1JLFA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 133
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlfA05
4LSNA 3L8BA 1SKWA 4KKOA 3CDEA 1MMLA 1QAIA 4B3OA 5KFBA 2E6LA 3NHGA 1CSJA 1C0TB 1TAQA 4Y1CA 4FLTA 4NLUA 4CJUA 1IH7A 2HHTA 1K1QA 2OZMA 2CKWA 3KKSA 1U09A 4PWDA 4DQQA 3TVKA 2BRLA 1IKYB 1BCOA 1NKBA 4NYFA 1BGXT 2YKMA 3T5KA 2JEGA 2VA2A 4NLVA 4QWAA 5HRPA 3AO5A 2OPSB 3CFRA 3V81A 3UIQA 4M95A 4CJVA 3O3GA 4KTQA 1GOAA 1KLMA 3ISNC 3NFAA 4CGIA 4B9SA 5D3GA 5DQHA 3AV9A 3V1QA 3TAMA 4CF0A 3SI8A 1HRHA 2R2SA 3C6UB 2R7YA 4IH6A 3O4NA 2KFNA 4AHTA 4URSA 3RB0A 3O3FA 2Y1IA 3LP1B 3DRPB 5J2MB 4B8CA 2YNHB 3UDLA 4K4SA 4E1NA 1HQUA 4OKEA 1SKRA 4J9RA 1K6YA 3ISND 1RBTA 1S9FA 4YR3A 2DPIA 3OYNA 3K59A 4KAZA 3QETA 4NLGA 2FVCA 1Z25A 1JLAB 2E9RX 2VG7B 2R8GA 2YNGB 4EP4A 1HMVA 4ZHRB 4JS5A 3PW7A 2J6UA 1S6PB 4FM2A 1IKWA 2IAJB 1S0OA 1S1UB 3LP3A 2ZE2B 1QAJA 3I5CA 2A1RA 1NK5A 3MXJA 3TAQA 2B5JA 3L2QA 3VA3A 2XO7A 3OL9A 2BQ3A 4FJGA 3QLHA 1T05B 3MF5A 4OLAA 4E7JA 2IJNA 3NGZA 4KFBA 3DOKA 4RNHA 3VA0A 1DTQA 4E7HA 3LAKA 1WLJA 1WAFA 4DTRA 1VK0A 3EY1A 3DYAA 3KLGB 4K50A 1TVRB 3NF9A 1NK0A 4M3ZA 4TSXA 3GIKA 1RT7B 3C6TA 3MEEB 5E41A 5I42B 2BQRA 5L1IA 4Y2CA 2GBZA 3SFUA 3B6OA 4E7KA 3ZSVA 4I2PA 3I5BA 2XCPA 3IRXB 1S4FA 1NK7A 2HMIB 4CJLA 4MK9A 4F4WA 4E19A 3VQCA 3CFOA 1VRUA 4MK8A 3QYYA 3F9KA 3VQEA 4H4MB 3TAPA 3QGHA 1N5YB 3QINA 5KFNA 4NLDA 4MKBA 3ZSYA 4Z4GA 1JIHA 1QS4A 2AGPA 5C24B 4BDZA 4RUAA 4GVMA 3SUOA 2G8HA 1FKOB 3HP6A 1UWBB 3ITHB 3AVIA 1D9DA 4NLOA 3G0ZA 2PZSA 3OYJA 3QEVA 4PUOA 4ED0A 4ZVFA 2J6SA 4FLXA 1JLFB 5J2PA 1C1CB 3T5LA 1S1VB 4B08A 4J9PA 1S9GA 1YTUA 2EX3A 3TAFA 4CIEA 4RW4B 4ELUA 1VSJA 3THVA 3HVTA 1K1SA 5KFJA 3QERA 1RTDA 4ID5A 4DTNA 4KV8B 3M9OB 3PW2A 2YNIB 4OPKA 3G6VA 4E7IA 2ITGA 5CY4A 4BE1A 2R2TA 4IKAA 2XHBA 5KG5A 5HROA 2HHVA 4ED2A 1U04A 1JLFA 5J2PB 4O3QA 4YP3A 1U45A 4WFXA 3KHLA 2RPIA 1NJWA 3VQBA 5KFQA 3VQ4A 2B4JA 1F21A 2IBKA 1RT4B 1RT2B 4DQIA 1S6QA 2E9ZA 1XR7A 4ID1A 3SQ1A 5DG8A 3FQKA 3PX0A 5JUMA 2YNHA 5KG1A 5C24A 2C22A 1KHWA 3DRPA 3DOLB 2FVRA 4KPYA 3H2LA 3NDKA 4H4MA 4DTXA 4I9LA 3H98A 5C42A 3V1OA 5D3GB 3GQCA 3HT3A 2XC9A 4N5SA 2HMIA 1RTIA 1RT1A 2Z1HA 4F8RA 4I2PB 3MXIA 4M3YA 5KG0A 3ZT2A 2UUWA 4TQSA 5JS2A 3BREA 1CZ9A 1KVAA 4Z0UA 1RT7A 1VSKA 4NCBA 5KFDA 2X6NA 3MTKA 1RA7A 4IFYA 4K4WA 1WSEA 3JSMA 1N6QB 5T14A 2E6MA 1VSLA 3NE6A 1IM4A 3CFPA 1C6VA 4FBTA 3QLHB 1VRTB 3HVRA 4KKOB 3EYZA 1J5OA 4K4YA 4KSEB 3KHGA 3V9UA 4FJKA 1DTTA 4ZVHA 2W8KA 1ASUA 3C95A 4DTPA 1RCHA 2O4GA 2HHSA 5KT5A 3HPOA 4DQRA 3QEPA 1NOYA 2ZKUA 2ZQBA 3VQPA 4ZP7A 2ZE2A 2YKNA 5KFVA 1L3TA 2GIQA 3AVHA 4DL6A 1VSIA 1LWEA 2WK4A 4RNFA 1KFDA 3TAGA 4DSIA 4QWBA 4NLPA 1KRPA 3KTQA 3AO3A 1IKXB 4FJJA 4MIBA 1LW0B 1BHLA 3K5OA 2BDPA 5KFIA 4WZMA 1EKEA 1YVFA 1XC9A 1B92A 3NAHA 1BQNA 2D0BA 3K2PA 4E1MA 3OLAA 1SUQA 4BDPA 3QZ7A 4IRKA 1UAXA 2R8IA 3RAXA 4XO0A 1BIZA 4R8UB 1JKHA 4RW6B 1TKXB 4CHYA 3OJUA 2HNYB 3CWJA 4CECA 4RUCA 2AQ4A 3RR7A 3KK1A 4ECTA 1NOZA 4CJ4A 4WYWA 5J2MA 2I5JB 1ITGA 1J53A 4DS4A 1NK8A 2AX0A 2RF2B 3ZSQA 2QXFA 4JUZA 4CJ3A 4W5NA 3WNFA 1RILA 3BGRA 5J2QA 4FJ5A 3HK2A 4ZPAA 4O44A 3QESA 1BQMA 5FDLA 3DRSA 1XR5A 3DLEB 2HVHA 3DLKA 4ECXA 4DS5A 1KLMB 1TGOA 3OL7A 4CIFA 3UQSA 2YNFA 1I39A 2YKMB 4FK2A 4NYZA 5SWMA 5KFEA 4O55A 3PX6A 3OYIA 2JEFA 5CYQB 3A2FA 3QNNA 4XPCA 5F8JA 3MEGB 2WOMA 4ZPCA 3NBPB 1CXUA 4AHUA 4HKQA 2EC0A 2VG6B 5DLGA 1S1XB 3PR5B 3FFIB 3PW5A 4RNNA 1TV6B 5C25B 3IGVA 1C0TA 3RAQA 4IKFA 5KFTA 4TYAA 3SPZA 1S0MA 5EWFA 4CEBA 3DRRB 5KFSA 3TWHA 3DRRA 4OPJA 4K4XA 2KFZA 1HNIB 3AVNA 4DG1B 4LSNB 4MFBB 4R5PB 3HYFA 1FKPA 1S1TB 3AVCA 3HPGA 3H5XA 1R0AB 4MQ3A 2WOMB 3H4DA 1JXLA 5CYQA 3LDSA 3V6HA 1KSPA 2X78A 3BSCA 4RG8A 4KTWA 3K5NA 1RTHA 5KFAA 3AVMA 3ALYA 4OJRA 4M3WA 3MECA 4NCGA 1EP4B 4WXOA 1QTMA 4O3RA 2EHGA 5KRSA 5KFKA 4F2SA 1RT6B 2PY5A 4QAGA 1JLEB 4BWJA 1RBRA 1UA0A 2I5JA 2DTUA 3CG7A 3I5AA 4Y1DA 1QE1A 3KK3A 4DSFA 5EWGA 2FLNA 2PYLA 3GIMA 4O3SA 4HVJA 3AVBA 1HYVA 1XHXA 2ZD1B 4DSLA 1RDAA 3OYBA 4MK7A 3SUNA 1I3AA 1YTAA 3UPFA 4U7CA 2FJVA 3DLRA 3RBDA 4KRFA 4NLQA 5F8NA 3PO5A 3H4BA 3EPIA 3FQLA 4TY8B 3VQSA 2YV0X 1NHUA 2FC0A 1VSHA 1TL3B 3PVXA 4DFKA 3MECB 1KFSA 1O1WA 4CJSA 1NNDA 1WN7A 1T94A 5KG2A 4CHZA 4AILC 3I0RA 3TANA 4Z4FA 4FZZA 3G6XA 4H54A 4F4ZA 3LWLA 2BANB 3HL8A 1J5OB 4EP5A 2GUIA 4J9OA 1UOCA 1CZBA 4CEQA 3OL8A 5HRNA 1TKZA 2XI2A 4LSLA 4FM1A 4Q0BB 4LD0A 1TKTB 4FS2A 3CVKA 4CGDA 1XHZA 4Q8FA 2ETJA 5DGBA 2VG6A 5F8HA 4N41A 3GIJA 1FK9B 3V6DA 4N56A 5J2NB 2G8IA 3V1RA 3T5HA 4ZPDA 1LV5A 2VG5B 2IC3B 4WFZA 3I0SB 2P5GA 4DSJA 2CJQA 4HHTA 4IH5A 1WSHA 3MEDB 3DLEA 4NLWA 4E0DA 3E01A 4O44B 5FROA 3BGRB 3Q8RB 4CHQA 2P5OA 4C8KA 5KT3A 4DQPA 5KFGA 4JRQA 2FVPA 3O4QA 2W7PA 1TK5A 3MAQA 3KK1B 2D0AA 1WNEA 3OLBA 1JL1A 3HHKA 4O4RA 4O3PA 3AVAA 3BQ1A 2ASJA 4GC6A 4C8OA 2FVQA 1VSDA 2W9BB 2G8WA 3IAYA 1RBSA 4ICLB 3OY9A 2V9WA 1KCFA 1X9MA 1C1AA 5EUHA 4NLSA 3G86A 4URQU 4CESA 4XPEA 3KHHA 3L2VA 3LP0B 4YMEA 4DF8A 3ZCMA 4Q8EA 1X1PA 3TAEA 2IS3A 4BDYA 1LW0A 4HUFA 2FLLA 1QHTA 2YNIA 1SH3A 4KV8A 1KLNA 1N4LA 4DTUA 4OL8A 3L3VA 3OYLA 1JLGA 2IC3A 4FLVA 4ECZA 2RKIB 1HYSB 1LAVA 5K14A 4FLUA 2D7SA 5L9XA 4M3TA 3CJ0A 3TARA 1T7PA 1W0HA 1RTHB 5KFFA 3LPTA 4KHNA 3IS9A 4CK2A 1RAJA 4IG3A 4FJ8A 4ZTFA 1FK9A 1T03A 3CIZA 3KLEA 1TP7A 4W5TA 3QO9A 4FLYA 4IQXA 4K8ZA 1C1CA 1S1WB 4FYDA 4MFBA 4R5PA 3AVKA 1TKZB 3KMSA 4DTOA 1HNIA 4ZTJA 3P83D 1Q9XA 1GX6A 3O3HA 4Z4CA 4B9NA 2HVIA 2HNZB 4CEZA 1LAWA 2GV9A 5C25A 4O4GA 2RDJA 4ZPBA 4TY9A 4O0JA 3MR5A 3K5MA 3T1AA 2DPJA 4ELVA 3I8DA 1TAUA 4IFVA 5J1EB 5KFPA 1RT3A 4IG0B 2PYJA 2V4RA 2XGQA 3H5UA 1CLQA 3VQQA 3HM9A 4KHYA 3ZT1A 2YNFB 4C8LA 3DLHA 4H4OB 4LY7A 2BQUA 4DQSA 3DLKB 4LQ3A 1REVA 4CJWA 3MR3A 3CO9A 2FJXA 3MEEA 4W5OA 2E9TA 1C2PA 2QKKA 3OYAA 3OYCA 1JLCA 5HLFA 3NGIA 4IDKA 4KHMA 1JLQB 2J6TA 2YHBA 2Q3SA 2HNYA 1IO2A 3AO4A 4FJLA 4K8XA 1S6QB 1HARA 4IBNA 1QE1B 2HNDA 3KK3B 4DU3A 4FZXC 2WHOA 4DU4A 1RDDA 3KKRA 2OZSA 3QIDA 3KHRA 5KG4A 2AWZA 4FJ9A 3QZ8A 1TK0A 4G3IA 4FM0A 1RT6A 3MR6A 3V9ZA 2W9AA 3BQ2A 3AVJA 4DFJA 3N6NA 3NAEA 5JS1A 2KQ2A 1Q8IA 1ZETA 4RW4A 4ZMMA 3BSOA 2KZMA 3M8PA 4I7FA 3RB3A 3OS0A 2AJQA 4FK0A 4KHWA 4O3OA 2XY8A 4ZHRA 2V0NA 2G8FA 3KLVA 4KE5A 3HPHA 1RBUA 4B9TA 3KLFA 3E51A 1R0AA 1BISA 5KFWA 3U6FA 4GMJB 4UQGA 3U3YA 1RYSA 1NKCA 3NH2A 1WSIA 5DLFA 1VRTA 4F3TA 3ZSOA 5SZTA 4JRPA 4RW9A 1ZBLA 3SPYA 1HQUB 1UWBA 1RA6A 4DFMA 4LH5A 3M9MB 3M8QB 4K4VA 2P1JA 1KVBA 4Y2AA 5KFRA 3OYGA 5KFHA 1A5WA 4FK4A 5F8IA 3RBEA 4C8MA 2I1RA 4OLBA 1J54A 3VQ7A 3TAMB 1RDRA 4FJ7A 3QIPB 4CJKA 4ECUA 3MXMA 4IH7A 3LALA 2OPQB 4FJNA 4RW8B 4RW8A 2BRKA 2OPPA 1W9HA 3FDSA 3JYTB 1NK6A 3L2WA 2Y1JA 1SV5A 4KBIA 1TKDA 4BE2A 3D28A 5J2QB 3C6TB 3SV4A 3GILA 4E7LA 2AU0A 4J9QA 4NLXA 4CF8A 2DFEA 3CYMA 3RR8A 4M41A 3QEXA 2RN2A 4Z4IA 1TVRA 4PY5A 3KLGA 3DYAB 2IM0A 3DM2B 4RW6A 4CGGA 1RT2A 4RU9A 3NCIA 4JV1A 4OKJA 1XWLA 2R2UA 1HYZA 4TXSA 1SUQB 1NJYA 3RMCA 4AHVA 2XY6A 4WZQA 4FJXA 2BGGA 1NKEA 1RTJA 2UUTA 4DLEA 1C1BB 2F96A 2XY5A 3HSTB 2DFHA 4KHQA 1BL3A 2UVRA 4OKKA 2B43A 3AA2A 4N47A 4J2EA 1WAJA 1U49A 5KT4A 1GX5A 4M3RA 3KMQA 4N76A 2DFFA 1HMVB 3CJ2A 5HP1B 1S9GB 3FSIA 5KFLA 1S97A 1EETB 1JLAA 3SUQA 4DTMA 3DLBA 2HHXA 4CGJA 4IRDA 3NF8A 4PUOB 3OL6A 4O0IA 2HHQA 4WE1B 1L3SA 3IN5A 1N6QA 3PZPA 4FCYA 3L2UA 3HJFA 3ITHA 1SH0A 1FKOA 4EBDA 4CIGA 4AHSA 3L3UA 4ECQA 3T5JA 2ATLA 3SI6A 4QOZB 3ZSXA 3TI0A 4YFUA 4IDKB 3QGIA 1N48A 1N5YA 3KJVA 4CJ5A 3D0PA 2XWYA 3SQ2A 4KTZA 4F50A 3TQ1A 4RZRA 2D5RA 2IDOA 4DFPA 4KHSA 3FRZA 4ECRA 3RWUA 3OHAA 1HQEA 5EU7A 1DLOB 2E4LA 2IOCA 1JL2A 2AX1A 3OS2A 4AHRA 2XY7A 3V81B 2DY4A 2OPQA 2GIRA 1DLOA 3SQ0A 1L3VA 3QIPA 3LP2B 2FBXA 2NUBA 3H5YA 5I42A 4YNQA 1RT3B 1B9DA 2B6AA 3T19A 1SL1A 1B9FA 4Z4EA 4DL7A 2ASDA 4R0EA 4CGHA 2HB5A 4Q43A 5KG7A 3UR0A 4JS4A 3HP9A 4IR9A 2O4IA 3K58A 4O4GB 2W7OA 4GW6A 3HVAA 3RB4A 1Z4UA 4CF1A 1DTQB 3OYMA 3S9HA 4B3OB 4FLWA 4CJPA 5L1LA 4HUGA 3V9WA 4ECYA 4WE1A 4RW9B 2XGPA 2OYQA 4OVLA 2QV6A 5KFCA 1T05A 3S3NA 4J9MA 4AHCA 4W5QA 3N6LA 2C2EA 3KLEB 3WNHA 3KD1E 4QCLA 1WSFA 2OA8A 1W25A 1T03B 2JC0A 1ZBIA 3DDKA 5HP1A 3M8SA 2W8LA 4FJIA 4IG3B 1RYRA 3NH0A 2IAJA 3IS9B 3M8PB 4I7FB 4BWMA 3VQ8A 4YQWA 3AVGA 3QEIA 2ATQA 3OHBA 2HW3A 4CEDA 4CEFA 2YNGA 1A5VA 2FBVA 2JEJA 1RTJB 2IM1A 4B8AB 4M3XA 3LP0A 3HXMA 3B6PA 4CEAA 2VWJA 5DQGA 4ICLA 4ZP9A 1LWCB 4CJTA 4KB7A 2W9BA 4B9MA 2BE2B 1D1UA 4CHNA 1XI1A 2D3ZA 2F8TA 4PQUB 5F8LA 1CXQA 4J9NA 4J2BA 1LW2A 3CJ5A 4CJFA 4CEOA 2IGIA 4CJRA 1JLCB 2WB4A 4FJHA 3PHEA 4CK1A 3S3OA 3C6UA 2JC1A 4KHRA 4CFCA 3E01B 5F8MA 3JYTA 4ED7A 1VRUB 3RTVA 3LP2A 4KAIA 2HHUA 3NH1A 4H4OA 4DF4A 2XI3A 4DWIA 1QSSA 2OPSA 5KT2A 3Q8SB 3GV7B 5HBMB 1JXBA 1HQEB 1T8EA 1ASWA 1NJXA 4TYBA 1Q9YA 4DSKA 4IFVB 5J1EA 1IKYA 5FRMA 1WSJA 4E89A 4HUEA 1JLBA 4WYLA 4QW9A 3V9XA 3BSAA 3KJVB 3KK2A 3IG1A 2R8JA 1L3UA 3MFHA 5F8GA 5KFOA 1S9EA 2A1SA 3M8QA 2HNZA 5DGAA 1BCMA 3DOKB 4C8NA 4NZ0A 4I2QB 4RNMA 4EBCA 3KLHA 3RRGA 4ED6A 4I9QA 1X9SA 1EX4A 1TK8A 1S0NA 3V6JA 5EDWA 4HCCA 3C94A 4ED3A 4B9VA 3DI6B 5F9NA 3OYEA 1BI4A 3RMBA 3KLFB 3PW0A 4CERA 5KRTA 5F9LA 4MH8A 5DQIA 4CF9A 3LAMA 4KB1A 4ELTA 1U48A 4LQ9A 3DMJB 4NRTA 3PY8A 3NF7A 3ZSZA 2R8HA 1X9WA 3KD5E 2RKIA 1HYSA 3QIOA 1WSGA 4CK3A 3CJ4A 4MKAA 4H8KA 2VG7A 4IRCA 3PJXA 2XCAA 2KTQA 3MR2A 3PO4A 1MU2B 2QK9A 1XR6A 5I3UA 1D9FA 2KZZA 4PA1A 2P51A 1OS5A 1SKSA 3QEWA 2HNDB 4F4YA 4ECVA 2WRMA 4DU1A 5KFXA 1I6JA 4G1QA 3DM2A 3EZUA 2Z1GA 3PR4A 2VA3A 3TR8A 5C5JA 3LP1A 1JLQA 3NKYA 1ZBHA 1JLEA 3OSNA 3PJWA 3F73A 3NMAA 4FW2A 1ZTTA 2YHAA 5L1JA 4M42A 4M94A 3KOAA 3RMDA 4ECWA 2FBTA 2OPRB 1SV5B 4J9KA 3TABA 3MEDA 2D0CA 2OPPB 3D5MA 3P5JA 3LANA 3KLIA 3RB6A 4DL4A 3ZT4A 2Z1JA 3V9SA 4CCHA 3VQ5A 4X2BA 3VQ6A 4NCAA 3SNNA 4CJEA 5KG6A 4PWDB 1G15A 1LWFB 1TQLA 3WNGA 3PX4A 4OGEA 2WONB 4IOBA 1TKTA 3LPUA 4LSLB 3GYNA 1EXQA 4M45A 2WCXA 4JV0A 3RRHA 4Y34A 5KGXA 1HPZA 4F3OA 5DG7A 2C28A 4W5RA 4RW7A 4RW7B 3L2RA 1HPZB 2W42A 4KO0B 3BJYA 1UA1A 4RNOA 4NLTA 2X6SA 1TV6A 4QW8A 3EPGA 1U47A 4HTUA 5T7BA 4DL3A 1RBVA 4FLZA 4CGFA 1S1XA 4FVMA 3NAIA 3AA5X 2HHWA 4ZP6A 3NBPA 4WXWA 4EEYA 4KI4A 3GV5B 4BE0A 3OJSA 2IA6A 3Q8PB 1HNVB 4HCBA 3BSNA 5CYMA 5K14B 1GOBA 4DTSA 4ZVGA 1NK4A 4XIUA 1GOCA 2ILYA 2Z1IA 5KFZA 4TQRA 2XRIA 4F4XA 2FVSA 3CQ8A 4HYKA 1D5AA 3V4IA 3CDWA 2D3UA 2ALZA 2FLPA 2ZD1A 1KTQA 3SZ2A 3SJJA 3WNEA 2C2DA 5KFUA 3HKWA 3NGYA 3OYFA 3S3MA 5I3UB 1MU2A 5HLFB 4EZ9A 4LH4A 4DTJA 3ICLA 3DLGA 4M3UA 4DMNA 2HAIA 4CE9A 1REVB 2O5DA 3NL0A 2HWHA 4CJQA 1ZBFA 1LWEB 2VG5A 3ZT0A 1IG9A 3HVWA 1HNVA 1TL1A 2ILZA 2KW4A 3DMJA 3OVNA 5KGWA 4DL5A 4DEZA 3HO1A 2W9CA 3SFGA 5KFMA 4IG0A 4B9UA 5HRRA 5DMRA 4FS1A 5KG3A 4NLYA 2LSNA 4J2AA 1BI4B 2G8KA 3ASMA 3NF6A 3AA4A 3DI6A 1QSYA 4CFBA 4Q0BA 2AGOA 4CHOA 4OGCA 3AVFA 2F8SA 3VQ9A 1C0UA 2AGQA 4I2QA 2QE5A 3JSMB 3CM5A 4EO6A 4FBUA 3MFIA 4O5BA 1SL2A 5DK5A 3M9NB 4WFYA 4K4TA 2X74A 1WNSA 1S1WA 3FFIA 3H5SA 1S10A 3QO9B 3IG1B 1S5JA 2D41A 3KIOA 1S49A 1JLBB 3MEGA 4J9SA 2UVWA 4BACA 1RT1B 3KLIB 1RTIB 5KFYA 1Z26A 3U3GA 1JLGB 4TY8A 1ZTWA 2C2RA 1T3NA 4URGA 1BQMB 5FDLB 3Q8QB 3SCXA 4K4UA 1FXXA 2OPRA 5C42B 1YVUA 5JXSA 3GV8B 4EYIB 1RT5B 2IM2A 2VWKA 1ZBUA 2RF2A 3DOLA 1LW2B 2UVUA 1BIUA 1L5UA 4Q45A 3ZSWA 4FW1A 3BR9A 4PQUA 1IKVA 1JKHB 4R8UA 1IKVB 3BDPA 4G1QB 1ZYQA 4DSEA 3IGNA 4YR0A 3OYHA 2F8EX 5KT6A 4Y3CA 3K57A 2IM3A 4K4ZA 1BQNB 2G8UA 3SQ4A 4DL2A 3V4IB 1RT5A 2R8KA 5HROB 4JV2A 1NJZA 3NGDA 5KI6A 1Y97A 4ID5B 3VQDA 3CJ3A 3I0SA 3PUFA 4NCGB 4TLRA 4EO8A 3HVTB 2UVVA 4EBEA 4ED1A 2RDIA 5EWEA 3G6YA 3RMAA 4AH9A 5J2NA 4MIAA 3V6DB 4YR2A 4IR1A 4ECSA 1KHVA 4ED8A 1NK9A 1SL0A 4GC7A 4EYHB 1S1VA 2OH2A 1S1TA 1RNHA 4DG1A 4KREA 4KO0A 3AA3A 3KNAA 3KLHB 4CEEA 4KB0A 1J9AA 3LZJA 4FXDA 4Z4HA 3SV3A 1C0MA 1C0UB 4IFYB 1N56A 2R2RA 3P1GA 5L1KA 2JEIA 1S9EB 4B9LA 3K5LA 5FRNA 2ASLA 2BANA 4J2DA 1RDBA 4KHUA 3VN5A 2WONA 5CZ2A 2FJWA 1JX4A 3KK2B 4QPXA 1LWFA 1QUVA 2FBYA 4ZVEA 3I0RB 2B6AB 3T3FA 3AVLA 1YT3A 4F2RA 2W9CB 4CHPA 3ZSRA 2V4QA 3LWMA 4TN2A 3H08A 1TL1B 4U6PA 5HBMA 1VSFA 4DLGA 3VQAA 4FJMA 2G8VA 4CFDA 3CM6A 5KT7A 3IRXA 1TL3A 4Q44A 3AO2A 4JLHA 4NRUA 5DG9A 3DRSB 3QGGA 1VSMA 4FZYA 2JGUA 4CF2A 2JLEA 3DLGB 1KVCA 4O3NA 3V6KA 4F4KA 1VSEA 1U4BA 3OS1A 3AO1A 3M8RA 2HWIA 3SYZA 1D8YA 3BQ0A 1A5XA 5CZ1A 2BR0A 2GC8A 1TKXA 3ZT3A 2BE2A 1RT4A 1LWCA 5HRSA 2IJFA 1QSLA 3QNOA 4KFBB 4NYNA 4QWDA 4E3SA 1D0EA 2WTFA 4ZP8A 1ASVA 3H59A 1JXEA 2QKBA 1HJRA 2B5JB 1QQCA 4EZ6A 3LZIA 1NHVA 1SH2A 1EETA 3H40A 4J9LA 3OSPA 4L8RB 1IKXA 3GIIA 1RTDB 1S1UA 3G10A 3SUPA 1EP4A 4QWEA 1IKWB 5CYMB 3EZ5A 4NLRA 3OYDA 4QWCA 1S6PA 4CFAA 5KTQA 3N6MA 4KI6A 3PV8A 2YKNB 3PW4A 3CDUA 1C1BA 2IMWP 3ULDA 1RDCA 1S48A 4Q5VA 1DTTB 3D45A 3OYKA 1FKPB
chains in the Genus database with same CATH superfamily
2QRRA 1SKWA 3D2EB 4OI1A 4WBFA 4AE5A 1CJKA 4NOHA 4H0VB 1S4EA 4Y1CA 1XK8A 4NLUA 4CJUA 2V63A 2OZMA 3GYXB 3EEQA 1ATRA 4PWDA 2BH1A 3TVKA 1BCOA 1IKYB 3BM7A 2CQ2A 3AJDA 2Z58B 2YKMA 2QMWA 1U0SA 5A76A 3I8BA 2GNKA 3VMFB 3O3GA 3FCHA 1S99A 3IFEA 4CGIA 2F9JA 2VDHA 3R5AA 3AV9A 2RQMA 2OFHX 4IEIA 1VR6A 2EEYA 4CF0A 5EHHA 3C6UB 4IH6A 3LP1B 5SUHA 3F44A 5J2MB 2J0XA 3QAEA 4DV6F 2YKAA 3KVGA 1N52B 1GLDG 4BC3A 1SKRA 1SJ4P 2DB1A 3ISND 2MQOA 3KWGA 2DPIA 3OYNA 4KAZA 1KEKA 3D0GE 1BO5O 3OR1B 4F4AA 2OTJS 2CZ4A 2CGJA 2YNGB 3R3LA 4EP4A 1SJ3P 2VFUA 3PW7A 2J6UA 1WI6A 2VGNA 4P7VA 2Q31A 4L73A 2IAJB 4OI4A 5CR4A 4X4PA 4OQJA 1PJ6A 1QAJA 2O8FB 3HFZB 2A1RA 2DJWA 3VEWA 2GHWA 1B99A 2VF3A 3MF5A 4E7JA 2IJNA 2A18A 5HMWA 3IKMA 3GG4A 1YSJA 3CPEA 3VA0A 3GLJA 3GOIA 4E7HA 1WAFA 1WC1A 4CLSA 4GKJJ 3E9OA 1Q81O 4BR2A 5CA5A 4LF4F 4QS9A 3GIKA 1E6VB 4YY3J 1YVNA 3MEEB 2BQRA 2HF3A 2GMJA 5FLXU 5KOWA 3C7NA 3SFUA 3B6OA 1WTBA 4CYUB 2M88A 4CJLA 2QL9B 1R6VA 4F4WA 3UFCX 5IM0A 4E19A 4KC5A 3EGNA 3B54A 1BU6O 2V4JA 1UPMB 3F9KA 2RVJA 2C3OA 1UW9A 3TAPA 1N5YB 2B4UA 1U1PA 4JB8B 4Z4GA 2HHHF 1JIHA 3DLJA 1QS4A 4ANEA 4BDZA 3NNCA 4EAHD 3SUOA 2G8HA 2VONA 1DRZA 1UEKA 3FJ2A 1RTZA 4NLOA 2GVZA 4BC4A 3OYJA 3GZ7A 3QEVA 1V4SA 4RR5A 4CT9A 3NGRA 4FLXA 4A8OA 4RU2A 1ZS6A 2JRSA 1U8SA 3UKRB 4J9PA 2ZKTA 1YTUA 2DR6A 1P1LA 2EX3A 2GV1A 1PKUA 5IWAJ 4PYDA 1K1SA 2K2PA 3PSIA 4DR2F 1GXUA 4LFAF 1X3NA 1K9MO 2VFTA 1TTHB 2KG1A 3G6VA 4E7IA 4IKAA 5KG5A 5M1KA 4WPAA 5J2PB 1U45A 3MN6A 1NB7A 1EKRA 4C11A 3VQ4A 1GXTA 3TJ9A 2HKEA 1F21A 2Q0UA 3A4TA 2CRLA 3KG1A 2ZBRA 2VODA 4FWSA 5DG8A 3FQKA 5CD4A 2YNHA 4A59A 2YWWA 5IQQA 2FVRA 1HLUA 4U7UK 4IO1A 1DQ9A 4R0JA 2VQEK 5DM6L 4N5SA 1YJWS 1RTIA 3VF6A 4C0BA 2DO4A 1ZH5A 3D2FB 1QVFR 4DR6K 4M3YA 3ZT2A 3NG8A 1CZ9A 3VAGA 4BC2A 1RFQA 1N34J 1E6VA 4M7XA 3NCRA 1VSKA 1X9JA 1H2TZ 4USHA 5AQWA 1EKSA 4WP9A 1HPMA 2J7UA 1O51A 5CZXA 1LQ9A 4DHVA 1RA7A 1HLWA 4MT1A 3S6EA 4K4WA 3MI7X 4L3QA 1VSLA 3D2EA 3EYZA 4JK8A 4K4YA 4KSEB 3KHGA 2GFFA 4OYPA 3R9LA 3HPOA 5DJBA 2HK3A 4YHHK 4CM0A 2GWJA 2UZAA 1WUAA 1R8AA 3M05A 5E84A 4WF9L 2GIQA 3A8IA 1NB2A 1FNMA 4M1KA 2EI5A 4RNFA 3ZX3A 4P6QA 5H9FJ 1RP5A 4QWBA 2DRDA 3BH7B 3KJNB 3HFVA 3VZIA 1LW0B 3IWXA 4LF7F 4ZK7M 2O8EA 2BDPA 5KFIA 3UI3A 3SK3A 3MCMA 1YGYA 3NAHA 2D0BA 1RAIB 3AXKA 1SUQA 2A3ZA 1WWHA 3W3DA 4XO0A 4R8UB 4KPCA 1TKXB 2NCKL 3RR7A 5DDQC 3GSIA 4ECTA 1Y4ZB 5J2MA 3TTCA 2UP1A 1ITGA 4DS4A 2AX0A 2EK6A 1WOPA 2UU9K 4FJ5A 1FRIA 3AD9C 3CCRS 5IT9Y 3HK2A 4ZPAA 2CWXA 4O44A 1NMEB 4A8WA 5FDLA 3DLEB 2F7TA 1LK7A 3BF1A 1TGOA 2D4WA 1MDUB 3IRWP 2XMTA 4ILHA 4P73A 3NOGA 3CCMN 3MOJB 2OMOA 4FK2A 2DO0A 5KFEA 2MZQA 4O55A 3PX6A 2JEFA 3A2FA 3G4SS 3NBPB 3VETA 3V5RA 5H1SV 3M2RA 2VG6B 3GU0A 4UUWA 4HT5A 4DX7A 3PR5B 5AQYA 2EBGA 1NSKL 3PW5A 3NVMA 3KWMA 3RAQA 5CHIA 4TYAA 3M3ZA 1R6YA 2KJVA 3BB5A 3L0QA 2K7JA 3VV2B 1UZHA 3AVNA 4R5PB 4OZJA 1VJQA 1DZ5A 3HPGA 4DX8H 3T1YF 1R0AB 4K41A 3ZZOA 3H4DA 4GKKF 4LRCA 3L4IA 4RG8A 3K5NA 5AQNA 3S41A 1S6UA 1HBUB 3J7AN 4AT1B 2AHOB 2HVEA 4F2SA 4W90B 3FKBA 4X62K 2D3O1 3I96A 5HL7L 2PY5A 3UB5A 3DDIA 1E4GT 4QAGA 1Q4RA 1RBRA 1KQFB 1UA0A 1WB9A 3D6FB 5GIOA 4F26A 1XNRJ 3RBZA 3KK3A 4HL9A 2D0PA 2MQNA 2E2OA 2PYLA 4ZJOA 2LVWA 3K8VA 3AVBA 4YOWA 3WQTA 1EO1A 3MM7A 1QLNA 1RDAA 3OYBA 4MK7A 2ZH5A 3SUNA 1YJ9S 4J5OA 3HHLB 3CC2S 3RBDA 4I67A 4NLQA 3S01A 3PO5A 2Q0RA 1G1XA 3ZFVA 1RABB 4CNYA 5LM7E 2N4CA 1V6HA 1TMMA 3MECB 1O1WA 1WKLA 2LFVA 1K44A 1SPBP 1NU0A 4PG8A 1T94A 2EPIA 1B7FA 5A8WB 4AILC 3CJCA 1D9AA 2OHDA 3TANA 4NLBA 4Z4FA 2UXDK 2Q2RA 2E1ZA 3ATUA 3NY0A 5A8KA 1NPPA 3P5TL 2C2OB 1UOCA 1XBWA 1XN9A 5CXTA 1F2GA 1OIAA 5AZJA 3C19A 1U2CA 4O0NA 2O8DB 4DV1J 3QT6A 1N0UA 4FM1A 4LD0A 3GL1A 2E1PA 1XHZA 2B8QA 1M5OC 4Q8FA 1FW6A 4N41A 3GIJA 3MCNA 1SQKA 2EFGA 4KH4A 3V1RA 4ZPDA 1LV5A 1RAEB 2UUAF 4DSJA 2HURA 3SDEA 2DT9A 4F3MA 4E0DA 5B08A 2CJKA 3L7PA 5FROA 3BBCA 3BGRB 4C1NK 2CADA 3CD5A 4CHQA 2EG1A 4X62F 2CQCA 5GAGU 3Q83A 1Y00A 1S72N 4DPXA 1MWKA 3KK1B 2D0AA 4Z94A 4AL5A 1SZ2A 3MDFA 3O3LA 1GNKA 4C8OA 2LA6A 4USTA 1A6LA 3IAYA 1YJ7A 3OY9A 4ICLB 4DR5J 3DNCA 2CZ9A 3JTPA 1T9WA 2H51B 4CESA 4AQYJ 5GAHP 1VIOA 4YMEA 3U9DA 1PGZA 3GG1A 5ETKA 2IS3A 4BDYA 3ID6A 4I56A 1SH3A 1QVFM 4H03B 3AJ2A 3ET6A 4OL8A 3L3VA 2ZM6F 4FPIA 2E44A 4B1YB 4FLUA 1GLEG 3L09A 2D7SA 2Y9HA 4Y2MA 3CD7A 1KKHA 4CK2A 1RAJA 4ETZA 1ATSA 5I3PA 4FJ8A 2V7ZA 1T03A 4JI4J 3CIZA 1JNZB 1FJGJ 4IQXA 4K8ZA 1S1WB 4FYDA 3AVKA 1MMDA 5D77A 1HNIA 5IWAF 4ZTJA 3F0NA 3AARA 4CLWA 3GJRB 1FD8A 3O3HA 3RSEB 1QAXA 2IPOB 3FC9A 1YXQA 2HVIA 1LAWA 1WEXA 2GV9A 1YDLA 4ZCKA 3CJ7A 3EXYA 4X4RA 5BRDA 1TAUA 5J1EB 5KFPA 5LY3A 4IG0B 2PYJA 2OLWA 4HTLA 4DR5F 4AL7A 2YNFB 2N3LA 1RI7A 1ZAXA 2WAQD 3GJSB 1IBLJ 2G0JA 4HLBA 4H4OB 2HZVA 2O1PA 3DRYA 4C98A 4TU9A 4DQSA 4LQ3A 4OX9K 2B4VA 3MEEA 2B9YA 3GE1A 4ISFA 4W5OA 1F60B 2E9TA 1K0TA 4WK1A 4IDKA 4O8KA 2MJUA 3MM7B 2OTJN 2J6TA 2YHBA 4K5SA 2IDEA 2Q3SA 4PL7A 2HNYA 1R7IA 5AQIA 3W3SA 4M8LA 5GAEU 1MSWD 5JICA 4NEYA 4FZXC 2ZBQA 4UUXA 1ATNA 1RDDA 4LMZA 5A6WA 3IC1A 1H3DA 2AWZA 4FJ9A 4ZVUB 1FXDA 4WP3A 1RT6A 4C6AA 2IYGA 2M7SA 3AVJA 2LQJA 3T1HF 2KQ2A 2HVZA 4PXEA 4FVCA 1WDTA 3JQJA 2XB2D 4USVA 4RW4A 3RB3A 3OS0A 2QA1A 3HPHA 2WBRA 4B9TA 3KLFA 1R0AA 4YDUC 4PQAA 4GMJB 4UQGA 2XMJA 1NKCA 1WSIA 1VRTA 4L75A 5L9NA 2RD5C 4JRPA 2CZVC 3TO8A 3SPYA 1UWBA 1RA6A 1YBUA 3M8QB 2VQEF 4ISGA 1BA1A 4TU8A 1KVBA 5KFRA 3QJJA 4ZCLA 3GB0A 4QQBA 5FD1A 3ETMA 3R1LA 1CVJA 4B1VA 3ZC4A 2L3MA 2H3EB 4WIIA 2NZ4A 1RDRA 2GJIA 1F9FA 3HDSA 4RW8A 4ZVPB 3CB4A 2M3DA 2OPPA 3CMQA 5AQMA 3FDSA 1HNWJ 2H9ZA 1SV5A 5HAOA 4YDUA 2UXDJ 4BY9C 4J9QA 4OX9F 3CYMA 3RR8A 5KPRA 3I9V9 1TVRA 1CZAN 4FYXB 2AEMA 1S0VA 2CH5A 2PN6A 4E98A 5HI7A 2FHMA 1S72S 3DOMB 2QMUB 2F4VF 3MM5B 4JV1A 4OKJA 2EKYA 2R2UA 1HYZA 3OTEA 2Z0GA 2ZHBA 3TZYA 1N8RT 4BRHA 1BMQB 3GFHA 1NKEA 1OQ6A 3EGVA 2HS3A 4OI2A 1RAAB 2F96A 2UVRA 2B43A 3AA2A 3RU0A 2YHYA 4N47A 1WAJA 2GVDB 1O8BA 2C2ZB 3MZIA 2YQ3A 4LBIA 1GX5A 3KMQA 4B1UB 4JKGB 3FBBA 5MAOA 2EKNA 4YB7A 3VR1A 1R0CB 1HBOA 5HQLA 1N32F 5EX3A 2HHXA 3ULEA 5MLCQ 1BY9A 4DU7A 3OL6A 3PACA 1MWQA 5HANA 3MM5A 3IN5A 3PZPA 4CZFA 1S22A 2W25A 3ITHA 2A1BA 3WUHA 3SI6A 4QOZB 1X4GA 2EBEA 4A2AA 3KFWX 2DITA 1N48A 3FMWA 1X0PA 2XWYA 3VPZA 3W8GA 4FWQA 5GMEA 2DGWA 4RZRA 3UVJA 3AQPA 2ZH8A 2D5RA 2IDOA 1VCTA 3PHTA 2ITMA 2Q36A 2E4LA 3ZX0A 3R7NB 4BC5A 4AHRA 3BV8A 3ZTPA 1XMQK 3DJCA 3PM9A 4K43A 2NUBA 4I1TA 1ZZNA 3HCXA 2RRBA 4DXLA 3PSFA 2KVQE 1B9FA 4DL7A 2GIFA 3DHWC 3OTOF 4IFEA 3WXIA 1IJJA 4Q43A 4OX9J 4Z7CA 4A62A 2O4IA 1MA9B 3K58A 3PKYA 4CLFA 4GW6A 3RB4A 1Z4UA 4CF1A 1RISA 2V2ZA 3OYMA 3S9HA 4FLWA 1WC5A 2H5IB 1QHAA 4WE1A 4B3MK 4NE9C 4C11B 5KFCA 1T05A 1V5VA 4DPUA 4UY8T 2XO6A 2XSJA 2MKSA 3GJTB 3LM9A 2E66A 1RAHB 2VC0A 4AHCA 3JAMO 2IIRA 2IJRA 2C2EA 4JI7F 1Q81T 3KD1E 4QCLA 2OA8A 1KBRA 2XG8A 5LJ5Y 2VBZA 3D6HB 1ZBIA 3Q23A 5HP1A 1NGEA 3I56S 2Y8WA 4FJIA 2V9KA 4MO4A 4IG3B 1Q86T 4I7FB 2W2OP 4Y6IA 3BKFA 2ALYB 1TUYA 2CYYA 4FPRA 5F3ZA 3OHBA 4R25A 1FF2A 3BYRA 2JEJA 1F5BA 4OYWA 3BR8A 3GE9A 4DCPB 4OJGA 1BHNA 2KXFA 5A2QU 1Q82O 1FXRA 2B9EA 1FX4A 2VWJA 4ICLA 2GVZB 3OBWA 4JI5K 4RX6A 4BBYA 2K7KA 4CHNA 3IM9A 2QGFB 1TMJA 2CPHA 1VQMS 4HH1A 2XLIA 4UTGA 4J9NA 5EX0A 1LW2A 1S76D 3T1HJ 4AQYF 3CJ5A 3EE8A 2P9KA 2KHDA 3CCQS 3JSRA 1FJEB 3PHEA 1XUPO 4CK1A 3S3OA 1RKJA 3RTVA 3A5OC 3LP2A 4EIAA 3U8XA 2ZJQL 1RAOA 4H4OA 1QSSA 2RDDA 5HVFA 4NI2B 1HKGA 3Q8SB 2O66A 5HBMB 1JXBA 1HQEB 3IBFB 2CG8A 1NJXA 5AR0A 4DSKA 3US5A 3HD1A 4IFVB 5FRMA 5IC6B 1WKKA 4J9VA 2O8CB 4E89A 1ESVA 2LQ9A 3BSAA 4LF6J 3KJVB 2I2YA 2RS2A 2G13A 2KVIA 4QZVB 1Y3KA 5F8GA 2ZJPQ 2C3UA 3RUBL 2OANA 1QDUB 5DDOC 4BRDA 5DGAA 4B17A 4ZLLA 4EBCA 2ZOGA 3QB0A 3LPEA 2NQPA 1RWUA 5A8KB 2P6SA 2HFZA 3V6JA 3EXCX 4CT8A 5F9NA 5HQ8A 1G6BA 3H46O 3AD7C 4CERA 5KRTA 4DV4K 3CTRA 5LSOA 1NU4A 5DQIA 4CF9A 2KFYA 3LAMA 1R8CA 1U48A 4DV3F 4LQ9A 3DMJB 3MTJA 4R79A 1VQ6S 5F0XA 1HYSA 1OSCA 3GG0A 2ZH6A 1FCAA 2CQ1A 5GINA 4MKAA 2E2NA 4H8KA 5CCLA 3PJXA 2ATCB 2KTQA 3MR2A 3PO4A 3HSCA 3RW7A 3MD3A 4N8OA 4AQYK 2ZDPA 1XR6A 4O8UA 4PA1A 3O9QA 5LMUF 2V6AA 3QEWA 3EVMA 5CAAA 1TL7B 2VBWA 4G1QA 3G82B 3EZUA 3J7YP 2ZOMA 5KOXA 4ERDA 4GKKJ 3TR8A 1DJ0A 5C5JA 3UCZP 4O23A 3AAWB 1ZBHA 1E3MA 3EE3A 4BVOA 4PL8A 2ZBPA 2ZOFA 1I94K 4M42A 4M94A 1VQ4N 1N8RO 4LR8A 2VFVA 4J9KA 4PG5A 1HNXF 3I56N 1IBKF 5LMNK 1RBLA 2Q66A 2P5VA 2D1CA 3V9SA 3LDPA 4DV5K 3EN9A 4NCAA 3SNNA 4LF8F 1Q8LA 1TQLA 2A3JA 3GCWP 3SBMA 3VAHA 1S6OA 2HFNA 5A0YB 4IOBA 4DV7J 4PXCA 1EXQA 3K89A 2WSEC 5KGXA 3AOBA 4U8VA 4F3OA 2YQ0A 4RW7A 2XWXA 3KK7A 2W42A 2UUCF 3TUPA 4KO0B 3BJYA 3D7EO 1NGGA 4NLTA 3SMSA 4A46A 4HTUA 3MUMP 2OSQA 3NAIA 3AA5X 2CQ3A 3MMAB 2GX9A 3NBPA 2MKYA 2HQFA 3HI9A 3GV5B 4EU0A 1FKAF 1AFIA 3OJSA 2KRRA 4V19J 2HOEA 3OUYA 4CJ7A 3Q8PB 2K8GA 1VQMN 1IQZA 4ATNA 1NK4A 5KFZA 4U7UD 5H9FK 3G8SA 2XRIA 1Q79A 3P38A 3MM8B 1D5AA 1TYQA 3I55N 1V3SA 1S7IA 5AJ3F 2N82B 1HR0J 5FPMA 2RE2A 3UD5A 1LWXA 3LPYA 5KFUA 3HKWA 4JI6J 3EM1A 1GLFO 3OYFA 3S3MA 5I3UB 1KOOA 4GO7X 2B56A 4EZ9A 1N32K 1HI0P 2A6MA 2DNOA 2FJEB 4CLUA 3PYGA 2HWHA 1ZBFA 2VG5A 3HVWA 1VQLN 2PI5A 3EDRB 3BY5A 2ILZA 2KW4A 4B9UA 1U1KA 4WKYA 2MLXA 4NLYA 4FOIA 3ZZZA 3NF6A 3AA4A 2Q6CA 4K42A 3L9ZA 2FHJD 1M5KC 4LUBA 3MM9B 2PE8A 1JCGA 1F3FA 1VFJA 3N4PA 4I2QA 2XQCA 2HRYA 4X66K 3CM5A 4O5BA 3R2CJ 2BJ8A 3CDBA 5IFMA 3M9NB 4WFYA 5E26A 1WNSA 4WFNL 3P31A 3FFIA 5LT5A 2FJBB 2ZM6J 3BGOP 1JLBB 2VIHA 3L6QA 1FI4A 2YXLA 3WQPA 1XEZA 3PFEA 2HSEB 5KFYA 1Y5NB 3U3GA 1ZTWA 2CA9A 2HHHK 3DXKA 4C9DA 3ZTOA 1BQMB 3ZX2A 2FGOA 4CWBA 3FCWA 5JXSA 4EYIB 1XQSC 2CJ9A 3EGWB 4JV5J 2MSTA 1B0TA 3DOLA 4WTOB 1BIUA 2E5HA 3CJ1A 4FW1A 3BR9A 4PQUA 4X66F 2IVNA 1VQ4S 4WJBA 3I55S 1YF5L 4R8UA 4G1QB 4GVBA 1YZ6A 1S5ZA 3U7JA 4AXIA 3OYHA 4Y3CA 4ZITA 2BA9A 1SS6A 3Q8VA 3K57A 1WORA 1BQNB 1OMSA 3QWPA 1RT5A 5HROB 2FZKB 3LDQA 3QAUA 2VFSA 1NZ8A 3W5ZA 4KRWA 3CCQN 1URNA 4U67L 2ZJRQ 4WCEL 3PUFA 3J7YI 2UVVA 3VEVA 5AT1B 4J90A 3RMAA 2DH8A 1VI7A 4XH5A 4KT0C 4IEEA 3UKRA 2V68A 4EYHB 3BDEA 2OH2A 2CG4A 1S1TA 1T95A 4FXVA 3M8ZA 3AA3A 3KNAA 4CEEA 1N5SA 3GPAA 3MCSA 2DTJA 3SIPB 1C0MA 1P9YA 1WOOA 2VBXA 2XMMA 4JI8J 3NNHA 5L1KA 5E3PA 1RDBA 2ASMA 4YHHF 3VN5A 5CZ2A 4I4BA 3EGZA 1QUVA 4JI0F 4BQLA 1RBAA 3UNGC 1N36K 2KN4A 4BGAA 4LFAK 4K2JA 2V4QA 4TN2A 4MMOA 1N36J 3ZZTA 2E5LK 3J80Y 8RUCA 3WX8A 1VSFA 3SCIE 3VQAA 2G8VA 1KC8T 3CM6A 5KT7A 1W26A 3A0IX 4F36A 2F65A 3DRSB 4DR5K 6AT1B 4FZYA 1ZA1B 1Z05A 2I6WA 4E1JA 3V6KA 4ZJQA 4ZPTR 3QSIA 1W2IA 3M8RA 5F41A 2QLJB 1SCJB 1T44A 3WXJA 5B0FA 2R7UA 4WFAL 3QNOA 2E7XA 4KFBB 1UZDA 2DNNA 4E3SA 1YAGA 1ASVA 3H59A 2MKHA 2CVEA 2O67A 4V19S 1K8AO 3QMLA 3I4PA 1JJ2R 3H40A 4ZCIA 3SUPA 1NRKA 1RDUA 3GSDA 4LF2A 1S6PA 2GQQA 4WTYA 5M1OA 3UCGA 3PV8A 3QICA 2JWKA 2OTLN 1C1BA 2HG4A 1UKUA 4ER8A 2CQIA 5CHCB 4Q5VA 1DTTB 1FKPB 3CCSN 4DOZA 4DR2K 4M5DA 1WF2A 5AE3A 2V5HG 2WZ1A 4B3OA 5GIPA 4DV0F 3UDCA 1C0TB 1JJHA 4FLTA 2CPZA 2E2QA 3L7UA 1IH7A 2HHTA 4UQTA 4ZVOB 1K1QA 5GMDA 1D8ZA 2CKWA 3OTBA 4DR3K 4DQQA 2BRLA 3HHLD 1RHJB 3SQGB 2BM1A 1BGXT 3O44A 4X84A 3T5KA 2JEGA 3CC7N 4NLVA 3VF0B 3CXCR 2AD9A 3HI0A 1D09B 3A3NB 4CJVA 3TOQA 4QOTA 1GOAA 1KLMA 3ISNC 3LDOA 3C7NB 2ZF5O 4WFAQ 3AFGA 2YJEA 3V1QA 3TAMA 4DX5A 3UVJB 2DXEA 2PGCA 1JCEA 2QA4N 2W01A 3O3FA 1KVKA 3DRPB 3W63A 3THWB 2NYHA 3UDLA 4K4SA 3O2IA 1P1TA 4J9RA 3MMCB 1S7HA 1RBTA 1YZ7A 3C0BA 4QIEA 5BPMA 1ZM4A 4NB4A 1YHQN 4C97A 1FDDA 1RHKB 2G9OA 3QETA 4NLGA 2FVCA 4KGZB 4FWOA 4LF4K 1X4AA 5FPDA 1OH6A 4CRJA 4QU7A 1CEZA 2JWNA 3J81O 1IKWA 2CPFA 2P8IA 3LL3A 3R5GA 5L38A 5EVZA 1NK5A 2K1RB 3MXJA 1Y5LB 2VPYB 4X65F 2B5JA 3RZAA 3VA3A 2YCHA 2IVPA 3OL9A 2BQ3A 4G6VB 1T05B 5K8PA 1PYOB 4I64A 2EWSA 3DOKA 2LEPA 3WX4A 3H3OB 1WLJA 3LA0A 4A8SA 3EY1A 4CQ1A 4K50A 4CTAB 1TVRB 4NYPA 2VKZG 3CO0P 3H0PA 1N33J 4TSXA 1RT7B 4WU3A 4F0HA 4H0YB 3W1YC 5I42B 3MN9A 4Y2CA 1S4FA 1NK7A 1WC4A 4WFBL 4USWA 5AQRA 2UXBJ 3VQCA 3WEEB 1VRUA 2G2YA 4E8UA 3OBIA 1U1RA 3VQEA 4H4MB 1YK9A 1HJOA 5E3AA 3QGHA 3TQEA 4DZ6A 3JB9k 4MKBA 2AGPA 5C24B 3TVYA 2W7AA 4X4VA 3M1FA 3HP6A 3AVIA 5CYJA 1PAEX 4ETXA 2PZSA 4JI0J 4ED0A 4KGXB 4WWSA 5HMZA 1IJEB 3CCJS 4LF9K 1S1VB 3ID8A 4LF8K 2DR7A 1WJ9A 4H5VA 3CNQP 1IM6A 1XMQF 1JMTA 5AZIB 2BMBA 4ELUA 1VSJA 3HVTA 4QPTA 3CJSA 3E3XA 1RTDA 2C3PA 4DTNA 3M9OB 2FLOA 5L39A 3PW2A 1FE0A 3LGHA 4B3RK 2DGSA 2ZWPA 1JLFA 4O3QA 1NJWA 1RAGB 3ZZRA 2DVIA 1EWQA 2COLA 4I6AA 1J6ZA 3MMCA 1Y64A 2DIUA 2CFXA 5JJBA 1RT4B 1LOUA 1S6QA 2AJ0A 1XR7A 1FTCA 2E1RA 2R7VA 5K8NA 3PX0A 4B3TK 3SCLE 2QA4S 4Y0FA 1KHWA 3DRPA 3VEYA 3VEOA 2BJ1A 1DARA 3NDKA 4P75A 4H4MA 5C42A 1Q95G 1WF1A 2D1KA 2V94A 5D3GB 2ABYA 4X66J 2IVOA 2OAUA 4GKJF 2HMIA 4KBOA 4RJVA 3K5PA 3IUCA 3HX9A 1KXPA 4J37A 4ILGB 3ZTRA 1M1HA 1UEVA 5HJXA 1RT7A 3OW2M 5LXYA 3A13A 4FWPA 4OFZA 4EHTA 2HFOA 3ADAC 1H2VZ 5D0EA 1N6QB 2NRTA 2GTDA 3FR0A 4M5DB 2MZ1A 1IR0A 2DY9A 3QLHB 3CMEN 1VRTB 2B4PA 2WSFC 2HMPA 3V9UA 1DTTA 4ZVHA 4KGKA 3O9SA 4NASA 3VQTA 1RCHA 4Y0WA 2YHWA 5A8RB 5KT5A 1NOYA 3VAKA 2JHEA 5KFVA 3BKTA 2BKOA 5AQHA 3TEHB 4DL6A 1VSIA 1ELOA 2WK4A 2CDQA 1MROB 3TAGA 1AFJA 2RMLA 3MEKA 4DR3F 4HEA9 4TVAB 4RWWA 1BHLA 1RWOB 3CC7S 2BM0A 5EGYA 3JTNA 3UCUP 3JSYA 2DHHA 1OYDA 2MQLA 2R3VA 3QDKA 3CCMS 5IS2A 2LEBA 2R8IA 1BIZA 3CJKA 2HNYB 3CWJA 3MOZA 3WXKA 1UJ6A 4FWLA 2CQ0A 4ZJLA 2VHGA 2E2PA 3ZSQA 3P49B 4W5NA 3H90A 4A8YA 4GY2B 5J2QA 5IT9O 4NO7A 3HSJA 1FJ7A 4DV0J 2HVHA 3DLKA 3K0SA 4ECXA 4GMKA 3SDEB 1KLMB 4YY3K 3D2WA 3OL7A 2YKQA 4ZVSB 1KAZA 3H1VX 2ZH4A 2YNFA 2KKZA 4JKHA 3BPSP 5ETTA 5SWMA 3HZ6A 4L72B 2R7RA 3QNNA 3AGRA 3DGVA 5F8JA 1VQ9N 4ZPCA 3BBBA 1CXUA 3A5MC 4D3HA 4UOGA 5DLGA 1UMJA 1ZAVA 2IRYA 1QAYA 2QTWA 3ETOA 3THXB 1TV6B 4BR0A 5C25B 2AP6A 4HI1A 2O8DA 1NDCA 1C0TA 1KQKA 5AQZA 3ZO7A 4IKFA 2ZWOA 4CEBA 3DRRB 5KFSA 2GUPA 1OY9A 1PC5A 2KFZA 5DZ6A 1VBZA 1OH5A 1UJ5A 2N7CA 4MFBB 4JNEA 3HYFA 1S1TB 3AVCA 3M30A 5GADP 3PG9A 2HS4A 2X1BA 4NLCA 2KXNB 1KVIA 4KTWA 2NS1B 1ZOTA 3OW2R 1X5SA 2AF6A 3G2XA 3MECA 4IOXA 4JI1J 5B0AA 4O3RA 1M1KO 1YBTA 4FPBA 2U2FA 1YJRA 4J7CA 2I5JA 3P45B 3CG7A 3UDVA 4DSFA 2BE7D 3FZ2A 3K9JA 4OZ5A 3GIMA 4DMZA 4O3SA 2OI2A 2HAFA 3M6WA 1QZ6A 3ATVA 1VBYA 1D4XA 4JI7J 1YTAA 1K9MT 3J8AA 3UPFA 3OHRA 3JTOA 5F8NA 2QWQA 4WF9Q 3EPIA 1H1VA 4IOAL 1Y11A 1VS3A 2FC0A 5KPZA 4KJIA 5ADXH 4ZPWR 1Y5IB 3CCTA 1NNDA 1WN7A 2LYVA 2D3OR 4W98A 4BVPA 3I0RA 3Q2TC 1HBMB 3SQOP 3TR5A 1LOTB 2MGZB 4OJHA 2LKZA 2DKOB 1ZBSA 4RKUC 3G6XA 3VTIA 2OKQA 3LWLA 5E33A 4DPWA 3M2VB 2V67A 4G1IA 4LIWA 2R42A 3HL8A 1XQIA 4EP5A 2GUIA 2E1MC 3CCLS 1UVNA 4FWKA 1CZBA 3W61A 1M1GA 1TKZA 3CCUS 4LSLA 4Q0BB 4C0OC 3W2VB 4CGDA 1VQON 2WBMA 2VFRA 1W97L 5DGBA 3BP8A 1VQPN 1IUJA 2AYBA 4KYZA 4RBTA 3VAIA 2WW4A 2P9NB 4RTFD 4B3SJ 3Q7CA 2CPIA 5A2QO 1FERA 2DBBA 4ILMA 1FNOA 3N5BA 1WSHA 3MEDB 3FZKA 4USJC 3E01A 2FYXA 5B7WA 4OHXA 2G2OA 2EFNA 2AEJA 4OZNA 3Q8RB 2NLXA 2PBDA 5LOQA 1FVQA 4F3QA 2SXLA 4PG7A 1VLYA 2GMHA 3MD1A 2FVPA 3O4QA 5M2UA 3OLBA 4GC6A 1VSDA 2G8WA 5THWA 4YY3F 2V9WA 4BRIA 3GFYA 1X9MA 4FF3A 2VCPA 3KHHA 3PTWA 1VBXA 1DAXA 3MXHP 3RYLA 3EJMA 3TAEA 4HUFA 2FLLA 1QHTA 3L7OA 2YNIA 2O01C 5AE1A 1KLNA 4DTUA 2KT5A 2UUCK 1NDPA 3OYLA 1JLGA 3D3CJ 4FLVA 2GHPA 2C2MB 5L9XA 1HBUA 2JSXA 3LPTA 3IS9A 2Q1LA 1SQEA 3T1HK 2BXJA 4L6V3 4ZTFA 3LO3A 5DM6Q 1TP7A 3FEXB 4W5TA 2E7WA 2EG2A 4FLYA 3M1VA 1CULA 4R5PA 2KXHA 3FK4A 4DTOA 2IA0A 4L74A 1IBKK 2HNZB 4MDAA 1HNXK 2JFDA 4CEZA 1YRXA 4O4GA 3N4QA 2MY8A 4DBQA 1KWMA 4WIQA 4YN3B 1QZ5A 3JSBA 5AFUA 3Q8YA 3T1AA 1ZM9A 4ELVA 4JI6F 1YJ9N 1YG0A 3JXOA 2V4RA 2XGQA 3HM9A 5E5NA 4C8LA 2P9EA 3O9RA 1OQ3A 3D2FA 4LF5J 4DV2J 2BQUA 3CO9A 2FJXA 3V2UC 2AYGA 1C2PA 4CDIA 2VKRA 5IC4B 3NGUA 4FKYA 4OYMA 2Z57B 3CCZA 2EVZA 3PXGa 3MCAB 1IO2A 4E2FB 3D1HA 3AO4A 4FJLA 4K8XA 1VAZA 5F2RA 2J9EA 4LBPA 4IBNA 1QE1B 4DU3A 2WHOA 4AM6A 4DU4A 3OQ2A 3QIDA 3KHRA 4JI3F 4BGBA 3W0LA 1X8DA 3QZ8A 1TK0A 5BPLA 1VQ7N 2UU9J 4I0WA 2APOA 2DNZA 1OVYA 2H5EA 4BRPA 4DFJA 1KNZA 4N8NA 4B3TF 2VC1A 1KQGB 1ZETA 3MUVP 3THYA 4ZMMA 3BSOA 3M8PA 4ES1A 4YOUA 4PRFA 4ZHRA 3M6VA 3CJTA 3H7HB 5DO2A 3KLVA 1HI8A 2JDJA 4JK9A 1LXNA 3HLUA 3E51A 4ZVQB 2IHR1 4NXMF 1BISA 2I0XA 1H73A 1FDNA 2HBRB 5H1SQ 5SZTA 4CZIA 4MYTA 2G0IA 1ZBLA 4DFMA 3M9MB 2HFVA 3MPYA 3VALA 1AB8A 4BRAA 1N34K 1CJUA 2I38A 3IO1A 1A5WA 1XMQJ 1CJTA 5F8IA 4EGLA 2QLFB 2PEHA 2I1RA 1FJGK 3T1YJ 4OLBA 1VQ8N 2Z56B 2AZ3A 1X5PA 1AYEA 3VQ7A 1MWMA 1WG1A 3LALA 3AXMA 1X31C 2ROGA 2FB0A 3TA2A 4CYUA 4QYRA 3OVBA 1CJVB 2FD2A 1NK6A 2H4YB 1KQSM 4NEZA 2Y1JA 1TKDA 5J2QB 3O1BA 3SV4A 2XMKA 2DFEA 3A8KA 3QEXA 4Z4IA 3HHLC 2BV3A 2XYHB 5I9EB 3DYAB 3DM2B 1RSCA 5K8MA 5IXUA 5AXNA 1SJRA 3HOTA 2UUBK 4TXSA 1NJYA 2B8PA 3RMCA 3ENVA 4AHVA 2D74B 4FJXA 4RO0A 1HI1A 1DEJA 5HJYA 2ASOA 1GMWD 4F0MA 5ITHA 1MWYA 2CNNB 2UUTA 4JKEA 2N3OA 5LJVA 2O8FA 2DFHA 4KHQA 1BL3A 4OJ1A 1SB6A 3LDLA 4OKKA 3FLCO 2XZTB 4BRKA 2HQIA 4GNIA 4PZVA 4N76A 2KT3A 3BBFA 3CJ2A 5DM7L 1B0PA 5DDPC 5AXLA 4AF1A 2W1BA 4FNHA 3HKZD 3U27A 1PIEA 1VJWA 3G4SN 3SUQA 2MKCA 4DTMA 3DLBA 4CGJA 4CO4A 2IDLA 3NF8A 4GV6A 2AKWB 1XNQK 2UXCK 4WE1B 2XLJA 1L3SA 1Q16B 1N6QA 2J76E 1UTAA 2QC3A 3L2UA 3HJFA 5D0HA 4OLPA 1G99A 3RBXA 3BYPA 5DS7A 4AHSA 3NLCA 3L3UA 4ECQA 2ATLA 1RWXB 3ZSXA 2Z30B 4YFUA 4I6MA 2FZGB 3KJVA 5GVQA 4CJ5A 1I94F 2M4MA 4DFPA 4ECRA 2V4JB 5LJWA 2L48A 5EU7A 2DGOA 2H4WB 2IOCA 1JL2A 3OS2A 1P8GA 2DY4A 2QWLA 2GIRA 4AM7A 3LP2B 2FC9A 2FBXA 3H5YA 4YOVA 1ROFA 4K0KF 3T19A 1SL1A 2ASDA 1KTVA 3TZXA 2BTFA 3TU5A 5KG7A 3UR0A 4JS4A 3HP9A 1XJWB 3BH6B 3WXLA 4O4GB 4GO5X 1NJIT 3HVAA 4JP8A 2DRBA 1Q5VA 2RQ4A 3RGIA 3V9WA 3I9ZA 4ECYA 3AB4B 2XGPA 4IXCA 4OVLA 3S3NA 4YDXA 3ELHA 3ENOA 4J9MA 2ASYA 4NXNJ 2AT1B 3PIPL 1SQGA 2DR9A 2Y0SD 3KLEB 2EFOA 4FOEA 2F7VA 4YORA 1XMBA 4BWMA 4YQWA 3AVGA 2J9DA 4ZLNA 2QMXA 4QIGA 4K7QA 3C6HA 4X4NA 2WW8A 2IM1A 2DIVA 2HIYA 3FNNA 4B8AB 1WHVA 3HXMA 2XSJB 1YI2N 4OX7A 3H45C 2M8HA 2XMUA 3LF0A 2QYCA 1D1UA 1ZM2A 4FWNA 2D3ZA 2F8TA 5F8LA 4U95A 4J2BA 2GW8A 5B0BA 4ANDA 2GMLA 4CJFA 1RU1A 3CCVN 1RWNB 5B0CA 3CXCM 1AW0A 4GV9A 1NAQA 1GXLA 3ZZPA 4CFCA 3E01B 4OYAA 5F8MA 3JYTA 3GCXP 2HHPA 3NH1A 2OSRA 4FF4A 5KT2A 3VERA 4WKRA 2VOPA 2HQ3A 1ASWA 4TYBA 1H7XA 2P9NA 3P96A 1VHXA 4DHYA 2HPUA 5GAGP 3TNVA 1IKYA 4JYAF 2B7CB 4HUEA 1JLBA 4WP8A 2NRWA 1U2FA 3KK2A 1N5TA 3QBXA 3MFHA 2J4RA 5KFOA 2A1SA 4DN9A 4UOFA 2HNZA 2KI2A 2CQHA 2C1EB 3DOKB 4C8NA 4I2QB 4CLZA 1UVJA 4YB5A 4ED6A 4I9QA 2H65B 4FDFA 3BEGB 5C7PA 1RWVB 1RDWX 4CO3A 4FO0A 3TX0A 3DI6B 2VDIA 1YUWA 4NXNF 4LF7K 3PEHA 4F0KA 4MH8A 3QRPA 3D0IE 1T9VA 3R6GB 2PMWA 4NRTA 1HD1A 3KD5E 2RKIA 3S8SA 3H1QA 5E7OB 4FKXA 4CZCA 2GWKA 2OD4A 3W60A 2Z4PA 1VQ7S 3D9BA 3BPDA 2QK9A 1R8HA 3VGLA 3U1NA 3FEZA 1NDLA 1FT8A 2HNDB 4F4YA 4HT7A 2ADBA 1Z2ZA 5LMNF 3JXUA 4BR9A 3DLLL 2Z1GA 5D6GA 3PR4A 2NPIA 2OD6A 2DHGA 3EZOA 1ICEB 4ZVTB 3NKYA 2ZNYA 1ZC6A 3OSNA 3NMAA 5L1JA 3KOAA 3X1LB 4OZ1A 2FJDB 1W7WA 2OPRB 4ECWA 1SV5B 4CZGA 3CJ8A 3PNIA 3TABA 3MEDA 1Y7PA 5DZ7A 5I3QA 1FJCA 2QXLA 2ZBIA 3HT0A 2A40A 2VGMA 3OUYB 2VQEJ 3PFOA 4PPDA 3VQ6A 4DV7F 4CJEA 5KG6A 1LWFB 1K0VA 4OGEA 4X65K 5E3QA 2WONB 4OIXA 2Y8YA 2HQCA 3LPUA 5K5MA 3RRHA 4CO5A 4Y34A 3A5NC 4RW7B 3J81Y 1HPZB 2HBMA 2G0CA 2FGCA 3MURP 1UA1A 4RNOA 1GH8A 2QA4G 2XTJP 4DV3J 2X6SA 5AXKA 3EPGA 3M2VA 4DL3A 4A5AA 4FVMA 4ZP6A 1FWLA 4KHPJ 5CQGA 1R31A 1KS2A 1NBWA 2BJEA 2P9LB 4J8FA 4CZLA 2RE1A 5EX5A 4HCBA 5CYMA 4IZ9A 1M5HA 2OP5A 2V69A 4ZVGA 2BABA 3CERA 1NSAA 5LMUJ 3E8OA 2ZH7A 3AHPA 5CE3A 6FD1A 2XHCA 5D4OA 1G2EA 3CQ8A 4HYKA 3R1HA 1M5SA 3TTDA 3DGPA 4M5LA 3CE8A 4FPAA 2ZFHA 4DR4F 1K8KA 3EUNA 3SZ2A 5A2QY 1XMOJ 1PC4A 2M0GB 3VWSA 4LSZB 1S77D 3QQCD 3WNEA 1SQFA 2C2DA 1H2UX 4K2XA 3T6BA 2PAVA 2V7YA 3NGYA 2UV8G 1MU2A 5HLFB 2VJVA 4LH4A 4DTJA 1DY3A 1VRQC 2FZCB 3CCVS 2ZITA 2HAIA 3AQOA 1GLBG 1DHMA 2GGPB 5HVGA 4YDDB 1IG9A 3QNWB 4X64F 1HNVA 1WF0A 4LFCF 3N28A 3OVNA 2M52A 3SFGA 4RWTA 2KYXA 4KQZA 5DMRA 1WI8A 4C3MA 5KG3A 3C16B 3QJLA 2G8KA 3EDQB 3ASMA 1HD0A 3NXZA 1QSYA 2AJFE 3HHDA 3VQ9A 1X5TA 4K59A 3C6AA 5BR8J 2UV8A 1XNQF 4DR1J 3MFIA 4F7VA 1SL2A 3BO4A 3AA9A 5DK5A 1VHIA 2JZ5A 1VQ6N 1S1WA 1VK8A 2IVYA 2W4PA 3FBEA 1S5JA 1YRUA 2XYPB 2D41A 4IWVA 2F4FA 4HVZA 3MEGA 2NXEA 2QEXS 1OY8A 5IV3A 1Z26A 2BJ9A 2AZ1A 1T3NA 4JV5F 1T9UA 2N4DA 2BOAA 3SCXA 1WD6A 1V5IB 3BZQA 4K4UA 5C42B 3TA0A 4RBVA 1J5EF 3M8WA 1BOTO 3J7ZO 2FHKA 3ZZ0A 2ZWHA 1LW2B 3HM8A 4ZIWA 3ZNJ1 3ZSWA 5AQTA 3U4LA 3SXLA 1JKHB 3BDPA 2N7YA 1SXLA 4AUKA 3IGNA 4QIFA 2M8DB 4P71A 4L76A 1KD1O 1HFEL 3R3TA 1TU0B 3ENAA 1V3ZA 1B0VA 1H7WA 2EWHA 3EO3A 4JV2A 5KI6A 1L3KA 3B6BA 1XNQJ 4EK2A 1RLCL 1Y97A 4ID5B 1WSRA 3VQDA 1VHFA 3I0SA 4TLRA 5E3RA 4EO8A 3HVTB 1MN9A 1HBNB 1NSPA 4EBEA 4HR2A 3G6YA 1HNZF 3IAS9 4AH9A 5J2NA 4MIAA 2V8GA 3UD4P 4QYZJ 4UOCA 4IR1A 1ZM3A 4ECSA 1FEEA 1R8BA 5HK4A 3W2WB 3KNGA 1A7GE 1S1VA 4P7TA 1HKAA 2J8AA 4L3KA 1DFDA 3K2YA 4DG1A 4KREA 1QQOA 2QIFA 4P74A 2YQ1A 1J9AA 3LZJA 3MPUB 1C0UB 4IFYB 3DXBA 1N56A 4CO2A 1UVMA 2ZJPL 2JEIA 3K5LA 2IRUA 2ASLA 2B9XA 2NXUA 2K3IA 4N77A 4BRLA 2WONA 3K7RA 4QPXA 3ILOA 1LWFA 2W2QP 4F25A 3H6EA 4QS8A 1YT3A 1RHMB 4CHPA 1NSQA 4LRDA 3H08A 3WEEA 2J7KA 4DLGA 3TUIC 4KR0B 4FJMA 4CFDA 1T6CA 1TL3A 4Q44A 3AO2A 4OPHA 5AFUH 4XDCA 2E7VA 4WQ4A 5H9EJ 3KUHA 5AJ3J 3QGGA 5L8RC 4OX8A 2KM8C 1RWWB 1VSMA 3NRBA 3NS5A 4MIWA 4O3NA 2MQMA 3CPWM 2ZC3A 1SIWB 3AO1A 3GIRA 3C8YA 1A5XA 2IRXA 1EX8A 2BR0A 2GC8A 1TKXA 3ZT3A 2BE2A 4CD1A 4CLYA 1G7CB 1RT4A 5CH7B 5TKYA 4DV3K 4JKAA 1QD1A 1SVDA 4ZP8A 3G25A 2QKBA 1HJRA 2WFBA 3MM8A 2K1RA 3T69A 1IKXA 4DV1F 2W2NP 3GIIA 3KDOA 1RTDB 1S1UA 1BC6A 1HNZK 2R9LA 1IKWB 4NLRA 3N6MA 4KI6A 4WQ4C 4WK3A 3CDUA 3O80A 2QT7A 2J9CA 2MDAA 3HFKA 3ULDA 7AT1B 1RDCA 2DISA 3R5DA 4XDDA 4X4TA 3H42A 2UXDF 2RJZA 3D45A 4H5NA 3W9JA 3L8BA 2ACYA 2X7IA 4G9ZA 1HWJA 4OYZA 3H2VE 4B1ZA 3CDEA 1MMLA 1IBKJ 1DGKN 2NUHA 3NCPA 3FZHA 1CSJA 1KOHA 2HBKA 4CZJA 3R7BB 2VICA 1VQNN 5A0YA 3CQYA 4ZA1A 4KGVB 1FNXH 4TLQA 2QO3A 1NKBA 4CNZA 3W62A 1FA0A 3O1WA 3VGKA 3OPKA 3OTCA 4X4OA 2XHWA 4C3KA 4QWAA 5HRPA 3AO5A 3MDQA 3V81A 3UIQA 4M95A 3NFAA 2CVIA 5CABA 3QT7A 5DQHA 4CLKA 3KXDA 3SQGA 3CC4S 3SI8A 4JOUA 1HRHA 5HMXA 1TL4A 4DV6J 4BROA 2V2KA 4AHTA 3RB0A 3AAQA 3EKUA 4B8CA 2F9TA 2YNHB 4PWUA 3KZBA 3D6MB 4LF7J 2EFQA 1OVQA 4X64J 1HQUA 5FJ4A 5BR8K 5L46A 4OKEA 1E4FT 3VGSA 5J1NA 1S9FA 4YR3A 4FXWA 4EMDA 2ZZTA 1Z25A 1JLAB 2E9RX 2VG7B 1ZBTA 1B3TA 3C3LA 4RLEA 3OFHA 2IVMA 2V34A 4UT4A 4JS5A 2QFIA 3B8HA 1S6PB 4FM2A 4OHZA 1U0HA 2WVEA 1QM9A 3LP3A 2J0SD 2ZE2B 3I5CA 3ENHA 3L4BC 4WFNQ 2ZZNA 4ILLA 3GP9A 1FJGF 1FWPA 4FJGA 1BWFO 3MX5A 3NGZA 4KFBA 2NRVA 2DGTA 4AL6A 1N34F 3CQXA 3OR2B 1KR4A 1TR0A 4BQZA 3LAKA 4DTRA 1VK0A 2KKHA 2FSKA 3DYAA 3KLGB 2L9NA 2QYGA 3ZNUA 3THWA 1WACA 3P3DA 1NK0A 4CM2A 2DHXA 2O8CA 3T7ZA 5E41A 2YBVA 1VIXA 4PXDA 5L1IA 2I7PA 2V50A 2GBZA 1RACB 2BW7A 3CIPA 4U7BA 4I2PA 4G65A 2FHOB 3UR3C 1F2HA 2DY1A 3CFOA 4BRMA 4MK8A 2P9CA 3D1QA 2QN6B 1U2VA 5HOOA 3PCOB 3F5TA 4RUAA 4GVMA 4J91A 4H0TB 4HI2A 2RIJA 3RSEA 3SMZA 4U96A 1D9DA 4DUYF 4CBXA 1M0SA 4M5NA 3G0ZA 2VJUA 4PUOA 1N88A 3AT1B 1JB0C 5J2PA 2PSZA 1WC3A 3T5LA 4HH0A 3VVTA 1RKIA 1YJVA 1NBEB 3LW5C 2EFPA 1S9GA 2H5JB 1P8ZA 4MAKA 3IR6B 3TAFA 2Q79A 3M2UB 4CIEA 5LMNJ 3NVKA 3THVA 4F67A 3QERA 3AOCA 2A0FB 4OI3A 4KV8B 4MLEA 3A8YA 3D66A 3D7SB 1HW8A 5CY4A 3OTOJ 2VD3A 1GLAG 5HROA 2HHVA 1U04A 5AQOA 3CF5L 3P6YC 1RQ0A 3KHLA 1D3WA 4UZBA 3VQBA 1YJWN 5KFQA 4RUBA 1KAYA 1HHSA 5F0WA 1RT2B 2E9ZA 1GMUA 5HQMA 4ID1A 1SC1B 2NPFA 1R8PA 5JUMA 5K8OA 5F0UA 9ATCB 3DOLB 2O3DA 3FRYA 5AQGA 4B1XB 4PG4A 3G71S 1BWVA 4DTXA 4F04B 3V1OA 4LRBA 2EK1A 3ULHA 4QIWD 3O6WA 3HT3A 2XC9A 3F2KA 1WOQA 2W40A 4I2PB 3K8WA 3MXIA 2UUWA 4FP9A 5AJ3K 5JS2A 3BREA 4AXJA 1KVAA 3RG6A 5ETLA 2W41A 5JMVA 3D0HE 3THPA 4LT6A 3BUZB 2ZH3A 2GEMA 3MCOA 4P2FA 2XMAA 2X6NA 4B3SF 2XZDB 5D8HB 1WSEA 2G2ZA 1UJ4A 3CD6S 2MTLA 2E6MA 3KKFA 1NGHA 1IM4A 3QJPA 3BGUA 3MMBB 3UW1A 3HVRA 4Z37A 1EQYA 2RHSB 4DQ8A 4DUZJ 3W9HA 5C2CA 3MX2A 3M1VB 5EN1A 3QFPA 2W8KA 3I32A 3C95A 2V8DA 1YHQS 1U25A 4RBUA 4X4SA 3VQPA 4ZP7A 2ZE2A 2YKNA 2J8SA 5A8WA 4B3MF 3THYB 3QT8A 3CCLN 1KFDA 2WVFA 4DSIA 4NLPA 1PJ7A 2V2VA 3KUGA 3KTQA 2HIQA 3AO3A 1IKXB 4JI2J 4LF8J 4FJJA 1U1OA 2A41A 3SAHA 1YVFA 1XC9A 1IWAA 1B92A 1BQNA 2GX8A 4DV5F 4E1MA 4JI2F 4DR2J 4ID8A 2GAHC 3B78A 4BDPA 4JI4F 4IRKA 1UAXA 4GVBB 3DOMA 4JKFA 1HNZJ 3OJUA 4CHYA 3ZXWA 2IY5B 4CECA 4RUCA 2AQ4A 1NOZA 4CJ4A 3LOUA 2F40A 4FL9A 1VISA 4RWXA 2RF2B 4JUZA 3OV7A 1RILA 4JYAK 3EX7B 1BQMA 2QZ8A 1FO1A 1V9OA 4DS5A 3MPWA 3U1MA 2MKIA 1MNEA 3UQSA 3WC0A 4FWRA 1JXVA 4C23A 4KGMA 2YKMB 2HFSA 3TEGA 4AHUA 3TZZA 4M5MA 5LSRA 2ZC4A 2GO8A 1S1XB 4LREA 5GADI 1KDNA 3FFIB 3PJ9A 4BLGA 3CMAN 3CEDA 3BS9A 3IGVA 1B4SA 4ZIVA 4ZLJA 2OIHA 4CO0A 4MJKA 4AD6A 3POTB 4QR2A 3LGMA 4K4XA 2CNKB 3MM9A 1IQTA 2L08A 4DG1B 2J5AA 1QUPA 4DUZF 2L41A 3H5XA 3PYDA 3FBFA 3VGTA 4MQ3A 1JXLA 2MSSA 3LDSA 4K0KK 3V6HA 1KSPA 1XC3A 1KONA 3IAM9 5KFAA 3AVMA 4C48A 3ALYA 4OJRA 4NCGA 2DGQA 4WXOA 1QTMA 1YIJS 2EHGA 4NA1A 5KRSA 3NWGA 2Z2YB 5KFKA 3MAAB 2PT0A 1RT6B 3ENBA 3ZETA 1K8AT 5D78A 1YJUA 2PMZD 4Y1DA 5EWGA 3G82A 3QGPA 1HNWF 2Q6BA 3PKMA 4WFBQ 7FD1A 3QRRA 1HYVA 4JN4A 1XHXA 1K47A 3UDEA 5D0RA 1TYQB 2FQQB 3EVOA 3K0JA 2P2CB 3FQLA 2YI1A 4TY8B 4U67Q 2YV0X 1VSHA 1TL3B 4DFKA 2JJ4D 1JJ2M 1KFSA 1P90A 1KVJA 4CJSA 4JEPA 1IBMF 1WSVA 1FEHA 3R6LB 4DR3J 1FVSA 4FZZA 2LXUA 4H54A 2KRBA 1UCNA 1ZPWX 3DU5A 1H98A 3MMBA 3CF5Q 1EQMA 2DR8A 1GTHA 4J9OA 2QWOA 5HN0A 1KC8O 2J0QD 3OL8A 2MKJA 5HRNA 2ZZMA 2XI2A 3J80O 2UXBK 2H3GX 4FS2A 3O9TA 3CVKA 2P9PB 3SSSA 1WDDA 3W2WA 2HGLA 5F8HA 2MGZA 3RAMA 1E6YA 4DUZK 1CS4B 1VQ5S 3V6DA 4N56A 2F63A 5J2NB 4U8YA 2G8IA 3T5HA 2CJYB 1NGCA 1SC4B 2P9UA 1SBRA 3I0SB 1VQ9S 2P5GA 2CJQA 4HHTA 4IH5A 3HOSA 4DV4J 1DQ8A 1O6XA 3D4JA 3OTOK 4DN0A 2P5OA 3FSYA 2QI2A 5C12A 5KT3A 4DQPA 1HWKA 5LL6Z 4JRQA 4DKWA 4LFAJ 2W7PA 4IOCQ 3MAQA 1AZSA 3HZEA 4A8KA 2NRRA 3CD6N 2K3KA 3BQ1A 3AVAA 2FVQA 2W6KA 1Y10A 1RBSA 1NLVA 4B3TJ 1KCFA 4H0XB 3RJMB 1C1AA 4GKKK 5EUHA 4NLSA 4URQU 3DGPB 4A61A 2OEMA 3LP0B 4DF8A 4LIRA 1K73O 3MMVA 3UKUB 3O8WA 4IOCL 2UU9F 2HRTA 1U2RA 2ZVSA 2UUCJ 1BQXA 1FRXA 4KV8A 2W2MP 1NGDA 3UNYA 1DKGD 2P9UB 1HYSB 5K14A 1UW4A 3CJ0A 3TARA 1T7PA 3W5XA 1W0HA 1RTHB 5KFFA 4KHNA 2YPYA 4H5WA 4IG3A 2QJ3A 2C3MA 2AEFA 2NNWA 3QO9A 2YY3A 3ZEUA 4LJMA 4CI6A 4MFBA 4OZLA 3W65A 2AYEA 3P83D 1GX6A 5HMYA 5AZJB 4HACA 1U24A 4B9NA 4Z4CA 1RCXB 1HX1A 2GCFA 2V8PA 3C14A 5C25A 3N9UC 2RDJA 4TY9A 1X0FA 4O0JA 3ILIA 4DR1K 1MWZA 3K5MA 4XAKA 2DPJA 3TZWA 2RAQA 3C16A 2EXUA 4IFVA 4B3RF 1Q82T 1RT3A 3IMXA 1U1MA 3H5UA 3W8PA 1CLQA 3HZGA 3ZT1A 3P4IA 2QG9B 1N54B 2KHOA 1VGYA 1U7LA 3J7AP 3PRVA 3F9MA 4DV6K 1WEZA 4MLHA 2IVFB 2OO4A 3DLKB 4JI2K 1UPPA 1REVA 4CI0B 4CJWA 3MR3A 3SEOA 4JI0K 3S7RA 2PD1A 4PHTX 2QKKA 4JHDB 2HWTA 4PWWA 1JLCA 5HLFA 4P52A 3VHQA 3N0VA 1JLQB 4X62J 2OCEA 1LNQA 4DCJB 3A5LC 2PA3A 4B3MJ 4P72A 1X5OA 1U6ZA 2M9KA 4BHQA 1S6QB 1HARA 1Q0NA 1NDKA 3KK3B 2HNDA 1TUVA 4OO1J 2ACMA 4FM0A 1HIYA 3MR6A 4LF9J 1Q7LB 2W9AA 1VBKA 3BQ2A 2CPYA 1TUGB 2RQKA 2DNKA 5JS1A 1Q8IA 3E66A 5AQFA 2GVDA 1OY6A 4C8YA 2QWRA 4I7FA 2KZMA 1S3XA 2AJQA 4YS2A 2E5LF 4KHWA 2XY8A 4PABA 2V0NA 1R0BG 2IFXA 2G8FA 3FZBA 1RBUA 3OT9A 2JWLA 1RYSA 5BYQA 3NH2A 1FWKA 1IR1A 4Y2KA 4MO5A 4WCEQ 2NRHA 1TL5A 5FPEA 1HQUB 1U26A 2K06A 2O8BA 2P1JA 5BYRA 4Y2AA 4DPTA 3OYGA 5KFHA 4FK4A 4C8MA 5CCMA 2KHCA 3M2RB 3AB2B 3M8YA 2FPHX 4I6WA 2HK2A 3TJ8A 1GMVA 4HHJA 3BO2A 1F9HA 2E29A 4PG6A 2BVZA 4CJKA 4Q2LA 3MXMA 4IH7A 2WVBA 4FJNA 4RW8B 3PEJA 5RUBA 3HSDA 2X1GA 3R7SB 3LGNA 3JYTB 2I9SA 4KBIA 4BE2A 2Z2ZA 3C6TB 3GILA 4E7LA 4G1PA 5GAHI 4CF8A 3MAHA 2RN2A 3HTVA 1T3VA 2PDAA 2L9DA 4FYVB 2R7OA 3NCQA 4CGGA 3VOVA 3NCIA 2DNYA 2LLZA 1CJKB 3PDNA 1FRKA 1SUQB 2E20A 2MLZA 4EUVA 2XY6A 3EE9A 4IO8A 4NMLA 1RAFB 1V3RA 3I6PA 4YUDA 2DYAA 4DLEA 2LDYA 3CJAA 1FRJA 2YPZA 3MPDA 1RADB 1PCAA 3AAPA 3F41A 1O0PA 4J2EA 3T6JA 5AZIA 1CQNA 1S57A 4M3RA 2KLAA 1HMVB 2QWNA 3FSIA 5KFLA 5K9FA 4IO9L 2MZSA 4PPZA 5A6PA 4HHHA 1F1BB 3G71N 9RUBA 3PIPQ 1UP1A 1VC5A 5DETA 4WQ5A 2HHQA 2FUG9 3UWTA 1T9TA 2YX7A 1SH0A 3W64A 2NSBA 2PMHA 1FKOA 4EBDA 4CIGA 1SC6A 2VPXB 3J81j 3T5JA 3VAJA 3VESA 2RILA 4HTIA 3TI0A 4IDKB 2HBLA 4FF2A 3OTDA 3D0PA 2Y3YA 1X4FA 3E1YA 3SQ2A 3DLLQ 2LXFA 2DNQA 4QS7A 4KHSA 4I69A 3OHAA 4JBCA 3NMRA 4BRFA 4RL1A 2FY8A 1PYTA 3N01A 5IT4A