1JLFA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 133
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlfA05
4HUFA 3QGHA 4RNMA 4O55A 4CJLA 3PVXA 4HUGA 2HNDB 3RB0A 3WNFA 3NL0A 1KCFA 4R5PA 3LAKA 4RW6A 5J1EB 3SUOA 5KFEA 2NUBA 1T8EA 1R0AA 4B9SA 4MK7A 1NK0A 4O3RA 1HYVA 4EZ9A 3QYYA 3WNEA 5FRNA 4O3QA 1UOCA 5KT5A 4O3SA 4CFBA 3AO5A 3CDEA 1JLGA 1NKEA 3LALA 3M8SA 2FBTA 4ECWA 4DEZA 4YFUA 4FLWA 3RMDA 4LY7A 4IBNA 1U49A 3V81B 4TYBA 3TAGA 3M8QA 1X1PA 4QW8A 5DG7A 3TR8A 4K4ZA 2KFNA 4CEAA 3MEGB 5KFSA 3S3OA 1KFDA 2XI3A 1HPZA 1EX4A 2R2SA 2HVIA 3BSOA 1LW2A 3NF8A 5DMRA 4DSLA 2IAJA 3O3FA 1DTQB 3BSCA 3OYLA 5L9XA 1JLEA 4K8XA 2D0CA 3QLHB 2ETJA 2JC0A 4WFXA 3DMJA 4O3NA 4C8LA 3K58A 4ED6A 4J9QA 4RG8A 1O1WA 4KI6A 4NYNA 1S1VA 4O4GB 4AHCA 3RMBA 3OYBA 3DLKA 4FJMA 4CJPA 2C2DA 3VN5A 4EYHB 2YNIA 4PWDA 4NLRA 4GVMA 4IDKA 3Q8QB 1QS4A 3MR3A 4NLVA 3Q8RB 3FSIA 1D5AA 2W8LA 1S9FA 4TXSA 5EUHA 4H54A 4TLRA 3KKRA 1HMVB 3C6TB 3RMAA 2BQRA 1D8YA 3TAPA 1NHVA 2YNGB 3OYKA 1FKPB 4K8ZA 4NLYA 1S1UB 4N47A 3AO2A 3I0SA 1HJRA 3KHLA 1CXUA 4DQQA 1RBUA 4F4ZA 5JS2A 1S1XB 3PZPA 1XC9A 4F2SA 4DMNA 1J53A 3IS9B 4CFCA 2R2TA 3TAMA 5J2NA 4DF8A 4OVLA 4Q44A 1HQUB 4WZMA 5KFNA 4E7IA 2J6UA 3QIPA 4Q5VA 4Z0UA 2IBKA 3H08A 2AGQA 2HHUA 4HUEA 2WB4A 5CZ2A 2BDPA 4Z4HA 1BISA 4HCCA 2JGUA 3PJWA 3PO4A 2VG5B 2OPQA 3I0RB 2ASDA 1C0UA 4K4YA 1UAXA 4LQ9A 4JV0A 3H4BA 2AWZA 3VQ5A 1RT5B 2P5GA 4F4WA 4B9MA 4RW8B 1HQEA 1BIZA 2RDJA 3LWMA 3SQ0A 2QE5A 2KFZA 3LP1B 2RF2A 4OJRA 5L1KA 2YNFA 1S9GB 4C8NA 4DG1A 4DSKA 3NFAA 1DTTB 4FJXA 2I5JA 1RBTA 4BE2A 4BDZA 2A1RA 3TABA 3SQ2A 3DOLB 1RT4B 4TN2A 5KFLA 4DFMA 3PW7A 3HVTA 5DQIA 2YNHA 3RAQA 3MF5A 4ED8A 1IKXA 1WSFA 1ZBLA 1RT3B 3QO9A 4WFYA 1TL1B 1SKSA 3AVJA 4ZPCA 4OLAA 1BQNA 3PW4A 5C25B 4NRUA 3NBPA 1VSDA 4DTSA 3H5SA 1U47A 2ZE2A 3KLFA 5EDWA 5F8IA 2XCPA 1GOAA 4RNFA 4RW7A 4CECA 5CZ1A 1X9MA 1RTHA 1L3TA 3KK2A 4H4MA 2UVRA 1BQMA 5KFPA 1I39A 2OH2A 1BGXT 4Y34A 1LW0A 2HHSA 3DM2A 2FJXA 4RUAA 3ITHA 1WSIA 4QOZB 2FVPA 3SQ1A 4IR9A 5I3UB 2HHWA 3N6NA 4AHUA 3JSMA 4F3OA 3CM5A 3VQPA 1D0EA 1NNDA 3VQ6A 2JEIA 4FJNA 2Z1JA 4Z4EA 4WYWA 4CJSA 3KTQA 3RRHA 4RW6B 3Q8SB 4LD0A 4CEEA 1TK8A 1R0AB 4Z4GA 2B6AA 1IKVA 4FLVA 1TVRA 1XR5A 5KRTA 1C0TB 1BHLA 2F96A 3NF6A 2I1RA 1VSHA 4FZYA 4Y3CA 3PR5B 3RTVA 2IM1A 4IG0A 1JLAA 4FLYA 1SKWA 2PYLA 4Q0BA 1C1AA 1JXEA 3H2LA 4IRDA 5HP1A 3FQLA 4DFKA 4DL4A 1IH7A 3NMAA 2W9BB 1B9DA 3KK3B 4IQXA 4H4OA 1VSEA 4BDYA 1SL0A 4HTUA 1HNIA 3TANA 2HWIA 4ZHRA 3KJVA 1LW2B 1S0NA 3PX0A 2WONB 1Z26A 3HK2A 1S0OA 5KFXA 1VK0A 3C95A 1JLCA 2OPSB 4PQUA 3OYEA 1T05B 4F4KA 3KLIA 2D3UA 1UA0A 4Z4FA 1IKWB 1S1VB 4K4UA 3K2PA 2WCXA 4YMEA 4N5SA 3ISND 1XR6A 2HHVA 3DI6B 5KT3A 4DQIA 5KFBA 3HL8A 2XRIA 3HP6A 2WOMA 3ISNC 4KSEB 4KE5A 4DTRA 1Q8IA 4CEZA 3AVGA 3QGIA 4RZRA 3FFIB 1CZBA 4J9OA 3MXMA 4CJ5A 3DLEB 4ZVHA 3KLGA 1N6QA 4CJTA 3KD1E 1KHWA 1F21A 2ATQA 4WYLA 3AVBA 4MIBA 4FBUA 3T5JA 4UQGA 4J9LA 5DG9A 1DLOA 4CJFA 3AV9A 3CWJA 2FLLA 1JLQA 1K1QA 1KLMA 3HPOA 1S6PA 5DQHA 1N4LA 3RB6A 1JL2A 5KFYA 3TAMB 5J2NB 1WNSA 4MIAA 3SNNA 2UUWA 1S49A 4CEQA 3AVHA 4NLUA 3K57A 5KFQA 5KFKA 2F8EX 1RDRA 2ZD1A 3VQSA 4CJQA 3UIQA 4L8RB 2GV9A 2OPQB 2VA3A 4OKKA 3SPYA 3BSNA 2UVWA 3RRGA 4NRTA 4NCGA 4CGGA 2XHBA 3EYZA 1A5XA 3GIKA 1Q9XA 3AA3A 4E7JA 4XPCA 5JS1A 4J9SA 2V0NA 2X6SA 5KG7A 4KB0A 3UDLA 2RF2B 4B8CA 3M8PB 3ZSWA 4NYFA 1KTQA 2IA6A 1S4FA 4F4YA 3D45A 4FJ5A 1NK8A 4NYZA 5KFAA 2IC3B 3O4NA 1QE1A 4ZP7A 4B08A 3U3YA 2IGIA 3QEWA 3PV8A 3HVTB 1Z25A 2YNHB 1FK9B 4R8UA 4WXWA 3BREA 4ECTA 3CDWA 2IDOA 3NGDA 4CGIA 4LSNA 2AX1A 5KRSA 2R2UA 1U09A 2D0BA 4IKAA 1BQNB 1S1WB 3CYMA 3Q8PB 3NBPB 1RT1A 2ZE2B 4WE1B 4RW7B 3GV7B 3BQ1A 4W5QA 1RTHB 3KLHB 3KK2B 3KHHA 1BQMB 4B3OB 4B9NA 4CEBA 3EY1A 1CSJA 4CK2A 4M94A 3KLEA 3DM2B 3ITHB 3VQDA 2R8HA 2AU0A 1VSKA 4F3TA 2OPRB 2P5OA 2IS3A 1U48A 2OPPA 3S3NA 4MKAA 4EEYA 4ECZA 4CESA 4KFBB 3GILA 3PW5A 4KTWA 2ZQBA 5K14A 3VA3A 5KTQA 4CJVA 3AVKA 4E1MA 3ZSVA 3IAYA 2V9WA 4K4SA 4TY9A 1EP4A 1TVRB 5KG4A 1S6QB 3T5HA 4RUCA 2BQUA 4CF8A 3IGNA 3S3MA 3QETA 4FJIA 5DGBA 4OGCA 2G8FA 2VWJA 3DRRB 1VSJA 4IG0B 3SCXA 3TAEA 2BANA 4RW9B 5F8NA 4BE0A 4DLEA 4Q0BB 1J5OB 4ECYA 4ED7A 1NK4A 1RT7A 1B9FA 3SI8A 1QAJA 2RKIB 3FRZA 1RCHA 1J9AA 1SL2A 4CF9A 3V9XA 1VRUA 3OHBA 4CHPA 3B6OA 5KG6A 5I42A 3LP2B 4ED1A 2IM3A 4OKEA 2JC1A 1TKXA 2E9ZA 4W5OA 3KJVB 1N48A 4DU1A 3RR7A 2VG6A 4EP4A 4E0DA 4J2AA 1S1TA 3QGGA 5KT7A 3BGRB 1JLCB 4PQUB 1TL3A 3HVWA 5T14A 2XGPA 2R8IA 3OYCA 1U04A 2JLEA 2FVSA 5CY4A 4NLPA 1C1CA 4CJ3A 3DRSA 3S9HA 4IFYB 3CG7A 5HBMA 3MECA 2XWYA 2HNYB 2QXFA 3H5UA 4CEFA 4H8KA 1ZBIA 2IJNA 4LH5A 2W9CA 2WOMB 1GOBA 2OA8A 1D9DA 3I5BA 5KFFA 4KAZA 2VWKA 1N5YA 3DLRA 4OLBA 1ZBUA 3SI6A 3CFOA 3PX6A 4I7FA 3FQKA 1KVBA 3IG1A 2HNZA 2A1SA 4KO0A 2D0AA 1Z4UA 3DLGA 5KT2A 1QUVA 1SUQA 2J6TA 5F8MA 1DLOB 1FKOA 3UPFA 3VQ9A 5HROB 4FJ8A 5HRRA 5C42A 2C2RA 4F2RA 2DFHA 4FZZA 2VG7A 3PW2A 4O3OA 4G3IA 1S6PB 5FRMA 4NLTA 2HMIA 1WSJA 3IRXB 4ID5B 3F9KA 4GMJB 4K4WA 2E9TA 3CJ5A 4FJ9A 5D3GB 4AHRA 2GIQA 4FS1A 5KFRA 3HSTB 3OYHA 1TV6B 4FJJA 5C24B 2E6LA 4M3ZA 4KHWA 5KFGA 2DY4A 1TKZB 3C6UB 3HVAA 3CIZA 1ZTTA 2FVRA 1RTIA 3QEPA 2AQ4A 4NLSA 3PHEA 4ZP8A 3PW0A 2IM0A 1JX4A 4NCGB 1JKHB 1NJZA 4M41A 4DTNA 4KB7A 1RBVA 1X9WA 4O44B 2QK9A 4B8AB 1CZ9A 4I9LA 1RTDA 4RW4A 1NK9A 2JEFA 4E89A 1CXQA 3AO4A 4E7HA 3K59A 1LWFB 1HYSA 3KHGA 1IG9A 2KZMA 4J9MA 4Z4IA 2G8VA 3TQ1A 1K1SA 3G6YA 4I2QA 3PX4A 4KKOA 1QE1B 4OPKA 3HYFA 2XCAA 4QWDA 4TQRA 2KQ2A 5KFJA 4FW1A 1KRPA 3RAXA 1C1BA 1S9EA 2YKNA 3ZCMA 4KHQA 2D7SA 1NK5A 4FYDA 5EWEA 1EXQA 1T03B 2IJFA 4F8RA 2DPJA 3ZT1A 1SV5A 3CM6A 1RT1B 2DFEA 3KIOA 3I8DA 3RB4A 5CYQA 1RDBA 2C2EA 2XY8A 5KFOA 3L2VA 4ECUA 3P83D 5FDLA 1A5VA 2G8WA 4KTQA 2RDIA 1Y97A 4QCLA 5HLFB 4KV8A 2G8UA 4IRCA 2YKMA 4JLHA 3MR6A 4J2BA 4GC7A 1JLBA 3OYAA 3QINA 5KFVA 5EWGA 4QAGA 2WK4A 4E19A 1XWLA 1L3VA 2AGOA 3IN5A 4CJ4A 3D0PA 2OPPB 4O3PA 3OYGA 3KMQA 2O5DA 1SL1A 3GIIA 3QNOA 3DYAB 2CKWA 1WNEA 3LP0B 4DWIA 3AA4A 2FJVA 4F4XA 1HYZA 5T7BA 1VSLA 2XI2A 1C2PA 1LWCA 3TAFA 4ZP6A 4DQRA 3K5OA 4BDPA 5F8HA 1ZBHA 3NGIA 1D9FA 3K5LA 1JIHA 1EP4B 4EO6A 4J9PA 5E41A 4B9TA 3JYTB 3HM9A 3CFRA 3NDKA 4TY8B 4J9KA 4M3XA 2HB5A 2DFFA 4PA1A 2ASLA 4RNNA 1MMLA 5DGAA 4CIGA 2BANB 1IKYA 4URGA 2C28A 3NF7A 3RR8A 4CHNA 4R5PB 5HRPA 1VSMA 4YP3A 3THVA 3OVNA 2KZZA 3T5LA 1KVCA 1WSGA 3PJXA 4CGDA 3ZSYA 4IH5A 2GUIA 3B6PA 2Q3SA 1TKXB 4ID1A 4KRFA 2P51A 1VRTA 4FS2A 3OY9A 1TKTA 1JLGB 3U6FA 2YHAA 4YNQA 3SYZA 3H59A 1SH3A 4G1QA 2C22A 2ALZA 1HNVA 3AA2A 3TWHA 1L5UA 4FJLA 1EKEA 3OL8A 3NAHA 1RT6A 1C1CB 3M8QB 1RYSA 3L2UA 3DRSB 2B5JA 1RA6A 3CFPA 4KHUA 1REVA 3MECB 4MH8A 5JUMA 3K5NA 2FBVA 2HAIA 2W9CB 5KFDA 1HPZB 4CGHA 4YR3A 3NH1A 3EZ5A 1U4BA 4Y1DA 4NLDA 3VQAA 4YQWA 4MK9A 2IAJB 3V6JA 4Y1CA 3DDKA 4IH7A 4DQSA 1JLEB 2HNZB 3IG1B 4DU4A 3KMSA 4BE1A 3DMJB 4OL8A 3I5CA 3NGZA 3AVNA 3PO5A 4CJRA 2FLNA 4QPXA 1XHXA 5C42B 1NOYA 3DLHA 2EHGA 4K4TA 3DLKB 4EBCA 4R0EA 2VG7B 2YNIB 3QZ7A 4PWDB 4YR0A 4IDKB 1GX6A 4IR1A 1K6YA 3SFUA 4NLWA 1RA7A 2HW3A 1GOCA 4AHSA 3T1AA 4ECQA 3V9SA 4QWCA 4GW6A 4DSFA 3I0SB 3P1GA 1C0MA 2PYJA 1WAFA 2IM2A 4Y2AA 4FK0A 4X2BA 1RTIB 1TQLA 1W0HA 4DQPA 4O0IA 4CK1A 4EYIB 3NH2A 4WFZA 2V4QA 4W5RA 1W25A 4FM2A 1QQCA 3V9ZA 2B4JA 2P1JA 3HPGA 4Z4CA 3G0ZA 3QIPB 4N76A 2DPIA 1WLJA 2BRKA 3QIOA 2O4GA 4FBTA 1L3UA 1RT2A 2J6SA 4CGFA 3QEXA 5J2MA 3C6TA 1KSPA 3H40A 1HARA 4KKOB 4CHZA 2YNGA 1C0UB 1S1UA 4EO8A 3ZSZA 4NLGA 2YKNB 1S10A 4FM1A 1HQEB 4M3RA 3SJJA 5KFHA 5DG8A 4MFBA 2BGGA 1WSEA 2YNFB 5CYQB 3IS9A 1C6VA 1QSLA 4DG1B 3SV3A 3L3UA 2WRMA 1LV5A 2I5JB 1QSYA 5FDLB 1XHZA 3KD5E 2HVHA 1HQUA 4ECRA 3VQEA 3OYFA 4IG3A 3M8RA 5L1IA 3LZJA 1T3NA 2R2RA 4KHYA 4KHRA 3TARA 5L1JA 1IKXB 4TSXA 3QO9B 3ZSQA 3NE6A 1A5WA 1LWEA 3BJYA 5DLGA 3KOAA 3VQQA 3DOKA 3VQBA 2VG5A 4FVMA 3KLFB 3KNAA 1SKRA 2KW4A 1RTJA 4DL5A 3MFHA 3KKSA 1RT5A 4TYAA 4NLQA 3VQCA 3G6VA 4H4MB 3H5XA 3ZSOA 1TKDA 4ZMMA 3BQ0A 1LWCB 3L8BA 3CJ2A 2OZMA 3MAQA 3LP1A 3WNGA 4EZ6A 4ZPAA 1ASWA 4CGJA 2E6MA 2Y1JA 5JXSA 5EWFA 1LW0B 1S9GA 1TGOA 4B9LA 1MU2A 1DTTA 3QESA 3SUQA 4HKQA 3BDPA 4MK8A 1JLFA 3RWUA 4CJWA 3JSMB 1S97A 1RT4A 1EETA 3P5JA 1RT3A 1IKYB 4CHYA 4DL7A 3MEEA 2GC8A 3KK1A 1TL1A 3MFIA 5HRSA 1I3AA 3C94A 4W5NA 4DF4A 3MR2A 3M9MB 4KHSA 3IGVA 3RBDA 2UUTA 5EU7A 2B6AB 4FM0A 1BCMA 4KHNA 1IKVB 4BACA 4KREA 4JRPA 4FZXC 3MEDA 3OL7A 1D1UA 4JUZA 3U3GA 3VQ7A 1VRTB 4ECSA 4ZPBA 5SZTA 4ZTJA 1JLAB 3AVFA 4M45A 4TQSA 4G1QB 1RDCA 4IFVA 3SV4A 5HP1B 3ZT2A 3ULDA 1HNVB 2GBZA 5KI6A 2R8GA 5J2QA 4AH9A 5I3UA 2B5JB 4PUOA 3V6HA 3UQSA 4H4OB 1REVB 3OYDA 1HNIB 5HRNA 4FK2A 1L3SA 5KG5A 4ZHRB 3ZT0A 3NF9A 4O0JA 3LWLA 4E7LA 2XC9A 4B9VA 3V4IA 3GIMA 5F8GA 2HHXA 1X9SA 3T3FA 3KLIB 2XY7A 4JV1A 4O5BA 1C0TA 4GC6A 3QERA 4CK3A 1J54A 4DTPA 4YR2A 3PY8A 3OL6A 4EBDA 3AVAA 4I2PA 3ZSRA 3KLGB 2BE2A 2W9BA 1N6QB 3KK3A 3NCIA 4FLUA 4J2DA 3O3GA 1KVAA 3PUFA 3V9WA 4DU3A 3GV5B 3OHAA 3QZ8A 1NJYA 5FROA 4J2EA 2YV0X 1JLQB 3GQCA 4M95A 1KLMB 3SQ4A 2F8SA 2X74A 2WONA 4OPJA 1NOZA 3SPZA 4JS5A 4FJ7A 5KFZA 4J9NA 2OPSA 5DLFA 1T05A 1WN7A 1B92A 3ZSXA 2XO7A 3PR4A 4CJKA 4KPYA 3HHKA 2FVQA 1IKWA 4DTMA 2JEGA 3MTKA 2BQ3A 1RDAA 3MR5A 4KHMA 4FLTA 4QWBA 1BIUA 4CEDA 3DI6A 2G8IA 3H5YA 5J2PA 3NH0A 4CHOA 3DLBA 2B43A 5KGXA 5KG2A 2ZD1B 1RT2B 4DSEA 3FFIA 3HKWA 1U45A 3ICLA 3DLEA 5J2MB 1UWBA 2ASJA 4O4RA 4KAIA 3QEVA 2RPIA 3O3HA 3SFGA 3LDSA 1WSHA 1FXXA 2W7PA 4FLZA 2UVVA 1NHUA 5DQGA 4FLXA 5KT6A 1NKBA 4ELUA 4JRQA 2D41A 3HO1A 1KLNA 4MFBB 3EPIA 3LAMA 4EP5A 4CERA 3H4DA 2KTQA 1JXLA 1BL3A 4QWAA 4OKJA 5KFIA 4N41A 4KB1A 2WTFA 4ICLA 4IG3B 3EPGA 3LZIA 1KHVA 4PY5A 4ZTFA 2BRLA 4R8UB 2W9AA 2Z1GA 4LSNB 1LWEB 3QEIA 5KFMA 2FBXA 1S0MA 3D5MA 3V9UA 3DOKB 1YTAA 3ASMA 4NCBA 1VSIA 1RTJB 4ZVEA 1YVUA 4LSLA 2G8KA 2EX3A 4RNOA 2FC0A 4DFPA 3OSPA 5KFCA 1XI1A 4CCHA 4AHVA 3HVRA 3SUNA 2ILYA 2E9RX 4WXOA 3M8PA 1BI4A 3KLEB 3E01A 4ZPDA 1MU2B 4CIFA 2XGQA 4ZP9A 1JLFB 3G6XA 3L3VA 1ZBFA 1ZTWA 4HYKA 2IC3A 3AA5X 4DFJA 4ELTA 1YTUA 3OS0A 4DS4A 4M3YA 1FK9A 1EETB 5KFWA 5K14B 3MEEB 3KK1B 4N56A 4CJUA 1S1WA 4Q45A 4KI4A 4WE1A 1TK0A 3HT3A 3G10A 2GIRA 2JEJA 4FJHA 2E4LA 5DK5A 3MEDB 4EBEA 3KLHA 3BQ2A 2O4IA 2DTUA 4XPEA 4CHQA 3OS2A 4FJGA 4B3OA 1S48A 4Q43A 1S5JA 4U7CA 3VQ4A 4IFVB 4K50A 1RT7B 4FXDA 2FVCA 3ZT4A 2W42A 2R8JA 5J2QB 5CYMA 1RBSA 2OPRA 4C8OA 2ATLA 4PUOB 3L2QA 5KG0A 4DSJA 2ILZA 1VRUB 1N56A 2OZSA 1SH2A 1IM4A 4Y2CA 2IMWP 3DRPA 3G86A 5I42B 4KFBA 3A2FA 2VA2A 2EC0A 4IOBA 4E1NA 1T94A 2X78A 3OSNA 2VG6B 5L1LA 3VA0A 1LAVA 1S1TB 1TL3B 3KHRA 3V1RA 3RBEA 4K4XA 3V4IB 3AVIA 3V6DA 4C8KA 3OS1A 4FW2A 4NCAA 3AVLA 1S6QA 4E3SA 4IH6A 4E7KA 4HHTA 2W7OA 4J9RA 1NKCA 4DSIA 2QKBA 1W9HA 3AO3A 1OS5A 1RBRA 4DTXA 5HBMB 4FCYA 4Q8FA 4K4VA 4JS4A 2UVUA 3NHGA 4RU9A 3DRRA 4LH4A 4RW9A 4FJKA 4IRKA 4CJEA 2HNDA 1QTMA 1J5OA 1I6JA 1N5YB 5J1EA 2RN2A 4URSA 2RKIA 4I2PB 4I7FB 2BE2B 4ZVFA 4KO0B 3DLGB 1SUQB 1FKOB 4M3UA 2F8TA 3LP2A 3TI0A 3RMCA 1QAIA 4CIEA 3V1OA 3L2WA 3ALYA 3BGRA 4AHTA 3AVMA 4CE9A 2HMIB 2XY5A 2XY6A 1SH0A 3QNNA 3V81A 1WAJA 3L2RA 1JXBA 1NK6A 2FLPA 3OJSA 2AX0A 4IFYA 2FBYA 3OL9A 1KFSA 3MEGA 2HNYA 5J2PB 3N6LA 3V6KA 5KT4A 2HHTA 4CF2A 4DL3A 2IOCA 3SZ2A 5KG3A 5KFUA 4CF0A 1DTQA 1UWBB 3OJUA 1RILA 3QLHA 3V1QA 2HHQA 4DL6A 4FK4A 1TP7A 1ZYQA 1IO2A 3NAEA 4DS5A 3OYNA 5HROA 3H98A 3WNHA 3O4QA 4O4GA 2R8KA 3VQ8A 4ED3A 4DL2A 4JV2A 4BWMA 1RTDB 4RW4B 3GYNA 1YT3A 3K5MA 4HVJA 5F8LA 3CVKA 3SUPA 1NJWA 3GV8B 4ED2A 3LPTA 1HYSB 3UR0A 4M3WA 5KG1A 3IRXA 2X6NA 1HMVA 4ID5A 1ASVA 4KTZA 4I2QB 4LQ3A 4RNHA 4ICLB 2QKKA 4ELVA 5D3GA 1FKPA 4BWJA 1TV6A 3TAQA 2WHOA 3E51A 3CQ8A 5C24A 4URQU 4MKBA 1C1BB 1S9EB 5KGWA 5F9LA 1QSSA 4WZQA 4M3TA 3LPUA 4MQ3A 3EZUA 3MXIA 1TKZA 3C6UA 1S1XA 3HPHA 3FDSA 2Z1IA 4I9QA 2PY5A 1SV5B 4Q8EA 3T19A 2HWHA 3HJFA 5F8JA 2YHBA 1JKHA 1TK5A 4LSLB 3F73A 2BR0A 4C8MA 1G15A 4O44A 1JL1A 1Q9YA 4IKFA 3TVKA 3I5AA 2FJWA 3QIDA 3OLBA 2D5RA 1TAUA 3CJ0A 4KV8B 4ED0A 2YKMB 1JLBB 1BI4B 2V4RA 1LWFA 2Z1HA 3NKYA 4W5TA 3E01B 3OYMA 1RDDA 1QHTA 3BSAA 4CEOA 1ZETA 2CJQA 1UA1A 3I0RA 4CF1A 3T5KA 2W8KA 3NGYA 3M9OB 1XR7A 1NK7A 1BCOA 4DLGA 3RB3A 5C5JA 3CO9A 4NZ0A 4ZVGA 2Y1IA 3HP9A 2AGPA 4RW8A 1RNHA 4DTJA 1T03A 4XIUA 3CJ4A 1ASUA 4DTUA 4CFDA 2R7YA 3M9NB 4F50A 4ECXA 3LANA 4CFAA 3LP3A 3MXJA 3DOLA 3N6MA 4AILC 3OYIA 5HLFA 4OGEA 3AVCA 3GIJA 4B9UA 1YVFA 3OLAA 2AJQA 3KLVA 4ECVA 2LSNA 4QW9A 2ZKUA 5CYMB 5C25A 1RAJA 3CJ3A 1ITGA 1RYRA 1NJXA 3DYAA 3DRPB 3LP0A 3ZT3A 3NAIA 2OYQA 4M42A 2PZSA 1VSFA 5F9NA 3D28A 4HCBA 4KBIA 4U6PA 2D3ZA 1LAWA 3CDUA 3AO1A 1TKTB 4NLXA 1HRHA 1GX5A 4NLOA 3HXMA 5SWMA 3V6DB 2QV6A 2ITGA 2G8HA 4DTOA 1TAQA 4XO0A 3OYJA 1RT6B 5KFTA 3BR9A 4QWEA 3JYTA 1T7PA 4TY8A 1CLQA
chains in the Genus database with same CATH superfamily
1MROB 2DCLA 3WNFA 4BC4A 4KH5A 4R5PA 2DEIA 2CNLB 3LAKA 1A6LA 3P49B 1T8EA 1R0AA 4B9SA 1F9FA 4OYXA 1NK0A 2CUYA 4O3RA 1HYVA 2I0XA 3C14B 3KJNB 3F5TA 1UOCA 5KT5A 4P10A 2DRBA 3DGPA 3CDEA 3TTCA 3CNQP 1S0VA 4P71A 4X62J 4ECWA 1FT8A 2OEJA 4EIAA 3A3PB 2KI2A 3V81B 4TYBA 4JV5J 3TAGA 2KLAA 4LF6J 3A8IA 3M8QA 1FKAF 3H45C 3RBXA 3TR8A 4K4ZA 2KFNA 2MHEA 2DVIA 2Z2MA 1YX2A 4LUBA 4DV1K 2R2SA 1MWKA 3TUZC 3UCZP 1JB0C 1XMOK 1DTQB 4K8XA 3SSSA 2UUBF 3QLHB 2ETJA 1S7HA 3DMJA 4O3NA 3K58A 4ED6A 1UJ4A 4HLBA 1WTFA 4QIWD 2L08A 3ZXWA 3OYBA 4FJMA 3SK3A 1P9YA 3H3NO 4EYHB 5GIPA 3KUGA 4NLRA 3A8KA 1OVQA 1QS4A 4LF9F 4NLVA 2FIUA 2A2DA 1MWQA 3SMZA 3QBXA 3KKRA 4JI7J 1V5VA 4CT9A 3UD5A 5HQ8A 3I56S 3O9QA 1FKPB 3CJBA 1S1UB 4WIIA 3G25A 1GK8A 1RBUA 4F4ZA 2RUGA 3O2IA 1YZ7A 2E1PA 1T9VA 4NL5A 3N5BA 3L4BC 1S1XB 1Q53A 3G87A 4NZ6A 1X8DA 4F2SA 2E1MC 3TAMA 2BE9B 3GU0A 3HDSA 4YY3J 3MM6B 4OVLA 1AB8A 4QS8A 4WZMA 1BXNA 4UZBA 1VOMA 1FJGK 3QIPA 4Q5VA 2LCWA 3H08A 3RG6A 4HT7A 2HHUA 1OPZA 3O8WA 2WB4A 3TVZA 4KR0B 3EN9A 1BISA 2P9KA 1U0HB 1NB2A 2BH1A 3FEZA 1RJJA 3CCQS 2ASDA 2D69A 1VC6A 3H4BA 5ETPA 1RT5B 4K41A 4B1XB 5THWA 1XNRJ 4B9MA 4M5LA 3FSXA 3NNCA 4RW8B 3F41A 2UP1A 2KHOA 3EO3A 1KC8O 3ZTSA 4RBVA 2KFZA 3CCMS 2ZJRL 3L7OA 2ZC3A 4ES1A 4AQYJ 1DTTB 2ZH5A 2ZBCA 2VQEF 4QIVA 3FBEA 3M8YA 4BE2A 3IUCA 1N88A 2A1RA 4LR9A 1S5ZA 4YOEA 4DFMA 5KFLA 1QLNA 3R6GB 3MF5A 3T69A 1ACMB 2CQCA 3ZEUB 3AVJA 2O8BB 3JTOA 4OLAA 3SAFA 1I94F 1ZAVA 2N3OA 2KH9A 1BWEA 1WEYA 5IWAJ 4RW7A 2DNPA 4JI6J 2F4VK 4CECA 4CIOA 5CZ1A 1VQOS 3EE9A 3KK2A 5I4MA 4H4MA 4C0BA 2UVRA 3H25A 5FJ4A 2WW8A 3MR7A 3AT1B 2KT5A 2V2ZA 1ZZNA 3X1LB 2AIRB 2V67A 3ILIA 3SQ1A 3CF5Q 5DM7Q 4ZLLA 3VQPA 1D0EA 2FJEB 3LW5C 1VI7A 1NNDA 5D78A 4A8XA 4CTAB 3CD6S 4FPAA 2A0FB 3UKRA 4WYWA 1GLCG 3M30B 3Q8SB 4LD0A 4CP5A 1WDDA 3J7ZT 3AAPA 4YDDB 1T44A 2H4YB 2B6AA 4DU7A 1TVRA 1C0TB 2F96A 2XQCA 2FUG9 2NXJA 4WK1A 2QMUB 4FZYA 4PXCA 4WU3A 5F0WA 3THWA 4Q0BA 4IRDA 1VQ8N 3J7Z5 5HP1A 3WXIA 5E2QA 2EWHA 3UO0A 1IH7A 2W9BB 2L3MA 4IQXA 2WUSA 1N36K 5BR9A 4DR3K 4BDYA 1ICEB 4QPTA 4HTUA 2IVYA 4FYYB 2OLWA 3GTYX 4ZHRA 5K8OA 3CC2S 3M32B 4X4VA 1SBRA 2VFSA 4OZ2A 1LW2B 1Z2ZA 1Z26A 3MGJA 3OVSA 3FRYA 1JLCA 4PQUA 4QYZJ 1XMBA 4J9UE 4UOFA 3VGUA 1LOUA 2IRUA 4WQ5A 5ETSA 2D3UA 2CQBA 3EICA 4Z4FA 4NZ7A 2VH7A 1S57A 1FFSB 4K4UA 2WCXA 2VDHA 3BYRA 2HHVA 3DI6B 5CZVA 5KFBA 2NPFA 3HP6A 3J7YI 3TO8A 3O9UA 3VGVA 2HHHK 2QWRA 1LOTB 3DLEB 2V4JB 2O8FA 1N6QA 3PEHA 4P7VA 3KD1E 3GWCA 2GAGC 4WYLA 5ETKA 3T5JA 2I8EA 4CZFA 4ZS6A 1M5OC 1HD1A 1U1PA 1N33K 3HZ6A 3TA1A 3HPOA 4CQ1A 1S6PA 4AXJA 5DQHA 5LMNJ 3K7RA 4NLCA 5KFYA 1WNSA 3LGNA 4LREA 2UUWA 4CJ7A 2CQDA 3BKFA 2FHKA 1WUAA 1BOTO 2V63A 2Q66A 5KFQA 5KFKA 1RDRA 4NX9A 4CH7A 2ITMA 1BUPA 5EY4A 3J7ZO 3GCWP 4CJQA 1WB9A 4OKKA 2EEYA 3I9V9 4NCGA 4CGGA 2E7VA 3HKZD 3EYZA 5FLXO 1Q9XA 2HFZA 4WP9A 2EXUA 4DV1J 5AR0A 1YQHA 3W65A 4L73A 1XMOJ 2RF2B 2HQGA 2QT7A 3M8PB 5D4NA 3JS9A 2C42A 1VLYA 2IA6A 1S4FA 4NYZA 4JYAK 2IA0A 2IC3B 3UNYA 4B08A 2C2ZB 3MM8B 3NS5A 2IGIA 2B4VA 4WXWA 3D9BA 4X66K 3CDWA 5C0YA 4LSNA 2AJFE 2F9DA 2XBPA 5EGYA 3CYMA 1RT1A 3RAMA 3L7UA 3M5RA 2WBNA 4CO5A 4WE1B 2PMHA 3BQ1A 4W5QA 1RTHB 1NPKA 4DX7A 2WFBA 4CEBA 1UETA 2DNMA 3CJ7A 3H46O 3KLEA 5DDOC 3GR0A 1MLAA 2AU0A 1VSKA 5E33A 2OPPA 4IJAA 1W7AA 1FJGJ 2NLWA 4WFNL 4EEYA 2VKZG 4WQ5C 1WOPA 3VA3A 4CJVA 2K3IA 1T95A 2EVZA 3QQCD 2XLIA 4K4SA 4TY9A 2ZZNA 2ZITA 2X1AA 1FRIA 3T5HA 2BQUA 3FZFA 2KJWA 1ZPVA 4FJIA 1DQ9A 4OGCA 3R7BB 3SCXA 1JJCB 1SJ1A 1ZM2A 2FZGB 2I7NA 4DR7J 3O9RA 5EVZA 1SKUB 4ZCLA 2E20A 1J9AA 2EK1A 2AYMA 3AXKA 4JEPA 1RSCA 4CM2A 3K89A 1FW6A 2CADA 4ED1A 4FSVA 3R7SB 1RADB 5AZJB 1RLCL 1V9OA 2PFDA 3QGGA 3BF1A 1X9JA 1TL3A 2E1AA 2RB7A 3HVWA 4HR2A 2V8PA 5T14A 2R8IA 1RHMB 3WQPA 3Q22A 3S01A 5FPDA 2F4VJ 4M5DA 2QWQA 2FVSA 5CY4A 4NLPA 2MGZA 1C1CA 2UV8A 5BPLA 4FXVA 4PCQA 1R27B 1YJUA 3O9TA 1JMTA 1ZBIA 1N5TA 2WOMB 1GOBA 2OA8A 2GVDB 2HVZA 4V19S 2DGSA 5B0AA 3DLRA 4OLBA 5JMVA 3B54A 2GEMA 4C2MA 2D0AA 3FCHA 3DLGA 4YOXA 2GGPA 1OVYA 5F8MA 3UPFA 1DLOB 1FKOA 1WOSA 4TLQA 2DHGA 5HRRA 2ZM6F 1NCLA 3EVMA 2VG7A 4X64F 1QVFM 2CH6A 2ADBA 3JS6A 2J8AA 3C0BA 2XYPB 1DZ5A 1Q5VA 4USMA 4F4AA 2RUSA 5D3GB 4AHRA 1Q7YO 5KFRA 4BLGA 1CQNA 1TV6B 4FYVB 4KPCA 4Y2KA 4C7QA 4OO1J 2P9NA 1RTIA 5KPTA 1WELA 2AF6A 4RO0A 4ZP8A 3PW0A 2OTLN 2N4CA 5EN1A 1N36J 3AAWB 5T41A 1NJZA 1DAXA 1X0PA 1YJ9S 4M41A 1OYEA 1RBVA 4O44B 4B8AB 4KY3A 3DRYA 2BXJA 4BRCA 2MQOA 2L41A 3BO4A 4UY8T 1F5CA 1YKWA 4B02A 1LWFB 3UVJA 4HACA 1IG9A 2GX8A 4Z4IA 2G8VA 2P9LB 3CCTA 4KKOA 5C15A 4JB8B 4OPKA 3FBBA 3HYFA 3NGKA 1FRKA 3RW6A 2KQ2A 1KRPA 1VQNS 2Y8YA 2YKNA 3ZCMA 1NK5A 4UY85 2NZ4A 5EWEA 2BJ8A 1T03B 3LF0A 4CD1A 2HHHJ 4F8RA 1ZA1B 1R89A 4UQTA 2V51B 2PA3A 4JK9A 3WBZA 4A8KA 4IOCQ 2LXUA 1K47A 2G8WA 1LFWA 2PBDA 1N33J 1V5IB 4JLHA 2I6WA 2XZDB 3HT0A 3WXMB 4P6QA 1T11A 3C19A 4E19A 1REGX 4PZVA 4UZCA 2QM1A 3O5BA 2HS4A 3OYGA 3KMQA 1U1MA 3HMJG 4IQMA 4M5JA 3GFZA 3D3BJ 3LM2A 2P9IA 3TAFA 4ZP6A 4C4WA 2GWKA 4P75A 5CCLA 5HL7Q 4ZCIA 4OIXA 4ZN3A 3K5LA 2I9SA 3D68A 1CJVB 3HM9A 3W5YA 4TY8B 3HZGA 2DFFA 3QRRA 2A41A 3C15A 4OJ3A 4A61A 4CHNA 4R5PB 2HF3A 1QUPA 1YBAA 4ZDNA 1RK8A 1PC5A 4YP3A 5TKYA 3THVA 5L38A 1KVCA 2LEPA 3IR5B 3PJXA 4ZVOB 5L46A 1F0XA 1VQ4N 1RAGB 4X66J 3Q8UA 4ID1A 3WC0A 2MLZA 2P51A 1RU2A 3DGPB 1TKTA 4UY8O 2GUPA 3ZZRA 4G1QA 4JI0F 4DCPB 4BC3A 4J9VA 2ALZA 1GMWD 1EKEA 1YXQA 3NAHA 2UUAF 3M8QB 4CO1A 1RYSA 3P38A 1RA6A 1Q8KA 3J7YP 3MECB 5JUMA 5E0OA 1VK3A 2O8CA 4LRAA 4ZOSA 1U4BA 1MNEA 1X3NA 3NOGA 4B1ZA 4YQWA 2ZBIA 1FDDA 2HNZB 4DU4A 3DMJB 2MZSA 2MYFA 3D4JA 4QIFA 3IMQJ 3FCVA 5C42B 3DLHA 2CQ4A 2HSEB 1NJIO 3MM7A 3CIPA 1BHNA 3EXYA 3MCSA 4IR1A 4OHWA 1SIWB 2HYIB 4USTA 4BCAA 4DHYA 1AXQA 3EDRB 3T1AA 4FN5A 4ECQA 2DD8S 1S3XA 1NZ8A 1PBUA 4GW6A 3ZZTA 3P1GA 3N28A 3T6BA 2PI4A 1WAFA 4FOIA 2XLKA 1LK5A 4OYBA 2IM2A 4Y2AA 4ED5A 2J0XA 4H0TB 2OSRA 4RBTA 2BE7D 5C7PA 2GHVC 5AXMA 3SSQA 2KKHA 3MWPA 3V9ZA 2P1JA 3O1BA 3QIPB 2DPIA 2CAJA 1E3MA 2CH5A 1CQMA 2F5GA 4F67A 2DR6A 1L3UA 2PEBA 3SCKE 2HKEA 3T1HF 3AARA 2HZAA 1GH8A 1HARA 2CDRB 2M2BA 2ZKTA 3M7VA 2DH7A 3ZSZA 4U96A 4NYOA 4NLGA 4FM1A 5D6GA 3SJJA 2O8EA 2H54B 3K2YA 1PILA 4EGLA 4FYXB 3C3LA 1LV5A 1IQZA 5F3TA 1X5OA 4TVAB 4ZVUB 2HVHA 3KD5E 1B3TA 4LF5F 3LZJA 4WIQA 3NXZA 3TRGA 3HTVA 3CJQA 4OZ1A 3VR1A 4AL7A 2C2KB 5AQZA 2LECA 4LFCF 1R6YA 3W5ZA 1AA1B 2VG5A 1IM6A 2CG4A 2UV8G 1SKRA 3KNAA 2KW4A 1RTJA 3G82A 4JP8A 3NMUA 3KKSA 1IJJA 2ZH3A 1VAZA 3BPDA 4NLQA 1RXOB 4B3RF 4H4MB 2DR8A 2HQCA 1Z6RA 1XTZA 4FWLA 1LWCB 4ZPAA 1ASWA 5JXSA 2WVBA 4JI5K 4IYQA 1N0UA 2EFGA 1SC1B 1HLWA 1JLFA 2HOEA 2MKYA 2IHR1 1S97A 1H3DA 4FPIA 1EWQA 1EETA 3P5JA 3M4XA 3I31A 3FC9A 3UKRB 1LWXA 4C3LA 3L4QA 4CI0B 1TL1A 4F04B 1T0TV 3NP5A 3MFIA 5HRSA 2VDIA 5H9FK 4LRCA 3HHLD 1FDNA 3AJDA 2E1ZA 2DEJA 3RBDA 3OTCA 2UUTA 2B6AB 5G0RA 3HHLC 4J37A 3CPWR 5IV4A 2Z4PA 3MEDA 3J80O 2VHGA 4JUZA 2HGMA 2VASA 1HA1A 3OVBA 3MUVP 4DPXA 4ECSA 3THWB 3SJHA 4PKDB 5GAEU 4UTGA 2CQIA 3AVFA 2RU3A 4TQSA 2VWBA 5F3ZA 3SMPA 3SV4A 5HP1B 5J2QA 1XQSC 4LRDA 1AUSL 3V6HA 1REVB 5KG5A 3DKDA 2KKZA 4ZHRB 2XMMA 4O0JA 1RABB 4QU7A 4J5OA 3OBWA 3FBFA 2XC9A 1T9XA 1KQFB 1S72N 4DR1K 2RMLA 3T3FA 1DBDA 1TUWA 3A5NC 4BQZA 1N32K 4C0HA 5BRHA 2CPXA 1M90T 2UUCF 3PY8A 2AV5A 1NGIA 2QA4S 1T6DA 1GLBG 4UOGA 4A8YA 3ZX0A 2KHCA 2K7JA 4LSZB 1SAZA 3TZYA 1N6QB 3HM8A 4OX7A 4J2DA 5KQ8A 1UZDA 3V9WA 1RBLA 2RQ4A 3GV5B 2MQPA 2MKJA 2X51A 4J2EA 1A7GE 2OUGA 3NCRA 4M95A 3GQCA 4KC5A 3TQEA 1FERA 3IAS9 4C1NK 2FZKB 3RUBL 5M1FA 3TSUA 5DLFA 3ELHA 1WN7A 3EZWA 3ZSXA 1H73A 4KPYA 3W64A 4DTMA 1HQ2A 4OZJA 4KHMA 4QWBA 1M5SA 5GAGU 2FYXA 2G8IA 3H5YA 1U25A 5BPMA 1M1KO 2B43A 1KOHA 1HNXK 2LQJA 4IOAL 3FFIA 1U45A 5A0YB 4MO5A 1BE4A 2P6TA 4BG9A 2JOQA 3QFUA 3KWMA 2YJFA 2UVVA 3NGUA 1NKBA 4K0KF 3FMWA 1HNWJ 4LF7K 1Q86T 4XDDA 3EPIA 3AGKA 3H4DA 1ZA2B 1JXLA 3N0VA 1BL3A 3TYTA 4FNHA 5KFIA 2WTFA 4OHVA 1Q95G 3DHXA 2MJNA 4G9ZA 1KHVA 3VETA 1RHKB 2ZH7A 1FFGB 4LSNB 1LWEB 2FBXA 5A8RB 3QDKA 3V9UA 3DOKB 3N4WA 2HBZB 2D3O1 1YTAA 3ASMA 5GVQA 2W1BA 3IMXA 2KN4A 4BRAA 3AHPA 2XHWA 4NMXA 4DFPA 1X5SA 1X60A 2RHQB 3BN4A 1SQGA 4CCHA 4AHVA 2NS1B 3HVRA 3SUNA 3JSBA 4ZPTR 1XMQF 4WXOA 3KLEB 2YWGA 3E01A 2LYVA 4CIFA 4OI4A 3T1YF 2F4FA 1Q18A 1X4GA 2DNRA 1YTUA 4FWRA 1WI6A 5LSOA 1UAWA 4JI2K 2QWLA 3H0PA 4KHPK 1T9TA 3LDNA 1OYDA 3A5LC 4CJUA 1S1WA 4JI4F 4ZPWR 5D4OA 2QEXN 2U1AA 4OYZA 2EBEA 3WIVA 4B3TF 2GIRA 3AA9A 2VPXB 3PKYA 3KLHA 3BQ2A 2DTUA 4XPEA 3DRXA 3EWGA 2YPYA 3OS2A 5A6WA 2PMWA 2QYCA 3H8YA 3EGWB 2DKOB 5HAOA 3EGVA 4DR4K 5JLFA 4FXDA 5CHCB 4CLYA 4I6AA 2R8JA 4DR6K 2PC6A 1RBSA 3KHYA 2OPRA 4C8OA 3L2QA 2ZJPQ 5B7WA 1N56A 2IMWP 5JVHL 4KGXB 4MAKA 3BBBA 2EFOA 2LLZA 4KFBA 4F0KA 5B09A 3R1HA 1Q86O 4KH4A 3OSNA 4LFAF 1SC6A 3HF5A 2QW9A 1VQ9N 1FI4A 4DR5K 4BR5A 4CI6A 1TL3B 2VONA 3KHRA 1N34K 1W7WA 5ETRA 3V4IB 4H03B 3AVIA 1DQ8A 4OYPA 4M5DB 4IH6A 4IO9Q 4HHTA 2W7OA 4AF1A 4DSIA 1W9HA 2DGQA 3H7HB 4ZVPB 4K4VA 4JS4A 3VALA 2UVUA 5LJ5Y 4X4OA 4LH4A 2HNDA 1I6JA 4JI5J 2UU9K 5J1EA 4LF8K 4P2SA 4XK8C 4I2PB 3D54A 3BYPA 4K2XA 2HZVA 2A10A 2OHDA 3DLGB 5BR8K 2GGPB 5AFUH 1FKOB 4M3UA 2DNZA 3OD2A 1U8WA 3RMCA 1DQAA 1YBTA 2KYZA 1WORA 4OI6A 3V1OA 4FO0A 3L2WA 5H9FJ 3BM7A 2RH3A 4AHTA 4LT6A 3GL1A 1SH0A 3L9ZA 5AQWA 1WAJA 4JI8F 1JXBA 3CERA 1NK6A 1CULA 2FLPA 2R7VA 4Z2XA 1AT1B 2FBYA 4S0MA 1AYEA 3TX8A 2FGOA 2HNYA 3GSDA 4BROA 1YVNA 4C3MA 4Y2IA 5BN9A 5J1PA 2HHTA 3VQTA 1U0SA 3WXKA 4DL3A 2IOCA 2VPZB 3PSIA 1HI1A 1VQ6S 2GQQA 2P9NB 1RILA 2MKKA 3D6TB 1QQOA 1HNZJ 2ZWPA 4DL6A 4FK4A 1M1HA 2VBWA 3ZO7A 3H98A 1B7FA 3O4QA 1HHSA 2MQMA 5GMEA 1VQLS 7FD1A 4DL2A 2HBRB 2YH0A 3K5MA 1YT3A 5F8LA 4DMZA 2F40A 3TUPA 2MKIA 4YB1P 4PXBA 1KXPA 1JK9B 4YN3B 4HACB 4DR1J 1XERA 4LQ3A 4M5NA 2APOA 2DR9A 2RHKA 1N32J 2OJ3A 3DN9A 4X62F 1I94J 4URQU 3ZZOA 1UTAA 1YIJN 4JV5F 4QOTA 4LF6F 3EZUA 1HR0F 2WSEC 2D4WA 2ZFHA 3EVWA 3LH2S 2CGLA 2DNNA 4M5GA 1W26A 5F8JA 1DT9A 1QHAA 2YHBA 4EFHA 4LSLB 2BR0A 4C8MA 2W01A 1SJFA 4I6MA 4DZDA 4H5RA 1Q9YA 3I5AA 2FJWA 1TAUA 2YKQA 3CJ0A 4JI3K 1KBRA 2A3JA 3W1YC 3W66A 2V4RA 2Z1HA 3OYMA 5DRKA 3HRGA 3LGHA 3BV8A 4CEOA 2GHWA 4HTLA 2R7SA 2MSTA 2DGUA 2A40A 3AOCA 1XNQK 1VS3A 4ZVGA 3HP9A 1RWPB 3VEWA 4JI7F 4WFBQ 4DTJA 3FFKB 2P9IB 4XIUA 3NWGA 3SEOA 1OY9A 3CJ4A 4DTUA 3TPQA 4CNYA 2R7YA 5B8HA 4DL0C 2DIVA 3M9NB 1HWUA 5AJ3K 1H2TZ 4F50A 2KXHA 5G4DA 4PYDA 3DOLA 5HLFA 4OGEA 3WHIA 4L3NA 2OD6A 3TWZA 3VF2A 3C15B 3CJTA 3ATVA 1RBOB 1U1LA 4YY3F 2MQLA 1RHRB 3W5XA 7FDRA 4DQ8A 3IO1A 5C25A 3CJ3A 1ITGA 4HTJA 1V3ZA 1SJ3P 3DRPB 3LP0A 3NAIA 2VFVA 1VSFA 4P52A 1B99A 1XBWA 5F9NA 4HCBA 4Z37A 2A42A 2D3ZA 4XTTA 1RDWX 1TKTB 2JNJA 3M2UA 1Q8LA 2JZ5A 1XC3A 4N77A 1HW8A 2QV6A 1O8BA 1XNRF 1YHQN 2G8HA 2ZHBA 1U8SA 1N8RO 4XO0A 2EFVA 3OYJA 3BR9A 4OI0A 4QWEA 3K9JA 1HUXA 4C1NI 3QGHA 4GY2B 4AQYF 4HUGA 2HBKA 2O8CB 3NL0A 3HOSA 3SUOA 5KFEA 1QZ5A 1G2EA 2GQCA 4JI2J 3QYYA 4O3QA 1NDLA 2IFXA 1NKEA 3AO5A 3M8SA 5IWAF 2VBZA 3HHLB 3JQKA 4X4RA 3LL3A 4DEZA 1NDKA 1E4FT 4HDHA 3CO0P 2CQGA 3TZZA 2J7UA 1R43A 3JTNA 4QW8A 4CLUA 5DG7A 4PAAA 1KOOA 4CEAA 2KRRA 5KFSA 3IAM9 3S3OA 4LR8A 3CJRA 1HPZA 3SQOP 2POKA 3BSOA 3NF8A 4DR4J 4FWNA 1DY3A 4KJIA 4Y6IA 3DOMA 4DR6J 1YSJA 1H7XA 1SQEA 1PIEA 5BYSA 4J9QA 4RG8A 1O1WA 4NYNA 2BW7A 1S1VA 4O4GB 4AHCA 2M0GB 2RIJA 2C2DA 3D1OA 3BO2A 3VN5A 2YNIA 4PWDA 2W6LA 4DR5J 2DGXA 3CD7A 3FSIA 5IT9O 3CI5A 2QJ3A 3MDQA 2BQRA 1D8YA 3A0IX 4K8ZA 2E5GA 4NLYA 5CQGA 1IBKK 5AXKA 3MX2A 1SXLA 5AQYA 1YRUA 2UU9J 2M4MA 1RU1A 2MLXA 1VQ7S 4DMNA 3V5RA 3KDNA 1IJEB 5J2NA 2L48A 2BABA 3LQVA 1VBXA 5BR8J 1GT8A 4Q44A 2HG4A 5IM0A 4OYWA 4CT8A 3RSEB 3C8YA 4WKRA 4OPHA 1R8PA 4QR1A 2BDPA 2JGUA 2GVZA 3ZFVA 2VG5B 2CZ9A 3R5BA 3I0RB 3G82B 3UWTA 2C3OA 1PJ7A 4F4WA 2WTUA 4RX6A 1QD1A 4L74A 1BIZA 2RDJA 3LWMA 2NRWA 4W92B 3BF3A 1TL5A 3RGIA 3T41A 3PKMA 4P7TA 2YNFA 1S99A 1WUUA 2LP4A 4PKHA 4C8NA 4FJXA 3D67A 4A8FA 1H72C 5LMNF 3TABA 2I38A 3PW7A 5DQIA 2YNHA 3RAQA 2MHNA 4MDBA 3D2FB 2QWNA 1TL1B 4Z7CA 2W7AA 2NREA 1VSDA 1U47A 2ZE2A 1RQ0A 2JHEA 5G0RB 4RNFA 4WTOB 4DUYK 1SJRA 4UUXA 4PG8A 1L3TA 1VRQC 1BQMA 5KFPA 2Q0UA 1OO0B 2R3VA 3DM2A 3M6VA 4ILLA 4DV1F 5BREA 2MDAA 1WC5A 3JSMA 1XMOF 2CJYB 4PQAA 1OWXA 5CXTA 3PYDA 3C6AA 3BEGB 3VQ6A 1R3NA 3AH6A 2JEIA 4Z4EA 4CJSA 4RW6B 3WQTA 1HD0A 2VPWB 2W2QP 2CPFA 3MEKA 3DAWA 4Z4GA 1VHXA 1UKUA 1WC3A 3VGTA 1IKVA 4BRGA 2JRSA 5KRTA 5H1SQ 3NF6A 4BVOA 4PG7A 1VSHA 3PR5B 3LOUA 3RTVA 2COLA 2GMJA 1RWVB 4WFAQ 1SKWA 2ZJRQ 1C1AA 3H2LA 2JWLA 5GAHU 4DFKA 5AJ3J 3NMAA 4OJGA 4N7TA 5AQSA 1R6VA 3D6RA 4H4OA 2C2OB 5M1QA 3F56A 1WBBA 5L9NA 1SL0A 3WQUA 4MDAA 2FHJA 3GSIA 2CWXA 3TANA 4FNIA 3ET6B 1Q81T 1DGKN 3KJVA 3I32A 3HK2A 4EHTA 1FJGF 1S0OA 1SI9A 1VK0A 1O13A 2J0WA 3OYEA 4F4KA 2DK2A 3CCEN 3D7EO 5DZ6A 2YX1A 2NXCA 2P9PB 3ISND 1XR6A 2XS5A 3ISNC 1Q8IA 4CEZA 3W7BA 3QGIA 4RZRA 3QT7A 3FFIB 2PMZD 2H3GX 3GG4A 3C16A 1VBKA 2CQ3A 2HVDA 2FSNA 4FBUA 1WC6A 4ILMA 2ASPA 3CWJA 2NZTA 1NU0A 2G13A 5F41A 1PAUB 2G2ZA 4DN0A 4E2FB 1N4LA 3RRKA 4DCOB 1V3SA 5B08A 3W2WA 4MIAA 1HWIA 3RU0A 4B1WB 3AVHA 2KG0A 4ATNA 2F8EX 4KT0C 2I7PA 2F4VF 1P9QC 2EI5A 3CJ8A 1YUWA 2P2CB 4L8RB 1FRJA 2G0IA 2OPQB 2VA3A 2JFDA 5CZXA 4NRTA 4JI1K 2BKPA 3U1MA 1WI8A 3IBFB 3AA3A 4E7JA 1EX8A 2QTWA 2HBJA 5JS1A 5KG7A 4JKGA 2B9WA 3UDLA 4B8CA 4NYFA 1KTQA 2H4WB 5M1OA 4MKYA 3TOQA 4AM7A 2LQBA 4FYWB 2DITA 3TSQA 3F0NA 3U3YA 3QEWA 3HVTB 1X4EA 1VJWA 3BREA 4ECTA 4NB4A 1HL6A 3NGDA 1Q81O 3K8WA 2X1FA 2NRZA 3W0LA 4B3SK 2VFUA 4E8UA 2NSBA 4IKAA 1BQNB 1S1WB 3NBPB 4JD2A 4JKDA 1K8KA 2W2NP 2ASMA 4FXWA 1IBKJ 3BUZB 4CBXA 4G1IA 2E5LK 3KLHB 3WEEA 3CCVN 3I55N 1N36F 2DB1A 4CK2A 4DUTA 2QSFA 3ITHB 1Y9OA 2FQQB 4F3TA 2OPRB 2K8GA 1YJNS 2E2QA 4CZIA 3M2RA 3S3NA 4AUKA 5F0XA 4OZ0A 4DUZK 4KFBB 5C10A 5K14A 3GFYA 4K8RA 5KTQA 4CH1A 3OBYA 1S72S 1QZ6A 4E1MA 3ZSVA 3IAYA 2CQ0A 3TEHB 1S4EA 4DBQA 3UDCA 2HIQA 5KG4A 4RUCA 5CAAA 2IVOA 3S3MA 2CNKB 3MMCA 2HHHF 1WG5A 5DGBA 1EB0A 2G8FA 4WF9L 2VWJA 2DR5A 5D0EA 1VSJA 4IG0B 3TAEA 2BANA 4BE0A 4DLEA 1YJTA 3S7RA 3W2VA 1NK4A 5A8KA 5AQKA 2DNOA 1QM9A 1N33F 1WF2A 3PJ9A 5GMDA 1YDLA 1RCHA 4N8OA 1SL2A 2CA9A 4U9RA 3R9LA 2C3UA 4PWUA 4CHPA 3ENWA 5KG6A 5ETQA 5I42A 4OKEA 2Q2RA 4CZLA 2E9ZA 3T9NA 2A18A 2Q31A 4W5OA 4DU1A 5BPNA 4M63A 3RR7A 4J2AA 1S1TA 5U47A 3MWTA 1X4HA 2CJKA 1VIOA 3D2EA 4IEIA 3SCJE 4QS9A 3OYCA 2JLEA 3VZIA 1HKCA 3OR1B 4F9OA 5AQMA 3QT6A 4DUYJ 4OHYA 4CJ3A 1X5TA 3DRSA 3S9HA 1VISA 5T7LA 3LPEA 5J1NA 2HNYB 3NS7B 3H5UA 4USJC 4H8KA 3OW2M 3TSPA 1NM1A 1YJRA 1SCJB 4U8YA 1D9DA 3AJ1A 4KAZA 2C3MA 4NEZA 2A6MA 2QIFA 3SI6A 3AGRA 3CFOA 3FQKA 3WX8A 3BGFA 4KO0A 1GXTA 1QUVA 2MY7A 1NAQA 1WSRA 2ZBRA 1VQKN 1JXVA 2BJDA 3PIOQ 3PRVA 2XLJA 3S6EA 1URRA 2Q3PA 3PW2A 4G3IA 2XMUA 3FUYA 4E98A 3KK7A 1MN9A 2YX4A 4NA2A 2HMIA 1WSJA 4X66F 4FF3A 1X31C 4LFCJ 2E9TA 4CO4A 3UN3A 4FJ9A 3MOJB 2BA9A 1M5PC 4QYRA 4A8SA 2V9KA 1BLUA 3VESA 2E6LA 2B4PA 3QSYB 3NVKA 4DV6K 2DY4A 4P2XA 3O1WA 3CIZA 3GE1A 4CZMA 3QEPA 2ZVIA 4YOTA 1DARA 2C2NA 5DM7L 2JLFA 4KB7A 1QVGR 1X9WA 1OIAA 4DPYA 1U2VA 2QGFB 2WZ1A 1VQMS 4E89A 1CXQA 2VODA 2QL7B 1HYSA 1WOOA 1FE0A 3C2PA 3D0GE 1B0PA 1K1SA 3G6YA 3PX4A 1OSCA 4LFBK 1QE1B 2H3EB 4JAXA 2Y8WA 2BW2A 4B1UB 3IXQA 2X7IA 4TQRA 1EWRA 3QFHA 4KHQA 2D7SA 4FYDA 1EXQA 2YWHA 2ZVSA 2MZRA 2DPJA 2W2PP 3O1LA 3CM6A 2DFEA 1SZ2A 1RDBA 4TKTA 1WEXA 5D0HA 5KFOA 3L2VA 3P83D 1DURA 1TZ0A 2X1GA 1Y97A 4OX9K 5HLFB 2V8HA 1W2IA 2BEFA 2JWKA 3OTBA 2YKMA 1DRZA 5KFVA 3JQMA 3AB4B 1O0PA 1XWLA 3IR7B 5IQQA 3KJFB 3G8SA 1WKKA 3VGMA 2AGOA 4M63C 1SQFA 4DX8H 4O3PA 4GVBA 1F3VA 2CKWA 3LP0B 2NXEA 4DWIA 1U26A 2RRBA 1VQ9S 2FHMA 2VL1A 3AA4A 5FD1A 4F4XA 1HWLA 2HRUA 3VMFB 2XI2A 4LIRA 4DQRA 2HRYA 3K5OA 3PYGA 3M2UB 5KOXA 4BDPA 1BMQB 1KQSM 2UUCJ 2HBQB 5F8HA 1ZBHA 3SBMA 3NGIA 4HHHA 1EP4B 4JI1J 4J9PA 4IDHA 5E41A 5CE3A 3D6FB 3CFRA 4OV6A 2OO4A 2UZAA 2Y1LB 1C4AA 4FKXA 3IBWA 2ASLA 5DGAA 4URGA 2C28A 3TX0A 2K3KA 3HSGA 3M6WA 3MMAB 3UKUB 4LR7A 3MPUB 3ZSYA 4IH5A 4A57A 2GUIA 5D15A 1TKXB 4KRFA 2MQQA 3GJQB 2HPUA 1A0OB 4B3SJ 4HI1A 3ZX2A 1SH3A 3VGKA 1CEZA 3LPYA 2QXLA 2VJVA 3AA2A 3TWHA 1L5UA 4FJLA 2E66A 2J5AA 2E5LJ 3CFPA 4J8FA 4JNEA 4KHUA 3ENHA 5D77A 4MH8A 3K5NA 5ADXH 2HAIA 2W9CB 5KFDA 1HPZB 2U2FA 4NPOA 4YR3A 3EZ5A 1NZAA 1FTRA 5HATA 5KAKA 3MD3A 3V6JA 3DDKA 2DHXA 1S79A 3IG1B 4BE1A 2HRTA 2FF3B 1NRKA 4OL8A 3RZAA 1KKHA 3AVNA 4DUZJ 1XHXA 5AE1A 3J81U 2AYEA 4K4TA 1CPZA 5LJ3Y 1IR0A 3VOVA 2CPDA 4R0EA 3VV2B 2YNIB 4PWDB 5AQHA 5DZ7A 1SVDA 2AP6A 5E5NA 4YR0A 1CBKA 4A8WA 3HULA 5KQDA 1L3KA 3QGPA 4NLWA 1RA7A 2NRHA 2XYGB 3AD9C 1YF5L 2GMHA 2HW3A 3AJ2A 1GOCA 2OCEA 2Q79A 2YX6A 3NGTA 4EFAC 3EGZA 2B3TB 4PWWA 3R7NB 5FIIA 4DOZA 4Q2LA 2W24A 4PG4A 1UVLA 4C97A 1K9MT 4X2BA 4CLPA 3TTDA 1W0HA 3PHTA 4DQPA 2V34A 3FMBA 4CK1A 1K73O 4W5RA 4FM2A 2B4JA 3HPGA 3NG8A 3T1YJ 5IM0B 3G0ZA 2DY1A 5JLHA 3THYA 3EMTA 2HLTA 1WLJA 2E2PA 2BRKA 3TZWA 2GCFA 1TMJA 1SB6A 1RT2A 1VQPN 3D66A 3MCNA 5J2MA 1KSPA 3BF4A 2YNGA 4JI4J 3CCSN 4RWTA 3MN9A 4EO8A 1V3RA 2OI2A 2HGLA 2HQDA 2AMCB 3TNVA 3V4MA 1S59A 1FJEB 1MW7A 5KFHA 1PJ6A 2BGGA 3CQXA 3J81j 2R7XA 1WSEA 2YNFB 5CYQB 1C6VA 1QSLA 4PEOA 2ADCA 2WRMA 3HFVA 1QSYA 3VAGA 5FDLB 4HEA9 2G1HA 3DXKA 1HQUA 2P9CA 4X64K 1FNMA 5L1IA 4M5HA 2IMOA 1BD6A 4OZ5A 2ZHAA 4KHYA 3L4IA 5L1JA 2VFRA 3FZMA 4DV0K 5DLGA 3KOAA 4CD3A 3VQQA 4NI2A 4C98A 4ILJA 2RS8A 1W2BM 3MFHA 3PSFA 2G4BA 4H5TA 5GAEI 4LJMA 3H5XA 3ZSOA 4ENOA 2OKQA 3VVTA 4X4PA 4DV6J 2E6MA 4FWMA 5BXIA 1TGOA 1MU2A 1DJ0A 1IUJA 4JOUA 4MK8A 2NQPA 4YOYA 1HBOA 4DV4K 3JSMB 3C65A 4J7CA 2M3DA 4LF4K 3HSDA 1RDUA 1RT3A 1IKYB 2E5JA 2VUGA 3FSYA 4Y00A 1T9WA 3MEEA 1YTYA 1K9MO 5D8HB 5LMUK 3MR2A 1XK8A 2BM1A 4LFBJ 1IKVB 4BACA 3T7ZA 4JRPA 3OL7A 1D1UA 2HBYB 4K2JA 5GADU 1VRTB 1MDUB 1YJ7A 4M45A 3BKTA 2DIUA 1RDCA 4IFVA 1M5HA 1HNVB 2R7TA 1ATSA 3BZCA 4AH9A 4FVUA 5I3UA 3KYLA 2B5JB 4PUOA 4H4OB 3JAMU 2ROGA 3TTFA 2PN6A 4OX9J 2DNLA 1P1TA 4FK2A 1L3SA 5LXYA 1RBAA 3GPAA 3K0SA 5ADZA 2QMXA 3LWLA 4E7LA 4XH4A 1NO8A 1Y5LB 4IXCA 2Q6BA 1M5VC 1BDGA 4WTYA 3UDVA 5F8GA 2HHXA 1X9SA 4PABA 1KS2A 3ZTRA 2DRDA 1U24A 5GAGI 4DN9A 1VC0A 3M6UA 1J54A 1KNZA 1KC8T 4D3HA 3P5BP 1U7LA 4GO7X 4LVNP 2CQHA 2OIHA 2JL9A 2V8GA 2V7ZA 4ILHA 3GB0A 2VIHA 3ZSRA 3OTOK 2BE2A 2GNKA 1HR0J 3KK3A 3HLUA 3NCIA 4FLUA 2CZ4A 4IOCL 3O3GA 2NCKL 3OHAA 1NSQA 3QZ8A 3Q24A 2FC8A 1NJYA 2W6KA 2YV0X 2F8SA 3POTA 4JS5A 3FEXB 4FJ7A 3L09A 1T05A 4WP8A 1TL7A 1M0SA 2DY9A 3W2WB 5JMNA 5DS7A 2FVQA 1Y3KA 3ZX3A 2BQ3A 2QZ8A 1VLOA 1BIUA 2ZF5O 5J2PA 1NDPA 3NH0A 3TA2A 4BVPA 1IBLK 5EXWA 4NXMK 4IJNA 3ICLA 4RBUA 2WSCC 3THXA 5HL7L 1XJWB 2Q43A 3LDSA 4OX8A 1FXXA 4R0JA 2L9WA 4JI5F 1NHUA 3Q23A 4W98A 4DV3K 3G96A 4JRQA 4PR6A 1KLNA 4MFBB 3JSYA 3LAMA 5M1PA 2KTQA 2LQ8A 1ZBTA 3ILLA 2F3JA 3ZC4A 4X4NA 5AQTA 3ENOA 4OKJA 3R5CA 4ISGA 4YUDA 4LF2A 4IG3B 1WC4A 3A8EA 1S7IA 2BRLA 3AB2B 3I56N 2BVZA 1OQ6A 2QWMA 5KFMA 1RWXB 1S0MA 3D5MA 4UOCA 4JD2B 1K8KB 1VSIA 3GZ7A 2OMLA 4OQJA 2RNEA 1CG2A 3OSPA 3WEEB 2DGWA 1HNZF 2X3GA 2ZOMA 2ILYA 2E9RX 1SJ4P 2KVQE 3DXSX 2I2YA 1BI4A 3VEYA 4DCHA 1RUSA 4CZKA 1Q0NA 3TVYA 1FO1A 3G6XA 3EM1A 3L3VA 3P31A 2CJBA 3AA5X 1NXIA 1FK9A 4ER8A 5KFWA 3K0JA 3M2VB 2YJEA 4DR1F 3CCQN 5K14B 1URNA 4Y0FA 3KK1B 4RLEA 3PYFA 2CVEA 4P9SA 1N32F 1UWAA 4Q45A 2O1PA 3M1VA 4KI4A 1PJ5A 1Z2LA 3CCMN 4Z7YA 2AZ1A 4AL5A 2E4LA 4BRHA 4EBEA 3MMCB 5E3AA 2WVFA 4FJGA 4B3OA 1RAFB 4NMLA 4Q43A 3AQOA 2CRLA 1S5JA 3VQ4A 2Z2ZA 3W2VB 2JLGA 4PXEA 2AJ2A 2BV3A 2W42A 4H0XB 2XHCA 4DSJA 3J81Y 3G8QA 2ILZA 1SH2A 2QI2A 3G86A 2PIIA 1EKSA 1RP5A 5I42B 2EC0A 3R1LA 1T94A 2XS2A 1UVKA 1YWXA 3EXCX 3VA0A 1S1TB 5K8NA 2FPHX 4K4XA 3D2EB 3V6DA 2CPYA 2GZOA 3OS1A 3AVLA 4E3SA 5K8PA 1HNXF 4E7KA 4WJBA 4J9RA 1HWJA 1RBRA 4DTXA 2LKZA 5T7LB 1O51A 3CD0A 4CO0A 3B6BA 4A8QA 3DRRA 1T9YA 1MROA 2WBMA 3AFGA 4A2BA 1QTMA 1YK9A 3CC7S 1J5OA 3DCAA 1B4SA 1UJ5A 2DO0A 2RN2A 4ZVFA 4LF7F 4KO0B 4DV4J 1IQTA 1TL4A 2KL8A 3GOIA 4LF4J 4PG5A 3TI0A 1QAIA 3C14A 2DGTA 1NGFA 2H51B 3PNIA 4NXNK 1ELOA 3MN6A 3ALYA 5LMUJ 2H5IB 4HT5A 2HMIB 2J4RA 3SXLA 2HFNA 2PFUA 3V81A 4BRIA 3OJSA 1N5SA 2AX0A 2E7XA 1KFSA 2A2CA 5K20B 1VJQA 1FDAA 1KD1O 2J7WA 4K5RA 3E9PA 1WHVA 1CC7A 1ZAXA 2XSFA 4CF0A 2PD1A 1DTQA 1UWBB 1WHWA 2FGCA 3J7AP 2UXDK 3CC2N 3QLHA 1PAEX 4C8YA 1IO2A 3NAEA 4CZJA 5HROA 4Q2MA 2CYYA 1GQEA 3N79A 3GYNA 2P5VA 3CVKA 5CCMA 3QJJA 4OFZA 1NJWA 4ED2A 3LPTA 1HYSB 4JI2F 1YGYA 3QB0A 4ID5A 4KHPF 4RNHA 4ICLB 2QKKA 2ZDOA 4ELVA 1FKPA 4BWJA 4RCHA 5DM6Q 4MKBA 4V19X 2H5JB 4I4BA 1QSSA 3LPUA 3C6UA 1S1XA 3FDSA 2J9EA 4PG6A 2ZH6A 3OTOJ 5GAEP 1GXUA 1C4CA 3HJFA 1UEUA 1UP1A 5C12A 3I55S 4I6YA 3F73A 2RAQA 3DLLQ 1K8AO 3MM6A 2ROEA 4DR4F 4JKCA 3BO3A 3KDOA 3FBCA 3ZTPA 2LFVA 4DR6F 2YHYA 3VEXA 4Y2MA 2YKMB 2M8HA 4PYAA 2L9DA 5RUBA 1VGYA 1IR2A 2ZH4A 1RDDA 3O6QA 1ZETA 1U0HA 4CF1A 3A5MC 4GVBB 4DR5F 3VAFA 3NGYA 2K1RA 3O80A 1DEJA 1N34F 1U1QA 3RB3A 1TUYA 2AGPA 4RW8A 1IBLJ 4NXMJ 1CS4A 2B9EA 1ASUA 4HHJA 1J5EK 5BN8A 1VIXA 3JAMY 2ZBQA 4A48A 4R25A 2UU9F 3LP3A 1Y3JA 4AILC 3OYIA 4DV3J 3LM9A 3P96A 3AVCA 4B9UA 3OLAA 2KHDA 2AJQA 2V52B 5BR8F 3WXLA 3SIPB 1OJ4A 2LSNA 3ZEUA 2ZKUA 5CYMB 2QLWA 1RYRA 2UXBK 1Q7YT 3DYAA 2B4UA 2W4CA 3R2DJ 1RWNB 3IR6B 1LAWA 4UOHA 2QFJA 3CJ1A 3ENQA 4NLXA 2MLYA 1UFKA 2QO3A 3A1YG 1GX5A 1IVZA 5GAGP 4NLOA 2V94A 4C0OC 1TUGB 3CJCA 4DTOA 1QVFR 2AEMA 2MKSA 5KFTA 2W41A 5H9EK 3JYTA 1CLQA 4CTAA 3C7NB 3RB0A 1KCFA 1D09B 3SAHA 2BX6A 2NUBA 1YITN 1VQKS 5JVGL 4ED4A 4IOXA 4MK7A 1K44A 5MAOA 2DHHA 3WNEA 3IFRA 2AYBA 4O8KA 3L6QA 4O3SA 4U67Q 1RAAB 4CFBA 3MUMP 3LALA 2V50A 3CCRS 4CLLA 4FLWA 2ERRA 2PGCA 4IBNA 1U49A 1JCEA 3IA0A 4WCEQ 2V2KA 3P39A 3MEGB 3EL2A 2NYHA 2ZOFA 1IV0A 1KFDA 1P1LA 3M32A 2HVIA 1LW2A 1E6VB 4K42A 1BC6A 3P3DA 1VK8A 1Y5IB 2MPUA 3BSCA 4C3KA 1YI2S 1JLEA 3OYLA 2D0CA 1B0TA 1U1OA 2JC0A 3QT8A 3R27A 1RWKB 1F2GA 4KI6A 3RMBA 1KN6A 2P9UA 2VC0A 3ETOA 3THYB 4CLSA 4IDKA 2HFVA 1KR4A 1S9FA 5EUHA 4H54A 1DFDA 1HMVB 2E1CA 3QNWB 2IJRA 3CMES 3RMAA 2EG1A 2G9OA 2E5IA 1NLKL 1NHVA 2ZWOA 2YNGB 3OYKA 4A8MP 2RRNA 4OJHA 4N47A 1UL3A 1FCAA 4B9QA 1CXUA 4M5KA 2IDLA 4CBUA 5AJ3F 3VGLA 1R8AA 1XC9A 1FWKA 1C0FA 4EMDA 1EZZB 4PXDA 3CHWA 1LFPA 4CFCA 2R2TA 3U27A 2CQPA 4OZ3A 4DR3J 2ZJPL 2NPIA 3DXKB 1HQUB 1IBCB 4DHVA 1XUPO 1TR0A 5KFNA 4E7IA 2P9GA 4NXNJ 1PKUA 1IBMK 2AGQA 1UPPA 1FNOA 4C11B 3FNNA 1NGJA 4HUEA 5A2QY 5CZ2A 6FDRA 4NI2B 4H5WA 3PJWA 2MMYA 1H98A 1C0UA 4F02A 4LQ9A 4IO9L 2AWZA 3TUJC 4OLOA 3VAIA 4LIWA 1HQEA 1E6YA 1FJ7A 2RF2A 4H0VB 1YJ9N 2ZH2A 1TFWA 5L1KA 2UXDJ 4QBUA 4WBFA 3NFAA 1HBOB 4RUHA 3MMJA 1HI8A 4LC9B 2QX0A 4TN2A 1NJIT 1WWHA 2NRXA 1N0VC 5EHHA 1BA1A 2MSSA 1ZBLA 1RT3B 3QO9A 5KPRA 3W9IA 3CW2C 2L9NA 2OFGX 2ASYA 1AUDA 3JQJA 1QAYA 3L3CA 5EDWA 1WG1A 2XCPA 1KAXA 1GOAA 3FZHA 1R7IA 1HLUA 1FFWB 4NE9C 3A12A 1RTHA 1YJWN 4AXIA 2YH1A 2MZTA 3NCQA 2GJFA 1I39A 2OH2A 1BGXT 4Y34A 3M8WA 5GAHI 2Q0RA 1PO6A 1LW0A 1TMMA 2XSJB 2FJXA 1WSIA 2XB2D 4QOZB 2FVPA 5ETVA 3NGRA 4IR9A 5I3UB 2HHWA 3N6NA 4AHUA 4F3OA 1WKLA 3CM5A 1JJ2M 4FJNA 4Z94A 4NLBA 3RRHA 3ID8A 3EEQA 1TK8A 2HMPA 4JYAJ 3HBTA 1R0AB 3MMBA 1ZZFA 2WW4A 1ZM3A 2F8MA 1FEHA 4DB3A 1XR5A 2X1BA 4M1KA 2D9OA 2M7SA 3ULEA 4BRDA 1UVJA 4Y3CA 4FZVA 2IM1A 4ZA1A 2HHPA 3CCJN 4GVEA 1JLAA 2CVIA 1B0VA 1IBKF 1J5EJ 4H0YB 3FQLA 1T6CA 5E3CA 1YG0A 4DL4A 2GJIA 5BYRA 1B9DA 3KK3B 5HN0A 1YLXA 2NSCA 1HKBA 1JJ4A 4IFEA 1VSEA 3ZETA 4ISFA 3FE1A 2XO6A 1KEKA 2DNQA 1EIYB 3PX0A 2YX7A 1WEZA 2R7UA 2AKWB 5KFXA 2ZH1A 1TELA 3C95A 1T05B 5MLCQ 5ETOA 1TL7B 5CHIA 2XG8A 2E2NA 3KLIA 3H3OB 1VQYA 2RILA 1V4SA 5AXLA 2AP1A 5GMKa 4KGZB 1RHJB 1I51B 2D1CA 3HL8A 2WOMA 4KSEB 2GVDA 2MB0B 3S1TA 4ES3A 3QSIA 3CCSS 3AVGA 1CZBA 3MXMA 4CJ5A 1WTBA 1U6BA 3KLGA 2PE8A 4J90A 4FF2A 4CJTA 4DI6A 2BKNA 3VZHA 5H9EJ 1F21A 3AVBA 1KQGB 4MIBA 1NSAA 1DLOA 5DG9A 4ILGB 1JLQA 1O5JA 1WHYA 1K1QA 1KLMA 3EJMA 4KYZA 1ATNA 2FTRA 2F8HA 1JL2A 2W25A 3TAMB 3D3CJ 2R7QA 1RLDA 3QT5A 1SQKA 1HX1A 2QFIA 3BZQA 4ZLNA 4JI6K 3K57A 1NMDA 2MTLA 2HFSA 4GV9A 4B1VA 5B0DA 1QDUB 4DUYF 4V1Ak 1IG8A 3VQSA 2IVNA 4Y28C 3R3LA 2P9KB 2IYGA 2G1DA 3SPYA 3UCGA 2Z8QA 2UVWA 1FESA 2DISA 4WKYA 3D2WA 3GIKA 2R7RA 2HLUA 4NA3A 4XPCA 3SBGA 4J9SA 1F5BA 2X6SA 4KB0A 3HFZB 4IEEA 2KFYA 2FY8A 5LY3A 2W2OP 3CJAA 3ZSWA 2AD9A 4H4KA 3X3UA 4FJ5A 4GNIA 2P9LA 1R8CA 4LBHA 2IRXA 4ZP7A 3PV8A 2HQFA 2VQFK 1EARA 1Z25A 3GBTA 5IV3A 1FK9B 4R8UA 4I0WA 2MZQA 1H38A 4CGIA 4JKEA 3UW1A 3WXJA 2OP5A 4P73A 3E1YA 2D0BA 3Q8PB 3LO3A 1RKIA 4RW7B 5FPEA 2AA4A 5E26A 3ILJA 3KK2B 2M9KA 2FF6A 3CCLN 2LQ9A 4WK3A 1GXLA 3CMQA 4OMFG 4B3OB 4B9NA 2N4DA 1CSJA 4M94A 3VQDA 3B8HA 5DDQC 2C1EB 2F1FA 4JHDA 2YWKA 2RU9A 2IS3A 1U48A 2AHOB 4MKAA 1PYOB 1IBMJ 3GILA 1M1KT 3UN5A 2ZQBA 3M05A 2H48B 2VBXA 2RE2A 3CE8A 1TVRB 4B3MK 4CF8A 3QETA 3S41A 2Y9HA 3NNHA 3B4DA 1WJ9A 3DRRB 1BQXA 5F8NA 4MLHA 4Q0BB 3KG0A 1J5OB 1ZPWX 4LRFA 2N7YA 3SI8A 5LMNK 4D3GA 2QWOA 3EVOA 4O8UA 1QAJA 3FRZA 1UVNA 3KJQB 3U1LA 3R8EA 3NS6A 3V9XA 1VRUA 1OH8A 3ENBA 2YQ1A 4DDFA 3K5PA 2B7BB 2JC1A 2YHWA 4FWQA 1VYAA 4CZGA 1N48A 2HF4A 3RYLA 2YBVA 4TNOA 4EP4A 3R9PA 3BZKA 5CABA 1JLCB 4PQUB 1U1RA 3O5TB 2XGPA 1U04A 1V6HA 2YKAA 3S8SA 1FRLA 4ANCA 4JK7A 3CG7A 2O67A 4YEAA 3FZ2A 3U02A 3MECA 3LTOA 4UF4A 4LH5A 1NPRA 4JI1F 1U1KA 3I5BA 5KFFA 1XQIA 2VWKA 3VF4A 1PYTA 3R3TA 3QAEA 3PX6A 5HO4A 4I7FA 2O8FB 1KVBA 2HNZA 3DJCA 5KT2A 1SUQA 2J6TA 5HROB 4FJ8A 4H4KC 5C42A 2GJ2A 4F2RA 4G6VB 2NR0A 4O3OA 1W97L 2J76E 3IWLA 1S6PB 4BRFA 8AT1B 1HBUA 4AM6A 4NLTA 2ZOGA 3C6HA 4PKGA 4FPBA 4ID5B 3ZLJA 2OELA 4B3SF 2GIQA 2BYCA 2QA4N 2AZ3A 4KRWA 4WF9Q 4M3ZA 1BG3A 3C46A 4KHWA 2XZWA 1CJUA 2VPYB 3C6UB 2E5LF 1H74A 2VD3A 3FVYA 2OSQA 4Y0WA 1ZTTA 2FVRA 1NHKL 3GG0A 1NNEA 3PHEA 3MMVA 5E3RA 4NCGB 1M5KC 2YKPA 2Z57B 3PM9A 5HI7A 3PRBA 4MKVA 3OHRA 1CZ9A 1NK9A 2QWPA 2ACYA 5ETTA 1NEEA 2JEFA 5AQFA 3AO4A 3MD1A 4E7HA 1LKZA 4YOUA 3K59A 3VTIA 5FLXY 3KHGA 3OPKA 1EJ7L 4DUZF 4J9MA 3ZTOA 3TQ1A 4AL6A 2PDAA 1CJTA 2Y1RI 2LMIA 2OMOA 3LDOA 2XCAA 4QWDA 2K1RB 3OT9A 3FZKA 1X4DA 5KFJA 2VYPA 5E3QA 3RAXA 1S9EA 2E1RA 4DCJB 1GLLO 2IJFA 3ZT1A 1CS4B 4WFAL 4PKIA 1RT1B 1M1GA 1F60B 4DR7K 3I8DA 4ECUA 1A5VA 2XMKA 5CA5A 2GAHC 3UI3A 3CTRA 5GAHP 4QCLA 4P74A 4KV8A 2G8UA 4IRCA 4GC7A 1JLBA 3OYAA 3QINA 3ISZA 4ES2A 4JKBA 2LU2A 3VTHA 2CJXB 3UD4P 3IN5A 5AQJA 4CJ4A 3SCLE 2OPPB 1WHXA 2Z0GA 1SL1A 3GIIA 3QNOA 3DYAB 2NRVA 4ZCMA 2BJ3A 3Q2TC 4I6WA 3I82A 1HYZA 5T7BA 2XMWA 2E2OA 2HIYA 1VSLA 2RQMA 3VHQA 1LWCA 1E4GT 3KXDA 1MWMA 2B51A 2A3ZA 1D9FA 4EO6A 1HBMA 3G8TA 4EI2A 3N9UC 3A5OC 4K25A 4OHZA 4YHHK 2BJEA 3JYTB 3NDKA 4J9KA 4M3XA 1VQ8S 3FCWA 4RNNA 1MMLA 4MYUA 1S76D 4CIGA 3DXMA 1PSDA 4F36A 4GKJK 3NF7A 3O8MA 5A6PA 3VENA 5HRPA 1Y0HA 4CWBA 2YHXA 4L72B 2KU7A 3OVNA 2J7KA 1KWMA 2VQFJ 3FKBA 3GYGA 3B78A 3OXGA 1FJCA 3CMAN 1T3OA 1ZS6A 6AT1B 3U6FA 2YHAA 4YNQA 3DWLA 2JWNA 2C22A 3NEKA 3L95X 5LOQA 3OL8A 4FKYA 1MA9B 1RT6A 2MGZB 1C1CB 2DHAA 3FLCO 3L2UA 4DV6F 4ZJOA 2V2VA 3P8BB 1REVA 3HHNB 1HW9A 1F2HA 2FDNA 4ZVQB 2FBVA 3IM8A 2V69A 4CGHA 1RZMA 2ZH8A 2DNHA 4NLDA 4YDXA 4OYMA 5DDRC 3W8GA 2H1YA 3MURP 4DQSA 1JLEB 3AXMA 3W60A 1NLVA 1VFJA 3J80U 3I5CA 2ZJQQ 3NGZA 1TU0B 4LBIA 3PO5A 2CG8A 2FLNA 1NOYA 2AEFA 2P9UB 4EBCA 2VG7B 2YQ3A 3QZ7A 3G9CA 5LJVA 4LFBF 3B4MA 4IDKB 1K6YA 1F6TA 1VBZA 2O66A 4B3MJ 2B8PA 2RJZA 3A3NB 1ZXOA 2ZUAA 3Q89A 3V9SA 4QWCA 5LSLA 3CDAA 2CJ9A 4KGMA 4I68A 2BUNA 1C0MA 3AOAA 2N82B 3FGVA 2YWWA 2EC2A 1RTIB 2M88A 4OX9F 1TQLA 3J7A1 3M1FA 3BH7B 4BGAA 1RGVA 3NH2A 4WFZA 4EWTA 2V4QA 4Y65A 2VOPA 1QQCA 2KXNB 4Q7AA 4EU0A 4H0OA 3CXCR 4E1JA 4ZIVA 2KT2A 2KXFA 2M52A 3GJSB 1ZH5A 2O4GA 4DV7K 3UVJB 4ZIWA 4FBTA 2Q1LA 4CGFA 2VICA 1Z1ZA 1ILYA 7AT1B 4V19J 3C6TA 1N8RT 5A0YA 2FJDB 2AJ4A 3H40A 4KKOB 4WQ4A 5ETMA 1C0UB 1VQ6N 4RJVA 1RAOA 3OXFA 2JJ4D 4XEIA 3Q7CA 2YKNB 1S10A 4CRJA 1HQEB 3CQYA 1R8HA 1E6YB 1U6FA 1UEKA 1VQLN 5LL6d 3IS9A 3SV3A 3O4WA 2DR7A 3L3UA 4USHA 2MY8A 2K06A 4ETXA 1XHZA 1RCOB 2VF3A 3VQEA 3OYFA 3M8RA 1T3NA 1PCAA 1NDCA 3TARA 5HJXA 2DRAA 4TSXA 3QO9B 1LWEA 1HJOA 4BC7A 5A8RA 3DOKA 3FJ2A 3VQBA 1UPMB 1OH7A 5IQ6A 4JKFA 2MEWA 4FVMA 2QSWA 5DJBA 1S77D 4DL5A 4OI2A 5GADI 1WG4A 2EG2A 2DPNA 1ZAWA 2RT3A 1AROP 2RVJA 2GTDA 3G6VA 1APSA 2ZBPA 1P6TA 1HNXJ 1TKDA 2GV1A 4ZMMA 3L8BA 1WACA 2OZMA 1Y11A 3GYXB 3LP1A 3WNGA 4CGJA 3US5A 1YRTA 2Y1JA 3BY5A 4H0PA 1LW0B 1S9GA 4U7UD 4B9LA 4PHTX 1FWPA