1RT3A

Azt drug resistant hiv-1 reverse transcriptase complexed with 1051u91
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
536
structure length
520
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title 3'-Azido-3'-deoxythymidine drug resistance mutations in HIV-1 reverse transcriptase can induce long range conformational changes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 135
structure length 520
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt3A05
2RPIA 2KZZA 3MFIA 4WYLA 2HNDA 4Q8FA 4LH4A 1TK5A 3TAQA 3VA0A 1TKXA 3LP0B 5KFVA 5J2NA 4FM2A 2HVIA 3KK2B 2AX1A 3LP3A 1Y97A 4IDKA 3BREA 4ED2A 3MXIA 1ASVA 3QIOA 2IOCA 4NLUA 1WNSA 1S1VB 2OPQB 3BSCA 3KLEA 4E89A 2DPJA 4O44A 3HPOA 4IFVA 1U49A 4EBEA 5DQHA 2WRMA 4DS5A 4ECVA 3DDKA 3V6DA 1IKWA 4G3IA 3KLFA 4ELVA 3TQ1A 2FBVA 2G8VA 4IH6A 4CHQA 1HRHA 3DLKB 3GIIA 5EWGA 1KRPA 1UAXA 1EX4A 1XC9A 1BIUA 1VK0A 4HCBA 5KFLA 2ZE2A 1TL1B 5KT3A 4KV8B 2FBYA 1WAJA 4M95A 4DQPA 4JUZA 2B4JA 4Z4FA 4G1QA 2J6UA 5C5JA 2R8GA 4RG8A 3V6JA 1R0AB 1L3TA 2XRIA 4XO0A 3EZ5A 4IH7A 3AO3A 4RNFA 4FYDA 3SQ1A 4F4XA 3MR3A 4I7FB 3DRSA 4EP4A 1S6PA 1T05B 1S1VA 1NKCA 3ALYA 5F8JA 4FBUA 1EETB 2HNYB 4EP5A 3QLHB 3M8PB 4EEYA 3V9WA 2UUWA 1S1UB 1ZBHA 3QO9A 4DF8A 1Q9XA 4J9QA 2YNIA 4TXSA 3SFUA 4CGHA 2FVRA 3CDUA 3GQCA 4FJNA 3L3UA 4NLDA 1F21A 4R8UB 2Z1IA 1RTIA 1SUQB 1SKSA 3HVWA 4KV8A 5D3GB 1SL2A 2XGQA 3OYNA 4CFCA 5KFJA 4F2SA 2ATLA 4ZP8A 1TL3B 4WFZA 4Y1CA 4NLYA 3K5OA 1ZETA 1RAJA 2DFHA 2BQ3A 4I7FA 3BQ1A 3WNEA 3QIPB 1D9FA 2OZSA 3AVHA 3TAEA 1EETA 2XI3A 3MFHA 3LP1B 1C0UA 4XPCA 4O4GB 3VQ7A 1S1WA 3QLHA 3IRXB 4ED0A 2Y1IA 3NE6A 4ELUA 3SV3A 5J2MB 3NGZA 4NYFA 4FK2A 5KG5A 1W9HA 4MH8A 4N41A 3DOKB 3OL6A 4EZ9A 4RUCA 4CFAA 3E51A 1REVB 1FKOB 4CGJA 3NGIA 5D3GA 4OPJA 1VSMA 4PWDB 2ILZA 1BL3A 2ETJA 4MIBA 4TY8A 1C1AA 4M42A 3LP2B 2FVCA 4FVMA 4KE5A 5KFIA 1VSEA 2XGPA 3D28A 4ZP7A 1TL3A 3SI6A 3MR6A 3ZSQA 2KFZA 3PX0A 4QPXA 2Z1GA 4TYBA 2X6NA 4J2AA 3M8QB 3TR8A 3ZSOA 3EY1A 2KQ2A 3AVGA 3KMQA 3LP1A 3PZPA 4OGCA 5DG8A 3IRXA 1RT2A 4DFMA 3S3OA 3VQEA 4KI4A 2QV6A 5KG3A 5J2MA 4DTMA 4I2QB 4F4YA 3KOAA 3DOKA 2W42A 4F4KA 1LW0B 5CY4A 3ZSRA 3CJ4A 4ECYA 4IFYA 4PQUB 4CF1A 4BE2A 1I6JA 3CFOA 2HHVA 3NAEA 2XWYA 1NHVA 2R2UA 5KFGA 3ITHB 4M41A 4DTOA 2XCAA 1TK8A 3AO2A 2VG6B 3OJUA 4ZPDA 5KFDA 4CJVA 1HMVB 3NHGA 2Y1JA 3KNAA 2R8HA 1KFSA 2FBTA 3M8QA 4I2PB 4C8NA 4B3OA 1RT3B 5KFMA 3PV8A 3LAKA 3U3YA 2KZMA 3ZT4A 3HT3A 1RBUA 4FJ8A 1HARA 5KFWA 2V9WA 1NOZA 4CE9A 3PHEA 4ECRA 4I2QA 2CKWA 3CJ2A 4KB1A 1SV5B 5KFFA 3V9SA 1FK9B 3DRRB 4PA1A 1TV6B 1XR5A 1B92A 4L8RB 4EZ6A 4DTSA 4PQUA 3I0RA 3V1OA 2XY8A 4CK3A 2UVUA 3TVKA 1J5OB 4CIGA 4YNQA 1BISA 3OYGA 1Z26A 2OPPA 4ZVEA 1ITGA 3K5NA 5K14A 3S3MA 4K4XA 1S49A 1C0MA 4JV1A 1HNVB 4K4UA 4DTXA 1IKYB 1RT5B 3AVAA 1HMVA 1UA0A 3PVXA 2PYJA 4GW6A 4I2PA 4KO0A 4JRPA 3VQ6A 3IG1B 3LWLA 2W8KA 4HYKA 4FJHA 5F8GA 1S9GB 2BDPA 4FJIA 3AVFA 5KGWA 4ECSA 1TK0A 3AA2A 4N56A 3OYBA 4ZHRA 1HYZA 3OY9A 5FRMA 1SV5A 4C8OA 2WB4A 1UWBA 3NF6A 1N56A 4LH5A 4BDYA 5SZTA 1FK9A 3DRRA 3MECA 4K8XA 5CZ1A 3K5MA 1TV6A 4CEQA 2F8SA 1QAIA 1KHWA 3T5JA 3RB4A 4WXOA 2BRKA 4B8AB 1T03A 2CJQA 4N5SA 2AGPA 3HHKA 5FDLB 1D5AA 2KTQA 3KD5E 1RYRA 3AVBA 1RT5A 3VQQA 3G6XA 1RTDA 4TY9A 3AA5X 4C8KA 4CERA 2FC0A 3MTKA 4E1MA 3K57A 5SWMA 5HROA 3IG1A 4ZP6A 2FJXA 3O3FA 1D1UA 1K1SA 5J2QA 1XR6A 4Q43A 3AVLA 4ZVHA 2W9BA 3O4NA 4FJGA 2W9CB 1WSEA 4AHUA 1KLMB 3K2PA 4IRCA 3DM2B 5DLGA 1S9EA 1XI1A 4FM0A 3MAQA 2UVWA 4QWEA 3HJFA 4E7JA 3NGDA 1U4BA 5L9XA 4IBNA 3KLGB 3EPIA 3VA3A 2VG5B 2P5GA 2AQ4A 1VRTB 4RW8B 3HSTB 1YTAA 2GV9A 2JEIA 5FDLA 5EWFA 3BJYA 3FSIA 3VQ8A 4KPYA 4O3PA 3SNNA 4NYZA 4NLVA 4CJUA 3BQ2A 4NRTA 3B6OA 1NKBA 4FJMA 1RA7A 3RRGA 4K4VA 4QWDA 5EDWA 1T8EA 4DSEA 3VQBA 4H4OA 1ZTTA 1OS5A 4BE1A 1N5YB 1EP4B 1K6YA 4Z4GA 3QEVA 3KLIB 3KKSA 4RW4B 4RW9A 3KMSA 2R8IA 1KLMA 2RF2B 3LPUA 4Q44A 3EYZA 1BQMB 2C2RA 3VQCA 2VA2A 3ISND 1KSPA 4TN2A 4ZPBA 2OPSB 3OYMA 1JLEB 2VG5A 4ZVGA 3H4DA 1SL0A 3V81A 4ED1A 4M3XA 1W0HA 4RW7B 2YNFB 4B9UA 3NBPA 3OYKA 1VSIA 3FFIA 3NCIA 1BQNA 2DFFA 3KHRA 4CF8A 3QGGA 4JV0A 5C25B 4WYWA 3C95A 3HVTB 5J2NB 1JKHA 4B9SA 4KI6A 5KI6A 4Y1DA 1S1XA 1JX4A 1ZBIA 2G8IA 3AVJA 4IG3B 3GIJA 2IBKA 3G0ZA 4KHYA 1CXUA 2ZQBA 4DU1A 3LDSA 1IKXA 1JLQA 3KLIA 3I0SB 2IA6A 5KFQA 2YV0X 4Z4IA 4RW4A 4GMJB 3KLEB 4DSIA 2G8HA 5F9NA 4ID5A 4O44B 4IFVB 1BQMA 4MFBB 1NK7A 3SFGA 4EYHB 3CFRA 3GYNA 3T5HA 3V6DB 3GIMA 1JLEA 4M3TA 1G15A 1IH7A 4ELTA 3AVCA 3KLFB 1WSGA 4RW7A 3H5SA 4Y34A 3HXMA 3NL0A 4WFYA 4FS2A 1GOCA 2X6SA 4LY7A 2HNZA 4AHSA 1NHUA 1RTHA 4HUFA 4J9LA 4O3OA 2Z1HA 4FK0A 1Z4UA 2ZE2B 2R8KA 3AVIA 2WHOA 1JLFA 3HPGA 3N6LA 2YNHB 5C25A 4CK2A 4G1QB 3HVTA 3RR8A 2ASJA 4OL8A 4FW1A 1T3NA 1IM4A 4FXDA 4IG3A 2IJFA 2Q3SA 4M94A 4FS1A 3RBDA 3DRSB 1S6PB 5EWEA 3I0SA 5KFKA 4C8MA 3OL7A 3WNHA 2V4QA 2PY5A 3QETA 3SYZA 4TQSA 3ZSYA 1C1BA 2C2EA 1YTUA 4MFBA 2F8TA 4B9MA 4CEAA 2FVPA 1NK4A 5F8HA 3QO9B 4DSJA 2YNIB 1UA1A 5F8IA 4E1NA 3B6PA 5KFNA 4LD0A 1N48A 4FZXC 1RNHA 3C6UB 2BR0A 4KKOA 3PW2A 3DLGB 3QEXA 1WSJA 1LWCB 4MKBA 4DWIA 1SH0A 3P1GA 4GC7A 1RTIB 1RDRA 2EX3A 3Q8RB 4ED8A 3CM6A 2E9RX 4QW8A 4DSLA 3JYTA 4DFPA 2YNHA 3ASMA 2YHAA 3OYDA 2VG7A 5KTQA 1A5WA 5C42A 2FLPA 2P5OA 4IKFA 4ECTA 4W5OA 3Q8PB 2ZD1A 1KVAA 1TVRB 3RMDA 5KT2A 3AO5A 4F50A 1SKRA 3H5XA 2HHTA 3QEIA 3U3GA 2OPRB 1EKEA 3NAIA 3FDSA 3RB6A 4FLVA 4ZPCA 3LZJA 1C0UB 2PYLA 3ZSWA 2O4IA 2YHBA 1S1WB 4AILC 1RT7A 4DSKA 4Z4HA 3CIZA 5JXSA 4F3TA 1CXQA 4CJQA 4CJ3A 4NLPA 1MU2A 2IJNA 3MEEB 4O0IA 3OLBA 3ZT0A 3NDKA 3C6UA 3DLGA 1LWCA 2C22A 4ED3A 1HPZA 1JXLA 3JSMA 1RBSA 3M9NB 4DTUA 4IQXA 1NK8A 4TY8B 3KLHB 4KTZA 4X2BA 3MXJA 1SH2A 4FJ5A 3SPZA 4ZPAA 1VSLA 2B5JA 4FLXA 3AV9A 4K4SA 1TVRA 1JLAB 2FBXA 1NJWA 2HAIA 3BQ0A 3ULDA 4W5QA 3DMJA 5F9LA 1NK6A 2OPRA 1B9FA 3IN5A 1RDAA 4K4WA 4XPEA 3EPGA 4ICLA 4F4WA 2OZMA 1RT2B 3CM5A 1RBTA 4FLZA 3WNGA 3OYCA 1L5UA 3UIQA 3MEEA 4E7HA 2F8EX 4KAIA 4CJ4A 3IGNA 4KRFA 2I5JB 1TKTB 4IFYB 1RT4A 1NJYA 4FJ9A 2W8LA 4F4ZA 5DK5A 1S48A 3KLHA 3OSNA 4B9NA 3M9MB 3V4IA 1LW2B 3F73A 1RCHA 4YFUA 3G10A 5KG1A 1JLAA 1WN7A 4LSNA 4CIFA 3N6NA 3BSNA 4JS4A 4K50A 4KHWA 3CDEA 2UVVA 3T5LA 2JC0A 4EBCA 5KFSA 4B3OB 1QE1A 5EU7A 3Q8QB 2D7SA 3LPTA 2D3UA 5T14A 1A5XA 1LWEA 3IS9B 1B9DA 3LAMA 3KHGA 1WSIA 3SUQA 4J9KA 1BIZA 5DQGA 2GUIA 5JS2A 5DQIA 3SV4A 4JRQA 1DTQB 3RRHA 4AHRA 3NF7A 4CEFA 1RT1B 1BGXT 2D0AA 3V9UA 3S3NA 2I5JA 1TKTA 4Y2AA 3I0RB 4M3WA 4IRKA 3L2UA 4FJXA 2XCPA 5KFTA 2XI2A 3FRZA 3TI0A 2OPPB 3AVNA 2JEJA 1LW2A 1RBRA 5K14B 3CYMA 3O3HA 2RN2A 3L8BA 1J54A 1S97A 5T7BA 3PO5A 5JS1A 3CDWA 3PX4A 5HRRA 2YKMA 3PO4A 2IS3A 4KO0B 4NYNA 4K4YA 5KFEA 4DU3A 4J9RA 3H5UA 5L1LA 3V6HA 1HJRA 1KCFA 3SUPA 4XIUA 5KFBA 3SZ2A 4E7LA 3KIOA 1IG9A 4J2BA 3IS9A 2BANB 4UQGA 3KHHA 1U09A 3OHAA 2RDIA 1QS4A 1QSSA 5KG2A 4DEZA 5I3UA 3OYJA 4ZHRB 1KLNA 4CEZA 1UWBB 1DTQA 4YP3A 4MK8A 1RT1A 3MECB 5KFZA 2XHBA 3H98A 5KG6A 1FKPA 4M3RA 1HQUB 3NFAA 3ISNC 3I5CA 2AWZA 1T03B 4CJPA 4H4MA 4OVLA 2R8JA 3NGYA 4DFJA 5I42A 1HYSA 2JEFA 3T19A 4CJEA 3D5MA 4CCHA 3SUNA 4NLOA 2R7YA 1RTDB 2HWHA 4F8RA 4NLRA 4RZRA 4QWAA 1QSLA 4DQRA 4CHNA 1UOCA 5HROB 3H2LA 4CJWA 4H8KA 3KD1E 4FCYA 5J2QB 4WZMA 3PW7A 5KFXA 3DLHA 2YNGA 4Q45A 2BANA 3DLEA 2W9BB 3HP9A 1S0NA 3RMBA 2VWKA 3TAFA 1JIHA 4O3QA 4EO6A 2UUTA 3KK3B 4Q5VA 3P5JA 1ZYQA 1S9EB 5KG0A 2G8FA 2AJQA 1L3VA 1HQUA 3OYEA 1JLBA 5L1JA 2VWJA 4DFKA 2AGQA 4M45A 3LALA 2E4LA 2LSNA 1RILA 4KTWA 5KT4A 5HP1A 5KFYA 2X74A 3RMAA 4CIEA 1HQEA 2ASLA 2E9TA 1HNIA 2E6MA 3ZT2A 3OHBA 2XY5A 4J9MA 3IGVA 2HHUA 2XY7A 1RT6A 3PR4A 4URGA 3ZT3A 2WK4A 3K5LA 4CGIA 5CYQA 5F8MA 4DTNA 2P51A 2UVRA 3N6MA 2E6LA 2GBZA 4O3SA 2J6SA 4H4OB 4ED7A 4DL2A 3QERA 1KTQA 4RW9B 4CGDA 3CWJA 4GC6A 3KK3A 2V0NA 1RDDA 3HVAA 2RKIA 1JXBA 2EC0A 2IDOA 4K4TA 5F8NA 4KAZA 3SQ0A 2HHSA 1DTTB 4U6PA 2FVSA 2G8UA 3BGRB 1QHTA 2HMIA 3V81B 4YR0A 5KFOA 1T7PA 4DL7A 2AX0A 4H54A 3K58A 4MQ3A 4B08A 3OS1A 3NBPB 5F8LA 3FFIB 1ZBUA 3KK1A 3NKYA 1BQNB 3M9OB 4I9LA 3VQAA 2HWIA 4Q0BA 2IM1A 1KFDA 1RDCA 4NCAA 2DFEA 2O4GA 5J2PB 4WE1A 3O3GA 1N6QA 4KFBA 4OGEA 1JKHB 1QQCA 4YQWA 5KFCA 1S1XB 3TAGA 4URSA 5KFUA 4ZMMA 1IKXB 1JLQB 4RU9A 4DL6A 3TAPA 4AH9A 4F2RA 4ID5B 3M8RA 4I9QA 3DLBA 3UPFA 1YT3A 3NH2A 4F3OA 1DTTA 2IM2A 5J1EB 4ZP9A 3BGRA 4WZQA 3G86A 3TWHA 3V9ZA 4TLRA 3GV8B 3V6KA 4B9TA 4O3RA 4PUOA 2X78A 3Q8SB 1JLCB 5KT6A 2QE5A 2HNZB 4DL5A 1RTHB 2OH2A 1VRUA 1VSHA 1I3AA 3T3FA 1JLFB 4Z0UA 5J2PA 1NJXA 4BWMA 4FM1A 1T94A 3PUFA 4W5RA 3D45A 2BRLA 3OVNA 4DG1A 3NH1A 3TAMA 5EUHA 2OYQA 3KHLA 2D3ZA 5JUMA 3QZ7A 4RW6A 4IOBA 1SH3A 2ASDA 1C2PA 2D0BA 2HHWA 3UR0A 3H08A 4KHRA 3L2VA 4LQ9A 3QYYA 3DLRA 1C1BB 4HUEA 3RTVA 3VQSA 1DLOB 4CHOA 2HB5A 3PY8A 5J1EA 4FJKA 4TYAA 2FLLA 2F96A 1QTMA 5KRSA 1JLCA 1K1QA 1TKZB 5KG7A 4KKOB 4CEEA 3OYHA 4DLEA 1J9AA 1EXQA 2HHQA 4N47A 3JYTB 3QNOA 3PJWA 4Q8EA 2VG7B 2RDJA 5C42B 1GOAA 1JXEA 2A1RA 3RAQA 2ZD1B 5HRSA 4CJKA 3PW5A 1S9FA 3TARA 1L3SA 2O5DA 4CHPA 2KFNA 3PR5B 1MMLA 3DI6A 4NRUA 3OLAA 3S9HA 4R5PB 4OKEA 4EO8A 4KTQA 2G8WA 1Z25A 3OYAA 4CGFA 5DMRA 1RT7B 5KT5A 3VQDA 4CJSA 1DLOA 4BACA 4DTJA 4OJRA 2QKBA 4KHUA 1MU2B 1KVBA 1I39A 4YMEA 4BDZA 3TABA 1TKZA 2BGGA 4RNHA 2WCXA 2G8KA 3P83D 5DGAA 1HPZB 4R0EA 5KG4A 3JSMB 5KGXA 4U7CA 4BWJA 5C24A 4FBTA 1ASUA 1U48A 1X9SA 5CYMB 4OKJA 2B5JB 1QSYA 2IM3A 3U6FA 4JLHA 1X9MA 4MK9A 3F9KA 3DOLB 4DU4A 3G6YA 3RB0A 3AA3A 4TSXA 3KLVA 1X1PA 4E7KA 3DMJB 2W9AA 3NAHA 1C1CB 4R5PA 3THVA 1NNDA 2AGOA 3LP0A 4HCCA 3T5KA 4ICLB 3KK2A 1TQLA 1S5JA 4JS5A 5HLFB 3RWUA 3E01B 3ZCMA 5L1KA 3MEGB 3MF5A 3MR2A 4ECZA 3QEWA 4CF9A 3VQ9A 2OPQA 1RYSA 1TGOA 1WLJA 1XHZA 3PW4A 1RT4B 3TANA 2B43A 1W25A 5KFPA 1LAVA 4DMNA 3H40A 4KHMA 3GV5B 2HW3A 5CYMA 3V4IB 1BHLA 5HRPA 1QAJA 3VN5A 1VSDA 4FLUA 3DLKA 4LSLB 1A5VA 4LSNB 3DOLA 5HRNA 1TL1A 4MK7A 5FROA 3HKWA 4ED6A 2D0CA 4NLGA 4WXWA 1C1CA 5DG9A 4KB0A 1QE1B 1S4FA 3RMCA 1TKDA 1QUVA 3I5BA 1R0AA 4CESA 2FLNA 3A2FA 4DTPA 4M3ZA 4ECUA 1LWEB 5HLFA 4IH5A 3E01A 3MEGA 4DQIA 4C8LA 2IM0A 3QESA 1T05A 3QEPA 5KFAA 1S1TB 5FRNA 3NF8A 4ECXA 4QCLA 4NCBA 1TP7A 3I5AA 2NUBA 2HNYA 4B9LA 1J53A 3OYLA 3T1AA 3DRPB 3M8PA 1N4LA 2WOMB 4CEOA 4QWBA 1S1UA 4CK1A 1LV5A 3RR7A 4RNMA 3SJJA 5KRTA 5DLFA 2DY4A 1CLQA 4KHQA 3CQ8A 4ZTFA 4LSLA 2IC3B 2DTUA 4R8UA 1SUQA 2YKMB 3L2RA 1L3UA 1YVFA 2QKKA 2ILYA 4E7IA 2BQRA 4J9NA 4CF0A 2FVQA 1WSHA 4NZ0A 4HHTA 4J9OA 3OL9A 3QIDA 5KFHA 1ASWA 2J6TA 1C0TB 1S0MA 5I3UB 2A1SA 3MR5A 2FJVA 4CEDA 3G6VA 1S1TA 3QIPA 1VSJA 4RNNA 3MXMA 3HK2A 1NJZA 2IAJB 4O4GA 3DRPA 1FKPB 3K59A 3D0PA 2WOMA 1YVUA 4H4MB 5E41A 2JC1A 3UDLA 3SUOA 3HO1A 5I42B 4AHCA 4CHYA 3M8SA 1HYSB 3SCXA 4NLXA 2KW4A 4MKAA 3RAXA 3VQ4A 4FK4A 2IC3A 4FZZA 1GX6A 4E0DA 2ZKUA 1C6VA 1REVA 1FKOA 2GIQA 2XC9A 2XY6A 3V9XA 3LZIA 1U47A 4PWDA 2C2DA 4FLTA 3FQKA 3VQ5A 4LQ3A 3LP2A 4EYIB 3CJ5A 5KT7A 1NK5A 2YNGB 2W7OA 4URQU 4FLYA 3OYFA 3DLEB 4DL3A 3QGHA 1RA6A 4KBIA 3I8DA 1C0TA 3CVKA 1LWFB 1FXXA 4DF4A 4KHSA 2IMWP 4TQRA 3SPYA 1CZBA 4K8ZA 1BI4B 3PW0A 4O0JA 3AVKA 4FJJA 2IAJA 1S0OA 4QW9A 2JEGA 2BQUA 1JLBB 3OS0A 3BSOA 1U04A 3PX6A 1TAQA 3KKRA 4O5BA 1NOYA 3HYFA 4KB7A 4CJ5A 1LW0A 4IG0B 3HL8A 3C94A 3L2WA 4B8CA 3SQ4A 2C28A 1S6QB 5HP1B 1HQEB 1HNIB 4KREA 4O55A 4Z4CA 1RT6B 2PZSA 1XHXA 4CECA 3C6TB 5CYQB 4CHZA 3ITHA 1WSFA 3MEDB 4KSEB 2VG6A 4ECWA 4OPKA 2FJWA 4YR3A 1KHVA 1LWFA 1SL1A 4IRDA 3O4QA 1BI4A 1RT3A 4HKQA 4DSFA 2RKIB 2EHGA 1RDBA 3LWMA 2XO7A 4JV2A 4AHVA 5L1IA 1NKEA 1RBVA 4FJLA 2AU0A 2HHXA 4ID1A 2R2RA 4BE0A 2HMIB 1GX5A 3UQSA 4FZYA 3H5YA 3HPHA 1KVCA 3V1QA 3AO1A 3FQLA 3KK1B 4RNOA 1JL1A 4DQQA 4IG0A 5DG7A 4M3YA 2GIRA 1S6QA 4Q0BB 3SQ2A 2W7PA 1CSJA 4OKKA 1X9WA 4ZTJA 4WE1B 1ZTWA 1N6QB 3CG7A 1CZ9A 2WONB 4KFBB 2QXFA 4CJLA 2Z1JA 4FW2A 1J5OA 2OA8A 3QGIA 4MIAA 2JGUA 1D0EA 3RB3A 4O4RA 3C6TA 2ITGA 3MEDA 2GC8A 1HNVA 1S10A 4HTUA 1IKYA 4CGGA 3EZUA 1VSFA 1D9DA 4DQSA 3QINA 1U45A 4NCGB 4CFBA 1WNEA 4ZVFA 3HP6A 1NK9A 4Y2CA 4N76A 1TAUA 3NF9A 3H59A 1IKVB 4DLGA 3CFPA 4GVMA 1S9GA 4OLAA 1SKWA 4HUGA 2D41A 4B9VA 3KJVB 4O3NA 2D5RA 4PUOB 1XR7A 3L3VA 3DYAB 3OS2A 1VRUB 1WAFA 5HBMB 4M3UA 3KTQA 3H4BA 4IKAA 3CJ3A 3OYIA 3BDPA 3BR9A 4K4ZA 4J2EA 2WONA 4WFXA 2R2SA 3AA4A 2QK9A 1BCOA 4W5TA 4DG1B 3PJXA 3TAMB 5DGBA 1D8YA 4NLTA 4RW6B 4NCGA 1Q9YA 3NMAA 4YR2A 4Z4EA 3GIKA 4W5NA 2B6AB 3ZT1A 5CZ2A 3QNNA 1IKVA 3BSAA 4CJTA 3CJ0A 2DPIA 4IR1A 4FJ7A 4CFDA 2VA3A 4QWCA 1ZBLA 4QOZB 4NLWA 3KJVA 1ZBFA 2W9CA 4BDPA 4CF2A 3OJSA 3HVRA 4E3SA 2YKNB 2IGIA 3DYAA 1Q8IA 4DL4A 3LANA 3DM2A 2ATQA 3ZSXA 5HBMA 3V1RA 2I1RA 4NLSA 1VSKA 4CJFA 3KLGA 4QAGA 3VQPA 3IAYA 4RUAA 1VRTA 4RW8A 3AO4A 4Y3CA 4J2DA 3OSPA 1BCMA 2R2TA 3GV7B 3RBEA 1IO2A 1XWLA 1JLGB 4ECQA 1RTJB 2BE2B 4CEBA 4AHTA 3DI6B 4FLWA 2HNDB 4J9PA 3ZSZA 3ZSVA 4J9SA 3QZ8A 3L2QA 1TKXB 4EBDA 2V4RA 2B6AA 3AVMA 4PY5A 4OLBA 4CJRA 3NH0A 1GOBA 1NK0A 3CO9A 4IDKB 4HVJA 1N5YA 1EP4A 1JL2A 3OL8A 1HYVA 1LAWA 4KHNA 2YKNA 2RF2A 3WNFA 1O1WA 5KFRA 2P1JA 2E9ZA 3GILA 2WTFA 4IR9A 2OPSA 5C24B 1IKWB 2JLEA 3ICLA 4DS4A 4E19A 3SI8A 2YNFA 4DTRA 4NLQA 3HM9A 2ALZA 2HVHA 1JLGA 1RTJA 2BE2A
chains in the Genus database with same CATH superfamily
4DX7A 3WIUA 2W4CA 3MFIA 4WYLA 4UQTA 3OR2B 3GBTA 2HNDA 4Q8FA 2IVMA 2DNMA 2QEXN 2PBDA 5LXYA 3VA0A 4FM2A 2CNLB 4ZVOB 4WTOB 3TR5A 4YB1P 1M1HA 4GKJJ 4L75A 4C3KA 3ZX2A 1S1VB 2VFTA 1KDNA 4RU2A 4ES3A 3MOJB 1U49A 2WB1D 4DS5A 2QSWA 4NXNK 2P6SA 3D6RA 2FBVA 1JCEA 3DLKB 1KRPA 3MAHA 1UAXA 3BGUA 4Y65A 3FGUA 3BGOP 2VOPA 1M0SA 1Q8BA 4KV8B 4A8WA 4BR9A 1J27A 1WAJA 1V6HA 3Q2SC 4A8KA 4Z4FA 3QFWA 2OIHA 3VQTA 2FB0A 4IH7A 4RNFA 3AO3A 3CMEN 4JKGB 4DR6J 4EP4A 1S6PA 3OT9A 3PACA 5F8JA 1ZPVA 2N3LA 2DY1A 3KK7A 2NUUG 2H54B 3IBWA 4EEYA 1Q5VA 5AZJB 2E20A 2OELA 2PE8A 1DGKN 4K42A 4TXSA 3H7HB 3GQCA 3MZIA 2CJBA 4M5MA 4M1KA 3CCUN 2K7JA 2F7TA 4OYOA 4BRIA 1WC5A 4LRCA 2Z1IA 1RTIA 3WXIA 2ATLA 3E3XA 4ZP8A 5C7PA 3S41A 2HFUA 5C2CA 3J7AN 3NRBA 4IDHA 3OBYA 4CZLA 4KHPK 1N8RT 3N79A 2DFHA 2BQ3A 2LQ8A 5HN0A 2OZSA 3LF0A 1MW7A 3AVHA 1NU4A 4A8SA 4P74A 1C0UA 1S1WA 1VQ6S 3AQOA 3IRXB 5ITHA 3C65A 4ELUA 1FRHA 4FK2A 4N41A 5BRDA 5BN9A 1UKUA 1BE4A 3E51A 3IRWP 5D3GA 2ETJA 2H4WB 3OTDA 4TY8A 4AQYJ 3ID8A 4M42A 3KG1A 2FVCA 3G25A 1VSEA 3F44A 4DR6F 2E2OA 5DRKA 3ZSQA 4LFAJ 1YIJN 2Z1GA 4J2AA 1T6DA 3EY1A 2CQBA 3PZPA 4DR2K 2B0GA 5DG8A 1NPKA 5CCMA 3U02A 2Z58B 1FJ7A 2QV6A 3G8TA 2WBMA 1KQGB 2CPZA 5J2MA 3O4WA 3D1QA 3I9ZA 1LW0B 1IBCB 2D69A 1R6VA 2QL5B 4ECYA 1WDTA 2ASOA 4IFYA 4PQUB 1B70B 2HHVA 2HFNA 4A5AA 3I33A 4JI0K 2FPHX 3BYRA 4CJVA 4J5OA 2Y1JA 3W0LA 1KFSA 3OTEA 3M8QA 4C8NA 3VWSA 3QNWB 4KC5A 3CCVS 3D7SB 1K47A 2F9DA 2BA9A 5L38A 3RRKA 3IWNC 5AQSA 3HT3A 4X65J 4MKYA 4FJ8A 4DI6A 3JAMU 1X4HA 2ZNYA 5LL6d 3FUYA 2V9WA 1XJWB 1NOZA 4RX6A 3KVGA 3PHEA 1W2BR 4I2QA 3MM6A 4PEOA 5KFFA 3MK6A 1RLDA 4AQYF 1PKUA 4KIAA 4DV7K 3EEQA 2DGQA 3EGVA 4DTSA 3I0RA 2Z30B 2GGPA 2ZHBA 2XY8A 4LFAF 2P9SA 1J5OB 1NPRA 4CIGA 3PRBA 1ITGA 1RKJA 2Y8YA 2EFVA 1HNVB 4DTXA 4JI6J 2AZ3A 1KN6A 1D4XA 3AVAA 2DITA 3PVXA 2PYJA 2JWLA 1RWUA 3GPAA 3PIPL 1ZH5A 4I2PA 2AIRB 4ZVPB 8RUCA 2B56A 3LWLA 1RAAB 4RBVA 3QJLA 4DV6J 1ZAXA 5F8GA 4OZ2A 3DCAA 3K17A 2J76E 2BDPA 3AVFA 2GZOA 4I69A 5KGWA 3KJNB 4C7QA 2RDDA 2WBRA 4N56A 1FDBA 3NS5A 4BRNA 4MYTA 5FRMA 2WB4A 2FQQB 1CBKA 4Y0FA 6AT1B 2VBXA 3VTHA 2L9WA 1FK9A 5SZTA 3WXJA 5LJVA 5CZ1A 1H7XA 3CJ9A 1QAIA 3AAQA 4H0YB 1OMSA 2CQPA 2CJQA 1VBYA 5GAGU 4DR2J 3HHKA 5CH7B 1D5AA 2VFSA 4CLPA 2Y1RI 2Y8WA 1RWPB 2B9XA 1A6LA 2FDNA 4X65F 2CIMA 3C16B 5A0YB 3CCRN 4BC9A 2J7WA 2OMLA 3AVLA 2H5JB 2J8AA 2VPWB 2W9BA 4KHPF 4CH0S 2HK3A 1TYQA 3VZIA 4JI0J 1YQHA 4AHUA 1J2VA 2E1YA 2BJEA 3DM2B 5DLGA 3UKRA 1S9EA 1XI1A 1KVJA 4FM0A 3BEXA 3HJFA 2QMUB 3NGDA 5L9XA 4KH0B 4OJ3A 4ANEA 4JI6F 1VRTB 4CZJA 1YTAA 2GV9A 2J8SA 4FF4A 1GEHA 5EWFA 3PHTA 2GO8A 4OFZA 4DV6F 3BQ2A 3UVJA 4ILHA 2IDEA 2HQFA 3CCJS 4QWDA 2ZH6A 2GQ2A 3VQBA 3SMPA 4Z4GA 3U1NA 5JVGQ 2QJ3A 3VF6A 2WVEA 1FJGJ 1PJ5A 3KMSA 4RW4B 4RW9A 3EGWB 3PSFA 2M70A 4Q44A 1N36J 4IWVA 3EYZA 1VQ8N 3WDOA 4DR2F 3ISND 4TN2A 2RE2A 3RW6A 1RADB 1OVYA 3D1OA 3NBPA 3LDNA 4OYXA 3ET6B 3KHRA 1GMUA 3WQTA 4WFBL 5G0RA 2ZC4A 1VDHA 3F9MA 1F5BA 4B9SA 3DKDA 1IWGA 1NLVA 4JI0F 1ZBIA 3AVJA 4XH4A 2N7CA 1K8AO 2IBKA 2MZJA 2ZQBA 4WQ4C 2CJ9A 4LBIA 3NY0A 1JLQA 3KLIA 5KFQA 4Z4IA 1SB6A 2F8MA 2G8HA 3PRDA 4ID5A 4O44B 4ZN3A 4XDCA 1U1NA 4NYPA 1JLEA 4YDXA 1YF5L 5AXMA 2QEXS 3RSEA 3KLFB 4IOCL 2VONA 4RW7A 2DHGA 3NL0A 4WFYA 2DEIA 2VC1A 4FS2A 4LY7A 1R7IA 5K8NA 1NHUA 1RTHA 4S0MA 1NGIA 4DV7F 2ZE2B 1QD1A 1OQ6A 3P3DA 2R8KA 1CJTA 4H03B 2WTUA 3T9ZA 5IFMA 2BJ8A 4C11B 2UZAA 2J0SD 4FW1A 4FZVA 1IM4A 2O67A 3BPDA 2IJFA 1N36F 2H51B 4M94A 4M5KA 1BWVA 3UO0A 2PA8D 4Q2MA 2CYYA 2G0JA 4RKUC 4C8MA 5KFKA 3WNHA 3CCMN 3HMJG 3W8GA 3QETA 2ZJQQ 1VQON 5DDPC 4TQSA 3QQCD 4WKYA 4JBCA 1YTUA 4B9MA 2V7ZA 2QWOA 3VETA 4PQAA 4CEAA 1NK4A 4G1IA 4WFAQ 1GXTA 4IUFA 4EI2A 1SAZA 4JI3K 4DCPB 2OLWA 2GS8A 4MKBA 1LWCB 1FJEB 1WSJA 2O8EA 3CMES 2OHDA 4GC7A 3Q8RB 2UP1A 3JYTA 3OQ2A 1AA1B 3SAHA 2VG7A 1N54B 5KTQA 5AQOA 3DRYA 5FPEA 3Q8PB 2ZD1A 4CO5A 1TVRB 3PDNA 1QQOA 2LEBA 4NA2A 2PO4A 3CJQA 2O8BB 1PYTA 1SKRA 1YLXA 3QEIA 2OPRB 3U1LA 4PHTX 2AEMA 1HBOA 4Z4HA 3CIZA 5JXSA 1WHXA 2J9DA 3TOQA 1RFQA 4CJ3A 3CGIA 4BR0A 3AB4B 3NMRA 4Z94A 4PKGA 3ZT0A 4ES1A 3J7ZO 1F5CA 1VQYA 3NDKA 2QLJB 2YJFA 4BC2A 1HPZA 3M9NB 3TUPA 3DXKA 5AJ3K 4IQXA 3O08A 3Q0AA 3D67A 2OEMA 2FLOA 5IV3A 3Q83A 3MXJA 1SH2A 2NSCA 1U8SA 3AV9A 3SDEB 4K4SA 2CNKB 2D1KA 2FBXA 1FWKA 5IT4A 4HT5A 4AE5A 2Z2LA 3IR5B 4BRHA 3DMJA 3GJSB 5F9LA 3AJ2A 3CJ8A 3DXBA 1NK6A 3HSCA 2A6MA 3OFFA 4K4WA 2F8HA 1D3WA 3EVMA 3H90A 4N8NA 2W1BA 4GMKA 1Y5LB 1RBTA 3JQJA 3O5TB 4O0NA 2I7PA 3LDLA 4A2BA 4WP8A 2FC9A 3EICA 5KOXA 1RAIB 2GELA 2J9CA 4KAIA 3AA8A 4OI3A 5CXTA 1YIJS 4FJ9A 4EHTA 5EX3A 5DK5A 3KLHA 2YPZA 3PSIA 3M9MB 2IVFB 3V4IA 3FZFA 4YFUA 1N52B 5KG1A 2M2BA 1JLAA 3IBFB 4CIFA 3HT0A 5HL7L 4OJGA 1KAYA 3N6NA 4C4WA 3MWTA 4JS4A 1WOPA 3T5LA 2JC0A 4EBCA 4JI3J 5F3ZA 1M5HA 5KFSA 1QE1A 5EU7A 4WK3A 3Q8QB 4DXLA 1R0BG 3EE9A 2D3UA 4A8MP 4FPBA 1LWEA 2GNKA 4LRAA 2CQDA 1HQ2A 1B9DA 1QHAA 1VQPN 1WSIA 4J9KA 3O8WA 2DNLA 1E4FT 3M8WA 4FSVA 4CEFA 3CPWM 1KWMA 3ZZTA 2D0AA 3V9UA 2KT3A 2CNOB 4Y2AA 4M3WA 3L2UA 4FJXA 1UVNA 3TSUA 5A8KB 1JMTA 2KXHA 3TUZC 1VQLN 1LW2A 3CYMA 3N4PA 3QSYB 3GE1A 1VK8A 3PO5A 3CDWA 1JJCB 4USHA 1C4CA 4FO0A 4J9RA 3V6HA 1KCFA 3SUPA 5KFBA 1N32J 1W26A 3KIOA 3IS9A 3KHHA 1X0PA 1UJ6A 1QSSA 4AT1B 3GYXB 2DH7A 3T1YJ 4ZHRB 4WU3A 2W01A 2XHWA 4CEZA 1GTEA 3CD5A 3MECB 2HQDA 5KG6A 1FKPA 4M3RA 3LGHA 2HBYB 1HQUB 1EQ0A 4DPYA 1BXNA 4H4MA 2CADA 4JI3F 4FWOA 2E66A 1EARA 5FLXO 3P4IA 4OZ1A 4FYWB 4EUVA 3UNYA 2C3MA 1WEYA 3CJKB 2NRXA 2GHVC 2CPEA 2K7KA 1NGBA 4CHNA 1KC8O 3H2LA 2JHEA 3KD1E 3CDBA 3DLHA 4WZMA 1MG7A 4OHVA 1SBRA 1VR6A 4Q45A 3TUJC 1RDUA 3HP9A 3RMBA 3MM8A 3W2VA 1RHKB 2DBBA 3T7ZA 3HFZB 1N0VC 1QTNB 3THYA 5EOYA 2OI2A 2UXBJ 3ATUA 2AJQA 4JD2B 5F0XA 2F9TA 1R6YA 1NB7A 3CJSA 4FPAA 2LA4A 3IUCA 4BR4A 3MM7A 2VBZA 3OYEA 3M2RA 1UZDA 4M45A 2F4VJ 5D6GA 5H1SV 2DR7A 3CCRS 3C66A 3A5NC 1S77D 3RMAA 1P8GA 1N32F 2V6AA 1HNIA 2QL7B 2AJFE 2XY5A 3O1BA 2C2NA 3ZT2A 2MZQA 1RT6A 2CQ3A 2MTLA 3R7SB 3K5LA 4JB8B 3T1YF 3OXLA 2P51A 2G2ZA 4GVBA 3CB4A 3I96A 5JLHA 3DHWC 4BVPA 3RU0A 5AQKA 3FZLA 3KK3A 3HVAA 2IYIA 4KAZA 3ID6A 1NNEA 1GLDG 3D2EA 1SVDA 1H2VZ 3BGRB 2DHSA 3BGLA 1QHTA 2HMIA 3V81B 5KFOA 1T7PA 3K58A 2UXCK 2GVZB 3HHLD 3NKYA 1BQNB 1SKUB 2CFXA 2NREA 4Q0BA 2O4GA 1IJFB 2HF3A 4KFBA 1JKHB 1VBZA 3VGVA 3TTCA 1QQCA 2NXEA 1VQ8S 3N5FA 2WSEC 2MDAA 2UXBF 2GV1A 3TSPA 1IKXB 3TAPA 4AH9A 3SQOP 1EQMA 1YDLA 3QICA 3UPFA 2F4VF 3NH2A 1JWWA 3NVMA 3AQPA 4QPTA 4WZQA 4U67Q 2H65B 1Y3KA 3V6KA 3L7OA 2I7NA 3NNCA 2QE5A 3OR1A 3SEOA 1MWKA 4DL5A 4M7YA 3ZEUA 1VRUA 3NGRA 1F5AA 5CD4H 3RVCA 4BRLA 1BLUA 4I0WA 1A7GE 3H46O 4W5RA 2BRLA 3EXYA 3TEGA 4JKHA 3PYDA 3B8HA 5ETSA 4DG1A 3NH1A 3TAMA 1FVQA 5JUMA 3A5OC 2RUSA 1SH3A 2MKKA 4PXCA 2ASDA 4M5GA 4IEEA 3L2VA 4YOVA 3UD3P 3OHRA 4LUBA 1H3DA 1P27B 4LQ9A 1UJ4A 4NASA 1IBMK 2UUBK 4AD6A 3ENWA 2LA6A 5L9NA 5LMNK 3ENQA 1SIZA 2HB5A 5J1EA 4FJKA 4TYAA 2Z2ZA 1RU1A 1JLCA 1K1QA 3THXB 1TKZB 3W1YC 5KG7A 3JAMY 4DLEA 3GCXP 4FWPA 4N47A 4ILLA 4OYMA 1T9WA 4Q8EA 3MPDA 2QYGA 1W7WA 5C42B 1JXEA 3CCMS 2CQHA 3CQXA 1VQOS 1BG3A 1S9FA 3TARA 3PR5B 1FNXH 3ZETB 4KGZB 5JMVA 4P7TA 3OLAA 3M30B 4X62K 4IFEA 4X4PA 5GIOA 4KTQA 2Q79A 2G8WA 1X4AA 1RT7B 2MKCA 3LH2S 4DTJA 4OJRA 3LDPA 3I82A 4YMEA 4I6MB 4BDZA 2YX1A 2BGGA 3MCPA 4RWXA 5DGAA 3P83D 3GIRA 3K0SA 3QBCA 4X66K 3MMCB 1V5VA 5C24A 4OYPA 5ETKA 1X9SA 1Q4RA 5CYMB 5LL6Z 3UD5A 2JH3A 1X9MA 4B3RK 4FPIA 3G6YA 2DRDA 1U1OA 1R8CA 5E3RA 3N0VA 3EUNA 4E7KA 2V2ZA 3THWB 4R5PA 2VHGA 4RO0A 3JSRA 1NGGA 3WXLA 4ICLB 1LWXA 2WC9A 2H3EB 2RRAA 3R27A 2R9LA 5L1KA 3MEGB 3MR2A 3RJMB 2QWPA 2OPQA 1EQYA 1X4DA 1TGOA 5L39A 1QVFM 4Y2IA 3GG1A 2B43A 3VEXA 4DMNA 3H40A 3P4UB 4NZ6A 1M5PC 4WWSA 4DQ8A 1RHQB 2D3O1 3VGLA 1VS3A 3TNVA 3QFPA 4C0OC 1YJNN 2OSQA 1R8HA 3MGJA 2V4JB 3M6VA 3JQMA 4NLGA 1C1CA 3TW0A 1ZXOA 3DLLL 1Y11A 2COLA 1R0AA 1I51B 2QSFA 2V7YA 1OY9A 4IH5A 2K06A 3E01A 4C1NK 1GMWA 1T05A 2ZDPA 5KFAA 4JK9A 5FRNA 4QCLA 3NF8A 4YB5A 2NUBA 2FYXA 2HNYA 3NNHA 3T1AA 1YBAA 3M8PA 4BQLA 2B4OA 4QWBA 5GAHP 1RCOB 3R5AA 3DWLA 1CLQA 5K5MA 5C2FA 3W62A 5KPZA 2O8FA 1GQEA 1WOOA 1J5EJ 4LRFA 4CYUA 1SUQA 2YKMB 3L2RA 2Q3PA 2ILYA 4E7IA 4CF0A 2B3TB 4HHTA 3W61A 4J9OA 5AQGA 3NNAA 3MN7A 5EX0A 4WTYA 3R1HA 1S5ZA 1S1TA 2MYFA 4RNNA 1VQLS 3GG4A 4V19X 2UUBF 3D4JA 4IO1A 4LF7J 4O4GA 3A5LC 4LF5K 4JI8K 5LMNF 3D0PA 2WOMA 3GJTB 3I9V9 1DARA 4CQ1A 1NSPA 2DKOB 3CNQP 3DGPB 2NPIA 4A8OA 4CI0B 3VQ4A 4FK4A 1F9HA 2V2VA 2ZKUA 2VQEK 1REVA 2HQ3A 1FA0A 3V9XA 3LZIA 2C2DA 4FLTA 3K8WA 1NK5A 5GAGI 1HR0K 2A40A 4QR2A 3DLEB 4LBHA 1PIEA 1HBUB 3FLCO 2DNNA 1FXDA 1TMMA 2IMWP 5GADP 2LP4A 3AD9C 2UU9J 3GONA 3BKUA 2N4DA 1TUVA 2J5AA 2JEGA 5BYRA 1JLBB 3MDQA 3OS0A 1E6YB 3PX6A 1ZPWX 1I94K 4P73A 1TAQA 3VAMA 2MSTA 2FSKA 3LGNA 3RBZA 3TEHB 2RQKA 4IG0B 2EK1A 1S0VA 4TU9A 2DGWA 2GWJA 1P90A 3C0BA 1IWAA 2ROGA 4CHZA 5KPRA 4TVAB 2KHCA 1WSFA 4KSEB 1WG4A 5MAOA 1SZ2A 3VVTA 4LF7F 1LWFA 3O80A 3A1YG 3O4QA 2X1FA 4HKQA 4DSFA 2VFRA 4WJBA 3O3LA 4HHJA 1NKEA 1Y5NB 3BF4A 1RBVA 2AU0A 3NGSA 1GLEG 4ID1A 4F36A 5ELZA 1OH6A 1GX5A 3BZQA 4KGVB 1HNXK 4EU0A 3AOBA 1K0TA 3H5YA 3PRVA 4FWQA 3FQLA 4B1YB 3MM9A 3KK1B 1U6ZA 4RNOA 1JL1A 3LDQA 4M3YA 1Q81O 4LVNP 3GE9A 2GIRA 1S6QA 1DY3A 1T9YA 4IYQA 1X9WA 4WE1B 1ZTWA 3BV8A 2OO4A 3OUYB 3Q7CA 2Z1JA 3J80U 3VENA 2YHYA 1Z2LA 4JI2K 3MEDA 3BZCA 1IKYA 4CD3A 3QSIA 4CGGA 3QINA 2DCLA 4CFBA 3HP6A 2PIIA 5BR8K 1IVZA 5GAEI 2DNGA 4JKFA 4IO8A 1VC5A 1IKVB 5K8OA 1Q86T 3OXGA 4B9VA 1SQKA 2R7WA 3UE5A 4PUOB 2GVDB 1QAYA 2MQLA 1WAFA 1YJTA 2OFHX 3KTQA 1PC4A 4B3TJ 3H4BA 4GVLA 3CJ3A 3CJRA 3BDPA 3LPEA 2R7RA 3UCGA 2R2SA 4PG6A 2P9IA 5E3PA 2WSFC 2ZGZA 1HBMA 1YRTA 4RW6B 4NLBA 1XN9A 3NMAA 4USJC 4YR2A 2KU7A 2KJWA 1WSVA 1HW9A 1M90T 3JS9A 2QG9B 1FNMA 3BSAA 3VF0B 1FCAA 4QOZB 4DHYA 1MWQA 2LXUA 1ZBFA 2ZC3A 4BDPA 2QRRA 4K25A 3HVRA 2G0IA 2IGIA 1RLCL 1M1KO 3DYAA 3LANA 5HBMA 3QPIA 3ZZOA 4PG8A 3A13A 4IOAL 3KLGA 2DXDA 4CZGA 3IAYA 3JB9k 1T02A 1ROFA 4BRDA 2EW9A 3P6YC 3GV7B 1IO2A 5AZIB 1JLGB 4LF4K 4ECQA 3HZEA 4AHTA 4FLWA 2PMWA 3HD2A 4ZIWA 1P9YA 1GXUA 3ZSVA 4J9SA 3L2QA 1TKXB 3C15B 5CHCB 3IR6B 4G65A 2B6AA 1Q8LA 3SLCA 2X3DA 2MQMA 2MSSA 4OZJA 3CEDA 4IDKB 1N5YA 1EP4A 4PKDB 4LC9B 2CPJA 4IJNA 4JHDB 3RBXA 2UXDK 3WNFA 2P1JA 2E9ZA 3I55N 1FDAA 3O9SA 4DCJB 4IR9A 5HAOA 1IKWB 1I94F 1W7AA 3TU5A 3H45C 4NLQA 4ZDNA 2BE2A 2EVZA 2KZZA 4QJVA 1HFEL 2JVRA 4QIEA 1TK5A 2GWKA 2CQIA 1B0TA 5J2NA 3TSQA 2HVIA 3AB2B 3H20A 5CA5A 3WEEA 3PYGA 3LP3A 1Y97A 3R5CA 3BREA 3MXIA 3A8YA 5A6PA 3QIOA 2IOCA 4X4UA 1Y4ZB 1Q0NA 4NE9C 3KLEA 3L6QA 3IC1A 4IFVA 5D15A 4CLUA 2C3UA 1EX8A 2YVSA 3I87A 2V2KA 3W60A 4ILJA 3P96A 2VJVA 3FEYB 1GLCG 5EWGA 1UTAA 2XLKA 4NXMK 2XYPB 1TL1B 5KT3A 2K3KA 3VAHA 3AY0A 3OR2A 4DQPA 4JUZA 4G1QA 5C5JA 3IA0A 5I9EB 3MPVA 3V6JA 4QYZJ 2PEBA 4LR8A 3W9HA 3EZ5A 4FYDA 4F4XA 3MHYA 4I7FB 3DRSA 4X4TA 5FLXU 1S1VA 2A3ZA 2KVQE 3DXSX 4YY3J 1NKCA 3ALYA 5M1NA 4FBUA 4IEIA 5BR8F 5D0EA 1EETB 4EP5A 3LW5C 4U95A 3QLHB 1OPIA 1YJNS 3D6HB 1GXLA 4KYZA 3JTOA 1S1UB 3G82A 2YNIA 4LFBK 3CF5L 2AEFA 1RWWB 3KUHA 2NXNA 1BY9A 1WHVA 1IQTA 1HNZK 4KBOA 5DM7Q 1LEOA 3ISZA 4R8UB 1WOSA 3J7YU 4KV8A 1SL2A 2XGQA 2UXDJ 3OYNA 4CFCA 5KFJA 4X64J 2P9LB 1GLAG 4JK8A 4F2SA 1VJWA 1VIXA 2GJ2A 5ETMA 4JKGA 3QFUA 1CJKB 3TYTA 1Q7YO 3BQ1A 4UT4A 3QIPB 3MXHP 1K9MO 3LP1B 3UFCX 3SBMA 4XPCA 3VQ7A 3VOVA 5BRHA 2Y1IA 5HATA 1ELOA 5AZJA 4JOUA 5DM6Q 1FHTA 2FHOB 5K20B 4BGBA 3NGZA 1W9HA 4MH8A 2HBLA 3DOKB 1YZ7A 2K8GA 3M2VB 4ZS6A 1FKOB 1WC4A 4OPJA 4DB3A 1VSMA 4PWDB 3FZBA 1BL3A 4MIBA 1C1AA 3LP2B 5KFIA 2XGPA 4JI5J 3C14B 4ZP7A 2LEAA 1MMDA 4QIGA 4FWNA 3U9DA 3MR6A 3PX0A 3VZHA 4QPXA 2X6NA 4NMXA 2O3DA 2C3PA 4QOTA 1GLJO 3KMQA 3Q8YA 1QAXA 3IRXA 1IR1A 3VQEA 4KI4A 3EGNA 3Q22A 1BWFO 2AEJA 2LDIA 1FVSA 2HHHJ 1PYSB 2UXDF 1YAGA 3KOAA 3E9LA 4L3KA 3R1XA 4DOZA 3ZSRA 2M88A 1TFYA 3W5ZA 4BE2A 1ZBTA 2YWEA 2Q1NA 4OZNA 2LYVA 2OGUA 5KFGA 2UUAK 3NS6A 4I67A 3OJUA 4ZPDA 3UD4P 1HMVB 4Z7CA 5MLCV 1B4SA 4XH1A 4B3OA 5KFMA 3PV8A 3LAKA 2Q97A 3U3YA 2KZMA 1IM6A 2ERRA 4DDFA 4LF9K 1HARA 5KFWA 1M5KC 1N5VA 2QLFB 4ECRA 3S8SA 2OMOA 2Q0UA 2XBPA 3V9SA 3DRRB 4BGAA 4DR4J 1TV6B 4A47A 3VHQA 4JI5F 1RK8A 3P8BB 4PQUA 2BW2A 3V1OA 5AQZA 1V3SA 4CK3A 5J1NA 2KI2A 4YNQA 1NLKL 2FF3B 2ZBIA 1Z26A 1S49A 2DRAA 1NO8A 3NLCA 2VQFK 2Q1LA 4GW6A 2EFQA 2ALYB 4KO0A 2QW9A 1R3NA 2VDIA 3T69A 3IG1B 1KR4A 4DR1K 1IBKK 3BPSP 1IR0A 2OEJA 4HYKA 4FJHA 1UZHA 2PC6A 4Q2LA 1KONA 1RQ0A 4JYAK 4LF6J 3OY9A 2AA4A 2GW8A 2ZH2A 5C2GA 4LF8K 1UWBA 5THWA 1N56A 4LH5A 1WKKA 3K5MA 3ZZPA 2F1FA 4EHUA 3T5JA 1Q7LB 3RB4A 4WXOA 3D7EO 4QIWD 4N5SA 2E1PA 4LFBF 2P6TA 2XYGB 1R0CB 5FDLB 1WTFA 2DISA 3KD5E 2H9ZA 3VQQA 1RTDA 3H6EA 1RAGB 2FZGB 4K0KK 4CLZA 4ZP6A 1F2HA 3O3FA 4QR1A 4B1UB 1XR6A 3MM5A 4FWLA 3FZ2A 3HHLB 3CCEN 4LSZB 2XLIA 4O5FA 2W9CB 4DR4F 1HLWA 1BWEA 2YH0A 1WSEA 1KTVA 5CZXA 4JV5K 1KLMB 2MGZA 1L3KA 3L7UA 1K8AT 2B8PA 1Q79A 4IBNA 5HVGA 3VA3A 2P5GA 2IPOB 2AQ4A 1T95A 1Y7PA 1NU0A 4FVUA 1VIOA 2FZCB 3FSIA 3FC9A 1Q16B 4KPYA 3VQ8A 3SNNA 4DJBA 4U7UK 4NYZA 2NRZA 4NRTA 1U1RA 3B6OA 3BF1A 8AT1B 2C42A 3MD3A 4LF6F 2QI2A 4H4OA 2EFPA 1W2IA 5ADZA 4PPZA 4OZ5A 2E7VA 4ZLPA 2LMIA 2RF2B 2P9PA 2C2RA 1D9AA 2KRBA 2CQ0A 1KSPA 5ADXA 2OPSB 3M2UB 1HNWJ 3U1MA 4BCAA 1SL0A 4Q7AA 4M3XA 3L4BC 2DNHA 3M8YA 2YNFB 3OYKA 3FFIA 4JYAJ 3LDOA 4DPXA 3LM2A 4YORA 4CF8A 3QGGA 1U1KA 4EFHA 1XNQJ 4ED4A 3PIOQ 4HTIA 1NGDA 2HIYA 4Y1DA 3BB5A 4FOIA 2CAJA 2BXJA 3I55S 1NSQA 3O9TA 4IG3B 1SC3B 3GIJA 4ZCLA 4YHHK 3JAMO 2Z56B 1T11A 2IA6A 2YHXA 4RW4A 2NPFA 2PI5A 4CO1A 5F9NA 4E98A 5GIPA 3CW2C 3D54A 2Q31A 4MFBB 4LF9F 1NK7A 2NUHA 3SFGA 4EYHB 3GYNA 3GIMA 2V50A 3MPYA 2DNRA 1G15A 3VR1A 3AVCA 1WSGA 1SPBP 3HXMA 4L74A 4Y6IA 3LPYA 1TELA 2CJXB 2X6SA 4YOXA 3SAGA 2HNZA 3S1TA 5FD1A 2WW4A 4HUFA 3MOZA 4O3OA 2Z1HA 3QT5A 2WHOA 3AJDA 3HPGA 4JKDA 2YNHB 3NOGA 4CK2A 3DU6A 2LU2A 2JZ5A 3J7ZT 1FRIA 2G2YA 4QU7A 2HZAA 1RTZA 4OL8A 2L9DA 2VDHA 2VQFF 2Q3SA 2HVEA 4FS1A 3RBDA 1FDNA 1S6PB 1Q82O 3PYFA 1R89A 3C6AA 2VOOA 4C6AA 1H2TZ 1YBTA 4B1VA 3HZ6A 2C2EA 2EI5A 2XMKA 2FVPA 2DIVA 4WFNL 4DSJA 2CPDA 1RAEB 2FIUA 4JYAF 5F8IA 1UVKA 1MMNA 4FXVA 1WF0A 4RR5A 1XNQF 2NRWA 4KKOA 3PW2A 3DLGB 1NCLA 2F4FA 3P1GA 2IVOA 1RTIB 2PFDA 3ZNUA 1YHQN 3ASMA 5A76A 2YHAA 4C11A 2P5OA 4IKFA 1NH8A 2J7UA 1KOOA 1KVAA 4FL9A 3SSRA 3AO5A 2DR8A 2QLBB 2L3MA 2KKHA 2F9WA 3JXOA 3M6UA 3U3GA 4OZ3A 4FLVA 3A8EA 1OYEA 1Y3JA 1C0UB 1MN9A 3CCLN 2O4IA 3D0IE 1S1WB 4UZCA 1VRQC 3CERA 3SMSA 2M8HA 3DOMB 1VOMA 4CO4A 1EWQA 1NEEA 3Q8UA 4F3TA 1CXQA 2XG8A 4CJQA 3CUNA 3MN9A 1MU2A 4JV5F 1WG5A 2YPYA 4R25A 3MEEB 4C98A 4ZLNA 1LWCA 2J0WA 4ED3A 1JXLA 2KM8C 3SBTA 2FJEB 4DTUA 1NK8A 4LFCK 4TY8B 4LT6A 4DR7K 2ZUGA 4WKRA 2N4CA 1CEZA 2YWGA 4X2BA 4FJ5A 3SPZA 4ZPAA 2B5JA 1U6BA 1TTHB 1TVRA 4FF1A 3QBXA 2KKZA 2Q43A 2HRYA 2ZWHA 2O8BA 5CQGA 1QJHA 1NJWA 3ULDA 5FIIA 1VBXA 2O8DA 2OPRA 2NZ4A 1B9FA 1QDUB 4ZVTB 3BYPA 4XPEA 1DFDA 3J81j 4OHWA 1TUGB 2IA0A 4AYBD 4YN3B 3QBWA 4UUXA 3OYCA 3R5BA 5DDOC 5GMEA 2F8EX 4E8UA 4CJ4A 4KRFA 3WXKA 2I5JB 4DV4K 4IFYB 5JMNA 4LR9A 1NUEA 3RYLA 2ZH4A 3K8VA 4OYWA 3G10A 3AODA 1WN7A 4LSNA 5B0AA 3BSNA 5FJ4A 1N34K 4KHWA 6FD1A 1HHQA 1CS4B 2ACMA 4JI4K 4J9VA 3WQPA 2CXEA 4ZJLA 1YJUA 1U02A 2V8GA 5HSPA 1MSWD 4DR3K 1R8BA 3MWPA 3LAMA 4CZCA 3KHGA 3SUQA 3EZWA 1KC8T 2GUIA 2HS0A 5AQFA 1HWLA 3RRHA 4XAKA 3NF7A 4BR5A 1RT1B 2QMXA 4PRFA 1PJ7A 3S3NA 1JNZB 3Q86A 2DH8A 3I0RB 4IRKA 3T1HJ 3A3NB 2XCPA 2P9SB 5KQ8A 1WTBA 2XI2A 1N88A 4DUZJ 1RBRA 2FY1A 1FERA 4BS2A 3O3HA 2Q6BA 1J54A 4HDHA 1S97A 1X31C 3PO4A 4CWBA 5IC4B 4M5DA 5KFEA 4DU3A 2O66A 3H5UA 1NGHA 1YUWA 4E7LA 4UQGA 4WBFA 4I6AA 2KDOA 1U09A 2RDIA 2BX6A 3PCOB 3FBCA 1BHNA 5AQMA 2CRLA 3FJ2A 3TA2A 4CZMA 3OVAA 1VFJA 4KPCA 3NFAA 5A8KA 4ZOSA 1GFWB 4OVLA 2R8JA 2CPHA 1HYSA 4AL7A 5HK4A 3T19A 2LDYA 3DXMA 1H1VA 4CJEA 4I1TA 4DR5J 4ZITA 4CRJA 2WBNA 2R7YA 2HWHA 5FPDA 4QWAA 4CO2A 3FK4A 1EO1A 3HHNB 1XMOK 5HOOA 2EFNA 4CJWA 3U27A 2YNGA 1CJVB 1B0PA 4CVNE 2W9BB 1HHTP 1TYQB 4LIRA 3MCOA 4EO6A 2UUTA 2HRTA 4WP3A 3SQGA 3UKRB 1S9EB 4YOWA 2G8FA 1VQKN 2DHXA 2W2QP 5FLXY 4DUZF 1L3VA 3ONQA 1HQUA 2FF6A 4ETZA 2QT7A 4DFKA 1VQ4N 4CZEA 1CQMA 4DV1J 4BY9C 3LALA 2HBJA 2Y0BB 1SIWB 3PIPQ 3IAM9 2ZWOA 2JLGA 2E4LA 2LSNA 5IV4A 4OYZA 5AE2A 3CCES 2P9UB 2X74A 1HQEA 2E9TA 4LFCF 3BBBA 2E6MA 3UVJB 4DR7F 2FY8A 3OHBA 4J9MA 1VMBA 3IGVA 4QS7A 2XY7A 1IJJA 4URGA 2PMZD 2CQCA 2UVRA 3N6MA 2GBZA 5BPLA 3CC4N 1W97L 3QERA 2E1RA 4RW9B 2ZDOA 1ZOTA 2ZOMA 4GC6A 2V0NA 1RDDA 2RKIA 2CA9A 2XSJA 5F8NA 4U9RA 3SQ0A 4U6PA 1Q18A 2G8UA 4YR0A 4DUYK 1JCFA 4BR2A 4H54A 4J9UE 1OWXA 4USIA 3NBPB 1GLFO 4I9LA 2IJRA 4J37A 4H5TA 1HBNB 4KRWA 4WYBA 4DV4F 3TWZA 2IM1A 1RDCA 2P8IA 5G0RB 2DFEA 3ZZUA 4GKJK 1N6QA 3MMAA 3FZKA 4OGEA 1ATNA 2VASA 3TAGA 2LQ5A 1H38A 1N34F 5KFUA 3TJ9A 2ZM6J 4P7VA 4CZIA 2XNRA 3TTDA 1JLQB 1RP5A 2QL9B 3VF4A 2JWNA 3AHPA 1QUPA 4JI4F 3HTVA 4D3GA 4DV2J 4ID5B 3M8RA 5BYQA 1VQ7N 4I9QA 4DV1F 3DLBA 4KY3A 3C2PA 2E7WA 4F3OA 1NSKL 2QFIA 2YQ0A 2IM2A 4B02A 4NLCA 4OYAA 3AXKA 3BGRA 2KH9A 3RSEB 3G86A 3V9ZA 4TLRA 2WAQD 3GV8B 4USUA 4B9TA 4O3RA 1RGVA 1G6BA 1RTHB 2OH2A 3GOIA 3EDQB 1I3AA 4GNIA 1CJTB 2HEKA 4Z0UA 5IM0A 1BUXA 4BWMA 3BP8A 5DDRC 5HQ8A 3PUFA 3D3CJ 3EL2A 4DR6K 3QT8A 3D45A 1FTRA 4EK2A 3OVNA 3MCNA 4PKHA 4C0HA 3BN7A 3R8EA 2OYQA 1PCAA 4MDAA 1KS2A 1FD8A 1X7VA 4NZ7A 1CZAN 2MKIA 5C12A 1NBEB 2D0BA 2E5IA 4WQ5A 1YJRA 3H08A 2DNQA 5ETOA 4IJAA 4AL5A 1MN7A 3F41A 1NGEA 3D1HA 3KYLA 4I64A 4GO5X 2MLZA 1OY6A 3HCXA 3TO8A 3HBTA 3OTOJ 1YJ9N 2FLLA 2F96A 3ETOA 1P6TA 1QTMA 3TZWA 1UPMB 3ZYYX 1UEKA 4LMZA 5KRSA 4BRKA 4WFBQ 4F4AA 1O6XA 2LQBA 2O8EB 1J9AA 4V1Ak 2HHQA 3JYTB 4O8UA 2VG7B 2KXNB 2RDJA 2A10A 3IAS9 2ZM6F 1WSRA 3RAQA 4JI7J 2ZD1B 2MLXA 5HRSA 2RILA 3PW5A 1WACA 1M90O 2O5DA 2J0QD 4CHPA 4DV2F 3NVKA 2KFNA 3DI6A 1ULRA 4DUYJ 4NRUA 3AAPA 3MCAB 3S9HA 4L76A 1CULB 2DJWA 4J91A 1FFGB 4OKEA 3J7YI 1XMOF 2BJ9A 4CGFA 4IOCQ 5IWAJ 3VQDA 2QA4G 2ZEJA 4BACA 3OFEA 2OCEA 1YHQS 4KHUA 1FRXA 5ETVA 3SIPB 1KVBA 4BC3A 3TABA 1TKZA 2B4PA 1XEZA 4AQYK 3IBCB 3BZKA 3H25A 1LKZA 1HPZB 1DAXA 2K1RB 5KG4A 1RKIA 4FBTA 3JSBA 1ASUA 4LFAK 5B0GA 4JP8A 1RXOB 2DXFA 3CCLS 2CZVC 1OY8A 4JLHA 2J7KA 3DOLB 4DU4A 3S6EA 3RB0A 5GINA 2GTDA 4TSXA 3ZETA 3DMJB 3KJFB 2W9AA 2VF3A 2WUSA 3NAHA 4B3MK 1NNDA 3LP0A 2HFVA 4Y28C 2ROPA 3OTOF 3MD1A 3KK2A 2XM3A 2RB7A 4JS5A 5AFUA 3RWUA 3ZTOA 5D4OA 3MF5A 4ECZA 4L72B 4USVA 4I6MA 1RYSA 1HUXA 2O01C 5D4NA 1YGYA 3Q8VA 2NRVA 1WLJA 5F41A 1K0VA 3PW4A 4JI7F 3TANA 2ROEA 1W25A 2H48B 4MO4A 4NI2B 4C1NI 3GV5B 4DUYF 4DX8H 5CYMA 3V4IB 3WX8A 1BA1A 1QAJA 1UETA 3S01A 3HKWA 4KR0B 4X65K 5A8WA 4GKJF 3AA9A 3A0IX 4KB0A 1QE1B 2DH9A 1VI7A 1TKDA 1QUVA 3VAGA 5DDQC 4OHYA 2N7YA 1S79A 3A2FA 4ECUA 1LWEB 1MWZA 2M9KA 2Z2YB 3MEGA 1H6KX 4C8LA 2AZ1A 2V51B 3WC0A 2FSNA 4BC5A 2LECA 2AW0A 3OYLA 2DY9A 2M3DA 2YH1A 1AFIA 1KP6A 2QTDA 2W41A 1EKRA 2HGNA 3SJJA 4JI6K 1APSA 1OSDA 5DLFA 3EXCX 1TUWA 3O44A 1C0FA 3IM9A 2IC3B 1KBRA 5T41A 1SJFA 2DTUA 1BU6O 3CJBA 4DV6K 2QKKA 2IVNA 2BQRA 4M5LA 1LXJA 3GB0A 3KDNA 1TZ0A 3QIDA 3ILOA 2J6TA 1C0TB 4F26A 3BH7B 3D6TB 4IO9L 1FNOA 3MR5A 3ZTSA 2FJVA 3L95X 4J90A 1VSJA 3MXMA 3MN6A 1XBWA 1X5OA 2CGKA 1FKPB 5HVFA 2GAGC 4B3MJ 3MR7A 2MZTA 4H4MB 3AD7C 1U8WA 3HO1A 3R7NB 2KW4A 1RZMA 1S72N 4E0DA 4F04B 4HACA 1C6VA 2GIQA 3ENBA 2ZHOA 2XC9A 2XZWA 1U47A 2DVIA 3TA1A 4LQ3A 2HBZB 3EVOA 1O51A 2K2PA 1Q81T 1VQSA 5KT7A 2FGCA 1CJUB 2RD5C 4URQU 1O0PA 3OYFA 2FHJD 1NHKL 3UCUP 3QGHA 3G4SN 3MM8B 4KBIA 3I8DA 2ZNZA 1FXXA 4DF4A 2CVIA 2IBOA 3NGKA 2PEHA 3OPKA 1BI4B 3PW0A 3THYB 3NWRA 1VAZA 3O1LA 2JDJA 1E6VB 1S0OA 4QW9A 4K59A 3TQEA 1LQ9A 4YOYA 3M2RB 2RE1A 2ZOFA 3MX2A 1T6CA 2EG1A 3DGPA 1NOYA 2CJKA 2LU1A 4KB7A 3U9ZA 2DEJA 3L2WA 3N9UC 3SQ4A 2C28A 2V8HA 3SJHA 4OZ0A 1HNIB 4UZBA 4O55A 1RT6B 2PZSA 1FJGK 4CECA 3C6TB 4Z2XA 2D74B 4ZJQA 3ITHA 3FSYA 3HJVA 2D0OA 1Q78A 4BROA 5BJRA 1VQKS 2VG6A 2VGNA 1N36K 1ZAWA 3BDEA 5DJBA 1VQ4S 3UCZP 4DV5J 2RJZA 1YRUA 4B3MF 2AYBA 1RT3A 3J8AA 2ZITA 3LWMA 4AHVA 2HVDA 3UN5A 3D2EB 2HHXA 2HMIB 3W64A 2I9SA 2GMJA 2NXJA 3UQSA 4A8XA 1XNRJ 3HPHA 1KVCA 3V1QA 4IG0A 5DG7A 3DDNA 1NGFA 1JXVA 3N01A 3CC4S 4Q0BB 3OV7A 4QQBA 1CSJA 4Y0WA 4OKKA 1M1KT 4KFBB 2QXFA 1AT1B 4CJLA 3FCVA 4MIAA 2JGUA 2I0XA 3RB3A 4O4RA 3KHYA 1S10A 3EN9A 3B54A 3EZUA 2RHQB 4DQSA 4CLTA 4OI4A 1U45A 3MPUB 4ZVFA 4CT9A 3H59A 5L46A 4DLGA 1S9GA 3N4QA 1SKWA 1IUJA 4ED5A 2LVWA 2JOQA 2RRBA 2D5RA 1JCGA 3MAAA 3OR1B 2DNKA 3OS2A 1VRUB 3CMAN 4M3UA 3ZZ0A 2ZBQA 3DFEA 4RWTA 4IKAA 4J2EA 2WZ1A 3QJPA 3OUYA 2CZ4A 4DV5F 1FFWB 1VQ7S 4DG1B 5DS7A 3PJXA 3TAMB 2VKRA 4NLTA 2AHOB 1MROB 4QS8A 2V34A 3GIKA 1NXIA 2BOPA 4FWKA 5CZ2A 2HRUA 5HMYA 1S59A 2BACA 2NNWA 1IKVA 5U47A 4DV3J 2ITMA 4CJTA 4FJ7A 4CFDA 4NLWA 2B51A 4KQZA 3BGFA 3UKUB 4CF2A 1FRLA 8ATCB 3PFOA 2XMJA 1RHJB 2E5GA 1K8KA 1VSKA 1PILA 2GJFA 2R3VA 4RUAA 4RW8A 1ZC6A 1VQNN 4Y3CA 3D6MB 1BCMA 2R2TA 3W7BA 2Z0GA 1F9EB 1RTJB 4CM0A 1WF2A 2DGSA 5GAEU 4BRCA 1YJ9S 5JLFA 3QZ8A 3UNGC 4EBDA 2KLAA 4OI0A 1NGJA 4OLBA 2W24A 3NH0A 3CJAA 4DX6A 1VYAA 1GOBA 2A41A 3MMVA 3CO9A 4HVJA 4L3NA 1UPPA 3OD2A 1JL2A 3OL8A 4KHNA 4UF4A 5B09A 3BM7A 3VEWA 1YJVA 4DBQA 3GR0A 2X7IA 3UI3A 1XUPO 1YK9A 1VHXA 5KFRA 1RWMB 3G6EN 2WTFA 3CTRA 3ZX3A 5C24B 5JVHL 1BA0A 2D1CA 2JLEA 3ICLA 2K3IA 4XEIA 3SI8A 3R5GA 4DTRA 3HM9A 2ALZA 5LJ5Y 1TUYA 2HF4A 5AZIA 1JLGA 2YV0X 3IWLA 3T6JA 2RPIA 1V4SA 4LH4A 3NWGA 3TAQA 4PZVA 1TKXA 5KFVA 1IN0A 2ZJPL 5E26A 1YSJA 1FJGF 5BR9A 5T7LA 2BKOA 2ZJRL 4IDKA 4ED2A 1UW9A 4AFFA 2DNYA 4F02A 5A8RA 4C97A 3AY9A 3D0HE 2OPQB 3BSCA 4E89A 2DPJA 3HPOA 3WIVA 4EBEA 5A2QO 1WUAA 1Q7YT 3DDKA 3V6DA 3H3OB 3D66A 1IKWA 5M1QA 4G3IA 1JJHA 3AT1B 1K9MT 2B7CB 4ELVA 3TQ1A 3J80O 4IH6A 2F63A 1BOTO 1BIUA 1VK0A 2XB2D 2JJ4D 5KFLA 1ITPA 1I3OB 2EWSA 4BREA 4KJIA 2R8GA 3VESA 4RG8A 1R0AB 4XO0A 4DCOB 1B0VA 2O1PA 1XQSC 1GH8A 2VU5A 4I68A 5F0WA 2Z2MA 1T05B 3UR3C 2HPUA 2HNYB 3B4MA 4OYBA 1RACB 4X4NA 3M8PB 4WCEL 4CNZA 2NLXA 3QO9A 1Q9XA 4J9QA 3SFUA 4CGHA 3KNGA 1ZA1B 3A8KA 3CDUA 4FJNA 3M4XA 3FRYA 2Q0RA 4NOHA 5BN8A 4NLDA 4QIVA 1SQGA 3RAMA 2ADBA 4CYUB 1TL5A 4E1JA 1T9XA 1SUQB 2V5HG 2RH3A 5AR0A 1N32K 4A61A 1CC8A 3RUBL 5EY4A 2U1AA 4HEA9 5FPMA 1TL3B 4WFZA 3T1YK 4U96A 4Y1CA 1ZETA 3TX8A 1RAJA 4CDIA 4N77A 4I7FA 2MLYA 3TAEA 2J9EA 1EETA 2XI3A 4ISEA 3KWGA 2H3GX 4O4GB 2ZBCA 2QA4N 3QLHA 2VYPA 4ED0A 2HQCA 2ASYA 4FWMA 3NE6A 3OXFA 3SV3A 2ZH8A 1GLLO 1S7HA 5KG5A 3I4HX 2YHWA 2AJ2A 4EZ9A 2NRTA 1UL3A 4UTGA 4PL7A 1REVB 2HMPA 3HZGA 3DLLQ 2GMLA 4CGJA 3NGIA 1WC1A 4FVMA 3H2VE 4CNYA 1TMJA 3VAFA 2KFZA 1OH7A 4OMFG 3CCWA 2VL1A 2UXBK 1B7FA 5F2RA 3CJ1A 2RQ4A 3IFRA 2B4UA 3EM1A 2RS8A 3TR8A 3QAEA 4DX5A 3AVGA 3LP1A 1S72S 4GV6A 2F4VK 1RWKB 4CLSA 2YX7A 5M2UA 2G0CA 1RT2A 3S3OA 1B7YB 5K8MA 2DD8S 2A3JA 1X4BA 2HHPA 3DOKA 2W42A 2CWKA 1FD2A 3M2VA 2HURA 3G4SS 1T3VA 1FRMA 1OKJA 1I6JA 4CH7A 5E2QA 1FRKA 3L4IA 3QDKA 2XWYA 1BMQB 2QWQA 2R2UA 3C14A 3M3ZA 3WQUA 4DTOA 2XCAA 4OLOA 1TK8A 4GO7X 3AO2A 2R42A 1R43A 2ZH5A 1RU2A 2R8HA 2ZH7A 3C19A 4WF9L 1FX4A 1H74A 1R8PA 2YWHA 4R0JA 5LMUJ 3EZOA 2FBTA 3E8OA 2KRRA 3DLJA 5BPNA 3ZT4A 4JK7A 1KD1T 2UUCJ 4MTPA 3FSXA 4CE9A 1AROP 2W4PA 1UWAA 3W3SA 1SV5B 4M63A 1G99A 3IXQA 2BH1A 4RPFA 2NXCA 4WQ5C 4MT1A 1X4EA 2YKOA 2V2QA 3FNNA 2UVUA 4GVEA 1YJWN 2UYTA 2OPPA 3K5NA 1E3MA 5K14A 4H5VA 4K4XA 1C0MA 4PKIA 4K4UA 1IKYB 1RT5B 1Y5IB 1HMVA 1UA0A 2MPUA 6FDRA 2HFSA 4JRPA 3VQ6A 1FF2A 2W8KA 4CO3A 5AQHA 4ZVQB 4B1ZA 4O8KA 4FJIA 2CQ1A 4J8FA 1PBAA 4EWTA 3AH6A 1TK0A 3EE8A 4UUWA 3AA2A 4ISGA 2G9OA 3OYBA 3CDAA 1HYZA 1LK5A 2R7TA 4JKAA 1WKLA 4BDYA 3DRRA 1ZZNA 1TV6A 2ZZMA 1Y10A 1KHWA 2BRKA 4B8AB 1T03A 1N5TA 2BOAA 2BE9B 4C23A 1U2VB 4RUBA 2P9IB 2P5VA 3FBFA 2JVOA 3GP9A 1FESA 1RE1B 1HBMB 3L0QA 2MB0B 2KTQA 3AVBA 4M5JA 4QIFA 2KVIA 3W9IA 3AA5X 2FC0A 4E1MA 2UUCF 5SWMA 5HROA 3IG1A 4CP5A 3CMAS 3F5TA 5KPTA 5B0DA 5J2QA 2W25A 4N8OA 3MUTP 3O4NA 1EAYC 1WB9A 1NJIO 3KG4A 2GEMA 3J81O 2GX8A 4IRCA 3CIPA 3HM8A 1J6ZA 1SJ1A 3MAQA 2UVWA 4E7JA 1U4BA 1XMQJ 5ADXH 1AUSL 3KLGB 2VG5B 4WPAA 2G13A 1TR0A 4BC4A 5FDLA 1FW6A 1RABB 3BJYA 2V9KA 2XEXA 2RNEA 4O3PA 3W8PA 1XC3A 1HLUA 1RA7A 3CHWA 5ETLA 3VPZA 4Y00A 4PWUA 4K4VA 3X1LB 2M5YA 5EDWA 2NR0A 1NZ8A 1T8EA 4CLLA 3NCRA 1ZTTA 3HHLA 4BE1A 1N5YB 1EP4B 3QEVA 5CE3A 4I4BA 1VQNS 2R8IA 3U7JA 1KLMA 1CVJA 3LPUA 1N33J 1BQMB 4RCHA 2PT0A 3THPA 3VQCA 2VA2A 5I4MA 4ZPBA 1Q82T 3OYMA 4ZVGA 3H4DA 1GT8A 3BKFA 1SC4B 4ED1A 1A9NB 1W0HA 1F60B 1FEHA 2CDQA 3PXGa 3FZHA 1BQXA 3ZTQA 3NCIA 2P9KB 1VLOA 3A8JA 2AJ1A 2DFFA 1JQGA 2MQPA 5C25B 3C95A 4B1XB 4MJKA 3HVTB 5J2NB 1S4EA 4BRPA 5B8HA 1S1XA 3G6ES 4LIWA 4WP9A 3TVZA 3G0ZA 4KHYA 1CXUA 3BY5A 4BRMA 2R7QA 3F2KA 2ZBPA 1F0XA 4USWA 3I0SB 2L41A 3W2WA 5M1PA 1XMQF 5IQQA 4GMJB 3KLEB 4DSIA 4IOAQ 4H4KA 4IFVB 2E2NA 2I6WA 1QM9A 2WW8A 3LOUA 2DGOA 3CFRA 3T5HA 1EJ7L 3RG6A 4M3TA 2GQCA 1IH7A 1IR2A 4ENOA 3MDFA 3H5SA 1P9QC 1V3ZA 4FKYA 1YRXA 1NAQA 4AHSA 1UW4A 4J9LA 1Z4UA 3C7NB 3HRGA 4ALZA 2GX9A 4KH1B 3AVIA 3SAFA 1JLFA 3N6LA 4UY8O 4G1QB 4BLGA 3ATVA 2FGOA 2EEYA 3FGVA 2ASJA 5J1PA 5AE1A 4YS2A 1T3NA 3D9BA 3RZAA 4FXDA 3CQYA 4IG3A 4CJ7A 1N33F 2MKYA 5D8HB 3DRSB 1KKHA 5EWEA 4OX9J 3OL7A 3ELHA 2V4QA 1R31A 2VKZG 1IBLJ 1PAEX 4Z37A 1NMDA 1C1BA 2EWHA 4MFBA 2F8TA 3VGMA 3OTCA 3G82B 5F8HA 2YNIB 2HS4A 4BVOA 1UA1A 2ZVIA 1X4GA 1J5EK 4E1NA 3H8YA 3G71N 4FZXC 1C0GA 1RNHA 3C6UB 1U0HB 1SH0A 1NRKA 1RDRA 4ED8A 2EX3A 4FN5A 9ATCB 3VGSA 4QW8A 4DSLA 4AF1A 4DFPA 2YNHA 3Q24A 1V9OA 1A5WA 2IHR1 4W5OA 2D9OA 3KUEA 1FE0A 3RMDA 5KT2A 3ILIA 2NZTA 4F50A 3M32A 4BG9A 4LF7K 3MI7X 4ZJOA 4JI1J 2HHTA 3QRQA 1LFWA 3JSYA 3LGMA 2RU9A 3QMQA 3FDSA 3RB6A 1HPMA 4ZPCA 1FX2A 3ZSWA 2YHBA 4DN0A 4G1PA 2KXFA 1DQ9A 2W6KA 3U8XA 3B4DA 5H9FJ 2NCKL 3ULHA 2PDAA 4NLPA 4DCHA 2QA1A 5ETRA 2IJNA 4O0IA 3DLGA 2C22A 2HSEB 3JSMA 1RBSA 2KYZA 3MN5A 4OIXA 1VQ5N 2D3OR 1RHMB 4NX9A 1Z05A 3ZNJ1 3EO3A 4FLXA 1S3XA 4OX9F 3PKYA 5E0OA 2M0GB 2QA4S 5M1KA 5HQMA 1IBLF 1PBUA 2UU9K 2HAIA 3BQ0A 5EXWA 3NP5A 2OD6A 2I8EA 3EX7B 3IN5A 4OZLA 1RDAA 1VHIA 4F4WA 3JQKA 3CF5Q 2V67A 4P6QA 5LXRA 3DOMA 1O8BA 4FLZA 4JKEA 2EPIA 1L5UA 3UIQA 3NG8A 1JK9B 3MEEA 5EGYA 3QB0A 3IGNA 1TKTB 2AJ4A 1RT4A 2HBQB 2AF6A 3R2DJ 3CD7A 5CZVA 2W8LA 4F4ZA 4PAAA 5I3PA 2BBEA 1S48A 4B9NA 2HLTA 4OX8A 3F73A 2IIRA 1BDGA 4JI1F 1RCHA 4G9ZA 4CTAA 4NXNJ 3HLUA 3IMQJ 3T41A 2DGTA 4DPOA 2VWBA 4K50A 4A62A 3CDEA 1YBUA 2V69A 4B3OB 2B7BB 1D09B 3E66A 5KAKA 3FMWA 2D7SA 4PG7A 3MX5A 3OW2M 4FP9A 1QZ5A 4A48A 5IQ6A 3TZXA 5BRFA 1BIZA 3IP0A 5JS2A 5E84A 3SV4A 4JRQA 1DTQB 1I1GA 3BH6B 3HSZA 1BO5O 2I5JA 4EIAA 2FJAB 4OX7A 5KFTA 4DKWA 1TL7A 3SK3A 3TI0A 3OBIA 4DU8A 2QWMA 2JSXA 5IXUA 2RN2A 3L8BA 2J4RA 5T7BA 3VEZA 2MKJA 5JS1A 3PX4A 1OSCA 2MQNA 1CS4A 2IS3A 3GJRB 4KO0B 1OJ4A 3I4PA 5L1LA 2ZOGA 5SUHA 3VGUA 5M2RA 2BANB 1VK3A 3M1VB 1VC0A 2C1EB 2MZSA 3CC2S 4H0TB 2CJAA 2HBRB 5DO2A 2O8CA 4B3TK 5I3UA 3OYJA 2VGMA 1YJWS 1KLNA 1UWBB 1X0FA 4KHPJ 4HTLA 2XMWA 4J7CA 4MK8A 1RT1A 1NM2A 7FD1A 4OV1A 5KFZA 3ISNC 4V19J 3I5CA 2AWZA 3L4QA 4NXNF 1J5EF 3NGYA 4DFJA 5I42A 4PG5A 4FVCA 3M6GA 3J7AP 4A2AA 1ZM2A 4F8RA 1RTDB 4NLRA 2ZKTA 1QSLA 2W2PP 2BABA 3QGPA 2BE7D 3R1LA 2BJ3A 3MM5B 1HKBA 1DQAA 4MKVA 4GKKK 3TAFA 3R6GB 3FR0A 4O3QA 2BUNA 3ZX0A 2MGZB 4Q5VA 2PFFB 2DR9A 5KG0A 3M6XA 4Y2MA 2CH5A 4K5RA 1G3OA 3T6BA 3DHXA 4N7TA 2VWJA 4B3SK 3IFEA 2AGQA 3TX0A 2F3JA 2HZVA 2QMWA 3HSDA 2CPYA 1RILA 2VIHA 2DTJA 1H73A 5A2QU 2DYAA 2OTLN 5HP1A 5KFYA 4CIEA 3AGRA 3ZO7A 3J7YP 4YB6A 1WBDA 4U8VA 2HHUA 3MMBA 2D9PA 2DNOA 5CYQA 5F8MA 4DTNA 1CJVA 1UMJA 4O3SA 4YUDA 4FOEA 4H4OB 3CE8A 1U2CA 4KGKA 4DL2A 2UU9F 1KTQA 1HKCA 2DO4A 3CWJA 1DBDA 2P9PB 4MDBA 3CXCM 1JXBA 1K73O 1PG5B 1MNEA 3ZTPA 2H4YB 3QWPA 4K4TA 1X5PA 1DTTB 4DZ6A 4U7UD 3VEVA 3US5A 2AX0A 1Y9OA 4CH1A 3FFIB 1GNKA 2XS2A 2VBYA 1ZBUA 2XS5A 1G7CB 2L48A 2OP5A 2P9UA 3TTFA 3QAUA 2FXUA 1NB2A 1U0SA 4KGXB 5J2PB 1HI0P 4DV7J 2PSZA 5AQPA 1HL6A 4YQWA 1FJCA 4DPUA 1VJQA 3V4MA 4ZMMA 1UFWA 4C3MA 4RU9A 2VB6A 4MMOA 4F2RA 4QU6A 1DQ8A 2GFFA 4ITSA 4P52A 1YT3A 3K0JA 4BRQA 2PA3A 3C46A 4ZP9A 3HI9A 1WKJA 3TWHA 3GLJA 3ULEB 2X78A 5KT6A 1LOTB 3VV2B 2EFOA 2HNZB 2QO3A 4GKKJ 4AXIA 2QWNA 1VSHA 1HBNA 1M1GA 4QYZK 5DZ6A 3JTNA 3N28A 1X3MA 2DCUB 4YDUA 4MLEA 4CO0A 2W2MP 4ILMA 4FM1A 2X1AA 4R79A 4YY3K 3GSIA 2D3ZA 4B3SJ 1SJQA