3V9UA

Crystal structure of rnase t in complex with a preferred ssdna (aat) with two mg in the active site
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
206
structure length
206
Chain Sequence
NAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 68
structure length 206
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9uA00
1LWEA 3JSMA 3NE6A 1S1UA 3PY8A 3C94A 5KI6A 1WLJA 1VK0A 3OYGA 2WONA 5HRSA 4GW6A 3LWMA 3NH1A 2GBZA 4DTPA 4OLAA 1U4BA 5HRRA 4DFPA 3KTQA 1A5XA 4KRFA 3TI0A 1GOAA 4WE1A 3VQ5A 3K58A 3RWUA 3OYEA 3RTVA 1HRHA 3DLGA 1L3VA 4ELTA 3LALA 4OVLA 1QHTA 1SV5A 1TKXA 2ATQA 3DRSA 3TAEA 2ITGA 2P1JA 4N47A 1JL2A 5KRSA 1K6YA 3PX6A 4B08A 3P1GA 4KHUA 2ETJA 3OYLA 4B9NA 3VQBA 4O0JA 3VQCA 4L8RB 4CFBA 1JLBA 5C25A 1KFSA 1TL3A 5I42A 3SNNA 3V1QA 3RRHA 1NJXA 3QINA 3P83D 4CEDA 3CFOA 4N76A 4I2PA 4HCBA 1TKZA 1J53A 1JLCA 4FLTA 1NJYA 1L3SA 4K8XA 1RTDA 4KHYA 1HQEA 2FBYA 4DU4A 4CF8A 4CK1A 4ZTJA 2PYJA 4W5TA 3NHGA 1ZBLA 3SZ2A 3ASMA 4DFJA 1WSHA 4M3ZA 1BCMA 1QS4A 2DFEA 2IOCA 3AVAA 3CM6A 4CJRA 1D8YA 3OS0A 3OYNA 4DSJA 1XC9A 3AO5A 5DK5A 1A5VA 4GVMA 4RW8A 4DTNA 4B9MA 2HNYA 4JS5A 1D9DA 5C24A 3WNEA 3OS1A 4DSIA 2IGIA 4FJHA 1J9AA 1KFDA 1X1PA 3KKSA 3K59A 2DTUA 4ICLA 2R7YA 3SPYA 2HMIA 3HK2A 4FJXA 4AH9A 1HJRA 2FBTA 3LPUA 4FVMA 2Q3SA 4OGEA 4CFAA 5CZ2A 1SKRA 1ASUA 1O1WA 1Y97A 4OKKA 1IO2A 3NGZA 3K2PA 1WSFA 2YNHA 3MXJA 3ZSOA 1T7PA 4Z4FA 4DLGA 2ZD1A 2XRIA 3PV8A 4KB1A 4CEEA 2HHUA 1HYVA 3G10A 1SKWA 1HQUA 4B9UA 4CK3A 1TK8A 4HHTA 3SQ2A 1TKDA 4N5SA 5E41A 4FJJA 1C1AA 3RRGA 4DQIA 1D9FA 4QAGA 2XHBA 1A5WA 5SWMA 4CJSA 2RKIA 4XIUA 1S9GA 4O4GA 3MAQA 1NK0A 2D0AA 4M41A 1B9FA 1JLGA 4CJLA 3TAGA 1HYSA 1NJZA 4JRQA 1VSDA 4KO0A 4DTRA 4FJNA 1XHXA 5J2QA 3AO3A 3LP1A 4Y1CA 3SQ1A 2DFHA 3B6PA 1RTIA 4Y1DA 1QTMA 1D5AA 3ITHA 1FK9A 1C0TA 4B9TA 4FJIA 3C6TA 4PY5A 3QNNA 1RBTA 4EP4A 4NCBA 4RW6A 4Z4EA 4IFVA 4Z4GA 2LSNA 4DSLA 4FW1A 5HROA 3AVFA 2O4IA 5HLFA 3AVIA 3AA4A 1X9SA 4FLYA 1Z26A 3AA3A 4FM2A 1X9MA 2QK9A 3WNGA 3HVRA 4CIGA 4KHNA 4KTZA 4CFCA 1W0HA 1ZBFA 4DS5A 1CXQA 4TSXA 4CEFA 2F8TA 4ELUA 3NH0A 1RDAA 1T05A 4CJQA 1UWBA 2YNFA 2XY7A 1TAQA 1JLFA 4MFBA 4B8CA 5T7BA 4FCYA 3I0RA 3HSTB 3A2FA 3P5JA 4CGIA 3DI6A 2X78A 4QCLA 4CHYA 3BDPA 3F9KA 4EP5A 3DOKA 3DLKA 3LDSA 3L2VA 4KI4A 4AHRA 1JLEA 1JL1A 4NYNA 1RT1A 4OLBA 2XY5A 4JS4A 3HT3A 2E6LA 1RBUA 3O3GA 1SL0A 1NK9A 1RCHA 4AHTA 1NK5A 4AILC 4M3TA 1G15A 4FM0A 4J2EA 2P51A 2I5JA 2OPQA 2B4JA 3NAEA 1TK0A 1Q9YA 5JS2A 3DLBA 1NK7A 1FKPA 4KI6A 3AA2A 3AVCA 4HUFA 1HNVA 4DF8A 4Z4IA 2XO7A 2KFNA 2X6NA 2G8FA 3RR8A 2E6MA 3MECA 2DFFA 4M45A 3V1RA 1S1VA 1QSLA 4DQSA 3SQ0A 4W5RA 4CGHA 4UQGA 3TWHA 4CEBA 1UA0A 1Q8IA 1KRPA 2ZQBA 3EYZA 4W5OA 3DLHA 2HB5A 1WSIA 4DTJA 2EX3A 4FK0A 2HHXA 1BI4B 4ID5A 5KRTA 3ALYA 5CY4A 4CJ4A 4DQRA 4B9LA 4Z4HA 3L3VA 4DFKA 1U49A 3QEXA 3ZSVA 3K5LA 2E4LA 3I8DA 3C6UA 4IBNA 4BE0A 1CLQA 4FYDA 1NKBA 1XWLA 3VA3A 4ZHRA 4F2SA 1VSKA 1GOCA 1ASWA 2YKNA 3OYMA 4JRPA 1U45A 2D0CA 1YVUA 3M8PA 4CJFA 1UAXA 4CEZA 4I9LA 1N6QA 4E3SA 4ELVA 1S6QA 4RW4A 2YHAA 4M3YA 4CIEA 3V9SA 1VRTA 1T03A 4PUOA 3VQAA 5J2NA 4BDPA 5CYMA 3QIOA 4FJ7A 1HYZA 2AJQA 1IKXA 1BQMA 4KPYA 3HVTA 2HHVA 2A1SA 1EKEA 1RT2A 3ZSZA 2OZSA 3EY1A 4DU3A 3O3HA 1ZBUA 1TKTA 4DTSA 4C8LA 1T8EA 3M8RA 4FZXC 1S1TA 3QEVA 1DTQA 5CZ1A 4CJTA 1HMVA 1SUQA 4CECA 1RDBA 3PO4A 4CGGA 4EZ6A 4N56A 5HP1A 2IAJA 2G8KA 2Y1JA 4J2BA 4FK4A 4QOZB 4M3RA 4R5PA 3HO1A 5C42A 1TK5A 5FRNA 4AHCA 1NOYA 1TGOA 2A1RA 1J5OA 1FXXA 3RMAA 3KLIA 2Y1IA 3DYAA 3MEEA 4F3TA 1RDDA 3QO9A 3MXMA 4CF2A 3KLGA 4CJKA 2OZMA 3CM5A 1VSHA 4PA1A 3ZSWA 3KK1A 4IFYA 1KLMA 4O44A 2GV9A 4CIFA 5K14A 1CZ9A 4DLEA 3IRXA 2G8HA 3AO4A 4CHNA 3KLFA 2G8WA 4RW9A 3K5MA 3CG7A 4CCHA 3VQ4A 3THVA 2YNGA 1WAFA 4H8KA 4M3UA 1Z25A 3OVNA 1VSJA 3VQ7A 1I39A 4FLVA 3JYTA 3SPZA 2DY4A 3NF7A 2OPSA 1WSGA 2X74A 3OYIA 2QKBA 3LAKA 2XY8A 1JXBA 4CF0A 1C0MA 1FKOA 2JLEA 4CJPA 3OS2A 4W5NA 4H4MA 4OGCA 4KHQA 1LWFA 3EZ5A 5J1EA 1HPZA 2P5OA 1BIZA 3H08A 4CGJA 4Q5VA 3OYHA 4ZTFA 3PX0A 3V9ZA 3NGIA 3K57A 1IKWA 3SUPA 3AV9A 3UIQA 4CE9A 3L2UA 4LY7A 2RN2A 3M8QA 5D3GA 4OKJA 1RBSA 3E01A 1VSEA 4AHSA 4BDYA 4GMJB 4CHQA 4J2AA 1KVCA 2KZMA 4IKFA 3KLHA 3HP6A 4I7FA 3ZSQA 3U3YA 4CF1A 2XY6A 4DWIA 4K8ZA 1JXEA 3HXMA 5FROA 1F21A 4FLUA 1Q9XA 2B5JA 2PZSA 2P5GA 4C8KA 3OYDA 2HHWA 3ZT0A 4I2QA 1JKHA 3PX4A 1VSFA 2W42A 4KHSA 4KAZA 1C6VA 3WNFA 4CJEA 4AHVA 3SYZA 3S3MA 2O4GA 1SL2A 3L8BA 4RW7A 1KCFA 1NK6A 4RG8A 4E19A 2VG7A 4JLHA 2PYLA 3RMBA 1TVRA 3SJJA 4BACA 3HPHA 3KKRA 1WN7A 5I3UA 4CGDA 3AVGA 3OYCA 2Z1HA 4FLWA 4J2DA 4FJ9A 3V6DA 4CERA 5HBMA 1BI4A 2FBVA 4DMNA 3QEWA 3TABA 5HRNA 5J2PA 3AVMA 2FC0A 3L2WA 4DTMA 1NKCA 1N5YA 1UA1A 3KD1E 2HHQA 4DSKA 3IS9A 1C1CA 3K5OA 3NH2A 1SL1A 1RBRA 1RT6A 4OJRA 4HTUA 4W5QA 3HPOA 1QSYA 4CK2A 1RT3A 1KSPA 3OYJA 1EETA 3G0ZA 5J2MA 1UOCA 1RT7A 5FDLA 3VA0A 1REVA 2OPRA 4AHUA 1BIUA 4DF4A 3TAQA 4E7KA 3QEPA 3T3FA 2G8UA 4NCAA 3NBPA 3VQ9A 2Z1JA 2OA8A 3RMCA 1U48A 3ZSXA 1DTTA 3TAFA 2OPPA 4C8NA 2VG6A 2D0BA 3DLRA 4E7HA 2RF2A 4CJ5A 3VQ6A 1VSLA 1ZBHA 1XI1A 2YKMA 3VQ8A 2YHBA 4CHOA 1TL1A 2BE2A 4HUGA 3OJSA 1KVBA 3MEGA 4KFBA 5KTQA 4LH4A 1TAUA 5KGXA 3TAPA 2FBXA 4HVJA 4Q0BA 2Z1IA 1L5UA 3CFPA 3ZT1A 3DM2A 2PY5A 4DQQA 1RT4A 3ZSRA 4CEQA 3QERA 1B92A 4CJWA 3AO2A 1LW0A 1VSIA 3LAMA 3VQQA 3K5NA 3SV4A 2HHSA 5DMRA 3V1OA 1C1BA 3AVHA 1NKEA 1BHLA 4FJLA 4HUEA 3MEDA 5KGWA 4B8AB 3RR7A 3QETA 2HVHA 4LD0A 4B9VA 5FRMA 1BQNA 1S1XA 3PO5A 4FJKA 4FZYA 4E7IA 3V4IA 2KZZA 4LSNA 1QQCA 4FW2A 3M8SA 1WSEA 3NF9A 3NF6A 3SUOA 4O55A 3SI6A 1SKSA 1EX4A 4YFUA 1WAJA 3OY9A 1S1WA 3CYMA 4FK2A 3O3FA 3HYFA 4M3WA 4DTUA 2RPIA 1KVAA 1WSJA 2QXFA 3O4QA 4OPJA 4OPKA 3QESA 1VRUA 3OYKA 3HL8A 3SUNA 1R0AA 4KTQA 4N41A 2HVIA 1HNIA 1CXUA 1RNHA 4ID1A 4NYFA 4DSEA 2IDOA 3AVBA 2G8VA 3HJFA 3LZJA 3V9WA 1JLAA 4O5BA 3TR8A 1RTJA 3CQ8A 5EU7A 3VQEA 4FLZA 4FJ8A 1RTHA 2VWJA 2D5RA 4MQ3A 1LW2A 4IG3A 1X9WA 4G1QA 1J54A 4FJGA 4PWDA 4Z0UA 1KTQA 3CFRA 3LP0A 4BE2A 3SV3A 4KHWA 1EXQA 2ZE2A 3V9UA 3SCXA 3DLEA 3DOLA 3TAMA 3QLHA 2KQ2A 3SUQA 1NK8A 3U6FA 4DQPA 2BDPA 3ZCMA 4F8RA 4FZZA 4CESA 1IG9A 4NCGA 2HHTA 4PQUA 3L3UA 3ZT4A 1S5JA 3ZSYA 3RMDA 2G8IA 4CF9A 1XHZA 3L2RA 2YV0X 3OYAA 1U47A 1GOBA 3WNHA 1RILA 2YNIA 2BANA 4CFDA 1U04A 4BWJA 4F4KA 3DRPA 4BWMA 3NF8A 3KK3A 3AVNA 3ZT2A 1L3UA 2F96A 3HP9A 1QSSA 4B9SA 2KFZA 4DTXA 3LP2A 4CEOA 4YNQA 3MXIA 1BCOA 4CJ3A 1S6PA 3NFAA 3LPTA 3LZIA 1S9EA 3BGRA 4LH5A 5CYQA 1LV5A 4CHPA 3C95A 3PUFA 4E0DA 2VWKA 1YTUA 1I3AA 1BISA 3VQDA 1YT3A 2X6SA 3U3GA 3TARA 4C8OA 4M3XA 4CHZA 2BGGA 1LAVA 2IS3A 3L2QA 1NOZA 1EP4A 3S3OA 3KK2A 4BDZA 3I0SA 4CJUA 3QEIA 1QE1A 3V9XA 1BGXT 2OYQA 4F2RA 1ZBIA 1IKVA 5HRPA 3S3NA 4HCCA 1ZYQA 3B6OA 3KLEA 2HNZA 1L3TA 4CEAA 3SQ4A 4Z4CA 3D0PA 3KIOA 5SZTA 1IH7A 1DLOA 3QIPA 4E7JA 1JLQA 3T19A 2KTQA 1VSMA 2F8SA 4DG1A 1ITGA 3D45A 3T1AA 3FFIA 4E7LA 3AVKA 1IKYA 1B9DA 4FLXA 4FJMA 3AA5X 3QNOA 3ULDA 4FJ5A 4EZ9A 1YTAA 1RDCA 1C0UA 4DSFA 1NK4A 4KKOA 2HNDA 3AVJA 4KREA 4C8MA 4KTWA 2JGUA 4DTOA 4E89A 4H4OA 4F3OA 4KB0A 2WOMA 4KV8A 4FM1A 2KW4A 1CZBA 3LANA 3NGYA 3NDKA 1KLNA 3AVLA 3IAYA 1ASVA 4O0IA 1NJWA 1LWCA 3KJVA 3S9HA 2HW3A 3HPGA 3OJUA 1LAWA 4OKEA 3OYBA 4BE1A 3OYFA 4DS4A 2B6AA 3O4NA 4CGFA 2IC3A 2QKKA 3DRRA 4I9QA 4IDKA 4DFMA 3IG1A 4E1NA 4E1MA 4M42A 1RBVA 2Z1GA 1BL3A 1TV6A 3VQPA 4IG0A 3NCIA 4B3OA 3V81A 1MU2A 4CJVA 3F73A 1WNSA 1W9HA 3DMJA 1RT5A 2GUIA 5JS1A 2NUBA 2EHGA 3ZT3A 3LWLA 3AO1A 4FXDA 3ISNC 4LSLA 3LP3A 3VN5A 3HM9A 4DU1A 3KD5E 3TANA 2VG5A
chains in the Genus database with same CATH superfamily
3C94A 1EQYA 1VK0A 3OYGA 4GW6A 3NH1A 4OO1J 4DTPA 3KK7A 1U4BA 3CJBA 1RDUA 2RHKA 3VEZA 1C0FA 3MN6A 4DHYA 3RWUA 4BRDA 4ELTA 3VENA 4OVLA 3TAEA 2ITGA 3PX6A 3ZETB 4FWSA 1K6YA 2HOEA 2ETJA 4IO9L 4PKGA 1T6DA 4O0JA 1S72N 5C25A 3V1QA 1NJXA 3QINA 1X9JA 3P83D 1GLDG 1TKZA 1J53A 2ZGYA 1NJYA 1L3SA 4K8XA 4DU4A 1ATSA 4CF8A 4CK1A 4K25A 3ATUA 4DFJA 3ASMA 1BCMA 3CM6A 1XC9A 4RW8A 3M6GA 2YHWA 5C24A 1NGHA 4JKEA 3CPWM 3KKSA 1KFDA 2DTUA 4H5VA 3HK2A 4AH9A 3O9UA 1SKRA 2CGKA 1OKJA 2A3ZA 4OKKA 1RDWX 3K2PA 2HSTA 3CCQN 1T7PA 4JI2K 1HQUA 1P90A 5KPZA 4CK3A 1TK8A 3TTCA 4HHTA 4B9UA 2I7NA 4GV9A 4N5SA 2E8AA 4UY8O 4WFBL 1A5WA 4CZGA 4XIUA 1VQNN 4O4GA 1NK0A 2I7PA 3TAGA 1NJZA 3G71N 2GUPA 2P9IB 2QTDA 3PSFA 3M5RA 1D5AA 3ZEUB 1C0TA 1NU0A 1P8ZA 5E26A 3QNNA 5LJVA 1KC8O 3SAHA 4NCBA 1LOTB 4PL8A 4BQZA 4Z4EA 4B3MK 2H3GX 4Z4GA 4DSLA 2W40A 4BR7A 5C0YA 3ZX2A 3AVFA 1U2VB 3MMVA 1N34K 3WNGA 3HVRA 4KHNA 4CFCA 4BREA 1WBDA 1CXQA 5AQQA 3VF2A 1UWBA 4B1ZA 2XY7A 1JLFA 3IMXA 4MFBA 4A5BA 1XNRK 1VQON 4KI4A 1JLEA 1JL1A 2E2PA 5C2FA 4B3RK 1SL0A 2AP1A 4AHTA 4AILC 5KPRA 1G15A 1YJWN 4FM0A 4J2EA 3CMEN 5JMVA 1TK0A 2CGLA 1NK7A 1N33K 1HLUA 4Z4IA 2X6NA 3K0SA 3CCRN 4BG8A 2DFFA 3DJCA 1QSLA 5GADP 4CGHA 2Q2RA 4WQ4C 1KRPA 1WSIA 2EX3A 2HHXA 3TSUA 1U49A 4OX9K 3CJAA 5HL7L 2VGMA 3EKSA 2A41A 3VA3A 3I8BA 1TYQB 3QMLA 4ZHRA 5KPTA 1GOCA 1KD1O 1K8KA 4JRPA 1U45A 3F9MA 4FWQA 1NGDA 4CEZA 2O8DB 4I9LA 4FWLA 4ELVA 1S6QA 3U4LA 3V9SA 3EL2A 5CYMA 1S3XA 1IJJA 2AJQA 1BQMA 3HVTA 4BRPA 2A1SA 1EKEA 1RT2A 3ZSZA 3EY1A 3O3HA 3O80A 3QEVA 4CJTA 4B3SK 1GLEG 1RDBA 4EZ6A 4JKDA 3L0QA 2J4RA 4DR7K 3HO1A 2O8FA 1TGOA 4B3TK 4WFNL 1C0GA 1BDGA 5M1FA 5AQJA 5LJWA 4K43A 2P9LA 4CJKA 3CM5A 3ZYYX 4LFAK 1KLMA 2ZJRL 4O44A 1MDUB 4DLEA 1YITN 4JI7K 3IRXA 4CHNA 2G8WA 3K5MA 1QZ6A 1WAFA 3L6QA 5AQVA 3VTIA 4H0XB 3JYTA 4WQ5A 4H5RA 3NF7A 2OPSA 1N32K 3LAKA 2XY8A 2ASPA 1JXBA 4W5NA 4CJPA 4KHQA 5AQHA 1YVNA 5J1EA 3EZ5A 3F2KA 2IVNA 1BIZA 4Q5VA 3O8MA 3UIQA 3K57A 1IKWA 3AV9A 4LY7A 2A5XA 2GTDA 5D3GA 1VSEA 2VGNA 2QWLA 4GMJB 4CHQA 3QDKA 3ZSQA 4K8ZA 4CF1A 4CZKA 5M1KA 4FLUA 2B5JA 2P5GA 2HHWA 3OYDA 3ZT0A 4I2QA 5BR8K 4YHHK 1S22A 3SYZA 1BOTO 4NB4A 2YCHA 5TKYA 4A5AA 3L8BA 5FPDA 4RG8A 4NO7A 3SJJA 4BACA 5I3UA 5IT9O 4FJ9A 3V6DA 1BI4A 3QEWA 5HRNA 3L2WA 3KD1E 5ADXH 3MN7A 3IKMA 3K5OA 1RT6A 5AFUH 3AGKA 4CK2A 1VQ9N 3G0ZA 5J2MA 5MLCQ 1UOCA 1MWKA 1REVA 4AHUA 1NMNA 4NCAA 2Z1JA 5BRDA 2OA8A 1U48A 3TAFA 2VG6A 2HHHK 1VSLA 1SAZA 4GY2B 4CHOA 1TL1A 4BR0A 1KVBA 3OHRA 3MEGA 3H6EA 3PSIA 4LH4A 5KTQA 4CD3A 2UUAK 2D4WA 2HF3A 1YIJN 2A6AA 3ZT1A 1Z05A 1RT4A 4LF8K 1NG9A 2HMPA 3DXMB 3R1XA 1C1BA 2V51B 3MN9A 3SBTA 3RVCA 4FZYA 5C10A 2Q36A 1QQCA 2Q97A 4A62A 1ZXOA 3M8SA 3NF9A 3SUOA 4YFUA 3OY9A 3CYMA 3VEXA 3CERA 4BRMA 4FJHA 4KTQA 2HVIA 1VRUA 3OYKA 4LF9K 4N41A 4FWOA 4ISEA 4NYFA 4IZ9A 2FSKA 3AVBA 3THYA 2G8VA 4H5TA 4JKCA 1LW2A 4IG3A 1NGJA 4PWDA 1KTQA 2P9KB 3LP0A 2KQ2A 4JKHA 1NK8A 4DQPA 4NCGA 1Z6RA 4JHDA 3E9OA 4BC4A 3MDQA 4PQUA 3ZT4A 3RMDA 3DWLA 5DM7L 1XHZA 2YV0X 3FZKA 1GOBA 2PFUA 4YOWA 1G99A 5AQWA 4FPBA 4BWJA 4F4KA 3NF8A 2V7ZA 3AVNA 1E4FT 3HP9A 4DTXA 4YNQA 4GVEA 2Q1NA 3LPTA 2W6KA 1S9EA 1GLJO 3BGRA 4BRFA 4IWVA 4E0DA 3R8EA 2FSNA 2D0PA 3J81O 2FF6A 2ASMA 3SMPA 1VQ7N 2E1ZA 4HWIA 3QEIA 2CGJA 1QE1A 2OYQA 4F2RA 1VHXA 2YX6A 1ZYQA 3O9TA 2DPNA 3U9DA 2HBMA 3T1HK 1DLOA 3QIPA 1JLQA 5LY3A 4KH4A 4A2AA 2AA4A 4DG1A 3VPZA 3J7ZO 3AVKA 1IKYA 3AARA 5AQZA 4FLXA 4FJMA 3ULEA 4FJ5A 3TU5A 4JK7A 3EKUA 3WEEA 4KKOA 4NXMK 1W2BM 4KREA 3AGRA 1J6ZA 4E89A 2FXUA 4H4OA 4F3OA 4F9OA 1VQ4N 3IAYA 1DGKN 4O0IA 2HW3A 1QQOA 5C15A 4BE1A 4DS4A 1MWMA 3O4NA 4I9QA 3DRRA 4K41A 3FZMA 4DFMA 4E1MA 4NXNK 4M42A 4B3OA 3CCEN 3V81A 1MU2A 5JS1A 1WNSA 3DMJA 2EHGA 4FXDA 3THWA 3ISNC 4LSLA 3KD5E 2VG5A 4CZLA 3NE6A 1S1UA 5KI6A 4JV5K 2GBZA 1QZ5A 4BY9C 4OLAA 1T44A 5HRRA 1VQLN 2F4VK 1A5XA 4KRFA 3MCPA 4WE1A 3VQ5A 3RTVA 1HRHA 4XEIA 3LALA 5BRHA 1TKXA 5KQ8A 1JL2A 3P1GA 4B9NA 5FPMA 3VQBA 1KFSA 5I42A 1BWFO 3RRHA 3CFOA 3H1VX 3EO3A 3AAPA 4LF4K 4KHYA 1EO1A 3T69A 5AQNA 4O5FA 2PYJA 4M3ZA 1WSHA 3AVAA 4CJRA 1D8YA 3ID6A 3HJFA 3OS0A 3AO5A 5DK5A 1A5VA 4GVMA 5AQKA 4DTNA 3H3OB 3WNEA 4DSIA 2IGIA 5BPNA 3G6EN 1J9AA 1X1PA 4BRKA 4ILGB 4BRNA 4I6MA 1ESVA 2HMIA 3ZLJA 4FJXA 1QHAA 4OGEA 4H0VB 4ISFA 4LC9B 3CHWA 2YNHA 3ZSOA 4Z4FA 2HHUA 2ZD1A 1WUAA 3PV8A 4CEEA 1HYVA 1SKWA 4BRAA 3CXCM 3SQ2A 1TKDA 4NLBA 1M90O 4FJJA 3RRGA 4DQIA 1IG8A 5LMUK 5SWMA 1S9GA 2D0AA 4M41A 4CJLA 4JRQA 5H1SQ 4JKGA 1XHXA 2ZJPL 3CCVN 2WFBA 5J2QA 3LP1A 3SQ1A 4OPAA 1RTIA 4LF7K 3L4QA 4J8FA 1W7AA 1KXPA 4RW6A 4LF5K 2YHXA 2LSNA 4FW1A 4V19S 1X9SA 2P9NA 3AA3A 5AQXA 1W0HA 1ZBFA 4CEFA 1HNZK 3NH0A 1T05A 4CJQA 2YNFA 2EWSA 1TAQA 2BH1A 5T7BA 4FCYA 3I0RA 4CD1A 3GE1A 3A2FA 1HJOA 4CHYA 3BDPA 3MWPA 3KWGA 4DR5K 1IBMK 3DOKA 3DLKA 3L2VA 2P9SA 5AZIB 4OLBA 4M63C 1RBUA 1NK9A 3CJ9A 3A5OC 1EWQA 2P51A 3ZETA 3NAEA 3NVKA 1O13A 4KI6A 3AA2A 3AVCA 1HNVA 2XO7A 5AJ3K 4MLHA 5AQSA 3J7AP 3V1RA 3SQ0A 3QBXA 3CPEA 3SBGA 1UA0A 3ENOA 2JWLA 1OVYA 1QVFM 3VEVA 3DLHA 4DTJA 4JK8A 4ID5A 3ALYA 4JNEA 3FFKB 1NGFA 4EIAA 3QEXA 4IBNA 2UYTA 3VOVA 4FYDA 3MCAB 3C7NA 4EFHA 3OYMA 1GLFO 1NBWA 3M8PA 4A2BA 2P9UB 4FPAA 4E3SA 3O4WA 4RW4A 4YOUA 4H5NA 1VRTA 1T03A 3VQAA 5J2NA 2OZSA 4JKBA 2HBLA 1TKTA 4C8LA 2CH5A 1S1TA 1DTQA 4LFBK 1HMVA 1SUQA 3D2FA 3KWIA 4JYAK 5AZJB 2IAJA 3N4PA 4M3RA 3MX2A 1J5OA 2A42A 2VWBA 3DYAA 3MEEA 4DKWA 4F3TA 3QO9A 4CF2A 3WXMB 2BUPA 4CIFA 2G8HA 4RW9A 1U2VA 3VQ4A 4JAXA 5AQFA 4CZHA 1I39A 3SPZA 5CE3A 5AQPA 4R79A 2X74A 3FE1A 4C1NK 3K9KA 3CQYA 1C0MA 2JLEA 3O08A 4CF0A 3OS2A 4H4MA 1TUYA 2P5OA 4CGJA 4IFEA 1HNWK 4OKJA 4EAHD 4J2AA 2KZMA 4B1XB 2DY4A 3HP6A 4DWIA 1JXEA 3HXMA 4H03B 1F21A 2PZSA 1JKHA 2QWMA 2W42A 3PX4A 2HBKA 1C6VA 4KAZA 3SAFA 2O4GA 3UKUA 2IVPA 3THXA 1SL2A 1NK6A 3LDNA 5B8HA 2PYLA 5BPMA 3ATVA 4CGDA 5AR0A 2NRTA 4DQ8A 2FBVA 3O9QA 3TABA 5J2PA 3N4QA 4WF9L 1N5YA 3RSEA 4CVNE 1TYQA 2YJFA 4RTFD 4YOXA 4W5QA 1QSYA 1RT3A 1KSPA 1EETA 4JI4K 4DF4A 1BIUA 2JWKA 4DV2K 2O8DA 2QW9A 3QFUA 3LDLA 3FZLA 3VQ9A 1NWKA 2V52B 2OPPA 4H0TB 2RF2A 4CJ5A 3FZFA 2BE2A 1ZC6A 4KFBA 4WQ4A 5KGXA 3TAPA 5ELZA 3A5MC 4DQQA 3ZSRA 3R9PA 1B92A 3AO2A 1LW0A 3EEQA 3VQQA 3K5NA 2HHSA 5DMRA 3V1OA 1NKEA 1BHLA 4JI0K 2UU9K 4CZMA 4FJLA 1NGAA 5KGWA 4B8AB 3QETA 2HVHA 4LD0A 4B9VA 5FRMA 3PO5A 4E7IA 3V4IA 3CJCA 4JKFA 1WSEA 3NF6A 1EX4A 1S1WA 3HTVA 1NGIA 2WTUA 4FK2A 1KAYA 3CCLN 1NGCA 1R0AA 4BVPA 5GIPA 4IJAA 3WQUA 4B1YB 1HNIA 4A61A 4FWPA 3TR8A 3VQEA 4FLZA 2GWKA 4G1QA 4FJGA 1NMDA 4KHWA 1MA9B 4JI1K 3DOLA 2WBNA 2IIRA 2YI1A 4YOYA 4FZZA 2VYPA 2GEMA 1T6CA 3DLLL 3L3UA 1IV0A 5FLXO 2VQEK 1K8AO 4DR6K 1RILA 4CFDA 2HF4A 4BWMA 3ZT2A 4BGBA 2F96A 1RGIA 2IVOA 3L4IA 1QSSA 2KFZA 3FLCO 4CJ3A 1S6PA 3SK3A 3NFAA 2CH6A 1LV5A 1KAXA 3A0IX 3PUFA 1YTUA 3W3DA 4KBOA 3TARA 1OH8A 4CHZA 2BGGA 2IS3A 3CCJN 5AQOA 2GELA 1EP4A 2QM1A 2O8FB 3F5TA 4BDZA 4JK9A 3NVMA 4CJUA 3V9XA 1ZBIA 2P9LB 1ILYA 1E4GT 3B6OA 3CETA 2F9WA 4BC3A 3KIOA 5SZTA 1K73O 2KTQA 3D45A 3FFIA 3ULDA 1GLBG 4EZ9A 1YTAA 2FF3B 1C0UA 2NRRA 4FOIA 5AQRA 3SLCA 3P38A 4DSFA 3DXKB 4C8MA 5LMNK 3E1YA 4DTOA 1LCUA 4KB0A 1ZBSA 3CCSN 2WOMA 4EHUA 1BA0A 3NGYA 2KHOA 4BGAA 2UXDK 4ISGA 3DXMA 4OKEA 1R59O 3EN9A 2UUBK 2QKKA 4IDKA 4A59A 1RBVA 3VQPA 3E66A 2GUIA 4JKAA 3ZT3A 3VN5A 3A8YA 4DU1A 2P9PA 3PIOL 4MO4A 3U8XA 1VQKN 1LWEA 3JSMA 3PY8A 2ASOA 3AY9A 1WLJA 2WONA 5HRSA 3EE8A 3DAWA 4DFPA 5FPEA 5DM6L 2BTFA 3GL1A 3TI0A 3K58A 2P9KA 3OYEA 1L3VA 3DLGA 4GKJK 1IBLK 1SV5A 3J80O 3DRSA 5KRSA 4KHUA 3BUZB 5M1NA 3VQCA 4L8RB 4CZJA 1JLBA 1TL3A 5BN8A 4BC2A 3SNNA 4L3QA 5F2RA 4BROA 4CEDA 3LM9A 4I2PA 3HI0A 4FLTA 1RTDA 2FLOA 2FBYA 3TTDA 4ZTJA 4W5TA 3SZ2A 1QS4A 3OBYA 4XH4A 3G4SN 3MN5A 3SPYA 1XQSC 5AQIA 4FZXC 2FBTA 3ZX3A 4MDAA 5CZ2A 4FWRA 3LDPA 1O1WA 5JICA 3NGZA 3LL3A 1WSFA 3MXJA 4KB1A 3G10A 2ZJQL 1C1AA 4DV6K 4QAGA 4BQLA 4CJSA 2RKIA 4CZIA 1B9FA 1JLGA 1HYSA 4DTRA 1VSDA 2GWJA 4B1VA 2NNWA 2OTJN 1KQSM 3Q7CA 1HUXA 3THYB 4DV4K 2DFHA 2O8CA 3D6RA 3CC4N 4EP4A 5HROA 4IDHA 3OTOK 1HPMA 3AVIA 5HLFA 3AA4A 4DB3A 4FLYA 1Z26A 1BUPA 2QK9A 5JVHL 4CIGA 1Q7YO 2NRHA 4GV6A 4TSXA 2Q0UA 1FJGK 2E5LK 4NLCA 5BN9A 3P5JA 3DI6A 2X78A 5BRFA 3F9KA 1HKCA 4Y0WA 4AHRA 3P4IA 1RT1A 5EY4A 2XY5A 1HNXK 4BR2A 3VGLA 3HT3A 1X3NA 3O3GA 3PIPL 3MK6A 1HX1A 2O8BB 2ITMA 1NK5A 2I5JA 2B4JA 3I55N 4DF8A 5I9EB 3RR8A 2YJEA 4RCHA 3MECA 4M45A 1S1VA 3FZHA 4CEBA 1D4XA 1Q8IA 3PLAA 4W5OA 3AAQA 2HB5A 1ATNA 5AQGA 1M1KO 3P39A 4B9LA 4Z4HA 3L3VA 3BZCA 3ULEB 3ZSVA 3BP8A 3U9ZA 3K5LA 3C6UA 1CLQA 4BE0A 1NKBA 1XWLA 4BR4A 4F2SA 2NRZA 1ASWA 1J5EK 4M7XA 1YVUA 1N6QA 4BRGA 2YHAA 4PUOA 4FWKA 3QIOA 4FJ7A 1HYZA 1K9MO 1WB9A 4JN4A 1Q81O 4KPYA 4WCEL 4DU3A 1ZBUA 3ZX0A 1T8EA 3MWTA 4CECA 3PO4A 4CGGA 3THWB 2E2NA 4N56A 5HP1A 2G8KA 2Y1JA 4ILHA 3WXLA 4QOZB 4KH6A 5C42A 1FW6A 1TK5A 4DV1K 2QA4N 3RMAA 2WUSA 1YJ9N 1Q82O 4BG9A 3O1WA 1RDDA 2QWOA 3MXMA 4FWNA 1VSHA 4PA1A 2D1KA 3KHYA 3ZSWA 4AF1A 4C1NI 2GV9A 4DUZK 4DR4K 3AO4A 3KLFA 3CG7A 3THVA 3TTFA 4M3UA 3OVNA 4IOXA 3VQ7A 1DKGD 5M1OA 3OYIA 4WFAL 3C6HA 3CJ1A 3H45C 4OGCA 1LWFA 3OA9A 3H08A 4ZTFA 3SUPA 2W41A 3NGIA 5AZIA 3V9ZA 3L2UA 2RN2A 3M8QA 1RBSA 4AHSA 4FVUA 4IKFA 3D2EA 3KLHA 5M1PA 3U3YA 2XY6A 4C23A 2O8EA 4I6MB 3SJHA 3UKRA 3CC7N 1QVGM 4CJEA 1RFQA 4FO0A 4YOVA 1Y64A 4E19A 2VG7A 4JLHA 3B8AX 3RMBA 4DR1K 1TVRA 1BA1A 2E1YA 3AVGA 2Z1HA 4FLWA 4J2DA 4CERA 2PAVA 4DMNA 1SQKA 3AVMA 4RWTA 3Q7BA 3JXUA 1UA1A 4JKGB 3IS9A 4O8UA 1SL1A 3NH2A 4OJRA 4HTUA 3ENBA 1VQPN 2E88A 1RT7A 3VA0A 2P9UA 3T3FA 3NBPA 4BRCA 3ZSXA 4XH1A 1V4TA 5JLFA 3BY5A 4C8NA 4E7HA 2D0BA 3M3ZA 3VQ6A 2P9NB 1ZBHA 5GINA 1XI1A 2YHBA 4PKIA 4HUGA 3OJSA 4K0KK 4O8KA 3QICA 1TAUA 4CBUA 4LF6K 5AZJA 3O1BA 2KLAA 3DM2A 4AM6A 3CI5A 3LDQA 1VQ8N 4CEQA 3QERA 4AM7A 3SV4A 4CJWA 4BVOA 2P9SB 3AVHA 3CD6N 4QS7A 3MEDA 1S1XA 4X62K 4FJKA 4QS8A 2KZZA 4FW2A 1E3MA 1WAJA 1NGBA 2NRWA 3O3FA 3HYFA 4M3WA 4XH5A 4JD2B 1NGEA 2RPIA 1KVAA 4OPJA 3VF4A 5M1QA 4DSEA 1RNHA 2P9IA 4U67L 4GV3A 4AQYK 3C6AA 3OW2M 1JLAA 3T7ZA 3V9WA 3CQ8A 3ZEUA 4Z94A 1RTHA 2D5RA 4MQ3A 4DR3K 1X9WA 1J54A 4Z0UA 5F0XA 3CFRA 4BE2A 2ZE2A 1HKGA 3SCXA 3DLEA 3SUQA 3QLHA 3U6FA 4X64K 2BDPA 4IEEA 3ZCMA 1OH7A 3O9RA 4F8RA 3UB5A 4JI3K 4CESA 3C7NB 2HHTA 5AQTA 2HBJA 1S5JA 3ZSYA 4E1JA 2NZTA 4H0OA 4CF9A 5HOOA 1U47A 1U04A 3S41A 3TPQA 4MO5A 2ZM6K 2E2OA 3KK3A 3BZKA 1L3UA 3WQTA 4IEIA 4CEOA 3MXIA 1OVQA 5CYQA 3A5LC 3C95A 3VEWA 1CZAN 2VWKA 4QS9A 5GAGP 4DR2K 3D2FB 2QWRA 1I3AA 1BISA 3O5BA 1YT3A 2X6SA 3U3GA 4C8OA 3TSPA 1LAVA 4MLEA 3CIPA 3R6MA 3S3OA 1XUPO 1VQ5N 3VERA 1BGXT 1IKVA 5HRPA 3S3NA 4HCCA 3HSCA 4BRIA 4Z4CA 3D0PA 3CF5L 1IH7A 4YORA 4FOEA 2F8SA 1ITGA 4E7LA 1B9DA 1Q18A 1EWRA 4IJNA 1N8RO 3QFPA 1RDCA 4DV0K 1JCFA 1YF5L 3VTHA 3AVJA 2JGUA 4X65K 1KLNA 1CZBA 3LANA 3NDKA 3AVLA 3HRGA 1NJWA 1LWCA 3KJVA 3S9HA 3HPGA 3MX5A 3OYFA 4CGFA 2IC3A 3H46O 4E1NA 4JI8K 2Z1GA 1BL3A 4JI5K 4IG0A 3NCIA 1RT5A 4B9QA 2NUBA 3AO1A 3LP3A 1TUUA 1VAZA 3UKUB 3THXB 3TANA 3P31A 3LWMA 3IUCA 2OCEA 3SMSA 3KTQA 1GOAA 2W6LA 1QHTA 2ATQA 3RSEB 2ZF5O 2P1JA 4N47A 4B08A 3OYLA 4LFCK 3CMAN 4CFBA 3BEXA 3J8AA 5IWAK 2UUCK 3UE5A 4N76A 3GG4A 4HCBA 1NGGA 1XNQK 1JLCA 4CZFA 2PBDA 1HQEA 3HOSA 1ZBLA 3NHGA 3HOTA 2IOCA 2DFEA 4DSJA 3OYNA 4B9MA 2HNYA 1NLVA 5E84A 4JS5A 1D9DA 2A40A 3OS1A 3WT0A 3CCMN 1K8KB 3K59A 1YAGA 4ICLA 2R7YA 1VQMN 1HJRA 4FVMA 3LPUA 2Q3SA 4CFAA 1ASUA 3A5NC 3GBTA 1Y97A 1IO2A 2Q31A 1NNEA 4DLGA 2XRIA 5BPLA 5E41A 2NRXA 1D9FA 4WQ5C 4BRLA 2V7YA 2XHBA 1KAZA 4X66K 3MAQA 2Q0RA 4CW7B 1NM1A 4KO0A 1SS6A 4FJNA 3DXKA 4K42A 3AO3A 4Y1CA 4CI6A 1SZ2A 5TKWA 3B6PA 4Y1DA 5F1XA 1QTMA 3ITHA 1FK9A 3K9JA 4B9TA 1ATRA 4FJIA 3C6TA 4PY5A 1RBTA 3QBWA 4IFVA 2QI2A 2ZGZA 1OH5A 2WC9A 2E20A 2O4IA 1BU6O 4BR9A 4FM2A 1X9MA 4KTZA 5FPNA 3OBWA 3J7YP 4DS5A 4CBXA 2F8TA 4ELUA 3C65A 1RDAA 1YI2N 4B8CA 3HM8A 3HSTB 4QCLA 4CGIA 1XMQK 2OTLN 2D0OA 1DT9A 4EP5A 3LDSA 5AQLA 4NYNA 1JCEA 3EZWA 3H3NO 4JS4A 2E6LA 2QWNA 1RCHA 2QWPA 4M3TA 3WXKA 4BR5A 2OPQA 3JS6A 1Q9YA 5JS2A 5AQMA 4GNIA 3DLBA 1FKPA 2UXCK 4HUFA 2KFNA 3QB0A 2G8FA 1IBKK 2E6MA 4PHTX 4DQSA 3BF1A 4W5RA 3TWHA 2YHYA 4UQGA 3VF6A 3ID8A 2ZQBA 3KVGA 1YXQA 3EYZA 5C12A 3E9LA 4FK0A 1BI4B 5KRTA 5CY4A 4CJ4A 4DQRA 4DFKA 1QQMA 2E4LA 3I8DA 2QXLA 3VGMA 1VSKA 2GX9A 2YKNA 1BG3A 2D0CA 4DV7K 4CJFA 1UAXA 4H0YB 4M3YA 4CIEA 1XMOK 3VEOA 4G9ZA 4H0PA 4BDPA 1IKXA 2HHVA 1HKBA 3VEYA 4DTSA 1WOQA 3M8RA 4FWMA 3T1YK 5CZ1A 1NJIO 4KHPK 2QEXN 2P9PB 3CCUN 4J2BA 4MDBA 4FK4A 4IO8A 4R5PA 5FRNA 4AHCA 1NOYA 2A1RA 4FSVA 1FXXA 3KLIA 2Y1IA 4BC5A 5GIOA 2NLXA 3KLGA 1T3VA 2OZMA 1XC3A 1DEJA 3I56N 1WBBA 3KK1A 4IFYA 5AQYA 1CZ9A 5K14A 4CCHA 5CR4A 1U6ZA 4IOAL 2YNGA 1GLAG 4H8KA 3VETA 1Z25A 1VSJA 3VESA 4FLVA 4IXCA 1WSGA 5JLHA 4H5WA 2QKBA 4YDUC 3E9PA 1FKOA 2ZWHA 3EE9A 1HPZA 3OYHA 3PX0A 5AQUA 4CE9A 4YDUA 3O9SA 2UXBK 3E01A 4BDYA 2RE2A 2O8BA 1KVCA 4I7FA 4JHDB 5FROA 3GOIA 1Q9XA 4C8KA 2VQFK 3FR0A 4KHSA 1VSFA 3WNFA 3S3MA 4AHVA 2NRVA 3WXJA 4JI6K 4DCHA 4RW7A 1KCFA 3G25A 3SAGA 3HPHA 3KKRA 1WN7A 3OYCA 3TSQA 5HBMA 4DV5K 2FC0A 3O6WA 4DTMA 5KQDA 1NKCA 3JAMO 2HHQA 4DSKA 1C1CA 4YOTA 3FGUA 1RBRA 3GDQA 4M7YA 3LM2A 1YHQN 3HPOA 4JEPA 1W97L 4CBWA 3OYJA 4DV3K 1Q86O 1YUWA 5FDLA 2O8CB 5A2QO 3TAQA 2OPRA 2G8UA 4E7KA 3QEPA 5GAHP 3RMCA 1DTTA 1H1VA 5EX5A 3DLRA 4BRQA 2YKMA 3VQ8A 4DUYK 1V4SA 3LDOA 1GLCG 4YY3K 3WEEB 3NMUA 2FBXA 4HVJA 4Q0BA 2Z1IA 1L5UA 3CFPA 1I94K 2PY5A 4WYBA 4U7BA 3CJ7A 5JVGL 1VSIA 3LAMA 2E2QA 1QQNA 4HUEA 5EXWA 1HR0K 3RR7A 5BREA 1BQNA 1N36K 2KKZA 4LSNA 4CZEA 4O55A 3SI6A 1SKSA 5CHIA 4IOCL 1OH6A 4DTUA 3BF3A 1WSJA 3SUNA 2QXFA 3O4QA 4CJ7A 4OPKA 3QESA 3HL8A 3VMFB 5ADXA 3VGKA 1CXUA 4ID1A 2IDOA 5AFUA 2VCPA 3IDHA 3LZJA 4O5BA 1RTJA 5EU7A 4FJ8A 2VWJA 3WXIA 5EOYA 4FL9A 3SV3A 3I33A 1VQ6N 1EXQA 5EVZA 2QWQA 3V9UA 3TAMA 1JJ2M 5C2DA 1X3MA 1IG9A 3WUHA 4BRHA 5BR9A 3HBTA 2G8IA 3R3LA 3L2RA 1YJNN 4HTLA 4KH5A 3OYAA 3WNHA 2YNIA 4ILJA 2BANA 4B1UB 3W0LA 3DRPA 4B9SA 1BO5O 3LP2A 1BCOA 3LZIA 3CC2N 4LH5A 3HZ6A 4CHPA 3H1QA 3D7EO 4A57A 3VQDA 4M3XA 2FSJA 3L2QA 1NOZA 1GLLO 3C0BA 3KK2A 4EHTA 4PL7A 3I0SA 3KLEA 1L3TA 2HNZA 4CEAA 3SQ4A 3ENHA 5LL6Z 4E7JA 5GAEP 3CQXA 3T19A 1VSMA 3T1AA 4GKKK 3AA5X 2OANA 3QNOA 4OPHA 1NK4A 2HNDA 3KZBA 4KTWA 2F9TA 4KV8A 4FM1A 2KW4A 1JCGA 1ASVA 4PKHA 3OJUA 1LAWA 3OYBA 3M1FA 3IFRA 2B6AA 2F7TA 3D2EB 3IG1A 2O8EB 1TV6A 4B1WB 3UKRB 4CJVA 3F73A 1W9HA 3LWLA 4JD2A 3HM9A
chains in the Genus database with same CATH topology
1LWEA 3JSMA 3NE6A 1S1UA 3PY8A 3C94A 5KI6A 1WLJA 1VK0A 3OYGA 2WONA 5HRSA 4GW6A 3LWMA 3NH1A 2GBZA 4DTPA 4OLAA 1U4BA 5HRRA 4DFPA 3KTQA 1A5XA 4KRFA 3TI0A 1GOAA 4WE1A 3VQ5A 3K58A 3RWUA 3OYEA 3RTVA 1HRHA 3DLGA 1L3VA 4ELTA 3LALA 4OVLA 1QHTA 1SV5A 1TKXA 2ATQA 3DRSA 3TAEA 2ITGA 2P1JA 4N47A 1JL2A 5KRSA 1K6YA 3PX6A 4B08A 3P1GA 4KHUA 2ETJA 3OYLA 4B9NA 3VQBA 4O0JA 3VQCA 4L8RB 4CFBA 1JLBA 5C25A 1KFSA 1TL3A 5I42A 3SNNA 3V1QA 3RRHA 1NJXA 3QINA 3P83D 4CEDA 3CFOA 4N76A 4I2PA 4HCBA 1TKZA 1J53A 1JLCA 4FLTA 1NJYA 1L3SA 4K8XA 1RTDA 4KHYA 1HQEA 2FBYA 4DU4A 4CF8A 4CK1A 4ZTJA 2PYJA 4W5TA 3NHGA 1ZBLA 3SZ2A 3ASMA 4DFJA 1WSHA 4M3ZA 1BCMA 1QS4A 2DFEA 2IOCA 3AVAA 3CM6A 4CJRA 1D8YA 3OS0A 3OYNA 4DSJA 1XC9A 3AO5A 5DK5A 1A5VA 4GVMA 4RW8A 4DTNA 4B9MA 2HNYA 4JS5A 1D9DA 5C24A 3WNEA 3OS1A 4DSIA 2IGIA 4FJHA 1J9AA 1KFDA 1X1PA 3KKSA 3K59A 2DTUA 4ICLA 2R7YA 3SPYA 2HMIA 3HK2A 4FJXA 4AH9A 1HJRA 2FBTA 3LPUA 4FVMA 2Q3SA 4OGEA 4CFAA 5CZ2A 1SKRA 1ASUA 1O1WA 1Y97A 4OKKA 1IO2A 3NGZA 3K2PA 1WSFA 2YNHA 3MXJA 3ZSOA 1T7PA 4Z4FA 4DLGA 2ZD1A 2XRIA 3PV8A 4KB1A 4CEEA 2HHUA 1HYVA 3G10A 1SKWA 1HQUA 4B9UA 4CK3A 1TK8A 4HHTA 3SQ2A 1TKDA 4N5SA 5E41A 4FJJA 1C1AA 3RRGA 4DQIA 1D9FA 4QAGA 2XHBA 1A5WA 5SWMA 4CJSA 2RKIA 4XIUA 1S9GA 4O4GA 3MAQA 1NK0A 2D0AA 4M41A 1B9FA 1JLGA 4CJLA 3TAGA 1HYSA 1NJZA 4JRQA 1VSDA 4KO0A 4DTRA 4FJNA 1XHXA 5J2QA 3AO3A 3LP1A 4Y1CA 3SQ1A 2DFHA 3B6PA 1RTIA 4Y1DA 1QTMA 1D5AA 3ITHA 1FK9A 1C0TA 4B9TA 4FJIA 3C6TA 4PY5A 3QNNA 1RBTA 4EP4A 4NCBA 4RW6A 4Z4EA 4IFVA 4Z4GA 2LSNA 4DSLA 4FW1A 5HROA 3AVFA 2O4IA 5HLFA 3AVIA 3AA4A 1X9SA 4FLYA 1Z26A 3AA3A 4FM2A 1X9MA 2QK9A 3WNGA 3HVRA 4CIGA 4KHNA 4KTZA 4CFCA 1W0HA 1ZBFA 4DS5A 1CXQA 4TSXA 4CEFA 2F8TA 4ELUA 3NH0A 1RDAA 1T05A 4CJQA 1UWBA 2YNFA 2XY7A 1TAQA 1JLFA 4MFBA 4B8CA 5T7BA 4FCYA 3I0RA 3HSTB 3A2FA 3P5JA 4CGIA 3DI6A 2X78A 4QCLA 4CHYA 3BDPA 3F9KA 4EP5A 3DOKA 3DLKA 3LDSA 3L2VA 4KI4A 4AHRA 1JLEA 1JL1A 4NYNA 1RT1A 4OLBA 2XY5A 4JS4A 3HT3A 2E6LA 1RBUA 3O3GA 1SL0A 1NK9A 1RCHA 4AHTA 1NK5A 4AILC 4M3TA 1G15A 4FM0A 4J2EA 2P51A 2I5JA 2OPQA 2B4JA 3NAEA 1TK0A 1Q9YA 5JS2A 3DLBA 1NK7A 1FKPA 4KI6A 3AA2A 3AVCA 4HUFA 1HNVA 4DF8A 4Z4IA 2XO7A 2KFNA 2X6NA 2G8FA 3RR8A 2E6MA 3MECA 2DFFA 4M45A 3V1RA 1S1VA 1QSLA 4DQSA 3SQ0A 4W5RA 4CGHA 4UQGA 3TWHA 4CEBA 1UA0A 1Q8IA 1KRPA 2ZQBA 3EYZA 4W5OA 3DLHA 2HB5A 1WSIA 4DTJA 2EX3A 4FK0A 2HHXA 1BI4B 4ID5A 5KRTA 3ALYA 5CY4A 4CJ4A 4DQRA 4B9LA 4Z4HA 3L3VA 4DFKA 1U49A 3QEXA 3ZSVA 3K5LA 2E4LA 3I8DA 3C6UA 4IBNA 4BE0A 1CLQA 4FYDA 1NKBA 1XWLA 3VA3A 4ZHRA 4F2SA 1VSKA 1GOCA 1ASWA 2YKNA 3OYMA 4JRPA 1U45A 2D0CA 1YVUA 3M8PA 4CJFA 1UAXA 4CEZA 4I9LA 1N6QA 4E3SA 4ELVA 1S6QA 4RW4A 2YHAA 4M3YA 4CIEA 3V9SA 1VRTA 1T03A 4PUOA 3VQAA 5J2NA 4BDPA 5CYMA 3QIOA 4FJ7A 1HYZA 2AJQA 1IKXA 1BQMA 4KPYA 3HVTA 2HHVA 2A1SA 1EKEA 1RT2A 3ZSZA 2OZSA 3EY1A 4DU3A 3O3HA 1ZBUA 1TKTA 4DTSA 4C8LA 1T8EA 3M8RA 4FZXC 1S1TA 3QEVA 1DTQA 5CZ1A 4CJTA 1HMVA 1SUQA 4CECA 1RDBA 3PO4A 4CGGA 4EZ6A 4N56A 5HP1A 2IAJA 2G8KA 2Y1JA 4J2BA 4FK4A 4QOZB 4M3RA 4R5PA 3HO1A 5C42A 1TK5A 5FRNA 4AHCA 1NOYA 1TGOA 2A1RA 1J5OA 1FXXA 3RMAA 3KLIA 2Y1IA 3DYAA 3MEEA 4F3TA 1RDDA 3QO9A 3MXMA 4CF2A 3KLGA 4CJKA 2OZMA 3CM5A 1VSHA 4PA1A 3ZSWA 3KK1A 4IFYA 1KLMA 4O44A 2GV9A 4CIFA 5K14A 1CZ9A 4DLEA 3IRXA 2G8HA 3AO4A 4CHNA 3KLFA 2G8WA 4RW9A 3K5MA 3CG7A 4CCHA 3VQ4A 3THVA 2YNGA 1WAFA 4H8KA 4M3UA 1Z25A 3OVNA 1VSJA 3VQ7A 1I39A 4FLVA 3JYTA 3SPZA 2DY4A 3NF7A 2OPSA 1WSGA 2X74A 3OYIA 2QKBA 3LAKA 2XY8A 1JXBA 4CF0A 1C0MA 1FKOA 2JLEA 4CJPA 3OS2A 4W5NA 4H4MA 4OGCA 4KHQA 1LWFA 3EZ5A 5J1EA 1HPZA 2P5OA 1BIZA 3H08A 4CGJA 4Q5VA 3OYHA 4ZTFA 3PX0A 3V9ZA 3NGIA 3K57A 1IKWA 3SUPA 3AV9A 3UIQA 4CE9A 3L2UA 4LY7A 2RN2A 3M8QA 5D3GA 4OKJA 1RBSA 3E01A 1VSEA 4AHSA 4BDYA 4GMJB 4CHQA 4J2AA 1KVCA 2KZMA 4IKFA 3KLHA 3HP6A 4I7FA 3ZSQA 3U3YA 4CF1A 2XY6A 4DWIA 4K8ZA 1JXEA 3HXMA 5FROA 1F21A 4FLUA 1Q9XA 2B5JA 2PZSA 2P5GA 4C8KA 3OYDA 2HHWA 3ZT0A 4I2QA 1JKHA 3PX4A 1VSFA 2W42A 4KHSA 4KAZA 1C6VA 3WNFA 4CJEA 4AHVA 3SYZA 3S3MA 2O4GA 1SL2A 3L8BA 4RW7A 1KCFA 1NK6A 4RG8A 4E19A 2VG7A 4JLHA 2PYLA 3RMBA 1TVRA 3SJJA 4BACA 3HPHA 3KKRA 1WN7A 5I3UA 4CGDA 3AVGA 3OYCA 2Z1HA 4FLWA 4J2DA 4FJ9A 3V6DA 4CERA 5HBMA 1BI4A 2FBVA 4DMNA 3QEWA 3TABA 5HRNA 5J2PA 3AVMA 2FC0A 3L2WA 4DTMA 1NKCA 1N5YA 1UA1A 3KD1E 2HHQA 4DSKA 3IS9A 1C1CA 3K5OA 3NH2A 1SL1A 1RBRA 1RT6A 4OJRA 4HTUA 4W5QA 3HPOA 1QSYA 4CK2A 1RT3A 1KSPA 3OYJA 1EETA 3G0ZA 5J2MA 1UOCA 1RT7A 5FDLA 3VA0A 1REVA 2OPRA 4AHUA 1BIUA 4DF4A 3TAQA 4E7KA 3QEPA 3T3FA 2G8UA 4NCAA 3NBPA 3VQ9A 2Z1JA 2OA8A 3RMCA 1U48A 3ZSXA 1DTTA 3TAFA 2OPPA 4C8NA 2VG6A 2D0BA 3DLRA 4E7HA 2RF2A 4CJ5A 3VQ6A 1VSLA 1ZBHA 1XI1A 2YKMA 3VQ8A 2YHBA 4CHOA 1TL1A 2BE2A 4HUGA 3OJSA 1KVBA 3MEGA 4KFBA 5KTQA 4LH4A 1TAUA 5KGXA 3TAPA 2FBXA 4HVJA 4Q0BA 2Z1IA 1L5UA 3CFPA 3ZT1A 3DM2A 2PY5A 4DQQA 1RT4A 3ZSRA 4CEQA 3QERA 1B92A 4CJWA 3AO2A 1LW0A 1VSIA 3LAMA 3VQQA 3K5NA 3SV4A 2HHSA 5DMRA 3V1OA 1C1BA 3AVHA 1NKEA 1BHLA 4FJLA 4HUEA 3MEDA 5KGWA 4B8AB 3RR7A 3QETA 2HVHA 4LD0A 4B9VA 5FRMA 1BQNA 1S1XA 3PO5A 4FJKA 4FZYA 4E7IA 3V4IA 2KZZA 4LSNA 1QQCA 4FW2A 3M8SA 1WSEA 3NF9A 3NF6A 3SUOA 4O55A 3SI6A 1SKSA 1EX4A 4YFUA 1WAJA 3OY9A 1S1WA 3CYMA 4FK2A 3O3FA 3HYFA 4M3WA 4DTUA 2RPIA 1KVAA 1WSJA 2QXFA 3O4QA 4OPJA 4OPKA 3QESA 1VRUA 3OYKA 3HL8A 3SUNA 1R0AA 4KTQA 4N41A 2HVIA 1HNIA 1CXUA 1RNHA 4ID1A 4NYFA 4DSEA 2IDOA 3AVBA 2G8VA 3HJFA 3LZJA 3V9WA 1JLAA 4O5BA 3TR8A 1RTJA 3CQ8A 5EU7A 3VQEA 4FLZA 4FJ8A 1RTHA 2VWJA 2D5RA 4MQ3A 1LW2A 4IG3A 1X9WA 4G1QA 1J54A 4FJGA 4PWDA 4Z0UA 1KTQA 3CFRA 3LP0A 4BE2A 3SV3A 4KHWA 1EXQA 2ZE2A 3V9UA 3SCXA 3DLEA 3DOLA 3TAMA 3QLHA 2KQ2A 3SUQA 1NK8A 3U6FA 4DQPA 2BDPA 3ZCMA 4F8RA 4FZZA 4CESA 1IG9A 4NCGA 2HHTA 4PQUA 3L3UA 3ZT4A 1S5JA 3ZSYA 3RMDA 2G8IA 4CF9A 1XHZA 3L2RA 2YV0X 3OYAA 1U47A 1GOBA 3WNHA 1RILA 2YNIA 2BANA 4CFDA 1U04A 4BWJA 4F4KA 3DRPA 4BWMA 3NF8A 3KK3A 3AVNA 3ZT2A 1L3UA 2F96A 3HP9A 1QSSA 4B9SA 2KFZA 4DTXA 3LP2A 4CEOA 4YNQA 3MXIA 1BCOA 4CJ3A 1S6PA 3NFAA 3LPTA 3LZIA 1S9EA 3BGRA 4LH5A 5CYQA 1LV5A 4CHPA 3C95A 3PUFA 4E0DA 2VWKA 1YTUA 1I3AA 1BISA 3VQDA 1YT3A 2X6SA 3U3GA 3TARA 4C8OA 4M3XA 4CHZA 2BGGA 1LAVA 2IS3A 3L2QA 1NOZA 1EP4A 3S3OA 3KK2A 4BDZA 3I0SA 4CJUA 3QEIA 1QE1A 3V9XA 1BGXT 2OYQA 4F2RA 1ZBIA 1IKVA 5HRPA 3S3NA 4HCCA 1ZYQA 3B6OA 3KLEA 2HNZA 1L3TA 4CEAA 3SQ4A 4Z4CA 3D0PA 3KIOA 5SZTA 1IH7A 1DLOA 3QIPA 4E7JA 1JLQA 3T19A 2KTQA 1VSMA 2F8SA 4DG1A 1ITGA 3D45A 3T1AA 3FFIA 4E7LA 3AVKA 1IKYA 1B9DA 4FLXA 4FJMA 3AA5X 3QNOA 3ULDA 4FJ5A 4EZ9A 1YTAA 1RDCA 1C0UA 4DSFA 1NK4A 4KKOA 2HNDA 3AVJA 4KREA 4C8MA 4KTWA 2JGUA 4DTOA 4E89A 4H4OA 4F3OA 4KB0A 2WOMA 4KV8A 4FM1A 2KW4A 1CZBA 3LANA 3NGYA 3NDKA 1KLNA 3AVLA 3IAYA 1ASVA 4O0IA 1NJWA 1LWCA 3KJVA 3S9HA 2HW3A 3HPGA 3OJUA 1LAWA 4OKEA 3OYBA 4BE1A 3OYFA 4DS4A 2B6AA 3O4NA 4CGFA 2IC3A 2QKKA 3DRRA 4I9QA 4IDKA 4DFMA 3IG1A 4E1NA 4E1MA 4M42A 1RBVA 2Z1GA 1BL3A 1TV6A 3VQPA 4IG0A 3NCIA 4B3OA 3V81A 1MU2A 4CJVA 3F73A 1WNSA 1W9HA 3DMJA 1RT5A 2GUIA 5JS1A 2NUBA 2EHGA 3ZT3A 3LWLA 3AO1A 4FXDA 3ISNC 4LSLA 3LP3A 3VN5A 3HM9A 4DU1A 3KD5E 3TANA 2VG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWE A;  3JSM A;  3NE6 A;  1S1U A;  3PY8 A;  3C94 A;  5KI6 A;  1WLJ A;  1VK0 A;  3OYG A;  2WON A;  5HRS A;  4GW6 A;  3LWM A;  3NH1 A;  2GBZ A;  4DTP A;  4OLA A;  1U4B A;  5HRR A;  4DFP A;  3KTQ A;  1A5X A;  4KRF A;  3TI0 A;  1GOA A;  4WE1 A;  3VQ5 A;  3K58 A;  3RWU A;  3OYE A;  3RTV A;  1HRH A;  3DLG A;  1L3V A;  4ELT A;  3LAL A;  4OVL A;  1QHT A;  1SV5 A;  1TKX A;  2ATQ A;  3DRS A;  3TAE A;  2ITG A;  2P1J A;  4N47 A;  1JL2 A;  5KRS A;  1K6Y A;  3PX6 A;  4B08 A;  3P1G A;  4KHU A;  2ETJ A;  3OYL A;  4B9N A;  3VQB A;  4O0J A;  3VQC A;  4L8R B;  4CFB A;  1JLB A;  5C25 A;  1KFS A;  1TL3 A;  5I42 A;  3SNN A;  3V1Q A;  3RRH A;  1NJX A;  3QIN A;  3P83 D;  4CED A;  3CFO A;  4N76 A;  4I2P A;  4HCB A;  1TKZ A;  1J53 A;  1JLC A;  4FLT A;  1NJY A;  1L3S A;  4K8X A;  1RTD A;  4KHY A;  1HQE A;  2FBY A;  4DU4 A;  4CF8 A;  4CK1 A;  4ZTJ A;  2PYJ A;  4W5T A;  3NHG A;  1ZBL A;  3SZ2 A;  3ASM A;  4DFJ A;  1WSH A;  4M3Z A;  1BCM A;  1QS4 A;  2DFE A;  2IOC A;  3AVA A;  3CM6 A;  4CJR A;  1D8Y A;  3OS0 A;  3OYN A;  4DSJ A;  1XC9 A;  3AO5 A;  5DK5 A;  1A5V A;  4GVM A;  4RW8 A;  4DTN A;  4B9M A;  2HNY A;  4JS5 A;  1D9D A;  5C24 A;  3WNE A;  3OS1 A;  4DSI A;  2IGI A;  4FJH A;  1J9A A;  1KFD A;  1X1P A;  3KKS A;  3K59 A;  2DTU A;  4ICL A;  2R7Y A;  3SPY A;  2HMI A;  3HK2 A;  4FJX A;  4AH9 A;  1HJR A;  2FBT A;  3LPU A;  4FVM A;  2Q3S A;  4OGE A;  4CFA A;  5CZ2 A;  1SKR A;  1ASU A;  1O1W A;  1Y97 A;  4OKK A;  1IO2 A;  3NGZ A;  3K2P A;  1WSF A;  2YNH A;  3MXJ A;  3ZSO A;  1T7P A;  4Z4F A;  4DLG A;  2ZD1 A;  2XRI A;  3PV8 A;  4KB1 A;  4CEE A;  2HHU A;  1HYV A;  3G10 A;  1SKW A;  1HQU A;  4B9U A;  4CK3 A;  1TK8 A;  4HHT A;  3SQ2 A;  1TKD A;  4N5S A;  5E41 A;  4FJJ A;  1C1A A;  3RRG A;  4DQI A;  1D9F A;  4QAG A;  2XHB A;  1A5W A;  5SWM A;  4CJS A;  2RKI A;  4XIU A;  1S9G A;  4O4G A;  3MAQ A;  1NK0 A;  2D0A A;  4M41 A;  1B9F A;  1JLG A;  4CJL A;  3TAG A;  1HYS A;  1NJZ A;  4JRQ A;  1VSD A;  4KO0 A;  4DTR A;  4FJN A;  1XHX A;  5J2Q A;  3AO3 A;  3LP1 A;  4Y1C A;  3SQ1 A;  2DFH A;  3B6P A;  1RTI A;  4Y1D A;  1QTM A;  1D5A A;  3ITH A;  1FK9 A;  1C0T A;  4B9T A;  4FJI A;  3C6T A;  4PY5 A;  3QNN A;  1RBT A;  4EP4 A;  4NCB A;  4RW6 A;  4Z4E A;  4IFV A;  4Z4G A;  2LSN A;  4DSL A;  4FW1 A;  5HRO A;  3AVF A;  2O4I A;  5HLF A;  3AVI A;  3AA4 A;  1X9S A;  4FLY A;  1Z26 A;  3AA3 A;  4FM2 A;  1X9M A;  2QK9 A;  3WNG A;  3HVR A;  4CIG A;  4KHN A;  4KTZ A;  4CFC A;  1W0H A;  1ZBF A;  4DS5 A;  1CXQ A;  4TSX A;  4CEF A;  2F8T A;  4ELU A;  3NH0 A;  1RDA A;  1T05 A;  4CJQ A;  1UWB A;  2YNF A;  2XY7 A;  1TAQ A;  1JLF A;  4MFB A;  4B8C A;  5T7B A;  4FCY A;  3I0R A;  3HST B;  3A2F A;  3P5J A;  4CGI A;  3DI6 A;  2X78 A;  4QCL A;  4CHY A;  3BDP A;  3F9K A;  4EP5 A;  3DOK A;  3DLK A;  3LDS A;  3L2V A;  4KI4 A;  4AHR A;  1JLE A;  1JL1 A;  4NYN A;  1RT1 A;  4OLB A;  2XY5 A;  4JS4 A;  3HT3 A;  2E6L A;  1RBU A;  3O3G A;  1SL0 A;  1NK9 A;  1RCH A;  4AHT A;  1NK5 A;  4AIL C;  4M3T A;  1G15 A;  4FM0 A;  4J2E A;  2P51 A;  2I5J A;  2OPQ A;  2B4J A;  3NAE A;  1TK0 A;  1Q9Y A;  5JS2 A;  3DLB A;  1NK7 A;  1FKP A;  4KI6 A;  3AA2 A;  3AVC A;  4HUF A;  1HNV A;  4DF8 A;  4Z4I A;  2XO7 A;  2KFN A;  2X6N A;  2G8F A;  3RR8 A;  2E6M A;  3MEC A;  2DFF A;  4M45 A;  3V1R A;  1S1V A;  1QSL A;  4DQS A;  3SQ0 A;  4W5R A;  4CGH A;  4UQG A;  3TWH A;  4CEB A;  1UA0 A;  1Q8I A;  1KRP A;  2ZQB A;  3EYZ A;  4W5O A;  3DLH A;  2HB5 A;  1WSI A;  4DTJ A;  2EX3 A;  4FK0 A;  2HHX A;  1BI4 B;  4ID5 A;  5KRT A;  3ALY A;  5CY4 A;  4CJ4 A;  4DQR A;  4B9L A;  4Z4H A;  3L3V A;  4DFK A;  1U49 A;  3QEX A;  3ZSV A;  3K5L A;  2E4L A;  3I8D A;  3C6U A;  4IBN A;  4BE0 A;  1CLQ A;  4FYD A;  1NKB A;  1XWL A;  3VA3 A;  4ZHR A;  4F2S A;  1VSK A;  1GOC A;  1ASW A;  2YKN A;  3OYM A;  4JRP A;  1U45 A;  2D0C A;  1YVU A;  3M8P A;  4CJF A;  1UAX A;  4CEZ A;  4I9L A;  1N6Q A;  4E3S A;  4ELV A;  1S6Q A;  4RW4 A;  2YHA A;  4M3Y A;  4CIE A;  3V9S A;  1VRT A;  1T03 A;  4PUO A;  3VQA A;  5J2N A;  4BDP A;  5CYM A;  3QIO A;  4FJ7 A;  1HYZ A;  2AJQ A;  1IKX A;  1BQM A;  4KPY A;  3HVT A;  2HHV A;  2A1S A;  1EKE A;  1RT2 A;  3ZSZ A;  2OZS A;  3EY1 A;  4DU3 A;  3O3H A;  1ZBU A;  1TKT A;  4DTS A;  4C8L A;  1T8E A;  3M8R A;  4FZX C;  1S1T A;  3QEV A;  1DTQ A;  5CZ1 A;  4CJT A;  1HMV A;  1SUQ A;  4CEC A;  1RDB A;  3PO4 A;  4CGG A;  4EZ6 A;  4N56 A;  5HP1 A;  2IAJ A;  2G8K A;  2Y1J A;  4J2B A;  4FK4 A;  4QOZ B;  4M3R A;  4R5P A;  3HO1 A;  5C42 A;  1TK5 A;  5FRN A;  4AHC A;  1NOY A;  1TGO A;  2A1R A;  1J5O A;  1FXX A;  3RMA A;  3KLI A;  2Y1I A;  3DYA A;  3MEE A;  4F3T A;  1RDD A;  3QO9 A;  3MXM A;  4CF2 A;  3KLG A;  4CJK A;  2OZM A;  3CM5 A;  1VSH A;  4PA1 A;  3ZSW A;  3KK1 A;  4IFY A;  1KLM A;  4O44 A;  2GV9 A;  4CIF A;  5K14 A;  1CZ9 A;  4DLE A;  3IRX A;  2G8H A;  3AO4 A;  4CHN A;  3KLF A;  2G8W A;  4RW9 A;  3K5M A;  3CG7 A;  4CCH A;  3VQ4 A;  3THV A;  2YNG A;  1WAF A;  4H8K A;  4M3U A;  1Z25 A;  3OVN A;  1VSJ A;  3VQ7 A;  1I39 A;  4FLV A;  3JYT A;  3SPZ A;  2DY4 A;  3NF7 A;  2OPS A;  1WSG A;  2X74 A;  3OYI A;  2QKB A;  3LAK A;  2XY8 A;  1JXB A;  4CF0 A;  1C0M A;  1FKO A;  2JLE A;  4CJP A;  3OS2 A;  4W5N A;  4H4M A;  4OGC A;  4KHQ A;  1LWF A;  3EZ5 A;  5J1E A;  1HPZ A;  2P5O A;  1BIZ A;  3H08 A;  4CGJ A;  4Q5V A;  3OYH A;  4ZTF A;  3PX0 A;  3V9Z A;  3NGI A;  3K57 A;  1IKW A;  3SUP A;  3AV9 A;  3UIQ A;  4CE9 A;  3L2U A;  4LY7 A;  2RN2 A;  3M8Q A;  5D3G A;  4OKJ A;  1RBS A;  3E01 A;  1VSE A;  4AHS A;  4BDY A;  4GMJ B;  4CHQ A;  4J2A A;  1KVC A;  2KZM A;  4IKF A;  3KLH A;  3HP6 A;  4I7F A;  3ZSQ A;  3U3Y A;  4CF1 A;  2XY6 A;  4DWI A;  4K8Z A;  1JXE A;  3HXM A;  5FRO A;  1F21 A;  4FLU A;  1Q9X A;  2B5J A;  2PZS A;  2P5G A;  4C8K A;  3OYD A;  2HHW A;  3ZT0 A;  4I2Q A;  1JKH A;  3PX4 A;  1VSF A;  2W42 A;  4KHS A;  4KAZ A;  1C6V A;  3WNF A;  4CJE A;  4AHV A;  3SYZ A;  3S3M A;  2O4G A;  1SL2 A;  3L8B A;  4RW7 A;  1KCF A;  1NK6 A;  4RG8 A;  4E19 A;  2VG7 A;  4JLH A;  2PYL A;  3RMB A;  1TVR A;  3SJJ A;  4BAC A;  3HPH A;  3KKR A;  1WN7 A;  5I3U A;  4CGD A;  3AVG A;  3OYC A;  2Z1H A;  4FLW A;  4J2D A;  4FJ9 A;  3V6D A;  4CER A;  5HBM A;  1BI4 A;  2FBV A;  4DMN A;  3QEW A;  3TAB A;  5HRN A;  5J2P A;  3AVM A;  2FC0 A;  3L2W A;  4DTM A;  1NKC A;  1N5Y A;  1UA1 A;  3KD1 E;  2HHQ A;  4DSK A;  3IS9 A;  1C1C A;  3K5O A;  3NH2 A;  1SL1 A;  1RBR A;  1RT6 A;  4OJR A;  4HTU A;  4W5Q A;  3HPO A;  1QSY A;  4CK2 A;  1RT3 A;  1KSP A;  3OYJ A;  1EET A;  3G0Z A;  5J2M A;  1UOC A;  1RT7 A;  5FDL A;  3VA0 A;  1REV A;  2OPR A;  4AHU A;  1BIU A;  4DF4 A;  3TAQ A;  4E7K A;  3QEP A;  3T3F A;  2G8U A;  4NCA A;  3NBP A;  3VQ9 A;  2Z1J A;  2OA8 A;  3RMC A;  1U48 A;  3ZSX A;  1DTT A;  3TAF A;  2OPP A;  4C8N A;  2VG6 A;  2D0B A;  3DLR A;  4E7H A;  2RF2 A;  4CJ5 A;  3VQ6 A;  1VSL A;  1ZBH A;  1XI1 A;  2YKM A;  3VQ8 A;  2YHB A;  4CHO A;  1TL1 A;  2BE2 A;  4HUG A;  3OJS A;  1KVB A;  3MEG A;  4KFB A;  5KTQ A;  4LH4 A;  1TAU A;  5KGX A;  3TAP A;  2FBX A;  4HVJ A;  4Q0B A;  2Z1I A;  1L5U A;  3CFP A;  3ZT1 A;  3DM2 A;  2PY5 A;  4DQQ A;  1RT4 A;  3ZSR A;  4CEQ A;  3QER A;  1B92 A;  4CJW A;  3AO2 A;  1LW0 A;  1VSI A;  3LAM A;  3VQQ A;  3K5N A;  3SV4 A;  2HHS A;  5DMR A;  3V1O A;  1C1B A;  3AVH A;  1NKE A;  1BHL A;  4FJL A;  4HUE A;  3MED A;  5KGW A;  4B8A B;  3RR7 A;  3QET A;  2HVH A;  4LD0 A;  4B9V A;  5FRM A;  1BQN A;  1S1X A;  3PO5 A;  4FJK A;  4FZY A;  4E7I A;  3V4I A;  2KZZ A;  4LSN A;  1QQC A;  4FW2 A;  3M8S A;  1WSE A;  3NF9 A;  3NF6 A;  3SUO A;  4O55 A;  3SI6 A;  1SKS A;  1EX4 A;  4YFU A;  1WAJ A;  3OY9 A;  1S1W A;  3CYM A;  4FK2 A;  3O3F A;  3HYF A;  4M3W A;  4DTU A;  2RPI A;  1KVA A;  1WSJ A;  2QXF A;  3O4Q A;  4OPJ A;  4OPK A;  3QES A;  1VRU A;  3OYK A;  3HL8 A;  3SUN A;  1R0A A;  4KTQ A;  4N41 A;  2HVI A;  1HNI A;  1CXU A;  1RNH A;  4ID1 A;  4NYF A;  4DSE A;  2IDO A;  3AVB A;  2G8V A;  3HJF A;  3LZJ A;  3V9W A;  1JLA A;  4O5B A;  3TR8 A;  1RTJ A;  3CQ8 A;  5EU7 A;  3VQE A;  4FLZ A;  4FJ8 A;  1RTH A;  2VWJ A;  2D5R A;  4MQ3 A;  1LW2 A;  4IG3 A;  1X9W A;  4G1Q A;  1J54 A;  4FJG A;  4PWD A;  4Z0U A;  1KTQ A;  3CFR A;  3LP0 A;  4BE2 A;  3SV3 A;  4KHW A;  1EXQ A;  2ZE2 A;  3V9U A;  3SCX A;  3DLE A;  3DOL A;  3TAM A;  3QLH A;  2KQ2 A;  3SUQ A;  1NK8 A;  3U6F A;  4DQP A;  2BDP A;  3ZCM A;  4F8R A;  4FZZ A;  4CES A;  1IG9 A;  4NCG A;  2HHT A;  4PQU A;  3L3U A;  3ZT4 A;  1S5J A;  3ZSY A;  3RMD A;  2G8I A;  4CF9 A;  1XHZ A;  3L2R A;  2YV0 X;  3OYA A;  1U47 A;  1GOB A;  3WNH A;  1RIL A;  2YNI A;  2BAN A;  4CFD A;  1U04 A;  4BWJ A;  4F4K A;  3DRP A;  4BWM A;  3NF8 A;  3KK3 A;  3AVN A;  3ZT2 A;  1L3U A;  2F96 A;  3HP9 A;  1QSS A;  4B9S A;  2KFZ A;  4DTX A;  3LP2 A;  4CEO A;  4YNQ A;  3MXI A;  1BCO A;  4CJ3 A;  1S6P A;  3NFA A;  3LPT A;  3LZI A;  1S9E A;  3BGR A;  4LH5 A;  5CYQ A;  1LV5 A;  4CHP A;  3C95 A;  3PUF A;  4E0D A;  2VWK A;  1YTU A;  1I3A A;  1BIS A;  3VQD A;  1YT3 A;  2X6S A;  3U3G A;  3TAR A;  4C8O A;  4M3X A;  4CHZ A;  2BGG A;  1LAV A;  2IS3 A;  3L2Q A;  1NOZ A;  1EP4 A;  3S3O A;  3KK2 A;  4BDZ A;  3I0S A;  4CJU A;  3QEI A;  1QE1 A;  3V9X A;  1BGX T;  2OYQ A;  4F2R A;  1ZBI A;  1IKV A;  5HRP A;  3S3N A;  4HCC A;  1ZYQ A;  3B6O A;  3KLE A;  2HNZ A;  1L3T A;  4CEA A;  3SQ4 A;  4Z4C A;  3D0P A;  3KIO A;  5SZT A;  1IH7 A;  1DLO A;  3QIP A;  4E7J A;  1JLQ A;  3T19 A;  2KTQ A;  1VSM A;  2F8S A;  4DG1 A;  1ITG A;  3D45 A;  3T1A A;  3FFI A;  4E7L A;  3AVK A;  1IKY A;  1B9D A;  4FLX A;  4FJM A;  3AA5 X;  3QNO A;  3ULD A;  4FJ5 A;  4EZ9 A;  1YTA A;  1RDC A;  1C0U A;  4DSF A;  1NK4 A;  4KKO A;  2HND A;  3AVJ A;  4KRE A;  4C8M A;  4KTW A;  2JGU A;  4DTO A;  4E89 A;  4H4O A;  4F3O A;  4KB0 A;  2WOM A;  4KV8 A;  4FM1 A;  2KW4 A;  1CZB A;  3LAN A;  3NGY A;  3NDK A;  1KLN A;  3AVL A;  3IAY A;  1ASV A;  4O0I A;  1NJW A;  1LWC A;  3KJV A;  3S9H A;  2HW3 A;  3HPG A;  3OJU A;  1LAW A;  4OKE A;  3OYB A;  4BE1 A;  3OYF A;  4DS4 A;  2B6A A;  3O4N A;  4CGF A;  2IC3 A;  2QKK A;  3DRR A;  4I9Q A;  4IDK A;  4DFM A;  3IG1 A;  4E1N A;  4E1M A;  4M42 A;  1RBV A;  2Z1G A;  1BL3 A;  1TV6 A;  3VQP A;  4IG0 A;  3NCI A;  4B3O A;  3V81 A;  1MU2 A;  4CJV A;  3F73 A;  1WNS A;  1W9H A;  3DMJ A;  1RT5 A;  2GUI A;  5JS1 A;  2NUB A;  2EHG A;  3ZT3 A;  3LWL A;  3AO1 A;  4FXD A;  3ISN C;  4LSL A;  3LP3 A;  3VN5 A;  3HM9 A;  4DU1 A;  3KD5 E;  3TAN A;  2VG5 A; 
#chains in the Genus database with same CATH topology
 3C94 A;  1EQY A;  1VK0 A;  3OYG A;  4GW6 A;  3NH1 A;  4OO1 J;  4DTP A;  3KK7 A;  1U4B A;  3CJB A;  1RDU A;  2RHK A;  3VEZ A;  1C0F A;  3MN6 A;  4DHY A;  3RWU A;  4BRD A;  4ELT A;  3VEN A;  4OVL A;  3TAE A;  2ITG A;  3PX6 A;  3ZET B;  4FWS A;  1K6Y A;  2HOE A;  2ETJ A;  4IO9 L;  4PKG A;  1T6D A;  4O0J A;  1S72 N;  5C25 A;  3V1Q A;  1NJX A;  3QIN A;  1X9J A;  3P83 D;  1GLD G;  1TKZ A;  1J53 A;  2ZGY A;  1NJY A;  1L3S A;  4K8X A;  4DU4 A;  1ATS A;  4CF8 A;  4CK1 A;  4K25 A;  3ATU A;  4DFJ A;  3ASM A;  1BCM A;  3CM6 A;  1XC9 A;  4RW8 A;  3M6G A;  2YHW A;  5C24 A;  1NGH A;  4JKE A;  3CPW M;  3KKS A;  1KFD A;  2DTU A;  4H5V A;  3HK2 A;  4AH9 A;  3O9U A;  1SKR A;  2CGK A;  1OKJ A;  2A3Z A;  4OKK A;  1RDW X;  3K2P A;  2HST A;  3CCQ N;  1T7P A;  4JI2 K;  1HQU A;  1P90 A;  5KPZ A;  4CK3 A;  1TK8 A;  3TTC A;  4HHT A;  4B9U A;  2I7N A;  4GV9 A;  4N5S A;  2E8A A;  4UY8 O;  4WFB L;  1A5W A;  4CZG A;  4XIU A;  1VQN N;  4O4G A;  1NK0 A;  2I7P A;  3TAG A;  1NJZ A;  3G71 N;  2GUP A;  2P9I B;  2QTD A;  3PSF A;  3M5R A;  1D5A A;  3ZEU B;  1C0T A;  1NU0 A;  1P8Z A;  5E26 A;  3QNN A;  5LJV A;  1KC8 O;  3SAH A;  4NCB A;  1LOT B;  4PL8 A;  4BQZ A;  4Z4E A;  4B3M K;  2H3G X;  4Z4G A;  4DSL A;  2W40 A;  4BR7 A;  5C0Y A;  3ZX2 A;  3AVF A;  1U2V B;  3MMV A;  1N34 K;  3WNG A;  3HVR A;  4KHN A;  4CFC A;  4BRE A;  1WBD A;  1CXQ A;  5AQQ A;  3VF2 A;  1UWB A;  4B1Z A;  2XY7 A;  1JLF A;  3IMX A;  4MFB A;  4A5B A;  1XNR K;  1VQO N;  4KI4 A;  1JLE A;  1JL1 A;  2E2P A;  5C2F A;  4B3R K;  1SL0 A;  2AP1 A;  4AHT A;  4AIL C;  5KPR A;  1G15 A;  1YJW N;  4FM0 A;  4J2E A;  3CME N;  5JMV A;  1TK0 A;  2CGL A;  1NK7 A;  1N33 K;  1HLU A;  4Z4I A;  2X6N A;  3K0S A;  3CCR N;  4BG8 A;  2DFF A;  3DJC A;  1QSL A;  5GAD P;  4CGH A;  2Q2R A;  4WQ4 C;  1KRP A;  1WSI A;  2EX3 A;  2HHX A;  3TSU A;  1U49 A;  4OX9 K;  3CJA A;  5HL7 L;  2VGM A;  3EKS A;  2A41 A;  3VA3 A;  3I8B A;  1TYQ B;  3QML A;  4ZHR A;  5KPT A;  1GOC A;  1KD1 O;  1K8K A;  4JRP A;  1U45 A;  3F9M A;  4FWQ A;  1NGD A;  4CEZ A;  2O8D B;  4I9L A;  4FWL A;  4ELV A;  1S6Q A;  3U4L A;  3V9S A;  3EL2 A;  5CYM A;  1S3X A;  1IJJ A;  2AJQ A;  1BQM A;  3HVT A;  4BRP A;  2A1S A;  1EKE A;  1RT2 A;  3ZSZ A;  3EY1 A;  3O3H A;  3O80 A;  3QEV A;  4CJT A;  4B3S K;  1GLE G;  1RDB A;  4EZ6 A;  4JKD A;  3L0Q A;  2J4R A;  4DR7 K;  3HO1 A;  2O8F A;  1TGO A;  4B3T K;  4WFN L;  1C0G A;  1BDG A;  5M1F A;  5AQJ A;  5LJW A;  4K43 A;  2P9L A;  4CJK A;  3CM5 A;  3ZYY X;  4LFA K;  1KLM A;  2ZJR L;  4O44 A;  1MDU B;  4DLE A;  1YIT N;  4JI7 K;  3IRX A;  4CHN A;  2G8W A;  3K5M A;  1QZ6 A;  1WAF A;  3L6Q A;  5AQV A;  3VTI A;  4H0X B;  3JYT A;  4WQ5 A;  4H5R A;  3NF7 A;  2OPS A;  1N32 K;  3LAK A;  2XY8 A;  2ASP A;  1JXB A;  4W5N A;  4CJP A;  4KHQ A;  5AQH A;  1YVN A;  5J1E A;  3EZ5 A;  3F2K A;  2IVN A;  1BIZ A;  4Q5V A;  3O8M A;  3UIQ A;  3K57 A;  1IKW A;  3AV9 A;  4LY7 A;  2A5X A;  2GTD A;  5D3G A;  1VSE A;  2VGN A;  2QWL A;  4GMJ B;  4CHQ A;  3QDK A;  3ZSQ A;  4K8Z A;  4CF1 A;  4CZK A;  5M1K A;  4FLU A;  2B5J A;  2P5G A;  2HHW A;  3OYD A;  3ZT0 A;  4I2Q A;  5BR8 K;  4YHH K;  1S22 A;  3SYZ A;  1BOT O;  4NB4 A;  2YCH A;  5TKY A;  4A5A A;  3L8B A;  5FPD A;  4RG8 A;  4NO7 A;  3SJJ A;  4BAC A;  5I3U A;  5IT9 O;  4FJ9 A;  3V6D A;  1BI4 A;  3QEW A;  5HRN A;  3L2W A;  3KD1 E;  5ADX H;  3MN7 A;  3IKM A;  3K5O A;  1RT6 A;  5AFU H;  3AGK A;  4CK2 A;  1VQ9 N;  3G0Z A;  5J2M A;  5MLC Q;  1UOC A;  1MWK A;  1REV A;  4AHU A;  1NMN A;  4NCA A;  2Z1J A;  5BRD A;  2OA8 A;  1U48 A;  3TAF A;  2VG6 A;  2HHH K;  1VSL A;  1SAZ A;  4GY2 B;  4CHO A;  1TL1 A;  4BR0 A;  1KVB A;  3OHR A;  3MEG A;  3H6E A;  3PSI A;  4LH4 A;  5KTQ A;  4CD3 A;  2UUA K;  2D4W A;  2HF3 A;  1YIJ N;  2A6A A;  3ZT1 A;  1Z05 A;  1RT4 A;  4LF8 K;  1NG9 A;  2HMP A;  3DXM B;  3R1X A;  1C1B A;  2V51 B;  3MN9 A;  3SBT A;  3RVC A;  4FZY A;  5C10 A;  2Q36 A;  1QQC A;  2Q97 A;  4A62 A;  1ZXO A;  3M8S A;  3NF9 A;  3SUO A;  4YFU A;  3OY9 A;  3CYM A;  3VEX A;  3CER A;  4BRM A;  4FJH A;  4KTQ A;  2HVI A;  1VRU A;  3OYK A;  4LF9 K;  4N41 A;  4FWO A;  4ISE A;  4NYF A;  4IZ9 A;  2FSK A;  3AVB A;  3THY A;  2G8V A;  4H5T A;  4JKC A;  1LW2 A;  4IG3 A;  1NGJ A;  4PWD A;  1KTQ A;  2P9K B;  3LP0 A;  2KQ2 A;  4JKH A;  1NK8 A;  4DQP A;  4NCG A;  1Z6R A;  4JHD A;  3E9O A;  4BC4 A;  3MDQ A;  4PQU A;  3ZT4 A;  3RMD A;  3DWL A;  5DM7 L;  1XHZ A;  2YV0 X;  3FZK A;  1GOB A;  2PFU A;  4YOW A;  1G99 A;  5AQW A;  4FPB A;  4BWJ A;  4F4K A;  3NF8 A;  2V7Z A;  3AVN A;  1E4F T;  3HP9 A;  4DTX A;  4YNQ A;  4GVE A;  2Q1N A;  3LPT A;  2W6K A;  1S9E A;  1GLJ O;  3BGR A;  4BRF A;  4IWV A;  4E0D A;  3R8E A;  2FSN A;  2D0P A;  3J81 O;  2FF6 A;  2ASM A;  3SMP A;  1VQ7 N;  2E1Z A;  4HWI A;  3QEI A;  2CGJ A;  1QE1 A;  2OYQ A;  4F2R A;  1VHX A;  2YX6 A;  1ZYQ A;  3O9T A;  2DPN A;  3U9D A;  2HBM A;  3T1H K;  1DLO A;  3QIP A;  1JLQ A;  5LY3 A;  4KH4 A;  4A2A A;  2AA4 A;  4DG1 A;  3VPZ A;  3J7Z O;  3AVK A;  1IKY A;  3AAR A;  5AQZ A;  4FLX A;  4FJM A;  3ULE A;  4FJ5 A;  3TU5 A;  4JK7 A;  3EKU A;  3WEE A;  4KKO A;  4NXM K;  1W2B M;  4KRE A;  3AGR A;  1J6Z A;  4E89 A;  2FXU A;  4H4O A;  4F3O A;  4F9O A;  1VQ4 N;  3IAY A;  1DGK N;  4O0I A;  2HW3 A;  1QQO A;  5C15 A;  4BE1 A;  4DS4 A;  1MWM A;  3O4N A;  4I9Q A;  3DRR A;  4K41 A;  3FZM A;  4DFM A;  4E1M A;  4NXN K;  4M42 A;  4B3O A;  3CCE N;  3V81 A;  1MU2 A;  5JS1 A;  1WNS A;  3DMJ A;  2EHG A;  4FXD A;  3THW A;  3ISN C;  4LSL A;  3KD5 E;  2VG5 A;  4CZL A;  3NE6 A;  1S1U A;  5KI6 A;  4JV5 K;  2GBZ A;  1QZ5 A;  4BY9 C;  4OLA A;  1T44 A;  5HRR A;  1VQL N;  2F4V K;  1A5X A;  4KRF A;  3MCP A;  4WE1 A;  3VQ5 A;  3RTV A;  1HRH A;  4XEI A;  3LAL A;  5BRH A;  1TKX A;  5KQ8 A;  1JL2 A;  3P1G A;  4B9N A;  5FPM A;  3VQB A;  1KFS A;  5I42 A;  1BWF O;  3RRH A;  3CFO A;  3H1V X;  3EO3 A;  3AAP A;  4LF4 K;  4KHY A;  1EO1 A;  3T69 A;  5AQN A;  4O5F A;  2PYJ A;  4M3Z A;  1WSH A;  3AVA A;  4CJR A;  1D8Y A;  3ID6 A;  3HJF A;  3OS0 A;  3AO5 A;  5DK5 A;  1A5V A;  4GVM A;  5AQK A;  4DTN A;  3H3O B;  3WNE A;  4DSI A;  2IGI A;  5BPN A;  3G6E N;  1J9A A;  1X1P A;  4BRK A;  4ILG B;  4BRN A;  4I6M A;  1ESV A;  2HMI A;  3ZLJ A;  4FJX A;  1QHA A;  4OGE A;  4H0V B;  4ISF A;  4LC9 B;  3CHW A;  2YNH A;  3ZSO A;  4Z4F A;  2HHU A;  2ZD1 A;  1WUA A;  3PV8 A;  4CEE A;  1HYV A;  1SKW A;  4BRA A;  3CXC M;  3SQ2 A;  1TKD A;  4NLB A;  1M90 O;  4FJJ A;  3RRG A;  4DQI A;  1IG8 A;  5LMU K;  5SWM A;  1S9G A;  2D0A A;  4M41 A;  4CJL A;  4JRQ A;  5H1S Q;  4JKG A;  1XHX A;  2ZJP L;  3CCV N;  2WFB A;  5J2Q A;  3LP1 A;  3SQ1 A;  4OPA A;  1RTI A;  4LF7 K;  3L4Q A;  4J8F A;  1W7A A;  1KXP A;  4RW6 A;  4LF5 K;  2YHX A;  2LSN A;  4FW1 A;  4V19 S;  1X9S A;  2P9N A;  3AA3 A;  5AQX A;  1W0H A;  1ZBF A;  4CEF A;  1HNZ K;  3NH0 A;  1T05 A;  4CJQ A;  2YNF A;  2EWS A;  1TAQ A;  2BH1 A;  5T7B A;  4FCY A;  3I0R A;  4CD1 A;  3GE1 A;  3A2F A;  1HJO A;  4CHY A;  3BDP A;  3MWP A;  3KWG A;  4DR5 K;  1IBM K;  3DOK A;  3DLK A;  3L2V A;  2P9S A;  5AZI B;  4OLB A;  4M63 C;  1RBU A;  1NK9 A;  3CJ9 A;  3A5O C;  1EWQ A;  2P51 A;  3ZET A;  3NAE A;  3NVK A;  1O13 A;  4KI6 A;  3AA2 A;  3AVC A;  1HNV A;  2XO7 A;  5AJ3 K;  4MLH A;  5AQS A;  3J7A P;  3V1R A;  3SQ0 A;  3QBX A;  3CPE A;  3SBG A;  1UA0 A;  3ENO A;  2JWL A;  1OVY A;  1QVF M;  3VEV A;  3DLH A;  4DTJ A;  4JK8 A;  4ID5 A;  3ALY A;  4JNE A;  3FFK B;  1NGF A;  4EIA A;  3QEX A;  4IBN A;  2UYT A;  3VOV A;  4FYD A;  3MCA B;  3C7N A;  4EFH A;  3OYM A;  1GLF O;  1NBW A;  3M8P A;  4A2B A;  2P9U B;  4FPA A;  4E3S A;  3O4W A;  4RW4 A;  4YOU A;  4H5N A;  1VRT A;  1T03 A;  3VQA A;  5J2N A;  2OZS A;  4JKB A;  2HBL A;  1TKT A;  4C8L A;  2CH5 A;  1S1T A;  1DTQ A;  4LFB K;  1HMV A;  1SUQ A;  3D2F A;  3KWI A;  4JYA K;  5AZJ B;  2IAJ A;  3N4P A;  4M3R A;  3MX2 A;  1J5O A;  2A42 A;  2VWB A;  3DYA A;  3MEE A;  4DKW A;  4F3T A;  3QO9 A;  4CF2 A;  3WXM B;  2BUP A;  4CIF A;  2G8H A;  4RW9 A;  1U2V A;  3VQ4 A;  4JAX A;  5AQF A;  4CZH A;  1I39 A;  3SPZ A;  5CE3 A;  5AQP A;  4R79 A;  2X74 A;  3FE1 A;  4C1N K;  3K9K A;  3CQY A;  1C0M A;  2JLE A;  3O08 A;  4CF0 A;  3OS2 A;  4H4M A;  1TUY A;  2P5O A;  4CGJ A;  4IFE A;  1HNW K;  4OKJ A;  4EAH D;  4J2A A;  2KZM A;  4B1X B;  2DY4 A;  3HP6 A;  4DWI A;  1JXE A;  3HXM A;  4H03 B;  1F21 A;  2PZS A;  1JKH A;  2QWM A;  2W42 A;  3PX4 A;  2HBK A;  1C6V A;  4KAZ A;  3SAF A;  2O4G A;  3UKU A;  2IVP A;  3THX A;  1SL2 A;  1NK6 A;  3LDN A;  5B8H A;  2PYL A;  5BPM A;  3ATV A;  4CGD A;  5AR0 A;  2NRT A;  4DQ8 A;  2FBV A;  3O9Q A;  3TAB A;  5J2P A;  3N4Q A;  4WF9 L;  1N5Y A;  3RSE A;  4CVN E;  1TYQ A;  2YJF A;  4RTF D;  4YOX A;  4W5Q A;  1QSY A;  1RT3 A;  1KSP A;  1EET A;  4JI4 K;  4DF4 A;  1BIU A;  2JWK A;  4DV2 K;  2O8D A;  2QW9 A;  3QFU A;  3LDL A;  3FZL A;  3VQ9 A;  1NWK A;  2V52 B;  2OPP A;  4H0T B;  2RF2 A;  4CJ5 A;  3FZF A;  2BE2 A;  1ZC6 A;  4KFB A;  4WQ4 A;  5KGX A;  3TAP A;  5ELZ A;  3A5M C;  4DQQ A;  3ZSR A;  3R9P A;  1B92 A;  3AO2 A;  1LW0 A;  3EEQ A;  3VQQ A;  3K5N A;  2HHS A;  5DMR A;  3V1O A;  1NKE A;  1BHL A;  4JI0 K;  2UU9 K;  4CZM A;  4FJL A;  1NGA A;  5KGW A;  4B8A B;  3QET A;  2HVH A;  4LD0 A;  4B9V A;  5FRM A;  3PO5 A;  4E7I A;  3V4I A;  3CJC A;  4JKF A;  1WSE A;  3NF6 A;  1EX4 A;  1S1W A;  3HTV A;  1NGI A;  2WTU A;  4FK2 A;  1KAY A;  3CCL N;  1NGC A;  1R0A A;  4BVP A;  5GIP A;  4IJA A;  3WQU A;  4B1Y B;  1HNI A;  4A61 A;  4FWP A;  3TR8 A;  3VQE A;  4FLZ A;  2GWK A;  4G1Q A;  4FJG A;  1NMD A;  4KHW A;  1MA9 B;  4JI1 K;  3DOL A;  2WBN A;  2IIR A;  2YI1 A;  4YOY A;  4FZZ A;  2VYP A;  2GEM A;  1T6C A;  3DLL L;  3L3U A;  1IV0 A;  5FLX O;  2VQE K;  1K8A O;  4DR6 K;  1RIL A;  4CFD A;  2HF4 A;  4BWM A;  3ZT2 A;  4BGB A;  2F96 A;  1RGI A;  2IVO A;  3L4I A;  1QSS A;  2KFZ A;  3FLC O;  4CJ3 A;  1S6P A;  3SK3 A;  3NFA A;  2CH6 A;  1LV5 A;  1KAX A;  3A0I X;  3PUF A;  1YTU A;  3W3D A;  4KBO A;  3TAR A;  1OH8 A;  4CHZ A;  2BGG A;  2IS3 A;  3CCJ N;  5AQO A;  2GEL A;  1EP4 A;  2QM1 A;  2O8F B;  3F5T A;  4BDZ A;  4JK9 A;  3NVM A;  4CJU A;  3V9X A;  1ZBI A;  2P9L B;  1ILY A;  1E4G T;  3B6O A;  3CET A;  2F9W A;  4BC3 A;  3KIO A;  5SZT A;  1K73 O;  2KTQ A;  3D45 A;  3FFI A;  3ULD A;  1GLB G;  4EZ9 A;  1YTA A;  2FF3 B;  1C0U A;  2NRR A;  4FOI A;  5AQR A;  3SLC A;  3P38 A;  4DSF A;  3DXK B;  4C8M A;  5LMN K;  3E1Y A;  4DTO A;  1LCU A;  4KB0 A;  1ZBS A;  3CCS N;  2WOM A;  4EHU A;  1BA0 A;  3NGY A;  2KHO A;  4BGA A;  2UXD K;  4ISG A;  3DXM A;  4OKE A;  1R59 O;  3EN9 A;  2UUB K;  2QKK A;  4IDK A;  4A59 A;  1RBV A;  3VQP A;  3E66 A;  2GUI A;  4JKA A;  3ZT3 A;  3VN5 A;  3A8Y A;  4DU1 A;  2P9P A;  3PIO L;  4MO4 A;  3U8X A;  1VQK N;  1LWE A;  3JSM A;  3PY8 A;  2ASO A;  3AY9 A;  1WLJ A;  2WON A;  5HRS A;  3EE8 A;  3DAW A;  4DFP A;  5FPE A;  5DM6 L;  2BTF A;  3GL1 A;  3TI0 A;  3K58 A;  2P9K A;  3OYE A;  1L3V A;  3DLG A;  4GKJ K;  1IBL K;  1SV5 A;  3J80 O;  3DRS A;  5KRS A;  4KHU A;  3BUZ B;  5M1N A;  3VQC A;  4L8R B;  4CZJ A;  1JLB A;  1TL3 A;  5BN8 A;  4BC2 A;  3SNN A;  4L3Q A;  5F2R A;  4BRO A;  4CED A;  3LM9 A;  4I2P A;  3HI0 A;  4FLT A;  1RTD A;  2FLO A;  2FBY A;  3TTD A;  4ZTJ A;  4W5T A;  3SZ2 A;  1QS4 A;  3OBY A;  4XH4 A;  3G4S N;  3MN5 A;  3SPY A;  1XQS C;  5AQI A;  4FZX C;  2FBT A;  3ZX3 A;  4MDA A;  5CZ2 A;  4FWR A;  3LDP A;  1O1W A;  5JIC A;  3NGZ A;  3LL3 A;  1WSF A;  3MXJ A;  4KB1 A;  3G10 A;  2ZJQ L;  1C1A A;  4DV6 K;  4QAG A;  4BQL A;  4CJS A;  2RKI A;  4CZI A;  1B9F A;  1JLG A;  1HYS A;  4DTR A;  1VSD A;  2GWJ A;  4B1V A;  2NNW A;  2OTJ N;  1KQS M;  3Q7C A;  1HUX A;  3THY B;  4DV4 K;  2DFH A;  2O8C A;  3D6R A;  3CC4 N;  4EP4 A;  5HRO A;  4IDH A;  3OTO K;  1HPM A;  3AVI A;  5HLF A;  3AA4 A;  4DB3 A;  4FLY A;  1Z26 A;  1BUP A;  2QK9 A;  5JVH L;  4CIG A;  1Q7Y O;  2NRH A;  4GV6 A;  4TSX A;  2Q0U A;  1FJG K;  2E5L K;  4NLC A;  5BN9 A;  3P5J A;  3DI6 A;  2X78 A;  5BRF A;  3F9K A;  1HKC A;  4Y0W A;  4AHR A;  3P4I A;  1RT1 A;  5EY4 A;  2XY5 A;  1HNX K;  4BR2 A;  3VGL A;  3HT3 A;  1X3N A;  3O3G A;  3PIP L;  3MK6 A;  1HX1 A;  2O8B B;  2ITM A;  1NK5 A;  2I5J A;  2B4J A;  3I55 N;  4DF8 A;  5I9E B;  3RR8 A;  2YJE A;  4RCH A;  3MEC A;  4M45 A;  1S1V A;  3FZH A;  4CEB A;  1D4X A;  1Q8I A;  3PLA A;  4W5O A;  3AAQ A;  2HB5 A;  1ATN A;  5AQG A;  1M1K O;  3P39 A;  4B9L A;  4Z4H A;  3L3V A;  3BZC A;  3ULE B;  3ZSV A;  3BP8 A;  3U9Z A;  3K5L A;  3C6U A;  1CLQ A;  4BE0 A;  1NKB A;  1XWL A;  4BR4 A;  4F2S A;  2NRZ A;  1ASW A;  1J5E K;  4M7X A;  1YVU A;  1N6Q A;  4BRG A;  2YHA A;  4PUO A;  4FWK A;  3QIO A;  4FJ7 A;  1HYZ A;  1K9M O;  1WB9 A;  4JN4 A;  1Q81 O;  4KPY A;  4WCE L;  4DU3 A;  1ZBU A;  3ZX0 A;  1T8E A;  3MWT A;  4CEC A;  3PO4 A;  4CGG A;  3THW B;  2E2N A;  4N56 A;  5HP1 A;  2G8K A;  2Y1J A;  4ILH A;  3WXL A;  4QOZ B;  4KH6 A;  5C42 A;  1FW6 A;  1TK5 A;  4DV1 K;  2QA4 N;  3RMA A;  2WUS A;  1YJ9 N;  1Q82 O;  4BG9 A;  3O1W A;  1RDD A;  2QWO A;  3MXM A;  4FWN A;  1VSH A;  4PA1 A;  2D1K A;  3KHY A;  3ZSW A;  4AF1 A;  4C1N I;  2GV9 A;  4DUZ K;  4DR4 K;  3AO4 A;  3KLF A;  3CG7 A;  3THV A;  3TTF A;  4M3U A;  3OVN A;  4IOX A;  3VQ7 A;  1DKG D;  5M1O A;  3OYI A;  4WFA L;  3C6H A;  3CJ1 A;  3H45 C;  4OGC A;  1LWF A;  3OA9 A;  3H08 A;  4ZTF A;  3SUP A;  2W41 A;  3NGI A;  5AZI A;  3V9Z A;  3L2U A;  2RN2 A;  3M8Q A;  1RBS A;  4AHS A;  4FVU A;  4IKF A;  3D2E A;  3KLH A;  5M1P A;  3U3Y A;  2XY6 A;  4C23 A;  2O8E A;  4I6M B;  3SJH A;  3UKR A;  3CC7 N;  1QVG M;  4CJE A;  1RFQ A;  4FO0 A;  4YOV A;  1Y64 A;  4E19 A;  2VG7 A;  4JLH A;  3B8A X;  3RMB A;  4DR1 K;  1TVR A;  1BA1 A;  2E1Y A;  3AVG A;  2Z1H A;  4FLW A;  4J2D A;  4CER A;  2PAV A;  4DMN A;  1SQK A;  3AVM A;  4RWT A;  3Q7B A;  3JXU A;  1UA1 A;  4JKG B;  3IS9 A;  4O8U A;  1SL1 A;  3NH2 A;  4OJR A;  4HTU A;  3ENB A;  1VQP N;  2E88 A;  1RT7 A;  3VA0 A;  2P9U A;  3T3F A;  3NBP A;  4BRC A;  3ZSX A;  4XH1 A;  1V4T A;  5JLF A;  3BY5 A;  4C8N A;  4E7H A;  2D0B A;  3M3Z A;  3VQ6 A;  2P9N B;  1ZBH A;  5GIN A;  1XI1 A;  2YHB A;  4PKI A;  4HUG A;  3OJS A;  4K0K K;  4O8K A;  3QIC A;  1TAU A;  4CBU A;  4LF6 K;  5AZJ A;  3O1B A;  2KLA A;  3DM2 A;  4AM6 A;  3CI5 A;  3LDQ A;  1VQ8 N;  4CEQ A;  3QER A;  4AM7 A;  3SV4 A;  4CJW A;  4BVO A;  2P9S B;  3AVH A;  3CD6 N;  4QS7 A;  3MED A;  1S1X A;  4X62 K;  4FJK A;  4QS8 A;  2KZZ A;  4FW2 A;  1E3M A;  1WAJ A;  1NGB A;  2NRW A;  3O3F A;  3HYF A;  4M3W A;  4XH5 A;  4JD2 B;  1NGE A;  2RPI A;  1KVA A;  4OPJ A;  3VF4 A;  5M1Q A;  4DSE A;  1RNH A;  2P9I A;  4U67 L;  4GV3 A;  4AQY K;  3C6A A;  3OW2 M;  1JLA A;  3T7Z A;  3V9W A;  3CQ8 A;  3ZEU A;  4Z94 A;  1RTH A;  2D5R A;  4MQ3 A;  4DR3 K;  1X9W A;  1J54 A;  4Z0U A;  5F0X A;  3CFR A;  4BE2 A;  2ZE2 A;  1HKG A;  3SCX A;  3DLE A;  3SUQ A;  3QLH A;  3U6F A;  4X64 K;  2BDP A;  4IEE A;  3ZCM A;  1OH7 A;  3O9R A;  4F8R A;  3UB5 A;  4JI3 K;  4CES A;  3C7N B;  2HHT A;  5AQT A;  2HBJ A;  1S5J A;  3ZSY A;  4E1J A;  2NZT A;  4H0O A;  4CF9 A;  5HOO A;  1U47 A;  1U04 A;  3S41 A;  3TPQ A;  4MO5 A;  2ZM6 K;  2E2O A;  3KK3 A;  3BZK A;  1L3U A;  3WQT A;  4IEI A;  4CEO A;  3MXI A;  1OVQ A;  5CYQ A;  3A5L C;  3C95 A;  3VEW A;  1CZA N;  2VWK A;  4QS9 A;  5GAG P;  4DR2 K;  3D2F B;  2QWR A;  1I3A A;  1BIS A;  3O5B A;  1YT3 A;  2X6S A;  3U3G A;  4C8O A;  3TSP A;  1LAV A;  4MLE A;  3CIP A;  3R6M A;  3S3O A;  1XUP O;  1VQ5 N;  3VER A;  1BGX T;  1IKV A;  5HRP A;  3S3N A;  4HCC A;  3HSC A;  4BRI A;  4Z4C A;  3D0P A;  3CF5 L;  1IH7 A;  4YOR A;  4FOE A;  2F8S A;  1ITG A;  4E7L A;  1B9D A;  1Q18 A;  1EWR A;  4IJN A;  1N8R O;  3QFP A;  1RDC A;  4DV0 K;  1JCF A;  1YF5 L;  3VTH A;  3AVJ A;  2JGU A;  4X65 K;  1KLN A;  1CZB A;  3LAN A;  3NDK A;  3AVL A;  3HRG A;  1NJW A;  1LWC A;  3KJV A;  3S9H A;  3HPG A;  3MX5 A;  3OYF A;  4CGF A;  2IC3 A;  3H46 O;  4E1N A;  4JI8 K;  2Z1G A;  1BL3 A;  4JI5 K;  4IG0 A;  3NCI A;  1RT5 A;  4B9Q A;  2NUB A;  3AO1 A;  3LP3 A;  1TUU A;  1VAZ A;  3UKU B;  3THX B;  3TAN A;  3P31 A;  3LWM A;  3IUC A;  2OCE A;  3SMS A;  3KTQ A;  1GOA A;  2W6L A;  1QHT A;  2ATQ A;  3RSE B;  2ZF5 O;  2P1J A;  4N47 A;  4B08 A;  3OYL A;  4LFC K;  3CMA N;  4CFB A;  3BEX A;  3J8A A;  5IWA K;  2UUC K;  3UE5 A;  4N76 A;  3GG4 A;  4HCB A;  1NGG A;  1XNQ K;  1JLC A;  4CZF A;  2PBD A;  1HQE A;  3HOS A;  1ZBL A;  3NHG A;  3HOT A;  2IOC A;  2DFE A;  4DSJ A;  3OYN A;  4B9M A;  2HNY A;  1NLV A;  5E84 A;  4JS5 A;  1D9D A;  2A40 A;  3OS1 A;  3WT0 A;  3CCM N;  1K8K B;  3K59 A;  1YAG A;  4ICL A;  2R7Y A;  1VQM N;  1HJR A;  4FVM A;  3LPU A;  2Q3S A;  4CFA A;  1ASU A;  3A5N C;  3GBT A;  1Y97 A;  1IO2 A;  2Q31 A;  1NNE A;  4DLG A;  2XRI A;  5BPL A;  5E41 A;  2NRX A;  1D9F A;  4WQ5 C;  4BRL A;  2V7Y A;  2XHB A;  1KAZ A;  4X66 K;  3MAQ A;  2Q0R A;  4CW7 B;  1NM1 A;  4KO0 A;  1SS6 A;  4FJN A;  3DXK A;  4K42 A;  3AO3 A;  4Y1C A;  4CI6 A;  1SZ2 A;  5TKW A;  3B6P A;  4Y1D A;  5F1X A;  1QTM A;  3ITH A;  1FK9 A;  3K9J A;  4B9T A;  1ATR A;  4FJI A;  3C6T A;  4PY5 A;  1RBT A;  3QBW A;  4IFV A;  2QI2 A;  2ZGZ A;  1OH5 A;  2WC9 A;  2E20 A;  2O4I A;  1BU6 O;  4BR9 A;  4FM2 A;  1X9M A;  4KTZ A;  5FPN A;  3OBW A;  3J7Y P;  4DS5 A;  4CBX A;  2F8T A;  4ELU A;  3C65 A;  1RDA A;  1YI2 N;  4B8C A;  3HM8 A;  3HST B;  4QCL A;  4CGI A;  1XMQ K;  2OTL N;  2D0O A;  1DT9 A;  4EP5 A;  3LDS A;  5AQL A;  4NYN A;  1JCE A;  3EZW A;  3H3N O;  4JS4 A;  2E6L A;  2QWN A;  1RCH A;  2QWP A;  4M3T A;  3WXK A;  4BR5 A;  2OPQ A;  3JS6 A;  1Q9Y A;  5JS2 A;  5AQM A;  4GNI A;  3DLB A;  1FKP A;  2UXC K;  4HUF A;  2KFN A;  3QB0 A;  2G8F A;  1IBK K;  2E6M A;  4PHT X;  4DQS A;  3BF1 A;  4W5R A;  3TWH A;  2YHY A;  4UQG A;  3VF6 A;  3ID8 A;  2ZQB A;  3KVG A;  1YXQ A;  3EYZ A;  5C12 A;  3E9L A;  4FK0 A;  1BI4 B;  5KRT A;  5CY4 A;  4CJ4 A;  4DQR A;  4DFK A;  1QQM A;  2E4L A;  3I8D A;  2QXL A;  3VGM A;  1VSK A;  2GX9 A;  2YKN A;  1BG3 A;  2D0C A;  4DV7 K;  4CJF A;  1UAX A;  4H0Y B;  4M3Y A;  4CIE A;  1XMO K;  3VEO A;  4G9Z A;  4H0P A;  4BDP A;  1IKX A;  2HHV A;  1HKB A;  3VEY A;  4DTS A;  1WOQ A;  3M8R A;  4FWM A;  3T1Y K;  5CZ1 A;  1NJI O;  4KHP K;  2QEX N;  2P9P B;  3CCU N;  4J2B A;  4MDB A;  4FK4 A;  4IO8 A;  4R5P A;  5FRN A;  4AHC A;  1NOY A;  2A1R A;  4FSV A;  1FXX A;  3KLI A;  2Y1I A;  4BC5 A;  5GIO A;  2NLX A;  3KLG A;  1T3V A;  2OZM A;  1XC3 A;  1DEJ A;  3I56 N;  1WBB A;  3KK1 A;  4IFY A;  5AQY A;  1CZ9 A;  5K14 A;  4CCH A;  5CR4 A;  1U6Z A;  4IOA L;  2YNG A;  1GLA G;  4H8K A;  3VET A;  1Z25 A;  1VSJ A;  3VES A;  4FLV A;  4IXC A;  1WSG A;  5JLH A;  4H5W A;  2QKB A;  4YDU C;  3E9P A;  1FKO A;  2ZWH A;  3EE9 A;  1HPZ A;  3OYH A;  3PX0 A;  5AQU A;  4CE9 A;  4YDU A;  3O9S A;  2UXB K;  3E01 A;  4BDY A;  2RE2 A;  2O8B A;  1KVC A;  4I7F A;  4JHD B;  5FRO A;  3GOI A;  1Q9X A;  4C8K A;  2VQF K;  3FR0 A;  4KHS A;  1VSF A;  3WNF A;  3S3M A;  4AHV A;  2NRV A;  3WXJ A;  4JI6 K;  4DCH A;  4RW7 A;  1KCF A;  3G25 A;  3SAG A;  3HPH A;  3KKR A;  1WN7 A;  3OYC A;  3TSQ A;  5HBM A;  4DV5 K;  2FC0 A;  3O6W A;  4DTM A;  5KQD A;  1NKC A;  3JAM O;  2HHQ A;  4DSK A;  1C1C A;  4YOT A;  3FGU A;  1RBR A;  3GDQ A;  4M7Y A;  3LM2 A;  1YHQ N;  3HPO A;  4JEP A;  1W97 L;  4CBW A;  3OYJ A;  4DV3 K;  1Q86 O;  1YUW A;  5FDL A;  2O8C B;  5A2Q O;  3TAQ A;  2OPR A;  2G8U A;  4E7K A;  3QEP A;  5GAH P;  3RMC A;  1DTT A;  1H1V A;  5EX5 A;  3DLR A;  4BRQ A;  2YKM A;  3VQ8 A;  4DUY K;  1V4S A;  3LDO A;  1GLC G;  4YY3 K;  3WEE B;  3NMU A;  2FBX A;  4HVJ A;  4Q0B A;  2Z1I A;  1L5U A;  3CFP A;  1I94 K;  2PY5 A;  4WYB A;  4U7B A;  3CJ7 A;  5JVG L;  1VSI A;  3LAM A;  2E2Q A;  1QQN A;  4HUE A;  5EXW A;  1HR0 K;  3RR7 A;  5BRE A;  1BQN A;  1N36 K;  2KKZ A;  4LSN A;  4CZE A;  4O55 A;  3SI6 A;  1SKS A;  5CHI A;  4IOC L;  1OH6 A;  4DTU A;  3BF3 A;  1WSJ A;  3SUN A;  2QXF A;  3O4Q A;  4CJ7 A;  4OPK A;  3QES A;  3HL8 A;  3VMF B;  5ADX A;  3VGK A;  1CXU A;  4ID1 A;  2IDO A;  5AFU A;  2VCP A;  3IDH A;  3LZJ A;  4O5B A;  1RTJ A;  5EU7 A;  4FJ8 A;  2VWJ A;  3WXI A;  5EOY A;  4FL9 A;  3SV3 A;  3I33 A;  1VQ6 N;  1EXQ A;  5EVZ A;  2QWQ A;  3V9U A;  3TAM A;  1JJ2 M;  5C2D A;  1X3M A;  1IG9 A;  3WUH A;  4BRH A;  5BR9 A;  3HBT A;  2G8I A;  3R3L A;  3L2R A;  1YJN N;  4HTL A;  4KH5 A;  3OYA A;  3WNH A;  2YNI A;  4ILJ A;  2BAN A;  4B1U B;  3W0L A;  3DRP A;  4B9S A;  1BO5 O;  3LP2 A;  1BCO A;  3LZI A;  3CC2 N;  4LH5 A;  3HZ6 A;  4CHP A;  3H1Q A;  3D7E O;  4A57 A;  3VQD A;  4M3X A;  2FSJ A;  3L2Q A;  1NOZ A;  1GLL O;  3C0B A;  3KK2 A;  4EHT A;  4PL7 A;  3I0S A;  3KLE A;  1L3T A;  2HNZ A;  4CEA A;  3SQ4 A;  3ENH A;  5LL6 Z;  4E7J A;  5GAE P;  3CQX A;  3T19 A;  1VSM A;  3T1A A;  4GKK K;  3AA5 X;  2OAN A;  3QNO A;  4OPH A;  1NK4 A;  2HND A;  3KZB A;  4KTW A;  2F9T A;  4KV8 A;  4FM1 A;  2KW4 A;  1JCG A;  1ASV A;  4PKH A;  3OJU A;  1LAW A;  3OYB A;  3M1F A;  3IFR A;  2B6A A;  2F7T A;  3D2E B;  3IG1 A;  2O8E B;  1TV6 A;  4B1W B;  3UKR B;  4CJV A;  3F73 A;  1W9H A;  3LWL A;  4JD2 A;  3HM9 A; 
#chains in the Genus database with same CATH homology
 1LWE A;  3JSM A;  3NE6 A;  1S1U A;  3PY8 A;  3C94 A;  5KI6 A;  1WLJ A;  1VK0 A;  3OYG A;  2WON A;  5HRS A;  4GW6 A;  3LWM A;  3NH1 A;  2GBZ A;  4DTP A;  4OLA A;  1U4B A;  5HRR A;  4DFP A;  3KTQ A;  1A5X A;  4KRF A;  3TI0 A;  1GOA A;  4WE1 A;  3VQ5 A;  3K58 A;  3RWU A;  3OYE A;  3RTV A;  1HRH A;  3DLG A;  1L3V A;  4ELT A;  3LAL A;  4OVL A;  1QHT A;  1SV5 A;  1TKX A;  2ATQ A;  3DRS A;  3TAE A;  2ITG A;  2P1J A;  4N47 A;  1JL2 A;  5KRS A;  1K6Y A;  3PX6 A;  4B08 A;  3P1G A;  4KHU A;  2ETJ A;  3OYL A;  4B9N A;  3VQB A;  4O0J A;  3VQC A;  4L8R B;  4CFB A;  1JLB A;  5C25 A;  1KFS A;  1TL3 A;  5I42 A;  3SNN A;  3V1Q A;  3RRH A;  1NJX A;  3QIN A;  3P83 D;  4CED A;  3CFO A;  4N76 A;  4I2P A;  4HCB A;  1TKZ A;  1J53 A;  1JLC A;  4FLT A;  1NJY A;  1L3S A;  4K8X A;  1RTD A;  4KHY A;  1HQE A;  2FBY A;  4DU4 A;  4CF8 A;  4CK1 A;  4ZTJ A;  2PYJ A;  4W5T A;  3NHG A;  1ZBL A;  3SZ2 A;  3ASM A;  4DFJ A;  1WSH A;  4M3Z A;  1BCM A;  1QS4 A;  2DFE A;  2IOC A;  3AVA A;  3CM6 A;  4CJR A;  1D8Y A;  3OS0 A;  3OYN A;  4DSJ A;  1XC9 A;  3AO5 A;  5DK5 A;  1A5V A;  4GVM A;  4RW8 A;  4DTN A;  4B9M A;  2HNY A;  4JS5 A;  1D9D A;  5C24 A;  3WNE A;  3OS1 A;  4DSI A;  2IGI A;  4FJH A;  1J9A A;  1KFD A;  1X1P A;  3KKS A;  3K59 A;  2DTU A;  4ICL A;  2R7Y A;  3SPY A;  2HMI A;  3HK2 A;  4FJX A;  4AH9 A;  1HJR A;  2FBT A;  3LPU A;  4FVM A;  2Q3S A;  4OGE A;  4CFA A;  5CZ2 A;  1SKR A;  1ASU A;  1O1W A;  1Y97 A;  4OKK A;  1IO2 A;  3NGZ A;  3K2P A;  1WSF A;  2YNH A;  3MXJ A;  3ZSO A;  1T7P A;  4Z4F A;  4DLG A;  2ZD1 A;  2XRI A;  3PV8 A;  4KB1 A;  4CEE A;  2HHU A;  1HYV A;  3G10 A;  1SKW A;  1HQU A;  4B9U A;  4CK3 A;  1TK8 A;  4HHT A;  3SQ2 A;  1TKD A;  4N5S A;  5E41 A;  4FJJ A;  1C1A A;  3RRG A;  4DQI A;  1D9F A;  4QAG A;  2XHB A;  1A5W A;  5SWM A;  4CJS A;  2RKI A;  4XIU A;  1S9G A;  4O4G A;  3MAQ A;  1NK0 A;  2D0A A;  4M41 A;  1B9F A;  1JLG A;  4CJL A;  3TAG A;  1HYS A;  1NJZ A;  4JRQ A;  1VSD A;  4KO0 A;  4DTR A;  4FJN A;  1XHX A;  5J2Q A;  3AO3 A;  3LP1 A;  4Y1C A;  3SQ1 A;  2DFH A;  3B6P A;  1RTI A;  4Y1D A;  1QTM A;  1D5A A;  3ITH A;  1FK9 A;  1C0T A;  4B9T A;  4FJI A;  3C6T A;  4PY5 A;  3QNN A;  1RBT A;  4EP4 A;  4NCB A;  4RW6 A;  4Z4E A;  4IFV A;  4Z4G A;  2LSN A;  4DSL A;  4FW1 A;  5HRO A;  3AVF A;  2O4I A;  5HLF A;  3AVI A;  3AA4 A;  1X9S A;  4FLY A;  1Z26 A;  3AA3 A;  4FM2 A;  1X9M A;  2QK9 A;  3WNG A;  3HVR A;  4CIG A;  4KHN A;  4KTZ A;  4CFC A;  1W0H A;  1ZBF A;  4DS5 A;  1CXQ A;  4TSX A;  4CEF A;  2F8T A;  4ELU A;  3NH0 A;  1RDA A;  1T05 A;  4CJQ A;  1UWB A;  2YNF A;  2XY7 A;  1TAQ A;  1JLF A;  4MFB A;  4B8C A;  5T7B A;  4FCY A;  3I0R A;  3HST B;  3A2F A;  3P5J A;  4CGI A;  3DI6 A;  2X78 A;  4QCL A;  4CHY A;  3BDP A;  3F9K A;  4EP5 A;  3DOK A;  3DLK A;  3LDS A;  3L2V A;  4KI4 A;  4AHR A;  1JLE A;  1JL1 A;  4NYN A;  1RT1 A;  4OLB A;  2XY5 A;  4JS4 A;  3HT3 A;  2E6L A;  1RBU A;  3O3G A;  1SL0 A;  1NK9 A;  1RCH A;  4AHT A;  1NK5 A;  4AIL C;  4M3T A;  1G15 A;  4FM0 A;  4J2E A;  2P51 A;  2I5J A;  2OPQ A;  2B4J A;  3NAE A;  1TK0 A;  1Q9Y A;  5JS2 A;  3DLB A;  1NK7 A;  1FKP A;  4KI6 A;  3AA2 A;  3AVC A;  4HUF A;  1HNV A;  4DF8 A;  4Z4I A;  2XO7 A;  2KFN A;  2X6N A;  2G8F A;  3RR8 A;  2E6M A;  3MEC A;  2DFF A;  4M45 A;  3V1R A;  1S1V A;  1QSL A;  4DQS A;  3SQ0 A;  4W5R A;  4CGH A;  4UQG A;  3TWH A;  4CEB A;  1UA0 A;  1Q8I A;  1KRP A;  2ZQB A;  3EYZ A;  4W5O A;  3DLH A;  2HB5 A;  1WSI A;  4DTJ A;  2EX3 A;  4FK0 A;  2HHX A;  1BI4 B;  4ID5 A;  5KRT A;  3ALY A;  5CY4 A;  4CJ4 A;  4DQR A;  4B9L A;  4Z4H A;  3L3V A;  4DFK A;  1U49 A;  3QEX A;  3ZSV A;  3K5L A;  2E4L A;  3I8D A;  3C6U A;  4IBN A;  4BE0 A;  1CLQ A;  4FYD A;  1NKB A;  1XWL A;  3VA3 A;  4ZHR A;  4F2S A;  1VSK A;  1GOC A;  1ASW A;  2YKN A;  3OYM A;  4JRP A;  1U45 A;  2D0C A;  1YVU A;  3M8P A;  4CJF A;  1UAX A;  4CEZ A;  4I9L A;  1N6Q A;  4E3S A;  4ELV A;  1S6Q A;  4RW4 A;  2YHA A;  4M3Y A;  4CIE A;  3V9S A;  1VRT A;  1T03 A;  4PUO A;  3VQA A;  5J2N A;  4BDP A;  5CYM A;  3QIO A;  4FJ7 A;  1HYZ A;  2AJQ A;  1IKX A;  1BQM A;  4KPY A;  3HVT A;  2HHV A;  2A1S A;  1EKE A;  1RT2 A;  3ZSZ A;  2OZS A;  3EY1 A;  4DU3 A;  3O3H A;  1ZBU A;  1TKT A;  4DTS A;  4C8L A;  1T8E A;  3M8R A;  4FZX C;  1S1T A;  3QEV A;  1DTQ A;  5CZ1 A;  4CJT A;  1HMV A;  1SUQ A;  4CEC A;  1RDB A;  3PO4 A;  4CGG A;  4EZ6 A;  4N56 A;  5HP1 A;  2IAJ A;  2G8K A;  2Y1J A;  4J2B A;  4FK4 A;  4QOZ B;  4M3R A;  4R5P A;  3HO1 A;  5C42 A;  1TK5 A;  5FRN A;  4AHC A;  1NOY A;  1TGO A;  2A1R A;  1J5O A;  1FXX A;  3RMA A;  3KLI A;  2Y1I A;  3DYA A;  3MEE A;  4F3T A;  1RDD A;  3QO9 A;  3MXM A;  4CF2 A;  3KLG A;  4CJK A;  2OZM A;  3CM5 A;  1VSH A;  4PA1 A;  3ZSW A;  3KK1 A;  4IFY A;  1KLM A;  4O44 A;  2GV9 A;  4CIF A;  5K14 A;  1CZ9 A;  4DLE A;  3IRX A;  2G8H A;  3AO4 A;  4CHN A;  3KLF A;  2G8W A;  4RW9 A;  3K5M A;  3CG7 A;  4CCH A;  3VQ4 A;  3THV A;  2YNG A;  1WAF A;  4H8K A;  4M3U A;  1Z25 A;  3OVN A;  1VSJ A;  3VQ7 A;  1I39 A;  4FLV A;  3JYT A;  3SPZ A;  2DY4 A;  3NF7 A;  2OPS A;  1WSG A;  2X74 A;  3OYI A;  2QKB A;  3LAK A;  2XY8 A;  1JXB A;  4CF0 A;  1C0M A;  1FKO A;  2JLE A;  4CJP A;  3OS2 A;  4W5N A;  4H4M A;  4OGC A;  4KHQ A;  1LWF A;  3EZ5 A;  5J1E A;  1HPZ A;  2P5O A;  1BIZ A;  3H08 A;  4CGJ A;  4Q5V A;  3OYH A;  4ZTF A;  3PX0 A;  3V9Z A;  3NGI A;  3K57 A;  1IKW A;  3SUP A;  3AV9 A;  3UIQ A;  4CE9 A;  3L2U A;  4LY7 A;  2RN2 A;  3M8Q A;  5D3G A;  4OKJ A;  1RBS A;  3E01 A;  1VSE A;  4AHS A;  4BDY A;  4GMJ B;  4CHQ A;  4J2A A;  1KVC A;  2KZM A;  4IKF A;  3KLH A;  3HP6 A;  4I7F A;  3ZSQ A;  3U3Y A;  4CF1 A;  2XY6 A;  4DWI A;  4K8Z A;  1JXE A;  3HXM A;  5FRO A;  1F21 A;  4FLU A;  1Q9X A;  2B5J A;  2PZS A;  2P5G A;  4C8K A;  3OYD A;  2HHW A;  3ZT0 A;  4I2Q A;  1JKH A;  3PX4 A;  1VSF A;  2W42 A;  4KHS A;  4KAZ A;  1C6V A;  3WNF A;  4CJE A;  4AHV A;  3SYZ A;  3S3M A;  2O4G A;  1SL2 A;  3L8B A;  4RW7 A;  1KCF A;  1NK6 A;  4RG8 A;  4E19 A;  2VG7 A;  4JLH A;  2PYL A;  3RMB A;  1TVR A;  3SJJ A;  4BAC A;  3HPH A;  3KKR A;  1WN7 A;  5I3U A;  4CGD A;  3AVG A;  3OYC A;  2Z1H A;  4FLW A;  4J2D A;  4FJ9 A;  3V6D A;  4CER A;  5HBM A;  1BI4 A;  2FBV A;  4DMN A;  3QEW A;  3TAB A;  5HRN A;  5J2P A;  3AVM A;  2FC0 A;  3L2W A;  4DTM A;  1NKC A;  1N5Y A;  1UA1 A;  3KD1 E;  2HHQ A;  4DSK A;  3IS9 A;  1C1C A;  3K5O A;  3NH2 A;  1SL1 A;  1RBR A;  1RT6 A;  4OJR A;  4HTU A;  4W5Q A;  3HPO A;  1QSY A;  4CK2 A;  1RT3 A;  1KSP A;  3OYJ A;  1EET A;  3G0Z A;  5J2M A;  1UOC A;  1RT7 A;  5FDL A;  3VA0 A;  1REV A;  2OPR A;  4AHU A;  1BIU A;  4DF4 A;  3TAQ A;  4E7K A;  3QEP A;  3T3F A;  2G8U A;  4NCA A;  3NBP A;  3VQ9 A;  2Z1J A;  2OA8 A;  3RMC A;  1U48 A;  3ZSX A;  1DTT A;  3TAF A;  2OPP A;  4C8N A;  2VG6 A;  2D0B A;  3DLR A;  4E7H A;  2RF2 A;  4CJ5 A;  3VQ6 A;  1VSL A;  1ZBH A;  1XI1 A;  2YKM A;  3VQ8 A;  2YHB A;  4CHO A;  1TL1 A;  2BE2 A;  4HUG A;  3OJS A;  1KVB A;  3MEG A;  4KFB A;  5KTQ A;  4LH4 A;  1TAU A;  5KGX A;  3TAP A;  2FBX A;  4HVJ A;  4Q0B A;  2Z1I A;  1L5U A;  3CFP A;  3ZT1 A;  3DM2 A;  2PY5 A;  4DQQ A;  1RT4 A;  3ZSR A;  4CEQ A;  3QER A;  1B92 A;  4CJW A;  3AO2 A;  1LW0 A;  1VSI A;  3LAM A;  3VQQ A;  3K5N A;  3SV4 A;  2HHS A;  5DMR A;  3V1O A;  1C1B A;  3AVH A;  1NKE A;  1BHL A;  4FJL A;  4HUE A;  3MED A;  5KGW A;  4B8A B;  3RR7 A;  3QET A;  2HVH A;  4LD0 A;  4B9V A;  5FRM A;  1BQN A;  1S1X A;  3PO5 A;  4FJK A;  4FZY A;  4E7I A;  3V4I A;  2KZZ A;  4LSN A;  1QQC A;  4FW2 A;  3M8S A;  1WSE A;  3NF9 A;  3NF6 A;  3SUO A;  4O55 A;  3SI6 A;  1SKS A;  1EX4 A;  4YFU A;  1WAJ A;  3OY9 A;  1S1W A;  3CYM A;  4FK2 A;  3O3F A;  3HYF A;  4M3W A;  4DTU A;  2RPI A;  1KVA A;  1WSJ A;  2QXF A;  3O4Q A;  4OPJ A;  4OPK A;  3QES A;  1VRU A;  3OYK A;  3HL8 A;  3SUN A;  1R0A A;  4KTQ A;  4N41 A;  2HVI A;  1HNI A;  1CXU A;  1RNH A;  4ID1 A;  4NYF A;  4DSE A;  2IDO A;  3AVB A;  2G8V A;  3HJF A;  3LZJ A;  3V9W A;  1JLA A;  4O5B A;  3TR8 A;  1RTJ A;  3CQ8 A;  5EU7 A;  3VQE A;  4FLZ A;  4FJ8 A;  1RTH A;  2VWJ A;  2D5R A;  4MQ3 A;  1LW2 A;  4IG3 A;  1X9W A;  4G1Q A;  1J54 A;  4FJG A;  4PWD A;  4Z0U A;  1KTQ A;  3CFR A;  3LP0 A;  4BE2 A;  3SV3 A;  4KHW A;  1EXQ A;  2ZE2 A;  3V9U A;  3SCX A;  3DLE A;  3DOL A;  3TAM A;  3QLH A;  2KQ2 A;  3SUQ A;  1NK8 A;  3U6F A;  4DQP A;  2BDP A;  3ZCM A;  4F8R A;  4FZZ A;  4CES A;  1IG9 A;  4NCG A;  2HHT A;  4PQU A;  3L3U A;  3ZT4 A;  1S5J A;  3ZSY A;  3RMD A;  2G8I A;  4CF9 A;  1XHZ A;  3L2R A;  2YV0 X;  3OYA A;  1U47 A;  1GOB A;  3WNH A;  1RIL A;  2YNI A;  2BAN A;  4CFD A;  1U04 A;  4BWJ A;  4F4K A;  3DRP A;  4BWM A;  3NF8 A;  3KK3 A;  3AVN A;  3ZT2 A;  1L3U A;  2F96 A;  3HP9 A;  1QSS A;  4B9S A;  2KFZ A;  4DTX A;  3LP2 A;  4CEO A;  4YNQ A;  3MXI A;  1BCO A;  4CJ3 A;  1S6P A;  3NFA A;  3LPT A;  3LZI A;  1S9E A;  3BGR A;  4LH5 A;  5CYQ A;  1LV5 A;  4CHP A;  3C95 A;  3PUF A;  4E0D A;  2VWK A;  1YTU A;  1I3A A;  1BIS A;  3VQD A;  1YT3 A;  2X6S A;  3U3G A;  3TAR A;  4C8O A;  4M3X A;  4CHZ A;  2BGG A;  1LAV A;  2IS3 A;  3L2Q A;  1NOZ A;  1EP4 A;  3S3O A;  3KK2 A;  4BDZ A;  3I0S A;  4CJU A;  3QEI A;  1QE1 A;  3V9X A;  1BGX T;  2OYQ A;  4F2R A;  1ZBI A;  1IKV A;  5HRP A;  3S3N A;  4HCC A;  1ZYQ A;  3B6O A;  3KLE A;  2HNZ A;  1L3T A;  4CEA A;  3SQ4 A;  4Z4C A;  3D0P A;  3KIO A;  5SZT A;  1IH7 A;  1DLO A;  3QIP A;  4E7J A;  1JLQ A;  3T19 A;  2KTQ A;  1VSM A;  2F8S A;  4DG1 A;  1ITG A;  3D45 A;  3T1A A;  3FFI A;  4E7L A;  3AVK A;  1IKY A;  1B9D A;  4FLX A;  4FJM A;  3AA5 X;  3QNO A;  3ULD A;  4FJ5 A;  4EZ9 A;  1YTA A;  1RDC A;  1C0U A;  4DSF A;  1NK4 A;  4KKO A;  2HND A;  3AVJ A;  4KRE A;  4C8M A;  4KTW A;  2JGU A;  4DTO A;  4E89 A;  4H4O A;  4F3O A;  4KB0 A;  2WOM A;  4KV8 A;  4FM1 A;  2KW4 A;  1CZB A;  3LAN A;  3NGY A;  3NDK A;  1KLN A;  3AVL A;  3IAY A;  1ASV A;  4O0I A;  1NJW A;  1LWC A;  3KJV A;  3S9H A;  2HW3 A;  3HPG A;  3OJU A;  1LAW A;  4OKE A;  3OYB A;  4BE1 A;  3OYF A;  4DS4 A;  2B6A A;  3O4N A;  4CGF A;  2IC3 A;  2QKK A;  3DRR A;  4I9Q A;  4IDK A;  4DFM A;  3IG1 A;  4E1N A;  4E1M A;  4M42 A;  1RBV A;  2Z1G A;  1BL3 A;  1TV6 A;  3VQP A;  4IG0 A;  3NCI A;  4B3O A;  3V81 A;  1MU2 A;  4CJV A;  3F73 A;  1WNS A;  1W9H A;  3DMJ A;  1RT5 A;  2GUI A;  5JS1 A;  2NUB A;  2EHG A;  3ZT3 A;  3LWL A;  3AO1 A;  4FXD A;  3ISN C;  4LSL A;  3LP3 A;  3VN5 A;  3HM9 A;  4DU1 A;  3KD5 E;  3TAN A;  2VG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...