3SK3A

Crystal structure of salmonella typhimurium acetate kinase (acka) with citrate bound at the dimeric interface
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
398
structure length
385
Chain Sequence
b'SKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGGDIDPAIIFHLHDTLGMSVDQINKMLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
molecule tags Transferase
source organism Salmonella enterica subsp. enterica serovar typhimurium
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
total genus 133
structure length 385
sequence length 398
chains with identical sequence B
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A02
4BG8A 3ENOA 4H5RA 4C23A 5FPNA 2A3ZA 3M1FA 1NBWA 3VOVA 4XH5A 3VEXA 4BR2A 3VF4A 2H3GX 3B8AX 4RWTA 3WUHA 2HMPA 3CHWA 1MWMA 4B9QA 2ASPA 2E20A 3CERA 4FWLA 3SK3A 1HKCA 5AQYA 4CZFA 4DHYA 4BG9A 2NLXA 4JHDA 3TPQA 4FWSA 4BRDA 5B8HA 5KPTA 4H0VB 3A5NC 3A5LC 3A5OC 1C0FA 5AQVA 3GDQA 4H5NA 3H6EA 2CH5A 4RTFD 2VWBA 3CETA 3J8AA 4IXCA 4CD3A 4GNIA 5AQIA 3QFPA 2Q36A 4CZLA 2YHXA 3DXKB 3IMXA 4CD1A 4QS8A 3LM9A 5AQSA 3JS6A 5BPLA 4BRHA 5AQWA 4BC5A 4WQ4C 2QWQA 3G25A 2ZF5O 1P8ZA 5AQQA 1DEJA 3IDHA 3QMLA 2P9SB 2P9IB 2D4WA 5JLFA 4ISEA 4EIAA 2FLOA 1YUWA 4WQ5C 3HSCA 1IJJA 3IFRA 1NGBA 1QHAA 3P4IA 4BC2A 4I6MA 2E8AA 4M63C 3LDPA 5BPNA 3H1QA 1YVNA 1U2VA 3O4WA 4BRIA 5EVZA 1GLLO 2I7NA 1NMDA 3FZFA 1HX1A 2P9NB 3QICA 5FPDA 4H5TA 1KXPA 3UE5A 4BVOA 3CJCA 3HM8A 2IVPA 2P9IA 2Q1NA 1E4GT 4JNEA 3GOIA 2P9KA 1BA1A 2QM1A 5EY4A 5JLHA 4FWQA 3VEVA 5AQLA 3FZLA 2GWJA 4DB3A 2DPNA 3I8BA 4H0XB 4CBWA 1RDWX 3VGKA 3WXKA 2E1YA 3I33A 4BRAA 1V4SA 4B1VA 2PBDA 5BN9A 1HKBA 1BU6O 2VYPA 3WXJA 4BRQA 3O80A 1MWKA 4BR9A 2P9UB 3CJBA 4BRFA 2D1KA 3HI0A 2A41A 1MA9B 1Z05A 4CBXA 2FSNA 3H45C 4K42A 3HTVA 4WYBA 2IIRA 4IWVA 4A61A 5EX5A 1GLEG 3O08A 5LJVA 3D2EA 4LC9B 1HKGA 3BEXA 1T44A 4KBOA 3EZWA 1KAZA 3VETA 4MLEA 5KPRA 3HBTA 2V52B 4BROA 3WEEA 3W0LA 3LM2A 1GLBG 4BRPA 2YJEA 1OKJA 1TUYA 3R9PA 4B1ZA 1QZ6A 2GTDA 1XQSC 4JD2A 1JCEA 1X9JA 3EO3A 4HTLA 2E2OA 3A0IX 3A5MC 4PL8A 3RSEB 4AM7A 3MCPA 2A5XA 4K43A 3VGMA 2QWOA 5ADXA 3VEZA 4BR0A 1DGKN 3VEYA 5F0XA 1QZ5A 1LOTB 4K25A 3VENA 1TYQA 4PKHA 3SMSA 5F2RA 4Y0WA 1JCGA 1K8KA 2E2PA 4BQZA 5AZIA 2QWLA 3UKRA 3QB0A 3KHYA 3ZETB 4EAHD 5BRHA 2IVOA 4JD2B 4I6MB 1BWFO 3FR0A 2P9KB 3DAWA 4H5VA 1QQOA 2QW9A 3GE1A 3LDQA 4FPBA 3AARA 4IJAA 4K41A 1GLDG 4MLHA 4BREA 1ZC6A 1K8KB 2ASMA 5ELZA 5ADXH 4XH1A 2ZGZA 2FXUA 4FWNA 4B1XB 1BA0A 3H46O 3WXIA 5FPMA 1NGGA 3C0BA 1JCFA 4WQ5A 3VEWA 4CZMA 4CJ7A 2V7ZA 3MN7A 3SMPA 1NM1A 2J4RA 2UYTA 2WUSA 4DQ8A 4FOIA 1Y64A 4BR5A 2P9UA 3EKUA 3CJAA 2AP1A 1XUPO 4BC4A 5JICA 1R59O 2GEMA 4FSVA 4J8FA 3H1VX 3WXLA 3ZEUB 2GUPA 4B1UB 1HJOA 4CZJA 2Q0UA 3BF3A 2PAVA 3LDLA 3QFUA 3L4IA 4H03B 3VF6A 2VCPA 5CE3A 3MK6A 3FFKB 3D7EO 5BN8A 4JHDB 1XC3A 3LDOA 3MDQA 3H3NO 5KPZA 1S22A 3VEOA 2EWSA 3DWLA 4Z94A 5BPMA 1NGFA 3ZEUA 2YI1A 4GY2B 1X3MA 4IZ9A 2QXLA 1GLJO 2QWNA 3CQXA 3IUCA 4WQ4A 3EN9A 3WQTA 2I7PA 5AZJA 5AQGA 1SAZA 3L6QA 2CGJA 3D2FB 1NLVA 2FF3B 4FWOA 4EHTA 4F9OA 2CGKA 4JN4A 3R6MA 3WQUA 5KQDA 2P9LB 1T6DA 3QBWA 3VERA 5AQNA 2E88A 3D2FA 3ULEB 1LCUA 4EFHA 4CZKA 5AQRA 5AQKA 4A62A 2F9TA 2FSKA 1SQKA 1D4XA 4H0YB 3ZX3A 1NGEA 4ISFA 4IJNA 5LY3A 2E1ZA 4QS7A 3ATUA 3LDNA 3AAQA 2OANA 2A40A 1BG3A 1X3NA 2D0PA 3BUZB 3CJ7A 2P9NA 3DXMB 3MN5A 2A6AA 2D0OA 5EXWA 3ULEA 3LL3A 3C7NA 3RSEA 1U2VB 3DJCA 4O8KA 2ZWHA 2A42A 2GWKA 2FSJA 5AFUH 1NGAA 5E84A 5JMVA 1GLFO 5AQHA 1QQMA 4H0OA 1H1VA 3C7NB 4FWRA 4FWPA 1BO5O 1WUAA 3D2EB 5KQ8A 2FF6A 2W40A 4L3QA 4BC3A 1EQYA 3JXUA 5F1XA 3UB5A 1C0GA 4FO0A 5AFUA 1WOQA 3ZX2A 1NGIA 4CZHA 3L0QA 3CI5A 1NGHA 4BGBA 3EKSA 2YHYA 4E1JA 5AQOA 3O1WA 3AY9A 2E2NA 5AQJA 5EOYA 2GELA 4BRMA 1TUUA 2HF3A 3AAPA 5BREA 2W41A 4DCHA 4ISGA 3O1BA 1RGIA 1U6ZA 3ATVA 3ZX0A 4CZEA 4H0PA 3WEEB 5AQTA 5E26A 3QDKA 3VESA 2P9LA 5FPEA 2P9SA 4BR4A 4IO8A 3U4LA 1HPMA 3DXKA 3S41A 1ATNA 3GL1A 4BRGA 4A2BA 4A2AA 3OHRA 3BP8A 4YDUC 5AZIB 3HZ6A 3ID8A 3O6WA 2ASOA 2QWRA 1S3XA 2P9PB 3MMVA 4BR7A 2KHOA 2Q0RA 3FZHA 1KAYA 3ENHA 5I9EB 3M6GA 3FE1A 4H0TB 3DXMA 5LJWA 4M7XA 3M3ZA 4BRKA 1ATRA 3CIPA 1Z6RA 3FZKA 4XEIA 1YXQA 2YCHA 3UKUB 1BOTO 4M7YA 1GLCG 3CJ1A 5AQPA 5TKYA 4BRCA 4QS9A 2NRHA 1DKGD 4MO4A 3MN6A 4YDUA 4EHUA 1QQNA 5BRFA 2AA4A 3VPZA 4FPAA 5AQMA 3UKUA 1V4TA 4FL9A 5BRDA 1E4FT 1MDUB 1CZAN 3U9ZA 1RFQA 2Q97A 3A8YA 2HF4A 2IVNA 3CJ9A 3CQYA 3TU5A 4O5FA 2E2QA 1ZXOA 2Q2RA 3QBXA 5AZJB 3FGUA 2V51B 3SLCA 3U8XA 1Q18A 3MN9A 3KZBA 4PKGA 4BGAA 4CI6A 5AQZA 2NZTA 4BRNA 1BDGA 4CZGA 1HUXA 5BR9A 2F9WA 4NO7A 1SZ2A 2BTFA 1HLUA 4BQLA 2V7YA 3VGLA 5AR0A 1J6ZA 2HOEA 3F9MA 4B1WB 1BUPA 1GLAG 3O5BA 2YJFA 3BF1A 2Q31A 4XH4A 3R8EA 1YAGA 1TYQB 3WT0A 3VF2A 2YHWA 2ZGYA 3EL2A 3ZETA 2ITMA 4RCHA 3FZMA 3W3DA 2QWPA 1T6CA 4BRLA 1ESVA 5AQUA 1IG8A 1NWKA 4FWMA 2CH6A 1G99A 2P9PA 3FLCO 4FWKA 1NGDA 1NGCA 4B1YB 4JAXA 3H3OB 3KVGA 4CBUA 3U9DA 3UKRB 5AQXA 1NGJA 4BVPA 4HWIA 4NB4A 3O8MA 5AQFA 2CGLA 2QWMA 4MO5A 4AM6A 1ZBSA 1KAXA 3GBTA 4PL7A 4H5WA 3GG4A 3SJHA 1ATSA 2BUPA 4FOEA 4CZIA 4PKIA
chains in the Genus database with same CATH superfamily
4JKEA 3NE6A 4H5RA 4NXMK 4CEDA 4CIGA 2A3ZA 5EU7A 1WAFA 4GMJB 4BR2A 4C8OA 2H3GX 4OKJA 4Z0UA 1VSEA 3VQ9A 3CHWA 3CERA 4FWLA 4BG9A 1VSHA 2NLXA 4JHDA 3TPQA 5J2MA 3V6DA 4FWSA 1N33K 3NF8A 2FC0A 4H8KA 1I3AA 1YITN 1VQON 4CFCA 4B9TA 3RTVA 3U3YA 5AQVA 4Z4IA 1A5WA 3NF6A 3ENBA 5CHIA 2CH5A 4GW6A 3J8AA 2OPQA 3QFPA 2Q36A 3OYLA 3IMXA 4CD1A 4Y1DA 5AQSA 3OS0A 1L3TA 5BPLA 3SUQA 3LP3A 4E7IA 4DS5A 4KPYA 4OPAA 3T69A 4Y1CA 4DSJA 2ZF5O 1P8ZA 3LP1A 1Q7YO 3LANA 2IGIA 2O8CA 3T3FA 3VQ8A 4CEZA 4CEFA 3L2QA 4DR7K 1YUWA 4WQ5C 1IJJA 4JRQA 4I6MA 1D9FA 3PLAA 4LF9K 4LF6K 3KK3A 5BPNA 2E5LK 2VGNA 3VA3A 4I9QA 3FZFA 1K73O 4JI0K 3ZT1A 1I94K 3NH0A 5EY4A 4KI4A 1RT4A 4JS5A 3O9QA 3MEDA 4OX9K 2XY7A 5HBMA 1KVBA 3WXKA 4YOVA 4BRAA 4B9NA 4AHSA 4DUYK 4RW9A 1IKYA 3QEIA 1K6YA 2P9UB 3OS2A 3CJBA 3WNFA 2A41A 1WSJA 2FSNA 1U4BA 1RT7A 5FRNA 3PUFA 3C95A 4HTUA 1JJ2M 1SL0A 2A1RA 3D2EA 4LC9B 5HLFA 3AA5X 1SKSA 5IT9O 4CGDA 4MLEA 2V52B 4B8AB 3G4SN 4BROA 3LM2A 4CJPA 2YJEA 1OKJA 4JD2A 5A2QO 2E2OA 5I42A 3NVMA 3RSEB 3MCPA 2XY6A 1YJ9N 2OZMA 2X6NA 4CGGA 3NH2A 2BDPA 1DGKN 1LWEA 4M41A 1QZ5A 2ATQA 1VQ4N 3VENA 3AA2A 3SMSA 4Y0WA 2XO7A 4FM0A 3KHYA 1JLQA 4I6MB 3CCVN 1BWFO 4KRFA 1LAWA 3ID6A 3FR0A 3K57A 4H5VA 1QSLA 4FPBA 3DOKA 1ZC6A 2ASMA 3KD5E 2RE2A 4XH1A 4FLXA 3OVNA 3Q7BA 1BA0A 4NXNK 3D0PA 3C0BA 1JCFA 1RBRA 4GVMA 1S1UA 2V7ZA 4CJ7A 4QAGA 4DQSA 4CHYA 4C1NK 2NRVA 2P9UA 4C8NA 1HYVA 1XUPO 4IKFA 4BC4A 4DG1A 1WSHA 4DQQA 4NYFA 4FJGA 1LWCA 1QVFM 2GEMA 3KIOA 3S3MA 1YI2N 4PY5A 4BY9C 1BI4A 1Q8IA 2BH1A 2YKNA 3K9KA 5GIPA 3QFUA 1SUQA 3L4IA 3VF6A 1S72N 3D7EO 3D45A 2QKBA 3HPOA 3QNOA 1ASWA 4CK2A 5KPZA 4JI3K 3T19A 4C8MA 4Z94A 3R3LA 2HW3A 5BPMA 1NGFA 1N6QA 3QEVA 3DLLL 2YI1A 4A5AA 1QE1A 1UAXA 5KTQA 1GLJO 3LP2A 1YJNN 3V1RA 1IV0A 2Q3SA 4JLHA 3IUCA 4UQGA 4WQ4A 3WQTA 4JV5K 4DV6K 2OPPA 3VN5A 2Y1IA 4HUGA 4NCBA 3DLKA 4FWOA 2VG5A 4JN4A 3SPZA 5KQDA 3D2FA 4X64K 4EFHA 2ZD1A 1WSFA 3MAQA 5J2PA 1K8AO 4MDBA 3HO1A 4NYNA 4M3XA 4IEEA 5HRPA 3KTQA 2FSKA 1SQKA 4H0YB 3ZX3A 4B3TK 1S1VA 4ISFA 5LY3A 3E66A 3LZJA 1BG3A 2D0PA 5FLXO 3MN5A 4BE2A 1UA0A 4M3YA 3CPWM 4KAZA 3RSEA 1U2VB 4O8KA 3MEGA 4M3UA 1ZBLA 4Z4GA 5E84A 4B9SA 3OA9A 1EO1A 5AQHA 2NRXA 3ZSRA 2NUBA 1ZBFA 3SNNA 3C7NB 3PX6A 2G8HA 4ZTJA 1EXQA 4DWIA 2W40A 3CCRN 4J2DA 3M8QA 3MWTA 1RILA 5JS2A 4BC3A 1QQCA 1RBUA 3NGYA 5HOOA 1C0GA 1DLOA 2QTDA 4FO0A 1OH7A 3T7ZA 3K9JA 4XIUA 1CZ9A 1NGIA 1D5AA 4CZHA 1L5UA 3HP6A 1VQNN 1CXUA 4YOYA 4E7KA 2P5GA 3EKSA 3K0SA 3SV4A 4B9LA 3OJSA 1KFDA 1LW0A 3AY9A 3AV9A 3P39A 3SQ0A 2GELA 3ZYYX 1B92A 3OYBA 3OYAA 1RDBA 1R0AA 3OYIA 4A57A 3TANA 3ITHA 4OPKA 4FM1A 3OYJA 3F73A 4IFEA 4KREA 1RGIA 1OH5A 5E26A 3ZLJA 3QDKA 5C2DA 2NRZA 4IO8A 3S41A 4CW7B 4CJLA 4A2BA 3O3HA 1VQ7N 3SQ4A 3AVCA 4JKBA 1YTUA 4HUFA 2HHTA 4OGEA 2Q0RA 4LF7K 1X9SA 4U67L 5I9EB 1N32K 3M6GA 3DXMA 3LAKA 5MLCQ 4KHNA 3M3ZA 2O8CB 2JLEA 4W5RA 3ZT3A 4R5PA 3CJ1A 3D6RA 1B9DA 1I39A 2PFUA 4BRCA 4FLTA 4ELUA 4DV3K 3AA4A 3MN6A 1NJWA 4EHUA 3VPZA 5AQMA 3UKUA 4FL9A 5SZTA 2UUAK 3IKMA 4DF8A 3A8YA 4J2EA 4DTMA 3S3NA 3LZIA 1VQ8N 4O0IA 1ILYA 4OPJA 3QLHA 3FGUA 5CZ1A 1VQMN 1Q18A 1TVRA 3KZBA 4CI6A 5AQZA 1XHXA 1BDGA 5BR9A 2EX3A 3TSQA 4FJLA 1IKVA 1KVAA 3C6HA 3EZ5A 4DV1K 3VGLA 3PSIA 1J6ZA 3F9MA 2OTLN 2UU9K 3M8PA 1N8RO 3VQAA 3NGIA 4IBNA 4FXDA 3R8EA 2X78A 1BIUA 4A59A 4DSFA 1NKBA 3AGKA 3ZETA 4Z4CA 2O8EB 2QWPA 3OW2M 5HL7L 2HHVA 1IG8A 2CH6A 1WSIA 1RBVA 4F3TA 4B1YB 3PY8A 4KTWA 3PO5A 3PX0A 5J1EA 4JRPA 1NGJA 4OLAA 5FDLA 3ZSZA 5AQFA 4R79A 4DFJA 3CCMN 2HHWA 2CGLA 1NOYA 1UA1A 4F2SA 4JI8K 4PL7A 3GG4A 1ATSA 3DLHA 5M1NA 4N47A 4K8XA 4BG8A 3ENOA 5DM7L 2WONA 1NK5A 5FPNA 1NJIO 4XH5A 1M1KO 3VF4A 3QETA 3B8AX 5J2QA 4RWTA 1BIZA 1O13A 4B9QA 4M45A 2E20A 4ID5A 3ZT4A 3WNEA 4LD0A 3NAEA 1VQLN 1TKDA 4CCHA 4CZFA 3VQQA 4CGJA 1E3MA 4KFBA 2VG7A 1Q86O 4U7BA 2YV0X 4BRDA 4O44A 4ZTFA 3DLBA 2HHXA 5GAHP 1C1CA 3SYZA 5JS1A 3SV3A 1C0FA 2F4VK 4KHWA 1A5VA 3I0SA 1HR0K 2PYJA 2VWBA 3AVMA 4IXCA 3HXMA 4CD3A 3K58A 5BR8K 4QS8A 2O4IA 4GV3A 4RW6A 4LFBK 4B3MK 3KKSA 2XY5A 4BE0A 2QWQA 2F96A 4YOWA 1SKRA 1HYSA 4JKGB 4OVLA 2HB5A 1RDCA 4YOUA 1EETA 2G8WA 3THYA 4ISEA 2FLOA 4C8LA 3IFRA 3QEXA 1NGBA 3WNHA 1QHAA 3P4IA 4BC2A 2E8AA 3IS9A 5C42A 2NRTA 3J80O 1U2VA 2QXFA 4BRIA 1WBBA 3QNNA 2I7NA 3CPEA 2P9NB 2ZQBA 5FPDA 2YNFA 4H5TA 1KXPA 4FVUA 1VRTA 2P9IA 4CF8A 4IO9L 1E4GT 5JLHA 1BA1A 2QM1A 5KGXA 4BWMA 2G8KA 3DMJA 3QESA 4DB3A 4DUZK 1IKXA 3I8BA 2HHHK 4O55A 4CBWA 4M3ZA 3VGKA 4ID1A 2E1YA 1IG9A 1V4SA 4B1VA 4IFYA 1S1XA 4BRQA 3HK2A 1MWKA 4BR9A 4FJ5A 1JXBA 4CJVA 2NRWA 2AJQA 4DSIA 1Z05A 3SPYA 1XMQK 3HTVA 3ZSXA 2G8VA 1CZBA 2IIRA 3N4PA 3SZ2A 1RBSA 5C0YA 4C1NI 4YFUA 5KI6A 3O3GA 3EZWA 3BZKA 3FFIA 5KPRA 1SS6A 1DTQA 4BRPA 3KK1A 1T3VA 4B3RK 1W2BM 1WLJA 1TUYA 1QZ6A 1N36K 1JCEA 1X9JA 4DFPA 5T7BA 4A5BA 3A5MC 4AM7A 2OCEA 3M5RA 1TAQA 3VQ4A 3AVHA 2IAJA 1FXXA 3PV8A 2KQ2A 3VEZA 2YHAA 4HCCA 4CF9A 1XNRK 1TYQA 3P5JA 4PKHA 2O8FA 3UIQA 1K8KA 1C0TA 3EE8A 4IOCL 5AZIA 4CGHA 2OPRA 4JD2B 4JKFA 3DYAA 4DKWA 3DAWA 2QW9A 3E1YA 4K41A 3GE1A 3AARA 4WF9L 4B9UA 1GLDG 4I7FA 1Q82O 3T1HK 4AILC 2FXUA 1BQMA 3QO9A 4FJXA 5FPMA 4WQ5A 3TI0A 2YNIA 2WUSA 4FOIA 1Y64A 3L2WA 3AO4A 4BR5A 3AVKA 3ISNC 3CJAA 2AP1A 4KKOA 1RTHA 4J8FA 3WXLA 4C8KA 4B1UB 2GUPA 3CQ8A 2FBTA 1D9DA 3CF5L 4X62K 3LDLA 4H03B 1OH8A 4CFBA 4CVNE 4OPHA 1NK9A 3LDOA 3VQPA 4CESA 2RKIA 4CK1A 3MCAB 3VEOA 3LPUA 3ZSYA 4WCEL 1J5OA 5LMNK 4KHQA 3OS1A 4CHQA 3SCXA 2I7PA 1ASVA 2FBVA 3E9OA 3L6QA 3F2KA 4OJRA 1NLVA 4WE1A 4F9OA 3WXMB 3R6MA 5HRSA 3DRRA 4BE1A 2E88A 4KTZA 3E01A 1IBMK 4TSXA 1LCUA 3KK7A 5AQRA 2DY4A 4E19A 2JWLA 3THWB 5AQKA 3S9HA 4OO1J 1FK9A 3WNGA 3CFOA 1KRPA 3AAQA 1NK7A 4FJ9A 4LF4K 2UUCK 1S9EA 4FYDA 3NVKA 2A6AA 4FM2A 3VQ5A 4JS4A 3TAEA 2D0OA 1HNXK 1JL1A 3C7NA 3JAMO 3AVJA 2A42A 2GWKA 2FSJA 3TABA 1Z25A 4E7JA 1J5EK 1QQMA 4H0OA 1NNEA 2QK9A 2UUBK 1S6QA 3CCEN 3RR8A 1QS4A 3JXUA 4CFAA 4LY7A 3UB5A 5F1XA 3DM2A 1S1TA 2D0BA 4JYAK 2UXDK 3OJUA 5GAGP 1M90O 3L0QA 1VQKN 1NGHA 3HT3A 4BGBA 4O4GA 3VQBA 1DTTA 4JI1K 3V9UA 4FW1A 3J7ZO 5AQJA 1VK0A 4CGFA 4BRMA 1TUUA 3AAPA 5BREA 4M3WA 2W41A 2HNZA 4YORA 4CF0A 3R1XA 3KKRA 4Z4EA 3WEEB 5J2NA 4DLGA 4BACA 1LV5A 3VESA 2UXCK 5FPEA 4N56A 2VGMA 4BR4A 3KLFA 4FJHA 1GOAA 3TAFA 4DV4K 1ATNA 4BRGA 1WN7A 5TKWA 1YTAA 4YDUC 3VMFB 3RMCA 2HBLA 1U48A 3O6WA 2ASOA 1S3XA 2P9PB 3TTFA 3MECA 1TAUA 3K59A 5GINA 1XI1A 1KLMA 4F3OA 4JKGA 1W0HA 3KWGA 4CHZA 1P90A 1ATRA 4XEIA 4CF1A 1GOCA 3CC7N 4N41A 1BOTO 4M7YA 3MWPA 4GV9A 1X9MA 2A1SA 4MO4A 2RHKA 4YDUA 2Z1GA 3NBPA 3TAGA 1N5YA 4CJSA 4FPAA 3HPHA 1HQEA 1E4FT 1ZBUA 1CZAN 3U9ZA 4KHPK 4DV5K 4LF8K 1RFQA 3M8RA 2Q97A 3SAGA 1RDDA 3CQYA 1EWRA 3K2PA 1ZXOA 5IWAK 2RN2A 4B3OA 2GX9A 2V51B 3U8XA 3IG1A 3J7YP 4WFBL 1ZYQA 2F8SA 3U6FA 2XY8A 2KFZA 4DR3K 4KB1A 4MQ3A 1HLUA 4JK9A 3BY5A 3QEWA 4KO0A 2HOEA 4X65K 1NK8A 4JI7K 1YJWN 5C24A 3OYCA 3BF1A 2Q31A 4GVEA 1RNHA 1TYQB 4M42A 5D3GA 1C6VA 2HHSA 4RCHA 3FZMA 4CJRA 1T6CA 1ESVA 2Z1HA 2P9PA 1NGDA 1NGCA 4UY8O 4AQYK 1JXEA 3M8SA 3KVGA 2W6KA 3UKRB 1XWLA 4BVPA 4NB4A 5HRNA 2YX6A 4ZHRA 1ZBSA 1KAXA 4CEBA 4EZ9A 3GBTA 4H5WA 2HHQA 3QIOA 3K5NA 1RT5A 3KLGA 4PKIA 4JI6K 4AHRA 4L8RB 4C23A 1A5XA 4DLEA 3VOVA 3VTIA 3WUHA 2ASPA 4FZZA 4EP5A 3SK3A 1HKCA 5AQYA 1JLCA 1BISA 2OYQA 4DHYA 4CECA 1KCFA 1IBLK 3AO3A 3RMBA 5SWMA 4H0VB 3OTOK 3AVFA 1QHTA 1LAVA 2GV9A 3A5OC 3DRSA 2OZSA 2O8BA 4I2PA 4LSNA 4Q5VA 4JK7A 3SI6A 2DFHA 2G8IA 4RTFD 3CETA 4GNIA 4CZLA 2YHXA 3LM9A 3SJJA 1JLBA 1X1PA 4KH5A 1OH6A 4PQUA 4DV0K 1HRHA 3P38A 3BGRA 3G25A 4FJJA 4KI6A 3CD6N 4DR6K 3U3GA 2YKMA 3NMUA 1DEJA 3IDHA 3QMLA 2Z1IA 2P9IB 3BDPA 4EIAA 3AO1A 2HBJA 2XHBA 1U04A 3DLGA 1VQ6N 3LALA 4WFAL 3ZT2A 4CJ4A 5M1FA 3QIPA 4JKCA 4M63C 3H1QA 4KH4A 1YVNA 4CJ5A 5EVZA 5KRTA 3TAPA 1HX1A 2DTUA 1QSSA 3K5OA 4BVOA 3HM8A 3GOIA 3AVNA 4FWQA 3VEVA 3FZLA 4KHSA 2DPNA 4H0XB 4GKJK 4RW4A 3L3UA 3HPGA 5BN9A 2ZM6K 1HKBA 3I56N 3QEPA 3HJFA 3KD1E 5KGWA 4B08A 2E6MA 1MA9B 4CBXA 4EZ6A 4IEIA 3H45C 3CCLN 3DI6A 1NJZA 3O9TA 1W9HA 4WYBA 2QA4N 1ITGA 4IWVA 1GLEG 3MX5A 2QKKA 2YNGA 4CJQA 4DQPA 3BEXA 3VETA 1U45A 2YNHA 2ITGA 3HBTA 3WEEA 3W0LA 3ULDA 1GLBG 2QEXN 4B1ZA 2GTDA 1XQSC 1HJRA 3EO3A 3L2UA 2RPIA 3A0IX 3NGZA 2IOCA 4GV6A 3V9ZA 4PL8A 4JKDA 2D5RA 3LWLA 2QWOA 5ADXA 5DMRA 2O8EA 3OYMA 1VAZA 3O9RA 3VEYA 4K25A 4LH4A 5F2RA 5CZ2A 2E2PA 4BQZA 5CR4A 4LFCK 3BZCA 3G0ZA 3ZETB 4EAHD 2IVOA 3PSFA 1NJXA 1YIJN 2BE2A 1QTMA 4MLHA 4DR4K 5ELZA 1K8KB 1NU0A 3OYEA 3LP0A 4FWNA 4B1XB 3H46O 1J53A 3I0RA 3VEWA 4CZMA 1BL3A 3MN7A 4B9MA 3ZCMA 1NM1A 3OYGA 2J4RA 2UYTA 4DFKA 3V4IA 4DQIA 4W5OA 4DR5K 1NKEA 2KTQA 3KLEA 3VQ7A 1NK0A 5C2FA 1R59O 4CEAA 3H1VX 3ZEUB 2Q0UA 3BF3A 4B3SK 3RWUA 5CE3A 3MK6A 5CYQA 3FFKB 5BN8A 1W7AA 1XC9A 3T1AA 1S22A 3CCJN 4ICLA 3O9SA 4CF2A 1UOCA 4DU4A 3O4NA 1X3MA 3KWIA 2QWNA 3HRGA 2WC9A 2D0CA 3L2RA 4N76A 3EY1A 2CGJA 2FF3B 3RRHA 3AO5A 1SL2A 3CCUN 4EP4A 1O1WA 4ILJA 1BCMA 2P9LB 3QBWA 4ILGB 4DSEA 3VERA 3ULEB 3AVAA 4CZKA 4FJMA 3DRPA 1IKWA 4M3RA 4E89A 4JI5K 4KV8A 4FJ8A 2HMIA 2WOMA 1D4XA 2NNWA 1ZBHA 4FCYA 2G8UA 3N4QA 2E1ZA 4QS7A 4OLBA 3RMAA 4AH9A 3CFRA 2A40A 3L3VA 1X3NA 4N5SA 1WBDA 3DXMB 2P9NA 4F4KA 4DU3A 3H08A 5EXWA 3CMAN 3EYZA 3DJCA 4J2AA 4K0KK 3NH1A 4G9ZA 1C0MA 4AF1A 2WTUA 1ASUA 5JMVA 1D8YA 4CK3A 2UXBK 3OYHA 4FJ7A 1H1VA 4FWRA 4CIFA 1WUAA 3TARA 5KQ8A 1REVA 3G71N 4L3QA 1EQYA 1RCHA 5I3UA 1QVGM 2E6LA 3MXMA 3AA3A 2HBMA 4FVMA 3V1QA 5AFUA 4IDHA 1XHZA 3CI5A 4DTXA 3MXJA 1TKXA 2YHYA 2B6AA 3OYDA 5AQOA 4BWJA 4PWDA 5EOYA 1EWQA 4CERA 2O4GA 1IBKK 4JKAA 4JK8A 1VQPN 2HF3A 1KC8O 4CEOA 3I55N 3O1BA 1EKEA 2FBXA 3TTDA 4MFBA 4CZEA 4DQRA 1JLEA 4H0PA 5AQTA 4YY3K 4KTQA 4LF5K 2P9LA 3L2VA 3TR8A 4E1MA 1HPMA 3GL1A 1FKPA 4A2AA 3OHRA 3ZSVA 3OBYA 4RW7A 2EHGA 5AZIB 3HZ6A 1WSEA 4OGCA 4FJNA 2XRIA 3CXCM 4CJFA 1JL2A 4DR2K 4BR7A 3AVGA 2KW4A 3ENHA 2VQEK 3FE1A 3NF7A 3LWMA 3QERA 4H0TB 4BRKA 3CIPA 1Z6RA 3FZKA 4BDYA 4FLVA 4CIEA 3J7AP 3TWHA 1TKTA 1YXQA 1SKWA 2YCHA 3I8DA 4LSLA 5AQPA 5TKYA 2VWJA 2NRHA 2OA8A 3ASMA 2BANA 2JWKA 1VSIA 1QQNA 5DK5A 2AA4A 3OYFA 1V4TA 3C6UA 5BRDA 3CM6A 1MDUB 1CLQA 4DTUA 2GBZA 4F2RA 4JI4K 2IVNA 3P31A 1ZBIA 2OPSA 4DTJA 3TU5A 4O5FA 2E2QA 3LPTA 2VWKA 2Q2RA 1VSLA 5AZJB 3MXIA 5M1OA 3SLCA 3MN9A 4PKGA 4BGAA 2NZTA 4BRNA 4HHTA 4CZGA 1HUXA 1S1WA 4NO7A 2OTJN 2PY5A 1SZ2A 2PZSA 2BTFA 1GOBA 1VSDA 2V7YA 3V9XA 4IOAL 2W42A 2E4LA 4W5QA 3TSPA 1HMVA 4DTSA 1Q81O 3O5BA 2HVIA 5FRMA 2HHUA 3WT0A 1RT6A 3P1GA 3VF2A 4H4MA 2YHWA 4IFVA 2ZGYA 4V19S 4CJTA 4IDKA 2ITMA 1MU2A 3W3DA 4G1QA 3PIPL 4FWMA 1T8EA 4O8UA 3U9DA 4W5NA 1Z26A 5AQXA 4FLYA 1OVQA 3HOSA 4DFMA 1RT2A 3PO4A 4MO5A 3C94A 4AM6A 2I5JA 5C15A 3P83D 1BGXT 2ZJQL 2BUPA 3KLHA 1BHLA 2PYLA 2DFFA 2HNYA 4YOTA 3DLRA 3K5MA 4JKHA 4X66K 3G6EN 3M1FA 1NBWA 3VEXA 1FW6A 2HMPA 1MWMA 3CCSN 3E9LA 4DR1K 4FK4A 2HNDA 3CC4N 1BI4B 1K9MO 1VSKA 5B8HA 1CXQA 5KPTA 5LMUK 4FLZA 2KLAA 3HP9A 3A5NC 3A5LC 3AVBA 3GDQA 4H5NA 3H6EA 3NHGA 4LH5A 5AQIA 5FROA 1HNIA 3LAMA 3ZSQA 4KHYA 3DXKB 3JS6A 2IS3A 3B6PA 4BRHA 5AQWA 4BC5A 5GIOA 4AHCA 2X6SA 4WQ4C 3SBGA 1X9WA 1HQUA 5JVHL 3HVRA 4DTRA 1IH7A 1RT1A 4DSLA 3SQ1A 5AQQA 4ILHA 5C10A 2P9SB 3SAFA 1KVCA 2D4WA 5JLFA 4ELVA 2KZZA 1HNVA 3E9PA 3HSCA 4DTNA 2O8FB 2R7YA 1SL1A 3JYTA 4FJKA 1LWFA 3CFPA 2ZJRL 3LDPA 1F21A 1C0UA 3O4WA 3O3FA 3SBTA 1GLLO 1NMDA 1TKZA 3QICA 3UE5A 4DS4A 3HSTB 3CJCA 2IVPA 4JNEA 3ALYA 2Q1NA 2KKZA 2P9KA 4OKEA 5AQLA 2GWJA 2IC3A 1JLAA 3A2FA 3QINA 1RDWX 1NG9A 3O4QA 1NK6A 2KZMA 1EX4A 1W97L 2B4JA 3I33A 4Z4HA 2PBDA 4J2BA 5M1PA 1BU6O 2VYPA 3WXJA 1RDUA 3LDSA 4PHTX 3O80A 3L8BA 1RTJA 3V81A 3THXB 4BRFA 3ZT0A 4E1NA 2D1KA 3HI0A 2F7TA 1L3SA 4K42A 1KLNA 1LW2A 5C25A 3PIOL 4OKKA 4A61A 1VSFA 3AO2A 5EX5A 5HROA 2F8TA 3O08A 3F5TA 5LJVA 3MX2A 1HKGA 2ZE2A 1T44A 4KBOA 4PUOA 1KAZA 1NMNA 4JI2K 3VQ6A 2ZJPL 1YHQN 3IAYA 1RTDA 3SQ2A 2HBKA 3TAQA 3T1YK 3R9PA 3OYKA 5M1QA 3PX4A 4HTLA 1S6PA 4M3TA 2A5XA 4K43A 3VGMA 2Z1JA 3NFAA 4CJKA 2GUIA 1N34K 3J81O 3MEEA 3KJVA 4YNQA 1J54A 3O9UA 4BR0A 4YOXA 1KFSA 4FK0A 3THYB 5F0XA 5C12A 1LOTB 4W5TA 1JCGA 4DV7K 5JVGL 2QWLA 3UKRA 3QB0A 4KB0A 4Z4FA 5BRHA 3VQCA 2O8DA 4FZYA 2P9KB 5E41A 4HCBA 1T03A 1QQOA 3LDQA 4IJAA 4BREA 5ADXH 4CJWA 4NCAA 2ZGZA 1UWBA 3EEQA 1Y97A 1QSYA 3WXIA 1TGOA 1NGGA 4RW8A 3Q7CA 3SMPA 4CJEA 2B5JA 1NOZA 4FJIA 4DQ8A 1XMOK 2O8BB 3EKUA 3VQDA 2VQFK 4E7LA 5JICA 3RMDA 4FSVA 2QI2A 4CHNA 4I2QA 3HM9A 1HJOA 4CZJA 3VTHA 4FK2A 1RDAA 1NKCA 3NF9A 3V9SA 2PAVA 3CYMA 2VCPA 4NCGA 4JHDB 1XC3A 4DSKA 2ETJA 2LSNA 3MDQA 3H3NO 2EWSA 2HSTA 4AHVA 3DWLA 3V1OA 2BGGA 3NCIA 3ZEUA 4GY2B 4IZ9A 2QXLA 3CQXA 3SUPA 3EN9A 1RTIA 5AZJA 5AQGA 1SAZA 4CEEA 3D2FB 3AVIA 4IG3A 3HL8A 2WBNA 2VG6A 4EHTA 4H4OA 2CGKA 3IRXA 3ZSWA 4CGIA 4CFDA 1T05A 1RBTA 3WQUA 1YT3A 1T6DA 1YVUA 5AQNA 3DLEA 4A62A 2F9TA 2Y1JA 1TK5A 3OY9A 1IO2A 3SUOA 5LL6Z 3NDKA 2O8DB 1VQ9N 3SAHA 1NGEA 4IJNA 3CMEN 1JLGA 2D0AA 3ATUA 4F8RA 3LDNA 2OANA 4IG0A 3OYNA 2KFNA 1T7PA 3BUZB 3CJ7A 3OBWA 3CC2N 3S3OA 3ULEA 3LL3A 4HUEA 4ELTA 4IOXA 2ZWHA 4DU1A 5AFUH 4B9VA 1NGAA 4CJ3A 1VHXA 1GLFO 4E0DA 1HPZA 4CEQA 4FLUA 4FZXC 1S9GA 4FWPA 1BO5O 1EP4A 3D2EB 4K8ZA 5GAEP 2FF6A 3AGRA 1KD1O 1HNWK 5HRRA 2HVHA 3G10A 1G15A 1JLFA 3CM5A 4CHOA 1DT9A 4QCLA 4FW2A 1WOQA 5CY4A 4FLWA 3ZX2A 5K14A 3RR7A 4NLCA 2FBYA 4O5BA 1VRUA 1VSMA 4RG8A 4E1JA 3O1WA 1BQNA 2E2NA 5M1KA 4BDZA 2YHBA 1RT3A 1C1AA 3RRGA 1TK8A 1HNZK 4DCHA 3HYFA 1Q9YA 4ISGA 3V9WA 1C1BA 4CJUA 1J9AA 3DOLA 3F9KA 2X74A 1U6ZA 3ATVA 2JGUA 3ZX0A 2P51A 3HVTA 1KSPA 1B9FA 2P9SA 3EE9A 3U4LA 3DXKA 1TK0A 1WSGA 5KRSA 1NK4A 3BP8A 1WAJA 1TV6A 3ID8A 3SUNA 1L3VA 5AJ3K 1KTQA 2QWRA 2P1JA 3C65A 2G8FA 3MMVA 4DF4A 4CHPA 4LFAK 2KHOA 4MDAA 3FZHA 3KK2A 1KAYA 3CCQN 5LJWA 3JSMA 4M7XA 4O0JA 5HP1A 1FKOA 3UKUB 3C6TA 1GLCG 4DV2K 4QS9A 3VA0A 1NJYA 1DKGD 4HVJA 2P5OA 1U47A 1SV5A 5BRFA 3AVLA 1U49A 3VQEA 1KQSM 3K5LA 5CYMA 3THWA 5H1SQ 3THXA 4NLBA 4E7HA 2HF4A 4DTPA 1VSJA 3CJ9A 4KH6A 3C6AA 3ZSOA 1TL3A 3TTCA 3KLIA 3QBXA 1TL1A 5DM6L 1WNSA 1WB9A 2RF2A 4DMNA 4AHTA 2F9WA 4BQLA 1YF5L 4DTOA 5AR0A 4B8CA 2NRRA 4B1WB 1BUPA 3B6OA 1Q9XA 1GLAG 2YJFA 2WFBA 4XH4A 4BDPA 1YAGA 3HOTA 3RVCA 3L4QA 3EL2A 3THVA 3TSUA 2DFEA 4BRLA 5AQUA 1FJGK 1NWKA 3FLCO 1G99A 4GKKK 4FWKA 1BCOA 1XNQK 4JAXA 4QOZB 3H3OB 4AHUA 3TAMA 4CBUA 1HYZA 1JKHA 4Q0BA 4HWIA 1L3UA 2W6LA 3O8MA 4E3SA 1S5JA 2IDOA 2QWMA 4CE9A 5GADP 4WFNL 4JEPA 1VQ5N 1OVYA 4KHUA 3CG7A 4I9LA 3SJHA 4YHHK 4FOEA 4PA1A 4CZIA
chains in the Genus database with same CATH topology
4YOTA 4JKEA 4BG8A 3ENOA 4H5RA 5DM7L 4C23A 5FPNA 2A3ZA 1NJIO 4JKHA 3G6EN 3M1FA 1NBWA 3VOVA 4XH5A 3VEXA 4BR2A 1M1KO 3VF4A 2H3GX 3B8AX 3VTIA 4RWTA 3WUHA 2HMPA 1O13A 1MWMA 3CHWA 4B9QA 2ASPA 3CCSN 2E20A 3CERA 4FWLA 3SK3A 1HKCA 5AQYA 3E9LA 1VQLN 4CZFA 4DHYA 4BG9A 2NLXA 4JHDA 3TPQA 3CC4N 1Q86O 4U7BA 4FWSA 1K9MO 4BRDA 5B8HA 5KPTA 4H0VB 1YITN 1VQON 5GAHP 2KLAA 3A5NC 3A5LC 3A5OC 1C0FA 4JK7A 5AQVA 3GDQA 3ENBA 5CHIA 4H5NA 3H6EA 2CH5A 4RTFD 2VWBA 3CETA 3J8AA 4IXCA 4CD3A 4GNIA 5AQIA 3QFPA 2Q36A 4CZLA 2YHXA 3DXKB 3IMXA 4CD1A 4QS8A 3LM9A 5AQSA 3JS6A 5BPLA 4BRHA 4KH5A 5AQWA 4GV3A 4BC5A 5GIOA 3P38A 4WQ4C 4OPAA 3SBGA 3T69A 5JVHL 2QWQA 4YOWA 3G25A 2ZF5O 1P8ZA 3CD6N 4JKGB 1Q7YO 3NMUA 5AQQA 4ILHA 4YOUA 1DEJA 5C10A 3IDHA 3QMLA 2P9SB 2P9IB 3SAFA 2D4WA 5JLFA 4ISEA 4EIAA 2FLOA 1YUWA 2HBJA 3E9PA 1IJJA 3HSCA 3IFRA 4WQ5C 1VQ6N 4WFAL 1NGBA 1QHAA 5M1FA 3P4IA 4BC2A 4I6MA 2ZJRL 2E8AA 4JKCA 4M63C 3PLAA 3LDPA 5BPNA 3H1QA 2NRTA 1YVNA 1U2VA 3O4WA 4KH4A 2VGNA 4BRIA 5EVZA 3SBTA 1GLLO 2I7NA 1NMDA 3CPEA 3FZFA 1HX1A 2P9NB 3QICA 5FPDA 1K73O 4H5TA 1KXPA 3UE5A 4BVOA 4FVUA 3CJCA 2IVPA 2P9IA 3HM8A 2Q1NA 1E4GT 4JNEA 2KKZA 2P9KA 2QM1A 1BA1A 3GOIA 5JLHA 4FWQA 3VEVA 5AQLA 3O9QA 3FZLA 2GWJA 4DB3A 2DPNA 3I8BA 4H0XB 4CBWA 1RDWX 3VGKA 3WXKA 4YOVA 1W97L 2E1YA 3I33A 4BRAA 1V4SA 4B1VA 2PBDA 5BN9A 1HKBA 5M1PA 1BU6O 2VYPA 3WXJA 1RDUA 3I56N 4PHTX 4BRQA 3O80A 1MWKA 4BR9A 2P9UB 3CJBA 2NRWA 4MLHA 4BRFA 2D1KA 3HI0A 2A41A 1MA9B 1Z05A 4CBXA 2F7TA 2FSNA 4IEIA 3H45C 3CCLN 4K42A 3HTVA 3O9TA 4WYBA 2QA4N 3PIOL 2IIRA 4IWVA 4A61A 1JJ2M 5EX5A 1GLEG 3N4PA 3MX5A 3F5TA 3O08A 5LJVA 5C0YA 3MX2A 4C1NI 3D2EA 4LC9B 1HKGA 3BEXA 1T44A 4KBOA 3EZWA 1KAZA 3VETA 2ZJPL 1YHQN 4MLEA 5KPRA 3HBTA 2V52B 3G4SN 4BROA 1SS6A 3WEEA 3W0LA 3LM2A 1GLBG 4BRPA 2HBKA 2YJEA 1OKJA 1T3VA 1W2BM 2QEXN 1TUYA 3R9PA 4B1ZA 1QZ6A 2GTDA 1XQSC 4JD2A 1JCEA 1X9JA 3EO3A 5M1QA 4HTLA 2E2OA 3A0IX 4A5BA 4GV6A 3NVMA 3A5MC 4PL8A 3RSEB 4JKDA 3MCPA 3M5RA 2A5XA 4AM7A 4K43A 3VGMA 2QWOA 1YJ9N 5ADXA 3VEZA 3O9UA 4BR0A 4YOXA 1VAZA 1DGKN 3O9RA 3VEYA 1QZ5A 1LOTB 5C12A 5F0XA 1VQ4N 4K25A 3VENA 1TYQA 4PKHA 3SMSA 5F2RA 4Y0WA 1JCGA 1K8KA 2E2PA 3EE8A 4BQZA 5CR4A 4IOCL 5AZIA 5JVGL 2QWLA 3UKRA 3QB0A 3KHYA 3ZETB 4EAHD 5BRHA 2IVOA 4JD2B 4I6MB 4JKFA 3CCVN 1BWFO 1YIJN 3ID6A 3FR0A 2P9KB 4DKWA 3DAWA 4H5VA 1QQOA 2QW9A 3E1YA 3GE1A 3LDQA 3AARA 4FPBA 4IJAA 1GLDG 4K41A 4BREA 1ZC6A 1K8KB 2ASMA 2RE2A 5ELZA 4XH1A 2ZGZA 5ADXH 1Q82O 3Q7BA 2FXUA 4FWNA 4B1XB 1BA0A 3H46O 3WXIA 5FPMA 1NGGA 3C0BA 1JCFA 4WQ5A 3VEWA 4CZMA 4CJ7A 2V7ZA 3MN7A 3Q7CA 3SMPA 1NM1A 2J4RA 2UYTA 2WUSA 4C1NK 4FOIA 1Y64A 4DQ8A 2NRVA 4BR5A 2P9UA 3EKUA 3CJAA 2AP1A 1XUPO 4BC4A 1QVFM 5JICA 5C2FA 1R59O 2GEMA 1YI2N 4FSVA 4J8FA 2QI2A 3H1VX 3WXLA 2GUPA 3ZEUB 1HJOA 4B1UB 3VTHA 4CZJA 4BY9C 3CF5L 2Q0UA 3BF3A 2BH1A 3K9KA 2PAVA 5GIPA 3LDLA 3QFUA 3L4IA 4H03B 3VF6A 2VCPA 5CE3A 3MK6A 3FFKB 1S72N 3D7EO 5BN8A 4JHDB 1XC3A 4OPHA 3LDOA 3MDQA 3H3NO 5KPZA 1S22A 3MCAB 3VEOA 2EWSA 2HSTA 3CCJN 3DWLA 4Z94A 3R3LA 3O9SA 5BPMA 1NGFA 3DLLL 3ZEUA 4WCEL 2YI1A 4GY2B 4A5AA 1X3MA 3KWIA 4IZ9A 2QXLA 1GLJO 2QWNA 3CQXA 1YJNN 3IUCA 4WQ4A 3EN9A 3HRGA 3WQTA 2I7PA 2WC9A 5AZJA 5AQGA 1SAZA 3E9OA 3L6QA 2CGJA 3F2KA 3D2FB 1NLVA 2FF3B 2WBNA 4FWOA 4EHTA 4F9OA 3WXMB 2CGKA 4JN4A 3CCUN 3R6MA 3WQUA 4ILJA 5KQDA 2P9LB 1T6DA 3QBWA 4ILGB 3VERA 5AQNA 2E88A 3D2FA 3ULEB 1LCUA 3KK7A 4EFHA 4CZKA 5AQRA 2JWLA 5AQKA 4A62A 2F9TA 4MDBA 1K8AO 4IEEA 4OO1J 2FSKA 1SQKA 1D4XA 2NNWA 4H0YB 3ZX3A 3SAHA 1VQ9N 3N4QA 1NGEA 4ISFA 4IJNA 3CMEN 5LY3A 2E1ZA 4QS7A 3ATUA 3E66A 3LDNA 3AAQA 2OANA 2A40A 1BG3A 1X3NA 2D0PA 3BUZB 3CJ7A 2P9NA 3DXMB 3MN5A 3OBWA 3CC2N 3NVKA 2A6AA 2D0OA 5EXWA 3CMAN 3CPWM 3ULEA 3LL3A 3C7NA 3RSEA 1U2VB 3DJCA 4O8KA 4IOXA 2ZWHA 4G9ZA 2A42A 2GWKA 2FSJA 5AFUH 4AF1A 1NGAA 5E84A 5JMVA 1GLFO 3OA9A 1EO1A 5AQHA 1QQMA 2NRXA 4H0OA 1H1VA 3C7NB 4FWRA 4FWPA 1BO5O 1WUAA 3D2EB 5GAEP 5KQ8A 2FF6A 2W40A 3AGRA 3G71N 3CCRN 1KD1O 3MWTA 4L3QA 4BC3A 1EQYA 1QVGM 3CCEN 5HOOA 3JXUA 5F1XA 3UB5A 1C0GA 2QTDA 4IO9L 1DT9A 4FO0A 2HBMA 3T7ZA 5AFUA 3K9JA 1WOQA 4IDHA 3ZX2A 1NGIA 5GAGP 4NLCA 4CZHA 1M90O 3L0QA 3CI5A 1VQKN 1NGHA 1VQNN 4BGBA 4YOYA 3EKSA 2YHYA 4E1JA 5AQOA 3O1WA 3AY9A 3J7ZO 2E2NA 3P39A 5AQJA 2GELA 5EOYA 3ZYYX 5M1KA 4JKAA 4JK8A 1TUUA 4A57A 4BRMA 1VQPN 2HF3A 3AAPA 5BREA 2W41A 4DCHA 1KC8O 4ISGA 4YORA 3I55N 3R1XA 3O1BA 4IFEA 3TTDA 1RGIA 1U6ZA 3ATVA 3ZX0A 4CZEA 4H0PA 3WEEB 5AQTA 5E26A 3QDKA 3VESA 2P9LA 5FPEA 2P9SA 2VGMA 4BR4A 3EE9A 2NRZA 4IO8A 5C2DA 3U4LA 1HPMA 3DXKA 3S41A 1ATNA 3GL1A 4BRGA 4A2BA 1VQ7N 4A2AA 5TKWA 3OHRA 3OBYA 3BP8A 4YDUC 3VMFB 2HBLA 4JKBA 3HZ6A 3ID8A 5AZIB 3CXCM 3O6WA 2ASOA 2QWRA 1S3XA 3C65A 2P9PB 3MMVA 3TTFA 4BR7A 2KHOA 2Q0RA 5GINA 4MDAA 3FZHA 4U67L 1KAYA 3ENHA 5I9EB 3M6GA 4JKGA 3FE1A 3CCQN 4H0TB 3DXMA 3KWGA 4M7XA 5LJWA 5MLCQ 3M3ZA 1P90A 4BRKA 1ATRA 3CIPA 1Z6RA 3FZKA 4XEIA 3CC7N 1YXQA 2YCHA 3UKUB 1BOTO 4M7YA 3MWPA 4GV9A 1GLCG 3CJ1A 5AQPA 3D6RA 5TKYA 2PFUA 4QS9A 4BRCA 2NRHA 1DKGD 4MO4A 3MN6A 2RHKA 4YDUA 4EHUA 2JWKA 1QQNA 5BRFA 2AA4A 3VPZA 4FPAA 5AQMA 3UKUA 1V4TA 4FL9A 1KQSM 5BRDA 1E4FT 1MDUB 1CZAN 3U9ZA 3IKMA 1RFQA 5H1SQ 2Q97A 4NLBA 3A8YA 2HF4A 3SAGA 2IVNA 3P31A 1VQ8N 3CJ9A 3CQYA 3TU5A 4KH6A 2E2QA 4O5FA 3C6AA 1ZXOA 3TTCA 1ILYA 2Q2RA 3QBXA 5AZJB 3FGUA 2GX9A 5M1OA 2V51B 3SLCA 1VQMN 3U8XA 1Q18A 3MN9A 3KZBA 4PKGA 4BGAA 5DM6L 4CI6A 5AQZA 2NZTA 4WFBL 4BRNA 5EY4A 1BDGA 4CZGA 1HUXA 5BR9A 2F9WA 4NO7A 2OTJN 3TSQA 1SZ2A 2BTFA 1HLUA 4JK9A 4BQLA 3C6HA 1YF5L 2V7YA 3VGLA 5AR0A 1J6ZA 2HOEA 4IOAL 2NRRA 3F9MA 2OTLN 3TSPA 4B1WB 1BUPA 1YJWN 1Q81O 1N8RO 1GLAG 3O5BA 2YJFA 2WFBA 3BF1A 2Q31A 4XH4A 4GVEA 3R8EA 1YAGA 1TYQB 3WT0A 4A59A 3VF2A 3HOTA 2YHWA 2ZGYA 3RVCA 3AGKA 3EL2A 3L4QA 3ZETA 2ITMA 4RCHA 3FZMA 3TSUA 3W3DA 2QWPA 1T6CA 4BRLA 1ESVA 5AQUA 5HL7L 3OW2M 1IG8A 3PIPL 1NWKA 4FWMA 2CH6A 1G99A 2P9PA 3FLCO 4FWKA 1NGDA 1NGCA 4B1YB 4UY8O 4JAXA 4O8UA 3H3OB 3KVGA 4CBUA 3U9DA 3UKRB 5AQXA 1NGJA 4BVPA 4HWIA 4NB4A 3HOSA 3O8MA 5AQFA 4R79A 4WF9L 3CCMN 2CGLA 2QWMA 4MO5A 2YX6A 4AM6A 1ZBSA 5GADP 4WFNL 1KAXA 4JEPA 5C15A 3GBTA 1VQ5N 1OVYA 4PL7A 4H5WA 2ZJQL 3GG4A 3SJHA 1ATSA 2BUPA 4FOEA 4CZIA 4PKIA 5M1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BG8 A;  3ENO A;  4H5R A;  4C23 A;  5FPN A;  2A3Z A;  3M1F A;  1NBW A;  3VOV A;  4XH5 A;  3VEX A;  4BR2 A;  3VF4 A;  2H3G X;  3B8A X;  4RWT A;  3WUH A;  2HMP A;  3CHW A;  1MWM A;  4B9Q A;  2ASP A;  2E20 A;  3CER A;  4FWL A;  3SK3 A;  1HKC A;  5AQY A;  4CZF A;  4DHY A;  4BG9 A;  2NLX A;  4JHD A;  3TPQ A;  4FWS A;  4BRD A;  5B8H A;  5KPT A;  4H0V B;  3A5N C;  3A5L C;  3A5O C;  1C0F A;  5AQV A;  3GDQ A;  4H5N A;  3H6E A;  2CH5 A;  4RTF D;  2VWB A;  3CET A;  3J8A A;  4IXC A;  4CD3 A;  4GNI A;  5AQI A;  3QFP A;  2Q36 A;  4CZL A;  2YHX A;  3DXK B;  3IMX A;  4CD1 A;  4QS8 A;  3LM9 A;  5AQS A;  3JS6 A;  5BPL A;  4BRH A;  5AQW A;  4BC5 A;  4WQ4 C;  2QWQ A;  3G25 A;  2ZF5 O;  1P8Z A;  5AQQ A;  1DEJ A;  3IDH A;  3QML A;  2P9S B;  2P9I B;  2D4W A;  5JLF A;  4ISE A;  4EIA A;  2FLO A;  1YUW A;  4WQ5 C;  3HSC A;  1IJJ A;  3IFR A;  1NGB A;  1QHA A;  3P4I A;  4BC2 A;  4I6M A;  2E8A A;  4M63 C;  3LDP A;  5BPN A;  3H1Q A;  1YVN A;  1U2V A;  3O4W A;  4BRI A;  5EVZ A;  1GLL O;  2I7N A;  1NMD A;  3FZF A;  1HX1 A;  2P9N B;  3QIC A;  5FPD A;  4H5T A;  1KXP A;  3UE5 A;  4BVO A;  3CJC A;  3HM8 A;  2IVP A;  2P9I A;  2Q1N A;  1E4G T;  4JNE A;  3GOI A;  2P9K A;  1BA1 A;  2QM1 A;  5EY4 A;  5JLH A;  4FWQ A;  3VEV A;  5AQL A;  3FZL A;  2GWJ A;  4DB3 A;  2DPN A;  3I8B A;  4H0X B;  4CBW A;  1RDW X;  3VGK A;  3WXK A;  2E1Y A;  3I33 A;  4BRA A;  1V4S A;  4B1V A;  2PBD A;  5BN9 A;  1HKB A;  1BU6 O;  2VYP A;  3WXJ A;  4BRQ A;  3O80 A;  1MWK A;  4BR9 A;  2P9U B;  3CJB A;  4BRF A;  2D1K A;  3HI0 A;  2A41 A;  1MA9 B;  1Z05 A;  4CBX A;  2FSN A;  3H45 C;  4K42 A;  3HTV A;  4WYB A;  2IIR A;  4IWV A;  4A61 A;  5EX5 A;  1GLE G;  3O08 A;  5LJV A;  3D2E A;  4LC9 B;  1HKG A;  3BEX A;  1T44 A;  4KBO A;  3EZW A;  1KAZ A;  3VET A;  4MLE A;  5KPR A;  3HBT A;  2V52 B;  4BRO A;  3WEE A;  3W0L A;  3LM2 A;  1GLB G;  4BRP A;  2YJE A;  1OKJ A;  1TUY A;  3R9P A;  4B1Z A;  1QZ6 A;  2GTD A;  1XQS C;  4JD2 A;  1JCE A;  1X9J A;  3EO3 A;  4HTL A;  2E2O A;  3A0I X;  3A5M C;  4PL8 A;  3RSE B;  4AM7 A;  3MCP A;  2A5X A;  4K43 A;  3VGM A;  2QWO A;  5ADX A;  3VEZ A;  4BR0 A;  1DGK N;  3VEY A;  5F0X A;  1QZ5 A;  1LOT B;  4K25 A;  3VEN A;  1TYQ A;  4PKH A;  3SMS A;  5F2R A;  4Y0W A;  1JCG A;  1K8K A;  2E2P A;  4BQZ A;  5AZI A;  2QWL A;  3UKR A;  3QB0 A;  3KHY A;  3ZET B;  4EAH D;  5BRH A;  2IVO A;  4JD2 B;  4I6M B;  1BWF O;  3FR0 A;  2P9K B;  3DAW A;  4H5V A;  1QQO A;  2QW9 A;  3GE1 A;  3LDQ A;  4FPB A;  3AAR A;  4IJA A;  4K41 A;  1GLD G;  4MLH A;  4BRE A;  1ZC6 A;  1K8K B;  2ASM A;  5ELZ A;  5ADX H;  4XH1 A;  2ZGZ A;  2FXU A;  4FWN A;  4B1X B;  1BA0 A;  3H46 O;  3WXI A;  5FPM A;  1NGG A;  3C0B A;  1JCF A;  4WQ5 A;  3VEW A;  4CZM A;  4CJ7 A;  2V7Z A;  3MN7 A;  3SMP A;  1NM1 A;  2J4R A;  2UYT A;  2WUS A;  4DQ8 A;  4FOI A;  1Y64 A;  4BR5 A;  2P9U A;  3EKU A;  3CJA A;  2AP1 A;  1XUP O;  4BC4 A;  5JIC A;  1R59 O;  2GEM A;  4FSV A;  4J8F A;  3H1V X;  3WXL A;  3ZEU B;  2GUP A;  4B1U B;  1HJO A;  4CZJ A;  2Q0U A;  3BF3 A;  2PAV A;  3LDL A;  3QFU A;  3L4I A;  4H03 B;  3VF6 A;  2VCP A;  5CE3 A;  3MK6 A;  3FFK B;  3D7E O;  5BN8 A;  4JHD B;  1XC3 A;  3LDO A;  3MDQ A;  3H3N O;  5KPZ A;  1S22 A;  3VEO A;  2EWS A;  3DWL A;  4Z94 A;  5BPM A;  1NGF A;  3ZEU A;  2YI1 A;  4GY2 B;  1X3M A;  4IZ9 A;  2QXL A;  1GLJ O;  2QWN A;  3CQX A;  3IUC A;  4WQ4 A;  3EN9 A;  3WQT A;  2I7P A;  5AZJ A;  5AQG A;  1SAZ A;  3L6Q A;  2CGJ A;  3D2F B;  1NLV A;  2FF3 B;  4FWO A;  4EHT A;  4F9O A;  2CGK A;  4JN4 A;  3R6M A;  3WQU A;  5KQD A;  2P9L B;  1T6D A;  3QBW A;  3VER A;  5AQN A;  2E88 A;  3D2F A;  3ULE B;  1LCU A;  4EFH A;  4CZK A;  5AQR A;  5AQK A;  4A62 A;  2F9T A;  2FSK A;  1SQK A;  1D4X A;  4H0Y B;  3ZX3 A;  1NGE A;  4ISF A;  4IJN A;  5LY3 A;  2E1Z A;  4QS7 A;  3ATU A;  3LDN A;  3AAQ A;  2OAN A;  2A40 A;  1BG3 A;  1X3N A;  2D0P A;  3BUZ B;  3CJ7 A;  2P9N A;  3DXM B;  3MN5 A;  2A6A A;  2D0O A;  5EXW A;  3ULE A;  3LL3 A;  3C7N A;  3RSE A;  1U2V B;  3DJC A;  4O8K A;  2ZWH A;  2A42 A;  2GWK A;  2FSJ A;  5AFU H;  1NGA A;  5E84 A;  5JMV A;  1GLF O;  5AQH A;  1QQM A;  4H0O A;  1H1V A;  3C7N B;  4FWR A;  4FWP A;  1BO5 O;  1WUA A;  3D2E B;  5KQ8 A;  2FF6 A;  2W40 A;  4L3Q A;  4BC3 A;  1EQY A;  3JXU A;  5F1X A;  3UB5 A;  1C0G A;  4FO0 A;  5AFU A;  1WOQ A;  3ZX2 A;  1NGI A;  4CZH A;  3L0Q A;  3CI5 A;  1NGH A;  4BGB A;  3EKS A;  2YHY A;  4E1J A;  5AQO A;  3O1W A;  3AY9 A;  2E2N A;  5AQJ A;  5EOY A;  2GEL A;  4BRM A;  1TUU A;  2HF3 A;  3AAP A;  5BRE A;  2W41 A;  4DCH A;  4ISG A;  3O1B A;  1RGI A;  1U6Z A;  3ATV A;  3ZX0 A;  4CZE A;  4H0P A;  3WEE B;  5AQT A;  5E26 A;  3QDK A;  3VES A;  2P9L A;  5FPE A;  2P9S A;  4BR4 A;  4IO8 A;  3U4L A;  1HPM A;  3DXK A;  3S41 A;  1ATN A;  3GL1 A;  4BRG A;  4A2B A;  4A2A A;  3OHR A;  3BP8 A;  4YDU C;  5AZI B;  3HZ6 A;  3ID8 A;  3O6W A;  2ASO A;  2QWR A;  1S3X A;  2P9P B;  3MMV A;  4BR7 A;  2KHO A;  2Q0R A;  3FZH A;  1KAY A;  3ENH A;  5I9E B;  3M6G A;  3FE1 A;  4H0T B;  3DXM A;  5LJW A;  4M7X A;  3M3Z A;  4BRK A;  1ATR A;  3CIP A;  1Z6R A;  3FZK A;  4XEI A;  1YXQ A;  2YCH A;  3UKU B;  1BOT O;  4M7Y A;  1GLC G;  3CJ1 A;  5AQP A;  5TKY A;  4BRC A;  4QS9 A;  2NRH A;  1DKG D;  4MO4 A;  3MN6 A;  4YDU A;  4EHU A;  1QQN A;  5BRF A;  2AA4 A;  3VPZ A;  4FPA A;  5AQM A;  3UKU A;  1V4T A;  4FL9 A;  5BRD A;  1E4F T;  1MDU B;  1CZA N;  3U9Z A;  1RFQ A;  2Q97 A;  3A8Y A;  2HF4 A;  2IVN A;  3CJ9 A;  3CQY A;  3TU5 A;  4O5F A;  2E2Q A;  1ZXO A;  2Q2R A;  3QBX A;  5AZJ B;  3FGU A;  2V51 B;  3SLC A;  3U8X A;  1Q18 A;  3MN9 A;  3KZB A;  4PKG A;  4BGA A;  4CI6 A;  5AQZ A;  2NZT A;  4BRN A;  1BDG A;  4CZG A;  1HUX A;  5BR9 A;  2F9W A;  4NO7 A;  1SZ2 A;  2BTF A;  1HLU A;  4BQL A;  2V7Y A;  3VGL A;  5AR0 A;  1J6Z A;  2HOE A;  3F9M A;  4B1W B;  1BUP A;  1GLA G;  3O5B A;  2YJF A;  3BF1 A;  2Q31 A;  4XH4 A;  3R8E A;  1YAG A;  1TYQ B;  3WT0 A;  3VF2 A;  2YHW A;  2ZGY A;  3EL2 A;  3ZET A;  2ITM A;  4RCH A;  3FZM A;  3W3D A;  2QWP A;  1T6C A;  4BRL A;  1ESV A;  5AQU A;  1IG8 A;  1NWK A;  4FWM A;  2CH6 A;  1G99 A;  2P9P A;  3FLC O;  4FWK A;  1NGD A;  1NGC A;  4B1Y B;  4JAX A;  3H3O B;  3KVG A;  4CBU A;  3U9D A;  3UKR B;  5AQX A;  1NGJ A;  4BVP A;  4HWI A;  4NB4 A;  3O8M A;  5AQF A;  2CGL A;  2QWM A;  4MO5 A;  4AM6 A;  1ZBS A;  1KAX A;  3GBT A;  4PL7 A;  4H5W A;  3GG4 A;  3SJH A;  1ATS A;  2BUP A;  4FOE A;  4CZI A;  4PKI A; 
#chains in the Genus database with same CATH topology
 4JKE A;  3NE6 A;  4H5R A;  4NXM K;  4CED A;  4CIG A;  2A3Z A;  5EU7 A;  1WAF A;  4GMJ B;  4BR2 A;  4C8O A;  2H3G X;  4OKJ A;  4Z0U A;  1VSE A;  3VQ9 A;  3CHW A;  3CER A;  4FWL A;  4BG9 A;  1VSH A;  2NLX A;  4JHD A;  3TPQ A;  5J2M A;  3V6D A;  4FWS A;  1N33 K;  3NF8 A;  2FC0 A;  4H8K A;  1I3A A;  1YIT N;  1VQO N;  4CFC A;  4B9T A;  3RTV A;  3U3Y A;  5AQV A;  4Z4I A;  1A5W A;  3NF6 A;  3ENB A;  5CHI A;  2CH5 A;  4GW6 A;  3J8A A;  2OPQ A;  3QFP A;  2Q36 A;  3OYL A;  3IMX A;  4CD1 A;  4Y1D A;  5AQS A;  3OS0 A;  1L3T A;  5BPL A;  3SUQ A;  3LP3 A;  4E7I A;  4DS5 A;  4KPY A;  4OPA A;  3T69 A;  4Y1C A;  4DSJ A;  2ZF5 O;  1P8Z A;  3LP1 A;  1Q7Y O;  3LAN A;  2IGI A;  2O8C A;  3T3F A;  3VQ8 A;  4CEZ A;  4CEF A;  3L2Q A;  4DR7 K;  1YUW A;  4WQ5 C;  1IJJ A;  4JRQ A;  4I6M A;  1D9F A;  3PLA A;  4LF9 K;  4LF6 K;  3KK3 A;  5BPN A;  2E5L K;  2VGN A;  3VA3 A;  4I9Q A;  3FZF A;  1K73 O;  4JI0 K;  3ZT1 A;  1I94 K;  3NH0 A;  5EY4 A;  4KI4 A;  1RT4 A;  4JS5 A;  3O9Q A;  3MED A;  4OX9 K;  2XY7 A;  5HBM A;  1KVB A;  3WXK A;  4YOV A;  4BRA A;  4B9N A;  4AHS A;  4DUY K;  4RW9 A;  1IKY A;  3QEI A;  1K6Y A;  2P9U B;  3OS2 A;  3CJB A;  3WNF A;  2A41 A;  1WSJ A;  2FSN A;  1U4B A;  1RT7 A;  5FRN A;  3PUF A;  3C95 A;  4HTU A;  1JJ2 M;  1SL0 A;  2A1R A;  3D2E A;  4LC9 B;  5HLF A;  3AA5 X;  1SKS A;  5IT9 O;  4CGD A;  4MLE A;  2V52 B;  4B8A B;  3G4S N;  4BRO A;  3LM2 A;  4CJP A;  2YJE A;  1OKJ A;  4JD2 A;  5A2Q O;  2E2O A;  5I42 A;  3NVM A;  3RSE B;  3MCP A;  2XY6 A;  1YJ9 N;  2OZM A;  2X6N A;  4CGG A;  3NH2 A;  2BDP A;  1DGK N;  1LWE A;  4M41 A;  1QZ5 A;  2ATQ A;  1VQ4 N;  3VEN A;  3AA2 A;  3SMS A;  4Y0W A;  2XO7 A;  4FM0 A;  3KHY A;  1JLQ A;  4I6M B;  3CCV N;  1BWF O;  4KRF A;  1LAW A;  3ID6 A;  3FR0 A;  3K57 A;  4H5V A;  1QSL A;  4FPB A;  3DOK A;  1ZC6 A;  2ASM A;  3KD5 E;  2RE2 A;  4XH1 A;  4FLX A;  3OVN A;  3Q7B A;  1BA0 A;  4NXN K;  3D0P A;  3C0B A;  1JCF A;  1RBR A;  4GVM A;  1S1U A;  2V7Z A;  4CJ7 A;  4QAG A;  4DQS A;  4CHY A;  4C1N K;  2NRV A;  2P9U A;  4C8N A;  1HYV A;  1XUP O;  4IKF A;  4BC4 A;  4DG1 A;  1WSH A;  4DQQ A;  4NYF A;  4FJG A;  1LWC A;  1QVF M;  2GEM A;  3KIO A;  3S3M A;  1YI2 N;  4PY5 A;  4BY9 C;  1BI4 A;  1Q8I A;  2BH1 A;  2YKN A;  3K9K A;  5GIP A;  3QFU A;  1SUQ A;  3L4I A;  3VF6 A;  1S72 N;  3D7E O;  3D45 A;  2QKB A;  3HPO A;  3QNO A;  1ASW A;  4CK2 A;  5KPZ A;  4JI3 K;  3T19 A;  4C8M A;  4Z94 A;  3R3L A;  2HW3 A;  5BPM A;  1NGF A;  1N6Q A;  3QEV A;  3DLL L;  2YI1 A;  4A5A A;  1QE1 A;  1UAX A;  5KTQ A;  1GLJ O;  3LP2 A;  1YJN N;  3V1R A;  1IV0 A;  2Q3S A;  4JLH A;  3IUC A;  4UQG A;  4WQ4 A;  3WQT A;  4JV5 K;  4DV6 K;  2OPP A;  3VN5 A;  2Y1I A;  4HUG A;  4NCB A;  3DLK A;  4FWO A;  2VG5 A;  4JN4 A;  3SPZ A;  5KQD A;  3D2F A;  4X64 K;  4EFH A;  2ZD1 A;  1WSF A;  3MAQ A;  5J2P A;  1K8A O;  4MDB A;  3HO1 A;  4NYN A;  4M3X A;  4IEE A;  5HRP A;  3KTQ A;  2FSK A;  1SQK A;  4H0Y B;  3ZX3 A;  4B3T K;  1S1V A;  4ISF A;  5LY3 A;  3E66 A;  3LZJ A;  1BG3 A;  2D0P A;  5FLX O;  3MN5 A;  4BE2 A;  1UA0 A;  4M3Y A;  3CPW M;  4KAZ A;  3RSE A;  1U2V B;  4O8K A;  3MEG A;  4M3U A;  1ZBL A;  4Z4G A;  5E84 A;  4B9S A;  3OA9 A;  1EO1 A;  5AQH A;  2NRX A;  3ZSR A;  2NUB A;  1ZBF A;  3SNN A;  3C7N B;  3PX6 A;  2G8H A;  4ZTJ A;  1EXQ A;  4DWI A;  2W40 A;  3CCR N;  4J2D A;  3M8Q A;  3MWT A;  1RIL A;  5JS2 A;  4BC3 A;  1QQC A;  1RBU A;  3NGY A;  5HOO A;  1C0G A;  1DLO A;  2QTD A;  4FO0 A;  1OH7 A;  3T7Z A;  3K9J A;  4XIU A;  1CZ9 A;  1NGI A;  1D5A A;  4CZH A;  1L5U A;  3HP6 A;  1VQN N;  1CXU A;  4YOY A;  4E7K A;  2P5G A;  3EKS A;  3K0S A;  3SV4 A;  4B9L A;  3OJS A;  1KFD A;  1LW0 A;  3AY9 A;  3AV9 A;  3P39 A;  3SQ0 A;  2GEL A;  3ZYY X;  1B92 A;  3OYB A;  3OYA A;  1RDB A;  1R0A A;  3OYI A;  4A57 A;  3TAN A;  3ITH A;  4OPK A;  4FM1 A;  3OYJ A;  3F73 A;  4IFE A;  4KRE A;  1RGI A;  1OH5 A;  5E26 A;  3ZLJ A;  3QDK A;  5C2D A;  2NRZ A;  4IO8 A;  3S41 A;  4CW7 B;  4CJL A;  4A2B A;  3O3H A;  1VQ7 N;  3SQ4 A;  3AVC A;  4JKB A;  1YTU A;  4HUF A;  2HHT A;  4OGE A;  2Q0R A;  4LF7 K;  1X9S A;  4U67 L;  5I9E B;  1N32 K;  3M6G A;  3DXM A;  3LAK A;  5MLC Q;  4KHN A;  3M3Z A;  2O8C B;  2JLE A;  4W5R A;  3ZT3 A;  4R5P A;  3CJ1 A;  3D6R A;  1B9D A;  1I39 A;  2PFU A;  4BRC A;  4FLT A;  4ELU A;  4DV3 K;  3AA4 A;  3MN6 A;  1NJW A;  4EHU A;  3VPZ A;  5AQM A;  3UKU A;  4FL9 A;  5SZT A;  2UUA K;  3IKM A;  4DF8 A;  3A8Y A;  4J2E A;  4DTM A;  3S3N A;  3LZI A;  1VQ8 N;  4O0I A;  1ILY A;  4OPJ A;  3QLH A;  3FGU A;  5CZ1 A;  1VQM N;  1Q18 A;  1TVR A;  3KZB A;  4CI6 A;  5AQZ A;  1XHX A;  1BDG A;  5BR9 A;  2EX3 A;  3TSQ A;  4FJL A;  1IKV A;  1KVA A;  3C6H A;  3EZ5 A;  4DV1 K;  3VGL A;  3PSI A;  1J6Z A;  3F9M A;  2OTL N;  2UU9 K;  3M8P A;  1N8R O;  3VQA A;  3NGI A;  4IBN A;  4FXD A;  3R8E A;  2X78 A;  1BIU A;  4A59 A;  4DSF A;  1NKB A;  3AGK A;  3ZET A;  4Z4C A;  2O8E B;  2QWP A;  3OW2 M;  5HL7 L;  2HHV A;  1IG8 A;  2CH6 A;  1WSI A;  1RBV A;  4F3T A;  4B1Y B;  3PY8 A;  4KTW A;  3PO5 A;  3PX0 A;  5J1E A;  4JRP A;  1NGJ A;  4OLA A;  5FDL A;  3ZSZ A;  5AQF A;  4R79 A;  4DFJ A;  3CCM N;  2HHW A;  2CGL A;  1NOY A;  1UA1 A;  4F2S A;  4JI8 K;  4PL7 A;  3GG4 A;  1ATS A;  3DLH A;  5M1N A;  4N47 A;  4K8X A;  4BG8 A;  3ENO A;  5DM7 L;  2WON A;  1NK5 A;  5FPN A;  1NJI O;  4XH5 A;  1M1K O;  3VF4 A;  3QET A;  3B8A X;  5J2Q A;  4RWT A;  1BIZ A;  1O13 A;  4B9Q A;  4M45 A;  2E20 A;  4ID5 A;  3ZT4 A;  3WNE A;  4LD0 A;  3NAE A;  1VQL N;  1TKD A;  4CCH A;  4CZF A;  3VQQ A;  4CGJ A;  1E3M A;  4KFB A;  2VG7 A;  1Q86 O;  4U7B A;  2YV0 X;  4BRD A;  4O44 A;  4ZTF A;  3DLB A;  2HHX A;  5GAH P;  1C1C A;  3SYZ A;  5JS1 A;  3SV3 A;  1C0F A;  2F4V K;  4KHW A;  1A5V A;  3I0S A;  1HR0 K;  2PYJ A;  2VWB A;  3AVM A;  4IXC A;  3HXM A;  4CD3 A;  3K58 A;  5BR8 K;  4QS8 A;  2O4I A;  4GV3 A;  4RW6 A;  4LFB K;  4B3M K;  3KKS A;  2XY5 A;  4BE0 A;  2QWQ A;  2F96 A;  4YOW A;  1SKR A;  1HYS A;  4JKG B;  4OVL A;  2HB5 A;  1RDC A;  4YOU A;  1EET A;  2G8W A;  3THY A;  4ISE A;  2FLO A;  4C8L A;  3IFR A;  3QEX A;  1NGB A;  3WNH A;  1QHA A;  3P4I A;  4BC2 A;  2E8A A;  3IS9 A;  5C42 A;  2NRT A;  3J80 O;  1U2V A;  2QXF A;  4BRI A;  1WBB A;  3QNN A;  2I7N A;  3CPE A;  2P9N B;  2ZQB A;  5FPD A;  2YNF A;  4H5T A;  1KXP A;  4FVU A;  1VRT A;  2P9I A;  4CF8 A;  4IO9 L;  1E4G T;  5JLH A;  1BA1 A;  2QM1 A;  5KGX A;  4BWM A;  2G8K A;  3DMJ A;  3QES A;  4DB3 A;  4DUZ K;  1IKX A;  3I8B A;  2HHH K;  4O55 A;  4CBW A;  4M3Z A;  3VGK A;  4ID1 A;  2E1Y A;  1IG9 A;  1V4S A;  4B1V A;  4IFY A;  1S1X A;  4BRQ A;  3HK2 A;  1MWK A;  4BR9 A;  4FJ5 A;  1JXB A;  4CJV A;  2NRW A;  2AJQ A;  4DSI A;  1Z05 A;  3SPY A;  1XMQ K;  3HTV A;  3ZSX A;  2G8V A;  1CZB A;  2IIR A;  3N4P A;  3SZ2 A;  1RBS A;  5C0Y A;  4C1N I;  4YFU A;  5KI6 A;  3O3G A;  3EZW A;  3BZK A;  3FFI A;  5KPR A;  1SS6 A;  1DTQ A;  4BRP A;  3KK1 A;  1T3V A;  4B3R K;  1W2B M;  1WLJ A;  1TUY A;  1QZ6 A;  1N36 K;  1JCE A;  1X9J A;  4DFP A;  5T7B A;  4A5B A;  3A5M C;  4AM7 A;  2OCE A;  3M5R A;  1TAQ A;  3VQ4 A;  3AVH A;  2IAJ A;  1FXX A;  3PV8 A;  2KQ2 A;  3VEZ A;  2YHA A;  4HCC A;  4CF9 A;  1XNR K;  1TYQ A;  3P5J A;  4PKH A;  2O8F A;  3UIQ A;  1K8K A;  1C0T A;  3EE8 A;  4IOC L;  5AZI A;  4CGH A;  2OPR A;  4JD2 B;  4JKF A;  3DYA A;  4DKW A;  3DAW A;  2QW9 A;  3E1Y A;  4K41 A;  3GE1 A;  3AAR A;  4WF9 L;  4B9U A;  1GLD G;  4I7F A;  1Q82 O;  3T1H K;  4AIL C;  2FXU A;  1BQM A;  3QO9 A;  4FJX A;  5FPM A;  4WQ5 A;  3TI0 A;  2YNI A;  2WUS A;  4FOI A;  1Y64 A;  3L2W A;  3AO4 A;  4BR5 A;  3AVK A;  3ISN C;  3CJA A;  2AP1 A;  4KKO A;  1RTH A;  4J8F A;  3WXL A;  4C8K A;  4B1U B;  2GUP A;  3CQ8 A;  2FBT A;  1D9D A;  3CF5 L;  4X62 K;  3LDL A;  4H03 B;  1OH8 A;  4CFB A;  4CVN E;  4OPH A;  1NK9 A;  3LDO A;  3VQP A;  4CES A;  2RKI A;  4CK1 A;  3MCA B;  3VEO A;  3LPU A;  3ZSY A;  4WCE L;  1J5O A;  5LMN K;  4KHQ A;  3OS1 A;  4CHQ A;  3SCX A;  2I7P A;  1ASV A;  2FBV A;  3E9O A;  3L6Q A;  3F2K A;  4OJR A;  1NLV A;  4WE1 A;  4F9O A;  3WXM B;  3R6M A;  5HRS A;  3DRR A;  4BE1 A;  2E88 A;  4KTZ A;  3E01 A;  1IBM K;  4TSX A;  1LCU A;  3KK7 A;  5AQR A;  2DY4 A;  4E19 A;  2JWL A;  3THW B;  5AQK A;  3S9H A;  4OO1 J;  1FK9 A;  3WNG A;  3CFO A;  1KRP A;  3AAQ A;  1NK7 A;  4FJ9 A;  4LF4 K;  2UUC K;  1S9E A;  4FYD A;  3NVK A;  2A6A A;  4FM2 A;  3VQ5 A;  4JS4 A;  3TAE A;  2D0O A;  1HNX K;  1JL1 A;  3C7N A;  3JAM O;  3AVJ A;  2A42 A;  2GWK A;  2FSJ A;  3TAB A;  1Z25 A;  4E7J A;  1J5E K;  1QQM A;  4H0O A;  1NNE A;  2QK9 A;  2UUB K;  1S6Q A;  3CCE N;  3RR8 A;  1QS4 A;  3JXU A;  4CFA A;  4LY7 A;  3UB5 A;  5F1X A;  3DM2 A;  1S1T A;  2D0B A;  4JYA K;  2UXD K;  3OJU A;  5GAG P;  1M90 O;  3L0Q A;  1VQK N;  1NGH A;  3HT3 A;  4BGB A;  4O4G A;  3VQB A;  1DTT A;  4JI1 K;  3V9U A;  4FW1 A;  3J7Z O;  5AQJ A;  1VK0 A;  4CGF A;  4BRM A;  1TUU A;  3AAP A;  5BRE A;  4M3W A;  2W41 A;  2HNZ A;  4YOR A;  4CF0 A;  3R1X A;  3KKR A;  4Z4E A;  3WEE B;  5J2N A;  4DLG A;  4BAC A;  1LV5 A;  3VES A;  2UXC K;  5FPE A;  4N56 A;  2VGM A;  4BR4 A;  3KLF A;  4FJH A;  1GOA A;  3TAF A;  4DV4 K;  1ATN A;  4BRG A;  1WN7 A;  5TKW A;  1YTA A;  4YDU C;  3VMF B;  3RMC A;  2HBL A;  1U48 A;  3O6W A;  2ASO A;  1S3X A;  2P9P B;  3TTF A;  3MEC A;  1TAU A;  3K59 A;  5GIN A;  1XI1 A;  1KLM A;  4F3O A;  4JKG A;  1W0H A;  3KWG A;  4CHZ A;  1P90 A;  1ATR A;  4XEI A;  4CF1 A;  1GOC A;  3CC7 N;  4N41 A;  1BOT O;  4M7Y A;  3MWP A;  4GV9 A;  1X9M A;  2A1S A;  4MO4 A;  2RHK A;  4YDU A;  2Z1G A;  3NBP A;  3TAG A;  1N5Y A;  4CJS A;  4FPA A;  3HPH A;  1HQE A;  1E4F T;  1ZBU A;  1CZA N;  3U9Z A;  4KHP K;  4DV5 K;  4LF8 K;  1RFQ A;  3M8R A;  2Q97 A;  3SAG A;  1RDD A;  3CQY A;  1EWR A;  3K2P A;  1ZXO A;  5IWA K;  2RN2 A;  4B3O A;  2GX9 A;  2V51 B;  3U8X A;  3IG1 A;  3J7Y P;  4WFB L;  1ZYQ A;  2F8S A;  3U6F A;  2XY8 A;  2KFZ A;  4DR3 K;  4KB1 A;  4MQ3 A;  1HLU A;  4JK9 A;  3BY5 A;  3QEW A;  4KO0 A;  2HOE A;  4X65 K;  1NK8 A;  4JI7 K;  1YJW N;  5C24 A;  3OYC A;  3BF1 A;  2Q31 A;  4GVE A;  1RNH A;  1TYQ B;  4M42 A;  5D3G A;  1C6V A;  2HHS A;  4RCH A;  3FZM A;  4CJR A;  1T6C A;  1ESV A;  2Z1H A;  2P9P A;  1NGD A;  1NGC A;  4UY8 O;  4AQY K;  1JXE A;  3M8S A;  3KVG A;  2W6K A;  3UKR B;  1XWL A;  4BVP A;  4NB4 A;  5HRN A;  2YX6 A;  4ZHR A;  1ZBS A;  1KAX A;  4CEB A;  4EZ9 A;  3GBT A;  4H5W A;  2HHQ A;  3QIO A;  3K5N A;  1RT5 A;  3KLG A;  4PKI A;  4JI6 K;  4AHR A;  4L8R B;  4C23 A;  1A5X A;  4DLE A;  3VOV A;  3VTI A;  3WUH A;  2ASP A;  4FZZ A;  4EP5 A;  3SK3 A;  1HKC A;  5AQY A;  1JLC A;  1BIS A;  2OYQ A;  4DHY A;  4CEC A;  1KCF A;  1IBL K;  3AO3 A;  3RMB A;  5SWM A;  4H0V B;  3OTO K;  3AVF A;  1QHT A;  1LAV A;  2GV9 A;  3A5O C;  3DRS A;  2OZS A;  2O8B A;  4I2P A;  4LSN A;  4Q5V A;  4JK7 A;  3SI6 A;  2DFH A;  2G8I A;  4RTF D;  3CET A;  4GNI A;  4CZL A;  2YHX A;  3LM9 A;  3SJJ A;  1JLB A;  1X1P A;  4KH5 A;  1OH6 A;  4PQU A;  4DV0 K;  1HRH A;  3P38 A;  3BGR A;  3G25 A;  4FJJ A;  4KI6 A;  3CD6 N;  4DR6 K;  3U3G A;  2YKM A;  3NMU A;  1DEJ A;  3IDH A;  3QML A;  2Z1I A;  2P9I B;  3BDP A;  4EIA A;  3AO1 A;  2HBJ A;  2XHB A;  1U04 A;  3DLG A;  1VQ6 N;  3LAL A;  4WFA L;  3ZT2 A;  4CJ4 A;  5M1F A;  3QIP A;  4JKC A;  4M63 C;  3H1Q A;  4KH4 A;  1YVN A;  4CJ5 A;  5EVZ A;  5KRT A;  3TAP A;  1HX1 A;  2DTU A;  1QSS A;  3K5O A;  4BVO A;  3HM8 A;  3GOI A;  3AVN A;  4FWQ A;  3VEV A;  3FZL A;  4KHS A;  2DPN A;  4H0X B;  4GKJ K;  4RW4 A;  3L3U A;  3HPG A;  5BN9 A;  2ZM6 K;  1HKB A;  3I56 N;  3QEP A;  3HJF A;  3KD1 E;  5KGW A;  4B08 A;  2E6M A;  1MA9 B;  4CBX A;  4EZ6 A;  4IEI A;  3H45 C;  3CCL N;  3DI6 A;  1NJZ A;  3O9T A;  1W9H A;  4WYB A;  2QA4 N;  1ITG A;  4IWV A;  1GLE G;  3MX5 A;  2QKK A;  2YNG A;  4CJQ A;  4DQP A;  3BEX A;  3VET A;  1U45 A;  2YNH A;  2ITG A;  3HBT A;  3WEE A;  3W0L A;  3ULD A;  1GLB G;  2QEX N;  4B1Z A;  2GTD A;  1XQS C;  1HJR A;  3EO3 A;  3L2U A;  2RPI A;  3A0I X;  3NGZ A;  2IOC A;  4GV6 A;  3V9Z A;  4PL8 A;  4JKD A;  2D5R A;  3LWL A;  2QWO A;  5ADX A;  5DMR A;  2O8E A;  3OYM A;  1VAZ A;  3O9R A;  3VEY A;  4K25 A;  4LH4 A;  5F2R A;  5CZ2 A;  2E2P A;  4BQZ A;  5CR4 A;  4LFC K;  3BZC A;  3G0Z A;  3ZET B;  4EAH D;  2IVO A;  3PSF A;  1NJX A;  1YIJ N;  2BE2 A;  1QTM A;  4MLH A;  4DR4 K;  5ELZ A;  1K8K B;  1NU0 A;  3OYE A;  3LP0 A;  4FWN A;  4B1X B;  3H46 O;  1J53 A;  3I0R A;  3VEW A;  4CZM A;  1BL3 A;  3MN7 A;  4B9M A;  3ZCM A;  1NM1 A;  3OYG A;  2J4R A;  2UYT A;  4DFK A;  3V4I A;  4DQI A;  4W5O A;  4DR5 K;  1NKE A;  2KTQ A;  3KLE A;  3VQ7 A;  1NK0 A;  5C2F A;  1R59 O;  4CEA A;  3H1V X;  3ZEU B;  2Q0U A;  3BF3 A;  4B3S K;  3RWU A;  5CE3 A;  3MK6 A;  5CYQ A;  3FFK B;  5BN8 A;  1W7A A;  1XC9 A;  3T1A A;  1S22 A;  3CCJ N;  4ICL A;  3O9S A;  4CF2 A;  1UOC A;  4DU4 A;  3O4N A;  1X3M A;  3KWI A;  2QWN A;  3HRG A;  2WC9 A;  2D0C A;  3L2R A;  4N76 A;  3EY1 A;  2CGJ A;  2FF3 B;  3RRH A;  3AO5 A;  1SL2 A;  3CCU N;  4EP4 A;  1O1W A;  4ILJ A;  1BCM A;  2P9L B;  3QBW A;  4ILG B;  4DSE A;  3VER A;  3ULE B;  3AVA A;  4CZK A;  4FJM A;  3DRP A;  1IKW A;  4M3R A;  4E89 A;  4JI5 K;  4KV8 A;  4FJ8 A;  2HMI A;  2WOM A;  1D4X A;  2NNW A;  1ZBH A;  4FCY A;  2G8U A;  3N4Q A;  2E1Z A;  4QS7 A;  4OLB A;  3RMA A;  4AH9 A;  3CFR A;  2A40 A;  3L3V A;  1X3N A;  4N5S A;  1WBD A;  3DXM B;  2P9N A;  4F4K A;  4DU3 A;  3H08 A;  5EXW A;  3CMA N;  3EYZ A;  3DJC A;  4J2A A;  4K0K K;  3NH1 A;  4G9Z A;  1C0M A;  4AF1 A;  2WTU A;  1ASU A;  5JMV A;  1D8Y A;  4CK3 A;  2UXB K;  3OYH A;  4FJ7 A;  1H1V A;  4FWR A;  4CIF A;  1WUA A;  3TAR A;  5KQ8 A;  1REV A;  3G71 N;  4L3Q A;  1EQY A;  1RCH A;  5I3U A;  1QVG M;  2E6L A;  3MXM A;  3AA3 A;  2HBM A;  4FVM A;  3V1Q A;  5AFU A;  4IDH A;  1XHZ A;  3CI5 A;  4DTX A;  3MXJ A;  1TKX A;  2YHY A;  2B6A A;  3OYD A;  5AQO A;  4BWJ A;  4PWD A;  5EOY A;  1EWQ A;  4CER A;  2O4G A;  1IBK K;  4JKA A;  4JK8 A;  1VQP N;  2HF3 A;  1KC8 O;  4CEO A;  3I55 N;  3O1B A;  1EKE A;  2FBX A;  3TTD A;  4MFB A;  4CZE A;  4DQR A;  1JLE A;  4H0P A;  5AQT A;  4YY3 K;  4KTQ A;  4LF5 K;  2P9L A;  3L2V A;  3TR8 A;  4E1M A;  1HPM A;  3GL1 A;  1FKP A;  4A2A A;  3OHR A;  3ZSV A;  3OBY A;  4RW7 A;  2EHG A;  5AZI B;  3HZ6 A;  1WSE A;  4OGC A;  4FJN A;  2XRI A;  3CXC M;  4CJF A;  1JL2 A;  4DR2 K;  4BR7 A;  3AVG A;  2KW4 A;  3ENH A;  2VQE K;  3FE1 A;  3NF7 A;  3LWM A;  3QER A;  4H0T B;  4BRK A;  3CIP A;  1Z6R A;  3FZK A;  4BDY A;  4FLV A;  4CIE A;  3J7A P;  3TWH A;  1TKT A;  1YXQ A;  1SKW A;  2YCH A;  3I8D A;  4LSL A;  5AQP A;  5TKY A;  2VWJ A;  2NRH A;  2OA8 A;  3ASM A;  2BAN A;  2JWK A;  1VSI A;  1QQN A;  5DK5 A;  2AA4 A;  3OYF A;  1V4T A;  3C6U A;  5BRD A;  3CM6 A;  1MDU B;  1CLQ A;  4DTU A;  2GBZ A;  4F2R A;  4JI4 K;  2IVN A;  3P31 A;  1ZBI A;  2OPS A;  4DTJ A;  3TU5 A;  4O5F A;  2E2Q A;  3LPT A;  2VWK A;  2Q2R A;  1VSL A;  5AZJ B;  3MXI A;  5M1O A;  3SLC A;  3MN9 A;  4PKG A;  4BGA A;  2NZT A;  4BRN A;  4HHT A;  4CZG A;  1HUX A;  1S1W A;  4NO7 A;  2OTJ N;  2PY5 A;  1SZ2 A;  2PZS A;  2BTF A;  1GOB A;  1VSD A;  2V7Y A;  3V9X A;  4IOA L;  2W42 A;  2E4L A;  4W5Q A;  3TSP A;  1HMV A;  4DTS A;  1Q81 O;  3O5B A;  2HVI A;  5FRM A;  2HHU A;  3WT0 A;  1RT6 A;  3P1G A;  3VF2 A;  4H4M A;  2YHW A;  4IFV A;  2ZGY A;  4V19 S;  4CJT A;  4IDK A;  2ITM A;  1MU2 A;  3W3D A;  4G1Q A;  3PIP L;  4FWM A;  1T8E A;  4O8U A;  3U9D A;  4W5N A;  1Z26 A;  5AQX A;  4FLY A;  1OVQ A;  3HOS A;  4DFM A;  1RT2 A;  3PO4 A;  4MO5 A;  3C94 A;  4AM6 A;  2I5J A;  5C15 A;  3P83 D;  1BGX T;  2ZJQ L;  2BUP A;  3KLH A;  1BHL A;  2PYL A;  2DFF A;  2HNY A;  4YOT A;  3DLR A;  3K5M A;  4JKH A;  4X66 K;  3G6E N;  3M1F A;  1NBW A;  3VEX A;  1FW6 A;  2HMP A;  1MWM A;  3CCS N;  3E9L A;  4DR1 K;  4FK4 A;  2HND A;  3CC4 N;  1BI4 B;  1K9M O;  1VSK A;  5B8H A;  1CXQ A;  5KPT A;  5LMU K;  4FLZ A;  2KLA A;  3HP9 A;  3A5N C;  3A5L C;  3AVB A;  3GDQ A;  4H5N A;  3H6E A;  3NHG A;  4LH5 A;  5AQI A;  5FRO A;  1HNI A;  3LAM A;  3ZSQ A;  4KHY A;  3DXK B;  3JS6 A;  2IS3 A;  3B6P A;  4BRH A;  5AQW A;  4BC5 A;  5GIO A;  4AHC A;  2X6S A;  4WQ4 C;  3SBG A;  1X9W A;  1HQU A;  5JVH L;  3HVR A;  4DTR A;  1IH7 A;  1RT1 A;  4DSL A;  3SQ1 A;  5AQQ A;  4ILH A;  5C10 A;  2P9S B;  3SAF A;  1KVC A;  2D4W A;  5JLF A;  4ELV A;  2KZZ A;  1HNV A;  3E9P A;  3HSC A;  4DTN A;  2O8F B;  2R7Y A;  1SL1 A;  3JYT A;  4FJK A;  1LWF A;  3CFP A;  2ZJR L;  3LDP A;  1F21 A;  1C0U A;  3O4W A;  3O3F A;  3SBT A;  1GLL O;  1NMD A;  1TKZ A;  3QIC A;  3UE5 A;  4DS4 A;  3HST B;  3CJC A;  2IVP A;  4JNE A;  3ALY A;  2Q1N A;  2KKZ A;  2P9K A;  4OKE A;  5AQL A;  2GWJ A;  2IC3 A;  1JLA A;  3A2F A;  3QIN A;  1RDW X;  1NG9 A;  3O4Q A;  1NK6 A;  2KZM A;  1EX4 A;  1W97 L;  2B4J A;  3I33 A;  4Z4H A;  2PBD A;  4J2B A;  5M1P A;  1BU6 O;  2VYP A;  3WXJ A;  1RDU A;  3LDS A;  4PHT X;  3O80 A;  3L8B A;  1RTJ A;  3V81 A;  3THX B;  4BRF A;  3ZT0 A;  4E1N A;  2D1K A;  3HI0 A;  2F7T A;  1L3S A;  4K42 A;  1KLN A;  1LW2 A;  5C25 A;  3PIO L;  4OKK A;  4A61 A;  1VSF A;  3AO2 A;  5EX5 A;  5HRO A;  2F8T A;  3O08 A;  3F5T A;  5LJV A;  3MX2 A;  1HKG A;  2ZE2 A;  1T44 A;  4KBO A;  4PUO A;  1KAZ A;  1NMN A;  4JI2 K;  3VQ6 A;  2ZJP L;  1YHQ N;  3IAY A;  1RTD A;  3SQ2 A;  2HBK A;  3TAQ A;  3T1Y K;  3R9P A;  3OYK A;  5M1Q A;  3PX4 A;  4HTL A;  1S6P A;  4M3T A;  2A5X A;  4K43 A;  3VGM A;  2Z1J A;  3NFA A;  4CJK A;  2GUI A;  1N34 K;  3J81 O;  3MEE A;  3KJV A;  4YNQ A;  1J54 A;  3O9U A;  4BR0 A;  4YOX A;  1KFS A;  4FK0 A;  3THY B;  5F0X A;  5C12 A;  1LOT B;  4W5T A;  1JCG A;  4DV7 K;  5JVG L;  2QWL A;  3UKR A;  3QB0 A;  4KB0 A;  4Z4F A;  5BRH A;  3VQC A;  2O8D A;  4FZY A;  2P9K B;  5E41 A;  4HCB A;  1T03 A;  1QQO A;  3LDQ A;  4IJA A;  4BRE A;  5ADX H;  4CJW A;  4NCA A;  2ZGZ A;  1UWB A;  3EEQ A;  1Y97 A;  1QSY A;  3WXI A;  1TGO A;  1NGG A;  4RW8 A;  3Q7C A;  3SMP A;  4CJE A;  2B5J A;  1NOZ A;  4FJI A;  4DQ8 A;  1XMO K;  2O8B B;  3EKU A;  3VQD A;  2VQF K;  4E7L A;  5JIC A;  3RMD A;  4FSV A;  2QI2 A;  4CHN A;  4I2Q A;  3HM9 A;  1HJO A;  4CZJ A;  3VTH A;  4FK2 A;  1RDA A;  1NKC A;  3NF9 A;  3V9S A;  2PAV A;  3CYM A;  2VCP A;  4NCG A;  4JHD B;  1XC3 A;  4DSK A;  2ETJ A;  2LSN A;  3MDQ A;  3H3N O;  2EWS A;  2HST A;  4AHV A;  3DWL A;  3V1O A;  2BGG A;  3NCI A;  3ZEU A;  4GY2 B;  4IZ9 A;  2QXL A;  3CQX A;  3SUP A;  3EN9 A;  1RTI A;  5AZJ A;  5AQG A;  1SAZ A;  4CEE A;  3D2F B;  3AVI A;  4IG3 A;  3HL8 A;  2WBN A;  2VG6 A;  4EHT A;  4H4O A;  2CGK A;  3IRX A;  3ZSW A;  4CGI A;  4CFD A;  1T05 A;  1RBT A;  3WQU A;  1YT3 A;  1T6D A;  1YVU A;  5AQN A;  3DLE A;  4A62 A;  2F9T A;  2Y1J A;  1TK5 A;  3OY9 A;  1IO2 A;  3SUO A;  5LL6 Z;  3NDK A;  2O8D B;  1VQ9 N;  3SAH A;  1NGE A;  4IJN A;  3CME N;  1JLG A;  2D0A A;  3ATU A;  4F8R A;  3LDN A;  2OAN A;  4IG0 A;  3OYN A;  2KFN A;  1T7P A;  3BUZ B;  3CJ7 A;  3OBW A;  3CC2 N;  3S3O A;  3ULE A;  3LL3 A;  4HUE A;  4ELT A;  4IOX A;  2ZWH A;  4DU1 A;  5AFU H;  4B9V A;  1NGA A;  4CJ3 A;  1VHX A;  1GLF O;  4E0D A;  1HPZ A;  4CEQ A;  4FLU A;  4FZX C;  1S9G A;  4FWP A;  1BO5 O;  1EP4 A;  3D2E B;  4K8Z A;  5GAE P;  2FF6 A;  3AGR A;  1KD1 O;  1HNW K;  5HRR A;  2HVH A;  3G10 A;  1G15 A;  1JLF A;  3CM5 A;  4CHO A;  1DT9 A;  4QCL A;  4FW2 A;  1WOQ A;  5CY4 A;  4FLW A;  3ZX2 A;  5K14 A;  3RR7 A;  4NLC A;  2FBY A;  4O5B A;  1VRU A;  1VSM A;  4RG8 A;  4E1J A;  3O1W A;  1BQN A;  2E2N A;  5M1K A;  4BDZ A;  2YHB A;  1RT3 A;  1C1A A;  3RRG A;  1TK8 A;  1HNZ K;  4DCH A;  3HYF A;  1Q9Y A;  4ISG A;  3V9W A;  1C1B A;  4CJU A;  1J9A A;  3DOL A;  3F9K A;  2X74 A;  1U6Z A;  3ATV A;  2JGU A;  3ZX0 A;  2P51 A;  3HVT A;  1KSP A;  1B9F A;  2P9S A;  3EE9 A;  3U4L A;  3DXK A;  1TK0 A;  1WSG A;  5KRS A;  1NK4 A;  3BP8 A;  1WAJ A;  1TV6 A;  3ID8 A;  3SUN A;  1L3V A;  5AJ3 K;  1KTQ A;  2QWR A;  2P1J A;  3C65 A;  2G8F A;  3MMV A;  4DF4 A;  4CHP A;  4LFA K;  2KHO A;  4MDA A;  3FZH A;  3KK2 A;  1KAY A;  3CCQ N;  5LJW A;  3JSM A;  4M7X A;  4O0J A;  5HP1 A;  1FKO A;  3UKU B;  3C6T A;  1GLC G;  4DV2 K;  4QS9 A;  3VA0 A;  1NJY A;  1DKG D;  4HVJ A;  2P5O A;  1U47 A;  1SV5 A;  5BRF A;  3AVL A;  1U49 A;  3VQE A;  1KQS M;  3K5L A;  5CYM A;  3THW A;  5H1S Q;  3THX A;  4NLB A;  4E7H A;  2HF4 A;  4DTP A;  1VSJ A;  3CJ9 A;  4KH6 A;  3C6A A;  3ZSO A;  1TL3 A;  3TTC A;  3KLI A;  3QBX A;  1TL1 A;  5DM6 L;  1WNS A;  1WB9 A;  2RF2 A;  4DMN A;  4AHT A;  2F9W A;  4BQL A;  1YF5 L;  4DTO A;  5AR0 A;  4B8C A;  2NRR A;  4B1W B;  1BUP A;  3B6O A;  1Q9X A;  1GLA G;  2YJF A;  2WFB A;  4XH4 A;  4BDP A;  1YAG A;  3HOT A;  3RVC A;  3L4Q A;  3EL2 A;  3THV A;  3TSU A;  2DFE A;  4BRL A;  5AQU A;  1FJG K;  1NWK A;  3FLC O;  1G99 A;  4GKK K;  4FWK A;  1BCO A;  1XNQ K;  4JAX A;  4QOZ B;  3H3O B;  4AHU A;  3TAM A;  4CBU A;  1HYZ A;  1JKH A;  4Q0B A;  4HWI A;  1L3U A;  2W6L A;  3O8M A;  4E3S A;  1S5J A;  2IDO A;  2QWM A;  4CE9 A;  5GAD P;  4WFN L;  4JEP A;  1VQ5 N;  1OVY A;  4KHU A;  3CG7 A;  4I9L A;  3SJH A;  4YHH K;  4FOE A;  4PA1 A;  4CZI A; 
#chains in the Genus database with same CATH homology
 4YOT A;  4JKE A;  4BG8 A;  3ENO A;  4H5R A;  5DM7 L;  4C23 A;  5FPN A;  2A3Z A;  1NJI O;  4JKH A;  3G6E N;  3M1F A;  1NBW A;  3VOV A;  4XH5 A;  3VEX A;  4BR2 A;  1M1K O;  3VF4 A;  2H3G X;  3B8A X;  3VTI A;  4RWT A;  3WUH A;  2HMP A;  1O13 A;  1MWM A;  3CHW A;  4B9Q A;  2ASP A;  3CCS N;  2E20 A;  3CER A;  4FWL A;  3SK3 A;  1HKC A;  5AQY A;  3E9L A;  1VQL N;  4CZF A;  4DHY A;  4BG9 A;  2NLX A;  4JHD A;  3TPQ A;  3CC4 N;  1Q86 O;  4U7B A;  4FWS A;  1K9M O;  4BRD A;  5B8H A;  5KPT A;  4H0V B;  1YIT N;  1VQO N;  5GAH P;  2KLA A;  3A5N C;  3A5L C;  3A5O C;  1C0F A;  4JK7 A;  5AQV A;  3GDQ A;  3ENB A;  5CHI A;  4H5N A;  3H6E A;  2CH5 A;  4RTF D;  2VWB A;  3CET A;  3J8A A;  4IXC A;  4CD3 A;  4GNI A;  5AQI A;  3QFP A;  2Q36 A;  4CZL A;  2YHX A;  3DXK B;  3IMX A;  4CD1 A;  4QS8 A;  3LM9 A;  5AQS A;  3JS6 A;  5BPL A;  4BRH A;  4KH5 A;  5AQW A;  4GV3 A;  4BC5 A;  5GIO A;  3P38 A;  4WQ4 C;  4OPA A;  3SBG A;  3T69 A;  5JVH L;  2QWQ A;  4YOW A;  3G25 A;  2ZF5 O;  1P8Z A;  3CD6 N;  4JKG B;  1Q7Y O;  3NMU A;  5AQQ A;  4ILH A;  4YOU A;  1DEJ A;  5C10 A;  3IDH A;  3QML A;  2P9S B;  2P9I B;  3SAF A;  2D4W A;  5JLF A;  4ISE A;  4EIA A;  2FLO A;  1YUW A;  2HBJ A;  3E9P A;  1IJJ A;  3HSC A;  3IFR A;  4WQ5 C;  1VQ6 N;  4WFA L;  1NGB A;  1QHA A;  5M1F A;  3P4I A;  4BC2 A;  4I6M A;  2ZJR L;  2E8A A;  4JKC A;  4M63 C;  3PLA A;  3LDP A;  5BPN A;  3H1Q A;  2NRT A;  1YVN A;  1U2V A;  3O4W A;  4KH4 A;  2VGN A;  4BRI A;  5EVZ A;  3SBT A;  1GLL O;  2I7N A;  1NMD A;  3CPE A;  3FZF A;  1HX1 A;  2P9N B;  3QIC A;  5FPD A;  1K73 O;  4H5T A;  1KXP A;  3UE5 A;  4BVO A;  4FVU A;  3CJC A;  2IVP A;  2P9I A;  3HM8 A;  2Q1N A;  1E4G T;  4JNE A;  2KKZ A;  2P9K A;  2QM1 A;  1BA1 A;  3GOI A;  5JLH A;  4FWQ A;  3VEV A;  5AQL A;  3O9Q A;  3FZL A;  2GWJ A;  4DB3 A;  2DPN A;  3I8B A;  4H0X B;  4CBW A;  1RDW X;  3VGK A;  3WXK A;  4YOV A;  1W97 L;  2E1Y A;  3I33 A;  4BRA A;  1V4S A;  4B1V A;  2PBD A;  5BN9 A;  1HKB A;  5M1P A;  1BU6 O;  2VYP A;  3WXJ A;  1RDU A;  3I56 N;  4PHT X;  4BRQ A;  3O80 A;  1MWK A;  4BR9 A;  2P9U B;  3CJB A;  2NRW A;  4MLH A;  4BRF A;  2D1K A;  3HI0 A;  2A41 A;  1MA9 B;  1Z05 A;  4CBX A;  2F7T A;  2FSN A;  4IEI A;  3H45 C;  3CCL N;  4K42 A;  3HTV A;  3O9T A;  4WYB A;  2QA4 N;  3PIO L;  2IIR A;  4IWV A;  4A61 A;  1JJ2 M;  5EX5 A;  1GLE G;  3N4P A;  3MX5 A;  3F5T A;  3O08 A;  5LJV A;  5C0Y A;  3MX2 A;  4C1N I;  3D2E A;  4LC9 B;  1HKG A;  3BEX A;  1T44 A;  4KBO A;  3EZW A;  1KAZ A;  3VET A;  2ZJP L;  1YHQ N;  4MLE A;  5KPR A;  3HBT A;  2V52 B;  3G4S N;  4BRO A;  1SS6 A;  3WEE A;  3W0L A;  3LM2 A;  1GLB G;  4BRP A;  2HBK A;  2YJE A;  1OKJ A;  1T3V A;  1W2B M;  2QEX N;  1TUY A;  3R9P A;  4B1Z A;  1QZ6 A;  2GTD A;  1XQS C;  4JD2 A;  1JCE A;  1X9J A;  3EO3 A;  5M1Q A;  4HTL A;  2E2O A;  3A0I X;  4A5B A;  4GV6 A;  3NVM A;  3A5M C;  4PL8 A;  3RSE B;  4JKD A;  3MCP A;  3M5R A;  2A5X A;  4AM7 A;  4K43 A;  3VGM A;  2QWO A;  1YJ9 N;  5ADX A;  3VEZ A;  3O9U A;  4BR0 A;  4YOX A;  1VAZ A;  1DGK N;  3O9R A;  3VEY A;  1QZ5 A;  1LOT B;  5C12 A;  5F0X A;  1VQ4 N;  4K25 A;  3VEN A;  1TYQ A;  4PKH A;  3SMS A;  5F2R A;  4Y0W A;  1JCG A;  1K8K A;  2E2P A;  3EE8 A;  4BQZ A;  5CR4 A;  4IOC L;  5AZI A;  5JVG L;  2QWL A;  3UKR A;  3QB0 A;  3KHY A;  3ZET B;  4EAH D;  5BRH A;  2IVO A;  4JD2 B;  4I6M B;  4JKF A;  3CCV N;  1BWF O;  1YIJ N;  3ID6 A;  3FR0 A;  2P9K B;  4DKW A;  3DAW A;  4H5V A;  1QQO A;  2QW9 A;  3E1Y A;  3GE1 A;  3LDQ A;  3AAR A;  4FPB A;  4IJA A;  1GLD G;  4K41 A;  4BRE A;  1ZC6 A;  1K8K B;  2ASM A;  2RE2 A;  5ELZ A;  4XH1 A;  2ZGZ A;  5ADX H;  1Q82 O;  3Q7B A;  2FXU A;  4FWN A;  4B1X B;  1BA0 A;  3H46 O;  3WXI A;  5FPM A;  1NGG A;  3C0B A;  1JCF A;  4WQ5 A;  3VEW A;  4CZM A;  4CJ7 A;  2V7Z A;  3MN7 A;  3Q7C A;  3SMP A;  1NM1 A;  2J4R A;  2UYT A;  2WUS A;  4C1N K;  4FOI A;  1Y64 A;  4DQ8 A;  2NRV A;  4BR5 A;  2P9U A;  3EKU A;  3CJA A;  2AP1 A;  1XUP O;  4BC4 A;  1QVF M;  5JIC A;  5C2F A;  1R59 O;  2GEM A;  1YI2 N;  4FSV A;  4J8F A;  2QI2 A;  3H1V X;  3WXL A;  2GUP A;  3ZEU B;  1HJO A;  4B1U B;  3VTH A;  4CZJ A;  4BY9 C;  3CF5 L;  2Q0U A;  3BF3 A;  2BH1 A;  3K9K A;  2PAV A;  5GIP A;  3LDL A;  3QFU A;  3L4I A;  4H03 B;  3VF6 A;  2VCP A;  5CE3 A;  3MK6 A;  3FFK B;  1S72 N;  3D7E O;  5BN8 A;  4JHD B;  1XC3 A;  4OPH A;  3LDO A;  3MDQ A;  3H3N O;  5KPZ A;  1S22 A;  3MCA B;  3VEO A;  2EWS A;  2HST A;  3CCJ N;  3DWL A;  4Z94 A;  3R3L A;  3O9S A;  5BPM A;  1NGF A;  3DLL L;  3ZEU A;  4WCE L;  2YI1 A;  4GY2 B;  4A5A A;  1X3M A;  3KWI A;  4IZ9 A;  2QXL A;  1GLJ O;  2QWN A;  3CQX A;  1YJN N;  3IUC A;  4WQ4 A;  3EN9 A;  3HRG A;  3WQT A;  2I7P A;  2WC9 A;  5AZJ A;  5AQG A;  1SAZ A;  3E9O A;  3L6Q A;  2CGJ A;  3F2K A;  3D2F B;  1NLV A;  2FF3 B;  2WBN A;  4FWO A;  4EHT A;  4F9O A;  3WXM B;  2CGK A;  4JN4 A;  3CCU N;  3R6M A;  3WQU A;  4ILJ A;  5KQD A;  2P9L B;  1T6D A;  3QBW A;  4ILG B;  3VER A;  5AQN A;  2E88 A;  3D2F A;  3ULE B;  1LCU A;  3KK7 A;  4EFH A;  4CZK A;  5AQR A;  2JWL A;  5AQK A;  4A62 A;  2F9T A;  4MDB A;  1K8A O;  4IEE A;  4OO1 J;  2FSK A;  1SQK A;  1D4X A;  2NNW A;  4H0Y B;  3ZX3 A;  3SAH A;  1VQ9 N;  3N4Q A;  1NGE A;  4ISF A;  4IJN A;  3CME N;  5LY3 A;  2E1Z A;  4QS7 A;  3ATU A;  3E66 A;  3LDN A;  3AAQ A;  2OAN A;  2A40 A;  1BG3 A;  1X3N A;  2D0P A;  3BUZ B;  3CJ7 A;  2P9N A;  3DXM B;  3MN5 A;  3OBW A;  3CC2 N;  3NVK A;  2A6A A;  2D0O A;  5EXW A;  3CMA N;  3CPW M;  3ULE A;  3LL3 A;  3C7N A;  3RSE A;  1U2V B;  3DJC A;  4O8K A;  4IOX A;  2ZWH A;  4G9Z A;  2A42 A;  2GWK A;  2FSJ A;  5AFU H;  4AF1 A;  1NGA A;  5E84 A;  5JMV A;  1GLF O;  3OA9 A;  1EO1 A;  5AQH A;  1QQM A;  2NRX A;  4H0O A;  1H1V A;  3C7N B;  4FWR A;  4FWP A;  1BO5 O;  1WUA A;  3D2E B;  5GAE P;  5KQ8 A;  2FF6 A;  2W40 A;  3AGR A;  3G71 N;  3CCR N;  1KD1 O;  3MWT A;  4L3Q A;  4BC3 A;  1EQY A;  1QVG M;  3CCE N;  5HOO A;  3JXU A;  5F1X A;  3UB5 A;  1C0G A;  2QTD A;  4IO9 L;  1DT9 A;  4FO0 A;  2HBM A;  3T7Z A;  5AFU A;  3K9J A;  1WOQ A;  4IDH A;  3ZX2 A;  1NGI A;  5GAG P;  4NLC A;  4CZH A;  1M90 O;  3L0Q A;  3CI5 A;  1VQK N;  1NGH A;  1VQN N;  4BGB A;  4YOY A;  3EKS A;  2YHY A;  4E1J A;  5AQO A;  3O1W A;  3AY9 A;  3J7Z O;  2E2N A;  3P39 A;  5AQJ A;  2GEL A;  5EOY A;  3ZYY X;  5M1K A;  4JKA A;  4JK8 A;  1TUU A;  4A57 A;  4BRM A;  1VQP N;  2HF3 A;  3AAP A;  5BRE A;  2W41 A;  4DCH A;  1KC8 O;  4ISG A;  4YOR A;  3I55 N;  3R1X A;  3O1B A;  4IFE A;  3TTD A;  1RGI A;  1U6Z A;  3ATV A;  3ZX0 A;  4CZE A;  4H0P A;  3WEE B;  5AQT A;  5E26 A;  3QDK A;  3VES A;  2P9L A;  5FPE A;  2P9S A;  2VGM A;  4BR4 A;  3EE9 A;  2NRZ A;  4IO8 A;  5C2D A;  3U4L A;  1HPM A;  3DXK A;  3S41 A;  1ATN A;  3GL1 A;  4BRG A;  4A2B A;  1VQ7 N;  4A2A A;  5TKW A;  3OHR A;  3OBY A;  3BP8 A;  4YDU C;  3VMF B;  2HBL A;  4JKB A;  3HZ6 A;  3ID8 A;  5AZI B;  3CXC M;  3O6W A;  2ASO A;  2QWR A;  1S3X A;  3C65 A;  2P9P B;  3MMV A;  3TTF A;  4BR7 A;  2KHO A;  2Q0R A;  5GIN A;  4MDA A;  3FZH A;  4U67 L;  1KAY A;  3ENH A;  5I9E B;  3M6G A;  4JKG A;  3FE1 A;  3CCQ N;  4H0T B;  3DXM A;  3KWG A;  4M7X A;  5LJW A;  5MLC Q;  3M3Z A;  1P90 A;  4BRK A;  1ATR A;  3CIP A;  1Z6R A;  3FZK A;  4XEI A;  3CC7 N;  1YXQ A;  2YCH A;  3UKU B;  1BOT O;  4M7Y A;  3MWP A;  4GV9 A;  1GLC G;  3CJ1 A;  5AQP A;  3D6R A;  5TKY A;  2PFU A;  4QS9 A;  4BRC A;  2NRH A;  1DKG D;  4MO4 A;  3MN6 A;  2RHK A;  4YDU A;  4EHU A;  2JWK A;  1QQN A;  5BRF A;  2AA4 A;  3VPZ A;  4FPA A;  5AQM A;  3UKU A;  1V4T A;  4FL9 A;  1KQS M;  5BRD A;  1E4F T;  1MDU B;  1CZA N;  3U9Z A;  3IKM A;  1RFQ A;  5H1S Q;  2Q97 A;  4NLB A;  3A8Y A;  2HF4 A;  3SAG A;  2IVN A;  3P31 A;  1VQ8 N;  3CJ9 A;  3CQY A;  3TU5 A;  4KH6 A;  2E2Q A;  4O5F A;  3C6A A;  1ZXO A;  3TTC A;  1ILY A;  2Q2R A;  3QBX A;  5AZJ B;  3FGU A;  2GX9 A;  5M1O A;  2V51 B;  3SLC A;  1VQM N;  3U8X A;  1Q18 A;  3MN9 A;  3KZB A;  4PKG A;  4BGA A;  5DM6 L;  4CI6 A;  5AQZ A;  2NZT A;  4WFB L;  4BRN A;  5EY4 A;  1BDG A;  4CZG A;  1HUX A;  5BR9 A;  2F9W A;  4NO7 A;  2OTJ N;  3TSQ A;  1SZ2 A;  2BTF A;  1HLU A;  4JK9 A;  4BQL A;  3C6H A;  1YF5 L;  2V7Y A;  3VGL A;  5AR0 A;  1J6Z A;  2HOE A;  4IOA L;  2NRR A;  3F9M A;  2OTL N;  3TSP A;  4B1W B;  1BUP A;  1YJW N;  1Q81 O;  1N8R O;  1GLA G;  3O5B A;  2YJF A;  2WFB A;  3BF1 A;  2Q31 A;  4XH4 A;  4GVE A;  3R8E A;  1YAG A;  1TYQ B;  3WT0 A;  4A59 A;  3VF2 A;  3HOT A;  2YHW A;  2ZGY A;  3RVC A;  3AGK A;  3EL2 A;  3L4Q A;  3ZET A;  2ITM A;  4RCH A;  3FZM A;  3TSU A;  3W3D A;  2QWP A;  1T6C A;  4BRL A;  1ESV A;  5AQU A;  5HL7 L;  3OW2 M;  1IG8 A;  3PIP L;  1NWK A;  4FWM A;  2CH6 A;  1G99 A;  2P9P A;  3FLC O;  4FWK A;  1NGD A;  1NGC A;  4B1Y B;  4UY8 O;  4JAX A;  4O8U A;  3H3O B;  3KVG A;  4CBU A;  3U9D A;  3UKR B;  5AQX A;  1NGJ A;  4BVP A;  4HWI A;  4NB4 A;  3HOS A;  3O8M A;  5AQF A;  4R79 A;  4WF9 L;  3CCM N;  2CGL A;  2QWM A;  4MO5 A;  2YX6 A;  4AM6 A;  1ZBS A;  5GAD P;  4WFN L;  1KAX A;  4JEP A;  5C15 A;  3GBT A;  1VQ5 N;  1OVY A;  4PL7 A;  4H5W A;  2ZJQ L;  3GG4 A;  3SJH A;  1ATS A;  2BUP A;  4FOE A;  4CZI A;  4PKI A;  5M1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...