1RT3A

Azt drug resistant hiv-1 reverse transcriptase complexed with 1051u91
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
536
structure length
520
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSIPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Azido-3'-deoxythymidine drug resistance mutations in HIV-1 reverse transcriptase can induce long range conformational changes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 135
structure length 520
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1998-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1rt3A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1rt3A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1rt3A05
1RT1A 4GC6A 4AHCA 3QLHB 2YV0X 3JYTB 3CFPA 3RR8A 4JV2A 3KIOA 1S6PA 1VSIA 2AGOA 4TY8B 3GIKA 1ZTTA 4W5TA 3C6TB 4FJHA 4DS4A 3F9KA 3KLFB 1TL1B 4B9NA 1JLCA 3V9SA 2OZMA 5KT2A 4HUEA 1NK5A 4HVJA 4OKKA 3IRXB 3K59A 1SUQA 2XHBA 2FVSA 4DFMA 4DSJA 2YKNA 1QTMA 1GX5A 3T5LA 4QWBA 2O4GA 1W0HA 3QESA 1ZYQA 2AQ4A 2YHAA 1J5OB 3EZUA 3AVIA 4CIGA 2VA3A 1CXUA 2XO7A 2VG6A 5KFXA 1FKPB 5J2QB 3JSMA 2I5JB 2YNGB 4K4ZA 3T3FA 4ECQA 4ZP6A 2G8FA 4Z4EA 1X9WA 4HHTA 1WAJA 4OLAA 5C24B 2EX3A 3N6LA 4ELUA 4ED7A 3PUFA 1NHVA 3MEGA 2IMWP 3G10A 1S9EA 2AJQA 5EWGA 4CJUA 3Q8QB 5KFOA 5KFTA 5KT5A 4CERA 4KHSA 1LV5A 5KFEA 3RB0A 2DFEA 2D41A 3OYAA 4DL2A 4DSLA 2B6AB 3LAKA 4NLWA 3I0SA 2GC8A 1VSKA 4DF4A 1WSJA 2R8JA 3MFHA 5D3GB 1JXLA 1T05B 2HHQA 1VRTA 4NYNA 2CKWA 4F3OA 2YNIA 4ZP8A 4MH8A 2HNYB 3DLHA 4NCGB 3SPZA 3VQBA 4CGIA 3PW7A 5F8IA 2WHOA 3QEPA 2UUTA 4B9SA 1Q9YA 1C6VA 3NGYA 1XR5A 5I3UB 2OPPA 4B3OA 4B9VA 2OA8A 1RT5A 3C6TA 3BSCA 3V6HA 4B8AB 4QAGA 1WNEA 3DRPA 2JC0A 3VQ8A 1S1VA 3MXMA 3OLBA 4RW7A 2IJFA 5DG8A 3V6JA 3QLHA 5JUMA 1HQEB 1QE1A 1S1UB 3SQ0A 2YKMB 4NLVA 3ALYA 3DMJB 5I3UA 4Q8EA 1IKYA 1A5VA 2F8SA 3NGZA 5F9LA 4EO6A 3LZIA 4C8LA 4ID5A 4TN2A 3OYGA 4I9LA 3PR5B 3SCXA 3QYYA 3DLGA 1N4LA 4CEDA 5C42B 1RDAA 3K2PA 3CG7A 1IH7A 5L1JA 5CY4A 1IKYB 3NCIA 3FFIB 2BR0A 3LALA 1HNVB 3IGVA 1JKHB 4NYZA 4OKEA 1D9FA 4M3RA 2QXFA 1NK7A 5KFMA 3KK1B 5KFQA 3ZT0A 3PVXA 3DMJA 4DTSA 5HP1A 2Z1GA 1UA1A 1OS5A 3AVKA 2RF2A 1S6QB 1GOBA 3VQPA 4WE1B 5KFDA 3KLHB 4CF8A 1KFSA 3U3GA 2QKKA 4M94A 3ZT4A 3QNOA 1NOYA 5FRMA 1RT1B 4XIUA 4G1QA 2YNIB 1JLFA 4F4WA 1RT3B 3H40A 3PW4A 1JXEA 1U47A 4M3WA 3CWJA 3T5HA 2AGPA 4N41A 1RT2A 2XRIA 1QSSA 3HO1A 2IOCA 2V4RA 1HRHA 3LP2B 3ITHA 1JLEB 3FRZA 4Q43A 1J53A 4CHZA 3PZPA 5KG2A 3BSOA 5L1LA 4NLTA 4E1MA 1S1VB 4WZMA 4FK4A 1REVA 2HMIA 3OL7A 4IRKA 4FW2A 4EZ9A 5HP1B 3PX0A 3RWUA 4JRQA 4OLBA 2W9BB 3V9WA 4QWCA 2J6SA 2UVRA 4M3UA 3DLKB 4CK3A 3OYKA 4DG1A 2E9ZA 1Z25A 3RAQA 5L1KA 5CZ1A 4KKOB 3L2RA 1B9FA 4BE2A 4WXOA 1X9SA 3FSIA 3ZT3A 2UUWA 3K5OA 4KREA 2VG6B 4CJKA 4DTMA 1MU2B 2X78A 4TLRA 1NK4A 2R8HA 4DTUA 4MFBA 3TARA 1GOCA 4AHSA 5HROB 1J9AA 1FK9B 5DLGA 3OYCA 5KFFA 2VWJA 4C8KA 4LQ3A 5C24A 4WZQA 1JLBA 4I2QA 4FJIA 1N6QA 3QGIA 2DFFA 3AO1A 4E1NA 1QUVA 3ICLA 4CGFA 3OYFA 4ZPAA 2X6SA 1EKEA 3HKWA 4LSLB 1IKVA 1TL1A 4RZRA 3TR8A 3DYAB 4NZ0A 3S9HA 3OHAA 4JV0A 2W9CB 1TK8A 2BDPA 3MTKA 5DK5A 3AVFA 4PWDA 2ZD1B 4KO0A 2J6UA 1J54A 1D1UA 4K4TA 1QQCA 4DFJA 1XR7A 3MF5A 2WRMA 4LQ9A 3OYNA 5KG5A 1Y97A 3LWLA 3FDSA 1SUQB 4U7CA 2W7OA 5T14A 1JLBB 2FVQA 3NBPB 4KTWA 2D3UA 4ZPBA 4PQUB 3HSTB 4DS5A 3EY1A 4FLUA 4EBDA 4PA1A 3G6YA 4I2QB 3KLIB 3CM6A 3L2VA 2P51A 4IBNA 4KTQA 3TI0A 4RW8A 1RT4A 4FZYA 5HRSA 3DI6B 5J2PA 4E7KA 1LAWA 3EYZA 1K1SA 1R0AB 4GC7A 4MIBA 3HVRA 2B43A 3QEVA 4Y34A 3S3NA 2FLPA 3HPHA 4CK1A 5L9XA 2FC0A 4E7HA 5HBMB 3KD5E 5FDLA 2Z1HA 1FXXA 4MK9A 4RUCA 1C1BA 2X74A 5F8LA 3AO4A 1S9FA 4K4XA 5KT3A 3L3VA 1NJXA 1CZBA 5HROA 1JLQA 3V6KA 1D5AA 3IRXA 2R8IA 1VSLA 3NL0A 4TSXA 1LW0B 1KLMA 4IKAA 5L1IA 1LWFB 1U09A 2OH2A 2DPJA 5DGBA 3RTVA 2XY5A 2WOMB 4Z4GA 4NLOA 4KFBA 4TY8A 4QWEA 2W8KA 1LW2B 3MR3A 4B08A 1KSPA 1HPZA 2WONB 4DF8A 1ASUA 4BDZA 3KHGA 1K6YA 2ETJA 4NLDA 2FVPA 1CSJA 3SI6A 3MAQA 2BQRA 3VQQA 4PWDB 2Z1JA 1L3TA 4FK2A 3IN5A 4YFUA 3D28A 3TQ1A 4KAIA 2DTUA 4Y1CA 1X1PA 3THVA 3PX6A 3HT3A 3SQ1A 1S1XB 4IH5A 5KFUA 2AX0A 3V6DB 4PUOB 3SNNA 1QAJA 4IQXA 4CIEA 1HMVB 2OPQA 1UOCA 2P5GA 1FK9A 3UQSA 3L3UA 4TQSA 4BE1A 2ITGA 2ILYA 3NF9A 1C1CB 1TKXA 3UIQA 4OGCA 3DOKB 4LSNB 3L2QA 4MIAA 1ZBFA 1WSFA 1QSYA 1VRUA 2ILZA 3QZ8A 5C42A 3H98A 2D0CA 4JV1A 5CYMB 5SZTA 3V81B 4CECA 4MK8A 3DM2A 3ITHB 4IG3A 3HJFA 4YMEA 4DEZA 1EP4B 2VG5A 3ZCMA 4CEAA 1U45A 3ZSVA 5F8MA 3OSPA 2GIRA 2WB4A 1BGXT 2W9BA 5J2NB 1KHVA 2XC9A 4DTRA 3G6XA 3LP1A 4WXWA 3G6VA 3DYAA 4FLXA 1NK9A 1EETA 3RMAA 1BQNA 3BQ1A 3DOLB 3DLEB 1XR6A 1C0UB 1JIHA 3ISND 5HRPA 5DQHA 4ECWA 2HHVA 4CEZA 4KI6A 3D45A 4FLZA 2ZE2B 2C22A 3KLVA 1KVCA 2QV6A 4RW6A 3ZSZA 3KK1A 2GUIA 4TQRA 2VG7A 5J1EA 1TQLA 3KK2B 4MKBA 3NGIA 2VG7B 3BJYA 1RT2B 3CYMA 1HJRA 4KHRA 4DTPA 2HNYA 1SL0A 1JLFB 4ECTA 2D0AA 3SZ2A 5KFCA 3EZ5A 2XWYA 3TAPA 3GYNA 5EUHA 4K4UA 3NGDA 1IKXB 4K4VA 2XY8A 3SJJA 2VA2A 1BCMA 4FVMA 4LSNA 2WCXA 4HCBA 1EXQA 1DTTB 4HYKA 3PR4A 3OSNA 3CDWA 1YT3A 1BIZA 3CQ8A 1LAVA 1HMVA 3NH1A 1TK0A 1HQEA 3IG1B 4H8KA 2D0BA 2YHBA 3BQ0A 3Q8RB 4GVMA 4TXSA 1MU2A 3BR9A 3DDKA 4TYAA 4DQSA 1RTDA 4QCLA 1FKPA 3VQSA 3L2WA 2HAIA 5KFLA 4KV8B 4ZP9A 4Q44A 4O4RA 3GV8B 2C2DA 5KFWA 4NLGA 1TAQA 3SV4A 4RNHA 4CFCA 1JLCB 4FW1A 2Z1IA 4RW4A 2ZE2A 3CVKA 1B92A 4EZ6A 1T3NA 3N6NA 4JLHA 2XI2A 3PY8A 3O3GA 1VSMA 4CEEA 3BGRB 2F96A 4OKJA 3RMDA 1BI4B 3FQKA 1EETB 4KTZA 4DWIA 1ZETA 3H5UA 4F8RA 3HP9A 4R5PB 1T8EA 1NK6A 2ZKUA 4NLQA 1LWCB 3TAEA 3QNNA 2OPQB 2IA6A 4GW6A 4W5OA 4DU3A 3OYHA 4FJMA 3NE6A 2BANA 5FDLB 3V9XA 3AVCA 4FJ5A 3LP3A 3VQEA 1TV6A 1C0UA 5DMRA 3HPOA 4KI4A 1C1AA 2I1RA 3AVJA 1JLAB 1TK5A 1N56A 4RNFA 4CGGA 4H4OA 3N6MA 4ID5B 4O3OA 3H08A 1N48A 4ICLA 1ASWA 4NLSA 3Q8PB 1HQUB 4NLUA 2ASJA 3OS1A 1S9GB 1N5YA 4OPKA 4O3QA 3GV7B 3PW5A 1WSHA 4M42A 4BDPA 1QAIA 2WOMA 3NKYA 3FFIA 4YR0A 4QOZB 2IJNA 1RNHA 5T7BA 1WN7A 2OPSA 2QE5A 3JSMB 1HNIA 5KFRA 3OYBA 3LP1B 2FVRA 4DL3A 2G8KA 1SL1A 3QO9B 2HNDA 3O3HA 1UWBB 1TKXB 2KFNA 4CJQA 3V1OA 4BDYA 4F2SA 2KZMA 2E4LA 3OYMA 1NJZA 3AA4A 1ASVA 4WFYA 3SUOA 1QE1B 4W5QA 3KLIA 3DRRA 4CJPA 1U4BA 5KFSA 3V6DA 3M9MB 1KLMB 3K5NA 3V4IB 4Z4CA 4URSA 5F8JA 2BQUA 1RDCA 1ZBIA 1N5YB 4B9TA 4ZTFA 1CLQA 1RTJB 4CHYA 3PW2A 2E6MA 3ZT1A 1S0NA 2IS3A 2W42A 1WLJA 3AVAA 3C6UA 2J6TA 3CJ3A 4DSIA 3CDUA 2KTQA 4FS2A 3CFRA 1RDRA 3E51A 2R2SA 4ECZA 3PHEA 3K5LA 1HARA 4JRPA 3NMAA 3K57A 4L8RB 2OPSB 2B5JB 3GV5B 3ZSYA 4CJFA 3VA3A 1TVRA 1R0AA 2Y1IA 4KHNA 3KOAA 5JS1A 5KTQA 4ED8A 3T19A 3OL9A 4H54A 4CEQA 4J9KA 2BRKA 1S0MA 4B8CA 4KPYA 2PYLA 4M3ZA 3VQDA 3OJSA 1RTHA 4TY9A 2R8KA 1WSIA 4KBIA 4C8NA 3U6FA 4J9PA 4O4GA 3DLBA 4X2BA 4H4OB 2XCAA 4FJNA 4PQUA 1YVUA 3TANA 1RT7A 4RW9A 2RKIA 5KG7A 1JLQB 1S1WA 4RNOA 4YQWA 2ATQA 5KFBA 4CJEA 1BISA 4DLGA 4IH7A 4FM0A 3RRHA 5FRNA 1DLOB 4MK7A 1DTQB 4FBUA 1RDDA 4ZMMA 1LWCA 1YTAA 2PYJA 3KKSA 4NCAA 2HHSA 1HNIB 3NFAA 1NK0A 1IKVB 3S3OA 1VSEA 3MECB 4DL6A 3O3FA 4E3SA 5C5JA 4N56A 3SV3A 2HWIA 1NNDA 1RT4B 1TKTA 3NF8A 4CF2A 3H5XA 3SYZA 4EP4A 1ZBLA 3WNGA 1L3VA 5KRSA 3MR6A 4J9MA 5DG9A 1SKRA 2V9WA 4QPXA 3MFIA 5KGXA 3ZSOA 1S4FA 1EX4A 2RDJA 3QZ7A 2JEGA 4DU1A 2HWHA 5C25A 3AV9A 3I5CA 4HUFA 3ZT2A 4LSLA 4DSKA 2HHXA 4QWAA 4M45A 2G8IA 5EDWA 1ZBHA 4CFDA 1S9GA 5KFIA 3TAQA 4RUAA 3E01B 3KLGA 5KFGA 3MXIA 1XHZA 4ED3A 4O3NA 4I2PA 2FVCA 4AHRA 4R5PA 5KG3A 1KRPA 5KG4A 1NK8A 2YNFA 3CM5A 3B6PA 5DG7A 2OPRA 4DTNA 3OHBA 4AILC 3RB3A 3BSAA 3NF6A 4YR3A 3G0ZA 1JLEA 2JC1A 3LPUA 3QIPA 5DLFA 4MFBB 4O3RA 2D3ZA 4J9NA 4K50A 2O5DA 3HVWA 4M3YA 2AX1A 4FZXC 3L2UA 4RW6B 3RAXA 1RBVA 2E9TA 4DL7A 2JEIA 1S1UA 1C0TB 3PO5A 1VRUB 4WYWA 3DLRA 4DTOA 3V1QA 4NLYA 2HNDB 4CJLA 4Q8FA 4XPCA 3VQ9A 3QIOA 2GIQA 4Z4IA 3CFOA 4I2PB 4J9SA 5EWFA 4KSEB 5KG0A 1JLGA 5KFYA 4CIFA 3HHKA 4Y1DA 4WFXA 1EP4A 2VG5B 1ITGA 4RG8A 3CIZA 3AVGA 2A1SA 3VQ7A 3DRSB 4CJWA 1JLAA 2D7SA 3CJ5A 2A1RA 3HXMA 2IAJB 4CJTA 1TV6B 5DQGA 4CF1A 5KFAA 3WNEA 4KKOA 2ZQBA 2FLLA 3LP2A 1U49A 1Q9XA 4DL4A 1C1CA 3RB6A 4EYHB 4M41A 5J1EB 1X9MA 4IFYA 5KFNA 1JX4A 1K1QA 3DLKA 5DGAA 1S0OA 5KRTA 3WNHA 4CK2A 2YKNB 1HPZB 4QW8A 1TKTB 2BGGA 1D0EA 3DLEA 4R8UB 3BGRA 1IKXA 3RBDA 2C2RA 4C8MA 3I5AA 4M95A 3AA3A 3VQ4A 4B9MA 4DTXA 1S49A 1SKWA 5HRRA 4NLPA 1BI4A 2JEFA 3SPYA 4Y3CA 2XI3A 1J5OA 3CDEA 4ZVHA 4CJ4A 1DTTA 4CGJA 2D5RA 4CESA 3QIPB 4AHTA 5I42B 4O5BA 1IG9A 3M8QA 4O0IA 4Q5VA 4G1QB 4CHQA 1TAUA 1VRTB 4BWMA 4LH4A 4IG0B 3GIMA 4KHWA 4F50A 3TAMB 1VSDA 4ECRA 1KLNA 1RTDB 3EPGA 3BSNA 3G86A 4E89A 3RRGA 4DQPA 4AHUA 1F21A 1RA6A 2YNHB 2XCPA 2RF2B 2HHWA 3MXJA 2G8VA 3DOKA 2C2EA 3KK2A 5F9NA 4O3PA 1RT6A 3HPGA 4O4GB 2IAJA 2HB5A 5KG1A 3QINA 3OS2A 3UPFA 2JEJA 1TP7A 4PUOA 4BE0A 1HYSB 1TVRB 1QHTA 2FJVA 3F73A 4NCBA 2P5OA 1RT5B 3TAFA 3SUPA 1RCHA 5J2NA 4J2AA 1DLOA 3GQCA 4ECVA 3SQ2A 4EYIB 1RILA 1S10A 3I5BA 4IKFA 2V4QA 1SL2A 3OLAA 4RW8B 2R2TA 3OYEA 4CE9A 2YKMA 2FBTA 4FLYA 1T03B 2HVIA 1QSLA 3TAGA 1WSGA 2F8TA 4CF9A 4J2DA 4ED2A 1HYVA 3NAIA 2AU0A 3HL8A 2W7PA 2OPRB 4E7IA 1DTQA 2ASLA 3QERA 4I7FA 2HW3A 5JXSA 2G8WA 4YP3A 4O44B 1S5JA 4DQIA 2KFZA 2IC3B 4K8XA 3ULDA 1UWBA 2XY6A 4I9QA 2EC0A 4HTUA 4Q45A 1T94A 4Q0BA 4FJGA 4IFYB 5J2QA 3MEEA 2PZSA 1FKOA 3MEDA 4C8OA 4FZZA 1I3AA 3DM2B 1LW0A 3M9OB 2VWKA 3OYDA 5KFKA 1TKDA 3QGGA 1XI1A 2FBYA 2ATLA 1T7PA 3QEIA 1G15A 1RT7B 4RW9B 1BHLA 2IM1A 4KB7A 2EHGA 4IRCA 1BIUA 2E9RX 4IR9A 3NAHA 2FBVA 1A5WA 5E41A 2BE2B 3AA2A 4J9RA 4JUZA 4NRTA 4OGEA 4CEBA 2IBKA 1XHXA 3NBPA 3KK3B 3GILA 3H4DA 3AVHA 4LY7A 3KNAA 4E19A 3AVNA 4CJVA 1RYRA 2HHTA 1C0TA 4IFVA 2IM3A 2IGIA 5C25B 4FLTA 3AVLA 2DY4A 2XY7A 1RTJA 4KAZA 1U04A 1LW2A 2BRLA 2OZSA 3RB4A 2JLEA 3LP0A 2RPIA 4ZVEA 3KJVA 4NLRA 3PW0A 4WE1A 1CXQA 1L3UA 5K14A 4FJXA 1TKZB 4ZHRB 4MKAA 4ECUA 3MR2A 4CFAA 4KB0A 5KG6A 4QWDA 1GOAA 4NYFA 3VQ6A 4IDKB 3QIDA 3S3MA 4WYLA 4F4XA 4XO0A 1C0MA 3I0RB 4FLVA 4W5RA 1Z4UA 2B5JA 4Z0UA 4F4ZA 4FJ9A 3H2LA 1RBTA 3A2FA 4TYBA 4EO8A 3V1RA 4ZPDA 4Z4HA 3BDPA 3T1AA 1HYSA 3LWMA 1S6QA 2W8LA 4HCCA 1WNSA 1Q8IA 3I8DA 5KT7A 3IGNA 1Z26A 4CGDA 3NDKA 1SV5A 2B4JA 3D0PA 4CGHA 2BE2A 3IS9B 1REVB 2HMIB 4O55A 1SH0A 4WFZA 1L3SA 4AH9A 1KCFA 4I7FB 2YNHA 4R0EA 4IR1A 2X6NA 1S1TA 3FQLA 4OL8A 2Q3SA 3GIJA 1RT6B 3HYFA 3AA5X 1GX6A 4IG0A 5F8NA 5K14B 4B3OB 3OYIA 1UA0A 3B6OA 4J9OA 3SFUA 5I42A 4FCYA 4ECYA 4KHQA 4DG1B 1T03A 3VQ5A 3O4QA 4CFBA 2R2RA 2FJXA 1D9DA 1RA7A 3LPTA 3LZJA 1T05A 1RYSA 3RMCA 3M8RA 4O3SA 4UQGA 3CJ4A 3HVTA 1SKSA 4IDKA 1LWEA 2IM2A 3NAEA 1TL3A 3DOLA 4ZTJA 4RW7B 3NF7A 3QO9A 4KE5A 3HM9A 3V9ZA 2ASDA 3LDSA 1TKZA 4E7JA 2OPPB 1HQUA 5KT6A 4B9LA 2RDIA 4DLEA 4KHUA 2HNZA 1JKHA 4FXDA 4IG3B 1HNVA 1HYZA 1BQMB 2E6LA 3M8PA 2I5JA 2YNGA 4NLXA 3C94A 1ZTWA 3KD1E 3QGHA 2P1JA 3BQ2A 5HLFA 4KB1A 3D5MA 2B6AA 1TGOA 3H5YA 2NUBA 4E0DA 3ZSQA 1NOZA 4EEYA 2CJQA 3LANA 3TVKA 3HK2A 4HUGA 2FJWA 2R7YA 4EP5A 4N76A 3VQCA 3AO3A 2IM0A 3AVBA 4YNQA 1RBSA 2QKBA 1S9EB 3O4NA 3H4BA 3HP6A 4DQRA 3T5KA 4KHYA 5KGWA 3C6UB 3NHGA 1S48A 1BCOA 4CJSA 5EWEA 2HNZB 2UVUA 4B9UA 4CHOA 2UVWA 3KKRA 4ICLB 4GMJB 2GV9A 2AWZA 3RBEA 1W9HA 1JL2A 1NKBA 3V4IA 4R8UA 3TWHA 1KHWA 5KFZA 4LH5A 4W5NA 3T5JA 4ECSA 4NCGA 5HLFB 4FBTA 4K8ZA 4RW4B 2G8UA 4KV8A 3M8QB 4RNNA 4K4SA 2ALZA 2IC3A 5CYMA 1BQMA 2AGQA 2WK4A 4AHVA 4QW9A 3DLGB 1RAJA 1UAXA 4K4YA 3AO2A 5CZ2A 1RT3A 3UDLA 3OL8A 3KLFA 1A5XA 4BWJA 2DPIA 3OY9A 1W25A 4DFKA 4CJRA 3PO4A 3ZSXA 4H4MA 4N47A 3KLHA 3MEGB 2YNFB 2LSNA 1VK0A 3VA0A 4OJRA 4FK0A 4KRFA 3DRSA 1LWEB 3CJ0A 3ZSRA 4DQQA 4ED6A 2G8HA 1YVFA 5KFVA 5F8HA 1XWLA 2OYQA 4FJJA 5HRNA 3M8SA 4FJ7A 4BACA 4CHNA 3P83D 3HVAA 5KFJA 3K58A 4ID1A 1B9DA 4ZVGA 2Y1JA 5EU7A 3BREA 1KFDA 2O4IA 1NJWA 3NH2A 3KTQA 3OJUA 1SH3A 3KHHA 4OPJA 3QETA 3C95A 3PX4A 2F8EX 3E01A 4H4MB 3KLGB 3CO9A 3AO5A 3DRPB 2KZZA 1KVAA 4PY5A 1IO2A 1RDBA 1NKEA 1S6PB 3P5JA 4U6PA 5DQIA 4XPEA 1ZBUA 3JYTA 1NHUA 3TAMA 2WTFA 2ZD1A 3ISNC 4KO0B 4CJ5A 2FBXA 4FM1A 5KI6A 1WSEA 4HKQA 4DU4A 3RMBA 5D3GA 3PJWA 2W9CA 4J9LA 5J2MA 2FLNA 5KFHA 3AVMA 4ZP7A 4CCHA 3I0SB 3KLEB 4LD0A 4EBCA 4J2BA 1IKWB 2XGQA 2HVHA 4CEOA 4NRUA 3KHRA 3V81A 2WONA 2JGUA 1S1WB 2IDOA 3DI6A 2C28A 1N6QB 1L5UA 3LAMA 3OYJA 4J9QA 4O0JA 3KHLA 3SUNA 1VSHA 1S1TB 1D8YA 4F2RA 1BQNB 3M8PB 1JXBA 3ASMA 4F4KA 3TABA 1S97A 3VQAA 3CJ2A 3HVTB 1RBRA 4J2EA 3IG1A 2UVVA 3QEXA 4N5SA 3OL6A 1NKCA 1JLGB 3U3YA 4ED1A 1VSJA 4IFVB 1C1BB 3SFGA 4FYDA 1KTQA 3MECA 4YR2A 1CZ9A 5F8GA 3H59A 3ZSWA 4IH6A 4ELVA 4E7LA 1TL3B 1IKWA 4JS5A 3KJVB 1XC9A 3KMQA 1FKOB 3MEDB 2DFHA 4FM2A 4DTJA 3P1GA 3KK3A 2KW4A 5J2MB 1SH2A 4Q0BB 2XGPA 3V9UA 2W9AA 4G3IA 1WAFA 4FS1A 4IRDA 3IS9A 3OS0A 5J2PB 4RNMA 4MQ3A 4DFPA 1MMLA 2QK9A 1I6JA 4F4YA 1RTIA 5CYQA 5SWMA 3OVNA 3L8BA 4ZHRA 4KFBB 1RTIB 5CYQB 1KVBA 1O1WA 3RR7A 4FJKA 1S1XA 1RBUA 2KQ2A 5JS2A 3PV8A 4K4WA 4FLWA 3DRRB 1VSFA 5HBMA 4RU9A 3PJXA 2V0NA 4DSFA 4O44A 4Z4FA 4DL5A 4M3XA 3KMSA 4FJLA 4ED0A 4URGA 3EPIA 3SQ4A 4CJ3A 3MR5A 2HHUA 1BL3A 4FJ8A 2BQ3A 4F3TA 5FROA 4JS4A 4CF0A 4EBEA 2RKIB 3Q8SB 4IOBA 1LWFA 1I39A 1QS4A 2R8GA 3LP0B 4OVLA 4Y2AA 4ZVFA 4KHMA 1SV5B 3OYLA 1RTHB 2R2UA 3K5MA 1JL1A 3H5SA 4ZPCA 5KFPA 2RN2A 3NH0A 3QEWA 1IM4A 3UR0A 2BANB 4CHPA 4ECXA 1C2PA 3KLEA 1YTUA 4DMNA 5KT4A 4DSEA 1U48A 4M3TA 3MEEB 2PY5A 4URQU 4Y2CA 3VN5A 3SUQA 3M9NB 3WNFA 3IAYA 3SI8A 2GBZA 3I0RA 4CEFA 1NJYA 3GIIA 4ELTA
chains in the Genus database with same CATH superfamily
1RT1A 4AHCA 4JV2A 1YJ7A 4JKEA 1S6PA 1UKUA 1VSIA 2AGOA 1ZTTA 3FKBA 4DS4A 1NCLA 3PYDA 5A8KB 3F9KA 1TL1B 2VFVA 1JLCA 4L3QA 2OZMA 1NK5A 3TP2A 4OKKA 3P6YC 3OVBA 3IRXB 3K59A 1T9XA 4DSJA 2YKNA 4EMDA 1GX5A 2GAHC 4LBHA 4QWBA 1RWVB 1BHNA 4FNHA 5AQLA 2BYCA 3W65A 1OMSA 2HBMA 3AD8C 4PWWA 1J5OB 3AVIA 2M5YA 2PMZD 2Y8YA 1FKPB 1ICEB 3VF0B 4E1JA 3MDQA 4ZVTB 2A2CA 3QB0A 1NPPA 2IBOA 4DV3F 5JMNA 2CIMA 2AYEA 4YHHK 4HHTA 1O5JA 4ETZA 3KG4A 2EX3A 3CD7A 2AW0A 1IXKA 2IMWP 2D9OA 1IJFB 3OVSA 2AJQA 1F6TA 5KFOA 5AQXA 3MMAB 2DPNA 4M5IA 3RB0A 4X4NA 5AE3A 2DFEA 2NYHA 1X31C 3JAMU 3GCWP 1VSKA 4DF4A 3VGKA 1RLDA 1HFEL 4ID8A 3MFHA 5D3GB 1JXLA 4ZVOB 3ZFVA 4IJAA 4NYNA 3GOIA 2CKWA 5D15A 2CNLB 3HHEA 4NCGB 3SPZA 2Y8WA 3VGSA 3PW7A 4B9SA 2UUTA 3FZBA 4MT1A 3CCUN 1YIJN 5I3UB 2HQCA 4ZCKA 2OPPA 1UP1A 4KGKA 1J27A 2OA8A 3BSCA 4DV7J 1WNEA 3DRPA 3AGKA 1RWWB 3RW7A 2EFPA 2IJFA 3PIPL 3KJNB 3QLHA 1S1UB 3SQ0A 1JXVA 3DMJB 1W7AA 4Q8EA 1HX1A 3HZGA 3CCLN 1T0TV 3I33A 4TN2A 3EDRB 1UVMA 3EICA 5E3PA 5A2QU 2OTLN 1F9HA 2XB2D 4JI5K 1KWMA 1MA9B 1DFDA 3FFIB 5GAGU 2BR0A 4FWQA 3LALA 4JNEA 2DRAA 4R0JA 4NYZA 3O6QA 4U7BA 4CTAA 3KK1B 3ZT0A 5FPNA 4UOHA 2K3IA 3Q2SC 4JV5F 1OS5A 2MLXA 3JXOA 3AVKA 4JI4F 2RF2A 1S6QB 4M63C 2O3DA 4WE1B 1OO0B 3KLHB 1YAGA 4YY3J 2ZZMA 1NOYA 1VHIA 1RT1B 2V8HA 4QYZJ 1RT3B 1F1BB 1JXEA 1OQ3A 3CWJA 3TZZA 1RT2A 1WC3A 1F5AA 5KOXA 3SSQA 1HRHA 1FTCA 3ITHA 2FPHX 1YZ6A 3PZPA 4DV4K 1R27B 2V8GA 3ZZUA 1VQ4S 4E1MA 1UJ5A 3KWGA 3L95X 3LGMA 1SJ3P 1RAFB 2HMIA 3FEXB 3GSDA 4FW2A 3GWCA 1UVKA 1Y9OA 2UVRA 3MM7A 5EXWA 2O8DA 2LEPA 2RE1A 2DH9A 3VVUA 1K8AT 3BB5A 1YUWA 2DGSA 1Z25A 5G0RA 1UFKA 3HOTA 4KKOB 4JHDA 2EKNA 3RU0A 1HHSA 4QR1A 2DIUA 4LT6A 1MDUB 2DK2A 1MU2B 1FRHA 4TLRA 2JL9A 1Z6RA 2RS2A 2Z4PA 4MFBA 3C2PA 2DNRA 1GOCA 4AHSA 4FPAA 1AXQA 2VJUA 4I2QA 4LF7K 3QGIA 4UY8T 4BC2A 1XJWB 5B8HA 2EFVA 1VMBA 1MWYA 4A8WA 3DOMB 5M1OA 2Y9HA 4EK2A 1TK8A 3ENVA 3CCTA 4JI1J 2HLUA 1NXIA 5DK5A 2H5EA 3AVFA 4PWDA 1YVNA 2N4DA 2ZJPQ 2DGXA 1M90O 1F3FA 3EGVA 2CQ4A 2E1PA 4LFCF 4YDDB 4YB5A 1P1LA 2WRMA 1Y97A 3FDSA 3EX7B 1Q82T 5AQSA 1JLBB 1R8HA 2P9KB 1VRQC 4ZPBA 2DHHA 4PQUB 1Y5NB 4LFAJ 4DS5A 4EBDA 1UEVA 4PA1A 3G6YA 4ZJLA 1P6TA 2EFQA 2CPXA 5JJBA 3TI0A 3C6AA 3PSFA 1HW9A 1PC4A 3DI6B 4P6QA 3EYZA 1K1SA 1R0AB 4GC7A 1HI8A 4WKRA 2LXUA 3G4SN 1SQGA 3M6WA 2FLPA 3VAKA 1KTVA 3MM9B 4E7HA 5HBMB 1PYSB 5FDLA 1BY9A 5HVFA 2YQ1A 4ZK7M 4MK9A 4CO2A 2BM0A 2RUSA 3AO4A 3BS9A 5LMNK 4B1YB 2HMPA 5IOLA 1VS3A 3WDOA 1URNA 2V51B 3IRXA 3I32A 1VSLA 3NL0A 4TSXA 3J7Z5 2HRTA 1LW0B 1KLMA 3NS5A 1U09A 2OH2A 4NO7A 5DGBA 3RTVA 1KQFB 1HLUA 4PG4A 4QWEA 1LW2B 2W4DA 2E5JA 3D0GE 5HMZA 1U1OA 2WONB 3CJAA 5CE3A 3KHGA 1K6YA 1PIEA 3K8WA 1XQSC 3JS6A 3SI6A 3TWZA 3HHLB 4PWDB 2Z2ZA 3GFXA 2HS4A 3PTWA 1N0VC 1L3TA 4YFUA 3D28A 3TQ1A 2DTUA 4ZLPA 1F9EB 4V1Ak 1SBRA 5AJ3K 2XHWA 2ZOMA 1VQON 2MZTA 3SNNA 2FTRA 4IQXA 4CIEA 2P5GA 4BE1A 2F1FA 2P9NA 3T7ZA 1TKXA 4BR7A 4LSNB 4B3TF 1ZBFA 4DN9A 1WSFA 4YOTA 4KGZB 4LF4K 3QZ8A 1YG0A 2Q3PA 2D0CA 5LSLA 3V81B 4CECA 2UXCK 2KU7A 2HGMA 3ULEA 4IG3A 4NMLA 5L46A 2HHHF 1OKJA 5F8MA 3R9LA 3US5A 2W9BA 1Q78A 4DTRA 1NU0A 3UW1A 1RE1B 3DYAA 2CADA 4LSZB 3ZZ0A 1HR0J 1HKAA 4DR5K 4CNZA 5C7PA 1C0UB 2J9CA 2C22A 1KVCA 2QV6A 1SCJB 5J1EA 4MKBA 1VQ8N 2VG7B 1RT2B 1HJRA 5AQJA 3ZEUA 3TQEA 2UP1A 5KFCA 3L7UA 2YY3A 3EZ5A 1QVGR 2ZUAA 4KH4A 2FLOA 4I0WA 3GYNA 4K4UA 1CJVA 3NGDA 1IKXB 3BGOP 2E2PA 4HHJA 1RK8A 3SJJA 1BCMA 4JI6K 2WCXA 5ADXA 4HCBA 3G25A 1T3VA 4AM7A 4BG9A 1M5VC 3CDWA 1YT3A 4CTAB 1IBMF 3Q8VA 3SJHA 4PWUA 2N3OA 2D0BA 2YHBA 4GVMA 1R7IA 3PRBA 4TYAA 4B3SK 2BKOA 4RBVA 4QCLA 3WUHA 2OD6A 4B9QA 3VQSA 4JP8A 3B4MA 1UVJA 2HAIA 1HBUA 1U2RA 3BZKA 4DV4F 4KV8B 4Q44A 1OWXA 1QUPA 4A8SA 2O8EA 1OH8A 3TVZA 4C3LA 1CULA 5IV3A 3ZO7A 1OPZA 2A5XA 1R43A 2ZE2A 3CVKA 1B92A 4JLHA 2XI2A 4U8VA 2GA7A 3KDOA 1N33F 2GIFA 4CEEA 3BGRB 4X4TA 1ZAWA 3ENWA 2DNPA 3MXHP 3AD7C 2LU2A 4B3SJ 1Y11A 2ITMA 3E8OA 4CH1A 3P31A 4MLHA 3PG9A 4LVOP 2IA6A 4PR6A 3IFEA 2W25A 1NMNA 2HIQA 4XDCA 3WXLA 4WKYA 4L75A 2BANA 1VQPS 3ENHA 5FDLB 2QA4N 4USKA 2O8CB 1JWWA 5HANA 4FJ5A 3OVAA 5DMRA 2QA2A 2F4VK 2AV5A 1N56A 4RNFA 3T1YK 3H0PA 1GXTA 3VEOA 1RWUA 1V3SA 5AQMA 1N48A 3THWB 5IT9Y 2BJDA 3NWGA 1E6VA 2XMUA 3OS1A 2NNWA 3CCUS 2QLWA 3B82A 4BDPA 3ILIA 4QOZB 2J8AA 1H1VA 4OHZA 3CERA 2QE5A 4LF5J 2CA9A 2GGPB 3OYBA 2C3UA 2IVMA 1APSA 1RCOB 3I9ZA 1YQHA 2HNDA 3BEGB 3C14A 2MLZA 2KFNA 4W92B 1YJWN 3FGVA 4BDYA 4IOAL 4JI7F 3J81O 3O8MA 3W3DA 2NCKL 3AA4A 1ASVA 4WFYA 3HX9A 5B09A 1MWKA 4QPTA 5KFSA 1VBXA 4XEIA 3V4IB 2IVNA 4Z4CA 4ZCMA 3A5LC 1VIXA 2OSQA 3BM7A 1VFJA 2QI2A 1RGVA 4JYAF 3P5BP 5DS7A 1S0NA 4PABA 2GWJA 1HNWK 2RAQA 2WFBA 5BYRA 4ED4A 3C6UA 4X4OA 2J6TA 2XYPB 4FS2A 3LTOA 1AA1B 3KKFA 3DNCA 3AOCA 1HARA 4JRPA 3G71S 3IP0A 3GV5B 1UFWA 4A48A 3W2VA 1Y00A 4BC5A 3VA3A 1Q5VA 2GO9A 4HT7A 1Q81O 5KTQA 4ED8A 4X65J 3J7YI 1KVIA 4B8CA 4M3ZA 4PPDA 2CNOB 4TY9A 5HAOA 2BUPA 1LNQA 1ZM9A 3FE1A 3R5BA 4OJGA 1IR0A 2VFTA 4TLQA 1M90T 3G96A 4A5AA 4H4OB 3R7SB 3R2CJ 1GT8A 3TANA 2ZJPL 1NGFA 4RW9A 4DPXA 4BG8A 2EXUA 5IC4B 1N32F 1BUPA 3UN5A 1BD6A 5KFBA 5AE2A 1QY7A 4DLGA 1R6YA 3C14B 2QEXN 3OTBA 3EE8A 1UTAA 4FBUA 1RDDA 1DTQB 3D1QA 2QA4S 1B0VA 1NK0A 4HVZA 3S3OA 5KPRA 2FXUA 3KWIA 5CH7B 4OHVA 4DL6A 2AF6A 1YHQS 5C5JA 4N56A 5AQZA 3M2UB 2HWIA 4ETXA 3MWTA 2DTJA 2MDAA 1FNOA 3SYZA 5KRSA 3PDNA 3MMJA 3MR6A 3K0SA 4JI8F 1CG2A 1AT1B 3NS7B 3QRPA 1K0TA 4OI0A 1A0OB 4Q2MA 2OUGA 1EX4A 2HBRB 5B0DA 2AD9A 1YWXA 2LEAA 3MI7X 4X66F 4QWAA 3GFYA 1ZBHA 4CFDA 2HFSA 4HHUA 3LDOA 2PFDA 5KFGA 3MXIA 4C0BA 5AQNA 4C2MA 4JI8J 4WCEL 3TZXA 4FZVA 4M5KA 1VK8A 3D7EO 2V8VA 2GMHA 1KRPA 4WFBQ 2JFKA 1B4SA 2YNFA 4NB4A 3CM5A 4ZVPB 2AJFE 2ZH3A 4M1KA 5GADP 1S4EA 1YJ9N 3ONQA 4OI1A 2VPWB 3G0ZA 4H0TB 2I9SA 1JLEA 4BRFA 1U1KA 3LPUA 4NXNJ 3PNIA 5HATA 4M3YA 3RAXA 5GAGP 2E9TA 5F3ZA 1S1UA 4A62A 4IXCA 1IQZA 1VRUB 1ZOTA 2K7KA 1JK9B 1ROFA 4F0KA 4U7UD 3ET6A 3V1QA 2CZVC 4HACB 4Q8FA 3VQ9A 2IRUA 2GIQA 2H5JB 2Y1RI 4BR4A 1N5TA 1U6BA 1QJHA 4J9SA 4LF7F 3G8SA 4KJIA 1PSDA 2LQJA 5AXNA 1FW6A 3UVJB 4JI0F 2M52A 1FRLA 3HHKA 1EP4A 2VG5B 3CIZA 2A1SA 3VENA 4PL8A 3VQ7A 4CJWA 2DGOA 1JLAA 3M6VA 2D7SA 5CYJA 2A1RA 5GAHI 3SCLE 3MOJB 4CJTA 2OEKA 9RUBA 1GMVA 2MY8A 2GQ2A 4CF1A 2ZJRL 3AHPA 3DN9A 4KKOA 4DX7A 4D3GA 2BH1A 1WKJA 4BQLA 1U2VB 4DV7K 5J1EB 4EYHB 1FX2A 2RH3A 1GXLA 3QFUA 1G2EA 4JI5F 2MZSA 5AQRA 3NNHA 3WNHA 2MHNA 1FJGF 2YKNB 5HJYA 3Q8UA 2UXDJ 4H03B 4QYZK 2BGGA 1D0EA 1YDLA 4CLWA 1FEHA 4ZDNA 5ITHA 3O1BA 1U0SA 4WTYA 1IKXA 1B7FA 4C8MA 4M95A 3SAHA 5GMDA 3VQ4A 7FD1A 2G13A 1SKWA 2R7OA 2XMWA 2MKHA 1BI4A 2JEFA 1UVLA 3CDEA 2A6OA 2EFGA 4YN3B 4FPIA 2D5RA 1HKGA 4O5BA 4CHQA 3BF3A 1VRTB 3GIMA 3W5YA 1VSDA 1RTDB 1XNQJ 2BJ8A 4L3KA 1ULRA 4DQPA 5EX5A 4NZ6A 2BOPA 2RF2B 2WBMA 2AZ3A 3MXJA 2G8VA 4F04B 1E6YB 2IAJA 3SDEA 1FESA 5IM0B 3MR7A 1FTRA 1ZAVA 2B3TB 2OJ3A 2VQFF 3OS2A 3AXMA 3DFEA 2JEJA 5CABA 2W4CA 2DNGA 4PUOA 4AM6A 3J81Y 4BE0A 1HYSB 3R6MA 1MROB 3EGZA 3F73A 5FJ4A 1RT5B 1WSRA 2JLFA 3SUPA 3JS9A 4CT9A 5J2NA 4YB6A 4YB1P 3D7SB 4QU6A 2MXYA 4KT0C 1Y5IB 5LMUJ 2P9EA 4QIFA 2L08A 4RW8B 2XQCA 2R2TA 1XBWA 3CMAN 2FBTA 1KOOA 2HVIA 2CVIA 3IUCA 1WSGA 3VAIA 5M2UA 1YSJA 2F8TA 1GNKA 4CF9A 4UUWA 1ATNA 4U8YA 2CPIA 4Q7AA 4J2DA 5D8HB 2AU0A 3CO0P 2ZNYA 1HA1A 2AYBA 3DHWC 1S5JA 4F4AA 3ULDA 4X4VA 1SS6A 2XY6A 2EC0A 5EY4A 2B8PA 4Q0BA 2DRBA 1R0BG 2G2OA 3HF5A 4DQ8A 4IFYB 3R6LB 1QQMA 5ETTA 4BGBA 3MEDA 2QLXA 2V9KA 1M5OC 1ZPWX 1I3AA 1S59A 1LW0A 4CO0A 2VWKA 3R27A 1VQ7S 1EQ0A 1FRMA 3QGGA 3NXZA 3EVOA 1XI1A 3EDQB 1G15A 1RT7B 1BHLA 1FKAF 4DR7K 4RO0A 4OI6A 3DAWA 2E9RX 4IR9A 1A5WA 4JUZA 5BR8J 3ZTQA 1BMQB 4DI6A 4CEBA 5IT0A 3SXLA 3NBPA 2V4JB 2KYZA 2FSNA 3KG0A 3GILA 3H4DA 3AVHA 4EHUA 2NRZA 2JOQA 4E19A 3M8WA 4AFFA 3A12A 4WF9L 1V5VA 2IM3A 4FLTA 2DY4A 2XY7A 3RBXA 3H1QA 1RTJA 1LEOA 1W2IA 3IC1A 2QTWA 3H25A 1UZHA 2CQDA 3RB4A 2QWRA 1PILA 2XMMA 4IOAQ 3KJVA 4NLRA 2J9DA 4B1VA 4OX9J 5H9FK 2HAFA 3BGUA 4NXNK 2B7BB 4BS2A 3KZBA 2ZH1A 3MX5A 4CFAA 3E9PA 4KB0A 2NRHA 3GJTB 5H9EJ 3QIDA 3PEHA 5HQLA 1C0MA 1VQNS 3ID8A 4USMA 3O9QA 4TYBA 4EO8A 3V1RA 4ZPDA 4BRNA 3BDPA 1HYSA 3LWMA 3DDIA 4B1ZA 2YKOA 3ZZPA 3MM5A 2YI1A 2EG1A 2IVYA 1Q8IA 1HBNA 3IGNA 1Z26A 5DDOC 3EM1A 1EO1A 4FWPA 2WBRA 1SV5A 4QIEA 4AL7A 1QDUB 4WFZA 3S1TA 4A57A 4I7FB 5M1NA 1WDTA 4LUBA 3FQLA 2HBYB 1GMUA 4OL8A 3GIJA 3HYFA 3AA5X 4I56A 2DXFA 3OXFA 5K14B 4B3OB 4R25A 4PCQA 2B9XA 4MTPA 1UA0A 3AGRA 3THYB 2HS0A 2ZWHA 3SFUA 5I42A 3CCZA 5D0GA 4KHQA 3KUHA 1X8DA 2HSEB 2FJXA 2BOAA 1U8SA 2OTLS 3LPTA 3RMCA 3TX0A 3M8RA 5ADXH 4UQGA 2P5VA 1I94K 4USJC 2I38A 3IBCB 4ZTJA 1VHXA 4XDDA 3QO9A 4KE5A 2CG8A 2ASDA 4PZVA 5LMNJ 2YTCA 4GVLA 1HQUA 5KT6A 1CPZA 4KHUA 2V2VA 4FXDA 4LIRA 4IG3B 5AQTA 1K8KB 2I5JA 3GDQA 3KD1E 3QGHA 2VOOA 5HLFA 1FWKA 2VC1A 4V19X 1WTFA 3VALA 4E0DA 3ZSQA 1D8ZA 2GX9A 4CH0S 2MMYA 2UXBF 4DV5J 4B1WB 4HUGA 1CS4A 1FRXA 1RUSA 2IM0A 4YNQA 4EFHA 5HMXA 2GW8A 3IBFB 3O4NA 2H1YA 1X4HA 4DV6J 4YHHF 1FX4A 2RU3A 2I7PA 3LQVA 4B9UA 3UVJA 2YQ3A 1C0GA 2P9PB 4OZ0A 4DMZA 3KKRA 3OTCA 4GMJB 1QHAA 3FZMA 4UOGA 1V4SA 5B0GA 3DU5A 3CUNA 3MMCA 4R8UA 4B3RK 1YBTA 3MM6B 4MMOA 1KHWA 1XMQJ 3R7NB 1V4TA 4NCGA 4ECSA 3CD6S 4DR1F 4FBTA 2G8UA 2VDIA 4KV8A 1X4EA 4LF8K 2IC3A 5CYMA 2AGQA 4AHVA 1LK7A 3L0QA 1BOTO 1UAXA 1PBUA 1VQKN 5CZ2A 1WC0A 3H8YA 1A5XA 1W25A 4FNIA 3G9CA 2H9ZA 4CJRA 2D3O1 2GVDB 5AQKA 2YNFB 2VQFJ 4KRFA 4LF9K 3EL2A 1S72S 2NLWA 4CLFA 2VL1A 4DQQA 3Q7CA 4GKKK 1NGHA 4ED6A 3O9UA 2VC0A 1RHRB 2G8HA 1XWLA 2OYQA 4FJJA 3M8SA 4FJ7A 3DKDA 2L9WA 2DT9A 4RX6A 3D2FA 1O6XA 4UF4A 4ZVGA 2RMLA 3A4TA 4ISGA 5EU7A 3BREA 3VGMA 1N0UA 3TRGA 1NLKL 1KFDA 1Q8KA 1UJ4A 3OJUA 3P39A 4NYPA 3GU0A 3P5TL 1I94F 5C2GA 4KHPK 2GQQA 4DV2K 2DH8A 3HULA 5IM0A 2V2QA 3NS6A 3E01A 3CO9A 5MAOA 3AO5A 1W97L 1S6PB 3EGNA 4MJKA 2DXEA 1NHUA 4QS9A 4PG8A 2QIFA 2VGMA 1U1QA 3UDCA 2CWXA 1MN9A 3S01A 2HVDA 3ZZOA 4CCHA 2YWWA 2LA6A 1IKWB 3CCES 2HVHA 4CEOA 1RAIB 5LMUK 3I6PA 1S1WB 4K42A 4J9QA 1QVGM 3NP5A 1HUXA 1VSHA 2K3KA 5AQOA 1BQNB 3M8PB 2VDHA 2V2KA 3TABA 1NB7A 2GHVC 2VBZA 1TYQA 2UVVA 2ZHOA 1N88A 1KD1O 1JLGB 4A47A 3R1LA 2UYTA 4ED1A 1VSJA 2NRRA 2ZVIA 4IFVB 2GTDA 1C1BB 4X4UA 3E1YA 2CFXA 5I3PA 1KTQA 4YR2A 1IVZA 3A8KA 1IKWA 3DGVA 2P9LA 1FKOB 4IDHA 2LDIA 1RSCA 3AOAA 5BPMA 3MCMA 2XGPA 3V9UA 2GHPA 4YOUA 1WAFA 1YBUA 3CJRA 4OYOA 5J2PB 4MQ3A 2H48B 3MPDA 4DFPA 4CLSA 2QK9A 4HDHA 1I6JA 5SWMA 2P9SB 2XULA 1KVBA 4A8YA 3D3CJ 3I4PA 4FJKA 1OIAA 4JKHA 2MJNA 3NY0A 3UNYA 3I9V9 3PV8A 3MPWA 2E1YA 4K4WA 4FLWA 1VJWA 2MPUA 2CRLA 3UCZP 1NWKA 3CC2N 4RU9A 2OLWA 4JYAJ 4O44A 4LF9J 4Z4FA 4M3XA 3IMQJ 3A8YA 3SQ4A 4CJ3A 3PYEA 3ZTPA 2FF3B 1BL3A 4F3TA 5FROA 1H72C 1KVKA 5AR0A 1YJNS 4IOBA 1BA1A 2DO4A 4P72A 3P3DA 4DHYA 3Q22A 4USWA 3ZTOA 4OVLA 2A3JA 1WELA 4JI5J 3I31A 4N77A 1PCAA 1RU2A 3VHQA 1PJ5A 1JL1A 4E98A 3W9JA 2PSZA 3NH0A 3QEWA 2CQGA 1UWAA 2BV3A 1IM4A 2M70A 1C2PA 3OW2M 4BY9C 3SAFA 5KT4A 4M3TA 1M5HA 3HT0A 3VN5A 3M9NB 4YOYA 4CEFA 1NJYA 1XQIA 4EFAC 2EPIA 4B17A 3JYTB 3RR8A 2C2NA 3N5FA 5JMVA 3RAMA 2ALYB 1DEJA 3OFFA 1OQ6A 4P73A 4JN4A 4B9NA 2FGCA 1KBRA 2EBEA 2CPFA 4HUEA 4AQYF 2A41A 1N32J 3QGPA 2CWKA 2KRRA 2LKZA 1SUQA 1NBEB 1R0CB 2A0FB 1Q8LA 2QLFB 3T5LA 3QFWA 1V9OA 2O4GA 1W0HA 1QZ6A 4NA2A 1ZYQA 2P2CB 1WACA 2AQ4A 4PKDB 4ZVUB 3AT1B 3F41A 3EZUA 4CIGA 4BRDA 2O8EB 1CXUA 2DGWA 3D6FB 4FWOA 2XO7A 4JKGA 2VG6A 2P6TA 5KFXA 5J2QB 4YOXA 5AZJB 3MM7B 4LF4J 2Y0SD 3MTJA 3FBEA 3T3FA 5EHHA 1S6UA 4KC5A 1X9WA 3LPYA 4OLAA 2CPDA 2QTDA 3G10A 1TFYA 4DV6F 4CJUA 4G65A 4CERA 2E66A 3WEEB 3TJ9A 3OYAA 3VGTA 1S3XA 3BBBA 3LAKA 2GC8A 4MO5A 4OPHA 2HHQA 1VRTA 4USUA 2YNIA 4RWXA 4ZP8A 2HNYB 4XAKA 4BRPA 3QEPA 2WHOA 1U2VA 1Q9YA 1R8CA 5JICA 1LQ9A 3AD9C 2X1GA 4YOWA 4DV3J 4B3OA 4B9VA 2HF4A 3V6HA 1PGZA 1H2UX 3MXMA 3QPIA 3OLBA 4RW7A 2XYHB 2KKZA 2BKNA 2FJDB 1GMWA 1HQEB 4F26A 2YKMB 2GHWA 4KYZA 2RD5C 2F8SA 5ETKA 1HW8A 3CDBA 3LZIA 2J7WA 3MPUB 1I5OB 3OYGA 4I9LA 2KKHA 3PR5B 3SCXA 2VHGA 5E3CA 2BBEA 4H0VB 4L72B 4Y2IA 1N4LA 4UQTA 1HR0F 1V3RA 4K0KJ 1RDAA 2ZDOA 1IH7A 2VZ9A 2KT3A 2RRAA 2C3MA 1IBKJ 1HNVB 4WP9A 1D9FA 2V68A 1NK7A 2R7UA 5KFMA 3DMJA 4DTSA 5HP1A 2Z1GA 1P8ZA 5AQHA 3OFGA 3RZAA 5DM6Q 3TPQA 2LVWA 4UTGA 1GOBA 2W6LA 2FUG9 3ZX0A 2DD8S 4CF8A 3U3GA 2QKKA 1W26A 3JQKA 2NUHA 3QNOA 3VEWA 2DISA 5FRMA 3PFEA 1Q7YO 5AQQA 2DHGA 1QZ5A 2F9JA 3CJQA 3ULHA 2AGPA 1M1KO 5L39A 4HLBA 3PKYA 4DCHA 3MMCB 3FRZA 4Q43A 4JI2J 1J53A 4P9SA 3I55N 2PBDA 3X3UA 3BSOA 5L1LA 3WIUA 2AA4A 3R5CA 4DR2F 1QAYA 1S1VB 4BHQA 4WZMA 4FK4A 1REVA 4EZ9A 4IRKA 3AY0A 2NXJA 2J7UA 4QWCA 4DV1F 1YITS 3A5NC 2J6SA 4M3UA 3LPEA 3TU5A 3DLKB 4DG1A 1YKWA 2RQKA 5A2QO 2HFNA 1AUSL 1TUGB 3SIPB 3L2RA 5D4NA 1B9FA 1HD0A 2POKA 3BGLA 3ZT3A 4A8QA 1U8WA 4CM0A 2APOA 3ZEUB 3THXA 3QT8A 2QM1A 2IMOA 1NM2A 1RBLA 2YVSA 4NXMK 3WXMB 3CF5L 1RQ0A 2R8HA 2EG2A 2J0QD 5DDQC 3TARA 2UXCJ 1FK9B 2CG4A 4MKYA 3TUIC 5KFFA 4LQ3A 3SMPA 4WZQA 3TSPA 1N6QA 3AO1A 5FLXY 3M2UA 4DZ6A 3NGUA 1IQTA 4ZPAA 1WI6A 1EKEA 7AT1B 3HKWA 1OPIA 1IKVA 3T1HK 3DYAB 4JV0A 1S12A 3TJ8A 1MN7A 3MTKA 1HBMA 5IT4A 2ZD1B 3G8TA 3QT6A 1BO5O 2P9CA 3VTHA 1K9MT 1YRTA 3QAUA 2UU9K 2H4WB 1EJ7L 1M1GA 2HVEA 4LFAF 1YJRA 3CCMN 3QRQA 3C7NB 3O9RA 3VEYA 1FVQA 2W7OA 5T14A 3UKUB 2D3UA 3J7ZO 3HSTB 2I2YA 1CVJA 2OKQA 1GH8A 3M2RA 4I2QB 4LRBA 3KLIB 2P51A 4HWIA 3CJCA 4RW8A 2BKPA 3L6QA 5J2PA 4E7KA 3W8PA 1LAWA 4OZ3A 3W2VB 3SMSA 4MIBA 1WC1A 4QIVA 3AAPA 4Y34A 3EO3A 1RWKB 2L3MA 3HPHA 3TUJC 3DOMA 5L9XA 2FC0A 3R5JB 5FIIA 2RRNA 3T6BA 3T41A 2E5LK 3WXIA 4FWMA 2NZTA 1C1BA 2X74A 5M1FA 4LF6F 1JLQA 1D5AA 1IV0A 2ZH5A 4BRAA 3LA0A 1AYEA 4WQ4C 2HRYA 2DPJA 5A76A 5T7LA 2QL9B 2FZGB 1G99A 5BR8F 1A6LA 1E6VB 2BM1A 2WW8A 3IKMA 2ETJA 4NLDA 4WBFA 3H1VX 1CSJA 5A0YB 3DXKB 5I4MA 2V7ZA 4KBOA 3RSEB 1VLOA 2O8BA 1ZC6A 1NO8A 1RAOA 3IN5A 3PFOA 4C3MA 3R6GB 4OX7A 4P71A 1NGGA 3HT3A 3SQ1A 2PIIA 5E33A 1WF0A 4P2SA 4YS2A 1HMVB 3UDEA 2RRBA 1UOCA 1FK9A 4TQSA 1IM6A 2ITGA 5E26A 1H98A 4IO9Q 3UIQA 5BPNA 3DOKB 3L2QA 3K17A 4MIAA 4M5GA 4WP8A 2J0XA 1NBWA 3ETOA 1QSYA 4BVOA 1VRUA 2ILZA 1X9JA 4KPCA 3BO4A 3CMQA 4RU2A 5CYMB 5IT9U 3VAMA 2C2KB 4YY3K 2GFFA 3DM2A 3EMTA 1Y4ZB 3HJFA 4CO1A 4YORA 1VGYA 4DEZA 3ZSVA 1B70B 4B3RJ 1WHXA 3CIMA 2NPFA 5ELZA 2GIRA 2WB4A 1BGXT 5J2NB 1KHVA 2XC9A 3RMAA 1DGKN 5TKYA 3N01A 3I56N 4LFAK 3DLEB 1VQ8S 1ITPA 3ZTRA 3ID6A 4CEZA 4C98A 1NGIA 4PHTX 5ETVA 3KLVA 2QMXA 4RW6A 2E1AA 5GAEU 4TQRA 2G1DA 1Z2LA 3CCJN 3NGIA 4U7UK 3J80U 4KHRA 4DTPA 4F7VA 5KPZA 1JLFB 4LF8F 4ECTA 4MLEA 2W2MP 5CHIA 1GEHA 2IYGA 2VFUA 2CQIA 3TAPA 1WG5A 4J5OA 4BC3A 2GJ2A 3R5DA 4IO1A 2M8DB 2LQ9A 5AXKA 5LM7E 2FHJA 1CJKA 3I55S 4FWKA 1HMVA 3HSZA 4B1XB 1HQEA 4CH7A 1RP5A 4H8KA 1BE4A 1HJOA 1M5PC 3Q8RB 2WUSA 5DRKA 2R7VA 1MU2A 4OI2A 3QSYB 2P6SA 1RTDA 3VAGA 1Q79A 3CJTA 5JLFA 5FPMA 1N5VA 3L2WA 4CZLA 2QC3A 4PRFA 1WBDA 2ZBCA 2C2DA 5KFWA 2DHAA 2Q1LA 3SV4A 1N34J 4CFCA 2JWLA 5D0RA 3PRVA 1JLCB 1KC8T 4RW4A 4O0NA 4EZ6A 1T3NA 4JOUA 2WSEC 2BE7D 3ENQA 3PY8A 3MPVA 4IOCL 1SC1B 4X84A 2F96A 1G7CB 4OKJA 2DY1A 1BI4B 1EETB 2UV8G 4KTZA 2YWGA 3A3NB 3H5UA 4R5PB 2ROEA 2BJ1A 5HQMA 2ZKUA 1ATRA 1VQYA 2QA4G 2OPQB 2BW2A 4FJMA 3NE6A 5IWAK 1WKKA 2ZWPA 1KN6A 2PEBA 2YWFA 3LP3A 1SC4B 4PYDA 4GY2B 1C0UA 3QT5A 4YOEA 1KD1T 4KI4A 1C1AA 2JFDA 3AH6A 3AVJA 2ZVSA 4HHHA 4H4OA 3ADAC 3TUPA 3WEEA 1UETA 4CM2A 3ZETB 3JSYA 4O3OA 3H08A 4ICLA 2ZDPA 2YX4A 3Q8PB 4NLUA 3G8QA 1ZBTA 2B56A 4OPKA 3GV7B 3PW5A 4M42A 2KB2A 1QAIA 3MM5B 4UW2A 2WOMA 1NLVA 2PDAA 1HR0K 2E5LJ 2IJNA 2RSQA 3B78A 4CWBA 3POTB 1U0HB 2MEWA 3JSMB 1KOHA 2ZM6J 1SL1A 2UUCK 1DKGD 2CPEA 2GVZB 3GJRB 1UWBB 3ATVA 4AD6A 2EI5A 2JJ4D 3H7HB 3V1OA 1H74A 3CCVS 2NRVA 5K8OA 4F2SA 2KZMA 2E4LA 1NJZA 4K2JA 4GV9A 2WAQD 4W5QA 3CJBA 4DCPB 5AE1A 1TL5A 1U4BA 1WSVA 2VU5A 3QAEA 3CDAA 1PBAA 3M9MB 1TMJA 3D6MB 3L4QA 1HNXF 1QLNA 2R9LA 3FEYB 4URSA 4GVBA 4U96A 1BWFO 1O0PA 1RDCA 3ZZYA 2B51A 2DNNA 1NNEA 4OFZA 1PAEX 3BEXA 4CHYA 4DBQA 2IS3A 2R7QA 2HF3A 1IBMJ 2W42A 5HQ8A 2IRXA 3CJ3A 4DSIA 2YHYA 2XO6A 2QWNA 5EVZA 1DRZA 3M6XA 3CFRA 2ZBPA 3FLCO 3PHEA 4LBPA 1DQAA 1TFWA 4ZOSA 3K57A 1X4DA 4L8RB 2HZVA 2B5JB 2GCFA 3ZSYA 3JSBA 4CJFA 2W2NP 4FVCA 1TVRA 1R0AA 3KOAA 3C15A 3IA0A 2GEMA 4KPYA 2HHPA 2PYLA 3OJSA 1RXOB 3AAWB 3K8VA 4OYWA 1NGBA 3HCXA 2R8KA 4KBIA 4NASA 3KG1A 4H5TA 4J9PA 3UFCX 4BR5A 1N33K 2CH6A 3DLBA 4JK9A 1X5OA 2DNQA 1M1HA 1TL4A 2WSCC 4FJNA 4PQUA 1YVUA 5AFUA 4G9ZA 5SUHA 2IA0A 2ATCB 3CT9A 5KG7A 4ANDA 1U6FA 4BRLA 1JLQB 1JJHA 4YQWA 1OJ4A 2J8SA 3ZLJA 2ATQA 3HMJG 8RUCA 4CJEA 3DXKA 4ZMMA 4GKJJ 1LWCA 4CZEA 2PYJA 1WDDA 1HNIB 2DYAA 1IJEB 4ENOA 3MX2A 2D69A 3GB0A 2VV5A 2HVZA 2QJ3A 3O3FA 3R7BB 2V94A 3Q86A 2MGZB 3H5XA 1ZBLA 3S8SA 4J9MA 5DG9A 4FYWB 1WG4A 1NG9A 1S4FA 2Q43A 2IIRA 4C97A 2RDJA 3QZ7A 2JEGA 4DU1A 5C25A 5CA5A 2VCPA 3I5CA 1H73A 2ZZTA 4ZPWR 2KT2A 4I4BA 5A8WB 2G8IA 2E1CA 3CCQN 2XMKA 4LC9B 1JJ2R 2QFJA 2CQBA 4RUAA 3KLGA 2CQHA 5C2FA 3AAQA 1WC6A 4I2PA 2FVCA 2XEXA 4R5PA 3IR6B 5KG3A 1R6VA 1BWVA 5LMNF 1S0VA 1OYDA 1BG3A 2J76E 4PXBA 3B6PA 4A2BA 1NZ8A 4DTNA 3OHBA 3BSAA 1Q8BA 4YR3A 3THWA 5B0FA 5DLFA 2O5DA 4BRMA 2ZH4A 3I8BA 2AIRB 3HVWA 2AX1A 3BH6B 4DL7A 1RJJA 1FDNA 2FIUA 3CULA 1FXDA 4NI2B 3PO5A 1IBMK 3OR2A 1RWXB 4DTOA 4DV0K 1GLAG 2HNDB 4CJLA 3OFEA 3CCJS 1ZM2A 1VBYA 3D3BJ 3HHDA 1M1KT 2IVOA 1K73O 3CFOA 4DCJB 3T1YJ 5KFYA 1R59O 2UXDF 4CIFA 3KYLA 4Y1DA 4WFXA 5HMYA 5GADU 3HOSA 4OHYA 3AVGA 4RG8A 4N8OA 2H65B 5ETQA 3CJ5A 2GV1A 4OYPA 1TV6B 3EUNA 3A1YG 5KFAA 3HM8A 2ZFHA 3WNEA 5KPTA 1Z2ZA 2B8QA 4QS8A 2ZQBA 1EWRA 3D2WA 1U49A 2QSFA 1C1CA 2NR0A 2B9YA 2C1EB 1X9MA 4M41A 3UE5A 1JX4A 2FY8A 5KRTA 4CZHA 1HPZB 4QW8A 1XEZA 3M30B 5M1QA 1FNXH 3DLEA 4LF7J 1WC5A 2ABYA 3BGRA 3IAM9 2EFNA 3RBDA 1G3OA 3I5AA 2R7XA 3AA3A 4B9MA 2AEFA 1TR0A 4DTXA 1N5SA 2EFOA 4Q2LA 5HRRA 1FRKA 3BKFA 4ZVHA 4MKVA 3W8GA 4OV6A 3QIPB 4AHTA 3GFHA 4O0IA 4NXNF 1TAUA 4KHWA 4LH4A 5IXUA 3CJKA 2XMJA 2YBVA 4F50A 2VB6A 4FN5A 5TKWA 3TAMB 2XLJA 4ECRA 3MUMP 3O80A 4E89A 4HH0A 4I6AA 3HKZD 4AHUA 1N8RT 4HH1A 3PKMA 3DOKA 3P4IA 3PHTA 2C2EA 4FO0A 3SCJE 1HIYA 4G1IA 4O3PA 4LF6K 5ETRA 4O4GB 2HWTA 4RR5A 1AROP 1NHKL 2W4PA 1FHTA 2AHOB 3GCXP 1WBBA 2MKIA 4CBXA 2PA8D 1TP7A 5D77A 2HFZA 4NL5A 2NXUA 3J81j 1ATSA 3U7JA 3WQUA 3AB2B 5CCLA 4DR5J 3CD6N 3TAFA 2A3ZA 1RCHA 2HQFA 4ECVA 3F0NA 2FGOA 4I1TA 4IKFA 2LCWA 3HFKA 3BV8A 1SL2A 4JI1K 3M6GA 3PJ9A 2YKMA 4O8KA 3KNGA 4FLYA 1VC6A 1RABB 3OD2A 3TAGA 5CR4A 3OTOF 1HYVA 3T1HF 1Q7LB 2NRWA 4YDXA 2G4BA 3HL8A 2PD1A 3D1OA 2GQCA 4E7IA 3OTEA 3WZ0A 1DTQA 2KVQE 3WT0A 2HW3A 5JXSA 4TKTA 4TVAB 4YP3A 1LFWA 4O44B 4CZMA 1UJ6A 2WTUA 1UWBA 2UXDK 1T94A 2ZM6K 4FJGA 1HBNB 1V5IB 5J2QA 2MHEA 2PZSA 3CCMS 1FJGK 1JNRB 1SZ2A 3OBYA 4Y28C 3OYDA 2Z56B 3CD0A 1HNXJ 1WF2A 1JJ2M 4RW9B 2FHMA 1GLJO 1CLFA 4I6YA 4IRCA 1BIUA 2FBVA 3NAHA 4IUFA 1CEZA 4YOVA 4Z2XA 2W1BA 3U8XA 3V4MA 5FLXO 1LXJA 4OGEA 4X62K 2MZRA 5DZ6A 5L38A 2OTJN 3J80O 4LF4F 2KXNB 2A1BA 2NUUG 3KNAA 4WQ4A 1DY3A 3FRYA 4CJVA 1HBOA 2ZUGA 2FJAB 1C0TA 3I4HX 3N9UC 3MD1A 1U04A 1LW2A 2OZSA 2JLEA 4ZCIA 4ZVEA 4NXMJ 2WSFC 5IV4A 3CETA 4WE1A 1CXQA 1L3UA 3VOVA 4ZHRB 4MKAA 2Q6CA 2YKPA 2P9UB 3U4LA 3FCVA 1Q5YA 5KG6A 4CZCA 1GOAA 3FJ2A 2DEJA 1Y3KA 2AJ2A 3K5PA 1PKUA 4FLVA 4W5RA 1Z4UA 3W64A 2B5JA 1YTYA 4BQZA 4FF3A 1VI7A 4WU2A 2AEJA 4LF5F 3OTOJ 1S6QA 2E1ZA 1RU1A 2VODA 4HCCA 2Z2LA 3BF4A 4CGDA 2YX1A 3DRYA 2B4JA 3D0PA 1CJKB 3IS9B 2PFUA 4O55A 1SH0A 1F3VA 3JQJA 3ETMA 4Z7YA 2B4VA 3RRKA 3QJJA 2X6NA 4CT8A 4CP5A 1NSQA 2DEIA 1GX6A 4IG0A 5F8NA 5DDRC 4AE5A 4RBUA 4FCYA 3CC7S 4F25A 3VQ5A 3O4QA 4CFBA 3F2KA 4IFEA 3LZJA 1T05A 4O3SA 3OBWA 2PT0A 3CJ4A 3M8ZA 2YWEA 1HBOB 4IDKA 3NAEA 2W2OP 2ZM6F 2ZJQQ 2XWXA 2VD3A 3NF7A 3RBZA 3V9ZA 4ZN3A 1H7XA 1VQ7N 1EHWA 3CI5A 4YHHJ 4EWTA 2AT1B 2HNZA 2C3PA 2CPJA 2PE8A 1C4CA 2NS1B 4CYUA 3M8PA 3D9BA 5JLHA 1S57A 2HURA 3F5TA 2HKEA 2IDEA 2W01A 2HHHK 4DV5F 2NPIA 2MTLA 3D5MA 4FWRA 2B6AA 4Z94A 1SC6A 4G1PA 2NUBA 1NOZA 2HFUA 3PACA 2JZ5A 2UXBK 1HI1A 1B7YB 3M05A 2IHR1 3TVKA 3HK2A 2FJWA 2R7YA 5U47A 4LR7A 2HBLA 5BREA 3AVBA 2PEHA 4FF2A 2QKBA 2NRTA 3HP6A 2DRDA 4DQRA 4KHYA 5KGWA 3C6UB 3NHGA 1WORA 4DR7F 2XZTB 4ZKAA 3RYLA 3KXDA 1BUXA 3IM9A 2ZKTA 1W9HA 3GJQB 1NKBA 3BO3A 4MDBA 4LH5A 4HL9A 5HLFB 5DM6L 4RW4B 2QL5B 1AUDA 5GIOA 2X1AA 1AB8A 4DR6F 2OEJA 1RAJA 3OV7A 1H7WA 1RT3A 4X65K 3THYA 1X0PA 1RDUA 4BR0A 1NSPA 2DPIA 3U02A 3MD3A 4NXMF 3PO4A 4H4MA 4N47A 3L4IA 2BW7A 3NRBA 3QQCD 4DV2F 4ES3A 4OJRA 3DRSA 2OELA 1LWEB 2D1CA 3ZSRA 4NI2A 1U1PA 2AMCB 1FWPA 1WOOA 2KVIA 1RISA 3UO0A 1N32K 4PG5A 1YVFA 5F8HA 1W2BR 4BACA 2OCEA 5KFJA 4ID1A 1UVNA 5E3QA 3NH2A 4JI0K 3MDFA 1YZ7A 4ILMA 2CYYA 3UN2A 3J7AN 1SC3B 1G6BA 1DQ8A 3LL3A 3QETA 5DM7Q 4JK8A 2A10A 2LP4A 3PX4A 1UW4A 2VQEJ 4PY5A 4OO1J 1NKEA 5FD1A 4CLYA 5DQIA 2F4VF 2Z0GA 3JYTA 3M30A 2FDNA 2ZD1A 3ISNC 1WSEA 4DPYA 4DU4A 3RMBA 1RZMA 3H2VE 5D3GA 4ZPTR 2MQLA 4LD0A 3TR5A 4LJMA 2XGQA 3U1LA 1NGJA 3FMWA 3VVTA 4DV5K 3NOCA 5B7WA 2MLYA 3C16B 3D67A 1IN0A 2IDOA 2C28A 4CIOA 2XZDB 2Z30B 1L5UA 3LAMA 3WC0A 1XMOK 4O0JA 3CC2S 3KHLA 3SUNA 3OTDA 5ETNA 1JXBA 3ASMA 4F4KA 2MYFA 3LM2A 3OL6A 1NKCA 2FSKA 2NZ4A 4R79A 3BUZB 3SBGA 4RPFA 1YBAA 1IBKF 2ZGYA 4K5RA 5ETLA 3IAS9 5F2RA 1FJ7A 4FYDA 4LREA 3IRWP 4EI2A 4DXLA 4ELVA 1TL3B 1H0HB 3PSIA 2KG0A 3MEDB 4FM2A 3JTPA 5J2MB 3IO1A 4BVPA 3QT7A 5AQGA 4DJBA 4Q0BB 2DR8A 1V6HA 3B8HA 1HI0P 4LFBK 2E88A 4G3IA 4IRDA 2CQ0A 5HSPA 2Y3YA 2Z2MA 1MMLA 2G2ZA 3D0IE 2ASOA 4WPAA 3OVNA 4ZHRA 2P9UA 1RTIB 5CYQB 3CC7N 2AP6A 3OT9A 1S76D 1RBUA 5JS2A 2E5GA 5AZIA 3DRRB 4ILLA 4FSVA 3PJXA 1L3KA 1RTZA 1P8GA 4DL5A 4DV1J 2VPZB 2K1RB 4FJLA 4ED0A 3CCEN 2E5IA 1U24A 3MR5A 2FYXA 1N36F 2DGVA 1TUWA 4JS4A 5LJWA 4ALZA 2QWOA 4EBEA 2CNNB 2CPZA 4DR3K 2E20A 2DR7A 2Q66A 2AP1A 1Q86O 3P38A 2MQQA 2YJFA 1OSCA 1QS4A 2R8GA 4ZLJA 1H2VZ 5LT5A 3HZEA 1B99A 4Y2AA 2P9NB 1ZAXA 1I3OB 1EARA 2V50A 3DWLA 3HFZB 1HWIA 3VQTA 2MGZA 1RTHB 3K5MA 5KFPA 2OD4A 2RN2A 2W7AA 5AQPA 3TW0A 1CQNA 4UY85 3UR0A 4PXEA 4CHPA 2QGFB 4ECXA 5CXTA 2C2OB 3KVGA 3KUGA 1YTUA 4AUKA 1R31A 4IEIA 2PY5A 2JNJA 2YQ0A 4E8UA 2UUBK 3SI8A 5LSRA 1P27B 3GIIA 4GC6A 1DHMA 2NXCA 2YV0X 3W2WA 3CFPA 3LW5C 2IVFB 4KH0B 1F2HA 3THPA 3Q2TC 4UY8O 3GIKA 2VKZG 3C6TB 3N4PA 3ZZZA 1N52B 4V19S 3KLFB 1MWQA 4MYUA 5AQFA 3V9SA 3HI9A 4JI7K 1VQ5N 3EE9A 4C9DA 3HDSA 3I87A 1YI2N 2B0GA 2FVSA 2OTJS 4AF1A 1AZSA 1QTMA 1RGIA 3R3TA 3THXB 3CQYA 4DPUA 1ACMB 2YHAA 2UUBF 3QRRA 1X7VA 3H6EA 3TVYA 1IBLF 2Q0UA 4KGMA 2VONA 4DU8A 3R9PA 2ZF5O 1Q95G 2VGNA 4K4ZA 2YNGB 2WBNA 3JAMY 3O08A 4ZP6A 4XK8C 3TUZC 4JI1F 2G8FA 5HN0A 1WAJA 3PYGA 5C24B 2MY7A 3J7A1 4ELUA 4ED7A 4ERDA 3PUFA 2ACMA 4LFBF 2IRYA 1S7IA 1Q1KA 5EWGA 3Q8QB 5KFTA 3VR1A 1VBKA 3ENBA 4KHSA 5KFEA 3MCOA 1FXLA 2VF3A 3D2FB 2B6AB 1O13A 2R8JA 1T05B 1EWQA 3OPKA 4AXIA 2QMUB 4MH8A 1MWMA 2JRSA 3G2XA 2OHDA 3E9LA 4K7QA 2GVDA 1FT8A 1XR5A 2C2MB 1RT5A 1DZ5A 4QAGA 4CZFA 2JC0A 3MAHA 1MSWD 1S1VA 3P4UB 1B64A 5AXMA 3W60A 4IEEA 1G4CA 3AJDA 5DG8A 3C46A 2XNRA 3VEVA 4I64A 2SXLA 2QT7A 3IWLA 5JUMA 2XSFA 3ALYA 1REGX 5I3UA 3VMFB 1IKYA 3HSGA 2WVDA 4FYXB 4CI0B 4EO6A 1SJRA 5BRHA 3ZETA 1RHJB 2GVZA 3GYGA 4OJ1A 2GAGC 1WEXA 5LMUF 3QYYA 1XUPO 1DBDA 2A42A 3CG7A 2V63A 3MN6A 2QL7B 1R3NA 3GMGA 2P9PA 2JVRA 4DN0A 1JKHB 4OKEA 3UKRA 2BJ9A 4DZDA 2QXFA 2CXEA 4C6AA 5KFQA 3PXGa 3ENAA 2BA9A 3CGIA 3HD2A 1Q82O 1T3OA 3CPWR 1UA1A 1BU6O 3V2UC 1LOTB 1WOSA 1GLDG 1DAXA 5BXIA 3RSEA 1KFSA 1U02A 1SXLA 4UOFA 3PLAA 2YNIB 3H40A 3UI3A 3W63A 2YX7A 3DHXA 4M3WA 3T5HA 2XG8A 3W0LA 1X3NA 2V4RA 4FXWA 3LP2B 3AARA 2RU9A 4HDGA 2M4MA 2EW9A 4CHZA 2ZH7A 2OMLA 5KG2A 1EZZB 2HK2A 4WFAL 3QFHA 4KY3A 5AFUH 2E2QA 4ISEA 1RKJA 2F7TA 3DXMB 4L73A 4CLPA 4ES2A 4JRQA 4OLBA 2W9BB 2O8BB 5K8MA 4LF9F 3E2EA 3OYKA 3HHLD 1IJJA 5IWAF 2LECA 1X3MA 4A8MP 4DX8H 3L3CA 2E9ZA 5CZ1A 3ET6B 2R7WA 2JHEA 3VGUA 5CQGA 4BE2A 4F3MA 2Q31A 2UUWA 4KREA 2VG6B 5K8NA 4DTMA 4KRWA 3R5AA 3BH7B 2CNKB 2K06A 1FFGB 4FWNA 1NK4A 5CCMA 1G1XA 3EWGA 1CQMA 1J9AA 1FJCA 3VESA 4C8KA 3OYCA 2VWJA 1WOPA 2UV8A 3JXUA 4AQYJ 4ILHA 2DFFA 1QUVA 3D6HB 3OYFA 5K20B 1P90A 2ASYA 2CJYB 3MAAA 3K9JA 1K44A 3O1WA 3TR8A 2RE2A 4WWSA 3S9HA 5E2QA 1RAHB 2W9CB 2BDPA 2IDLA 2MZ1A 1HPMA 4NA1A 5FLXU 3OFHA 1YX2A 1J54A 3JTOA 4K4TA 4X4QA 1XR7A 1F9FA 3MF5A 2Q1NA 5KG5A 3OYNA 3RG6A 1SUQB 2OFGX 2K2PA 3NBPB 2V4JA 2L48A 1V3ZA 4KTWA 2LQ5A 1OH7A 1IR1A 2BTFA 3A0IX 3W62A 2B4OA 3CJ8A 3M2VB 3CM6A 4CJ7A 2P9IB 1N34F 3DXBA 1RT4A 1FO1A 4KH1B 2KXFA 4J8FA 2BX6A 2N7CA 3FBCA 3WHIA 2B43A 2HFVA 2IJRA 2GGPA 2R7TA 3D66A 4X66J 2CJBA 2E2OA 3SSSA 2O8CA 3KD5E 3AODA 2Z1HA 2YXLA 2ZITA 5F8LA 4P7TA 5KT3A 3L3VA 5C12A 5FPDA 1CZBA 5HROA 2UU9J 3V6KA 1I94J 1TU0B 2R8IA 1TELA 4X64J 4YDUC 5L1IA 1LWFB 1E3MA 4PG7A 3E9OA 2P9KA 1HWLA 2XY5A 2WOMB 4Z4GA 3A8EA 2V5HG 4NLOA 4B08A 3MR3A 4HTIA 1KSPA 1HPZA 3IR5B 3VPZA 2RQ4A 4C48A 1ASUA 1YGYA 4DX6A 4BDZA 1MMDA 3FBBA 1YRXA 3MAQA 4GO7X 1X0FA 2W40A 9ATCB 2YKAA 4FK2A 3TX8A 5D4LA 4Y1CA 1X1PA 2J0SD 4MIWA 5KFUA 4CD3A 5AT1B 1GLBG 2ZH8A 4PUOB 4DHVA 4NMXA 1QAJA 2O1PA 2Z8QA 3WX4A 2JX2A 2OPQA 1T9VA 1JCFA 3Q23A 4F0MA 4HT5A 3NF9A 1C1CB 4ZPVR 2QXLA 3FC9A 4OGCA 1SQFA 3JQMA 4A8OA 4CBUA 4OIXA 1XMQF 1TUYA 1WEZA 3BP8A 1UZDA 2RB7A 5C42A 2KI2A 3L4BC 3HD1A 5SZTA 2XYGB 4H0YB 2EBGA 3BR8A 2IIHA 3ITHB 1WOQA 2HPUA 1HNWF 2C42A 2QX0A 1HKCA 4IQMA 5E5NA 2Q97A 3OSPA 2H3EB 3IDHA 3M2RB 2XMVA 3G6XA 3LP1A 3G6VA 1OY9A 2DHSA 3IFRA 1NK9A 3EZWA 4ZJOA 3VGLA 4TNOA 1EETA 1BQNA 2OIHA 2V34A 3BQ1A 3DOLB 4DR5F 2LMIA 1YJUA 4I69A 3ISND 1HWKA 4GV6A 4QZVB 1U2FA 2VWBA 3VF2A 2VQFK 5LSOA 4DR6J 3MMBA 2ZWOA 2EK6A 3P8BB 3KK1A 2GUIA 2RHKA 2VG7A 3W61A 3GSIA 1HBMB 4RTFD 3BJYA 6AT1B 3CYMA 2HNYA 2HGNA 2RHQB 2ERRA 3GG1A 3KK7A 4WCEQ 2D0AA 2G2YA 3HZ6A 3IWXA 3C0BA 3AA9A 2AKWB 2XY8A 4F02A 4FVMA 4LSNA 3KFWX 1RHQB 1DTTB 3GP9A 1EXQA 3PR4A 3OSNA 3W5ZA 2I7NA 1BIZA 4M5DB 4QBUA 1M0SA 3CQ8A 1LAVA 2HIYA 2RQMA 1YJ9S 3N28A 4IZ9A 2XSJB 3BQ0A 3GG4A 4TXSA 3NG8A 3BR9A 3DDKA 4WK1A 1YF5L 5F0XA 1R8PA 2OAUA 5KFLA 3CCSN 4ZP9A 2FJBB 1U1NA 1FFWB 2VBWA 3G6EN 4JI2F 4NLGA 4RNHA 1CULB 4DR1J 3CD5A 2DBBA 2AJ4A 4FW1A 3DJCA 4Y65A 1Z05A 4CYUB 3T9ZA 2LLZA 4GNIA 3N6NA 3ZYYX 2CJ9A 1TMMA 1TZ0A 1VSMA 5K9FA 1ZZNA 3VGVA 4DWIA 1VBZA 4MDAA 2HBZB 3HP9A 4O5FA 2H5IB 3KWMA 5J1PA 3AJ2A 4WQ5A 1T8EA 1NK6A 4NLQA 1LWCB 5T41A 3MHYA 3PCOB 4GW6A 4W5OA 4A8KA 3M6UA 1YHQN 5DO2A 3SEOA 2DR6A 1FWLA 4K0KF 2BZ2A 5GAEP 3F56A 1T9TA 5C10A 3MM9A 1ZZFA 3OXGA 1VQMS 3VQEA 1TV6A 4CVNE 2DJWA 3OR1A 2I1RA 2K7JA 4B02A 2QEXS 3QWPA 1UVIA 4CGGA 1VHFA 2GNKA 4ID5B 1FDBA 2GUPA 2M9KA 5A0YA 3FVYA 1WEYA 1HQUB 1IR2A 1YIJS 3GE9A 1S9GB 1N5YA 4ZJQA 5AQUA 3CB4A 2OI2A 3AA8A 3QJPA 4YR0A 3SLCA 5T7BA 1WN7A 4RWTA 2OPSA 4Y00A 1OY6A 2KN4A 3CC4S 5KFRA 3LP1B 5GIPA 4DL3A 2G8KA 3QO9B 3VEZA 5LJ5Y 4OLPA 3EXYA 4CJQA 1WHYA 2E1RA 2NXEA 4WFBL 2DCUB 1ZBSA 2DGQA 2FZKB 3SUOA 1QE1B 5A8RA 2U2FA 5HOOA 3LO3A 3V6DA 1ESVA 2KLAA 3M4XA 3K5NA 4WF9Q 5HJXA 3CXCR 2ASPA 2OSRA 5F8JA 3TA2A 2BQUA 1ZBIA 4B9TA 3DLJA 1TL7A 1T6DA 2N4CA 1WLJA 1DQ9A 4WYBA 3ULEB 3MCSA 3CDUA 3E51A 2R2SA 3MWBA 1GTEA 3K5LA 3SK3A 1KQSM 2M7SA 3NMAA 3LGNA 4C11A 1X4AA 4JHDB 3MAAB 3N0VA 2Y1IA 4KHNA 5JS1A 3OL9A 2BXJA 4J9KA 2BRKA 1S0MA 3GBTA 1OY8A 4RL1A 1RTHA 3JSRA 2O66A 3EN9A 3MN5A 4F3QA 2MKJA 3U6FA 1F5BA 4OZ1A 4FWSA 4CNYA 1K9MO 3BF1A 4X2BA 1I51B 3ISZA 2XCAA 3I82A 3BY5A 2RKIA 2WVFA 3CMES 1S1WA 1YITN 3WIVA 2KH9A 5F0UA 5D4PA 3J7AP 1BISA 2RQCA 1X5PA 1VQLN 4DUYF 2KXHA 1GAOA 4ZVSB 1HL6A 4X66K 4AT1B 1NJIT 3M32A 1R8AA 2ZC3A 4L6V3 4ZA1A 2ACYA 1IKVB 3MCAB 3SV3A 1CJTA 1NNDA 1RT4B 1TKTA 4USVA 2ROPA 4CF2A 4EP4A 3WNGA 1YRUA 1SKRA 1NDPA 2V9WA 4QPXA 4J90A 5IC6B 5KGXA 3ZSOA 2W2PP 3R8EA 3OR1B 4UUXA 1SJFA 4OQJA 2HWHA 3ZT2A 4LSLA 2XLIA 5B0CA 2B4PA 4A4JA 5HL7L 3L9ZA 2LU1A 2EK1A 4HI2A 2FF6A 3JAMO 1S9GA 5KFIA 1FEEA 3TAQA 3E01B 4IOXA 2P9IA 1B0TA 2W2QP 4ED5A 2HZAA 3UKRB 4AHRA 3QATA 3O9SA 2WVEA 5F1XA 5KG4A 1NK8A 1FXRA 4XH5A 5GMEA 4ANEA 5DG7A 4GKKJ 2YWKA 6FDRA 3BZCA 2M2BA 4DU7A 1GLEG 4AILC 2E5LF 4OI4A 5HO4A 4V19J 3D6RA 3NF6A 2HSTA 2ZHAA 3QIPA 4O3RA 4MFBB 3S41A 2D3ZA 4J9NA 2CQ1A 4LF8J 2A6MA 1S6OA 3HSCA 2GWKA 4RW6B 1RBVA 2JDJA 4ISFA 1NU4A 1C0TB 4A46A 1EIYB 4WYWA 2HQDA 2F4FA 1PYOB 4NLYA 4JKDA 3R2DJ 1U1RA 1SIZA 5D78A 1JLGA 1Q7YT 4M5DA 2GZOA 5BJRA 1C4AA 4JI3J 2FC9A 5GAHP 4W98A 3DRSB 4K43A 3W66A