYB 3HK2A 4LF9K 1GOBA 4GMJB 1TL3A 3QEVA 4AHVA 1OVQA 3GDQA 1T8EA 1I94K 3VQ7A 4M3UA 1UA0A 4FWQA 1LW2A 2YKMA 3VQAA 2KTQA 3SYZA 4WCEL 1D8YA 1FK9A 4AILC 4BR7A 3AVNA 4IJAA 2QWQA 5CY4A 1ASUA 4LD0A 4BR2A 1VQ7N 4E1MA 3AVJA 3SCXA 2Q0RA 1KSPA 5AFUH 5AQZA 2QM1A 4BDZA 5AFUA 5AZIB 3DLLL 2D1KA 5SZTA 4B1ZA 2CGKA 4RW8A 4FJHA 3H08A 4A59A 1BQMA 4KHYA 2NRTA 4DS5A 3PIPL 2P51A 4LF5K 3O1BA 1HJOA 4FWRA 3T3FA 3C95A 3RR8A 3B6PA 2O8CA 1RTHA 3AAQA 4F2RA 1SKRA 4C1NI 4GV3A 4L8RB 4RG8A 3O4NA 4FJXA 3J7YP 1XMQK 2VYPA 1LAVA 3RMCA 1ASWA 4B8AB 4WF9L 3VEYA 3H46O 3THYA 3CF5L 5LL6Z 3BZKA 5EY4A 2HNDA 2UXBK 3KD5E 5J2PA 1WSFA 3RMAA 2QWNA 1NK6A 3HO1A 5LJWA 4AHRA 1N36K 3K58A 3CFRA 4FM2A 3QEXA 4EZ6A 2VWKA 1KLNA 1Q8IA 2FSJA 2QK9A 3T1HK 4I9QA 1O1WA 2F8TA 3ASMA 4CW7B 4OO1J 2FF3B 1KTQA 4DSFA 4CZEA 4FJ7A 1VSMA 4H0VB 4O8UA 1ATNA 2R7YA 4K8XA 4KKOA 2HBJA 4BWJA 1GLDG 1SL1A 1ATRA 2IDOA 4JKGA 3VQPA 4DTMA 1Y64A 3SK3A 3THXA 1IKXA 4CJFA 1TL1A 4XEIA 4E3SA 3PO4A 4OPHA 2ZJQL 4CVNE 5BN9A 4BRAA 4IZ9A 4JKCA 4CFDA 4WQ4C 3MWPA 2BDPA 1RCHA 3AO3A 4O44A 4KFBA 3OYBA 2HF3A 4ID5A 1GLFO 3CMAN 1TUYA 5AQWA 4CFCA 4YY3K 2E88A 5AQNA 3EZ5A 4FZZA 3OA9A 1IKYA 2GTDA 3KLIA 4JS5A 3CCVN 1OKJA 1RBTA 3QNOA 1GOAA 3A5LC 3OYKA 2BANA 1ATSA 1TGOA 4JD2A 4FJKA 5JICA 1G15A 3MK6A 3F73A 4OKEA 1VSKA 2NRXA 4IBNA 5AR0A 1O13A 1S9EA 4CJ7A 3VENA 3I33A 5FPMA 3Q7CA 1JCGA 1CXUA 5CYQA 3QFUA 5FRMA 3ID8A 2GWKA 3AO5A 4IG3A 1U49A 5BPMA 1S72N 4B1UB 3SPZA 3SUPA 4CJ5A 4DV7K 2HHWA 4DQSA 3QBWA 5HLFA 3O80A 4CGFA 1ZXOA 2O8EB 2D0PA 2HMPA 3OYLA 4DWIA 3SLCA 2P9IB 3RVCA 2DFFA 3FZKA 4O5BA 2PY5A 4FWLA 4DV6K 2A6AA 4BDPA 3TTFA 3K9KA 4UQGA 4FWPA 3VQ6A 3AARA 4FK2A 2ZQBA 4CERA 2E6LA 3PV8A 3O9UA 1TYQB 4Z4IA 1Z25A 4FJLA 1HNIA 1W97L 5KPTA 4IEEA 3HSCA 4CZKA 1NOYA 3QFPA 3HOTA 3O8MA 1WBDA 4PL8A 3TSPA 4DTRA 2D0CA 4JN4A 1JLFA 2ZE2A 3QEPA 3OYGA 1U4BA 2ZJPL 3DXMA 4DUZK 1ZC6A 1QS4A 4Q5VA 4E1JA 4QAGA 3K5NA 4QCLA 1G99A 3HYFA 3PUFA 3W3DA 5BREA 4CZHA 5BRHA 3U3YA 1IKVA 4PWDA 4E7LA 3LANA 1EETA 2DFHA 3SMPA 1LWCA 4I2PA 3V6DA 2VGNA 1HQEA 3M3ZA 1D5AA 5GAGP 4IOAL 5BPNA 2D0OA 4B9TA 1EXQA 4QS9A 5J1EA 3ITHA 5AQRA 4QS8A 3V9SA 3CCSN 2KZMA 1NG9A 3A2FA 3L4IA 1HYSA 3FLCO 2Q36A 3P31A 3LDOA 3ATUA 5BPLA 4WFBL 4FZYA 3DYAA 5FDLA 3C6TA 3T69A 3DOKA 4GV9A 4B9LA 1WNSA 2OPRA 4GKKK 3SUOA 5KPRA 5ADXH 4DUYK 4WYBA 3IUCA 3E01A 2O4IA 1SL2A 5ADXA 3PX0A 2FBXA 2ITMA 5JS1A 3HSTB 4H4MA 1KVCA 4OX9K 1HR0K 3L2QA 4FCYA 2W40A 3VF6A 4IXCA 4OPAA 2QEXN 1ZBHA 1JLGA 2HMIA 2OA8A 3J81O 1IBKK 1IH7A 1NKEA 4GNIA 1QQNA 1RT1A 3LP2A 4AF1A 4LF4K 3MN7A 3U9DA 3CJCA 4FK4A 3V9XA 2Q0UA 2ASMA 4DHYA 1D4XA 3A5NC 3SAHA 4M45A 5FRNA 2OPPA 5AQXA 5A2QO 3AVGA 1GLCG 1WSGA 5MLCQ 5HRPA 4GVMA 2V51B 1L3VA 1NGBA 3FZMA 3KVGA 1GOCA 4JI6K 4DF8A 4NYNA 3UKUB 4FJGA 1NMDA 3ZT1A 3RMBA 5FPNA 4PL7A 3VA0A 5LMNK 4CZLA 4DR2K 1WOQA 3OY9A 3NHGA 3MN9A 4ISGA 1J6ZA 4KHWA 1E4GT 4XH4A 4NXMK 3DXKA 1BI4A 4KB0A 3E9LA 2P9PB 1NOZA 5C12A 4KPYA 3H1QA 4HUGA 2HOEA 4K43A 2VGMA 4JHDB 5AQIA 5IT9O 3EEQA 4KTZA 5GIPA 3ZETB 4BRGA 4OVLA 3JXUA 3ZSVA 5T7BA 2XY7A 1WAFA 4BGBA 1VSDA 2DTUA 2IVNA 1XMOK 4JEPA 4DTUA 3T1AA 5DM6L 2IS3A 4CIFA 1K8KB 4H5VA 2NRWA 4M41A 2JWKA 3AVLA 4CJEA 4IFYA 1NGEA 1C0FA 2WBNA 2ITGA 3PLAA 4IFEA 4JI2K 3VERA 1B9DA 3VETA 4FM1A 1EX4A 1C0MA 3AO1A 5AQKA 4X65K 1I3AA 2VWBA 2QWOA 3O4WA 5FLXO 5CZ1A 1S6QA 4AHTA 3K0SA 4EIAA 3CFPA 4DV5K 3RTVA 2J4RA 3QMLA 4DR3K 1NGIA 4AHUA 3UKUA 4QS7A 4H0YB 3CJBA 2HHSA 4O4GA 4O5FA 4IOXA 2P9NB 3IMXA 1HPZA 2Y1JA 1XC3A 2OZSA 3C0BA 2HBMA 3MXMA 1WSHA 1WBBA 4FM0A 4DU4A 5B8HA 2XY6A 3TANA 4YORA 3J8AA 2WUSA 3N4QA 4CJUA 3NE6A 1LW0A 4B3TK 4B1XB 3WNHA 3OJUA 3VQ9A 2E1YA 5HRSA 1BHLA 3LP1A 3S3OA 4PKIA 3LPTA 3CQYA 4M3RA 5BRFA 5EXWA 4O0JA 4CZMA 3TAFA 2E2PA 1JJ2M 4OJRA 5GAEP 2P9PA 1YIJN 1T3VA 2XO7A 3TAQA 1TV6A 3VGMA 4B3OA 3ISNC 3KK3A 2Q31A 4FJNA 1C1AA 1IO2A 5AQYA 4DU3A 2F9WA 5AQJA 1YJNN 3EO3A 1NK0A 4FWMA 1E4FT 3LDSA 3T1YK 4Z0UA 3EL2A 5M1PA 4DTOA 2G8FA 3AO4A 4CD1A 1WSJA 1P8ZA 2HHQA 4C8MA 3TABA 1K9MO 2X6SA 1SS6A 4J2BA 4Z4GA 3ZSOA 4KTQA 5IWAK 4W5TA 1TKDA 1JLCA 5KGWA 1Q86O 4H4OA 4HWIA 1WSEA 3AVKA 2WC9A 4DMNA 2YHXA 4NYFA 2QWMA 4M7XA 1NK9A 4DQ8A 1GLBG 4BRQA 1WUAA 1TKZA 3MEDA 4Z4FA 3BY5A 3D2FB 2GV9A 5K14A 3KLFA 1WSIA 1YAGA 1RBRA 3PSIA 4KBOA 3ENBA 3MEEA 4Z4EA 2O8CB 3NF6A 4WQ5A 5F2RA 4FZXC 4GV6A 5DK5A 3PO5A 1KXPA 3TU5A 1BQNA 3DLHA 4FYDA 3MAQA 1E3MA 3A8YA 3CQXA 3PSFA 1S1UA 3ZSRA 2E1ZA 3TTCA 4C8KA 1QSLA 2V52B 2YHWA 4FJJA 2XRIA 3M5RA 4CGDA 4FLZA 2UUAK 2HSTA 4B1WB 3THVA 5ELZA 3K59A 3NBPA 1HKCA 1RT4A 2GEMA 2PFUA 3OBWA 2VCPA 1KQSM 1VQ4N 4B3RK 5KTQA 4FPBA 3CFOA 1Q18A 2YV0X 4CE9A 1TUUA 3OS0A 3U4LA 3M8SA 1T6CA 1XWLA 4FVMA 1RT6A 1N6QA 2ZD1A 2O8DA 4K0KK 2X6NA 4DTXA 3L2VA 3QIOA 3GG4A 4PKHA 4E0DA 2EWSA 4LH4A 2QW9A 4E7KA 4CIEA 3HVRA 2NUBA 4JKGB 1BL3A 4GW6A 3HXMA 4AQYK 3QEWA 3CJ1A 3OYFA 3CCLN 3L8BA 2KLAA 1ZBFA 2Q3SA 3THXB 3J80O 2I7PA 2UXCK 2IAJA 4XIUA 2KHOA 1NU0A 3CYMA 3F9KA 5EVZA 4CCHA 3EZWA 1SKSA 4JI8K 3SJHA 4CFAA 4E7JA 3VGLA 4DLGA 4CHZA 4LFCK 3D2FA 1HNXK 1WN7A 1JXBA 3AO2A 2F4VK 1YT3A 2JLEA 3THWB 2E2QA 1N32K 4KH5A 3G6EN 1VSEA 5AQOA 1RNHA 4BR4A 2ZWHA 4JI1K 3AVHA 3KTQA 4E19A 4JD2B 3FZFA 3VQQA 4AM6A 2RHKA 2I5JA 1FJGK 3H1VX 1V4TA 3M8PA 2OYQA 1HLUA 3O5BA 1EWQA 1IJJA 3QIPA 1C1BA 2OPQA 1BOTO 4HVJA 3U9ZA 3G25A 5FPDA 3OYHA 4DV4K 3G4SN 2D0BA 2CGJA 3KK1A 2YJFA 1C0UA 4J2DA 3L6QA 3MDQA 3ZT3A 2HBKA 3KWIA 4RW6A 3DOLA 4BG8A 1GLAG 3MMVA 3AVMA 1TVRA 4NO7A 4BC3A 1T7PA 1Z26A 2VWJA 1NJWA 5J2NA 2X78A 3V1QA 1VSIA 3WXJA 2A41A 2A42A 1C0GA 1RDDA 1WB9A 2NRVA 3L2WA 3NGZA 2G8WA 3TSUA 3AVCA 3KHYA 2IGIA 3A0IX 4N47A 4W5NA 4CZJA 3V9ZA 3LPUA 4M63C 4NCGA 4DQQA 1YJWN 1XHXA 3C7NA 4IJNA 1RT2A 4BE1A 4NB4A 5HBMA 3DXMB 4ILGB 1VSFA 1L5UA 4IDHA 4CJ3A 1QSYA 3D2EA 3ZEUA 1R59O 3ZT0A 1Q9YA 1S1VA 2QKKA 2PYJA 1IBMK 4HCCA 1J5OA 4BQZA 5C24A 3THWA 3NH0A 4DFPA 1VQ5N 3LAMA 4ILHA 2IVOA 4YOYA 1SV5A 4JKHA 3OYCA 1OH5A 5AQUA 2GX9A 4IEIA 4JI4K 4BREA 3HI0A 4BWMA 4YOWA 3OVNA 3EYZA 2LSNA 1VQPN 3PIOL 4DV2K 1J54A 1P90A 2IVPA 1RTIA 4OGEA 4A2BA 4DS4A 3WXIA 3L3UA 4OKJA 5AQTA 4H5WA 5C42A 1YTAA 4CZIA 4W5OA 4BQLA 3LM9A 1HX1A 2Z1HA 3DWLA 4CBWA 3TAMA 1RT7A 3BZCA 4BRLA 4B3MK 4RW7A 4K25A 2HB5A 3C6HA 4JI7K 3NVKA 2GUIA 1HKGA 1NWKA 4KREA 4YFUA 1IBLK 3NGYA 2HBLA 3O9SA 4ILJA 2G8VA 3O9TA 3WT0A 3VESA 4DTNA 3CPWM 2CGLA 3LDQA 4PQUA 3NFAA 3K9JA 3B8AX 4EP4A 2KFZA 3O1WA 4C23A 4CJQA 3VQDA 1S3XA 3WXLA 2XY5A 3FFIA 2FC0A 1NGGA 2E2NA 4DSLA 4BRPA 2Q97A 3OYIA 2Y1IA 1QQMA 4CGJA 3Q7BA 1WAJA 1YHQN 3OS1A 4GY2B 2RPIA 2W6KA 1HRHA 1MU2A 1QE1A 3D6RA 3HZ6A 4FJ8A 1FKOA 3I55N 3WNGA 4R5PA 1IG8A 2BTFA 1Q7YO 3FZHA 3NDKA 2YNHA 1YI2N 3OYNA 3JS6A 3MWTA 1MWKA 1EKEA 2W42A 1JLEA 2H3GX 3G10A 2P9UA 4BR0A 1CZ9A 4E7HA 3E1YA 3DJCA 1LWFA 1NJIO 4DFMA 1CLQA 4Y1DA
chains in the Genus database with same CATH topology
2PYLA 4IFYA 1W0HA 1CXQA 3NF8A 3M8QA 1A5VA 4ID1A 1ITGA 3P83D 2ITGA 1GOBA 3ZCMA 3ZSXA 1BIZA 3TAEA 1BI4B 3VQ4A 4CF2A 4ELVA 4GMJB 4CGHA 1B9DA 4FM1A 1SL0A 2XY8A 1QHTA 4B9VA 1TL3A 1EX4A 3QEVA 3QNNA 2VG6A 1C0MA 3AO1A 5E41A 2A1RA 3K2PA 4AHVA 5HROA 3DLRA 5C25A 1IG9A 1I3AA 1T8EA 2HHXA 4LH5A 3VQ7A 4M3UA 5CZ1A 1QTMA 4CIGA 1BIUA 1S6QA 4AHTA 3CFPA 3RTVA 1UA0A 1DTQA 3NH1A 4DQRA 3U6FA 1LW2A 2YKMA 3VQAA 2KTQA 4AHUA 3SYZA 3DMJA 5FROA 3TI0A 1U48A 1D8YA 1VSJA 1FK9A 4AILC 1X1PA 3AVNA 2HHSA 4O4GA 1HPZA 2Y1JA 2OZSA 4CJPA 5CY4A 1ASUA 1HYZA 4OKKA 2HHVA 4LD0A 3MXMA 1WSHA 1CZBA 2RF2A 4FM0A 4MFBA 4NCBA 4DU4A 2XY6A 3TANA 4E1MA 3AVJA 3SCXA 1JLAA 4CJUA 4FJ9A 1JLQA 3NE6A 3V4IA 1LW0A 3ZT4A 4KV8A 3WNHA 3OJUA 3VQ9A 4FLTA 1KSPA 4FXDA 3S3OA 5HRSA 1BHLA 2GBZA 3LP1A 3LPTA 4OLBA 4B8CA 4M3RA 4CK1A 4BDZA 4O0JA 3TAFA 3SQ2A 2QKBA 4OJRA 5SZTA 1KCFA 4CEEA 4F2SA 3QESA 3NF9A 2XO7A 4N56A 3TAQA 3RWUA 4RW8A 4FJHA 3H08A 1TV6A 2BE2A 5I3UA 1BQMA 4KHYA 4B3OA 1KRPA 1S6PA 3ISNC 4DS5A 3KK3A 3LWMA 3ZT2A 4FJNA 2P51A 2E6MA 1C1AA 1TK5A 1B9FA 1NJZA 1IO2A 1NKBA 4Z4HA 4DU3A 2EHGA 3T3FA 3C95A 1NK0A 3RR8A 4DSKA 3B6PA 1L3UA 1RTHA 4F2RA 3LDSA 3P1GA 1SKRA 1ASVA 2FBVA 4Z0UA 5HRRA 4DTOA 2G8FA 4L8RB 4CJWA 4RG8A 3AO4A 4OGCA 3O4NA 4FJXA 4CESA 3TR8A 3K5MA 4BE0A 1TAQA 3UIQA 1WSJA 2HHQA 1LAVA 4C8MA 3TABA 3RMCA 1ASWA 3LP3A 4B8AB 2X6SA 4I7FA 4J2BA 4Z4GA 3ZSOA 4AH9A 4KTQA 3SJJA 2JGUA 1TKDA 4W5TA 1JLCA 2HNDA 5KGWA 1U45A 4IG0A 4EZ9A 4ZHRA 4H4OA 3KD5E 1KVAA 5J2PA 1NK8A 2HW3A 4JS4A 3V81A 1WSFA 4CHYA 4CEAA 4DU1A 3RMAA 3HJFA 3HK2A 3OJSA 2YHBA 1WSEA 1NK6A 3AVKA 3HO1A 1RDAA 1X9SA 4DG1A 3TAPA 4DMNA 1RT5A 4CFBA 4NYFA 4AHRA 3I8DA 1DLOA 3S9HA 1NK9A 3K58A 3CFRA 3KIOA 2XHBA 3MEDA 1TKZA 4C8NA 4FM2A 4Z4FA 3QEXA 4EZ6A 2VWKA 1S9GA 2GV9A 4I2QA 1Q8IA 4ZTJA 1KLNA 4KB1A 2QK9A 5K14A 3K57A 4CJLA 2G8IA 3KLFA 4I9LA 1K6YA 1VSHA 1O1WA 1WSIA 3KLGA 4I9QA 3ASMA 2F8TA 1RBRA 3BGRA 3VQ8A 4DTSA 3CM5A 3CG7A 3LAKA 3MEEA 1KTQA 4DSFA 4Z4EA 3AV9A 3NF6A 3ZSZA 2FBYA 4FJ7A 1RBVA 4FZXC 5DK5A 1S1XA 2A1SA 3PO5A 1A5WA 1RDCA 1VSMA 3JYTA 4F4KA 5D3GA 3V9WA 4CEOA 4E7IA 1BISA 1BQNA 3JSMA 2G8HA 3DLHA 1S1WA 5KGXA 4FYDA 4KTWA 3MAQA 4N41A 2R7YA 4K8XA 1J9AA 3HP6A 1VRUA 2B6AA 4KKOA 4DSIA 1S1UA 3ZSRA 4JLHA 4BWJA 3RRHA 3V9UA 1SL1A 3M8RA 4C8KA 3HVTA 2IDOA 3O3GA 3VQPA 3VQEA 1QSLA 3LP0A 5SWMA 3DRSA 4KHUA 1HYVA 4DTMA 4FJJA 1UA1A 2XRIA 4CGDA 4FLZA 2P1JA 4CJEA 3EY1A 4DFJA 1IKXA 4CJFA 1DTTA 1TL1A 2IC3A 1C0TA 3O3FA 2OZMA 3THVA 3K59A 4C8LA 3V1RA 3NBPA 3KLEA 3MXIA 2X74A 3ZSYA 4FLWA 4E3SA 1UAXA 4DFKA 1BGXT 3PO4A 4F8RA 2HHTA 5CZ2A 1RT4A 4CEBA 4YNQA 3NF7A 3G0ZA 2YNGA 4CFDA 3CFOA 4IFVA 5KTQA 2BDPA 4LY7A 4KRFA 1NKCA 3S3MA 2YV0X 4CE9A 4Z4CA 3SV3A 3OS0A 1RCHA 3I0SA 3QERA 1T05A 3SZ2A 2KZZA 3LALA 4N76A 3M8SA 1KFSA 3AO3A 4O44A 4KFBA 3OYBA 1XWLA 1D9DA 5CYMA 4FVMA 1RT6A 1KLMA 4ID5A 1N6QA 3DM2A 4CJRA 1Q9XA 2E4LA 2ZD1A 4CF9A 3SNNA 4DF4A 3MXJA 3SQ1A 2X6NA 4CFCA 3EZ5A 4FZZA 4DTXA 1ZBIA 1IKYA 4OPJA 3L2VA 3KLIA 3QIOA 4JS5A 1LV5A 1RBTA 4E0DA 3QNOA 4LH4A 3L3VA 2Z1JA 3O3HA 3SUQA 1GOAA 4HUEA 3OYKA 2BANA 1JL2A 4E7KA 4CIEA 4AHSA 1B92A 4DTPA 3HVRA 1TGOA 1VK0A 2NUBA 1BL3A 4GW6A 3DRRA 4FJKA 3HXMA 3QEWA 1G15A 1LWEA 3F73A 3OYFA 4OKEA 1VSLA 5J2QA 1F21A 5JS2A 2Q3SA 1ZBFA 3L8BA 1VSKA 2AJQA 3AA5X 4E89A 4CK3A 4IBNA 3KKRA 2IAJA 4KHNA 4XIUA 4N5SA 2B5JA 3CYMA 3DRPA 3F9KA 1S9EA 3LWLA 4CCHA 2QXFA 4CJTA 4ICLA 3D45A 4E1NA 3AVFA 3NGIA 1SKSA 5CYQA 1CXUA 4CFAA 4E7JA 5FRMA 3AO5A 1TK0A 4DLGA 4CHZA 2ATQA 4CEQA 4DTJA 1REVA 4IG3A 4CHNA 1U49A 4CGGA 1WN7A 1JXBA 3SPZA 3SUPA 3SUNA 3IG1A 2Z1IA 2YNIA 3AA4A 3AO2A 2WOMA 4CJ5A 4DQSA 2HHWA 1CLQA 3WNFA 3AVAA 1YT3A 3DLGA 5I42A 1U47A 5HLFA 4DQPA 4F3TA 1L3TA 2DY4A 4Y1CA 1HJRA 4W5QA 2JLEA 4CGFA 1XC9A 3B6OA 5KI6A 1RT3A 3MEGA 1VSEA 3OYLA 4DWIA 1BCOA 4OPKA 4FJ5A 1RNHA 2DFFA 3AVHA 1QQCA 4O5BA 2PY5A 3KTQA 4BDPA 4E19A 3VQQA 3NH2A 1NK7A 4CJKA 3L2RA 2I5JA 4UQGA 3VQ6A 4O55A 4CK2A 4FK2A 2ZQBA 3M8PA 2E6LA 4CERA 3PV8A 2OYQA 3T19A 2RN2A 4QOZB 1ZBLA 4Z4IA 1Z25A 5HRNA 4HHTA 4FJLA 3VQ5A 4RW4A 1HNIA 1C6VA 1A5XA 1C1BA 1I39A 3QIPA 2OPQA 3QINA 3KLHA 3SQ4A 4HVJA 2RKIA 3P5JA 1NOYA 2HVHA 3OYHA 4CHOA 3SPYA 2D0BA 3DLKA 2VG7A 1VRTA 3LZIA 4DTRA 2D0CA 4LSNA 3KK1A 4CF1A 1JLFA 2ZE2A 4H8KA 3QEPA 3I0RA 1C0UA 4CF8A 3OYGA 1U4BA 4J2DA 4M3XA 1UOCA 3C94A 3ZT3A 3LZJA 4B9UA 3U3GA 3HPOA 1BCMA 4RW6A 2P5GA 4OLAA 3DOLA 1JXEA 1QS4A 4PA1A 4Q5VA 4QAGA 1NJXA 3K5NA 3PY8A 4QCLA 3HYFA 4MQ3A 3PUFA 1LAWA 3AVMA 1TVRA 3U3YA 3MECA 4HUFA 4W5RA 2HNYA 1IKVA 1T7PA 1Z26A 2D5RA 1XHZA 3ALYA 2VWJA 1RBSA 3AA2A 1NJWA 4PWDA 5J2NA 4IKFA 2X78A 3IRXA 3VQBA 3V1QA 1VSIA 3LANA 4E7LA 1D9FA 1EETA 1RDDA 2DFHA 3BDPA 2HHUA 1LWCA 1KVBA 4I2PA 3V6DA 3VN5A 3L2WA 3ZSQA 4O0IA 4KI4A 3NGZA 2G8WA 1YTUA 1HQEA 1D5AA 4KO0A 3AVCA 1X9MA 4B9TA 2IGIA 4J2EA 1EXQA 5J1EA 3O4QA 3ITHA 4N47A 2D0AA 3ULDA 3OYJA 4W5NA 1UWBA 3V9SA 3SQ0A 3ZSWA 2KZMA 1HNVA 3V9ZA 3LPUA 4DQQA 4NCGA 3A2FA 4FLUA 3OYMA 3RRGA 1XHXA 3AVBA 3QO9A 4BDYA 1HYSA 1RILA 4DSEA 1RT2A 4BE1A 4CHQA 5HBMA 3NCIA 1L5UA 1VSFA 3HPHA 3NAEA 2O4GA 4CJ3A 1QSYA 4M3ZA 4B08A 1HQUA 1SKWA 1ZBUA 2EX3A 3PX4A 4TSXA 3ZT0A 4JRPA 1Q9YA 1S1VA 4FLXA 4FZYA 4CEDA 4CF0A 5J2MA 3DYAA 5FDLA 2QKKA 3C6TA 2PYJA 4HCCA 4FLYA 1J5OA 3D0PA 3DOKA 5C24A 1RTDA 3NH0A 4DFPA 3QLHA 1WNSA 4B9LA 4M3TA 1RBUA 2OPRA 3K5OA 4HCBA 2F8SA 3SUOA 1TKXA 3LAMA 2G8KA 3OS2A 3E01A 1SV5A 2O4IA 1SL2A 1FXXA 1TAUA 3OYCA 5DMRA 3PX0A 2FBXA 1R0AA 1QSSA 4HTUA 2KW4A 3HSTB 4Y1DA 4H4MA 4FK0A 5JS1A 3DLBA 2YNFA 1KVCA 4B9MA 3RMDA 3L2QA 4BWMA 4FCYA 3OVNA 2OPSA 4CJSA 2KQ2A 3EYZA 1KFDA 1SUQA 3KKSA 3SI6A 1ZYQA 4CGIA 2LSNA 5KRTA 4B9NA 1JLGA 2HMIA 4CHPA 2OA8A 2PZSA 1ZBHA 4Q0BA 1IH7A 1NKEA 3S3NA 2KFNA 3SV4A 1J54A 1RT1A 3VA3A 3LP2A 4CECA 4PUOA 4C8OA 1RTIA 3KD1E 4OGEA 4DS4A 1RTJA 4F3OA 4FK4A 3IS9A 3L3UA 3AVIA 4OKJA 1YVUA 1JKHA 3V9XA 5C42A 2B4JA 1YTAA 1S5JA 2VG5A 3QEIA 4DSJA 1C1CA 4W5OA 1X9WA 4M45A 4AHCA 5FRNA 3OYEA 2Z1HA 2HVIA 4G1QA 3K5LA 1IKWA 2YKNA 4ZTFA 1WLJA 1RT7A 2OPPA 2Z1GA 3TAMA 3TARA 4M42A 3AVGA 1WSGA 3KJVA 3V1OA 4RW7A 4JRQA 4J2AA 2FBTA 5HRPA 4KI6A 4WE1A 4GVMA 2HB5A 1XI1A 4PY5A 1JLBA 2GUIA 1L3VA 1J53A 4ELUA 4M3WA 1GOCA 3CM6A 4DF8A 4KREA 3WNEA 1EP4A 4NYNA 4FJGA 4FW1A 4KHSA 4YFUA 3ZT1A 3DLEA 1N5YA 4FJIA 4ELTA 3NGYA 2ETJA 3RMBA 3C6UA 1FKPA 4IDKA 2G8VA 3VA0A 4BACA 3OYAA 4CEZA 1NK4A 1T03A 4B9SA 4DLEA 1TK8A 4DTNA 1S1TA 2HNZA 4PQUA 3NFAA 4EP4A 1Y97A 2KFZA 3RR7A 1L3SA 3OY9A 4CJQA 3VQDA 2P5OA 3CQ8A 2DFEA 2YHAA 2XY5A 3NHGA 4KHWA 3FFIA 4KAZA 2G8UA 1BI4A 3KK2A 2FC0A 3IAYA 4KB0A 4DSLA 1JL1A 5KRSA 1NOZA 3OYIA 2Y1IA 1NJYA 4KPYA 3DI6A 4CGJA 4HUGA 1WAJA 3OS1A 5HP1A 2RPIA 1HRHA 1MU2A 3TAGA 4DQIA 4KHQA 4NCAA 1QE1A 4FJMA 4KTZA 4CJVA 4FJ8A 1FKOA 3HL8A 3L2UA 1RDBA 1W9HA 3HP9A 3WNGA 4R5PA 4BE2A 4CJ4A 4FLVA 3NDKA 3VQCA 2YNHA 4OVLA 2WONA 3HM9A 3ZSVA 5T7BA 3OYNA 2XY7A 2BGGA 1WAFA 4RW9A 3QETA 3TWHA 1VSDA 3PX6A 2DTUA 2F96A 3HT3A 1EKEA 4FW2A 2W42A 1JLEA 1TKTA 3AA3A 1HMVA 3G10A 3T1AA 4DTUA 2IS3A 5EU7A 1CZ9A 1U04A 3OYDA 4CIFA 4K8ZA 4E7HA 1LWFA 4EP5A 1NK5A 4M3YA 3HPGA 4DFMA 4LSLA 4CEFA 4M41A 2IOCA 3AVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYL A;  4IFY A;  1W0H A;  1CXQ A;  3NF8 A;  3M8Q A;  1A5V A;  4ID1 A;  1ITG A;  3P83 D;  2ITG A;  1GOB A;  3ZCM A;  3ZSX A;  1BIZ A;  3TAE A;  1BI4 B;  3VQ4 A;  4CF2 A;  4ELV A;  4GMJ B;  4CGH A;  1B9D A;  4FM1 A;  1SL0 A;  2XY8 A;  1QHT A;  4B9V A;  1TL3 A;  1EX4 A;  3QEV A;  3QNN A;  2VG6 A;  1C0M A;  3AO1 A;  5E41 A;  2A1R A;  3K2P A;  4AHV A;  5HRO A;  3DLR A;  5C25 A;  1IG9 A;  1I3A A;  1T8E A;  2HHX A;  4LH5 A;  3VQ7 A;  4M3U A;  5CZ1 A;  1QTM A;  4CIG A;  1BIU A;  1S6Q A;  4AHT A;  3CFP A;  3RTV A;  1UA0 A;  1DTQ A;  3NH1 A;  4DQR A;  3U6F A;  1LW2 A;  2YKM A;  3VQA A;  2KTQ A;  4AHU A;  3SYZ A;  3DMJ A;  5FRO A;  3TI0 A;  1U48 A;  1D8Y A;  1VSJ A;  1FK9 A;  4AIL C;  1X1P A;  3AVN A;  2HHS A;  4O4G A;  1HPZ A;  2Y1J A;  2OZS A;  4CJP A;  5CY4 A;  1ASU A;  1HYZ A;  4OKK A;  2HHV A;  4LD0 A;  3MXM A;  1WSH A;  1CZB A;  2RF2 A;  4FM0 A;  4MFB A;  4NCB A;  4DU4 A;  2XY6 A;  3TAN A;  4E1M A;  3AVJ A;  3SCX A;  1JLA A;  4CJU A;  4FJ9 A;  1JLQ A;  3NE6 A;  3V4I A;  1LW0 A;  3ZT4 A;  4KV8 A;  3WNH A;  3OJU A;  3VQ9 A;  4FLT A;  1KSP A;  4FXD A;  3S3O A;  5HRS A;  1BHL A;  2GBZ A;  3LP1 A;  3LPT A;  4OLB A;  4B8C A;  4M3R A;  4CK1 A;  4BDZ A;  4O0J A;  3TAF A;  3SQ2 A;  2QKB A;  4OJR A;  5SZT A;  1KCF A;  4CEE A;  4F2S A;  3QES A;  3NF9 A;  2XO7 A;  4N56 A;  3TAQ A;  3RWU A;  4RW8 A;  4FJH A;  3H08 A;  1TV6 A;  2BE2 A;  5I3U A;  1BQM A;  4KHY A;  4B3O A;  1KRP A;  1S6P A;  3ISN C;  4DS5 A;  3KK3 A;  3LWM A;  3ZT2 A;  4FJN A;  2P51 A;  2E6M A;  1C1A A;  1TK5 A;  1B9F A;  1NJZ A;  1IO2 A;  1NKB A;  4Z4H A;  4DU3 A;  2EHG A;  3T3F A;  3C95 A;  1NK0 A;  3RR8 A;  4DSK A;  3B6P A;  1L3U A;  1RTH A;  4F2R A;  3LDS A;  3P1G A;  1SKR A;  1ASV A;  2FBV A;  4Z0U A;  5HRR A;  4DTO A;  2G8F A;  4L8R B;  4CJW A;  4RG8 A;  3AO4 A;  4OGC A;  3O4N A;  4FJX A;  4CES A;  3TR8 A;  3K5M A;  4BE0 A;  1TAQ A;  3UIQ A;  1WSJ A;  2HHQ A;  1LAV A;  4C8M A;  3TAB A;  3RMC A;  1ASW A;  3LP3 A;  4B8A B;  2X6S A;  4I7F A;  4J2B A;  4Z4G A;  3ZSO A;  4AH9 A;  4KTQ A;  3SJJ A;  2JGU A;  1TKD A;  4W5T A;  1JLC A;  2HND A;  5KGW A;  1U45 A;  4IG0 A;  4EZ9 A;  4ZHR A;  4H4O A;  3KD5 E;  1KVA A;  5J2P A;  1NK8 A;  2HW3 A;  4JS4 A;  3V81 A;  1WSF A;  4CHY A;  4CEA A;  4DU1 A;  3RMA A;  3HJF A;  3HK2 A;  3OJS A;  2YHB A;  1WSE A;  1NK6 A;  3AVK A;  3HO1 A;  1RDA A;  1X9S A;  4DG1 A;  3TAP A;  4DMN A;  1RT5 A;  4CFB A;  4NYF A;  4AHR A;  3I8D A;  1DLO A;  3S9H A;  1NK9 A;  3K58 A;  3CFR A;  3KIO A;  2XHB A;  3MED A;  1TKZ A;  4C8N A;  4FM2 A;  4Z4F A;  3QEX A;  4EZ6 A;  2VWK A;  1S9G A;  2GV9 A;  4I2Q A;  1Q8I A;  4ZTJ A;  1KLN A;  4KB1 A;  2QK9 A;  5K14 A;  3K57 A;  4CJL A;  2G8I A;  3KLF A;  4I9L A;  1K6Y A;  1VSH A;  1O1W A;  1WSI A;  3KLG A;  4I9Q A;  3ASM A;  2F8T A;  1RBR A;  3BGR A;  3VQ8 A;  4DTS A;  3CM5 A;  3CG7 A;  3LAK A;  3MEE A;  1KTQ A;  4DSF A;  4Z4E A;  3AV9 A;  3NF6 A;  3ZSZ A;  2FBY A;  4FJ7 A;  1RBV A;  4FZX C;  5DK5 A;  1S1X A;  2A1S A;  3PO5 A;  1A5W A;  1RDC A;  1VSM A;  3JYT A;  4F4K A;  5D3G A;  3V9W A;  4CEO A;  4E7I A;  1BIS A;  1BQN A;  3JSM A;  2G8H A;  3DLH A;  1S1W A;  5KGX A;  4FYD A;  4KTW A;  3MAQ A;  4N41 A;  2R7Y A;  4K8X A;  1J9A A;  3HP6 A;  1VRU A;  2B6A A;  4KKO A;  4DSI A;  1S1U A;  3ZSR A;  4JLH A;  4BWJ A;  3RRH A;  3V9U A;  1SL1 A;  3M8R A;  4C8K A;  3HVT A;  2IDO A;  3O3G A;  3VQP A;  3VQE A;  1QSL A;  3LP0 A;  5SWM A;  3DRS A;  4KHU A;  1HYV A;  4DTM A;  4FJJ A;  1UA1 A;  2XRI A;  4CGD A;  4FLZ A;  2P1J A;  4CJE A;  3EY1 A;  4DFJ A;  1IKX A;  4CJF A;  1DTT A;  1TL1 A;  2IC3 A;  1C0T A;  3O3F A;  2OZM A;  3THV A;  3K59 A;  4C8L A;  3V1R A;  3NBP A;  3KLE A;  3MXI A;  2X74 A;  3ZSY A;  4FLW A;  4E3S A;  1UAX A;  4DFK A;  1BGX T;  3PO4 A;  4F8R A;  2HHT A;  5CZ2 A;  1RT4 A;  4CEB A;  4YNQ A;  3NF7 A;  3G0Z A;  2YNG A;  4CFD A;  3CFO A;  4IFV A;  5KTQ A;  2BDP A;  4LY7 A;  4KRF A;  1NKC A;  3S3M A;  2YV0 X;  4CE9 A;  4Z4C A;  3SV3 A;  3OS0 A;  1RCH A;  3I0S A;  3QER A;  1T05 A;  3SZ2 A;  2KZZ A;  3LAL A;  4N76 A;  3M8S A;  1KFS A;  3AO3 A;  4O44 A;  4KFB A;  3OYB A;  1XWL A;  1D9D A;  5CYM A;  4FVM A;  1RT6 A;  1KLM A;  4ID5 A;  1N6Q A;  3DM2 A;  4CJR A;  1Q9X A;  2E4L A;  2ZD1 A;  4CF9 A;  3SNN A;  4DF4 A;  3MXJ A;  3SQ1 A;  2X6N A;  4CFC A;  3EZ5 A;  4FZZ A;  4DTX A;  1ZBI A;  1IKY A;  4OPJ A;  3L2V A;  3KLI A;  3QIO A;  4JS5 A;  1LV5 A;  1RBT A;  4E0D A;  3QNO A;  4LH4 A;  3L3V A;  2Z1J A;  3O3H A;  3SUQ A;  1GOA A;  4HUE A;  3OYK A;  2BAN A;  1JL2 A;  4E7K A;  4CIE A;  4AHS A;  1B92 A;  4DTP A;  3HVR A;  1TGO A;  1VK0 A;  2NUB A;  1BL3 A;  4GW6 A;  3DRR A;  4FJK A;  3HXM A;  3QEW A;  1G15 A;  1LWE A;  3F73 A;  3OYF A;  4OKE A;  1VSL A;  5J2Q A;  1F21 A;  5JS2 A;  2Q3S A;  1ZBF A;  3L8B A;  1VSK A;  2AJQ A;  3AA5 X;  4E89 A;  4CK3 A;  4IBN A;  3KKR A;  2IAJ A;  4KHN A;  4XIU A;  4N5S A;  2B5J A;  3CYM A;  3DRP A;  3F9K A;  1S9E A;  3LWL A;  4CCH A;  2QXF A;  4CJT A;  4ICL A;  3D45 A;  4E1N A;  3AVF A;  3NGI A;  1SKS A;  5CYQ A;  1CXU A;  4CFA A;  4E7J A;  5FRM A;  3AO5 A;  1TK0 A;  4DLG A;  4CHZ A;  2ATQ A;  4CEQ A;  4DTJ A;  1REV A;  4IG3 A;  4CHN A;  1U49 A;  4CGG A;  1WN7 A;  1JXB A;  3SPZ A;  3SUP A;  3SUN A;  3IG1 A;  2Z1I A;  2YNI A;  3AA4 A;  3AO2 A;  2WOM A;  4CJ5 A;  4DQS A;  2HHW A;  1CLQ A;  3WNF A;  3AVA A;  1YT3 A;  3DLG A;  5I42 A;  1U47 A;  5HLF A;  4DQP A;  4F3T A;  1L3T A;  2DY4 A;  4Y1C A;  1HJR A;  4W5Q A;  2JLE A;  4CGF A;  1XC9 A;  3B6O A;  5KI6 A;  1RT3 A;  3MEG A;  1VSE A;  3OYL A;  4DWI A;  1BCO A;  4OPK A;  4FJ5 A;  1RNH A;  2DFF A;  3AVH A;  1QQC A;  4O5B A;  2PY5 A;  3KTQ A;  4BDP A;  4E19 A;  3VQQ A;  3NH2 A;  1NK7 A;  4CJK A;  3L2R A;  2I5J A;  4UQG A;  3VQ6 A;  4O55 A;  4CK2 A;  4FK2 A;  2ZQB A;  3M8P A;  2E6L A;  4CER A;  3PV8 A;  2OYQ A;  3T19 A;  2RN2 A;  4QOZ B;  1ZBL A;  4Z4I A;  1Z25 A;  5HRN A;  4HHT A;  4FJL A;  3VQ5 A;  4RW4 A;  1HNI A;  1C6V A;  1A5X A;  1C1B A;  1I39 A;  3QIP A;  2OPQ A;  3QIN A;  3KLH A;  3SQ4 A;  4HVJ A;  2RKI A;  3P5J A;  1NOY A;  2HVH A;  3OYH A;  4CHO A;  3SPY A;  2D0B A;  3DLK A;  2VG7 A;  1VRT A;  3LZI A;  4DTR A;  2D0C A;  4LSN A;  3KK1 A;  4CF1 A;  1JLF A;  2ZE2 A;  4H8K A;  3QEP A;  3I0R A;  1C0U A;  4CF8 A;  3OYG A;  1U4B A;  4J2D A;  4M3X A;  1UOC A;  3C94 A;  3ZT3 A;  3LZJ A;  4B9U A;  3U3G A;  3HPO A;  1BCM A;  4RW6 A;  2P5G A;  4OLA A;  3DOL A;  1JXE A;  1QS4 A;  4PA1 A;  4Q5V A;  4QAG A;  1NJX A;  3K5N A;  3PY8 A;  4QCL A;  3HYF A;  4MQ3 A;  3PUF A;  1LAW A;  3AVM A;  1TVR A;  3U3Y A;  3MEC A;  4HUF A;  4W5R A;  2HNY A;  1IKV A;  1T7P A;  1Z26 A;  2D5R A;  1XHZ A;  3ALY A;  2VWJ A;  1RBS A;  3AA2 A;  1NJW A;  4PWD A;  5J2N A;  4IKF A;  2X78 A;  3IRX A;  3VQB A;  3V1Q A;  1VSI A;  3LAN A;  4E7L A;  1D9F A;  1EET A;  1RDD A;  2DFH A;  3BDP A;  2HHU A;  1LWC A;  1KVB A;  4I2P A;  3V6D A;  3VN5 A;  3L2W A;  3ZSQ A;  4O0I A;  4KI4 A;  3NGZ A;  2G8W A;  1YTU A;  1HQE A;  1D5A A;  4KO0 A;  3AVC A;  1X9M A;  4B9T A;  2IGI A;  4J2E A;  1EXQ A;  5J1E A;  3O4Q A;  3ITH A;  4N47 A;  2D0A A;  3ULD A;  3OYJ A;  4W5N A;  1UWB A;  3V9S A;  3SQ0 A;  3ZSW A;  2KZM A;  1HNV A;  3V9Z A;  3LPU A;  4DQQ A;  4NCG A;  3A2F A;  4FLU A;  3OYM A;  3RRG A;  1XHX A;  3AVB A;  3QO9 A;  4BDY A;  1HYS A;  1RIL A;  4DSE A;  1RT2 A;  4BE1 A;  4CHQ A;  5HBM A;  3NCI A;  1L5U A;  1VSF A;  3HPH A;  3NAE A;  2O4G A;  4CJ3 A;  1QSY A;  4M3Z A;  4B08 A;  1HQU A;  1SKW A;  1ZBU A;  2EX3 A;  3PX4 A;  4TSX A;  3ZT0 A;  4JRP A;  1Q9Y A;  1S1V A;  4FLX A;  4FZY A;  4CED A;  4CF0 A;  5J2M A;  3DYA A;  5FDL A;  2QKK A;  3C6T A;  2PYJ A;  4HCC A;  4FLY A;  1J5O A;  3D0P A;  3DOK A;  5C24 A;  1RTD A;  3NH0 A;  4DFP A;  3QLH A;  1WNS A;  4B9L A;  4M3T A;  1RBU A;  2OPR A;  3K5O A;  4HCB A;  2F8S A;  3SUO A;  1TKX A;  3LAM A;  2G8K A;  3OS2 A;  3E01 A;  1SV5 A;  2O4I A;  1SL2 A;  1FXX A;  1TAU A;  3OYC A;  5DMR A;  3PX0 A;  2FBX A;  1R0A A;  1QSS A;  4HTU A;  2KW4 A;  3HST B;  4Y1D A;  4H4M A;  4FK0 A;  5JS1 A;  3DLB A;  2YNF A;  1KVC A;  4B9M A;  3RMD A;  3L2Q A;  4BWM A;  4FCY A;  3OVN A;  2OPS A;  4CJS A;  2KQ2 A;  3EYZ A;  1KFD A;  1SUQ A;  3KKS A;  3SI6 A;  1ZYQ A;  4CGI A;  2LSN A;  5KRT A;  4B9N A;  1JLG A;  2HMI A;  4CHP A;  2OA8 A;  2PZS A;  1ZBH A;  4Q0B A;  1IH7 A;  1NKE A;  3S3N A;  2KFN A;  3SV4 A;  1J54 A;  1RT1 A;  3VA3 A;  3LP2 A;  4CEC A;  4PUO A;  4C8O A;  1RTI A;  3KD1 E;  4OGE A;  4DS4 A;  1RTJ A;  4F3O A;  4FK4 A;  3IS9 A;  3L3U A;  3AVI A;  4OKJ A;  1YVU A;  1JKH A;  3V9X A;  5C42 A;  2B4J A;  1YTA A;  1S5J A;  2VG5 A;  3QEI A;  4DSJ A;  1C1C A;  4W5O A;  1X9W A;  4M45 A;  4AHC A;  5FRN A;  3OYE A;  2Z1H A;  2HVI A;  4G1Q A;  3K5L A;  1IKW A;  2YKN A;  4ZTF A;  1WLJ A;  1RT7 A;  2OPP A;  2Z1G A;  3TAM A;  3TAR A;  4M42 A;  3AVG A;  1WSG A;  3KJV A;  3V1O A;  4RW7 A;  4JRQ A;  4J2A A;  2FBT A;  5HRP A;  4KI6 A;  4WE1 A;  4GVM A;  2HB5 A;  1XI1 A;  4PY5 A;  1JLB A;  2GUI A;  1L3V A;  1J53 A;  4ELU A;  4M3W A;  1GOC A;  3CM6 A;  4DF8 A;  4KRE A;  3WNE A;  1EP4 A;  4NYN A;  4FJG A;  4FW1 A;  4KHS A;  4YFU A;  3ZT1 A;  3DLE A;  1N5Y A;  4FJI A;  4ELT A;  3NGY A;  2ETJ A;  3RMB A;  3C6U A;  1FKP A;  4IDK A;  2G8V A;  3VA0 A;  4BAC A;  3OYA A;  4CEZ A;  1NK4 A;  1T03 A;  4B9S A;  4DLE A;  1TK8 A;  4DTN A;  1S1T A;  2HNZ A;  4PQU A;  3NFA A;  4EP4 A;  1Y97 A;  2KFZ A;  3RR7 A;  1L3S A;  3OY9 A;  4CJQ A;  3VQD A;  2P5O A;  3CQ8 A;  2DFE A;  2YHA A;  2XY5 A;  3NHG A;  4KHW A;  3FFI A;  4KAZ A;  2G8U A;  1BI4 A;  3KK2 A;  2FC0 A;  3IAY A;  4KB0 A;  4DSL A;  1JL1 A;  5KRS A;  1NOZ A;  3OYI A;  2Y1I A;  1NJY A;  4KPY A;  3DI6 A;  4CGJ A;  4HUG A;  1WAJ A;  3OS1 A;  5HP1 A;  2RPI A;  1HRH A;  1MU2 A;  3TAG A;  4DQI A;  4KHQ A;  4NCA A;  1QE1 A;  4FJM A;  4KTZ A;  4CJV A;  4FJ8 A;  1FKO A;  3HL8 A;  3L2U A;  1RDB A;  1W9H A;  3HP9 A;  3WNG A;  4R5P A;  4BE2 A;  4CJ4 A;  4FLV A;  3NDK A;  3VQC A;  2YNH A;  4OVL A;  2WON A;  3HM9 A;  3ZSV A;  5T7B A;  3OYN A;  2XY7 A;  2BGG A;  1WAF A;  4RW9 A;  3QET A;  3TWH A;  1VSD A;  3PX6 A;  2DTU A;  2F96 A;  3HT3 A;  1EKE A;  4FW2 A;  2W42 A;  1JLE A;  1TKT A;  3AA3 A;  1HMV A;  3G10 A;  3T1A A;  4DTU A;  2IS3 A;  5EU7 A;  1CZ9 A;  1U04 A;  3OYD A;  4CIF A;  4K8Z A;  4E7H A;  1LWF A;  4EP5 A;  1NK5 A;  4M3Y A;  3HPG A;  4DFM A;  4LSL A;  4CEF A;  4M41 A;  2IOC A;  3AVL A; 
#chains in the Genus database with same CATH topology
 1ZBS A;  3MCP A;  3HTV A;  1S22 A;  4L3Q A;  5CHI A;  3M8Q A;  4ID1 A;  1ITG A;  3EKU A;  3VPZ A;  3ZCM A;  3ZSX A;  1VAZ A;  1BIZ A;  3DXK B;  1BI4 B;  4CF2 A;  5JMV A;  1N8R O;  4CGH A;  1SL0 A;  2XY8 A;  1QHT A;  5HRO A;  3DLR A;  5C25 A;  2WFB A;  1IG9 A;  4JKB A;  4LH5 A;  1QTM A;  2QI2 A;  3NH1 A;  3U6F A;  4U7B A;  4JKF A;  1U48 A;  1VSJ A;  3R1X A;  4BVO A;  4BVP A;  4CJP A;  5CE3 A;  3WXK A;  1CZB A;  2RF2 A;  4NCB A;  4MFB A;  4O8K A;  4BRF A;  3CCU N;  2A5X A;  4DV3 K;  3C6A A;  1JLA A;  4FJ9 A;  4A57 A;  3V4I A;  3ZT4 A;  2W6L A;  5KQ8 A;  4CZF A;  4FLT A;  4FXD A;  3CCE N;  1EWR A;  4B8C A;  3MN5 A;  3SQ2 A;  1N33 K;  3MN6 A;  3M1F A;  1NNE A;  3QES A;  3NF9 A;  4N56 A;  4I6M A;  3RWU A;  3CJ7 A;  5I3U A;  2BE2 A;  4EFH A;  1KRP A;  1S6P A;  3C65 A;  3UKR A;  3LWM A;  1YJ9 N;  3ZT2 A;  1TK5 A;  1NBW A;  1NKB A;  4DV1 K;  1QVG M;  1M90 O;  3QDK A;  4H5R A;  4H0X B;  1ASV A;  2FBV A;  1OH6 A;  3WQU A;  1SAZ A;  2HHH K;  1MWM A;  3TR8 A;  4CES A;  3K5M A;  4BE0 A;  4DR7 K;  2YHY A;  4RTF D;  3LP3 A;  4FWO A;  2FLO A;  4Y0W A;  4PHT X;  3O6W A;  3CME N;  2JGU A;  1BO5 O;  4EZ9 A;  5E26 A;  4IG0 A;  4ZHR A;  2HW3 A;  1NK8 A;  4JS4 A;  3V81 A;  4CHY A;  2YI1 A;  4DU1 A;  3OJS A;  4WQ4 A;  2P9S B;  3VEZ A;  1RDA A;  1K8A O;  1BDG A;  2ASP A;  1RT5 A;  4CFB A;  4FPA A;  3S9H A;  2IIR A;  3NVM A;  1NM1 A;  3KIO A;  2D4W A;  1VQL N;  1T6D A;  1S9G A;  4I2Q A;  4ZTJ A;  3K57 A;  2G8I A;  4I9L A;  3KLG A;  3BGR A;  3VQ8 A;  4DTS A;  3CM5 A;  4GVE A;  1W2B M;  3LAK A;  2ZGY A;  3AV9 A;  3ZSZ A;  2FBY A;  1RBV A;  1S1X A;  2A1S A;  1A5W A;  1RDC A;  3JYT A;  1V4S A;  1BIS A;  4RCH A;  2G8H A;  1S1W A;  4CI6 A;  4KTW A;  2O8F A;  4N41 A;  1KAZ A;  3HP6 A;  1NGD A;  4DSI A;  2I7N A;  3HOS A;  3RRH A;  2UYT A;  5AQL A;  3P4I A;  1QQO A;  3A5O C;  5SWM A;  2ZJR L;  4KHU A;  1HYV A;  4YOU A;  3CD6 N;  3EY1 A;  4DFJ A;  4H0T B;  4IO9 L;  2OZM A;  4C8L A;  3V1R A;  3KLE A;  4KI4 A;  3ID6 A;  4FLW A;  1UAX A;  4DFK A;  4DCH A;  2HHT A;  4A61 A;  5EX5 A;  4CEB A;  4YNQ A;  3G0Z A;  4IFV A;  4KRF A;  2YJE A;  4LY7 A;  3L0Q A;  1YIT N;  3S3M A;  2KZZ A;  5HL7 L;  3SV3 A;  1XNQ K;  2JWL A;  3SZ2 A;  3VTI A;  3BP8 A;  4JYA K;  5CYM A;  3CCQ N;  4NXN K;  3DM2 A;  4CJR A;  1Q9X A;  2E4L A;  4CF9 A;  3SNN A;  3ZX0 A;  4DF4 A;  2Q1N A;  3MXJ A;  3SQ1 A;  1ZBI A;  4OPJ A;  4H0O A;  1RFQ A;  1LV5 A;  4BRD A;  3SUQ A;  3L3V A;  4MO5 A;  4HUE A;  4UY8 O;  1B92 A;  4DR5 K;  1VK0 A;  4BC4 A;  2NRH A;  2Q2R A;  1H1V A;  1FW6 A;  5AQM A;  1VSL A;  5J2Q A;  1F21 A;  3AA5 X;  1KD1 O;  4B1Y B;  1NMN A;  3W0L A;  4KHN A;  3ULE A;  2P9S A;  4N5S A;  1NGF A;  3LWL A;  3DRP A;  3VTH A;  4ICL A;  4CJT A;  2O8B A;  3NGI A;  1TK0 A;  1RDW X;  2V7Y A;  2ATQ A;  1VQ9 N;  3IG1 A;  2Z1I A;  3AA4 A;  3AGR A;  2WOM A;  2O8D B;  4K42 A;  4X66 K;  4WFA L;  3DLG A;  1K73 O;  4DQP A;  1L3T A;  1HJR A;  3B6O A;  5KI6 A;  4B9Q A;  1RT3 A;  5KPZ A;  3D7E O;  3T7Z A;  1QQC A;  2FXU A;  3QB0 A;  4DR6 K;  2FSN A;  3SAG A;  3NH2 A;  1NK7 A;  2E5L K;  1BU6 O;  3EE9 A;  4O55 A;  3GOI A;  5AQQ A;  4FVU A;  2NLX A;  2RN2 A;  4QOZ B;  1ZBL A;  5HRN A;  4EAH D;  1HNZ K;  3N4P A;  3VQ5 A;  4RW4 A;  1C6V A;  1A5X A;  3QIN A;  2RKI A;  2HVH A;  3GE1 A;  2VQF K;  4CHO A;  3EE8 A;  3CET A;  3LZI A;  1VRT A;  4LSN A;  3DAW A;  4CF1 A;  3CHW A;  3I0R A;  3E9O A;  2FF6 A;  3HBT A;  4M3X A;  1UOC A;  3C94 A;  2P5G A;  3U3G A;  4MDA A;  1JXE A;  1NJX A;  3PY8 A;  4BRO A;  3CXC M;  5JVH L;  2V7Z A;  4MQ3 A;  5C2F A;  3FR0 A;  1YUW A;  3MEC A;  4HUF A;  4BRN A;  4W5R A;  2E8A A;  3ZYY X;  2D5R A;  1XHZ A;  5F0X A;  3ALY A;  1RBS A;  3AA2 A;  1XQS C;  4IKF A;  1JCF A;  3IRX A;  3VQB A;  1D9F A;  2A40 A;  3MX2 A;  2HHU A;  3FGU A;  2F9T A;  3WEE A;  2E20 A;  3VN5 A;  3H45 C;  4O0I A;  4DKW A;  4KO0 A;  4H5N A;  4CD3 A;  4J2E A;  3O4Q A;  2D0A A;  3CCM N;  1UWB A;  1HNV A;  3ATV A;  3RRG A;  3QO9 A;  2CH6 A;  4BDY A;  1RIL A;  4DSE A;  3SBG A;  3P38 A;  5TKY A;  3NCI A;  4IOC L;  2O4G A;  4H5T A;  4BRK A;  4KH4 A;  1X3N A;  1HQU A;  1SKW A;  3PX4 A;  4JRP A;  4FLX A;  1NGC A;  4CF0 A;  5AQH A;  4OLB A;  4FLY A;  3O9Q A;  5M1K A;  2W41 A;  1RTD A;  4M3T A;  3QLH A;  3FFK B;  4WFN L;  2G8K A;  5AQS A;  3ENO A;  3OS2 A;  4JK8 A;  1FXX A;  1NGJ A;  5DMR A;  1R0A A;  4HTU A;  2KW4 A;  4MLH A;  3DLB A;  2YNF A;  5TKW A;  3R9P A;  1HPM A;  2OPS A;  4CJS A;  2KQ2 A;  3FZL A;  1SUQ A;  1U2V A;  3SI6 A;  4CGI A;  5KRT A;  3CJA A;  4B9N A;  2PZS A;  3AGK A;  3S3N A;  3SV4 A;  3ENH A;  3C7N B;  4C8O A;  3KD1 E;  1VQ8 N;  1RTJ A;  3IS9 A;  3IKM A;  1YVU A;  3D2E B;  1JKH A;  3ZEU B;  1XNR K;  2B4J A;  3ZX3 A;  4DSJ A;  2VG5 A;  2OCE A;  3OYE A;  1IKW A;  2YKN A;  4M42 A;  4JRQ A;  3V1O A;  4J2A A;  4KI6 A;  4FWN A;  3OBY A;  1YF5 L;  4FOI A;  3AAP A;  2QXL A;  1T44 A;  2CH5 A;  3WNE A;  2P9L A;  4KHS A;  4BC5 A;  3DLE A;  1DEJ A;  4ELT A;  3UB5 A;  1FKP A;  3JAM O;  3OYA A;  4CEZ A;  1T03 A;  4B9S A;  1GLE G;  3J7Z O;  4FWK A;  4B1V A;  3O9R A;  1L3S A;  4CBX A;  2ZGZ A;  1Q81 O;  3E66 A;  2P5O A;  4HTL A;  2DFE A;  5HOO A;  1HNW K;  5E84 A;  1KAY A;  3WQT A;  1OH8 A;  4BY9 C;  4R79 A;  4XH1 A;  2G8U A;  1KAX A;  1GLJ O;  1JL1 A;  5KRS A;  4JI0 K;  4EHU A;  1NJY A;  4PKG A;  3ZLJ A;  4BRH A;  5M1F A;  5HP1 A;  4DB3 A;  5AZJ B;  4CBU A;  4YHH K;  4KHQ A;  4DQI A;  2YX6 A;  5H1S Q;  4FJM A;  4CJV A;  3HL8 A;  2YCH A;  3L2U A;  1RDB A;  1W9H A;  4YOX A;  5F1X A;  5M1O A;  4BE2 A;  4CJ4 A;  4FLV A;  2WON A;  3BF1 A;  4XH5 A;  1RDU A;  5GAD P;  3HT3 A;  2FSK A;  3KK7 A;  3EKS A;  3OYD A;  3WXM B;  4LC9 B;  1YVN A;  2QWL A;  4ISE A;  4LSL A;  4CEF A;  5M1N A;  2IOC A;  2PYL A;  3LM2 A;  1CXQ A;  4A5B A;  3MCA B;  4JK7 A;  3P83 D;  5DM7 L;  3TAE A;  4ELV A;  3VF2 A;  3VQ4 A;  3TPQ A;  4A62 A;  1GLL O;  2KKZ A;  5AZI A;  3SAF A;  4B9V A;  3QNN A;  2A1R A;  2VG6 A;  5E41 A;  3K2P A;  4FL9 A;  4FSV A;  2HHX A;  5BR9 A;  3BF3 A;  3CC7 N;  4CIG A;  1BIU A;  1DTQ A;  4DQR A;  3DMJ A;  5FRO A;  3TI0 A;  3LDN A;  2DPN A;  1DKG D;  1X1P A;  4BC2 A;  3NMU A;  4YDU A;  1OVY A;  1ESV A;  1HYZ A;  4BR9 A;  4OKK A;  2P9U B;  2HHV A;  4JKA A;  3R8E A;  1JLQ A;  4LFA K;  4KV8 A;  3VEV A;  4H0P A;  2GBZ A;  5JLH A;  4CK1 A;  4DR4 K;  2QKB A;  4G9Z A;  1KCF A;  4CEE A;  4V19 S;  3SMS A;  1XUP O;  4F2S A;  4GKJ K;  5AZJ A;  1HUX A;  1U6Z A;  5JLF A;  2GUP A;  2E6M A;  1N34 K;  1B9F A;  5CR4 A;  1NJZ A;  4X62 K;  3I56 N;  1CZA N;  5AQG A;  4Z4H A;  2QWP A;  2EHG A;  2UXD K;  1OH7 A;  4DSK A;  1L3U A;  3VEW A;  1JCE A;  3P1G A;  5HRR A;  3VEO A;  4CJW A;  4LF6 K;  3E9P A;  4OGC A;  3KZB A;  3UIQ A;  1TAQ A;  3LL3 A;  2BUP A;  4MDB A;  4I7F A;  3MX5 A;  4BRI A;  4AH9 A;  3G71 N;  3SJJ A;  2QWR A;  1U45 A;  1KVA A;  1X3M A;  4BG9 A;  4CEA A;  3HJF A;  4I6M B;  3HRG A;  2YHB A;  4BRC A;  1X9S A;  4DG1 A;  3TAP A;  1IV0 A;  2UU9 K;  4J8F A;  3I8D A;  5LY3 A;  1DLO A;  3UKR B;  2XHB A;  3F9M A;  4YOT A;  4C8N A;  2F7T A;  3CJ9 A;  4KB1 A;  2OTJ N;  4CJL A;  3U8X A;  1K6Y A;  1VSH A;  2QTD A;  4A5A A;  1EO1 A;  3VEX A;  1BA1 A;  4KHP K;  3CG7 A;  2BH1 A;  3VGK A;  3ZX2 A;  5D3G A;  4F4K A;  3FE1 A;  4LF7 K;  3V9W A;  4CEO A;  2NNW A;  4E7I A;  3JSM A;  5KGX A;  5GAH P;  1J9A A;  1VRU A;  2B6A A;  5BR8 K;  4JLH A;  3V9U A;  3M8R A;  3HVT A;  3O3G A;  3VQE A;  3LP0 A;  3DRS A;  2UUB K;  3P39 A;  1UA1 A;  5M1Q A;  2P1J A;  3GL1 A;  4MO4 A;  4BGA A;  1DTT A;  2IC3 A;  1C0T A;  2AP1 A;  3LDP A;  3O3F A;  3MXI A;  2X74 A;  3ZSY A;  4F8R A;  1BGX T;  5CZ2 A;  3NF7 A;  1Q82 O;  2YNG A;  1QZ6 A;  1NKC A;  4Z4C A;  3S41 A;  3I0S A;  3QER A;  1T05 A;  2HF4 A;  3LAL A;  4N76 A;  1KFS A;  1D9D A;  4C1N K;  1KLM A;  3BEX A;  3UE5 A;  5AJ3 K;  3IDH A;  3CC2 N;  2O8E A;  2O8F B;  1NLV A;  4FWS A;  1KC8 O;  2P9I A;  2Z1J A;  4WQ5 C;  3O3H A;  1JL2 A;  3H3O B;  4AHS A;  3CCJ N;  4DTP A;  4Z94 A;  5AQP A;  3DRR A;  3HM8 A;  1LWE A;  4AM7 A;  5JS2 A;  1BG3 A;  2AJQ A;  4E89 A;  4CK3 A;  1TYQ A;  3KKR A;  1SZ2 A;  3QBX A;  4IO8 A;  2B5J A;  4LF8 K;  2QXF A;  3A5M C;  3D45 A;  4E1N A;  3AVF A;  4FO0 A;  1W7A A;  2RE2 A;  4DTJ A;  1X9J A;  4CEQ A;  1REV A;  1Z05 A;  4CHN A;  4CGG A;  1SQK A;  3F2K A;  4NLC A;  1VQ6 N;  3VOV A;  4DV0 K;  3SUN A;  2YNI A;  3WNF A;  3AVA A;  1U47 A;  5I42 A;  2DY4 A;  4F3T A;  3CPE A;  4Y1C A;  5C0Y A;  4W5Q A;  1XC9 A;  1M1K O;  2P9K B;  3MEG A;  2PAV A;  1BCO A;  3J7A P;  4OPK A;  4FJ5 A;  3H3N O;  3I8B A;  4A2A A;  4CJK A;  3L2R A;  4CK2 A;  2OTL N;  5C15 A;  3T19 A;  1VQN N;  2ZM6 K;  4JAX A;  4HHT A;  3ULE B;  1I39 A;  3KLH A;  3SQ4 A;  3OW2 M;  3EN9 A;  3P5J A;  2O8B B;  3SPY A;  3DLK A;  4BRM A;  2VG7 A;  1NGA A;  4H8K A;  4CF8 A;  4NLB A;  3LZJ A;  4B9U A;  4OLA A;  2QA4 N;  3HPO A;  1BCM A;  1VHX A;  4H03 B;  4PA1 A;  1LCU A;  1LAW A;  2HNY A;  3AY9 A;  1BA0 A;  3OTO K;  5LJV A;  5GIO A;  4K41 A;  3BDP A;  4KH6 A;  1DT9 A;  1KVB A;  3ZSQ A;  1YTU A;  4LFB K;  1J5E K;  2GWJ A;  1X9M A;  1LOT B;  4ISF A;  4F9O A;  3ULD A;  3OYJ A;  2UUC K;  3SQ0 A;  3ZSW A;  4U67 L;  3M6G A;  4FLU A;  1Z6R A;  3OYM A;  3AVB A;  3VMF B;  4CHQ A;  4RWT A;  2NRZ A;  3HPH A;  3NAE A;  4M3Z A;  4B08 A;  1ZBU A;  2EX3 A;  4TSX A;  2VQE K;  1BUP A;  5C2D A;  4CED A;  5J2M A;  1QHA A;  3CCR N;  3D0P A;  3O08 A;  1RBU A;  3K5O A;  2P9K A;  4HCB A;  2F8S A;  1TKX A;  2NZT A;  5EOY A;  4JKE A;  3CC4 N;  1TAU A;  1QSS A;  3WEE B;  4B3S K;  4FK0 A;  1VQO N;  4FOE A;  4B9M A;  3RSE B;  4JV5 K;  3RMD A;  1KFD A;  1MDU B;  1ILY A;  3KKS A;  4CZG A;  5KQD A;  3GBT A;  4JI5 K;  4YOV A;  1ZYQ A;  4X64 K;  3R6M A;  4CHP A;  4Q0B A;  3CER A;  2KFN A;  4DR1 K;  4BR5 A;  3CIP A;  3VA3 A;  4CEC A;  4PUO A;  1VQK N;  4F3O A;  1BWF O;  2A3Z A;  4EHT A;  3AVI A;  3WUH A;  3QEI A;  1S5J A;  3L4Q A;  1C1C A;  1X9W A;  4AHC A;  3IFR A;  2HVI A;  4G1Q A;  3K5L A;  3QIC A;  3H6E A;  1WLJ A;  2Z1G A;  3TAR A;  1EQY A;  4ZTF A;  3KJV A;  4JHD A;  5BN8 A;  3OHR A;  2FBT A;  4WE1 A;  4IWV A;  1MA9 B;  1XI1 A;  4PY5 A;  1JLB A;  1J53 A;  4ELU A;  4M3W A;  3ZET A;  3CM6 A;  5FPE A;  1EP4 A;  2AA4 A;  4FW1 A;  1N5Y A;  4FJI A;  4JK9 A;  3SBT A;  2ETJ A;  4JI3 K;  2ASO A;  3LDL A;  3C6U A;  4IDK A;  1NK4 A;  4BAC A;  4DLE A;  3CI5 A;  1TK8 A;  4M7Y A;  1S1T A;  1U2V B;  2HNZ A;  1Y97 A;  3RR7 A;  3TTD A;  4YDU C;  2GEL A;  1K8K A;  2NRR A;  5BRD A;  3TSQ A;  2PBD A;  3CQ8 A;  1HKB A;  2YHA A;  2ZF5 O;  5AQV A;  4KAZ A;  5I9E B;  3KK2 A;  5AQF A;  3IAY A;  1RGI A;  4MLE A;  5C10 A;  3DI6 A;  5JVG L;  3TAG A;  4NCA A;  1VQM N;  1QZ5 A;  3HP9 A;  2P9L B;  2WTU A;  3VQC A;  1QVF M;  3HM9 A;  2BGG A;  5GIN A;  3BUZ B;  4RW9 A;  3QET A;  3F5T A;  3TWH A;  3PX6 A;  2P9N A;  2F96 A;  3RSE A;  4FW2 A;  1NGH A;  1TKT A;  3AA3 A;  1HMV A;  4JNE A;  1YXQ A;  1DGK N;  1U04 A;  3KWG A;  5EU7 A;  3R3L A;  2E2O A;  4K8Z A;  4EP5 A;  1NK5 A;  4M3Y A;  3HPG A;  3VF4 A;  2OAN A;  4JKD A;  1W0H A;  5LMU K;  3NF8 A;  1A5V A;  3THY B;  3HK2 A;  4LF9 K;  1GOB A;  4GMJ B;  1TL3 A;  3QEV A;  4AHV A;  1OVQ A;  3GDQ A;  1T8E A;  1I94 K;  3VQ7 A;  4M3U A;  1UA0 A;  4FWQ A;  1LW2 A;  2YKM A;  3VQA A;  2KTQ A;  3SYZ A;  4WCE L;  1D8Y A;  1FK9 A;  4AIL C;  4BR7 A;  3AVN A;  4IJA A;  2QWQ A;  5CY4 A;  1ASU A;  4LD0 A;  4BR2 A;  1VQ7 N;  4E1M A;  3AVJ A;  3SCX A;  2Q0R A;  1KSP A;  5AFU H;  5AQZ A;  2QM1 A;  4BDZ A;  5AFU A;  5AZI B;  3DLL L;  2D1K A;  5SZT A;  4B1Z A;  2CGK A;  4RW8 A;  4FJH A;  3H08 A;  4A59 A;  1BQM A;  4KHY A;  2NRT A;  4DS5 A;  3PIP L;  2P51 A;  4LF5 K;  3O1B A;  1HJO A;  4FWR A;  3T3F A;  3C95 A;  3RR8 A;  3B6P A;  2O8C A;  1RTH A;  3AAQ A;  4F2R A;  1SKR A;  4C1N I;  4GV3 A;  4L8R B;  4RG8 A;  3O4N A;  4FJX A;  3J7Y P;  1XMQ K;  2VYP A;  1LAV A;  3RMC A;  1ASW A;  4B8A B;  4WF9 L;  3VEY A;  3H46 O;  3THY A;  3CF5 L;  5LL6 Z;  3BZK A;  5EY4 A;  2HND A;  2UXB K;  3KD5 E;  5J2P A;  1WSF A;  3RMA A;  2QWN A;  1NK6 A;  3HO1 A;  5LJW A;  4AHR A;  1N36 K;  3K58 A;  3CFR A;  4FM2 A;  3QEX A;  4EZ6 A;  2VWK A;  1KLN A;  1Q8I A;  2FSJ A;  2QK9 A;  3T1H K;  4I9Q A;  1O1W A;  2F8T A;  3ASM A;  4CW7 B;  4OO1 J;  2FF3 B;  1KTQ A;  4DSF A;  4CZE A;  4FJ7 A;  1VSM A;  4H0V B;  4O8U A;  1ATN A;  2R7Y A;  4K8X A;  4KKO A;  2HBJ A;  4BWJ A;  1GLD G;  1SL1 A;  1ATR A;  2IDO A;  4JKG A;  3VQP A;  4DTM A;  1Y64 A;  3SK3 A;  3THX A;  1IKX A;  4CJF A;  1TL1 A;  4XEI A;  4E3S A;  3PO4 A;  4OPH A;  2ZJQ L;  4CVN E;  5BN9 A;  4BRA A;  4IZ9 A;  4JKC A;  4CFD A;  4WQ4 C;  3MWP A;  2BDP A;  1RCH A;  3AO3 A;  4O44 A;  4KFB A;  3OYB A;  2HF3 A;  4ID5 A;  1GLF O;  3CMA N;  1TUY A;  5AQW A;  4CFC A;  4YY3 K;  2E88 A;  5AQN A;  3EZ5 A;  4FZZ A;  3OA9 A;  1IKY A;  2GTD A;  3KLI A;  4JS5 A;  3CCV N;  1OKJ A;  1RBT A;  3QNO A;  1GOA A;  3A5L C;  3OYK A;  2BAN A;  1ATS A;  1TGO A;  4JD2 A;  4FJK A;  5JIC A;  1G15 A;  3MK6 A;  3F73 A;  4OKE A;  1VSK A;  2NRX A;  4IBN A;  5AR0 A;  1O13 A;  1S9E A;  4CJ7 A;  3VEN A;  3I33 A;  5FPM A;  3Q7C A;  1JCG A;  1CXU A;  5CYQ A;  3QFU A;  5FRM A;  3ID8 A;  2GWK A;  3AO5 A;  4IG3 A;  1U49 A;  5BPM A;  1S72 N;  4B1U B;  3SPZ A;  3SUP A;  4CJ5 A;  4DV7 K;  2HHW A;  4DQS A;  3QBW A;  5HLF A;  3O80 A;  4CGF A;  1ZXO A;  2O8E B;  2D0P A;  2HMP A;  3OYL A;  4DWI A;  3SLC A;  2P9I B;  3RVC A;  2DFF A;  3FZK A;  4O5B A;  2PY5 A;  4FWL A;  4DV6 K;  2A6A A;  4BDP A;  3TTF A;  3K9K A;  4UQG A;  4FWP A;  3VQ6 A;  3AAR A;  4FK2 A;  2ZQB A;  4CER A;  2E6L A;  3PV8 A;  3O9U A;  1TYQ B;  4Z4I A;  1Z25 A;  4FJL A;  1HNI A;  1W97 L;  5KPT A;  4IEE A;  3HSC A;  4CZK A;  1NOY A;  3QFP A;  3HOT A;  3O8M A;  1WBD A;  4PL8 A;  3TSP A;  4DTR A;  2D0C A;  4JN4 A;  1JLF A;  2ZE2 A;  3QEP A;  3OYG A;  1U4B A;  2ZJP L;  3DXM A;  4DUZ K;  1ZC6 A;  1QS4 A;  4Q5V A;  4E1J A;  4QAG A;  3K5N A;  4QCL A;  1G99 A;  3HYF A;  3PUF A;  3W3D A;  5BRE A;  4CZH A;  5BRH A;  3U3Y A;  1IKV A;  4PWD A;  4E7L A;  3LAN A;  1EET A;  2DFH A;  3SMP A;  1LWC A;  4I2P A;  3V6D A;  2VGN A;  1HQE A;  3M3Z A;  1D5A A;  5GAG P;  4IOA L;  5BPN A;  2D0O A;  4B9T A;  1EXQ A;  4QS9 A;  5J1E A;  3ITH A;  5AQR A;  4QS8 A;  3V9S A;  3CCS N;  2KZM A;  1NG9 A;  3A2F A;  3L4I A;  1HYS A;  3FLC O;  2Q36 A;  3P31 A;  3LDO A;  3ATU A;  5BPL A;  4WFB L;  4FZY A;  3DYA A;  5FDL A;  3C6T A;  3T69 A;  3DOK A;  4GV9 A;  4B9L A;  1WNS A;  2OPR A;  4GKK K;  3SUO A;  5KPR A;  5ADX H;  4DUY K;  4WYB A;  3IUC A;  3E01 A;  2O4I A;  1SL2 A;  5ADX A;  3PX0 A;  2FBX A;  2ITM A;  5JS1 A;  3HST B;  4H4M A;  1KVC A;  4OX9 K;  1HR0 K;  3L2Q A;  4FCY A;  2W40 A;  3VF6 A;  4IXC A;  4OPA A;  2QEX N;  1ZBH A;  1JLG A;  2HMI A;  2OA8 A;  3J81 O;  1IBK K;  1IH7 A;  1NKE A;  4GNI A;  1QQN A;  1RT1 A;  3LP2 A;  4AF1 A;  4LF4 K;  3MN7 A;  3U9D A;  3CJC A;  4FK4 A;  3V9X A;  2Q0U A;  2ASM A;  4DHY A;  1D4X A;  3A5N C;  3SAH A;  4M45 A;  5FRN A;  2OPP A;  5AQX A;  5A2Q O;  3AVG A;  1GLC G;  1WSG A;  5MLC Q;  5HRP A;  4GVM A;  2V51 B;  1L3V A;  1NGB A;  3FZM A;  3KVG A;  1GOC A;  4JI6 K;  4DF8 A;  4NYN A;  3UKU B;  4FJG A;  1NMD A;  3ZT1 A;  3RMB A;  5FPN A;  4PL7 A;  3VA0 A;  5LMN K;  4CZL A;  4DR2 K;  1WOQ A;  3OY9 A;  3NHG A;  3MN9 A;  4ISG A;  1J6Z A;  4KHW A;  1E4G T;  4XH4 A;  4NXM K;  3DXK A;  1BI4 A;  4KB0 A;  3E9L A;  2P9P B;  1NOZ A;  5C12 A;  4KPY A;  3H1Q A;  4HUG A;  2HOE A;  4K43 A;  2VGM A;  4JHD B;  5AQI A;  5IT9 O;  3EEQ A;  4KTZ A;  5GIP A;  3ZET B;  4BRG A;  4OVL A;  3JXU A;  3ZSV A;  5T7B A;  2XY7 A;  1WAF A;  4BGB A;  1VSD A;  2DTU A;  2IVN A;  1XMO K;  4JEP A;  4DTU A;  3T1A A;  5DM6 L;  2IS3 A;  4CIF A;  1K8K B;  4H5V A;  2NRW A;  4M41 A;  2JWK A;  3AVL A;  4CJE A;  4IFY A;  1NGE A;  1C0F A;  2WBN A;  2ITG A;  3PLA A;  4IFE A;  4JI2 K;  3VER A;  1B9D A;  3VET A;  4FM1 A;  1EX4 A;  1C0M A;  3AO1 A;  5AQK A;  4X65 K;  1I3A A;  2VWB A;  2QWO A;  3O4W A;  5FLX O;  5CZ1 A;  1S6Q A;  4AHT A;  3K0S A;  4EIA A;  3CFP A;  4DV5 K;  3RTV A;  2J4R A;  3QML A;  4DR3 K;  1NGI A;  4AHU A;  3UKU A;  4QS7 A;  4H0Y B;  3CJB A;  2HHS A;  4O4G A;  4O5F A;  4IOX A;  2P9N B;  3IMX A;  1HPZ A;  2Y1J A;  1XC3 A;  2OZS A;  3C0B A;  2HBM A;  3MXM A;  1WSH A;  1WBB A;  4FM0 A;  4DU4 A;  5B8H A;  2XY6 A;  3TAN A;  4YOR A;  3J8A A;  2WUS A;  3N4Q A;  4CJU A;  3NE6 A;  1LW0 A;  4B3T K;  4B1X B;  3WNH A;  3OJU A;  3VQ9 A;  2E1Y A;  5HRS A;  1BHL A;  3LP1 A;  3S3O A;  4PKI A;  3LPT A;  3CQY A;  4M3R A;  5BRF A;  5EXW A;  4O0J A;  4CZM A;  3TAF A;  2E2P A;  1JJ2 M;  4OJR A;  5GAE P;  2P9P A;  1YIJ N;  1T3V A;  2XO7 A;  3TAQ A;  1TV6 A;  3VGM A;  4B3O A;  3ISN C;  3KK3 A;  2Q31 A;  4FJN A;  1C1A A;  1IO2 A;  5AQY A;  4DU3 A;  2F9W A;  5AQJ A;  1YJN N;  3EO3 A;  1NK0 A;  4FWM A;  1E4F T;  3LDS A;  3T1Y K;  4Z0U A;  3EL2 A;  5M1P A;  4DTO A;  2G8F A;  3AO4 A;  4CD1 A;  1WSJ A;  1P8Z A;  2HHQ A;  4C8M A;  3TAB A;  1K9M O;  2X6S A;  1SS6 A;  4J2B A;  4Z4G A;  3ZSO A;  4KTQ A;  5IWA K;  4W5T A;  1TKD A;  1JLC A;  5KGW A;  1Q86 O;  4H4O A;  4HWI A;  1WSE A;  3AVK A;  2WC9 A;  4DMN A;  2YHX A;  4NYF A;  2QWM A;  4M7X A;  1NK9 A;  4DQ8 A;  1GLB G;  4BRQ A;  1WUA A;  1TKZ A;  3MED A;  4Z4F A;  3BY5 A;  3D2F B;  2GV9 A;  5K14 A;  3KLF A;  1WSI A;  1YAG A;  1RBR A;  3PSI A;  4KBO A;  3ENB A;  3MEE A;  4Z4E A;  2O8C B;  3NF6 A;  4WQ5 A;  5F2R A;  4FZX C;  4GV6 A;  5DK5 A;  3PO5 A;  1KXP A;  3TU5 A;  1BQN A;  3DLH A;  4FYD A;  3MAQ A;  1E3M A;  3A8Y A;  3CQX A;  3PSF A;  1S1U A;  3ZSR A;  2E1Z A;  3TTC A;  4C8K A;  1QSL A;  2V52 B;  2YHW A;  4FJJ A;  2XRI A;  3M5R A;  4CGD A;  4FLZ A;  2UUA K;  2HST A;  4B1W B;  3THV A;  5ELZ A;  3K59 A;  3NBP A;  1HKC A;  1RT4 A;  2GEM A;  2PFU A;  3OBW A;  2VCP A;  1KQS M;  1VQ4 N;  4B3R K;  5KTQ A;  4FPB A;  3CFO A;  1Q18 A;  2YV0 X;  4CE9 A;  1TUU A;  3OS0 A;  3U4L A;  3M8S A;  1T6C A;  1XWL A;  4FVM A;  1RT6 A;  1N6Q A;  2ZD1 A;  2O8D A;  4K0K K;  2X6N A;  4DTX A;  3L2V A;  3QIO A;  3GG4 A;  4PKH A;  4E0D A;  2EWS A;  4LH4 A;  2QW9 A;  4E7K A;  4CIE A;  3HVR A;  2NUB A;  4JKG B;  1BL3 A;  4GW6 A;  3HXM A;  4AQY K;  3QEW A;  3CJ1 A;  3OYF A;  3CCL N;  3L8B A;  2KLA A;  1ZBF A;  2Q3S A;  3THX B;  3J80 O;  2I7P A;  2UXC K;  2IAJ A;  4XIU A;  2KHO A;  1NU0 A;  3CYM A;  3F9K A;  5EVZ A;  4CCH A;  3EZW A;  1SKS A;  4JI8 K;  3SJH A;  4CFA A;  4E7J A;  3VGL A;  4DLG A;  4CHZ A;  4LFC K;  3D2F A;  1HNX K;  1WN7 A;  1JXB A;  3AO2 A;  2F4V K;  1YT3 A;  2JLE A;  3THW B;  2E2Q A;  1N32 K;  4KH5 A;  3G6E N;  1VSE A;  5AQO A;  1RNH A;  4BR4 A;  2ZWH A;  4JI1 K;  3AVH A;  3KTQ A;  4E19 A;  4JD2 B;  3FZF A;  3VQQ A;  4AM6 A;  2RHK A;  2I5J A;  1FJG K;  3H1V X;  1V4T A;  3M8P A;  2OYQ A;  1HLU A;  3O5B A;  1EWQ A;  1IJJ A;  3QIP A;  1C1B A;  2OPQ A;  1BOT O;  4HVJ A;  3U9Z A;  3G25 A;  5FPD A;  3OYH A;  4DV4 K;  3G4S N;  2D0B A;  2CGJ A;  3KK1 A;  2YJF A;  1C0U A;  4J2D A;  3L6Q A;  3MDQ A;  3ZT3 A;  2HBK A;  3KWI A;  4RW6 A;  3DOL A;  4BG8 A;  1GLA G;  3MMV A;  3AVM A;  1TVR A;  4NO7 A;  4BC3 A;  1T7P A;  1Z26 A;  2VWJ A;  1NJW A;  5J2N A;  2X78 A;  3V1Q A;  1VSI A;  3WXJ A;  2A41 A;  2A42 A;  1C0G A;  1RDD A;  1WB9 A;  2NRV A;  3L2W A;  3NGZ A;  2G8W A;  3TSU A;  3AVC A;  3KHY A;  2IGI A;  3A0I X;  4N47 A;  4W5N A;  4CZJ A;  3V9Z A;  3LPU A;  4M63 C;  4NCG A;  4DQQ A;  1YJW N;  1XHX A;  3C7N A;  4IJN A;  1RT2 A;  4BE1 A;  4NB4 A;  5HBM A;  3DXM B;  4ILG B;  1VSF A;  1L5U A;  4IDH A;  4CJ3 A;  1QSY A;  3D2E A;  3ZEU A;  1R59 O;  3ZT0 A;  1Q9Y A;  1S1V A;  2QKK A;  2PYJ A;  1IBM K;  4HCC A;  1J5O A;  4BQZ A;  5C24 A;  3THW A;  3NH0 A;  4DFP A;  1VQ5 N;  3LAM A;  4ILH A;  2IVO A;  4YOY A;  1SV5 A;  4JKH A;  3OYC A;  1OH5 A;  5AQU A;  2GX9 A;  4IEI A;  4JI4 K;  4BRE A;  3HI0 A;  4BWM A;  4YOW A;  3OVN A;  3EYZ A;  2LSN A;  1VQP N;  3PIO L;  4DV2 K;  1J54 A;  1P90 A;  2IVP A;  1RTI A;  4OGE A;  4A2B A;  4DS4 A;  3WXI A;  3L3U A;  4OKJ A;  5AQT A;  4H5W A;  5C42 A;  1YTA A;  4CZI A;  4W5O A;  4BQL A;  3LM9 A;  1HX1 A;  2Z1H A;  3DWL A;  4CBW A;  3TAM A;  1RT7 A;  3BZC A;  4BRL A;  4B3M K;  4RW7 A;  4K25 A;  2HB5 A;  3C6H A;  4JI7 K;  3NVK A;  2GUI A;  1HKG A;  1NWK A;  4KRE A;  4YFU A;  1IBL K;  3NGY A;  2HBL A;  3O9S A;  4ILJ A;  2G8V A;  3O9T A;  3WT0 A;  3VES A;  4DTN A;  3CPW M;  2CGL A;  3LDQ A;  4PQU A;  3NFA A;  3K9J A;  3B8A X;  4EP4 A;  2KFZ A;  3O1W A;  4C23 A;  4CJQ A;  3VQD A;  1S3X A;  3WXL A;  2XY5 A;  3FFI A;  2FC0 A;  1NGG A;  2E2N A;  4DSL A;  4BRP A;  2Q97 A;  3OYI A;  2Y1I A;  1QQM A;  4CGJ A;  3Q7B A;  1WAJ A;  1YHQ N;  3OS1 A;  4GY2 B;  2RPI A;  2W6K A;  1HRH A;  1MU2 A;  1QE1 A;  3D6R A;  3HZ6 A;  4FJ8 A;  1FKO A;  3I55 N;  3WNG A;  4R5P A;  1IG8 A;  2BTF A;  1Q7Y O;  3FZH A;  3NDK A;  2YNH A;  1YI2 N;  3OYN A;  3JS6 A;  3MWT A;  1MWK A;  1EKE A;  2W42 A;  1JLE A;  2H3G X;  3G10 A;  2P9U A;  4BR0 A;  1CZ9 A;  4E7H A;  3E1Y A;  3DJC A;  1LWF A;  1NJI O;  4DFM A;  1CLQ A;  4Y1D A; 
#chains in the Genus database with same CATH homology
 2PYL A;  4IFY A;  1W0H A;  1CXQ A;  3NF8 A;  3M8Q A;  1A5V A;  4ID1 A;  1ITG A;  3P83 D;  2ITG A;  1GOB A;  3ZCM A;  3ZSX A;  1BIZ A;  3TAE A;  1BI4 B;  3VQ4 A;  4CF2 A;  4ELV A;  4GMJ B;  4CGH A;  1B9D A;  4FM1 A;  1SL0 A;  2XY8 A;  1QHT A;  4B9V A;  1TL3 A;  1EX4 A;  3QEV A;  3QNN A;  2VG6 A;  1C0M A;  3AO1 A;  5E41 A;  2A1R A;  3K2P A;  4AHV A;  5HRO A;  3DLR A;  5C25 A;  1IG9 A;  1I3A A;  1T8E A;  2HHX A;  4LH5 A;  3VQ7 A;  4M3U A;  5CZ1 A;  1QTM A;  4CIG A;  1BIU A;  1S6Q A;  4AHT A;  3CFP A;  3RTV A;  1UA0 A;  1DTQ A;  3NH1 A;  4DQR A;  3U6F A;  1LW2 A;  2YKM A;  3VQA A;  2KTQ A;  4AHU A;  3SYZ A;  3DMJ A;  5FRO A;  3TI0 A;  1U48 A;  1D8Y A;  1VSJ A;  1FK9 A;  4AIL C;  1X1P A;  3AVN A;  2HHS A;  4O4G A;  1HPZ A;  2Y1J A;  2OZS A;  4CJP A;  5CY4 A;  1ASU A;  1HYZ A;  4OKK A;  2HHV A;  4LD0 A;  3MXM A;  1WSH A;  1CZB A;  2RF2 A;  4FM0 A;  4MFB A;  4NCB A;  4DU4 A;  2XY6 A;  3TAN A;  4E1M A;  3AVJ A;  3SCX A;  1JLA A;  4CJU A;  4FJ9 A;  1JLQ A;  3NE6 A;  3V4I A;  1LW0 A;  3ZT4 A;  4KV8 A;  3WNH A;  3OJU A;  3VQ9 A;  4FLT A;  1KSP A;  4FXD A;  3S3O A;  5HRS A;  1BHL A;  2GBZ A;  3LP1 A;  3LPT A;  4OLB A;  4B8C A;  4M3R A;  4CK1 A;  4BDZ A;  4O0J A;  3TAF A;  3SQ2 A;  2QKB A;  4OJR A;  5SZT A;  1KCF A;  4CEE A;  4F2S A;  3QES A;  3NF9 A;  2XO7 A;  4N56 A;  3TAQ A;  3RWU A;  4RW8 A;  4FJH A;  3H08 A;  1TV6 A;  2BE2 A;  5I3U A;  1BQM A;  4KHY A;  4B3O A;  1KRP A;  1S6P A;  3ISN C;  4DS5 A;  3KK3 A;  3LWM A;  3ZT2 A;  4FJN A;  2P51 A;  2E6M A;  1C1A A;  1TK5 A;  1B9F A;  1NJZ A;  1IO2 A;  1NKB A;  4Z4H A;  4DU3 A;  2EHG A;  3T3F A;  3C95 A;  1NK0 A;  3RR8 A;  4DSK A;  3B6P A;  1L3U A;  1RTH A;  4F2R A;  3LDS A;  3P1G A;  1SKR A;  1ASV A;  2FBV A;  4Z0U A;  5HRR A;  4DTO A;  2G8F A;  4L8R B;  4CJW A;  4RG8 A;  3AO4 A;  4OGC A;  3O4N A;  4FJX A;  4CES A;  3TR8 A;  3K5M A;  4BE0 A;  1TAQ A;  3UIQ A;  1WSJ A;  2HHQ A;  1LAV A;  4C8M A;  3TAB A;  3RMC A;  1ASW A;  3LP3 A;  4B8A B;  2X6S A;  4I7F A;  4J2B A;  4Z4G A;  3ZSO A;  4AH9 A;  4KTQ A;  3SJJ A;  2JGU A;  1TKD A;  4W5T A;  1JLC A;  2HND A;  5KGW A;  1U45 A;  4IG0 A;  4EZ9 A;  4ZHR A;  4H4O A;  3KD5 E;  1KVA A;  5J2P A;  1NK8 A;  2HW3 A;  4JS4 A;  3V81 A;  1WSF A;  4CHY A;  4CEA A;  4DU1 A;  3RMA A;  3HJF A;  3HK2 A;  3OJS A;  2YHB A;  1WSE A;  1NK6 A;  3AVK A;  3HO1 A;  1RDA A;  1X9S A;  4DG1 A;  3TAP A;  4DMN A;  1RT5 A;  4CFB A;  4NYF A;  4AHR A;  3I8D A;  1DLO A;  3S9H A;  1NK9 A;  3K58 A;  3CFR A;  3KIO A;  2XHB A;  3MED A;  1TKZ A;  4C8N A;  4FM2 A;  4Z4F A;  3QEX A;  4EZ6 A;  2VWK A;  1S9G A;  2GV9 A;  4I2Q A;  1Q8I A;  4ZTJ A;  1KLN A;  4KB1 A;  2QK9 A;  5K14 A;  3K57 A;  4CJL A;  2G8I A;  3KLF A;  4I9L A;  1K6Y A;  1VSH A;  1O1W A;  1WSI A;  3KLG A;  4I9Q A;  3ASM A;  2F8T A;  1RBR A;  3BGR A;  3VQ8 A;  4DTS A;  3CM5 A;  3CG7 A;  3LAK A;  3MEE A;  1KTQ A;  4DSF A;  4Z4E A;  3AV9 A;  3NF6 A;  3ZSZ A;  2FBY A;  4FJ7 A;  1RBV A;  4FZX C;  5DK5 A;  1S1X A;  2A1S A;  3PO5 A;  1A5W A;  1RDC A;  1VSM A;  3JYT A;  4F4K A;  5D3G A;  3V9W A;  4CEO A;  4E7I A;  1BIS A;  1BQN A;  3JSM A;  2G8H A;  3DLH A;  1S1W A;  5KGX A;  4FYD A;  4KTW A;  3MAQ A;  4N41 A;  2R7Y A;  4K8X A;  1J9A A;  3HP6 A;  1VRU A;  2B6A A;  4KKO A;  4DSI A;  1S1U A;  3ZSR A;  4JLH A;  4BWJ A;  3RRH A;  3V9U A;  1SL1 A;  3M8R A;  4C8K A;  3HVT A;  2IDO A;  3O3G A;  3VQP A;  3VQE A;  1QSL A;  3LP0 A;  5SWM A;  3DRS A;  4KHU A;  1HYV A;  4DTM A;  4FJJ A;  1UA1 A;  2XRI A;  4CGD A;  4FLZ A;  2P1J A;  4CJE A;  3EY1 A;  4DFJ A;  1IKX A;  4CJF A;  1DTT A;  1TL1 A;  2IC3 A;  1C0T A;  3O3F A;  2OZM A;  3THV A;  3K59 A;  4C8L A;  3V1R A;  3NBP A;  3KLE A;  3MXI A;  2X74 A;  3ZSY A;  4FLW A;  4E3S A;  1UAX A;  4DFK A;  1BGX T;  3PO4 A;  4F8R A;  2HHT A;  5CZ2 A;  1RT4 A;  4CEB A;  4YNQ A;  3NF7 A;  3G0Z A;  2YNG A;  4CFD A;  3CFO A;  4IFV A;  5KTQ A;  2BDP A;  4LY7 A;  4KRF A;  1NKC A;  3S3M A;  2YV0 X;  4CE9 A;  4Z4C A;  3SV3 A;  3OS0 A;  1RCH A;  3I0S A;  3QER A;  1T05 A;  3SZ2 A;  2KZZ A;  3LAL A;  4N76 A;  3M8S A;  1KFS A;  3AO3 A;  4O44 A;  4KFB A;  3OYB A;  1XWL A;  1D9D A;  5CYM A;  4FVM A;  1RT6 A;  1KLM A;  4ID5 A;  1N6Q A;  3DM2 A;  4CJR A;  1Q9X A;  2E4L A;  2ZD1 A;  4CF9 A;  3SNN A;  4DF4 A;  3MXJ A;  3SQ1 A;  2X6N A;  4CFC A;  3EZ5 A;  4FZZ A;  4DTX A;  1ZBI A;  1IKY A;  4OPJ A;  3L2V A;  3KLI A;  3QIO A;  4JS5 A;  1LV5 A;  1RBT A;  4E0D A;  3QNO A;  4LH4 A;  3L3V A;  2Z1J A;  3O3H A;  3SUQ A;  1GOA A;  4HUE A;  3OYK A;  2BAN A;  1JL2 A;  4E7K A;  4CIE A;  4AHS A;  1B92 A;  4DTP A;  3HVR A;  1TGO A;  1VK0 A;  2NUB A;  1BL3 A;  4GW6 A;  3DRR A;  4FJK A;  3HXM A;  3QEW A;  1G15 A;  1LWE A;  3F73 A;  3OYF A;  4OKE A;  1VSL A;  5J2Q A;  1F21 A;  5JS2 A;  2Q3S A;  1ZBF A;  3L8B A;  1VSK A;  2AJQ A;  3AA5 X;  4E89 A;  4CK3 A;  4IBN A;  3KKR A;  2IAJ A;  4KHN A;  4XIU A;  4N5S A;  2B5J A;  3CYM A;  3DRP A;  3F9K A;  1S9E A;  3LWL A;  4CCH A;  2QXF A;  4CJT A;  4ICL A;  3D45 A;  4E1N A;  3AVF A;  3NGI A;  1SKS A;  5CYQ A;  1CXU A;  4CFA A;  4E7J A;  5FRM A;  3AO5 A;  1TK0 A;  4DLG A;  4CHZ A;  2ATQ A;  4CEQ A;  4DTJ A;  1REV A;  4IG3 A;  4CHN A;  1U49 A;  4CGG A;  1WN7 A;  1JXB A;  3SPZ A;  3SUP A;  3SUN A;  3IG1 A;  2Z1I A;  2YNI A;  3AA4 A;  3AO2 A;  2WOM A;  4CJ5 A;  4DQS A;  2HHW A;  1CLQ A;  3WNF A;  3AVA A;  1YT3 A;  3DLG A;  5I42 A;  1U47 A;  5HLF A;  4DQP A;  4F3T A;  1L3T A;  2DY4 A;  4Y1C A;  1HJR A;  4W5Q A;  2JLE A;  4CGF A;  1XC9 A;  3B6O A;  5KI6 A;  1RT3 A;  3MEG A;  1VSE A;  3OYL A;  4DWI A;  1BCO A;  4OPK A;  4FJ5 A;  1RNH A;  2DFF A;  3AVH A;  1QQC A;  4O5B A;  2PY5 A;  3KTQ A;  4BDP A;  4E19 A;  3VQQ A;  3NH2 A;  1NK7 A;  4CJK A;  3L2R A;  2I5J A;  4UQG A;  3VQ6 A;  4O55 A;  4CK2 A;  4FK2 A;  2ZQB A;  3M8P A;  2E6L A;  4CER A;  3PV8 A;  2OYQ A;  3T19 A;  2RN2 A;  4QOZ B;  1ZBL A;  4Z4I A;  1Z25 A;  5HRN A;  4HHT A;  4FJL A;  3VQ5 A;  4RW4 A;  1HNI A;  1C6V A;  1A5X A;  1C1B A;  1I39 A;  3QIP A;  2OPQ A;  3QIN A;  3KLH A;  3SQ4 A;  4HVJ A;  2RKI A;  3P5J A;  1NOY A;  2HVH A;  3OYH A;  4CHO A;  3SPY A;  2D0B A;  3DLK A;  2VG7 A;  1VRT A;  3LZI A;  4DTR A;  2D0C A;  4LSN A;  3KK1 A;  4CF1 A;  1JLF A;  2ZE2 A;  4H8K A;  3QEP A;  3I0R A;  1C0U A;  4CF8 A;  3OYG A;  1U4B A;  4J2D A;  4M3X A;  1UOC A;  3C94 A;  3ZT3 A;  3LZJ A;  4B9U A;  3U3G A;  3HPO A;  1BCM A;  4RW6 A;  2P5G A;  4OLA A;  3DOL A;  1JXE A;  1QS4 A;  4PA1 A;  4Q5V A;  4QAG A;  1NJX A;  3K5N A;  3PY8 A;  4QCL A;  3HYF A;  4MQ3 A;  3PUF A;  1LAW A;  3AVM A;  1TVR A;  3U3Y A;  3MEC A;  4HUF A;  4W5R A;  2HNY A;  1IKV A;  1T7P A;  1Z26 A;  2D5R A;  1XHZ A;  3ALY A;  2VWJ A;  1RBS A;  3AA2 A;  1NJW A;  4PWD A;  5J2N A;  4IKF A;  2X78 A;  3IRX A;  3VQB A;  3V1Q A;  1VSI A;  3LAN A;  4E7L A;  1D9F A;  1EET A;  1RDD A;  2DFH A;  3BDP A;  2HHU A;  1LWC A;  1KVB A;  4I2P A;  3V6D A;  3VN5 A;  3L2W A;  3ZSQ A;  4O0I A;  4KI4 A;  3NGZ A;  2G8W A;  1YTU A;  1HQE A;  1D5A A;  4KO0 A;  3AVC A;  1X9M A;  4B9T A;  2IGI A;  4J2E A;  1EXQ A;  5J1E A;  3O4Q A;  3ITH A;  4N47 A;  2D0A A;  3ULD A;  3OYJ A;  4W5N A;  1UWB A;  3V9S A;  3SQ0 A;  3ZSW A;  2KZM A;  1HNV A;  3V9Z A;  3LPU A;  4DQQ A;  4NCG A;  3A2F A;  4FLU A;  3OYM A;  3RRG A;  1XHX A;  3AVB A;  3QO9 A;  4BDY A;  1HYS A;  1RIL A;  4DSE A;  1RT2 A;  4BE1 A;  4CHQ A;  5HBM A;  3NCI A;  1L5U A;  1VSF A;  3HPH A;  3NAE A;  2O4G A;  4CJ3 A;  1QSY A;  4M3Z A;  4B08 A;  1HQU A;  1SKW A;  1ZBU A;  2EX3 A;  3PX4 A;  4TSX A;  3ZT0 A;  4JRP A;  1Q9Y A;  1S1V A;  4FLX A;  4FZY A;  4CED A;  4CF0 A;  5J2M A;  3DYA A;  5FDL A;  2QKK A;  3C6T A;  2PYJ A;  4HCC A;  4FLY A;  1J5O A;  3D0P A;  3DOK A;  5C24 A;  1RTD A;  3NH0 A;  4DFP A;  3QLH A;  1WNS A;  4B9L A;  4M3T A;  1RBU A;  2OPR A;  3K5O A;  4HCB A;  2F8S A;  3SUO A;  1TKX A;  3LAM A;  2G8K A;  3OS2 A;  3E01 A;  1SV5 A;  2O4I A;  1SL2 A;  1FXX A;  1TAU A;  3OYC A;  5DMR A;  3PX0 A;  2FBX A;  1R0A A;  1QSS A;  4HTU A;  2KW4 A;  3HST B;  4Y1D A;  4H4M A;  4FK0 A;  5JS1 A;  3DLB A;  2YNF A;  1KVC A;  4B9M A;  3RMD A;  3L2Q A;  4BWM A;  4FCY A;  3OVN A;  2OPS A;  4CJS A;  2KQ2 A;  3EYZ A;  1KFD A;  1SUQ A;  3KKS A;  3SI6 A;  1ZYQ A;  4CGI A;  2LSN A;  5KRT A;  4B9N A;  1JLG A;  2HMI A;  4CHP A;  2OA8 A;  2PZS A;  1ZBH A;  4Q0B A;  1IH7 A;  1NKE A;  3S3N A;  2KFN A;  3SV4 A;  1J54 A;  1RT1 A;  3VA3 A;  3LP2 A;  4CEC A;  4PUO A;  4C8O A;  1RTI A;  3KD1 E;  4OGE A;  4DS4 A;  1RTJ A;  4F3O A;  4FK4 A;  3IS9 A;  3L3U A;  3AVI A;  4OKJ A;  1YVU A;  1JKH A;  3V9X A;  5C42 A;  2B4J A;  1YTA A;  1S5J A;  2VG5 A;  3QEI A;  4DSJ A;  1C1C A;  4W5O A;  1X9W A;  4M45 A;  4AHC A;  5FRN A;  3OYE A;  2Z1H A;  2HVI A;  4G1Q A;  3K5L A;  1IKW A;  2YKN A;  4ZTF A;  1WLJ A;  1RT7 A;  2OPP A;  2Z1G A;  3TAM A;  3TAR A;  4M42 A;  3AVG A;  1WSG A;  3KJV A;  3V1O A;  4RW7 A;  4JRQ A;  4J2A A;  2FBT A;  5HRP A;  4KI6 A;  4WE1 A;  4GVM A;  2HB5 A;  1XI1 A;  4PY5 A;  1JLB A;  2GUI A;  1L3V A;  1J53 A;  4ELU A;  4M3W A;  1GOC A;  3CM6 A;  4DF8 A;  4KRE A;  3WNE A;  1EP4 A;  4NYN A;  4FJG A;  4FW1 A;  4KHS A;  4YFU A;  3ZT1 A;  3DLE A;  1N5Y A;  4FJI A;  4ELT A;  3NGY A;  2ETJ A;  3RMB A;  3C6U A;  1FKP A;  4IDK A;  2G8V A;  3VA0 A;  4BAC A;  3OYA A;  4CEZ A;  1NK4 A;  1T03 A;  4B9S A;  4DLE A;  1TK8 A;  4DTN A;  1S1T A;  2HNZ A;  4PQU A;  3NFA A;  4EP4 A;  1Y97 A;  2KFZ A;  3RR7 A;  1L3S A;  3OY9 A;  4CJQ A;  3VQD A;  2P5O A;  3CQ8 A;  2DFE A;  2YHA A;  2XY5 A;  3NHG A;  4KHW A;  3FFI A;  4KAZ A;  2G8U A;  1BI4 A;  3KK2 A;  2FC0 A;  3IAY A;  4KB0 A;  4DSL A;  1JL1 A;  5KRS A;  1NOZ A;  3OYI A;  2Y1I A;  1NJY A;  4KPY A;  3DI6 A;  4CGJ A;  4HUG A;  1WAJ A;  3OS1 A;  5HP1 A;  2RPI A;  1HRH A;  1MU2 A;  3TAG A;  4DQI A;  4KHQ A;  4NCA A;  1QE1 A;  4FJM A;  4KTZ A;  4CJV A;  4FJ8 A;  1FKO A;  3HL8 A;  3L2U A;  1RDB A;  1W9H A;  3HP9 A;  3WNG A;  4R5P A;  4BE2 A;  4CJ4 A;  4FLV A;  3NDK A;  3VQC A;  2YNH A;  4OVL A;  2WON A;  3HM9 A;  3ZSV A;  5T7B A;  3OYN A;  2XY7 A;  2BGG A;  1WAF A;  4RW9 A;  3QET A;  3TWH A;  1VSD A;  3PX6 A;  2DTU A;  2F96 A;  3HT3 A;  1EKE A;  4FW2 A;  2W42 A;  1JLE A;  1TKT A;  3AA3 A;  1HMV A;  3G10 A;  3T1A A;  4DTU A;  2IS3 A;  5EU7 A;  1CZ9 A;  1U04 A;  3OYD A;  4CIF A;  4K8Z A;  4E7H A;  1LWF A;  4EP5 A;  1NK5 A;  4M3Y A;  3HPG A;  4DFM A;  4LSL A;  4CEF A;  4M41 A;  2IOC A;  3AVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...