3SK3A

Crystal structure of salmonella typhimurium acetate kinase (acka) with citrate bound at the dimeric interface
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
398
structure length
385
Chain Sequence
SKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGGDIDPAIIFHLHDTLGMSVDQINKMLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
molecule keywords Acetate kinase
total genus 133
structure length 385
sequence length 398
chains with identical sequence B
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A02
1XQSC 4JAXA 2PAVA 5AQPA 4GY2B 1E4FT 1H1VA 2Q36A 4NO7A 3D2FA 2DPNA 3BUZB 2NZTA 4XH1A 2Q0RA 1S3XA 2VYPA 4FWPA 4WQ5C 2QXLA 4CBUA 5AQIA 4FPAA 4QS7A 3EN9A 4RTFD 2ZGYA 2QW9A 4CD1A 4CZEA 3QFPA 1HKBA 3D2EA 3LL3A 3LDOA 4BQZA 3VESA 1QZ6A 2YJFA 2WUSA 3LM2A 5AFUA 5FPMA 3H45C 3DJCA 4JD2B 4NB4A 3KVGA 4M7XA 4BGBA 2P9LB 2V7ZA 2VCPA 3IMXA 4H03B 4BVOA 4A2AA 5AZIA 5BRFA 5F0XA 5FPDA 4K41A 4BRLA 1BU6O 4A2BA 4FWLA 5TKYA 4XH4A 3S41A 4BRMA 3I33A 3RSEA 3O4WA 3A8YA 3CI5A 4B1XB 2A42A 2D4WA 5F2RA 3WXIA 2H3GX 3SMSA 2AP1A 3VENA 3IDHA 1TYQB 1GLJO 3H6EA 5AR0A 3VEOA 4YDUC 3EKSA 1R59O 1U2VA 4FL9A 3ZX3A 3CJCA 2F9WA 1RDWX 2ZGZA 3C7NA 4H5RA 5E26A 5AQJA 4DCHA 1G99A 1DGKN 4ISEA 3H46O 2P9PA 2V52B 1NLVA 1YVNA 4BREA 3MCPA 3MMVA 3U8XA 3LM9A 4BRGA 4CZHA 3WEEA 3RSEB 4FWNA 3CHWA 1WOQA 1S22A 4EHUA 3B8AX 4H0XB 3LDNA 1X3NA 1JCFA 2Q97A 4AM6A 5ADXH 1E4GT 3CJ7A 4O8KA 5KPRA 1GLCG 1IG8A 2YHWA 3H3OB 2ASOA 3MN5A 4H5NA 2QWQA 3LDLA 5AQFA 5I9EB 3AAQA 4JD2A 1HPMA 1BA1A 1NGCA 5JLFA 3M6GA 3DXKA 1BOTO 3L6QA 2ITMA 4BR2A 2VWBA 4AM7A 4BR5A 1NM1A 2QWNA 4QS9A 1EQYA 2YJEA 4C23A 1SQKA 2A3ZA 3CQYA 3A5LC 3R8EA 1NGHA 5BRHA 4PKHA 1D4XA 2YCHA 4MO5A 3DAWA 4RCHA 4FO0A 4Z94A 5AZJA 5EY4A 5EOYA 4WQ5A 4DHYA 4FPBA 2CH5A 3QBWA 4MLHA 3GL1A 4FOEA 3VF4A 4H0VB 3ZEUB 1U6ZA 5AQGA 4WQ4C 3QDKA 4FOIA 3L0QA 2P9NA 2OANA 2P9KA 4H0PA 2Q0UA 4BRNA 2E20A 3ZEUA 1TYQA 1LOTB 3HM8A 2A41A 2FSJA 3ENOA 3UB5A 1NBWA 1GLFO 3R9PA 3UKRA 1TUYA 1KXPA 3GG4A 3MN9A 4H5VA 2FSKA 5AQLA 3MK6A 1HUXA 1SZ2A 1T6DA 4EFHA 3G25A 4MLEA 4A61A 4BR4A 4FWOA 4BRQA 3W3DA 3UKUA 2E8AA 2QM1A 3O5BA 2D1KA 5BREA 3CJBA 3O1WA 3VPZA 2P9NB 3EKUA 1RGIA 1BWFO 2D0OA 4BG9A 3GOIA 4KBOA 4JHDB 4FWSA 1KAXA 4FWMA 3FZKA 1NGAA 4IXCA 4H0TB 4BQLA 4CI6A 3SK3A 3U9ZA 4PKIA 2FXUA 3WXLA 3AARA 4BG8A 2FSNA 4IZ9A 1DKGD 2V51B 1ESVA 3R6MA 3IUCA 2QWOA 2P9IA 3DXMB 1BUPA 1NWKA 3VEZA 1BO5O 3WQUA 1KAZA 3ZX0A 4IWVA 3BF3A 1X3MA 1MWMA 1NGGA 3KHYA 3WXJA 1NGJA 3ULEB 4K43A 1X9JA 4B1VA 3I8BA 1GLLO 1WUAA 3UKUB 3WUHA 3CETA 3ENHA 3VF6A 3C0BA 2P9UB 4BGAA 2IIRA 2ASPA 3CIPA 4Y0WA 5LY3A 5ELZA 4BC3A 3U4LA 4WQ4A 3EZWA 1IJJA 4BR9A 4BRAA 4CZJA 4GNIA 4HTLA 5F1XA 3QB0A 5CE3A 3A5OC 5AFUH 3FZFA 2HF4A 3L4IA 2FLOA 3BF1A 5AQVA 5AQZA 3VGLA 1QHAA 4CZKA 2CH6A 3C7NB 3A5MC 2Q1NA 1CZAN 2BUPA 4QS8A 1NGBA 3GE1A 4M63C 3DXKB 4PL8A 3JS6A 3EO3A 2W40A 3D2FB 1YAGA 3P4IA 2KHOA 4BRCA 1ATRA 3OHRA 2I7PA 1C0GA 5KQDA 1JCEA 3ZETA 5KQ8A 1HLUA 3FZMA 3W0LA 2NLXA 2YI1A 3CERA 3VETA 3EL2A 3DWLA 2AA4A 3VEWA 2CGKA 3VOVA 4DB3A 2YHYA 2P9PB 3JXUA 1ATNA 5AQNA 3SLCA 4JN4A 2CGLA 1U2VB 4PKGA 2E88A 3D7EO 1NGFA 4I6MA 2IVPA 1Z6RA 1JCGA 3H1VX 3WQTA 4CBWA 3HZ6A 1Q18A 4CZFA 2GWKA 3FZLA 2QWLA 2P9IB 3VEYA 4CD3A 5AQUA 2GWJA 1T44A 1NGEA 1LCUA 3CJ9A 5AQKA 1MWKA 4E1JA 2UYTA 1P8ZA 5BRDA 2GEMA 4FWQA 4WYBA 3SJHA 3UKRB 4CBXA 2Q31A 1QQMA 2IVOA 2E1YA 5B8HA 1TUUA 4L3QA 4BRDA 3M3ZA 4FSVA 2P9KB 3GBTA 1HKCA 3CJAA 4H0OA 5AQSA 4K42A 1KAYA 3H1QA 4I6MB 3D2EB 4XH5A 3VEXA 2GUPA 5AQQA 3U9DA 2QWPA 4H5WA 3ATUA 3QICA 3QBXA 4CZIA 3IFRA 2ZF5O 3ATVA 2E2NA 5AQRA 3AY9A 2D0PA 3BP8A 3WXKA 1HX1A 3O80A 3F9MA 4YDUA 2E2QA 3O8MA 4O5FA 4JNEA 3VGKA 2I7NA 1BG3A 1HKGA 2J4RA 2E1ZA 4JHDA 4F9OA 5E84A 5LJWA 3A0IX 5ADXA 5EXWA 1ZC6A 4B1ZA 3LDPA 1ZBSA 4ISGA 4M7YA 3FLCO 2FF3B 2HOEA 4BR7A 1GLAG 5JICA 2GTDA 5AQHA 4K25A 4XEIA 1MDUB 2P9SB 2W41A 2HMPA 3A5NC 2A6AA 5BPLA 4CZGA 5AZJB 1K8KA 3O6WA 1ZXOA 3HSCA 3WEEB 4RWTA 5FPEA 1NGIA 3FGUA 4CZLA 3WT0A 3QMLA 2GELA 3VERA 2Q2RA 2P9UA 3O08A 3TPQA 4B1WB 1NGDA 4H5TA 4IJAA 5BPMA 3QFUA 1RFQA 2FF6A 4HWIA 2BTFA 5BN8A 5JMVA 2E2PA 3ULEA 3VF2A 2PBDA 5FPNA 1BA0A 4BC2A 3FFKB 4BRKA 1J6ZA 5AQYA 4MO4A 1C0FA 3VEVA 1Y64A 3ZX2A 2E2OA 4CJ7A 5EVZA 5EX5A 3ZETB 4LC9B 3HBTA 4DQ8A 3MN7A 5BPNA 4J8FA 3O1BA 4H0YB 5AQMA 2HF3A 5BN9A 3FZHA 5AQXA 3CQXA 2F9TA 5KPTA 1YXQA 1XUPO 1BDGA 3ID8A 4B1UB 3HTVA 2P9SA 3SMPA 3TU5A 2ZWHA 5KPZA 1NMDA 1V4TA 3MDQA 4BR0A 2A5XA 2EWSA 2V7YA 3CJ1A 3HI0A 1OKJA 1XC3A 2A40A 3GDQA 2ASMA 4BC4A 2YHXA 2QWRA 4BRHA 1QZ5A 3KZBA 4BROA 1V4SA 3FE1A 2NRHA 4BRIA 4B1YB 1GLBG 3AAPA 5LJVA 1GLEG 5JLHA 1SAZA 3FR0A 1HJOA 3UE5A 1DEJA 4ISFA 4FWKA 1Z05A 3MN6A 2P9LA 4EHTA 1K8KB 3H3NO 1ATSA 3LDQA 5AQOA 3M1FA 1QQOA 1MA9B 5AZIB 4BVPA 3BEXA 2IVNA 4CZMA 1QQNA 5AQTA 4BRFA 4EAHD 2CGJA 3J8AA 4PL7A 4BC5A 4IO8A 4FWRA 4B9QA 1GLDG 1YUWA 3VGMA 2QWMA 3DXMA 4A62A 1T6CA 4EIAA 5AQWA 4BRPA 4IJNA 5BR9A
chains in the Genus database with same CATH superfamily
4JAXA 3J81O 3P39A 4GVMA 3JSMA 2O8EB 3AVKA 4FJXA 2DTUA 1S3XA 3ISNC 4GV9A 4CHYA 4IEIA 4FWPA 4CBUA 2QW9A 5M1FA 1N36K 5HRSA 3LL3A 1HPZA 3LDOA 2D5RA 3MX5A 4NYFA 3HPGA 3E9PA 3DJCA 3HL8A 4DU1A 2V7ZA 3IMXA 4CHPA 3SUQA 5AZIA 5BRFA 5F0XA 5HLFA 3CC7N 1BU6O 1E3MA 4DFPA 4M41A 4O0JA 1BQNA 3A8YA 3CI5A 2A42A 2F96A 3VENA 4F4KA 3IDHA 3MECA 5AR0A 3VQ4A 1W2BM 4YDUC 3QIPA 1R59O 3CJCA 1RDDA 3MWPA 2UXDK 1RDWX 2ZGZA 5AQJA 2OZMA 3ZSQA 4WE1A 1NK7A 3OYKA 2Z1IA 3THWA 4CZHA 2G8HA 1BL3A 3SI6A 1Q81O 4BY9C 3RSEB 4FWNA 4EHUA 1S22A 2R7YA 4DQPA 4K0KK 2Q97A 4DV1K 3CJ7A 4BWMA 4DR1K 3OTOK 3PUFA 4KHSA 4NCBA 4HUFA 3AVGA 1NK6A 2X78A 3RMCA 4AHTA 4B3MK 1NKCA 3N4PA 3DXKA 4B8AB 1VSKA 2IS3A 2ITMA 4FJMA 4JRPA 1TL3A 4KHYA 1NM1A 1VSLA 3VA3A 4B08A 1QQCA 1RT1A 4C8LA 1SQKA 3CCMN 3CQYA 3H08A 3DOKA 3CPEA 1NGHA 3KK3A 3SPZA 4PKHA 2YCHA 4PUOA 1JKHA 2D0AA 4FK2A 5DM7L 5J2MA 4CHNA 4JI6K 1YIJN 3GL1A 4LY7A 4H0VB 4UQGA 5AQGA 3EE9A 1SKSA 3L0QA 3F5TA 3ZSZA 4H0PA 4BRNA 3E9OA 2E20A 1LOTB 2A41A 3HPHA 2ZE2A 3MEDA 2Z1HA 3SQ4A 4DU4A 1JL2A 1KXPA 3MN9A 2O8DB 4DUYK 2FSKA 1J54A 3V9SA 3MK6A 5GADP 2O8BA 3AA5X 3ZSRA 1EO1A 5GINA 1L3VA 3V1RA 4JK8A 1RDUA 3TTDA 4BRQA 3W3DA 1XHXA 1TK5A 3UKUA 1HQUA 4OGEA 3OYMA 4E7JA 3CJBA 1BWFO 4DTNA 3TARA 4FWMA 3B6PA 3FZKA 4IXCA 1EXQA 3EY1A 3U9ZA 4PKIA 2FXUA 5T7BA 4DR4K 4JS4A 2X6NA 1ESVA 3LZIA 3NF7A 4KB0A 2QWOA 3OYBA 3ALYA 4FK0A 3LP0A 5CZ1A 1RTHA 1JXEA 4DS4A 5EU7A 1C1AA 1MWMA 3KHYA 2WTUA 2KFZA 5C15A 3OY9A 4B1VA 3ZT4A 1GLLO 3WUHA 3CETA 3ENHA 4LFAK 4DV3K 2IIRA 4WQ4A 3C6AA 4BRAA 1VRTA 4CZJA 5F1XA 2G8UA 4OKJA 5CE3A 5KRTA 1WB9A 3A5OC 4DLEA 2HF4A 3ID6A 3C7NB 4JK9A 3TAQA 3MCAB 4CEFA 1CZAN 4DUZK 3NH1A 1Q86O 4OPHA 3LPTA 4PL8A 3JS6A 1S5JA 3NGIA 2VWKA 2OCEA 3VQAA 4JS5A 3D2FB 4BRCA 4JI5K 3TR8A 2PY5A 3K5NA 1I3AA 3AV9A 3L2RA 2I7PA 5KQDA 1TK8A 3RRGA 3OYLA 2CGKA 5SZTA 2P9PB 5AQNA 4DTPA 2XY7A 3SLCA 4JN4A 1P90A 4I6MA 4JKFA 1Z6RA 3H1VX 4GVEA 2OYQA 1RTDA 3G0ZA 2O8FB 3DLLL 4DSJA 3FZLA 2QWLA 3VEYA 1T44A 5AQKA 3ZSOA 1KVBA 3CFRA 5BRDA 2GEMA 2Z1JA 5JVGL 1VSHA 4CBXA 2Q31A 3VQ8A 5B8HA 4J2EA 4L3QA 5M1NA 2P9KB 1ZBHA 1Z25A 1LW0A 4W5QA 4FLXA 4XH5A 4DTSA 3IS9A 1BIUA 1JLEA 2JLEA 3NMUA 4JKBA 3ATVA 4JKCA 3TAEA 1HX1A 1QHTA 2E2QA 1JLAA 3MEEA 4O5FA 1JLCA 3OYNA 1J5OA 4CEBA 4FJKA 4AHRA 2OPPA 3QIOA 3ZSVA 4DV6K 4IBNA 1WLJA 2GV9A 4O4GA 2F8TA 2J4RA 4KH6A 4Z4GA 4JHDA 4I7FA 4DFKA 4B1ZA 3LDPA 4I2QA 1ZBSA 4ISGA 3FLCO 1VQON 4CHOA 4K25A 2UUCK 1MDUB 2P9SB 4NYNA 1L3SA 3CFOA 2A6AA 3NGZA 3O6WA 3HSCA 4RWTA 1YT3A 2P51A 3FGUA 3TAFA 4MFBA 4FW2A 4NLCA 3QEWA 1KCFA 1LV5A 4CJWA 4CJPA 3L3UA 4YOTA 4H5TA 1JJ2M 3IG1A 5FROA 1GOAA 4FZYA 4OLBA 5GIOA 2P5OA 2O8CA 1UWBA 3I56N 2E2PA 3KK7A 3VF2A 1BA0A 4BC2A 3FFKB 4LH4A 4DTXA 3RMBA 4LD0A 1YJ9N 1NJWA 4DR2K 2NUBA 1Y64A 4Z4EA 5EVZA 3ZETB 4LC9B 5CZ2A 4DTRA 4DTOA 3F9KA 3PO4A 3RWUA 5AQMA 4CEEA 5BN9A 4IDKA 2B4JA 4KHPK 1YXQA 3T69A 1CZ9A 1KFDA 2VGNA 3HTVA 2P9SA 2QI2A 4FJ5A 4BR0A 4IFEA 1NKBA 5HRNA 3SV3A 3PX6A 4AH9A 2A5XA 4FJNA 5C25A 2IAJA 1RNHA 1YITN 1FXXA 3MEGA 2OPQA 2ZJQL 1XC3A 3V9XA 3NH2A 3GDQA 1OH8A 1LWEA 1W97L 3OYFA 3TI0A 4CVNE 4B9MA 2NRHA 4KH4A 1WAFA 2NRXA 1TVRA 4B1YB 3LWLA 4CEOA 3SCXA 5LJVA 3B6OA 5JLHA 2O8BB 3FR0A 5M1PA 3QEPA 3SBGA 3M8SA 4JI7K 4M3WA 1HYZA 1Z05A 3NE6A 4CFDA 3CMAN 1U49A 3M1FA 1KTQA 1MA9B 1NOYA 2HHHK 4J2DA 3T1YK 4N5SA 4MDAA 1QQNA 3M8QA 4EAHD 1UAXA 4ILJA 4EP5A 3OS1A 4IKFA 1YUWA 3VGMA 3QETA 1T6CA 4BRPA 1SL0A 2KKZA 4FVUA 1ASWA 1S72N 1XQSC 2PAVA 4R79A 3QEXA 1CLQA 2HMIA 4FVMA 4GY2B 1E4FT 1H1VA 1BQMA 3BUZB 4ELUA 2JGUA 3VQCA 2VYPA 1VQ7N 1C1CA 2QXFA 2NNWA 4WQ5C 3OW2M 4I9QA 5AQIA 4QS7A 3AVIA 3WNEA 3OBYA 4CD1A 2BANA 3QFPA 4LF8K 5HBMA 3RR7A 3VESA 2YJFA 2WUSA 4AHUA 5HRRA 5FPMA 3RVCA 3H45C 4NB4A 5HP1A 4BGBA 1D5AA 2VCPA 2IGIA 4A2AA 2YV0X 5FPDA 1WSGA 4IDHA 1XWLA 3R1XA 5TKYA 2UXCK 4BRMA 3RSEA 3O4WA 3OBWA 3KD5E 3I0SA 5F2RA 4GW6A 1U47A 2AP1A 3OS0A 1RTIA 1ASVA 2FC0A 2JWKA 3C6UA 3HYFA 3VEOA 4WF9L 3EKSA 4KKOA 1U2VA 3AGKA 2F9WA 3LANA 4LFCK 4H5RA 5E26A 4FM2A 4DCHA 4KAZA 4L8RB 1BI4A 2QKKA 1DGKN 3K5OA 4FLTA 2P9PA 2V52B 3WNGA 1NLVA 3CQ8A 1X9WA 2PZSA 3P5JA 4BREA 3MMVA 4BRGA 5GAEP 4B3SK 3WEEA 3QEVA 3ZLJA 4CF0A 1HQEA 3CHWA 3HO1A 1WOQA 3B8AX 1E4GT 4DWIA 5KPRA 4O55A 2O8FA 1GLCG 2P5GA 4B8CA 1IG8A 3H3OB 2DFEA 3LDLA 4H5NA 3AAQA 2A1SA 1JLGA 4DQSA 3SUOA 1ITGA 3L6QA 3PV8A 2ZD1A 3DLRA 3S3NA 3D45A 2QWNA 4QS9A 3SYZA 4UY8O 3MXMA 4CCHA 1NK4A 3A5LC 3F73A 4KREA 5BRHA 4CF1A 4DQIA 5AZJA 3DLKA 3OVNA 1X9SA 5EOYA 4FPBA 2GUIA 2CH5A 1RT3A 5KI6A 1U6ZA 1R0AA 1TKXA 1D9DA 3LP1A 4CEZA 1FKOA 2D0CA 3VQPA 1TYQA 3UB5A 1NK5A 1EWRA 4B3RK 3R9PA 3S9HA 2KZZA 4AHCA 1VRUA 3GG4A 4YNQA 3HM9A 3AGRA 3C94A 1VSIA 3S3OA 4N56A 1T6DA 4OPKA 4MLEA 3O9TA 4BR4A 4FWOA 4C1NI 1DTQA 1QVFM 3NBPA 2E8AA 2QM1A 5M1OA 2LSNA 4BWJA 3D6RA 4H4OA 2OZSA 3CCEN 4DSLA 3L2WA 3AVJA 3EKUA 4DQRA 3GOIA 4KBOA 3JYTA 4CI6A 2DFHA 4LF9K 5D3GA 4I2PA 3V1QA 4BG8A 2O4GA 4B9TA 4M3YA 1DKGD 1VHXA 3NCIA 3O4QA 1IO2A 4IFYA 2P9IA 3BY5A 4IOCL 1BUPA 1NWKA 1KC8O 4Z4IA 5E41A 2OTLN 3RMDA 5J2PA 1BO5O 3QINA 4OKEA 4YOXA 1KAZA 1I39A 4IWVA 3BF3A 2HVIA 2VWJA 1NGGA 1QE1A 4YOVA 3ULEB 1X9JA 2KW4A 3P31A 3I8BA 3VN5A 1WUAA 1X1PA 2P9UB 4CIEA 2W6LA 2ASPA 4HCBA 5ELZA 4BC3A 4IFVA 3U4LA 4Z4HA 3O9UA 4RW8A 4M3ZA 3C6HA 3CYMA 4CGGA 3AO4A 4NXMK 3O9SA 3QB0A 1YF5L 3OYIA 3LAKA 4IOAL 4CF2A 2IC3A 3BF1A 2B5JA 2CH6A 1RBVA 3WXMB 3QO9A 5C0YA 2Q1NA 1Y97A 3CFPA 3E01A 4A5AA 1NGBA 2YNIA 4GKKK 3DXKB 3V4IA 3THXA 2HHQA 4CJKA 2W40A 5C2DA 3K9JA 2X74A 1KD1O 2O8EA 1ATRA 4BE0A 1C0GA 1JCEA 1JLFA 4JV5K 4OX9K 1ILYA 2Q3SA 1CZBA 4CJQA 3L2VA 3EL2A 3VTHA 3LWMA 1KQSM 1WBDA 3VOVA 4N47A 4DR7K 2CGLA 1U2VB 4PKGA 4HUGA 3KLHA 4BE2A 2E88A 3RMAA 3WQTA 1JCGA 4DR5K 1M90O 5CYQA 4B9LA 5LL6Z 3K9KA 1Q18A 1VSJA 4KTWA 4CGDA 3DM2A 4JKGB 1NK0A 2RF2A 2GWJA 2RE2A 2G8IA 3VQDA 3T19A 4WYBA 3SJHA 2E6LA 2XY6A 1VAZA 3E9LA 4YOWA 4E1MA 3NHGA 4FSVA 1HKCA 3CJAA 1XMQK 4JI1K 3PLAA 4ID5A 4DR3K 1JL1A 1BIZA 3Q7CA 2FBXA 3VEXA 4FJ9A 4LFBK 5AQQA 2VG5A 1YJNN 3QBXA 3IFRA 4HUEA 3K2PA 3CMEN 3DLEA 2E2NA 4JI0K 1UA0A 3BP8A 3R3LA 3WXKA 3O80A 3F9MA 4YDUA 4CJ3A 4M3UA 3O8MA 4FK4A 4ZHRA 3PX0A 3VGKA 1BG3A 1HKGA 4W5NA 3G4SN 1T05A 3A0IX 1T7PA 4WFNL 1S1UA 4DTMA 3I55N 3NAEA 2HMPA 4FYDA 4OPAA 4CJFA 1IKWA 1CXUA 5AZJB 3K59A 1K8KA 3TTCA 1W0HA 1ZXOA 5CHIA 5M1QA 3RR8A 3OYEA 1HNXK 2W42A 5LMUK 2Q2RA 2P9UA 3O08A 4B1WB 4WCEL 1NGDA 3TSUA 2KQ2A 2W6KA 2XY8A 4M45A 4CJ5A 1RBUA 2IDOA 1RCHA 1RFQA 2FF6A 2BTFA 2G8VA 2KZMA 3ULEA 4JRQA 3U6FA 3DRRA 5FPNA 4C8OA 3VQBA 1Q9YA 4B9VA 3O3FA 3CD6N 1ASUA 1N5YA 4YORA 1Z26A 3SUPA 2E2OA 1ZBFA 4CJ7A 2HW3A 2B6AA 3HJFA 4CK2A 4M42A 3MN7A 1S1VA 3O4NA 5BPNA 4ZTJA 4J8FA 4B9UA 3T1HK 4KO0A 3CQXA 4GV6A 4Z4CA 2ZJRL 2ZWHA 1NMDA 3THWB 3ZT0A 1XMOK 4QAGA 3VQ6A 2V7YA 3THXB 2O4IA 4KHUA 2A40A 3RTVA 2YHXA 2E4LA 3O9QA 3FE1A 3HOSA 3AA2A 3KWIA 2KTQA 4CJEA 4RW4A 1Q8IA 4BDZA 4CGJA 3CPWM 4EHTA 1K8KB 3EZ5A 3H3NO 3LDQA 4YFUA 1QQOA 4X64K 2DFFA 5JS1A 3NVKA 5DM6L 3BEXA 1VQLN 3K57A 3ULDA 3UIQA 3FFIA 4BRFA 1HRHA 1KVAA 2CGJA 3J8AA 1U4BA 4BC5A 4IO8A 4FWRA 4E0DA 4B9QA 1J5EK 4RW7A 2UUBK 1SUQA 3DXMA 3MWTA 2FBYA 4IJNA 5BR9A 5GAHP 1S9EA 1N8RO 2OPRA 1EKEA 1HMVA 5AQPA 2Q36A 3K0SA 4KHNA 2DPNA 2NZTA 4XH1A 4DFMA 1VK0A 1IBLK 3SUNA 2FBTA 1OH6A 4O5BA 1SKRA 4FPAA 1ZBIA 4RTFD 1Q7YO 2ZGYA 4CZEA 1GOCA 4CF9A 1HKBA 3DLHA 2PFUA 3D2EA 4C8MA 4BQZA 4FJHA 4JD2B 4M3XA 4M7XA 1S6QA 3M8PA 2BGGA 3LZJA 3AVHA 4K41A 1RT2A 4FWLA 5DK5A 4CIGA 4HHTA 4KHQA 3I33A 1VSDA 3PX4A 4DR6K 1HNWK 2H3GX 3SMSA 3H6EA 1VQ6N 2KFNA 4GKJK 3DRSA 3V9ZA 5J2NA 1LWCA 4JKDA 1T03A 3OS2A 2O8CB 4KH5A 1ZBUA 1J9AA 3Q7BA 4CE9A 4M3RA 3WNHA 1HNZK 1C0TA 1VQ8N 4O8KA 3VQ7A 2EHGA 2ASOA 3MN5A 5I9EB 4Y1DA 4DMNA 1O13A 1BA1A 1NGCA 4Y1CA 3M6GA 3QNNA 1BOTO 5I3UA 3IAYA 4AM7A 4BR5A 5LMNK 4OVLA 1EETA 4CFAA 1YVUA 4JK7A 4DTUA 1EQYA 3LAMA 1XHZA 3R8EA 4O8UA 2QA4N 2X6SA 1D4XA 4CHQA 4MO5A 3DAWA 4RCHA 4FO0A 4KFBA 4Z94A 1OH7A 2YHBA 4F3TA 1WBBA 4FXDA 4WFBL 3SAGA 3TAMA 4JI8K 4MLHA 4FOEA 3NF6A 2RHKA 2VGMA 3ZEUB 4ELVA 4WQ4C 2Y1JA 3QDKA 4FOIA 4FJGA 3S3MA 1RTJA 1M1KO 2G8KA 3AO5A 1W7AA 2JWLA 1NU0A 1ZYQA 3ASMA 2FSJA 3ENOA 4IG3A 1NBWA 3ZT3A 3TSPA 1RDCA 1GLFO 4G1QA 2UU9K 3LDSA 1N32K 4LH5A 3ZT2A 1HR0K 3QLHA 3KK2A 1I94K 4EFHA 2FBVA 4A5BA 3G25A 4BE1A 1NNEA 1VQ4N 2WC9A 3HVTA 4H4MA 3PIOL 2D1KA 4FJIA 1LAWA 3CCJN 4AHVA 3O1WA 3CM5A 2P9NB 3VPZA 2QEXN 1WSJA 2D0OA 4BG9A 3LALA 4W5TA 5CY4A 4FWSA 3LP2A 3O9RA 2HBLA 3SK3A 1WNSA 3U3YA 3WXLA 3AARA 3SNNA 1KLMA 5H1SQ 2FSNA 3NDKA 4E19A 2HHUA 4IZ9A 3ZCMA 3HK2A 2BDPA 2V51B 3C95A 3IUCA 3PO5A 4N41A 3HOTA 4FLYA 3DXMB 1WSFA 1FKPA 1D8YA 3VEZA 1NK9A 4PHTX 4FJJA 3ZX0A 4DKWA 1A5WA 3WXJA 3MAQA 1NGJA 2NRRA 4DF4A 4DSFA 4CJUA 4DU3A 3A2FA 2HHWA 5C24A 3VF6A 3NFAA 4OKKA 4BGAA 1QSYA 2F8SA 3CIPA 5FRNA 5LY3A 1IKXA 1K8AO 4BR9A 1HYSA 2HSTA 4GNIA 4HTLA 2BH1A 5IWAK 4IO9L 5AFUH 3FZFA 2FLOA 5AQZA 3T3FA 4CZKA 1K9MO 3PIPL 4GV3A 1UOCA 2BUPA 4U7BA 3ZSWA 4M63C 3PSFA 4CJLA 3THYB 4KTZA 4ICLA 4CJVA 4JI2K 1NJXA 1C6VA 3VMFB 1YAGA 1LW2A 4DV0K 1TKZA 4O44A 1KRPA 3OHRA 1REVA 3T7ZA 3AA3A 1RBRA 4QOZB 3FZMA 2YI1A 3VETA 3DWLA 2AA4A 3AO2A 3BZCA 3VA0A 3DLBA 3VTIA 3P38A 3G71N 3D7EO 1NGFA 2HHXA 4IOXA 2VG6A 4CBWA 1KLNA 4ILHA 3HZ6A 1RDAA 2Y1IA 4OGCA 1N6QA 2P9IB 2Z1GA 4CEAA 5AQUA 3I8DA 1MWKA 3ZYYX 5KGWA 3UKRB 1Q9XA 2PYLA 4IG0A 4KPYA 4X65K 5KTQA 2IVOA 4CERA 2E1YA 2VQFK 1TUUA 4BRDA 3M3ZA 4DSKA 3KIOA 3GBTA 1FW6A 3SAFA 4H0OA 3HSTB 4K42A 1KAYA 3CCSN 3P83D 4I6MB 4ZTFA 4IEEA 4YY3K 1FJGK 4LF6K 1B9FA 3ATUA 3TAPA 4CZIA 2ZF5O 4CW7B 4F8RA 1RDBA 5AQRA 5FDLA 1NJIO 1RT7A 3DOLA 4CJRA 3K5LA 3J7YP 5K14A 4DG1A 4KHWA 5A2QO 1QS4A 2F7TA 2OPSA 2NRWA 2XHBA 3BDPA 4F9OA 1CXQA 2PYJA 4LF4K 4FM1A 1N34K 2FF3B 2HOEA 1RBTA 4BR7A 1YTUA 1IG9A 2GTDA 5AQHA 3K58A 2W41A 4GMJB 4NLBA 5BPLA 1OH5A 4CZGA 3CM6A 3SQ1A 3WEEB 4JEPA 1BCOA 5FPEA 1NGIA 4CHZA 4CZLA 3CC2N 4WFAL 3WT0A 1K6YA 2GELA 3ITHA 4ILGB 2OA8A 4QCLA 1KFSA 1XNRK 3AVMA 5BPMA 3CCVN 1DTTA 3QFUA 5BR8K 1RBSA 4DSEA 4DQQA 2EX3A 3V9UA 1WSEA 4CJ4A 5BN8A 5JMVA 1NOZA 3CF5L 3G6EN 2PBDA 4DSIA 3MXJA 4CK3A 5JS2A 5AQYA 5GAGP 4BDPA 4MO4A 1W9HA 3VEVA 1HNVA 3HT3A 4DQ8A 4CEQA 4KI4A 2UXBK 3O1BA 4H0YB 4JKEA 3QERA 3FZHA 2F9TA 4CGIA 5J2QA 1XUPO 1SL1A 1BDGA 4J2AA 4CECA 4CK1A 4AHSA 4B1UB 4FCYA 1HYVA 3SMPA 5KPZA 1TKDA 4EZ9A 1V4TA 2HHSA 3MDQA 4JKAA 4B9SA 2RPIA 2GX9A 4YOYA 3CJ1A 3HI0A 4MQ3A 1OKJA 1LWFA 1DT9A 2HHTA 3EE8A 4BC4A 2QWRA 2WONA 4C8KA 4BRHA 5AJ3K 3M8RA 3KZBA 4BROA 5C10A 3KLGA 1V4SA 2UUAK 4FZZA 4BRIA 3OJUA 1S6PA 3D0PA 4XIUA 3SAHA 1SAZA 1HJOA 4YOUA 1DEJA 3KLIA 4ISFA 4FWKA 3E66A 4LSNA 3MN6A 3O3GA 3OYCA 2G8FA 5AQOA 1ATSA 3L4QA 3PY8A 4BVPA 3NF9A 2IVNA 4FJ7A 5AQTA 4A57A 3J80O 3O3HA 4PL7A 3L2QA 2NRVA 3TTFA 4YHHK 2HBJA 4W5OA 1GLDG 2IOCA 3OJSA 1A5XA 5FRMA 4FW1A 1DLOA 4A62A 1TAQA 5AQWA 3OA9A 4ID1A 1XC9A 2YKNA 4PY5A 3SBTA 4NO7A 3OYGA 3D2FA 4FJ8A 1RILA 4LF7K 2Q0RA 2QKBA 3CCUN 3TAGA 3AVFA 4RW6A 4OJRA 3E1YA 4E3SA 5CYMA 4DFJA 3V6DA 1NK8A 2QXLA 1RT6A 3QNOA 5HOOA 3EN9A 4CFBA 1HJRA 4HVJA 4OLAA 1WN7A 4F2SA 2YX6A 1QZ6A 3LM2A 5AFUA 3TWHA 3G10A 4E89A 1IKYA 3KVGA 4E7KA 2P9LB 3DLGA 4H03B 4BVOA 3VQQA 3CC4N 2NRTA 2P1JA 4BRLA 4A2BA 3AVAA 4XH4A 3S41A 3SJJA 4RG8A 4Z4FA 1EWQA 4B1XB 2D4WA 3DYAA 3WXIA 3HVRA 2O8DA 3KWGA 1TYQB 1GLJO 3RRHA 3U3GA 1MU2A 1VSEA 4FL9A 1S1XA 3ZX3A 3C7NA 4ELTA 3KK1A 1G99A 3TANA 2HHVA 4K8ZA 3J7AP 4ISEA 3H46O 1YI2N 1T8EA 3BGRA 1YVNA 1BGXT 3MCPA 3U8XA 3LM9A 3DRPA 4H0XB 3LDNA 1X3NA 1JCFA 4H8KA 1L3TA 4AM6A 5ADXH 4KRFA 3KKSA 1OVYA 2YHWA 4DF8A 3AO3A 2QWQA 4JLHA 5AQFA 3ZSXA 4JD2A 2XO7A 3THYA 1HPMA 5JLFA 5C42A 3TSQA 2NRZA 3NGYA 1U45A 1A5VA 4BR2A 4HTUA 2VWBA 5HL7L 3VQ9A 2YJEA 4C23A 1EX4A 2A3ZA 1GOBA 5J1EA 4FZXC 3PSIA 3CCLN 1N33K 5EY4A 4E1NA 1S1TA 4FLWA 4WQ5A 4DHYA 4F3OA 4KI6A 3HPOA 3QBWA 4JYAK 4KB1A 3VF4A 2HBMA 1BCMA 4R5PA 5CR4A 5IT9O 2P9NA 2XRIA 1VQPN 2OANA 2P9KA 4DV4K 1VQ5N 1RT5A 1VQ9N 1C1BA 2Q0UA 3TABA 3ZEUA 3HM8A 1IV0A 2I5JA 1NMNA 3UKRA 4EP4A 1TUYA 4O0IA 4H5VA 1LAVA 2E6MA 5AQLA 1HUXA 3ZSYA 1SZ2A 4LSLA 3OYJA 1WAJA 4A61A 5MLCQ 2YNHA 3NVMA 3KLEA 3O5BA 5BREA 3IRXA 1SV5A 1YHQN 4NCAA 1RGIA 3ENBA 4Q0BA 4X62K 4JHDB 2HVHA 2ETJA 1KAXA 1TAUA 4E7HA 4KTQA 1NGAA 4H0TB 4BQLA 3L2UA 4X66K 4CGFA 3THVA 3AVCA 2ATQA 3CCRN 4FM0A 3R6MA 1F21A 4EZ6A 1G15A 2E5LK 2F4VK 2BE2A 3WQUA 4MDBA 4AQYK 1SL2A 5C2FA 1X3MA 4V19S 2ZM6K 1QTMA 4K43A 4CESA 4CJTA 4PWDA 1C0UA 4C8NA 1IH7A 4DV2K 3UKUB 4Q5VA 5HRPA 3C0BA 4Y0WA 3EZWA 1IJJA 4DV7K 3CCQN 1KSPA 1XI1A 4LF5K 5TKWA 3L4IA 4JI3K 3AVLA 5AQVA 3OYDA 3VGLA 1QHAA 3P1GA 1BHLA 3ZT1A 2RN2A 3A5MC 1BI4B 4FJLA 4QS8A 1ZBLA 1QSLA 3OYHA 4G9ZA 1D9FA 4PQUA 1NJZA 3GE1A 4C1NK 3JAMO 1C0MA 3EO3A 3EYZA 1S1WA 3F2KA 3KD1E 2HB5A 1SKWA 2ZQBA 3P4IA 2KHOA 4CJSA 4CEDA 3SPYA 1TL1A 5KQ8A 3ZETA 1B9DA 4W5RA 1HLUA 3W0LA 2NLXA 3CERA 1TGOA 3VEWA 4DB3A 2YHYA 5GIPA 3JXUA 1S9GA 3HXMA 1YJWN 1ATNA 4AILC 5I42A 1Q82O 3WNFA 2IVPA 4HCCA 5KRSA 2OTJN 1T3VA 3NF8A 1JLBA 3MX2A 4CZFA 4K8XA 2GWKA 4AF1A 3T1AA 4CD3A 1JLQA 2XY5A 1NGEA 1LCUA 3CJ9A 4E1JA 2UYTA 1P8ZA 1VSMA 4E7IA 4FWQA 2VG7A 2HNZA 1XNQK 1QQMA 3VQEA 3QEIA 5AQSA 4M3TA 3V9WA 1B92A 3H1QA 3IKMA 2WFBA 2YNFA 3N4QA 3D2EB 3CXCM 2GUPA 1TK0A 2D0BA 3U9DA 3OYAA 2QWPA 4H5WA 1IBMK 3QICA 3CG7A 2G8WA 4E7LA 3V81A 1VQMN 3AY9A 3J7ZO 1VQNN 2D0PA 3C6TA 1NKEA 4JKGA 1K73O 1NG9A 4JNEA 3M5RA 4PA1A 4FLVA 2I7NA 5SWMA 2A1RA 4N76A 3VQ5A 4BDYA 2HBKA 1U04A 2E1ZA 4Z0UA 1YTAA 5E84A 5LJWA 1QVGM 2YNGA 3SQ2A 5ADXA 5EXWA 1TKTA 1TV6A 1WSHA 1ZC6A 4M7YA 3NH0A 1GLAG 5JICA 4XEIA 1KVCA 3MXIA 4NCGA 3A5NC 3KKRA 4KV8A 3KJVA 4NXNK 1JXBA 1IBKK 1EP4A 1BISA 4FLUA 5HROA 3QMLA 3HRGA 3SV4A 3VERA 3EEQA 3TPQA 3QESA 4IJAA 2ZJPL 2WOMA 4HWIA 4A59A 3SZ2A 4TSXA 1L5UA 3I0RA 1RT4A 3V1OA 4FLZA 3LP3A 4BRKA 4U67L 1J6ZA 3L8BA 1U48A 4BACA 4JI4K 1C0FA 4DV5K 3DI6A 3ZX2A 3LPUA 2AJQA 2YKMA 5EX5A 4B3TK 3HBTA 5C12A 3K5MA 5KGXA 2YHAA 4F2RA 1O1WA 2HF3A 1X9MA 4DTJA 4OO1J 5AQXA 5KPTA 5JVHL 4JKHA 2QK9A 3ID8A 3AO1A 3TU5A 4CIFA 2DY4A 4CF8A 1WSIA 1L3UA 4B3OA 2EWSA 3BZKA 3SQ0A 3L3VA 3DMJA 3AVBA 2HNDA 2GBZA 4RW9A 2VQEK 2ASMA 1OVQA 1QZ5A 1IKVA 4J2BA 1FK9A 5DMRA 3KTQA 1GLBG 3AAPA 4OPJA 3HP6A 3KLFA 4CGHA 2RKIA 1GLEG 1QSSA 3UE5A 4CFCA 2P9LA 2ITGA 2WBNA 1J53A 2KLAA 5AZIB 5M1KA 4DLGA 2HNYA 1NJYA 3AA4A 3HP9A 1HNIA 2QTDA 5FLXO 1UA1A 4CZMA 4I9LA 3AVNA 1VQKN 4B9NA 4DS5A 2QWMA 1SS6A 1VSFA 4EIAA 3C65A
chains in the Genus database with same CATH topology
4FVUA 1S72N 1XQSC 4JAXA 1N8RO 2PAVA 4R79A 3P39A 5AQPA 3SBTA 4GY2B 1E4FT 1H1VA 2Q36A 4NO7A 3D2FA 2DPNA 3BUZB 2NZTA 4XH1A 2Q0RA 3CCUN 1S3XA 2VYPA 1VQ7N 4GV9A 4IEIA 2NNWA 3E1YA 4FWPA 4WQ5C 2QXLA 4CBUA 3OW2M 5AQIA 4FPAA 4QS7A 5HOOA 3EN9A 4RTFD 1Q7YO 3OBYA 2ZGYA 2QW9A 4CD1A 4CZEA 5M1FA 2YX6A 3QFPA 1HKBA 2PFUA 3D2EA 3LL3A 3LDOA 3MX5A 3VESA 1QZ6A 2YJFA 2WUSA 3LM2A 3RVCA 5FPMA 3E9PA 3H45C 3DJCA 5AFUA 4JD2B 4NB4A 3KVGA 4M7XA 4BGBA 2P9LB 2V7ZA 2VCPA 3IMXA 4H03B 4BVOA 4A2AA 5AZIA 5BRFA 5F0XA 5FPDA 4K41A 3CC4N 4BQZA 2NRTA 4BRLA 3CC7N 1BU6O 4IDHA 3R1XA 4A2BA 4FWLA 5TKYA 4XH4A 3S41A 4BRMA 3I33A 3RSEA 3O4WA 3A8YA 3OBWA 3CI5A 4B1XB 2A42A 2D4WA 5F2RA 3WXIA 2H3GX 3SMSA 3KWGA 2AP1A 3VENA 2JWKA 1TYQB 1GLJO 3H6EA 3IDHA 5AR0A 3VEOA 4WF9L 1VQ6N 1W2BM 4YDUC 3EKSA 1R59O 1U2VA 4FL9A 3ZX3A 3CJCA 3AGKA 2F9WA 3MWPA 1RDWX 2ZGZA 3C7NA 4H5RA 4JKDA 5E26A 5AQJA 4DCHA 1G99A 1DGKN 4KH5A 4ISEA 3H46O 2P9PA 2V52B 1YI2N 1NLVA 1YVNA 4BREA 3MCPA 3MMVA 3Q7BA 3LM9A 3U8XA 4BRGA 4CZHA 5GAEP 3WEEA 1Q81O 4BY9C 3RSEB 4FWNA 3CHWA 1WOQA 1S22A 4EHUA 3B8AX 4H0XB 3LDNA 1X3NA 1JCFA 2Q97A 4AM6A 5ADXH 1E4GT 3CJ7A 1VQ8N 4O8KA 5KPRA 1GLCG 1OVYA 1IG8A 2YHWA 3H3OB 2ASOA 3MN5A 4H5NA 2QWQA 3LDLA 5AQFA 5I9EB 3AAQA 4JD2A 1HPMA 1O13A 1BA1A 1NGCA 5JLFA 3M6GA 3TSQA 3N4PA 3DXKA 1BOTO 2NRZA 3L6QA 2ITMA 4BR2A 2VWBA 4AM7A 5HL7L 4BR5A 1NM1A 2QWNA 4QS9A 4JK7A 1EQYA 4UY8O 2YJEA 4C23A 1SQKA 2A3ZA 3CQYA 3CCMN 3A5LC 3R8EA 3CPEA 1NGHA 4O8UA 2QA4N 5BRHA 4PKHA 1D4XA 2YCHA 4MO5A 3DAWA 4RCHA 4FO0A 4Z94A 3CCLN 5AZJA 5EY4A 5EOYA 5DM7L 4WQ5A 4DHYA 4FPBA 4WFBL 3SAGA 1YIJN 2CH5A 3QBWA 4MLHA 3GL1A 4FOEA 3VF4A 2HBMA 2RHKA 2VGMA 4H0VB 1U6ZA 3ZEUB 5AQGA 3EE9A 4WQ4C 3QDKA 4FOIA 5CR4A 3L0QA 2P9NA 3F5TA 1VQPN 1M1KO 2OANA 2P9KA 1VQ5N 1VQ9N 2JWLA 4H0PA 2Q0UA 4BRNA 3E9OA 2E20A 3ZEUA 1TYQA 1LOTB 3HM8A 2A41A 2FSJA 3ENOA 3UB5A 1NBWA 3TSPA 1GLFO 3R9PA 3UKRA 1TUYA 1KXPA 3GG4A 3MN9A 4H5VA 3AGRA 2FSKA 5AQLA 3MK6A 5GADP 1HUXA 1EO1A 1SZ2A 5GINA 1T6DA 4A5BA 4EFHA 3G25A 4MLEA 4A61A 5MLCQ 1VQ4N 3O9TA 4JK8A 1RDUA 4FWOA 3TTDA 2WC9A 3W3DA 4BRQA 4BR4A 4C1NI 3UKUA 1QVFM 2E8AA 2QM1A 5M1OA 3NVMA 3PIOL 3O5BA 2D1KA 5BREA 3D6RA 3CJBA 3CCJN 3CCEN 1YHQN 3O1WA 3VPZA 2P9NB 2QEXN 3EKUA 1RGIA 1BWFO 2D0OA 3ENBA 4BG9A 3GOIA 4KBOA 4JHDB 4FWSA 1KAXA 4FWMA 3O9RA 1NGAA 2HBLA 3FZKA 4IXCA 4H0TB 4BQLA 4CI6A 3SK3A 3U9ZA 4PKIA 2FXUA 3WXLA 3AARA 4BG8A 5H1SQ 2FSNA 3CCRN 4IZ9A 1DKGD 2V51B 1ESVA 3R6MA 3IUCA 2QWOA 2P9IA 3HOTA 4IOCL 3DXMB 1BUPA 1NWKA 1KC8O 2OTLN 3VEZA 1BO5O 3WQUA 4MDBA 4PHTX 4YOXA 1KAZA 3ZX0A 4IWVA 5C2FA 3BF3A 1X3MA 1MWMA 4DKWA 1NGGA 3KHYA 3WXJA 1NGJA 4YOVA 3ULEB 2NRRA 4K43A 5C15A 1X9JA 3P31A 4B1VA 3I8BA 1GLLO 1WUAA 3OA9A 3UKUB 3WUHA 3CETA 3ENHA 3VF6A 3C0BA 2P9UB 4BGAA 2IIRA 2ASPA 3CIPA 4Y0WA 5LY3A 5ELZA 4BC3A 3U4LA 4WQ4A 3C6AA 3EZWA 3O9UA 1K8AO 1IJJA 4BR9A 4BRAA 4CZJA 3C6HA 3CCQN 2HSTA 4GNIA 4HTLA 5F1XA 3O9SA 2BH1A 3QB0A 1YF5L 5CE3A 3A5OC 4IO9L 5AFUH 2HF4A 3FZFA 3ID6A 3L4IA 5TKWA 2FLOA 3BF1A 5AQVA 5AQZA 3VGLA 1QHAA 4CZKA 2CH6A 1K9MO 3WXMB 3C7NB 3PIPL 5C0YA 3A5MC 4JK9A 2Q1NA 3MCAB 4GV3A 1CZAN 2BUPA 4QS8A 4U7BA 4A5AA 1NGBA 4G9ZA 3GE1A 4M63C 1Q86O 4OPHA 3DXKB 4PL8A 4C1NK 3JS6A 3EO3A 3F2KA 2W40A 5C2DA 3K9JA 3VMFB 3D2FB 1YAGA 3P4IA 1KD1O 2KHOA 4BRCA 1ATRA 3OHRA 3T7ZA 2I7PA 1C0GA 5KQDA 1JCEA 3ZETA 5KQ8A 5GAHP 1HLUA 1ILYA 3FZMA 3W0LA 2NLXA 2YI1A 3CERA 3VETA 3EL2A 3DWLA 3VTHA 2AA4A 1KQSM 3VEWA 2CGKA 3VOVA 4DB3A 2YHYA 2P9PB 5GIPA 3JXUA 1YJWN 1ATNA 5AQNA 3SLCA 4JN4A 2CGLA 1U2VB 3P38A 4PKGA 3VTIA 1P90A 2E88A 3G71N 3D7EO 1NGFA 1Q82O 4I6MA 2IVPA 4IOXA 4JKFA 1Z6RA 1JCGA 3H1VX 3WQTA 4CBWA 1M90O 4GVEA 4ILHA 2OTJN 1T3VA 3HZ6A 3K9KA 3MX2A 1Q18A 4CZFA 3DLLL 2GWKA 3FZLA 4AF1A 2QWLA 4JKGB 2P9IB 3VEYA 4CD3A 5AQUA 2GWJA 1T44A 1NGEA 1LCUA 3CJ9A 2RE2A 1MWKA 5AQKA 4E1JA 2UYTA 1P8ZA 3ZYYX 5BRDA 2GEMA 4FWQA 4WYBA 5JVGL 3SJHA 3UKRB 4CBXA 2Q31A 1QQMA 1VAZA 2IVOA 3E9LA 2E1YA 5B8HA 4YOWA 1TUUA 4L3QA 5M1NA 4BRDA 3M3ZA 4FSVA 2P9KB 3GBTA 1HKCA 3SAFA 3CJAA 4H0OA 5AQSA 3PLAA 4K42A 1KAYA 3CCSN 3H1QA 4I6MB 3IKMA 2WFBA 3N4QA 3D2EB 4XH5A 3Q7CA 3VEXA 3CXCM 4IEEA 2GUPA 5AQQA 3U9DA 2QWPA 4H5WA 3ATUA 1YJNN 3QICA 3QBXA 4CZIA 3IFRA 3NMUA 2ZF5O 4JKBA 3CMEN 3ATVA 2E2NA 4JKCA 5AQRA 3AY9A 3J7ZO 1NJIO 1VQMN 2D0PA 3BP8A 3R3LA 1HX1A 3WXKA 1VQNN 3O80A 3F9MA 4YDUA 4JKGA 2E2QA 1K73O 3O8MA 4O5FA 4JNEA 3M5RA 3VGKA 2I7NA 1BG3A 1HKGA 2F7TA 2HBKA 2NRWA 2J4RA 4KH6A 2E1ZA 3G4SN 4JHDA 4F9OA 4IOAL 5E84A 5LJWA 1QVGM 3A0IX 5ADXA 5EXWA 4WFNL 1ZC6A 4B1ZA 3LDPA 1ZBSA 4ISGA 4M7YA 3FLCO 2FF3B 2HOEA 4BR7A 1GLAG 1VQON 5JICA 2GTDA 5AQHA 4K25A 4XEIA 1MDUB 2P9SB 3I55N 2W41A 2HMPA 4NLBA 3A5NC 4OPAA 2A6AA 5BPLA 4CZGA 5AZJB 1K8KA 3TTCA 3O6WA 1ZXOA 3HSCA 3WEEB 4RWTA 4JEPA 5CHIA 5FPEA 1NGIA 5M1QA 3FGUA 4CZLA 3CC2N 4NLCA 4WFAL 3WT0A 3QMLA 3HRGA 2GELA 3VERA 2Q2RA 2P9UA 3O08A 4ILGB 3TPQA 4B1WB 4YOTA 4WCEL 1NGDA 3TSUA 4H5TA 4IJAA 1JJ2M 5BPMA 3CCVN 2ZJPL 3QFUA 1RFQA 2FF6A 4HWIA 4A59A 2BTFA 5GIOA 5BN8A 3I56N 5JMVA 2E2PA 3KK7A 3ULEA 3VF2A 3CF5L 3G6EN 2PBDA 5FPNA 1BA0A 4BC2A 3FFKB 4BRKA 4U67L 1J6ZA 5AQYA 5GAGP 3CD6N 4MO4A 1C0FA 1YJ9N 4YORA 3VEVA 1Y64A 3ZX2A 2E2OA 4CJ7A 5EVZA 5EX5A 3ZETB 4LC9B 3HBTA 4DQ8A 5C12A 3MN7A 5BPNA 4J8FA 3O1BA 4H0YB 5AQMA 2HF3A 4JKEA 5BN9A 4OO1J 3FZHA 5AQXA 3CQXA 2F9TA 5KPTA 1YXQA 1XUPO 4JKHA 1BDGA 5JVHL 3T69A 3ID8A 4GV6A 2VGNA 4B1UB 3HTVA 2ZJRL 2P9SA 3SMPA 3TU5A 2ZWHA 5KPZA 1NMDA 1V4TA 2QI2A 3MDQA 4BR0A 4IFEA 4JKAA 2A5XA 2EWSA 2V7YA 2GX9A 4YOYA 3CJ1A 1YITN 3HI0A 2ZJQL 1OKJA 1XC3A 1DT9A 3EE8A 2A40A 3GDQA 2ASMA 4BC4A 2YHXA 1W97L 2QWRA 4BRHA 1QZ5A 3KZBA 4BROA 5C10A 3O9QA 1V4SA 3FE1A 2NRHA 3HOSA 4KH4A 4BRIA 2NRXA 4B1YB 1GLBG 3AAPA 3KWIA 5LJVA 1GLEG 5JLHA 3SAHA 1SAZA 3FR0A 1HJOA 4YOUA 3UE5A 1DEJA 4ISFA 5M1PA 3SBGA 4FWKA 3E66A 1Z05A 3MN6A 2P9LA 4EHTA 1K8KB 3CPWM 2WBNA 3H3NO 1ATSA 3L4QA 3LDQA 5AQOA 3M1FA 3CMAN 5M1KA 1QQOA 1MA9B 2KLAA 5AZIB 4BVPA 3NVKA 5DM6L 2QTDA 2IVNA 3BEXA 1VQLN 4CZMA 4MDAA 1QQNA 5AQTA 4A57A 4BRFA 4EAHD 2CGJA 3J8AA 4PL7A 4BC5A 1VQKN 2NRVA 4IO8A 4ILJA 3TTFA 4FWRA 4B9QA 2HBJA 1GLDG 1YUWA 3VGMA 2QWMA 1SS6A 3DXMA 3MWTA 1T6CA 4A62A 4EIAA 5AQWA 4BRPA 4IJNA 3C65A 5BR9A 2KKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XQS C;  4JAX A;  2PAV A;  5AQP A;  4GY2 B;  1E4F T;  1H1V A;  2Q36 A;  4NO7 A;  3D2F A;  2DPN A;  3BUZ B;  2NZT A;  4XH1 A;  2Q0R A;  1S3X A;  2VYP A;  4FWP A;  4WQ5 C;  2QXL A;  4CBU A;  5AQI A;  4FPA A;  4QS7 A;  3EN9 A;  4RTF D;  2ZGY A;  2QW9 A;  4CD1 A;  4CZE A;  3QFP A;  1HKB A;  3D2E A;  3LL3 A;  3LDO A;  4BQZ A;  3VES A;  1QZ6 A;  2YJF A;  2WUS A;  3LM2 A;  5AFU A;  5FPM A;  3H45 C;  3DJC A;  4JD2 B;  4NB4 A;  3KVG A;  4M7X A;  4BGB A;  2P9L B;  2V7Z A;  2VCP A;  3IMX A;  4H03 B;  4BVO A;  4A2A A;  5AZI A;  5BRF A;  5F0X A;  5FPD A;  4K41 A;  4BRL A;  1BU6 O;  4A2B A;  4FWL A;  5TKY A;  4XH4 A;  3S41 A;  4BRM A;  3I33 A;  3RSE A;  3O4W A;  3A8Y A;  3CI5 A;  4B1X B;  2A42 A;  2D4W A;  5F2R A;  3WXI A;  2H3G X;  3SMS A;  2AP1 A;  3VEN A;  3IDH A;  1TYQ B;  1GLJ O;  3H6E A;  5AR0 A;  3VEO A;  4YDU C;  3EKS A;  1R59 O;  1U2V A;  4FL9 A;  3ZX3 A;  3CJC A;  2F9W A;  1RDW X;  2ZGZ A;  3C7N A;  4H5R A;  5E26 A;  5AQJ A;  4DCH A;  1G99 A;  1DGK N;  4ISE A;  3H46 O;  2P9P A;  2V52 B;  1NLV A;  1YVN A;  4BRE A;  3MCP A;  3MMV A;  3U8X A;  3LM9 A;  4BRG A;  4CZH A;  3WEE A;  3RSE B;  4FWN A;  3CHW A;  1WOQ A;  1S22 A;  4EHU A;  3B8A X;  4H0X B;  3LDN A;  1X3N A;  1JCF A;  2Q97 A;  4AM6 A;  5ADX H;  1E4G T;  3CJ7 A;  4O8K A;  5KPR A;  1GLC G;  1IG8 A;  2YHW A;  3H3O B;  2ASO A;  3MN5 A;  4H5N A;  2QWQ A;  3LDL A;  5AQF A;  5I9E B;  3AAQ A;  4JD2 A;  1HPM A;  1BA1 A;  1NGC A;  5JLF A;  3M6G A;  3DXK A;  1BOT O;  3L6Q A;  2ITM A;  4BR2 A;  2VWB A;  4AM7 A;  4BR5 A;  1NM1 A;  2QWN A;  4QS9 A;  1EQY A;  2YJE A;  4C23 A;  1SQK A;  2A3Z A;  3CQY A;  3A5L C;  3R8E A;  1NGH A;  5BRH A;  4PKH A;  1D4X A;  2YCH A;  4MO5 A;  3DAW A;  4RCH A;  4FO0 A;  4Z94 A;  5AZJ A;  5EY4 A;  5EOY A;  4WQ5 A;  4DHY A;  4FPB A;  2CH5 A;  3QBW A;  4MLH A;  3GL1 A;  4FOE A;  3VF4 A;  4H0V B;  3ZEU B;  1U6Z A;  5AQG A;  4WQ4 C;  3QDK A;  4FOI A;  3L0Q A;  2P9N A;  2OAN A;  2P9K A;  4H0P A;  2Q0U A;  4BRN A;  2E20 A;  3ZEU A;  1TYQ A;  1LOT B;  3HM8 A;  2A41 A;  2FSJ A;  3ENO A;  3UB5 A;  1NBW A;  1GLF O;  3R9P A;  3UKR A;  1TUY A;  1KXP A;  3GG4 A;  3MN9 A;  4H5V A;  2FSK A;  5AQL A;  3MK6 A;  1HUX A;  1SZ2 A;  1T6D A;  4EFH A;  3G25 A;  4MLE A;  4A61 A;  4BR4 A;  4FWO A;  4BRQ A;  3W3D A;  3UKU A;  2E8A A;  2QM1 A;  3O5B A;  2D1K A;  5BRE A;  3CJB A;  3O1W A;  3VPZ A;  2P9N B;  3EKU A;  1RGI A;  1BWF O;  2D0O A;  4BG9 A;  3GOI A;  4KBO A;  4JHD B;  4FWS A;  1KAX A;  4FWM A;  3FZK A;  1NGA A;  4IXC A;  4H0T B;  4BQL A;  4CI6 A;  3SK3 A;  3U9Z A;  4PKI A;  2FXU A;  3WXL A;  3AAR A;  4BG8 A;  2FSN A;  4IZ9 A;  1DKG D;  2V51 B;  1ESV A;  3R6M A;  3IUC A;  2QWO A;  2P9I A;  3DXM B;  1BUP A;  1NWK A;  3VEZ A;  1BO5 O;  3WQU A;  1KAZ A;  3ZX0 A;  4IWV A;  3BF3 A;  1X3M A;  1MWM A;  1NGG A;  3KHY A;  3WXJ A;  1NGJ A;  3ULE B;  4K43 A;  1X9J A;  4B1V A;  3I8B A;  1GLL O;  1WUA A;  3UKU B;  3WUH A;  3CET A;  3ENH A;  3VF6 A;  3C0B A;  2P9U B;  4BGA A;  2IIR A;  2ASP A;  3CIP A;  4Y0W A;  5LY3 A;  5ELZ A;  4BC3 A;  3U4L A;  4WQ4 A;  3EZW A;  1IJJ A;  4BR9 A;  4BRA A;  4CZJ A;  4GNI A;  4HTL A;  5F1X A;  3QB0 A;  5CE3 A;  3A5O C;  5AFU H;  3FZF A;  2HF4 A;  3L4I A;  2FLO A;  3BF1 A;  5AQV A;  5AQZ A;  3VGL A;  1QHA A;  4CZK A;  2CH6 A;  3C7N B;  3A5M C;  2Q1N A;  1CZA N;  2BUP A;  4QS8 A;  1NGB A;  3GE1 A;  4M63 C;  3DXK B;  4PL8 A;  3JS6 A;  3EO3 A;  2W40 A;  3D2F B;  1YAG A;  3P4I A;  2KHO A;  4BRC A;  1ATR A;  3OHR A;  2I7P A;  1C0G A;  5KQD A;  1JCE A;  3ZET A;  5KQ8 A;  1HLU A;  3FZM A;  3W0L A;  2NLX A;  2YI1 A;  3CER A;  3VET A;  3EL2 A;  3DWL A;  2AA4 A;  3VEW A;  2CGK A;  3VOV A;  4DB3 A;  2YHY A;  2P9P B;  3JXU A;  1ATN A;  5AQN A;  3SLC A;  4JN4 A;  2CGL A;  1U2V B;  4PKG A;  2E88 A;  3D7E O;  1NGF A;  4I6M A;  2IVP A;  1Z6R A;  1JCG A;  3H1V X;  3WQT A;  4CBW A;  3HZ6 A;  1Q18 A;  4CZF A;  2GWK A;  3FZL A;  2QWL A;  2P9I B;  3VEY A;  4CD3 A;  5AQU A;  2GWJ A;  1T44 A;  1NGE A;  1LCU A;  3CJ9 A;  5AQK A;  1MWK A;  4E1J A;  2UYT A;  1P8Z A;  5BRD A;  2GEM A;  4FWQ A;  4WYB A;  3SJH A;  3UKR B;  4CBX A;  2Q31 A;  1QQM A;  2IVO A;  2E1Y A;  5B8H A;  1TUU A;  4L3Q A;  4BRD A;  3M3Z A;  4FSV A;  2P9K B;  3GBT A;  1HKC A;  3CJA A;  4H0O A;  5AQS A;  4K42 A;  1KAY A;  3H1Q A;  4I6M B;  3D2E B;  4XH5 A;  3VEX A;  2GUP A;  5AQQ A;  3U9D A;  2QWP A;  4H5W A;  3ATU A;  3QIC A;  3QBX A;  4CZI A;  3IFR A;  2ZF5 O;  3ATV A;  2E2N A;  5AQR A;  3AY9 A;  2D0P A;  3BP8 A;  3WXK A;  1HX1 A;  3O80 A;  3F9M A;  4YDU A;  2E2Q A;  3O8M A;  4O5F A;  4JNE A;  3VGK A;  2I7N A;  1BG3 A;  1HKG A;  2J4R A;  2E1Z A;  4JHD A;  4F9O A;  5E84 A;  5LJW A;  3A0I X;  5ADX A;  5EXW A;  1ZC6 A;  4B1Z A;  3LDP A;  1ZBS A;  4ISG A;  4M7Y A;  3FLC O;  2FF3 B;  2HOE A;  4BR7 A;  1GLA G;  5JIC A;  2GTD A;  5AQH A;  4K25 A;  4XEI A;  1MDU B;  2P9S B;  2W41 A;  2HMP A;  3A5N C;  2A6A A;  5BPL A;  4CZG A;  5AZJ B;  1K8K A;  3O6W A;  1ZXO A;  3HSC A;  3WEE B;  4RWT A;  5FPE A;  1NGI A;  3FGU A;  4CZL A;  3WT0 A;  3QML A;  2GEL A;  3VER A;  2Q2R A;  2P9U A;  3O08 A;  3TPQ A;  4B1W B;  1NGD A;  4H5T A;  4IJA A;  5BPM A;  3QFU A;  1RFQ A;  2FF6 A;  4HWI A;  2BTF A;  5BN8 A;  5JMV A;  2E2P A;  3ULE A;  3VF2 A;  2PBD A;  5FPN A;  1BA0 A;  4BC2 A;  3FFK B;  4BRK A;  1J6Z A;  5AQY A;  4MO4 A;  1C0F A;  3VEV A;  1Y64 A;  3ZX2 A;  2E2O A;  4CJ7 A;  5EVZ A;  5EX5 A;  3ZET B;  4LC9 B;  3HBT A;  4DQ8 A;  3MN7 A;  5BPN A;  4J8F A;  3O1B A;  4H0Y B;  5AQM A;  2HF3 A;  5BN9 A;  3FZH A;  5AQX A;  3CQX A;  2F9T A;  5KPT A;  1YXQ A;  1XUP O;  1BDG A;  3ID8 A;  4B1U B;  3HTV A;  2P9S A;  3SMP A;  3TU5 A;  2ZWH A;  5KPZ A;  1NMD A;  1V4T A;  3MDQ A;  4BR0 A;  2A5X A;  2EWS A;  2V7Y A;  3CJ1 A;  3HI0 A;  1OKJ A;  1XC3 A;  2A40 A;  3GDQ A;  2ASM A;  4BC4 A;  2YHX A;  2QWR A;  4BRH A;  1QZ5 A;  3KZB A;  4BRO A;  1V4S A;  3FE1 A;  2NRH A;  4BRI A;  4B1Y B;  1GLB G;  3AAP A;  5LJV A;  1GLE G;  5JLH A;  1SAZ A;  3FR0 A;  1HJO A;  3UE5 A;  1DEJ A;  4ISF A;  4FWK A;  1Z05 A;  3MN6 A;  2P9L A;  4EHT A;  1K8K B;  3H3N O;  1ATS A;  3LDQ A;  5AQO A;  3M1F A;  1QQO A;  1MA9 B;  5AZI B;  4BVP A;  3BEX A;  2IVN A;  4CZM A;  1QQN A;  5AQT A;  4BRF A;  4EAH D;  2CGJ A;  3J8A A;  4PL7 A;  4BC5 A;  4IO8 A;  4FWR A;  4B9Q A;  1GLD G;  1YUW A;  3VGM A;  2QWM A;  3DXM A;  4A62 A;  1T6C A;  4EIA A;  5AQW A;  4BRP A;  4IJN A;  5BR9 A; 
#chains in the Genus database with same CATH topology
 4JAX A;  3J81 O;  3P39 A;  4GVM A;  3JSM A;  2O8E B;  3AVK A;  4FJX A;  2DTU A;  1S3X A;  3ISN C;  4GV9 A;  4CHY A;  4IEI A;  4FWP A;  4CBU A;  2QW9 A;  5M1F A;  1N36 K;  5HRS A;  3LL3 A;  1HPZ A;  3LDO A;  2D5R A;  3MX5 A;  4NYF A;  3HPG A;  3E9P A;  3DJC A;  3HL8 A;  4DU1 A;  2V7Z A;  3IMX A;  4CHP A;  3SUQ A;  5AZI A;  5BRF A;  5F0X A;  5HLF A;  3CC7 N;  1BU6 O;  1E3M A;  4DFP A;  4M41 A;  4O0J A;  1BQN A;  3A8Y A;  3CI5 A;  2A42 A;  2F96 A;  3VEN A;  4F4K A;  3IDH A;  3MEC A;  5AR0 A;  3VQ4 A;  1W2B M;  4YDU C;  3QIP A;  1R59 O;  3CJC A;  1RDD A;  3MWP A;  2UXD K;  1RDW X;  2ZGZ A;  5AQJ A;  2OZM A;  3ZSQ A;  4WE1 A;  1NK7 A;  3OYK A;  2Z1I A;  3THW A;  4CZH A;  2G8H A;  1BL3 A;  3SI6 A;  1Q81 O;  4BY9 C;  3RSE B;  4FWN A;  4EHU A;  1S22 A;  2R7Y A;  4DQP A;  4K0K K;  2Q97 A;  4DV1 K;  3CJ7 A;  4BWM A;  4DR1 K;  3OTO K;  3PUF A;  4KHS A;  4NCB A;  4HUF A;  3AVG A;  1NK6 A;  2X78 A;  3RMC A;  4AHT A;  4B3M K;  1NKC A;  3N4P A;  3DXK A;  4B8A B;  1VSK A;  2IS3 A;  2ITM A;  4FJM A;  4JRP A;  1TL3 A;  4KHY A;  1NM1 A;  1VSL A;  3VA3 A;  4B08 A;  1QQC A;  1RT1 A;  4C8L A;  1SQK A;  3CCM N;  3CQY A;  3H08 A;  3DOK A;  3CPE A;  1NGH A;  3KK3 A;  3SPZ A;  4PKH A;  2YCH A;  4PUO A;  1JKH A;  2D0A A;  4FK2 A;  5DM7 L;  5J2M A;  4CHN A;  4JI6 K;  1YIJ N;  3GL1 A;  4LY7 A;  4H0V B;  4UQG A;  5AQG A;  3EE9 A;  1SKS A;  3L0Q A;  3F5T A;  3ZSZ A;  4H0P A;  4BRN A;  3E9O A;  2E20 A;  1LOT B;  2A41 A;  3HPH A;  2ZE2 A;  3MED A;  2Z1H A;  3SQ4 A;  4DU4 A;  1JL2 A;  1KXP A;  3MN9 A;  2O8D B;  4DUY K;  2FSK A;  1J54 A;  3V9S A;  3MK6 A;  5GAD P;  2O8B A;  3AA5 X;  3ZSR A;  1EO1 A;  5GIN A;  1L3V A;  3V1R A;  4JK8 A;  1RDU A;  3TTD A;  4BRQ A;  3W3D A;  1XHX A;  1TK5 A;  3UKU A;  1HQU A;  4OGE A;  3OYM A;  4E7J A;  3CJB A;  1BWF O;  4DTN A;  3TAR A;  4FWM A;  3B6P A;  3FZK A;  4IXC A;  1EXQ A;  3EY1 A;  3U9Z A;  4PKI A;  2FXU A;  5T7B A;  4DR4 K;  4JS4 A;  2X6N A;  1ESV A;  3LZI A;  3NF7 A;  4KB0 A;  2QWO A;  3OYB A;  3ALY A;  4FK0 A;  3LP0 A;  5CZ1 A;  1RTH A;  1JXE A;  4DS4 A;  5EU7 A;  1C1A A;  1MWM A;  3KHY A;  2WTU A;  2KFZ A;  5C15 A;  3OY9 A;  4B1V A;  3ZT4 A;  1GLL O;  3WUH A;  3CET A;  3ENH A;  4LFA K;  4DV3 K;  2IIR A;  4WQ4 A;  3C6A A;  4BRA A;  1VRT A;  4CZJ A;  5F1X A;  2G8U A;  4OKJ A;  5CE3 A;  5KRT A;  1WB9 A;  3A5O C;  4DLE A;  2HF4 A;  3ID6 A;  3C7N B;  4JK9 A;  3TAQ A;  3MCA B;  4CEF A;  1CZA N;  4DUZ K;  3NH1 A;  1Q86 O;  4OPH A;  3LPT A;  4PL8 A;  3JS6 A;  1S5J A;  3NGI A;  2VWK A;  2OCE A;  3VQA A;  4JS5 A;  3D2F B;  4BRC A;  4JI5 K;  3TR8 A;  2PY5 A;  3K5N A;  1I3A A;  3AV9 A;  3L2R A;  2I7P A;  5KQD A;  1TK8 A;  3RRG A;  3OYL A;  2CGK A;  5SZT A;  2P9P B;  5AQN A;  4DTP A;  2XY7 A;  3SLC A;  4JN4 A;  1P90 A;  4I6M A;  4JKF A;  1Z6R A;  3H1V X;  4GVE A;  2OYQ A;  1RTD A;  3G0Z A;  2O8F B;  3DLL L;  4DSJ A;  3FZL A;  2QWL A;  3VEY A;  1T44 A;  5AQK A;  3ZSO A;  1KVB A;  3CFR A;  5BRD A;  2GEM A;  2Z1J A;  5JVG L;  1VSH A;  4CBX A;  2Q31 A;  3VQ8 A;  5B8H A;  4J2E A;  4L3Q A;  5M1N A;  2P9K B;  1ZBH A;  1Z25 A;  1LW0 A;  4W5Q A;  4FLX A;  4XH5 A;  4DTS A;  3IS9 A;  1BIU A;  1JLE A;  2JLE A;  3NMU A;  4JKB A;  3ATV A;  4JKC A;  3TAE A;  1HX1 A;  1QHT A;  2E2Q A;  1JLA A;  3MEE A;  4O5F A;  1JLC A;  3OYN A;  1J5O A;  4CEB A;  4FJK A;  4AHR A;  2OPP A;  3QIO A;  3ZSV A;  4DV6 K;  4IBN A;  1WLJ A;  2GV9 A;  4O4G A;  2F8T A;  2J4R A;  4KH6 A;  4Z4G A;  4JHD A;  4I7F A;  4DFK A;  4B1Z A;  3LDP A;  4I2Q A;  1ZBS A;  4ISG A;  3FLC O;  1VQO N;  4CHO A;  4K25 A;  2UUC K;  1MDU B;  2P9S B;  4NYN A;  1L3S A;  3CFO A;  2A6A A;  3NGZ A;  3O6W A;  3HSC A;  4RWT A;  1YT3 A;  2P51 A;  3FGU A;  3TAF A;  4MFB A;  4FW2 A;  4NLC A;  3QEW A;  1KCF A;  1LV5 A;  4CJW A;  4CJP A;  3L3U A;  4YOT A;  4H5T A;  1JJ2 M;  3IG1 A;  5FRO A;  1GOA A;  4FZY A;  4OLB A;  5GIO A;  2P5O A;  2O8C A;  1UWB A;  3I56 N;  2E2P A;  3KK7 A;  3VF2 A;  1BA0 A;  4BC2 A;  3FFK B;  4LH4 A;  4DTX A;  3RMB A;  4LD0 A;  1YJ9 N;  1NJW A;  4DR2 K;  2NUB A;  1Y64 A;  4Z4E A;  5EVZ A;  3ZET B;  4LC9 B;  5CZ2 A;  4DTR A;  4DTO A;  3F9K A;  3PO4 A;  3RWU A;  5AQM A;  4CEE A;  5BN9 A;  4IDK A;  2B4J A;  4KHP K;  1YXQ A;  3T69 A;  1CZ9 A;  1KFD A;  2VGN A;  3HTV A;  2P9S A;  2QI2 A;  4FJ5 A;  4BR0 A;  4IFE A;  1NKB A;  5HRN A;  3SV3 A;  3PX6 A;  4AH9 A;  2A5X A;  4FJN A;  5C25 A;  2IAJ A;  1RNH A;  1YIT N;  1FXX A;  3MEG A;  2OPQ A;  2ZJQ L;  1XC3 A;  3V9X A;  3NH2 A;  3GDQ A;  1OH8 A;  1LWE A;  1W97 L;  3OYF A;  3TI0 A;  4CVN E;  4B9M A;  2NRH A;  4KH4 A;  1WAF A;  2NRX A;  1TVR A;  4B1Y B;  3LWL A;  4CEO A;  3SCX A;  5LJV A;  3B6O A;  5JLH A;  2O8B B;  3FR0 A;  5M1P A;  3QEP A;  3SBG A;  3M8S A;  4JI7 K;  4M3W A;  1HYZ A;  1Z05 A;  3NE6 A;  4CFD A;  3CMA N;  1U49 A;  3M1F A;  1KTQ A;  1MA9 B;  1NOY A;  2HHH K;  4J2D A;  3T1Y K;  4N5S A;  4MDA A;  1QQN A;  3M8Q A;  4EAH D;  1UAX A;  4ILJ A;  4EP5 A;  3OS1 A;  4IKF A;  1YUW A;  3VGM A;  3QET A;  1T6C A;  4BRP A;  1SL0 A;  2KKZ A;  4FVU A;  1ASW A;  1S72 N;  1XQS C;  2PAV A;  4R79 A;  3QEX A;  1CLQ A;  2HMI A;  4FVM A;  4GY2 B;  1E4F T;  1H1V A;  1BQM A;  3BUZ B;  4ELU A;  2JGU A;  3VQC A;  2VYP A;  1VQ7 N;  1C1C A;  2QXF A;  2NNW A;  4WQ5 C;  3OW2 M;  4I9Q A;  5AQI A;  4QS7 A;  3AVI A;  3WNE A;  3OBY A;  4CD1 A;  2BAN A;  3QFP A;  4LF8 K;  5HBM A;  3RR7 A;  3VES A;  2YJF A;  2WUS A;  4AHU A;  5HRR A;  5FPM A;  3RVC A;  3H45 C;  4NB4 A;  5HP1 A;  4BGB A;  1D5A A;  2VCP A;  2IGI A;  4A2A A;  2YV0 X;  5FPD A;  1WSG A;  4IDH A;  1XWL A;  3R1X A;  5TKY A;  2UXC K;  4BRM A;  3RSE A;  3O4W A;  3OBW A;  3KD5 E;  3I0S A;  5F2R A;  4GW6 A;  1U47 A;  2AP1 A;  3OS0 A;  1RTI A;  1ASV A;  2FC0 A;  2JWK A;  3C6U A;  3HYF A;  3VEO A;  4WF9 L;  3EKS A;  4KKO A;  1U2V A;  3AGK A;  2F9W A;  3LAN A;  4LFC K;  4H5R A;  5E26 A;  4FM2 A;  4DCH A;  4KAZ A;  4L8R B;  1BI4 A;  2QKK A;  1DGK N;  3K5O A;  4FLT A;  2P9P A;  2V52 B;  3WNG A;  1NLV A;  3CQ8 A;  1X9W A;  2PZS A;  3P5J A;  4BRE A;  3MMV A;  4BRG A;  5GAE P;  4B3S K;  3WEE A;  3QEV A;  3ZLJ A;  4CF0 A;  1HQE A;  3CHW A;  3HO1 A;  1WOQ A;  3B8A X;  1E4G T;  4DWI A;  5KPR A;  4O55 A;  2O8F A;  1GLC G;  2P5G A;  4B8C A;  1IG8 A;  3H3O B;  2DFE A;  3LDL A;  4H5N A;  3AAQ A;  2A1S A;  1JLG A;  4DQS A;  3SUO A;  1ITG A;  3L6Q A;  3PV8 A;  2ZD1 A;  3DLR A;  3S3N A;  3D45 A;  2QWN A;  4QS9 A;  3SYZ A;  4UY8 O;  3MXM A;  4CCH A;  1NK4 A;  3A5L C;  3F73 A;  4KRE A;  5BRH A;  4CF1 A;  4DQI A;  5AZJ A;  3DLK A;  3OVN A;  1X9S A;  5EOY A;  4FPB A;  2GUI A;  2CH5 A;  1RT3 A;  5KI6 A;  1U6Z A;  1R0A A;  1TKX A;  1D9D A;  3LP1 A;  4CEZ A;  1FKO A;  2D0C A;  3VQP A;  1TYQ A;  3UB5 A;  1NK5 A;  1EWR A;  4B3R K;  3R9P A;  3S9H A;  2KZZ A;  4AHC A;  1VRU A;  3GG4 A;  4YNQ A;  3HM9 A;  3AGR A;  3C94 A;  1VSI A;  3S3O A;  4N56 A;  1T6D A;  4OPK A;  4MLE A;  3O9T A;  4BR4 A;  4FWO A;  4C1N I;  1DTQ A;  1QVF M;  3NBP A;  2E8A A;  2QM1 A;  5M1O A;  2LSN A;  4BWJ A;  3D6R A;  4H4O A;  2OZS A;  3CCE N;  4DSL A;  3L2W A;  3AVJ A;  3EKU A;  4DQR A;  3GOI A;  4KBO A;  3JYT A;  4CI6 A;  2DFH A;  4LF9 K;  5D3G A;  4I2P A;  3V1Q A;  4BG8 A;  2O4G A;  4B9T A;  4M3Y A;  1DKG D;  1VHX A;  3NCI A;  3O4Q A;  1IO2 A;  4IFY A;  2P9I A;  3BY5 A;  4IOC L;  1BUP A;  1NWK A;  1KC8 O;  4Z4I A;  5E41 A;  2OTL N;  3RMD A;  5J2P A;  1BO5 O;  3QIN A;  4OKE A;  4YOX A;  1KAZ A;  1I39 A;  4IWV A;  3BF3 A;  2HVI A;  2VWJ A;  1NGG A;  1QE1 A;  4YOV A;  3ULE B;  1X9J A;  2KW4 A;  3P31 A;  3I8B A;  3VN5 A;  1WUA A;  1X1P A;  2P9U B;  4CIE A;  2W6L A;  2ASP A;  4HCB A;  5ELZ A;  4BC3 A;  4IFV A;  3U4L A;  4Z4H A;  3O9U A;  4RW8 A;  4M3Z A;  3C6H A;  3CYM A;  4CGG A;  3AO4 A;  4NXM K;  3O9S A;  3QB0 A;  1YF5 L;  3OYI A;  3LAK A;  4IOA L;  4CF2 A;  2IC3 A;  3BF1 A;  2B5J A;  2CH6 A;  1RBV A;  3WXM B;  3QO9 A;  5C0Y A;  2Q1N A;  1Y97 A;  3CFP A;  3E01 A;  4A5A A;  1NGB A;  2YNI A;  4GKK K;  3DXK B;  3V4I A;  3THX A;  2HHQ A;  4CJK A;  2W40 A;  5C2D A;  3K9J A;  2X74 A;  1KD1 O;  2O8E A;  1ATR A;  4BE0 A;  1C0G A;  1JCE A;  1JLF A;  4JV5 K;  4OX9 K;  1ILY A;  2Q3S A;  1CZB A;  4CJQ A;  3L2V A;  3EL2 A;  3VTH A;  3LWM A;  1KQS M;  1WBD A;  3VOV A;  4N47 A;  4DR7 K;  2CGL A;  1U2V B;  4PKG A;  4HUG A;  3KLH A;  4BE2 A;  2E88 A;  3RMA A;  3WQT A;  1JCG A;  4DR5 K;  1M90 O;  5CYQ A;  4B9L A;  5LL6 Z;  3K9K A;  1Q18 A;  1VSJ A;  4KTW A;  4CGD A;  3DM2 A;  4JKG B;  1NK0 A;  2RF2 A;  2GWJ A;  2RE2 A;  2G8I A;  3VQD A;  3T19 A;  4WYB A;  3SJH A;  2E6L A;  2XY6 A;  1VAZ A;  3E9L A;  4YOW A;  4E1M A;  3NHG A;  4FSV A;  1HKC A;  3CJA A;  1XMQ K;  4JI1 K;  3PLA A;  4ID5 A;  4DR3 K;  1JL1 A;  1BIZ A;  3Q7C A;  2FBX A;  3VEX A;  4FJ9 A;  4LFB K;  5AQQ A;  2VG5 A;  1YJN N;  3QBX A;  3IFR A;  4HUE A;  3K2P A;  3CME N;  3DLE A;  2E2N A;  4JI0 K;  1UA0 A;  3BP8 A;  3R3L A;  3WXK A;  3O80 A;  3F9M A;  4YDU A;  4CJ3 A;  4M3U A;  3O8M A;  4FK4 A;  4ZHR A;  3PX0 A;  3VGK A;  1BG3 A;  1HKG A;  4W5N A;  3G4S N;  1T05 A;  3A0I X;  1T7P A;  4WFN L;  1S1U A;  4DTM A;  3I55 N;  3NAE A;  2HMP A;  4FYD A;  4OPA A;  4CJF A;  1IKW A;  1CXU A;  5AZJ B;  3K59 A;  1K8K A;  3TTC A;  1W0H A;  1ZXO A;  5CHI A;  5M1Q A;  3RR8 A;  3OYE A;  1HNX K;  2W42 A;  5LMU K;  2Q2R A;  2P9U A;  3O08 A;  4B1W B;  4WCE L;  1NGD A;  3TSU A;  2KQ2 A;  2W6K A;  2XY8 A;  4M45 A;  4CJ5 A;  1RBU A;  2IDO A;  1RCH A;  1RFQ A;  2FF6 A;  2BTF A;  2G8V A;  2KZM A;  3ULE A;  4JRQ A;  3U6F A;  3DRR A;  5FPN A;  4C8O A;  3VQB A;  1Q9Y A;  4B9V A;  3O3F A;  3CD6 N;  1ASU A;  1N5Y A;  4YOR A;  1Z26 A;  3SUP A;  2E2O A;  1ZBF A;  4CJ7 A;  2HW3 A;  2B6A A;  3HJF A;  4CK2 A;  4M42 A;  3MN7 A;  1S1V A;  3O4N A;  5BPN A;  4ZTJ A;  4J8F A;  4B9U A;  3T1H K;  4KO0 A;  3CQX A;  4GV6 A;  4Z4C A;  2ZJR L;  2ZWH A;  1NMD A;  3THW B;  3ZT0 A;  1XMO K;  4QAG A;  3VQ6 A;  2V7Y A;  3THX B;  2O4I A;  4KHU A;  2A40 A;  3RTV A;  2YHX A;  2E4L A;  3O9Q A;  3FE1 A;  3HOS A;  3AA2 A;  3KWI A;  2KTQ A;  4CJE A;  4RW4 A;  1Q8I A;  4BDZ A;  4CGJ A;  3CPW M;  4EHT A;  1K8K B;  3EZ5 A;  3H3N O;  3LDQ A;  4YFU A;  1QQO A;  4X64 K;  2DFF A;  5JS1 A;  3NVK A;  5DM6 L;  3BEX A;  1VQL N;  3K57 A;  3ULD A;  3UIQ A;  3FFI A;  4BRF A;  1HRH A;  1KVA A;  2CGJ A;  3J8A A;  1U4B A;  4BC5 A;  4IO8 A;  4FWR A;  4E0D A;  4B9Q A;  1J5E K;  4RW7 A;  2UUB K;  1SUQ A;  3DXM A;  3MWT A;  2FBY A;  4IJN A;  5BR9 A;  5GAH P;  1S9E A;  1N8R O;  2OPR A;  1EKE A;  1HMV A;  5AQP A;  2Q36 A;  3K0S A;  4KHN A;  2DPN A;  2NZT A;  4XH1 A;  4DFM A;  1VK0 A;  1IBL K;  3SUN A;  2FBT A;  1OH6 A;  4O5B A;  1SKR A;  4FPA A;  1ZBI A;  4RTF D;  1Q7Y O;  2ZGY A;  4CZE A;  1GOC A;  4CF9 A;  1HKB A;  3DLH A;  2PFU A;  3D2E A;  4C8M A;  4BQZ A;  4FJH A;  4JD2 B;  4M3X A;  4M7X A;  1S6Q A;  3M8P A;  2BGG A;  3LZJ A;  3AVH A;  4K41 A;  1RT2 A;  4FWL A;  5DK5 A;  4CIG A;  4HHT A;  4KHQ A;  3I33 A;  1VSD A;  3PX4 A;  4DR6 K;  1HNW K;  2H3G X;  3SMS A;  3H6E A;  1VQ6 N;  2KFN A;  4GKJ K;  3DRS A;  3V9Z A;  5J2N A;  1LWC A;  4JKD A;  1T03 A;  3OS2 A;  2O8C B;  4KH5 A;  1ZBU A;  1J9A A;  3Q7B A;  4CE9 A;  4M3R A;  3WNH A;  1HNZ K;  1C0T A;  1VQ8 N;  4O8K A;  3VQ7 A;  2EHG A;  2ASO A;  3MN5 A;  5I9E B;  4Y1D A;  4DMN A;  1O13 A;  1BA1 A;  1NGC A;  4Y1C A;  3M6G A;  3QNN A;  1BOT O;  5I3U A;  3IAY A;  4AM7 A;  4BR5 A;  5LMN K;  4OVL A;  1EET A;  4CFA A;  1YVU A;  4JK7 A;  4DTU A;  1EQY A;  3LAM A;  1XHZ A;  3R8E A;  4O8U A;  2QA4 N;  2X6S A;  1D4X A;  4CHQ A;  4MO5 A;  3DAW A;  4RCH A;  4FO0 A;  4KFB A;  4Z94 A;  1OH7 A;  2YHB A;  4F3T A;  1WBB A;  4FXD A;  4WFB L;  3SAG A;  3TAM A;  4JI8 K;  4MLH A;  4FOE A;  3NF6 A;  2RHK A;  2VGM A;  3ZEU B;  4ELV A;  4WQ4 C;  2Y1J A;  3QDK A;  4FOI A;  4FJG A;  3S3M A;  1RTJ A;  1M1K O;  2G8K A;  3AO5 A;  1W7A A;  2JWL A;  1NU0 A;  1ZYQ A;  3ASM A;  2FSJ A;  3ENO A;  4IG3 A;  1NBW A;  3ZT3 A;  3TSP A;  1RDC A;  1GLF O;  4G1Q A;  2UU9 K;  3LDS A;  1N32 K;  4LH5 A;  3ZT2 A;  1HR0 K;  3QLH A;  3KK2 A;  1I94 K;  4EFH A;  2FBV A;  4A5B A;  3G25 A;  4BE1 A;  1NNE A;  1VQ4 N;  2WC9 A;  3HVT A;  4H4M A;  3PIO L;  2D1K A;  4FJI A;  1LAW A;  3CCJ N;  4AHV A;  3O1W A;  3CM5 A;  2P9N B;  3VPZ A;  2QEX N;  1WSJ A;  2D0O A;  4BG9 A;  3LAL A;  4W5T A;  5CY4 A;  4FWS A;  3LP2 A;  3O9R A;  2HBL A;  3SK3 A;  1WNS A;  3U3Y A;  3WXL A;  3AAR A;  3SNN A;  1KLM A;  5H1S Q;  2FSN A;  3NDK A;  4E19 A;  2HHU A;  4IZ9 A;  3ZCM A;  3HK2 A;  2BDP A;  2V51 B;  3C95 A;  3IUC A;  3PO5 A;  4N41 A;  3HOT A;  4FLY A;  3DXM B;  1WSF A;  1FKP A;  1D8Y A;  3VEZ A;  1NK9 A;  4PHT X;  4FJJ A;  3ZX0 A;  4DKW A;  1A5W A;  3WXJ A;  3MAQ A;  1NGJ A;  2NRR A;  4DF4 A;  4DSF A;  4CJU A;  4DU3 A;  3A2F A;  2HHW A;  5C24 A;  3VF6 A;  3NFA A;  4OKK A;  4BGA A;  1QSY A;  2F8S A;  3CIP A;  5FRN A;  5LY3 A;  1IKX A;  1K8A O;  4BR9 A;  1HYS A;  2HST A;  4GNI A;  4HTL A;  2BH1 A;  5IWA K;  4IO9 L;  5AFU H;  3FZF A;  2FLO A;  5AQZ A;  3T3F A;  4CZK A;  1K9M O;  3PIP L;  4GV3 A;  1UOC A;  2BUP A;  4U7B A;  3ZSW A;  4M63 C;  3PSF A;  4CJL A;  3THY B;  4KTZ A;  4ICL A;  4CJV A;  4JI2 K;  1NJX A;  1C6V A;  3VMF B;  1YAG A;  1LW2 A;  4DV0 K;  1TKZ A;  4O44 A;  1KRP A;  3OHR A;  1REV A;  3T7Z A;  3AA3 A;  1RBR A;  4QOZ B;  3FZM A;  2YI1 A;  3VET A;  3DWL A;  2AA4 A;  3AO2 A;  3BZC A;  3VA0 A;  3DLB A;  3VTI A;  3P38 A;  3G71 N;  3D7E O;  1NGF A;  2HHX A;  4IOX A;  2VG6 A;  4CBW A;  1KLN A;  4ILH A;  3HZ6 A;  1RDA A;  2Y1I A;  4OGC A;  1N6Q A;  2P9I B;  2Z1G A;  4CEA A;  5AQU A;  3I8D A;  1MWK A;  3ZYY X;  5KGW A;  3UKR B;  1Q9X A;  2PYL A;  4IG0 A;  4KPY A;  4X65 K;  5KTQ A;  2IVO A;  4CER A;  2E1Y A;  2VQF K;  1TUU A;  4BRD A;  3M3Z A;  4DSK A;  3KIO A;  3GBT A;  1FW6 A;  3SAF A;  4H0O A;  3HST B;  4K42 A;  1KAY A;  3CCS N;  3P83 D;  4I6M B;  4ZTF A;  4IEE A;  4YY3 K;  1FJG K;  4LF6 K;  1B9F A;  3ATU A;  3TAP A;  4CZI A;  2ZF5 O;  4CW7 B;  4F8R A;  1RDB A;  5AQR A;  5FDL A;  1NJI O;  1RT7 A;  3DOL A;  4CJR A;  3K5L A;  3J7Y P;  5K14 A;  4DG1 A;  4KHW A;  5A2Q O;  1QS4 A;  2F7T A;  2OPS A;  2NRW A;  2XHB A;  3BDP A;  4F9O A;  1CXQ A;  2PYJ A;  4LF4 K;  4FM1 A;  1N34 K;  2FF3 B;  2HOE A;  1RBT A;  4BR7 A;  1YTU A;  1IG9 A;  2GTD A;  5AQH A;  3K58 A;  2W41 A;  4GMJ B;  4NLB A;  5BPL A;  1OH5 A;  4CZG A;  3CM6 A;  3SQ1 A;  3WEE B;  4JEP A;  1BCO A;  5FPE A;  1NGI A;  4CHZ A;  4CZL A;  3CC2 N;  4WFA L;  3WT0 A;  1K6Y A;  2GEL A;  3ITH A;  4ILG B;  2OA8 A;  4QCL A;  1KFS A;  1XNR K;  3AVM A;  5BPM A;  3CCV N;  1DTT A;  3QFU A;  5BR8 K;  1RBS A;  4DSE A;  4DQQ A;  2EX3 A;  3V9U A;  1WSE A;  4CJ4 A;  5BN8 A;  5JMV A;  1NOZ A;  3CF5 L;  3G6E N;  2PBD A;  4DSI A;  3MXJ A;  4CK3 A;  5JS2 A;  5AQY A;  5GAG P;  4BDP A;  4MO4 A;  1W9H A;  3VEV A;  1HNV A;  3HT3 A;  4DQ8 A;  4CEQ A;  4KI4 A;  2UXB K;  3O1B A;  4H0Y B;  4JKE A;  3QER A;  3FZH A;  2F9T A;  4CGI A;  5J2Q A;  1XUP O;  1SL1 A;  1BDG A;  4J2A A;  4CEC A;  4CK1 A;  4AHS A;  4B1U B;  4FCY A;  1HYV A;  3SMP A;  5KPZ A;  1TKD A;  4EZ9 A;  1V4T A;  2HHS A;  3MDQ A;  4JKA A;  4B9S A;  2RPI A;  2GX9 A;  4YOY A;  3CJ1 A;  3HI0 A;  4MQ3 A;  1OKJ A;  1LWF A;  1DT9 A;  2HHT A;  3EE8 A;  4BC4 A;  2QWR A;  2WON A;  4C8K A;  4BRH A;  5AJ3 K;  3M8R A;  3KZB A;  4BRO A;  5C10 A;  3KLG A;  1V4S A;  2UUA K;  4FZZ A;  4BRI A;  3OJU A;  1S6P A;  3D0P A;  4XIU A;  3SAH A;  1SAZ A;  1HJO A;  4YOU A;  1DEJ A;  3KLI A;  4ISF A;  4FWK A;  3E66 A;  4LSN A;  3MN6 A;  3O3G A;  3OYC A;  2G8F A;  5AQO A;  1ATS A;  3L4Q A;  3PY8 A;  4BVP A;  3NF9 A;  2IVN A;  4FJ7 A;  5AQT A;  4A57 A;  3J80 O;  3O3H A;  4PL7 A;  3L2Q A;  2NRV A;  3TTF A;  4YHH K;  2HBJ A;  4W5O A;  1GLD G;  2IOC A;  3OJS A;  1A5X A;  5FRM A;  4FW1 A;  1DLO A;  4A62 A;  1TAQ A;  5AQW A;  3OA9 A;  4ID1 A;  1XC9 A;  2YKN A;  4PY5 A;  3SBT A;  4NO7 A;  3OYG A;  3D2F A;  4FJ8 A;  1RIL A;  4LF7 K;  2Q0R A;  2QKB A;  3CCU N;  3TAG A;  3AVF A;  4RW6 A;  4OJR A;  3E1Y A;  4E3S A;  5CYM A;  4DFJ A;  3V6D A;  1NK8 A;  2QXL A;  1RT6 A;  3QNO A;  5HOO A;  3EN9 A;  4CFB A;  1HJR A;  4HVJ A;  4OLA A;  1WN7 A;  4F2S A;  2YX6 A;  1QZ6 A;  3LM2 A;  5AFU A;  3TWH A;  3G10 A;  4E89 A;  1IKY A;  3KVG A;  4E7K A;  2P9L B;  3DLG A;  4H03 B;  4BVO A;  3VQQ A;  3CC4 N;  2NRT A;  2P1J A;  4BRL A;  4A2B A;  3AVA A;  4XH4 A;  3S41 A;  3SJJ A;  4RG8 A;  4Z4F A;  1EWQ A;  4B1X B;  2D4W A;  3DYA A;  3WXI A;  3HVR A;  2O8D A;  3KWG A;  1TYQ B;  1GLJ O;  3RRH A;  3U3G A;  1MU2 A;  1VSE A;  4FL9 A;  1S1X A;  3ZX3 A;  3C7N A;  4ELT A;  3KK1 A;  1G99 A;  3TAN A;  2HHV A;  4K8Z A;  3J7A P;  4ISE A;  3H46 O;  1YI2 N;  1T8E A;  3BGR A;  1YVN A;  1BGX T;  3MCP A;  3U8X A;  3LM9 A;  3DRP A;  4H0X B;  3LDN A;  1X3N A;  1JCF A;  4H8K A;  1L3T A;  4AM6 A;  5ADX H;  4KRF A;  3KKS A;  1OVY A;  2YHW A;  4DF8 A;  3AO3 A;  2QWQ A;  4JLH A;  5AQF A;  3ZSX A;  4JD2 A;  2XO7 A;  3THY A;  1HPM A;  5JLF A;  5C42 A;  3TSQ A;  2NRZ A;  3NGY A;  1U45 A;  1A5V A;  4BR2 A;  4HTU A;  2VWB A;  5HL7 L;  3VQ9 A;  2YJE A;  4C23 A;  1EX4 A;  2A3Z A;  1GOB A;  5J1E A;  4FZX C;  3PSI A;  3CCL N;  1N33 K;  5EY4 A;  4E1N A;  1S1T A;  4FLW A;  4WQ5 A;  4DHY A;  4F3O A;  4KI6 A;  3HPO A;  3QBW A;  4JYA K;  4KB1 A;  3VF4 A;  2HBM A;  1BCM A;  4R5P A;  5CR4 A;  5IT9 O;  2P9N A;  2XRI A;  1VQP N;  2OAN A;  2P9K A;  4DV4 K;  1VQ5 N;  1RT5 A;  1VQ9 N;  1C1B A;  2Q0U A;  3TAB A;  3ZEU A;  3HM8 A;  1IV0 A;  2I5J A;  1NMN A;  3UKR A;  4EP4 A;  1TUY A;  4O0I A;  4H5V A;  1LAV A;  2E6M A;  5AQL A;  1HUX A;  3ZSY A;  1SZ2 A;  4LSL A;  3OYJ A;  1WAJ A;  4A61 A;  5MLC Q;  2YNH A;  3NVM A;  3KLE A;  3O5B A;  5BRE A;  3IRX A;  1SV5 A;  1YHQ N;  4NCA A;  1RGI A;  3ENB A;  4Q0B A;  4X62 K;  4JHD B;  2HVH A;  2ETJ A;  1KAX A;  1TAU A;  4E7H A;  4KTQ A;  1NGA A;  4H0T B;  4BQL A;  3L2U A;  4X66 K;  4CGF A;  3THV A;  3AVC A;  2ATQ A;  3CCR N;  4FM0 A;  3R6M A;  1F21 A;  4EZ6 A;  1G15 A;  2E5L K;  2F4V K;  2BE2 A;  3WQU A;  4MDB A;  4AQY K;  1SL2 A;  5C2F A;  1X3M A;  4V19 S;  2ZM6 K;  1QTM A;  4K43 A;  4CES A;  4CJT A;  4PWD A;  1C0U A;  4C8N A;  1IH7 A;  4DV2 K;  3UKU B;  4Q5V A;  5HRP A;  3C0B A;  4Y0W A;  3EZW A;  1IJJ A;  4DV7 K;  3CCQ N;  1KSP A;  1XI1 A;  4LF5 K;  5TKW A;  3L4I A;  4JI3 K;  3AVL A;  5AQV A;  3OYD A;  3VGL A;  1QHA A;  3P1G A;  1BHL A;  3ZT1 A;  2RN2 A;  3A5M C;  1BI4 B;  4FJL A;  4QS8 A;  1ZBL A;  1QSL A;  3OYH A;  4G9Z A;  1D9F A;  4PQU A;  1NJZ A;  3GE1 A;  4C1N K;  3JAM O;  1C0M A;  3EO3 A;  3EYZ A;  1S1W A;  3F2K A;  3KD1 E;  2HB5 A;  1SKW A;  2ZQB A;  3P4I A;  2KHO A;  4CJS A;  4CED A;  3SPY A;  1TL1 A;  5KQ8 A;  3ZET A;  1B9D A;  4W5R A;  1HLU A;  3W0L A;  2NLX A;  3CER A;  1TGO A;  3VEW A;  4DB3 A;  2YHY A;  5GIP A;  3JXU A;  1S9G A;  3HXM A;  1YJW N;  1ATN A;  4AIL C;  5I42 A;  1Q82 O;  3WNF A;  2IVP A;  4HCC A;  5KRS A;  2OTJ N;  1T3V A;  3NF8 A;  1JLB A;  3MX2 A;  4CZF A;  4K8X A;  2GWK A;  4AF1 A;  3T1A A;  4CD3 A;  1JLQ A;  2XY5 A;  1NGE A;  1LCU A;  3CJ9 A;  4E1J A;  2UYT A;  1P8Z A;  1VSM A;  4E7I A;  4FWQ A;  2VG7 A;  2HNZ A;  1XNQ K;  1QQM A;  3VQE A;  3QEI A;  5AQS A;  4M3T A;  3V9W A;  1B92 A;  3H1Q A;  3IKM A;  2WFB A;  2YNF A;  3N4Q A;  3D2E B;  3CXC M;  2GUP A;  1TK0 A;  2D0B A;  3U9D A;  3OYA A;  2QWP A;  4H5W A;  1IBM K;  3QIC A;  3CG7 A;  2G8W A;  4E7L A;  3V81 A;  1VQM N;  3AY9 A;  3J7Z O;  1VQN N;  2D0P A;  3C6T A;  1NKE A;  4JKG A;  1K73 O;  1NG9 A;  4JNE A;  3M5R A;  4PA1 A;  4FLV A;  2I7N A;  5SWM A;  2A1R A;  4N76 A;  3VQ5 A;  4BDY A;  2HBK A;  1U04 A;  2E1Z A;  4Z0U A;  1YTA A;  5E84 A;  5LJW A;  1QVG M;  2YNG A;  3SQ2 A;  5ADX A;  5EXW A;  1TKT A;  1TV6 A;  1WSH A;  1ZC6 A;  4M7Y A;  3NH0 A;  1GLA G;  5JIC A;  4XEI A;  1KVC A;  3MXI A;  4NCG A;  3A5N C;  3KKR A;  4KV8 A;  3KJV A;  4NXN K;  1JXB A;  1IBK K;  1EP4 A;  1BIS A;  4FLU A;  5HRO A;  3QML A;  3HRG A;  3SV4 A;  3VER A;  3EEQ A;  3TPQ A;  3QES A;  4IJA A;  2ZJP L;  2WOM A;  4HWI A;  4A59 A;  3SZ2 A;  4TSX A;  1L5U A;  3I0R A;  1RT4 A;  3V1O A;  4FLZ A;  3LP3 A;  4BRK A;  4U67 L;  1J6Z A;  3L8B A;  1U48 A;  4BAC A;  4JI4 K;  1C0F A;  4DV5 K;  3DI6 A;  3ZX2 A;  3LPU A;  2AJQ A;  2YKM A;  5EX5 A;  4B3T K;  3HBT A;  5C12 A;  3K5M A;  5KGX A;  2YHA A;  4F2R A;  1O1W A;  2HF3 A;  1X9M A;  4DTJ A;  4OO1 J;  5AQX A;  5KPT A;  5JVH L;  4JKH A;  2QK9 A;  3ID8 A;  3AO1 A;  3TU5 A;  4CIF A;  2DY4 A;  4CF8 A;  1WSI A;  1L3U A;  4B3O A;  2EWS A;  3BZK A;  3SQ0 A;  3L3V A;  3DMJ A;  3AVB A;  2HND A;  2GBZ A;  4RW9 A;  2VQE K;  2ASM A;  1OVQ A;  1QZ5 A;  1IKV A;  4J2B A;  1FK9 A;  5DMR A;  3KTQ A;  1GLB G;  3AAP A;  4OPJ A;  3HP6 A;  3KLF A;  4CGH A;  2RKI A;  1GLE G;  1QSS A;  3UE5 A;  4CFC A;  2P9L A;  2ITG A;  2WBN A;  1J53 A;  2KLA A;  5AZI B;  5M1K A;  4DLG A;  2HNY A;  1NJY A;  3AA4 A;  3HP9 A;  1HNI A;  2QTD A;  5FLX O;  1UA1 A;  4CZM A;  4I9L A;  3AVN A;  1VQK N;  4B9N A;  4DS5 A;  2QWM A;  1SS6 A;  1VSF A;  4EIA A;  3C65 A; 
#chains in the Genus database with same CATH homology
 4FVU A;  1S72 N;  1XQS C;  4JAX A;  1N8R O;  2PAV A;  4R79 A;  3P39 A;  5AQP A;  3SBT A;  4GY2 B;  1E4F T;  1H1V A;  2Q36 A;  4NO7 A;  3D2F A;  2DPN A;  3BUZ B;  2NZT A;  4XH1 A;  2Q0R A;  3CCU N;  1S3X A;  2VYP A;  1VQ7 N;  4GV9 A;  4IEI A;  2NNW A;  3E1Y A;  4FWP A;  4WQ5 C;  2QXL A;  4CBU A;  3OW2 M;  5AQI A;  4FPA A;  4QS7 A;  5HOO A;  3EN9 A;  4RTF D;  1Q7Y O;  3OBY A;  2ZGY A;  2QW9 A;  4CD1 A;  4CZE A;  5M1F A;  2YX6 A;  3QFP A;  1HKB A;  2PFU A;  3D2E A;  3LL3 A;  3LDO A;  3MX5 A;  3VES A;  1QZ6 A;  2YJF A;  2WUS A;  3LM2 A;  3RVC A;  5FPM A;  3E9P A;  3H45 C;  3DJC A;  5AFU A;  4JD2 B;  4NB4 A;  3KVG A;  4M7X A;  4BGB A;  2P9L B;  2V7Z A;  2VCP A;  3IMX A;  4H03 B;  4BVO A;  4A2A A;  5AZI A;  5BRF A;  5F0X A;  5FPD A;  4K41 A;  3CC4 N;  4BQZ A;  2NRT A;  4BRL A;  3CC7 N;  1BU6 O;  4IDH A;  3R1X A;  4A2B A;  4FWL A;  5TKY A;  4XH4 A;  3S41 A;  4BRM A;  3I33 A;  3RSE A;  3O4W A;  3A8Y A;  3OBW A;  3CI5 A;  4B1X B;  2A42 A;  2D4W A;  5F2R A;  3WXI A;  2H3G X;  3SMS A;  3KWG A;  2AP1 A;  3VEN A;  2JWK A;  1TYQ B;  1GLJ O;  3H6E A;  3IDH A;  5AR0 A;  3VEO A;  4WF9 L;  1VQ6 N;  1W2B M;  4YDU C;  3EKS A;  1R59 O;  1U2V A;  4FL9 A;  3ZX3 A;  3CJC A;  3AGK A;  2F9W A;  3MWP A;  1RDW X;  2ZGZ A;  3C7N A;  4H5R A;  4JKD A;  5E26 A;  5AQJ A;  4DCH A;  1G99 A;  1DGK N;  4KH5 A;  4ISE A;  3H46 O;  2P9P A;  2V52 B;  1YI2 N;  1NLV A;  1YVN A;  4BRE A;  3MCP A;  3MMV A;  3Q7B A;  3LM9 A;  3U8X A;  4BRG A;  4CZH A;  5GAE P;  3WEE A;  1Q81 O;  4BY9 C;  3RSE B;  4FWN A;  3CHW A;  1WOQ A;  1S22 A;  4EHU A;  3B8A X;  4H0X B;  3LDN A;  1X3N A;  1JCF A;  2Q97 A;  4AM6 A;  5ADX H;  1E4G T;  3CJ7 A;  1VQ8 N;  4O8K A;  5KPR A;  1GLC G;  1OVY A;  1IG8 A;  2YHW A;  3H3O B;  2ASO A;  3MN5 A;  4H5N A;  2QWQ A;  3LDL A;  5AQF A;  5I9E B;  3AAQ A;  4JD2 A;  1HPM A;  1O13 A;  1BA1 A;  1NGC A;  5JLF A;  3M6G A;  3TSQ A;  3N4P A;  3DXK A;  1BOT O;  2NRZ A;  3L6Q A;  2ITM A;  4BR2 A;  2VWB A;  4AM7 A;  5HL7 L;  4BR5 A;  1NM1 A;  2QWN A;  4QS9 A;  4JK7 A;  1EQY A;  4UY8 O;  2YJE A;  4C23 A;  1SQK A;  2A3Z A;  3CQY A;  3CCM N;  3A5L C;  3R8E A;  3CPE A;  1NGH A;  4O8U A;  2QA4 N;  5BRH A;  4PKH A;  1D4X A;  2YCH A;  4MO5 A;  3DAW A;  4RCH A;  4FO0 A;  4Z94 A;  3CCL N;  5AZJ A;  5EY4 A;  5EOY A;  5DM7 L;  4WQ5 A;  4DHY A;  4FPB A;  4WFB L;  3SAG A;  1YIJ N;  2CH5 A;  3QBW A;  4MLH A;  3GL1 A;  4FOE A;  3VF4 A;  2HBM A;  2RHK A;  2VGM A;  4H0V B;  1U6Z A;  3ZEU B;  5AQG A;  3EE9 A;  4WQ4 C;  3QDK A;  4FOI A;  5CR4 A;  3L0Q A;  2P9N A;  3F5T A;  1VQP N;  1M1K O;  2OAN A;  2P9K A;  1VQ5 N;  1VQ9 N;  2JWL A;  4H0P A;  2Q0U A;  4BRN A;  3E9O A;  2E20 A;  3ZEU A;  1TYQ A;  1LOT B;  3HM8 A;  2A41 A;  2FSJ A;  3ENO A;  3UB5 A;  1NBW A;  3TSP A;  1GLF O;  3R9P A;  3UKR A;  1TUY A;  1KXP A;  3GG4 A;  3MN9 A;  4H5V A;  3AGR A;  2FSK A;  5AQL A;  3MK6 A;  5GAD P;  1HUX A;  1EO1 A;  1SZ2 A;  5GIN A;  1T6D A;  4A5B A;  4EFH A;  3G25 A;  4MLE A;  4A61 A;  5MLC Q;  1VQ4 N;  3O9T A;  4JK8 A;  1RDU A;  4FWO A;  3TTD A;  2WC9 A;  3W3D A;  4BRQ A;  4BR4 A;  4C1N I;  3UKU A;  1QVF M;  2E8A A;  2QM1 A;  5M1O A;  3NVM A;  3PIO L;  3O5B A;  2D1K A;  5BRE A;  3D6R A;  3CJB A;  3CCJ N;  3CCE N;  1YHQ N;  3O1W A;  3VPZ A;  2P9N B;  2QEX N;  3EKU A;  1RGI A;  1BWF O;  2D0O A;  3ENB A;  4BG9 A;  3GOI A;  4KBO A;  4JHD B;  4FWS A;  1KAX A;  4FWM A;  3O9R A;  1NGA A;  2HBL A;  3FZK A;  4IXC A;  4H0T B;  4BQL A;  4CI6 A;  3SK3 A;  3U9Z A;  4PKI A;  2FXU A;  3WXL A;  3AAR A;  4BG8 A;  5H1S Q;  2FSN A;  3CCR N;  4IZ9 A;  1DKG D;  2V51 B;  1ESV A;  3R6M A;  3IUC A;  2QWO A;  2P9I A;  3HOT A;  4IOC L;  3DXM B;  1BUP A;  1NWK A;  1KC8 O;  2OTL N;  3VEZ A;  1BO5 O;  3WQU A;  4MDB A;  4PHT X;  4YOX A;  1KAZ A;  3ZX0 A;  4IWV A;  5C2F A;  3BF3 A;  1X3M A;  1MWM A;  4DKW A;  1NGG A;  3KHY A;  3WXJ A;  1NGJ A;  4YOV A;  3ULE B;  2NRR A;  4K43 A;  5C15 A;  1X9J A;  3P31 A;  4B1V A;  3I8B A;  1GLL O;  1WUA A;  3OA9 A;  3UKU B;  3WUH A;  3CET A;  3ENH A;  3VF6 A;  3C0B A;  2P9U B;  4BGA A;  2IIR A;  2ASP A;  3CIP A;  4Y0W A;  5LY3 A;  5ELZ A;  4BC3 A;  3U4L A;  4WQ4 A;  3C6A A;  3EZW A;  3O9U A;  1K8A O;  1IJJ A;  4BR9 A;  4BRA A;  4CZJ A;  3C6H A;  3CCQ N;  2HST A;  4GNI A;  4HTL A;  5F1X A;  3O9S A;  2BH1 A;  3QB0 A;  1YF5 L;  5CE3 A;  3A5O C;  4IO9 L;  5AFU H;  2HF4 A;  3FZF A;  3ID6 A;  3L4I A;  5TKW A;  2FLO A;  3BF1 A;  5AQV A;  5AQZ A;  3VGL A;  1QHA A;  4CZK A;  2CH6 A;  1K9M O;  3WXM B;  3C7N B;  3PIP L;  5C0Y A;  3A5M C;  4JK9 A;  2Q1N A;  3MCA B;  4GV3 A;  1CZA N;  2BUP A;  4QS8 A;  4U7B A;  4A5A A;  1NGB A;  4G9Z A;  3GE1 A;  4M63 C;  1Q86 O;  4OPH A;  3DXK B;  4PL8 A;  4C1N K;  3JS6 A;  3EO3 A;  3F2K A;  2W40 A;  5C2D A;  3K9J A;  3VMF B;  3D2F B;  1YAG A;  3P4I A;  1KD1 O;  2KHO A;  4BRC A;  1ATR A;  3OHR A;  3T7Z A;  2I7P A;  1C0G A;  5KQD A;  1JCE A;  3ZET A;  5KQ8 A;  5GAH P;  1HLU A;  1ILY A;  3FZM A;  3W0L A;  2NLX A;  2YI1 A;  3CER A;  3VET A;  3EL2 A;  3DWL A;  3VTH A;  2AA4 A;  1KQS M;  3VEW A;  2CGK A;  3VOV A;  4DB3 A;  2YHY A;  2P9P B;  5GIP A;  3JXU A;  1YJW N;  1ATN A;  5AQN A;  3SLC A;  4JN4 A;  2CGL A;  1U2V B;  3P38 A;  4PKG A;  3VTI A;  1P90 A;  2E88 A;  3G71 N;  3D7E O;  1NGF A;  1Q82 O;  4I6M A;  2IVP A;  4IOX A;  4JKF A;  1Z6R A;  1JCG A;  3H1V X;  3WQT A;  4CBW A;  1M90 O;  4GVE A;  4ILH A;  2OTJ N;  1T3V A;  3HZ6 A;  3K9K A;  3MX2 A;  1Q18 A;  4CZF A;  3DLL L;  2GWK A;  3FZL A;  4AF1 A;  2QWL A;  4JKG B;  2P9I B;  3VEY A;  4CD3 A;  5AQU A;  2GWJ A;  1T44 A;  1NGE A;  1LCU A;  3CJ9 A;  2RE2 A;  1MWK A;  5AQK A;  4E1J A;  2UYT A;  1P8Z A;  3ZYY X;  5BRD A;  2GEM A;  4FWQ A;  4WYB A;  5JVG L;  3SJH A;  3UKR B;  4CBX A;  2Q31 A;  1QQM A;  1VAZ A;  2IVO A;  3E9L A;  2E1Y A;  5B8H A;  4YOW A;  1TUU A;  4L3Q A;  5M1N A;  4BRD A;  3M3Z A;  4FSV A;  2P9K B;  3GBT A;  1HKC A;  3SAF A;  3CJA A;  4H0O A;  5AQS A;  3PLA A;  4K42 A;  1KAY A;  3CCS N;  3H1Q A;  4I6M B;  3IKM A;  2WFB A;  3N4Q A;  3D2E B;  4XH5 A;  3Q7C A;  3VEX A;  3CXC M;  4IEE A;  2GUP A;  5AQQ A;  3U9D A;  2QWP A;  4H5W A;  3ATU A;  1YJN N;  3QIC A;  3QBX A;  4CZI A;  3IFR A;  3NMU A;  2ZF5 O;  4JKB A;  3CME N;  3ATV A;  2E2N A;  4JKC A;  5AQR A;  3AY9 A;  3J7Z O;  1NJI O;  1VQM N;  2D0P A;  3BP8 A;  3R3L A;  1HX1 A;  3WXK A;  1VQN N;  3O80 A;  3F9M A;  4YDU A;  4JKG A;  2E2Q A;  1K73 O;  3O8M A;  4O5F A;  4JNE A;  3M5R A;  3VGK A;  2I7N A;  1BG3 A;  1HKG A;  2F7T A;  2HBK A;  2NRW A;  2J4R A;  4KH6 A;  2E1Z A;  3G4S N;  4JHD A;  4F9O A;  4IOA L;  5E84 A;  5LJW A;  1QVG M;  3A0I X;  5ADX A;  5EXW A;  4WFN L;  1ZC6 A;  4B1Z A;  3LDP A;  1ZBS A;  4ISG A;  4M7Y A;  3FLC O;  2FF3 B;  2HOE A;  4BR7 A;  1GLA G;  1VQO N;  5JIC A;  2GTD A;  5AQH A;  4K25 A;  4XEI A;  1MDU B;  2P9S B;  3I55 N;  2W41 A;  2HMP A;  4NLB A;  3A5N C;  4OPA A;  2A6A A;  5BPL A;  4CZG A;  5AZJ B;  1K8K A;  3TTC A;  3O6W A;  1ZXO A;  3HSC A;  3WEE B;  4RWT A;  4JEP A;  5CHI A;  5FPE A;  1NGI A;  5M1Q A;  3FGU A;  4CZL A;  3CC2 N;  4NLC A;  4WFA L;  3WT0 A;  3QML A;  3HRG A;  2GEL A;  3VER A;  2Q2R A;  2P9U A;  3O08 A;  4ILG B;  3TPQ A;  4B1W B;  4YOT A;  4WCE L;  1NGD A;  3TSU A;  4H5T A;  4IJA A;  1JJ2 M;  5BPM A;  3CCV N;  2ZJP L;  3QFU A;  1RFQ A;  2FF6 A;  4HWI A;  4A59 A;  2BTF A;  5GIO A;  5BN8 A;  3I56 N;  5JMV A;  2E2P A;  3KK7 A;  3ULE A;  3VF2 A;  3CF5 L;  3G6E N;  2PBD A;  5FPN A;  1BA0 A;  4BC2 A;  3FFK B;  4BRK A;  4U67 L;  1J6Z A;  5AQY A;  5GAG P;  3CD6 N;  4MO4 A;  1C0F A;  1YJ9 N;  4YOR A;  3VEV A;  1Y64 A;  3ZX2 A;  2E2O A;  4CJ7 A;  5EVZ A;  5EX5 A;  3ZET B;  4LC9 B;  3HBT A;  4DQ8 A;  5C12 A;  3MN7 A;  5BPN A;  4J8F A;  3O1B A;  4H0Y B;  5AQM A;  2HF3 A;  4JKE A;  5BN9 A;  4OO1 J;  3FZH A;  5AQX A;  3CQX A;  2F9T A;  5KPT A;  1YXQ A;  1XUP O;  4JKH A;  1BDG A;  5JVH L;  3T69 A;  3ID8 A;  4GV6 A;  2VGN A;  4B1U B;  3HTV A;  2ZJR L;  2P9S A;  3SMP A;  3TU5 A;  2ZWH A;  5KPZ A;  1NMD A;  1V4T A;  2QI2 A;  3MDQ A;  4BR0 A;  4IFE A;  4JKA A;  2A5X A;  2EWS A;  2V7Y A;  2GX9 A;  4YOY A;  3CJ1 A;  1YIT N;  3HI0 A;  2ZJQ L;  1OKJ A;  1XC3 A;  1DT9 A;  3EE8 A;  2A40 A;  3GDQ A;  2ASM A;  4BC4 A;  2YHX A;  1W97 L;  2QWR A;  4BRH A;  1QZ5 A;  3KZB A;  4BRO A;  5C10 A;  3O9Q A;  1V4S A;  3FE1 A;  2NRH A;  3HOS A;  4KH4 A;  4BRI A;  2NRX A;  4B1Y B;  1GLB G;  3AAP A;  3KWI A;  5LJV A;  1GLE G;  5JLH A;  3SAH A;  1SAZ A;  3FR0 A;  1HJO A;  4YOU A;  3UE5 A;  1DEJ A;  4ISF A;  5M1P A;  3SBG A;  4FWK A;  3E66 A;  1Z05 A;  3MN6 A;  2P9L A;  4EHT A;  1K8K B;  3CPW M;  2WBN A;  3H3N O;  1ATS A;  3L4Q A;  3LDQ A;  5AQO A;  3M1F A;  3CMA N;  5M1K A;  1QQO A;  1MA9 B;  2KLA A;  5AZI B;  4BVP A;  3NVK A;  5DM6 L;  2QTD A;  2IVN A;  3BEX A;  1VQL N;  4CZM A;  4MDA A;  1QQN A;  5AQT A;  4A57 A;  4BRF A;  4EAH D;  2CGJ A;  3J8A A;  4PL7 A;  4BC5 A;  1VQK N;  2NRV A;  4IO8 A;  4ILJ A;  3TTF A;  4FWR A;  4B9Q A;  2HBJ A;  1GLD G;  1YUW A;  3VGM A;  2QWM A;  1SS6 A;  3DXM A;  3MWT A;  1T6C A;  4A62 A;  4EIA A;  5AQW A;  4BRP A;  4IJN A;  3C65 A;  5BR9 A;  2KKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...