1ZBIA

Bacillus halodurans rnase h catalytic domain mutant d132n in complex with 12-mer rna/dna hybrid
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*AP*CP*AP*CP*CP*UP*GP*AP*UP*UP*C)-3'
publication title Crystal Structures of RNase H Bound to an RNA/DNA Hybrid: Substrate Specificity and Metal-Dependent Catalysis.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/rna/dna
total genus 40
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2005-04-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1zbiA00
3NAEA 1VSKA 4KRFA 2KW4A 4M3TA 1LWCA 4FJ7A 3SYZA 3DM2A 3CFRA 1S1UA 4JLHA 1U48A 3HK2A 4DWIA 3CM6A 1RDBA 1IKVA 5HBMA 1U47A 1NJWA 5DMRA 2HMIA 1BI4B 4ELUA 2F8TA 2HHWA 4OKEA 4CFDA 3QERA 3IRXA 3SCXA 3SQ0A 2HVIA 1TV6A 4CIFA 1TKZA 3OYBA 1RTIA 1BIZA 1JLGA 5HLFA 3NE6A 5CYMA 1L3VA 1C1BA 1RT3A 3NBPA 4FZXC 4DMNA 1IKYA 1EX4A 2YNIA 4DFKA 2OYQA 1JLBA 4FCYA 1NKEA 1FKPA 4LSNA 3TABA 3ZSWA 4FK4A 4O0JA 2VG7A 3B6OA 2OPSA 3QEXA 1Q9YA 4OLBA 4PWDA 5EU7A 2BANA 3VQ7A 4HHTA 1L3SA 4W5TA 4DTJA 3SUPA 2FBXA 1XC9A 2YNHA 4F8RA 4OLAA 1BIUA 4JS5A 1BGXT 1HNIA 3NFAA 3QIPA 4CIEA 3NH0A 3D0PA 4FLYA 3AA4A 4AILC 3U6FA 3PX6A 4DSIA 4FJHA 4KI6A 3HP9A 1JLQA 4CECA 4FW1A 4KHSA 3B6PA 3OYDA 2IAJA 3HYFA 4CEDA 3QEVA 2P5OA 2YNFA 4KO0A 3DLEA 1JLAA 1FKOA 1YTAA 2Q3SA 2B6AA 4CEQA 1C0TA 3AO1A 4OKJA 3BGRA 4QAGA 1IKWA 3DRRA 1F21A 2HNYA 3U3GA 3VQPA 3OJSA 5JS2A 3HXMA 4FLZA 4I9QA 1SL0A 4FLWA 3AVKA 2P1JA 4ZHRA 4UQGA 1EP4A 4BE2A 3AVMA 1T7PA 4O5BA 2HHTA 4FW2A 2IS3A 3K5OA 1RDAA 5HRRA 1X9MA 1WN7A 4IDKA 4KI4A 3KKRA 4O55A 3F9KA 1S6PA 4H4OA 3SPYA 3OYMA 4Z4IA 5KGXA 1L5UA 3AVJA 1S1XA 2VG5A 1XHXA 4E7KA 1CLQA 1S9EA 1HYSA 3SZ2A 1QHTA 4K8XA 3K5LA 3V9XA 1B9FA 1BHLA 1RT4A 3KLIA 4N56A 4DTPA 3RMCA 3VQEA 4W5NA 1DTTA 4HCBA 4DF8A 1ASUA 2NUBA 3M8PA 1RTHA 1HYVA 1RCHA 3LALA 4IKFA 5CYQA 3L8BA 1TKXA 1J53A 1O1WA 4IFVA 4XIUA 4DTMA 3D45A 4CF2A 4CJSA 4DU4A 4AHTA 3P5JA 1W0HA 5J1EA 4FLTA 1T8EA 2AJQA 3QLHA 2OPPA 1VRUA 3V1OA 3SNNA 3RR8A 2DY4A 3DLKA 4CEAA 2RPIA 4HVJA 2Z1HA 3ULDA 2XY8A 2FBYA 4AHVA 3SQ4A 4KHQA 3V9ZA 3PV8A 1CXQA 1U4BA 4TSXA 4Y1CA 4EP4A 4DTXA 3I0RA 1NOZA 3TR8A 3KD5E 2G8HA 3NF8A 1HPZA 2IDOA 4DF4A 2KTQA 3C94A 5C24A 4OKKA 2F96A 4N47A 3M8RA 3NF7A 4M3RA 4JRPA 4KAZA 4B9LA 1RDDA 4CESA 4CEOA 4FJ8A 5J2PA 4DTNA 3TAQA 1VSLA 2ITGA 4OJRA 4CJ4A 3VA3A 1TK5A 1NKBA 4BDYA 1QSYA 3LPTA 3IAYA 4FJIA 1KTQA 3RRHA 3L3VA 3ZT2A 1VK0A 4CHPA 4B9SA 2HB5A 4OPKA 1LV5A 1I39A 2QKBA 5C42A 3OYAA 3MXIA 3AA2A 3HVRA 4Z0UA 1Q9XA 3K5MA 4F2RA 4FJJA 4CK2A 1IKXA 4CJUA 4RW8A 3S3MA 3NGYA 3OYEA 4C8OA 4J2BA 1A5VA 2KQ2A 2E4LA 1C0UA 3OYCA 2X74A 1S1TA 1IO2A 3PO4A 5T7BA 1RT6A 4Z4CA 4O4GA 2D0BA 3HPHA 1CZBA 3V4IA 1NK8A 2X6SA 4NCAA 4CGDA 4J2AA 1KVCA 4DS4A 1RBVA 2YNGA 3UIQA 3NHGA 3VN5A 1KSPA 3WNEA 4B9NA 2GBZA 3VQDA 1NK5A 4FJ9A 3ZSQA 4DS5A 4B08A 4CJTA 3L2QA 4Q0BA 3QETA 3PX4A 4MQ3A 3JYTA 1LWFA 3MEDA 4AHCA 5DK5A 2I5JA 2QK9A 4B9UA 4FZYA 4B9TA 3TAFA 3SUQA 4CGHA 2YKNA 1KCFA 3HPOA 1QSSA 1RT2A 1SUQA 4CJ5A 1BL3A 3MXMA 1RNHA 3HSTB 2BDPA 1BI4A 3VQAA 2D5RA 3LP2A 4DSJA 2EHGA 4KTZA 3PX0A 3VQ5A 1JXEA 4ZTJA 1NKCA 1TKTA 1HQEA 2D0CA 3F73A 2IGIA 1HNVA 1T03A 4CIGA 1EKEA 4Z4EA 3TAGA 1TK0A 2KZZA 1GOAA 1LW0A 1JL1A 3OYHA 4DFPA 2O4GA 1T05A 4DQIA 3ZT3A 4QCLA 4CJKA 4Z4HA 4I7FA 1YT3A 4FJKA 4BWJA 1C1CA 1S5JA 1BQNA 3L3UA 5HRNA 1C0MA 3OYLA 1KLNA 3PO5A 3PY8A 4HCCA 2BGGA 2G8VA 4M3YA 2HHXA 4NYNA 3K2PA 4FZZA 2OPRA 3OYIA 4J2DA 1LW2A 3CYMA 3VQCA 1NJYA 4C8KA 2HNZA 4NCBA 3OVNA 1KLMA 1JL2A 4N76A 1S1WA 3BDPA 4RW6A 1N5YA 3QNNA 3VQ4A 1K6YA 3OY9A 3AVHA 1WSFA 1TVRA 2YKMA 3DRSA 3LP3A 4CEFA 4CJVA 3OJUA 4CJPA 3L2VA 4BE1A 3HJFA 4PY5A 1J5OA 4KHYA 3SV4A 3THVA 3NH1A 3SUOA 3AVCA 4M45A 4N5SA 1KFSA 4CE9A 4EP5A 3H08A 1CXUA 3JSMA 3ZT1A 4FYDA 3O3FA 1GOBA 4KB1A 3AA5X 1JLFA 4KHWA 4W5QA 4PUOA 3RMDA 1D9DA 2ATQA 1Q8IA 3SV3A 4C8NA 3LWMA 2X6NA 4HUFA 4FJLA 1FXXA 4HUGA 1HRHA 1GOCA 5K14A 3KJVA 4YNQA 3SUNA 4J2EA 2G8IA 4GMJB 4CHNA 2Y1IA 5KRTA 3SQ1A 1FK9A 3RTVA 2DFFA 5KTQA 2HHSA 4O44A 4AHRA 4CERA 1RBTA 3TANA 2IC3A 1XWLA 3K57A 3NF6A 4FJGA 2HHUA 2QKKA 1RT7A 2GV9A 4B8CA 4DG1A 1WAFA 3WNGA 2YHBA 1D8YA 2G8FA 1VSIA 1VSHA 2XO7A 4KHNA 1SL2A 5KRSA 4FM2A 1XHZA 4FLUA 3TARA 2OZMA 3G0ZA 3KK2A 3E01A 1ASWA 3HM9A 4M3XA 3AVIA 1UAXA 3T1AA 3TAEA 4CF0A 4ZTFA 3K5NA 4F3TA 4CJRA 4M3WA 2YHAA 1YTUA 2JLEA 3ZSOA 1KRPA 1WAJA 4CEZA 3NH2A 3L2UA 3HL8A 3AVFA 4Z4GA 3RR7A 1L3UA 3ISNC 4M41A 3NGIA 2Y1JA 1DTQA 4E1NA 2PY5A 3DYAA 3RRGA 4EZ9A 2G8KA 2ZD1A 3CM5A 4ELTA 4B9VA 1TK8A 1EXQA 2RF2A 2ZQBA 3KIOA 4DQSA 3HO1A 4B8AB 4CJFA 3DLGA 4IG0A 4CHOA 4AHSA 3RWUA 3C6TA 3DOLA 3OS0A 1ZBHA 1RTDA 2PZSA 1JLEA 1G15A 4E7JA 5C25A 3AO3A 4DFMA 4BE0A 1ZBIA 2KFZA 3ASMA 3LZJA 4DQQA 3CFPA 2P51A 4CJQA 1HYZA 1U49A 1HMVA 1LAWA 3U3YA 3AV9A 4F3OA 5J2NA 1U45A 3AVLA 2QXFA 2IOCA 4FVMA 1NJXA 3G10A 1TKDA 2VWJA 2Z1GA 1J9AA 2HHQA 3VQ6A 2F8SA 1A5WA 3NCIA 4E0DA 4FJXA 1C6VA 3DLHA 2WONA 4CEEA 4KTWA 1WSJA 3V1RA 1ZBUA 3LP0A 3KLHA 5HP1A 1D5AA 1U04A 4Y1DA 1SKSA 1QTMA 4L8RB 4M42A 4O0IA 1IG9A 3C6UA 4W5RA 4K8ZA 5D3GA 2Z1JA 1NK9A 3ZT4A 1XI1A 1TL1A 4CEBA 3AVNA 4IG3A 4RW4A 1NK7A 4C8MA 1WSIA 3M8QA 1UA1A 3IS9A 1N6QA 1QQCA 2XY6A 4B3OA 4CF8A 4I2QA 3V9UA 3SQ2A 3KLFA 4KV8A 3QINA 1JKHA 3ALYA 3KK3A 3TAPA 2KFNA 3FFIA 4F2SA 2FC0A 1VSMA 3V1QA 3KLEA 3RMAA 4JRQA 3VQBA 3OS2A 3WNHA 5JS1A 3TI0A 2VWKA 3DLBA 1RBUA 1BCOA 4CGJA 4W5OA 4KHUA 5FRNA 2ETJA 2FBVA 5FROA 4H4MA 1VSEA 5HRSA 1B92A 3O3GA 3OS1A 2G8UA 3NF9A 3O4QA 4FLXA 4DFJA 4RG8A 5KI6A 3QEPA 4CF9A 1DLOA 3KLGA 1NK4A 2OA8A 4FJNA 3TAMA 4DTSA 3DLRA 1VSDA 4Q5VA 3EYZA 1VSJA 1Z26A 4HUEA 2RN2A 4OGEA 4CF1A 3LPUA 4CFBA 4HTUA 4E3SA 4N41A 4DSFA 1ZBLA 2OZSA 4BDPA 2VG6A 4OGCA 4E1MA 1SKRA 2Z1IA 2RKIA 3EY1A 4G1QA 3TWHA 1C1AA 3SI6A 4ID5A 3NGZA 1D9FA 3AO4A 3HPGA 1TAQA 4YFUA 3RMBA 1ZBFA 4AHUA 2FBTA 1TAUA 4Z4FA 3C95A 1VSFA 1S9GA 3CG7A 3KKSA 5CY4A 2A1RA 4CHQA 5E41A 2EX3A 1KVAA 4CK1A 5J2MA 4I2PA 1J54A 4QOZB 1X1PA 2PYLA 4OVLA 4WE1A 1X9WA 3KTQA 1WNSA 3LANA 1QE1A 4LH4A 1NK0A 1HJRA 2D0AA 3OYGA 4IBNA 1I3AA 1RILA 4CFCA 1LAVA 3MXJA 1WSHA 4DLEA 4DQRA 4CGIA 4C8LA 2YV0X 2B5JA 4BDZA 4FM0A 1UWBA 3QESA 3S9HA 3SPZA 1Z25A 4LSLA 1CZ9A 5CZ1A 5CZ2A 4DTUA 2E6MA 5J2QA 3HVTA 4EZ6A 4F4KA 2B4JA 1EETA 2PYJA 1JXBA 3MECA 3LWLA 2OPQA 4FM1A 1SKWA 5HROA 4ELVA 4PQUA 3AVAA 1TL3A 2E6LA 3EZ5A 4DTRA 4KKOA 1JLCA 3LP1A 4DU3A 4AH9A 1ZYQA 5SZTA 3QO9A 4BACA 3ZT0A 3I0SA 4CFAA 1SV5A 2XRIA 3KK1A 3ZSVA 4DSKA 3KD1E 3HP6A 3CQ8A 1NOYA 3NDKA 4CJWA 3ITHA 1S6QA 4NYFA 3AO5A 3P1GA 3LAKA 2BE2A 1Y97A 2HW3A 1BCMA 3ZCMA 4MFBA 3ZSRA 1TGOA 4CJ3A 4OPJA 4E89A 4E7HA 4ICLA 4RW9A 3WNFA 5I3UA 1YVUA 3QNOA 4FJMA 3A2FA 3CFOA 4KREA 1ASVA 3T19A 1R0AA 3LDSA 1L3TA 2DFHA 4LH5A 3AVBA 1VRTA 4ID1A 1LWEA 3O4NA 2WOMA 4GVMA 2XY5A 2R7YA 2JGUA 4DU1A 1BQMA 1UA0A 3DOKA 1RBSA 3MAQA 4E19A 1RT5A 1IH7A 4BWMA 1RTJA 5I42A 3PUFA 3HT3A 3V9SA 1WSEA 4PA1A 2DTUA 2HNDA 1RT1A 4IFYA 1S1VA 3S3OA 2A1SA 4R5PA 4JS4A 4FK2A 4FK0A 3AA3A 3OYFA 2KZMA 5SWMA 4CGFA 1REVA 1W9HA 3V81A 1SL1A 3IG1A 1NJZA 2GUIA 4KB0A 3L2WA 1MU2A 4GW6A 4I9LA 4CGGA 4CJEA 3MEGA 5FDLA 3VQ8A 3OYJA 3T3FA 4B9MA 1WLJA 3OYNA 1QSLA 3AVGA 2HHVA 1X9SA 1QS4A 3DRPA 3ZSXA 1BISA 3SJJA 2P5GA 4CCHA 3P83D 4DQPA 1ITGA 3K58A 4M3UA 2HVHA 3VQQA 3QIOA 4CK3A 3LZIA 4FXDA 1WSGA 3V9WA 3O3HA 2XHBA 3VQ9A 4FJ5A 4KPYA 4LD0A 1UOCA 3ZSYA 3QEWA 3V6DA 4CHZA 3M8SA 1RDCA 3L2RA 4E7LA 3K59A 2W42A 2XY7A 2DFEA 3S3NA 4KFBA 4CHYA 4E7IA 4RW7A 4FLVA 2O4IA 4DLGA 3VA0A 4CJLA 1A5XA 1HQUA 3AO2A 4DSLA 1KVBA 3LAMA 1KFDA 2G8WA 5FRMA 2X78A 3DMJA 3ZSZA 4NCGA 4M3ZA 3QEIA 5KGWA 3I8DA 3OYKA 3DI6A 4KTQA 1RBRA 4DTOA 2ZE2A 2LSNA 1NK6A 4DSEA 4H8KA 4LY7A 5HRPA 1B9DA 3MEEA
chains in the Genus database with same CATH superfamily
4K41A 4O5FA 2QWMA 4BRPA 3SYZA 3CFRA 1S1UA 1KXPA 4JLHA 5KPRA 1U48A 4DWIA 3CM6A 1IKVA 1NJWA 2HMPA 5DMRA 3CMAN 4ELUA 2P9NB 3IRXA 5BPMA 3VETA 1TV6A 3OYBA 4FOEA 5A2QO 5CYMA 1C1BA 3WXMB 4PWDA 1CZAN 3ZYYX 4F8RA 1T3VA 2YCHA 1BIUA 1BGXT 3NH0A 3U6FA 3ATVA 3AA4A 3FZFA 4DHYA 4DSIA 4QS7A 3HP9A 1JJ2M 4BRAA 2GTDA 3SAFA 3QEVA 4KO0A 3DLEA 3D2FB 2Q3SA 2NLXA 4CGDA 3BGRA 1IKWA 4FLZA 4H03B 5AQQA 3AVMA 3WXKA 1X9MA 1OH5A 3QICA 5AZJB 2NRTA 1S6PA 4H4OA 4Z4IA 4IFEA 4A5BA 1L5UA 3VEYA 1NU0A 1CLQA 5BRDA 4NLCA 4K8XA 3K5LA 3V9XA 4BR2A 4DTPA 3RMCA 4W5NA 1ZBSA 4A2AA 1DTTA 4DF8A 3CCUN 2E1ZA 3M8PA 1XUPO 1HYVA 2VQEK 1TKXA 1O1WA 2I7PA 4YORA 4CJSA 4DU4A 4AHTA 1O13A 5J1EA 1TUYA 4JI1K 3V1OA 3RR8A 3SNNA 2DY4A 3EZWA 2XY8A 2FBYA 3O80A 3V9ZA 1U2VB 1CXQA 4DTXA 1DGKN 1V4SA 2G8HA 3P39A 3C94A 3FE1A 2HBLA 4M3RA 2ZF5O 5EXWA 4KAZA 4CESA 3PSIA 4CEOA 4DV2K 4CJ4A 1Q7YO 1VAZA 4BDYA 4FJIA 3RRHA 3L3VA 4MLEA 3HI0A 2W6KA 2VWBA 3BP8A 4B1VA 2HB5A 4FWQA 2O8CA 1LV5A 5C42A 1FJGK 4LFBK 3TTCA 3QDKA 2O8BB 3K5MA 4CJUA 3HZ6A 3NGYA 5BR8K 1KC8O 4FWMA 4O4GA 3L4QA 2QWLA 1CZBA 1NK8A 5CR4A 2X6SA 1C0GA 4GV9A 3UIQA 3NHGA 1KSPA 4FJ9A 1WUAA 4CJTA 4CZKA 2GWJA 4MQ3A 3MEDA 5DK5A 3O6WA 3TAFA 1TYQA 2YKNA 2KHOA 3HPOA 4IO8A 1BL3A 1RNHA 2A40A 3LP2A 4KTZA 3OBWA 1JXEA 1YITN 4ZTJA 1TKTA 1W7AA 3P38A 1HNVA 1T03A 1ILYA 4Z4EA 3LM2A 2KZZA 4RCHA 3GG4A 5B8HA 1XMOK 2O4GA 4DQIA 4I7FA 3E9PA 4BWJA 1S5JA 2NRZA 3L3UA 4BR9A 1KLNA 2BGGA 4JNEA 4M3YA 1Q18A 4NYNA 5ELZA 3OYIA 1LW2A 4K42A 1NJYA 4C8KA 2ASPA 1OH8A 5GINA 1Y64A 5JVGL 1K8KA 1S1WA 3BDPA 1N5YA 3VQ4A 3OY9A 1TVRA 4BE1A 1VQLN 3D2FA 1J5OA 3HJFA 2OTLN 4A61A 4M45A 4N5SA 4YOYA 3ZT1A 1GLAG 1P90A 4NXMK 4C8NA 2X6NA 2I7NA 1GLDG 4PKGA 1YIJN 2Y1IA 5KTQA 2HHSA 3W3DA 4AHRA 5AFUA 3VEXA 2D1KA 1J6ZA 2OANA 1VQ9N 1XWLA 2QKKA 1RT7A 4H0XB 5KRSA 4FM2A 3TARA 3G0ZA 3HM9A 1UAXA 3M5RA 5KQ8A 3K9JA 3MX2A 2A41A 4WYBA 2JLEA 3NH2A 2IVOA 1EO1A 2GWKA 3RRGA 4B3RK 4DQ8A 4NB4A 2P9UB 1DT9A 4DQSA 3KIOA 5GADP 4G9ZA 4B8AB 4IG0A 3RWUA 3OS0A 3MDQA 3DXMB 1VHXA 1G15A 1NGJA 3AO3A 1NGBA 5IWAK 4B1YB 3LZJA 2A42A 4CJQA 1LAWA 3SLCA 3AV9A 4IZ9A 3O9RA 3TSUA 2O8BA 2IOCA 4FVMA 3G10A 1J9AA 1EQYA 2HHQA 4A2BA 3T7ZA 4E0DA 4A5AA 3ZLJA 4FOIA 4KTWA 1WSJA 3V1RA 3LP0A 4DV0K 1QTMA 4LF4K 1D5AA 1U04A 2FSKA 5E84A 3THWB 4FSVA 2Z1JA 3ZT4A 4BGAA 2QWOA 4RW4A 1DKGD 4DR2K 3IS9A 4JI7K 4JV5K 3SQ2A 3KLFA 4CZMA 3KK3A 3TAPA 3IDHA 3V1QA 3VQBA 3OS2A 1XNQK 2HBMA 3TI0A 4H5WA 4JKAA 5C2DA 1E3MA 3DLBA 4B9QA 4XH5A 1B92A 3RSEB 3NF9A 3KWGA 3WUHA 4F9OA 4RG8A 3GE1A 3H1QA 2UU9K 2OA8A 1DLOA 3KLGA 1NGGA 4MLHA 3HRGA 1VSDA 4Q5VA 1HNWK 4CZLA 1Z26A 4OGEA 3LPUA 1ZBLA 1WB9A 5DM7L 4BDPA 2OZSA 2VG6A 4OGCA 2Q36A 2CH6A 5M1KA 3TWHA 3U4LA 1S22A 5CHIA 1JCEA 3CCRN 1VQMN 3VGKA 1S9GA 3CG7A 3GBTA 2P9PA 2EX3A 1KVAA 5J2MA 2WC9A 5AQJA 4QOZB 4OVLA 4HWIA 1WNSA 1QE1A 4LH4A 1HJRA 2D0AA 3OYGA 1NG9A 4IBNA 2E2OA 3FZHA 4IXCA 1NMDA 1XNRK 3TSPA 3SPZA 1YVNA 5CZ2A 3R1XA 4JKGB 2UXCK 1BUPA 1LCUA 4GVEA 4FM1A 1SKWA 2OPQA 1TL3A 3CPEA 1JLCA 2YHXA 3LP1A 3ID8A 2ZGYA 3QO9A 4BRGA 3LDPA 4DSKA 3ZSVA 5AQKA 3P4IA 4XH1A 5AQHA 4CJWA 3ITHA 3VERA 3LAKA 1Y97A 2HW3A 2CGLA 3DXMA 3ZSRA 3WNFA 1YVUA 4FJMA 1P8ZA 3I55N 2RE2A 4KREA 3I33A 4Z94A 3T1YK 4ID1A 3O4NA 4GVMA 4H5TA 3RVCA 4IEIA 5KQDA 3MMVA 1RBSA 4BWMA 3V9SA 3IMXA 4PA1A 2DTUA 2HNDA 4B1XB 3MN9A 4IFYA 5H1SQ 2UUCK 3CJBA 5FPDA 2P9KB 3ZX2A 5GIPA 4KB0A 1YI2N 1MU2A 4I9LA 3MEGA 3UE5A 2WBNA 3OYJA 1WLJA 3MN5A 1QSLA 4IDHA 1BWFO 1QS4A 3SJJA 1ITGA 3VESA 2YX6A 3RSEA 4KPYA 4DR5K 1GLFO 4K25A 3U9DA 4E7LA 3K59A 3I8BA 3CC2N 4KFBA 4E7IA 4RW7A 4CJLA 1HQUA 4JI2K 1KVBA 2Q0UA 1XQSC 3LAMA 1KFDA 1IBLK 4DR6K 1ATSA 3ZSZA 4NCGA 4M3ZA 4FWPA 3I8DA 5M1QA 1NK6A 4DSEA 4H8KA 5AQVA 3PO4A 3NAEA 1VSKA 2NZTA 4KRFA 1SZ2A 1LWCA 2WUSA 4QS8A 1ESVA 4YOTA 4FJ7A 4YDUA 5ADXA 1U47A 1RDBA 2HMIA 3WEEB 4CFDA 3QERA 3CCVN 4C23A 5C10A 1TKZA 3EL2A 1JLGA 2E2NA 3UKUB 3SAHA 4WFBL 2NRHA 3A5OC 1IKYA 1EX4A 4DFKA 1FKPA 5HOOA 4LSNA 3TABA 4FK4A 4O0JA 4BC4A 3QEXA 4U67L 2VCPA 4CBWA 5EU7A 3VQ7A 1YJ9N 4W5TA 1XC9A 2YNHA 4OLAA 5AQNA 4JKGA 3D0PA 4CIEA 3QIPA 3CHWA 4JK8A 4FLYA 4KHSA 2IAJA 3HYFA 4CEDA 5AQOA 4CI6A 5EOYA 4X65K 2P9SB 3UKRB 1YTAA 1C0TA 3VQPA 4PL8A 3DRRA 3U3GA 1F21A 2HNYA 3JS6A 3WXLA 1NGAA 3JAMO 3O9QA 4FLWA 1SL0A 1T7PA 4UQGA 2HHTA 2IS3A 2ZWHA 1RDAA 5HRRA 4DV5K 1WN7A 4IDKA 4XEIA 3CJCA 1Q82O 4KI4A 3F9KA 3AVJA 1S1XA 4BVOA 1S9EA 1HYSA 5F1XA 3KLIA 3VQEA 2ZJPL 5LMUK 1VQPN 1ASUA 3QFUA 5CYQA 3L8BA 4XIUA 4CF2A 1W0HA 3T69A 1T8EA 2BTFA 2KKZA 4WFNL 1XMQK 3CJ1A 3R3LA 4B1WB 3S41A 4KHQA 3MK6A 2UXDK 3ULEB 4KHPK 4TSXA 4Y1CA 4EP4A 3TR8A 3KD5E 3NF8A 3VTHA 2KTQA 4OKKA 4N47A 3NF7A 4JRPA 4B9LA 3U8XA 3CCSN 3NVKA 2A5XA 3R9PA 3VA3A 2QI2A 3LPTA 3ENOA 4LFCK 2O8DB 1I39A 2QKBA 1K8AO 4I6MB 5AQUA 3HVRA 3FR0A 4Z0UA 4FJJA 2NRVA 4RW8A 4A57A 3ZETB 4J2BA 2KQ2A 1S1TA 3CPWM 1IO2A 4NCAA 2D0BA 3V4IA 1RBVA 2VGNA 2YNGA 4JHDA 4B9NA 3Q7CA 2ASOA 3VQDA 4DS5A 4BY9C 3QETA 3JYTA 1LWFA 4AHCA 1VQ6N 5M1OA 4A62A 4B9TA 4CGHA 3O9UA 2QWPA 5AQSA 5EY4A 4DSJA 3PX0A 3VQ5A 4BRKA 2VQFK 4J8FA 3UKUA 1EKEA 2RHKA 3TAGA 2O8FA 2UYTA 1XC3A 1T05A 5AQIA 5BN8A 4YOWA 1YT3A 2QWRA 5HRNA 1OH6A 3PY8A 1C0MA 2G8VA 4GKKK 2HHXA 4J2DA 3CYMA 4DUZK 3O9SA 4JI5K 3QNNA 2E2QA 3K9KA 1WSFA 3AVHA 3L2VA 3OJUA 2P9SA 3A8YA 3SV4A 3THVA 2FXUA 3SUOA 4LF5K 4FYDA 3H08A 1CXUA 4WQ4A 4W5QA 4PUOA 3CMEN 1D9DA 1NGEA 2ATQA 3SV3A 3MWPA 4BRLA 1BA0A 3IUCA 4HUGA 3C7NA 2G8IA 2YHYA 3C6HA 1FK9A 4CERA 5M1NA 3NF6A 2GV9A 4B8CA 4DG1A 2OCEA 1WAFA 2YHBA 4WQ5A 5M1PA 2CH5A 4BRFA 3C0BA 4KHNA 1XHZA 3VEZA 1ASWA 2FSJA 3TAEA 2V7YA 4CF0A 3G4SN 3ZSOA 1WBDA 1WAJA 2QTDA 4CEZA 4Z4GA 3AVFA 4BROA 5KPZA 3ISNC 4M41A 2PY5A 2G8KA 3CM5A 1TK8A 3DLGA 4CHOA 4AHSA 3C6TA 4BGBA 4H0VB 4E7JA 4DFMA 1ZBIA 4IOAL 5J2NA 3A5MC 1NJXA 2Z1GA 3HOSA 2CGKA 1A5WA 1C6VA 3CJ7A 4JD2B 3DLHA 2QXLA 3HTVA 4KH6A 4IO9L 5HP1A 2W6LA 3J7ZO 4O0IA 3CCMN 5BR9A 1NK9A 1S72N 1FW6A 3U9ZA 4C8MA 3PLAA 3ZEUA 1UA1A 1QQCA 2XY6A 4JKBA 4CF8A 2Q31A 5BN9A 3VGLA 3V9UA 4KV8A 3QINA 4EHTA 5C2FA 3LDLA 3CERA 2FC0A 4EIAA 3RMAA 1VQ7N 1V4TA 3VGMA 2VWKA 5HL7L 2P9NA 2PAVA 3J81O 4CGJA 3VEOA 5FPMA 4X62K 5FROA 5HRSA 4H4MA 3OS1A 3O3GA 4BR7A 3O4QA 1QVFM 4FLXA 5KI6A 4YY3K 3O8MA 3TAMA 3DLRA 1IJJA 5ADXH 3CIPA 4BG8A 4MDAA 1SKRA 3J7YP 4JI8K 3NVMA 3SI6A 1YJNN 3RMBA 1ZBFA 1TAUA 3C95A 3KKSA 2A1RA 4I2PA 1J54A 4CD1A 3J8AA 3R6MA 2PYLA 4MDBA 4WE1A 4X66K 1QZ5A 5AZJA 3O1WA 4JI0K 4IWVA 2WFBA 4DV1K 4GV3A 1I3AA 3MXJA 1WSHA 4CGIA 1E4FT 2E1YA 2YV0X 4AF1A 4FM0A 3N4PA 3CD6N 1Z25A 1CZ9A 4ILJA 3MX5A 4BRQA 4F4KA 2PYJA 3DJCA 3EKUA 1JXBA 2HHHK 3OTOK 4ELVA 2GX9A 2NRXA 4DU3A 4OPHA 1ZYQA 5SZTA 1N36K 1U2VA 2QW9A 3ZT0A 3KK1A 1SV5A 2XRIA 3N4QA 3PSFA 1NNEA 3HP6A 3CQ8A 3NDKA 1JCFA 1Z6RA 3A5LC 4NYFA 1U6ZA 1BCMA 3BZCA 4E89A 3TTDA 4ICLA 5I3UA 3QNOA 3MCAB 4LF9K 2OTJN 3T19A 3AVBA 1VRTA 3O5BA 1LWEA 1K9MO 4DU1A 1BQMA 3SK3A 2VGMA 3DOKA 4JD2A 5M1FA 4X64K 4E19A 3AGKA 3THXB 3PUFA 3HT3A 3E66A 2JWKA 1RT1A 5AQPA 1MWKA 4DV4K 3S3OA 4FK0A 1VQNN 3C65A 5EVZA 1REVA 1W9HA 3V81A 5FLXO 4BVPA 1NJZA 2Q2RA 2GUIA 3L2WA 4GW6A 4CGGA 5FDLA 1SAZA 3VQ8A 1DEJA 3ZX0A 1OVYA 3VF2A 1X9SA 2P5GA 4M3UA 4H0TB 4CCHA 3K58A 3VQQA 3LZIA 4FXDA 3V9WA 4DV7K 4V19S 1MA9B 4LD0A 1UOCA 1ATNA 3M8SA 1RDCA 3EKSA 3L2RA 2XY7A 4CHYA 4FLVA 3T1HK 2O4IA 3VA0A 1LOTB 2NRWA 2G8WA 3BY5A 3DMJA 3QEIA 2V51B 3A0IX 4WFAL 3DI6A 3OYKA 4DTOA 4KTQA 2LSNA 4HUEA 2KW4A 4BQLA 3KVGA 3HOTA 1GLEG 2UUAK 4JK7A 3HK2A 5HBMA 5AQZA 2F8TA 4DR4K 1BI4B 4OKEA 5EX5A 3VPZA 3SCXA 3SQ0A 2HVIA 3DLLL 4CIFA 1BIZA 3O4WA 5HLFA 4H5RA 4DV3K 1RT3A 3F5TA 4FZXC 1JLBA 1NKEA 4FWOA 4YOXA 3ZSWA 2GEMA 3DAWA 2VG7A 1Q9YA 4OLBA 1N32K 4HHTA 3PIOL 3SUPA 2FBXA 1EWQA 4DR7K 4JS5A 1HNIA 3NFAA 4FJ8A 4KI6A 1BO5O 4CECA 3DXKB 3FZLA 2P5OA 2YNFA 1JLAA 3VTIA 2B6AA 4CEQA 3AO1A 4OKJA 4I9QA 3H6EA 4FPAA 2E5LK 3J7AP 4CZGA 4ZHRA 4BE2A 1EP4A 1KQSM 4O5BA 4FW2A 4RTFD 2P9UA 3CI5A 3KKRA 5I9EB 5KGXA 2VG5A 2NRRA 1XHXA 4E7KA 1NJIO 3SZ2A 4BRDA 1B9FA 1RT4A 3R8EA 1RCHA 1J53A 4FWNA 3D45A 2QWNA 3WT0A 1Z05A 4WF9L 3QLHA 2OPPA 1VRUA 3LM9A 3DLKA 4CEAA 4HVJA 2PFUA 2Z1HA 3ULDA 4AHVA 1U4BA 2ITMA 3I0RA 1NOZA 4DF4A 1HPZA 3THWA 1Q86O 2QEXN 5C24A 4RWTA 2F96A 2UXBK 3LDOA 5JMVA 3MCPA 4MO4A 4DTNA 1J5EK 1VSLA 2ITGA 1TK5A 1X3MA 1NKBA 2O8EB 1QSYA 1KTQA 1VK0A 4C1NK 4B9SA 3G6EN 3CC7N 1X9JA 4CZEA 3MXIA 3AA2A 4F2RA 2ZJQL 4BRCA 4CK2A 1IKXA 4IEEA 1A5VA 2E4LA 1C0UA 3OYCA 2BH1A 2X74A 5T7BA 1RT6A 3FLCO 3HPHA 1W97L 1KAXA 4J2AA 1KVCA 4DS4A 3VN5A 3WNEA 1NK5A 2V52B 4B08A 3PX4A 2QK9A 2I5JA 4B9UA 1KAZA 3SUQA 1KCFA 1RT2A 1SUQA 4CJ5A 1BI4A 4YHHK 3VQAA 2D5RA 2EHGA 3AAPA 1TUUA 3F73A 2IGIA 3CCJN 4CIGA 4C1NI 1TK0A 1GOAA 1JL1A 1BG3A 4DFPA 4QCLA 3ZT3A 2F7TA 4CJKA 1C1CA 1BQNA 3OYLA 4OX9K 3PO5A 3WQTA 3K2PA 3VOVA 4JYAK 3WQUA 2W40A 2HNZA 3SJHA 4NCBA 3OVNA 4LC9B 1W2BM 4LF6K 3A5NC 3LDQA 1K6YA 1NGCA 4H0YB 2YKMA 4DR1K 4CEFA 4CJVA 4PY5A 4CJPA 1BDGA 4K0KK 4KHYA 3OW2M 3AVCA 3KZBA 3JSMA 2E2PA 4KB1A 3AA5X 1JLFA 3W0LA 5AR0A 3RMDA 1BA1A 5AQRA 5FPNA 3LWMA 4HUFA 4BR5A 5AFUH 1HRHA 5K14A 4CW7B 3SUNA 4J2EA 1S3XA 4GMJB 4CHNA 2DFFA 4CD3A 1RBTA 3TANA 3K57A 2ZJRL 4FJGA 3QMLA 1T44A 3WNGA 1VSHA 3VF6A 5CE3A 2OZMA 4FLUA 3KK2A 3M1FA 4PKHA 3AVIA 3NMUA 1D4XA 4F3TA 4CJRA 1T6CA 2PBDA 1KRPA 2JWLA 3RR7A 1L3UA 5C0YA 2H3GX 2Y1JA 4E1NA 2HSTA 4ELTA 3HO1A 2P9KA 3DOLA 1ZBHA 4O8UA 2PZSA 4BREA 2CGJA 4AM6A 1M90O 5C25A 4BE0A 3ZX3A 2KFZA 3ASMA 4M63C 3HBTA 3BEXA 1HYZA 1HMVA 4F3OA 1U45A 3VEVA 4HTLA 1TKDA 2VWJA 3VQ6A 4KH5A 1ZXOA 3B8AX 5TKWA 1QVGM 1ZBUA 4EZ9A 2AA4A 4M42A 1IG9A 3C6UA 3I56N 4K8ZA 4B1UB 1XI1A 1TL1A 4CEBA 5MLCQ 3AVNA 1NK7A 2FLOA 1N6QA 1BOTO 1QZ6A 3O9TA 4I2QA 4EFHA 1JKHA 3ALYA 4F2SA 3KLEA 1VSMA 2O8CB 5JS1A 3WEEA 1HPMA 3IKMA 4KHUA 3EO3A 5BPNA 1HKCA 2IIRA 3CXCM 4DFJA 4FJNA 4CF9A 5JICA 1NK4A 1VQ8N 5AQLA 3E9LA 2YJEA 2RN2A 4CBXA 4DSFA 2Q0RA 4ISEA 2D0PA 3CJ9A 2Z1IA 2RKIA 1TYQB 4K43A 4CJ7A 4H0PA 1C1AA 4ID5A 3HPGA 3K0SA 1TAQA 4YFUA 3UKRA 4AHUA 3L4IA 3PIPL 3FZMA 3TPQA 1MWMA 5GAHP 3WXIA 2VYPA 5E41A 4JI4K 1HLUA 2FSNA 3KTQA 1T6DA 3G71N 1YXQA 3LANA 4E1JA 3DWLA 5GAGP 1LAVA 4DQRA 1K8KB 1E4GT 3QESA 1UWBA 3KHYA 4DTUA 2A3ZA 4YOUA 4EZ6A 2B4JA 3ID6A 1EETA 3MECA 4BR4A 3AVAA 1JCGA 2E6LA 2P9IB 4DTRA 4AH9A 4BACA 3ULEA 2HF3A 4CFAA 1K73O 3CQXA 1YAGA 3AO5A 5AZIB 2BE2A 1OVQA 1TGOA 4OPJA 2E20A 4RW9A 3H1VX 3HSCA 3AGRA 3A2FA 3CFOA 3VEWA 4H0OA 1ASVA 5C12A 2O8DA 3M6GA 1R0AA 1HNZK 1L3TA 2DFHA 5LMNK 2WOMA 1KD1O 2XY5A 2R7YA 2JGUA 4CZJA 4I6MA 4NO7A 1RTJA 3QBWA 1WSEA 3ZETA 5KPTA 1S1VA 1N34K 4B3TK 3THYB 4JS4A 1H1VA 5BRFA 3AA3A 2KZMA 5SWMA 4KBOA 4QS9A 3IG1A 3SBGA 3AAQA 2KLAA 2F4VK 3EE8A 3T3FA 4B9MA 2HHVA 1GLLO 1BISA 4DQPA 1N33K 2HVHA 3QIOA 4JI6K 3WXJA 5JLHA 1VQ4N 2YHWA 3O3HA 2XHBA 3VQ9A 1HNXK 2DPNA 3O1BA 4LF8K 3L6QA 3QEWA 4CHZA 3MWTA 1I94K 3GDQA 3S3NA 4DUYK 2W42A 3EN9A 1A5XA 3AO2A 4DSLA 1N8RO 4DCHA 5AQWA 3TTFA 2ZE2A 1HKBA 1VQKN 4LY7A 1B9DA 3MEEA 2FF3B 4PKIA 4BRIA 4M3TA 2GUPA 3VMFB 3DM2A 4JKEA 1BU6O 2HHWA 5F2RA 4CZIA 4BQZA 3GL1A 1RTIA 1RDWX 4LF7K 3NE6A 1L3VA 3NBPA 4DMNA 2YNIA 2OYQA 4B3MK 3C6AA 4FCYA 1EWRA 1HJOA 4JI3K 5DM6L 3B6OA 2OPSA 3UB5A 4UY8O 2BANA 1L3SA 4DTJA 5JLFA 1QHAA 4AILC 4FJHA 3PX6A 4KH4A 1JLQA 4FW1A 3B6PA 3OYDA 2IVNA 1FKOA 2P9IA 4QAGA 3OJSA 2P9PB 3HXMA 5JS2A 3D7EO 5FPEA 3AVKA 2P1JA 3K5OA 4JEPA 5AZIA 1NGIA 4O55A 3HM8A 1WOQA 3OYMA 3SPYA 1QHTA 1BHLA 4N56A 4EAHD 4HCBA 2ASMA 2NUBA 1RTHA 3CJAA 3LALA 4FWSA 4B3SK 4IKFA 4DTMA 4IFVA 3D2EB 1GLJO 3P5JA 4FLTA 2AJQA 3H46O 2RPIA 5BREA 3SQ4A 1HX1A 3PV8A 3EE9A 3ENBA 4IJNA 3THYA 3FZKA 3P31A 2IDOA 2Q1NA 1NBWA 5F0XA 3M8RA 4JKDA 1RDDA 4JKHA 4PL7A 4OO1J 4Y0WA 5J2PA 3TAQA 4OJRA 3BUZB 3IAYA 3SBTA 2J4RA 3M3ZA 3ZT2A 2Q97A 1SS6A 4BR0A 4CHPA 2HF4A 4OPKA 3OYAA 1Q9XA 4FWLA 3S3MA 3OYEA 4LFAK 4C8OA 3OBYA 4YOVA 3QFPA 4M7XA 4Z4CA 2GBZA 3ZSQA 3CQYA 3L2QA 1OKJA 4Q0BA 1NLVA 2HBKA 4FZYA 1QSSA 5GAEP 5LY3A 3MXMA 3HSTB 4JKFA 3GOIA 2BDPA 4R79A 1NKCA 1HQEA 2D0CA 1KAYA 4AQYK 4FL9A 1X3NA 2HOEA 5AQGA 1LW0A 2A6AA 4IJAA 3OYHA 4BC2A 4B1ZA 4Z4HA 4XH4A 3D6RA 4FJKA 4HCCA 4MO5A 1GLBG 4FZZA 2OPRA 4CZHA 3VQCA 4CVNE 1KLMA 1JL2A 4N76A 4RW6A 1G99A 2IVPA 4BRNA 3DRSA 3LP3A 1D9FA 4ILGB 4FWKA 3KWIA 1GLCG 3NH1A 1C0FA 1KFSA 4CE9A 4EP5A 2P9LB 2AP1A 4BC5A 3O3FA 1GOBA 4KHWA 3L0QA 4ISGA 1Q8IA 3MN7A 4FJLA 1FXXA 5C15A 1RDUA 1GOCA 3KJVA 4YNQA 3CCLN 2FF6A 4BRMA 5KRTA 3SQ1A 3RTVA 4O44A 2IC3A 2HHUA 3E9OA 3F2KA 1R59O 3ENHA 1D8YA 2G8FA 1VSIA 2XO7A 1M1KO 1SL2A 1IV0A 3D2EA 3E01A 4M3XA 3T1AA 2ZGZA 5GIOA 4ZTFA 3K5NA 4M3WA 2YHAA 1ZC6A 1YTUA 3THXA 3L2UA 3HL8A 2YJFA 4PHTX 1OH7A 4A59A 5AQYA 3NGIA 1DTQA 4O8KA 4U7BA 3DYAA 4DV6K 2ZD1A 2D0OA 4B9VA 1EXQA 2RF2A 2ZQBA 4JN4A 5AQFA 4FVUA 5AQTA 4ILHA 4YDUC 4CJFA 1VQON 3CCQN 3CF5L 2ZM6K 1RTDA 1NGHA 1JLEA 4JK9A 1VQ5N 1SQKA 4EHUA 5BRHA 4DQQA 3CFPA 2P51A 1U49A 5LJVA 4WCEL 3U3YA 3FGUA 3AVLA 2QXFA 4BG9A 2F8SA 4L3QA 3NCIA 4FJXA 2WONA 4CEEA 4DB3A 1RGIA 4GY2B 3KLHA 4L8RB 4Y1DA 1SKSA 2W41A 4GKJK 4W5RA 2WTUA 5D3GA 4FWRA 4IG3A 1WSIA 3M8QA 4FPBA 4M7YA 4B3OA 5E26A 2KFNA 2QWQA 3FFIA 4DR3K 4JRQA 3WNHA 1NGFA 1BCOA 1NMNA 1RBUA 2E88A 3EEQA 4W5OA 5FRNA 3VF4A 2ETJA 2FBVA 1VSEA 2UUBK 2E8AA 2G8UA 5LL6Z 3H45C 3OHRA 3QEPA 3SAGA 3J80O 4DTSA 3OA9A 4JHDB 3EYZA 1VSJA 3H3NO 3QB0A 4NXNK 4CF1A 4CFBA 4HTUA 4E3SA 4N41A 1RFQA 2HBJA 4FO0A 2NNWA 1YJWN 4E1MA 3CCEN 1MDUB 3EY1A 2QM1A 4G1QA 5BPLA 4GV6A 2GELA 3G25A 3DXKA 3NGZA 3AO4A 2P9LA 5AJ3K 2FBTA 3KK7A 4Z4FA 1VSFA 5CY4A 4CHQA 2O8FB 4CK1A 1X1PA 1WBBA 1NGDA 1X9WA 4BC3A 3TSQA 1NK0A 5AQXA 2QA4N 1HR0K 4CFCA 1RILA 3AARA 4C8LA 4DLEA 4BDZA 2B5JA 3S9HA 4LSLA 5CZ1A 3ATUA 2E6MA 4IOXA 3CC4N 3LL3A 3E1YA 3HVTA 5J2QA 1Q81O 5LJWA 1IBKK 2V7ZA 3LWLA 5HROA 4PQUA 3EZ5A 4KKOA 1QQOA 4JAXA 3C7NB 3I0SA 3Q7BA 3KD1E 1QQNA 1NOYA 1YF5L 1YHQN 3SMPA 2D4WA 1S6QA 3CETA 3FFKB 3O08A 3P1GA 3SMSA 3BF1A 3ZCMA 1IBMK 4MFBA 1IG8A 4CJ3A 4JKCA 5AQMA 4E7HA 2O8EA 2F9WA 3LDSA 4OPAA 4LH5A 2F9TA 1UA0A 3MAQA 1RT5A 1IH7A 3IFRA 5I42A 5IT9O 2YI1A 2EWSA 3TU5A 2A1SA 4R5PA 4AM7A 4FK2A 3OYFA 4H5VA 4CGFA 1SL1A 4ISFA 3BF3A 4WQ4C 4CJEA 3BZKA 4NLBA 4GNIA 3OYNA 5JVHL 3AVGA 1ATRA 3DRPA 3JXUA 3ZSXA 4H5NA 3P83D 4CK3A 1HUXA 1WSGA 4DKWA 1YUWA 4FJ5A 1HKGA 2BUPA 3V6DA 3ZSYA 3AY9A 1NM1A 3F9MA 2DFEA 1QQMA 4DLGA 4BRHA 4WQ5C 3QBXA 5TKYA 3MN6A 5FRMA 2X78A 3VENA 4CBUA 5KGWA 3ZEUB 1RBRA 3LDNA 4CZFA 3H3OB 4IOCL 1NWKA 5HRPA
chains in the Genus database with same CATH topology
3NAEA 1VSKA 4KRFA 2KW4A 4M3TA 1LWCA 4FJ7A 3SYZA 3DM2A 3CFRA 1S1UA 4JLHA 1U48A 3HK2A 4DWIA 3CM6A 1RDBA 1IKVA 5HBMA 1U47A 1NJWA 5DMRA 2HMIA 1BI4B 4ELUA 2F8TA 2HHWA 4OKEA 4CFDA 3QERA 3IRXA 3SCXA 3SQ0A 2HVIA 1TV6A 4CIFA 1TKZA 3OYBA 1RTIA 1BIZA 1JLGA 5HLFA 3NE6A 5CYMA 1L3VA 1C1BA 1RT3A 3NBPA 4FZXC 4DMNA 1IKYA 1EX4A 2YNIA 4DFKA 2OYQA 1JLBA 4FCYA 1NKEA 1FKPA 4LSNA 3TABA 3ZSWA 4FK4A 4O0JA 2VG7A 3B6OA 2OPSA 3QEXA 1Q9YA 4OLBA 4PWDA 5EU7A 2BANA 3VQ7A 4HHTA 1L3SA 4W5TA 4DTJA 3SUPA 2FBXA 1XC9A 2YNHA 4F8RA 4OLAA 1BIUA 4JS5A 1BGXT 1HNIA 3NFAA 3QIPA 4CIEA 3NH0A 3D0PA 4FLYA 3AA4A 4AILC 3U6FA 3PX6A 4DSIA 4FJHA 4KI6A 3HP9A 1JLQA 4CECA 4FW1A 4KHSA 3B6PA 3OYDA 2IAJA 3HYFA 4CEDA 3QEVA 2P5OA 2YNFA 4KO0A 3DLEA 1JLAA 1FKOA 1YTAA 2Q3SA 2B6AA 4CEQA 1C0TA 3AO1A 4OKJA 3BGRA 4QAGA 1IKWA 3DRRA 1F21A 2HNYA 3U3GA 3VQPA 3OJSA 5JS2A 3HXMA 4FLZA 4I9QA 1SL0A 4FLWA 3AVKA 2P1JA 4ZHRA 4UQGA 1EP4A 4BE2A 3AVMA 1T7PA 4O5BA 2HHTA 4FW2A 2IS3A 3K5OA 1RDAA 5HRRA 1X9MA 1WN7A 4IDKA 4KI4A 3KKRA 4O55A 3F9KA 1S6PA 4H4OA 3SPYA 3OYMA 4Z4IA 5KGXA 1L5UA 3AVJA 1S1XA 2VG5A 1XHXA 4E7KA 1CLQA 1S9EA 1HYSA 3SZ2A 1QHTA 4K8XA 3K5LA 3V9XA 1B9FA 1BHLA 1RT4A 3KLIA 4N56A 4DTPA 3RMCA 3VQEA 4W5NA 1DTTA 4HCBA 4DF8A 1ASUA 2NUBA 3M8PA 1RTHA 1HYVA 1RCHA 3LALA 4IKFA 5CYQA 3L8BA 1TKXA 1J53A 1O1WA 4IFVA 4XIUA 4DTMA 3D45A 4CF2A 4CJSA 4DU4A 4AHTA 3P5JA 1W0HA 5J1EA 4FLTA 1T8EA 2AJQA 3QLHA 2OPPA 1VRUA 3V1OA 3SNNA 3RR8A 2DY4A 3DLKA 4CEAA 2RPIA 4HVJA 2Z1HA 3ULDA 2XY8A 2FBYA 4AHVA 3SQ4A 4KHQA 3V9ZA 3PV8A 1CXQA 1U4BA 4TSXA 4Y1CA 4EP4A 4DTXA 3I0RA 1NOZA 3TR8A 3KD5E 2G8HA 3NF8A 1HPZA 2IDOA 4DF4A 2KTQA 3C94A 5C24A 4OKKA 2F96A 4N47A 3M8RA 3NF7A 4M3RA 4JRPA 4KAZA 4B9LA 1RDDA 4CESA 4CEOA 4FJ8A 5J2PA 4DTNA 3TAQA 1VSLA 2ITGA 4OJRA 4CJ4A 3VA3A 1TK5A 1NKBA 4BDYA 1QSYA 3LPTA 3IAYA 4FJIA 1KTQA 3RRHA 3L3VA 3ZT2A 1VK0A 4CHPA 4B9SA 2HB5A 4OPKA 1LV5A 1I39A 2QKBA 5C42A 3OYAA 3MXIA 3AA2A 3HVRA 4Z0UA 1Q9XA 3K5MA 4F2RA 4FJJA 4CK2A 1IKXA 4CJUA 4RW8A 3S3MA 3NGYA 3OYEA 4C8OA 4J2BA 1A5VA 2KQ2A 2E4LA 1C0UA 3OYCA 2X74A 1S1TA 1IO2A 3PO4A 5T7BA 1RT6A 4Z4CA 4O4GA 2D0BA 3HPHA 1CZBA 3V4IA 1NK8A 2X6SA 4NCAA 4CGDA 4J2AA 1KVCA 4DS4A 1RBVA 2YNGA 3UIQA 3NHGA 3VN5A 1KSPA 3WNEA 4B9NA 2GBZA 3VQDA 1NK5A 4FJ9A 3ZSQA 4DS5A 4B08A 4CJTA 3L2QA 4Q0BA 3QETA 3PX4A 4MQ3A 3JYTA 1LWFA 3MEDA 4AHCA 5DK5A 2I5JA 2QK9A 4B9UA 4FZYA 4B9TA 3TAFA 3SUQA 4CGHA 2YKNA 1KCFA 3HPOA 1QSSA 1RT2A 1SUQA 4CJ5A 1BL3A 3MXMA 1RNHA 3HSTB 2BDPA 1BI4A 3VQAA 2D5RA 3LP2A 4DSJA 2EHGA 4KTZA 3PX0A 3VQ5A 1JXEA 4ZTJA 1NKCA 1TKTA 1HQEA 2D0CA 3F73A 2IGIA 1HNVA 1T03A 4CIGA 1EKEA 4Z4EA 3TAGA 1TK0A 2KZZA 1GOAA 1LW0A 1JL1A 3OYHA 4DFPA 2O4GA 1T05A 4DQIA 3ZT3A 4QCLA 4CJKA 4Z4HA 4I7FA 1YT3A 4FJKA 4BWJA 1C1CA 1S5JA 1BQNA 3L3UA 5HRNA 1C0MA 3OYLA 1KLNA 3PO5A 3PY8A 4HCCA 2BGGA 2G8VA 4M3YA 2HHXA 4NYNA 3K2PA 4FZZA 2OPRA 3OYIA 4J2DA 1LW2A 3CYMA 3VQCA 1NJYA 4C8KA 2HNZA 4NCBA 3OVNA 1KLMA 1JL2A 4N76A 1S1WA 3BDPA 4RW6A 1N5YA 3QNNA 3VQ4A 1K6YA 3OY9A 3AVHA 1WSFA 1TVRA 2YKMA 3DRSA 3LP3A 4CEFA 4CJVA 3OJUA 4CJPA 3L2VA 4BE1A 3HJFA 4PY5A 1J5OA 4KHYA 3SV4A 3THVA 3NH1A 3SUOA 3AVCA 4M45A 4N5SA 1KFSA 4CE9A 4EP5A 3H08A 1CXUA 3JSMA 3ZT1A 4FYDA 3O3FA 1GOBA 4KB1A 3AA5X 1JLFA 4KHWA 4W5QA 4PUOA 3RMDA 1D9DA 2ATQA 1Q8IA 3SV3A 4C8NA 3LWMA 2X6NA 4HUFA 4FJLA 1FXXA 4HUGA 1HRHA 1GOCA 5K14A 3KJVA 4YNQA 3SUNA 4J2EA 2G8IA 4GMJB 4CHNA 2Y1IA 5KRTA 3SQ1A 1FK9A 3RTVA 2DFFA 5KTQA 2HHSA 4O44A 4AHRA 4CERA 1RBTA 3TANA 2IC3A 1XWLA 3K57A 3NF6A 4FJGA 2HHUA 2QKKA 1RT7A 2GV9A 4B8CA 4DG1A 1WAFA 3WNGA 2YHBA 1D8YA 2G8FA 1VSIA 1VSHA 2XO7A 4KHNA 1SL2A 5KRSA 4FM2A 1XHZA 4FLUA 3TARA 2OZMA 3G0ZA 3KK2A 3E01A 1ASWA 3HM9A 4M3XA 3AVIA 1UAXA 3T1AA 3TAEA 4CF0A 4ZTFA 3K5NA 4F3TA 4CJRA 4M3WA 2YHAA 1YTUA 2JLEA 3ZSOA 1KRPA 1WAJA 4CEZA 3NH2A 3L2UA 3HL8A 3AVFA 4Z4GA 3RR7A 1L3UA 3ISNC 4M41A 3NGIA 2Y1JA 1DTQA 4E1NA 2PY5A 3DYAA 3RRGA 4EZ9A 2G8KA 2ZD1A 3CM5A 4ELTA 4B9VA 1TK8A 1EXQA 2RF2A 2ZQBA 3KIOA 4DQSA 3HO1A 4B8AB 4CJFA 3DLGA 4IG0A 4CHOA 4AHSA 3RWUA 3C6TA 3DOLA 3OS0A 1ZBHA 1RTDA 2PZSA 1JLEA 1G15A 4E7JA 5C25A 3AO3A 4DFMA 4BE0A 1ZBIA 2KFZA 3ASMA 3LZJA 4DQQA 3CFPA 2P51A 4CJQA 1HYZA 1U49A 1HMVA 1LAWA 3U3YA 3AV9A 4F3OA 5J2NA 1U45A 3AVLA 2QXFA 2IOCA 4FVMA 1NJXA 3G10A 1TKDA 2VWJA 2Z1GA 1J9AA 2HHQA 3VQ6A 2F8SA 1A5WA 3NCIA 4E0DA 4FJXA 1C6VA 3DLHA 2WONA 4CEEA 4KTWA 1WSJA 3V1RA 1ZBUA 3LP0A 3KLHA 5HP1A 1D5AA 1U04A 4Y1DA 1SKSA 1QTMA 4L8RB 4M42A 4O0IA 1IG9A 3C6UA 4W5RA 4K8ZA 5D3GA 2Z1JA 1NK9A 3ZT4A 1XI1A 1TL1A 4CEBA 3AVNA 4IG3A 4RW4A 1NK7A 4C8MA 1WSIA 3M8QA 1UA1A 3IS9A 1N6QA 1QQCA 2XY6A 4B3OA 4CF8A 4I2QA 3V9UA 3SQ2A 3KLFA 4KV8A 3QINA 1JKHA 3ALYA 3KK3A 3TAPA 2KFNA 3FFIA 4F2SA 2FC0A 1VSMA 3V1QA 3KLEA 3RMAA 4JRQA 3VQBA 3OS2A 3WNHA 5JS1A 3TI0A 2VWKA 3DLBA 1RBUA 1BCOA 4CGJA 4W5OA 4KHUA 5FRNA 2ETJA 2FBVA 5FROA 4H4MA 1VSEA 5HRSA 1B92A 3O3GA 3OS1A 2G8UA 3NF9A 3O4QA 4FLXA 4DFJA 4RG8A 5KI6A 3QEPA 4CF9A 1DLOA 3KLGA 1NK4A 2OA8A 4FJNA 3TAMA 4DTSA 3DLRA 1VSDA 4Q5VA 3EYZA 1VSJA 1Z26A 4HUEA 2RN2A 4OGEA 4CF1A 3LPUA 4CFBA 4HTUA 4E3SA 4N41A 4DSFA 1ZBLA 2OZSA 4BDPA 2VG6A 4OGCA 4E1MA 1SKRA 2Z1IA 2RKIA 3EY1A 4G1QA 3TWHA 1C1AA 3SI6A 4ID5A 3NGZA 1D9FA 3AO4A 3HPGA 1TAQA 4YFUA 3RMBA 1ZBFA 4AHUA 2FBTA 1TAUA 4Z4FA 3C95A 1VSFA 1S9GA 3CG7A 3KKSA 5CY4A 2A1RA 4CHQA 5E41A 2EX3A 1KVAA 4CK1A 5J2MA 4I2PA 1J54A 4QOZB 1X1PA 2PYLA 4OVLA 4WE1A 1X9WA 3KTQA 1WNSA 3LANA 1QE1A 4LH4A 1NK0A 1HJRA 2D0AA 3OYGA 4IBNA 1I3AA 1RILA 4CFCA 1LAVA 3MXJA 1WSHA 4DLEA 4DQRA 4CGIA 4C8LA 2YV0X 2B5JA 4BDZA 4FM0A 1UWBA 3QESA 3S9HA 3SPZA 1Z25A 4LSLA 1CZ9A 5CZ1A 5CZ2A 4DTUA 2E6MA 5J2QA 3HVTA 4EZ6A 4F4KA 2B4JA 1EETA 2PYJA 1JXBA 3MECA 3LWLA 2OPQA 4FM1A 1SKWA 5HROA 4ELVA 4PQUA 3AVAA 1TL3A 2E6LA 3EZ5A 4DTRA 4KKOA 1JLCA 3LP1A 4DU3A 4AH9A 1ZYQA 5SZTA 3QO9A 4BACA 3ZT0A 3I0SA 4CFAA 1SV5A 2XRIA 3KK1A 3ZSVA 4DSKA 3KD1E 3HP6A 3CQ8A 1NOYA 3NDKA 4CJWA 3ITHA 1S6QA 4NYFA 3AO5A 3P1GA 3LAKA 2BE2A 1Y97A 2HW3A 1BCMA 3ZCMA 4MFBA 3ZSRA 1TGOA 4CJ3A 4OPJA 4E89A 4E7HA 4ICLA 4RW9A 3WNFA 5I3UA 1YVUA 3QNOA 4FJMA 3A2FA 3CFOA 4KREA 1ASVA 3T19A 1R0AA 3LDSA 1L3TA 2DFHA 4LH5A 3AVBA 1VRTA 4ID1A 1LWEA 3O4NA 2WOMA 4GVMA 2XY5A 2R7YA 2JGUA 4DU1A 1BQMA 1UA0A 3DOKA 1RBSA 3MAQA 4E19A 1RT5A 1IH7A 4BWMA 1RTJA 5I42A 3PUFA 3HT3A 3V9SA 1WSEA 4PA1A 2DTUA 2HNDA 1RT1A 4IFYA 1S1VA 3S3OA 2A1SA 4R5PA 4JS4A 4FK2A 4FK0A 3AA3A 3OYFA 2KZMA 5SWMA 4CGFA 1REVA 1W9HA 3V81A 1SL1A 3IG1A 1NJZA 2GUIA 4KB0A 3L2WA 1MU2A 4GW6A 4I9LA 4CGGA 4CJEA 3MEGA 5FDLA 3VQ8A 3OYJA 3T3FA 4B9MA 1WLJA 3OYNA 1QSLA 3AVGA 2HHVA 1X9SA 1QS4A 3DRPA 3ZSXA 1BISA 3SJJA 2P5GA 4CCHA 3P83D 4DQPA 1ITGA 3K58A 4M3UA 2HVHA 3VQQA 3QIOA 4CK3A 3LZIA 4FXDA 1WSGA 3V9WA 3O3HA 2XHBA 3VQ9A 4FJ5A 4KPYA 4LD0A 1UOCA 3ZSYA 3QEWA 3V6DA 4CHZA 3M8SA 1RDCA 3L2RA 4E7LA 3K59A 2W42A 2XY7A 2DFEA 3S3NA 4KFBA 4CHYA 4E7IA 4RW7A 4FLVA 2O4IA 4DLGA 3VA0A 4CJLA 1A5XA 1HQUA 3AO2A 4DSLA 1KVBA 3LAMA 1KFDA 2G8WA 5FRMA 2X78A 3DMJA 3ZSZA 4NCGA 4M3ZA 3QEIA 5KGWA 3I8DA 3OYKA 3DI6A 4KTQA 1RBRA 4DTOA 2ZE2A 2LSNA 1NK6A 4DSEA 4H8KA 4LY7A 5HRPA 1B9DA 3MEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NAE A;  1VSK A;  4KRF A;  2KW4 A;  4M3T A;  1LWC A;  4FJ7 A;  3SYZ A;  3DM2 A;  3CFR A;  1S1U A;  4JLH A;  1U48 A;  3HK2 A;  4DWI A;  3CM6 A;  1RDB A;  1IKV A;  5HBM A;  1U47 A;  1NJW A;  5DMR A;  2HMI A;  1BI4 B;  4ELU A;  2F8T A;  2HHW A;  4OKE A;  4CFD A;  3QER A;  3IRX A;  3SCX A;  3SQ0 A;  2HVI A;  1TV6 A;  4CIF A;  1TKZ A;  3OYB A;  1RTI A;  1BIZ A;  1JLG A;  5HLF A;  3NE6 A;  5CYM A;  1L3V A;  1C1B A;  1RT3 A;  3NBP A;  4FZX C;  4DMN A;  1IKY A;  1EX4 A;  2YNI A;  4DFK A;  2OYQ A;  1JLB A;  4FCY A;  1NKE A;  1FKP A;  4LSN A;  3TAB A;  3ZSW A;  4FK4 A;  4O0J A;  2VG7 A;  3B6O A;  2OPS A;  3QEX A;  1Q9Y A;  4OLB A;  4PWD A;  5EU7 A;  2BAN A;  3VQ7 A;  4HHT A;  1L3S A;  4W5T A;  4DTJ A;  3SUP A;  2FBX A;  1XC9 A;  2YNH A;  4F8R A;  4OLA A;  1BIU A;  4JS5 A;  1BGX T;  1HNI A;  3NFA A;  3QIP A;  4CIE A;  3NH0 A;  3D0P A;  4FLY A;  3AA4 A;  4AIL C;  3U6F A;  3PX6 A;  4DSI A;  4FJH A;  4KI6 A;  3HP9 A;  1JLQ A;  4CEC A;  4FW1 A;  4KHS A;  3B6P A;  3OYD A;  2IAJ A;  3HYF A;  4CED A;  3QEV A;  2P5O A;  2YNF A;  4KO0 A;  3DLE A;  1JLA A;  1FKO A;  1YTA A;  2Q3S A;  2B6A A;  4CEQ A;  1C0T A;  3AO1 A;  4OKJ A;  3BGR A;  4QAG A;  1IKW A;  3DRR A;  1F21 A;  2HNY A;  3U3G A;  3VQP A;  3OJS A;  5JS2 A;  3HXM A;  4FLZ A;  4I9Q A;  1SL0 A;  4FLW A;  3AVK A;  2P1J A;  4ZHR A;  4UQG A;  1EP4 A;  4BE2 A;  3AVM A;  1T7P A;  4O5B A;  2HHT A;  4FW2 A;  2IS3 A;  3K5O A;  1RDA A;  5HRR A;  1X9M A;  1WN7 A;  4IDK A;  4KI4 A;  3KKR A;  4O55 A;  3F9K A;  1S6P A;  4H4O A;  3SPY A;  3OYM A;  4Z4I A;  5KGX A;  1L5U A;  3AVJ A;  1S1X A;  2VG5 A;  1XHX A;  4E7K A;  1CLQ A;  1S9E A;  1HYS A;  3SZ2 A;  1QHT A;  4K8X A;  3K5L A;  3V9X A;  1B9F A;  1BHL A;  1RT4 A;  3KLI A;  4N56 A;  4DTP A;  3RMC A;  3VQE A;  4W5N A;  1DTT A;  4HCB A;  4DF8 A;  1ASU A;  2NUB A;  3M8P A;  1RTH A;  1HYV A;  1RCH A;  3LAL A;  4IKF A;  5CYQ A;  3L8B A;  1TKX A;  1J53 A;  1O1W A;  4IFV A;  4XIU A;  4DTM A;  3D45 A;  4CF2 A;  4CJS A;  4DU4 A;  4AHT A;  3P5J A;  1W0H A;  5J1E A;  4FLT A;  1T8E A;  2AJQ A;  3QLH A;  2OPP A;  1VRU A;  3V1O A;  3SNN A;  3RR8 A;  2DY4 A;  3DLK A;  4CEA A;  2RPI A;  4HVJ A;  2Z1H A;  3ULD A;  2XY8 A;  2FBY A;  4AHV A;  3SQ4 A;  4KHQ A;  3V9Z A;  3PV8 A;  1CXQ A;  1U4B A;  4TSX A;  4Y1C A;  4EP4 A;  4DTX A;  3I0R A;  1NOZ A;  3TR8 A;  3KD5 E;  2G8H A;  3NF8 A;  1HPZ A;  2IDO A;  4DF4 A;  2KTQ A;  3C94 A;  5C24 A;  4OKK A;  2F96 A;  4N47 A;  3M8R A;  3NF7 A;  4M3R A;  4JRP A;  4KAZ A;  4B9L A;  1RDD A;  4CES A;  4CEO A;  4FJ8 A;  5J2P A;  4DTN A;  3TAQ A;  1VSL A;  2ITG A;  4OJR A;  4CJ4 A;  3VA3 A;  1TK5 A;  1NKB A;  4BDY A;  1QSY A;  3LPT A;  3IAY A;  4FJI A;  1KTQ A;  3RRH A;  3L3V A;  3ZT2 A;  1VK0 A;  4CHP A;  4B9S A;  2HB5 A;  4OPK A;  1LV5 A;  1I39 A;  2QKB A;  5C42 A;  3OYA A;  3MXI A;  3AA2 A;  3HVR A;  4Z0U A;  1Q9X A;  3K5M A;  4F2R A;  4FJJ A;  4CK2 A;  1IKX A;  4CJU A;  4RW8 A;  3S3M A;  3NGY A;  3OYE A;  4C8O A;  4J2B A;  1A5V A;  2KQ2 A;  2E4L A;  1C0U A;  3OYC A;  2X74 A;  1S1T A;  1IO2 A;  3PO4 A;  5T7B A;  1RT6 A;  4Z4C A;  4O4G A;  2D0B A;  3HPH A;  1CZB A;  3V4I A;  1NK8 A;  2X6S A;  4NCA A;  4CGD A;  4J2A A;  1KVC A;  4DS4 A;  1RBV A;  2YNG A;  3UIQ A;  3NHG A;  3VN5 A;  1KSP A;  3WNE A;  4B9N A;  2GBZ A;  3VQD A;  1NK5 A;  4FJ9 A;  3ZSQ A;  4DS5 A;  4B08 A;  4CJT A;  3L2Q A;  4Q0B A;  3QET A;  3PX4 A;  4MQ3 A;  3JYT A;  1LWF A;  3MED A;  4AHC A;  5DK5 A;  2I5J A;  2QK9 A;  4B9U A;  4FZY A;  4B9T A;  3TAF A;  3SUQ A;  4CGH A;  2YKN A;  1KCF A;  3HPO A;  1QSS A;  1RT2 A;  1SUQ A;  4CJ5 A;  1BL3 A;  3MXM A;  1RNH A;  3HST B;  2BDP A;  1BI4 A;  3VQA A;  2D5R A;  3LP2 A;  4DSJ A;  2EHG A;  4KTZ A;  3PX0 A;  3VQ5 A;  1JXE A;  4ZTJ A;  1NKC A;  1TKT A;  1HQE A;  2D0C A;  3F73 A;  2IGI A;  1HNV A;  1T03 A;  4CIG A;  1EKE A;  4Z4E A;  3TAG A;  1TK0 A;  2KZZ A;  1GOA A;  1LW0 A;  1JL1 A;  3OYH A;  4DFP A;  2O4G A;  1T05 A;  4DQI A;  3ZT3 A;  4QCL A;  4CJK A;  4Z4H A;  4I7F A;  1YT3 A;  4FJK A;  4BWJ A;  1C1C A;  1S5J A;  1BQN A;  3L3U A;  5HRN A;  1C0M A;  3OYL A;  1KLN A;  3PO5 A;  3PY8 A;  4HCC A;  2BGG A;  2G8V A;  4M3Y A;  2HHX A;  4NYN A;  3K2P A;  4FZZ A;  2OPR A;  3OYI A;  4J2D A;  1LW2 A;  3CYM A;  3VQC A;  1NJY A;  4C8K A;  2HNZ A;  4NCB A;  3OVN A;  1KLM A;  1JL2 A;  4N76 A;  1S1W A;  3BDP A;  4RW6 A;  1N5Y A;  3QNN A;  3VQ4 A;  1K6Y A;  3OY9 A;  3AVH A;  1WSF A;  1TVR A;  2YKM A;  3DRS A;  3LP3 A;  4CEF A;  4CJV A;  3OJU A;  4CJP A;  3L2V A;  4BE1 A;  3HJF A;  4PY5 A;  1J5O A;  4KHY A;  3SV4 A;  3THV A;  3NH1 A;  3SUO A;  3AVC A;  4M45 A;  4N5S A;  1KFS A;  4CE9 A;  4EP5 A;  3H08 A;  1CXU A;  3JSM A;  3ZT1 A;  4FYD A;  3O3F A;  1GOB A;  4KB1 A;  3AA5 X;  1JLF A;  4KHW A;  4W5Q A;  4PUO A;  3RMD A;  1D9D A;  2ATQ A;  1Q8I A;  3SV3 A;  4C8N A;  3LWM A;  2X6N A;  4HUF A;  4FJL A;  1FXX A;  4HUG A;  1HRH A;  1GOC A;  5K14 A;  3KJV A;  4YNQ A;  3SUN A;  4J2E A;  2G8I A;  4GMJ B;  4CHN A;  2Y1I A;  5KRT A;  3SQ1 A;  1FK9 A;  3RTV A;  2DFF A;  5KTQ A;  2HHS A;  4O44 A;  4AHR A;  4CER A;  1RBT A;  3TAN A;  2IC3 A;  1XWL A;  3K57 A;  3NF6 A;  4FJG A;  2HHU A;  2QKK A;  1RT7 A;  2GV9 A;  4B8C A;  4DG1 A;  1WAF A;  3WNG A;  2YHB A;  1D8Y A;  2G8F A;  1VSI A;  1VSH A;  2XO7 A;  4KHN A;  1SL2 A;  5KRS A;  4FM2 A;  1XHZ A;  4FLU A;  3TAR A;  2OZM A;  3G0Z A;  3KK2 A;  3E01 A;  1ASW A;  3HM9 A;  4M3X A;  3AVI A;  1UAX A;  3T1A A;  3TAE A;  4CF0 A;  4ZTF A;  3K5N A;  4F3T A;  4CJR A;  4M3W A;  2YHA A;  1YTU A;  2JLE A;  3ZSO A;  1KRP A;  1WAJ A;  4CEZ A;  3NH2 A;  3L2U A;  3HL8 A;  3AVF A;  4Z4G A;  3RR7 A;  1L3U A;  3ISN C;  4M41 A;  3NGI A;  2Y1J A;  1DTQ A;  4E1N A;  2PY5 A;  3DYA A;  3RRG A;  4EZ9 A;  2G8K A;  2ZD1 A;  3CM5 A;  4ELT A;  4B9V A;  1TK8 A;  1EXQ A;  2RF2 A;  2ZQB A;  3KIO A;  4DQS A;  3HO1 A;  4B8A B;  4CJF A;  3DLG A;  4IG0 A;  4CHO A;  4AHS A;  3RWU A;  3C6T A;  3DOL A;  3OS0 A;  1ZBH A;  1RTD A;  2PZS A;  1JLE A;  1G15 A;  4E7J A;  5C25 A;  3AO3 A;  4DFM A;  4BE0 A;  1ZBI A;  2KFZ A;  3ASM A;  3LZJ A;  4DQQ A;  3CFP A;  2P51 A;  4CJQ A;  1HYZ A;  1U49 A;  1HMV A;  1LAW A;  3U3Y A;  3AV9 A;  4F3O A;  5J2N A;  1U45 A;  3AVL A;  2QXF A;  2IOC A;  4FVM A;  1NJX A;  3G10 A;  1TKD A;  2VWJ A;  2Z1G A;  1J9A A;  2HHQ A;  3VQ6 A;  2F8S A;  1A5W A;  3NCI A;  4E0D A;  4FJX A;  1C6V A;  3DLH A;  2WON A;  4CEE A;  4KTW A;  1WSJ A;  3V1R A;  1ZBU A;  3LP0 A;  3KLH A;  5HP1 A;  1D5A A;  1U04 A;  4Y1D A;  1SKS A;  1QTM A;  4L8R B;  4M42 A;  4O0I A;  1IG9 A;  3C6U A;  4W5R A;  4K8Z A;  5D3G A;  2Z1J A;  1NK9 A;  3ZT4 A;  1XI1 A;  1TL1 A;  4CEB A;  3AVN A;  4IG3 A;  4RW4 A;  1NK7 A;  4C8M A;  1WSI A;  3M8Q A;  1UA1 A;  3IS9 A;  1N6Q A;  1QQC A;  2XY6 A;  4B3O A;  4CF8 A;  4I2Q A;  3V9U A;  3SQ2 A;  3KLF A;  4KV8 A;  3QIN A;  1JKH A;  3ALY A;  3KK3 A;  3TAP A;  2KFN A;  3FFI A;  4F2S A;  2FC0 A;  1VSM A;  3V1Q A;  3KLE A;  3RMA A;  4JRQ A;  3VQB A;  3OS2 A;  3WNH A;  5JS1 A;  3TI0 A;  2VWK A;  3DLB A;  1RBU A;  1BCO A;  4CGJ A;  4W5O A;  4KHU A;  5FRN A;  2ETJ A;  2FBV A;  5FRO A;  4H4M A;  1VSE A;  5HRS A;  1B92 A;  3O3G A;  3OS1 A;  2G8U A;  3NF9 A;  3O4Q A;  4FLX A;  4DFJ A;  4RG8 A;  5KI6 A;  3QEP A;  4CF9 A;  1DLO A;  3KLG A;  1NK4 A;  2OA8 A;  4FJN A;  3TAM A;  4DTS A;  3DLR A;  1VSD A;  4Q5V A;  3EYZ A;  1VSJ A;  1Z26 A;  4HUE A;  2RN2 A;  4OGE A;  4CF1 A;  3LPU A;  4CFB A;  4HTU A;  4E3S A;  4N41 A;  4DSF A;  1ZBL A;  2OZS A;  4BDP A;  2VG6 A;  4OGC A;  4E1M A;  1SKR A;  2Z1I A;  2RKI A;  3EY1 A;  4G1Q A;  3TWH A;  1C1A A;  3SI6 A;  4ID5 A;  3NGZ A;  1D9F A;  3AO4 A;  3HPG A;  1TAQ A;  4YFU A;  3RMB A;  1ZBF A;  4AHU A;  2FBT A;  1TAU A;  4Z4F A;  3C95 A;  1VSF A;  1S9G A;  3CG7 A;  3KKS A;  5CY4 A;  2A1R A;  4CHQ A;  5E41 A;  2EX3 A;  1KVA A;  4CK1 A;  5J2M A;  4I2P A;  1J54 A;  4QOZ B;  1X1P A;  2PYL A;  4OVL A;  4WE1 A;  1X9W A;  3KTQ A;  1WNS A;  3LAN A;  1QE1 A;  4LH4 A;  1NK0 A;  1HJR A;  2D0A A;  3OYG A;  4IBN A;  1I3A A;  1RIL A;  4CFC A;  1LAV A;  3MXJ A;  1WSH A;  4DLE A;  4DQR A;  4CGI A;  4C8L A;  2YV0 X;  2B5J A;  4BDZ A;  4FM0 A;  1UWB A;  3QES A;  3S9H A;  3SPZ A;  1Z25 A;  4LSL A;  1CZ9 A;  5CZ1 A;  5CZ2 A;  4DTU A;  2E6M A;  5J2Q A;  3HVT A;  4EZ6 A;  4F4K A;  2B4J A;  1EET A;  2PYJ A;  1JXB A;  3MEC A;  3LWL A;  2OPQ A;  4FM1 A;  1SKW A;  5HRO A;  4ELV A;  4PQU A;  3AVA A;  1TL3 A;  2E6L A;  3EZ5 A;  4DTR A;  4KKO A;  1JLC A;  3LP1 A;  4DU3 A;  4AH9 A;  1ZYQ A;  5SZT A;  3QO9 A;  4BAC A;  3ZT0 A;  3I0S A;  4CFA A;  1SV5 A;  2XRI A;  3KK1 A;  3ZSV A;  4DSK A;  3KD1 E;  3HP6 A;  3CQ8 A;  1NOY A;  3NDK A;  4CJW A;  3ITH A;  1S6Q A;  4NYF A;  3AO5 A;  3P1G A;  3LAK A;  2BE2 A;  1Y97 A;  2HW3 A;  1BCM A;  3ZCM A;  4MFB A;  3ZSR A;  1TGO A;  4CJ3 A;  4OPJ A;  4E89 A;  4E7H A;  4ICL A;  4RW9 A;  3WNF A;  5I3U A;  1YVU A;  3QNO A;  4FJM A;  3A2F A;  3CFO A;  4KRE A;  1ASV A;  3T19 A;  1R0A A;  3LDS A;  1L3T A;  2DFH A;  4LH5 A;  3AVB A;  1VRT A;  4ID1 A;  1LWE A;  3O4N A;  2WOM A;  4GVM A;  2XY5 A;  2R7Y A;  2JGU A;  4DU1 A;  1BQM A;  1UA0 A;  3DOK A;  1RBS A;  3MAQ A;  4E19 A;  1RT5 A;  1IH7 A;  4BWM A;  1RTJ A;  5I42 A;  3PUF A;  3HT3 A;  3V9S A;  1WSE A;  4PA1 A;  2DTU A;  2HND A;  1RT1 A;  4IFY A;  1S1V A;  3S3O A;  2A1S A;  4R5P A;  4JS4 A;  4FK2 A;  4FK0 A;  3AA3 A;  3OYF A;  2KZM A;  5SWM A;  4CGF A;  1REV A;  1W9H A;  3V81 A;  1SL1 A;  3IG1 A;  1NJZ A;  2GUI A;  4KB0 A;  3L2W A;  1MU2 A;  4GW6 A;  4I9L A;  4CGG A;  4CJE A;  3MEG A;  5FDL A;  3VQ8 A;  3OYJ A;  3T3F A;  4B9M A;  1WLJ A;  3OYN A;  1QSL A;  3AVG A;  2HHV A;  1X9S A;  1QS4 A;  3DRP A;  3ZSX A;  1BIS A;  3SJJ A;  2P5G A;  4CCH A;  3P83 D;  4DQP A;  1ITG A;  3K58 A;  4M3U A;  2HVH A;  3VQQ A;  3QIO A;  4CK3 A;  3LZI A;  4FXD A;  1WSG A;  3V9W A;  3O3H A;  2XHB A;  3VQ9 A;  4FJ5 A;  4KPY A;  4LD0 A;  1UOC A;  3ZSY A;  3QEW A;  3V6D A;  4CHZ A;  3M8S A;  1RDC A;  3L2R A;  4E7L A;  3K59 A;  2W42 A;  2XY7 A;  2DFE A;  3S3N A;  4KFB A;  4CHY A;  4E7I A;  4RW7 A;  4FLV A;  2O4I A;  4DLG A;  3VA0 A;  4CJL A;  1A5X A;  1HQU A;  3AO2 A;  4DSL A;  1KVB A;  3LAM A;  1KFD A;  2G8W A;  5FRM A;  2X78 A;  3DMJ A;  3ZSZ A;  4NCG A;  4M3Z A;  3QEI A;  5KGW A;  3I8D A;  3OYK A;  3DI6 A;  4KTQ A;  1RBR A;  4DTO A;  2ZE2 A;  2LSN A;  1NK6 A;  4DSE A;  4H8K A;  4LY7 A;  5HRP A;  1B9D A;  3MEE A; 
#chains in the Genus database with same CATH topology
 4K41 A;  4O5F A;  2QWM A;  4BRP A;  3SYZ A;  3CFR A;  1S1U A;  1KXP A;  4JLH A;  5KPR A;  1U48 A;  4DWI A;  3CM6 A;  1IKV A;  1NJW A;  2HMP A;  5DMR A;  3CMA N;  4ELU A;  2P9N B;  3IRX A;  5BPM A;  3VET A;  1TV6 A;  3OYB A;  4FOE A;  5A2Q O;  5CYM A;  1C1B A;  3WXM B;  4PWD A;  1CZA N;  3ZYY X;  4F8R A;  1T3V A;  2YCH A;  1BIU A;  1BGX T;  3NH0 A;  3U6F A;  3ATV A;  3AA4 A;  3FZF A;  4DHY A;  4DSI A;  4QS7 A;  3HP9 A;  1JJ2 M;  4BRA A;  2GTD A;  3SAF A;  3QEV A;  4KO0 A;  3DLE A;  3D2F B;  2Q3S A;  2NLX A;  4CGD A;  3BGR A;  1IKW A;  4FLZ A;  4H03 B;  5AQQ A;  3AVM A;  3WXK A;  1X9M A;  1OH5 A;  3QIC A;  5AZJ B;  2NRT A;  1S6P A;  4H4O A;  4Z4I A;  4IFE A;  4A5B A;  1L5U A;  3VEY A;  1NU0 A;  1CLQ A;  5BRD A;  4NLC A;  4K8X A;  3K5L A;  3V9X A;  4BR2 A;  4DTP A;  3RMC A;  4W5N A;  1ZBS A;  4A2A A;  1DTT A;  4DF8 A;  3CCU N;  2E1Z A;  3M8P A;  1XUP O;  1HYV A;  2VQE K;  1TKX A;  1O1W A;  2I7P A;  4YOR A;  4CJS A;  4DU4 A;  4AHT A;  1O13 A;  5J1E A;  1TUY A;  4JI1 K;  3V1O A;  3RR8 A;  3SNN A;  2DY4 A;  3EZW A;  2XY8 A;  2FBY A;  3O80 A;  3V9Z A;  1U2V B;  1CXQ A;  4DTX A;  1DGK N;  1V4S A;  2G8H A;  3P39 A;  3C94 A;  3FE1 A;  2HBL A;  4M3R A;  2ZF5 O;  5EXW A;  4KAZ A;  4CES A;  3PSI A;  4CEO A;  4DV2 K;  4CJ4 A;  1Q7Y O;  1VAZ A;  4BDY A;  4FJI A;  3RRH A;  3L3V A;  4MLE A;  3HI0 A;  2W6K A;  2VWB A;  3BP8 A;  4B1V A;  2HB5 A;  4FWQ A;  2O8C A;  1LV5 A;  5C42 A;  1FJG K;  4LFB K;  3TTC A;  3QDK A;  2O8B B;  3K5M A;  4CJU A;  3HZ6 A;  3NGY A;  5BR8 K;  1KC8 O;  4FWM A;  4O4G A;  3L4Q A;  2QWL A;  1CZB A;  1NK8 A;  5CR4 A;  2X6S A;  1C0G A;  4GV9 A;  3UIQ A;  3NHG A;  1KSP A;  4FJ9 A;  1WUA A;  4CJT A;  4CZK A;  2GWJ A;  4MQ3 A;  3MED A;  5DK5 A;  3O6W A;  3TAF A;  1TYQ A;  2YKN A;  2KHO A;  3HPO A;  4IO8 A;  1BL3 A;  1RNH A;  2A40 A;  3LP2 A;  4KTZ A;  3OBW A;  1JXE A;  1YIT N;  4ZTJ A;  1TKT A;  1W7A A;  3P38 A;  1HNV A;  1T03 A;  1ILY A;  4Z4E A;  3LM2 A;  2KZZ A;  4RCH A;  3GG4 A;  5B8H A;  1XMO K;  2O4G A;  4DQI A;  4I7F A;  3E9P A;  4BWJ A;  1S5J A;  2NRZ A;  3L3U A;  4BR9 A;  1KLN A;  2BGG A;  4JNE A;  4M3Y A;  1Q18 A;  4NYN A;  5ELZ A;  3OYI A;  1LW2 A;  4K42 A;  1NJY A;  4C8K A;  2ASP A;  1OH8 A;  5GIN A;  1Y64 A;  5JVG L;  1K8K A;  1S1W A;  3BDP A;  1N5Y A;  3VQ4 A;  3OY9 A;  1TVR A;  4BE1 A;  1VQL N;  3D2F A;  1J5O A;  3HJF A;  2OTL N;  4A61 A;  4M45 A;  4N5S A;  4YOY A;  3ZT1 A;  1GLA G;  1P90 A;  4NXM K;  4C8N A;  2X6N A;  2I7N A;  1GLD G;  4PKG A;  1YIJ N;  2Y1I A;  5KTQ A;  2HHS A;  3W3D A;  4AHR A;  5AFU A;  3VEX A;  2D1K A;  1J6Z A;  2OAN A;  1VQ9 N;  1XWL A;  2QKK A;  1RT7 A;  4H0X B;  5KRS A;  4FM2 A;  3TAR A;  3G0Z A;  3HM9 A;  1UAX A;  3M5R A;  5KQ8 A;  3K9J A;  3MX2 A;  2A41 A;  4WYB A;  2JLE A;  3NH2 A;  2IVO A;  1EO1 A;  2GWK A;  3RRG A;  4B3R K;  4DQ8 A;  4NB4 A;  2P9U B;  1DT9 A;  4DQS A;  3KIO A;  5GAD P;  4G9Z A;  4B8A B;  4IG0 A;  3RWU A;  3OS0 A;  3MDQ A;  3DXM B;  1VHX A;  1G15 A;  1NGJ A;  3AO3 A;  1NGB A;  5IWA K;  4B1Y B;  3LZJ A;  2A42 A;  4CJQ A;  1LAW A;  3SLC A;  3AV9 A;  4IZ9 A;  3O9R A;  3TSU A;  2O8B A;  2IOC A;  4FVM A;  3G10 A;  1J9A A;  1EQY A;  2HHQ A;  4A2B A;  3T7Z A;  4E0D A;  4A5A A;  3ZLJ A;  4FOI A;  4KTW A;  1WSJ A;  3V1R A;  3LP0 A;  4DV0 K;  1QTM A;  4LF4 K;  1D5A A;  1U04 A;  2FSK A;  5E84 A;  3THW B;  4FSV A;  2Z1J A;  3ZT4 A;  4BGA A;  2QWO A;  4RW4 A;  1DKG D;  4DR2 K;  3IS9 A;  4JI7 K;  4JV5 K;  3SQ2 A;  3KLF A;  4CZM A;  3KK3 A;  3TAP A;  3IDH A;  3V1Q A;  3VQB A;  3OS2 A;  1XNQ K;  2HBM A;  3TI0 A;  4H5W A;  4JKA A;  5C2D A;  1E3M A;  3DLB A;  4B9Q A;  4XH5 A;  1B92 A;  3RSE B;  3NF9 A;  3KWG A;  3WUH A;  4F9O A;  4RG8 A;  3GE1 A;  3H1Q A;  2UU9 K;  2OA8 A;  1DLO A;  3KLG A;  1NGG A;  4MLH A;  3HRG A;  1VSD A;  4Q5V A;  1HNW K;  4CZL A;  1Z26 A;  4OGE A;  3LPU A;  1ZBL A;  1WB9 A;  5DM7 L;  4BDP A;  2OZS A;  2VG6 A;  4OGC A;  2Q36 A;  2CH6 A;  5M1K A;  3TWH A;  3U4L A;  1S22 A;  5CHI A;  1JCE A;  3CCR N;  1VQM N;  3VGK A;  1S9G A;  3CG7 A;  3GBT A;  2P9P A;  2EX3 A;  1KVA A;  5J2M A;  2WC9 A;  5AQJ A;  4QOZ B;  4OVL A;  4HWI A;  1WNS A;  1QE1 A;  4LH4 A;  1HJR A;  2D0A A;  3OYG A;  1NG9 A;  4IBN A;  2E2O A;  3FZH A;  4IXC A;  1NMD A;  1XNR K;  3TSP A;  3SPZ A;  1YVN A;  5CZ2 A;  3R1X A;  4JKG B;  2UXC K;  1BUP A;  1LCU A;  4GVE A;  4FM1 A;  1SKW A;  2OPQ A;  1TL3 A;  3CPE A;  1JLC A;  2YHX A;  3LP1 A;  3ID8 A;  2ZGY A;  3QO9 A;  4BRG A;  3LDP A;  4DSK A;  3ZSV A;  5AQK A;  3P4I A;  4XH1 A;  5AQH A;  4CJW A;  3ITH A;  3VER A;  3LAK A;  1Y97 A;  2HW3 A;  2CGL A;  3DXM A;  3ZSR A;  3WNF A;  1YVU A;  4FJM A;  1P8Z A;  3I55 N;  2RE2 A;  4KRE A;  3I33 A;  4Z94 A;  3T1Y K;  4ID1 A;  3O4N A;  4GVM A;  4H5T A;  3RVC A;  4IEI A;  5KQD A;  3MMV A;  1RBS A;  4BWM A;  3V9S A;  3IMX A;  4PA1 A;  2DTU A;  2HND A;  4B1X B;  3MN9 A;  4IFY A;  5H1S Q;  2UUC K;  3CJB A;  5FPD A;  2P9K B;  3ZX2 A;  5GIP A;  4KB0 A;  1YI2 N;  1MU2 A;  4I9L A;  3MEG A;  3UE5 A;  2WBN A;  3OYJ A;  1WLJ A;  3MN5 A;  1QSL A;  4IDH A;  1BWF O;  1QS4 A;  3SJJ A;  1ITG A;  3VES A;  2YX6 A;  3RSE A;  4KPY A;  4DR5 K;  1GLF O;  4K25 A;  3U9D A;  4E7L A;  3K59 A;  3I8B A;  3CC2 N;  4KFB A;  4E7I A;  4RW7 A;  4CJL A;  1HQU A;  4JI2 K;  1KVB A;  2Q0U A;  1XQS C;  3LAM A;  1KFD A;  1IBL K;  4DR6 K;  1ATS A;  3ZSZ A;  4NCG A;  4M3Z A;  4FWP A;  3I8D A;  5M1Q A;  1NK6 A;  4DSE A;  4H8K A;  5AQV A;  3PO4 A;  3NAE A;  1VSK A;  2NZT A;  4KRF A;  1SZ2 A;  1LWC A;  2WUS A;  4QS8 A;  1ESV A;  4YOT A;  4FJ7 A;  4YDU A;  5ADX A;  1U47 A;  1RDB A;  2HMI A;  3WEE B;  4CFD A;  3QER A;  3CCV N;  4C23 A;  5C10 A;  1TKZ A;  3EL2 A;  1JLG A;  2E2N A;  3UKU B;  3SAH A;  4WFB L;  2NRH A;  3A5O C;  1IKY A;  1EX4 A;  4DFK A;  1FKP A;  5HOO A;  4LSN A;  3TAB A;  4FK4 A;  4O0J A;  4BC4 A;  3QEX A;  4U67 L;  2VCP A;  4CBW A;  5EU7 A;  3VQ7 A;  1YJ9 N;  4W5T A;  1XC9 A;  2YNH A;  4OLA A;  5AQN A;  4JKG A;  3D0P A;  4CIE A;  3QIP A;  3CHW A;  4JK8 A;  4FLY A;  4KHS A;  2IAJ A;  3HYF A;  4CED A;  5AQO A;  4CI6 A;  5EOY A;  4X65 K;  2P9S B;  3UKR B;  1YTA A;  1C0T A;  3VQP A;  4PL8 A;  3DRR A;  3U3G A;  1F21 A;  2HNY A;  3JS6 A;  3WXL A;  1NGA A;  3JAM O;  3O9Q A;  4FLW A;  1SL0 A;  1T7P A;  4UQG A;  2HHT A;  2IS3 A;  2ZWH A;  1RDA A;  5HRR A;  4DV5 K;  1WN7 A;  4IDK A;  4XEI A;  3CJC A;  1Q82 O;  4KI4 A;  3F9K A;  3AVJ A;  1S1X A;  4BVO A;  1S9E A;  1HYS A;  5F1X A;  3KLI A;  3VQE A;  2ZJP L;  5LMU K;  1VQP N;  1ASU A;  3QFU A;  5CYQ A;  3L8B A;  4XIU A;  4CF2 A;  1W0H A;  3T69 A;  1T8E A;  2BTF A;  2KKZ A;  4WFN L;  1XMQ K;  3CJ1 A;  3R3L A;  4B1W B;  3S41 A;  4KHQ A;  3MK6 A;  2UXD K;  3ULE B;  4KHP K;  4TSX A;  4Y1C A;  4EP4 A;  3TR8 A;  3KD5 E;  3NF8 A;  3VTH A;  2KTQ A;  4OKK A;  4N47 A;  3NF7 A;  4JRP A;  4B9L A;  3U8X A;  3CCS N;  3NVK A;  2A5X A;  3R9P A;  3VA3 A;  2QI2 A;  3LPT A;  3ENO A;  4LFC K;  2O8D B;  1I39 A;  2QKB A;  1K8A O;  4I6M B;  5AQU A;  3HVR A;  3FR0 A;  4Z0U A;  4FJJ A;  2NRV A;  4RW8 A;  4A57 A;  3ZET B;  4J2B A;  2KQ2 A;  1S1T A;  3CPW M;  1IO2 A;  4NCA A;  2D0B A;  3V4I A;  1RBV A;  2VGN A;  2YNG A;  4JHD A;  4B9N A;  3Q7C A;  2ASO A;  3VQD A;  4DS5 A;  4BY9 C;  3QET A;  3JYT A;  1LWF A;  4AHC A;  1VQ6 N;  5M1O A;  4A62 A;  4B9T A;  4CGH A;  3O9U A;  2QWP A;  5AQS A;  5EY4 A;  4DSJ A;  3PX0 A;  3VQ5 A;  4BRK A;  2VQF K;  4J8F A;  3UKU A;  1EKE A;  2RHK A;  3TAG A;  2O8F A;  2UYT A;  1XC3 A;  1T05 A;  5AQI A;  5BN8 A;  4YOW A;  1YT3 A;  2QWR A;  5HRN A;  1OH6 A;  3PY8 A;  1C0M A;  2G8V A;  4GKK K;  2HHX A;  4J2D A;  3CYM A;  4DUZ K;  3O9S A;  4JI5 K;  3QNN A;  2E2Q A;  3K9K A;  1WSF A;  3AVH A;  3L2V A;  3OJU A;  2P9S A;  3A8Y A;  3SV4 A;  3THV A;  2FXU A;  3SUO A;  4LF5 K;  4FYD A;  3H08 A;  1CXU A;  4WQ4 A;  4W5Q A;  4PUO A;  3CME N;  1D9D A;  1NGE A;  2ATQ A;  3SV3 A;  3MWP A;  4BRL A;  1BA0 A;  3IUC A;  4HUG A;  3C7N A;  2G8I A;  2YHY A;  3C6H A;  1FK9 A;  4CER A;  5M1N A;  3NF6 A;  2GV9 A;  4B8C A;  4DG1 A;  2OCE A;  1WAF A;  2YHB A;  4WQ5 A;  5M1P A;  2CH5 A;  4BRF A;  3C0B A;  4KHN A;  1XHZ A;  3VEZ A;  1ASW A;  2FSJ A;  3TAE A;  2V7Y A;  4CF0 A;  3G4S N;  3ZSO A;  1WBD A;  1WAJ A;  2QTD A;  4CEZ A;  4Z4G A;  3AVF A;  4BRO A;  5KPZ A;  3ISN C;  4M41 A;  2PY5 A;  2G8K A;  3CM5 A;  1TK8 A;  3DLG A;  4CHO A;  4AHS A;  3C6T A;  4BGB A;  4H0V B;  4E7J A;  4DFM A;  1ZBI A;  4IOA L;  5J2N A;  3A5M C;  1NJX A;  2Z1G A;  3HOS A;  2CGK A;  1A5W A;  1C6V A;  3CJ7 A;  4JD2 B;  3DLH A;  2QXL A;  3HTV A;  4KH6 A;  4IO9 L;  5HP1 A;  2W6L A;  3J7Z O;  4O0I A;  3CCM N;  5BR9 A;  1NK9 A;  1S72 N;  1FW6 A;  3U9Z A;  4C8M A;  3PLA A;  3ZEU A;  1UA1 A;  1QQC A;  2XY6 A;  4JKB A;  4CF8 A;  2Q31 A;  5BN9 A;  3VGL A;  3V9U A;  4KV8 A;  3QIN A;  4EHT A;  5C2F A;  3LDL A;  3CER A;  2FC0 A;  4EIA A;  3RMA A;  1VQ7 N;  1V4T A;  3VGM A;  2VWK A;  5HL7 L;  2P9N A;  2PAV A;  3J81 O;  4CGJ A;  3VEO A;  5FPM A;  4X62 K;  5FRO A;  5HRS A;  4H4M A;  3OS1 A;  3O3G A;  4BR7 A;  3O4Q A;  1QVF M;  4FLX A;  5KI6 A;  4YY3 K;  3O8M A;  3TAM A;  3DLR A;  1IJJ A;  5ADX H;  3CIP A;  4BG8 A;  4MDA A;  1SKR A;  3J7Y P;  4JI8 K;  3NVM A;  3SI6 A;  1YJN N;  3RMB A;  1ZBF A;  1TAU A;  3C95 A;  3KKS A;  2A1R A;  4I2P A;  1J54 A;  4CD1 A;  3J8A A;  3R6M A;  2PYL A;  4MDB A;  4WE1 A;  4X66 K;  1QZ5 A;  5AZJ A;  3O1W A;  4JI0 K;  4IWV A;  2WFB A;  4DV1 K;  4GV3 A;  1I3A A;  3MXJ A;  1WSH A;  4CGI A;  1E4F T;  2E1Y A;  2YV0 X;  4AF1 A;  4FM0 A;  3N4P A;  3CD6 N;  1Z25 A;  1CZ9 A;  4ILJ A;  3MX5 A;  4BRQ A;  4F4K A;  2PYJ A;  3DJC A;  3EKU A;  1JXB A;  2HHH K;  3OTO K;  4ELV A;  2GX9 A;  2NRX A;  4DU3 A;  4OPH A;  1ZYQ A;  5SZT A;  1N36 K;  1U2V A;  2QW9 A;  3ZT0 A;  3KK1 A;  1SV5 A;  2XRI A;  3N4Q A;  3PSF A;  1NNE A;  3HP6 A;  3CQ8 A;  3NDK A;  1JCF A;  1Z6R A;  3A5L C;  4NYF A;  1U6Z A;  1BCM A;  3BZC A;  4E89 A;  3TTD A;  4ICL A;  5I3U A;  3QNO A;  3MCA B;  4LF9 K;  2OTJ N;  3T19 A;  3AVB A;  1VRT A;  3O5B A;  1LWE A;  1K9M O;  4DU1 A;  1BQM A;  3SK3 A;  2VGM A;  3DOK A;  4JD2 A;  5M1F A;  4X64 K;  4E19 A;  3AGK A;  3THX B;  3PUF A;  3HT3 A;  3E66 A;  2JWK A;  1RT1 A;  5AQP A;  1MWK A;  4DV4 K;  3S3O A;  4FK0 A;  1VQN N;  3C65 A;  5EVZ A;  1REV A;  1W9H A;  3V81 A;  5FLX O;  4BVP A;  1NJZ A;  2Q2R A;  2GUI A;  3L2W A;  4GW6 A;  4CGG A;  5FDL A;  1SAZ A;  3VQ8 A;  1DEJ A;  3ZX0 A;  1OVY A;  3VF2 A;  1X9S A;  2P5G A;  4M3U A;  4H0T B;  4CCH A;  3K58 A;  3VQQ A;  3LZI A;  4FXD A;  3V9W A;  4DV7 K;  4V19 S;  1MA9 B;  4LD0 A;  1UOC A;  1ATN A;  3M8S A;  1RDC A;  3EKS A;  3L2R A;  2XY7 A;  4CHY A;  4FLV A;  3T1H K;  2O4I A;  3VA0 A;  1LOT B;  2NRW A;  2G8W A;  3BY5 A;  3DMJ A;  3QEI A;  2V51 B;  3A0I X;  4WFA L;  3DI6 A;  3OYK A;  4DTO A;  4KTQ A;  2LSN A;  4HUE A;  2KW4 A;  4BQL A;  3KVG A;  3HOT A;  1GLE G;  2UUA K;  4JK7 A;  3HK2 A;  5HBM A;  5AQZ A;  2F8T A;  4DR4 K;  1BI4 B;  4OKE A;  5EX5 A;  3VPZ A;  3SCX A;  3SQ0 A;  2HVI A;  3DLL L;  4CIF A;  1BIZ A;  3O4W A;  5HLF A;  4H5R A;  4DV3 K;  1RT3 A;  3F5T A;  4FZX C;  1JLB A;  1NKE A;  4FWO A;  4YOX A;  3ZSW A;  2GEM A;  3DAW A;  2VG7 A;  1Q9Y A;  4OLB A;  1N32 K;  4HHT A;  3PIO L;  3SUP A;  2FBX A;  1EWQ A;  4DR7 K;  4JS5 A;  1HNI A;  3NFA A;  4FJ8 A;  4KI6 A;  1BO5 O;  4CEC A;  3DXK B;  3FZL A;  2P5O A;  2YNF A;  1JLA A;  3VTI A;  2B6A A;  4CEQ A;  3AO1 A;  4OKJ A;  4I9Q A;  3H6E A;  4FPA A;  2E5L K;  3J7A P;  4CZG A;  4ZHR A;  4BE2 A;  1EP4 A;  1KQS M;  4O5B A;  4FW2 A;  4RTF D;  2P9U A;  3CI5 A;  3KKR A;  5I9E B;  5KGX A;  2VG5 A;  2NRR A;  1XHX A;  4E7K A;  1NJI O;  3SZ2 A;  4BRD A;  1B9F A;  1RT4 A;  3R8E A;  1RCH A;  1J53 A;  4FWN A;  3D45 A;  2QWN A;  3WT0 A;  1Z05 A;  4WF9 L;  3QLH A;  2OPP A;  1VRU A;  3LM9 A;  3DLK A;  4CEA A;  4HVJ A;  2PFU A;  2Z1H A;  3ULD A;  4AHV A;  1U4B A;  2ITM A;  3I0R A;  1NOZ A;  4DF4 A;  1HPZ A;  3THW A;  1Q86 O;  2QEX N;  5C24 A;  4RWT A;  2F96 A;  2UXB K;  3LDO A;  5JMV A;  3MCP A;  4MO4 A;  4DTN A;  1J5E K;  1VSL A;  2ITG A;  1TK5 A;  1X3M A;  1NKB A;  2O8E B;  1QSY A;  1KTQ A;  1VK0 A;  4C1N K;  4B9S A;  3G6E N;  3CC7 N;  1X9J A;  4CZE A;  3MXI A;  3AA2 A;  4F2R A;  2ZJQ L;  4BRC A;  4CK2 A;  1IKX A;  4IEE A;  1A5V A;  2E4L A;  1C0U A;  3OYC A;  2BH1 A;  2X74 A;  5T7B A;  1RT6 A;  3FLC O;  3HPH A;  1W97 L;  1KAX A;  4J2A A;  1KVC A;  4DS4 A;  3VN5 A;  3WNE A;  1NK5 A;  2V52 B;  4B08 A;  3PX4 A;  2QK9 A;  2I5J A;  4B9U A;  1KAZ A;  3SUQ A;  1KCF A;  1RT2 A;  1SUQ A;  4CJ5 A;  1BI4 A;  4YHH K;  3VQA A;  2D5R A;  2EHG A;  3AAP A;  1TUU A;  3F73 A;  2IGI A;  3CCJ N;  4CIG A;  4C1N I;  1TK0 A;  1GOA A;  1JL1 A;  1BG3 A;  4DFP A;  4QCL A;  3ZT3 A;  2F7T A;  4CJK A;  1C1C A;  1BQN A;  3OYL A;  4OX9 K;  3PO5 A;  3WQT A;  3K2P A;  3VOV A;  4JYA K;  3WQU A;  2W40 A;  2HNZ A;  3SJH A;  4NCB A;  3OVN A;  4LC9 B;  1W2B M;  4LF6 K;  3A5N C;  3LDQ A;  1K6Y A;  1NGC A;  4H0Y B;  2YKM A;  4DR1 K;  4CEF A;  4CJV A;  4PY5 A;  4CJP A;  1BDG A;  4K0K K;  4KHY A;  3OW2 M;  3AVC A;  3KZB A;  3JSM A;  2E2P A;  4KB1 A;  3AA5 X;  1JLF A;  3W0L A;  5AR0 A;  3RMD A;  1BA1 A;  5AQR A;  5FPN A;  3LWM A;  4HUF A;  4BR5 A;  5AFU H;  1HRH A;  5K14 A;  4CW7 B;  3SUN A;  4J2E A;  1S3X A;  4GMJ B;  4CHN A;  2DFF A;  4CD3 A;  1RBT A;  3TAN A;  3K57 A;  2ZJR L;  4FJG A;  3QML A;  1T44 A;  3WNG A;  1VSH A;  3VF6 A;  5CE3 A;  2OZM A;  4FLU A;  3KK2 A;  3M1F A;  4PKH A;  3AVI A;  3NMU A;  1D4X A;  4F3T A;  4CJR A;  1T6C A;  2PBD A;  1KRP A;  2JWL A;  3RR7 A;  1L3U A;  5C0Y A;  2H3G X;  2Y1J A;  4E1N A;  2HST A;  4ELT A;  3HO1 A;  2P9K A;  3DOL A;  1ZBH A;  4O8U A;  2PZS A;  4BRE A;  2CGJ A;  4AM6 A;  1M90 O;  5C25 A;  4BE0 A;  3ZX3 A;  2KFZ A;  3ASM A;  4M63 C;  3HBT A;  3BEX A;  1HYZ A;  1HMV A;  4F3O A;  1U45 A;  3VEV A;  4HTL A;  1TKD A;  2VWJ A;  3VQ6 A;  4KH5 A;  1ZXO A;  3B8A X;  5TKW A;  1QVG M;  1ZBU A;  4EZ9 A;  2AA4 A;  4M42 A;  1IG9 A;  3C6U A;  3I56 N;  4K8Z A;  4B1U B;  1XI1 A;  1TL1 A;  4CEB A;  5MLC Q;  3AVN A;  1NK7 A;  2FLO A;  1N6Q A;  1BOT O;  1QZ6 A;  3O9T A;  4I2Q A;  4EFH A;  1JKH A;  3ALY A;  4F2S A;  3KLE A;  1VSM A;  2O8C B;  5JS1 A;  3WEE A;  1HPM A;  3IKM A;  4KHU A;  3EO3 A;  5BPN A;  1HKC A;  2IIR A;  3CXC M;  4DFJ A;  4FJN A;  4CF9 A;  5JIC A;  1NK4 A;  1VQ8 N;  5AQL A;  3E9L A;  2YJE A;  2RN2 A;  4CBX A;  4DSF A;  2Q0R A;  4ISE A;  2D0P A;  3CJ9 A;  2Z1I A;  2RKI A;  1TYQ B;  4K43 A;  4CJ7 A;  4H0P A;  1C1A A;  4ID5 A;  3HPG A;  3K0S A;  1TAQ A;  4YFU A;  3UKR A;  4AHU A;  3L4I A;  3PIP L;  3FZM A;  3TPQ A;  1MWM A;  5GAH P;  3WXI A;  2VYP A;  5E41 A;  4JI4 K;  1HLU A;  2FSN A;  3KTQ A;  1T6D A;  3G71 N;  1YXQ A;  3LAN A;  4E1J A;  3DWL A;  5GAG P;  1LAV A;  4DQR A;  1K8K B;  1E4G T;  3QES A;  1UWB A;  3KHY A;  4DTU A;  2A3Z A;  4YOU A;  4EZ6 A;  2B4J A;  3ID6 A;  1EET A;  3MEC A;  4BR4 A;  3AVA A;  1JCG A;  2E6L A;  2P9I B;  4DTR A;  4AH9 A;  4BAC A;  3ULE A;  2HF3 A;  4CFA A;  1K73 O;  3CQX A;  1YAG A;  3AO5 A;  5AZI B;  2BE2 A;  1OVQ A;  1TGO A;  4OPJ A;  2E20 A;  4RW9 A;  3H1V X;  3HSC A;  3AGR A;  3A2F A;  3CFO A;  3VEW A;  4H0O A;  1ASV A;  5C12 A;  2O8D A;  3M6G A;  1R0A A;  1HNZ K;  1L3T A;  2DFH A;  5LMN K;  2WOM A;  1KD1 O;  2XY5 A;  2R7Y A;  2JGU A;  4CZJ A;  4I6M A;  4NO7 A;  1RTJ A;  3QBW A;  1WSE A;  3ZET A;  5KPT A;  1S1V A;  1N34 K;  4B3T K;  3THY B;  4JS4 A;  1H1V A;  5BRF A;  3AA3 A;  2KZM A;  5SWM A;  4KBO A;  4QS9 A;  3IG1 A;  3SBG A;  3AAQ A;  2KLA A;  2F4V K;  3EE8 A;  3T3F A;  4B9M A;  2HHV A;  1GLL O;  1BIS A;  4DQP A;  1N33 K;  2HVH A;  3QIO A;  4JI6 K;  3WXJ A;  5JLH A;  1VQ4 N;  2YHW A;  3O3H A;  2XHB A;  3VQ9 A;  1HNX K;  2DPN A;  3O1B A;  4LF8 K;  3L6Q A;  3QEW A;  4CHZ A;  3MWT A;  1I94 K;  3GDQ A;  3S3N A;  4DUY K;  2W42 A;  3EN9 A;  1A5X A;  3AO2 A;  4DSL A;  1N8R O;  4DCH A;  5AQW A;  3TTF A;  2ZE2 A;  1HKB A;  1VQK N;  4LY7 A;  1B9D A;  3MEE A;  2FF3 B;  4PKI A;  4BRI A;  4M3T A;  2GUP A;  3VMF B;  3DM2 A;  4JKE A;  1BU6 O;  2HHW A;  5F2R A;  4CZI A;  4BQZ A;  3GL1 A;  1RTI A;  1RDW X;  4LF7 K;  3NE6 A;  1L3V A;  3NBP A;  4DMN A;  2YNI A;  2OYQ A;  4B3M K;  3C6A A;  4FCY A;  1EWR A;  1HJO A;  4JI3 K;  5DM6 L;  3B6O A;  2OPS A;  3UB5 A;  4UY8 O;  2BAN A;  1L3S A;  4DTJ A;  5JLF A;  1QHA A;  4AIL C;  4FJH A;  3PX6 A;  4KH4 A;  1JLQ A;  4FW1 A;  3B6P A;  3OYD A;  2IVN A;  1FKO A;  2P9I A;  4QAG A;  3OJS A;  2P9P B;  3HXM A;  5JS2 A;  3D7E O;  5FPE A;  3AVK A;  2P1J A;  3K5O A;  4JEP A;  5AZI A;  1NGI A;  4O55 A;  3HM8 A;  1WOQ A;  3OYM A;  3SPY A;  1QHT A;  1BHL A;  4N56 A;  4EAH D;  4HCB A;  2ASM A;  2NUB A;  1RTH A;  3CJA A;  3LAL A;  4FWS A;  4B3S K;  4IKF A;  4DTM A;  4IFV A;  3D2E B;  1GLJ O;  3P5J A;  4FLT A;  2AJQ A;  3H46 O;  2RPI A;  5BRE A;  3SQ4 A;  1HX1 A;  3PV8 A;  3EE9 A;  3ENB A;  4IJN A;  3THY A;  3FZK A;  3P31 A;  2IDO A;  2Q1N A;  1NBW A;  5F0X A;  3M8R A;  4JKD A;  1RDD A;  4JKH A;  4PL7 A;  4OO1 J;  4Y0W A;  5J2P A;  3TAQ A;  4OJR A;  3BUZ B;  3IAY A;  3SBT A;  2J4R A;  3M3Z A;  3ZT2 A;  2Q97 A;  1SS6 A;  4BR0 A;  4CHP A;  2HF4 A;  4OPK A;  3OYA A;  1Q9X A;  4FWL A;  3S3M A;  3OYE A;  4LFA K;  4C8O A;  3OBY A;  4YOV A;  3QFP A;  4M7X A;  4Z4C A;  2GBZ A;  3ZSQ A;  3CQY A;  3L2Q A;  1OKJ A;  4Q0B A;  1NLV A;  2HBK A;  4FZY A;  1QSS A;  5GAE P;  5LY3 A;  3MXM A;  3HST B;  4JKF A;  3GOI A;  2BDP A;  4R79 A;  1NKC A;  1HQE A;  2D0C A;  1KAY A;  4AQY K;  4FL9 A;  1X3N A;  2HOE A;  5AQG A;  1LW0 A;  2A6A A;  4IJA A;  3OYH A;  4BC2 A;  4B1Z A;  4Z4H A;  4XH4 A;  3D6R A;  4FJK A;  4HCC A;  4MO5 A;  1GLB G;  4FZZ A;  2OPR A;  4CZH A;  3VQC A;  4CVN E;  1KLM A;  1JL2 A;  4N76 A;  4RW6 A;  1G99 A;  2IVP A;  4BRN A;  3DRS A;  3LP3 A;  1D9F A;  4ILG B;  4FWK A;  3KWI A;  1GLC G;  3NH1 A;  1C0F A;  1KFS A;  4CE9 A;  4EP5 A;  2P9L B;  2AP1 A;  4BC5 A;  3O3F A;  1GOB A;  4KHW A;  3L0Q A;  4ISG A;  1Q8I A;  3MN7 A;  4FJL A;  1FXX A;  5C15 A;  1RDU A;  1GOC A;  3KJV A;  4YNQ A;  3CCL N;  2FF6 A;  4BRM A;  5KRT A;  3SQ1 A;  3RTV A;  4O44 A;  2IC3 A;  2HHU A;  3E9O A;  3F2K A;  1R59 O;  3ENH A;  1D8Y A;  2G8F A;  1VSI A;  2XO7 A;  1M1K O;  1SL2 A;  1IV0 A;  3D2E A;  3E01 A;  4M3X A;  3T1A A;  2ZGZ A;  5GIO A;  4ZTF A;  3K5N A;  4M3W A;  2YHA A;  1ZC6 A;  1YTU A;  3THX A;  3L2U A;  3HL8 A;  2YJF A;  4PHT X;  1OH7 A;  4A59 A;  5AQY A;  3NGI A;  1DTQ A;  4O8K A;  4U7B A;  3DYA A;  4DV6 K;  2ZD1 A;  2D0O A;  4B9V A;  1EXQ A;  2RF2 A;  2ZQB A;  4JN4 A;  5AQF A;  4FVU A;  5AQT A;  4ILH A;  4YDU C;  4CJF A;  1VQO N;  3CCQ N;  3CF5 L;  2ZM6 K;  1RTD A;  1NGH A;  1JLE A;  4JK9 A;  1VQ5 N;  1SQK A;  4EHU A;  5BRH A;  4DQQ A;  3CFP A;  2P51 A;  1U49 A;  5LJV A;  4WCE L;  3U3Y A;  3FGU A;  3AVL A;  2QXF A;  4BG9 A;  2F8S A;  4L3Q A;  3NCI A;  4FJX A;  2WON A;  4CEE A;  4DB3 A;  1RGI A;  4GY2 B;  3KLH A;  4L8R B;  4Y1D A;  1SKS A;  2W41 A;  4GKJ K;  4W5R A;  2WTU A;  5D3G A;  4FWR A;  4IG3 A;  1WSI A;  3M8Q A;  4FPB A;  4M7Y A;  4B3O A;  5E26 A;  2KFN A;  2QWQ A;  3FFI A;  4DR3 K;  4JRQ A;  3WNH A;  1NGF A;  1BCO A;  1NMN A;  1RBU A;  2E88 A;  3EEQ A;  4W5O A;  5FRN A;  3VF4 A;  2ETJ A;  2FBV A;  1VSE A;  2UUB K;  2E8A A;  2G8U A;  5LL6 Z;  3H45 C;  3OHR A;  3QEP A;  3SAG A;  3J80 O;  4DTS A;  3OA9 A;  4JHD B;  3EYZ A;  1VSJ A;  3H3N O;  3QB0 A;  4NXN K;  4CF1 A;  4CFB A;  4HTU A;  4E3S A;  4N41 A;  1RFQ A;  2HBJ A;  4FO0 A;  2NNW A;  1YJW N;  4E1M A;  3CCE N;  1MDU B;  3EY1 A;  2QM1 A;  4G1Q A;  5BPL A;  4GV6 A;  2GEL A;  3G25 A;  3DXK A;  3NGZ A;  3AO4 A;  2P9L A;  5AJ3 K;  2FBT A;  3KK7 A;  4Z4F A;  1VSF A;  5CY4 A;  4CHQ A;  2O8F B;  4CK1 A;  1X1P A;  1WBB A;  1NGD A;  1X9W A;  4BC3 A;  3TSQ A;  1NK0 A;  5AQX A;  2QA4 N;  1HR0 K;  4CFC A;  1RIL A;  3AAR A;  4C8L A;  4DLE A;  4BDZ A;  2B5J A;  3S9H A;  4LSL A;  5CZ1 A;  3ATU A;  2E6M A;  4IOX A;  3CC4 N;  3LL3 A;  3E1Y A;  3HVT A;  5J2Q A;  1Q81 O;  5LJW A;  1IBK K;  2V7Z A;  3LWL A;  5HRO A;  4PQU A;  3EZ5 A;  4KKO A;  1QQO A;  4JAX A;  3C7N B;  3I0S A;  3Q7B A;  3KD1 E;  1QQN A;  1NOY A;  1YF5 L;  1YHQ N;  3SMP A;  2D4W A;  1S6Q A;  3CET A;  3FFK B;  3O08 A;  3P1G A;  3SMS A;  3BF1 A;  3ZCM A;  1IBM K;  4MFB A;  1IG8 A;  4CJ3 A;  4JKC A;  5AQM A;  4E7H A;  2O8E A;  2F9W A;  3LDS A;  4OPA A;  4LH5 A;  2F9T A;  1UA0 A;  3MAQ A;  1RT5 A;  1IH7 A;  3IFR A;  5I42 A;  5IT9 O;  2YI1 A;  2EWS A;  3TU5 A;  2A1S A;  4R5P A;  4AM7 A;  4FK2 A;  3OYF A;  4H5V A;  4CGF A;  1SL1 A;  4ISF A;  3BF3 A;  4WQ4 C;  4CJE A;  3BZK A;  4NLB A;  4GNI A;  3OYN A;  5JVH L;  3AVG A;  1ATR A;  3DRP A;  3JXU A;  3ZSX A;  4H5N A;  3P83 D;  4CK3 A;  1HUX A;  1WSG A;  4DKW A;  1YUW A;  4FJ5 A;  1HKG A;  2BUP A;  3V6D A;  3ZSY A;  3AY9 A;  1NM1 A;  3F9M A;  2DFE A;  1QQM A;  4DLG A;  4BRH A;  4WQ5 C;  3QBX A;  5TKY A;  3MN6 A;  5FRM A;  2X78 A;  3VEN A;  4CBU A;  5KGW A;  3ZEU B;  1RBR A;  3LDN A;  4CZF A;  3H3O B;  4IOC L;  1NWK A;  5HRP A; 
#chains in the Genus database with same CATH homology
 3NAE A;  1VSK A;  4KRF A;  2KW4 A;  4M3T A;  1LWC A;  4FJ7 A;  3SYZ A;  3DM2 A;  3CFR A;  1S1U A;  4JLH A;  1U48 A;  3HK2 A;  4DWI A;  3CM6 A;  1RDB A;  1IKV A;  5HBM A;  1U47 A;  1NJW A;  5DMR A;  2HMI A;  1BI4 B;  4ELU A;  2F8T A;  2HHW A;  4OKE A;  4CFD A;  3QER A;  3IRX A;  3SCX A;  3SQ0 A;  2HVI A;  1TV6 A;  4CIF A;  1TKZ A;  3OYB A;  1RTI A;  1BIZ A;  1JLG A;  5HLF A;  3NE6 A;  5CYM A;  1L3V A;  1C1B A;  1RT3 A;  3NBP A;  4FZX C;  4DMN A;  1IKY A;  1EX4 A;  2YNI A;  4DFK A;  2OYQ A;  1JLB A;  4FCY A;  1NKE A;  1FKP A;  4LSN A;  3TAB A;  3ZSW A;  4FK4 A;  4O0J A;  2VG7 A;  3B6O A;  2OPS A;  3QEX A;  1Q9Y A;  4OLB A;  4PWD A;  5EU7 A;  2BAN A;  3VQ7 A;  4HHT A;  1L3S A;  4W5T A;  4DTJ A;  3SUP A;  2FBX A;  1XC9 A;  2YNH A;  4F8R A;  4OLA A;  1BIU A;  4JS5 A;  1BGX T;  1HNI A;  3NFA A;  3QIP A;  4CIE A;  3NH0 A;  3D0P A;  4FLY A;  3AA4 A;  4AIL C;  3U6F A;  3PX6 A;  4DSI A;  4FJH A;  4KI6 A;  3HP9 A;  1JLQ A;  4CEC A;  4FW1 A;  4KHS A;  3B6P A;  3OYD A;  2IAJ A;  3HYF A;  4CED A;  3QEV A;  2P5O A;  2YNF A;  4KO0 A;  3DLE A;  1JLA A;  1FKO A;  1YTA A;  2Q3S A;  2B6A A;  4CEQ A;  1C0T A;  3AO1 A;  4OKJ A;  3BGR A;  4QAG A;  1IKW A;  3DRR A;  1F21 A;  2HNY A;  3U3G A;  3VQP A;  3OJS A;  5JS2 A;  3HXM A;  4FLZ A;  4I9Q A;  1SL0 A;  4FLW A;  3AVK A;  2P1J A;  4ZHR A;  4UQG A;  1EP4 A;  4BE2 A;  3AVM A;  1T7P A;  4O5B A;  2HHT A;  4FW2 A;  2IS3 A;  3K5O A;  1RDA A;  5HRR A;  1X9M A;  1WN7 A;  4IDK A;  4KI4 A;  3KKR A;  4O55 A;  3F9K A;  1S6P A;  4H4O A;  3SPY A;  3OYM A;  4Z4I A;  5KGX A;  1L5U A;  3AVJ A;  1S1X A;  2VG5 A;  1XHX A;  4E7K A;  1CLQ A;  1S9E A;  1HYS A;  3SZ2 A;  1QHT A;  4K8X A;  3K5L A;  3V9X A;  1B9F A;  1BHL A;  1RT4 A;  3KLI A;  4N56 A;  4DTP A;  3RMC A;  3VQE A;  4W5N A;  1DTT A;  4HCB A;  4DF8 A;  1ASU A;  2NUB A;  3M8P A;  1RTH A;  1HYV A;  1RCH A;  3LAL A;  4IKF A;  5CYQ A;  3L8B A;  1TKX A;  1J53 A;  1O1W A;  4IFV A;  4XIU A;  4DTM A;  3D45 A;  4CF2 A;  4CJS A;  4DU4 A;  4AHT A;  3P5J A;  1W0H A;  5J1E A;  4FLT A;  1T8E A;  2AJQ A;  3QLH A;  2OPP A;  1VRU A;  3V1O A;  3SNN A;  3RR8 A;  2DY4 A;  3DLK A;  4CEA A;  2RPI A;  4HVJ A;  2Z1H A;  3ULD A;  2XY8 A;  2FBY A;  4AHV A;  3SQ4 A;  4KHQ A;  3V9Z A;  3PV8 A;  1CXQ A;  1U4B A;  4TSX A;  4Y1C A;  4EP4 A;  4DTX A;  3I0R A;  1NOZ A;  3TR8 A;  3KD5 E;  2G8H A;  3NF8 A;  1HPZ A;  2IDO A;  4DF4 A;  2KTQ A;  3C94 A;  5C24 A;  4OKK A;  2F96 A;  4N47 A;  3M8R A;  3NF7 A;  4M3R A;  4JRP A;  4KAZ A;  4B9L A;  1RDD A;  4CES A;  4CEO A;  4FJ8 A;  5J2P A;  4DTN A;  3TAQ A;  1VSL A;  2ITG A;  4OJR A;  4CJ4 A;  3VA3 A;  1TK5 A;  1NKB A;  4BDY A;  1QSY A;  3LPT A;  3IAY A;  4FJI A;  1KTQ A;  3RRH A;  3L3V A;  3ZT2 A;  1VK0 A;  4CHP A;  4B9S A;  2HB5 A;  4OPK A;  1LV5 A;  1I39 A;  2QKB A;  5C42 A;  3OYA A;  3MXI A;  3AA2 A;  3HVR A;  4Z0U A;  1Q9X A;  3K5M A;  4F2R A;  4FJJ A;  4CK2 A;  1IKX A;  4CJU A;  4RW8 A;  3S3M A;  3NGY A;  3OYE A;  4C8O A;  4J2B A;  1A5V A;  2KQ2 A;  2E4L A;  1C0U A;  3OYC A;  2X74 A;  1S1T A;  1IO2 A;  3PO4 A;  5T7B A;  1RT6 A;  4Z4C A;  4O4G A;  2D0B A;  3HPH A;  1CZB A;  3V4I A;  1NK8 A;  2X6S A;  4NCA A;  4CGD A;  4J2A A;  1KVC A;  4DS4 A;  1RBV A;  2YNG A;  3UIQ A;  3NHG A;  3VN5 A;  1KSP A;  3WNE A;  4B9N A;  2GBZ A;  3VQD A;  1NK5 A;  4FJ9 A;  3ZSQ A;  4DS5 A;  4B08 A;  4CJT A;  3L2Q A;  4Q0B A;  3QET A;  3PX4 A;  4MQ3 A;  3JYT A;  1LWF A;  3MED A;  4AHC A;  5DK5 A;  2I5J A;  2QK9 A;  4B9U A;  4FZY A;  4B9T A;  3TAF A;  3SUQ A;  4CGH A;  2YKN A;  1KCF A;  3HPO A;  1QSS A;  1RT2 A;  1SUQ A;  4CJ5 A;  1BL3 A;  3MXM A;  1RNH A;  3HST B;  2BDP A;  1BI4 A;  3VQA A;  2D5R A;  3LP2 A;  4DSJ A;  2EHG A;  4KTZ A;  3PX0 A;  3VQ5 A;  1JXE A;  4ZTJ A;  1NKC A;  1TKT A;  1HQE A;  2D0C A;  3F73 A;  2IGI A;  1HNV A;  1T03 A;  4CIG A;  1EKE A;  4Z4E A;  3TAG A;  1TK0 A;  2KZZ A;  1GOA A;  1LW0 A;  1JL1 A;  3OYH A;  4DFP A;  2O4G A;  1T05 A;  4DQI A;  3ZT3 A;  4QCL A;  4CJK A;  4Z4H A;  4I7F A;  1YT3 A;  4FJK A;  4BWJ A;  1C1C A;  1S5J A;  1BQN A;  3L3U A;  5HRN A;  1C0M A;  3OYL A;  1KLN A;  3PO5 A;  3PY8 A;  4HCC A;  2BGG A;  2G8V A;  4M3Y A;  2HHX A;  4NYN A;  3K2P A;  4FZZ A;  2OPR A;  3OYI A;  4J2D A;  1LW2 A;  3CYM A;  3VQC A;  1NJY A;  4C8K A;  2HNZ A;  4NCB A;  3OVN A;  1KLM A;  1JL2 A;  4N76 A;  1S1W A;  3BDP A;  4RW6 A;  1N5Y A;  3QNN A;  3VQ4 A;  1K6Y A;  3OY9 A;  3AVH A;  1WSF A;  1TVR A;  2YKM A;  3DRS A;  3LP3 A;  4CEF A;  4CJV A;  3OJU A;  4CJP A;  3L2V A;  4BE1 A;  3HJF A;  4PY5 A;  1J5O A;  4KHY A;  3SV4 A;  3THV A;  3NH1 A;  3SUO A;  3AVC A;  4M45 A;  4N5S A;  1KFS A;  4CE9 A;  4EP5 A;  3H08 A;  1CXU A;  3JSM A;  3ZT1 A;  4FYD A;  3O3F A;  1GOB A;  4KB1 A;  3AA5 X;  1JLF A;  4KHW A;  4W5Q A;  4PUO A;  3RMD A;  1D9D A;  2ATQ A;  1Q8I A;  3SV3 A;  4C8N A;  3LWM A;  2X6N A;  4HUF A;  4FJL A;  1FXX A;  4HUG A;  1HRH A;  1GOC A;  5K14 A;  3KJV A;  4YNQ A;  3SUN A;  4J2E A;  2G8I A;  4GMJ B;  4CHN A;  2Y1I A;  5KRT A;  3SQ1 A;  1FK9 A;  3RTV A;  2DFF A;  5KTQ A;  2HHS A;  4O44 A;  4AHR A;  4CER A;  1RBT A;  3TAN A;  2IC3 A;  1XWL A;  3K57 A;  3NF6 A;  4FJG A;  2HHU A;  2QKK A;  1RT7 A;  2GV9 A;  4B8C A;  4DG1 A;  1WAF A;  3WNG A;  2YHB A;  1D8Y A;  2G8F A;  1VSI A;  1VSH A;  2XO7 A;  4KHN A;  1SL2 A;  5KRS A;  4FM2 A;  1XHZ A;  4FLU A;  3TAR A;  2OZM A;  3G0Z A;  3KK2 A;  3E01 A;  1ASW A;  3HM9 A;  4M3X A;  3AVI A;  1UAX A;  3T1A A;  3TAE A;  4CF0 A;  4ZTF A;  3K5N A;  4F3T A;  4CJR A;  4M3W A;  2YHA A;  1YTU A;  2JLE A;  3ZSO A;  1KRP A;  1WAJ A;  4CEZ A;  3NH2 A;  3L2U A;  3HL8 A;  3AVF A;  4Z4G A;  3RR7 A;  1L3U A;  3ISN C;  4M41 A;  3NGI A;  2Y1J A;  1DTQ A;  4E1N A;  2PY5 A;  3DYA A;  3RRG A;  4EZ9 A;  2G8K A;  2ZD1 A;  3CM5 A;  4ELT A;  4B9V A;  1TK8 A;  1EXQ A;  2RF2 A;  2ZQB A;  3KIO A;  4DQS A;  3HO1 A;  4B8A B;  4CJF A;  3DLG A;  4IG0 A;  4CHO A;  4AHS A;  3RWU A;  3C6T A;  3DOL A;  3OS0 A;  1ZBH A;  1RTD A;  2PZS A;  1JLE A;  1G15 A;  4E7J A;  5C25 A;  3AO3 A;  4DFM A;  4BE0 A;  1ZBI A;  2KFZ A;  3ASM A;  3LZJ A;  4DQQ A;  3CFP A;  2P51 A;  4CJQ A;  1HYZ A;  1U49 A;  1HMV A;  1LAW A;  3U3Y A;  3AV9 A;  4F3O A;  5J2N A;  1U45 A;  3AVL A;  2QXF A;  2IOC A;  4FVM A;  1NJX A;  3G10 A;  1TKD A;  2VWJ A;  2Z1G A;  1J9A A;  2HHQ A;  3VQ6 A;  2F8S A;  1A5W A;  3NCI A;  4E0D A;  4FJX A;  1C6V A;  3DLH A;  2WON A;  4CEE A;  4KTW A;  1WSJ A;  3V1R A;  1ZBU A;  3LP0 A;  3KLH A;  5HP1 A;  1D5A A;  1U04 A;  4Y1D A;  1SKS A;  1QTM A;  4L8R B;  4M42 A;  4O0I A;  1IG9 A;  3C6U A;  4W5R A;  4K8Z A;  5D3G A;  2Z1J A;  1NK9 A;  3ZT4 A;  1XI1 A;  1TL1 A;  4CEB A;  3AVN A;  4IG3 A;  4RW4 A;  1NK7 A;  4C8M A;  1WSI A;  3M8Q A;  1UA1 A;  3IS9 A;  1N6Q A;  1QQC A;  2XY6 A;  4B3O A;  4CF8 A;  4I2Q A;  3V9U A;  3SQ2 A;  3KLF A;  4KV8 A;  3QIN A;  1JKH A;  3ALY A;  3KK3 A;  3TAP A;  2KFN A;  3FFI A;  4F2S A;  2FC0 A;  1VSM A;  3V1Q A;  3KLE A;  3RMA A;  4JRQ A;  3VQB A;  3OS2 A;  3WNH A;  5JS1 A;  3TI0 A;  2VWK A;  3DLB A;  1RBU A;  1BCO A;  4CGJ A;  4W5O A;  4KHU A;  5FRN A;  2ETJ A;  2FBV A;  5FRO A;  4H4M A;  1VSE A;  5HRS A;  1B92 A;  3O3G A;  3OS1 A;  2G8U A;  3NF9 A;  3O4Q A;  4FLX A;  4DFJ A;  4RG8 A;  5KI6 A;  3QEP A;  4CF9 A;  1DLO A;  3KLG A;  1NK4 A;  2OA8 A;  4FJN A;  3TAM A;  4DTS A;  3DLR A;  1VSD A;  4Q5V A;  3EYZ A;  1VSJ A;  1Z26 A;  4HUE A;  2RN2 A;  4OGE A;  4CF1 A;  3LPU A;  4CFB A;  4HTU A;  4E3S A;  4N41 A;  4DSF A;  1ZBL A;  2OZS A;  4BDP A;  2VG6 A;  4OGC A;  4E1M A;  1SKR A;  2Z1I A;  2RKI A;  3EY1 A;  4G1Q A;  3TWH A;  1C1A A;  3SI6 A;  4ID5 A;  3NGZ A;  1D9F A;  3AO4 A;  3HPG A;  1TAQ A;  4YFU A;  3RMB A;  1ZBF A;  4AHU A;  2FBT A;  1TAU A;  4Z4F A;  3C95 A;  1VSF A;  1S9G A;  3CG7 A;  3KKS A;  5CY4 A;  2A1R A;  4CHQ A;  5E41 A;  2EX3 A;  1KVA A;  4CK1 A;  5J2M A;  4I2P A;  1J54 A;  4QOZ B;  1X1P A;  2PYL A;  4OVL A;  4WE1 A;  1X9W A;  3KTQ A;  1WNS A;  3LAN A;  1QE1 A;  4LH4 A;  1NK0 A;  1HJR A;  2D0A A;  3OYG A;  4IBN A;  1I3A A;  1RIL A;  4CFC A;  1LAV A;  3MXJ A;  1WSH A;  4DLE A;  4DQR A;  4CGI A;  4C8L A;  2YV0 X;  2B5J A;  4BDZ A;  4FM0 A;  1UWB A;  3QES A;  3S9H A;  3SPZ A;  1Z25 A;  4LSL A;  1CZ9 A;  5CZ1 A;  5CZ2 A;  4DTU A;  2E6M A;  5J2Q A;  3HVT A;  4EZ6 A;  4F4K A;  2B4J A;  1EET A;  2PYJ A;  1JXB A;  3MEC A;  3LWL A;  2OPQ A;  4FM1 A;  1SKW A;  5HRO A;  4ELV A;  4PQU A;  3AVA A;  1TL3 A;  2E6L A;  3EZ5 A;  4DTR A;  4KKO A;  1JLC A;  3LP1 A;  4DU3 A;  4AH9 A;  1ZYQ A;  5SZT A;  3QO9 A;  4BAC A;  3ZT0 A;  3I0S A;  4CFA A;  1SV5 A;  2XRI A;  3KK1 A;  3ZSV A;  4DSK A;  3KD1 E;  3HP6 A;  3CQ8 A;  1NOY A;  3NDK A;  4CJW A;  3ITH A;  1S6Q A;  4NYF A;  3AO5 A;  3P1G A;  3LAK A;  2BE2 A;  1Y97 A;  2HW3 A;  1BCM A;  3ZCM A;  4MFB A;  3ZSR A;  1TGO A;  4CJ3 A;  4OPJ A;  4E89 A;  4E7H A;  4ICL A;  4RW9 A;  3WNF A;  5I3U A;  1YVU A;  3QNO A;  4FJM A;  3A2F A;  3CFO A;  4KRE A;  1ASV A;  3T19 A;  1R0A A;  3LDS A;  1L3T A;  2DFH A;  4LH5 A;  3AVB A;  1VRT A;  4ID1 A;  1LWE A;  3O4N A;  2WOM A;  4GVM A;  2XY5 A;  2R7Y A;  2JGU A;  4DU1 A;  1BQM A;  1UA0 A;  3DOK A;  1RBS A;  3MAQ A;  4E19 A;  1RT5 A;  1IH7 A;  4BWM A;  1RTJ A;  5I42 A;  3PUF A;  3HT3 A;  3V9S A;  1WSE A;  4PA1 A;  2DTU A;  2HND A;  1RT1 A;  4IFY A;  1S1V A;  3S3O A;  2A1S A;  4R5P A;  4JS4 A;  4FK2 A;  4FK0 A;  3AA3 A;  3OYF A;  2KZM A;  5SWM A;  4CGF A;  1REV A;  1W9H A;  3V81 A;  1SL1 A;  3IG1 A;  1NJZ A;  2GUI A;  4KB0 A;  3L2W A;  1MU2 A;  4GW6 A;  4I9L A;  4CGG A;  4CJE A;  3MEG A;  5FDL A;  3VQ8 A;  3OYJ A;  3T3F A;  4B9M A;  1WLJ A;  3OYN A;  1QSL A;  3AVG A;  2HHV A;  1X9S A;  1QS4 A;  3DRP A;  3ZSX A;  1BIS A;  3SJJ A;  2P5G A;  4CCH A;  3P83 D;  4DQP A;  1ITG A;  3K58 A;  4M3U A;  2HVH A;  3VQQ A;  3QIO A;  4CK3 A;  3LZI A;  4FXD A;  1WSG A;  3V9W A;  3O3H A;  2XHB A;  3VQ9 A;  4FJ5 A;  4KPY A;  4LD0 A;  1UOC A;  3ZSY A;  3QEW A;  3V6D A;  4CHZ A;  3M8S A;  1RDC A;  3L2R A;  4E7L A;  3K59 A;  2W42 A;  2XY7 A;  2DFE A;  3S3N A;  4KFB A;  4CHY A;  4E7I A;  4RW7 A;  4FLV A;  2O4I A;  4DLG A;  3VA0 A;  4CJL A;  1A5X A;  1HQU A;  3AO2 A;  4DSL A;  1KVB A;  3LAM A;  1KFD A;  2G8W A;  5FRM A;  2X78 A;  3DMJ A;  3ZSZ A;  4NCG A;  4M3Z A;  3QEI A;  5KGW A;  3I8D A;  3OYK A;  3DI6 A;  4KTQ A;  1RBR A;  4DTO A;  2ZE2 A;  2LSN A;  1NK6 A;  4DSE A;  4H8K A;  4LY7 A;  5HRP A;  1B9D A;  3MEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...