1RT3A

Azt drug resistant hiv-1 reverse transcriptase complexed with 1051u91
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
536
structure length
520
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title 3'-Azido-3'-deoxythymidine drug resistance mutations in HIV-1 reverse transcriptase can induce long range conformational changes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 135
structure length 520
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt3A05
1FK9B 3OVNA 4FZXC 1WAFA 4NLDA 3AVGA 1SL1A 5HRPA 1HQUA 4I7FB 4NCGB 3MEGA 3IAYA 3KLVA 3P5JA 1U09A 4NLOA 3HP6A 3SQ2A 4M3WA 3O4QA 5J2QA 3K57A 4KTQA 3G6XA 4KPYA 2ASLA 2VWKA 3MEDA 5EUHA 3RMCA 1T8EA 1W0HA 1EP4B 1QE1A 5J2NB 1RT1A 3ISNC 2BQUA 3NHGA 3K5NA 4ED1A 1KFDA 3DM2B 4DQQA 4KB0A 3PW5A 3T5HA 1NJWA 3ZSQA 4ECVA 3HVTA 4NZ0A 1Y97A 4LD0A 3VN5A 3OYFA 1WSIA 3CFPA 3H59A 1GX6A 2FVPA 2DFFA 3M9OB 3CJ4A 1QTMA 3DLBA 1N6QB 3TARA 2C28A 3BR9A 3OL7A 4DQPA 3VQAA 4R5PB 4Q5VA 3V9WA 4DWIA 3QIOA 1U49A 4R8UB 2YHAA 2B4JA 3VQ7A 2J6SA 2JEIA 4PA1A 3HKWA 2VA3A 4MK9A 1D1UA 2AGOA 4CGJA 2RN2A 5C42A 2YKMA 2J6UA 2QKBA 2G8WA 4DFKA 2IAJB 3OYMA 1QUVA 3L3VA 5KFIA 3OL9A 3TVKA 4CHQA 2UVUA 4XO0A 4KE5A 1KLMB 4DG1A 3OS0A 4CE9A 1RTDB 1VSDA 3ZSVA 3NF8A 1TV6B 1LW0B 3PZPA 1ZETA 4Q43A 3C6UB 4DU1A 3H5XA 3DDKA 2YV0X 1C1CB 3OYCA 4ED0A 1S97A 3KD1E 3H4BA 4FK4A 3ZT2A 3MAQA 3DOKA 4ECYA 3RB4A 3E01B 4DL7A 1S48A 4J9SA 2I5JB 4O3PA 3PHEA 4K4YA 4K4XA 3V9ZA 2KTQA 2BRKA 1N48A 3RTVA 1NKEA 4B9SA 4CEQA 2OA8A 1EP4A 2ILZA 3OLAA 4B3OB 1SV5B 2X6SA 1C6VA 5DMRA 2RPIA 2JEFA 4FJHA 2X6NA 1RT2A 3PX0A 3DM2A 4IBNA 3MXIA 2G8HA 4TN2A 3G86A 3DOLB 3PY8A 2YKNA 4TXSA 5KFUA 4CEZA 2OPSB 3EPGA 2AGPA 4OPJA 5KT6A 1C0TB 4NCAA 5KFEA 2FBXA 2VWJA 1N6QA 4IG3A 3NH0A 2ALZA 3OYEA 4R5PA 1VK0A 1D5AA 1QSLA 4DLGA 2KFNA 4RUCA 3TAGA 2NUBA 2C22A 4O0IA 3NBPA 4R8UA 2WHOA 4EP4A 3KLGB 1SH3A 1HQEA 1OS5A 3NAEA 4F4ZA 1W9HA 2HNZA 4G3IA 1EX4A 1SH0A 3ICLA 4AILC 3I0SA 3N6LA 4FJGA 5DK5A 2BE2B 3RB3A 4PQUB 2YNHB 1KVAA 3SPZA 1N5YB 4XPEA 4LH5A 2ZD1B 1ITGA 2BANB 4DLEA 3V4IB 1RTDA 1J53A 1TV6A 1SKRA 3NGDA 4K8XA 3C6UA 3BSAA 3GIMA 4WYLA 4ZPAA 3CQ8A 4JV0A 4DTXA 3ZT0A 3MR6A 4AHRA 2RDJA 1RT3B 3RMAA 4J9QA 2BGGA 4OL8A 5SZTA 3JSMB 1YVFA 3ASMA 1S0MA 3NKYA 2RKIA 3V1OA 1ZBHA 5KFWA 4JRQA 1VSJA 4ICLA 4RNFA 1RILA 1RTJB 2D0BA 4B8CA 2HVHA 4M94A 3HT3A 5EU7A 3KNAA 4TYBA 4KHSA 3NFAA 3MF5A 4CJEA 5F9NA 4CJTA 3BDPA 3V9UA 1HNVB 1BCOA 2AX1A 2OYQA 3CWJA 3TAMB 4NLRA 2G8VA 1REVB 3AVKA 4EBCA 1WSFA 4CK2A 2V4QA 3QERA 4KHNA 3RR8A 5HROA 4RU9A 3NGZA 4E7HA 3PW0A 2F8EX 3OL6A 5HLFB 1L5UA 3M8PB 2YNIB 4DQRA 5KT4A 2WONB 3PW7A 2QK9A 4X2BA 3KLEB 2HHUA 4O3NA 4EBEA 4FBTA 3T5LA 4Q0BA 3NE6A 4O3SA 4QWCA 3SUPA 2IMWP 2KW4A 4MIBA 2O4IA 4PQUA 1HJRA 4CHNA 2XGQA 2FLPA 1QHTA 1N5YA 1S0NA 4FJNA 4B9MA 4IQXA 5KFAA 2ZD1A 4CJ4A 4E7JA 4Q45A 3GV8B 4FK2A 3QIPA 2EC0A 4RNNA 2CKWA 3DLEA 4ID5A 3TAQA 2KFZA 4CGHA 1L3SA 2KZMA 3RB6A 3BJYA 3EZ5A 2HNDB 2BQRA 4QW8A 5FROA 4CERA 3M8QB 5HRNA 3OYLA 2JEJA 2HHXA 3OSNA 1SL2A 2HAIA 3RMBA 3LP2A 3V6JA 3DRSA 4O4RA 4LQ3A 4J2DA 4DFPA 1JLCB 3PR4A 2ATQA 4RW9B 4H4MA 1TGOA 1BISA 3ALYA 1RTJA 1Z4UA 4CHZA 4TY9A 1K6YA 3TANA 3QGGA 4DL4A 2R2UA 3NMAA 2O4GA 1A5WA 3Q8RB 1S10A 1HNVA 5F8NA 5KG4A 2HHVA 5KG1A 1C1BA 1XC9A 4MIAA 3V6DB 1REVA 2F8TA 4O0JA 3QO9A 3D28A 1LAVA 3DI6B 3KHGA 3SZ2A 1XR5A 4BE0A 4CF2A 5DGBA 5T7BA 2W8LA 1TVRB 3VQ6A 4CJPA 5KGXA 1TKXA 1RTHB 4FJ5A 2FC0A 4FLUA 2Y1JA 1VRUB 4ED7A 3M8PA 2A1SA 3HYFA 4KKOA 4E1NA 3VQ5A 2WONA 1WLJA 2FVQA 4ZVEA 3SQ4A 1T05A 3TABA 1LWCA 3DYAA 3QLHB 5KTQA 5CYQA 5KFKA 3U3GA 4RW4B 3K58A 4ECUA 4RNOA 5I3UB 4L8RB 4E19A 1WNSA 4CJVA 1R0AA 4N76A 2RF2A 2XI3A 5KFRA 3PW2A 3ZSXA 4IR1A 3O3FA 1BL3A 3H08A 3MXJA 3HPHA 3KJVB 3HJFA 2HNYA 3CO9A 5KFTA 3AV9A 1S1VA 3HVAA 4NLUA 4I2PA 5J1EA 4C8OA 3DRPB 2VG7B 1IKVB 1T94A 2D7SA 2IS3A 4CGFA 1JXBA 4RW8B 4ELTA 3N6NA 4HUFA 3JYTA 4N56A 5KT2A 4CJWA 4KHWA 4ECXA 4K4WA 1JLCA 2AX0A 5FRNA 3BQ0A 3MEEB 2PY5A 3CYMA 3L2WA 1JLGB 4MFBA 3MTKA 2IOCA 4KAIA 3CDUA 3KLFB 2DY4A 1TK0A 5I42A 4OKJA 5FDLA 2W42A 4ZPCA 2V4RA 1D0EA 4NYZA 5C5JA 4J9KA 3GV7B 1SKWA 5KG5A 3IRXA 3OYKA 4Y34A 1S1TB 1DTTB 4I9LA 1KVCA 3WNHA 5HP1B 2WB4A 3AVFA 4EO6A 3BSOA 4URSA 1W25A 3KKSA 3PW4A 2VG5A 2E9ZA 2VG6A 2IC3B 3V81B 2W9BB 5KGWA 3DLKB 4NLPA 2BR0A 4CIGA 1HMVA 1C0MA 3PUFA 4Y2AA 4KO0A 3I0RA 3EYZA 4IDKB 3BQ1A 4F50A 4O4GA 3MR5A 1S1WB 5EWFA 4ED2A 2DFHA 4YP3A 4RW4A 2OPRA 3WNGA 3VQ9A 4CEBA 3AVMA 4OGEA 4H8KA 2XY8A 2HHWA 1X9SA 2Q3SA 3QIDA 4I2QB 4F4YA 3OL8A 3VQPA 4ECSA 5CY4A 1A5VA 3NF7A 4LSLB 3LP3A 5KI6A 2WOMB 3CFOA 3KK3B 4TY8B 1S5JA 2IM0A 4CJQA 4DEZA 4MQ3A 1XWLA 3NH2A 2VG7A 3G10A 4NLYA 3MFHA 3SI8A 1LWFB 1S1XA 2V9WA 3SI6A 1RT5B 4NLGA 4KI6A 3D45A 4BE1A 3UPFA 2UUTA 1S4FA 2PYJA 2P5GA 4IRDA 3NAIA 3QGIA 5DLGA 4J9RA 4FLZA 5DG9A 1CZ9A 4E1MA 3LALA 2GBZA 4RUAA 4Y2CA 1JKHA 5KG6A 5C25A 4RNMA 1JLGA 4J9PA 4CIEA 4LSNA 5F9LA 4F8RA 1BQMB 3Q8QB 1VSLA 1NK0A 4N5SA 2G8UA 1RT6A 3I5AA 1HYSB 4TYAA 3DLHA 5C24A 2FBTA 4J9OA 4DTRA 2D3ZA 1DLOB 3WNEA 1Z25A 4FLXA 3UQSA 1JLQB 3G6YA 1VSEA 4IG0B 1RTIB 1CLQA 3IS9B 1TL3A 3M9MB 2OPQB 1O1WA 3V6KA 1VSHA 1RDDA 3ISND 1C0UB 1IKYA 3DLKA 3C6TB 1YTAA 4XPCA 4JUZA 4FBUA 3EZUA 4IDKA 1YT3A 1JLBB 2AGQA 1S9GB 1JLEB 1VRTA 2QXFA 5J2MA 1KFSA 4IFVB 2Y1IA 4O44A 2HHTA 3T19A 1LWEB 1S6QB 5KFHA 5J2PB 1S6PB 1RT4B 3CDEA 2AU0A 3OS1A 4CFDA 4TLRA 3LP1B 1FK9A 4J9LA 3OYAA 3HPOA 1ZBIA 3KHHA 1BCMA 2ZE2B 3KMQA 4I7FA 4NCGA 4QPXA 2W8KA 3HPGA 2R8IA 3H40A 1BIZA 4AHVA 4O5BA 2WOMA 3KK3A 3N6MA 4TY8A 1BIUA 4DSFA 3NGYA 5KFDA 1HARA 2IM1A 2B5JB 4ZTFA 3SUQA 3KMSA 5J2NA 4BE2A 3PO4A 5KG7A 3OJSA 3KKRA 3L3UA 1QAJA 1N56A 4MK8A 2HB5A 4U6PA 4JS5A 2FJVA 1HYVA 1KCFA 4HTUA 2DFEA 4J2BA 4WFXA 2ITGA 3KLIB 4U7CA 1UWBB 4KV8B 4PWDB 2QV6A 1BGXT 1A5XA 4FJKA 1YTUA 3DRRB 4M3TA 4URGA 3I5CA 5EWGA 1TL1B 2CJQA 4K8ZA 5DGAA 4IG0A 2XGPA 4ZPBA 3FQLA 4GW6A 2OPQA 2KQ2A 1U04A 4H4OB 2DPJA 1RNHA 1Q8IA 3PJWA 1C0UA 3GIKA 2UVWA 3C6TA 4IFYB 2IAJA 4ZP9A 4CHYA 4LY7A 3OYHA 5F8MA 3M8RA 3AA4A 1S9GA 1RA6A 1KLMA 2R8HA 4AH9A 3AVBA 1JL1A 2OPPB 3VQ8A 4ZHRB 1KRPA 1LW0A 1Q9XA 1LWEA 4BDZA 4HKQA 1C1CA 1RT4A 4BWMA 3FRZA 5CZ1A 4CGGA 2JGUA 4WFYA 2X74A 4KTZA 4B9NA 4FYDA 5KFLA 4K4UA 3FQKA 1TAQA 3RMDA 4MKAA 4FJLA 4DTOA 1D9FA 3E01A 5KFOA 1JLFB 4IKAA 4DTNA 4Y1CA 2I5JA 3MECB 4IR9A 1ZTTA 3KIOA 4ZTJA 1IKWB 3GQCA 4QAGA 4B3OA 1SV5A 3LP0B 1JX4A 4G1QB 1VSIA 3DMJB 4R0EA 4DFJA 4DTPA 3DOLA 3AO2A 3V9SA 5HBMB 2PZSA 3SNNA 3AO5A 3KLIA 2OPSA 5F8LA 1C0TA 1RDCA 1ZBLA 2ATLA 1SKSA 4BDPA 4CF1A 4W5OA 1WSHA 1RBUA 4B9TA 5KFCA 4Z4FA 2AQ4A 2D0AA 3CJ5A 1LW2B 1ASWA 4MH8A 4W5QA 3NDKA 1LV5A 1I39A 1ZTWA 4C8LA 2LSNA 1UA0A 3KLGA 1XR6A 2D3UA 3OYIA 4LQ9A 2HHQA 1ASUA 4DFMA 1J54A 3L2UA 4WE1B 4RZRA 3OSPA 4FM2A 2BE2A 4GVMA 2HVIA 2EHGA 4Q8EA 3K5MA 2Z1HA 1EETB 2YNHA 5L1KA 4DQSA 4KFBB 4KREA 1EKEA 2HWHA 2YHBA 4CFBA 4CGDA 4RW7B 1S9EB 2BANA 4AHCA 3EPIA 3V4IA 1Q9YA 3BREA 4QWEA 3BGRB 4E3SA 2OPPA 1NK8A 3ZSRA 4IKFA 3T3FA 5L1JA 3G6VA 4FJMA 4B9LA 3THVA 1IM4A 4ELUA 2E4LA 4O55A 3SFUA 3KHLA 2HHSA 3CFRA 1RT3A 3VQQA 3CG7A 1CXUA 4DMNA 3ZT4A 1TK5A 3JSMA 4YMEA 4HHTA 4OVLA 1QS4A 3P1GA 3QETA 1NK7A 3QEIA 4M41A 1IKXB 3K5OA 4RW6B 1MU2B 4E89A 1EXQA 2JC0A 4KHMA 3V6HA 3AA2A 4FLWA 1X9MA 3ITHB 1JL2A 4IRKA 1L3TA 5HRRA 3LP0A 4G1QA 3OYDA 1JLAB 4Y3CA 3OYBA 2B6AB 3TAMA 5EDWA 4DQIA 3NGIA 2Z1GA 3RRGA 1XI1A 3KLHB 3SYZA 4M3RA 1FKOB 4FK0A 2P5OA 3IG1B 4DL6A 4JV1A 1TP7A 3B6OA 1GOCA 4DL5A 4OKKA 4OLAA 2J6TA 5HLFA 3QGHA 2XI2A 2YNIA 3CJ0A 1T7PA 4CJUA 3GV5B 3OHBA 4EO8A 2R8GA 1NK6A 3KLEA 4Y1DA 2YNGB 1LAWA 3EY1A 3KK2B 4DS4A 3LZJA 4CJSA 1Z26A 1U48A 4WE1A 3S3OA 5FRMA 3M8SA 3O4NA 3O3HA 2IJNA 3L2QA 2IBKA 4E0DA 5DQGA 3CIZA 5KFNA 4W5TA 2W7PA 3IGNA 3P83D 3PX6A 1UA1A 3VQSA 4ZPDA 3H4DA 4NCBA 4F4WA 3HVRA 4FW1A 5JUMA 1S9EA 3NCIA 1T03B 1BQNB 1HRHA 1QSSA 4XIUA 2FBVA 3H98A 3VQCA 4F2SA 4EEYA 1ASVA 4M3ZA 2HNDA 1TAUA 4WZMA 3PJXA 5CYMB 3QNNA 1X1PA 3ZT1A 3M8QA 2FLNA 2G8IA 4HVJA 4JLHA 3MEGB 4FJ8A 2R7YA 1HNIB 3S3MA 2E6LA 2WK4A 1RA7A 1NK5A 4CGIA 3L8BA 3NF6A 2IA6A 1GOBA 4LH4A 2WCXA 4F4KA 1RT7B 4RW9A 2HWIA 1L3VA 5F8GA 5J2QB 5KFZA 4KBIA 2E9TA 3MEDB 2A1RA 3HL8A 1QE1B 1TQLA 1RT1B 1CXQA 4ED3A 4IH5A 4J9NA 3V1RA 3HVTB 3H5YA 3OHAA 4BDYA 3LWMA 3V6DA 2XRIA 5K14B 3DI6A 5L1IA 2G8FA 3CVKA 4E7KA 2UUWA 2ZKUA 4CFCA 4B9VA 3AO3A 1TVRA 3K59A 5L1LA 2R2RA 2FJWA 4CJFA 1RTHA 2VA2A 4IRCA 4EZ6A 1VRUA 2ILYA 5L9XA 4FZYA 3MXMA 4OPKA 3D5MA 3NAHA 2DTUA 1NKCA 4KAZA 4KB7A 4Z4GA 4FJXA 1S49A 3OYNA 4CHOA 2FVCA 4M3XA 2QKKA 1JXLA 5T14A 4YR2A 1J9AA 3QLHA 2G8KA 5C42B 2YKMB 2PYLA 3NF9A 2Z1IA 3H2LA 4FS1A 5I3UA 1VSKA 4KB1A 3HHKA 4OJRA 3U6FA 1KHVA 3NL0A 3LAMA 5KFPA 3PV8A 4CF9A 3T5KA 3KJVA 3C95A 3RRHA 1S9FA 1T03A 3SQ1A 4KHYA 3QEWA 5DQIA 1B9DA 2QE5A 3V1QA 1F21A 4Z4EA 3DRPA 1IKVA 5CYMA 1HPZB 3QZ7A 4RW8A 3DOKB 3F9KA 2XY7A 1L3UA 1HNIA 4FM0A 3AA3A 5KT7A 3I8DA 2R8JA 1NK9A 1RT7A 3KHRA 1BI4B 3MEEA 4DU3A 4CEAA 1UOCA 3LPUA 1VSMA 3HO1A 5JS1A 3KLFA 4FZZA 2HMIB 4K50A 1RT2B 1YVUA 1WAJA 3S9HA 4RNHA 4C8NA 4OGCA 3I5BA 4QOZB 4EYIB 2YKNB 2BQ3A 4K4TA 2D5RA 1U45A 4JRPA 3GIJA 5KFBA 5K14A 5KFYA 1S1TA 1DTTA 1BHLA 1JXEA 1WSGA 5HP1A 4CEDA 3CJ2A 4N47A 4IG3B 4CJKA 4FLTA 3UDLA 3V9XA 3FFIB 3VQBA 3U3YA 2OZMA 2IC3A 1B92A 3V81A 2W9BA 4FLYA 4DSLA 2OZSA 3NBPB 4O3OA 5CZ2A 4CJ5A 1NJYA 4KHQA 1S1UB 3LANA 1HQEB 4CF8A 3UIQA 5KG3A 1KVBA 2HNZB 4Q8FA 4O3RA 1I3AA 1KHWA 3QYYA 1S1WA 3H5UA 3I0SB 1NKBA 2GUIA 2W7OA 3HK2A 3QEVA 1RDAA 1TKTB 3MFIA 4Q44A 4J2EA 2R2SA 5KFGA 1RCHA 2W9CB 5KFQA 4KRFA 4DTJA 3NH1A 4I2QA 3Q8SB 3OJUA 3SFGA 4ZVGA 4ECWA 2FVRA 4LSLA 1RYSA 4N41A 3TR8A 2P1JA 4KSEB 2DPIA 4DTSA 2IJFA 3ZCMA 4KHUA 3QEXA 3AVLA 3KTQA 1LWFA 4NYFA 1HPZA 1RT5A 2RKIB 4Z0UA 4ICLB 3RR7A 3T5JA 1T3NA 4PUOB 4FJIA 4Z4HA 1SUQB 3ZSYA 4FJJA 4ZP8A 1BI4A 2KZZA 3DLRA 3PVXA 5D3GB 1QSYA 1BQMA 1S0OA 2HMIA 1HYSA 4ED6A 4CK3A 1UAXA 4F3OA 3RAQA 1DLOA 3OS2A 2ASJA 3RAXA 3ZSWA 1D8YA 4FLVA 4CJRA 1JLQA 4CEOA 5HROB 2JEGA 4YFUA 1RTIA 3IS9A 3FFIA 1CSJA 4FVMA 1QQCA 3VQEA 2O5DA 4IH6A 1TKZB 4QWBA 4ECQA 3TAPA 4CIFA 2W9AA 4BACA 1S1UA 1RDBA 5HRSA 1JLBA 3KD5E 2FJXA 4DSJA 1JLEA 2R2TA 4ED8A 4Q0BB 4IFVA 4I9QA 4CEFA 4DTMA 1S6QA 5J2PA 1S6PA 1TKTA 3G0ZA 5KT3A 5DLFA 2FLLA 3F73A 4GC7A 1ZBUA 4F2RA 2W9CA 2XWYA 3LP1A 3VQDA 1RBVA 4CFAA 4TQRA 2ZE2A 3QIPB 1C1AA 3A2FA 3DLEB 4ID5B 5KFXA 3HXMA 3WNFA 4M45A 4WFZA 4CK1A 3ULDA 2AJQA 3SV3A 4J2AA 2XC9A 4DF4A 4FJ7A 4JV2A 2B5JA 4PY5A 4TQSA 3E51A 3LP2B 1RBSA 3DRSB 4CHPA 2ETJA 2P51A 4ZVFA 2XY5A 1GX5A 4NRTA 4H4MB 4QCLA 4PUOA 4MKBA 4FS2A 3UR0A 3SPYA 1SUQA 4GC6A 1FKPB 5KFSA 1DTQB 4DSEA 1KSPA 5D3GA 2Z1JA 3VQ4A 1G15A 2AWZA 4NLQA 1IH7A 1UWBA 1SH2A 2BRLA 4KV8A 4CF0A 4IH7A 4PWDA 1C1BB 4JS4A 4CJ3A 3H5SA 1J5OB 2IM3A 3GILA 2C2RA 3QESA 3QO9B 5JXSA 4DL3A 4NLVA 4UQGA 3DRRA 4NLWA 4ELVA 3AVHA 3OYGA 1TL1A 2ASDA 1KTQA 3BQ2A 3DLGB 1TKXB 1I6JA 4KHRA 4WXOA 3L2VA 2UVVA 3TAFA 2C2EA 4F4XA 4KKOB 3AVNA 4H4OA 4HUEA 1NNDA 2D41A 1ZBFA 1SL0A 1TKZA 4IFYA 5KG2A 1T05B 1NOYA 2XHBA 2D0CA 1LWCB 2YNFB 4AHSA 4E7IA 4ZVHA 4EZ9A 3DYAB 3O3GA 2I1RA 4HYKA 4WYWA 4NLXA 3SJJA 5CYQB 3Q8PB 1ZYQA 4W5NA 5E41A 2GIQA 4FXDA 4ZHRA 1GOAA 2UVRA 1WSEA 3PX4A 4ECRA 1R0AB 4HUGA 2RF2B 1K1SA 4YR3A 1WSJA 3AVCA 3SV4A 5EWEA 3LWLA 4DSKA 2X78A 3RB0A 3MR2A 3CJ3A 3K5LA 3AO1A 1TKDA 3RBEA 3TI0A 3QINA 1MMLA 2HNYB 3K2PA 1S1VB 3ZSZA 4QWDA 1JLFA 3KOAA 4I2PB 3M9NB 5J1EB 4KTWA 4K4ZA 4M3UA 4CEEA 3D0PA 2GV9A 2RDIA 1NK4A 3MECA 1WN7A 3SQ0A 3T1AA 3CDWA 1IKWA 2GIRA 4K4SA 4DF8A 3JYTB 4OLBA 4FJ9A 4ID1A 2HW3A 2R8KA 3BSCA 3DMJA 1RDRA 1FKPA 5HBMA 4C8MA 4MFBB 3OYJA 1DTQA 1N4LA 3OY9A 1X9WA 3QZ8A 2XCAA 3BSNA 3OLBA 4FCYA 5I42B 4J9MA 5FDLB 3TAEA 4Z4IA 4B08A 3ZSOA 4C8KA 1J5OA 3LDSA 1VSFA 4GMJB 1LW2A 4K4VA 3IRXB 3FSIA 5KFVA 2OH2A 4M42A 4E7LA 1IG9A 5F8JA 3C94A 3DLGA 3HM9A 4NLTA 2VG5B 4YQWA 3HVWA 4O3QA 2VG6B 1FXXA 3LZIA 1U47A 4HCCA 3AVIA 3L2RA 1HMVB 3GYNA 2XCPA 2E6MA 4KO0B 1RAJA 2BDPA 3I0RB 5DG7A 1EETA 4QW9A 3PR5B 3B6PA 4KFBA 2B43A 2IGIA 4B8AB 3HP9A 4O4GB 3FDSA 5KFMA 2YNFA 1XHXA 3AA5X 3RWUA 1XR7A 3LPTA 3AO4A 4RW7A 2FBYA 4MK7A 4URQU 2OPRB 5KFJA 3BGRA 3KK1B 5KT5A 2XO7A 4CESA 3VA3A 4NLSA 3LAKA 4CECA 2ZQBA 4IOBA 4M95A 1HQUB 3S3NA 4RG8A 4DSIA 5KRTA 3QEPA 3SUNA 1RYRA 3ZT3A 2JLEA 5F8IA 4W5RA 1IKXA 1S1XB 4RW6A 3CM6A 3VA0A 1MU2A 2XY6A 1B9FA 4DTUA 4AHTA 4AHUA 3ITHA 1NHVA 3IN5A 1NHUA 1JLAA 1RBRA 1C2PA 3RBDA 2B6AA 1CZBA 1NOZA 2IDOA 4OKEA 1RBTA 1HYZA 1JKHB 4TSXA 4CJLA 2V0NA 3KLHA 5C25B 4EBDA 4LSNB 4ZP7A 5DQHA 1FKOA 4ECZA 4DL2A 1RT6B 3IG1A 4DS5A 5DG8A 5C24B 2F96A 4FW2A 2IM2A 3CM5A 4DU4A 5JS2A 4EYHB 1NJZA 3HSTB 2FVSA 4ZMMA 4FM1A 4WZQA 2C2DA 2EX3A 3MR3A 1D9DA 1TK8A 2JC1A 1IO2A 2YNGA 4M3YA 4YR0A 4CCHA 4H54A 4NYNA 3QNOA 1TL3B 4YNQA 4BWJA 3KK2A 4QWAA 4F3TA 4WXWA 4ZP6A 4HCBA 3TWHA 3GIIA 2F8SA 2GC8A 1IKYB 4EP5A 1XHZA 4Z4CA 1QAIA 1K1QA 3AVAA 3SUOA 5F8HA 1JIHA 3TQ1A 2E9RX 1NJXA 3PO5A 3AVJA 5SWMA 5KFFA 1VRTB 5J2MB 4DG1B 1WNEA 4NRUA 4KI4A 3SCXA 1U4BA 4O44B 1BQNA 2WTFA 2WRMA 4ECTA 4B9UA 3KK1A 1KLNA 5KRSA 3IGVA 5KG0A
chains in the Genus database with same CATH superfamily
4OZ0A 4FZXC 4NLDA 3EMTA 1SL1A 1HQUA 4WU2A 5HSPA 3MWBA 1Q8BA 1B99A 3W9HA 1WF2A 1UVJA 4NLOA 3AJ1A 3HP6A 5E3RA 4FF4A 3O4QA 3J81Y 2CPYA 4KTQA 2ASLA 2AJ2A 2QZ8A 3D7EO 1RU1A 2O8EA 3NHGA 5IV3A 3S7RA 1UW4A 1BXNA 4DQQA 3FCHA 3QDKA 2BE7D 4R25A 3MMBB 4NZ0A 1Y97A 3FZBA 3FZ2A 2FSKA 1GX6A 1ZAWA 4OPHA 3MMAA 1Q5VA 4DQPA 5AE2A 4FXWA 2HVDA 3TUJC 4R5PB 2GO8A 4HI1A 3D0GE 4FVCA 4LMZA 4DWIA 1U49A 3HHLA 3SQGB 4RWXA 2QWRA 1HWIA 3AHPA 2JEIA 3TJAA 3HD2A 3ILOA 4DV3K 4Y6IA 1G99A 3HZ6A 2HGLA 2D69A 2AD9A 4JI6K 2QKBA 2G8WA 4BR7A 2CPIA 4LUBA 5KFIA 3TVKA 3B82A 1LXNA 2UVUA 2KHOA 4KE5A 4C2MA 1VQMS 3VALA 2IFXA 2CH6A 1JXVA 5D6GA 4Q43A 4JI1F 3DDKA 4DJBA 1IR2A 1U2RA 1D8ZA 3GFYA 2ZEJA 5D4LA 3KD1E 4FK4A 3R6GB 3K8VA 4P2SA 2IPOB 3DOKA 3TW0A 3MM6A 4DL7A 5IT9Y 5F3ZA 1YJNN 2F5GA 2ROPA 2I5JB 4K4XA 2KTQA 2FF6A 3EZWA 4CEQA 2MSSA 3H46O 3EVWA 1SV5B 4N8NA 1C6VA 1H98A 1RT2A 1F2GA 3TR5A 5M1KA 3AY0A 3G86A 3DOLB 4X66F 3PY8A 3VEWA 4LF5K 1HNZK 1LCUA 1MMNA 5JMVA 3D6RA 4CEZA 1Q81O 2AGPA 5KT6A 4NCAA 2ASPA 4ILMA 3NH0A 3VVUA 2YX1A 5AQNA 2XNRA 3UD4P 3NXZA 2DO4A 1QSLA 1FRKA 1BC6A 1RU2A 3NLCA 2NUBA 4O0IA 1M5VC 3MN7A 1SH3A 3RBXA 1F5AA 3PSIA 4F4ZA 4LF4F 1RADB 3DLJA 2HRTA 3H7HB 1EQ0A 4AILC 2NR0A 5DK5A 2XNQA 1X5SA 3IR7B 4PQUB 2YNHB 4DR1F 3VZHA 1U26A 4QS9A 3NG8A 1N5YB 2B51A 4CVNE 2CIMA 1ITGA 5AQSA 1TV6A 2RS2A 1D9AA 3BSAA 2VICA 3GJRB 1Q0NA 3H45C 3ZT0A 2YKPA 2FGCA 4DBQA 5ELZA 5C2CA 2RDJA 2CRLA 3RMAA 4J9QA 4YOTA 4OL8A 1P8GA 3LGNA 3ASMA 4DR6F 2GMLA 3NKYA 4V19S 1WKKA 4BG8A 2RKIA 3EWGA 4OZLA 4DHVA 4ANEA 3V2UC 4OX9J 1AFJA 2P6SA 4BGBA 2HVHA 2QFJA 4CZMA 4ZLNA 4WKRA 2FJBB 5FPMA 3KNAA 5F9NA 4CJTA 3BDPA 1QQOA 2OYQA 1WI6A 4QU6A 3CWJA 4IJNA 4TU7A 1HR0F 4EHTA 4UUWA 3DGPA 4EBCA 2V4QA 4HACB 4JBCA 4QIVA 2A3JA 2A2CA 4PXDA 4RU9A 3WQTA 2EG1A 4E7HA 4DV1F 1CJUB 5A6PA 2F8EX 3OL6A 5HLFB 3J7YP 2QA4N 3W2VA 3PW7A 3CQXA 2ZBQA 4JKAA 2QWNA 3GFZA 4M63C 2UZAA 2LVWA 2ZGZA 4Q0BA 3UD5A 4O3SA 2FHMA 4QWCA 2UUBJ 2O4IA 4CHNA 3R5AA 1B70B 4UOCA 1FWLA 3HT0A 4E7JA 4Q45A 4M5GA 1Q82O 3QIPA 3TZZA 3DLEA 4FPIA 1G4CA 1S57A 3N9UC 3D1OA 4CERA 3SXLA 3M2VB 4AE5A 2WAQD 4I6YA 5HRNA 1BWEA 1SL2A 1VBYA 3RMBA 1ILYA 4JI8K 3C15A 2B9YA 4H4MA 1TGOA 3SCIE 1RTJA 1Z4UA 3ZX3A 3M4XA 1Q86O 2DNLA 2R2UA 1TUWA 2VBXA 1A5WA 4LFBJ 1S10A 4A8QA 4A4JA 5KG4A 2RQKA 2HHVA 4MKVA 1C1BA 1KQFB 1XC9A 4MIAA 3THWA 3Q89A 2F8TA 4O0JA 4OHXA 4OMFG 4ILGB 3VENA 2GQCA 2OEMA 4WU3A 3HKZD 2JVOA 2LEBA 5DGBA 2H4YB 3R1HA 4A5AA 4FJ5A 3LM2A 3MX5A 4AYBD 1D3WA 1VRUB 1GLBG 3M8PA 3P3DA 4KKOA 4DDFA 2AJ1A 2DEIA 6FD1A 1U1QA 2E1YA 2AMCB 4KH0B 2RRNA 5KTQA 1FRMA 4RW4B 2MKSA 2XI3A 3PW2A 3ZSXA 1NZ8A 3CSKA 3HSCA 3H08A 3HPHA 3LDNA 3HJFA 3DXSX 5T41A 1JJCB 3U1LA 3AV9A 2KRRA 4DU7A 3D0IE 4NLUA 3BBFA 2D1CA 4C8OA 1CBKA 2VG7B 2D7SA 2HG4A 2VFVA 5D0HA 1JXBA 4C11B 3LDLA 4KHWA 1M5KC 2HFOA 3PHTA 3MEEB 3JQMA 3DXMB 1QM9A 1JLGB 1YIJS 2MDAA 4Q7AA 3CDUA 2O8BB 4LSZB 1TK0A 4OKJA 4QJVA 2V4RA 1D0EA 1N33F 4JI1K 4W92B 3GV7B 4A8YA 1WHYA 1HI1A 1DTTB 4I9LA 5HP1B 1WHXA 3PKMA 1JCFA 3BSOA 2EWSA 2P9GA 3PW4A 1OPIA 2E9ZA 2W9BB 1Z2ZA 1C0MA 4Y2AA 5AJ3F 4KO0A 2VBYA 7FD1A 3CCUN 5ETTA 3I0RA 4F50A 3QT8A 4NXNJ 2OANA 4DR3K 1PC5A 4O4GA 2C2NA 3GWCA 3VPZA 2HFVA 2DFHA 4B1YB 4YP3A 3C6AA 1P90A 2QA4G 2OPRA 1RBOB 3RYLA 2QWOA 3WNGA 5JLFA 4X66K 3UKUB 3D7SB 4OGEA 2HHWA 2MKCA 3SCJE 1KD1O 3MPVA 3QIDA 1RWPB 1S6OA 3EM1A 2FZGB 5T7LB 2YY3A 3POTA 3CF5Q 4NEYA 1KP6A 3HD1A 4TY8B 4FYWB 3P4UB 3NH2A 3G10A 4USIA 2YQ1A 4NLYA 4X4UA 1GXTA 4LF4K 4CZKA 4BE1A 4CP5A 2EWHA 1FTRA 2BJ7A 1S4FA 1IWGA 3PXGa 2E66A 4CZIA 2NXUA 4E1MA 2CA9A 4RUAA 4Y2CA 3MPDA 5C25A 4RNMA 4I0WA 4C98A 4P6QA 3Q8QB 3L4IA 3UN5A 4M5NA 1NK0A 4C1NK 2G8UA 1VQ9N 1HYSB 1MMDA 4J9OA 2IRYA 5LXRA 3K0SA 4FLXA 1R43A 3CI5A 1HNWJ 3HTVA 1H2UX 2ZVIA 3UN2A 2A6OA 3D1HA 3QRRA 1CLQA 1R0CB 3T1YF 1TL3A 4DR6K 2OPQB 2F65A 2PN6A 2W2PP 2L9NA 1VIOA 3DLKA 1HNXJ 1O13A 3UB5A 3EZUA 3T6BA 2BM0A 2AGQA 1S9GB 3TU5A 4B1UB 2BJEA 4M5JA 1OIAA 1VRTA 2QXFA 1MN7A 1JCEA 3GP9A 2ZH8A 4O44A 1RXOB 1HR0K 2CVEA 1LWEB 1S6QB 5J2PB 1RT4B 2EFNA 3CDEA 2B7CB 3OS1A 2HZVA 4JKGB 4CFDA 1I51B 2J8AA 1R59O 4J9LA 3KHHA 1GTEA 1KC8T 4D3HA 4LBPA 3KMQA 4NCGA 4HT7A 2FJDB 2R8IA 5AXLA 1BIZA 2VV5A 9RUBA 3R3TA 5THWA 4WTYA 4DSFA 2VFUA 3NGYA 2OMOA 2COLA 2NZ4A 3CJTA 3SUQA 3L3UA 1QAJA 3EXCX 5LJWA 2FJVA 1HYVA 2MXYA 4JI0J 2A41A 2WVEA 4KR0B 3MUTP 4ZCIA 4AL6A 3A8IA 5H1SQ 1XIQA 1UWBB 4EAHD 1GXUA 4BROA 4XTTA 3D2FB 2QV6A 1BGXT 1H1VA 3KVGA 3QFWA 5D15A 4M3TA 4URGA 3I5CA 4OZJA 3SLCA 4QOTA 2RILA 3NMUA 4K8ZA 5HJXA 1M5PC 3CUNA 3FQLA 4GW6A 4NLCA 3OQ2A 2KQ2A 4CBWA 1U04A 1JJ2M 2QX0A 1C0UA 2UVWA 1WF0A 4ZP9A 3OYHA 5E5NA 3AT1B 3M8RA 4WK3A 4WK1A 2CJXB 3AVBA 1LW0A 3FSXA 1B7YB 2BXJA 4BDZA 3DRYA 1C1CA 2QLXA 2DR9A 4BRKA 1ACMB 4WFYA 1CC8A 3BH6B 3SMPA 4K4UA 3ENOA 2VPZB 2GJFA 2G0CA 2AP6A 4FJLA 4ZA1A 1D9FA 3E01A 1CQNA 1FRLA 1KAZA 2HVEA 3PYFA 4IR9A 2H9ZA 1ZTTA 1XNRJ 3KIOA 2VB6A 3RSEA 4ZTJA 3GQCA 1N5VA 4J9UE 1SB6A 2YTCA 5BN8A 1BHNA 4KGXB 1JX4A 4G1QB 2E8AA 4P52A 4LFCK 1VSIA 2QA4S 4B3RK 4PR6A 4DTPA 3AO2A 5HBMB 5E33A 1RDCA 4J8FA 1ZBLA 2ATLA 4BDPA 4CF1A 1Q7LB 2OELA 1TFWA 2PMWA 4Z4FA 2ASMA 1RQ0A 4MH8A 4W5QA 3LA0A 4WFNQ 1U1RA 1OH7A 4ZIWA 4C8LA 1SJ3P 1KVIA 5FPDA 2MGZB 1UA0A 1XR6A 3N01A 1XUPO 1FJ7A 4DUZJ 4GKKJ 2AKWB 1ASUA 4RZRA 1KQSM 2X1FA 3I33A 1VMBA 1VC5A 4FM2A 2DHHA 2HVIA 3GG4A 5L1KA 4DQSA 5IFMA 3TRGA 3O8WA 2LU1A 4CGDA 2BANA 3H2UB 4OYXA 4AHCA 2O8DA 1N33K 2OPPA 1VQ5S 5L1JA 4FJMA 4B9LA 1X8DA 5E3PA 1U1KA 3EKSA 5LY3A 1WC5A 1BWVA 3THVA 3F41A 2P9NA 1UVNA 3CFRA 1RT3A 3VQQA 3CG7A 5A2QO 3BGUA 3TSUA 1RGVA 2L08A 1XNQF 4K2XA 1NK7A 4DI6A 2P9KB 3H90A 1IKXB 5AQKA 1NPPA 4RW6B 1MU2B 4E89A 5AQIA 4L74A 2JC0A 4KHMA 2QTWA 3V6HA 3EE8A 4FLWA 1J5EK 3WBZA 2DGOA 3D2WA 3OYDA 5BXIA 2GS8A 3US5A 2DK2A 3VR1A 5EDWA 4CRJA 3NGIA 4YB7A 2C3MA 1XI1A 2NLXA 2CPXA 2PSZA 1MSWD 3J7YU 2KH9A 2P5OA 3CCWA 1N32F 1WSVA 1S5ZA 5F41A 2J4RA 4ZVOB 1IN0A 2CUYA 1GOCA 2XMUA 4OKKA 2O67A 2VC1A 2F4FA 2XI2A 2YNIA 3CJ0A 1ZM9A 3OHBA 5K8OA 1NK6A 5HMXA 3KLEA 1N36K 3QBCA 4F7VA 1LAWA 3CCTA 3EY1A 2JLGA 3KK2B 4DS4A 4P9SA 3T7ZA 3C46A 2IJNA 4C9DA 2Y8WA 3U9ZA 1M1KT 2MJNA 4W5TA 2W7PA 5AR0A 2QJ3A 2DIUA 3IGNA 1IR1A 3P83D 2B8QA 3VQSA 2F4VJ 3H4DA 3ZYYX 2GELA 3SEOA 3ZTRA 5JUMA 1S9EA 4Y65A 1T02A 4CYUA 4IO8A 1RAIB 1FEEA 1F5CA 4EEYA 1ASVA 1TAUA 2IJRA 2KKZA 3ZT1A 4GMKA 3M8QA 2G2ZA 4HVJA 4JLHA 3T1YK 1HNIB 1PKUA 3S3MA 2E6LA 3HF5A 3SAHA 2E2OA 3GL1A 4CGIA 2VQFF 3L8BA 3NF6A 2IA6A 4F4KA 1RT7B 1L3VA 5F8GA 4B9QA 3CCMN 2E9TA 3QBXA 3HL8A 3VV2B 2KT3A 4U7BA 2KU7A 2FUG9 4X4SA 3NS5A 2JDJA 2J0XA 3MM8A 4CLFA 3C16A 4ZDNA 5IV4A 4BR5A 4DV4F 3V1RA 1ZZNA 2XS5A 3CCUS 2UXCJ 2XRIA 1FNMA 3VEVA 4FWMA 1U24A 4FSVA 5L1IA 1NLKL 3MMAB 2W41A 1TVRA 3ZNJ1 2PA3A 4CJFA 3HMJG 2ZJPL 3U1MA 2HGMA 4IRCA 1RUSA 5AQFA 3HI9A 3PCOB 3HHLB 1HJOA 4Z4GA 4FOEA 3OYNA 3EGWB 5LT5A 4F26A 1JXLA 4DV5F 4YR2A 3MD1A 2G8KA 1UJ4A 2VFTA 2NQPA 1X5PA 2P2CB 1QLNA 2Z1IA 3R6MA 3H2LA 4KB1A 3CXCR 3D9BA 4PPZA 1Q16B 3MM7A 3HHKA 4KGKA 3U6FA 5BN9A 2LP4A 2OJ3A 2GIFA 3O4WA 3C95A 2ZH3A 2W7AA 3LTOA 4WWSA 3M1FA 1T03A 5F0XA 2BH1A 1R6YA 2DHSA 3HZGA 3CHWA 4CO1A 3LF0A 1P8ZA 1G6BA 4L3KA 5DQIA 2D3OR 3WEEA 3V1QA 4N7TA 1F21A 3DRPA 4Z4EA 3O5TB 4PWUA 1FDBA 1VQ9S 4J7CA 4CH0S 1N5SA 3DOKB 1RWXB 3MM6B 2XY7A 1L3UA 2B9EA 2CPHA 1UZDA 5HI7A 2CPEA 3KHRA 1BI4B 4PZVA 4DU3A 1QQMA 3DXKA 3ZTSA 3LPUA 3HO1A 3U8XA 4X64J 2LDIA 2HMIB 2WSFC 1RT2B 3BO4A 1Y3JA 3S9HA 3ZZYA 4RNHA 4IFEA 4ZCLA 4EYIB 2BQ3A 1WKLA 5K14A 2DHGA 2QLBB 1JXEA 2RE1A 3UR3C 2P9IA 3IBWA 5AE1A 4DPWA 1DHMA 3VQBA 1Y64A 3WUHA 3WHIA 2OZMA 3V81A 1WOPA 5CABA 1U8WA 2PE8A 3G96A 1FA0A 2P9CA 1NJYA 4BRNA 5E2QA 3GYXB 3LANA 4CF8A 2AEFA 5AQUA 2E5HA 3PJ9A 4FNHA 1XC3A 3QYYA 2IIHA 2KT2A 3H5UA 3BGOP 1Z2LA 1NGJA 1QUPA 3BZCA 2B8PA 2LEPA 2H65B 3MFIA 3I9V9 4FYVB 2R2SA 5KFGA 2W9CB 1WKJA 2GHVC 4DTJA 1TUUA 1K9MT 3Q8SB 4WQ5C 1SC6A 2MLXA 2ZH6A 3J7ZO 2WZ1A 4ZVGA 4ECWA 1AUDA 5AZIA 3ZCMA 2PDAA 2MZSA 2MKJA 3W7BA 3WT0A 1OYEA 4RO0A 1HPZA 1RT5A 2DNOA 4FWOA 2RKIB 2CWXA 5AQJA 2V34A 1WC4A 4DXLA 1BG3A 2OLWA 2DGTA 3L4QA 2POKA 5A0YA 2W2OP 4JI3K 2BVZA 4CK3A 3TSPA 3RAQA 3P39A 1KOOA 3CIMA 1TFYA 1PYSB 2Q6BA 3DGPB 3W8GA 3ZSWA 3NCQA 1A0OB 4CEOA 3MXHP 1FX4A 1IVZA 5EX3A 4JI2F 2LA6A 3UWTA 2XMJA 3A3PB 1XNQK 4F0HA 3CCJN 1X31C 4FVMA 1QQCA 2YWHA 4USTA 4FPBA 3W2VB 1NSAA 2HRUA 2MQLA 2XG8A 4FP9A 4WQ4C 3TAPA 3R5BA 3IWLA 1S1UA 4A48A 5M1QA 1RDBA 2IYGA 5D0EA 1IJEB 4DR2F 4DSJA 1JLEA 4ED8A 2V7ZA 4Q0BB 4IFVA 1S3XA 4HH0A 4CEFA 5JJBA 1HBOA 3BUZB 1XJWB 2J7KA 5IC6B 3G0ZA 5KT3A 1DQAA 4FWSA 1R3NA 4TQRA 4FDFA 3QIPB 2PEBA 1OMSA 3DLEB 1XMQJ 5KFXA 3WNFA 4KY3A 4FWRA 4FWLA 2RMLA 2AJQA 4J2AA 4G6VB 1ZAVA 3UO0A 2XC9A 3QNWB 5ETSA 2UUAF 4JV2A 2B5JA 5H1SV 2HBKA 1RBSA 1IG8A 4C23A 2X1AA 4B3TF 4OO1J 2XY5A 1GX5A 4NRTA 4H4MB 3T9NA 3C6HA 4PUOA 3UR0A 4DX5A 1FKPB 5KFSA 2BZ2A 1EJ7L 1WELA 2FTRA 1HBMA 3C0BA 1C1BB 4JS4A 4UOHA 5CHCB 2IM3A 3GILA 3THWB 3KJNB 1IBKF 5JXSA 3DRRA 2DHAA 3AVHA 1BDGA 1KTQA 4CW7B 3DLGB 1IXKA 1PBUA 1XBWA 2GVDA 3K5PA 4ENOA 4U67Q 4F4XA 4LFAJ 4KKOB 2VQFK 4M1KA 4EMDA 4HUEA 1ZBFA 4LREA 3NP5A 4OX7A 1SL0A 1TKZA 2GV1A 2LECA 4K0KF 3WIVA 4W4MA 4NMLA 4E7IA 3AAWB 3CJAA 3CCVS 1ZYQA 2KB2A 4DV4K 2GIQA 3CD6N 2P6TA 4FXDA 3MK6A 4GV3A 2LDYA 2ZBRA 4BC3A 3SV4A 1K1SA 2UUBF 4K8RA 2QL7B 1I94K 1FRXA 3BYPA 3DDNA 1B3TA 5U47A 5FPEA 1UJ5A 3W2WA 3HZEA 3R3LA 2GIRA 4DUYJ 3UDVA 2VD3A 3TUIC 4DV5K 2C1EB 2PFFB 2HW3A 4K59A 1D09B 3M2UA 2B4PA 2R8KA 5LMUF 4KT0C 4PG4A 2MQPA 3GYGA 2ZUGA 4I4BA 5LSRA 2O8CB 2VQEK 3QZ8A 2XCAA 2HFNA 2ADCA 2HBZB 3F9MA 4XH1A 3P38A 5AQPA 5L9NA 1J5OA 3LDSA 2GMHA 4GMJB 1RBAA 3FVYA 1AYEA 5KFVA 4FWQA 3PIOQ 4A57A 3LDOA 3GJQB 4WFNL 1BY9A 1IG9A 5B8HA 2W2MP 4BQLA 1S79A 1U47A 3LZIA 4USHA 1LOUA 3L2RA 3ZEUB 1J27A 4KO0B 4Y2KA 1RAJA 1W26A 3I0RB 1HKBA 5DG7A 2R7XA 4YHHF 3NVKA 4B8AB 4O4GB 2YNFA 1F9HA 3A0IX 4URQU 2OPRB 2GNKA 3LH2S 1YQHA 2P9SA 3CCMS 3KK1B 1EAYC 1RHQB 4PAAA 1NZAA 1FDDA 2Q0UA 4CESA 1WEXA 3QICA 5L39A 2B4UA 1WUAA 1RHKB 3DLLL 1VLYA 3POTB 3SUNA 3HHLC 3CTRA 3DXBA 2JLEA 1CEZA 2ZH5A 2ZDPA 2UV8A 1T6DA 4ZLPA 4A47A 3CM6A 3VA0A 2UU9J 1QQNA 2R4FA 3ITHA 3DN9A 4B1ZA 4EUVA 1MW7A 1RBRA 4M63A 3AAQA 3RBDA 4CJ7A 3PLAA 2B6AA 1CZBA 1EO1A 2IVPA 1HYZA 4IO9Q 4CJLA 5C25B 4LVOP 4ZP7A 1FKOA 4ECZA 5AQQA 3IG1A 1NGFA 1VQSA 3CJSA 1A6LA 3NMRA 5F2RA 4CDIA 1FJCA 3P5BP 2XULA 1SPBP 3N79A 5LOQA 2C2DA 4FYXB 3MCSA 2YNGA 4M3YA 3MAAA 1TL3B 4YNQA 3MEKA 4CI0B 4DV7J 1Q95G 1NGHA 2F8SA 2GC8A 3DHXA 4EP5A 1QAIA 3NWRA 3SUOA 4HHJA 3PO5A 3AVJA 1EKSA 5DM6L 2OD6A 2ZITA 1VRTB 2IBOA 4DG1B 4CO3A 3QMQA 1J2VA 3D4JA 1U4BA 3SCXA 4O44B 3WXJA 4OZNA 3OR2A 2WRMA 2Y9HA 2HGNA 5FD1A 4RUBA 5KRSA 2Q36A 4UF4A 2I9SA 3QQCD 4NCGB 1RBLA 3SIPB 1UKUA 2UV8G 1FVSA 1UW9A 1U09A 1PJ5A 5DZ6A 2C3OA 4M3WA 1XK8A 4KIAA 3K57A 1T8EA 2HQCA 2VU5A 3PFOA 2DY9A 4RPFA 1W2BM 2A0FB 1YRTA 1RT1A 3ISNC 1YUWA 9ATCB 1VI7A 5AQVA 5F0UA 1NJWA 3GIRA 1KWMA 4YUDA 3VN5A 1IBMJ 2PBDA 3OYFA 3R5GA 3CFPA 1F60B 3H59A 2Z2LA 4RU2A 2QC3A 4ILLA 1S72N 1GK8A 1N6QB 2E2QA 1AUSL 5MLCV 3DNCA 1IBLF 3U1NA 3GU0A 3FC9A 1UVIA 5L38A 5A8KA 4WIQA 2AA4A 2YQ3A 4JV5J 3QIOA 4R8UB 2UUAK 4ZVQB 1HNWF 1NHKL 5AE3A 4PA1A 4PQAA 3HKWA 2VA3A 1VQNN 2P9LB 3AXKA 5C42A 1Y00A 3U27A 2DY1A 3OYMA 3MM9A 4CZGA 2K7KA 3L3VA 3OL9A 4OX9K 4XO0A 1EKRA 2DCLA 1NJIT 4O0NA 5GIPA 1YBAA 2ROGA 1RTDB 1VSDA 1LW0B 1ZETA 2HSTA 1MROA 2H48B 3H5XA 3QWUA 1DT9A 1WBDA 1C1CB 1IBKK 3OYCA 3P8BB 1P9YA 2AEMA 4CTAB 1RHRB 1S97A 5GAHI 2O8FA 4EHUA 1FDAA 3CULA 4EGLA 3MR7A 1ZBSA 3RB4A 3E01B 2FHJA 2VPXB 1GQEA 4O3PA 3PHEA 2FF3B 2CZ9A 3V9ZA 4K0KK 2BRKA 1N48A 1NKEA 3RSEB 2QGFB 2N82B 3E8OA 2P9PA 3CCJS 4X84A 1BWFO 4GO7X 2CNLB 3MXIA 4TN2A 2MY8A 4X4QA 3EVOA 1NM2A 2YKNA 4TXSA 5KFUA 3M32A 2UUBK 4OPJA 2VWJA 4QPTA 1QVGR 3OYEA 2V6AA 3HJVA 4R5PA 1VK0A 4DLGA 1GLJO 3UE2A 4RUCA 4A8FA 2WHOA 5ETNA 1HQEA 2CQPA 2ABYA 3I87A 1EX4A 4WF9Q 1S76D 2JH3A 3ICLA 3W9JA 4FJGA 3WX4A 1RABB 3SAFA 2OKQA 1KVAA 4CM2A 5K8NA 5JICA 2ZD1B 5KQDA 2BANB 2O8DB 4DLEA 1S22A 1SKRA 3NGDA 1X4BA 1SJQA 2F1FA 4ZPAA 2JVRA 3CGIA 4JV0A 1RISA 3NGRA 2P9UA 5FLXO 5BREA 1VQ7N 3MR6A 3GBTA 2P9NB 5KPZA 4AHRA 2G0IA 1RT3B 2BGGA 4USKA 4ZVUB 3RBZA 1S0MA 2VOPA 3K0JA 2DPNA 3G71N 1ZBHA 5KFWA 3D3CJ 1MG7A 4Q2MA 3WXMB 1FXDA 4YY3F 1CZAN 3TPQA 2GA7A 4KHSA 1RTZA 3NFAA 3MF5A 1H38A 1UZHA 4BRGA 4NXMJ 1X4FA 4JI5F 1HNVB 2QEXN 3DOMA 1REVB 4BR4A 4DV2F 3AVKA 2BEFA 3SMSA 3OXFA 5B09A 1ZA2B 2C2OB 8AT1B 3BY5A 5HROA 1HQ2A 5CCMA 3NGZA 2OFHX 2WFBA 3CD6S 1VQ6S 2YNIB 2KHCA 1MDUB 4DCJB 4DQRA 4DOZA 2WONB 3OHRA 3KLEB 1C4AA 2E5JA 2HHUA 2DD8S 2QRRA 2QO3A 4O3NA 5JLHA 1HUXA 4FBTA 2G1DA 2AJ4A 2DNNA 4YOXA 4E1JA 3WX8A 2LCWA 4PQUA 3P96A 1HJRA 2XGQA 3FR0A 4TU9A 1QHTA 1N5YA 3CC7N 1NLVA 4PG6A 3GV8B 4FK2A 4X4OA 3PTWA 4ID5A 4CYUB 4V19X 3TAQA 1U8SA 4BY9C 2HWTA 2Y1RI 3D0HE 2V4JB 3RB6A 4C0BA 4DZ6A 3BJYA 2BQRA 1HW9A 5FROA 5CE3A 2V8GA 2MQOA 3M8QB 1U1PA 2GJIA 5HL7L 4LQ3A 1JLCB 2ATQA 3OFGA 3ALYA 4CHZA 1K6YA 3TANA 3NMAA 2W1BA 3MM8B 4JK9A 4CZCA 3C16B 1YLXA 5F8NA 3K89A 2XWXA 5KG1A 4HDGA 3D28A 2V94A 2DNRA 5B0AA 4C4WA 4HACA 2Z2ZA 1TUYA 1CJKB 4YDXA 1TVRB 1NMEB 4CJPA 5KGXA 1TKXA 4DN0A 2R3VA 3K2YA 4C48A 2A1SA 3HYFA 3F5TA 1X60A 3MOZA 2CG8A 3C66A 2DNZA 1WLJA 5G0RA 2FVQA 4ZVEA 3D67A 1DQ8A 2BJDA 1BMQB 3SBTA 3TA1A 3U02A 4Y0FA 4OZ2A 3TABA 2BBEA 5CYQA 4ECUA 3ETMA 3EDQB 5GADI 1KQKA 2NLWA 4P71A 3MXJA 2VDIA 3W3SA 4OX8A 5LJVA 4BC5A 2OTLS 2HNYA 3TUZC 5KFTA 4W90B 1S1VA 1U2CA 4AT1B 3WEEB 1T9YA 1UCNA 5J1EA 3DRPB 1T94A 3CO0P 5DDOC 1DURA 2IS3A 2ZNYA 4BRIA 5GAHP 2WVCA 1HNWK 4CGFA 2XZDB 4ELTA 4OI2A 4YS2A 3JYTA 4N56A 4IOXA 2UYTA 4ECXA 4K4WA 3V4MA 4PHTX 2KRBA 1XMOJ 2BJ1A 1RAOA 2VH7A 1UP1A 1O8BA 3DXKB 4N8OA 3MTKA 1APSA 2IOCA 1NUEA 2WSCC 2DY4A 3KNGA 4OHYA 1HNXK 4BRDA 2MZRA 2K8GA 5FDLA 2GFFA 4ZPCA 4BRMA 4NYZA 5C5JA 4J9KA 1FWPA 2KXNB 3HHLD 1CJTB 5KG5A 1ZZFA 3OYKA 3O9SA 1RDWX 4RBTA 2E5LF 2P9IB 1LEOA 3PRVA 1W25A 2VC0A 1REGX 4YOYA 2NRHA 1XTZA 4K7QA 2V2VA 3V81B 4NLPA 1ZH5A 1HMVA 3I6PA 3CMAN 2WSEC 2MQ8A 1N5TA 2HF3A 2ZZTA 5IOLA 3O6WA 1OVYA 3MR5A 5EWFA 4ED2A 3AD7C 4S0MA 4RW4A 3AVMA 2U1AA 4ED4A 2XY8A 4JI0K 2QSFA 1FFGB 3OTDA 4F04B 1OH8A 3IFRA 3OL8A 3VQPA 4ECSA 3UNGC 2F8HA 1MWYA 3WC0A 3ZZUA 3LP3A 3CFOA 3KK3B 1ATNA 5AZIB 3TTDA 1S5JA 2IM0A 4UUXA 2BKOA 4DEZA 1XWLA 2VG7A 4X65J 3BB5A 3D54A 1S72S 3FZLA 3MFHA 3QJLA 4QR0A 3UCGA 2XMKA 3SI6A 1RT5B 3EN9A 3UPFA 4C11A 1B7FA 5BR8J 2PYJA 1RDUA 4IRDA 2ZC4A 2E1MC 1WG4A 2JFDA 3ILLA 3MD3A 3QGIA 3THYA 1FX2A 2E7VA 5DG9A 1CZ9A 2J0SD 4IXCA 1GLAG 1JNZB 1JKHA 1KS2A 5KG6A 4AQYJ 1JLGA 2H5IB 2OFGX 3ZLJA 4IO9L 4X62F 3LGHA 4BC7A 2H3EB 1VQNS 4N5SA 2O8BA 4RBVA 2RQMA 3DLHA 5C24A 2FBTA 2ASYA 4YN3B 2HK3A 1O0PA 3ATUA 1ZXOA 2QMUB 3UQSA 2ZM6J 3G6YA 3QATA 2CZVC 4IG0B 1EB0A 3IR5B 4LF8F 3J80U 2C3UA 1SKUB 3RW6A 3M9MB 4ZPVR 2MZQA 4G1IA 3V6KA 4OIXA 3ISND 4A46A 1W2IA 2MKHA 4NA2A 4FBUA 3QFUA 1YT3A 1FHTA 1JLEB 2VYPA 3MCAB 5J2MA 4IFVB 1XNRK 2Y1IA 3FGUA 3GJSB 1V6HA 1HBOB 5AQGA 3TUPA 1WTBA 5KFHA 1CULA 2ZNZA 4DV2K 3MWTA 3IBCB 4KRWA 1UTAA 2XMTA 3HPOA 2EKNA 4PKGA 1ZBIA 2DRAA 2FPHX 4NB4A 1SVDA 3PIPL 4I7FA 5HQLA 2FZKB 2A1BA 2WVBA 4O5BA 3ZNUA 2CQ2A 1KEKA 1MN9A 4TY8A 4FVUA 2XSFA 1BIUA 3BEXA 4ZCKA 2IM1A 2B5JB 1RGIA 2ACMA 5J2NA 1LOTB 5KG7A 1YSJA 3GFXA 5K8MA 2ACYA 4MK8A 4PXCA 3IR6B 4DUZK 4GKKK 4CLSA 4HTUA 4ZVSB 3PACA 4WP8A 4WFXA 5B0CA 3KLIB 5RUBA 2NZTA 2DH9A 3M6UA 3WDOA 1HBMB 3JXUA 4QS7A 4LR8A 5DJBA 2AT1B 5CZXA 5LSLA 1HLWA 2YH0A 1A5XA 5E0OA 2F3JA 3DRRB 1H2TZ 2MKIA 2F9WA 4IQMA 2QFIA 1E6YA 1X4CA 2CJQA 5E26A 3CMEN 2OPQA 2GVDB 5HK4A 3CCZA 4E8UA 3KZBA 3O3LA 1VQ7S 2IAJA 3DWLA 2NXCA 4JYAF 5D4OA 4ETXA 3MM5A 3AA4A 1S9GA 3CCEN 2YQ0A 1KLMA 1YJWN 4AH9A 4P2XA 4USWA 2YHWA 2W4DA 4K41A 3D6TB 1R31A 3VQ8A 1KRPA 1Q9XA 2DNHA 1HWKA 1V5VA 1LWEA 4JHDA 1RT4A 3MMJA 5BPNA 4J5OA 1OH5A 5CZ1A 5GADP 3BM7A 4KTZA 1H7WA 4DV3J 5KFLA 3TP2A 2QEXS 3FQKA 2A3ZA 3O9QA 2HHHF 4JKEA 2JLFA 4JI6J 1R8CA 2A18A 2AZ1A 1GXLA 2GQQA 2NRXA 2NXEA 4Y1CA 2PT0A 4Y28C 1LK7A 4X4TA 2YWWA 1CPZA 2Q79A 3ILIA 4B3OA 3HSZA 3M2UB 2FJAB 2GZOA 5CAAA 1AFIA 4IDHA 3V9SA 3SK3A 1XN9A 2NYIA 1OWXA 1C0TA 2AV5A 2FJEB 4PYAA 1RBUA 2M52A 4B9TA 4TVAB 3GCWP 2D0AA 3RAMA 2DGVA 2Q97A 4PG7A 3CC7S 3NDKA 2QXLA 1I39A 2IA0A 2NRZA 3T1HJ 4LF6J 4V1Ak 1VQ8N 3KLGA 2D3UA 3H3NO 4LQ9A 3GE9A 3CDBA 2YX6A 3ONQA 4M8LA 4ZITA 2EHGA 4Q8EA 3K5MA 1NSQA 1NNEA 2HWHA 2HRYA 2YHBA 4P2MA 2N4DA 4Q2LA 3J8AA 4BRCA 2AYMA 4MYTA 3O2IA 3V4IA 3P5TL 4E3SA 1NK8A 1BO5O 4BRAA 2P9SB 4K5RA 3T3FA 3EZOA 2Q2RA 4FXVA 1C0FA 3ENHA 2N3OA 4DX6A 4IO1A 2BA9A 1HNZF 2E4LA 2E5LK 2UXCK 3SFUA 3KHLA 2D74B 2DXEA 2MHEA 3ZO7A 2FC8A 1CXUA 3JSMA 2GCFA 2XLJA 1KC8O 3QETA 4ZLLA 2KXHA 4M41A 5B0DA 1V4TA 1GLDG 3H3OB 1JJHA 3ITHB 3CQYA 3QT7A 4WKYA 4G1QA 1JK9B 2EG2A 4Y3CA 2QSWA 3QMLA 2B6AB 4DZDA 1N54B 4NLBA 1CVJA 4BCAA 2OSRA 3VGMA 1H0HB 1FKOB 3IG1B 2ZHAA 3QSIA 3GB0A 1TP7A 1S77D 3VAKA 3B6OA 3P4IA 1M5OC 2XO6A 4DL5A 2QWQA 3VWSA 4OLAA 3QGHA 2J6TA 3K9KA 3B8AX 1T7PA 4CJUA 2V50A 4EO8A 4Y1DA 2YNGB 1WBBA 1M5SA 3IMXA 4CJSA 3EDRB 1Q1KA 4P7VA 4IYQA 3L2QA 1KXPA 3DJCA 4ZPDA 1K0VA 4X62K 4NCBA 4F4WA 3HVRA 4Z37A 4BRPA 4V19J 3JAMU 3J81O 5J1NA 1GAOA 4F2SA 1YHQN 5CH7B 2HNDA 1VQKN 4X4PA 2AEJA 1WSRA 3M1VA 1RA7A 3P45B 4IUFA 4RW9A 5KFZA 3VAHA 1TQLA 1RT1B 2BW2A 5HQ8A 4BS2A 2M70A 3AOAA 4J9NA 3O9UA 4JI4F 3OHAA 1W2BR 3V6DA 2V68A 1O6XA 3CMAS 5GAEI 2XYGB 2FXUA 4E7KA 2LQBA 4B9VA 2N7CA 3I4HX 4OI6A 3Q86A 5L1LA 2FJWA 1RTHA 3JTPA 1P1TA 3BKUA 2DR5A 4EZ6A 1QY7A 2J9CA 4OHZA 5A8KB 5M1OA 4GRSA 3NAHA 1NKCA 5LM7E 4BQZA 2HSEB 1U2FA 1J9AA 4IZ9A 1HHSA 3QLHA 1F3VA 2WTUA 3LQVA 5C42B 1U6ZA 2M8DB 3J7AP 2PMZD 1RKIA 2PEHA 3AD9C 3NF9A 3AAPA 3M6XA 3MM9B 3LOUA 3DDIA 5I3UA 1VSKA 4OJRA 5KFPA 3PV8A 5GAHU 3KJVA 3RRHA 1S9FA 5C7PA 3SQ1A 5DDPC 1MROB 1RACB 3QEWA 2PFUA 4L75A 2XSJB 2KXFA 2O8FB 3JXOA 2E2NA 3DAWA 1SIZA 5FPNA 1TL4A 1X3MA 2G2OA 4BVOA 2E5IA 1DFDA 5HAOA 2F9JA 1OJ4A 1HNIA 1T11A 4J37A 4FM0A 1YJRA 3CT9A 3I8DA 2R8JA 1NK9A 1RT7A 2QG9B 4DR7F 1GTHA 2BKNA 4CEAA 3TEHB 4OJGA 1BD6A 4JYAK 3UE5A 1VSMA 4IOCL 2P9PB 3PYDA 5K20B 3CD7A 3G4SN 1I5OB 4U8YA 2YKNB 3KDNA 4K4TA 4Y2MA 1U45A 4JRPA 3I56S 1S1TA 3M32B 1WSGA 4B1VA 4N47A 2HHHK 4CJKA 3V9XA 3UDLA 2C42A 4BLGA 3FSYA 3ZX2A 2IC3A 2XMVA 1B92A 1DGKN 3P49B 1NDCA 1XMQK 5C2GA 1GT8A 2BABA 1V3ZA 3B8HA 4KHQA 1YVNA 1HQEB 3R8YA 5KG3A 1SQGA 3UIQA 2GJ2A 3CXCM 1Y5IB 5LXYA 2GUIA 3HK2A 4FO0A 1RDAA 1WHWA 1Q53A 4CO5A 4J2EA 5B7WA 2E1CA 1M1KO 1A7GE 2ZWOA 3OJUA 1ZAXA 4LSLA 1U25A 4N41A 1Y10A 4FWPA 2NUUG 2DPIA 3R6LB 2P9UB 1YI2N 3Q2TC 4ED5A 1VBZA 4PG8A 3WC2A 1H73A 2CQDA 4X66J 1E6VA 3R8EA 4Z0UA 3X3UA 1IJFB 3I55N 2QWMA 4I6WA 4LVNP 2CQIA 2V63A 1BI4A 2KZZA 3EL2A 5D3GB 4DR3F 5BYRA 1BQMA 2BOPA 3CMES 1S59A 2HMIA 4JD2A 2OEJA 3DOMB 3UI3A 4XEIA 4B17A 1UL3A 1RAAB 3RAXA 1RZMA 1YJVA 2JRSA 4LF4J 3D1QA 5HROB 3CCES 3FNNA 1YJWS 1CS4A 1RTIA 4PCQA 3IS9A 4XH4A 4E2FB 1P6TA 4DR1J 1SC1B 4PEOA 5GMKa 2E5GA 4IH6A 3TZYA 1U0HB 4ECQA 3NCRA 2W9AA 1IWAA 4KGVB 1JLBA 2OTJN 4DX8H 1FFSB 5C12A 4I9QA 4DUYK 4NI2A 5IZHA 4DTMA 2E1RA 4PXEA 5DLFA 2AJFE 2HFSA 5CD4A 1ZBUA 1GMWD 4QQBA 4LRDA 2W9CA 1RBVA 4CFAA 1TR0A 1JWWA 4ID5B 2RD5C 3F44A 2DGQA 4FYYB 2RS8A 3ULDA 3SV3A 3CJ8A 2Z4PA 4F3QA 3AB2B 1GLCG 1LXJA 3GE1A 2VJUA 4OQJA 5ETRA 1PC4A 3E51A 1HR0J 3JAMY 2QWLA 1PYOB 3WQPA 2UXBF 5EX5A 4BHQA 4OYWA 3SPYA 5EVZA 1Y5LB 4H0TB 1FI4A 1DTQB 1KSPA 2HBMA 1VQ8S 4DV1J 2ZJQQ 2DH8A 2DR7A 3VQ4A 2YH1A 1XMBA 1VK3A 4BC4A 4YEAA 1WC0A 1YRXA 4GKJJ 4A8XA 4NXMF 4I64A 3HSDA 2HS4A 3LDQA 1HHQA 3NS6A 4NLWA 5GAEP 3MI7X 2CNKB 1PAEX 1VIXA 4ZKAA 2EFQA 3TOQA 1TKXB 4H4KA 1WACA 2QLJB 4KHRA 3VGVA 3TAFA 3F0NA 4H4OA 1NNDA 5G0RB 3R5CA 4OLPA 2W4PA 4IFYA 5KG2A 1SQFA 3ISZA 4AHSA 1K8AT 4EZ9A 1ATSA 1HPMA 5GADU 2F63A 5AQRA 4WYWA 5IS2A 3SJJA 5CYQB 4W5NA 3TX8A 3FKBA 2AIRB 3AOCA 5E41A 3RZAA 4JI4K 4ZHRA 2QN6B 4HUGA 1WSJA 4DSKA 2CJAA 3CJ3A 2MTLA 3AO1A 3RBEA 2OCEA 3QINA 2HNYB 1S1VB 2RHKA 2NRRA 4QWDA 1JLFA 2MSTA 5M2PA 4I69A 1K9MO 3IMQJ 3Q24A 5J1EB 1YTYA 3IRWP 4DV0J 1VQPN 5I3QA 4KC5A 5B0BA 3T1AA 4DF8A 3JYTB 5ETPA 4ID1A 2HIQA 2VONA 4PL8A 3BSCA 4DV7K 2QA2A 4P7TA 1FKPA 1BUPA 1X9WA 3W60A 3BSNA 5FDLB 4Z4IA 1UJ6A 4DV6F 2W2QP 1R89A 1RHMB 3FZMA 1VSFA 1LW2A 4QZVB 3SMZA 3LL3A 2OD4A 1ZS6A 2GX9A 1YZ6A 2ZGYA 4M42A 1VQ4N 2ZJPQ 3KUHA 3Q8YA 1Q8KA 3DLGA 3HM9A 3I32A 1DEJA 4O3QA 3IAS9 1FXXA 2APOA 1SIWB 3OUYA 2K3KA 1YHQS 1HMVB 2E6MA 1VQKS 4DR7K 1YBUA 1URRA 4OYOA 4CZEA 1EETA 4QW9A 3PR5B 4KFBA 3RWUA 1XR7A 3AO4A 4MK7A 4LFCF 2FY8A 3E9OA 3CCSS 2QW9A 3VGTA 4B3RF 2YWEA 3BGRA 2OAUA 3SBGA 5KT5A 2XO7A 2B7BB 4HTJA 3J7A1 3CJBA 2H3GX 3LAKA 2Y3YA 1FD8A 3HSJA 3W8PA 1S6UA 2CQBA 4IOBA 3S3NA 3A5NC 3ENAA 1RYRA 4B3MF 4ZPTR 1RLDA 3FMBA 2M7SA 3NNCA 4WP3A 5F8IA 1DQ9A 3A1YG 2XTJP 1B9FA 4DTUA 2I7PA 2HPUA 2Y0BB 1N33J 2A6MA 4AHTA 1NHVA 4PABA 4GVBA 1JLAA 3THYB 2IDOA 2N7YA 5D0GA 1JKHB 3KLHA 3HFZB 1YK9A 2O8CA 3KWMA 1OY9A 3LPEA 1B64A 1Q4RA 5C24B 2F96A 4FW2A 5AJ3J 3CM5A 2CPDA 4AD6A 1Z6RA 2Q31A 3ULEA 2G2YA 3PNIA 2Y8YA 4ZMMA 4FM1A 4WZQA 4ANDA 4QWAA 2PIIA 4OI0A 4OI4A 3GR0A 3HFKA 3GIIA 4FPRA 3W65A 1Y5NB 2YCHA 1I3OB 1BOTO 3ZEUA 2W2NP 3DU5A 3EKUA 1K1QA 2KJWA 3NWGA 2XBPA 1NJXA 3ZFVA 5SWMA 2YHXA 1J5EF 2BACA 2DNPA 3VVTA 3E66A 5J2MB 2DRDA 2ZOFA 1BQNA 2L3MA 5A76A 2WTFA 1HBNA 1CULB 5AQXA 3VESA 3MTJA 3KK1A 2PI5A 3L0QA 1YAGA 2CQ3A 3OVNA 1PBAA 1H74A 4IEEA 3M6WA 3J7Z5 2DVIA 2J5AA 1YWXA 4I7FB 3IAYA 3KLVA 3G4SS 2DGSA 2NCKL 1VYAA 3SQ2A 2I38A 1XEZA 3E9LA 3TZWA 2VWKA 3RMCA 3MEDA 1N36F 1EP4B 5K9FA 5K5MA 5J2NB 3ZTPA 5EX0A 1EZZB 1JJ4A 2LXFA 3K5NA 4ED1A 2GWKA 3DM2B 2JJ4D 4QIGA 1ROFA 3ZSQA 4ECVA 3HVTA 3TO8A 3CJ1A 4CO2A 5BR8F 1U1LA 3RGIA 1PSDA 2FVPA 3T1YJ 1Y4ZB 3CJ4A 1GEHA 2M0GB 4FKXA 4OJHA 1CC7A 1DJ0A 1H7XA 3TARA 4YOEA 2C28A 3BR9A 4AQYF 4JI7F 4ISGA 1O51A 3G9CA 2O66A 1BA0A 3VQAA 2CGLA 2B4VA 4CLUA 2VOOA 3ZX0A 3V9WA 3LO3A 4PG5A 3M6GA 3UN3A 1E6YB 5FJ4A 4FOIA 2A10A 4DB3A 2FD2A 1SJ1A 2HBJA 2J6SA 2ZM6F 3WQUA 3R7SB 1D1UA 2AGOA 2YKMA 2W6LA 2RRBA 4TKTA 2UXBK 2J6UA 4DFKA 2IAJB 3BS9A 1YI2S 4NL5A 4U7UD 4OJ3A 1W7WA 1RSCA 2WW8A 4PYDA 4CHQA 2H4WB 4LF7F 3MM5B 1G3OA 1N8RT 2V2QA 1KLMB 4DG1A 3ET6A 1YJNS 4CE9A 3P6YC 3I55S 3NF8A 4NXMK 3C6UB 4DU1A 2ZWHA 5DS7A 2YV0X 4JHDB 2VGNA 3KWIA 4UY8O 1X4GA 1FKAF 3H4BA 1KBRA 3UVJA 3W5ZA 2CGJA 3CCLN 4H5WA 3LM9A 4WJBA 3O44A 1S48A 1RAHB 4F4AA 3L7UA 3BO3A 1V3SA 1VISA 5ADXH 3RTVA 3HSGA 2HQ3A 2YX4A 4B9SA 3E1YA 2CG4A 3CPWR 2ILZA 2W4CA 4B3OB 4GVEA 3BGLA 2BOAA 2RPIA 2GAHC 4FJHA 2N3LA 3R5DA 1MNEA 4IBNA 2KKHA 2J7WA 3WIUA 3FEXB 3HULA 4ZVTB 1SCJB 3A3OB 4TU8A 3EPGA 2ZBPA 1C0TB 2OTJS 4D3GA 5KFEA 1N6QA 4L3NA 4IG3A 3M8YA 3TZXA 2B56A 1NGAA 5GMDA 4JKFA 1H2VZ 3S01A 3S8SA 3TAGA 2C22A 1E4GT 4R8UA 4EP4A 3KLGB 2BKPA 1TUGB 1OS5A 2C2KB 3NAEA 1W9HA 2LXUA 1SH0A 1CLFA 2ERRA 2P9LA 3N6LA 1N34F 2FSJA 5DO2A 3GSIA 2JOQA 4DHYA 2YPYA 3RUBL 8ATCB 2VPWB 2CFXA 4NEZA 4LH5A 1PJ7A 2UXDF 2CH5A 4CD3A 4DV6K 3QJPA 3V4IB 1RTDA 2P5VA 1J53A 1TYQA 1P27B 3A5OC 4RWTA 1SJ4P 3GIMA 3R2CJ 3BR8A 5IM0A 4AL5A 4DTXA 2VZ9A 4RBUA 4CTAA 3A8YA 1IQZA 4HTIA 2ZC3A 5E3AA 5ETQA 3IWNC 4YOVA 3JSMB 1YVFA 4J91A 4HHHA 2CNOB 3VEXA 1ZBTA 3TYTA 2ZZNA 4F9OA 4L3QA 5EXWA 4ICLA 2ZFHA 4R0JA 2D0BA 2E88A 3AXMA 4B8CA 4M94A 4EI2A 4HEA9 5EU7A 3AJ2A 5H9FK 1S0VA 3V9UA 1BCOA 2AX1A 1FERA 4LR9A 3EE9A 3QPIA 3OTOF 3JS9A 3SCKE 1VAZA 4M7YA 1QVGM 1F9EB 3FMWA 2DHXA 2GGPA 1R6VA 4MDAA 3THXA 4CK2A 3R7NB 4KHNA 2I0XA 3L95X 3IM9A 5HANA 2CJ9A 2MLZA 1T9VA 4AM7A 3BF3A 3GZ7A 1L5UA 4B3MK 1X4AA 4M5IA 2DNMA 2QK9A 1ESVA 4USMA 4OFZA 4NWBA 5IQQA 4EBEA 4K5SA 5HMYA 3T5LA 2ZUAA 4KJIA 4WFAL 2KN4A 3SUPA 2IMWP 1XQSC 1R0BG 2RH3A 4MIBA 4OHVA 1NWKA 4B3SF 5AQTA 1VQPS 1S0NA 4KPCA 3N5FA 4B9MA 3UNYA 2JL9A 4IQXA 2NNWA 2ZD1A 1NB2A 4CJ4A 1XNQJ 5IWAF 4PRFA 2W25A 3Q23A 4JI3F 1C0GA 2EC0A 1FJEB 1WEYA 2KFZA 1LNQA 1L3SA 4CGHA 5M1NA 2RIJA 4H0PA 5HMZA 2U2FA 3EZ5A 4MMOA 2HNDB 3CERA 1K73T 1TZ0A 1GMWA 1UFKA 3CE8A 3DLLQ 2CQ1A 1SI9A 4GO5X 3M1VB 3L7OA 2HAIA 3LP2A 1KDNA 5AQOA 3GPAA 2EI5A 2VF3A 3PR4A 4RTFD 2X51A 4RW9B 2AYEA 1FRIA 3VGSA 2QA1A 2M88A 1N32J 1VQ4S 5IXUA 3IM8A 3BH7B 1ICEB 4DL4A 5GAEU 2ZJQL 1HNVA 4DCPB 4BR2A 2HBLA 3V6DB 2M4MA 1REVA 1VRQC 4DPYA 3QO9A 3BZKA 3ULHA 3KHGA 4I56A 1XR5A 4CF2A 5T7BA 3ZZPA 2W8LA 3QWPA 5J1PA 1BUXA 4CZLA 1RTHB 3FEYB 2FC0A 1T6CA 1NRKA 1F9FA 1RI7A 4E1NA 3VAMA 3VQ5A 2WONA 1GFWB 1NPKA 3SQ4A 1FD2A 2X1BA 5JMNA 2DRBA 1TTHB 4FKYA 3HM8A 3DYAA 3QLHB 4FF2A 3CMQA 2EFVA 1RWUA 3QJJA 1YX2A 2LEAA 1FTCA 1SZ2A 1F0XA 3ATVA 4RNOA 5D0RA 3C2PA 5I3UB 5BR8K 4YOWA 4L8RB 1WNSA 4CJVA 3W61A 1R0AA 5DM6Q 4N76A 2RF2A 3EJMA 4ZJQA 4IR1A 3O3FA 2YKOA 3CC4N 4AQYK 4JI7K 3KJVB 1RCXB 2VQFJ 1TELA 5EY4A 3VMFB 3AQOA 2DISA 3CO9A 3UKRA 2FQQB 3ENQA 2VBWA 2V4JA 4ZK7M 3Q83A 3G8TA 2AF6A 3KUGA 3HBTA 2Z0GA 2FC9A 2ZM6K 3N6NA 4HUFA 5KT2A 4CJWA 4UZCA 3O6QA 2DTJA 3RRKA 2GX8A 4UT4A 1JLCA 2PY5A 2LKZA 4OYBA 3L2WA 4MFBA 4LF1A 3J81j 1FXRA 4LF7K 4KAIA 2ZBIA 4ES2A 1I1GA 3OR1A 1SAZA 1MWMA 1SC3B 3TTCA 4CD1A 4NZ7A 3CD0A 1ATRA 3BKTA 3QB0A 4A61A 4DQ8A 3IRXA 4Y34A 1S1TB 4DV5J 3WNHA 4EO6A 1V4SA 1CJKA 4K25A 4XAKA 1I94F 3HCXA 2VG6A 2IC3B 5LL6Z 5KGWA 2BR0A 4CIGA 5DETA 2KHDA 5CYJA 3HHDA 3NNAA 1VFJA 1P9QC 2HHPA 4IDKB 1ELOA 4I1TA 2Z30B 2OMLA 4F36A 1WOOA 1OPZA 2EEYA 4PKHA 2J7UA 3VQ9A 2HS0A 2Q66A 2BMBA 1X9SA 1WG1A 1TMMA 2VQEF 2V2KA 3KYLA 5CD4H 4JN4A 3VTIA 4F4YA 2DGXA 4GV9A 2YKAA 2FHJD 2NREA 5CY4A 1A5VA 1M90O 4I6AA 3NF7A 4LF2A 4LSLB 1NGCA 3BV8A 3NEKA 2WOMB 5KI6A 4QYZJ 1BA1A 1F6TA 1T9UA 4CJQA 2MQQA 2AZ3A 4MTPA 4H0YB 1MWKA 2FDNA 3SI8A 2V9WA 4NLGA 3L6QA 2HZCA 4KI6A 1R8AA 3E9PA 2UUTA 2R7WA 1E6VB 1N34K 4A59A 3NAIA 5DLGA 4FLZA 3LALA 2GBZA 1OYDA 1HW8A 4J9PA 4WYBA 4LSNA 1BE4A 2M5YA 1BQMB 1VSLA 4JD2B 2UXDK 1RT6A 3I5AA 4TYAA 4U8VA 1AT1B 2C3PA 3WNEA 2IVMA 1NAQA 2VJVA 2NRWA 1PAUB 1CJTA 1TUVA 1VSEA 1CS4B 1RTIB 3IS9B 2Y1LB 1O1WA 1VSHA 2HFUA 2EFGA 3C6TB 3OW2R 1AXQA 2MB0B 4A8SA 4QR1A 1JLBB 3FFKB 3CCLS 4WFBL 3VCDA 1KFSA 4NASA 4B1XB 4NI2B 3OTOK 2HHTA 5E3CA 4ID8A 3JQKA 2AU0A 3QGPA 4Z2XA 4TLRA 1FK9A 3OYAA 1IR0A 1BCMA 2A6AA 2H5JB 4QPXA 2ALYB 3HPGA 3CJQA 3KK7A 3KK3A 4WTOB 3N6MA 3CJCA 3NCPA 2KG1A 1NBWA 3LGMA 4BE2A 3PO4A 3OJSA 2GEMA 3KKRA 2R7OA 3T1HK 4LF6K 4JS5A 2IVNA 2HB5A 4OYAA 2XLKA 2UUCJ 4ZPWR 4B3SK 1N52B 2JWKA 1HWJA 4U7CA 4JI2J 1O5JA 1DZ5A 5IWAK 1WB9A 2DNKA 3VAJA 1VBKA 1S99A 3UDEA 2HIYA 4ISEA 1RLCL 4FJKA 1YTUA 4DR2J 2J0WA 2ZOGA 1EIYB 5DGAA 4IG0A 2XGPA 3FBFA 5TKWA 2QTDA 1IJJA 4H4OB 3H0PA 2YJFA 2E1PA 4EIAA 1JB0C 4ISFA 3GIKA 2XEXA 4IFYB 5GINA 3NGKA 2NRVA 4LY7A 2NSCA 2P8IA 4KBOA 4MIWA 2IY5B 2IRUA 3EUNA 4DPOA 3L9ZA 2R8HA 3OA9A 4KYZA 4ZHRB 5KPTA 1DY3A 3PEHA 2UUAJ 5IQ6A 3N4PA 2N4CA 4HKQA 2KDOA 3N28A 4BWMA 4HTLA 2HQGA 4CGGA 2JGUA 2X74A 3G8QA 1GLFO 2WW4A 1JCGA 1FJGJ 3BN7A 4USUA 4B3TJ 5F1XA 2O1PA 4MYUA 3R27A 2E29A 3RMDA 2HFZA 2IDLA 3AB4B 2MZ1A 4AUKA 3PRBA 3D6FB 6FDRA 5KFOA 1JLFB 5BR9A 1GMUA 3EGNA 1KN6A 1OSDA 4QAGA 3CDAA 5CQGA 5HL7Q 2D9PA 2ASOA 3LP0B 2NS1B 3BO2A 1IBKJ 1SJFA 4B02A 4FF1A 3OBWA 4R0EA 2MMYA 2PZSA 1VOMA 4XDCA 3KLIA 2OPSA 3M2RB 4OX9F 2A42A 5ADZA 3KG4A 1SKSA 3PFEA 3SDEA 1WSHA 4W5OA 3OXGA 5SUHA 5KFCA 2G4BA 5D78A 4K0KJ 3CJ5A 1LW2B 4F0KA 4QR2A 1ASWA 3H1VX 1UWAA 2PFDA 4GKJF 2G1HA 1KOHA 1DKGD 2QLFB 4IJAA 2HURA 1NGEA 3I82A 1J54A 3L2UA 4WE1B 5GAGI 3OUYB 3DRXA 1KQGB 1SXLA 4ZIVA 2BE2A 4GVMA 2Z1HA 3GTYX 1EETB 1VQYA 4KFBB 4KREA 1WORA 1EKEA 4CFBA 3M05A 4RLEA 5BYQA 1SQEA 4ZVPB 2XLIA 3EPIA 1Q9YA 1QJHA 5EN1A 4NX9A 3BGRB 3G8SA 3DGVA 3C19A 2NSBA 2HBQB 1Y7PA 1IM4A 4LT6A 2PD1A 5LMUJ 4DMNA 1TK5A 3ZT4A 4YMEA 2CVIA 2CJKA 2IVFB 1NMNA 4BC2A 3QEIA 3O9RA 2XM3A 4OLOA 1VQ5N 2LMIA 3NRBA 4KHPJ 1EXQA 1QDUB 3TWZA 1F1BB 1Y0HA 1JL2A 1NXIA 2Q43A 4IRKA 4BR9A 4DV0F 2E7WA 5BRHA 2KVQE 4GVBB 1JLAB 1TU0B 4A2AA 4LRCA 4MLHA 3TAMA 3AQPA 2Z1GA 3N4QA 3KLHB 2GW8A 3SYZA 3ZZZA 2FYXA 2LYVA 4M3RA 2YJEA 4OI1A 3ID6A 5IT0A 5M1FA 4DL6A 1T44A 3ZTOA 4I6MB 3ULEB 4YHHJ 4LFBF 3GV5B 1FEHA 2MHNA 2X3GA 3N4WA 3CC4S 1JMTA 3VGUA 4WCEL 3LZJA 2MKKA 1X5OA 1U48A 3S3OA 5FRMA 2MQMA 2IVYA 3O3HA 1H6KX 1LK5A 3CIZA 3PX6A 1UA1A 1CG2A 5A8RA 5C2DA 4YB6A 4FW1A 5E7OB 4CI6A 3SSSA 3NCIA 1BQNB 2DJWA 1HRHA 1HBNB 2FBVA 3H98A 3S6EA 5AQYA 1B0PA 3VQCA 2CQGA 4YDDB 1RAFB 4RJVA 4M3ZA 2B3TB