3SK3A

Crystal structure of salmonella typhimurium acetate kinase (acka) with citrate bound at the dimeric interface
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
398
structure length
385
Chain Sequence
SKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGGDIDPAIIFHLHDTLGMSVDQINKMLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Acetate kinase
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 133
structure length 385
sequence length 398
chains with identical sequence B
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A02
4JAXA 3EZWA 1NGCA 3VOVA 5BR9A 4RCHA 3O80A 5AQRA 4BVPA 1S3XA 3AARA 2QXLA 4BR0A 5ADXH 1NMDA 4A62A 1BA1A 1HKCA 1YAGA 2FSKA 4ISFA 4BR4A 4F9OA 2ZGZA 2OANA 3MDQA 4XH5A 1ZC6A 2EWSA 5AQHA 4CZMA 4WQ4C 4O5FA 4CZGA 4E1JA 2H3GX 5FPNA 2W40A 2V52B 3H1QA 3P4IA 4BQLA 1ATSA 3KVGA 3SJHA 1RGIA 1QHAA 3BF1A 3GG4A 1P8ZA 1WUAA 3EKUA 2V51B 1KXPA 2AP1A 3BEXA 1NGFA 4B1WB 4QS9A 3SMPA 3A5LC 2I7NA 1V4TA 3QDKA 5EX5A 2A3ZA 4BR9A 3ZX3A 1G99A 1RFQA 3H45C 4BRIA 2YCHA 1NBWA 5AQSA 1MA9B 2GWKA 4MLHA 2D1KA 4BRDA 1NGHA 5EXWA 1KAXA 3L6QA 1U6ZA 4H5VA 5KPZA 4H0VB 4CD3A 5F1XA 3O1BA 5AQGA 3VGLA 5E84A 2GTDA 1TYQB 2E2PA 2QWQA 3DAWA 4WYBA 5AR0A 4GY2B 1Z6RA 3JXUA 3ENHA 4JN4A 4MO5A 1DEJA 2P9SB 5EVZA 4XEIA 5ELZA 4BRPA 3H3OB 5AQKA 2E1ZA 3WXIA 5KQ8A 1J6ZA 5AQZA 1SAZA 4K43A 1GLLO 4NO7A 4BC3A 4BRLA 4JNEA 3H3NO 1KAYA 2QWPA 2ITMA 1TYQA 4BG8A 3AY9A 2IVNA 4FO0A 4H03B 3LDLA 4MO4A 1HJOA 4CZHA 3FGUA 2P9NB 2P9SA 3A8YA 4CZEA 4IZ9A 2I7PA 1EQYA 5BRHA 3H46O 1HKGA 1MWMA 2UYTA 3ZX2A 2PAVA 5AQYA 3C7NA 3J8AA 4HWIA 1BUPA 3FZHA 1HUXA 2P9NA 2E88A 3DXKB 1SZ2A 3GE1A 3WXKA 3WXLA 3OHRA 3CJ9A 1LCUA 4JD2B 5ADXA 4WQ4A 1ZXOA 1JCGA 2V7ZA 1R59O 1NGAA 2NLXA 5BRDA 3MMVA 4K42A 2FLOA 2KHOA 3DJCA 3LDPA 3WT0A 4CZLA 1BDGA 5BPMA 2CH5A 4A61A 3HI0A 3DXKA 3SLCA 1NGIA 3F9MA 3MK6A 3UKRB 2E1YA 4QS7A 5FPDA 3MN9A 4JD2A 4M7YA 2CGJA 3FFKB 3GDQA 2HMPA 1K8KB 3FZMA 3MN7A 5AQUA 3VEWA 2YHWA 2FF3B 1Y64A 3RSEB 3O08A 4EAHD 4ISGA 1Z05A 5BN9A 4BREA 3WQTA 3EN9A 3L0QA 2VCPA 3L4IA 2ASPA 3S41A 3HBTA 3GL1A 3W0LA 3R8EA 3VF4A 3VEZA 3FZLA 3UKRA 4H0YB 1BU6O 4BRHA 3ZX0A 4Z94A 4GNIA 5EOYA 1QQMA 4FWNA 1TUYA 4BRFA 1K8KA 1T6DA 2Q31A 3VESA 4BC5A 3RSEA 4B1UB 1MWKA 3G25A 5F2RA 3LDQA 3O8MA 2Q2RA 3VF2A 4B1ZA 3VGMA 3WXJA 2Q1NA 4FWOA 3MN6A 4BG9A 3HZ6A 3BP8A 3EO3A 1XUPO 4FL9A 5F0XA 1KAZA 2NRHA 3VENA 3IDHA 3A5NC 2E8AA 2GELA 5AQVA 2NZTA 2YJFA 5FPMA 3O5BA 3UB5A 1GLBG 4BC2A 3U4LA 4BRNA 4IXCA 3EKSA 4B1YB 3FZFA 3CI5A 5AQFA 2Q0RA 1SQKA 4AM6A 4PL8A 2DPNA 1HX1A 4WQ5A 1Q18A 1T6CA 2FXUA 2QWOA 5BRFA 1GLFO 4FWKA 3VEVA 4ISEA 4FWSA 3VETA 4K25A 1U2VB 4O8KA 4J8FA 1NWKA 3I8BA 2A40A 2D4WA 2QM1A 2J4RA 3CERA 4FWPA 3KHYA 5AQLA 4BRGA 3IMXA 1E4FT 4IJNA 1NGBA 5JLFA 1GLAG 3H1VX 2E2NA 3KZBA 4FWRA 5LJVA 5AZIB 1DGKN 2HF4A 2VYPA 3UE5A 3ZETB 3C7NB 2QW9A 2YI1A 1ESVA 4DCHA 1X9JA 3ATUA 4BGBA 2E20A 3I33A 2D0OA 3M1FA 4L3QA 3BUZB 1U2VA 3ATVA 4B1XB 4BRCA 2CH6A 3AAQA 4B1VA 4H0XB 4BC4A 4YDUC 5JLHA 1NGDA 4WQ5C 5AZIA 4BROA 3ZETA 4PKGA 4PL7A 4BR5A 3ULEB 5EY4A 1BWFO 4K41A 4CJ7A 3LM2A 4H5RA 3TPQA 4BRAA 2HF3A 1BA0A 4FWQA 1X3NA 5TKYA 3O6WA 3SK3A 4DHYA 5AFUA 1CZAN 4FSVA 1C0FA 3LL3A 4IJAA 5B8HA 4B9QA 5KQDA 1X3MA 1E4GT 3CQXA 5LJWA 2GWJA 2HOEA 4AM7A 5AQIA 4LC9B 3ULEA 3M6GA 4DB3A 3MCPA 2A5XA 4FOIA 1YUWA 5AQWA 3D7EO 1HLUA 3VGKA 1HPMA 3DWLA 2ASMA 3CHWA 3CQYA 3EL2A 2CGKA 2P9PB 1ATNA 3ID8A 1ATRA 5BPLA 4CBUA 4Y0WA 5AFUH 3QFUA 1OKJA 5KPTA 2PBDA 3R6MA 3WEEB 4DQ8A 4BR2A 4EHUA 3TU5A 1H1VA 2Q0UA 3A5OC 1JCEA 4M63C 3ENOA 3QICA 2FSJA 4H0PA 4MLEA 2W41A 4H5WA 4PKIA 2P9PA 1HKBA 3A0IX 3QB0A 4CZFA 4BQZA 3QMLA 2WUSA 2QWLA 4EFHA 1GLDG 3B8AX 3WEEA 3FR0A 3LDNA 2IIRA 3M3ZA 4H5NA 3LM9A 2VWBA 1ZBSA 3ZEUB 5JMVA 5I9EB 3MN5A 3QBWA 1T44A 3FLCO 1BO5O 3SMSA 1NM1A 2A41A 3GBTA 2V7YA 4KBOA 1DKGD 3CETA 1QZ6A 4BGAA 2F9WA 4FPBA 1WOQA 4IO8A 2P9KB 2F9TA 2YHXA 3ZEUA 2YHYA 3W3DA 4CD1A 4JHDB 3BF3A 2QWRA 3HSCA 3VEOA 1QZ5A 4FWMA 4YDUA 5KPRA 1V4SA 3A5MC 5BN8A 4CZJA 4A2AA 1BG3A 5AQQA 3FZKA 3IUCA 1XQSC 3O4WA 2QWNA 3WUHA 2P9KA 1BOTO 3IFRA 3CJ7A 1QQNA 2D0PA 3U9ZA 3AAPA 5AQTA 4IWVA 5CE3A 3VPZA 4NB4A 4JHDA 2ZGYA 1IJJA 1S22A 4XH1A 2A6AA 3R9PA 1LOTB 4CZIA 2AA4A 2GEMA 2BTFA 3DXMB 5LY3A 4BRMA 5AQMA 3O1WA 3H6EA 4BR7A 1D4XA 2Q97A 3VEYA 3U8XA 2QWMA 3WQUA 3CJ1A 4QS8A 1QQOA 3VERA 2ASOA 2IVOA 4H0OA 4A2BA 4RWTA 2P9LB 2Q36A 2ZWHA 4CBXA 2IVPA 2A42A 3DXMA 3HM8A 5FPEA 1GLEG 3QBXA 3D2EB 4I6MB 4CZKA 4EHTA 4PKHA 1JCFA 4BRKA 1XC3A 5AQJA 5BREA 1TUUA 3JS6A 3D2FB 1GLJO 5AQNA 2P9IB 5BPNA 3QFPA 3CIPA 5AZJB 4CI6A 4CBWA 4HTLA 3HTVA 1NLVA 1MDUB 1RDWX 5AQXA 2P9LA 4FOEA 2P9UB 3VEXA 4C23A 3LDOA 4FPAA 4EIAA 3CJCA 2E2OA 3UKUB 2GUPA 3D2EA 2FF6A 4I6MA 1C0GA 5JICA 3C0BA 3GOIA 1GLCG 4H5TA 3CJAA 5AQOA 2FSNA 2ZF5O 5AQPA 2E2QA 3D2FA 3CJBA 4M7XA 2P9IA 5AZJA 4RTFD 5E26A 2P9UA 1YVNA 2CGLA 1IG8A 1NGJA 4BRQA 2BUPA 3UKUA 1YXQA 1NGEA 4FWLA 4H0TB 4BVOA 3U9DA 3FE1A 1NGGA 3VF6A 4XH4A 2YJEA
chains in the Genus database with same CATH superfamily
3F2KA 3AA5X 1VHXA 1XNQK 4YOTA 3AO1A 4BR0A 1X9MA 2W6LA 5GAEP 3SCXA 2HNDA 4QAGA 4EP5A 4F3OA 3PX6A 4ISFA 3LP2A 4BR4A 1TVRA 2O8EA 4XH5A 3MDQA 4CJ4A 2EWSA 4CJQA 3AVAA 4C8MA 4WQ4C 4CZGA 4E1JA 2H3GX 5FPNA 3LP1A 4CGFA 4BQLA 4G1QA 2GX9A 3KVGA 3MXIA 4ELUA 1TL3A 1N6QA 3QEVA 1F21A 3BF1A 4B3RK 3P1GA 1W0HA 5LMUK 2NRRA 3DI6A 2YX6A 1NGFA 1HYZA 4CHNA 2A1SA 5EX5A 2DFHA 1D5AA 2A3ZA 1XWLA 4FLUA 1X9WA 2P1JA 4GMJB 4X65K 3T1HK 2AJQA 2YCHA 2FBXA 1MA9B 3LANA 5EXWA 3PUFA 4ILJA 5C25A 5DMRA 3BZCA 3KLHA 5KPZA 5F1XA 4IFYA 4LY7A 5AQGA 4DR7K 2E2PA 3DAWA 2JLEA 3OTOK 4DR6K 1Z6RA 1DTQA 1DEJA 3I0RA 4FM2A 2W6KA 3WXIA 5KQ8A 4RG8A 1J6ZA 5AQZA 3D0PA 4DV2K 1KLNA 3C6HA 5CZ2A 4M3XA 4B8CA 1LAWA 2ITMA 2NRZA 3U3YA 3L2RA 3J7ZO 1RT7A 4MO4A 1HJOA 3FFIA 4BE2A 2P9NB 2F8TA 4DU3A 4DF4A 1JLFA 3OBWA 3ALYA 1FXXA 3KD5E 4E0DA 2FBYA 2I7PA 4ILGB 4YOVA 1YVUA 1HYSA 5BRHA 3H46O 3T19A 1NK7A 5C12A 1EO1A 4AHSA 4ZTFA 3LPUA 3OS2A 2D0BA 4HWIA 3I55N 5C10A 3EZ5A 1BUPA 2OTLN 4DTUA 3DRSA 1SZ2A 3OHRA 3CJ9A 2G8UA 4CVNE 2O8CB 4JD2B 5ADXA 1ZXOA 1JCGA 1L3UA 1NGAA 4Z0UA 4I9QA 4LF6K 3LDPA 1VQ7N 3WT0A 4CZLA 4CF1A 5D3GA 2UXCK 4NCAA 3DXKA 1C0MA 2Z1GA 4YNQA 4HHTA 3FFKB 3FZMA 4DSLA 4IFEA 5C2DA 4DS4A 2D5RA 2FF3B 1XMOK 2YKMA 1VSFA 4EAHD 4KTZA 4BREA 3L4IA 3EE8A 3L2WA 2RHKA 3VEZA 3FZLA 4OGEA 4JKHA 3E9PA 1YF5L 2NRVA 1BU6O 2X6SA 4BRHA 4Z94A 3THWB 5EOYA 1BHLA 1B9DA 4JKGB 3VQDA 4M3WA 1JKHA 5M1OA 1BI4A 2UXBK 3LDQA 1KD1O 3VF2A 4B1ZA 2X78A 2HHSA 3DLKA 4A5AA 2UUCK 4FWOA 3EEQA 2PYJA 4DR4K 3SPYA 2OYQA 1VSDA 4ZHRA 2QI2A 2UXDK 3PX0A 1K8AO 3VENA 1DTTA 3CCUN 1OH8A 3A5NC 2GELA 4PHTX 4DQRA 2YJFA 5KGXA 3O5BA 4BWMA 4M3RA 4BRNA 5JVHL 1ASUA 1HR0K 5C0YA 4KHYA 3L8BA 3FZFA 4KO0A 2ZE2A 4CFAA 2Q0RA 5MLCQ 4CJWA 1Q18A 1QVGM 4CJ3A 1GLFO 3AVIA 3VEVA 4ISEA 1LWEA 3E9OA 4CCHA 4K25A 2KW4A 4IG0A 4J8FA 3CERA 5AQLA 1YI2N 3AVBA 1QVFM 1NGBA 2IGIA 3KZBA 4FWRA 4BDPA 3UE5A 4UQGA 3C7NB 3WNGA 4FM1A 3DLGA 3EY1A 2E20A 4DQIA 4L3QA 3BUZB 1U2VA 3ZT1A 2DFFA 4O0IA 4Z4FA 4RW6A 4NCBA 4BC4A 4FZYA 4FJ9A 4WQ5C 5TKWA 3ZETA 4PL7A 5BR8K 1NJWA 1VQLN 3CFPA 1RDBA 2HBKA 4K41A 3SZ2A 1QQCA 3DLRA 4H5RA 3TPQA 4BRAA 1QTMA 2HVHA 2HF3A 4N5SA 4Z4EA 3G6EN 3HM9A 1BA0A 4FWQA 5TKYA 3SK3A 3O6WA 3RMBA 4E1NA 5B8HA 5KQDA 1X3MA 5LJWA 3NF7A 2GWJA 4KH4A 1C6VA 4AM7A 4B9LA 5AQIA 3OYBA 1VSLA 4DB3A 3VTHA 5AQWA 3D7EO 1HPMA 4WFBL 3DWLA 3I56N 2HVIA 3M8QA 1MU2A 3EL2A 3QIOA 5IWAK 1CLQA 4N47A 3ID8A 3L2UA 4CBUA 4O44A 4RW4A 3QFUA 4IO9L 2HNZA 2PBDA 3R6MA 3WEEB 2QTDA 3KK2A 4CEDA 2BANA 1RT3A 3VQ8A 1QSLA 1RDCA 3V9XA 2YV0X 1JXEA 3SBTA 4H0PA 4MLEA 1T7PA 2KFZA 1HKBA 3V1RA 1RT1A 1NJXA 4AHVA 2P5OA 3QMLA 2QWLA 4EFHA 1GLDG 2PFUA 1D8YA 2E6LA 2YHBA 4HUGA 4KHSA 1YITN 3ZEUB 1J54A 1FK9A 3CCMN 1GOBA 5HOOA 3SMSA 1C0UA 4GV3A 5GIOA 4KBOA 3DM2A 1W9HA 4EZ9A 1VQ8N 4FW2A 3LZIA 1VSJA 1WOQA 4FZZA 4MDBA 3LWMA 3VQ5A 1TK5A 2YHXA 2YHYA 1YJWN 3W3DA 3MAQA 5FRNA 4CIGA 2QWRA 3OJSA 3TAEA 3VEOA 4ZTJA 1V4SA 3T69A 5BN8A 1JLBA 5AQQA 3T7ZA 3FZKA 3O4WA 1HNWK 1BOTO 1IBKK 1QQNA 1TGOA 3HPOA 5AQTA 3VPZA 3ZT2A 3QERA 1S22A 2XY7A 1O13A 3RMAA 4JI5K 5KI6A 1LOTB 3KIOA 3V6DA 4FJXA 3TTDA 1RCHA 4DSIA 3NBPA 4BR7A 4N76A 2Q97A 4PY5A 3U8XA 4X66K 4J2EA 1QQOA 1T05A 1IG9A 4RWTA 4CBXA 3TI0A 2A42A 1KTQA 3MEGA 1GLEG 1ITGA 4CZKA 4AHTA 4IOAL 4KFBA 4PKHA 1BISA 1XC9A 1NOZA 4CESA 2HBJA 3KLFA 1GLJO 3OVNA 5AQNA 4DTXA 3O9RA 5AZJB 4CI6A 3QINA 1KQSM 3HTVA 5CY4A 4LF5K 4O55A 3AVCA 1RDUA 3LDOA 4FPAA 3CJCA 3UKUB 1FJGK 2GUPA 3ITHA 2FF6A 4DSJA 5C24A 2ZQBA 3JYTA 2FSNA 3E01A 3TAMA 3D2FA 3CJBA 1GOCA 3G0ZA 2OZMA 4DV4K 2Z1HA 1IG8A 4KRFA 1NGJA 4BRQA 3IG1A 4LD0A 1WSIA 4H0TB 3HSTB 4DR5K 4H4OA 2O8EB 1NMNA 4IEIA 4XH4A 3EZWA 1KLMA 1U49A 2ZJQL 3NFAA 3O80A 5AQRA 4CJ5A 1HNIA 2ITGA 3G4SN 1IV0A 1HQUA 1WBBA 3DRPA 4FLYA 1SL2A 2YKNA 1K73O 3O9SA 1HKCA 1JJ2M 4CHYA 2OANA 1ZC6A 4AHUA 4CEZA 4KREA 3H1QA 1ATSA 2HHTA 3OYAA 2JWLA 4IOCL 1QHAA 3OJUA 3E1YA 1LW0A 1P8ZA 4FJ7A 3NH0A 3HL8A 3EKUA 3DLLL 4DKWA 2AP1A 3ZSVA 1WSFA 3NDKA 1W7AA 3A5LC 3O3GA 3QDKA 1V4TA 1NKBA 1VQ4N 3ZX3A 4DFKA 2HBLA 4I9LA 4E7KA 1RFQA 4FJHA 2D1KA 1J9AA 4YOYA 1KAXA 1U6ZA 3O1BA 1XHXA 5E84A 2GTDA 1EX4A 4WYBA 1IKVA 3MX2A 2VG6A 4GY2B 4LH5A 4OLBA 5HP1A 4JN4A 2DTUA 1N5YA 4A5BA 2OPQA 1S5JA 3R1XA 3H3OB 4GVEA 4F2SA 5GAHP 1CZBA 3KK3A 5M1KA 4BC3A 4HCCA 4CJTA 4BRLA 4DV6K 2IAJA 4ID1A 2XY6A 1C1CA 1KFDA 4WE1A 3LZJA 4CIFA 4GV9A 2IVNA 4FO0A 4DLGA 3AVHA 5GIPA 3OYKA 3QESA 3LDLA 4CJSA 1YTUA 3VMFB 4EZ6A 5GAGP 2P9SA 3TAFA 4CZEA 1IBMK 4IZ9A 4F8RA 1E3MA 1EQYA 1ZBLA 4CGJA 1HKGA 2UYTA 3DYAA 2WFBA 4FJ5A 4DTPA 5AQYA 2ZD1A 4C1NI 4DWIA 2OPSA 1HUXA 1WLJA 5C15A 5JS1A 3DXKB 4J2BA 1BIUA 3T1YK 4CJKA 1X9SA 1NKEA 2RE2A 1ZBIA 3VQAA 1R59O 3L3VA 1VSHA 4B9SA 3DJCA 4JRQA 3BGRA 3SJJA 4CF0A 4A61A 3HO1A 1WAJA 4DQPA 4OKEA 3CF5L 3F9MA 4W5TA 4QS7A 3NF9A 5FPDA 4M7YA 1YHQN 2HMPA 3B6PA 1ZBHA 4BE0A 3MN7A 5AQUA 2YHWA 5C2FA 3O08A 4ISGA 1FKPA 3SBGA 4FLXA 3OYFA 3WQTA 1BI4B 1SUQA 3LAMA 3S41A 4JKAA 3S9HA 3GL1A 5M1PA 3SV4A 4JI6K 3SUOA 1L3SA 1SKWA 2KFNA 2E5LK 4LFBK 4JI1K 4GNIA 4IG3A 4WFNL 4BRFA 1TUYA 1I3AA 4LFCK 3NAEA 4OKJA 1L5UA 3O8MA 4CJVA 1RDAA 4CEFA 1S1TA 3VGMA 1A5WA 1CZ9A 1NK0A 3BP8A 4B8AB 4KH6A 5CZ1A 3IDHA 4B3SK 4FLTA 4IFVA 2HW3A 5FPMA 3VQEA 3N4PA 4BC2A 1JLAA 2HHUA 1B92A 3TSQA 4LF4K 2F4VK 3CI5A 1UAXA 1GOAA 3WNHA 1SQKA 2WONA 3AVKA 1NK6A 3V1QA 1HX1A 3OYMA 1NK8A 3SQ1A 2FXUA 1NK4A 4FWSA 3VETA 1VQ6N 4MDAA 1U2VB 4O8KA 3THXA 1NWKA 3MECA 1TV6A 2QM1A 2J4RA 4CHPA 3S3OA 3IMXA 1ILYA 2GBZA 4IJNA 4E19A 3CCRN 5JLFA 3C6UA 4KPYA 3V1OA 2YNIA 4CF2A 1DGKN 3ZETB 2EHGA 4YOUA 4DCHA 5C42A 2IDOA 3M1FA 1NOYA 3ATVA 2G8HA 4PWDA 3HOSA 4B1VA 3V9WA 4M3ZA 1NGDA 3LP0A 4IDKA 4BR5A 1BWFO 3QIPA 4CJLA 3LALA 4JI0K 4WFAL 4OPKA 4OPHA 4FSVA 5AFUA 1C0FA 4KI4A 4DR3K 3SQ2A 1XHZA 3V9UA 4NXNK 4HTUA 3T1AA 3CCSN 4HVJA 4FK4A 4E3SA 3CQYA 4OGCA 1SL1A 3ZSRA 1VQON 4H8KA 2O4GA 3ZSWA 5AFUH 4JYAK 3U6FA 4BR2A 3CM5A 4JI4K 1EETA 1N34K 3RR7A 3P31A 3A5OC 1JCEA 4M63C 1QS4A 1T03A 1KVAA 2FSJA 4B9TA 4JRPA 4LH4A 3PIPL 5T7BA 3AVFA 4PKIA 3QB0A 2HBMA 3VQ4A 1HNXK 2WUSA 4W5RA 3B8AX 2IIRA 4IBNA 4FJMA 1ZBSA 2WC9A 1NG9A 5I9EB 3SQ0A 3O9QA 2LSNA 2FBTA 1BO5O 2XHBA 1XNRK 1NM1A 3DMJA 4DG1A 1Q82O 2F9WA 2YNFA 1RTHA 4HUEA 1U04A 1RBUA 4FVMA 1I94K 1G15A 3VQPA 3NGIA 4YDUA 3A5MC 1P90A 1T3VA 1KSPA 4DTOA 3UIQA 4A2AA 1BG3A 3C6AA 4YORA 4JK9A 3WUHA 4JKCA 4K8ZA 2D0PA 3TAPA 4JHDA 4DU1A 3ASMA 3O4NA 4XH1A 2A6AA 3JAMO 1QHTA 2IC3A 4CZIA 1RTJA 3HPHA 5AQMA 3KWIA 4LSLA 1QE1A 3C6TA 4ELTA 2B4JA 3BDPA 3CCQN 2QWMA 1RBSA 4FZXC 2FC0A 2O8FA 2RN2A 3RRGA 4DSFA 4AF1A 1XMQK 1Z25A 3SAHA 3DXMA 3QBXA 1VQMN 4YY3K 1VAZA 4BRKA 1TUUA 3JS6A 1ASVA 3M5RA 4BWJA 3K0SA 1J5OA 3D2FB 2WOMA 4R79A 1RBVA 4JI7K 1WSJA 1MDUB 1TL1A 4FOEA 1NK9A 1W2BM 1N36K 1EWRA 3AGRA 1VSKA 3G71N 4I6MA 2KKZA 1C0GA 3MEDA 5JICA 3HPGA 3RTVA 4B9NA 3IAYA 3GOIA 1S1VA 5AQPA 2E2QA 1NNEA 4NYNA 3CPEA 3NVKA 5FLXO 2HSTA 1JLEA 4OJRA 2CGLA 5J1EA 1HNVA 2OCEA 3F5TA 1NGEA 1QSYA 3PSFA 1Q86O 4BVOA 4OPJA 3U9DA 5HROA 5KTQA 3R3LA 4FLWA 4LF7K 4KI6A 4M41A 2YJEA 4JAXA 3O3HA 3VOVA 3RMDA 5BR9A 4RCHA 4BVPA 3NHGA 1S3XA 3AARA 1EXQA 2OPRA 3DLBA 1BA1A 2RKIA 1YAGA 3OS0A 4F3TA 1NJIO 2ZGZA 1KC8O 1NKCA 1J5EK 4OLAA 1Q9YA 3TTFA 5AQHA 4CZMA 1VSIA 4E89A 2W40A 3AO5A 4FW1A 3J80O 4B3OA 3SJHA 1RGIA 2Z1JA 3Q7BA 2QXFA 3OW2M 3GG4A 1EKEA 4X62K 1ZYQA 1VSMA 5GADP 1KXPA 1UA0A 3BEXA 4FJ8A 4DV7K 2I7NA 3D6RA 1M1KO 3CCJN 4B08A 1G99A 5K14A 3KLGA 4CEOA 3IRXA 3H45C 1SV5A 1NBWA 5AQSA 4PQUA 1N32K 3E66A 2HHQA 3MWPA 3NVMA 2YNGA 4JI2K 2E4LA 5FRMA 4CK2A 3MCAB 3ZSYA 4JS5A 3MXMA 4GKJK 5AR0A 3ZSOA 3AO3A 4CJPA 3KWGA 3P39A 4L8RB 3ENHA 5EVZA 2P9SB 3ZSXA 3HK2A 5ELZA 2BE2A 4KB0A 2HHXA 4Z4CA 3DOLA 4K43A 4JKEA 4BDYA 5J2PA 4NCGA 1W97L 4JNEA 2XY5A 4DV5K 1TYQA 3PY8A 3FGUA 5H1SQ 3OYHA 1O1WA 4DTSA 3C65A 3F9KA 3HVRA 1IBLK 1S6QA 3P5JA 2G8VA 2PAVA 1QSSA 3THYA 2XRIA 2QK9A 3C7NA 3RVCA 4KHWA 1OH5A 3FZHA 2BH1A 3WXKA 3PIOL 3KLIA 4E1MA 4NLBA 2V7ZA 3M8PA 3MMVA 2WBNA 4K42A 4B3TK 2KHOA 4FJGA 3NGZA 1BCOA 1RTDA 1BDGA 3VQCA 5BPMA 3HYFA 3SAFA 3HI0A 3SLCA 1NGIA 3HXMA 2F7TA 3N4QA 4DR1K 2HB5A 2CGJA 3GDQA 5CYMA 2PYLA 3VEWA 1T8EA 1Z05A 4Q5VA 3SNNA 3EN9A 4B3MK 3W0LA 1BL3A 2VCPA 2ASPA 3L0QA 1LAVA 3HBTA 3OA9A 3DLHA 3TANA 3UKRA 3MEEA 1S9EA 2NUBA 3E9LA 4ELVA 1QQMA 1YIJN 1CXUA 1K8KA 2Q31A 3VESA 4BC5A 1C0TA 3RSEA 4B1UB 1MWKA 1RDDA 1WSEA 3IKMA 5F2RA 2NRXA 1TAUA 2P5GA 4YOWA 4CHOA 3ZSQA 3VQBA 2NRTA 1OVYA 3BY5A 3SYZA 1UA1A 2OZSA 4YFUA 3IS9A 4KTQA 4BG9A 4E7IA 3HZ6A 1BQNA 4FL9A 4RW8A 2NRHA 3QLHA 4QOZB 3HT3A 2BGGA 2E8AA 5AQVA 3CQ8A 3THXB 3VQ9A 3TWHA 3ZT4A 1GLBG 3U4LA 3K5MA 2GUIA 1RT6A 3M8SA 1ZBUA 3K9KA 3AVLA 5LMNK 4GV6A 4JS4A 4AM6A 4OVLA 4WQ5A 3PLAA 1T6CA 4O4GA 3CMAN 1RT4A 2QWOA 4IEEA 3SUPA 2X74A 1C1AA 4N56A 4CHZA 3J7AP 2EX3A 3J81O 2HHWA 4JK7A 3I8BA 2A40A 2D4WA 4FWPA 2D0CA 5M1NA 4BRGA 4DFPA 1EWQA 3P38A 1E4FT 5AJ3K 1HNZK 4FLVA 4UY8O 1GLAG 3H1VX 2E2NA 5LJVA 3CXCM 4CFDA 4XIUA 2QW9A 2YI1A 1X9JA 5IT9O 3K5LA 2D0OA 1RTIA 3CYMA 3WNEA 2F8SA 2B5JA 4IKFA 4DUZK 1VK0A 3AAQA 4JKBA 4LSNA 1S1XA 3BZKA 1KVCA 4YDUC 5JLHA 1JXBA 5AZIA 3MXJA 4RW9A 2OTJN 5EY4A 1Q8IA 3QNOA 4CJ7A 3ULDA 3LM2A 3T3FA 4M45A 2KTQA 4J2AA 3DLEA 1BGXT 3LL3A 4K0KK 4Z4HA 1YJNN 3CQXA 2ZJRL 1TKTA 2HOEA 3AO4A 3LP3A 3ULEA 4CK1A 3M6GA 4DF8A 3MCPA 1L3TA 1HLUA 4DTJA 3CHWA 2B6AA 4FJLA 3SV3A 2F96A 3VA3A 3SAGA 1RILA 1ATNA 4KH5A 3HVTA 2HMIA 1OKJA 4KHQA 4CEEA 2UUBK 3MWTA 4PA1A 4CJRA 4EHUA 1H1VA 2Q0UA 1HPZA 4B9UA 5KRTA 2VG5A 2G8FA 3OYGA 3OYNA 3ZT0A 4H5WA 4CEAA 2P9PA 3A0IX 1CXQA 4CZFA 4BQZA 1RBTA 4FJKA 4KKOA 4CE9A 3FR0A 3M3ZA 4H5NA 3TR8A 5JMVA 4DS5A 2VQFK 3FLCO 1S72N 4CIEA 3OYEA 3L2VA 4JI3K 2A41A 2V7YA 1JL1A 3NF8A 4YOXA 1DKGD 1S6PA 1QZ6A 3CETA 3LAKA 4BGAA 1U47A 4DMNA 2O8DA 5HRSA 4IO8A 2F9TA 4DSKA 2NNWA 4M3UA 2PY5A 2I5JA 4JHDB 1REVA 2PZSA 4JI8K 1U4BA 3HSCA 3VQ7A 1OH6A 5KPRA 1QZ5A 4FWMA 4CZJA 2RF2A 3TAQA 3G10A 2JWKA 4EP4A 3IUCA 1XQSC 1VQPN 2P9KA 3CJ7A 2A1RA 3QETA 1WN7A 4AHRA 4IWVA 4NB4A 2O4IA 1IJJA 3S3MA 3I8DA 2O8FB 4Z4IA 1S9GA 3PO5A 3R9PA 3ID6A 4HCBA 3VA0A 4N41A 2AA4A 2GEMA 3DXMB 4DV1K 3THVA 1K9MO 5LY3A 4BRMA 3O1WA 3O9TA 4B9VA 3CMEN 3H6EA 4DV3K 1D4XA 3AA4A 2XO7A 1K6YA 2G8KA 3CJ1A 3VERA 4YHHK 4H0OA 2IVOA 3LDSA 4B9MA 4A2BA 2ZWHA 2IVPA 5FPEA 2KQ2A 4I6MB 4M3YA 1U48A 3JSMA 3PSIA 2UU9K 3OYCA 5AQJA 1X1PA 4CJFA 1SL0A 4H4MA 4W5QA 3F73A 3QFPA 3CIPA 4CBWA 4HTLA 3NH1A 1NLVA 1Q7YO 1VQ5N 5AQXA 2P9LA 3VEXA 4C23A 2X6NA 1BCMA 2O8BA 3DRRA 2E2OA 3D2EA 3C0BA 3QEIA 4H5TA 3CJAA 2G8WA 1J53A 2ZF5O 3KK7A 2P9IA 3KK1A 5E26A 3OYDA 4JK8A 4DLEA 2P9UA 1VRUA 3K2PA 1VRTA 2W42A 5CHIA 1NJZA 4R5PA 4HUFA 3FE1A 3VF6A 3PX4A 4Z4GA 1NGCA 1S1WA 3AVMA 4AHCA 3ISNC 4DUYK 1KVBA 1A5XA 3OYLA 3K57A 4CEQA 2QXLA 1YT3A 5ADXH 4F2RA 5SZTA 4DR2K 1NMDA 4A62A 4J2DA 2Y1IA 4M3TA 4DV0K 2FSKA 4FLZA 4F9OA 4C8LA 4AILC 4V19S 1RNHA 4CJUA 1I39A 4KHPK 4E7HA 4O5FA 5M1QA 1LW2A 1Z26A 3OBYA 2P51A 2V52B 3KLEA 3P4IA 3SPZA 1EP4A 1C1BA 1NK5A 1N33K 2DFEA 4CGDA 3CFOA 3CC4N 2Y1JA 4I2QA 2HHVA 1WUAA 4CFBA 2KZMA 4GW6A 2V51B 2ZM6K 3KD1E 4GKKK 4B1WB 4QS9A 3SMPA 1R0AA 1NJYA 2KZZA 3ZT3A 3RR8A 1OVQA 1ZBFA 4E7JA 1HMVA 2NRWA 4FK2A 4BR9A 3EYZA 4IOXA 4BRIA 1ASWA 4WCEL 2GWKA 4MLHA 4BRDA 4A59A 1NGHA 3L6QA 2VGNA 4H5VA 3QEPA 4H0VB 1TKXA 2ZJPL 4CD3A 3HOTA 3QEWA 3MX5A 3ZLJA 3VGLA 1TYQB 4I7FA 2QWQA 5HRPA 4Q0BA 5HRRA 3JXUA 4MO5A 2QEXN 1UWBA 4XEIA 4BRPA 4C8KA 5AQKA 2E1ZA 1SAZA 1GLLO 4NO7A 4CJEA 4DTNA 4W5NA 4O0JA 3H3NO 1KAYA 3THYB 2QWPA 4A57A 4BG8A 3AY9A 1KFSA 4H03B 5I3UA 2XY8A 4CZHA 1KCFA 4CGHA 3A8YA 3M8RA 1D9DA 4M42A 3TTCA 2WTUA 4JLHA 5FDLA 1S1UA 3L3UA 5CR4A 4KV8A 4KAZA 4FJNA 3V9SA 2IOCA 1MWMA 2OA8A 3ZX2A 4GVMA 3J8AA 1B9FA 3NF6A 1TK0A 1NU0A 2P9NA 5E41A 2E88A 3GE1A 3WXLA 3NMUA 3AVJA 1LCUA 5DM6L 4CF8A 4OPAA 4WQ4A 1Q81O 4FXDA 2NLXA 5BRDA 4W5OA 1DT9A 3O3FA 2FLOA 2CH5A 1A5VA 3AA3A 3CCVN 3TSUA 1WNSA 4C1NK 1LV5A 1LWCA 2Q3SA 3MK6A 3UKRB 1WAFA 1Y97A 2E1YA 3MN9A 2O8CA 4JD2A 3S3NA 1K8KB 3LWLA 1Y64A 3RSEB 3CCEN 4TSXA 4BACA 1IKXA 5BN9A 4CECA 4BE1A 3R8EA 3VF4A 3ZSZA 4MQ3A 4H0YB 3V81A 3CC7N 3ZX0A 2D0AA 3DOKA 1VSEA 4FWNA 2DY4A 1T6DA 2BDPA 3V4IA 2UUAK 1YJ9N 3KTQA 3G25A 4AH9A 2Q2RA 3NCIA 1XI1A 3WXJA 2Q1NA 3KKSA 1U45A 4CEBA 3MN6A 3THWA 3K59A 2G8IA 3EO3A 1XUPO 5F0XA 1KAZA 1TKZA 3AV9A 2GV9A 1HJRA 5LL6Z 3PV8A 4JKGA 3OS1A 2NZTA 3UB5A 5KGWA 4IXCA 3EKSA 4B1YB 3C95A 4G9ZA 4NYFA 4KTWA 5EU7A 4IDHA 3ENBA 5AQFA 1TK8A 1BQMA 4PL8A 2DPNA 1HYVA 3QNNA 5BRFA 4FWKA 4FM0A 3L2QA 4OX9K 4KHUA 1RT5A 3WNFA 4CK3A 4AQYK 3RRHA 4MFBA 3KHYA 4C8NA 3TAGA 5CYQA 5HL7L 5AZIB 2HF4A 2VYPA 1TAQA 1ESVA 5JS2A 3ATUA 4BGBA 3A2FA 2E6MA 3I33A 4FYDA 3Q7CA 1RBRA 3AA2A 4B1XB 4BRCA 2CH6A 4OKKA 4CFCA 4NXMK 1WB9A 1JLQA 4H0XB 4X64K 4ICLA 2YHAA 3VTIA 5I42A 4BROA 4FCYA 4PKGA 3ULEB 4CGGA 1YTAA 3CC2N 4JV5K 3K5OA 4ILHA 1X3NA 3AO2A 4DHYA 1CZAN 1WSHA 4IJAA 3ZYYX 4B9QA 1Q9XA 3OYJA 1E4GT 1JLCA 3OY9A 4DSEA 4LC9B 3B6OA 2VQEK 4FOIA 2A5XA 1YUWA 5J2MA 3VGKA 2ASMA 1WBDA 1DLOA 4LF9K 2QA4N 3AGKA 3NE6A 2CGKA 2P9PB 3K5NA 5BPLA 1ATRA 1D9FA 4Y0WA 3SQ4A 4FJIA 2JGUA 5KPTA 3NH2A 4DQ8A 1IKYA 2KLAA 2HNYA 3TU5A 1JL2A 3NGYA 4Y1CA 3HP6A 4DFMA 3ENOA 1L3VA 1RT2A 4O5BA 2R7YA 4FK0A 4JEPA 3AVGA 3QICA 5J2QA 3K58A 2W41A 1HRHA 1VQ9N 2ETJA 5DM7L 1KRPA 4FVUA 4Y1DA 3I0SA 4JKFA 4OO1J 1TKDA 3WEEA 3KJVA 3LDNA 2O8DB 5M1FA 3LM9A 2VWBA 4CHQA 1OH7A 1SS6A 1JLGA 2QKBA 3MN5A 3CCLN 3CD6N 3QBWA 1T44A 3SUQA 5J2NA 5DK5A 3AVNA 4CGIA 3GBTA 2VGMA 4O8UA 3CFRA 2YNHA 1M90O 3WXMB 3VQQA 4FPBA 4E7LA 2P9KB 3CPWM 5HLFA 3ZEUA 5KRSA 4DFJA 5HBMA 4F4KA 4CD1A 4DQQA 3SI6A 4U67L 1HQEA 3BF3A 2QKKA 3TSPA 4DTMA 5FROA 3VN5A 4CF9A 2HHHK 3HRGA 2QWNA 1VQNN 3IFRA 3U9ZA 1BIZA 3AAPA 5CE3A 1WSGA 2ZGYA 5A2QO 4DTRA 1SKRA 5SWMA 3ZCMA 4KB1A 1IH7A 3RWUA 4U7BA 2BTFA 2VG7A 3D45A 3LPTA 4DU4A 1LWFA 3C94A 3TARA 4LF8K 3J7YP 1VQKN 3VEYA 2IS3A 3WQUA 3SUNA 4QS8A 4JKDA 3HJFA 2ASOA 2P9LB 2Q36A 4FJJA 4K8XA 4CERA 5GINA 3HM8A 3L4QA 3HP9A 2O8BB 3D2EB 3O9UA 3RMCA 4EHTA 1FW6A 4LFAK 1IO2A 1JCFA 3O4QA 5JVGL 1XC3A 5BREA 4I2PA 3H08A 3TABA 2ATQA 4QCLA 2P9IB 5BPNA 2Z1IA 3OYIA 2VWKA 1RDWX 2OPPA 2P9UB 4WF9L 1IKWA 4EIAA 3EE9A 3V9ZA 3QO9A 4BY9C 4C8OA 2VWJA 1UOCA 3P83D 3PO4A 1GLCG 5AQOA 3VQ6A 4CW7B 1SKSA 2RPIA 4M7XA 4NLCA 1FKOA 5AZJA 3K9JA 4RTFD 1YVNA 4KHNA 2BUPA 3KKRA 3UKUA 1YXQA 4DQSA 4FWLA 1N8RO 3CM6A 3U3GA 3QEXA 4PUOA 4ID5A 5HRNA 1NGGA 3CG7A 4RW7A 2FBVA 4BDZA
chains in the Genus database with same CATH topology
4JAXA 3EZWA 3F2KA 1NGCA 3VOVA 5BR9A 2ZJQL 4RCHA 3O80A 5AQRA 4BVPA 4YOTA 1S3XA 3AARA 2QXLA 4BR0A 5ADXH 3G4SN 1NMDA 4A62A 1BA1A 5GAEP 1K73O 3O9SA 1HKCA 1YAGA 2FSKA 4ISFA 1JJ2M 4BR4A 4F9OA 1NJIO 2ZGZA 2OANA 3MDQA 4XH5A 1KC8O 1ZC6A 2EWSA 3TTFA 5AQHA 4CZMA 4WQ4C 4O5FA 5M1QA 4CZGA 4E1JA 2H3GX 5FPNA 2W40A 3OBYA 2V52B 3H1QA 3P4IA 2GX9A 1ATSA 4BQLA 3KVGA 3SJHA 1RGIA 2JWLA 3Q7BA 1QHAA 4IOCL 3BF1A 3E1YA 3OW2M 3GG4A 1P8ZA 3CC4N 1WUAA 3EKUA 2V51B 2NRRA 3DLLL 4DKWA 5GADP 1KXPA 2AP1A 2YX6A 3BEXA 1NGFA 4B1WB 4QS9A 3SMPA 3A5LC 2I7NA 1V4TA 3D6RA 3QDKA 2NRWA 5EX5A 3CCJN 1M1KO 1VQ4N 2A3ZA 4BR9A 3ZX3A 1G99A 4IOXA 2HBLA 1RFQA 3H45C 4BRIA 4WF9L 2YCHA 4WCEL 1NBWA 5AQSA 1MA9B 2GWKA 4MLHA 2D1KA 4BRDA 3E66A 1NGHA 5EXWA 3MWPA 4A59A 4ILJA 1KAXA 3L6QA 1U6ZA 2VGNA 3NVMA 4H5VA 5KPZA 4H0VB 2ZJPL 4CD3A 5F1XA 3MCAB 3O1BA 3HOTA 3MX5A 5AQGA 3VGLA 5E84A 2GTDA 1TYQB 2E2PA 2QWQA 3DAWA 4WYBA 5AR0A 3MX2A 3KWGA 4GY2B 3P39A 1Z6RA 3JXUA 3ENHA 4JN4A 4MO5A 1DEJA 2P9SB 5EVZA 2QEXN 4A5BA 4XEIA 5ELZA 4BRPA 3R1XA 3H3OB 4GVEA 2E1ZA 5AQKA 5GAHP 3WXIA 5KQ8A 1J6ZA 5AQZA 5M1KA 1SAZA 4K43A 1GLLO 4NO7A 4BC3A 4BRLA 4JKEA 3W0LA 1W97L 4JNEA 3C6HA 3H3NO 1KAYA 2QWPA 2ITMA 1TYQA 4A57A 2NRZA 3AY9A 2IVNA 4FO0A 4BG8A 4GV9A 3J7ZO 4H03B 5GIPA 3LDLA 4MO4A 3VMFB 1HJOA 4CZHA 3FGUA 5GAGP 2P9NB 5H1SQ 2P9SA 3A8YA 3OBWA 3C65A 4CZEA 4IZ9A 3TTCA 2I7PA 4ILGB 4YOVA 5CR4A 1EQYA 5BRHA 3H46O 1HKGA 1MWMA 2UYTA 3ZX2A 2WFBA 2PAVA 5C12A 1EO1A 5AQYA 3C7NA 3J8AA 4HWIA 4C1NI 5C10A 3RVCA 3I55N 1BUPA 2OTLN 3FZHA 1HUXA 5C15A 2BH1A 2P9NA 2E88A 3DXKB 1SZ2A 3GE1A 3WXKA 3WXLA 3OHRA 3NMUA 3CJ9A 3PIOL 1LCUA 5DM6L 4JD2B 5ADXA 2RE2A 1ZXOA 1JCGA 4OPAA 4NLBA 4WQ4A 1Q81O 2V7ZA 1R59O 1NGAA 2NLXA 5BRDA 1DT9A 3MMVA 2WBNA 4K42A 2FLOA 2KHOA 3DJCA 3LDPA 1VQ7N 3WT0A 4CZLA 1BDGA 5BPMA 2CH5A 4A61A 3SAFA 3HI0A 3TSUA 3CCVN 4C1NK 3CF5L 3DXKA 3SLCA 1NGIA 3F9MA 3MK6A 3UKRB 2E1YA 2F7TA 3N4QA 4QS7A 5FPDA 3MN9A 4JD2A 4M7YA 2CGJA 3FFKB 3GDQA 2HMPA 1YHQN 1K8KB 3FZMA 3MN7A 5AQUA 4IFEA 3VEWA 5C2DA 2YHWA 2FF3B 1Y64A 3RSEB 3CCEN 5C2FA 3O08A 4EAHD 4ISGA 3SBGA 1Z05A 5BN9A 4BREA 3WQTA 3EN9A 3L0QA 2VCPA 3L4IA 2ASPA 3OA9A 3HBTA 3GL1A 4JKAA 3EE8A 5M1PA 3R8EA 3S41A 2RHKA 3VEZA 3VF4A 3FZLA 4JKHA 3E9PA 4H0YB 3UKRA 1YF5L 2NRVA 1BU6O 4BRHA 3CC7N 3ZX0A 4Z94A 4GNIA 3E9LA 5EOYA 4WFNL 1QQMA 1YIJN 4FWNA 1TUYA 4BRFA 1K8KA 1T6DA 2Q31A 3VESA 4BC5A 3RSEA 4B1UB 1YJ9N 1MWKA 4JKGB 3IKMA 3G25A 5F2RA 2NRXA 4YOWA 5M1OA 3LDQA 3O8MA 1KD1O 2Q2RA 3VF2A 2NRTA 1OVYA 4B1ZA 3VGMA 3WXJA 4A5AA 2Q1NA 4FWOA 3MN6A 4BG9A 3HZ6A 3BP8A 3EO3A 1XUPO 4FL9A 5F0XA 2QI2A 1KAZA 4KH6A 2NRHA 1K8AO 3VENA 3IDHA 3CCUN 4JKGA 3A5NC 2E8AA 2GELA 5AQVA 4PHTX 2NZTA 2YJFA 5FPMA 3O5BA 3N4PA 3UB5A 1GLBG 4BC2A 3U4LA 4BRNA 4YOYA 5JVHL 4IXCA 3TSQA 5C0YA 3EKSA 3K9KA 4B1YB 3FZFA 4G9ZA 3CI5A 4IDHA 3ENBA 5AQFA 2Q0RA 4GV6A 1SQKA 4AM6A 5MLCQ 4PL8A 2DPNA 1HX1A 4WQ5A 1Q18A 3PLAA 1QVGM 1T6CA 2FXUA 3CMAN 2QWOA 5BRFA 1GLFO 4FWKA 4IEEA 3VEVA 4ISEA 4FWSA 3E9OA 3VETA 1VQ6N 4K25A 4MDAA 1U2VB 4O8KA 4J8FA 1NWKA 3I8BA 4JK7A 2A40A 2D4WA 2QM1A 2J4RA 3CERA 4FWPA 5M1NA 3KHYA 5AQLA 4BRGA 3IMXA 1YI2N 3P38A 1ILYA 1E4FT 1QVFM 4IJNA 3CCRN 1NGBA 5JLFA 4UY8O 1GLAG 3H1VX 5HL7L 2E2NA 3KZBA 4FWRA 5LJVA 3CXCM 5AZIB 1DGKN 2HF4A 2VYPA 3UE5A 3ZETB 3C7NB 2QW9A 2YI1A 4YOUA 1ESVA 4DCHA 1X9JA 3ATUA 4BGBA 2E20A 3I33A 2D0OA 3M1FA 4L3QA 3BUZB 1U2VA 3ATVA 3Q7CA 4B1XB 4BRCA 2CH6A 3AAQA 4JKBA 3HOSA 4B1VA 4H0XB 4BC4A 4YDUC 3VTIA 5JLHA 1NGDA 4WQ5C 5AZIA 4BROA 5TKWA 3ZETA 4PKGA 4PL7A 4BR5A 1VQLN 2OTJN 3ULEB 5EY4A 1BWFO 2HBKA 4K41A 4CJ7A 3LM2A 4H5RA 3TPQA 4BRAA 3CC2N 2HF3A 4ILHA 4WFAL 3G6EN 1BA0A 4FWQA 1X3NA 5TKYA 3O6WA 3SK3A 4DHYA 4OPHA 1CZAN 4FSVA 5AFUA 1C0FA 3LL3A 4IJAA 3ZYYX 5B8HA 4B9QA 1YJNN 5KQDA 1X3MA 1E4GT 3CQXA 5LJWA 2ZJRL 2GWJA 2HOEA 4KH4A 4AM7A 5AQIA 4LC9B 3ULEA 3M6GA 4DB3A 3CCSN 3VTHA 3MCPA 2A5XA 4FOIA 1YUWA 5AQWA 3D7EO 1HLUA 3VGKA 1HPMA 4WFBL 3DWLA 2ASMA 3CHWA 3I56N 3CQYA 2QA4N 3AGKA 3EL2A 2CGKA 2P9PB 3SAGA 1ATNA 3ID8A 1ATRA 4KH5A 5BPLA 1VQON 4CBUA 4Y0WA 5AFUH 3QFUA 1OKJA 5KPTA 4IO9L 2PBDA 3R6MA 2KLAA 3WEEB 4BR2A 4DQ8A 2QTDA 3MWTA 4EHUA 3TU5A 3P31A 1H1VA 2Q0UA 3A5OC 1JCEA 4M63C 3ENOA 4JEPA 3QICA 2FSJA 3SBTA 4H0PA 4MLEA 2W41A 1VQ9N 4FVUA 5DM7L 4H5WA 3PIPL 4PKIA 2P9PA 1HKBA 3A0IX 3QB0A 2HBMA 4JKFA 4CZFA 4BQZA 4OO1J 3QMLA 2WUSA 2QWLA 4EFHA 1GLDG 2PFUA 3B8AX 3WEEA 3FR0A 3LDNA 2IIRA 3M3ZA 4H5NA 5M1FA 3LM9A 2VWBA 1ZBSA 2WC9A 1YITN 3ZEUB 5JMVA 5I9EB 1SS6A 3MN5A 3CCLN 3CD6N 3QBWA 1T44A 3O9QA 3FLCO 1S72N 3CCMN 1BO5O 5HOOA 3SMSA 4GV3A 1NM1A 2A41A 3GBTA 5GIOA 2V7YA 2VGMA 4KBOA 4O8UA 4YOXA 1Q82O 1DKGD 3CETA 1QZ6A 4BGAA 2F9WA 1M90O 1VQ8N 3WXMB 4FPBA 1WOQA 4MDBA 4IO8A 2P9KB 2F9TA 3CPWM 2YHXA 3ZEUA 2YHYA 1YJWN 2NNWA 3W3DA 4CD1A 4U67L 4JHDB 3BF3A 2QWRA 3HSCA 3VEOA 1QZ5A 4FWMA 4YDUA 5KPRA 1V4SA 1P90A 3A5MC 3T69A 1T3VA 4CZJA 5BN8A 3TSPA 4A2AA 1BG3A 3C6AA 5AQQA 2JWKA 3T7ZA 3FZKA 4YORA 3IUCA 1XQSC 3O4WA 3HRGA 2QWNA 4JK9A 3WUHA 1VQPN 2P9KA 1BOTO 1VQNN 3IFRA 3CJ7A 4JKCA 1QQNA 2D0PA 3U9ZA 3AAPA 5AQTA 4IWVA 5CE3A 3VPZA 4NB4A 4JHDA 2ZGYA 1IJJA 1S22A 4XH1A 2A6AA 3R9PA 1O13A 3ID6A 4U7BA 1LOTB 4CZIA 2AA4A 2GEMA 2BTFA 3DXMB 3TTDA 1K9MO 5LY3A 4BRMA 5AQMA 3O1WA 3O9TA 3CMEN 3H6EA 3KWIA 4BR7A 1D4XA 2Q97A 1VQKN 3VEYA 3U8XA 3CCQN 2QWMA 3WQUA 3CJ1A 4QS8A 1QQOA 3VERA 4JKDA 2ASOA 2IVOA 4H0OA 4AF1A 4A2BA 4RWTA 2P9LB 2Q36A 2ZWHA 4CBXA 3SAHA 5GINA 2IVPA 2A42A 3DXMA 3HM8A 3L4QA 5FPEA 1GLEG 3QBXA 3D2EB 3O9UA 4I6MB 4CZKA 4EHTA 4IOAL 4PKHA 1VQMN 1JCFA 1VAZA 5JVGL 4BRKA 1XC3A 5AQJA 5BREA 1TUUA 3JS6A 3M5RA 2HBJA 3D2FB 1GLJO 4R79A 5AQNA 2P9IB 5BPNA 3O9RA 3QFPA 3CIPA 5AZJB 4CI6A 1KQSM 4CBWA 4HTLA 3HTVA 1NLVA 1MDUB 1RDWX 1Q7YO 1VQ5N 5AQXA 2P9LA 4FOEA 2P9UB 3VEXA 4C23A 1RDUA 3LDOA 4FPAA 3EE9A 4EIAA 3CJCA 3AGRA 1W2BM 2E2OA 3UKUB 2GUPA 3D2EA 2FF6A 4I6MA 3G71N 4BY9C 2KKZA 1C0GA 5JICA 3C0BA 3GOIA 1GLCG 4H5TA 3CJAA 5AQOA 2FSNA 2ZF5O 5AQPA 2E2QA 3D2FA 3CJBA 4M7XA 3KK7A 2P9IA 3CPEA 3NVKA 4NLCA 2HSTA 3K9JA 4RTFD 5AZJA 5E26A 4JK8A 2P9UA 1YVNA 2CGLA 1IG8A 1NGJA 4BRQA 2BUPA 3UKUA 1YXQA 3F5TA 1NGEA 4FWLA 5CHIA 4H0TB 4BVOA 1Q86O 1N8RO 3U9DA 3FE1A 3R3LA 1NGGA 3VF6A 4IEIA 4XH4A 2YJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JAX A;  3EZW A;  1NGC A;  3VOV A;  5BR9 A;  4RCH A;  3O80 A;  5AQR A;  4BVP A;  1S3X A;  3AAR A;  2QXL A;  4BR0 A;  5ADX H;  1NMD A;  4A62 A;  1BA1 A;  1HKC A;  1YAG A;  2FSK A;  4ISF A;  4BR4 A;  4F9O A;  2ZGZ A;  2OAN A;  3MDQ A;  4XH5 A;  1ZC6 A;  2EWS A;  5AQH A;  4CZM A;  4WQ4 C;  4O5F A;  4CZG A;  4E1J A;  2H3G X;  5FPN A;  2W40 A;  2V52 B;  3H1Q A;  3P4I A;  4BQL A;  1ATS A;  3KVG A;  3SJH A;  1RGI A;  1QHA A;  3BF1 A;  3GG4 A;  1P8Z A;  1WUA A;  3EKU A;  2V51 B;  1KXP A;  2AP1 A;  3BEX A;  1NGF A;  4B1W B;  4QS9 A;  3SMP A;  3A5L C;  2I7N A;  1V4T A;  3QDK A;  5EX5 A;  2A3Z A;  4BR9 A;  3ZX3 A;  1G99 A;  1RFQ A;  3H45 C;  4BRI A;  2YCH A;  1NBW A;  5AQS A;  1MA9 B;  2GWK A;  4MLH A;  2D1K A;  4BRD A;  1NGH A;  5EXW A;  1KAX A;  3L6Q A;  1U6Z A;  4H5V A;  5KPZ A;  4H0V B;  4CD3 A;  5F1X A;  3O1B A;  5AQG A;  3VGL A;  5E84 A;  2GTD A;  1TYQ B;  2E2P A;  2QWQ A;  3DAW A;  4WYB A;  5AR0 A;  4GY2 B;  1Z6R A;  3JXU A;  3ENH A;  4JN4 A;  4MO5 A;  1DEJ A;  2P9S B;  5EVZ A;  4XEI A;  5ELZ A;  4BRP A;  3H3O B;  5AQK A;  2E1Z A;  3WXI A;  5KQ8 A;  1J6Z A;  5AQZ A;  1SAZ A;  4K43 A;  1GLL O;  4NO7 A;  4BC3 A;  4BRL A;  4JNE A;  3H3N O;  1KAY A;  2QWP A;  2ITM A;  1TYQ A;  4BG8 A;  3AY9 A;  2IVN A;  4FO0 A;  4H03 B;  3LDL A;  4MO4 A;  1HJO A;  4CZH A;  3FGU A;  2P9N B;  2P9S A;  3A8Y A;  4CZE A;  4IZ9 A;  2I7P A;  1EQY A;  5BRH A;  3H46 O;  1HKG A;  1MWM A;  2UYT A;  3ZX2 A;  2PAV A;  5AQY A;  3C7N A;  3J8A A;  4HWI A;  1BUP A;  3FZH A;  1HUX A;  2P9N A;  2E88 A;  3DXK B;  1SZ2 A;  3GE1 A;  3WXK A;  3WXL A;  3OHR A;  3CJ9 A;  1LCU A;  4JD2 B;  5ADX A;  4WQ4 A;  1ZXO A;  1JCG A;  2V7Z A;  1R59 O;  1NGA A;  2NLX A;  5BRD A;  3MMV A;  4K42 A;  2FLO A;  2KHO A;  3DJC A;  3LDP A;  3WT0 A;  4CZL A;  1BDG A;  5BPM A;  2CH5 A;  4A61 A;  3HI0 A;  3DXK A;  3SLC A;  1NGI A;  3F9M A;  3MK6 A;  3UKR B;  2E1Y A;  4QS7 A;  5FPD A;  3MN9 A;  4JD2 A;  4M7Y A;  2CGJ A;  3FFK B;  3GDQ A;  2HMP A;  1K8K B;  3FZM A;  3MN7 A;  5AQU A;  3VEW A;  2YHW A;  2FF3 B;  1Y64 A;  3RSE B;  3O08 A;  4EAH D;  4ISG A;  1Z05 A;  5BN9 A;  4BRE A;  3WQT A;  3EN9 A;  3L0Q A;  2VCP A;  3L4I A;  2ASP A;  3S41 A;  3HBT A;  3GL1 A;  3W0L A;  3R8E A;  3VF4 A;  3VEZ A;  3FZL A;  3UKR A;  4H0Y B;  1BU6 O;  4BRH A;  3ZX0 A;  4Z94 A;  4GNI A;  5EOY A;  1QQM A;  4FWN A;  1TUY A;  4BRF A;  1K8K A;  1T6D A;  2Q31 A;  3VES A;  4BC5 A;  3RSE A;  4B1U B;  1MWK A;  3G25 A;  5F2R A;  3LDQ A;  3O8M A;  2Q2R A;  3VF2 A;  4B1Z A;  3VGM A;  3WXJ A;  2Q1N A;  4FWO A;  3MN6 A;  4BG9 A;  3HZ6 A;  3BP8 A;  3EO3 A;  1XUP O;  4FL9 A;  5F0X A;  1KAZ A;  2NRH A;  3VEN A;  3IDH A;  3A5N C;  2E8A A;  2GEL A;  5AQV A;  2NZT A;  2YJF A;  5FPM A;  3O5B A;  3UB5 A;  1GLB G;  4BC2 A;  3U4L A;  4BRN A;  4IXC A;  3EKS A;  4B1Y B;  3FZF A;  3CI5 A;  5AQF A;  2Q0R A;  1SQK A;  4AM6 A;  4PL8 A;  2DPN A;  1HX1 A;  4WQ5 A;  1Q18 A;  1T6C A;  2FXU A;  2QWO A;  5BRF A;  1GLF O;  4FWK A;  3VEV A;  4ISE A;  4FWS A;  3VET A;  4K25 A;  1U2V B;  4O8K A;  4J8F A;  1NWK A;  3I8B A;  2A40 A;  2D4W A;  2QM1 A;  2J4R A;  3CER A;  4FWP A;  3KHY A;  5AQL A;  4BRG A;  3IMX A;  1E4F T;  4IJN A;  1NGB A;  5JLF A;  1GLA G;  3H1V X;  2E2N A;  3KZB A;  4FWR A;  5LJV A;  5AZI B;  1DGK N;  2HF4 A;  2VYP A;  3UE5 A;  3ZET B;  3C7N B;  2QW9 A;  2YI1 A;  1ESV A;  4DCH A;  1X9J A;  3ATU A;  4BGB A;  2E20 A;  3I33 A;  2D0O A;  3M1F A;  4L3Q A;  3BUZ B;  1U2V A;  3ATV A;  4B1X B;  4BRC A;  2CH6 A;  3AAQ A;  4B1V A;  4H0X B;  4BC4 A;  4YDU C;  5JLH A;  1NGD A;  4WQ5 C;  5AZI A;  4BRO A;  3ZET A;  4PKG A;  4PL7 A;  4BR5 A;  3ULE B;  5EY4 A;  1BWF O;  4K41 A;  4CJ7 A;  3LM2 A;  4H5R A;  3TPQ A;  4BRA A;  2HF3 A;  1BA0 A;  4FWQ A;  1X3N A;  5TKY A;  3O6W A;  3SK3 A;  4DHY A;  5AFU A;  1CZA N;  4FSV A;  1C0F A;  3LL3 A;  4IJA A;  5B8H A;  4B9Q A;  5KQD A;  1X3M A;  1E4G T;  3CQX A;  5LJW A;  2GWJ A;  2HOE A;  4AM7 A;  5AQI A;  4LC9 B;  3ULE A;  3M6G A;  4DB3 A;  3MCP A;  2A5X A;  4FOI A;  1YUW A;  5AQW A;  3D7E O;  1HLU A;  3VGK A;  1HPM A;  3DWL A;  2ASM A;  3CHW A;  3CQY A;  3EL2 A;  2CGK A;  2P9P B;  1ATN A;  3ID8 A;  1ATR A;  5BPL A;  4CBU A;  4Y0W A;  5AFU H;  3QFU A;  1OKJ A;  5KPT A;  2PBD A;  3R6M A;  3WEE B;  4DQ8 A;  4BR2 A;  4EHU A;  3TU5 A;  1H1V A;  2Q0U A;  3A5O C;  1JCE A;  4M63 C;  3ENO A;  3QIC A;  2FSJ A;  4H0P A;  4MLE A;  2W41 A;  4H5W A;  4PKI A;  2P9P A;  1HKB A;  3A0I X;  3QB0 A;  4CZF A;  4BQZ A;  3QML A;  2WUS A;  2QWL A;  4EFH A;  1GLD G;  3B8A X;  3WEE A;  3FR0 A;  3LDN A;  2IIR A;  3M3Z A;  4H5N A;  3LM9 A;  2VWB A;  1ZBS A;  3ZEU B;  5JMV A;  5I9E B;  3MN5 A;  3QBW A;  1T44 A;  3FLC O;  1BO5 O;  3SMS A;  1NM1 A;  2A41 A;  3GBT A;  2V7Y A;  4KBO A;  1DKG D;  3CET A;  1QZ6 A;  4BGA A;  2F9W A;  4FPB A;  1WOQ A;  4IO8 A;  2P9K B;  2F9T A;  2YHX A;  3ZEU A;  2YHY A;  3W3D A;  4CD1 A;  4JHD B;  3BF3 A;  2QWR A;  3HSC A;  3VEO A;  1QZ5 A;  4FWM A;  4YDU A;  5KPR A;  1V4S A;  3A5M C;  5BN8 A;  4CZJ A;  4A2A A;  1BG3 A;  5AQQ A;  3FZK A;  3IUC A;  1XQS C;  3O4W A;  2QWN A;  3WUH A;  2P9K A;  1BOT O;  3IFR A;  3CJ7 A;  1QQN A;  2D0P A;  3U9Z A;  3AAP A;  5AQT A;  4IWV A;  5CE3 A;  3VPZ A;  4NB4 A;  4JHD A;  2ZGY A;  1IJJ A;  1S22 A;  4XH1 A;  2A6A A;  3R9P A;  1LOT B;  4CZI A;  2AA4 A;  2GEM A;  2BTF A;  3DXM B;  5LY3 A;  4BRM A;  5AQM A;  3O1W A;  3H6E A;  4BR7 A;  1D4X A;  2Q97 A;  3VEY A;  3U8X A;  2QWM A;  3WQU A;  3CJ1 A;  4QS8 A;  1QQO A;  3VER A;  2ASO A;  2IVO A;  4H0O A;  4A2B A;  4RWT A;  2P9L B;  2Q36 A;  2ZWH A;  4CBX A;  2IVP A;  2A42 A;  3DXM A;  3HM8 A;  5FPE A;  1GLE G;  3QBX A;  3D2E B;  4I6M B;  4CZK A;  4EHT A;  4PKH A;  1JCF A;  4BRK A;  1XC3 A;  5AQJ A;  5BRE A;  1TUU A;  3JS6 A;  3D2F B;  1GLJ O;  5AQN A;  2P9I B;  5BPN A;  3QFP A;  3CIP A;  5AZJ B;  4CI6 A;  4CBW A;  4HTL A;  3HTV A;  1NLV A;  1MDU B;  1RDW X;  5AQX A;  2P9L A;  4FOE A;  2P9U B;  3VEX A;  4C23 A;  3LDO A;  4FPA A;  4EIA A;  3CJC A;  2E2O A;  3UKU B;  2GUP A;  3D2E A;  2FF6 A;  4I6M A;  1C0G A;  5JIC A;  3C0B A;  3GOI A;  1GLC G;  4H5T A;  3CJA A;  5AQO A;  2FSN A;  2ZF5 O;  5AQP A;  2E2Q A;  3D2F A;  3CJB A;  4M7X A;  2P9I A;  5AZJ A;  4RTF D;  5E26 A;  2P9U A;  1YVN A;  2CGL A;  1IG8 A;  1NGJ A;  4BRQ A;  2BUP A;  3UKU A;  1YXQ A;  1NGE A;  4FWL A;  4H0T B;  4BVO A;  3U9D A;  3FE1 A;  1NGG A;  3VF6 A;  4XH4 A;  2YJE A; 
#chains in the Genus database with same CATH topology
 3F2K A;  3AA5 X;  1VHX A;  1XNQ K;  4YOT A;  3AO1 A;  4BR0 A;  1X9M A;  2W6L A;  5GAE P;  3SCX A;  2HND A;  4QAG A;  4EP5 A;  4F3O A;  3PX6 A;  4ISF A;  3LP2 A;  4BR4 A;  1TVR A;  2O8E A;  4XH5 A;  3MDQ A;  4CJ4 A;  2EWS A;  4CJQ A;  3AVA A;  4C8M A;  4WQ4 C;  4CZG A;  4E1J A;  2H3G X;  5FPN A;  3LP1 A;  4CGF A;  4BQL A;  4G1Q A;  2GX9 A;  3KVG A;  3MXI A;  4ELU A;  1TL3 A;  1N6Q A;  3QEV A;  1F21 A;  3BF1 A;  4B3R K;  3P1G A;  1W0H A;  5LMU K;  2NRR A;  3DI6 A;  2YX6 A;  1NGF A;  1HYZ A;  4CHN A;  2A1S A;  5EX5 A;  2DFH A;  1D5A A;  2A3Z A;  1XWL A;  4FLU A;  1X9W A;  2P1J A;  4GMJ B;  4X65 K;  3T1H K;  2AJQ A;  2YCH A;  2FBX A;  1MA9 B;  3LAN A;  5EXW A;  3PUF A;  4ILJ A;  5C25 A;  5DMR A;  3BZC A;  3KLH A;  5KPZ A;  5F1X A;  4IFY A;  4LY7 A;  5AQG A;  4DR7 K;  2E2P A;  3DAW A;  2JLE A;  3OTO K;  4DR6 K;  1Z6R A;  1DTQ A;  1DEJ A;  3I0R A;  4FM2 A;  2W6K A;  3WXI A;  5KQ8 A;  4RG8 A;  1J6Z A;  5AQZ A;  3D0P A;  4DV2 K;  1KLN A;  3C6H A;  5CZ2 A;  4M3X A;  4B8C A;  1LAW A;  2ITM A;  2NRZ A;  3U3Y A;  3L2R A;  3J7Z O;  1RT7 A;  4MO4 A;  1HJO A;  3FFI A;  4BE2 A;  2P9N B;  2F8T A;  4DU3 A;  4DF4 A;  1JLF A;  3OBW A;  3ALY A;  1FXX A;  3KD5 E;  4E0D A;  2FBY A;  2I7P A;  4ILG B;  4YOV A;  1YVU A;  1HYS A;  5BRH A;  3H46 O;  3T19 A;  1NK7 A;  5C12 A;  1EO1 A;  4AHS A;  4ZTF A;  3LPU A;  3OS2 A;  2D0B A;  4HWI A;  3I55 N;  5C10 A;  3EZ5 A;  1BUP A;  2OTL N;  4DTU A;  3DRS A;  1SZ2 A;  3OHR A;  3CJ9 A;  2G8U A;  4CVN E;  2O8C B;  4JD2 B;  5ADX A;  1ZXO A;  1JCG A;  1L3U A;  1NGA A;  4Z0U A;  4I9Q A;  4LF6 K;  3LDP A;  1VQ7 N;  3WT0 A;  4CZL A;  4CF1 A;  5D3G A;  2UXC K;  4NCA A;  3DXK A;  1C0M A;  2Z1G A;  4YNQ A;  4HHT A;  3FFK B;  3FZM A;  4DSL A;  4IFE A;  5C2D A;  4DS4 A;  2D5R A;  2FF3 B;  1XMO K;  2YKM A;  1VSF A;  4EAH D;  4KTZ A;  4BRE A;  3L4I A;  3EE8 A;  3L2W A;  2RHK A;  3VEZ A;  3FZL A;  4OGE A;  4JKH A;  3E9P A;  1YF5 L;  2NRV A;  1BU6 O;  2X6S A;  4BRH A;  4Z94 A;  3THW B;  5EOY A;  1BHL A;  1B9D A;  4JKG B;  3VQD A;  4M3W A;  1JKH A;  5M1O A;  1BI4 A;  2UXB K;  3LDQ A;  1KD1 O;  3VF2 A;  4B1Z A;  2X78 A;  2HHS A;  3DLK A;  4A5A A;  2UUC K;  4FWO A;  3EEQ A;  2PYJ A;  4DR4 K;  3SPY A;  2OYQ A;  1VSD A;  4ZHR A;  2QI2 A;  2UXD K;  3PX0 A;  1K8A O;  3VEN A;  1DTT A;  3CCU N;  1OH8 A;  3A5N C;  2GEL A;  4PHT X;  4DQR A;  2YJF A;  5KGX A;  3O5B A;  4BWM A;  4M3R A;  4BRN A;  5JVH L;  1ASU A;  1HR0 K;  5C0Y A;  4KHY A;  3L8B A;  3FZF A;  4KO0 A;  2ZE2 A;  4CFA A;  2Q0R A;  5MLC Q;  4CJW A;  1Q18 A;  1QVG M;  4CJ3 A;  1GLF O;  3AVI A;  3VEV A;  4ISE A;  1LWE A;  3E9O A;  4CCH A;  4K25 A;  2KW4 A;  4IG0 A;  4J8F A;  3CER A;  5AQL A;  1YI2 N;  3AVB A;  1QVF M;  1NGB A;  2IGI A;  3KZB A;  4FWR A;  4BDP A;  3UE5 A;  4UQG A;  3C7N B;  3WNG A;  4FM1 A;  3DLG A;  3EY1 A;  2E20 A;  4DQI A;  4L3Q A;  3BUZ B;  1U2V A;  3ZT1 A;  2DFF A;  4O0I A;  4Z4F A;  4RW6 A;  4NCB A;  4BC4 A;  4FZY A;  4FJ9 A;  4WQ5 C;  5TKW A;  3ZET A;  4PL7 A;  5BR8 K;  1NJW A;  1VQL N;  3CFP A;  1RDB A;  2HBK A;  4K41 A;  3SZ2 A;  1QQC A;  3DLR A;  4H5R A;  3TPQ A;  4BRA A;  1QTM A;  2HVH A;  2HF3 A;  4N5S A;  4Z4E A;  3G6E N;  3HM9 A;  1BA0 A;  4FWQ A;  5TKY A;  3SK3 A;  3O6W A;  3RMB A;  4E1N A;  5B8H A;  5KQD A;  1X3M A;  5LJW A;  3NF7 A;  2GWJ A;  4KH4 A;  1C6V A;  4AM7 A;  4B9L A;  5AQI A;  3OYB A;  1VSL A;  4DB3 A;  3VTH A;  5AQW A;  3D7E O;  1HPM A;  4WFB L;  3DWL A;  3I56 N;  2HVI A;  3M8Q A;  1MU2 A;  3EL2 A;  3QIO A;  5IWA K;  1CLQ A;  4N47 A;  3ID8 A;  3L2U A;  4CBU A;  4O44 A;  4RW4 A;  3QFU A;  4IO9 L;  2HNZ A;  2PBD A;  3R6M A;  3WEE B;  2QTD A;  3KK2 A;  4CED A;  2BAN A;  1RT3 A;  3VQ8 A;  1QSL A;  1RDC A;  3V9X A;  2YV0 X;  1JXE A;  3SBT A;  4H0P A;  4MLE A;  1T7P A;  2KFZ A;  1HKB A;  3V1R A;  1RT1 A;  1NJX A;  4AHV A;  2P5O A;  3QML A;  2QWL A;  4EFH A;  1GLD G;  2PFU A;  1D8Y A;  2E6L A;  2YHB A;  4HUG A;  4KHS A;  1YIT N;  3ZEU B;  1J54 A;  1FK9 A;  3CCM N;  1GOB A;  5HOO A;  3SMS A;  1C0U A;  4GV3 A;  5GIO A;  4KBO A;  3DM2 A;  1W9H A;  4EZ9 A;  1VQ8 N;  4FW2 A;  3LZI A;  1VSJ A;  1WOQ A;  4FZZ A;  4MDB A;  3LWM A;  3VQ5 A;  1TK5 A;  2YHX A;  2YHY A;  1YJW N;  3W3D A;  3MAQ A;  5FRN A;  4CIG A;  2QWR A;  3OJS A;  3TAE A;  3VEO A;  4ZTJ A;  1V4S A;  3T69 A;  5BN8 A;  1JLB A;  5AQQ A;  3T7Z A;  3FZK A;  3O4W A;  1HNW K;  1BOT O;  1IBK K;  1QQN A;  1TGO A;  3HPO A;  5AQT A;  3VPZ A;  3ZT2 A;  3QER A;  1S22 A;  2XY7 A;  1O13 A;  3RMA A;  4JI5 K;  5KI6 A;  1LOT B;  3KIO A;  3V6D A;  4FJX A;  3TTD A;  1RCH A;  4DSI A;  3NBP A;  4BR7 A;  4N76 A;  2Q97 A;  4PY5 A;  3U8X A;  4X66 K;  4J2E A;  1QQO A;  1T05 A;  1IG9 A;  4RWT A;  4CBX A;  3TI0 A;  2A42 A;  1KTQ A;  3MEG A;  1GLE G;  1ITG A;  4CZK A;  4AHT A;  4IOA L;  4KFB A;  4PKH A;  1BIS A;  1XC9 A;  1NOZ A;  4CES A;  2HBJ A;  3KLF A;  1GLJ O;  3OVN A;  5AQN A;  4DTX A;  3O9R A;  5AZJ B;  4CI6 A;  3QIN A;  1KQS M;  3HTV A;  5CY4 A;  4LF5 K;  4O55 A;  3AVC A;  1RDU A;  3LDO A;  4FPA A;  3CJC A;  3UKU B;  1FJG K;  2GUP A;  3ITH A;  2FF6 A;  4DSJ A;  5C24 A;  2ZQB A;  3JYT A;  2FSN A;  3E01 A;  3TAM A;  3D2F A;  3CJB A;  1GOC A;  3G0Z A;  2OZM A;  4DV4 K;  2Z1H A;  1IG8 A;  4KRF A;  1NGJ A;  4BRQ A;  3IG1 A;  4LD0 A;  1WSI A;  4H0T B;  3HST B;  4DR5 K;  4H4O A;  2O8E B;  1NMN A;  4IEI A;  4XH4 A;  3EZW A;  1KLM A;  1U49 A;  2ZJQ L;  3NFA A;  3O80 A;  5AQR A;  4CJ5 A;  1HNI A;  2ITG A;  3G4S N;  1IV0 A;  1HQU A;  1WBB A;  3DRP A;  4FLY A;  1SL2 A;  2YKN A;  1K73 O;  3O9S A;  1HKC A;  1JJ2 M;  4CHY A;  2OAN A;  1ZC6 A;  4AHU A;  4CEZ A;  4KRE A;  3H1Q A;  1ATS A;  2HHT A;  3OYA A;  2JWL A;  4IOC L;  1QHA A;  3OJU A;  3E1Y A;  1LW0 A;  1P8Z A;  4FJ7 A;  3NH0 A;  3HL8 A;  3EKU A;  3DLL L;  4DKW A;  2AP1 A;  3ZSV A;  1WSF A;  3NDK A;  1W7A A;  3A5L C;  3O3G A;  3QDK A;  1V4T A;  1NKB A;  1VQ4 N;  3ZX3 A;  4DFK A;  2HBL A;  4I9L A;  4E7K A;  1RFQ A;  4FJH A;  2D1K A;  1J9A A;  4YOY A;  1KAX A;  1U6Z A;  3O1B A;  1XHX A;  5E84 A;  2GTD A;  1EX4 A;  4WYB A;  1IKV A;  3MX2 A;  2VG6 A;  4GY2 B;  4LH5 A;  4OLB A;  5HP1 A;  4JN4 A;  2DTU A;  1N5Y A;  4A5B A;  2OPQ A;  1S5J A;  3R1X A;  3H3O B;  4GVE A;  4F2S A;  5GAH P;  1CZB A;  3KK3 A;  5M1K A;  4BC3 A;  4HCC A;  4CJT A;  4BRL A;  4DV6 K;  2IAJ A;  4ID1 A;  2XY6 A;  1C1C A;  1KFD A;  4WE1 A;  3LZJ A;  4CIF A;  4GV9 A;  2IVN A;  4FO0 A;  4DLG A;  3AVH A;  5GIP A;  3OYK A;  3QES A;  3LDL A;  4CJS A;  1YTU A;  3VMF B;  4EZ6 A;  5GAG P;  2P9S A;  3TAF A;  4CZE A;  1IBM K;  4IZ9 A;  4F8R A;  1E3M A;  1EQY A;  1ZBL A;  4CGJ A;  1HKG A;  2UYT A;  3DYA A;  2WFB A;  4FJ5 A;  4DTP A;  5AQY A;  2ZD1 A;  4C1N I;  4DWI A;  2OPS A;  1HUX A;  1WLJ A;  5C15 A;  5JS1 A;  3DXK B;  4J2B A;  1BIU A;  3T1Y K;  4CJK A;  1X9S A;  1NKE A;  2RE2 A;  1ZBI A;  3VQA A;  1R59 O;  3L3V A;  1VSH A;  4B9S A;  3DJC A;  4JRQ A;  3BGR A;  3SJJ A;  4CF0 A;  4A61 A;  3HO1 A;  1WAJ A;  4DQP A;  4OKE A;  3CF5 L;  3F9M A;  4W5T A;  4QS7 A;  3NF9 A;  5FPD A;  4M7Y A;  1YHQ N;  2HMP A;  3B6P A;  1ZBH A;  4BE0 A;  3MN7 A;  5AQU A;  2YHW A;  5C2F A;  3O08 A;  4ISG A;  1FKP A;  3SBG A;  4FLX A;  3OYF A;  3WQT A;  1BI4 B;  1SUQ A;  3LAM A;  3S41 A;  4JKA A;  3S9H A;  3GL1 A;  5M1P A;  3SV4 A;  4JI6 K;  3SUO A;  1L3S A;  1SKW A;  2KFN A;  2E5L K;  4LFB K;  4JI1 K;  4GNI A;  4IG3 A;  4WFN L;  4BRF A;  1TUY A;  1I3A A;  4LFC K;  3NAE A;  4OKJ A;  1L5U A;  3O8M A;  4CJV A;  1RDA A;  4CEF A;  1S1T A;  3VGM A;  1A5W A;  1CZ9 A;  1NK0 A;  3BP8 A;  4B8A B;  4KH6 A;  5CZ1 A;  3IDH A;  4B3S K;  4FLT A;  4IFV A;  2HW3 A;  5FPM A;  3VQE A;  3N4P A;  4BC2 A;  1JLA A;  2HHU A;  1B92 A;  3TSQ A;  4LF4 K;  2F4V K;  3CI5 A;  1UAX A;  1GOA A;  3WNH A;  1SQK A;  2WON A;  3AVK A;  1NK6 A;  3V1Q A;  1HX1 A;  3OYM A;  1NK8 A;  3SQ1 A;  2FXU A;  1NK4 A;  4FWS A;  3VET A;  1VQ6 N;  4MDA A;  1U2V B;  4O8K A;  3THX A;  1NWK A;  3MEC A;  1TV6 A;  2QM1 A;  2J4R A;  4CHP A;  3S3O A;  3IMX A;  1ILY A;  2GBZ A;  4IJN A;  4E19 A;  3CCR N;  5JLF A;  3C6U A;  4KPY A;  3V1O A;  2YNI A;  4CF2 A;  1DGK N;  3ZET B;  2EHG A;  4YOU A;  4DCH A;  5C42 A;  2IDO A;  3M1F A;  1NOY A;  3ATV A;  2G8H A;  4PWD A;  3HOS A;  4B1V A;  3V9W A;  4M3Z A;  1NGD A;  3LP0 A;  4IDK A;  4BR5 A;  1BWF O;  3QIP A;  4CJL A;  3LAL A;  4JI0 K;  4WFA L;  4OPK A;  4OPH A;  4FSV A;  5AFU A;  1C0F A;  4KI4 A;  4DR3 K;  3SQ2 A;  1XHZ A;  3V9U A;  4NXN K;  4HTU A;  3T1A A;  3CCS N;  4HVJ A;  4FK4 A;  4E3S A;  3CQY A;  4OGC A;  1SL1 A;  3ZSR A;  1VQO N;  4H8K A;  2O4G A;  3ZSW A;  5AFU H;  4JYA K;  3U6F A;  4BR2 A;  3CM5 A;  4JI4 K;  1EET A;  1N34 K;  3RR7 A;  3P31 A;  3A5O C;  1JCE A;  4M63 C;  1QS4 A;  1T03 A;  1KVA A;  2FSJ A;  4B9T A;  4JRP A;  4LH4 A;  3PIP L;  5T7B A;  3AVF A;  4PKI A;  3QB0 A;  2HBM A;  3VQ4 A;  1HNX K;  2WUS A;  4W5R A;  3B8A X;  2IIR A;  4IBN A;  4FJM A;  1ZBS A;  2WC9 A;  1NG9 A;  5I9E B;  3SQ0 A;  3O9Q A;  2LSN A;  2FBT A;  1BO5 O;  2XHB A;  1XNR K;  1NM1 A;  3DMJ A;  4DG1 A;  1Q82 O;  2F9W A;  2YNF A;  1RTH A;  4HUE A;  1U04 A;  1RBU A;  4FVM A;  1I94 K;  1G15 A;  3VQP A;  3NGI A;  4YDU A;  3A5M C;  1P90 A;  1T3V A;  1KSP A;  4DTO A;  3UIQ A;  4A2A A;  1BG3 A;  3C6A A;  4YOR A;  4JK9 A;  3WUH A;  4JKC A;  4K8Z A;  2D0P A;  3TAP A;  4JHD A;  4DU1 A;  3ASM A;  3O4N A;  4XH1 A;  2A6A A;  3JAM O;  1QHT A;  2IC3 A;  4CZI A;  1RTJ A;  3HPH A;  5AQM A;  3KWI A;  4LSL A;  1QE1 A;  3C6T A;  4ELT A;  2B4J A;  3BDP A;  3CCQ N;  2QWM A;  1RBS A;  4FZX C;  2FC0 A;  2O8F A;  2RN2 A;  3RRG A;  4DSF A;  4AF1 A;  1XMQ K;  1Z25 A;  3SAH A;  3DXM A;  3QBX A;  1VQM N;  4YY3 K;  1VAZ A;  4BRK A;  1TUU A;  3JS6 A;  1ASV A;  3M5R A;  4BWJ A;  3K0S A;  1J5O A;  3D2F B;  2WOM A;  4R79 A;  1RBV A;  4JI7 K;  1WSJ A;  1MDU B;  1TL1 A;  4FOE A;  1NK9 A;  1W2B M;  1N36 K;  1EWR A;  3AGR A;  1VSK A;  3G71 N;  4I6M A;  2KKZ A;  1C0G A;  3MED A;  5JIC A;  3HPG A;  3RTV A;  4B9N A;  3IAY A;  3GOI A;  1S1V A;  5AQP A;  2E2Q A;  1NNE A;  4NYN A;  3CPE A;  3NVK A;  5FLX O;  2HST A;  1JLE A;  4OJR A;  2CGL A;  5J1E A;  1HNV A;  2OCE A;  3F5T A;  1NGE A;  1QSY A;  3PSF A;  1Q86 O;  4BVO A;  4OPJ A;  3U9D A;  5HRO A;  5KTQ A;  3R3L A;  4FLW A;  4LF7 K;  4KI6 A;  4M41 A;  2YJE A;  4JAX A;  3O3H A;  3VOV A;  3RMD A;  5BR9 A;  4RCH A;  4BVP A;  3NHG A;  1S3X A;  3AAR A;  1EXQ A;  2OPR A;  3DLB A;  1BA1 A;  2RKI A;  1YAG A;  3OS0 A;  4F3T A;  1NJI O;  2ZGZ A;  1KC8 O;  1NKC A;  1J5E K;  4OLA A;  1Q9Y A;  3TTF A;  5AQH A;  4CZM A;  1VSI A;  4E89 A;  2W40 A;  3AO5 A;  4FW1 A;  3J80 O;  4B3O A;  3SJH A;  1RGI A;  2Z1J A;  3Q7B A;  2QXF A;  3OW2 M;  3GG4 A;  1EKE A;  4X62 K;  1ZYQ A;  1VSM A;  5GAD P;  1KXP A;  1UA0 A;  3BEX A;  4FJ8 A;  4DV7 K;  2I7N A;  3D6R A;  1M1K O;  3CCJ N;  4B08 A;  1G99 A;  5K14 A;  3KLG A;  4CEO A;  3IRX A;  3H45 C;  1SV5 A;  1NBW A;  5AQS A;  4PQU A;  1N32 K;  3E66 A;  2HHQ A;  3MWP A;  3NVM A;  2YNG A;  4JI2 K;  2E4L A;  5FRM A;  4CK2 A;  3MCA B;  3ZSY A;  4JS5 A;  3MXM A;  4GKJ K;  5AR0 A;  3ZSO A;  3AO3 A;  4CJP A;  3KWG A;  3P39 A;  4L8R B;  3ENH A;  5EVZ A;  2P9S B;  3ZSX A;  3HK2 A;  5ELZ A;  2BE2 A;  4KB0 A;  2HHX A;  4Z4C A;  3DOL A;  4K43 A;  4JKE A;  4BDY A;  5J2P A;  4NCG A;  1W97 L;  4JNE A;  2XY5 A;  4DV5 K;  1TYQ A;  3PY8 A;  3FGU A;  5H1S Q;  3OYH A;  1O1W A;  4DTS A;  3C65 A;  3F9K A;  3HVR A;  1IBL K;  1S6Q A;  3P5J A;  2G8V A;  2PAV A;  1QSS A;  3THY A;  2XRI A;  2QK9 A;  3C7N A;  3RVC A;  4KHW A;  1OH5 A;  3FZH A;  2BH1 A;  3WXK A;  3PIO L;  3KLI A;  4E1M A;  4NLB A;  2V7Z A;  3M8P A;  3MMV A;  2WBN A;  4K42 A;  4B3T K;  2KHO A;  4FJG A;  3NGZ A;  1BCO A;  1RTD A;  1BDG A;  3VQC A;  5BPM A;  3HYF A;  3SAF A;  3HI0 A;  3SLC A;  1NGI A;  3HXM A;  2F7T A;  3N4Q A;  4DR1 K;  2HB5 A;  2CGJ A;  3GDQ A;  5CYM A;  2PYL A;  3VEW A;  1T8E A;  1Z05 A;  4Q5V A;  3SNN A;  3EN9 A;  4B3M K;  3W0L A;  1BL3 A;  2VCP A;  2ASP A;  3L0Q A;  1LAV A;  3HBT A;  3OA9 A;  3DLH A;  3TAN A;  3UKR A;  3MEE A;  1S9E A;  2NUB A;  3E9L A;  4ELV A;  1QQM A;  1YIJ N;  1CXU A;  1K8K A;  2Q31 A;  3VES A;  4BC5 A;  1C0T A;  3RSE A;  4B1U B;  1MWK A;  1RDD A;  1WSE A;  3IKM A;  5F2R A;  2NRX A;  1TAU A;  2P5G A;  4YOW A;  4CHO A;  3ZSQ A;  3VQB A;  2NRT A;  1OVY A;  3BY5 A;  3SYZ A;  1UA1 A;  2OZS A;  4YFU A;  3IS9 A;  4KTQ A;  4BG9 A;  4E7I A;  3HZ6 A;  1BQN A;  4FL9 A;  4RW8 A;  2NRH A;  3QLH A;  4QOZ B;  3HT3 A;  2BGG A;  2E8A A;  5AQV A;  3CQ8 A;  3THX B;  3VQ9 A;  3TWH A;  3ZT4 A;  1GLB G;  3U4L A;  3K5M A;  2GUI A;  1RT6 A;  3M8S A;  1ZBU A;  3K9K A;  3AVL A;  5LMN K;  4GV6 A;  4JS4 A;  4AM6 A;  4OVL A;  4WQ5 A;  3PLA A;  1T6C A;  4O4G A;  3CMA N;  1RT4 A;  2QWO A;  4IEE A;  3SUP A;  2X74 A;  1C1A A;  4N56 A;  4CHZ A;  3J7A P;  2EX3 A;  3J81 O;  2HHW A;  4JK7 A;  3I8B A;  2A40 A;  2D4W A;  4FWP A;  2D0C A;  5M1N A;  4BRG A;  4DFP A;  1EWQ A;  3P38 A;  1E4F T;  5AJ3 K;  1HNZ K;  4FLV A;  4UY8 O;  1GLA G;  3H1V X;  2E2N A;  5LJV A;  3CXC M;  4CFD A;  4XIU A;  2QW9 A;  2YI1 A;  1X9J A;  5IT9 O;  3K5L A;  2D0O A;  1RTI A;  3CYM A;  3WNE A;  2F8S A;  2B5J A;  4IKF A;  4DUZ K;  1VK0 A;  3AAQ A;  4JKB A;  4LSN A;  1S1X A;  3BZK A;  1KVC A;  4YDU C;  5JLH A;  1JXB A;  5AZI A;  3MXJ A;  4RW9 A;  2OTJ N;  5EY4 A;  1Q8I A;  3QNO A;  4CJ7 A;  3ULD A;  3LM2 A;  3T3F A;  4M45 A;  2KTQ A;  4J2A A;  3DLE A;  1BGX T;  3LL3 A;  4K0K K;  4Z4H A;  1YJN N;  3CQX A;  2ZJR L;  1TKT A;  2HOE A;  3AO4 A;  3LP3 A;  3ULE A;  4CK1 A;  3M6G A;  4DF8 A;  3MCP A;  1L3T A;  1HLU A;  4DTJ A;  3CHW A;  2B6A A;  4FJL A;  3SV3 A;  2F96 A;  3VA3 A;  3SAG A;  1RIL A;  1ATN A;  4KH5 A;  3HVT A;  2HMI A;  1OKJ A;  4KHQ A;  4CEE A;  2UUB K;  3MWT A;  4PA1 A;  4CJR A;  4EHU A;  1H1V A;  2Q0U A;  1HPZ A;  4B9U A;  5KRT A;  2VG5 A;  2G8F A;  3OYG A;  3OYN A;  3ZT0 A;  4H5W A;  4CEA A;  2P9P A;  3A0I X;  1CXQ A;  4CZF A;  4BQZ A;  1RBT A;  4FJK A;  4KKO A;  4CE9 A;  3FR0 A;  3M3Z A;  4H5N A;  3TR8 A;  5JMV A;  4DS5 A;  2VQF K;  3FLC O;  1S72 N;  4CIE A;  3OYE A;  3L2V A;  4JI3 K;  2A41 A;  2V7Y A;  1JL1 A;  3NF8 A;  4YOX A;  1DKG D;  1S6P A;  1QZ6 A;  3CET A;  3LAK A;  4BGA A;  1U47 A;  4DMN A;  2O8D A;  5HRS A;  4IO8 A;  2F9T A;  4DSK A;  2NNW A;  4M3U A;  2PY5 A;  2I5J A;  4JHD B;  1REV A;  2PZS A;  4JI8 K;  1U4B A;  3HSC A;  3VQ7 A;  1OH6 A;  5KPR A;  1QZ5 A;  4FWM A;  4CZJ A;  2RF2 A;  3TAQ A;  3G10 A;  2JWK A;  4EP4 A;  3IUC A;  1XQS C;  1VQP N;  2P9K A;  3CJ7 A;  2A1R A;  3QET A;  1WN7 A;  4AHR A;  4IWV A;  4NB4 A;  2O4I A;  1IJJ A;  3S3M A;  3I8D A;  2O8F B;  4Z4I A;  1S9G A;  3PO5 A;  3R9P A;  3ID6 A;  4HCB A;  3VA0 A;  4N41 A;  2AA4 A;  2GEM A;  3DXM B;  4DV1 K;  3THV A;  1K9M O;  5LY3 A;  4BRM A;  3O1W A;  3O9T A;  4B9V A;  3CME N;  3H6E A;  4DV3 K;  1D4X A;  3AA4 A;  2XO7 A;  1K6Y A;  2G8K A;  3CJ1 A;  3VER A;  4YHH K;  4H0O A;  2IVO A;  3LDS A;  4B9M A;  4A2B A;  2ZWH A;  2IVP A;  5FPE A;  2KQ2 A;  4I6M B;  4M3Y A;  1U48 A;  3JSM A;  3PSI A;  2UU9 K;  3OYC A;  5AQJ A;  1X1P A;  4CJF A;  1SL0 A;  4H4M A;  4W5Q A;  3F73 A;  3QFP A;  3CIP A;  4CBW A;  4HTL A;  3NH1 A;  1NLV A;  1Q7Y O;  1VQ5 N;  5AQX A;  2P9L A;  3VEX A;  4C23 A;  2X6N A;  1BCM A;  2O8B A;  3DRR A;  2E2O A;  3D2E A;  3C0B A;  3QEI A;  4H5T A;  3CJA A;  2G8W A;  1J53 A;  2ZF5 O;  3KK7 A;  2P9I A;  3KK1 A;  5E26 A;  3OYD A;  4JK8 A;  4DLE A;  2P9U A;  1VRU A;  3K2P A;  1VRT A;  2W42 A;  5CHI A;  1NJZ A;  4R5P A;  4HUF A;  3FE1 A;  3VF6 A;  3PX4 A;  4Z4G A;  1NGC A;  1S1W A;  3AVM A;  4AHC A;  3ISN C;  4DUY K;  1KVB A;  1A5X A;  3OYL A;  3K57 A;  4CEQ A;  2QXL A;  1YT3 A;  5ADX H;  4F2R A;  5SZT A;  4DR2 K;  1NMD A;  4A62 A;  4J2D A;  2Y1I A;  4M3T A;  4DV0 K;  2FSK A;  4FLZ A;  4F9O A;  4C8L A;  4AIL C;  4V19 S;  1RNH A;  4CJU A;  1I39 A;  4KHP K;  4E7H A;  4O5F A;  5M1Q A;  1LW2 A;  1Z26 A;  3OBY A;  2P51 A;  2V52 B;  3KLE A;  3P4I A;  3SPZ A;  1EP4 A;  1C1B A;  1NK5 A;  1N33 K;  2DFE A;  4CGD A;  3CFO A;  3CC4 N;  2Y1J A;  4I2Q A;  2HHV A;  1WUA A;  4CFB A;  2KZM A;  4GW6 A;  2V51 B;  2ZM6 K;  3KD1 E;  4GKK K;  4B1W B;  4QS9 A;  3SMP A;  1R0A A;  1NJY A;  2KZZ A;  3ZT3 A;  3RR8 A;  1OVQ A;  1ZBF A;  4E7J A;  1HMV A;  2NRW A;  4FK2 A;  4BR9 A;  3EYZ A;  4IOX A;  4BRI A;  1ASW A;  4WCE L;  2GWK A;  4MLH A;  4BRD A;  4A59 A;  1NGH A;  3L6Q A;  2VGN A;  4H5V A;  3QEP A;  4H0V B;  1TKX A;  2ZJP L;  4CD3 A;  3HOT A;  3QEW A;  3MX5 A;  3ZLJ A;  3VGL A;  1TYQ B;  4I7F A;  2QWQ A;  5HRP A;  4Q0B A;  5HRR A;  3JXU A;  4MO5 A;  2QEX N;  1UWB A;  4XEI A;  4BRP A;  4C8K A;  5AQK A;  2E1Z A;  1SAZ A;  1GLL O;  4NO7 A;  4CJE A;  4DTN A;  4W5N A;  4O0J A;  3H3N O;  1KAY A;  3THY B;  2QWP A;  4A57 A;  4BG8 A;  3AY9 A;  1KFS A;  4H03 B;  5I3U A;  2XY8 A;  4CZH A;  1KCF A;  4CGH A;  3A8Y A;  3M8R A;  1D9D A;  4M42 A;  3TTC A;  2WTU A;  4JLH A;  5FDL A;  1S1U A;  3L3U A;  5CR4 A;  4KV8 A;  4KAZ A;  4FJN A;  3V9S A;  2IOC A;  1MWM A;  2OA8 A;  3ZX2 A;  4GVM A;  3J8A A;  1B9F A;  3NF6 A;  1TK0 A;  1NU0 A;  2P9N A;  5E41 A;  2E88 A;  3GE1 A;  3WXL A;  3NMU A;  3AVJ A;  1LCU A;  5DM6 L;  4CF8 A;  4OPA A;  4WQ4 A;  1Q81 O;  4FXD A;  2NLX A;  5BRD A;  4W5O A;  1DT9 A;  3O3F A;  2FLO A;  2CH5 A;  1A5V A;  3AA3 A;  3CCV N;  3TSU A;  1WNS A;  4C1N K;  1LV5 A;  1LWC A;  2Q3S A;  3MK6 A;  3UKR B;  1WAF A;  1Y97 A;  2E1Y A;  3MN9 A;  2O8C A;  4JD2 A;  3S3N A;  1K8K B;  3LWL A;  1Y64 A;  3RSE B;  3CCE N;  4TSX A;  4BAC A;  1IKX A;  5BN9 A;  4CEC A;  4BE1 A;  3R8E A;  3VF4 A;  3ZSZ A;  4MQ3 A;  4H0Y B;  3V81 A;  3CC7 N;  3ZX0 A;  2D0A A;  3DOK A;  1VSE A;  4FWN A;  2DY4 A;  1T6D A;  2BDP A;  3V4I A;  2UUA K;  1YJ9 N;  3KTQ A;  3G25 A;  4AH9 A;  2Q2R A;  3NCI A;  1XI1 A;  3WXJ A;  2Q1N A;  3KKS A;  1U45 A;  4CEB A;  3MN6 A;  3THW A;  3K59 A;  2G8I A;  3EO3 A;  1XUP O;  5F0X A;  1KAZ A;  1TKZ A;  3AV9 A;  2GV9 A;  1HJR A;  5LL6 Z;  3PV8 A;  4JKG A;  3OS1 A;  2NZT A;  3UB5 A;  5KGW A;  4IXC A;  3EKS A;  4B1Y B;  3C95 A;  4G9Z A;  4NYF A;  4KTW A;  5EU7 A;  4IDH A;  3ENB A;  5AQF A;  1TK8 A;  1BQM A;  4PL8 A;  2DPN A;  1HYV A;  3QNN A;  5BRF A;  4FWK A;  4FM0 A;  3L2Q A;  4OX9 K;  4KHU A;  1RT5 A;  3WNF A;  4CK3 A;  4AQY K;  3RRH A;  4MFB A;  3KHY A;  4C8N A;  3TAG A;  5CYQ A;  5HL7 L;  5AZI B;  2HF4 A;  2VYP A;  1TAQ A;  1ESV A;  5JS2 A;  3ATU A;  4BGB A;  3A2F A;  2E6M A;  3I33 A;  4FYD A;  3Q7C A;  1RBR A;  3AA2 A;  4B1X B;  4BRC A;  2CH6 A;  4OKK A;  4CFC A;  4NXM K;  1WB9 A;  1JLQ A;  4H0X B;  4X64 K;  4ICL A;  2YHA A;  3VTI A;  5I42 A;  4BRO A;  4FCY A;  4PKG A;  3ULE B;  4CGG A;  1YTA A;  3CC2 N;  4JV5 K;  3K5O A;  4ILH A;  1X3N A;  3AO2 A;  4DHY A;  1CZA N;  1WSH A;  4IJA A;  3ZYY X;  4B9Q A;  1Q9X A;  3OYJ A;  1E4G T;  1JLC A;  3OY9 A;  4DSE A;  4LC9 B;  3B6O A;  2VQE K;  4FOI A;  2A5X A;  1YUW A;  5J2M A;  3VGK A;  2ASM A;  1WBD A;  1DLO A;  4LF9 K;  2QA4 N;  3AGK A;  3NE6 A;  2CGK A;  2P9P B;  3K5N A;  5BPL A;  1ATR A;  1D9F A;  4Y0W A;  3SQ4 A;  4FJI A;  2JGU A;  5KPT A;  3NH2 A;  4DQ8 A;  1IKY A;  2KLA A;  2HNY A;  3TU5 A;  1JL2 A;  3NGY A;  4Y1C A;  3HP6 A;  4DFM A;  3ENO A;  1L3V A;  1RT2 A;  4O5B A;  2R7Y A;  4FK0 A;  4JEP A;  3AVG A;  3QIC A;  5J2Q A;  3K58 A;  2W41 A;  1HRH A;  1VQ9 N;  2ETJ A;  5DM7 L;  1KRP A;  4FVU A;  4Y1D A;  3I0S A;  4JKF A;  4OO1 J;  1TKD A;  3WEE A;  3KJV A;  3LDN A;  2O8D B;  5M1F A;  3LM9 A;  2VWB A;  4CHQ A;  1OH7 A;  1SS6 A;  1JLG A;  2QKB A;  3MN5 A;  3CCL N;  3CD6 N;  3QBW A;  1T44 A;  3SUQ A;  5J2N A;  5DK5 A;  3AVN A;  4CGI A;  3GBT A;  2VGM A;  4O8U A;  3CFR A;  2YNH A;  1M90 O;  3WXM B;  3VQQ A;  4FPB A;  4E7L A;  2P9K B;  3CPW M;  5HLF A;  3ZEU A;  5KRS A;  4DFJ A;  5HBM A;  4F4K A;  4CD1 A;  4DQQ A;  3SI6 A;  4U67 L;  1HQE A;  3BF3 A;  2QKK A;  3TSP A;  4DTM A;  5FRO A;  3VN5 A;  4CF9 A;  2HHH K;  3HRG A;  2QWN A;  1VQN N;  3IFR A;  3U9Z A;  1BIZ A;  3AAP A;  5CE3 A;  1WSG A;  2ZGY A;  5A2Q O;  4DTR A;  1SKR A;  5SWM A;  3ZCM A;  4KB1 A;  1IH7 A;  3RWU A;  4U7B A;  2BTF A;  2VG7 A;  3D45 A;  3LPT A;  4DU4 A;  1LWF A;  3C94 A;  3TAR A;  4LF8 K;  3J7Y P;  1VQK N;  3VEY A;  2IS3 A;  3WQU A;  3SUN A;  4QS8 A;  4JKD A;  3HJF A;  2ASO A;  2P9L B;  2Q36 A;  4FJJ A;  4K8X A;  4CER A;  5GIN A;  3HM8 A;  3L4Q A;  3HP9 A;  2O8B B;  3D2E B;  3O9U A;  3RMC A;  4EHT A;  1FW6 A;  4LFA K;  1IO2 A;  1JCF A;  3O4Q A;  5JVG L;  1XC3 A;  5BRE A;  4I2P A;  3H08 A;  3TAB A;  2ATQ A;  4QCL A;  2P9I B;  5BPN A;  2Z1I A;  3OYI A;  2VWK A;  1RDW X;  2OPP A;  2P9U B;  4WF9 L;  1IKW A;  4EIA A;  3EE9 A;  3V9Z A;  3QO9 A;  4BY9 C;  4C8O A;  2VWJ A;  1UOC A;  3P83 D;  3PO4 A;  1GLC G;  5AQO A;  3VQ6 A;  4CW7 B;  1SKS A;  2RPI A;  4M7X A;  4NLC A;  1FKO A;  5AZJ A;  3K9J A;  4RTF D;  1YVN A;  4KHN A;  2BUP A;  3KKR A;  3UKU A;  1YXQ A;  4DQS A;  4FWL A;  1N8R O;  3CM6 A;  3U3G A;  3QEX A;  4PUO A;  4ID5 A;  5HRN A;  1NGG A;  3CG7 A;  4RW7 A;  2FBV A;  4BDZ A; 
#chains in the Genus database with same CATH homology
 4JAX A;  3EZW A;  3F2K A;  1NGC A;  3VOV A;  5BR9 A;  2ZJQ L;  4RCH A;  3O80 A;  5AQR A;  4BVP A;  4YOT A;  1S3X A;  3AAR A;  2QXL A;  4BR0 A;  5ADX H;  3G4S N;  1NMD A;  4A62 A;  1BA1 A;  5GAE P;  1K73 O;  3O9S A;  1HKC A;  1YAG A;  2FSK A;  4ISF A;  1JJ2 M;  4BR4 A;  4F9O A;  1NJI O;  2ZGZ A;  2OAN A;  3MDQ A;  4XH5 A;  1KC8 O;  1ZC6 A;  2EWS A;  3TTF A;  5AQH A;  4CZM A;  4WQ4 C;  4O5F A;  5M1Q A;  4CZG A;  4E1J A;  2H3G X;  5FPN A;  2W40 A;  3OBY A;  2V52 B;  3H1Q A;  3P4I A;  2GX9 A;  1ATS A;  4BQL A;  3KVG A;  3SJH A;  1RGI A;  2JWL A;  3Q7B A;  1QHA A;  4IOC L;  3BF1 A;  3E1Y A;  3OW2 M;  3GG4 A;  1P8Z A;  3CC4 N;  1WUA A;  3EKU A;  2V51 B;  2NRR A;  3DLL L;  4DKW A;  5GAD P;  1KXP A;  2AP1 A;  2YX6 A;  3BEX A;  1NGF A;  4B1W B;  4QS9 A;  3SMP A;  3A5L C;  2I7N A;  1V4T A;  3D6R A;  3QDK A;  2NRW A;  5EX5 A;  3CCJ N;  1M1K O;  1VQ4 N;  2A3Z A;  4BR9 A;  3ZX3 A;  1G99 A;  4IOX A;  2HBL A;  1RFQ A;  3H45 C;  4BRI A;  4WF9 L;  2YCH A;  4WCE L;  1NBW A;  5AQS A;  1MA9 B;  2GWK A;  4MLH A;  2D1K A;  4BRD A;  3E66 A;  1NGH A;  5EXW A;  3MWP A;  4A59 A;  4ILJ A;  1KAX A;  3L6Q A;  1U6Z A;  2VGN A;  3NVM A;  4H5V A;  5KPZ A;  4H0V B;  2ZJP L;  4CD3 A;  5F1X A;  3MCA B;  3O1B A;  3HOT A;  3MX5 A;  5AQG A;  3VGL A;  5E84 A;  2GTD A;  1TYQ B;  2E2P A;  2QWQ A;  3DAW A;  4WYB A;  5AR0 A;  3MX2 A;  3KWG A;  4GY2 B;  3P39 A;  1Z6R A;  3JXU A;  3ENH A;  4JN4 A;  4MO5 A;  1DEJ A;  2P9S B;  5EVZ A;  2QEX N;  4A5B A;  4XEI A;  5ELZ A;  4BRP A;  3R1X A;  3H3O B;  4GVE A;  2E1Z A;  5AQK A;  5GAH P;  3WXI A;  5KQ8 A;  1J6Z A;  5AQZ A;  5M1K A;  1SAZ A;  4K43 A;  1GLL O;  4NO7 A;  4BC3 A;  4BRL A;  4JKE A;  3W0L A;  1W97 L;  4JNE A;  3C6H A;  3H3N O;  1KAY A;  2QWP A;  2ITM A;  1TYQ A;  4A57 A;  2NRZ A;  3AY9 A;  2IVN A;  4FO0 A;  4BG8 A;  4GV9 A;  3J7Z O;  4H03 B;  5GIP A;  3LDL A;  4MO4 A;  3VMF B;  1HJO A;  4CZH A;  3FGU A;  5GAG P;  2P9N B;  5H1S Q;  2P9S A;  3A8Y A;  3OBW A;  3C65 A;  4CZE A;  4IZ9 A;  3TTC A;  2I7P A;  4ILG B;  4YOV A;  5CR4 A;  1EQY A;  5BRH A;  3H46 O;  1HKG A;  1MWM A;  2UYT A;  3ZX2 A;  2WFB A;  2PAV A;  5C12 A;  1EO1 A;  5AQY A;  3C7N A;  3J8A A;  4HWI A;  4C1N I;  5C10 A;  3RVC A;  3I55 N;  1BUP A;  2OTL N;  3FZH A;  1HUX A;  5C15 A;  2BH1 A;  2P9N A;  2E88 A;  3DXK B;  1SZ2 A;  3GE1 A;  3WXK A;  3WXL A;  3OHR A;  3NMU A;  3CJ9 A;  3PIO L;  1LCU A;  5DM6 L;  4JD2 B;  5ADX A;  2RE2 A;  1ZXO A;  1JCG A;  4OPA A;  4NLB A;  4WQ4 A;  1Q81 O;  2V7Z A;  1R59 O;  1NGA A;  2NLX A;  5BRD A;  1DT9 A;  3MMV A;  2WBN A;  4K42 A;  2FLO A;  2KHO A;  3DJC A;  3LDP A;  1VQ7 N;  3WT0 A;  4CZL A;  1BDG A;  5BPM A;  2CH5 A;  4A61 A;  3SAF A;  3HI0 A;  3TSU A;  3CCV N;  4C1N K;  3CF5 L;  3DXK A;  3SLC A;  1NGI A;  3F9M A;  3MK6 A;  3UKR B;  2E1Y A;  2F7T A;  3N4Q A;  4QS7 A;  5FPD A;  3MN9 A;  4JD2 A;  4M7Y A;  2CGJ A;  3FFK B;  3GDQ A;  2HMP A;  1YHQ N;  1K8K B;  3FZM A;  3MN7 A;  5AQU A;  4IFE A;  3VEW A;  5C2D A;  2YHW A;  2FF3 B;  1Y64 A;  3RSE B;  3CCE N;  5C2F A;  3O08 A;  4EAH D;  4ISG A;  3SBG A;  1Z05 A;  5BN9 A;  4BRE A;  3WQT A;  3EN9 A;  3L0Q A;  2VCP A;  3L4I A;  2ASP A;  3OA9 A;  3HBT A;  3GL1 A;  4JKA A;  3EE8 A;  5M1P A;  3R8E A;  3S41 A;  2RHK A;  3VEZ A;  3VF4 A;  3FZL A;  4JKH A;  3E9P A;  4H0Y B;  3UKR A;  1YF5 L;  2NRV A;  1BU6 O;  4BRH A;  3CC7 N;  3ZX0 A;  4Z94 A;  4GNI A;  3E9L A;  5EOY A;  4WFN L;  1QQM A;  1YIJ N;  4FWN A;  1TUY A;  4BRF A;  1K8K A;  1T6D A;  2Q31 A;  3VES A;  4BC5 A;  3RSE A;  4B1U B;  1YJ9 N;  1MWK A;  4JKG B;  3IKM A;  3G25 A;  5F2R A;  2NRX A;  4YOW A;  5M1O A;  3LDQ A;  3O8M A;  1KD1 O;  2Q2R A;  3VF2 A;  2NRT A;  1OVY A;  4B1Z A;  3VGM A;  3WXJ A;  4A5A A;  2Q1N A;  4FWO A;  3MN6 A;  4BG9 A;  3HZ6 A;  3BP8 A;  3EO3 A;  1XUP O;  4FL9 A;  5F0X A;  2QI2 A;  1KAZ A;  4KH6 A;  2NRH A;  1K8A O;  3VEN A;  3IDH A;  3CCU N;  4JKG A;  3A5N C;  2E8A A;  2GEL A;  5AQV A;  4PHT X;  2NZT A;  2YJF A;  5FPM A;  3O5B A;  3N4P A;  3UB5 A;  1GLB G;  4BC2 A;  3U4L A;  4BRN A;  4YOY A;  5JVH L;  4IXC A;  3TSQ A;  5C0Y A;  3EKS A;  3K9K A;  4B1Y B;  3FZF A;  4G9Z A;  3CI5 A;  4IDH A;  3ENB A;  5AQF A;  2Q0R A;  4GV6 A;  1SQK A;  4AM6 A;  5MLC Q;  4PL8 A;  2DPN A;  1HX1 A;  4WQ5 A;  1Q18 A;  3PLA A;  1QVG M;  1T6C A;  2FXU A;  3CMA N;  2QWO A;  5BRF A;  1GLF O;  4FWK A;  4IEE A;  3VEV A;  4ISE A;  4FWS A;  3E9O A;  3VET A;  1VQ6 N;  4K25 A;  4MDA A;  1U2V B;  4O8K A;  4J8F A;  1NWK A;  3I8B A;  4JK7 A;  2A40 A;  2D4W A;  2QM1 A;  2J4R A;  3CER A;  4FWP A;  5M1N A;  3KHY A;  5AQL A;  4BRG A;  3IMX A;  1YI2 N;  3P38 A;  1ILY A;  1E4F T;  1QVF M;  4IJN A;  3CCR N;  1NGB A;  5JLF A;  4UY8 O;  1GLA G;  3H1V X;  5HL7 L;  2E2N A;  3KZB A;  4FWR A;  5LJV A;  3CXC M;  5AZI B;  1DGK N;  2HF4 A;  2VYP A;  3UE5 A;  3ZET B;  3C7N B;  2QW9 A;  2YI1 A;  4YOU A;  1ESV A;  4DCH A;  1X9J A;  3ATU A;  4BGB A;  2E20 A;  3I33 A;  2D0O A;  3M1F A;  4L3Q A;  3BUZ B;  1U2V A;  3ATV A;  3Q7C A;  4B1X B;  4BRC A;  2CH6 A;  3AAQ A;  4JKB A;  3HOS A;  4B1V A;  4H0X B;  4BC4 A;  4YDU C;  3VTI A;  5JLH A;  1NGD A;  4WQ5 C;  5AZI A;  4BRO A;  5TKW A;  3ZET A;  4PKG A;  4PL7 A;  4BR5 A;  1VQL N;  2OTJ N;  3ULE B;  5EY4 A;  1BWF O;  2HBK A;  4K41 A;  4CJ7 A;  3LM2 A;  4H5R A;  3TPQ A;  4BRA A;  3CC2 N;  2HF3 A;  4ILH A;  4WFA L;  3G6E N;  1BA0 A;  4FWQ A;  1X3N A;  5TKY A;  3O6W A;  3SK3 A;  4DHY A;  4OPH A;  1CZA N;  4FSV A;  5AFU A;  1C0F A;  3LL3 A;  4IJA A;  3ZYY X;  5B8H A;  4B9Q A;  1YJN N;  5KQD A;  1X3M A;  1E4G T;  3CQX A;  5LJW A;  2ZJR L;  2GWJ A;  2HOE A;  4KH4 A;  4AM7 A;  5AQI A;  4LC9 B;  3ULE A;  3M6G A;  4DB3 A;  3CCS N;  3VTH A;  3MCP A;  2A5X A;  4FOI A;  1YUW A;  5AQW A;  3D7E O;  1HLU A;  3VGK A;  1HPM A;  4WFB L;  3DWL A;  2ASM A;  3CHW A;  3I56 N;  3CQY A;  2QA4 N;  3AGK A;  3EL2 A;  2CGK A;  2P9P B;  3SAG A;  1ATN A;  3ID8 A;  1ATR A;  4KH5 A;  5BPL A;  1VQO N;  4CBU A;  4Y0W A;  5AFU H;  3QFU A;  1OKJ A;  5KPT A;  4IO9 L;  2PBD A;  3R6M A;  2KLA A;  3WEE B;  4BR2 A;  4DQ8 A;  2QTD A;  3MWT A;  4EHU A;  3TU5 A;  3P31 A;  1H1V A;  2Q0U A;  3A5O C;  1JCE A;  4M63 C;  3ENO A;  4JEP A;  3QIC A;  2FSJ A;  3SBT A;  4H0P A;  4MLE A;  2W41 A;  1VQ9 N;  4FVU A;  5DM7 L;  4H5W A;  3PIP L;  4PKI A;  2P9P A;  1HKB A;  3A0I X;  3QB0 A;  2HBM A;  4JKF A;  4CZF A;  4BQZ A;  4OO1 J;  3QML A;  2WUS A;  2QWL A;  4EFH A;  1GLD G;  2PFU A;  3B8A X;  3WEE A;  3FR0 A;  3LDN A;  2IIR A;  3M3Z A;  4H5N A;  5M1F A;  3LM9 A;  2VWB A;  1ZBS A;  2WC9 A;  1YIT N;  3ZEU B;  5JMV A;  5I9E B;  1SS6 A;  3MN5 A;  3CCL N;  3CD6 N;  3QBW A;  1T44 A;  3O9Q A;  3FLC O;  1S72 N;  3CCM N;  1BO5 O;  5HOO A;  3SMS A;  4GV3 A;  1NM1 A;  2A41 A;  3GBT A;  5GIO A;  2V7Y A;  2VGM A;  4KBO A;  4O8U A;  4YOX A;  1Q82 O;  1DKG D;  3CET A;  1QZ6 A;  4BGA A;  2F9W A;  1M90 O;  1VQ8 N;  3WXM B;  4FPB A;  1WOQ A;  4MDB A;  4IO8 A;  2P9K B;  2F9T A;  3CPW M;  2YHX A;  3ZEU A;  2YHY A;  1YJW N;  2NNW A;  3W3D A;  4CD1 A;  4U67 L;  4JHD B;  3BF3 A;  2QWR A;  3HSC A;  3VEO A;  1QZ5 A;  4FWM A;  4YDU A;  5KPR A;  1V4S A;  1P90 A;  3A5M C;  3T69 A;  1T3V A;  4CZJ A;  5BN8 A;  3TSP A;  4A2A A;  1BG3 A;  3C6A A;  5AQQ A;  2JWK A;  3T7Z A;  3FZK A;  4YOR A;  3IUC A;  1XQS C;  3O4W A;  3HRG A;  2QWN A;  4JK9 A;  3WUH A;  1VQP N;  2P9K A;  1BOT O;  1VQN N;  3IFR A;  3CJ7 A;  4JKC A;  1QQN A;  2D0P A;  3U9Z A;  3AAP A;  5AQT A;  4IWV A;  5CE3 A;  3VPZ A;  4NB4 A;  4JHD A;  2ZGY A;  1IJJ A;  1S22 A;  4XH1 A;  2A6A A;  3R9P A;  1O13 A;  3ID6 A;  4U7B A;  1LOT B;  4CZI A;  2AA4 A;  2GEM A;  2BTF A;  3DXM B;  3TTD A;  1K9M O;  5LY3 A;  4BRM A;  5AQM A;  3O1W A;  3O9T A;  3CME N;  3H6E A;  3KWI A;  4BR7 A;  1D4X A;  2Q97 A;  1VQK N;  3VEY A;  3U8X A;  3CCQ N;  2QWM A;  3WQU A;  3CJ1 A;  4QS8 A;  1QQO A;  3VER A;  4JKD A;  2ASO A;  2IVO A;  4H0O A;  4AF1 A;  4A2B A;  4RWT A;  2P9L B;  2Q36 A;  2ZWH A;  4CBX A;  3SAH A;  5GIN A;  2IVP A;  2A42 A;  3DXM A;  3HM8 A;  3L4Q A;  5FPE A;  1GLE G;  3QBX A;  3D2E B;  3O9U A;  4I6M B;  4CZK A;  4EHT A;  4IOA L;  4PKH A;  1VQM N;  1JCF A;  1VAZ A;  5JVG L;  4BRK A;  1XC3 A;  5AQJ A;  5BRE A;  1TUU A;  3JS6 A;  3M5R A;  2HBJ A;  3D2F B;  1GLJ O;  4R79 A;  5AQN A;  2P9I B;  5BPN A;  3O9R A;  3QFP A;  3CIP A;  5AZJ B;  4CI6 A;  1KQS M;  4CBW A;  4HTL A;  3HTV A;  1NLV A;  1MDU B;  1RDW X;  1Q7Y O;  1VQ5 N;  5AQX A;  2P9L A;  4FOE A;  2P9U B;  3VEX A;  4C23 A;  1RDU A;  3LDO A;  4FPA A;  3EE9 A;  4EIA A;  3CJC A;  3AGR A;  1W2B M;  2E2O A;  3UKU B;  2GUP A;  3D2E A;  2FF6 A;  4I6M A;  3G71 N;  4BY9 C;  2KKZ A;  1C0G A;  5JIC A;  3C0B A;  3GOI A;  1GLC G;  4H5T A;  3CJA A;  5AQO A;  2FSN A;  2ZF5 O;  5AQP A;  2E2Q A;  3D2F A;  3CJB A;  4M7X A;  3KK7 A;  2P9I A;  3CPE A;  3NVK A;  4NLC A;  2HST A;  3K9J A;  4RTF D;  5AZJ A;  5E26 A;  4JK8 A;  2P9U A;  1YVN A;  2CGL A;  1IG8 A;  1NGJ A;  4BRQ A;  2BUP A;  3UKU A;  1YXQ A;  3F5T A;  1NGE A;  4FWL A;  5CHI A;  4H0T B;  4BVO A;  1Q86 O;  1N8R O;  3U9D A;  3FE1 A;  3R3L A;  1NGG A;  3VF6 A;  4IEI A;  4XH4 A;  2YJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...