4CEBA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cebA00
1SL0A 3VQPA 4CJLA 1FXXA 3OYAA 1T8EA 2FBYA 3DI6A 2FBVA 3LP2A 3OYGA 4AHSA 3OYIA 3ASMA 3EYZA 1KLNA 1LW0A 1SUQA 4ID5A 4KHYA 4PY5A 1S9GA 3VQ7A 3WNHA 3ZSZA 3AA5X 1JXEA 4B8CA 4CGDA 2QKKA 4PA1A 1C1BA 1EKEA 4CJFA 3QNOA 3NCIA 4J2BA 4DTXA 4GW6A 3QIPA 1B9FA 4CE9A 5J2NA 3V81A 1UA0A 2Z1IA 1NK5A 3D45A 1L3VA 4I9QA 3B6OA 4N41A 1ASUA 2IDOA 2YKMA 3VQCA 3V6DA 4DU1A 3I0RA 3QEPA 2HMIA 1DLOA 4CECA 4F2RA 3OYKA 1JKHA 2HW3A 2E6MA 2WOMA 3T3FA 4M3XA 4BE1A 3OYMA 1ZBUA 1ZBFA 3AVIA 3IS9A 4WE1A 3SQ4A 3MEGA 4W5TA 2QXFA 3SUPA 3B6PA 1RTDA 5HRNA 4IG3A 5HLFA 4RG8A 2ETJA 1KCFA 1X9MA 2BANA 1LAWA 3CQ8A 4OJRA 4CHOA 5I42A 4B9NA 3AA2A 4FLUA 1ZYQA 4B9TA 4CHZA 1JXBA 3SCXA 4ZTJA 1XC9A 3RR8A 4B3OA 2HHWA 4DLEA 3TANA 1RBVA 4CEAA 1EX4A 4DTPA 1T05A 4OKEA 1Z26A 2JLEA 3M8RA 1JLQA 1ZBHA 1TK8A 3V9WA 4I9LA 3PX4A 3AA4A 1TK5A 3VA0A 1J54A 4NYFA 1Y97A 3T19A 4DTSA 2Y1JA 5FDLA 1VSJA 3MEEA 1NOYA 2G8FA 3MXIA 3NH1A 3QETA 4CGIA 4O0JA 3SUQA 4B8AB 4CFDA 3ZSOA 2DTUA 4DU4A 1VSEA 1C0MA 3F9KA 3IRXA 1D8YA 3L2RA 3O4NA 5C24A 1N6QA 4CF1A 4KTWA 2B5JA 3SUOA 3WNEA 4FZZA 2G8IA 3NF7A 3CFOA 1NKEA 4CJ5A 3RMAA 1NJYA 3ZSQA 4HCCA 4EZ6A 1XI1A 3ZT4A 3ZT3A 1B9DA 3AVMA 4HUEA 3RMBA 2ATQA 1SL1A 3DLGA 3RRHA 1K6YA 4DTNA 1BQMA 3DOKA 4F4KA 3NH2A 1VSDA 4DMNA 4UQGA 1LW2A 4M41A 4M3ZA 4DWIA 5D3GA 3O4QA 4KB1A 4Z4EA 3M8SA 4K8XA 3AVFA 3HK2A 1G15A 1KVCA 3TR8A 2XO7A 3HPOA 4KHNA 3DOLA 4EP4A 1HQEA 4Z4HA 5J2QA 4CGJA 1RT7A 3P83D 4E1MA 2RF2A 3KKRA 1SKRA 1L5UA 3AVBA 4CK2A 1S1TA 2JGUA 4N47A 1NK0A 4OVLA 4HTUA 1VSLA 4E7JA 3HPGA 4FW2A 3OS1A 1D5AA 1TV6A 2ZD1A 2X6NA 4FLXA 4FJGA 2X6SA 4FJ7A 4FXDA 1WNSA 1BIZA 1FKPA 4HUFA 1TAQA 3MXMA 1S1XA 3HP9A 4E7LA 2HVIA 3K2PA 3VQ8A 4HVJA 3TAQA 1RTJA 3QLHA 1TKTA 4CF8A 3HP6A 4DLGA 1FKOA 3AVLA 1TGOA 4CESA 4CIGA 4DQSA 2ZQBA 2OZSA 4Y1CA 4ZHRA 4KI6A 1T7PA 4JRPA 2D0CA 5CYMA 3K5LA 3K57A 1NK9A 1L3UA 4Z4CA 1YT3A 5J1EA 1TKDA 1VSFA 4KRFA 4CJUA 1XWLA 3OS2A 2GBZA 1NK7A 1YTUA 3AVAA 3ZSYA 3OYBA 3V9ZA 3OS0A 4RW4A 5EU7A 3RMDA 4MFBA 1KFSA 3DLKA 4E1NA 4CK1A 3SQ1A 4OKJA 4KAZA 4CJSA 3PV8A 3DRPA 4E19A 1S1WA 4CJ4A 2KFZA 1Z25A 3QERA 1RDDA 4LSLA 1A5WA 3L8BA 3P1GA 4KV8A 2XY6A 3LZJA 2EHGA 3V1RA 1RDAA 4Y1DA 4CEOA 4PUOA 2D0BA 4FJMA 1NJXA 1LWCA 1RTIA 2IC3A 2ZE2A 4OGEA 2YV0X 4CF2A 3K5OA 3LP1A 3EZ5A 4FLZA 3DLHA 4DQPA 4IKFA 3AVCA 4FM0A 1TKXA 1KRPA 1YVUA 4Z4IA 3NF8A 2VG6A 3RR7A 2YKNA 3VQQA 1A5XA 3E01A 4XIUA 4AILC 3OYEA 3OYFA 2Y1IA 3O3FA 3HJFA 3PO4A 3V1OA 1UOCA 4O4GA 1VRTA 4ICLA 1ASVA 4KPYA 1W0HA 5CY4A 2FBXA 1T03A 1J5OA 1BL3A 3AV9A 4R5PA 4AHCA 3L2WA 4CJEA 1U04A 2YHBA 3MECA 1U45A 1L3SA 4B9MA 2DFEA 1EXQA 3AVHA 4OPJA 1WSFA 4CJ3A 4CJKA 3QEVA 4OKKA 5FROA 3OYJA 4IFYA 4CGHA 3RMCA 3S3NA 4FJXA 3SUNA 2KW4A 3ISNC 3S3OA 4FLTA 3PX6A 4IDKA 5DMRA 4CEEA 3VQ5A 3P5JA 1KLMA 2DFHA 3ZSRA 1WSHA 4KHQA 2FC0A 3HVTA 4DF8A 1NKCA 1D9FA 4Z0UA 1X9WA 2KTQA 3TABA 1BI4B 2PZSA 4AHVA 3ULDA 4QAGA 2KZMA 1HRHA 1C0TA 4NYNA 2NUBA 3L2QA 1WAFA 3M8PA 4W5RA 3BDPA 4IG0A 3L2VA 4B9UA 1CLQA 5I3UA 1EETA 3VQDA 1TL1A 3L3UA 3CFPA 2YHAA 4CF0A 1GOAA 1HYZA 4G1QA 4BWJA 1NKBA 4M3RA 4CFAA 1TL3A 4FLVA 4FJHA 3OJSA 5KTQA 1VRUA 3VA3A 3QEWA 3OJUA 3LPTA 5J2PA 2FBTA 3K5MA 1NOZA 2DY4A 3KD1E 3NGYA 4FLYA 2HHQA 1XHXA 3IAYA 4AHUA 1CXQA 2B6AA 4DU3A 4DFMA 1QSLA 3CFRA 3L2UA 1BIUA 4CIEA 1KVBA 3VQ4A 5HRRA 2OPPA 1N5YA 4DTJA 3FFIA 4RW8A 3TARA 5CZ1A 4C8NA 3HYFA 2IAJA 4CJWA 4CHYA 3K58A 3VQAA 1WSJA 4Q0BA 3PY8A 2BE2A 3SZ2A 1VK0A 3NE6A 2VG5A 3HSTB 2G8UA 5FRNA 3RTVA 4CEBA 4BWMA 3RWUA 4FJLA 3AVJA 2XRIA 3M8QA 3LALA 4CERA 3JSMA 2OZMA 4FYDA 3SJJA 1NJWA 2KZZA 3NGIA 3DMJA 2G8KA 3NF9A 3UIQA 4B9LA 3V9SA 2O4IA 2D5RA 4FZYA 1QHTA 5JS1A 3KLHA 2KQ2A 3QIOA 2I5JA 4CGGA 3LP3A 4IBNA 2OPQA 4KTQA 2P1JA 3WNGA 1XHZA 1Q9YA 4DQIA 1X9SA 3AVKA 4CHPA 1FK9A 3TWHA 1Q9XA 2F8SA 1KTQA 2HHTA 3NFAA 1YTAA 4FK4A 2X78A 1UWBA 3JYTA 2P5GA 3PX0A 1RT3A 5HROA 3HM9A 3CG7A 1O1WA 1IO2A 1VSKA 3V1QA 3D0PA 4FCYA 1VSMA 3OYLA 5FRMA 2Q3SA 3TAGA 4K8ZA 4B08A 2XHBA 1ZBIA 3I0SA 5KGXA 1C6VA 4CEZA 4L8RB 2D0AA 3O3HA 1WLJA 1UAXA 1W9HA 3DLRA 4DQRA 1QSYA 4FZXC 2YNIA 3NF6A 3K59A 4I7FA 2KFNA 2G8VA 4CHQA 3CM6A 2BDPA 4DSLA 3T1AA 3U3GA 4J2EA 4KHWA 4KREA 1U4BA 1LAVA 1RTHA 3S3MA 1RT2A 2G8WA 5KRSA 3DLBA 4C8LA 1S9EA 4FM2A 2O4GA 4FJ5A 3U6FA 3NGZA 4ID1A 3OYNA 3AVNA 1HNIA 2Z1GA 3SYZA 1REVA 1QQCA 3BGRA 3VQ6A 5KRTA 2EX3A 2VWKA 3OY9A 1KSPA 1IKWA 4I2QA 4O5BA 4BDYA 1J53A 4CEQA 4LH5A 1U48A 1CXUA 4BE2A 3KLFA 2OYQA 1BQNA 3LAMA 4JLHA 3VQBA 3ZCMA 4RW9A 4CCHA 2F96A 2YNGA 2YNFA 1RBSA 3A2FA 4CFBA 3MEDA 4AHRA 5HRSA 3KLEA 2HB5A 3AA3A 4CK3A 3HXMA 3OYHA 4BDZA 4DS4A 1WSGA 1JLGA 2XY8A 3C95A 3SI6A 2PY5A 4QCLA 3THVA 3LWLA 4M45A 5T7BA 4C8MA 4J2AA 4M3YA 4N5SA 4BACA 3DLEA 3CM5A 3KTQA 4KTZA 1IH7A 1ASWA 3S9HA 3KIOA 3TI0A 5DK5A 3AO1A 3SPYA 4OGCA 1LV5A 4W5QA 2AJQA 4DTUA 3VN5A 3KLGA 1HQUA 3OYCA 4DF4A 1RT4A 4JRQA 1S6QA 2A1RA 3WNFA 3DRSA 4E0DA 2OPSA 3LDSA 1WAJA 4E7KA 3MXJA 1I39A 4FVMA 1ZBLA 4F3TA 4RW6A 1I3AA 1R0AA 4HUGA 4KHUA 3EY1A 3QEIA 2QKBA 3TAMA 3MAQA 4AH9A 4ELTA 4M3WA 4PQUA 2F8TA 4PWDA 3SQ2A 3LZIA 2HVHA 4JS4A 5HBMA 1S5JA 1JLEA 2RKIA 4DFKA 1Q8IA 5JS2A 3K5NA 4FK0A 3H08A 1A5VA 4H4OA 1NJZA 4B9VA 1WSEA 3LAKA 4KKOA 3NAEA 1RBTA 4CEDA 4LY7A 1U49A 4M3TA 1JLCA 2X74A 3C94A 1JLBA 4C8OA 1X1PA 1NK4A 1S1VA 1RBRA 3AO3A 3LPUA 1BGXT 1SKSA 4GVMA 4JS5A 4B9SA 1RT1A 1C1AA 2OPRA 3SNNA 4J2DA 3QNNA 3DRRA 3OYDA 4DTRA 3HO1A 1LWFA 5C25A 4YFUA 4W5NA 4CGFA 1S1UA 3C6TA 3C6UA 5KI6A 3V9UA 1BCMA 4N56A 2ITGA 3U3YA 3PUFA 5C42A 2XY7A 3TAEA 2B4JA 1QSSA 3G0ZA 4O55A 3ZT0A 2RN2A 2HNZA 1NK6A 1RT5A 4DSEA 4FK2A 3V9XA 4OLAA 1BCOA 4OLBA 1WN7A 1ITGA 4ELVA 1BI4A 4KFBA 3SPZA 3DYAA 4NCBA 3ZSXA 5HP1A 4Z4GA 3LWMA 1SL2A 4ZTFA 1SV5A 1GOCA 1QS4A 1GOBA 3AO5A 4DSFA 4YNQA 4CIFA 3QO9A 4MQ3A 3NBPA 3CYMA 5E41A 2PYJA 1CZ9A 4H4MA 4NCGA 5CYQA 3HT3A 4CF9A 2OA8A 3KKSA 4IFVA 1D9DA 4DFJA 2P51A 3G10A 2HHXA 1BHLA 4FJKA 4EP5A 3O3GA 3KK2A 4DS5A 4FW1A 4CJVA 3SQ0A 2P5OA 4DSKA 5SZTA 3NHGA 2BGGA 3SV4A 3VQ9A 1NK8A 1RCHA 4O0IA 4GMJB 4LH4A 3AO4A 3KK3A 2Z1JA 1CZBA 1DTTA 4LSNA 2LSNA 4LD0A 2E6LA 2A1SA 1TVRA 3SV3A 5CZ2A 1QE1A 1RNHA 2IGIA 2RPIA 4CJTA 3NDKA 4F3OA 1C1CA 5KGWA 1HYVA 5HRPA 4OPKA 3TAFA 3TAPA 3HVRA 4AHTA 3QESA 1TK0A 4CEFA 1RDCA 4FLWA 3L3VA 4FJIA 3ZSWA 4CJRA 2PYLA 1HPZA 3OVNA 4M42A 2E4LA 1SKWA 4F8RA 1C0UA 1VSIA 4M3UA 3KD5E 1JL2A 4EZ9A 3IG1A 4DTMA 4FM1A 1RILA 4H8KA 4KI4A 2G8HA 1IKYA 4CHNA 2HNDA 4E7IA 1JLAA 3QEXA 4Z4FA 1DTQA 4I2PA 3ALYA 3DM2A 2IS3A 3AO2A 4HHTA 1F21A 3ZT1A 3KLIA 1MU2A 4ELUA 4FJNA 3LANA 2Z1HA 3HL8A 3KK1A 2XY5A 1RT6A 4DG1A 2GV9A 3KJVA 1WSIA 1UA1A 1TAUA 2QK9A 2R7YA 4CJQA 1BISA 1VSHA 4RW7A 3F73A 1EP4A 4DSJA 4HCBA 4NCAA 2HHVA 1U47A 1IG9A 1L3TA 2HNYA 5K14A 4N76A 3VQEA 4E7HA 4E3SA 4FJJA 1RDBA 4FJ9A 3QINA 3AVGA 4C8KA 1HJRA 2HHSA 4DTOA 4QOZB 1HMVA 2YNHA 3PO5A 4DSIA 1HYSA 1KFDA 5SWMA 2IOCA 1KVAA 1IKXA 2W42A 4DFPA 5J2MA 1TKZA 2GUIA 3ITHA 4W5OA 1J9AA 2DFFA 3LP0A 4Q5VA 2VG7A 1S6PA 4KHSA 2HHUA 3ZSVA 4E89A 1LWEA 3NH0A 2VWJA 4CFCA 4FJ8A 1HNVA 4DQQA 1B92A 4BDPA 4BE0A 3HPHA 4TSXA 3I8DA 4O44A 4F2SA 4KB0A 1JLFA 1IKVA 3RRGA 3ZT2A 4CJPA 4KO0A 1QTMA 1RBUA 1JL1A 3V4IA 2WONA
chains in the Genus database with same CATH superfamily
1T8EA 1FXXA 3M6GA 5AQVA 2FBYA 3DI6A 2FBVA 2IIRA 3OYIA 1HJOA 3D7EO 3SAHA 3ZSZA 2QKKA 2I7NA 1C1BA 2IVPA 3ENBA 4GW6A 1UA0A 2H3GX 5C12A 4BRHA 3VQCA 2WUSA 4CECA 3OYKA 3VGLA 4M3XA 4BE1A 4GV6A 4UY8O 4WE1A 3MEGA 4W5TA 3O9SA 3SUPA 5HLFA 5AQMA 1KCFA 4OJRA 4WFBL 3RR8A 4CEAA 1KXPA 4B1XB 5GIOA 2ASOA 2JLEA 4FOEA 1Y97A 4DTSA 2P9KB 1NOYA 4DKWA 3MXIA 4FWSA 2QW9A 2OANA 4O0JA 4B8AB 4CFDA 3T1YK 4DU4A 1D8YA 3ATUA 3L2RA 3QFUA 4C23A 3NF7A 2ITMA 5EY4A 3HSCA 4CZIA 1B9DA 3RMBA 4AM6A 1FW6A 4DTNA 2P9SA 4F4KA 1BU6O 4FWPA 4M41A 4DWIA 5D3GA 3O4QA 1YI2N 3M8SA 1KVCA 3F2KA 3HPOA 1U2VB 4X62K 2QWQA 1RT7A 4E1MA 2RF2A 1SKRA 3AVBA 2W6KA 4CK2A 4FW2A 4FLXA 1D5AA 1TV6A 2ZD1A 2X6NA 4FJGA 4FXDA 1K8KA 3CJ1A 2ZJPL 4HUFA 4BC4A 3TAQA 3HP6A 4CF8A 3D2FA 1FKOA 1Z05A 4ZHRA 2KLAA 2D0CA 1NK9A 3K57A 1TKDA 1QHAA 1XWLA 1NK7A 1WBDA 4LF5K 5AQIA 2GWKA 4CJSA 3DRPA 4E19A 4BC2A 1Z25A 3L8BA 3LZJA 3V1RA 4Y1DA 4PUOA 4M3ZA 5M1OA 2HHXA 1NJXA 2IC3A 4CF2A 5M1QA 3EZ5A 1N8RO 1HNXK 4IKFA 3P39A 4JYAK 1KRPA 3RSEA 1E4GT 3E01A 3UKRA 4XIUA 3OYFA 3V1OA 3VESA 2QTDA 2FBXA 2V7ZA 3J8AA 1T03A 1BL3A 3AV9A 4AHCA 1U04A 1OH5A 2YHBA 4JKCA 3AVHA 4KHWA 4CJ3A 3RMCA 4OKKA 3OYJA 3SMPA 4XH4A 4GV3A 1ZXOA 1NGGA 3S3OA 4FLTA 4YY3K 3VQ5A 1W2BM 1KLMA 3OA9A 1WSHA 2FC0A 3CC7N 3JAMO 4Z0UA 4B3TK 4K43A 3VPZA 5FPDA 4H03B 3L2VA 4FOIA 3VQDA 3DLLL 1NKBA 3H6EA 4AM7A 4DQ8A 3AGRA 4BRAA 5KQ8A 3VA3A 1QQOA 2FBTA 2A5XA 4JHDA 4FLYA 3IAYA 3VMFB 5HRRA 4BY9C 4RW8A 2FF3B 4B3RK 3HYFA 3MWTA 3K58A 1TUUA 1WSJA 4C1NK 1NWKA 1VK0A 5ADXH 2G8UA 1I94K 4A61A 4B1ZA 2XRIA 1X9JA 4CERA 1KAYA 4WYBA 4FYDA 3C6AA 2O8DA 3QFPA 3ULEA 3NF9A 4DV6K 3UIQA 4B9LA 4FZYA 2BTFA 2HOEA 3C7NB 4OPAA 3CPEA 1NGBA 1XHZA 1ATSA 3BP8A 1X9SA 1HNZK 3SK3A 3JYTA 4K0KK 2P5GA 3A0IX 4I6MB 5HROA 4CVNE 4BVPA 3D0PA 5FRMA 5GAEP 2Q3SA 1ATRA 5KGXA 2P9PA 1WLJA 4M7XA 1KC8O 4LFAK 2KKZA 1VQ4N 5M1PA 4KREA 3T1AA 5M1NA 1RTHA 3O9RA 3S3MA 1IV0A 4ID1A 1YJNN 2Z1GA 3SYZA 1REVA 5KRTA 4I2QA 2D0PA 2NRXA 4O5BA 4CEQA 2GX9A 1CXUA 3VQBA 3ZCMA 2YNGA 3T7ZA 3KLEA 3KLHA 3HXMA 2PY5A 4BDZA 2YCHA 1H1VA 1S3XA 2GTDA 1KAXA 3F9MA 3THVA 4B3MK 2FSJA 5T7BA 4J2AA 1WBBA 4KTZA 1IH7A 1T44A 3S9HA 3KIOA 2BH1A 3AARA 3AO1A 2RE2A 4BR5A 4PL8A 3MN6A 1NMDA 3OYCA 2UXCK 1RT4A 1S6QA 2OPSA 5LMNK 3O8MA 1HLUA 3QMLA 4FO0A 4FVMA 4JKDA 4RW6A 3ZETB 1R0AA 3EY1A 3CCMN 3QEIA 3TAMA 4M3WA 4ELTA 2F8TA 4PWDA 2HVHA 4JS4A 3H45C 3ZLJA 3H08A 4B9VA 1NJZA 1U49A 1JLCA 1YVNA 4FWLA 1X1PA 1S1VA 5IT9O 1BGXT 1SKSA 2FSKA 4GVMA 4B9SA 1RT1A 2D1KA 2UUAK 4NB4A 2OPRA 1QVGM 3SNNA 2ZGZA 3QNNA 3DRRA 3GE1A 2HSTA 3CCJN 1LWFA 4B9QA 4YFUA 4CGFA 2XY7A 4N56A 3U3YA 3PUFA 4YOUA 3ZT0A 5AQNA 4FK2A 2FF6A 3TSPA 4BQZA 1JCFA 4OLAA 4NXMK 4ELVA 4KFBA 3SPZA 3QICA 4DV1K 1SL2A 4BREA 1GOBA 5BREA 3BEXA 5CYQA 1X3NA 1D9DA 5AQPA 3A5LC 3KZBA 4FW1A 3NHGA 3C6HA 3VQ9A 2IVOA 4GMJB 1XNQK 3L4QA 2Z1JA 3VTHA 5AJ3K 3O6WA 3CD6N 4M63C 3SV3A 4IDHA 4F3OA 2RPIA 4CJTA 3KWIA 1HYVA 4OPKA 3UB5A 2O8EA 2HBKA 3E1YA 4CJRA 2PYLA 2O8BA 2E4LA 2ZM6K 2GELA 1NU0A 4FWMA 4WFAL 1JL2A 4EZ9A 4DTMA 3NVKA 4KI4A 5AZJB 1KAZA 5F1XA 2G8HA 4CHNA 4H0VB 3QEXA 4Z4FA 4I2PA 3ALYA 4FWNA 1F21A 4EAHD 1MU2A 3PIOL 3KK1A 2GEMA 3KJVA 2E20A 1NNEA 1WSIA 3ENOA 4NLBA 5JICA 4HCBA 5K14A 1RDBA 4FJ9A 3QINA 5AQHA 1HMVA 1HYSA 1KFDA 3ATVA 2PBDA 3VEZA 3VF4A 5GIPA 5SWMA 2IOCA 2UYTA 2GUIA 4W5OA 2DPNA 4FPAA 4JI6K 4Q5VA 3DJCA 4EHUA 4H5TA 4JKGA 3DXMA 3MX2A 4CFCA 4EHTA 4BQLA 1YUWA 3HPHA 4JD2A 4KB0A 3K9KA 1IKVA 1SZ2A 3L4IA 1NGJA 4CD1A 5KPRA 2WONA 4CJLA 3OYGA 4IJNA 4ILHA 3EYZA 3ASMA 1SUQA 3TSQA 3WEEA 3C0BA 3VEVA 3AA5X 1JXEA 4PA1A 1EKEA 4CJFA 5CE3A 1EO1A 4DTXA 3V81A 1RDWX 4ISEA 1L3VA 3B6OA 1BO5O 1ASUA 2IDOA 4DU1A 3I0RA 3QEPA 5AQGA 3VETA 1JKHA 4IWVA 5AZIB 3EE8A 1GLBG 1LOTB 1GLLO 3OYMA 4DR7K 3THWA 5KPZA 3IS9A 4IFEA 3AGKA 3ZX2A 2QXFA 1RTDA 3CPWM 4FL9A 4IG3A 1NM1A 1X9MA 2BANA 4CHOA 1XMOK 3SCXA 1XC9A 4DTPA 1ESVA 1EX4A 3WXMB 1T05A 4CZLA 1Z26A 1ZBHA 4I9LA 3AA4A 1J54A 1D4XA 2Y1JA 3U9ZA 2G8FA 3NH1A 4BRIA 3T69A 4X64K 1R59O 3SUQA 3ZSOA 1TYQB 3F9KA 4FSVA 2B5JA 4FZZA 4DV4K 3CFOA 1NKEA 3RMAA 3ZSQA 4HCCA 1NLVA 3HI0A 1XUPO 3ZT3A 4HUEA 3AVMA 2ATQA 3J7ZO 3RRHA 5IWAK 3FZLA 1BQMA 3NH2A 1HKBA 3CERA 5JVGL 2XO7A 3TR8A 2O8FB 5AQQA 4EP4A 1S22A 4Z4HA 1XMQK 5J2QA 3FZHA 3HOSA 5C15A 3KKRA 4PHTX 5FPEA 3SBTA 4HTUA 3OS1A 1BIZA 4G9ZA 1FKPA 3MXMA 1TAQA 5F2RA 4E7LA 2HVIA 4HVJA 1CZAN 1RTJA 3AVLA 3W0LA 2ZQBA 4BG9A 3CIPA 5CYMA 4JRPA 3IDHA 4B3SK 4DR5K 1DGKN 1VSFA 4CI6A 2GBZA 4K25A 3V9ZA 4B1WB 4RW4A 1JCEA 3DLKA 4WQ4C 1XC3A 4LF4K 3SQ1A 4KHPK 3EZWA 3PV8A 2OCEA 4H5WA 1S1WA 2KFZA 3EN9A 5LJVA 4JEPA 2PFUA 4LSLA 3P1GA 5EXWA 2EHGA 4FJMA 1RTIA 3LP1A 1IG8A 4FLZA 3CMEN 4FM0A 2YKNA 4AILC 1NGHA 4JI5K 3CXCM 2Q1NA 3HJFA 1HX1A 1K8AO 4ICLA 1RGIA 2F9TA 4A2BA 3A5MC 4JI1K 4IEEA 1L3SA 3O08A 5C10A 1EXQA 3BZCA 5BRFA 4WQ5C 1EWRA 5BR9A 2P9NA 1T6DA 3SUNA 4FJXA 2KW4A 3ISNC 2OTLN 2YHXA 4IDKA 3MWPA 3P5JA 3E9OA 3HVTA 4DF8A 3K9JA 4IO8A 2IVNA 3CJCA 3TABA 1BI4B 1IBKK 2PZSA 3ULDA 2ASMA 1C0TA 2NUBA 1WAFA 3M8PA 4W5RA 2QA4N 3NMUA 1EETA 1TL1A 3CFPA 4CF0A 2UUBK 2F9WA 3CCSN 4M3RA 4BRKA 4FJHA 3OJSA 1X3MA 1BA1A 3LPTA 3G6EN 3VOVA 3K5MA 1NOZA 5FLXO 3KD1E 1XNRK 4DU3A 4DHYA 4DFMA 3GDQA 1QSLA 3CFRA 3FZMA 4CIEA 1KVBA 1Q82O 3CCLN 2OPPA 3D6RA 4C8NA 3FE1A 3O4WA 4CHYA 3PY8A 3SZ2A 3NE6A 2QWNA 3S41A 3RTVA 4CEBA 4BWMA 3ZX3A 3M8QA 3LALA 1M1KO 3CJ7A 5AQJA 3V9SA 2D4WA 1QHTA 4V19S 3QIOA 2I5JA 1GLFO 3VF6A 1K8KB 3TWHA 1Q9XA 3O9UA 2X78A 3HM9A 3CG7A 1VSKA 3V1QA 1IJJA 1ZBIA 3CCVN 2YHYA 4ISFA 2D0AA 4CEZA 4L8RB 3O3HA 1UAXA 3A8YA 1E3MA 1BA0A 1GLAG 3OW2M 3K59A 3SJHA 3F5TA 4YDUC 2G8VA 2NNWA 3CM6A 4CHQA 4J2EA 3U3GA 3PSFA 1U4BA 4PKGA 1RT2A 1U2VA 1S72N 3DLBA 5KPTA 3NGZA 1HNIA 2NRTA 1MA9B 3Q7CA 1KSPA 1IKWA 3UKRB 1QZ5A 2ZJQL 1U48A 5H1SQ 1K9MO 2CH5A 3MK6A 4CCHA 3AAPA 4C1NI 5HRSA 1RBSA 3AA3A 4CK3A 1WSGA 1JLGA 3E66A 4YOVA 3LWLA 4M45A 2O8CA 4C8MA 3CM5A 4DCHA 3TI0A 1ZBSA 4W5QA 3OBWA 4DTUA 1HQUA 4DF4A 3I55N 4OX9K 2NRWA 4E0DA 5LJWA 3LDSA 2PAVA 4F3TA 4BROA 1J6ZA 1BUPA 2NZTA 3SBGA 3MAQA 5JVHL 2QKBA 4PQUA 3CJAA 4MLHA 3BF3A 3JXUA 4JAXA 3VENA 4DFKA 1JLEA 2E2QA 2RKIA 1Q8IA 3K5NA 1WSEA 3NAEA 4KKOA 3HTVA 3WT0A 5BN8A 5ADXA 2UUCK 4LY7A 5AQKA 4M3TA 4MO5A 3C94A 4JHDB 3AO3A 1NGIA 4RCHA 1HNWK 1RFQA 2ZF5O 3N4PA 1YXQA 3WXKA 1SQKA 4BR4A 3TAEA 3M3ZA 3LDPA 1QSSA 3G0ZA 1NK6A 2F7TA 4IZ9A 4DSEA 4OLBA 3JS6A 3Q7BA 1J5EK 3O9QA 4NCBA 4Z4GA 1SV5A 1GOCA 1ZC6A 2UXDK 4DSFA 1GLJO 4YNQA 1KD1O 4CIFA 3I33A 5HOOA 3CYMA 3C65A 4H4MA 2CGKA 3HT3A 3KKSA 4JN4A 4B1YB 3HM8A 2FLOA 3IMXA 3G10A 4FJKA 3O3GA 1VHXA 3KK2A 3SQ0A 4DSKA 5SZTA 3WQTA 3SV4A 3B8AX 1OH7A 3KK3A 1WOQA 4LSNA 3CCEN 5CZ2A 1RNHA 2IGIA 1FJGK 3LDQA 3TAPA 5HRPA 4AHTA 3T1HK 1XQSC 4FWQA 4BR0A 3MX5A 3OVNA 4M42A 4RWTA 3NVMA 3IG1A 4PL7A 2UXBK 5FPNA 4DV7K 4H8KA 3VGMA 1JLAA 4IXCA 1DTQA 3HOTA 3DM2A 2IS3A 3AO2A 3C7NA 5CHIA 4HHTA 3J81O 3ZT1A 3ZEUA 3LANA 2Z1HA 3R9PA 4AQYK 1RT6A 4GNIA 3GOIA 4RW7A 4CJQA 1U47A 2HHHK 1L3TA 4I6MA 2ASPA 4CZKA 3GL1A 4C8KA 1DT9A 1EWQA 2HHSA 4DTOA 4QOZB 3PO5A 4DSIA 1DKGD 2W42A 4JK8A 1C0FA 5J2MA 1TKZA 2NRRA 4Y0WA 3CCQN 5I9EB 3PSIA 3G25A 4YHHK 4KHSA 1NMNA 1IBLK 3ZSVA 3E9PA 3NH0A 2VWJA 1HNVA 4DQQA 4BDPA 4BE0A 4F2SA 1JLFA 3ZT2A 4KO0A 1QTMA 2W6LA 1QSYA 1SL0A 3VQPA 1W97L 3OYAA 4FK0A 1KLNA 5C2FA 3LP2A 4AHSA 1LW0A 4ID5A 1S9GA 3VQ7A 3IFRA 3H1QA 3QNOA 3NCIA 5J2NA 4CE9A 1GLEG 1B9FA 3QIPA 2Z1IA 3D45A 4I9QA 5BRDA 3V6DA 1MDUB 2HMIA 1DLOA 4U67L 4Z94A 1VQLN 4BGAA 5BPLA 4O8UA 3PLAA 2NRZA 3SAGA 1Q7YO 3DWLA 1ATNA 3ZETA 4BVOA 1LAWA 3WXLA 5I42A 4B9NA 3AA2A 4FLUA 1ZYQA 1RDUA 4B3OA 1VQKN 3TANA 5AQXA 3BF1A 5F0XA 4JK7A 4H5VA 2QWRA 3M8RA 1JLQA 3MDQA 4CZMA 4HWIA 4NYFA 2CGLA 1VSJA 3MEEA 2P9LA 5JMVA 2A6AA 4LFCK 2DTUA 3THYB 1VSEA 3IRXA 1BG3A 1N6QA 4CF1A 4KTWA 3SUOA 3G4SN 3G71N 2G8IA 1Q18A 1NJYA 1V4TA 1XI1A 2QWLA 1SL1A 3EKUA 3DLGA 1K6YA 3DOKA 3O9TA 1VSDA 4DMNA 3THXB 1MWMA 1G15A 4KHNA 1HQEA 4JKFA 3VEXA 3I8BA 4CGJA 3P83D 5JLFA 1QQMA 1S1TA 2JGUA 4N47A 2ZJRL 4BRLA 4A59A 2A41A 5GAGP 4EFHA 3HPGA 1TUYA 4FJ7A 2X6SA 3K2PA 3QLHA 4DLGA 4DQSA 4CESA 3CJBA 3HRGA 2OZSA 4BR9A 4KI6A 1T7PA 3FZKA 1L3UA 4Z4CA 5B8HA 4JKBA 4KBOA 4KRFA 3DXKA 3OS2A 1YTUA 3ZSYA 1YHQN 3OYBA 1KFSA 4JNEA 4OKJA 3RVCA 4JD2B 5BRHA 4KV8A 2XY6A 4CEOA 2KZZA 2D0BA 4OGEA 2YV0X 4DQPA 3K5OA 3OTOK 3TPQA 1TKXA 1YVUA 3NF8A 2VG6A 3RR7A 1BOTO 4BGBA 3VQQA 3WUHA 3OYEA 3O3FA 3PO4A 1VQMN 3CQXA 1ASVA 5AFUH 3CMAN 1J5OA 2E8AA 3QB0A 5AQZA 4A57A 3L2WA 4CJEA 5HL7L 3MECA 1U45A 2V51B 2DFEA 4BRDA 4OPJA 4B9UA 4CJKA 1NG9A 4IFYA 5M1KA 1NGAA 2BUPA 2NRHA 5DM7L 3THWB 5DMRA 3ZSRA 5JLHA 4H0PA 3VERA 2KTQA 3N4QA 3D2EB 4AHVA 3K0SA 1HRHA 3L2QA 2J4RA 1CLQA 3P31A 4IG0A 4CZJA 5I3UA 2P9IB 2RHKA 2YHAA 1GOAA 3LM9A 4G1QA 4BWJA 4A2AA 3CC2N 1TL3A 3R8EA 4FLVA 4LC9B 1DEJA 4U7BA 3HZ6A 1Z6RA 3QEWA 3OJUA 4XH1A 5LL6Z 4YOWA 2DY4A 4YOYA 3NGYA 4H0XB 2WTUA 1CXQA 5LMUK 4LF6K 3L2UA 1BIUA 2YJFA 1N5YA 4DTJA 4AF1A 2IAJA 4CJWA 3VQAA 4Q0BA 3W3DA 4F9OA 1ILYA 4YOTA 3AVJA 2Q2RA 2F4VK 5FPMA 3PIPL 4JI4K 2NRVA 1NJWA 3DMJA 2O4IA 3VEOA 5GADP 4DR1K 4KH5A 3ZX0A 2KQ2A 3LP3A 4IBNA 4KTQA 2P1JA 1Q9YA 2I7PA 4JK9A 3AVKA 4CHPA 3UKUB 2HHTA 4DV3K 1YTAA 4FK4A 3U9DA 1TYQA 1UWBA 5EVZA 4WCEL 1O1WA 2JWKA 1IO2A 1VSMA 3KHYA 5AQFA 1Y64A 3R1XA 3DLRA 4DQRA 4FZXC 2YNIA 4QS8A 3VGKA 2BDPA 4DSLA 4E1JA 2O8FA 5KRSA 4FM2A 1Q81O 4GVEA 3OYNA 3AVNA 2P9UB 3BGRA 3OY9A 2EX3A 1GLDG 4BE2A 4MDBA 4WFNL 1BQNA 3SAFA 2OYQA 4RW9A 2YNFA 3MEDA 3OYHA 4QCLA 4A5AA 3BZKA 4DR2K 4M3YA 5TKWA 1Q86O 4BACA 5DK5A 3SPYA 4OGCA 1LV5A 1QZ6A 4GY2B 4GV9A 3VN5A 2WC9A 4LFBK 3WNFA 3DRSA 3MXJA 1I39A 1ZBLA 4HUGA 4BRCA 4DB3A 3SQ2A 2WBNA 5C0YA 4H4OA 4B1VA 3QDKA 1RBTA 2YX6A 4CEDA 2V7YA 2X74A 3WXJA 1NK4A 1RBRA 3LPUA 2QEXN 3AAQA 4JS5A 3CETA 1C1AA 3P38A 4ILGB 4DTRA 3HO1A 1E4FT 5C25A 1YITN 4W5NA 1S1UA 3C6TA 3C6UA 5KI6A 3V9UA 2ZWHA 4CZFA 3VEYA 2B4JA 3WXIA 2RN2A 2HNZA 3O1BA 1RT5A 3P4IA 1WN7A 1ITGA 1BI4A 3FGUA 1QVFM 5HP1A 2P9SB 1YAGA 1QS4A 3AO5A 4A62A 3LDOA 3I56N 3QO9A 1VQPN 2AP1A 4MQ3A 3HBTA 3LDLA 5E41A 3VEWA 2PYJA 2OA8A 3GBTA 4M7YA 1VQ9N 2HBLA 1BHLA 2E1ZA 4CJVA 2P5OA 1YF5L 3MN7A 4LH4A 5AQYA 3AO4A 2P9KA 2HF3A 2A1SA 4CD3A 3D2FB 1QE1A 3NDKA 4EIAA 5KGWA 3HVRA 3QESA 1TK0A 1NGEA 1RDCA 5AR0A 4IO9L 4FJIA 3L6QA 3CHWA 4F8RA 1C0UA 1VSIA 3KD5E 2FSNA 4FM1A 5C2DA 1RILA 4FWKA 2HNDA 4E7IA 4NLCA 4OO1J 3HL8A 1HKCA 3RSEB 2GV9A 1UA1A 2E88A 4JV5K 2R7YA 3F73A 1BISA 1EP4A 4NCAA 2HHVA 1IG9A 2HNYA 4N76A 3QBWA 3VQEA 4E7HA 4E3SA 4FJJA 2OTJN 2HBJA 3AVGA 1VQ8N 4BG8A 2O8CB 1YJ9N 4MO4A 4PKHA 1KVAA 4DFPA 3ITHA 4H0OA 5ELZA 4FWOA 1J9AA 4LF8K 2DFFA 4LF9K 4BC3A 3CCRN 3LP0A 3TTCA 2KHOA 3OBYA 2HHUA 3EKSA 2CGJA 4E89A 1OH8A 1LWEA 4FJ8A 1B92A 4B1UB 4NO7A 4O44A 4CJPA 1JCGA 2QWOA 3IKMA 1VQ7N 2E2NA 4PY5A 4KHYA 3U4LA 3WNHA 4OPHA 3IUCA 4B8CA 4CGDA 5AQUA 4CW7B 3LDNA 3MMVA 3AY9A 4J2BA 1NK5A 4N41A 2YKMA 2JWLA 1IBMK 3TU5A 2QWPA 4F2RA 4KH4A 2HW3A 4H0YB 2E6MA 2WOMA 3T3FA 1ZBUA 2GWJA 1ZBFA 3AVIA 3SQ4A 4DUYK 3B6PA 5HRNA 4RG8A 2ETJA 4BRMA 4DR6K 1N32K 3CQ8A 2VGNA 3CC4N 2O8DB 2HF4A 4B9TA 4BR7A 2VWBA 3EL2A 4CHZA 1JXBA 4ZTJA 3J7AP 3ULEB 2HMPA 2HHWA 4DLEA 1RBVA 4A5BA 1BDGA 4OKEA 4FPBA 4DR4K 1TK8A 1U6ZA 3V9WA 3PX4A 1TK5A 3VA0A 3T19A 5FDLA 3WQUA 3QETA 4CGIA 1C0MA 3O4NA 5C24A 4JI3K 3WNEA 3H46O 4CJ5A 5AQRA 4EZ6A 4K42A 1W7AA 3ENHA 3ZT4A 4WQ4A 2P9PB 4DR3K 1T6CA 4HTLA 3QBXA 4UQGA 5AQTA 1LW2A 3HK2A 2E5LK 4KB1A 4Z4EA 4K8XA 3AVFA 3H3OB 3CF5L 3DOLA 3U8XA 1SAZA 3ZEUB 2Q31A 4O5FA 1VQ5N 1L5UA 1NK0A 4OVLA 1VAZA 2HBMA 1VSLA 4E7JA 1G99A 1WUAA 1WNSA 4IEIA 1S1XA 3HP9A 2GUPA 3VQ8A 1NGFA 1TKTA 1C0GA 4CIGA 1TGOA 4CJ7A 3EE9A 1NJIO 4Y1CA 2QWMA 3K5LA 4WQ5A 3MCAB 1LCUA 1BWFO 1YT3A 5J1EA 4CJUA 1NGCA 3AVAA 3OS0A 5EU7A 3RMDA 4MFBA 3M1FA 4E1NA 4J8FA 3TTDA 4CK1A 4KAZA 4JI7K 4PKIA 4BRNA 4CJ4A 3QERA 1RDDA 1A5WA 1VQON 3TSUA 1RDAA 4NXNK 1LWCA 2YJEA 2ZE2A 3FFKB 3KWGA 1OVQA 3BUZB 4QS9A 1OVYA 3DLHA 3SLCA 3AVCA 4H5RA 1OH6A 4Z4IA 1A5XA 1QQNA 2Y1IA 4BR2A 1UOCA 4O4GA 1VRTA 5E84A 4KPYA 1W0HA 5CY4A 4R5PA 4XEIA 4BRFA 5AQOA 4B9MA 2Q0RA 1WSFA 3QEVA 2WFBA 4CZGA 5FROA 3S3NA 4CGHA 3LL3A 1VQ6N 2E1YA 3PX6A 4CEEA 2DFHA 4KHQA 2FXUA 1HPMA 4JI8K 1NKCA 1D9FA 1X9WA 2KZMA 4QAGA 3FLCO 4NYNA 3BDPA 4CBWA 2VQFK 1GLCG 2NLXA 3L3UA 1HYZA 4H0TB 2AA4A 3H3NO 4CFAA 3LM2A 5KTQA 1VRUA 2P9LB 5J2PA 4BC5A 2HHQA 1XHXA 4AHUA 4X66K 2B6AA 4GKJK 3A5OC 3R6MA 3VQ4A 1JJ2M 3FFIA 3TARA 5CZ1A 1K73O 1OKJA 3EEQA 2BE2A 2W41A 2VG5A 3HSTB 4K41A 5FRNA 3RWUA 4FJLA 2O8EB 4XH5A 5EOYA 3VTIA 2Q0UA 4YDUA 3JSMA 2OZMA 5TKYA 3SJJA 2O8BB 3NGIA 2YI1A 4CBXA 2VYPA 4ISGA 3MCPA 5MLCQ 1N33K 2D5RA 5JS1A 2QI2A 3FZFA 4JKHA 3VF2A 4CGGA 2OPQA 3WNGA 4DQIA 1FK9A 3DAWA 4KH6A 2F8SA 1KTQA 3NFAA 3THYA 5GAHP 3O1WA 4CZHA 3PX0A 2UU9K 1RT3A 4FCYA 3OYLA 3DXKB 2Q97A 3TAGA 4K8ZA 4B08A 2XHBA 3I0SA 1C6VA 2A3ZA 4DV0K 1W9HA 2A42A 3THXA 3NF6A 5AQLA 1HR0K 4IJAA 4I7FA 5AFUA 2KFNA 4JI2K 1LAVA 4JKGB 2G8WA 3DXMB 4BRQA 4MLEA 1S9EA 4C8LA 2O4GA 4DV5K 3U6FA 4FJ5A 4JKAA 3J7YP 5AZJA 1QQCA 3VQ6A 2VWKA 3CJ9A 5M1FA 4BDYA 2QM1A 1J53A 4LH5A 1SS6A 3KLFA 3E9LA 3LAMA 4JLHA 3KK7A 3WEEB 2F96A 4CFBA 3A2FA 4AHRA 1NBWA 2G8KA 2HB5A 5LY3A 4DS4A 3SI6A 2XY8A 3C95A 4YORA 5GINA 3A5NC 4L3QA 4N5SA 1HUXA 3DLEA 2VCPA 2V52B 3KTQA 1ASWA 4IOCL 3UE5A 4JKEA 2AJQA 2D0OA 4IOXA 3O80A 5AQWA 2YHWA 4FVUA 3KLGA 1P8ZA 3TTFA 4JRQA 1MWKA 2A1RA 1WAJA 4E7KA 1O13A 1I3AA 4KHUA 5EX5A 4AH9A 1YIJN 3LZIA 3CQYA 3MN9A 3O5BA 1T3VA 5HBMA 1S5JA 4LF7K 5JS2A 1A5VA 1EQYA 2W40A 1KQSM 3LAKA 5BPNA 2ZGYA 2E2OA 1JLBA 4C8OA 4H5NA 3FR0A 4J2DA 4YOXA 3OYDA 3CCUN 5BR8K 1BCMA 2ITGA 5C42A 4O55A 5KQDA 1NGDA 5AZIA 3ID6A 1M90O 3V9XA 1BCOA 3R3LA 3D2EA 3DYAA 2CH6A 3ZSXA 3LWMA 4ZTFA 2P9IA 3BY5A 4GKKK 3NBPA 5BPMA 1CZ9A 4NCGA 4CF9A 3H1VX 4IFVA 4DFJA 2P51A 4BRPA 4X65K 5A2QO 1P90A 4BRGA 4EP5A 5DM6L 4DS5A 2BGGA 1NK8A 3CI5A 1RCHA 4O0IA 4ILJA 1V4SA 1CZBA 1DTTA 2LSNA 3EO3A 2E6LA 4LD0A 1TVRA 4R79A 1C1CA 3TAFA 3MN5A 4CEFA 3J80O 4FLWA 3GG4A 3L3VA 5CR4A 3ZSWA 4DV2K 1HPZA 2EWSA 1SKWA 4IOAL 3KVGA 4M3UA 3ID8A 1N34K 1IKYA 2VGMA 4O8KA 4ELUA 3KLIA 4FJNA 2VQEK 5E26A 2XY5A 4DG1A 3UKUA 5BN9A 1TAUA 2QK9A 1VSHA 4DSJA 3L0QA 3ZYYX 4CBUA 4WF9L 2QXLA 4JI0K 2E2PA 1HJRA 4DUZK 2Q36A 2A40A 2YNHA 4CZEA 1IKXA 5AQSA 1HKGA 2P9NB 4RTFD 2VG7A 1S6PA 1WB9A 1VQNN 3OHRA 4FWRA 4TSXA 2P9UA 3I8DA 3SMSA 3RRGA 4MDAA 1RBUA 4QS7A 1N36K 1JL1A 3M5RA 1YJWN 3V4IA
chains in the Genus database with same CATH topology
1SL0A 3VQPA 4CJLA 1FXXA 3OYAA 1T8EA 2FBYA 3DI6A 2FBVA 3LP2A 3OYGA 4AHSA 3OYIA 3ASMA 3EYZA 1KLNA 1LW0A 1SUQA 4ID5A 4KHYA 4PY5A 1S9GA 3VQ7A 3WNHA 3ZSZA 3AA5X 1JXEA 4B8CA 4CGDA 2QKKA 4PA1A 1C1BA 1EKEA 4CJFA 3QNOA 3NCIA 4J2BA 4DTXA 4GW6A 3QIPA 1B9FA 4CE9A 5J2NA 3V81A 1UA0A 2Z1IA 1NK5A 3D45A 1L3VA 4I9QA 3B6OA 4N41A 1ASUA 2IDOA 2YKMA 3VQCA 3V6DA 4DU1A 3I0RA 3QEPA 2HMIA 1DLOA 4CECA 4F2RA 3OYKA 1JKHA 2HW3A 2E6MA 2WOMA 3T3FA 4M3XA 4BE1A 3OYMA 1ZBUA 1ZBFA 3AVIA 3IS9A 4WE1A 3SQ4A 3MEGA 4W5TA 2QXFA 3SUPA 3B6PA 1RTDA 5HRNA 4IG3A 5HLFA 4RG8A 2ETJA 1KCFA 1X9MA 2BANA 1LAWA 3CQ8A 4OJRA 4CHOA 5I42A 4B9NA 3AA2A 4FLUA 1ZYQA 4B9TA 4CHZA 1JXBA 3SCXA 4ZTJA 1XC9A 3RR8A 4B3OA 2HHWA 4DLEA 3TANA 1RBVA 4CEAA 1EX4A 4DTPA 1T05A 4OKEA 1Z26A 2JLEA 3M8RA 1JLQA 1ZBHA 1TK8A 3V9WA 4I9LA 3PX4A 3AA4A 1TK5A 3VA0A 1J54A 4NYFA 1Y97A 3T19A 4DTSA 2Y1JA 5FDLA 1VSJA 3MEEA 1NOYA 2G8FA 3MXIA 3NH1A 3QETA 4CGIA 4O0JA 3SUQA 4B8AB 4CFDA 3ZSOA 2DTUA 4DU4A 1VSEA 1C0MA 3F9KA 3IRXA 1D8YA 3L2RA 3O4NA 5C24A 1N6QA 4CF1A 4KTWA 2B5JA 3SUOA 3WNEA 4FZZA 2G8IA 3NF7A 3CFOA 1NKEA 4CJ5A 3RMAA 1NJYA 3ZSQA 4HCCA 4EZ6A 1XI1A 3ZT4A 3ZT3A 1B9DA 3AVMA 4HUEA 3RMBA 2ATQA 1SL1A 3DLGA 3RRHA 1K6YA 4DTNA 1BQMA 3DOKA 4F4KA 3NH2A 1VSDA 4DMNA 4UQGA 1LW2A 4M41A 4M3ZA 4DWIA 5D3GA 3O4QA 4KB1A 4Z4EA 3M8SA 4K8XA 3AVFA 3HK2A 1G15A 1KVCA 3TR8A 2XO7A 3HPOA 4KHNA 3DOLA 4EP4A 1HQEA 4Z4HA 5J2QA 4CGJA 1RT7A 3P83D 4E1MA 2RF2A 3KKRA 1SKRA 1L5UA 3AVBA 4CK2A 1S1TA 2JGUA 4N47A 1NK0A 4OVLA 4HTUA 1VSLA 4E7JA 3HPGA 4FW2A 3OS1A 1D5AA 1TV6A 2ZD1A 2X6NA 4FLXA 4FJGA 2X6SA 4FJ7A 4FXDA 1WNSA 1BIZA 1FKPA 4HUFA 1TAQA 3MXMA 1S1XA 3HP9A 4E7LA 2HVIA 3K2PA 3VQ8A 4HVJA 3TAQA 1RTJA 3QLHA 1TKTA 4CF8A 3HP6A 4DLGA 1FKOA 3AVLA 1TGOA 4CESA 4CIGA 4DQSA 2ZQBA 2OZSA 4Y1CA 4ZHRA 4KI6A 1T7PA 4JRPA 2D0CA 5CYMA 3K5LA 3K57A 1NK9A 1L3UA 4Z4CA 1YT3A 5J1EA 1TKDA 1VSFA 4KRFA 4CJUA 1XWLA 3OS2A 2GBZA 1NK7A 1YTUA 3AVAA 3ZSYA 3OYBA 3V9ZA 3OS0A 4RW4A 5EU7A 3RMDA 4MFBA 1KFSA 3DLKA 4E1NA 4CK1A 3SQ1A 4OKJA 4KAZA 4CJSA 3PV8A 3DRPA 4E19A 1S1WA 4CJ4A 2KFZA 1Z25A 3QERA 1RDDA 4LSLA 1A5WA 3L8BA 3P1GA 4KV8A 2XY6A 3LZJA 2EHGA 3V1RA 1RDAA 4Y1DA 4CEOA 4PUOA 2D0BA 4FJMA 1NJXA 1LWCA 1RTIA 2IC3A 2ZE2A 4OGEA 2YV0X 4CF2A 3K5OA 3LP1A 3EZ5A 4FLZA 3DLHA 4DQPA 4IKFA 3AVCA 4FM0A 1TKXA 1KRPA 1YVUA 4Z4IA 3NF8A 2VG6A 3RR7A 2YKNA 3VQQA 1A5XA 3E01A 4XIUA 4AILC 3OYEA 3OYFA 2Y1IA 3O3FA 3HJFA 3PO4A 3V1OA 1UOCA 4O4GA 1VRTA 4ICLA 1ASVA 4KPYA 1W0HA 5CY4A 2FBXA 1T03A 1J5OA 1BL3A 3AV9A 4R5PA 4AHCA 3L2WA 4CJEA 1U04A 2YHBA 3MECA 1U45A 1L3SA 4B9MA 2DFEA 1EXQA 3AVHA 4OPJA 1WSFA 4CJ3A 4CJKA 3QEVA 4OKKA 5FROA 3OYJA 4IFYA 4CGHA 3RMCA 3S3NA 4FJXA 3SUNA 2KW4A 3ISNC 3S3OA 4FLTA 3PX6A 4IDKA 5DMRA 4CEEA 3VQ5A 3P5JA 1KLMA 2DFHA 3ZSRA 1WSHA 4KHQA 2FC0A 3HVTA 4DF8A 1NKCA 1D9FA 4Z0UA 1X9WA 2KTQA 3TABA 1BI4B 2PZSA 4AHVA 3ULDA 4QAGA 2KZMA 1HRHA 1C0TA 4NYNA 2NUBA 3L2QA 1WAFA 3M8PA 4W5RA 3BDPA 4IG0A 3L2VA 4B9UA 1CLQA 5I3UA 1EETA 3VQDA 1TL1A 3L3UA 3CFPA 2YHAA 4CF0A 1GOAA 1HYZA 4G1QA 4BWJA 1NKBA 4M3RA 4CFAA 1TL3A 4FLVA 4FJHA 3OJSA 5KTQA 1VRUA 3VA3A 3QEWA 3OJUA 3LPTA 5J2PA 2FBTA 3K5MA 1NOZA 2DY4A 3KD1E 3NGYA 4FLYA 2HHQA 1XHXA 3IAYA 4AHUA 1CXQA 2B6AA 4DU3A 4DFMA 1QSLA 3CFRA 3L2UA 1BIUA 4CIEA 1KVBA 3VQ4A 5HRRA 2OPPA 1N5YA 4DTJA 3FFIA 4RW8A 3TARA 5CZ1A 4C8NA 3HYFA 2IAJA 4CJWA 4CHYA 3K58A 3VQAA 1WSJA 4Q0BA 3PY8A 2BE2A 3SZ2A 1VK0A 3NE6A 2VG5A 3HSTB 2G8UA 5FRNA 3RTVA 4CEBA 4BWMA 3RWUA 4FJLA 3AVJA 2XRIA 3M8QA 3LALA 4CERA 3JSMA 2OZMA 4FYDA 3SJJA 1NJWA 2KZZA 3NGIA 3DMJA 2G8KA 3NF9A 3UIQA 4B9LA 3V9SA 2O4IA 2D5RA 4FZYA 1QHTA 5JS1A 3KLHA 2KQ2A 3QIOA 2I5JA 4CGGA 3LP3A 4IBNA 2OPQA 4KTQA 2P1JA 3WNGA 1XHZA 1Q9YA 4DQIA 1X9SA 3AVKA 4CHPA 1FK9A 3TWHA 1Q9XA 2F8SA 1KTQA 2HHTA 3NFAA 1YTAA 4FK4A 2X78A 1UWBA 3JYTA 2P5GA 3PX0A 1RT3A 5HROA 3HM9A 3CG7A 1O1WA 1IO2A 1VSKA 3V1QA 3D0PA 4FCYA 1VSMA 3OYLA 5FRMA 2Q3SA 3TAGA 4K8ZA 4B08A 2XHBA 1ZBIA 3I0SA 5KGXA 1C6VA 4CEZA 4L8RB 2D0AA 3O3HA 1WLJA 1UAXA 1W9HA 3DLRA 4DQRA 1QSYA 4FZXC 2YNIA 3NF6A 3K59A 4I7FA 2KFNA 2G8VA 4CHQA 3CM6A 2BDPA 4DSLA 3T1AA 3U3GA 4J2EA 4KHWA 4KREA 1U4BA 1LAVA 1RTHA 3S3MA 1RT2A 2G8WA 5KRSA 3DLBA 4C8LA 1S9EA 4FM2A 2O4GA 4FJ5A 3U6FA 3NGZA 4ID1A 3OYNA 3AVNA 1HNIA 2Z1GA 3SYZA 1REVA 1QQCA 3BGRA 3VQ6A 5KRTA 2EX3A 2VWKA 3OY9A 1KSPA 1IKWA 4I2QA 4O5BA 4BDYA 1J53A 4CEQA 4LH5A 1U48A 1CXUA 4BE2A 3KLFA 2OYQA 1BQNA 3LAMA 4JLHA 3VQBA 3ZCMA 4RW9A 4CCHA 2F96A 2YNGA 2YNFA 1RBSA 3A2FA 4CFBA 3MEDA 4AHRA 5HRSA 3KLEA 2HB5A 3AA3A 4CK3A 3HXMA 3OYHA 4BDZA 4DS4A 1WSGA 1JLGA 2XY8A 3C95A 3SI6A 2PY5A 4QCLA 3THVA 3LWLA 4M45A 5T7BA 4C8MA 4J2AA 4M3YA 4N5SA 4BACA 3DLEA 3CM5A 3KTQA 4KTZA 1IH7A 1ASWA 3S9HA 3KIOA 3TI0A 5DK5A 3AO1A 3SPYA 4OGCA 1LV5A 4W5QA 2AJQA 4DTUA 3VN5A 3KLGA 1HQUA 3OYCA 4DF4A 1RT4A 4JRQA 1S6QA 2A1RA 3WNFA 3DRSA 4E0DA 2OPSA 3LDSA 1WAJA 4E7KA 3MXJA 1I39A 4FVMA 1ZBLA 4F3TA 4RW6A 1I3AA 1R0AA 4HUGA 4KHUA 3EY1A 3QEIA 2QKBA 3TAMA 3MAQA 4AH9A 4ELTA 4M3WA 4PQUA 2F8TA 4PWDA 3SQ2A 3LZIA 2HVHA 4JS4A 5HBMA 1S5JA 1JLEA 2RKIA 4DFKA 1Q8IA 5JS2A 3K5NA 4FK0A 3H08A 1A5VA 4H4OA 1NJZA 4B9VA 1WSEA 3LAKA 4KKOA 3NAEA 1RBTA 4CEDA 4LY7A 1U49A 4M3TA 1JLCA 2X74A 3C94A 1JLBA 4C8OA 1X1PA 1NK4A 1S1VA 1RBRA 3AO3A 3LPUA 1BGXT 1SKSA 4GVMA 4JS5A 4B9SA 1RT1A 1C1AA 2OPRA 3SNNA 4J2DA 3QNNA 3DRRA 3OYDA 4DTRA 3HO1A 1LWFA 5C25A 4YFUA 4W5NA 4CGFA 1S1UA 3C6TA 3C6UA 5KI6A 3V9UA 1BCMA 4N56A 2ITGA 3U3YA 3PUFA 5C42A 2XY7A 3TAEA 2B4JA 1QSSA 3G0ZA 4O55A 3ZT0A 2RN2A 2HNZA 1NK6A 1RT5A 4DSEA 4FK2A 3V9XA 4OLAA 1BCOA 4OLBA 1WN7A 1ITGA 4ELVA 1BI4A 4KFBA 3SPZA 3DYAA 4NCBA 3ZSXA 5HP1A 4Z4GA 3LWMA 1SL2A 4ZTFA 1SV5A 1GOCA 1QS4A 1GOBA 3AO5A 4DSFA 4YNQA 4CIFA 3QO9A 4MQ3A 3NBPA 3CYMA 5E41A 2PYJA 1CZ9A 4H4MA 4NCGA 5CYQA 3HT3A 4CF9A 2OA8A 3KKSA 4IFVA 1D9DA 4DFJA 2P51A 3G10A 2HHXA 1BHLA 4FJKA 4EP5A 3O3GA 3KK2A 4DS5A 4FW1A 4CJVA 3SQ0A 2P5OA 4DSKA 5SZTA 3NHGA 2BGGA 3SV4A 3VQ9A 1NK8A 1RCHA 4O0IA 4GMJB 4LH4A 3AO4A 3KK3A 2Z1JA 1CZBA 1DTTA 4LSNA 2LSNA 4LD0A 2E6LA 2A1SA 1TVRA 3SV3A 5CZ2A 1QE1A 1RNHA 2IGIA 2RPIA 4CJTA 3NDKA 4F3OA 1C1CA 5KGWA 1HYVA 5HRPA 4OPKA 3TAFA 3TAPA 3HVRA 4AHTA 3QESA 1TK0A 4CEFA 1RDCA 4FLWA 3L3VA 4FJIA 3ZSWA 4CJRA 2PYLA 1HPZA 3OVNA 4M42A 2E4LA 1SKWA 4F8RA 1C0UA 1VSIA 4M3UA 3KD5E 1JL2A 4EZ9A 3IG1A 4DTMA 4FM1A 1RILA 4H8KA 4KI4A 2G8HA 1IKYA 4CHNA 2HNDA 4E7IA 1JLAA 3QEXA 4Z4FA 1DTQA 4I2PA 3ALYA 3DM2A 2IS3A 3AO2A 4HHTA 1F21A 3ZT1A 3KLIA 1MU2A 4ELUA 4FJNA 3LANA 2Z1HA 3HL8A 3KK1A 2XY5A 1RT6A 4DG1A 2GV9A 3KJVA 1WSIA 1UA1A 1TAUA 2QK9A 2R7YA 4CJQA 1BISA 1VSHA 4RW7A 3F73A 1EP4A 4DSJA 4HCBA 4NCAA 2HHVA 1U47A 1IG9A 1L3TA 2HNYA 5K14A 4N76A 3VQEA 4E7HA 4E3SA 4FJJA 1RDBA 4FJ9A 3QINA 3AVGA 4C8KA 1HJRA 2HHSA 4DTOA 4QOZB 1HMVA 2YNHA 3PO5A 4DSIA 1HYSA 1KFDA 5SWMA 2IOCA 1KVAA 1IKXA 2W42A 4DFPA 5J2MA 1TKZA 2GUIA 3ITHA 4W5OA 1J9AA 2DFFA 3LP0A 4Q5VA 2VG7A 1S6PA 4KHSA 2HHUA 3ZSVA 4E89A 1LWEA 3NH0A 2VWJA 4CFCA 4FJ8A 1HNVA 4DQQA 1B92A 4BDPA 4BE0A 3HPHA 4TSXA 3I8DA 4O44A 4F2SA 4KB0A 1JLFA 1IKVA 3RRGA 3ZT2A 4CJPA 4KO0A 1QTMA 1RBUA 1JL1A 3V4IA 2WONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL0 A;  3VQP A;  4CJL A;  1FXX A;  3OYA A;  1T8E A;  2FBY A;  3DI6 A;  2FBV A;  3LP2 A;  3OYG A;  4AHS A;  3OYI A;  3ASM A;  3EYZ A;  1KLN A;  1LW0 A;  1SUQ A;  4ID5 A;  4KHY A;  4PY5 A;  1S9G A;  3VQ7 A;  3WNH A;  3ZSZ A;  3AA5 X;  1JXE A;  4B8C A;  4CGD A;  2QKK A;  4PA1 A;  1C1B A;  1EKE A;  4CJF A;  3QNO A;  3NCI A;  4J2B A;  4DTX A;  4GW6 A;  3QIP A;  1B9F A;  4CE9 A;  5J2N A;  3V81 A;  1UA0 A;  2Z1I A;  1NK5 A;  3D45 A;  1L3V A;  4I9Q A;  3B6O A;  4N41 A;  1ASU A;  2IDO A;  2YKM A;  3VQC A;  3V6D A;  4DU1 A;  3I0R A;  3QEP A;  2HMI A;  1DLO A;  4CEC A;  4F2R A;  3OYK A;  1JKH A;  2HW3 A;  2E6M A;  2WOM A;  3T3F A;  4M3X A;  4BE1 A;  3OYM A;  1ZBU A;  1ZBF A;  3AVI A;  3IS9 A;  4WE1 A;  3SQ4 A;  3MEG A;  4W5T A;  2QXF A;  3SUP A;  3B6P A;  1RTD A;  5HRN A;  4IG3 A;  5HLF A;  4RG8 A;  2ETJ A;  1KCF A;  1X9M A;  2BAN A;  1LAW A;  3CQ8 A;  4OJR A;  4CHO A;  5I42 A;  4B9N A;  3AA2 A;  4FLU A;  1ZYQ A;  4B9T A;  4CHZ A;  1JXB A;  3SCX A;  4ZTJ A;  1XC9 A;  3RR8 A;  4B3O A;  2HHW A;  4DLE A;  3TAN A;  1RBV A;  4CEA A;  1EX4 A;  4DTP A;  1T05 A;  4OKE A;  1Z26 A;  2JLE A;  3M8R A;  1JLQ A;  1ZBH A;  1TK8 A;  3V9W A;  4I9L A;  3PX4 A;  3AA4 A;  1TK5 A;  3VA0 A;  1J54 A;  4NYF A;  1Y97 A;  3T19 A;  4DTS A;  2Y1J A;  5FDL A;  1VSJ A;  3MEE A;  1NOY A;  2G8F A;  3MXI A;  3NH1 A;  3QET A;  4CGI A;  4O0J A;  3SUQ A;  4B8A B;  4CFD A;  3ZSO A;  2DTU A;  4DU4 A;  1VSE A;  1C0M A;  3F9K A;  3IRX A;  1D8Y A;  3L2R A;  3O4N A;  5C24 A;  1N6Q A;  4CF1 A;  4KTW A;  2B5J A;  3SUO A;  3WNE A;  4FZZ A;  2G8I A;  3NF7 A;  3CFO A;  1NKE A;  4CJ5 A;  3RMA A;  1NJY A;  3ZSQ A;  4HCC A;  4EZ6 A;  1XI1 A;  3ZT4 A;  3ZT3 A;  1B9D A;  3AVM A;  4HUE A;  3RMB A;  2ATQ A;  1SL1 A;  3DLG A;  3RRH A;  1K6Y A;  4DTN A;  1BQM A;  3DOK A;  4F4K A;  3NH2 A;  1VSD A;  4DMN A;  4UQG A;  1LW2 A;  4M41 A;  4M3Z A;  4DWI A;  5D3G A;  3O4Q A;  4KB1 A;  4Z4E A;  3M8S A;  4K8X A;  3AVF A;  3HK2 A;  1G15 A;  1KVC A;  3TR8 A;  2XO7 A;  3HPO A;  4KHN A;  3DOL A;  4EP4 A;  1HQE A;  4Z4H A;  5J2Q A;  4CGJ A;  1RT7 A;  3P83 D;  4E1M A;  2RF2 A;  3KKR A;  1SKR A;  1L5U A;  3AVB A;  4CK2 A;  1S1T A;  2JGU A;  4N47 A;  1NK0 A;  4OVL A;  4HTU A;  1VSL A;  4E7J A;  3HPG A;  4FW2 A;  3OS1 A;  1D5A A;  1TV6 A;  2ZD1 A;  2X6N A;  4FLX A;  4FJG A;  2X6S A;  4FJ7 A;  4FXD A;  1WNS A;  1BIZ A;  1FKP A;  4HUF A;  1TAQ A;  3MXM A;  1S1X A;  3HP9 A;  4E7L A;  2HVI A;  3K2P A;  3VQ8 A;  4HVJ A;  3TAQ A;  1RTJ A;  3QLH A;  1TKT A;  4CF8 A;  3HP6 A;  4DLG A;  1FKO A;  3AVL A;  1TGO A;  4CES A;  4CIG A;  4DQS A;  2ZQB A;  2OZS A;  4Y1C A;  4ZHR A;  4KI6 A;  1T7P A;  4JRP A;  2D0C A;  5CYM A;  3K5L A;  3K57 A;  1NK9 A;  1L3U A;  4Z4C A;  1YT3 A;  5J1E A;  1TKD A;  1VSF A;  4KRF A;  4CJU A;  1XWL A;  3OS2 A;  2GBZ A;  1NK7 A;  1YTU A;  3AVA A;  3ZSY A;  3OYB A;  3V9Z A;  3OS0 A;  4RW4 A;  5EU7 A;  3RMD A;  4MFB A;  1KFS A;  3DLK A;  4E1N A;  4CK1 A;  3SQ1 A;  4OKJ A;  4KAZ A;  4CJS A;  3PV8 A;  3DRP A;  4E19 A;  1S1W A;  4CJ4 A;  2KFZ A;  1Z25 A;  3QER A;  1RDD A;  4LSL A;  1A5W A;  3L8B A;  3P1G A;  4KV8 A;  2XY6 A;  3LZJ A;  2EHG A;  3V1R A;  1RDA A;  4Y1D A;  4CEO A;  4PUO A;  2D0B A;  4FJM A;  1NJX A;  1LWC A;  1RTI A;  2IC3 A;  2ZE2 A;  4OGE A;  2YV0 X;  4CF2 A;  3K5O A;  3LP1 A;  3EZ5 A;  4FLZ A;  3DLH A;  4DQP A;  4IKF A;  3AVC A;  4FM0 A;  1TKX A;  1KRP A;  1YVU A;  4Z4I A;  3NF8 A;  2VG6 A;  3RR7 A;  2YKN A;  3VQQ A;  1A5X A;  3E01 A;  4XIU A;  4AIL C;  3OYE A;  3OYF A;  2Y1I A;  3O3F A;  3HJF A;  3PO4 A;  3V1O A;  1UOC A;  4O4G A;  1VRT A;  4ICL A;  1ASV A;  4KPY A;  1W0H A;  5CY4 A;  2FBX A;  1T03 A;  1J5O A;  1BL3 A;  3AV9 A;  4R5P A;  4AHC A;  3L2W A;  4CJE A;  1U04 A;  2YHB A;  3MEC A;  1U45 A;  1L3S A;  4B9M A;  2DFE A;  1EXQ A;  3AVH A;  4OPJ A;  1WSF A;  4CJ3 A;  4CJK A;  3QEV A;  4OKK A;  5FRO A;  3OYJ A;  4IFY A;  4CGH A;  3RMC A;  3S3N A;  4FJX A;  3SUN A;  2KW4 A;  3ISN C;  3S3O A;  4FLT A;  3PX6 A;  4IDK A;  5DMR A;  4CEE A;  3VQ5 A;  3P5J A;  1KLM A;  2DFH A;  3ZSR A;  1WSH A;  4KHQ A;  2FC0 A;  3HVT A;  4DF8 A;  1NKC A;  1D9F A;  4Z0U A;  1X9W A;  2KTQ A;  3TAB A;  1BI4 B;  2PZS A;  4AHV A;  3ULD A;  4QAG A;  2KZM A;  1HRH A;  1C0T A;  4NYN A;  2NUB A;  3L2Q A;  1WAF A;  3M8P A;  4W5R A;  3BDP A;  4IG0 A;  3L2V A;  4B9U A;  1CLQ A;  5I3U A;  1EET A;  3VQD A;  1TL1 A;  3L3U A;  3CFP A;  2YHA A;  4CF0 A;  1GOA A;  1HYZ A;  4G1Q A;  4BWJ A;  1NKB A;  4M3R A;  4CFA A;  1TL3 A;  4FLV A;  4FJH A;  3OJS A;  5KTQ A;  1VRU A;  3VA3 A;  3QEW A;  3OJU A;  3LPT A;  5J2P A;  2FBT A;  3K5M A;  1NOZ A;  2DY4 A;  3KD1 E;  3NGY A;  4FLY A;  2HHQ A;  1XHX A;  3IAY A;  4AHU A;  1CXQ A;  2B6A A;  4DU3 A;  4DFM A;  1QSL A;  3CFR A;  3L2U A;  1BIU A;  4CIE A;  1KVB A;  3VQ4 A;  5HRR A;  2OPP A;  1N5Y A;  4DTJ A;  3FFI A;  4RW8 A;  3TAR A;  5CZ1 A;  4C8N A;  3HYF A;  2IAJ A;  4CJW A;  4CHY A;  3K58 A;  3VQA A;  1WSJ A;  4Q0B A;  3PY8 A;  2BE2 A;  3SZ2 A;  1VK0 A;  3NE6 A;  2VG5 A;  3HST B;  2G8U A;  5FRN A;  3RTV A;  4CEB A;  4BWM A;  3RWU A;  4FJL A;  3AVJ A;  2XRI A;  3M8Q A;  3LAL A;  4CER A;  3JSM A;  2OZM A;  4FYD A;  3SJJ A;  1NJW A;  2KZZ A;  3NGI A;  3DMJ A;  2G8K A;  3NF9 A;  3UIQ A;  4B9L A;  3V9S A;  2O4I A;  2D5R A;  4FZY A;  1QHT A;  5JS1 A;  3KLH A;  2KQ2 A;  3QIO A;  2I5J A;  4CGG A;  3LP3 A;  4IBN A;  2OPQ A;  4KTQ A;  2P1J A;  3WNG A;  1XHZ A;  1Q9Y A;  4DQI A;  1X9S A;  3AVK A;  4CHP A;  1FK9 A;  3TWH A;  1Q9X A;  2F8S A;  1KTQ A;  2HHT A;  3NFA A;  1YTA A;  4FK4 A;  2X78 A;  1UWB A;  3JYT A;  2P5G A;  3PX0 A;  1RT3 A;  5HRO A;  3HM9 A;  3CG7 A;  1O1W A;  1IO2 A;  1VSK A;  3V1Q A;  3D0P A;  4FCY A;  1VSM A;  3OYL A;  5FRM A;  2Q3S A;  3TAG A;  4K8Z A;  4B08 A;  2XHB A;  1ZBI A;  3I0S A;  5KGX A;  1C6V A;  4CEZ A;  4L8R B;  2D0A A;  3O3H A;  1WLJ A;  1UAX A;  1W9H A;  3DLR A;  4DQR A;  1QSY A;  4FZX C;  2YNI A;  3NF6 A;  3K59 A;  4I7F A;  2KFN A;  2G8V A;  4CHQ A;  3CM6 A;  2BDP A;  4DSL A;  3T1A A;  3U3G A;  4J2E A;  4KHW A;  4KRE A;  1U4B A;  1LAV A;  1RTH A;  3S3M A;  1RT2 A;  2G8W A;  5KRS A;  3DLB A;  4C8L A;  1S9E A;  4FM2 A;  2O4G A;  4FJ5 A;  3U6F A;  3NGZ A;  4ID1 A;  3OYN A;  3AVN A;  1HNI A;  2Z1G A;  3SYZ A;  1REV A;  1QQC A;  3BGR A;  3VQ6 A;  5KRT A;  2EX3 A;  2VWK A;  3OY9 A;  1KSP A;  1IKW A;  4I2Q A;  4O5B A;  4BDY A;  1J53 A;  4CEQ A;  4LH5 A;  1U48 A;  1CXU A;  4BE2 A;  3KLF A;  2OYQ A;  1BQN A;  3LAM A;  4JLH A;  3VQB A;  3ZCM A;  4RW9 A;  4CCH A;  2F96 A;  2YNG A;  2YNF A;  1RBS A;  3A2F A;  4CFB A;  3MED A;  4AHR A;  5HRS A;  3KLE A;  2HB5 A;  3AA3 A;  4CK3 A;  3HXM A;  3OYH A;  4BDZ A;  4DS4 A;  1WSG A;  1JLG A;  2XY8 A;  3C95 A;  3SI6 A;  2PY5 A;  4QCL A;  3THV A;  3LWL A;  4M45 A;  5T7B A;  4C8M A;  4J2A A;  4M3Y A;  4N5S A;  4BAC A;  3DLE A;  3CM5 A;  3KTQ A;  4KTZ A;  1IH7 A;  1ASW A;  3S9H A;  3KIO A;  3TI0 A;  5DK5 A;  3AO1 A;  3SPY A;  4OGC A;  1LV5 A;  4W5Q A;  2AJQ A;  4DTU A;  3VN5 A;  3KLG A;  1HQU A;  3OYC A;  4DF4 A;  1RT4 A;  4JRQ A;  1S6Q A;  2A1R A;  3WNF A;  3DRS A;  4E0D A;  2OPS A;  3LDS A;  1WAJ A;  4E7K A;  3MXJ A;  1I39 A;  4FVM A;  1ZBL A;  4F3T A;  4RW6 A;  1I3A A;  1R0A A;  4HUG A;  4KHU A;  3EY1 A;  3QEI A;  2QKB A;  3TAM A;  3MAQ A;  4AH9 A;  4ELT A;  4M3W A;  4PQU A;  2F8T A;  4PWD A;  3SQ2 A;  3LZI A;  2HVH A;  4JS4 A;  5HBM A;  1S5J A;  1JLE A;  2RKI A;  4DFK A;  1Q8I A;  5JS2 A;  3K5N A;  4FK0 A;  3H08 A;  1A5V A;  4H4O A;  1NJZ A;  4B9V A;  1WSE A;  3LAK A;  4KKO A;  3NAE A;  1RBT A;  4CED A;  4LY7 A;  1U49 A;  4M3T A;  1JLC A;  2X74 A;  3C94 A;  1JLB A;  4C8O A;  1X1P A;  1NK4 A;  1S1V A;  1RBR A;  3AO3 A;  3LPU A;  1BGX T;  1SKS A;  4GVM A;  4JS5 A;  4B9S A;  1RT1 A;  1C1A A;  2OPR A;  3SNN A;  4J2D A;  3QNN A;  3DRR A;  3OYD A;  4DTR A;  3HO1 A;  1LWF A;  5C25 A;  4YFU A;  4W5N A;  4CGF A;  1S1U A;  3C6T A;  3C6U A;  5KI6 A;  3V9U A;  1BCM A;  4N56 A;  2ITG A;  3U3Y A;  3PUF A;  5C42 A;  2XY7 A;  3TAE A;  2B4J A;  1QSS A;  3G0Z A;  4O55 A;  3ZT0 A;  2RN2 A;  2HNZ A;  1NK6 A;  1RT5 A;  4DSE A;  4FK2 A;  3V9X A;  4OLA A;  1BCO A;  4OLB A;  1WN7 A;  1ITG A;  4ELV A;  1BI4 A;  4KFB A;  3SPZ A;  3DYA A;  4NCB A;  3ZSX A;  5HP1 A;  4Z4G A;  3LWM A;  1SL2 A;  4ZTF A;  1SV5 A;  1GOC A;  1QS4 A;  1GOB A;  3AO5 A;  4DSF A;  4YNQ A;  4CIF A;  3QO9 A;  4MQ3 A;  3NBP A;  3CYM A;  5E41 A;  2PYJ A;  1CZ9 A;  4H4M A;  4NCG A;  5CYQ A;  3HT3 A;  4CF9 A;  2OA8 A;  3KKS A;  4IFV A;  1D9D A;  4DFJ A;  2P51 A;  3G10 A;  2HHX A;  1BHL A;  4FJK A;  4EP5 A;  3O3G A;  3KK2 A;  4DS5 A;  4FW1 A;  4CJV A;  3SQ0 A;  2P5O A;  4DSK A;  5SZT A;  3NHG A;  2BGG A;  3SV4 A;  3VQ9 A;  1NK8 A;  1RCH A;  4O0I A;  4GMJ B;  4LH4 A;  3AO4 A;  3KK3 A;  2Z1J A;  1CZB A;  1DTT A;  4LSN A;  2LSN A;  4LD0 A;  2E6L A;  2A1S A;  1TVR A;  3SV3 A;  5CZ2 A;  1QE1 A;  1RNH A;  2IGI A;  2RPI A;  4CJT A;  3NDK A;  4F3O A;  1C1C A;  5KGW A;  1HYV A;  5HRP A;  4OPK A;  3TAF A;  3TAP A;  3HVR A;  4AHT A;  3QES A;  1TK0 A;  4CEF A;  1RDC A;  4FLW A;  3L3V A;  4FJI A;  3ZSW A;  4CJR A;  2PYL A;  1HPZ A;  3OVN A;  4M42 A;  2E4L A;  1SKW A;  4F8R A;  1C0U A;  1VSI A;  4M3U A;  3KD5 E;  1JL2 A;  4EZ9 A;  3IG1 A;  4DTM A;  4FM1 A;  1RIL A;  4H8K A;  4KI4 A;  2G8H A;  1IKY A;  4CHN A;  2HND A;  4E7I A;  1JLA A;  3QEX A;  4Z4F A;  1DTQ A;  4I2P A;  3ALY A;  3DM2 A;  2IS3 A;  3AO2 A;  4HHT A;  1F21 A;  3ZT1 A;  3KLI A;  1MU2 A;  4ELU A;  4FJN A;  3LAN A;  2Z1H A;  3HL8 A;  3KK1 A;  2XY5 A;  1RT6 A;  4DG1 A;  2GV9 A;  3KJV A;  1WSI A;  1UA1 A;  1TAU A;  2QK9 A;  2R7Y A;  4CJQ A;  1BIS A;  1VSH A;  4RW7 A;  3F73 A;  1EP4 A;  4DSJ A;  4HCB A;  4NCA A;  2HHV A;  1U47 A;  1IG9 A;  1L3T A;  2HNY A;  5K14 A;  4N76 A;  3VQE A;  4E7H A;  4E3S A;  4FJJ A;  1RDB A;  4FJ9 A;  3QIN A;  3AVG A;  4C8K A;  1HJR A;  2HHS A;  4DTO A;  4QOZ B;  1HMV A;  2YNH A;  3PO5 A;  4DSI A;  1HYS A;  1KFD A;  5SWM A;  2IOC A;  1KVA A;  1IKX A;  2W42 A;  4DFP A;  5J2M A;  1TKZ A;  2GUI A;  3ITH A;  4W5O A;  1J9A A;  2DFF A;  3LP0 A;  4Q5V A;  2VG7 A;  1S6P A;  4KHS A;  2HHU A;  3ZSV A;  4E89 A;  1LWE A;  3NH0 A;  2VWJ A;  4CFC A;  4FJ8 A;  1HNV A;  4DQQ A;  1B92 A;  4BDP A;  4BE0 A;  3HPH A;  4TSX A;  3I8D A;  4O44 A;  4F2S A;  4KB0 A;  1JLF A;  1IKV A;  3RRG A;  3ZT2 A;  4CJP A;  4KO0 A;  1QTM A;  1RBU A;  1JL1 A;  3V4I A;  2WON A; 
#chains in the Genus database with same CATH topology
 1T8E A;  1FXX A;  3M6G A;  5AQV A;  2FBY A;  3DI6 A;  2FBV A;  2IIR A;  3OYI A;  1HJO A;  3D7E O;  3SAH A;  3ZSZ A;  2QKK A;  2I7N A;  1C1B A;  2IVP A;  3ENB A;  4GW6 A;  1UA0 A;  2H3G X;  5C12 A;  4BRH A;  3VQC A;  2WUS A;  4CEC A;  3OYK A;  3VGL A;  4M3X A;  4BE1 A;  4GV6 A;  4UY8 O;  4WE1 A;  3MEG A;  4W5T A;  3O9S A;  3SUP A;  5HLF A;  5AQM A;  1KCF A;  4OJR A;  4WFB L;  3RR8 A;  4CEA A;  1KXP A;  4B1X B;  5GIO A;  2ASO A;  2JLE A;  4FOE A;  1Y97 A;  4DTS A;  2P9K B;  1NOY A;  4DKW A;  3MXI A;  4FWS A;  2QW9 A;  2OAN A;  4O0J A;  4B8A B;  4CFD A;  3T1Y K;  4DU4 A;  1D8Y A;  3ATU A;  3L2R A;  3QFU A;  4C23 A;  3NF7 A;  2ITM A;  5EY4 A;  3HSC A;  4CZI A;  1B9D A;  3RMB A;  4AM6 A;  1FW6 A;  4DTN A;  2P9S A;  4F4K A;  1BU6 O;  4FWP A;  4M41 A;  4DWI A;  5D3G A;  3O4Q A;  1YI2 N;  3M8S A;  1KVC A;  3F2K A;  3HPO A;  1U2V B;  4X62 K;  2QWQ A;  1RT7 A;  4E1M A;  2RF2 A;  1SKR A;  3AVB A;  2W6K A;  4CK2 A;  4FW2 A;  4FLX A;  1D5A A;  1TV6 A;  2ZD1 A;  2X6N A;  4FJG A;  4FXD A;  1K8K A;  3CJ1 A;  2ZJP L;  4HUF A;  4BC4 A;  3TAQ A;  3HP6 A;  4CF8 A;  3D2F A;  1FKO A;  1Z05 A;  4ZHR A;  2KLA A;  2D0C A;  1NK9 A;  3K57 A;  1TKD A;  1QHA A;  1XWL A;  1NK7 A;  1WBD A;  4LF5 K;  5AQI A;  2GWK A;  4CJS A;  3DRP A;  4E19 A;  4BC2 A;  1Z25 A;  3L8B A;  3LZJ A;  3V1R A;  4Y1D A;  4PUO A;  4M3Z A;  5M1O A;  2HHX A;  1NJX A;  2IC3 A;  4CF2 A;  5M1Q A;  3EZ5 A;  1N8R O;  1HNX K;  4IKF A;  3P39 A;  4JYA K;  1KRP A;  3RSE A;  1E4G T;  3E01 A;  3UKR A;  4XIU A;  3OYF A;  3V1O A;  3VES A;  2QTD A;  2FBX A;  2V7Z A;  3J8A A;  1T03 A;  1BL3 A;  3AV9 A;  4AHC A;  1U04 A;  1OH5 A;  2YHB A;  4JKC A;  3AVH A;  4KHW A;  4CJ3 A;  3RMC A;  4OKK A;  3OYJ A;  3SMP A;  4XH4 A;  4GV3 A;  1ZXO A;  1NGG A;  3S3O A;  4FLT A;  4YY3 K;  3VQ5 A;  1W2B M;  1KLM A;  3OA9 A;  1WSH A;  2FC0 A;  3CC7 N;  3JAM O;  4Z0U A;  4B3T K;  4K43 A;  3VPZ A;  5FPD A;  4H03 B;  3L2V A;  4FOI A;  3VQD A;  3DLL L;  1NKB A;  3H6E A;  4AM7 A;  4DQ8 A;  3AGR A;  4BRA A;  5KQ8 A;  3VA3 A;  1QQO A;  2FBT A;  2A5X A;  4JHD A;  4FLY A;  3IAY A;  3VMF B;  5HRR A;  4BY9 C;  4RW8 A;  2FF3 B;  4B3R K;  3HYF A;  3MWT A;  3K58 A;  1TUU A;  1WSJ A;  4C1N K;  1NWK A;  1VK0 A;  5ADX H;  2G8U A;  1I94 K;  4A61 A;  4B1Z A;  2XRI A;  1X9J A;  4CER A;  1KAY A;  4WYB A;  4FYD A;  3C6A A;  2O8D A;  3QFP A;  3ULE A;  3NF9 A;  4DV6 K;  3UIQ A;  4B9L A;  4FZY A;  2BTF A;  2HOE A;  3C7N B;  4OPA A;  3CPE A;  1NGB A;  1XHZ A;  1ATS A;  3BP8 A;  1X9S A;  1HNZ K;  3SK3 A;  3JYT A;  4K0K K;  2P5G A;  3A0I X;  4I6M B;  5HRO A;  4CVN E;  4BVP A;  3D0P A;  5FRM A;  5GAE P;  2Q3S A;  1ATR A;  5KGX A;  2P9P A;  1WLJ A;  4M7X A;  1KC8 O;  4LFA K;  2KKZ A;  1VQ4 N;  5M1P A;  4KRE A;  3T1A A;  5M1N A;  1RTH A;  3O9R A;  3S3M A;  1IV0 A;  4ID1 A;  1YJN N;  2Z1G A;  3SYZ A;  1REV A;  5KRT A;  4I2Q A;  2D0P A;  2NRX A;  4O5B A;  4CEQ A;  2GX9 A;  1CXU A;  3VQB A;  3ZCM A;  2YNG A;  3T7Z A;  3KLE A;  3KLH A;  3HXM A;  2PY5 A;  4BDZ A;  2YCH A;  1H1V A;  1S3X A;  2GTD A;  1KAX A;  3F9M A;  3THV A;  4B3M K;  2FSJ A;  5T7B A;  4J2A A;  1WBB A;  4KTZ A;  1IH7 A;  1T44 A;  3S9H A;  3KIO A;  2BH1 A;  3AAR A;  3AO1 A;  2RE2 A;  4BR5 A;  4PL8 A;  3MN6 A;  1NMD A;  3OYC A;  2UXC K;  1RT4 A;  1S6Q A;  2OPS A;  5LMN K;  3O8M A;  1HLU A;  3QML A;  4FO0 A;  4FVM A;  4JKD A;  4RW6 A;  3ZET B;  1R0A A;  3EY1 A;  3CCM N;  3QEI A;  3TAM A;  4M3W A;  4ELT A;  2F8T A;  4PWD A;  2HVH A;  4JS4 A;  3H45 C;  3ZLJ A;  3H08 A;  4B9V A;  1NJZ A;  1U49 A;  1JLC A;  1YVN A;  4FWL A;  1X1P A;  1S1V A;  5IT9 O;  1BGX T;  1SKS A;  2FSK A;  4GVM A;  4B9S A;  1RT1 A;  2D1K A;  2UUA K;  4NB4 A;  2OPR A;  1QVG M;  3SNN A;  2ZGZ A;  3QNN A;  3DRR A;  3GE1 A;  2HST A;  3CCJ N;  1LWF A;  4B9Q A;  4YFU A;  4CGF A;  2XY7 A;  4N56 A;  3U3Y A;  3PUF A;  4YOU A;  3ZT0 A;  5AQN A;  4FK2 A;  2FF6 A;  3TSP A;  4BQZ A;  1JCF A;  4OLA A;  4NXM K;  4ELV A;  4KFB A;  3SPZ A;  3QIC A;  4DV1 K;  1SL2 A;  4BRE A;  1GOB A;  5BRE A;  3BEX A;  5CYQ A;  1X3N A;  1D9D A;  5AQP A;  3A5L C;  3KZB A;  4FW1 A;  3NHG A;  3C6H A;  3VQ9 A;  2IVO A;  4GMJ B;  1XNQ K;  3L4Q A;  2Z1J A;  3VTH A;  5AJ3 K;  3O6W A;  3CD6 N;  4M63 C;  3SV3 A;  4IDH A;  4F3O A;  2RPI A;  4CJT A;  3KWI A;  1HYV A;  4OPK A;  3UB5 A;  2O8E A;  2HBK A;  3E1Y A;  4CJR A;  2PYL A;  2O8B A;  2E4L A;  2ZM6 K;  2GEL A;  1NU0 A;  4FWM A;  4WFA L;  1JL2 A;  4EZ9 A;  4DTM A;  3NVK A;  4KI4 A;  5AZJ B;  1KAZ A;  5F1X A;  2G8H A;  4CHN A;  4H0V B;  3QEX A;  4Z4F A;  4I2P A;  3ALY A;  4FWN A;  1F21 A;  4EAH D;  1MU2 A;  3PIO L;  3KK1 A;  2GEM A;  3KJV A;  2E20 A;  1NNE A;  1WSI A;  3ENO A;  4NLB A;  5JIC A;  4HCB A;  5K14 A;  1RDB A;  4FJ9 A;  3QIN A;  5AQH A;  1HMV A;  1HYS A;  1KFD A;  3ATV A;  2PBD A;  3VEZ A;  3VF4 A;  5GIP A;  5SWM A;  2IOC A;  2UYT A;  2GUI A;  4W5O A;  2DPN A;  4FPA A;  4JI6 K;  4Q5V A;  3DJC A;  4EHU A;  4H5T A;  4JKG A;  3DXM A;  3MX2 A;  4CFC A;  4EHT A;  4BQL A;  1YUW A;  3HPH A;  4JD2 A;  4KB0 A;  3K9K A;  1IKV A;  1SZ2 A;  3L4I A;  1NGJ A;  4CD1 A;  5KPR A;  2WON A;  4CJL A;  3OYG A;  4IJN A;  4ILH A;  3EYZ A;  3ASM A;  1SUQ A;  3TSQ A;  3WEE A;  3C0B A;  3VEV A;  3AA5 X;  1JXE A;  4PA1 A;  1EKE A;  4CJF A;  5CE3 A;  1EO1 A;  4DTX A;  3V81 A;  1RDW X;  4ISE A;  1L3V A;  3B6O A;  1BO5 O;  1ASU A;  2IDO A;  4DU1 A;  3I0R A;  3QEP A;  5AQG A;  3VET A;  1JKH A;  4IWV A;  5AZI B;  3EE8 A;  1GLB G;  1LOT B;  1GLL O;  3OYM A;  4DR7 K;  3THW A;  5KPZ A;  3IS9 A;  4IFE A;  3AGK A;  3ZX2 A;  2QXF A;  1RTD A;  3CPW M;  4FL9 A;  4IG3 A;  1NM1 A;  1X9M A;  2BAN A;  4CHO A;  1XMO K;  3SCX A;  1XC9 A;  4DTP A;  1ESV A;  1EX4 A;  3WXM B;  1T05 A;  4CZL A;  1Z26 A;  1ZBH A;  4I9L A;  3AA4 A;  1J54 A;  1D4X A;  2Y1J A;  3U9Z A;  2G8F A;  3NH1 A;  4BRI A;  3T69 A;  4X64 K;  1R59 O;  3SUQ A;  3ZSO A;  1TYQ B;  3F9K A;  4FSV A;  2B5J A;  4FZZ A;  4DV4 K;  3CFO A;  1NKE A;  3RMA A;  3ZSQ A;  4HCC A;  1NLV A;  3HI0 A;  1XUP O;  3ZT3 A;  4HUE A;  3AVM A;  2ATQ A;  3J7Z O;  3RRH A;  5IWA K;  3FZL A;  1BQM A;  3NH2 A;  1HKB A;  3CER A;  5JVG L;  2XO7 A;  3TR8 A;  2O8F B;  5AQQ A;  4EP4 A;  1S22 A;  4Z4H A;  1XMQ K;  5J2Q A;  3FZH A;  3HOS A;  5C15 A;  3KKR A;  4PHT X;  5FPE A;  3SBT A;  4HTU A;  3OS1 A;  1BIZ A;  4G9Z A;  1FKP A;  3MXM A;  1TAQ A;  5F2R A;  4E7L A;  2HVI A;  4HVJ A;  1CZA N;  1RTJ A;  3AVL A;  3W0L A;  2ZQB A;  4BG9 A;  3CIP A;  5CYM A;  4JRP A;  3IDH A;  4B3S K;  4DR5 K;  1DGK N;  1VSF A;  4CI6 A;  2GBZ A;  4K25 A;  3V9Z A;  4B1W B;  4RW4 A;  1JCE A;  3DLK A;  4WQ4 C;  1XC3 A;  4LF4 K;  3SQ1 A;  4KHP K;  3EZW A;  3PV8 A;  2OCE A;  4H5W A;  1S1W A;  2KFZ A;  3EN9 A;  5LJV A;  4JEP A;  2PFU A;  4LSL A;  3P1G A;  5EXW A;  2EHG A;  4FJM A;  1RTI A;  3LP1 A;  1IG8 A;  4FLZ A;  3CME N;  4FM0 A;  2YKN A;  4AIL C;  1NGH A;  4JI5 K;  3CXC M;  2Q1N A;  3HJF A;  1HX1 A;  1K8A O;  4ICL A;  1RGI A;  2F9T A;  4A2B A;  3A5M C;  4JI1 K;  4IEE A;  1L3S A;  3O08 A;  5C10 A;  1EXQ A;  3BZC A;  5BRF A;  4WQ5 C;  1EWR A;  5BR9 A;  2P9N A;  1T6D A;  3SUN A;  4FJX A;  2KW4 A;  3ISN C;  2OTL N;  2YHX A;  4IDK A;  3MWP A;  3P5J A;  3E9O A;  3HVT A;  4DF8 A;  3K9J A;  4IO8 A;  2IVN A;  3CJC A;  3TAB A;  1BI4 B;  1IBK K;  2PZS A;  3ULD A;  2ASM A;  1C0T A;  2NUB A;  1WAF A;  3M8P A;  4W5R A;  2QA4 N;  3NMU A;  1EET A;  1TL1 A;  3CFP A;  4CF0 A;  2UUB K;  2F9W A;  3CCS N;  4M3R A;  4BRK A;  4FJH A;  3OJS A;  1X3M A;  1BA1 A;  3LPT A;  3G6E N;  3VOV A;  3K5M A;  1NOZ A;  5FLX O;  3KD1 E;  1XNR K;  4DU3 A;  4DHY A;  4DFM A;  3GDQ A;  1QSL A;  3CFR A;  3FZM A;  4CIE A;  1KVB A;  1Q82 O;  3CCL N;  2OPP A;  3D6R A;  4C8N A;  3FE1 A;  3O4W A;  4CHY A;  3PY8 A;  3SZ2 A;  3NE6 A;  2QWN A;  3S41 A;  3RTV A;  4CEB A;  4BWM A;  3ZX3 A;  3M8Q A;  3LAL A;  1M1K O;  3CJ7 A;  5AQJ A;  3V9S A;  2D4W A;  1QHT A;  4V19 S;  3QIO A;  2I5J A;  1GLF O;  3VF6 A;  1K8K B;  3TWH A;  1Q9X A;  3O9U A;  2X78 A;  3HM9 A;  3CG7 A;  1VSK A;  3V1Q A;  1IJJ A;  1ZBI A;  3CCV N;  2YHY A;  4ISF A;  2D0A A;  4CEZ A;  4L8R B;  3O3H A;  1UAX A;  3A8Y A;  1E3M A;  1BA0 A;  1GLA G;  3OW2 M;  3K59 A;  3SJH A;  3F5T A;  4YDU C;  2G8V A;  2NNW A;  3CM6 A;  4CHQ A;  4J2E A;  3U3G A;  3PSF A;  1U4B A;  4PKG A;  1RT2 A;  1U2V A;  1S72 N;  3DLB A;  5KPT A;  3NGZ A;  1HNI A;  2NRT A;  1MA9 B;  3Q7C A;  1KSP A;  1IKW A;  3UKR B;  1QZ5 A;  2ZJQ L;  1U48 A;  5H1S Q;  1K9M O;  2CH5 A;  3MK6 A;  4CCH A;  3AAP A;  4C1N I;  5HRS A;  1RBS A;  3AA3 A;  4CK3 A;  1WSG A;  1JLG A;  3E66 A;  4YOV A;  3LWL A;  4M45 A;  2O8C A;  4C8M A;  3CM5 A;  4DCH A;  3TI0 A;  1ZBS A;  4W5Q A;  3OBW A;  4DTU A;  1HQU A;  4DF4 A;  3I55 N;  4OX9 K;  2NRW A;  4E0D A;  5LJW A;  3LDS A;  2PAV A;  4F3T A;  4BRO A;  1J6Z A;  1BUP A;  2NZT A;  3SBG A;  3MAQ A;  5JVH L;  2QKB A;  4PQU A;  3CJA A;  4MLH A;  3BF3 A;  3JXU A;  4JAX A;  3VEN A;  4DFK A;  1JLE A;  2E2Q A;  2RKI A;  1Q8I A;  3K5N A;  1WSE A;  3NAE A;  4KKO A;  3HTV A;  3WT0 A;  5BN8 A;  5ADX A;  2UUC K;  4LY7 A;  5AQK A;  4M3T A;  4MO5 A;  3C94 A;  4JHD B;  3AO3 A;  1NGI A;  4RCH A;  1HNW K;  1RFQ A;  2ZF5 O;  3N4P A;  1YXQ A;  3WXK A;  1SQK A;  4BR4 A;  3TAE A;  3M3Z A;  3LDP A;  1QSS A;  3G0Z A;  1NK6 A;  2F7T A;  4IZ9 A;  4DSE A;  4OLB A;  3JS6 A;  3Q7B A;  1J5E K;  3O9Q A;  4NCB A;  4Z4G A;  1SV5 A;  1GOC A;  1ZC6 A;  2UXD K;  4DSF A;  1GLJ O;  4YNQ A;  1KD1 O;  4CIF A;  3I33 A;  5HOO A;  3CYM A;  3C65 A;  4H4M A;  2CGK A;  3HT3 A;  3KKS A;  4JN4 A;  4B1Y B;  3HM8 A;  2FLO A;  3IMX A;  3G10 A;  4FJK A;  3O3G A;  1VHX A;  3KK2 A;  3SQ0 A;  4DSK A;  5SZT A;  3WQT A;  3SV4 A;  3B8A X;  1OH7 A;  3KK3 A;  1WOQ A;  4LSN A;  3CCE N;  5CZ2 A;  1RNH A;  2IGI A;  1FJG K;  3LDQ A;  3TAP A;  5HRP A;  4AHT A;  3T1H K;  1XQS C;  4FWQ A;  4BR0 A;  3MX5 A;  3OVN A;  4M42 A;  4RWT A;  3NVM A;  3IG1 A;  4PL7 A;  2UXB K;  5FPN A;  4DV7 K;  4H8K A;  3VGM A;  1JLA A;  4IXC A;  1DTQ A;  3HOT A;  3DM2 A;  2IS3 A;  3AO2 A;  3C7N A;  5CHI A;  4HHT A;  3J81 O;  3ZT1 A;  3ZEU A;  3LAN A;  2Z1H A;  3R9P A;  4AQY K;  1RT6 A;  4GNI A;  3GOI A;  4RW7 A;  4CJQ A;  1U47 A;  2HHH K;  1L3T A;  4I6M A;  2ASP A;  4CZK A;  3GL1 A;  4C8K A;  1DT9 A;  1EWQ A;  2HHS A;  4DTO A;  4QOZ B;  3PO5 A;  4DSI A;  1DKG D;  2W42 A;  4JK8 A;  1C0F A;  5J2M A;  1TKZ A;  2NRR A;  4Y0W A;  3CCQ N;  5I9E B;  3PSI A;  3G25 A;  4YHH K;  4KHS A;  1NMN A;  1IBL K;  3ZSV A;  3E9P A;  3NH0 A;  2VWJ A;  1HNV A;  4DQQ A;  4BDP A;  4BE0 A;  4F2S A;  1JLF A;  3ZT2 A;  4KO0 A;  1QTM A;  2W6L A;  1QSY A;  1SL0 A;  3VQP A;  1W97 L;  3OYA A;  4FK0 A;  1KLN A;  5C2F A;  3LP2 A;  4AHS A;  1LW0 A;  4ID5 A;  1S9G A;  3VQ7 A;  3IFR A;  3H1Q A;  3QNO A;  3NCI A;  5J2N A;  4CE9 A;  1GLE G;  1B9F A;  3QIP A;  2Z1I A;  3D45 A;  4I9Q A;  5BRD A;  3V6D A;  1MDU B;  2HMI A;  1DLO A;  4U67 L;  4Z94 A;  1VQL N;  4BGA A;  5BPL A;  4O8U A;  3PLA A;  2NRZ A;  3SAG A;  1Q7Y O;  3DWL A;  1ATN A;  3ZET A;  4BVO A;  1LAW A;  3WXL A;  5I42 A;  4B9N A;  3AA2 A;  4FLU A;  1ZYQ A;  1RDU A;  4B3O A;  1VQK N;  3TAN A;  5AQX A;  3BF1 A;  5F0X A;  4JK7 A;  4H5V A;  2QWR A;  3M8R A;  1JLQ A;  3MDQ A;  4CZM A;  4HWI A;  4NYF A;  2CGL A;  1VSJ A;  3MEE A;  2P9L A;  5JMV A;  2A6A A;  4LFC K;  2DTU A;  3THY B;  1VSE A;  3IRX A;  1BG3 A;  1N6Q A;  4CF1 A;  4KTW A;  3SUO A;  3G4S N;  3G71 N;  2G8I A;  1Q18 A;  1NJY A;  1V4T A;  1XI1 A;  2QWL A;  1SL1 A;  3EKU A;  3DLG A;  1K6Y A;  3DOK A;  3O9T A;  1VSD A;  4DMN A;  3THX B;  1MWM A;  1G15 A;  4KHN A;  1HQE A;  4JKF A;  3VEX A;  3I8B A;  4CGJ A;  3P83 D;  5JLF A;  1QQM A;  1S1T A;  2JGU A;  4N47 A;  2ZJR L;  4BRL A;  4A59 A;  2A41 A;  5GAG P;  4EFH A;  3HPG A;  1TUY A;  4FJ7 A;  2X6S A;  3K2P A;  3QLH A;  4DLG A;  4DQS A;  4CES A;  3CJB A;  3HRG A;  2OZS A;  4BR9 A;  4KI6 A;  1T7P A;  3FZK A;  1L3U A;  4Z4C A;  5B8H A;  4JKB A;  4KBO A;  4KRF A;  3DXK A;  3OS2 A;  1YTU A;  3ZSY A;  1YHQ N;  3OYB A;  1KFS A;  4JNE A;  4OKJ A;  3RVC A;  4JD2 B;  5BRH A;  4KV8 A;  2XY6 A;  4CEO A;  2KZZ A;  2D0B A;  4OGE A;  2YV0 X;  4DQP A;  3K5O A;  3OTO K;  3TPQ A;  1TKX A;  1YVU A;  3NF8 A;  2VG6 A;  3RR7 A;  1BOT O;  4BGB A;  3VQQ A;  3WUH A;  3OYE A;  3O3F A;  3PO4 A;  1VQM N;  3CQX A;  1ASV A;  5AFU H;  3CMA N;  1J5O A;  2E8A A;  3QB0 A;  5AQZ A;  4A57 A;  3L2W A;  4CJE A;  5HL7 L;  3MEC A;  1U45 A;  2V51 B;  2DFE A;  4BRD A;  4OPJ A;  4B9U A;  4CJK A;  1NG9 A;  4IFY A;  5M1K A;  1NGA A;  2BUP A;  2NRH A;  5DM7 L;  3THW B;  5DMR A;  3ZSR A;  5JLH A;  4H0P A;  3VER A;  2KTQ A;  3N4Q A;  3D2E B;  4AHV A;  3K0S A;  1HRH A;  3L2Q A;  2J4R A;  1CLQ A;  3P31 A;  4IG0 A;  4CZJ A;  5I3U A;  2P9I B;  2RHK A;  2YHA A;  1GOA A;  3LM9 A;  4G1Q A;  4BWJ A;  4A2A A;  3CC2 N;  1TL3 A;  3R8E A;  4FLV A;  4LC9 B;  1DEJ A;  4U7B A;  3HZ6 A;  1Z6R A;  3QEW A;  3OJU A;  4XH1 A;  5LL6 Z;  4YOW A;  2DY4 A;  4YOY A;  3NGY A;  4H0X B;  2WTU A;  1CXQ A;  5LMU K;  4LF6 K;  3L2U A;  1BIU A;  2YJF A;  1N5Y A;  4DTJ A;  4AF1 A;  2IAJ A;  4CJW A;  3VQA A;  4Q0B A;  3W3D A;  4F9O A;  1ILY A;  4YOT A;  3AVJ A;  2Q2R A;  2F4V K;  5FPM A;  3PIP L;  4JI4 K;  2NRV A;  1NJW A;  3DMJ A;  2O4I A;  3VEO A;  5GAD P;  4DR1 K;  4KH5 A;  3ZX0 A;  2KQ2 A;  3LP3 A;  4IBN A;  4KTQ A;  2P1J A;  1Q9Y A;  2I7P A;  4JK9 A;  3AVK A;  4CHP A;  3UKU B;  2HHT A;  4DV3 K;  1YTA A;  4FK4 A;  3U9D A;  1TYQ A;  1UWB A;  5EVZ A;  4WCE L;  1O1W A;  2JWK A;  1IO2 A;  1VSM A;  3KHY A;  5AQF A;  1Y64 A;  3R1X A;  3DLR A;  4DQR A;  4FZX C;  2YNI A;  4QS8 A;  3VGK A;  2BDP A;  4DSL A;  4E1J A;  2O8F A;  5KRS A;  4FM2 A;  1Q81 O;  4GVE A;  3OYN A;  3AVN A;  2P9U B;  3BGR A;  3OY9 A;  2EX3 A;  1GLD G;  4BE2 A;  4MDB A;  4WFN L;  1BQN A;  3SAF A;  2OYQ A;  4RW9 A;  2YNF A;  3MED A;  3OYH A;  4QCL A;  4A5A A;  3BZK A;  4DR2 K;  4M3Y A;  5TKW A;  1Q86 O;  4BAC A;  5DK5 A;  3SPY A;  4OGC A;  1LV5 A;  1QZ6 A;  4GY2 B;  4GV9 A;  3VN5 A;  2WC9 A;  4LFB K;  3WNF A;  3DRS A;  3MXJ A;  1I39 A;  1ZBL A;  4HUG A;  4BRC A;  4DB3 A;  3SQ2 A;  2WBN A;  5C0Y A;  4H4O A;  4B1V A;  3QDK A;  1RBT A;  2YX6 A;  4CED A;  2V7Y A;  2X74 A;  3WXJ A;  1NK4 A;  1RBR A;  3LPU A;  2QEX N;  3AAQ A;  4JS5 A;  3CET A;  1C1A A;  3P38 A;  4ILG B;  4DTR A;  3HO1 A;  1E4F T;  5C25 A;  1YIT N;  4W5N A;  1S1U A;  3C6T A;  3C6U A;  5KI6 A;  3V9U A;  2ZWH A;  4CZF A;  3VEY A;  2B4J A;  3WXI A;  2RN2 A;  2HNZ A;  3O1B A;  1RT5 A;  3P4I A;  1WN7 A;  1ITG A;  1BI4 A;  3FGU A;  1QVF M;  5HP1 A;  2P9S B;  1YAG A;  1QS4 A;  3AO5 A;  4A62 A;  3LDO A;  3I56 N;  3QO9 A;  1VQP N;  2AP1 A;  4MQ3 A;  3HBT A;  3LDL A;  5E41 A;  3VEW A;  2PYJ A;  2OA8 A;  3GBT A;  4M7Y A;  1VQ9 N;  2HBL A;  1BHL A;  2E1Z A;  4CJV A;  2P5O A;  1YF5 L;  3MN7 A;  4LH4 A;  5AQY A;  3AO4 A;  2P9K A;  2HF3 A;  2A1S A;  4CD3 A;  3D2F B;  1QE1 A;  3NDK A;  4EIA A;  5KGW A;  3HVR A;  3QES A;  1TK0 A;  1NGE A;  1RDC A;  5AR0 A;  4IO9 L;  4FJI A;  3L6Q A;  3CHW A;  4F8R A;  1C0U A;  1VSI A;  3KD5 E;  2FSN A;  4FM1 A;  5C2D A;  1RIL A;  4FWK A;  2HND A;  4E7I A;  4NLC A;  4OO1 J;  3HL8 A;  1HKC A;  3RSE B;  2GV9 A;  1UA1 A;  2E88 A;  4JV5 K;  2R7Y A;  3F73 A;  1BIS A;  1EP4 A;  4NCA A;  2HHV A;  1IG9 A;  2HNY A;  4N76 A;  3QBW A;  3VQE A;  4E7H A;  4E3S A;  4FJJ A;  2OTJ N;  2HBJ A;  3AVG A;  1VQ8 N;  4BG8 A;  2O8C B;  1YJ9 N;  4MO4 A;  4PKH A;  1KVA A;  4DFP A;  3ITH A;  4H0O A;  5ELZ A;  4FWO A;  1J9A A;  4LF8 K;  2DFF A;  4LF9 K;  4BC3 A;  3CCR N;  3LP0 A;  3TTC A;  2KHO A;  3OBY A;  2HHU A;  3EKS A;  2CGJ A;  4E89 A;  1OH8 A;  1LWE A;  4FJ8 A;  1B92 A;  4B1U B;  4NO7 A;  4O44 A;  4CJP A;  1JCG A;  2QWO A;  3IKM A;  1VQ7 N;  2E2N A;  4PY5 A;  4KHY A;  3U4L A;  3WNH A;  4OPH A;  3IUC A;  4B8C A;  4CGD A;  5AQU A;  4CW7 B;  3LDN A;  3MMV A;  3AY9 A;  4J2B A;  1NK5 A;  4N41 A;  2YKM A;  2JWL A;  1IBM K;  3TU5 A;  2QWP A;  4F2R A;  4KH4 A;  2HW3 A;  4H0Y B;  2E6M A;  2WOM A;  3T3F A;  1ZBU A;  2GWJ A;  1ZBF A;  3AVI A;  3SQ4 A;  4DUY K;  3B6P A;  5HRN A;  4RG8 A;  2ETJ A;  4BRM A;  4DR6 K;  1N32 K;  3CQ8 A;  2VGN A;  3CC4 N;  2O8D B;  2HF4 A;  4B9T A;  4BR7 A;  2VWB A;  3EL2 A;  4CHZ A;  1JXB A;  4ZTJ A;  3J7A P;  3ULE B;  2HMP A;  2HHW A;  4DLE A;  1RBV A;  4A5B A;  1BDG A;  4OKE A;  4FPB A;  4DR4 K;  1TK8 A;  1U6Z A;  3V9W A;  3PX4 A;  1TK5 A;  3VA0 A;  3T19 A;  5FDL A;  3WQU A;  3QET A;  4CGI A;  1C0M A;  3O4N A;  5C24 A;  4JI3 K;  3WNE A;  3H46 O;  4CJ5 A;  5AQR A;  4EZ6 A;  4K42 A;  1W7A A;  3ENH A;  3ZT4 A;  4WQ4 A;  2P9P B;  4DR3 K;  1T6C A;  4HTL A;  3QBX A;  4UQG A;  5AQT A;  1LW2 A;  3HK2 A;  2E5L K;  4KB1 A;  4Z4E A;  4K8X A;  3AVF A;  3H3O B;  3CF5 L;  3DOL A;  3U8X A;  1SAZ A;  3ZEU B;  2Q31 A;  4O5F A;  1VQ5 N;  1L5U A;  1NK0 A;  4OVL A;  1VAZ A;  2HBM A;  1VSL A;  4E7J A;  1G99 A;  1WUA A;  1WNS A;  4IEI A;  1S1X A;  3HP9 A;  2GUP A;  3VQ8 A;  1NGF A;  1TKT A;  1C0G A;  4CIG A;  1TGO A;  4CJ7 A;  3EE9 A;  1NJI O;  4Y1C A;  2QWM A;  3K5L A;  4WQ5 A;  3MCA B;  1LCU A;  1BWF O;  1YT3 A;  5J1E A;  4CJU A;  1NGC A;  3AVA A;  3OS0 A;  5EU7 A;  3RMD A;  4MFB A;  3M1F A;  4E1N A;  4J8F A;  3TTD A;  4CK1 A;  4KAZ A;  4JI7 K;  4PKI A;  4BRN A;  4CJ4 A;  3QER A;  1RDD A;  1A5W A;  1VQO N;  3TSU A;  1RDA A;  4NXN K;  1LWC A;  2YJE A;  2ZE2 A;  3FFK B;  3KWG A;  1OVQ A;  3BUZ B;  4QS9 A;  1OVY A;  3DLH A;  3SLC A;  3AVC A;  4H5R A;  1OH6 A;  4Z4I A;  1A5X A;  1QQN A;  2Y1I A;  4BR2 A;  1UOC A;  4O4G A;  1VRT A;  5E84 A;  4KPY A;  1W0H A;  5CY4 A;  4R5P A;  4XEI A;  4BRF A;  5AQO A;  4B9M A;  2Q0R A;  1WSF A;  3QEV A;  2WFB A;  4CZG A;  5FRO A;  3S3N A;  4CGH A;  3LL3 A;  1VQ6 N;  2E1Y A;  3PX6 A;  4CEE A;  2DFH A;  4KHQ A;  2FXU A;  1HPM A;  4JI8 K;  1NKC A;  1D9F A;  1X9W A;  2KZM A;  4QAG A;  3FLC O;  4NYN A;  3BDP A;  4CBW A;  2VQF K;  1GLC G;  2NLX A;  3L3U A;  1HYZ A;  4H0T B;  2AA4 A;  3H3N O;  4CFA A;  3LM2 A;  5KTQ A;  1VRU A;  2P9L B;  5J2P A;  4BC5 A;  2HHQ A;  1XHX A;  4AHU A;  4X66 K;  2B6A A;  4GKJ K;  3A5O C;  3R6M A;  3VQ4 A;  1JJ2 M;  3FFI A;  3TAR A;  5CZ1 A;  1K73 O;  1OKJ A;  3EEQ A;  2BE2 A;  2W41 A;  2VG5 A;  3HST B;  4K41 A;  5FRN A;  3RWU A;  4FJL A;  2O8E B;  4XH5 A;  5EOY A;  3VTI A;  2Q0U A;  4YDU A;  3JSM A;  2OZM A;  5TKY A;  3SJJ A;  2O8B B;  3NGI A;  2YI1 A;  4CBX A;  2VYP A;  4ISG A;  3MCP A;  5MLC Q;  1N33 K;  2D5R A;  5JS1 A;  2QI2 A;  3FZF A;  4JKH A;  3VF2 A;  4CGG A;  2OPQ A;  3WNG A;  4DQI A;  1FK9 A;  3DAW A;  4KH6 A;  2F8S A;  1KTQ A;  3NFA A;  3THY A;  5GAH P;  3O1W A;  4CZH A;  3PX0 A;  2UU9 K;  1RT3 A;  4FCY A;  3OYL A;  3DXK B;  2Q97 A;  3TAG A;  4K8Z A;  4B08 A;  2XHB A;  3I0S A;  1C6V A;  2A3Z A;  4DV0 K;  1W9H A;  2A42 A;  3THX A;  3NF6 A;  5AQL A;  1HR0 K;  4IJA A;  4I7F A;  5AFU A;  2KFN A;  4JI2 K;  1LAV A;  4JKG B;  2G8W A;  3DXM B;  4BRQ A;  4MLE A;  1S9E A;  4C8L A;  2O4G A;  4DV5 K;  3U6F A;  4FJ5 A;  4JKA A;  3J7Y P;  5AZJ A;  1QQC A;  3VQ6 A;  2VWK A;  3CJ9 A;  5M1F A;  4BDY A;  2QM1 A;  1J53 A;  4LH5 A;  1SS6 A;  3KLF A;  3E9L A;  3LAM A;  4JLH A;  3KK7 A;  3WEE B;  2F96 A;  4CFB A;  3A2F A;  4AHR A;  1NBW A;  2G8K A;  2HB5 A;  5LY3 A;  4DS4 A;  3SI6 A;  2XY8 A;  3C95 A;  4YOR A;  5GIN A;  3A5N C;  4L3Q A;  4N5S A;  1HUX A;  3DLE A;  2VCP A;  2V52 B;  3KTQ A;  1ASW A;  4IOC L;  3UE5 A;  4JKE A;  2AJQ A;  2D0O A;  4IOX A;  3O80 A;  5AQW A;  2YHW A;  4FVU A;  3KLG A;  1P8Z A;  3TTF A;  4JRQ A;  1MWK A;  2A1R A;  1WAJ A;  4E7K A;  1O13 A;  1I3A A;  4KHU A;  5EX5 A;  4AH9 A;  1YIJ N;  3LZI A;  3CQY A;  3MN9 A;  3O5B A;  1T3V A;  5HBM A;  1S5J A;  4LF7 K;  5JS2 A;  1A5V A;  1EQY A;  2W40 A;  1KQS M;  3LAK A;  5BPN A;  2ZGY A;  2E2O A;  1JLB A;  4C8O A;  4H5N A;  3FR0 A;  4J2D A;  4YOX A;  3OYD A;  3CCU N;  5BR8 K;  1BCM A;  2ITG A;  5C42 A;  4O55 A;  5KQD A;  1NGD A;  5AZI A;  3ID6 A;  1M90 O;  3V9X A;  1BCO A;  3R3L A;  3D2E A;  3DYA A;  2CH6 A;  3ZSX A;  3LWM A;  4ZTF A;  2P9I A;  3BY5 A;  4GKK K;  3NBP A;  5BPM A;  1CZ9 A;  4NCG A;  4CF9 A;  3H1V X;  4IFV A;  4DFJ A;  2P51 A;  4BRP A;  4X65 K;  5A2Q O;  1P90 A;  4BRG A;  4EP5 A;  5DM6 L;  4DS5 A;  2BGG A;  1NK8 A;  3CI5 A;  1RCH A;  4O0I A;  4ILJ A;  1V4S A;  1CZB A;  1DTT A;  2LSN A;  3EO3 A;  2E6L A;  4LD0 A;  1TVR A;  4R79 A;  1C1C A;  3TAF A;  3MN5 A;  4CEF A;  3J80 O;  4FLW A;  3GG4 A;  3L3V A;  5CR4 A;  3ZSW A;  4DV2 K;  1HPZ A;  2EWS A;  1SKW A;  4IOA L;  3KVG A;  4M3U A;  3ID8 A;  1N34 K;  1IKY A;  2VGM A;  4O8K A;  4ELU A;  3KLI A;  4FJN A;  2VQE K;  5E26 A;  2XY5 A;  4DG1 A;  3UKU A;  5BN9 A;  1TAU A;  2QK9 A;  1VSH A;  4DSJ A;  3L0Q A;  3ZYY X;  4CBU A;  4WF9 L;  2QXL A;  4JI0 K;  2E2P A;  1HJR A;  4DUZ K;  2Q36 A;  2A40 A;  2YNH A;  4CZE A;  1IKX A;  5AQS A;  1HKG A;  2P9N B;  4RTF D;  2VG7 A;  1S6P A;  1WB9 A;  1VQN N;  3OHR A;  4FWR A;  4TSX A;  2P9U A;  3I8D A;  3SMS A;  3RRG A;  4MDA A;  1RBU A;  4QS7 A;  1N36 K;  1JL1 A;  3M5R A;  1YJW N;  3V4I A; 
#chains in the Genus database with same CATH homology
 1SL0 A;  3VQP A;  4CJL A;  1FXX A;  3OYA A;  1T8E A;  2FBY A;  3DI6 A;  2FBV A;  3LP2 A;  3OYG A;  4AHS A;  3OYI A;  3ASM A;  3EYZ A;  1KLN A;  1LW0 A;  1SUQ A;  4ID5 A;  4KHY A;  4PY5 A;  1S9G A;  3VQ7 A;  3WNH A;  3ZSZ A;  3AA5 X;  1JXE A;  4B8C A;  4CGD A;  2QKK A;  4PA1 A;  1C1B A;  1EKE A;  4CJF A;  3QNO A;  3NCI A;  4J2B A;  4DTX A;  4GW6 A;  3QIP A;  1B9F A;  4CE9 A;  5J2N A;  3V81 A;  1UA0 A;  2Z1I A;  1NK5 A;  3D45 A;  1L3V A;  4I9Q A;  3B6O A;  4N41 A;  1ASU A;  2IDO A;  2YKM A;  3VQC A;  3V6D A;  4DU1 A;  3I0R A;  3QEP A;  2HMI A;  1DLO A;  4CEC A;  4F2R A;  3OYK A;  1JKH A;  2HW3 A;  2E6M A;  2WOM A;  3T3F A;  4M3X A;  4BE1 A;  3OYM A;  1ZBU A;  1ZBF A;  3AVI A;  3IS9 A;  4WE1 A;  3SQ4 A;  3MEG A;  4W5T A;  2QXF A;  3SUP A;  3B6P A;  1RTD A;  5HRN A;  4IG3 A;  5HLF A;  4RG8 A;  2ETJ A;  1KCF A;  1X9M A;  2BAN A;  1LAW A;  3CQ8 A;  4OJR A;  4CHO A;  5I42 A;  4B9N A;  3AA2 A;  4FLU A;  1ZYQ A;  4B9T A;  4CHZ A;  1JXB A;  3SCX A;  4ZTJ A;  1XC9 A;  3RR8 A;  4B3O A;  2HHW A;  4DLE A;  3TAN A;  1RBV A;  4CEA A;  1EX4 A;  4DTP A;  1T05 A;  4OKE A;  1Z26 A;  2JLE A;  3M8R A;  1JLQ A;  1ZBH A;  1TK8 A;  3V9W A;  4I9L A;  3PX4 A;  3AA4 A;  1TK5 A;  3VA0 A;  1J54 A;  4NYF A;  1Y97 A;  3T19 A;  4DTS A;  2Y1J A;  5FDL A;  1VSJ A;  3MEE A;  1NOY A;  2G8F A;  3MXI A;  3NH1 A;  3QET A;  4CGI A;  4O0J A;  3SUQ A;  4B8A B;  4CFD A;  3ZSO A;  2DTU A;  4DU4 A;  1VSE A;  1C0M A;  3F9K A;  3IRX A;  1D8Y A;  3L2R A;  3O4N A;  5C24 A;  1N6Q A;  4CF1 A;  4KTW A;  2B5J A;  3SUO A;  3WNE A;  4FZZ A;  2G8I A;  3NF7 A;  3CFO A;  1NKE A;  4CJ5 A;  3RMA A;  1NJY A;  3ZSQ A;  4HCC A;  4EZ6 A;  1XI1 A;  3ZT4 A;  3ZT3 A;  1B9D A;  3AVM A;  4HUE A;  3RMB A;  2ATQ A;  1SL1 A;  3DLG A;  3RRH A;  1K6Y A;  4DTN A;  1BQM A;  3DOK A;  4F4K A;  3NH2 A;  1VSD A;  4DMN A;  4UQG A;  1LW2 A;  4M41 A;  4M3Z A;  4DWI A;  5D3G A;  3O4Q A;  4KB1 A;  4Z4E A;  3M8S A;  4K8X A;  3AVF A;  3HK2 A;  1G15 A;  1KVC A;  3TR8 A;  2XO7 A;  3HPO A;  4KHN A;  3DOL A;  4EP4 A;  1HQE A;  4Z4H A;  5J2Q A;  4CGJ A;  1RT7 A;  3P83 D;  4E1M A;  2RF2 A;  3KKR A;  1SKR A;  1L5U A;  3AVB A;  4CK2 A;  1S1T A;  2JGU A;  4N47 A;  1NK0 A;  4OVL A;  4HTU A;  1VSL A;  4E7J A;  3HPG A;  4FW2 A;  3OS1 A;  1D5A A;  1TV6 A;  2ZD1 A;  2X6N A;  4FLX A;  4FJG A;  2X6S A;  4FJ7 A;  4FXD A;  1WNS A;  1BIZ A;  1FKP A;  4HUF A;  1TAQ A;  3MXM A;  1S1X A;  3HP9 A;  4E7L A;  2HVI A;  3K2P A;  3VQ8 A;  4HVJ A;  3TAQ A;  1RTJ A;  3QLH A;  1TKT A;  4CF8 A;  3HP6 A;  4DLG A;  1FKO A;  3AVL A;  1TGO A;  4CES A;  4CIG A;  4DQS A;  2ZQB A;  2OZS A;  4Y1C A;  4ZHR A;  4KI6 A;  1T7P A;  4JRP A;  2D0C A;  5CYM A;  3K5L A;  3K57 A;  1NK9 A;  1L3U A;  4Z4C A;  1YT3 A;  5J1E A;  1TKD A;  1VSF A;  4KRF A;  4CJU A;  1XWL A;  3OS2 A;  2GBZ A;  1NK7 A;  1YTU A;  3AVA A;  3ZSY A;  3OYB A;  3V9Z A;  3OS0 A;  4RW4 A;  5EU7 A;  3RMD A;  4MFB A;  1KFS A;  3DLK A;  4E1N A;  4CK1 A;  3SQ1 A;  4OKJ A;  4KAZ A;  4CJS A;  3PV8 A;  3DRP A;  4E19 A;  1S1W A;  4CJ4 A;  2KFZ A;  1Z25 A;  3QER A;  1RDD A;  4LSL A;  1A5W A;  3L8B A;  3P1G A;  4KV8 A;  2XY6 A;  3LZJ A;  2EHG A;  3V1R A;  1RDA A;  4Y1D A;  4CEO A;  4PUO A;  2D0B A;  4FJM A;  1NJX A;  1LWC A;  1RTI A;  2IC3 A;  2ZE2 A;  4OGE A;  2YV0 X;  4CF2 A;  3K5O A;  3LP1 A;  3EZ5 A;  4FLZ A;  3DLH A;  4DQP A;  4IKF A;  3AVC A;  4FM0 A;  1TKX A;  1KRP A;  1YVU A;  4Z4I A;  3NF8 A;  2VG6 A;  3RR7 A;  2YKN A;  3VQQ A;  1A5X A;  3E01 A;  4XIU A;  4AIL C;  3OYE A;  3OYF A;  2Y1I A;  3O3F A;  3HJF A;  3PO4 A;  3V1O A;  1UOC A;  4O4G A;  1VRT A;  4ICL A;  1ASV A;  4KPY A;  1W0H A;  5CY4 A;  2FBX A;  1T03 A;  1J5O A;  1BL3 A;  3AV9 A;  4R5P A;  4AHC A;  3L2W A;  4CJE A;  1U04 A;  2YHB A;  3MEC A;  1U45 A;  1L3S A;  4B9M A;  2DFE A;  1EXQ A;  3AVH A;  4OPJ A;  1WSF A;  4CJ3 A;  4CJK A;  3QEV A;  4OKK A;  5FRO A;  3OYJ A;  4IFY A;  4CGH A;  3RMC A;  3S3N A;  4FJX A;  3SUN A;  2KW4 A;  3ISN C;  3S3O A;  4FLT A;  3PX6 A;  4IDK A;  5DMR A;  4CEE A;  3VQ5 A;  3P5J A;  1KLM A;  2DFH A;  3ZSR A;  1WSH A;  4KHQ A;  2FC0 A;  3HVT A;  4DF8 A;  1NKC A;  1D9F A;  4Z0U A;  1X9W A;  2KTQ A;  3TAB A;  1BI4 B;  2PZS A;  4AHV A;  3ULD A;  4QAG A;  2KZM A;  1HRH A;  1C0T A;  4NYN A;  2NUB A;  3L2Q A;  1WAF A;  3M8P A;  4W5R A;  3BDP A;  4IG0 A;  3L2V A;  4B9U A;  1CLQ A;  5I3U A;  1EET A;  3VQD A;  1TL1 A;  3L3U A;  3CFP A;  2YHA A;  4CF0 A;  1GOA A;  1HYZ A;  4G1Q A;  4BWJ A;  1NKB A;  4M3R A;  4CFA A;  1TL3 A;  4FLV A;  4FJH A;  3OJS A;  5KTQ A;  1VRU A;  3VA3 A;  3QEW A;  3OJU A;  3LPT A;  5J2P A;  2FBT A;  3K5M A;  1NOZ A;  2DY4 A;  3KD1 E;  3NGY A;  4FLY A;  2HHQ A;  1XHX A;  3IAY A;  4AHU A;  1CXQ A;  2B6A A;  4DU3 A;  4DFM A;  1QSL A;  3CFR A;  3L2U A;  1BIU A;  4CIE A;  1KVB A;  3VQ4 A;  5HRR A;  2OPP A;  1N5Y A;  4DTJ A;  3FFI A;  4RW8 A;  3TAR A;  5CZ1 A;  4C8N A;  3HYF A;  2IAJ A;  4CJW A;  4CHY A;  3K58 A;  3VQA A;  1WSJ A;  4Q0B A;  3PY8 A;  2BE2 A;  3SZ2 A;  1VK0 A;  3NE6 A;  2VG5 A;  3HST B;  2G8U A;  5FRN A;  3RTV A;  4CEB A;  4BWM A;  3RWU A;  4FJL A;  3AVJ A;  2XRI A;  3M8Q A;  3LAL A;  4CER A;  3JSM A;  2OZM A;  4FYD A;  3SJJ A;  1NJW A;  2KZZ A;  3NGI A;  3DMJ A;  2G8K A;  3NF9 A;  3UIQ A;  4B9L A;  3V9S A;  2O4I A;  2D5R A;  4FZY A;  1QHT A;  5JS1 A;  3KLH A;  2KQ2 A;  3QIO A;  2I5J A;  4CGG A;  3LP3 A;  4IBN A;  2OPQ A;  4KTQ A;  2P1J A;  3WNG A;  1XHZ A;  1Q9Y A;  4DQI A;  1X9S A;  3AVK A;  4CHP A;  1FK9 A;  3TWH A;  1Q9X A;  2F8S A;  1KTQ A;  2HHT A;  3NFA A;  1YTA A;  4FK4 A;  2X78 A;  1UWB A;  3JYT A;  2P5G A;  3PX0 A;  1RT3 A;  5HRO A;  3HM9 A;  3CG7 A;  1O1W A;  1IO2 A;  1VSK A;  3V1Q A;  3D0P A;  4FCY A;  1VSM A;  3OYL A;  5FRM A;  2Q3S A;  3TAG A;  4K8Z A;  4B08 A;  2XHB A;  1ZBI A;  3I0S A;  5KGX A;  1C6V A;  4CEZ A;  4L8R B;  2D0A A;  3O3H A;  1WLJ A;  1UAX A;  1W9H A;  3DLR A;  4DQR A;  1QSY A;  4FZX C;  2YNI A;  3NF6 A;  3K59 A;  4I7F A;  2KFN A;  2G8V A;  4CHQ A;  3CM6 A;  2BDP A;  4DSL A;  3T1A A;  3U3G A;  4J2E A;  4KHW A;  4KRE A;  1U4B A;  1LAV A;  1RTH A;  3S3M A;  1RT2 A;  2G8W A;  5KRS A;  3DLB A;  4C8L A;  1S9E A;  4FM2 A;  2O4G A;  4FJ5 A;  3U6F A;  3NGZ A;  4ID1 A;  3OYN A;  3AVN A;  1HNI A;  2Z1G A;  3SYZ A;  1REV A;  1QQC A;  3BGR A;  3VQ6 A;  5KRT A;  2EX3 A;  2VWK A;  3OY9 A;  1KSP A;  1IKW A;  4I2Q A;  4O5B A;  4BDY A;  1J53 A;  4CEQ A;  4LH5 A;  1U48 A;  1CXU A;  4BE2 A;  3KLF A;  2OYQ A;  1BQN A;  3LAM A;  4JLH A;  3VQB A;  3ZCM A;  4RW9 A;  4CCH A;  2F96 A;  2YNG A;  2YNF A;  1RBS A;  3A2F A;  4CFB A;  3MED A;  4AHR A;  5HRS A;  3KLE A;  2HB5 A;  3AA3 A;  4CK3 A;  3HXM A;  3OYH A;  4BDZ A;  4DS4 A;  1WSG A;  1JLG A;  2XY8 A;  3C95 A;  3SI6 A;  2PY5 A;  4QCL A;  3THV A;  3LWL A;  4M45 A;  5T7B A;  4C8M A;  4J2A A;  4M3Y A;  4N5S A;  4BAC A;  3DLE A;  3CM5 A;  3KTQ A;  4KTZ A;  1IH7 A;  1ASW A;  3S9H A;  3KIO A;  3TI0 A;  5DK5 A;  3AO1 A;  3SPY A;  4OGC A;  1LV5 A;  4W5Q A;  2AJQ A;  4DTU A;  3VN5 A;  3KLG A;  1HQU A;  3OYC A;  4DF4 A;  1RT4 A;  4JRQ A;  1S6Q A;  2A1R A;  3WNF A;  3DRS A;  4E0D A;  2OPS A;  3LDS A;  1WAJ A;  4E7K A;  3MXJ A;  1I39 A;  4FVM A;  1ZBL A;  4F3T A;  4RW6 A;  1I3A A;  1R0A A;  4HUG A;  4KHU A;  3EY1 A;  3QEI A;  2QKB A;  3TAM A;  3MAQ A;  4AH9 A;  4ELT A;  4M3W A;  4PQU A;  2F8T A;  4PWD A;  3SQ2 A;  3LZI A;  2HVH A;  4JS4 A;  5HBM A;  1S5J A;  1JLE A;  2RKI A;  4DFK A;  1Q8I A;  5JS2 A;  3K5N A;  4FK0 A;  3H08 A;  1A5V A;  4H4O A;  1NJZ A;  4B9V A;  1WSE A;  3LAK A;  4KKO A;  3NAE A;  1RBT A;  4CED A;  4LY7 A;  1U49 A;  4M3T A;  1JLC A;  2X74 A;  3C94 A;  1JLB A;  4C8O A;  1X1P A;  1NK4 A;  1S1V A;  1RBR A;  3AO3 A;  3LPU A;  1BGX T;  1SKS A;  4GVM A;  4JS5 A;  4B9S A;  1RT1 A;  1C1A A;  2OPR A;  3SNN A;  4J2D A;  3QNN A;  3DRR A;  3OYD A;  4DTR A;  3HO1 A;  1LWF A;  5C25 A;  4YFU A;  4W5N A;  4CGF A;  1S1U A;  3C6T A;  3C6U A;  5KI6 A;  3V9U A;  1BCM A;  4N56 A;  2ITG A;  3U3Y A;  3PUF A;  5C42 A;  2XY7 A;  3TAE A;  2B4J A;  1QSS A;  3G0Z A;  4O55 A;  3ZT0 A;  2RN2 A;  2HNZ A;  1NK6 A;  1RT5 A;  4DSE A;  4FK2 A;  3V9X A;  4OLA A;  1BCO A;  4OLB A;  1WN7 A;  1ITG A;  4ELV A;  1BI4 A;  4KFB A;  3SPZ A;  3DYA A;  4NCB A;  3ZSX A;  5HP1 A;  4Z4G A;  3LWM A;  1SL2 A;  4ZTF A;  1SV5 A;  1GOC A;  1QS4 A;  1GOB A;  3AO5 A;  4DSF A;  4YNQ A;  4CIF A;  3QO9 A;  4MQ3 A;  3NBP A;  3CYM A;  5E41 A;  2PYJ A;  1CZ9 A;  4H4M A;  4NCG A;  5CYQ A;  3HT3 A;  4CF9 A;  2OA8 A;  3KKS A;  4IFV A;  1D9D A;  4DFJ A;  2P51 A;  3G10 A;  2HHX A;  1BHL A;  4FJK A;  4EP5 A;  3O3G A;  3KK2 A;  4DS5 A;  4FW1 A;  4CJV A;  3SQ0 A;  2P5O A;  4DSK A;  5SZT A;  3NHG A;  2BGG A;  3SV4 A;  3VQ9 A;  1NK8 A;  1RCH A;  4O0I A;  4GMJ B;  4LH4 A;  3AO4 A;  3KK3 A;  2Z1J A;  1CZB A;  1DTT A;  4LSN A;  2LSN A;  4LD0 A;  2E6L A;  2A1S A;  1TVR A;  3SV3 A;  5CZ2 A;  1QE1 A;  1RNH A;  2IGI A;  2RPI A;  4CJT A;  3NDK A;  4F3O A;  1C1C A;  5KGW A;  1HYV A;  5HRP A;  4OPK A;  3TAF A;  3TAP A;  3HVR A;  4AHT A;  3QES A;  1TK0 A;  4CEF A;  1RDC A;  4FLW A;  3L3V A;  4FJI A;  3ZSW A;  4CJR A;  2PYL A;  1HPZ A;  3OVN A;  4M42 A;  2E4L A;  1SKW A;  4F8R A;  1C0U A;  1VSI A;  4M3U A;  3KD5 E;  1JL2 A;  4EZ9 A;  3IG1 A;  4DTM A;  4FM1 A;  1RIL A;  4H8K A;  4KI4 A;  2G8H A;  1IKY A;  4CHN A;  2HND A;  4E7I A;  1JLA A;  3QEX A;  4Z4F A;  1DTQ A;  4I2P A;  3ALY A;  3DM2 A;  2IS3 A;  3AO2 A;  4HHT A;  1F21 A;  3ZT1 A;  3KLI A;  1MU2 A;  4ELU A;  4FJN A;  3LAN A;  2Z1H A;  3HL8 A;  3KK1 A;  2XY5 A;  1RT6 A;  4DG1 A;  2GV9 A;  3KJV A;  1WSI A;  1UA1 A;  1TAU A;  2QK9 A;  2R7Y A;  4CJQ A;  1BIS A;  1VSH A;  4RW7 A;  3F73 A;  1EP4 A;  4DSJ A;  4HCB A;  4NCA A;  2HHV A;  1U47 A;  1IG9 A;  1L3T A;  2HNY A;  5K14 A;  4N76 A;  3VQE A;  4E7H A;  4E3S A;  4FJJ A;  1RDB A;  4FJ9 A;  3QIN A;  3AVG A;  4C8K A;  1HJR A;  2HHS A;  4DTO A;  4QOZ B;  1HMV A;  2YNH A;  3PO5 A;  4DSI A;  1HYS A;  1KFD A;  5SWM A;  2IOC A;  1KVA A;  1IKX A;  2W42 A;  4DFP A;  5J2M A;  1TKZ A;  2GUI A;  3ITH A;  4W5O A;  1J9A A;  2DFF A;  3LP0 A;  4Q5V A;  2VG7 A;  1S6P A;  4KHS A;  2HHU A;  3ZSV A;  4E89 A;  1LWE A;  3NH0 A;  2VWJ A;  4CFC A;  4FJ8 A;  1HNV A;  4DQQ A;  1B92 A;  4BDP A;  4BE0 A;  3HPH A;  4TSX A;  3I8D A;  4O44 A;  4F2S A;  4KB0 A;  1JLF A;  1IKV A;  3RRG A;  3ZT2 A;  4CJP A;  4KO0 A;  1QTM A;  1RBU A;  1JL1 A;  3V4I A;  2WON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...