1ZBIA

Bacillus halodurans rnase h catalytic domain mutant d132n in complex with 12-mer rna/dna hybrid
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
b'EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*C)-3'
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 40
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbiA00
1BISA 2RF2A 1NK6A 1ZBIA 1F21A 4FXDA 1YTUA 4CFBA 3T1AA 3L8BA 3CM5A 3SPZA 3JSMA 3TI0A 1J5OA 4OJRA 1ASUA 4CHPA 4CK1A 4OPJA 3QIPA 4FJIA 1S1XA 4CK3A 2YHAA 3OY9A 1UAXA 3C94A 4DTOA 1SKWA 4DWIA 4FZYA 4FJLA 3HK2A 3DMJA 4NYNA 4CEEA 3NCIA 4M3TA 3VA0A 4DF8A 1S1VA 1UA0A 2I5JA 3LANA 3HP6A 3KKRA 1EKEA 4C8NA 5KRTA 3QERA 4B9VA 4O4GA 3M8PA 2B5JA 3AA2A 1Q9XA 2FBYA 1HMVA 3KLIA 3CFOA 3ZSXA 4E7KA 3KJVA 1S5JA 1S1TA 1XWLA 2KQ2A 3AO2A 3L2QA 3EYZA 3OS1A 1Z25A 5C25A 3SYZA 2G8WA 1LV5A 4J2AA 4FK0A 3VQCA 1KLMA 3RMCA 3DRSA 4RW8A 3KLFA 1S6PA 4CESA 3QEPA 4CHYA 2JGUA 3V1OA 4CJSA 3V9ZA 1RT1A 1O1WA 2P1JA 3TWHA 1RT3A 3PV8A 1YTAA 4KB0A 4KTQA 4M3WA 3L3VA 1TGOA 3ZT2A 3EY1A 1QSSA 4B9SA 3LWLA 3V1QA 3L3UA 2HW3A 1LAVA 3HP9A 3MAQA 4FZXC 1WSHA 2HHTA 1C1BA 1J53A 4C8OA 4FJ7A 4OLAA 4JRQA 1RT7A 4M42A 4EZ6A 3AVIA 4PQUA 4CJWA 3SQ0A 3V9WA 1RDBA 4C8MA 1HPZA 5HROA 2NUBA 4E7LA 2ZE2A 2PYLA 1ZYQA 4B9NA 4FJJA 4DS5A 1TKZA 5I42A 4J2EA 4FM0A 3C6UA 3MEEA 3DLBA 4ELTA 3OYJA 4EZ9A 4CGHA 4BDYA 4DLGA 4FJXA 4DTMA 5SWMA 1RBTA 1VSIA 3TR8A 3HT3A 3HVTA 4CCHA 1RT2A 3KK2A 1TL3A 1RBSA 3PX0A 5JS1A 3TAQA 4BDZA 3QEIA 4CJLA 3JYTA 1KVCA 1XHXA 5CYQA 4CEQA 4DTNA 4KPYA 1CZ9A 5CZ1A 4AHRA 3L2RA 3V6DA 4I7FA 2A1RA 1RTDA 1SL1A 3RWUA 1CLQA 4ZTJA 1A5VA 3VQ5A 2KW4A 1EXQA 5C24A 4IFYA 4F3TA 5EU7A 4F8RA 4KHSA 1RT5A 3OYFA 1NJYA 3I0RA 3ZCMA 3BGRA 1QQCA 1VSFA 1L3SA 4FJ5A 4DS4A 5K14A 1ZBFA 1JLAA 3SQ1A 2ITGA 2XY7A 3SPYA 1U49A 1U48A 3KD1E 4DSIA 4L8RB 5J1EA 1RTJA 3CFRA 1A5WA 4KV8A 3KTQA 3OYBA 3EZ5A 3ZSYA 3MXMA 1RT6A 3S9HA 4QAGA 3OYIA 1TVRA 3K57A 3OYDA 5J2PA 4LSLA 3RRGA 3LP1A 1WAJA 3PUFA 1C1CA 4Z0UA 4CJEA 5SZTA 2F8SA 3MEDA 1SL0A 1RDDA 4KHWA 1DLOA 3O4NA 1NOYA 2X74A 1TKDA 4FJKA 3VQPA 3QNOA 3IAYA 2Z1HA 3C95A 3KD5E 2QKBA 4DTUA 1HYZA 4CJ4A 3AVCA 3PX4A 4CGJA 2OA8A 3ULDA 3NF8A 2OPQA 3AO5A 3OYEA 2GBZA 1IH7A 1CZBA 3AVNA 3IG1A 4O55A 3RRHA 4ELUA 4FJMA 3G0ZA 3QLHA 1I3AA 1ITGA 1S1UA 1J9AA 2A1SA 3VQ7A 3AVGA 4CERA 4KFBA 2YNFA 5KI6A 3TABA 1SKSA 2X6NA 2XRIA 1X9WA 4F2SA 1K6YA 1RBVA 3V4IA 1KFSA 4CHQA 4KB1A 3OYKA 1WLJA 3AVKA 1JL2A 3U3GA 1NJZA 1A5XA 1LW2A 4B9MA 5DK5A 3NH0A 2HNYA 5HRRA 1MU2A 1ASVA 3L2WA 3CQ8A 1UOCA 3V9XA 3WNHA 4TSXA 3KIOA 1BQNA 4BWMA 5DMRA 4HCBA 1JL1A 1HYVA 2QKKA 3I0SA 3NH1A 3L2VA 3VA3A 4UQGA 3PY8A 1KFDA 4W5RA 1WSIA 1TK5A 1JKHA 3OYNA 3AVLA 4B8AB 4NCGA 3KLEA 3AA5X 1D9DA 1ZBHA 4DSJA 4KI4A 4O44A 1QTMA 3ISNC 2GV9A 1XI1A 2XY8A 1BL3A 3TAGA 2D5RA 1BGXT 1RILA 4CF0A 3VQQA 2Y1JA 1QHTA 3KKSA 1QSYA 1KRPA 2HB5A 3L2UA 3MXIA 3M8RA 1XC9A 3D45A 4DQSA 4FLUA 2HNZA 4W5TA 2VG7A 5E41A 1LWFA 1HNVA 3DOLA 4CFCA 4BE0A 3OYGA 3SUQA 1HQEA 1DTQA 4ICLA 1JXEA 4FJGA 4CHOA 3AO4A 1BCOA 3VQEA 2KZMA 3OYCA 4LSNA 3RMDA 4OPKA 3LAMA 1D9FA 2G8FA 3B6OA 1LWCA 2OPPA 3O3GA 4GW6A 3TARA 4BE1A 4J2DA 3AVJA 2F8TA 3FFIA 1TKXA 1U04A 1NJWA 1NJXA 3DLEA 4FLXA 3ITHA 4BDPA 2HVIA 3MEGA 4CE9A 3KLHA 4DF4A 4I9LA 1VSMA 3SCXA 3WNFA 4HVJA 4MFBA 4E19A 1TK8A 3RMAA 1U47A 4GVMA 3NAEA 3LPUA 4CGIA 4M3RA 3ZT0A 4XIUA 2YHBA 3K59A 4F4KA 3CFPA 1VSLA 1T7PA 2BGGA 3DRPA 3DYAA 3HO1A 3H08A 3IRXA 3NGYA 1C6VA 2X78A 5HRPA 1N5YA 4DSKA 3OYMA 2E6LA 3NHGA 2JLEA 3LAKA 1L5UA 4FJHA 5KGXA 1ASWA 1VSDA 4E7HA 4OKJA 4FLWA 1VSKA 2Z1GA 1Y97A 3NDKA 3V9UA 1U45A 1XHZA 1B92A 1JLEA 4G1QA 2RKIA 4KAZA 1RBRA 3TAMA 3ZSZA 1RDAA 4FLVA 1NK4A 3NF6A 4PY5A 3G10A 4AHSA 1J54A 4CEFA 2G8KA 4FYDA 5CY4A 4AHVA 4R5PA 4HHTA 3VQAA 4DTRA 1NKCA 4HCCA 4ID5A 3OJUA 1VK0A 1WSJA 4DMNA 2FBTA 3IS9A 3D0PA 4QCLA 3OYHA 4CK2A 5C42A 4Z4FA 4IFVA 4CJUA 1TAUA 4AHCA 3PX6A 4Z4HA 1GOBA 1REVA 3DRRA 3NFAA 2G8UA 1L3TA 3ZT3A 4KI6A 1LWEA 3LP2A 4N41A 3LZJA 5FDLA 3U3YA 1NKBA 4KHQA 1HNIA 1BCMA 4EP4A 2ETJA 3MECA 4CJQA 1KLNA 4LH5A 5FROA 2DFHA 4HUFA 1L3UA 3AO1A 1VSJA 4O5BA 4M3ZA 2PZSA 2WONA 2DFFA 1IG9A 3SJJA 4DQRA 2ZQBA 1KSPA 2PYJA 2IS3A 4CF8A 4DG1A 4B9LA 4FZZA 3AO3A 4WE1A 3DLKA 2IC3A 1SV5A 2O4GA 4CHNA 3TAEA 1NK9A 3DLRA 4Z4CA 1WSFA 2OPSA 3WNGA 3SQ2A 5KRSA 4JS4A 5J2NA 2ZD1A 3NF7A 3THVA 2Z1JA 2RPIA 2QXFA 3NBPA 1HJRA 1WNSA 1C0UA 1S6QA 1BHLA 1U4BA 3CYMA 5D3GA 2VWJA 1RTIA 4AHUA 3F9KA 4K8XA 5KTQA 3ZSOA 3SNNA 4Y1CA 4FLZA 2XY6A 1KVAA 1X9SA 3RR8A 2G8IA 2DFEA 4Y1DA 1IKXA 3SUNA 1TV6A 1IKWA 5J2QA 2HHQA 1IO2A 1CXUA 3WNEA 2FBXA 4B8CA 3O3FA 3UIQA 5I3UA 4CJVA 4DFPA 1WSEA 1TL1A 2VWKA 3VQ8A 1QSLA 5FRMA 3ZT4A 3PO5A 4ZTFA 5CZ2A 1S1WA 3P1GA 1D8YA 2FBVA 2WOMA 1FXXA 2YV0X 4HTUA 2HMIA 4FK2A 1B9DA 4E7JA 2OYQA 4N76A 1TKTA 1C0MA 3I8DA 5HP1A 2YNHA 5J2MA 3QETA 4KREA 4CF2A 3K5NA 1X1PA 4LH4A 1X9MA 2IOCA 4N5SA 4IG3A 4CGGA 1RBUA 3SQ4A 4ELVA 3CM6A 4M41A 2QK9A 3SUPA 4DFMA 1RDCA 2O4IA 2ATQA 4DTJA 3HJFA 1JLGA 3VQ4A 3VQ6A 1FK9A 4I2QA 4CIFA 1WSGA 2XHBA 4FLYA 3F73A 2XO7A 3HPHA 2VG6A 3DLGA 3VN5A 4CGFA 1W0HA 2FC0A 1KCFA 3ALYA 3PO4A 2KZZA 3MXJA 4B3OA 1LAWA 4DQQA 4DSEA 3LWMA 1UWBA 3QESA 1I39A 4FW1A 2IDOA 4GMJB 5JS2A 4CJ5A 5HRNA 3HM9A 4JLHA 3NGIA 4KTWA 4DSFA 4KO0A 2B6AA 3QIOA 3HSTB 4F3OA 2YKNA 3QNNA 3OVNA 4CEDA 4CJKA 3ZSVA 4OLBA 5T7BA 1TK0A 1LW0A 4M3XA 4CECA 4QOZB 1IKVA 2D0BA 1T8EA 4CF1A 3NH2A 2HVHA 4H8KA 3AVHA 1JLCA 4CHZA 3SZ2A 3SUOA 2PY5A 3QO9A 3DLHA 2DY4A 4RW4A 2D0CA 1SL2A 1WN7A 4FK4A 2YKMA 3NE6A 1SKRA 4EP5A 4E3SA 3P83D 1FKOA 3AVBA 3HYFA 3A2FA 1NK5A 1HRHA 4ID1A 4RG8A 4W5NA 1D5AA 4N47A 1VRUA 4CFAA 3TAPA 3V81A 4FLTA 4C8KA 3RMBA 1C0TA 2BE2A 4FM1A 4W5QA 4E7IA 4N56A 3U6FA 4IKFA 4CF9A 3SV4A 4I9QA 1DTTA 3SV3A 3RR7A 3VQDA 1NK8A 1RCHA 4DQIA 4DU3A 1HYSA 2HNDA 4DFJA 4K8ZA 1L3VA 2R7YA 3B6PA 4O0JA 3O4QA 1KVBA 2BDPA 3HPOA 4DTXA 3TAFA 4FJ9A 4M45A 2BANA 4F2RA 4DLEA 1GOAA 1HQUA 4OKEA 2EHGA 2VG5A 1UA1A 1KTQA 2Q3SA 3NGZA 4IBNA 1NK7A 4HUEA 5HRSA 3S3NA 4CJTA 1NKEA 3QEWA 1QS4A 3LPTA 2W42A 2HHSA 5HLFA 4B9UA 3T19A 1VRTA 2E6MA 1Z26A 2RN2A 4CIGA 4FW2A 3LALA 3LP0A 4M3UA 3K5OA 1S9GA 4Z4IA 1RTHA 3OJSA 4KTZA 2P51A 4OGEA 3S3OA 4BACA 4OVLA 1YT3A 2P5OA 2HHUA 3K58A 2F96A 2KTQA 2Z1IA 1TAQA 2YNGA 4E0DA 4E89A 3QEVA 1FKPA 4CIEA 4ZHRA 4FJNA 4RW7A 4CEZA 1EP4A 2GUIA 4LY7A 4PUOA 1SUQA 3VQ9A 2HHXA 2HHVA 4OGCA 4DFKA 1JLQA 4YFUA 1BQMA 4KHNA 4FCYA 4BWJA 3AVMA 4C8LA 3AV9A 1BIZA 4Z4GA 4CFDA 3DOKA 3CG7A 4NYFA 3ASMA 3E01A 2OZMA 3OYLA 4CJFA 4Q0BA 3OS0A 1EETA 1RNHA 2D0AA 4DU1A 4DSLA 3S3MA 3AVFA 3KK1A 4Q5VA 3M8SA 1NK0A 1C1AA 4CJPA 3NF9A 4H4OA 2IGIA 1QE1A 3V1RA 4CEBA 3HXMA 3LDSA 4RW9A 4CEAA 4B08A 3BDPA 3K5LA 3V9SA 1T03A 1VSEA 5KGWA 4M3YA 2G8HA 3LZIA 5FRNA 1B9FA 3SI6A 2LSNA 3K2PA 2X6SA 3HPGA 4O0IA 1ZBLA 3M8QA 1RT4A 1BIUA 2E4LA 3AVAA 2P5GA 4DU4A 2KFNA 2B4JA 3ZT1A 1IKYA 3DI6A 4E1MA 4CEOA 4JRPA 3HVRA 4BE2A 2OZSA 3ZSWA 2AJQA 2DTUA 4KHUA 1BI4A 1YVUA 2YNIA 1GOCA 1VSHA 3OS2A 3K5MA 3KLGA 4AH9A 4NCAA 1S9EA 2OPRA 3AA4A 4RW6A 1BI4B 4CJ3A 3OYAA 3KK3A 1NOZA 4DQPA 2HHWA 4NCBA 4AHTA 3LP3A 3DM2A 4KRFA 4DTPA 4I2PA 4PA1A 3QINA 3P5JA 1W9HA 4CGDA 2Y1IA 4CJRA 3O3HA 4YNQA 4MQ3A 1JXBA 2EX3A 2XY5A 4KKOA 4PWDA 2G8VA 1WAFA 1Q9YA 4FM2A 4OKKA 4FJ8A 3HL8A 4LD0A 4KHYA 4B9TA 1G15A 4DTSA 3VQBA 1Q8IA 4W5OA 4JS5A 3RTVA 1CXQA 3ZSRA 5HBMA 1ZBUA 1JLBA 2IAJA 2KFZA 1T05A 1N6QA 4H4MA 4IDKA 3T3FA 4IG0A 3TANA 4Z4EA 4FVMA 4E1NA 3AA3A 5CYMA 1R0AA 4AILC 1EX4A 3QEXA 3ZSQA 4J2BA 1JLFA 3C6TA 4HUGA
chains in the Genus database with same CATH superfamily
2FF3B 2GWKA 2RF2A 3ID6A 4WFAL 3SPZA 2O8FA 1ASUA 3HBTA 4CHPA 4ISFA 4FJIA 1S1XA 4FJLA 3OY9A 1UAXA 4GV6A 3DMJA 4CEEA 2V7YA 3IDHA 3NCIA 4M3TA 4DF8A 3O1BA 2I5JA 3HP6A 3KKRA 1EKEA 4O4GA 4CZLA 2FBYA 3J7YP 3KLIA 3KJVA 2KQ2A 4CZGA 3CCMN 3O9QA 1NMDA 1Z25A 3A5OC 3THYB 3SYZA 4FL9A 4CZFA 2G8WA 3DJCA 3KLFA 4DV4K 4CHYA 5M1KA 3V1OA 5AZIB 3V9ZA 5BN8A 1YHQN 4XH1A 1RT3A 2WUSA 1WB9A 4KTQA 4BC4A 3L3VA 4B9SA 3MAQA 5FPMA 4A62A 4PQUA 3SQ0A 4C8MA 4IXCA 5HL7L 1ZYQA 2HBLA 3UKUA 4J2EA 4ELTA 3OYJA 4EZ9A 4BRKA 4DLGA 1RBTA 1TL3A 3PX0A 3ZEUA 5KPRA 5BPMA 1SS6A 4ILHA 1CZ9A 5CZ1A 3V6DA 1EXQA 5C24A 2QA4N 4F3TA 5EU7A 1NJYA 3MK6A 4FJ5A 1QQCA 2V51B 3P4IA 3VERA 1U49A 3G25A 3OYBA 5BR9A 3S9HA 3OYIA 1R59O 5J2PA 3OYDA 2ZM6K 4CJEA 2D4WA 3MEDA 4KHWA 1DLOA 3EEQA 3CJ1A 2ZJQL 2E2NA 2X74A 1TKDA 1OH6A 3K0SA 3AAQA 2Z1HA 3C95A 2NNWA 2ITMA 2OA8A 1OH7A 3FZLA 3WQTA 2OPQA 3AO5A 3OYEA 5F1XA 3KWIA 3IG1A 3CCSN 5ADXA 1I3AA 1K8KA 1J9AA 3AVGA 5FPEA 2CGKA 3JAMO 3RSEA 1X9WA 1KFSA 4CHQA 3ENHA 4IDHA 1JL2A 1NJZA 1A5XA 1LW2A 3L2WA 4XH4A 3DXMB 1OVYA 4A5BA 2QEXN 1JL1A 4W5RA 1WSIA 1YAGA 1ZBHA 4KH6A 4O44A 3ISNC 1XI1A 2XY8A 5FPNA 2P9SB 3TAGA 1RILA 3VQQA 2Y1JA 3WEEA 3CXCM 1MDUB 2ASMA 3FZKA 1XC9A 4BRQA 4MLEA 1VQ9N 1GLDG 3D2EA 2HNZA 4W5TA 1QVFM 3DOLA 3OYGA 1HQEA 1DTQA 1JXEA 2GELA 2KZMA 3LM2A 4LSNA 2UYTA 1K73O 3B6OA 3AVJA 3FFIA 4OX9K 3ITHA 3CC2N 4BDPA 4I9LA 1EWQA 4HVJA 4E19A 2E5LK 2ZF5O 4BQZA 1C0FA 3AY9A 3LPUA 1BOTO 1P8ZA 3TSQA 4XIUA 2O8EB 1YITN 1HX1A 4F4KA 2Q0RA 3DYAA 3NGYA 2YI1A 2X78A 1L5UA 3AARA 4FJHA 1ASWA 3J80O 4OKJA 1VSKA 1U2VB 1U45A 4BQLA 2NRVA 3TAMA 1RDAA 5CE3A 2G8KA 1J54A 1N8RO 4FYDA 1TYQA 4AHVA 4R5PA 4HHTA 3VQAA 1Y64A 3OJUA 1WSJA 3CQYA 4Z4FA 4IFVA 4CJUA 1X9JA 3VEWA 4AHCA 3PX6A 5FPDA 2G8UA 4B3TK 2A6AA 5EXWA 5AQUA 5FDLA 3U3YA 2P9UB 4KHQA 2E88A 1L3UA 4O5BA 2DFFA 1IG9A 4IZ9A 4FZZA 2PYJA 3AO3A 4WE1A 1SV5A 1GLAG 4CHNA 3ZLJA 1OH8A 3TTCA 4CD1A 4B1WB 2OPSA 4M7XA 2D1KA 5KRSA 3TSPA 4JS4A 2ZD1A 4MDAA 3THVA 5AQWA 2QXFA 1BHLA 1U4BA 3O80A 5KTQA 1KVAA 1TV6A 3M3ZA 3UIQA 3WNEA 5C12A 5I3UA 4DFPA 1QSLA 3LL3A 5M1PA 5I9EB 2A41A 4H5VA 4ZTFA 1S1WA 3GE1A 4HTUA 2NLXA 1TKTA 3I8DA 5HP1A 3BP8A 2UXBK 1X1PA 4FWKA 2GEMA 1RGIA 2IOCA 3G4SN 2NRXA 3E1YA 4IG3A 4CGGA 1T6CA 4ELVA 4M41A 5BPNA 1OH5A 3VQ6A 1FK9A 2PFUA 2XHBA 2QWRA 3C6AA 3QESA 4FW1A 4JLHA 3CQXA 2HMPA 3J81O 3OVNA 4H5TA 3ZSVA 5T7BA 5JLFA 3CETA 3QICA 2E1YA 3A5LC 4IEIA 4B3RK 3CJBA 1RDWX 4XEIA 3QFUA 4CF1A 3NH2A 4H8KA 2PY5A 1JLCA 4RW4A 4M7YA 4AQYK 3HRGA 4JKDA 4EP5A 2HBMA 4O8UA 2O8BA 4R79A 2O8FB 4ID1A 4W5NA 1D5AA 4ILGB 3RMBA 4LC9B 1DTTA 1L3VA 4O0JA 1KVBA 4DLEA 4GVEA 2EHGA 2VG5A 2Q3SA 5EX5A 4HUEA 5HRSA 4CJTA 3JXUA 3QEWA 1IV0A 3R9PA 1VRTA 4X65K 2HSTA 4OGEA 3S3OA 1S3XA 4BACA 4BRCA 2IIRA 2HHUA 4DB3A 2Z1IA 3ID8A 4J8FA 3AAPA 4CIEA 3VEYA 5M1QA 4PKHA 4K25A 2VQFK 1BO5O 2GUIA 4PUOA 1SUQA 3VQ9A 2HHXA 4OGCA 4DFKA 3THWA 1M1KO 1I94K 4FCYA 4BWJA 4C8LA 3MMVA 4NYFA 4Q0BA 5AQGA 5JVGL 1BU6O 3ZEUB 2D0AA 4DSLA 3KK1A 4Q5VA 3M8SA 2F9WA 2JWLA 3BZCA 4CJPA 4H4OA 2HBKA 4H5WA 1YUWA 1T3VA 2A42A 4B08A 3K5LA 2OTLN 4M3YA 3SI6A 1HNWK 4GKKK 3T69A 1RT4A 5F0XA 3ZX3A 3E9OA 3L6QA 4BVOA 3CI5A 4BRMA 4A59A 1HKBA 2F4VK 4NXNK 2AJQA 2DTUA 3HI0A 4BR5A 4GY2B 5GAGP 4JI8K 2W41A 4AH9A 1OVQA 1S9EA 3A5MC 1BI4B 3K9JA 3OYAA 1NOZA 4AHTA 3H45C 4DTPA 4I2PA 1VQ6N 3QINA 3P5JA 1K8KB 4CGDA 3O3HA 4BRNA 4MQ3A 3WXLA 4A5AA 2O8DB 3FE1A 1WAFA 2QWMA 3BUZB 2HOEA 1Q9YA 1XMOK 3DAWA 5AJ3K 2IVPA 2NRWA 3VQBA 4W5OA 3CPEA 5AQOA 1J5EK 3CD6N 2IAJA 4AF1A 1T05A 1Q18A 3T3FA 1NGIA 3VF6A 3TANA 5CYMA 4YOXA 4J2BA 4PKIA 3ZSQA 1S22A 4HUGA 4KH4A 1NK6A 4FXDA 3L8BA 1J5OA 4OJRA 1ZBSA 2E20A 4KBOA 3QFPA 2YHAA 1SKWA 4FZYA 3HK2A 4DWIA 4K0KK 1X3MA 3O9SA 3D2EB 1VQNN 2D0OA 1S1VA 1XNRK 1HLUA 1YIJN 4BG9A 4JI1K 2B5JA 3AA2A 1Q9XA 3CPWM 3T7ZA 4JEPA 4LF8K 3S41A 5GADP 1XWLA 1S1TA 3CMAN 2Q2RA 3NMUA 4BC3A 1KLMA 4I6MA 4CJSA 3G71N 1ATNA 4KB0A 3ZT2A 1NWKA 3LWLA 2VCPA 1LAVA 1BG3A 2HHTA 1C1BA 1J53A 2QM1A 4OLAA 1NGJA 1HKGA 4JRQA 1IG8A 2ZJPL 1NGFA 3AVIA 4CJWA 5HROA 1HPZA 4WQ4A 2O8CA 4B9NA 4JNEA 5I42A 3I33A 3DLBA 3C6UA 4JKGA 4YOWA 4FJXA 3HOSA 4DTMA 2YHXA 5SWMA 2W40A 2UUBK 4WFBL 3KK2A 1RBSA 3TAQA 2UXDK 3VEZA 1KVCA 1XHXA 5CYQA 5EVZA 4JI6K 4YY3K 4DTNA 3U9DA 4AHRA 4DV5K 1RTDA 2Q97A 3RWUA 3EE8A 1SL1A 1GLFO 4YOYA 4BR9A 4KHSA 1L3SA 4DS4A 2ITGA 1U48A 5J1EA 1RTJA 3L0QA 3CFRA 1A5WA 4KV8A 3EZ5A 3ZSYA 3MXMA 1RT6A 1YI2N 3I56N 3PUFA 1C1CA 4Z0UA 4B1VA 3UKRA 1P90A 3SJHA 3QNOA 1FW6A 3P38A 3IAYA 3KD5E 4CJ4A 4CGJA 3ULDA 2P9LA 3NF8A 4JKHA 4CZEA 2GBZA 1IH7A 3AVNA 4O55A 4A57A 5LY3A 2WFBA 1OKJA 4IJAA 3G0ZA 3QLHA 4FJMA 1S1UA 1Q86O 3W0LA 3VQ7A 4F2SA 3V4IA 1RBVA 1E3MA 3U3GA 3C7NA 4B3MK 5FLXO 3NH0A 1ZC6A 4H5NA 5HRRA 1MU2A 2A40A 4BWMA 3I0SA 3VA3A 4UQGA 1TK5A 3OYNA 4B8AB 3KLEA 4UY8O 1D9DA 3HSCA 1QTMA 2GV9A 1WUAA 3FFKB 5DM7L 1VQPN 3CIPA 2D5RA 4CF0A 3C65A 3KKSA 2HB5A 1QHAA 1XQSC 3M8RA 5BRDA 4FLUA 5E41A 1HNVA 1MA9B 4WCEL 3MX2A 4FPBA 4FJGA 5AZJA 2WBNA 3AO4A 5H1SQ 1BCOA 3LAMA 4J2DA 3R3LA 3DLEA 4FLXA 4DV6K 3KLHA 4CE9A 4DCHA 3M6GA 3VEXA 1ZXOA 3SCXA 1M90O 4LF5K 4FWLA 4MFBA 1RDUA 4FWOA 4WYBA 3O4WA 1YJNN 4GVMA 4CGIA 4M3RA 3TSUA 5LMNK 3CCJN 2BGGA 3CFPA 4MDBA 3IRXA 2HHVA 4DSKA 3MCAB 2E6LA 3OYMA 1KAXA 5KGXA 4X66K 4JKEA 4E7HA 4XH5A 1XHZA 1JLEA 3P39A 2P9PB 1WBBA 4B1ZA 4CEFA 4CW7B 4HCCA 4BRDA 4ID5A 1VK0A 3IS9A 5KPZA 4CK2A 4X64K 5C42A 5GIPA 1TAUA 4NLCA 3WT0A 2QW9A 3DRRA 4DR6K 3C6HA 4DR7K 4KI6A 3LP2A 3E9LA 4DKWA 3CCEN 2YJEA 4B3SK 1NKBA 3HZ6A 1K8AO 4EP4A 2ETJA 1KLNA 4BRFA 4CJQA 4HUFA 4GKJK 3SJJA 2ZQBA 4FWQA 5AQLA 2IS3A 3SBTA 4CF8A 4DG1A 3L4QA 3THWB 3DLKA 2IC3A 5E84A 2O4GA 3G6EN 1TUYA 4OPAA 4FOIA 3R1XA 3DLRA 4Z4CA 1WSFA 1NBWA 4JN4A 3LDPA 3NF7A 4QS9A 2RPIA 1SZ2A 1HJRA 4O8KA 4DR5K 1C0UA 4LFCK 4F9OA 3CYMA 5D3GA 4BVPA 5AQXA 4AHUA 3NVMA 3ZSOA 4FOEA 1X9SA 2G8IA 4Y1DA 3SUNA 5J2QA 1HUXA 2HHQA 2VWKA 5FRMA 2P9IA 3EKSA 3D2FB 5CZ2A 2WOMA 1XC3A 2HMIA 1B9DA 4E7JA 1YVNA 4JI7K 2YNHA 3SBGA 4LH4A 3MN5A 1QQOA 3SQ4A 3CM6A 3SUPA 4DFMA 5BRFA 2O4IA 2ATQA 3EO3A 3HJFA 4CIFA 1ATSA 1WSGA 4FLYA 5C10A 3F73A 3WXKA 2KLAA 2VG6A 2KZZA 2W6KA 1VAZA 4B3OA 3CJCA 4DQQA 4CBXA 4CBWA 1W2BM 2IDOA 4GMJB 5HRNA 3H1VX 3HM9A 3NGIA 4KO0A 3QIOA 3HSTB 4F3OA 4CZKA 3QNNA 4CEDA 4OLBA 1LW0A 4JKAA 2D0BA 4PL8A 2HVHA 3SUOA 4CHZA 4CZHA 3QO9A 2Q1NA 2D0CA 3ATUA 1SL2A 1WN7A 4BRGA 4FK4A 1SKRA 3L4IA 3P83D 2QWPA 4QS8A 3CMEN 2HF3A 5A2QO 4B1UB 3V81A 1VQ8N 4DQ8A 4W5QA 4E7IA 4CF9A 1U6ZA 3O6WA 3RR7A 1LOTB 4DU3A 4BR2A 1J6ZA 2HNDA 4DFJA 1EQYA 4K8ZA 2R7YA 3B6PA 3TAFA 4FJ9A 4M45A 1HQUA 1GOAA 1UA1A 1NK7A 3NGZA 4IBNA 2UUAK 3LPTA 3SK3A 4I6MB 3T19A 2Q36A 4CIGA 4K42A 4M3UA 3GL1A 1S9GA 4Z4IA 1RTHA 3TU5A 2P5OA 2F96A 2KTQA 3I55N 4E89A 5AFUH 1FKPA 2BH1A 3OBWA 4PL7A 4JKGB 3LM9A 3AVMA 4Z4GA 3PIPL 3CG7A 3ASMA 3E01A 4BRHA 5M1FA 4KHPK 4CJFA 1EETA 4DU1A 1YXQA 1NK0A 1C1AA 3NF9A 2IGIA 3DXKA 1QE1A 3HXMA 4DV7K 5EOYA 1SAZA 4CEAA 3BDPA 1NLVA 4CZIA 1HR0K 2G8HA 3LZIA 2Q0UA 5FRNA 1B9FA 2LSNA 2W6LA 2X6SA 2JWKA 3H46O 4O0IA 4MO4A 4BRAA 4JRPA 5JVHL 4BE2A 3ZSWA 5AR0A 3THXA 3AGKA 3UKRB 3J7ZO 2UXCK 1GLLO 4NCAA 3KZBA 2OPRA 4RTFD 2P9LB 4NCBA 3LP3A 1W9HA 4CJRA 4YORA 2FXUA 2G8VA 3FR0A 1GLEG 4FM2A 4FJ8A 3HL8A 3ZETB 3D6RA 1G15A 3RTVA 1JLBA 1KXPA 5MLCQ 3P31A 1NM1A 4WQ5A 4Z4EA 3KVGA 1VHXA 1BISA 1F21A 3KK7A 3T1AA 3CM5A 1KD1O 3QIPA 3WXJA 3C94A 4NYNA 3CERA 1NNEA 3LANA 3H3NO 4B9VA 1NU0A 3M8PA 5AZJB 5GINA 1HMVA 1IJJA 3CFOA 4E7KA 4IJNA 3AO2A 1WOQA 2OANA 3N4PA 5C25A 3VF2A 5F2RA 4RW8A 5M1NA 4DV0K 1S6PA 4CESA 1VQ7N 2JGUA 5JLHA 1RT1A 2CH5A 3TWHA 3PV8A 3Q7BA 2DPNA 4M3WA 4JHDA 3V1QA 3HP9A 2CGLA 4ISGA 4K41A 4FJ7A 3LDOA 3EZWA 1RT7A 4M42A 1XUPO 1RDBA 1QZ6A 4E7LA 1Q7YO 2ZE2A 4H0VB 2HF4A 2ASPA 3UKUB 3TR8A 3HT3A 3HVTA 1IBMK 4CEQA 4KPYA 2VGNA 3Q7CA 3L2RA 2V52B 4I7FA 1CLQA 4ZTJA 4DR3K 5TKWA 1RT5A 3OYFA 3I8BA 3CF5L 3ZCMA 3BGRA 5K14A 1ZBFA 1JLAA 3SLCA 2XY7A 3KD1E 4DSIA 1JCFA 3RRGA 3K57A 1TVRA 4LSLA 4FWMA 1CZAN 1HNZK 2F8SA 1SL0A 1RDDA 5LL6Z 1VQON 3MN7A 1HYZA 4JD2A 4EHUA 4DTUA 5AQVA 4JKBA 4ELUA 3H6EA 2QWQA 4CERA 4OPHA 2YNFA 5KI6A 3TABA 2X6NA 2XRIA 4JI4K 4KB1A 1K6YA 3O5BA 4YOUA 3WXIA 3RSEB 2HNYA 3CQ8A 1UOCA 4TSXA 1BQNA 2P9NA 1T44A 4HCBA 1E4FT 1ESVA 2CH6A 1HYVA 2P9IB 1NGDA 4LFAK 3NH1A 2E2PA 3PY8A 4RWTA 4DUYK 1KFDA 1JKHA 4NCGA 3AA5X 1BGXT 1DGKN 1QSYA 1KRPA 3L2UA 4JKCA 3SAGA 3D45A 2NRRA 1NG9A 3H3OB 3WEEB 4WFNL 4HWIA 2VG7A 4BE0A 4AM6A 3SUQA 4IO8A 5AQZA 3OYCA 1D9FA 4OPKA 4NB4A 3O3GA 4FWSA 3TARA 1U04A 1NJWA 4DV2K 2YHYA 2HVIA 2QWNA 3KWGA 4X62K 4BRIA 1TK8A 3MN9A 2O8EA 3VENA 3RMAA 1NGCA 2ZGZA 5BPLA 3HOTA 3ZT0A 2YHBA 3K59A 3HO1A 1T7PA 3J8AA 1N5YA 2JLEA 3LAKA 2Z1GA 2GUPA 3V9UA 3GBTA 4G1QA 1JCGA 2E2OA 2VYPA 2YX6A 1RBRA 4DR4K 4IEEA 1DT9A 4FLVA 4FO0A 3WUHA 3NF6A 5AQTA 5CY4A 2F7TA 4IOCL 1NKCA 3A0IX 4DMNA 2J4RA 2RE2A 1TYQB 3PSFA 5KQDA 4Z4HA 3NFAA 1L3TA 2I7NA 3FZMA 2WC9A 3LZJA 1ILYA 4JKFA 3K9KA 1HNIA 1Z6RA 4GV3A 5FROA 4B1YB 3AO1A 1VSJA 4M3ZA 1NGBA 1KSPA 4CI6A 5AQHA 1NK9A 3B8AX 2BTFA 3SQ2A 5J2NA 3PSIA 3NBPA 2QWOA 3VGKA 3A8YA 3O1WA 4B1XB 3DWLA 2VWJA 3F9KA 4ISEA 4K8XA 3SNNA 4Y1CA 3RR8A 3DXKB 2XY6A 3FZHA 2DFEA 1IKXA 1IKWA 3FLCO 2FBXA 4B8CA 4C1NK 5BREA 1VQMN 1WSEA 2PAVA 3VQ8A 3VTIA 4B9QA 1QQNA 3P1GA 4CZMA 1D8YA 1FXXA 3J7AP 2YV0X 5AQRA 3NVKA 4FK2A 5CR4A 3VETA 1C0MA 5JMVA 3QETA 3THXB 1X9MA 3O8MA 1RBUA 2A3ZA 5IWAK 2QK9A 1RDCA 2NRTA 4DTJA 1JLGA 3VQ4A 1D4XA 3HPHA 4CGFA 3VN5A 3DLGA 1W0HA 2FC0A 4JI5K 3MXJA 3CC4N 1LAWA 4DUZK 1GLJO 3LWMA 1UWBA 4CJ5A 5JS2A 1IBKK 4DSFA 2B6AA 4JK9A 3CJ7A 4BROA 1TK0A 4M3XA 4QOZB 4CECA 1IKVA 1T8EA 4FPAA 4ILJA 3AVHA 3SZ2A 4BC5A 1XMQK 2DY4A 3DLHA 4BY9C 2YKMA 1NMNA 4LFBK 3HYFA 1NK5A 1IBLK 1HRHA 4CJ7A 3MDQA 4N47A 4CFAA 2IVNA 4IOXA 4FLTA 4C8KA 1C0TA 2BE2A 4FM1A 2O8BB 4N56A 4IKFA 1Q81O 3SV4A 4I9QA 3SV3A 3VQDA 5AFUA 1NK8A 1RCHA 1EWRA 1BUPA 3IFRA 3QMLA 2E1ZA 3TTDA 2BDPA 3A5NC 4LF4K 2BANA 3ZX2A 1K9MO 4BC2A 4F2RA 4OKEA 4H5RA 3DLLL 3BZKA 3S3NA 1QS4A 3U8XA 1W97L 2W42A 2HHSA 2D0PA 1NGHA 1Z26A 2RN2A 2QXLA 4FW2A 3BF3A 3D7EO 4JHDB 3OJSA 4KTZA 1VQKN 4OVLA 4Z94A 3SMSA 4EHTA 3K58A 1TAQA 1HNXK 4H0OA 2H3GX 3EL2A 3QEVA 3VEVA 5BR8K 4FJNA 4RW7A 1EP4A 4FWNA 4LY7A 3ENOA 1JLQA 2GWJA 4V19S 1BQMA 4KHNA 5AQNA 2BUPA 3AV9A 1BIZA 3DOKA 4RCHA 3GOIA 4JAXA 3OYLA 4DV1K 3OS0A 4GNIA 3OW2M 3AVFA 2KKZA 1WBDA 4NO7A 3V1RA 5AQJA 5AQIA 5LJWA 1H1VA 3V9SA 4O5FA 1VSEA 4C23A 5BRHA 1ATRA 1S72N 5JICA 4LF9K 1QVGM 3O08A 5C15A 2I7PA 3AVAA 2P5GA 3ZT1A 4E1MA 1FJGK 2OZSA 1BI4A 1YVUA 1VSHA 3OS2A 3K5MA 4RW6A 3AA4A 4JD2B 4CJ3A 4JV5K 1C0GA 3QBWA 2HHWA 3BEXA 1JJ2M 2O8DA 3DM2A 4KRFA 4E1JA 2Y1IA 4YNQA 4PWDA 2XY5A 4JI3K 5AQQA 4KKOA 4DV3K 1T6DA 4FVUA 1KAZA 4JYAK 4OKKA 3OHRA 4CD3A 4IWVA 4LD0A 4B9TA 4G9ZA 1V4SA 1Q8IA 2QTDA 1CXQA 2P9NB 5HBMA 1ZBUA 4CZJA 1BWFO 4H0YB 1N6QA 4H4MA 4WQ4C 3ULEA 3AA3A 4AILC 1EX4A 1NJIO 3C6TA 1EO1A 1ZBIA 1YTUA 4CFBA 3TI0A 3JSMA 2P9KA 4CK1A 4OPJA 1MWMA 4CK3A 4DTOA 5C0YA 5TKYA 3VA0A 4YDUC 1UA0A 4GV9A 3VGMA 1BA1A 4C8NA 5KRTA 3QERA 3T1YK 1N36K 3GDQA 2YJFA 3ZX0A 3ZSXA 5B8HA 1HPMA 1S5JA 3EYZA 3L2QA 3OS1A 2YCHA 1DEJA 1LV5A 4J2AA 4FK0A 3VQCA 4BR7A 4PHTX 3RMCA 3DRSA 3VOVA 3QEPA 3WXMB 1O1WA 3ZYYX 2P1JA 4H03B 3MCPA 1YTAA 4MO5A 1TGOA 4CBUA 3EY1A 3O9RA 1QSSA 3L3UA 4FZXC 2VWBA 1WSHA 4C8OA 1NGGA 4EZ6A 2WTUA 5HOOA 3V9WA 2NUBA 4FJJA 3HTVA 2PYLA 4DS5A 1TKZA 5BN9A 4FM0A 3MEEA 4CGHA 4BDYA 2O8CB 1VSIA 3KHYA 3FGUA 4CCHA 1RT2A 3VTHA 1QQMA 5JS1A 4BDZA 3QEIA 4CJLA 3JYTA 4BR4A 2A1RA 1A5VA 3VQ5A 2KW4A 3R6MA 4IFYA 3N4QA 4F8RA 3I0RA 1VSFA 4BGBA 3SQ1A 2FSNA 1GLBG 3SPYA 1YJ9N 4L8RB 1DKGD 3QBXA 3KTQA 5ELZA 5GAEP 4QAGA 2ASOA 3LP1A 1WAJA 3MN6A 2KHOA 3WQUA 4EAHD 5SZTA 1NOYA 3O4NA 3F5TA 4JI0K 4FJKA 3VQPA 2NZTA 3C0BA 4MLHA 2QKBA 1KC8O 1HJOA 4EIAA 3AVCA 3PX4A 1CZBA 3RRHA 5AQPA 5LMUK 1W7AA 1ITGA 2A1SA 3O9UA 4KFBA 3U9ZA 1SKSA 2AP1A 1X3NA 3CCUN 3OYKA 1WLJA 3AVKA 4B9MA 5DK5A 1ASVA 2NRZA 3V9XA 2FSJA 3WNHA 3HM8A 3KIOA 5DMRA 3C7NB 3AGRA 3IMXA 2QKKA 3L2VA 1LCUA 5AQFA 3AVLA 4DSJA 4KI4A 4IFEA 1BL3A 1QHTA 3FZFA 5ADXH 4JK7A 3MXIA 3SMPA 4DQSA 2ZGYA 4A2BA 3VMFB 1LWFA 4CFCA 1YF5L 1MWKA 2RHKA 3LDQA 4ICLA 4CHOA 2E8AA 2HBJA 3VQEA 2OTJN 3RMDA 2G8FA 1LWCA 2OPPA 3VF4A 3E66A 4GW6A 4BE1A 2F8TA 1TKXA 2UUCK 3THYA 1NJXA 4M63C 3MEGA 4DF4A 1VSMA 3WNFA 5AZIA 4BRPA 1U47A 3IKMA 3NAEA 1JCEA 4FSVA 1VSLA 4Y0WA 3DRPA 3H08A 1C6VA 5HRPA 2VGMA 3NHGA 3CCRN 1VSDA 2P9PA 4FLWA 4BRLA 1TUUA 1Y97A 5AQMA 3NDKA 5KQ8A 1B92A 3VPZA 2RKIA 3VESA 4H0XB 4KAZA 2AA4A 3ZSZA 2A5XA 1NK4A 4PY5A 3G10A 4JK8A 4AHSA 1E4GT 1GLCG 3SAFA 4JI2K 4DTRA 4IOAL 3CJAA 1YJWN 5IT9O 4QCLA 2FBTA 3GG4A 3D0PA 2FF6A 3OYHA 3EKUA 1GOBA 1O13A 1REVA 1V4TA 3ZT3A 1LWEA 4N41A 2GTDA 2VQEK 1BCMA 3JS6A 3MECA 4LH5A 1QZ5A 2DFHA 4NXMK 2PZSA 2WONA 4DQRA 4B9LA 1Z05A 2ZJRL 3TAEA 2V7ZA 3WNGA 3U4LA 2Z1JA 2E2QA 4WF9L 1WNSA 4BGAA 1S6QA 1RTIA 2EWSA 4IO9L 4FLZA 4A61A 3D2FA 3DXMA 1IO2A 1CXUA 3O3FA 2HW3A 4CJVA 1TL1A 3ZT4A 3PO5A 4H0PA 2GX9A 2FBVA 2UU9K 2OYQA 4N76A 3M5RA 1SQKA 2F9TA 2P9SA 5J2MA 4KREA 2OCEA 5C2FA 4CF2A 3K5NA 4N5SA 3CCQN 3CCLN 3UB5A 4L3QA 1N34K 4I2QA 3BY5A 2XO7A 3PO4A 2FSKA 2FLOA 1KCFA 3ALYA 2HHHK 5GIOA 2QWLA 5AQYA 4DSEA 2QI2A 5LJVA 1I39A 4KTWA 2YKNA 3IUCA 4CJKA 4K43A 3UE5A 2CGJA 1BDGA 3LDNA 4DR1K 5CHIA 3ULEB 4H0TB 5C2DA 5E26A 3NE6A 5DM6L 4E3SA 1FKOA 3AVBA 3OTOK 1VQLN 3A2FA 5AQSA 4RG8A 2P9KB 3E9PA 1VRUA 3TAPA 1G99A 4BREA 1HKCA 5EY4A 5M1OA 3U6FA 1U2VA 4CVNE 3RVCA 4NLBA 4YHHK 4DQIA 1HYSA 1VQ5N 5AQKA 3O4QA 3CHWA 3HPOA 4DTXA 4DR2K 5KPTA 3EE9A 3O9TA 2IVOA 1KTQA 4QS7A 3CJ9A 1NKEA 2YHWA 3MWTA 5HLFA 4B9UA 2E6MA 3VGLA 3LALA 3LP0A 3MX5A 3K5OA 2P51A 2Q31A 1YT3A 2P9UA 4DHYA 4BR0A 3QB0A 2YNGA 4E0DA 3F2KA 4HTLA 4PKGA 4ZHRA 4CEZA 4YOVA 4U7BA 4LF7K 3ENBA 4YFUA 3CCVN 4CFDA 2OZMA 3PIOL 1RNHA 4YDUA 1BA0A 3EN9A 3S3MA 3SAHA 4WQ5C 4BG8A 2NRHA 4CEBA 1N32K 3ATVA 3TPQA 3LDSA 4RW9A 1T03A 5KGWA 3R8EA 3OA9A 3F9MA 3OBYA 3K2PA 1NGAA 3HPGA 5GAHP 1ZBLA 3M8QA 4A2AA 1BIUA 2E4LA 4YOTA 1XNQK 3TTFA 3QDKA 4DU4A 1VQ4N 2KFNA 2B4JA 1IKYA 3DI6A 4FWRA 4CEOA 4FWPA 3HVRA 4U67L 3PLAA 4KHUA 1NGEA 2YNIA 1GOCA 2ZWHA 3KLGA 3LDLA 2PBDA 3MWPA 3KK3A 4DQPA 4EFHA 4PA1A 1Q82O 4C1NI 3ZETA 1JXBA 2EX3A 3VEOA 3M1FA 1N33K 1KAYA 4KHYA 4DTSA 4JS5A 3ZSRA 1RFQA 1KQSM 2KFZA 3CC7N 4KH5A 3T1HK 4IDKA 4IG0A 4FVMA 4AM7A 3W3DA 4E1NA 1R0AA 3QEXA 1JLFA 4LF6K 4OO1J 3BF1A 3H1QA
chains in the Genus database with same CATH topology
1BISA 2RF2A 1NK6A 1ZBIA 1F21A 4FXDA 1YTUA 4CFBA 3T1AA 3L8BA 3CM5A 3SPZA 3JSMA 3TI0A 1J5OA 4OJRA 1ASUA 4CHPA 4CK1A 4OPJA 3QIPA 4FJIA 1S1XA 4CK3A 2YHAA 3OY9A 1UAXA 3C94A 4DTOA 1SKWA 4DWIA 4FZYA 4FJLA 3HK2A 3DMJA 4NYNA 4CEEA 3NCIA 4M3TA 3VA0A 4DF8A 1S1VA 1UA0A 2I5JA 3LANA 3HP6A 3KKRA 1EKEA 4C8NA 5KRTA 3QERA 4B9VA 4O4GA 3M8PA 2B5JA 3AA2A 1Q9XA 2FBYA 1HMVA 3KLIA 3CFOA 3ZSXA 4E7KA 3KJVA 1S5JA 1S1TA 1XWLA 2KQ2A 3AO2A 3L2QA 3EYZA 3OS1A 1Z25A 5C25A 3SYZA 2G8WA 1LV5A 4J2AA 4FK0A 3VQCA 1KLMA 3RMCA 3DRSA 4RW8A 3KLFA 1S6PA 4CESA 3QEPA 4CHYA 2JGUA 3V1OA 4CJSA 3V9ZA 1RT1A 1O1WA 2P1JA 3TWHA 1RT3A 3PV8A 1YTAA 4KB0A 4KTQA 4M3WA 3L3VA 1TGOA 3ZT2A 3EY1A 1QSSA 4B9SA 3LWLA 3V1QA 3L3UA 2HW3A 1LAVA 3HP9A 3MAQA 4FZXC 1WSHA 2HHTA 1C1BA 1J53A 4C8OA 4FJ7A 4OLAA 4JRQA 1RT7A 4M42A 4EZ6A 3AVIA 4PQUA 4CJWA 3SQ0A 3V9WA 1RDBA 4C8MA 1HPZA 5HROA 2NUBA 4E7LA 2ZE2A 2PYLA 1ZYQA 4B9NA 4FJJA 4DS5A 1TKZA 5I42A 4J2EA 4FM0A 3C6UA 3MEEA 3DLBA 4ELTA 3OYJA 4EZ9A 4CGHA 4BDYA 4DLGA 4FJXA 4DTMA 5SWMA 1RBTA 1VSIA 3TR8A 3HT3A 3HVTA 4CCHA 1RT2A 3KK2A 1TL3A 1RBSA 3PX0A 5JS1A 3TAQA 4BDZA 3QEIA 4CJLA 3JYTA 1KVCA 1XHXA 5CYQA 4CEQA 4DTNA 4KPYA 1CZ9A 5CZ1A 4AHRA 3L2RA 3V6DA 4I7FA 2A1RA 1RTDA 1SL1A 3RWUA 1CLQA 4ZTJA 1A5VA 3VQ5A 2KW4A 1EXQA 5C24A 4IFYA 4F3TA 5EU7A 4F8RA 4KHSA 1RT5A 3OYFA 1NJYA 3I0RA 3ZCMA 3BGRA 1QQCA 1VSFA 1L3SA 4FJ5A 4DS4A 5K14A 1ZBFA 1JLAA 3SQ1A 2ITGA 2XY7A 3SPYA 1U49A 1U48A 3KD1E 4DSIA 4L8RB 5J1EA 1RTJA 3CFRA 1A5WA 4KV8A 3KTQA 3OYBA 3EZ5A 3ZSYA 3MXMA 1RT6A 3S9HA 4QAGA 3OYIA 1TVRA 3K57A 3OYDA 5J2PA 4LSLA 3RRGA 3LP1A 1WAJA 3PUFA 1C1CA 4Z0UA 4CJEA 5SZTA 2F8SA 3MEDA 1SL0A 1RDDA 4KHWA 1DLOA 3O4NA 1NOYA 2X74A 1TKDA 4FJKA 3VQPA 3QNOA 3IAYA 2Z1HA 3C95A 3KD5E 2QKBA 4DTUA 1HYZA 4CJ4A 3AVCA 3PX4A 4CGJA 2OA8A 3ULDA 3NF8A 2OPQA 3AO5A 3OYEA 2GBZA 1IH7A 1CZBA 3AVNA 3IG1A 4O55A 3RRHA 4ELUA 4FJMA 3G0ZA 3QLHA 1I3AA 1ITGA 1S1UA 1J9AA 2A1SA 3VQ7A 3AVGA 4CERA 4KFBA 2YNFA 5KI6A 3TABA 1SKSA 2X6NA 2XRIA 1X9WA 4F2SA 1K6YA 1RBVA 3V4IA 1KFSA 4CHQA 4KB1A 3OYKA 1WLJA 3AVKA 1JL2A 3U3GA 1NJZA 1A5XA 1LW2A 4B9MA 5DK5A 3NH0A 2HNYA 5HRRA 1MU2A 1ASVA 3L2WA 3CQ8A 1UOCA 3V9XA 3WNHA 4TSXA 3KIOA 1BQNA 4BWMA 5DMRA 4HCBA 1JL1A 1HYVA 2QKKA 3I0SA 3NH1A 3L2VA 3VA3A 4UQGA 3PY8A 1KFDA 4W5RA 1WSIA 1TK5A 1JKHA 3OYNA 3AVLA 4B8AB 4NCGA 3KLEA 3AA5X 1D9DA 1ZBHA 4DSJA 4KI4A 4O44A 1QTMA 3ISNC 2GV9A 1XI1A 2XY8A 1BL3A 3TAGA 2D5RA 1BGXT 1RILA 4CF0A 3VQQA 2Y1JA 1QHTA 3KKSA 1QSYA 1KRPA 2HB5A 3L2UA 3MXIA 3M8RA 1XC9A 3D45A 4DQSA 4FLUA 2HNZA 4W5TA 2VG7A 5E41A 1LWFA 1HNVA 3DOLA 4CFCA 4BE0A 3OYGA 3SUQA 1HQEA 1DTQA 4ICLA 1JXEA 4FJGA 4CHOA 3AO4A 1BCOA 3VQEA 2KZMA 3OYCA 4LSNA 3RMDA 4OPKA 3LAMA 1D9FA 2G8FA 3B6OA 1LWCA 2OPPA 3O3GA 4GW6A 3TARA 4BE1A 4J2DA 3AVJA 2F8TA 3FFIA 1TKXA 1U04A 1NJWA 1NJXA 3DLEA 4FLXA 3ITHA 4BDPA 2HVIA 3MEGA 4CE9A 3KLHA 4DF4A 4I9LA 1VSMA 3SCXA 3WNFA 4HVJA 4MFBA 4E19A 1TK8A 3RMAA 1U47A 4GVMA 3NAEA 3LPUA 4CGIA 4M3RA 3ZT0A 4XIUA 2YHBA 3K59A 4F4KA 3CFPA 1VSLA 1T7PA 2BGGA 3DRPA 3DYAA 3HO1A 3H08A 3IRXA 3NGYA 1C6VA 2X78A 5HRPA 1N5YA 4DSKA 3OYMA 2E6LA 3NHGA 2JLEA 3LAKA 1L5UA 4FJHA 5KGXA 1ASWA 1VSDA 4E7HA 4OKJA 4FLWA 1VSKA 2Z1GA 1Y97A 3NDKA 3V9UA 1U45A 1XHZA 1B92A 1JLEA 4G1QA 2RKIA 4KAZA 1RBRA 3TAMA 3ZSZA 1RDAA 4FLVA 1NK4A 3NF6A 4PY5A 3G10A 4AHSA 1J54A 4CEFA 2G8KA 4FYDA 5CY4A 4AHVA 4R5PA 4HHTA 3VQAA 4DTRA 1NKCA 4HCCA 4ID5A 3OJUA 1VK0A 1WSJA 4DMNA 2FBTA 3IS9A 3D0PA 4QCLA 3OYHA 4CK2A 5C42A 4Z4FA 4IFVA 4CJUA 1TAUA 4AHCA 3PX6A 4Z4HA 1GOBA 1REVA 3DRRA 3NFAA 2G8UA 1L3TA 3ZT3A 4KI6A 1LWEA 3LP2A 4N41A 3LZJA 5FDLA 3U3YA 1NKBA 4KHQA 1HNIA 1BCMA 4EP4A 2ETJA 3MECA 4CJQA 1KLNA 4LH5A 5FROA 2DFHA 4HUFA 1L3UA 3AO1A 1VSJA 4O5BA 4M3ZA 2PZSA 2WONA 2DFFA 1IG9A 3SJJA 4DQRA 2ZQBA 1KSPA 2PYJA 2IS3A 4CF8A 4DG1A 4B9LA 4FZZA 3AO3A 4WE1A 3DLKA 2IC3A 1SV5A 2O4GA 4CHNA 3TAEA 1NK9A 3DLRA 4Z4CA 1WSFA 2OPSA 3WNGA 3SQ2A 5KRSA 4JS4A 5J2NA 2ZD1A 3NF7A 3THVA 2Z1JA 2RPIA 2QXFA 3NBPA 1HJRA 1WNSA 1C0UA 1S6QA 1BHLA 1U4BA 3CYMA 5D3GA 2VWJA 1RTIA 4AHUA 3F9KA 4K8XA 5KTQA 3ZSOA 3SNNA 4Y1CA 4FLZA 2XY6A 1KVAA 1X9SA 3RR8A 2G8IA 2DFEA 4Y1DA 1IKXA 3SUNA 1TV6A 1IKWA 5J2QA 2HHQA 1IO2A 1CXUA 3WNEA 2FBXA 4B8CA 3O3FA 3UIQA 5I3UA 4CJVA 4DFPA 1WSEA 1TL1A 2VWKA 3VQ8A 1QSLA 5FRMA 3ZT4A 3PO5A 4ZTFA 5CZ2A 1S1WA 3P1GA 1D8YA 2FBVA 2WOMA 1FXXA 2YV0X 4HTUA 2HMIA 4FK2A 1B9DA 4E7JA 2OYQA 4N76A 1TKTA 1C0MA 3I8DA 5HP1A 2YNHA 5J2MA 3QETA 4KREA 4CF2A 3K5NA 1X1PA 4LH4A 1X9MA 2IOCA 4N5SA 4IG3A 4CGGA 1RBUA 3SQ4A 4ELVA 3CM6A 4M41A 2QK9A 3SUPA 4DFMA 1RDCA 2O4IA 2ATQA 4DTJA 3HJFA 1JLGA 3VQ4A 3VQ6A 1FK9A 4I2QA 4CIFA 1WSGA 2XHBA 4FLYA 3F73A 2XO7A 3HPHA 2VG6A 3DLGA 3VN5A 4CGFA 1W0HA 2FC0A 1KCFA 3ALYA 3PO4A 2KZZA 3MXJA 4B3OA 1LAWA 4DQQA 4DSEA 3LWMA 1UWBA 3QESA 1I39A 4FW1A 2IDOA 4GMJB 5JS2A 4CJ5A 5HRNA 3HM9A 4JLHA 3NGIA 4KTWA 4DSFA 4KO0A 2B6AA 3QIOA 3HSTB 4F3OA 2YKNA 3QNNA 3OVNA 4CEDA 4CJKA 3ZSVA 4OLBA 5T7BA 1TK0A 1LW0A 4M3XA 4CECA 4QOZB 1IKVA 2D0BA 1T8EA 4CF1A 3NH2A 2HVHA 4H8KA 3AVHA 1JLCA 4CHZA 3SZ2A 3SUOA 2PY5A 3QO9A 3DLHA 2DY4A 4RW4A 2D0CA 1SL2A 1WN7A 4FK4A 2YKMA 3NE6A 1SKRA 4EP5A 4E3SA 3P83D 1FKOA 3AVBA 3HYFA 3A2FA 1NK5A 1HRHA 4ID1A 4RG8A 4W5NA 1D5AA 4N47A 1VRUA 4CFAA 3TAPA 3V81A 4FLTA 4C8KA 3RMBA 1C0TA 2BE2A 4FM1A 4W5QA 4E7IA 4N56A 3U6FA 4IKFA 4CF9A 3SV4A 4I9QA 1DTTA 3SV3A 3RR7A 3VQDA 1NK8A 1RCHA 4DQIA 4DU3A 1HYSA 2HNDA 4DFJA 4K8ZA 1L3VA 2R7YA 3B6PA 4O0JA 3O4QA 1KVBA 2BDPA 3HPOA 4DTXA 3TAFA 4FJ9A 4M45A 2BANA 4F2RA 4DLEA 1GOAA 1HQUA 4OKEA 2EHGA 2VG5A 1UA1A 1KTQA 2Q3SA 3NGZA 4IBNA 1NK7A 4HUEA 5HRSA 3S3NA 4CJTA 1NKEA 3QEWA 1QS4A 3LPTA 2W42A 2HHSA 5HLFA 4B9UA 3T19A 1VRTA 2E6MA 1Z26A 2RN2A 4CIGA 4FW2A 3LALA 3LP0A 4M3UA 3K5OA 1S9GA 4Z4IA 1RTHA 3OJSA 4KTZA 2P51A 4OGEA 3S3OA 4BACA 4OVLA 1YT3A 2P5OA 2HHUA 3K58A 2F96A 2KTQA 2Z1IA 1TAQA 2YNGA 4E0DA 4E89A 3QEVA 1FKPA 4CIEA 4ZHRA 4FJNA 4RW7A 4CEZA 1EP4A 2GUIA 4LY7A 4PUOA 1SUQA 3VQ9A 2HHXA 2HHVA 4OGCA 4DFKA 1JLQA 4YFUA 1BQMA 4KHNA 4FCYA 4BWJA 3AVMA 4C8LA 3AV9A 1BIZA 4Z4GA 4CFDA 3DOKA 3CG7A 4NYFA 3ASMA 3E01A 2OZMA 3OYLA 4CJFA 4Q0BA 3OS0A 1EETA 1RNHA 2D0AA 4DU1A 4DSLA 3S3MA 3AVFA 3KK1A 4Q5VA 3M8SA 1NK0A 1C1AA 4CJPA 3NF9A 4H4OA 2IGIA 1QE1A 3V1RA 4CEBA 3HXMA 3LDSA 4RW9A 4CEAA 4B08A 3BDPA 3K5LA 3V9SA 1T03A 1VSEA 5KGWA 4M3YA 2G8HA 3LZIA 5FRNA 1B9FA 3SI6A 2LSNA 3K2PA 2X6SA 3HPGA 4O0IA 1ZBLA 3M8QA 1RT4A 1BIUA 2E4LA 3AVAA 2P5GA 4DU4A 2KFNA 2B4JA 3ZT1A 1IKYA 3DI6A 4E1MA 4CEOA 4JRPA 3HVRA 4BE2A 2OZSA 3ZSWA 2AJQA 2DTUA 4KHUA 1BI4A 1YVUA 2YNIA 1GOCA 1VSHA 3OS2A 3K5MA 3KLGA 4AH9A 4NCAA 1S9EA 2OPRA 3AA4A 4RW6A 1BI4B 4CJ3A 3OYAA 3KK3A 1NOZA 4DQPA 2HHWA 4NCBA 4AHTA 3LP3A 3DM2A 4KRFA 4DTPA 4I2PA 4PA1A 3QINA 3P5JA 1W9HA 4CGDA 2Y1IA 4CJRA 3O3HA 4YNQA 4MQ3A 1JXBA 2EX3A 2XY5A 4KKOA 4PWDA 2G8VA 1WAFA 1Q9YA 4FM2A 4OKKA 4FJ8A 3HL8A 4LD0A 4KHYA 4B9TA 1G15A 4DTSA 3VQBA 1Q8IA 4W5OA 4JS5A 3RTVA 1CXQA 3ZSRA 5HBMA 1ZBUA 1JLBA 2IAJA 2KFZA 1T05A 1N6QA 4H4MA 4IDKA 3T3FA 4IG0A 3TANA 4Z4EA 4FVMA 4E1NA 3AA3A 5CYMA 1R0AA 4AILC 1EX4A 3QEXA 3ZSQA 4J2BA 1JLFA 3C6TA 4HUGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIS A;  2RF2 A;  1NK6 A;  1ZBI A;  1F21 A;  4FXD A;  1YTU A;  4CFB A;  3T1A A;  3L8B A;  3CM5 A;  3SPZ A;  3JSM A;  3TI0 A;  1J5O A;  4OJR A;  1ASU A;  4CHP A;  4CK1 A;  4OPJ A;  3QIP A;  4FJI A;  1S1X A;  4CK3 A;  2YHA A;  3OY9 A;  1UAX A;  3C94 A;  4DTO A;  1SKW A;  4DWI A;  4FZY A;  4FJL A;  3HK2 A;  3DMJ A;  4NYN A;  4CEE A;  3NCI A;  4M3T A;  3VA0 A;  4DF8 A;  1S1V A;  1UA0 A;  2I5J A;  3LAN A;  3HP6 A;  3KKR A;  1EKE A;  4C8N A;  5KRT A;  3QER A;  4B9V A;  4O4G A;  3M8P A;  2B5J A;  3AA2 A;  1Q9X A;  2FBY A;  1HMV A;  3KLI A;  3CFO A;  3ZSX A;  4E7K A;  3KJV A;  1S5J A;  1S1T A;  1XWL A;  2KQ2 A;  3AO2 A;  3L2Q A;  3EYZ A;  3OS1 A;  1Z25 A;  5C25 A;  3SYZ A;  2G8W A;  1LV5 A;  4J2A A;  4FK0 A;  3VQC A;  1KLM A;  3RMC A;  3DRS A;  4RW8 A;  3KLF A;  1S6P A;  4CES A;  3QEP A;  4CHY A;  2JGU A;  3V1O A;  4CJS A;  3V9Z A;  1RT1 A;  1O1W A;  2P1J A;  3TWH A;  1RT3 A;  3PV8 A;  1YTA A;  4KB0 A;  4KTQ A;  4M3W A;  3L3V A;  1TGO A;  3ZT2 A;  3EY1 A;  1QSS A;  4B9S A;  3LWL A;  3V1Q A;  3L3U A;  2HW3 A;  1LAV A;  3HP9 A;  3MAQ A;  4FZX C;  1WSH A;  2HHT A;  1C1B A;  1J53 A;  4C8O A;  4FJ7 A;  4OLA A;  4JRQ A;  1RT7 A;  4M42 A;  4EZ6 A;  3AVI A;  4PQU A;  4CJW A;  3SQ0 A;  3V9W A;  1RDB A;  4C8M A;  1HPZ A;  5HRO A;  2NUB A;  4E7L A;  2ZE2 A;  2PYL A;  1ZYQ A;  4B9N A;  4FJJ A;  4DS5 A;  1TKZ A;  5I42 A;  4J2E A;  4FM0 A;  3C6U A;  3MEE A;  3DLB A;  4ELT A;  3OYJ A;  4EZ9 A;  4CGH A;  4BDY A;  4DLG A;  4FJX A;  4DTM A;  5SWM A;  1RBT A;  1VSI A;  3TR8 A;  3HT3 A;  3HVT A;  4CCH A;  1RT2 A;  3KK2 A;  1TL3 A;  1RBS A;  3PX0 A;  5JS1 A;  3TAQ A;  4BDZ A;  3QEI A;  4CJL A;  3JYT A;  1KVC A;  1XHX A;  5CYQ A;  4CEQ A;  4DTN A;  4KPY A;  1CZ9 A;  5CZ1 A;  4AHR A;  3L2R A;  3V6D A;  4I7F A;  2A1R A;  1RTD A;  1SL1 A;  3RWU A;  1CLQ A;  4ZTJ A;  1A5V A;  3VQ5 A;  2KW4 A;  1EXQ A;  5C24 A;  4IFY A;  4F3T A;  5EU7 A;  4F8R A;  4KHS A;  1RT5 A;  3OYF A;  1NJY A;  3I0R A;  3ZCM A;  3BGR A;  1QQC A;  1VSF A;  1L3S A;  4FJ5 A;  4DS4 A;  5K14 A;  1ZBF A;  1JLA A;  3SQ1 A;  2ITG A;  2XY7 A;  3SPY A;  1U49 A;  1U48 A;  3KD1 E;  4DSI A;  4L8R B;  5J1E A;  1RTJ A;  3CFR A;  1A5W A;  4KV8 A;  3KTQ A;  3OYB A;  3EZ5 A;  3ZSY A;  3MXM A;  1RT6 A;  3S9H A;  4QAG A;  3OYI A;  1TVR A;  3K57 A;  3OYD A;  5J2P A;  4LSL A;  3RRG A;  3LP1 A;  1WAJ A;  3PUF A;  1C1C A;  4Z0U A;  4CJE A;  5SZT A;  2F8S A;  3MED A;  1SL0 A;  1RDD A;  4KHW A;  1DLO A;  3O4N A;  1NOY A;  2X74 A;  1TKD A;  4FJK A;  3VQP A;  3QNO A;  3IAY A;  2Z1H A;  3C95 A;  3KD5 E;  2QKB A;  4DTU A;  1HYZ A;  4CJ4 A;  3AVC A;  3PX4 A;  4CGJ A;  2OA8 A;  3ULD A;  3NF8 A;  2OPQ A;  3AO5 A;  3OYE A;  2GBZ A;  1IH7 A;  1CZB A;  3AVN A;  3IG1 A;  4O55 A;  3RRH A;  4ELU A;  4FJM A;  3G0Z A;  3QLH A;  1I3A A;  1ITG A;  1S1U A;  1J9A A;  2A1S A;  3VQ7 A;  3AVG A;  4CER A;  4KFB A;  2YNF A;  5KI6 A;  3TAB A;  1SKS A;  2X6N A;  2XRI A;  1X9W A;  4F2S A;  1K6Y A;  1RBV A;  3V4I A;  1KFS A;  4CHQ A;  4KB1 A;  3OYK A;  1WLJ A;  3AVK A;  1JL2 A;  3U3G A;  1NJZ A;  1A5X A;  1LW2 A;  4B9M A;  5DK5 A;  3NH0 A;  2HNY A;  5HRR A;  1MU2 A;  1ASV A;  3L2W A;  3CQ8 A;  1UOC A;  3V9X A;  3WNH A;  4TSX A;  3KIO A;  1BQN A;  4BWM A;  5DMR A;  4HCB A;  1JL1 A;  1HYV A;  2QKK A;  3I0S A;  3NH1 A;  3L2V A;  3VA3 A;  4UQG A;  3PY8 A;  1KFD A;  4W5R A;  1WSI A;  1TK5 A;  1JKH A;  3OYN A;  3AVL A;  4B8A B;  4NCG A;  3KLE A;  3AA5 X;  1D9D A;  1ZBH A;  4DSJ A;  4KI4 A;  4O44 A;  1QTM A;  3ISN C;  2GV9 A;  1XI1 A;  2XY8 A;  1BL3 A;  3TAG A;  2D5R A;  1BGX T;  1RIL A;  4CF0 A;  3VQQ A;  2Y1J A;  1QHT A;  3KKS A;  1QSY A;  1KRP A;  2HB5 A;  3L2U A;  3MXI A;  3M8R A;  1XC9 A;  3D45 A;  4DQS A;  4FLU A;  2HNZ A;  4W5T A;  2VG7 A;  5E41 A;  1LWF A;  1HNV A;  3DOL A;  4CFC A;  4BE0 A;  3OYG A;  3SUQ A;  1HQE A;  1DTQ A;  4ICL A;  1JXE A;  4FJG A;  4CHO A;  3AO4 A;  1BCO A;  3VQE A;  2KZM A;  3OYC A;  4LSN A;  3RMD A;  4OPK A;  3LAM A;  1D9F A;  2G8F A;  3B6O A;  1LWC A;  2OPP A;  3O3G A;  4GW6 A;  3TAR A;  4BE1 A;  4J2D A;  3AVJ A;  2F8T A;  3FFI A;  1TKX A;  1U04 A;  1NJW A;  1NJX A;  3DLE A;  4FLX A;  3ITH A;  4BDP A;  2HVI A;  3MEG A;  4CE9 A;  3KLH A;  4DF4 A;  4I9L A;  1VSM A;  3SCX A;  3WNF A;  4HVJ A;  4MFB A;  4E19 A;  1TK8 A;  3RMA A;  1U47 A;  4GVM A;  3NAE A;  3LPU A;  4CGI A;  4M3R A;  3ZT0 A;  4XIU A;  2YHB A;  3K59 A;  4F4K A;  3CFP A;  1VSL A;  1T7P A;  2BGG A;  3DRP A;  3DYA A;  3HO1 A;  3H08 A;  3IRX A;  3NGY A;  1C6V A;  2X78 A;  5HRP A;  1N5Y A;  4DSK A;  3OYM A;  2E6L A;  3NHG A;  2JLE A;  3LAK A;  1L5U A;  4FJH A;  5KGX A;  1ASW A;  1VSD A;  4E7H A;  4OKJ A;  4FLW A;  1VSK A;  2Z1G A;  1Y97 A;  3NDK A;  3V9U A;  1U45 A;  1XHZ A;  1B92 A;  1JLE A;  4G1Q A;  2RKI A;  4KAZ A;  1RBR A;  3TAM A;  3ZSZ A;  1RDA A;  4FLV A;  1NK4 A;  3NF6 A;  4PY5 A;  3G10 A;  4AHS A;  1J54 A;  4CEF A;  2G8K A;  4FYD A;  5CY4 A;  4AHV A;  4R5P A;  4HHT A;  3VQA A;  4DTR A;  1NKC A;  4HCC A;  4ID5 A;  3OJU A;  1VK0 A;  1WSJ A;  4DMN A;  2FBT A;  3IS9 A;  3D0P A;  4QCL A;  3OYH A;  4CK2 A;  5C42 A;  4Z4F A;  4IFV A;  4CJU A;  1TAU A;  4AHC A;  3PX6 A;  4Z4H A;  1GOB A;  1REV A;  3DRR A;  3NFA A;  2G8U A;  1L3T A;  3ZT3 A;  4KI6 A;  1LWE A;  3LP2 A;  4N41 A;  3LZJ A;  5FDL A;  3U3Y A;  1NKB A;  4KHQ A;  1HNI A;  1BCM A;  4EP4 A;  2ETJ A;  3MEC A;  4CJQ A;  1KLN A;  4LH5 A;  5FRO A;  2DFH A;  4HUF A;  1L3U A;  3AO1 A;  1VSJ A;  4O5B A;  4M3Z A;  2PZS A;  2WON A;  2DFF A;  1IG9 A;  3SJJ A;  4DQR A;  2ZQB A;  1KSP A;  2PYJ A;  2IS3 A;  4CF8 A;  4DG1 A;  4B9L A;  4FZZ A;  3AO3 A;  4WE1 A;  3DLK A;  2IC3 A;  1SV5 A;  2O4G A;  4CHN A;  3TAE A;  1NK9 A;  3DLR A;  4Z4C A;  1WSF A;  2OPS A;  3WNG A;  3SQ2 A;  5KRS A;  4JS4 A;  5J2N A;  2ZD1 A;  3NF7 A;  3THV A;  2Z1J A;  2RPI A;  2QXF A;  3NBP A;  1HJR A;  1WNS A;  1C0U A;  1S6Q A;  1BHL A;  1U4B A;  3CYM A;  5D3G A;  2VWJ A;  1RTI A;  4AHU A;  3F9K A;  4K8X A;  5KTQ A;  3ZSO A;  3SNN A;  4Y1C A;  4FLZ A;  2XY6 A;  1KVA A;  1X9S A;  3RR8 A;  2G8I A;  2DFE A;  4Y1D A;  1IKX A;  3SUN A;  1TV6 A;  1IKW A;  5J2Q A;  2HHQ A;  1IO2 A;  1CXU A;  3WNE A;  2FBX A;  4B8C A;  3O3F A;  3UIQ A;  5I3U A;  4CJV A;  4DFP A;  1WSE A;  1TL1 A;  2VWK A;  3VQ8 A;  1QSL A;  5FRM A;  3ZT4 A;  3PO5 A;  4ZTF A;  5CZ2 A;  1S1W A;  3P1G A;  1D8Y A;  2FBV A;  2WOM A;  1FXX A;  2YV0 X;  4HTU A;  2HMI A;  4FK2 A;  1B9D A;  4E7J A;  2OYQ A;  4N76 A;  1TKT A;  1C0M A;  3I8D A;  5HP1 A;  2YNH A;  5J2M A;  3QET A;  4KRE A;  4CF2 A;  3K5N A;  1X1P A;  4LH4 A;  1X9M A;  2IOC A;  4N5S A;  4IG3 A;  4CGG A;  1RBU A;  3SQ4 A;  4ELV A;  3CM6 A;  4M41 A;  2QK9 A;  3SUP A;  4DFM A;  1RDC A;  2O4I A;  2ATQ A;  4DTJ A;  3HJF A;  1JLG A;  3VQ4 A;  3VQ6 A;  1FK9 A;  4I2Q A;  4CIF A;  1WSG A;  2XHB A;  4FLY A;  3F73 A;  2XO7 A;  3HPH A;  2VG6 A;  3DLG A;  3VN5 A;  4CGF A;  1W0H A;  2FC0 A;  1KCF A;  3ALY A;  3PO4 A;  2KZZ A;  3MXJ A;  4B3O A;  1LAW A;  4DQQ A;  4DSE A;  3LWM A;  1UWB A;  3QES A;  1I39 A;  4FW1 A;  2IDO A;  4GMJ B;  5JS2 A;  4CJ5 A;  5HRN A;  3HM9 A;  4JLH A;  3NGI A;  4KTW A;  4DSF A;  4KO0 A;  2B6A A;  3QIO A;  3HST B;  4F3O A;  2YKN A;  3QNN A;  3OVN A;  4CED A;  4CJK A;  3ZSV A;  4OLB A;  5T7B A;  1TK0 A;  1LW0 A;  4M3X A;  4CEC A;  4QOZ B;  1IKV A;  2D0B A;  1T8E A;  4CF1 A;  3NH2 A;  2HVH A;  4H8K A;  3AVH A;  1JLC A;  4CHZ A;  3SZ2 A;  3SUO A;  2PY5 A;  3QO9 A;  3DLH A;  2DY4 A;  4RW4 A;  2D0C A;  1SL2 A;  1WN7 A;  4FK4 A;  2YKM A;  3NE6 A;  1SKR A;  4EP5 A;  4E3S A;  3P83 D;  1FKO A;  3AVB A;  3HYF A;  3A2F A;  1NK5 A;  1HRH A;  4ID1 A;  4RG8 A;  4W5N A;  1D5A A;  4N47 A;  1VRU A;  4CFA A;  3TAP A;  3V81 A;  4FLT A;  4C8K A;  3RMB A;  1C0T A;  2BE2 A;  4FM1 A;  4W5Q A;  4E7I A;  4N56 A;  3U6F A;  4IKF A;  4CF9 A;  3SV4 A;  4I9Q A;  1DTT A;  3SV3 A;  3RR7 A;  3VQD A;  1NK8 A;  1RCH A;  4DQI A;  4DU3 A;  1HYS A;  2HND A;  4DFJ A;  4K8Z A;  1L3V A;  2R7Y A;  3B6P A;  4O0J A;  3O4Q A;  1KVB A;  2BDP A;  3HPO A;  4DTX A;  3TAF A;  4FJ9 A;  4M45 A;  2BAN A;  4F2R A;  4DLE A;  1GOA A;  1HQU A;  4OKE A;  2EHG A;  2VG5 A;  1UA1 A;  1KTQ A;  2Q3S A;  3NGZ A;  4IBN A;  1NK7 A;  4HUE A;  5HRS A;  3S3N A;  4CJT A;  1NKE A;  3QEW A;  1QS4 A;  3LPT A;  2W42 A;  2HHS A;  5HLF A;  4B9U A;  3T19 A;  1VRT A;  2E6M A;  1Z26 A;  2RN2 A;  4CIG A;  4FW2 A;  3LAL A;  3LP0 A;  4M3U A;  3K5O A;  1S9G A;  4Z4I A;  1RTH A;  3OJS A;  4KTZ A;  2P51 A;  4OGE A;  3S3O A;  4BAC A;  4OVL A;  1YT3 A;  2P5O A;  2HHU A;  3K58 A;  2F96 A;  2KTQ A;  2Z1I A;  1TAQ A;  2YNG A;  4E0D A;  4E89 A;  3QEV A;  1FKP A;  4CIE A;  4ZHR A;  4FJN A;  4RW7 A;  4CEZ A;  1EP4 A;  2GUI A;  4LY7 A;  4PUO A;  1SUQ A;  3VQ9 A;  2HHX A;  2HHV A;  4OGC A;  4DFK A;  1JLQ A;  4YFU A;  1BQM A;  4KHN A;  4FCY A;  4BWJ A;  3AVM A;  4C8L A;  3AV9 A;  1BIZ A;  4Z4G A;  4CFD A;  3DOK A;  3CG7 A;  4NYF A;  3ASM A;  3E01 A;  2OZM A;  3OYL A;  4CJF A;  4Q0B A;  3OS0 A;  1EET A;  1RNH A;  2D0A A;  4DU1 A;  4DSL A;  3S3M A;  3AVF A;  3KK1 A;  4Q5V A;  3M8S A;  1NK0 A;  1C1A A;  4CJP A;  3NF9 A;  4H4O A;  2IGI A;  1QE1 A;  3V1R A;  4CEB A;  3HXM A;  3LDS A;  4RW9 A;  4CEA A;  4B08 A;  3BDP A;  3K5L A;  3V9S A;  1T03 A;  1VSE A;  5KGW A;  4M3Y A;  2G8H A;  3LZI A;  5FRN A;  1B9F A;  3SI6 A;  2LSN A;  3K2P A;  2X6S A;  3HPG A;  4O0I A;  1ZBL A;  3M8Q A;  1RT4 A;  1BIU A;  2E4L A;  3AVA A;  2P5G A;  4DU4 A;  2KFN A;  2B4J A;  3ZT1 A;  1IKY A;  3DI6 A;  4E1M A;  4CEO A;  4JRP A;  3HVR A;  4BE2 A;  2OZS A;  3ZSW A;  2AJQ A;  2DTU A;  4KHU A;  1BI4 A;  1YVU A;  2YNI A;  1GOC A;  1VSH A;  3OS2 A;  3K5M A;  3KLG A;  4AH9 A;  4NCA A;  1S9E A;  2OPR A;  3AA4 A;  4RW6 A;  1BI4 B;  4CJ3 A;  3OYA A;  3KK3 A;  1NOZ A;  4DQP A;  2HHW A;  4NCB A;  4AHT A;  3LP3 A;  3DM2 A;  4KRF A;  4DTP A;  4I2P A;  4PA1 A;  3QIN A;  3P5J A;  1W9H A;  4CGD A;  2Y1I A;  4CJR A;  3O3H A;  4YNQ A;  4MQ3 A;  1JXB A;  2EX3 A;  2XY5 A;  4KKO A;  4PWD A;  2G8V A;  1WAF A;  1Q9Y A;  4FM2 A;  4OKK A;  4FJ8 A;  3HL8 A;  4LD0 A;  4KHY A;  4B9T A;  1G15 A;  4DTS A;  3VQB A;  1Q8I A;  4W5O A;  4JS5 A;  3RTV A;  1CXQ A;  3ZSR A;  5HBM A;  1ZBU A;  1JLB A;  2IAJ A;  2KFZ A;  1T05 A;  1N6Q A;  4H4M A;  4IDK A;  3T3F A;  4IG0 A;  3TAN A;  4Z4E A;  4FVM A;  4E1N A;  3AA3 A;  5CYM A;  1R0A A;  4AIL C;  1EX4 A;  3QEX A;  3ZSQ A;  4J2B A;  1JLF A;  3C6T A;  4HUG A; 
#chains in the Genus database with same CATH topology
 2FF3 B;  2GWK A;  2RF2 A;  3ID6 A;  4WFA L;  3SPZ A;  2O8F A;  1ASU A;  3HBT A;  4CHP A;  4ISF A;  4FJI A;  1S1X A;  4FJL A;  3OY9 A;  1UAX A;  4GV6 A;  3DMJ A;  4CEE A;  2V7Y A;  3IDH A;  3NCI A;  4M3T A;  4DF8 A;  3O1B A;  2I5J A;  3HP6 A;  3KKR A;  1EKE A;  4O4G A;  4CZL A;  2FBY A;  3J7Y P;  3KLI A;  3KJV A;  2KQ2 A;  4CZG A;  3CCM N;  3O9Q A;  1NMD A;  1Z25 A;  3A5O C;  3THY B;  3SYZ A;  4FL9 A;  4CZF A;  2G8W A;  3DJC A;  3KLF A;  4DV4 K;  4CHY A;  5M1K A;  3V1O A;  5AZI B;  3V9Z A;  5BN8 A;  1YHQ N;  4XH1 A;  1RT3 A;  2WUS A;  1WB9 A;  4KTQ A;  4BC4 A;  3L3V A;  4B9S A;  3MAQ A;  5FPM A;  4A62 A;  4PQU A;  3SQ0 A;  4C8M A;  4IXC A;  5HL7 L;  1ZYQ A;  2HBL A;  3UKU A;  4J2E A;  4ELT A;  3OYJ A;  4EZ9 A;  4BRK A;  4DLG A;  1RBT A;  1TL3 A;  3PX0 A;  3ZEU A;  5KPR A;  5BPM A;  1SS6 A;  4ILH A;  1CZ9 A;  5CZ1 A;  3V6D A;  1EXQ A;  5C24 A;  2QA4 N;  4F3T A;  5EU7 A;  1NJY A;  3MK6 A;  4FJ5 A;  1QQC A;  2V51 B;  3P4I A;  3VER A;  1U49 A;  3G25 A;  3OYB A;  5BR9 A;  3S9H A;  3OYI A;  1R59 O;  5J2P A;  3OYD A;  2ZM6 K;  4CJE A;  2D4W A;  3MED A;  4KHW A;  1DLO A;  3EEQ A;  3CJ1 A;  2ZJQ L;  2E2N A;  2X74 A;  1TKD A;  1OH6 A;  3K0S A;  3AAQ A;  2Z1H A;  3C95 A;  2NNW A;  2ITM A;  2OA8 A;  1OH7 A;  3FZL A;  3WQT A;  2OPQ A;  3AO5 A;  3OYE A;  5F1X A;  3KWI A;  3IG1 A;  3CCS N;  5ADX A;  1I3A A;  1K8K A;  1J9A A;  3AVG A;  5FPE A;  2CGK A;  3JAM O;  3RSE A;  1X9W A;  1KFS A;  4CHQ A;  3ENH A;  4IDH A;  1JL2 A;  1NJZ A;  1A5X A;  1LW2 A;  3L2W A;  4XH4 A;  3DXM B;  1OVY A;  4A5B A;  2QEX N;  1JL1 A;  4W5R A;  1WSI A;  1YAG A;  1ZBH A;  4KH6 A;  4O44 A;  3ISN C;  1XI1 A;  2XY8 A;  5FPN A;  2P9S B;  3TAG A;  1RIL A;  3VQQ A;  2Y1J A;  3WEE A;  3CXC M;  1MDU B;  2ASM A;  3FZK A;  1XC9 A;  4BRQ A;  4MLE A;  1VQ9 N;  1GLD G;  3D2E A;  2HNZ A;  4W5T A;  1QVF M;  3DOL A;  3OYG A;  1HQE A;  1DTQ A;  1JXE A;  2GEL A;  2KZM A;  3LM2 A;  4LSN A;  2UYT A;  1K73 O;  3B6O A;  3AVJ A;  3FFI A;  4OX9 K;  3ITH A;  3CC2 N;  4BDP A;  4I9L A;  1EWQ A;  4HVJ A;  4E19 A;  2E5L K;  2ZF5 O;  4BQZ A;  1C0F A;  3AY9 A;  3LPU A;  1BOT O;  1P8Z A;  3TSQ A;  4XIU A;  2O8E B;  1YIT N;  1HX1 A;  4F4K A;  2Q0R A;  3DYA A;  3NGY A;  2YI1 A;  2X78 A;  1L5U A;  3AAR A;  4FJH A;  1ASW A;  3J80 O;  4OKJ A;  1VSK A;  1U2V B;  1U45 A;  4BQL A;  2NRV A;  3TAM A;  1RDA A;  5CE3 A;  2G8K A;  1J54 A;  1N8R O;  4FYD A;  1TYQ A;  4AHV A;  4R5P A;  4HHT A;  3VQA A;  1Y64 A;  3OJU A;  1WSJ A;  3CQY A;  4Z4F A;  4IFV A;  4CJU A;  1X9J A;  3VEW A;  4AHC A;  3PX6 A;  5FPD A;  2G8U A;  4B3T K;  2A6A A;  5EXW A;  5AQU A;  5FDL A;  3U3Y A;  2P9U B;  4KHQ A;  2E88 A;  1L3U A;  4O5B A;  2DFF A;  1IG9 A;  4IZ9 A;  4FZZ A;  2PYJ A;  3AO3 A;  4WE1 A;  1SV5 A;  1GLA G;  4CHN A;  3ZLJ A;  1OH8 A;  3TTC A;  4CD1 A;  4B1W B;  2OPS A;  4M7X A;  2D1K A;  5KRS A;  3TSP A;  4JS4 A;  2ZD1 A;  4MDA A;  3THV A;  5AQW A;  2QXF A;  1BHL A;  1U4B A;  3O80 A;  5KTQ A;  1KVA A;  1TV6 A;  3M3Z A;  3UIQ A;  3WNE A;  5C12 A;  5I3U A;  4DFP A;  1QSL A;  3LL3 A;  5M1P A;  5I9E B;  2A41 A;  4H5V A;  4ZTF A;  1S1W A;  3GE1 A;  4HTU A;  2NLX A;  1TKT A;  3I8D A;  5HP1 A;  3BP8 A;  2UXB K;  1X1P A;  4FWK A;  2GEM A;  1RGI A;  2IOC A;  3G4S N;  2NRX A;  3E1Y A;  4IG3 A;  4CGG A;  1T6C A;  4ELV A;  4M41 A;  5BPN A;  1OH5 A;  3VQ6 A;  1FK9 A;  2PFU A;  2XHB A;  2QWR A;  3C6A A;  3QES A;  4FW1 A;  4JLH A;  3CQX A;  2HMP A;  3J81 O;  3OVN A;  4H5T A;  3ZSV A;  5T7B A;  5JLF A;  3CET A;  3QIC A;  2E1Y A;  3A5L C;  4IEI A;  4B3R K;  3CJB A;  1RDW X;  4XEI A;  3QFU A;  4CF1 A;  3NH2 A;  4H8K A;  2PY5 A;  1JLC A;  4RW4 A;  4M7Y A;  4AQY K;  3HRG A;  4JKD A;  4EP5 A;  2HBM A;  4O8U A;  2O8B A;  4R79 A;  2O8F B;  4ID1 A;  4W5N A;  1D5A A;  4ILG B;  3RMB A;  4LC9 B;  1DTT A;  1L3V A;  4O0J A;  1KVB A;  4DLE A;  4GVE A;  2EHG A;  2VG5 A;  2Q3S A;  5EX5 A;  4HUE A;  5HRS A;  4CJT A;  3JXU A;  3QEW A;  1IV0 A;  3R9P A;  1VRT A;  4X65 K;  2HST A;  4OGE A;  3S3O A;  1S3X A;  4BAC A;  4BRC A;  2IIR A;  2HHU A;  4DB3 A;  2Z1I A;  3ID8 A;  4J8F A;  3AAP A;  4CIE A;  3VEY A;  5M1Q A;  4PKH A;  4K25 A;  2VQF K;  1BO5 O;  2GUI A;  4PUO A;  1SUQ A;  3VQ9 A;  2HHX A;  4OGC A;  4DFK A;  3THW A;  1M1K O;  1I94 K;  4FCY A;  4BWJ A;  4C8L A;  3MMV A;  4NYF A;  4Q0B A;  5AQG A;  5JVG L;  1BU6 O;  3ZEU B;  2D0A A;  4DSL A;  3KK1 A;  4Q5V A;  3M8S A;  2F9W A;  2JWL A;  3BZC A;  4CJP A;  4H4O A;  2HBK A;  4H5W A;  1YUW A;  1T3V A;  2A42 A;  4B08 A;  3K5L A;  2OTL N;  4M3Y A;  3SI6 A;  1HNW K;  4GKK K;  3T69 A;  1RT4 A;  5F0X A;  3ZX3 A;  3E9O A;  3L6Q A;  4BVO A;  3CI5 A;  4BRM A;  4A59 A;  1HKB A;  2F4V K;  4NXN K;  2AJQ A;  2DTU A;  3HI0 A;  4BR5 A;  4GY2 B;  5GAG P;  4JI8 K;  2W41 A;  4AH9 A;  1OVQ A;  1S9E A;  3A5M C;  1BI4 B;  3K9J A;  3OYA A;  1NOZ A;  4AHT A;  3H45 C;  4DTP A;  4I2P A;  1VQ6 N;  3QIN A;  3P5J A;  1K8K B;  4CGD A;  3O3H A;  4BRN A;  4MQ3 A;  3WXL A;  4A5A A;  2O8D B;  3FE1 A;  1WAF A;  2QWM A;  3BUZ B;  2HOE A;  1Q9Y A;  1XMO K;  3DAW A;  5AJ3 K;  2IVP A;  2NRW A;  3VQB A;  4W5O A;  3CPE A;  5AQO A;  1J5E K;  3CD6 N;  2IAJ A;  4AF1 A;  1T05 A;  1Q18 A;  3T3F A;  1NGI A;  3VF6 A;  3TAN A;  5CYM A;  4YOX A;  4J2B A;  4PKI A;  3ZSQ A;  1S22 A;  4HUG A;  4KH4 A;  1NK6 A;  4FXD A;  3L8B A;  1J5O A;  4OJR A;  1ZBS A;  2E20 A;  4KBO A;  3QFP A;  2YHA A;  1SKW A;  4FZY A;  3HK2 A;  4DWI A;  4K0K K;  1X3M A;  3O9S A;  3D2E B;  1VQN N;  2D0O A;  1S1V A;  1XNR K;  1HLU A;  1YIJ N;  4BG9 A;  4JI1 K;  2B5J A;  3AA2 A;  1Q9X A;  3CPW M;  3T7Z A;  4JEP A;  4LF8 K;  3S41 A;  5GAD P;  1XWL A;  1S1T A;  3CMA N;  2Q2R A;  3NMU A;  4BC3 A;  1KLM A;  4I6M A;  4CJS A;  3G71 N;  1ATN A;  4KB0 A;  3ZT2 A;  1NWK A;  3LWL A;  2VCP A;  1LAV A;  1BG3 A;  2HHT A;  1C1B A;  1J53 A;  2QM1 A;  4OLA A;  1NGJ A;  1HKG A;  4JRQ A;  1IG8 A;  2ZJP L;  1NGF A;  3AVI A;  4CJW A;  5HRO A;  1HPZ A;  4WQ4 A;  2O8C A;  4B9N A;  4JNE A;  5I42 A;  3I33 A;  3DLB A;  3C6U A;  4JKG A;  4YOW A;  4FJX A;  3HOS A;  4DTM A;  2YHX A;  5SWM A;  2W40 A;  2UUB K;  4WFB L;  3KK2 A;  1RBS A;  3TAQ A;  2UXD K;  3VEZ A;  1KVC A;  1XHX A;  5CYQ A;  5EVZ A;  4JI6 K;  4YY3 K;  4DTN A;  3U9D A;  4AHR A;  4DV5 K;  1RTD A;  2Q97 A;  3RWU A;  3EE8 A;  1SL1 A;  1GLF O;  4YOY A;  4BR9 A;  4KHS A;  1L3S A;  4DS4 A;  2ITG A;  1U48 A;  5J1E A;  1RTJ A;  3L0Q A;  3CFR A;  1A5W A;  4KV8 A;  3EZ5 A;  3ZSY A;  3MXM A;  1RT6 A;  1YI2 N;  3I56 N;  3PUF A;  1C1C A;  4Z0U A;  4B1V A;  3UKR A;  1P90 A;  3SJH A;  3QNO A;  1FW6 A;  3P38 A;  3IAY A;  3KD5 E;  4CJ4 A;  4CGJ A;  3ULD A;  2P9L A;  3NF8 A;  4JKH A;  4CZE A;  2GBZ A;  1IH7 A;  3AVN A;  4O55 A;  4A57 A;  5LY3 A;  2WFB A;  1OKJ A;  4IJA A;  3G0Z A;  3QLH A;  4FJM A;  1S1U A;  1Q86 O;  3W0L A;  3VQ7 A;  4F2S A;  3V4I A;  1RBV A;  1E3M A;  3U3G A;  3C7N A;  4B3M K;  5FLX O;  3NH0 A;  1ZC6 A;  4H5N A;  5HRR A;  1MU2 A;  2A40 A;  4BWM A;  3I0S A;  3VA3 A;  4UQG A;  1TK5 A;  3OYN A;  4B8A B;  3KLE A;  4UY8 O;  1D9D A;  3HSC A;  1QTM A;  2GV9 A;  1WUA A;  3FFK B;  5DM7 L;  1VQP N;  3CIP A;  2D5R A;  4CF0 A;  3C65 A;  3KKS A;  2HB5 A;  1QHA A;  1XQS C;  3M8R A;  5BRD A;  4FLU A;  5E41 A;  1HNV A;  1MA9 B;  4WCE L;  3MX2 A;  4FPB A;  4FJG A;  5AZJ A;  2WBN A;  3AO4 A;  5H1S Q;  1BCO A;  3LAM A;  4J2D A;  3R3L A;  3DLE A;  4FLX A;  4DV6 K;  3KLH A;  4CE9 A;  4DCH A;  3M6G A;  3VEX A;  1ZXO A;  3SCX A;  1M90 O;  4LF5 K;  4FWL A;  4MFB A;  1RDU A;  4FWO A;  4WYB A;  3O4W A;  1YJN N;  4GVM A;  4CGI A;  4M3R A;  3TSU A;  5LMN K;  3CCJ N;  2BGG A;  3CFP A;  4MDB A;  3IRX A;  2HHV A;  4DSK A;  3MCA B;  2E6L A;  3OYM A;  1KAX A;  5KGX A;  4X66 K;  4JKE A;  4E7H A;  4XH5 A;  1XHZ A;  1JLE A;  3P39 A;  2P9P B;  1WBB A;  4B1Z A;  4CEF A;  4CW7 B;  4HCC A;  4BRD A;  4ID5 A;  1VK0 A;  3IS9 A;  5KPZ A;  4CK2 A;  4X64 K;  5C42 A;  5GIP A;  1TAU A;  4NLC A;  3WT0 A;  2QW9 A;  3DRR A;  4DR6 K;  3C6H A;  4DR7 K;  4KI6 A;  3LP2 A;  3E9L A;  4DKW A;  3CCE N;  2YJE A;  4B3S K;  1NKB A;  3HZ6 A;  1K8A O;  4EP4 A;  2ETJ A;  1KLN A;  4BRF A;  4CJQ A;  4HUF A;  4GKJ K;  3SJJ A;  2ZQB A;  4FWQ A;  5AQL A;  2IS3 A;  3SBT A;  4CF8 A;  4DG1 A;  3L4Q A;  3THW B;  3DLK A;  2IC3 A;  5E84 A;  2O4G A;  3G6E N;  1TUY A;  4OPA A;  4FOI A;  3R1X A;  3DLR A;  4Z4C A;  1WSF A;  1NBW A;  4JN4 A;  3LDP A;  3NF7 A;  4QS9 A;  2RPI A;  1SZ2 A;  1HJR A;  4O8K A;  4DR5 K;  1C0U A;  4LFC K;  4F9O A;  3CYM A;  5D3G A;  4BVP A;  5AQX A;  4AHU A;  3NVM A;  3ZSO A;  4FOE A;  1X9S A;  2G8I A;  4Y1D A;  3SUN A;  5J2Q A;  1HUX A;  2HHQ A;  2VWK A;  5FRM A;  2P9I A;  3EKS A;  3D2F B;  5CZ2 A;  2WOM A;  1XC3 A;  2HMI A;  1B9D A;  4E7J A;  1YVN A;  4JI7 K;  2YNH A;  3SBG A;  4LH4 A;  3MN5 A;  1QQO A;  3SQ4 A;  3CM6 A;  3SUP A;  4DFM A;  5BRF A;  2O4I A;  2ATQ A;  3EO3 A;  3HJF A;  4CIF A;  1ATS A;  1WSG A;  4FLY A;  5C10 A;  3F73 A;  3WXK A;  2KLA A;  2VG6 A;  2KZZ A;  2W6K A;  1VAZ A;  4B3O A;  3CJC A;  4DQQ A;  4CBX A;  4CBW A;  1W2B M;  2IDO A;  4GMJ B;  5HRN A;  3H1V X;  3HM9 A;  3NGI A;  4KO0 A;  3QIO A;  3HST B;  4F3O A;  4CZK A;  3QNN A;  4CED A;  4OLB A;  1LW0 A;  4JKA A;  2D0B A;  4PL8 A;  2HVH A;  3SUO A;  4CHZ A;  4CZH A;  3QO9 A;  2Q1N A;  2D0C A;  3ATU A;  1SL2 A;  1WN7 A;  4BRG A;  4FK4 A;  1SKR A;  3L4I A;  3P83 D;  2QWP A;  4QS8 A;  3CME N;  2HF3 A;  5A2Q O;  4B1U B;  3V81 A;  1VQ8 N;  4DQ8 A;  4W5Q A;  4E7I A;  4CF9 A;  1U6Z A;  3O6W A;  3RR7 A;  1LOT B;  4DU3 A;  4BR2 A;  1J6Z A;  2HND A;  4DFJ A;  1EQY A;  4K8Z A;  2R7Y A;  3B6P A;  3TAF A;  4FJ9 A;  4M45 A;  1HQU A;  1GOA A;  1UA1 A;  1NK7 A;  3NGZ A;  4IBN A;  2UUA K;  3LPT A;  3SK3 A;  4I6M B;  3T19 A;  2Q36 A;  4CIG A;  4K42 A;  4M3U A;  3GL1 A;  1S9G A;  4Z4I A;  1RTH A;  3TU5 A;  2P5O A;  2F96 A;  2KTQ A;  3I55 N;  4E89 A;  5AFU H;  1FKP A;  2BH1 A;  3OBW A;  4PL7 A;  4JKG B;  3LM9 A;  3AVM A;  4Z4G A;  3PIP L;  3CG7 A;  3ASM A;  3E01 A;  4BRH A;  5M1F A;  4KHP K;  4CJF A;  1EET A;  4DU1 A;  1YXQ A;  1NK0 A;  1C1A A;  3NF9 A;  2IGI A;  3DXK A;  1QE1 A;  3HXM A;  4DV7 K;  5EOY A;  1SAZ A;  4CEA A;  3BDP A;  1NLV A;  4CZI A;  1HR0 K;  2G8H A;  3LZI A;  2Q0U A;  5FRN A;  1B9F A;  2LSN A;  2W6L A;  2X6S A;  2JWK A;  3H46 O;  4O0I A;  4MO4 A;  4BRA A;  4JRP A;  5JVH L;  4BE2 A;  3ZSW A;  5AR0 A;  3THX A;  3AGK A;  3UKR B;  3J7Z O;  2UXC K;  1GLL O;  4NCA A;  3KZB A;  2OPR A;  4RTF D;  2P9L B;  4NCB A;  3LP3 A;  1W9H A;  4CJR A;  4YOR A;  2FXU A;  2G8V A;  3FR0 A;  1GLE G;  4FM2 A;  4FJ8 A;  3HL8 A;  3ZET B;  3D6R A;  1G15 A;  3RTV A;  1JLB A;  1KXP A;  5MLC Q;  3P31 A;  1NM1 A;  4WQ5 A;  4Z4E A;  3KVG A;  1VHX A;  1BIS A;  1F21 A;  3KK7 A;  3T1A A;  3CM5 A;  1KD1 O;  3QIP A;  3WXJ A;  3C94 A;  4NYN A;  3CER A;  1NNE A;  3LAN A;  3H3N O;  4B9V A;  1NU0 A;  3M8P A;  5AZJ B;  5GIN A;  1HMV A;  1IJJ A;  3CFO A;  4E7K A;  4IJN A;  3AO2 A;  1WOQ A;  2OAN A;  3N4P A;  5C25 A;  3VF2 A;  5F2R A;  4RW8 A;  5M1N A;  4DV0 K;  1S6P A;  4CES A;  1VQ7 N;  2JGU A;  5JLH A;  1RT1 A;  2CH5 A;  3TWH A;  3PV8 A;  3Q7B A;  2DPN A;  4M3W A;  4JHD A;  3V1Q A;  3HP9 A;  2CGL A;  4ISG A;  4K41 A;  4FJ7 A;  3LDO A;  3EZW A;  1RT7 A;  4M42 A;  1XUP O;  1RDB A;  1QZ6 A;  4E7L A;  1Q7Y O;  2ZE2 A;  4H0V B;  2HF4 A;  2ASP A;  3UKU B;  3TR8 A;  3HT3 A;  3HVT A;  1IBM K;  4CEQ A;  4KPY A;  2VGN A;  3Q7C A;  3L2R A;  2V52 B;  4I7F A;  1CLQ A;  4ZTJ A;  4DR3 K;  5TKW A;  1RT5 A;  3OYF A;  3I8B A;  3CF5 L;  3ZCM A;  3BGR A;  5K14 A;  1ZBF A;  1JLA A;  3SLC A;  2XY7 A;  3KD1 E;  4DSI A;  1JCF A;  3RRG A;  3K57 A;  1TVR A;  4LSL A;  4FWM A;  1CZA N;  1HNZ K;  2F8S A;  1SL0 A;  1RDD A;  5LL6 Z;  1VQO N;  3MN7 A;  1HYZ A;  4JD2 A;  4EHU A;  4DTU A;  5AQV A;  4JKB A;  4ELU A;  3H6E A;  2QWQ A;  4CER A;  4OPH A;  2YNF A;  5KI6 A;  3TAB A;  2X6N A;  2XRI A;  4JI4 K;  4KB1 A;  1K6Y A;  3O5B A;  4YOU A;  3WXI A;  3RSE B;  2HNY A;  3CQ8 A;  1UOC A;  4TSX A;  1BQN A;  2P9N A;  1T44 A;  4HCB A;  1E4F T;  1ESV A;  2CH6 A;  1HYV A;  2P9I B;  1NGD A;  4LFA K;  3NH1 A;  2E2P A;  3PY8 A;  4RWT A;  4DUY K;  1KFD A;  1JKH A;  4NCG A;  3AA5 X;  1BGX T;  1DGK N;  1QSY A;  1KRP A;  3L2U A;  4JKC A;  3SAG A;  3D45 A;  2NRR A;  1NG9 A;  3H3O B;  3WEE B;  4WFN L;  4HWI A;  2VG7 A;  4BE0 A;  4AM6 A;  3SUQ A;  4IO8 A;  5AQZ A;  3OYC A;  1D9F A;  4OPK A;  4NB4 A;  3O3G A;  4FWS A;  3TAR A;  1U04 A;  1NJW A;  4DV2 K;  2YHY A;  2HVI A;  2QWN A;  3KWG A;  4X62 K;  4BRI A;  1TK8 A;  3MN9 A;  2O8E A;  3VEN A;  3RMA A;  1NGC A;  2ZGZ A;  5BPL A;  3HOT A;  3ZT0 A;  2YHB A;  3K59 A;  3HO1 A;  1T7P A;  3J8A A;  1N5Y A;  2JLE A;  3LAK A;  2Z1G A;  2GUP A;  3V9U A;  3GBT A;  4G1Q A;  1JCG A;  2E2O A;  2VYP A;  2YX6 A;  1RBR A;  4DR4 K;  4IEE A;  1DT9 A;  4FLV A;  4FO0 A;  3WUH A;  3NF6 A;  5AQT A;  5CY4 A;  2F7T A;  4IOC L;  1NKC A;  3A0I X;  4DMN A;  2J4R A;  2RE2 A;  1TYQ B;  3PSF A;  5KQD A;  4Z4H A;  3NFA A;  1L3T A;  2I7N A;  3FZM A;  2WC9 A;  3LZJ A;  1ILY A;  4JKF A;  3K9K A;  1HNI A;  1Z6R A;  4GV3 A;  5FRO A;  4B1Y B;  3AO1 A;  1VSJ A;  4M3Z A;  1NGB A;  1KSP A;  4CI6 A;  5AQH A;  1NK9 A;  3B8A X;  2BTF A;  3SQ2 A;  5J2N A;  3PSI A;  3NBP A;  2QWO A;  3VGK A;  3A8Y A;  3O1W A;  4B1X B;  3DWL A;  2VWJ A;  3F9K A;  4ISE A;  4K8X A;  3SNN A;  4Y1C A;  3RR8 A;  3DXK B;  2XY6 A;  3FZH A;  2DFE A;  1IKX A;  1IKW A;  3FLC O;  2FBX A;  4B8C A;  4C1N K;  5BRE A;  1VQM N;  1WSE A;  2PAV A;  3VQ8 A;  3VTI A;  4B9Q A;  1QQN A;  3P1G A;  4CZM A;  1D8Y A;  1FXX A;  3J7A P;  2YV0 X;  5AQR A;  3NVK A;  4FK2 A;  5CR4 A;  3VET A;  1C0M A;  5JMV A;  3QET A;  3THX B;  1X9M A;  3O8M A;  1RBU A;  2A3Z A;  5IWA K;  2QK9 A;  1RDC A;  2NRT A;  4DTJ A;  1JLG A;  3VQ4 A;  1D4X A;  3HPH A;  4CGF A;  3VN5 A;  3DLG A;  1W0H A;  2FC0 A;  4JI5 K;  3MXJ A;  3CC4 N;  1LAW A;  4DUZ K;  1GLJ O;  3LWM A;  1UWB A;  4CJ5 A;  5JS2 A;  1IBK K;  4DSF A;  2B6A A;  4JK9 A;  3CJ7 A;  4BRO A;  1TK0 A;  4M3X A;  4QOZ B;  4CEC A;  1IKV A;  1T8E A;  4FPA A;  4ILJ A;  3AVH A;  3SZ2 A;  4BC5 A;  1XMQ K;  2DY4 A;  3DLH A;  4BY9 C;  2YKM A;  1NMN A;  4LFB K;  3HYF A;  1NK5 A;  1IBL K;  1HRH A;  4CJ7 A;  3MDQ A;  4N47 A;  4CFA A;  2IVN A;  4IOX A;  4FLT A;  4C8K A;  1C0T A;  2BE2 A;  4FM1 A;  2O8B B;  4N56 A;  4IKF A;  1Q81 O;  3SV4 A;  4I9Q A;  3SV3 A;  3VQD A;  5AFU A;  1NK8 A;  1RCH A;  1EWR A;  1BUP A;  3IFR A;  3QML A;  2E1Z A;  3TTD A;  2BDP A;  3A5N C;  4LF4 K;  2BAN A;  3ZX2 A;  1K9M O;  4BC2 A;  4F2R A;  4OKE A;  4H5R A;  3DLL L;  3BZK A;  3S3N A;  1QS4 A;  3U8X A;  1W97 L;  2W42 A;  2HHS A;  2D0P A;  1NGH A;  1Z26 A;  2RN2 A;  2QXL A;  4FW2 A;  3BF3 A;  3D7E O;  4JHD B;  3OJS A;  4KTZ A;  1VQK N;  4OVL A;  4Z94 A;  3SMS A;  4EHT A;  3K58 A;  1TAQ A;  1HNX K;  4H0O A;  2H3G X;  3EL2 A;  3QEV A;  3VEV A;  5BR8 K;  4FJN A;  4RW7 A;  1EP4 A;  4FWN A;  4LY7 A;  3ENO A;  1JLQ A;  2GWJ A;  4V19 S;  1BQM A;  4KHN A;  5AQN A;  2BUP A;  3AV9 A;  1BIZ A;  3DOK A;  4RCH A;  3GOI A;  4JAX A;  3OYL A;  4DV1 K;  3OS0 A;  4GNI A;  3OW2 M;  3AVF A;  2KKZ A;  1WBD A;  4NO7 A;  3V1R A;  5AQJ A;  5AQI A;  5LJW A;  1H1V A;  3V9S A;  4O5F A;  1VSE A;  4C23 A;  5BRH A;  1ATR A;  1S72 N;  5JIC A;  4LF9 K;  1QVG M;  3O08 A;  5C15 A;  2I7P A;  3AVA A;  2P5G A;  3ZT1 A;  4E1M A;  1FJG K;  2OZS A;  1BI4 A;  1YVU A;  1VSH A;  3OS2 A;  3K5M A;  4RW6 A;  3AA4 A;  4JD2 B;  4CJ3 A;  4JV5 K;  1C0G A;  3QBW A;  2HHW A;  3BEX A;  1JJ2 M;  2O8D A;  3DM2 A;  4KRF A;  4E1J A;  2Y1I A;  4YNQ A;  4PWD A;  2XY5 A;  4JI3 K;  5AQQ A;  4KKO A;  4DV3 K;  1T6D A;  4FVU A;  1KAZ A;  4JYA K;  4OKK A;  3OHR A;  4CD3 A;  4IWV A;  4LD0 A;  4B9T A;  4G9Z A;  1V4S A;  1Q8I A;  2QTD A;  1CXQ A;  2P9N B;  5HBM A;  1ZBU A;  4CZJ A;  1BWF O;  4H0Y B;  1N6Q A;  4H4M A;  4WQ4 C;  3ULE A;  3AA3 A;  4AIL C;  1EX4 A;  1NJI O;  3C6T A;  1EO1 A;  1ZBI A;  1YTU A;  4CFB A;  3TI0 A;  3JSM A;  2P9K A;  4CK1 A;  4OPJ A;  1MWM A;  4CK3 A;  4DTO A;  5C0Y A;  5TKY A;  3VA0 A;  4YDU C;  1UA0 A;  4GV9 A;  3VGM A;  1BA1 A;  4C8N A;  5KRT A;  3QER A;  3T1Y K;  1N36 K;  3GDQ A;  2YJF A;  3ZX0 A;  3ZSX A;  5B8H A;  1HPM A;  1S5J A;  3EYZ A;  3L2Q A;  3OS1 A;  2YCH A;  1DEJ A;  1LV5 A;  4J2A A;  4FK0 A;  3VQC A;  4BR7 A;  4PHT X;  3RMC A;  3DRS A;  3VOV A;  3QEP A;  3WXM B;  1O1W A;  3ZYY X;  2P1J A;  4H03 B;  3MCP A;  1YTA A;  4MO5 A;  1TGO A;  4CBU A;  3EY1 A;  3O9R A;  1QSS A;  3L3U A;  4FZX C;  2VWB A;  1WSH A;  4C8O A;  1NGG A;  4EZ6 A;  2WTU A;  5HOO A;  3V9W A;  2NUB A;  4FJJ A;  3HTV A;  2PYL A;  4DS5 A;  1TKZ A;  5BN9 A;  4FM0 A;  3MEE A;  4CGH A;  4BDY A;  2O8C B;  1VSI A;  3KHY A;  3FGU A;  4CCH A;  1RT2 A;  3VTH A;  1QQM A;  5JS1 A;  4BDZ A;  3QEI A;  4CJL A;  3JYT A;  4BR4 A;  2A1R A;  1A5V A;  3VQ5 A;  2KW4 A;  3R6M A;  4IFY A;  3N4Q A;  4F8R A;  3I0R A;  1VSF A;  4BGB A;  3SQ1 A;  2FSN A;  1GLB G;  3SPY A;  1YJ9 N;  4L8R B;  1DKG D;  3QBX A;  3KTQ A;  5ELZ A;  5GAE P;  4QAG A;  2ASO A;  3LP1 A;  1WAJ A;  3MN6 A;  2KHO A;  3WQU A;  4EAH D;  5SZT A;  1NOY A;  3O4N A;  3F5T A;  4JI0 K;  4FJK A;  3VQP A;  2NZT A;  3C0B A;  4MLH A;  2QKB A;  1KC8 O;  1HJO A;  4EIA A;  3AVC A;  3PX4 A;  1CZB A;  3RRH A;  5AQP A;  5LMU K;  1W7A A;  1ITG A;  2A1S A;  3O9U A;  4KFB A;  3U9Z A;  1SKS A;  2AP1 A;  1X3N A;  3CCU N;  3OYK A;  1WLJ A;  3AVK A;  4B9M A;  5DK5 A;  1ASV A;  2NRZ A;  3V9X A;  2FSJ A;  3WNH A;  3HM8 A;  3KIO A;  5DMR A;  3C7N B;  3AGR A;  3IMX A;  2QKK A;  3L2V A;  1LCU A;  5AQF A;  3AVL A;  4DSJ A;  4KI4 A;  4IFE A;  1BL3 A;  1QHT A;  3FZF A;  5ADX H;  4JK7 A;  3MXI A;  3SMP A;  4DQS A;  2ZGY A;  4A2B A;  3VMF B;  1LWF A;  4CFC A;  1YF5 L;  1MWK A;  2RHK A;  3LDQ A;  4ICL A;  4CHO A;  2E8A A;  2HBJ A;  3VQE A;  2OTJ N;  3RMD A;  2G8F A;  1LWC A;  2OPP A;  3VF4 A;  3E66 A;  4GW6 A;  4BE1 A;  2F8T A;  1TKX A;  2UUC K;  3THY A;  1NJX A;  4M63 C;  3MEG A;  4DF4 A;  1VSM A;  3WNF A;  5AZI A;  4BRP A;  1U47 A;  3IKM A;  3NAE A;  1JCE A;  4FSV A;  1VSL A;  4Y0W A;  3DRP A;  3H08 A;  1C6V A;  5HRP A;  2VGM A;  3NHG A;  3CCR N;  1VSD A;  2P9P A;  4FLW A;  4BRL A;  1TUU A;  1Y97 A;  5AQM A;  3NDK A;  5KQ8 A;  1B92 A;  3VPZ A;  2RKI A;  3VES A;  4H0X B;  4KAZ A;  2AA4 A;  3ZSZ A;  2A5X A;  1NK4 A;  4PY5 A;  3G10 A;  4JK8 A;  4AHS A;  1E4G T;  1GLC G;  3SAF A;  4JI2 K;  4DTR A;  4IOA L;  3CJA A;  1YJW N;  5IT9 O;  4QCL A;  2FBT A;  3GG4 A;  3D0P A;  2FF6 A;  3OYH A;  3EKU A;  1GOB A;  1O13 A;  1REV A;  1V4T A;  3ZT3 A;  1LWE A;  4N41 A;  2GTD A;  2VQE K;  1BCM A;  3JS6 A;  3MEC A;  4LH5 A;  1QZ5 A;  2DFH A;  4NXM K;  2PZS A;  2WON A;  4DQR A;  4B9L A;  1Z05 A;  2ZJR L;  3TAE A;  2V7Z A;  3WNG A;  3U4L A;  2Z1J A;  2E2Q A;  4WF9 L;  1WNS A;  4BGA A;  1S6Q A;  1RTI A;  2EWS A;  4IO9 L;  4FLZ A;  4A61 A;  3D2F A;  3DXM A;  1IO2 A;  1CXU A;  3O3F A;  2HW3 A;  4CJV A;  1TL1 A;  3ZT4 A;  3PO5 A;  4H0P A;  2GX9 A;  2FBV A;  2UU9 K;  2OYQ A;  4N76 A;  3M5R A;  1SQK A;  2F9T A;  2P9S A;  5J2M A;  4KRE A;  2OCE A;  5C2F A;  4CF2 A;  3K5N A;  4N5S A;  3CCQ N;  3CCL N;  3UB5 A;  4L3Q A;  1N34 K;  4I2Q A;  3BY5 A;  2XO7 A;  3PO4 A;  2FSK A;  2FLO A;  1KCF A;  3ALY A;  2HHH K;  5GIO A;  2QWL A;  5AQY A;  4DSE A;  2QI2 A;  5LJV A;  1I39 A;  4KTW A;  2YKN A;  3IUC A;  4CJK A;  4K43 A;  3UE5 A;  2CGJ A;  1BDG A;  3LDN A;  4DR1 K;  5CHI A;  3ULE B;  4H0T B;  5C2D A;  5E26 A;  3NE6 A;  5DM6 L;  4E3S A;  1FKO A;  3AVB A;  3OTO K;  1VQL N;  3A2F A;  5AQS A;  4RG8 A;  2P9K B;  3E9P A;  1VRU A;  3TAP A;  1G99 A;  4BRE A;  1HKC A;  5EY4 A;  5M1O A;  3U6F A;  1U2V A;  4CVN E;  3RVC A;  4NLB A;  4YHH K;  4DQI A;  1HYS A;  1VQ5 N;  5AQK A;  3O4Q A;  3CHW A;  3HPO A;  4DTX A;  4DR2 K;  5KPT A;  3EE9 A;  3O9T A;  2IVO A;  1KTQ A;  4QS7 A;  3CJ9 A;  1NKE A;  2YHW A;  3MWT A;  5HLF A;  4B9U A;  2E6M A;  3VGL A;  3LAL A;  3LP0 A;  3MX5 A;  3K5O A;  2P51 A;  2Q31 A;  1YT3 A;  2P9U A;  4DHY A;  4BR0 A;  3QB0 A;  2YNG A;  4E0D A;  3F2K A;  4HTL A;  4PKG A;  4ZHR A;  4CEZ A;  4YOV A;  4U7B A;  4LF7 K;  3ENB A;  4YFU A;  3CCV N;  4CFD A;  2OZM A;  3PIO L;  1RNH A;  4YDU A;  1BA0 A;  3EN9 A;  3S3M A;  3SAH A;  4WQ5 C;  4BG8 A;  2NRH A;  4CEB A;  1N32 K;  3ATV A;  3TPQ A;  3LDS A;  4RW9 A;  1T03 A;  5KGW A;  3R8E A;  3OA9 A;  3F9M A;  3OBY A;  3K2P A;  1NGA A;  3HPG A;  5GAH P;  1ZBL A;  3M8Q A;  4A2A A;  1BIU A;  2E4L A;  4YOT A;  1XNQ K;  3TTF A;  3QDK A;  4DU4 A;  1VQ4 N;  2KFN A;  2B4J A;  1IKY A;  3DI6 A;  4FWR A;  4CEO A;  4FWP A;  3HVR A;  4U67 L;  3PLA A;  4KHU A;  1NGE A;  2YNI A;  1GOC A;  2ZWH A;  3KLG A;  3LDL A;  2PBD A;  3MWP A;  3KK3 A;  4DQP A;  4EFH A;  4PA1 A;  1Q82 O;  4C1N I;  3ZET A;  1JXB A;  2EX3 A;  3VEO A;  3M1F A;  1N33 K;  1KAY A;  4KHY A;  4DTS A;  4JS5 A;  3ZSR A;  1RFQ A;  1KQS M;  2KFZ A;  3CC7 N;  4KH5 A;  3T1H K;  4IDK A;  4IG0 A;  4FVM A;  4AM7 A;  3W3D A;  4E1N A;  1R0A A;  3QEX A;  1JLF A;  4LF6 K;  4OO1 J;  3BF1 A;  3H1Q A; 
#chains in the Genus database with same CATH homology
 1BIS A;  2RF2 A;  1NK6 A;  1ZBI A;  1F21 A;  4FXD A;  1YTU A;  4CFB A;  3T1A A;  3L8B A;  3CM5 A;  3SPZ A;  3JSM A;  3TI0 A;  1J5O A;  4OJR A;  1ASU A;  4CHP A;  4CK1 A;  4OPJ A;  3QIP A;  4FJI A;  1S1X A;  4CK3 A;  2YHA A;  3OY9 A;  1UAX A;  3C94 A;  4DTO A;  1SKW A;  4DWI A;  4FZY A;  4FJL A;  3HK2 A;  3DMJ A;  4NYN A;  4CEE A;  3NCI A;  4M3T A;  3VA0 A;  4DF8 A;  1S1V A;  1UA0 A;  2I5J A;  3LAN A;  3HP6 A;  3KKR A;  1EKE A;  4C8N A;  5KRT A;  3QER A;  4B9V A;  4O4G A;  3M8P A;  2B5J A;  3AA2 A;  1Q9X A;  2FBY A;  1HMV A;  3KLI A;  3CFO A;  3ZSX A;  4E7K A;  3KJV A;  1S5J A;  1S1T A;  1XWL A;  2KQ2 A;  3AO2 A;  3L2Q A;  3EYZ A;  3OS1 A;  1Z25 A;  5C25 A;  3SYZ A;  2G8W A;  1LV5 A;  4J2A A;  4FK0 A;  3VQC A;  1KLM A;  3RMC A;  3DRS A;  4RW8 A;  3KLF A;  1S6P A;  4CES A;  3QEP A;  4CHY A;  2JGU A;  3V1O A;  4CJS A;  3V9Z A;  1RT1 A;  1O1W A;  2P1J A;  3TWH A;  1RT3 A;  3PV8 A;  1YTA A;  4KB0 A;  4KTQ A;  4M3W A;  3L3V A;  1TGO A;  3ZT2 A;  3EY1 A;  1QSS A;  4B9S A;  3LWL A;  3V1Q A;  3L3U A;  2HW3 A;  1LAV A;  3HP9 A;  3MAQ A;  4FZX C;  1WSH A;  2HHT A;  1C1B A;  1J53 A;  4C8O A;  4FJ7 A;  4OLA A;  4JRQ A;  1RT7 A;  4M42 A;  4EZ6 A;  3AVI A;  4PQU A;  4CJW A;  3SQ0 A;  3V9W A;  1RDB A;  4C8M A;  1HPZ A;  5HRO A;  2NUB A;  4E7L A;  2ZE2 A;  2PYL A;  1ZYQ A;  4B9N A;  4FJJ A;  4DS5 A;  1TKZ A;  5I42 A;  4J2E A;  4FM0 A;  3C6U A;  3MEE A;  3DLB A;  4ELT A;  3OYJ A;  4EZ9 A;  4CGH A;  4BDY A;  4DLG A;  4FJX A;  4DTM A;  5SWM A;  1RBT A;  1VSI A;  3TR8 A;  3HT3 A;  3HVT A;  4CCH A;  1RT2 A;  3KK2 A;  1TL3 A;  1RBS A;  3PX0 A;  5JS1 A;  3TAQ A;  4BDZ A;  3QEI A;  4CJL A;  3JYT A;  1KVC A;  1XHX A;  5CYQ A;  4CEQ A;  4DTN A;  4KPY A;  1CZ9 A;  5CZ1 A;  4AHR A;  3L2R A;  3V6D A;  4I7F A;  2A1R A;  1RTD A;  1SL1 A;  3RWU A;  1CLQ A;  4ZTJ A;  1A5V A;  3VQ5 A;  2KW4 A;  1EXQ A;  5C24 A;  4IFY A;  4F3T A;  5EU7 A;  4F8R A;  4KHS A;  1RT5 A;  3OYF A;  1NJY A;  3I0R A;  3ZCM A;  3BGR A;  1QQC A;  1VSF A;  1L3S A;  4FJ5 A;  4DS4 A;  5K14 A;  1ZBF A;  1JLA A;  3SQ1 A;  2ITG A;  2XY7 A;  3SPY A;  1U49 A;  1U48 A;  3KD1 E;  4DSI A;  4L8R B;  5J1E A;  1RTJ A;  3CFR A;  1A5W A;  4KV8 A;  3KTQ A;  3OYB A;  3EZ5 A;  3ZSY A;  3MXM A;  1RT6 A;  3S9H A;  4QAG A;  3OYI A;  1TVR A;  3K57 A;  3OYD A;  5J2P A;  4LSL A;  3RRG A;  3LP1 A;  1WAJ A;  3PUF A;  1C1C A;  4Z0U A;  4CJE A;  5SZT A;  2F8S A;  3MED A;  1SL0 A;  1RDD A;  4KHW A;  1DLO A;  3O4N A;  1NOY A;  2X74 A;  1TKD A;  4FJK A;  3VQP A;  3QNO A;  3IAY A;  2Z1H A;  3C95 A;  3KD5 E;  2QKB A;  4DTU A;  1HYZ A;  4CJ4 A;  3AVC A;  3PX4 A;  4CGJ A;  2OA8 A;  3ULD A;  3NF8 A;  2OPQ A;  3AO5 A;  3OYE A;  2GBZ A;  1IH7 A;  1CZB A;  3AVN A;  3IG1 A;  4O55 A;  3RRH A;  4ELU A;  4FJM A;  3G0Z A;  3QLH A;  1I3A A;  1ITG A;  1S1U A;  1J9A A;  2A1S A;  3VQ7 A;  3AVG A;  4CER A;  4KFB A;  2YNF A;  5KI6 A;  3TAB A;  1SKS A;  2X6N A;  2XRI A;  1X9W A;  4F2S A;  1K6Y A;  1RBV A;  3V4I A;  1KFS A;  4CHQ A;  4KB1 A;  3OYK A;  1WLJ A;  3AVK A;  1JL2 A;  3U3G A;  1NJZ A;  1A5X A;  1LW2 A;  4B9M A;  5DK5 A;  3NH0 A;  2HNY A;  5HRR A;  1MU2 A;  1ASV A;  3L2W A;  3CQ8 A;  1UOC A;  3V9X A;  3WNH A;  4TSX A;  3KIO A;  1BQN A;  4BWM A;  5DMR A;  4HCB A;  1JL1 A;  1HYV A;  2QKK A;  3I0S A;  3NH1 A;  3L2V A;  3VA3 A;  4UQG A;  3PY8 A;  1KFD A;  4W5R A;  1WSI A;  1TK5 A;  1JKH A;  3OYN A;  3AVL A;  4B8A B;  4NCG A;  3KLE A;  3AA5 X;  1D9D A;  1ZBH A;  4DSJ A;  4KI4 A;  4O44 A;  1QTM A;  3ISN C;  2GV9 A;  1XI1 A;  2XY8 A;  1BL3 A;  3TAG A;  2D5R A;  1BGX T;  1RIL A;  4CF0 A;  3VQQ A;  2Y1J A;  1QHT A;  3KKS A;  1QSY A;  1KRP A;  2HB5 A;  3L2U A;  3MXI A;  3M8R A;  1XC9 A;  3D45 A;  4DQS A;  4FLU A;  2HNZ A;  4W5T A;  2VG7 A;  5E41 A;  1LWF A;  1HNV A;  3DOL A;  4CFC A;  4BE0 A;  3OYG A;  3SUQ A;  1HQE A;  1DTQ A;  4ICL A;  1JXE A;  4FJG A;  4CHO A;  3AO4 A;  1BCO A;  3VQE A;  2KZM A;  3OYC A;  4LSN A;  3RMD A;  4OPK A;  3LAM A;  1D9F A;  2G8F A;  3B6O A;  1LWC A;  2OPP A;  3O3G A;  4GW6 A;  3TAR A;  4BE1 A;  4J2D A;  3AVJ A;  2F8T A;  3FFI A;  1TKX A;  1U04 A;  1NJW A;  1NJX A;  3DLE A;  4FLX A;  3ITH A;  4BDP A;  2HVI A;  3MEG A;  4CE9 A;  3KLH A;  4DF4 A;  4I9L A;  1VSM A;  3SCX A;  3WNF A;  4HVJ A;  4MFB A;  4E19 A;  1TK8 A;  3RMA A;  1U47 A;  4GVM A;  3NAE A;  3LPU A;  4CGI A;  4M3R A;  3ZT0 A;  4XIU A;  2YHB A;  3K59 A;  4F4K A;  3CFP A;  1VSL A;  1T7P A;  2BGG A;  3DRP A;  3DYA A;  3HO1 A;  3H08 A;  3IRX A;  3NGY A;  1C6V A;  2X78 A;  5HRP A;  1N5Y A;  4DSK A;  3OYM A;  2E6L A;  3NHG A;  2JLE A;  3LAK A;  1L5U A;  4FJH A;  5KGX A;  1ASW A;  1VSD A;  4E7H A;  4OKJ A;  4FLW A;  1VSK A;  2Z1G A;  1Y97 A;  3NDK A;  3V9U A;  1U45 A;  1XHZ A;  1B92 A;  1JLE A;  4G1Q A;  2RKI A;  4KAZ A;  1RBR A;  3TAM A;  3ZSZ A;  1RDA A;  4FLV A;  1NK4 A;  3NF6 A;  4PY5 A;  3G10 A;  4AHS A;  1J54 A;  4CEF A;  2G8K A;  4FYD A;  5CY4 A;  4AHV A;  4R5P A;  4HHT A;  3VQA A;  4DTR A;  1NKC A;  4HCC A;  4ID5 A;  3OJU A;  1VK0 A;  1WSJ A;  4DMN A;  2FBT A;  3IS9 A;  3D0P A;  4QCL A;  3OYH A;  4CK2 A;  5C42 A;  4Z4F A;  4IFV A;  4CJU A;  1TAU A;  4AHC A;  3PX6 A;  4Z4H A;  1GOB A;  1REV A;  3DRR A;  3NFA A;  2G8U A;  1L3T A;  3ZT3 A;  4KI6 A;  1LWE A;  3LP2 A;  4N41 A;  3LZJ A;  5FDL A;  3U3Y A;  1NKB A;  4KHQ A;  1HNI A;  1BCM A;  4EP4 A;  2ETJ A;  3MEC A;  4CJQ A;  1KLN A;  4LH5 A;  5FRO A;  2DFH A;  4HUF A;  1L3U A;  3AO1 A;  1VSJ A;  4O5B A;  4M3Z A;  2PZS A;  2WON A;  2DFF A;  1IG9 A;  3SJJ A;  4DQR A;  2ZQB A;  1KSP A;  2PYJ A;  2IS3 A;  4CF8 A;  4DG1 A;  4B9L A;  4FZZ A;  3AO3 A;  4WE1 A;  3DLK A;  2IC3 A;  1SV5 A;  2O4G A;  4CHN A;  3TAE A;  1NK9 A;  3DLR A;  4Z4C A;  1WSF A;  2OPS A;  3WNG A;  3SQ2 A;  5KRS A;  4JS4 A;  5J2N A;  2ZD1 A;  3NF7 A;  3THV A;  2Z1J A;  2RPI A;  2QXF A;  3NBP A;  1HJR A;  1WNS A;  1C0U A;  1S6Q A;  1BHL A;  1U4B A;  3CYM A;  5D3G A;  2VWJ A;  1RTI A;  4AHU A;  3F9K A;  4K8X A;  5KTQ A;  3ZSO A;  3SNN A;  4Y1C A;  4FLZ A;  2XY6 A;  1KVA A;  1X9S A;  3RR8 A;  2G8I A;  2DFE A;  4Y1D A;  1IKX A;  3SUN A;  1TV6 A;  1IKW A;  5J2Q A;  2HHQ A;  1IO2 A;  1CXU A;  3WNE A;  2FBX A;  4B8C A;  3O3F A;  3UIQ A;  5I3U A;  4CJV A;  4DFP A;  1WSE A;  1TL1 A;  2VWK A;  3VQ8 A;  1QSL A;  5FRM A;  3ZT4 A;  3PO5 A;  4ZTF A;  5CZ2 A;  1S1W A;  3P1G A;  1D8Y A;  2FBV A;  2WOM A;  1FXX A;  2YV0 X;  4HTU A;  2HMI A;  4FK2 A;  1B9D A;  4E7J A;  2OYQ A;  4N76 A;  1TKT A;  1C0M A;  3I8D A;  5HP1 A;  2YNH A;  5J2M A;  3QET A;  4KRE A;  4CF2 A;  3K5N A;  1X1P A;  4LH4 A;  1X9M A;  2IOC A;  4N5S A;  4IG3 A;  4CGG A;  1RBU A;  3SQ4 A;  4ELV A;  3CM6 A;  4M41 A;  2QK9 A;  3SUP A;  4DFM A;  1RDC A;  2O4I A;  2ATQ A;  4DTJ A;  3HJF A;  1JLG A;  3VQ4 A;  3VQ6 A;  1FK9 A;  4I2Q A;  4CIF A;  1WSG A;  2XHB A;  4FLY A;  3F73 A;  2XO7 A;  3HPH A;  2VG6 A;  3DLG A;  3VN5 A;  4CGF A;  1W0H A;  2FC0 A;  1KCF A;  3ALY A;  3PO4 A;  2KZZ A;  3MXJ A;  4B3O A;  1LAW A;  4DQQ A;  4DSE A;  3LWM A;  1UWB A;  3QES A;  1I39 A;  4FW1 A;  2IDO A;  4GMJ B;  5JS2 A;  4CJ5 A;  5HRN A;  3HM9 A;  4JLH A;  3NGI A;  4KTW A;  4DSF A;  4KO0 A;  2B6A A;  3QIO A;  3HST B;  4F3O A;  2YKN A;  3QNN A;  3OVN A;  4CED A;  4CJK A;  3ZSV A;  4OLB A;  5T7B A;  1TK0 A;  1LW0 A;  4M3X A;  4CEC A;  4QOZ B;  1IKV A;  2D0B A;  1T8E A;  4CF1 A;  3NH2 A;  2HVH A;  4H8K A;  3AVH A;  1JLC A;  4CHZ A;  3SZ2 A;  3SUO A;  2PY5 A;  3QO9 A;  3DLH A;  2DY4 A;  4RW4 A;  2D0C A;  1SL2 A;  1WN7 A;  4FK4 A;  2YKM A;  3NE6 A;  1SKR A;  4EP5 A;  4E3S A;  3P83 D;  1FKO A;  3AVB A;  3HYF A;  3A2F A;  1NK5 A;  1HRH A;  4ID1 A;  4RG8 A;  4W5N A;  1D5A A;  4N47 A;  1VRU A;  4CFA A;  3TAP A;  3V81 A;  4FLT A;  4C8K A;  3RMB A;  1C0T A;  2BE2 A;  4FM1 A;  4W5Q A;  4E7I A;  4N56 A;  3U6F A;  4IKF A;  4CF9 A;  3SV4 A;  4I9Q A;  1DTT A;  3SV3 A;  3RR7 A;  3VQD A;  1NK8 A;  1RCH A;  4DQI A;  4DU3 A;  1HYS A;  2HND A;  4DFJ A;  4K8Z A;  1L3V A;  2R7Y A;  3B6P A;  4O0J A;  3O4Q A;  1KVB A;  2BDP A;  3HPO A;  4DTX A;  3TAF A;  4FJ9 A;  4M45 A;  2BAN A;  4F2R A;  4DLE A;  1GOA A;  1HQU A;  4OKE A;  2EHG A;  2VG5 A;  1UA1 A;  1KTQ A;  2Q3S A;  3NGZ A;  4IBN A;  1NK7 A;  4HUE A;  5HRS A;  3S3N A;  4CJT A;  1NKE A;  3QEW A;  1QS4 A;  3LPT A;  2W42 A;  2HHS A;  5HLF A;  4B9U A;  3T19 A;  1VRT A;  2E6M A;  1Z26 A;  2RN2 A;  4CIG A;  4FW2 A;  3LAL A;  3LP0 A;  4M3U A;  3K5O A;  1S9G A;  4Z4I A;  1RTH A;  3OJS A;  4KTZ A;  2P51 A;  4OGE A;  3S3O A;  4BAC A;  4OVL A;  1YT3 A;  2P5O A;  2HHU A;  3K58 A;  2F96 A;  2KTQ A;  2Z1I A;  1TAQ A;  2YNG A;  4E0D A;  4E89 A;  3QEV A;  1FKP A;  4CIE A;  4ZHR A;  4FJN A;  4RW7 A;  4CEZ A;  1EP4 A;  2GUI A;  4LY7 A;  4PUO A;  1SUQ A;  3VQ9 A;  2HHX A;  2HHV A;  4OGC A;  4DFK A;  1JLQ A;  4YFU A;  1BQM A;  4KHN A;  4FCY A;  4BWJ A;  3AVM A;  4C8L A;  3AV9 A;  1BIZ A;  4Z4G A;  4CFD A;  3DOK A;  3CG7 A;  4NYF A;  3ASM A;  3E01 A;  2OZM A;  3OYL A;  4CJF A;  4Q0B A;  3OS0 A;  1EET A;  1RNH A;  2D0A A;  4DU1 A;  4DSL A;  3S3M A;  3AVF A;  3KK1 A;  4Q5V A;  3M8S A;  1NK0 A;  1C1A A;  4CJP A;  3NF9 A;  4H4O A;  2IGI A;  1QE1 A;  3V1R A;  4CEB A;  3HXM A;  3LDS A;  4RW9 A;  4CEA A;  4B08 A;  3BDP A;  3K5L A;  3V9S A;  1T03 A;  1VSE A;  5KGW A;  4M3Y A;  2G8H A;  3LZI A;  5FRN A;  1B9F A;  3SI6 A;  2LSN A;  3K2P A;  2X6S A;  3HPG A;  4O0I A;  1ZBL A;  3M8Q A;  1RT4 A;  1BIU A;  2E4L A;  3AVA A;  2P5G A;  4DU4 A;  2KFN A;  2B4J A;  3ZT1 A;  1IKY A;  3DI6 A;  4E1M A;  4CEO A;  4JRP A;  3HVR A;  4BE2 A;  2OZS A;  3ZSW A;  2AJQ A;  2DTU A;  4KHU A;  1BI4 A;  1YVU A;  2YNI A;  1GOC A;  1VSH A;  3OS2 A;  3K5M A;  3KLG A;  4AH9 A;  4NCA A;  1S9E A;  2OPR A;  3AA4 A;  4RW6 A;  1BI4 B;  4CJ3 A;  3OYA A;  3KK3 A;  1NOZ A;  4DQP A;  2HHW A;  4NCB A;  4AHT A;  3LP3 A;  3DM2 A;  4KRF A;  4DTP A;  4I2P A;  4PA1 A;  3QIN A;  3P5J A;  1W9H A;  4CGD A;  2Y1I A;  4CJR A;  3O3H A;  4YNQ A;  4MQ3 A;  1JXB A;  2EX3 A;  2XY5 A;  4KKO A;  4PWD A;  2G8V A;  1WAF A;  1Q9Y A;  4FM2 A;  4OKK A;  4FJ8 A;  3HL8 A;  4LD0 A;  4KHY A;  4B9T A;  1G15 A;  4DTS A;  3VQB A;  1Q8I A;  4W5O A;  4JS5 A;  3RTV A;  1CXQ A;  3ZSR A;  5HBM A;  1ZBU A;  1JLB A;  2IAJ A;  2KFZ A;  1T05 A;  1N6Q A;  4H4M A;  4IDK A;  3T3F A;  4IG0 A;  3TAN A;  4Z4E A;  4FVM A;  4E1N A;  3AA3 A;  5CYM A;  1R0A A;  4AIL C;  1EX4 A;  3QEX A;  3ZSQ A;  4J2B A;  1JLF A;  3C6T A;  4HUG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...