1JLFA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
539
structure length
538
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLCVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 133
structure length 538
sequence length 539
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlfA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlfA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlfA05
1IKYA 2VG6A 2C28A 3DLRA 4PWDB 4H4MA 4Q0BA 4ECWA 1B92A 5D3GA 4PQUB 2IGIA 4F4XA 2P5OA 2FC0A 3TANA 2RF2A 3RB3A 4FJMA 2WB4A 3PJXA 4Q45A 4KSEB 2QKKA 3OJUA 4KRFA 3SQ0A 3I0SB 4M3XA 5HBMB 3UPFA 4DF4A 4UQGA 4FJGA 2YNGA 2B6AA 3OYFA 2UVUA 5FDLB 4CIFA 4NCGA 4ICLA 2AX1A 1RTJA 3I0SA 2R7YA 1RT6B 4TYBA 3MR6A 3V4IA 1FK9A 3CFOA 4DSJA 3L2VA 4CK3A 3SI6A 3T5JA 3MXJA 3OS2A 4Y1DA 3HJFA 3VQ6A 1EKEA 1X9WA 5HROA 5C25B 2HNYB 4KHUA 1RT2B 3OL7A 3OYNA 3QEXA 5KG1A 4QWEA 4ED8A 1VSFA 5C25A 3SQ2A 3QEWA 1UA1A 2HNYA 4YR2A 4LQ9A 4E89A 3OHAA 1IKVB 4NLQA 1TKZA 3RWUA 4DG1A 4NLPA 4DTNA 4KFBB 2IOCA 2W42A 3M8QA 5K14A 4ZPCA 3L2QA 4K4YA 1VSEA 4R5PB 4ID5B 3SPZA 4LD0A 3KMQA 1WNEA 2BDPA 4EZ9A 2Y1JA 1ZBIA 4NLWA 1IKVA 3LPUA 2JLEA 2Q3SA 4Q8EA 2R2RA 1HQUB 1IM4A 4QOZB 3QEIA 4ZP8A 5SZTA 3DRRA 4ID5A 3ZT4A 1LWCB 4B9MA 2QKBA 2XGPA 4QW9A 1NOYA 4ED7A 4FJNA 4J2EA 4ZVEA 4NLSA 4CGHA 1FKOB 1O1WA 4WFYA 3ALYA 4JRQA 4KAZA 4PA1A 3OYJA 2OZMA 4ECYA 3M9MB 3AO1A 3VQCA 3PX0A 4JV0A 2BRLA 1S6QB 5EU7A 3JSMA 4JLHA 3OYHA 4EEYA 1NK7A 4FJKA 4Y3CA 2OA8A 3BR9A 1LAWA 1TQLA 3ASMA 2WCXA 1U48A 1RBVA 3AO3A 4FVMA 3KHGA 4FK4A 4J9NA 3G86A 1RT3B 1LWEA 2DPIA 3HPOA 4K4XA 4I7FB 3NAIA 2OPQB 4AHTA 2VA2A 3LP0B 4FLVA 4CEBA 4O3NA 4FLYA 4CJ5A 4RNHA 3NFAA 2V4RA 3NF7A 1JL1A 2YKMB 4EBDA 1TAUA 3LANA 4IBNA 3RBDA 4KKOB 1I39A 2HHSA 3UQSA 1SL1A 1KCFA 3V9ZA 4NCAA 3AVBA 4DL6A 4BDYA 5C24A 2P1JA 2V4QA 1RT5A 4IH7A 3C6TB 2C2RA 4CFDA 2KFNA 4CJQA 3FRZA 5KG2A 1JX4A 1GOBA 4KHWA 4ED6A 4ZPDA 1VSMA 4WFZA 4ECRA 3AVCA 3DRSA 3FDSA 4YMEA 3PX4A 2J6UA 2G8WA 1HRHA 3ZCMA 3TAEA 2IAJB 3M8PB 5KFBA 2KQ2A 3SUNA 3KHRA 1BHLA 2Z1IA 4KI6A 3V1QA 2A1SA 1S1XA 2ZE2A 4RW6A 4B08A 3RR7A 2YNHA 3PW7A 4RNFA 3OYBA 1WAJA 4IRCA 4GMJB 2BANA 3RB0A 4MQ3A 1VSLA 3BQ1A 1ASVA 2IAJA 3H2LA 3CG7A 1YT3A 4J9SA 4OPKA 4FLXA 2WK4A 3LP1A 5KFUA 3BSCA 5KG3A 1BQMA 3S9HA 2HVIA 1L3VA 4M3ZA 3DLGB 4DS5A 1XWLA 3H5SA 3LP3A 3NH1A 3OS0A 5DG7A 4WYWA 4AHUA 3BJYA 3K59A 5HP1B 1DTQB 4R8UA 1BIZA 1LW0B 4FJHA 4DLGA 3CWJA 2RPIA 1A5WA 1C6VA 4I2QA 2EHGA 3MEGA 4TXSA 1VRUA 2ATLA 1DTQA 3V9XA 4BDPA 4NLYA 4C8LA 3QLHA 4X2BA 3BSAA 5JS2A 3HP6A 3DI6B 3NHGA 3O3HA 2XY6A 2WRMA 4J9QA 4EO8A 4XPCA 3V1OA 3DOKB 2FVSA 4U6PA 4ECUA 4WFXA 3CQ8A 4K8XA 3CJ2A 3OSNA 4DSIA 3OYGA 1T94A 1T05B 4CIEA 1TVRA 3DI6A 4YR3A 3RMCA 4E3SA 4KTQA 2YNIA 3AVJA 3LP2B 4TQRA 4K4WA 4FLZA 1QUVA 1D1UA 1FXXA 3CDEA 4F4KA 1TK5A 3DRPB 3ICLA 4OLBA 3SFGA 4XPEA 2W9CA 1FKPB 1QSYA 5EDWA 3V9WA 4DSEA 1LW2B 1X1PA 5KT5A 1S1UA 3QERA 2R8JA 3KK3A 3S3OA 5KFJA 4KB1A 4CGGA 3KD5E 1FKPA 5J2QB 3VQ5A 4QCLA 3ZSZA 3ZT0A 4FJIA 2AJQA 4M95A 1RTIB 1RDDA 4FJLA 2R8KA 5KTQA 1HYVA 3OYMA 2NUBA 1JLBA 4TYAA 1KVBA 3D28A 1RDBA 3KLGB 3M9OB 3CIZA 5J2QA 3T5KA 3BSOA 1S5JA 4CEFA 1KHVA 3CO9A 2JEIA 2EC0A 1KVAA 3GV8B 3FSIA 1ASWA 1SKWA 3OYEA 4CJFA 1BQNA 1GX5A 2G8VA 3DLKB 4NYFA 4M3RA 1U49A 5KRTA 3ZSVA 3KLGA 2IM3A 2P5GA 1G15A 3D0PA 5DQHA 1QTMA 2JGUA 2IM1A 1Y97A 2OPSA 4K4UA 3HT3A 5CYQA 3PR4A 1C0MA 3HVAA 1NHUA 4CESA 3V6DB 3T5HA 3OS1A 2G8KA 3KJVB 3CDWA 2G8UA 4GW6A 3RTVA 1RTDA 3QEPA 1XR5A 5KGXA 1S9FA 2V9WA 1TL3A 4DWIA 4XIUA 1BCOA 5DLGA 3HYFA 3KJVA 4G1QA 4IQXA 2ALZA 4MIBA 4TY8B 4K4TA 4FS1A 5CYMA 4PY5A 2IM2A 1WSHA 1JXBA 4PUOB 1N48A 3OYAA 3AVIA 2W9AA 4NZ0A 4J2AA 4OJRA 3OLBA 3AVLA 4RW4B 2OPRB 2FBVA 4F50A 2IM0A 4O3PA 2XY5A 4OPJA 3MEEB 1RT4B 3T5LA 4JV2A 4PUOA 4H4OA 3I5CA 3HK2A 2AGPA 2I1RA 1D0EA 2QV6A 4F8RA 2I5JA 3M8SA 1JLQB 2E6MA 5KT7A 3FFIB 4O3QA 4BWJA 3D45A 2JC1A 3RB6A 1TKDA 4FCYA 1HYZA 1J53A 4KV8B 2ZKUA 1C1CA 3AVFA 1HNIB 1C2PA 1S9EA 3N6NA 1GX6A 3I5BA 3U3GA 4WXOA 3IAYA 1J9AA 1JKHA 4DQRA 3H40A 2F96A 1EETA 3BDPA 2KZZA 3P5JA 3L3VA 3V9SA 5KG7A 2D0CA 5KG6A 2R8IA 2XY8A 3VQ9A 1DTTA 1A5XA 2B5JB 3MEDB 3HVTA 4IOBA 3BQ2A 3AV9A 3RB4A 1SV5B 4MK9A 1EX4A 4FK0A 4ECQA 4ZP6A 4FZXC 3NGIA 1C1BA 1ZETA 3KMSA 5T7BA 3A2FA 1S6PB 4C8KA 4DL5A 3IN5A 4RW7B 4DU1A 4J2BA 4JRPA 1UAXA 2AQ4A 1RT1A 3HL8A 3PVXA 4IG0B 4NYNA 1RTHA 1S6PA 4FBUA 1QS4A 1IKYB 1TKTA 2VG6B 4FXDA 4H4MB 4Q0BB 4RW7A 3CM6A 5D3GB 4NLRA 3HSTB 4Q44A 2ILZA 2FVPA 4CJLA 3NF9A 4F4ZA 2RF2B 1N5YA 2XCAA 1YTUA 4AILC 4ED0A 4EYIB 4AHRA 3SV3A 2VA3A 2R8GA 4DLEA 4OKKA 4W5NA 2YNGB 2B6AB 1IO2A 4AHSA 4J9RA 3GV5B 2OYQA 5F8GA 1X9SA 4NCGB 5T14A 4ICLB 3SNNA 1YVUA 1CXQA 1YTAA 3SUOA 1RTJB 1BI4A 4EYHB 4E1MA 1NHVA 2RN2A 1KSPA 1NK4A 1JXEA 2HHXA 2LSNA 4EBEA 2E9RX 3V4IB 4RNOA 1KRPA 1TKXB 1FK9B 4QWDA 1SH0A 4WZMA 3G6VA 1S1WA 4E0DA 2XCPA 4Z4GA 4Q5VA 4CIGA 3HKWA 5KFSA 4CEDA 2HMIA 4TY9A 5HROB 3PZPA 4Z4EA 4IG3A 1TKXA 1NK6A 2OH2A 1SH3A 3AVHA 4LSNA 1RNHA 2W7PA 4FYDA 1QE1B 5DG8A 3ITHA 3HPGA 4KB0A 5FRNA 1TKZB 3AA4A 4DG1B 4H54A 3M8QB 3TWHA 5K14B 5E41A 4Z4CA 4GC6A 1BCMA 1QE1A 3RAXA 5F8JA 4ZTJA 2ZD1A 5C42A 4IKAA 2JEGA 1NKBA 4K8ZA 3ZT3A 4KREA 3JYTA 4KHSA 1R0AA 1Q8IA 4DSFA 1L3SA 3DRRB 2VG5A 2R8HA 4CHOA 4DSKA 3HHKA 3EZ5A 4O3OA 1CLQA 4Z4IA 4FW2A 4KTZA 5DLFA 1NJZA 2IC3B 5KGWA 4E19A 3OYKA 1OS5A 1YVFA 3SZ2A 1ZYQA 5CZ2A 4RUCA 4IRDA 4AHCA 3CDUA 1LWFA 1N56A 2IJFA 2D7SA 2IC3A 5JUMA 3N6MA 4DEZA 3JSMB 3VN5A 2C2DA 3KLIB 3TVKA 2GIQA 4EO6A 2D0AA 4CHZA 4QWCA 3RMAA 4ZHRA 1RBRA 1T8EA 2Z1GA 1GOAA 1S1VA 2ILYA 4DL4A 4QAGA 3KLIA 2Y1IA 1RYSA 1LWEB 4HTUA 4ELUA 4DL3A 2ASLA 3AO5A 1HQEA 3MXMA 3RR8A 4BE2A 4O3RA 4CJSA 1ASUA 1U4BA 1JLEB 2O4GA 5KFHA 4CEQA 1HMVA 1KFDA 4FZZA 2W9BA 4B3OB 4ZP9A 2AWZA 1JLEA 4NLUA 4BWMA 5KFGA 3HM9A 3EYZA 1KTQA 5FRMA 4IDKA 5L1IA 5C24B 1ZTTA 3CYMA 5KFDA 2GUIA 1RBSA 4DTSA 4KE5A 4F4WA 1RT5B 4B3OA 4ID1A 4F2RA 4H8KA 4ECXA 4RZRA 4KHRA 4CCHA 4OLAA 3FQKA 3PO4A 4LQ3A 1U09A 2ASJA 2HNZB 1WSFA 4CFBA 3LALA 3KK1A 1ZBFA 1ZBUA 3I0RA 3NGZA 1RCHA 1JLGA 4O44A 3H4DA 3B6OA 3OHBA 2AGQA 1RDCA 4CGFA 4J2DA 1SH2A 3DRSB 4F3OA 5DK5A 3LWMA 4KPYA 2DPJA 2HNZA 3BQ0A 1XR7A 3ZSXA 3B6PA 2X74A 2FVQA 1W9HA 5KFEA 1S1XB 3E51A 3QEVA 2ZE2B 4RW6B 2YHBA 3BGRA 2YNHB 4JS5A 3KK2A 4M3UA 2ASDA 4O0IA 3OL6A 2BANB 1XC9A 4NLOA 4YP3A 4MK8A 5L1LA 3GV7B 4DQPA 4WYLA 1QSSA 3N6LA 3DLEA 3LZIA 1KLNA 3LAMA 3PR5B 3LP1B 5F8HA 3OY9A 1BQMB 2VWKA 1HNVA 3Q8SB 1HARA 5J2MA 3ZSOA 1VRTA 1I6JA 2KW4A 4MK7A 2HW3A 4OKEA 2XWYA 3HXMA 2RDJA 1HPZB 3NDKA 3VQSA 5KFCA 1Z25A 4R8UB 3SI8A 2BGGA 4QW8A 2XO7A 3SPYA 4E7JA 4OL8A 3KLHA 4I2QB 4CEOA 1SL0A 4W5RA 1EP4B 3DOLB 3MEGB 1HPZA 1VRUB 1C1AA 3ZT1A 2HHUA 4IRKA 1K1QA 1RA7A 4GVMA 1RILA 4CGDA 3QLHB 4JS4A 2V0NA 1QHTA 4Z4FA 2WTFA 1L3TA 4K4SA 3OLAA 1EP4A 3DOLA 2UVWA 3QZ7A 3QIPA 2XC9A 5J1EA 1S10A 4HCBA 4NYZA 1KLMA 5CY4A 3CFRA 1TVRB 2UVRA 1NKCA 1F21A 1T7PA 3T19A 5KFNA 2XRIA 4HUEA 3RRGA 2XHBA 3TR8A 2YNIB 4NLVA 3GILA 4TQSA 3C6UB 4CFCA 5KT6A 1ZTWA 4B8AB 1REVB 3CVKA 1NOZA 4M94A 5KFOA 4BE1A 4F2SA 2W9CB 3I8DA 3DYAA 4CEZA 2G8HA 4W5QA 2UUTA 4KHNA 3C6UA 3SUQA 3D5MA 4RW8B 2VG7B 1UA0A 4FBTA 1S1UB 4NLDA 5KFVA 1REVA 5KRSA 3KK3B 4O5BA 3VA0A 3ISND 4ZVFA 4EP5A 3QGGA 2D3UA 4E7KA 4RW8A 2VG7A 1WAFA 4CF8A 2BRKA 1GOCA 1JLBB 5F9NA 1J5OB 1A5VA 2D3ZA 3P1GA 1TV6A 3AVNA 3E01B 2KTQA 1SUQA 3IG1A 3O3FA 1BGXT 1VK0A 2ZQBA 3NH0A 1BQNB 1K1SA 4FK2A 1J5OA 3BREA 4OGEA 3VQ4A 2QK9A 4Z4HA 2YHAA 3WNFA 2IBKA 3E01A 3VQDA 1KVCA 1L5UA 5KG5A 3DDKA 3T3FA 3AVAA 3VQ7A 4IR1A 2OPSB 1WLJA 2BR0A 3K57A 2HHVA 3V81A 5CYQB 4O3SA 4IFVA 3F9KA 3NAHA 4DTXA 4FLUA 2RKIA 2HWHA 2GC8A 1RTDB 4DL7A 3DM2A 3L3UA 1S0MA 4BACA 3K5MA 1TL3B 1DLOA 3CJ3A 4E7HA 4CJ3A 1XI1A 4G1QB 4ZP7A 3THVA 1HYSA 4FJJA 5I42A 4FM1A 1TL1A 5CYMB 1JXLA 4C8MA 2HNDA 5KFWA 5KFYA 3UR0A 2BQ3A 1WNSA 4KTWA 4MKAA 3PUFA 3F73A 3OJSA 1S97A 1X9MA 1TK8A 2F8EX 4BDZA 5KFIA 4B9UA 4M3TA 2XI2A 5HRRA 3QIOA 2DFEA 4H4OB 2HHTA 4CK1A 4KHYA 1VSKA 3C95A 2I5JB 4FW1A 4ED3A 3KHHA 5DGBA 4EP4A 3NCIA 3I5AA 4URSA 3QYYA 3MAQA 1KFSA 3KD1E 4ZVHA 4DSLA 2IJNA 1C1CB 3MFIA 1S9EB 3OL9A 4KHQA 2BE2A 3MR3A 1JKHB 3DMJA 3QO9A 4DTRA 4HVJA 1C0UB 1JLFB 5KT4A 2AU0A 1EETB 1T3NA 1S1TA 4IFYB 1DTTB 3ZSYA 1JLCA 3QNOA 3QZ8A 2AX0A 3HVTB 1C0UA 5I3UA 1JLFA 4C8OA 1KHWA 4TN2A 4ED2A 1C1BB 3AVKA 3SJJA 1I3AA 4IFYA 1NJYA 3NMAA 2CKWA 4FZYA 5F8IA 3LPTA 5KI6A 3OYDA 1B9FA 1RT1B 3CFPA 2YNFA 3QGHA 1RTHB 5KFKA 4FJXA 1TKTB 4CE9A 2PYLA 3V6HA 4Y2AA 2PYJA 2B43A 3QIDA 3OL8A 2DFFA 4U7CA 1D9FA 3QINA 1VSIA 4C8NA 3NBPA 1N5YB 3RAQA 2W8LA 4HUGA 3UDLA 3GIIA 2FJWA 2J6SA 3CJ0A 3TABA 4CJWA 5SWMA 5F8MA 3IRXA 3EPIA 4CJPA 1D8YA 3M8RA 2YKNA 3KLVA 3MECA 4NRTA 1IKWA 1BI4B 4M41A 5JXSA 3V1RA 4W5TA 3V6JA 2BQUA 4URGA 2ITGA 4J9KA 4CJ4A 3SYZA 4DS4A 1L3UA 1N6QB 3KTQA 4ZMMA 4ZPAA 3KLFB 4B9VA 1Z26A 1S1WB 3KKRA 1TGOA 3GIMA 4CJEA 3PW4A 3P83D 3ZT2A 2OPPA 3RRHA 2X6SA 1Z4UA 4N56A 2HMIB 3H5XA 3WNHA 4DTPA 4IG3B 1N6QA 4ELVA 5J2PA 4R0EA 3KLFA 3K2PA 1LV5A 4NLTA 3G10A 4O4RA 4LSNB 4PWDA 3DLHA 4EBCA 5C5JA 1D9DA 4PQUA 2HB5A 4K4VA 4AHVA 4FJ8A 3ITHB 3PO5A 3ZSQA 4FS2A 4CJVA 1S9GB 3DLBA 5FROA 3VA3A 3V6KA 4FLTA 3Q8RB 1XR6A 2JEJA 4CHNA 4NRUA 5HBMA 5KFTA 3SUPA 3OYLA 3IGVA 2ZD1B 3VQAA 5C42B 5FDLA 2C22A 1JIHA 1S9GA 1CXUA 4Y1CA 1TP7A 3JYTB 3Q8PB 3LWLA 1R0AB 1UWBB 2VG5B 2X6NA 4CF2A 2IA6A 3NL0A 1RT6A 4J9MA 2FVCA 4Q43A 3MR2A 5KFQA 5CZ1A 1T03B 4BE0A 1Q9XA 3G6YA 3O3GA 2IMWP 1UWBA 4MH8A 3L8BA 3AO2A 4DF8A 1LWFB 3LZJA 1RT2A 3L2UA 2DY4A 1T03A 1NK0A 3G0ZA 4ZHRB 2KZMA 3TAQA 1RDRA 1S1VB 3GIKA 3TAGA 4KBIA 4DTJA 4FJ9A 4B9NA 4FLWA 4KFBA 3S3MA 4R5PA 2FJVA 4WE1B 3ULDA 2EX3A 1HQEB 2QXFA 1NJXA 4MKBA 2KFZA 1HMVB 4CEAA 1HQUA 3MTKA 4HYKA 5HLFB 4WE1A 2W9BB 5DQGA 4JUZA 1LWCA 4CECA 1HJRA 3QESA 2UVVA 3ZSRA 2R2SA 2IS3A 3U3YA 4IDKB 1FKOA 1WSEA 4I9QA 5HLFA 5KFMA 4J9OA 5EWFA 2FBTA 5KFLA 3KNAA 2R2TA 1CZ9A 2PY5A 4M3WA 3OSPA 3K5NA 3K5OA 1S6QA 4E7LA 4ED1A 4DFJA 2X78A 3KK1B 1U04A 1S48A 5DGAA 4LH4A 5KT3A 3I0RB 4OKJA 1JLGB 3NGYA 4O44B 3AA5X 2C2EA 4JV1A 5HRNA 4IH5A 4N47A 2W7OA 5F9LA 1EXQA 3AA2A 3OYCA 2VWJA 3K58A 2XGQA 1RT3A 2O4IA 4CFAA 3NH2A 3EY1A 4URQU 3CM5A 4I7FA 4CJTA 2OPQA 3ZSWA 4FJ5A 5F8LA 4CF0A 3LP0A 3BGRB 4DQQA 3HVRA 3KK2B 3PHEA 2Z1HA 2WOMB 5EWGA 4NLXA 4RW9B 3SQ4A 1XHZA 4N41A 2HHQA 2YKMA 3RMDA 4WXWA 1MMLA 4CJKA 1U47A 2F8SA 2A1RA 3DLEB 4Z0UA 4KKOA 2XI3A 1SKRA 2HVHA 3H4BA 1S4FA 1TK0A 1K6YA 1HNVB 3PW0A 3TAFA 3MR5A 2WOMA 5J2MB 4RW9A 1VRTB 2PZSA 3CJ5A 4KB7A 1U45A 1RAJA 1VSJA 2F8TA 4HHTA 3C6TA 5HRPA 4K4ZA 2YV0X 1JLAB 5KG4A 3NE6A 3KHLA 2D5RA 3KLHB 4QPXA 4RU9A 3RMBA 4DTOA 5HRSA 2DTUA 4DQIA 1RA6A 4LY7A 4CHQA 3VQ8A 4QWBA 1Q9YA 3PW2A 1JLAA 5EWEA 2P51A 4IH6A 3UIQA 4N76A 1LAVA 5L9XA 1BIUA 4AH9A 4LSLB 3O4QA 2E9ZA 4DU4A 3QIPB 2FJXA 5EUHA 3L2RA 3M8PA 5J1EB 4CF1A 1KLMB 3WNEA 3LAKA 2IDOA 4YFUA 1JL2A 4LSLA 1NK9A 4QWAA 3CJ4A 2XY7A 3K5LA 4KI4A 4ZPBA 3EZUA 1RDAA 1RBUA 2E9TA 1NK5A 1VSDA 4B9TA 4ZVGA 3DLGA 3DYAB 4RUAA 1NK8A 2W8KA 4K50A 5HP1A 2GIRA 3KLEB 1NKEA 2AGOA 1LW0A 3PY8A 4CGIA 4ECTA 4O4GB 3HVWA 1WN7A 1SKSA 3U6FA 4Q8FA 4DTUA 1IH7A 4E1NA 4L8RB 3TAPA 3KLEA 2UUWA 1RYRA 1QQCA 4O4GA 1D5AA 1TV6B 1XHXA 4M3YA 4XO0A 1SUQB 3IG1B 3MXIA 2FBYA 4B9SA 4B9LA 3DOKA 3PV8A 1TAQA 3SFUA 5KT2A 4Y34A 3TARA 4ZTFA 4DFKA 4MFBB 3NKYA 1T05A 1CZBA 1S49A 5KFAA 1NJWA 2GV9A 1ZBHA 2RDIA 4CERA 3LP2A 3T1AA 2WHOA 3H59A 4FJ7A 3V81B 2HHWA 1NNDA 4MFBA 4IFVB 3AVGA 3VQBA 1ZBLA 2RKIB 4FM2A 3DRPA 2ATQA 3TAMB 3DM2B 3H5YA 2D41A 4DU3A 4E7IA 3M9NB 1LW2A 2FVRA 2JEFA 3GQCA 1QSLA 3NF8A 4O0JA 5KFRA 4DTMA 1DLOB 4ECVA 3TAMA 1HYSB 1W25A 5I42B 1TL1B 4ECZA 4YR0A 3HP9A 2FBXA 2HNDB 2HWIA 1RBTA 4GC7A 1VSHA 1RTIA 3H98A 1IG9A 4ECSA 3GYNA 2G8FA 1S0OA 2Z1JA 1SL2A 4ELTA 3KIOA 3SCXA 4CF9A 5L1KA 4M45A 2FLLA 1N4LA 1WSGA 3DLKA 3TI0A 4J9PA 3RBEA 4IR9A 5KG0A 2JC0A 4IKFA 3MF5A 4TSXA 2E4LA 4G3IA 4CGJA 5DG9A 5F8NA 3ISNC 1W0HA 2E6LA 5L1JA 2D0BA 1J54A 3V6DA 2QE5A 4F4YA 2BE2B 5JS1A 5J2NB 4YQWA 3WNGA 3DMJB 3QO9B 4CHPA 3GIJA 1BL3A 3VQQA 3KOAA 4LH5A 1UOCA 1RT7B 1S1TB 2GBZA 1ITGA 4OVLA 4RG8A 3V9UA 4HKQA 1WSJA 5J2NA 4HUFA 4DFMA 1JLCB 4TY8A 1B9DA 2FLNA 3O4NA 2R2UA 4MIAA 4Y2CA 4RNNA 4CJUA 5I3UB 3FQLA 2WONB 3HO1A 1RT7A 3OYIA 4CHYA 3KKSA 3PW5A 1C0TB 2HAIA 3SQ1A 4RW4A 2OPRA 3VQPA 2FLPA 3TQ1A 1QAIA 1QAJA 4F3TA 5KFFA 3MEEA 1RT4A 2BQRA 4RNMA 2WONA 5KFZA 4YNQA 3C94A 1C0TA 3H5UA 2YNFB 5DQIA 1JLQA 4W5OA 3NAEA 3FFIA 2ETJA 4DMNA 4O55A 4FM0A 2CJQA 3IGNA 3MFHA 4N5SA 3G6XA 4KV8A 3S3NA 2G8IA 4NLGA 4M42A 3EPGA 3NBPB 3L2WA 1HNIA 2O5DA 4EZ6A 4DL2A 2B4JA 3VQEA 4KAIA 4J9LA 4I2PB 3AVMA 3Q8QB 3SV4A 3OVNA 1MU2B 3IRXB 1IKXB 1BISA 4I9LA 4OGCA 3BSNA 2YKNB 3MECB 1WSIA 1IKWB 5DMRA 4CK2A 3PX6A 4I2PA 4CJRA 1S0NA 2B5JA 3PJWA 2J6TA 3MEDA 3H08A 4HCCA 3NGDA 1MU2A 4WZQA 1IKXA 3HPHA 4DQSA 4KO0B 1SV5A 4TLRA 2OZSA 3AA3A 3QNNA 3IS9B 3NF6A 4DFPA 2OPPB 2DFHA 3QETA 3QGIA 1CSJA 3LDSA 3AO4A 4KHMA 5KFPA 5J2PB 5KFXA 4IG0A 4KO0A 4CEEA 3IS9A 4NCBA 4B8CA
chains in the Genus database with same CATH superfamily
4DR4J 4ECWA 3NLCA 5D3GA 2VBYA 2XZDB 3OTCA 4F4XA 2CPYA 1F5CA 4QIVA 2QMWA 4A62A 1FRMA 4WQ5A 3TANA 1R3NA 4Q45A 1S72N 2C2OB 3OJUA 1URRA 3SQ0A 3HM8A 2W1BA 4G1IA 4UQGA 2YNGA 3OYFA 4Y00A 5FDLB 1YRXA 1GK8A 2CPXA 2MQLA 3QMLA 1BLUA 2Z58B 4Y6IA 2AX1A 1YI2S 3BKFA 4X4VA 2YX6A 4JBCA 3KK7A 5FPMA 5CD4H 4TYBA 2QWRA 1HD0A 4DSJA 2QA2A 3T5JA 3OS2A 4RX6A 3HJFA 2R7OA 3H90A 5AQRA 2QMXA 1X9WA 1Z2LA 5HROA 1Q79A 2DPNA 5C25B 3CMAS 1TFYA 2HNYB 4R0JA 4ZA1A 1B7FA 2A40A 4CNZA 1IUJA 1WWHA 2DY9A 3MOJB 1X7VA 1VQ6N 4QWEA 2VV5A 4LF4F 1X4AA 4G1PA 4M7YA 1SC4B 3RWUA 1WI6A 4DG1A 2JWNA 2ACMA 4DTNA 2IOCA 2W42A 4ZPCA 1WKJA 1T0TV 1Z2ZA 3TUJC 1T9TA 4LD0A 1IWGA 1ATSA 4DR2J 1UPPA 3L0QA 2G2ZA 3P5TL 4EZ9A 5IT0A 5IWAF 4Y0FA 2F4VK 4QQBA 3MM7B 2JLEA 4F4AA 3CC2S 4B1WB 2XS2A 2YJEA 2R2RA 1NGJA 4QOZB 2CZVC 2BTFA 4PL8A 5GAHI 5SZTA 4ID5A 3CJKB 3ZT4A 1FNOA 4G9ZA 4J2EA 3DHXA 4NLSA 4CLLA 4CGHA 3T1HF 4ID8A 2AP6A 1YVNA 3K89A 2MQQA 3GJRB 3AD7C 5BRDA 4JLHA 4KPCA 1R0CB 2PA3A 3O6QA 4CLWA 3W9JA 4NWBA 1NK7A 1B3TA 3MCMA 3R5DA 2J4RA 1TQLA 1IBMJ 3DCAA 3SCKE 2Z57B 4GKKF 3TRGA 4C4WA 3G86A 3OTOK 1DGKN 2DPIA 4K4XA 3NAIA 2OPQB 1Y5LB 4LFAJ 2AZ3A 1DKGD 4PG7A 3LP0B 2XYPB 1XNRK 2DNGA 4PPZA 4CJ5A 2V4RA 2HQIA 3C65A 1M5PC 3G25A 2YKMB 2KT2A 3W2WB 4DV6F 3LANA 3R5AA 3JAMU 4IBNA 1I39A 3J7YI 3CF5L 4BRCA 4JYAF 4YUDA 3ZZOA 3TSPA 1YBAA 4DL6A 5C24A 3FBEA 3THYB 3QBCA 1RT5A 3SBMA 3TW0A 2GQQA 1C0GA 1RXOB 2KFNA 5D4PA 1K44A 1JX4A 4ER8A 4KHWA 2DEJA 4ED6A 4ZPDA 2IVMA 2Q31A 3VAMA 1S0VA 1S3XA 1VSMA 3D67A 4DHYA 2YJFA 1BA0A 1RWKB 3CCWA 3IC1A 4QJVA 3PX4A 4A47A 1CJKB 1Q53A 1REGX 2XSJA 6FDRA 3TAEA 3M8PB 5GADP 3SUNA 2NPIA 1HBNA 2MQNA 3RR7A 1WORA 4JI2K 4JI0F 4DR6K 2RU9A 2Y0BB 2PE8A 2C3PA 3N5FA 3VGMA 2NLWA 1O6XA 3LP1A 2HVIA 2QYCA 1O0PA 4O23A 4M3ZA 1ZPVA 3DLGB 1MMNA 4NASA 1XWLA 4DS5A 3NH1A 2GFFA 3OS0A 2DO4A 1NSAA 3K59A 1AA1B 5HP1B 1P27B 4R8UA 1BIZA 1LW0B 2HQCA 4DLGA 2RPIA 3VTHA 2MMYA 1WOSA 2EHGA 4TXSA 3PFOA 1DTQA 3J7Z5 1YJTA 4NLYA 3TEGA 3VF0B 4J5OA 5BR8K 5GIPA 1IQTA 4OO1J 5JS2A 4ZVPB 3HP6A 3NHGA 2VPYB 2FYXA 4J9QA 4XPCA 2DT9A 4FVCA 4WFXA 3CQ8A 4K8XA 3NNAA 2HGLA 2UUBF 5GVQA 1TVRA 3SBTA 4KH0B 1WG5A 2HG4A 1WHXA 3LP2B 1MROA 3CDEA 4F4KA 3A0IX 2AF6A 4ALZA 1TUGB 2WFBA 3DRPB 4OLBA 8AT1B 4DSEA 1LW2B 4AL6A 1X1PA 5A2QY 4KB1A 3UD4P 1FKPA 2AP1A 3MMBA 3L09A 3DC2A 3P8BB 3BDEA 1RDDA 2NXNA 4FJLA 2R8KA 1KQSR 3KLGB 1F9EB 2XMMA 4UZCA 3CO9A 1YITN 2EC0A 4C3KA 5IQ6A 3OYEA 1CPZA 5KRTA 4DL0C 3ZSVA 2CDQA 2IM3A 2P5GA 2ZJPQ 4BC5A 1IBCB 4S0MA 2JGUA 1IQZA 2YPZA 1FD2A 5CYQA 3PR4A 1C0MA 3HVAA 3V6DB 3OS1A 2G8UA 3CO0P 1W26A 3RTVA 3QWUA 5A6PA 1FRHA 2NZCA 2YQ0A 2W6KA 4DX6A 5IWAJ 4Z7CA 4FKXA 3K0JA 2V9WA 4DWIA 4XIUA 2QT7A 2UUAF 1FTRA 2XMKA 1YHQS 1Y0HA 1JXBA 3VHQA 1H0HB 5EX5A 1OPZA 4X4TA 2OPRB 4ZJOA 4IZ9A 4YDDB 3CJ8A 4O3PA 2XY5A 1RT4B 1RHKB 4OZ2A 3I5CA 1RWOB 2QI2A 2B51A 2AGPA 3FGVA 1HLUA 4GKJF 1OYDA 4CBWA 1GTEA 2JX2A 3FFIB 3D45A 2RVJA 4IOCQ 2JC1A 4FCYA 5HK4A 2DXFA 4DHVA 1J53A 1VOMA 3G8QA 4PZVA 2DITA 3N6NA 1WC4A 3ZETB 2QW9A 5AQZA 3IAYA 1J2VA 1J9AA 2MSTA 4QYRA 4DQRA 2DGTA 5A8WA 2RE2A 1GLAG 2KZZA 2UU9K 3L3VA 4WWSA 4IYQA 3U27A 4DV6J 3MEDB 4IOBA 4CBUA 4I6AA 4X62F 4JI7K 3KZBA 3MCNA 1SV5B 2GMHA 4MK9A 1EX4A 2A6AA 5LJVA 4ECQA 3BF1A 3NGIA 1C1BA 2HLTA 1S6PB 1HL6A 2W41A 4DL5A 4K59A 4RW7B 3C7NB 4J2BA 4JRPA 4H5WA 3HL8A 2K2PA 1FJGK 4B1ZA 4IG0B 1U6FA 4JKGA 4CZJA 4U67L 2BM0A 1QS4A 2OANA 1TKTA 3OTOF 1HI1A 5D3GB 3ULHA 4NLRA 2G4BA 2Z2LA 2JFDA 2DEIA 4F4ZA 2G1DA 3J7ZO 1N5YA 3WC2A 5ETNA 4AILC 3HRGA 3SV3A 4DLEA 5E2QA 2MLXA 2YNGB 4HHHA 4KBOA 4JI0J 4AHSA 2QSFA 4J9RA 3J8AA 2Z2ZA 5F8GA 4ZLPA 3SNNA 3CIMA 3SUOA 5JVGL 4X4QA 1WUAA 1HJOA 3SBGA 1KSPA 2RN2A 3FEZA 3S6EA 1NXIA 3LH2S 4WZMA 2CDRB 4A8KA 4QS9A 4E0DA 2XCPA 3OV7A 2CFXA 4M5DA 4Q5VA 1U1OA 2H5JB 1VQPN 5KFSA 2HMIA 3O9RA 5HROB 3FJ2A 5AJ3K 1K0TA 5CQGA 3EXYA 4FPIA 5U47A 1RZMA 4ETXA 4CO0A 3U8XA 4FYDA 2O8EA 3KWMA 4JI2F 3L6QA 2CVIA 3FR0A 1HUXA 2GJ2A 2GX9A 3QFPA 5FRNA 1N8RT 4MMOA 4IO9L 4DG1B 2ACYA 4BQZA 2P9PA 4H54A 3WEEB 5F8JA 2UUBJ 1BY9A 5C42A 1WHVA 2VKZG 1SC3B 4OI2A 4K8ZA 2F4FA 5C7PA 4KREA 1Q8IA 3CCJN 4O3OA 1FWLA 4FW2A 1JJHA 4H5VA 2MZRA 3OYKA 1OS5A 3HFVA 2VFVA 3SZ2A 2ZJRQ 3V5RA 2NXCA 1RLCL 1MLAA 4RUCA 1LWFA 4P7TA 3ZFVA 2CNKB 4DCJB 2IC3A 5JUMA 4DEZA 3TVKA 3ELHA 3OVBA 1S6UA 1RGVA 1NMEB 2GIQA 4IUFA 1GMWD 4DI6A 4GVEA 4ZHRA 1FFWB 1GOAA 1AW0A 2BMBA 2ILYA 2A2DA 3GFYA 4ZJLA 4DL4A 2ASMA 2OP5A 3KLIA 3AARA 1Q86T 2Y1IA 3OXFA 2ASLA 4YDXA 3AO5A 2CQPA 3RR8A 2LQJA 2JLFA 1KXPA 2W2PP 5J1PA 4QIFA 2CJYB 4F7VA 2GCFA 1UPMB 2V2KA 3F0NA 1EJ7L 1CBKA 1JLEA 3HM9A 5C24B 1K9MT 5B0AA 1ZTTA 3PM9A 2QRRA 2MKKA 4CD3A 7AT1B 4KE5A 4DTSA 3ONQA 1RT5B 4BBYA 2UUAJ 4H8KA 4KHRA 4CCHA 3OBYA 3U1NA 4CLKA 2DXEA 3LALA 3HI0A 3KK1A 4E2FB 4NI2A 3I0RA 1U7LA 1RCHA 1JLGA 1M1GA 1H7XA 1V5VA 2AGQA 2ZH2A 4J2DA 1SH2A 2QMUB 4F3OA 4ILHA 3IBFB 3MPYA 4OMFG 3ZZZA 2DPJA 2HNZA 2BZ2A 1KNZA 3ZSXA 3B6PA 1UFWA 2XSJB 3NCPA 3OA9A 4OHXA 3D68A 1HBNB 2E2PA 4GKJJ 4B3TF 5BJRA 4M3UA 1GLDG 3WX4A 3D4JA 2L9NA 4NLOA 4YP3A 5AQLA 3O6WA 2NRXA 2BJEA 5L1LA 3CD6S 3PYGA 4DQPA 1VQ9N 4WYLA 1NGCA 1X8DA 1Q7YT 1CZAN 3N6LA 3W8PA 1S59A 3LAMA 4X65F 3LP1B 3K17A 1XIQA 2E2NA 1HNVA 2VC1A 4F67A 1M5KC 2XS7A 5J2MA 5M2UA 3WZ0A 2KHDA 3F5TA 1HPZB 4XH5A 3VQSA 5KFCA 4R8UB 2XO7A 1UAWA 3VGUA 1SL0A 3EICA 4I1TA 3BF3A 4IRKA 1RILA 5DM6L 2E5LK 4JS4A 2V0NA 2M0GB 1H2TZ 2BKPA 3OLAA 1EP4A 4GO5X 3DOLA 5LXRA 2UVWA 3QIPA 4OX8A 1GQEA 5CY4A 4B3SF 4LVOP 3CFRA 1TVRB 2GNKA 3OTOJ 1T7PA 5KFNA 3ATVA 2PI5A 3OTEA 4NLVA 4TQSA 2YY3A 1MROB 2UUCK 1P90A 3DGVA 2CNLB 3I8DA 4CEZA 1MN9A 3AFGA 4RW8B 2VG7B 4DPUA 4FBTA 4B1UB 1Q8BA 4NLDA 5KFVA 1REVA 5KRSA 3KUHA 4OYBA 4NLBA 3E9LA 1UVJA 3U02A 1AUDA 3MMBB 2A6OA 3K2YA 2D3UA 3MPDA 1VYAA 2EK6A 1FJGF 2CGJA 2BRKA 2OEKA 2H3GX 2D3ZA 1TV6A 1I51B 1MMDA 3E01B 2R42A 2IJRA 4X4OA 1L3KA 2E66A 1FEHA 1VK0A 1FESA 2ZH9A 3PIOQ 1JB0C 4JI1F 4I64A 4H0OA 4FK2A 1XERA 1NPRA 2A5XA 4OGEA 3NNCA 4NE9C 3RG6A 2ZM6F 2V94A 2YHAA 3VQDA 1KVCA 1TYQA 3DDKA 4JI2J 3MN7A 2KYZA 1WLJA 5CYQB 1B99A 2PIIA 3OW2M 1PC5A 3NAHA 2RKIA 4ZN3A 4CM2A 4RJVA 3G71N 3DOMA 2KVQE 3BZQA 4BACA 2KB2A 4ES3A 1RU1A 3I4HX 2NS1B 4RO0A 3IMXA 4BREA 5JJBA 4ZP7A 3THVA 2VDIA 4FJJA 5I42A 2PBDA 2KJWA 2W2NP 4C8MA 2HNDA 2VICA 5AJ3F 4NZ7A 3PUFA 3OJSA 4BC7A 4P9SA 3C14A 1TK8A 1V3ZA 3NMUA 1KC8O 4B9UA 4XDCA 2EW9A 4HACB 4OHWA 3QIOA 5BR8J 2HHTA 2MKHA 2V2ZA 3KXDA 2VQEK 1VSKA 3GIRA 4OYMA 3UE2A 4FW1A 4DV3K 3IA0A 3GMGA 3NCIA 4LFCK 2ZNZA 1KFSA 3FVYA 1MA9B 2ZH1A 2HEKA 3RAMA 3D54A 1YJ7A 4MLHA 3OL9A 2H3EB 3EGNA 3S41A 2BE2A 1UETA 2ASPA 5IT9Y 1G3OA 3UO0A 3VOVA 2HBZB 4DTRA 4HVJA 2AU0A 1T3NA 3QWPA 2GX8A 1KDNA 3Q23A 3ZSYA 3QNOA 1VBKA 1NRKA 2Q3PA 2XTJP 1KS2A 3VZHA 1JLFA 4C8OA 1S99A 2PFUA 3Q8YA 4NPOA 5D15A 1WC0A 2OI2A 4UF4A 3GR0A 1C1BB 3VF4A 5EN1A 3V2UC 4ED5A 3GCWP 3R5BA 4CLSA 3CFPA 1V4SA 2X1GA 3QGHA 1HX1A 4M5NA 4BG8A 1TKTB 2PYLA 3V6HA 4HDGA 1AB8A 3QIDA 2GW8A 2E20A 4QYZK 1N5YB 1DY3A 1WBDA 2G13A 3FMBA 2KDOA 4BRIA 3SQGA 3L4BC 3UDLA 5M1FA 3CJ0A 3TABA 3JTNA 4F02A 4B3TJ 1NU4A 3TQEA 2QWPA 3VF6A 2OIHA 5AQTA 1NB2A 4BGBA 3IRXA 2LVWA 1LOTB 3Q2SC 4X65J 1KQFB 2H65B 2LP4A 4URGA 4DS4A 2J5AA 3TZZA 2JJ4D 1HFEL 2HS4A 1ZZNA 4CJEA 3DLJA 4M5DB 2J9DE 2OPPA 1VQ8S 4H0YB 2B56A 2HMIB 3M2RB 4J9UE 3FKBA 1O5JA 3R6LB 1OWXA 4PWDA 2O8EB 3MAAA 5K8MA 1K8AO 1X4HA 2BJ8A 1DHMA 3BO3A 2VU5A 5AQSA 3I55N 4C3MA 3VA3A 4P73A 4FLTA 3Q8RB 1XR6A 3GG4A 1KVJA 4WIIA 5H1SQ 1X31C 2BBEA 3OFFA 3VQAA 5C42B 5HAOA 4CZMA 1S9GA 2P9IA 1Q1KA 1RAOA 1VMBA 3Q8PB 1KVIA 1RDUA 2WSEC 4UOFA 5GAHU 3R6MA 3U9DA 2CQGA 4K2JA 5ETSA 1PO6A 2CPZA 4USHA 1V9OA 2B8PA 5KFQA 5CZ1A 3HHLD 2N3OA 1RWNB 3O3GA 2HGMA 3PYEA 1LWFB 3HOSA 3LZJA 1RT2A 2J7WA 2PMWA 2DY4A 1FHTA 1NK0A 2QWOA 3JSBA 1FJGJ 1JCFA 3EN9A 3NVMA 4ZHRB 3W3DA 3SSQA 4DZDA 3TAQA 3AQPA 3GIKA 4KBIA 1RUSA 3JQKA 4K2XA 4KFBA 2G0CA 5C12A 4R5PA 1JJ2M 2DVIA 5THWA 3E1YA 5CHCB 2AA4A 4PKDB 4CLPA 2XQCA 2KFZA 3VESA 1HQUA 4HYKA 5HLFB 3EVMA 2WVFA 2DHHA 3DKDA 1LWCA 4JV5F 1T6CA 1HJRA 2H48B 3MWTA 3VGVA 4YY3K 3D6RA 5HJYA 5EWFA 2VQFK 5HVHA 5AXKA 1ZC6A 3LQVA 1S6QA 4P74A 4ED1A 4DFJA 2MY8A 3IM8A 3TTFA 2EEYA 2DH8A 2X78A 3KK1B 3FFKB 4NI2B 5AJ3J 3I4PA 1TR0A 3I0RB 2W7AA 1JLGB 1RLDA 3VAJA 4IEEA 4C0HA 3TEHB 3H7HB 1XBWA 3CXCM 4IH5A 4N47A 2W7OA 4USTA 1JCEA 1ZZFA 4FNIA 3U4LA 4USUA 5GAGI 3NH2A 4FYWB 1VR6A 4CJTA 1VQLN 3QNWB 3KG0A 4WTOB 2NRVA 5LOQA 3K0SA 4V19S 4IJNA 5FD1A 2K06A 2WOMB 2HHQA 1XHZA 4GVLA 3OXGA 1MMLA 1NSKL 1U47A 4KKOA 3GDQA 3H4BA 1F1BB 1S4FA 3E3XA 2MQ8A 1HNVB 2VBZA 5J2MB 3D2EA 4RW9A 1U45A 5HVGA 5ETPA 5HRPA 2HF3A 1JLAB 5FJ4A 2W2OP 4JOUA 2JVOA 1YBUA 4Y0WA 3VAFA 2ZOGA 2DTUA 4LY7A 1Q82O 4QWBA 2LQBA 4DV3F 3JXOA 5EWEA 3O4WA 4IH6A 5AQPA 2P6TA 1Q81O 3EGZA 1BIUA 3MDFA 2I2YA 1FERA 1GEHA 2LEPA 2E9ZA 3QIPB 3GJSB 2XZWA 3A5LC 1AROP 1XMQF 4AYBD 3WNEA 3JAMY 3D3CJ 3TTDA 1LFPA 1Y64A 2FZGB 4BLGA 3BR8A 2VPZB 5FPEA 4ZVQB 1VS3A 4WP3A 4J37A 3ENAA 1SJFA 3DGPB 4JI6K 1QUPA 2R9LA 3CDAA 3CD0A 2HBYB 1UW9A 3UD3P 3N4PA 2L41A 3DXMB 3O8MA 1PILA 4L3KA 3CC7S 4MYTA 2AGOA 3PY8A 4CGIA 2DGQA 3DHWC 4C7QA 1ZA1B 4DTUA 5C2GA 1YBTA 3CI5A 2HFUA 4O4GA 1D5AA 4C23A 4CYUA 1S12A 3UW1A 1TV6B 4M63A 5CD4A 2EKYA 1XHXA 4M3YA 4XO0A 4MLEA 3MXIA 3AT1B 2FBYA 3M2UA 3VF2A 3QT7A 3DOKA 3PV8A 1SS6A 5KT2A 3CCMS 3TARA 1BMQB 4DFKA 1T05A 9RUBA 1NJWA 3THPA 2G9OA 2HHPA 2K8GA 2IMOA 2BH1A 2W4PA 3R27A 2P9KA 2Z2YB 1X0FA 2WHOA 4FJ7A 4MFBA 2IDLA 3AVGA 3VQBA 1QQOA 2RKIB 3O5BA 4FM2A 4ZPTR 2OAUA 3TUIC 3JB9k 3DOMB 3NMRA 1YITS 5MAOA 4IO8A 2LA6A 3H5YA 5BYRA 1VDHA 2JEFA 3GQCA 4E1JA 1W97L 1FRXA 3NF8A 4QBUA 3J7ZT 1Q5VA 4DTMA 2L9DA 1VC6A 4ECVA 3TAMA 2IVNA 2V2VA 4RWXA 5I42B 3FC9A 2P9SA 2E1RA 2HNDB 2FBXA 1RBTA 2BXJA 2J8AA 3NGSA 3I56S 3GYNA 3OFGA 4AQYF 4BRMA 4OZ0A 3FBCA 3IM9A 5AQFA 2G8FA 1SI9A 2DGWA 2E5LJ 2NREA 4A2BA 4A48A 4RR5A 1OKJA 5L1KA 4PCQA 4FYXB 3RBEA 1PGZA 3M6XA 4FPRA 2HVEA 5KG0A 3MF5A 4M5GA 3R6GB 4YOEA 1FVSA 2XG8A 4G3IA 4CGJA 5DG9A 4EFHA 2AEJA 4FYVB 4PWUA 4X4RA 1RBAA 1W0HA 4QIEA 4F4YA 2BE2B 4C11A 1R6VA 3WNGA 2UUCJ 3ENVA 1RBOB 4KGVB 4A8XA 3KOAA 4LH5A 1UOCA 3HD2A 1RT7B 3N4WA 5JLFA 4PKIA 4LRFA 1N33K 2CADA 4HUFA 4DFMA 1VCTA 2R2UA 4MIAA 3E9PA 4B02A 5SUHA 4JV5J 3HO1A 3VGSA 1UZHA 4CDIA 4CHYA 2V9KA 4RWWA 3PW5A 3JQJA 4GRSA 3VQPA 3UCZP 3W5YA 1NGBA 2D3O1 1O51A 3PG9A 1JLQA 1VFJA 1HNZK 2LA4A 4USKA 1XK8A 4O55A 3M30B 4YB7A 3F41A 1LQ9A 4QU6A 2JDJA 2G8IA 2VGMA 4CZLA 2VIHA 2L08A 4KR0B 2VONA 1CQMA 3SQGB 4FZVA 2ASYA 4J9LA 1NLKL 4BC2A 3AVMA 3Q8QB 1E6VA 2Y1RI 2J9CA 2FLOA 4C48A 3IRXB 6AT1B 3QMQA 3RU0A 4OZLA 5EVZA 2CQ2A 1RAAB 4I2PA 5AQOA 1XMBA 1S0NA 2J6TA 4IOAQ 3H08A 4NA1A 1MU2A 1YQHA 4WZQA 3HPHA 4CO1A 1R8BA 5ETTA 2OZSA 1FDNA 1GXLA 3O08A 1H72C 2OPPB 3FRYA 2BE7D 1CSJA 3AO4A 4KO0A 3WDOA 3WXKA 2A0FB 4B8CA 5BN8A 4PWDB 5IT9O 3C6AA 4H4MA 4Q0BA 3MAAB 2DR9A 4DV3J 2IGIA 4CZEA 2MTLA 5ELZA 4LFCJ 2RF2A 3DU5A 4FJMA 2WB4A 1VQPS 4KSEB 1NCLA 2QKKA 1JK9B 2AJ1A 2I38A 3I0SB 3OR2B 1D8ZA 1XMQJ 1RE1B 2UVUA 3UWTA 4CIFA 5GAEU 2P9IB 4F0KA 1FEEA 1U2RA 3NWGA 4UT4A 2X1FA 2GGPB 2OCEA 4JAXA 3H45C 3KJQB 1XMOF 3V4IA 1FK9A 5HQLA 1BOTO 4FF3A 4CK3A 3SI6A 3ZO7A 3TX8A 5AXNA 3P5BP 4Y1DA 3VQ6A 1EKEA 3U9ZA 4DV4K 3A5OC 1YI2N 3BGLA 2J8SA 1RT2B 3HTVA 5BPLA 5F3ZA 4DPXA 3CCJS 1OYEA 2V63A 4WKRA 4JI3K 3SQ2A 4YR2A 4LQ9A 4E89A 2O1PA 4NLQA 3GZ7A 1VLOA 4CIOA 2DNKA 5A8KB 4NLPA 5IC6B 2GMLA 4KFBB 5K14A 4K4YA 1VSEA 4QYZJ 3VAHA 1EKRA 4R5PB 4WQ4C 4TVAB 1DBDA 3HBTA 3SPZA 4CI6A 2VGNA 3ADAC 1IBKK 4N77A 4NLWA 1IKVA 2KH9A 3LPUA 2Q3SA 2W2MP 5HATA 1HQUB 2MLZA 2W01A 1RFQA 3OTDA 1LWCB 2O8CA 4MO5A 4K7QA 2XGPA 3POTA 2PMZD 4ZK7M 1TUWA 4FJNA 3FEXB 4ZVEA 4J90A 1RBLA 4OJHA 2GHVC 2ZH7A 2HYIB 1WTFA 4WFYA 4JRQA 4U7BA 3IBCB 4PA1A 3OYJA 4ZCMA 4H0TB 4JD2B 1OVYA 1ZM3A 1ZH5A 4JV0A 1S6QB 5B08A 4FYYB 4ZCKA 1GXTA 3F56A 1FTCA 3EVWA 4EEYA 1Y00A 2CG8A 4AQYJ 3BR9A 1ILYA 3CCRN 4LMZA 2P9NA 2WCXA 4BGAA 4FK4A 1QD1A 2YWHA 2MKCA 3QAUA 2VA2A 4OZ5A 4FLVA 4FLYA 2B4PA 3NFAA 3HHLC 1RCOB 1YRUA 1JL1A 2FXUA 3WIVA 4EBDA 1TAUA 1U1LA 3BBFA 4DPOA 2CNNB 3M8YA 3RBDA 4KKOB 2LKZA 2HHSA 4B3MK 4YB6A 2RU3A 3OXLA 3M32B 3BEXA 3V9ZA 4NCAA 4OYIA 4ZVTB 2CGKA 3D2EB 4NLCA 4ISEA 1TMMA 2O8FB 1IVZA 4IH7A 2NZTA 2QEXN 4CJQA 3FRZA 5KG2A 4K8RA 4PG8A 5CR4A 2YX7A 2YBVA 1VQ9S 5CCMA 3GSIA 4IQMA 4WFZA 5B0DA 3FDSA 1Q8LA 3W9HA 4HL9A 1EQ0A 2J6UA 2ZOFA 2HK2A 2QLXA 3HKZD 3ZCMA 3KHRA 4KI6A 2Z1IA 1FRJA 1S1XA 2ZE2A 4RW6A 2YNHA 3PW7A 4RNFA 1KC8T 1WAJA 4CT8A 2BANA 2QGFB 4DPYA 1ASVA 2IAJA 4U9RA 3CG7A 1E4GT 3J81U 1YK9A 5KG3A 4OPAA 2MDAA 3MWBA 1L3VA 1N33F 1Y11A 3H5SA 3LP3A 1NGGA 3D9BA 3IR6B 3GL1A 4Y2KA 3BJYA 1SZ2A 3ULEA 4LF7K 4JHDA 4XAKA 3ZNUA 1CS4A 1YG0A 2HHHK 5EGYA 3CWJA 4K0KF 5RUBA 3HT0A 4BCAA 4USMA 2OEMA 4M5JA 2F7VA 3MK6A 2WC9A 1HNWK 1M0SA 2XMJA 1SJ3P 4BC4A 4P2SA 4BDPA 5HN0A 3QLHA 2OHDA 4CYUB 2XNRA 3N4QA 3DI6B 2WRMA 4M5MA 1HNZF 3L4IA 1S76D 4DR5F 3M2UB 3DOKB 4DR7K 3CQXA 3W66A 2W6LA 2FVSA 2CPHA 1HBMA 3CJ2A 4DSIA 2FPHX 3OYGA 4CIEA 1T05B 2VUGA 4CNYA 5H9FK 2MJNA 3RMCA 1RAGB 2P9KB 2ZDPA 4CZFA 3J7YP 4FLZA 4DV0K 1QUVA 4HTIA 1D1UA 1TK5A 1AFIA 1MWYA 4DV5F 4AM6A 3O9QA 4XPEA 3UDVA 4DX7A 3V9WA 2UXCF 5DM6Q 1S1UA 2G1HA 2KVIA 3B4MA 3NS5A 4FF1A 4BR9A 3KK3A 3I8BA 1E4FT 4EHUA 5J2QB 4QCLA 2P9SB 4CBXA 1Y3KA 4JKAA 4DUTA 1XMOJ 3ZT0A 3GTYX 2AJQA 4M95A 4OYPA 4TYAA 3G71S 3BZKA 1KVBA 3M9OB 4CQ1A 3BSOA 2AEMA 1IG8A 3JAMO 1S5JA 4CEFA 4EFAC 1KHVA 2CPFA 1KVAA 4CTAA 2W40A 2J9DA 3IR7B 3VQTA 2G8VA 2JVRA 2AJ2A 2PO4A 1U49A 1OMSA 1WEYA 2GO8A 4UQTA 3FZBA 1V3SA 3D0PA 1FDAA 2IM1A 4X4UA 1BD6A 2OPSA 1ACMB 3HT3A 4K4UA 1KP6A 1R43A 4CESA 2O8DB 3CDWA 4C11B 4GW6A 1RTDA 3IAM9 3QEPA 4DUYF 1K8AT 3DLLL 5CE3A 1KAXA 1TL3A 3G8SA 1BCOA 1FE4A 3PKYA 3HYFA 3KJVA 4G1QA 4DBQA 4K4TA 5CYMA 1IBLK 1PJ7A 2NUHA 4WKYA 3CJ1A 4PUOB 1N48A 3OYAA 4F9OA 1ESVA 5E0OA 2DGXA 4JKEA 2V2QA 2CH5A 1WDTA 2FBVA 4F50A 2IM0A 4WFBL 1S7IA 5C2CA 3P38A 5GMKa 1TL4A 2VFRA 2O8BA 4OPJA 4JI3F 4OJ1A 3T5LA 4H4OA 5K20B 3PEJA 3HK2A 4L3QA 2V7YA 5GINA 1DAXA 5DJBA 2ZDOA 1JLQB 2DNPA 2FGCA 3R5GA 2FSNA 4RBTA 2EFOA 1VBZA 1UJ5A 4P52A 1IBKF 3A3NB 1GX6A 4BG9A 1VQSA 3GG0A 2HURA 2BYCA 2B4UA 4MJKA 3AGKA 3K8WA 2ZH4A 1E6VB 2GVZA 4PXBA 3H40A 1QHAA 3CPWM 2F96A 1EETA 4H0PA 2IBOA 3P5JA 1FWPA 5KG7A 2D0CA 5KG6A 3QDKA 3NNHA 2FC9A 3GLJA 3IFRA 4CO2A 2L3MA 3HX9A 2HK3A 2NRTA 4F04B 4FK0A 4K43A 5T7BA 1ZETA 1JXVA 3A2FA 3CCUN 3IN5A 2AJFE 3H3NO 4DU1A 3LPEA 4LSZB 1RT1A 3PVXA 2HBLA 3LO3A 2FHMA 4M5HA 1HA1A 3C6HA 4BRGA 5ETLA 3CUNA 4FXDA 4H4MB 4Q0BB 4C2MA 2K3IA 4LBHA 4Y65A 4NMLA 1BXNA 1X4FA 4CJLA 4LRCA 2RF2B 2XCAA 2X1BA 1YJNS 5E5NA 3MMCA 4AHRA 2VA3A 2R8GA 1NBEB 5IOLA 3S1TA 3GV5B 2OYQA 5HMZA 5AXMA 1YVUA 1VQKS 4QS8A 2D9OA 1YDLA 2Q6BA 2G0JA 1ATRA 5JLHA 5AQXA 3M2VA 1NK4A 1QQMA 3D3BJ 4EBEA 2RD5C 1N33J 1S7HA 3V4IB 4TLQA 1FK9B 4QWDA 1SH0A 3G6VA 4BRAA 4A8YA 2P2CB 3K7RA 3C16A 3W62A 2N4CA 3HKWA 1NPKA 4IG3A 1FX4A 1TKXA 4K0KJ 5JMVA 4UUXA 1SH3A 4AE5A 1RNHA 5CH7B 1QE1B 4HTJA 1S6OA 3JXUA 2NZ4A 2VHGA 1HNZJ 4DR5J 2LU1A 2POKA 5K14B 5E41A 1E6YB 3W2VA 1Q82T 3RAXA 3AOAA 3SCIE 3RVCA 2N82B 1Q81T 3ZT3A 2EBEA 3NP5A 4KHSA 3RW7A 4WU3A 1R0AA 1TL5A 1UJ6A 2M8HA 2ZH5A 4CHOA 4LF7F 3EZ5A 5DDPC 3QT8A 4DV5J 1TFWA 1WI8A 3POTB 1U0HA 2AD9A 2M5YA 2AT1B 4E19A 2O01C 1P8GA 2ZH8A 1RTZA 2VB6A 1ZYQA 3OHRA 4X66K 2GV1A 3BO4A 1VJQA 4AHCA 3CDUA 2HFVA 3O2IA 1N36F 2IJFA 5B0GA 2D7SA 3M3ZA 3N6MA 5AE3A 3I9V9 5A8RA 5FLXU 1HHSA 1R6YA 1FXRA 2J0SD 2CQCA 2B8QA 2V52B 1T8EA 1NU0A 2P9NB 3LM2A 2LLZA 2ZH6A 4X64K 2C1EB 2COLA 3MHYA 3UE5A 2ZH3A 4YB5A 2KI2A 4ELUA 1HW9A 1WKKA 4OV1A 1HQEA 3MXMA 4BE2A 2VFUA 1ASUA 1OQ3A 4I6MA 5KFHA 1HMVA 2D74B 2Z4PA 2HQFA 2W9BA 2AWZA 1K73T 4NLUA 1U6ZA 3SLCA 2E1PA 1FNXH 4BWMA 5FRMA 4IDKA 5L1IA 4DUYJ 4I67A 1VQLS 4MTPA 5KFDA 2GUIA 1RBSA 4B3OA 3PCOB 4ID1A 2MHEA 4F2RA 1JNRB 3A5MC 1SVDA 1KR4A 3IFEA 3PO4A 4LQ3A 2ASJA 1U09A 3ILOA 4CFBA 1X5OA 2N7CA 3NGZA 3D6MB 3L3CA 2GAHC 2DYAA 4IOXA 4JI5K 5DK5A 2NQPA 3VV2B 3K9KA 4BR5A 3R9PA 3BQ0A 1XR7A 4JI3J 2NXUA 2X74A 2FVQA 1R27B 3T1YK 2ZGZA 1S1XB 2ZE2B 4RW6B 1YXQA 2YNHB 3KK2A 2RJZA 3L95X 1DJ0A 2QLBB 2MGZA 1HHQA 4O0IA 3OL6A 4MKVA 2BANB 3PEHA 3GV7B 5DM7Q 1OJ4A 1H2VZ 5IQQA 1IBKJ 4FN5A 3PR5B 5F8HA 1N34K 4OX9K 2C3MA 4OJ3A 5ADXH 3RBXA 2VWKA 3QFWA 4D3HA 2QA4N 4TU9A 3LF0A 1IBLF 3HZGA 1I6JA 3ZSOA 4MK7A 4OKEA 3HXMA 3ULEB 2RDJA 1MSWD 4JHDB 4KYZA 3D7EO 3CD6N 1CS4B 2Y3YA 1MG7A 4QW8A 1NB7A 1VK3A 2HS0A 3WX8A 3KLHA 4CEOA 1JQGA 4F36A 2XLKA 3R5CA 5M1NA 1K1QA 1RA7A 3D6HB 4JNEA 1VHFA 1AFJA 3QLHB 2OFHX 4Z4FA 2E5GA 2WTFA 2LEBA 1CC8A 2ITMA 4E98A 3SK3A 1BDGA 2XC9A 5J1EA 1HBMB 1GMWA 5IC4B 2YKAA 3QSIA 3CMEN 2XRIA 3TR8A 2WAQD 3GILA 3BYPA 3C6UB 4CFCA 1IXKA 3UN3A 5KT6A 1SQKA 5MLCV 4B8AB 3CVKA 2DHXA 2HSEB 1P1TA 1NOZA 2D1KA 4KH4A 4F2SA 4CH1A 1O13A 5AQHA 1DFDA 1VGYA 1S1UB 3OTBA 4NXNF 1HR0F 3QQCD 3KK3B 3ISND 1NGHA 3EM1A 2P9UA 4E7KA 2MEWA 3BF4A 4ATNA 1OY8A 1N5TA 2CWKA 4CF8A 1NNEA 2CQDA 1GOCA 5F9NA 1J5OB 2FGOA 3HHEA 2KTQA 4DJBA 3VERA 2HKEA 1X4BA 1WF2A 4CTAB 1IN0A 1HBUA 3NH0A 4DX8H 4KHPF 1K1SA 3BREA 2QK9A 3MUTP 4ANDA 3M05A 1L5UA 2PAVA 1HWJA 3T3FA 4IR1A 2OPSB 4ZPWR 2BR0A 1DZ5A 3V81A 2HHVA 2ZHAA 4O3SA 4PABA 4WCEQ 1U1RA 3A8EA 3A3PB 1N0UA 4DL7A 1RTDB 3OD2A 2QA1A 2K1RB 3AXMA 4XH4A 4K25A 1MWQA 3K5MA 1TL3B 3FSXA 1DLOA 3CJ3A 3H46O 4CJ3A 5GMEA 2OO4A 3W7BA 4G1QB 4GMKA 4ANCA 1IBMF 1X4DA 5D8HB 5M1KA 5CYMB 4LF7J 2A2CA 5KFWA 1NH8A 2HHHJ 1MN7A 2CA9A 4KTWA 4MKAA 4LFAF 3C15A 1EWQA 2HBJA 4FXWA 1M90O 2F8EX 1ROFA 1HNWJ 2B4OA 2DHGA 4M3TA 4O0NA 3HOTA 3J80U 1LWXA 4H4OB 4M8LA 4JEPA 2CQ1A 5AQNA 3JS9A 2H9ZA 4ED3A 5LM7E 3KHHA 1T95A 4OI0A 4H5TA 1IJEB 3CCEN 3BGFA 3MAQA 3TUPA 3DAWA 2F8HA 1YJVA 2F65A 3ENBA 4WF9Q 3D0HE 2AJ0A 2XYGB 3B54A 1W2BM 5ETMA 3DMJA 3QO9A 2YVSA 2GVZB 1EETB 4M5IA 3M6UA 4FWPA 1VIXA 3IKMA 2AX0A 3MM5A 3NGKA 1C0UA 5I3UA 1GAOA 2GS8A 5HMWA 1CG2A 1U0SA 1ELOA 4NXMK 2W24A 4IFYA 1NJYA 2WUSA 3LPTA 4WQ5C 4PPDA 1RT1B 3R3TA 3G2XA 5KFKA 2RIJA 4PEOA 2B43A 3TA0A 3OL8A 2FF6A 2KO1A 4U7CA 4WBFA 1D9FA 2VOOA 3QINA 3TR5A 2DY1A 4BRHA 3NBPA 2PFDA 1U8SA 2W8LA 2QLWA 2MQPA 5E26A 3MMCB 1XC3A 5AZJB 3MUMP 3MZIA 2KT5A 3M8RA 2YKNA 1H74A 3N0VA 3ILJA 2V69A 4NRTA 1LKZA 3V1RA 4W5TA 3M2VB 3FZFA 2ITGA 3SYZA 1G7CB 1N6QB 2QM1A 4ZMMA 2KRBA 4ILJA 3I87A 4ZPAA 5LSLA 4B9VA 1IBLJ 3KKRA 4WYBA 2YX1A 3P83D 3C16B 4N8NA 4RCHA 1M1KO 4C9DA 1P1LA 3I9ZA 3H5XA 2KM8C 3TP2A 3WNHA 4DTPA 4IG3B 2BJ3A 2CZ9A 4ELVA 5J2PA 3KLFA 3F44A 1GH8A 4ZLJA 2QA4G 1F2GA 1X4CA 3T1YF 2BX6A 3VPZA 5BREA 4AHVA 4OHVA 1VQ8N 1U1MA 1VBYA 3DLBA 5FROA 3ZTOA 3V6KA 2EWSA 2R3VA 4RUBA 2JEJA 1Z6RA 3W2VB 1WTBA 4NRUA 5HBMA 5M1QA 2OSRA 5D0RA 2QX0A 1CXUA 1GLEG 3TPQA 4ZS6A 1R0AB 5M1OA 3VAGA 4TU7A 2X6NA 4A8SA 2UXDK 1T3OA 1U0HB 1NDCA 3MR2A 2Q66A 4XEIA 4CLFA 5IM0B 3EGWB 4BE0A 3AOCA 1UWBA 3CTRA 4PQAA 4NXNJ 1HR0J 1HWUA 5CABA 3AO2A 4DF8A 3LOUA 4CZCA 2BA9A 2CWXA 2Z8QA 1QLNA 1T03A 1Q5YA 5A8RB 3G0ZA 3CJBA 2W4DA 2W2QP 2KZMA 1RDRA 4LF5F 1R59O 2LCWA 3VCDA 3CCQN 4B9NA 4FLWA 2EC2A 2ZZMA 4WE1B 4KHPJ 1EX8A 1HQEB 1GFWB 2BUNA 2K7KA 4I6MB 2QIFA 4OFZA 4FSVA 4ZIVA 1HMVB 4PL7A 2W9BB 3CCRS 4DR3K 5DQGA 2VJUA 4JUZA 5AR0A 2AYEA 2A3JA 1RJJA 3J81j 1HWIA 2R2SA 2IS3A 2HBMA 4IDKB 3ZZPA 4I9QA 1VQ7S 3Q86A 4J9OA 3RRKA 1HWKA 3D6TB 2GVDA 2G0IA 3AD8C 2PY5A 3DFEA 4CZKA 3MGJA 4E7LA 3CPEA 1U04A 1Q0NA 2E5HA 3IRWP 3NGYA 1Y5IB 5L39A 1EO1A 4BR7A 2DR8A 4YB1P 2LQ5A 3HSZA 3AA2A 2EI5A 2DGUA 1RT3A 4R25A 4CFAA 3EY1A 3CEDA 2VPXB 3L9ZA 4I7FA 4URQU 2RHQB 3JTOA 3ZSWA 4FJ5A 2QEXS 2HFZA 4CH7A 3KK2B 2MGZB 2FB0A 4U7UK 2Z1HA 4GNIA 2FJAB 4N41A 1N32F 2PI4A 1P9QC 3O5TB 5AFUA 4Z0UA 1U26A 2XI3A 4A46A 2YHXA 4K41A 3CJ5A 2DB1A 4KB7A 1J6ZA 1ZS6A 2BKNA 2IHR1 3C6TA 4ZCLA 5ETOA 3KHLA 3KLHB 2JL9A 3RMBA 2V34A 3HHLA 5HRSA 3NGTA 1RAHB 4YOXA 3UKRA 2P9LA 1SC1B 3ENOA 4N76A 2CQ0A 5L9XA 4LSLB 1C4CA 3O4QA 3N79A 5EUHA 2FJXA 3L2RA 5J1EB 3MXHP 4X64J 3FSYA 3MAHA 1OIAA 1QDUB 1WC1A 4L76A 3O3LA 1WKLA 4NA3A 3CNQP 4U96A 2RQCA 3K5LA 4KI4A 4PKHA 4ZPBA 3EZUA 2XSFA 2UXBK 1RBUA 3EMTA 4AFFA 1FX2A 2C42A 2ZZTA 4JN4A 3ZZUA 5LMUF 1I94F 1B64A 4B1XB 1NKEA 2ADCA 1F5BA 1VQOS 4NXMF 5JMNA 3MM8B 3UNYA 4A8OA 2MB0B 3DRXA 4Q8FA 3CJ9A 2IIRA 2P9UB 1VHIA 2WBNA 3AY9A 2ZJPL 1IH7A 2EBGA 2HMPA 4E1NA 4L8RB 3E2EA 3KLEA 1JWWA 1GLJO 2VWBA 2RAQA 3CC7N 1RAIB 5GAGP 1DQAA 4B9SA 3ZTSA 1X0PA 4FOEA 3SFUA 4Y34A 1HBUB 3CCVN 5IV3A 1ZAVA 2CJ9A 3NKYA 1NDLA 3J81Y 3T1YJ 2V8DA 2RDIA 4CERA 3ZZ0A 3WXIA 3O8WA 3H59A 4WFAQ 1QVGM 2I0XA 3V81B 2O3DA 5L9NA 3JTPA 2E88A 3AAPA 4QS7A 1ZBLA 3CCMN 1K47A 2UV8A 1EAYC 4E7IA 3M9NB 2NCKL 5G0RA 1RB0A 4O0JA 4A4JA 1J5EK 1DLOB 2WSCC 3HMJG 3HJVA 3M8WA 3RSEA 4U95A 4KGMA 4ECZA 3PTWA 4YR0A 3HP9A 4IOCL 5DZ6A 3ZTQA 3A5NC 2ZKTA 1GLBG 3H98A 3C15B 2X1AA 1B0PA 4ECSA 2FZCB 2KLAA 3QRPA 4E8UA 3PIPQ 2FY8A 1S0OA 1SL2A 2Z1JA 2NRRA 4ELTA 1OSCA 1GLCG 4DV7K 1UEKA 4M45A 1WSGA 3RW6A 3TI0A 2DNRA 1VQMS 4OYZA 3I56N 2V6AA 1TUUA 5A76A 4M7XA 4DR4K 3C19A 4JI8K 4YN3B 4LF5J 3H3OB 2VCPA 2UZAA 3ISNC 2D0BA 1R7IA 5JS1A 1OQ6A 5J2NB 2CG4A 4YQWA 1EKSA 3DMJB 3QO9B 4CHPA 2PC6A 4LF9K 1BL3A 3ZZTA 3PSIA 4HKQA 3OW2R 4TY8A 1YLXA 2FLNA 2VL1A 3B8AX 3MM5B 4HT7A 4JI4K 5I3UB 3FQLA 3O1LA 3OYIA 3EVOA 1MDUB 2Q6CA 3TA1A 2DRDA 3SQ1A 4RW4A 2FLPA 2V68A 3HZEA 1QAJA 3QT5A 3TSUA 4HDHA 3T41A 2BQRA 4RNMA 2WONA 4YNQA 4X4NA 1C0TA 3H5UA 2F4VF 3FZLA 3P45B 5DQIA 2JSXA 5TKYA 4W5OA 5ETVA 5K5MA 2VJVA 2ETJA 4FM0A 3IGNA 4B17A 4KV8A 4PHTX 2DNYA 4QOTA 3CCUS 3NBPB 2QSWA 1HNIA 2P9GA 3L2WA 4DR1K 4EZ6A 4DL2A 2DGOA 2B4JA 3VQEA 3ZEUA 3P39A 1OY6A 2AW0A 3MX2A 4DR3F 4F0HA 1QAYA 5HO4A 1LXNA 2HZCA 5T41A 1NHKL 4DR2K 4EAHD 4FVUA 4I9LA 4OGCA 3BSNA 2YKNB 1PYTA 5HL7Q 1N32J 1WSIA 3PX6A 1DT9A 4CJRA 2B5JA 3PJWA 4KGXB 4ZIWA 1VQ4N 2Y8YA 2F7TA 3NGDA 1IKXA 5B0BA 2CAJA 2DNLA 3GG1A 4HVZA 3AA3A 3IS9B 5AQGA 2GTDA 4JP8A 4UW2A 3QGIA 5LL6Z 1XNRF 2BUPA 4AF1A 5J2PB 1U1KA 2HGNA 2JH3A 2Z2MA 4CEEA 4NCBA 2RHSB 1IKYA 3O1BA 1B92A 2O66A 3UR3C 2FC0A 3PJXA 3CJ7A 4KRFA 1FFSB 3A8KA 3D0IE 5L8RC 4M3XA 5HBMB 4NL5A 2ZJRL 3UPFA 2B6AA 2MZ1A 1W7WA 4LIWA 4FWMA 5L46A 5HI7A 2HVDA 2MKJA 3U1LA 1RTJA 3W8GA 3FLCO 5GADU 3Q24A 1W7AA 3HD1A 2KL8A 3Q89A 2ZFHA 4UY85 2JNJA 5BRHA 3GP9A 2BV3A 5LMUJ 1I94J 4PG5A 1GTHA 2NSBA 2ZWPA 4U8YA 4NXMJ 2MQOA 5KQDA 2AEFA 3OL7A 3OYNA 3QEXA 4DR6F 2F1FA 4D3GA 5KG1A 4HEA9 1LK5A 3CD7A 2YCHA 3GFXA 5C25A 3QEWA 1RACB 1UA1A 4FNHA 1QQNA 2HNYA 4QR2A 2ERRA 5GAEI 1TKZA 1ZAWA 3WXLA 4AXIA 5LSRA 3M8QA 3L2QA 2CJBA 3KWIA 1QZ6A 4ID5B 1E3MA 4LFBK 4DN9A 2BDPA 4ILMA 1ZBIA 2W25A 2BVZA 3RJMB 3QEIA 2EG1A 3DRRA 2B0GA 2BE9B 2QKBA 4P72A 1KEKA 5BR8F 4QW9A 3H2VE 4EGLA 3BO2A 2OUGA 1WC5A 2D69A 3ALYA 4CVNE 1LNQA 1OO0B 2GVDB 2HFSA 3MX5A 2DR5A 3HFZB 4Y28C 3PX0A 5EU7A 3JSMA 3ZXWA 3OYHA 2MQMA 3EXCX 3ETMA 3FK4A 1U2FA 1LAWA 5LJ5Y 4H0XB 2MKIA 3UFCX 1U48A 1RBVA 3AO3A 2VH7A 4FVMA 4LF8K 1RHJB 4J9NA 2ZF5O 4LF6K 4PXDA 1RT3B 1LWEA 4I7FB 2MZJA 4CEBA 3VGLA 4O3NA 4H03B 2C2NA 1O8BA 1EIYB 4Z2XA 3H6EA 1NEEA 2M4MA 4QPTA 3SSSA 5AQVA 1F5AA 2B9XA 2V67A 4Q7AA 2EFGA 4ZDNA 1EARA 1ZAXA 4KJIA 2A41A 3BH6B 1KCFA 2DCLA 2F9DA 4BDYA 2UXDJ 2P1JA 1RI7A 2V4QA 3C6TB 4OI4A 5FLXY 2IYIA 2M88A 3VVTA 2CQ4A 1TMJA 1Y5NB 3QT6A 1X3NA 3HHLB 2CGLA 3N28A 3TZYA 3UKRB 5I9EB 2CPDA 2QA4S 2P9LB 4LT6A 2A3ZA 3AVCA 3OQ2A 3DRSA 2A1BA 2M9KA 4IWVA 2B9YA 1HRHA 4JI8F 5KFBA 2EFQA 2KQ2A 3BP8A 2GIFA 4B08A 5EX0A 2F4VJ 1QY7A 1M90T 3OYBA 2FC8A 1WEZA 4CH0S 4GMJB 3GJQB 3RB0A 3CXCR 4KRWA 4LF9F 3CJSA 3H2LA 4J9SA 3P96A 4OPKA 4FLXA 2I9SA 4LF4K 1RDWX 4DR3J 2YKOA 4JKBA 4P2XA 4JI4F 1UVIA 3UVJA 5BN9A 1DTQB 3CMES 3PIOL 1D9AA 1OY9A 3NS7B 4NA2A 5IWAK 3AA9A 2XMAA 5C0YA 1C6VA 3MEGA 1XUPO 1VRUA 2ATLA 3V9XA 2NSCA 1Z1ZA 2XYHB 4X2BA 3BPSP 2XY6A 3O3HA 4NMXA 4EO8A 3T1HK 2VFSA 5IFMA 3L7OA 1XNRJ 1ZM2A 4U6PA 4UY8O 4YOWA 3ENWA 3FBFA 5C2DA 1NSPA 3W5ZA 3OSNA 2UU9F 1T94A 3GONA 4YR3A 4E3SA 4EI2A 2YNIA 3QSYB 3AVJA 1PYSB 4K4WA 3ENQA 4JI7F 2KT3A 3TSQA 1FXXA 4OV6A 1A9NB 2HSTA 4GKKK 3BY5A 1FKPB 5CXTA 2E44A 5G0RB 1WSRA 3OR1A 2LFVA 5MLCQ 3QERA 3NGUA 5KFJA 3MMAA 2Q0UA 1HNXK 2ALYB 3RSEB 2F8MA 3LDQA 1ICEB 2CXEA 4FWKA 1H38A 5CA5A 1HYVA 3OYMA 3G82A 1JLBA 1PSDA 2NUBA 4JYAK 1IR1A 4I6YA 3CIZA 3T5KA 1TELA 3UN2A 3W1YC 2JEIA 1GNKA 2PDAA 4Y2IA 3GV8B 4RLEA 1SKWA 1BQNA 1GX5A 1VQ5N 4M3RA 4DR6J 3KLGA 1OH7A 2IRUA 1FO1A 1M1KT 3ATUA 5FPDA 4KT0C 1G15A 3C66A 4NOHA 2LXUA 5JVHQ 3AJ1A 2SXLA 1Y97A 4OYWA 2HIYA 1NHUA 2IY5B 4CM0A 2G8KA 5K8PA 2XM3A 1NGAA 3THXA 4ETZA 1DARA 3R9LA 1XR5A 5KGXA 3AODA 1S9FA 4WJBA 4JI0K 2WBRA 3M8ZA 1WG1A 4IQXA 3CCES 2ALZA 1FRIA 4MIBA 3LGMA 3QRRA 2R7UA 4TY8B 2PD1A 2BJ9A 4PY5A 2IM2A 4QIWD 1WSHA 4ES1A 4AXJA 3AVIA 2HQGA 5FPNA 2W9AA 4NZ0A 1HBOA 4OJRA 4J2AA 3ZLJA 3OLBA 3AVLA 4RW4B 3G9CA 3VAKA 2IIHA 3J81O 2WSFC 4AL5A 2VASA 4CJ7A 4JV2A 4YOYA 2I1RA 2QV6A 4RUHA 2I5JA 2NXEA 3M8SA 4M5LA 2E6MA 5D4LA 5KT7A 4O3QA 3GYXB 1DURA 2NPFA 3PYDA 4KV8B 5A8WB 1C1CA 1PCAA 1HNIB 1C2PA 4FWQA 3I5BA 3U3GA 2OELA 2HIQA 4HR2A 1S79A 3W64A 1RHRB 5B7WA 3ISZA 4BRFA 3A4TA 1OH6A 1Y4ZB 1V3RA 2JFKA 2KKZA 2WBMA 3V9SA 4BY9C 1QVFM 1FCAA 4DUZK 1NGIA 1DTTA 3QATA 1A5XA 3QJPA 2B5JB 3BQ2A 4YEAA 3IWLA 4QR1A 4F25A 2QO3A 5E33A 4JKGB 1VBXA 3AAWB 3J80Y 4ZP6A 4USJC 4C8KA 2CIMA 4H5NA 1UAXA 2AQ4A 4EUVA 1P6TA 3EKUA 4NYNA 3SMPA 2WVBA 1RTHA 4LF6F 1S6PA 1IKYB 4EK2A 3HCXA 3VEWA 4RW7A 5H9EK 2UYTA 2FVPA 1MNEA 3MPVA 3CC4N 3FMWA 4ILRA 4FWOA 1WB9A 1YTUA 1U02A 4LR8A 4JI8J 3KUEA 4EYIB 4P10A 5H1SV 3W0LA 4OKKA 2ROEA 2B6AB 4TKTA 5AE1A 3EE9A 1M5VC 1N5SA 1X9SA 2WZ1A 2HRYA 4UOCA 1H1VA 1CXQA 4LF9J 1YTAA 1RTJB 3AA8A 3BGOP 1NHVA 3P49B 4F0MA 4DPTA 1NAQA 1YJNN 1JXEA 3EO3A 4RNOA 5HQMA 1G4CA 2A10A 4HHUA 3CETA 4OLOA 2BOAA 2X3GA 4JI4J 1X5TA 1F3VA 3T6JA 4CIGA 1VQKN 3D2FA 3BB5A 1UCNA 3PZPA 4Z4EA 3R5JB 3PNIA 1RABB 2CPIA 2UUAK 2OH2A 4PXEA 2P9PB 2Z30B 2GHWA 3BV8A 3BBCA 1FXDA 5DG8A 2F9WA 3HPGA 1SC6A 1MWKA 2HOEA 4EIAA 2ZJQQ 3HI9A 2DBBA 1Y10A 1TKZB 4I56A 1HKAA 3M8QB 4O8KA 4GC6A 1BCMA 1XEZA 4DR1J 2UU9J 2ZD1A 2XB2D 4IKAA 2CYYA 2JEGA 3CCSN 4GKJK 5F2RA 3UI3A 4ZVOB 2JLGA 1ZBSA 2MKSA 4WFNL 3DRRB 4JI7J 2RNEA 1G6BA 3MN6A 2R8HA 3HHKA 3WEEA 3HSDA 1CLQA 4Z4IA 2E5LF 3CCQS 4KTZA 3PRVA 3CE8A 1NJZA 4BRKA 2IC3B 1FJEB 1YVFA 1ZM9A 1OPIA 3A8IA 2HQDA 2ZEJA 4FWSA 2ADBA 5CZ2A 4IRDA 1RISA 4RWTA 1UVMA 2I7PA 1KONA 3JSMB 4USVA 2C2DA 3KLIB 3Q7CA 1YWXA 4LJMA 2D0AA 4CHZA 1TUVA 4QWCA 1GMUA 1LOUA 1KKHA 4X62K 2UUCF 1NGDA 2Z1GA 1KOOA 3GYGA 1RYSA 1LWEB 4CZHA 2CH6A 2V51B 4AD6A 1U4BA 4CJSA 2QLFB 1JLEB 1CJUA 4O5FA 4P71A 5C2FA 3IMQJ 4LRAA 1RWVB 3M7VA 4MYUA 3LDLA 2WVCA 1HNXF 2GJFA 1KTQA 2PEHA 7FDRA 3CYMA 2FHJA 3VGKA 2LEAA 3HF5A 1YJUA 1VC0A 2MPUA 3WXMB 2PA8D 2HNZB 1GLLO 2DJWA 1SB6A 2PMHA 5ETQA 4O44A 3B6OA 3GR1A 4FPAA 2RQKA 3OHBA 1RDCA 4LF1A 4J91A 3DRSB 3G8TA 5LJWA 1UL3A 5CHIA 3CMQA 3LWMA 4KPYA 4RPFA 3VEZA 1VISA 2IDEA 1FKAF 3CJRA 4FP9A 3E51A 3QEVA 3D6FB 2YHBA 4JS5A 1YZ6A 2AHOB 3SAHA 4C8YA 2BKOA 4ZITA 1SQEA 4P2MA 3VTIA 1VQNN 2CUYA 4MK8A 3C2PA 2B7BB 4LFBJ 4H4KC 1QSSA 1FVQA 1X5SA 1KLNA 1YAGA 3D1OA 3LZIA 4U8VA 2N7YA 2FJDB 3Q8SB 4NEYA 2FDNA 3IR5B 1HARA 2VPWB 1VRTA 3BS9A 2KW4A 3PSFA 2HW3A 3CB4A 2BM1A 4PRFA 3UVJB 4DCHA 1RU2A 4M63C 2VQEF 3A8YA 5BYQA 4J8FA 1U1NA 5LL6d 4OL8A 3M5RA 5AQYA 4E7JA 4LFCF 2F63A 4DQ8A 1EP4B 3DOLB 3MEGB 1HPZA 1VRUB 4CT9A 3ZT1A 1WG4A 4GV6A 4I4BA 3CF5Q 4CRJA 3DXBA 1QHTA 3B8HA 2J7UA 1X5PA 2E1MC 5E3PA 1L3TA 2ATCB 3KYLA 1NLVA 3EWGA 1F2HA 1S4EA 4LF8J 3J7A1 3CULA 4LF6J 2EVZA 3MI7X 3T19A 4IJAA 2C2KB 2XHBA 2YNIB 3HLUA 1FWKA 1C4AA 3GU0A 4H5RA 5F0UA 4ERDA 4B9QA 4J9VA 1ZTWA 1EWRA 1REVB 5FLXO 5KFOA 4DUZF 3J7AP 2OFGX 4KH6A 3DYAA 2G8HA 4W5QA 4KHNA 3CCVS 3SUQA 5EXWA 4PYAA 3B4DA 2XZTB 3OR1B 5F3TA 2BJDA 5BYSA 2GEMA 4O5BA 3MMAB 3VA0A 5BR9A 3QGGA 3LTOA 1IWAA 4RW8A 2VG7A 1WAFA 3G82B 1JLBB 1A5VA 2QWQA 1K73O 3P1GA 3NOGA 4XDDA 3VALA 1TYQB 2KN4A 1UEUA 3SAGA 2ZQBA 4CP5A 4OI1A 4OLPA 1BQNB 1TZ0A 4ITSA 3NXZA 1JJCB 3WNFA 2GELA 3E01A 3LL3A 4FWLA 2DH9A 2QWNA 2G2YA 1H98A 3VQ7A 2HLUA 2HZVA 3OUYA 1F9HA 1YIJN 3K57A 3F9KA 4IFVA 3NVKA 4DTXA 2HFOA 3GBTA 1N5VA 3THXB 2GC8A 5KPZA 4MO4A 1IR2A 3QGPA 4W98A 3B82A 2IVYA 4LF4J 4B3TK 2ZC3A 1FW6A 3S7RA 2ZBRA 4E7HA 3W60A 3C14B 2M2BA 1HYSA 2GAGC 1JXLA 2HAFA 4X65K 1S97A 1HBOB 3MUVP 4KY3A 3R2CJ 1X9MA 4BDZA 2LYVA 2XI2A 4RL1A 1V