1JLFA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
539
structure length
538
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 133
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlfA05
4ZHRA 3RAXA 4E7IA 4U7CA 2YV0X 1JL1A 3VQAA 4CF2A 3FFIB 4IKAA 1LW0B 5HROB 1SL0A 2AGOA 1WSEA 1S0MA 3VQ6A 2D5RA 2OPQB 2GIRA 3T5JA 1KLMA 1WSHA 4LH4A 5KTQA 4K4YA 1KTQA 1RAJA 1S49A 5KT7A 1NNDA 1LWFA 3NGIA 4CJVA 2QXFA 3K5LA 4GC6A 2W8LA 4DTOA 1T03B 4ED8A 1JLGA 3VN5A 1RBTA 1REVB 4CEAA 3BSOA 3OYMA 1SKWA 1TKXA 5F8IA 3AVAA 4ELUA 4DLGA 4LSNA 1RA7A 3C6TA 5KG7A 4C8NA 5KFOA 2KZZA 4K4WA 4DS5A 4EO8A 3C6UB 2UVVA 4N76A 3KK2B 3D28A 1JKHA 4OL8A 4O3QA 4KHMA 2JEFA 1C0UA 3SJJA 1G15A 1JIHA 4KHRA 2BDPA 4FBTA 1VSHA 2DFHA 4R0EA 1C1CB 2W9BA 5CZ1A 1UWBB 2QE5A 5HLFA 5L1KA 1RT6B 4O5BA 1S9GB 1U48A 4FJHA 4CHYA 1B92A 1KFSA 4I7FA 1HQUA 2VWJA 4DFKA 1YVFA 2BGGA 1Q9XA 4ZVHA 4LQ9A 5KI6A 2R2RA 3ISND 1JX4A 3SNNA 5EWGA 4O44A 4K8ZA 1W25A 4FW1A 2IOCA 4KHWA 3MFHA 3U3GA 3TAGA 5I3UB 3QERA 3OYEA 3I0RA 2WCXA 1JLAB 3EZ5A 4IR9A 4ZPDA 3ITHA 2FLLA 3SZ2A 2YKNA 4CHNA 5D3GB 4FJXA 2RN2A 2WTFA 4FJ7A 3NAIA 3Q8QB 2HHVA 2IAJB 1HNIB 3LANA 3H98A 5KT2A 4CJKA 3PX0A 2ILYA 1ZTTA 3NBPB 5KFVA 4Z4IA 4NLOA 2HWHA 4M3YA 4RNMA 2EC0A 3KKRA 1SV5B 3AA3A 4FJNA 2IA6A 4RW6A 4I2PB 3VQ8A 5CYMA 3CFOA 4CJ4A 2FVRA 3QLHB 4DFMA 1JXLA 1IKWA 4FBUA 4KSEB 5DLFA 2R8KA 1S1VB 1RBUA 4EO6A 3MEEB 4K8XA 1JLQB 3KLEA 3LP2B 4ECWA 1K6YA 4DMNA 3I0SA 4Q8FA 1ITGA 4CGDA 1R0AB 1HPZB 3AVLA 3KJVA 4K4TA 5C24A 1S97A 5DMRA 3DRSB 4Q8EA 2B6AB 3SFUA 3SI8A 2BANA 4IG3B 3VQDA 4ID5B 3CIZA 1C1AA 4PWDA 3VQ9A 4E7LA 1JXEA 4F8RA 4IFVB 3C95A 4DTMA 3RB4A 3TAQA 1RCHA 1S5JA 5F8NA 1DTQA 4NYFA 3QEWA 3HKWA 1NK0A 2I1RA 4Z0UA 1F21A 3PX6A 5KFBA 3IS9A 5KFPA 4ZTJA 1VRUB 2ZE2A 1NJYA 4CEEA 3BJYA 3H5XA 1S1VA 2D41A 3P5JA 1SKSA 3HVAA 4B3OA 4J2EA 4IH6A 3PY8A 4OLAA 4EYIB 4CJPA 4DG1A 1HYSA 3NAEA 1WNEA 2YNHA 4Z4EA 1KSPA 4NLWA 2A1SA 4IG0A 3AO2A 3HSTB 1HNVA 1FK9B 2G8IA 3CDUA 4MK9A 3DMJA 3AVKA 4BE1A 3QEXA 4RW4A 2Z1IA 2D0BA 2KZMA 4WXOA 1D9DA 4FJIA 4N56A 1YTAA 1TVRB 3GIIA 4KAIA 4CJTA 2Y1JA 5KFZA 3EY1A 1L5UA 1C1BB 3CJ4A 2ASDA 1EETA 1S1WA 4KFBA 1TP7A 2FJWA 4OLBA 3PW0A 5T7BA 1VSMA 3ASMA 4NLGA 3V1RA 5DGBA 3KLVA 3JYTA 4M3TA 2B5JA 4UQGA 1U49A 4FK4A 4ECVA 3SQ4A 2IC3A 4BWJA 3ZCMA 3RB6A 3NF7A 3TI0A 1IO2A 5KG6A 2BE2A 2ZKUA 1C2PA 2W9CB 2OPSA 4CGGA 3SCXA 4FJ5A 3BGRB 4IKFA 3ALYA 1WSIA 1EP4A 3AA4A 4KI4A 1Z4UA 3I5CA 1Z26A 3ZT2A 4CHPA 1J53A 1RDRA 2BR0A 4E7JA 2V4QA 1NK6A 3O3FA 3FSIA 4N47A 4Q43A 1KCFA 1U47A 3CM6A 3BQ0A 3V9WA 4QWBA 3KK1B 3ZSZA 3ZSYA 4WZMA 3OHAA 4EEYA 2G8KA 3QZ8A 1IKYA 5CYQA 2AX1A 3ISNC 3DRRB 4R8UB 2XGQA 1BQNB 4KV8B 3CJ5A 1BCOA 3P1GA 4DL6A 5J2NB 4IRKA 4O4GB 3CM5A 4RW8A 3KLIB 2O5DA 4RZRA 3NGYA 4CESA 4WE1A 4XPCA 1VSIA 5JS2A 4NCGB 3DOKB 1L3SA 3V6JA 3BQ2A 4CFDA 4NLRA 1X9SA 3LAKA 3VQSA 4Y1CA 1RT1B 3S9HA 2VG7A 2RDIA 2XCPA 3RMDA 2ATQA 1FKPA 3DRPA 2HNYB 4BDZA 3K5NA 3HPOA 5KRSA 1T05A 2OPPB 1LWEA 3PJXA 5DQIA 5F9NA 2NUBA 5SWMA 4CEQA 3KHRA 2YKMB 4JUZA 1VSEA 3PZPA 1VSDA 3TQ1A 1RDDA 2UUWA 1YT3A 2JC1A 3LZJA 4KREA 4B8CA 1S0NA 4PUOB 1S9EB 4DTXA 3H2LA 3V81B 2KW4A 4FM2A 2VG5B 3OSNA 1O1WA 1GOCA 3DLKB 1J54A 3OYDA 5KG0A 5DG9A 5DK5A 2V9WA 4RNNA 1I6JA 4XO0A 5KFCA 1BIUA 3V6DB 4H54A 5CY4A 1JLFA 2P5OA 5HRRA 3QGGA 4LY7A 2E6LA 5L1IA 4NYZA 3M8SA 3SV4A 1RT7A 4J9OA 4H4OA 2WRMA 3KHGA 2RDJA 4FJKA 4R5PB 4NCBA 5KFYA 5J2MA 3MEDA 2BRLA 1JLCA 4Y1DA 4M94A 4FS2A 2HNDA 4JLHA 2E4LA 1RT5B 3LWLA 4CEDA 4QW8A 3E01A 2KTQA 4X2BA 1NK5A 4J2BA 4FLTA 2Q3SA 1NOYA 3V4IB 5HBMB 2HWIA 3IG1B 2VG6B 4YR0A 4H4MA 3AV9A 2WK4A 1TV6B 1N6QB 4W5OA 1T3NA 1D1UA 3S3OA 1DTTA 3L3UA 4FJ8A 1RDAA 1EXQA 1QSLA 3DOLA 2O4GA 1DLOA 1B9FA 2Z1GA 1U45A 2RKIB 4YR3A 3AVIA 1BI4A 3ULDA 5KFLA 2JEGA 3V9ZA 3L2WA 1RTDB 1I3AA 4LSLA 2RF2A 2CJQA 1QE1B 4B9UA 1BISA 1RTJB 3JSMA 3MXIA 4Q5VA 5J1EB 1JXBA 3D45A 2R2UA 4DQQA 1S6QB 3WNEA 3PW7A 3HVRA 3DLEB 1IKVA 4IQXA 2YNIB 4RUCA 3L2VA 1RYSA 4KKOB 3ICLA 3VQEA 3TARA 2X78A 1S6PA 3GYNA 2EHGA 4M42A 2W8KA 4CF9A 2KQ2A 1RT3B 4AHVA 2FJVA 1Q8IA 3I5AA 3T3FA 5KFHA 4YR2A 2OPRB 3NL0A 3OS1A 4GW6A 3HVTB 3MECB 1D9FA 4ID1A 3PO4A 1TL3A 3GIMA 3B6PA 4ICLA 4DF8A 3M8QB 1RT2A 2HMIA 4PQUA 4ZTFA 1J5OB 3QINA 3FQLA 1U09A 4J9MA 2IJFA 4YFUA 2W7OA 1QUVA 3PX4A 2E6MA 1GOAA 4CJWA 4ELVA 4DSKA 4GVMA 3BSCA 1IM4A 1BQMA 3QO9A 3ZSXA 3KK3A 4B9NA 4DU1A 3NGDA 4CF8A 1MMLA 3HJFA 4IDKA 3QYYA 2P1JA 3WNHA 1A5XA 1VRTB 3SPYA 4OVLA 3OYKA 4PA1A 1RBVA 3MTKA 4DTSA 2W7PA 5HP1A 4J9LA 2IJNA 2V0NA 3TAFA 4RW7B 3LP0A 1JL2A 4CGFA 1TKDA 4IRDA 2YNFA 3RMAA 3H08A 1KHVA 5F8JA 4O3SA 1SL2A 3FQKA 1ASVA 4HUGA 4ZMMA 3VA3A 2OA8A 1TK5A 4WFXA 1S1UA 4G3IA 2V4RA 3CO9A 4RU9A 3PW4A 1KVBA 4HVJA 1J9AA 5I42B 2HHUA 2C22A 2DFFA 4M95A 4JRQA 3OHBA 1NKEA 3NH0A 3FFIA 3U6FA 1LW0A 5HROA 4BACA 4ED3A 3LP1B 2FJXA 3U3YA 3ZT3A 2OPQA 5KFIA 5DG8A 2ALZA 3NKYA 4QW9A 5KG5A 3EYZA 2HNZB 3OYCA 1WNSA 1IKXB 3CJ3A 3FDSA 2XI3A 3G0ZA 3F73A 1LAWA 4FLVA 3C94A 3RBEA 5FROA 1T03A 3CDWA 3HVWA 4EBEA 1REVA 2AWZA 3DLBA 2UVRA 1RA6A 3SUNA 3KD5E 4I9LA 1HMVB 4CIFA 4PY5A 3VQBA 2FVPA 4J9RA 4F4ZA 4CJ5A 1XI1A 3KTQA 1IG9A 1MU2B 4IR1A 2LSNA 3AO4A 2BQ3A 3C6UA 3T1AA 1KRPA 3KK2A 3HO1A 3K59A 4GC7A 2D0CA 3G6YA 1VSKA 2EX3A 4Y2AA 3HP9A 2G8HA 3EPGA 4DL7A 1EX4A 1SKRA 1C1CA 4KAZA 3NH2A 5EWFA 4CECA 5KFNA 1UWBA 3H5SA 3ZSQA 2R8IA 1RNHA 4FK0A 5KFUA 1RT6A 1S9GA 4J9NA 3TAMB 2ZQBA 4F4XA 3CFRA 5EUHA 5EDWA 4QWCA 1NK7A 1T7PA 2JEJA 4QAGA 2VA3A 4KTWA 1RDCA 4BWMA 2PY5A 1SH2A 4DTNA 2HHWA 2FLPA 4DSIA 3VQQA 4FLXA 3OYNA 4YQWA 3SQ2A 4NLQA 3OYHA 4EZ9A 4B9MA 4O0JA 4KHYA 5I3UA 3SUPA 2OZSA 4FYDA 2WOMB 2FVCA 1TK0A 3OYJA 3GQCA 2ZD1B 1JLAA 4ECRA 1NKCA 1K1QA 5E41A 4Q0BB 1JLBB 5D3GA 5F8HA 4ZPBA 2FBTA 4KHNA 4E3SA 2IAJA 5J2QB 1HNIA 3DM2B 4ED0A 3OL7A 5DQHA 4TLRA 3N6LA 1NJXA 3H40A 4B08A 3Q8RB 3NBPA 2I5JB 1D5AA 2FVQA 3EZUA 4J2AA 3N6MA 4AILC 1SV5A 4I2PA 3BSAA 3MEGB 4BDYA 3QLHA 4QWEA 5KFWA 4DQSA 3TANA 2R8JA 3PR5B 2RPIA 3VQCA 4TY9A 2FLNA 4EYHB 3LPTA 3P83D 3MEEA 4NLPA 1JLQA 3LP2A 4MFBB 3PW5A 4CGIA 5J2PB 3ZSVA 4IRCA 4FJGA 3MR5A 3KLFB 4NCAA 1SH3A 3RBDA 3QGIA 1R0AA 1HPZA 2F96A 4Y3CA 3DRSA 3PR4A 2B6AA 4CEFA 4IG3A 1X1PA 3BSNA 4JS5A 4ID5A 3DI6B 1OS5A 3UIQA 3KLHB 3CDEA 1S1TB 1KVCA 3K2PA 5KGWA 3O4NA 4IH5A 3G6XA 3D5MA 3A2FA 4IFVA 2CKWA 2HAIA 4MQ3A 4B9VA 5CZ2A 4CHOA 4MIBA 3QESA 4M3ZA 5FDLB 4K4ZA 1C6VA 3HYFA 3GV7B 2BRKA 4O4RA 3BREA 1RT4B 1LWCB 1VRUA 4KHSA 1N5YB 4URGA 4RNHA 2HW3A 1RTHB 4DWIA 4DTPA 3QIDA 5F8GA 5KFDA 5HRPA 3ZSOA 3HP6A 5KT3A 3CJ0A 4KTZA 5C5JA 3T5KA 3V1OA 4MKBA 4NRTA 4DU4A 5KRTA 1VK0A 4FCYA 4G1QB 5KFJA 3LAMA 3DDKA 3QEVA 4DL2A 1FK9A 1HQEB 1YTUA 3LWMA 3DYAB 3GV5B 2UUTA 4ECTA 4FM0A 3BDPA 1QAJA 4KHQA 5KT4A 3LPUA 3WNFA 4AHSA 1TVRA 4Z4CA 2GC8A 4KO0B 3QIPB 4BE0A 4FZXC 3MFIA 4B8AB 3T19A 1C1BA 3L2RA 1NJZA 5KFEA 1L3UA 4CJSA 4DS4A 3NAHA 4E7HA 4CIGA 4RNOA 3RTVA 1TAQA 3THVA 4K4UA 4DL5A 1VSJA 1TQLA 2FC0A 4ZVEA 3PW2A 3OYLA 2WONB 1S0OA 2R7YA 1NJWA 4JS4A 2HVHA 1KHWA 5C42B 4WFZA 2W9CA 1RDBA 3BGRA 4FS1A 4EBDA 4IFYB 4EZ6A 2HHXA 3V6KA 2XO7A 1NKBA 1GX6A 4TYBA 4CFCA 3H59A 4J2DA 3RWUA 3KK1A 5C25B 3HK2A 3CWJA 5K14B 3MAQA 1TL1B 2IM2A 1WAJA 4CCHA 3OYGA 3AVMA 4QOZB 3AA2A 3KLGB 4F3OA 3DRRA 2Y1IA 1S1XB 4OKEA 4R8UA 4DFJA 2VA2A 3IRXB 2DPJA 1TKTB 1BQNA 4KV8A 2HHTA 1WAFA 3AVFA 4M3UA 5J2NA 4O4GA 3M9MB 3KLIA 4RW9B 3V9SA 1VSLA 2R2TA 3QNOA 2IDOA 1FKOB 4NCGA 4O0IA 3DOKA 4HCBA 2Z1JA 3DLGB 4HTUA 3OL8A 2A1RA 2JEIA 1RTIB 4TSXA 1RT1A 3M9NB 1LW2B 4M3RA 1TKZB 3QETA 4DL3A 2C28A 4ZP9A 2G8FA 2HNYA 1JLEB 2FBYA 4B9SA 4KHUA 2OPPA 2Z1HA 3V9UA 4AH9A 4OPKA 4DSEA 3O4QA 4C8OA 1TK8A 2YKMA 4N41A 2WB4A 3RB3A 4Q45A 4Z4HA 4ELTA 3KKSA 4ZPAA 1CXQA 4YP3A 1QSSA 4ZP8A 4K4XA 4URQU 4PUOA 4TY8B 4ECQA 1S9EA 1SUQB 4FZZA 3V81A 2XGPA 2VG5A 4FW2A 3DLKA 4I2QB 4DU3A 3NFAA 4WFYA 1ZETA 4KRFA 5KG1A 4N5SA 4E1NA 4CK3A 1LV5A 1XHZA 1C0TB 3M8PB 3ZSWA 2IMWP 3V6DA 4CJUA 3I8DA 2QK9A 2KFNA 2YNGB 4OGEA 1XR5A 2UVWA 4F2SA 4FK2A 4NLXA 4NZ0A 1HRHA 1WSJA 3HL8A 4MH8A 4ED2A 1X9MA 4ZHRB 1N4LA 4R5PA 3PHEA 3OYFA 4CGJA 5KFFA 3IN5A 5T14A 4IBNA 2G8WA 1EKEA 1B9DA 2F8SA 1RT5A 4IH7A 2X6SA 4BDPA 4HCCA 1TAUA 1U4BA 2IS3A 1KLMB 4J9KA 3MXJA 3V4IA 4C8LA 5HBMA 4FVMA 3IG1A 4F3TA 3NE6A 2AX0A 3V9XA 3ZT0A 1LWFB 1CSJA 2D3ZA 2VG6A 5DLGA 2HHSA 3QNNA 1TV6A 3NH1A 4CFBA 2B4JA 3NDKA 1N6QA 3OVNA 2DPIA 4E0DA 4M3WA 1JLGB 3EPIA 4ECZA 5JXSA 4NLUA 2BQUA 1TKXB 4E89A 4YNQA 1D0EA 2XY8A 3G86A 5KFKA 2UVUA 2E9ZA 4CHZA 2J6UA 4LSNB 1WN7A 3C6TB 2RKIA 3PO5A 3KMSA 4WYLA 4E7KA 2X6NA 3UDLA 3HHKA 2JLEA 1RTDA 3HT3A 1HARA 3TABA 1JKHB 3K5MA 4KI6A 1QE1A 2BQRA 1RTJA 1C0UB 5J1EA 1UOCA 5SZTA 3MR3A 3CYMA 4RUAA 3I5BA 4MIAA 1HYZA 1WSFA 3Q8SB 1S6QA 3CFPA 2W9BB 1T94A 2XY5A 1S48A 3DLEA 1Q9YA 2YNIA 5HLFB 4MK8A 2IM0A 3QEIA 4KKOA 3NF9A 3FRZA 4ZP7A 4RNFA 2ASJA 4I7FB 4HYKA 3L8BA 1HQUB 3AVGA 1RT3A 4K4SA 4CJ3A 1Y97A 3GIJA 2OPRA 4B9TA 3CJ2A 3HVTA 3MECA 1C0MA 4NLSA 3VQ4A 4O44B 3M8QA 4M45A 1J5OA 1KFDA 4E19A 3CQ8A 4KE5A 3I0RB 4FXDA 1RBRA 1KLNA 3ITHB 4FLZA 2YKNB 1NK4A 3H4DA 4CK1A 3H5YA 3PJWA 1GOBA 2KFZA 4ZPCA 2W9AA 4NLTA 4ZVGA 3DLRA 1QSYA 4DTRA 5L1JA 1VRTA 2GUIA 3L2QA 3LALA 3SI6A 1KVAA 4RW6B 5JUMA 1NHUA 4HUEA 4CHQA 5CYMB 4RW7A 5KG2A 3HPGA 2J6TA 2E9RX 3QIOA 4CEZA 3LDSA 1IKWB 1D8YA 2P5GA 4I9QA 4CF0A 2DY4A 3HXMA 1QTMA 3OJUA 3KLEB 3RR8A 4OPJA 3UQSA 4ED6A 4ECSA 3I0SB 1BHLA 2XY7A 2IM1A 3NMAA 2XHBA 4XIUA 5L9XA 3VQ5A 4KB7A 3OYAA 1RYRA 3Q8PB 5I42A 4CERA 5KFGA 4FJMA 3KJVB 2PZSA 3AA5X 5C24B 4U6PA 3ZT1A 3RRHA 2BANB 3TR8A 3QEPA 3OY9A 3L2UA 4ECYA 4J9PA 3VA0A 3O3HA 3IAYA 4CFAA 3LP1A 4PWDB 3AVJA 3SPZA 1U04A 3CG7A 5HRNA 1W9HA 3TVKA 3KHHA 4CF1A 3SUQA 3HPHA 4RG8A 5F8MA 4DSLA 4FM1A 1DTQB 2HNZA 1CLQA 4Z4GA 1IKXA 3H5UA 2QKBA 1BGXT 4JV2A 1ZBFA 3IS9B 4DQPA 4JV1A 2ZE2B 3RB0A 2IM3A 5HRSA 2YHAA 4LQ3A 3SQ1A 4KTQA 3NHGA 2DTUA 4K50A 1HMVA 4B3OB 3CVKA 2O4IA 4HKQA 3PUFA 4M41A 4DG1B 1HYSB 3AO3A 1ZBLA 1MU2A 4NLVA 3D0PA 1N48A 2YNHB 4Y34A 4IG0B 1HNVB 2W42A 5L1LA 1QS4A 2XY6A 3DMJB 3BR9A 4CK2A 2ASLA 3IGNA 4WXWA 4RW4B 4MKAA 4O3OA 3ZSRA 1NOZA 2OH2A 3SQ0A 3NF8A 2D7SA 4YMEA 1BIZA 4F4YA 2OYQA 1W0HA 3TAMA 4O3RA 3UPFA 4AHUA 4TQRA 4EBCA 1EETB 1S1WB 1YVUA 2XCAA 4KFBB 3O3GA 4OGCA 2G8UA 3MXMA 3QGHA 3JYTB 3S3MA 2AQ4A 2B5JB 1QHTA 4ECUA 5KFAA 2QV6A 4DL4A 1K1SA 4CEBA 4KB0A 2F8EX 4GMJB 3RRGA 2IC3B 5DQGA 3V6HA 3UR0A 4C8KA 1L3TA 2BE2B 2JC0A 2WOMA 4FJJA 1NK9A 3SV3A 2ZD1A 2OPSB 3IGVA 1XHXA 2B43A 2HB5A 4Q0BA 1JLBA 1EP4B 4ECXA 1BCMA 1TGOA 3TWHA 4DQIA 2E9TA 3E51A 1L3VA 3OL9A 4JV0A 4F2RA 3M8RA 3TAEA 5J2QA 3DLHA 4FZYA 3DM2A 1BL3A 4CGHA 3NGZA 4Z4FA 4NRUA 2IGIA 3T5LA 2PYLA 1A5WA 2I5JA 3BQ1A 4DF4A 3MR6A 3KIOA 2F8TA 2P51A 4FLUA 4WYWA 1IKYB 3V1QA 5CYQB 3MEGA 4MK7A 2AGPA 1S9FA 5EU7A 1ZBUA 3K5OA 4CJFA 3OJSA 4RW8B 4WE1B 3LZIA 4FLWA 3NF6A 4MFBA 4J9QA 3OYIA 5J2PA 3S3NA 2QKKA 4ED1A 2FBVA 1FXXA 1HYVA 3KLFA 5KG3A 3QZ7A 2IBKA 4LH5A 2C2EA 3KMQA 2FBXA 3GIKA 4F50A 2VG7B 4AHRA 1WSGA 4J9SA 1FKPB 3DRPB 2D0AA 4DFPA 3DI6A 1T05B 1I39A 2R2SA 2C2DA 3KLHA 1S1TA 4TYAA 1LWEB 5KT6A 4H8KA 2GBZA 4FJLA 2WHOA 4TN2A 1ZBHA 4HUFA 3HM9A 3MF5A 3ZT4A 5FDLA 2FVSA 3KOAA 3PV8A 4O3NA 3AVCA 3NCIA 4DTUA 5DGAA 2OZMA 1CZ9A 1RBSA 4HHTA 2VWKA 1RT4A 1X9WA 4CJQA 1LWCA 1N5YA 4CJEA 1RTHA 4EP5A 4CJLA 4TXSA 4KBIA 3AO5A 4C8MA 4DTJA 2YHBA 4ZVFA 1SL1A 2G8VA 1NHVA 1JLFB 2C2RA 4G1QA 3RAQA 4Q44A 1NK8A 1RT7B 4H4OB 5F8LA 2GV9A 5KG4A 1HQEA 5KGXA 2D3UA 4QCLA 4L8RB 5KFXA 5J2MB 3MEDB 3DYAA 4B9LA 1JLCB 3K58A 2ATLA 4CJRA 3AO1A 3OLBA 5F9LA 4AHTA 2HNDB 1QQCA 3AVNA 4M3XA 5FRNA 3E01B 3G6VA 4KO0A 3QIPA 3M9OB 3T5HA 1SH0A 2GIQA 4F4KA 2X74A 1ZBIA 4NYNA 2R8HA 2ILZA 3OS0A 3KNAA 3F9KA 4H4MB 3OL6A 2ITGA 4IOBA 4ZP6A 2XI2A 4CIEA 4W5QA 3SYZA 4KPYA 1T8EA 1DTTB 5KFMA 4QPXA 1XC9A 3PVXA 1LAVA 2WONA 3DOLB 1DLOB 3H4BA 3L3VA 1QAIA 3GV8B 5C42A 4DQRA 2XC9A 4O55A 1BI4B 3KHLA 3N6NA 4CEOA 5JS1A 4IFYA 5FRMA 3LP3A 3SFGA 4LSLB 4O3PA 4K4VA 2RF2B 1UAXA 5KFTA 1HJRA 2AJQA 4QWAA 3JSMB 1CXUA 1N56A 3TAPA 3MR2A 3VQPA 1ZTWA 2AU0A 4ED7A 5C25A 4W5NA 3K57A 5K14A 3RMBA 2AGQA 4F4WA 1TL1A 4W5TA 1IH7A 1UA1A 1IKVB 3KLGA 4FJ9A 3G10A 3OYBA 1S1XA 1VSFA 5DG7A 3IRXA 4BE2A 1TKTA 4W5RA 2XWYA 4JRPA 3VQ7A 1S6PB 4DSFA 3SUOA 2J6SA 4RW9A 3OS2A 2R8GA 5KT5A 1FKOA 5KFQA 1GX5A 3RMCA 3DLGA 3GILA 5EWEA 1RTIA 1ZYQA 4Y2CA 1S4FA 4AHCA 2PYJA 2JGUA 4E1MA 1UA0A 1LW2A 1TL3B 4WZQA 1TKZA 4ICLB 1RILA 4PQUB 1RT2B 2HMIB 1XR7A 1ASUA 1CZBA 3AVHA 4LD0A 1XWLA 1JLEA 3AVBA 4OJRA 4OKKA 4DEZA 4CE9A 1Z25A 3OSPA 4OKJA 5KFRA 1BQMB 3QO9B 3KK3B 3OLAA 4IDKB 4FLYA 2XRIA 2HVIA 4DLEA 5HP1B 4TY8A 1SUQA 3LP0B 3RR7A 5KFSA 2YNFB 2DFEA 4QWDA 4URSA 1WLJA 3KD1E 1S10A 4I2QA 4EP4A 1C0TA 3B6OA 3M8PA 4KB1A 1A5VA 4NLDA 3WNGA 2HHQA 2YNGA 1S1UB 4DSJA 2ETJA 4TQSA 1XR6A 4NLYA 1ASWA 4XPEA
chains in the Genus database with same CATH superfamily
4ZHRA 2CQ3A 4FYVB 1RCOB 3BUZB 1RP5A 3DU6A 3IFEA 1RCXB 5HROB 2QN6B 2AGOA 5HL7Q 1S0MA 3VQ6A 2D5RA 4BRMA 2GCFA 5KTQA 3W5YA 1DRZA 4K4YA 1KTQA 2IIHA 1S49A 2QWNA 4USJC 4CJVA 2YI1A 4GC6A 4TNOA 4LRAA 4WFNL 4DTOA 1NEEA 2O8BA 2QX0A 4DV6F 3R3TA 3VN5A 3OYMA 1X5PA 1U7LA 4KR0B 1YBAA 4IO1A 4DLGA 5IV4A 3DXKB 3VESA 4DV0K 4K4WA 4DS5A 3S1TA 2HFUA 2E5JA 3D6MB 4IOAL 4OYWA 5ETMA 1F9EB 3KK2B 2CZ4A 4N76A 1UEUA 5AFUH 2RILA 2VU5A 1F3FA 3K17A 4NMXA 1G15A 2ZNZA 2NXUA 4FBTA 3H45C 3CC2S 2B4OA 1N34J 1UWBB 1CC7A 2QE5A 3FZBA 5HLFA 2QO3A 4DDFA 3MX5A 2R7VA 1VDHA 4FJHA 4NOHA 4CHYA 2Z4PA 3C15A 1F9FA 2YWFA 2RQCA 1HLUA 2VWJA 1YVFA 1QTNB 1UW9A 5GAHI 2R2RA 3CMAN 2ASOA 2LYVA 1T11A 5F0XA 2BV3A 2X3GA 1SJQA 4FWSA 1W25A 5E2QA 3T1YJ 3AGKA 4KHWA 3ZZ0A 3MFHA 3U3GA 3GFHA 3IBFB 5I3UB 3FVYA 4P2FA 2OEJA 3G4SS 1NH7A 3I0RA 2WCXA 1JLAB 1AB8A 1VQON 2EK1A 3CPWM 2FLLA 1YBUA 4FJXA 4DR3K 4FJ7A 3NAIA 1NCLA 2MTLA 4DR6K 1W2IA 1CULB 2P9SB 4CM2A 1H2UX 1Q7YT 3W3DA 3VHQA 2M8HA 2V8PA 1V3RA 1DAXA 2HWHA 5EX3A 1SV5B 2IA6A 4RW6A 2ZH1A 2HFOA 4I2PB 4V19J 2FVRA 3TPQA 4DV4K 3VEYA 2PFFB 1S1VB 4ZA1A 3R5JB 3KLEA 2WSCC 5F1XA 1K6YA 4BRKA 4AM6A 4DB3A 3NVMA 1IR2A 1Y4ZB 2W7AA 1M5HA 3K5PA 1B0VA 1K47A 4K4TA 3E2EA 4LFBK 1S97A 3DRSB 2BJEA 1NU4A 3CCUS 3SI8A 2M70A 5JVGL 1VISA 2QWLA 3VQDA 4Q7AA 2PC6A 1RADB 3IBCB 3IC1A 2P9NA 3VQ9A 4BQLA 5IT9Y 3IM8A 3WDOA 1IBLJ 3TAQA 3D6HB 3DOMA 2MSSA 4K5SA 2YX7A 3HKWA 1NK0A 5EY4A 2X1GA 5ETQA 2W4PA 4JD2A 4CEEA 3H5XA 4IO9L 3OW2M 4I68A 4I6MB 4BS2A 5ETOA 1SKSA 2IDEA 4B3OA 4J2EA 1UFWA 1RBOB 1PBUA 2WVCA 2YNHA 2XS7A 4RWWA 2YH1A 1CS4A 2RMLA 2G8IA 4MO4A 3O44A 3F2KA 3KG0A 4KHPF 3F9MA 5DM7L 3GCXP 4R0JA 2DNPA 3KHYA 3LGMA 4JK7A 2V67A 3BP8A 4LF2A 3U1LA 4U9RA 3W7BA 4CJTA 5EX0A 3EY1A 1L5UA 2OTLS 3CJ4A 4BR0A 1F0XA 2ASDA 3VVTA 3PW0A 4YY3K 3ASMA 4NLGA 5DGBA 3ENQA 2RU3A 4FN5A 3U9DA 3K7RA 4FK4A 4ECVA 4AE5A 3SQ4A 3HHLA 1P9YA 3I9V9 3CSKA 3RB6A 1VLYA 1IO2A 5D4LA 1WELA 1C2PA 1OY6A 1X5SA 3QJPA 4CGGA 1OIAA 4EWTA 4IKFA 3MPDA 3R97A 3ETOA 3I5CA 1RWPB 1J53A 2Z2YB 3UR3C 4NO7A 3N28A 3MGJA 3ZTQA 1NK6A 3FSIA 1HFEL 4Q43A 2G1DA 1U47A 3CM6A 3BQ0A 1W2BM 2UXBJ 3F41A 2HGLA 2KFYA 4WZMA 2G8KA 3J8AA 1B70B 4DPTA 5FIIA 2XGQA 3L7PA 5J2NB 4B3MK 1AFIA 4IRKA 4RW8A 3NGYA 1TELA 2XSJB 3US5A 4ISFA 2J8SA 9ATCB 1N36K 3DOKB 3THXB 3O80A 1KD1T 1X9SA 3LAKA 3VQSA 3M6XA 5IM0B 4DHYA 1Q5VA 4GKKJ 3HPOA 4CZFA 1LWEA 3PJXA 2R7TA 2DH8A 2CH6A 1N32F 2CDRB 1VSEA 3PHTA 3PZPA 3B8HA 3TQ1A 1KAXA 4DN0A 3J81U 2VICA 2UUWA 3A5MC 1WKLA 4E1JA 2VBXA 3H2LA 2KW4A 3JSRA 1PJ7A 2HHPA 2V9WA 3CCJN 1N8RO 2K1RA 2HQFA 3G71N 1I6JA 1YI2S 1BHNA 1GXUA 2ZM6J 4A8MP 5CY4A 2JOQA 5HRRA 2XZWA 2JHEA 3JS9A 1R43A 1EAYC 5L1IA 4NYZA 3CCQS 3SV4A 4H4OA 2DJWA 1U1LA 3L4IA 2CPXA 4H0OA 3K9KA 5J2MA 4F4AA 5LJVA 3TZYA 4CP5A 1FFGB 1V3ZA 4F0MA 2E4LA 4DR2F 3F0NA 1LQ9A 1R89A 1HR0F 3V4IB 1OSDA 4LF8J 2N4CA 4DCOB 2HWIA 3IG1B 2HWTA 4CT8A 3CJTA 4AT1B 4LSZB 3D2FB 1SBRA 3H1VX 4H4MA 1HNWJ 3MHYA 1F60B 3GYXB 4U67Q 3IAS9 2G2OA 2GWJA 2UXDJ 1QSLA 2X1FA 2O4GA 1DLOA 1NMNA 1XMBA 4YR3A 3IMXA 4CH1A 3IKMA 1HWJA 4OYMA 3L2WA 2B9XA 2OSRA 4LSLA 2RF2A 1TUGB 1FW6A 5HQ8A 2CQPA 1BISA 4YDUA 2G0CA 1SJ1A 2M2BA 4MKVA 3I4HX 3VMFB 3CC2N 4DV5F 3H3NO 3O6QA 4CLSA 5A2QO 1RYSA 2O8FA 4KKOB 3C14A 5LMNJ 3VQEA 1S6PA 3AGRA 2VJVA 4M42A 3WIUA 3FBBA 1RT3B 4OMFG 2JJ4D 2FGCA 3OXFA 1WF2A 3W3SA 3BBCA 5KFHA 3NL0A 3HVTB 4W98A 1D9FA 2JVRA 1HWUA 4ID1A 1RAHB 3GIMA 3M8QB 2MGZA 3QINA 2VODA 2C2KB 3ZTPA 3G4SN 3X3UA 1XBWA 4QYRA 4NASA 4YFUA 2W7OA 1QUVA 1GOAA 2VFTA 1N33F 1EQMA 3MMBB 5B08A 2ZBCA 4DU1A 1TU0B 1MMLA 3W9JA 4NXNK 1M5KC 2VH7A 4F25A 3QYYA 3A12A 4L3NA 3SPYA 2G13A 4PA1A 3EE3A 3ILOA 3NCRA 4C7QA 2W7PA 3DNCA 2VQFK 3LP0A 4WFNQ 2B0GA 1V4SA 4IRDA 4JYAK 1Q8BA 5KQDA 3RMAA 3OA9A 4CI6A 4NYPA 4O3SA 1SL2A 4ZOSA 1SQKA 5CCMA 5C7PA 3OD2A 2P9LA 2OA8A 1NJIT 4WFXA 4ER8A 2RHSB 2V4RA 3MUTP 3BKUA 3FZLA 1WC4A 3PW4A 1KVBA 4HVJA 1BE4A 1J9AA 3SAHA 4C9DA 1VK3A 2HHUA 4UZCA 4QYZJ 1WHWA 2DFFA 4J5OA 4IOAQ 3CCUN 2IMOA 3OHBA 2PD1A 4H0XB 3M30B 4YDXA 2AW0A 2RS8A 2D0PA 2FJXA 3ZT3A 4JI6F 2OPQA 2QLWA 4JN4A 5DG8A 4FF1A 3OYCA 3AOCA 4JEPA 3G0ZA 3TJ8A 3F73A 3GJSB 4USKA 4FLVA 3C94A 3BGFA 3CDWA 4XK8C 1REVA 3DLBA 2UVRA 5K9FA 3UN3A 2HSTA 3VQBA 2FVPA 5DO2A 4J9RA 1NGCA 1XI1A 3G25A 2RRBA 3SBTA 3R7BB 4IR1A 4F04B 2BQ3A 1KRPA 3MCSA 4K2XA 3SBGA 3L7OA 3K59A 4GC7A 2MQNA 1VSKA 4Z37A 2M52A 4Y2AA 4X66K 2ZZNA 1SKRA 5L46A 1P8ZA 2RT3A 3LF0A 1RT6A 3TAMB 2HAFA 3TNVA 4TVAB 4F4XA 5AQYA 5EUHA 5LY3A 1M5SA 2MKKA 1NK7A 4M5JA 3H25A 1RDCA 3A5LC 3MD3A 2PY5A 3J7AN 2GNKA 2Y8YA 3OW2R 2HOEA 5AQXA 2JWNA 3HSZA 2Q36A 4PAAA 3VAGA 4ZVTB 1ZOTA 3SUPA 2OZSA 2FTRA 2ZF5O 3O6WA 1FE4A 2U1AA 5DZ6A 2EI5A 1HD1A 1QVFR 3KUEA 5JVGQ 1S5ZA 5E41A 3M2RA 1YJNN 5F8HA 1K8AO 2NUHA 2KHCA 5CYJA 3MMCA 3E9PA 1NJXA 3QJLA 1YJTA 3O9UA 2FVQA 1D5AA 3EZUA 3MMAA 4AILC 4QU6A 1S0VA 4BDYA 3HSGA 4LT6A 2VHGA 3TANA 1FJ7A 3JB9k 4V19X 2Q1NA 1IWGA 1U1PA 4NLPA 4IO9Q 3W8PA 3LP2A 2O8EA 1T02A 4HVZA 1P9QC 1Y3KA 3KJQB 4NCAA 2VBWA 3QGIA 1U1KA 5DDQC 1HPZA 1NPRA 4Y3CA 3GU0A 4FNHA 2B6AA 4K2JA 5E5NA 4IG3A 3NGKA 4K41A 2P5VA 1OS5A 4A57A 4IH5A 3NEKA 3G6XA 1IG8A 3P31A 3D5MA 2ROGA 4X65J 1W2BR 4JI1J 4OPHA 4B9VA 2GQCA 3OR2B 3QESA 4M3ZA 5FDLB 4K4ZA 3AA9A 1C6VA 1RXOB 3GONA 1VFJA 4BC3A 4O4RA 2GMJA 2AEFA 4URGA 1RHJB 5E3PA 2W24A 2FSJA 4L75A 2F65A 3CJ0A 1FRLA 4ILJA 3VALA 4MKBA 4O8UA 5KRTA 4FCYA 5KFJA 1B64A 1FK9A 1R6YA 4BY9C 3UO0A 3UDCA 2OANA 2H5IB 2KG1A 1UWAA 4J9UE 3GV5B 3A5OC 2K8GA 3BDPA 1PGZA 1Q86O 2E1MC 2W6LA 2HK2A 3WNFA 3WBZA 2GC8A 3UDEA 5GMDA 2WBNA 4FZXC 3EKSA 4B8AB 3L2RA 1NJZA 4CJSA 5D15A 3OFEA 3NAHA 4E7HA 4FSVA 4DV3F 2LU2A 3ZTSA 4DL5A 3CJKB 2DD8S 3CXCM 3MOJB 4JKFA 3OYLA 2A0FB 3Q0AA 2WONB 1S0OA 1NJWA 2CPIA 2HVHA 5C42B 1PCAA 3BGRA 1IWAA 2QGFB 1U1OA 4OI2A 4C0OC 3FEXB 4R25A 3HHNB 3V6KA 2BTFA 1HQ2A 2GX8A 2CXEA 5GAGI 4TYBA 4CFCA 2RQMA 2BM1A 3H59A 2R7UA 3CWJA 2I7PA 1EWQA 4YS2A 4B3RJ 4J91A 3AVMA 1HKBA 4ITSA 3KLGB 3DRRA 1ZPVA 1S1XB 2Y1IA 4DFJA 3I8BA 2GUPA 5LMUF 1BQNA 4ZJOA 4O4GA 3SCJE 2E1AA 3EUNA 4PWWA 2R2TA 2L3MA 4O0IA 4JI7J 4HCBA 1SKUB 2Z1JA 3DLGB 1VIXA 4HTUA 1UVKA 2HBZB 4BC9A 2E29A 5H9EJ 1KQSM 2CQCA 1LW2B 1GXTA 3PJ9A 1FE0A 3QETA 2BUPA 4NX9A 2VQEK 4DL3A 2HNYA 4KJIA 4OZNA 4DUYJ 2OPPA 4LFCF 2FF3B 2HPUA 1SI9A 2F8MA 5FPDA 2WB4A 4WQ4C 1U0SA 4Z4HA 4ELTA 2ZVIA 3KKSA 2EVZA 1CJKA 2AZ3A 1QSSA 4ZVOB 4I0WA 3CCSS 1T9TA 3ZZTA 1Q18A 1X4AA 3HDSA 4IXCA 4PZVA 2CDQA 3V81A 3W2VB 2VYPA 3DLKA 4DR2K 5CZXA 3NFAA 4KGMA 4N5SA 4E1NA 1HR0K 5IT0A 3AY0A 3C7NB 3OFGA 2IMWP 3V6DA 1EB0A 3A3NB 2XHCA 4CW7B 2YNGB 4NLXA 2M3DA 4GVBB 4J37A 4CO5A 1VQ4S 4JI3J 2I6WA 3T1HF 4JI0F 4ED2A 2PAVA 1N4LA 4R5PA 2YCHA 2B4UA 4CGJA 4FL9A 1KONA 4DU7A 4FPAA 2G8WA 1B9DA 2UUAF 4XH5A 1RT5A 1Q5YA 4HCCA 3R8YA 3FUYA 2IS3A 2RB7A 2ZJRL 1KLMB 3S6EA 1K44A 2GZOA 2DTJA 3UNYA 1GNKA 4FVMA 5AT1B 3W65A 1D09B 5K8NA 1G2EA 1T44A 2XYGB 3ZT0A 3QFUA 1U2CA 3G8TA 3ZEUA 4ILHA 2WB1D 1JCGA 4M5HA 5A2QY 3GB0A 3ZYYX 2B4JA 5KPRA 4U8YA 4E0DA 4ECZA 4DV5K 4NLUA 5LSLA 1NGFA 2ZH9A 1IBMJ 3FCVA 2BQUA 4ZVPB 3D67A 2XLKA 3NWRA 5MLCV 4BQZA 2U2FA 3RBZA 4CHZA 2J6UA 4CH0S 4AUKA 3JAMO 3WQUA 2RKIA 4H0YB 2ZDOA 3NGSA 4O8KA 4FWLA 4E7KA 2X6NA 3HHKA 3HT3A 3K5MA 4KI6A 3MX2A 1C0UB 2XYHB 3TTDA 4RUAA 5D0EA 3WXJA 2NZ4A 1M90T 1WSFA 2BJ8A 3H20A 1RHMB 5HQLA 4I67A 1IBKJ 3DLEA 1KWMA 1TMMA 3D2EB 4PXDA 2YNIA 1NGIA 3QEIA 2W2QP 1KVJA 3NF9A 1FFSB 3FRZA 4RNFA 2MDAA 4RO0A 1N5TA 2CJXB 4I7FB 2LCWA 4PXBA 3Q7CA 4OZ0A 1Y97A 5BXIA 3KWGA 2OPRA 2XS5A 5FD1A 3G8QA 4NLSA 4LF5J 3EGZA 2ZBIA 1VQMS 5ETPA 4M45A 3WEEA 3DGVA 4E19A 3CQ8A 1PAEX 2FJDB 2CQDA 2LMIA 4FXDA 1HKGA 3ITHB 2GS8A 3H4DA 4CO0A 3TTCA 3H5YA 5ELZA 4JI5K 4K42A 3BO2A 4ZPCA 1X5TA 4HTJA 1QSYA 4H4KA 4KC5A 4DTRA 4PG4A 2J0WA 1S6UA 3LALA 2DEIA 2E66A 4HUEA 5KG2A 1PAUB 4CEZA 2DNHA 3M6WA 1IKWB 2XMWA 2BJ9A 1TL4A 1U0HA 1SJRA 2PMZD 3HXMA 4DR5J 2BEFA 4LF4F 3QPIA 3SXLA 4JKHA 1N52B 2IM1A 3NMAA 2UZAA 4JOUA 5L9XA 4JI2J 2QW9A 4FKYA 4U6PA 2Z2LA 1VGYA 2KLAA 5IS2A 3JTOA 2PEBA 1WG4A 3PDNA 4DI6A 1ZAVA 4J9PA 3VA0A 4ZS6A 3IAYA 1HNXJ 2HMPA 2FC8A 3CG7A 3LM2A 5JLFA 2RHQB 1TUYA 2CADA 2MLXA 3POTA 2PN6A 1JCFA 2DHAA 3P5BP 2HGNA 3IS9B 2C3YA 4JV1A 3WZ0A 4DUTA 2XMMA 4K0KF 4K7QA 1U2FA 4B3SJ 2IM3A 1DJ0A 1FX4A 4CYUB 4P73A 1HBUB 4KTQA 3NHGA 1HNZK 1FF2A 2DH9A 1VR6A 4OJHA 4YB6A 1N54B 1I94K 4DG1B 4KH6A 1XEZA 1MU2A 2QLXA 2YX6A 4Y34A 1O6XA 1HNVB 1AYEA 3ILJA 3N9UC 1QS4A 1NBEB 5BRFA 1DZ5A 4ZDNA 2O8CA 3SQGA 4DV2F 1R3NA 3QWUA 4USIA 2QA4N 1FRIA 4Y2KA 5A8RB 3SCLE 5DZ7A 2ZH7A 1RLDA 4FPRA 1BIZA 3JSYA 1NM2A 3C46A 4I69A 4QQBA 1N88A 1S1WB 2Q6CA 1WOPA 1YVUA 3HFKA 4H5WA 3VAFA 1UL3A 2GFFA 1EQ0A 5CD4A 3QRQA 2AQ4A 2B5JB 2GHWA 5KFAA 3GG0A 2QV6A 4DL4A 1K1SA 4CEBA 2JWKA 4KB0A 4NLBA 2CWXA 4EUVA 1UP1A 1L3TA 2EFPA 3D0HE 2JC0A 1T6DA 1Q7YO 2LQ5A 1XHXA 2B43A 2HB5A 4Q0BA 1JLBA 4ECXA 1BCMA 2KHDA 3DLHA 2DR5A 4FZYA 3DM2A 2PYLA 4DF4A 1ITPA 5HVFA 4JI8J 3BBBA 1VQPS 1BWFO 2QT7A 1RHRB 3K5OA 3AAQA 5ITHA 4LF6F 5ADZA 3KWMA 4E8UA 4FP9A 1K0TA 3CXCR 4LIRA 4J9QA 5J2PA 1FXXA 1HYVA 3KLFA 5KG3A 2XZDB 1NGDA 2FBXA 3KMQA 1XMQK 2VG7B 1YDLA 2GA7A 4J9SA 3OBIA 3DRPB 2CYYA 1URNA 3FEYB 2UP1A 1T05B 2CNOB 1I39A 2C2DA 4CO1A 1S1TA 1OVYA 3R9LA 3NNAA 3EGWB 1O0PA 2MZSA 3G8SA 4DR1F 3EGNA 2BOPA 1I1GA 3ZT4A 4ATNA 3PV8A 4Y28C 3NCIA 4DTUA 2WZ1A 1MROB 2DITA 2VWKA 3RSEB 4WP8A 1RWVB 1RTHA 4KBIA 3MPUB 4C8MA 1KQSR 1CJTA 2YHBA 3THWA 4ZVFA 1NHVA 4LVNP 1JLFB 2M9KA 1GMWA 2C2RA 4G1QA 3RAQA 2F40A 4Q44A 5IFMA 1NK8A 1VQ4N 4NZ6A 4DV3K 4OYPA 2F7TA 3DDIA 5KG4A 5K8MA 4FWKA 2L9DA 2RDDA 4NEYA 4L8RB 5KFXA 1OKJA 3DYAA 3K58A 2OMOA 4CZGA 4CJRA 2PBDA 4LF7F 3PRVA 4P74A 1F3VA 4FXWA 2XG8A 3E01B 1CZAN 1DHMA 1LNQA 4ZPVR 4RPFA 1T9VA 3PRBA 2HFSA 2IFXA 4NYNA 2NZCA 2ITGA 2D69A 2FSNA 3QDKA 4ZP6A 2PIIA 4WFBQ 2V50A 3ZO7A 2LA6A 1KOHA 3SYZA 3IAM9 3ZETA 2DVIA 1DTTB 3PFOA 2W4DA 3ET6A 4JKAA 3L3VA 3VR1A 3GV8B 1QAIA 2HHHF 1BI4B 3FJ2A 2ATCB 3KHLA 2E5HA 3N6NA 5JS1A 3C19A 3LP3A 4BLGA 4ZJLA 5KFTA 1HJRA 3JSMB 1YSJA 3UKRB 3VQPA 1J2VA 2ZVSA 1MA9B 1NH8A 4ED7A 5C25A 3K57A 1AFJA 1TL1A 1F2HA 5DDOC 4W5TA 1GEHA 3G10A 4L6V3 5DG7A 4BE2A 2H51B 3FBCA 3HHDA 1EX8A 4QIWD 1KD1O 5FJ4A 4RW9A 3OVAA 2ACYA 1YX2A 2J5AA 3QFWA 1FKOA 3DCAA 5KFQA 1NSKL 2F3JA 3RMCA 2GMHA 3F44A 4AQYK 2V2QA 4EIAA 1VQMN 1NU0A 4E1MA 1UA0A 5CE3A 1TL3B 1VC0A 1RILA 1RT2B 2HMIB 3D3BJ 1XR7A 3U9ZA 1FTRA 1WG5A 1JLEA 3AVBA 5G0RA 4AL6A 2CZ9A 1FEEA 3KYLA 3B78A 2BKNA 3QT5A 4QR2A 1Z25A 3H7HB 1G6BA 3UE5A 1Y7PA 3TX8A 2XMJA 4LFAK 2ZJRQ 3KK3B 4BRCA 2UV8A 2QG9B 4EAHD 4IDKB 2XRIA 4G9ZA 2CFXA 4C11A 3IDHA 3AXMA 4DLEA 1SUQA 3WC0A 2O3DA 2YNFB 2DFEA 1WLJA 3UD5A 2DNOA 2GMLA 3CF5L 1GLFO 5J1PA 4EP4A 1YJRA 4DU8A 2UUBJ 1A5VA 2ASYA 4DR7F 1KQFB 3V5RA 3QAEA 4TQSA 2XSFA 4OYBA 1TL5A 3CCES 3MDFA 3JAMY 5LSOA 4G6VB 4CZEA 5JJBA 3N4WA 4U7CA 1BMQB 3MM5B 4B17A 4DV1J 3GJTB 3FFIB 1LW0B 2F9DA 1WSEA 2FSKA 3A8YA 3D1QA 1UW4A 2IDLA 2BUNA 2GVZA 2QSFA 3QSIA 1QVGM 4DV4J 1XJWB 1VQ7S 2GVDA 4KH4A 3T6BA 1NNDA 1BOTO 1LWFA 4OI0A 3SJHA 3NGIA 2VFSA 3S7RA 3K5LA 2QTDA 2MY8A 5DJBA 2W8LA 3VOVA 3UVJA 3FZFA 2E20A 1JLGA 2OTJS 4NXMJ 4N8NA 2O66A 3KJFB 3LPEA 4QPTA 4LFBJ 5M1NA 1SKWA 4X4RA 1TKXA 3FCHA 4ELUA 5A76A 2MQMA 4OHZA 4LSNA 3C6TA 2OKQA 3Q86A 2XNQA 1U1NA 5KFOA 1EIYB 2KZZA 4EO8A 1NZAA 3C6UB 1W7WA 1WI6A 4OL8A 3H1QA 3CDAA 4KHRA 2P9IA 1YQHA 2BDPA 2DFHA 2VCPA 4TKTA 3MM6B 2FF6A 1C1CB 4AXIA 3FBEA 3NS7B 5B0AA 1DURA 5L1KA 4YOVA 4HI1A 4GV9A 2MQPA 3OTOK 4X62F 2F9WA 4DN9A 1NWKA 3I56S 1B92A 2GV1A 2V2ZA 3LA0A 2XO6A 1HQUA 5AXKA 1FHTA 4DFKA 2KVIA 4LQ9A 2LQBA 2R7OA 4Q2MA 4YOWA 2VPYB 4NE9C 3PYFA 3MPWA 5TKYA 8AT1B 1IUJA 4O44A 3QGPA 2IOCA 1HL6A 3UFCX 4OZJA 1AXQA 3QERA 1VQYA 2NRRA 4P72A 3EZ5A 4IR9A 3CB4A 4ZPDA 2YKNA 4CHNA 2OHDA 1F2GA 2XMUA 1S57A 4LF4K 2E5LK 3Q8QB 1WC6A 2HHVA 2J7WA 3LANA 3H98A 4M63A 4BROA 2ILYA 1PIEA 3TWZA 1RHQB 5IQ6A 4M5DB 4FJNA 3VQ8A 3AB2B 5CYMA 2NRTA 1NJIO 3FKBA 3SAFA 2IIRA 4QZVB 4YHHK 4KSEB 4HL9A 5DLFA 4OJ1A 3NRBA 3MEEB 1SB6A 3I96A 1WWHA 3I0SA 3ADAC 1W7AA 2O8DA 2FZGB 3K89A 1R0AB 3KJVA 4ZJQA 4B3TJ 2ZH3A 4K0KK 4OX9F 4Q8EA 5T7LB 2BANA 2G4BA 1N34F 1E4FT 3D7EO 3CIZA 1ULRA 4NA3A 3ATVA 2HVEA 1T0TV 2D4WA 1TTHB 4CT9A 1OWXA 4IFVB 4Z94A 4DTMA 4A59A 2B4PA 3HZ6A 1RAEB 5GAHP 3OFHA 1UVNA 3MR7A 2VFVA 5A6WA 2VIHA 3FZHA 5F8NA 1CJVA 4PXEA 5AQNA 2I1RA 4Z0UA 1VRQC 5AZJA 5KFBA 1N36J 2VV5A 3FEZA 5E3QA 3T1YF 4DV2K 2CPDA 2DHGA 2P9UB 4JBCA 1NJYA 1FVSA 1X8DA 3M32B 3BJYA 2F4FA 4RJVA 2AYEA 5C2GA 3NXZA 3P5JA 1KVIA 2FHJA 5HSPA 2EPIA 2J9EA 2A1SA 4IG0A 3AO2A 1DEJA 1IJFB 1M5VC 1WC0A 2CG4A 2P9PA 2P6TA 2Z1IA 3ZNJ1 1VMBA 2KJVA 4N56A 5GAEP 4HDGA 1S4EA 3MCMA 3I6PA 4ED4A 5KFZA 1C1BB 1FERA 1EETA 1TP7A 2FJWA 4OLBA 1FXLA 1VSMA 3R6MA 1XNQK 3JYTA 2VGNA 4UQGA 4HHUA 1U49A 5LJ5Y 1U2VA 3GFYA 4XEIA 1RLCL 1Q7LB 2APOA 4U7BA 4K8RA 3T9ZA 4BRFA 4ZN3A 2CPEA 3MAAB 6AT1B 2W9CB 2OPSA 2GX9A 2DNNA 1IBLF 2Q0RA 1EP4A 4FWOA 2I7NA 4CHPA 1RDRA 3TUJC 3TA1A 3VENA 2BR0A 4E7JA 1ZA2B 2IY5B 3HFZB 3ZZYA 1Y3JA 3MI7X 2YQ1A 3ZSZA 3ZSYA 3Q22A 4EEYA 3QZ8A 2AX1A 3ISNC 3OUYB 4R8UB 1VQSA 4F36A 4DL6A 3KLIB 4RZRA 1ZC6A 4WE1A 4XPCA 3AHPA 1OH8A 3FK4A 1L3SA 4NLRA 5AR0A 1PYOB 1RQ0A 1WUAA 2OEMA 5M2RA 2JFDA 2RDIA 3RMDA 4OI6A 2ATQA 3K5NA 1V5IB 3G6EN 3H2VE 3D66A 7FDRA 5AQFA 5FLXU 5AZIB 3HSCA 5F9NA 3WXKA 4ZK7M 3ZXWA 5SWMA 4HTIA 2YKMB 4JKBA 4JUZA 2IVNA 5MAOA 1VSDA 5E3AA 4V1Ak 1YT3A 1T95A 2JC1A 2BOAA 1G99A 3LZJA 1XNRK 4PUOB 1VQ8S 4M7YA 2CQBA 2UUAJ 1S9EB 4DTXA 2VONA 1VQ5S 4ZVUB 2VG5B 2GTDA 3OSNA 1O1WA 1GOCA 5KG0A 3LGNA 1F6TA 5DK5A 3MPVA 4YORA 4RNNA 1BIUA 4H54A 4UY8T 3T7ZA 2NPIA 4WBFA 3M1FA 1ZBSA 2WRMA 5BYSA 3NY0A 4FJKA 2UXBF 1X4FA 4NCBA 4ZVQB 5KFYA 2V4JA 2BRLA 1JLCA 1TL7A 1HBNB 4NXNJ 4M94A 3QJJA 4BRAA 2HNDA 3RUBL 1X3NA 4JLHA 3ILLA 4WK3A 4QW8A 4CEDA 3O9SA 2VQFJ 4PCQA 1RAIB 3DGPA 3P8BB 5ETKA 1NK5A 4JKGB 4J2BA 4JYAJ 2Q3SA 1NOYA 4WIIA 5GMEA 3CCTA 1VQ7N 3EL2A 3HFVA 3HTVA 2VG6B 3M1VA 3EDQB 4HACB 3B82A 3RVCA 3AV9A 5FPEA 1TV6B 4WJBA 4AM7A 1RGVA 1N6QB 2OTJN 2UU9K 4GKKF 2QA4G 1BWEA 3LQVA 4EGLA 2J9DA 1EXQA 2E1CA 3DOLA 3CJAA 3IFRA 4PG7A 3AVIA 5KFLA 2JEGA 4Z7CA 1RTDB 1P90A 3MCNA 1R0CB 4B9UA 2JDJA 1RTJB 3J7Z5 2KN4A 1JXBA 4CBWA 3TRGA 2IVOA 4CTAB 4HTLA 1X9JA 2V5HG 1RHUB 3DC2A 3PW7A 2QWPA 3BEXA 3VGKA 2RQ4A 2NREA 3ZZZA 1FJGJ 3L2VA 4RTFD 2EWSA 3I56N 2MZ1A 1RFQA 3BZCA 1RZMA 2ZHOA 1VLOA 2W8KA 4AXJA 4QR1A 4CF9A 3CF5Q 4AHVA 4CLWA 5MLCQ 2FJVA 2CNLB 2DY9A 2LQ9A 1NGGA 2JWLA 3M3ZA 3T3FA 3ZTRA 3KKFA 3GZ7A 4EHUA 3GP9A 2HURA 1HLWA 2M8DB 1JB0C 4ICLA 2BABA 3OT9A 1J5OB 1KAZA 1E3MA 4X66J 3C16A 3TO8A 3PX4A 3QATA 4LF8F 4NWBA 1JJCB 3BDEA 4GVMA 3HULA 3MM8A 3ZSXA 1RWOB 4RLEA 1HNWF 1UFLA 4YB1P 3ENAA 3UD3P 1KC8T 2P1JA 3WNHA 1A5XA 4MLEA 1VRTB 1MWQA 1FCAA 2KU7A 5HP1A 3GE9A 1JCEA 4CO4A 4PKHA 4GY2B 1TKDA 2FHOB 1FNXH 3H08A 2PA3A 5F8JA 1ASVA 4HUGA 5B0CA 3VA3A 3TUZC 3ULEB 3ETMA 2RHKA 1S1UA 3CO9A 4RU9A 2XLJA 5CABA 3L7UA 3U1NA 2D3O1 3O4WA 4YOXA 3MM7B 4JRQA 4CRJA 2B7BB 1NKEA 3L95X 2F8HA 3NH0A 3U6FA 5HROA 2D3OR 3Q23A 5KOWA 5LMNF 2XS2A 5KFIA 2H48B 3LDOA 4FF4A 1UCNA 4CD3A 1WNSA 3FDSA 2XI3A 5F0WA 3RBEA 1NGBA 2AEMA 2FPHX 2CPZA 4EBEA 1S7IA 1MWYA 1RA6A 3SUNA 3KD5E 3LDPA 2BZ2A 3DXKA 1HMVB 3QB0A 2BW7A 3PXGa 3CERA 4F4ZA 4O5FA 2Q1LA 3EZWA 3AO4A 1M90O 2H5JB 5AQKA 2O67A 2YQ0A 4H0VB 3KK2A 1T3VA 2YX4A 2CQHA 2ZHBA 3V4MA 1SC1B 3K8VA 4YEAA 3HP9A 3M8WA 4DL7A 1Q8KA 5EWFA 1IJEB 1UWBA 1GMUA 1RNHA 4FK0A 5KFUA 1OY8A 1KXPA 4J9NA 1SQFA 5EDWA 1VQ9S 2ROEA 1VQKS 2RE1A 4P71A 2HHWA 2IHR1 2K7KA 2FLPA 3D9BA 2HVZA 3OYNA 1TYQB 4YQWA 3IA0A 4OX8A 3ENBA 4B9MA 3U1MA 2LECA 3GL1A 5HJYA 5I3UA 4FYDA 5D78A 2WOMB 1ZXOA 2FY1A 1NGHA 3MAHA 1BO5O 4BRLA 1JLAA 3Q8UA 1FJEB 1UJ4A 4KQZA 1U6FA 2J7UA 5DRKA 3WXIA 2Q43A 4ZPBA 3ILIA 2FBTA 2AF6A 4KHNA 4E3SA 2QWRA 1CULA 2P9SA 3DLJA 5DQHA 4TLRA 1PC4A 3H40A 1PILA 4S0MA 3Q8RB 2I5JB 3K9JA 4I6WA 2RAQA 5F2RA 1SV5A 1ZAWA 1N34K 1UVMA 4I2PA 3MEGB 2FB0A 3SAGA 5KFWA 4DQSA 1Q79A 4PEOA 5AJ3K 2R8JA 4DR1J 4TY9A 4DX7A 4EYHB 3V2UC 3LPTA 4GKJJ 3ZZOA 5AXLA 1MMDA 4MFBB 4CGIA 2GJFA 4IRCA 5KOXA 1MWMA 1M1HA 5JMVA 2E7VA 1SH3A 4ES2A 1UEVA 1NGJA 3DRSA 5HO4A 4CEFA 3UKUB 3A13A 2QWOA 1X1PA 4OPAA 3DI6B 1IR0A 3R1LA 3OR1B 3KLHB 3B4MA 2M4MA 1YVNA 1FD8A 2MZQA 5KGWA 2NLWA 1OPIA 5K8OA 2MZJA 5D0HA 1ROFA 2HAIA 4QIEA 4UUXA 5A0YB 4CHOA 1UPPA 1CQNA 2Q31A 3CCRS 4TU7A 5BPLA 2QRRA 2V8GA 1KP6A 3GV7B 1KEKA 3RW6A 1X4DA 4USHA 1SC3B 4KHSA 3WXLA 4OI1A 5LSRA 4CD1A 3DRYA 2VQEJ 2CGJA 4I6MA 3IR5B 1VS3A 5HRPA 3ZSOA 3PLAA 1X0FA 4ZLNA 2K3KA 2Z30B 1VK0A 1OMSA 2NXJA 4MJKA 5AQHA 2FYXA 3UE2A 2ZHAA 3TU5A 4A47A 3VAKA 3CCVS 2ZBQA 2P9GA 4ECTA 3N4QA 4KHQA 3GG1A 4ANEA 5KT4A 4Z4CA 4KO0B 1UTAA 2OFGX 5AQMA 5GMKa 3CPEA 4A46A 4KGVB 3JTNA 2R7XA 2CJKA 1HBMB 8ATCB 5AQWA 4CIGA 3VZIA 3W61A 3QFPA 1HI1A 3E66A 1VJWA 2LDYA 1E6VB 2M88A 3I4PA 2DHSA 3T9NA 3ONQA 4WYBA 1VSJA 3QQCD 4LREA 5HMWA 1RJJA 4FNIA 1KHWA 4WFZA 4X65F 2NYHA 4FS1A 4JI1F 3I9ZA 3GSDA 4OHVA 5BR8F 5HN0A 2HHXA 4X4UA 2P9KB 5HAOA 3CD0A 1NKBA 1FTCA 2VL1A 2A5XA 2COLA 3EGVA 3HK2A 3MMVA 3MAQA 2VF3A 4LR9A 4PWUA 4F3OA 4USTA 1FWKA 4FWQA 3CUNA 3H8YA 4KH1B 1TKTB 2HHTA 3U4LA 5J2NA 3HBTA 2W4CA 2XSJA 3V9SA 1VSLA 3A3OB 5U47A 4XH4A 4BRNA 4ZPTR 3DOKA 5GIOA 3THXA 2HKEA 4C3LA 3M2VB 1RTIB 4E2FB 3AH6A 4EK2A 1CEZA 5IM0A 1HWKA 1OJ4A 1TKZB 4IJAA 2RJZA 2DYAA 2QWQA 2G8FA 1YJVA 4M1KA 2FBYA 1MN7A 4AH9A 2IVMA 3GDQA 1B0TA 4B9QA 3J80U 4DSEA 3EKUA 4P75A 3IMQJ 4C8OA 1TK8A 3TEHB 4M5MA 3TYTA 3RB3A 1M1KT 4UUWA 2I8EA 1J5EJ 2F9TA 2FY8A 4ZPAA 4K4XA 3OTEA 3THTA 3C65A 4I2QB 4DU3A 4LIWA 1ZETA 1R8PA 1LV5A 1YF5L 4FOEA 1C0TB 3ZSWA 3D4JA 1FNOA 4CJUA 3I8DA 4QS9A 2QK9A 4OGEA 2CJAA 2UVWA 4H0TB 4JHDB 5GAGP 2QTWA 4P7TA 4C6AA 4JI5J 1WSJA 2EFQA 2XULA 4MH8A 4FWNA 2UUCJ 4CZMA 1YRTA 5IOLA 1WHYA 3RU0A 3IBWA 2V9KA 2IA0A 3R27A 4GKKK 1R0BG 4B3RF 3CCMS 5ETNA 1TUVA 3IO1A 3AT1B 3H46O 5HVHA 2OIHA 2X6SA 2Z2ZA 4NZ7A 3PSIA 1Q53A 3IWLA 3V4IA 4C8LA 3IG1A 4F3TA 3NE6A 5F41A 4JI7F 2HBJA 5DLGA 2HHSA 3D2FA 3QNNA 1RAFB 4CO3A 2DT9A 4X64K 1GMWD 3OVNA 4M3WA 4B1XB 5HI7A 1VBYA 4B1ZA 2MQQA 4DUYF 3AD9C 2AP1A 4E89A 1UJ6A 2XY8A 2E9ZA 1YITS 4C3MA 2ZM6K 3PO5A 2XM3A 2JLEA 1T3OA 1PJ5A 2L9WA 4FVCA 3W1YC 1JKHB 3QBCA 3R6LB 5LOQA 3ZX2A 1UOCA 4W90B 2J4RA 4MAKA 1R8BA 1YK9A 2W9BB 1S48A 4HI2A 2DNQA 1EJ7L 4KKOA 4FDFA 4MDAA 2ASJA 1HNZJ 4CLKA 3L8BA 2M0GB 1VQ9N 1RT3A 2VPZB 1VQKN 4JI3F 2EWHA 4JV5J 4B9TA 3MDQA 3HVTA 1Z1ZA 4WQ4A 3MK6A 3M8QA 2OCEA 1RU1A 3LH2S 2UXDK 1BU6O 1KLNA 3ZZUA 3LW5C 3MMBA 3BF1A 1RE1B 3CD7A 4PYDA 2HRYA 1GOBA 4NYOA 2KFZA 3BGUA 5CD4H 1B0PA 4Y0WA 1EKRA 4NLTA 3MUMP 4ZVGA 1REGX 4GVLA 2UXCK 1XK8A 2X51A 4OX9J 4CZLA 3DLLL 2KRRA 3IP0A 1AT1B 5JUMA 1IBMF 1NHUA 4CHQA 1HJOA 2YTCA 2J6TA 2E9RX 1N5SA 5THWA 3CC7S 1D8YA 5ETSA 4I9QA 1A0OB 4H5NA 5CH7B 1QTMA 4X4VA 3O2IA 1NBWA 4OPJA 3UQSA 1BHLA 4ZLPA 2GGPB 1ATRA 4KB7A 4FPBA 5A8WB 1AA1B 1NO8A 3CJRA 1KQKA 3OYAA 5KFGA 1RBLA 3AA5X 5C24B 2FHMA 4JAXA 3RRHA 5C2FA 2W2PP 4NEZA 1IBKF 4BGAA 4HHHA 4CH7A 3O3HA 3M30A 2ZUGA 4PWDB 2HZCA 1CVJA 4CF1A 5IC6B 4OHXA 4KBOA 4OZLA 1WSVA 3IRWP 3EXCX 1DTQB 3CCRN 4Z4GA 2QKBA 4H03B 1XQSC 5ADXA 4LF5F 4K25A 1JQGA 1LFWA 3G9CA 3VEVA 1XMQJ 4A2AA 2ZE2B 3I31A 3RB0A 2WC9A 1FRJA 4BGBA 3KDOA 2DTUA 2NSCA 3CVKA 3A4TA 2O4IA 1UEKA 2SXLA 2E1PA 4M41A 1HYSB 1ZBLA 1C4CA 1N48A 3KXDA 4JKEA 4W92B 2XY6A 5AE3A 5IWAK 3CCLN 3DMJB 3CCVN 1TR0A 2ASLA 2F4VF 4RW4B 2HQCA 7FD1A 3ZZPA 4O3OA 4DV7J 5M1FA 4WF9L 2AP6A 1NOZA 2OH2A 4OV1A 3M5RA 1AZSB 3NF8A 1E6YB 4F4YA 2MQLA 3TAMA 4DR5F 2KB2A 1NDCA 3UPFA 4EBCA 4TQRA 1SC4B 4KFBB 3O3GA 2HIQA 2GIFA 4OGCA 3ULHA 1SJFA 2G8UA 4HH0A 4JI2F 9RUBA 3QGHA 4ILRA 1OH5A 3O1WA 4KH5A 3C6AA 3CD5A 1X31C 3LPYA 2IC3B 3V6HA 2QFIA 1HNXF 1ZM3A 5HANA 2BE2B 3NNHA 1WTBA 3SV3A 1GTHA 3NGRA 1TGOA 3R2DJ 2F5GA 3F5TA 2YHYA 2WSFC 3OL9A 4JV0A 3I87A 1FJCA 3M8RA 3TAEA 3C2PA 4Z4FA 2Y8WA 2IGIA 1WI8A 2YQ3A 4B3SF 4FLUA 1IKYB 3V1QA 5CYQB 2HBKA 1U25A 1NXIA 2AGPA 1S9FA 5EU7A 1ZBUA 1YBTA 3W0LA 2A18A 4B1YB 3LZIA 3LTOA 2HLTA 2QKKA 1BA1A 3KK7A 2DGOA 2I9SA 4LH5A 3QT7A 5I4MA 3C66A 1C0FA 4AHRA 3T41A 3VCDA 2PO4A 4I6AA 2ZBRA 1FKPB 4TYAA 1NPPA 5KT6A 2H5EA 1OH6A 3AQPA 2WHOA 3J81j 1ZBHA 3JQMA 3TJ9A 3HM9A 3MF5A 3OR2A 2AMCB 5FDLA 1RHKB 1JJ2M 3KOAA 2QA2A 4PRFA 4RL1A 3BM7A 3MOZA 4UTGA 1CZ9A 1SPBP 2Z57B 3RJMB 4AQYJ 5C0YA 4DHVA 2YXLA 4UOCA 4EP5A 4L3KA 5J1NA 4N8OA 4CJLA 2H4WB 4H0PA 1HI8A 3OXGA 1Y5LB 4C2MA 1WSRA 3BKFA 3DAWA 1LFPA 1GFWB 1RT7B 4LFAJ 3CJSA 2GV9A 4LC9B 2ZH5A 1G3OA 2D9PA 2DNMA 3MEDB 1FVQA 3AO1A 3OLBA 2V51B 3TUIC 4KGXB 3R1HA 4JI8F 1VQNS 3AQOA 3Q24A 4M3XA 5FRNA 3HD2A 2YWWA 2YX1A 1KKHA 3KZBA 2HS0A 4RBTA 5EGYA 3KWIA 2KM8B 2KKHA 3U7JA 2ILZA 3OS0A 5BRHA 1F5BA 4F7VA 2F9JA 4YDDB 4IOBA 2FHJD 1PYSB 3D0GE 4X4PA 3OBWA 2J7KA 4RBUA 3CJKA 3NGUA 1T8EA 2YJFA 3PVXA 2HF4A 5A8KB 2WONA 3CJ7A 3J7AP 2FD2A 3AOBA 2CGKA 2DO0A 4Y0FA 5C42A 3IWXA 2UV8G 4O55A 1GK8A 3VQTA 5FRMA 2CA9A 4O3PA 5RUBA 4IJNA 2AJQA 1I5OB 1P8GA 1CXUA 3TAPA 3O9RA 1ZTWA 3WX4A 2H3EB 4W5NA 3RMBA 3DXMB 1IH7A 1IKVB 3KLGA 2E44A 1ICEB 1S1XA 1VSFA 1QY7A 4RUHA 5AQPA 4W5RA 3AJ2A 1WC5A 2Q6BA 5KAKA 1SJ3P 3MM9B 1JJHA 1NHKL 2VGMA 2Y0BB 3CCWA 4RKUC 3PG9A 3OS2A 4ZN1A 2R8GA 3AXKA 1K73T 1GX5A 3DLGA 1I3OB 5EWEA 1CLFA 1ZYQA 1QM9A 4Y2CA 3CIPA 2EC2A 4P9SA 3S8SA 1LW2A 4PQUB 1YZ6A 2LEPA 3SBMA 1GTEA 3FR0A 3AVHA 4LD0A 1V3SA 3PEHA 1YIJS 3EM1A 2A6OA 4IOXA 2XEXA 3VTIA 1PKUA 4CE9A 2B9EA 4OKJA 3OTOJ 1TUWA 2H3GX 1BQMB 3QO9B 3H3OB 4C0BA 1DQAA 5D4PA 1NSQA 2DGXA 1XERA 3OTBA 3BH7B 1TZ0A 3UN2A 2W2NP 1H7XA 2KT3A 4OHYA 2HVIA 4DCJB 4UY8O 5KFSA 1RWXB 2CQ1A 5HK4A 4C8ZA 4LRDA 3W2VA 3CC7N 4ILMA 5AQJA 1RACB 4RCHA 2HZAA 3C7NA 1H73A 5B0GA 2YNGA 4JI7K 1UVLA 3C8YA 4DSJA 4GVBA 2ETJA 2E5LJ 1XR6A 4NLYA 3THYB 2MZTA 4G1PA 3S01A 4ES3A 3RAXA 2LQ8A 4E7IA 1S3XA 3NNCA 2YJEA 4KT0C 1VI7A 2GQ2A 5BPMA 2MQOA 2BH1A 3T5JA 1KLMA 2VZ9A 4LH4A 2EKYA 3W2WB 1HD0A 2LEAA 1P1LA 5M2PA 4YHHJ 3TOQA 1HKCA 3TSPA 2QXFA 5T41A 1JNZB 2QLJB 1RKJA 3MTJA 4A5BA 1T03B 4CEAA 2E2QA 1Z05A 2HSEB 4NA1A 4BRHA 4KY3A 4X4OA 5AXNA 3U02A 3VEWA 5KG7A 3NGTA 4C8NA 1X7VA 1GLBG 3IR6B 2V8DA 1LWXA 4JI3K 2UVVA 2MKSA 3D28A 3CPWR 2QL9B 4KHMA 2JEFA 1C0UA 3P6YC 3SJJA 4DV6K 5BR9A 3VGMA 2C3MA 4H5RA 5HOOA 2HG4A 5CZ1A 2R7QA 2QZ8A 3KNGA 1S9GB 1U48A 3DLLQ 5FLXO 2UUBF 1KFSA 4I7FA 4QIFA 2V6AA 2BGGA 4DPOA 1Q9XA 4CLTA 4DR3F 2QM1A 2E1YA 4ZVHA 3DHWC 5EX5A 2BMBA 1JX4A 3NCPA 4LBIA 5EWGA 4K8ZA 4FW1A 3VF6A 4IFEA 1IBMK 4DV1F 1RWUA 2J76E 2X3DA 3OYEA 3GE1A 4IDHA 1S22A 4DV4F 3ITHA 3SZ2A 5D3GB 1KC8O 2RN2A 4I64A 2WTFA 4BG9A 2L9NA 2XQCA 2IAJB 3UN5A 1HNIB 4OFZA 5KT2A 3PX0A 1WBDA 1ZTTA 3NBPB 1VJQA 4NLOA 1JK9B 4M3YA 4NXMF 1KS2A 1PYTA 3KKRA 4AD6A 1CC8A 4LFBF 1DT9A 1Q78A 1GAOA 4CJ4A 3QLHB 1IKWA 2OTLN 4FBUA 1QUPA 2OD4A 2FXUA 4IYQA 1VC5A 5IC4B 2GQQA 1Y9OA 4EO6A 1JLQB 5H1SQ 2E8AA 4M5KA 1IQTA 1LOTB 4CNYA 1ITGA 5E0OA 1OSCA 4LF5K 5CCLA 2CIMA 2NRXA 4L74A 3VF4A 2QMWA 2RU9A 4ID5B 2WVBA 4I6YA 4WU3A 1BY9A 3OFFA 4F8RA 4WF9Q 5EN1A 3RB4A 1U1RA 3M4XA 1S5JA 4CQ1A 4NL5A 2DIUA 2HBLA 2C2ZB 3RG6A 3M2UB 3PX6A 3IS9A 1PG5B 3CO0P 1GT8A 4UF4A 2YH0A 1YJWS 1VRUB 4UZBA 2NPFA 3BEGB 1UJ5A 4CYUA 2E5GA 5AQTA 1HBUA 4WQ5C 2DNRA 4YB7A 5CZVA 1BXNA 3TSQA 4CZIA 4DR5K 3J7A1 4IH6A 3D6TB 4EYIB 4CJPA 4DG1A 1AUSL 3NAEA 1KSPA 4NLWA 3SEOA 3W63A 3EVMA 1HNVA 3HZEA 3VWSA 1R31A 4MK9A 3ID8A 4OJ3A 4A8KA 3AVKA 2LXIA 4BE1A 2XHWA 3QEXA 1BG3A 2CAJA 1RAGB 4DBQA 4NMLA 2ZNYA 1WOOA 3D7SB 5A8RA 4MYTA 1XNRJ 1TVRB 3GIIA 4C3KA 4KAIA 2ZC3A 2DR9A 5BR8J 1S1WA 2DR8A 1U24A 1X5OA 3B54A 5T7BA 4KHPK 3V1RA 3KLVA 4M3TA 1AW0A 1EWRA 2B5JA 4Z2XA 2ITMA 4B3TF 3QBXA 2KI2A 4B3SK 3ZCMA 3HOTA 4BR9A 3SDEB 3TI0A 5BPNA 5B0FA 5KG6A 3VGUA 2ZKUA 1X60A 1YI2N 1U1QA 3ZNUA 2F7VA 3C0BA 3HMJG 2KM8C 1S6OA 3SCXA 2DXEA 2YPYA 4LRFA 4FJ5A 2ZUAA 1WSIA 4NLCA 3QFHA 4KI4A 1RBAA 2WVEA 3CCQN 2FIUA 2V4QA 1ATSA 4IEIA 4BG8A 4N47A 4A8OA 1N36F 1KCFA 1FEHA 1DBDA 4QWBA 3KK1B 2VPWB 3BPDA 2Z58B 3DFEA 3W9IA 2GWKA 3CEDA 3TZXA 2BACA 1QZ6A 2DO4A 3OHAA 5KPTA 3D68A 2UU9J 3CJ5A 4KV8B 2W2OP 3CM5A 2O5DA 4OX7A 3SQOP 1VSIA 3W62A 5JS2A 2DXFA 4NCGB 3EEQA 3PRDA 2GW8A 4Y1CA 1RT1B 2VG7A 4KGKA 2B56A 1YIJN 3DRPA 4BDZA 2IVPA 2IVFB 3QMLA 4NI2B 1XTZA 1T05A 2IVYA 4GVEA 1BD6A 3EE8A 2CPFA 3PYDA 2D0OA 2NUBA 2W1BA 4LRCA 3D3CJ 2BYCA 2V7ZA 1RDDA 2DNGA 1NLKL 1R59O 3X1LB 5M1KA 3J7YP 3R5CA 3GBTA 4B8CA 1MROA 5BYQA 3ZX3A 2VKZG 3RSEA 2ZJPQ 1NSAA 4WKRA 1YAGA 3OYDA 2HBRB 5DG9A 1OQ6A 3JQKA 1N32K 2ASMA 4XO0A 2LQJA 5KFCA 1J6ZA 2E1ZA 4WFBL 1JLFA 3QGGA 4P52A 4EU0A 1RTZA 1CJUB 4M7XA 1OO0B 2IRYA 2KH9A 2E6LA 5I3PA 2RDJA 2DR7A 2L08A 6FDRA 1EQYA 5IQQA 5GIPA 2N3OA 3QT8A 3E01A 2KTQA 4X2BA 1M1GA 2EBGA 3AA8A 5HBMB 3PCOB 2HFZA 4BR4A 4JP8A 4YR0A 2B4VA 2B8QA 2GHVC 4OLOA 4AFFA 2WK4A 3JTPA 2R7WA 3BY5A 1G7CB 3UNGC 4CZKA 1DTTA 5B09A 2QEXS 2NNWA 1FO1A 1U45A 4RWXA 1BI4A 2RVJA 2OI2A 3UI3A 5M1PA 2YHWA 3R5DA 1QE1B 3JSMA 5J1EB 3FSXA 3UKRA 5B8HA 3Q2TC 2R2UA 4DQQA 1S6QB 3VEZA 3HVRA 2QC3A 1LXJA 1KR4A 4RUCA 2VASA 2VC0A 1IXKA 4CVNE 1Q82T 3P5TL 2XZTB 2V2VA 1S77D 2EHGA 4UOFA 3JS6A 1Q8IA 1AUDA 4GW6A 1QDUB 4OHWA 3MECB 2KDOA 2ZJQL 4U7UD 4NXNF 2YWEA 2HBMA 4WKYA 3PO4A 1IJJA 1TL3A 2BVZA 2JFKA 3B6PA 1YTYA 1YXQA 1RT2A 2HMIA 5TKWA 2IJFA 1M1KO 1PJ6A 2VQFF 2MJUA 4JYAF 4CJWA 1S76D 2C3OA 4ELVA 1U02A 4JB8B 3BSCA 4LVOP 2W40A 2DGUA 4UW2A 3KK3A 4O23A 3NP5A 3MZIA 3BGOP 3NGDA 4CF8A 4MIWA 4P10A 4D3GA 2ZH2A 4IDKA 4UOHA 1C4AA 5GADI 3R3LA 1W26A 4OVLA 1RWNB 1RBVA 5CXTA 2CJYB 4DTSA 4J9LA 2IJNA 3TAFA 4RW7B 3BS9A 2QMXA 4FF3A 2MKHA 5AQIA 2YNFA 3CD6S 2NXCA 3MN7A 1N33K 3AJ1A 4P2SA 1KHVA 3LGHA 4IOCQ 2N7CA 4A8FA 1XMOJ 3E3XA 3FQKA 4WTOB 3BH6B 4CI0B 1RABB 2HBYB 3FZ2A 5I42B 2VD3A 1JWWA 4DJBA 2PGCA 2W2MP 2HVDA 1NPKA 4WK1A 1HA1A 3EX7B 4M95A 5CA5A 3HRGA 3MM5A 3A8EA 3TZWA 5AQLA 2YWKA 2Q97A 3FFIA 1LW0A 3SIPB 4RR5A 1N5QA 1FJGF 4PABA 3LP1B 3U3YA 2MLZA 3BN4A 1VQLS 2ALZA 3NKYA 3N0VA 5AJ3J 2OD6A 3NCQA 5KG5A 3EYZA 2AJ1A 2HNZB 1IKXB 2MPUA 3CJ3A 3CC4S 3RAMA 5FLXY 2F4VJ 2Q0UA 5FROA 4JI4J 3HVWA 1YJWN 2AWZA 4X66F 4FWPA 4JI6K 3VAHA 3NWGA 4Y2IA 4CIFA 7AT1B 2OMLA 2RRAA 2UUBK 3KTQA 1IG9A 1OVQA 2LSNA 3LOUA 1K8KB 2P8IA 3C6UA 3VVUA 3VAIA 2JH3A 2DKOB 2KT5A 3SCIE 3BYPA 2EX3A 2G8HA 3VGTA 3EPGA 2B8PA 3MM6A 4DV1K 1C1CA 4KAZA 5KFNA 2R8IA 3ELHA 3IXQA 3CFRA 3J80O 5HMZA 2E7XA 3NOCA 4QWCA 3LDLA 1K9MT 5GAEI 1T7PA 2W01A 3I32A 3GIRA 2VA3A 4ALZA 4I56A 1RISA 1WB9A 2MYFA 4DTNA 4BR7A 4ZPWR 4DSIA 1U6ZA 3FC9A 1U26A 1Q95G 4NXMK 2NUUG 1HHTP 3SQ2A 4NLQA 1APSA 5IT4A 4B1WB 3OYHA 5E3RA 4O0JA 4L72B 1GLEG 5H9FK 2P9EA 2CH5A 4KHYA 2HIYA 3M8ZA 3GJQB 4BREA 2RQKA 1WTFA 2FVCA 1TK0A 3OYJA 2ZD1B 1BWVA 4ECRA 1NKCA 2KXHA 1SC6A 1YHQS 2HRUA 2ZH4A 4DPXA 3BF4A 2DRAA 1Y64A 3M6VA 5J2QB 2LP4A 3MUVP 1YJ9S 4ED0A 3UCZP 2N7YA 3N6LA 4B08A 1HIYA 2CQ4A 3G82B 3PYGA 3GSIA 2PMHA 2LDIA 2FJAB 4FPIA 3QT6A 5B0BA 4M5DA 5DDRC 1ZM4A 3MCPA 4CDIA 2QLFB 1JJ4A 4QWEA 4PXCA 3QMQA 4OYZA 2E7WA 3VAMA 1NGAA 2DB1A 4M5GA 3MEEA 1UFKA 3SLCA 2VPXB 3TVZA 4V19S 2CQIA 2W25A 2XYPB 3GJRB 3RBDA 4PR6A 1R0AA 3A5NC 4DR4J 1QVFM 3PR4A 5T7LA 4LF9J 4JS5A 3JXOA 1L3KA 2HQDA 1KVCA 3EJMA 3K2PA 5AXMA 2YKPA 1FKAF 4IFVA 4J8FA 4ID8A 2CKWA 3R6GB 2EFOA 2CPJA 2HF3A 5AE2A 2BRKA 2Y0SD 4IQMA 1FDNA 1RT4B 3GWCA 1RGIA 1LWCB 2H1YA 2P9UA 1N5YB 1BUXA 1NGEA 4DWIA 3M32A 4DTPA 4NPOA 5F8GA 2BW2A 2WVFA 3HP6A 5KT3A 3FCWA 5B7WA 3ENHA 1CQMA 5FPMA 4NRTA 2OLWA 4J90A 3E1YA 3LAMA 5LT5A 1YJNS 3DDKA 4DL2A 3NS6A 1M5OC 5HVGA 1HQEB 4B3TK 3LWMA 5L39A 2FJBB 4FM0A 2MKYA 4BBYA 3LPUA 4OYOA 3QIPB 2CQ2A 8RUCA 3MFIA 4GKJF 4LRBA 1C1BA 2OFHX 1L3UA 1ZA1B 3QAUA 4OYXA 3TP2A 4RNOA 3R1XA 3H6EA 3CCSN 3RTVA 1TAQA 1HPMA 1NG9A 3THVA 3QNWB 3K0JA 3P4IA 1TQLA 2QEXN 3MAAA 3PW2A 3HHEA 1DQ9A 2GHPA 4P2XA 2W9CA 1LEOA 1WKJA 1RDBA 1Z2LA 4FYWB 4IFYB 4PPZA 2BA9A 5DETA 4EZ6A 4PYAA 2QI2A 4XDCA 3PKYA 1NM1A 1ZM2A 3CCZA 2FQQB 1GX6A 2CJBA 3RWUA 4J2DA 2OUGA 4JKDA 5K14B 2ZBPA 2IM2A 4CCHA 3CNQP 3JSBA 4X64J 1WAJA 3OYGA 4QOZB 3AA2A 1RUSA 3WX8A 3OUYA 2VQEF 3QRRA 4R8UA 2VA2A 3IRXB 4DX5A 3AVFA 5I3QA 4DUZJ 2D9OA 3M9MB 3KLIA 2AEJA 1OQ3A 4CZJA 4CO2A 3LM9A 3OL8A 2A1RA 2ASPA 4ZCIA 4M3RA 1MMNA 3BV8A 5LMUK 2C3UA 1S7HA 4B9SA 4KHUA 3A0IX 2Z1HA 3V9UA 2E2PA 5AZIA 3O4QA 2YKMA 3TSUA 3RGIA 2VBYA 4XDDA 4Q45A 2LFVA 1YRXA 2IPOB 4GO7X 1CXQA