4CEBA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cebA00
2G8WA 3PY8A 5FRMA 3CM6A 3ZSRA 3HPGA 3K5LA 4Z4GA 3M8PA 3AA3A 1KLMA 1KVCA 3VA3A 1JL2A 4LY7A 4CJPA 4ID1A 3V9XA 4E7JA 4LSNA 1RDCA 1N6QA 4HVJA 1LW0A 1ITGA 2IDOA 1BL3A 4Z4CA 5FDLA 4B9SA 3MXJA 4DG1A 5EU7A 1KSPA 1KRPA 4O0IA 4KREA 1NOYA 3V9ZA 4FW2A 1R0AA 1KFDA 2E6LA 2OA8A 3AVJA 3TABA 1D8YA 3ALYA 5J2PA 4I9QA 5KI6A 4HUEA 4ZTFA 3S3OA 1D9FA 1EX4A 4FLYA 1YTUA 5J2MA 3NFAA 1SL2A 5K14A 2Z1JA 3VQEA 2PYJA 1K6YA 5SZTA 2HVHA 3TAPA 3OYDA 4KI4A 3KIOA 1GOBA 4NYNA 1UA1A 3NDKA 3AVBA 3SQ1A 5HLFA 3SUNA 4DTNA 3HP9A 4E7HA 2RN2A 2WONA 1RBTA 4DU4A 1DTTA 3DLHA 4O0JA 4KB0A 4CGIA 1NJYA 3AA5X 2OYQA 3QLHA 2HB5A 2O4GA 2G8KA 3MEDA 1RNHA 3ZT3A 5KGWA 2QKKA 4KHQA 1L3VA 3OYNA 3JYTA 4HCBA 3SI6A 3KLGA 1JLQA 1WNSA 4JRQA 2BDPA 1TK0A 3P5JA 3QIPA 4Y1CA 1RDBA 4HTUA 5E41A 3DI6A 1FKPA 4CEBA 1C0TA 2P5OA 3OS1A 3TAQA 1NJZA 2VG6A 3M8SA 1XHXA 3H08A 1B9DA 4PUOA 4CJSA 4CF2A 1S9EA 4AILC 4B08A 2X78A 3S3MA 3ZSVA 1RTHA 4KHNA 1JL1A 4KAZA 1RDAA 2IS3A 3HPOA 3V4IA 4KO0A 4M42A 1C6VA 3O4NA 4E3SA 4J2EA 3ZT4A 4QCLA 4B8CA 1XWLA 4RW7A 5DMRA 5HRPA 4E1NA 2VG5A 3LAMA 4DTXA 1IO2A 2OPQA 3HSTB 4EZ9A 3UIQA 1Z26A 1RT7A 1Z25A 1ZBIA 3DLRA 2OPRA 3TAGA 1SKRA 4CCHA 4DTPA 1N5YA 3NE6A 1TK8A 3ISNC 4ELVA 2XY6A 3VQ7A 3V1OA 5JS2A 3DRSA 3NBPA 2DFEA 3ZSZA 3TAMA 3KLFA 3KKRA 4PQUA 1WSHA 4I9LA 4DQSA 5SWMA 4CHNA 2A1SA 4RW6A 5HRSA 4FJHA 3SCXA 4RW4A 1CZ9A 2VWKA 3CM5A 3HJFA 1RT6A 3I0SA 4Z0UA 2ZQBA 3OYEA 3ZSQA 4CHZA 3PO5A 1IKXA 2PYLA 2G8VA 2HNYA 1JKHA 4DTUA 1VRUA 3VN5A 3DYAA 1L3UA 5C24A 3PX6A 3T19A 3M8QA 4I7FA 1U04A 4KFBA 2YKMA 1KFSA 3RR8A 3AA4A 5C25A 3OYBA 3SNNA 4FLTA 3OY9A 1BIZA 1U4BA 1TL3A 1JXEA 4WE1A 3IAYA 3IRXA 3AO5A 1WSFA 3IS9A 4F3OA 3AO2A 4OKEA 2JGUA 3C95A 3CFRA 3SUQA 4CEAA 2QK9A 1TKDA 3C94A 4JLHA 3OYIA 4HUFA 4CF9A 1WAJA 4CHOA 3MECA 3V9WA 3ZSOA 2OZSA 4DF4A 3AVLA 1T8EA 1BQMA 2ETJA 4OGCA 5KRSA 3ZT1A 4DMNA 4IFYA 3EY1A 3AO4A 3KKSA 3ZCMA 1LWFA 4E7KA 4H8KA 1EKEA 1REVA 1S5JA 1TL1A 3KLHA 4CERA 4J2DA 3KD5E 4XIUA 4B9VA 4DTSA 4IG0A 3MXIA 3C6UA 4KV8A 4O4GA 3LP1A 3LP0A 1SUQA 5KRTA 4OLAA 2XHBA 4ID5A 2Q3SA 4FJIA 3DLGA 4KHSA 2Z1HA 4M3TA 2GBZA 2YNIA 4Y1DA 4L8RB 2OPSA 2YHAA 3B6PA 2IGIA 2RKIA 3BGRA 4NCBA 1JLEA 4W5OA 2ZD1A 3V9UA 3V9SA 5J2QA 1B9FA 1BIUA 4OVLA 4GVMA 4FJGA 2WOMA 3KJVA 3OYLA 3A2FA 2KZMA 1YVUA 1RBRA 3AA2A 3OYHA 4M3ZA 2KZZA 3S3NA 1WSEA 1VSIA 2HMIA 1RTIA 3MXMA 4ICLA 4CGFA 2FBVA 4OPJA 4CJ3A 1U45A 1F21A 4OKJA 3NAEA 1CXUA 4AHTA 4CECA 4Z4HA 4FXDA 2PZSA 4KI6A 4N56A 3P83D 3TI0A 1VSKA 3U3YA 2HVIA 3KK2A 4C8MA 1QE1A 1C1BA 3NGZA 3L2WA 3HVTA 4CF1A 1BISA 3OS2A 3TANA 3T3FA 1RCHA 3HL8A 1D5AA 1GOCA 4DTMA 4W5NA 4FZYA 1WSGA 4OLBA 2YKNA 4K8ZA 1TAUA 1JLAA 3B6OA 3NH2A 1BCMA 4DSFA 3AO3A 1I3AA 1RBSA 1B92A 3AVKA 4DSIA 4FZXC 3SQ0A 3SQ4A 3OYKA 1W9HA 3VQ5A 1D9DA 2B5JA 3RMDA 5CY4A 3VQ8A 3VQAA 3OYJA 3DOLA 4FM0A 2HHVA 4CEOA 3AVHA 4HHTA 4CIEA 5HROA 3ZSYA 2XRIA 3I0RA 4DFJA 3KTQA 1TKTA 1BI4B 4DS5A 4HCCA 3DOKA 3HM9A 3CFPA 4FLZA 1VSHA 4FJ5A 4KHWA 3LP2A 4F8RA 4IBNA 3P1GA 2F96A 1NJXA 1LWEA 2IC3A 4RW8A 1HQEA 4BDYA 4C8OA 1EETA 1HYVA 2B6AA 4CJTA 2YV0X 3QETA 3V81A 2LSNA 5J1EA 3HK2A 4FJNA 5D3GA 1BHLA 3SV3A 3NF8A 1VSMA 3CG7A 3VQDA 4AHVA 3AVCA 1X9SA 1T7PA 2HW3A 3HVRA 1WN7A 3MEEA 2X74A 2HHUA 5CZ1A 4CFAA 3AO1A 4B3OA 3WNGA 4CEQA 1ZBUA 1XI1A 4M45A 4OPKA 4BE2A 3V1RA 4DF8A 1RBVA 1CXQA 4CJVA 4W5RA 3RMCA 2EX3A 3ULDA 3QNNA 1KLNA 4DFMA 4FM2A 4DSEA 3AVNA 1JLFA 3NF6A 1C0MA 3QO9A 1J54A 4JRPA 3K5NA 1HNIA 2XY7A 4MFBA 5HP1A 1U49A 2FBXA 4YNQA 4Z4EA 3OYFA 4C8LA 4KTQA 3KLIA 3VA0A 1S1VA 2QKBA 3TAEA 4KB1A 3VQBA 1HYZA 3DRRA 4CEDA 3PO4A 4LH4A 1A5XA 4FJMA 1X9MA 4FLXA 2YNFA 4GMJB 3AVFA 1MU2A 1FK9A 4DFPA 4DU1A 4E19A 5KGXA 1J5OA 3IG1A 1TKXA 1DTQA 1I39A 4IDKA 3RRGA 2G8FA 5FRNA 4CJ5A 1FXXA 3PX4A 3CYMA 1NK4A 4B9TA 3QINA 2X6NA 2P5GA 3QERA 3E01A 2IOCA 3NF7A 4W5QA 4DQRA 1Q8IA 1WLJA 3AVMA 3K57A 4BE0A 4CJUA 3VQCA 2X6SA 4C8NA 3OYCA 2P51A 4CJKA 4B9UA 1RT1A 4M3XA 2F8SA 2OPPA 4RW9A 4BACA 4C8KA 1Q9XA 2KW4A 5JS1A 1QSSA 2G8UA 4Z4FA 3SPYA 1RTDA 1U47A 2YNGA 1C1AA 4E7LA 1C0UA 1W0HA 1Y97A 2JLEA 4O44A 4JS5A 3PUFA 3TWHA 3G10A 1NK9A 3L3VA 3OJSA 1SL0A 2KTQA 3FFIA 3T1AA 3DMJA 4F2RA 4KPYA 4PWDA 4IFVA 3K59A 4JS4A 4FLUA 1UOCA 4LSLA 4KHUA 3V6DA 4FW1A 4DTRA 3HPHA 5CYQA 1S6QA 4FJXA 4KKOA 3LZJA 2G8IA 1LW2A 3KD1E 4CK3A 2FC0A 4O55A 3HP6A 4M3WA 1S1UA 1JLCA 1ASVA 4O5BA 4W5TA 4CEFA 4BE1A 2Z1IA 1VSEA 4AH9A 1EXQA 2FBTA 1QHTA 3F73A 3ZSXA 3QIOA 5CZ2A 3RRHA 1SL1A 4ZTJA 1UAXA 1NK6A 4RG8A 4DLGA 4LD0A 5HRNA 3AVAA 4CK2A 2GUIA 2E4LA 2D0CA 3EYZA 3QEIA 1A5WA 3SUOA 3D45A 1L3SA 4IKFA 4DQPA 1NOZA 5HRRA 3EZ5A 4DS4A 4G1QA 2RF2A 3CFOA 3TARA 2HHXA 2HNDA 1WSJA 3DM2A 4DLEA 4OGEA 3RMBA 3SUPA 3S9HA 2VWJA 3NCIA 2DTUA 5T7BA 2XO7A 4FJ9A 3DLBA 1TKZA 4OJRA 5CYMA 3QEWA 3LANA 4DSJA 3JSMA 3LWMA 1BI4A 1UWBA 4KTZA 4CJQA 3RR7A 4CFBA 4CHYA 5I3UA 2G8HA 1LAVA 4I2PA 4DTJA 2B4JA 4FLWA 4B9LA 4CF0A 1S1TA 4F3TA 2P1JA 4CGHA 4E7IA 2E6MA 3VQ4A 4CHPA 4EP5A 1L5UA 2VG7A 5FROA 1NK8A 1ZYQA 1L3TA 2OZMA 4N76A 4F4KA 3QEPA 1QQCA 1TVRA 2IAJA 4BDPA 2HNZA 3LZIA 3RTVA 3HXMA 3MAQA 3D0PA 2R7YA 1TAQA 3QEXA 4B9NA 1S1WA 1KVAA 1VSDA 2BANA 2BE2A 1O1WA 2FBYA 4KRFA 1HYSA 4CJFA 3AVIA 1HJRA 4FYDA 4CJLA 4K8XA 3LPUA 1RT3A 4ELTA 3WNEA 3L2RA 4UQGA 3WNFA 3LPTA 1YTAA 3LP3A 4FJ8A 4Z4IA 4J2AA 2DFFA 1G15A 3NGIA 3SYZA 4DSKA 5I42A 1NK0A 4CIFA 1SKWA 3VQPA 4J2BA 3M8RA 1ASWA 4ELUA 2XY8A 2ZE2A 3RWUA 5HBMA 1GOAA 4E89A 2Y1IA 4NYFA 1Q9YA 3ITHA 1T03A 1S1XA 3O4QA 3ZT2A 2Z1GA 4FVMA 4CJWA 3PX0A 3OS0A 3KK3A 1C1CA 3L8BA 1TK5A 1NKBA 2DFHA 1X1PA 1CZBA 4E1MA 2KFZA 2I5JA 1VSLA 1HQUA 4AHRA 4CK1A 1FKOA 1KVBA 4CJEA 1IG9A 4I2QA 4MQ3A 1UA0A 3VQ9A 4NCAA 4CGDA 3AV9A 4EP4A 4F2SA 4CESA 4FJJA 4FK2A 1YT3A 1A5VA 3SPZA 3BDPA 4FK0A 1JLGA 1RBUA 4BWMA 4CIGA 4AHSA 1X9WA 1NJWA 2ATQA 4KHYA 4N41A 3O3GA 2AJQA 4DSLA 3KLEA 3K5MA 4FJ7A 3OYMA 3OJUA 3K58A 3L2VA 1RTJA 4AHUA 2YHBA 3ASMA 3WNHA 4DQQA 3NHGA 4H4MA 3CQ8A 3VQQA 4N5SA 2HHWA 3KK1A 3NH0A 3HT3A 5C42A 5KTQA 4CF8A 4FZZA 4QOZB 1VK0A 2HHQA 4KTWA 1VSFA 2D0BA 1S9GA 2KQ2A 3L3UA 2GV9A 2W42A 2Y1JA 4BDZA 2XY5A 3THVA 1JLBA 4DWIA 2DY4A 3G0ZA 1ASUA 4YFUA 2NUBA 4IG3A 2QXFA 1TV6A 4FJKA 1WSIA 2HHSA 1RDDA 2O4IA 4DFKA 4PY5A 1RT4A 4FCYA 3C6TA 1NK5A 3SZ2A 1EP4A 4DTOA 3ZT0A 4TSXA 3LDSA 1WAFA 4PA1A 3L2UA 4CEZA 1ZBHA 1SV5A 3L2QA 4N47A 3U6FA 2RPIA 3QEVA 3NF9A 2ITGA 1NK7A 1RT5A 1CLQA 1RILA 4DU3A 4BWJA 4CJRA 1HMVA 3SV4A 4M41A 1RT2A 2YNHA 3VQ6A 3PV8A 1HPZA 1U48A 2PY5A 2BGGA 4NCGA 3NGYA 3QNOA 1XHZA 1IKVA 1QSLA 3NH1A 2HHTA 1BQNA 3I8DA 3TAFA 3K5OA 3ZSWA 3K2PA 3TR8A 3HYFA 4Q5VA 3OYGA 2F8TA 1IKYA 3SQ2A 3SJJA 1SKSA 1S6PA 4M3RA 4FLVA 3F9KA 4R5PA 1HRHA 3QESA 1KCFA 2A1RA 4Q0BA 1JXBA 3HO1A 1ZBFA 3MEGA 4CJ4A 1LV5A 1NKCA 1IKWA 1LAWA 5DK5A 4CFCA 1ZBLA 1BCOA 1QSYA 4DQIA 2EHGA 1XC9A 1NKEA 3O3HA 1KTQA 1T05A 1QS4A 4CEEA 4CGGA 4AHCA 3OVNA 2D0AA 2KFNA 4CFDA 1DLOA 3AVGA 1VSJA 1VRTA 1J53A 3LAKA 4CGJA 3LALA 4H4OA 4OKKA 1TGOA 3DRPA 1J9AA 4CHQA 3LWLA 4B9MA 4FM1A 3RMAA 1QTMA 2D5RA 1IH7A 1LWCA 5J2NA 1HNVA 3DLKA 4B8AB 4E0DA 4M3UA 4M3YA 4CE9A 3OYAA 3V1QA 4EZ6A 4LH5A 3O3FA 3DLEA 4QAGA 4FJLA 3U3GA 4ZHRA 4HUGA 4GW6A 4FK4A 1BGXT
chains in the Genus database with same CATH superfamily
3PY8A 3K5LA 2E5LK 1Q86O 1KVCA 4LY7A 2VYPA 1IJJA 1YIJN 4CD1A 4E7JA 1RDCA 2IDOA 1BL3A 4ISGA 1ZC6A 4DG1A 5EU7A 1KRPA 4KREA 4B1VA 4C1NI 4FW2A 4ISFA 3AVJA 2GWKA 5KI6A 5J2MA 2Z1JA 2PYJA 2HVHA 5SZTA 4KI4A 3KIOA 4X62K 5HLFA 4DTNA 2F4VK 3RSEB 3VGMA 4BVOA 4DU4A 4KB0A 2W40A 3AA5X 1I94K 2QKKA 4KHQA 3OYNA 4HCBA 5BPMA 1QQOA 1WNSA 4BRCA 3QIPA 4HTUA 3DI6A 1NGFA 3MX2A 3OS1A 3J81O 2O8DB 3H08A 4PUOA 4CF2A 1S9EA 4AILC 2X78A 4RTFD 4PKHA 3ZSVA 5BPLA 2YJFA 1JL1A 4KAZA 1RDAA 4M42A 3V4IA 3T7ZA 4J2EA 2UUCK 2J4RA 3TPQA 4B8CA 3CC4N 2QWRA 2CH6A 1YXQA 4E1NA 4EZ9A 4GKKK 1ZBIA 3DLRA 4JYAK 4DTPA 3ISNC 4H0OA 1P8ZA 3CMEN 1HUXA 4CZGA 4RW6A 3SCXA 4RW4A 1CZ9A 2VWKA 1S3XA 5F0XA 3ID8A 3I0SA 4CVNE 3PO5A 1X9JA 2PYLA 1VRUA 3PX6A 5AQGA 5C25A 2FSKA 4FLTA 3OY9A 1TL3A 4WE1A 3IRXA 4BRFA 3SUQA 2QK9A 4JLHA 3OYIA 4CF9A 4U67L 3MECA 4LF7K 3V9WA 4DF4A 3VEVA 3WXKA 1T8EA 5C2DA 2ETJA 4DMNA 3LDPA 4IFYA 3EY1A 3AO4A 3ZEUA 2V51B 1RDWX 3I55N 1TL1A 4CZKA 3PSFA 4BRIA 4XIUA 3C6AA 4DTSA 3MXIA 2KKZA 3SAFA 2V7ZA 2XHBA 4ID5A 2Q3SA 1ATNA 4J8FA 1FJGK 2CGKA 2YNIA 4H5RA 2A40A 4PHTX 1JLEA 4NCBA 4K42A 3V9SA 3NMUA 1BIUA 5ADXH 4H0PA 2WOMA 3KJVA 1YVUA 1RBRA 4BRLA 1YITN 3WUHA 3N4PA 1RTIA 3CJ9A 3O9TA 4OPJA 4JK9A 1F21A 4FWMA 2ZJQL 1CXUA 4AHTA 3RSEA 4BR0A 2D1KA 2VQFK 4KH6A 1BISA 4RWTA 1NGDA 2ASPA 1D5AA 4JV5K 3SLCA 3M6GA 5JLFA 5EOYA 1WSGA 2ZGYA 5FPDA 1M1KO 1BCMA 5AQPA 2QEXN 2O8DA 3SQ0A 3BZKA 4OX9K 3VQ5A 3ULEB 2B5JA 3RMDA 3DOLA 4FM0A 4CEOA 2QW9A 3AVHA 3ZSYA 2XRIA 3VEYA 4M63C 4HCCA 4F9OA 3HM9A 3I8BA 2P9NB 2IC3A 4BRKA 1HQEA 1EETA 2B6AA 3V81A 1VSMA 3CG7A 3VQDA 2HHUA 1BUPA 4CFAA 3WNGA 4CEQA 4AQYK 4U7BA 1XI1A 4B3SK 3V1RA 3RMCA 1KLNA 1CXQA 2EX3A 3E1YA 4DSEA 3AVNA 4JRPA 1HNIA 3H3NO 4FO0A 3SBTA 3UKRB 2FBXA 3CETA 1NGJA 4Z4EA 3KLIA 3VA0A 4AM6A 4DR2K 3PO4A 4FWQA 4IDHA 4FLXA 2ASOA 2YNFA 2QWQA 3AVFA 1MU2A 5LJVA 4DU1A 5AJ3K 3J8AA 1DTQA 5M1OA 2P9IB 3VERA 5FRNA 1FXXA 3QINA 2X6NA 3VENA 4B1XB 2PAVA 2FSJA 4DQRA 3OBWA 2NRRA 3OYCA 4GV9A 3VEOA 4CJKA 4M3XA 2F8SA 1YI2N 1RGIA 4DV1K 4C8KA 3VTIA 3TSUA 4Z4FA 2YNGA 1C1AA 3GBTA 3VPZA 3UKUB 3PUFA 3HI0A 4WFBL 1VQPN 1KD1O 2UXDK 4F2RA 4PWDA 4KHUA 4LSLA 3EKSA 4FW1A 4X65K 5CYQA 1LW2A 1HLUA 4JAXA 2FC0A 3MCPA 3HP6A 1VQ9N 1JLCA 3THYB 4O5BA 1YAGA 3FZLA 1KAZA 4WQ4C 4BE1A 1VSEA 2VCPA 2FBTA 4AH9A 3QIOA 5HRNA 3CQYA 4A5AA 4JI5K 2YJEA 4DS4A 2KLAA 5FPEA 2RF2A 5TKWA 1TKZA 5CYMA 3VGKA 3LANA 2GEMA 1LAVA 4CF0A 2P1JA 3OBYA 4CGHA 2E6MA 2P9NA 4CHPA 4JI6K 2VG7A 2OZMA 1TYQB 4H0YB 1QQCA 2IAJA 4A57A 4BDPA 3QEXA 1S1WA 1VSDA 1O1WA 4WQ5C 4CJFA 4DV5K 4JD2B 4FYDA 3R3LA 2V52B 3K9KA 1YTAA 3N4QA 4Z4IA 2DFFA 4ILJA 3NGIA 1K73O 3UKRA 5AQRA 5I42A 1NK0A 3D2EB 3BZCA 5AQYA 1ASWA 2ZWHA 2ZE2A 4ELUA 4CJWA 3LDLA 3MN9A 4BRPA 3L8BA 1TK5A 2JWKA 1NKBA 2KFZA 3QBXA 1IG9A 3BEXA 1U2VB 3O9QA 4GV6A 2P9IA 4EP4A 2O8EB 4BG9A 4H0XB 4DR5K 4CIGA 4H5TA 4M7YA 5KPZA 4DSLA 2A42A 4FJ7A 3FZFA 3OJUA 4H5WA 2YHBA 5BREA 1VAZA 5I9EB 1Q18A 4IEEA 3HT3A 2OTJN 5KTQA 1S22A 4FZZA 2HHQA 1VSFA 3TI0A 1ATRA 3UKUA 2XY5A 1JLBA 2DY4A 1TV6A 1VQNN 4PY5A 4B3MK 4JK8A 2WC9A 3LDSA 1WAFA 4PA1A 1SV5A 4FWNA 3L2QA 3CCUN 3M1FA 4DU3A 3DXKB 2HF3A 3NVMA 3P31A 4M41A 1RT2A 3VQ6A 2YHXA 4FWKA 2PY5A 4BRDA 1QSLA 1BQNA 5AFUH 3K2PA 4LF5K 3TR8A 3HYFA 2F8TA 3HSCA 1K8AO 1XQSC 4NB4A 3F9KA 1IBMK 4BRGA 1JXBA 2E2OA 2Q1NA 1IKWA 4IEIA 1JCEA 5DK5A 3VTHA 3THWB 1ZBLA 4DQIA 2EHGA 1N34K 1HKCA 1R59O 3O3HA 3VEZA 4CGGA 4CEEA 4AHCA 2D0AA 3KWIA 4CFDA 3AVGA 3OHRA 1VSJA 2O8CB 1T6CA 4YOVA 3LALA 4OKKA 1TGOA 1J9AA 3LWLA 1TYQA 3A5MC 4B9MA 2WUSA 5J2NA 3PLAA 4ZHRA 1E4GT 4KH4A 4Z4GA 3M8PA 1Z6RA 1JL2A 1E3MA 4YOUA 1LW0A 1ITGA 4Z4CA 5AQKA 4B9SA 4O0IA 4YDUA 3IMXA 3S3OA 5EVZA 3NFAA 1SL2A 5K14A 5HOOA 1NGBA 4L3QA 4A2AA 3NDKA 3AVBA 1ILYA 1U2VA 3EO3A 2O8EA 5M1PA 4O0JA 5AQUA 1NJYA 3S41A 2HB5A 3O80A 3ZT3A 1N33K 4WQ4A 1L3VA 3JYTA 2I7NA 5JVGL 1RDBA 5E41A 5EX5A 1FKPA 4CEBA 5M1NA 2P5OA 3TAQA 1NJZA 3HRGA 3QFPA 3S3MA 3QICA 3D2FA 1HJOA 4KHNA 3HPOA 3O4NA 4E3SA 4BROA 1V4SA 1XWLA 4RW7A 5ADXA 5HRPA 3C7NB 2VG5A 3LAMA 3HSTB 4QS8A 1RT7A 2QWNA 1Z25A 5C12A 4JKHA 1SKRA 3PIOL 4DR3K 1N5YA 4CCHA 3WT0A 1BG3A 1OH8A 3CPWM 3J7AP 4ELVA 4YOWA 2XY6A 3V1OA 3DRSA 2DFEA 1HNXK 3TAMA 1HR0K 3DXMA 3KKRA 3FLCO 1FW6A 4PQUA 4I9LA 4BC5A 4DQSA 4CHNA 2A1SA 4NXNK 3LM9A 4WQ5A 3CI5A 5BRHA 1GLJO 2G8VA 1N36K 3WEEA 1JKHA 2OTLN 2Q2RA 3DYAA 1L3UA 4I7FA 1KFSA 2YKMA 3SNNA 3THWA 2QM1A 1U4BA 3DWLA 3IAYA 4WYBA 3AO2A 2JGUA 3CFRA 4IFEA 3C94A 4HUFA 1WAJA 2E2QA 2OZSA 3ID6A 1BQMA 4V19S 2O8CA 1GLFO 3C65A 5KRSA 3L4IA 2WFBA 3MMVA 3J80O 5ELZA 4E7KA 4LFCK 1REVA 3MN7A 4CERA 4BR2A 4J2DA 3KD5E 1NGCA 1OH6A 2P9PA 5KRTA 4JI3K 5AQMA 3PSIA 4L8RB 2IGIA 2NRHA 2RKIA 3ATVA 3KZBA 4W5OA 4Z94A 4FJGA 1T6DA 3K9JA 4UY8O 3UE5A 3E66A 3OYLA 2KZMA 2CH5A 3AA2A 2KZZA 1VSIA 4KH5A 2HMIA 4CGFA 2FBVA 2HBLA 1VQ6N 3NAEA 1KAYA 2PFUA 3H6EA 4GVEA 2CGJA 1VSKA 3KK2A 3L2WA 3OS2A 4DV4K 3HL8A 3AAPA 4JKGB 1VQ5N 4OLBA 1TAUA 3MN5A 2A6AA 3NH2A 4JI8K 2F7TA 1RBSA 1B92A 3AVKA 4DSIA 1BWFO 3SQ4A 4GY2B 4CZMA 4YY3K 5CY4A 3OYJA 1XNQK 5JICA 1Q7YO 4K43A 3DOKA 4FLZA 4FJ5A 4GNIA 4F8RA 1K8KB 1EWRA 1H1VA 3ZYYX 2F96A 1VQKN 4YOXA 1Q82O 4RW8A 4C8OA 1HYVA 1NBWA 4IXCA 4K0KK 4AHVA 2OANA 3HVRA 2X74A 3ZETB 4ILHA 4BE2A 4W5RA 3ULDA 1JLFA 1NNEA 1BOTO 3O4WA 2E8AA 1S1VA 3HZ6A 1W7AA 4DHYA 3VF6A 1KAXA 4KB1A 2QWMA 1A5XA 4CBXA 4GMJB 3TSPA 4WF9L 3K0SA 1ESVA 4DFPA 4E19A 1J5OA 4FWRA 4CZLA 3CJAA 3F2KA 1BA0A 4B9TA 4YORA 3E01A 4EHTA 2FF6A 2I7PA 4B1WB 3NVKA 3K57A 2VGMA 2HBMA 3Q7CA 4CJUA 4BE0A 3MK6A 3VQCA 4C8NA 4EAHD 3L6QA 1U6ZA 4C1NK 2P9UB 5JS1A 4CZFA 1RFQA 4LFAK 4E7LA 1C0UA 1Y97A 1YUWA 4O44A 1CZAN 3G10A 3L3VA 3MN6A 2KTQA 3T1AA 4KPYA 1QVFM 4IFVA 3ZX2A 4PL7A 3V6DA 3SMSA 1S6QA 4H0TB 3IDHA 5AQWA 2G8IA 3KD1E 4CK3A 4NLBA 3U4LA 3OTOK 1V4TA 1ASVA 3A0IX 1MA9B 4W5TA 4A5BA 3EN9A 3O1WA 4CEFA 2EWSA 1QHTA 3F73A 1SL1A 4ZTJA 2Q0RA 4FWPA 4RG8A 4LD0A 4DLGA 2GUIA 2D0CA 5JMVA 3SUOA 1A5WA 4IKFA 3ZLJA 3WXMB 1NOZA 3EZ5A 2AP1A 4G1QA 4JKCA 4MO4A 4DLEA 3RMBA 4DV0K 2HMPA 3SUPA 3G71N 3S9HA 4FJ9A 1GLEG 3QEWA 4DSJA 3JSMA 3LWMA 1UWBA 4CJQA 5I3UA 4JKEA 1OVYA 2B4JA 2WBNA 3FZKA 4E7IA 3M5RA 1L3TA 4C23A 3DJCA 3RTVA 2BANA 1SS6A 3AVIA 1HJRA 4K8XA 4H5VA 4UQGA 3HBTA 5AFUA 4FWSA 5AZJB 5E26A 5FPNA 4CIFA 4A62A 1T03A 3ZT2A 3PX0A 1P90A 3OA9A 4FVMA 3KK3A 2ZF5O 3WXJA 1X1PA 1CZBA 4E1MA 4WFAL 2UXBK 4BVPA 4CJEA 3OW2M 4CGDA 3AV9A 4FK2A 4FJJA 5C0YA 3LDOA 3SPZA 4FK0A 1RBUA 4BWMA 5BRDA 2AJQA 3OYMA 3L2VA 1EO1A 3NHGA 3CQ8A 4DR6K 3KK1A 5IT9O 4JI2K 3SAHA 4JKAA 3LDQA 4KTWA 2Y1JA 4GV3A 4DWIA 2NUBA 2BH1A 4FJKA 1WSIA 5LMUK 4DFKA 1HNZK 1SZ2A 4DTOA 2ITMA 3ZT0A 1IBLK 1DGKN 4LFBK 4XH5A 5F2RA 3A5OC 3L2UA 4DV3K 4N47A 3QEVA 5GADP 1HKGA 5LY3A 2ITGA 3J7ZO 1RILA 4YDUC 3AAQA 3SV4A 3E9OA 2YNHA 3O08A 4NCGA 3NH1A 3K5OA 3TTCA 3ZSWA 4H03B 4K25A 3SQ2A 5KPTA 1S6PA 4M3RA 3QESA 1HRHA 2A1RA 4Q0BA 1ZBFA 4EFHA 1NKCA 4CZJA 1QSYA 3CCLN 1BCOA 1JJ2M 1XC3A 1NKEA 2FXUA 1KTQA 4EHUA 1QS4A 5BPNA 4CZHA 4YOYA 4BR5A 4DCHA 4LF8K 1J53A 4DR4K 4H4OA 4DKWA 1KC8O 2Q0UA 2D5RA 3ULEA 4E0DA 3OYAA 4YOTA 1ATSA 4EZ6A 2H3GX 5AQSA 3O3FA 2O8BB 3U3GA 4HUGA 4FK4A 2G8WA 5MLCQ 3ZSRA 2E1YA 3HPGA 1XNRK 1KLMA 2NNWA 5JLHA 1Z05A 4ID1A 3V9XA 4BRQA 4LSNA 1N6QA 5AZJA 3KK7A 5FDLA 3MXJA 3VESA 4BR4A 1KSPA 1GLDG 3MWTA 1QVGM 2P9KB 1R0AA 3FFKB 3CIPA 4ZTFA 1YTUA 1EX4A 4JKDA 3H3OB 3VQEA 1WBBA 1K6YA 4JNEA 3OYDA 1GOBA 4NYNA 1UA1A 3SUNA 3ENHA 3HP9A 4WFNL 4E7HA 4BC3A 2RN2A 3BP8A 2WONA 1DTTA 3DLHA 4CGIA 2OYQA 2O4GA 3MEDA 1RNHA 5KGWA 2W6LA 1JLQA 4JRQA 2ZM6K 4Y1CA 1NM1A 1C0TA 4CBWA 1XHXA 1B9DA 4CJSA 1VHXA 1YJ9N 2NRZA 1RTHA 1SQKA 3I56N 2IS3A 4KO0A 1C6VA 3CF5L 5BRFA 3QDKA 3ZT4A 4DTXA 1IO2A 2OPQA 4B1ZA 2O8FB 4BRNA 3NE6A 1TK8A 4BC4A 5JS2A 3ZSZA 3NBPA 3KLFA 5C2FA 3UB5A 1WSHA 3SBGA 5SWMA 3R8EA 5HRSA 3CM5A 4PKGA 3MCAB 3HJFA 1RT6A 4Z0UA 2IVNA 4CHZA 1IKXA 2HNYA 4JHDB 4DTUA 3VN5A 3THYA 3WXLA 1U04A 3RR8A 3AA4A 3OYBA 2BUPA 1BIZA 3C0BA 5AQXA 1JXEA 3IS9A 3BUZB 4F3OA 4XEIA 3C95A 2UXCK 4CEAA 1TKDA 4B9QA 4CHOA 5GAEP 3ZSOA 3AVLA 1C0FA 4Y0WA 1S72N 1XMQK 4A61A 3ZCMA 1LWFA 4LF9K 3BF3A 3C6HA 1DT9A 4B9VA 4H5NA 4IG0A 3LP1A 1SUQA 3ENBA 1BO5O 2Z1HA 2YI1A 4M3TA 2GBZA 4JKFA 4XH1A 4Y1DA 4BRAA 3BGRA 5J2QA 4CD3A 1DEJA 3B8AX 2P9KA 3A2FA 1TUYA 2RE2A 3GDQA 3GOIA 3F9MA 4JD2A 5BR8K 3OYHA 3SMPA 3S3NA 1WSEA 3CJCA 3MXMA 2YX6A 4ICLA 4CJ3A 4O5FA 3CQXA 3AGRA 2D0OA 4OKJA 3P4IA 4CECA 4Z4HA 4FXDA 2PZSA 2E88A 4N56A 4YHHK 3D2EA 3EKUA 4FPBA 3U3YA 2HVIA 1QE1A 1D4XA 1C1BA 3NGZA 3HVTA 4CF1A 1RCHA 3CHWA 1GOCA 1J5EK 4W5NA 3CMAN 4FZYA 5H1SQ 3EL2A 2YKNA 4A2BA 4K8ZA 1JLAA 4MLEA 4CJ7A 4JI4K 4X64K 2ASMA 4ILGB 4BG8A 4IJNA 3OYKA 1HX1A 3R6MA 1D9DA 2RHKA 3VQAA 1MWMA 1BDGA 4HHTA 1O13A 4CIEA 5HROA 4DFJA 2GTDA 3KTQA 1BI4B 3D6RA 3QFUA 4O8KA 3CFPA 1NGAA 2FLOA 4KHWA 1C0GA 4IBNA 3P1GA 3WQUA 4BDYA 3QETA 1W97L 2LSNA 5J1EA 5IWAK 4FJNA 3TU5A 3NF8A 3SV3A 1VQ8N 1X9SA 3U9DA 2HW3A 1WN7A 5CZ1A 3MX5A 3VEXA 4CJVA 3P39A 3QNNA 3CPEA 4DFMA 4FM2A 2NRTA 1C0MA 3NF6A 3QO9A 3VGLA 4JHDA 3K5NA 2XY7A 5HP1A 3R1XA 4YNQA 3DXKA 3OYFA 1W2BM 4C8LA 4KTQA 4CW7B 1NG9A 3TAEA 1XUPO 2QTDA 4LH4A 1X9MA 1FK9A 1BU6O 3IG1A 3VF2A 1TKXA 5AQNA 3RRGA 2G8FA 4CJ5A 1NK4A 5AR0A 2IOCA 1Q8IA 1WLJA 2F9TA 2X6SA 3O9RA 4B9UA 1YVNA 1RT1A 2VWBA 2OPPA 4IOCL 1Q9XA 2KW4A 5FLXO 2VQEK 2HHHK 4FOIA 1NGHA 3SPYA 4JS5A 1W0HA 3TWHA 5BN8A 1NK9A 3OJSA 1SL0A 1HKBA 5AQJA 2F9WA 4B3RK 3K59A 4JS4A 1UOCA 5FPMA 3HPHA 4FJXA 4BREA 2UUAK 4EIAA 3GL1A 1S1UA 3TTDA 3M3ZA 1EXQA 3RRHA 1NK6A 5AZIB 3AVAA 3EYZA 4E1JA 3D45A 1L3SA 5BN9A 4FOEA 3CD6N 4BGAA 1Q81O 4OPHA 3G6EN 3CFOA 2P9LB 3TSQA 5AQOA 2A3ZA 3TARA 4DR7K 2HNDA 1WSJA 3DM2A 3HOSA 4IOAL 4OGEA 2VWJA 2HF4A 3E9LA 5T7BA 4OJRA 1BI4A 4KTZA 3RR7A 4CFBA 4CHYA 4I2PA 4CI6A 4B9LA 2KHOA 3VQ4A 4EP5A 1ZYQA 1OH7A 1M90O 4PKIA 4F4KA 3QEPA 1TVRA 4BC2A 2HNZA 5AQTA 3LZIA 3HXMA 5B8HA 3MAQA 1TAQA 3CCSN 2BE2A 4KRFA 1HYSA 2GX9A 3O9SA 3C7NA 3A5LC 5TKYA 4CJLA 2QWOA 3A5NC 3ZX0A 3WNEA 2VGNA 2ZGZA 3WNFA 1OVQA 3LPTA 3LP3A 1G15A 4DSKA 2Q97A 1N32K 2CGLA 3A8YA 3VQPA 3L0QA 4J2BA 3M8RA 3CCMN 5C15A 1NLVA 5HBMA 1GOAA 4E89A 2Y1IA 4NYFA 1Q9YA 3ITHA 1WOQA 3FZMA 3OS0A 1C1CA 3CJ1A 1HQUA 5HL7L 1IV0A 1KVBA 1ZXOA 4I2QA 4MQ3A 1UA0A 4LF4K 4NCAA 3LL3A 3SJHA 4F2SA 4I6MB 1MWKA 4CESA 1JLGA 4KHYA 3KLEA 3K5MA 2GELA 5AQLA 4AHUA 3L4QA 3ASMA 5JVHL 3NH0A 1JCFA 4QOZB 3JS6A 1S9GA 2W41A 2W42A 2GV9A 2QWPA 3THVA 3G0ZA 1T44A 1QHAA 2P9SB 1N8RO 1RDDA 2O4IA 3VMFB 4JKBA 4BRMA 3EE9A 4FCYA 4CZIA 2W6KA 3SZ2A 4MO5A 2UU9K 4CEZA 1ZBHA 2DPNA 5DM6L 3U6FA 2RPIA 3CC7N 4BWJA 3CCVN 4CJRA 4NXMK 1HMVA 2UYTA 3LDNA 2BGGA 3T1HK 3NGYA 5AZIA 5GAGP 1X3MA 1XHZA 3I8DA 3TAFA 1EQYA 2ZJPL 3WXIA 4Q5VA 2GWJA 5AQIA 4PL8A 4R5PA 2P9LA 4GKJK 2QI2A 4CJ4A 4DV2K 4JI1K 4CFCA 1NWKA 4JKGA 2BTFA 3W3DA 3CCRN 3OVNA 1YF5L 5F1XA 1VRTA 3LAKA 4CGJA 3ATUA 3E9PA 4CHQA 3DRPA 3G25A 1YJWN 1NGGA 4ISEA 1QTMA 1NU0A 1LWCA 1HNVA 1NMNA 4CE9A 4G9ZA 3DLEA 4FJLA 1RDUA 1VQON 2A41A 5FRMA 3CM6A 3U8XA 1K8KA 5CR4A 3AA3A 5M1QA 3VA3A 5GAHP 4CJPA 4HVJA 3CC2N 3H1VX 3JAMO 1ZBSA 1IG8A 1NOYA 3V9ZA 3ZETA 3H1QA 4BGBA 1KFDA 2E6LA 2OA8A 3EE8A 3TABA 1D8YA 3ALYA 5J2PA 4HUEA 1D9FA 4FLYA 1WBDA 4K41A 3TAPA 4IZ9A 2YCHA 3SQ1A 4WCEL 4I6MA 1RBTA 4JEPA 2NRWA 2AA4A 5A2QO 2E20A 3QLHA 2G8KA 5LL6Z 1NJIO 4BRHA 4FWOA 2OCEA 3VEWA 3SI6A 3KLGA 2BDPA 1TK0A 3P5JA 1G99A 2ZJRL 4KBOA 4MDAA 2VG6A 3M8SA 1YHQN 4FVUA 4B08A 1HNWK 2D4WA 3EZWA 1QQNA 4B1YB 1WB9A 2P9SA 4QCLA 5DMRA 3Q7BA 3UIQA 2P9UA 1Z26A 1LOTB 2OPRA 3TAGA 1TUUA 3VQ7A 3O8MA 2QXLA 4IWVA 4FJHA 3VOVA 1JCGA 4DV6K 2ZQBA 3OYEA 3ZSQA 3CCQN 4XH4A 3SK3A 3T1YK 3CJBA 5C24A 1NGEA 3T19A 3M8QA 4KFBA 3O9UA 3J7YP 5KQ8A 3AO5A 1HPMA 1WSFA 4OKEA 2FF3B 2YHWA 4NO7A 4BR9A 5KPRA 1KQSM 2IIRA 3QB0A 2Q36A 4OGCA 1EWQA 3ZT1A 3KKSA 5CHIA 4H8KA 1EKEA 1S5JA 3KLHA 4MLHA 5AQQA 1VQLN 3C6UA 4KV8A 3T69A 4O4GA 3LP0A 4OLAA 5AQHA 3FZHA 5KQDA 4JI7K 4FJIA 4FL9A 3DLGA 4KHSA 2NRVA 2QWLA 2OPSA 2YHAA 3B6PA 2ZD1A 3V9UA 1DKGD 1B9FA 4M7XA 1XMOK 4OVLA 4GVMA 4IO8A 1SAZA 5LJWA 1YJNN 3LM2A 4M3ZA 1U45A 5CE3A 4HTLA 5M1FA 1MDUB 3FR0A 4KI6A 3BF1A 3P83D 2NLXA 3H45C 1NMDA 4C8MA 2Q31A 3TANA 3T3FA 3THXB 4DTMA 4RCHA 2IVPA 1E4FT 5M1KA 3B6OA 4DSFA 3H46O 3AO3A 4BQZA 1I3AA 3IUCA 5GINA 4FZXC 1W9HA 3P38A 4DV7K 3I33A 3VQ8A 2HHVA 3R9PA 3HOTA 1X3NA 4JI0K 3I0RA 1TKTA 2FSNA 4DS5A 3CCEN 1VSHA 3IKMA 1QQMA 2HOEA 3LP2A 3KVGA 5GIOA 4FPAA 4JN4A 1NJXA 1LWEA 4IJAA 4CJTA 4B3TK 2YV0X 3HK2A 5D3GA 1BHLA 3F5TA 3AVCA 1T7PA 3MEEA 4X66K 3AO1A 4B3OA 4KHPK 1ZBUA 4M45A 4OPKA 4DF8A 4DR1K 1RBVA 4FWLA 1J54A 3D7EO 4MFBA 3AY9A 3FGUA 3PIPL 1U49A 4DB3A 1Y64A 4FSVA 2QKBA 3VQBA 3AGKA 5AQZA 1HYZA 3DRRA 2UUBK 4CEDA 4HWIA 4FJMA 1K9MO 2A5XA 3WQTA 3GG4A 5KGXA 3QBWA 4O8UA 4IDKA 1I39A 3PX4A 3CYMA 2P5GA 4NLCA 3FE1A 3QERA 3O6WA 3NF7A 4W5QA 3D2FB 4OPAA 4JK7A 3AVMA 2P51A 3VF4A 1VQMN 4RW9A 4BACA 2WTUA 1QSSA 2G8UA 1RTDA 1U47A 1QZ5A 2JLEA 4QS7A 4IO9L 5E84A 1VQ4N 3DXMB 3FFIA 3SAGA 3DMJA 2O8BA 4LC9B 4FLUA 4DTRA 4KKOA 3LZJA 5GIPA 2NRXA 3HTVA 4O55A 3W0LA 3WEEB 4M3WA 2Z1IA 1T3VA 3GE1A 5CZ2A 4IOXA 3ZSXA 4A59A 1UAXA 5C10A 3THXA 4CK2A 2E4LA 3QEIA 4DQPA 5HRRA 3IFRA 3DLLL 2HBKA 4CBUA 4DUYK 2HHXA 4OO1J 4MDBA 1GLLO 3NCIA 2DTUA 2XO7A 3DLBA 1OKJA 5EY4A 3VETA 1BA1A 2P9PB 5AQVA 2G8HA 4DTJA 4FLWA 1S1TA 4F3TA 3KHYA 4N76A 1L5UA 5FROA 1NK8A 3DAWA 3O5BA 4I9QA 3D0PA 1GLAG 2R7YA 4CZEA 4B9NA 1KVAA 2FBYA 2E2NA 3KWGA 4QS9A 3LPUA 1RT3A 4ELTA 1OH5A 3L2RA 2O8FA 3RVCA 4FJ8A 4J2AA 3SYZA 3MDQA 2YHYA 3CCJN 4H0VB 5LMNK 1SKWA 3CERA 3RWUA 2XY8A 3TTFA 1S1XA 3O4QA 2PBDA 2Z1GA 4BQLA 4AF1A 2E2PA 2V7YA 2DFHA 4BY9C 2I5JA 1VSLA 2D0PA 4AHRA 4CK1A 1FKOA 3BY5A 1J6ZA 3VQ9A 3O1BA 1YT3A 1A5VA 4DQ8A 3BDPA 1X9WA 2NZTA 3CJ7A 4AHSA 1NJWA 2ATQA 4N41A 3O3GA 3EEQA 3K58A 1RTJA 3HM8A 3WNHA 4DQQA 5EXWA 2GUPA 4H4MA 3ZX3A 3VQQA 4N5SA 2HHWA 5C42A 4CF8A 1VK0A 5BR9A 3L3UA 2D0BA 4B1UB 2KQ2A 4AM7A 4BDZA 1IBKK 1ASUA 4BR7A 4YFUA 4IG3A 2QXFA 3G4SN 1GLCG 2HHSA 1RT4A 3C6TA 1QZ6A 1NK5A 1EP4A 4TSXA 2IVOA 3NF9A 1NK7A 1CLQA 1RT5A 1LCUA 3MWPA 1GLBG 3PV8A 1HPZA 2HBJA 1U48A 3QNOA 1IKVA 2HHTA 5AQFA 3OYGA 1IKYA 3SJJA 1SKSA 4FLVA 1KCFA 2HSTA 3CXCM 3HO1A 3MEGA 1LV5A 1LAWA 2E1ZA 4R79A 1XC9A 4DUZK 1KXPA 3QMLA 1WUAA 1T05A 1NGIA 2KFNA 1DLOA 3U9ZA 4LF6K 1VQ7N 3ZEUB 4FM1A 3AARA 3RMAA 1IH7A 4M3YA 3DLKA 2QA4N 3ENOA 4B8AB 4M3UA 5DM7L 3V1QA 4LH5A 4QAGA 2JWLA 4GW6A 3JXUA 1BGXT
chains in the Genus database with same CATH topology
2G8WA 3PY8A 5FRMA 3CM6A 3ZSRA 3HPGA 3K5LA 4Z4GA 3M8PA 3AA3A 1KLMA 1KVCA 3VA3A 1JL2A 4LY7A 4CJPA 4ID1A 3V9XA 4E7JA 4LSNA 1RDCA 1N6QA 4HVJA 1LW0A 1ITGA 2IDOA 1BL3A 4Z4CA 5FDLA 4B9SA 3MXJA 4DG1A 5EU7A 1KSPA 1KRPA 4O0IA 4KREA 1NOYA 3V9ZA 4FW2A 1R0AA 1KFDA 2E6LA 2OA8A 3AVJA 3TABA 1D8YA 3ALYA 5J2PA 4I9QA 5KI6A 4HUEA 4ZTFA 3S3OA 1D9FA 1EX4A 4FLYA 1YTUA 5J2MA 3NFAA 1SL2A 5K14A 2Z1JA 3VQEA 2PYJA 1K6YA 5SZTA 2HVHA 3TAPA 3OYDA 4KI4A 3KIOA 1GOBA 4NYNA 1UA1A 3NDKA 3AVBA 3SQ1A 5HLFA 3SUNA 4DTNA 3HP9A 4E7HA 2RN2A 2WONA 1RBTA 4DU4A 1DTTA 3DLHA 4O0JA 4KB0A 4CGIA 1NJYA 3AA5X 2OYQA 3QLHA 2HB5A 2O4GA 2G8KA 3MEDA 1RNHA 3ZT3A 5KGWA 2QKKA 4KHQA 1L3VA 3OYNA 3JYTA 4HCBA 3SI6A 3KLGA 1JLQA 1WNSA 4JRQA 2BDPA 1TK0A 3P5JA 3QIPA 4Y1CA 1RDBA 4HTUA 5E41A 3DI6A 1FKPA 4CEBA 1C0TA 2P5OA 3OS1A 3TAQA 1NJZA 2VG6A 3M8SA 1XHXA 3H08A 1B9DA 4PUOA 4CJSA 4CF2A 1S9EA 4AILC 4B08A 2X78A 3S3MA 3ZSVA 1RTHA 4KHNA 1JL1A 4KAZA 1RDAA 2IS3A 3HPOA 3V4IA 4KO0A 4M42A 1C6VA 3O4NA 4E3SA 4J2EA 3ZT4A 4QCLA 4B8CA 1XWLA 4RW7A 5DMRA 5HRPA 4E1NA 2VG5A 3LAMA 4DTXA 1IO2A 2OPQA 3HSTB 4EZ9A 3UIQA 1Z26A 1RT7A 1Z25A 1ZBIA 3DLRA 2OPRA 3TAGA 1SKRA 4CCHA 4DTPA 1N5YA 3NE6A 1TK8A 3ISNC 4ELVA 2XY6A 3VQ7A 3V1OA 5JS2A 3DRSA 3NBPA 2DFEA 3ZSZA 3TAMA 3KLFA 3KKRA 4PQUA 1WSHA 4I9LA 4DQSA 5SWMA 4CHNA 2A1SA 4RW6A 5HRSA 4FJHA 3SCXA 4RW4A 1CZ9A 2VWKA 3CM5A 3HJFA 1RT6A 3I0SA 4Z0UA 2ZQBA 3OYEA 3ZSQA 4CHZA 3PO5A 1IKXA 2PYLA 2G8VA 2HNYA 1JKHA 4DTUA 1VRUA 3VN5A 3DYAA 1L3UA 5C24A 3PX6A 3T19A 3M8QA 4I7FA 1U04A 4KFBA 2YKMA 1KFSA 3RR8A 3AA4A 5C25A 3OYBA 3SNNA 4FLTA 3OY9A 1BIZA 1U4BA 1TL3A 1JXEA 4WE1A 3IAYA 3IRXA 3AO5A 1WSFA 3IS9A 4F3OA 3AO2A 4OKEA 2JGUA 3C95A 3CFRA 3SUQA 4CEAA 2QK9A 1TKDA 3C94A 4JLHA 3OYIA 4HUFA 4CF9A 1WAJA 4CHOA 3MECA 3V9WA 3ZSOA 2OZSA 4DF4A 3AVLA 1T8EA 1BQMA 2ETJA 4OGCA 5KRSA 3ZT1A 4DMNA 4IFYA 3EY1A 3AO4A 3KKSA 3ZCMA 1LWFA 4E7KA 4H8KA 1EKEA 1REVA 1S5JA 1TL1A 3KLHA 4CERA 4J2DA 3KD5E 4XIUA 4B9VA 4DTSA 4IG0A 3MXIA 3C6UA 4KV8A 4O4GA 3LP1A 3LP0A 1SUQA 5KRTA 4OLAA 2XHBA 4ID5A 2Q3SA 4FJIA 3DLGA 4KHSA 2Z1HA 4M3TA 2GBZA 2YNIA 4Y1DA 4L8RB 2OPSA 2YHAA 3B6PA 2IGIA 2RKIA 3BGRA 4NCBA 1JLEA 4W5OA 2ZD1A 3V9UA 3V9SA 5J2QA 1B9FA 1BIUA 4OVLA 4GVMA 4FJGA 2WOMA 3KJVA 3OYLA 3A2FA 2KZMA 1YVUA 1RBRA 3AA2A 3OYHA 4M3ZA 2KZZA 3S3NA 1WSEA 1VSIA 2HMIA 1RTIA 3MXMA 4ICLA 4CGFA 2FBVA 4OPJA 4CJ3A 1U45A 1F21A 4OKJA 3NAEA 1CXUA 4AHTA 4CECA 4Z4HA 4FXDA 2PZSA 4KI6A 4N56A 3P83D 3TI0A 1VSKA 3U3YA 2HVIA 3KK2A 4C8MA 1QE1A 1C1BA 3NGZA 3L2WA 3HVTA 4CF1A 1BISA 3OS2A 3TANA 3T3FA 1RCHA 3HL8A 1D5AA 1GOCA 4DTMA 4W5NA 4FZYA 1WSGA 4OLBA 2YKNA 4K8ZA 1TAUA 1JLAA 3B6OA 3NH2A 1BCMA 4DSFA 3AO3A 1I3AA 1RBSA 1B92A 3AVKA 4DSIA 4FZXC 3SQ0A 3SQ4A 3OYKA 1W9HA 3VQ5A 1D9DA 2B5JA 3RMDA 5CY4A 3VQ8A 3VQAA 3OYJA 3DOLA 4FM0A 2HHVA 4CEOA 3AVHA 4HHTA 4CIEA 5HROA 3ZSYA 2XRIA 3I0RA 4DFJA 3KTQA 1TKTA 1BI4B 4DS5A 4HCCA 3DOKA 3HM9A 3CFPA 4FLZA 1VSHA 4FJ5A 4KHWA 3LP2A 4F8RA 4IBNA 3P1GA 2F96A 1NJXA 1LWEA 2IC3A 4RW8A 1HQEA 4BDYA 4C8OA 1EETA 1HYVA 2B6AA 4CJTA 2YV0X 3QETA 3V81A 2LSNA 5J1EA 3HK2A 4FJNA 5D3GA 1BHLA 3SV3A 3NF8A 1VSMA 3CG7A 3VQDA 4AHVA 3AVCA 1X9SA 1T7PA 2HW3A 3HVRA 1WN7A 3MEEA 2X74A 2HHUA 5CZ1A 4CFAA 3AO1A 4B3OA 3WNGA 4CEQA 1ZBUA 1XI1A 4M45A 4OPKA 4BE2A 3V1RA 4DF8A 1RBVA 1CXQA 4CJVA 4W5RA 3RMCA 2EX3A 3ULDA 3QNNA 1KLNA 4DFMA 4FM2A 4DSEA 3AVNA 1JLFA 3NF6A 1C0MA 3QO9A 1J54A 4JRPA 3K5NA 1HNIA 2XY7A 4MFBA 5HP1A 1U49A 2FBXA 4YNQA 4Z4EA 3OYFA 4C8LA 4KTQA 3KLIA 3VA0A 1S1VA 2QKBA 3TAEA 4KB1A 3VQBA 1HYZA 3DRRA 4CEDA 3PO4A 4LH4A 1A5XA 4FJMA 1X9MA 4FLXA 2YNFA 4GMJB 3AVFA 1MU2A 1FK9A 4DFPA 4DU1A 4E19A 5KGXA 1J5OA 3IG1A 1TKXA 1DTQA 1I39A 4IDKA 3RRGA 2G8FA 5FRNA 4CJ5A 1FXXA 3PX4A 3CYMA 1NK4A 4B9TA 3QINA 2X6NA 2P5GA 3QERA 3E01A 2IOCA 3NF7A 4W5QA 4DQRA 1Q8IA 1WLJA 3AVMA 3K57A 4BE0A 4CJUA 3VQCA 2X6SA 4C8NA 3OYCA 2P51A 4CJKA 4B9UA 1RT1A 4M3XA 2F8SA 2OPPA 4RW9A 4BACA 4C8KA 1Q9XA 2KW4A 5JS1A 1QSSA 2G8UA 4Z4FA 3SPYA 1RTDA 1U47A 2YNGA 1C1AA 4E7LA 1C0UA 1W0HA 1Y97A 2JLEA 4O44A 4JS5A 3PUFA 3TWHA 3G10A 1NK9A 3L3VA 3OJSA 1SL0A 2KTQA 3FFIA 3T1AA 3DMJA 4F2RA 4KPYA 4PWDA 4IFVA 3K59A 4JS4A 4FLUA 1UOCA 4LSLA 4KHUA 3V6DA 4FW1A 4DTRA 3HPHA 5CYQA 1S6QA 4FJXA 4KKOA 3LZJA 2G8IA 1LW2A 3KD1E 4CK3A 2FC0A 4O55A 3HP6A 4M3WA 1S1UA 1JLCA 1ASVA 4O5BA 4W5TA 4CEFA 4BE1A 2Z1IA 1VSEA 4AH9A 1EXQA 2FBTA 1QHTA 3F73A 3ZSXA 3QIOA 5CZ2A 3RRHA 1SL1A 4ZTJA 1UAXA 1NK6A 4RG8A 4DLGA 4LD0A 5HRNA 3AVAA 4CK2A 2GUIA 2E4LA 2D0CA 3EYZA 3QEIA 1A5WA 3SUOA 3D45A 1L3SA 4IKFA 4DQPA 1NOZA 5HRRA 3EZ5A 4DS4A 4G1QA 2RF2A 3CFOA 3TARA 2HHXA 2HNDA 1WSJA 3DM2A 4DLEA 4OGEA 3RMBA 3SUPA 3S9HA 2VWJA 3NCIA 2DTUA 5T7BA 2XO7A 4FJ9A 3DLBA 1TKZA 4OJRA 5CYMA 3QEWA 3LANA 4DSJA 3JSMA 3LWMA 1BI4A 1UWBA 4KTZA 4CJQA 3RR7A 4CFBA 4CHYA 5I3UA 2G8HA 1LAVA 4I2PA 4DTJA 2B4JA 4FLWA 4B9LA 4CF0A 1S1TA 4F3TA 2P1JA 4CGHA 4E7IA 2E6MA 3VQ4A 4CHPA 4EP5A 1L5UA 2VG7A 5FROA 1NK8A 1ZYQA 1L3TA 2OZMA 4N76A 4F4KA 3QEPA 1QQCA 1TVRA 2IAJA 4BDPA 2HNZA 3LZIA 3RTVA 3HXMA 3MAQA 3D0PA 2R7YA 1TAQA 3QEXA 4B9NA 1S1WA 1KVAA 1VSDA 2BANA 2BE2A 1O1WA 2FBYA 4KRFA 1HYSA 4CJFA 3AVIA 1HJRA 4FYDA 4CJLA 4K8XA 3LPUA 1RT3A 4ELTA 3WNEA 3L2RA 4UQGA 3WNFA 3LPTA 1YTAA 3LP3A 4FJ8A 4Z4IA 4J2AA 2DFFA 1G15A 3NGIA 3SYZA 4DSKA 5I42A 1NK0A 4CIFA 1SKWA 3VQPA 4J2BA 3M8RA 1ASWA 4ELUA 2XY8A 2ZE2A 3RWUA 5HBMA 1GOAA 4E89A 2Y1IA 4NYFA 1Q9YA 3ITHA 1T03A 1S1XA 3O4QA 3ZT2A 2Z1GA 4FVMA 4CJWA 3PX0A 3OS0A 3KK3A 1C1CA 3L8BA 1TK5A 1NKBA 2DFHA 1X1PA 1CZBA 4E1MA 2KFZA 2I5JA 1VSLA 1HQUA 4AHRA 4CK1A 1FKOA 1KVBA 4CJEA 1IG9A 4I2QA 4MQ3A 1UA0A 3VQ9A 4NCAA 4CGDA 3AV9A 4EP4A 4F2SA 4CESA 4FJJA 4FK2A 1YT3A 1A5VA 3SPZA 3BDPA 4FK0A 1JLGA 1RBUA 4BWMA 4CIGA 4AHSA 1X9WA 1NJWA 2ATQA 4KHYA 4N41A 3O3GA 2AJQA 4DSLA 3KLEA 3K5MA 4FJ7A 3OYMA 3OJUA 3K58A 3L2VA 1RTJA 4AHUA 2YHBA 3ASMA 3WNHA 4DQQA 3NHGA 4H4MA 3CQ8A 3VQQA 4N5SA 2HHWA 3KK1A 3NH0A 3HT3A 5C42A 5KTQA 4CF8A 4FZZA 4QOZB 1VK0A 2HHQA 4KTWA 1VSFA 2D0BA 1S9GA 2KQ2A 3L3UA 2GV9A 2W42A 2Y1JA 4BDZA 2XY5A 3THVA 1JLBA 4DWIA 2DY4A 3G0ZA 1ASUA 4YFUA 2NUBA 4IG3A 2QXFA 1TV6A 4FJKA 1WSIA 2HHSA 1RDDA 2O4IA 4DFKA 4PY5A 1RT4A 4FCYA 3C6TA 1NK5A 3SZ2A 1EP4A 4DTOA 3ZT0A 4TSXA 3LDSA 1WAFA 4PA1A 3L2UA 4CEZA 1ZBHA 1SV5A 3L2QA 4N47A 3U6FA 2RPIA 3QEVA 3NF9A 2ITGA 1NK7A 1RT5A 1CLQA 1RILA 4DU3A 4BWJA 4CJRA 1HMVA 3SV4A 4M41A 1RT2A 2YNHA 3VQ6A 3PV8A 1HPZA 1U48A 2PY5A 2BGGA 4NCGA 3NGYA 3QNOA 1XHZA 1IKVA 1QSLA 3NH1A 2HHTA 1BQNA 3I8DA 3TAFA 3K5OA 3ZSWA 3K2PA 3TR8A 3HYFA 4Q5VA 3OYGA 2F8TA 1IKYA 3SQ2A 3SJJA 1SKSA 1S6PA 4M3RA 4FLVA 3F9KA 4R5PA 1HRHA 3QESA 1KCFA 2A1RA 4Q0BA 1JXBA 3HO1A 1ZBFA 3MEGA 4CJ4A 1LV5A 1NKCA 1IKWA 1LAWA 5DK5A 4CFCA 1ZBLA 1BCOA 1QSYA 4DQIA 2EHGA 1XC9A 1NKEA 3O3HA 1KTQA 1T05A 1QS4A 4CEEA 4CGGA 4AHCA 3OVNA 2D0AA 2KFNA 4CFDA 1DLOA 3AVGA 1VSJA 1VRTA 1J53A 3LAKA 4CGJA 3LALA 4H4OA 4OKKA 1TGOA 3DRPA 1J9AA 4CHQA 3LWLA 4B9MA 4FM1A 3RMAA 1QTMA 2D5RA 1IH7A 1LWCA 5J2NA 1HNVA 3DLKA 4B8AB 4E0DA 4M3UA 4M3YA 4CE9A 3OYAA 3V1QA 4EZ6A 4LH5A 3O3FA 3DLEA 4QAGA 4FJLA 3U3GA 4ZHRA 4HUGA 4GW6A 4FK4A 1BGXT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G8W A;  3PY8 A;  5FRM A;  3CM6 A;  3ZSR A;  3HPG A;  3K5L A;  4Z4G A;  3M8P A;  3AA3 A;  1KLM A;  1KVC A;  3VA3 A;  1JL2 A;  4LY7 A;  4CJP A;  4ID1 A;  3V9X A;  4E7J A;  4LSN A;  1RDC A;  1N6Q A;  4HVJ A;  1LW0 A;  1ITG A;  2IDO A;  1BL3 A;  4Z4C A;  5FDL A;  4B9S A;  3MXJ A;  4DG1 A;  5EU7 A;  1KSP A;  1KRP A;  4O0I A;  4KRE A;  1NOY A;  3V9Z A;  4FW2 A;  1R0A A;  1KFD A;  2E6L A;  2OA8 A;  3AVJ A;  3TAB A;  1D8Y A;  3ALY A;  5J2P A;  4I9Q A;  5KI6 A;  4HUE A;  4ZTF A;  3S3O A;  1D9F A;  1EX4 A;  4FLY A;  1YTU A;  5J2M A;  3NFA A;  1SL2 A;  5K14 A;  2Z1J A;  3VQE A;  2PYJ A;  1K6Y A;  5SZT A;  2HVH A;  3TAP A;  3OYD A;  4KI4 A;  3KIO A;  1GOB A;  4NYN A;  1UA1 A;  3NDK A;  3AVB A;  3SQ1 A;  5HLF A;  3SUN A;  4DTN A;  3HP9 A;  4E7H A;  2RN2 A;  2WON A;  1RBT A;  4DU4 A;  1DTT A;  3DLH A;  4O0J A;  4KB0 A;  4CGI A;  1NJY A;  3AA5 X;  2OYQ A;  3QLH A;  2HB5 A;  2O4G A;  2G8K A;  3MED A;  1RNH A;  3ZT3 A;  5KGW A;  2QKK A;  4KHQ A;  1L3V A;  3OYN A;  3JYT A;  4HCB A;  3SI6 A;  3KLG A;  1JLQ A;  1WNS A;  4JRQ A;  2BDP A;  1TK0 A;  3P5J A;  3QIP A;  4Y1C A;  1RDB A;  4HTU A;  5E41 A;  3DI6 A;  1FKP A;  4CEB A;  1C0T A;  2P5O A;  3OS1 A;  3TAQ A;  1NJZ A;  2VG6 A;  3M8S A;  1XHX A;  3H08 A;  1B9D A;  4PUO A;  4CJS A;  4CF2 A;  1S9E A;  4AIL C;  4B08 A;  2X78 A;  3S3M A;  3ZSV A;  1RTH A;  4KHN A;  1JL1 A;  4KAZ A;  1RDA A;  2IS3 A;  3HPO A;  3V4I A;  4KO0 A;  4M42 A;  1C6V A;  3O4N A;  4E3S A;  4J2E A;  3ZT4 A;  4QCL A;  4B8C A;  1XWL A;  4RW7 A;  5DMR A;  5HRP A;  4E1N A;  2VG5 A;  3LAM A;  4DTX A;  1IO2 A;  2OPQ A;  3HST B;  4EZ9 A;  3UIQ A;  1Z26 A;  1RT7 A;  1Z25 A;  1ZBI A;  3DLR A;  2OPR A;  3TAG A;  1SKR A;  4CCH A;  4DTP A;  1N5Y A;  3NE6 A;  1TK8 A;  3ISN C;  4ELV A;  2XY6 A;  3VQ7 A;  3V1O A;  5JS2 A;  3DRS A;  3NBP A;  2DFE A;  3ZSZ A;  3TAM A;  3KLF A;  3KKR A;  4PQU A;  1WSH A;  4I9L A;  4DQS A;  5SWM A;  4CHN A;  2A1S A;  4RW6 A;  5HRS A;  4FJH A;  3SCX A;  4RW4 A;  1CZ9 A;  2VWK A;  3CM5 A;  3HJF A;  1RT6 A;  3I0S A;  4Z0U A;  2ZQB A;  3OYE A;  3ZSQ A;  4CHZ A;  3PO5 A;  1IKX A;  2PYL A;  2G8V A;  2HNY A;  1JKH A;  4DTU A;  1VRU A;  3VN5 A;  3DYA A;  1L3U A;  5C24 A;  3PX6 A;  3T19 A;  3M8Q A;  4I7F A;  1U04 A;  4KFB A;  2YKM A;  1KFS A;  3RR8 A;  3AA4 A;  5C25 A;  3OYB A;  3SNN A;  4FLT A;  3OY9 A;  1BIZ A;  1U4B A;  1TL3 A;  1JXE A;  4WE1 A;  3IAY A;  3IRX A;  3AO5 A;  1WSF A;  3IS9 A;  4F3O A;  3AO2 A;  4OKE A;  2JGU A;  3C95 A;  3CFR A;  3SUQ A;  4CEA A;  2QK9 A;  1TKD A;  3C94 A;  4JLH A;  3OYI A;  4HUF A;  4CF9 A;  1WAJ A;  4CHO A;  3MEC A;  3V9W A;  3ZSO A;  2OZS A;  4DF4 A;  3AVL A;  1T8E A;  1BQM A;  2ETJ A;  4OGC A;  5KRS A;  3ZT1 A;  4DMN A;  4IFY A;  3EY1 A;  3AO4 A;  3KKS A;  3ZCM A;  1LWF A;  4E7K A;  4H8K A;  1EKE A;  1REV A;  1S5J A;  1TL1 A;  3KLH A;  4CER A;  4J2D A;  3KD5 E;  4XIU A;  4B9V A;  4DTS A;  4IG0 A;  3MXI A;  3C6U A;  4KV8 A;  4O4G A;  3LP1 A;  3LP0 A;  1SUQ A;  5KRT A;  4OLA A;  2XHB A;  4ID5 A;  2Q3S A;  4FJI A;  3DLG A;  4KHS A;  2Z1H A;  4M3T A;  2GBZ A;  2YNI A;  4Y1D A;  4L8R B;  2OPS A;  2YHA A;  3B6P A;  2IGI A;  2RKI A;  3BGR A;  4NCB A;  1JLE A;  4W5O A;  2ZD1 A;  3V9U A;  3V9S A;  5J2Q A;  1B9F A;  1BIU A;  4OVL A;  4GVM A;  4FJG A;  2WOM A;  3KJV A;  3OYL A;  3A2F A;  2KZM A;  1YVU A;  1RBR A;  3AA2 A;  3OYH A;  4M3Z A;  2KZZ A;  3S3N A;  1WSE A;  1VSI A;  2HMI A;  1RTI A;  3MXM A;  4ICL A;  4CGF A;  2FBV A;  4OPJ A;  4CJ3 A;  1U45 A;  1F21 A;  4OKJ A;  3NAE A;  1CXU A;  4AHT A;  4CEC A;  4Z4H A;  4FXD A;  2PZS A;  4KI6 A;  4N56 A;  3P83 D;  3TI0 A;  1VSK A;  3U3Y A;  2HVI A;  3KK2 A;  4C8M A;  1QE1 A;  1C1B A;  3NGZ A;  3L2W A;  3HVT A;  4CF1 A;  1BIS A;  3OS2 A;  3TAN A;  3T3F A;  1RCH A;  3HL8 A;  1D5A A;  1GOC A;  4DTM A;  4W5N A;  4FZY A;  1WSG A;  4OLB A;  2YKN A;  4K8Z A;  1TAU A;  1JLA A;  3B6O A;  3NH2 A;  1BCM A;  4DSF A;  3AO3 A;  1I3A A;  1RBS A;  1B92 A;  3AVK A;  4DSI A;  4FZX C;  3SQ0 A;  3SQ4 A;  3OYK A;  1W9H A;  3VQ5 A;  1D9D A;  2B5J A;  3RMD A;  5CY4 A;  3VQ8 A;  3VQA A;  3OYJ A;  3DOL A;  4FM0 A;  2HHV A;  4CEO A;  3AVH A;  4HHT A;  4CIE A;  5HRO A;  3ZSY A;  2XRI A;  3I0R A;  4DFJ A;  3KTQ A;  1TKT A;  1BI4 B;  4DS5 A;  4HCC A;  3DOK A;  3HM9 A;  3CFP A;  4FLZ A;  1VSH A;  4FJ5 A;  4KHW A;  3LP2 A;  4F8R A;  4IBN A;  3P1G A;  2F96 A;  1NJX A;  1LWE A;  2IC3 A;  4RW8 A;  1HQE A;  4BDY A;  4C8O A;  1EET A;  1HYV A;  2B6A A;  4CJT A;  2YV0 X;  3QET A;  3V81 A;  2LSN A;  5J1E A;  3HK2 A;  4FJN A;  5D3G A;  1BHL A;  3SV3 A;  3NF8 A;  1VSM A;  3CG7 A;  3VQD A;  4AHV A;  3AVC A;  1X9S A;  1T7P A;  2HW3 A;  3HVR A;  1WN7 A;  3MEE A;  2X74 A;  2HHU A;  5CZ1 A;  4CFA A;  3AO1 A;  4B3O A;  3WNG A;  4CEQ A;  1ZBU A;  1XI1 A;  4M45 A;  4OPK A;  4BE2 A;  3V1R A;  4DF8 A;  1RBV A;  1CXQ A;  4CJV A;  4W5R A;  3RMC A;  2EX3 A;  3ULD A;  3QNN A;  1KLN A;  4DFM A;  4FM2 A;  4DSE A;  3AVN A;  1JLF A;  3NF6 A;  1C0M A;  3QO9 A;  1J54 A;  4JRP A;  3K5N A;  1HNI A;  2XY7 A;  4MFB A;  5HP1 A;  1U49 A;  2FBX A;  4YNQ A;  4Z4E A;  3OYF A;  4C8L A;  4KTQ A;  3KLI A;  3VA0 A;  1S1V A;  2QKB A;  3TAE A;  4KB1 A;  3VQB A;  1HYZ A;  3DRR A;  4CED A;  3PO4 A;  4LH4 A;  1A5X A;  4FJM A;  1X9M A;  4FLX A;  2YNF A;  4GMJ B;  3AVF A;  1MU2 A;  1FK9 A;  4DFP A;  4DU1 A;  4E19 A;  5KGX A;  1J5O A;  3IG1 A;  1TKX A;  1DTQ A;  1I39 A;  4IDK A;  3RRG A;  2G8F A;  5FRN A;  4CJ5 A;  1FXX A;  3PX4 A;  3CYM A;  1NK4 A;  4B9T A;  3QIN A;  2X6N A;  2P5G A;  3QER A;  3E01 A;  2IOC A;  3NF7 A;  4W5Q A;  4DQR A;  1Q8I A;  1WLJ A;  3AVM A;  3K57 A;  4BE0 A;  4CJU A;  3VQC A;  2X6S A;  4C8N A;  3OYC A;  2P51 A;  4CJK A;  4B9U A;  1RT1 A;  4M3X A;  2F8S A;  2OPP A;  4RW9 A;  4BAC A;  4C8K A;  1Q9X A;  2KW4 A;  5JS1 A;  1QSS A;  2G8U A;  4Z4F A;  3SPY A;  1RTD A;  1U47 A;  2YNG A;  1C1A A;  4E7L A;  1C0U A;  1W0H A;  1Y97 A;  2JLE A;  4O44 A;  4JS5 A;  3PUF A;  3TWH A;  3G10 A;  1NK9 A;  3L3V A;  3OJS A;  1SL0 A;  2KTQ A;  3FFI A;  3T1A A;  3DMJ A;  4F2R A;  4KPY A;  4PWD A;  4IFV A;  3K59 A;  4JS4 A;  4FLU A;  1UOC A;  4LSL A;  4KHU A;  3V6D A;  4FW1 A;  4DTR A;  3HPH A;  5CYQ A;  1S6Q A;  4FJX A;  4KKO A;  3LZJ A;  2G8I A;  1LW2 A;  3KD1 E;  4CK3 A;  2FC0 A;  4O55 A;  3HP6 A;  4M3W A;  1S1U A;  1JLC A;  1ASV A;  4O5B A;  4W5T A;  4CEF A;  4BE1 A;  2Z1I A;  1VSE A;  4AH9 A;  1EXQ A;  2FBT A;  1QHT A;  3F73 A;  3ZSX A;  3QIO A;  5CZ2 A;  3RRH A;  1SL1 A;  4ZTJ A;  1UAX A;  1NK6 A;  4RG8 A;  4DLG A;  4LD0 A;  5HRN A;  3AVA A;  4CK2 A;  2GUI A;  2E4L A;  2D0C A;  3EYZ A;  3QEI A;  1A5W A;  3SUO A;  3D45 A;  1L3S A;  4IKF A;  4DQP A;  1NOZ A;  5HRR A;  3EZ5 A;  4DS4 A;  4G1Q A;  2RF2 A;  3CFO A;  3TAR A;  2HHX A;  2HND A;  1WSJ A;  3DM2 A;  4DLE A;  4OGE A;  3RMB A;  3SUP A;  3S9H A;  2VWJ A;  3NCI A;  2DTU A;  5T7B A;  2XO7 A;  4FJ9 A;  3DLB A;  1TKZ A;  4OJR A;  5CYM A;  3QEW A;  3LAN A;  4DSJ A;  3JSM A;  3LWM A;  1BI4 A;  1UWB A;  4KTZ A;  4CJQ A;  3RR7 A;  4CFB A;  4CHY A;  5I3U A;  2G8H A;  1LAV A;  4I2P A;  4DTJ A;  2B4J A;  4FLW A;  4B9L A;  4CF0 A;  1S1T A;  4F3T A;  2P1J A;  4CGH A;  4E7I A;  2E6M A;  3VQ4 A;  4CHP A;  4EP5 A;  1L5U A;  2VG7 A;  5FRO A;  1NK8 A;  1ZYQ A;  1L3T A;  2OZM A;  4N76 A;  4F4K A;  3QEP A;  1QQC A;  1TVR A;  2IAJ A;  4BDP A;  2HNZ A;  3LZI A;  3RTV A;  3HXM A;  3MAQ A;  3D0P A;  2R7Y A;  1TAQ A;  3QEX A;  4B9N A;  1S1W A;  1KVA A;  1VSD A;  2BAN A;  2BE2 A;  1O1W A;  2FBY A;  4KRF A;  1HYS A;  4CJF A;  3AVI A;  1HJR A;  4FYD A;  4CJL A;  4K8X A;  3LPU A;  1RT3 A;  4ELT A;  3WNE A;  3L2R A;  4UQG A;  3WNF A;  3LPT A;  1YTA A;  3LP3 A;  4FJ8 A;  4Z4I A;  4J2A A;  2DFF A;  1G15 A;  3NGI A;  3SYZ A;  4DSK A;  5I42 A;  1NK0 A;  4CIF A;  1SKW A;  3VQP A;  4J2B A;  3M8R A;  1ASW A;  4ELU A;  2XY8 A;  2ZE2 A;  3RWU A;  5HBM A;  1GOA A;  4E89 A;  2Y1I A;  4NYF A;  1Q9Y A;  3ITH A;  1T03 A;  1S1X A;  3O4Q A;  3ZT2 A;  2Z1G A;  4FVM A;  4CJW A;  3PX0 A;  3OS0 A;  3KK3 A;  1C1C A;  3L8B A;  1TK5 A;  1NKB A;  2DFH A;  1X1P A;  1CZB A;  4E1M A;  2KFZ A;  2I5J A;  1VSL A;  1HQU A;  4AHR A;  4CK1 A;  1FKO A;  1KVB A;  4CJE A;  1IG9 A;  4I2Q A;  4MQ3 A;  1UA0 A;  3VQ9 A;  4NCA A;  4CGD A;  3AV9 A;  4EP4 A;  4F2S A;  4CES A;  4FJJ A;  4FK2 A;  1YT3 A;  1A5V A;  3SPZ A;  3BDP A;  4FK0 A;  1JLG A;  1RBU A;  4BWM A;  4CIG A;  4AHS A;  1X9W A;  1NJW A;  2ATQ A;  4KHY A;  4N41 A;  3O3G A;  2AJQ A;  4DSL A;  3KLE A;  3K5M A;  4FJ7 A;  3OYM A;  3OJU A;  3K58 A;  3L2V A;  1RTJ A;  4AHU A;  2YHB A;  3ASM A;  3WNH A;  4DQQ A;  3NHG A;  4H4M A;  3CQ8 A;  3VQQ A;  4N5S A;  2HHW A;  3KK1 A;  3NH0 A;  3HT3 A;  5C42 A;  5KTQ A;  4CF8 A;  4FZZ A;  4QOZ B;  1VK0 A;  2HHQ A;  4KTW A;  1VSF A;  2D0B A;  1S9G A;  2KQ2 A;  3L3U A;  2GV9 A;  2W42 A;  2Y1J A;  4BDZ A;  2XY5 A;  3THV A;  1JLB A;  4DWI A;  2DY4 A;  3G0Z A;  1ASU A;  4YFU A;  2NUB A;  4IG3 A;  2QXF A;  1TV6 A;  4FJK A;  1WSI A;  2HHS A;  1RDD A;  2O4I A;  4DFK A;  4PY5 A;  1RT4 A;  4FCY A;  3C6T A;  1NK5 A;  3SZ2 A;  1EP4 A;  4DTO A;  3ZT0 A;  4TSX A;  3LDS A;  1WAF A;  4PA1 A;  3L2U A;  4CEZ A;  1ZBH A;  1SV5 A;  3L2Q A;  4N47 A;  3U6F A;  2RPI A;  3QEV A;  3NF9 A;  2ITG A;  1NK7 A;  1RT5 A;  1CLQ A;  1RIL A;  4DU3 A;  4BWJ A;  4CJR A;  1HMV A;  3SV4 A;  4M41 A;  1RT2 A;  2YNH A;  3VQ6 A;  3PV8 A;  1HPZ A;  1U48 A;  2PY5 A;  2BGG A;  4NCG A;  3NGY A;  3QNO A;  1XHZ A;  1IKV A;  1QSL A;  3NH1 A;  2HHT A;  1BQN A;  3I8D A;  3TAF A;  3K5O A;  3ZSW A;  3K2P A;  3TR8 A;  3HYF A;  4Q5V A;  3OYG A;  2F8T A;  1IKY A;  3SQ2 A;  3SJJ A;  1SKS A;  1S6P A;  4M3R A;  4FLV A;  3F9K A;  4R5P A;  1HRH A;  3QES A;  1KCF A;  2A1R A;  4Q0B A;  1JXB A;  3HO1 A;  1ZBF A;  3MEG A;  4CJ4 A;  1LV5 A;  1NKC A;  1IKW A;  1LAW A;  5DK5 A;  4CFC A;  1ZBL A;  1BCO A;  1QSY A;  4DQI A;  2EHG A;  1XC9 A;  1NKE A;  3O3H A;  1KTQ A;  1T05 A;  1QS4 A;  4CEE A;  4CGG A;  4AHC A;  3OVN A;  2D0A A;  2KFN A;  4CFD A;  1DLO A;  3AVG A;  1VSJ A;  1VRT A;  1J53 A;  3LAK A;  4CGJ A;  3LAL A;  4H4O A;  4OKK A;  1TGO A;  3DRP A;  1J9A A;  4CHQ A;  3LWL A;  4B9M A;  4FM1 A;  3RMA A;  1QTM A;  2D5R A;  1IH7 A;  1LWC A;  5J2N A;  1HNV A;  3DLK A;  4B8A B;  4E0D A;  4M3U A;  4M3Y A;  4CE9 A;  3OYA A;  3V1Q A;  4EZ6 A;  4LH5 A;  3O3F A;  3DLE A;  4QAG A;  4FJL A;  3U3G A;  4ZHR A;  4HUG A;  4GW6 A;  4FK4 A;  1BGX T; 
#chains in the Genus database with same CATH topology
 3PY8 A;  3K5L A;  2E5L K;  1Q86 O;  1KVC A;  4LY7 A;  2VYP A;  1IJJ A;  1YIJ N;  4CD1 A;  4E7J A;  1RDC A;  2IDO A;  1BL3 A;  4ISG A;  1ZC6 A;  4DG1 A;  5EU7 A;  1KRP A;  4KRE A;  4B1V A;  4C1N I;  4FW2 A;  4ISF A;  3AVJ A;  2GWK A;  5KI6 A;  5J2M A;  2Z1J A;  2PYJ A;  2HVH A;  5SZT A;  4KI4 A;  3KIO A;  4X62 K;  5HLF A;  4DTN A;  2F4V K;  3RSE B;  3VGM A;  4BVO A;  4DU4 A;  4KB0 A;  2W40 A;  3AA5 X;  1I94 K;  2QKK A;  4KHQ A;  3OYN A;  4HCB A;  5BPM A;  1QQO A;  1WNS A;  4BRC A;  3QIP A;  4HTU A;  3DI6 A;  1NGF A;  3MX2 A;  3OS1 A;  3J81 O;  2O8D B;  3H08 A;  4PUO A;  4CF2 A;  1S9E A;  4AIL C;  2X78 A;  4RTF D;  4PKH A;  3ZSV A;  5BPL A;  2YJF A;  1JL1 A;  4KAZ A;  1RDA A;  4M42 A;  3V4I A;  3T7Z A;  4J2E A;  2UUC K;  2J4R A;  3TPQ A;  4B8C A;  3CC4 N;  2QWR A;  2CH6 A;  1YXQ A;  4E1N A;  4EZ9 A;  4GKK K;  1ZBI A;  3DLR A;  4JYA K;  4DTP A;  3ISN C;  4H0O A;  1P8Z A;  3CME N;  1HUX A;  4CZG A;  4RW6 A;  3SCX A;  4RW4 A;  1CZ9 A;  2VWK A;  1S3X A;  5F0X A;  3ID8 A;  3I0S A;  4CVN E;  3PO5 A;  1X9J A;  2PYL A;  1VRU A;  3PX6 A;  5AQG A;  5C25 A;  2FSK A;  4FLT A;  3OY9 A;  1TL3 A;  4WE1 A;  3IRX A;  4BRF A;  3SUQ A;  2QK9 A;  4JLH A;  3OYI A;  4CF9 A;  4U67 L;  3MEC A;  4LF7 K;  3V9W A;  4DF4 A;  3VEV A;  3WXK A;  1T8E A;  5C2D A;  2ETJ A;  4DMN A;  3LDP A;  4IFY A;  3EY1 A;  3AO4 A;  3ZEU A;  2V51 B;  1RDW X;  3I55 N;  1TL1 A;  4CZK A;  3PSF A;  4BRI A;  4XIU A;  3C6A A;  4DTS A;  3MXI A;  2KKZ A;  3SAF A;  2V7Z A;  2XHB A;  4ID5 A;  2Q3S A;  1ATN A;  4J8F A;  1FJG K;  2CGK A;  2YNI A;  4H5R A;  2A40 A;  4PHT X;  1JLE A;  4NCB A;  4K42 A;  3V9S A;  3NMU A;  1BIU A;  5ADX H;  4H0P A;  2WOM A;  3KJV A;  1YVU A;  1RBR A;  4BRL A;  1YIT N;  3WUH A;  3N4P A;  1RTI A;  3CJ9 A;  3O9T A;  4OPJ A;  4JK9 A;  1F21 A;  4FWM A;  2ZJQ L;  1CXU A;  4AHT A;  3RSE A;  4BR0 A;  2D1K A;  2VQF K;  4KH6 A;  1BIS A;  4RWT A;  1NGD A;  2ASP A;  1D5A A;  4JV5 K;  3SLC A;  3M6G A;  5JLF A;  5EOY A;  1WSG A;  2ZGY A;  5FPD A;  1M1K O;  1BCM A;  5AQP A;  2QEX N;  2O8D A;  3SQ0 A;  3BZK A;  4OX9 K;  3VQ5 A;  3ULE B;  2B5J A;  3RMD A;  3DOL A;  4FM0 A;  4CEO A;  2QW9 A;  3AVH A;  3ZSY A;  2XRI A;  3VEY A;  4M63 C;  4HCC A;  4F9O A;  3HM9 A;  3I8B A;  2P9N B;  2IC3 A;  4BRK A;  1HQE A;  1EET A;  2B6A A;  3V81 A;  1VSM A;  3CG7 A;  3VQD A;  2HHU A;  1BUP A;  4CFA A;  3WNG A;  4CEQ A;  4AQY K;  4U7B A;  1XI1 A;  4B3S K;  3V1R A;  3RMC A;  1KLN A;  1CXQ A;  2EX3 A;  3E1Y A;  4DSE A;  3AVN A;  4JRP A;  1HNI A;  3H3N O;  4FO0 A;  3SBT A;  3UKR B;  2FBX A;  3CET A;  1NGJ A;  4Z4E A;  3KLI A;  3VA0 A;  4AM6 A;  4DR2 K;  3PO4 A;  4FWQ A;  4IDH A;  4FLX A;  2ASO A;  2YNF A;  2QWQ A;  3AVF A;  1MU2 A;  5LJV A;  4DU1 A;  5AJ3 K;  3J8A A;  1DTQ A;  5M1O A;  2P9I B;  3VER A;  5FRN A;  1FXX A;  3QIN A;  2X6N A;  3VEN A;  4B1X B;  2PAV A;  2FSJ A;  4DQR A;  3OBW A;  2NRR A;  3OYC A;  4GV9 A;  3VEO A;  4CJK A;  4M3X A;  2F8S A;  1YI2 N;  1RGI A;  4DV1 K;  4C8K A;  3VTI A;  3TSU A;  4Z4F A;  2YNG A;  1C1A A;  3GBT A;  3VPZ A;  3UKU B;  3PUF A;  3HI0 A;  4WFB L;  1VQP N;  1KD1 O;  2UXD K;  4F2R A;  4PWD A;  4KHU A;  4LSL A;  3EKS A;  4FW1 A;  4X65 K;  5CYQ A;  1LW2 A;  1HLU A;  4JAX A;  2FC0 A;  3MCP A;  3HP6 A;  1VQ9 N;  1JLC A;  3THY B;  4O5B A;  1YAG A;  3FZL A;  1KAZ A;  4WQ4 C;  4BE1 A;  1VSE A;  2VCP A;  2FBT A;  4AH9 A;  3QIO A;  5HRN A;  3CQY A;  4A5A A;  4JI5 K;  2YJE A;  4DS4 A;  2KLA A;  5FPE A;  2RF2 A;  5TKW A;  1TKZ A;  5CYM A;  3VGK A;  3LAN A;  2GEM A;  1LAV A;  4CF0 A;  2P1J A;  3OBY A;  4CGH A;  2E6M A;  2P9N A;  4CHP A;  4JI6 K;  2VG7 A;  2OZM A;  1TYQ B;  4H0Y B;  1QQC A;  2IAJ A;  4A57 A;  4BDP A;  3QEX A;  1S1W A;  1VSD A;  1O1W A;  4WQ5 C;  4CJF A;  4DV5 K;  4JD2 B;  4FYD A;  3R3L A;  2V52 B;  3K9K A;  1YTA A;  3N4Q A;  4Z4I A;  2DFF A;  4ILJ A;  3NGI A;  1K73 O;  3UKR A;  5AQR A;  5I42 A;  1NK0 A;  3D2E B;  3BZC A;  5AQY A;  1ASW A;  2ZWH A;  2ZE2 A;  4ELU A;  4CJW A;  3LDL A;  3MN9 A;  4BRP A;  3L8B A;  1TK5 A;  2JWK A;  1NKB A;  2KFZ A;  3QBX A;  1IG9 A;  3BEX A;  1U2V B;  3O9Q A;  4GV6 A;  2P9I A;  4EP4 A;  2O8E B;  4BG9 A;  4H0X B;  4DR5 K;  4CIG A;  4H5T A;  4M7Y A;  5KPZ A;  4DSL A;  2A42 A;  4FJ7 A;  3FZF A;  3OJU A;  4H5W A;  2YHB A;  5BRE A;  1VAZ A;  5I9E B;  1Q18 A;  4IEE A;  3HT3 A;  2OTJ N;  5KTQ A;  1S22 A;  4FZZ A;  2HHQ A;  1VSF A;  3TI0 A;  1ATR A;  3UKU A;  2XY5 A;  1JLB A;  2DY4 A;  1TV6 A;  1VQN N;  4PY5 A;  4B3M K;  4JK8 A;  2WC9 A;  3LDS A;  1WAF A;  4PA1 A;  1SV5 A;  4FWN A;  3L2Q A;  3CCU N;  3M1F A;  4DU3 A;  3DXK B;  2HF3 A;  3NVM A;  3P31 A;  4M41 A;  1RT2 A;  3VQ6 A;  2YHX A;  4FWK A;  2PY5 A;  4BRD A;  1QSL A;  1BQN A;  5AFU H;  3K2P A;  4LF5 K;  3TR8 A;  3HYF A;  2F8T A;  3HSC A;  1K8A O;  1XQS C;  4NB4 A;  3F9K A;  1IBM K;  4BRG A;  1JXB A;  2E2O A;  2Q1N A;  1IKW A;  4IEI A;  1JCE A;  5DK5 A;  3VTH A;  3THW B;  1ZBL A;  4DQI A;  2EHG A;  1N34 K;  1HKC A;  1R59 O;  3O3H A;  3VEZ A;  4CGG A;  4CEE A;  4AHC A;  2D0A A;  3KWI A;  4CFD A;  3AVG A;  3OHR A;  1VSJ A;  2O8C B;  1T6C A;  4YOV A;  3LAL A;  4OKK A;  1TGO A;  1J9A A;  3LWL A;  1TYQ A;  3A5M C;  4B9M A;  2WUS A;  5J2N A;  3PLA A;  4ZHR A;  1E4G T;  4KH4 A;  4Z4G A;  3M8P A;  1Z6R A;  1JL2 A;  1E3M A;  4YOU A;  1LW0 A;  1ITG A;  4Z4C A;  5AQK A;  4B9S A;  4O0I A;  4YDU A;  3IMX A;  3S3O A;  5EVZ A;  3NFA A;  1SL2 A;  5K14 A;  5HOO A;  1NGB A;  4L3Q A;  4A2A A;  3NDK A;  3AVB A;  1ILY A;  1U2V A;  3EO3 A;  2O8E A;  5M1P A;  4O0J A;  5AQU A;  1NJY A;  3S41 A;  2HB5 A;  3O80 A;  3ZT3 A;  1N33 K;  4WQ4 A;  1L3V A;  3JYT A;  2I7N A;  5JVG L;  1RDB A;  5E41 A;  5EX5 A;  1FKP A;  4CEB A;  5M1N A;  2P5O A;  3TAQ A;  1NJZ A;  3HRG A;  3QFP A;  3S3M A;  3QIC A;  3D2F A;  1HJO A;  4KHN A;  3HPO A;  3O4N A;  4E3S A;  4BRO A;  1V4S A;  1XWL A;  4RW7 A;  5ADX A;  5HRP A;  3C7N B;  2VG5 A;  3LAM A;  3HST B;  4QS8 A;  1RT7 A;  2QWN A;  1Z25 A;  5C12 A;  4JKH A;  1SKR A;  3PIO L;  4DR3 K;  1N5Y A;  4CCH A;  3WT0 A;  1BG3 A;  1OH8 A;  3CPW M;  3J7A P;  4ELV A;  4YOW A;  2XY6 A;  3V1O A;  3DRS A;  2DFE A;  1HNX K;  3TAM A;  1HR0 K;  3DXM A;  3KKR A;  3FLC O;  1FW6 A;  4PQU A;  4I9L A;  4BC5 A;  4DQS A;  4CHN A;  2A1S A;  4NXN K;  3LM9 A;  4WQ5 A;  3CI5 A;  5BRH A;  1GLJ O;  2G8V A;  1N36 K;  3WEE A;  1JKH A;  2OTL N;  2Q2R A;  3DYA A;  1L3U A;  4I7F A;  1KFS A;  2YKM A;  3SNN A;  3THW A;  2QM1 A;  1U4B A;  3DWL A;  3IAY A;  4WYB A;  3AO2 A;  2JGU A;  3CFR A;  4IFE A;  3C94 A;  4HUF A;  1WAJ A;  2E2Q A;  2OZS A;  3ID6 A;  1BQM A;  4V19 S;  2O8C A;  1GLF O;  3C65 A;  5KRS A;  3L4I A;  2WFB A;  3MMV A;  3J80 O;  5ELZ A;  4E7K A;  4LFC K;  1REV A;  3MN7 A;  4CER A;  4BR2 A;  4J2D A;  3KD5 E;  1NGC A;  1OH6 A;  2P9P A;  5KRT A;  4JI3 K;  5AQM A;  3PSI A;  4L8R B;  2IGI A;  2NRH A;  2RKI A;  3ATV A;  3KZB A;  4W5O A;  4Z94 A;  4FJG A;  1T6D A;  3K9J A;  4UY8 O;  3UE5 A;  3E66 A;  3OYL A;  2KZM A;  2CH5 A;  3AA2 A;  2KZZ A;  1VSI A;  4KH5 A;  2HMI A;  4CGF A;  2FBV A;  2HBL A;  1VQ6 N;  3NAE A;  1KAY A;  2PFU A;  3H6E A;  4GVE A;  2CGJ A;  1VSK A;  3KK2 A;  3L2W A;  3OS2 A;  4DV4 K;  3HL8 A;  3AAP A;  4JKG B;  1VQ5 N;  4OLB A;  1TAU A;  3MN5 A;  2A6A A;  3NH2 A;  4JI8 K;  2F7T A;  1RBS A;  1B92 A;  3AVK A;  4DSI A;  1BWF O;  3SQ4 A;  4GY2 B;  4CZM A;  4YY3 K;  5CY4 A;  3OYJ A;  1XNQ K;  5JIC A;  1Q7Y O;  4K43 A;  3DOK A;  4FLZ A;  4FJ5 A;  4GNI A;  4F8R A;  1K8K B;  1EWR A;  1H1V A;  3ZYY X;  2F96 A;  1VQK N;  4YOX A;  1Q82 O;  4RW8 A;  4C8O A;  1HYV A;  1NBW A;  4IXC A;  4K0K K;  4AHV A;  2OAN A;  3HVR A;  2X74 A;  3ZET B;  4ILH A;  4BE2 A;  4W5R A;  3ULD A;  1JLF A;  1NNE A;  1BOT O;  3O4W A;  2E8A A;  1S1V A;  3HZ6 A;  1W7A A;  4DHY A;  3VF6 A;  1KAX A;  4KB1 A;  2QWM A;  1A5X A;  4CBX A;  4GMJ B;  3TSP A;  4WF9 L;  3K0S A;  1ESV A;  4DFP A;  4E19 A;  1J5O A;  4FWR A;  4CZL A;  3CJA A;  3F2K A;  1BA0 A;  4B9T A;  4YOR A;  3E01 A;  4EHT A;  2FF6 A;  2I7P A;  4B1W B;  3NVK A;  3K57 A;  2VGM A;  2HBM A;  3Q7C A;  4CJU A;  4BE0 A;  3MK6 A;  3VQC A;  4C8N A;  4EAH D;  3L6Q A;  1U6Z A;  4C1N K;  2P9U B;  5JS1 A;  4CZF A;  1RFQ A;  4LFA K;  4E7L A;  1C0U A;  1Y97 A;  1YUW A;  4O44 A;  1CZA N;  3G10 A;  3L3V A;  3MN6 A;  2KTQ A;  3T1A A;  4KPY A;  1QVF M;  4IFV A;  3ZX2 A;  4PL7 A;  3V6D A;  3SMS A;  1S6Q A;  4H0T B;  3IDH A;  5AQW A;  2G8I A;  3KD1 E;  4CK3 A;  4NLB A;  3U4L A;  3OTO K;  1V4T A;  1ASV A;  3A0I X;  1MA9 B;  4W5T A;  4A5B A;  3EN9 A;  3O1W A;  4CEF A;  2EWS A;  1QHT A;  3F73 A;  1SL1 A;  4ZTJ A;  2Q0R A;  4FWP A;  4RG8 A;  4LD0 A;  4DLG A;  2GUI A;  2D0C A;  5JMV A;  3SUO A;  1A5W A;  4IKF A;  3ZLJ A;  3WXM B;  1NOZ A;  3EZ5 A;  2AP1 A;  4G1Q A;  4JKC A;  4MO4 A;  4DLE A;  3RMB A;  4DV0 K;  2HMP A;  3SUP A;  3G71 N;  3S9H A;  4FJ9 A;  1GLE G;  3QEW A;  4DSJ A;  3JSM A;  3LWM A;  1UWB A;  4CJQ A;  5I3U A;  4JKE A;  1OVY A;  2B4J A;  2WBN A;  3FZK A;  4E7I A;  3M5R A;  1L3T A;  4C23 A;  3DJC A;  3RTV A;  2BAN A;  1SS6 A;  3AVI A;  1HJR A;  4K8X A;  4H5V A;  4UQG A;  3HBT A;  5AFU A;  4FWS A;  5AZJ B;  5E26 A;  5FPN A;  4CIF A;  4A62 A;  1T03 A;  3ZT2 A;  3PX0 A;  1P90 A;  3OA9 A;  4FVM A;  3KK3 A;  2ZF5 O;  3WXJ A;  1X1P A;  1CZB A;  4E1M A;  4WFA L;  2UXB K;  4BVP A;  4CJE A;  3OW2 M;  4CGD A;  3AV9 A;  4FK2 A;  4FJJ A;  5C0Y A;  3LDO A;  3SPZ A;  4FK0 A;  1RBU A;  4BWM A;  5BRD A;  2AJQ A;  3OYM A;  3L2V A;  1EO1 A;  3NHG A;  3CQ8 A;  4DR6 K;  3KK1 A;  5IT9 O;  4JI2 K;  3SAH A;  4JKA A;  3LDQ A;  4KTW A;  2Y1J A;  4GV3 A;  4DWI A;  2NUB A;  2BH1 A;  4FJK A;  1WSI A;  5LMU K;  4DFK A;  1HNZ K;  1SZ2 A;  4DTO A;  2ITM A;  3ZT0 A;  1IBL K;  1DGK N;  4LFB K;  4XH5 A;  5F2R A;  3A5O C;  3L2U A;  4DV3 K;  4N47 A;  3QEV A;  5GAD P;  1HKG A;  5LY3 A;  2ITG A;  3J7Z O;  1RIL A;  4YDU C;  3AAQ A;  3SV4 A;  3E9O A;  2YNH A;  3O08 A;  4NCG A;  3NH1 A;  3K5O A;  3TTC A;  3ZSW A;  4H03 B;  4K25 A;  3SQ2 A;  5KPT A;  1S6P A;  4M3R A;  3QES A;  1HRH A;  2A1R A;  4Q0B A;  1ZBF A;  4EFH A;  1NKC A;  4CZJ A;  1QSY A;  3CCL N;  1BCO A;  1JJ2 M;  1XC3 A;  1NKE A;  2FXU A;  1KTQ A;  4EHU A;  1QS4 A;  5BPN A;  4CZH A;  4YOY A;  4BR5 A;  4DCH A;  4LF8 K;  1J53 A;  4DR4 K;  4H4O A;  4DKW A;  1KC8 O;  2Q0U A;  2D5R A;  3ULE A;  4E0D A;  3OYA A;  4YOT A;  1ATS A;  4EZ6 A;  2H3G X;  5AQS A;  3O3F A;  2O8B B;  3U3G A;  4HUG A;  4FK4 A;  2G8W A;  5MLC Q;  3ZSR A;  2E1Y A;  3HPG A;  1XNR K;  1KLM A;  2NNW A;  5JLH A;  1Z05 A;  4ID1 A;  3V9X A;  4BRQ A;  4LSN A;  1N6Q A;  5AZJ A;  3KK7 A;  5FDL A;  3MXJ A;  3VES A;  4BR4 A;  1KSP A;  1GLD G;  3MWT A;  1QVG M;  2P9K B;  1R0A A;  3FFK B;  3CIP A;  4ZTF A;  1YTU A;  1EX4 A;  4JKD A;  3H3O B;  3VQE A;  1WBB A;  1K6Y A;  4JNE A;  3OYD A;  1GOB A;  4NYN A;  1UA1 A;  3SUN A;  3ENH A;  3HP9 A;  4WFN L;  4E7H A;  4BC3 A;  2RN2 A;  3BP8 A;  2WON A;  1DTT A;  3DLH A;  4CGI A;  2OYQ A;  2O4G A;  3MED A;  1RNH A;  5KGW A;  2W6L A;  1JLQ A;  4JRQ A;  2ZM6 K;  4Y1C A;  1NM1 A;  1C0T A;  4CBW A;  1XHX A;  1B9D A;  4CJS A;  1VHX A;  1YJ9 N;  2NRZ A;  1RTH A;  1SQK A;  3I56 N;  2IS3 A;  4KO0 A;  1C6V A;  3CF5 L;  5BRF A;  3QDK A;  3ZT4 A;  4DTX A;  1IO2 A;  2OPQ A;  4B1Z A;  2O8F B;  4BRN A;  3NE6 A;  1TK8 A;  4BC4 A;  5JS2 A;  3ZSZ A;  3NBP A;  3KLF A;  5C2F A;  3UB5 A;  1WSH A;  3SBG A;  5SWM A;  3R8E A;  5HRS A;  3CM5 A;  4PKG A;  3MCA B;  3HJF A;  1RT6 A;  4Z0U A;  2IVN A;  4CHZ A;  1IKX A;  2HNY A;  4JHD B;  4DTU A;  3VN5 A;  3THY A;  3WXL A;  1U04 A;  3RR8 A;  3AA4 A;  3OYB A;  2BUP A;  1BIZ A;  3C0B A;  5AQX A;  1JXE A;  3IS9 A;  3BUZ B;  4F3O A;  4XEI A;  3C95 A;  2UXC K;  4CEA A;  1TKD A;  4B9Q A;  4CHO A;  5GAE P;  3ZSO A;  3AVL A;  1C0F A;  4Y0W A;  1S72 N;  1XMQ K;  4A61 A;  3ZCM A;  1LWF A;  4LF9 K;  3BF3 A;  3C6H A;  1DT9 A;  4B9V A;  4H5N A;  4IG0 A;  3LP1 A;  1SUQ A;  3ENB A;  1BO5 O;  2Z1H A;  2YI1 A;  4M3T A;  2GBZ A;  4JKF A;  4XH1 A;  4Y1D A;  4BRA A;  3BGR A;  5J2Q A;  4CD3 A;  1DEJ A;  3B8A X;  2P9K A;  3A2F A;  1TUY A;  2RE2 A;  3GDQ A;  3GOI A;  3F9M A;  4JD2 A;  5BR8 K;  3OYH A;  3SMP A;  3S3N A;  1WSE A;  3CJC A;  3MXM A;  2YX6 A;  4ICL A;  4CJ3 A;  4O5F A;  3CQX A;  3AGR A;  2D0O A;  4OKJ A;  3P4I A;  4CEC A;  4Z4H A;  4FXD A;  2PZS A;  2E88 A;  4N56 A;  4YHH K;  3D2E A;  3EKU A;  4FPB A;  3U3Y A;  2HVI A;  1QE1 A;  1D4X A;  1C1B A;  3NGZ A;  3HVT A;  4CF1 A;  1RCH A;  3CHW A;  1GOC A;  1J5E K;  4W5N A;  3CMA N;  4FZY A;  5H1S Q;  3EL2 A;  2YKN A;  4A2B A;  4K8Z A;  1JLA A;  4MLE A;  4CJ7 A;  4JI4 K;  4X64 K;  2ASM A;  4ILG B;  4BG8 A;  4IJN A;  3OYK A;  1HX1 A;  3R6M A;  1D9D A;  2RHK A;  3VQA A;  1MWM A;  1BDG A;  4HHT A;  1O13 A;  4CIE A;  5HRO A;  4DFJ A;  2GTD A;  3KTQ A;  1BI4 B;  3D6R A;  3QFU A;  4O8K A;  3CFP A;  1NGA A;  2FLO A;  4KHW A;  1C0G A;  4IBN A;  3P1G A;  3WQU A;  4BDY A;  3QET A;  1W97 L;  2LSN A;  5J1E A;  5IWA K;  4FJN A;  3TU5 A;  3NF8 A;  3SV3 A;  1VQ8 N;  1X9S A;  3U9D A;  2HW3 A;  1WN7 A;  5CZ1 A;  3MX5 A;  3VEX A;  4CJV A;  3P39 A;  3QNN A;  3CPE A;  4DFM A;  4FM2 A;  2NRT A;  1C0M A;  3NF6 A;  3QO9 A;  3VGL A;  4JHD A;  3K5N A;  2XY7 A;  5HP1 A;  3R1X A;  4YNQ A;  3DXK A;  3OYF A;  1W2B M;  4C8L A;  4KTQ A;  4CW7 B;  1NG9 A;  3TAE A;  1XUP O;  2QTD A;  4LH4 A;  1X9M A;  1FK9 A;  1BU6 O;  3IG1 A;  3VF2 A;  1TKX A;  5AQN A;  3RRG A;  2G8F A;  4CJ5 A;  1NK4 A;  5AR0 A;  2IOC A;  1Q8I A;  1WLJ A;  2F9T A;  2X6S A;  3O9R A;  4B9U A;  1YVN A;  1RT1 A;  2VWB A;  2OPP A;  4IOC L;  1Q9X A;  2KW4 A;  5FLX O;  2VQE K;  2HHH K;  4FOI A;  1NGH A;  3SPY A;  4JS5 A;  1W0H A;  3TWH A;  5BN8 A;  1NK9 A;  3OJS A;  1SL0 A;  1HKB A;  5AQJ A;  2F9W A;  4B3R K;  3K59 A;  4JS4 A;  1UOC A;  5FPM A;  3HPH A;  4FJX A;  4BRE A;  2UUA K;  4EIA A;  3GL1 A;  1S1U A;  3TTD A;  3M3Z A;  1EXQ A;  3RRH A;  1NK6 A;  5AZI B;  3AVA A;  3EYZ A;  4E1J A;  3D45 A;  1L3S A;  5BN9 A;  4FOE A;  3CD6 N;  4BGA A;  1Q81 O;  4OPH A;  3G6E N;  3CFO A;  2P9L B;  3TSQ A;  5AQO A;  2A3Z A;  3TAR A;  4DR7 K;  2HND A;  1WSJ A;  3DM2 A;  3HOS A;  4IOA L;  4OGE A;  2VWJ A;  2HF4 A;  3E9L A;  5T7B A;  4OJR A;  1BI4 A;  4KTZ A;  3RR7 A;  4CFB A;  4CHY A;  4I2P A;  4CI6 A;  4B9L A;  2KHO A;  3VQ4 A;  4EP5 A;  1ZYQ A;  1OH7 A;  1M90 O;  4PKI A;  4F4K A;  3QEP A;  1TVR A;  4BC2 A;  2HNZ A;  5AQT A;  3LZI A;  3HXM A;  5B8H A;  3MAQ A;  1TAQ A;  3CCS N;  2BE2 A;  4KRF A;  1HYS A;  2GX9 A;  3O9S A;  3C7N A;  3A5L C;  5TKY A;  4CJL A;  2QWO A;  3A5N C;  3ZX0 A;  3WNE A;  2VGN A;  2ZGZ A;  3WNF A;  1OVQ A;  3LPT A;  3LP3 A;  1G15 A;  4DSK A;  2Q97 A;  1N32 K;  2CGL A;  3A8Y A;  3VQP A;  3L0Q A;  4J2B A;  3M8R A;  3CCM N;  5C15 A;  1NLV A;  5HBM A;  1GOA A;  4E89 A;  2Y1I A;  4NYF A;  1Q9Y A;  3ITH A;  1WOQ A;  3FZM A;  3OS0 A;  1C1C A;  3CJ1 A;  1HQU A;  5HL7 L;  1IV0 A;  1KVB A;  1ZXO A;  4I2Q A;  4MQ3 A;  1UA0 A;  4LF4 K;  4NCA A;  3LL3 A;  3SJH A;  4F2S A;  4I6M B;  1MWK A;  4CES A;  1JLG A;  4KHY A;  3KLE A;  3K5M A;  2GEL A;  5AQL A;  4AHU A;  3L4Q A;  3ASM A;  5JVH L;  3NH0 A;  1JCF A;  4QOZ B;  3JS6 A;  1S9G A;  2W41 A;  2W42 A;  2GV9 A;  2QWP A;  3THV A;  3G0Z A;  1T44 A;  1QHA A;  2P9S B;  1N8R O;  1RDD A;  2O4I A;  3VMF B;  4JKB A;  4BRM A;  3EE9 A;  4FCY A;  4CZI A;  2W6K A;  3SZ2 A;  4MO5 A;  2UU9 K;  4CEZ A;  1ZBH A;  2DPN A;  5DM6 L;  3U6F A;  2RPI A;  3CC7 N;  4BWJ A;  3CCV N;  4CJR A;  4NXM K;  1HMV A;  2UYT A;  3LDN A;  2BGG A;  3T1H K;  3NGY A;  5AZI A;  5GAG P;  1X3M A;  1XHZ A;  3I8D A;  3TAF A;  1EQY A;  2ZJP L;  3WXI A;  4Q5V A;  2GWJ A;  5AQI A;  4PL8 A;  4R5P A;  2P9L A;  4GKJ K;  2QI2 A;  4CJ4 A;  4DV2 K;  4JI1 K;  4CFC A;  1NWK A;  4JKG A;  2BTF A;  3W3D A;  3CCR N;  3OVN A;  1YF5 L;  5F1X A;  1VRT A;  3LAK A;  4CGJ A;  3ATU A;  3E9P A;  4CHQ A;  3DRP A;  3G25 A;  1YJW N;  1NGG A;  4ISE A;  1QTM A;  1NU0 A;  1LWC A;  1HNV A;  1NMN A;  4CE9 A;  4G9Z A;  3DLE A;  4FJL A;  1RDU A;  1VQO N;  2A41 A;  5FRM A;  3CM6 A;  3U8X A;  1K8K A;  5CR4 A;  3AA3 A;  5M1Q A;  3VA3 A;  5GAH P;  4CJP A;  4HVJ A;  3CC2 N;  3H1V X;  3JAM O;  1ZBS A;  1IG8 A;  1NOY A;  3V9Z A;  3ZET A;  3H1Q A;  4BGB A;  1KFD A;  2E6L A;  2OA8 A;  3EE8 A;  3TAB A;  1D8Y A;  3ALY A;  5J2P A;  4HUE A;  1D9F A;  4FLY A;  1WBD A;  4K41 A;  3TAP A;  4IZ9 A;  2YCH A;  3SQ1 A;  4WCE L;  4I6M A;  1RBT A;  4JEP A;  2NRW A;  2AA4 A;  5A2Q O;  2E20 A;  3QLH A;  2G8K A;  5LL6 Z;  1NJI O;  4BRH A;  4FWO A;  2OCE A;  3VEW A;  3SI6 A;  3KLG A;  2BDP A;  1TK0 A;  3P5J A;  1G99 A;  2ZJR L;  4KBO A;  4MDA A;  2VG6 A;  3M8S A;  1YHQ N;  4FVU A;  4B08 A;  1HNW K;  2D4W A;  3EZW A;  1QQN A;  4B1Y B;  1WB9 A;  2P9S A;  4QCL A;  5DMR A;  3Q7B A;  3UIQ A;  2P9U A;  1Z26 A;  1LOT B;  2OPR A;  3TAG A;  1TUU A;  3VQ7 A;  3O8M A;  2QXL A;  4IWV A;  4FJH A;  3VOV A;  1JCG A;  4DV6 K;  2ZQB A;  3OYE A;  3ZSQ A;  3CCQ N;  4XH4 A;  3SK3 A;  3T1Y K;  3CJB A;  5C24 A;  1NGE A;  3T19 A;  3M8Q A;  4KFB A;  3O9U A;  3J7Y P;  5KQ8 A;  3AO5 A;  1HPM A;  1WSF A;  4OKE A;  2FF3 B;  2YHW A;  4NO7 A;  4BR9 A;  5KPR A;  1KQS M;  2IIR A;  3QB0 A;  2Q36 A;  4OGC A;  1EWQ A;  3ZT1 A;  3KKS A;  5CHI A;  4H8K A;  1EKE A;  1S5J A;  3KLH A;  4MLH A;  5AQQ A;  1VQL N;  3C6U A;  4KV8 A;  3T69 A;  4O4G A;  3LP0 A;  4OLA A;  5AQH A;  3FZH A;  5KQD A;  4JI7 K;  4FJI A;  4FL9 A;  3DLG A;  4KHS A;  2NRV A;  2QWL A;  2OPS A;  2YHA A;  3B6P A;  2ZD1 A;  3V9U A;  1DKG D;  1B9F A;  4M7X A;  1XMO K;  4OVL A;  4GVM A;  4IO8 A;  1SAZ A;  5LJW A;  1YJN N;  3LM2 A;  4M3Z A;  1U45 A;  5CE3 A;  4HTL A;  5M1F A;  1MDU B;  3FR0 A;  4KI6 A;  3BF1 A;  3P83 D;  2NLX A;  3H45 C;  1NMD A;  4C8M A;  2Q31 A;  3TAN A;  3T3F A;  3THX B;  4DTM A;  4RCH A;  2IVP A;  1E4F T;  5M1K A;  3B6O A;  4DSF A;  3H46 O;  3AO3 A;  4BQZ A;  1I3A A;  3IUC A;  5GIN A;  4FZX C;  1W9H A;  3P38 A;  4DV7 K;  3I33 A;  3VQ8 A;  2HHV A;  3R9P A;  3HOT A;  1X3N A;  4JI0 K;  3I0R A;  1TKT A;  2FSN A;  4DS5 A;  3CCE N;  1VSH A;  3IKM A;  1QQM A;  2HOE A;  3LP2 A;  3KVG A;  5GIO A;  4FPA A;  4JN4 A;  1NJX A;  1LWE A;  4IJA A;  4CJT A;  4B3T K;  2YV0 X;  3HK2 A;  5D3G A;  1BHL A;  3F5T A;  3AVC A;  1T7P A;  3MEE A;  4X66 K;  3AO1 A;  4B3O A;  4KHP K;  1ZBU A;  4M45 A;  4OPK A;  4DF8 A;  4DR1 K;  1RBV A;  4FWL A;  1J54 A;  3D7E O;  4MFB A;  3AY9 A;  3FGU A;  3PIP L;  1U49 A;  4DB3 A;  1Y64 A;  4FSV A;  2QKB A;  3VQB A;  3AGK A;  5AQZ A;  1HYZ A;  3DRR A;  2UUB K;  4CED A;  4HWI A;  4FJM A;  1K9M O;  2A5X A;  3WQT A;  3GG4 A;  5KGX A;  3QBW A;  4O8U A;  4IDK A;  1I39 A;  3PX4 A;  3CYM A;  2P5G A;  4NLC A;  3FE1 A;  3QER A;  3O6W A;  3NF7 A;  4W5Q A;  3D2F B;  4OPA A;  4JK7 A;  3AVM A;  2P51 A;  3VF4 A;  1VQM N;  4RW9 A;  4BAC A;  2WTU A;  1QSS A;  2G8U A;  1RTD A;  1U47 A;  1QZ5 A;  2JLE A;  4QS7 A;  4IO9 L;  5E84 A;  1VQ4 N;  3DXM B;  3FFI A;  3SAG A;  3DMJ A;  2O8B A;  4LC9 B;  4FLU A;  4DTR A;  4KKO A;  3LZJ A;  5GIP A;  2NRX A;  3HTV A;  4O55 A;  3W0L A;  3WEE B;  4M3W A;  2Z1I A;  1T3V A;  3GE1 A;  5CZ2 A;  4IOX A;  3ZSX A;  4A59 A;  1UAX A;  5C10 A;  3THX A;  4CK2 A;  2E4L A;  3QEI A;  4DQP A;  5HRR A;  3IFR A;  3DLL L;  2HBK A;  4CBU A;  4DUY K;  2HHX A;  4OO1 J;  4MDB A;  1GLL O;  3NCI A;  2DTU A;  2XO7 A;  3DLB A;  1OKJ A;  5EY4 A;  3VET A;  1BA1 A;  2P9P B;  5AQV A;  2G8H A;  4DTJ A;  4FLW A;  1S1T A;  4F3T A;  3KHY A;  4N76 A;  1L5U A;  5FRO A;  1NK8 A;  3DAW A;  3O5B A;  4I9Q A;  3D0P A;  1GLA G;  2R7Y A;  4CZE A;  4B9N A;  1KVA A;  2FBY A;  2E2N A;  3KWG A;  4QS9 A;  3LPU A;  1RT3 A;  4ELT A;  1OH5 A;  3L2R A;  2O8F A;  3RVC A;  4FJ8 A;  4J2A A;  3SYZ A;  3MDQ A;  2YHY A;  3CCJ N;  4H0V B;  5LMN K;  1SKW A;  3CER A;  3RWU A;  2XY8 A;  3TTF A;  1S1X A;  3O4Q A;  2PBD A;  2Z1G A;  4BQL A;  4AF1 A;  2E2P A;  2V7Y A;  2DFH A;  4BY9 C;  2I5J A;  1VSL A;  2D0P A;  4AHR A;  4CK1 A;  1FKO A;  3BY5 A;  1J6Z A;  3VQ9 A;  3O1B A;  1YT3 A;  1A5V A;  4DQ8 A;  3BDP A;  1X9W A;  2NZT A;  3CJ7 A;  4AHS A;  1NJW A;  2ATQ A;  4N41 A;  3O3G A;  3EEQ A;  3K58 A;  1RTJ A;  3HM8 A;  3WNH A;  4DQQ A;  5EXW A;  2GUP A;  4H4M A;  3ZX3 A;  3VQQ A;  4N5S A;  2HHW A;  5C42 A;  4CF8 A;  1VK0 A;  5BR9 A;  3L3U A;  2D0B A;  4B1U B;  2KQ2 A;  4AM7 A;  4BDZ A;  1IBK K;  1ASU A;  4BR7 A;  4YFU A;  4IG3 A;  2QXF A;  3G4S N;  1GLC G;  2HHS A;  1RT4 A;  3C6T A;  1QZ6 A;  1NK5 A;  1EP4 A;  4TSX A;  2IVO A;  3NF9 A;  1NK7 A;  1CLQ A;  1RT5 A;  1LCU A;  3MWP A;  1GLB G;  3PV8 A;  1HPZ A;  2HBJ A;  1U48 A;  3QNO A;  1IKV A;  2HHT A;  5AQF A;  3OYG A;  1IKY A;  3SJJ A;  1SKS A;  4FLV A;  1KCF A;  2HST A;  3CXC M;  3HO1 A;  3MEG A;  1LV5 A;  1LAW A;  2E1Z A;  4R79 A;  1XC9 A;  4DUZ K;  1KXP A;  3QML A;  1WUA A;  1T05 A;  1NGI A;  2KFN A;  1DLO A;  3U9Z A;  4LF6 K;  1VQ7 N;  3ZEU B;  4FM1 A;  3AAR A;  3RMA A;  1IH7 A;  4M3Y A;  3DLK A;  2QA4 N;  3ENO A;  4B8A B;  4M3U A;  5DM7 L;  3V1Q A;  4LH5 A;  4QAG A;  2JWL A;  4GW6 A;  3JXU A;  1BGX T; 
#chains in the Genus database with same CATH homology
 2G8W A;  3PY8 A;  5FRM A;  3CM6 A;  3ZSR A;  3HPG A;  3K5L A;  4Z4G A;  3M8P A;  3AA3 A;  1KLM A;  1KVC A;  3VA3 A;  1JL2 A;  4LY7 A;  4CJP A;  4ID1 A;  3V9X A;  4E7J A;  4LSN A;  1RDC A;  1N6Q A;  4HVJ A;  1LW0 A;  1ITG A;  2IDO A;  1BL3 A;  4Z4C A;  5FDL A;  4B9S A;  3MXJ A;  4DG1 A;  5EU7 A;  1KSP A;  1KRP A;  4O0I A;  4KRE A;  1NOY A;  3V9Z A;  4FW2 A;  1R0A A;  1KFD A;  2E6L A;  2OA8 A;  3AVJ A;  3TAB A;  1D8Y A;  3ALY A;  5J2P A;  4I9Q A;  5KI6 A;  4HUE A;  4ZTF A;  3S3O A;  1D9F A;  1EX4 A;  4FLY A;  1YTU A;  5J2M A;  3NFA A;  1SL2 A;  5K14 A;  2Z1J A;  3VQE A;  2PYJ A;  1K6Y A;  5SZT A;  2HVH A;  3TAP A;  3OYD A;  4KI4 A;  3KIO A;  1GOB A;  4NYN A;  1UA1 A;  3NDK A;  3AVB A;  3SQ1 A;  5HLF A;  3SUN A;  4DTN A;  3HP9 A;  4E7H A;  2RN2 A;  2WON A;  1RBT A;  4DU4 A;  1DTT A;  3DLH A;  4O0J A;  4KB0 A;  4CGI A;  1NJY A;  3AA5 X;  2OYQ A;  3QLH A;  2HB5 A;  2O4G A;  2G8K A;  3MED A;  1RNH A;  3ZT3 A;  5KGW A;  2QKK A;  4KHQ A;  1L3V A;  3OYN A;  3JYT A;  4HCB A;  3SI6 A;  3KLG A;  1JLQ A;  1WNS A;  4JRQ A;  2BDP A;  1TK0 A;  3P5J A;  3QIP A;  4Y1C A;  1RDB A;  4HTU A;  5E41 A;  3DI6 A;  1FKP A;  4CEB A;  1C0T A;  2P5O A;  3OS1 A;  3TAQ A;  1NJZ A;  2VG6 A;  3M8S A;  1XHX A;  3H08 A;  1B9D A;  4PUO A;  4CJS A;  4CF2 A;  1S9E A;  4AIL C;  4B08 A;  2X78 A;  3S3M A;  3ZSV A;  1RTH A;  4KHN A;  1JL1 A;  4KAZ A;  1RDA A;  2IS3 A;  3HPO A;  3V4I A;  4KO0 A;  4M42 A;  1C6V A;  3O4N A;  4E3S A;  4J2E A;  3ZT4 A;  4QCL A;  4B8C A;  1XWL A;  4RW7 A;  5DMR A;  5HRP A;  4E1N A;  2VG5 A;  3LAM A;  4DTX A;  1IO2 A;  2OPQ A;  3HST B;  4EZ9 A;  3UIQ A;  1Z26 A;  1RT7 A;  1Z25 A;  1ZBI A;  3DLR A;  2OPR A;  3TAG A;  1SKR A;  4CCH A;  4DTP A;  1N5Y A;  3NE6 A;  1TK8 A;  3ISN C;  4ELV A;  2XY6 A;  3VQ7 A;  3V1O A;  5JS2 A;  3DRS A;  3NBP A;  2DFE A;  3ZSZ A;  3TAM A;  3KLF A;  3KKR A;  4PQU A;  1WSH A;  4I9L A;  4DQS A;  5SWM A;  4CHN A;  2A1S A;  4RW6 A;  5HRS A;  4FJH A;  3SCX A;  4RW4 A;  1CZ9 A;  2VWK A;  3CM5 A;  3HJF A;  1RT6 A;  3I0S A;  4Z0U A;  2ZQB A;  3OYE A;  3ZSQ A;  4CHZ A;  3PO5 A;  1IKX A;  2PYL A;  2G8V A;  2HNY A;  1JKH A;  4DTU A;  1VRU A;  3VN5 A;  3DYA A;  1L3U A;  5C24 A;  3PX6 A;  3T19 A;  3M8Q A;  4I7F A;  1U04 A;  4KFB A;  2YKM A;  1KFS A;  3RR8 A;  3AA4 A;  5C25 A;  3OYB A;  3SNN A;  4FLT A;  3OY9 A;  1BIZ A;  1U4B A;  1TL3 A;  1JXE A;  4WE1 A;  3IAY A;  3IRX A;  3AO5 A;  1WSF A;  3IS9 A;  4F3O A;  3AO2 A;  4OKE A;  2JGU A;  3C95 A;  3CFR A;  3SUQ A;  4CEA A;  2QK9 A;  1TKD A;  3C94 A;  4JLH A;  3OYI A;  4HUF A;  4CF9 A;  1WAJ A;  4CHO A;  3MEC A;  3V9W A;  3ZSO A;  2OZS A;  4DF4 A;  3AVL A;  1T8E A;  1BQM A;  2ETJ A;  4OGC A;  5KRS A;  3ZT1 A;  4DMN A;  4IFY A;  3EY1 A;  3AO4 A;  3KKS A;  3ZCM A;  1LWF A;  4E7K A;  4H8K A;  1EKE A;  1REV A;  1S5J A;  1TL1 A;  3KLH A;  4CER A;  4J2D A;  3KD5 E;  4XIU A;  4B9V A;  4DTS A;  4IG0 A;  3MXI A;  3C6U A;  4KV8 A;  4O4G A;  3LP1 A;  3LP0 A;  1SUQ A;  5KRT A;  4OLA A;  2XHB A;  4ID5 A;  2Q3S A;  4FJI A;  3DLG A;  4KHS A;  2Z1H A;  4M3T A;  2GBZ A;  2YNI A;  4Y1D A;  4L8R B;  2OPS A;  2YHA A;  3B6P A;  2IGI A;  2RKI A;  3BGR A;  4NCB A;  1JLE A;  4W5O A;  2ZD1 A;  3V9U A;  3V9S A;  5J2Q A;  1B9F A;  1BIU A;  4OVL A;  4GVM A;  4FJG A;  2WOM A;  3KJV A;  3OYL A;  3A2F A;  2KZM A;  1YVU A;  1RBR A;  3AA2 A;  3OYH A;  4M3Z A;  2KZZ A;  3S3N A;  1WSE A;  1VSI A;  2HMI A;  1RTI A;  3MXM A;  4ICL A;  4CGF A;  2FBV A;  4OPJ A;  4CJ3 A;  1U45 A;  1F21 A;  4OKJ A;  3NAE A;  1CXU A;  4AHT A;  4CEC A;  4Z4H A;  4FXD A;  2PZS A;  4KI6 A;  4N56 A;  3P83 D;  3TI0 A;  1VSK A;  3U3Y A;  2HVI A;  3KK2 A;  4C8M A;  1QE1 A;  1C1B A;  3NGZ A;  3L2W A;  3HVT A;  4CF1 A;  1BIS A;  3OS2 A;  3TAN A;  3T3F A;  1RCH A;  3HL8 A;  1D5A A;  1GOC A;  4DTM A;  4W5N A;  4FZY A;  1WSG A;  4OLB A;  2YKN A;  4K8Z A;  1TAU A;  1JLA A;  3B6O A;  3NH2 A;  1BCM A;  4DSF A;  3AO3 A;  1I3A A;  1RBS A;  1B92 A;  3AVK A;  4DSI A;  4FZX C;  3SQ0 A;  3SQ4 A;  3OYK A;  1W9H A;  3VQ5 A;  1D9D A;  2B5J A;  3RMD A;  5CY4 A;  3VQ8 A;  3VQA A;  3OYJ A;  3DOL A;  4FM0 A;  2HHV A;  4CEO A;  3AVH A;  4HHT A;  4CIE A;  5HRO A;  3ZSY A;  2XRI A;  3I0R A;  4DFJ A;  3KTQ A;  1TKT A;  1BI4 B;  4DS5 A;  4HCC A;  3DOK A;  3HM9 A;  3CFP A;  4FLZ A;  1VSH A;  4FJ5 A;  4KHW A;  3LP2 A;  4F8R A;  4IBN A;  3P1G A;  2F96 A;  1NJX A;  1LWE A;  2IC3 A;  4RW8 A;  1HQE A;  4BDY A;  4C8O A;  1EET A;  1HYV A;  2B6A A;  4CJT A;  2YV0 X;  3QET A;  3V81 A;  2LSN A;  5J1E A;  3HK2 A;  4FJN A;  5D3G A;  1BHL A;  3SV3 A;  3NF8 A;  1VSM A;  3CG7 A;  3VQD A;  4AHV A;  3AVC A;  1X9S A;  1T7P A;  2HW3 A;  3HVR A;  1WN7 A;  3MEE A;  2X74 A;  2HHU A;  5CZ1 A;  4CFA A;  3AO1 A;  4B3O A;  3WNG A;  4CEQ A;  1ZBU A;  1XI1 A;  4M45 A;  4OPK A;  4BE2 A;  3V1R A;  4DF8 A;  1RBV A;  1CXQ A;  4CJV A;  4W5R A;  3RMC A;  2EX3 A;  3ULD A;  3QNN A;  1KLN A;  4DFM A;  4FM2 A;  4DSE A;  3AVN A;  1JLF A;  3NF6 A;  1C0M A;  3QO9 A;  1J54 A;  4JRP A;  3K5N A;  1HNI A;  2XY7 A;  4MFB A;  5HP1 A;  1U49 A;  2FBX A;  4YNQ A;  4Z4E A;  3OYF A;  4C8L A;  4KTQ A;  3KLI A;  3VA0 A;  1S1V A;  2QKB A;  3TAE A;  4KB1 A;  3VQB A;  1HYZ A;  3DRR A;  4CED A;  3PO4 A;  4LH4 A;  1A5X A;  4FJM A;  1X9M A;  4FLX A;  2YNF A;  4GMJ B;  3AVF A;  1MU2 A;  1FK9 A;  4DFP A;  4DU1 A;  4E19 A;  5KGX A;  1J5O A;  3IG1 A;  1TKX A;  1DTQ A;  1I39 A;  4IDK A;  3RRG A;  2G8F A;  5FRN A;  4CJ5 A;  1FXX A;  3PX4 A;  3CYM A;  1NK4 A;  4B9T A;  3QIN A;  2X6N A;  2P5G A;  3QER A;  3E01 A;  2IOC A;  3NF7 A;  4W5Q A;  4DQR A;  1Q8I A;  1WLJ A;  3AVM A;  3K57 A;  4BE0 A;  4CJU A;  3VQC A;  2X6S A;  4C8N A;  3OYC A;  2P51 A;  4CJK A;  4B9U A;  1RT1 A;  4M3X A;  2F8S A;  2OPP A;  4RW9 A;  4BAC A;  4C8K A;  1Q9X A;  2KW4 A;  5JS1 A;  1QSS A;  2G8U A;  4Z4F A;  3SPY A;  1RTD A;  1U47 A;  2YNG A;  1C1A A;  4E7L A;  1C0U A;  1W0H A;  1Y97 A;  2JLE A;  4O44 A;  4JS5 A;  3PUF A;  3TWH A;  3G10 A;  1NK9 A;  3L3V A;  3OJS A;  1SL0 A;  2KTQ A;  3FFI A;  3T1A A;  3DMJ A;  4F2R A;  4KPY A;  4PWD A;  4IFV A;  3K59 A;  4JS4 A;  4FLU A;  1UOC A;  4LSL A;  4KHU A;  3V6D A;  4FW1 A;  4DTR A;  3HPH A;  5CYQ A;  1S6Q A;  4FJX A;  4KKO A;  3LZJ A;  2G8I A;  1LW2 A;  3KD1 E;  4CK3 A;  2FC0 A;  4O55 A;  3HP6 A;  4M3W A;  1S1U A;  1JLC A;  1ASV A;  4O5B A;  4W5T A;  4CEF A;  4BE1 A;  2Z1I A;  1VSE A;  4AH9 A;  1EXQ A;  2FBT A;  1QHT A;  3F73 A;  3ZSX A;  3QIO A;  5CZ2 A;  3RRH A;  1SL1 A;  4ZTJ A;  1UAX A;  1NK6 A;  4RG8 A;  4DLG A;  4LD0 A;  5HRN A;  3AVA A;  4CK2 A;  2GUI A;  2E4L A;  2D0C A;  3EYZ A;  3QEI A;  1A5W A;  3SUO A;  3D45 A;  1L3S A;  4IKF A;  4DQP A;  1NOZ A;  5HRR A;  3EZ5 A;  4DS4 A;  4G1Q A;  2RF2 A;  3CFO A;  3TAR A;  2HHX A;  2HND A;  1WSJ A;  3DM2 A;  4DLE A;  4OGE A;  3RMB A;  3SUP A;  3S9H A;  2VWJ A;  3NCI A;  2DTU A;  5T7B A;  2XO7 A;  4FJ9 A;  3DLB A;  1TKZ A;  4OJR A;  5CYM A;  3QEW A;  3LAN A;  4DSJ A;  3JSM A;  3LWM A;  1BI4 A;  1UWB A;  4KTZ A;  4CJQ A;  3RR7 A;  4CFB A;  4CHY A;  5I3U A;  2G8H A;  1LAV A;  4I2P A;  4DTJ A;  2B4J A;  4FLW A;  4B9L A;  4CF0 A;  1S1T A;  4F3T A;  2P1J A;  4CGH A;  4E7I A;  2E6M A;  3VQ4 A;  4CHP A;  4EP5 A;  1L5U A;  2VG7 A;  5FRO A;  1NK8 A;  1ZYQ A;  1L3T A;  2OZM A;  4N76 A;  4F4K A;  3QEP A;  1QQC A;  1TVR A;  2IAJ A;  4BDP A;  2HNZ A;  3LZI A;  3RTV A;  3HXM A;  3MAQ A;  3D0P A;  2R7Y A;  1TAQ A;  3QEX A;  4B9N A;  1S1W A;  1KVA A;  1VSD A;  2BAN A;  2BE2 A;  1O1W A;  2FBY A;  4KRF A;  1HYS A;  4CJF A;  3AVI A;  1HJR A;  4FYD A;  4CJL A;  4K8X A;  3LPU A;  1RT3 A;  4ELT A;  3WNE A;  3L2R A;  4UQG A;  3WNF A;  3LPT A;  1YTA A;  3LP3 A;  4FJ8 A;  4Z4I A;  4J2A A;  2DFF A;  1G15 A;  3NGI A;  3SYZ A;  4DSK A;  5I42 A;  1NK0 A;  4CIF A;  1SKW A;  3VQP A;  4J2B A;  3M8R A;  1ASW A;  4ELU A;  2XY8 A;  2ZE2 A;  3RWU A;  5HBM A;  1GOA A;  4E89 A;  2Y1I A;  4NYF A;  1Q9Y A;  3ITH A;  1T03 A;  1S1X A;  3O4Q A;  3ZT2 A;  2Z1G A;  4FVM A;  4CJW A;  3PX0 A;  3OS0 A;  3KK3 A;  1C1C A;  3L8B A;  1TK5 A;  1NKB A;  2DFH A;  1X1P A;  1CZB A;  4E1M A;  2KFZ A;  2I5J A;  1VSL A;  1HQU A;  4AHR A;  4CK1 A;  1FKO A;  1KVB A;  4CJE A;  1IG9 A;  4I2Q A;  4MQ3 A;  1UA0 A;  3VQ9 A;  4NCA A;  4CGD A;  3AV9 A;  4EP4 A;  4F2S A;  4CES A;  4FJJ A;  4FK2 A;  1YT3 A;  1A5V A;  3SPZ A;  3BDP A;  4FK0 A;  1JLG A;  1RBU A;  4BWM A;  4CIG A;  4AHS A;  1X9W A;  1NJW A;  2ATQ A;  4KHY A;  4N41 A;  3O3G A;  2AJQ A;  4DSL A;  3KLE A;  3K5M A;  4FJ7 A;  3OYM A;  3OJU A;  3K58 A;  3L2V A;  1RTJ A;  4AHU A;  2YHB A;  3ASM A;  3WNH A;  4DQQ A;  3NHG A;  4H4M A;  3CQ8 A;  3VQQ A;  4N5S A;  2HHW A;  3KK1 A;  3NH0 A;  3HT3 A;  5C42 A;  5KTQ A;  4CF8 A;  4FZZ A;  4QOZ B;  1VK0 A;  2HHQ A;  4KTW A;  1VSF A;  2D0B A;  1S9G A;  2KQ2 A;  3L3U A;  2GV9 A;  2W42 A;  2Y1J A;  4BDZ A;  2XY5 A;  3THV A;  1JLB A;  4DWI A;  2DY4 A;  3G0Z A;  1ASU A;  4YFU A;  2NUB A;  4IG3 A;  2QXF A;  1TV6 A;  4FJK A;  1WSI A;  2HHS A;  1RDD A;  2O4I A;  4DFK A;  4PY5 A;  1RT4 A;  4FCY A;  3C6T A;  1NK5 A;  3SZ2 A;  1EP4 A;  4DTO A;  3ZT0 A;  4TSX A;  3LDS A;  1WAF A;  4PA1 A;  3L2U A;  4CEZ A;  1ZBH A;  1SV5 A;  3L2Q A;  4N47 A;  3U6F A;  2RPI A;  3QEV A;  3NF9 A;  2ITG A;  1NK7 A;  1RT5 A;  1CLQ A;  1RIL A;  4DU3 A;  4BWJ A;  4CJR A;  1HMV A;  3SV4 A;  4M41 A;  1RT2 A;  2YNH A;  3VQ6 A;  3PV8 A;  1HPZ A;  1U48 A;  2PY5 A;  2BGG A;  4NCG A;  3NGY A;  3QNO A;  1XHZ A;  1IKV A;  1QSL A;  3NH1 A;  2HHT A;  1BQN A;  3I8D A;  3TAF A;  3K5O A;  3ZSW A;  3K2P A;  3TR8 A;  3HYF A;  4Q5V A;  3OYG A;  2F8T A;  1IKY A;  3SQ2 A;  3SJJ A;  1SKS A;  1S6P A;  4M3R A;  4FLV A;  3F9K A;  4R5P A;  1HRH A;  3QES A;  1KCF A;  2A1R A;  4Q0B A;  1JXB A;  3HO1 A;  1ZBF A;  3MEG A;  4CJ4 A;  1LV5 A;  1NKC A;  1IKW A;  1LAW A;  5DK5 A;  4CFC A;  1ZBL A;  1BCO A;  1QSY A;  4DQI A;  2EHG A;  1XC9 A;  1NKE A;  3O3H A;  1KTQ A;  1T05 A;  1QS4 A;  4CEE A;  4CGG A;  4AHC A;  3OVN A;  2D0A A;  2KFN A;  4CFD A;  1DLO A;  3AVG A;  1VSJ A;  1VRT A;  1J53 A;  3LAK A;  4CGJ A;  3LAL A;  4H4O A;  4OKK A;  1TGO A;  3DRP A;  1J9A A;  4CHQ A;  3LWL A;  4B9M A;  4FM1 A;  3RMA A;  1QTM A;  2D5R A;  1IH7 A;  1LWC A;  5J2N A;  1HNV A;  3DLK A;  4B8A B;  4E0D A;  4M3U A;  4M3Y A;  4CE9 A;  3OYA A;  3V1Q A;  4EZ6 A;  4LH5 A;  3O3F A;  3DLE A;  4QAG A;  4FJL A;  3U3G A;  4ZHR A;  4HUG A;  4GW6 A;  4FK4 A;  1BGX T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...