4CEBA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 58
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cebA00
1S6QA 3AVHA 2O4IA 2RN2A 4CJ3A 4QOZB 4DS5A 2HHXA 4CK1A 3NAEA 4L8RB 1YTUA 4DFPA 3KKRA 2GBZA 3QESA 3H08A 3F73A 1KLNA 1REVA 4N41A 5CZ2A 1RT5A 2ZE2A 3K57A 4DTJA 3SQ1A 1RDBA 3OYDA 3EZ5A 1VSJA 4B9MA 3O4NA 4FJKA 4FM2A 4CJSA 4YNQA 3P1GA 1U45A 3KTQA 3FFIA 3AVFA 3ZT4A 4CJRA 3K5NA 4BACA 3HM9A 4DSLA 4CEOA 3PV8A 4C8LA 1TKZA 3ZCMA 4AHRA 3OYNA 4PWDA 2HHQA 3KIOA 2G8HA 1IKVA 3TAEA 3LAMA 1FK9A 1IO2A 1XWLA 1JXBA 1G15A 1L3UA 4LH5A 3TAQA 4ZTJA 1TL1A 1BL3A 3ISNC 1LAVA 4LY7A 4FJJA 4CJTA 1C0TA 4EZ6A 3OYBA 3LZJA 2Y1JA 1U4BA 5DMRA 2XY7A 3HXMA 1HYVA 2ZQBA 5KI6A 4KHQA 2X6NA 2EX3A 1S5JA 1BIUA 3L8BA 1NK0A 4Z4CA 3WNHA 3EYZA 2HNZA 1HMVA 4E7JA 4DU1A 2PYLA 1KVAA 3IS9A 4M45A 2ETJA 4BDYA 4DLEA 1VSIA 4W5TA 3HP6A 1TGOA 3QEVA 1MU2A 3SUPA 1NK9A 4CE9A 3M8RA 2G8VA 2FC0A 1I3AA 3RWUA 4CHNA 4FLXA 3KJVA 1RBVA 4PA1A 3OYLA 3L2RA 3AVKA 4E0DA 3MEDA 3QIOA 1BCMA 4UQGA 1N6QA 1LW0A 1WN7A 2BE2A 3I0SA 1QE1A 5KTQA 4W5RA 1VSMA 1SUQA 1W0HA 5KGWA 1BQNA 2RKIA 4O44A 3NGZA 3LP3A 4IFYA 5HBMA 3NE6A 3ZSZA 4B9SA 4KB1A 4M42A 4FJNA 1VRTA 4AHVA 1FKPA 1S6PA 3NF9A 3OYGA 2VWJA 3K2PA 3TWHA 3PO4A 1TVRA 1T7PA 2KQ2A 1TL3A 3HSTB 3AO5A 4EP4A 4FLYA 2HVHA 3DRRA 4EZ9A 5T7BA 5K14A 4CEAA 3K5MA 3RRGA 3NBPA 3VQ6A 1JL2A 4HCBA 1WLJA 3AA5X 1S1TA 3U3GA 2JLEA 4DQSA 2G8UA 4KRFA 3QEXA 4W5OA 1SKWA 1L3TA 1BCOA 2E6LA 1ZBUA 2HB5A 5JS2A 1NOZA 1Q9XA 2Y1IA 4I7FA 3AVNA 3O3FA 5CY4A 3OYMA 1LW2A 4DTRA 4KFBA 2VG6A 2YV0X 4EP5A 1VSHA 1QSYA 4OGCA 4DTOA 1HNVA 3IG1A 3ZT2A 3SNNA 3QNNA 2RPIA 1F21A 2Z1GA 2BANA 2Z1HA 3ZT1A 3TABA 1O1WA 4E7KA 1CXQA 4ZHRA 2AJQA 4BDZA 3SPYA 1D8YA 3VQ8A 4DSIA 4CJUA 1NJYA 1JLBA 3V6DA 1JLQA 2Z1JA 4CK2A 3I8DA 4DSEA 3VQ4A 4CEBA 4QCLA 4DFMA 2EHGA 3V1OA 4CHZA 2DTUA 3HP9A 3ZSRA 4CJPA 3KLFA 3VQPA 2Z1IA 3LWLA 3OYAA 4HUFA 1HRHA 3P83D 4HUGA 1Q8IA 4DQPA 3CM6A 5J2NA 4B9NA 4FJGA 4TSXA 4H4OA 1JLGA 3NH2A 2HNDA 1NK5A 1EX4A 4FJHA 3SZ2A 2ITGA 3TARA 3KLEA 5J2PA 2D0CA 3VQ5A 1X1PA 1JLAA 1FKOA 3OYIA 1LWEA 3ITHA 1U04A 4OGEA 4KTZA 3QEIA 4F4KA 4FXDA 3L2UA 3QERA 1HQEA 5HRRA 1J5OA 3V9SA 1C1CA 1S9GA 4F2SA 3CFRA 4CHQA 4IBNA 3UIQA 4KHWA 5HLFA 4FLTA 4Z4GA 3WNEA 1QHTA 1NKCA 1N5YA 2IOCA 3HL8A 3NHGA 3LP2A 2DFHA 1D9DA 3AO2A 3VA0A 1JL1A 1X9WA 4ELTA 4HUEA 1LWFA 4FJLA 3ULDA 4OKJA 2D0AA 3VQDA 3VQAA 3CQ8A 1WSEA 3B6OA 4FJ5A 4RW4A 4OLBA 3HVTA 3V1RA 1VSFA 1TAQA 3IRXA 3O4QA 4FJMA 1SKRA 4FZZA 4CEFA 4B3OA 4IG0A 5J2MA 3CM5A 3HJFA 3HVRA 4DFKA 1T03A 1ASVA 1JLFA 4MFBA 4M3WA 1EP4A 3HK2A 3CFPA 1VSLA 1VSKA 3DLKA 1KVCA 2E4LA 1S1XA 2HW3A 4GW6A 1DTQA 5FRMA 2QKBA 3ZSWA 4IKFA 4O5BA 2FBVA 4KAZA 5HRSA 1HNIA 4CIEA 4CECA 1RDAA 3RMCA 1SV5A 4FK2A 2OYQA 1ZBHA 1JLEA 3L2QA 1TKXA 1RT1A 1WSHA 2YHAA 2KTQA 1WAFA 4ICLA 1J54A 1VSDA 2F96A 1B9FA 3OY9A 4E1NA 2OA8A 2OPPA 4B9UA 5J1EA 4M3UA 1QQCA 3P5JA 2KZMA 3VQ7A 4AHTA 5I3UA 1XI1A 4M3ZA 3T1AA 1RT7A 3QINA 3RTVA 2I5JA 4CJ4A 1IG9A 2FBTA 4Z4EA 3LANA 3K59A 1SKSA 5FRNA 4IDKA 4CGGA 3KLGA 4NYNA 2ATQA 4AHCA 4FM1A 1TV6A 4BE1A 2OZMA 4B8CA 3KD5E 4FLUA 2WOMA 4HVJA 3U6FA 1RNHA 4B9TA 4KHYA 3HYFA 4KREA 4FYDA 2KW4A 2X78A 3VQCA 1NK6A 1RCHA 3LAKA 5HRNA 4MQ3A 3D0PA 3AVBA 3VA3A 3MECA 2LSNA 3K58A 1NJZA 2P51A 3K5OA 3AVAA 4FJ8A 1T8EA 3PUFA 1X9SA 5KRTA 1K6YA 3SI6A 1JLCA 5HROA 1KSPA 4FZYA 3KKSA 5D3GA 4KHSA 1WAJA 1NK7A 4KO0A 2PY5A 2IGIA 2YNGA 3OJUA 1Z26A 1RDCA 1YVUA 4RW6A 1UAXA 3B6PA 4CJKA 1NK8A 3VQEA 1VSEA 3DOLA 3DRPA 3QEWA 4F3OA 4F3TA 4OPJA 4CGFA 3S3NA 3AO1A 1S1VA 4CJWA 4OPKA 3EY1A 2A1RA 3TAFA 3LZIA 1BISA 4FK0A 1HJRA 3QNOA 3VQQA 4BE2A 4C8KA 1A5VA 1RTIA 4E89A 3LWMA 4KPYA 1KFSA 3QETA 4E7LA 1HYSA 3DLEA 4Z4HA 3SQ2A 1XHXA 1ITGA 3VQBA 4J2AA 1S1WA 3AA3A 3KK2A 4LD0A 4H8KA 4JS5A 1TK5A 2KFNA 1B9DA 1UWBA 2YNFA 4LH4A 3NH0A 3OYHA 4F2RA 4I9QA 3LPTA 4CJFA 5JS1A 4FM0A 3MXJA 4DQQA 4KTQA 1NJWA 1C1BA 3AV9A 3AVGA 4B8AB 3OS0A 1W9HA 3T19A 4DFJA 4AH9A 3O3HA 2G8FA 1KLMA 1CZ9A 4CF8A 4FW2A 4CEDA 4E19A 4FLVA 2XY5A 1NKBA 4R5PA 3CG7A 1J53A 4CF0A 4DU3A 5I42A 3MEEA 3C6UA 3WNGA 1C0UA 4RW9A 3KK3A 1IH7A 1RTJA 2KZZA 2Q3SA 4W5NA 4HTUA 4DQIA 3ALYA 1ZBIA 5SZTA 3AVIA 2YHBA 3HPHA 1GOAA 2OPQA 3HT3A 3CYMA 3LP0A 4CJQA 3ZSVA 3OVNA 3K5LA 2QXFA 3SV4A 3RRHA 2BDPA 4F8RA 4ELVA 2DY4A 1BQMA 1YT3A 1TAUA 3TI0A 2QKKA 4CCHA 2DFEA 4JLHA 2D0BA 4AHSA 2FBXA 4NCGA 4CF2A 3AVCA 3E01A 2HHTA 2XRIA 4CERA 4HCCA 2YNIA 2BGGA 4FJXA 3NF6A 1HPZA 2P1JA 1KVBA 3M8SA 3CFOA 5C24A 3TR8A 3JYTA 3SUOA 4J2BA 1JXEA 3ZSXA 4CJVA 1ASWA 1R0AA 3MAQA 4RW7A 3KLHA 1RT3A 4DTPA 2VG7A 3TAPA 3L3VA 1QS4A 4CFAA 4DQRA 2G8KA 4CJEA 1QTMA 3QEPA 1KTQA 4Y1CA 2OZSA 2VG5A 3V9WA 2QK9A 4PQUA 4CGJA 2XY6A 3IAYA 4WE1A 4KHNA 1SL2A 4RG8A 3ZT0A 3DI6A 1UA0A 1NJXA 3M8PA 4N76A 4PUOA 3AA4A 3AA2A 3QLHA 1RT6A 3L2VA 4DMNA 3BDPA 2YKNA 3T3FA 1IKYA 4H4MA 3L2WA 4DF4A 3RMDA 3ZT3A 3OYFA 4E3SA 4I2QA 4CFBA 4CJLA 1XC9A 4J2DA 3BGRA 3G0ZA 3RMBA 2F8TA 4NCBA 4DU4A 1S9EA 1WSIA 4CFCA 2OPRA 4W5QA 5DK5A 1A5XA 1GOBA 1BI4B 4OLAA 1VK0A 4LSLA 5C25A 3SCXA 4KKOA 2A1SA 4Z4FA 3RR7A 2O4GA 1UOCA 1WNSA 1TKTA 3SV3A 4DTMA 2XHBA 3LDSA 1A5WA 1SL1A 4DSKA 3VN5A 4NCAA 2G8IA 4IFVA 4BWMA 3ZSOA 1CLQA 5FDLA 4Z0UA 4CHYA 4FW1A 4FJ9A 1B92A 1RBRA 2IDOA 3OS1A 1ZYQA 4QAGA 4CEEA 1FXXA 5CYMA 4JRPA 4K8ZA 4FLZA 4B9VA 4OKKA 3JSMA 4CHOA 2P5GA 4ID5A 3HPGA 1RBTA 1EXQA 5CYQA 5EU7A 1J9AA 3V4IA 4DTXA 3LP1A 4C8OA 4O55A 1RTHA 1ZBLA 3HO1A 4XIUA 4E7HA 4M3YA 1I39A 2GUIA 4I2PA 4DSFA 2HHVA 4KI4A 1L3SA 1GOCA 3DMJA 3I0RA 4GVMA 1CXUA 3AO4A 4CIGA 4M3TA 2HHUA 2X74A 1T05A 1VRUA 2PYJA 3KK1A 4CGHA 3S3MA 5FROA 4CF1A 3C94A 4Q5VA 3V9XA 3DLGA 3ZSQA 1LWCA 3L3UA 3TANA 1TKDA 4NYFA 4Q0BA 4FJ7A 3RR8A 4GMJB 4O0JA 4K8XA 1HYZA 1RBSA 2HVIA 5KGXA 2XY8A 3NH1A 3MXIA 1UA1A 4KB0A 1DTTA 3KD1E 4FZXC 4PY5A 1U48A 4DWIA 4E7IA 2XO7A 4FVMA 3AVMA 4O4GA 1D9FA 4CEQA 1NOYA 4B08A 2HMIA 1WSGA 1Z25A 4CJ5A 2OPSA 3AVLA 3NGIA 3DLRA 4B9LA 2W42A 1RT2A 1CZBA 1IKXA 3OS2A 4JRQA 1ZBFA 5J2QA 1D5AA 1TK0A 1KFDA 4O0IA 1RTDA 3OYKA 2GV9A 3OYEA 4DS4A 2ZD1A 3S9HA 3SQ0A 1BGXT 4DF8A 2B4JA 1X9MA 1RBUA 2B5JA 3AVJA 4YFUA 2IC3A 3LPUA 1EKEA 3TAMA 1C1AA 4LSNA 1LV5A 4ELUA 3V81A 3PX4A 3SJJA 1RT4A 4JS4A 1WSJA 3SUQA 4AILC 2JGUA 3MEGA 4CEZA 4CHPA 1IKWA 4CF9A 5E41A 4KI6A 3SUNA 2YNHA 2B6AA 4IG3A 3PX0A 1JKHA 3AO3A 4DG1A 4G1QA 2IAJA 2X6SA 4M3RA 3THVA 1QSLA 1Y97A 2D5RA 3DOKA 1RDDA 4CFDA 4KHUA 5KRSA 3NDKA 1C0MA 4KV8A 3DRSA 3OYCA 3S3OA 3HPOA 3NF8A 1NK4A 1KRPA 3A2FA 3C95A 3DYAA 4N5SA 3SPZA 1KCFA 3TAGA 3U3YA 5C42A 4E1MA 2FBYA 3DLBA 3VQ9A 1BIZA 3O3GA 3KLIA 4DTNA 5HP1A 2NUBA 1LAWA 2YKMA 1TK8A 1SL0A 2VWKA 2HNYA 1BI4A 3V1QA 4FK4A 4FCYA 1S1UA 2PZSA 3ZSYA 4CGDA 5CZ1A 4M41A 4ZTFA 3OJSA 4C8NA 3SQ4A 3OYJA 4C8MA 3PY8A 3QIPA 4DSJA 3V9ZA 3QO9A 1YTAA 3V9UA 3M8QA 3WNFA 1L3VA 2KFZA 3NCIA 4OJRA 2E6MA 3PO5A 4BDPA 4M3XA 4AHUA 1WSFA 3D45A 1QSSA 2HHSA 1U47A 2RF2A 3MXMA 3G10A 2IS3A 2G8WA 4FJIA 1BHLA 4FLWA 2WONA 4N47A 3ASMA 5SWMA 4DTUA 3PX6A 1XHZA 4HHTA 3LALA 2F8SA 1ASUA 4DTSA 4CESA 4Y1DA 4KTWA 4OKEA 4I9LA 4BWJA 4CGIA 3C6TA 4CIFA 3NF7A 4BE0A 2R7YA 1Q9YA 3F9KA 1NKEA 1DLOA 3NFAA 4CK3A 2P5OA 1HQUA 3DM2A 4N56A 2HHWA 3SYZA 4OVLA 1U49A 4J2EA 4ID1A 4Z4IA 1EETA 1L5UA 3DLHA 4RW8A 1RILA 3NGYA 5HRPA 2DFFA 3RMAA 4DLGA 1C6VA
chains in the Genus database with same CATH superfamily
1S6QA 4FWKA 2WFBA 4YOVA 3KKRA 2HBKA 5BR9A 4N41A 3D2EB 3EZ5A 3ENBA 1LOTB 4FJKA 3GBTA 3LM2A 4CJSA 4RCHA 3P1GA 3ZT4A 3L4QA 3P31A 5AFUA 4BACA 4KHPK 3T69A 1BU6O 4CEOA 1TKZA 2G8HA 3QB0A 2RHKA 3EO3A 4R79A 1G15A 3AAPA 3OTOK 1U4BA 5AQUA 2XY7A 4KHQA 4LF5K 2X6NA 4JAXA 2O8FB 4BDYA 3FZMA 3QEVA 1TGOA 3DXKA 4CE9A 4DV2K 2IVPA 3FE1A 3CMAN 3BUZB 3MCAB 4FLXA 1RBVA 1VQLN 2BE2A 3I0SA 2QA4N 4GV3A 5KTQA 1VSMA 2IVOA 1SUQA 1W0HA 4H5NA 4F9OA 2RKIA 4IFYA 3OYGA 1FKPA 3NF9A 3PO4A 1W97L 3K2PA 3WXIA 3ENHA 2KQ2A 4EP4A 2F4VK 4EZ9A 4JK8A 5K14A 4CEAA 1NGHA 1NGEA 3GE1A 4FOEA 1WLJA 3AA5X 4W5OA 2YHYA 3ULEB 2HSTA 1OH8A 1Q9XA 2I7NA 4CW7B 3TSUA 3AVNA 3MMVA 5CY4A 1QQMA 2YV0X 3DJCA 5CHIA 4YHHK 5AQXA 2Z1GA 2BANA 2WBNA 2FF3B 3W3DA 2AJQA 3VGLA 2VQFK 1D8YA 2O8DA 2UUAK 3G25A 2Z1JA 2OCEA 3M5RA 4QCLA 4CJPA 1HRHA 1VQPN 1Q8IA 1QHAA 4FJHA 3TARA 4BRKA 3VEOA 3ATUA 3QEIA 3MX2A 3QERA 1GLFO 4DV5K 1C1CA 4KHWA 4IOXA 3WNEA 1QHTA 3SMPA 3CCLN 2E20A 2GTDA 3ZEUB 4CJ7A 4HUEA 4OKJA 2D0AA 1NLVA 3VQAA 3I55N 3EE8A 1WSEA 4FJ5A 5AZIA 4FZZA 1SKRA 3A5MC 3HJFA 4DFKA 4MFBA 4M3WA 3CFPA 3DLKA 2E4LA 2QKBA 4MLEA 3ZSWA 3KHYA 4JD2A 2E2OA 4MLHA 2HF4A 4NLBA 3SJHA 4FK2A 1ZBHA 3CJ9A 1RT1A 1Q82O 1WAFA 4ICLA 5GIOA 1J54A 2F96A 3LDQA 4DR4K 4FWMA 4B9UA 4JN4A 4XEIA 4IFEA 3VQ7A 1NG9A 4JI6K 2ZGZA 1IG9A 3K59A 2CH5A 1ESVA 5FRNA 1GLAG 2ATQA 4LF9K 4B8CA 3O1BA 3VEVA 3O6WA 4FLUA 4B9TA 3HYFA 3CJCA 5AQMA 4BRNA 4BRMA 3CETA 4BRHA 5HRNA 3SAGA 4FWPA 3K58A 4B1UB 3R3LA 4JKGA 3PUFA 3SI6A 5HROA 1KSPA 4FZYA 4KHSA 3T1YK 2PY5A 4JKEA 1RDCA 1YVUA 4CJKA 1NK8A 4F3TA 4F3OA 4OPJA 4CGFA 3AO1A 3EY1A 4OPKA 2A1RA 1IG8A 3TAFA 4C8KA 1A5VA 4E89A 3LWMA 1HKBA 3QETA 1XHXA 1MDUB 3AA3A 4H8KA 3OYHA 2YNFA 4DQQA 4KTQA 4M63C 3LDNA 4IDHA 4B8AB 3OS0A 4AH9A 2EWSA 4FLVA 1CZ9A 4CF8A 4CEDA 2XY5A 3PIOL 3N4PA 3C6UA 3TTDA 1IH7A 3CI5A 3O80A 3RSEB 3ALYA 5SZTA 3AVIA 3R8EA 3HPHA 3CYMA 3RRHA 4ELVA 1BQMA 1K8KB 1YT3A 3DXMB 1HKCA 4JLHA 4AHSA 2FBXA 4CF2A 2UYTA 2W41A 3BZCA 4CERA 3UKRB 1S22A 1KVBA 3CFOA 4M7XA 3SUOA 1JXEA 3ZSXA 1NMDA 4RW7A 3KLHA 1RT3A 2VG7A 3L3VA 4CFAA 4DQRA 5KPTA 1QTMA 2QWPA 2VG5A 2QK9A 3A5LC 3GDQA 4RG8A 3ZT0A 3QLHA 5KQ8A 4CZMA 1X9JA 4NLCA 4CI6A 2YKNA 3RMDA 4E3SA 4J2DA 3AY9A 4CJLA 3CCMN 3G0ZA 5ADXA 5DM7L 4JI5K 2O8DB 1BI4B 1VK0A 4KKOA 3RR7A 2O4GA 1T3VA 3SV3A 2P9SA 4DSKA 1CLQA 3CD6N 4BWMA 1VQNN 4OPHA 4Z0UA 4FW1A 1B92A 4CEEA 4WFNL 4JRPA 4B9VA 4JNEA 4BC4A 1YVNA 3ATVA 4IJAA 5AQKA 1VQ4N 3JAMO 3V4IA 3CHWA 1RTHA 3HOSA 4YY3K 1GOCA 4GVMA 2NNWA 1VQON 1OH7A 3VGKA 5AZJA 4FPAA 3CCUN 3DLGA 3B8AX 3TANA 4FJ7A 2HVIA 2QEXN 5KGXA 1YUWA 3NH1A 4KB0A 1DTTA 3HTVA 5AZIB 2D0OA 1YJNN 4CEQA 2CGJA 1NOYA 1D9FA 4B08A 2HMIA 2YHXA 3NGIA 3DLRA 2QWOA 4GNIA 1IKXA 1VQ9N 1I94K 2JWLA 4A5BA 2GV9A 3OYEA 1HKGA 4DS4A 1ATNA 2ZD1A 4JKFA 1VQ6N 3SQ0A 4JD2B 2B5JA 1N34K 3LPUA 5AQRA 1C1AA 4LSNA 4MO5A 3PX4A 3SJJA 1SZ2A 4XH1A 4AILC 2JGUA 3MEGA 5F2RA 4AM7A 4BC5A 1QQNA 4CHPA 4IG3A 4EHUA 1JKHA 2VWBA 3CJ7A 1TUYA 4M3RA 5C10A 4KHUA 4CFDA 4KH6A 3NDKA 1C0MA 1RDUA 3ZX0A 1KRPA 3SPZA 1KCFA 3C7NA 2VQEK 2FBYA 3R1XA 3O1WA 4CBWA 5BPNA 4FCYA 2NRWA 4CGDA 1KC8O 3PY8A 3O9TA 1HNXK 5AQTA 3M8QA 3WNFA 4EHTA 4M3XA 3WXMB 3SBTA 3P4IA 4K25A 4BVPA 5LMUK 2G8WA 1EWRA 3O5BA 4DTUA 4HHTA 3W0LA 2QTDA 4O8KA 2NRTA 4KTWA 2KKZA 4CGIA 4H03B 2P9PB 4BE0A 2R7YA 3D2FB 3F9KA 1DLOA 3P38A 4CK3A 3DM2A 3FFKB 4OVLA 1U49A 1HR0K 4J2EA 4ID1A 4Z4IA 3DLHA 5HRPA 2DFFA 3WEEB 2HOEA 4DV4K 4FL9A 4NXMK 4CJ3A 3NAEA 2VCPA 1KLNA 1NGDA 2E2NA 3SQ1A 1RDBA 3AAQA 5AJ3K 2I7PA 1VSJA 3O4NA 1RDWX 3AVFA 1IJJA 3SK3A 3HM9A 4DSLA 1BA1A 3PV8A 2HHQA 3TAEA 3LAMA 1FK9A 1XWLA 3H3OB 4XH4A 3VPZA 3GOIA 4LH5A 4ZTJA 4NXNK 1BL3A 3ISNC 4BRPA 3IMXA 4BRFA 4BRDA 5KPRA 2ZQBA 2EX3A 1S5JA 1NK0A 3L8BA 3IUCA 5E84A 3EYZA 4E7JA 4DU1A 4K43A 3QFUA 4DLEA 1VSIA 2P9LA 4W5TA 3HP6A 4B1VA 2O8BA 3SLCA 2YX6A 4PA1A 3L2RA 3AVKA 3MEDA 1Z6RA 1BCMA 1N6QA 3CJAA 1LW0A 2WTUA 2QWMA 4B9SA 4FJNA 1VRTA 1S6PA 5M1FA 4BRLA 1TVRA 1T7PA 1TL3A 3NMUA 3M6GA 1G99A 5JICA 4MDAA 3K5MA 4X62K 4H0VB 4WCEL 4GKKK 2E6LA 3HOTA 2E88A 1YHQN 1ZBUA 4FWSA 2HB5A 4IO9L 1TYQA 2PBDA 4LFCK 3EN9A 4JKHA 1VSHA 4OGCA 4DTOA 3IG1A 3QNNA 2Z1HA 5CE3A 3ZT1A 1O1WA 4E7KA 3H6EA 1CXQA 4ZHRA 5HL7L 5C2DA 4NB4A 3N4QA 3G6EN 3V6DA 1JLQA 5A2QO 4CZGA 1Q81O 4H0XB 2Q0UA 3ZSRA 4QS7A 3LWLA 2P9NA 3OYAA 4HUFA 3DWLA 2P9UB 1YF5L 3C0BA 4B1ZA 2W6KA 4FJGA 1ZXOA 1JLGA 1GLDG 2HNDA 2ITGA 5J2PA 3A5OC 1GLCG 2D0CA 3VQ5A 4BROA 3WXKA 1U04A 4FWLA 4OGEA 3I33A 2HF3A 5HRRA 3MK6A 3UE5A 3CFRA 4CHQA 3UIQA 3VTIA 5HLFA 4Z4GA 4H0TB 4WF9L 2BTFA 1N5YA 3BZKA 3NHGA 4DV3K 1P8ZA 1D9DA 3VA0A 3THWB 1LWFA 3ULDA 2O8CA 3CQ8A 4PL7A 3O4QA 1WOQA 5LY3A 4B3OA 4IG0A 5J2MA 3CM5A 1T03A 2Q36A 1EP4A 3UKUB 4ISGA 4IOAL 1KVCA 1S1XA 2HW3A 1HX1A 5FRMA 1ZBSA 1K73O 3C7NB 4O5BA 2FBVA 3WXJA 4BG8A 2ASPA 1HNIA 2PAVA 1E3MA 3MDQA 3HI0A 3L2QA 1QZ6A 4JI2K 5C0YA 1WSHA 4GV9A 5GAEP 5AQWA 2OA8A 1MWKA 5J1EA 4M3UA 3A8YA 3O9QA 5BR8K 1ZC6A 5I3UA 4M3ZA 2UXDK 3QINA 5AQOA 3MX5A 1SKSA 3L6QA 5JVGL 4NYNA 2P9KA 2A40A 4B3RK 1TV6A 2OZMA 4G9ZA 2WOMA 2KW4A 4DR6K 1RCHA 4LC9B 3D0PA 3THXA 3ID8A 3L0QA 3CCRN 3HSCA 5BN9A 1X9SA 1K6YA 2YNGA 1Z26A 4RW6A 2RE2A 3B6PA 5GIPA 3QEWA 1VSEA 3I8BA 3S3NA 4OX9K 4CJWA 4MDBA 3LZIA 1YAGA 1QQOA 4JKCA 4KPYA 1RTIA 5AQYA 3F9MA 3BY5A 1HYSA 3DLEA 3VQBA 1ITGA 2KFNA 2JWKA 1KQSM 5JS1A 3QBWA 3LPTA 3D7EO 4FM0A 4EIAA 3T1HK 4JI3K 3AVGA 5JVHL 3O3HA 4E19A 2NRRA 1Q86O 3CPWM 4GY2B 4CZIA 3CG7A 1J53A 4R5PA 5I42A 3SMSA 3WNGA 4YOUA 2KZZA 4W5NA 1Q7YO 5EOYA 4QS9A 3CCSN 4DR1K 3K5LA 3LP0A 4FVUA 3SV4A 3ZSVA 5IT9O 1BUPA 3J7AP 3VF6A 2DY4A 3H1VX 4BC3A 3TI0A 2QKKA 2DFEA 2A42A 3E01A 4YOWA 2XRIA 3OA9A 1W2BM 2BGGA 4FJXA 4DV1K 5AQHA 3NF6A 1HPZA 2P1JA 2ZGYA 5C24A 3TR8A 5EX5A 1ASWA 3TAPA 3AGKA 1NGJA 3VERA 2G8KA 1S3XA 3C6HA 2GX9A 2OZSA 3QEPA 1NJIO 4CGJA 5C15A 2XY6A 3IAYA 2QWRA 1TYQB 1EQYA 2HBLA 3DI6A 1UA0A 1NJXA 3M8PA 4N76A 3AA4A 5M1QA 4H4MA 3L2WA 4DF4A 3J81O 3FLCO 4NCBA 2F8TA 1S9EA 1BDGA 3SBGA 2OPRA 2IVNA 4W5QA 4JI4K 5AQVA 1UOCA 1WNSA 3IDHA 3LDSA 1SL1A 1A5WA 2G8IA 4BRCA 3THYA 5FDLA 1C0FA 4CHYA 4KH4A 2IDOA 1RBRA 3G4SN 4QAGA 4IEIA 1FXXA 1HPMA 3T7ZA 4BR7A 3BF1A 4OKKA 4FLZA 4CHOA 4ID5A 2YI1A 5CYQA 3VETA 4DTXA 4C8OA 4O55A 1ZBLA 3HO1A 1I39A 3R9PA 4KI4A 3DMJA 1CXUA 5BN8A 4CIGA 1XMOK 1T05A 1VRUA 2PYJA 4DUZK 4LFAK 4I6MB 4JI0K 5FROA 3C65A 1TKDA 1LWCA 4GMJB 1NM1A 1VQKN 4BRAA 1O13A 4O0JA 2O8CB 3WXLA 4E1JA 1UA1A 4CZFA 3RVCA 1U48A 1FJGK 1WSGA 1Z25A 2OPSA 3AVLA 3U4LA 1D5AA 1KFDA 1HJOA 4IXCA 1K9MO 1RTDA 2E5LK 1X9MA 3J7YP 2CH6A 3U8XA 4JS4A 2V52B 5JMVA 2UXBK 4CEZA 5E41A 3SUNA 2YNHA 4JKDA 4AF1A 4CD3A 4DR5K 3AO3A 3FZLA 5AQIA 3ZX2A 2V7ZA 4G1QA 5KPZA 5KRSA 3DXKB 5H1SQ 1N32K 4KV8A 3S3OA 3HPOA 3M1FA 3A2FA 3E9PA 3TAGA 5BPLA 4E1MA 1TK8A 1BIZA 5HP1A 1LAWA 4X64K 1SL0A 2VWKA 3CF5L 4FK4A 3O8MA 3ZSYA 5CZ1A 4M41A 4ZTFA 4C8NA 1N8RO 1NU0A 5GAHP 4DSJA 1L3VA 4RWTA 3NCIA 2E6MA 3PO5A 4BDPA 1WSFA 1QSSA 4A2AA 2RF2A 3MXMA 3EKSA 5JLHA 3PX6A 4B3TK 3AARA 3LALA 3TSQA 4DTSA 4CESA 3MN5A 4OKEA 1MA9B 4CIFA 1E4GT 2KLAA 2HHHK 3NFAA 1L5UA 2A3ZA 3RMAA 2GUPA 3VEZA 2O4IA 1JJ2M 1KAZA 4IOCL 4DS5A 4CK1A 4JI8K 3MWPA 4DFPA 3QESA 3H08A 3F73A 1SS6A 3NVMA 3IFRA 5CZ2A 2ZE2A 3K57A 4DTJA 2P9IA 2F7TA 4DR7K 4DR2K 5LMNK 5FPEA 4FM2A 4EFHA 4YNQA 3KTQA 3FFIA 5AQZA 4PKIA 4C8LA 2OTLN 4AHRA 3OYNA 3KIOA 1IKVA 1JXBA 4ILJA 3TAQA 1LAVA 4FJJA 1XUPO 5ADXH 3OYBA 3LZJA 2Y1JA 1HLUA 5DMRA 3HXMA 5KI6A 1SAZA 2NRXA 4Z4CA 3WNHA 2HNZA 1HMVA 2PYLA 1KVAA 3IS9A 4M45A 1YJ9N 3SUPA 5EVZA 1NK9A 2FC0A 3O08A 3RWUA 5BRHA 1DT9A 4CHNA 1ILYA 3OYLA 1QZ5A 4E0DA 3QIOA 4UQGA 3M3ZA 1WN7A 2D4WA 5AQPA 2WC9A 3CERA 4M42A 3NE6A 3LP3A 4KB1A 5HBMA 1SQKA 3ZSZA 3CCEN 3VOVA 3OBYA 5LL6Z 3VENA 3HSTB 1X3NA 5M1PA 5GADP 3NBPA 1JL2A 1NGGA 3Q7BA 4DQSA 2G8UA 4KRFA 3QEXA 2ZF5O 1L3TA 2VYPA 4IJNA 2O8EA 1LCUA 4XH5A 1NGIA 3CC7N 1LW2A 4DTRA 2VG6A 4IEEA 4C1NK 2HBJA 1QSYA 3ZLJA 3SNNA 3ZT2A 3J7ZO 2FXUA 4DV0K 1KXPA 4H0PA 4CZLA 4BDZA 4ISFA 3SPYA 3VQ8A 4DSIA 3DLLL 3O4WA 1NJYA 1JLBA 4BR5A 3FR0A 4CK2A 4DQ8A 3I8DA 3VQ4A 2QM1A 4DFMA 2EHGA 3D2EA 3V1OA 4CHZA 2DTUA 3VQPA 3QICA 4DKWA 4JKGB 1U2VA 2BH1A 2YCHA 4HUGA 2ITMA 5AQQA 4H4OA 2Q0RA 1NK5A 1BA0A 3FZHA 3SZ2A 1Z05A 3KLEA 4A5AA 5MLCQ 2QI2A 1FKOA 3ITHA 4KTZA 2UXCK 2V51B 4BVOA 3L2UA 1N36K 4FXDA 1RFQA 1HQEA 1J5OA 1S9GA 4F2SA 4FLTA 2O8FA 1NKCA 1VAZA 3LP2A 1X9WA 4ELTA 3B6OA 4RW4A 4CBUA 5I9EB 3V1RA 3EKUA 1TAQA 3IRXA 4FJMA 1V4SA 4CEFA 3VMFB 3HVRA 1ASVA 2YJFA 3HK2A 1CZAN 4FWQA 5C12A 3PSFA 3LDLA 1DTQA 1TUUA 4GW6A 4IKFA 3QBXA 1S72N 4KAZA 1SV5A 2OYQA 1JLEA 3OBWA 1TKXA 4GKJK 3U9DA 2KHOA 2KTQA 4KH5A 1VSDA 4PKHA 1GLEG 3OY9A 4E1NA 2OPPA 4X66K 1X3MA 1QQCA 3ULEA 1RGIA 4BGAA 5AQSA 1XI1A 3WT0A 4CJ4A 4ISEA 4CBXA 4IDKA 4CGGA 3KLGA 4FM1A 1WBBA 4FSVA 4HVJA 1RNHA 4KREA 1P90A 3D6RA 1KD1O 3CXCM 4FYDA 2OTJN 3LAKA 3VA3A 4BR2A 2LSNA 1NJZA 1WUAA 2P51A 4DCHA 1KAYA 3FZFA 1GLBG 5BRFA 3HZ6A 5KRTA 4X65K 3KKSA 4KO0A 4JK7A 3VQEA 3DOLA 5EY4A 2P9SB 1BISA 4FK0A 2OANA 1HJRA 3JS6A 5GAGP 4GV6A 1KFSA 4E7LA 4Z4HA 2GEMA 4J2AA 1S1WA 3KK2A 4JS5A 4BG9A 1TK5A 1B9DA 1HUXA 1UWBA 3TPQA 3NH0A 4F2RA 1HNWK 3MXJA 1JCGA 4NO7A 4JHDA 4WQ4C 1W9HA 2W6LA 4DFJA 1YIJN 3F2KA 3MWTA 2G8FA 5AZJB 4BY9C 1KLMA 5HOOA 4FW2A 4CZHA 4WFAL 3MN6A 2W40A 3ID6A 5LJWA 1NKBA 4DU3A 4CF0A 5ELZA 3O9RA 2HMPA 4RW9A 2BUPA 1YJWN 4C23A 4DQIA 4DB3A 3BEXA 1XNQK 1ZBIA 3HM8A 1GOAA 4WQ5C 3HT3A 4CJQA 3OVNA 4A2BA 2QXFA 4F8RA 4C1NI 2DPNA 2IIRA 1TAUA 3E1YA 4A59A 4CCHA 1KAXA 1BOTO 4NCGA 3AVCA 2YNIA 3BP8A 1OH6A 3M8SA 3R6MA 3JYTA 4J2BA 4CJVA 4DHYA 3EL2A 1R0AA 4A62A 1QS4A 4FPBA 1KTQA 3V9WA 1VQ7N 4JEPA 1SL2A 4H0YB 4PUOA 1NGAA 3AA2A 1RT6A 3L2VA 4DMNA 3BDPA 3RMBA 1VQ5N 1IBKK 4CFCA 3BF3A 1GOBA 5DK5A 1W7AA 4OLAA 5C25A 2A1SA 4Z4FA 2ZJRL 1TKTA 4FO0A 4DTMA 4WFBL 4NCAA 4JI7K 1NWKA 4FJ9A 1U2VB 3OS1A 4BRQA 3EE9A 5CYMA 3HPGA 3CCJN 1J9AA 3ENOA 4XIUA 2GUIA 2V7YA 5KQDA 5AFUH 3CJ1A 3VEWA 3TTCA 1L3SA 4M3TA 3K9KA 3PIPL 3S3MA 5E26A 4FWRA 3C94A 5M1OA 3G71N 4Q5VA 3V9XA 3ZSQA 3L3UA 4NYFA 4Q0BA 1GLLO 4K8XA 1RBSA 2GWJA 3RSEA 4U7BA 4BRGA 2F9TA 3KD1E 4PY5A 3MCPA 4FZXC 4DWIA 1R59O 2XO7A 4FVMA 5GINA 3AVMA 4O4GA 4H0OA 5FPNA 1GLJO 4CJ5A 4B9LA 2W42A 1CZBA 3HBTA 1K8KA 1IBLK 1D4XA 1TK0A 5J2QA 1NBWA 3DXMA 1OVQA 4O0IA 3OYKA 1XMQK 1BWFO 3UKRA 5AQGA 4BR9A 4K42A 3AVJA 1J6ZA 4YFUA 4A61A 1EKEA 1LV5A 2E2PA 3OHRA 4CD1A 3V81A 5FLXO 5LJVA 3PX0A 3SAFA 3A5NC 3VTHA 2E2QA 4DG1A 5B8HA 3THVA 2X6SA 1QSLA 1Y97A 2P9LB 3VEXA 1RDDA 1V4TA 5C2FA 2O8BB 3VF2A 3LL3A 3C95A 4N5SA 2YHWA 3WQUA 4IO8A 5C42A 3VQ9A 3O3GA 1NGBA 2YKMA 2HNYA 4V19S 1BI4A 1JCFA 2PZSA 3OJSA 3SQ4A 3OYJA 1ATSA 3V9ZA 3V9UA 4ILGB 2J4RA 3VEYA 4OJRA 3AGRA 4AHUA 3D45A 2HHSA 4AM6A 1QVFM 5AQNA 4FJIA 4B9QA 5CR4A 2WONA 4BQLA 2QWLA 1XHZA 2F8SA 4BREA 4Y1DA 4BWJA 3L4IA 1EWQA 4DUYK 3C6TA 1Q9YA 2HHWA 4LF7K 1HQUA 5AQJA 2AP1A 4N56A 2UU9K 1E4FT 1EETA 4HWIA 4RW8A 1NGCA 3DAWA 4DLGA 3AVHA 2RN2A 4QOZB 2HHXA 4L8RB 1YTUA 4JHDB 2GBZA 5IWAK 4UY8O 4J8FA 1REVA 1RT5A 2F9WA 3UB5A 3OYDA 3I56N 3ZETA 4B9MA 3LDOA 2P9NB 1U45A 1XC3A 4CJRA 3K5NA 3ZCMA 1T6DA 3CQYA 4PWDA 1IO2A 2FSJA 1L3UA 1TL1A 4LY7A 4CJTA 1C0TA 4EZ6A 1HYVA 3JXUA 1BIUA 3HRGA 2A6AA 3KVGA 2ETJA 1MU2A 3M8RA 2G8VA 1I3AA 5BPMA 1YITN 2A5XA 3KJVA 3J80O 2E1YA 4LF8K 1T6CA 1QE1A 5EXWA 4W5RA 3KWIA 2A41A 5KGWA 1BQNA 2E8AA 4O44A 4OPAA 3NGZA 1K8AO 1WB9A 3WQTA 4AHVA 2CGLA 3TWHA 2VWJA 3SAHA 3AO5A 4FLYA 2HVHA 3DRRA 5T7BA 3RRGA 3CJBA 3VQ6A 4PKGA 4HCBA 3VGMA 3U3GA 1S1TA 2JLEA 5FPDA 1BG3A 4QS8A 1SKWA 2FF6A 1BCOA 2P9PA 3D2FA 5JS2A 3K9JA 1NOZA 5DM6L 2Y1IA 5JLFA 1VQ8N 4I7FA 3O3FA 3OYMA 4KFBA 4EP5A 1HNVA 3WEEA 2RPIA 1F21A 2P9KB 2QWQA 4AQYK 3TABA 1M1KO 3QDKA 4CJUA 4DSEA 3CCVN 4CEBA 3THXB 1H1VA 3HP9A 3KLFA 2Z1IA 4RTFD 1BO5O 2PFUA 4ILHA 4IZ9A 3P83D 4DQPA 3CM6A 5J2NA 4Y0WA 4B9NA 1IV0A 4TSXA 3H1QA 3NH2A 3EEQA 4FOIA 1EX4A 1YXQA 4BC2A 1OKJA 4BR0A 4H5VA 1X1PA 1JLAA 4K41A 3OYIA 1LWEA 5BREA 4F4KA 3LM9A 1ATRA 3V9SA 4IBNA 1MWMA 1N33K 5TKWA 2IOCA 1Q18A 3HL8A 1C0GA 2AA4A 4YOXA 2DFHA 2GWKA 3AO2A 1JL1A 4FJLA 3VQDA 4BQZA 5AQLA 3CMEN 3PSIA 4OLBA 3HVTA 1VSFA 1FW6A 2VGMA 1M90O 3CC4N 1JLFA 2NRVA 1VSLA 1VSKA 1OH5A 5HRSA 2UUBK 4CIEA 4CECA 1RDAA 3TSPA 3RMCA 3GL1A 2YHAA 2WUSA 4JI1K 4K0KK 1B9FA 1OVYA 2Q31A 2NLXA 1VQMN 2NRZA 4CZJA 4U67L 3ZYYX 2ZWHA 3P5JA 2KZMA 4AHTA 4JV5K 4OO1J 2D1KA 3T1AA 1RT7A 2QW9A 3RTVA 2I5JA 2FBTA 4Z4EA 3LANA 4LFBK 2CGKA 4AHCA 3FGUA 2Q1NA 4BE1A 4DV7K 3MN9A 4BGBA 3KD5E 1U6ZA 3ZX3A 3F5TA 3U6FA 4KHYA 3CCQN 2X78A 3VQCA 1NK6A 4MQ3A 3AVBA 4B1YB 3MECA 3K0SA 3KWGA 3K5OA 2Q97A 2ASMA 3AVAA 4FJ8A 1T8EA 5D3GA 1JLCA 4DR3K 2P9UA 4MO4A 1WAJA 1NK7A 3GG4A 2IGIA 2VGNA 3OJUA 1UAXA 3DRPA 1S1VA 3THYB 3ZETB 3QNOA 3VQQA 2ASOA 4BE2A 3E9OA 4CZEA 3SQ2A 3KZBA 4FWNA 4LD0A 4LH4A 4I9QA 4CJFA 1Y64A 3QMLA 5BRDA 1NJWA 1C1BA 1VHXA 3THWA 5F0XA 3AV9A 3T19A 4O5FA 1J5EK 4JKBA 3KK7A 3E9LA 3MEEA 5FPMA 2QXLA 3TU5A 1C0UA 1NNEA 3KK3A 1RTJA 2FLOA 2Q3SA 3UKUA 4HTUA 5AR0A 1EO1A 2YHBA 3CC2N 2OPQA 5F1XA 2BDPA 2NRHA 4HTLA 2ZM6K 2D0BA 2HHTA 4HCCA 1NGFA 3MN7A 1DKGD 1NMNA 4IWVA 3PLAA 4L3QA 4WYBA 1YI2N 4PHTX 2FSNA 3OW2M 3MAQA 4BR4A 4DTPA 4CJEA 4PQUA 4Y1CA 3H45C 1DEJA 4Z94A 4YOTA 1HNZK 4WE1A 4KHNA 2ZJQL 3H46O 3QFPA 4B3MK 2HBMA 4B1WB 3T3FA 1IKYA 3ZT3A 3OYFA 4I2QA 4CFBA 1XC9A 3BGRA 4JK9A 4DU4A 4CVNE 1WSIA 1WBDA 1A5XA 4CZKA 4LSLA 3SCXA 3Q7CA 2XHBA 3VN5A 4IFVA 3ZSOA 4A57A 3CPEA 1QVGM 4LF4K 1ZYQA 4LF6K 4K8ZA 2QWNA 4H5WA 3JSMA 3H3NO 2P5GA 1RBTA 1EXQA 5EU7A 3NVKA 3LP1A 4E7HA 4M3YA 2HHVA 4I2PA 4DSFA 4GVEA 3I0RA 3AO4A 2HHUA 4YDUA 2X74A 3KK1A 4CGHA 1XQSC 4CF1A 4JYAK 3J8AA 5AQFA 3RR8A 3C6AA 1IBMK 1HYZA 5M1KA 2XY8A 4B3SK 3O9SA 3MXIA 3EZWA 4YDUC 4YORA 3S41A 4E7IA 2P9IB 1JCEA 2H3GX 1XNRK 1RT2A 2UUCK 3OS2A 4JRQA 1ZBFA 4WQ4A 4H5TA 1DGKN 4EAHD 3S9HA 4DV6K 1BGXT 4DF8A 2B4JA 1RBUA 4H5RA 2IC3A 3TAMA 2YJEA 4ELUA 3ZEUA 1RT4A 1WSJA 3SUQA 4JKAA 4CF9A 1IKWA 4KI6A 3VF4A 4KBOA 2B6AA 3IKMA 4WQ5A 5M1NA 2GELA 2IAJA 3A0IX 3DOKA 2D5RA 5TKYA 2E1ZA 4BRIA 3DRSA 3OYCA 3NF8A 1NK4A 3O9UA 3DYAA 3E66A 3U3YA 4FWOA 3DLBA 3VESA 3KLIA 4DTNA 2NUBA 4O8UA 3WUHA 2FSKA 3V1QA 4PL8A 1S1UA 3U9ZA 3CQXA 4C8MA 3QIPA 4YOYA 3QO9A 1YTAA 2KFZA 3TTFA 2NZTA 3FZKA 1U47A 2Q2RA 3G10A 2IS3A 1T44A 1BHLA 4M7YA 4FLWA 4N47A 3CIPA 3ASMA 5SWMA 1ASUA 2D0PA 4I9LA 4B1XB 3NF7A 2P5OA 1NKEA 2O8EB 3P39A 3SYZA 4I6MA 3LDPA 2ZJPL 1RILA 3NGYA 1C6VA
chains in the Genus database with same CATH topology
1S6QA 3AVHA 2O4IA 2RN2A 4CJ3A 4QOZB 4DS5A 2HHXA 4CK1A 3NAEA 4L8RB 1YTUA 4DFPA 3KKRA 2GBZA 3QESA 3H08A 3F73A 1KLNA 1REVA 4N41A 5CZ2A 1RT5A 2ZE2A 3K57A 4DTJA 3SQ1A 1RDBA 3OYDA 3EZ5A 1VSJA 4B9MA 3O4NA 4FJKA 4FM2A 4CJSA 4YNQA 3P1GA 1U45A 3KTQA 3FFIA 3AVFA 3ZT4A 4CJRA 3K5NA 4BACA 3HM9A 4DSLA 4CEOA 3PV8A 4C8LA 1TKZA 3ZCMA 4AHRA 3OYNA 4PWDA 2HHQA 3KIOA 2G8HA 1IKVA 3TAEA 3LAMA 1FK9A 1IO2A 1XWLA 1JXBA 1G15A 1L3UA 4LH5A 3TAQA 4ZTJA 1TL1A 1BL3A 3ISNC 1LAVA 4LY7A 4FJJA 4CJTA 1C0TA 4EZ6A 3OYBA 3LZJA 2Y1JA 1U4BA 5DMRA 2XY7A 3HXMA 1HYVA 2ZQBA 5KI6A 4KHQA 2X6NA 2EX3A 1S5JA 1BIUA 3L8BA 1NK0A 4Z4CA 3WNHA 3EYZA 2HNZA 1HMVA 4E7JA 4DU1A 2PYLA 1KVAA 3IS9A 4M45A 2ETJA 4BDYA 4DLEA 1VSIA 4W5TA 3HP6A 1TGOA 3QEVA 1MU2A 3SUPA 1NK9A 4CE9A 3M8RA 2G8VA 2FC0A 1I3AA 3RWUA 4CHNA 4FLXA 3KJVA 1RBVA 4PA1A 3OYLA 3L2RA 3AVKA 4E0DA 3MEDA 3QIOA 1BCMA 4UQGA 1N6QA 1LW0A 1WN7A 2BE2A 3I0SA 1QE1A 5KTQA 4W5RA 1VSMA 1SUQA 1W0HA 5KGWA 1BQNA 2RKIA 4O44A 3NGZA 3LP3A 4IFYA 5HBMA 3NE6A 3ZSZA 4B9SA 4KB1A 4M42A 4FJNA 1VRTA 4AHVA 1FKPA 1S6PA 3NF9A 3OYGA 2VWJA 3K2PA 3TWHA 3PO4A 1TVRA 1T7PA 2KQ2A 1TL3A 3HSTB 3AO5A 4EP4A 4FLYA 2HVHA 3DRRA 4EZ9A 5T7BA 5K14A 4CEAA 3K5MA 3RRGA 3NBPA 3VQ6A 1JL2A 4HCBA 1WLJA 3AA5X 1S1TA 3U3GA 2JLEA 4DQSA 2G8UA 4KRFA 3QEXA 4W5OA 1SKWA 1L3TA 1BCOA 2E6LA 1ZBUA 2HB5A 5JS2A 1NOZA 1Q9XA 2Y1IA 4I7FA 3AVNA 3O3FA 5CY4A 3OYMA 1LW2A 4DTRA 4KFBA 2VG6A 2YV0X 4EP5A 1VSHA 1QSYA 4OGCA 4DTOA 1HNVA 3IG1A 3ZT2A 3SNNA 3QNNA 2RPIA 1F21A 2Z1GA 2BANA 2Z1HA 3ZT1A 3TABA 1O1WA 4E7KA 1CXQA 4ZHRA 2AJQA 4BDZA 3SPYA 1D8YA 3VQ8A 4DSIA 4CJUA 1NJYA 1JLBA 3V6DA 1JLQA 2Z1JA 4CK2A 3I8DA 4DSEA 3VQ4A 4CEBA 4QCLA 4DFMA 2EHGA 3V1OA 4CHZA 2DTUA 3HP9A 3ZSRA 4CJPA 3KLFA 3VQPA 2Z1IA 3LWLA 3OYAA 4HUFA 1HRHA 3P83D 4HUGA 1Q8IA 4DQPA 3CM6A 5J2NA 4B9NA 4FJGA 4TSXA 4H4OA 1JLGA 3NH2A 2HNDA 1NK5A 1EX4A 4FJHA 3SZ2A 2ITGA 3TARA 3KLEA 5J2PA 2D0CA 3VQ5A 1X1PA 1JLAA 1FKOA 3OYIA 1LWEA 3ITHA 1U04A 4OGEA 4KTZA 3QEIA 4F4KA 4FXDA 3L2UA 3QERA 1HQEA 5HRRA 1J5OA 3V9SA 1C1CA 1S9GA 4F2SA 3CFRA 4CHQA 4IBNA 3UIQA 4KHWA 5HLFA 4FLTA 4Z4GA 3WNEA 1QHTA 1NKCA 1N5YA 2IOCA 3HL8A 3NHGA 3LP2A 2DFHA 1D9DA 3AO2A 3VA0A 1JL1A 1X9WA 4ELTA 4HUEA 1LWFA 4FJLA 3ULDA 4OKJA 2D0AA 3VQDA 3VQAA 3CQ8A 1WSEA 3B6OA 4FJ5A 4RW4A 4OLBA 3HVTA 3V1RA 1VSFA 1TAQA 3IRXA 3O4QA 4FJMA 1SKRA 4FZZA 4CEFA 4B3OA 4IG0A 5J2MA 3CM5A 3HJFA 3HVRA 4DFKA 1T03A 1ASVA 1JLFA 4MFBA 4M3WA 1EP4A 3HK2A 3CFPA 1VSLA 1VSKA 3DLKA 1KVCA 2E4LA 1S1XA 2HW3A 4GW6A 1DTQA 5FRMA 2QKBA 3ZSWA 4IKFA 4O5BA 2FBVA 4KAZA 5HRSA 1HNIA 4CIEA 4CECA 1RDAA 3RMCA 1SV5A 4FK2A 2OYQA 1ZBHA 1JLEA 3L2QA 1TKXA 1RT1A 1WSHA 2YHAA 2KTQA 1WAFA 4ICLA 1J54A 1VSDA 2F96A 1B9FA 3OY9A 4E1NA 2OA8A 2OPPA 4B9UA 5J1EA 4M3UA 1QQCA 3P5JA 2KZMA 3VQ7A 4AHTA 5I3UA 1XI1A 4M3ZA 3T1AA 1RT7A 3QINA 3RTVA 2I5JA 4CJ4A 1IG9A 2FBTA 4Z4EA 3LANA 3K59A 1SKSA 5FRNA 4IDKA 4CGGA 3KLGA 4NYNA 2ATQA 4AHCA 4FM1A 1TV6A 4BE1A 2OZMA 4B8CA 3KD5E 4FLUA 2WOMA 4HVJA 3U6FA 1RNHA 4B9TA 4KHYA 3HYFA 4KREA 4FYDA 2KW4A 2X78A 3VQCA 1NK6A 1RCHA 3LAKA 5HRNA 4MQ3A 3D0PA 3AVBA 3VA3A 3MECA 2LSNA 3K58A 1NJZA 2P51A 3K5OA 3AVAA 4FJ8A 1T8EA 3PUFA 1X9SA 5KRTA 1K6YA 3SI6A 1JLCA 5HROA 1KSPA 4FZYA 3KKSA 5D3GA 4KHSA 1WAJA 1NK7A 4KO0A 2PY5A 2IGIA 2YNGA 3OJUA 1Z26A 1RDCA 1YVUA 4RW6A 1UAXA 3B6PA 4CJKA 1NK8A 3VQEA 1VSEA 3DOLA 3DRPA 3QEWA 4F3OA 4F3TA 4OPJA 4CGFA 3S3NA 3AO1A 1S1VA 4CJWA 4OPKA 3EY1A 2A1RA 3TAFA 3LZIA 1BISA 4FK0A 1HJRA 3QNOA 3VQQA 4BE2A 4C8KA 1A5VA 1RTIA 4E89A 3LWMA 4KPYA 1KFSA 3QETA 4E7LA 1HYSA 3DLEA 4Z4HA 3SQ2A 1XHXA 1ITGA 3VQBA 4J2AA 1S1WA 3AA3A 3KK2A 4LD0A 4H8KA 4JS5A 1TK5A 2KFNA 1B9DA 1UWBA 2YNFA 4LH4A 3NH0A 3OYHA 4F2RA 4I9QA 3LPTA 4CJFA 5JS1A 4FM0A 3MXJA 4DQQA 4KTQA 1NJWA 1C1BA 3AV9A 3AVGA 4B8AB 3OS0A 1W9HA 3T19A 4DFJA 4AH9A 3O3HA 2G8FA 1KLMA 1CZ9A 4CF8A 4FW2A 4CEDA 4E19A 4FLVA 2XY5A 1NKBA 4R5PA 3CG7A 1J53A 4CF0A 4DU3A 5I42A 3MEEA 3C6UA 3WNGA 1C0UA 4RW9A 3KK3A 1IH7A 1RTJA 2KZZA 2Q3SA 4W5NA 4HTUA 4DQIA 3ALYA 1ZBIA 5SZTA 3AVIA 2YHBA 3HPHA 1GOAA 2OPQA 3HT3A 3CYMA 3LP0A 4CJQA 3ZSVA 3OVNA 3K5LA 2QXFA 3SV4A 3RRHA 2BDPA 4F8RA 4ELVA 2DY4A 1BQMA 1YT3A 1TAUA 3TI0A 2QKKA 4CCHA 2DFEA 4JLHA 2D0BA 4AHSA 2FBXA 4NCGA 4CF2A 3AVCA 3E01A 2HHTA 2XRIA 4CERA 4HCCA 2YNIA 2BGGA 4FJXA 3NF6A 1HPZA 2P1JA 1KVBA 3M8SA 3CFOA 5C24A 3TR8A 3JYTA 3SUOA 4J2BA 1JXEA 3ZSXA 4CJVA 1ASWA 1R0AA 3MAQA 4RW7A 3KLHA 1RT3A 4DTPA 2VG7A 3TAPA 3L3VA 1QS4A 4CFAA 4DQRA 2G8KA 4CJEA 1QTMA 3QEPA 1KTQA 4Y1CA 2OZSA 2VG5A 3V9WA 2QK9A 4PQUA 4CGJA 2XY6A 3IAYA 4WE1A 4KHNA 1SL2A 4RG8A 3ZT0A 3DI6A 1UA0A 1NJXA 3M8PA 4N76A 4PUOA 3AA4A 3AA2A 3QLHA 1RT6A 3L2VA 4DMNA 3BDPA 2YKNA 3T3FA 1IKYA 4H4MA 3L2WA 4DF4A 3RMDA 3ZT3A 3OYFA 4E3SA 4I2QA 4CFBA 4CJLA 1XC9A 4J2DA 3BGRA 3G0ZA 3RMBA 2F8TA 4NCBA 4DU4A 1S9EA 1WSIA 4CFCA 2OPRA 4W5QA 5DK5A 1A5XA 1GOBA 1BI4B 4OLAA 1VK0A 4LSLA 5C25A 3SCXA 4KKOA 2A1SA 4Z4FA 3RR7A 2O4GA 1UOCA 1WNSA 1TKTA 3SV3A 4DTMA 2XHBA 3LDSA 1A5WA 1SL1A 4DSKA 3VN5A 4NCAA 2G8IA 4IFVA 4BWMA 3ZSOA 1CLQA 5FDLA 4Z0UA 4CHYA 4FW1A 4FJ9A 1B92A 1RBRA 2IDOA 3OS1A 1ZYQA 4QAGA 4CEEA 1FXXA 5CYMA 4JRPA 4K8ZA 4FLZA 4B9VA 4OKKA 3JSMA 4CHOA 2P5GA 4ID5A 3HPGA 1RBTA 1EXQA 5CYQA 5EU7A 1J9AA 3V4IA 4DTXA 3LP1A 4C8OA 4O55A 1RTHA 1ZBLA 3HO1A 4XIUA 4E7HA 4M3YA 1I39A 2GUIA 4I2PA 4DSFA 2HHVA 4KI4A 1L3SA 1GOCA 3DMJA 3I0RA 4GVMA 1CXUA 3AO4A 4CIGA 4M3TA 2HHUA 2X74A 1T05A 1VRUA 2PYJA 3KK1A 4CGHA 3S3MA 5FROA 4CF1A 3C94A 4Q5VA 3V9XA 3DLGA 3ZSQA 1LWCA 3L3UA 3TANA 1TKDA 4NYFA 4Q0BA 4FJ7A 3RR8A 4GMJB 4O0JA 4K8XA 1HYZA 1RBSA 2HVIA 5KGXA 2XY8A 3NH1A 3MXIA 1UA1A 4KB0A 1DTTA 3KD1E 4FZXC 4PY5A 1U48A 4DWIA 4E7IA 2XO7A 4FVMA 3AVMA 4O4GA 1D9FA 4CEQA 1NOYA 4B08A 2HMIA 1WSGA 1Z25A 4CJ5A 2OPSA 3AVLA 3NGIA 3DLRA 4B9LA 2W42A 1RT2A 1CZBA 1IKXA 3OS2A 4JRQA 1ZBFA 5J2QA 1D5AA 1TK0A 1KFDA 4O0IA 1RTDA 3OYKA 2GV9A 3OYEA 4DS4A 2ZD1A 3S9HA 3SQ0A 1BGXT 4DF8A 2B4JA 1X9MA 1RBUA 2B5JA 3AVJA 4YFUA 2IC3A 3LPUA 1EKEA 3TAMA 1C1AA 4LSNA 1LV5A 4ELUA 3V81A 3PX4A 3SJJA 1RT4A 4JS4A 1WSJA 3SUQA 4AILC 2JGUA 3MEGA 4CEZA 4CHPA 1IKWA 4CF9A 5E41A 4KI6A 3SUNA 2YNHA 2B6AA 4IG3A 3PX0A 1JKHA 3AO3A 4DG1A 4G1QA 2IAJA 2X6SA 4M3RA 3THVA 1QSLA 1Y97A 2D5RA 3DOKA 1RDDA 4CFDA 4KHUA 5KRSA 3NDKA 1C0MA 4KV8A 3DRSA 3OYCA 3S3OA 3HPOA 3NF8A 1NK4A 1KRPA 3A2FA 3C95A 3DYAA 4N5SA 3SPZA 1KCFA 3TAGA 3U3YA 5C42A 4E1MA 2FBYA 3DLBA 3VQ9A 1BIZA 3O3GA 3KLIA 4DTNA 5HP1A 2NUBA 1LAWA 2YKMA 1TK8A 1SL0A 2VWKA 2HNYA 1BI4A 3V1QA 4FK4A 4FCYA 1S1UA 2PZSA 3ZSYA 4CGDA 5CZ1A 4M41A 4ZTFA 3OJSA 4C8NA 3SQ4A 3OYJA 4C8MA 3PY8A 3QIPA 4DSJA 3V9ZA 3QO9A 1YTAA 3V9UA 3M8QA 3WNFA 1L3VA 2KFZA 3NCIA 4OJRA 2E6MA 3PO5A 4BDPA 4M3XA 4AHUA 1WSFA 3D45A 1QSSA 2HHSA 1U47A 2RF2A 3MXMA 3G10A 2IS3A 2G8WA 4FJIA 1BHLA 4FLWA 2WONA 4N47A 3ASMA 5SWMA 4DTUA 3PX6A 1XHZA 4HHTA 3LALA 2F8SA 1ASUA 4DTSA 4CESA 4Y1DA 4KTWA 4OKEA 4I9LA 4BWJA 4CGIA 3C6TA 4CIFA 3NF7A 4BE0A 2R7YA 1Q9YA 3F9KA 1NKEA 1DLOA 3NFAA 4CK3A 2P5OA 1HQUA 3DM2A 4N56A 2HHWA 3SYZA 4OVLA 1U49A 4J2EA 4ID1A 4Z4IA 1EETA 1L5UA 3DLHA 4RW8A 1RILA 3NGYA 5HRPA 2DFFA 3RMAA 4DLGA 1C6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S6Q A;  3AVH A;  2O4I A;  2RN2 A;  4CJ3 A;  4QOZ B;  4DS5 A;  2HHX A;  4CK1 A;  3NAE A;  4L8R B;  1YTU A;  4DFP A;  3KKR A;  2GBZ A;  3QES A;  3H08 A;  3F73 A;  1KLN A;  1REV A;  4N41 A;  5CZ2 A;  1RT5 A;  2ZE2 A;  3K57 A;  4DTJ A;  3SQ1 A;  1RDB A;  3OYD A;  3EZ5 A;  1VSJ A;  4B9M A;  3O4N A;  4FJK A;  4FM2 A;  4CJS A;  4YNQ A;  3P1G A;  1U45 A;  3KTQ A;  3FFI A;  3AVF A;  3ZT4 A;  4CJR A;  3K5N A;  4BAC A;  3HM9 A;  4DSL A;  4CEO A;  3PV8 A;  4C8L A;  1TKZ A;  3ZCM A;  4AHR A;  3OYN A;  4PWD A;  2HHQ A;  3KIO A;  2G8H A;  1IKV A;  3TAE A;  3LAM A;  1FK9 A;  1IO2 A;  1XWL A;  1JXB A;  1G15 A;  1L3U A;  4LH5 A;  3TAQ A;  4ZTJ A;  1TL1 A;  1BL3 A;  3ISN C;  1LAV A;  4LY7 A;  4FJJ A;  4CJT A;  1C0T A;  4EZ6 A;  3OYB A;  3LZJ A;  2Y1J A;  1U4B A;  5DMR A;  2XY7 A;  3HXM A;  1HYV A;  2ZQB A;  5KI6 A;  4KHQ A;  2X6N A;  2EX3 A;  1S5J A;  1BIU A;  3L8B A;  1NK0 A;  4Z4C A;  3WNH A;  3EYZ A;  2HNZ A;  1HMV A;  4E7J A;  4DU1 A;  2PYL A;  1KVA A;  3IS9 A;  4M45 A;  2ETJ A;  4BDY A;  4DLE A;  1VSI A;  4W5T A;  3HP6 A;  1TGO A;  3QEV A;  1MU2 A;  3SUP A;  1NK9 A;  4CE9 A;  3M8R A;  2G8V A;  2FC0 A;  1I3A A;  3RWU A;  4CHN A;  4FLX A;  3KJV A;  1RBV A;  4PA1 A;  3OYL A;  3L2R A;  3AVK A;  4E0D A;  3MED A;  3QIO A;  1BCM A;  4UQG A;  1N6Q A;  1LW0 A;  1WN7 A;  2BE2 A;  3I0S A;  1QE1 A;  5KTQ A;  4W5R A;  1VSM A;  1SUQ A;  1W0H A;  5KGW A;  1BQN A;  2RKI A;  4O44 A;  3NGZ A;  3LP3 A;  4IFY A;  5HBM A;  3NE6 A;  3ZSZ A;  4B9S A;  4KB1 A;  4M42 A;  4FJN A;  1VRT A;  4AHV A;  1FKP A;  1S6P A;  3NF9 A;  3OYG A;  2VWJ A;  3K2P A;  3TWH A;  3PO4 A;  1TVR A;  1T7P A;  2KQ2 A;  1TL3 A;  3HST B;  3AO5 A;  4EP4 A;  4FLY A;  2HVH A;  3DRR A;  4EZ9 A;  5T7B A;  5K14 A;  4CEA A;  3K5M A;  3RRG A;  3NBP A;  3VQ6 A;  1JL2 A;  4HCB A;  1WLJ A;  3AA5 X;  1S1T A;  3U3G A;  2JLE A;  4DQS A;  2G8U A;  4KRF A;  3QEX A;  4W5O A;  1SKW A;  1L3T A;  1BCO A;  2E6L A;  1ZBU A;  2HB5 A;  5JS2 A;  1NOZ A;  1Q9X A;  2Y1I A;  4I7F A;  3AVN A;  3O3F A;  5CY4 A;  3OYM A;  1LW2 A;  4DTR A;  4KFB A;  2VG6 A;  2YV0 X;  4EP5 A;  1VSH A;  1QSY A;  4OGC A;  4DTO A;  1HNV A;  3IG1 A;  3ZT2 A;  3SNN A;  3QNN A;  2RPI A;  1F21 A;  2Z1G A;  2BAN A;  2Z1H A;  3ZT1 A;  3TAB A;  1O1W A;  4E7K A;  1CXQ A;  4ZHR A;  2AJQ A;  4BDZ A;  3SPY A;  1D8Y A;  3VQ8 A;  4DSI A;  4CJU A;  1NJY A;  1JLB A;  3V6D A;  1JLQ A;  2Z1J A;  4CK2 A;  3I8D A;  4DSE A;  3VQ4 A;  4CEB A;  4QCL A;  4DFM A;  2EHG A;  3V1O A;  4CHZ A;  2DTU A;  3HP9 A;  3ZSR A;  4CJP A;  3KLF A;  3VQP A;  2Z1I A;  3LWL A;  3OYA A;  4HUF A;  1HRH A;  3P83 D;  4HUG A;  1Q8I A;  4DQP A;  3CM6 A;  5J2N A;  4B9N A;  4FJG A;  4TSX A;  4H4O A;  1JLG A;  3NH2 A;  2HND A;  1NK5 A;  1EX4 A;  4FJH A;  3SZ2 A;  2ITG A;  3TAR A;  3KLE A;  5J2P A;  2D0C A;  3VQ5 A;  1X1P A;  1JLA A;  1FKO A;  3OYI A;  1LWE A;  3ITH A;  1U04 A;  4OGE A;  4KTZ A;  3QEI A;  4F4K A;  4FXD A;  3L2U A;  3QER A;  1HQE A;  5HRR A;  1J5O A;  3V9S A;  1C1C A;  1S9G A;  4F2S A;  3CFR A;  4CHQ A;  4IBN A;  3UIQ A;  4KHW A;  5HLF A;  4FLT A;  4Z4G A;  3WNE A;  1QHT A;  1NKC A;  1N5Y A;  2IOC A;  3HL8 A;  3NHG A;  3LP2 A;  2DFH A;  1D9D A;  3AO2 A;  3VA0 A;  1JL1 A;  1X9W A;  4ELT A;  4HUE A;  1LWF A;  4FJL A;  3ULD A;  4OKJ A;  2D0A A;  3VQD A;  3VQA A;  3CQ8 A;  1WSE A;  3B6O A;  4FJ5 A;  4RW4 A;  4OLB A;  3HVT A;  3V1R A;  1VSF A;  1TAQ A;  3IRX A;  3O4Q A;  4FJM A;  1SKR A;  4FZZ A;  4CEF A;  4B3O A;  4IG0 A;  5J2M A;  3CM5 A;  3HJF A;  3HVR A;  4DFK A;  1T03 A;  1ASV A;  1JLF A;  4MFB A;  4M3W A;  1EP4 A;  3HK2 A;  3CFP A;  1VSL A;  1VSK A;  3DLK A;  1KVC A;  2E4L A;  1S1X A;  2HW3 A;  4GW6 A;  1DTQ A;  5FRM A;  2QKB A;  3ZSW A;  4IKF A;  4O5B A;  2FBV A;  4KAZ A;  5HRS A;  1HNI A;  4CIE A;  4CEC A;  1RDA A;  3RMC A;  1SV5 A;  4FK2 A;  2OYQ A;  1ZBH A;  1JLE A;  3L2Q A;  1TKX A;  1RT1 A;  1WSH A;  2YHA A;  2KTQ A;  1WAF A;  4ICL A;  1J54 A;  1VSD A;  2F96 A;  1B9F A;  3OY9 A;  4E1N A;  2OA8 A;  2OPP A;  4B9U A;  5J1E A;  4M3U A;  1QQC A;  3P5J A;  2KZM A;  3VQ7 A;  4AHT A;  5I3U A;  1XI1 A;  4M3Z A;  3T1A A;  1RT7 A;  3QIN A;  3RTV A;  2I5J A;  4CJ4 A;  1IG9 A;  2FBT A;  4Z4E A;  3LAN A;  3K59 A;  1SKS A;  5FRN A;  4IDK A;  4CGG A;  3KLG A;  4NYN A;  2ATQ A;  4AHC A;  4FM1 A;  1TV6 A;  4BE1 A;  2OZM A;  4B8C A;  3KD5 E;  4FLU A;  2WOM A;  4HVJ A;  3U6F A;  1RNH A;  4B9T A;  4KHY A;  3HYF A;  4KRE A;  4FYD A;  2KW4 A;  2X78 A;  3VQC A;  1NK6 A;  1RCH A;  3LAK A;  5HRN A;  4MQ3 A;  3D0P A;  3AVB A;  3VA3 A;  3MEC A;  2LSN A;  3K58 A;  1NJZ A;  2P51 A;  3K5O A;  3AVA A;  4FJ8 A;  1T8E A;  3PUF A;  1X9S A;  5KRT A;  1K6Y A;  3SI6 A;  1JLC A;  5HRO A;  1KSP A;  4FZY A;  3KKS A;  5D3G A;  4KHS A;  1WAJ A;  1NK7 A;  4KO0 A;  2PY5 A;  2IGI A;  2YNG A;  3OJU A;  1Z26 A;  1RDC A;  1YVU A;  4RW6 A;  1UAX A;  3B6P A;  4CJK A;  1NK8 A;  3VQE A;  1VSE A;  3DOL A;  3DRP A;  3QEW A;  4F3O A;  4F3T A;  4OPJ A;  4CGF A;  3S3N A;  3AO1 A;  1S1V A;  4CJW A;  4OPK A;  3EY1 A;  2A1R A;  3TAF A;  3LZI A;  1BIS A;  4FK0 A;  1HJR A;  3QNO A;  3VQQ A;  4BE2 A;  4C8K A;  1A5V A;  1RTI A;  4E89 A;  3LWM A;  4KPY A;  1KFS A;  3QET A;  4E7L A;  1HYS A;  3DLE A;  4Z4H A;  3SQ2 A;  1XHX A;  1ITG A;  3VQB A;  4J2A A;  1S1W A;  3AA3 A;  3KK2 A;  4LD0 A;  4H8K A;  4JS5 A;  1TK5 A;  2KFN A;  1B9D A;  1UWB A;  2YNF A;  4LH4 A;  3NH0 A;  3OYH A;  4F2R A;  4I9Q A;  3LPT A;  4CJF A;  5JS1 A;  4FM0 A;  3MXJ A;  4DQQ A;  4KTQ A;  1NJW A;  1C1B A;  3AV9 A;  3AVG A;  4B8A B;  3OS0 A;  1W9H A;  3T19 A;  4DFJ A;  4AH9 A;  3O3H A;  2G8F A;  1KLM A;  1CZ9 A;  4CF8 A;  4FW2 A;  4CED A;  4E19 A;  4FLV A;  2XY5 A;  1NKB A;  4R5P A;  3CG7 A;  1J53 A;  4CF0 A;  4DU3 A;  5I42 A;  3MEE A;  3C6U A;  3WNG A;  1C0U A;  4RW9 A;  3KK3 A;  1IH7 A;  1RTJ A;  2KZZ A;  2Q3S A;  4W5N A;  4HTU A;  4DQI A;  3ALY A;  1ZBI A;  5SZT A;  3AVI A;  2YHB A;  3HPH A;  1GOA A;  2OPQ A;  3HT3 A;  3CYM A;  3LP0 A;  4CJQ A;  3ZSV A;  3OVN A;  3K5L A;  2QXF A;  3SV4 A;  3RRH A;  2BDP A;  4F8R A;  4ELV A;  2DY4 A;  1BQM A;  1YT3 A;  1TAU A;  3TI0 A;  2QKK A;  4CCH A;  2DFE A;  4JLH A;  2D0B A;  4AHS A;  2FBX A;  4NCG A;  4CF2 A;  3AVC A;  3E01 A;  2HHT A;  2XRI A;  4CER A;  4HCC A;  2YNI A;  2BGG A;  4FJX A;  3NF6 A;  1HPZ A;  2P1J A;  1KVB A;  3M8S A;  3CFO A;  5C24 A;  3TR8 A;  3JYT A;  3SUO A;  4J2B A;  1JXE A;  3ZSX A;  4CJV A;  1ASW A;  1R0A A;  3MAQ A;  4RW7 A;  3KLH A;  1RT3 A;  4DTP A;  2VG7 A;  3TAP A;  3L3V A;  1QS4 A;  4CFA A;  4DQR A;  2G8K A;  4CJE A;  1QTM A;  3QEP A;  1KTQ A;  4Y1C A;  2OZS A;  2VG5 A;  3V9W A;  2QK9 A;  4PQU A;  4CGJ A;  2XY6 A;  3IAY A;  4WE1 A;  4KHN A;  1SL2 A;  4RG8 A;  3ZT0 A;  3DI6 A;  1UA0 A;  1NJX A;  3M8P A;  4N76 A;  4PUO A;  3AA4 A;  3AA2 A;  3QLH A;  1RT6 A;  3L2V A;  4DMN A;  3BDP A;  2YKN A;  3T3F A;  1IKY A;  4H4M A;  3L2W A;  4DF4 A;  3RMD A;  3ZT3 A;  3OYF A;  4E3S A;  4I2Q A;  4CFB A;  4CJL A;  1XC9 A;  4J2D A;  3BGR A;  3G0Z A;  3RMB A;  2F8T A;  4NCB A;  4DU4 A;  1S9E A;  1WSI A;  4CFC A;  2OPR A;  4W5Q A;  5DK5 A;  1A5X A;  1GOB A;  1BI4 B;  4OLA A;  1VK0 A;  4LSL A;  5C25 A;  3SCX A;  4KKO A;  2A1S A;  4Z4F A;  3RR7 A;  2O4G A;  1UOC A;  1WNS A;  1TKT A;  3SV3 A;  4DTM A;  2XHB A;  3LDS A;  1A5W A;  1SL1 A;  4DSK A;  3VN5 A;  4NCA A;  2G8I A;  4IFV A;  4BWM A;  3ZSO A;  1CLQ A;  5FDL A;  4Z0U A;  4CHY A;  4FW1 A;  4FJ9 A;  1B92 A;  1RBR A;  2IDO A;  3OS1 A;  1ZYQ A;  4QAG A;  4CEE A;  1FXX A;  5CYM A;  4JRP A;  4K8Z A;  4FLZ A;  4B9V A;  4OKK A;  3JSM A;  4CHO A;  2P5G A;  4ID5 A;  3HPG A;  1RBT A;  1EXQ A;  5CYQ A;  5EU7 A;  1J9A A;  3V4I A;  4DTX A;  3LP1 A;  4C8O A;  4O55 A;  1RTH A;  1ZBL A;  3HO1 A;  4XIU A;  4E7H A;  4M3Y A;  1I39 A;  2GUI A;  4I2P A;  4DSF A;  2HHV A;  4KI4 A;  1L3S A;  1GOC A;  3DMJ A;  3I0R A;  4GVM A;  1CXU A;  3AO4 A;  4CIG A;  4M3T A;  2HHU A;  2X74 A;  1T05 A;  1VRU A;  2PYJ A;  3KK1 A;  4CGH A;  3S3M A;  5FRO A;  4CF1 A;  3C94 A;  4Q5V A;  3V9X A;  3DLG A;  3ZSQ A;  1LWC A;  3L3U A;  3TAN A;  1TKD A;  4NYF A;  4Q0B A;  4FJ7 A;  3RR8 A;  4GMJ B;  4O0J A;  4K8X A;  1HYZ A;  1RBS A;  2HVI A;  5KGX A;  2XY8 A;  3NH1 A;  3MXI A;  1UA1 A;  4KB0 A;  1DTT A;  3KD1 E;  4FZX C;  4PY5 A;  1U48 A;  4DWI A;  4E7I A;  2XO7 A;  4FVM A;  3AVM A;  4O4G A;  1D9F A;  4CEQ A;  1NOY A;  4B08 A;  2HMI A;  1WSG A;  1Z25 A;  4CJ5 A;  2OPS A;  3AVL A;  3NGI A;  3DLR A;  4B9L A;  2W42 A;  1RT2 A;  1CZB A;  1IKX A;  3OS2 A;  4JRQ A;  1ZBF A;  5J2Q A;  1D5A A;  1TK0 A;  1KFD A;  4O0I A;  1RTD A;  3OYK A;  2GV9 A;  3OYE A;  4DS4 A;  2ZD1 A;  3S9H A;  3SQ0 A;  1BGX T;  4DF8 A;  2B4J A;  1X9M A;  1RBU A;  2B5J A;  3AVJ A;  4YFU A;  2IC3 A;  3LPU A;  1EKE A;  3TAM A;  1C1A A;  4LSN A;  1LV5 A;  4ELU A;  3V81 A;  3PX4 A;  3SJJ A;  1RT4 A;  4JS4 A;  1WSJ A;  3SUQ A;  4AIL C;  2JGU A;  3MEG A;  4CEZ A;  4CHP A;  1IKW A;  4CF9 A;  5E41 A;  4KI6 A;  3SUN A;  2YNH A;  2B6A A;  4IG3 A;  3PX0 A;  1JKH A;  3AO3 A;  4DG1 A;  4G1Q A;  2IAJ A;  2X6S A;  4M3R A;  3THV A;  1QSL A;  1Y97 A;  2D5R A;  3DOK A;  1RDD A;  4CFD A;  4KHU A;  5KRS A;  3NDK A;  1C0M A;  4KV8 A;  3DRS A;  3OYC A;  3S3O A;  3HPO A;  3NF8 A;  1NK4 A;  1KRP A;  3A2F A;  3C95 A;  3DYA A;  4N5S A;  3SPZ A;  1KCF A;  3TAG A;  3U3Y A;  5C42 A;  4E1M A;  2FBY A;  3DLB A;  3VQ9 A;  1BIZ A;  3O3G A;  3KLI A;  4DTN A;  5HP1 A;  2NUB A;  1LAW A;  2YKM A;  1TK8 A;  1SL0 A;  2VWK A;  2HNY A;  1BI4 A;  3V1Q A;  4FK4 A;  4FCY A;  1S1U A;  2PZS A;  3ZSY A;  4CGD A;  5CZ1 A;  4M41 A;  4ZTF A;  3OJS A;  4C8N A;  3SQ4 A;  3OYJ A;  4C8M A;  3PY8 A;  3QIP A;  4DSJ A;  3V9Z A;  3QO9 A;  1YTA A;  3V9U A;  3M8Q A;  3WNF A;  1L3V A;  2KFZ A;  3NCI A;  4OJR A;  2E6M A;  3PO5 A;  4BDP A;  4M3X A;  4AHU A;  1WSF A;  3D45 A;  1QSS A;  2HHS A;  1U47 A;  2RF2 A;  3MXM A;  3G10 A;  2IS3 A;  2G8W A;  4FJI A;  1BHL A;  4FLW A;  2WON A;  4N47 A;  3ASM A;  5SWM A;  4DTU A;  3PX6 A;  1XHZ A;  4HHT A;  3LAL A;  2F8S A;  1ASU A;  4DTS A;  4CES A;  4Y1D A;  4KTW A;  4OKE A;  4I9L A;  4BWJ A;  4CGI A;  3C6T A;  4CIF A;  3NF7 A;  4BE0 A;  2R7Y A;  1Q9Y A;  3F9K A;  1NKE A;  1DLO A;  3NFA A;  4CK3 A;  2P5O A;  1HQU A;  3DM2 A;  4N56 A;  2HHW A;  3SYZ A;  4OVL A;  1U49 A;  4J2E A;  4ID1 A;  4Z4I A;  1EET A;  1L5U A;  3DLH A;  4RW8 A;  1RIL A;  3NGY A;  5HRP A;  2DFF A;  3RMA A;  4DLG A;  1C6V A; 
#chains in the Genus database with same CATH topology
 1S6Q A;  4FWK A;  2WFB A;  4YOV A;  3KKR A;  2HBK A;  5BR9 A;  4N41 A;  3D2E B;  3EZ5 A;  3ENB A;  1LOT B;  4FJK A;  3GBT A;  3LM2 A;  4CJS A;  4RCH A;  3P1G A;  3ZT4 A;  3L4Q A;  3P31 A;  5AFU A;  4BAC A;  4KHP K;  3T69 A;  1BU6 O;  4CEO A;  1TKZ A;  2G8H A;  3QB0 A;  2RHK A;  3EO3 A;  4R79 A;  1G15 A;  3AAP A;  3OTO K;  1U4B A;  5AQU A;  2XY7 A;  4KHQ A;  4LF5 K;  2X6N A;  4JAX A;  2O8F B;  4BDY A;  3FZM A;  3QEV A;  1TGO A;  3DXK A;  4CE9 A;  4DV2 K;  2IVP A;  3FE1 A;  3CMA N;  3BUZ B;  3MCA B;  4FLX A;  1RBV A;  1VQL N;  2BE2 A;  3I0S A;  2QA4 N;  4GV3 A;  5KTQ A;  1VSM A;  2IVO A;  1SUQ A;  1W0H A;  4H5N A;  4F9O A;  2RKI A;  4IFY A;  3OYG A;  1FKP A;  3NF9 A;  3PO4 A;  1W97 L;  3K2P A;  3WXI A;  3ENH A;  2KQ2 A;  4EP4 A;  2F4V K;  4EZ9 A;  4JK8 A;  5K14 A;  4CEA A;  1NGH A;  1NGE A;  3GE1 A;  4FOE A;  1WLJ A;  3AA5 X;  4W5O A;  2YHY A;  3ULE B;  2HST A;  1OH8 A;  1Q9X A;  2I7N A;  4CW7 B;  3TSU A;  3AVN A;  3MMV A;  5CY4 A;  1QQM A;  2YV0 X;  3DJC A;  5CHI A;  4YHH K;  5AQX A;  2Z1G A;  2BAN A;  2WBN A;  2FF3 B;  3W3D A;  2AJQ A;  3VGL A;  2VQF K;  1D8Y A;  2O8D A;  2UUA K;  3G25 A;  2Z1J A;  2OCE A;  3M5R A;  4QCL A;  4CJP A;  1HRH A;  1VQP N;  1Q8I A;  1QHA A;  4FJH A;  3TAR A;  4BRK A;  3VEO A;  3ATU A;  3QEI A;  3MX2 A;  3QER A;  1GLF O;  4DV5 K;  1C1C A;  4KHW A;  4IOX A;  3WNE A;  1QHT A;  3SMP A;  3CCL N;  2E20 A;  2GTD A;  3ZEU B;  4CJ7 A;  4HUE A;  4OKJ A;  2D0A A;  1NLV A;  3VQA A;  3I55 N;  3EE8 A;  1WSE A;  4FJ5 A;  5AZI A;  4FZZ A;  1SKR A;  3A5M C;  3HJF A;  4DFK A;  4MFB A;  4M3W A;  3CFP A;  3DLK A;  2E4L A;  2QKB A;  4MLE A;  3ZSW A;  3KHY A;  4JD2 A;  2E2O A;  4MLH A;  2HF4 A;  4NLB A;  3SJH A;  4FK2 A;  1ZBH A;  3CJ9 A;  1RT1 A;  1Q82 O;  1WAF A;  4ICL A;  5GIO A;  1J54 A;  2F96 A;  3LDQ A;  4DR4 K;  4FWM A;  4B9U A;  4JN4 A;  4XEI A;  4IFE A;  3VQ7 A;  1NG9 A;  4JI6 K;  2ZGZ A;  1IG9 A;  3K59 A;  2CH5 A;  1ESV A;  5FRN A;  1GLA G;  2ATQ A;  4LF9 K;  4B8C A;  3O1B A;  3VEV A;  3O6W A;  4FLU A;  4B9T A;  3HYF A;  3CJC A;  5AQM A;  4BRN A;  4BRM A;  3CET A;  4BRH A;  5HRN A;  3SAG A;  4FWP A;  3K58 A;  4B1U B;  3R3L A;  4JKG A;  3PUF A;  3SI6 A;  5HRO A;  1KSP A;  4FZY A;  4KHS A;  3T1Y K;  2PY5 A;  4JKE A;  1RDC A;  1YVU A;  4CJK A;  1NK8 A;  4F3T A;  4F3O A;  4OPJ A;  4CGF A;  3AO1 A;  3EY1 A;  4OPK A;  2A1R A;  1IG8 A;  3TAF A;  4C8K A;  1A5V A;  4E89 A;  3LWM A;  1HKB A;  3QET A;  1XHX A;  1MDU B;  3AA3 A;  4H8K A;  3OYH A;  2YNF A;  4DQQ A;  4KTQ A;  4M63 C;  3LDN A;  4IDH A;  4B8A B;  3OS0 A;  4AH9 A;  2EWS A;  4FLV A;  1CZ9 A;  4CF8 A;  4CED A;  2XY5 A;  3PIO L;  3N4P A;  3C6U A;  3TTD A;  1IH7 A;  3CI5 A;  3O80 A;  3RSE B;  3ALY A;  5SZT A;  3AVI A;  3R8E A;  3HPH A;  3CYM A;  3RRH A;  4ELV A;  1BQM A;  1K8K B;  1YT3 A;  3DXM B;  1HKC A;  4JLH A;  4AHS A;  2FBX A;  4CF2 A;  2UYT A;  2W41 A;  3BZC A;  4CER A;  3UKR B;  1S22 A;  1KVB A;  3CFO A;  4M7X A;  3SUO A;  1JXE A;  3ZSX A;  1NMD A;  4RW7 A;  3KLH A;  1RT3 A;  2VG7 A;  3L3V A;  4CFA A;  4DQR A;  5KPT A;  1QTM A;  2QWP A;  2VG5 A;  2QK9 A;  3A5L C;  3GDQ A;  4RG8 A;  3ZT0 A;  3QLH A;  5KQ8 A;  4CZM A;  1X9J A;  4NLC A;  4CI6 A;  2YKN A;  3RMD A;  4E3S A;  4J2D A;  3AY9 A;  4CJL A;  3CCM N;  3G0Z A;  5ADX A;  5DM7 L;  4JI5 K;  2O8D B;  1BI4 B;  1VK0 A;  4KKO A;  3RR7 A;  2O4G A;  1T3V A;  3SV3 A;  2P9S A;  4DSK A;  1CLQ A;  3CD6 N;  4BWM A;  1VQN N;  4OPH A;  4Z0U A;  4FW1 A;  1B92 A;  4CEE A;  4WFN L;  4JRP A;  4B9V A;  4JNE A;  4BC4 A;  1YVN A;  3ATV A;  4IJA A;  5AQK A;  1VQ4 N;  3JAM O;  3V4I A;  3CHW A;  1RTH A;  3HOS A;  4YY3 K;  1GOC A;  4GVM A;  2NNW A;  1VQO N;  1OH7 A;  3VGK A;  5AZJ A;  4FPA A;  3CCU N;  3DLG A;  3B8A X;  3TAN A;  4FJ7 A;  2HVI A;  2QEX N;  5KGX A;  1YUW A;  3NH1 A;  4KB0 A;  1DTT A;  3HTV A;  5AZI B;  2D0O A;  1YJN N;  4CEQ A;  2CGJ A;  1NOY A;  1D9F A;  4B08 A;  2HMI A;  2YHX A;  3NGI A;  3DLR A;  2QWO A;  4GNI A;  1IKX A;  1VQ9 N;  1I94 K;  2JWL A;  4A5B A;  2GV9 A;  3OYE A;  1HKG A;  4DS4 A;  1ATN A;  2ZD1 A;  4JKF A;  1VQ6 N;  3SQ0 A;  4JD2 B;  2B5J A;  1N34 K;  3LPU A;  5AQR A;  1C1A A;  4LSN A;  4MO5 A;  3PX4 A;  3SJJ A;  1SZ2 A;  4XH1 A;  4AIL C;  2JGU A;  3MEG A;  5F2R A;  4AM7 A;  4BC5 A;  1QQN A;  4CHP A;  4IG3 A;  4EHU A;  1JKH A;  2VWB A;  3CJ7 A;  1TUY A;  4M3R A;  5C10 A;  4KHU A;  4CFD A;  4KH6 A;  3NDK A;  1C0M A;  1RDU A;  3ZX0 A;  1KRP A;  3SPZ A;  1KCF A;  3C7N A;  2VQE K;  2FBY A;  3R1X A;  3O1W A;  4CBW A;  5BPN A;  4FCY A;  2NRW A;  4CGD A;  1KC8 O;  3PY8 A;  3O9T A;  1HNX K;  5AQT A;  3M8Q A;  3WNF A;  4EHT A;  4M3X A;  3WXM B;  3SBT A;  3P4I A;  4K25 A;  4BVP A;  5LMU K;  2G8W A;  1EWR A;  3O5B A;  4DTU A;  4HHT A;  3W0L A;  2QTD A;  4O8K A;  2NRT A;  4KTW A;  2KKZ A;  4CGI A;  4H03 B;  2P9P B;  4BE0 A;  2R7Y A;  3D2F B;  3F9K A;  1DLO A;  3P38 A;  4CK3 A;  3DM2 A;  3FFK B;  4OVL A;  1U49 A;  1HR0 K;  4J2E A;  4ID1 A;  4Z4I A;  3DLH A;  5HRP A;  2DFF A;  3WEE B;  2HOE A;  4DV4 K;  4FL9 A;  4NXM K;  4CJ3 A;  3NAE A;  2VCP A;  1KLN A;  1NGD A;  2E2N A;  3SQ1 A;  1RDB A;  3AAQ A;  5AJ3 K;  2I7P A;  1VSJ A;  3O4N A;  1RDW X;  3AVF A;  1IJJ A;  3SK3 A;  3HM9 A;  4DSL A;  1BA1 A;  3PV8 A;  2HHQ A;  3TAE A;  3LAM A;  1FK9 A;  1XWL A;  3H3O B;  4XH4 A;  3VPZ A;  3GOI A;  4LH5 A;  4ZTJ A;  4NXN K;  1BL3 A;  3ISN C;  4BRP A;  3IMX A;  4BRF A;  4BRD A;  5KPR A;  2ZQB A;  2EX3 A;  1S5J A;  1NK0 A;  3L8B A;  3IUC A;  5E84 A;  3EYZ A;  4E7J A;  4DU1 A;  4K43 A;  3QFU A;  4DLE A;  1VSI A;  2P9L A;  4W5T A;  3HP6 A;  4B1V A;  2O8B A;  3SLC A;  2YX6 A;  4PA1 A;  3L2R A;  3AVK A;  3MED A;  1Z6R A;  1BCM A;  1N6Q A;  3CJA A;  1LW0 A;  2WTU A;  2QWM A;  4B9S A;  4FJN A;  1VRT A;  1S6P A;  5M1F A;  4BRL A;  1TVR A;  1T7P A;  1TL3 A;  3NMU A;  3M6G A;  1G99 A;  5JIC A;  4MDA A;  3K5M A;  4X62 K;  4H0V B;  4WCE L;  4GKK K;  2E6L A;  3HOT A;  2E88 A;  1YHQ N;  1ZBU A;  4FWS A;  2HB5 A;  4IO9 L;  1TYQ A;  2PBD A;  4LFC K;  3EN9 A;  4JKH A;  1VSH A;  4OGC A;  4DTO A;  3IG1 A;  3QNN A;  2Z1H A;  5CE3 A;  3ZT1 A;  1O1W A;  4E7K A;  3H6E A;  1CXQ A;  4ZHR A;  5HL7 L;  5C2D A;  4NB4 A;  3N4Q A;  3G6E N;  3V6D A;  1JLQ A;  5A2Q O;  4CZG A;  1Q81 O;  4H0X B;  2Q0U A;  3ZSR A;  4QS7 A;  3LWL A;  2P9N A;  3OYA A;  4HUF A;  3DWL A;  2P9U B;  1YF5 L;  3C0B A;  4B1Z A;  2W6K A;  4FJG A;  1ZXO A;  1JLG A;  1GLD G;  2HND A;  2ITG A;  5J2P A;  3A5O C;  1GLC G;  2D0C A;  3VQ5 A;  4BRO A;  3WXK A;  1U04 A;  4FWL A;  4OGE A;  3I33 A;  2HF3 A;  5HRR A;  3MK6 A;  3UE5 A;  3CFR A;  4CHQ A;  3UIQ A;  3VTI A;  5HLF A;  4Z4G A;  4H0T B;  4WF9 L;  2BTF A;  1N5Y A;  3BZK A;  3NHG A;  4DV3 K;  1P8Z A;  1D9D A;  3VA0 A;  3THW B;  1LWF A;  3ULD A;  2O8C A;  3CQ8 A;  4PL7 A;  3O4Q A;  1WOQ A;  5LY3 A;  4B3O A;  4IG0 A;  5J2M A;  3CM5 A;  1T03 A;  2Q36 A;  1EP4 A;  3UKU B;  4ISG A;  4IOA L;  1KVC A;  1S1X A;  2HW3 A;  1HX1 A;  5FRM A;  1ZBS A;  1K73 O;  3C7N B;  4O5B A;  2FBV A;  3WXJ A;  4BG8 A;  2ASP A;  1HNI A;  2PAV A;  1E3M A;  3MDQ A;  3HI0 A;  3L2Q A;  1QZ6 A;  4JI2 K;  5C0Y A;  1WSH A;  4GV9 A;  5GAE P;  5AQW A;  2OA8 A;  1MWK A;  5J1E A;  4M3U A;  3A8Y A;  3O9Q A;  5BR8 K;  1ZC6 A;  5I3U A;  4M3Z A;  2UXD K;  3QIN A;  5AQO A;  3MX5 A;  1SKS A;  3L6Q A;  5JVG L;  4NYN A;  2P9K A;  2A40 A;  4B3R K;  1TV6 A;  2OZM A;  4G9Z A;  2WOM A;  2KW4 A;  4DR6 K;  1RCH A;  4LC9 B;  3D0P A;  3THX A;  3ID8 A;  3L0Q A;  3CCR N;  3HSC A;  5BN9 A;  1X9S A;  1K6Y A;  2YNG A;  1Z26 A;  4RW6 A;  2RE2 A;  3B6P A;  5GIP A;  3QEW A;  1VSE A;  3I8B A;  3S3N A;  4OX9 K;  4CJW A;  4MDB A;  3LZI A;  1YAG A;  1QQO A;  4JKC A;  4KPY A;  1RTI A;  5AQY A;  3F9M A;  3BY5 A;  1HYS A;  3DLE A;  3VQB A;  1ITG A;  2KFN A;  2JWK A;  1KQS M;  5JS1 A;  3QBW A;  3LPT A;  3D7E O;  4FM0 A;  4EIA A;  3T1H K;  4JI3 K;  3AVG A;  5JVH L;  3O3H A;  4E19 A;  2NRR A;  1Q86 O;  3CPW M;  4GY2 B;  4CZI A;  3CG7 A;  1J53 A;  4R5P A;  5I42 A;  3SMS A;  3WNG A;  4YOU A;  2KZZ A;  4W5N A;  1Q7Y O;  5EOY A;  4QS9 A;  3CCS N;  4DR1 K;  3K5L A;  3LP0 A;  4FVU A;  3SV4 A;  3ZSV A;  5IT9 O;  1BUP A;  3J7A P;  3VF6 A;  2DY4 A;  3H1V X;  4BC3 A;  3TI0 A;  2QKK A;  2DFE A;  2A42 A;  3E01 A;  4YOW A;  2XRI A;  3OA9 A;  1W2B M;  2BGG A;  4FJX A;  4DV1 K;  5AQH A;  3NF6 A;  1HPZ A;  2P1J A;  2ZGY A;  5C24 A;  3TR8 A;  5EX5 A;  1ASW A;  3TAP A;  3AGK A;  1NGJ A;  3VER A;  2G8K A;  1S3X A;  3C6H A;  2GX9 A;  2OZS A;  3QEP A;  1NJI O;  4CGJ A;  5C15 A;  2XY6 A;  3IAY A;  2QWR A;  1TYQ B;  1EQY A;  2HBL A;  3DI6 A;  1UA0 A;  1NJX A;  3M8P A;  4N76 A;  3AA4 A;  5M1Q A;  4H4M A;  3L2W A;  4DF4 A;  3J81 O;  3FLC O;  4NCB A;  2F8T A;  1S9E A;  1BDG A;  3SBG A;  2OPR A;  2IVN A;  4W5Q A;  4JI4 K;  5AQV A;  1UOC A;  1WNS A;  3IDH A;  3LDS A;  1SL1 A;  1A5W A;  2G8I A;  4BRC A;  3THY A;  5FDL A;  1C0F A;  4CHY A;  4KH4 A;  2IDO A;  1RBR A;  3G4S N;  4QAG A;  4IEI A;  1FXX A;  1HPM A;  3T7Z A;  4BR7 A;  3BF1 A;  4OKK A;  4FLZ A;  4CHO A;  4ID5 A;  2YI1 A;  5CYQ A;  3VET A;  4DTX A;  4C8O A;  4O55 A;  1ZBL A;  3HO1 A;  1I39 A;  3R9P A;  4KI4 A;  3DMJ A;  1CXU A;  5BN8 A;  4CIG A;  1XMO K;  1T05 A;  1VRU A;  2PYJ A;  4DUZ K;  4LFA K;  4I6M B;  4JI0 K;  5FRO A;  3C65 A;  1TKD A;  1LWC A;  4GMJ B;  1NM1 A;  1VQK N;  4BRA A;  1O13 A;  4O0J A;  2O8C B;  3WXL A;  4E1J A;  1UA1 A;  4CZF A;  3RVC A;  1U48 A;  1FJG K;  1WSG A;  1Z25 A;  2OPS A;  3AVL A;  3U4L A;  1D5A A;  1KFD A;  1HJO A;  4IXC A;  1K9M O;  1RTD A;  2E5L K;  1X9M A;  3J7Y P;  2CH6 A;  3U8X A;  4JS4 A;  2V52 B;  5JMV A;  2UXB K;  4CEZ A;  5E41 A;  3SUN A;  2YNH A;  4JKD A;  4AF1 A;  4CD3 A;  4DR5 K;  3AO3 A;  3FZL A;  5AQI A;  3ZX2 A;  2V7Z A;  4G1Q A;  5KPZ A;  5KRS A;  3DXK B;  5H1S Q;  1N32 K;  4KV8 A;  3S3O A;  3HPO A;  3M1F A;  3A2F A;  3E9P A;  3TAG A;  5BPL A;  4E1M A;  1TK8 A;  1BIZ A;  5HP1 A;  1LAW A;  4X64 K;  1SL0 A;  2VWK A;  3CF5 L;  4FK4 A;  3O8M A;  3ZSY A;  5CZ1 A;  4M41 A;  4ZTF A;  4C8N A;  1N8R O;  1NU0 A;  5GAH P;  4DSJ A;  1L3V A;  4RWT A;  3NCI A;  2E6M A;  3PO5 A;  4BDP A;  1WSF A;  1QSS A;  4A2A A;  2RF2 A;  3MXM A;  3EKS A;  5JLH A;  3PX6 A;  4B3T K;  3AAR A;  3LAL A;  3TSQ A;  4DTS A;  4CES A;  3MN5 A;  4OKE A;  1MA9 B;  4CIF A;  1E4G T;  2KLA A;  2HHH K;  3NFA A;  1L5U A;  2A3Z A;  3RMA A;  2GUP A;  3VEZ A;  2O4I A;  1JJ2 M;  1KAZ A;  4IOC L;  4DS5 A;  4CK1 A;  4JI8 K;  3MWP A;  4DFP A;  3QES A;  3H08 A;  3F73 A;  1SS6 A;  3NVM A;  3IFR A;  5CZ2 A;  2ZE2 A;  3K57 A;  4DTJ A;  2P9I A;  2F7T A;  4DR7 K;  4DR2 K;  5LMN K;  5FPE A;  4FM2 A;  4EFH A;  4YNQ A;  3KTQ A;  3FFI A;  5AQZ A;  4PKI A;  4C8L A;  2OTL N;  4AHR A;  3OYN A;  3KIO A;  1IKV A;  1JXB A;  4ILJ A;  3TAQ A;  1LAV A;  4FJJ A;  1XUP O;  5ADX H;  3OYB A;  3LZJ A;  2Y1J A;  1HLU A;  5DMR A;  3HXM A;  5KI6 A;  1SAZ A;  2NRX A;  4Z4C A;  3WNH A;  2HNZ A;  1HMV A;  2PYL A;  1KVA A;  3IS9 A;  4M45 A;  1YJ9 N;  3SUP A;  5EVZ A;  1NK9 A;  2FC0 A;  3O08 A;  3RWU A;  5BRH A;  1DT9 A;  4CHN A;  1ILY A;  3OYL A;  1QZ5 A;  4E0D A;  3QIO A;  4UQG A;  3M3Z A;  1WN7 A;  2D4W A;  5AQP A;  2WC9 A;  3CER A;  4M42 A;  3NE6 A;  3LP3 A;  4KB1 A;  5HBM A;  1SQK A;  3ZSZ A;  3CCE N;  3VOV A;  3OBY A;  5LL6 Z;  3VEN A;  3HST B;  1X3N A;  5M1P A;  5GAD P;  3NBP A;  1JL2 A;  1NGG A;  3Q7B A;  4DQS A;  2G8U A;  4KRF A;  3QEX A;  2ZF5 O;  1L3T A;  2VYP A;  4IJN A;  2O8E A;  1LCU A;  4XH5 A;  1NGI A;  3CC7 N;  1LW2 A;  4DTR A;  2VG6 A;  4IEE A;  4C1N K;  2HBJ A;  1QSY A;  3ZLJ A;  3SNN A;  3ZT2 A;  3J7Z O;  2FXU A;  4DV0 K;  1KXP A;  4H0P A;  4CZL A;  4BDZ A;  4ISF A;  3SPY A;  3VQ8 A;  4DSI A;  3DLL L;  3O4W A;  1NJY A;  1JLB A;  4BR5 A;  3FR0 A;  4CK2 A;  4DQ8 A;  3I8D A;  3VQ4 A;  2QM1 A;  4DFM A;  2EHG A;  3D2E A;  3V1O A;  4CHZ A;  2DTU A;  3VQP A;  3QIC A;  4DKW A;  4JKG B;  1U2V A;  2BH1 A;  2YCH A;  4HUG A;  2ITM A;  5AQQ A;  4H4O A;  2Q0R A;  1NK5 A;  1BA0 A;  3FZH A;  3SZ2 A;  1Z05 A;  3KLE A;  4A5A A;  5MLC Q;  2QI2 A;  1FKO A;  3ITH A;  4KTZ A;  2UXC K;  2V51 B;  4BVO A;  3L2U A;  1N36 K;  4FXD A;  1RFQ A;  1HQE A;  1J5O A;  1S9G A;  4F2S A;  4FLT A;  2O8F A;  1NKC A;  1VAZ A;  3LP2 A;  1X9W A;  4ELT A;  3B6O A;  4RW4 A;  4CBU A;  5I9E B;  3V1R A;  3EKU A;  1TAQ A;  3IRX A;  4FJM A;  1V4S A;  4CEF A;  3VMF B;  3HVR A;  1ASV A;  2YJF A;  3HK2 A;  1CZA N;  4FWQ A;  5C12 A;  3PSF A;  3LDL A;  1DTQ A;  1TUU A;  4GW6 A;  4IKF A;  3QBX A;  1S72 N;  4KAZ A;  1SV5 A;  2OYQ A;  1JLE A;  3OBW A;  1TKX A;  4GKJ K;  3U9D A;  2KHO A;  2KTQ A;  4KH5 A;  1VSD A;  4PKH A;  1GLE G;  3OY9 A;  4E1N A;  2OPP A;  4X66 K;  1X3M A;  1QQC A;  3ULE A;  1RGI A;  4BGA A;  5AQS A;  1XI1 A;  3WT0 A;  4CJ4 A;  4ISE A;  4CBX A;  4IDK A;  4CGG A;  3KLG A;  4FM1 A;  1WBB A;  4FSV A;  4HVJ A;  1RNH A;  4KRE A;  1P90 A;  3D6R A;  1KD1 O;  3CXC M;  4FYD A;  2OTJ N;  3LAK A;  3VA3 A;  4BR2 A;  2LSN A;  1NJZ A;  1WUA A;  2P51 A;  4DCH A;  1KAY A;  3FZF A;  1GLB G;  5BRF A;  3HZ6 A;  5KRT A;  4X65 K;  3KKS A;  4KO0 A;  4JK7 A;  3VQE A;  3DOL A;  5EY4 A;  2P9S B;  1BIS A;  4FK0 A;  2OAN A;  1HJR A;  3JS6 A;  5GAG P;  4GV6 A;  1KFS A;  4E7L A;  4Z4H A;  2GEM A;  4J2A A;  1S1W A;  3KK2 A;  4JS5 A;  4BG9 A;  1TK5 A;  1B9D A;  1HUX A;  1UWB A;  3TPQ A;  3NH0 A;  4F2R A;  1HNW K;  3MXJ A;  1JCG A;  4NO7 A;  4JHD A;  4WQ4 C;  1W9H A;  2W6L A;  4DFJ A;  1YIJ N;  3F2K A;  3MWT A;  2G8F A;  5AZJ B;  4BY9 C;  1KLM A;  5HOO A;  4FW2 A;  4CZH A;  4WFA L;  3MN6 A;  2W40 A;  3ID6 A;  5LJW A;  1NKB A;  4DU3 A;  4CF0 A;  5ELZ A;  3O9R A;  2HMP A;  4RW9 A;  2BUP A;  1YJW N;  4C23 A;  4DQI A;  4DB3 A;  3BEX A;  1XNQ K;  1ZBI A;  3HM8 A;  1GOA A;  4WQ5 C;  3HT3 A;  4CJQ A;  3OVN A;  4A2B A;  2QXF A;  4F8R A;  4C1N I;  2DPN A;  2IIR A;  1TAU A;  3E1Y A;  4A59 A;  4CCH A;  1KAX A;  1BOT O;  4NCG A;  3AVC A;  2YNI A;  3BP8 A;  1OH6 A;  3M8S A;  3R6M A;  3JYT A;  4J2B A;  4CJV A;  4DHY A;  3EL2 A;  1R0A A;  4A62 A;  1QS4 A;  4FPB A;  1KTQ A;  3V9W A;  1VQ7 N;  4JEP A;  1SL2 A;  4H0Y B;  4PUO A;  1NGA A;  3AA2 A;  1RT6 A;  3L2V A;  4DMN A;  3BDP A;  3RMB A;  1VQ5 N;  1IBK K;  4CFC A;  3BF3 A;  1GOB A;  5DK5 A;  1W7A A;  4OLA A;  5C25 A;  2A1S A;  4Z4F A;  2ZJR L;  1TKT A;  4FO0 A;  4DTM A;  4WFB L;  4NCA A;  4JI7 K;  1NWK A;  4FJ9 A;  1U2V B;  3OS1 A;  4BRQ A;  3EE9 A;  5CYM A;  3HPG A;  3CCJ N;  1J9A A;  3ENO A;  4XIU A;  2GUI A;  2V7Y A;  5KQD A;  5AFU H;  3CJ1 A;  3VEW A;  3TTC A;  1L3S A;  4M3T A;  3K9K A;  3PIP L;  3S3M A;  5E26 A;  4FWR A;  3C94 A;  5M1O A;  3G71 N;  4Q5V A;  3V9X A;  3ZSQ A;  3L3U A;  4NYF A;  4Q0B A;  1GLL O;  4K8X A;  1RBS A;  2GWJ A;  3RSE A;  4U7B A;  4BRG A;  2F9T A;  3KD1 E;  4PY5 A;  3MCP A;  4FZX C;  4DWI A;  1R59 O;  2XO7 A;  4FVM A;  5GIN A;  3AVM A;  4O4G A;  4H0O A;  5FPN A;  1GLJ O;  4CJ5 A;  4B9L A;  2W42 A;  1CZB A;  3HBT A;  1K8K A;  1IBL K;  1D4X A;  1TK0 A;  5J2Q A;  1NBW A;  3DXM A;  1OVQ A;  4O0I A;  3OYK A;  1XMQ K;  1BWF O;  3UKR A;  5AQG A;  4BR9 A;  4K42 A;  3AVJ A;  1J6Z A;  4YFU A;  4A61 A;  1EKE A;  1LV5 A;  2E2P A;  3OHR A;  4CD1 A;  3V81 A;  5FLX O;  5LJV A;  3PX0 A;  3SAF A;  3A5N C;  3VTH A;  2E2Q A;  4DG1 A;  5B8H A;  3THV A;  2X6S A;  1QSL A;  1Y97 A;  2P9L B;  3VEX A;  1RDD A;  1V4T A;  5C2F A;  2O8B B;  3VF2 A;  3LL3 A;  3C95 A;  4N5S A;  2YHW A;  3WQU A;  4IO8 A;  5C42 A;  3VQ9 A;  3O3G A;  1NGB A;  2YKM A;  2HNY A;  4V19 S;  1BI4 A;  1JCF A;  2PZS A;  3OJS A;  3SQ4 A;  3OYJ A;  1ATS A;  3V9Z A;  3V9U A;  4ILG B;  2J4R A;  3VEY A;  4OJR A;  3AGR A;  4AHU A;  3D45 A;  2HHS A;  4AM6 A;  1QVF M;  5AQN A;  4FJI A;  4B9Q A;  5CR4 A;  2WON A;  4BQL A;  2QWL A;  1XHZ A;  2F8S A;  4BRE A;  4Y1D A;  4BWJ A;  3L4I A;  1EWQ A;  4DUY K;  3C6T A;  1Q9Y A;  2HHW A;  4LF7 K;  1HQU A;  5AQJ A;  2AP1 A;  4N56 A;  2UU9 K;  1E4F T;  1EET A;  4HWI A;  4RW8 A;  1NGC A;  3DAW A;  4DLG A;  3AVH A;  2RN2 A;  4QOZ B;  2HHX A;  4L8R B;  1YTU A;  4JHD B;  2GBZ A;  5IWA K;  4UY8 O;  4J8F A;  1REV A;  1RT5 A;  2F9W A;  3UB5 A;  3OYD A;  3I56 N;  3ZET A;  4B9M A;  3LDO A;  2P9N B;  1U45 A;  1XC3 A;  4CJR A;  3K5N A;  3ZCM A;  1T6D A;  3CQY A;  4PWD A;  1IO2 A;  2FSJ A;  1L3U A;  1TL1 A;  4LY7 A;  4CJT A;  1C0T A;  4EZ6 A;  1HYV A;  3JXU A;  1BIU A;  3HRG A;  2A6A A;  3KVG A;  2ETJ A;  1MU2 A;  3M8R A;  2G8V A;  1I3A A;  5BPM A;  1YIT N;  2A5X A;  3KJV A;  3J80 O;  2E1Y A;  4LF8 K;  1T6C A;  1QE1 A;  5EXW A;  4W5R A;  3KWI A;  2A41 A;  5KGW A;  1BQN A;  2E8A A;  4O44 A;  4OPA A;  3NGZ A;  1K8A O;  1WB9 A;  3WQT A;  4AHV A;  2CGL A;  3TWH A;  2VWJ A;  3SAH A;  3AO5 A;  4FLY A;  2HVH A;  3DRR A;  5T7B A;  3RRG A;  3CJB A;  3VQ6 A;  4PKG A;  4HCB A;  3VGM A;  3U3G A;  1S1T A;  2JLE A;  5FPD A;  1BG3 A;  4QS8 A;  1SKW A;  2FF6 A;  1BCO A;  2P9P A;  3D2F A;  5JS2 A;  3K9J A;  1NOZ A;  5DM6 L;  2Y1I A;  5JLF A;  1VQ8 N;  4I7F A;  3O3F A;  3OYM A;  4KFB A;  4EP5 A;  1HNV A;  3WEE A;  2RPI A;  1F21 A;  2P9K B;  2QWQ A;  4AQY K;  3TAB A;  1M1K O;  3QDK A;  4CJU A;  4DSE A;  3CCV N;  4CEB A;  3THX B;  1H1V A;  3HP9 A;  3KLF A;  2Z1I A;  4RTF D;  1BO5 O;  2PFU A;  4ILH A;  4IZ9 A;  3P83 D;  4DQP A;  3CM6 A;  5J2N A;  4Y0W A;  4B9N A;  1IV0 A;  4TSX A;  3H1Q A;  3NH2 A;  3EEQ A;  4FOI A;  1EX4 A;  1YXQ A;  4BC2 A;  1OKJ A;  4BR0 A;  4H5V A;  1X1P A;  1JLA A;  4K41 A;  3OYI A;  1LWE A;  5BRE A;  4F4K A;  3LM9 A;  1ATR A;  3V9S A;  4IBN A;  1MWM A;  1N33 K;  5TKW A;  2IOC A;  1Q18 A;  3HL8 A;  1C0G A;  2AA4 A;  4YOX A;  2DFH A;  2GWK A;  3AO2 A;  1JL1 A;  4FJL A;  3VQD A;  4BQZ A;  5AQL A;  3CME N;  3PSI A;  4OLB A;  3HVT A;  1VSF A;  1FW6 A;  2VGM A;  1M90 O;  3CC4 N;  1JLF A;  2NRV A;  1VSL A;  1VSK A;  1OH5 A;  5HRS A;  2UUB K;  4CIE A;  4CEC A;  1RDA A;  3TSP A;  3RMC A;  3GL1 A;  2YHA A;  2WUS A;  4JI1 K;  4K0K K;  1B9F A;  1OVY A;  2Q31 A;  2NLX A;  1VQM N;  2NRZ A;  4CZJ A;  4U67 L;  3ZYY X;  2ZWH A;  3P5J A;  2KZM A;  4AHT A;  4JV5 K;  4OO1 J;  2D1K A;  3T1A A;  1RT7 A;  2QW9 A;  3RTV A;  2I5J A;  2FBT A;  4Z4E A;  3LAN A;  4LFB K;  2CGK A;  4AHC A;  3FGU A;  2Q1N A;  4BE1 A;  4DV7 K;  3MN9 A;  4BGB A;  3KD5 E;  1U6Z A;  3ZX3 A;  3F5T A;  3U6F A;  4KHY A;  3CCQ N;  2X78 A;  3VQC A;  1NK6 A;  4MQ3 A;  3AVB A;  4B1Y B;  3MEC A;  3K0S A;  3KWG A;  3K5O A;  2Q97 A;  2ASM A;  3AVA A;  4FJ8 A;  1T8E A;  5D3G A;  1JLC A;  4DR3 K;  2P9U A;  4MO4 A;  1WAJ A;  1NK7 A;  3GG4 A;  2IGI A;  2VGN A;  3OJU A;  1UAX A;  3DRP A;  1S1V A;  3THY B;  3ZET B;  3QNO A;  3VQQ A;  2ASO A;  4BE2 A;  3E9O A;  4CZE A;  3SQ2 A;  3KZB A;  4FWN A;  4LD0 A;  4LH4 A;  4I9Q A;  4CJF A;  1Y64 A;  3QML A;  5BRD A;  1NJW A;  1C1B A;  1VHX A;  3THW A;  5F0X A;  3AV9 A;  3T19 A;  4O5F A;  1J5E K;  4JKB A;  3KK7 A;  3E9L A;  3MEE A;  5FPM A;  2QXL A;  3TU5 A;  1C0U A;  1NNE A;  3KK3 A;  1RTJ A;  2FLO A;  2Q3S A;  3UKU A;  4HTU A;  5AR0 A;  1EO1 A;  2YHB A;  3CC2 N;  2OPQ A;  5F1X A;  2BDP A;  2NRH A;  4HTL A;  2ZM6 K;  2D0B A;  2HHT A;  4HCC A;  1NGF A;  3MN7 A;  1DKG D;  1NMN A;  4IWV A;  3PLA A;  4L3Q A;  4WYB A;  1YI2 N;  4PHT X;  2FSN A;  3OW2 M;  3MAQ A;  4BR4 A;  4DTP A;  4CJE A;  4PQU A;  4Y1C A;  3H45 C;  1DEJ A;  4Z94 A;  4YOT A;  1HNZ K;  4WE1 A;  4KHN A;  2ZJQ L;  3H46 O;  3QFP A;  4B3M K;  2HBM A;  4B1W B;  3T3F A;  1IKY A;  3ZT3 A;  3OYF A;  4I2Q A;  4CFB A;  1XC9 A;  3BGR A;  4JK9 A;  4DU4 A;  4CVN E;  1WSI A;  1WBD A;  1A5X A;  4CZK A;  4LSL A;  3SCX A;  3Q7C A;  2XHB A;  3VN5 A;  4IFV A;  3ZSO A;  4A57 A;  3CPE A;  1QVG M;  4LF4 K;  1ZYQ A;  4LF6 K;  4K8Z A;  2QWN A;  4H5W A;  3JSM A;  3H3N O;  2P5G A;  1RBT A;  1EXQ A;  5EU7 A;  3NVK A;  3LP1 A;  4E7H A;  4M3Y A;  2HHV A;  4I2P A;  4DSF A;  4GVE A;  3I0R A;  3AO4 A;  2HHU A;  4YDU A;  2X74 A;  3KK1 A;  4CGH A;  1XQS C;  4CF1 A;  4JYA K;  3J8A A;  5AQF A;  3RR8 A;  3C6A A;  1IBM K;  1HYZ A;  5M1K A;  2XY8 A;  4B3S K;  3O9S A;  3MXI A;  3EZW A;  4YDU C;  4YOR A;  3S41 A;  4E7I A;  2P9I B;  1JCE A;  2H3G X;  1XNR K;  1RT2 A;  2UUC K;  3OS2 A;  4JRQ A;  1ZBF A;  4WQ4 A;  4H5T A;  1DGK N;  4EAH D;  3S9H A;  4DV6 K;  1BGX T;  4DF8 A;  2B4J A;  1RBU A;  4H5R A;  2IC3 A;  3TAM A;  2YJE A;  4ELU A;  3ZEU A;  1RT4 A;  1WSJ A;  3SUQ A;  4JKA A;  4CF9 A;  1IKW A;  4KI6 A;  3VF4 A;  4KBO A;  2B6A A;  3IKM A;  4WQ5 A;  5M1N A;  2GEL A;  2IAJ A;  3A0I X;  3DOK A;  2D5R A;  5TKY A;  2E1Z A;  4BRI A;  3DRS A;  3OYC A;  3NF8 A;  1NK4 A;  3O9U A;  3DYA A;  3E66 A;  3U3Y A;  4FWO A;  3DLB A;  3VES A;  3KLI A;  4DTN A;  2NUB A;  4O8U A;  3WUH A;  2FSK A;  3V1Q A;  4PL8 A;  1S1U A;  3U9Z A;  3CQX A;  4C8M A;  3QIP A;  4YOY A;  3QO9 A;  1YTA A;  2KFZ A;  3TTF A;  2NZT A;  3FZK A;  1U47 A;  2Q2R A;  3G10 A;  2IS3 A;  1T44 A;  1BHL A;  4M7Y A;  4FLW A;  4N47 A;  3CIP A;  3ASM A;  5SWM A;  1ASU A;  2D0P A;  4I9L A;  4B1X B;  3NF7 A;  2P5O A;  1NKE A;  2O8E B;  3P39 A;  3SYZ A;  4I6M A;  3LDP A;  2ZJP L;  1RIL A;  3NGY A;  1C6V A; 
#chains in the Genus database with same CATH homology
 1S6Q A;  3AVH A;  2O4I A;  2RN2 A;  4CJ3 A;  4QOZ B;  4DS5 A;  2HHX A;  4CK1 A;  3NAE A;  4L8R B;  1YTU A;  4DFP A;  3KKR A;  2GBZ A;  3QES A;  3H08 A;  3F73 A;  1KLN A;  1REV A;  4N41 A;  5CZ2 A;  1RT5 A;  2ZE2 A;  3K57 A;  4DTJ A;  3SQ1 A;  1RDB A;  3OYD A;  3EZ5 A;  1VSJ A;  4B9M A;  3O4N A;  4FJK A;  4FM2 A;  4CJS A;  4YNQ A;  3P1G A;  1U45 A;  3KTQ A;  3FFI A;  3AVF A;  3ZT4 A;  4CJR A;  3K5N A;  4BAC A;  3HM9 A;  4DSL A;  4CEO A;  3PV8 A;  4C8L A;  1TKZ A;  3ZCM A;  4AHR A;  3OYN A;  4PWD A;  2HHQ A;  3KIO A;  2G8H A;  1IKV A;  3TAE A;  3LAM A;  1FK9 A;  1IO2 A;  1XWL A;  1JXB A;  1G15 A;  1L3U A;  4LH5 A;  3TAQ A;  4ZTJ A;  1TL1 A;  1BL3 A;  3ISN C;  1LAV A;  4LY7 A;  4FJJ A;  4CJT A;  1C0T A;  4EZ6 A;  3OYB A;  3LZJ A;  2Y1J A;  1U4B A;  5DMR A;  2XY7 A;  3HXM A;  1HYV A;  2ZQB A;  5KI6 A;  4KHQ A;  2X6N A;  2EX3 A;  1S5J A;  1BIU A;  3L8B A;  1NK0 A;  4Z4C A;  3WNH A;  3EYZ A;  2HNZ A;  1HMV A;  4E7J A;  4DU1 A;  2PYL A;  1KVA A;  3IS9 A;  4M45 A;  2ETJ A;  4BDY A;  4DLE A;  1VSI A;  4W5T A;  3HP6 A;  1TGO A;  3QEV A;  1MU2 A;  3SUP A;  1NK9 A;  4CE9 A;  3M8R A;  2G8V A;  2FC0 A;  1I3A A;  3RWU A;  4CHN A;  4FLX A;  3KJV A;  1RBV A;  4PA1 A;  3OYL A;  3L2R A;  3AVK A;  4E0D A;  3MED A;  3QIO A;  1BCM A;  4UQG A;  1N6Q A;  1LW0 A;  1WN7 A;  2BE2 A;  3I0S A;  1QE1 A;  5KTQ A;  4W5R A;  1VSM A;  1SUQ A;  1W0H A;  5KGW A;  1BQN A;  2RKI A;  4O44 A;  3NGZ A;  3LP3 A;  4IFY A;  5HBM A;  3NE6 A;  3ZSZ A;  4B9S A;  4KB1 A;  4M42 A;  4FJN A;  1VRT A;  4AHV A;  1FKP A;  1S6P A;  3NF9 A;  3OYG A;  2VWJ A;  3K2P A;  3TWH A;  3PO4 A;  1TVR A;  1T7P A;  2KQ2 A;  1TL3 A;  3HST B;  3AO5 A;  4EP4 A;  4FLY A;  2HVH A;  3DRR A;  4EZ9 A;  5T7B A;  5K14 A;  4CEA A;  3K5M A;  3RRG A;  3NBP A;  3VQ6 A;  1JL2 A;  4HCB A;  1WLJ A;  3AA5 X;  1S1T A;  3U3G A;  2JLE A;  4DQS A;  2G8U A;  4KRF A;  3QEX A;  4W5O A;  1SKW A;  1L3T A;  1BCO A;  2E6L A;  1ZBU A;  2HB5 A;  5JS2 A;  1NOZ A;  1Q9X A;  2Y1I A;  4I7F A;  3AVN A;  3O3F A;  5CY4 A;  3OYM A;  1LW2 A;  4DTR A;  4KFB A;  2VG6 A;  2YV0 X;  4EP5 A;  1VSH A;  1QSY A;  4OGC A;  4DTO A;  1HNV A;  3IG1 A;  3ZT2 A;  3SNN A;  3QNN A;  2RPI A;  1F21 A;  2Z1G A;  2BAN A;  2Z1H A;  3ZT1 A;  3TAB A;  1O1W A;  4E7K A;  1CXQ A;  4ZHR A;  2AJQ A;  4BDZ A;  3SPY A;  1D8Y A;  3VQ8 A;  4DSI A;  4CJU A;  1NJY A;  1JLB A;  3V6D A;  1JLQ A;  2Z1J A;  4CK2 A;  3I8D A;  4DSE A;  3VQ4 A;  4CEB A;  4QCL A;  4DFM A;  2EHG A;  3V1O A;  4CHZ A;  2DTU A;  3HP9 A;  3ZSR A;  4CJP A;  3KLF A;  3VQP A;  2Z1I A;  3LWL A;  3OYA A;  4HUF A;  1HRH A;  3P83 D;  4HUG A;  1Q8I A;  4DQP A;  3CM6 A;  5J2N A;  4B9N A;  4FJG A;  4TSX A;  4H4O A;  1JLG A;  3NH2 A;  2HND A;  1NK5 A;  1EX4 A;  4FJH A;  3SZ2 A;  2ITG A;  3TAR A;  3KLE A;  5J2P A;  2D0C A;  3VQ5 A;  1X1P A;  1JLA A;  1FKO A;  3OYI A;  1LWE A;  3ITH A;  1U04 A;  4OGE A;  4KTZ A;  3QEI A;  4F4K A;  4FXD A;  3L2U A;  3QER A;  1HQE A;  5HRR A;  1J5O A;  3V9S A;  1C1C A;  1S9G A;  4F2S A;  3CFR A;  4CHQ A;  4IBN A;  3UIQ A;  4KHW A;  5HLF A;  4FLT A;  4Z4G A;  3WNE A;  1QHT A;  1NKC A;  1N5Y A;  2IOC A;  3HL8 A;  3NHG A;  3LP2 A;  2DFH A;  1D9D A;  3AO2 A;  3VA0 A;  1JL1 A;  1X9W A;  4ELT A;  4HUE A;  1LWF A;  4FJL A;  3ULD A;  4OKJ A;  2D0A A;  3VQD A;  3VQA A;  3CQ8 A;  1WSE A;  3B6O A;  4FJ5 A;  4RW4 A;  4OLB A;  3HVT A;  3V1R A;  1VSF A;  1TAQ A;  3IRX A;  3O4Q A;  4FJM A;  1SKR A;  4FZZ A;  4CEF A;  4B3O A;  4IG0 A;  5J2M A;  3CM5 A;  3HJF A;  3HVR A;  4DFK A;  1T03 A;  1ASV A;  1JLF A;  4MFB A;  4M3W A;  1EP4 A;  3HK2 A;  3CFP A;  1VSL A;  1VSK A;  3DLK A;  1KVC A;  2E4L A;  1S1X A;  2HW3 A;  4GW6 A;  1DTQ A;  5FRM A;  2QKB A;  3ZSW A;  4IKF A;  4O5B A;  2FBV A;  4KAZ A;  5HRS A;  1HNI A;  4CIE A;  4CEC A;  1RDA A;  3RMC A;  1SV5 A;  4FK2 A;  2OYQ A;  1ZBH A;  1JLE A;  3L2Q A;  1TKX A;  1RT1 A;  1WSH A;  2YHA A;  2KTQ A;  1WAF A;  4ICL A;  1J54 A;  1VSD A;  2F96 A;  1B9F A;  3OY9 A;  4E1N A;  2OA8 A;  2OPP A;  4B9U A;  5J1E A;  4M3U A;  1QQC A;  3P5J A;  2KZM A;  3VQ7 A;  4AHT A;  5I3U A;  1XI1 A;  4M3Z A;  3T1A A;  1RT7 A;  3QIN A;  3RTV A;  2I5J A;  4CJ4 A;  1IG9 A;  2FBT A;  4Z4E A;  3LAN A;  3K59 A;  1SKS A;  5FRN A;  4IDK A;  4CGG A;  3KLG A;  4NYN A;  2ATQ A;  4AHC A;  4FM1 A;  1TV6 A;  4BE1 A;  2OZM A;  4B8C A;  3KD5 E;  4FLU A;  2WOM A;  4HVJ A;  3U6F A;  1RNH A;  4B9T A;  4KHY A;  3HYF A;  4KRE A;  4FYD A;  2KW4 A;  2X78 A;  3VQC A;  1NK6 A;  1RCH A;  3LAK A;  5HRN A;  4MQ3 A;  3D0P A;  3AVB A;  3VA3 A;  3MEC A;  2LSN A;  3K58 A;  1NJZ A;  2P51 A;  3K5O A;  3AVA A;  4FJ8 A;  1T8E A;  3PUF A;  1X9S A;  5KRT A;  1K6Y A;  3SI6 A;  1JLC A;  5HRO A;  1KSP A;  4FZY A;  3KKS A;  5D3G A;  4KHS A;  1WAJ A;  1NK7 A;  4KO0 A;  2PY5 A;  2IGI A;  2YNG A;  3OJU A;  1Z26 A;  1RDC A;  1YVU A;  4RW6 A;  1UAX A;  3B6P A;  4CJK A;  1NK8 A;  3VQE A;  1VSE A;  3DOL A;  3DRP A;  3QEW A;  4F3O A;  4F3T A;  4OPJ A;  4CGF A;  3S3N A;  3AO1 A;  1S1V A;  4CJW A;  4OPK A;  3EY1 A;  2A1R A;  3TAF A;  3LZI A;  1BIS A;  4FK0 A;  1HJR A;  3QNO A;  3VQQ A;  4BE2 A;  4C8K A;  1A5V A;  1RTI A;  4E89 A;  3LWM A;  4KPY A;  1KFS A;  3QET A;  4E7L A;  1HYS A;  3DLE A;  4Z4H A;  3SQ2 A;  1XHX A;  1ITG A;  3VQB A;  4J2A A;  1S1W A;  3AA3 A;  3KK2 A;  4LD0 A;  4H8K A;  4JS5 A;  1TK5 A;  2KFN A;  1B9D A;  1UWB A;  2YNF A;  4LH4 A;  3NH0 A;  3OYH A;  4F2R A;  4I9Q A;  3LPT A;  4CJF A;  5JS1 A;  4FM0 A;  3MXJ A;  4DQQ A;  4KTQ A;  1NJW A;  1C1B A;  3AV9 A;  3AVG A;  4B8A B;  3OS0 A;  1W9H A;  3T19 A;  4DFJ A;  4AH9 A;  3O3H A;  2G8F A;  1KLM A;  1CZ9 A;  4CF8 A;  4FW2 A;  4CED A;  4E19 A;  4FLV A;  2XY5 A;  1NKB A;  4R5P A;  3CG7 A;  1J53 A;  4CF0 A;  4DU3 A;  5I42 A;  3MEE A;  3C6U A;  3WNG A;  1C0U A;  4RW9 A;  3KK3 A;  1IH7 A;  1RTJ A;  2KZZ A;  2Q3S A;  4W5N A;  4HTU A;  4DQI A;  3ALY A;  1ZBI A;  5SZT A;  3AVI A;  2YHB A;  3HPH A;  1GOA A;  2OPQ A;  3HT3 A;  3CYM A;  3LP0 A;  4CJQ A;  3ZSV A;  3OVN A;  3K5L A;  2QXF A;  3SV4 A;  3RRH A;  2BDP A;  4F8R A;  4ELV A;  2DY4 A;  1BQM A;  1YT3 A;  1TAU A;  3TI0 A;  2QKK A;  4CCH A;  2DFE A;  4JLH A;  2D0B A;  4AHS A;  2FBX A;  4NCG A;  4CF2 A;  3AVC A;  3E01 A;  2HHT A;  2XRI A;  4CER A;  4HCC A;  2YNI A;  2BGG A;  4FJX A;  3NF6 A;  1HPZ A;  2P1J A;  1KVB A;  3M8S A;  3CFO A;  5C24 A;  3TR8 A;  3JYT A;  3SUO A;  4J2B A;  1JXE A;  3ZSX A;  4CJV A;  1ASW A;  1R0A A;  3MAQ A;  4RW7 A;  3KLH A;  1RT3 A;  4DTP A;  2VG7 A;  3TAP A;  3L3V A;  1QS4 A;  4CFA A;  4DQR A;  2G8K A;  4CJE A;  1QTM A;  3QEP A;  1KTQ A;  4Y1C A;  2OZS A;  2VG5 A;  3V9W A;  2QK9 A;  4PQU A;  4CGJ A;  2XY6 A;  3IAY A;  4WE1 A;  4KHN A;  1SL2 A;  4RG8 A;  3ZT0 A;  3DI6 A;  1UA0 A;  1NJX A;  3M8P A;  4N76 A;  4PUO A;  3AA4 A;  3AA2 A;  3QLH A;  1RT6 A;  3L2V A;  4DMN A;  3BDP A;  2YKN A;  3T3F A;  1IKY A;  4H4M A;  3L2W A;  4DF4 A;  3RMD A;  3ZT3 A;  3OYF A;  4E3S A;  4I2Q A;  4CFB A;  4CJL A;  1XC9 A;  4J2D A;  3BGR A;  3G0Z A;  3RMB A;  2F8T A;  4NCB A;  4DU4 A;  1S9E A;  1WSI A;  4CFC A;  2OPR A;  4W5Q A;  5DK5 A;  1A5X A;  1GOB A;  1BI4 B;  4OLA A;  1VK0 A;  4LSL A;  5C25 A;  3SCX A;  4KKO A;  2A1S A;  4Z4F A;  3RR7 A;  2O4G A;  1UOC A;  1WNS A;  1TKT A;  3SV3 A;  4DTM A;  2XHB A;  3LDS A;  1A5W A;  1SL1 A;  4DSK A;  3VN5 A;  4NCA A;  2G8I A;  4IFV A;  4BWM A;  3ZSO A;  1CLQ A;  5FDL A;  4Z0U A;  4CHY A;  4FW1 A;  4FJ9 A;  1B92 A;  1RBR A;  2IDO A;  3OS1 A;  1ZYQ A;  4QAG A;  4CEE A;  1FXX A;  5CYM A;  4JRP A;  4K8Z A;  4FLZ A;  4B9V A;  4OKK A;  3JSM A;  4CHO A;  2P5G A;  4ID5 A;  3HPG A;  1RBT A;  1EXQ A;  5CYQ A;  5EU7 A;  1J9A A;  3V4I A;  4DTX A;  3LP1 A;  4C8O A;  4O55 A;  1RTH A;  1ZBL A;  3HO1 A;  4XIU A;  4E7H A;  4M3Y A;  1I39 A;  2GUI A;  4I2P A;  4DSF A;  2HHV A;  4KI4 A;  1L3S A;  1GOC A;  3DMJ A;  3I0R A;  4GVM A;  1CXU A;  3AO4 A;  4CIG A;  4M3T A;  2HHU A;  2X74 A;  1T05 A;  1VRU A;  2PYJ A;  3KK1 A;  4CGH A;  3S3M A;  5FRO A;  4CF1 A;  3C94 A;  4Q5V A;  3V9X A;  3DLG A;  3ZSQ A;  1LWC A;  3L3U A;  3TAN A;  1TKD A;  4NYF A;  4Q0B A;  4FJ7 A;  3RR8 A;  4GMJ B;  4O0J A;  4K8X A;  1HYZ A;  1RBS A;  2HVI A;  5KGX A;  2XY8 A;  3NH1 A;  3MXI A;  1UA1 A;  4KB0 A;  1DTT A;  3KD1 E;  4FZX C;  4PY5 A;  1U48 A;  4DWI A;  4E7I A;  2XO7 A;  4FVM A;  3AVM A;  4O4G A;  1D9F A;  4CEQ A;  1NOY A;  4B08 A;  2HMI A;  1WSG A;  1Z25 A;  4CJ5 A;  2OPS A;  3AVL A;  3NGI A;  3DLR A;  4B9L A;  2W42 A;  1RT2 A;  1CZB A;  1IKX A;  3OS2 A;  4JRQ A;  1ZBF A;  5J2Q A;  1D5A A;  1TK0 A;  1KFD A;  4O0I A;  1RTD A;  3OYK A;  2GV9 A;  3OYE A;  4DS4 A;  2ZD1 A;  3S9H A;  3SQ0 A;  1BGX T;  4DF8 A;  2B4J A;  1X9M A;  1RBU A;  2B5J A;  3AVJ A;  4YFU A;  2IC3 A;  3LPU A;  1EKE A;  3TAM A;  1C1A A;  4LSN A;  1LV5 A;  4ELU A;  3V81 A;  3PX4 A;  3SJJ A;  1RT4 A;  4JS4 A;  1WSJ A;  3SUQ A;  4AIL C;  2JGU A;  3MEG A;  4CEZ A;  4CHP A;  1IKW A;  4CF9 A;  5E41 A;  4KI6 A;  3SUN A;  2YNH A;  2B6A A;  4IG3 A;  3PX0 A;  1JKH A;  3AO3 A;  4DG1 A;  4G1Q A;  2IAJ A;  2X6S A;  4M3R A;  3THV A;  1QSL A;  1Y97 A;  2D5R A;  3DOK A;  1RDD A;  4CFD A;  4KHU A;  5KRS A;  3NDK A;  1C0M A;  4KV8 A;  3DRS A;  3OYC A;  3S3O A;  3HPO A;  3NF8 A;  1NK4 A;  1KRP A;  3A2F A;  3C95 A;  3DYA A;  4N5S A;  3SPZ A;  1KCF A;  3TAG A;  3U3Y A;  5C42 A;  4E1M A;  2FBY A;  3DLB A;  3VQ9 A;  1BIZ A;  3O3G A;  3KLI A;  4DTN A;  5HP1 A;  2NUB A;  1LAW A;  2YKM A;  1TK8 A;  1SL0 A;  2VWK A;  2HNY A;  1BI4 A;  3V1Q A;  4FK4 A;  4FCY A;  1S1U A;  2PZS A;  3ZSY A;  4CGD A;  5CZ1 A;  4M41 A;  4ZTF A;  3OJS A;  4C8N A;  3SQ4 A;  3OYJ A;  4C8M A;  3PY8 A;  3QIP A;  4DSJ A;  3V9Z A;  3QO9 A;  1YTA A;  3V9U A;  3M8Q A;  3WNF A;  1L3V A;  2KFZ A;  3NCI A;  4OJR A;  2E6M A;  3PO5 A;  4BDP A;  4M3X A;  4AHU A;  1WSF A;  3D45 A;  1QSS A;  2HHS A;  1U47 A;  2RF2 A;  3MXM A;  3G10 A;  2IS3 A;  2G8W A;  4FJI A;  1BHL A;  4FLW A;  2WON A;  4N47 A;  3ASM A;  5SWM A;  4DTU A;  3PX6 A;  1XHZ A;  4HHT A;  3LAL A;  2F8S A;  1ASU A;  4DTS A;  4CES A;  4Y1D A;  4KTW A;  4OKE A;  4I9L A;  4BWJ A;  4CGI A;  3C6T A;  4CIF A;  3NF7 A;  4BE0 A;  2R7Y A;  1Q9Y A;  3F9K A;  1NKE A;  1DLO A;  3NFA A;  4CK3 A;  2P5O A;  1HQU A;  3DM2 A;  4N56 A;  2HHW A;  3SYZ A;  4OVL A;  1U49 A;  4J2E A;  4ID1 A;  4Z4I A;  1EET A;  1L5U A;  3DLH A;  4RW8 A;  1RIL A;  3NGY A;  5HRP A;  2DFF A;  3RMA A;  4DLG A;  1C6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...