3SK3A

Crystal structure of salmonella typhimurium acetate kinase (acka) with citrate bound at the dimeric interface
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
398
structure length
385
Chain Sequence
SKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAALGAGAAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGGDIDPAIIFHLHDTLGMSVDQINKMLLGLTEVTSDCRYVEDNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic investigations on Salmonella typhimurium acetate kinase (AckA): identification of a putative ligand binding pocket at the dimeric interface
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Transferase
molecule keywords Acetate kinase
total genus 133
structure length 385
sequence length 398
chains with identical sequence B
ec nomenclature ec 2.7.2.1: Acetate kinase.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00871 Acetate_kinase Acetokinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3sk3A02
2GTDA 1YAGA 5AQRA 3VGLA 3P4IA 3OHRA 5KPTA 1V4TA 5AQVA 3O1BA 3H3NO 3J8AA 2YJEA 4FWMA 4K43A 4BR7A 4JHDA 4EFHA 5AR0A 1ZXOA 2GWJA 2ZGZA 3F9MA 1WOQA 5EY4A 2E1ZA 1TYQA 3R9PA 1H1VA 2A40A 3U9DA 1Q18A 4EAHD 3VOVA 4BR0A 3ZX2A 3ZETA 2E88A 1S22A 5AQUA 3CJ9A 2V52B 1P8ZA 2GUPA 4BG9A 4JNEA 1GLDG 4HWIA 1NM1A 3VEZA 3CJ7A 1TYQB 2YHWA 4BRDA 1IG8A 1HKGA 3HI0A 5KQDA 2ASMA 3A5LC 3IUCA 4Z94A 1QZ6A 2FSNA 3RSEB 2P9NA 3CETA 4BRNA 4BREA 4B1ZA 3CQYA 4AM7A 4O5FA 4L3QA 1DGKN 3MDQA 1SQKA 1MWKA 4BROA 3D2FB 4FOIA 2VWBA 5AQOA 3WXJA 3SK3A 1QQOA 3CERA 4FWSA 4MLEA 1NGCA 5EOYA 3VGMA 3HBTA 2VYPA 3CQXA 2Q0UA 4RWTA 4JHDB 2P9KB 3CIPA 3WXLA 1DKGD 2A41A 1E4GT 2NZTA 1GLLO 3L4IA 3FFKB 2GWKA 4CZKA 2GELA 3S41A 1IJJA 3DXMB 3LDPA 3TPQA 3VEOA 3WQTA 3QICA 1KAZA 1LCUA 2F9WA 1BA1A 4H5TA 1HX1A 3QB0A 2A5XA 2Q36A 3TU5A 4H0PA 4CBWA 4A2BA 1C0GA 4IJAA 2P9SB 3QBWA 3EO3A 4XH4A 2NRHA 2CGKA 2QWNA 2D0PA 3D2EB 4YDUA 2ZF5O 2WUSA 3EN9A 3JXUA 4FO0A 3BUZB 3SMPA 4PL7A 3BEXA 3ULEB 2IVPA 3O8MA 4H0TB 2A42A 1JCGA 4EHTA 4FWPA 4QS8A 3SLCA 5JMVA 3QDKA 3A5NC 4PKIA 1NGHA 4WQ5A 1JCEA 4M63C 4K41A 2QM1A 4F9OA 1QQMA 4GNIA 2QWMA 1TUUA 4DB3A 5KPZA 3VEVA 4AM6A 1YVNA 4CD3A 1NGFA 5F0XA 2OANA 1NGEA 3WEEA 2E1YA 3FE1A 1HKCA 2VCPA 1MWMA 2W41A 3UE5A 5B8HA 3EZWA 5AQWA 5AQNA 1K8KB 2P9UA 2QXLA 1RFQA 2E2OA 4CZMA 2DPNA 3GBTA 3UKUB 2Q97A 3W0LA 4M7XA 5FPDA 4BVPA 5LY3A 3W3DA 1BOTO 2QWOA 4H5NA 1Z6RA 4QS9A 4MLHA 5TKYA 1XQSC 1RDWX 3VEYA 5JLHA 5EVZA 4CZGA 4BR5A 5BN8A 2NLXA 2QWLA 3VF2A 3C7NB 4EHUA 3A0IX 3H46O 3HSCA 5AQKA 3BP8A 2E2PA 4KBOA 2FLOA 4CJ7A 4BRHA 2IVOA 1GLJO 3CJ1A 5AQSA 1YUWA 4BRGA 2Q1NA 3ULEA 3I8BA 2FF6A 3EKUA 4GY2B 3LM2A 1BWFO 4JAXA 4FWOA 2GEMA 5AQTA 4J8FA 4IO8A 3R8EA 5AQPA 4CBUA 1X3MA 3EL2A 1NGJA 1MA9B 3WUHA 2Q0RA 1HUXA 2W40A 3GL1A 3JS6A 3MCPA 5AQIA 1KAYA 5JLFA 4CZIA 4FWLA 3HZ6A 3M6GA 3O4WA 3MN9A 5AZJA 4DQ8A 1BG3A 3B8AX 4B1XB 5JICA 4PKHA 1ZBSA 4I6MA 2ITMA 5EXWA 4JD2B 2H3GX 4B1YB 3QFUA 3I33A 5AQLA 1J6ZA 4PKGA 3WXKA 2HMPA 4FWQA 3CHWA 1XC3A 2E2NA 2P9KA 3FGUA 4M7YA 3VETA 3SMSA 2Q31A 2V7ZA 4RCHA 5AZIB 3BF3A 4NB4A 3D2FA 4BRLA 1HKBA 3KZBA 2P9LB 1BA0A 2P9PA 3AY9A 3QBXA 2ASOA 3MN7A 4K25A 1X3NA 2PAVA 3QFPA 3A5MC 1NWKA 2I7PA 3H45C 5BPLA 3IFRA 1NMDA 3LDLA 4A2AA 3U4LA 4BGBA 3ZEUB 1QQNA 5AFUH 5BPNA 3H3OB 1GLEG 5LJVA 2EWSA 5AQFA 3VESA 1BO5O 5E84A 3KHYA 4BRCA 3VEXA 1YXQA 3H1VX 2CGJA 5AQMA 4CZLA 3UKRB 1U2VA 1T6CA 1OKJA 2CGLA 4CZEA 4BRMA 2E20A 1HJOA 2P9PB 3U9ZA 2PBDA 5FPMA 3C0BA 5AQJA 1C0FA 4E1JA 2P9SA 3VEWA 3GE1A 1KAXA 4HTLA 4CBXA 5BRFA 1QZ5A 2YHXA 3FR0A 1HPMA 2FXUA 3UKRA 4EIAA 1GLCG 4CZJA 4FWNA 3BF1A 2I7NA 3SJHA 3FZHA 3M3ZA 4BRPA 4CI6A 4ISEA 2P9NB 2QWRA 4I6MB 2IIRA 5AQYA 5AQZA 3MN6A 1G99A 4WQ4A 4WYBA 3CJBA 4BR9A 2AP1A 2FSJA 1Z05A 4H0VB 4B1VA 3WT0A 3VPZA 1U6ZA 1BDGA 3ENHA 5LJWA 2FSKA 4LC9B 3ID8A 5E26A 1NGBA 3LDNA 4BQLA 1NBWA 1ATSA 3ZETB 3ENOA 2P9IB 2CH6A 2QWQA 4JN4A 1U2VB 2HOEA 4BC3A 1S3XA 1KXPA 5FPEA 4IZ9A 2F9TA 1GLAG 4BRKA 1ATNA 2A6AA 5ADXA 3UKUA 5BN9A 2J4RA 1ESVA 3DWLA 1SAZA 4H5WA 3VF4A 4BRAA 4C23A 3FZKA 3VF6A 2FF3B 4FPAA 1T6DA 3O80A 1NLVA 2BTFA 2E8AA 5BRDA 4BQZA 4XH1A 4FOEA 2V7YA 5BREA 3ATVA 3ATUA 2P9LA 1ATRA 4B9QA 4BR4A 2ZWHA 3GOIA 3O5BA 1Y64A 1JCFA 4IXCA 1D4XA 4B1WB 3ZX0A 5CE3A 3LDOA 1NGGA 3MK6A 5AQHA 5ELZA 2V51B 3A8YA 5KQ8A 2QW9A 3FZLA 4Y0WA 4BRQA 3WXIA 3CI5A 1X9JA 4CZFA 4ISFA 1ZC6A 4PL8A 3RSEA 2QWPA 5BRHA 3L0QA 4FSVA 2YI1A 4H5RA 3G25A 3MMVA 5ADXH 2A3ZA 3FLCO 5AZJB 4BVOA 2P9IA 2D4WA 3O08A 4WQ5C 3GDQA 3LDQA 3A5OC 4CD1A 2D1KA 2D0OA 2YHYA 4BRIA 3QMLA 4FL9A 4IWVA 4BC4A 4B1UB 3DXMA 3ZX3A 5AQXA 3UB5A 2BUPA 2Q2RA 3LL3A 3H1QA 3HTVA 2CH5A 3CJAA 3VERA 1R59O 1XUPO 4JD2A 3O1WA 1BU6O 5EX5A 5AFUA 3O6WA 4WQ4C 3VENA 3LM9A 2HF4A 1CZAN 3D7EO 1NGIA 4FPBA 3FZMA 4QS7A 1QHAA 4H03B 3DAWA 3D2EA 3H6EA 3R6MA 4H0XB 3EKSA 2ASPA 1GLBG 2KHOA 4IJNA 4XEIA 3HM8A 3WEEB 3U8XA 4A62A 4BC2A 2ZGYA 1BUPA 3AAQA 3C7NA 3GG4A 1T44A 3M1FA 3DXKA 4BC5A 3IDHA 3KVGA 4RTFD 4K42A 4BRFA 4DHYA 4BR2A 2E2QA 1WUAA 5F2RA 1NGAA 4A61A 4FWRA 1NGDA 2AA4A 1GLFO 1TUYA 2UYTA 1LOTB 4O8KA 2IVNA 4MO4A 5F1XA 3DJCA 1K8KA 2P9UB 5FPNA 3ZEUA 2HF3A 4ISGA 4DCHA 1E4FT 1EQYA 3FZFA 4YDUC 5AQQA 1HLUA 4FWKA 1V4SA 5BR9A 3IMXA 3DXKB 3VGKA 3WQUA 5KPRA 3CJCA 1MDUB 3AARA 2YJFA 2YCHA 4NO7A 5AZIA 4BGAA 1RGIA 3AAPA 3MN5A 4CZHA 4H5VA 5BPMA 4H0OA 4MO5A 4XH5A 1SZ2A 4BG8A 4H0YB 5I9EB 1DEJA 5AQGA 3L6QA
chains in the Genus database with same CATH superfamily
4OKEA 3HXMA 1YAGA 5AQRA 3OHRA 5AQVA 4FWMA 4YORA 1A5WA 3HVRA 3LALA 3E9PA 3ZT0A 2E1ZA 1JLAA 1TYQA 4QCLA 3MX2A 1RBSA 2PY5A 4BR0A 3ZX2A 4L8RB 3KLGA 3ZSRA 3FFIA 4DV5K 4JNEA 4KHSA 4FJMA 4HWIA 3I0RA 3THWA 4BRDA 1IG8A 4OO1J 4OPHA 4RW4A 3VMFB 4DUYK 1HJRA 1VQ5N 4F2RA 3S3OA 2FSNA 3E01A 4KHPK 3G4SN 4FM0A 5FLXO 3OJSA 1JL2A 5FRMA 3DLHA 4K8XA 1TKXA 4DU1A 2F8TA 2HHTA 2OZMA 3PIOL 3D0PA 4FW2A 3U3GA 1VSLA 3MECA 1XI1A 1X9WA 1DTQA 4PHTX 1VQNN 3HBTA 3TABA 4JI5K 2YKMA 3AGKA 1YJ9N 4FK0A 3OYIA 3CIPA 4J2DA 2NZTA 1GLLO 1S1VA 3TAPA 3FFKB 2GWKA 4DSJA 4OVLA 2GELA 3S41A 1YJNN 3TPQA 2VQEK 3VEOA 1YIJN 3WQTA 4IOCL 2XRIA 2F9WA 3I0SA 4CFCA 1BA1A 4H5TA 1HX1A 4CFAA 2Q36A 3TU5A 4JKEA 4JI3K 4FLWA 1VQ8N 1C0GA 3QBWA 2QWNA 1BI4A 3D6RA 1CXUA 1U48A 2D0PA 2G8VA 5FDLA 1QTMA 1XMQK 2WUSA 3EN9A 3K59A 3BEXA 3SNNA 2IVPA 4DKWA 5GIPA 1VQPN 3L2RA 4X62K 3SQ1A 2XY6A 1C6VA 1HNVA 5HP1A 3B6OA 4DR5K 3TTFA 4E7JA 4KI6A 2ATQA 3QO9A 3LPTA 1BI4B 1U4BA 4DTPA 1QQMA 4YOYA 4DQIA 1NMNA 5KPZA 3L8BA 4MDAA 4AM6A 3PV8A 1NGEA 5JVHL 2O8FB 1MWMA 3KKRA 3P83D 1N8RO 2KTQA 3BZCA 5DK5A 1BCOA 4NYFA 4FJLA 4M7XA 1SV5A 4BVPA 5LY3A 1TAUA 3LZJA 1BHLA 2ITGA 2UUBK 4M3RA 1Z6RA 3F9KA 4MLHA 5TKYA 4OKKA 3VTHA 1Q9XA 3CCRN 1RDWX 4CJEA 4JKHA 3D45A 4CZGA 2O8FA 4IFYA 3IAYA 2NLXA 3VF2A 1BIZA 3CCJN 3H46O 4UQGA 3HSCA 2O8CA 4JKFA 4JKDA 3G0ZA 2E2PA 1BL3A 4CJ7A 3SV4A 3ZSOA 1GLJO 5AQSA 3QNOA 1KCFA 1NK9A 3ULEA 3OW2M 4KAZA 3PX0A 4CVNE 4Q5VA 5M1KA 4CCHA 3AA4A 3F73A 3T1HK 3OYBA 4J8FA 1VSEA 1SKWA 5AQPA 3EL2A 1NGJA 4IKFA 3AVJA 4DMNA 4CHQA 3MCPA 3C6AA 4DQRA 4JKGB 3LZIA 1VQLN 1JXBA 3CG7A 3VQEA 4LFBK 3QEPA 4DTOA 3MN9A 3I8DA 4X64K 3B8AX 1DTTA 4B1XB 3SBTA 2OPQA 4CJRA 1RT2A 4I6MA 2ITMA 1VK0A 4JS5A 4OLAA 3QFUA 3I56N 1WLJA 2HHUA 4JI2K 4ELUA 2KW4A 2E2NA 2P9KA 3N4QA 2HHWA 3VETA 1O1WA 1D9FA 1FXXA 1D5AA 5M1NA 3T69A 4CJFA 1WBDA 3DI6A 4BRLA 2P9PA 4GV9A 2ASOA 3MN7A 3WNHA 3L2UA 2XY8A 4B9LA 1VSKA 4A2AA 3U4LA 1UOCA 1QQNA 5AFUH 3KK2A 2JLEA 2A1RA 2NRXA 1BO5O 5E84A 4KHWA 1YXQA 4DFJA 3SQ0A 4CZEA 3HPOA 4FLTA 3G71N 2FBYA 2P9PB 5FPMA 2VG6A 5HRRA 4E1JA 3ID6A 3VEWA 4YFUA 5J2QA 4F3TA 1EWQA 1QZ5A 1NK0A 3FR0A 3UKRA 4EIAA 2VG5A 3IG1A 2X6SA 2P51A 3SJHA 4CI6A 1D8YA 1L5UA 2NRVA 2NRZA 2E6MA 3EE8A 5AJ3K 2I5JA 2IGIA 1JLCA 2IIRA 1QS4A 1JLFA 2VGNA 4WYBA 3ZT2A 3BZKA 1SUQA 2FSJA 1Z05A 3OS2A 4M3UA 3NDKA 4FK2A 4JKGA 4IEEA 4OKJA 2Q3SA 5E26A 1NGBA 3LDNA 2O4GA 2VQFK 3G6EN 1FW6A 3ZETB 2UUAK 3NGYA 1KC8O 4O0JA 4GVEA 2O8DB 4M41A 3DWLA 1VQ4N 2FF3B 3V9ZA 1XMOK 4CJTA 2DY4A 1NLVA 5LMNK 2BTFA 5CY4A 3TTCA 5BREA 2NRRA 3SJJA 3ATUA 1ATRA 4B9QA 4BR4A 2ZWHA 5HLFA 3VN5A 2E5LK 4IXCA 1D4XA 4R5PA 3C65A 4B1WB 3LDOA 3SAHA 2PZSA 3MK6A 5AQHA 1RILA 1HNWK 3VQ9A 4ZHRA 4EP5A 4ISFA 1ZC6A 5FROA 2OPSA 3DLEA 2QWPA 2F4VK 2HMIA 2BDPA 2KKZA 3G25A 4E7LA 1BIUA 5ADXH 5AZJB 1U49A 4BVOA 1NOZA 4NXNK 3LWMA 1LAVA 1JLQA 3LAKA 3NVKA 1L3SA 3J81O 4FL9A 3SZ2A 4BY9C 3TAGA 4FM2A 4BC4A 4B9TA 3R3LA 3UB5A 2UXBK 2BUPA 3CFOA 1XNRK 1YI2N 4E7HA 3LL3A 1NNEA 3H1QA 1XHXA 3HOSA 4IDKA 1R59O 4CF9A 1DT9A 4XIUA 1S1XA 4DR4K 4KREA 4YOTA 4E3SA 3O9UA 3LM9A 2HF4A 1CZAN 4QS7A 4JI4K 4LF9K 3AO2A 2JGUA 4H03B 1C0TA 3D2EA 2XY7A 3R6MA 2UU9K 4H0XB 1WSFA 3KK3A 4XEIA 4JLHA 4A62A 4E1MA 5LMUK 2ZGYA 3AAQA 1T44A 1Q81O 4I2QA 3DLBA 4FZYA 3K5OA 3VQ7A 1C1AA 5F2RA 2O8BA 2OZSA 2AA4A 1SL2A 1GLFO 1VQ7N 1TUYA 4KV8A 3DJCA 4DFKA 2HNZA 4N41A 4ISGA 4BACA 1VQ9N 3FZFA 1EQYA 2X6NA 2ZJRL 3V9XA 5BR9A 4FJNA 5KGWA 3AARA 4CEOA 3THWB 5AZIA 1F21A 4H5VA 2PYLA 4H4MA 1JLEA 3RR8A 4MO5A 2Y1IA 5CHIA 3TARA 2YNHA 3O4NA 5IWAK 4G9ZA 5C15A 1J5EK 4YOXA 3OYFA 4LSLA 4JI0K 4CEAA 2RKIA 5HRPA 1V4TA 1TGOA 3O1BA 4LF7K 3AVFA 4LY7A 4EFHA 5AR0A 1ZXOA 4ILGB 3LANA 3PSIA 1HR0K 2ZGZA 2OCEA 3F9MA 5EY4A 3CQ8A 3R9PA 3TAMA 4LF6K 2A40A 5KI6A 3U9DA 3OA9A 3IRXA 4CEEA 3ZETA 4W5OA 4YNQA 1RTIA 2V52B 1P8ZA 5A2QO 3RWUA 3PX4A 3HSTB 3O3GA 3TAQA 3LPUA 3RVCA 4A5BA 3V1OA 4FJ8A 4Z4FA 3BDPA 1HKGA 3HI0A 2ASMA 1QZ6A 3M8QA 1T7PA 1ZBFA 4B1ZA 3CQYA 3HVTA 3NHGA 1KRPA 1FKPA 4Y1DA 1U45A 3MDQA 4CIEA 1X9SA 4I9QA 2VWBA 3F2KA 3WXJA 1QQOA 1Y97A 3CERA 1YF5L 1IKXA 1NGCA 1SS6A 4OPKA 3AVMA 2IDOA 4KHNA 1I39A 1N33K 4JHDB 1RT5A 4B3MK 4CJKA 2QI2A 1DKGD 5C0YA 1VQMN 4YY3K 4FJXA 2G8WA 4E1NA 3AA3A 3QICA 3G10A 1REVA 4H0PA 3M5RA 4CBWA 2ZJPL 4LFCK 4A2BA 3RMAA 4JI8K 3ISNC 3AO5A 3OS1A 4X66K 4O5BA 3OYDA 2QKKA 2HBKA 2HVHA 3E9LA 4PL7A 2GV9A 1YJWN 3ULEB 3O8MA 2G8KA 2O8EB 4W5RA 2A42A 2HHHK 4FK4A 4DU4A 4EHTA 5KRSA 2Z1IA 2WBNA 3QDKA 3HPGA 3A5NC 4WQ5A 5EU7A 4DV6K 3MX5A 1WSGA 4DTUA 4FLYA 2VWKA 4DB3A 1GOCA 4DSFA 2DFEA 3VEVA 4CHOA 1UA0A 4CFBA 1R0AA 2VCPA 4WF9L 1BGXT 4KH4A 1VAZA 1CZBA 1NJWA 1LW2A 3ZSVA 2QXLA 4KH5A 3NVMA 4OJRA 4CZMA 2DPNA 3DRRA 3AVHA 2BANA 4NCBA 3J80O 4B3SK 3VQBA 3VQ8A 1FKOA 1W0HA 1KQSM 3K5LA 3UIQA 2FBXA 4BR5A 4AHSA 5BN8A 3QNNA 3VQAA 1VQ6N 4Y1CA 3A0IX 4CESA 1UWBA 2FLOA 3DLGA 4BRGA 4PA1A 1JJ2M 3EKUA 1YVUA 3LM2A 4DTSA 4DSEA 3NE6A 1BWFO 3JSMA 2YNFA 2GEMA 3TSQA 2F7TA 3SAGA 1X3MA 3THYA 2P5OA 3OYAA 1MA9B 3F5TA 2RF2A 1C1BA 1IH7A 4IFVA 4CEFA 2HHQA 4NYNA 4FWLA 3HZ6A 3O4WA 3CC2N 1B9DA 3OJUA 3NGIA 4FZXC 4OPAA 4DQ8A 2HHVA 5DMRA 2F8SA 4DUZK 1ZBSA 4LFAK 2QXFA 4DFMA 4LF4K 3CPEA 4U67L 4PKGA 2O8CB 1VRUA 2HMPA 4FWQA 4E0DA 5HOOA 1XC3A 3E9OA 4M7YA 3AVNA 5AZIB 4RCHA 3K5NA 3IS9A 1JL1A 2OPRA 3BF3A 3KK7A 1EX4A 3C6UA 3D2FA 5K14A 4K25A 3A5MC 1NWKA 3VTIA 3H45C 4FJ9A 1NMDA 1HQEA 3ZEUB 1GLEG 3LP2A 4JK8A 5GAHP 2XY5A 2EWSA 2O8DA 3ZSYA 1S9EA 4CJQA 3VEXA 3H1VX 3UKRB 1OKJA 4B08A 5C42A 1K9MO 4ELTA 4DS5A 3U9ZA 2BGGA 4H4OA 3L2WA 1VSFA 1OH6A 5AQJA 3T19A 1C0FA 2RHKA 3MWPA 3OYHA 3OYJA 3OBWA 1IBMK 2FBVA 4NLCA 4JI7K 1HPMA 3LP0A 5JS2A 4M3XA 3BF1A 2I7NA 3M3ZA 1S5JA 4Z4HA 2KLAA 4TSXA 4M3TA 4LH5A 5CYQA 3NMUA 2WOMA 3MN6A 3C6TA 1VSJA 2AP1A 4A59A 2XHBA 4DQPA 4CF1A 3L2QA 3AO3A 4LC9B 4W5TA 4V19S 3ID8A 4BQLA 1NBWA 1ATSA 2XO7A 4KH6A 3QIPA 5CZ1A 1YHQN 4X65K 4M3YA 2HOEA 4BC3A 5FPEA 3DLRA 3PSFA 2F9TA 3K58A 1GLAG 5ADXA 4NCGA 3HL8A 4FJ7A 3I55N 3CM6A 4HUFA 1ASVA 5MLCQ 3KD5E 4H5WA 4C23A 4RW8A 3MEEA 4Z4EA 4J2AA 1T6DA 3TAEA 1X9MA 3HRGA 1RDUA 2E8AA 4BQZA 2HNYA 2G8FA 3V1RA 3ZSQA 1IBKK 3GOIA 1Y64A 1HMVA 2YHAA 2X78A 3CCVN 2ZE2A 2KZZA 5HRNA 2NRTA 4B9MA 2QW9A 1RT7A 3NGZA 4E19A 4Y0WA 3C6HA 4AILC 1K6YA 1LWEA 4EZ9A 4CECA 3L0QA 4R79A 2YI1A 4WE1A 5SWMA 1WSHA 2A3ZA 3FLCO 3DLKA 3CCEN 2F96A 4FJIA 4WQ5C 3GDQA 3LDQA 3V81A 2D1KA 4BRIA 4CHPA 1J5OA 4B1UB 3ZX3A 2HW3A 3DRSA 4FXDA 5E41A 2CH5A 3BGRA 4C8NA 3TSPA 5KTQA 4WFAL 1IG9A 3V9UA 3HK2A 1Q9YA 1QSSA 4EZ6A 5AFUA 3ENBA 4ZTFA 3CC4N 3VENA 5HROA 3M8SA 4E7IA 3DAWA 2IOCA 5C12A 3U6FA 3QESA 1KVCA 2ASPA 1GLBG 2KHOA 2Z1HA 3HM8A 1RT4A 1NK5A 3GG4A 3TTDA 4KFBA 4JI1K 1TV6A 3IDHA 4LSNA 4BDPA 2YHBA 4RTFD 3PIPL 1SL1A 4DHYA 4H8KA 1WUAA 4KHQA 1NGAA 3RRGA 4A61A 3OYMA 4FWRA 4GKJK 1HYSA 1NGDA 1N34K 2UYTA 4DR1K 2O8EA 3MXMA 4O8KA 2IAJA 1ASWA 2A1SA 1QSYA 3P5JA 1BCMA 2OA8A 3VQDA 1LW0A 3WQUA 5KPRA 1Q82O 2UXDK 1NG9A 4BG8A 4IDHA 3VQ4A 5C10A 2GTDA 3VGLA 3S3MA 5KPTA 4DR2K 2FC0A 3J8AA 4K43A 4BR7A 1VQKN 4B9NA 3SUQA 3AA2A 4U7BA 1WOQA 2GX9A 3O3FA 1VRTA 4ZTJA 1H1VA 3N4PA 1KLMA 5C24A 4CGIA 1C0UA 2VG7A 5M1FA 2GUPA 4HCCA 4BG9A 1NM1A 2W42A 3VEZA 2HSTA 1CZ9A 4DTRA 5KQDA 3RSEB 4W5NA 3ZSZA 3VQ6A 3CXCM 2E6LA 1TVRA 3VQCA 3HJFA 4AM7A 1RCHA 3AVIA 4JRQA 1WAFA 4CJ3A 4L3QA 1DGKN 2GBZA 3L3VA 1MWKA 4BROA 4FOIA 5J2MA 3LP1A 3SK3A 5HRSA 4MLEA 3T1YK 5EOYA 4CF0A 3QIOA 3VGMA 4DF8A 1SL0A 1S1WA 1YT3A 3CQXA 4RWTA 4OGCA 2P9KB 3K0SA 1IBLK 3TSUA 4FM1A 3WXLA 4DTMA 5I42A 4WFBL 3C94A 3L4IA 4DTNA 1QVGM 4DR6K 1CLQA 1RNHA 3DXMB 1ZBIA 4YHHK 4FLVA 3DOKA 3O9RA 3AGRA 2DTUA 3THXB 1N6QA 4FCYA 1TL1A 2P9SB 4C8OA 3EO3A 1S1UA 2CGKA 2NRHA 1NK8A 3SPZA 4GW6A 1RDBA 4FO0A 3SMPA 3SV3A 1K8AO 3VA0A 4G1QA 1NU0A 4Z4CA 1RBTA 4H0TB 3QLHA 5C2DA 3C95A 3DRPA 1WSJA 4GKKK 1JLGA 1NJYA 2HBJA 1TK5A 3NFAA 3LAMA 4FWPA 4QS8A 3DOLA 4JKCA 4W5QA 4JK9A 1JCEA 4M63C 4KKOA 4KB0A 4IO9L 4GNIA 2QWMA 3RMCA 4KTQA 1TUUA 4WFNL 3RRHA 2YNIA 4CD3A 1YVNA 1NGFA 5CR4A 1WB9A 3WEEA 2E1YA 3Q7BA 3MEDA 4FZZA 3V9WA 3UE5A 1Q86O 4LD0A 4CEBA 2KFZA 4AF1A 4CW7B 1RT6A 3UKUB 2Q97A 1IKWA 4KTWA 2NUBA 3W0LA 3J7YP 3Q7CA 4F8RA 4DV4K 1KFDA 1WN7A 1ASUA 4JYAK 2JWKA 1BISA 3OS0A 3CMEN 3VEYA 5EVZA 1O13A 2RE2A 1X1PA 4J2EA 3C7NB 3HPHA 4EHUA 2AJQA 3SAFA 4BE0A 3KLHA 4JI6K 3SPYA 4CHZA 3BP8A 5M1QA 4BRHA 4PUOA 3L3UA 1WSEA 3ZLJA 2IVOA 4DSIA 3CJ1A 4N5SA 3I8BA 1YTUA 4GY2B 3DLLL 2D0AA 4JAXA 1NK7A 3SCXA 1J9AA 1L3VA 4I9LA 1EO1A 2B5JA 4AQYK 3P39A 4IO8A 3VA3A 5FRNA 3QEIA 4M3ZA 2IC3A 1JXEA 3SBGA 2NNWA 3WUHA 2W40A 4FVMA 1KVAA 1KAYA 2Z1JA 5AQIA 4AHCA 3OYCA 3SQ2A 4KPYA 4O44A 1J53A 3DYAA 4CZIA 4ID1A 3QEXA 3NCIA 5AZJA 1OH8A 1BG3A 4JKAA 4DWIA 3SQ4A 1VSDA 4EP4A 3AVKA 1ITGA 4DR7K 5JICA 4PKHA 2QEXN 5EXWA 3CCUN 4JD2B 2H3GX 4B1YB 3JYTA 5TKWA 5AQLA 1ZBUA 3KLEA 1D9DA 4FJHA 2OYQA 4CJWA 1EXQA 3SMSA 2Q31A 2V7ZA 5GIOA 3NF7A 1XC9A 1ZBLA 4CJ4A 3PUFA 3SYZA 2P9LB 1BA0A 3AVCA 1FK9A 1EETA 3QFPA 4HTUA 3IFRA 2BE2A 4ILHA 4NLBA 5BPNA 4CIFA 3H3OB 3TR8A 3VQQA 3O3HA 1WSIA 2QTDA 2P1JA 1KVBA 4LH4A 5JVGL 3K9KA 4LF8K 2CGJA 4CZLA 4DF4A 3EZ5A 1U2VA 3RTVA 2W6KA 3WNFA 4N76A 1QQCA 4BRMA 3V9SA 3ULDA 4IFEA 5C2FA 1K73O 3PLAA 3K5MA 1LV5A 1N32K 1TKDA 2P9SA 1KAXA 2YKNA 3B6PA 4HTLA 4CBXA 5BRFA 3OYGA 2FXUA 1T05A 2O4IA 3PY8A 2EHGA 4FWNA 3IKMA 2D5RA 3FZHA 2HVIA 3ZYYX 2VWJA 5J2NA 4CJUA 3AO4A 3LP3A 5AQYA 5AQZA 3CD6N 1G99A 3CJBA 4HUEA 4IOAL 4H0VB 4OLBA 1S72N 3K57A 2BH1A 4B1VA 1VHXA 3CCMN 3CCLN 3OYLA 1U6ZA 3ZSWA 5JS1A 2FSKA 1NOYA 3KIOA 3OYEA 4KI4A 4GMJB 1LAWA 3TANA 3ENOA 2P9IB 4JN4A 1EKEA 1KXPA 4J2BA 4IZ9A 4DTXA 3UKUA 5BN9A 2J4RA 1HNZK 4BRAA 4FLZA 4HUGA 3ZCMA 4FLUA 1WBBA 3VF6A 4F2SA 4DFPA 1VQON 2ZD1A 1U04A 3O80A 1ILYA 5BRDA 2O8BB 2V7YA 2PFUA 2P9LA 3NH1A 3E66A 1GOAA 2HNDA 4AHTA 1BQMA 5CE3A 2R7YA 3MCAB 1NGGA 4CJ5A 4CK3A 3KKSA 3A8YA 4DTJA 3M8PA 2HBMA 3FZLA 4BRQA 3CI5A 1X9JA 4F3OA 4CZFA 1YTAA 4PL8A 3RSEA 3OYNA 3TAFA 4ICLA 3HYFA 3ASMA 4FSVA 4H5RA 1KFSA 4C8KA 3AVAA 4PY5A 2E4LA 4CF2A 2ZJQL 1QHTA 3MMVA 4ILJA 4IBNA 1N36K 2RN2A 5DM6L 2G8IA 4CD1A 4B9VA 1BQNA 4C8MA 4M3WA 2JWLA 3QMLA 1OVQA 4MQ3A 4DLEA 1L3TA 4YOWA 4MFBA 5IT9O 5AQXA 3SI6A 2YX6A 2G8HA 2Q2RA 3J7ZO 4OX9K 3MEGA 4JD2A 3O1WA 1LWFA 1BU6O 5M1OA 3QINA 3E1YA 1Z25A 1RDAA 5EX5A 3JAMO 3NH0A 3MWTA 3AVGA 3D7EO 1NGIA 5BR8K 4FPBA 3FZMA 4FLXA 1QHAA 3AV9A 3H6EA 3EKSA 2OPPA 4DG1A 2YV0X 4BC2A 3C7NA 1BUPA 3DXKA 1UAXA 1T8EA 4CFDA 1G15A 1T3VA 4BC5A 4DV2K 3KVGA 4A5AA 4IEIA 4BRFA 1TL3A 4BR2A 2E2QA 1KLNA 4N56A 3KLFA 1LOTB 1E3MA 4MO4A 4JKBA 1K8KA 2P9UB 5FPNA 1OH7A 3CYMA 3V1QA 1HNXK 4CGHA 2KQ2A 1HLUA 4FWKA 1V4SA 3CPWM 5LL6Z 4DQSA 3IMXA 3DXKB 4PWDA 4AHVA 3TWHA 1MDUB 3NF6A 3AO1A 1B9FA 4O8UA 2YCHA 1U47A 2W6LA 4BGAA 1RGIA 3DMJA 5BPMA 4H0OA 1TK8A 2WONA 4FJ5A 2UUCK 1NKCA 3S9HA 5I9EB 1DEJA 4BE2A 1IV0A 5AQGA 4RW6A 3P4IA 4CJLA 3H3NO 4GV3A 2YJEA 3ZT4A 3EYZA 4JHDA 4NCAA 2GWJA 3KD1E 1EWRA 1W2BM 3KWIA 4O4GA 1Q18A 4EAHD 3VOVA 2E88A 1S22A 5AQUA 3THXA 4C8LA 3CJ9A 2WTUA 3CFPA 4PQUA 3HP6A 1GLDG 5KRTA 3CJ7A 5H1SQ 1TYQB 2YHWA 4AHUA 3MXJA 2D0CA 3A5LC 3IUCA 4Z94A 3P38A 2P9NA 3CETA 3KTQA 2QK9A 4BRNA 4BREA 1A5VA 3HO1A 2DFHA 4IG0A 4O5FA 1VSIA 4RG8A 1SQKA 1S6QA 3D2FB 5AQOA 4FWSA 3KJVA 4KTZA 2FBTA 1L3UA 3V6DA 3K9JA 2VYPA 2Q0UA 4CJSA 1TAQA 1W7AA 1RDDA 4E89A 3AVLA 3QEWA 4E7KA 4CJVA 3OY9A 4DLGA 2A41A 4FJJA 1E4GT 1S9GA 4FW1A 4CGDA 3CF5L 3CM5A 4IG3A 3P1GA 1I94K 4CZKA 4LF5K 1IJJA 4DV0K 1KSPA 3LDPA 2HHSA 4CE9A 2HHXA 3O4QA 1KAZA 3ALYA 1LCUA 3QEVA 1IO2A 3QB0A 1RBRA 2A5XA 3TI0A 1I3AA 4Z4GA 3CC7N 4IJAA 4YOUA 3HT3A 4XH4A 2Y1JA 1QVFM 1LWCA 5C25A 4HHTA 3D2EB 4YDUA 2ZF5O 4ID5A 5J2PA 4DU3A 3JXUA 3BUZB 3QETA 5GADP 5DM7L 1P90A 4IOXA 4B8AB 1WNSA 3NBPA 1NJXA 1JCGA 2WFBA 1B92A 4DV1K 1CXQA 3MAQA 3SLCA 4CK2A 5JMVA 2KZMA 4DV7K 4PKIA 4CEZA 1NGHA 4DSLA 4K41A 2QM1A 2OTJN 4F9OA 5GAEP 3NH2A 1M1KO 1HYVA 2QA4N 5F0XA 1GOBA 2OANA 1OH5A 3NF8A 3L2VA 3FE1A 1NK4A 1HKCA 2W41A 5B8HA 2X74A 3O9SA 4AH9A 3EZWA 5AQWA 5AQNA 1OVYA 4FJGA 1K8KB 2P9UA 1RFQA 4CF8A 2E2OA 3GBTA 5FPDA 1Z26A 2GUIA 4OPJA 3W3DA 1BOTO 4FJKA 2QWOA 1XNQK 1NK6A 4H5NA 1HRHA 1RT3A 4QS9A 1S6PA 1C1CA 4NXMK 5T7BA 1XQSC 3ZSXA 2UXCK 5JLHA 1UA1A 4K8ZA 2QWLA 3T7ZA 1XWLA 3WXMB 3U3YA 1W9HA 5AQKA 4KBOA 3CCSN 1SKRA 4M42A 4QOZB 1MU2A 1YUWA 2Q1NA 2OTLN 1YITN 1QSLA 1KD1O 2FF6A 3RR7A 2VGMA 4AHRA 3LDSA 4CGJA 4FWOA 1RTHA 4A57A 1Q7YO 5AQTA 4Z0UA 4RW7A 3R8EA 3OYKA 4CBUA 3EY1A 4CGGA 4KRFA 2Q0RA 1HUXA 3GL1A 2NRWA 3JS6A 5JLFA 3VQPA 1NKEA 3CFRA 1JLBA 3AVBA 3M6GA 3K2PA 1T03A 2DFFA 5CZ2A 4KHYA 3R1XA 5J1EA 4JK7A 1TKTA 3HM9A 4I7FA 4DS4A 3ZT3A 1RT1A 3I33A 4B9UA 1J6ZA 3WXKA 3T1AA 3CHWA 4KB1A 5SZTA 3FGUA 3MXIA 4GV6A 3O9TA 2ZQBA 1IKVA 4CK1A 4KO0A 4NB4A 4HCBA 1HKBA 3DM2A 3AY9A 3KZBA 3QBXA 4K0KK 1X3NA 2PAVA 4BWMA 2I7PA 5BPLA 3LDLA 4Q0BA 4JS4A 2RPIA 4BGBA 1RTDA 5LJVA 3SUNA 5AQFA 3VESA 4JRPA 3KHYA 4BRCA 2IS3A 5AQMA 3SUPA 1T6CA 2CGLA 3WNGA 4CIGA 2E20A 4FVUA 1IKYA 3KWGA 1HJOA 4RW9A 4CHYA 2PBDA 2PYJA 3C0BA 1HPZA 3ZT1A 3GE1A 4KHUA 4WCEL 3AA5X 4JV5K 2YHXA 1GLCG 4CZJA 4BDYA 4Z4IA 4BRPA 4DQQA 4ISEA 3HOTA 4DSKA 2P9NB 4B3RK 2QWRA 1TK0A 4I6MB 2EX3A 4GVMA 4ELVA 4WQ4A 4BR9A 3WT0A 3VPZA 1DLOA 1M90O 2ETJA 1BDGA 3ENHA 3PO4A 1HYZA 5LJWA 1TKZA 1W97L 1ZBHA 1Q8IA 3PX6A 1SKSA 1A5XA 1RBUA 3V4IA 4QAGA 2CH6A 2QWQA 4I2PA 1U2VB 3H08A 1VSMA 1S3XA 3VQ5A 4BRKA 1ATNA 2A6AA 4CERA 3VF4A 1ESVA 1SAZA 1RBVA 3FZKA 4FPAA 2HBLA 4BWJA 3OVNA 3A2FA 3CMAN 5HL7L 4XH1A 4FOEA 4CHNA 3LWLA 2HB5A 2KFNA 3ATVA 1FJGK 3O5BA 1JCFA 3M8RA 4B3OA 3ZX0A 4M45A 5ELZA 5CYMA 2V51B 5KQ8A 4O0IA 2Z1GA 3OBYA 3WXIA 3BY5A 1QE1A 3OTOK 2YNGA 4CEQA 1ZYQA 5BRHA 4C1NK 3CCQN 3HP9A 3J7AP 4C1NI 3P31A 4JEPA 4CGFA 2P9IA 2D4WA 3O08A 1HQUA 1RDCA 1NJZA 5GAGP 3A5OC 2D0OA 4B3TK 4O55A 1JKHA 2YHYA 1NKBA 5I3UA 4IWVA 2B6AA 3THYB 1C0MA 4B9SA 3ITHA 2LSNA 3DXMA 1HNIA 3HTVA 3VERA 3CJAA 1XUPO 3S3NA 3RMBA 4CEDA 3PO5A 4HVJA 3O6WA 4WQ4C 3T3FA 1WAJA 4B8CA 3RMDA 2QKBA 4N47A 5KGXA 5HBMA 4OGEA 2D0BA 4IJNA 1EP4A 1J54A 2B4JA 3WEEB 3U8XA 1S1TA 5D3GA 3M1FA 4BDZA 4FYDA 2G8UA 4K42A 3L4QA 4F4KA 4YOVA 4CJPA 2P5GA 4UY8O 2IVNA 1VSHA 5F1XA 2WC9A 1XHZA 5M1PA 3ZEUA 4BE1A 3EEQA 2HF3A 3O9QA 3THVA 4DCHA 4MDBA 5AQQA 1E4FT 1NJIO 4YDUC 3QERA 3VGKA 3NF9A 3CJCA 4NO7A 2YJFA 3KLIA 5GINA 1KTQA 1RTJA 3AAPA 3MN5A 4CZHA 4DV3K 1N5YA 4XH5A 2ZM6K 3NAEA 3WNEA 1SZ2A 3KK1A 4H0YB 3EE9A 3SUOA 3L6QA 4DR3K
chains in the Genus database with same CATH topology
5C10A 2GTDA 1YAGA 5AQRA 3VGLA 3P4IA 3OHRA 5KPTA 1V4TA 5AQVA 3O1BA 3H3NO 4GV3A 3J8AA 2YJEA 4FWMA 4K43A 4BR7A 4JHDA 4YORA 5AR0A 1ZXOA 2GWJA 4ILGB 4EFHA 1VQKN 2ZGZA 3F9MA 4U7BA 1WOQA 3E9PA 2GX9A 5EY4A 2E1ZA 1TYQA 3R9PA 1H1VA 1W2BM 2A40A 3KWIA 3MX2A 3N4PA 3U9DA 3OA9A 1Q18A 4EAHD 3VOVA 4BR0A 3ZX2A 3ZETA 2E88A 1S22A 5AQUA 3CJ9A 2V52B 1P8ZA 2GUPA 5M1FA 4BG9A 4JNEA 1GLDG 4HWIA 1NM1A 3RVCA 3VEZA 4A5BA 3CJ7A 2HSTA 5H1SQ 1TYQB 2YHWA 4BRDA 1IG8A 4OO1J 4OPHA 1HKGA 3HI0A 3VMFB 5KQDA 1VQ5N 2ASMA 3A5LC 3IUCA 4Z94A 1QZ6A 2FSNA 3P38A 3RSEB 2P9NA 3CETA 4BRNA 4BREA 3CXCM 4B1ZA 3G4SN 3CQYA 4AM7A 4O5FA 4L3QA 1DGKN 3MDQA 1SQKA 1MWKA 4BROA 3D2FB 4FOIA 2VWBA 5AQOA 3F2KA 3SK3A 3WXJA 1QQOA 3CERA 4FWSA 3PIOL 1YF5L 4MLEA 1SS6A 1NGCA 5EOYA 3VGMA 3K9JA 4PHTX 1VQNN 2VYPA 3CQXA 2Q0UA 3HBTA 4RWTA 4JHDB 2P9KB 3AGKA 1YJ9N 3TSUA 3CIPA 2QI2A 1DKGD 3WXLA 5C0YA 2A41A 1VQMN 1E4GT 4WFBL 3CF5L 2NZTA 1GLLO 3L4IA 3FFKB 2GWKA 1QVGM 4CZKA 2GELA 3S41A 1IJJA 1YJNN 3DXMB 3LDPA 3TPQA 3VEOA 1YIJN 3WQTA 3QICA 4IOCL 1KAZA 1LCUA 2F9WA 3O9RA 1BA1A 4H5TA 1HX1A 3QB0A 2A5XA 2Q36A 3AGRA 4JKEA 3TU5A 4H0PA 3M5RA 4CBWA 2ZJPL 1VQ8N 4A2BA 3CC7N 1C0GA 4IJAA 4YOUA 2P9SB 3QBWA 3EO3A 4XH4A 2NRHA 2CGKA 2QWNA 3D6RA 1QVFM 2D0PA 3D2EB 2HBKA 2ZF5O 4YDUA 2WUSA 3EN9A 3JXUA 4FO0A 3BUZB 3E9LA 3SMPA 3BEXA 4PL7A 3ULEB 1YJWN 1K8AO 2IVPA 3O8MA 5GADP 4DKWA 5DM7L 1P90A 4H0TB 5C2DA 2A42A 4IOXA 5GIPA 1VQPN 1JCGA 2WFBA 4EHTA 2HBJA 4FWPA 4QS8A 3SLCA 2WBNA 5JMVA 3QDKA 3TTFA 4JKCA 3A5NC 4PKIA 1NGHA 4JK9A 4WQ5A 1JCEA 3MX5A 4M63C 4K41A 2QM1A 2OTJN 4F9OA 1QQMA 4YOYA 4IO9L 4GNIA 2QWMA 1TUUA 4DB3A 5GAEP 4WFNL 5KPZA 1M1KO 2QA4N 4MDAA 3VEVA 1YVNA 4AM6A 1NGFA 5CR4A 4CD3A 5F0XA 2OANA 1NGEA 5JVHL 3WEEA 2E1YA 3FE1A 3Q7BA 1HKCA 2VCPA 1MWMA 2W41A 3UE5A 4WF9L 5B8HA 1Q86O 3O9SA 1VAZA 4KH4A 1N8RO 3EZWA 5AQWA 5AQNA 1OVYA 1K8KB 2P9UA 2QXLA 4KH5A 3NVMA 4AF1A 1RFQA 2E2OA 4CZMA 2DPNA 3GBTA 3UKUB 2Q97A 3W0LA 4M7XA 5FPDA 4BVPA 3Q7CA 5LY3A 3W3DA 1BOTO 2QWOA 2JWKA 4H5NA 1Z6RA 4QS9A 4MLHA 5TKYA 1XQSC 3VTHA 1KQSM 3CMEN 3CCRN 1RDWX 3VEYA 5JLHA 4JKHA 5EVZA 4BR5A 4CZGA 5BN8A 1O13A 2NLXA 2RE2A 1VQ6N 2QWLA 3VF2A 3C7NB 4EHUA 3A0IX 3H46O 3T7ZA 3CCJN 3SAFA 3WXMB 3HSCA 5AQKA 4JKFA 4JKDA 3BP8A 2E2PA 4KBOA 2FLOA 5M1QA 4CJ7A 4BRHA 3CCSN 2IVOA 1GLJO 3CJ1A 5AQSA 1YUWA 4BRGA 2Q1NA 3ULEA 1YITN 2OTLN 3OW2M 1KD1O 3I8BA 2FF6A 3EKUA 1JJ2M 2VGMA 5M1KA 4GY2B 3LM2A 3DLLL 1BWFO 4JAXA 4FWOA 2GEMA 4A57A 1Q7YO 5AQTA 1EO1A 4J8FA 3TSQA 3P39A 4IO8A 3R8EA 2F7TA 3SAGA 5AQPA 4CBUA 1X3MA 3EL2A 1NGJA 3SBGA 1MA9B 3F5TA 2NNWA 3WUHA 2Q0RA 1HUXA 2W40A 2NRWA 3GL1A 3JS6A 3C6AA 1KAYA 3MCPA 5AQIA 5JLFA 4JKGB 1VQLN 4CZIA 4FWLA 3HZ6A 3M6GA 3O4WA 3MN9A 3CC2N 5AZJA 4OPAA 4DQ8A 1BG3A 3R1XA 3B8AX 4JKAA 4B1XB 3SBTA 4JK7A 5JICA 4PKHA 1ZBSA 4I6MA 2ITMA 2QEXN 5EXWA 3CCUN 4JD2B 2H3GX 4B1YB 3CPEA 3QFUA 5TKWA 3I33A 5AQLA 4U67L 3I56N 1J6ZA 4PKGA 3WXKA 2HMPA 4FWQA 3CHWA 5HOOA 1XC3A 2E2NA 2P9KA 3E9OA 3FGUA 3N4QA 4M7YA 4GV6A 3VETA 3O9TA 3SMSA 2Q31A 2V7ZA 4RCHA 5AZIB 5GIOA 3BF3A 3KK7A 4NB4A 5M1NA 3T69A 3D2FA 4BRLA 1HKBA 3KZBA 2P9LB 1BA0A 2P9PA 3AY9A 3QBXA 4GV9A 2ASOA 3MN7A 4K25A 1X3NA 2PAVA 3QFPA 3A5MC 1NWKA 2I7PA 3H45C 3VTIA 5BPLA 3IFRA 1NMDA 3LDLA 4A2AA 4ILHA 3U4LA 4NLBA 4BGBA 3ZEUB 1QQNA 5AFUH 5BPNA 3H3OB 1GLEG 5LJVA 4JK8A 5GAHP 2EWSA 2NRXA 5AQFA 3VESA 1BO5O 2QTDA 5E84A 3KHYA 4BRCA 5JVGL 3K9KA 1YXQA 3H1VX 3VEXA 2CGJA 5AQMA 4CZLA 3UKRB 1U2VA 1T6CA 1OKJA 2CGLA 4CZEA 1K9MO 4BRMA 2E20A 4FVUA 3KWGA 4IFEA 5C2FA 1HJOA 2P9PB 3U9ZA 3G71N 1K73O 3PLAA 2PBDA 5FPMA 3C0BA 5AQJA 1C0FA 2RHKA 3ID6A 4E1JA 2P9SA 3VEWA 3GE1A 1KAXA 3MWPA 4HTLA 4CBXA 3OBWA 5BRFA 4WCEL 1QZ5A 4NLCA 2YHXA 3FR0A 1HPMA 2FXUA 3UKRA 4EIAA 1GLCG 4CZJA 4FWNA 3BF1A 3IKMA 2I7NA 3SJHA 3FZHA 3M3ZA 4BRPA 4CI6A 3ZYYX 4ISEA 3HOTA 2KLAA 2P9NB 2NRVA 2NRZA 2QWRA 3EE8A 4I6MB 3NMUA 2IIRA 5AQYA 5AQZA 3MN6A 1G99A 3CD6N 2VGNA 4WQ4A 4WYBA 3CJBA 4IOAL 4BR9A 2AP1A 2FSJA 1Z05A 4H0VB 4A59A 1S72N 2BH1A 4B1VA 3WT0A 3CCMN 3VPZA 4JKGA 3CCLN 1M90O 1U6ZA 4IEEA 1BDGA 3ENHA 5LJWA 2FSKA 4LC9B 3ID8A 1W97L 5E26A 1NGBA 3LDNA 4BQLA 3G6EN 1NBWA 1ATSA 3ZETB 4KH6A 3ENOA 2P9IB 2CH6A 1YHQN 2QWQA 4JN4A 1U2VB 2HOEA 1KC8O 4BC3A 1S3XA 1KXPA 5FPEA 4IZ9A 2F9TA 1GLAG 4BRKA 1ATNA 2A6AA 4GVEA 5ADXA 3UKUA 5BN9A 3I55N 5MLCQ 2J4RA 1ESVA 3DWLA 1SAZA 4H5WA 3VF4A 4BRAA 4C23A 1VQ4N 3FZKA 3VF6A 2FF3B 4FPAA 1VQON 2HBLA 1T6DA 3O80A 1NLVA 3HRGA 1RDUA 1ILYA 2BTFA 2E8AA 5BRDA 5HL7L 4BQZA 4XH1A 4FOEA 2V7YA 3TTCA 5BREA 3CMAN 2NRRA 2PFUA 3ATVA 3ATUA 2P9LA 1ATRA 4B9QA 3E66A 4BR4A 2ZWHA 3GOIA 3O5BA 1Y64A 1JCFA 4IXCA 1D4XA 3C65A 4B1WB 3ZX0A 5CE3A 3CCVN 3LDOA 3MCAB 1NGGA 3SAHA 3MK6A 5AQHA 5ELZA 2V51B 3A8YA 2NRTA 5KQ8A 2HBMA 2QW9A 3FZLA 4Y0WA 4BRQA 3OBYA 3CI5A 1X9JA 3C6HA 3WXIA 4CZFA 4ISFA 1ZC6A 4PL8A 3RSEA 2QWPA 5BRHA 3L0QA 4C1NK 4R79A 3CCQN 4FSVA 2YI1A 4H5RA 2KKZA 3G25A 4C1NI 2ZJQL 3MMVA 3P31A 4JEPA 2A3ZA 3FLCO 5AZJB 4BVOA 5ADXH 2P9IA 3CCEN 4ILJA 2D4WA 3O08A 4WQ5C 3GDQA 3LDQA 5DM6L 5GAGP 3A5OC 4CD1A 2D1KA 2D0OA 3NVKA 2YHYA 4BRIA 2JWLA 3QMLA 4FL9A 4IWVA 4BY9C 4YOWA 4BC4A 4B1UB 3DXMA 3ZX3A 3R3LA 5AQXA 3UB5A 2BUPA 2YX6A 1YI2N 2Q2RA 3LL3A 3H1QA 3HTVA 2CH5A 3CJAA 3VERA 3TSPA 3J7ZO 1R59O 1XUPO 4WFAL 3HOSA 4JD2A 3O1WA 1BU6O 1DT9A 5M1OA 3E1YA 4YOTA 5EX5A 5AFUA 3O9UA 3ENBA 3O6WA 3CC4N 3MWTA 4WQ4C 3VENA 3LM9A 2HF4A 1CZAN 3D7EO 1NGIA 4FPBA 3FZMA 4QS7A 1QHAA 4H03B 3DAWA 3D2EA 3H6EA 3R6MA 5C12A 4H0XB 3EKSA 2ASPA 1GLBG 2KHOA 4IJNA 4XEIA 3HM8A 3WEEB 3U8XA 4A62A 4BC2A 2ZGYA 1BUPA 3AAQA 3C7NA 3GG4A 1T44A 3M1FA 3TTDA 3DXKA 1T3VA 3IDHA 4BC5A 1Q81O 3KVGA 4A5AA 4RTFD 4IEIA 4K42A 4BRFA 3PIPL 3L4QA 4DHYA 4BR2A 2E2QA 4YOVA 1WUAA 5F2RA 1NGAA 4A61A 4FWRA 1NGDA 2AA4A 1GLFO 1VQ7N 1TUYA 2UYTA 4UY8O 1LOTB 4O8KA 2IVNA 4MO4A 5F1XA 4JKBA 3DJCA 1K8KA 2P9UB 2WC9A 5FPNA 5M1PA 3ZEUA 2HF3A 3O9QA 4ISGA 4DCHA 1VQ9N 4MDBA 1E4FT 1EQYA 3FZFA 4YDUC 5AQQA 1HLUA 4FWKA 1V4SA 2ZJRL 1NJIO 5BR9A 3CPWM 3IMXA 3DXKB 3VGKA 3WQUA 5KPRA 1Q82O 3CJCA 1MDUB 3AARA 2YJFA 2YCHA 4NO7A 4O8UA 5GINA 5AZIA 4BGAA 1RGIA 3AAPA 3MN5A 4CZHA 4H5VA 5BPMA 4H0OA 4MO5A 4XH5A 5CHIA 1SZ2A 4BG8A 4IDHA 4H0YB 5I9EB 1DEJA 4G9ZA 5C15A 3EE9A 5AQGA 4YOXA 3L6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTD A;  1YAG A;  5AQR A;  3VGL A;  3P4I A;  3OHR A;  5KPT A;  1V4T A;  5AQV A;  3O1B A;  3H3N O;  3J8A A;  2YJE A;  4FWM A;  4K43 A;  4BR7 A;  4JHD A;  4EFH A;  5AR0 A;  1ZXO A;  2GWJ A;  2ZGZ A;  3F9M A;  1WOQ A;  5EY4 A;  2E1Z A;  1TYQ A;  3R9P A;  1H1V A;  2A40 A;  3U9D A;  1Q18 A;  4EAH D;  3VOV A;  4BR0 A;  3ZX2 A;  3ZET A;  2E88 A;  1S22 A;  5AQU A;  3CJ9 A;  2V52 B;  1P8Z A;  2GUP A;  4BG9 A;  4JNE A;  1GLD G;  4HWI A;  1NM1 A;  3VEZ A;  3CJ7 A;  1TYQ B;  2YHW A;  4BRD A;  1IG8 A;  1HKG A;  3HI0 A;  5KQD A;  2ASM A;  3A5L C;  3IUC A;  4Z94 A;  1QZ6 A;  2FSN A;  3RSE B;  2P9N A;  3CET A;  4BRN A;  4BRE A;  4B1Z A;  3CQY A;  4AM7 A;  4O5F A;  4L3Q A;  1DGK N;  3MDQ A;  1SQK A;  1MWK A;  4BRO A;  3D2F B;  4FOI A;  2VWB A;  5AQO A;  3WXJ A;  3SK3 A;  1QQO A;  3CER A;  4FWS A;  4MLE A;  1NGC A;  5EOY A;  3VGM A;  3HBT A;  2VYP A;  3CQX A;  2Q0U A;  4RWT A;  4JHD B;  2P9K B;  3CIP A;  3WXL A;  1DKG D;  2A41 A;  1E4G T;  2NZT A;  1GLL O;  3L4I A;  3FFK B;  2GWK A;  4CZK A;  2GEL A;  3S41 A;  1IJJ A;  3DXM B;  3LDP A;  3TPQ A;  3VEO A;  3WQT A;  3QIC A;  1KAZ A;  1LCU A;  2F9W A;  1BA1 A;  4H5T A;  1HX1 A;  3QB0 A;  2A5X A;  2Q36 A;  3TU5 A;  4H0P A;  4CBW A;  4A2B A;  1C0G A;  4IJA A;  2P9S B;  3QBW A;  3EO3 A;  4XH4 A;  2NRH A;  2CGK A;  2QWN A;  2D0P A;  3D2E B;  4YDU A;  2ZF5 O;  2WUS A;  3EN9 A;  3JXU A;  4FO0 A;  3BUZ B;  3SMP A;  4PL7 A;  3BEX A;  3ULE B;  2IVP A;  3O8M A;  4H0T B;  2A42 A;  1JCG A;  4EHT A;  4FWP A;  4QS8 A;  3SLC A;  5JMV A;  3QDK A;  3A5N C;  4PKI A;  1NGH A;  4WQ5 A;  1JCE A;  4M63 C;  4K41 A;  2QM1 A;  4F9O A;  1QQM A;  4GNI A;  2QWM A;  1TUU A;  4DB3 A;  5KPZ A;  3VEV A;  4AM6 A;  1YVN A;  4CD3 A;  1NGF A;  5F0X A;  2OAN A;  1NGE A;  3WEE A;  2E1Y A;  3FE1 A;  1HKC A;  2VCP A;  1MWM A;  2W41 A;  3UE5 A;  5B8H A;  3EZW A;  5AQW A;  5AQN A;  1K8K B;  2P9U A;  2QXL A;  1RFQ A;  2E2O A;  4CZM A;  2DPN A;  3GBT A;  3UKU B;  2Q97 A;  3W0L A;  4M7X A;  5FPD A;  4BVP A;  5LY3 A;  3W3D A;  1BOT O;  2QWO A;  4H5N A;  1Z6R A;  4QS9 A;  4MLH A;  5TKY A;  1XQS C;  1RDW X;  3VEY A;  5JLH A;  5EVZ A;  4CZG A;  4BR5 A;  5BN8 A;  2NLX A;  2QWL A;  3VF2 A;  3C7N B;  4EHU A;  3A0I X;  3H46 O;  3HSC A;  5AQK A;  3BP8 A;  2E2P A;  4KBO A;  2FLO A;  4CJ7 A;  4BRH A;  2IVO A;  1GLJ O;  3CJ1 A;  5AQS A;  1YUW A;  4BRG A;  2Q1N A;  3ULE A;  3I8B A;  2FF6 A;  3EKU A;  4GY2 B;  3LM2 A;  1BWF O;  4JAX A;  4FWO A;  2GEM A;  5AQT A;  4J8F A;  4IO8 A;  3R8E A;  5AQP A;  4CBU A;  1X3M A;  3EL2 A;  1NGJ A;  1MA9 B;  3WUH A;  2Q0R A;  1HUX A;  2W40 A;  3GL1 A;  3JS6 A;  3MCP A;  5AQI A;  1KAY A;  5JLF A;  4CZI A;  4FWL A;  3HZ6 A;  3M6G A;  3O4W A;  3MN9 A;  5AZJ A;  4DQ8 A;  1BG3 A;  3B8A X;  4B1X B;  5JIC A;  4PKH A;  1ZBS A;  4I6M A;  2ITM A;  5EXW A;  4JD2 B;  2H3G X;  4B1Y B;  3QFU A;  3I33 A;  5AQL A;  1J6Z A;  4PKG A;  3WXK A;  2HMP A;  4FWQ A;  3CHW A;  1XC3 A;  2E2N A;  2P9K A;  3FGU A;  4M7Y A;  3VET A;  3SMS A;  2Q31 A;  2V7Z A;  4RCH A;  5AZI B;  3BF3 A;  4NB4 A;  3D2F A;  4BRL A;  1HKB A;  3KZB A;  2P9L B;  1BA0 A;  2P9P A;  3AY9 A;  3QBX A;  2ASO A;  3MN7 A;  4K25 A;  1X3N A;  2PAV A;  3QFP A;  3A5M C;  1NWK A;  2I7P A;  3H45 C;  5BPL A;  3IFR A;  1NMD A;  3LDL A;  4A2A A;  3U4L A;  4BGB A;  3ZEU B;  1QQN A;  5AFU H;  5BPN A;  3H3O B;  1GLE G;  5LJV A;  2EWS A;  5AQF A;  3VES A;  1BO5 O;  5E84 A;  3KHY A;  4BRC A;  3VEX A;  1YXQ A;  3H1V X;  2CGJ A;  5AQM A;  4CZL A;  3UKR B;  1U2V A;  1T6C A;  1OKJ A;  2CGL A;  4CZE A;  4BRM A;  2E20 A;  1HJO A;  2P9P B;  3U9Z A;  2PBD A;  5FPM A;  3C0B A;  5AQJ A;  1C0F A;  4E1J A;  2P9S A;  3VEW A;  3GE1 A;  1KAX A;  4HTL A;  4CBX A;  5BRF A;  1QZ5 A;  2YHX A;  3FR0 A;  1HPM A;  2FXU A;  3UKR A;  4EIA A;  1GLC G;  4CZJ A;  4FWN A;  3BF1 A;  2I7N A;  3SJH A;  3FZH A;  3M3Z A;  4BRP A;  4CI6 A;  4ISE A;  2P9N B;  2QWR A;  4I6M B;  2IIR A;  5AQY A;  5AQZ A;  3MN6 A;  1G99 A;  4WQ4 A;  4WYB A;  3CJB A;  4BR9 A;  2AP1 A;  2FSJ A;  1Z05 A;  4H0V B;  4B1V A;  3WT0 A;  3VPZ A;  1U6Z A;  1BDG A;  3ENH A;  5LJW A;  2FSK A;  4LC9 B;  3ID8 A;  5E26 A;  1NGB A;  3LDN A;  4BQL A;  1NBW A;  1ATS A;  3ZET B;  3ENO A;  2P9I B;  2CH6 A;  2QWQ A;  4JN4 A;  1U2V B;  2HOE A;  4BC3 A;  1S3X A;  1KXP A;  5FPE A;  4IZ9 A;  2F9T A;  1GLA G;  4BRK A;  1ATN A;  2A6A A;  5ADX A;  3UKU A;  5BN9 A;  2J4R A;  1ESV A;  3DWL A;  1SAZ A;  4H5W A;  3VF4 A;  4BRA A;  4C23 A;  3FZK A;  3VF6 A;  2FF3 B;  4FPA A;  1T6D A;  3O80 A;  1NLV A;  2BTF A;  2E8A A;  5BRD A;  4BQZ A;  4XH1 A;  4FOE A;  2V7Y A;  5BRE A;  3ATV A;  3ATU A;  2P9L A;  1ATR A;  4B9Q A;  4BR4 A;  2ZWH A;  3GOI A;  3O5B A;  1Y64 A;  1JCF A;  4IXC A;  1D4X A;  4B1W B;  3ZX0 A;  5CE3 A;  3LDO A;  1NGG A;  3MK6 A;  5AQH A;  5ELZ A;  2V51 B;  3A8Y A;  5KQ8 A;  2QW9 A;  3FZL A;  4Y0W A;  4BRQ A;  3WXI A;  3CI5 A;  1X9J A;  4CZF A;  4ISF A;  1ZC6 A;  4PL8 A;  3RSE A;  2QWP A;  5BRH A;  3L0Q A;  4FSV A;  2YI1 A;  4H5R A;  3G25 A;  3MMV A;  5ADX H;  2A3Z A;  3FLC O;  5AZJ B;  4BVO A;  2P9I A;  2D4W A;  3O08 A;  4WQ5 C;  3GDQ A;  3LDQ A;  3A5O C;  4CD1 A;  2D1K A;  2D0O A;  2YHY A;  4BRI A;  3QML A;  4FL9 A;  4IWV A;  4BC4 A;  4B1U B;  3DXM A;  3ZX3 A;  5AQX A;  3UB5 A;  2BUP A;  2Q2R A;  3LL3 A;  3H1Q A;  3HTV A;  2CH5 A;  3CJA A;  3VER A;  1R59 O;  1XUP O;  4JD2 A;  3O1W A;  1BU6 O;  5EX5 A;  5AFU A;  3O6W A;  4WQ4 C;  3VEN A;  3LM9 A;  2HF4 A;  1CZA N;  3D7E O;  1NGI A;  4FPB A;  3FZM A;  4QS7 A;  1QHA A;  4H03 B;  3DAW A;  3D2E A;  3H6E A;  3R6M A;  4H0X B;  3EKS A;  2ASP A;  1GLB G;  2KHO A;  4IJN A;  4XEI A;  3HM8 A;  3WEE B;  3U8X A;  4A62 A;  4BC2 A;  2ZGY A;  1BUP A;  3AAQ A;  3C7N A;  3GG4 A;  1T44 A;  3M1F A;  3DXK A;  4BC5 A;  3IDH A;  3KVG A;  4RTF D;  4K42 A;  4BRF A;  4DHY A;  4BR2 A;  2E2Q A;  1WUA A;  5F2R A;  1NGA A;  4A61 A;  4FWR A;  1NGD A;  2AA4 A;  1GLF O;  1TUY A;  2UYT A;  1LOT B;  4O8K A;  2IVN A;  4MO4 A;  5F1X A;  3DJC A;  1K8K A;  2P9U B;  5FPN A;  3ZEU A;  2HF3 A;  4ISG A;  4DCH A;  1E4F T;  1EQY A;  3FZF A;  4YDU C;  5AQQ A;  1HLU A;  4FWK A;  1V4S A;  5BR9 A;  3IMX A;  3DXK B;  3VGK A;  3WQU A;  5KPR A;  3CJC A;  1MDU B;  3AAR A;  2YJF A;  2YCH A;  4NO7 A;  5AZI A;  4BGA A;  1RGI A;  3AAP A;  3MN5 A;  4CZH A;  4H5V A;  5BPM A;  4H0O A;  4MO5 A;  4XH5 A;  1SZ2 A;  4BG8 A;  4H0Y B;  5I9E B;  1DEJ A;  5AQG A;  3L6Q A; 
#chains in the Genus database with same CATH topology
 4OKE A;  3HXM A;  1YAG A;  5AQR A;  3OHR A;  5AQV A;  4FWM A;  4YOR A;  1A5W A;  3HVR A;  3LAL A;  3E9P A;  3ZT0 A;  2E1Z A;  1JLA A;  1TYQ A;  4QCL A;  3MX2 A;  1RBS A;  2PY5 A;  4BR0 A;  3ZX2 A;  4L8R B;  3KLG A;  3ZSR A;  3FFI A;  4DV5 K;  4JNE A;  4KHS A;  4FJM A;  4HWI A;  3I0R A;  3THW A;  4BRD A;  1IG8 A;  4OO1 J;  4OPH A;  4RW4 A;  3VMF B;  4DUY K;  1HJR A;  1VQ5 N;  4F2R A;  3S3O A;  2FSN A;  3E01 A;  4KHP K;  3G4S N;  4FM0 A;  5FLX O;  3OJS A;  1JL2 A;  5FRM A;  3DLH A;  4K8X A;  1TKX A;  4DU1 A;  2F8T A;  2HHT A;  2OZM A;  3PIO L;  3D0P A;  4FW2 A;  3U3G A;  1VSL A;  3MEC A;  1XI1 A;  1X9W A;  1DTQ A;  4PHT X;  1VQN N;  3HBT A;  3TAB A;  4JI5 K;  2YKM A;  3AGK A;  1YJ9 N;  4FK0 A;  3OYI A;  3CIP A;  4J2D A;  2NZT A;  1GLL O;  1S1V A;  3TAP A;  3FFK B;  2GWK A;  4DSJ A;  4OVL A;  2GEL A;  3S41 A;  1YJN N;  3TPQ A;  2VQE K;  3VEO A;  1YIJ N;  3WQT A;  4IOC L;  2XRI A;  2F9W A;  3I0S A;  4CFC A;  1BA1 A;  4H5T A;  1HX1 A;  4CFA A;  2Q36 A;  3TU5 A;  4JKE A;  4JI3 K;  4FLW A;  1VQ8 N;  1C0G A;  3QBW A;  2QWN A;  1BI4 A;  3D6R A;  1CXU A;  1U48 A;  2D0P A;  2G8V A;  5FDL A;  1QTM A;  1XMQ K;  2WUS A;  3EN9 A;  3K59 A;  3BEX A;  3SNN A;  2IVP A;  4DKW A;  5GIP A;  1VQP N;  3L2R A;  4X62 K;  3SQ1 A;  2XY6 A;  1C6V A;  1HNV A;  5HP1 A;  3B6O A;  4DR5 K;  3TTF A;  4E7J A;  4KI6 A;  2ATQ A;  3QO9 A;  3LPT A;  1BI4 B;  1U4B A;  4DTP A;  1QQM A;  4YOY A;  4DQI A;  1NMN A;  5KPZ A;  3L8B A;  4MDA A;  4AM6 A;  3PV8 A;  1NGE A;  5JVH L;  2O8F B;  1MWM A;  3KKR A;  3P83 D;  1N8R O;  2KTQ A;  3BZC A;  5DK5 A;  1BCO A;  4NYF A;  4FJL A;  4M7X A;  1SV5 A;  4BVP A;  5LY3 A;  1TAU A;  3LZJ A;  1BHL A;  2ITG A;  2UUB K;  4M3R A;  1Z6R A;  3F9K A;  4MLH A;  5TKY A;  4OKK A;  3VTH A;  1Q9X A;  3CCR N;  1RDW X;  4CJE A;  4JKH A;  3D45 A;  4CZG A;  2O8F A;  4IFY A;  3IAY A;  2NLX A;  3VF2 A;  1BIZ A;  3CCJ N;  3H46 O;  4UQG A;  3HSC A;  2O8C A;  4JKF A;  4JKD A;  3G0Z A;  2E2P A;  1BL3 A;  4CJ7 A;  3SV4 A;  3ZSO A;  1GLJ O;  5AQS A;  3QNO A;  1KCF A;  1NK9 A;  3ULE A;  3OW2 M;  4KAZ A;  3PX0 A;  4CVN E;  4Q5V A;  5M1K A;  4CCH A;  3AA4 A;  3F73 A;  3T1H K;  3OYB A;  4J8F A;  1VSE A;  1SKW A;  5AQP A;  3EL2 A;  1NGJ A;  4IKF A;  3AVJ A;  4DMN A;  4CHQ A;  3MCP A;  3C6A A;  4DQR A;  4JKG B;  3LZI A;  1VQL N;  1JXB A;  3CG7 A;  3VQE A;  4LFB K;  3QEP A;  4DTO A;  3MN9 A;  3I8D A;  4X64 K;  3B8A X;  1DTT A;  4B1X B;  3SBT A;  2OPQ A;  4CJR A;  1RT2 A;  4I6M A;  2ITM A;  1VK0 A;  4JS5 A;  4OLA A;  3QFU A;  3I56 N;  1WLJ A;  2HHU A;  4JI2 K;  4ELU A;  2KW4 A;  2E2N A;  2P9K A;  3N4Q A;  2HHW A;  3VET A;  1O1W A;  1D9F A;  1FXX A;  1D5A A;  5M1N A;  3T69 A;  4CJF A;  1WBD A;  3DI6 A;  4BRL A;  2P9P A;  4GV9 A;  2ASO A;  3MN7 A;  3WNH A;  3L2U A;  2XY8 A;  4B9L A;  1VSK A;  4A2A A;  3U4L A;  1UOC A;  1QQN A;  5AFU H;  3KK2 A;  2JLE A;  2A1R A;  2NRX A;  1BO5 O;  5E84 A;  4KHW A;  1YXQ A;  4DFJ A;  3SQ0 A;  4CZE A;  3HPO A;  4FLT A;  3G71 N;  2FBY A;  2P9P B;  5FPM A;  2VG6 A;  5HRR A;  4E1J A;  3ID6 A;  3VEW A;  4YFU A;  5J2Q A;  4F3T A;  1EWQ A;  1QZ5 A;  1NK0 A;  3FR0 A;  3UKR A;  4EIA A;  2VG5 A;  3IG1 A;  2X6S A;  2P51 A;  3SJH A;  4CI6 A;  1D8Y A;  1L5U A;  2NRV A;  2NRZ A;  2E6M A;  3EE8 A;  5AJ3 K;  2I5J A;  2IGI A;  1JLC A;  2IIR A;  1QS4 A;  1JLF A;  2VGN A;  4WYB A;  3ZT2 A;  3BZK A;  1SUQ A;  2FSJ A;  1Z05 A;  3OS2 A;  4M3U A;  3NDK A;  4FK2 A;  4JKG A;  4IEE A;  4OKJ A;  2Q3S A;  5E26 A;  1NGB A;  3LDN A;  2O4G A;  2VQF K;  3G6E N;  1FW6 A;  3ZET B;  2UUA K;  3NGY A;  1KC8 O;  4O0J A;  4GVE A;  2O8D B;  4M41 A;  3DWL A;  1VQ4 N;  2FF3 B;  3V9Z A;  1XMO K;  4CJT A;  2DY4 A;  1NLV A;  5LMN K;  2BTF A;  5CY4 A;  3TTC A;  5BRE A;  2NRR A;  3SJJ A;  3ATU A;  1ATR A;  4B9Q A;  4BR4 A;  2ZWH A;  5HLF A;  3VN5 A;  2E5L K;  4IXC A;  1D4X A;  4R5P A;  3C65 A;  4B1W B;  3LDO A;  3SAH A;  2PZS A;  3MK6 A;  5AQH A;  1RIL A;  1HNW K;  3VQ9 A;  4ZHR A;  4EP5 A;  4ISF A;  1ZC6 A;  5FRO A;  2OPS A;  3DLE A;  2QWP A;  2F4V K;  2HMI A;  2BDP A;  2KKZ A;  3G25 A;  4E7L A;  1BIU A;  5ADX H;  5AZJ B;  1U49 A;  4BVO A;  1NOZ A;  4NXN K;  3LWM A;  1LAV A;  1JLQ A;  3LAK A;  3NVK A;  1L3S A;  3J81 O;  4FL9 A;  3SZ2 A;  4BY9 C;  3TAG A;  4FM2 A;  4BC4 A;  4B9T A;  3R3L A;  3UB5 A;  2UXB K;  2BUP A;  3CFO A;  1XNR K;  1YI2 N;  4E7H A;  3LL3 A;  1NNE A;  3H1Q A;  1XHX A;  3HOS A;  4IDK A;  1R59 O;  4CF9 A;  1DT9 A;  4XIU A;  1S1X A;  4DR4 K;  4KRE A;  4YOT A;  4E3S A;  3O9U A;  3LM9 A;  2HF4 A;  1CZA N;  4QS7 A;  4JI4 K;  4LF9 K;  3AO2 A;  2JGU A;  4H03 B;  1C0T A;  3D2E A;  2XY7 A;  3R6M A;  2UU9 K;  4H0X B;  1WSF A;  3KK3 A;  4XEI A;  4JLH A;  4A62 A;  4E1M A;  5LMU K;  2ZGY A;  3AAQ A;  1T44 A;  1Q81 O;  4I2Q A;  3DLB A;  4FZY A;  3K5O A;  3VQ7 A;  1C1A A;  5F2R A;  2O8B A;  2OZS A;  2AA4 A;  1SL2 A;  1GLF O;  1VQ7 N;  1TUY A;  4KV8 A;  3DJC A;  4DFK A;  2HNZ A;  4N41 A;  4ISG A;  4BAC A;  1VQ9 N;  3FZF A;  1EQY A;  2X6N A;  2ZJR L;  3V9X A;  5BR9 A;  4FJN A;  5KGW A;  3AAR A;  4CEO A;  3THW B;  5AZI A;  1F21 A;  4H5V A;  2PYL A;  4H4M A;  1JLE A;  3RR8 A;  4MO5 A;  2Y1I A;  5CHI A;  3TAR A;  2YNH A;  3O4N A;  5IWA K;  4G9Z A;  5C15 A;  1J5E K;  4YOX A;  3OYF A;  4LSL A;  4JI0 K;  4CEA A;  2RKI A;  5HRP A;  1V4T A;  1TGO A;  3O1B A;  4LF7 K;  3AVF A;  4LY7 A;  4EFH A;  5AR0 A;  1ZXO A;  4ILG B;  3LAN A;  3PSI A;  1HR0 K;  2ZGZ A;  2OCE A;  3F9M A;  5EY4 A;  3CQ8 A;  3R9P A;  3TAM A;  4LF6 K;  2A40 A;  5KI6 A;  3U9D A;  3OA9 A;  3IRX A;  4CEE A;  3ZET A;  4W5O A;  4YNQ A;  1RTI A;  2V52 B;  1P8Z A;  5A2Q O;  3RWU A;  3PX4 A;  3HST B;  3O3G A;  3TAQ A;  3LPU A;  3RVC A;  4A5B A;  3V1O A;  4FJ8 A;  4Z4F A;  3BDP A;  1HKG A;  3HI0 A;  2ASM A;  1QZ6 A;  3M8Q A;  1T7P A;  1ZBF A;  4B1Z A;  3CQY A;  3HVT A;  3NHG A;  1KRP A;  1FKP A;  4Y1D A;  1U45 A;  3MDQ A;  4CIE A;  1X9S A;  4I9Q A;  2VWB A;  3F2K A;  3WXJ A;  1QQO A;  1Y97 A;  3CER A;  1YF5 L;  1IKX A;  1NGC A;  1SS6 A;  4OPK A;  3AVM A;  2IDO A;  4KHN A;  1I39 A;  1N33 K;  4JHD B;  1RT5 A;  4B3M K;  4CJK A;  2QI2 A;  1DKG D;  5C0Y A;  1VQM N;  4YY3 K;  4FJX A;  2G8W A;  4E1N A;  3AA3 A;  3QIC A;  3G10 A;  1REV A;  4H0P A;  3M5R A;  4CBW A;  2ZJP L;  4LFC K;  4A2B A;  3RMA A;  4JI8 K;  3ISN C;  3AO5 A;  3OS1 A;  4X66 K;  4O5B A;  3OYD A;  2QKK A;  2HBK A;  2HVH A;  3E9L A;  4PL7 A;  2GV9 A;  1YJW N;  3ULE B;  3O8M A;  2G8K A;  2O8E B;  4W5R A;  2A42 A;  2HHH K;  4FK4 A;  4DU4 A;  4EHT A;  5KRS A;  2Z1I A;  2WBN A;  3QDK A;  3HPG A;  3A5N C;  4WQ5 A;  5EU7 A;  4DV6 K;  3MX5 A;  1WSG A;  4DTU A;  4FLY A;  2VWK A;  4DB3 A;  1GOC A;  4DSF A;  2DFE A;  3VEV A;  4CHO A;  1UA0 A;  4CFB A;  1R0A A;  2VCP A;  4WF9 L;  1BGX T;  4KH4 A;  1VAZ A;  1CZB A;  1NJW A;  1LW2 A;  3ZSV A;  2QXL A;  4KH5 A;  3NVM A;  4OJR A;  4CZM A;  2DPN A;  3DRR A;  3AVH A;  2BAN A;  4NCB A;  3J80 O;  4B3S K;  3VQB A;  3VQ8 A;  1FKO A;  1W0H A;  1KQS M;  3K5L A;  3UIQ A;  2FBX A;  4BR5 A;  4AHS A;  5BN8 A;  3QNN A;  3VQA A;  1VQ6 N;  4Y1C A;  3A0I X;  4CES A;  1UWB A;  2FLO A;  3DLG A;  4BRG A;  4PA1 A;  1JJ2 M;  3EKU A;  1YVU A;  3LM2 A;  4DTS A;  4DSE A;  3NE6 A;  1BWF O;  3JSM A;  2YNF A;  2GEM A;  3TSQ A;  2F7T A;  3SAG A;  1X3M A;  3THY A;  2P5O A;  3OYA A;  1MA9 B;  3F5T A;  2RF2 A;  1C1B A;  1IH7 A;  4IFV A;  4CEF A;  2HHQ A;  4NYN A;  4FWL A;  3HZ6 A;  3O4W A;  3CC2 N;  1B9D A;  3OJU A;  3NGI A;  4FZX C;  4OPA A;  4DQ8 A;  2HHV A;  5DMR A;  2F8S A;  4DUZ K;  1ZBS A;  4LFA K;  2QXF A;  4DFM A;  4LF4 K;  3CPE A;  4U67 L;  4PKG A;  2O8C B;  1VRU A;  2HMP A;  4FWQ A;  4E0D A;  5HOO A;  1XC3 A;  3E9O A;  4M7Y A;  3AVN A;  5AZI B;  4RCH A;  3K5N A;  3IS9 A;  1JL1 A;  2OPR A;  3BF3 A;  3KK7 A;  1EX4 A;  3C6U A;  3D2F A;  5K14 A;  4K25 A;  3A5M C;  1NWK A;  3VTI A;  3H45 C;  4FJ9 A;  1NMD A;  1HQE A;  3ZEU B;  1GLE G;  3LP2 A;  4JK8 A;  5GAH P;  2XY5 A;  2EWS A;  2O8D A;  3ZSY A;  1S9E A;  4CJQ A;  3VEX A;  3H1V X;  3UKR B;  1OKJ A;  4B08 A;  5C42 A;  1K9M O;  4ELT A;  4DS5 A;  3U9Z A;  2BGG A;  4H4O A;  3L2W A;  1VSF A;  1OH6 A;  5AQJ A;  3T19 A;  1C0F A;  2RHK A;  3MWP A;  3OYH A;  3OYJ A;  3OBW A;  1IBM K;  2FBV A;  4NLC A;  4JI7 K;  1HPM A;  3LP0 A;  5JS2 A;  4M3X A;  3BF1 A;  2I7N A;  3M3Z A;  1S5J A;  4Z4H A;  2KLA A;  4TSX A;  4M3T A;  4LH5 A;  5CYQ A;  3NMU A;  2WOM A;  3MN6 A;  3C6T A;  1VSJ A;  2AP1 A;  4A59 A;  2XHB A;  4DQP A;  4CF1 A;  3L2Q A;  3AO3 A;  4LC9 B;  4W5T A;  4V19 S;  3ID8 A;  4BQL A;  1NBW A;  1ATS A;  2XO7 A;  4KH6 A;  3QIP A;  5CZ1 A;  1YHQ N;  4X65 K;  4M3Y A;  2HOE A;  4BC3 A;  5FPE A;  3DLR A;  3PSF A;  2F9T A;  3K58 A;  1GLA G;  5ADX A;  4NCG A;  3HL8 A;  4FJ7 A;  3I55 N;  3CM6 A;  4HUF A;  1ASV A;  5MLC Q;  3KD5 E;  4H5W A;  4C23 A;  4RW8 A;  3MEE A;  4Z4E A;  4J2A A;  1T6D A;  3TAE A;  1X9M A;  3HRG A;  1RDU A;  2E8A A;  4BQZ A;  2HNY A;  2G8F A;  3V1R A;  3ZSQ A;  1IBK K;  3GOI A;  1Y64 A;  1HMV A;  2YHA A;  2X78 A;  3CCV N;  2ZE2 A;  2KZZ A;  5HRN A;  2NRT A;  4B9M A;  2QW9 A;  1RT7 A;  3NGZ A;  4E19 A;  4Y0W A;  3C6H A;  4AIL C;  1K6Y A;  1LWE A;  4EZ9 A;  4CEC A;  3L0Q A;  4R79 A;  2YI1 A;  4WE1 A;  5SWM A;  1WSH A;  2A3Z A;  3FLC O;  3DLK A;  3CCE N;  2F96 A;  4FJI A;  4WQ5 C;  3GDQ A;  3LDQ A;  3V81 A;  2D1K A;  4BRI A;  4CHP A;  1J5O A;  4B1U B;  3ZX3 A;  2HW3 A;  3DRS A;  4FXD A;  5E41 A;  2CH5 A;  3BGR A;  4C8N A;  3TSP A;  5KTQ A;  4WFA L;  1IG9 A;  3V9U A;  3HK2 A;  1Q9Y A;  1QSS A;  4EZ6 A;  5AFU A;  3ENB A;  4ZTF A;  3CC4 N;  3VEN A;  5HRO A;  3M8S A;  4E7I A;  3DAW A;  2IOC A;  5C12 A;  3U6F A;  3QES A;  1KVC A;  2ASP A;  1GLB G;  2KHO A;  2Z1H A;  3HM8 A;  1RT4 A;  1NK5 A;  3GG4 A;  3TTD A;  4KFB A;  4JI1 K;  1TV6 A;  3IDH A;  4LSN A;  4BDP A;  2YHB A;  4RTF D;  3PIP L;  1SL1 A;  4DHY A;  4H8K A;  1WUA A;  4KHQ A;  1NGA A;  3RRG A;  4A61 A;  3OYM A;  4FWR A;  4GKJ K;  1HYS A;  1NGD A;  1N34 K;  2UYT A;  4DR1 K;  2O8E A;  3MXM A;  4O8K A;  2IAJ A;  1ASW A;  2A1S A;  1QSY A;  3P5J A;  1BCM A;  2OA8 A;  3VQD A;  1LW0 A;  3WQU A;  5KPR A;  1Q82 O;  2UXD K;  1NG9 A;  4BG8 A;  4IDH A;  3VQ4 A;  5C10 A;  2GTD A;  3VGL A;  3S3M A;  5KPT A;  4DR2 K;  2FC0 A;  3J8A A;  4K43 A;  4BR7 A;  1VQK N;  4B9N A;  3SUQ A;  3AA2 A;  4U7B A;  1WOQ A;  2GX9 A;  3O3F A;  1VRT A;  4ZTJ A;  1H1V A;  3N4P A;  1KLM A;  5C24 A;  4CGI A;  1C0U A;  2VG7 A;  5M1F A;  2GUP A;  4HCC A;  4BG9 A;  1NM1 A;  2W42 A;  3VEZ A;  2HST A;  1CZ9 A;  4DTR A;  5KQD A;  3RSE B;  4W5N A;  3ZSZ A;  3VQ6 A;  3CXC M;  2E6L A;  1TVR A;  3VQC A;  3HJF A;  4AM7 A;  1RCH A;  3AVI A;  4JRQ A;  1WAF A;  4CJ3 A;  4L3Q A;  1DGK N;  2GBZ A;  3L3V A;  1MWK A;  4BRO A;  4FOI A;  5J2M A;  3LP1 A;  3SK3 A;  5HRS A;  4MLE A;  3T1Y K;  5EOY A;  4CF0 A;  3QIO A;  3VGM A;  4DF8 A;  1SL0 A;  1S1W A;  1YT3 A;  3CQX A;  4RWT A;  4OGC A;  2P9K B;  3K0S A;  1IBL K;  3TSU A;  4FM1 A;  3WXL A;  4DTM A;  5I42 A;  4WFB L;  3C94 A;  3L4I A;  4DTN A;  1QVG M;  4DR6 K;  1CLQ A;  1RNH A;  3DXM B;  1ZBI A;  4YHH K;  4FLV A;  3DOK A;  3O9R A;  3AGR A;  2DTU A;  3THX B;  1N6Q A;  4FCY A;  1TL1 A;  2P9S B;  4C8O A;  3EO3 A;  1S1U A;  2CGK A;  2NRH A;  1NK8 A;  3SPZ A;  4GW6 A;  1RDB A;  4FO0 A;  3SMP A;  3SV3 A;  1K8A O;  3VA0 A;  4G1Q A;  1NU0 A;  4Z4C A;  1RBT A;  4H0T B;  3QLH A;  5C2D A;  3C95 A;  3DRP A;  1WSJ A;  4GKK K;  1JLG A;  1NJY A;  2HBJ A;  1TK5 A;  3NFA A;  3LAM A;  4FWP A;  4QS8 A;  3DOL A;  4JKC A;  4W5Q A;  4JK9 A;  1JCE A;  4M63 C;  4KKO A;  4KB0 A;  4IO9 L;  4GNI A;  2QWM A;  3RMC A;  4KTQ A;  1TUU A;  4WFN L;  3RRH A;  2YNI A;  4CD3 A;  1YVN A;  1NGF A;  5CR4 A;  1WB9 A;  3WEE A;  2E1Y A;  3Q7B A;  3MED A;  4FZZ A;  3V9W A;  3UE5 A;  1Q86 O;  4LD0 A;  4CEB A;  2KFZ A;  4AF1 A;  4CW7 B;  1RT6 A;  3UKU B;  2Q97 A;  1IKW A;  4KTW A;  2NUB A;  3W0L A;  3J7Y P;  3Q7C A;  4F8R A;  4DV4 K;  1KFD A;  1WN7 A;  1ASU A;  4JYA K;  2JWK A;  1BIS A;  3OS0 A;  3CME N;  3VEY A;  5EVZ A;  1O13 A;  2RE2 A;  1X1P A;  4J2E A;  3C7N B;  3HPH A;  4EHU A;  2AJQ A;  3SAF A;  4BE0 A;  3KLH A;  4JI6 K;  3SPY A;  4CHZ A;  3BP8 A;  5M1Q A;  4BRH A;  4PUO A;  3L3U A;  1WSE A;  3ZLJ A;  2IVO A;  4DSI A;  3CJ1 A;  4N5S A;  3I8B A;  1YTU A;  4GY2 B;  3DLL L;  2D0A A;  4JAX A;  1NK7 A;  3SCX A;  1J9A A;  1L3V A;  4I9L A;  1EO1 A;  2B5J A;  4AQY K;  3P39 A;  4IO8 A;  3VA3 A;  5FRN A;  3QEI A;  4M3Z A;  2IC3 A;  1JXE A;  3SBG A;  2NNW A;  3WUH A;  2W40 A;  4FVM A;  1KVA A;  1KAY A;  2Z1J A;  5AQI A;  4AHC A;  3OYC A;  3SQ2 A;  4KPY A;  4O44 A;  1J53 A;  3DYA A;  4CZI A;  4ID1 A;  3QEX A;  3NCI A;  5AZJ A;  1OH8 A;  1BG3 A;  4JKA A;  4DWI A;  3SQ4 A;  1VSD A;  4EP4 A;  3AVK A;  1ITG A;  4DR7 K;  5JIC A;  4PKH A;  2QEX N;  5EXW A;  3CCU N;  4JD2 B;  2H3G X;  4B1Y B;  3JYT A;  5TKW A;  5AQL A;  1ZBU A;  3KLE A;  1D9D A;  4FJH A;  2OYQ A;  4CJW A;  1EXQ A;  3SMS A;  2Q31 A;  2V7Z A;  5GIO A;  3NF7 A;  1XC9 A;  1ZBL A;  4CJ4 A;  3PUF A;  3SYZ A;  2P9L B;  1BA0 A;  3AVC A;  1FK9 A;  1EET A;  3QFP A;  4HTU A;  3IFR A;  2BE2 A;  4ILH A;  4NLB A;  5BPN A;  4CIF A;  3H3O B;  3TR8 A;  3VQQ A;  3O3H A;  1WSI A;  2QTD A;  2P1J A;  1KVB A;  4LH4 A;  5JVG L;  3K9K A;  4LF8 K;  2CGJ A;  4CZL A;  4DF4 A;  3EZ5 A;  1U2V A;  3RTV A;  2W6K A;  3WNF A;  4N76 A;  1QQC A;  4BRM A;  3V9S A;  3ULD A;  4IFE A;  5C2F A;  1K73 O;  3PLA A;  3K5M A;  1LV5 A;  1N32 K;  1TKD A;  2P9S A;  1KAX A;  2YKN A;  3B6P A;  4HTL A;  4CBX A;  5BRF A;  3OYG A;  2FXU A;  1T05 A;  2O4I A;  3PY8 A;  2EHG A;  4FWN A;  3IKM A;  2D5R A;  3FZH A;  2HVI A;  3ZYY X;  2VWJ A;  5J2N A;  4CJU A;  3AO4 A;  3LP3 A;  5AQY A;  5AQZ A;  3CD6 N;  1G99 A;  3CJB A;  4HUE A;  4IOA L;  4H0V B;  4OLB A;  1S72 N;  3K57 A;  2BH1 A;  4B1V A;  1VHX A;  3CCM N;  3CCL N;  3OYL A;  1U6Z A;  3ZSW A;  5JS1 A;  2FSK A;  1NOY A;  3KIO A;  3OYE A;  4KI4 A;  4GMJ B;  1LAW A;  3TAN A;  3ENO A;  2P9I B;  4JN4 A;  1EKE A;  1KXP A;  4J2B A;  4IZ9 A;  4DTX A;  3UKU A;  5BN9 A;  2J4R A;  1HNZ K;  4BRA A;  4FLZ A;  4HUG A;  3ZCM A;  4FLU A;  1WBB A;  3VF6 A;  4F2S A;  4DFP A;  1VQO N;  2ZD1 A;  1U04 A;  3O80 A;  1ILY A;  5BRD A;  2O8B B;  2V7Y A;  2PFU A;  2P9L A;  3NH1 A;  3E66 A;  1GOA A;  2HND A;  4AHT A;  1BQM A;  5CE3 A;  2R7Y A;  3MCA B;  1NGG A;  4CJ5 A;  4CK3 A;  3KKS A;  3A8Y A;  4DTJ A;  3M8P A;  2HBM A;  3FZL A;  4BRQ A;  3CI5 A;  1X9J A;  4F3O A;  4CZF A;  1YTA A;  4PL8 A;  3RSE A;  3OYN A;  3TAF A;  4ICL A;  3HYF A;  3ASM A;  4FSV A;  4H5R A;  1KFS A;  4C8K A;  3AVA A;  4PY5 A;  2E4L A;  4CF2 A;  2ZJQ L;  1QHT A;  3MMV A;  4ILJ A;  4IBN A;  1N36 K;  2RN2 A;  5DM6 L;  2G8I A;  4CD1 A;  4B9V A;  1BQN A;  4C8M A;  4M3W A;  2JWL A;  3QML A;  1OVQ A;  4MQ3 A;  4DLE A;  1L3T A;  4YOW A;  4MFB A;  5IT9 O;  5AQX A;  3SI6 A;  2YX6 A;  2G8H A;  2Q2R A;  3J7Z O;  4OX9 K;  3MEG A;  4JD2 A;  3O1W A;  1LWF A;  1BU6 O;  5M1O A;  3QIN A;  3E1Y A;  1Z25 A;  1RDA A;  5EX5 A;  3JAM O;  3NH0 A;  3MWT A;  3AVG A;  3D7E O;  1NGI A;  5BR8 K;  4FPB A;  3FZM A;  4FLX A;  1QHA A;  3AV9 A;  3H6E A;  3EKS A;  2OPP A;  4DG1 A;  2YV0 X;  4BC2 A;  3C7N A;  1BUP A;  3DXK A;  1UAX A;  1T8E A;  4CFD A;  1G15 A;  1T3V A;  4BC5 A;  4DV2 K;  3KVG A;  4A5A A;  4IEI A;  4BRF A;  1TL3 A;  4BR2 A;  2E2Q A;  1KLN A;  4N56 A;  3KLF A;  1LOT B;  1E3M A;  4MO4 A;  4JKB A;  1K8K A;  2P9U B;  5FPN A;  1OH7 A;  3CYM A;  3V1Q A;  1HNX K;  4CGH A;  2KQ2 A;  1HLU A;  4FWK A;  1V4S A;  3CPW M;  5LL6 Z;  4DQS A;  3IMX A;  3DXK B;  4PWD A;  4AHV A;  3TWH A;  1MDU B;  3NF6 A;  3AO1 A;  1B9F A;  4O8U A;  2YCH A;  1U47 A;  2W6L A;  4BGA A;  1RGI A;  3DMJ A;  5BPM A;  4H0O A;  1TK8 A;  2WON A;  4FJ5 A;  2UUC K;  1NKC A;  3S9H A;  5I9E B;  1DEJ A;  4BE2 A;  1IV0 A;  5AQG A;  4RW6 A;  3P4I A;  4CJL A;  3H3N O;  4GV3 A;  2YJE A;  3ZT4 A;  3EYZ A;  4JHD A;  4NCA A;  2GWJ A;  3KD1 E;  1EWR A;  1W2B M;  3KWI A;  4O4G A;  1Q18 A;  4EAH D;  3VOV A;  2E88 A;  1S22 A;  5AQU A;  3THX A;  4C8L A;  3CJ9 A;  2WTU A;  3CFP A;  4PQU A;  3HP6 A;  1GLD G;  5KRT A;  3CJ7 A;  5H1S Q;  1TYQ B;  2YHW A;  4AHU A;  3MXJ A;  2D0C A;  3A5L C;  3IUC A;  4Z94 A;  3P38 A;  2P9N A;  3CET A;  3KTQ A;  2QK9 A;  4BRN A;  4BRE A;  1A5V A;  3HO1 A;  2DFH A;  4IG0 A;  4O5F A;  1VSI A;  4RG8 A;  1SQK A;  1S6Q A;  3D2F B;  5AQO A;  4FWS A;  3KJV A;  4KTZ A;  2FBT A;  1L3U A;  3V6D A;  3K9J A;  2VYP A;  2Q0U A;  4CJS A;  1TAQ A;  1W7A A;  1RDD A;  4E89 A;  3AVL A;  3QEW A;  4E7K A;  4CJV A;  3OY9 A;  4DLG A;  2A41 A;  4FJJ A;  1E4G T;  1S9G A;  4FW1 A;  4CGD A;  3CF5 L;  3CM5 A;  4IG3 A;  3P1G A;  1I94 K;  4CZK A;  4LF5 K;  1IJJ A;  4DV0 K;  1KSP A;  3LDP A;  2HHS A;  4CE9 A;  2HHX A;  3O4Q A;  1KAZ A;  3ALY A;  1LCU A;  3QEV A;  1IO2 A;  3QB0 A;  1RBR A;  2A5X A;  3TI0 A;  1I3A A;  4Z4G A;  3CC7 N;  4IJA A;  4YOU A;  3HT3 A;  4XH4 A;  2Y1J A;  1QVF M;  1LWC A;  5C25 A;  4HHT A;  3D2E B;  4YDU A;  2ZF5 O;  4ID5 A;  5J2P A;  4DU3 A;  3JXU A;  3BUZ B;  3QET A;  5GAD P;  5DM7 L;  1P90 A;  4IOX A;  4B8A B;  1WNS A;  3NBP A;  1NJX A;  1JCG A;  2WFB A;  1B92 A;  4DV1 K;  1CXQ A;  3MAQ A;  3SLC A;  4CK2 A;  5JMV A;  2KZM A;  4DV7 K;  4PKI A;  4CEZ A;  1NGH A;  4DSL A;  4K41 A;  2QM1 A;  2OTJ N;  4F9O A;  5GAE P;  3NH2 A;  1M1K O;  1HYV A;  2QA4 N;  5F0X A;  1GOB A;  2OAN A;  1OH5 A;  3NF8 A;  3L2V A;  3FE1 A;  1NK4 A;  1HKC A;  2W41 A;  5B8H A;  2X74 A;  3O9S A;  4AH9 A;  3EZW A;  5AQW A;  5AQN A;  1OVY A;  4FJG A;  1K8K B;  2P9U A;  1RFQ A;  4CF8 A;  2E2O A;  3GBT A;  5FPD A;  1Z26 A;  2GUI A;  4OPJ A;  3W3D A;  1BOT O;  4FJK A;  2QWO A;  1XNQ K;  1NK6 A;  4H5N A;  1HRH A;  1RT3 A;  4QS9 A;  1S6P A;  1C1C A;  4NXM K;  5T7B A;  1XQS C;  3ZSX A;  2UXC K;  5JLH A;  1UA1 A;  4K8Z A;  2QWL A;  3T7Z A;  1XWL A;  3WXM B;  3U3Y A;  1W9H A;  5AQK A;  4KBO A;  3CCS N;  1SKR A;  4M42 A;  4QOZ B;  1MU2 A;  1YUW A;  2Q1N A;  2OTL N;  1YIT N;  1QSL A;  1KD1 O;  2FF6 A;  3RR7 A;  2VGM A;  4AHR A;  3LDS A;  4CGJ A;  4FWO A;  1RTH A;  4A57 A;  1Q7Y O;  5AQT A;  4Z0U A;  4RW7 A;  3R8E A;  3OYK A;  4CBU A;  3EY1 A;  4CGG A;  4KRF A;  2Q0R A;  1HUX A;  3GL1 A;  2NRW A;  3JS6 A;  5JLF A;  3VQP A;  1NKE A;  3CFR A;  1JLB A;  3AVB A;  3M6G A;  3K2P A;  1T03 A;  2DFF A;  5CZ2 A;  4KHY A;  3R1X A;  5J1E A;  4JK7 A;  1TKT A;  3HM9 A;  4I7F A;  4DS4 A;  3ZT3 A;  1RT1 A;  3I33 A;  4B9U A;  1J6Z A;  3WXK A;  3T1A A;  3CHW A;  4KB1 A;  5SZT A;  3FGU A;  3MXI A;  4GV6 A;  3O9T A;  2ZQB A;  1IKV A;  4CK1 A;  4KO0 A;  4NB4 A;  4HCB A;  1HKB A;  3DM2 A;  3AY9 A;  3KZB A;  3QBX A;  4K0K K;  1X3N A;  2PAV A;  4BWM A;  2I7P A;  5BPL A;  3LDL A;  4Q0B A;  4JS4 A;  2RPI A;  4BGB A;  1RTD A;  5LJV A;  3SUN A;  5AQF A;  3VES A;  4JRP A;  3KHY A;  4BRC A;  2IS3 A;  5AQM A;  3SUP A;  1T6C A;  2CGL A;  3WNG A;  4CIG A;  2E20 A;  4FVU A;  1IKY A;  3KWG A;  1HJO A;  4RW9 A;  4CHY A;  2PBD A;  2PYJ A;  3C0B A;  1HPZ A;  3ZT1 A;  3GE1 A;  4KHU A;  4WCE L;  3AA5 X;  4JV5 K;  2YHX A;  1GLC G;  4CZJ A;  4BDY A;  4Z4I A;  4BRP A;  4DQQ A;  4ISE A;  3HOT A;  4DSK A;  2P9N B;  4B3R K;  2QWR A;  1TK0 A;  4I6M B;  2EX3 A;  4GVM A;  4ELV A;  4WQ4 A;  4BR9 A;  3WT0 A;  3VPZ A;  1DLO A;  1M90 O;  2ETJ A;  1BDG A;  3ENH A;  3PO4 A;  1HYZ A;  5LJW A;  1TKZ A;  1W97 L;  1ZBH A;  1Q8I A;  3PX6 A;  1SKS A;  1A5X A;  1RBU A;  3V4I A;  4QAG A;  2CH6 A;  2QWQ A;  4I2P A;  1U2V B;  3H08 A;  1VSM A;  1S3X A;  3VQ5 A;  4BRK A;  1ATN A;  2A6A A;  4CER A;  3VF4 A;  1ESV A;  1SAZ A;  1RBV A;  3FZK A;  4FPA A;  2HBL A;  4BWJ A;  3OVN A;  3A2F A;  3CMA N;  5HL7 L;  4XH1 A;  4FOE A;  4CHN A;  3LWL A;  2HB5 A;  2KFN A;  3ATV A;  1FJG K;  3O5B A;  1JCF A;  3M8R A;  4B3O A;  3ZX0 A;  4M45 A;  5ELZ A;  5CYM A;  2V51 B;  5KQ8 A;  4O0I A;  2Z1G A;  3OBY A;  3WXI A;  3BY5 A;  1QE1 A;  3OTO K;  2YNG A;  4CEQ A;  1ZYQ A;  5BRH A;  4C1N K;  3CCQ N;  3HP9 A;  3J7A P;  4C1N I;  3P31 A;  4JEP A;  4CGF A;  2P9I A;  2D4W A;  3O08 A;  1HQU A;  1RDC A;  1NJZ A;  5GAG P;  3A5O C;  2D0O A;  4B3T K;  4O55 A;  1JKH A;  2YHY A;  1NKB A;  5I3U A;  4IWV A;  2B6A A;  3THY B;  1C0M A;  4B9S A;  3ITH A;  2LSN A;  3DXM A;  1HNI A;  3HTV A;  3VER A;  3CJA A;  1XUP O;  3S3N A;  3RMB A;  4CED A;  3PO5 A;  4HVJ A;  3O6W A;  4WQ4 C;  3T3F A;  1WAJ A;  4B8C A;  3RMD A;  2QKB A;  4N47 A;  5KGX A;  5HBM A;  4OGE A;  2D0B A;  4IJN A;  1EP4 A;  1J54 A;  2B4J A;  3WEE B;  3U8X A;  1S1T A;  5D3G A;  3M1F A;  4BDZ A;  4FYD A;  2G8U A;  4K42 A;  3L4Q A;  4F4K A;  4YOV A;  4CJP A;  2P5G A;  4UY8 O;  2IVN A;  1VSH A;  5F1X A;  2WC9 A;  1XHZ A;  5M1P A;  3ZEU A;  4BE1 A;  3EEQ A;  2HF3 A;  3O9Q A;  3THV A;  4DCH A;  4MDB A;  5AQQ A;  1E4F T;  1NJI O;  4YDU C;  3QER A;  3VGK A;  3NF9 A;  3CJC A;  4NO7 A;  2YJF A;  3KLI A;  5GIN A;  1KTQ A;  1RTJ A;  3AAP A;  3MN5 A;  4CZH A;  4DV3 K;  1N5Y A;  4XH5 A;  2ZM6 K;  3NAE A;  3WNE A;  1SZ2 A;  3KK1 A;  4H0Y B;  3EE9 A;  3SUO A;  3L6Q A;  4DR3 K; 
#chains in the Genus database with same CATH homology
 5C10 A;  2GTD A;  1YAG A;  5AQR A;  3VGL A;  3P4I A;  3OHR A;  5KPT A;  1V4T A;  5AQV A;  3O1B A;  3H3N O;  4GV3 A;  3J8A A;  2YJE A;  4FWM A;  4K43 A;  4BR7 A;  4JHD A;  4YOR A;  5AR0 A;  1ZXO A;  2GWJ A;  4ILG B;  4EFH A;  1VQK N;  2ZGZ A;  3F9M A;  4U7B A;  1WOQ A;  3E9P A;  2GX9 A;  5EY4 A;  2E1Z A;  1TYQ A;  3R9P A;  1H1V A;  1W2B M;  2A40 A;  3KWI A;  3MX2 A;  3N4P A;  3U9D A;  3OA9 A;  1Q18 A;  4EAH D;  3VOV A;  4BR0 A;  3ZX2 A;  3ZET A;  2E88 A;  1S22 A;  5AQU A;  3CJ9 A;  2V52 B;  1P8Z A;  2GUP A;  5M1F A;  4BG9 A;  4JNE A;  1GLD G;  4HWI A;  1NM1 A;  3RVC A;  3VEZ A;  4A5B A;  3CJ7 A;  2HST A;  5H1S Q;  1TYQ B;  2YHW A;  4BRD A;  1IG8 A;  4OO1 J;  4OPH A;  1HKG A;  3HI0 A;  3VMF B;  5KQD A;  1VQ5 N;  2ASM A;  3A5L C;  3IUC A;  4Z94 A;  1QZ6 A;  2FSN A;  3P38 A;  3RSE B;  2P9N A;  3CET A;  4BRN A;  4BRE A;  3CXC M;  4B1Z A;  3G4S N;  3CQY A;  4AM7 A;  4O5F A;  4L3Q A;  1DGK N;  3MDQ A;  1SQK A;  1MWK A;  4BRO A;  3D2F B;  4FOI A;  2VWB A;  5AQO A;  3F2K A;  3SK3 A;  3WXJ A;  1QQO A;  3CER A;  4FWS A;  3PIO L;  1YF5 L;  4MLE A;  1SS6 A;  1NGC A;  5EOY A;  3VGM A;  3K9J A;  4PHT X;  1VQN N;  2VYP A;  3CQX A;  2Q0U A;  3HBT A;  4RWT A;  4JHD B;  2P9K B;  3AGK A;  1YJ9 N;  3TSU A;  3CIP A;  2QI2 A;  1DKG D;  3WXL A;  5C0Y A;  2A41 A;  1VQM N;  1E4G T;  4WFB L;  3CF5 L;  2NZT A;  1GLL O;  3L4I A;  3FFK B;  2GWK A;  1QVG M;  4CZK A;  2GEL A;  3S41 A;  1IJJ A;  1YJN N;  3DXM B;  3LDP A;  3TPQ A;  3VEO A;  1YIJ N;  3WQT A;  3QIC A;  4IOC L;  1KAZ A;  1LCU A;  2F9W A;  3O9R A;  1BA1 A;  4H5T A;  1HX1 A;  3QB0 A;  2A5X A;  2Q36 A;  3AGR A;  4JKE A;  3TU5 A;  4H0P A;  3M5R A;  4CBW A;  2ZJP L;  1VQ8 N;  4A2B A;  3CC7 N;  1C0G A;  4IJA A;  4YOU A;  2P9S B;  3QBW A;  3EO3 A;  4XH4 A;  2NRH A;  2CGK A;  2QWN A;  3D6R A;  1QVF M;  2D0P A;  3D2E B;  2HBK A;  2ZF5 O;  4YDU A;  2WUS A;  3EN9 A;  3JXU A;  4FO0 A;  3BUZ B;  3E9L A;  3SMP A;  3BEX A;  4PL7 A;  3ULE B;  1YJW N;  1K8A O;  2IVP A;  3O8M A;  5GAD P;  4DKW A;  5DM7 L;  1P90 A;  4H0T B;  5C2D A;  2A42 A;  4IOX A;  5GIP A;  1VQP N;  1JCG A;  2WFB A;  4EHT A;  2HBJ A;  4FWP A;  4QS8 A;  3SLC A;  2WBN A;  5JMV A;  3QDK A;  3TTF A;  4JKC A;  3A5N C;  4PKI A;  1NGH A;  4JK9 A;  4WQ5 A;  1JCE A;  3MX5 A;  4M63 C;  4K41 A;  2QM1 A;  2OTJ N;  4F9O A;  1QQM A;  4YOY A;  4IO9 L;  4GNI A;  2QWM A;  1TUU A;  4DB3 A;  5GAE P;  4WFN L;  5KPZ A;  1M1K O;  2QA4 N;  4MDA A;  3VEV A;  1YVN A;  4AM6 A;  1NGF A;  5CR4 A;  4CD3 A;  5F0X A;  2OAN A;  1NGE A;  5JVH L;  3WEE A;  2E1Y A;  3FE1 A;  3Q7B A;  1HKC A;  2VCP A;  1MWM A;  2W41 A;  3UE5 A;  4WF9 L;  5B8H A;  1Q86 O;  3O9S A;  1VAZ A;  4KH4 A;  1N8R O;  3EZW A;  5AQW A;  5AQN A;  1OVY A;  1K8K B;  2P9U A;  2QXL A;  4KH5 A;  3NVM A;  4AF1 A;  1RFQ A;  2E2O A;  4CZM A;  2DPN A;  3GBT A;  3UKU B;  2Q97 A;  3W0L A;  4M7X A;  5FPD A;  4BVP A;  3Q7C A;  5LY3 A;  3W3D A;  1BOT O;  2QWO A;  2JWK A;  4H5N A;  1Z6R A;  4QS9 A;  4MLH A;  5TKY A;  1XQS C;  3VTH A;  1KQS M;  3CME N;  3CCR N;  1RDW X;  3VEY A;  5JLH A;  4JKH A;  5EVZ A;  4BR5 A;  4CZG A;  5BN8 A;  1O13 A;  2NLX A;  2RE2 A;  1VQ6 N;  2QWL A;  3VF2 A;  3C7N B;  4EHU A;  3A0I X;  3H46 O;  3T7Z A;  3CCJ N;  3SAF A;  3WXM B;  3HSC A;  5AQK A;  4JKF A;  4JKD A;  3BP8 A;  2E2P A;  4KBO A;  2FLO A;  5M1Q A;  4CJ7 A;  4BRH A;  3CCS N;  2IVO A;  1GLJ O;  3CJ1 A;  5AQS A;  1YUW A;  4BRG A;  2Q1N A;  3ULE A;  1YIT N;  2OTL N;  3OW2 M;  1KD1 O;  3I8B A;  2FF6 A;  3EKU A;  1JJ2 M;  2VGM A;  5M1K A;  4GY2 B;  3LM2 A;  3DLL L;  1BWF O;  4JAX A;  4FWO A;  2GEM A;  4A57 A;  1Q7Y O;  5AQT A;  1EO1 A;  4J8F A;  3TSQ A;  3P39 A;  4IO8 A;  3R8E A;  2F7T A;  3SAG A;  5AQP A;  4CBU A;  1X3M A;  3EL2 A;  1NGJ A;  3SBG A;  1MA9 B;  3F5T A;  2NNW A;  3WUH A;  2Q0R A;  1HUX A;  2W40 A;  2NRW A;  3GL1 A;  3JS6 A;  3C6A A;  1KAY A;  3MCP A;  5AQI A;  5JLF A;  4JKG B;  1VQL N;  4CZI A;  4FWL A;  3HZ6 A;  3M6G A;  3O4W A;  3MN9 A;  3CC2 N;  5AZJ A;  4OPA A;  4DQ8 A;  1BG3 A;  3R1X A;  3B8A X;  4JKA A;  4B1X B;  3SBT A;  4JK7 A;  5JIC A;  4PKH A;  1ZBS A;  4I6M A;  2ITM A;  2QEX N;  5EXW A;  3CCU N;  4JD2 B;  2H3G X;  4B1Y B;  3CPE A;  3QFU A;  5TKW A;  3I33 A;  5AQL A;  4U67 L;  3I56 N;  1J6Z A;  4PKG A;  3WXK A;  2HMP A;  4FWQ A;  3CHW A;  5HOO A;  1XC3 A;  2E2N A;  2P9K A;  3E9O A;  3FGU A;  3N4Q A;  4M7Y A;  4GV6 A;  3VET A;  3O9T A;  3SMS A;  2Q31 A;  2V7Z A;  4RCH A;  5AZI B;  5GIO A;  3BF3 A;  3KK7 A;  4NB4 A;  5M1N A;  3T69 A;  3D2F A;  4BRL A;  1HKB A;  3KZB A;  2P9L B;  1BA0 A;  2P9P A;  3AY9 A;  3QBX A;  4GV9 A;  2ASO A;  3MN7 A;  4K25 A;  1X3N A;  2PAV A;  3QFP A;  3A5M C;  1NWK A;  2I7P A;  3H45 C;  3VTI A;  5BPL A;  3IFR A;  1NMD A;  3LDL A;  4A2A A;  4ILH A;  3U4L A;  4NLB A;  4BGB A;  3ZEU B;  1QQN A;  5AFU H;  5BPN A;  3H3O B;  1GLE G;  5LJV A;  4JK8 A;  5GAH P;  2EWS A;  2NRX A;  5AQF A;  3VES A;  1BO5 O;  2QTD A;  5E84 A;  3KHY A;  4BRC A;  5JVG L;  3K9K A;  1YXQ A;  3H1V X;  3VEX A;  2CGJ A;  5AQM A;  4CZL A;  3UKR B;  1U2V A;  1T6C A;  1OKJ A;  2CGL A;  4CZE A;  1K9M O;  4BRM A;  2E20 A;  4FVU A;  3KWG A;  4IFE A;  5C2F A;  1HJO A;  2P9P B;  3U9Z A;  3G71 N;  1K73 O;  3PLA A;  2PBD A;  5FPM A;  3C0B A;  5AQJ A;  1C0F A;  2RHK A;  3ID6 A;  4E1J A;  2P9S A;  3VEW A;  3GE1 A;  1KAX A;  3MWP A;  4HTL A;  4CBX A;  3OBW A;  5BRF A;  4WCE L;  1QZ5 A;  4NLC A;  2YHX A;  3FR0 A;  1HPM A;  2FXU A;  3UKR A;  4EIA A;  1GLC G;  4CZJ A;  4FWN A;  3BF1 A;  3IKM A;  2I7N A;  3SJH A;  3FZH A;  3M3Z A;  4BRP A;  4CI6 A;  3ZYY X;  4ISE A;  3HOT A;  2KLA A;  2P9N B;  2NRV A;  2NRZ A;  2QWR A;  3EE8 A;  4I6M B;  3NMU A;  2IIR A;  5AQY A;  5AQZ A;  3MN6 A;  1G99 A;  3CD6 N;  2VGN A;  4WQ4 A;  4WYB A;  3CJB A;  4IOA L;  4BR9 A;  2AP1 A;  2FSJ A;  1Z05 A;  4H0V B;  4A59 A;  1S72 N;  2BH1 A;  4B1V A;  3WT0 A;  3CCM N;  3VPZ A;  4JKG A;  3CCL N;  1M90 O;  1U6Z A;  4IEE A;  1BDG A;  3ENH A;  5LJW A;  2FSK A;  4LC9 B;  3ID8 A;  1W97 L;  5E26 A;  1NGB A;  3LDN A;  4BQL A;  3G6E N;  1NBW A;  1ATS A;  3ZET B;  4KH6 A;  3ENO A;  2P9I B;  2CH6 A;  1YHQ N;  2QWQ A;  4JN4 A;  1U2V B;  2HOE A;  1KC8 O;  4BC3 A;  1S3X A;  1KXP A;  5FPE A;  4IZ9 A;  2F9T A;  1GLA G;  4BRK A;  1ATN A;  2A6A A;  4GVE A;  5ADX A;  3UKU A;  5BN9 A;  3I55 N;  5MLC Q;  2J4R A;  1ESV A;  3DWL A;  1SAZ A;  4H5W A;  3VF4 A;  4BRA A;  4C23 A;  1VQ4 N;  3FZK A;  3VF6 A;  2FF3 B;  4FPA A;  1VQO N;  2HBL A;  1T6D A;  3O80 A;  1NLV A;  3HRG A;  1RDU A;  1ILY A;  2BTF A;  2E8A A;  5BRD A;  5HL7 L;  4BQZ A;  4XH1 A;  4FOE A;  2V7Y A;  3TTC A;  5BRE A;  3CMA N;  2NRR A;  2PFU A;  3ATV A;  3ATU A;  2P9L A;  1ATR A;  4B9Q A;  3E66 A;  4BR4 A;  2ZWH A;  3GOI A;  3O5B A;  1Y64 A;  1JCF A;  4IXC A;  1D4X A;  3C65 A;  4B1W B;  3ZX0 A;  5CE3 A;  3CCV N;  3LDO A;  3MCA B;  1NGG A;  3SAH A;  3MK6 A;  5AQH A;  5ELZ A;  2V51 B;  3A8Y A;  2NRT A;  5KQ8 A;  2HBM A;  2QW9 A;  3FZL A;  4Y0W A;  4BRQ A;  3OBY A;  3CI5 A;  1X9J A;  3C6H A;  3WXI A;  4CZF A;  4ISF A;  1ZC6 A;  4PL8 A;  3RSE A;  2QWP A;  5BRH A;  3L0Q A;  4C1N K;  4R79 A;  3CCQ N;  4FSV A;  2YI1 A;  4H5R A;  2KKZ A;  3G25 A;  4C1N I;  2ZJQ L;  3MMV A;  3P31 A;  4JEP A;  2A3Z A;  3FLC O;  5AZJ B;  4BVO A;  5ADX H;  2P9I A;  3CCE N;  4ILJ A;  2D4W A;  3O08 A;  4WQ5 C;  3GDQ A;  3LDQ A;  5DM6 L;  5GAG P;  3A5O C;  4CD1 A;  2D1K A;  2D0O A;  3NVK A;  2YHY A;  4BRI A;  2JWL A;  3QML A;  4FL9 A;  4IWV A;  4BY9 C;  4YOW A;  4BC4 A;  4B1U B;  3DXM A;  3ZX3 A;  3R3L A;  5AQX A;  3UB5 A;  2BUP A;  2YX6 A;  1YI2 N;  2Q2R A;  3LL3 A;  3H1Q A;  3HTV A;  2CH5 A;  3CJA A;  3VER A;  3TSP A;  3J7Z O;  1R59 O;  1XUP O;  4WFA L;  3HOS A;  4JD2 A;  3O1W A;  1BU6 O;  1DT9 A;  5M1O A;  3E1Y A;  4YOT A;  5EX5 A;  5AFU A;  3O9U A;  3ENB A;  3O6W A;  3CC4 N;  3MWT A;  4WQ4 C;  3VEN A;  3LM9 A;  2HF4 A;  1CZA N;  3D7E O;  1NGI A;  4FPB A;  3FZM A;  4QS7 A;  1QHA A;  4H03 B;  3DAW A;  3D2E A;  3H6E A;  3R6M A;  5C12 A;  4H0X B;  3EKS A;  2ASP A;  1GLB G;  2KHO A;  4IJN A;  4XEI A;  3HM8 A;  3WEE B;  3U8X A;  4A62 A;  4BC2 A;  2ZGY A;  1BUP A;  3AAQ A;  3C7N A;  3GG4 A;  1T44 A;  3M1F A;  3TTD A;  3DXK A;  1T3V A;  3IDH A;  4BC5 A;  1Q81 O;  3KVG A;  4A5A A;  4RTF D;  4IEI A;  4K42 A;  4BRF A;  3PIP L;  3L4Q A;  4DHY A;  4BR2 A;  2E2Q A;  4YOV A;  1WUA A;  5F2R A;  1NGA A;  4A61 A;  4FWR A;  1NGD A;  2AA4 A;  1GLF O;  1VQ7 N;  1TUY A;  2UYT A;  4UY8 O;  1LOT B;  4O8K A;  2IVN A;  4MO4 A;  5F1X A;  4JKB A;  3DJC A;  1K8K A;  2P9U B;  2WC9 A;  5FPN A;  5M1P A;  3ZEU A;  2HF3 A;  3O9Q A;  4ISG A;  4DCH A;  1VQ9 N;  4MDB A;  1E4F T;  1EQY A;  3FZF A;  4YDU C;  5AQQ A;  1HLU A;  4FWK A;  1V4S A;  2ZJR L;  1NJI O;  5BR9 A;  3CPW M;  3IMX A;  3DXK B;  3VGK A;  3WQU A;  5KPR A;  1Q82 O;  3CJC A;  1MDU B;  3AAR A;  2YJF A;  2YCH A;  4NO7 A;  4O8U A;  5GIN A;  5AZI A;  4BGA A;  1RGI A;  3AAP A;  3MN5 A;  4CZH A;  4H5V A;  5BPM A;  4H0O A;  4MO5 A;  4XH5 A;  5CHI A;  1SZ2 A;  4BG8 A;  4IDH A;  4H0Y B;  5I9E B;  1DEJ A;  4G9Z A;  5C15 A;  3EE9 A;  5AQG A;  4YOX A;  3L6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...