4CEBA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cebA00
3IG1A 2KW4A 1SL1A 1WNSA 4LD0A 4KPYA 1T7PA 5KRTA 1ZBIA 2R7YA 3LDSA 1VSLA 3QEVA 4FXDA 4DTPA 1XC9A 1TK0A 3E01A 2QK9A 1QE1A 3FFIA 1X9SA 4FZZA 5J2MA 4CF9A 5HRPA 3OS1A 3KLHA 4CK3A 5J2PA 2HB5A 2IAJA 3B6OA 3RMBA 1VSKA 1GOAA 4MFBA 2DTUA 3OYAA 4CECA 3PO4A 1JKHA 4B9LA 4CEOA 4NCAA 1YTUA 3I0SA 4CEBA 4OPKA 4F3OA 2WOMA 4Z4CA 1NJXA 1L3UA 2XO7A 3OYKA 4DSEA 1VSEA 4HCCA 4DQSA 2DFEA 4FVMA 3SUQA 1JL2A 1ZBLA 3F73A 4Z0UA 1RBRA 3C6TA 3JSMA 4CJFA 4CIGA 4K8XA 4PA1A 5DK5A 4EP4A 1RTHA 1RT3A 3QNNA 1L3SA 4KAZA 2NUBA 4KRFA 4Z4FA 1VSFA 3LZIA 4O0IA 3NCIA 4IFVA 4L8RB 2E6MA 4B3OA 3VQ7A 4CJEA 1BISA 1IKYA 4R5PA 3T3FA 1U45A 3O3FA 4CEFA 3ZT2A 1J9AA 3RMCA 2OA8A 4KHUA 4XIUA 5C25A 1Q9XA 4J2EA 1Y97A 3I8DA 3L2UA 1RT6A 2OPRA 4G1QA 1RTDA 4CJSA 3OS2A 4Y1DA 3MXJA 3SV4A 1L5UA 4AHVA 3KJVA 4EZ6A 4H4OA 3LAKA 3TAEA 4CESA 1LV5A 2PYJA 3TAQA 2A1SA 1S5JA 3OYFA 4FM0A 1EP4A 4GMJB 4DSLA 2Z1IA 4RG8A 3TARA 4FJIA 3HPGA 4PWDA 1KFSA 1NOZA 4FJLA 1EKEA 1LWFA 3V9SA 2YNIA 1ASUA 1C0UA 3VQ6A 1QQCA 3NGYA 3D0PA 4CHOA 4DSIA 3OY9A 5HRRA 4CGHA 2IC3A 2B4JA 1NJYA 5E41A 3QEXA 4CJPA 3UIQA 4H4MA 2D5RA 2LSNA 4FJGA 3OYJA 3QEPA 1HYZA 4CIEA 3CFPA 3I0RA 1T05A 1TV6A 3P5JA 1TKXA 1XHXA 3QERA 2ATQA 3DLBA 3CFOA 5KRSA 4CEZA 4AHSA 1HYSA 5SZTA 3SCXA 2XRIA 2YNFA 1A5VA 4CGJA 4O0JA 3SYZA 4C8KA 4ZTFA 4FK0A 2VG5A 3ZT1A 4CJTA 2X6NA 1RTIA 4B9SA 4YNQA 1WLJA 3K5MA 4DTUA 3PX0A 3T1AA 4KB1A 4NCBA 3H08A 4Z4EA 1SUQA 4DS4A 4Y1CA 1VSHA 2ETJA 4H8KA 3AVAA 5JS1A 1IKXA 1WSEA 1RBVA 3TAPA 3AVNA 4CFDA 1WSIA 1I3AA 1FKPA 1JLGA 4BE2A 4HUFA 3VQEA 3AVJA 1D5AA 5DMRA 3KKSA 1CZ9A 4CJ3A 2P51A 4E3SA 1X9MA 1J5OA 1EXQA 4IDKA 1FXXA 1EX4A 1QSSA 4OLBA 3M8SA 4DFKA 4O4GA 2JGUA 5D3GA 2KFZA 3AVGA 4FLZA 4OGCA 1KVAA 3DOKA 3AVLA 3NGZA 1RBSA 4AHCA 4HHTA 3WNHA 3TABA 4C8NA 1ZBUA 3EY1A 2RKIA 4KI6A 1NK4A 4ZHRA 3PV8A 4FJ9A 4F4KA 4J2DA 1UWBA 4ID5A 1NK8A 3L3VA 3VQ9A 4FLWA 4KI4A 1TAUA 3MEEA 4FLUA 1S9GA 1A5XA 4KKOA 4KTZA 1FK9A 3WNGA 3ZCMA 3QO9A 4AHUA 1NK0A 3DRPA 4M3TA 3SJJA 4DG1A 3DYAA 2DY4A 3P83D 3VQBA 4PUOA 1L3TA 2IGIA 4FM2A 2IOCA 2HVHA 1BI4A 3NBPA 1S6PA 4DTJA 4DQRA 1B9DA 1UAXA 3RMAA 3HJFA 3CG7A 3SQ0A 4FLXA 2HVIA 1WN7A 3M8RA 4PQUA 1VK0A 3CM5A 2HMIA 2YHAA 4QOZB 2OPSA 4GW6A 1BGXT 1ASWA 3DLKA 4OKJA 4BDYA 3SPZA 3S9HA 4FM1A 2G8HA 4GVMA 2E4LA 3LWLA 3DLHA 4FJ7A 4K8ZA 4YFUA 1KCFA 4C8LA 1HQEA 3HP6A 1LWCA 4NYNA 3ZT3A 4QAGA 2VG6A 2ZD1A 4DTOA 3QESA 4DS5A 1ZYQA 4N76A 4CHQA 1N6QA 1KTQA 1J54A 4O5BA 1A5WA 3IRXA 4M3YA 2GUIA 3A2FA 5HROA 3QNOA 1XI1A 4AHRA 1JLBA 3AVFA 2PZSA 3IAYA 2QXFA 3HL8A 2P5OA 3TANA 4DSKA 4KB0A 2G8VA 4DQIA 1SKWA 3L2QA 4DFPA 1CZBA 3AVKA 4M45A 3DM2A 4OKEA 2D0BA 4F8RA 1RDBA 1DTQA 4W5TA 3K2PA 4KTWA 4O44A 3L2VA 1NOYA 2QKBA 3LAMA 4WE1A 3SQ4A 1TKZA 4TSXA 2G8UA 3O4NA 4DSJA 3NH0A 1B9FA 3OYHA 3K5OA 4I2QA 3T19A 2KQ2A 3K57A 3VN5A 3V9XA 2XY5A 1I39A 2P1JA 3OYDA 2XHBA 4E7HA 4J2BA 4HUEA 4B08A 1RT2A 2E6LA 3G0ZA 3SZ2A 1QSYA 1BHLA 2DFHA 2YKNA 3KK1A 4DFJA 3SUPA 4CHYA 3RMDA 1DLOA 4KO0A 2FBYA 1NKCA 4DTXA 4Z4HA 3VQ8A 5HRSA 4ID1A 3ULDA 3CFRA 3HVTA 1TK5A 1TKTA 4CEDA 1TL3A 4CHNA 3NF7A 1FKOA 2GV9A 1RBUA 4CHPA 1BQNA 3IS9A 4RW9A 4FLYA 4DTSA 2X6SA 5J2NA 4CJQA 3S3MA 3OYGA 3HM9A 1U04A 4OPJA 1HJRA 1LWEA 4C8OA 2RPIA 1MU2A 2BGGA 1T03A 3RWUA 1NK5A 1RT5A 2G8WA 2HHXA 1K6YA 4E7KA 3NH2A 4KHYA 3S3NA 3ZT4A 3NF9A 3AA5X 3DI6A 4UQGA 2Y1JA 1HNVA 3VQDA 3QETA 3BGRA 4B9NA 4Q0BA 4DSFA 4CEEA 2PYLA 5KI6A 1CXUA 4W5QA 4RW7A 1TL1A 3AVIA 3VQPA 2HHVA 1GOCA 1DTTA 1SL0A 1RDDA 4ICLA 3V9ZA 3SPYA 1LAVA 1RILA 1WSFA 1BCMA 3HP9A 4OJRA 3MXIA 1Q9YA 1RT1A 4FJHA 4I9LA 1C1CA 2YV0X 3JYTA 1U4BA 4RW6A 1D9DA 4FJ8A 4B8CA 2G8FA 1RBTA 3U3YA 4CERA 2FBTA 4CJLA 3B6PA 2OPPA 1U49A 4LH5A 5SWMA 2HHWA 2HW3A 3M8PA 2X78A 3PX6A 1D9FA 4Z4GA 3SI6A 4E19A 3QINA 1KVBA 4I9QA 3OS0A 3KTQA 2ZQBA 1RDAA 3DLRA 3KD5E 3D45A 3TWHA 5FRNA 3L2RA 1IKVA 4FJXA 1O1WA 3ZSXA 4JS4A 4F2SA 1VRTA 1TVRA 2FBVA 3QIPA 4CJUA 3DRSA 1U48A 3RTVA 4KHSA 4N56A 3O3GA 3KK3A 3SUOA 3NGIA 2KZZA 1WAJA 4CF2A 3NF6A 1X9WA 3DLEA 4FW1A 4N41A 3AVBA 5HP1A 3VQCA 3QEIA 4CJVA 1W0HA 2IS3A 1QTMA 3VQAA 4JLHA 1EETA 2WONA 2HHUA 4M3XA 3S3OA 1Z25A 3PO5A 4RW4A 4FLTA 1BQMA 3LP0A 3ZT0A 4CFBA 3SQ2A 5JS2A 5HLFA 1S1XA 3AA4A 1RTJA 3LPTA 4DLEA 4KTQA 4AHTA 1TKDA 4CEAA 3AA2A 4NCGA 4NYFA 3ZSQA 3OYEA 4BWJA 2OZMA 5FRMA 4DMNA 2HNZA 1NJWA 3RRGA 5FDLA 1YT3A 2Q3SA 4BE1A 4DU3A 1IKWA 1RT7A 4IG0A 4DU1A 3LP3A 2G8KA 2BDPA 3CM6A 3ZSOA 4KREA 1HRHA 4Z4IA 3KLIA 1UA1A 3DMJA 2EHGA 4FK2A 4CJWA 3OYBA 3SQ1A 3RR8A 1BI4B 1HYVA 1JLQA 4OVLA 4CIFA 3EYZA 1TAQA 3OJUA 2P5GA 3AVCA 3K5NA 1YVUA 4CGIA 3HSTB 1L3VA 4M3UA 3LALA 3ZSZA 1SKSA 4B9MA 2KZMA 4CF0A 3SV3A 3L2WA 4JRQA 1RCHA 4BACA 2IDOA 1QS4A 2OPQA 4IBNA 4CCHA 3MAQA 5T7BA 3U3GA 1YTAA 4CGDA 1VSIA 4W5OA 4I2PA 3L3UA 1HQUA 1NKEA 1ITGA 1ZBHA 3C94A 3V4IA 4CK2A 3AVMA 5CZ2A 4DWIA 3OYLA 1XHZA 4CHZA 3HXMA 3QEWA 4B9VA 4IFYA 3HO1A 4CE9A 3LPUA 1C0TA 4BDPA 5CZ1A 3THVA 1NK6A 4HVJA 2B6AA 3OJSA 3PX4A 4CEQA 2DFFA 1SKRA 1JXEA 1S1VA 3K58A 3BDPA 1HNIA 1KFDA 4QCLA 1JLCA 1REVA 3O4QA 2F8SA 1BL3A 1Z26A 2Y1IA 3VA0A 3PUFA 3VQQA 5J1EA 3LZJA 3TAFA 3LP2A 4N47A 1B92A 3CQ8A 1QSLA 3AVHA 3KLFA 2XY7A 3QLHA 4M41A 4CGGA 3AO5A 1R0AA 4CF8A 2F8TA 3AO1A 4HTUA 3F9KA 3VA3A 4W5NA 4M3RA 4DU4A 2KTQA 1HMVA 1S9EA 1VSJA 3HT3A 4JRPA 4KHQA 1WSJA 4B8AB 1BIUA 4FCYA 4FZYA 2A1RA 1NJZA 2VWKA 4CJ4A 1S1TA 4CJ5A 2FBXA 3MECA 4OGEA 3L8BA 2YKMA 3KLGA 1NKBA 4B9UA 4DF8A 4M3WA 3NH1A 2ITGA 4DTMA 3VQ5A 4DQQA 1F21A 2EX3A 4E7LA 1S1WA 2QKKA 3AV9A 4FJNA 2BE2A 1NK9A 3ASMA 1VSDA 4FJMA 1SL2A 3ZSWA 1ZBFA 3RR7A 2B5JA 4KHNA 2AJQA 1G15A 4BDZA 3ITHA 3ZSRA 1Q8IA 3V81A 1ASVA 1KVCA 4FZXC 4FLVA 1CXQA 4N5SA 1RDCA 4FW2A 1WSHA 1XWLA 3EZ5A 4E7JA 2RF2A 1UA0A 1JLFA 1N5YA 4HCBA 4ZTJA 4FYDA 3WNEA 4W5RA 3HK2A 2HHQA 4HUGA 4O55A 3AO2A 4FJKA 2XY6A 4F2RA 1JLAA 2D0AA 5C42A 4DFMA 3V6DA 3U6FA 1IH7A 4DLGA 4C8MA 3MXMA 4PY5A 2KFNA 4E1MA 1HPZA 4Q5VA 3ISNC 3C95A 3K5LA 1KRPA 3V9UA 3CYMA 3ALYA 1LW2A 3OYMA 3KLEA 4AH9A 3TI0A 1NK7A 1D8YA 1KLNA 4KV8A 1X1PA 1SV5A 3HPHA 3SNNA 2Z1HA 4FK4A 4CGFA 3O3HA 1LAWA 5HBMA 3C6UA 1J53A 3NE6A 1C0MA 1JLEA 1LW0A 1W9HA 1WSGA 2YNHA 2Z1GA 5KGXA 4F3TA 3NHGA 4I7FA 3NF8A 4DF4A 4MQ3A 4ELTA 3AA3A 3DRRA 3V1RA 4LSLA 5HRNA 2BANA 3ZSVA 3PY8A 2HHSA 2G8IA 3DOLA 2VWJA 4RW8A 2GBZA 4LY7A 2Z1JA 5EU7A 1T8EA 1TGOA 3RRHA 2OZSA 3LWMA 3V1QA 3KIOA 3WNFA 2HHTA 4CF1A 3V9WA 3G10A 2D0CA 3VQ4A 3OVNA 1JL1A 3OYCA 4EZ9A 1WAFA 1IO2A 2F96A 3NAEA 3P1GA 3QIOA 5K14A 3DLGA 4E0DA 1VRUA 4ELUA 3KKRA 1RT4A 2VG7A 2OYQA 4E89A 5CYQA 1C1AA 2W42A 3HYFA 1KSPA 1C1BA 3SUNA 1U47A 4B9TA 3ZSYA 5I42A 3AO3A 2XY8A 1S6QA 3OYIA 4CFAA 4FJ5A 3M8QA 3MEGA 3OYNA 4M3ZA 3TAGA 2HNYA 5I3UA 3AO4A 1BCOA 3V1OA 2YNGA 5C24A 4EP5A 2JLEA 2I5JA 1IG9A 4M42A 4BWMA 4CJRA 4CK1A 2FC0A 4LH4A 4IKFA 3KD1E 4CFCA 2RN2A 2O4IA 5J2QA 1QHTA 4E1NA 1TK8A 4J2AA 2YHBA 2ZE2A 4DTRA 4FJJA 1CLQA 3KK2A 4OLAA 4DQPA 3NDKA 3LANA 3NFAA 3TAMA 1RNHA 1GOBA 2HNDA 5CYMA 3LP1A 1S1UA 4BE0A 3HVRA 4AILC 3MEDA 1C6VA 5CY4A 2PY5A 1KLMA 3TR8A 4DTNA 1JXBA 2X74A 2O4GA 5KGWA 1BIZA 4OKKA 3K59A 5KTQA 4KHWA 5FROA 4KFBA 4JS5A 1UOCA 4LSNA 4ELVA 4E7IA 4CJKA 4IG3A 3HPOA 1VSMA
chains in the Genus database with same CATH superfamily
2KLAA 1VSLA 2P9UB 1XC9A 2QK9A 3FFIA 1K8AO 5J2MA 3ENBA 3ULEA 4CK3A 5J2PA 2HB5A 4NLCA 3QMLA 4MFBA 3OBWA 4CECA 4B9LA 3C65A 1YTUA 4F3OA 2WOMA 1L3UA 2YHYA 3JS6A 3EE8A 3CHWA 3CJBA 3HZ6A 3SUQA 1JL2A 1U2VA 4A62A 4Z0UA 2NRXA 4CJFA 1WBBA 4KRFA 3U9DA 1VSFA 3SBTA 4L8RB 3O9QA 1BISA 4R5PA 2FXUA 1J9AA 4FO0A 3IKMA 3LDLA 4J2EA 3L2UA 2CGLA 4FWKA 4G1QA 3DXMA 3MWPA 4B3MK 3LAKA 2RHKA 4JI2K 4RTFD 3JAMO 5E26A 2PYJA 3TAQA 4H0XB 4M7XA 3E1YA 1N32K 1R59O 3D0PA 4K41A 2ZJPL 4DSIA 2Q36A 4CJPA 3UIQA 2LSNA 4FJGA 3OYJA 2CH6A 3QEPA 1ZC6A 1HYZA 1T05A 2IVPA 1W7AA 2HBJA 1TKXA 2ATQA 5KRSA 1MA9B 4B1UB 1YIJN 4DR4K 2YNFA 4DV7K 4CGJA 4ZTFA 3MWTA 4PKIA 4BR9A 1MWMA 4DTUA 4KB1A 4YDUA 4A57A 1NGCA 3KVGA 3EKUA 2QA4N 4BG8A 4DS4A 4Y1CA 4JV5K 1OH6A 1RBVA 3TAPA 1WSIA 1FKPA 3WEEB 4BE2A 2QM1A 5AQGA 3AVJA 4E3SA 4B3OA 4OLBA 3AVGA 4BR5A 4OGCA 1YXQA 3AVLA 5CHIA 4C8NA 2YJFA 2RKIA 1NK4A 3EE9A 4ID5A 3VQ9A 4YDUC 2E5LK 5M1FA 1P8ZA 1NK0A 4M3TA 3SJJA 3DYAA 2DY4A 1VQMN 3P83D 3R8EA 3CJCA 4CBXA 4DUZK 2IGIA 1IG8A 2IOCA 5AQLA 1BI4A 3RMAA 1UAXA 3G71N 3SQ0A 4FWRA 2HVIA 1GLLO 3CM5A 2YHAA 5AQQA 1BGXT 1EWRA 4OKJA 1QVGM 4BDYA 3S9HA 4FM1A 2F7TA 4FJ7A 4DUYK 3DLHA 4K8ZA 1LWCA 4NYNA 3ZT3A 4DTOA 2VG6A 3KK7A 5BR8K 2D0OA 4JK8A 1N6QA 4Y0WA 4BGAA 1KTQA 2JWKA 4BRDA 1Q18A 2GUIA 3A2FA 1XI1A 3L6QA 3IAYA 1OH8A 1JCEA 3AVFA 3ULEB 5AQJA 4DV0K 1EO1A 3TANA 4M7YA 1CZBA 4FVUA 4OKEA 2D0BA 4F8RA 1RDBA 3L2VA 4AM6A 3O1WA 5BPMA 3LAMA 4G9ZA 2G8UA 1TKZA 1U2VB 4TSXA 3NH0A 2KQ2A 2XY5A 3OYDA 2P1JA 4B08A 1BHLA 2DFHA 2J4RA 3KK1A 4DFJA 4KO0A 4NXNK 4QS9A 1NKCA 4OX9K 4CZFA 3CFRA 2PAVA 3CCJN 4CHNA 2GELA 5GAEP 4FLYA 5J2NA 4CJQA 1U04A 1HJRA 1LWEA 1T03A 5C0YA 5BREA 3ZT4A 3S3NA 3AA5X 3R1XA 1HNVA 2F9WA 1RGIA 4Q0BA 4B9NA 4DSFA 3MCAB 3WQTA 4W5QA 4RW7A 3AVIA 2HHVA 1DTTA 5ADXH 4JI4K 4CZJA 3V9ZA 3SPYA 1ATRA 3HP9A 4OJRA 5BN9A 2P9LA 3JYTA 1D9DA 4RW6A 3U3YA 2A40A 3CCRN 2FBTA 4CJLA 5AZJA 2OPPA 3TSQA 1XNRK 2DPNA 4FWQA 3M8PA 4BVPA 4H5VA 4E19A 1KVBA 2ZQBA 2VQEK 5FPEA 3T7ZA 4YHHK 5FRNA 3L2RA 3ZSXA 1VRTA 1HPMA 1NGBA 1VQ8N 3CJAA 3KK3A 5AFUH 4BY9C 3NF6A 1X9WA 4FW1A 4BR2A 4N41A 3GE1A 3AVBA 3C0BA 3C7NA 4JLHA 5JMVA 2WONA 2HHUA 3DAWA 1BQMA 2NRVA 4H0PA 5HLFA 2D4WA 4AHTA 4CEAA 4NCGA 3OYEA 3P38A 1ZBSA 4JI3K 1UA1A 5AQKA 5EY4A 5LY3A 3SQ1A 1BI4B 1TAQA 3AVCA 3K5NA 3CJ1A 1L3VA 3HSTB 3LALA 4MO5A 4B9MA 3L2WA 1QQMA 4JRQA 4CCHA 3MAQA 3SJHA 5T7BA 1HQUA 3H45C 4MLEA 4KH5A 2WTUA 5AR0A 3C94A 1XHZA 1BA0A 4BDPA 3THVA 4HVJA 3OJSA 2QI2A 3PIPL 5BRFA 1TUUA 1NWKA 1Q86O 1JLCA 3ZX0A 3VA0A 1KQSM 1VQ6N 5IT9O 4X65K 3ID8A 3LP2A 3CQ8A 3NVMA 5AQHA 3VA3A 4HTUA 2KTQA 4FPBA 5DM7L 2P9IA 1WSJA 4XH5A 3TSPA 2UXDK 3WXMB 2FBXA 5A2QO 2YKMA 3R6MA 4BREA 4DF8A 4M3WA 2ITGA 4DTMA 4DQQA 4AQYK 2F4VK 1S1WA 3AV9A 2BE2A 1OKJA 1NK9A 1VSDA 1SL2A 3ZSWA 1ASVA 4OPHA 3QB0A 1WSHA 4JK9A 3EZ5A 5HOOA 1N5YA 4HCBA 3DLLL 3WNEA 4X62K 2UUCK 2XY6A 1JLAA 2QW9A 5C42A 4DKWA 3O1BA 4Q5VA 2QWPA 3ISNC 1KRPA 3HRGA 3CERA 3KLEA 4AH9A 1D8YA 3LM9A 4CD3A 3BZCA 1SV5A 3O3HA 5GADP 2P9LB 3D2EA 5AQZA 1LW0A 4QS7A 4F3TA 5AZJB 3PY8A 4GKKK 3DOLA 2VWJA 1BO5O 5GINA 3LWMA 1JCFA 2W6LA 4DV4K 2HHTA 4IOXA 3OVNA 4FPAA 1JL1A 3OYCA 1WAFA 3NAEA 5K14A 4E0DA 4ELUA 4E1JA 2VG7A 1T3VA 4DCHA 3ZSYA 4IZ9A 4CFAA 3C7NB 4KH4A 2HNYA 2OTLN 3AO4A 1Y64A 2YNGA 5C24A 1WOQA 3AGKA 3F9MA 4BWMA 3QICA 4IKFA 4A2AA 2RN2A 4CFCA 5J2QA 5M1OA 2YHBA 4J8FA 2A3ZA 3NFAA 3TAMA 5CY4A 2O4GA 3K59A 2P9UA 3ENHA 4JS5A 2PFUA 4ELVA 4E7IA 1VSMA 4R79A 2KW4A 1WNSA 3LDSA 3QEVA 4FXDA 1XQSC 1RDUA 3E01A 1QE1A 1X9SA 3CC4N 3VETA 4H5WA 5HRPA 1NJXA 2IAJA 1GOAA 3OYAA 3BZKA 3I55N 4NCAA 3I0SA 4OPKA 4Z4CA 4DQSA 3VPZA 4FVMA 3F73A 4CIGA 3UKRA 4EP4A 5FLXO 4KAZA 2NUBA 4O0IA 2P9IB 3P39A 2E6MA 3WQUA 1N33K 1VQON 2A42A 3T3FA 4JKBA 3O3FA 3ZT2A 4JI1K 4H0YB 5AQXA 4XIUA 1Q9XA 4H5RA 3CI5A 1RT6A 2OPRA 1L5UA 4H4OA 4IO9L 4CESA 3CCVN 1KAZA 2A1SA 3MN7A 3OYFA 4GMJB 4FM0A 2Z1IA 1W2BM 3TARA 3HPGA 1HUXA 1EKEA 1LWFA 2E2NA 3CD6N 1ZXOA 2YNIA 4V19S 5GAHP 3VQ6A 5AQYA 4HTLA 4CGHA 3O6WA 1YAGA 2ZWHA 5E41A 3FGUA 3QEXA 4H4MA 2VWBA 4CIEA 3CFPA 3BP8A 3PLAA 3P5JA 1XHXA 3CFOA 2JWLA 5SZTA 2Q97A 3CCEN 4A61A 3SYZA 4C8KA 2W40A 4FK0A 2VG5A 3ZT1A 5AQIA 4K42A 4B9SA 1I94K 5TKWA 3PX0A 3H08A 4H5TA 1VSHA 5C15A 3AVNA 3MN5A 3PSIA 5KPZA 4F9OA 1YVNA 3VQEA 3BF1A 3KWGA 3D6RA 4YOXA 1CZ9A 1J5OA 1X9MA 1EX4A 1QSSA 3M8SA 4DFKA 5D3GA 2KFZA 4FLZA 3DOKA 3LDPA 4HHTA 4AHCA 3WNHA 2E88A 5B8HA 3CCMN 4KI6A 4FJ9A 4ZHRA 2UU9K 4J2DA 5HL7L 3CJ7A 1NK8A 2CH5A 4KI4A 3WNGA 3QO9A 4AHUA 3DRPA 4DR5K 1JCGA 4PUOA 1NMNA 1S72N 3NBPA 3HJFA 4KHPK 1WN7A 3IUCA 4GV9A 1LCUA 1ASWA 3DLKA 4AF1A 3ATUA 4GVMA 2E4LA 3VGKA 3LWLA 2IVOA 4YFUA 1KCFA 4C8LA 5M1PA 1GLEG 2ZD1A 4N76A 2YCHA 4L3QA 1HJOA 3IRXA 1KXPA 5M1NA 1GLFO 3WXJA 5HROA 4AHRA 4DSKA 4KB0A 1K8KA 3HL8A 2YX6A 4DFPA 1S22A 3U4LA 3TSUA 4BRKA 3AVKA 3J7ZO 1QVFM 3K2PA 4O44A 1NOYA 3VTHA 3N4PA 4WE1A 3SQ4A 3SK3A 3O4NA 1NGEA 5CR4A 1B9FA 1TUYA 3K5OA 3T19A 3V9XA 3SUOA 4FL9A 3UKRB 1I39A 5AQOA 3TPQA 4E7HA 3EKSA 4HUEA 3O9SA 1RT2A 2VCPA 3SZ2A 5BN8A 4BRPA 1VQLN 3THYA 4DTXA 3VQ8A 4ID1A 4ILJA 2ASOA 1TK5A 1HKCA 1TKTA 4C1NI 2RE2A 3NF7A 5AQSA 2GV9A 5ADXA 1BQNA 3O8MA 4DTSA 2X6SA 3S3MA 4X64K 3QBXA 4C8OA 2BGGA 1MU2A 3RWUA 4LF6K 1K6YA 4E7KA 3NH2A 4YY3K 3BGRA 2O8CB 2PYLA 1CXUA 1TL1A 1GOCA 1SL0A 4ICLA 1WSFA 1HNZK 3MXIA 4FJHA 2P9PA 4XH1A 1C1CA 2YV0X 1WUAA 1U4BA 2UXCK 3G25A 1GLDG 2KKZA 3Q7CA 2OCEA 3B6PA 1XNQK 5AFUA 1E3MA 1D9FA 3PX6A 1DT9A 3OS0A 3IFRA 3L0QA 1IKVA 3VESA 4A5BA 4FJXA 4F2SA 1TVRA 2FBVA 4KHSA 3O3GA 2V51B 3QEIA 2A6AA 3VQAA 1EETA 4M3XA 2QEXN 1Z25A 3U8XA 4FLTA 5F0XA 2ASMA 3SQ2A 5M1QA 4DLEA 1RTJA 3AA4A 4KTQA 1NGGA 4NYFA 3ZSQA 1XC3A 5FRMA 4DMNA 3RRGA 1NJWA 1FJGK 1YT3A 2Q3SA 2BDPA 5GAGP 3CM6A 3ZSOA 5GIPA 4GKJK 4KREA 4IWVA 4Z4IA 2IIRA 2Q0RA 3KLIA 3QFUA 1X3MA 3DMJA 4CJWA 3A5OC 1SZ2A 1HYVA 4Z94A 2Q1NA 1NGHA 3OJUA 3CQXA 1SQKA 4BRQA 1OH7A 4ISGA 1RCHA 2IDOA 3WXIA 2OPQA 3A5MC 3U3GA 4CGDA 4W5OA 1K73O 3I33A 4B1YB 2UYTA 1NGFA 3AVMA 4DWIA 3H1QA 5LMUK 5AQPA 4FWOA 1C0TA 5KQ8A 1SKRA 2B6AA 3PX4A 4CEQA 2DFFA 1JXEA 3FZLA 3BDPA 2WC9A 5BRHA 2F8SA 1BL3A 1K8KB 1Z26A 2Y1IA 3PUFA 3VQQA 5J1EA 1TYQB 4N47A 1QSLA 4BR4A 3AVHA 3VEOA 3KLFA 1WB9A 2F8TA 4CF8A 3AO1A 4B1WB 4M3RA 1HMVA 2NRTA 4BRHA 1KC8O 4B8AB 4GNIA 1BIUA 2A1RA 1HKGA 5EX5A 3A0IX 3L8BA 3CCQN 3KLGA 3NH1A 3THYB 4BGBA 1NBWA 3MMVA 3VQ5A 3D2FA 1VQ4N 4NB4A 4FJNA 3RR7A 3VF6A 2B5JA 2AJQA 1G15A 3EO3A 1KVCA 4FW2A 1JLFA 4YOVA 2UUAK 3D7EO 2O8EB 2WUSA 4HUGA 3BEXA 3W3DA 4FJKA 3CJ9A 3MXMA 3P4IA 4PY5A 1Z05A 4K25A 3K5LA 4BRMA 3CYMA 3ALYA 1KLNA 1W97L 3SNNA 1NU0A 4CGFA 1LAWA 2P9PB 4FWSA 3PIOL 4JNEA 5HBMA 3NE6A 2QTDA 5KGXA 3NHGA 3QDKA 2NRWA 2E2QA 3NF8A 2ZJQL 3DRRA 2E2OA 2BANA 3ZSVA 2G8IA 4RW8A 5EU7A 2Z1JA 3LL3A 5I9EB 5GIOA 3RRHA 2OZSA 3G6EN 2D0CA 1EQYA 4O5FA 1IO2A 3P1GA 3QIOA 2UXBK 3DLGA 1VRUA 2OYQA 3HYFA 3S41A 1C1BA 4B9TA 2FSJA 4FJ5A 3P31A 3MEGA 1T6CA 3TAGA 3FR0A 5I3UA 2D0PA 3FZMA 4IXCA 4EP5A 2JLEA 3K0SA 4LH4A 2O4IA 2E20A 1V4TA 3WUHA 3KK2A 4LF5K 5KQDA 3NDKA 3LANA 4CZKA 1RNHA 1GOBA 1S1UA 4BE0A 3CF5L 2Q31A 2FSKA 1C6VA 2EWSA 1JXBA 4IJAA 4ISFA 1BIZA 2ITMA 3SMPA 3VENA 5FROA 4RCHA 1QQOA 1UOCA 3MX2A 3HPOA 1C0GA 3GBTA 4LD0A 4KPYA 1T7PA 2R7YA 1OVYA 3LDQA 2IVNA 4FZZA 3OS1A 3KLHA 1JJ2M 4B9QA 3PO4A 2WFBA 4CEOA 5JICA 2XO7A 4HCCA 2DFEA 1MDUB 5BR9A 2GTDA 4K8XA 4PA1A 5DK5A 1RTHA 1L3SA 5JLFA 3LZIA 3NCIA 1FW6A 3VQ7A 3ZETA 1IKYA 1U45A 4JI0K 4CEFA 4FOEA 3RMCA 2OA8A 3OW2M 4LFCK 5C25A 4JI6K 3I8DA 1IBLK 3O9UA 1RTDA 3MXJA 3SV4A 3KJVA 4CZIA 1T44A 3D2FB 3PSFA 3TAEA 2NRHA 4JKAA 2Q0UA 1LV5A 1YJ9N 1YF5L 3H6EA 4RG8A 3J7YP 4FJIA 4PWDA 1KFSA 1ASUA 1C0UA 4KBOA 1QQCA 3NGYA 4CHOA 3VF4A 3VEZA 2IC3A 3MX5A 3WXKA 4RWTA 5AQRA 3I0RA 1SS6A 4GV3A 1TV6A 3O80A 3QERA 3CMAN 4CEZA 4AHSA 3ENOA 1HYSA 1VQPN 2XRIA 1A5VA 2E2PA 2A5XA 4O0JA 4BRFA 4CJTA 5IWAK 1RTIA 5JVHL 4NCBA 4WQ5C 3T1AA 3CCLN 4Z4EA 3ZX3A 2E8AA 3FLCO 1IKXA 5JS1A 1WSEA 4CFDA 2GWJA 1I3AA 4CBUA 2NRZA 1JLGA 4PL7A 4HUFA 3UB5A 3KKSA 3LDOA 2P51A 3MN6A 1QQNA 1FXXA 2QWOA 4IDKA 3VGMA 4O4GA 2JGUA 4DV3K 1KVAA 1NNEA 4LFAK 3NGZA 2GX9A 1ZBUA 3EY1A 2NLXA 4YOWA 3PV8A 4F4KA 3L3VA 2PBDA 4FLWA 4MLHA 3MEEA 4FLUA 1S9GA 1A5XA 4KTZA 3ZCMA 1FK9A 3OHRA 1VQ5N 2BUPA 4OO1J 3HM8A 2HHHK 3DXKA 4FM2A 2ZGYA 5C2DA 4DQRA 1IBKK 1IJJA 1VK0A 5LJWA 4QOZB 4BR0A 4KH6A 3GOIA 2G8HA 1E4GT 4JKCA 4DV6K 5LL6Z 4B3TK 4BC2A 4JKDA 3GL1A 1HQEA 1NLVA 3HP6A 4QAGA 1DGKN 4DS5A 2H3GX 3J81O 1P90A 1J54A 4O5BA 3R3LA 1H1VA 2QXFA 1SKWA 4DR1K 3THXA 4M45A 3DM2A 5EOYA 4CI6A 1DTQA 4DV1K 5AQFA 4H0VB 1DKGD 4DSJA 3JXUA 2FLOA 3H3NO 3K57A 3VN5A 2XHBA 4J2BA 1QSYA 2YKNA 3VGLA 3ZETB 3RMDA 1XUPO 1DLOA 4XH4A 5DM6L 4NO7A 4IOAL 4Z4HA 5HRSA 3RSEA 1BUPA 3ULDA 3HVTA 4CEDA 5EVZA 1FKOA 1Q82O 1RBUA 1J5EK 2QWQA 3FE1A 2CGJA 3OYGA 3HM9A 2O8CA 2HF3A 2VGNA 4IJNA 2RPIA 1BU6O 1RT5A 2G8WA 2HHXA 4KHYA 4WYBA 4GVEA 3J8AA 4BVOA 3VQDA 3QETA 3TTFA 3L4QA 3VQPA 4MDAA 3LM2A 3CXCM 1LAVA 1RILA 1QZ6A 2P9NA 1Q9YA 1RT1A 1O13A 3B8AX 4I9LA 3KHYA 4B8CA 2G8FA 3CC2N 1U49A 3BF3A 5BRDA 3O5BA 4BR7A 2HW3A 3UKUA 2X78A 4CZEA 3SI6A 3HSCA 4I9QA 3D45A 3HBTA 4BQZA 2ASPA 1VQNN 3J80O 4JS4A 3SLCA 1M90O 3DRSA 4DR2K 1U48A 4FWPA 4FSVA 4N56A 2O8FA 5AZIB 3NGIA 4IEIA 5HP1A 2QWMA 3VQCA 1W0HA 5BPLA 3PO5A 4RW4A 4OPAA 3LP0A 3BUZB 3ZT0A 3VOVA 1TKDA 2D1KA 3G4SN 4BWJA 2OZMA 2HNZA 4DU3A 4DU1A 4IG0A 3R9PA 2AP1A 4CZGA 1HRHA 3CPWM 4JHDA 3DXKB 4U67L 4OVLA 2F9TA 4M3UA 3CQYA 3ZSZA 1SKSA 2KZMA 4CF0A 5F2RA 1YTAA 1MWKA 1ATNA 1NKEA 1ITGA 1ZBHA 3V4IA 4CK2A 5CZ2A 3OYLA 3HO1A 4IFYA 1TYQA 1OVQA 4IEEA 4CE9A 3LPUA 5CZ1A 1NK6A 2O8DB 1S1VA 3K58A 1NGJA 3LZJA 5LJVA 3THXB 2XY7A 1R0AA 4CGGA 4WFAL 4BRNA 4DU4A 3CIPA 1S9EA 3AARA 3GG4A 4JRPA 4KHQA 2BTFA 1KAYA 4H5NA 4YOTA 4FZYA 2WBNA 4EAHD 4CJ4A 1S1TA 1Q81O 3E9OA 3HTVA 4OGEA 1NKBA 3OBYA 1CZAN 3EZWA 5FPMA 4BC3A 5AQMA 3THWA 4CJ7A 1F21A 2EX3A 4E7LA 1YUWA 3RSEB 3EEQA 3KZBA 3ZX2A 3ASMA 3LDNA 2O8EA 1ZBFA 2QWNA 2NZTA 3FZKA 1M1KO 3C6HA 1ESVA 4N5SA 3O08A 5H1SQ 1XWLA 4E7JA 1UA0A 2RF2A 4ZTJA 4W5RA 5JVGL 2HHQA 2AA4A 5AQNA 3GDQA 4O55A 4JAXA 3I8BA 2UUBK 4F2RA 3ZYYX 4DFMA 3V6DA 3U6FA 1IH7A 4E1MA 1HPZA 1DEJA 3C95A 1LW2A 3OYMA 1NK7A 4KV8A 1X1PA 1WBDA 3HPHA 2P9NB 4JYAK 3C6UA 1J53A 3OA9A 4CZMA 1C0MA 1JLEA 1W9HA 1WSGA 2Z1GA 4I7FA 3AA3A 3V1RA 4LY7A 4A59A 3I56N 3UKUB 4BC5A 1VQ7N 3KIOA 4I6MA 4CF1A 4C23A 3G10A 2NNWA 2VQFK 4EZ9A 2F96A 4JEPA 1NGIA 3T1HK 3KKRA 1RT4A 3HOSA 1KSPA 1C1AA 2O8FB 4BRLA 3SUNA 1U47A 5I42A 3AO3A 1NMDA 2XY8A 1S6QA 3OYIA 4BQLA 4WCEL 3OYNA 1BDGA 3T1YK 1YJWN 4M42A 2I5JA 4PKHA 1IG9A 4LF4K 3NVKA 3SAHA 3ZEUA 4CJRA 4DV2K 4LF9K 4DB3A 3J7AP 1TK8A 4U7BA 3AAPA 5AQTA 4FJJA 4OLAA 4DQPA 1OH5A 2E1YA 1N36K 2I7PA 3HVRA 4AILC 2YJEA 5MLCQ 3MEDA 2PY5A 1KAXA 3TR8A 4EFHA 4JHDB 2GEMA 4OKKA 3SBGA 5KTQA 1YHQN 1XMOK 3IG1A 1SL1A 2E1ZA 3ATVA 5AQVA 1IBMK 5KRTA 1ZBIA 4CD1A 3K9JA 4JK7A 4DTPA 1TK0A 4CF9A 5AJ3K 2OTJN 4MDBA 3B6OA 3RMBA 1VSKA 4BRCA 4B3SK 4UY8O 2DTUA 4YOYA 1JKHA 4CEBA 3OYKA 4JI5K 2OANA 3QBWA 4O8KA 4DSEA 1VSEA 1QZ5A 4K43A 3MN9A 1ZBLA 1S3XA 5F1XA 3TTCA 4GV6A 1RBRA 3C6TA 3JSMA 3TU5A 4JD2A 4NXMK 4B1XB 1RT3A 3QNNA 4Z4FA 4B1VA 4IFVA 4C1NK 3A5NC 4CJEA 3WXLA 4KHUA 1Y97A 3VTIA 4CJSA 3OS2A 4Y1DA 3THWB 2O8BA 4AHVA 4EZ6A 3EL2A 1HKBA 4NLBA 1S5JA 3H46O 1V4SA 5JLHA 1EP4A 4DSLA 3DXMB 4FJLA 1NOZA 3V9SA 1BWFO 4PKGA 4H0TB 5HRRA 3OY9A 4WFBL 3M1FA 4B1ZA 2VGMA 2B4JA 1NJYA 5BPNA 2D5RA 3DJCA 2KHOA 5C10A 4CW7B 3C6AA 3DLBA 2YHWA 4PHTX 1BOTO 4ILHA 3SCXA 4IFEA 3NMUA 1G99A 2X6NA 3VERA 2FF3B 4YNQA 1WLJA 3K5MA 2FF6A 1RFQA 1SUQA 4JKFA 5LMNK 2ETJA 4H8KA 3AVAA 3W0LA 4DQ8A 3H3OB 4I6MB 4BROA 2HF4A 5DMRA 1D5AA 4CJ3A 1EXQA 4DR3K 5C12A 1VQKN 2HBMA 1GLCG 1D4XA 5AQWA 1RBSA 3TABA 1UWBA 2P9KA 1TAUA 1X3NA 5C2FA 4FWLA 4KKOA 2HSTA 3ZEUB 4DG1A 4LC9B 4JI7K 3VQBA 1EWQA 1L3TA 4CZLA 4JKGA 4IO8A 2HVHA 4DTJA 1S6PA 1B9DA 2W6KA 3CG7A 5TKYA 4FLXA 3F2KA 4IOCL 3M8RA 4PQUA 2HMIA 4BC4A 2OPSA 4GW6A 3F5TA 4LF8K 3SPZA 2GWKA 3CCSN 1SAZA 2NRRA 3QESA 1ZYQA 4CHQA 1J6ZA 3M3ZA 1VQ9N 1A5WA 4PL8A 4M3YA 2FSNA 4FOIA 4EHTA 1JLBA 3QNOA 1NG9A 2PZSA 3CC7N 2P5OA 2G8VA 4DQIA 1IV0A 3SAFA 3L2QA 3CETA 4W5TA 4KTWA 4LFBK 5KPTA 1LOTB 2QKBA 3OYHA 3CMEN 4H0OA 4I2QA 4JD2B 3T69A 3EN9A 2W41A 4EIAA 2E6LA 3G0ZA 4O8UA 3SUPA 2V7ZA 2CGKA 4CHYA 2FBYA 2HBLA 4CZHA 2V7YA 2Q2RA 1TL3A 2O8BB 4IDHA 4CHPA 3IS9A 4RW9A 4A2BA 4JKEA 4WQ5A 2V52B 4OPJA 3KWIA 1XMQK 4AM7A 1NK5A 2P9SA 3NF9A 3DI6A 3VEVA 4UQGA 2Y1JA 2YHXA 4CEEA 5KI6A 1RDDA 4DV5K 3TTDA 1BCMA 4YOUA 3IDHA 3HOTA 4BRIA 3N4QA 5CE3A 1NGDA 4FJ8A 1RBTA 3UE5A 4CERA 4M63C 3SMSA 1NJIO 2A41A 4LH5A 5SWMA 2ZM6K 2HHWA 4WF9L 1QHAA 4Z4GA 3E9PA 4BRAA 3QINA 2HOEA 5E84A 5AZIA 3KTQA 1RDAA 3DLRA 3KD5E 4FWMA 3TWHA 1O1WA 3U9ZA 4CJUA 3QIPA 2I7NA 3RTVA 4LF7K 2KZZA 1WAJA 4CF2A 3DLEA 3FZHA 4CVNE 4CJVA 2IS3A 1QTMA 4ISEA 3SAGA 3M6GA 3S3OA 4K0KK 3E66A 5M1KA 1E4FT 4CFBA 2VYPA 5JS2A 1S1XA 3LPTA 4A5AA 2ZGZA 3AA2A 2P9KB 1HNXK 2HBKA 1BG3A 1ATSA 5FDLA 4BE1A 1IKWA 1RT7A 4JKHA 3LP3A 4XEIA 2G8KA 3MDQA 3AGRA 3OTOK 4FK2A 2EHGA 3FFKB 3VMFB 3OYBA 4JKGB 4MO4A 2YI1A 3RR8A 1JLQA 4CIFA 3EYZA 2P5GA 1YVUA 4CGIA 1U6ZA 2QWLA 3SV3A 4BACA 1QS4A 4IBNA 1GLBG 1HLUA 4WFNL 1Q7YO 3AAQA 2O8DA 4YORA 1VSIA 4I2PA 3L3UA 2GUPA 2QWRA 1VAZA 4CHZA 3HXMA 3QEWA 4B9VA 3MCPA 5FPNA 3VF2A 1KD1O 4JN4A 3IMXA 3O9TA 5AQUA 1HNIA 1KFDA 3CCUN 4CBWA 4QCLA 1REVA 3O4QA 1VHXA 4BRGA 5ELZA 3TAFA 4X66K 1B92A 5FPDA 3WT0A 3QLHA 4M41A 3AO5A 3F9KA 3ID6A 4W5NA 1VSJA 3HT3A 4H03B 4WQ4A 4QS8A 4FCYA 3QFPA 1NJZA 2VWKA 3O4WA 2ZJRL 4CJ5A 3MECA 3RVCA 1K9MO 4DHYA 4B9UA 4BG9A 5KPRA 2QKKA 4ILGB 4FJMA 4KHNA 4BDZA 3ITHA 3ZSRA 1Q8IA 3V81A 3MK6A 4FZXC 3A8YA 4FLVA 1CXQA 1RDCA 3VEWA 4WQ4C 4FYDA 3DWLA 1HNWK 2BH1A 3HK2A 1N8RO 3AO2A 2P9SB 1NM1A 3E9LA 2HMPA 2D0AA 4DLGA 4C8MA 4FWNA 2KFNA 3V9UA 1GLAG 3TI0A 2Z1HA 4FK4A 3VEXA 1NGAA 3VEYA 2YNHA 4DF4A 4MQ3A 3K9KA 4ELTA 5HRNA 4LSLA 3ZLJA 2HHSA 2GBZA 1T8EA 3D2EB 1TGOA 5EXWA 3FZFA 3V1QA 3WNFA 4HWIA 3L4IA 3V9WA 3VQ4A 1X9JA 2QXLA 3WEEA 1Z6RA 1YI2N 3Q7BA 4DR7K 3CPEA 1T6DA 4E89A 5CYQA 3H1VX 2W42A 3HI0A 1C0FA 4B3RK 3M8QA 4M3ZA 3M5RA 1BCOA 3V1OA 1N34K 1HR0K 3A5LC 4CK1A 2FC0A 4EHUA 3KD1E 1QHTA 4E1NA 4J2AA 2ZE2A 4DTRA 1CLQA 3AY9A 1YJNN 4JI8K 2HNDA 5CYMA 3LP1A 1BA1A 1KLMA 4DTNA 4DR6K 1GLJO 3O9RA 2X74A 5KGWA 1YITN 1HX1A 1ILYA 2ZF5O 4KHWA 4KFBA 1RDWX 4GY2B 3BY5A 4LSNA 4CJKA 4IG3A
chains in the Genus database with same CATH topology
3IG1A 2KW4A 1SL1A 1WNSA 4LD0A 4KPYA 1T7PA 5KRTA 1ZBIA 2R7YA 3LDSA 1VSLA 3QEVA 4FXDA 4DTPA 1XC9A 1TK0A 3E01A 2QK9A 1QE1A 3FFIA 1X9SA 4FZZA 5J2MA 4CF9A 5HRPA 3OS1A 3KLHA 4CK3A 5J2PA 2HB5A 2IAJA 3B6OA 3RMBA 1VSKA 1GOAA 4MFBA 2DTUA 3OYAA 4CECA 3PO4A 1JKHA 4B9LA 4CEOA 4NCAA 1YTUA 3I0SA 4CEBA 4OPKA 4F3OA 2WOMA 4Z4CA 1NJXA 1L3UA 2XO7A 3OYKA 4DSEA 1VSEA 4HCCA 4DQSA 2DFEA 4FVMA 3SUQA 1JL2A 1ZBLA 3F73A 4Z0UA 1RBRA 3C6TA 3JSMA 4CJFA 4CIGA 4K8XA 4PA1A 5DK5A 4EP4A 1RTHA 1RT3A 3QNNA 1L3SA 4KAZA 2NUBA 4KRFA 4Z4FA 1VSFA 3LZIA 4O0IA 3NCIA 4IFVA 4L8RB 2E6MA 4B3OA 3VQ7A 4CJEA 1BISA 1IKYA 4R5PA 3T3FA 1U45A 3O3FA 4CEFA 3ZT2A 1J9AA 3RMCA 2OA8A 4KHUA 4XIUA 5C25A 1Q9XA 4J2EA 1Y97A 3I8DA 3L2UA 1RT6A 2OPRA 4G1QA 1RTDA 4CJSA 3OS2A 4Y1DA 3MXJA 3SV4A 1L5UA 4AHVA 3KJVA 4EZ6A 4H4OA 3LAKA 3TAEA 4CESA 1LV5A 2PYJA 3TAQA 2A1SA 1S5JA 3OYFA 4FM0A 1EP4A 4GMJB 4DSLA 2Z1IA 4RG8A 3TARA 4FJIA 3HPGA 4PWDA 1KFSA 1NOZA 4FJLA 1EKEA 1LWFA 3V9SA 2YNIA 1ASUA 1C0UA 3VQ6A 1QQCA 3NGYA 3D0PA 4CHOA 4DSIA 3OY9A 5HRRA 4CGHA 2IC3A 2B4JA 1NJYA 5E41A 3QEXA 4CJPA 3UIQA 4H4MA 2D5RA 2LSNA 4FJGA 3OYJA 3QEPA 1HYZA 4CIEA 3CFPA 3I0RA 1T05A 1TV6A 3P5JA 1TKXA 1XHXA 3QERA 2ATQA 3DLBA 3CFOA 5KRSA 4CEZA 4AHSA 1HYSA 5SZTA 3SCXA 2XRIA 2YNFA 1A5VA 4CGJA 4O0JA 3SYZA 4C8KA 4ZTFA 4FK0A 2VG5A 3ZT1A 4CJTA 2X6NA 1RTIA 4B9SA 4YNQA 1WLJA 3K5MA 4DTUA 3PX0A 3T1AA 4KB1A 4NCBA 3H08A 4Z4EA 1SUQA 4DS4A 4Y1CA 1VSHA 2ETJA 4H8KA 3AVAA 5JS1A 1IKXA 1WSEA 1RBVA 3TAPA 3AVNA 4CFDA 1WSIA 1I3AA 1FKPA 1JLGA 4BE2A 4HUFA 3VQEA 3AVJA 1D5AA 5DMRA 3KKSA 1CZ9A 4CJ3A 2P51A 4E3SA 1X9MA 1J5OA 1EXQA 4IDKA 1FXXA 1EX4A 1QSSA 4OLBA 3M8SA 4DFKA 4O4GA 2JGUA 5D3GA 2KFZA 3AVGA 4FLZA 4OGCA 1KVAA 3DOKA 3AVLA 3NGZA 1RBSA 4AHCA 4HHTA 3WNHA 3TABA 4C8NA 1ZBUA 3EY1A 2RKIA 4KI6A 1NK4A 4ZHRA 3PV8A 4FJ9A 4F4KA 4J2DA 1UWBA 4ID5A 1NK8A 3L3VA 3VQ9A 4FLWA 4KI4A 1TAUA 3MEEA 4FLUA 1S9GA 1A5XA 4KKOA 4KTZA 1FK9A 3WNGA 3ZCMA 3QO9A 4AHUA 1NK0A 3DRPA 4M3TA 3SJJA 4DG1A 3DYAA 2DY4A 3P83D 3VQBA 4PUOA 1L3TA 2IGIA 4FM2A 2IOCA 2HVHA 1BI4A 3NBPA 1S6PA 4DTJA 4DQRA 1B9DA 1UAXA 3RMAA 3HJFA 3CG7A 3SQ0A 4FLXA 2HVIA 1WN7A 3M8RA 4PQUA 1VK0A 3CM5A 2HMIA 2YHAA 4QOZB 2OPSA 4GW6A 1BGXT 1ASWA 3DLKA 4OKJA 4BDYA 3SPZA 3S9HA 4FM1A 2G8HA 4GVMA 2E4LA 3LWLA 3DLHA 4FJ7A 4K8ZA 4YFUA 1KCFA 4C8LA 1HQEA 3HP6A 1LWCA 4NYNA 3ZT3A 4QAGA 2VG6A 2ZD1A 4DTOA 3QESA 4DS5A 1ZYQA 4N76A 4CHQA 1N6QA 1KTQA 1J54A 4O5BA 1A5WA 3IRXA 4M3YA 2GUIA 3A2FA 5HROA 3QNOA 1XI1A 4AHRA 1JLBA 3AVFA 2PZSA 3IAYA 2QXFA 3HL8A 2P5OA 3TANA 4DSKA 4KB0A 2G8VA 4DQIA 1SKWA 3L2QA 4DFPA 1CZBA 3AVKA 4M45A 3DM2A 4OKEA 2D0BA 4F8RA 1RDBA 1DTQA 4W5TA 3K2PA 4KTWA 4O44A 3L2VA 1NOYA 2QKBA 3LAMA 4WE1A 3SQ4A 1TKZA 4TSXA 2G8UA 3O4NA 4DSJA 3NH0A 1B9FA 3OYHA 3K5OA 4I2QA 3T19A 2KQ2A 3K57A 3VN5A 3V9XA 2XY5A 1I39A 2P1JA 3OYDA 2XHBA 4E7HA 4J2BA 4HUEA 4B08A 1RT2A 2E6LA 3G0ZA 3SZ2A 1QSYA 1BHLA 2DFHA 2YKNA 3KK1A 4DFJA 3SUPA 4CHYA 3RMDA 1DLOA 4KO0A 2FBYA 1NKCA 4DTXA 4Z4HA 3VQ8A 5HRSA 4ID1A 3ULDA 3CFRA 3HVTA 1TK5A 1TKTA 4CEDA 1TL3A 4CHNA 3NF7A 1FKOA 2GV9A 1RBUA 4CHPA 1BQNA 3IS9A 4RW9A 4FLYA 4DTSA 2X6SA 5J2NA 4CJQA 3S3MA 3OYGA 3HM9A 1U04A 4OPJA 1HJRA 1LWEA 4C8OA 2RPIA 1MU2A 2BGGA 1T03A 3RWUA 1NK5A 1RT5A 2G8WA 2HHXA 1K6YA 4E7KA 3NH2A 4KHYA 3S3NA 3ZT4A 3NF9A 3AA5X 3DI6A 4UQGA 2Y1JA 1HNVA 3VQDA 3QETA 3BGRA 4B9NA 4Q0BA 4DSFA 4CEEA 2PYLA 5KI6A 1CXUA 4W5QA 4RW7A 1TL1A 3AVIA 3VQPA 2HHVA 1GOCA 1DTTA 1SL0A 1RDDA 4ICLA 3V9ZA 3SPYA 1LAVA 1RILA 1WSFA 1BCMA 3HP9A 4OJRA 3MXIA 1Q9YA 1RT1A 4FJHA 4I9LA 1C1CA 2YV0X 3JYTA 1U4BA 4RW6A 1D9DA 4FJ8A 4B8CA 2G8FA 1RBTA 3U3YA 4CERA 2FBTA 4CJLA 3B6PA 2OPPA 1U49A 4LH5A 5SWMA 2HHWA 2HW3A 3M8PA 2X78A 3PX6A 1D9FA 4Z4GA 3SI6A 4E19A 3QINA 1KVBA 4I9QA 3OS0A 3KTQA 2ZQBA 1RDAA 3DLRA 3KD5E 3D45A 3TWHA 5FRNA 3L2RA 1IKVA 4FJXA 1O1WA 3ZSXA 4JS4A 4F2SA 1VRTA 1TVRA 2FBVA 3QIPA 4CJUA 3DRSA 1U48A 3RTVA 4KHSA 4N56A 3O3GA 3KK3A 3SUOA 3NGIA 2KZZA 1WAJA 4CF2A 3NF6A 1X9WA 3DLEA 4FW1A 4N41A 3AVBA 5HP1A 3VQCA 3QEIA 4CJVA 1W0HA 2IS3A 1QTMA 3VQAA 4JLHA 1EETA 2WONA 2HHUA 4M3XA 3S3OA 1Z25A 3PO5A 4RW4A 4FLTA 1BQMA 3LP0A 3ZT0A 4CFBA 3SQ2A 5JS2A 5HLFA 1S1XA 3AA4A 1RTJA 3LPTA 4DLEA 4KTQA 4AHTA 1TKDA 4CEAA 3AA2A 4NCGA 4NYFA 3ZSQA 3OYEA 4BWJA 2OZMA 5FRMA 4DMNA 2HNZA 1NJWA 3RRGA 5FDLA 1YT3A 2Q3SA 4BE1A 4DU3A 1IKWA 1RT7A 4IG0A 4DU1A 3LP3A 2G8KA 2BDPA 3CM6A 3ZSOA 4KREA 1HRHA 4Z4IA 3KLIA 1UA1A 3DMJA 2EHGA 4FK2A 4CJWA 3OYBA 3SQ1A 3RR8A 1BI4B 1HYVA 1JLQA 4OVLA 4CIFA 3EYZA 1TAQA 3OJUA 2P5GA 3AVCA 3K5NA 1YVUA 4CGIA 3HSTB 1L3VA 4M3UA 3LALA 3ZSZA 1SKSA 4B9MA 2KZMA 4CF0A 3SV3A 3L2WA 4JRQA 1RCHA 4BACA 2IDOA 1QS4A 2OPQA 4IBNA 4CCHA 3MAQA 5T7BA 3U3GA 1YTAA 4CGDA 1VSIA 4W5OA 4I2PA 3L3UA 1HQUA 1NKEA 1ITGA 1ZBHA 3C94A 3V4IA 4CK2A 3AVMA 5CZ2A 4DWIA 3OYLA 1XHZA 4CHZA 3HXMA 3QEWA 4B9VA 4IFYA 3HO1A 4CE9A 3LPUA 1C0TA 4BDPA 5CZ1A 3THVA 1NK6A 4HVJA 2B6AA 3OJSA 3PX4A 4CEQA 2DFFA 1SKRA 1JXEA 1S1VA 3K58A 3BDPA 1HNIA 1KFDA 4QCLA 1JLCA 1REVA 3O4QA 2F8SA 1BL3A 1Z26A 2Y1IA 3VA0A 3PUFA 3VQQA 5J1EA 3LZJA 3TAFA 3LP2A 4N47A 1B92A 3CQ8A 1QSLA 3AVHA 3KLFA 2XY7A 3QLHA 4M41A 4CGGA 3AO5A 1R0AA 4CF8A 2F8TA 3AO1A 4HTUA 3F9KA 3VA3A 4W5NA 4M3RA 4DU4A 2KTQA 1HMVA 1S9EA 1VSJA 3HT3A 4JRPA 4KHQA 1WSJA 4B8AB 1BIUA 4FCYA 4FZYA 2A1RA 1NJZA 2VWKA 4CJ4A 1S1TA 4CJ5A 2FBXA 3MECA 4OGEA 3L8BA 2YKMA 3KLGA 1NKBA 4B9UA 4DF8A 4M3WA 3NH1A 2ITGA 4DTMA 3VQ5A 4DQQA 1F21A 2EX3A 4E7LA 1S1WA 2QKKA 3AV9A 4FJNA 2BE2A 1NK9A 3ASMA 1VSDA 4FJMA 1SL2A 3ZSWA 1ZBFA 3RR7A 2B5JA 4KHNA 2AJQA 1G15A 4BDZA 3ITHA 3ZSRA 1Q8IA 3V81A 1ASVA 1KVCA 4FZXC 4FLVA 1CXQA 4N5SA 1RDCA 4FW2A 1WSHA 1XWLA 3EZ5A 4E7JA 2RF2A 1UA0A 1JLFA 1N5YA 4HCBA 4ZTJA 4FYDA 3WNEA 4W5RA 3HK2A 2HHQA 4HUGA 4O55A 3AO2A 4FJKA 2XY6A 4F2RA 1JLAA 2D0AA 5C42A 4DFMA 3V6DA 3U6FA 1IH7A 4DLGA 4C8MA 3MXMA 4PY5A 2KFNA 4E1MA 1HPZA 4Q5VA 3ISNC 3C95A 3K5LA 1KRPA 3V9UA 3CYMA 3ALYA 1LW2A 3OYMA 3KLEA 4AH9A 3TI0A 1NK7A 1D8YA 1KLNA 4KV8A 1X1PA 1SV5A 3HPHA 3SNNA 2Z1HA 4FK4A 4CGFA 3O3HA 1LAWA 5HBMA 3C6UA 1J53A 3NE6A 1C0MA 1JLEA 1LW0A 1W9HA 1WSGA 2YNHA 2Z1GA 5KGXA 4F3TA 3NHGA 4I7FA 3NF8A 4DF4A 4MQ3A 4ELTA 3AA3A 3DRRA 3V1RA 4LSLA 5HRNA 2BANA 3ZSVA 3PY8A 2HHSA 2G8IA 3DOLA 2VWJA 4RW8A 2GBZA 4LY7A 2Z1JA 5EU7A 1T8EA 1TGOA 3RRHA 2OZSA 3LWMA 3V1QA 3KIOA 3WNFA 2HHTA 4CF1A 3V9WA 3G10A 2D0CA 3VQ4A 3OVNA 1JL1A 3OYCA 4EZ9A 1WAFA 1IO2A 2F96A 3NAEA 3P1GA 3QIOA 5K14A 3DLGA 4E0DA 1VRUA 4ELUA 3KKRA 1RT4A 2VG7A 2OYQA 4E89A 5CYQA 1C1AA 2W42A 3HYFA 1KSPA 1C1BA 3SUNA 1U47A 4B9TA 3ZSYA 5I42A 3AO3A 2XY8A 1S6QA 3OYIA 4CFAA 4FJ5A 3M8QA 3MEGA 3OYNA 4M3ZA 3TAGA 2HNYA 5I3UA 3AO4A 1BCOA 3V1OA 2YNGA 5C24A 4EP5A 2JLEA 2I5JA 1IG9A 4M42A 4BWMA 4CJRA 4CK1A 2FC0A 4LH4A 4IKFA 3KD1E 4CFCA 2RN2A 2O4IA 5J2QA 1QHTA 4E1NA 1TK8A 4J2AA 2YHBA 2ZE2A 4DTRA 4FJJA 1CLQA 3KK2A 4OLAA 4DQPA 3NDKA 3LANA 3NFAA 3TAMA 1RNHA 1GOBA 2HNDA 5CYMA 3LP1A 1S1UA 4BE0A 3HVRA 4AILC 3MEDA 1C6VA 5CY4A 2PY5A 1KLMA 3TR8A 4DTNA 1JXBA 2X74A 2O4GA 5KGWA 1BIZA 4OKKA 3K59A 5KTQA 4KHWA 5FROA 4KFBA 4JS5A 1UOCA 4LSNA 4ELVA 4E7IA 4CJKA 4IG3A 3HPOA 1VSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG1 A;  2KW4 A;  1SL1 A;  1WNS A;  4LD0 A;  4KPY A;  1T7P A;  5KRT A;  1ZBI A;  2R7Y A;  3LDS A;  1VSL A;  3QEV A;  4FXD A;  4DTP A;  1XC9 A;  1TK0 A;  3E01 A;  2QK9 A;  1QE1 A;  3FFI A;  1X9S A;  4FZZ A;  5J2M A;  4CF9 A;  5HRP A;  3OS1 A;  3KLH A;  4CK3 A;  5J2P A;  2HB5 A;  2IAJ A;  3B6O A;  3RMB A;  1VSK A;  1GOA A;  4MFB A;  2DTU A;  3OYA A;  4CEC A;  3PO4 A;  1JKH A;  4B9L A;  4CEO A;  4NCA A;  1YTU A;  3I0S A;  4CEB A;  4OPK A;  4F3O A;  2WOM A;  4Z4C A;  1NJX A;  1L3U A;  2XO7 A;  3OYK A;  4DSE A;  1VSE A;  4HCC A;  4DQS A;  2DFE A;  4FVM A;  3SUQ A;  1JL2 A;  1ZBL A;  3F73 A;  4Z0U A;  1RBR A;  3C6T A;  3JSM A;  4CJF A;  4CIG A;  4K8X A;  4PA1 A;  5DK5 A;  4EP4 A;  1RTH A;  1RT3 A;  3QNN A;  1L3S A;  4KAZ A;  2NUB A;  4KRF A;  4Z4F A;  1VSF A;  3LZI A;  4O0I A;  3NCI A;  4IFV A;  4L8R B;  2E6M A;  4B3O A;  3VQ7 A;  4CJE A;  1BIS A;  1IKY A;  4R5P A;  3T3F A;  1U45 A;  3O3F A;  4CEF A;  3ZT2 A;  1J9A A;  3RMC A;  2OA8 A;  4KHU A;  4XIU A;  5C25 A;  1Q9X A;  4J2E A;  1Y97 A;  3I8D A;  3L2U A;  1RT6 A;  2OPR A;  4G1Q A;  1RTD A;  4CJS A;  3OS2 A;  4Y1D A;  3MXJ A;  3SV4 A;  1L5U A;  4AHV A;  3KJV A;  4EZ6 A;  4H4O A;  3LAK A;  3TAE A;  4CES A;  1LV5 A;  2PYJ A;  3TAQ A;  2A1S A;  1S5J A;  3OYF A;  4FM0 A;  1EP4 A;  4GMJ B;  4DSL A;  2Z1I A;  4RG8 A;  3TAR A;  4FJI A;  3HPG A;  4PWD A;  1KFS A;  1NOZ A;  4FJL A;  1EKE A;  1LWF A;  3V9S A;  2YNI A;  1ASU A;  1C0U A;  3VQ6 A;  1QQC A;  3NGY A;  3D0P A;  4CHO A;  4DSI A;  3OY9 A;  5HRR A;  4CGH A;  2IC3 A;  2B4J A;  1NJY A;  5E41 A;  3QEX A;  4CJP A;  3UIQ A;  4H4M A;  2D5R A;  2LSN A;  4FJG A;  3OYJ A;  3QEP A;  1HYZ A;  4CIE A;  3CFP A;  3I0R A;  1T05 A;  1TV6 A;  3P5J A;  1TKX A;  1XHX A;  3QER A;  2ATQ A;  3DLB A;  3CFO A;  5KRS A;  4CEZ A;  4AHS A;  1HYS A;  5SZT A;  3SCX A;  2XRI A;  2YNF A;  1A5V A;  4CGJ A;  4O0J A;  3SYZ A;  4C8K A;  4ZTF A;  4FK0 A;  2VG5 A;  3ZT1 A;  4CJT A;  2X6N A;  1RTI A;  4B9S A;  4YNQ A;  1WLJ A;  3K5M A;  4DTU A;  3PX0 A;  3T1A A;  4KB1 A;  4NCB A;  3H08 A;  4Z4E A;  1SUQ A;  4DS4 A;  4Y1C A;  1VSH A;  2ETJ A;  4H8K A;  3AVA A;  5JS1 A;  1IKX A;  1WSE A;  1RBV A;  3TAP A;  3AVN A;  4CFD A;  1WSI A;  1I3A A;  1FKP A;  1JLG A;  4BE2 A;  4HUF A;  3VQE A;  3AVJ A;  1D5A A;  5DMR A;  3KKS A;  1CZ9 A;  4CJ3 A;  2P51 A;  4E3S A;  1X9M A;  1J5O A;  1EXQ A;  4IDK A;  1FXX A;  1EX4 A;  1QSS A;  4OLB A;  3M8S A;  4DFK A;  4O4G A;  2JGU A;  5D3G A;  2KFZ A;  3AVG A;  4FLZ A;  4OGC A;  1KVA A;  3DOK A;  3AVL A;  3NGZ A;  1RBS A;  4AHC A;  4HHT A;  3WNH A;  3TAB A;  4C8N A;  1ZBU A;  3EY1 A;  2RKI A;  4KI6 A;  1NK4 A;  4ZHR A;  3PV8 A;  4FJ9 A;  4F4K A;  4J2D A;  1UWB A;  4ID5 A;  1NK8 A;  3L3V A;  3VQ9 A;  4FLW A;  4KI4 A;  1TAU A;  3MEE A;  4FLU A;  1S9G A;  1A5X A;  4KKO A;  4KTZ A;  1FK9 A;  3WNG A;  3ZCM A;  3QO9 A;  4AHU A;  1NK0 A;  3DRP A;  4M3T A;  3SJJ A;  4DG1 A;  3DYA A;  2DY4 A;  3P83 D;  3VQB A;  4PUO A;  1L3T A;  2IGI A;  4FM2 A;  2IOC A;  2HVH A;  1BI4 A;  3NBP A;  1S6P A;  4DTJ A;  4DQR A;  1B9D A;  1UAX A;  3RMA A;  3HJF A;  3CG7 A;  3SQ0 A;  4FLX A;  2HVI A;  1WN7 A;  3M8R A;  4PQU A;  1VK0 A;  3CM5 A;  2HMI A;  2YHA A;  4QOZ B;  2OPS A;  4GW6 A;  1BGX T;  1ASW A;  3DLK A;  4OKJ A;  4BDY A;  3SPZ A;  3S9H A;  4FM1 A;  2G8H A;  4GVM A;  2E4L A;  3LWL A;  3DLH A;  4FJ7 A;  4K8Z A;  4YFU A;  1KCF A;  4C8L A;  1HQE A;  3HP6 A;  1LWC A;  4NYN A;  3ZT3 A;  4QAG A;  2VG6 A;  2ZD1 A;  4DTO A;  3QES A;  4DS5 A;  1ZYQ A;  4N76 A;  4CHQ A;  1N6Q A;  1KTQ A;  1J54 A;  4O5B A;  1A5W A;  3IRX A;  4M3Y A;  2GUI A;  3A2F A;  5HRO A;  3QNO A;  1XI1 A;  4AHR A;  1JLB A;  3AVF A;  2PZS A;  3IAY A;  2QXF A;  3HL8 A;  2P5O A;  3TAN A;  4DSK A;  4KB0 A;  2G8V A;  4DQI A;  1SKW A;  3L2Q A;  4DFP A;  1CZB A;  3AVK A;  4M45 A;  3DM2 A;  4OKE A;  2D0B A;  4F8R A;  1RDB A;  1DTQ A;  4W5T A;  3K2P A;  4KTW A;  4O44 A;  3L2V A;  1NOY A;  2QKB A;  3LAM A;  4WE1 A;  3SQ4 A;  1TKZ A;  4TSX A;  2G8U A;  3O4N A;  4DSJ A;  3NH0 A;  1B9F A;  3OYH A;  3K5O A;  4I2Q A;  3T19 A;  2KQ2 A;  3K57 A;  3VN5 A;  3V9X A;  2XY5 A;  1I39 A;  2P1J A;  3OYD A;  2XHB A;  4E7H A;  4J2B A;  4HUE A;  4B08 A;  1RT2 A;  2E6L A;  3G0Z A;  3SZ2 A;  1QSY A;  1BHL A;  2DFH A;  2YKN A;  3KK1 A;  4DFJ A;  3SUP A;  4CHY A;  3RMD A;  1DLO A;  4KO0 A;  2FBY A;  1NKC A;  4DTX A;  4Z4H A;  3VQ8 A;  5HRS A;  4ID1 A;  3ULD A;  3CFR A;  3HVT A;  1TK5 A;  1TKT A;  4CED A;  1TL3 A;  4CHN A;  3NF7 A;  1FKO A;  2GV9 A;  1RBU A;  4CHP A;  1BQN A;  3IS9 A;  4RW9 A;  4FLY A;  4DTS A;  2X6S A;  5J2N A;  4CJQ A;  3S3M A;  3OYG A;  3HM9 A;  1U04 A;  4OPJ A;  1HJR A;  1LWE A;  4C8O A;  2RPI A;  1MU2 A;  2BGG A;  1T03 A;  3RWU A;  1NK5 A;  1RT5 A;  2G8W A;  2HHX A;  1K6Y A;  4E7K A;  3NH2 A;  4KHY A;  3S3N A;  3ZT4 A;  3NF9 A;  3AA5 X;  3DI6 A;  4UQG A;  2Y1J A;  1HNV A;  3VQD A;  3QET A;  3BGR A;  4B9N A;  4Q0B A;  4DSF A;  4CEE A;  2PYL A;  5KI6 A;  1CXU A;  4W5Q A;  4RW7 A;  1TL1 A;  3AVI A;  3VQP A;  2HHV A;  1GOC A;  1DTT A;  1SL0 A;  1RDD A;  4ICL A;  3V9Z A;  3SPY A;  1LAV A;  1RIL A;  1WSF A;  1BCM A;  3HP9 A;  4OJR A;  3MXI A;  1Q9Y A;  1RT1 A;  4FJH A;  4I9L A;  1C1C A;  2YV0 X;  3JYT A;  1U4B A;  4RW6 A;  1D9D A;  4FJ8 A;  4B8C A;  2G8F A;  1RBT A;  3U3Y A;  4CER A;  2FBT A;  4CJL A;  3B6P A;  2OPP A;  1U49 A;  4LH5 A;  5SWM A;  2HHW A;  2HW3 A;  3M8P A;  2X78 A;  3PX6 A;  1D9F A;  4Z4G A;  3SI6 A;  4E19 A;  3QIN A;  1KVB A;  4I9Q A;  3OS0 A;  3KTQ A;  2ZQB A;  1RDA A;  3DLR A;  3KD5 E;  3D45 A;  3TWH A;  5FRN A;  3L2R A;  1IKV A;  4FJX A;  1O1W A;  3ZSX A;  4JS4 A;  4F2S A;  1VRT A;  1TVR A;  2FBV A;  3QIP A;  4CJU A;  3DRS A;  1U48 A;  3RTV A;  4KHS A;  4N56 A;  3O3G A;  3KK3 A;  3SUO A;  3NGI A;  2KZZ A;  1WAJ A;  4CF2 A;  3NF6 A;  1X9W A;  3DLE A;  4FW1 A;  4N41 A;  3AVB A;  5HP1 A;  3VQC A;  3QEI A;  4CJV A;  1W0H A;  2IS3 A;  1QTM A;  3VQA A;  4JLH A;  1EET A;  2WON A;  2HHU A;  4M3X A;  3S3O A;  1Z25 A;  3PO5 A;  4RW4 A;  4FLT A;  1BQM A;  3LP0 A;  3ZT0 A;  4CFB A;  3SQ2 A;  5JS2 A;  5HLF A;  1S1X A;  3AA4 A;  1RTJ A;  3LPT A;  4DLE A;  4KTQ A;  4AHT A;  1TKD A;  4CEA A;  3AA2 A;  4NCG A;  4NYF A;  3ZSQ A;  3OYE A;  4BWJ A;  2OZM A;  5FRM A;  4DMN A;  2HNZ A;  1NJW A;  3RRG A;  5FDL A;  1YT3 A;  2Q3S A;  4BE1 A;  4DU3 A;  1IKW A;  1RT7 A;  4IG0 A;  4DU1 A;  3LP3 A;  2G8K A;  2BDP A;  3CM6 A;  3ZSO A;  4KRE A;  1HRH A;  4Z4I A;  3KLI A;  1UA1 A;  3DMJ A;  2EHG A;  4FK2 A;  4CJW A;  3OYB A;  3SQ1 A;  3RR8 A;  1BI4 B;  1HYV A;  1JLQ A;  4OVL A;  4CIF A;  3EYZ A;  1TAQ A;  3OJU A;  2P5G A;  3AVC A;  3K5N A;  1YVU A;  4CGI A;  3HST B;  1L3V A;  4M3U A;  3LAL A;  3ZSZ A;  1SKS A;  4B9M A;  2KZM A;  4CF0 A;  3SV3 A;  3L2W A;  4JRQ A;  1RCH A;  4BAC A;  2IDO A;  1QS4 A;  2OPQ A;  4IBN A;  4CCH A;  3MAQ A;  5T7B A;  3U3G A;  1YTA A;  4CGD A;  1VSI A;  4W5O A;  4I2P A;  3L3U A;  1HQU A;  1NKE A;  1ITG A;  1ZBH A;  3C94 A;  3V4I A;  4CK2 A;  3AVM A;  5CZ2 A;  4DWI A;  3OYL A;  1XHZ A;  4CHZ A;  3HXM A;  3QEW A;  4B9V A;  4IFY A;  3HO1 A;  4CE9 A;  3LPU A;  1C0T A;  4BDP A;  5CZ1 A;  3THV A;  1NK6 A;  4HVJ A;  2B6A A;  3OJS A;  3PX4 A;  4CEQ A;  2DFF A;  1SKR A;  1JXE A;  1S1V A;  3K58 A;  3BDP A;  1HNI A;  1KFD A;  4QCL A;  1JLC A;  1REV A;  3O4Q A;  2F8S A;  1BL3 A;  1Z26 A;  2Y1I A;  3VA0 A;  3PUF A;  3VQQ A;  5J1E A;  3LZJ A;  3TAF A;  3LP2 A;  4N47 A;  1B92 A;  3CQ8 A;  1QSL A;  3AVH A;  3KLF A;  2XY7 A;  3QLH A;  4M41 A;  4CGG A;  3AO5 A;  1R0A A;  4CF8 A;  2F8T A;  3AO1 A;  4HTU A;  3F9K A;  3VA3 A;  4W5N A;  4M3R A;  4DU4 A;  2KTQ A;  1HMV A;  1S9E A;  1VSJ A;  3HT3 A;  4JRP A;  4KHQ A;  1WSJ A;  4B8A B;  1BIU A;  4FCY A;  4FZY A;  2A1R A;  1NJZ A;  2VWK A;  4CJ4 A;  1S1T A;  4CJ5 A;  2FBX A;  3MEC A;  4OGE A;  3L8B A;  2YKM A;  3KLG A;  1NKB A;  4B9U A;  4DF8 A;  4M3W A;  3NH1 A;  2ITG A;  4DTM A;  3VQ5 A;  4DQQ A;  1F21 A;  2EX3 A;  4E7L A;  1S1W A;  2QKK A;  3AV9 A;  4FJN A;  2BE2 A;  1NK9 A;  3ASM A;  1VSD A;  4FJM A;  1SL2 A;  3ZSW A;  1ZBF A;  3RR7 A;  2B5J A;  4KHN A;  2AJQ A;  1G15 A;  4BDZ A;  3ITH A;  3ZSR A;  1Q8I A;  3V81 A;  1ASV A;  1KVC A;  4FZX C;  4FLV A;  1CXQ A;  4N5S A;  1RDC A;  4FW2 A;  1WSH A;  1XWL A;  3EZ5 A;  4E7J A;  2RF2 A;  1UA0 A;  1JLF A;  1N5Y A;  4HCB A;  4ZTJ A;  4FYD A;  3WNE A;  4W5R A;  3HK2 A;  2HHQ A;  4HUG A;  4O55 A;  3AO2 A;  4FJK A;  2XY6 A;  4F2R A;  1JLA A;  2D0A A;  5C42 A;  4DFM A;  3V6D A;  3U6F A;  1IH7 A;  4DLG A;  4C8M A;  3MXM A;  4PY5 A;  2KFN A;  4E1M A;  1HPZ A;  4Q5V A;  3ISN C;  3C95 A;  3K5L A;  1KRP A;  3V9U A;  3CYM A;  3ALY A;  1LW2 A;  3OYM A;  3KLE A;  4AH9 A;  3TI0 A;  1NK7 A;  1D8Y A;  1KLN A;  4KV8 A;  1X1P A;  1SV5 A;  3HPH A;  3SNN A;  2Z1H A;  4FK4 A;  4CGF A;  3O3H A;  1LAW A;  5HBM A;  3C6U A;  1J53 A;  3NE6 A;  1C0M A;  1JLE A;  1LW0 A;  1W9H A;  1WSG A;  2YNH A;  2Z1G A;  5KGX A;  4F3T A;  3NHG A;  4I7F A;  3NF8 A;  4DF4 A;  4MQ3 A;  4ELT A;  3AA3 A;  3DRR A;  3V1R A;  4LSL A;  5HRN A;  2BAN A;  3ZSV A;  3PY8 A;  2HHS A;  2G8I A;  3DOL A;  2VWJ A;  4RW8 A;  2GBZ A;  4LY7 A;  2Z1J A;  5EU7 A;  1T8E A;  1TGO A;  3RRH A;  2OZS A;  3LWM A;  3V1Q A;  3KIO A;  3WNF A;  2HHT A;  4CF1 A;  3V9W A;  3G10 A;  2D0C A;  3VQ4 A;  3OVN A;  1JL1 A;  3OYC A;  4EZ9 A;  1WAF A;  1IO2 A;  2F96 A;  3NAE A;  3P1G A;  3QIO A;  5K14 A;  3DLG A;  4E0D A;  1VRU A;  4ELU A;  3KKR A;  1RT4 A;  2VG7 A;  2OYQ A;  4E89 A;  5CYQ A;  1C1A A;  2W42 A;  3HYF A;  1KSP A;  1C1B A;  3SUN A;  1U47 A;  4B9T A;  3ZSY A;  5I42 A;  3AO3 A;  2XY8 A;  1S6Q A;  3OYI A;  4CFA A;  4FJ5 A;  3M8Q A;  3MEG A;  3OYN A;  4M3Z A;  3TAG A;  2HNY A;  5I3U A;  3AO4 A;  1BCO A;  3V1O A;  2YNG A;  5C24 A;  4EP5 A;  2JLE A;  2I5J A;  1IG9 A;  4M42 A;  4BWM A;  4CJR A;  4CK1 A;  2FC0 A;  4LH4 A;  4IKF A;  3KD1 E;  4CFC A;  2RN2 A;  2O4I A;  5J2Q A;  1QHT A;  4E1N A;  1TK8 A;  4J2A A;  2YHB A;  2ZE2 A;  4DTR A;  4FJJ A;  1CLQ A;  3KK2 A;  4OLA A;  4DQP A;  3NDK A;  3LAN A;  3NFA A;  3TAM A;  1RNH A;  1GOB A;  2HND A;  5CYM A;  3LP1 A;  1S1U A;  4BE0 A;  3HVR A;  4AIL C;  3MED A;  1C6V A;  5CY4 A;  2PY5 A;  1KLM A;  3TR8 A;  4DTN A;  1JXB A;  2X74 A;  2O4G A;  5KGW A;  1BIZ A;  4OKK A;  3K59 A;  5KTQ A;  4KHW A;  5FRO A;  4KFB A;  4JS5 A;  1UOC A;  4LSN A;  4ELV A;  4E7I A;  4CJK A;  4IG3 A;  3HPO A;  1VSM A; 
#chains in the Genus database with same CATH topology
 2KLA A;  1VSL A;  2P9U B;  1XC9 A;  2QK9 A;  3FFI A;  1K8A O;  5J2M A;  3ENB A;  3ULE A;  4CK3 A;  5J2P A;  2HB5 A;  4NLC A;  3QML A;  4MFB A;  3OBW A;  4CEC A;  4B9L A;  3C65 A;  1YTU A;  4F3O A;  2WOM A;  1L3U A;  2YHY A;  3JS6 A;  3EE8 A;  3CHW A;  3CJB A;  3HZ6 A;  3SUQ A;  1JL2 A;  1U2V A;  4A62 A;  4Z0U A;  2NRX A;  4CJF A;  1WBB A;  4KRF A;  3U9D A;  1VSF A;  3SBT A;  4L8R B;  3O9Q A;  1BIS A;  4R5P A;  2FXU A;  1J9A A;  4FO0 A;  3IKM A;  3LDL A;  4J2E A;  3L2U A;  2CGL A;  4FWK A;  4G1Q A;  3DXM A;  3MWP A;  4B3M K;  3LAK A;  2RHK A;  4JI2 K;  4RTF D;  3JAM O;  5E26 A;  2PYJ A;  3TAQ A;  4H0X B;  4M7X A;  3E1Y A;  1N32 K;  1R59 O;  3D0P A;  4K41 A;  2ZJP L;  4DSI A;  2Q36 A;  4CJP A;  3UIQ A;  2LSN A;  4FJG A;  3OYJ A;  2CH6 A;  3QEP A;  1ZC6 A;  1HYZ A;  1T05 A;  2IVP A;  1W7A A;  2HBJ A;  1TKX A;  2ATQ A;  5KRS A;  1MA9 B;  4B1U B;  1YIJ N;  4DR4 K;  2YNF A;  4DV7 K;  4CGJ A;  4ZTF A;  3MWT A;  4PKI A;  4BR9 A;  1MWM A;  4DTU A;  4KB1 A;  4YDU A;  4A57 A;  1NGC A;  3KVG A;  3EKU A;  2QA4 N;  4BG8 A;  4DS4 A;  4Y1C A;  4JV5 K;  1OH6 A;  1RBV A;  3TAP A;  1WSI A;  1FKP A;  3WEE B;  4BE2 A;  2QM1 A;  5AQG A;  3AVJ A;  4E3S A;  4B3O A;  4OLB A;  3AVG A;  4BR5 A;  4OGC A;  1YXQ A;  3AVL A;  5CHI A;  4C8N A;  2YJF A;  2RKI A;  1NK4 A;  3EE9 A;  4ID5 A;  3VQ9 A;  4YDU C;  2E5L K;  5M1F A;  1P8Z A;  1NK0 A;  4M3T A;  3SJJ A;  3DYA A;  2DY4 A;  1VQM N;  3P83 D;  3R8E A;  3CJC A;  4CBX A;  4DUZ K;  2IGI A;  1IG8 A;  2IOC A;  5AQL A;  1BI4 A;  3RMA A;  1UAX A;  3G71 N;  3SQ0 A;  4FWR A;  2HVI A;  1GLL O;  3CM5 A;  2YHA A;  5AQQ A;  1BGX T;  1EWR A;  4OKJ A;  1QVG M;  4BDY A;  3S9H A;  4FM1 A;  2F7T A;  4FJ7 A;  4DUY K;  3DLH A;  4K8Z A;  1LWC A;  4NYN A;  3ZT3 A;  4DTO A;  2VG6 A;  3KK7 A;  5BR8 K;  2D0O A;  4JK8 A;  1N6Q A;  4Y0W A;  4BGA A;  1KTQ A;  2JWK A;  4BRD A;  1Q18 A;  2GUI A;  3A2F A;  1XI1 A;  3L6Q A;  3IAY A;  1OH8 A;  1JCE A;  3AVF A;  3ULE B;  5AQJ A;  4DV0 K;  1EO1 A;  3TAN A;  4M7Y A;  1CZB A;  4FVU A;  4OKE A;  2D0B A;  4F8R A;  1RDB A;  3L2V A;  4AM6 A;  3O1W A;  5BPM A;  3LAM A;  4G9Z A;  2G8U A;  1TKZ A;  1U2V B;  4TSX A;  3NH0 A;  2KQ2 A;  2XY5 A;  3OYD A;  2P1J A;  4B08 A;  1BHL A;  2DFH A;  2J4R A;  3KK1 A;  4DFJ A;  4KO0 A;  4NXN K;  4QS9 A;  1NKC A;  4OX9 K;  4CZF A;  3CFR A;  2PAV A;  3CCJ N;  4CHN A;  2GEL A;  5GAE P;  4FLY A;  5J2N A;  4CJQ A;  1U04 A;  1HJR A;  1LWE A;  1T03 A;  5C0Y A;  5BRE A;  3ZT4 A;  3S3N A;  3AA5 X;  3R1X A;  1HNV A;  2F9W A;  1RGI A;  4Q0B A;  4B9N A;  4DSF A;  3MCA B;  3WQT A;  4W5Q A;  4RW7 A;  3AVI A;  2HHV A;  1DTT A;  5ADX H;  4JI4 K;  4CZJ A;  3V9Z A;  3SPY A;  1ATR A;  3HP9 A;  4OJR A;  5BN9 A;  2P9L A;  3JYT A;  1D9D A;  4RW6 A;  3U3Y A;  2A40 A;  3CCR N;  2FBT A;  4CJL A;  5AZJ A;  2OPP A;  3TSQ A;  1XNR K;  2DPN A;  4FWQ A;  3M8P A;  4BVP A;  4H5V A;  4E19 A;  1KVB A;  2ZQB A;  2VQE K;  5FPE A;  3T7Z A;  4YHH K;  5FRN A;  3L2R A;  3ZSX A;  1VRT A;  1HPM A;  1NGB A;  1VQ8 N;  3CJA A;  3KK3 A;  5AFU H;  4BY9 C;  3NF6 A;  1X9W A;  4FW1 A;  4BR2 A;  4N41 A;  3GE1 A;  3AVB A;  3C0B A;  3C7N A;  4JLH A;  5JMV A;  2WON A;  2HHU A;  3DAW A;  1BQM A;  2NRV A;  4H0P A;  5HLF A;  2D4W A;  4AHT A;  4CEA A;  4NCG A;  3OYE A;  3P38 A;  1ZBS A;  4JI3 K;  1UA1 A;  5AQK A;  5EY4 A;  5LY3 A;  3SQ1 A;  1BI4 B;  1TAQ A;  3AVC A;  3K5N A;  3CJ1 A;  1L3V A;  3HST B;  3LAL A;  4MO5 A;  4B9M A;  3L2W A;  1QQM A;  4JRQ A;  4CCH A;  3MAQ A;  3SJH A;  5T7B A;  1HQU A;  3H45 C;  4MLE A;  4KH5 A;  2WTU A;  5AR0 A;  3C94 A;  1XHZ A;  1BA0 A;  4BDP A;  3THV A;  4HVJ A;  3OJS A;  2QI2 A;  3PIP L;  5BRF A;  1TUU A;  1NWK A;  1Q86 O;  1JLC A;  3ZX0 A;  3VA0 A;  1KQS M;  1VQ6 N;  5IT9 O;  4X65 K;  3ID8 A;  3LP2 A;  3CQ8 A;  3NVM A;  5AQH A;  3VA3 A;  4HTU A;  2KTQ A;  4FPB A;  5DM7 L;  2P9I A;  1WSJ A;  4XH5 A;  3TSP A;  2UXD K;  3WXM B;  2FBX A;  5A2Q O;  2YKM A;  3R6M A;  4BRE A;  4DF8 A;  4M3W A;  2ITG A;  4DTM A;  4DQQ A;  4AQY K;  2F4V K;  1S1W A;  3AV9 A;  2BE2 A;  1OKJ A;  1NK9 A;  1VSD A;  1SL2 A;  3ZSW A;  1ASV A;  4OPH A;  3QB0 A;  1WSH A;  4JK9 A;  3EZ5 A;  5HOO A;  1N5Y A;  4HCB A;  3DLL L;  3WNE A;  4X62 K;  2UUC K;  2XY6 A;  1JLA A;  2QW9 A;  5C42 A;  4DKW A;  3O1B A;  4Q5V A;  2QWP A;  3ISN C;  1KRP A;  3HRG A;  3CER A;  3KLE A;  4AH9 A;  1D8Y A;  3LM9 A;  4CD3 A;  3BZC A;  1SV5 A;  3O3H A;  5GAD P;  2P9L B;  3D2E A;  5AQZ A;  1LW0 A;  4QS7 A;  4F3T A;  5AZJ B;  3PY8 A;  4GKK K;  3DOL A;  2VWJ A;  1BO5 O;  5GIN A;  3LWM A;  1JCF A;  2W6L A;  4DV4 K;  2HHT A;  4IOX A;  3OVN A;  4FPA A;  1JL1 A;  3OYC A;  1WAF A;  3NAE A;  5K14 A;  4E0D A;  4ELU A;  4E1J A;  2VG7 A;  1T3V A;  4DCH A;  3ZSY A;  4IZ9 A;  4CFA A;  3C7N B;  4KH4 A;  2HNY A;  2OTL N;  3AO4 A;  1Y64 A;  2YNG A;  5C24 A;  1WOQ A;  3AGK A;  3F9M A;  4BWM A;  3QIC A;  4IKF A;  4A2A A;  2RN2 A;  4CFC A;  5J2Q A;  5M1O A;  2YHB A;  4J8F A;  2A3Z A;  3NFA A;  3TAM A;  5CY4 A;  2O4G A;  3K59 A;  2P9U A;  3ENH A;  4JS5 A;  2PFU A;  4ELV A;  4E7I A;  1VSM A;  4R79 A;  2KW4 A;  1WNS A;  3LDS A;  3QEV A;  4FXD A;  1XQS C;  1RDU A;  3E01 A;  1QE1 A;  1X9S A;  3CC4 N;  3VET A;  4H5W A;  5HRP A;  1NJX A;  2IAJ A;  1GOA A;  3OYA A;  3BZK A;  3I55 N;  4NCA A;  3I0S A;  4OPK A;  4Z4C A;  4DQS A;  3VPZ A;  4FVM A;  3F73 A;  4CIG A;  3UKR A;  4EP4 A;  5FLX O;  4KAZ A;  2NUB A;  4O0I A;  2P9I B;  3P39 A;  2E6M A;  3WQU A;  1N33 K;  1VQO N;  2A42 A;  3T3F A;  4JKB A;  3O3F A;  3ZT2 A;  4JI1 K;  4H0Y B;  5AQX A;  4XIU A;  1Q9X A;  4H5R A;  3CI5 A;  1RT6 A;  2OPR A;  1L5U A;  4H4O A;  4IO9 L;  4CES A;  3CCV N;  1KAZ A;  2A1S A;  3MN7 A;  3OYF A;  4GMJ B;  4FM0 A;  2Z1I A;  1W2B M;  3TAR A;  3HPG A;  1HUX A;  1EKE A;  1LWF A;  2E2N A;  3CD6 N;  1ZXO A;  2YNI A;  4V19 S;  5GAH P;  3VQ6 A;  5AQY A;  4HTL A;  4CGH A;  3O6W A;  1YAG A;  2ZWH A;  5E41 A;  3FGU A;  3QEX A;  4H4M A;  2VWB A;  4CIE A;  3CFP A;  3BP8 A;  3PLA A;  3P5J A;  1XHX A;  3CFO A;  2JWL A;  5SZT A;  2Q97 A;  3CCE N;  4A61 A;  3SYZ A;  4C8K A;  2W40 A;  4FK0 A;  2VG5 A;  3ZT1 A;  5AQI A;  4K42 A;  4B9S A;  1I94 K;  5TKW A;  3PX0 A;  3H08 A;  4H5T A;  1VSH A;  5C15 A;  3AVN A;  3MN5 A;  3PSI A;  5KPZ A;  4F9O A;  1YVN A;  3VQE A;  3BF1 A;  3KWG A;  3D6R A;  4YOX A;  1CZ9 A;  1J5O A;  1X9M A;  1EX4 A;  1QSS A;  3M8S A;  4DFK A;  5D3G A;  2KFZ A;  4FLZ A;  3DOK A;  3LDP A;  4HHT A;  4AHC A;  3WNH A;  2E88 A;  5B8H A;  3CCM N;  4KI6 A;  4FJ9 A;  4ZHR A;  2UU9 K;  4J2D A;  5HL7 L;  3CJ7 A;  1NK8 A;  2CH5 A;  4KI4 A;  3WNG A;  3QO9 A;  4AHU A;  3DRP A;  4DR5 K;  1JCG A;  4PUO A;  1NMN A;  1S72 N;  3NBP A;  3HJF A;  4KHP K;  1WN7 A;  3IUC A;  4GV9 A;  1LCU A;  1ASW A;  3DLK A;  4AF1 A;  3ATU A;  4GVM A;  2E4L A;  3VGK A;  3LWL A;  2IVO A;  4YFU A;  1KCF A;  4C8L A;  5M1P A;  1GLE G;  2ZD1 A;  4N76 A;  2YCH A;  4L3Q A;  1HJO A;  3IRX A;  1KXP A;  5M1N A;  1GLF O;  3WXJ A;  5HRO A;  4AHR A;  4DSK A;  4KB0 A;  1K8K A;  3HL8 A;  2YX6 A;  4DFP A;  1S22 A;  3U4L A;  3TSU A;  4BRK A;  3AVK A;  3J7Z O;  1QVF M;  3K2P A;  4O44 A;  1NOY A;  3VTH A;  3N4P A;  4WE1 A;  3SQ4 A;  3SK3 A;  3O4N A;  1NGE A;  5CR4 A;  1B9F A;  1TUY A;  3K5O A;  3T19 A;  3V9X A;  3SUO A;  4FL9 A;  3UKR B;  1I39 A;  5AQO A;  3TPQ A;  4E7H A;  3EKS A;  4HUE A;  3O9S A;  1RT2 A;  2VCP A;  3SZ2 A;  5BN8 A;  4BRP A;  1VQL N;  3THY A;  4DTX A;  3VQ8 A;  4ID1 A;  4ILJ A;  2ASO A;  1TK5 A;  1HKC A;  1TKT A;  4C1N I;  2RE2 A;  3NF7 A;  5AQS A;  2GV9 A;  5ADX A;  1BQN A;  3O8M A;  4DTS A;  2X6S A;  3S3M A;  4X64 K;  3QBX A;  4C8O A;  2BGG A;  1MU2 A;  3RWU A;  4LF6 K;  1K6Y A;  4E7K A;  3NH2 A;  4YY3 K;  3BGR A;  2O8C B;  2PYL A;  1CXU A;  1TL1 A;  1GOC A;  1SL0 A;  4ICL A;  1WSF A;  1HNZ K;  3MXI A;  4FJH A;  2P9P A;  4XH1 A;  1C1C A;  2YV0 X;  1WUA A;  1U4B A;  2UXC K;  3G25 A;  1GLD G;  2KKZ A;  3Q7C A;  2OCE A;  3B6P A;  1XNQ K;  5AFU A;  1E3M A;  1D9F A;  3PX6 A;  1DT9 A;  3OS0 A;  3IFR A;  3L0Q A;  1IKV A;  3VES A;  4A5B A;  4FJX A;  4F2S A;  1TVR A;  2FBV A;  4KHS A;  3O3G A;  2V51 B;  3QEI A;  2A6A A;  3VQA A;  1EET A;  4M3X A;  2QEX N;  1Z25 A;  3U8X A;  4FLT A;  5F0X A;  2ASM A;  3SQ2 A;  5M1Q A;  4DLE A;  1RTJ A;  3AA4 A;  4KTQ A;  1NGG A;  4NYF A;  3ZSQ A;  1XC3 A;  5FRM A;  4DMN A;  3RRG A;  1NJW A;  1FJG K;  1YT3 A;  2Q3S A;  2BDP A;  5GAG P;  3CM6 A;  3ZSO A;  5GIP A;  4GKJ K;  4KRE A;  4IWV A;  4Z4I A;  2IIR A;  2Q0R A;  3KLI A;  3QFU A;  1X3M A;  3DMJ A;  4CJW A;  3A5O C;  1SZ2 A;  1HYV A;  4Z94 A;  2Q1N A;  1NGH A;  3OJU A;  3CQX A;  1SQK A;  4BRQ A;  1OH7 A;  4ISG A;  1RCH A;  2IDO A;  3WXI A;  2OPQ A;  3A5M C;  3U3G A;  4CGD A;  4W5O A;  1K73 O;  3I33 A;  4B1Y B;  2UYT A;  1NGF A;  3AVM A;  4DWI A;  3H1Q A;  5LMU K;  5AQP A;  4FWO A;  1C0T A;  5KQ8 A;  1SKR A;  2B6A A;  3PX4 A;  4CEQ A;  2DFF A;  1JXE A;  3FZL A;  3BDP A;  2WC9 A;  5BRH A;  2F8S A;  1BL3 A;  1K8K B;  1Z26 A;  2Y1I A;  3PUF A;  3VQQ A;  5J1E A;  1TYQ B;  4N47 A;  1QSL A;  4BR4 A;  3AVH A;  3VEO A;  3KLF A;  1WB9 A;  2F8T A;  4CF8 A;  3AO1 A;  4B1W B;  4M3R A;  1HMV A;  2NRT A;  4BRH A;  1KC8 O;  4B8A B;  4GNI A;  1BIU A;  2A1R A;  1HKG A;  5EX5 A;  3A0I X;  3L8B A;  3CCQ N;  3KLG A;  3NH1 A;  3THY B;  4BGB A;  1NBW A;  3MMV A;  3VQ5 A;  3D2F A;  1VQ4 N;  4NB4 A;  4FJN A;  3RR7 A;  3VF6 A;  2B5J A;  2AJQ A;  1G15 A;  3EO3 A;  1KVC A;  4FW2 A;  1JLF A;  4YOV A;  2UUA K;  3D7E O;  2O8E B;  2WUS A;  4HUG A;  3BEX A;  3W3D A;  4FJK A;  3CJ9 A;  3MXM A;  3P4I A;  4PY5 A;  1Z05 A;  4K25 A;  3K5L A;  4BRM A;  3CYM A;  3ALY A;  1KLN A;  1W97 L;  3SNN A;  1NU0 A;  4CGF A;  1LAW A;  2P9P B;  4FWS A;  3PIO L;  4JNE A;  5HBM A;  3NE6 A;  2QTD A;  5KGX A;  3NHG A;  3QDK A;  2NRW A;  2E2Q A;  3NF8 A;  2ZJQ L;  3DRR A;  2E2O A;  2BAN A;  3ZSV A;  2G8I A;  4RW8 A;  5EU7 A;  2Z1J A;  3LL3 A;  5I9E B;  5GIO A;  3RRH A;  2OZS A;  3G6E N;  2D0C A;  1EQY A;  4O5F A;  1IO2 A;  3P1G A;  3QIO A;  2UXB K;  3DLG A;  1VRU A;  2OYQ A;  3HYF A;  3S41 A;  1C1B A;  4B9T A;  2FSJ A;  4FJ5 A;  3P31 A;  3MEG A;  1T6C A;  3TAG A;  3FR0 A;  5I3U A;  2D0P A;  3FZM A;  4IXC A;  4EP5 A;  2JLE A;  3K0S A;  4LH4 A;  2O4I A;  2E20 A;  1V4T A;  3WUH A;  3KK2 A;  4LF5 K;  5KQD A;  3NDK A;  3LAN A;  4CZK A;  1RNH A;  1GOB A;  1S1U A;  4BE0 A;  3CF5 L;  2Q31 A;  2FSK A;  1C6V A;  2EWS A;  1JXB A;  4IJA A;  4ISF A;  1BIZ A;  2ITM A;  3SMP A;  3VEN A;  5FRO A;  4RCH A;  1QQO A;  1UOC A;  3MX2 A;  3HPO A;  1C0G A;  3GBT A;  4LD0 A;  4KPY A;  1T7P A;  2R7Y A;  1OVY A;  3LDQ A;  2IVN A;  4FZZ A;  3OS1 A;  3KLH A;  1JJ2 M;  4B9Q A;  3PO4 A;  2WFB A;  4CEO A;  5JIC A;  2XO7 A;  4HCC A;  2DFE A;  1MDU B;  5BR9 A;  2GTD A;  4K8X A;  4PA1 A;  5DK5 A;  1RTH A;  1L3S A;  5JLF A;  3LZI A;  3NCI A;  1FW6 A;  3VQ7 A;  3ZET A;  1IKY A;  1U45 A;  4JI0 K;  4CEF A;  4FOE A;  3RMC A;  2OA8 A;  3OW2 M;  4LFC K;  5C25 A;  4JI6 K;  3I8D A;  1IBL K;  3O9U A;  1RTD A;  3MXJ A;  3SV4 A;  3KJV A;  4CZI A;  1T44 A;  3D2F B;  3PSF A;  3TAE A;  2NRH A;  4JKA A;  2Q0U A;  1LV5 A;  1YJ9 N;  1YF5 L;  3H6E A;  4RG8 A;  3J7Y P;  4FJI A;  4PWD A;  1KFS A;  1ASU A;  1C0U A;  4KBO A;  1QQC A;  3NGY A;  4CHO A;  3VF4 A;  3VEZ A;  2IC3 A;  3MX5 A;  3WXK A;  4RWT A;  5AQR A;  3I0R A;  1SS6 A;  4GV3 A;  1TV6 A;  3O80 A;  3QER A;  3CMA N;  4CEZ A;  4AHS A;  3ENO A;  1HYS A;  1VQP N;  2XRI A;  1A5V A;  2E2P A;  2A5X A;  4O0J A;  4BRF A;  4CJT A;  5IWA K;  1RTI A;  5JVH L;  4NCB A;  4WQ5 C;  3T1A A;  3CCL N;  4Z4E A;  3ZX3 A;  2E8A A;  3FLC O;  1IKX A;  5JS1 A;  1WSE A;  4CFD A;  2GWJ A;  1I3A A;  4CBU A;  2NRZ A;  1JLG A;  4PL7 A;  4HUF A;  3UB5 A;  3KKS A;  3LDO A;  2P51 A;  3MN6 A;  1QQN A;  1FXX A;  2QWO A;  4IDK A;  3VGM A;  4O4G A;  2JGU A;  4DV3 K;  1KVA A;  1NNE A;  4LFA K;  3NGZ A;  2GX9 A;  1ZBU A;  3EY1 A;  2NLX A;  4YOW A;  3PV8 A;  4F4K A;  3L3V A;  2PBD A;  4FLW A;  4MLH A;  3MEE A;  4FLU A;  1S9G A;  1A5X A;  4KTZ A;  3ZCM A;  1FK9 A;  3OHR A;  1VQ5 N;  2BUP A;  4OO1 J;  3HM8 A;  2HHH K;  3DXK A;  4FM2 A;  2ZGY A;  5C2D A;  4DQR A;  1IBK K;  1IJJ A;  1VK0 A;  5LJW A;  4QOZ B;  4BR0 A;  4KH6 A;  3GOI A;  2G8H A;  1E4G T;  4JKC A;  4DV6 K;  5LL6 Z;  4B3T K;  4BC2 A;  4JKD A;  3GL1 A;  1HQE A;  1NLV A;  3HP6 A;  4QAG A;  1DGK N;  4DS5 A;  2H3G X;  3J81 O;  1P90 A;  1J54 A;  4O5B A;  3R3L A;  1H1V A;  2QXF A;  1SKW A;  4DR1 K;  3THX A;  4M45 A;  3DM2 A;  5EOY A;  4CI6 A;  1DTQ A;  4DV1 K;  5AQF A;  4H0V B;  1DKG D;  4DSJ A;  3JXU A;  2FLO A;  3H3N O;  3K57 A;  3VN5 A;  2XHB A;  4J2B A;  1QSY A;  2YKN A;  3VGL A;  3ZET B;  3RMD A;  1XUP O;  1DLO A;  4XH4 A;  5DM6 L;  4NO7 A;  4IOA L;  4Z4H A;  5HRS A;  3RSE A;  1BUP A;  3ULD A;  3HVT A;  4CED A;  5EVZ A;  1FKO A;  1Q82 O;  1RBU A;  1J5E K;  2QWQ A;  3FE1 A;  2CGJ A;  3OYG A;  3HM9 A;  2O8C A;  2HF3 A;  2VGN A;  4IJN A;  2RPI A;  1BU6 O;  1RT5 A;  2G8W A;  2HHX A;  4KHY A;  4WYB A;  4GVE A;  3J8A A;  4BVO A;  3VQD A;  3QET A;  3TTF A;  3L4Q A;  3VQP A;  4MDA A;  3LM2 A;  3CXC M;  1LAV A;  1RIL A;  1QZ6 A;  2P9N A;  1Q9Y A;  1RT1 A;  1O13 A;  3B8A X;  4I9L A;  3KHY A;  4B8C A;  2G8F A;  3CC2 N;  1U49 A;  3BF3 A;  5BRD A;  3O5B A;  4BR7 A;  2HW3 A;  3UKU A;  2X78 A;  4CZE A;  3SI6 A;  3HSC A;  4I9Q A;  3D45 A;  3HBT A;  4BQZ A;  2ASP A;  1VQN N;  3J80 O;  4JS4 A;  3SLC A;  1M90 O;  3DRS A;  4DR2 K;  1U48 A;  4FWP A;  4FSV A;  4N56 A;  2O8F A;  5AZI B;  3NGI A;  4IEI A;  5HP1 A;  2QWM A;  3VQC A;  1W0H A;  5BPL A;  3PO5 A;  4RW4 A;  4OPA A;  3LP0 A;  3BUZ B;  3ZT0 A;  3VOV A;  1TKD A;  2D1K A;  3G4S N;  4BWJ A;  2OZM A;  2HNZ A;  4DU3 A;  4DU1 A;  4IG0 A;  3R9P A;  2AP1 A;  4CZG A;  1HRH A;  3CPW M;  4JHD A;  3DXK B;  4U67 L;  4OVL A;  2F9T A;  4M3U A;  3CQY A;  3ZSZ A;  1SKS A;  2KZM A;  4CF0 A;  5F2R A;  1YTA A;  1MWK A;  1ATN A;  1NKE A;  1ITG A;  1ZBH A;  3V4I A;  4CK2 A;  5CZ2 A;  3OYL A;  3HO1 A;  4IFY A;  1TYQ A;  1OVQ A;  4IEE A;  4CE9 A;  3LPU A;  5CZ1 A;  1NK6 A;  2O8D B;  1S1V A;  3K58 A;  1NGJ A;  3LZJ A;  5LJV A;  3THX B;  2XY7 A;  1R0A A;  4CGG A;  4WFA L;  4BRN A;  4DU4 A;  3CIP A;  1S9E A;  3AAR A;  3GG4 A;  4JRP A;  4KHQ A;  2BTF A;  1KAY A;  4H5N A;  4YOT A;  4FZY A;  2WBN A;  4EAH D;  4CJ4 A;  1S1T A;  1Q81 O;  3E9O A;  3HTV A;  4OGE A;  1NKB A;  3OBY A;  1CZA N;  3EZW A;  5FPM A;  4BC3 A;  5AQM A;  3THW A;  4CJ7 A;  1F21 A;  2EX3 A;  4E7L A;  1YUW A;  3RSE B;  3EEQ A;  3KZB A;  3ZX2 A;  3ASM A;  3LDN A;  2O8E A;  1ZBF A;  2QWN A;  2NZT A;  3FZK A;  1M1K O;  3C6H A;  1ESV A;  4N5S A;  3O08 A;  5H1S Q;  1XWL A;  4E7J A;  1UA0 A;  2RF2 A;  4ZTJ A;  4W5R A;  5JVG L;  2HHQ A;  2AA4 A;  5AQN A;  3GDQ A;  4O55 A;  4JAX A;  3I8B A;  2UUB K;  4F2R A;  3ZYY X;  4DFM A;  3V6D A;  3U6F A;  1IH7 A;  4E1M A;  1HPZ A;  1DEJ A;  3C95 A;  1LW2 A;  3OYM A;  1NK7 A;  4KV8 A;  1X1P A;  1WBD A;  3HPH A;  2P9N B;  4JYA K;  3C6U A;  1J53 A;  3OA9 A;  4CZM A;  1C0M A;  1JLE A;  1W9H A;  1WSG A;  2Z1G A;  4I7F A;  3AA3 A;  3V1R A;  4LY7 A;  4A59 A;  3I56 N;  3UKU B;  4BC5 A;  1VQ7 N;  3KIO A;  4I6M A;  4CF1 A;  4C23 A;  3G10 A;  2NNW A;  2VQF K;  4EZ9 A;  2F96 A;  4JEP A;  1NGI A;  3T1H K;  3KKR A;  1RT4 A;  3HOS A;  1KSP A;  1C1A A;  2O8F B;  4BRL A;  3SUN A;  1U47 A;  5I42 A;  3AO3 A;  1NMD A;  2XY8 A;  1S6Q A;  3OYI A;  4BQL A;  4WCE L;  3OYN A;  1BDG A;  3T1Y K;  1YJW N;  4M42 A;  2I5J A;  4PKH A;  1IG9 A;  4LF4 K;  3NVK A;  3SAH A;  3ZEU A;  4CJR A;  4DV2 K;  4LF9 K;  4DB3 A;  3J7A P;  1TK8 A;  4U7B A;  3AAP A;  5AQT A;  4FJJ A;  4OLA A;  4DQP A;  1OH5 A;  2E1Y A;  1N36 K;  2I7P A;  3HVR A;  4AIL C;  2YJE A;  5MLC Q;  3MED A;  2PY5 A;  1KAX A;  3TR8 A;  4EFH A;  4JHD B;  2GEM A;  4OKK A;  3SBG A;  5KTQ A;  1YHQ N;  1XMO K;  3IG1 A;  1SL1 A;  2E1Z A;  3ATV A;  5AQV A;  1IBM K;  5KRT A;  1ZBI A;  4CD1 A;  3K9J A;  4JK7 A;  4DTP A;  1TK0 A;  4CF9 A;  5AJ3 K;  2OTJ N;  4MDB A;  3B6O A;  3RMB A;  1VSK A;  4BRC A;  4B3S K;  4UY8 O;  2DTU A;  4YOY A;  1JKH A;  4CEB A;  3OYK A;  4JI5 K;  2OAN A;  3QBW A;  4O8K A;  4DSE A;  1VSE A;  1QZ5 A;  4K43 A;  3MN9 A;  1ZBL A;  1S3X A;  5F1X A;  3TTC A;  4GV6 A;  1RBR A;  3C6T A;  3JSM A;  3TU5 A;  4JD2 A;  4NXM K;  4B1X B;  1RT3 A;  3QNN A;  4Z4F A;  4B1V A;  4IFV A;  4C1N K;  3A5N C;  4CJE A;  3WXL A;  4KHU A;  1Y97 A;  3VTI A;  4CJS A;  3OS2 A;  4Y1D A;  3THW B;  2O8B A;  4AHV A;  4EZ6 A;  3EL2 A;  1HKB A;  4NLB A;  1S5J A;  3H46 O;  1V4S A;  5JLH A;  1EP4 A;  4DSL A;  3DXM B;  4FJL A;  1NOZ A;  3V9S A;  1BWF O;  4PKG A;  4H0T B;  5HRR A;  3OY9 A;  4WFB L;  3M1F A;  4B1Z A;  2VGM A;  2B4J A;  1NJY A;  5BPN A;  2D5R A;  3DJC A;  2KHO A;  5C10 A;  4CW7 B;  3C6A A;  3DLB A;  2YHW A;  4PHT X;  1BOT O;  4ILH A;  3SCX A;  4IFE A;  3NMU A;  1G99 A;  2X6N A;  3VER A;  2FF3 B;  4YNQ A;  1WLJ A;  3K5M A;  2FF6 A;  1RFQ A;  1SUQ A;  4JKF A;  5LMN K;  2ETJ A;  4H8K A;  3AVA A;  3W0L A;  4DQ8 A;  3H3O B;  4I6M B;  4BRO A;  2HF4 A;  5DMR A;  1D5A A;  4CJ3 A;  1EXQ A;  4DR3 K;  5C12 A;  1VQK N;  2HBM A;  1GLC G;  1D4X A;  5AQW A;  1RBS A;  3TAB A;  1UWB A;  2P9K A;  1TAU A;  1X3N A;  5C2F A;  4FWL A;  4KKO A;  2HST A;  3ZEU B;  4DG1 A;  4LC9 B;  4JI7 K;  3VQB A;  1EWQ A;  1L3T A;  4CZL A;  4JKG A;  4IO8 A;  2HVH A;  4DTJ A;  1S6P A;  1B9D A;  2W6K A;  3CG7 A;  5TKY A;  4FLX A;  3F2K A;  4IOC L;  3M8R A;  4PQU A;  2HMI A;  4BC4 A;  2OPS A;  4GW6 A;  3F5T A;  4LF8 K;  3SPZ A;  2GWK A;  3CCS N;  1SAZ A;  2NRR A;  3QES A;  1ZYQ A;  4CHQ A;  1J6Z A;  3M3Z A;  1VQ9 N;  1A5W A;  4PL8 A;  4M3Y A;  2FSN A;  4FOI A;  4EHT A;  1JLB A;  3QNO A;  1NG9 A;  2PZS A;  3CC7 N;  2P5O A;  2G8V A;  4DQI A;  1IV0 A;  3SAF A;  3L2Q A;  3CET A;  4W5T A;  4KTW A;  4LFB K;  5KPT A;  1LOT B;  2QKB A;  3OYH A;  3CME N;  4H0O A;  4I2Q A;  4JD2 B;  3T69 A;  3EN9 A;  2W41 A;  4EIA A;  2E6L A;  3G0Z A;  4O8U A;  3SUP A;  2V7Z A;  2CGK A;  4CHY A;  2FBY A;  2HBL A;  4CZH A;  2V7Y A;  2Q2R A;  1TL3 A;  2O8B B;  4IDH A;  4CHP A;  3IS9 A;  4RW9 A;  4A2B A;  4JKE A;  4WQ5 A;  2V52 B;  4OPJ A;  3KWI A;  1XMQ K;  4AM7 A;  1NK5 A;  2P9S A;  3NF9 A;  3DI6 A;  3VEV A;  4UQG A;  2Y1J A;  2YHX A;  4CEE A;  5KI6 A;  1RDD A;  4DV5 K;  3TTD A;  1BCM A;  4YOU A;  3IDH A;  3HOT A;  4BRI A;  3N4Q A;  5CE3 A;  1NGD A;  4FJ8 A;  1RBT A;  3UE5 A;  4CER A;  4M63 C;  3SMS A;  1NJI O;  2A41 A;  4LH5 A;  5SWM A;  2ZM6 K;  2HHW A;  4WF9 L;  1QHA A;  4Z4G A;  3E9P A;  4BRA A;  3QIN A;  2HOE A;  5E84 A;  5AZI A;  3KTQ A;  1RDA A;  3DLR A;  3KD5 E;  4FWM A;  3TWH A;  1O1W A;  3U9Z A;  4CJU A;  3QIP A;  2I7N A;  3RTV A;  4LF7 K;  2KZZ A;  1WAJ A;  4CF2 A;  3DLE A;  3FZH A;  4CVN E;  4CJV A;  2IS3 A;  1QTM A;  4ISE A;  3SAG A;  3M6G A;  3S3O A;  4K0K K;  3E66 A;  5M1K A;  1E4F T;  4CFB A;  2VYP A;  5JS2 A;  1S1X A;  3LPT A;  4A5A A;  2ZGZ A;  3AA2 A;  2P9K B;  1HNX K;  2HBK A;  1BG3 A;  1ATS A;  5FDL A;  4BE1 A;  1IKW A;  1RT7 A;  4JKH A;  3LP3 A;  4XEI A;  2G8K A;  3MDQ A;  3AGR A;  3OTO K;  4FK2 A;  2EHG A;  3FFK B;  3VMF B;  3OYB A;  4JKG B;  4MO4 A;  2YI1 A;  3RR8 A;  1JLQ A;  4CIF A;  3EYZ A;  2P5G A;  1YVU A;  4CGI A;  1U6Z A;  2QWL A;  3SV3 A;  4BAC A;  1QS4 A;  4IBN A;  1GLB G;  1HLU A;  4WFN L;  1Q7Y O;  3AAQ A;  2O8D A;  4YOR A;  1VSI A;  4I2P A;  3L3U A;  2GUP A;  2QWR A;  1VAZ A;  4CHZ A;  3HXM A;  3QEW A;  4B9V A;  3MCP A;  5FPN A;  3VF2 A;  1KD1 O;  4JN4 A;  3IMX A;  3O9T A;  5AQU A;  1HNI A;  1KFD A;  3CCU N;  4CBW A;  4QCL A;  1REV A;  3O4Q A;  1VHX A;  4BRG A;  5ELZ A;  3TAF A;  4X66 K;  1B92 A;  5FPD A;  3WT0 A;  3QLH A;  4M41 A;  3AO5 A;  3F9K A;  3ID6 A;  4W5N A;  1VSJ A;  3HT3 A;  4H03 B;  4WQ4 A;  4QS8 A;  4FCY A;  3QFP A;  1NJZ A;  2VWK A;  3O4W A;  2ZJR L;  4CJ5 A;  3MEC A;  3RVC A;  1K9M O;  4DHY A;  4B9U A;  4BG9 A;  5KPR A;  2QKK A;  4ILG B;  4FJM A;  4KHN A;  4BDZ A;  3ITH A;  3ZSR A;  1Q8I A;  3V81 A;  3MK6 A;  4FZX C;  3A8Y A;  4FLV A;  1CXQ A;  1RDC A;  3VEW A;  4WQ4 C;  4FYD A;  3DWL A;  1HNW K;  2BH1 A;  3HK2 A;  1N8R O;  3AO2 A;  2P9S B;  1NM1 A;  3E9L A;  2HMP A;  2D0A A;  4DLG A;  4C8M A;  4FWN A;  2KFN A;  3V9U A;  1GLA G;  3TI0 A;  2Z1H A;  4FK4 A;  3VEX A;  1NGA A;  3VEY A;  2YNH A;  4DF4 A;  4MQ3 A;  3K9K A;  4ELT A;  5HRN A;  4LSL A;  3ZLJ A;  2HHS A;  2GBZ A;  1T8E A;  3D2E B;  1TGO A;  5EXW A;  3FZF A;  3V1Q A;  3WNF A;  4HWI A;  3L4I A;  3V9W A;  3VQ4 A;  1X9J A;  2QXL A;  3WEE A;  1Z6R A;  1YI2 N;  3Q7B A;  4DR7 K;  3CPE A;  1T6D A;  4E89 A;  5CYQ A;  3H1V X;  2W42 A;  3HI0 A;  1C0F A;  4B3R K;  3M8Q A;  4M3Z A;  3M5R A;  1BCO A;  3V1O A;  1N34 K;  1HR0 K;  3A5L C;  4CK1 A;  2FC0 A;  4EHU A;  3KD1 E;  1QHT A;  4E1N A;  4J2A A;  2ZE2 A;  4DTR A;  1CLQ A;  3AY9 A;  1YJN N;  4JI8 K;  2HND A;  5CYM A;  3LP1 A;  1BA1 A;  1KLM A;  4DTN A;  4DR6 K;  1GLJ O;  3O9R A;  2X74 A;  5KGW A;  1YIT N;  1HX1 A;  1ILY A;  2ZF5 O;  4KHW A;  4KFB A;  1RDW X;  4GY2 B;  3BY5 A;  4LSN A;  4CJK A;  4IG3 A; 
#chains in the Genus database with same CATH homology
 3IG1 A;  2KW4 A;  1SL1 A;  1WNS A;  4LD0 A;  4KPY A;  1T7P A;  5KRT A;  1ZBI A;  2R7Y A;  3LDS A;  1VSL A;  3QEV A;  4FXD A;  4DTP A;  1XC9 A;  1TK0 A;  3E01 A;  2QK9 A;  1QE1 A;  3FFI A;  1X9S A;  4FZZ A;  5J2M A;  4CF9 A;  5HRP A;  3OS1 A;  3KLH A;  4CK3 A;  5J2P A;  2HB5 A;  2IAJ A;  3B6O A;  3RMB A;  1VSK A;  1GOA A;  4MFB A;  2DTU A;  3OYA A;  4CEC A;  3PO4 A;  1JKH A;  4B9L A;  4CEO A;  4NCA A;  1YTU A;  3I0S A;  4CEB A;  4OPK A;  4F3O A;  2WOM A;  4Z4C A;  1NJX A;  1L3U A;  2XO7 A;  3OYK A;  4DSE A;  1VSE A;  4HCC A;  4DQS A;  2DFE A;  4FVM A;  3SUQ A;  1JL2 A;  1ZBL A;  3F73 A;  4Z0U A;  1RBR A;  3C6T A;  3JSM A;  4CJF A;  4CIG A;  4K8X A;  4PA1 A;  5DK5 A;  4EP4 A;  1RTH A;  1RT3 A;  3QNN A;  1L3S A;  4KAZ A;  2NUB A;  4KRF A;  4Z4F A;  1VSF A;  3LZI A;  4O0I A;  3NCI A;  4IFV A;  4L8R B;  2E6M A;  4B3O A;  3VQ7 A;  4CJE A;  1BIS A;  1IKY A;  4R5P A;  3T3F A;  1U45 A;  3O3F A;  4CEF A;  3ZT2 A;  1J9A A;  3RMC A;  2OA8 A;  4KHU A;  4XIU A;  5C25 A;  1Q9X A;  4J2E A;  1Y97 A;  3I8D A;  3L2U A;  1RT6 A;  2OPR A;  4G1Q A;  1RTD A;  4CJS A;  3OS2 A;  4Y1D A;  3MXJ A;  3SV4 A;  1L5U A;  4AHV A;  3KJV A;  4EZ6 A;  4H4O A;  3LAK A;  3TAE A;  4CES A;  1LV5 A;  2PYJ A;  3TAQ A;  2A1S A;  1S5J A;  3OYF A;  4FM0 A;  1EP4 A;  4GMJ B;  4DSL A;  2Z1I A;  4RG8 A;  3TAR A;  4FJI A;  3HPG A;  4PWD A;  1KFS A;  1NOZ A;  4FJL A;  1EKE A;  1LWF A;  3V9S A;  2YNI A;  1ASU A;  1C0U A;  3VQ6 A;  1QQC A;  3NGY A;  3D0P A;  4CHO A;  4DSI A;  3OY9 A;  5HRR A;  4CGH A;  2IC3 A;  2B4J A;  1NJY A;  5E41 A;  3QEX A;  4CJP A;  3UIQ A;  4H4M A;  2D5R A;  2LSN A;  4FJG A;  3OYJ A;  3QEP A;  1HYZ A;  4CIE A;  3CFP A;  3I0R A;  1T05 A;  1TV6 A;  3P5J A;  1TKX A;  1XHX A;  3QER A;  2ATQ A;  3DLB A;  3CFO A;  5KRS A;  4CEZ A;  4AHS A;  1HYS A;  5SZT A;  3SCX A;  2XRI A;  2YNF A;  1A5V A;  4CGJ A;  4O0J A;  3SYZ A;  4C8K A;  4ZTF A;  4FK0 A;  2VG5 A;  3ZT1 A;  4CJT A;  2X6N A;  1RTI A;  4B9S A;  4YNQ A;  1WLJ A;  3K5M A;  4DTU A;  3PX0 A;  3T1A A;  4KB1 A;  4NCB A;  3H08 A;  4Z4E A;  1SUQ A;  4DS4 A;  4Y1C A;  1VSH A;  2ETJ A;  4H8K A;  3AVA A;  5JS1 A;  1IKX A;  1WSE A;  1RBV A;  3TAP A;  3AVN A;  4CFD A;  1WSI A;  1I3A A;  1FKP A;  1JLG A;  4BE2 A;  4HUF A;  3VQE A;  3AVJ A;  1D5A A;  5DMR A;  3KKS A;  1CZ9 A;  4CJ3 A;  2P51 A;  4E3S A;  1X9M A;  1J5O A;  1EXQ A;  4IDK A;  1FXX A;  1EX4 A;  1QSS A;  4OLB A;  3M8S A;  4DFK A;  4O4G A;  2JGU A;  5D3G A;  2KFZ A;  3AVG A;  4FLZ A;  4OGC A;  1KVA A;  3DOK A;  3AVL A;  3NGZ A;  1RBS A;  4AHC A;  4HHT A;  3WNH A;  3TAB A;  4C8N A;  1ZBU A;  3EY1 A;  2RKI A;  4KI6 A;  1NK4 A;  4ZHR A;  3PV8 A;  4FJ9 A;  4F4K A;  4J2D A;  1UWB A;  4ID5 A;  1NK8 A;  3L3V A;  3VQ9 A;  4FLW A;  4KI4 A;  1TAU A;  3MEE A;  4FLU A;  1S9G A;  1A5X A;  4KKO A;  4KTZ A;  1FK9 A;  3WNG A;  3ZCM A;  3QO9 A;  4AHU A;  1NK0 A;  3DRP A;  4M3T A;  3SJJ A;  4DG1 A;  3DYA A;  2DY4 A;  3P83 D;  3VQB A;  4PUO A;  1L3T A;  2IGI A;  4FM2 A;  2IOC A;  2HVH A;  1BI4 A;  3NBP A;  1S6P A;  4DTJ A;  4DQR A;  1B9D A;  1UAX A;  3RMA A;  3HJF A;  3CG7 A;  3SQ0 A;  4FLX A;  2HVI A;  1WN7 A;  3M8R A;  4PQU A;  1VK0 A;  3CM5 A;  2HMI A;  2YHA A;  4QOZ B;  2OPS A;  4GW6 A;  1BGX T;  1ASW A;  3DLK A;  4OKJ A;  4BDY A;  3SPZ A;  3S9H A;  4FM1 A;  2G8H A;  4GVM A;  2E4L A;  3LWL A;  3DLH A;  4FJ7 A;  4K8Z A;  4YFU A;  1KCF A;  4C8L A;  1HQE A;  3HP6 A;  1LWC A;  4NYN A;  3ZT3 A;  4QAG A;  2VG6 A;  2ZD1 A;  4DTO A;  3QES A;  4DS5 A;  1ZYQ A;  4N76 A;  4CHQ A;  1N6Q A;  1KTQ A;  1J54 A;  4O5B A;  1A5W A;  3IRX A;  4M3Y A;  2GUI A;  3A2F A;  5HRO A;  3QNO A;  1XI1 A;  4AHR A;  1JLB A;  3AVF A;  2PZS A;  3IAY A;  2QXF A;  3HL8 A;  2P5O A;  3TAN A;  4DSK A;  4KB0 A;  2G8V A;  4DQI A;  1SKW A;  3L2Q A;  4DFP A;  1CZB A;  3AVK A;  4M45 A;  3DM2 A;  4OKE A;  2D0B A;  4F8R A;  1RDB A;  1DTQ A;  4W5T A;  3K2P A;  4KTW A;  4O44 A;  3L2V A;  1NOY A;  2QKB A;  3LAM A;  4WE1 A;  3SQ4 A;  1TKZ A;  4TSX A;  2G8U A;  3O4N A;  4DSJ A;  3NH0 A;  1B9F A;  3OYH A;  3K5O A;  4I2Q A;  3T19 A;  2KQ2 A;  3K57 A;  3VN5 A;  3V9X A;  2XY5 A;  1I39 A;  2P1J A;  3OYD A;  2XHB A;  4E7H A;  4J2B A;  4HUE A;  4B08 A;  1RT2 A;  2E6L A;  3G0Z A;  3SZ2 A;  1QSY A;  1BHL A;  2DFH A;  2YKN A;  3KK1 A;  4DFJ A;  3SUP A;  4CHY A;  3RMD A;  1DLO A;  4KO0 A;  2FBY A;  1NKC A;  4DTX A;  4Z4H A;  3VQ8 A;  5HRS A;  4ID1 A;  3ULD A;  3CFR A;  3HVT A;  1TK5 A;  1TKT A;  4CED A;  1TL3 A;  4CHN A;  3NF7 A;  1FKO A;  2GV9 A;  1RBU A;  4CHP A;  1BQN A;  3IS9 A;  4RW9 A;  4FLY A;  4DTS A;  2X6S A;  5J2N A;  4CJQ A;  3S3M A;  3OYG A;  3HM9 A;  1U04 A;  4OPJ A;  1HJR A;  1LWE A;  4C8O A;  2RPI A;  1MU2 A;  2BGG A;  1T03 A;  3RWU A;  1NK5 A;  1RT5 A;  2G8W A;  2HHX A;  1K6Y A;  4E7K A;  3NH2 A;  4KHY A;  3S3N A;  3ZT4 A;  3NF9 A;  3AA5 X;  3DI6 A;  4UQG A;  2Y1J A;  1HNV A;  3VQD A;  3QET A;  3BGR A;  4B9N A;  4Q0B A;  4DSF A;  4CEE A;  2PYL A;  5KI6 A;  1CXU A;  4W5Q A;  4RW7 A;  1TL1 A;  3AVI A;  3VQP A;  2HHV A;  1GOC A;  1DTT A;  1SL0 A;  1RDD A;  4ICL A;  3V9Z A;  3SPY A;  1LAV A;  1RIL A;  1WSF A;  1BCM A;  3HP9 A;  4OJR A;  3MXI A;  1Q9Y A;  1RT1 A;  4FJH A;  4I9L A;  1C1C A;  2YV0 X;  3JYT A;  1U4B A;  4RW6 A;  1D9D A;  4FJ8 A;  4B8C A;  2G8F A;  1RBT A;  3U3Y A;  4CER A;  2FBT A;  4CJL A;  3B6P A;  2OPP A;  1U49 A;  4LH5 A;  5SWM A;  2HHW A;  2HW3 A;  3M8P A;  2X78 A;  3PX6 A;  1D9F A;  4Z4G A;  3SI6 A;  4E19 A;  3QIN A;  1KVB A;  4I9Q A;  3OS0 A;  3KTQ A;  2ZQB A;  1RDA A;  3DLR A;  3KD5 E;  3D45 A;  3TWH A;  5FRN A;  3L2R A;  1IKV A;  4FJX A;  1O1W A;  3ZSX A;  4JS4 A;  4F2S A;  1VRT A;  1TVR A;  2FBV A;  3QIP A;  4CJU A;  3DRS A;  1U48 A;  3RTV A;  4KHS A;  4N56 A;  3O3G A;  3KK3 A;  3SUO A;  3NGI A;  2KZZ A;  1WAJ A;  4CF2 A;  3NF6 A;  1X9W A;  3DLE A;  4FW1 A;  4N41 A;  3AVB A;  5HP1 A;  3VQC A;  3QEI A;  4CJV A;  1W0H A;  2IS3 A;  1QTM A;  3VQA A;  4JLH A;  1EET A;  2WON A;  2HHU A;  4M3X A;  3S3O A;  1Z25 A;  3PO5 A;  4RW4 A;  4FLT A;  1BQM A;  3LP0 A;  3ZT0 A;  4CFB A;  3SQ2 A;  5JS2 A;  5HLF A;  1S1X A;  3AA4 A;  1RTJ A;  3LPT A;  4DLE A;  4KTQ A;  4AHT A;  1TKD A;  4CEA A;  3AA2 A;  4NCG A;  4NYF A;  3ZSQ A;  3OYE A;  4BWJ A;  2OZM A;  5FRM A;  4DMN A;  2HNZ A;  1NJW A;  3RRG A;  5FDL A;  1YT3 A;  2Q3S A;  4BE1 A;  4DU3 A;  1IKW A;  1RT7 A;  4IG0 A;  4DU1 A;  3LP3 A;  2G8K A;  2BDP A;  3CM6 A;  3ZSO A;  4KRE A;  1HRH A;  4Z4I A;  3KLI A;  1UA1 A;  3DMJ A;  2EHG A;  4FK2 A;  4CJW A;  3OYB A;  3SQ1 A;  3RR8 A;  1BI4 B;  1HYV A;  1JLQ A;  4OVL A;  4CIF A;  3EYZ A;  1TAQ A;  3OJU A;  2P5G A;  3AVC A;  3K5N A;  1YVU A;  4CGI A;  3HST B;  1L3V A;  4M3U A;  3LAL A;  3ZSZ A;  1SKS A;  4B9M A;  2KZM A;  4CF0 A;  3SV3 A;  3L2W A;  4JRQ A;  1RCH A;  4BAC A;  2IDO A;  1QS4 A;  2OPQ A;  4IBN A;  4CCH A;  3MAQ A;  5T7B A;  3U3G A;  1YTA A;  4CGD A;  1VSI A;  4W5O A;  4I2P A;  3L3U A;  1HQU A;  1NKE A;  1ITG A;  1ZBH A;  3C94 A;  3V4I A;  4CK2 A;  3AVM A;  5CZ2 A;  4DWI A;  3OYL A;  1XHZ A;  4CHZ A;  3HXM A;  3QEW A;  4B9V A;  4IFY A;  3HO1 A;  4CE9 A;  3LPU A;  1C0T A;  4BDP A;  5CZ1 A;  3THV A;  1NK6 A;  4HVJ A;  2B6A A;  3OJS A;  3PX4 A;  4CEQ A;  2DFF A;  1SKR A;  1JXE A;  1S1V A;  3K58 A;  3BDP A;  1HNI A;  1KFD A;  4QCL A;  1JLC A;  1REV A;  3O4Q A;  2F8S A;  1BL3 A;  1Z26 A;  2Y1I A;  3VA0 A;  3PUF A;  3VQQ A;  5J1E A;  3LZJ A;  3TAF A;  3LP2 A;  4N47 A;  1B92 A;  3CQ8 A;  1QSL A;  3AVH A;  3KLF A;  2XY7 A;  3QLH A;  4M41 A;  4CGG A;  3AO5 A;  1R0A A;  4CF8 A;  2F8T A;  3AO1 A;  4HTU A;  3F9K A;  3VA3 A;  4W5N A;  4M3R A;  4DU4 A;  2KTQ A;  1HMV A;  1S9E A;  1VSJ A;  3HT3 A;  4JRP A;  4KHQ A;  1WSJ A;  4B8A B;  1BIU A;  4FCY A;  4FZY A;  2A1R A;  1NJZ A;  2VWK A;  4CJ4 A;  1S1T A;  4CJ5 A;  2FBX A;  3MEC A;  4OGE A;  3L8B A;  2YKM A;  3KLG A;  1NKB A;  4B9U A;  4DF8 A;  4M3W A;  3NH1 A;  2ITG A;  4DTM A;  3VQ5 A;  4DQQ A;  1F21 A;  2EX3 A;  4E7L A;  1S1W A;  2QKK A;  3AV9 A;  4FJN A;  2BE2 A;  1NK9 A;  3ASM A;  1VSD A;  4FJM A;  1SL2 A;  3ZSW A;  1ZBF A;  3RR7 A;  2B5J A;  4KHN A;  2AJQ A;  1G15 A;  4BDZ A;  3ITH A;  3ZSR A;  1Q8I A;  3V81 A;  1ASV A;  1KVC A;  4FZX C;  4FLV A;  1CXQ A;  4N5S A;  1RDC A;  4FW2 A;  1WSH A;  1XWL A;  3EZ5 A;  4E7J A;  2RF2 A;  1UA0 A;  1JLF A;  1N5Y A;  4HCB A;  4ZTJ A;  4FYD A;  3WNE A;  4W5R A;  3HK2 A;  2HHQ A;  4HUG A;  4O55 A;  3AO2 A;  4FJK A;  2XY6 A;  4F2R A;  1JLA A;  2D0A A;  5C42 A;  4DFM A;  3V6D A;  3U6F A;  1IH7 A;  4DLG A;  4C8M A;  3MXM A;  4PY5 A;  2KFN A;  4E1M A;  1HPZ A;  4Q5V A;  3ISN C;  3C95 A;  3K5L A;  1KRP A;  3V9U A;  3CYM A;  3ALY A;  1LW2 A;  3OYM A;  3KLE A;  4AH9 A;  3TI0 A;  1NK7 A;  1D8Y A;  1KLN A;  4KV8 A;  1X1P A;  1SV5 A;  3HPH A;  3SNN A;  2Z1H A;  4FK4 A;  4CGF A;  3O3H A;  1LAW A;  5HBM A;  3C6U A;  1J53 A;  3NE6 A;  1C0M A;  1JLE A;  1LW0 A;  1W9H A;  1WSG A;  2YNH A;  2Z1G A;  5KGX A;  4F3T A;  3NHG A;  4I7F A;  3NF8 A;  4DF4 A;  4MQ3 A;  4ELT A;  3AA3 A;  3DRR A;  3V1R A;  4LSL A;  5HRN A;  2BAN A;  3ZSV A;  3PY8 A;  2HHS A;  2G8I A;  3DOL A;  2VWJ A;  4RW8 A;  2GBZ A;  4LY7 A;  2Z1J A;  5EU7 A;  1T8E A;  1TGO A;  3RRH A;  2OZS A;  3LWM A;  3V1Q A;  3KIO A;  3WNF A;  2HHT A;  4CF1 A;  3V9W A;  3G10 A;  2D0C A;  3VQ4 A;  3OVN A;  1JL1 A;  3OYC A;  4EZ9 A;  1WAF A;  1IO2 A;  2F96 A;  3NAE A;  3P1G A;  3QIO A;  5K14 A;  3DLG A;  4E0D A;  1VRU A;  4ELU A;  3KKR A;  1RT4 A;  2VG7 A;  2OYQ A;  4E89 A;  5CYQ A;  1C1A A;  2W42 A;  3HYF A;  1KSP A;  1C1B A;  3SUN A;  1U47 A;  4B9T A;  3ZSY A;  5I42 A;  3AO3 A;  2XY8 A;  1S6Q A;  3OYI A;  4CFA A;  4FJ5 A;  3M8Q A;  3MEG A;  3OYN A;  4M3Z A;  3TAG A;  2HNY A;  5I3U A;  3AO4 A;  1BCO A;  3V1O A;  2YNG A;  5C24 A;  4EP5 A;  2JLE A;  2I5J A;  1IG9 A;  4M42 A;  4BWM A;  4CJR A;  4CK1 A;  2FC0 A;  4LH4 A;  4IKF A;  3KD1 E;  4CFC A;  2RN2 A;  2O4I A;  5J2Q A;  1QHT A;  4E1N A;  1TK8 A;  4J2A A;  2YHB A;  2ZE2 A;  4DTR A;  4FJJ A;  1CLQ A;  3KK2 A;  4OLA A;  4DQP A;  3NDK A;  3LAN A;  3NFA A;  3TAM A;  1RNH A;  1GOB A;  2HND A;  5CYM A;  3LP1 A;  1S1U A;  4BE0 A;  3HVR A;  4AIL C;  3MED A;  1C6V A;  5CY4 A;  2PY5 A;  1KLM A;  3TR8 A;  4DTN A;  1JXB A;  2X74 A;  2O4G A;  5KGW A;  1BIZ A;  4OKK A;  3K59 A;  5KTQ A;  4KHW A;  5FRO A;  4KFB A;  4JS5 A;  1UOC A;  4LSN A;  4ELV A;  4E7I A;  4CJK A;  4IG3 A;  3HPO A;  1VSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...