3SK3A

Crystal structure of salmonella typhimurium acetate kinase (acka) with citrate bound at the dimeric interface
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
398
structure length
385
Chain Sequence
SKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGGDIDPAIIFHLHDTLGMSVDQINKMLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetate kinase
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
total genus 133
structure length 385
sequence length 398
chains with identical sequence B
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A02
1DGKN 3MN9A 1HKGA 2A5XA 3BP8A 5AQFA 3A8YA 4QS7A 2CGLA 4H5RA 4CZIA 4RCHA 3H3NO 2AA4A 5AQTA 3CJAA 1P8ZA 3VGLA 5KPZA 3DXMB 4BRAA 4I6MB 3A5NC 3G25A 3VEXA 3WQTA 3U8XA 3VGKA 3GE1A 2ASPA 1ATNA 4BC4A 4E1JA 1WUAA 4BVOA 3EL2A 3VEYA 4B1UB 2QW9A 4HWIA 3J8AA 4M7YA 3FZMA 3KVGA 4FOIA 1GLEG 1GLBG 4BRFA 2Q31A 3LDQA 2E88A 2QM1A 3D2EA 4K41A 4A2BA 3ZEUB 4BC5A 3LDNA 4WQ4A 5AQKA 5BPNA 5KPTA 2V7ZA 4CD1A 1IJJA 3W3DA 3VERA 3FGUA 5AQJA 3CQXA 2W40A 4B1ZA 3VF6A 1NWKA 4JNEA 4BQZA 3AARA 1LOTB 3IDHA 5JMVA 3RSEB 3ATVA 3O6WA 1Z05A 3SMSA 3VF2A 2HMPA 3H3OB 3FZHA 1ZC6A 1YXQA 2J4RA 4BRCA 4B1XB 4BRLA 1RGIA 3QMLA 1D4XA 1S3XA 3ENOA 4PKIA 1EQYA 3DJCA 2KHOA 4BG8A 2I7NA 3DAWA 1DEJA 5JLHA 4BVPA 3OHRA 1XUPO 2E20A 2VCPA 4BC3A 3H45C 5JLFA 1TUUA 1RFQA 2CGKA 3O4WA 3EKUA 3SLCA 3HM8A 2QWPA 2A42A 4BRKA 1GLDG 1C0GA 1HUXA 5BN8A 4BREA 4MO4A 4Z94A 1JCEA 2YHXA 3O1WA 2P9LB 4BRDA 3WQUA 4WYBA 3S41A 1NGFA 2E8AA 4BRPA 2FSNA 3ULEA 1ATSA 2IVPA 2ZWHA 2V51B 5ELZA 2P9SA 3D7EO 5AQWA 4CD3A 1NBWA 4FWQA 1NGBA 3LL3A 4FL9A 5AZIB 4H0TB 3M3ZA 3VETA 2P9PA 5I9EB 3WEEB 5B8HA 4ISEA 5TKYA 3LM9A 5BRFA 5AQUA 1XQSC 1XC3A 2ITMA 3MN5A 2YHYA 4BRMA 2P9UB 2A3ZA 3VGMA 4K42A 3AY9A 5AZJA 1J6ZA 2I7PA 1E4GT 2E1ZA 4BRNA 2YJFA 3ZETB 4WQ5C 3DXKA 3TPQA 4WQ4C 4H0VB 4JD2A 4FPAA 3UKUB 4FWSA 5AR0A 2AP1A 2D0PA 1QHAA 3CI5A 2GEMA 4K43A 4BR2A 3QFUA 1T44A 1SAZA 2Q0RA 4CBUA 2Q36A 3HTVA 2V52B 2YHWA 3GDQA 1MWKA 2QXLA 4IXCA 2PAVA 3B8AX 1R59O 3CETA 2GTDA 1BOTO 5AFUH 2BUPA 3VEWA 3ZX3A 2P9KA 3UKRA 1MWMA 5F0XA 1MDUB 1JCFA 3D2EB 4FPBA 2P9NB 3A5OC 4H0XB 3LDPA 2ZF5O 3P4IA 3R6MA 5AQHA 3WXKA 4C23A 3EKSA 3CHWA 3LDLA 4HTLA 3VOVA 4A62A 3F9MA 5EY4A 2V7YA 1GLCG 4BR9A 3VEZA 3VESA 2E2PA 2QWNA 4GY2B 4IZ9A 4XH1A 2ZGZA 3GL1A 1NMDA 4BR0A 3IMXA 5KPRA 4FWOA 5AQOA 4I6MA 3CJ7A 3CQYA 4CBWA 1KXPA 5LY3A 1TUYA 3JS6A 3TU5A 5BR9A 5EVZA 3WXJA 2HF3A 1ZBSA 4A61A 3O5BA 1Y64A 1GLAG 1GLLO 1QQOA 4H5NA 1YUWA 4H0PA 5BRDA 1X3MA 3QBWA 3GG4A 3LDOA 1E4FT 4FWNA 2FXUA 3ZX0A 3FZLA 5LJWA 5AQMA 3QB0A 4CZKA 3BF3A 4PL8A 3ZEUA 4CZEA 4YDUC 2F9TA 1Q18A 1BO5O 1K8KB 2HOEA 1GLJO 2OANA 3ULEB 1KAZA 2D1KA 2CGJA 2P9IB 1BA1A 4CZLA 1T6DA 2GUPA 2FF3B 4XEIA 1HJOA 4DCHA 4NO7A 5F1XA 1GLFO 3ATUA 3ENHA 5EX5A 1Z6RA 1NGHA 4PKGA 1RDWX 5FPNA 3VEOA 4FWRA 3CJ9A 1HX1A 4AM7A 4IWVA 3BF1A 4CBXA 1NM1A 3CIPA 4IO8A 4B1YB 2EWSA 5BPMA 1ESVA 2P9PB 3H1VX 1C0FA 4QS8A 1YVNA 3VPZA 4PL7A 3R9PA 5AFUA 5AQNA 1G99A 2A6AA 3L0QA 4BR4A 4BR7A 3ZX2A 4CI6A 1NGEA 2UYTA 4BG9A 3M6GA 2ASOA 1U2VA 3ID8A 3D2FA 2H3GX 3U9ZA 4BRHA 3UE5A 4H5WA 3I33A 3SJHA 1DKGD 3QDKA 4K25A 3AAQA 2QWLA 4CZFA 4O5FA 4CZGA 1HKBA 1H1VA 4DQ8A 3QBXA 4JD2B 2GWKA 1CZAN 5FPMA 1SQKA 3KHYA 3L6QA 2E2NA 3O1BA 1IG8A 1TYQA 5E84A 1ATRA 3EO3A 2VWBA 3DWLA 2IIRA 3EZWA 1KAXA 4B1VA 4EAHD 2F9WA 2E2OA 4DHYA 2Q1NA 4JHDA 3A5MC 5EXWA 3WUHA 2ASMA 2NLXA 4BROA 5AZIA 3VEVA 1YAGA 2P9KB 3UKRB 1JCGA 2GWJA 4BR5A 3FZKA 1HLUA 2D0OA 4FO0A 5ADXA 5AQQA 2Q0UA 4NB4A 3EN9A 3GBTA 3C7NA 3HZ6A 4FWLA 4BRGA 5BPLA 2PBDA 2YJEA 2P9UA 3IUCA 4BC2A 3MK6A 1HKCA 4BRIA 1SZ2A 1QQNA 2QWRA 3QFPA 2NZTA 4BQLA 1NGCA 3ZETA 2YCHA 4EFHA 4EHUA 3U4LA 4MO5A 3WXLA 3FZFA 2ZGYA 3MN6A 3UKUA 1T6CA 3FLCO 4PKHA 2CH6A 4M63C 5KQDA 5FPDA 5FPEA 4RWTA 1BA0A 3MN7A 3H1QA 5AQXA 3DXMA 3BEXA 5KQ8A 1S22A 5AQLA 4GNIA 2E2QA 1V4TA 2A40A 3SMPA 3GOIA 5AQYA 2Q2RA 1MA9B 5LJVA 3R8EA 4WQ5A 2P9NA 5AQPA 3C0BA 4J8FA 1NGIA 1QZ5A 3CJCA 3SK3A 3O80A 2VYPA 3VENA 4B9QA 1X9JA 5ADXH 2NRHA 4L3QA 4BRQA 4XH4A 4IJNA 4H03B 3JXUA 2FSJA 5BREA 3WXIA 2IVNA 4KBOA 4XH5A 2YI1A 2QWMA 3A0IX 1U6ZA 3H6EA 1BWFO 3I8BA 4MLEA 5AQSA 2W41A 4H0OA 2IVOA 3L4IA 4ISFA 3CERA 3HSCA 5BRHA 2Q97A 4CJ7A 3M1FA 4Y0WA 3AAPA 2P9SB 3CJBA 3IFRA 3RSEA 3FFKB 1BUPA 2D4WA 1NLVA 1KAYA 5CE3A 3CJ1A 1X3NA 2FLOA 2FF6A 4H0YB 1U2VB 3QICA 1BG3A 1NGAA 3D2FB 4ISGA 4CZJA 3A5LC 4FWMA 3H46O 5AQZA 5AQIA 5JICA 3O08A 4M7XA 3HBTA 4DB3A 1NGJA 5E26A 4JAXA 1NGGA 1OKJA 3FR0A 5AZJB 1K8KA 2QWQA 1QQMA 3MMVA 3MCPA 2P9IA 5F2RA 2GELA 3DXKB 4LC9B 1TYQB 3U9DA 1QZ6A 3W0LA 4B1WB 4BGAA 4AM6A 4EIAA 3O8MA 2QWOA 4A2AA 2BTFA 1NGDA 2P9LA 4MLHA 5AQRA 3WT0A 4H5VA 4FSVA 3FE1A 1LCUA 3LM2A 2WUSA 4JHDB 3MDQA 4QS9A 3HI0A 5EOYA 1HPMA 5BN9A 1ZXOA 4IJAA 4FOEA 5AQGA 3KZBA 4FWPA 3C7NB 4YDUA 1BDGA 4JN4A 2FSKA 4CZMA 2HF4A 5AQVA 3BUZB 2E1YA 4FWKA 3UB5A 2CH5A 4CZHA 2DPNA 3WEEA 1V4SA 4RTFD 4BGBA 1WOQA 3VF4A 2A41A 4F9OA 1BU6O 4EHTA 4H5TA 4O8KA
chains in the Genus database with same CATH superfamily
1DGKN 3MN9A 4JI8K 3E01A 2X6NA 4CJ3A 4YOVA 4CJLA 4QS7A 2CGLA 4H5RA 4KHYA 3AA5X 4RCHA 1T3VA 4BRAA 4CJRA 3WQTA 1VK0A 3GE1A 2Y1JA 1HR0K 2ASPA 1ATNA 1N32K 2Z1HA 1SKRA 4BVOA 2QXFA 2HHUA 3T1AA 4B1UB 1L3UA 1OH5A 3J8AA 4M7YA 2HHTA 1GLBG 4BDYA 1RCHA 2E88A 2QM1A 1BI4B 4A2BA 3LP2A 3NAEA 5BPNA 1HYZA 3NBPA 3W3DA 1ASWA 3VERA 1FJGK 4GV3A 2W40A 3F9KA 4DMNA 3VF6A 4JNEA 4CEFA 3IDHA 3MAQA 4ID5A 4OJRA 3ATVA 5E41A 3CFPA 1Z05A 3H3OB 3FZHA 3CFOA 5JVHL 2OTJN 4KKOA 4BRLA 4LFAK 4F8RA 4DV1K 2QTDA 3KTQA 1ASVA 3OS2A 2G8HA 5KRSA 3D0PA 1S3XA 3SV4A 1W0HA 4ELVA 4HCCA 3AO4A 4BG8A 1NKBA 4FJ5A 1DEJA 3DLRA 3OHRA 4CF8A 3QLHA 1S5JA 2VCPA 5JLFA 2OCEA 2GX9A 3PIOL 3HM8A 4CERA 4KRFA 2B6AA 3MEGA 4NYFA 4CEOA 2YHXA 3O1WA 2XY7A 3T7ZA 1KFDA 2QKKA 1X1PA 3CG7A 3KK2A 4WYBA 3S41A 4BRPA 4J2BA 1WAJA 2IVPA 2OPRA 3ZLJA 3V9XA 2V51B 1WN7A 5J1EA 2P9SA 4DLGA 5AQWA 4CD3A 3TSPA 1NBWA 1W97L 5J2QA 4FWQA 3HT3A 5AZIB 2UXBK 2KKZA 4G1QA 2Z1JA 3CYMA 4Y1DA 3CCMN 3J7YP 5B8HA 5KI6A 3IKMA 4DU4A 4Y1CA 5KGXA 5FRNA 4M3ZA 1A5WA 4NXMK 1F21A 4FPAA 3KLGA 3OYLA 1QHAA 4NLCA 3TTDA 4LF9K 1T44A 1T03A 2HMIA 2Q36A 3BZCA 2V52B 2QI2A 2YHWA 3GDQA 2DY4A 4GVEA 2QKBA 3TAFA 5JVGL 1NK5A 3KD5E 4DR4K 2G8FA 1VSHA 1RILA 4B3MK 4DSLA 1D8YA 2P9KA 3QERA 4WFNL 5HBMA 4E7HA 3A5OC 4CHZA 4ELUA 2F4VK 2ZF5O 3WXKA 2E6LA 4NCGA 3EKSA 3CHWA 2ZJPL 4Z4CA 3S3OA 4KAZA 1D9FA 1GLCG 4DS5A 4GMJB 4BR9A 2QWNA 4PA1A 1YTAA 2ZGZA 3GL1A 5CHIA 1NMDA 4CFBA 2XHBA 4AHVA 4HTUA 3TSUA 1C1AA 3C6UA 3SAFA 3AVIA 3OYCA 3DMJA 4DV0K 3ZCMA 3WXJA 1XHZA 1Q7YO 1NMNA 1D5AA 4CEDA 2OTLN 4IOXA 1Y64A 2D0BA 1GLAG 4IEEA 4C8NA 1K6YA 3J7AP 4B3RK 3GG4A 4N41A 1E4FT 3AVKA 4N5SA 1EETA 1HRHA 1KC8O 4FK4A 4N47A 4CZKA 3QB0A 4JI3K 3ZEUA 4PWDA 3Q7BA 4YDUC 2HBMA 1Q18A 3AGRA 4JI2K 4GKJK 1SUQA 4IG0A 1Q82O 1BA1A 1P90A 4CZLA 1T6DA 3KK1A 2FF3B 4DCHA 5F1XA 1NKCA 1OVYA 4KTQA 1KLNA 3HL8A 1S1TA 1Z6RA 3K5OA 1NKEA 4LF7K 4DFJA 2NRRA 1YJWN 4FWRA 3CJ9A 1NM1A 4FM2A 5C12A 3OYGA 1ESVA 5MLCQ 3OBYA 2UUCK 1SKWA 1YVNA 4F4KA 3THYB 4PL7A 5SWMA 2RF2A 3VQ8A 3L0QA 4OO1J 4DTRA 2O4GA 4U67L 4CI6A 4LF4K 1IKXA 5HOOA 1YIJN 1N36K 4FJNA 1EWRA 3QDKA 4CJUA 1TKZA 2JWLA 1VQON 4PQUA 1LV5A 2ZD1A 2D0AA 3F73A 4IO9L 2GWKA 1CZAN 4CEAA 3AA3A 3EE9A 3SQ2A 1SQKA 3KHYA 3VQ4A 3L6QA 2E2NA 5J2PA 1IG8A 1ATRA 2VWBA 3DWLA 4FLUA 1KAXA 3ULDA 1RBTA 4C8KA 2VGMA 1M1KO 2NLXA 4W5QA 1NK4A 4BROA 3VEVA 3UKRB 1HLUA 5ADXA 4X66K 5AQQA 4EZ9A 4NB4A 3GBTA 4DR5K 1ZBUA 4DR6K 5GIOA 3IUCA 4CIEA 3SV3A 4LSNA 1QQNA 4ILJA 3AVHA 3QFPA 4Z4GA 4Z0UA 1NG9A 1NGCA 4EFHA 4EHUA 5KRTA 4QAGA 1ZYQA 3O3GA 4MO5A 2YV0X 1NOYA 3CD6N 4CJQA 3FZFA 2ZGYA 3MN6A 1JLGA 1T6CA 2JGUA 4DKWA 5KQDA 4RWTA 5M1FA 5AQXA 2ETJA 1EO1A 2IDOA 1S22A 5AQLA 3OJSA 4GNIA 2E2QA 4DF8A 5AQYA 3PIPL 4LH4A 3JYTA 4JKHA 1JLAA 4WQ5A 1RTHA 3DOKA 4J8FA 1S1XA 1QZ5A 3NGZA 3RRHA 5HRPA 4B9QA 3ZT0A 5ADXH 4BRQA 2HHSA 1VSEA 4XH4A 4DR1K 4JI1K 3HM9A 3JXUA 2W6LA 3O4QA 3BDPA 1BI4A 1VSMA 3SBTA 3AO2A 3A0IX 1U6ZA 3I8BA 5GIPA 1TL1A 3QNNA 2ZM6K 4KI6A 3E1YA 5IT9O 3HSCA 3NVKA 5BRHA 4CJ7A 4Y0WA 3KKSA 3L2WA 4WCEL 3NF7A 5H1SQ 2P9SB 3CJBA 4RW6A 4NCBA 4OKEA 3LZJA 1NLVA 1KAYA 5IWAK 2RN2A 2FF6A 4JKAA 1XMOK 1VRUA 2VGNA 4H4OA 4CVNE 4CZJA 3H46O 4DB3A 4KB1A 1NGJA 4JAXA 1BL3A 3FR0A 4Q5VA 3NGYA 2P9IA 4DTXA 1TYQB 1VQPN 1QZ6A 4LSLA 3IAYA 4WE1A 3OYMA 3O8MA 4CF1A 4W5TA 1NGDA 2VQEK 4OLAA 4FZXC 4BDZA 4FYDA 4CEQA 3MDQA 3HI0A 4DF4A 4DTMA 1Z26A 1L5UA 3ZYYX 3OYFA 1ZXOA 4AH9A 3THXB 2FBTA 5C0YA 3E9LA 4FOEA 1T7PA 3KZBA 3KK3A 3C7NB 4CJEA 1BDGA 4DTNA 2HF4A 5AQVA 5HRNA 4DSKA 4CZHA 3TTCA 1V4SA 1WSGA 3VF4A 3QIOA 4F9OA 4EHTA 4AF1A 2E5LK 4KHPK 1BGXT 1HKGA 3P39A 3A8YA 1EXQA 2HBKA 3NF8A 4OPAA 5DMRA 1QTMA 3H3NO 3CCLN 2B4JA 3T1HK 1HNZK 1SL0A 3VGLA 5KPZA 4E89A 3A5NC 3VQ9A 3VGKA 4W5OA 3RMBA 4BC4A 4J2AA 1WUAA 3MCAB 2OZSA 2O8EB 1RT1A 3VEYA 1W2BM 3S9HA 3PX0A 1WBDA 2RPIA 2FC0A 4MDBA 3O9QA 4O0IA 4JRQA 3VQ7A 3KVGA 3DI6A 3SAHA 4BRFA 4IEIA 1CXUA 4GW6A 4K41A 1RDCA 3ZEUB 5AQKA 1JKHA 4OKKA 3ZT4A 2KFNA 1U4BA 5AQJA 4CHPA 1LW2A 1NWKA 4CFAA 4CGDA 1NK6A 4BQZA 2KFZA 4I7FA 3VQCA 2KZZA 5HLFA 3PSIA 3SMSA 4FZZA 3ID6A 5GADP 1I94K 4B1XB 5CYMA 2G8VA 2ZJQL 4C1NI 3OBWA 1IBLK 1IKWA 4B3SK 1EQYA 3DLBA 3QETA 4X65K 3DAWA 3LP3A 1SKSA 4BC3A 4IOAL 2CGKA 4B3TK 3NF9A 4EP4A 4M3UA 4CJSA 3O9SA 1GLDG 3NH0A 3L2RA 5BN8A 1XI1A 1JLFA 2UXCK 4F2SA 4RW4A 3VQ5A 1U04A 4W5RA 1ATSA 2ZWHA 1QS4A 2FBXA 4RG8A 3HPGA 1WSIA 4YHHK 3SQ0A 5J2MA 4LF8K 1BCOA 2ATQA 1RBSA 5C10A 3PV8A 3LL3A 1RBVA 3PO4A 4B9SA 5I9EB 3WEEB 1WSHA 4ISEA 3THYA 2QK9A 5AQUA 2YHYA 4BRMA 2A3ZA 1E3MA 1J53A 3OW2M 2X74A 4K42A 3WNEA 2HHXA 4PUOA 4WQ5C 2WBNA 3J81O 2A1RA 4FJJA 2VG6A 3AVGA 1KVBA 1FW6A 4IG3A 4JI4K 3OYNA 5HROA 4K43A 3QFUA 1TAUA 3RR8A 1K73O 1MWKA 2QXLA 3E9PA 3KWIA 3MXIA 1S1WA 3BY5A 2IS3A 1FK9A 4YOYA 2GTDA 1BOTO 4DV2K 1YI2N 3U3YA 1DLOA 4A59A 2PZSA 3ZX3A 3UKRA 4BE2A 3TAGA 3D2EB 3LPTA 5CYQA 3DLGA 3LDPA 4DU1A 1JL1A 3P4IA 3CC4N 3LAMA 2DFFA 4ILGB 2KW4A 1O13A 3HVTA 2V7YA 3VTIA 3SUPA 4AHCA 2PYLA 3VESA 3PSFA 3QEIA 2GV9A 4I2QA 5KPRA 4FWOA 4I6MA 3CJ7A 4CF2A 3OVNA 5A2QO 4CF0A 5LY3A 3DLHA 4M45A 3TSQA 4NLBA 5CR4A 1KVCA 5K14A 2HF3A 1HQEA 1ZBSA 3KK7A 5KGWA 3TAEA 1IBMK 4DTPA 5M1OA 5BRDA 4FWNA 2HHVA 3ZX0A 5LJWA 3SCXA 3BF3A 5M1QA 4AQYK 4CZEA 4FLTA 3C6HA 2F9TA 2HOEA 4DTUA 1KAZA 3HRGA 3I8DA 2P9IB 3VQAA 1BQNA 1RTDA 2O8BB 4XEIA 1HJOA 1VHXA 1U45A 4EP5A 3G10A 1GLFO 4IFEA 4JV5K 2Z1IA 3MX2A 4F2RA 4CW7B 3M8PA 1WB9A 3BF1A 4UY8O 4CBXA 4AHTA 2XY5A 4IO8A 2EWSA 2PFUA 2P9PB 5BR8K 3R9PA 1G99A 2A6AA 4BR7A 4BR4A 1N33K 1K8AO 5EU7A 1NGEA 3M6GA 1C0MA 3PLAA 1RT6A 3ID8A 4I9LA 3RR7A 3SYZA 4O44A 1RDBA 1QSYA 5FPMA 1HYVA 1X9MA 4MQ3A 4MDAA 4LF6K 4DUYK 1SV5A 2Q3SA 3O1BA 4DTSA 3AVMA 1TYQA 3KLFA 4FW2A 2HNDA 2G8KA 2IIRA 4EAHD 2BH1A 3K2PA 2F9WA 2E2OA 5FRMA 4DSIA 4RW7A 1CZBA 4R5PA 2E6MA 1EX4A 1C1BA 3FZKA 3THXA 1UWBA 5GAGP 4CECA 3RTVA 4CE9A 3HZ6A 3C7NA 1EKEA 2PBDA 1JLEA 2P9UA 2RHKA 3EEQA 4BRIA 4FK0A 1SZ2A 4BQLA 4Z4EA 3ZETA 2YCHA 3MWTA 1JLCA 1S6QA 4BDPA 3UKUA 4CEEA 3QINA 2OPPA 3VMFB 4M63C 4CFCA 3PUFA 4N56A 4C8MA 3NVMA 2ITGA 4ZTJA 1XC9A 1C6VA 1CZ9A 1QE1A 1S9EA 3LZIA 1FXXA 3GOIA 3K59A 2Q2RA 4KHQA 2O8EA 3AVBA 5CY4A 4CEZA 1W9HA 3ISNC 2P9NA 5AQPA 1NGIA 4DQQA 2O4IA 3LP1A 5C25A 2BDPA 2NRHA 4L3QA 4IJNA 1TK8A 3CCRN 3EY1A 3O9UA 3WXIA 4X62K 4FVMA 4FXDA 1ITGA 4O4GA 3RMDA 4E1MA 3H6EA 2NRZA 5AQSA 4ID1A 4H0OA 5DM6L 2IVOA 1KRPA 3L2VA 1EP4A 4FCYA 3CMAN 3AAPA 1VSLA 2NRWA 3O9RA 2YHBA 2B5JA 3FFKB 4YOUA 1BUPA 1WBBA 4LFCK 4CHQA 3CJ1A 1X3NA 4JYAK 4H0YB 1U2VB 3LWLA 3VQQA 4JI0K 1DT9A 4CJPA 3MXJA 3ZT2A 3AVLA 1HMVA 3A5LC 3CM5A 4B9TA 5AQZA 1KFSA 3MECA 3O08A 3HBTA 1UA1A 3EYZA 2KTQA 2HBLA 5E26A 4G9ZA 1XNRK 1OKJA 4JI7K 3N4QA 1RTJA 2QWQA 1J5OA 3ASMA 4DQSA 1LWFA 5F2RA 4DFKA 4OX9K 3U9DA 3WXMB 1X9WA 4B1WB 1TV6A 4BACA 3MXMA 1Q86O 4DSJA 3S3MA 3MEEA 4JK9A 4JHDB 1HQUA 1I39A 4BE0A 1HPMA 4DTJA 3V81A 1QHTA 5C15A 3L4QA 4FWPA 4C8LA 3LPUA 3C94A 4JN4A 2FSKA 2NRXA 3HOTA 3CCJN 4B9VA 2E1YA 3K5NA 2CH5A 4DTOA 3WEEA 4BGBA 3NH2A 4OPJA 2HHQA 3V1QA 4O8KA 3CPWM 1N8RO 1IO2A 4F3OA 2IGIA 5AQFA 2VG5A 4JKDA 2XY8A 4YORA 3ZSZA 2AA4A 2HB5A 4CJTA 3V9WA 4FLXA 3DXMB 4I6MB 3S3NA 3DM2A 3VEXA 1ILYA 3KLIA 3U8XA 1TGOA 3FFIA 3OYAA 3EL2A 2D5RA 5LL6Z 2QW9A 3RWUA 4E7KA 4HWIA 1BHLA 5M1KA 5J2NA 4GV6A 1GLEG 3SPYA 3D2EA 3CCVN 3AVCA 3OA9A 1T8EA 2ZJRL 2V7ZA 1IJJA 4CIGA 4NXNK 4M42A 4B1ZA 2EHGA 3TABA 1REVA 3AARA 1LOTB 5JMVA 4CK3A 3OJUA 2YNGA 3O6WA 3CC7N 3VF2A 2HMPA 4E1NA 1L3VA 1S6PA 2QA4N 4QOZB 1YXQA 2J4RA 1IG9A 1RGIA 4M3RA 2NUBA 1NJYA 4K8XA 4PKIA 3I0RA 2KHOA 3HJFA 4JS5A 4Z4IA 3QEXA 5JLHA 3SQ1A 2P1JA 4BVPA 1ASUA 2E20A 3EE8A 1TUUA 3AGKA 1JLQA 2NRVA 3P5JA 5HL7L 1RFQA 3WNFA 1B92A 2OZMA 2BGGA 4FM0A 4FLZA 3SLCA 1VQ4N 2A42A 4BRKA 4E7IA 4AILC 3I0SA 4H4MA 1WNSA 4KB0A 4KPYA 4BREA 1BIUA 4MO4A 3NMUA 1JCEA 4BRDA 3WQUA 1S72N 3ZSVA 2O8BA 1Q81O 1QVFM 3WNGA 3D7EO 4HUFA 5T7BA 3TAQA 3OYBA 2PY5A 3QEPA 4B08A 3NDKA 2P9PA 3HXMA 5TKYA 3LM9A 4OGEA 5BRFA 4CHOA 4DG1A 1XQSC 2ITMA 2P9UB 4E7LA 1YJNN 3MX5A 3MWPA 3AY9A 3LAKA 2DFEA 1J6ZA 2I7PA 4DFMA 4BRNA 3ZETB 3DXKA 3VA0A 1VQ9N 4WQ4C 4H0VB 1L3TA 3UKUB 3NHGA 4FWSA 2AP1A 3PX4A 4DSFA 3CMEN 4BR2A 3TTFA 3HTVA 3OS0A 4B9NA 3Q7CA 1TVRA 4B3OA 3CETA 4HUEA 3VTHA 2HNYA 5AFUH 4DR2K 2Z1GA 3PY8A 3LDSA 3VEWA 5C2DA 1U48A 1MWMA 1MDUB 1NNEA 2P9NB 5HRRA 4H0XB 4CJWA 3A2FA 1WSEA 3LDLA 4HTLA 1IV0A 1QSSA 2F8TA 3F9MA 4UQGA 5EY4A 3AO1A 2IC3A 2KLAA 2QEXN 2UXDK 3VEZA 4CHNA 4FJKA 4Z4FA 4GY2B 4IZ9A 2FBYA 3VQDA 4B8CA 3HO1A 3CQYA 3KD1E 2BANA 4CBWA 4PY5A 4CCHA 5BR9A 3R3LA 5EVZA 3P83D 4DFPA 4IBNA 4M3TA 3J80O 4A61A 3IG1A 3K57A 3O5BA 5GAHP 3V4IA 1GLLO 1TKTA 1QQOA 2VG7A 1YUWA 4H0PA 3CM6A 3CCUN 1HNWK 4O0JA 1QQCA 3LDOA 2WOMA 2FXUA 1ZBIA 3FZLA 4M41A 3TAMA 4HHTA 4AHUA 4JI5K 1BQMA 1VSIA 4OGCA 5M1PA 4FJIA 1I3AA 2YKMA 1GLJO 2OANA 3O4NA 3ULEB 2D1KA 2WC9A 1OVQA 1IKYA 3TWHA 3ATUA 5EX5A 4JLHA 1NGHA 3AO3A 4PKGA 2UUAK 1RDWX 4K0KK 3V1OA 4AM7A 2DTUA 1XMQK 3THWA 4JKFA 1G15A 3CIPA 4B1YB 2VQFK 2ZE2A 4GV9A 4ZTFA 3H1VX 2YKNA 4QS8A 1JXBA 5AQNA 1GOCA 4CFDA 3ZX2A 4KV8A 3C6TA 2UYTA 1WSJA 4BY9C 3LP0A 1U2VA 2H3GX 3U9ZA 4DS4A 4BRHA 3K58A 2O8CB 3SJHA 1DKGD 1MU2A 1K9MO 3OYHA 4CZFA 3V9ZA 4O5FA 4CZGA 1HKBA 4JD2B 4CESA 4YOTA 4LFBK 2YNHA 1T05A 5HRSA 4JS4A 5TKWA 1SL2A 4CJKA 2HHWA 4CJFA 1HNXK 1N34K 3J7ZO 3KJVA 5FDLA 3TR8A 5E84A 3AA2A 4ICLA 3NGIA 2OPQA 1DTQA 1LAVA 4B1VA 1N6QA 2P5GA 1IH7A 1O1WA 2Q1NA 1KLMA 4JHDA 1WSFA 4AHRA 5EXWA 3WUHA 4YNQA 3OYDA 4FW1A 4QCLA 4ILHA 1RT2A 2D0OA 3HP6A 3HP9A 2HW3A 1CXQA 1YHQN 2Q0UA 4FWLA 4DQIA 1HNIA 2YJEA 3DLEA 4BC2A 4KREA 1HKCA 4JK8A 4DV3K 4NCAA 2QWRA 2NZTA 1ZBFA 1NJXA 2DFHA 1S1VA 5HP1A 3LWMA 1IBKK 1B9DA 3U4LA 4A5AA 1VQLN 1IKVA 5KTQA 3WXLA 3FLCO 5FROA 2CH6A 3SAGA 4DR3K 5FPDA 5FPEA 2O8DB 1BA0A 3MN7A 2GBZA 3H1QA 3DXMA 2O8FA 3BEXA 3CCSN 3OS1A 4F3TA 1JLBA 1KQSM 5GINA 2JWKA 3L2QA 2NNWA 1M90O 2A40A 3SMPA 3T19A 1VQ7N 1NJIO 5JS2A 1RBUA 1MA9B 5M1NA 5LJVA 3R8EA 3E66A 3CF5L 1NK0A 3C0BA 3KIOA 5SZTA 4CGIA 3HPHA 3CFRA 2VYPA 4CJVA 3OYKA 2HBJA 3NF6A 4H03B 4IDKA 5BREA 2HHHK 3O9TA 4U7BA 2KZMA 4YFUA 3OYEA 3DLLL 4KBOA 4XH5A 3K9JA 3ZSWA 1YT3A 4J2EA 1HNVA 2W41A 4DU3A 3CERA 5CZ2A 1BIZA 3M1FA 4FLYA 3TAPA 1ZBHA 3IFRA 2RKIA 4KO0A 3ZSRA 1Q9YA 4LH5A 4RW9A 3I56N 4IOCL 2F7TA 1BG3A 3D2FB 4ISGA 4LF5K 1Q9XA 3L3UA 2XY6A 4FWMA 1RDUA 4JK7A 5AQIA 5JICA 1XNQK 4M7XA 4FJHA 3VQPA 1NGGA 4Z4HA 1K8KA 1QQMA 1WAFA 4I2PA 3DXKB 2VWJA 3R1XA 4FVUA 4BGAA 3OTOK 2Y1IA 4A2AA 3KLHA 3NFAA 4MLHA 1LWEA 3AVJA 3FE1A 1SS6A 1LCUA 2I5JA 3LM2A 4QS9A 1JXEA 3SJJA 5EOYA 5BN9A 5JS1A 3P31A 4OPHA 4CGHA 3MEDA 4W5NA 5AQGA 1Y97A 1YITN 3OYIA 1OH6A 3PO5A 3BUZB 3P1GA 4FWKA 3UB5A 4JKGB 5C24A 2DPNA 1LW0A 2EX3A 1WOQA 2YHAA 3ITHA 1FKPA 2A41A 4JKCA 1NK9A 4O8UA 4H5TA 3ZSYA 3IRXA 1VSJA 2A5XA 3L2UA 3BP8A 5DM7L 1RNHA 4CZIA 4CJ4A 1SL1A 5AQTA 3CJAA 4I9QA 1P8ZA 3CXCM 3THVA 4FJ8A 1KVAA 4M3WA 3M8SA 3G25A 3UIQA 4FJLA 4AHSA 1N5YA 1HYSA 2F96A 4FJ9A 4E1JA 1VQKN 4B8AB 4FLVA 3O3HA 3K5LA 4BWMA 1VQ6N 4WFBL 2XO7A 3RMAA 4B9MA 4DUZK 3FZMA 1J5EK 4FOIA 1B9FA 1VSFA 1YJ9N 2Q31A 3HYFA 3LDQA 4BC5A 4KHNA 4GKKK 1GOBA 3LDNA 4WQ4A 5KPTA 4CD1A 3I55N 3L3VA 4RW8A 4R79A 3FGUA 3CQXA 3TARA 5LMUK 1NJWA 3G0ZA 1RBRA 3F5TA 4IFYA 1RTIA 3RSEB 1ZBLA 3G71N 2W42A 3LANA 4BE1A 3KKRA 1ZC6A 3QNOA 4BRCA 3THWB 3QMLA 4M3YA 4OKJA 4E19A 1D4XA 3SUOA 4H8KA 3ENOA 3DJCA 3VN5A 2I7NA 1U49A 1VQ5N 1XUPO 3H45C 3HSTB 3HPOA 3O4WA 4CF9A 3D6RA 4B9UA 3EKUA 4PHTX 2QWPA 3SI6A 4KHWA 2A1SA 4K8ZA 3AVNA 3U3GA 3DOLA 1C0GA 2KQ2A 4GVMA 1HUXA 3V9UA 1UAXA 4Z94A 4DV6K 1HJRA 2P9LB 2LSNA 4LY7A 4DSEA 1UA0A 1NGFA 2E8AA 2FSNA 3ULEA 3L8BA 4KTWA 2FBVA 1VAZA 2BE2A 5ELZA 3B6PA 1XHXA 4KI4A 4FK2A 1NGBA 4FL9A 3ZSOA 2WFBA 4MFBA 4H0TB 3M3ZA 2ZQBA 5FLXO 4KFBA 1RDDA 3AVAA 3VETA 3AO5A 1XC3A 3MN5A 2OYQA 3VGMA 3ZT1A 4FJXA 3ZSXA 4ZHRA 5AZJA 3CCEN 4DV5K 1E4GT 2E1ZA 2O8CA 2YJFA 4OVLA 3SUQA 3TPQA 4KH5A 4JRPA 1A5VA 1Q8IA 2WONA 4JD2A 1NK8A 1TAQA 3C65A 4BWJA 5AR0A 2D0PA 3CI5A 3EZ5A 4CGJA 2GEMA 4FZYA 4C8OA 3DRRA 1SAZA 2Q0RA 4CBUA 4A5BA 1TK5A 3AVFA 2O8FB 1VRTA 4IXCA 2PAVA 3B8AX 3SZ2A 1R59O 2F8SA 1EWQA 3U6FA 2JLEA 2P51A 5C2FA 3AA4A 3HVRA 2BUPA 2W6KA 1Z25A 5F0XA 1JCFA 4FPBA 1CLQA 4KTZA 4HVJA 4OPKA 2YNIA 3R6MA 3CCQN 5AQHA 4C23A 1U47A 4FJ7A 3WNHA 1JJ2M 3VQ6A 1KTQA 1RDAA 3M8RA 1QSLA 3VOVA 3JAMO 4A62A 1NOZA 1TL3A 4EZ6A 3M8QA 2E2PA 4XH1A 4BR0A 3M5RA 3IMXA 5AQOA 2NRTA 4DR7K 5D3GA 4ELTA 4JI6K 1KXPA 1TUYA 3JS6A 3ZT3A 3TU5A 2IOCA 2O8DA 1XWLA 3SNNA 4X64K 2OPSA 4IDHA 4V19S 4H5NA 4HUGA 1X3MA 2X78A 3QBWA 1DTTA 2WTUA 1NK7A 3DRPA 3PX6A 5AQMA 4PL8A 3NE6A 2RE2A 1BO5O 1K8KB 1VQNN 3TI0A 3N4PA 2CGJA 2GUPA 1TKXA 4NO7A 1S9GA 3ENHA 1OH8A 5FPNA 3VEOA 1HX1A 4IWVA 3TANA 1W7AA 3AV9A 1YVUA 5BPMA 1C0FA 3VPZA 3P38A 5AFUA 3C95A 1QVGM 1BCMA 2G8UA 3V6DA 4BG9A 4FLWA 4DQPA 4YOWA 2ASOA 3DYAA 3D2FA 1S1UA 3UE5A 3NCIA 4H5WA 3I33A 4K25A 1VQ8N 1RT4A 3AAQA 2QWLA 3CPEA 3VA3A 4B9LA 3KWGA 4FJGA 4LD0A 1H1VA 4DQ8A 3ALYA 4CJ5A 3QBXA 3C6AA 3ZSQA 4JKBA 4JKEA 1BISA 4Q0BA 4KH4A 1TK0A 1A5XA 3EO3A 2GUIA 1KD1O 4M3XA 3EZWA 3NH1A 1C0UA 1R0AA 3IS9A 5C42A 4DHYA 4WFAL 4XIUA 3QEVA 3A5MC 3BGRA 4IKFA 2ASMA 1GOAA 3B6OA 4IFVA 3SUNA 5AZIA 2G8IA 1YAGA 2P9KB 4BR5A 1JCGA 2GWJA 2R7YA 3QEWA 4FO0A 2VWKA 3SBGA 3T1YK 3EN9A 5BPLA 4BRGA 4O5BA 4JEPA 3MK6A 4C1NK 2IAJA 3K0SA 1KSPA 4NYNA 5I3UA 4JKGA 3QIPA 3VQBA 3LALA 3G4SN 1NU0A 4DWIA 1X9SA 4PKHA 3O3FA 3K9KA 3JSMA 2AJQA 4YY3K 1VSKA 5KQ8A 4KHUA 4FJMA 1LAWA 3SQ4A 1V4TA 2UU9K 2XRIA 3RRGA 1FKOA 2YNFA 4DV4K 3T3FA 1C0TA 3E9OA 1VSDA 2P5OA 3BZKA 1WLJA 1J54A 4DQRA 3T69A 3CJCA 3SK3A 3O80A 3VENA 1NJZA 4YOXA 4KHSA 1X9JA 3QESA 2YX6A 2G8WA 2FSJA 4CIFA 4E7JA 2IVNA 3DRSA 4WF9L 1RT3A 2YI1A 2QWMA 1D9DA 4E0DA 1BWFO 4MLEA 4CK1A 1OH7A 4TSXA 4J2DA 3L4IA 4ISFA 4OLBA 2PYJA 2Q97A 2HNZA 3CC2N 5AJ3K 4CGFA 3RSEA 1TKDA 1RT7A 3DLKA 5LMNK 2D4WA 1KCFA 1RT5A 5CE3A 5I42A 3HK2A 3VQEA 4CHYA 2FLOA 3QO9A 3QICA 3G6EN 3D45A 1NGAA 4KH6A 5GAEP 4L8RB 3OYJA 2HSTA 3H08A 4DLEA 3ENBA 3OY9A 4CGGA 4N76A 1J9AA 5AZJB 3RMCA 1UOCA 3MMVA 3MCPA 5CZ1A 2GELA 3SPZA 4LC9B 2X6SA 1HPZA 4A57A 4CEBA 3W0LA 3RVCA 3V9SA 4AM6A 4EIAA 2QWOA 3K5MA 1LWCA 2BTFA 2P9LA 5AQRA 3WT0A 4H5VA 4FSVA 2E4LA 3F2KA 2WUSA 1YF5L 2UUBK 1JL2A 3V1RA 2HVIA 3CQ8A 5DK5A 4IJAA 4YDUA 1L3SA 1VQMN 2HVHA 3HOSA 4CZMA 4HCBA 3KLEA 4CK2A 4DV7K 4FM1A 4RTFD 4O55A 4E3SA 1BU6O 2OA8A 1YTUA 1C1CA 2D0CA
chains in the Genus database with same CATH topology
1DGKN 1N8RO 3MN9A 1HKGA 2A5XA 3BP8A 3P39A 5AQFA 5DM7L 4JKDA 3A8YA 4YOVA 2HBKA 4QS7A 2CGLA 4H5RA 4OPAA 4CZIA 4RCHA 4YORA 3H3NO 3CCLN 2AA4A 5AQTA 1T3VA 3CJAA 1P8ZA 3VGLA 5KPZA 3CXCM 3DXMB 4BRAA 4I6MB 3A5NC 3G25A 3VEXA 3WQTA 1ILYA 3U8XA 3VGKA 3GE1A 2ASPA 1ATNA 4BC4A 4E1JA 1WUAA 1VQKN 3MCAB 4BVOA 3EL2A 3VEYA 1W2BM 4B1UB 1VQ6N 4WFBL 2QW9A 4MDBA 3O9QA 4HWIA 3J8AA 4M7YA 3FZMA 3KVGA 5M1KA 4FOIA 4GV6A 1GLEG 1GLBG 3SAHA 4BRFA 1YJ9N 2Q31A 3LDQA 4IEIA 2E88A 2QM1A 3D2EA 4K41A 4A2BA 3CCVN 3ZEUB 4BC5A 3OA9A 3LDNA 4WQ4A 2ZJRL 5AQKA 5BPNA 5KPTA 2V7ZA 4CD1A 3I55N 1IJJA 3W3DA 3VERA 4R79A 3FGUA 5AQJA 3CQXA 4GV3A 2W40A 4B1ZA 3VF6A 1NWKA 4JNEA 4BQZA 3AARA 1LOTB 3IDHA 5JMVA 3F5TA 3RSEB 3ATVA 3CC7N 3O6WA 3G71N 1Z05A 3SMSA 3VF2A 2HMPA 3H3OB 3ID6A 3FZHA 5GADP 5JVHL 1ZC6A 2QA4N 2OTJN 1YXQA 2J4RA 4BRCA 4B1XB 4BRLA 1RGIA 3QMLA 2ZJQL 4C1NI 3OBWA 2QTDA 1D4XA 1S3XA 3ENOA 4PKIA 1EQYA 3DJCA 2KHOA 4BG8A 2I7NA 3DAWA 1DEJA 5JLHA 1VQ5N 4BVPA 3OHRA 1XUPO 2E20A 2VCPA 4BC3A 3EE8A 3H45C 5JLFA 1TUUA 3AGKA 4IOAL 5HL7L 2NRVA 2GX9A 1RFQA 3PIOL 2CGKA 3O4WA 3D6RA 3EKUA 3SLCA 3HM8A 4PHTX 1VQ4N 2QWPA 2A42A 3O9SA 4BRKA 1GLDG 1C0GA 1HUXA 5BN8A 4BREA 3NMUA 4MO4A 4Z94A 1JCEA 2YHXA 3O1WA 3T7ZA 2P9LB 4BRDA 3WQUA 1S72N 4WYBA 3S41A 1NGFA 2E8AA 4BRPA 2FSNA 3ULEA 1ATSA 2IVPA 2ZWHA 2V51B 1VAZA 1Q81O 5ELZA 1QVFM 2P9SA 3D7EO 5AQWA 4CD3A 3TSPA 1NBWA 1W97L 5C10A 4FWQA 1NGBA 3LL3A 4FL9A 2WFBA 5AZIB 4H0TB 2KKZA 3M3ZA 3VETA 3CCMN 2P9PA 5I9EB 3WEEB 5B8HA 4ISEA 5TKYA 3LM9A 5BRFA 5AQUA 1XQSC 1XC3A 2ITMA 3MN5A 2YHYA 3IKMA 4BRMA 2P9UB 2A3ZA 3VGMA 1YJNN 3MX5A 3OW2M 3MWPA 4K42A 3AY9A 5AZJA 3CCEN 1J6ZA 2I7PA 1E4GT 2E1ZA 4BRNA 2YJFA 3ZETB 4WQ5C 3DXKA 3TPQA 4KH5A 2WBNA 1VQ9N 4WQ4C 4H0VB 4JD2A 4FPAA 3UKUB 4FWSA 3C65A 5AR0A 2AP1A 2D0PA 3CMEN 1QHAA 3CI5A 4NLCA 2GEMA 4K43A 3TTDA 4BR2A 3QFUA 1T44A 1SAZA 3TTFA 2Q0RA 4CBUA 2Q36A 3HTVA 4A5BA 2V52B 2QI2A 2YHWA 3GDQA 1K73O 1MWKA 2QXLA 3E9PA 3KWIA 4GVEA 4IXCA 2PAVA 3B8AX 3Q7CA 5JVGL 1R59O 3CETA 3VTHA 4YOYA 2GTDA 5C2FA 1BOTO 5AFUH 1YI2N 4A59A 2BUPA 3VEWA 5C2DA 3ZX3A 2P9KA 3UKRA 1MWMA 4WFNL 5F0XA 1MDUB 1JCFA 3D2EB 4FPBA 2P9NB 3A5OC 4H0XB 3LDPA 2ZF5O 3P4IA 3R6MA 3CC4N 5AQHA 3WXKA 4C23A 3CCQN 1JJ2M 3EKSA 3CHWA 2ZJPL 4ILGB 3LDLA 4HTLA 3VOVA 1O13A 4A62A 3F9MA 5EY4A 2V7YA 3VTIA 1GLCG 2KLAA 2QEXN 4BR9A 3VEZA 3VESA 2E2PA 2QWNA 4GY2B 4IZ9A 4XH1A 2ZGZA 3GL1A 5CHIA 1NMDA 4BR0A 3M5RA 3IMXA 5KPRA 4FWOA 5AQOA 4I6MA 2NRTA 3CJ7A 3CQYA 4CBWA 3TSUA 1KXPA 3SAFA 5LY3A 1TUYA 3JS6A 3TSQA 3TU5A 5BR9A 4NLBA 3R3LA 5EVZA 5CR4A 3WXJA 1Q7YO 2HF3A 1ZBSA 4A61A 3KK7A 2OTLN 3O5BA 1Y64A 4IEEA 1GLAG 4IOXA 5GAHP 1GLLO 4IDHA 1QQOA 4H5NA 1YUWA 4H0PA 5M1OA 3CCUN 5BRDA 1X3MA 3QBWA 3GG4A 3LDOA 1E4FT 4FWNA 1KC8O 2FXUA 3ZX0A 3FZLA 5LJWA 5AQMA 3QB0A 4CZKA 3BF3A 4PL8A 5M1QA 3ZEUA 3Q7BA 4CZEA 4YDUC 2RE2A 3C6HA 3AGRA 2F9TA 2HBMA 1Q18A 5M1PA 1BO5O 1K8KB 2HOEA 1VQNN 1GLJO 2OANA 3ULEB 1KAZA 3HRGA 3N4PA 1Q82O 2D1KA 2CGJA 2P9IB 1BA1A 1P90A 4CZLA 1T6DA 2GUPA 2FF3B 4XEIA 1HJOA 4DCHA 4NO7A 2WC9A 5F1XA 1OVYA 1GLFO 3ATUA 3ENHA 4IFEA 5EX5A 1Z6RA 3MX2A 1NGHA 4PKGA 2NRRA 1RDWX 1YJWN 5FPNA 3VEOA 4FWRA 3CJ9A 1HX1A 4AM7A 4IWVA 3BF1A 4UY8O 4CBXA 1NM1A 4JKFA 3CIPA 4IO8A 5C12A 4B1YB 4GV9A 2EWSA 2PFUA 1ESVA 5BPMA 2P9PB 3H1VX 3OBYA 1C0FA 4QS8A 5MLCQ 1YVNA 3VPZA 3P38A 4PL7A 3R9PA 5AFUA 1QVGM 5AQNA 1G99A 2A6AA 3L0QA 4BR4A 4BR7A 3ZX2A 1K8AO 4OO1J 4U67L 4CI6A 1NGEA 2UYTA 4BG9A 3M6GA 3PLAA 5HOOA 4YOWA 2ASOA 4BY9C 1U2VA 3ID8A 3D2FA 2H3GX 3U9ZA 4BRHA 3UE5A 1YIJN 4H5WA 3I33A 3SJHA 1DKGD 3QDKA 4K25A 1K9MO 3AAQA 3CPEA 2QWLA 1VQ8N 4CZFA 2JWLA 4O5FA 1VQON 3KWGA 4CZGA 1HKBA 1H1VA 4DQ8A 3QBXA 4JD2B 4YOTA 4IO9L 2GWKA 1CZAN 5FPMA 3C6AA 3EE9A 1SQKA 4JKBA 5TKWA 4MDAA 3KHYA 4JKEA 3L6QA 2E2NA 3O1BA 3J7ZO 4KH4A 1IG8A 1TYQA 5E84A 1ATRA 3EO3A 2VWBA 1KD1O 3DWLA 2IIRA 3EZWA 1KAXA 4B1VA 4EAHD 2BH1A 2F9WA 2E2OA 4DHYA 2Q1NA 4WFAL 4JHDA 2VGMA 3A5MC 1M1KO 5EXWA 3WUHA 2ASMA 2NLXA 4BROA 5AZIA 3VEVA 1YAGA 2P9KB 3UKRB 1JCGA 2GWJA 4BR5A 4ILHA 3FZKA 1HLUA 2D0OA 4FO0A 5GAGP 5ADXA 5AQQA 3SBGA 2Q0UA 4NB4A 3EN9A 3GBTA 3C7NA 3HZ6A 4FWLA 4BRGA 5BPLA 2PBDA 2YJEA 5GIOA 2P9UA 2RHKA 3IUCA 4JEPA 3MK6A 4BC2A 1HKCA 4C1NK 4JK8A 4BRIA 4JKGA 1SZ2A 1QQNA 2QWRA 4ILJA 3QFPA 2NZTA 4BQLA 1NGCA 3ZETA 2YCHA 4EFHA 4EHUA 3MWTA 3U4LA 4A5AA 1VQLN 4MO5A 3G4SN 3CD6N 3WXLA 3FZFA 2ZGYA 3MN6A 3UKUA 1T6CA 3FLCO 4PKHA 2CH6A 4M63C 3VMFB 3SAGA 4DKWA 5KQDA 5FPDA 5FPEA 3K9KA 4RWTA 5M1FA 1BA0A 3MN7A 3H1QA 3NVMA 5AQXA 3DXMA 3BEXA 3CCSN 5KQ8A 1EO1A 1S22A 5AQLA 4GNIA 1KQSM 2E2QA 5GINA 1V4TA 2JWKA 2NNWA 1M90O 2A40A 3SMPA 3GOIA 5AQYA 2Q2RA 3PIPL 3E9OA 1VQ7N 1NJIO 4JKHA 1MA9B 5M1NA 5LJVA 3R8EA 3E66A 4WQ5A 2P9NA 5AQPA 3CF5L 3C0BA 4J8FA 3T69A 1NGIA 1QZ5A 3CJCA 3SK3A 3O80A 2VYPA 3VENA 4B9QA 4YOXA 1X9JA 5ADXH 2NRHA 2YX6A 2HBJA 4L3QA 4XH4A 4BRQA 4IJNA 4H03B 3JXUA 2FSJA 3CCRN 5BREA 3O9TA 3O9UA 3WXIA 4U7BA 2IVNA 3DLLL 4WF9L 4KBOA 4XH5A 2YI1A 2QWMA 3SBTA 3K9JA 3A0IX 1U6ZA 3H6EA 1BWFO 3I8BA 4MLEA 5GIPA 2NRZA 5AQSA 2W41A 4H0OA 3E1YA 2IVOA 5DM6L 3L4IA 4ISFA 3CERA 3HSCA 3NVKA 5BRHA 2Q97A 4CJ7A 3CC2N 3M1FA 4Y0WA 3CMAN 3AAPA 2NRWA 3O9RA 4WCEL 5H1SQ 2P9SB 3CJBA 3IFRA 3RSEA 3FFKB 4YOUA 1BUPA 2D4WA 1NLVA 1KAYA 5CE3A 3I56N 3CJ1A 1X3NA 2FLOA 2FF6A 4H0YB 4JKAA 1U2VB 3QICA 3G6EN 2F7TA 1BG3A 1NGAA 2VGNA 3D2FB 4ISGA 4KH6A 4IOCL 1DT9A 4CZJA 5GAEP 3A5LC 4FWMA 3H46O 1RDUA 2HSTA 5AQZA 4JK7A 5AQIA 5JICA 3O08A 4M7XA 3HBTA 4DB3A 3ENBA 1NGJA 2HBLA 4JAXA 5E26A 4G9ZA 1NGGA 1OKJA 3FR0A 3N4QA 5AZJB 1K8KA 2QWQA 1QQMA 3MMVA 3MCPA 2P9IA 5F2RA 2GELA 3DXKB 4LC9B 1TYQB 3R1XA 3U9DA 3WXMB 4A57A 1QZ6A 1VQPN 4FVUA 3W0LA 3RVCA 4B1WB 4BGAA 4AM6A 4EIAA 3O8MA 2QWOA 4A2AA 2BTFA 1NGDA 1Q86O 2P9LA 4MLHA 5AQRA 3WT0A 4H5VA 4FSVA 3FE1A 1YHQN 1SS6A 3F2KA 1LCUA 3LM2A 2WUSA 4JK9A 3MDQA 4JHDB 4QS9A 3HI0A 1YF5L 3ZYYX 5EOYA 1HPMA 5BN9A 3P31A 1ZXOA 4OPHA 5C0YA 4IJAA 3L4QA 5C15A 3E9LA 4FOEA 5AQGA 3KZBA 4FWPA 3C7NB 4YDUA 1VQMN 1BDGA 3HOSA 1YITN 4JN4A 2FSKA 2NRXA 3HOTA 4CZMA 3CCJN 2HF4A 5AQVA 3BUZB 2E1YA 4FWKA 3UB5A 2CH5A 4JKGB 4CZHA 2DPNA 3TTCA 3WEEA 1V4SA 4RTFD 4BGBA 1WOQA 3VF4A 4JKCA 2A41A 4F9OA 1BU6O 4EHTA 4O8UA 4H5TA 4AF1A 4O8KA 3CPWM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGK N;  3MN9 A;  1HKG A;  2A5X A;  3BP8 A;  5AQF A;  3A8Y A;  4QS7 A;  2CGL A;  4H5R A;  4CZI A;  4RCH A;  3H3N O;  2AA4 A;  5AQT A;  3CJA A;  1P8Z A;  3VGL A;  5KPZ A;  3DXM B;  4BRA A;  4I6M B;  3A5N C;  3G25 A;  3VEX A;  3WQT A;  3U8X A;  3VGK A;  3GE1 A;  2ASP A;  1ATN A;  4BC4 A;  4E1J A;  1WUA A;  4BVO A;  3EL2 A;  3VEY A;  4B1U B;  2QW9 A;  4HWI A;  3J8A A;  4M7Y A;  3FZM A;  3KVG A;  4FOI A;  1GLE G;  1GLB G;  4BRF A;  2Q31 A;  3LDQ A;  2E88 A;  2QM1 A;  3D2E A;  4K41 A;  4A2B A;  3ZEU B;  4BC5 A;  3LDN A;  4WQ4 A;  5AQK A;  5BPN A;  5KPT A;  2V7Z A;  4CD1 A;  1IJJ A;  3W3D A;  3VER A;  3FGU A;  5AQJ A;  3CQX A;  2W40 A;  4B1Z A;  3VF6 A;  1NWK A;  4JNE A;  4BQZ A;  3AAR A;  1LOT B;  3IDH A;  5JMV A;  3RSE B;  3ATV A;  3O6W A;  1Z05 A;  3SMS A;  3VF2 A;  2HMP A;  3H3O B;  3FZH A;  1ZC6 A;  1YXQ A;  2J4R A;  4BRC A;  4B1X B;  4BRL A;  1RGI A;  3QML A;  1D4X A;  1S3X A;  3ENO A;  4PKI A;  1EQY A;  3DJC A;  2KHO A;  4BG8 A;  2I7N A;  3DAW A;  1DEJ A;  5JLH A;  4BVP A;  3OHR A;  1XUP O;  2E20 A;  2VCP A;  4BC3 A;  3H45 C;  5JLF A;  1TUU A;  1RFQ A;  2CGK A;  3O4W A;  3EKU A;  3SLC A;  3HM8 A;  2QWP A;  2A42 A;  4BRK A;  1GLD G;  1C0G A;  1HUX A;  5BN8 A;  4BRE A;  4MO4 A;  4Z94 A;  1JCE A;  2YHX A;  3O1W A;  2P9L B;  4BRD A;  3WQU A;  4WYB A;  3S41 A;  1NGF A;  2E8A A;  4BRP A;  2FSN A;  3ULE A;  1ATS A;  2IVP A;  2ZWH A;  2V51 B;  5ELZ A;  2P9S A;  3D7E O;  5AQW A;  4CD3 A;  1NBW A;  4FWQ A;  1NGB A;  3LL3 A;  4FL9 A;  5AZI B;  4H0T B;  3M3Z A;  3VET A;  2P9P A;  5I9E B;  3WEE B;  5B8H A;  4ISE A;  5TKY A;  3LM9 A;  5BRF A;  5AQU A;  1XQS C;  1XC3 A;  2ITM A;  3MN5 A;  2YHY A;  4BRM A;  2P9U B;  2A3Z A;  3VGM A;  4K42 A;  3AY9 A;  5AZJ A;  1J6Z A;  2I7P A;  1E4G T;  2E1Z A;  4BRN A;  2YJF A;  3ZET B;  4WQ5 C;  3DXK A;  3TPQ A;  4WQ4 C;  4H0V B;  4JD2 A;  4FPA A;  3UKU B;  4FWS A;  5AR0 A;  2AP1 A;  2D0P A;  1QHA A;  3CI5 A;  2GEM A;  4K43 A;  4BR2 A;  3QFU A;  1T44 A;  1SAZ A;  2Q0R A;  4CBU A;  2Q36 A;  3HTV A;  2V52 B;  2YHW A;  3GDQ A;  1MWK A;  2QXL A;  4IXC A;  2PAV A;  3B8A X;  1R59 O;  3CET A;  2GTD A;  1BOT O;  5AFU H;  2BUP A;  3VEW A;  3ZX3 A;  2P9K A;  3UKR A;  1MWM A;  5F0X A;  1MDU B;  1JCF A;  3D2E B;  4FPB A;  2P9N B;  3A5O C;  4H0X B;  3LDP A;  2ZF5 O;  3P4I A;  3R6M A;  5AQH A;  3WXK A;  4C23 A;  3EKS A;  3CHW A;  3LDL A;  4HTL A;  3VOV A;  4A62 A;  3F9M A;  5EY4 A;  2V7Y A;  1GLC G;  4BR9 A;  3VEZ A;  3VES A;  2E2P A;  2QWN A;  4GY2 B;  4IZ9 A;  4XH1 A;  2ZGZ A;  3GL1 A;  1NMD A;  4BR0 A;  3IMX A;  5KPR A;  4FWO A;  5AQO A;  4I6M A;  3CJ7 A;  3CQY A;  4CBW A;  1KXP A;  5LY3 A;  1TUY A;  3JS6 A;  3TU5 A;  5BR9 A;  5EVZ A;  3WXJ A;  2HF3 A;  1ZBS A;  4A61 A;  3O5B A;  1Y64 A;  1GLA G;  1GLL O;  1QQO A;  4H5N A;  1YUW A;  4H0P A;  5BRD A;  1X3M A;  3QBW A;  3GG4 A;  3LDO A;  1E4F T;  4FWN A;  2FXU A;  3ZX0 A;  3FZL A;  5LJW A;  5AQM A;  3QB0 A;  4CZK A;  3BF3 A;  4PL8 A;  3ZEU A;  4CZE A;  4YDU C;  2F9T A;  1Q18 A;  1BO5 O;  1K8K B;  2HOE A;  1GLJ O;  2OAN A;  3ULE B;  1KAZ A;  2D1K A;  2CGJ A;  2P9I B;  1BA1 A;  4CZL A;  1T6D A;  2GUP A;  2FF3 B;  4XEI A;  1HJO A;  4DCH A;  4NO7 A;  5F1X A;  1GLF O;  3ATU A;  3ENH A;  5EX5 A;  1Z6R A;  1NGH A;  4PKG A;  1RDW X;  5FPN A;  3VEO A;  4FWR A;  3CJ9 A;  1HX1 A;  4AM7 A;  4IWV A;  3BF1 A;  4CBX A;  1NM1 A;  3CIP A;  4IO8 A;  4B1Y B;  2EWS A;  5BPM A;  1ESV A;  2P9P B;  3H1V X;  1C0F A;  4QS8 A;  1YVN A;  3VPZ A;  4PL7 A;  3R9P A;  5AFU A;  5AQN A;  1G99 A;  2A6A A;  3L0Q A;  4BR4 A;  4BR7 A;  3ZX2 A;  4CI6 A;  1NGE A;  2UYT A;  4BG9 A;  3M6G A;  2ASO A;  1U2V A;  3ID8 A;  3D2F A;  2H3G X;  3U9Z A;  4BRH A;  3UE5 A;  4H5W A;  3I33 A;  3SJH A;  1DKG D;  3QDK A;  4K25 A;  3AAQ A;  2QWL A;  4CZF A;  4O5F A;  4CZG A;  1HKB A;  1H1V A;  4DQ8 A;  3QBX A;  4JD2 B;  2GWK A;  1CZA N;  5FPM A;  1SQK A;  3KHY A;  3L6Q A;  2E2N A;  3O1B A;  1IG8 A;  1TYQ A;  5E84 A;  1ATR A;  3EO3 A;  2VWB A;  3DWL A;  2IIR A;  3EZW A;  1KAX A;  4B1V A;  4EAH D;  2F9W A;  2E2O A;  4DHY A;  2Q1N A;  4JHD A;  3A5M C;  5EXW A;  3WUH A;  2ASM A;  2NLX A;  4BRO A;  5AZI A;  3VEV A;  1YAG A;  2P9K B;  3UKR B;  1JCG A;  2GWJ A;  4BR5 A;  3FZK A;  1HLU A;  2D0O A;  4FO0 A;  5ADX A;  5AQQ A;  2Q0U A;  4NB4 A;  3EN9 A;  3GBT A;  3C7N A;  3HZ6 A;  4FWL A;  4BRG A;  5BPL A;  2PBD A;  2YJE A;  2P9U A;  3IUC A;  4BC2 A;  3MK6 A;  1HKC A;  4BRI A;  1SZ2 A;  1QQN A;  2QWR A;  3QFP A;  2NZT A;  4BQL A;  1NGC A;  3ZET A;  2YCH A;  4EFH A;  4EHU A;  3U4L A;  4MO5 A;  3WXL A;  3FZF A;  2ZGY A;  3MN6 A;  3UKU A;  1T6C A;  3FLC O;  4PKH A;  2CH6 A;  4M63 C;  5KQD A;  5FPD A;  5FPE A;  4RWT A;  1BA0 A;  3MN7 A;  3H1Q A;  5AQX A;  3DXM A;  3BEX A;  5KQ8 A;  1S22 A;  5AQL A;  4GNI A;  2E2Q A;  1V4T A;  2A40 A;  3SMP A;  3GOI A;  5AQY A;  2Q2R A;  1MA9 B;  5LJV A;  3R8E A;  4WQ5 A;  2P9N A;  5AQP A;  3C0B A;  4J8F A;  1NGI A;  1QZ5 A;  3CJC A;  3SK3 A;  3O80 A;  2VYP A;  3VEN A;  4B9Q A;  1X9J A;  5ADX H;  2NRH A;  4L3Q A;  4BRQ A;  4XH4 A;  4IJN A;  4H03 B;  3JXU A;  2FSJ A;  5BRE A;  3WXI A;  2IVN A;  4KBO A;  4XH5 A;  2YI1 A;  2QWM A;  3A0I X;  1U6Z A;  3H6E A;  1BWF O;  3I8B A;  4MLE A;  5AQS A;  2W41 A;  4H0O A;  2IVO A;  3L4I A;  4ISF A;  3CER A;  3HSC A;  5BRH A;  2Q97 A;  4CJ7 A;  3M1F A;  4Y0W A;  3AAP A;  2P9S B;  3CJB A;  3IFR A;  3RSE A;  3FFK B;  1BUP A;  2D4W A;  1NLV A;  1KAY A;  5CE3 A;  3CJ1 A;  1X3N A;  2FLO A;  2FF6 A;  4H0Y B;  1U2V B;  3QIC A;  1BG3 A;  1NGA A;  3D2F B;  4ISG A;  4CZJ A;  3A5L C;  4FWM A;  3H46 O;  5AQZ A;  5AQI A;  5JIC A;  3O08 A;  4M7X A;  3HBT A;  4DB3 A;  1NGJ A;  5E26 A;  4JAX A;  1NGG A;  1OKJ A;  3FR0 A;  5AZJ B;  1K8K A;  2QWQ A;  1QQM A;  3MMV A;  3MCP A;  2P9I A;  5F2R A;  2GEL A;  3DXK B;  4LC9 B;  1TYQ B;  3U9D A;  1QZ6 A;  3W0L A;  4B1W B;  4BGA A;  4AM6 A;  4EIA A;  3O8M A;  2QWO A;  4A2A A;  2BTF A;  1NGD A;  2P9L A;  4MLH A;  5AQR A;  3WT0 A;  4H5V A;  4FSV A;  3FE1 A;  1LCU A;  3LM2 A;  2WUS A;  4JHD B;  3MDQ A;  4QS9 A;  3HI0 A;  5EOY A;  1HPM A;  5BN9 A;  1ZXO A;  4IJA A;  4FOE A;  5AQG A;  3KZB A;  4FWP A;  3C7N B;  4YDU A;  1BDG A;  4JN4 A;  2FSK A;  4CZM A;  2HF4 A;  5AQV A;  3BUZ B;  2E1Y A;  4FWK A;  3UB5 A;  2CH5 A;  4CZH A;  2DPN A;  3WEE A;  1V4S A;  4RTF D;  4BGB A;  1WOQ A;  3VF4 A;  2A41 A;  4F9O A;  1BU6 O;  4EHT A;  4H5T A;  4O8K A; 
#chains in the Genus database with same CATH topology
 1DGK N;  3MN9 A;  4JI8 K;  3E01 A;  2X6N A;  4CJ3 A;  4YOV A;  4CJL A;  4QS7 A;  2CGL A;  4H5R A;  4KHY A;  3AA5 X;  4RCH A;  1T3V A;  4BRA A;  4CJR A;  3WQT A;  1VK0 A;  3GE1 A;  2Y1J A;  1HR0 K;  2ASP A;  1ATN A;  1N32 K;  2Z1H A;  1SKR A;  4BVO A;  2QXF A;  2HHU A;  3T1A A;  4B1U B;  1L3U A;  1OH5 A;  3J8A A;  4M7Y A;  2HHT A;  1GLB G;  4BDY A;  1RCH A;  2E88 A;  2QM1 A;  1BI4 B;  4A2B A;  3LP2 A;  3NAE A;  5BPN A;  1HYZ A;  3NBP A;  3W3D A;  1ASW A;  3VER A;  1FJG K;  4GV3 A;  2W40 A;  3F9K A;  4DMN A;  3VF6 A;  4JNE A;  4CEF A;  3IDH A;  3MAQ A;  4ID5 A;  4OJR A;  3ATV A;  5E41 A;  3CFP A;  1Z05 A;  3H3O B;  3FZH A;  3CFO A;  5JVH L;  2OTJ N;  4KKO A;  4BRL A;  4LFA K;  4F8R A;  4DV1 K;  2QTD A;  3KTQ A;  1ASV A;  3OS2 A;  2G8H A;  5KRS A;  3D0P A;  1S3X A;  3SV4 A;  1W0H A;  4ELV A;  4HCC A;  3AO4 A;  4BG8 A;  1NKB A;  4FJ5 A;  1DEJ A;  3DLR A;  3OHR A;  4CF8 A;  3QLH A;  1S5J A;  2VCP A;  5JLF A;  2OCE A;  2GX9 A;  3PIO L;  3HM8 A;  4CER A;  4KRF A;  2B6A A;  3MEG A;  4NYF A;  4CEO A;  2YHX A;  3O1W A;  2XY7 A;  3T7Z A;  1KFD A;  2QKK A;  1X1P A;  3CG7 A;  3KK2 A;  4WYB A;  3S41 A;  4BRP A;  4J2B A;  1WAJ A;  2IVP A;  2OPR A;  3ZLJ A;  3V9X A;  2V51 B;  1WN7 A;  5J1E A;  2P9S A;  4DLG A;  5AQW A;  4CD3 A;  3TSP A;  1NBW A;  1W97 L;  5J2Q A;  4FWQ A;  3HT3 A;  5AZI B;  2UXB K;  2KKZ A;  4G1Q A;  2Z1J A;  3CYM A;  4Y1D A;  3CCM N;  3J7Y P;  5B8H A;  5KI6 A;  3IKM A;  4DU4 A;  4Y1C A;  5KGX A;  5FRN A;  4M3Z A;  1A5W A;  4NXM K;  1F21 A;  4FPA A;  3KLG A;  3OYL A;  1QHA A;  4NLC A;  3TTD A;  4LF9 K;  1T44 A;  1T03 A;  2HMI A;  2Q36 A;  3BZC A;  2V52 B;  2QI2 A;  2YHW A;  3GDQ A;  2DY4 A;  4GVE A;  2QKB A;  3TAF A;  5JVG L;  1NK5 A;  3KD5 E;  4DR4 K;  2G8F A;  1VSH A;  1RIL A;  4B3M K;  4DSL A;  1D8Y A;  2P9K A;  3QER A;  4WFN L;  5HBM A;  4E7H A;  3A5O C;  4CHZ A;  4ELU A;  2F4V K;  2ZF5 O;  3WXK A;  2E6L A;  4NCG A;  3EKS A;  3CHW A;  2ZJP L;  4Z4C A;  3S3O A;  4KAZ A;  1D9F A;  1GLC G;  4DS5 A;  4GMJ B;  4BR9 A;  2QWN A;  4PA1 A;  1YTA A;  2ZGZ A;  3GL1 A;  5CHI A;  1NMD A;  4CFB A;  2XHB A;  4AHV A;  4HTU A;  3TSU A;  1C1A A;  3C6U A;  3SAF A;  3AVI A;  3OYC A;  3DMJ A;  4DV0 K;  3ZCM A;  3WXJ A;  1XHZ A;  1Q7Y O;  1NMN A;  1D5A A;  4CED A;  2OTL N;  4IOX A;  1Y64 A;  2D0B A;  1GLA G;  4IEE A;  4C8N A;  1K6Y A;  3J7A P;  4B3R K;  3GG4 A;  4N41 A;  1E4F T;  3AVK A;  4N5S A;  1EET A;  1HRH A;  1KC8 O;  4FK4 A;  4N47 A;  4CZK A;  3QB0 A;  4JI3 K;  3ZEU A;  4PWD A;  3Q7B A;  4YDU C;  2HBM A;  1Q18 A;  3AGR A;  4JI2 K;  4GKJ K;  1SUQ A;  4IG0 A;  1Q82 O;  1BA1 A;  1P90 A;  4CZL A;  1T6D A;  3KK1 A;  2FF3 B;  4DCH A;  5F1X A;  1NKC A;  1OVY A;  4KTQ A;  1KLN A;  3HL8 A;  1S1T A;  1Z6R A;  3K5O A;  1NKE A;  4LF7 K;  4DFJ A;  2NRR A;  1YJW N;  4FWR A;  3CJ9 A;  1NM1 A;  4FM2 A;  5C12 A;  3OYG A;  1ESV A;  5MLC Q;  3OBY A;  2UUC K;  1SKW A;  1YVN A;  4F4K A;  3THY B;  4PL7 A;  5SWM A;  2RF2 A;  3VQ8 A;  3L0Q A;  4OO1 J;  4DTR A;  2O4G A;  4U67 L;  4CI6 A;  4LF4 K;  1IKX A;  5HOO A;  1YIJ N;  1N36 K;  4FJN A;  1EWR A;  3QDK A;  4CJU A;  1TKZ A;  2JWL A;  1VQO N;  4PQU A;  1LV5 A;  2ZD1 A;  2D0A A;  3F73 A;  4IO9 L;  2GWK A;  1CZA N;  4CEA A;  3AA3 A;  3EE9 A;  3SQ2 A;  1SQK A;  3KHY A;  3VQ4 A;  3L6Q A;  2E2N A;  5J2P A;  1IG8 A;  1ATR A;  2VWB A;  3DWL A;  4FLU A;  1KAX A;  3ULD A;  1RBT A;  4C8K A;  2VGM A;  1M1K O;  2NLX A;  4W5Q A;  1NK4 A;  4BRO A;  3VEV A;  3UKR B;  1HLU A;  5ADX A;  4X66 K;  5AQQ A;  4EZ9 A;  4NB4 A;  3GBT A;  4DR5 K;  1ZBU A;  4DR6 K;  5GIO A;  3IUC A;  4CIE A;  3SV3 A;  4LSN A;  1QQN A;  4ILJ A;  3AVH A;  3QFP A;  4Z4G A;  4Z0U A;  1NG9 A;  1NGC A;  4EFH A;  4EHU A;  5KRT A;  4QAG A;  1ZYQ A;  3O3G A;  4MO5 A;  2YV0 X;  1NOY A;  3CD6 N;  4CJQ A;  3FZF A;  2ZGY A;  3MN6 A;  1JLG A;  1T6C A;  2JGU A;  4DKW A;  5KQD A;  4RWT A;  5M1F A;  5AQX A;  2ETJ A;  1EO1 A;  2IDO A;  1S22 A;  5AQL A;  3OJS A;  4GNI A;  2E2Q A;  4DF8 A;  5AQY A;  3PIP L;  4LH4 A;  3JYT A;  4JKH A;  1JLA A;  4WQ5 A;  1RTH A;  3DOK A;  4J8F A;  1S1X A;  1QZ5 A;  3NGZ A;  3RRH A;  5HRP A;  4B9Q A;  3ZT0 A;  5ADX H;  4BRQ A;  2HHS A;  1VSE A;  4XH4 A;  4DR1 K;  4JI1 K;  3HM9 A;  3JXU A;  2W6L A;  3O4Q A;  3BDP A;  1BI4 A;  1VSM A;  3SBT A;  3AO2 A;  3A0I X;  1U6Z A;  3I8B A;  5GIP A;  1TL1 A;  3QNN A;  2ZM6 K;  4KI6 A;  3E1Y A;  5IT9 O;  3HSC A;  3NVK A;  5BRH A;  4CJ7 A;  4Y0W A;  3KKS A;  3L2W A;  4WCE L;  3NF7 A;  5H1S Q;  2P9S B;  3CJB A;  4RW6 A;  4NCB A;  4OKE A;  3LZJ A;  1NLV A;  1KAY A;  5IWA K;  2RN2 A;  2FF6 A;  4JKA A;  1XMO K;  1VRU A;  2VGN A;  4H4O A;  4CVN E;  4CZJ A;  3H46 O;  4DB3 A;  4KB1 A;  1NGJ A;  4JAX A;  1BL3 A;  3FR0 A;  4Q5V A;  3NGY A;  2P9I A;  4DTX A;  1TYQ B;  1VQP N;  1QZ6 A;  4LSL A;  3IAY A;  4WE1 A;  3OYM A;  3O8M A;  4CF1 A;  4W5T A;  1NGD A;  2VQE K;  4OLA A;  4FZX C;  4BDZ A;  4FYD A;  4CEQ A;  3MDQ A;  3HI0 A;  4DF4 A;  4DTM A;  1Z26 A;  1L5U A;  3ZYY X;  3OYF A;  1ZXO A;  4AH9 A;  3THX B;  2FBT A;  5C0Y A;  3E9L A;  4FOE A;  1T7P A;  3KZB A;  3KK3 A;  3C7N B;  4CJE A;  1BDG A;  4DTN A;  2HF4 A;  5AQV A;  5HRN A;  4DSK A;  4CZH A;  3TTC A;  1V4S A;  1WSG A;  3VF4 A;  3QIO A;  4F9O A;  4EHT A;  4AF1 A;  2E5L K;  4KHP K;  1BGX T;  1HKG A;  3P39 A;  3A8Y A;  1EXQ A;  2HBK A;  3NF8 A;  4OPA A;  5DMR A;  1QTM A;  3H3N O;  3CCL N;  2B4J A;  3T1H K;  1HNZ K;  1SL0 A;  3VGL A;  5KPZ A;  4E89 A;  3A5N C;  3VQ9 A;  3VGK A;  4W5O A;  3RMB A;  4BC4 A;  4J2A A;  1WUA A;  3MCA B;  2OZS A;  2O8E B;  1RT1 A;  3VEY A;  1W2B M;  3S9H A;  3PX0 A;  1WBD A;  2RPI A;  2FC0 A;  4MDB A;  3O9Q A;  4O0I A;  4JRQ A;  3VQ7 A;  3KVG A;  3DI6 A;  3SAH A;  4BRF A;  4IEI A;  1CXU A;  4GW6 A;  4K41 A;  1RDC A;  3ZEU B;  5AQK A;  1JKH A;  4OKK A;  3ZT4 A;  2KFN A;  1U4B A;  5AQJ A;  4CHP A;  1LW2 A;  1NWK A;  4CFA A;  4CGD A;  1NK6 A;  4BQZ A;  2KFZ A;  4I7F A;  3VQC A;  2KZZ A;  5HLF A;  3PSI A;  3SMS A;  4FZZ A;  3ID6 A;  5GAD P;  1I94 K;  4B1X B;  5CYM A;  2G8V A;  2ZJQ L;  4C1N I;  3OBW A;  1IBL K;  1IKW A;  4B3S K;  1EQY A;  3DLB A;  3QET A;  4X65 K;  3DAW A;  3LP3 A;  1SKS A;  4BC3 A;  4IOA L;  2CGK A;  4B3T K;  3NF9 A;  4EP4 A;  4M3U A;  4CJS A;  3O9S A;  1GLD G;  3NH0 A;  3L2R A;  5BN8 A;  1XI1 A;  1JLF A;  2UXC K;  4F2S A;  4RW4 A;  3VQ5 A;  1U04 A;  4W5R A;  1ATS A;  2ZWH A;  1QS4 A;  2FBX A;  4RG8 A;  3HPG A;  1WSI A;  4YHH K;  3SQ0 A;  5J2M A;  4LF8 K;  1BCO A;  2ATQ A;  1RBS A;  5C10 A;  3PV8 A;  3LL3 A;  1RBV A;  3PO4 A;  4B9S A;  5I9E B;  3WEE B;  1WSH A;  4ISE A;  3THY A;  2QK9 A;  5AQU A;  2YHY A;  4BRM A;  2A3Z A;  1E3M A;  1J53 A;  3OW2 M;  2X74 A;  4K42 A;  3WNE A;  2HHX A;  4PUO A;  4WQ5 C;  2WBN A;  3J81 O;  2A1R A;  4FJJ A;  2VG6 A;  3AVG A;  1KVB A;  1FW6 A;  4IG3 A;  4JI4 K;  3OYN A;  5HRO A;  4K43 A;  3QFU A;  1TAU A;  3RR8 A;  1K73 O;  1MWK A;  2QXL A;  3E9P A;  3KWI A;  3MXI A;  1S1W A;  3BY5 A;  2IS3 A;  1FK9 A;  4YOY A;  2GTD A;  1BOT O;  4DV2 K;  1YI2 N;  3U3Y A;  1DLO A;  4A59 A;  2PZS A;  3ZX3 A;  3UKR A;  4BE2 A;  3TAG A;  3D2E B;  3LPT A;  5CYQ A;  3DLG A;  3LDP A;  4DU1 A;  1JL1 A;  3P4I A;  3CC4 N;  3LAM A;  2DFF A;  4ILG B;  2KW4 A;  1O13 A;  3HVT A;  2V7Y A;  3VTI A;  3SUP A;  4AHC A;  2PYL A;  3VES A;  3PSF A;  3QEI A;  2GV9 A;  4I2Q A;  5KPR A;  4FWO A;  4I6M A;  3CJ7 A;  4CF2 A;  3OVN A;  5A2Q O;  4CF0 A;  5LY3 A;  3DLH A;  4M45 A;  3TSQ A;  4NLB A;  5CR4 A;  1KVC A;  5K14 A;  2HF3 A;  1HQE A;  1ZBS A;  3KK7 A;  5KGW A;  3TAE A;  1IBM K;  4DTP A;  5M1O A;  5BRD A;  4FWN A;  2HHV A;  3ZX0 A;  5LJW A;  3SCX A;  3BF3 A;  5M1Q A;  4AQY K;  4CZE A;  4FLT A;  3C6H A;  2F9T A;  2HOE A;  4DTU A;  1KAZ A;  3HRG A;  3I8D A;  2P9I B;  3VQA A;  1BQN A;  1RTD A;  2O8B B;  4XEI A;  1HJO A;  1VHX A;  1U45 A;  4EP5 A;  3G10 A;  1GLF O;  4IFE A;  4JV5 K;  2Z1I A;  3MX2 A;  4F2R A;  4CW7 B;  3M8P A;  1WB9 A;  3BF1 A;  4UY8 O;  4CBX A;  4AHT A;  2XY5 A;  4IO8 A;  2EWS A;  2PFU A;  2P9P B;  5BR8 K;  3R9P A;  1G99 A;  2A6A A;  4BR7 A;  4BR4 A;  1N33 K;  1K8A O;  5EU7 A;  1NGE A;  3M6G A;  1C0M A;  3PLA A;  1RT6 A;  3ID8 A;  4I9L A;  3RR7 A;  3SYZ A;  4O44 A;  1RDB A;  1QSY A;  5FPM A;  1HYV A;  1X9M A;  4MQ3 A;  4MDA A;  4LF6 K;  4DUY K;  1SV5 A;  2Q3S A;  3O1B A;  4DTS A;  3AVM A;  1TYQ A;  3KLF A;  4FW2 A;  2HND A;  2G8K A;  2IIR A;  4EAH D;  2BH1 A;  3K2P A;  2F9W A;  2E2O A;  5FRM A;  4DSI A;  4RW7 A;  1CZB A;  4R5P A;  2E6M A;  1EX4 A;  1C1B A;  3FZK A;  3THX A;  1UWB A;  5GAG P;  4CEC A;  3RTV A;  4CE9 A;  3HZ6 A;  3C7N A;  1EKE A;  2PBD A;  1JLE A;  2P9U A;  2RHK A;  3EEQ A;  4BRI A;  4FK0 A;  1SZ2 A;  4BQL A;  4Z4E A;  3ZET A;  2YCH A;  3MWT A;  1JLC A;  1S6Q A;  4BDP A;  3UKU A;  4CEE A;  3QIN A;  2OPP A;  3VMF B;  4M63 C;  4CFC A;  3PUF A;  4N56 A;  4C8M A;  3NVM A;  2ITG A;  4ZTJ A;  1XC9 A;  1C6V A;  1CZ9 A;  1QE1 A;  1S9E A;  3LZI A;  1FXX A;  3GOI A;  3K59 A;  2Q2R A;  4KHQ A;  2O8E A;  3AVB A;  5CY4 A;  4CEZ A;  1W9H A;  3ISN C;  2P9N A;  5AQP A;  1NGI A;  4DQQ A;  2O4I A;  3LP1 A;  5C25 A;  2BDP A;  2NRH A;  4L3Q A;  4IJN A;  1TK8 A;  3CCR N;  3EY1 A;  3O9U A;  3WXI A;  4X62 K;  4FVM A;  4FXD A;  1ITG A;  4O4G A;  3RMD A;  4E1M A;  3H6E A;  2NRZ A;  5AQS A;  4ID1 A;  4H0O A;  5DM6 L;  2IVO A;  1KRP A;  3L2V A;  1EP4 A;  4FCY A;  3CMA N;  3AAP A;  1VSL A;  2NRW A;  3O9R A;  2YHB A;  2B5J A;  3FFK B;  4YOU A;  1BUP A;  1WBB A;  4LFC K;  4CHQ A;  3CJ1 A;  1X3N A;  4JYA K;  4H0Y B;  1U2V B;  3LWL A;  3VQQ A;  4JI0 K;  1DT9 A;  4CJP A;  3MXJ A;  3ZT2 A;  3AVL A;  1HMV A;  3A5L C;  3CM5 A;  4B9T A;  5AQZ A;  1KFS A;  3MEC A;  3O08 A;  3HBT A;  1UA1 A;  3EYZ A;  2KTQ A;  2HBL A;  5E26 A;  4G9Z A;  1XNR K;  1OKJ A;  4JI7 K;  3N4Q A;  1RTJ A;  2QWQ A;  1J5O A;  3ASM A;  4DQS A;  1LWF A;  5F2R A;  4DFK A;  4OX9 K;  3U9D A;  3WXM B;  1X9W A;  4B1W B;  1TV6 A;  4BAC A;  3MXM A;  1Q86 O;  4DSJ A;  3S3M A;  3MEE A;  4JK9 A;  4JHD B;  1HQU A;  1I39 A;  4BE0 A;  1HPM A;  4DTJ A;  3V81 A;  1QHT A;  5C15 A;  3L4Q A;  4FWP A;  4C8L A;  3LPU A;  3C94 A;  4JN4 A;  2FSK A;  2NRX A;  3HOT A;  3CCJ N;  4B9V A;  2E1Y A;  3K5N A;  2CH5 A;  4DTO A;  3WEE A;  4BGB A;  3NH2 A;  4OPJ A;  2HHQ A;  3V1Q A;  4O8K A;  3CPW M;  1N8R O;  1IO2 A;  4F3O A;  2IGI A;  5AQF A;  2VG5 A;  4JKD A;  2XY8 A;  4YOR A;  3ZSZ A;  2AA4 A;  2HB5 A;  4CJT A;  3V9W A;  4FLX A;  3DXM B;  4I6M B;  3S3N A;  3DM2 A;  3VEX A;  1ILY A;  3KLI A;  3U8X A;  1TGO A;  3FFI A;  3OYA A;  3EL2 A;  2D5R A;  5LL6 Z;  2QW9 A;  3RWU A;  4E7K A;  4HWI A;  1BHL A;  5M1K A;  5J2N A;  4GV6 A;  1GLE G;  3SPY A;  3D2E A;  3CCV N;  3AVC A;  3OA9 A;  1T8E A;  2ZJR L;  2V7Z A;  1IJJ A;  4CIG A;  4NXN K;  4M42 A;  4B1Z A;  2EHG A;  3TAB A;  1REV A;  3AAR A;  1LOT B;  5JMV A;  4CK3 A;  3OJU A;  2YNG A;  3O6W A;  3CC7 N;  3VF2 A;  2HMP A;  4E1N A;  1L3V A;  1S6P A;  2QA4 N;  4QOZ B;  1YXQ A;  2J4R A;  1IG9 A;  1RGI A;  4M3R A;  2NUB A;  1NJY A;  4K8X A;  4PKI A;  3I0R A;  2KHO A;  3HJF A;  4JS5 A;  4Z4I A;  3QEX A;  5JLH A;  3SQ1 A;  2P1J A;  4BVP A;  1ASU A;  2E20 A;  3EE8 A;  1TUU A;  3AGK A;  1JLQ A;  2NRV A;  3P5J A;  5HL7 L;  1RFQ A;  3WNF A;  1B92 A;  2OZM A;  2BGG A;  4FM0 A;  4FLZ A;  3SLC A;  1VQ4 N;  2A42 A;  4BRK A;  4E7I A;  4AIL C;  3I0S A;  4H4M A;  1WNS A;  4KB0 A;  4KPY A;  4BRE A;  1BIU A;  4MO4 A;  3NMU A;  1JCE A;  4BRD A;  3WQU A;  1S72 N;  3ZSV A;  2O8B A;  1Q81 O;  1QVF M;  3WNG A;  3D7E O;  4HUF A;  5T7B A;  3TAQ A;  3OYB A;  2PY5 A;  3QEP A;  4B08 A;  3NDK A;  2P9P A;  3HXM A;  5TKY A;  3LM9 A;  4OGE A;  5BRF A;  4CHO A;  4DG1 A;  1XQS C;  2ITM A;  2P9U B;  4E7L A;  1YJN N;  3MX5 A;  3MWP A;  3AY9 A;  3LAK A;  2DFE A;  1J6Z A;  2I7P A;  4DFM A;  4BRN A;  3ZET B;  3DXK A;  3VA0 A;  1VQ9 N;  4WQ4 C;  4H0V B;  1L3T A;  3UKU B;  3NHG A;  4FWS A;  2AP1 A;  3PX4 A;  4DSF A;  3CME N;  4BR2 A;  3TTF A;  3HTV A;  3OS0 A;  4B9N A;  3Q7C A;  1TVR A;  4B3O A;  3CET A;  4HUE A;  3VTH A;  2HNY A;  5AFU H;  4DR2 K;  2Z1G A;  3PY8 A;  3LDS A;  3VEW A;  5C2D A;  1U48 A;  1MWM A;  1MDU B;  1NNE A;  2P9N B;  5HRR A;  4H0X B;  4CJW A;  3A2F A;  1WSE A;  3LDL A;  4HTL A;  1IV0 A;  1QSS A;  2F8T A;  3F9M A;  4UQG A;  5EY4 A;  3AO1 A;  2IC3 A;  2KLA A;  2QEX N;  2UXD K;  3VEZ A;  4CHN A;  4FJK A;  4Z4F A;  4GY2 B;  4IZ9 A;  2FBY A;  3VQD A;  4B8C A;  3HO1 A;  3CQY A;  3KD1 E;  2BAN A;  4CBW A;  4PY5 A;  4CCH A;  5BR9 A;  3R3L A;  5EVZ A;  3P83 D;  4DFP A;  4IBN A;  4M3T A;  3J80 O;  4A61 A;  3IG1 A;  3K57 A;  3O5B A;  5GAH P;  3V4I A;  1GLL O;  1TKT A;  1QQO A;  2VG7 A;  1YUW A;  4H0P A;  3CM6 A;  3CCU N;  1HNW K;  4O0J A;  1QQC A;  3LDO A;  2WOM A;  2FXU A;  1ZBI A;  3FZL A;  4M41 A;  3TAM A;  4HHT A;  4AHU A;  4JI5 K;  1BQM A;  1VSI A;  4OGC A;  5M1P A;  4FJI A;  1I3A A;  2YKM A;  1GLJ O;  2OAN A;  3O4N A;  3ULE B;  2D1K A;  2WC9 A;  1OVQ A;  1IKY A;  3TWH A;  3ATU A;  5EX5 A;  4JLH A;  1NGH A;  3AO3 A;  4PKG A;  2UUA K;  1RDW X;  4K0K K;  3V1O A;  4AM7 A;  2DTU A;  1XMQ K;  3THW A;  4JKF A;  1G15 A;  3CIP A;  4B1Y B;  2VQF K;  2ZE2 A;  4GV9 A;  4ZTF A;  3H1V X;  2YKN A;  4QS8 A;  1JXB A;  5AQN A;  1GOC A;  4CFD A;  3ZX2 A;  4KV8 A;  3C6T A;  2UYT A;  1WSJ A;  4BY9 C;  3LP0 A;  1U2V A;  2H3G X;  3U9Z A;  4DS4 A;  4BRH A;  3K58 A;  2O8C B;  3SJH A;  1DKG D;  1MU2 A;  1K9M O;  3OYH A;  4CZF A;  3V9Z A;  4O5F A;  4CZG A;  1HKB A;  4JD2 B;  4CES A;  4YOT A;  4LFB K;  2YNH A;  1T05 A;  5HRS A;  4JS4 A;  5TKW A;  1SL2 A;  4CJK A;  2HHW A;  4CJF A;  1HNX K;  1N34 K;  3J7Z O;  3KJV A;  5FDL A;  3TR8 A;  5E84 A;  3AA2 A;  4ICL A;  3NGI A;  2OPQ A;  1DTQ A;  1LAV A;  4B1V A;  1N6Q A;  2P5G A;  1IH7 A;  1O1W A;  2Q1N A;  1KLM A;  4JHD A;  1WSF A;  4AHR A;  5EXW A;  3WUH A;  4YNQ A;  3OYD A;  4FW1 A;  4QCL A;  4ILH A;  1RT2 A;  2D0O A;  3HP6 A;  3HP9 A;  2HW3 A;  1CXQ A;  1YHQ N;  2Q0U A;  4FWL A;  4DQI A;  1HNI A;  2YJE A;  3DLE A;  4BC2 A;  4KRE A;  1HKC A;  4JK8 A;  4DV3 K;  4NCA A;  2QWR A;  2NZT A;  1ZBF A;  1NJX A;  2DFH A;  1S1V A;  5HP1 A;  3LWM A;  1IBK K;  1B9D A;  3U4L A;  4A5A A;  1VQL N;  1IKV A;  5KTQ A;  3WXL A;  3FLC O;  5FRO A;  2CH6 A;  3SAG A;  4DR3 K;  5FPD A;  5FPE A;  2O8D B;  1BA0 A;  3MN7 A;  2GBZ A;  3H1Q A;  3DXM A;  2O8F A;  3BEX A;  3CCS N;  3OS1 A;  4F3T A;  1JLB A;  1KQS M;  5GIN A;  2JWK A;  3L2Q A;  2NNW A;  1M90 O;  2A40 A;  3SMP A;  3T19 A;  1VQ7 N;  1NJI O;  5JS2 A;  1RBU A;  1MA9 B;  5M1N A;  5LJV A;  3R8E A;  3E66 A;  3CF5 L;  1NK0 A;  3C0B A;  3KIO A;  5SZT A;  4CGI A;  3HPH A;  3CFR A;  2VYP A;  4CJV A;  3OYK A;  2HBJ A;  3NF6 A;  4H03 B;  4IDK A;  5BRE A;  2HHH K;  3O9T A;  4U7B A;  2KZM A;  4YFU A;  3OYE A;  3DLL L;  4KBO A;  4XH5 A;  3K9J A;  3ZSW A;  1YT3 A;  4J2E A;  1HNV A;  2W41 A;  4DU3 A;  3CER A;  5CZ2 A;  1BIZ A;  3M1F A;  4FLY A;  3TAP A;  1ZBH A;  3IFR A;  2RKI A;  4KO0 A;  3ZSR A;  1Q9Y A;  4LH5 A;  4RW9 A;  3I56 N;  4IOC L;  2F7T A;  1BG3 A;  3D2F B;  4ISG A;  4LF5 K;  1Q9X A;  3L3U A;  2XY6 A;  4FWM A;  1RDU A;  4JK7 A;  5AQI A;  5JIC A;  1XNQ K;  4M7X A;  4FJH A;  3VQP A;  1NGG A;  4Z4H A;  1K8K A;  1QQM A;  1WAF A;  4I2P A;  3DXK B;  2VWJ A;  3R1X A;  4FVU A;  4BGA A;  3OTO K;  2Y1I A;  4A2A A;  3KLH A;  3NFA A;  4MLH A;  1LWE A;  3AVJ A;  3FE1 A;  1SS6 A;  1LCU A;  2I5J A;  3LM2 A;  4QS9 A;  1JXE A;  3SJJ A;  5EOY A;  5BN9 A;  5JS1 A;  3P31 A;  4OPH A;  4CGH A;  3MED A;  4W5N A;  5AQG A;  1Y97 A;  1YIT N;  3OYI A;  1OH6 A;  3PO5 A;  3BUZ B;  3P1G A;  4FWK A;  3UB5 A;  4JKG B;  5C24 A;  2DPN A;  1LW0 A;  2EX3 A;  1WOQ A;  2YHA A;  3ITH A;  1FKP A;  2A41 A;  4JKC A;  1NK9 A;  4O8U A;  4H5T A;  3ZSY A;  3IRX A;  1VSJ A;  2A5X A;  3L2U A;  3BP8 A;  5DM7 L;  1RNH A;  4CZI A;  4CJ4 A;  1SL1 A;  5AQT A;  3CJA A;  4I9Q A;  1P8Z A;  3CXC M;  3THV A;  4FJ8 A;  1KVA A;  4M3W A;  3M8S A;  3G25 A;  3UIQ A;  4FJL A;  4AHS A;  1N5Y A;  1HYS A;  2F96 A;  4FJ9 A;  4E1J A;  1VQK N;  4B8A B;  4FLV A;  3O3H A;  3K5L A;  4BWM A;  1VQ6 N;  4WFB L;  2XO7 A;  3RMA A;  4B9M A;  4DUZ K;  3FZM A;  1J5E K;  4FOI A;  1B9F A;  1VSF A;  1YJ9 N;  2Q31 A;  3HYF A;  3LDQ A;  4BC5 A;  4KHN A;  4GKK K;  1GOB A;  3LDN A;  4WQ4 A;  5KPT A;  4CD1 A;  3I55 N;  3L3V A;  4RW8 A;  4R79 A;  3FGU A;  3CQX A;  3TAR A;  5LMU K;  1NJW A;  3G0Z A;  1RBR A;  3F5T A;  4IFY A;  1RTI A;  3RSE B;  1ZBL A;  3G71 N;  2W42 A;  3LAN A;  4BE1 A;  3KKR A;  1ZC6 A;  3QNO A;  4BRC A;  3THW B;  3QML A;  4M3Y A;  4OKJ A;  4E19 A;  1D4X A;  3SUO A;  4H8K A;  3ENO A;  3DJC A;  3VN5 A;  2I7N A;  1U49 A;  1VQ5 N;  1XUP O;  3H45 C;  3HST B;  3HPO A;  3O4W A;  4CF9 A;  3D6R A;  4B9U A;  3EKU A;  4PHT X;  2QWP A;  3SI6 A;  4KHW A;  2A1S A;  4K8Z A;  3AVN A;  3U3G A;  3DOL A;  1C0G A;  2KQ2 A;  4GVM A;  1HUX A;  3V9U A;  1UAX A;  4Z94 A;  4DV6 K;  1HJR A;  2P9L B;  2LSN A;  4LY7 A;  4DSE A;  1UA0 A;  1NGF A;  2E8A A;  2FSN A;  3ULE A;  3L8B A;  4KTW A;  2FBV A;  1VAZ A;  2BE2 A;  5ELZ A;  3B6P A;  1XHX A;  4KI4 A;  4FK2 A;  1NGB A;  4FL9 A;  3ZSO A;  2WFB A;  4MFB A;  4H0T B;  3M3Z A;  2ZQB A;  5FLX O;  4KFB A;  1RDD A;  3AVA A;  3VET A;  3AO5 A;  1XC3 A;  3MN5 A;  2OYQ A;  3VGM A;  3ZT1 A;  4FJX A;  3ZSX A;  4ZHR A;  5AZJ A;  3CCE N;  4DV5 K;  1E4G T;  2E1Z A;  2O8C A;  2YJF A;  4OVL A;  3SUQ A;  3TPQ A;  4KH5 A;  4JRP A;  1A5V A;  1Q8I A;  2WON A;  4JD2 A;  1NK8 A;  1TAQ A;  3C65 A;  4BWJ A;  5AR0 A;  2D0P A;  3CI5 A;  3EZ5 A;  4CGJ A;  2GEM A;  4FZY A;  4C8O A;  3DRR A;  1SAZ A;  2Q0R A;  4CBU A;  4A5B A;  1TK5 A;  3AVF A;  2O8F B;  1VRT A;  4IXC A;  2PAV A;  3B8A X;  3SZ2 A;  1R59 O;  2F8S A;  1EWQ A;  3U6F A;  2JLE A;  2P51 A;  5C2F A;  3AA4 A;  3HVR A;  2BUP A;  2W6K A;  1Z25 A;  5F0X A;  1JCF A;  4FPB A;  1CLQ A;  4KTZ A;  4HVJ A;  4OPK A;  2YNI A;  3R6M A;  3CCQ N;  5AQH A;  4C23 A;  1U47 A;  4FJ7 A;  3WNH A;  1JJ2 M;  3VQ6 A;  1KTQ A;  1RDA A;  3M8R A;  1QSL A;  3VOV A;  3JAM O;  4A62 A;  1NOZ A;  1TL3 A;  4EZ6 A;  3M8Q A;  2E2P A;  4XH1 A;  4BR0 A;  3M5R A;  3IMX A;  5AQO A;  2NRT A;  4DR7 K;  5D3G A;  4ELT A;  4JI6 K;  1KXP A;  1TUY A;  3JS6 A;  3ZT3 A;  3TU5 A;  2IOC A;  2O8D A;  1XWL A;  3SNN A;  4X64 K;  2OPS A;  4IDH A;  4V19 S;  4H5N A;  4HUG A;  1X3M A;  2X78 A;  3QBW A;  1DTT A;  2WTU A;  1NK7 A;  3DRP A;  3PX6 A;  5AQM A;  4PL8 A;  3NE6 A;  2RE2 A;  1BO5 O;  1K8K B;  1VQN N;  3TI0 A;  3N4P A;  2CGJ A;  2GUP A;  1TKX A;  4NO7 A;  1S9G A;  3ENH A;  1OH8 A;  5FPN A;  3VEO A;  1HX1 A;  4IWV A;  3TAN A;  1W7A A;  3AV9 A;  1YVU A;  5BPM A;  1C0F A;  3VPZ A;  3P38 A;  5AFU A;  3C95 A;  1QVG M;  1BCM A;  2G8U A;  3V6D A;  4BG9 A;  4FLW A;  4DQP A;  4YOW A;  2ASO A;  3DYA A;  3D2F A;  1S1U A;  3UE5 A;  3NCI A;  4H5W A;  3I33 A;  4K25 A;  1VQ8 N;  1RT4 A;  3AAQ A;  2QWL A;  3CPE A;  3VA3 A;  4B9L A;  3KWG A;  4FJG A;  4LD0 A;  1H1V A;  4DQ8 A;  3ALY A;  4CJ5 A;  3QBX A;  3C6A A;  3ZSQ A;  4JKB A;  4JKE A;  1BIS A;  4Q0B A;  4KH4 A;  1TK0 A;  1A5X A;  3EO3 A;  2GUI A;  1KD1 O;  4M3X A;  3EZW A;  3NH1 A;  1C0U A;  1R0A A;  3IS9 A;  5C42 A;  4DHY A;  4WFA L;  4XIU A;  3QEV A;  3A5M C;  3BGR A;  4IKF A;  2ASM A;  1GOA A;  3B6O A;  4IFV A;  3SUN A;  5AZI A;  2G8I A;  1YAG A;  2P9K B;  4BR5 A;  1JCG A;  2GWJ A;  2R7Y A;  3QEW A;  4FO0 A;  2VWK A;  3SBG A;  3T1Y K;  3EN9 A;  5BPL A;  4BRG A;  4O5B A;  4JEP A;  3MK6 A;  4C1N K;  2IAJ A;  3K0S A;  1KSP A;  4NYN A;  5I3U A;  4JKG A;  3QIP A;  3VQB A;  3LAL A;  3G4S N;  1NU0 A;  4DWI A;  1X9S A;  4PKH A;  3O3F A;  3K9K A;  3JSM A;  2AJQ A;  4YY3 K;  1VSK A;  5KQ8 A;  4KHU A;  4FJM A;  1LAW A;  3SQ4 A;  1V4T A;  2UU9 K;  2XRI A;  3RRG A;  1FKO A;  2YNF A;  4DV4 K;  3T3F A;  1C0T A;  3E9O A;  1VSD A;  2P5O A;  3BZK A;  1WLJ A;  1J54 A;  4DQR A;  3T69 A;  3CJC A;  3SK3 A;  3O80 A;  3VEN A;  1NJZ A;  4YOX A;  4KHS A;  1X9J A;  3QES A;  2YX6 A;  2G8W A;  2FSJ A;  4CIF A;  4E7J A;  2IVN A;  3DRS A;  4WF9 L;  1RT3 A;  2YI1 A;  2QWM A;  1D9D A;  4E0D A;  1BWF O;  4MLE A;  4CK1 A;  1OH7 A;  4TSX A;  4J2D A;  3L4I A;  4ISF A;  4OLB A;  2PYJ A;  2Q97 A;  2HNZ A;  3CC2 N;  5AJ3 K;  4CGF A;  3RSE A;  1TKD A;  1RT7 A;  3DLK A;  5LMN K;  2D4W A;  1KCF A;  1RT5 A;  5CE3 A;  5I42 A;  3HK2 A;  3VQE A;  4CHY A;  2FLO A;  3QO9 A;  3QIC A;  3G6E N;  3D45 A;  1NGA A;  4KH6 A;  5GAE P;  4L8R B;  3OYJ A;  2HST A;  3H08 A;  4DLE A;  3ENB A;  3OY9 A;  4CGG A;  4N76 A;  1J9A A;  5AZJ B;  3RMC A;  1UOC A;  3MMV A;  3MCP A;  5CZ1 A;  2GEL A;  3SPZ A;  4LC9 B;  2X6S A;  1HPZ A;  4A57 A;  4CEB A;  3W0L A;  3RVC A;  3V9S A;  4AM6 A;  4EIA A;  2QWO A;  3K5M A;  1LWC A;  2BTF A;  2P9L A;  5AQR A;  3WT0 A;  4H5V A;  4FSV A;  2E4L A;  3F2K A;  2WUS A;  1YF5 L;  2UUB K;  1JL2 A;  3V1R A;  2HVI A;  3CQ8 A;  5DK5 A;  4IJA A;  4YDU A;  1L3S A;  1VQM N;  2HVH A;  3HOS A;  4CZM A;  4HCB A;  3KLE A;  4CK2 A;  4DV7 K;  4FM1 A;  4RTF D;  4O55 A;  4E3S A;  1BU6 O;  2OA8 A;  1YTU A;  1C1C A;  2D0C A; 
#chains in the Genus database with same CATH homology
 1DGK N;  1N8R O;  3MN9 A;  1HKG A;  2A5X A;  3BP8 A;  3P39 A;  5AQF A;  5DM7 L;  4JKD A;  3A8Y A;  4YOV A;  2HBK A;  4QS7 A;  2CGL A;  4H5R A;  4OPA A;  4CZI A;  4RCH A;  4YOR A;  3H3N O;  3CCL N;  2AA4 A;  5AQT A;  1T3V A;  3CJA A;  1P8Z A;  3VGL A;  5KPZ A;  3CXC M;  3DXM B;  4BRA A;  4I6M B;  3A5N C;  3G25 A;  3VEX A;  3WQT A;  1ILY A;  3U8X A;  3VGK A;  3GE1 A;  2ASP A;  1ATN A;  4BC4 A;  4E1J A;  1WUA A;  1VQK N;  3MCA B;  4BVO A;  3EL2 A;  3VEY A;  1W2B M;  4B1U B;  1VQ6 N;  4WFB L;  2QW9 A;  4MDB A;  3O9Q A;  4HWI A;  3J8A A;  4M7Y A;  3FZM A;  3KVG A;  5M1K A;  4FOI A;  4GV6 A;  1GLE G;  1GLB G;  3SAH A;  4BRF A;  1YJ9 N;  2Q31 A;  3LDQ A;  4IEI A;  2E88 A;  2QM1 A;  3D2E A;  4K41 A;  4A2B A;  3CCV N;  3ZEU B;  4BC5 A;  3OA9 A;  3LDN A;  4WQ4 A;  2ZJR L;  5AQK A;  5BPN A;  5KPT A;  2V7Z A;  4CD1 A;  3I55 N;  1IJJ A;  3W3D A;  3VER A;  4R79 A;  3FGU A;  5AQJ A;  3CQX A;  4GV3 A;  2W40 A;  4B1Z A;  3VF6 A;  1NWK A;  4JNE A;  4BQZ A;  3AAR A;  1LOT B;  3IDH A;  5JMV A;  3F5T A;  3RSE B;  3ATV A;  3CC7 N;  3O6W A;  3G71 N;  1Z05 A;  3SMS A;  3VF2 A;  2HMP A;  3H3O B;  3ID6 A;  3FZH A;  5GAD P;  5JVH L;  1ZC6 A;  2QA4 N;  2OTJ N;  1YXQ A;  2J4R A;  4BRC A;  4B1X B;  4BRL A;  1RGI A;  3QML A;  2ZJQ L;  4C1N I;  3OBW A;  2QTD A;  1D4X A;  1S3X A;  3ENO A;  4PKI A;  1EQY A;  3DJC A;  2KHO A;  4BG8 A;  2I7N A;  3DAW A;  1DEJ A;  5JLH A;  1VQ5 N;  4BVP A;  3OHR A;  1XUP O;  2E20 A;  2VCP A;  4BC3 A;  3EE8 A;  3H45 C;  5JLF A;  1TUU A;  3AGK A;  4IOA L;  5HL7 L;  2NRV A;  2GX9 A;  1RFQ A;  3PIO L;  2CGK A;  3O4W A;  3D6R A;  3EKU A;  3SLC A;  3HM8 A;  4PHT X;  1VQ4 N;  2QWP A;  2A42 A;  3O9S A;  4BRK A;  1GLD G;  1C0G A;  1HUX A;  5BN8 A;  4BRE A;  3NMU A;  4MO4 A;  4Z94 A;  1JCE A;  2YHX A;  3O1W A;  3T7Z A;  2P9L B;  4BRD A;  3WQU A;  1S72 N;  4WYB A;  3S41 A;  1NGF A;  2E8A A;  4BRP A;  2FSN A;  3ULE A;  1ATS A;  2IVP A;  2ZWH A;  2V51 B;  1VAZ A;  1Q81 O;  5ELZ A;  1QVF M;  2P9S A;  3D7E O;  5AQW A;  4CD3 A;  3TSP A;  1NBW A;  1W97 L;  5C10 A;  4FWQ A;  1NGB A;  3LL3 A;  4FL9 A;  2WFB A;  5AZI B;  4H0T B;  2KKZ A;  3M3Z A;  3VET A;  3CCM N;  2P9P A;  5I9E B;  3WEE B;  5B8H A;  4ISE A;  5TKY A;  3LM9 A;  5BRF A;  5AQU A;  1XQS C;  1XC3 A;  2ITM A;  3MN5 A;  2YHY A;  3IKM A;  4BRM A;  2P9U B;  2A3Z A;  3VGM A;  1YJN N;  3MX5 A;  3OW2 M;  3MWP A;  4K42 A;  3AY9 A;  5AZJ A;  3CCE N;  1J6Z A;  2I7P A;  1E4G T;  2E1Z A;  4BRN A;  2YJF A;  3ZET B;  4WQ5 C;  3DXK A;  3TPQ A;  4KH5 A;  2WBN A;  1VQ9 N;  4WQ4 C;  4H0V B;  4JD2 A;  4FPA A;  3UKU B;  4FWS A;  3C65 A;  5AR0 A;  2AP1 A;  2D0P A;  3CME N;  1QHA A;  3CI5 A;  4NLC A;  2GEM A;  4K43 A;  3TTD A;  4BR2 A;  3QFU A;  1T44 A;  1SAZ A;  3TTF A;  2Q0R A;  4CBU A;  2Q36 A;  3HTV A;  4A5B A;  2V52 B;  2QI2 A;  2YHW A;  3GDQ A;  1K73 O;  1MWK A;  2QXL A;  3E9P A;  3KWI A;  4GVE A;  4IXC A;  2PAV A;  3B8A X;  3Q7C A;  5JVG L;  1R59 O;  3CET A;  3VTH A;  4YOY A;  2GTD A;  5C2F A;  1BOT O;  5AFU H;  1YI2 N;  4A59 A;  2BUP A;  3VEW A;  5C2D A;  3ZX3 A;  2P9K A;  3UKR A;  1MWM A;  4WFN L;  5F0X A;  1MDU B;  1JCF A;  3D2E B;  4FPB A;  2P9N B;  3A5O C;  4H0X B;  3LDP A;  2ZF5 O;  3P4I A;  3R6M A;  3CC4 N;  5AQH A;  3WXK A;  4C23 A;  3CCQ N;  1JJ2 M;  3EKS A;  3CHW A;  2ZJP L;  4ILG B;  3LDL A;  4HTL A;  3VOV A;  1O13 A;  4A62 A;  3F9M A;  5EY4 A;  2V7Y A;  3VTI A;  1GLC G;  2KLA A;  2QEX N;  4BR9 A;  3VEZ A;  3VES A;  2E2P A;  2QWN A;  4GY2 B;  4IZ9 A;  4XH1 A;  2ZGZ A;  3GL1 A;  5CHI A;  1NMD A;  4BR0 A;  3M5R A;  3IMX A;  5KPR A;  4FWO A;  5AQO A;  4I6M A;  2NRT A;  3CJ7 A;  3CQY A;  4CBW A;  3TSU A;  1KXP A;  3SAF A;  5LY3 A;  1TUY A;  3JS6 A;  3TSQ A;  3TU5 A;  5BR9 A;  4NLB A;  3R3L A;  5EVZ A;  5CR4 A;  3WXJ A;  1Q7Y O;  2HF3 A;  1ZBS A;  4A61 A;  3KK7 A;  2OTL N;  3O5B A;  1Y64 A;  4IEE A;  1GLA G;  4IOX A;  5GAH P;  1GLL O;  4IDH A;  1QQO A;  4H5N A;  1YUW A;  4H0P A;  5M1O A;  3CCU N;  5BRD A;  1X3M A;  3QBW A;  3GG4 A;  3LDO A;  1E4F T;  4FWN A;  1KC8 O;  2FXU A;  3ZX0 A;  3FZL A;  5LJW A;  5AQM A;  3QB0 A;  4CZK A;  3BF3 A;  4PL8 A;  5M1Q A;  3ZEU A;  3Q7B A;  4CZE A;  4YDU C;  2RE2 A;  3C6H A;  3AGR A;  2F9T A;  2HBM A;  1Q18 A;  5M1P A;  1BO5 O;  1K8K B;  2HOE A;  1VQN N;  1GLJ O;  2OAN A;  3ULE B;  1KAZ A;  3HRG A;  3N4P A;  1Q82 O;  2D1K A;  2CGJ A;  2P9I B;  1BA1 A;  1P90 A;  4CZL A;  1T6D A;  2GUP A;  2FF3 B;  4XEI A;  1HJO A;  4DCH A;  4NO7 A;  2WC9 A;  5F1X A;  1OVY A;  1GLF O;  3ATU A;  3ENH A;  4IFE A;  5EX5 A;  1Z6R A;  3MX2 A;  1NGH A;  4PKG A;  2NRR A;  1RDW X;  1YJW N;  5FPN A;  3VEO A;  4FWR A;  3CJ9 A;  1HX1 A;  4AM7 A;  4IWV A;  3BF1 A;  4UY8 O;  4CBX A;  1NM1 A;  4JKF A;  3CIP A;  4IO8 A;  5C12 A;  4B1Y B;  4GV9 A;  2EWS A;  2PFU A;  1ESV A;  5BPM A;  2P9P B;  3H1V X;  3OBY A;  1C0F A;  4QS8 A;  5MLC Q;  1YVN A;  3VPZ A;  3P38 A;  4PL7 A;  3R9P A;  5AFU A;  1QVG M;  5AQN A;  1G99 A;  2A6A A;  3L0Q A;  4BR4 A;  4BR7 A;  3ZX2 A;  1K8A O;  4OO1 J;  4U67 L;  4CI6 A;  1NGE A;  2UYT A;  4BG9 A;  3M6G A;  3PLA A;  5HOO A;  4YOW A;  2ASO A;  4BY9 C;  1U2V A;  3ID8 A;  3D2F A;  2H3G X;  3U9Z A;  4BRH A;  3UE5 A;  1YIJ N;  4H5W A;  3I33 A;  3SJH A;  1DKG D;  3QDK A;  4K25 A;  1K9M O;  3AAQ A;  3CPE A;  2QWL A;  1VQ8 N;  4CZF A;  2JWL A;  4O5F A;  1VQO N;  3KWG A;  4CZG A;  1HKB A;  1H1V A;  4DQ8 A;  3QBX A;  4JD2 B;  4YOT A;  4IO9 L;  2GWK A;  1CZA N;  5FPM A;  3C6A A;  3EE9 A;  1SQK A;  4JKB A;  5TKW A;  4MDA A;  3KHY A;  4JKE A;  3L6Q A;  2E2N A;  3O1B A;  3J7Z O;  4KH4 A;  1IG8 A;  1TYQ A;  5E84 A;  1ATR A;  3EO3 A;  2VWB A;  1KD1 O;  3DWL A;  2IIR A;  3EZW A;  1KAX A;  4B1V A;  4EAH D;  2BH1 A;  2F9W A;  2E2O A;  4DHY A;  2Q1N A;  4WFA L;  4JHD A;  2VGM A;  3A5M C;  1M1K O;  5EXW A;  3WUH A;  2ASM A;  2NLX A;  4BRO A;  5AZI A;  3VEV A;  1YAG A;  2P9K B;  3UKR B;  1JCG A;  2GWJ A;  4BR5 A;  4ILH A;  3FZK A;  1HLU A;  2D0O A;  4FO0 A;  5GAG P;  5ADX A;  5AQQ A;  3SBG A;  2Q0U A;  4NB4 A;  3EN9 A;  3GBT A;  3C7N A;  3HZ6 A;  4FWL A;  4BRG A;  5BPL A;  2PBD A;  2YJE A;  5GIO A;  2P9U A;  2RHK A;  3IUC A;  4JEP A;  3MK6 A;  4BC2 A;  1HKC A;  4C1N K;  4JK8 A;  4BRI A;  4JKG A;  1SZ2 A;  1QQN A;  2QWR A;  4ILJ A;  3QFP A;  2NZT A;  4BQL A;  1NGC A;  3ZET A;  2YCH A;  4EFH A;  4EHU A;  3MWT A;  3U4L A;  4A5A A;  1VQL N;  4MO5 A;  3G4S N;  3CD6 N;  3WXL A;  3FZF A;  2ZGY A;  3MN6 A;  3UKU A;  1T6C A;  3FLC O;  4PKH A;  2CH6 A;  4M63 C;  3VMF B;  3SAG A;  4DKW A;  5KQD A;  5FPD A;  5FPE A;  3K9K A;  4RWT A;  5M1F A;  1BA0 A;  3MN7 A;  3H1Q A;  3NVM A;  5AQX A;  3DXM A;  3BEX A;  3CCS N;  5KQ8 A;  1EO1 A;  1S22 A;  5AQL A;  4GNI A;  1KQS M;  2E2Q A;  5GIN A;  1V4T A;  2JWK A;  2NNW A;  1M90 O;  2A40 A;  3SMP A;  3GOI A;  5AQY A;  2Q2R A;  3PIP L;  3E9O A;  1VQ7 N;  1NJI O;  4JKH A;  1MA9 B;  5M1N A;  5LJV A;  3R8E A;  3E66 A;  4WQ5 A;  2P9N A;  5AQP A;  3CF5 L;  3C0B A;  4J8F A;  3T69 A;  1NGI A;  1QZ5 A;  3CJC A;  3SK3 A;  3O80 A;  2VYP A;  3VEN A;  4B9Q A;  4YOX A;  1X9J A;  5ADX H;  2NRH A;  2YX6 A;  2HBJ A;  4L3Q A;  4XH4 A;  4BRQ A;  4IJN A;  4H03 B;  3JXU A;  2FSJ A;  3CCR N;  5BRE A;  3O9T A;  3O9U A;  3WXI A;  4U7B A;  2IVN A;  3DLL L;  4WF9 L;  4KBO A;  4XH5 A;  2YI1 A;  2QWM A;  3SBT A;  3K9J A;  3A0I X;  1U6Z A;  3H6E A;  1BWF O;  3I8B A;  4MLE A;  5GIP A;  2NRZ A;  5AQS A;  2W41 A;  4H0O A;  3E1Y A;  2IVO A;  5DM6 L;  3L4I A;  4ISF A;  3CER A;  3HSC A;  3NVK A;  5BRH A;  2Q97 A;  4CJ7 A;  3CC2 N;  3M1F A;  4Y0W A;  3CMA N;  3AAP A;  2NRW A;  3O9R A;  4WCE L;  5H1S Q;  2P9S B;  3CJB A;  3IFR A;  3RSE A;  3FFK B;  4YOU A;  1BUP A;  2D4W A;  1NLV A;  1KAY A;  5CE3 A;  3I56 N;  3CJ1 A;  1X3N A;  2FLO A;  2FF6 A;  4H0Y B;  4JKA A;  1U2V B;  3QIC A;  3G6E N;  2F7T A;  1BG3 A;  1NGA A;  2VGN A;  3D2F B;  4ISG A;  4KH6 A;  4IOC L;  1DT9 A;  4CZJ A;  5GAE P;  3A5L C;  4FWM A;  3H46 O;  1RDU A;  2HST A;  5AQZ A;  4JK7 A;  5AQI A;  5JIC A;  3O08 A;  4M7X A;  3HBT A;  4DB3 A;  3ENB A;  1NGJ A;  2HBL A;  4JAX A;  5E26 A;  4G9Z A;  1NGG A;  1OKJ A;  3FR0 A;  3N4Q A;  5AZJ B;  1K8K A;  2QWQ A;  1QQM A;  3MMV A;  3MCP A;  2P9I A;  5F2R A;  2GEL A;  3DXK B;  4LC9 B;  1TYQ B;  3R1X A;  3U9D A;  3WXM B;  4A57 A;  1QZ6 A;  1VQP N;  4FVU A;  3W0L A;  3RVC A;  4B1W B;  4BGA A;  4AM6 A;  4EIA A;  3O8M A;  2QWO A;  4A2A A;  2BTF A;  1NGD A;  1Q86 O;  2P9L A;  4MLH A;  5AQR A;  3WT0 A;  4H5V A;  4FSV A;  3FE1 A;  1YHQ N;  1SS6 A;  3F2K A;  1LCU A;  3LM2 A;  2WUS A;  4JK9 A;  3MDQ A;  4JHD B;  4QS9 A;  3HI0 A;  1YF5 L;  3ZYY X;  5EOY A;  1HPM A;  5BN9 A;  3P31 A;  1ZXO A;  4OPH A;  5C0Y A;  4IJA A;  3L4Q A;  5C15 A;  3E9L A;  4FOE A;  5AQG A;  3KZB A;  4FWP A;  3C7N B;  4YDU A;  1VQM N;  1BDG A;  3HOS A;  1YIT N;  4JN4 A;  2FSK A;  2NRX A;  3HOT A;  4CZM A;  3CCJ N;  2HF4 A;  5AQV A;  3BUZ B;  2E1Y A;  4FWK A;  3UB5 A;  2CH5 A;  4JKG B;  4CZH A;  2DPN A;  3TTC A;  3WEE A;  1V4S A;  4RTF D;  4BGB A;  1WOQ A;  3VF4 A;  4JKC A;  2A41 A;  4F9O A;  1BU6 O;  4EHT A;  4O8U A;  4H5T A;  4AF1 A;  4O8K A;  3CPW M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...