1RT3A

Azt drug resistant hiv-1 reverse transcriptase complexed with 1051u91
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
536
structure length
520
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title 3'-Azido-3'-deoxythymidine drug resistance mutations in HIV-1 reverse transcriptase can induce long range conformational changes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 135
structure length 520
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt3A05
1TKXB 3VQPA 4MKAA 3BDPA 2J6TA 1D1UA 2FBXA 2XC9A 3SI8A 3HVWA 4F4WA 3QEPA 4DFMA 4IR1A 3KKSA 1YVUA 3TQ1A 1QQCA 4ZPBA 2OYQA 1NK9A 3LP3A 4CGFA 4CFBA 2AGPA 2WHOA 3LP2B 3DLKA 3T1AA 2B6AB 5C5JA 2X6SA 3ZT4A 3I5AA 2D7SA 3IRXB 4IKFA 4ECUA 3BREA 2ZD1B 4LH4A 4K50A 2G8VA 3LP0A 4DFJA 3MXJA 4ZVHA 4KTWA 3JSMA 2CJQA 1JLAA 4RW9B 3LALA 2VG5B 3M8RA 2ILZA 4CJWA 1NHVA 3PW0A 3UPFA 1JXBA 4J9QA 2RKIA 3KK1A 2IM0A 1RCHA 3OHAA 3KLHA 3DLGA 4FJNA 4K8ZA 4CF0A 1KVCA 2DTUA 3VQSA 4C8KA 1KFSA 1B92A 2DFFA 4FJGA 5KGWA 3GV5B 3BR9A 4H8KA 4O44A 1EP4A 1WNSA 1TV6A 2Z1GA 3BJYA 3ZCMA 5HBMB 3KLGB 3OS2A 4DG1A 1QSLA 4EEYA 1TK0A 4RW6A 3SI6A 5FRMA 1S5JA 2D3UA 3CM6A 4RW8B 1R0AA 1X9SA 1SV5B 4DU1A 4M3UA 3P1GA 4ZVEA 3RR8A 1T05A 4OGEA 2HNDB 3OS1A 4Q44A 2W7PA 1C6VA 2VWKA 3CJ2A 2OPQB 5KFUA 4CEZA 3M8QB 3QIDA 3V6DB 1EETB 4DQRA 3BQ0A 4QAGA 4J2BA 1IKWA 3GIJA 3CFOA 4KB7A 1QS4A 1RA6A 1KHVA 2BRLA 4WYLA 1TL3B 4DTOA 1S1TA 4FK4A 2DFHA 3RMBA 3AVFA 3V9WA 3L2VA 3H98A 4K4WA 1L3SA 1IKXB 1CXQA 1NNDA 4FBUA 3PW4A 2R7YA 4CF8A 4DL2A 3KLIA 4AHVA 5DQGA 2ASDA 1TQLA 2WOMA 4DEZA 4EBDA 4PQUA 4FJ9A 3AVAA 4IDKB 3G10A 3MAQA 4DF4A 3MECA 4ZMMA 1RT3B 1RTIB 3VA0A 2DFEA 4HTUA 5DG8A 2YNGA 2VG6A 3ZSYA 4FLTA 3QNOA 4O3PA 2Y1IA 3SPYA 1RNHA 2JC1A 4CIEA 1HMVB 4CFAA 4GVMA 3DLEA 5KG7A 3L2QA 3D28A 4DMNA 1RBUA 1S9GA 1RT7B 3VQ7A 2HB5A 4URGA 3SUOA 5KFJA 3PZPA 3VQ4A 3T5JA 3KHRA 2PY5A 4KHYA 4G1QB 2V4QA 3VQ5A 1S6PB 1N4LA 5C25A 3RWUA 1RDBA 1N6QA 1S1WA 3KJVA 1UWBA 4KPYA 5D3GB 2QE5A 3NMAA 1JLBA 2ZKUA 4K4YA 2QK9A 3MR5A 3JYTA 4R0EA 3K2PA 1S4FA 4E7HA 3MEEB 3BSAA 4ZP8A 3TR8A 5KFRA 1U45A 3EZUA 2FBYA 4MIBA 2W7OA 2KFNA 4IR9A 3TWHA 1HQEA 1LAVA 4FM0A 5KFBA 3OJSA 1QSSA 3I0SA 4IKAA 4MQ3A 4H4OB 3K57A 3K5MA 4CHOA 3OL6A 2AWZA 1IKYB 2G8FA 4JV2A 4FLUA 5F9NA 4DL6A 3OYJA 3BSNA 3C6UB 3NGZA 3ZT2A 2E6LA 2G8WA 3NCIA 3DYAB 1C1CB 1WSIA 4CEEA 1S1UA 3DMJA 5F8NA 4KHNA 4RU9A 1TAQA 4FYDA 5EWFA 3O4NA 2DY4A 5DLGA 4NLSA 3OYHA 1DLOB 2F8EX 2HHUA 4O55A 1J9AA 5KG0A 4F50A 4J9NA 3HK2A 4C8LA 1S1VB 1RT4A 3DRRB 2GIQA 2HHTA 5C42B 5F8GA 3ZSWA 3AVIA 1LW2A 5J2PB 3NKYA 3MEGA 4RW7A 1Y97A 2E6MA 4B8AB 3NGYA 2FVPA 5DK5A 1WSHA 5FDLB 4FJIA 4M45A 3ZT0A 3QEWA 1NK4A 1C0UB 1YTUA 3HO1A 4FJLA 3QEIA 1JLCA 4K4UA 3E01A 4I2QB 3HM9A 4KRFA 1XR6A 3NH2A 4ECXA 3S3NA 3CVKA 2R2RA 4BWJA 4IRCA 2D3ZA 2HHSA 4IG3B 3LZJA 5I42B 1S0NA 4L8RB 1XHZA 1F21A 1JLQB 4CHZA 4ID5A 4DTMA 1FKPA 4WFZA 1T03B 1JLFB 4CJKA 3MF5A 3VQBA 3AVMA 3CO9A 4OKJA 1S97A 5DMRA 1RDCA 2AQ4A 2OPRA 2R2TA 4CHNA 1TGOA 3K5LA 2XGQA 3PR4A 4FM2A 5JUMA 4ELTA 4NZ0A 4HCBA 4CJEA 3SPZA 3MXMA 4NLUA 4B3OB 2A1RA 4IOBA 3C95A 4WXOA 3SZ2A 3DLHA 4Q45A 4TLRA 2QXFA 5KFYA 3V6KA 2B43A 5EUHA 3NBPB 1CLQA 3V4IB 4EYHB 4CJSA 3QGHA 1TVRA 1VRUB 5EWEA 4DLGA 4FJ8A 4HUFA 1TP7A 4LSNA 3I5BA 3UR0A 3NAHA 3G6VA 3TANA 3LPTA 4I2PB 2FJVA 3SUNA 1T3NA 4Y34A 4DSLA 5HROB 4WZQA 1RBVA 2FVCA 3HT3A 2OH2A 3V9UA 5FROA 2IC3A 1NK6A 2BE2A 1BIZA 1WSEA 4ZVFA 3OS0A 2XY5A 5I3UA 4E7LA 2P5GA 5HLFB 4GMJB 2XI2A 4ECYA 3KMSA 4ZP6A 3V6HA 1U04A 4CE9A 4FVMA 4CIFA 2JLEA 2YNIB 1MMLA 2VG7A 1JL2A 4WYWA 4DQPA 3DM2A 1Z25A 5KFGA 4O3RA 2OPSB 4WZMA 3CM5A 4TQRA 3QEXA 4NCGA 4YQWA 4ICLB 3IAYA 2FC0A 4DTSA 1VSEA 2BANB 3S3MA 1HNVB 2HW3A 5KG1A 3QETA 3TAEA 4ECTA 4FJMA 4Q0BB 2WCXA 4FBTA 3FDSA 3V9SA 2D5RA 4JV0A 4YFUA 1TK8A 2J6UA 2LSNA 4AHCA 4XPEA 4LH5A 3LWMA 2ZE2B 4TY9A 4J9SA 3FFIB 4J9LA 1BGXT 4PWDA 1RT5B 4CEBA 1TKDA 1HQUB 2R8JA 4C8OA 4ZHRB 4RNFA 4KAIA 2AGOA 3L2WA 3QGGA 1NJWA 4E7JA 4ECZA 4IG0A 1HNIB 3KHHA 4BE0A 4KHWA 3EYZA 3IGVA 4ID1A 1ZYQA 1TKTA 1JXEA 4O5BA 5DGAA 4CF2A 3EPIA 3H40A 4ED6A 2IAJA 4F4KA 1S9EA 1JKHA 2FJWA 2W8KA 1HARA 4KV8A 5KRTA 3K5NA 1RYRA 4O4RA 4CJ4A 4BDPA 3SYZA 3NF8A 3VQ8A 4B9LA 2KFZA 5SZTA 3SQ1A 1SH3A 3SFGA 2HVIA 2XCAA 5KG6A 1J54A 4DTXA 2R2SA 3V81B 3DRPA 1ZTTA 3DRSA 4KTZA 1RTJA 1NJZA 1X9WA 3JSMB 3F9KA 2HNYB 1XR7A 1RT2A 5L1JA 1EXQA 4ECWA 2UUTA 2FLLA 3AO1A 1LW0A 3KK1B 2XY6A 4AH9A 2XHBA 2RN2A 3CFPA 5KFSA 3T3FA 1T8EA 4NLOA 2F96A 3THVA 4O44B 1EP4B 2WK4A 4KI4A 3H59A 1RTHA 5L1IA 3ZSZA 1NHUA 3OVNA 2XGPA 3KLEA 4DL5A 4LSLA 4DG1B 2IM3A 5J2NA 2PYJA 4CF9A 1TAUA 3SFUA 1LWEB 2P1JA 4CK1A 1T05B 3Q8RB 2IOCA 4J9KA 4M3YA 3UDLA 1S6QA 3CFRA 4JRQA 2W9CA 2GIRA 4FJ5A 2RDIA 5L1LA 4K4XA 3SCXA 4CK2A 4M3TA 3AO5A 2YKMB 3CJ0A 2UVRA 2Z1JA 4KO0B 4CEFA 5KT7A 2YKNB 1S1TB 2HHXA 4FS1A 3DOLB 2XI3A 4CJQA 4FS2A 4W5RA 4RUCA 1BQMA 5CYQA 4M3XA 4ZVGA 3OYEA 4K4VA 5KFIA 4Q5VA 2UVWA 4RW4A 2O4IA 3IG1A 1XC9A 2ASJA 4PQUB 3SNNA 4G3IA 2I5JA 2IJNA 1XHXA 4DSIA 5KFQA 4O0JA 3DLBA 1S1XA 2RF2B 3CJ3A 4IFYA 4U7CA 3AA4A 2YNGB 4LD0A 1FK9B 4IBNA 3K59A 3MEDA 5F8HA 1ASUA 4Z4IA 2AJQA 5J2MB 4HKQA 4KI6A 5J1EB 2IDOA 4J9PA 4WFXA 3TARA 1U4BA 4E19A 3MR6A 4O4GA 3TAFA 5KFVA 2YNHB 2CKWA 4ZP7A 4KB1A 1TKZA 4IH6A 4IFVA 5K14B 4OVLA 4CJFA 4N76A 2JEFA 4ZTFA 4CFCA 5C25B 1RYSA 1N6QB 4PUOA 2XY8A 4QOZB 1K1QA 1UWBB 3CG7A 4KE5A 2HWIA 4DSEA 3JYTB 4FLVA 4I9LA 3KHLA 3GIIA 4TYBA 3PW5A 3UQSA 1SUQA 4EP4A 5T14A 2GV9A 3BSOA 3LWLA 3TI0A 4O0IA 2X74A 4M41A 1HPZA 3WNEA 1REVA 5HRSA 4EZ9A 1Q9XA 4FJ7A 4NCBA 1IM4A 4NLVA 2GUIA 3RBEA 2FBTA 1WN7A 3OL8A 4MK7A 4ZP9A 1C0TA 3LP2A 1D9DA 3CDWA 4K4TA 4KB0A 4CJUA 2AU0A 3M8SA 3TABA 3L2RA 3N6MA 5HP1A 3QLHA 1W9HA 1SKSA 1LAWA 3V1OA 4FK2A 3ISNC 3U3GA 3O3FA 3AVCA 2BQ3A 2OPPA 5F8LA 2VA2A 3KLFB 2XO7A 1LW2B 1MU2A 2F8TA 4FZZA 2D0AA 1QSYA 3TVKA 5KFAA 4FLWA 3PHEA 3T5KA 1RTDB 3KK2B 1ZBFA 4W5TA 5HBMA 3KLGA 4KSEB 3BQ2A 4J9RA 2IM1A 4PY5A 3SUPA 2C28A 1LWFA 4H54A 3HP9A 4ZPDA 1SV5A 3PO5A 2D0CA 1HYVA 2AX0A 3HPGA 1HRHA 4ZTJA 1D5AA 3GV8B 1ZBIA 5JXSA 4CESA 2OPQA 3NAEA 3M8QA 3ISND 3V6DA 1RBSA 1BQNB 3RMAA 5FRNA 3VA3A 4AHRA 2F8SA 1W25A 3H08A 2W42A 3C94A 2OPRB 3AA3A 4HCCA 4B8CA 4ED0A 3QGIA 3KHGA 3KK3B 1TL3A 3C6TB 4TYAA 1RILA 2EC0A 3NL0A 1DTTB 1J53A 4CHYA 1IKXA 3GILA 4J2AA 3RB3A 1K6YA 4R5PB 5KFEA 1WSFA 5L1KA 3H5YA 2B5JA 3TAMB 1YT3A 2W9BB 3AVLA 4IRKA 4XIUA 5C24B 4FLZA 4KKOB 2JEGA 1S48A 2A1SA 1NKCA 3M9NB 1DTQB 3PUFA 4CECA 2PYLA 4DFKA 2FJXA 1HMVA 4NLYA 4DSJA 1HYZA 1KHWA 4ELVA 4NLDA 3SQ0A 1UA0A 1RT7A 1NJYA 2IC3B 3I0RA 3NH0A 5KG5A 1U09A 1GOAA 1U48A 3P83D 3QIPB 2WONB 1S6PA 3BSCA 3MXIA 5KFXA 3BGRB 2IBKA 3H2LA 4IQXA 5D3GA 2WRMA 4I7FB 4RG8A 3Q8QB 3NGDA 5KGXA 1O1WA 1SL1A 3OY9A 5F8JA 4EZ6A 4DSFA 2ALZA 4N41A 4H4OA 3KLVA 1QE1A 1C1BB 3FQKA 5DG7A 1N5YB 4E7IA 2BGGA 3RR7A 1B9DA 2ATQA 4Y2CA 2ETJA 1SKWA 4B9NA 2AX1A 3C6UA 3UIQA 1IG9A 1S9FA 5HRNA 1VSJA 2KZMA 2HHVA 3DYAA 2HNZB 1C1CA 2EX3A 4RNHA 1NOYA 3M9OB 3HJFA 3OYIA 5KI6A 4ELUA 2V0NA 3DOKB 5KFKA 1DLOA 1S0OA 4CFDA 4NYNA 3HPOA 3QO9A 3OYNA 1S0MA 3VQCA 2FLPA 1Q8IA 3KMQA 1S1VA 4YR2A 1VSKA 4W5QA 3KOAA 3M8PB 3WNFA 5JS1A 4CCHA 1CXUA 4H4MB 4Y2AA 1ZBHA 4AILC 2Z1IA 3NAIA 4YR3A 5HRRA 5KT5A 4TY8B 3SQ4A 4Z4CA 5J2PA 5F9LA 1FXXA 4FJKA 5KFFA 2JC0A 1TKTB 1C0UA 2V4RA 4QWDA 1UOCA 1LWCB 1GOCA 1RDDA 4EP5A 5JS2A 4DF8A 4OKKA 4KV8B 3MFIA 2DPIA 3SUQA 4I2QA 3GYNA 4Z4EA 2IM2A 3OSNA 4JV1A 4DTJA 4KHSA 1B9FA 4KFBA 3IS9B 3H5SA 4MFBA 4IG3A 1A5VA 1IKVB 4FM1A 2E4LA 4E7KA 3DRPB 1RTJB 3F73A 1QTMA 3O4QA 4DL7A 4UQGA 2ZQBA 1T03A 5KFCA 2BQUA 3ALYA 2R2UA 1JLGA 3AVJA 4JLHA 3CYMA 4Z4GA 4NLWA 3CQ8A 1LW0B 2WTFA 3OYBA 1KCFA 4F4ZA 4LQ9A 5F8MA 4DQQA 3DI6A 1GOBA 1NJXA 4WE1A 4IH7A 4MH8A 1N56A 4N56A 5KT6A 4FZXC 1XWLA 4J2EA 2I1RA 3CJ5A 1QAIA 4N5SA 1RAJA 1RTHB 1ZBUA 2XCPA 4JS4A 4B3OA 2VA3A 4CGJA 3OYDA 4DFPA 3CDUA 4U6PA 5KG4A 1RT1A 2BDPA 4JRPA 3HVTA 3NBPA 1FKOA 3V4IA 3I5CA 4QW9A 3Q8PB 2OZMA 4M95A 2YV0X 4RW7B 5CYMB 4ECRA 1VRUA 4NRTA 5KFWA 4B08A 4DWIA 4DL4A 1S6QB 3IN5A 4I2PA 1BI4A 2W9CB 3NDKA 2IMWP 2YHBA 4NLQA 4XPCA 3PJXA 2R8KA 4FXDA 4BDYA 3MR2A 3ITHA 3DLKB 3G6YA 3G0ZA 4Q8FA 3H5XA 4OGCA 4FJJA 5KFMA 2UVUA 4OPKA 3LP0B 1EX4A 1RT6A 3DDKA 4KBIA 1JLAB 1BQMB 4ZPAA 2HMIA 1KRPA 4TSXA 2Y1JA 2YNIA 4KHQA 1VSLA 3IG1B 3ZSOA 3WNHA 3CIZA 1QHTA 3BQ1A 2P5OA 2RKIB 4X2BA 4ECQA 1RDAA 1NKEA 4MK8A 4B9UA 3KLHB 4B9SA 3DLGB 5DG9A 3EPGA 3QESA 1S1XB 4IFYB 2E9ZA 2HAIA 4QWCA 4R8UA 1WLJA 2C2EA 3ICLA 4M3RA 1KSPA 2HWHA 1TV6B 1KLMA 2E9TA 1NK0A 4AHUA 2QKKA 4J2DA 4B9TA 3K5OA 4O4GB 3O3HA 4Q0BA 4RW6B 2ILYA 4WFYA 1TKZB 1S49A 3AVNA 1R0AB 3KKRA 1VSFA 2ZE2A 3ZSVA 2BRKA 2Q3SA 3FFIA 5J2QA 2O5DA 2ATLA 3EZ5A 4GW6A 4ED3A 3OLAA 1RT5A 4F4YA 1XI1A 1HQUA 4O3NA 2V9WA 3Q8SB 4YNQA 2UVVA 2XRIA 1RBTA 2D41A 1SUQB 2HHWA 1VRTA 3LDSA 2ASLA 3RRHA 1NK5A 1IKWB 5KFHA 3AV9A 4AHTA 5EU7A 4CHPA 1HPZB 3PJWA 3OSPA 3PO4A 1REVB 4CJPA 1I6JA 4M94A 1SKRA 1Q9YA 4W5NA 4NLXA 4TQSA 3T19A 3OYKA 4O3QA 2PZSA 4RNMA 5E41A 4Y1CA 1C0TB 3QIOA 3KLIB 4KHMA 3L2UA 1T7PA 4HHTA 2WOMB 1RA7A 4QW8A 3V81A 1U47A 1TL1A 4OL8A 5HP1B 3LZIA 3QLHB 3MECB 2R8IA 1BHLA 3NFAA 2HNYA 2VG6B 4OLAA 2FVRA 3ZT3A 4NCAA 2OPPB 3RB0A 2KZZA 3DLEB 4B9MA 3B6PA 1JLEA 3U6FA 1S9GB 3DLRA 3B6OA 1KTQA 4K8XA 1SH2A 1MU2B 4EYIB 4CJVA 3GV7B 3L3UA 3VQAA 4DL3A 1JXLA 3ZSQA 1NKBA 3LP1A 1S1WB 2RPIA 3QNNA 2YNFA 3KJVB 3AVBA 4Q8EA 3TAPA 1VSMA 1JLBB 1BIUA 3OYFA 1J5OA 1KFDA 2XWYA 1RDRA 3OLBA 1HYSA 3T5LA 3K58A 1LWFB 1KVAA 4FLXA 4Y3CA 1HQEB 4YP3A 2FVQA 1TKXA 4ED2A 3I0SB 1LWEA 4NLPA 3GQCA 2X78A 4KTQA 1N48A 4W5OA 3HYFA 3PVXA 1NOZA 3H5UA 3SV3A 3OYAA 4F2RA 4K4SA 3HKWA 4ECSA 1L3VA 4ED1A 4CJTA 1WAFA 2YKMA 2J6SA 4KHUA 2B6AA 1S1UB 3DMJB 4KAZA 4KREA 1D8YA 2AGQA 4KO0A 4DQIA 3IRXA 2YKNA 2ZD1A 5KFPA 3AVHA 4ZPCA 5CZ2A 1SH0A 3DOLA 3RMDA 5KFOA 4NYFA 3CJ4A 4GC7A 4RW9A 2VG5A 4C8NA 3HP6A 3RBDA 3NH1A 1RT4B 5KTQA 4HVJA 4DTUA 4RNNA 1CSJA 1CZ9A 4BACA 2B5JB 1XR5A 2RF2A 4CJ3A 3MEGB 3I8DA 5DQHA 3SJJA 1VSHA 4CJRA 1FK9A 2D0BA 2GBZA 3LANA 4FW2A 5J2MA 1GX6A 2E9RX 5J1EA 1JLCB 4HYKA 3E01B 2YNHA 3I0RB 4RW8A 4F3OA 5K14A 2KQ2A 3FQLA 4HUGA 2G8HA 4AHSA 2BQRA 4CK3A 2HNDA 3AO2A 3QYYA 4CGDA 4ID5B 1FKPB 2JEJA 3NGIA 4ED8A 1EETA 1C1AA 4J9MA 4Y1DA 1Z4UA 3PR5B 2RDJA 3D5MA 1QE1B 3KIOA 1D9FA 2JGUA 4Q43A 3L3VA 4QWEA 1JX4A 4JUZA 1TK5A 1ASWA 1BL3A 4YMEA 2R8HA 3PX6A 4TXSA 4CEQA 3TAQA 3T5HA 3OHBA 4QWBA 4IDKA 3RRGA 1RT3A 3VQ9A 1RTIA 2OZSA 1VSIA 3QO9B 1TVRB 3EY1A 3NF9A 3ULDA 4LSNB 4CJLA 5DLFA 4DTRA 5KFLA 4BE1A 3MTKA 2FBVA 1L3TA 4EO8A 4WXWA 4QPXA 4DTNA 3KLFA 3RAQA 1YTAA 2UUWA 4RNOA 3WNGA 1GX5A 4CF1A 3VQ6A 2BE2B 1YVFA 5KT4A 4BWMA 4CEDA 4XO0A 4FJHA 1G15A 4G1QA 5I3UB 2W9AA 4CGIA 2VWJA 2IJFA 3O3GA 4O3SA 2IS3A 3E51A 1RTDA 3KK2A 1VSDA 4K4ZA 1SL2A 3QINA 3V9XA 3AA2A 3MEEA 4N47A 4CHQA 1BISA 5CZ1A 2G8KA 3RB6A 3RTVA 2VG7B 4KFBB 4NLRA 3MFHA 4FLYA 4MFBB 1UA1A 3DM2B 4E89A 4CJ5A 1JL1A 3OYLA 3V6JA 1IKYA 5KT2A 3G6XA 4NCGB 2NUBA 3V9ZA 3S3OA 1JLGB 1BQNA 5CY4A 3HVAA 3ZSXA 4KHRA 5DGBA 3V1QA 4OJRA 3ZT1A 1ASVA 3DI6B 1IH7A 1QAJA 1KLNA 4EBCA 5KG3A 3OL9A 3RB4A 5F8IA 4WE1B 3M9MB 3HXMA 4BE2A 2O4GA 3KK3A 3OYMA 4OLBA 3C6TA 4URSA 4FCYA 1DTTA 3PW2A 1WSJA 1S10A 4CGGA 5HRPA 5KFZA 4EO6A 3HVRA 4R5PA 1C0MA 4OKEA 4PWDB 5KRSA 3PW7A 3DRRA 3KTQA 1HJRA 2B4JA 1NK8A 5C42A 4MK9A 3G86A 4FK0A 3LAMA 3TAMA 2KW4A 1WNEA 1RT1B 4IG0B 1EKEA 2BR0A 4IH5A 2W9BA 3HVTB 2IGIA 3VQDA 4DSKA 1FKOB 1LV5A 5C24A 4FZYA 4KKOA 3D0PA 1A5XA 3OYGA 4BDZA 5FDLA 1DTQA 3KNAA 4I9QA 4MIAA 3QZ8A 4QWAA 5SWMA 2IAJB 1S9EB 1JKHB 1BI4B 3CWJA 2R8GA 4IRDA 3OJUA 5DQIA 3A2FA 3H4BA 5KFDA 3AA5X 4Z0UA 2OA8A 3ZSRA 3ITHB 4MKBA 1C2PA 4CERA 2HVHA 3QIPA 2WONA 2W8LA 3VQEA 5I42A 3BGRA 1K1SA 4LY7A 5T7BA 4QCLA 3DRSB 1JIHA 4I7FA 1RT6B 1JLQA 3NF7A 3FRZA 2HMIB 1ZETA 1RT2B 1JLFA 1I39A 4DU3A 4TN2A 1ITGA 1SL0A 4E1MA 2C2DA 3PX0A 4NYZA 1C1BA 4M42A 1NK7A 1N5YA 5KG2A 4CEAA 5KT3A 1WAJA 3TAGA 1ZTWA 4R8UB 1L5UA 2C22A 2GC8A 4EBEA 3CDEA 3SQ2A 4FJXA 3HSTB 3PV8A 3SV4A 1KLMB 2HNZA 2G8UA 2DPJA 3KLEB 1OS5A 1X9MA 4FW1A 4LSLB 3PY8A 4JS5A 3DOKA 5J2NB 3LAKA 1D0EA 4E0DA 4CIGA 3GIKA 1IO2A 1VK0A 5EWGA 2JEIA 1W0HA 3VQQA 3D45A 5J2QB 4URQU 4DS5A 2IA6A 2FLNA 2QV6A 2ITGA 2XY7A 3QZ7A 3M8PA 2EHGA 4H4MA 3AVGA 3U3YA 3VN5A 4C8MA 5HROA 4TY8A 2G8IA 1VRTB 3NF6A 3KD5E 3AO3A 4HUEA 2KTQA 3HPHA 4GC6A 3FSIA 4DTPA 4DS4A 3NE6A 3LPUA 3QEVA 1LWCA 4F8RA 5HLFA 3P5JA 1BCMA 2Z1HA 3V1RA 5KFTA 3MR3A 5CYQB 3NHGA 4OPJA 4NLGA 4O3OA 4NLTA 4RW4B 4ED7A 2FVSA 4DQSA 3IS9A 1X1PA 4E1NA 3KD1E 1IKVA 3H4DA 1T94A 1TL1B 2I5JB 1ZBLA 1BCOA 2OPSA 3OYCA 4Z4HA 2P51A 4DU4A 3QERA 3N6NA 4M3ZA 2YHAA 1L3UA 4ICLA 4E3SA 3MEDB 3HL8A 3L8BA 4F2SA 4DLEA 4M3WA 4Z4FA 1QUVA 1A5WA 1WSGA 2BANA 4LQ3A 1JLEB 1I3AA 1HNVA 4CEOA 3AVKA 2X6NA 3N6LA 2C2RA 1Z26A 4CGHA 5KFNA 1CZBA 4YR0A 4J9OA 4PA1A 4IFVB 4NRUA 1UAXA 3OL7A 3GIMA 4F3TA 5EDWA 2HHQA 3HHKA 2WB4A 3LP1B 4PUOB 3ASMA 1RBRA 2YNFB 3PX4A 4F4XA 4ZHRA 1U49A 4ECVA 3S9HA 4RUAA 1J5OB 2QKBA 3RMCA 1HYSB 4B9VA 3AO4A 5L9XA 1HNIA 3RAXA 3IGNA 1KVBA 4RZRA 5CYMA
chains in the Genus database with same CATH superfamily
1HBUB 5ADXA 2EXUA 4PWWA 2HWTA 3F41A 3FNNA 4P10A 4RTFD 3LUYA 3U1MA 2IIRA 3HI9A 2R7XA 4JBCA 4Z7CA 2R7RA 3PEJA 2LA6A 4LR8A 3I56S 4CFBA 2WHOA 3W2VA 1S6OA 4O5FA 1ZAXA 3GCWP 2B8QA 3MPWA 3EVOA 2D7SA 3MPVA 4TKTA 4ECUA 4WF9L 1M90T 1FD8A 4K50A 1FEEA 1LWXA 3CCEN 4X4UA 4UUWA 5I3QA 3QBXA 3M8RA 4UZCA 3LDLA 4GVBB 2K06A 2MJNA 3JXOA 4J9QA 2RKIA 1F9FA 3MCSA 1KQSM 4HH1A 3KLHA 4FJNA 2W25A 2FHKA 1KVCA 4K5RA 4LFBK 1B92A 2KL8A 5E3CA 4OX9K 1DQAA 5A6WA 3A3PB 1VQNS 5LY3A 3AJ2A 4JK8A 3KLGB 1NEEA 3NRBA 3KYLA 3OS2A 3CCSS 4HH0A 2MQPA 4LFBF 1S5JA 4RW8B 5CZXA 4X84A 4OX9F 3DXSX 1RWVB 4M3UA 1FERA 1UPMB 2B9EA 1HI1A 4ZVEA 3LQVA 4OV1A 2YY3A 1HFEL 4OGEA 3M30B 3R5GA 2W7PA 3BGFA 4ZCIA 5LJWA 2OPQB 4ZIWA 3OTDA 4Y0WA 1QAXA 1T9YA 1AROP 1EETB 3S01A 2Q2RA 4J2BA 4KB7A 2MTLA 1YK9A 2RB7A 2V4JA 1S1TA 4CZHA 2QN6B 5EX0A 2DFHA 2GQQA 1OJ4A 3VEVA 3L2VA 3H98A 4K4WA 1L3SA 5L46A 4V19X 1NNDA 2NXJA 2COLA 4CF8A 2K1RB 1TQLA 2MQNA 2L9DA 2OSRA 4DEZA 3CJQA 4EBDA 5ADZA 3G10A 2CGKA 5M1KA 4DF4A 4DUTA 5AT1B 5DG8A 1RGVA 4FLTA 3QNOA 3Q86A 2PO4A 3FMBA 3VTIA 4PG4A 1HMVB 4OLOA 1HNXJ 1Y10A 3WHIA 1RBUA 1RT7B 2HB5A 4GKJK 2BACA 3VQ4A 3T5JA 3OHRA 2V4QA 5FPMA 3FR0A 5C25A 3RWUA 3FZMA 3OW2R 3W9JA 4F7VA 1JLBA 2QK9A 4GKJF 4ENOA 4R0EA 5BYQA 4O23A 4YY3K 2BYCA 3TWHA 2CPZA 2WTUA 5CD4H 4PXEA 3CMES 3OL6A 2EK6A 2YHYA 4HI1A 1M5SA 4YY3F 5ETOA 3OYJA 4HACA 2E1AA 3A3OB 3NGZA 3W63A 2ZGZA 3ZT2A 5AXLA 1VFJA 3DYAB 1WSIA 4CEEA 5AQIA 1RDWX 5F8NA 2DY4A 3OYHA 4OFZA 4AD6A 1RQ0A 1J9AA 3TSPA 3C8YA 2JSXA 3EE3A 1PAEX 1WBDA 1S1VB 1M90O 3HLUA 2V2ZA 3ZSWA 2W24A 2HGLA 1VQLS 2WB1D 3NKYA 3MEGA 1Y97A 2EFNA 3CJTA 3U9DA 1AUSL 5DK5A 5JLHA 1PO6A 3W61A 3QEWA 3ZT0A 1VQ8N 1EHWA 3HO1A 3CI5A 3QEIA 4YB7A 3IC1A 4K4UA 1AW0A 1FO1A 1XBWA 2C2ZB 2AYBA 1XR6A 3NH2A 4OX7A 2XSFA 3WXIA 4A2BA 1OKJA 3CVKA 2HS0A 1ATNA 2D3ZA 3LZJA 2IRUA 1S0NA 3D68A 2IRXA 1D9AA 3Q22A 3QT6A 1UJ5A 2AP6A 1H3DA 3AQOA 4ID5A 3TWZA 2I6WA 1JLFB 3T7ZA 3AVMA 1W97L 3CO9A 1UZDA 1OQ3A 3GYXB 2VOPA 5DMRA 3EX7B 3J81j 2R2TA 2PEHA 2GFFA 1TGOA 2NXNA 7FDRA 1RB0A 3J7AP 4RUBA 3B8AX 1N52B 2KJWA 3SCKE 2CH6A 3RZAA 2DNQA 1AT1B 4B3OB 1NCLA 4KIAA 3C95A 5BRDA 1FDDA 4FYXB 4WP8A 5KFYA 3UKUB 3V6KA 2B43A 3UD4P 3QRQA 4BG9A 3EUNA 4EYHB 4CJSA 3QGHA 2BJEA 1FCAA 1RI7A 4FJ8A 4CBWA 3TP2A 4LSNA 3I5BA 2GA7A 1U2VA 2NR0A 2HFVA 3PYEA 5DDRC 3FBEA 5E7OB 1XEZA 2JLGA 4LR7A 1RBVA 4IQMA 5L39A 2C3UA 2BE2A 3NEKA 4M5DB 3A5OC 3FCVA 4ZVFA 2XY5A 1BIZA 1B4SA 3VGKA 3M1VB 4V19J 4B3SJ 2P5GA 5HLFB 1NMDA 3TJ8A 2F4FA 2IRYA 3KMSA 2AEFA 4ZDNA 4CIFA 3AB2B 3M5RA 1CULA 2QLXA 2VG7A 4WYWA 4OZ2A 4DQPA 5LJ5Y 1T9TA 4USVA 5KFGA 1KC8T 3D6TB 2CJ9A 4JEPA 4NCGA 3FZ2A 4W98A 3CJCA 1Q8BA 1NG9A 2FC0A 4IUFA 1Q5YA 5HATA 2YKPA 2BANB 3AY0A 3ET6B 3GR0A 5KG1A 4ECTA 4CZEA 2DR8A 4Q0BB 4UY8T 3LL3A 2EG2A 3OVBA 3HHLC 1C4CA 4YFUA 3EZWA 3CD6S 3TZWA 2ZE2B 2B4VA 3FFIB 4YHHJ 1RT5B 1TKDA 4IZ9A 2R8JA 1R0BG 1K9MO 4EUVA 3M1FA 3QGGA 4E7JA 2E8AA 3ZNUA 4KHWA 3EYZA 4NO7A 2LECA 4RL1A 4O5BA 5DGAA 2DR7A 4JKBA 1XK8A 1RKJA 3LPEA 2HBYB 2M4MA 4F4KA 2C2OB 1S9EA 2FJWA 3D9BA 3B8HA 1HARA 1N34J 4LJMA 2WSEC 1NGEA 3GWCA 4CJ4A 5D0HA 3SYZA 2UUCK 2AW0A 4OI0A 3MUTP 1HBMA 5AQUA 2HVIA 2E1PA 2PFFB 3LDQA 3DRPA 1RP5A 1HHTP 4KTZA 4OI4A 4O0NA 1X9WA 3JSMB 4BR9A 2UUCF 2ZBRA 1RT2A 3ZC4A 1JNZB 4Z37A 5L1JA 2WVBA 1U2CA 2OSQA 2XHBA 2RN2A 3A4TA 5KFSA 1RACB 4C11A 3U1LA 2F96A 2ADBA 5JMNA 2QTDA 3OUYB 2E88A 3PJ9A 5AQKA 4DV2J 4B3MK 2C42A 2CUYA 1UTAA 5LOQA 2KO1A 2XGPA 1SJ3P 4CLWA 1U7LA 4LMZA 4CZLA 1ZA1B 5J2NA 2A3JA 2N3LA 1K0TA 1JNRB 2YTCA 4PRFA 3ZO7A 3RJMB 4B3MF 1TAUA 1LWEB 2IOCA 3SDEB 3HMJG 3ENQA 5ETPA 4M3YA 2ZZMA 4JRQA 1QZ6A 3GB0A 1HLWA 1NGBA 5AZIA 1XMOK 4FJ5A 1VQ5S 3CULA 4NI2B 3CPEA 2P5VA 5AQXA 3J7ZT 4KO0B 5AR0A 4CEFA 2CG4A 5LL6d 1M5PC 1RWKB 2HHXA 1RE1B 3DOLB 1XMOF 1TUUA 1HQ2A 4CJQA 4NEZA 2HFSA 2MB0B 2W4PA 2M0GB 2M9KA 3WDOA 1BDGA 2O4IA 4X4TA 3R7SB 3AQPA 4G3IA 3R9LA 2JFDA 4ANDA 3NGUA 1S1XA 2RF2B 1ICEB 4U7CA 3HSZA 3C2PA 1E4GT 1TU0B 1F9EB 3EICA 2DR9A 1ASUA 4BGBA 2LXUA 4KI6A 4NLBA 3TARA 2ZHAA 5E33A 2QLBB 4ZP7A 1OIAA 4AYBD 4IFVA 4ZCMA 5K14B 1WOSA 2JEFA 2W7AA 4ZVTB 1O5JA 1RYSA 2I7PA 2I2YA 4JI2K 3W62A 4QOZB 1XMQJ 4G1PA 2XNRA 2JWKA 4UY8O 2BW7A 1Y11A 2CPEA 2CFXA 4IFEA 3KHLA 3GIIA 2MSSA 4TYBA 4OV6A 2EFQA 1UVKA 3RSEB 1WELA 3Q8VA 5CCMA 2GCFA 3LWLA 4JI2F 3TI0A 4ILRA 4O0IA 4LF2A 1W7WA 1HPZA 3TZZA 1SI9A 2G13A 5HRSA 2ZBQA 1UFLA 4XH1A 4NYOA 4NASA 4FJ7A 4NLVA 4HHUA 1FWPA 2DNNA 4H0OA 3I96A 3PACA 4ZP9A 1C0TA 3LP2A 1D9DA 4QYZJ 1FJCA 5BPLA 4K4TA 2C1EB 1RBOB 2KHCA 4CJUA 1DT9A 3TABA 3NNAA 4NMLA 2HSTA 2V69A 1FDBA 3J7YP 3I9ZA 3JB9k 4KRWA 4FWKA 2D1CA 2GX8A 2MHNA 2E20A 1QSYA 5KFAA 4DPWA 4FLWA 1Y64A 4R79A 1RTDB 4DHYA 2HBRB 3HTVA 4J9RA 3P8BB 4LFCJ 2C28A 3M4XA 3GFYA 2KVQE 4Y2IA 5ITHA 2BKNA 3HP9A 3RGIA 1HYVA 1KTVA 2WW8A 1D5AA 3O4WA 3GV8B 1CJUB 4FF3A 4CESA 1Q95G 3M8QA 1LKZA 4P73A 2CQGA 4DR5J 2ZJRQ 4DV6J 3VA3A 4MAKA 1C0GA 3O5BA 5AQGA 2A3ZA 4P7TA 3CCMS 4K5SA 1RILA 2EC0A 3NL0A 1DTTB 1J53A 4CHYA 1SQEA 3MUMP 3GILA 4BRHA 1UETA 4NA1A 1V5VA 2A41A 4QIWD 3J7ZO 2Z57B 2GAHC 3R6LB 5L1KA 3THWB 4W4MA 2ZVIA 2BE7D 2H9ZA 2MQQA 2OUGA 4C8YA 5C24B 1IBKK 1FA0A 3C3LA 2CNOB 5IV4A 1VQKN 5C2DA 4QIGA 2G2YA 2VGMA 1NKCA 3PUFA 1B0VA 4YOXA 1KHWA 4ELVA 5EY4A 1UP1A 1UA0A 3IBWA 1IBKF 4DU8A 3CPWM 4A8XA 1NSQA 3QIPB 2LDYA 1RWMB 4BQZA 2LQ9A 5KFXA 1VQPS 2IBKA 1WG5A 3H2LA 4IQXA 2VB6A 4RG8A 1RWPB 2YI1A 1Q53A 2JNJA 4DR2J 2Y0BB 2UP1A 4JI7J 4QBUA 4EIAA 2RILA 1WOQA 2EFVA 3OR2B 4YS2A 2ZJRL 2XEXA 4H4OA 1QE1A 1VDHA 4P2MA 1N5YB 4E7IA 2BGGA 3RR7A 1B9DA 1YRTA 2QWOA 1IWGA 3UIQA 3PRDA 1CJTA 3DFEA 1M1HA 1N54B 1XQIA 1VSJA 2HHVA 4H0PA 4RNHA 2KG0A 2P9IA 3A8YA 3OYIA 1B64A 1X3NA 5KI6A 2W41A 5AE3A 5D78A 1DY3A 4BRPA 4NYNA 3ZZTA 3GU0A 1HNZJ 4YR2A 2Y0SD 3VAKA 5F2RA 4OYWA 4CCHA 4AILC 2MXYA 4WBFA 3S8SA 3SQ4A 2HQCA 5D6GA 1ZM3A 4OHWA 2JC0A 4DV3K 5M1OA 1R6YA 1C0UA 1U24A 2V4RA 1UEUA 1UCNA 4EP5A 1YBAA 4OKKA 1TL7A 2F65A 4CTAB 3SUQA 4I2QA 4DV3F 3QGPA 2EEYA 4DTJA 3CTRA 4KHSA 3BKTA 1KQKA 1WBBA 3H5SA 4IG3A 3WQPA 1IKVB 2E4LA 4CM2A 2ROGA 3F73A 4JI3K 3O4QA 3MMCB 1T03A 1YKWA 2PMHA 3OTOK 2R2UA 2F9DA 5K5MA 3AVJA 4MLHA 3CYMA 4Z4GA 1LW0B 4AFFA 3OYBA 3LTOA 3DI6A 3CJKA 2OMOA 3M8YA 4M5LA 3ZTOA 4JI3F 1NJXA 4WE1A 4IH7A 4MH8A 3NLCA 1N56A 3PFEA 2QYGA 4LF8J 4J2EA 3CJ5A 2CQ3A 2ZF5O 4N5SA 3KKFA 3Q83A 1ATRA 1RTHB 4JS4A 3CD7A 4CGJA 2VICA 1HPMA 2RU9A 3O2IA 4FNHA 5G0RB 2Q0RA 2O8BB 3I31A 2J0SD 1RT1A 3BDEA 3V4IA 1VQSA 5CYMB 1F6TA 1EZZB 3DAWA 1R8BA 2QM1A 4DR6J 2Q66A 4P6QA 5DM6L 3D66A 3A5MC 4PG5A 3Q24A 3ILLA 4RWTA 2PDAA 1BI4A 1NB2A 4ED5A 3NDKA 2VQFJ 2CJXB 3J81O 2CZ4A 4A59A 1PKUA 2LLZA 2IVPA 4BRLA 2UVUA 3AD9C 2IVMA 4F3MA 1UZHA 4CLSA 4KBIA 4G65A 3V2UC 3EGWB 1KRPA 2YNIA 3NCRA 1N8RT 1IM6A 3BN7A 3IKMA 4YB1P 3IG1B 2QL9B 2BJDA 3CIZA 3BQ1A 2C2NA 1IJFB 2ZM6J 1QQOA 4X2BA 1NKEA 4B9UA 3BR8A 5DG9A 3IFEA 4IFYB 1T6CA 1WLJA 1MWQA 2GS8A 1KSPA 3JTOA 2C2KB 2VASA 3WQUA 1NK0A 4AHUA 1NH7A 2C3MA 3R2CJ 2ZJPL 4EI2A 2PT0A 3CCRS 1H2VZ 4K42A 4EGLA 2W2PP 4WFYA 1SQKA 1TKZB 1S49A 3GLJA 1LXNA 3J80O 1GT8A 3HOTA 2Q3SA 3EZ5A 5M1QA 3OLAA 3OW2M 4F4YA 1VHXA 4USJC 2KN4A 2V9WA 2V7YA 3Q8SB 2E7XA 1SUQB 4FYWB 2HHWA 4G9ZA 1HR0K 1VRTA 4U8YA 1IKWB 1FRHA 3QJJA 5EU7A 5THWA 4CHPA 4F26A 5BXIA 3PO4A 1I6JA 4M94A 4OZNA 4JKCA 5E3QA 3MM7B 3T1HK 4LF6K 4TQSA 4KH4A 2ZH6A 1HR0F 3VZIA 2PZSA 5E41A 3D6MB 3GE1A 1JK9B 2CQ1A 3L2UA 3KLIB 4X4SA 1KAYA 3CEDA 3T1HF 4QW8A 3GYGA 1CQMA 4LF6F 3GJTB 3WXLA 5HP1B 2OFGX 2R8IA 2HNYA 5F0UA 1BA0A 4BVPA 4A57A 1YI2N 4OLAA 4GKKK 2KZZA 5ETNA 1Q4RA 3R8YA 3OFGA 4B9MA 3ULEB 4OHVA 5JICA 3IA0A 2YHXA 4WQ4A 1S9GB 4IOAL 2QWLA 1P9QC 2YX6A 3B6OA 4K8XA 1MU2B 2BTFA 4L72B 2K3KA 1V4SA 4GKKF 1SJRA 1JXLA 3QNNA 1QD1A 3FLCO 4JKGA 4LF9J 1K0VA 1J5OA 2UXCF 1RDRA 4DR7K 3T5LA 4KH0B 1LWFB 1RCOB 1KVAA 4PXCA 2EW9A 5F3ZA 1K73T 1CC8A 1XTZA 2KKZA 1HBUA 1FNOA 2K8GA 4FPRA 2DJWA 2X78A 3CIPA 3HYFA 4IO1A 4DR7F 3D7EO 3KZBA 3H5UA 4F2RA 4U7UK 1GQEA 2ROEA 2F4VJ 3MAAB 2WBRA 1TUGB 4UY85 3C16B 2AP1A 2J6SA 5BREA 4IJNA 4KAZA 2JWNA 2D74B 2FPHX 4DQIA 3HHDA 4CJ7A 3EL2A 3DHWC 4UOCA 4YEAA 3RMDA 5KFOA 4DUZK 2DHSA 1RLDA 1EO1A 3RBDA 1IBCB 1VAZA 3L0QA 4JI4K 4DTUA 2E5HA 4RNNA 1CSJA 2B5JB 1OYDA 2GO8A 4DUZF 1NO8A 1N8RO 1HHQA 5DQHA 4A8OA 1VSHA 1FK9A 2F1FA 4JI4F 4ZIVA 2VOOA 2WSFC 2YWHA 1TUWA 5M2PA 5J2MA 1S5ZA 1GX6A 4UZBA 3CW2C 1PYOB 4C1NI 2YNHA 3I0RB 3OT9A 1PJ7A 4RW8A 1TR0A 5ETSA 1C4AA 4TVAB 4CIOA 1HW8A 2KQ2A 3FQLA 2G8HA 6AT1B 3M30A 4CLKA 4ZCKA 3QYYA 3RYLA 4CGDA 2JEJA 1EETA 1C1AA 2HF4A 2E29A 4J9MA 2VQEK 4Y1DA 4QIEA 1Z4UA 1U8SA 4RJVA 3K0SA 2GGPB 4AL6A 1LXJA 4FWQA 1JX4A 3H90A 4JUZA 1TK5A 1X8DA 2VQEF 2G2OA 5TKYA 3KDNA 3IFRA 3MWTA 4NMXA 5D4NA 1Q1KA 2QEXS 3AGRA 4CEQA 1BUXA 1U2RA 2G1HA 2F7TA 3CO0P 3OHBA 3D2FA 1S22A 1S72N 2D3OR 4ZCLA 1W26A 4FSVA 2OD6A 5K8PA 2R7SA 7AT1B 5M1PA 2QWQA 4M5JA 1PGZA 4QPXA 1T9XA 3EJMA 5BR8J 3IDHA 3J7Z5 4BRAA 1SZ2A 3TX8A 2KT3A 1T6DA 5I3UB 2HVDA 3RRKA 2Y1LB 4CGIA 3ZZYA 1E6VB 4DN9A 1XNRJ 2VWJA 2IJFA 3O3GA 2IS3A 2ALYB 3E51A 1F9HA 1KS2A 5IT9Y 1NNEA 4DU7A 3EGNA 2E66A 1HNXK 4U9RA 2P9KA 1G4CA 4C7QA 4MFBB 1UVLA 4B3RJ 4ZVOB 3KG0A 9ATCB 5KT2A 3G6XA 2R7TA 2P9SB 1HNXF 2NUBA 2LU1A 3V9ZA 5A8RB 5C2GA 1K73O 3A8JA 1JLGB 3C14B 3HVAA 5AQZA 2ACYA 4M7YA 5C12A 2IY5B 3ZT1A 2PFDA 2VIHA 1QAJA 3I8BA 4EBCA 1YJ7A 4FYYB 1YHQN 3C0BA 2O4GA 3C6TA 2CJAA 2FB0A 3GP9A 5LMNJ 3IAS9 3M32B 5KRSA 3PW7A 4KYZA 5CZVA 3KTQA 2B4JA 3KUHA 3KNGA 3G86A 4FK0A 1VYAA 4IG0B 1EKEA 4IH5A 2W9BA 3MCOA 4DSKA 2IGIA 2GV1A 2DKOB 4KKOA 4CZJA 4QJVA 2GVDB 4X64J 2IAJB 5DQIA 3A2FA 3H4BA 4FWPA 3ITHB 2CZVC 2X1BA 5BRFA 1P1TA 1DJ0A 3W64A 1R7IA 4OO1J 1WUAA 1FRJA 3CQYA 4PPZA 3TRGA 1S99A 1Y5NB 1B99A 2VKZG 1U6ZA 1M5KC 3AAWB 3FRZA 1JLFA 4EMDA 1ITGA 3FSYA 2G2ZA 3PX0A 3ONQA 2MPUA 3CMAN 4RBTA 1NK7A 3CCRN 5KG2A 3DDIA 5KT3A 1WAJA 3AARA 3ZETB 3TAGA 2QA4S 4W92B 3CDEA 4FJXA 2O8CB 3KLEB 2ZH2A 3NOGA 4LSLB 4JS5A 3LAKA 3UKUA 1J2VA 1N36K 3JSBA 2GMHA 3H45C 4IYQA 2FSKA 1IR0A 2ASOA 4DS5A 2D9OA 3G8SA 1R8HA 1WG4A 4H03B 1WHXA 4ZITA 1IBLJ 3M6UA 4RWXA 1N36F 3VMFB 3NF6A 4NYPA 5LJ3Y 4QYRA 3AO3A 4M5DA 4AE5A 3DLLL 2NRXA 2C3YA 2KTQA 4GVLA 5AXMA 3G87A 3UVJB 3NE6A 5GADP 2CQDA 4JYAJ 4JI5J 4OYIA 1VQ7S 2F7VA 2J9DE 3MN6A 5HLFA 1HJOA 4J9VA 3V1RA 1SXLA 5CYQB 3NHGA 4CRJA 4NLGA 3OBYA 2AYMA 2XZWA 2MKJA 1UEVA 4ED7A 2FVSA 4DQSA 2H4YB 3IS9A 3MMJA 2D1KA 3T41A 1XQSC 1TL1B 1A6LA 3Q8YA 4DU4A 3FE1A 3N6NA 2YJFA 3G2XA 1WTBA 2F63A 5M2UA 2MYFA 3MXHP 1FVQA 4F2SA 1QUVA 3DOMA 5GAEP 1YJNN 2BANA 2QL5B 3BO2A 5T7LB 2X6NA 2CGJA 1M5VC 2HK2A 4CGHA 4J90A 3A5LC 1Z1ZA 2BX6A 1SBRA 2CQHA 3GIMA 2HRTA 2RQCA 3N9UC 1NBEB 2RHKA 3LP1B 1RBRA 2KI2A 5DM7Q 3E9PA 4F4XA 4A47A 2YH1A 3S9HA 3CCWA 2QKBA 3RMCA 3CCUS 2QWPA 1X0FA 4RW7A 5HJXA 1TKXB 5F0XA 2J6TA 1D1UA 4E2FB 2K3IA 2OELA 3FGVA 5I4MA 3R1LA 3UNYA 3EGVA 1RDUA 1Q7LB 1WF1A 1MROA 3QEPA 3UNGC 4DFMA 2XSJB 3KKSA 2V5HG 3TQ1A 1R27B 5HO4A 2DRBA 2OYQA 2K7KA 2N82B 3LP3A 3H46O 2AGPA 2VBYA 3DLKA 3T1AA 4QR1A 3ZT4A 3I5AA 4I6MA 2A6AA 3UD5A 4IKFA 1VQMN 2ZD1B 1VK8A 3N4WA 1IUJA 4AUKA 2G8VA 2QL7B 2M88A 3MI7X 3JSMA 3NGTA 4RW9B 3LALA 3CXCM 2ILZA 4CJWA 3MX5A 3O8MA 5LSOA 3DLGA 3IWNC 1Q79A 4EK2A 1W2BR 2MKKA 4LBIA 3CB4A 4H8KA 1UW4A 2GJ2A 3RU0A 2EBEA 1TV6A 2Z1GA 4JNEA 5B0EA 1YZ7A 2OTLS 1VQ4N 1QSLA 1TK0A 1U02A 5KPTA 1FDNA 4PWUA 1R0AA 4UTGA 1FEHA 2B9XA 3HZ6A 1SV5B 4DU1A 1XJWB 4BG8A 3P1GA 2KYZA 3RR8A 1Y3JA 2J76E 3WQTA 2HNDB 3OS1A 5B7WA 4Q44A 4C1NK 5A2QU 3VEZA 4CEZA 3JTPA 3JTNA 1SB6A 5D0GA 1KR4A 1CS4B 4USKA 4A8YA 2YVSA 3HI0A 1IR2A 2VYPA 4JKDA 1IV0A 1UWAA 3G96A 4FDFA 4BC4A 2BRLA 4DTOA 4FK4A 3I55N 3RMBA 1HI0P 1HWUA 4RKUC 4KHPJ 5I3PA 5K9FA 3V9WA 1IKXB 5HJYA 1Z6RA 1HWJA 2R7YA 3FZBA 4KT0C 5DQGA 4L74A 3JAMO 2PSZA 4FJ9A 4JI6J 1R6VA 4B1UB 2H3GX 3MAQA 1NPKA 4U7UD 1RT3B 5LSRA 1YIJN 1VQ6S 2DFEA 3CHWA 2RHSB 4HTUA 1KWMA 2VG6A 1RNHA 1AFIA 1SJ1A 4HTLA 4L75A 2VPYB 4CFAA 1IQZA 3DLEA 5KG7A 1SPBP 5EXWA 3VERA 3T1YK 5H9FK 2YHWA 5CHIA 3PZPA 3SUOA 3CETA 2M52A 2UV8G 1WC3A 4EFHA 5MLCV 1S6PB 3QBWA 2CH5A 2LQ8A 1M5OC 4FXVA 2CQBA 1S1WA 1JJ2R 4KPYA 2ZKUA 3MR5A 2B51A 2Q1LA 3T1YF 1S4FA 4E7HA 2FBYA 2W7OA 2XLKA 1HQEA 1LAVA 5KFBA 1QSSA 1YAGA 2RSQA 3I0SA 4IKAA 2W1BA 3GBTA 3K57A 1EKSA 3K5MA 5AQPA 2XMUA 3VENA 3KHYA 3MM5B 1HKGA 1XMQK 1K8AT 4CW7B 2EC2A 4DL6A 2VGNA 3C6UB 1E6YB 1LCUA 3OFFA 2Q31A 2G8WA 3NCIA 1C1CB 4PAAA 1K8KB 1S1UA 3OVAA 1S77D 2NPIA 1XMQF 4DV0K 1TAQA 1Q7YT 3VR1A 5EWFA 2ZOMA 5C15A 5DLGA 1FJGJ 1DLOB 2E7WA 1WHYA 5KG0A 1DAXA 1RHMB 4J9NA 4C8LA 3N4PA 2UU9J 2KXHA 2ZC4A 2GIQA 2HHTA 3EM1A 3MCMA 1U1LA 4DV0F 1KQSR 3AA9A 3VGTA 5E0OA 5F8GA 3LDNA 3K9KA 2V51B 3MMBB 2FJBB 5FLXU 1QDUB 2E6MA 5FDLB 4LIRA 2NCKL 2V9KA 1YTUA 3W8GA 5A2QY 1KQGB 3PG9A 3HD2A 4Y28C 2IJRA 1JLCA 5CYJA 1NRKA 3C7NB 3E01A 2OTJS 1U1MA 3HM9A 3MD1A 1JMTA 1D4XA 1S6UA 3S3NA 1KBRA 2QMXA 1SC4B 3BO4A 2UXBJ 4L8RB 1XHZA 2LMIA 4I6YA 3CCTA 1F21A 4WFBL 4LF7K 2BV3A 2P9CA 4A8KA 4CHZA 2B4OA 4CJKA 3MF5A 3VQBA 3CCVS 4LRFA 1S97A 3D4JA 3OR1B 1D09B 4CHNA 1BMQB 1RAEB 2DB1A 4LF7F 5ETVA 5GAGU 2XGQA 3E9LA 5A6PA 3PR4A 3BEGB 2J9DA 5AFUH 1YGYA 4ELTA 3PIOL 1DEJA 4G1IA 2FSNA 3CJ8A 3SPZA 4BRQA 2IBOA 2MMYA 4IOBA 2NNWA 1NGGA 3THWA 1N5TA 2CNKB 3SZ2A 2DY9A 2QXFA 2ZKTA 3CSKA 3NBPB 1CLQA 3JQMA 4DV1K 2DPNA 1KD1T 5EWEA 3FVYA 3C15A 4HUFA 1TP7A 3MMAB 1J5EK 3UR0A 3NAHA 3LPTA 4H5TA 4I2PB 3UO0A 1T3NA 3NS6A 2MQ8A 4MMOA 4WZQA 4DV1F 2FVCA 2FC8A 1UW9A 5FROA 3V9UA 4GMKA 1B7YB 1WDDA 1N33K 1WSEA 4PR6A 3BYRA 4E7LA 2O8FB 1J5EF 4MIWA 1T95A 2LKZA 3TEGA 5CA5A 4CDIA 4L6V3 4CO2A 3GFXA 4ECYA 2GMJA 4ZP6A 4C0BA 4YOTA 2NRRA 1N33F 1MMLA 3V5RA 4IDHA 3OR2A 1UVMA 1Z25A 3F5TA 3BGLA 2N4CA 1WSVA 1G3OA 3CM5A 3QEXA 3ETOA 2Z56B 4OHYA 3IAYA 4OJ1A 4JI7K 3S3MA 4YOVA 4U67Q 3QETA 2MLZA 3TAEA 1K8AO 2WCXA 3BH7B 4FBTA 3V9SA 1ZBTA 4JV0A 5FLXY 2FZGB 2J8AA 2X3DA 2Z0GA 3CCUN 1GXLA 4JD2A 3AD7C 1GLBG 4TY9A 4J9SA 5FPNA 4DMZA 2VD3A 1BGXT 4J9LA 3L09A 5A8WB 4JI7F 2XWXA 4PWDA 1HQUB 2GHWA 1GH8A 4X62J 1NJWA 2JL9A 5LMUK 3N4QA 2RRNA 3VVUA 4OYZA 4BE0A 3IGVA 2DGXA 1R8AA 3OV7A 4DV7K 4Y2KA 1MA9B 2QO3A 5A76A 1MMDA 3H40A 2H54B 4JI8J 4ED6A 3PKMA 2RHQB 4P72A 5LMUF 5AQQA 4NEYA 5KRTA 1RYRA 4JOUA 4BLGA 1RCXB 3NF8A 4DX6A 4NB4A 4DX8H 5C7PA 3SMZA 4DV7F 3SQ1A 1BWFO 4HHJA 1GLFO 1SH3A 3SFGA 2V2QA 1J54A 4DTXA 2R2SA 2M8HA 4ZJQA 3DRSA 2M70A 1VLYA 3PYFA 5ETKA 3FZHA 3MM9B 4LBHA 3WXJA 4EHUA 5JVHL 2A40A 1EXQA 3DWLA 2GQ2A 2VPWB 2FLLA 1LW0A 3TSQA 2HFNA 4AH9A 4U67L 2P9LA 3DU6A 2KRBA 4I1TA 3WX4A 2QI2A 1FKAF 2HF3A 5D0RA 2B3TB 3K5PA 1RBAA 4O44B 1EP4B 2WK4A 4KI4A 3H59A 1RTHA 3ZSZA 3ISZA 1KOHA 4S0MA 4I0WA 5G0RA 2O8BA 2PYJA 3PRBA 2GJIA 1HWLA 1YJ9S 2FF3B 5E3PA 2KH9A 4CF9A 2OCEA 1YBTA 2OIHA 2P1JA 1T05B 3DXMB 4CK1A 4WYBA 5IQ6A 5GIOA 5D77A 2NUUG 1KAZA 2GTDA 4CZFA 4M3TA 4KGVB 2YKMB 3SXLA 4A5AA 3EDQB 2H51B 2Z1JA 3L7UA 2DNOA 3ILJA 2QGFB 3HFVA 3NGSA 2IDLA 4DUYK 1MNEA 2YKNB 4FS2A 1F2HA 4TU9A 2AJ2A 4RW4A 3O9RA 3IG1A 4DUYF 2ASJA 3ID8A 2MGZB 4PQUB 4JKHA 1XNQJ 2IJNA 2HLTA 4DSIA 5KFQA 2IVYA 3B6BA 3GONA 4IFYA 3AA4A 4AQYK 3UDVA 4CO3A 4IBNA 3JQKA 2E2PA 2ZDPA 2YX7A 2W2MP 2EKYA 3HFZB 5A8KB 2DR5A 1U26A 2V68A 5J1EB 3ZZUA 4ES1A 3MR6A 3GIRA 3TAFA 1TKZA 2F8MA 4AQYF 2XQCA 1T3OA 3I82A 3W66A 5BPNA 1N6QB 4PUOA 2XY8A 1UWBB 5B0CA 2HWIA 4DSEA 3JYTB 2NRZA 1FE0A 1YJRA 2E7VA 3JQJA 1SUQA 4USMA 5T14A 4OZ0A 2AIRB 3CJ1A 2GV9A 3QFHA 2OMLA 1H74A 3DC2A 3J7YI 2PC6A 2X74A 1APSA 5IWAK 4HDHA 3VGMA 5AQNA 2RDDA 1MWKA 3CGIA 4HWIA 2GUIA 3QBCA 4WCEQ 3RBEA 1WI6A 2FBTA 1KVIA 5GMDA 1XC3A 3OL8A 3R8EA 2LDIA 3IM8A 5IWAF 3MEKA 4OZJA 1QZ5A 3W7BA 2VHGA 2CQIA 4K59A 5LT5A 5DO2A 3M8SA 3L2RA 2Z4PA 1CJKB 5HP1A 1W9HA 3G82B 1ROFA 3DGVA 5LXRA 4DL0C 3V1OA 4FK2A 2RD5C 2GX9A 4ZLLA 4CM0A 3THXA 2BZ2A 3TU5A 2JFKA 2NRTA 2VA2A 4PG8A 2LEPA 2XO7A 5IZHA 3A5NC 1MU2A 2QG9B 2F8TA 1CG2A 2VJUA 4KGZB 2BE9B 2WAQD 3THYB 3OFHA 3KK2B 5HBMA 4HHHA 4C3LA 4KSEB 1YITS 3D7SB 1H7XA 1DRZA 1FRXA 5IFMA 1LWFA 3R1XA 1YRXA 3D1OA 2J9CA 2UUAJ 3CCVN 3PO5A 2AX0A 2HHHK 3MM6B 2FDNA 3EMTA 3POTB 1S59A 4DR1J 2ZBIA 1SQFA 4FWMA 3V6DA 2QWRA 1RBSA 2CXEA 4LIWA 2LQBA 4WCEL 2DGOA 2MLXA 1OQ6A 1BQNB 3BBFA 3RMAA 2HHHF 1Y5LB 1QJHA 2F8SA 2OPRB 4ED0A 3KHGA 3KK3B 1TL3A 4LRAA 4TYAA 5AQYA 2XYHB 1BUPA 8RUCA 1RKIA 4KH5A 4ILMA 3RB3A 5IXUA 4USHA 3OXLA 3LDPA 1FWLA 2J0XA 3A8KA 2NRVA 1Z2LA 2B5JA 3TAMB 4IRKA 3H25A 4FLZA 4IEEA 2BVZA 2JEGA 3KG1A 1S48A 4K2JA 4LSZB 1DTQB 2FJXA 4BREA 3E66A 5AQJA 5HL7L 3QMQA 4X66J 3SQ0A 3Q23A 2M7SA 3FUYA 2WUSA 3CF5Q 1U1KA 3I0RA 3NH0A 5KG5A 3P83D 1HBNB 2OO4A 1UVNA 5D4LA 1WACA 4U7BA 5D3GA 2WRMA 4I7FB 3Q8QB 4RLEA 4NXMK 1S79A 2LVWA 5F8JA 4F3QA 3MD3A 4K0KJ 3KLVA 1C1BB 1Z2ZA 4OYAA 4ZPVR 3WIVA 2GZOA 1PC4A 4BRGA 4NXMF 5A0YB 4LFAK 1SKWA 3WUHA 1NLKL 2AX1A 4DV4J 2O8DB 4QU6A 5FPDA 5EVZA 1IG9A 4LF5J 2KZMA 4HR2A 2EX3A 1NOYA 4IOCL 4LREA 4LFAF 3PDNA 1LEOA 3MCPA 3UI3A 3H2UB 3HSGA 1PYSB 1QQNA 4OI2A 3OYNA 2QA4G 1FE4A 5EHHA 4H4MB 1ZBHA 3BY5A 3WXKA 4YR3A 5HRRA 2IDEA 4FOIA 2BJ8A 4I4BA 5J2PA 4M63A 3MOJB 4EU0A 1FXXA 5GAHP 4ZKAA 5KFFA 2ZBPA 2NXUA 3P4IA 3CC7N 4XDCA 1LWCB 2BJ7A 4ILGB 1RDDA 3AAPA 4MO4A 1MN7A 4DF8A 2FC9A 2DPIA 1ZM2A 3UKRB 1RISA 3GYNA 3MM8B 5BN8A 5GVQA 3U7JA 1B9FA 4X4VA 4JI1J 4MFBA 4QOTA 3JSRA 3H6EA 4CLYA 1RTJB 4G6VB 1QTMA 1AZSB 4NOHA 2P9SA 1PILA 2HLUA 5A8RA 5KFCA 2BQUA 2LXFA 3ALYA 2BH1A 1JLGA 1HKCA 3C14A 1NU4A 4WIIA 4U96A 2ZITA 3MN7A 1F60B 1T0TV 3F2KA 2BEFA 1BA1A 1R43A 4AXJA 4N56A 3QFUA 1W2BM 4ZOSA 1NWKA 1ZBUA 2ZZNA 3OYDA 4DFPA 3CDUA 2E1MC 3E8OA 4U6PA 1ELOA 1XUPO 3J8AA 3CC2N 2FY1A 4PL7A 2OEJA 4JRPA 3O9QA 4QW9A 3FBFA 2W2OP 5ADXH 2XO6A 2AEMA 2QFIA 1AUDA 1VRUA 4NRTA 2J7UA 4C3MA 2NQPA 5KFWA 4B08A 1T9WA 1S6QB 5IM0A 1B70B 1YUWA 3GMGA 3OTBA 5TKWA 3PJXA 1NHKL 4FXDA 4BDYA 2HAFA 4DR4K 2OI2A 3HDSA 3MR2A 3ITHA 1GLEG 3W2VB 3G6YA 1WF0A 1TYQB 4M5IA 3FGUA 4Q8FA 4LFBJ 5KFMA 2E5IA 4BS2A 4F0KA 4OX9J 1EX4A 3DDKA 5GAGP 4DR4F 3DN9A 3VF4A 1QHTA 1S12A 2M8DB 2IIHA 2RKIB 2L48A 1RDAA 3H3NO 4MK8A 3KLHB 5HVHA 1OVQA 1Q0NA 3EPGA 2XMJA 1WDTA 2YWKA 3SBTA 3TR5A 2HWHA 4A8MP 3T69A 4J2DA 4B9TA 4OIXA 1WEYA 2WC9A 3O3HA 1F5BA 4WFNQ 2HBJA 4A8WA 1HHSA 3G4SS 3J7YU 5FPEA 2ATLA 4H4KA 1OO0B 4O3NA 3E3XA 4C0OC 2R42A 3O8WA 4N77A 1YBUA 2DT9A 2MZTA 1LK5A 2XRIA 3FRYA 1SIZA 1DQ9A 2D41A 3CCJS 2B9WA 4DI6A 4ILLA 2ASLA 3DXKA 3VEWA 5KFHA 4EWTA 4AHTA 3CCQN 4OZ5A 1X4GA 3OSPA 1REVB 1WC0A 2R7UA 1Q9YA 4NLXA 4UOGA 4PYDA 1HA1A 3OYKA 4WIQA 3EWGA 4RNMA 4Y1CA 4KHMA 2E5GA 3GG0A 4CO4A 4GKJJ 3TUPA 4BHQA 2U1AA 3V81A 1U47A 2ACMA 1TL1A 9RUBA 3M6GA 3SSRA 4I68A 4CYUA 4FF1A 2MDAA 4IO9Q 2V2KA 1WC4A 1PSDA 3Q8UA 2H5JB 3VGUA 2OPPB 4YY3J 3U6FA 5DDOC 2FJDB 4CT9A 3U4LA 3NGRA 3IAM9 5D8HB 2HFZA 2VUGA 4EYIB 4CJVA 3L3UA 3ZSQA 3LP1A 2RPIA 3CCLN 1OMSA 2AJ0A 3R3TA 3SMPA 4Q8EA 2AV5A 1JLBB 5CABA 1BIUA 4MDAA 3ZTSA 2JWLA 4FLXA 4IEIA 3TZXA 4LVNP 4CO1A 4YP3A 2FVQA 3I87A 1TKXA 3ZZ0A 3K0JA 3VF0B 3SAGA 2H5IB 3WXMB 4W5OA 4JN4A 2ZNYA 2FJEB 3OYAA 4ZLPA 4HACB 2UUBK 4QS9A 4JK7A 1L3VA 1WAFA 3FZFA 4DPUA 1SQGA 2RRBA 4KHUA 4DCOB 5AQMA 1P8GA 3QAUA 5KFPA 2ZD1A 5CZ2A 4C48A 2UUBF 2CAJA 4IO9L 3CJ4A 4BR2A 4RW9A 4N8OA 4BRNA 4C8NA 3HP6A 4OPHA 3NH1A 3N28A 3UDEA 2Q97A 2RT3A 4BACA 3ENVA 3UN5A 3P3DA 3MEGB 5I9EB 4CJRA 2ZHOA 3SCLE 4LT6A 3VEOA 4DOZA 2GBZA 4UOFA 4LC9B 4ZN1A 3ADAC 2WW4A 2JHEA 3J81U 4AM7A 3EDRB 4EAHD 1SKUB 2A6MA 4X65K 5AQTA 2QMUB 3R27A 2V63A 2BQRA 3MCAB 2AYGA 2HNDA 2YKOA 3AHPA 4YDUA 3ZX2A 1L3KA 4WQ4C 1YVNA 4ID5B 2IYGA 4X65F 5ETTA 3TVZA 1P27B 1CS4A 2C3PA 3M3ZA 3DCAA 3LF0A 2A2CA 5H9EK 2MLYA 3D5MA 4B17A 4OJ3A 3D0IE 3KIOA 3O6QA 1D9FA 2YJEA 4QWEA 1OH5A 3ATUA 1ASWA 2Q6BA 1UFKA 4YMEA 1V5IB 3X3UA 1GLCG 2JOQA 3F9MA 1GFWB 1N32J 4KH6A 3TUZC 1FWKA 3T9ZA 3TAQA 3GSDA 1K9MT 4WK3A 4USWA 2HK3A 2A6OA 4UT4A 1RT3A 3J80U 2N7YA 1VSIA 1O6XA 3QO9B 3VV2B 1WHVA 2IVOA 1VQ9N 3BF1A 2IVFB 4LSNB 2Y1RI 2VDIA 4CJLA 4DTRA 5KFLA 3MTKA 1U2VB 2FBVA 2J5AA 4EO8A 4WXWA 3KLFA 2Q79A 3N5FA 3B78A 4RNOA 3FMWA 3WNGA 1GX5A 2BE2B 5KT4A 2KFYA 5G4DA 4XO0A 1NSAA 4FJHA 1G15A 2P9UB 3LGMA 3O9UA 1YJWN 1WORA 3PTWA 2XLIA 2Z2MA 1VSDA 2Z8QA 3HX9A 1FFSB 2LQJA 5CZ1A 2G8KA 4DX5A 3RTVA 3RB6A 3KUEA 2VG7B 1UA1A 1O13A 5AXKA 1JQGA 4CJ5A 3OYLA 2KDOA 4NCGB 1U8WA 4Q2LA 2B56A 1SCJB 2XLJA 3J7A1 1NGAA 2HQDA 2MQMA 5DGBA 2DY1A 1K8KA 1BWEA 3N01A 1RXOB 4F04B 3O1WA 2QTWA 1KLNA 3HXMA 3M9MB 2P6TA 1M1KO 1IBMK 5LSLA 4URSA 3EVWA 4FCYA 3TX0A 4WK1A 5BPMA 1QVGR 2X7IA 4WJBA 5HRPA 5B0BA 5U47A 2FSJA 4R5PA 2KM8B 2XHWA 3E1YA 1NDLA 1NK8A 2DISA 1IBMF 3J81Y 2RU3A 3QSYB 2UUCJ 1WNEA 2BR0A 3HVTB 2FTRA 4FZYA 1A5XA 2KKHA 4H0VB 4ISGA 1CJVB 4BC5A 3OYGA 5FDLA 2ZOGA 3HKZD 3KNAA 4I9QA 4MIAA 3QZ8A 1YF5L 4P74A 1WKLA 1S9EB 2QFJA 4NZ6A 4BRCA 2X1GA 2ZUGA 3NS7B 3OJUA 4BRMA 5HQMA 4Z0UA 2OA8A 3ZSRA 1EWQA 3CDAA 1HBMB 2CA9A 2WONA 4PXBA 3UN2A 2V2VA 3BGRA 2BJ3A 2YWFA 4LY7A 2UXDK 3B82A 3QDKA 3BF4A 1VIOA 1ZETA 3VEXA 1RT2B 4B3MJ 5IT9O 4E8UA 4TN2A 1SL0A 3IR6B 4E1MA 1ZXOA 1IVZA 1EJ7L 1C0FA 2UXDF 1SAZA 1ZPWX 2CYYA 4ZLJA 5ELZA 1VGYA 4R8UB 2MZJA 1HWKA 1FFGB 2GC8A 3EXCX 4EBEA 5AFUA 5GADI 4BC2A 2PE8A 2HNZA 1XMOJ 2RUGA 1X9MA 1I94K 2FZKB 2AF6A 4FW1A 2QYCA 2HQGA 4FVUA 3DOKA 5J2NB 1D0EA 3IMXA 4CIGA 3GIKA 1IO2A 5HN0A 1VK0A 4RWWA 2JEIA 4AT1B 5J2QB 4URQU 2MJUA 2PD1A 2GVZB 1J6ZA 2IA6A 2FLNA 5KQDA 1I94F 3QZ7A 3M8PA 2KT5A 2EHGA 4JV5K 1G1XA 4TY8A 4BRKA 5GINA 2PBDA 3EO3A 2QT7A 4RUHA 1MDUB 4J7CA 3SSQA 4GC6A 4DTPA 3I56N 2O8FA 5GAEI 4Y00A 3GL1A 3QEVA 2BABA 4JV5F 4HI2A 3P5JA 1U0HA 4WP9A 1BCMA 4J8FA 2BXJA 4WU2A 4PKGA 3EEQA 2CQ4A 2CIMA 2IHR1 4NLTA 3GJSB 3AJ1A 3K89A 4CZGA 3W5YA 3OFEA 1BE4A 4CLPA 2AA4A 3R1HA 2FQQB 5M1FA 1P9YA 1T94A 2D4WA 3L95X 4Z4HA 2P51A 3SJHA 4JI2J 2WVFA 2VCPA 3QERA 1GXTA 4M3ZA 3PKYA 4IWVA 2SXLA 4DLEA 4QR0A 5AE2A 1A5WA 4L76A 4LF4K 1WSGA 1VQNN 1I3AA 4CEOA 3GSIA 3N6LA 2VKRA 1Y7PA 4KQZA 5KFNA 3RUBL 1QM9A 3CCSN 4PA1A 4IFVB 4NRUA 2WBMA 1AFJA 1UAXA 5EDWA 4RX6A 2WB4A 5DS7A 4LF4F 2P8IA 5A8WA 3U02A 2YNFB 3PX4A 2NSCA 1U49A 4RUAA 1P6TA 3K7RA 2DVIA 1HYSB 5L9XA 5IOLA 3RAXA 2HQIA 4MKAA 3BDPA 3ENBA 3BH6B 2BJ9A 4JKFA 4LUBA 3D54A 2GNKA 1PIEA 1EKRA 3G71S 3HVWA 4F4WA 4IR1A 2KXFA 1QQCA 2D0PA 2EVZA 5AZJB 1ZH5A 3J7AN 4C4WA 4CGFA 3LP2B 4OI1A 2IFXA 5C5JA 2X6SA 2VH7A 2QRRA 1G7CB 5B0GA 3BREA 2YWGA 4LH4A 3LP0A 4DFJA 3MXJA 4ZVHA 2DHGA 2CJQA 1JLAA 2V8HA 3IR5B 2GW8A 1JXBA 4JI0K 4CWBA 3LA0A 3OHAA 5B0FA 3KUGA 4CF0A 4K8ZA 4M5MA 3MN5A 3VQSA 1FF2A 3GV5B 4OJGA 2KVIA 4O44A 1EP4A 2KHOA 4H5WA 4JI0F 3BJYA 3ZCMA 5BYRA 2XMMA 5DETA 2H5EA 4EEYA 4RW6A 3M2UA 4CP5A 3GG4A 2D3UA 3ETMA 5ETLA 4F4AA 2XTJP 1VOMA 1X9SA 3TQEA 1TL5A 3JSYA 4IJAA 1T05A 1KP6A 3FCWA 1C6VA 4ERDA 3CMEN 3M8QB 4DX7A 5AJ3K 3QIDA 1U2FA 4DQRA 1YJTA 1FJ7A 1AB8A 3WT0A 4J37A 4Z7YA 3FZLA 3CDBA 2RS2A 1QS4A 1RA6A 2XB2D 2W4DA 2VFVA 5AJ3F 2CWXA 3AVFA 4USTA 2CVEA 1CXQA 3PW4A 4DL2A 3OTEA 4OYOA 5IV3A 1RWUA 2ASDA 2WOMA 4HEA9 4PQUA 4IDKB 3CCES 3MECA 2IMOA 2DRAA 4ZMMA 4Y2MA 4ED4A 3FZKA 1VQLN 1RTIB 3VA0A 5D4OA 3GFZA 3ZSYA 2HHPA 3LOUA 2Y1IA 5KOXA 4A46A 2JC1A 3IR7B 2UV8A 2XS5A 3L2QA 3D28A 2I7NA 3NOCA 1H73A 4WFAQ 1ZZFA 2PY5A 4KHYA 4G1QB 2YQ1A 2DXFA 1ZAVA 4FVCA 2QIFA 2W4CA 4I6WA 3FC9A 1RDBA 1N6QA 3BYPA 3KJVA 1UWBA 1DQ8A 3NMAA 2CQCA 3JYTA 3K2PA 3TR8A 1RFQA 5KFRA 5AQOA 1U45A 3EZUA 2MY7A 1TUVA 1IN0A 3B4DA 4H4OB 2DTJA 2V52B 2HFOA 3GJRB 1E3MA 3GCXP 4JV2A 5F9NA 1VBXA 4BRFA 2DYAA 4DBQA 3SQOP 3R7BB 2P9IB 3DMJA 1ZA2B 4C2MA 1NAQA 2CNLB 2VPZB 4KHNA 1CJKA 4DV3J 4NLSA 2FHJA 2ZUAA 2HHUA 5IT0A 2BM1A 1U1NA 4OZ1A 4Q7AA 4DR3J 4F50A 1CLFA 3CXCR 2KHDA 2RS8A 1RT4A 3DRRB 3EKSA 3SIPB 3O6WA 3AVIA 1WC1A 5FJ4A 5C2FA 3NGYA 1WSHA 4FJIA 4DCPB 1NK4A 1C0UB 4A8QA 4JI3J 5B0DA 3LGHA 2BJ1A 3THYA 2IA0A 1NMNA 4UQTA 3UB5A 1KAXA 2DNPA 4I2QB 3MMVA 3ZZPA 4DZ6A 1EQ0A 4BWJA 4TU7A 4UF4A 4IG3B 3MM6A 3M05A 5I42B 1R89A 3P4UB 3POTA 4QS7A 3KWMA 1JLQB 2Q36A 4DTMA 1FKPA 1T03B 2DNZA 2ZH8A 1QAYA 3JS9A 1RU2A 4OKJA 3VF6A 1HI8A 5GADU 1RDCA 3R6GB 2OPRA 2XG8A 3CJKB 3HFKA 2CDRB 1X7VA 3K5LA 1Y5IB 1WOOA 4NXNK 1YWXA 5GMKa 2XBPA 4LRCA 2HZAA 3SBMA 1H0HB 1ZPVA 3CD6N 3AGKA 3MXMA 1RHKB 2ZH1A 4NLUA 2A1RA 1CBKA 4PCQA 4WXOA 4L3QA 3BGOP 4Q45A 4NXNF 4C98A 3FSXA 4A61A 1GMWA 2MHEA 5EUHA 3O1LA 1HW9A 3V4IB 4HL9A 3ZXWA 1O51A 1Q18A 1TVRA 2DNHA 4FWNA 1H98A 4H0TB 4YOUA 2Z2ZA 5GAEU 2F9JA 2NYHA 2CPXA 3GDQA 3R3LA 3TANA 4Y34A 4DSLA 4ITSA 3HT3A 1GLAG 1HBNA 3OS0A 3KFWX 3KJQB 4NA3A 1LNQA 5AQWA 1VQ8S 1N5VA 3DKDA 3O1BA 3N79A 4CD1A 2ASPA 1NJIO 1AYEA 2ZDOA 2HGMA 4GMJB 3IBCB 3V6HA 4FVMA 4X66K 2JLEA 2YNIB 2EKNA 3JAMU 1JL2A 4L73A 3DM2A 1BO5O 1MG7A 1PBAA 5M2RA 2OPSB 2E5LK 5A0YA 4TQRA 2V94A 3TSUA 3UFCX 2ZH3A 2VC1A 2FHJD 1RAOA 1HR0J 2E5LF 4FJMA 4CO0A 4D3HA 1TK8A 2RJZA 2J6UA 3OTOF 4AHCA 4C8ZA 4OPAA 2DD8S 3CJAA 3T1HJ 4LF6J 4CEBA 4RNFA 4KAIA 3SCIE 4ECZA 1OH8A 1VQ5N 3H1VX 4ID1A 3BF3A 4ZPTR 1CZAN 4BCAA 1JXEA 4H5RA 3L4QA 4CF2A 1VBYA 2MZ1A 2QWNA 1WUUA 1JKHA 2GMLA 1RUSA 3K5NA 4RCHA 3UKRA 3A1YG 1FX4A 4O4RA 4BDPA 3MM8A 5SZTA 4I6AA 2H65B 4FWRA 3HCXA 5KG6A 2UXCJ 3D3CJ 4WF9Q 3LGNA 3WX8A 1RTJA 3FFKB 1DURA 2R4FA 4A8SA 2HNYB 3KG4A 4DV5K 2ZEJA 2J0QD 2FIUA 4DR7J 2UUTA 3AO1A 3KK1B 3A3NB 2EFOA 4LBPA 2XY6A 1TFWA 1X5OA 3CERA 1DGKN 2VWBA 3O80A 3R9PA 3CFPA 3RBXA 4DV5F 1T8EA 1OPZA 3THVA 2MKHA 2KB2A 3C6AA 5L1IA 1GMWD 4QIVA 1NHUA 4JKGB 4DG1B 2IM3A 2BUPA 4UUXA 4DZDA 2ROPA 1RZMA 1DFDA 4X4RA 4B3TJ 4GVEA 2DR6A 5FLXO 4KY3A 2D3O1 4J9KA 4DUZJ 1S6QA 3WC0A 3SSSA 1BHNA 1TELA 2GIRA 4JI4J 5CXTA 3AT1B 2RDIA 3JAMY 5L1LA 4K4XA 2DXDA 3CJ0A 2UVRA 1TYQA 3LM2A 2H4WB 5KT7A 1B3TA 5AQVA 2J0WA 4RUCA 1FRMA 4M3XA 5EX5A 3OYEA 4K4VA 5KFIA 1FT8A 2HZVA 4Q5VA 3UDCA 1N0VC 2RIJA 1FX2A 2YH0A 3GJQB 3M6XA 1LK7A 3RBZA 4H0XB 3SNNA 2DNLA 2XMAA 3K2YA 2I5JA 1P1LA 4KBOA 3ZEUA 3CJ3A 2NLWA 3NY0A 3UCGA 2YNGB 4LD0A 4BRIA 4OJHA 1FK9B 3MEDA 3D2EA 3IWXA 5J2MB 4ZVQB 2IDOA 2VQEJ 1HLUA 5KFVA 2YNHB 1X3MA 4KB1A 3A0IX 4CJFA 2N7CA 4ZTFA 2YCHA 4CFCA 1K1QA 3CG7A 1U1RA 3VZHA 3DJCA 1HNWJ 1EAYC 2DGTA 3PW5A 3UQSA 1SJFA 4EP4A 5GMEA 2P6SA 3BSOA 4BR5A 3OQ2A 5DRKA 5DDQC 3WNEA 1RK8A 1REVA 4USUA 4GRSA 2KG1A 4EZ9A 4CLFA 3ULHA 3CCMN 2AZ3A 1Q9XA 4NCBA 3VESA 2HSEB 4XTTA 3HD1A 4KJIA 1N88A 1WN7A 4JAXA 1V9OA 2KT2A 3M8ZA 4I67A 1RBLA 4IXCA 4F25A 1PC5A 4M5HA 2ZBCA 4BQLA 1ZM9A 4KB0A 5JLFA 3D2FB 3D6HB 3S7RA 3N6MA 1SKSA 2AHOB 2LYVA 1QVGM 3O3FA 3SLCA 3BM7A 3AVCA 4GVBA 2BQ3A 3THTA 2OPPA 2XMWA 3TVYA 4NPOA 1Y00A 1LW2B 2A1BA 2JRSA 1MMNA 2D0AA 2HOEA 2VDHA 3BBCA 3PHEA 2L9NA 1QVFR 3T5KA 1VQPN 2KXNB 3KLGA 2ABYA 4ETZA 3BQ2A 2XHCA 2IM1A 2D69A 1ITPA 4PY5A 3MTJA 1H72C 1WI8A 2P9KB 4ZTJA 1UPPA 1ZBIA 2W01A 5JXSA 3CJSA 3VVTA 2OPQA 3NAEA 3HHLB 1QLNA 4Q2MA 4Y0FA 3ISND 4BR7A 2P9GA 1A9NB 4P2SA 1W25A 3H08A 2W42A 3AA3A 4B8CA 1N5SA 3QGIA 1VR6A 1F0XA 2VF3A 1RADB 3C6TB 3A13A 3I33A 2GHVC 4YOWA 2O66A 5FD1A 2M5YA 4MTPA 4J2AA 1K6YA 3QFWA 1RAIB 3H42A 1GEHA 2K1RA 5KFEA 4ER8A 3A8EA 1SJQA 1UEKA 1YT3A 2W9BB 4XIUA 1S57A 4KKOB 2QMWA 2A1SA 2ZNZA 4CECA 2G0CA 5GIPA 1HMVA 4NLYA 4DSJA 1T3VA 5CE3A 1X4FA 2JJ4D 3QNWB 1NGFA 3OPKA 1RT7A 2V6AA 5BRHA 3CMQA 2D9PA 2XMVA 1NJYA 2IC3B 1U09A 1GOAA 4ZVSB 1UFWA 5CHCB 4F67A 1RAFB 3BSCA 1OH7A 3MPUB 2P2CB 1ACMB 1JJCB 4MJKA 3NGDA 5KGXA 1O1WA 2VFRA 1SL1A 1ZS6A 3T6JA 4X4NA 4EZ6A 2W6KA 5MAOA 1OVYA 3O08A 1UJ4A 3O5TB 3VF2A 1N36J 3VQTA 5CD4A 3OBWA 2X1FA 3QRPA 2YWEA 2ATQA 2HS3A 2EFPA 1KNZA 2N4DA 4FP9A 1FRIA 5GAHI 1VHIA 1S9FA 3DYAA 3M9OB 1FRKA 3HJFA 5M1NA 5C0YA 4ELUA 2V0NA 2DNKA 3IMQJ 4FF4A 4CFDA 1Q86T 1EWRA 3HPOA 3QO9A 3L3CA 1S0MA 1Q8IA 1S1VA 1WC5A 1VSKA 4W5QA 3KOAA 1RHJB 3WNFA 5JS1A 1X0PA 1CXUA 2C3OA 1N32K 5KT5A 1MWZA 5F9LA 1VQKS 4FJKA 2CNNB 3M8WA 2P9UA 5HMXA 2YPZA 1TKTB 1WWHA 4QWDA 1JJHA 1UOCA 2HPUA 1JJ4A 1ATSA 1N32F 4LRBA 4KV8B 3MPDA 3Q2SC 4DQ8A 4OI6A 1R31A 4Z4EA 4FZVA 2IM2A 4HLBA 4M5NA 1UAWA 4H0YB 3IS9B 1EQYA 1T9VA 1NXIA 3UCUP 1KVJA 3ZZRA 4CBXA 3E2EA 3N5BA 3BS9A 4IOXA 4DL7A 4UQGA 4RU2A 2ZQBA 4B1XB 2MKCA 5KPZA 2L08A 4WQ5A 2BA9A 3DOMB 2WZ1A 4NLWA 3CQ8A 4F4ZA 4LQ9A 1GOBA 5KT6A 4FZXC 3SBGA 1XWLA 2XYGB 1RAJA 2J7KA 4B3OA 4DB3A 3L7OA 2VZ9A 2HQFA 4PG7A 5KG4A 1VC0A 1B0PA 2CRLA 5GAGI 3HVTA 1T11A 3Q8PB 4RW7B 2CPHA 5L38A 4ECRA 3KK7A 1CJVA 3TZYA 6FD1A 4DWIA 1MROB 3IN5A 4DPOA 3FCHA 2W9CB 2IMWP 1NBWA 4XPCA 3HHEA 1VI7A 4OMFG 1LOTB 3T6BA 3D2WA 2AJ1A 3M1VA 3DLKB 5L9NA 3RW7A