3SK3A

Crystal structure of salmonella typhimurium acetate kinase (acka) with citrate bound at the dimeric interface
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
398
structure length
385
Chain Sequence
SKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGGDIDPAIIFHLHDTLGMSVDQINKMLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
total genus 133
structure length 385
sequence length 398
chains with identical sequence B
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A02
3WQTA 2P9PA 1XQSC 3DWLA 2FSNA 2E2NA 4MLEA 1KXPA 4H5NA 1HUXA 2ASOA 4WYBA 4H0OA 4BRKA 4BVPA 5I9EB 4BRMA 1HKBA 2V52B 5AQRA 1LOTB 4H0PA 4XH4A 2GWJA 4CZLA 4QS9A 4C23A 1RGIA 4FWLA 1YVNA 3H6EA 4B1VA 4CZHA 3GBTA 1HLUA 1JCFA 1YXQA 1ESVA 3OHRA 1ZC6A 2HF4A 1TUYA 4JHDA 4FWMA 4NB4A 2I7PA 5AQYA 3CQXA 4CZMA 1E4GT 1NWKA 2FXUA 3D7EO 3CJAA 4BR0A 2E8AA 2KHOA 1EQYA 3EKSA 1NGJA 5FPDA 5TKYA 5BR9A 3C0BA 4RTFD 2P9KA 4FWSA 4DHYA 4BGBA 5JLHA 1QZ6A 2P9PB 1BUPA 1KAXA 5AQTA 1JCEA 1S3XA 5CE3A 4H0XB 2IIRA 3L6QA 4FSVA 2F9TA 1S22A 1R59O 5ELZA 4CBWA 1MWMA 3M1FA 4BRIA 4CZJA 2V51B 3ATVA 3CIPA 4BG9A 1Q18A 1D4XA 2CGLA 5LJWA 5F0XA 2QWRA 5JLFA 4PKIA 1Y64A 4JHDB 1XC3A 2D1KA 2Q36A 3O1WA 3H45C 4Z94A 2QWOA 2E88A 3B8AX 3H1QA 4FWQA 1Z6RA 1BA1A 2EWSA 5AQKA 2P9KB 3FFKB 2J4RA 5AQVA 2ASMA 4BRLA 3FR0A 4BRAA 3CI5A 2WUSA 4JAXA 4BR9A 4BRDA 5KQ8A 3AAQA 5AQPA 1ZXOA 1NMDA 2CH5A 3CHWA 4B1ZA 3BF1A 4IJAA 3MMVA 4K43A 3AY9A 1T44A 2AA4A 2Q2RA 2VWBA 5BRHA 2GWKA 5AQSA 4BREA 5F1XA 3GL1A 5AQWA 1IG8A 1SZ2A 2D4WA 3A5LC 1HPMA 4FWOA 4HTLA 4K25A 4PKHA 3VEOA 1KAYA 1C0GA 1U2VA 5EOYA 3UB5A 2IVOA 4GY2B 3MK6A 4YDUA 3EN9A 1DEJA 3SLCA 4BRPA 1GLEG 1X3MA 1ATRA 1GLJO 2PAVA 2Q31A 3KZBA 3U8XA 4EIAA 1GLFO 3D2EA 3O08A 1LCUA 4K42A 1NGCA 4H0TB 4WQ4A 2A3ZA 3O8MA 3UKRA 2NZTA 4XEIA 1QQMA 3CQYA 1BOTO 3O4WA 3HTVA 3VGKA 1NGEA 3QBWA 2A5XA 3MN5A 4JN4A 4A62A 3R9PA 3VF6A 2P9LA 3WEEA 4BROA 2YCHA 5AQHA 3CERA 4H03B 3P4IA 5BRDA 4BRNA 2F9WA 2NLXA 1NGDA 4AM7A 2D0PA 4BR4A 1MA9B 1GLAG 4ISEA 5JICA 1U2VB 3JXUA 5AQXA 5B8HA 5E26A 4A61A 3D2EB 3GDQA 1NGIA 3L0QA 4BG8A 4DB3A 5AZIA 2QWQA 3FZHA 2YHXA 3VENA 1BDGA 3WQUA 3UKRB 4BRCA 3LDLA 4K41A 2P9SA 1XUPO 3MDQA 2QXLA 3BF3A 3VERA 4IXCA 3S41A 3QFPA 2P9LB 3WEEB 2FLOA 4BR5A 3MCPA 3CJBA 4BRGA 3O6WA 4FWPA 4IZ9A 1Z05A 3QICA 4IWVA 3VOVA 2E1ZA 5AQJA 2GEMA 2VYPA 4GNIA 4MLHA 5BN9A 5KPZA 5KPTA 3VF2A 1T6CA 2V7YA 2ZGZA 3VGLA 2YHYA 4B1YB 5EX5A 2Q0RA 1TUUA 3IFRA 4CZFA 5AZIB 4CD3A 2Q97A 2A42A 3H3OB 1BO5O 3A0IX 4BC4A 4RWTA 3VETA 2P9SB 1HKGA 3VPZA 3VEWA 4Y0WA 1NGGA 4FL9A 1NGHA 4XH5A 5AFUA 4BGAA 3QB0A 2Q0UA 3MN9A 3O5BA 2E2QA 3SJHA 5FPNA 3L4IA 3ZX0A 1P8ZA 3IUCA 4E1JA 5KQDA 2DPNA 4BQZA 3UKUA 4YDUC 4HWIA 3VEVA 3SK3A 3KHYA 3FZFA 4IO8A 4CZIA 4BR2A 4FPBA 1K8KA 4CI6A 4M7YA 3C7NA 3ZX2A 4BC2A 4CZEA 3JS6A 5FPMA 2VCPA 4WQ4C 2GTDA 3WT0A 4WQ5A 3SMSA 4I6MA 3QDKA 3H46O 1NGBA 3U9DA 3BP8A 3ZEUA 4EFHA 2A41A 3LM9A 5E84A 2E2OA 1MDUB 1GLLO 3LM2A 5AQZA 1GLCG 3ZX3A 2CH6A 3EL2A 3DJCA 4FWNA 4AM6A 3AAPA 2GUPA 3WXLA 1ATSA 3QMLA 3I8BA 3HBTA 4DCHA 1WOQA 3BEXA 3EO3A 3WUHA 2IVNA 2NRHA 1BWFO 2ZF5O 1WUAA 3D2FA 3UKUB 3ENHA 1SQKA 1YAGA 2I7NA 2CGJA 5AZJA 1ATNA 2QM1A 4BC5A 1QQOA 2E2PA 5AQGA 2PBDA 1K8KB 4FWKA 3MN6A 5AQLA 5BPNA 3HZ6A 2ASPA 5AQQA 3EKUA 3GG4A 2H3GX 3FLCO 1NM1A 4I6MB 4BRQA 3H3NO 1YUWA 3A5NC 3W3DA 3FZLA 3ZEUB 4BR7A 4CZKA 4CJ7A 4EHTA 4F9OA 1X3NA 1CZAN 1HKCA 2GELA 4A2AA 3U9ZA 1RFQA 4B1XB 3LDQA 4FOIA 4H5TA 4J8FA 4FO0A 3VESA 3AARA 4MO5A 4EHUA 2YJFA 3CJ1A 2YHWA 3RSEA 3W0LA 4BQLA 3D2FB 5EXWA 5AQFA 4NO7A 1JCGA 4FPAA 5AZJB 2P9NA 2QWPA 5AFUH 5LY3A 2P9UA 3DAWA 4PKGA 3LL3A 3DXMA 4MO4A 5KPRA 1H1VA 3HSCA 3TU5A 3VF4A 3HM8A 1GLDG 4B1UB 5AQMA 4H0VB 1BA0A 3FE1A 2CGKA 3ULEA 4JNEA 4O8KA 4EAHD 3O1BA 3WXJA 5F2RA 2OANA 2FSJA 3R8EA 2UYTA 4DQ8A 1HJOA 3SMPA 4CD1A 2ITMA 5EY4A 5BRFA 4CZGA 3LDOA 1RDWX 3ENOA 2E20A 1NGAA 4ISFA 1TYQA 4QS8A 3RSEB 3VGMA 4A2BA 3ATUA 5ADXA 1E4FT 3VEZA 2P9NB 3H1VX 3GOIA 4IJNA 3TPQA 1QZ5A 3F9MA 4FWRA 5AR0A 5BPLA 1GLBG 4H5RA 2P9UB 2FSKA 2P9IA 4XH1A 3M6GA 3DXKA 2QWMA 3DXMB 3EZWA 4H0YB 4KBOA 4JD2A 4WQ5C 2FF3B 2W40A 4B9QA 3G25A 2QW9A 3FZMA 3ULEB 1SAZA 3A5OC 1HX1A 3I33A 5JMVA 3CJ9A 4PL7A 4ISGA 1DGKN 5EVZA 3MN7A 5FPEA 4B1WB 3WXKA 2A40A 3FGUA 3LDPA 3KVGA 1KAZA 2QWLA 1TYQB 1BG3A 4O5FA 2Q1NA 3WXIA 3U4LA 1G99A 3IMXA 1V4SA 3LDNA 3HI0A 2HOEA 5LJVA 2ZGYA 1V4TA 4FOEA 2P9IB 1J6ZA 3DXKB 5BREA 5AQOA 4L3QA 1QQNA 2AP1A 4JD2B 2D0OA 2V7ZA 5BPMA 2ZWHA 2YI1A 3ZETA 3A5MC 2W41A 4M7XA 4QS7A 3CETA 2FF6A 2BTFA 4CBUA 5AQUA 4BRHA 4CBXA 4BRFA 1T6DA 3C7NB 3ID8A 3R6MA 3FZKA 4M63C 1DKGD 4PL8A 3CJ7A 1NBWA 2IVPA 3QFUA 4RCHA 3J8AA 3BUZB 2A6AA 1MWKA 2BUPA 3O80A 1IJJA 4H5WA 3VEXA 5AQIA 1BU6O 5AQNA 3VEYA 3QBXA 1OKJA 3IDHA 5BN8A 2E1YA 3UE5A 4BC3A 3CJCA 3A8YA 4H5VA 4BVOA 1C0FA 1NGFA 2HF3A 4LC9B 2QWNA 1ZBSA 2HMPA 3GE1A 3M3ZA 5ADXH 3ZETB 1QHAA 1X9JA 1U6ZA 2YJEA 1NLVA
chains in the Genus database with same CATH superfamily
3K9JA 2UUBK 3L8BA 4OGCA 1XQSC 3CCVN 3OYDA 2X78A 3T1HK 3P1GA 3ZSQA 1N36K 1KXPA 4BRKA 1JLCA 2KQ2A 4H0OA 4BVPA 4DU3A 1UWBA 1LOTB 3OYBA 5GAHP 1RGIA 5EU7A 4Z4EA 2HHXA 4B1VA 4CZHA 1HLUA 4CW7B 4FYDA 4FWMA 4CF1A 4U67L 5AQYA 3NF8A 2QI2A 1E4GT 3OBWA 1EQYA 1JLEA 5TKYA 1HNIA 2HHTA 3V1OA 1WSFA 1LW0A 4BGBA 4M3TA 1QZ6A 3LANA 4C8OA 2VG5A 3KLHA 3K57A 4CEEA 1S3XA 5CE3A 4H0XB 4DTNA 3MEGA 3SBGA 5C42A 4WF9L 1T05A 4KREA 1RNHA 2Z1GA 2V51B 3ATVA 3BY5A 3MECA 5FLXO 2VG7A 3T3FA 4JS5A 3E9LA 4B9SA 2CGLA 4JRQA 1XC3A 3T19A 2RHKA 4DU1A 3SQ1A 1KVBA 2QWOA 3H1QA 3CQ8A 4AHRA 5D3GA 2YV0X 4KHNA 1YHQN 3FR0A 4RW7A 4BR9A 4CGFA 2W42A 2A1RA 4XIUA 1D5AA 3O4QA 4Q5VA 2CH5A 1RT7A 4CFBA 3MMVA 1YI2N 1NJYA 4DMNA 4F8RA 4CF0A 3CMAN 1XNRK 2BE2A 5AQSA 1CXQA 4BREA 3L4QA 1I94K 5F1XA 1C1CA 4CERA 1Z25A 3KTQA 3OYLA 3VEOA 4DQSA 5EOYA 3AVCA 4JYAK 3L2UA 4I2QA 3O9UA 4CESA 4YDUA 4V19S 5DM7L 3PX0A 4DV6K 4KHYA 2PAVA 1GLJO 2YX6A 4EIAA 3RMDA 5IWAK 3K2PA 4DQQA 4NCAA 3NFAA 3CMEN 4C1NI 1NGCA 2D0CA 4H0TB 4PA1A 3O9RA 4FLTA 3NGYA 1BOTO 1EETA 3E9OA 3Q7BA 3MN5A 3VQ9A 3E1YA 3R9PA 3K58A 2DY4A 3WEEA 4BROA 5KTQA 1J53A 3TR8A 3CERA 4H03B 2XY5A 5BRDA 3OYHA 5J2QA 2NLXA 4NXMK 4BR4A 4X62K 2WONA 5AQXA 4A61A 4CECA 3D0PA 2HBLA 1KQSM 3KKRA 1L5UA 1HRHA 1ASUA 3HL8A 4DB3A 4IFEA 3OBYA 4DV4K 2QWQA 3V9WA 3CCLN 5KI6A 1VAZA 1BDGA 3BZKA 4BRCA 2P9SA 3C6AA 4JKHA 3MDQA 4CGHA 3VERA 1OVQA 1W9HA 1A5XA 4TSXA 3QFPA 4WCEL 1B9DA 3WEEB 2QK9A 3CJBA 2Z1IA 3KK7A 1JL1A 4CJSA 1TKZA 4PHTX 5AQJA 5BN9A 5CHIA 2EHGA 2DTUA 4YY3K 4CEOA 1S1WA 2IC3A 1SV5A 3VMFB 4NYNA 4B1YB 3B6OA 1IO2A 1TUUA 3IFRA 4J2AA 3AVIA 5FRMA 3L2WA 3H3OB 2P9SB 4F2RA 3NH0A 3VEWA 3N4PA 4Y0WA 1NGGA 4AHVA 4JI0K 1N34K 2QKBA 4DV5K 2XY8A 5C2DA 3S3OA 1QSYA 1LW2A 2Q0UA 3MN9A 4BE0A 2E2QA 3SJHA 3HVRA 3SBTA 2HVHA 4E1JA 3THWA 3VEVA 3SK3A 3ZSOA 4WFAL 3KHYA 3T1AA 4IO8A 1WSHA 4BR2A 4FPBA 4M7YA 3ZX2A 1VQ8N 1RDAA 3NH1A 3CCUN 1O1WA 4AHUA 2AJQA 1N32K 3OYAA 1EWRA 1D9FA 2B4JA 2GBZA 1NGBA 1JXEA 5KGWA 3BP8A 4EFHA 4QOZB 1JLAA 3AVHA 1KD1O 4FWNA 3AAPA 4OKJA 2GUPA 3IKMA 4FVUA 1RTIA 3HBTA 4EZ6A 4DCHA 3BEXA 3EO3A 1VQPN 2P5GA 3CFPA 3THWB 1SQKA 1YAGA 5AZJA 5J2MA 5HRRA 1QQOA 5AQLA 3NF9A 3KLGA 4PUOA 2ASPA 1J5OA 2UXBK 5FROA 5J1EA 2H3GX 3FLCO 1RILA 1ZYQA 3H3NO 2OCEA 3W3DA 4CJ5A 1EO1A 4KKOA 1I39A 4CZKA 4EHTA 3UIQA 1SL2A 3T7ZA 2BDPA 4CIFA 1TVRA 3LDQA 4FO0A 4EHUA 2YJFA 3W0LA 3K59A 1Q9XA 2OYQA 5EXWA 3QO9A 5AZJB 3F9KA 3WXMB 4JLHA 3PLAA 3DXMA 3M8SA 5HBMA 3HSCA 3VF4A 4RW9A 4ID1A 1GLDG 2VWKA 5BR8K 1SKRA 1J9AA 3V9UA 4HUEA 3K5NA 3BDPA 4JNEA 4O8KA 4GV3A 3WXJA 3OY9A 5F2RA 4F3TA 4CJQA 2UYTA 4DQ8A 3PX6A 4BE2A 3IG1A 4CD1A 3OYKA 3J7YP 1U45A 1WBBA 3SAHA 1W2BM 3OYCA 4LY7A 1ZBLA 3AVAA 3PO5A 4E89A 3V9ZA 3ATUA 4W5QA 3H1VX 3GOIA 3SQ0A 4DV7K 1QZ5A 1GLBG 1VSLA 4E7IA 2FSKA 3P5JA 3DXKA 3DXMB 2E6MA 3NMUA 4CVNE 2NRRA 3TANA 2QW9A 3FZMA 1SAZA 1TV6A 4CEDA 3TWHA 3NH2A 1VQKN 1HX1A 1D8YA 4WFBL 4PL7A 4ISGA 3AO5A 1NK6A 3HK2A 3EZ5A 4B9NA 4W5OA 3FGUA 4DTRA 4KH4A 1KAZA 4CE9A 3ULDA 4W5RA 1BG3A 4NLBA 3MCAB 3HPGA 3U4LA 1G99A 3IMXA 1V4SA 4JK8A 2HOEA 4HCBA 5LJVA 4U7BA 2Y1JA 3TSQA 5KRSA 1J6ZA 3DXKB 3I0RA 5BREA 4IOXA 5BPMA 2ZWHA 3I55N 4FJ7A 2KZZA 4BWMA 4DTSA 3M5RA 4M7XA 4HUFA 4CBUA 4UY8O 4BRHA 3RTVA 1T6DA 3C7NB 3R6MA 3FZKA 3DLLL 5HP1A 2ZJPL 3V1QA 1TKXA 4CJVA 4FJHA 2HBKA 3QFUA 1ASVA 4FVMA 2FBXA 1JLQA 3VEXA 1VK0A 2X6NA 4H5WA 5K14A 5AQNA 1IV0A 1XNQK 1ZBUA 5BN8A 3M8RA 2E1YA 3CJCA 4H5VA 2Q3SA 1NGFA 2HF3A 3M3ZA 3VA3A 4Z4FA 3U3YA 2HHUA 2VGMA 4CGGA 2G8UA 3WQTA 4DS4A 2P9PA 3PY8A 3LP3A 1WNSA 5DM6L 2RE2A 3QLHA 3C65A 2ASOA 4WYBA 4Z4HA 4BRMA 3KK3A 4IDHA 2NNWA 2JLEA 5AQRA 5M1KA 4H0PA 4XH4A 3DRRA 4CHQA 4FWLA 4KB0A 4Z4GA 1VQ5N 3H6EA 4B9MA 1T8EA 3GBTA 4PY5A 4ZHRA 1ZC6A 4B3OA 3KKSA 4DTPA 3AO4A 4Y1DA 4JHDA 1N33K 3VTHA 3EKSA 1KCFA 4H4OA 5FPDA 5BR9A 4M45A 4RTFD 2WFBA 4DV0K 1XHZA 4FWSA 5M1OA 3CM6A 2P9PB 4WFNL 3V6DA 1NKBA 1JCEA 4CEQA 4FK4A 2IGIA 3C6UA 3M1FA 1IBLK 4BRIA 1HJRA 4CZJA 3CIPA 3ZSZA 3TARA 1IBKK 3VA0A 2KZMA 4JHDB 1K9MO 2D1KA 2X6SA 1VQNN 4KFBA 4FJ9A 1BHLA 3FFKB 5DMRA 4E0DA 4O8UA 5KQ8A 3IRXA 3CC7N 4J2BA 4KHPK 3OS1A 4IJAA 5LMNK 1BGXT 1OVYA 1EKEA 4B9UA 2QKKA 4KAZA 3L2QA 3ZSYA 4CF9A 3U3GA 4AF1A 1IG8A 3A5LC 4IFVA 2NRWA 4FWOA 1BI4A 4PKHA 1KAYA 1C0GA 3UB5A 5CY4A 4GY2B 3MK6A 1QSSA 3DLBA 4I9LA 3T69A 1N8RO 1X3MA 3AVGA 1DTQA 1GLFO 1IBMK 3MXIA 4B9LA 1S1VA 4HUGA 4K42A 3CFOA 1UOCA 2I5JA 2QTDA 4XEIA 2KLAA 3HTVA 3VGKA 1NGEA 3QBWA 4CJTA 3VQ4A 2A5XA 4JI7K 4A62A 4YOTA 3VF6A 4Z4CA 1YF5L 1JLFA 4IG0A 4JI1K 3P4IA 1M90O 5KRTA 2F9WA 1VQLN 1BI4B 2D0PA 1MA9B 1GLAG 4ISEA 3OVNA 1FK9A 4KTWA 4CFDA 1RBVA 3EYZA 4X64K 1U49A 1ILYA 3CFRA 2HW3A 4GMJB 3TTDA 1Q9YA 4AILC 1KLNA 1XHXA 3ZYYX 4BG8A 4KHUA 1JXBA 5AZIA 3VENA 1C0MA 1S72N 3WQUA 3D45A 3KWIA 4K41A 4OPAA 4DFJA 2QXLA 3BF3A 1P90A 4IXCA 3EE8A 3S41A 4AHSA 3KLFA 3HPHA 4E3SA 4KHSA 1Q81O 2UXCK 3MCPA 3O6WA 4FWPA 3NDKA 2KW4A 4O0IA 3V81A 1Z05A 4IG3A 1Q7YO 3K5OA 4JI8K 3VQ5A 2GX9A 1C6VA 4MLHA 1LAVA 1VSKA 1KTQA 5KPTA 4DUYK 1ZBIA 3WNHA 4KRFA 4NCBA 2ZGZA 1YTAA 3VGLA 1EX4A 1NK5A 2NRZA 4JKDA 4DFMA 5AZIB 4CD3A 3HYFA 1NJZA 1BO5O 3A0IX 4RWTA 5A2QO 1HKGA 3C6TA 3QINA 5GAGP 3O3GA 3VPZA 4E7HA 2DFHA 4FLXA 3AA3A 4XH5A 5AFUA 4BGAA 1HYVA 3MWPA 1TL1A 3FFIA 3ZX0A 5KQDA 2O8DA 4PQUA 4BQZA 2B6AA 3NGZA 4DLGA 2XY6A 3FZFA 3S3MA 4ELUA 4IO9L 4CZIA 4GKJK 4OLAA 1K8KA 4KHWA 4BC2A 4CZEA 4JEPA 2XO7A 1BIZA 4CEAA 5GADP 1VSMA 1U47A 4F2SA 3LAKA 3VQDA 4HHTA 3ZEUA 2E2OA 1JLBA 4FM1A 1FXXA 4FJLA 2CH6A 2IS3A 1WB9A 4AM6A 3ENBA 2O8CA 1X9SA 3P39A 3PUFA 4OX9K 3BZCA 1WOQA 4ID5A 1NG9A 5M1QA 2O8DB 2NRHA 1BWFO 1EP4A 4IEIA 2F96A 1REVA 3ENHA 1BISA 4CEBA 1ATNA 3DLRA 5C2FA 4BC5A 5J2NA 3SUQA 4CJLA 1F21A 1K8KB 1UAXA 3HZ6A 5AQQA 3MXMA 4DTXA 1HPZA 3EKUA 1NU0A 4OVLA 4NLCA 4HVJA 1NM1A 2G8FA 4FJMA 2FBYA 1JL2A 3KD5E 3FZLA 3ZEUB 1TK5A 1N5YA 4BR7A 4DV3K 4CJ7A 3TAPA 3OJSA 3AVKA 3M8PA 4F9OA 3KLIA 3HP9A 4ILHA 4O55A 3SUPA 2O8CB 1VQ9N 4LH4A 3SYZA 2Z1HA 3U9ZA 4B1XB 4YOUA 4H5TA 1S9GA 2D0BA 4UQGA 3K9KA 4IFYA 1YT3A 3CJ1A 3RSEA 3TAMA 1CXUA 2FBTA 3KK1A 2PFUA 4NO7A 2P9NA 4KI6A 5C0YA 2QWPA 5AFUH 2P9UA 3DAWA 2E6LA 3NAEA 4ILGB 4FLVA 4N47A 2E4LA 4FJGA 3HM8A 1OH7A 5AQMA 1BA0A 3LPUA 4DLEA 2WC9A 3O1BA 4JK9A 2O8FA 4DQPA 3R8EA 4LSLA 4ZTFA 1LWEA 5GAEP 1RBSA 5BRFA 5FRNA 4CZGA 3SCXA 3LDOA 1TK8A 2A1SA 1TYQA 4QS8A 3RSEB 3L3VA 1L3SA 1VSEA 3VEZA 2P9NB 4FK0A 1RT2A 4IJNA 1NJXA 3DM2A 2P9UB 4GV6A 4AHCA 1C0UA 1NK0A 3EZWA 3TTCA 4KBOA 1RDDA 1LWFA 2FF3B 2VG6A 4DSFA 5MLCQ 3P31A 1TL3A 2O8FB 3SPYA 1C1BA 3DOKA 4JI6K 4FJKA 3I33A 1J5EK 3AVFA 3CJ9A 4CK3A 2X74A 1A5WA 4CIEA 3T1YK 3A2FA 4RW4A 3WXKA 3HPOA 2A40A 3KVGA 1XI1A 1IG9A 1TYQB 4R5PA 4O5FA 2Q1NA 4IDKA 4JI5K 3OYMA 4FZXC 1K8AO 3LDNA 5GIOA 3HI0A 3TSPA 3HJFA 3HM9A 3AGKA 4FOEA 1C1AA 3ZSVA 3JSMA 1IH7A 2UUCK 3ZT3A 2D0OA 3SQ2A 4CHOA 2UU9K 1X9MA 2ITGA 2XRIA 4KPYA 3A5MC 4DS5A 2W41A 3CC2N 1I3AA 4QS7A 1EWQA 3DRSA 4CEFA 2YNGA 1VQON 1HNVA 4OPKA 3PIOL 4B8CA 1RDCA 2RPIA 3OYFA 3ID8A 4FCYA 4EZ9A 4IOCL 1DKGD 1LV5A 4M3YA 4JI4K 4LFBK 1NJIO 1QVGM 1NBWA 2OPRA 4RCHA 3J8AA 4CK2A 1MWKA 2BUPA 2QEXN 1OKJA 3IDHA 2KTQA 3DOLA 2OPQA 4FM0A 4A59A 1IKYA 1RTHA 3A8YA 5JS1A 2NRTA 4BVOA 1RBTA 1ZBSA 5JVGL 4YHHK 4KI4A 2XHBA 3RMAA 2HB5A 1VQ4N 1NLVA 3DLEA 4PWDA 3DWLA 3L3UA 2ZJRL 4JK7A 1O13A 3TAGA 3VQCA 1TKTA 2BANA 5I9EB 2V52B 1YTUA 1Q8IA 4CZLA 4C23A 4BDYA 3THVA 3L2VA 1YXQA 1ESVA 4YORA 3OHRA 2HF4A 2WBNA 1TUYA 3E9PA 3VQPA 5CYQA 4CJWA 4LSNA 3THXA 2BH1A 3OYJA 1VSFA 2FXUA 4BR0A 3CJAA 1M1KO 1NGJA 1WSJA 5M1NA 3AO3A 1TKDA 1WBDA 2NRVA 1QVFM 4DR2K 1BUPA 1KAXA 5AQTA 3OYNA 2IIRA 4FLWA 4FZYA 2RKIA 1NKEA 1YVUA 1S22A 2F8SA 5ELZA 1CLQA 1MWMA 2VGNA 3SQ4A 5HOOA 1OH6A 5HRNA 3OYIA 3ZSXA 3SV4A 4N41A 3CG7A 5LJWA 5F0XA 2QWRA 5JLFA 3SAGA 1YJNN 1Y64A 3OA9A 3THXB 2Q36A 4Z4IA 1NK8A 2E88A 4CJ4A 1HYZA 1IKWA 3CCSN 5AQVA 2ASMA 3PIPL 2WUSA 1NNEA 4DR4K 3AAQA 5AQPA 4AH9A 1E3MA 1ZXOA 3BF1A 3PV8A 4K43A 4YOXA 4M42A 3AY9A 1T44A 4GV9A 3PSIA 1NK7A 5AQWA 1SZ2A 2D4WA 4N76A 1HPMA 2HNDA 3ZSWA 4FJ5A 3JAMO 2ZQBA 2IVOA 3RMCA 3F2KA 1DEJA 3SLCA 1TAUA 4BRPA 1GLEG 1ATRA 3KZBA 3U8XA 4FK2A 4CGDA 4JV5K 1KVAA 3J80O 2KFNA 4M3RA 2F4VK 1WSGA 3AO1A 1W7AA 3NF7A 3O8MA 3UKRA 2NZTA 1HQUA 3DLKA 3CQYA 3Q7CA 1U48A 3CCQN 4DR3K 3NGIA 3F5TA 2XY7A 4JKFA 2YCHA 3ID6A 4BRNA 4K8ZA 4AM7A 3R1XA 5JICA 3JXUA 4B8AB 4GVEA 5B8HA 5E26A 3I8DA 3M8QA 3MEDA 3O9TA 3MAQA 3QIPA 1C0TA 2NRXA 1NGIA 3L0QA 3CYMA 4JRPA 4M41A 4LF8K 3UKRB 3LDLA 1YJ9N 1XUPO 3D6RA 2FLOA 3TTFA 4BRGA 3ZLJA 2P5OA 1X9WA 4IZ9A 4IKFA 3QNNA 3QICA 4IWVA 3VN5A 1VQMN 5KGXA 2GEMA 5KPZA 4FJIA 3LWMA 1ZBFA 2KFZA 4FXDA 4CJPA 4YFUA 2Q0RA 4DWIA 2Q97A 2A42A 4NYFA 4BC4A 3RRGA 4CHNA 3VETA 5C25A 1K73O 4DG1A 3NVMA 1VSDA 3V1RA 3J81O 4G9ZA 4FL9A 1SS6A 3AGRA 2FC0A 2OPSA 2OZSA 1S9EA 3O5BA 5FPNA 4OPJA 2HHWA 1P8ZA 2OPPA 3IUCA 4DFPA 3P38A 1RT5A 3OYGA 5T7BA 1RBRA 4HWIA 3ZT4A 1UA0A 4CHPA 4M3ZA 4O5BA 1VRUA 3AVMA 2ZE2A 2G8IA 3JS6A 1U4BA 1BIUA 5FPMA 2VCPA 3ZSRA 1BQMA 4WQ4C 2GTDA 4MDBA 1HNWK 3SMSA 4I6MA 5M1FA 3NCIA 5HLFA 4LF4K 2YHAA 4C8KA 3U9DA 3QEXA 4F3OA 3HT3A 5AQZA 1GLCG 3ZX3A 3EL2A 3DJCA 5FDLA 3KJVA 4DSKA 1D9DA 3WXLA 1ATSA 4JKEA 3QMLA 3I8BA 2O8EA 4X65K 3WUHA 4OKKA 3BGRA 4LD0A 3ALYA 2ZF5O 3TAFA 2QM1A 1SKWA 4DTOA 4FWKA 3MN6A 4KO0A 5BPNA 2QA4N 1SL0A 1HNXK 3LP1A 4E1NA 4OJRA 1Z26A 4J2EA 3CF5L 2P1JA 4I6MB 4CJKA 4KHQA 3A5NC 3QIOA 3SV3A 2VWJA 4YOVA 3CXCM 1HR0K 4BDPA 1WSIA 1X3NA 1WAFA 5SWMA 4O0JA 1HKCA 4A2AA 1RT4A 3VQ8A 4HTUA 2O8EB 4FOIA 3VESA 3EY1A 4OKEA 4MO5A 5C15A 1Q86O 4BQLA 2BGGA 4LFAK 1JCGA 4RW6A 4DKWA 1KSPA 1SUQA 4CJRA 4PKGA 3LL3A 5KPRA 1CZBA 3C94A 4B1UB 4H0VB 3FE1A 3AVLA 2CGKA 3ULEA 1HMVA 3G71N 2FSJA 1J54A 4CJFA 4Z0UA 1IKXA 4C8NA 3SMPA 4B3TK 2O4IA 2ITMA 1R0AA 1NK9A 4E1MA 3AA5X 3ENOA 2E20A 1NGAA 4A2BA 3VGMA 4M3WA 4I2PA 1B92A 4JKBA 4QAGA 5ADXA 1E4FT 4QCLA 3DI6A 3JYTA 3TPQA 4O44A 5BPLA 4FZZA 4DUZK 1W97L 3OYEA 2P9IA 4XH1A 4BACA 3E01A 3EE9A 4FW1A 5H1SQ 2FBVA 2VQEK 1QSLA 2E5LK 4WQ5C 4EP4A 4LF6K 2WOMA 4B9QA 3PX4A 3NBPA 1RDBA 3G25A 3ULEB 3HO1A 4KH6A 3H08A 3I56N 4JS4A 3NE6A 1DTTA 5M1PA 3ZT1A 5LL6Z 2HHSA 1KVCA 3SZ2A 3LDPA 1KLMA 3DLHA 2W6LA 3IS9A 3WXIA 4DR6K 3HOTA 3V4IA 2RN2A 3NVKA 5LMUK 1JLGA 4KB1A 2ZGYA 2P9IB 4YOWA 4L3QA 5C24A 2F8TA 1ASWA 1QQNA 2AP1A 3IAYA 3KLEA 2YI1A 3LP0A 3ZETA 2YKMA 4H8KA 1DLOA 3NHGA 2D5RA 4DTMA 3CETA 3S3NA 1FW6A 4M63C 4DSIA 3DRPA 1JKHA 4PL8A 1VSJA 1N6QA 1BQNA 3VQ6A 5E41A 1QS4A 2HSTA 3BUZB 2A6AA 3QETA 3TAEA 3O80A 1IJJA 4ELTA 1BU6O 3VEYA 3QBXA 4CJUA 2Y1IA 3MX5A 3UE5A 4BC3A 2DFEA 2ATQA 3E66A 1HNZK 1C0FA 4LC9B 3N4QA 2HMPA 3V9XA 5ADXH 4RW8A 3ZETB 4YNQA 3QEPA 1QHAA 2OZMA 2OTJN 1U6ZA 3TI0A 5AQIA 1T3VA 1IKVA 5CR4A 1QHTA 3MWTA 2FSNA 1XMQK 2E2NA 3EEQA 4MLEA 2R7YA 4B3SK 4KTQA 4H5NA 1HUXA 4KTZA 2YKNA 4FJJA 2ZM6K 1HKBA 2UXDK 4LF5K 2G8VA 2ZD1A 3CCJN 2GWJA 2PZSA 4QS9A 4CIGA 1YVNA 1RT6A 2HVIA 4YOYA 1JCFA 3ZT2A 3KK2A 1XWLA 4FW2A 4NB4A 2I7PA 3CQXA 4CZMA 1NWKA 3D7EO 4I7FA 2E8AA 4LH5A 2KHOA 3AA4A 3CPEA 5GIPA 3AO2A 4ELVA 4DF8A 3C0BA 2P9KA 3CC4N 2HBJA 3LPTA 4DHYA 5JLHA 3OJUA 1ITGA 4C8MA 3RMBA 2G8KA 3P83D 4IBNA 5SZTA 4RG8A 4DR5K 2IDOA 3L6QA 4BWJA 4GVMA 4FSVA 3MXJA 2F9TA 1R59O 4CK1A 1RTJA 3DLGA 4W5TA 4CJEA 4CBWA 1GOCA 1S1UA 2OA8A 2YNIA 2F7TA 3NF6A 4BG9A 4ICLA 1Q18A 1D4XA 3HRGA 3S9HA 4PKIA 4B08A 4AQYK 2B5JA 3O1WA 3H45C 4CEZA 2IAJA 3LALA 4Z94A 2HNZA 3B8AX 2Z1JA 4FWQA 1Z6RA 1BA1A 2EWSA 4OPHA 5AQKA 1X1PA 4CF8A 2HHHK 4B3RK 2P9KB 2JGUA 4G1QA 4KH5A 3B6PA 2J4RA 4JKCA 4BRLA 4BRAA 3CI5A 3HVTA 4JAXA 4BRDA 5HL7L 2YNFA 4X66K 4AHTA 5CYMA 4LFCK 1NMDA 3CHWA 3I0SA 3AV9A 4B1ZA 3RVCA 4K0KK 3DYAA 1NMNA 2AA4A 2Q2RA 2VWBA 3ISNC 5BRHA 2GWKA 4Q0BA 4B9VA 2GUIA 3QERA 3O3FA 1NK4A 3RWUA 3VQ7A 3GL1A 3MX2A 1SKSA 1CZ9A 3AVBA 4HTLA 4K25A 3SUOA 2EX3A 1U2VA 1QE1A 1BL3A 3ASMA 2YNHA 1Y97A 3QESA 3PSFA 3EN9A 4DTUA 2Q31A 3O3HA 3D2EA 4C1NK 3O08A 1LCUA 3LP2A 4WQ4A 4N56A 4F4KA 2A3ZA 2P51A 4NXNK 1QQMA 4DSLA 2HNYA 3O4WA 3L2RA 4FLYA 4JN4A 4E7KA 3ZCMA 2UUAK 2P9LA 4B3MK 3SJJA 3G0ZA 4OLBA 5AQHA 4CHYA 3QEIA 1VQ7N 4MFBA 4CGJA 1NGDA 4JKAA 3KD1E 1U2VB 1NKCA 1TGOA 3QEWA 3RR8A 4BY9C 3HOSA 1RBUA 4DQIA 3OS2A 1RT3A 4JKGA 1A5VA 3HSTB 5J2PA 3VQEA 3D2EB 3GDQA 1HYSA 3FZHA 2YHXA 4FLUA 4DFKA 3O9QA 3C6HA 1S1XA 4O4GA 1L3TA 1RT1A 2P9LB 3CCMN 4BR5A 1KRPA 1NOYA 2DFFA 4DR1K 3VOVA 1G15A 2E1ZA 1BCMA 5CZ2A 4CF2A 2VYPA 4FLZA 4GNIA 1B9FA 4J2DA 3VF2A 3SUNA 1T6CA 2V7YA 4JKGB 1LAWA 4W5NA 1DT9A 3TAQA 2YHYA 4LF9K 5EX5A 1T03A 1BCOA 4CZFA 2PY5A 1T7PA 1MU2A 3CPWM 1VSHA 3OTOK 4N5SA 1WSEA 3TSUA 3SAFA 2G8WA 1OH5A 1VQ6N 1NGHA 2G8HA 1WLJA 2PYJA 3G10A 3VQAA 2O4GA 3QB0A 1S1TA 1QTMA 3G4SN 2PYLA 4A5AA 3L4IA 1TAQA 4KV8A 2DPNA 4MDAA 4C8LA 3UKUA 3CCEN 4YDUC 5CZ1A 1WAJA 4CI6A 3C7NA 4E7JA 3O9SA 2JWKA 4FM2A 3WT0A 4ILJA 4CCHA 2IOCA 4WQ5A 3QDKA 3H46O 3CCRN 4OO1J 2A41A 2QXFA 3LM9A 5E84A 1MDUB 5AJ3K 3TABA 1GLLO 2W6KA 1WN7A 3LM2A 4OGEA 3R3LA 1JJ2M 4CJ3A 5C12A 2OTLN 4HCCA 1ZBHA 4B9TA 5JVHL 1HQEA 4EP5A 4CHZA 3G6EN 1S6QA 2IVNA 2O8BA 3SPZA 3J7AP 3RRHA 5I3UA 3SI6A 5JS2A 5C10A 1WUAA 3D2FA 3UKUB 2I7NA 2CGJA 3O4NA 2E2PA 5TKWA 5AQGA 2PBDA 1NJWA 4CFCA 3GG4A 4DSEA 1NOZA 4BRQA 1GOAA 1YUWA 1K6YA 2NUBA 1FKPA 1U04A 3ZT0A 4BDZA 1RCHA 1RTDA 4I9QA 1CZAN 2GELA 3RR7A 2VQFK 1L3UA 1RFQA 4J8FA 3AARA 4DTJA 2O8BB 4E7LA 2YHWA 1XMOK 1YIJN 3ITHA 3D2FB 5AQFA 3KIOA 4FPAA 5LY3A 1KC8O 1OH8A 1XC9A 4MO4A 1H1VA 3TU5A 4H4MA 3WNFA 4DV1K 4IOAL 1Q82O 2RF2A 4EAHD 1VHXA 3MEEA 1TK0A 2OANA 1YJWN 1HJOA 2KKZA 3CD6N 5EY4A 2JWLA 1RDWX 3U6FA 4ISFA 3V9SA 3QNOA 1VSIA 3VQQA 2LSNA 4IEEA 3F9MA 4FWRA 5AR0A 2ZJQL 4H5RA 4K8XA 4WE1A 5HRPA 3M6GA 4CFAA 4DU4A 2QWMA 3K5LA 3AVNA 4H0YB 4M3UA 4M3XA 4JD2A 4DQRA 4DSJA 2W40A 4A5BA 1W0HA 3WNGA 1GOBA 3PO4A 3A5OC 4FJ8A 4ZTJA 4A57A 5JMVA 1DGKN 5EVZA 3MN7A 3F73A 3SNNA 1SL1A 4E19A 4JI2K 5FPEA 1EXQA 3LAMA 1FJGK 4B1WB 3AVJA 2QWLA 3LDSA 5DK5A 4L8RB 1YITN 3CM5A 3DMJA 2ETJA 4NCGA 2WTUA 1VRTA 2HBMA 1V4TA 4CGIA 5HRSA 3LZJA 4BE1A 4DF4A 5GINA 3HP6A 2YHBA 5AQOA 5HROA 3K0SA 1RDUA 4JD2B 5I42A 2V7ZA 2HHQA 1S6PA 3HXMA 3LWLA 3THYA 3VQBA 3OS0A 1LWCA 2FF6A 4JI3K 2BTFA 4MQ3A 5AQUA 4CBXA 4BRFA 4FJNA 3LZIA 3K5MA 1KFSA 3WNEA 1L3VA 4FJXA 3CJ7A 4DV2K 3KWGA 2HHVA 4Y1CA 3QEVA 2D0AA 4DR7K 2IVPA 1UA1A 2HMIA 4R79A 3VTIA 1FKOA 1S5JA 2QWNA 3GE1A 2GV9A 4GKKK 4LF7K 3C95A 3J7ZO 1KFDA 1QQCA 1X9JA 3AA2A 2YJEA 5IT9O 3OW2M 3THYB 4GW6A
chains in the Genus database with same CATH topology
3K9JA 3WQTA 5CR4A 2P9PA 1XQSC 3DWLA 3MWTA 2ZJRL 4JK7A 3CCVN 5DM6L 2FSNA 2RE2A 2E2NA 4MLEA 1O13A 1KXPA 4H5NA 3C65A 1HUXA 2ASOA 4WYBA 4H0OA 4BRKA 4BVPA 5I9EB 4BRMA 1HKBA 4IDHA 2NNWA 2V52B 5AQRA 1LOTB 5M1KA 4H0PA 4XH4A 2GWJA 4CZLA 4QS9A 4C23A 5GAHP 3CCJN 1RGIA 4FWLA 1YVNA 1VQ5N 3H6EA 4B1VA 4CZHA 3GBTA 1HLUA 4YOYA 1JCFA 1YXQA 1ESVA 4YORA 3OHRA 1ZC6A 2HF4A 2WBNA 1TUYA 1NLVA 3E9PA 4JHDA 4FWMA 4NB4A 2I7PA 4U67L 5AQYA 3CQXA 4CZMA 2QI2A 1E4GT 2BH1A 1NWKA 2FXUA 3D7EO 3CJAA 3OBWA 2E8AA 3VTHA 2KHOA 1EQYA 3CPEA 4BR0A 5GIPA 3EKSA 1NGJA 5FPDA 1M1KO 5TKYA 5BR9A 5M1NA 3C0BA 2WFBA 4RTFD 2P9KA 3CC4N 2HBJA 4FWSA 4DHYA 5M1OA 4BGBA 5JLHA 1QZ6A 2NRVA 2P9PB 1QVFM 4WFNL 1BUPA 1KAXA 5AQTA 1JCEA 1S3XA 5CE3A 4H0XB 3SBGA 2IIRA 3L6QA 4WF9L 4FSVA 2F9TA 1S22A 1R59O 5ELZA 4CBWA 1MWMA 3M1FA 2VGNA 4BRIA 4CZJA 2V51B 3ATVA 5HOOA 2F7TA 3CIPA 3E9LA 4BG9A 1Q18A 1D4XA 2CGLA 5LJWA 3HRGA 2QWRA 5F0XA 5JLFA 3SAGA 1YJNN 4PKIA 1Y64A 3OA9A 1XC3A 4JHDB 2D1KA 1K9MO 2RHKA 2Q36A 3O1WA 3H45C 1VQNN 4Z94A 2QWOA 2E88A 3B8AX 3H1QA 4FWQA 1Z6RA 1BA1A 2EWSA 4OPHA 5AQKA 2P9KB 4KH5A 3FFKB 2J4RA 3CCSN 4JKCA 5AQVA 2ASMA 4BRLA 3PIPL 3FR0A 4BRAA 3CI5A 2WUSA 4JAXA 4O8UA 4BR9A 4BRDA 5HL7L 5KQ8A 3AAQA 5AQPA 3CC7N 1ZXOA 1NMDA 2CH5A 3CHWA 4B1ZA 3BF1A 3RVCA 4IJAA 1OVYA 3MMVA 4K43A 4YOXA 1YI2N 3AY9A 1T44A 2AA4A 2Q2RA 2VWBA 5BRHA 2GWKA 3CMAN 4GV9A 5AQSA 4BREA 3L4QA 5F1XA 4AF1A 3GL1A 3MX2A 5AQWA 1IG8A 3A5LC 1SZ2A 2D4WA 2NRWA 1HPMA 4FWOA 4HTLA 4K25A 4PKHA 3VEOA 1KAYA 1C0GA 1U2VA 5EOYA 3UB5A 2IVOA 4GY2B 3MK6A 3O9UA 3F2KA 3T69A 4YDUA 3EN9A 5DM7L 1N8RO 1DEJA 3SLCA 4BRPA 1GLEG 1X3MA 1ATRA 1GLJO 2PAVA 2Q31A 2YX6A 3KZBA 3U8XA 4EIAA 1GLFO 3D2EA 4C1NK 3O08A 1LCUA 3CMEN 4K42A 4C1NI 1NGCA 4H0TB 4WQ4A 3O9RA 2A3ZA 2QTDA 3O8MA 3UKRA 2NZTA 4XEIA 1QQMA 3CQYA 1BOTO 2KLAA 3E9OA 3O4WA 3HTVA 3VGKA 1NGEA 3QBWA 3Q7CA 3CCQN 2A5XA 3Q7BA 3MN5A 4JN4A 3E1YA 4YOTA 3R9PA 3VF6A 1YF5L 2P9LA 4A62A 3WEEA 4BROA 3F5TA 4JKFA 2YCHA 5AQHA 3CERA 3ID6A 4H03B 3P4IA 5BRDA 4BRNA 1M90O 1VQ7N 2F9WA 2NLXA 1NGDA 1VQLN 4AM7A 2D0PA 4BR4A 1MA9B 1GLAG 4ISEA 3R1XA 4JKAA 5JICA 1U2VB 3JXUA 4BY9C 4GVEA 3HOSA 5AQXA 5B8HA 5E26A 4JKGA 4A61A 1ILYA 2HBLA 3TTDA 1KQSM 3ZYYX 3O9TA 3D2EB 2NRXA 3GDQA 1NGIA 3L0QA 4BG8A 4DB3A 4IFEA 3OBYA 5AZIA 2QWQA 3FZHA 3CCLN 2YHXA 1VAZA 3VENA 1S72N 1BDGA 3WQUA 3O9QA 3KWIA 3UKRB 4BRCA 3LDLA 4K41A 1YJ9N 2P9SA 3C6AA 3C6HA 4OPAA 1XUPO 4JKHA 3MDQA 2QXLA 3BF3A 1P90A 3VERA 3D6RA 3EE8A 4IXCA 3S41A 3QFPA 4WCEL 2P9LB 1YHQN 3WEEB 2FLOA 3CCMN 3TTFA 4BR5A 1Q81O 3MCPA 3CJBA 4BRGA 3KK7A 3O6WA 4FWPA 4IZ9A 1Z05A 3QICA 4IWVA 3VOVA 1Q7YO 2E1ZA 1VQMN 4PHTX 5AQJA 2GEMA 2VYPA 4GNIA 2GX9A 4MLHA 5BN9A 5CHIA 5KPZA 5KPTA 3VF2A 1T6CA 2V7YA 4JKGB 2ZGZA 1DT9A 3VGLA 3VMFB 2YHYA 4B1YB 5EX5A 2NRZA 2Q0RA 4JKDA 1TUUA 3IFRA 4CZFA 5AZIB 4CD3A 2Q97A 2A42A 3H3OB 1BO5O 3A0IX 4BC4A 4RWTA 3CPWM 3VETA 2P9SB 3TSUA 1HKGA 1K73O 3NVMA 5GAGP 3VPZA 3VEWA 3SAFA 4G9ZA 3N4PA 4Y0WA 1NGGA 4FL9A 1VQ6N 1NGHA 1SS6A 3AGRA 4XH5A 5C2DA 5AFUA 4BGAA 3QB0A 2Q0UA 3MN9A 3O5BA 2E2QA 3SJHA 3MWPA 3G4SN 5FPNA 4A5AA 3SBTA 3L4IA 3ZX0A 1P8ZA 3IUCA 4E1JA 4MDAA 2DPNA 5KQDA 4BQZA 3P38A 3UKUA 3CCEN 4YDUC 4HWIA 3VEVA 3SK3A 4WFAL 3KHYA 3FZFA 4IO8A 4IO9L 4CZIA 4BR2A 4FPBA 1K8KA 4CI6A 4M7YA 3C7NA 3ZX2A 1VQ8N 4BC2A 4CZEA 4JEPA 3O9SA 3JS6A 5FPMA 3CCUN 2JWKA 2VCPA 5GADP 4WQ4C 2GTDA 3WT0A 4ILJA 4MDBA 4WQ5A 3SMSA 4I6MA 3QDKA 3H46O 3CCRN 5M1FA 4OO1J 1NGBA 3U9DA 3BP8A 3ZEUA 4EFHA 2A41A 3LM9A 5E84A 2E2OA 1MDUB 1GLLO 3LM2A 5AQZA 1GLCG 3ZX3A 2CH6A 3R3LA 3EL2A 1KD1O 3DJCA 4FWNA 4AM6A 3ENBA 3AAPA 1JJ2M 2GUPA 3WXLA 1ATSA 5C12A 4JKEA 3P39A 3I8BA 3IKMA 3QMLA 2OTLN 3HBTA 4FVUA 5JVHL 4DCHA 1WOQA 3BEXA 3EO3A 3WUHA 5M1QA 3G6EN 1VQPN 2IVNA 2NRHA 1BWFO 4IEIA 2ZF5O 5C10A 1WUAA 3D2FA 3UKUB 1SQKA 1YAGA 2I7NA 3ENHA 2CGJA 5AZJA 1ATNA 2QM1A 5C2FA 4BC5A 1QQOA 2E2PA 5TKWA 5AQGA 2PBDA 1K8KB 4FWKA 3MN6A 5AQLA 5BPNA 2QA4N 3HZ6A 2ASPA 5AQQA 3EKUA 3GG4A 2H3GX 3FLCO 4NLCA 3CF5L 1NM1A 4I6MB 4BRQA 3H3NO 1YUWA 3A5NC 3W3DA 3FZLA 3ZEUB 1EO1A 4BR7A 4CZKA 4CJ7A 4YOVA 4EHTA 4F9OA 3CXCM 4ILHA 1X3NA 3T7ZA 1CZAN 1VQ9N 1HKCA 2GELA 4A2AA 3U9ZA 1RFQA 4B1XB 3LDQA 4FOIA 4YOUA 4H5TA 4J8FA 4FO0A 3VESA 3AARA 3K9KA 4MO5A 4EHUA 2YJFA 3CJ1A 2YHWA 5C15A 3RSEA 3W0LA 1YIJN 1Q86O 4BQLA 3D2FB 5EXWA 5AQFA 2PFUA 4NO7A 1JCGA 4FPAA 5AZJB 2P9NA 5C0YA 4DKWA 2QWPA 5AFUH 3WXMB 5LY3A 1KC8O 2P9UA 3DAWA 4ILGB 4PKGA 3LL3A 3PLAA 3DXMA 4MO4A 5KPRA 1H1VA 3HSCA 3TU5A 3VF4A 3HM8A 1GLDG 4B1UB 5AQMA 4H0VB 4IOAL 1BA0A 3FE1A 1Q82O 2CGKA 3ULEA 4JNEA 4O8KA 2WC9A 3O1BA 4JK9A 4EAHD 3WXJA 3G71N 5F2RA 4GV3A 2OANA 2FSJA 3R8EA 2UYTA 4DQ8A 1YJWN 1HJOA 3SMPA 4CD1A 2KKZA 5GAEP 2ITMA 3CD6N 5EY4A 3SAHA 1W2BM 5BRFA 2JWLA 4CZGA 3LDOA 1RDWX 3ENOA 2E20A 1NGAA 4ISFA 1TYQA 4QS8A 3RSEB 3VGMA 4A2BA 3ATUA 4JKBA 5ADXA 1E4FT 3VEZA 2P9NB 3H1VX 3GOIA 4IEEA 4IJNA 3TPQA 1QZ5A 3F9MA 4FWRA 5AR0A 5BPLA 2ZJQL 1GLBG 4H5RA 2P9UB 2FSKA 1W97L 4GV6A 2P9IA 4XH1A 3M6GA 3DXKA 3EE9A 2QWMA 3DXMB 3EZWA 5H1SQ 3NMUA 3TTCA 4H0YB 4KBOA 4JD2A 4WQ5C 2FF3B 2W40A 4A5BA 4B9QA 2NRRA 5MLCQ 3P31A 3G25A 2QW9A 3FZMA 3ULEB 1SAZA 3A5OC 4KH6A 4A57A 1VQKN 1HX1A 3I33A 5JMVA 3I56N 3CJ9A 4WFBL 4PL7A 4ISGA 1DGKN 5EVZA 3MN7A 5M1PA 5FPEA 4B1WB 3WXKA 2A40A 3FGUA 3LDPA 3KVGA 4KH4A 1KAZA 2QWLA 1TYQB 1BG3A 4O5FA 4NLBA 2Q1NA 1YITN 3MCAB 3WXIA 3HOTA 3U4LA 1G99A 3IMXA 1K8AO 1V4SA 3LDNA 3NVKA 5GIOA 3HI0A 2HOEA 4JK8A 3TSPA 5LJVA 4U7BA 2HBMA 2ZGYA 3TSQA 1V4TA 3AGKA 4FOEA 2P9IB 1J6ZA 3DXKB 5GINA 5BREA 4YOWA 5AQOA 4L3QA 1RDUA 4IOXA 1QQNA 2AP1A 4JD2B 2D0OA 2V7ZA 5BPMA 2ZWHA 2YI1A 3ZETA 3I55N 3A5MC 2W41A 3M5RA 4M7XA 3CC2N 4QS7A 3CETA 2FF6A 1VQON 2BTFA 4CBUA 3PIOL 5AQUA 4UY8O 4BRHA 4CBXA 4BRFA 1T6DA 3C7NB 3ID8A 3R6MA 3FZKA 3DLLL 4IOCL 4M63C 2ZJPL 1DKGD 1NJIO 4PL8A 3CJ7A 3KWGA 1QVGM 1NBWA 2HBKA 2IVPA 3QFUA 4RCHA 3J8AA 2HSTA 3BUZB 2A6AA 1MWKA 2BUPA 3O80A 1IJJA 4H5WA 3VEXA 5AQIA 2QEXN 1BU6O 5AQNA 3VEYA 3QBXA 1OKJA 3IDHA 5BN8A 3MX5A 2E1YA 3UE5A 4BC3A 4R79A 3VTIA 3CJCA 3E66A 4A59A 3A8YA 4H5VA 2NRTA 1C0FA 1NGFA 2HF3A 4BVOA 4LC9B 2QWNA 1ZBSA 2HMPA 3GE1A 3N4QA 3M3ZA 5ADXH 3ZETB 3J7ZO 5JVGL 1QHAA 1X9JA 2OTJN 1U6ZA 2YJEA 3OW2M 1VQ4N 1T3VA 2VGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WQT A;  2P9P A;  1XQS C;  3DWL A;  2FSN A;  2E2N A;  4MLE A;  1KXP A;  4H5N A;  1HUX A;  2ASO A;  4WYB A;  4H0O A;  4BRK A;  4BVP A;  5I9E B;  4BRM A;  1HKB A;  2V52 B;  5AQR A;  1LOT B;  4H0P A;  4XH4 A;  2GWJ A;  4CZL A;  4QS9 A;  4C23 A;  1RGI A;  4FWL A;  1YVN A;  3H6E A;  4B1V A;  4CZH A;  3GBT A;  1HLU A;  1JCF A;  1YXQ A;  1ESV A;  3OHR A;  1ZC6 A;  2HF4 A;  1TUY A;  4JHD A;  4FWM A;  4NB4 A;  2I7P A;  5AQY A;  3CQX A;  4CZM A;  1E4G T;  1NWK A;  2FXU A;  3D7E O;  3CJA A;  4BR0 A;  2E8A A;  2KHO A;  1EQY A;  3EKS A;  1NGJ A;  5FPD A;  5TKY A;  5BR9 A;  3C0B A;  4RTF D;  2P9K A;  4FWS A;  4DHY A;  4BGB A;  5JLH A;  1QZ6 A;  2P9P B;  1BUP A;  1KAX A;  5AQT A;  1JCE A;  1S3X A;  5CE3 A;  4H0X B;  2IIR A;  3L6Q A;  4FSV A;  2F9T A;  1S22 A;  1R59 O;  5ELZ A;  4CBW A;  1MWM A;  3M1F A;  4BRI A;  4CZJ A;  2V51 B;  3ATV A;  3CIP A;  4BG9 A;  1Q18 A;  1D4X A;  2CGL A;  5LJW A;  5F0X A;  2QWR A;  5JLF A;  4PKI A;  1Y64 A;  4JHD B;  1XC3 A;  2D1K A;  2Q36 A;  3O1W A;  3H45 C;  4Z94 A;  2QWO A;  2E88 A;  3B8A X;  3H1Q A;  4FWQ A;  1Z6R A;  1BA1 A;  2EWS A;  5AQK A;  2P9K B;  3FFK B;  2J4R A;  5AQV A;  2ASM A;  4BRL A;  3FR0 A;  4BRA A;  3CI5 A;  2WUS A;  4JAX A;  4BR9 A;  4BRD A;  5KQ8 A;  3AAQ A;  5AQP A;  1ZXO A;  1NMD A;  2CH5 A;  3CHW A;  4B1Z A;  3BF1 A;  4IJA A;  3MMV A;  4K43 A;  3AY9 A;  1T44 A;  2AA4 A;  2Q2R A;  2VWB A;  5BRH A;  2GWK A;  5AQS A;  4BRE A;  5F1X A;  3GL1 A;  5AQW A;  1IG8 A;  1SZ2 A;  2D4W A;  3A5L C;  1HPM A;  4FWO A;  4HTL A;  4K25 A;  4PKH A;  3VEO A;  1KAY A;  1C0G A;  1U2V A;  5EOY A;  3UB5 A;  2IVO A;  4GY2 B;  3MK6 A;  4YDU A;  3EN9 A;  1DEJ A;  3SLC A;  4BRP A;  1GLE G;  1X3M A;  1ATR A;  1GLJ O;  2PAV A;  2Q31 A;  3KZB A;  3U8X A;  4EIA A;  1GLF O;  3D2E A;  3O08 A;  1LCU A;  4K42 A;  1NGC A;  4H0T B;  4WQ4 A;  2A3Z A;  3O8M A;  3UKR A;  2NZT A;  4XEI A;  1QQM A;  3CQY A;  1BOT O;  3O4W A;  3HTV A;  3VGK A;  1NGE A;  3QBW A;  2A5X A;  3MN5 A;  4JN4 A;  4A62 A;  3R9P A;  3VF6 A;  2P9L A;  3WEE A;  4BRO A;  2YCH A;  5AQH A;  3CER A;  4H03 B;  3P4I A;  5BRD A;  4BRN A;  2F9W A;  2NLX A;  1NGD A;  4AM7 A;  2D0P A;  4BR4 A;  1MA9 B;  1GLA G;  4ISE A;  5JIC A;  1U2V B;  3JXU A;  5AQX A;  5B8H A;  5E26 A;  4A61 A;  3D2E B;  3GDQ A;  1NGI A;  3L0Q A;  4BG8 A;  4DB3 A;  5AZI A;  2QWQ A;  3FZH A;  2YHX A;  3VEN A;  1BDG A;  3WQU A;  3UKR B;  4BRC A;  3LDL A;  4K41 A;  2P9S A;  1XUP O;  3MDQ A;  2QXL A;  3BF3 A;  3VER A;  4IXC A;  3S41 A;  3QFP A;  2P9L B;  3WEE B;  2FLO A;  4BR5 A;  3MCP A;  3CJB A;  4BRG A;  3O6W A;  4FWP A;  4IZ9 A;  1Z05 A;  3QIC A;  4IWV A;  3VOV A;  2E1Z A;  5AQJ A;  2GEM A;  2VYP A;  4GNI A;  4MLH A;  5BN9 A;  5KPZ A;  5KPT A;  3VF2 A;  1T6C A;  2V7Y A;  2ZGZ A;  3VGL A;  2YHY A;  4B1Y B;  5EX5 A;  2Q0R A;  1TUU A;  3IFR A;  4CZF A;  5AZI B;  4CD3 A;  2Q97 A;  2A42 A;  3H3O B;  1BO5 O;  3A0I X;  4BC4 A;  4RWT A;  3VET A;  2P9S B;  1HKG A;  3VPZ A;  3VEW A;  4Y0W A;  1NGG A;  4FL9 A;  1NGH A;  4XH5 A;  5AFU A;  4BGA A;  3QB0 A;  2Q0U A;  3MN9 A;  3O5B A;  2E2Q A;  3SJH A;  5FPN A;  3L4I A;  3ZX0 A;  1P8Z A;  3IUC A;  4E1J A;  5KQD A;  2DPN A;  4BQZ A;  3UKU A;  4YDU C;  4HWI A;  3VEV A;  3SK3 A;  3KHY A;  3FZF A;  4IO8 A;  4CZI A;  4BR2 A;  4FPB A;  1K8K A;  4CI6 A;  4M7Y A;  3C7N A;  3ZX2 A;  4BC2 A;  4CZE A;  3JS6 A;  5FPM A;  2VCP A;  4WQ4 C;  2GTD A;  3WT0 A;  4WQ5 A;  3SMS A;  4I6M A;  3QDK A;  3H46 O;  1NGB A;  3U9D A;  3BP8 A;  3ZEU A;  4EFH A;  2A41 A;  3LM9 A;  5E84 A;  2E2O A;  1MDU B;  1GLL O;  3LM2 A;  5AQZ A;  1GLC G;  3ZX3 A;  2CH6 A;  3EL2 A;  3DJC A;  4FWN A;  4AM6 A;  3AAP A;  2GUP A;  3WXL A;  1ATS A;  3QML A;  3I8B A;  3HBT A;  4DCH A;  1WOQ A;  3BEX A;  3EO3 A;  3WUH A;  2IVN A;  2NRH A;  1BWF O;  2ZF5 O;  1WUA A;  3D2F A;  3UKU B;  3ENH A;  1SQK A;  1YAG A;  2I7N A;  2CGJ A;  5AZJ A;  1ATN A;  2QM1 A;  4BC5 A;  1QQO A;  2E2P A;  5AQG A;  2PBD A;  1K8K B;  4FWK A;  3MN6 A;  5AQL A;  5BPN A;  3HZ6 A;  2ASP A;  5AQQ A;  3EKU A;  3GG4 A;  2H3G X;  3FLC O;  1NM1 A;  4I6M B;  4BRQ A;  3H3N O;  1YUW A;  3A5N C;  3W3D A;  3FZL A;  3ZEU B;  4BR7 A;  4CZK A;  4CJ7 A;  4EHT A;  4F9O A;  1X3N A;  1CZA N;  1HKC A;  2GEL A;  4A2A A;  3U9Z A;  1RFQ A;  4B1X B;  3LDQ A;  4FOI A;  4H5T A;  4J8F A;  4FO0 A;  3VES A;  3AAR A;  4MO5 A;  4EHU A;  2YJF A;  3CJ1 A;  2YHW A;  3RSE A;  3W0L A;  4BQL A;  3D2F B;  5EXW A;  5AQF A;  4NO7 A;  1JCG A;  4FPA A;  5AZJ B;  2P9N A;  2QWP A;  5AFU H;  5LY3 A;  2P9U A;  3DAW A;  4PKG A;  3LL3 A;  3DXM A;  4MO4 A;  5KPR A;  1H1V A;  3HSC A;  3TU5 A;  3VF4 A;  3HM8 A;  1GLD G;  4B1U B;  5AQM A;  4H0V B;  1BA0 A;  3FE1 A;  2CGK A;  3ULE A;  4JNE A;  4O8K A;  4EAH D;  3O1B A;  3WXJ A;  5F2R A;  2OAN A;  2FSJ A;  3R8E A;  2UYT A;  4DQ8 A;  1HJO A;  3SMP A;  4CD1 A;  2ITM A;  5EY4 A;  5BRF A;  4CZG A;  3LDO A;  1RDW X;  3ENO A;  2E20 A;  1NGA A;  4ISF A;  1TYQ A;  4QS8 A;  3RSE B;  3VGM A;  4A2B A;  3ATU A;  5ADX A;  1E4F T;  3VEZ A;  2P9N B;  3H1V X;  3GOI A;  4IJN A;  3TPQ A;  1QZ5 A;  3F9M A;  4FWR A;  5AR0 A;  5BPL A;  1GLB G;  4H5R A;  2P9U B;  2FSK A;  2P9I A;  4XH1 A;  3M6G A;  3DXK A;  2QWM A;  3DXM B;  3EZW A;  4H0Y B;  4KBO A;  4JD2 A;  4WQ5 C;  2FF3 B;  2W40 A;  4B9Q A;  3G25 A;  2QW9 A;  3FZM A;  3ULE B;  1SAZ A;  3A5O C;  1HX1 A;  3I33 A;  5JMV A;  3CJ9 A;  4PL7 A;  4ISG A;  1DGK N;  5EVZ A;  3MN7 A;  5FPE A;  4B1W B;  3WXK A;  2A40 A;  3FGU A;  3LDP A;  3KVG A;  1KAZ A;  2QWL A;  1TYQ B;  1BG3 A;  4O5F A;  2Q1N A;  3WXI A;  3U4L A;  1G99 A;  3IMX A;  1V4S A;  3LDN A;  3HI0 A;  2HOE A;  5LJV A;  2ZGY A;  1V4T A;  4FOE A;  2P9I B;  1J6Z A;  3DXK B;  5BRE A;  5AQO A;  4L3Q A;  1QQN A;  2AP1 A;  4JD2 B;  2D0O A;  2V7Z A;  5BPM A;  2ZWH A;  2YI1 A;  3ZET A;  3A5M C;  2W41 A;  4M7X A;  4QS7 A;  3CET A;  2FF6 A;  2BTF A;  4CBU A;  5AQU A;  4BRH A;  4CBX A;  4BRF A;  1T6D A;  3C7N B;  3ID8 A;  3R6M A;  3FZK A;  4M63 C;  1DKG D;  4PL8 A;  3CJ7 A;  1NBW A;  2IVP A;  3QFU A;  4RCH A;  3J8A A;  3BUZ B;  2A6A A;  1MWK A;  2BUP A;  3O80 A;  1IJJ A;  4H5W A;  3VEX A;  5AQI A;  1BU6 O;  5AQN A;  3VEY A;  3QBX A;  1OKJ A;  3IDH A;  5BN8 A;  2E1Y A;  3UE5 A;  4BC3 A;  3CJC A;  3A8Y A;  4H5V A;  4BVO A;  1C0F A;  1NGF A;  2HF3 A;  4LC9 B;  2QWN A;  1ZBS A;  2HMP A;  3GE1 A;  3M3Z A;  5ADX H;  3ZET B;  1QHA A;  1X9J A;  1U6Z A;  2YJE A;  1NLV A; 
#chains in the Genus database with same CATH topology
 3K9J A;  2UUB K;  3L8B A;  4OGC A;  1XQS C;  3CCV N;  3OYD A;  2X78 A;  3T1H K;  3P1G A;  3ZSQ A;  1N36 K;  1KXP A;  4BRK A;  1JLC A;  2KQ2 A;  4H0O A;  4BVP A;  4DU3 A;  1UWB A;  1LOT B;  3OYB A;  5GAH P;  1RGI A;  5EU7 A;  4Z4E A;  2HHX A;  4B1V A;  4CZH A;  1HLU A;  4CW7 B;  4FYD A;  4FWM A;  4CF1 A;  4U67 L;  5AQY A;  3NF8 A;  2QI2 A;  1E4G T;  3OBW A;  1EQY A;  1JLE A;  5TKY A;  1HNI A;  2HHT A;  3V1O A;  1WSF A;  1LW0 A;  4BGB A;  4M3T A;  1QZ6 A;  3LAN A;  4C8O A;  2VG5 A;  3KLH A;  3K57 A;  4CEE A;  1S3X A;  5CE3 A;  4H0X B;  4DTN A;  3MEG A;  3SBG A;  5C42 A;  4WF9 L;  1T05 A;  4KRE A;  1RNH A;  2Z1G A;  2V51 B;  3ATV A;  3BY5 A;  3MEC A;  5FLX O;  2VG7 A;  3T3F A;  4JS5 A;  3E9L A;  4B9S A;  2CGL A;  4JRQ A;  1XC3 A;  3T19 A;  2RHK A;  4DU1 A;  3SQ1 A;  1KVB A;  2QWO A;  3H1Q A;  3CQ8 A;  4AHR A;  5D3G A;  2YV0 X;  4KHN A;  1YHQ N;  3FR0 A;  4RW7 A;  4BR9 A;  4CGF A;  2W42 A;  2A1R A;  4XIU A;  1D5A A;  3O4Q A;  4Q5V A;  2CH5 A;  1RT7 A;  4CFB A;  3MMV A;  1YI2 N;  1NJY A;  4DMN A;  4F8R A;  4CF0 A;  3CMA N;  1XNR K;  2BE2 A;  5AQS A;  1CXQ A;  4BRE A;  3L4Q A;  1I94 K;  5F1X A;  1C1C A;  4CER A;  1Z25 A;  3KTQ A;  3OYL A;  3VEO A;  4DQS A;  5EOY A;  3AVC A;  4JYA K;  3L2U A;  4I2Q A;  3O9U A;  4CES A;  4YDU A;  4V19 S;  5DM7 L;  3PX0 A;  4DV6 K;  4KHY A;  2PAV A;  1GLJ O;  2YX6 A;  4EIA A;  3RMD A;  5IWA K;  3K2P A;  4DQQ A;  4NCA A;  3NFA A;  3CME N;  4C1N I;  1NGC A;  2D0C A;  4H0T B;  4PA1 A;  3O9R A;  4FLT A;  3NGY A;  1BOT O;  1EET A;  3E9O A;  3Q7B A;  3MN5 A;  3VQ9 A;  3E1Y A;  3R9P A;  3K58 A;  2DY4 A;  3WEE A;  4BRO A;  5KTQ A;  1J53 A;  3TR8 A;  3CER A;  4H03 B;  2XY5 A;  5BRD A;  3OYH A;  5J2Q A;  2NLX A;  4NXM K;  4BR4 A;  4X62 K;  2WON A;  5AQX A;  4A61 A;  4CEC A;  3D0P A;  2HBL A;  1KQS M;  3KKR A;  1L5U A;  1HRH A;  1ASU A;  3HL8 A;  4DB3 A;  4IFE A;  3OBY A;  4DV4 K;  2QWQ A;  3V9W A;  3CCL N;  5KI6 A;  1VAZ A;  1BDG A;  3BZK A;  4BRC A;  2P9S A;  3C6A A;  4JKH A;  3MDQ A;  4CGH A;  3VER A;  1OVQ A;  1W9H A;  1A5X A;  4TSX A;  3QFP A;  4WCE L;  1B9D A;  3WEE B;  2QK9 A;  3CJB A;  2Z1I A;  3KK7 A;  1JL1 A;  4CJS A;  1TKZ A;  4PHT X;  5AQJ A;  5BN9 A;  5CHI A;  2EHG A;  2DTU A;  4YY3 K;  4CEO A;  1S1W A;  2IC3 A;  1SV5 A;  3VMF B;  4NYN A;  4B1Y B;  3B6O A;  1IO2 A;  1TUU A;  3IFR A;  4J2A A;  3AVI A;  5FRM A;  3L2W A;  3H3O B;  2P9S B;  4F2R A;  3NH0 A;  3VEW A;  3N4P A;  4Y0W A;  1NGG A;  4AHV A;  4JI0 K;  1N34 K;  2QKB A;  4DV5 K;  2XY8 A;  5C2D A;  3S3O A;  1QSY A;  1LW2 A;  2Q0U A;  3MN9 A;  4BE0 A;  2E2Q A;  3SJH A;  3HVR A;  3SBT A;  2HVH A;  4E1J A;  3THW A;  3VEV A;  3SK3 A;  3ZSO A;  4WFA L;  3KHY A;  3T1A A;  4IO8 A;  1WSH A;  4BR2 A;  4FPB A;  4M7Y A;  3ZX2 A;  1VQ8 N;  1RDA A;  3NH1 A;  3CCU N;  1O1W A;  4AHU A;  2AJQ A;  1N32 K;  3OYA A;  1EWR A;  1D9F A;  2B4J A;  2GBZ A;  1NGB A;  1JXE A;  5KGW A;  3BP8 A;  4EFH A;  4QOZ B;  1JLA A;  3AVH A;  1KD1 O;  4FWN A;  3AAP A;  4OKJ A;  2GUP A;  3IKM A;  4FVU A;  1RTI A;  3HBT A;  4EZ6 A;  4DCH A;  3BEX A;  3EO3 A;  1VQP N;  2P5G A;  3CFP A;  3THW B;  1SQK A;  1YAG A;  5AZJ A;  5J2M A;  5HRR A;  1QQO A;  5AQL A;  3NF9 A;  3KLG A;  4PUO A;  2ASP A;  1J5O A;  2UXB K;  5FRO A;  5J1E A;  2H3G X;  3FLC O;  1RIL A;  1ZYQ A;  3H3N O;  2OCE A;  3W3D A;  4CJ5 A;  1EO1 A;  4KKO A;  1I39 A;  4CZK A;  4EHT A;  3UIQ A;  1SL2 A;  3T7Z A;  2BDP A;  4CIF A;  1TVR A;  3LDQ A;  4FO0 A;  4EHU A;  2YJF A;  3W0L A;  3K59 A;  1Q9X A;  2OYQ A;  5EXW A;  3QO9 A;  5AZJ B;  3F9K A;  3WXM B;  4JLH A;  3PLA A;  3DXM A;  3M8S A;  5HBM A;  3HSC A;  3VF4 A;  4RW9 A;  4ID1 A;  1GLD G;  2VWK A;  5BR8 K;  1SKR A;  1J9A A;  3V9U A;  4HUE A;  3K5N A;  3BDP A;  4JNE A;  4O8K A;  4GV3 A;  3WXJ A;  3OY9 A;  5F2R A;  4F3T A;  4CJQ A;  2UYT A;  4DQ8 A;  3PX6 A;  4BE2 A;  3IG1 A;  4CD1 A;  3OYK A;  3J7Y P;  1U45 A;  1WBB A;  3SAH A;  1W2B M;  3OYC A;  4LY7 A;  1ZBL A;  3AVA A;  3PO5 A;  4E89 A;  3V9Z A;  3ATU A;  4W5Q A;  3H1V X;  3GOI A;  3SQ0 A;  4DV7 K;  1QZ5 A;  1GLB G;  1VSL A;  4E7I A;  2FSK A;  3P5J A;  3DXK A;  3DXM B;  2E6M A;  3NMU A;  4CVN E;  2NRR A;  3TAN A;  2QW9 A;  3FZM A;  1SAZ A;  1TV6 A;  4CED A;  3TWH A;  3NH2 A;  1VQK N;  1HX1 A;  1D8Y A;  4WFB L;  4PL7 A;  4ISG A;  3AO5 A;  1NK6 A;  3HK2 A;  3EZ5 A;  4B9N A;  4W5O A;  3FGU A;  4DTR A;  4KH4 A;  1KAZ A;  4CE9 A;  3ULD A;  4W5R A;  1BG3 A;  4NLB A;  3MCA B;  3HPG A;  3U4L A;  1G99 A;  3IMX A;  1V4S A;  4JK8 A;  2HOE A;  4HCB A;  5LJV A;  4U7B A;  2Y1J A;  3TSQ A;  5KRS A;  1J6Z A;  3DXK B;  3I0R A;  5BRE A;  4IOX A;  5BPM A;  2ZWH A;  3I55 N;  4FJ7 A;  2KZZ A;  4BWM A;  4DTS A;  3M5R A;  4M7X A;  4HUF A;  4CBU A;  4UY8 O;  4BRH A;  3RTV A;  1T6D A;  3C7N B;  3R6M A;  3FZK A;  3DLL L;  5HP1 A;  2ZJP L;  3V1Q A;  1TKX A;  4CJV A;  4FJH A;  2HBK A;  3QFU A;  1ASV A;  4FVM A;  2FBX A;  1JLQ A;  3VEX A;  1VK0 A;  2X6N A;  4H5W A;  5K14 A;  5AQN A;  1IV0 A;  1XNQ K;  1ZBU A;  5BN8 A;  3M8R A;  2E1Y A;  3CJC A;  4H5V A;  2Q3S A;  1NGF A;  2HF3 A;  3M3Z A;  3VA3 A;  4Z4F A;  3U3Y A;  2HHU A;  2VGM A;  4CGG A;  2G8U A;  3WQT A;  4DS4 A;  2P9P A;  3PY8 A;  3LP3 A;  1WNS A;  5DM6 L;  2RE2 A;  3QLH A;  3C65 A;  2ASO A;  4WYB A;  4Z4H A;  4BRM A;  3KK3 A;  4IDH A;  2NNW A;  2JLE A;  5AQR A;  5M1K A;  4H0P A;  4XH4 A;  3DRR A;  4CHQ A;  4FWL A;  4KB0 A;  4Z4G A;  1VQ5 N;  3H6E A;  4B9M A;  1T8E A;  3GBT A;  4PY5 A;  4ZHR A;  1ZC6 A;  4B3O A;  3KKS A;  4DTP A;  3AO4 A;  4Y1D A;  4JHD A;  1N33 K;  3VTH A;  3EKS A;  1KCF A;  4H4O A;  5FPD A;  5BR9 A;  4M45 A;  4RTF D;  2WFB A;  4DV0 K;  1XHZ A;  4FWS A;  5M1O A;  3CM6 A;  2P9P B;  4WFN L;  3V6D A;  1NKB A;  1JCE A;  4CEQ A;  4FK4 A;  2IGI A;  3C6U A;  3M1F A;  1IBL K;  4BRI A;  1HJR A;  4CZJ A;  3CIP A;  3ZSZ A;  3TAR A;  1IBK K;  3VA0 A;  2KZM A;  4JHD B;  1K9M O;  2D1K A;  2X6S A;  1VQN N;  4KFB A;  4FJ9 A;  1BHL A;  3FFK B;  5DMR A;  4E0D A;  4O8U A;  5KQ8 A;  3IRX A;  3CC7 N;  4J2B A;  4KHP K;  3OS1 A;  4IJA A;  5LMN K;  1BGX T;  1OVY A;  1EKE A;  4B9U A;  2QKK A;  4KAZ A;  3L2Q A;  3ZSY A;  4CF9 A;  3U3G A;  4AF1 A;  1IG8 A;  3A5L C;  4IFV A;  2NRW A;  4FWO A;  1BI4 A;  4PKH A;  1KAY A;  1C0G A;  3UB5 A;  5CY4 A;  4GY2 B;  3MK6 A;  1QSS A;  3DLB A;  4I9L A;  3T69 A;  1N8R O;  1X3M A;  3AVG A;  1DTQ A;  1GLF O;  1IBM K;  3MXI A;  4B9L A;  1S1V A;  4HUG A;  4K42 A;  3CFO A;  1UOC A;  2I5J A;  2QTD A;  4XEI A;  2KLA A;  3HTV A;  3VGK A;  1NGE A;  3QBW A;  4CJT A;  3VQ4 A;  2A5X A;  4JI7 K;  4A62 A;  4YOT A;  3VF6 A;  4Z4C A;  1YF5 L;  1JLF A;  4IG0 A;  4JI1 K;  3P4I A;  1M90 O;  5KRT A;  2F9W A;  1VQL N;  1BI4 B;  2D0P A;  1MA9 B;  1GLA G;  4ISE A;  3OVN A;  1FK9 A;  4KTW A;  4CFD A;  1RBV A;  3EYZ A;  4X64 K;  1U49 A;  1ILY A;  3CFR A;  2HW3 A;  4GMJ B;  3TTD A;  1Q9Y A;  4AIL C;  1KLN A;  1XHX A;  3ZYY X;  4BG8 A;  4KHU A;  1JXB A;  5AZI A;  3VEN A;  1C0M A;  1S72 N;  3WQU A;  3D45 A;  3KWI A;  4K41 A;  4OPA A;  4DFJ A;  2QXL A;  3BF3 A;  1P90 A;  4IXC A;  3EE8 A;  3S41 A;  4AHS A;  3KLF A;  3HPH A;  4E3S A;  4KHS A;  1Q81 O;  2UXC K;  3MCP A;  3O6W A;  4FWP A;  3NDK A;  2KW4 A;  4O0I A;  3V81 A;  1Z05 A;  4IG3 A;  1Q7Y O;  3K5O A;  4JI8 K;  3VQ5 A;  2GX9 A;  1C6V A;  4MLH A;  1LAV A;  1VSK A;  1KTQ A;  5KPT A;  4DUY K;  1ZBI A;  3WNH A;  4KRF A;  4NCB A;  2ZGZ A;  1YTA A;  3VGL A;  1EX4 A;  1NK5 A;  2NRZ A;  4JKD A;  4DFM A;  5AZI B;  4CD3 A;  3HYF A;  1NJZ A;  1BO5 O;  3A0I X;  4RWT A;  5A2Q O;  1HKG A;  3C6T A;  3QIN A;  5GAG P;  3O3G A;  3VPZ A;  4E7H A;  2DFH A;  4FLX A;  3AA3 A;  4XH5 A;  5AFU A;  4BGA A;  1HYV A;  3MWP A;  1TL1 A;  3FFI A;  3ZX0 A;  5KQD A;  2O8D A;  4PQU A;  4BQZ A;  2B6A A;  3NGZ A;  4DLG A;  2XY6 A;  3FZF A;  3S3M A;  4ELU A;  4IO9 L;  4CZI A;  4GKJ K;  4OLA A;  1K8K A;  4KHW A;  4BC2 A;  4CZE A;  4JEP A;  2XO7 A;  1BIZ A;  4CEA A;  5GAD P;  1VSM A;  1U47 A;  4F2S A;  3LAK A;  3VQD A;  4HHT A;  3ZEU A;  2E2O A;  1JLB A;  4FM1 A;  1FXX A;  4FJL A;  2CH6 A;  2IS3 A;  1WB9 A;  4AM6 A;  3ENB A;  2O8C A;  1X9S A;  3P39 A;  3PUF A;  4OX9 K;  3BZC A;  1WOQ A;  4ID5 A;  1NG9 A;  5M1Q A;  2O8D B;  2NRH A;  1BWF O;  1EP4 A;  4IEI A;  2F96 A;  1REV A;  3ENH A;  1BIS A;  4CEB A;  1ATN A;  3DLR A;  5C2F A;  4BC5 A;  5J2N A;  3SUQ A;  4CJL A;  1F21 A;  1K8K B;  1UAX A;  3HZ6 A;  5AQQ A;  3MXM A;  4DTX A;  1HPZ A;  3EKU A;  1NU0 A;  4OVL A;  4NLC A;  4HVJ A;  1NM1 A;  2G8F A;  4FJM A;  2FBY A;  1JL2 A;  3KD5 E;  3FZL A;  3ZEU B;  1TK5 A;  1N5Y A;  4BR7 A;  4DV3 K;  4CJ7 A;  3TAP A;  3OJS A;  3AVK A;  3M8P A;  4F9O A;  3KLI A;  3HP9 A;  4ILH A;  4O55 A;  3SUP A;  2O8C B;  1VQ9 N;  4LH4 A;  3SYZ A;  2Z1H A;  3U9Z A;  4B1X B;  4YOU A;  4H5T A;  1S9G A;  2D0B A;  4UQG A;  3K9K A;  4IFY A;  1YT3 A;  3CJ1 A;  3RSE A;  3TAM A;  1CXU A;  2FBT A;  3KK1 A;  2PFU A;  4NO7 A;  2P9N A;  4KI6 A;  5C0Y A;  2QWP A;  5AFU H;  2P9U A;  3DAW A;  2E6L A;  3NAE A;  4ILG B;  4FLV A;  4N47 A;  2E4L A;  4FJG A;  3HM8 A;  1OH7 A;  5AQM A;  1BA0 A;  3LPU A;  4DLE A;  2WC9 A;  3O1B A;  4JK9 A;  2O8F A;  4DQP A;  3R8E A;  4LSL A;  4ZTF A;  1LWE A;  5GAE P;  1RBS A;  5BRF A;  5FRN A;  4CZG A;  3SCX A;  3LDO A;  1TK8 A;  2A1S A;  1TYQ A;  4QS8 A;  3RSE B;  3L3V A;  1L3S A;  1VSE A;  3VEZ A;  2P9N B;  4FK0 A;  1RT2 A;  4IJN A;  1NJX A;  3DM2 A;  2P9U B;  4GV6 A;  4AHC A;  1C0U A;  1NK0 A;  3EZW A;  3TTC A;  4KBO A;  1RDD A;  1LWF A;  2FF3 B;  2VG6 A;  4DSF A;  5MLC Q;  3P31 A;  1TL3 A;  2O8F B;  3SPY A;  1C1B A;  3DOK A;  4JI6 K;  4FJK A;  3I33 A;  1J5E K;  3AVF A;  3CJ9 A;  4CK3 A;  2X74 A;  1A5W A;  4CIE A;  3T1Y K;  3A2F A;  4RW4 A;  3WXK A;  3HPO A;  2A40 A;  3KVG A;  1XI1 A;  1IG9 A;  1TYQ B;  4R5P A;  4O5F A;  2Q1N A;  4IDK A;  4JI5 K;  3OYM A;  4FZX C;  1K8A O;  3LDN A;  5GIO A;  3HI0 A;  3TSP A;  3HJF A;  3HM9 A;  3AGK A;  4FOE A;  1C1A A;  3ZSV A;  3JSM A;  1IH7 A;  2UUC K;  3ZT3 A;  2D0O A;  3SQ2 A;  4CHO A;  2UU9 K;  1X9M A;  2ITG A;  2XRI A;  4KPY A;  3A5M C;  4DS5 A;  2W41 A;  3CC2 N;  1I3A A;  4QS7 A;  1EWQ A;  3DRS A;  4CEF A;  2YNG A;  1VQO N;  1HNV A;  4OPK A;  3PIO L;  4B8C A;  1RDC A;  2RPI A;  3OYF A;  3ID8 A;  4FCY A;  4EZ9 A;  4IOC L;  1DKG D;  1LV5 A;  4M3Y A;  4JI4 K;  4LFB K;  1NJI O;  1QVG M;  1NBW A;  2OPR A;  4RCH A;  3J8A A;  4CK2 A;  1MWK A;  2BUP A;  2QEX N;  1OKJ A;  3IDH A;  2KTQ A;  3DOL A;  2OPQ A;  4FM0 A;  4A59 A;  1IKY A;  1RTH A;  3A8Y A;  5JS1 A;  2NRT A;  4BVO A;  1RBT A;  1ZBS A;  5JVG L;  4YHH K;  4KI4 A;  2XHB A;  3RMA A;  2HB5 A;  1VQ4 N;  1NLV A;  3DLE A;  4PWD A;  3DWL A;  3L3U A;  2ZJR L;  4JK7 A;  1O13 A;  3TAG A;  3VQC A;  1TKT A;  2BAN A;  5I9E B;  2V52 B;  1YTU A;  1Q8I A;  4CZL A;  4C23 A;  4BDY A;  3THV A;  3L2V A;  1YXQ A;  1ESV A;  4YOR A;  3OHR A;  2HF4 A;  2WBN A;  1TUY A;  3E9P A;  3VQP A;  5CYQ A;  4CJW A;  4LSN A;  3THX A;  2BH1 A;  3OYJ A;  1VSF A;  2FXU A;  4BR0 A;  3CJA A;  1M1K O;  1NGJ A;  1WSJ A;  5M1N A;  3AO3 A;  1TKD A;  1WBD A;  2NRV A;  1QVF M;  4DR2 K;  1BUP A;  1KAX A;  5AQT A;  3OYN A;  2IIR A;  4FLW A;  4FZY A;  2RKI A;  1NKE A;  1YVU A;  1S22 A;  2F8S A;  5ELZ A;  1CLQ A;  1MWM A;  2VGN A;  3SQ4 A;  5HOO A;  1OH6 A;  5HRN A;  3OYI A;  3ZSX A;  3SV4 A;  4N41 A;  3CG7 A;  5LJW A;  5F0X A;  2QWR A;  5JLF A;  3SAG A;  1YJN N;  1Y64 A;  3OA9 A;  3THX B;  2Q36 A;  4Z4I A;  1NK8 A;  2E88 A;  4CJ4 A;  1HYZ A;  1IKW A;  3CCS N;  5AQV A;  2ASM A;  3PIP L;  2WUS A;  1NNE A;  4DR4 K;  3AAQ A;  5AQP A;  4AH9 A;  1E3M A;  1ZXO A;  3BF1 A;  3PV8 A;  4K43 A;  4YOX A;  4M42 A;  3AY9 A;  1T44 A;  4GV9 A;  3PSI A;  1NK7 A;  5AQW A;  1SZ2 A;  2D4W A;  4N76 A;  1HPM A;  2HND A;  3ZSW A;  4FJ5 A;  3JAM O;  2ZQB A;  2IVO A;  3RMC A;  3F2K A;  1DEJ A;  3SLC A;  1TAU A;  4BRP A;  1GLE G;  1ATR A;  3KZB A;  3U8X A;  4FK2 A;  4CGD A;  4JV5 K;  1KVA A;  3J80 O;  2KFN A;  4M3R A;  2F4V K;  1WSG A;  3AO1 A;  1W7A A;  3NF7 A;  3O8M A;  3UKR A;  2NZT A;  1HQU A;  3DLK A;  3CQY A;  3Q7C A;  1U48 A;  3CCQ N;  4DR3 K;  3NGI A;  3F5T A;  2XY7 A;  4JKF A;  2YCH A;  3ID6 A;  4BRN A;  4K8Z A;  4AM7 A;  3R1X A;  5JIC A;  3JXU A;  4B8A B;  4GVE A;  5B8H A;  5E26 A;  3I8D A;  3M8Q A;  3MED A;  3O9T A;  3MAQ A;  3QIP A;  1C0T A;  2NRX A;  1NGI A;  3L0Q A;  3CYM A;  4JRP A;  4M41 A;  4LF8 K;  3UKR B;  3LDL A;  1YJ9 N;  1XUP O;  3D6R A;  2FLO A;  3TTF A;  4BRG A;  3ZLJ A;  2P5O A;  1X9W A;  4IZ9 A;  4IKF A;  3QNN A;  3QIC A;  4IWV A;  3VN5 A;  1VQM N;  5KGX A;  2GEM A;  5KPZ A;  4FJI A;  3LWM A;  1ZBF A;  2KFZ A;  4FXD A;  4CJP A;  4YFU A;  2Q0R A;  4DWI A;  2Q97 A;  2A42 A;  4NYF A;  4BC4 A;  3RRG A;  4CHN A;  3VET A;  5C25 A;  1K73 O;  4DG1 A;  3NVM A;  1VSD A;  3V1R A;  3J81 O;  4G9Z A;  4FL9 A;  1SS6 A;  3AGR A;  2FC0 A;  2OPS A;  2OZS A;  1S9E A;  3O5B A;  5FPN A;  4OPJ A;  2HHW A;  1P8Z A;  2OPP A;  3IUC A;  4DFP A;  3P38 A;  1RT5 A;  3OYG A;  5T7B A;  1RBR A;  4HWI A;  3ZT4 A;  1UA0 A;  4CHP A;  4M3Z A;  4O5B A;  1VRU A;  3AVM A;  2ZE2 A;  2G8I A;  3JS6 A;  1U4B A;  1BIU A;  5FPM A;  2VCP A;  3ZSR A;  1BQM A;  4WQ4 C;  2GTD A;  4MDB A;  1HNW K;  3SMS A;  4I6M A;  5M1F A;  3NCI A;  5HLF A;  4LF4 K;  2YHA A;  4C8K A;  3U9D A;  3QEX A;  4F3O A;  3HT3 A;  5AQZ A;  1GLC G;  3ZX3 A;  3EL2 A;  3DJC A;  5FDL A;  3KJV A;  4DSK A;  1D9D A;  3WXL A;  1ATS A;  4JKE A;  3QML A;  3I8B A;  2O8E A;  4X65 K;  3WUH A;  4OKK A;  3BGR A;  4LD0 A;  3ALY A;  2ZF5 O;  3TAF A;  2QM1 A;  1SKW A;  4DTO A;  4FWK A;  3MN6 A;  4KO0 A;  5BPN A;  2QA4 N;  1SL0 A;  1HNX K;  3LP1 A;  4E1N A;  4OJR A;  1Z26 A;  4J2E A;  3CF5 L;  2P1J A;  4I6M B;  4CJK A;  4KHQ A;  3A5N C;  3QIO A;  3SV3 A;  2VWJ A;  4YOV A;  3CXC M;  1HR0 K;  4BDP A;  1WSI A;  1X3N A;  1WAF A;  5SWM A;  4O0J A;  1HKC A;  4A2A A;  1RT4 A;  3VQ8 A;  4HTU A;  2O8E B;  4FOI A;  3VES A;  3EY1 A;  4OKE A;  4MO5 A;  5C15 A;  1Q86 O;  4BQL A;  2BGG A;  4LFA K;  1JCG A;  4RW6 A;  4DKW A;  1KSP A;  1SUQ A;  4CJR A;  4PKG A;  3LL3 A;  5KPR A;  1CZB A;  3C94 A;  4B1U B;  4H0V B;  3FE1 A;  3AVL A;  2CGK A;  3ULE A;  1HMV A;  3G71 N;  2FSJ A;  1J54 A;  4CJF A;  4Z0U A;  1IKX A;  4C8N A;  3SMP A;  4B3T K;  2O4I A;  2ITM A;  1R0A A;  1NK9 A;  4E1M A;  3AA5 X;  3ENO A;  2E20 A;  1NGA A;  4A2B A;  3VGM A;  4M3W A;  4I2P A;  1B92 A;  4JKB A;  4QAG A;  5ADX A;  1E4F T;  4QCL A;  3DI6 A;  3JYT A;  3TPQ A;  4O44 A;  5BPL A;  4FZZ A;  4DUZ K;  1W97 L;  3OYE A;  2P9I A;  4XH1 A;  4BAC A;  3E01 A;  3EE9 A;  4FW1 A;  5H1S Q;  2FBV A;  2VQE K;  1QSL A;  2E5L K;  4WQ5 C;  4EP4 A;  4LF6 K;  2WOM A;  4B9Q A;  3PX4 A;  3NBP A;  1RDB A;  3G25 A;  3ULE B;  3HO1 A;  4KH6 A;  3H08 A;  3I56 N;  4JS4 A;  3NE6 A;  1DTT A;  5M1P A;  3ZT1 A;  5LL6 Z;  2HHS A;  1KVC A;  3SZ2 A;  3LDP A;  1KLM A;  3DLH A;  2W6L A;  3IS9 A;  3WXI A;  4DR6 K;  3HOT A;  3V4I A;  2RN2 A;  3NVK A;  5LMU K;  1JLG A;  4KB1 A;  2ZGY A;  2P9I B;  4YOW A;  4L3Q A;  5C24 A;  2F8T A;  1ASW A;  1QQN A;  2AP1 A;  3IAY A;  3KLE A;  2YI1 A;  3LP0 A;  3ZET A;  2YKM A;  4H8K A;  1DLO A;  3NHG A;  2D5R A;  4DTM A;  3CET A;  3S3N A;  1FW6 A;  4M63 C;  4DSI A;  3DRP A;  1JKH A;  4PL8 A;  1VSJ A;  1N6Q A;  1BQN A;  3VQ6 A;  5E41 A;  1QS4 A;  2HST A;  3BUZ B;  2A6A A;  3QET A;  3TAE A;  3O80 A;  1IJJ A;  4ELT A;  1BU6 O;  3VEY A;  3QBX A;  4CJU A;  2Y1I A;  3MX5 A;  3UE5 A;  4BC3 A;  2DFE A;  2ATQ A;  3E66 A;  1HNZ K;  1C0F A;  4LC9 B;  3N4Q A;  2HMP A;  3V9X A;  5ADX H;  4RW8 A;  3ZET B;  4YNQ A;  3QEP A;  1QHA A;  2OZM A;  2OTJ N;  1U6Z A;  3TI0 A;  5AQI A;  1T3V A;  1IKV A;  5CR4 A;  1QHT A;  3MWT A;  2FSN A;  1XMQ K;  2E2N A;  3EEQ A;  4MLE A;  2R7Y A;  4B3S K;  4KTQ A;  4H5N A;  1HUX A;  4KTZ A;  2YKN A;  4FJJ A;  2ZM6 K;  1HKB A;  2UXD K;  4LF5 K;  2G8V A;  2ZD1 A;  3CCJ N;  2GWJ A;  2PZS A;  4QS9 A;  4CIG A;  1YVN A;  1RT6 A;  2HVI A;  4YOY A;  1JCF A;  3ZT2 A;  3KK2 A;  1XWL A;  4FW2 A;  4NB4 A;  2I7P A;  3CQX A;  4CZM A;  1NWK A;  3D7E O;  4I7F A;  2E8A A;  4LH5 A;  2KHO A;  3AA4 A;  3CPE A;  5GIP A;  3AO2 A;  4ELV A;  4DF8 A;  3C0B A;  2P9K A;  3CC4 N;  2HBJ A;  3LPT A;  4DHY A;  5JLH A;  3OJU A;  1ITG A;  4C8M A;  3RMB A;  2G8K A;  3P83 D;  4IBN A;  5SZT A;  4RG8 A;  4DR5 K;  2IDO A;  3L6Q A;  4BWJ A;  4GVM A;  4FSV A;  3MXJ A;  2F9T A;  1R59 O;  4CK1 A;  1RTJ A;  3DLG A;  4W5T A;  4CJE A;  4CBW A;  1GOC A;  1S1U A;  2OA8 A;  2YNI A;  2F7T A;  3NF6 A;  4BG9 A;  4ICL A;  1Q18 A;  1D4X A;  3HRG A;  3S9H A;  4PKI A;  4B08 A;  4AQY K;  2B5J A;  3O1W A;  3H45 C;  4CEZ A;  2IAJ A;  3LAL A;  4Z94 A;  2HNZ A;  3B8A X;  2Z1J A;  4FWQ A;  1Z6R A;  1BA1 A;  2EWS A;  4OPH A;  5AQK A;  1X1P A;  4CF8 A;  2HHH K;  4B3R K;  2P9K B;  2JGU A;  4G1Q A;  4KH5 A;  3B6P A;  2J4R A;  4JKC A;  4BRL A;  4BRA A;  3CI5 A;  3HVT A;  4JAX A;  4BRD A;  5HL7 L;  2YNF A;  4X66 K;  4AHT A;  5CYM A;  4LFC K;  1NMD A;  3CHW A;  3I0S A;  3AV9 A;  4B1Z A;  3RVC A;  4K0K K;  3DYA A;  1NMN A;  2AA4 A;  2Q2R A;  2VWB A;  3ISN C;  5BRH A;  2GWK A;  4Q0B A;  4B9V A;  2GUI A;  3QER A;  3O3F A;  1NK4 A;  3RWU A;  3VQ7 A;  3GL1 A;  3MX2 A;  1SKS A;  1CZ9 A;  3AVB A;  4HTL A;  4K25 A;  3SUO A;  2EX3 A;  1U2V A;  1QE1 A;  1BL3 A;  3ASM A;  2YNH A;  1Y97 A;  3QES A;  3PSF A;  3EN9 A;  4DTU A;  2Q31 A;  3O3H A;  3D2E A;  4C1N K;  3O08 A;  1LCU A;  3LP2 A;  4WQ4 A;  4N56 A;  4F4K A;  2A3Z A;  2P51 A;  4NXN K;  1QQM A;  4DSL A;  2HNY A;  3O4W A;  3L2R A;  4FLY A;  4JN4 A;  4E7K A;  3ZCM A;  2UUA K;  2P9L A;  4B3M K;  3SJJ A;  3G0Z A;  4OLB A;  5AQH A;  4CHY A;  3QEI A;  1VQ7 N;  4MFB A;  4CGJ A;  1NGD A;  4JKA A;  3KD1 E;  1U2V B;  1NKC A;  1TGO A;  3QEW A;  3RR8 A;  4BY9 C;  3HOS A;  1RBU A;  4DQI A;  3OS2 A;  1RT3 A;  4JKG A;  1A5V A;  3HST B;  5J2P A;  3VQE A;  3D2E B;  3GDQ A;  1HYS A;  3FZH A;  2YHX A;  4FLU A;  4DFK A;  3O9Q A;  3C6H A;  1S1X A;  4O4G A;  1L3T A;  1RT1 A;  2P9L B;  3CCM N;  4BR5 A;  1KRP A;  1NOY A;  2DFF A;  4DR1 K;  3VOV A;  1G15 A;  2E1Z A;  1BCM A;  5CZ2 A;  4CF2 A;  2VYP A;  4FLZ A;  4GNI A;  1B9F A;  4J2D A;  3VF2 A;  3SUN A;  1T6C A;  2V7Y A;  4JKG B;  1LAW A;  4W5N A;  1DT9 A;  3TAQ A;  2YHY A;  4LF9 K;  5EX5 A;  1T03 A;  1BCO A;  4CZF A;  2PY5 A;  1T7P A;  1MU2 A;  3CPW M;  1VSH A;  3OTO K;  4N5S A;  1WSE A;  3TSU A;  3SAF A;  2G8W A;  1OH5 A;  1VQ6 N;  1NGH A;  2G8H A;  1WLJ A;  2PYJ A;  3G10 A;  3VQA A;  2O4G A;  3QB0 A;  1S1T A;  1QTM A;  3G4S N;  2PYL A;  4A5A A;  3L4I A;  1TAQ A;  4KV8 A;  2DPN A;  4MDA A;  4C8L A;  3UKU A;  3CCE N;  4YDU C;  5CZ1 A;  1WAJ A;  4CI6 A;  3C7N A;  4E7J A;  3O9S A;  2JWK A;  4FM2 A;  3WT0 A;  4ILJ A;  4CCH A;  2IOC A;  4WQ5 A;  3QDK A;  3H46 O;  3CCR N;  4OO1 J;  2A41 A;  2QXF A;  3LM9 A;  5E84 A;  1MDU B;  5AJ3 K;  3TAB A;  1GLL O;  2W6K A;  1WN7 A;  3LM2 A;  4OGE A;  3R3L A;  1JJ2 M;  4CJ3 A;  5C12 A;  2OTL N;  4HCC A;  1ZBH A;  4B9T A;  5JVH L;  1HQE A;  4EP5 A;  4CHZ A;  3G6E N;  1S6Q A;  2IVN A;  2O8B A;  3SPZ A;  3J7A P;  3RRH A;  5I3U A;  3SI6 A;  5JS2 A;  5C10 A;  1WUA A;  3D2F A;  3UKU B;  2I7N A;  2CGJ A;  3O4N A;  2E2P A;  5TKW A;  5AQG A;  2PBD A;  1NJW A;  4CFC A;  3GG4 A;  4DSE A;  1NOZ A;  4BRQ A;  1GOA A;  1YUW A;  1K6Y A;  2NUB A;  1FKP A;  1U04 A;  3ZT0 A;  4BDZ A;  1RCH A;  1RTD A;  4I9Q A;  1CZA N;  2GEL A;  3RR7 A;  2VQF K;  1L3U A;  1RFQ A;  4J8F A;  3AAR A;  4DTJ A;  2O8B B;  4E7L A;  2YHW A;  1XMO K;  1YIJ N;  3ITH A;  3D2F B;  5AQF A;  3KIO A;  4FPA A;  5LY3 A;  1KC8 O;  1OH8 A;  1XC9 A;  4MO4 A;  1H1V A;  3TU5 A;  4H4M A;  3WNF A;  4DV1 K;  4IOA L;  1Q82 O;  2RF2 A;  4EAH D;  1VHX A;  3MEE A;  1TK0 A;  2OAN A;  1YJW N;  1HJO A;  2KKZ A;  3CD6 N;  5EY4 A;  2JWL A;  1RDW X;  3U6F A;  4ISF A;  3V9S A;  3QNO A;  1VSI A;  3VQQ A;  2LSN A;  4IEE A;  3F9M A;  4FWR A;  5AR0 A;  2ZJQ L;  4H5R A;  4K8X A;  4WE1 A;  5HRP A;  3M6G A;  4CFA A;  4DU4 A;  2QWM A;  3K5L A;  3AVN A;  4H0Y B;  4M3U A;  4M3X A;  4JD2 A;  4DQR A;  4DSJ A;  2W40 A;  4A5B A;  1W0H A;  3WNG A;  1GOB A;  3PO4 A;  3A5O C;  4FJ8 A;  4ZTJ A;  4A57 A;  5JMV A;  1DGK N;  5EVZ A;  3MN7 A;  3F73 A;  3SNN A;  1SL1 A;  4E19 A;  4JI2 K;  5FPE A;  1EXQ A;  3LAM A;  1FJG K;  4B1W B;  3AVJ A;  2QWL A;  3LDS A;  5DK5 A;  4L8R B;  1YIT N;  3CM5 A;  3DMJ A;  2ETJ A;  4NCG A;  2WTU A;  1VRT A;  2HBM A;  1V4T A;  4CGI A;  5HRS A;  3LZJ A;  4BE1 A;  4DF4 A;  5GIN A;  3HP6 A;  2YHB A;  5AQO A;  5HRO A;  3K0S A;  1RDU A;  4JD2 B;  5I42 A;  2V7Z A;  2HHQ A;  1S6P A;  3HXM A;  3LWL A;  3THY A;  3VQB A;  3OS0 A;  1LWC A;  2FF6 A;  4JI3 K;  2BTF A;  4MQ3 A;  5AQU A;  4CBX A;  4BRF A;  4FJN A;  3LZI A;  3K5M A;  1KFS A;  3WNE A;  1L3V A;  4FJX A;  3CJ7 A;  4DV2 K;  3KWG A;  2HHV A;  4Y1C A;  3QEV A;  2D0A A;  4DR7 K;  2IVP A;  1UA1 A;  2HMI A;  4R79 A;  3VTI A;  1FKO A;  1S5J A;  2QWN A;  3GE1 A;  2GV9 A;  4GKK K;  4LF7 K;  3C95 A;  3J7Z O;  1KFD A;  1QQC A;  1X9J A;  3AA2 A;  2YJE A;  5IT9 O;  3OW2 M;  3THY B;  4GW6 A; 
#chains in the Genus database with same CATH homology
 3K9J A;  3WQT A;  5CR4 A;  2P9P A;  1XQS C;  3DWL A;  3MWT A;  2ZJR L;  4JK7 A;  3CCV N;  5DM6 L;  2FSN A;  2RE2 A;  2E2N A;  4MLE A;  1O13 A;  1KXP A;  4H5N A;  3C65 A;  1HUX A;  2ASO A;  4WYB A;  4H0O A;  4BRK A;  4BVP A;  5I9E B;  4BRM A;  1HKB A;  4IDH A;  2NNW A;  2V52 B;  5AQR A;  1LOT B;  5M1K A;  4H0P A;  4XH4 A;  2GWJ A;  4CZL A;  4QS9 A;  4C23 A;  5GAH P;  3CCJ N;  1RGI A;  4FWL A;  1YVN A;  1VQ5 N;  3H6E A;  4B1V A;  4CZH A;  3GBT A;  1HLU A;  4YOY A;  1JCF A;  1YXQ A;  1ESV A;  4YOR A;  3OHR A;  1ZC6 A;  2HF4 A;  2WBN A;  1TUY A;  1NLV A;  3E9P A;  4JHD A;  4FWM A;  4NB4 A;  2I7P A;  4U67 L;  5AQY A;  3CQX A;  4CZM A;  2QI2 A;  1E4G T;  2BH1 A;  1NWK A;  2FXU A;  3D7E O;  3CJA A;  3OBW A;  2E8A A;  3VTH A;  2KHO A;  1EQY A;  3CPE A;  4BR0 A;  5GIP A;  3EKS A;  1NGJ A;  5FPD A;  1M1K O;  5TKY A;  5BR9 A;  5M1N A;  3C0B A;  2WFB A;  4RTF D;  2P9K A;  3CC4 N;  2HBJ A;  4FWS A;  4DHY A;  5M1O A;  4BGB A;  5JLH A;  1QZ6 A;  2NRV A;  2P9P B;  1QVF M;  4WFN L;  1BUP A;  1KAX A;  5AQT A;  1JCE A;  1S3X A;  5CE3 A;  4H0X B;  3SBG A;  2IIR A;  3L6Q A;  4WF9 L;  4FSV A;  2F9T A;  1S22 A;  1R59 O;  5ELZ A;  4CBW A;  1MWM A;  3M1F A;  2VGN A;  4BRI A;  4CZJ A;  2V51 B;  3ATV A;  5HOO A;  2F7T A;  3CIP A;  3E9L A;  4BG9 A;  1Q18 A;  1D4X A;  2CGL A;  5LJW A;  3HRG A;  2QWR A;  5F0X A;  5JLF A;  3SAG A;  1YJN N;  4PKI A;  1Y64 A;  3OA9 A;  1XC3 A;  4JHD B;  2D1K A;  1K9M O;  2RHK A;  2Q36 A;  3O1W A;  3H45 C;  1VQN N;  4Z94 A;  2QWO A;  2E88 A;  3B8A X;  3H1Q A;  4FWQ A;  1Z6R A;  1BA1 A;  2EWS A;  4OPH A;  5AQK A;  2P9K B;  4KH5 A;  3FFK B;  2J4R A;  3CCS N;  4JKC A;  5AQV A;  2ASM A;  4BRL A;  3PIP L;  3FR0 A;  4BRA A;  3CI5 A;  2WUS A;  4JAX A;  4O8U A;  4BR9 A;  4BRD A;  5HL7 L;  5KQ8 A;  3AAQ A;  5AQP A;  3CC7 N;  1ZXO A;  1NMD A;  2CH5 A;  3CHW A;  4B1Z A;  3BF1 A;  3RVC A;  4IJA A;  1OVY A;  3MMV A;  4K43 A;  4YOX A;  1YI2 N;  3AY9 A;  1T44 A;  2AA4 A;  2Q2R A;  2VWB A;  5BRH A;  2GWK A;  3CMA N;  4GV9 A;  5AQS A;  4BRE A;  3L4Q A;  5F1X A;  4AF1 A;  3GL1 A;  3MX2 A;  5AQW A;  1IG8 A;  3A5L C;  1SZ2 A;  2D4W A;  2NRW A;  1HPM A;  4FWO A;  4HTL A;  4K25 A;  4PKH A;  3VEO A;  1KAY A;  1C0G A;  1U2V A;  5EOY A;  3UB5 A;  2IVO A;  4GY2 B;  3MK6 A;  3O9U A;  3F2K A;  3T69 A;  4YDU A;  3EN9 A;  5DM7 L;  1N8R O;  1DEJ A;  3SLC A;  4BRP A;  1GLE G;  1X3M A;  1ATR A;  1GLJ O;  2PAV A;  2Q31 A;  2YX6 A;  3KZB A;  3U8X A;  4EIA A;  1GLF O;  3D2E A;  4C1N K;  3O08 A;  1LCU A;  3CME N;  4K42 A;  4C1N I;  1NGC A;  4H0T B;  4WQ4 A;  3O9R A;  2A3Z A;  2QTD A;  3O8M A;  3UKR A;  2NZT A;  4XEI A;  1QQM A;  3CQY A;  1BOT O;  2KLA A;  3E9O A;  3O4W A;  3HTV A;  3VGK A;  1NGE A;  3QBW A;  3Q7C A;  3CCQ N;  2A5X A;  3Q7B A;  3MN5 A;  4JN4 A;  3E1Y A;  4YOT A;  3R9P A;  3VF6 A;  1YF5 L;  2P9L A;  4A62 A;  3WEE A;  4BRO A;  3F5T A;  4JKF A;  2YCH A;  5AQH A;  3CER A;  3ID6 A;  4H03 B;  3P4I A;  5BRD A;  4BRN A;  1M90 O;  1VQ7 N;  2F9W A;  2NLX A;  1NGD A;  1VQL N;  4AM7 A;  2D0P A;  4BR4 A;  1MA9 B;  1GLA G;  4ISE A;  3R1X A;  4JKA A;  5JIC A;  1U2V B;  3JXU A;  4BY9 C;  4GVE A;  3HOS A;  5AQX A;  5B8H A;  5E26 A;  4JKG A;  4A61 A;  1ILY A;  2HBL A;  3TTD A;  1KQS M;  3ZYY X;  3O9T A;  3D2E B;  2NRX A;  3GDQ A;  1NGI A;  3L0Q A;  4BG8 A;  4DB3 A;  4IFE A;  3OBY A;  5AZI A;  2QWQ A;  3FZH A;  3CCL N;  2YHX A;  1VAZ A;  3VEN A;  1S72 N;  1BDG A;  3WQU A;  3O9Q A;  3KWI A;  3UKR B;  4BRC A;  3LDL A;  4K41 A;  1YJ9 N;  2P9S A;  3C6A A;  3C6H A;  4OPA A;  1XUP O;  4JKH A;  3MDQ A;  2QXL A;  3BF3 A;  1P90 A;  3VER A;  3D6R A;  3EE8 A;  4IXC A;  3S41 A;  3QFP A;  4WCE L;  2P9L B;  1YHQ N;  3WEE B;  2FLO A;  3CCM N;  3TTF A;  4BR5 A;  1Q81 O;  3MCP A;  3CJB A;  4BRG A;  3KK7 A;  3O6W A;  4FWP A;  4IZ9 A;  1Z05 A;  3QIC A;  4IWV A;  3VOV A;  1Q7Y O;  2E1Z A;  1VQM N;  4PHT X;  5AQJ A;  2GEM A;  2VYP A;  4GNI A;  2GX9 A;  4MLH A;  5BN9 A;  5CHI A;  5KPZ A;  5KPT A;  3VF2 A;  1T6C A;  2V7Y A;  4JKG B;  2ZGZ A;  1DT9 A;  3VGL A;  3VMF B;  2YHY A;  4B1Y B;  5EX5 A;  2NRZ A;  2Q0R A;  4JKD A;  1TUU A;  3IFR A;  4CZF A;  5AZI B;  4CD3 A;  2Q97 A;  2A42 A;  3H3O B;  1BO5 O;  3A0I X;  4BC4 A;  4RWT A;  3CPW M;  3VET A;  2P9S B;  3TSU A;  1HKG A;  1K73 O;  3NVM A;  5GAG P;  3VPZ A;  3VEW A;  3SAF A;  4G9Z A;  3N4P A;  4Y0W A;  1NGG A;  4FL9 A;  1VQ6 N;  1NGH A;  1SS6 A;  3AGR A;  4XH5 A;  5C2D A;  5AFU A;  4BGA A;  3QB0 A;  2Q0U A;  3MN9 A;  3O5B A;  2E2Q A;  3SJH A;  3MWP A;  3G4S N;  5FPN A;  4A5A A;  3SBT A;  3L4I A;  3ZX0 A;  1P8Z A;  3IUC A;  4E1J A;  4MDA A;  2DPN A;  5KQD A;  4BQZ A;  3P38 A;  3UKU A;  3CCE N;  4YDU C;  4HWI A;  3VEV A;  3SK3 A;  4WFA L;  3KHY A;  3FZF A;  4IO8 A;  4IO9 L;  4CZI A;  4BR2 A;  4FPB A;  1K8K A;  4CI6 A;  4M7Y A;  3C7N A;  3ZX2 A;  1VQ8 N;  4BC2 A;  4CZE A;  4JEP A;  3O9S A;  3JS6 A;  5FPM A;  3CCU N;  2JWK A;  2VCP A;  5GAD P;  4WQ4 C;  2GTD A;  3WT0 A;  4ILJ A;  4MDB A;  4WQ5 A;  3SMS A;  4I6M A;  3QDK A;  3H46 O;  3CCR N;  5M1F A;  4OO1 J;  1NGB A;  3U9D A;  3BP8 A;  3ZEU A;  4EFH A;  2A41 A;  3LM9 A;  5E84 A;  2E2O A;  1MDU B;  1GLL O;  3LM2 A;  5AQZ A;  1GLC G;  3ZX3 A;  2CH6 A;  3R3L A;  3EL2 A;  1KD1 O;  3DJC A;  4FWN A;  4AM6 A;  3ENB A;  3AAP A;  1JJ2 M;  2GUP A;  3WXL A;  1ATS A;  5C12 A;  4JKE A;  3P39 A;  3I8B A;  3IKM A;  3QML A;  2OTL N;  3HBT A;  4FVU A;  5JVH L;  4DCH A;  1WOQ A;  3BEX A;  3EO3 A;  3WUH A;  5M1Q A;  3G6E N;  1VQP N;  2IVN A;  2NRH A;  1BWF O;  4IEI A;  2ZF5 O;  5C10 A;  1WUA A;  3D2F A;  3UKU B;  1SQK A;  1YAG A;  2I7N A;  3ENH A;  2CGJ A;  5AZJ A;  1ATN A;  2QM1 A;  5C2F A;  4BC5 A;  1QQO A;  2E2P A;  5TKW A;  5AQG A;  2PBD A;  1K8K B;  4FWK A;  3MN6 A;  5AQL A;  5BPN A;  2QA4 N;  3HZ6 A;  2ASP A;  5AQQ A;  3EKU A;  3GG4 A;  2H3G X;  3FLC O;  4NLC A;  3CF5 L;  1NM1 A;  4I6M B;  4BRQ A;  3H3N O;  1YUW A;  3A5N C;  3W3D A;  3FZL A;  3ZEU B;  1EO1 A;  4BR7 A;  4CZK A;  4CJ7 A;  4YOV A;  4EHT A;  4F9O A;  3CXC M;  4ILH A;  1X3N A;  3T7Z A;  1CZA N;  1VQ9 N;  1HKC A;  2GEL A;  4A2A A;  3U9Z A;  1RFQ A;  4B1X B;  3LDQ A;  4FOI A;  4YOU A;  4H5T A;  4J8F A;  4FO0 A;  3VES A;  3AAR A;  3K9K A;  4MO5 A;  4EHU A;  2YJF A;  3CJ1 A;  2YHW A;  5C15 A;  3RSE A;  3W0L A;  1YIJ N;  1Q86 O;  4BQL A;  3D2F B;  5EXW A;  5AQF A;  2PFU A;  4NO7 A;  1JCG A;  4FPA A;  5AZJ B;  2P9N A;  5C0Y A;  4DKW A;  2QWP A;  5AFU H;  3WXM B;  5LY3 A;  1KC8 O;  2P9U A;  3DAW A;  4ILG B;  4PKG A;  3LL3 A;  3PLA A;  3DXM A;  4MO4 A;  5KPR A;  1H1V A;  3HSC A;  3TU5 A;  3VF4 A;  3HM8 A;  1GLD G;  4B1U B;  5AQM A;  4H0V B;  4IOA L;  1BA0 A;  3FE1 A;  1Q82 O;  2CGK A;  3ULE A;  4JNE A;  4O8K A;  2WC9 A;  3O1B A;  4JK9 A;  4EAH D;  3WXJ A;  3G71 N;  5F2R A;  4GV3 A;  2OAN A;  2FSJ A;  3R8E A;  2UYT A;  4DQ8 A;  1YJW N;  1HJO A;  3SMP A;  4CD1 A;  2KKZ A;  5GAE P;  2ITM A;  3CD6 N;  5EY4 A;  3SAH A;  1W2B M;  5BRF A;  2JWL A;  4CZG A;  3LDO A;  1RDW X;  3ENO A;  2E20 A;  1NGA A;  4ISF A;  1TYQ A;  4QS8 A;  3RSE B;  3VGM A;  4A2B A;  3ATU A;  4JKB A;  5ADX A;  1E4F T;  3VEZ A;  2P9N B;  3H1V X;  3GOI A;  4IEE A;  4IJN A;  3TPQ A;  1QZ5 A;  3F9M A;  4FWR A;  5AR0 A;  5BPL A;  2ZJQ L;  1GLB G;  4H5R A;  2P9U B;  2FSK A;  1W97 L;  4GV6 A;  2P9I A;  4XH1 A;  3M6G A;  3DXK A;  3EE9 A;  2QWM A;  3DXM B;  3EZW A;  5H1S Q;  3NMU A;  3TTC A;  4H0Y B;  4KBO A;  4JD2 A;  4WQ5 C;  2FF3 B;  2W40 A;  4A5B A;  4B9Q A;  2NRR A;  5MLC Q;  3P31 A;  3G25 A;  2QW9 A;  3FZM A;  3ULE B;  1SAZ A;  3A5O C;  4KH6 A;  4A57 A;  1VQK N;  1HX1 A;  3I33 A;  5JMV A;  3I56 N;  3CJ9 A;  4WFB L;  4PL7 A;  4ISG A;  1DGK N;  5EVZ A;  3MN7 A;  5M1P A;  5FPE A;  4B1W B;  3WXK A;  2A40 A;  3FGU A;  3LDP A;  3KVG A;  4KH4 A;  1KAZ A;  2QWL A;  1TYQ B;  1BG3 A;  4O5F A;  4NLB A;  2Q1N A;  1YIT N;  3MCA B;  3WXI A;  3HOT A;  3U4L A;  1G99 A;  3IMX A;  1K8A O;  1V4S A;  3LDN A;  3NVK A;  5GIO A;  3HI0 A;  2HOE A;  4JK8 A;  3TSP A;  5LJV A;  4U7B A;  2HBM A;  2ZGY A;  3TSQ A;  1V4T A;  3AGK A;  4FOE A;  2P9I B;  1J6Z A;  3DXK B;  5GIN A;  5BRE A;  4YOW A;  5AQO A;  4L3Q A;  1RDU A;  4IOX A;  1QQN A;  2AP1 A;  4JD2 B;  2D0O A;  2V7Z A;  5BPM A;  2ZWH A;  2YI1 A;  3ZET A;  3I55 N;  3A5M C;  2W41 A;  3M5R A;  4M7X A;  3CC2 N;  4QS7 A;  3CET A;  2FF6 A;  1VQO N;  2BTF A;  4CBU A;  3PIO L;  5AQU A;  4UY8 O;  4BRH A;  4CBX A;  4BRF A;  1T6D A;  3C7N B;  3ID8 A;  3R6M A;  3FZK A;  3DLL L;  4IOC L;  4M63 C;  2ZJP L;  1DKG D;  1NJI O;  4PL8 A;  3CJ7 A;  3KWG A;  1QVG M;  1NBW A;  2HBK A;  2IVP A;  3QFU A;  4RCH A;  3J8A A;  2HST A;  3BUZ B;  2A6A A;  1MWK A;  2BUP A;  3O80 A;  1IJJ A;  4H5W A;  3VEX A;  5AQI A;  2QEX N;  1BU6 O;  5AQN A;  3VEY A;  3QBX A;  1OKJ A;  3IDH A;  5BN8 A;  3MX5 A;  2E1Y A;  3UE5 A;  4BC3 A;  4R79 A;  3VTI A;  3CJC A;  3E66 A;  4A59 A;  3A8Y A;  4H5V A;  2NRT A;  1C0F A;  1NGF A;  2HF3 A;  4BVO A;  4LC9 B;  2QWN A;  1ZBS A;  2HMP A;  3GE1 A;  3N4Q A;  3M3Z A;  5ADX H;  3ZET B;  3J7Z O;  5JVG L;  1QHA A;  1X9J A;  2OTJ N;  1U6Z A;  2YJE A;  3OW2 M;  1VQ4 N;  1T3V A;  2VGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...