1ZBIA

Bacillus halodurans rnase h catalytic domain mutant d132n in complex with 12-mer rna/dna hybrid
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna/dna
molecule keywords 5'-R(*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*C)-3'
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
total genus 40
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbiA00
3ULDA 2FBTA 4PA1A 3TAFA 1KLMA 4HCBA 1KCFA 3THVA 1S5JA 2YNIA 4W5NA 3QEIA 3G10A 4CJSA 4QAGA 3V1RA 4Q0BA 2IGIA 3VQ4A 2HNZA 3L2VA 3T1AA 4KAZA 4CJLA 1JLGA 3AVMA 3MXJA 4B9TA 3F9KA 3SQ0A 2KTQA 4ZTFA 4I2PA 1GOBA 3WNGA 3HYFA 3KIOA 3ZT3A 1ASWA 5C42A 1NKBA 2KZMA 1JLEA 1XWLA 4PY5A 3NH2A 1GOCA 2XY8A 2OPPA 3NFAA 4OKKA 4DSEA 3V6DA 4N56A 1L3SA 2BDPA 4DS4A 3AO2A 4CGIA 3DOLA 3OJUA 3OS0A 4W5RA 3JSMA 1BGXT 3O3GA 3DLHA 2WOMA 3AA2A 1NJZA 2A1RA 3K5NA 4FJIA 2KFZA 4Q5VA 1NK9A 1KVBA 1RBSA 4M41A 4Z4HA 4ELUA 1SL2A 4DWIA 3RMAA 3OYDA 5KGWA 3PY8A 3L2RA 3DYAA 3LPTA 3SUNA 1J9AA 4YFUA 4DTPA 3TARA 4B9NA 4CJ4A 1S1TA 3SQ1A 2HB5A 3QNOA 1L3UA 4HTUA 3SQ2A 1NKEA 4DQIA 1A5VA 4EP5A 2Q3SA 3NF7A 5J2QA 3FFIA 1ZBLA 2HHVA 5E41A 4FLWA 4E0DA 3LP1A 4DF4A 1UA0A 3IAYA 3M8QA 2HHSA 4FCYA 3L2QA 1TGOA 4FLYA 4KI4A 1IH7A 4RW7A 4CESA 5SWMA 4ELTA 2QK9A 1IKVA 3AO1A 4OGCA 2YKNA 4CJVA 1HMVA 3LZJA 4O0JA 4RW6A 5CY4A 4FK4A 3VQQA 3HP9A 1U48A 3U3YA 4KHUA 4CJPA 3U6FA 4CFBA 4GW6A 3LWLA 4M3ZA 4KFBA 2KFNA 4ID1A 3AO4A 1RCHA 2Z1IA 4Z4CA 1WAFA 1JL1A 1R0AA 2D5RA 2ZD1A 1FKOA 2OPQA 4BWMA 3NGZA 3K59A 3VQBA 4JS5A 4XIUA 3I8DA 4DFMA 2E4LA 3PO4A 4F8RA 1RNHA 2YHBA 2D0BA 1BI4A 3CG7A 3L3VA 4LY7A 4DG1A 1XC9A 1NK0A 1VRTA 3E01A 5DK5A 4LH4A 3WNEA 3QLHA 3ZSXA 3NH0A 2G8WA 1TAUA 3KLFA 3HK2A 3QINA 4CF1A 4OKEA 5KGXA 5J2NA 1SL1A 3DOKA 2HHXA 2IDOA 3TR8A 3QETA 4C8MA 2IAJA 3PO5A 3B6PA 3H08A 3OYKA 1KFSA 4CJTA 3HM9A 3QIPA 4FJ8A 4CJRA 3T3FA 5DMRA 1BCOA 2PY5A 4FM1A 1RT5A 3D0PA 1FK9A 4ZHRA 1LV5A 1RT2A 2KZZA 1RTDA 1S1WA 1RT6A 4AH9A 1RTIA 2FC0A 1TV6A 3AVCA 2VG6A 5HRPA 1NK6A 1A5WA 2HW3A 1CZBA 1VSEA 4J2EA 5FROA 5CYMA 3HVTA 1RBRA 5J1EA 1VSHA 1WLJA 4JRQA 3UIQA 1C0TA 4RW9A 2Z1JA 2FBXA 2VWJA 3QEVA 4CGHA 3DRRA 4PUOA 4R5PA 3S3MA 3SV3A 4IG0A 4W5QA 1HJRA 2F8TA 3NGIA 4KKOA 4QCLA 2OPSA 4DFJA 3PV8A 3ZT0A 3AVIA 3HSTB 3VQEA 1JLQA 3AVBA 1IKWA 2QKBA 3C95A 1QSLA 1UOCA 4CJFA 4PWDA 1B9FA 4F3OA 5J2PA 3EYZA 3KK1A 3VQ9A 5C25A 2XY6A 4IKFA 4KHNA 4UQGA 2HVHA 3WNFA 3V9WA 1G15A 2KQ2A 4L8RB 3VQPA 4G1QA 3VA3A 3SZ2A 1IG9A 3RR8A 1QSYA 1WSGA 2O4IA 4CJQA 4BE1A 4CEZA 5HP1A 3O3FA 3TAQA 3K58A 4DQPA 3IG1A 5HRSA 3V1QA 4Z0UA 4FJ5A 4AHCA 1TVRA 3AVKA 3VQ7A 3ZSOA 3QNNA 3LP2A 2RKIA 4K8XA 4BE0A 3JYTA 3HPGA 2ETJA 4BWJA 1HYVA 4BDZA 3QESA 1K6YA 2EHGA 3CM5A 4BACA 3RMCA 3AO5A 3G0ZA 3VQDA 1NOYA 4ID5A 4E19A 4DU4A 4HCCA 3RTVA 5JS1A 4CIEA 2OA8A 1XHZA 1RTJA 3LP0A 3AVJA 1CXUA 5HBMA 3OY9A 4DF8A 3LALA 4O5BA 3M8SA 3CM6A 3PX6A 1LW0A 3WNHA 4RW8A 1HNIA 3O4NA 3RMBA 3NF9A 4FJHA 1LAWA 1T05A 3OVNA 1CXQA 1Y97A 2B4JA 2XY5A 2ITGA 5D3GA 2GBZA 3L3UA 3PUFA 5KRTA 3QIOA 3L8BA 1VSIA 3MXMA 1QQCA 4OVLA 3HL8A 3P83D 3S9HA 3KLEA 3K5OA 3MAQA 2E6MA 4CERA 4FYDA 4CHPA 1HRHA 4OLBA 4PQUA 4OLAA 4DQSA 1UA1A 3AA5X 2HMIA 4E7JA 4I2QA 1BQMA 1YT3A 4J2DA 4LH5A 2P51A 1LWCA 5C24A 1JL2A 4KB1A 1QHTA 3LP3A 2VG7A 3HPOA 1RBTA 4KHQA 1MU2A 4DSFA 3RRHA 4M3XA 1HPZA 1VSMA 5J2MA 1A5XA 1YVUA 2E6LA 1LW2A 1NK4A 1BIZA 5HLFA 3KK3A 4Y1CA 1CZ9A 3LAKA 1KVAA 1Z26A 3MEGA 3HVRA 1L3TA 2GUIA 1W9HA 1NJYA 3AA4A 1HQEA 4CJ5A 4CCHA 4FW2A 4EZ9A 3HXMA 1KLNA 2YHAA 3MECA 3OYAA 1JXBA 4B8CA 3TAPA 2OPRA 3S3OA 2HNYA 3ZT4A 1EETA 4KV8A 3V4IA 1EKEA 5HROA 1UWBA 2X6NA 1D9DA 2D0AA 1IKYA 4C8KA 2OZSA 1S6QA 1U45A 1KFDA 1NK8A 4KTZA 2XRIA 4HUFA 1RBUA 3OYCA 4AHSA 1TK5A 3KD1E 4FZXC 2YNHA 5FRMA 1Q9XA 3ZT2A 3VN5A 4OGEA 3F73A 4DSIA 1DTQA 3TAEA 1C0MA 1ZBFA 4M3WA 2GV9A 4KRFA 2IC3A 1TK0A 4MFBA 4O0IA 4BDYA 2AJQA 4CEOA 3LAMA 1IKXA 1W0HA 3U3GA 3V9SA 1JXEA 3ZCMA 4DMNA 1NOZA 1EP4A 3OS2A 1LAVA 3MXIA 1T03A 3QEWA 2XHBA 4FLXA 2F8SA 2OYQA 1TL3A 4J2BA 1TKDA 2HHQA 3OYGA 4CJEA 4FK0A 1U04A 5SZTA 4E7KA 1SL0A 1UAXA 1JLBA 1T7PA 1SKWA 4CEEA 4FZYA 1Q9YA 4IFYA 4B9MA 3NH1A 4DLGA 1ZBHA 3K2PA 2EX3A 2P5OA 5FRNA 4E3SA 1XI1A 1NK7A 4E7IA 3IRXA 1QS4A 1GOAA 3NDKA 1RDAA 1BQNA 4CF9A 4CF2A 1SV5A 1TKZA 1X9SA 5HRNA 3OYMA 1KVCA 3BDPA 4FJXA 1ASVA 2IS3A 3LANA 3LDSA 3C94A 3MEDA 4H8KA 4OJRA 4MQ3A 3OYHA 1WSIA 3AVNA 3VQ8A 4O44A 3CFPA 3QEXA 2HNDA 4CJKA 3EZ5A 4N47A 1KRPA 1WN7A 1BL3A 4KTQA 1BIUA 2D0CA 3NHGA 4E1MA 1F21A 4Z4EA 2DY4A 2G8FA 2WONA 4DTSA 4B3OA 1S1VA 4DS5A 1TL1A 1JKHA 3KK2A 2O4GA 2G8KA 1WAJA 4FJ7A 3OYLA 2FBVA 4AHTA 1KSPA 2G8UA 1VSJA 3CQ8A 4B8AB 4CGDA 3LWMA 4CK1A 5FDLA 1L3VA 2B6AA 1ZYQA 1JLAA 1I39A 4HHTA 3NE6A 4FJLA 4B9VA 5K14A 3CFRA 3LZIA 1HYSA 4B9UA 3AVAA 1REVA 1FXXA 1S1XA 4WE1A 4CECA 1JLFA 3V9XA 4DTJA 1NJWA 1VRUA 4KHYA 1VSLA 1DTTA 1SKRA 4DU3A 4B9LA 3DLRA 2Z1GA 4FLVA 3OYIA 4JLHA 2JGUA 2KW4A 1J54A 4JS4A 4ICLA 4M3RA 3VQ5A 1HYZA 3SCXA 4E89A 2ATQA 4KPYA 4OKJA 1C0UA 3A2FA 3HP6A 3SUQA 1D9FA 1YTUA 4C8OA 1X9WA 4DSLA 1HQUA 4ZTJA 4RG8A 3OS1A 1U47A 1VSFA 1S9EA 3DMJA 3ISNC 5HRRA 3SYZA 4CEBA 4FJJA 2NUBA 4I9LA 4HUEA 3KKRA 4F2RA 1Z25A 4CJWA 4FVMA 1SUQA 1BCMA 4GVMA 4O55A 4CGGA 4FJMA 1C6VA 4M45A 4CHZA 1NKCA 5JS2A 1LWFA 4M3YA 3TABA 5KRSA 3K57A 1RILA 1RT3A 3HT3A 3EY1A 4AHVA 1N5YA 3B6OA 4AHRA 2JLEA 1LWEA 4F4KA 4KB0A 2IOCA 1JLCA 4B9SA 3M8RA 2PYJA 3TWHA 4AILC 2Y1IA 4CHNA 1IO2A 1ZBUA 4NYFA 2Z1HA 4CGFA 3O4QA 4CF0A 3SJJA 1YTAA 4O4GA 4FJGA 1RDCA 3VQ6A 4Z4FA 4H4OA 4CK2A 4OPKA 4ELVA 5CZ2A 3LPUA 1RTHA 3DLGA 1J5OA 1RBVA 4CFAA 2P1JA 1XHXA 2BANA 3NBPA 4FJKA 4M42A 2RN2A 3ALYA 1VSDA 3K5MA 2ZE2A 3ZSZA 4CE9A 4DFKA 2YNFA 3AVHA 4EP4A 4IBNA 3KJVA 3SPZA 1NK5A 1WSFA 2Y1JA 1RT4A 1S1UA 1L5UA 2OZMA 4FJ9A 4LD0A 4CFCA 1J53A 3V81A 4QOZB 1I3AA 3ZSWA 3MEEA 3ZSRA 1D8YA 4FW1A 3KKSA 3HPHA 4W5TA 2G8VA 4DSJA 4NCBA 2YNGA 4NCGA 4FZZA 4FXDA 1RT1A 1B92A 1FKPA 4KHSA 3ZT1A 2LSNA 3DI6A 3I0RA 4KTWA 4OPJA 2RPIA 2X78A 4CHYA 4KI6A 1RT7A 2X6SA 5I42A 3M8PA 4CHOA 4KREA 1B9DA 3KLGA 4AHUA 4N41A 3VQAA 5CYQA 3QERA 1N6QA 2B5JA 4Z4GA 3SQ4A 4IDKA 3TANA 4F3TA 4J2AA 1C1AA 3PX0A 3V1OA 4DSKA 1TAQA 3T19A 1Q8IA 3OYFA 4DTUA 2DFHA 3RMDA 2HHUA 3SUOA 4CEFA 4EZ6A 2FBYA 4DU1A 3RR7A 4E7HA 4GMJB 1S9GA 3L2UA 3C6TA 1O1WA 3NAEA 1CLQA 1EX4A 4DQQA 3AA3A 1ITGA 4C8LA 1U49A 1VSKA 4CEAA 3KLHA 2R7YA 1QSSA 3ITHA 3AO3A 4NCAA 4CJUA 4FLUA 4W5OA 2HHWA 3NGYA 4DTRA 3O3HA 1DLOA 4NYNA 4HVJA 3L2WA 1WNSA 1C1CA 4LSNA 4Y1DA 3DLKA 4FM2A 3OYBA 4KHWA 1BISA 5T7BA 1EXQA 1BI4B 3C6UA 4IFVA 4DTOA 4LSLA 1QTMA 4FLTA 3QO9A 2DFFA 2X74A 3OYEA 1S6PA 3AV9A 2VWKA 5KI6A 3OYNA 3TAMA 2BE2A 2XY7A 4CJ3A 3NF8A 2QXFA 4CEQA 2RF2A 1WSJA 3BGRA 1T8EA 3KTQA 4CIGA 5EU7A 3RRGA 4M3TA 2G8IA 3I0SA 2DTUA 1X1PA 4CF8A 3P1GA 4DQRA 4DTXA 3DM2A 2ZQBA 4C8NA 3V9UA 4DLEA 1VK0A 4TSXA 1TKXA 2G8HA 1RDBA 1D5AA 4E1NA 2F96A 3ZSYA 4N5SA 1U4BA 3IS9A 2QKKA 3AVGA 5CZ1A 3SNNA 2BGGA 5I3UA 4CFDA 4M3UA 2YV0X 3CFOA 3DRSA 2XO7A 2W42A 1C1BA 3VA0A 4CHQA 4RW4A 2PZSA 4FJNA 3AVLA 4Z4IA 3OYJA 2HHTA 3CYMA 4CIFA 3ZSQA 3AVFA 3DLBA 2PYLA 1HNVA 3DRPA 5KTQA 2P5GA 4BDPA 2A1SA 3ASMA 3SI6A 4KO0A 2HVIA 3DLEA 3NF6A 2DFEA 4DTNA 1WSHA 3KLIA 3SV4A 1BHLA 3OJSA 4FM0A 3PX4A 3S3NA 4I9QA 3HJFA 3ZSVA 4CK3A 3NCIA 4I7FA 4F2SA 3VQCA 4B08A 4E7LA 4CEDA 4CGJA 3RWUA 4FK2A 3SUPA 2I5JA 1ZBIA 3TI0A 4FLZA 4H4MA 1QE1A 1ASUA 3D45A 4HUGA 3TAGA 1TK8A 1SKSA 1NJXA 1RDDA 1TKTA 3P5JA 3K5LA 4DTMA 3V9ZA 4DFPA 4N76A 4JRPA 3KD5E 3SPYA 1WSEA 1KTQA 2YKMA 4YNQA 1X9MA 3QEPA 2VG5A 3HO1A 4BE2A 4IG3A 4K8ZA
chains in the Genus database with same CATH superfamily
3ULDA 3TAFA 1K9MO 3G10A 4Q0BA 2IGIA 3T1AA 4B3RK 4KAZA 1GOBA 3HYFA 3KIOA 5C42A 3WXKA 1BO5O 3P39A 1JLEA 1XWLA 4PY5A 2XY8A 2GTDA 3WUHA 5AQVA 3OJUA 2D0OA 4W5RA 3JSMA 4DV5K 1NJZA 3TTFA 3BZCA 4H5TA 4PKHA 1KVBA 1RBSA 4Z4HA 2OCEA 3CJ7A 4JKGB 3OYDA 3PY8A 4JI1K 3TARA 5LY3A 3PLAA 3IDHA 4B9NA 4O8KA 3GDQA 4IO9L 2HB5A 3CJCA 3QNOA 3SQ2A 1NKEA 4DQIA 3UB5A 3H3OB 5E41A 4E0DA 3O1BA 3IAYA 2HHSA 4GKKK 4FLYA 3VENA 3CJBA 1Q82O 2A41A 4O0JA 5CY4A 4FK4A 2W40A 1RDWX 4DV7K 1NMDA 2A40A 1P8ZA 4Z4CA 2QWPA 3O8MA 3T69A 2OPQA 3VQBA 2QWQA 4DFMA 5H1SQ 1MDUB 3VF6A 2D0BA 3CG7A 4LY7A 4DG1A 5LMUK 3WNEA 3E01A 5DK5A 3T7ZA 4BVOA 3QLHA 3NH0A 3KLFA 3HK2A 3A5LC 3LDLA 4OKEA 5KGXA 1OH6A 2VGNA 3QETA 3WXJA 1BU6O 3MWTA 3HM9A 3F2KA 4FJ8A 4CJRA 4XH1A 3FLCO 1RT5A 3QMLA 4O8UA 4ILGB 1RTDA 1RTIA 1TV6A 3HOSA 1JCEA 4FVUA 1CZBA 5HL7L 5J1EA 1BA0A 3CERA 3MWPA 1C0GA 3THYA 1WLJA 4JEPA 1NWKA 5AR0A 3QEVA 2FSJA 4PUOA 4R5PA 3ID6A 3CIPA 3D2FA 3NGIA 4KKOA 5GAGP 2OPSA 4DFJA 4ISGA 1YHQN 3CD6N 3HSTB 1IKWA 2QKBA 3C95A 3L6QA 1IJJA 4CJFA 3CCMN 4WF9L 3EO3A 5J2PA 1YJ9N 2W41A 2XY6A 2UU9K 4O5FA 4A61A 4L8RB 3VA3A 3CCLN 2O4IA 3TPQA 5HP1A 5HRSA 3V1QA 4M63C 3ENBA 1CZAN 3A8YA 3QNNA 1WOQA 2RKIA 2E2QA 3B8AX 3HPGA 5AQZA 2EHGA 4ID5A 1W2BM 4HCCA 1EWQA 3RTVA 5JS1A 4BG8A 4DF8A 3W0LA 2QA4N 5B8HA 3LALA 1Q7YO 1VQ5N 2O8CB 4X64K 1M90O 1HNIA 3F9MA 4J8FA 5GADP 5D3GA 2HHHK 3L8BA 3MXMA 1QQCA 4OVLA 2E2NA 2ASPA 3K5OA 1EWRA 5BREA 4FYDA 4A59A 4CHPA 5JVHL 3BZKA 4V19S 4H5WA 2P51A 3F5TA 4KHQA 1NGAA 1HPZA 4C1NI 5J2MA 1A5XA 2E6LA 1LW2A 4WFNL 3U9DA 4OPAA 5GAEP 3MEGA 1L3TA 3O9QA 1W9HA 4FW2A 4QS9A 3C6AA 1JXBA 2QTDA 4B8CA 3TAPA 2IIRA 2OPRA 4DV1K 4C8KA 4BRLA 2QEXN 4JKHA 3VOVA 3OYCA 1TK5A 3KD1E 2YNHA 4DB3A 1KQSM 4NLBA 1TK0A 4MFBA 1ILYA 1DT9A 3CQXA 3H3NO 2F9WA 3U3GA 3V9SA 2GWJA 3A5MC 4DMNA 1EP4A 1LAVA 2F8SA 3OYGA 3CHWA 1U04A 1ATSA 3SJHA 3CCQN 4X66K 4B9MA 4DLGA 1XI1A 4JI5K 1NK7A 4F9OA 1GOAA 3NDKA 4CF2A 4ILHA 2A3ZA 3AGKA 3C94A 3MEDA 4H8KA 1MWKA 4LFBK 3OYHA 4WYBA 3VQ8A 3O9RA 3CQYA 4IDHA 3CFPA 3EZ5A 4N47A 4NXNK 2QWMA 2ITMA 1RFQA 3FZHA 1NGGA 3O9SA 5DM6L 3DJCA 3OYLA 4JI3K 4AHTA 3P38A 1VSJA 4BQZA 4CGDA 3O08A 3I8BA 1ZYQA 3NE6A 3SBTA 3VEXA 3LZIA 4B9VA 4B9UA 3V9XA 4CD1A 3U8XA 1NJWA 1VRUA 3THXA 1DTTA 3PSFA 3G6EN 2JGUA 3SAGA 4ICLA 4M3RA 3VQ5A 1HYZA 3G25A 3HP6A 5AZIA 3SUQA 1VQ4N 2KLAA 1VQ8N 1U47A 2UUAK 5HRRA 5MLCQ 1TYQB 1Z6RA 4FVMA 1SUQA 1BCMA 4O55A 2VWBA 1BDGA 4CGGA 1C6VA 1NKCA 4EHUA 1XMOK 1RT3A 1IV0A 5AFUH 4AHVA 3B6OA 4AHRA 4IEIA 4PL8A 1Q86O 3TWHA 4AILC 4JHDB 3O4QA 1YTAA 3VTHA 2Q31A 2UUBK 2P9NA 4FO0A 1J5OA 4M7YA 5LJWA 2QXLA 3ZLJA 4IOAL 4B1YB 2GX9A 3MX2A 3NBPA 3UKUA 3K5MA 3ATVA 2ZE2A 4CE9A 2YNFA 5AQJA 1WSFA 2Y1JA 3EE8A 3EKUA 2V7ZA 3VPZA 4AQYK 4LD0A 2GEMA 5AQWA 4NCBA 4FW1A 4DSJA 4HTLA 2G8VA 3EN9A 4FZZA 4FXDA 5JMVA 3I55N 3ZT1A 5KPRA 2RPIA 5I42A 2X6SA 3M8PA 2YHWA 4CHOA 4N41A 3VQAA 5CYQA 3QERA 1NGIA 2B5JA 4Z4GA 3CPWM 4J2AA 1C1AA 3IFRA 4JKAA 4CZHA 3I56N 1Q8IA 3OYFA 5BN8A 4EZ6A 4DU1A 3CCJN 1T6CA 1CLQA 1EX4A 4BC5A 4PHTX 1QSSA 4BRDA 3NGYA 3ZETA 3L4QA 4NYNA 1V4SA 3L2WA 1WNSA 4JD2B 4RWTA 2O8DA 4Y1DA 1T44A 4H0OA 4IFVA 3QO9A 2ZJQL 2DFFA 2X74A 3KK7A 5AQGA 5KI6A 3TAMA 2HBJA 2QXFA 2RF2A 3BGRA 2DTUA 3RRGA 1K8KB 3I0SA 1X1PA 4JI2K 4BC2A 4TSXA 2G8HA 1RDBA 4N5SA 2NRTA 3IS9A 3AVGA 5CZ1A 4CFDA 5GIPA 3AY9A 2YV0X 4YORA 1C1BA 2WFBA 4CHQA 4CBUA 2Q1NA 3E9LA 2PZSA 1N36K 4FJNA 4CIFA 4H0PA 4BDPA 4ILJA 2HVIA 2E5LK 4DTNA 4B1VA 1BHLA 4FM0A 3PX4A 3HJFA 4I9QA 1V4TA 1NM1A 2HSTA 4I7FA 1ATRA 4E7LA 3RWUA 3SUPA 2I5JA 5M1KA 3TI0A 4GKJK 3RVCA 4B1XB 3TAGA 3U4LA 1YJNN 3K5LA 3V9ZA 3KD5E 4B1WB 4YNQA 3SPYA 1X9MA 5KPZA 1HLUA 3VEOA 1S5JA 3HRGA 3ZX3A 4CJSA 3L2VA 1EO1A 1JLGA 3UKRA 2P9KB 2KTQA 4ZTFA 4I2PA 4JKDA 3ZT3A 1ASWA 1HKCA 1NKBA 2KZMA 3O9TA 5BN9A 3PSIA 5AQRA 5BPNA 3V6DA 3EEQA 5BPLA 3AO2A 3OS0A 1BGXT 3DLHA 3AA2A 5CHIA 5FPDA 1VQLN 1HUXA 2I7NA 3K5NA 1KXPA 2KFZA 3GG4A 1NK9A 1X9JA 2A6AA 4WFAL 1SL2A 3RMAA 2ZM6K 3M3ZA 1JCFA 4YDUA 4CJ4A 1L3UA 3THWB 1YUWA 4EP5A 3NF7A 3VEYA 3O9UA 4AM6A 3Q7CA 4DF4A 1IG8A 4FOEA 4CESA 2QK9A 3MMVA 3AO1A 4RW6A 3VQQA 2P9UA 4CJPA 3U6FA 4GW6A 4M3ZA 4LF8K 3DAWA 4BR7A 3S41A 1WAFA 1JL1A 1FKOA 2FXUA 3NGZA 3K59A 2VQFK 1RNHA 3WXLA 3ENHA 1NK0A 5AQQA 1IBLK 4A5BA 3QINA 1JJ2M 1SL1A 4BRGA 4FPBA 2IAJA 3OA9A 4FM1A 4ZHRA 1GLEG 1RT2A 2O8EB 2VG6A 5LMNK 4J2EA 4A2AA 4EIAA 1RBRA 1VSHA 3AGRA 3UIQA 4RW9A 1SZ2A 1VQ9N 3PIOL 3SV3A 1HJRA 2F8TA 3E66A 1SQKA 3PV8A 2FSNA 3AVIA 3D2EB 3QBWA 4ISEA 3VQEA 3SAFA 1W7AA 2P9LA 3V9WA 2KQ2A 4G1QA 1IG9A 2O8FB 3LL3A 1WSGA 1S22A 3R3LA 4KBOA 4AHCA 4CI6A 1R59O 1ZXOA 3LP2A 4BE0A 3JYTA 1RGIA 4BWJA 1HYVA 1K6YA 5HOOA 3CM5A 4BACA 3RMCA 3AO5A 2FF3B 3IUCA 4E19A 4DU4A 2OA8A 2NRRA 2UXBK 4BG9A 1CXUA 5HBMA 2CGLA 1X3NA 3PX6A 1LW0A 4RW8A 4BRNA 3O4NA 1LAWA 1GLLO 2B4JA 2XY5A 3MK6A 3L3UA 4PL7A 1VSIA 3J7YP 4JKFA 1VQON 3ULEA 2KHOA 3KLEA 4JN4A 4B3SK 4DQSA 4E7JA 4DR2K 4I2QA 1BQMA 4FWNA 4LH5A 5C24A 1LWCA 3EZWA 4M7XA 5C15A 2VG7A 1MU2A 3FE1A 3RRHA 3VTIA 2W6KA 3LDNA 3KK3A 1CZ9A 1Z26A 1VQ6N 4WQ4A 3AA4A 1HQEA 4YOVA 1MA9B 4IJAA 2HNYA 3U9ZA 1EETA 4KV8A 1XNQK 1Z05A 5HROA 2O8BB 1D9DA 2D0AA 1IKYA 1NGJA 1C0FA 1S6QA 1KFDA 1YF5L 3VEWA 3MCAB 4HUFA 2QWNA 4AHSA 4FZXC 3G71N 2FLOA 1Q9XA 3F73A 4DSIA 3TAEA 1C0MA 1ZBFA 5TKYA 2GV9A 1NGBA 4KRFA 2IC3A 4O0IA 4BDYA 1OKJA 4CEOA 1IKXA 1W0HA 3A0IX 4K43A 3ZCMA 3BEXA 1NOZA 3MXIA 4YY3K 4ISFA 5LJVA 4E7KA 1UAXA 3BP8A 1T7PA 4L3QA 4IXCA 5KQ8A 5FRNA 4IZ9A 4BR5A 4I6MB 1SV5A 3OYMA 1ASVA 2W6LA 2A5XA 3VERA 1QHAA 2RE2A 4O44A 5AQKA 4CJKA 3SAHA 3M1FA 3NHGA 1DGKN 4H5RA 4E1MA 2D0PA 2G8FA 4B3OA 5GIOA 2HOEA 5FPEA 2G8KA 1ESVA 2UXDK 3L0QA 4BGAA 2B6AA 1GLFO 1JLAA 1I39A 3MDQA 4B1UB 5K14A 1HYSA 3AVAA 4DTJA 4CECA 5ADXA 4K25A 5M1QA 2ZF5O 4LF5K 1VSLA 4B9LA 3DLRA 2Z1GA 3W3DA 1YJWN 4FLVA 5BRHA 4FWKA 1YVNA 5I9EB 3IKMA 4G9ZA 3VEVA 2UXCK 3DXMB 1X9WA 4RG8A 3OS1A 3RSEB 1S9EA 2QM1A 4FSVA 3SYZA 3Q7BA 4FJJA 3KKRA 3FGUA 3WT0A 3K57A 1E3MA 2JLEA 1LWEA 3NMUA 1HNXK 3IMXA 2IOCA 1JLCA 3M8RA 4JHDA 2PYJA 2Y1IA 4CHNA 1VQNN 4CBXA 4CGFA 3SJJA 4O4GA 1RDCA 3VQ6A 4Z4FA 4H4OA 3O6WA 2E1YA 5EVZA 3LPUA 1XMQK 4H0YB 3CMAN 2D4WA 3P4IA 4M42A 3KHYA 2RN2A 5JLFA 3ZSZA 1NJIO 4DFKA 1NK5A 2P9IB 3AVHA 3N4QA 1L5UA 4FJ9A 1O13A 3R8EA 4QOZB 3ZSWA 3MEEA 3ZSRA 3HPHA 2YNGA 1RT1A 3C7NA 4DR3K 1B92A 1FKPA 3SMPA 1BG3A 4IOCL 2LSNA 3I0RA 4KTWA 4OPJA 4KI6A 1RT7A 4KREA 3KLGA 2P9PA 4DUZK 4JK7A 3SQ4A 4XH4A 4IDKA 3ID8A 3M5RA 3H45C 1G99A 4DTUA 2DFHA 4GMJB 4BR4A 3L2UA 1O1WA 3NAEA 2WTUA 2WUSA 4BRQA 3P31A 1VSKA 5CE3A 2R7YA 4FWQA 1T3VA 3DXKA 4CJUA 4FLUA 4DTRA 4OO1J 3CJ9A 1HX1A 1C1CA 4B3MK 4LSNA 4FM2A 3OYBA 2VCPA 1BISA 1EXQA 3CI5A 4LSLA 4WQ5C 3KWIA 3FZLA 3OYEA 4DV0K 2VGMA 5TKWA 4BGBA 3GE1A 3OYNA 2BE2A 2XY7A 3NF8A 2QWOA 4CEQA 2ZWHA 3KTQA 2QWRA 4CF8A 5F1XA 2ZQBA 4C8NA 3V9UA 3HBTA 1TKXA 1D5AA 2F96A 3O1WA 3SNNA 3HI0A 2BGGA 3CFOA 3DRSA 2W42A 3VA0A 1QVGM 3CMEN 3LM9A 3AVLA 1NGDA 1HNVA 5KTQA 2P5GA 3ASMA 2E2OA 4YHHK 3D2FB 4QS8A 3KLIA 3OJSA 4CK3A 1ATNA 4JKCA 3VQCA 4EHTA 4CEDA 4FK2A 1ZBIA 1TK8A 3D45A 4LF7K 1SKSA 4X65K 3KZBA 3R6MA 4IO8A 2ZGYA 5AQPA 1WSEA 2YKMA 4E7IA 3AARA 3A5NC 4BE2A 4K8ZA 2FBTA 2J4RA 4PA1A 1KLMA 1KCFA 3THVA 3QEIA 4QAGA 2HBLA 3ZX2A 1GLCG 4B9TA 3WNGA 3UE5A 5AJ3K 4EAHD 4YOWA 2OPPA 2NRHA 3E1YA 4N56A 5ELZA 5BR8K 4CGIA 4GV3A 3DOLA 2AA4A 2WOMA 4FJIA 4Q5VA 3AAQA 3E9PA 4M41A 4ELUA 5F0XA 4AF1A 5KGWA 3SUNA 3LPTA 4DTPA 2FF6A 1S1TA 4HTUA 1NMNA 1A5VA 4CW7B 1ZBLA 3M6GA 4BY9C 1D4XA 3LP1A 2BUPA 3CJ1A 3L2QA 1TGOA 4BR2A 4KI4A 1IH7A 5SWMA 1IKVA 2YI1A 4OGCA 2YKNA 4CJVA 5GAHP 1U48A 4KHUA 3WEEA 4KFBA 4ID1A 3AO4A 3LDQA 2Z1IA 2YHXA 4CZFA 1R0AA 2D5RA 1IBMK 1W97L 1VHXA 4BWMA 4JS5A 3I8DA 1OVQA 1LOTB 2YJFA 1BI4A 1XC9A 3WQTA 3SMSA 3ZSXA 4B1ZA 2G8WA 4U67L 4BVPA 5JVGL 4GY2B 4CF1A 2FSKA 5J2NA 4NO7A 4CD3A 4DR5K 1WUAA 3VEZA 2HHXA 2IDOA 3TR8A 3B6PA 3OYKA 4YOTA 4CJTA 5DMRA 2PY5A 3ZYYX 2O8EA 1FK9A 2KZZA 4BRAA 2HW3A 5HRPA 3AVCA 1NK6A 1VSEA 1XC3A 5FROA 1EQYA 2P9SA 4JRQA 1C0TA 3BF1A 4BREA 2FBXA 2VWJA 1VQKN 3S3MA 4IG0A 4W5QA 4QCLA 2BH1A 3D2EA 1JLQA 2YX6A 4PWDA 1B9FA 4F3OA 3EYZA 5C25A 2Q2RA 3WNFA 2JWKA 4Y0WA 4YOXA 4H5VA 3RR8A 4JI8K 1QSYA 4K42A 3SBGA 4CJQA 4CZIA 1NGHA 2PAVA 4DQPA 2V7YA 4FJ5A 2IVPA 1TVRA 3ZSOA 3THXB 3QESA 2CGKA 3G0ZA 3VQDA 3WQUA 3JXUA 1XHZA 1HNWK 3VF4A 3AVJA 5AZIB 5ADXH 1NNEA 4O5BA 3CM6A 5AZJB 3RMBA 2YHYA 1CXQA 1Y97A 4FL9A 4CZKA 2GBZA 3ENOA 3TSPA 3P83D 3S9HA 2E6MA 4CERA 1HRHA 3CCRN 4OLBA 1HJOA 5E84A 4PQUA 1U2VB 5AQMA 1UA1A 4OLAA 2JWLA 4R79A 3OBYA 4JKGA 4J2DA 4KB1A 3EL2A 1JL2A 3PIPL 1HPMA 1WB9A 3HPOA 2NRXA 2P9NB 1YI2N 1YVUA 4MDAA 5AQTA 4FWPA 5AQHA 1NK4A 5HLFA 4Y1CA 3UKUB 3H1QA 3LAKA 4WCEL 3HVRA 1NJYA 4EZ9A 3J80O 3HXMA 3MECA 3OYAA 2OTJN 4BRCA 1NGEA 4CBWA 4BC4A 3V4IA 1EKEA 1UWBA 2OZSA 1U45A 1IBKK 3K9KA 2XRIA 5BRFA 1OH7A 1GLDG 3CCEN 1SS6A 3ZT2A 4M3WA 5GINA 3HTVA 1GLAG 3CETA 2AJQA 1OH5A 3K9JA 3LAMA 4LF9K 4DV4K 4B9QA 1JXEA 3MCPA 2I7PA 3QEWA 2GELA 4A2BA 1TL3A 2OYQA 2HHQA 1BA1A 5SZTA 1GLBG 1JLBA 3LDOA 4CEEA 1Q9YA 4IFYA 3ZETB 3K2PA 5C12A 1QVFM 4DR6K 3IRXA 1BQNA 4CF9A 2O8DB 1X9SA 5KPTA 3BDPA 2IS3A 3LANA 1NU0A 4EFHA 4OJRA 4MQ3A 4LF4K 1WSIA 2HBKA 3AVNA 5M1NA 3I33A 1VQ7N 1BL3A 3J7ZO 3L4IA 1BIUA 2D0CA 4Z4EA 1F21A 2DY4A 1DEJA 4DTSA 1S1VA 4DS5A 1TL1A 3KK2A 2O4GA 4FJ7A 3DWLA 1OH8A 4C1NK 4AM7A 4LFCK 3LWMA 4CK1A 5FDLA 4BRMA 3LDPA 2V51B 2PFUA 1GLJO 1REVA 1DKGD 2OTLN 1JLFA 4XEIA 3BUZB 4DU3A 3K0SA 3QBXA 4XH5A 2KW4A 1J54A 3CC2N 2F7TA 2ATQA 4KPYA 4OKJA 3DXMA 3A2FA 1YTUA 4DSLA 1HQUA 3ZEUB 2O8CA 1VSFA 1ZBSA 4CEBA 3VESA 3H1VX 4I9LA 3CXCM 4HUEA 4F2RA 4CJWA 1N34K 3FR0A 4M45A 4CHZA 5JS2A 4M3YA 3TABA 3GOIA 3HT3A 3EY1A 4KB0A 4KHPK 4B9SA 5EX5A 3UKRB 1IO2A 1ZBUA 4NYFA 2Z1HA 4CF0A 2GUPA 4CK2A 4OPKA 3DLGA 1RBVA 3TSQA 4U7BA 2P1JA 3ZX0A 3QICA 3TSUA 3R9PA 3ALYA 3O5BA 4DUYK 2P9IA 1XQSC 3CPEA 2UUCK 3KJVA 4JKBA 1Y64A 1RT4A 1S1UA 2OZMA 5AQLA 4CFCA 1J53A 3V81A 1I3AA 3NVKA 4MDBA 3FFKB 1T6DA 4DCHA 4KHSA 2OANA 3DI6A 4H0TB 1LCUA 4CHYA 2G8IA 3VGLA 1B9DA 5EY4A 4AHUA 5BPMA 3FZMA 3N4PA 2KKZA 4NB4A 1N6QA 3QFPA 4F3TA 3PX0A 3V1OA 3T19A 3RMDA 2HHUA 2Q0UA 4MLHA 4OX9K 4DR4K 3C6TA 1TUUA 2P9UB 5FPMA 4DQQA 3AA3A 1N32K 2DPNA 1U49A 4CEAA 3KLHA 3ITHA 3AO3A 1BOTO 5IWAK 4NCAA 1QQOA 4W5OA 2HMPA 3O3HA 1DLOA 4BQLA 4HVJA 1XNRK 3CCUN 1HKGA 4KHWA 5T7BA 3C6UA 4DTOA 1QTMA 4FLTA 4BR0A 2WBNA 3EKSA 5AQYA 2VWKA 4CJ3A 4JI0K 3CJAA 4CIGA 4RCHA 4FWSA 3P1GA 2WC9A 4DTXA 4PKIA 3CF5L 3MN7A 5M1FA 3DLLL 4DR7K 3ZSYA 4DV2K 2QKKA 1I94K 5I3UA 1QZ6A 3WXIA 4RW4A 3BF3A 3SK3A 4Z4IA 3CYMA 3AVFA 1J6ZA 2PYLA 3DRPA 3SI6A 4DKWA 2CH6A 5FLXO 2DFEA 4H03B 2Q97A 1WSHA 1X3MA 1KAXA 4BC3A 3NCIA 2NRVA 4CGJA 4A62A 4JYAK 2P9LB 4FLZA 4H4MA 1ASUA 4BRKA 2IVOA 1TKTA 3P5JA 4DTMA 4K0KK 1TYQA 4JRPA 1KTQA 3HO1A 5EOYA 4HCBA 5F2RA 1NGFA 2YNIA 4H5NA 4W5NA 3V1RA 1QZ5A 3VQ4A 2HNZA 2YCHA 3WXMB 4CJLA 3AVMA 3MXJA 1XUPO 3F9KA 4BR9A 3SQ0A 5M1OA 4GVEA 1MWMA 4CZLA 2F4VK 2HF3A 3NH2A 1GOCA 2YJEA 3NFAA 4OKKA 4DSEA 1L3SA 3RR7A 2BDPA 4DS4A 4YDUC 4MLEA 4NXMK 3JAMO 3O3GA 3ULEB 2A1RA 4H0XB 4JK8A 5AQXA 1OVYA 4DWIA 3L2RA 3DYAA 1J9AA 4YFUA 1J5EK 4LFAK 3SQ1A 2NNWA 3H6EA 4X62K 2Q3SA 5J2QA 2HHVA 3FFIA 4B3TK 4FLWA 4RTFD 2EWSA 1UA0A 3M8QA 4FCYA 4JAXA 1QQNA 3O80A 4RW7A 4ELTA 3LZJA 3TTDA 1HMVA 3HP9A 3U3YA 1E4GT 4CFBA 3LWLA 2KFNA 1RCHA 2ZD1A 4JD2A 4XIUA 1HR0K 1BWFO 3C0BA 1FJGK 2E4LA 3PO4A 4F8RA 5E26A 2YHBA 4BROA 3L3VA 4JK9A 1VRTA 1TAUA 4LH4A 2E8AA 3VETA 4BRHA 4IWVA 4GV6A 3TU5A 3DOKA 2F9TA 4C8MA 3PO5A 5AQNA 5AQFA 3H08A 1K8KA 1U6ZA 1KFSA 3QIPA 3T3FA 1BCOA 3D0PA 3J8AA 1LV5A 1S1WA 1RT6A 4AH9A 2FC0A 4KH6A 1A5WA 3OBWA 1K8AO 5CYMA 3HVTA 3THYB 2Z1JA 4OPHA 4CGHA 3DRRA 4WFBL 1S3XA 3FZFA 3C6HA 1HNZK 5FPNA 3ZT0A 2VYPA 3AVBA 2AP1A 1QSLA 1UOCA 1JCGA 1NGCA 3KK1A 3VQ9A 4KHNA 4IKFA 1RDUA 4UQGA 2HVHA 1YITN 1G15A 3VQPA 3SZ2A 4BE1A 4CEZA 3O3FA 3TAQA 3K58A 3IG1A 4Z0UA 3VQ7A 3AVKA 2CH5A 4K8XA 2ETJA 4BDZA 1KD1O 1NOYA 2P9KA 1K73O 3D7EO 4CIEA 1RTJA 3LP0A 4DQ8A 3OY9A 1H1VA 2ZJPL 4LC9B 4FWOA 5EXWA 5AZJA 3M8SA 3WNHA 3JS6A 3MN6A 3NF9A 4FJHA 1T05A 3OVNA 4FPAA 1QQMA 3C65A 2ITGA 3PUFA 5KRTA 3QIOA 5AQUA 3HL8A 1Q81O 2V52B 3MAQA 1U2VA 3AA5X 3AAPA 4DV3K 2HMIA 1YT3A 2Q0RA 5C0YA 4WQ4C 4QS7A 1QHTA 4PKGA 4JI4K 1KAZA 3QFUA 3LP3A 1RBTA 4DSFA 4M3XA 1VSMA 3THWA 5C2FA 1BIZA 4JI7K 1KVAA 4FWLA 2GUIA 4CCHA 3QB0A 4CJ5A 1TUYA 3J81O 1KC8O 4CZEA 1KLNA 2YHAA 4KH5A 1P90A 3S3OA 4CZMA 3ZT4A 4A5AA 2X6NA 4JI6K 3C7NB 2E1ZA 3HSCA 2QW9A 4YOUA 5LL6Z 1NK8A 2HF4A 5IT9O 4KTZA 3OTOK 1RBUA 5FRMA 2P9PB 2NZTA 3VN5A 4OGEA 1DTQA 3GBTA 4H0VB 1S72N 5C2DA 4CJ7A 3OS2A 1T03A 2XHBA 4FLXA 4J2BA 1TKDA 4FK0A 4CJEA 1SL0A 4FWRA 5AQIA 1SKWA 4FZYA 2E20A 3DXKB 3E9OA 3NH1A 1ZBHA 2EX3A 2P5OA 4E3SA 1QS4A 1RDAA 1TKZA 5HRNA 4FJXA 1KVCA 2CGJA 3LDSA 3CCSN 1NBWA 3QEXA 4MO4A 2HNDA 1WBDA 1KRPA 1WN7A 4MO5A 4KTQA 1BUPA 3MN5A 4CZGA 2WONA 4BRPA 3KVGA 1JKHA 4IJNA 1WAJA 2FBVA 1KSPA 2G8UA 2IVNA 3CQ8A 4NLCA 3OHRA 4B8AB 1L3VA 5BR9A 2PBDA 2O8FA 3MN9A 4HHTA 2NLXA 4IOXA 4FJLA 3VGMA 3CFRA 4JV5K 3R1XA 1FXXA 1S1XA 4WE1A 2ZGZA 1Q18A 3HM8A 4KHYA 1SKRA 3OYIA 4JLHA 3VGKA 4JS4A 3SCXA 3KWGA 4KH4A 4E89A 1C0UA 1NG9A 1D9FA 1M1KO 2GWKA 3ZEUA 4C8OA 1WBBA 4ZTJA 3DMJA 3ISNC 3VF2A 2NUBA 1NLVA 3CCVN 1Z25A 4GVMA 4FJMA 3J7AP 1YIJN 3CC7N 1LWFA 5KRSA 1RILA 1N5YA 2Q36A 2ASMA 2RHKA 4F4KA 5BRDA 4BRIA 3OW2M 3QDKA 2E2PA 3EE9A 4FJGA 1VQMN 5KQDA 3VMFB 3T1YK 4ELVA 5CZ2A 1KAYA 1RTHA 4CFAA 3FZKA 5AQSA 2D1KA 3MX5A 1XHXA 2BANA 4C23A 5DM7L 4FJKA 1VAZA 2UYTA 2E88A 1VSDA 4EP4A 4IBNA 3SPZA 3D6RA 2QWLA 1D8YA 1E4FT 1HKBA 2QI2A 3KKSA 4W5TA 2O8BA 4NCGA 2ASOA 5C10A 2X78A 5A2QO 4A57A 3TANA 4HWIA 4DSKA 3H46O 1TAQA 2VQEK 3CC4N 3SUOA 4CEFA 4YOYA 2A42A 2FBYA 3LM2A 4E7HA 5AQOA 1S9GA 3A5OC 3NVMA 1N33K 3WEEB 1ITGA 4C8LA 4DV6K 3G4SN 4IEEA 2HHWA 5CR4A 4I6MA 4LF6K 1SAZA 4UY8O 3DLKA 3O4WA 1BI4B 3TTCA 4FWMA 4JKEA 1VQPN 2NRZA 2ZJRL 2BTFA 1S6PA 5JICA 3AV9A 3ATUA 4CZJA 1T8EA 1WSJA 5EU7A 4M3TA 4IFEA 3GL1A 4DQRA 4BRFA 3DM2A 4DLEA 1VK0A 4WQ5A 4E1NA 1YXQA 4JNEA 4Z94A 1U4BA 4M3UA 2XO7A 4K41A 2P9SB 4FOIA 3OYJA 5JLHA 2HHTA 2HBMA 3ZSQA 3DLBA 4DR1K 2A1SA 1N8RO 2NRWA 3HOTA 2H3GX 4KO0A 3DLEA 3NF6A 3HZ6A 4DHYA 3SV4A 1ZC6A 3S3NA 3ZSVA 3SLCA 3T1HK 1FW6A 4F2SA 4B08A 4E1JA 5AFUA 3BY5A 1QE1A 4HUGA 4CVNE 3RSEA 1YAGA 1NJXA 4GV9A 1RDDA 5M1PA 4DFPA 4N76A 3QEPA 2VG5A 4GNIA 4IG3A
chains in the Genus database with same CATH topology
3ULDA 2FBTA 4PA1A 3TAFA 1KLMA 4HCBA 1KCFA 3THVA 1S5JA 2YNIA 4W5NA 3QEIA 3G10A 4CJSA 4QAGA 3V1RA 4Q0BA 2IGIA 3VQ4A 2HNZA 3L2VA 3T1AA 4KAZA 4CJLA 1JLGA 3AVMA 3MXJA 4B9TA 3F9KA 3SQ0A 2KTQA 4ZTFA 4I2PA 1GOBA 3WNGA 3HYFA 3KIOA 3ZT3A 1ASWA 5C42A 1NKBA 2KZMA 1JLEA 1XWLA 4PY5A 3NH2A 1GOCA 2XY8A 2OPPA 3NFAA 4OKKA 4DSEA 3V6DA 4N56A 1L3SA 2BDPA 4DS4A 3AO2A 4CGIA 3DOLA 3OJUA 3OS0A 4W5RA 3JSMA 1BGXT 3O3GA 3DLHA 2WOMA 3AA2A 1NJZA 2A1RA 3K5NA 4FJIA 2KFZA 4Q5VA 1NK9A 1KVBA 1RBSA 4M41A 4Z4HA 4ELUA 1SL2A 4DWIA 3RMAA 3OYDA 5KGWA 3PY8A 3L2RA 3DYAA 3LPTA 3SUNA 1J9AA 4YFUA 4DTPA 3TARA 4B9NA 4CJ4A 1S1TA 3SQ1A 2HB5A 3QNOA 1L3UA 4HTUA 3SQ2A 1NKEA 4DQIA 1A5VA 4EP5A 2Q3SA 3NF7A 5J2QA 3FFIA 1ZBLA 2HHVA 5E41A 4FLWA 4E0DA 3LP1A 4DF4A 1UA0A 3IAYA 3M8QA 2HHSA 4FCYA 3L2QA 1TGOA 4FLYA 4KI4A 1IH7A 4RW7A 4CESA 5SWMA 4ELTA 2QK9A 1IKVA 3AO1A 4OGCA 2YKNA 4CJVA 1HMVA 3LZJA 4O0JA 4RW6A 5CY4A 4FK4A 3VQQA 3HP9A 1U48A 3U3YA 4KHUA 4CJPA 3U6FA 4CFBA 4GW6A 3LWLA 4M3ZA 4KFBA 2KFNA 4ID1A 3AO4A 1RCHA 2Z1IA 4Z4CA 1WAFA 1JL1A 1R0AA 2D5RA 2ZD1A 1FKOA 2OPQA 4BWMA 3NGZA 3K59A 3VQBA 4JS5A 4XIUA 3I8DA 4DFMA 2E4LA 3PO4A 4F8RA 1RNHA 2YHBA 2D0BA 1BI4A 3CG7A 3L3VA 4LY7A 4DG1A 1XC9A 1NK0A 1VRTA 3E01A 5DK5A 4LH4A 3WNEA 3QLHA 3ZSXA 3NH0A 2G8WA 1TAUA 3KLFA 3HK2A 3QINA 4CF1A 4OKEA 5KGXA 5J2NA 1SL1A 3DOKA 2HHXA 2IDOA 3TR8A 3QETA 4C8MA 2IAJA 3PO5A 3B6PA 3H08A 3OYKA 1KFSA 4CJTA 3HM9A 3QIPA 4FJ8A 4CJRA 3T3FA 5DMRA 1BCOA 2PY5A 4FM1A 1RT5A 3D0PA 1FK9A 4ZHRA 1LV5A 1RT2A 2KZZA 1RTDA 1S1WA 1RT6A 4AH9A 1RTIA 2FC0A 1TV6A 3AVCA 2VG6A 5HRPA 1NK6A 1A5WA 2HW3A 1CZBA 1VSEA 4J2EA 5FROA 5CYMA 3HVTA 1RBRA 5J1EA 1VSHA 1WLJA 4JRQA 3UIQA 1C0TA 4RW9A 2Z1JA 2FBXA 2VWJA 3QEVA 4CGHA 3DRRA 4PUOA 4R5PA 3S3MA 3SV3A 4IG0A 4W5QA 1HJRA 2F8TA 3NGIA 4KKOA 4QCLA 2OPSA 4DFJA 3PV8A 3ZT0A 3AVIA 3HSTB 3VQEA 1JLQA 3AVBA 1IKWA 2QKBA 3C95A 1QSLA 1UOCA 4CJFA 4PWDA 1B9FA 4F3OA 5J2PA 3EYZA 3KK1A 3VQ9A 5C25A 2XY6A 4IKFA 4KHNA 4UQGA 2HVHA 3WNFA 3V9WA 1G15A 2KQ2A 4L8RB 3VQPA 4G1QA 3VA3A 3SZ2A 1IG9A 3RR8A 1QSYA 1WSGA 2O4IA 4CJQA 4BE1A 4CEZA 5HP1A 3O3FA 3TAQA 3K58A 4DQPA 3IG1A 5HRSA 3V1QA 4Z0UA 4FJ5A 4AHCA 1TVRA 3AVKA 3VQ7A 3ZSOA 3QNNA 3LP2A 2RKIA 4K8XA 4BE0A 3JYTA 3HPGA 2ETJA 4BWJA 1HYVA 4BDZA 3QESA 1K6YA 2EHGA 3CM5A 4BACA 3RMCA 3AO5A 3G0ZA 3VQDA 1NOYA 4ID5A 4E19A 4DU4A 4HCCA 3RTVA 5JS1A 4CIEA 2OA8A 1XHZA 1RTJA 3LP0A 3AVJA 1CXUA 5HBMA 3OY9A 4DF8A 3LALA 4O5BA 3M8SA 3CM6A 3PX6A 1LW0A 3WNHA 4RW8A 1HNIA 3O4NA 3RMBA 3NF9A 4FJHA 1LAWA 1T05A 3OVNA 1CXQA 1Y97A 2B4JA 2XY5A 2ITGA 5D3GA 2GBZA 3L3UA 3PUFA 5KRTA 3QIOA 3L8BA 1VSIA 3MXMA 1QQCA 4OVLA 3HL8A 3P83D 3S9HA 3KLEA 3K5OA 3MAQA 2E6MA 4CERA 4FYDA 4CHPA 1HRHA 4OLBA 4PQUA 4OLAA 4DQSA 1UA1A 3AA5X 2HMIA 4E7JA 4I2QA 1BQMA 1YT3A 4J2DA 4LH5A 2P51A 1LWCA 5C24A 1JL2A 4KB1A 1QHTA 3LP3A 2VG7A 3HPOA 1RBTA 4KHQA 1MU2A 4DSFA 3RRHA 4M3XA 1HPZA 1VSMA 5J2MA 1A5XA 1YVUA 2E6LA 1LW2A 1NK4A 1BIZA 5HLFA 3KK3A 4Y1CA 1CZ9A 3LAKA 1KVAA 1Z26A 3MEGA 3HVRA 1L3TA 2GUIA 1W9HA 1NJYA 3AA4A 1HQEA 4CJ5A 4CCHA 4FW2A 4EZ9A 3HXMA 1KLNA 2YHAA 3MECA 3OYAA 1JXBA 4B8CA 3TAPA 2OPRA 3S3OA 2HNYA 3ZT4A 1EETA 4KV8A 3V4IA 1EKEA 5HROA 1UWBA 2X6NA 1D9DA 2D0AA 1IKYA 4C8KA 2OZSA 1S6QA 1U45A 1KFDA 1NK8A 4KTZA 2XRIA 4HUFA 1RBUA 3OYCA 4AHSA 1TK5A 3KD1E 4FZXC 2YNHA 5FRMA 1Q9XA 3ZT2A 3VN5A 4OGEA 3F73A 4DSIA 1DTQA 3TAEA 1C0MA 1ZBFA 4M3WA 2GV9A 4KRFA 2IC3A 1TK0A 4MFBA 4O0IA 4BDYA 2AJQA 4CEOA 3LAMA 1IKXA 1W0HA 3U3GA 3V9SA 1JXEA 3ZCMA 4DMNA 1NOZA 1EP4A 3OS2A 1LAVA 3MXIA 1T03A 3QEWA 2XHBA 4FLXA 2F8SA 2OYQA 1TL3A 4J2BA 1TKDA 2HHQA 3OYGA 4CJEA 4FK0A 1U04A 5SZTA 4E7KA 1SL0A 1UAXA 1JLBA 1T7PA 1SKWA 4CEEA 4FZYA 1Q9YA 4IFYA 4B9MA 3NH1A 4DLGA 1ZBHA 3K2PA 2EX3A 2P5OA 5FRNA 4E3SA 1XI1A 1NK7A 4E7IA 3IRXA 1QS4A 1GOAA 3NDKA 1RDAA 1BQNA 4CF9A 4CF2A 1SV5A 1TKZA 1X9SA 5HRNA 3OYMA 1KVCA 3BDPA 4FJXA 1ASVA 2IS3A 3LANA 3LDSA 3C94A 3MEDA 4H8KA 4OJRA 4MQ3A 3OYHA 1WSIA 3AVNA 3VQ8A 4O44A 3CFPA 3QEXA 2HNDA 4CJKA 3EZ5A 4N47A 1KRPA 1WN7A 1BL3A 4KTQA 1BIUA 2D0CA 3NHGA 4E1MA 1F21A 4Z4EA 2DY4A 2G8FA 2WONA 4DTSA 4B3OA 1S1VA 4DS5A 1TL1A 1JKHA 3KK2A 2O4GA 2G8KA 1WAJA 4FJ7A 3OYLA 2FBVA 4AHTA 1KSPA 2G8UA 1VSJA 3CQ8A 4B8AB 4CGDA 3LWMA 4CK1A 5FDLA 1L3VA 2B6AA 1ZYQA 1JLAA 1I39A 4HHTA 3NE6A 4FJLA 4B9VA 5K14A 3CFRA 3LZIA 1HYSA 4B9UA 3AVAA 1REVA 1FXXA 1S1XA 4WE1A 4CECA 1JLFA 3V9XA 4DTJA 1NJWA 1VRUA 4KHYA 1VSLA 1DTTA 1SKRA 4DU3A 4B9LA 3DLRA 2Z1GA 4FLVA 3OYIA 4JLHA 2JGUA 2KW4A 1J54A 4JS4A 4ICLA 4M3RA 3VQ5A 1HYZA 3SCXA 4E89A 2ATQA 4KPYA 4OKJA 1C0UA 3A2FA 3HP6A 3SUQA 1D9FA 1YTUA 4C8OA 1X9WA 4DSLA 1HQUA 4ZTJA 4RG8A 3OS1A 1U47A 1VSFA 1S9EA 3DMJA 3ISNC 5HRRA 3SYZA 4CEBA 4FJJA 2NUBA 4I9LA 4HUEA 3KKRA 4F2RA 1Z25A 4CJWA 4FVMA 1SUQA 1BCMA 4GVMA 4O55A 4CGGA 4FJMA 1C6VA 4M45A 4CHZA 1NKCA 5JS2A 1LWFA 4M3YA 3TABA 5KRSA 3K57A 1RILA 1RT3A 3HT3A 3EY1A 4AHVA 1N5YA 3B6OA 4AHRA 2JLEA 1LWEA 4F4KA 4KB0A 2IOCA 1JLCA 4B9SA 3M8RA 2PYJA 3TWHA 4AILC 2Y1IA 4CHNA 1IO2A 1ZBUA 4NYFA 2Z1HA 4CGFA 3O4QA 4CF0A 3SJJA 1YTAA 4O4GA 4FJGA 1RDCA 3VQ6A 4Z4FA 4H4OA 4CK2A 4OPKA 4ELVA 5CZ2A 3LPUA 1RTHA 3DLGA 1J5OA 1RBVA 4CFAA 2P1JA 1XHXA 2BANA 3NBPA 4FJKA 4M42A 2RN2A 3ALYA 1VSDA 3K5MA 2ZE2A 3ZSZA 4CE9A 4DFKA 2YNFA 3AVHA 4EP4A 4IBNA 3KJVA 3SPZA 1NK5A 1WSFA 2Y1JA 1RT4A 1S1UA 1L5UA 2OZMA 4FJ9A 4LD0A 4CFCA 1J53A 3V81A 4QOZB 1I3AA 3ZSWA 3MEEA 3ZSRA 1D8YA 4FW1A 3KKSA 3HPHA 4W5TA 2G8VA 4DSJA 4NCBA 2YNGA 4NCGA 4FZZA 4FXDA 1RT1A 1B92A 1FKPA 4KHSA 3ZT1A 2LSNA 3DI6A 3I0RA 4KTWA 4OPJA 2RPIA 2X78A 4CHYA 4KI6A 1RT7A 2X6SA 5I42A 3M8PA 4CHOA 4KREA 1B9DA 3KLGA 4AHUA 4N41A 3VQAA 5CYQA 3QERA 1N6QA 2B5JA 4Z4GA 3SQ4A 4IDKA 3TANA 4F3TA 4J2AA 1C1AA 3PX0A 3V1OA 4DSKA 1TAQA 3T19A 1Q8IA 3OYFA 4DTUA 2DFHA 3RMDA 2HHUA 3SUOA 4CEFA 4EZ6A 2FBYA 4DU1A 3RR7A 4E7HA 4GMJB 1S9GA 3L2UA 3C6TA 1O1WA 3NAEA 1CLQA 1EX4A 4DQQA 3AA3A 1ITGA 4C8LA 1U49A 1VSKA 4CEAA 3KLHA 2R7YA 1QSSA 3ITHA 3AO3A 4NCAA 4CJUA 4FLUA 4W5OA 2HHWA 3NGYA 4DTRA 3O3HA 1DLOA 4NYNA 4HVJA 3L2WA 1WNSA 1C1CA 4LSNA 4Y1DA 3DLKA 4FM2A 3OYBA 4KHWA 1BISA 5T7BA 1EXQA 1BI4B 3C6UA 4IFVA 4DTOA 4LSLA 1QTMA 4FLTA 3QO9A 2DFFA 2X74A 3OYEA 1S6PA 3AV9A 2VWKA 5KI6A 3OYNA 3TAMA 2BE2A 2XY7A 4CJ3A 3NF8A 2QXFA 4CEQA 2RF2A 1WSJA 3BGRA 1T8EA 3KTQA 4CIGA 5EU7A 3RRGA 4M3TA 2G8IA 3I0SA 2DTUA 1X1PA 4CF8A 3P1GA 4DQRA 4DTXA 3DM2A 2ZQBA 4C8NA 3V9UA 4DLEA 1VK0A 4TSXA 1TKXA 2G8HA 1RDBA 1D5AA 4E1NA 2F96A 3ZSYA 4N5SA 1U4BA 3IS9A 2QKKA 3AVGA 5CZ1A 3SNNA 2BGGA 5I3UA 4CFDA 4M3UA 2YV0X 3CFOA 3DRSA 2XO7A 2W42A 1C1BA 3VA0A 4CHQA 4RW4A 2PZSA 4FJNA 3AVLA 4Z4IA 3OYJA 2HHTA 3CYMA 4CIFA 3ZSQA 3AVFA 3DLBA 2PYLA 1HNVA 3DRPA 5KTQA 2P5GA 4BDPA 2A1SA 3ASMA 3SI6A 4KO0A 2HVIA 3DLEA 3NF6A 2DFEA 4DTNA 1WSHA 3KLIA 3SV4A 1BHLA 3OJSA 4FM0A 3PX4A 3S3NA 4I9QA 3HJFA 3ZSVA 4CK3A 3NCIA 4I7FA 4F2SA 3VQCA 4B08A 4E7LA 4CEDA 4CGJA 3RWUA 4FK2A 3SUPA 2I5JA 1ZBIA 3TI0A 4FLZA 4H4MA 1QE1A 1ASUA 3D45A 4HUGA 3TAGA 1TK8A 1SKSA 1NJXA 1RDDA 1TKTA 3P5JA 3K5LA 4DTMA 3V9ZA 4DFPA 4N76A 4JRPA 3KD5E 3SPYA 1WSEA 1KTQA 2YKMA 4YNQA 1X9MA 3QEPA 2VG5A 3HO1A 4BE2A 4IG3A 4K8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULD A;  2FBT A;  4PA1 A;  3TAF A;  1KLM A;  4HCB A;  1KCF A;  3THV A;  1S5J A;  2YNI A;  4W5N A;  3QEI A;  3G10 A;  4CJS A;  4QAG A;  3V1R A;  4Q0B A;  2IGI A;  3VQ4 A;  2HNZ A;  3L2V A;  3T1A A;  4KAZ A;  4CJL A;  1JLG A;  3AVM A;  3MXJ A;  4B9T A;  3F9K A;  3SQ0 A;  2KTQ A;  4ZTF A;  4I2P A;  1GOB A;  3WNG A;  3HYF A;  3KIO A;  3ZT3 A;  1ASW A;  5C42 A;  1NKB A;  2KZM A;  1JLE A;  1XWL A;  4PY5 A;  3NH2 A;  1GOC A;  2XY8 A;  2OPP A;  3NFA A;  4OKK A;  4DSE A;  3V6D A;  4N56 A;  1L3S A;  2BDP A;  4DS4 A;  3AO2 A;  4CGI A;  3DOL A;  3OJU A;  3OS0 A;  4W5R A;  3JSM A;  1BGX T;  3O3G A;  3DLH A;  2WOM A;  3AA2 A;  1NJZ A;  2A1R A;  3K5N A;  4FJI A;  2KFZ A;  4Q5V A;  1NK9 A;  1KVB A;  1RBS A;  4M41 A;  4Z4H A;  4ELU A;  1SL2 A;  4DWI A;  3RMA A;  3OYD A;  5KGW A;  3PY8 A;  3L2R A;  3DYA A;  3LPT A;  3SUN A;  1J9A A;  4YFU A;  4DTP A;  3TAR A;  4B9N A;  4CJ4 A;  1S1T A;  3SQ1 A;  2HB5 A;  3QNO A;  1L3U A;  4HTU A;  3SQ2 A;  1NKE A;  4DQI A;  1A5V A;  4EP5 A;  2Q3S A;  3NF7 A;  5J2Q A;  3FFI A;  1ZBL A;  2HHV A;  5E41 A;  4FLW A;  4E0D A;  3LP1 A;  4DF4 A;  1UA0 A;  3IAY A;  3M8Q A;  2HHS A;  4FCY A;  3L2Q A;  1TGO A;  4FLY A;  4KI4 A;  1IH7 A;  4RW7 A;  4CES A;  5SWM A;  4ELT A;  2QK9 A;  1IKV A;  3AO1 A;  4OGC A;  2YKN A;  4CJV A;  1HMV A;  3LZJ A;  4O0J A;  4RW6 A;  5CY4 A;  4FK4 A;  3VQQ A;  3HP9 A;  1U48 A;  3U3Y A;  4KHU A;  4CJP A;  3U6F A;  4CFB A;  4GW6 A;  3LWL A;  4M3Z A;  4KFB A;  2KFN A;  4ID1 A;  3AO4 A;  1RCH A;  2Z1I A;  4Z4C A;  1WAF A;  1JL1 A;  1R0A A;  2D5R A;  2ZD1 A;  1FKO A;  2OPQ A;  4BWM A;  3NGZ A;  3K59 A;  3VQB A;  4JS5 A;  4XIU A;  3I8D A;  4DFM A;  2E4L A;  3PO4 A;  4F8R A;  1RNH A;  2YHB A;  2D0B A;  1BI4 A;  3CG7 A;  3L3V A;  4LY7 A;  4DG1 A;  1XC9 A;  1NK0 A;  1VRT A;  3E01 A;  5DK5 A;  4LH4 A;  3WNE A;  3QLH A;  3ZSX A;  3NH0 A;  2G8W A;  1TAU A;  3KLF A;  3HK2 A;  3QIN A;  4CF1 A;  4OKE A;  5KGX A;  5J2N A;  1SL1 A;  3DOK A;  2HHX A;  2IDO A;  3TR8 A;  3QET A;  4C8M A;  2IAJ A;  3PO5 A;  3B6P A;  3H08 A;  3OYK A;  1KFS A;  4CJT A;  3HM9 A;  3QIP A;  4FJ8 A;  4CJR A;  3T3F A;  5DMR A;  1BCO A;  2PY5 A;  4FM1 A;  1RT5 A;  3D0P A;  1FK9 A;  4ZHR A;  1LV5 A;  1RT2 A;  2KZZ A;  1RTD A;  1S1W A;  1RT6 A;  4AH9 A;  1RTI A;  2FC0 A;  1TV6 A;  3AVC A;  2VG6 A;  5HRP A;  1NK6 A;  1A5W A;  2HW3 A;  1CZB A;  1VSE A;  4J2E A;  5FRO A;  5CYM A;  3HVT A;  1RBR A;  5J1E A;  1VSH A;  1WLJ A;  4JRQ A;  3UIQ A;  1C0T A;  4RW9 A;  2Z1J A;  2FBX A;  2VWJ A;  3QEV A;  4CGH A;  3DRR A;  4PUO A;  4R5P A;  3S3M A;  3SV3 A;  4IG0 A;  4W5Q A;  1HJR A;  2F8T A;  3NGI A;  4KKO A;  4QCL A;  2OPS A;  4DFJ A;  3PV8 A;  3ZT0 A;  3AVI A;  3HST B;  3VQE A;  1JLQ A;  3AVB A;  1IKW A;  2QKB A;  3C95 A;  1QSL A;  1UOC A;  4CJF A;  4PWD A;  1B9F A;  4F3O A;  5J2P A;  3EYZ A;  3KK1 A;  3VQ9 A;  5C25 A;  2XY6 A;  4IKF A;  4KHN A;  4UQG A;  2HVH A;  3WNF A;  3V9W A;  1G15 A;  2KQ2 A;  4L8R B;  3VQP A;  4G1Q A;  3VA3 A;  3SZ2 A;  1IG9 A;  3RR8 A;  1QSY A;  1WSG A;  2O4I A;  4CJQ A;  4BE1 A;  4CEZ A;  5HP1 A;  3O3F A;  3TAQ A;  3K58 A;  4DQP A;  3IG1 A;  5HRS A;  3V1Q A;  4Z0U A;  4FJ5 A;  4AHC A;  1TVR A;  3AVK A;  3VQ7 A;  3ZSO A;  3QNN A;  3LP2 A;  2RKI A;  4K8X A;  4BE0 A;  3JYT A;  3HPG A;  2ETJ A;  4BWJ A;  1HYV A;  4BDZ A;  3QES A;  1K6Y A;  2EHG A;  3CM5 A;  4BAC A;  3RMC A;  3AO5 A;  3G0Z A;  3VQD A;  1NOY A;  4ID5 A;  4E19 A;  4DU4 A;  4HCC A;  3RTV A;  5JS1 A;  4CIE A;  2OA8 A;  1XHZ A;  1RTJ A;  3LP0 A;  3AVJ A;  1CXU A;  5HBM A;  3OY9 A;  4DF8 A;  3LAL A;  4O5B A;  3M8S A;  3CM6 A;  3PX6 A;  1LW0 A;  3WNH A;  4RW8 A;  1HNI A;  3O4N A;  3RMB A;  3NF9 A;  4FJH A;  1LAW A;  1T05 A;  3OVN A;  1CXQ A;  1Y97 A;  2B4J A;  2XY5 A;  2ITG A;  5D3G A;  2GBZ A;  3L3U A;  3PUF A;  5KRT A;  3QIO A;  3L8B A;  1VSI A;  3MXM A;  1QQC A;  4OVL A;  3HL8 A;  3P83 D;  3S9H A;  3KLE A;  3K5O A;  3MAQ A;  2E6M A;  4CER A;  4FYD A;  4CHP A;  1HRH A;  4OLB A;  4PQU A;  4OLA A;  4DQS A;  1UA1 A;  3AA5 X;  2HMI A;  4E7J A;  4I2Q A;  1BQM A;  1YT3 A;  4J2D A;  4LH5 A;  2P51 A;  1LWC A;  5C24 A;  1JL2 A;  4KB1 A;  1QHT A;  3LP3 A;  2VG7 A;  3HPO A;  1RBT A;  4KHQ A;  1MU2 A;  4DSF A;  3RRH A;  4M3X A;  1HPZ A;  1VSM A;  5J2M A;  1A5X A;  1YVU A;  2E6L A;  1LW2 A;  1NK4 A;  1BIZ A;  5HLF A;  3KK3 A;  4Y1C A;  1CZ9 A;  3LAK A;  1KVA A;  1Z26 A;  3MEG A;  3HVR A;  1L3T A;  2GUI A;  1W9H A;  1NJY A;  3AA4 A;  1HQE A;  4CJ5 A;  4CCH A;  4FW2 A;  4EZ9 A;  3HXM A;  1KLN A;  2YHA A;  3MEC A;  3OYA A;  1JXB A;  4B8C A;  3TAP A;  2OPR A;  3S3O A;  2HNY A;  3ZT4 A;  1EET A;  4KV8 A;  3V4I A;  1EKE A;  5HRO A;  1UWB A;  2X6N A;  1D9D A;  2D0A A;  1IKY A;  4C8K A;  2OZS A;  1S6Q A;  1U45 A;  1KFD A;  1NK8 A;  4KTZ A;  2XRI A;  4HUF A;  1RBU A;  3OYC A;  4AHS A;  1TK5 A;  3KD1 E;  4FZX C;  2YNH A;  5FRM A;  1Q9X A;  3ZT2 A;  3VN5 A;  4OGE A;  3F73 A;  4DSI A;  1DTQ A;  3TAE A;  1C0M A;  1ZBF A;  4M3W A;  2GV9 A;  4KRF A;  2IC3 A;  1TK0 A;  4MFB A;  4O0I A;  4BDY A;  2AJQ A;  4CEO A;  3LAM A;  1IKX A;  1W0H A;  3U3G A;  3V9S A;  1JXE A;  3ZCM A;  4DMN A;  1NOZ A;  1EP4 A;  3OS2 A;  1LAV A;  3MXI A;  1T03 A;  3QEW A;  2XHB A;  4FLX A;  2F8S A;  2OYQ A;  1TL3 A;  4J2B A;  1TKD A;  2HHQ A;  3OYG A;  4CJE A;  4FK0 A;  1U04 A;  5SZT A;  4E7K A;  1SL0 A;  1UAX A;  1JLB A;  1T7P A;  1SKW A;  4CEE A;  4FZY A;  1Q9Y A;  4IFY A;  4B9M A;  3NH1 A;  4DLG A;  1ZBH A;  3K2P A;  2EX3 A;  2P5O A;  5FRN A;  4E3S A;  1XI1 A;  1NK7 A;  4E7I A;  3IRX A;  1QS4 A;  1GOA A;  3NDK A;  1RDA A;  1BQN A;  4CF9 A;  4CF2 A;  1SV5 A;  1TKZ A;  1X9S A;  5HRN A;  3OYM A;  1KVC A;  3BDP A;  4FJX A;  1ASV A;  2IS3 A;  3LAN A;  3LDS A;  3C94 A;  3MED A;  4H8K A;  4OJR A;  4MQ3 A;  3OYH A;  1WSI A;  3AVN A;  3VQ8 A;  4O44 A;  3CFP A;  3QEX A;  2HND A;  4CJK A;  3EZ5 A;  4N47 A;  1KRP A;  1WN7 A;  1BL3 A;  4KTQ A;  1BIU A;  2D0C A;  3NHG A;  4E1M A;  1F21 A;  4Z4E A;  2DY4 A;  2G8F A;  2WON A;  4DTS A;  4B3O A;  1S1V A;  4DS5 A;  1TL1 A;  1JKH A;  3KK2 A;  2O4G A;  2G8K A;  1WAJ A;  4FJ7 A;  3OYL A;  2FBV A;  4AHT A;  1KSP A;  2G8U A;  1VSJ A;  3CQ8 A;  4B8A B;  4CGD A;  3LWM A;  4CK1 A;  5FDL A;  1L3V A;  2B6A A;  1ZYQ A;  1JLA A;  1I39 A;  4HHT A;  3NE6 A;  4FJL A;  4B9V A;  5K14 A;  3CFR A;  3LZI A;  1HYS A;  4B9U A;  3AVA A;  1REV A;  1FXX A;  1S1X A;  4WE1 A;  4CEC A;  1JLF A;  3V9X A;  4DTJ A;  1NJW A;  1VRU A;  4KHY A;  1VSL A;  1DTT A;  1SKR A;  4DU3 A;  4B9L A;  3DLR A;  2Z1G A;  4FLV A;  3OYI A;  4JLH A;  2JGU A;  2KW4 A;  1J54 A;  4JS4 A;  4ICL A;  4M3R A;  3VQ5 A;  1HYZ A;  3SCX A;  4E89 A;  2ATQ A;  4KPY A;  4OKJ A;  1C0U A;  3A2F A;  3HP6 A;  3SUQ A;  1D9F A;  1YTU A;  4C8O A;  1X9W A;  4DSL A;  1HQU A;  4ZTJ A;  4RG8 A;  3OS1 A;  1U47 A;  1VSF A;  1S9E A;  3DMJ A;  3ISN C;  5HRR A;  3SYZ A;  4CEB A;  4FJJ A;  2NUB A;  4I9L A;  4HUE A;  3KKR A;  4F2R A;  1Z25 A;  4CJW A;  4FVM A;  1SUQ A;  1BCM A;  4GVM A;  4O55 A;  4CGG A;  4FJM A;  1C6V A;  4M45 A;  4CHZ A;  1NKC A;  5JS2 A;  1LWF A;  4M3Y A;  3TAB A;  5KRS A;  3K57 A;  1RIL A;  1RT3 A;  3HT3 A;  3EY1 A;  4AHV A;  1N5Y A;  3B6O A;  4AHR A;  2JLE A;  1LWE A;  4F4K A;  4KB0 A;  2IOC A;  1JLC A;  4B9S A;  3M8R A;  2PYJ A;  3TWH A;  4AIL C;  2Y1I A;  4CHN A;  1IO2 A;  1ZBU A;  4NYF A;  2Z1H A;  4CGF A;  3O4Q A;  4CF0 A;  3SJJ A;  1YTA A;  4O4G A;  4FJG A;  1RDC A;  3VQ6 A;  4Z4F A;  4H4O A;  4CK2 A;  4OPK A;  4ELV A;  5CZ2 A;  3LPU A;  1RTH A;  3DLG A;  1J5O A;  1RBV A;  4CFA A;  2P1J A;  1XHX A;  2BAN A;  3NBP A;  4FJK A;  4M42 A;  2RN2 A;  3ALY A;  1VSD A;  3K5M A;  2ZE2 A;  3ZSZ A;  4CE9 A;  4DFK A;  2YNF A;  3AVH A;  4EP4 A;  4IBN A;  3KJV A;  3SPZ A;  1NK5 A;  1WSF A;  2Y1J A;  1RT4 A;  1S1U A;  1L5U A;  2OZM A;  4FJ9 A;  4LD0 A;  4CFC A;  1J53 A;  3V81 A;  4QOZ B;  1I3A A;  3ZSW A;  3MEE A;  3ZSR A;  1D8Y A;  4FW1 A;  3KKS A;  3HPH A;  4W5T A;  2G8V A;  4DSJ A;  4NCB A;  2YNG A;  4NCG A;  4FZZ A;  4FXD A;  1RT1 A;  1B92 A;  1FKP A;  4KHS A;  3ZT1 A;  2LSN A;  3DI6 A;  3I0R A;  4KTW A;  4OPJ A;  2RPI A;  2X78 A;  4CHY A;  4KI6 A;  1RT7 A;  2X6S A;  5I42 A;  3M8P A;  4CHO A;  4KRE A;  1B9D A;  3KLG A;  4AHU A;  4N41 A;  3VQA A;  5CYQ A;  3QER A;  1N6Q A;  2B5J A;  4Z4G A;  3SQ4 A;  4IDK A;  3TAN A;  4F3T A;  4J2A A;  1C1A A;  3PX0 A;  3V1O A;  4DSK A;  1TAQ A;  3T19 A;  1Q8I A;  3OYF A;  4DTU A;  2DFH A;  3RMD A;  2HHU A;  3SUO A;  4CEF A;  4EZ6 A;  2FBY A;  4DU1 A;  3RR7 A;  4E7H A;  4GMJ B;  1S9G A;  3L2U A;  3C6T A;  1O1W A;  3NAE A;  1CLQ A;  1EX4 A;  4DQQ A;  3AA3 A;  1ITG A;  4C8L A;  1U49 A;  1VSK A;  4CEA A;  3KLH A;  2R7Y A;  1QSS A;  3ITH A;  3AO3 A;  4NCA A;  4CJU A;  4FLU A;  4W5O A;  2HHW A;  3NGY A;  4DTR A;  3O3H A;  1DLO A;  4NYN A;  4HVJ A;  3L2W A;  1WNS A;  1C1C A;  4LSN A;  4Y1D A;  3DLK A;  4FM2 A;  3OYB A;  4KHW A;  1BIS A;  5T7B A;  1EXQ A;  1BI4 B;  3C6U A;  4IFV A;  4DTO A;  4LSL A;  1QTM A;  4FLT A;  3QO9 A;  2DFF A;  2X74 A;  3OYE A;  1S6P A;  3AV9 A;  2VWK A;  5KI6 A;  3OYN A;  3TAM A;  2BE2 A;  2XY7 A;  4CJ3 A;  3NF8 A;  2QXF A;  4CEQ A;  2RF2 A;  1WSJ A;  3BGR A;  1T8E A;  3KTQ A;  4CIG A;  5EU7 A;  3RRG A;  4M3T A;  2G8I A;  3I0S A;  2DTU A;  1X1P A;  4CF8 A;  3P1G A;  4DQR A;  4DTX A;  3DM2 A;  2ZQB A;  4C8N A;  3V9U A;  4DLE A;  1VK0 A;  4TSX A;  1TKX A;  2G8H A;  1RDB A;  1D5A A;  4E1N A;  2F96 A;  3ZSY A;  4N5S A;  1U4B A;  3IS9 A;  2QKK A;  3AVG A;  5CZ1 A;  3SNN A;  2BGG A;  5I3U A;  4CFD A;  4M3U A;  2YV0 X;  3CFO A;  3DRS A;  2XO7 A;  2W42 A;  1C1B A;  3VA0 A;  4CHQ A;  4RW4 A;  2PZS A;  4FJN A;  3AVL A;  4Z4I A;  3OYJ A;  2HHT A;  3CYM A;  4CIF A;  3ZSQ A;  3AVF A;  3DLB A;  2PYL A;  1HNV A;  3DRP A;  5KTQ A;  2P5G A;  4BDP A;  2A1S A;  3ASM A;  3SI6 A;  4KO0 A;  2HVI A;  3DLE A;  3NF6 A;  2DFE A;  4DTN A;  1WSH A;  3KLI A;  3SV4 A;  1BHL A;  3OJS A;  4FM0 A;  3PX4 A;  3S3N A;  4I9Q A;  3HJF A;  3ZSV A;  4CK3 A;  3NCI A;  4I7F A;  4F2S A;  3VQC A;  4B08 A;  4E7L A;  4CED A;  4CGJ A;  3RWU A;  4FK2 A;  3SUP A;  2I5J A;  1ZBI A;  3TI0 A;  4FLZ A;  4H4M A;  1QE1 A;  1ASU A;  3D45 A;  4HUG A;  3TAG A;  1TK8 A;  1SKS A;  1NJX A;  1RDD A;  1TKT A;  3P5J A;  3K5L A;  4DTM A;  3V9Z A;  4DFP A;  4N76 A;  4JRP A;  3KD5 E;  3SPY A;  1WSE A;  1KTQ A;  2YKM A;  4YNQ A;  1X9M A;  3QEP A;  2VG5 A;  3HO1 A;  4BE2 A;  4IG3 A;  4K8Z A; 
#chains in the Genus database with same CATH topology
 3ULD A;  3TAF A;  1K9M O;  3G10 A;  4Q0B A;  2IGI A;  3T1A A;  4B3R K;  4KAZ A;  1GOB A;  3HYF A;  3KIO A;  5C42 A;  3WXK A;  1BO5 O;  3P39 A;  1JLE A;  1XWL A;  4PY5 A;  2XY8 A;  2GTD A;  3WUH A;  5AQV A;  3OJU A;  2D0O A;  4W5R A;  3JSM A;  4DV5 K;  1NJZ A;  3TTF A;  3BZC A;  4H5T A;  4PKH A;  1KVB A;  1RBS A;  4Z4H A;  2OCE A;  3CJ7 A;  4JKG B;  3OYD A;  3PY8 A;  4JI1 K;  3TAR A;  5LY3 A;  3PLA A;  3IDH A;  4B9N A;  4O8K A;  3GDQ A;  4IO9 L;  2HB5 A;  3CJC A;  3QNO A;  3SQ2 A;  1NKE A;  4DQI A;  3UB5 A;  3H3O B;  5E41 A;  4E0D A;  3O1B A;  3IAY A;  2HHS A;  4GKK K;  4FLY A;  3VEN A;  3CJB A;  1Q82 O;  2A41 A;  4O0J A;  5CY4 A;  4FK4 A;  2W40 A;  1RDW X;  4DV7 K;  1NMD A;  2A40 A;  1P8Z A;  4Z4C A;  2QWP A;  3O8M A;  3T69 A;  2OPQ A;  3VQB A;  2QWQ A;  4DFM A;  5H1S Q;  1MDU B;  3VF6 A;  2D0B A;  3CG7 A;  4LY7 A;  4DG1 A;  5LMU K;  3WNE A;  3E01 A;  5DK5 A;  3T7Z A;  4BVO A;  3QLH A;  3NH0 A;  3KLF A;  3HK2 A;  3A5L C;  3LDL A;  4OKE A;  5KGX A;  1OH6 A;  2VGN A;  3QET A;  3WXJ A;  1BU6 O;  3MWT A;  3HM9 A;  3F2K A;  4FJ8 A;  4CJR A;  4XH1 A;  3FLC O;  1RT5 A;  3QML A;  4O8U A;  4ILG B;  1RTD A;  1RTI A;  1TV6 A;  3HOS A;  1JCE A;  4FVU A;  1CZB A;  5HL7 L;  5J1E A;  1BA0 A;  3CER A;  3MWP A;  1C0G A;  3THY A;  1WLJ A;  4JEP A;  1NWK A;  5AR0 A;  3QEV A;  2FSJ A;  4PUO A;  4R5P A;  3ID6 A;  3CIP A;  3D2F A;  3NGI A;  4KKO A;  5GAG P;  2OPS A;  4DFJ A;  4ISG A;  1YHQ N;  3CD6 N;  3HST B;  1IKW A;  2QKB A;  3C95 A;  3L6Q A;  1IJJ A;  4CJF A;  3CCM N;  4WF9 L;  3EO3 A;  5J2P A;  1YJ9 N;  2W41 A;  2XY6 A;  2UU9 K;  4O5F A;  4A61 A;  4L8R B;  3VA3 A;  3CCL N;  2O4I A;  3TPQ A;  5HP1 A;  5HRS A;  3V1Q A;  4M63 C;  3ENB A;  1CZA N;  3A8Y A;  3QNN A;  1WOQ A;  2RKI A;  2E2Q A;  3B8A X;  3HPG A;  5AQZ A;  2EHG A;  4ID5 A;  1W2B M;  4HCC A;  1EWQ A;  3RTV A;  5JS1 A;  4BG8 A;  4DF8 A;  3W0L A;  2QA4 N;  5B8H A;  3LAL A;  1Q7Y O;  1VQ5 N;  2O8C B;  4X64 K;  1M90 O;  1HNI A;  3F9M A;  4J8F A;  5GAD P;  5D3G A;  2HHH K;  3L8B A;  3MXM A;  1QQC A;  4OVL A;  2E2N A;  2ASP A;  3K5O A;  1EWR A;  5BRE A;  4FYD A;  4A59 A;  4CHP A;  5JVH L;  3BZK A;  4V19 S;  4H5W A;  2P51 A;  3F5T A;  4KHQ A;  1NGA A;  1HPZ A;  4C1N I;  5J2M A;  1A5X A;  2E6L A;  1LW2 A;  4WFN L;  3U9D A;  4OPA A;  5GAE P;  3MEG A;  1L3T A;  3O9Q A;  1W9H A;  4FW2 A;  4QS9 A;  3C6A A;  1JXB A;  2QTD A;  4B8C A;  3TAP A;  2IIR A;  2OPR A;  4DV1 K;  4C8K A;  4BRL A;  2QEX N;  4JKH A;  3VOV A;  3OYC A;  1TK5 A;  3KD1 E;  2YNH A;  4DB3 A;  1KQS M;  4NLB A;  1TK0 A;  4MFB A;  1ILY A;  1DT9 A;  3CQX A;  3H3N O;  2F9W A;  3U3G A;  3V9S A;  2GWJ A;  3A5M C;  4DMN A;  1EP4 A;  1LAV A;  2F8S A;  3OYG A;  3CHW A;  1U04 A;  1ATS A;  3SJH A;  3CCQ N;  4X66 K;  4B9M A;  4DLG A;  1XI1 A;  4JI5 K;  1NK7 A;  4F9O A;  1GOA A;  3NDK A;  4CF2 A;  4ILH A;  2A3Z A;  3AGK A;  3C94 A;  3MED A;  4H8K A;  1MWK A;  4LFB K;  3OYH A;  4WYB A;  3VQ8 A;  3O9R A;  3CQY A;  4IDH A;  3CFP A;  3EZ5 A;  4N47 A;  4NXN K;  2QWM A;  2ITM A;  1RFQ A;  3FZH A;  1NGG A;  3O9S A;  5DM6 L;  3DJC A;  3OYL A;  4JI3 K;  4AHT A;  3P38 A;  1VSJ A;  4BQZ A;  4CGD A;  3O08 A;  3I8B A;  1ZYQ A;  3NE6 A;  3SBT A;  3VEX A;  3LZI A;  4B9V A;  4B9U A;  3V9X A;  4CD1 A;  3U8X A;  1NJW A;  1VRU A;  3THX A;  1DTT A;  3PSF A;  3G6E N;  2JGU A;  3SAG A;  4ICL A;  4M3R A;  3VQ5 A;  1HYZ A;  3G25 A;  3HP6 A;  5AZI A;  3SUQ A;  1VQ4 N;  2KLA A;  1VQ8 N;  1U47 A;  2UUA K;  5HRR A;  5MLC Q;  1TYQ B;  1Z6R A;  4FVM A;  1SUQ A;  1BCM A;  4O55 A;  2VWB A;  1BDG A;  4CGG A;  1C6V A;  1NKC A;  4EHU A;  1XMO K;  1RT3 A;  1IV0 A;  5AFU H;  4AHV A;  3B6O A;  4AHR A;  4IEI A;  4PL8 A;  1Q86 O;  3TWH A;  4AIL C;  4JHD B;  3O4Q A;  1YTA A;  3VTH A;  2Q31 A;  2UUB K;  2P9N A;  4FO0 A;  1J5O A;  4M7Y A;  5LJW A;  2QXL A;  3ZLJ A;  4IOA L;  4B1Y B;  2GX9 A;  3MX2 A;  3NBP A;  3UKU A;  3K5M A;  3ATV A;  2ZE2 A;  4CE9 A;  2YNF A;  5AQJ A;  1WSF A;  2Y1J A;  3EE8 A;  3EKU A;  2V7Z A;  3VPZ A;  4AQY K;  4LD0 A;  2GEM A;  5AQW A;  4NCB A;  4FW1 A;  4DSJ A;  4HTL A;  2G8V A;  3EN9 A;  4FZZ A;  4FXD A;  5JMV A;  3I55 N;  3ZT1 A;  5KPR A;  2RPI A;  5I42 A;  2X6S A;  3M8P A;  2YHW A;  4CHO A;  4N41 A;  3VQA A;  5CYQ A;  3QER A;  1NGI A;  2B5J A;  4Z4G A;  3CPW M;  4J2A A;  1C1A A;  3IFR A;  4JKA A;  4CZH A;  3I56 N;  1Q8I A;  3OYF A;  5BN8 A;  4EZ6 A;  4DU1 A;  3CCJ N;  1T6C A;  1CLQ A;  1EX4 A;  4BC5 A;  4PHT X;  1QSS A;  4BRD A;  3NGY A;  3ZET A;  3L4Q A;  4NYN A;  1V4S A;  3L2W A;  1WNS A;  4JD2 B;  4RWT A;  2O8D A;  4Y1D A;  1T44 A;  4H0O A;  4IFV A;  3QO9 A;  2ZJQ L;  2DFF A;  2X74 A;  3KK7 A;  5AQG A;  5KI6 A;  3TAM A;  2HBJ A;  2QXF A;  2RF2 A;  3BGR A;  2DTU A;  3RRG A;  1K8K B;  3I0S A;  1X1P A;  4JI2 K;  4BC2 A;  4TSX A;  2G8H A;  1RDB A;  4N5S A;  2NRT A;  3IS9 A;  3AVG A;  5CZ1 A;  4CFD A;  5GIP A;  3AY9 A;  2YV0 X;  4YOR A;  1C1B A;  2WFB A;  4CHQ A;  4CBU A;  2Q1N A;  3E9L A;  2PZS A;  1N36 K;  4FJN A;  4CIF A;  4H0P A;  4BDP A;  4ILJ A;  2HVI A;  2E5L K;  4DTN A;  4B1V A;  1BHL A;  4FM0 A;  3PX4 A;  3HJF A;  4I9Q A;  1V4T A;  1NM1 A;  2HST A;  4I7F A;  1ATR A;  4E7L A;  3RWU A;  3SUP A;  2I5J A;  5M1K A;  3TI0 A;  4GKJ K;  3RVC A;  4B1X B;  3TAG A;  3U4L A;  1YJN N;  3K5L A;  3V9Z A;  3KD5 E;  4B1W B;  4YNQ A;  3SPY A;  1X9M A;  5KPZ A;  1HLU A;  3VEO A;  1S5J A;  3HRG A;  3ZX3 A;  4CJS A;  3L2V A;  1EO1 A;  1JLG A;  3UKR A;  2P9K B;  2KTQ A;  4ZTF A;  4I2P A;  4JKD A;  3ZT3 A;  1ASW A;  1HKC A;  1NKB A;  2KZM A;  3O9T A;  5BN9 A;  3PSI A;  5AQR A;  5BPN A;  3V6D A;  3EEQ A;  5BPL A;  3AO2 A;  3OS0 A;  1BGX T;  3DLH A;  3AA2 A;  5CHI A;  5FPD A;  1VQL N;  1HUX A;  2I7N A;  3K5N A;  1KXP A;  2KFZ A;  3GG4 A;  1NK9 A;  1X9J A;  2A6A A;  4WFA L;  1SL2 A;  3RMA A;  2ZM6 K;  3M3Z A;  1JCF A;  4YDU A;  4CJ4 A;  1L3U A;  3THW B;  1YUW A;  4EP5 A;  3NF7 A;  3VEY A;  3O9U A;  4AM6 A;  3Q7C A;  4DF4 A;  1IG8 A;  4FOE A;  4CES A;  2QK9 A;  3MMV A;  3AO1 A;  4RW6 A;  3VQQ A;  2P9U A;  4CJP A;  3U6F A;  4GW6 A;  4M3Z A;  4LF8 K;  3DAW A;  4BR7 A;  3S41 A;  1WAF A;  1JL1 A;  1FKO A;  2FXU A;  3NGZ A;  3K59 A;  2VQF K;  1RNH A;  3WXL A;  3ENH A;  1NK0 A;  5AQQ A;  1IBL K;  4A5B A;  3QIN A;  1JJ2 M;  1SL1 A;  4BRG A;  4FPB A;  2IAJ A;  3OA9 A;  4FM1 A;  4ZHR A;  1GLE G;  1RT2 A;  2O8E B;  2VG6 A;  5LMN K;  4J2E A;  4A2A A;  4EIA A;  1RBR A;  1VSH A;  3AGR A;  3UIQ A;  4RW9 A;  1SZ2 A;  1VQ9 N;  3PIO L;  3SV3 A;  1HJR A;  2F8T A;  3E66 A;  1SQK A;  3PV8 A;  2FSN A;  3AVI A;  3D2E B;  3QBW A;  4ISE A;  3VQE A;  3SAF A;  1W7A A;  2P9L A;  3V9W A;  2KQ2 A;  4G1Q A;  1IG9 A;  2O8F B;  3LL3 A;  1WSG A;  1S22 A;  3R3L A;  4KBO A;  4AHC A;  4CI6 A;  1R59 O;  1ZXO A;  3LP2 A;  4BE0 A;  3JYT A;  1RGI A;  4BWJ A;  1HYV A;  1K6Y A;  5HOO A;  3CM5 A;  4BAC A;  3RMC A;  3AO5 A;  2FF3 B;  3IUC A;  4E19 A;  4DU4 A;  2OA8 A;  2NRR A;  2UXB K;  4BG9 A;  1CXU A;  5HBM A;  2CGL A;  1X3N A;  3PX6 A;  1LW0 A;  4RW8 A;  4BRN A;  3O4N A;  1LAW A;  1GLL O;  2B4J A;  2XY5 A;  3MK6 A;  3L3U A;  4PL7 A;  1VSI A;  3J7Y P;  4JKF A;  1VQO N;  3ULE A;  2KHO A;  3KLE A;  4JN4 A;  4B3S K;  4DQS A;  4E7J A;  4DR2 K;  4I2Q A;  1BQM A;  4FWN A;  4LH5 A;  5C24 A;  1LWC A;  3EZW A;  4M7X A;  5C15 A;  2VG7 A;  1MU2 A;  3FE1 A;  3RRH A;  3VTI A;  2W6K A;  3LDN A;  3KK3 A;  1CZ9 A;  1Z26 A;  1VQ6 N;  4WQ4 A;  3AA4 A;  1HQE A;  4YOV A;  1MA9 B;  4IJA A;  2HNY A;  3U9Z A;  1EET A;  4KV8 A;  1XNQ K;  1Z05 A;  5HRO A;  2O8B B;  1D9D A;  2D0A A;  1IKY A;  1NGJ A;  1C0F A;  1S6Q A;  1KFD A;  1YF5 L;  3VEW A;  3MCA B;  4HUF A;  2QWN A;  4AHS A;  4FZX C;  3G71 N;  2FLO A;  1Q9X A;  3F73 A;  4DSI A;  3TAE A;  1C0M A;  1ZBF A;  5TKY A;  2GV9 A;  1NGB A;  4KRF A;  2IC3 A;  4O0I A;  4BDY A;  1OKJ A;  4CEO A;  1IKX A;  1W0H A;  3A0I X;  4K43 A;  3ZCM A;  3BEX A;  1NOZ A;  3MXI A;  4YY3 K;  4ISF A;  5LJV A;  4E7K A;  1UAX A;  3BP8 A;  1T7P A;  4L3Q A;  4IXC A;  5KQ8 A;  5FRN A;  4IZ9 A;  4BR5 A;  4I6M B;  1SV5 A;  3OYM A;  1ASV A;  2W6L A;  2A5X A;  3VER A;  1QHA A;  2RE2 A;  4O44 A;  5AQK A;  4CJK A;  3SAH A;  3M1F A;  3NHG A;  1DGK N;  4H5R A;  4E1M A;  2D0P A;  2G8F A;  4B3O A;  5GIO A;  2HOE A;  5FPE A;  2G8K A;  1ESV A;  2UXD K;  3L0Q A;  4BGA A;  2B6A A;  1GLF O;  1JLA A;  1I39 A;  3MDQ A;  4B1U B;  5K14 A;  1HYS A;  3AVA A;  4DTJ A;  4CEC A;  5ADX A;  4K25 A;  5M1Q A;  2ZF5 O;  4LF5 K;  1VSL A;  4B9L A;  3DLR A;  2Z1G A;  3W3D A;  1YJW N;  4FLV A;  5BRH A;  4FWK A;  1YVN A;  5I9E B;  3IKM A;  4G9Z A;  3VEV A;  2UXC K;  3DXM B;  1X9W A;  4RG8 A;  3OS1 A;  3RSE B;  1S9E A;  2QM1 A;  4FSV A;  3SYZ A;  3Q7B A;  4FJJ A;  3KKR A;  3FGU A;  3WT0 A;  3K57 A;  1E3M A;  2JLE A;  1LWE A;  3NMU A;  1HNX K;  3IMX A;  2IOC A;  1JLC A;  3M8R A;  4JHD A;  2PYJ A;  2Y1I A;  4CHN A;  1VQN N;  4CBX A;  4CGF A;  3SJJ A;  4O4G A;  1RDC A;  3VQ6 A;  4Z4F A;  4H4O A;  3O6W A;  2E1Y A;  5EVZ A;  3LPU A;  1XMQ K;  4H0Y B;  3CMA N;  2D4W A;  3P4I A;  4M42 A;  3KHY A;  2RN2 A;  5JLF A;  3ZSZ A;  1NJI O;  4DFK A;  1NK5 A;  2P9I B;  3AVH A;  3N4Q A;  1L5U A;  4FJ9 A;  1O13 A;  3R8E A;  4QOZ B;  3ZSW A;  3MEE A;  3ZSR A;  3HPH A;  2YNG A;  1RT1 A;  3C7N A;  4DR3 K;  1B92 A;  1FKP A;  3SMP A;  1BG3 A;  4IOC L;  2LSN A;  3I0R A;  4KTW A;  4OPJ A;  4KI6 A;  1RT7 A;  4KRE A;  3KLG A;  2P9P A;  4DUZ K;  4JK7 A;  3SQ4 A;  4XH4 A;  4IDK A;  3ID8 A;  3M5R A;  3H45 C;  1G99 A;  4DTU A;  2DFH A;  4GMJ B;  4BR4 A;  3L2U A;  1O1W A;  3NAE A;  2WTU A;  2WUS A;  4BRQ A;  3P31 A;  1VSK A;  5CE3 A;  2R7Y A;  4FWQ A;  1T3V A;  3DXK A;  4CJU A;  4FLU A;  4DTR A;  4OO1 J;  3CJ9 A;  1HX1 A;  1C1C A;  4B3M K;  4LSN A;  4FM2 A;  3OYB A;  2VCP A;  1BIS A;  1EXQ A;  3CI5 A;  4LSL A;  4WQ5 C;  3KWI A;  3FZL A;  3OYE A;  4DV0 K;  2VGM A;  5TKW A;  4BGB A;  3GE1 A;  3OYN A;  2BE2 A;  2XY7 A;  3NF8 A;  2QWO A;  4CEQ A;  2ZWH A;  3KTQ A;  2QWR A;  4CF8 A;  5F1X A;  2ZQB A;  4C8N A;  3V9U A;  3HBT A;  1TKX A;  1D5A A;  2F96 A;  3O1W A;  3SNN A;  3HI0 A;  2BGG A;  3CFO A;  3DRS A;  2W42 A;  3VA0 A;  1QVG M;  3CME N;  3LM9 A;  3AVL A;  1NGD A;  1HNV A;  5KTQ A;  2P5G A;  3ASM A;  2E2O A;  4YHH K;  3D2F B;  4QS8 A;  3KLI A;  3OJS A;  4CK3 A;  1ATN A;  4JKC A;  3VQC A;  4EHT A;  4CED A;  4FK2 A;  1ZBI A;  1TK8 A;  3D45 A;  4LF7 K;  1SKS A;  4X65 K;  3KZB A;  3R6M A;  4IO8 A;  2ZGY A;  5AQP A;  1WSE A;  2YKM A;  4E7I A;  3AAR A;  3A5N C;  4BE2 A;  4K8Z A;  2FBT A;  2J4R A;  4PA1 A;  1KLM A;  1KCF A;  3THV A;  3QEI A;  4QAG A;  2HBL A;  3ZX2 A;  1GLC G;  4B9T A;  3WNG A;  3UE5 A;  5AJ3 K;  4EAH D;  4YOW A;  2OPP A;  2NRH A;  3E1Y A;  4N56 A;  5ELZ A;  5BR8 K;  4CGI A;  4GV3 A;  3DOL A;  2AA4 A;  2WOM A;  4FJI A;  4Q5V A;  3AAQ A;  3E9P A;  4M41 A;  4ELU A;  5F0X A;  4AF1 A;  5KGW A;  3SUN A;  3LPT A;  4DTP A;  2FF6 A;  1S1T A;  4HTU A;  1NMN A;  1A5V A;  4CW7 B;  1ZBL A;  3M6G A;  4BY9 C;  1D4X A;  3LP1 A;  2BUP A;  3CJ1 A;  3L2Q A;  1TGO A;  4BR2 A;  4KI4 A;  1IH7 A;  5SWM A;  1IKV A;  2YI1 A;  4OGC A;  2YKN A;  4CJV A;  5GAH P;  1U48 A;  4KHU A;  3WEE A;  4KFB A;  4ID1 A;  3AO4 A;  3LDQ A;  2Z1I A;  2YHX A;  4CZF A;  1R0A A;  2D5R A;  1IBM K;  1W97 L;  1VHX A;  4BWM A;  4JS5 A;  3I8D A;  1OVQ A;  1LOT B;  2YJF A;  1BI4 A;  1XC9 A;  3WQT A;  3SMS A;  3ZSX A;  4B1Z A;  2G8W A;  4U67 L;  4BVP A;  5JVG L;  4GY2 B;  4CF1 A;  2FSK A;  5J2N A;  4NO7 A;  4CD3 A;  4DR5 K;  1WUA A;  3VEZ A;  2HHX A;  2IDO A;  3TR8 A;  3B6P A;  3OYK A;  4YOT A;  4CJT A;  5DMR A;  2PY5 A;  3ZYY X;  2O8E A;  1FK9 A;  2KZZ A;  4BRA A;  2HW3 A;  5HRP A;  3AVC A;  1NK6 A;  1VSE A;  1XC3 A;  5FRO A;  1EQY A;  2P9S A;  4JRQ A;  1C0T A;  3BF1 A;  4BRE A;  2FBX A;  2VWJ A;  1VQK N;  3S3M A;  4IG0 A;  4W5Q A;  4QCL A;  2BH1 A;  3D2E A;  1JLQ A;  2YX6 A;  4PWD A;  1B9F A;  4F3O A;  3EYZ A;  5C25 A;  2Q2R A;  3WNF A;  2JWK A;  4Y0W A;  4YOX A;  4H5V A;  3RR8 A;  4JI8 K;  1QSY A;  4K42 A;  3SBG A;  4CJQ A;  4CZI A;  1NGH A;  2PAV A;  4DQP A;  2V7Y A;  4FJ5 A;  2IVP A;  1TVR A;  3ZSO A;  3THX B;  3QES A;  2CGK A;  3G0Z A;  3VQD A;  3WQU A;  3JXU A;  1XHZ A;  1HNW K;  3VF4 A;  3AVJ A;  5AZI B;  5ADX H;  1NNE A;  4O5B A;  3CM6 A;  5AZJ B;  3RMB A;  2YHY A;  1CXQ A;  1Y97 A;  4FL9 A;  4CZK A;  2GBZ A;  3ENO A;  3TSP A;  3P83 D;  3S9H A;  2E6M A;  4CER A;  1HRH A;  3CCR N;  4OLB A;  1HJO A;  5E84 A;  4PQU A;  1U2V B;  5AQM A;  1UA1 A;  4OLA A;  2JWL A;  4R79 A;  3OBY A;  4JKG A;  4J2D A;  4KB1 A;  3EL2 A;  1JL2 A;  3PIP L;  1HPM A;  1WB9 A;  3HPO A;  2NRX A;  2P9N B;  1YI2 N;  1YVU A;  4MDA A;  5AQT A;  4FWP A;  5AQH A;  1NK4 A;  5HLF A;  4Y1C A;  3UKU B;  3H1Q A;  3LAK A;  4WCE L;  3HVR A;  1NJY A;  4EZ9 A;  3J80 O;  3HXM A;  3MEC A;  3OYA A;  2OTJ N;  4BRC A;  1NGE A;  4CBW A;  4BC4 A;  3V4I A;  1EKE A;  1UWB A;  2OZS A;  1U45 A;  1IBK K;  3K9K A;  2XRI A;  5BRF A;  1OH7 A;  1GLD G;  3CCE N;  1SS6 A;  3ZT2 A;  4M3W A;  5GIN A;  3HTV A;  1GLA G;  3CET A;  2AJQ A;  1OH5 A;  3K9J A;  3LAM A;  4LF9 K;  4DV4 K;  4B9Q A;  1JXE A;  3MCP A;  2I7P A;  3QEW A;  2GEL A;  4A2B A;  1TL3 A;  2OYQ A;  2HHQ A;  1BA1 A;  5SZT A;  1GLB G;  1JLB A;  3LDO A;  4CEE A;  1Q9Y A;  4IFY A;  3ZET B;  3K2P A;  5C12 A;  1QVF M;  4DR6 K;  3IRX A;  1BQN A;  4CF9 A;  2O8D B;  1X9S A;  5KPT A;  3BDP A;  2IS3 A;  3LAN A;  1NU0 A;  4EFH A;  4OJR A;  4MQ3 A;  4LF4 K;  1WSI A;  2HBK A;  3AVN A;  5M1N A;  3I33 A;  1VQ7 N;  1BL3 A;  3J7Z O;  3L4I A;  1BIU A;  2D0C A;  4Z4E A;  1F21 A;  2DY4 A;  1DEJ A;  4DTS A;  1S1V A;  4DS5 A;  1TL1 A;  3KK2 A;  2O4G A;  4FJ7 A;  3DWL A;  1OH8 A;  4C1N K;  4AM7 A;  4LFC K;  3LWM A;  4CK1 A;  5FDL A;  4BRM A;  3LDP A;  2V51 B;  2PFU A;  1GLJ O;  1REV A;  1DKG D;  2OTL N;  1JLF A;  4XEI A;  3BUZ B;  4DU3 A;  3K0S A;  3QBX A;  4XH5 A;  2KW4 A;  1J54 A;  3CC2 N;  2F7T A;  2ATQ A;  4KPY A;  4OKJ A;  3DXM A;  3A2F A;  1YTU A;  4DSL A;  1HQU A;  3ZEU B;  2O8C A;  1VSF A;  1ZBS A;  4CEB A;  3VES A;  3H1V X;  4I9L A;  3CXC M;  4HUE A;  4F2R A;  4CJW A;  1N34 K;  3FR0 A;  4M45 A;  4CHZ A;  5JS2 A;  4M3Y A;  3TAB A;  3GOI A;  3HT3 A;  3EY1 A;  4KB0 A;  4KHP K;  4B9S A;  5EX5 A;  3UKR B;  1IO2 A;  1ZBU A;  4NYF A;  2Z1H A;  4CF0 A;  2GUP A;  4CK2 A;  4OPK A;  3DLG A;  1RBV A;  3TSQ A;  4U7B A;  2P1J A;  3ZX0 A;  3QIC A;  3TSU A;  3R9P A;  3ALY A;  3O5B A;  4DUY K;  2P9I A;  1XQS C;  3CPE A;  2UUC K;  3KJV A;  4JKB A;  1Y64 A;  1RT4 A;  1S1U A;  2OZM A;  5AQL A;  4CFC A;  1J53 A;  3V81 A;  1I3A A;  3NVK A;  4MDB A;  3FFK B;  1T6D A;  4DCH A;  4KHS A;  2OAN A;  3DI6 A;  4H0T B;  1LCU A;  4CHY A;  2G8I A;  3VGL A;  1B9D A;  5EY4 A;  4AHU A;  5BPM A;  3FZM A;  3N4P A;  2KKZ A;  4NB4 A;  1N6Q A;  3QFP A;  4F3T A;  3PX0 A;  3V1O A;  3T19 A;  3RMD A;  2HHU A;  2Q0U A;  4MLH A;  4OX9 K;  4DR4 K;  3C6T A;  1TUU A;  2P9U B;  5FPM A;  4DQQ A;  3AA3 A;  1N32 K;  2DPN A;  1U49 A;  4CEA A;  3KLH A;  3ITH A;  3AO3 A;  1BOT O;  5IWA K;  4NCA A;  1QQO A;  4W5O A;  2HMP A;  3O3H A;  1DLO A;  4BQL A;  4HVJ A;  1XNR K;  3CCU N;  1HKG A;  4KHW A;  5T7B A;  3C6U A;  4DTO A;  1QTM A;  4FLT A;  4BR0 A;  2WBN A;  3EKS A;  5AQY A;  2VWK A;  4CJ3 A;  4JI0 K;  3CJA A;  4CIG A;  4RCH A;  4FWS A;  3P1G A;  2WC9 A;  4DTX A;  4PKI A;  3CF5 L;  3MN7 A;  5M1F A;  3DLL L;  4DR7 K;  3ZSY A;  4DV2 K;  2QKK A;  1I94 K;  5I3U A;  1QZ6 A;  3WXI A;  4RW4 A;  3BF3 A;  3SK3 A;  4Z4I A;  3CYM A;  3AVF A;  1J6Z A;  2PYL A;  3DRP A;  3SI6 A;  4DKW A;  2CH6 A;  5FLX O;  2DFE A;  4H03 B;  2Q97 A;  1WSH A;  1X3M A;  1KAX A;  4BC3 A;  3NCI A;  2NRV A;  4CGJ A;  4A62 A;  4JYA K;  2P9L B;  4FLZ A;  4H4M A;  1ASU A;  4BRK A;  2IVO A;  1TKT A;  3P5J A;  4DTM A;  4K0K K;  1TYQ A;  4JRP A;  1KTQ A;  3HO1 A;  5EOY A;  4HCB A;  5F2R A;  1NGF A;  2YNI A;  4H5N A;  4W5N A;  3V1R A;  1QZ5 A;  3VQ4 A;  2HNZ A;  2YCH A;  3WXM B;  4CJL A;  3AVM A;  3MXJ A;  1XUP O;  3F9K A;  4BR9 A;  3SQ0 A;  5M1O A;  4GVE A;  1MWM A;  4CZL A;  2F4V K;  2HF3 A;  3NH2 A;  1GOC A;  2YJE A;  3NFA A;  4OKK A;  4DSE A;  1L3S A;  3RR7 A;  2BDP A;  4DS4 A;  4YDU C;  4MLE A;  4NXM K;  3JAM O;  3O3G A;  3ULE B;  2A1R A;  4H0X B;  4JK8 A;  5AQX A;  1OVY A;  4DWI A;  3L2R A;  3DYA A;  1J9A A;  4YFU A;  1J5E K;  4LFA K;  3SQ1 A;  2NNW A;  3H6E A;  4X62 K;  2Q3S A;  5J2Q A;  2HHV A;  3FFI A;  4B3T K;  4FLW A;  4RTF D;  2EWS A;  1UA0 A;  3M8Q A;  4FCY A;  4JAX A;  1QQN A;  3O80 A;  4RW7 A;  4ELT A;  3LZJ A;  3TTD A;  1HMV A;  3HP9 A;  3U3Y A;  1E4G T;  4CFB A;  3LWL A;  2KFN A;  1RCH A;  2ZD1 A;  4JD2 A;  4XIU A;  1HR0 K;  1BWF O;  3C0B A;  1FJG K;  2E4L A;  3PO4 A;  4F8R A;  5E26 A;  2YHB A;  4BRO A;  3L3V A;  4JK9 A;  1VRT A;  1TAU A;  4LH4 A;  2E8A A;  3VET A;  4BRH A;  4IWV A;  4GV6 A;  3TU5 A;  3DOK A;  2F9T A;  4C8M A;  3PO5 A;  5AQN A;  5AQF A;  3H08 A;  1K8K A;  1U6Z A;  1KFS A;  3QIP A;  3T3F A;  1BCO A;  3D0P A;  3J8A A;  1LV5 A;  1S1W A;  1RT6 A;  4AH9 A;  2FC0 A;  4KH6 A;  1A5W A;  3OBW A;  1K8A O;  5CYM A;  3HVT A;  3THY B;  2Z1J A;  4OPH A;  4CGH A;  3DRR A;  4WFB L;  1S3X A;  3FZF A;  3C6H A;  1HNZ K;  5FPN A;  3ZT0 A;  2VYP A;  3AVB A;  2AP1 A;  1QSL A;  1UOC A;  1JCG A;  1NGC A;  3KK1 A;  3VQ9 A;  4KHN A;  4IKF A;  1RDU A;  4UQG A;  2HVH A;  1YIT N;  1G15 A;  3VQP A;  3SZ2 A;  4BE1 A;  4CEZ A;  3O3F A;  3TAQ A;  3K58 A;  3IG1 A;  4Z0U A;  3VQ7 A;  3AVK A;  2CH5 A;  4K8X A;  2ETJ A;  4BDZ A;  1KD1 O;  1NOY A;  2P9K A;  1K73 O;  3D7E O;  4CIE A;  1RTJ A;  3LP0 A;  4DQ8 A;  3OY9 A;  1H1V A;  2ZJP L;  4LC9 B;  4FWO A;  5EXW A;  5AZJ A;  3M8S A;  3WNH A;  3JS6 A;  3MN6 A;  3NF9 A;  4FJH A;  1T05 A;  3OVN A;  4FPA A;  1QQM A;  3C65 A;  2ITG A;  3PUF A;  5KRT A;  3QIO A;  5AQU A;  3HL8 A;  1Q81 O;  2V52 B;  3MAQ A;  1U2V A;  3AA5 X;  3AAP A;  4DV3 K;  2HMI A;  1YT3 A;  2Q0R A;  5C0Y A;  4WQ4 C;  4QS7 A;  1QHT A;  4PKG A;  4JI4 K;  1KAZ A;  3QFU A;  3LP3 A;  1RBT A;  4DSF A;  4M3X A;  1VSM A;  3THW A;  5C2F A;  1BIZ A;  4JI7 K;  1KVA A;  4FWL A;  2GUI A;  4CCH A;  3QB0 A;  4CJ5 A;  1TUY A;  3J81 O;  1KC8 O;  4CZE A;  1KLN A;  2YHA A;  4KH5 A;  1P90 A;  3S3O A;  4CZM A;  3ZT4 A;  4A5A A;  2X6N A;  4JI6 K;  3C7N B;  2E1Z A;  3HSC A;  2QW9 A;  4YOU A;  5LL6 Z;  1NK8 A;  2HF4 A;  5IT9 O;  4KTZ A;  3OTO K;  1RBU A;  5FRM A;  2P9P B;  2NZT A;  3VN5 A;  4OGE A;  1DTQ A;  3GBT A;  4H0V B;  1S72 N;  5C2D A;  4CJ7 A;  3OS2 A;  1T03 A;  2XHB A;  4FLX A;  4J2B A;  1TKD A;  4FK0 A;  4CJE A;  1SL0 A;  4FWR A;  5AQI A;  1SKW A;  4FZY A;  2E20 A;  3DXK B;  3E9O A;  3NH1 A;  1ZBH A;  2EX3 A;  2P5O A;  4E3S A;  1QS4 A;  1RDA A;  1TKZ A;  5HRN A;  4FJX A;  1KVC A;  2CGJ A;  3LDS A;  3CCS N;  1NBW A;  3QEX A;  4MO4 A;  2HND A;  1WBD A;  1KRP A;  1WN7 A;  4MO5 A;  4KTQ A;  1BUP A;  3MN5 A;  4CZG A;  2WON A;  4BRP A;  3KVG A;  1JKH A;  4IJN A;  1WAJ A;  2FBV A;  1KSP A;  2G8U A;  2IVN A;  3CQ8 A;  4NLC A;  3OHR A;  4B8A B;  1L3V A;  5BR9 A;  2PBD A;  2O8F A;  3MN9 A;  4HHT A;  2NLX A;  4IOX A;  4FJL A;  3VGM A;  3CFR A;  4JV5 K;  3R1X A;  1FXX A;  1S1X A;  4WE1 A;  2ZGZ A;  1Q18 A;  3HM8 A;  4KHY A;  1SKR A;  3OYI A;  4JLH A;  3VGK A;  4JS4 A;  3SCX A;  3KWG A;  4KH4 A;  4E89 A;  1C0U A;  1NG9 A;  1D9F A;  1M1K O;  2GWK A;  3ZEU A;  4C8O A;  1WBB A;  4ZTJ A;  3DMJ A;  3ISN C;  3VF2 A;  2NUB A;  1NLV A;  3CCV N;  1Z25 A;  4GVM A;  4FJM A;  3J7A P;  1YIJ N;  3CC7 N;  1LWF A;  5KRS A;  1RIL A;  1N5Y A;  2Q36 A;  2ASM A;  2RHK A;  4F4K A;  5BRD A;  4BRI A;  3OW2 M;  3QDK A;  2E2P A;  3EE9 A;  4FJG A;  1VQM N;  5KQD A;  3VMF B;  3T1Y K;  4ELV A;  5CZ2 A;  1KAY A;  1RTH A;  4CFA A;  3FZK A;  5AQS A;  2D1K A;  3MX5 A;  1XHX A;  2BAN A;  4C23 A;  5DM7 L;  4FJK A;  1VAZ A;  2UYT A;  2E88 A;  1VSD A;  4EP4 A;  4IBN A;  3SPZ A;  3D6R A;  2QWL A;  1D8Y A;  1E4F T;  1HKB A;  2QI2 A;  3KKS A;  4W5T A;  2O8B A;  4NCG A;  2ASO A;  5C10 A;  2X78 A;  5A2Q O;  4A57 A;  3TAN A;  4HWI A;  4DSK A;  3H46 O;  1TAQ A;  2VQE K;  3CC4 N;  3SUO A;  4CEF A;  4YOY A;  2A42 A;  2FBY A;  3LM2 A;  4E7H A;  5AQO A;  1S9G A;  3A5O C;  3NVM A;  1N33 K;  3WEE B;  1ITG A;  4C8L A;  4DV6 K;  3G4S N;  4IEE A;  2HHW A;  5CR4 A;  4I6M A;  4LF6 K;  1SAZ A;  4UY8 O;  3DLK A;  3O4W A;  1BI4 B;  3TTC A;  4FWM A;  4JKE A;  1VQP N;  2NRZ A;  2ZJR L;  2BTF A;  1S6P A;  5JIC A;  3AV9 A;  3ATU A;  4CZJ A;  1T8E A;  1WSJ A;  5EU7 A;  4M3T A;  4IFE A;  3GL1 A;  4DQR A;  4BRF A;  3DM2 A;  4DLE A;  1VK0 A;  4WQ5 A;  4E1N A;  1YXQ A;  4JNE A;  4Z94 A;  1U4B A;  4M3U A;  2XO7 A;  4K41 A;  2P9S B;  4FOI A;  3OYJ A;  5JLH A;  2HHT A;  2HBM A;  3ZSQ A;  3DLB A;  4DR1 K;  2A1S A;  1N8R O;  2NRW A;  3HOT A;  2H3G X;  4KO0 A;  3DLE A;  3NF6 A;  3HZ6 A;  4DHY A;  3SV4 A;  1ZC6 A;  3S3N A;  3ZSV A;  3SLC A;  3T1H K;  1FW6 A;  4F2S A;  4B08 A;  4E1J A;  5AFU A;  3BY5 A;  1QE1 A;  4HUG A;  4CVN E;  3RSE A;  1YAG A;  1NJX A;  4GV9 A;  1RDD A;  5M1P A;  4DFP A;  4N76 A;  3QEP A;  2VG5 A;  4GNI A;  4IG3 A; 
#chains in the Genus database with same CATH homology
 3ULD A;  2FBT A;  4PA1 A;  3TAF A;  1KLM A;  4HCB A;  1KCF A;  3THV A;  1S5J A;  2YNI A;  4W5N A;  3QEI A;  3G10 A;  4CJS A;  4QAG A;  3V1R A;  4Q0B A;  2IGI A;  3VQ4 A;  2HNZ A;  3L2V A;  3T1A A;  4KAZ A;  4CJL A;  1JLG A;  3AVM A;  3MXJ A;  4B9T A;  3F9K A;  3SQ0 A;  2KTQ A;  4ZTF A;  4I2P A;  1GOB A;  3WNG A;  3HYF A;  3KIO A;  3ZT3 A;  1ASW A;  5C42 A;  1NKB A;  2KZM A;  1JLE A;  1XWL A;  4PY5 A;  3NH2 A;  1GOC A;  2XY8 A;  2OPP A;  3NFA A;  4OKK A;  4DSE A;  3V6D A;  4N56 A;  1L3S A;  2BDP A;  4DS4 A;  3AO2 A;  4CGI A;  3DOL A;  3OJU A;  3OS0 A;  4W5R A;  3JSM A;  1BGX T;  3O3G A;  3DLH A;  2WOM A;  3AA2 A;  1NJZ A;  2A1R A;  3K5N A;  4FJI A;  2KFZ A;  4Q5V A;  1NK9 A;  1KVB A;  1RBS A;  4M41 A;  4Z4H A;  4ELU A;  1SL2 A;  4DWI A;  3RMA A;  3OYD A;  5KGW A;  3PY8 A;  3L2R A;  3DYA A;  3LPT A;  3SUN A;  1J9A A;  4YFU A;  4DTP A;  3TAR A;  4B9N A;  4CJ4 A;  1S1T A;  3SQ1 A;  2HB5 A;  3QNO A;  1L3U A;  4HTU A;  3SQ2 A;  1NKE A;  4DQI A;  1A5V A;  4EP5 A;  2Q3S A;  3NF7 A;  5J2Q A;  3FFI A;  1ZBL A;  2HHV A;  5E41 A;  4FLW A;  4E0D A;  3LP1 A;  4DF4 A;  1UA0 A;  3IAY A;  3M8Q A;  2HHS A;  4FCY A;  3L2Q A;  1TGO A;  4FLY A;  4KI4 A;  1IH7 A;  4RW7 A;  4CES A;  5SWM A;  4ELT A;  2QK9 A;  1IKV A;  3AO1 A;  4OGC A;  2YKN A;  4CJV A;  1HMV A;  3LZJ A;  4O0J A;  4RW6 A;  5CY4 A;  4FK4 A;  3VQQ A;  3HP9 A;  1U48 A;  3U3Y A;  4KHU A;  4CJP A;  3U6F A;  4CFB A;  4GW6 A;  3LWL A;  4M3Z A;  4KFB A;  2KFN A;  4ID1 A;  3AO4 A;  1RCH A;  2Z1I A;  4Z4C A;  1WAF A;  1JL1 A;  1R0A A;  2D5R A;  2ZD1 A;  1FKO A;  2OPQ A;  4BWM A;  3NGZ A;  3K59 A;  3VQB A;  4JS5 A;  4XIU A;  3I8D A;  4DFM A;  2E4L A;  3PO4 A;  4F8R A;  1RNH A;  2YHB A;  2D0B A;  1BI4 A;  3CG7 A;  3L3V A;  4LY7 A;  4DG1 A;  1XC9 A;  1NK0 A;  1VRT A;  3E01 A;  5DK5 A;  4LH4 A;  3WNE A;  3QLH A;  3ZSX A;  3NH0 A;  2G8W A;  1TAU A;  3KLF A;  3HK2 A;  3QIN A;  4CF1 A;  4OKE A;  5KGX A;  5J2N A;  1SL1 A;  3DOK A;  2HHX A;  2IDO A;  3TR8 A;  3QET A;  4C8M A;  2IAJ A;  3PO5 A;  3B6P A;  3H08 A;  3OYK A;  1KFS A;  4CJT A;  3HM9 A;  3QIP A;  4FJ8 A;  4CJR A;  3T3F A;  5DMR A;  1BCO A;  2PY5 A;  4FM1 A;  1RT5 A;  3D0P A;  1FK9 A;  4ZHR A;  1LV5 A;  1RT2 A;  2KZZ A;  1RTD A;  1S1W A;  1RT6 A;  4AH9 A;  1RTI A;  2FC0 A;  1TV6 A;  3AVC A;  2VG6 A;  5HRP A;  1NK6 A;  1A5W A;  2HW3 A;  1CZB A;  1VSE A;  4J2E A;  5FRO A;  5CYM A;  3HVT A;  1RBR A;  5J1E A;  1VSH A;  1WLJ A;  4JRQ A;  3UIQ A;  1C0T A;  4RW9 A;  2Z1J A;  2FBX A;  2VWJ A;  3QEV A;  4CGH A;  3DRR A;  4PUO A;  4R5P A;  3S3M A;  3SV3 A;  4IG0 A;  4W5Q A;  1HJR A;  2F8T A;  3NGI A;  4KKO A;  4QCL A;  2OPS A;  4DFJ A;  3PV8 A;  3ZT0 A;  3AVI A;  3HST B;  3VQE A;  1JLQ A;  3AVB A;  1IKW A;  2QKB A;  3C95 A;  1QSL A;  1UOC A;  4CJF A;  4PWD A;  1B9F A;  4F3O A;  5J2P A;  3EYZ A;  3KK1 A;  3VQ9 A;  5C25 A;  2XY6 A;  4IKF A;  4KHN A;  4UQG A;  2HVH A;  3WNF A;  3V9W A;  1G15 A;  2KQ2 A;  4L8R B;  3VQP A;  4G1Q A;  3VA3 A;  3SZ2 A;  1IG9 A;  3RR8 A;  1QSY A;  1WSG A;  2O4I A;  4CJQ A;  4BE1 A;  4CEZ A;  5HP1 A;  3O3F A;  3TAQ A;  3K58 A;  4DQP A;  3IG1 A;  5HRS A;  3V1Q A;  4Z0U A;  4FJ5 A;  4AHC A;  1TVR A;  3AVK A;  3VQ7 A;  3ZSO A;  3QNN A;  3LP2 A;  2RKI A;  4K8X A;  4BE0 A;  3JYT A;  3HPG A;  2ETJ A;  4BWJ A;  1HYV A;  4BDZ A;  3QES A;  1K6Y A;  2EHG A;  3CM5 A;  4BAC A;  3RMC A;  3AO5 A;  3G0Z A;  3VQD A;  1NOY A;  4ID5 A;  4E19 A;  4DU4 A;  4HCC A;  3RTV A;  5JS1 A;  4CIE A;  2OA8 A;  1XHZ A;  1RTJ A;  3LP0 A;  3AVJ A;  1CXU A;  5HBM A;  3OY9 A;  4DF8 A;  3LAL A;  4O5B A;  3M8S A;  3CM6 A;  3PX6 A;  1LW0 A;  3WNH A;  4RW8 A;  1HNI A;  3O4N A;  3RMB A;  3NF9 A;  4FJH A;  1LAW A;  1T05 A;  3OVN A;  1CXQ A;  1Y97 A;  2B4J A;  2XY5 A;  2ITG A;  5D3G A;  2GBZ A;  3L3U A;  3PUF A;  5KRT A;  3QIO A;  3L8B A;  1VSI A;  3MXM A;  1QQC A;  4OVL A;  3HL8 A;  3P83 D;  3S9H A;  3KLE A;  3K5O A;  3MAQ A;  2E6M A;  4CER A;  4FYD A;  4CHP A;  1HRH A;  4OLB A;  4PQU A;  4OLA A;  4DQS A;  1UA1 A;  3AA5 X;  2HMI A;  4E7J A;  4I2Q A;  1BQM A;  1YT3 A;  4J2D A;  4LH5 A;  2P51 A;  1LWC A;  5C24 A;  1JL2 A;  4KB1 A;  1QHT A;  3LP3 A;  2VG7 A;  3HPO A;  1RBT A;  4KHQ A;  1MU2 A;  4DSF A;  3RRH A;  4M3X A;  1HPZ A;  1VSM A;  5J2M A;  1A5X A;  1YVU A;  2E6L A;  1LW2 A;  1NK4 A;  1BIZ A;  5HLF A;  3KK3 A;  4Y1C A;  1CZ9 A;  3LAK A;  1KVA A;  1Z26 A;  3MEG A;  3HVR A;  1L3T A;  2GUI A;  1W9H A;  1NJY A;  3AA4 A;  1HQE A;  4CJ5 A;  4CCH A;  4FW2 A;  4EZ9 A;  3HXM A;  1KLN A;  2YHA A;  3MEC A;  3OYA A;  1JXB A;  4B8C A;  3TAP A;  2OPR A;  3S3O A;  2HNY A;  3ZT4 A;  1EET A;  4KV8 A;  3V4I A;  1EKE A;  5HRO A;  1UWB A;  2X6N A;  1D9D A;  2D0A A;  1IKY A;  4C8K A;  2OZS A;  1S6Q A;  1U45 A;  1KFD A;  1NK8 A;  4KTZ A;  2XRI A;  4HUF A;  1RBU A;  3OYC A;  4AHS A;  1TK5 A;  3KD1 E;  4FZX C;  2YNH A;  5FRM A;  1Q9X A;  3ZT2 A;  3VN5 A;  4OGE A;  3F73 A;  4DSI A;  1DTQ A;  3TAE A;  1C0M A;  1ZBF A;  4M3W A;  2GV9 A;  4KRF A;  2IC3 A;  1TK0 A;  4MFB A;  4O0I A;  4BDY A;  2AJQ A;  4CEO A;  3LAM A;  1IKX A;  1W0H A;  3U3G A;  3V9S A;  1JXE A;  3ZCM A;  4DMN A;  1NOZ A;  1EP4 A;  3OS2 A;  1LAV A;  3MXI A;  1T03 A;  3QEW A;  2XHB A;  4FLX A;  2F8S A;  2OYQ A;  1TL3 A;  4J2B A;  1TKD A;  2HHQ A;  3OYG A;  4CJE A;  4FK0 A;  1U04 A;  5SZT A;  4E7K A;  1SL0 A;  1UAX A;  1JLB A;  1T7P A;  1SKW A;  4CEE A;  4FZY A;  1Q9Y A;  4IFY A;  4B9M A;  3NH1 A;  4DLG A;  1ZBH A;  3K2P A;  2EX3 A;  2P5O A;  5FRN A;  4E3S A;  1XI1 A;  1NK7 A;  4E7I A;  3IRX A;  1QS4 A;  1GOA A;  3NDK A;  1RDA A;  1BQN A;  4CF9 A;  4CF2 A;  1SV5 A;  1TKZ A;  1X9S A;  5HRN A;  3OYM A;  1KVC A;  3BDP A;  4FJX A;  1ASV A;  2IS3 A;  3LAN A;  3LDS A;  3C94 A;  3MED A;  4H8K A;  4OJR A;  4MQ3 A;  3OYH A;  1WSI A;  3AVN A;  3VQ8 A;  4O44 A;  3CFP A;  3QEX A;  2HND A;  4CJK A;  3EZ5 A;  4N47 A;  1KRP A;  1WN7 A;  1BL3 A;  4KTQ A;  1BIU A;  2D0C A;  3NHG A;  4E1M A;  1F21 A;  4Z4E A;  2DY4 A;  2G8F A;  2WON A;  4DTS A;  4B3O A;  1S1V A;  4DS5 A;  1TL1 A;  1JKH A;  3KK2 A;  2O4G A;  2G8K A;  1WAJ A;  4FJ7 A;  3OYL A;  2FBV A;  4AHT A;  1KSP A;  2G8U A;  1VSJ A;  3CQ8 A;  4B8A B;  4CGD A;  3LWM A;  4CK1 A;  5FDL A;  1L3V A;  2B6A A;  1ZYQ A;  1JLA A;  1I39 A;  4HHT A;  3NE6 A;  4FJL A;  4B9V A;  5K14 A;  3CFR A;  3LZI A;  1HYS A;  4B9U A;  3AVA A;  1REV A;  1FXX A;  1S1X A;  4WE1 A;  4CEC A;  1JLF A;  3V9X A;  4DTJ A;  1NJW A;  1VRU A;  4KHY A;  1VSL A;  1DTT A;  1SKR A;  4DU3 A;  4B9L A;  3DLR A;  2Z1G A;  4FLV A;  3OYI A;  4JLH A;  2JGU A;  2KW4 A;  1J54 A;  4JS4 A;  4ICL A;  4M3R A;  3VQ5 A;  1HYZ A;  3SCX A;  4E89 A;  2ATQ A;  4KPY A;  4OKJ A;  1C0U A;  3A2F A;  3HP6 A;  3SUQ A;  1D9F A;  1YTU A;  4C8O A;  1X9W A;  4DSL A;  1HQU A;  4ZTJ A;  4RG8 A;  3OS1 A;  1U47 A;  1VSF A;  1S9E A;  3DMJ A;  3ISN C;  5HRR A;  3SYZ A;  4CEB A;  4FJJ A;  2NUB A;  4I9L A;  4HUE A;  3KKR A;  4F2R A;  1Z25 A;  4CJW A;  4FVM A;  1SUQ A;  1BCM A;  4GVM A;  4O55 A;  4CGG A;  4FJM A;  1C6V A;  4M45 A;  4CHZ A;  1NKC A;  5JS2 A;  1LWF A;  4M3Y A;  3TAB A;  5KRS A;  3K57 A;  1RIL A;  1RT3 A;  3HT3 A;  3EY1 A;  4AHV A;  1N5Y A;  3B6O A;  4AHR A;  2JLE A;  1LWE A;  4F4K A;  4KB0 A;  2IOC A;  1JLC A;  4B9S A;  3M8R A;  2PYJ A;  3TWH A;  4AIL C;  2Y1I A;  4CHN A;  1IO2 A;  1ZBU A;  4NYF A;  2Z1H A;  4CGF A;  3O4Q A;  4CF0 A;  3SJJ A;  1YTA A;  4O4G A;  4FJG A;  1RDC A;  3VQ6 A;  4Z4F A;  4H4O A;  4CK2 A;  4OPK A;  4ELV A;  5CZ2 A;  3LPU A;  1RTH A;  3DLG A;  1J5O A;  1RBV A;  4CFA A;  2P1J A;  1XHX A;  2BAN A;  3NBP A;  4FJK A;  4M42 A;  2RN2 A;  3ALY A;  1VSD A;  3K5M A;  2ZE2 A;  3ZSZ A;  4CE9 A;  4DFK A;  2YNF A;  3AVH A;  4EP4 A;  4IBN A;  3KJV A;  3SPZ A;  1NK5 A;  1WSF A;  2Y1J A;  1RT4 A;  1S1U A;  1L5U A;  2OZM A;  4FJ9 A;  4LD0 A;  4CFC A;  1J53 A;  3V81 A;  4QOZ B;  1I3A A;  3ZSW A;  3MEE A;  3ZSR A;  1D8Y A;  4FW1 A;  3KKS A;  3HPH A;  4W5T A;  2G8V A;  4DSJ A;  4NCB A;  2YNG A;  4NCG A;  4FZZ A;  4FXD A;  1RT1 A;  1B92 A;  1FKP A;  4KHS A;  3ZT1 A;  2LSN A;  3DI6 A;  3I0R A;  4KTW A;  4OPJ A;  2RPI A;  2X78 A;  4CHY A;  4KI6 A;  1RT7 A;  2X6S A;  5I42 A;  3M8P A;  4CHO A;  4KRE A;  1B9D A;  3KLG A;  4AHU A;  4N41 A;  3VQA A;  5CYQ A;  3QER A;  1N6Q A;  2B5J A;  4Z4G A;  3SQ4 A;  4IDK A;  3TAN A;  4F3T A;  4J2A A;  1C1A A;  3PX0 A;  3V1O A;  4DSK A;  1TAQ A;  3T19 A;  1Q8I A;  3OYF A;  4DTU A;  2DFH A;  3RMD A;  2HHU A;  3SUO A;  4CEF A;  4EZ6 A;  2FBY A;  4DU1 A;  3RR7 A;  4E7H A;  4GMJ B;  1S9G A;  3L2U A;  3C6T A;  1O1W A;  3NAE A;  1CLQ A;  1EX4 A;  4DQQ A;  3AA3 A;  1ITG A;  4C8L A;  1U49 A;  1VSK A;  4CEA A;  3KLH A;  2R7Y A;  1QSS A;  3ITH A;  3AO3 A;  4NCA A;  4CJU A;  4FLU A;  4W5O A;  2HHW A;  3NGY A;  4DTR A;  3O3H A;  1DLO A;  4NYN A;  4HVJ A;  3L2W A;  1WNS A;  1C1C A;  4LSN A;  4Y1D A;  3DLK A;  4FM2 A;  3OYB A;  4KHW A;  1BIS A;  5T7B A;  1EXQ A;  1BI4 B;  3C6U A;  4IFV A;  4DTO A;  4LSL A;  1QTM A;  4FLT A;  3QO9 A;  2DFF A;  2X74 A;  3OYE A;  1S6P A;  3AV9 A;  2VWK A;  5KI6 A;  3OYN A;  3TAM A;  2BE2 A;  2XY7 A;  4CJ3 A;  3NF8 A;  2QXF A;  4CEQ A;  2RF2 A;  1WSJ A;  3BGR A;  1T8E A;  3KTQ A;  4CIG A;  5EU7 A;  3RRG A;  4M3T A;  2G8I A;  3I0S A;  2DTU A;  1X1P A;  4CF8 A;  3P1G A;  4DQR A;  4DTX A;  3DM2 A;  2ZQB A;  4C8N A;  3V9U A;  4DLE A;  1VK0 A;  4TSX A;  1TKX A;  2G8H A;  1RDB A;  1D5A A;  4E1N A;  2F96 A;  3ZSY A;  4N5S A;  1U4B A;  3IS9 A;  2QKK A;  3AVG A;  5CZ1 A;  3SNN A;  2BGG A;  5I3U A;  4CFD A;  4M3U A;  2YV0 X;  3CFO A;  3DRS A;  2XO7 A;  2W42 A;  1C1B A;  3VA0 A;  4CHQ A;  4RW4 A;  2PZS A;  4FJN A;  3AVL A;  4Z4I A;  3OYJ A;  2HHT A;  3CYM A;  4CIF A;  3ZSQ A;  3AVF A;  3DLB A;  2PYL A;  1HNV A;  3DRP A;  5KTQ A;  2P5G A;  4BDP A;  2A1S A;  3ASM A;  3SI6 A;  4KO0 A;  2HVI A;  3DLE A;  3NF6 A;  2DFE A;  4DTN A;  1WSH A;  3KLI A;  3SV4 A;  1BHL A;  3OJS A;  4FM0 A;  3PX4 A;  3S3N A;  4I9Q A;  3HJF A;  3ZSV A;  4CK3 A;  3NCI A;  4I7F A;  4F2S A;  3VQC A;  4B08 A;  4E7L A;  4CED A;  4CGJ A;  3RWU A;  4FK2 A;  3SUP A;  2I5J A;  1ZBI A;  3TI0 A;  4FLZ A;  4H4M A;  1QE1 A;  1ASU A;  3D45 A;  4HUG A;  3TAG A;  1TK8 A;  1SKS A;  1NJX A;  1RDD A;  1TKT A;  3P5J A;  3K5L A;  4DTM A;  3V9Z A;  4DFP A;  4N76 A;  4JRP A;  3KD5 E;  3SPY A;  1WSE A;  1KTQ A;  2YKM A;  4YNQ A;  1X9M A;  3QEP A;  2VG5 A;  3HO1 A;  4BE2 A;  4IG3 A;  4K8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...