1JLFA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 133
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlfA05
1XWLA 5EWGA 3ICLA 5FDLA 4K50A 3LP1B 3PY8A 5FRMA 2PY5A 3HPOA 3DM2B 1T8EA 3RWUA 4KHWA 3OS0A 4L8RB 4DU4A 1J5OA 1KFDA 4Y34A 5EWEA 1JLFA 3PW4A 2P5GA 5J2MB 1TL3A 1HYSB 4Q45A 2FLPA 4AHCA 1D1UA 3OYFA 4ZTFA 2R2RA 1T7PA 1YVFA 3M8SA 5DG7A 2HB5A 1VRTB 2HNZA 2F8EX 2HHSA 3HSTB 3LWMA 3DDKA 3OL7A 3V9XA 2W9CB 1SKRA 3MECA 1JLGA 4B8AB 2KZMA 2F96A 1TL1A 1R0AA 2IGIA 4OGEA 4ZHRA 3F73A 4DQRA 4B9TA 3I0SA 2R2UA 3V1RA 3SUNA 4HCBA 3JYTA 2WTFA 3NDKA 4W5TA 4E1MA 1RILA 1UWBB 1YTAA 3KLGA 3SUPA 3Q8RB 5CYQA 2BRKA 2OPQB 2BDPA 3NF7A 2YNIB 2VG5B 3PR4A 4J2EA 1RAJA 1GOAA 4ED1A 3DI6B 3CJ0A 1N48A 4KO0A 3ZSZA 4ECWA 3LP0A 3S9HA 1JLQB 2ITGA 4NLYA 1JLQA 5KT5A 3LWLA 3L3UA 3MR2A 2HAIA 4K4YA 3AVKA 5KI6A 5C42B 5C24B 1QQCA 1JLBB 3AO3A 5DQHA 3BDPA 2FBYA 4H4OB 3KHHA 2PYLA 1RA7A 1I6JA 4F50A 1MMLA 4J9RA 3MR3A 3L2UA 4N56A 1RT1B 3H5XA 4NRUA 2VA2A 1A5XA 2JGUA 1WN7A 2ZE2B 4XO0A 3QGGA 2WK4A 1SKSA 5KG5A 1J9AA 4G3IA 4ECSA 2FLLA 3U3YA 3QNNA 2R7YA 4M42A 1KVBA 5L1KA 2A1RA 2KZZA 1RBRA 3LALA 4ELVA 2ZD1B 2R8GA 3FFIA 3HO1A 1RT3B 5J2NB 3SI6A 1RT7A 5JUMA 4E7HA 4KB7A 1RDRA 1TVRA 2PZSA 4IR1A 5C42A 4RNNA 1IKYA 4U6PA 4EBCA 4RUAA 2XHBA 4BDYA 4DTMA 4C8OA 4LSLB 1EETA 3V6KA 4ECUA 3H40A 4YR2A 2G8FA 1JL1A 3G6XA 4B08A 3LP0B 1XHZA 3K57A 3KK3A 2YKNA 3MEGA 1YVUA 3VQAA 3TR8A 5JS2A 3OSNA 4ECXA 4DQQA 4CF8A 3KK2B 4FLTA 3AO2A 2OPRA 4CJEA 3OJUA 3OYIA 3RB3A 1ZTTA 4OGCA 5K14A 3M9NB 3GIMA 3C6TB 4KBIA 4DFPA 3SPYA 5T14A 2HHUA 4MH8A 4OKJA 4KKOB 4ED3A 3AVBA 5JXSA 5KFAA 3BQ2A 3DRPB 3SQ2A 5E41A 1JLAA 4ZPBA 2FBXA 3PZPA 1LWCB 3NF9A 4DSIA 3M8PB 4MK8A 2C2EA 4O3PA 1WSGA 1RTJA 5KGXA 1REVB 2W9BB 2BQRA 3OYDA 5I3UA 2P1JA 3BR9A 4CEOA 2XI3A 4ZVFA 1XR6A 4MIAA 1TK0A 4FJMA 1S1WB 4I7FA 4ED6A 5HRNA 4M94A 4DFKA 1J53A 3QIDA 3H59A 2DFEA 4KAIA 1S1XA 1TGOA 3QEWA 4IR9A 2HMIA 4FM0A 1RT1A 1SV5A 5DLFA 4KKOA 4FLUA 4N47A 4CIGA 3QLHA 4DTRA 1RTDB 1KVCA 1RTDA 4C8KA 4FM1A 3OYJA 3MFHA 4H54A 1JLEA 3SFUA 3M9OB 2E6MA 4I9LA 1WSHA 1TK5A 1RT7B 4B9SA 3RR8A 3V4IA 4R0EA 3LP3A 1UWBA 3N6LA 1U4BA 1TKDA 1VSKA 3NGYA 1JKHB 4CHPA 2WOMA 2VG5A 5KGWA 1NK6A 5HBMA 3VQ9A 2YNGA 3BREA 4LSLA 4ECQA 3ZSXA 3NHGA 3DOLB 4PQUA 4FVMA 2IJNA 4IFYA 1J54A 2X78A 1WSFA 2ZQBA 4AHTA 2I1RA 4O4RA 1REVA 1LV5A 3TAPA 4FBUA 2IS3A 2E9ZA 1C1CB 1QAIA 1JLGB 3NAHA 4Z4EA 4FLVA 2BR0A 2YHAA 4O5BA 3UIQA 4F3OA 4XPCA 1SUQB 1YTUA 1KFSA 3TAGA 2IM0A 4QOZB 4OPKA 5J2MA 4ECTA 4NRTA 4CF1A 4IH7A 1NK0A 4QCLA 3ZCMA 3PJXA 2XY8A 3MXIA 3P5JA 3DI6A 1GX6A 5F9NA 5DQGA 4FJ5A 3O4NA 3QLHB 2IOCA 3H08A 4OPJA 1IKWB 1IKWA 1T03A 3VQ8A 5HLFA 3OYBA 1DTQB 5KFJA 2WB4A 4MFBA 4FZXC 3RAXA 4K4UA 5F8MA 1JLCA 3Q8PB 4CJTA 3DLGB 3MEEB 1S1TB 4HYKA 2C2DA 4K4ZA 4CJSA 1TL1B 4M3UA 3V6DB 3DLEA 3U3GA 3TANA 4CK3A 1ZBHA 3HVAA 4WE1A 3VQEA 4YNQA 5DK5A 3KLGB 3T5JA 4KHNA 5F8LA 4RU9A 3GYNA 1W9HA 4M3WA 1MU2B 2GC8A 3RMAA 3VQ4A 3DLRA 4RW4A 4CHZA 4AHRA 1SKWA 2R2SA 4FK4A 3ITHA 2W8LA 5DGAA 3SJJA 1B9DA 3QIPB 3TI0A 4UQGA 4KI6A 4K8ZA 2HNZB 4WXWA 2FJVA 4H4OA 1KTQA 2JEIA 3AVLA 4CIEA 1RNHA 4EYIB 2AJQA 2VG6B 3HVWA 2FVPA 5DQIA 2ASLA 1SV5B 4ED0A 2BRLA 3CO9A 4O44B 2BANA 5KFQA 2D5RA 2OPPA 4KTQA 3V1OA 1U49A 4CERA 3ALYA 4Q5VA 3D28A 3OLBA 4ECYA 3EZUA 3PW2A 5CZ1A 2UVRA 1BQMB 4ZPAA 1QHTA 2YNIA 3JSMB 1UOCA 3KD1E 5EUHA 4J9LA 1L3VA 3PW0A 2EHGA 3L8BA 1S97A 1LAWA 3E01B 4DF4A 3E01A 1HNVA 4KAZA 1WNEA 4QPXA 1BCOA 1L3TA 3CDEA 4ELTA 1EETB 4I2QB 1N5YB 3SYZA 4M3XA 1ZTWA 4FW2A 5KRSA 3V81A 3VA3A 5KFCA 5KFHA 2CJQA 2HHTA 2DPJA 1JLCB 1FK9A 3CG7A 1D9DA 4B8CA 3UR0A 1BI4A 4EYHB 3DLGA 3MEEA 4E7KA 3L2WA 4AHVA 4DMNA 2VWJA 4KB0A 3HKWA 5CY4A 3DYAA 2E9RX 3TABA 3MEDB 4JRQA 1NHVA 3RMCA 3VQCA 2RKIB 4MQ3A 1SH3A 4ED8A 3QGHA 4CIFA 4QWBA 3K5OA 5F8IA 3VQ5A 1DLOB 2F8SA 2HWHA 2J6TA 1RT6B 4B9MA 2YHBA 3JYTB 4B9UA 1HMVB 1K1SA 2YV0X 1A5WA 5FDLB 3K5LA 4CEQA 2YKMA 1HYZA 1TAUA 4W5NA 3GIJA 1C1BA 1TVRB 5KFPA 3QZ7A 3RB4A 4URGA 2YNFB 3G6VA 4LQ3A 4DTOA 2W9BA 3K58A 4I2PB 4KI4A 4DG1A 3VQPA 3CDWA 3OYEA 3SZ2A 4DLEA 4AHSA 4W5OA 3H5UA 2W9AA 1A5VA 4CHQA 3DMJA 5KFRA 4IDKA 3HYFA 2AGQA 3NGDA 4BDPA 3OS1A 3V9SA 1S1WA 5F9LA 4CGDA 3RMDA 3LPTA 5KG1A 1S6PB 1X1PA 4J2AA 4Q8FA 5DMRA 4JV2A 1VSLA 4E7LA 5SZTA 3T5KA 2RF2B 2GUIA 3KLFB 4O3QA 1RDCA 2HNYB 4RNFA 1D0EA 3RBDA 5C25A 1T3NA 2XY7A 3AVAA 1W0HA 4J9NA 3FSIA 1JLAB 1RT5B 3QIOA 1Z26A 4OVLA 2KW4A 1SH2A 4KTWA 4YR0A 3EPGA 3PX4A 1K1QA 4K4XA 1IKVB 4NLWA 1RT2A 1WLJA 3EY1A 5D3GA 3G10A 3ZSOA 4YMEA 3KIOA 5T7BA 5HLFB 5HRPA 1I3AA 4RW4B 2J6UA 4TYBA 2YNFA 3HVRA 5J2NA 4X2BA 1RTIB 1KHVA 1LWFB 3NAIA 2DFHA 3SPZA 3ISND 5L1LA 3OHAA 3KLEB 4XIUA 1WAJA 4E19A 1ASUA 4PA1A 3QERA 2RKIA 3MECB 4ID5B 3NL0A 1LW0B 4OLBA 4TSXA 2XRIA 4O44A 2RDJA 1LAVA 4WXOA 1XC9A 2P5OA 5J1EA 2VA3A 1IM4A 4ED2A 4U7CA 4YFUA 3CIZA 4NLVA 1TKZA 1L5UA 4FBTA 4DQPA 2AU0A 1HYSA 3FRZA 4K4TA 3QGIA 1TQLA 2HHWA 3BJYA 3KJVB 4IRCA 4Q0BB 3PW5A 3QIPA 1EXQA 3AVMA 2BQUA 3FQLA 4DSLA 3IN5A 4Z0UA 3LAKA 3L2VA 5KFSA 3Q8QB 2ASDA 2QV6A 4CF9A 1TK8A 4KSEB 5I3UB 3E51A 2B5JB 3IG1B 1NK7A 2A1SA 3I0RB 3KD5E 1QTMA 4QWCA 3AO5A 2BQ3A 5F8HA 4CEDA 3NCIA 4NLTA 3RAQA 1S1XB 3BGRA 1GOBA 5I42B 3KLEA 3PV8A 3LZIA 1S9GA 1X9MA 4IH5A 4MK7A 2RPIA 5HRRA 1HNVB 2ASJA 3KK2A 1QSYA 2C2RA 1CXQA 1FKOB 2PYJA 4EEYA 1J5OB 1X9WA 2QXFA 4NLQA 4IG3A 3DLHA 1KCFA 4CJ5A 4CESA 4EZ9A 4NLDA 1X9SA 1S1VA 2HHQA 3DYAB 1ZBUA 1EP4B 3ZT1A 1B92A 4BWMA 3DRPA 1RDBA 1Q9XA 4G1QB 2ATLA 4G1QA 3MTKA 1NKCA 1S1TA 2VG6A 3NH2A 3H98A 1BIUA 3P83D 1T94A 1ZBFA 4CGJA 4KO0B 3G6YA 4OL8A 3HPGA 3ZSWA 1NK9A 4CECA 4DWIA 1FXXA 4TQRA 4CJUA 3KK1B 3QINA 5KRTA 1C1CA 4ID5A 4WFXA 1HQUA 1LW2B 5KT3A 5HP1A 3CFOA 2BE2A 1F21A 1S0NA 4H4MA 4OLAA 4HUGA 1C0UB 4NCAA 1GX5A 1CLQA 4BDZA 4NZ0A 2X74A 3ZSYA 3CDUA 5L9XA 4HUEA 2D3ZA 2DTUA 4LSNB 4CJLA 2D41A 3KJVA 1RT4B 3M9MB 1HRHA 2E4LA 1WSEA 5KG7A 3IS9A 1S0OA 4DL6A 4ZTJA 1Y97A 5KT2A 3RB0A 4FXDA 3PVXA 4ZVEA 1TV6B 3GIKA 4DTJA 1XR7A 4F2RA 2IM2A 1DTTA 1N6QB 4URQU 5F8GA 4DFMA 3DOLA 1S6QB 3AO4A 3C6UA 4F4KA 4NCGA 3DLEB 2IAJB 3DRRB 1TKXA 1RBUA 5KFUA 1U09A 3T19A 3T5HA 3BSAA 4B3OB 4CFBA 4Y2AA 4FYDA 2B6AA 5C25B 3EPIA 4CJKA 4QWDA 4CHYA 4DTNA 4J9QA 5KFIA 2RN2A 3KHGA 4DTUA 3VQQA 4E3SA 2EC0A 2R8KA 4IH6A 3SI8A 2D0CA 4M3ZA 1HQUB 3PUFA 1BGXT 3V6JA 3AVNA 4DLGA 4M41A 4ZHRB 1IKXA 4DL2A 4IDKB 1D9FA 1G15A 4KE5A 4I2QA 3OYGA 2DPIA 1HNIA 4CJPA 1NOZA 3V4IB 3GQCA 3LDSA 1RCHA 4F4ZA 3OJSA 2AX0A 1RT4A 1RTIA 5KG3A 1YT3A 3AVGA 2YNHB 4PWDA 4BWJA 1HQEB 3RR7A 1OS5A 2IC3A 4HTUA 4PQUB 4ZP8A 1RBVA 2HNYA 3KLIB 2WOMB 1BIZA 4C8MA 4GC7A 4BE2A 3CJ3A 4RNMA 2YKNB 4F4YA 1VRUB 1Q9YA 4QAGA 1QS4A 5KFTA 4QW8A 2IAJA 4N41A 1ASWA 3MR5A 1NOYA 4O0JA 4NYZA 4Y3CA 2OZMA 4FCYA 3DOKB 2J6SA 4NYFA 3C6TA 5KFFA 4NLSA 3BGRB 4DSFA 2KQ2A 4JUZA 1KLNA 3IRXA 1S1UB 4F2SA 2X6SA 3NBPA 4IRDA 2FVQA 4AHUA 1IKXB 2EX3A 4CEFA 2Z1HA 3GILA 5KFXA 4Z4FA 1GOCA 5KT4A 3I0RA 3DLBA 2D0BA 3LP2B 1C0TB 4CF0A 1K6YA 3SQ4A 3OLAA 1C6VA 2FVCA 4TY8B 3AA5X 2D0AA 4ZPCA 3S3OA 1VSMA 4CJ4A 4IOBA 2BE2B 1NJWA 2GIRA 1S4FA 1IKYB 3IGNA 5DG8A 4DL3A 1VK0A 1NKEA 2OA8A 1KRPA 4RW9B 2XGPA 2IJFA 4OKKA 4HVJA 4OKEA 4CGHA 2ALZA 4FZZA 4YQWA 5D3GB 4NLXA 5CYMB 3A2FA 3ASMA 4DFJA 1LWEA 4Z4GA 1JIHA 4BACA 2FVSA 4URSA 1RBTA 4ZPDA 2IDOA 4TLRA 1Z25A 3S3NA 4JLHA 3QETA 1SH0A 5KFNA 4ZVHA 4RW6A 3B6OA 1TL3B 2XY5A 1KLMB 3DLKB 1I39A 1LWFA 4FK2A 4Y2CA 4J2BA 4DQIA 3NH1A 3H4BA 3KMSA 3MEDA 1CZ9A 3QO9A 4DSJA 1NJYA 4MIBA 2YNGB 3LPUA 2VWKA 2IC3B 3SQ1A 3AVJA 4FS1A 3ZSQA 3QEIA 1C2PA 4DL4A 4DEZA 3THVA 1CZBA 4FJHA 1S9GB 1LW0A 4AH9A 5KFDA 4J9SA 1O1WA 3QYYA 4LH5A 3H5SA 3KKRA 1LW2A 4DTPA 3KLHB 1S5JA 2I5JB 2HW3A 5J2QA 3AA2A 1VSIA 3O3HA 4B9LA 1JLEB 1IG9A 4WE1B 3T3FA 1HPZB 2KFNA 5KG0A 1HYVA 3O3GA 1KLMA 4R8UA 3TAEA 4Z4IA 4IBNA 4PY5A 4K4VA 1DLOA 3LZJA 4LD0A 4CF2A 2W7OA 4CGIA 4O3RA 4R5PB 3NAEA 4Q0BA 3NBPB 5KFYA 2WONB 1NJXA 1SL0A 2IA6A 4E7JA 2QK9A 3KLIA 4I9QA 2ILZA 4ZP9A 3T1AA 1T05A 4CGFA 2R8JA 5CZ2A 4ICLA 3SQ0A 4NLPA 4TQSA 2XCPA 2O4GA 3AVCA 1C0MA 2OYQA 3K5MA 3OHBA 5C24A 3OYHA 4CK2A 4FJ8A 1FK9B 1RYRA 2JEFA 3TAMA 3KHLA 3NH0A 2HWIA 3DRSB 1N56A 2E6LA 3AVHA 1U04A 4CHNA 3C95A 3GV5B 1UAXA 4LH4A 2OPQA 4EP5A 4CE9A 3AV9A 4WYLA 1S0MA 4RW8A 4H4MB 3VQSA 3IGVA 1QE1A 1S49A 4QWAA 3CQ8A 4DG1B 4I2PA 1JLFB 3SNNA 4ECVA 4DS4A 4KV8B 3CVKA 1S48A 5KFZA 4B9VA 3OSPA 4DQSA 1QUVA 1JKHA 3O4QA 5KFWA 3OL6A 1IKVA 3MF5A 2JEGA 5J2PA 1JX4A 4ZMMA 4CJFA 4F3TA 1S9EB 1S6QA 1ZETA 5KTQA 3AA4A 1RTHB 2FBVA 2KTQA 2XO7A 4MFBB 4TN2A 3ISNC 4ICLB 4NCBA 1JXLA 4CK1A 3M8RA 1WAFA 5L1IA 2OPSB 5KFBA 3KLFA 3MAQA 2Z1JA 3DM2A 3SV4A 3MFIA 3CM6A 4KHYA 4ZP6A 4WZQA 2B43A 4RG8A 2ATQA 2IM3A 1KSPA 4JV1A 1TKTB 5I42A 4Y1CA 4DL7A 4H8KA 5DGBA 2UVWA 5C5JA 2HNDA 3I5CA 4GVMA 1MU2A 1NK4A 1N5YA 3EYZA 3QZ8A 1NKBA 3OVNA 3I5BA 4F4WA 4EZ6A 2AQ4A 4FJNA 2NUBA 4RZRA 5KFLA 1RTJB 3F9KA 4AILC 1JLBA 2V0NA 4NLGA 4EP4A 2ZD1A 1QSSA 3LAMA 3HT3A 4FJXA 4O4GB 1U47A 3P1GA 4O55A 5FROA 1S10A 1VRTA 3V6DA 4KFBB 5KG6A 1SL2A 3OYCA 3OYKA 1JXBA 1HJRA 3QO9B 4J2DA 1XR5A 4YR3A 2XY6A 3JSMA 3KTQA 3DRSA 2GIQA 1VSEA 2W8KA 5SWMA 4QWEA 2B6AB 3V9ZA 2UUWA 2D7SA 3LP1A 3KK3B 4EBEA 4TY9A 1S9FA 3MXMA 3HJFA 5CYMA 4HHTA 3HVTB 5HRSA 3H4DA 3SUOA 1LWEB 1VSDA 3KOAA 4ZP7A 2FC0A 4ED7A 3H2LA 1UA1A 3VN5A 4FJGA 1HNIB 4KV8A 3ZT4A 1BHLA 1JXEA 2FBTA 5CYQB 2Z1GA 1BQNA 4IKFA 3PHEA 3AVFA 3TAFA 4CEBA 3MR6A 3BSNA 2V4RA 4WZMA 4TY8A 4CFDA 4XPEA 3V9WA 1RYSA 5KFEA 3OL9A 3TQ1A 3FQKA 4YP3A 4QW9A 3QEXA 3N6MA 5HP1B 5KG4A 4NLOA 3DRRA 4M95A 4CJ3A 3VQBA 3PX6A 1IH7A 3V1QA 3IRXB 5K14B 3HK2A 4O0IA 3VA0A 1HARA 3M8QB 3M8QA 1L3SA 3PX0A 4Z4CA 4FW1A 4CGGA 4CCHA 4R5PA 4JS4A 3IS9B 1T03B 1CSJA 2X6NA 2WONA 2OZSA 2JC0A 3V81B 1DTQA 4GC6A 4FJLA 4IG3B 4IRKA 4O4GA 1TKXB 1C0TA 3BSOA 3OYNA 3PJWA 4EBDA 1DTTB 1N6QA 3RRGA 1HQEA 5JS1A 3G0ZA 2YNHA 4PWDB 5DLGA 4BE0A 4KHRA 4NCGB 4RNOA 3QNOA 4I7FB 5J2QB 5EDWA 1BQMA 3N6NA 3DMJB 3I8DA 2G8WA 3I5AA 3L3VA 5KFMA 3OY9A 4Q43A 2HVIA 3ULDA 3KK1A 3AVIA 4C8LA 3QESA 4KHUA 4IFVA 1TKTA 4J9MA 4IFVB 2AGOA 1ZYQA 2P51A 2AWZA 5KFGA 4IG0A 4RW7A 3V6HA 4DSKA 4JRPA 3TAQA 4Z4HA 3VQ6A 1RT6A 2V9WA 4FLXA 2XGQA 3OS2A 2KFZA 2C22A 5KT7A 1QAJA 3CWJA 1VSJA 1C1BB 3RBEA 2OPRB 3PW7A 4J9OA 4WFZA 3KLVA 3HL8A 1KHWA 1BISA 4CEAA 2CKWA 3Q8SB 1RDAA 4M3YA 2G8VA 2XI2A 2WRMA 3KMQA 1TAQA 1D5AA 1S1UA 4ECRA 1ZBIA 2F8TA 3OYLA 4GMJB 3BQ0A 3C6UB 3HP9A 2IM1A 3LANA 1UA0A 4ECZA 3OYAA 1N4LA 1CXUA 4K4SA 4F4XA 4NYNA 3NKYA 3K2PA 4E89A 3D5MA 1RBSA 1JL2A 2FLNA 2OH2A 4BE1A 2HMIB 5DG9A 3NF8A 3SUQA 3ZSVA 1Q8IA 4CJQA 4HKQA 4O3SA 4J9PA 4FLWA 4R8UB 4DSEA 2DY4A 4KHSA 2V4QA 2GV9A 4TXSA 1XHXA 4HCCA 4LY7A 4O3NA 5KFVA 2O5DA 3NE6A 1RT2B 4Y1DA 1WSIA 2R8IA 2E9TA 3TWHA 4DTSA 5FRNA 4RW6B 3NGIA 4DU1A 3ZSRA 4E1NA 3DLKA 3K5NA 3RRHA 4KPYA 2R8HA 2FJWA 4KHQA 2WHOA 3O3FA 3V9UA 2HHXA 3OL8A 1VSHA 4CJWA 2XCAA 1RA6A 2AGPA 4J9KA 3BSCA 2JEJA 5J2PB 3PO4A 2W7PA 3RMBA 4OJRA 4B9NA 4RW9A 1VRUA 2OPSA 4CEZA 5HROB 3ZT2A 1U48A 2B4JA 1NJZA 4DTXA 3GIIA 4C8NA 3IAYA 3L2RA 3T5LA 2O4IA 3MEGB 3CYMA 3WNEA 1ITGA 4HUFA 4DF8A 5J1EB 1WSJA 3ITHB 1L3UA 4CJVA 2WCXA 2I5JA 4NLUA 1TKZB 1EX4A 3I0SB 1Z4UA 4ELUA 3UDLA 2ZE2A 1BQNB 3HXMA 4EO6A 3H5YA 1NHUA 2IBKA 3M8PA 3AO1A 1LWCA 3HHKA 4GW6A 4Q8EA 2D3UA 1B9FA 3CM5A 4O3OA 2HNDB 2Z1IA 4FJ7A 4PUOB 3CJ5A 3FFIB 4MKBA 4DL5A 3KNAA 4K8XA 4EO8A 4IKAA 3K59A 3RTVA 4KHMA 2C28A 2VG7A 1KVAA 2B5JA 3IG1A 4N76A 1T05B 3CFRA 2DFFA 4N5SA 5F8JA 1TP7A 3GV7B 3WNGA 2RF2A 4W5QA 2G8UA 3NGZA 4B3OA 4TYAA 4KFBA 3RB6A 1FKPB 3CFPA 2BGGA 3C94A 2ZKUA 1D8YA 2QE5A 5KFKA 1XI1A 1SL1A 3HP6A 2W42A 4Q44A 2G8KA 2AX1A 2UVUA 3ZT3A 3VQDA 1HPZA 3GV8B 1RT5A 4CJRA 3WNHA 3HVTA 1BCMA 4E0DA 4JS5A 2IMWP 4FLZA 2ETJA 3VQ7A 3UPFA 4FLYA 4FJJA 3U6FA 1TV6A 4CHOA 5L1JA 4ID1A 3NFAA 1RT3A 4WYWA 2XC9A 3NMAA 1FKOA 1NK5A 2LSNA 4RW8B 3WNFA 3PO5A 2FVRA 1S1VB 4LSNA 2GBZA 2FJXA 4DS5A 4F8RA 4NLRA 3FDSA 1IO2A 5HBMB 2QKKA 2Y1JA 2Y1IA 4ZVGA 5KT6A 2R2TA 3EZ5A 4FJ9A 3CJ2A 4RUCA 3AA3A 2BANB 2HHVA 3TAMB 3HPHA 4MK9A 1C1AA 1ASVA 1BL3A 3KKSA 4WFYA 5HROA 1NNDA 3KLHA 1RTHA 1R0AB 4M3RA 1NK8A 4JV0A 4E7IA 3PR5B 4KTZA 4FZYA 1SUQA 1HMVA 3DOKA 1QSLA 4FS2A 4KRFA 2YKMB 4M3TA 5KG2A 3B6PA 1FKPA 3QEPA 4FJIA 1EP4A 2ILYA 1QE1B 4DU3A 2Q3SA 2UUTA 3G86A 3MXJA 4FK0A 2QKBA 4K4WA 3TVKA 5EU7A 5F8NA 4IFYB 2JLEA 5EWFA 4KREA 1RDDA 3D45A 1WNSA 1S6PA 4RNHA 3UQSA 3NF6A 3CJ4A 4M45A 4PUOA 2UVVA 1BI4B 3KHRA 3LP2A 2VG7B 1S9EA 4CEEA 3TARA 2HVHA 3OYMA 3BQ1A 1ZBLA 2G8IA 4IG0B 4RW7B 4W5RA 4MKAA 3SFGA 4CFAA 2XWYA 4IQXA 3ZT0A 4FJKA 1C0UA 1U45A 3HM9A 3S3MA 2OPPB 2RDIA 4FM2A 3D0PA 4KB1A 3SV3A 1EKEA 4LQ9A 1VSFA 1W25A 2JC1A 2G8HA 3L2QA 2W9CA 3QEVA 4CFCA 5KFOA 3SCXA
chains in the Genus database with same CATH superfamily
5EWGA 2PMHA 2X1FA 1JCGA 3HPOA 1R8PA 5DDPC 4PG4A 4ILRA 2IJRA 2MKKA 2CUYA 1J5OA 2YY3A 1JLFA 3M3ZA 1AUSL 5J2MB 4DPWA 1FRLA 2R7XA 3JQMA 1BE4A 1D1UA 2ATCB 2CAJA 2DHSA 1HNWK 4M5LA 1T7PA 3HSGA 2HF3A 5A0YB 4JKFA 5M2PA 4F25A 3V9XA 1TYQA 2AJ0A 1SKRA 3ZTQA 2V2KA 3GL1A 1JLGA 2R7TA 2F96A 2ZF5O 3WXLA 2O8BB 2BMBA 3ZFVA 3CCLN 1NPKA 2M0GB 3QRQA 3SUNA 4HCBA 1MN7A 4E1MA 4JV5K 4FYVB 1WUUA 4LF8K 2OPQB 4LF1A 3NF7A 2HK2A 4ISFA 2GEMA 1LWXA 3LH2S 2RH3A 1GOAA 5DO2A 4ILLA 5AFUH 2RMLA 3ZSZA 2LEBA 3LP0A 2AYGA 3S9HA 4ZCKA 2AYBA 4AM6A 4JI5F 3LWLA 3GMGA 2OKQA 4NA3A 3AVKA 2AF6A 4KGMA 1TTHB 2MPUA 4M8LA 1HNXF 2OD6A 2PAVA 5AE3A 3CHWA 2OTJS 2PEHA 1RT1B 1NO8A 4NRUA 3AY9A 1A5XA 2I7PA 2ZE2B 3QGGA 3ZZZA 2WK4A 2D74B 5AJ3F 1J5EK 1P90A 1S7HA 3C65A 1PAUB 4P72A 4LBHA 2A3JA 4OYPA 3HULA 3D2FB 2MY7A 3LALA 1YJ9S 3KDOA 5GADU 2QMUB 5C42A 4RNNA 4RUAA 4C8OA 1XQSC 4LSLB 2HBQB 4ECUA 2QFJA 2W25A 4DR6J 1TL4A 2NRHA 1C4AA 1J5EF 5AJ3K 3G6XA 3UKUB 2L08A 5AXKA 1XHZA 1ZXOA 2J8SA 5CD4H 1FJGJ 3MEGA 3UNGC 3M1VB 3SDEB 3OSNA 3F9MA 1HNXK 2XMTA 3J81O 4FLTA 3CCJN 5GAHU 3RB3A 3GIMA 4KBIA 1UEVA 3DN9A 4OHZA 5FPMA 3R5AA 2F5GA 4OKJA 4A8XA 2RQKA 3AVBA 2E5HA 2FBXA 4XH4A 1KD1O 3PYFA 3KWIA 4O3PA 2ADCA 4JI3F 5KGXA 2BQRA 2OUGA 4B1WB 1S4EA 4LFBK 3NWRA 4MIAA 4FJMA 4M94A 3PYEA 5A8KB 5E3AA 1J53A 3QT6A 4NLCA 3HFVA 2LYVA 4FM0A 1RT1A 4CH0S 3JQJA 4MLEA 4KKOA 2AIRB 2VOOA 3QLHA 2CJYB 1FJGK 4Y00A 1RTDB 2EPIA 3M8YA 3OYJA 5B08A 5MLCQ 3UVJA 2CG8A 1OVQA 3R5DA 2CPXA 1WSHA 3E8OA 3OBWA 1WC4A 1RT7B 4B9SA 3D6FB 1ZC6A 3RRKA 3KG1A 3LP3A 3AB4B 1U4BA 1TKDA 5BRHA 3QAEA 3T6BA 1V6HA 4OYZA 1PYSB 2AA4A 4LSLA 1YJ7A 1FTCA 3DOLB 3HRGA 4FVMA 4DV3K 4IFYA 3KUEA 5D78A 4M5MA 3QICA 2ZQBA 2I1RA 4YS2A 4FPBA 2QO3A 1P9QC 3D6TB 4FBUA 5GAGI 2AT1B 1QAIA 4A5BA 4KY3A 2KH9A 4I6WA 4PCQA 4USUA 3FBCA 3U9ZA 3SMZA 1GTEA 4CO2A 3G82A 1OH7A 1KFSA 2UUCJ 3N0VA 3TUPA 1NRKA 3H3OB 4QOZB 4NRTA 2YKOA 2QL7B 4QCLA 2YWGA 1NB2A 2RU3A 3PJXA 2XY8A 4DCHA 1GX6A 3TR5A 2GWKA 3H08A 2O1PA 2CGJA 1Y9OA 4JI6K 4A47A 1UW4A 1MSWD 3LPEA 1ZBTA 3OXFA 1TL1B 4M3UA 4C9DA 5BYSA 4C1NI 3KJFB 3H45C 3MMCA 4LRCA 4WE1A 2OO4A 3GBTA 2AV5A 1MW7A 2AEMA 4A2AA 5DK5A 4JI2F 3KLGB 1WSRA 3CPWR 3LM2A 3S8SA 5ADXA 4XEIA 2YHYA 2HAFA 4ERDA 3VQ4A 4CHZA 4WKRA 4AHRA 1FDDA 3E66A 3PFEA 2M4MA 4FK4A 3ITHA 5IQQA 3EN9A 3M2RB 1VC6A 4M5IA 4K8ZA 3PEHA 3U1NA 2DY1A 4CIEA 4OYMA 3R3TA 1RNHA 4EYIB 2AJQA 3MWTA 1RAAB 3HD1A 5DQIA 3NGTA 2FDNA 1I5OB 4O44B 3EGVA 1K73O 5KFQA 2NXJA 3O1BA 1B0VA 1VIXA 4NI2A 3MOJB 4CERA 2V8GA 1OWXA 2UVRA 1SIWB 4ZPAA 4NB4A 4DL0C 1UOCA 1LFWA 4J9LA 2ADBA 1L3VA 3E01B 4DF4A 3PCOB 1HNVA 4KAZA 3UKRB 1BCOA 4L76A 1HKGA 4BC5A 3Q0AA 1L3TA 3HT0A 4ELTA 4X65K 3SYZA 1ZTWA 4FW2A 1W2IA 5KFCA 2CJQA 1QJHA 2DPJA 3CERA 3RGIA 3NWGA 3UR0A 4IOCQ 4E7KA 3L2WA 4AHVA 4DMNA 4C1NK 1XERA 1WF0A 2UU9K 3K9JA 4DV1J 2XMKA 3TABA 3OR2A 5F0WA 2LU2A 4WK3A 1NHVA 4CLPA 3LQVA 1NJIT 2PDAA 2GVZB 4C0HA 4D3GA 2OANA 3SMPA 5C12A 2HWHA 2J6TA 1UPPA 3DOMA 1T11A 2BBEA 1HMVB 1NGHA 1K1SA 1Y11A 1TAUA 1HYZA 4W5NA 3B8HA 1Y5NB 5KFPA 2KDOA 2YNFB 3IP0A 1A0OB 4UW2A 1VQ9N 1WTFA 5HOOA 4I2PB 4DG1A 3N5FA 1TL7B 2V50A 2G4BA 2IPOB 3ZZUA 4DLEA 4W5OA 4OYAA 2WBMA 5J1PA 1CC7A 3HYFA 3GWCA 1Q4RA 2AGQA 2P9NB 5GAHP 3DC2A 1S1WA 4U67L 3RMDA 3I33A 2C3YA 2W4CA 3PM9A 1X1PA 2EEYA 4Q8FA 1WOPA 4EHUA 4JV2A 1VSLA 4HLBA 3IDHA 4LF9F 3GZ7A 3HZ6A 2KHOA 2VL1A 3KLFB 3Q24A 1RDCA 4HH1A 4DX6A 5CR4A 1RU1A 2RQCA 4M63C 4ER8A 2XY7A 1X31C 4J9NA 3FSIA 3QIOA 3H7HB 3HHLB 3LM9A 4C0BA 2KW4A 2QL9B 3B78A 4KTWA 1OO0B 4YR0A 2C3PA 3CJTA 1K1QA 4EIAA 1IKVB 4NLWA 5D3GA 3S6EA 2EKNA 3E1YA 3ADAC 1WEXA 5T7BA 2J6UA 3W62A 2BX6A 3TA2A 3OVSA 4X2BA 4DKWA 3CUNA 2IFXA 3CMAS 2ERRA 3NAIA 1NPRA 3ISND 3C16A 2RRBA 2QYCA 2MZJA 4USJC 4J90A 2H9ZA 3NMRA 1WKJA 2ROEA 3NL0A 2VONA 4DUZF 2XRIA 2CWKA 2IHR1 4O44A 2BKOA 1TUUA 1S57A 2P5OA 4EMDA 1VQ6S 4ED2A 4U7CA 4YFUA 5IXUA 3CIZA 4FBTA 3ZX2A 4CYUA 1HYSA 2HGNA 1TQLA 4KH5A 5E0OA 4JKDA 2YKQA 1APSA 3P39A 3QIPA 1EXQA 4OHYA 3IN5A 4LF6J 3Q8QB 1VQLN 1E4GT 1GTHA 3BKFA 4DV2K 3THXA 2QV6A 4J9VA 1L3KA 3FVYA 3A5NC 3OW2M 4MYTA 3E51A 2H51B 3Q83A 3CC2S 2HVEA 1MWQA 4EK2A 2DXEA 2UUBJ 1VQPN 1QTMA 4JEPA 4EUVA 1RWXB 1XTZA 2C3OA 5IC6B 1XJWB 1KQSM 3SQGB 5F8HA 3PYDA 4NYPA 1Q82O 4NLTA 3RAQA 4HEA9 3PV8A 2UU9J 1X9MA 3HHLD 3MAAA 4IH5A 4MK7A 2Y0SD 1QZ6A 2GAHC 3A4TA 4YOUA 3MM5B 5IT4A 3VAJA 4OYXA 2P9SB 2HSTA 5GAEU 1IG8A 3PACA 4AF1A 3MWPA 3MGJA 1YHQS 2C2RA 1KNZA 1ZOTA 3O9UA 4WQ5A 2QT7A 1X9WA 4NLQA 3U4LA 4CJ5A 4DV6K 4AQYF 2D69A 2X1GA 1X9SA 1AFIA 2HHQA 3DYAB 1EP4B 4BQZA 1B92A 3M30B 4ZVOB 4G1QA 1R6VA 2J4RA 3AJDA 3BB5A 1DQ8A 3A8IA 1E6VA 1BIUA 1ZBFA 4KO0B 3G6YA 3HPGA 3BBBA 4DWIA 4PXEA 2DR5A 3KK1B 5KRTA 3AJ1A 1LW2B 3U9DA 2RE1A 3TQEA 3MMAA 2CDQA 4OLAA 4NCAA 3MM7A 2BOAA 2CQ2A 2D3ZA 2DTUA 3AD9C 5D6GA 2BTFA 4LBIA 2D41A 2JVOA 3KJVA 4DUZK 3M9MB 1IBKK 1SCJB 4KR0B 4LF6F 1Y97A 5HSPA 1TV6B 3J80Y 4DTJA 1XR7A 2IM2A 1N6QB 5F8GA 3DOLA 3AO4A 3HJVA 2IRUA 3ZTSA 3HLUA 1W97L 1V5VA 2P9UB 3DRRB 5GAEP 3CC4N 4OV6A 3JSBA 3ZZOA 4B3OB 4CFBA 1SQFA 2B6AA 3M05A 3EPIA 1IXKA 3CJ7A 5AXMA 4J9QA 3HSCA 4DPOA 2R8KA 3NMUA 3ID6A 2Q2RA 1GLDG 3PUFA 4TVAB 4M41A 3R7NB 1MWKA 4TU9A 3K8WA 4X4QA 3UCZP 1HNIA 3L0QA 3DXMA 3V4IB 5LT5A 4DR6K 3IFRA 2N4CA 3BH7B 1Y00A 1CULB 4L73A 4F4ZA 1JQGA 1Q5VA 4CZMA 2AX0A 1RTIA 5KG3A 1YT3A 4X65J 2HGMA 1OS5A 3QJJA 2NYHA 5K5MA 1QDUB 2HNYA 2A10A 5CCLA 2V7ZA 2WOMB 2MXYA 4JYAK 4PL7A 3CJ3A 3GONA 4RNMA 4IOAQ 2YKNB 2KJWA 3KG0A 3AAWB 1VRUB 3SBMA 3D3CJ 4N8NA 2WW8A 4QW8A 2IAJA 1U6FA 4PL8A 2DK2A 1VQ8S 5H9EJ 4NASA 1SKUB 4ZVPB 3C7NA 4O0JA 4Y3CA 3ZZTA 2J6SA 5M1PA 1C4CA 4NLSA 4DSFA 4JUZA 1KLNA 2CQ1A 3IRXA 3C15B 4GVBA 5D0EA 4BRMA 2X6SA 1FVSA 1B64A 2XMWA 3NBPA 2G2ZA 4NXNJ 2Z1HA 3DGPB 4Z4FA 3KFWX 3I0RA 3F56A 3LP2B 1JCFA 4KH4A 1YI2N 3OLAA 4CVNE 4CI0B 4TY8B 3MI7X 2D0AA 1VSMA 1N0UA 2HPUA 3TO8A 3NS7B 1S4FA 1HNZK 4DL3A 1VK0A 3HD2A 1FFSB 4DQ8A 2LA4A 4BHQA 3CJAA 3J80O 1KQFB 2MKIA 2H3GX 4JYAJ 5AQNA 1MLAA 3DOMB 3FBBA 1HX1A 4NLXA 3EKSA 4DFJA 2ZM6K 4HI1A 1JIHA 4Z4GA 1OY8A 2KVQE 3JS9A 3VAGA 5BJRA 4TLRA 4UF4A 1Z25A 3S3NA 3B6OA 1TL3B 2XY5A 1I39A 2G13A 4OYIA 5THWA 4J2BA 4DMZA 4DQIA 1YJRA 2KYXA 4DV4J 3H4BA 1CZ9A 1WC5A 3UDCA 4DSJA 1NJYA 3O5TB 3AVJA 3BN7A 3ZX3A 1C2PA 1CZBA 3BKTA 1S9GB 4Y28C 1LW0A 4AH9A 5KFDA 3QYYA 3GG0A 3ATUA 3MPVA 3DKDA 2CPFA 1RK8A 2I5JB 2HW3A 3RU0A 3HSDA 1M5PC 3AA2A 1VSIA 3O3HA 3T1HK 4B9QA 1ROFA 5BYQA 3F5TA 5KG0A 2DR8A 1HYVA 2WBNA 1JNRB 2LXFA 1FERA 1KLMA 2HBMA 4DR5J 3J7ZO 4R8UA 4K59A 4IBNA 4PY5A 4A8QA 3LZJA 2BUPA 3CCMS 3CIPA 4ZDNA 2W7OA 4O3RA 4R5PB 2FF3B 4YOWA 4X66K 3JQKA 2NPIA 2WONB 3PKMA 4GKKK 2PIIA 1NJXA 2J9DE 4DV7J 2RB7A 4DUYK 2R8JA 1H7XA 3SK3A 3RBZA 2KG0A 3BPDA 1NBWA 3VCDA 4TQSA 1C0MA 3CD5A 2XLIA 3L9ZA 2QW9A 4NEYA 1U2CA 1FK9B 1RYRA 2OTLN 4PKHA 5LSOA 3S41A 3VEYA 3JAMY 4DHVA 2QWRA 3OV7A 4CHNA 1IBMK 2LQJA 3C95A 2X3DA 1EQYA 4X64F 2DTJA 2WC9A 4ILMA 2I9SA 4GO5X 3BO3A 2A5XA 3EVMA 3AXMA 3AV9A 4WYLA 2XMAA 4H0XB 1CPZA 3NXZA 5DJBA 2CADA 1QE1A 3SNNA 4ECVA 3I31A 4AL6A 4B9VA 4DQSA 1QD1A 4RCHA 5KFWA 4JAXA 5D0RA 2EFNA 2RQ4A 1ZM2A 1B7FA 4CJFA 3KKFA 5AQLA 1F0XA 1Q7LB 2MKSA 4F3TA 5KTQA 3POTA 4P6QA 3LGHA 5J1NA 3ISNC 2E1ZA 5D4LA 1RQ0A 1JJ2R 1HNXJ 4OHXA 1EQMA 4LF6K 1JXLA 4CK1A 4CZIA 1H38A 5L1IA 5DDQC 4PQAA 2EWHA 5KFBA 1CJVA 4USWA 2IVYA 1S79A 4ZP6A 4WZQA 1QLNA 1DQAA 1KSPA 1T9UA 4JV1A 5I42A 2O8DB 4DL7A 2F7TA 1WHWA 5DGBA 5C5JA 3JB9k 2NXNA 1N5YA 4GMKA 1X8DA 3QZ8A 1NBEB 4CI6A 1LFPA 5KFLA 3F9KA 5AQSA 4AILC 4RWWA 3CCZA 3IR7B 3NNAA 2KXHA 2V0NA 3MCOA 1EHWA 3EM1A 4QIWD 4QU6A 1U47A 1IBKJ 4PABA 1QVFR 2Q0RA 5FROA 2ZJRL 5ETVA 1VRTA 4OI2A 4Y2MA 3OYCA 2HVDA 1JXBA 4J2DA 2YWWA 4YR3A 3R1LA 2JWKA 1HPMA 2MLXA 3P4UB 1VSEA 3UCGA 2BE7D 2V34A 2UUWA 3CQXA 3TWZA 1UCNA 3JTNA 4EBEA 1S9FA 2H5JB 1PO6A 2B8QA 2GV1A 3HJFA 4DCJB 3HVTB 5HRSA 3MM5A 3H4DA 1U02A 2CQIA 3R1HA 4ZP7A 3AY0A 3H2LA 2B3TB 2VIHA 4DOZA 4IDHA 3MPUB 4FP9A 4ZIWA 3AFGA 2MYFA 3CNQP 2FBTA 2Z1GA 2VF3A 2BOPA 3IC1A 3M32B 3AVFA 3TAFA 4P7TA 3BPSP 3TP2A 5CZVA 4BS2A 4QS9A 2DO0A 4ZK7M 3V9WA 1RYSA 5KFEA 2AMCB 2ZBIA 1FVQA 3N6MA 2RDDA 2D1KA 1CJVB 1FRXA 4M95A 3BEGB 1RDWX 4FWPA 4K42A 3VQBA 4CJ3A 3PX6A 3MM6B 2XLKA 3K89A 3TYTA 2GJ2A 3VA0A 4V1Ak 1N5VA 4X4OA 1IBMJ 3PHTA 3S01A 4U7UD 2Y1LB 5CABA 8ATCB 4TU8A 2P9IB 1T03B 2X6NA 3N4QA 1WC6A 3BGFA 3V81B 2PA8D 4IG3B 1WC0A 2AP1A 4HVZA 4OPAA 2NXUA 5A8KA 2QLWA 3BSOA 3OYNA 1FKAF 1N6QA 1KKHA 1YJWS 5J2QB 4YOYA 2JZ5A 1RU2A 4HR2A 1GMVA 3FKBA 4BR5A 4B3RJ 3HHDA 5KFMA 3OY9A 3ULEA 2QMWA 2Y0BB 3SCLE 5KOXA 4C3MA 2AWZA 2AKWB 1NDPA 5EX5A 3UVJB 1HNZJ 4EHTA 4LF7J 3Q23A 1VQ8N 4FLXA 2C22A 1OYEA 3SXLA 4FWRA 3RBEA 3WZ0A 5LMUK 3P8BB 3UDEA 2N7YA 2VKRA 1YJTA 5BXIA 2V8VA 3KMQA 3P3DA 5E84A 3VESA 4JK7A 1TAQA 2YWFA 1KC8O 4CJ7A 4HTIA 1AXQA 2P9NA 2F8TA 3OYLA 1Q79A 4JI2J 3BQ0A 1XK8A 2J9CA 5BR8K 3HP9A 2O8FB 4NL5A 1H2VZ 5ETPA 1HL6A 2BW7A 4ECZA 3OYAA 4NYNA 3NKYA 3IMQJ 5L46A 1HUXA 1QVGM 5BYRA 1YSJA 2FLNA 1CJKB 3ZSVA 4R0JA 4ZKAA 4DV0K 4HKQA 3NNHA 4NMXA 2VASA 3N4PA 1LXNA 4TXSA 2A6OA 4LY7A 5LJ3Y 4H03B 1RT2B 4Y1DA 5MAOA 2E9TA 2NRWA 2B4UA 2EK1A 4N8OA 3N5BA 4E1NA 3OPKA 1A6LA 1KBRA 1NLVA 5LJ5Y 4BRLA 3VEXA 4FYWB 3G6ES 1VI7A 2FJWA 4RBVA 1R0CB 3O3FA 1FD2A 4EI2A 5ELZA 4LVNP 2GJFA 2J9DA 1VS3A 3TA0A 2XCAA 3DU6A 1RA6A 3BY5A 4FWMA 2AGPA 4J9KA 1YRTA 1IWGA 4B9NA 2XZDB 3G2XA 2OPSA 5HROB 2VGMA 1U48A 5E7OB 2IBOA 3C8YA 4BRIA 4DTXA 2BKNA 4C3LA 4RWTA 4C8NA 3GIIA 3IAYA 3QJPA 4DF8A 1RHQB 5J1EB 3ITHB 1GLFO 2L9DA 5KPTA 1TKZB 1NGFA 1FEHA 1XBWA 1NAQA 3R2DJ 3G82B 1BQNB 1NHUA 4DI6A 3F0NA 2IBKA 3M8PA 4FWQA 3HHKA 3I4PA 2D3UA 3JS6A 2VQEJ 2W41A 2MQ8A 1BO5O 3A12A 3CSKA 3L4QA 4JI7F 2Z1IA 5DETA 1HLWA 4DL5A 4K8XA 1DKGD 2C28A 5IT9Y 2VG7A 2OHDA 3KXDA 2B5JA 1WEZA 5A8RB 2VQFF 2OI2A 4N5SA 4YOTA 5F8JA 2C2NA 3GV7B 2V4JB 3W0LA 3NGZA 1JCEA 2E2QA 2C2MB 4KFBA 1N32F 2E5JA 3W65A 1SL1A 1X9JA 4KIAA 3LTOA 4JI3J 2NRTA 2K3IA 3QMLA 2G8KA 2AX1A 2UVUA 3AQOA 3GV8B 1RT5A 3WNHA 4UT4A 4JS5A 2IMWP 2PBDA 2ETJA 3UPFA 1TV6A 1X3NA 2FUG9 4R79A 4MLHA 2CIMA 4ID8A 2V2QA 3J7Z5 3WNFA 2IVFB 1RWPB 3CPWM 2NRVA 3FDSA 3AGKA 5HBMB 2MKCA 2Y1JA 4ZVGA 5KT6A 1XNRK 1U1QA 3CT9A 2ZUAA 3IFEA 3HSZA 1C1AA 3VEVA 2G0JA 1ASVA 1BL3A 1SZ2A 3MN6A 5AQTA 1D9AA 4WFYA 2L41A 5L39A 4E7IA 4Q2LA 4OHWA 5C7PA 1RAGB 4LF2A 4IOCL 2PI4A 3TPQA 4FJIA 2ILYA 3RYLA 2RHQB 3P96A 1QE1B 1PKUA 2UUTA 4MDAA 4F0HA 4V19J 4K4WA 3TVKA 5EU7A 2B56A 1RBAA 2JLEA 2V2VA 2ZWHA 4RNHA 3CJ4A 4M45A 2QA4G 3BP8A 5A2QO 4ZS6A 3VQTA 1Q0NA 4KGVB 2MQQA 5IM0A 2RHSB 4IQXA 1WHYA 4GV6A 1U1PA 3C3LA 3VAMA 1VQ7S 4FM2A 1RB0A 4CLTA 1EKEA 4FOEA 5AQXA 4CFCA 1TMMA 5KFOA 2QWQA 4GKJJ 3VETA 2C3MA 3GR0A 5GVQA 1XWLA 1WTBA 3J8AA 1B0PA 2X51A 3QFUA 3LP1B 1HBMA 2OP5A 2PY5A 3DM2B 2RE2A 3W3DA 4KHWA 3OS0A 4DU4A 3BKUA 2W1BA 1OVYA 3A3NB 2LVWA 4Y34A 2PMZD 2DCUB 2P5GA 2UUBK 4Z7CA 4Q45A 4IOAL 2A0FB 3TSQA 3C15A 2U1AA 2R2RA 4CZCA 3SIPB 1M1HA 3CCSS 2DGWA 4X4VA 4PHTX 1VRTB 1V3SA 2F8EX 3HSTB 4A8MP 2NRRA 4H0YB 1RE1B 4OFZA 2MDAA 3MECA 3R7SB 1ZM4A 2KZMA 5IWAJ 5CZXA 3LGNA 2NXCA 2IGIA 4OGEA 4ZHRA 2YI1A 3I0SA 2R2UA 4CP5A 3NDKA 1ZZFA 4M5HA 5LXRA 3PXGa 3PJ9A 3CW2C 3Q8RB 2BDPA 1YJNS 3CQYA 3WQPA 5A6PA 3T1YJ 4DXLA 3DI6B 2HMPA 3DFEA 4AXIA 2ALYB 1JLQB 1CJUA 5CH7B 3MR2A 5F0XA 2C2OB 2QM1A 4K4YA 5KI6A 2EI5A 2VKZG 1JLBB 3CCVS 2FQQB 5H1SV 3AO3A 3M2VA 4USKA 2J76E 2PYLA 2PSZA 2KKZA 4JK9A 3L2UA 3MX2A 4N56A 4WQ5C 2MKYA 4FOIA 4CBWA 3BN4A 1UFKA 1FX4A 3H5XA 3I82A 2DISA 4WP9A 4WFAL 3W7BA 1SKSA 3MXHP 1S72N 3N79A 4TU7A 1SC1B 3D6RA 4G3IA 3W1YC 3IBWA 1KD1T 1GLJO 2HGLA 4DV1F 1KVBA 1RBRA 4X4PA 5M2RA 3FFIA 3HO1A 1RT3B 1D3WA 4DR6F 1P27B 1XC3A 4K2JA 2PZSA 4JI7J 2HBYB 4M5DB 1FJ7A 4U6PA 2YPZA 1J6ZA 3RJMB 1EETA 3V6KA 2GELA 4H5VA 2UXBK 3UWTA 2G8FA 2F8MA 4K5SA 1JL1A 1WBBA 4B08A 1O13A 3LP0B 3MMAB 1NM2A 3NS6A 3MCSA 2IA0A 3OTCA 4X66F 3W9IA 5ETKA 5JS2A 4CF8A 3WXIA 2PEBA 2OPRA 3OJUA 3OYIA 1ZTTA 5K14A 4MKYA 2CA9A 1FXDA 2W4PA 2EBEA 4DHYA 4KQZA 2VFTA 5KFAA 4RPFA 1HW9A 3CCLS 5E41A 3SQ2A 3DHWC 3PZPA 3NF9A 3MHYA 1Z6RA 4KHPF 2I0XA 2M5YA 2E1MC 1K8KA 5LMNK 3E9PA 3QFWA 1U6ZA 5E3CA 1X5TA 3OYDA 2VHGA 2P1JA 3D2EA 4CEOA 2XI3A 2K1RB 1XR6A 3SJHA 1NDCA 4ED6A 3A13A 2OEJA 2P9LA 4JKCA 1VQ4N 5HRNA 4ENOA 2MTLA 3QIDA 2Q66A 1WHVA 2QIFA 4IYQA 4RLEA 1NNEA 2DFEA 3WXMB 2XWXA 5DLFA 2IYGA 3MM9A 4X62K 3AXKA 4KHPJ 1KVCA 4A8KA 3G8QA 4C8KA 4B02A 5FJ4A 3MFHA 2MHEA 4O0NA 4I9LA 3PSIA 4BC4A 4RUBA 3A5OC 1YITS 3DXMB 2OCEA 1Y3KA 4NXMJ 4LF5F 2WOMA 1R89A 5DZ6A 1NEEA 5KGWA 1NK6A 1SJ1A 1HI0P 3IM9A 2A6AA 4CM2A 3BYRA 1J54A 2X78A 4X4RA 1JJHA 3B6BA 4UZCA 4AHTA 4L3NA 4CT8A 3TAPA 1YZ6A 3C66A 3UD4P 2JDJA 2RIJA 2KHDA 2A3ZA 4Z4EA 2B9YA 3UIQA 4F3OA 4DR5K 4JB8B 4XPCA 4C48A 1YTUA 4DZ6A 3BV8A 2I6WA 4OPKA 4B3MK 2ZH3A 1V4SA 5T7LB 2H1YA 4ECTA 4IH7A 1NK0A 2IVOA 3ZCMA 3EICA 1OMSA 5F9NA 1BHNA 3QLHB 2IOCA 2F9JA 4OPJA 3WIUA 1GMUA 1IKWA 2B4PA 3OYBA 4WU3A 2WB4A 3LPYA 3FGVA 3FZHA 4JKEA 1JLCA 3Q8PB 3DLGB 2E5LJ 1K73T 4HYKA 2C2DA 3OUYB 5BPLA 4RR5A 2ZBRA 4FDFA 4WQ4C 4F3QA 1NMNA 2JX2A 1RCOB 4QZVB 3MCMA 4JD2B 4CK3A 2QSFA 3CDBA 1IR0A 2MGZA 4ZLJA 3HVAA 1Y64A 3FUYA 1N36J 4AXJA 2QXLA 3O80A 1KDNA 4G65A 5H9FJ 1RGVA 2YX4A 4I68A 2GC8A 4M1KA 1RABB 4QS7A 1REGX 1GXTA 3ZLJA 1HD1A 3TZWA 4G1IA 4Y65A 2W8LA 1M5SA 3SJJA 3QIPB 2Z2YB 2EKYA 3D3BJ 5CQGA 1S12A 1UVJA 5BRFA 3TZXA 3EXYA 2L9NA 1LK7A 3CCUS 4GVBB 4H4OA 3K0SA 5GADP 2XBPA 3Q2SC 3RSEB 3HVWA 3UFCX 2FVPA 3W66A 8AT1B 2I8EA 1T02A 3UN5A 2H3EB 1W2BR 1HWLA 4X64K 5AZJB 4WFAQ 2IVMA 1XMBA 3LDPA 4O5FA 3V1OA 1U49A 3ZX0A 2MY8A 3D6MB 4Q5VA 3ALYA 3D28A 3PW2A 1VQMN 1S6OA 1ZM3A 4WFNQ 2O67A 4JN4A 3PW0A 3L8BA 4NWBA 1T44A 2P9SA 3CCSN 1N34K 1TL5A 4BRPA 2IIHA 1PSDA 3CDEA 3EO3A 4M3XA 3ETMA 2P9CA 3BZCA 3V81A 2PE8A 4F0MA 2O8FA 1A9NB 2GJIA 2HHTA 4H0VB 1FK9A 2EG2A 1I94F 2LQBA 3DLGA 4YOXA 1G2EA 2VWJA 3HKWA 2Q3PA 1OKJA 2WSFC 5CY4A 5AQWA 3T1HF 1CLFA 2LFVA 3SSQA 1NLKL 2COLA 4Q7AA 1I94J 3VQCA 3O2IA 2VBZA 2CH5A 4C7QA 2Y1RI 1ACMB 1BXNA 1B3TA 4J7CA 4B9MA 4B9UA 3F41A 1VLOA 2N4DA 3QZ7A 2WVFA 2CJBA 3G6VA 2W9BA 1PILA 5LOQA 3CXCR 2M8HA 1WF2A 3CDWA 4IO1A 1J27A 3OYEA 3TU5A 4AHSA 2CZ4A 1W26A 3HHLC 5KFRA 4PXDA 5GINA 1T6CA 1Q53A 5U47A 4BDPA 3OS1A 3P5TL 5F9LA 4FNHA 2VICA 3LPTA 4DUYJ 1S6PB 2XZWA 5DMRA 4E8UA 3VOVA 1U6BA 3JTPA 2GFFA 2FGCA 4E7LA 2RF2B 3N01A 1XNQJ 1HJOA 2UP1A 2CDRB 3MMJA 4RNFA 1D0EA 1T3NA 3CO0P 2AP6A 5ETMA 3AVAA 1W0HA 5I9EB 2JLGA 4C11A 1Z26A 4BRNA 1UETA 2YWHA 1U1RA 2GZOA 1DBDA 3PX4A 4K4XA 1RT2A 3EY1A 3G10A 4C98A 4PG6A 3MEKA 4YMEA 4LR7A 2JL9A 5HRPA 1XNRJ 2VJUA 3MWBA 3PIOL 3JSRA 1NDKA 2KI2A 2NSCA 2VB6A 1Q86T 2YNFA 2ROPA 2YWEA 3FCHA 4K5RA 3G8SA 1RTIB 4MO5A 1KHVA 3T9NA 3O5BA 2QLXA 4WQ4A 2HZCA 1LWFB 2A42A 1WI8A 2W2OP 2FHOB 4QOTA 3OHAA 3KLEB 4XIUA 1WAJA 3CETA 3E3XA 3GJRB 2E88A 2OMOA 1PJ7A 2V94A 4USMA 4ID5B 2CPEA 5GAEI 1EQ0A 4TSXA 2QA4N 2DNGA 3EDQB 4DCPB 4Z2XA 1XC9A 3CCUN 5J1EA 1VQPS 1VQNS 4X84A 2VA3A 1IM4A 4NLVA 1TKZA 2ASYA 4J37A 1MWYA 3FRZA 2B4VA 2ZC4A 3MCNA 2HHWA 3BJYA 3H2VE 4IRCA 3PW5A 1NGCA 3DXBA 3AVMA 1IUJA 1U0HA 3FQLA 4QPTA 4DSLA 4Z0UA 3LAKA 3L2VA 1H2UX 5KFSA 3FLCO 1KOHA 2ASDA 2J0WA 4RKUC 2OSRA 4DPUA 3JSYA 2B5JB 5A8RA 1PYTA 4CQ1A 4LF7K 4G1PA 4W92B 2AJ4A 2GWJA 4CEDA 3D6HB 3BGRA 4FVCA 3WEEB 3LZIA 1SC6A 3MUVP 1BA1A 4F0KA 2FYXA 3NGUA 5AQJA 4C2MA 1QHAA 2HK3A 1HWUA 3DJCA 3ZZYA 3EJMA 3GFYA 3NRBA 3KWGA 1QSYA 2AYMA 1S77D 5BR8J 4UZBA 1TMJA 4EEYA 1J5OB 4FKYA 1IBKF 4OJHA 4NLDA 1ZBUA 4X4NA 1WEYA 1F3VA 4NXNF 3THWB 5HMXA 4LF7F 1RDBA 4C0OC 1X5SA 1NKCA 2ZDPA 3AD7C 2VG6A 3CF5L 3H98A 3P83D 4P52A 1DARA 3OQ2A 2CYYA 2G2YA 4OL8A 2RHKA 3PFOA 1KAYA 5KQ8A 2GX8A 2BJ1A 1RI7A 4CJUA 1VYAA 3PIPL 4ID5A 4UTGA 5HP1A 2PFUA 2BJ7A 2QWMA 1CLQA 2RNEA 2DNYA 3ZSYA 2DHGA 3CDUA 2E1CA 1N52B 4LJMA 4HUEA 1HD0A 2CXEA 1G7CB 1C0FA 2QA4S 3CEDA 2DB1A 3N28A 1RT4B 3B54A 2GCFA 2HHHJ 5KG7A 3IS9A 2GMLA 4A2BA 4QYZJ 3T41A 2ZJQL 4ITSA 4CTAA 4ZVEA 2G0IA 2ZZMA 3IBCB 2Z0GA 3M6WA 1S6QB 3G71S 2XHWA 4NCGA 4F4KA 5LJWA 2XMMA 1YKWA 5JVGL 3CC7N 4B1YB 3EL2A 1T95A 3T5HA 4LR8A 3BSAA 2BVZA 4Y2AA 3QT5A 4CJKA 3X1LB 2R9LA 4A46A 1R27B 4HH0A 1EX8A 2RN2A 3KHGA 3OFFA 2ASPA 2EC0A 3NY0A 2AD9A 4BRDA 3V6JA 3AVNA 1HWIA 4ZHRB 1IKXA 3DXSX 3ISZA 4IDKB 1RJJA 1G15A 4KE5A 1TELA 3OYGA 2DPIA 3W63A 1KR4A 4BVOA 2QTDA 4X4SA 4YB6A 1RCHA 4B1XB 1X7VA 3OJSA 2F7VA 5CXTA 4BROA 3A5LC 1FESA 1HQEB 5BPMA 1LOTB 2KKHA 4PQUB 1S5ZA 2XYPB 1DZ5A 2QI2A 2ZOFA 3D9BA 4GC7A 2XZTB 4F4YA 3M1VA 4ZJLA 2A1BA 3ZYYX 4NYZA 2OZMA 4FCYA 3DOKB 2AJ2A 1P8GA 2GNKA 5KFFA 3BGRB 1NJIO 1CC8A 4D3HA 5FPNA 4E1JA 3AHPA 2OEKA 5F1XA 1CQMA 4AFFA 3OTBA 1SS6A 2OFGX 4AHUA 2KB2A 1MA9B 2F9TA 2YXLA 4CEFA 3D2WA 2BM0A 5KT4A 1GOCA 2G1HA 2D0BA 4BREA 2LLZA 2FVCA 3AA5X 6AT1B 4YDUA 4P9SA 3KUHA 4WU2A 4CJ4A 1NG9A 4HTJA 3EGWB 1NGJA 5DG8A 1N32K 1NSKL 1OY6A 2OA8A 1KRPA 4RW9B 1Y5IB 4OKKA 4HVJA 1FXLA 3CULA 1UWAA 4KGXB 1U2FA 2KXNB 1GLCG 5D3GB 1VCTA 2CQDA 1NDLA 3V4MA 2FVSA 4URSA 3CC2N 4ZPDA 2IDOA 1N54B 1SH0A 4OV1A 2H4WB 4ZVHA 1HWJA 1VQLS 3DLKB 4FK2A 4ILJA 3KMSA 4LF4F 1X3MA 2HQFA 3LPUA 2VWKA 3NCRA 3ZSQA 3THVA 4MAKA 3PKYA 3DGPA 1O1WA 2O8EA 1S3XA 4LH5A 1N33J 3AJ2A 3AODA 1RHKB 4DTPA 1VISA 4KH1B 3P45B 4NE9C 4B3TF 3R6LB 5IV3A 2VPXB 4B9LA 5FLXY 1IG9A 1QVFM 1KTVA 3OTOF 1F9HA 5IOLA 4Z4IA 3EGNA 1DLOA 4HWIA 1MROB 2Q31A 4RTFD 1YWXA 3NBPB 1RCXB 2IA6A 5ETTA 5TKWA 4I9QA 2VBYA 4ZP9A 1RDUA 3M5RA 3BH6B 4GVLA 5HL7Q 4NLPA 4J9UE 3VHQA 3D1QA 2AZ1A 2OYQA 3K5MA 3OHBA 5C24A 3HM8A 2JH3A 4HTLA 3U1MA 4OI3A 1YJUA 3TAMA 4PAAA 4UOFA 4OYWA 3KHLA 2E8AA 5C2DA 1KVKA 3DRSB 3FSYA 1N56A 4LC9B 2W7AA 3ENOA 3GV5B 1T9XA 2OPQA 4H0TB 4F9OA 2F4FA 3SEOA 2QLBB 2E2NA 2E7WA 1S0MA 1EO1A 3UE5A 1XQIA 4H4MB 3IKMA 4YY3K 3GR1A 1S49A 3CQ8A 4O8UA 1YF5L 1JLFB 1OYDA 4KV8B 4P74A 1U0HB 1UVKA 5KFZA 2R7VA 2CQCA 3OSPA 3ZXWA 2QEXN 3G8TA 3MF5A 2JEGA 3O8MA 5J2PA 3ENVA 5D4OA 4CLUA 3O6QA 3OT9A 2VBWA 1S9EB 1VC0A 1YIJS 4WF9L 2JVRA 1RTHB 1E6YA 3K17A 4EGLA 2FBVA 2KRRA 4QR1A 2DT9A 4ZPTR 4NCBA 3AT1B 3F44A 3M8RA 1WAFA 3J7ZT 4UY85 4RU2A 4WYBA 1F5CA 4DR3F 1F60B 3MAQA 3R1XA 4CZLA 1AA1B 2Z1JA 3DM2A 1MNEA 2ZC3A 4P2XA 5DDOC 4LUBA 4KHYA 1BU6O 2ACYA 2B43A 4RG8A 2IM3A 2UV8G 4OPHA 4Y2IA 1HHSA 4Y1CA 1UVMA 1X5OA 4NX9A 1RWMB 2UVWA 5H9EK 2HNDA 3O8WA 3MAHA 4J5OA 3EYZA 1NKBA 5EHHA 2NUBA 4PG5A 1RTJB 1T3VA 1SJRA 2D4WA 1JLBA 2H48B 4NLGA 1QSSA 4FJXA 4ZVTB 3W64A 2ZEJA 4AQYJ 3QFPA 3E2EA 1YJ9N 3OUYA 2F65A 3V6DA 2K2PA 4NXNK 2AJFE 1BY9A 3CB4A 2YHXA 1OH8A 1OQ6A 4IEIA 1VAZA 2KM8B 4K7QA 4QWEA 2B6AB 3V9ZA 2Z8QA 3TSUA 4TY9A 5CYMA 2DITA 1M90T 2P5VA 3KOAA 3FGUA 2FC0A 3W2VB 1UA1A 1FE0A 2JFDA 3DLLL 3Q7BA 1UEUA 1B70B 3L7UA 2QLFB 3L3CA 3ZT4A 1H1VA 1NGIA 4CRJA 2ZUGA 1TL7A 3MCPA 4DBQA 4IKFA 1FE4A 1XMQF 2UXBF 3ONQA 5AXNA 4CFDA 3TUZC 1FJGF 2FZKB 4XPEA 3QT7A 3EEQA 3OL9A 3TQ1A 1IN0A 3FJ2A 1WC3A 2J7WA 4YP3A 4QW9A 2ZM6J 4A48A 1VJQA 3LDNA 4BQLA 5HP1B 5AQFA 5KG4A 3DRRA 3ETOA 2UUAK 4DR1K 2UUCF 4YB5A 4DR4F 4MIWA 3IRXB 2E1AA 2R7WA 4O0IA 2WVEA 1HARA 3FEZA 2XSJA 5HQLA 3M8QB 2UXDJ 1B0TA 3O9SA 4Z4CA 3JXOA 4CGGA 4CCHA 1Q81T 1RSCA 9RUBA 2ZZNA 1GLLO 3IS9B 1CSJA 5ITHA 2V8DA 3GFHA 1RHJB 5DS7A 3C6AA 2JC0A 1DTQA 4IRKA 2R42A 4M7XA 2E7VA 1C0TA 2NNWA 5AQGA 4EBDA 3RRGA 1HQEA 3O6WA 5JS1A 3G0ZA 4NCGB 4RNOA 3QNOA 4DPXA 2Q79A 1Y7PA 3U1LA 1CULA 5HVFA 3ZETB 2BABA 3ULDA 2HRYA 2E29A 4C8LA 3AVIA 4AM7A 3BBFA 4IFVA 4J9MA 2AHOB 1KC8T 5KFGA 2RUSA 3V6HA 3J7YU 2XS5A 3LUYA 4Z4HA 2V9WA 1OSCA 3OS2A 3CMES 2HZAA 3A3OB 5KT7A 2UUAJ 3EWGA 1VSJA 1C1BB 2OPRB 1FDAA 3RBXA 5JVHQ 4J9OA 5ETOA 1QQMA 3KLVA 1KHWA 1BISA 1VQMS 2EW9A 3Q8SB 3BEXA 4PWUA 1KOOA 3O9RA 2HLTA 4I67A 4UQTA 1SJ4P 1D5AA 1IQTA 1N5SA 3CJ9A 1MMDA 1ZBIA 3JAMO 3A5MC 4GMJB 4M5GA 2VUGA 3C6UB 2IM1A 4YHHK 2HFOA 1CXUA 4K4SA 2B7CB 1JL2A 2UUBF 4HDGA 4BE1A 2CVIA 2HMIB 3MUMP 1N36F 4CJQA 5A6WA 3T9ZA 2X1BA 5LL6Z 3O1LA 1WORA 4FLWA 3M1FA 1VOMA 2V4QA 2ZNZA 4QIGA 2V52B 5AR0A 4HCCA 4QR0A 1WSIA 2EFVA 2Y8YA 5HVHA 4K0KK 5B0BA 4QBUA 3DLKA 3MOZA 2CQ4A 5E3RA 4KPYA 4F3MA 1PCAA 3OL8A 4BR9A 3C19A 4LIWA 4DX5A 4I56A 3BSCA 2AZ3A 3J81U 2AW0A 3GFZA 1J5EJ 2IIRA 4OJRA 2CPJA 3CIMA 4RW9A 2I2YA 2FF6A 4CEZA 4BRHA 1SQKA 1R8HA 3L2RA 3D66A 5C2CA 1ITGA 2P2CB 1IM6A 2WCXA 2I5JA 4NLUA 3W5XA 4A62A 1YZ7A 2ZE2A 3MDQA 2KFYA 2MQLA 5I3QA 4GW6A 2BXJA 1K0TA 5AJ3J 5EXWA 5AE1A 2HBZB 5H1SQ 3CM5A 3UKRA 3ZETA 4YHHF 3VF6A 4PUOB 3P6YC 3MMVA 4IKAA 2OFHX 3P5BP 3IG1A 5LY3A 5BRDA 3NOCA 3CFRA 3QBXA 2QYGA 3F2KA 3VEWA 3WNGA 2G8UA 4W5QA 1T0TV 2E1PA 1T3OA 4B3OA 2Y3YA 1FKPB 3CFPA 3C94A 2ZKUA 2YX6A 4C3KA 1HBUB 3HHEA 1BCMA 1XMOJ 2DVIA 3TNVA 4FJJA 2C2KB 4ID1A 3SBGA 2CQ3A 4C4WA 1RT3A 1FKOA 1NK5A 1VHXA 2LA6A 3G9CA 2M8DB 2H4YB 1WC1A 3HOSA 2HRTA 4NLRA 5HQMA 2QKKA 3CJRA 1ATRA 2G9OA 1FRIA 4DV6J 4DR7K 1HKAA 2LEPA 1Q5YA 3ZTPA 3CJ2A 1S22A 2A2CA 3OBIA 4RUCA 4P2SA 3AA3A 4FWNA 4FYXB 5L8RC 4IUFA 3TAMB 4MK9A 3CPEA 4WWSA 1S0VA 2ZH4A 5HROA 4M3RA 1V3ZA 2GS8A 5CHIA 4JV0A 1AZSB 1T9WA 2ITMA 2Q0UA 4KTZA 4FZYA 4B3RK 1SUQA 4DR7F 1HMVA 1ATNA 5E26A 4JNEA 4KRFA 5DRKA 4M3TA 1P1LA 3BO4A 4JI8J 1JJ2M 2VC0A 3GSDA 1GEHA 4JI6F 2ZBCA 4FPAA 1FA0A 2JOQA 2Q3SA 1NGEA 3L4IA 5A8WB 3CI5A 2QKBA 2YQ1A 3VALA 4OZLA 1B7YB 4IFYB 1YG0A 1S6PA 3UQSA 3NF6A 4PUOA 1BI4B 3LP2A 2VG7B 1S9EA 2HVHA 5CD4A 1UJ5A 3BQ1A 1XMQK 1F1BB 2BUNA 4IG0B 4RW7B 4ZVQB 2P9LB 3SFGA 2XWYA 2M2BA 3ZT0A 5D77A 4FJKA 2NRZA 1UMJA 4L3QA 2ASOA 1VK3A 2DH9A 4KH6A 3HI0A 3SV3A 2JC1A 2GTDA 2W9CA 4O8KA 4HHUA 2UXCK 2DNMA 2DGOA 3CJBA 4AL5A 4DV3F 4WP3A 5AE2A 1Q8KA 3PY8A 4UOHA 4DV0F 5E3QA 1RXOB 1T8EA 4ZLLA 4L8RB 2DHHA 2P9IA 3OBYA 1KFDA 1KQSR 2CJAA 3I87A 1TL3A 1HYSB 4WFBQ 4KJIA 2FLPA 5CHCB 4ZTFA 3MPWA 2Q6BA 4FPIA 2P9GA 3WXJA 3M8SA 2Z30B 2PA3A 2HNZA 1BMQB 2M52A 1YAGA 5LMNF 5F41A 1OH6A 1W7WA 4GV9A 3OL7A 2XSFA 4KHPK 3H8YA 3VGMA 3VTIA 1TL1A 3AGRA 4HT7A 2M88A 3F73A 1YGYA 5LXYA 1KAZA 3V1RA 3DNCA 1GAOA 2B4OA 2WTFA 4W5TA 3FZLA 1U1MA 3HHNB 1UWBB 3VAIA 2VODA 4JP8A 3KLGA 4CLWA 3SUPA 5CYQA 2BRKA 1VQ7N 1PAEX 2YNIB 1Q8BA 4AQYK 2UV8A 4DV6F 3PR4A 5B0CA 2PFFB 1IBLK 3VENA 1YLXA 3HZGA 5D0HA 3CJ0A 1N48A 2ZGYA 4KO0A 1HBNA 3AA8A 5IWAF 1UVNA 1TUGB 5K8MA 2GVDA 3CD0A 4BCAA 4DR2K 4NXMK 2HAIA 1X0FA 1QQCA 1AZSA 3BDPA 2FBYA 3IXQA 1I6JA 1EAYC 2DRAA 1RWNB 2NLXA 3CMAN 2MLZA 1YI2S 1EARA 2JGUA 2DGXA 4J91A 1H72C 4XO0A 1YXQA 3A8YA 2QX0A 5KG5A 2HQDA 2W2MP 2XG8A 3OTDA 3U3YA 1N33F 4M42A 3G96A 2KZZA 3T1HJ 3IR6B 3UCUP 4FWKA 3HFKA 1VBXA 4A8WA 3KVGA 4EAHD 2ZD1B 5J2NB 4XAKA 4E7HA 2VFRA 1RDRA 1TVRA 5JMNA 1YUWA 3NGSA 3PRVA 3O3LA 1IKYA 4BDYA 4DTMA 3MD3A 1XEZA 3H40A 1E6VB 1YTYA 4IJNA 2E2OA 4WCEQ 2XYHB 5M2UA 3KK3A 2XQCA 1YVUA 4TLQA 3GJSB 2GVZA 3FSXA 3SDEA 4AYBD 4DQQA 3ID8A 3M2VB 3AAQA 4A4JA 3OD2A 3DXKB 5K20B 1LNQA 4X64J 4M5KA 3C6TB 2WFBA 1CJKA 5T14A 4OZ5A 1NSAA 2HHUA 3G87A 3GP9A 5JXSA 1S59A 4WTOB 2HQGA 1JLAA 3QWPA 2BYCA 4ZPBA 1LWCB 4DSIA 3FZMA 3M8PB 1G1XA 1F2HA 4L3KA 2IY5B 2DBBA 1WSGA 2X1AA 1H6KX 2DH7A 2Z2LA 5IT0A 2DPNA 2NZ4A 1REVB 2VGNA 5I3UA 3BR9A 3SCJE 1WG5A 4JV5F 1U2RA 5LMUJ 4ZVFA 3QRRA 3FBFA 4BR0A 2OEMA 2XYGB 1TK0A 1S1WB 3CJ8A 5F2RA 3MMBB 5AQVA 4HACB 3DAWA 3M8ZA 2MLYA 3TEHB 3CCEN 4JV5J 4KAIA 1S1XA 3QEWA 1OSDA 2HMIA 3SQOP 1SV5A 2EG1A 1SJ3P 2NCKL 5BREA 4HHHA 4DTRA 5AQRA 1RWOB 1RTDA 2V8PA 3MM8B 3X3UA 2ACMA 2J0XA 5LM7E 5G0RB 3M9OB 1HBNB 2E6MA 3CJSA 1TK5A 4JI0J 1DURA 3RR8A 1T6DA 3V4IA 4R0EA 1FWLA 2M7SA 1FF2A 1UWBA 3D67A 2PT0A 3FFKB 3N6LA 2XNQA 1VSKA 3NGYA 2G2OA 3MD1A 5HBMA 5AT1B 3VQ9A 2YNGA 4LIRA 3ZSXA 2ZH8A 1IWAA 1Y5LB 4PQUA 3I55N 3P31A 2AJ1A 2IJNA 4FF2A 1K8KB 5KPRA 2MMYA 1WSFA 5FLXO 4NEZA 1RWUA 1LV5A 3FNNA 1HIYA 2K3KA 4KRWA 4L75A 1C1CB 3G4SN 1O51A 2IDEA 4FLVA 2ZWPA 2AEJA 2A18A 2YHAA 2EFGA 2DKOB 1N5QA 2HFVA 5ETLA 4O5BA 3THYA 3HMJG 1H74A 2DNQA 2IM0A 2VFVA 3FZ2A 3WIVA 4C11B 5J2MA 3GG1A 4CF1A 3MXIA 4KC5A 5CE3A 4FJ5A 1P1TA 1SPBP 3VGSA 1T03A 2F1FA 3QSYB 3VQ8A 4CYUB 5KFJA 4FZXC 3HTVA 3RAXA 4K4UA 5F8MA 3G4SS 2GMHA 1GK8A 1S1TB 1YJVA 4K4ZA 3GLJA 5IV4A 3V6DB 2LECA 1CS4A 3DLEA 5HQ8A 1TYQB 4DUYF 2UXDF 4DR3K 3VQEA 4ED4A 1VQOS 5JVHL 3T5JA 3ZZRA 4KHNA 4WTYA 5M1FA 3R6MA 1W9HA 3HZEA 5GMKa 3VZHA 1Z05A 2Q97A 5GAGU 4B3MF 2XB2D 3LF0A 3CMQA 3H42A 4IWVA 1J2VA 4RW4A 2R2SA 1MDUB 2X7IA 5DGAA 1GXUA 1B9DA 3TI0A 1U25A 4DV3J 2VQFK 1KTQA 1WWHA 5HI7A 2PMWA 3FCVA 3IWNC 1Q16B 4CO3A 3GE1A 1SV5B 2BRLA 3CO9A 4CH7A 4DCOB 2D5RA 2AEFA 2DRBA 4A5AA 2J8AA 3K2YA 3CD6N 2FLOA 5KAKA 3OLBA 2CJKA 3EZUA 5CZ1A 4IEEA 4HACA 2NLWA 5C2GA 5EUHA 1S97A 2MSTA 1LAWA 3E01A 1RHUB 4YOEA 1NGAA 3MAAB 1WNEA 2GHWA 4QPXA 1GFWB 4DPYA 3A8KA 3MCAB 5AQOA 4I2QB 4F04B 1GLAG 2CPZA 3CCRN 3POTB 1JB0C 5FPEA 2GGPA 4AUKA 4BRFA 3THPA 1JLCB 3CG7A 1D9DA 3BZQA 1BI4A 1BLUA 2GIFA 2BKPA 4I6AA 4EYHB 2RVJA 5E2QA 4CDIA 3GSIA 3DYAA 1PC4A 5IQ6A 3FBEA 4CBXA 4JRQA 4MMOA 3MPYA 1UFLA 1X4DA 3GB0A 4UY8T 4IJAA 2ZOGA 4MQ3A 1SH3A 2BV3A 2HBKA 3QGHA 1XUPO 4CIFA 2DNNA 3CTRA 3VQ5A 1DLOB 1N88A 1PBUA 2F8SA 3J7YP 5CYJA 1R0BG 4HT5A 4G9ZA 4ZLPA 1YQHA 1A5WA 4CEQA 2YKMA 2W01A 1C1BA 2UYTA 2E2PA 3NNCA 4LR9A 1ZS6A 1LCUA 1UKUA 3K58A 1X0PA 1U1OA 3IRWP 1BQXA 4BY9C 2O8DA 3H5UA 4BC9A 2W9AA 3R5BA 1QM9A 4CHQA 3DMJA 3K7RA 3Q7CA 4BLGA 4U8VA 5LL6d 3I32A 4CGDA 1IBLJ 4BRQA 5KG1A 3OHRA 4BGAA 4J2AA 2QZ8A 3NGRA 1ZH5A 2R3VA 5SZTA 4OMFG 2GUIA 2HNYB 3OTOJ 3W5ZA 3UN2A 1Q7YO 1RT5B 2CG4A 1FHTA 4OVLA 4A8SA 3HHLA 1SH2A 3EPGA 2APOA 4DN0A 5TKYA 3PNIA 1VQ5S 1XMOF 3CC7S 3KIOA 3H2UB 5HLFB 4RW4B 3R8EA 4CZEA 2OAUA 4TYBA 4GV3A 1SJQA 3HVRA 4PXCA 2YTCA 5CAAA 3HCXA 2FJAB 3IA0A 2RRNA 3MR7A 3ULHA 5F3ZA 3SPZA 1Q95G 3JAMU 3LGMA 4E19A 1HKCA 4MT1A 1ASUA 2DNRA 3M2UB 4ZIVA 4WJBA 3QERA 2GMJA 3A8EA 1CG2A 2XLJA 1HHTP 2FHJD 3GDQA 4B1VA 4OLBA 4XH5A 4IO9Q 2RDJA 1LAVA 2VDIA 2MZ1A 2HYIB 5D8HB 2P8IA 2MQMA 1JNZB 2QWLA 2KLAA 5HO4A 3VVTA 4CLYA 4JI0F 4CNYA 5RUBA 4K2XA 2WBRA 4Q0BB 4Y0FA 2R7RA 1ZAWA 2BQUA 1OH5A 1XMQJ 1PJ5A 4DDFA 3RVCA 2VFUA 1QAYA 4CF9A 5I3UB 1HR0J 4Y2KA 3IG1B 2A1SA 5D15A 3I0RB 3Q8UA 3KD5E 4CT9A 2UUCK 3KHYA 2BQ3A 4NZ6A 2VCPA 3NCIA 4PWWA 4PXBA 1S1XB 2NS1B 1GOBA 1AB8A 4U9RA 3KLEA 1S9GA 2VWBA 2K06A 2NPFA 1VQKS 4USVA 2I7NA 3CDAA 2EXUA 4DR2F 5DM7Q 3VV2B 3N4WA 2MEWA 3UW1A 3TZZA 1O6XA 2ASJA 3KK2A 3QBWA 4NA2A 3VPZA 1NB7A 2ZJPL 4QIVA 1VFJA 1AFJA 1ZA1B 1IBLF 1FKOB 1NHKL 3M2RA 2QXFA 4IG3A 3SCIE 3DLHA 4CESA 4EZ9A 2DNHA 4USTA 4BVPA 4LF8F 3J7AN 3DRPA 4G1QB 4OI6A 2ATLA 3MTKA 4FNIA 4QR2A 3W2WA 3GPAA 5GAHI 2E1RA 1SAZA 4FPRA 3NH2A 3NP5A 1U8SA 4CGJA 3ZSWA 5FPDA 1FXXA 4GKJK 4TQRA 4CZJA 3QINA 1C1CA 4WFXA 4JI1J 1HQUA 2J0QD 1XIQA 2BE2A 1N34F 4HUGA 1H2TZ 2RD5C 2X3GA 4BDZA 4NZ0A 5L9XA 2EFQA 4OX9K 1FFGB 4LSNB 3ENAA 2XULA 1UAWA 2E4LA 5IT9O 1V3RA 3RW6A 5A2QY 4USHA 5KT2A 3RB0A 2RS8A 4FXDA 2FJBB 3PVXA 4H0OA 2B9EA 4AD6A 1E4FT 2BZ2A 4K0KJ 1CJUB 4PG8A 4DFMA 2FHMA 3GFXA 1R31A 5EN1A 3QAUA 3DLEB 1H98A 3O9TA 3CMEN 1F5AA 5KFUA 1U09A 4RJVA 1RWWB 2F3JA 4PYDA 4B3SF 2GHPA 4LMZA 5C25B 2RILA 3EDRB 4QWDA 4DTNA 2YVSA 3VQQA 2CNLB 4JKAA 4E3SA 1R3NA 4GNIA 2K8GA 2EFPA 1BGXT 4LSZB 4DLGA 2HRUA 5JJBA 2FZGB 1D9FA 4B1UB 4G6VB 3QRPA 3FMWA 2B0GA 3ENQA 1UW9A 1NOZA 2HFZA 3VGTA 3LDSA 4ZVRB 2VYPA 2Q43A 1VQ4S 1IJJA 2ZBQA 4WIIA 1RT4A 3LW5C 3WHIA 2YNHB 4PWDA 4BWJA 2M3DA 1DGKN 5AZIB 1RBVA 5AQUA 5FD1A 6FD1A 1BIZA 2A40A 3I55S 2KU7A 4BE2A 3EE9A 1DFDA 4GKKF 2KN4A 4RUHA 1Q9YA 3BF3A 4WCEL 3CCMN 4N41A 3TUJC 1ASWA 2DHXA 1NOYA 2OGUA 1VQSA 4C8ZA 2HZVA 4QS8A 3OVAA 3BM7A 1W2BM 2LQ9A 4K25A 2KQ2A 3VERA 1S1UB 2KO1A 4AT1B 1NSPA 3BGOP 3UDVA 3I96A 3FZBA 1B4SA 4IRDA 1HNWJ 4PPDA 4E2FB 1NPPA 1M5KC 4LFCJ 1IKXB 4FWLA 3GILA 5KFXA 3ZC4A 4GKKJ 3R5JB 4DV7K 2DR9A 3ZNUA 4CF0A 3SQ4A 3EVOA 4ZPCA 3S3OA 5DM7L 2BE2B 2GIRA 1IKYB 3IGNA 3C6HA 1JXVA 2CVEA 4PR6A 3MK6A 1VK8A 5C2FA 4RBUA 4U96A 7FDRA 2IJFA 4OKEA 2SXLA 4WIQA 4YQWA 3EE3A 2WTUA 1RKJA 1RADB 5CYMB 3RUBL 3A2FA 3ASMA 1AYEA 4YDUC 4BRKA 4BACA 1S6UA 4RBTA 1RBTA 5F0UA 5L38A 1WSVA 4LF4K 3QETA 3GCXP 1M0SA 1S99A 3LA0A 3VZIA 1RKIA 1LWFA 1M90O 3NH1A 3MEDA 4LFAJ 4NLBA 3QO9A 2DR7A 4NYOA 3HI9A 1U1LA 1PC5A 1NU0A 4OJ1A 3SQ1A 4FS1A 3MN9A 4DL4A 4DEZA 4JI6J 3D54A 1ZPWX 5CA5A 2N82B 1P6TA 1WKLA 2HWTA 4H5RA 5GIOA 3KKRA 3SQGA 5AQHA 2POKA 3ULEB 3CJKB 5J2QA 3TTDA 5LMUF 4M5JA 1ZA2B 4ZVUB 3QPIA 1FRHA 4QU7A 3H3NO 1NXIA 4WE1B 3O3GA 1UP1A 2H54B 1I94K 4N7TA 1FRKA 1UL3A 4OO1J 2GX9A 2UXCJ 3NAEA 3PRBA 3UO0A