3V9UA

Crystal structure of rnase t in complex with a preferred ssdna (aat) with two mg in the active site
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
206
structure length
206
Chain Sequence
NAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSGYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
total genus 68
structure length 206
sequence length 206
chains with identical sequence B, C, D
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3v9uA00
4IG0A 3WNGA 1EP4A 3KLGA 4FVMA 4CF8A 4DMNA 4CFAA 5C42A 3VN5A 4HUEA 3AA4A 3AO4A 4CFDA 2Z1HA 4CHPA 3S3OA 4OLBA 1C1AA 3VQ5A 3AO1A 1QQCA 4FJLA 4DSFA 2ZQBA 4CJTA 4RW8A 3PV8A 4HCBA 4KHWA 3NF6A 3NF9A 4IDKA 3KK1A 4DF8A 2OZMA 4CGFA 4E7IA 1JLCA 4CK2A 2YV0X 3D0PA 3OVNA 1C0MA 4CJEA 3NGIA 4DQQA 3SPYA 3SNNA 4O55A 4W5OA 2HNZA 3OYIA 3SUOA 4AILC 3V1QA 3AVJA 3HK2A 1C6VA 4ZHRA 3QEVA 1J54A 3A2FA 4DTXA 1D5AA 3IAYA 5JS1A 4E7HA 2GBZA 5KI6A 3OYEA 3F73A 3MXMA 2IC3A 3HP9A 3HVRA 3QEPA 3DLHA 2HHTA 4DQRA 2JGUA 4KHQA 2KZZA 1X1PA 4B08A 2Z1IA 4F2SA 3E01A 4CEFA 4FJ9A 1HNVA 1WSGA 3IRXA 4M3WA 3V9XA 3LP1A 4LSNA 4CHZA 3VQ8A 3M8QA 1IKVA 5E41A 1ASVA 4N41A 4K8XA 2BE2A 1GOCA 4IBNA 3G0ZA 3U3GA 4W5TA 1TK8A 3TABA 4YNQA 3HPOA 3L2VA 4BE2A 1U45A 2A1SA 1NK8A 3AV9A 3AVAA 2XY5A 4Z4FA 3AVGA 4OKEA 1TV6A 4Z4CA 4KTZA 3AA5X 2XO7A 3RR8A 1JKHA 1RNHA 3QINA 1JXEA 4NYFA 1QSSA 3IG1A 3BDPA 4OVLA 2XY6A 3RRHA 3HPHA 1BL3A 2Z1JA 3WNFA 4CJLA 1NJZA 4KB1A 4FXDA 1VSJA 4FJ7A 4FYDA 3HPGA 1KFSA 3ITHA 4QOZB 1D9DA 1RBSA 3KK3A 1RILA 3TR8A 3NF8A 5HRSA 4FLVA 3ZSWA 4E0DA 1VSHA 1J9AA 4LY7A 3ULDA 5I42A 1RTDA 3PUFA 1XHXA 2G8FA 3AA2A 3PX0A 4CHQA 4W5RA 4BACA 1C0UA 3ZSQA 3SV3A 1L3VA 3ZSZA 3DLBA 1JLGA 4CE9A 2P5GA 3VA0A 1CLQA 4F3TA 3WNEA 4O44A 3FFIA 3QESA 5SZTA 3SPZA 4PUOA 3AO3A 3PX4A 2AJQA 2OPPA 3LANA 4CEBA 3B6OA 4Y1DA 4KTQA 4DG1A 3SV4A 1ZBHA 2HMIA 4DSJA 2HVHA 3KK2A 4B9NA 2QK9A 3MEDA 1HMVA 3OYLA 3T1AA 3P1GA 3TARA 1RT7A 4E3SA 4KFBA 4ZTJA 4NCBA 4ZTFA 1VSFA 4GMJB 4ID1A 1XI1A 1XHZA 4DQIA 3ZSVA 4CF9A 1BHLA 4CGDA 1Y97A 3VQ4A 3K58A 2YNIA 4CJPA 1IKWA 4NCGA 4CJWA 2E6MA 5J2QA 4ELVA 3KLEA 4C8MA 3L2QA 4WE1A 4OJRA 4CJ4A 3NE6A 4F4KA 2BANA 4OGCA 2FBTA 3IS9A 2D5RA 1ZBFA 1RT3A 1RTJA 3VQEA 3ZT1A 1DTQA 4UQGA 3NH0A 3O3FA 3MEGA 3SI6A 1FKOA 4CEEA 3S3MA 3HJFA 3H08A 3CFOA 1EKEA 4KKOA 2XY8A 4C8KA 2GUIA 2B4JA 1WSJA 1IKYA 3VQDA 3OYAA 4DFKA 2HHXA 3P83D 3AVCA 1S6PA 3CM6A 2B6AA 3NBPA 4N56A 3PO5A 4M45A 2O4IA 4I9QA 2ITGA 4CGGA 1NK9A 1N5YA 3CFPA 2YNHA 3DRPA 4FW1A 2F8TA 3JYTA 4YFUA 4B9TA 3ZSXA 3HYFA 1RT5A 4JLHA 3ZT0A 2DFFA 5CZ2A 5CYQA 3TAGA 4M3XA 4W5NA 1WSIA 4IFYA 3DRRA 3I8DA 3V6DA 3NFAA 4FJJA 1ZBLA 3C95A 3QETA 3LPTA 5HRNA 3OYKA 5KRSA 4OKKA 4KI4A 4FM1A 4O5BA 4CF0A 4CEAA 2D0BA 1TKTA 1RBRA 2E4LA 3AVBA 3QO9A 2PYLA 1VRTA 3OS2A 3K5MA 1C1CA 2Q3SA 3QIPA 4BWJA 3LP2A 4F2RA 1TAUA 4JRPA 1SKRA 4CESA 4DF4A 3LP3A 3ALYA 1TKZA 1HPZA 3S9HA 3DMJA 5C25A 3TWHA 3CG7A 3DLRA 1RTHA 4FLZA 1A5WA 1S1VA 4E7LA 4DTSA 4FJXA 1WSEA 4BDZA 4KV8A 1U48A 4AHTA 3V81A 3SUQA 3THVA 3ZSOA 3CYMA 2OPQA 3L3VA 4G1QA 1SL0A 1YTAA 1KSPA 1XWLA 3ZSYA 3NAEA 1VRUA 4E89A 3V9UA 1BCMA 4J2DA 1T05A 2IAJA 4KAZA 2R7YA 4FJ8A 3HT3A 2DY4A 4PY5A 1FK9A 1Q8IA 2GV9A 3DLEA 1Q9XA 3OYMA 3SQ1A 4HUFA 2DFHA 4CEDA 3EY1A 3I0RA 1CXUA 4OKJA 4H8KA 1NKEA 5J2MA 4KRFA 4HCCA 2BGGA 4AHSA 2JLEA 2QKBA 1G15A 4RG8A 1BI4A 3VQ6A 3MECA 4KREA 1NKCA 3NCIA 1EX4A 1KTQA 2IOCA 3ASMA 4DS5A 1NK4A 5FDLA 4ELUA 5FRMA 1NOYA 3TAPA 3B6PA 4B8AB 4CJ3A 4NCAA 4RW6A 5JS2A 3SJJA 1JXBA 2Y1IA 5I3UA 4FJHA 1A5VA 4RW4A 3O3GA 3OYGA 3K57A 1HYZA 4KB0A 4CJQA 4M3UA 3VQCA 4PA1A 3SQ2A 1U04A 1NK5A 4E19A 2LSNA 3VQAA 4DLEA 4CJKA 1EXQA 2OPRA 4CIEA 2ZD1A 4IFVA 4DQSA 2IGIA 4CF2A 3BGRA 3EYZA 2D0CA 2OPSA 3KLHA 1SV5A 4KHYA 5C24A 2P1JA 4DU3A 4DSLA 4LD0A 3KD1E 1WLJA 2KFZA 4QCLA 3DLKA 1L5UA 4FZZA 3M8RA 1S9GA 2PY5A 2FBXA 2OZSA 4KPYA 3AVLA 1HQEA 2FC0A 3OYNA 1BQNA 3RRGA 3G10A 2OA8A 1B9FA 1MU2A 3MXJA 3D45A 3RMBA 1UA1A 1S5JA 2Z1GA 1IH7A 4R5PA 4FZXC 4CEZA 4I9LA 4I2QA 1BCOA 4E7KA 2XHBA 1W9HA 1BIZA 3UIQA 1A5XA 4Q5VA 3LP0A 2YKNA 3T19A 1QS4A 1I3AA 3ZT3A 3C6TA 1CXQA 1N6QA 4OPJA 3DOKA 4BWMA 4Z4HA 5EU7A 3RTVA 2HB5A 4DLGA 1I39A 4BE1A 1KCFA 4EP4A 4FLUA 2HNDA 1BISA 3VA3A 1QTMA 3V9ZA 1HJRA 1DLOA 3NHGA 1NJWA 4FJKA 3HSTB 2OYQA 4K8ZA 1S1UA 1RDAA 4Z4IA 1S1WA 1BI4B 1JLBA 4JS5A 1SKSA 3AO5A 3OYJA 3AVNA 3KJVA 2HHQA 1J5OA 1T03A 2G8HA 1RDDA 3O4NA 3TAFA 3O4QA 3SQ4A 2X6NA 3OS1A 1NK0A 1XC9A 3DYAA 4MFBA 4DTPA 3AA3A 4DTNA 1SKWA 3M8PA 1UA0A 1U49A 1GOBA 1KVCA 4CJ5A 3RMCA 1Z25A 4DFMA 3LAKA 3QLHA 1J53A 4BDPA 4M3YA 3NH2A 4HVJA 3LWLA 4ELTA 3OYCA 4E7JA 3MAQA 1HQUA 5CZ1A 4CHNA 5J1EA 4KO0A 1RBVA 2G8UA 3AVKA 4KI6A 1FXXA 4ID5A 3CQ8A 1RT4A 4AHRA 1ZBIA 1KFDA 2G8WA 3L2UA 5KGXA 3HM9A 1U47A 4IKFA 1RCHA 3SYZA 3AVFA 3OYFA 3HO1A 3HL8A 3NDKA 5KTQA 3KKSA 4FJIA 1HYSA 4F3OA 4CHOA 4FZYA 3M8SA 2Y1JA 3ZCMA 3SZ2A 1VSKA 1IG9A 2HVIA 1TKXA 2G8KA 4FJMA 4NYNA 4L8RB 2ATQA 4Z0UA 2RF2A 3VQ7A 2P5OA 1TK0A 4CCHA 2XRIA 3F9KA 4DFPA 1S9EA 2RPIA 3VQBA 1QSLA 4B9VA 4FJ5A 3KKRA 3K5NA 1VSEA 2I5JA 3C6UA 4AHCA 3WNHA 3VQQA 4B9LA 4DS4A 4DSKA 3PO4A 1TAQA 3PX6A 4J2AA 3KLFA 3L3UA 3SCXA 4M3ZA 3I0SA 2FBVA 2HHWA 3OYHA 3LAMA 1TK5A 1HYVA 1LAVA 2YKMA 3DLGA 1FKPA 2RN2A 2YHAA 5SWMA 4OPKA 1L3UA 3V1RA 2KFNA 1Z26A 1TGOA 2IDOA 5DMRA 3HVTA 2PZSA 2VG7A 1RBUA 1NK7A 1KLMA 1QHTA 4QAGA 4CFBA 4CK1A 3ISNC 3V9SA 3CM5A 3C94A 5DK5A 4LSLA 3VQPA 4CEQA 4CJSA 4RW7A 3HXMA 3QEIA 4PWDA 4DWIA 1RT2A 3NH1A 3V1OA 1WSFA 4DTRA 4Y1CA 1SL1A 2YNFA 1LW2A 4M41A 2HHVA 3U6FA 1RBTA 1SL2A 4OLAA 1YTUA 5T7BA 2YHBA 3OY9A 3V4IA 5HROA 4B3OA 2KQ2A 2QXFA 4FLWA 5J2NA 5FRNA 4EZ6A 1JL1A 1VSDA 1WN7A 1WAJA 4HHTA 4CGHA 3VQ9A 1VSIA 3O3HA 3KTQA 4DQPA 1CZBA 1S1TA 1VK0A 3LWMA 1KRPA 1JLFA 4JS4A 1LWFA 4FLTA 1VSLA 1WSHA 3K5OA 5J2PA 4J2BA 4KHNA 4GVMA 1UAXA 3NGZA 2VG5A 1QE1A 2D0AA 1YT3A 3NGYA 3OYDA 3OJUA 3NF7A 5CYMA 3K59A 4DTOA 1X9WA 1D8YA 2BDPA 1RT6A 4DU4A 3LALA 1BGXT 1WAFA 5FROA 2DFEA 1D9FA 1YVUA 1JL2A 4PQUA 3KIOA 1TVRA 5CY4A 4FM0A 4B8CA 4CGJA 4M3TA 4AHVA 1Q9YA 4KHSA 1KVAA 2KW4A 1B9DA 1ITGA 4B9SA 1LAWA 4F8RA 2HHUA 4TSXA 3K5LA 4FW2A 1LV5A 3TAEA 4M3RA 4O0IA 4E1MA 4CHYA 1LW0A 3K2PA 4MQ3A 4LH5A 3L2RA 4DTJA 1JLAA 1LWCA 3DM2A 5HP1A 4EZ9A 1O1WA 4FK4A 4CFCA 4O4GA 4FJGA 1REVA 1TL1A 2XY7A 2KTQA 2FBYA 3TAQA 4CJVA 1IO2A 3SQ0A 5HLFA 1ZYQA 3OYBA 2ZE2A 4DTUA 4FK2A 2YNGA 3KLIA 2VWKA 4CIFA 4CK3A 4CERA 5HRPA 3QNNA 3TI0A 3ZT2A 4CGIA 1NJXA 3KD5E 1S1XA 1BQMA 4N5SA 4DFJA 4IG3A 3DI6A 4FLYA 4CECA 3TAMA 4C8OA 3LPUA 4KHUA 3T3FA 1KVBA 1U4BA 3P5JA 2VG6A 2E6LA 5HRRA 2P51A 2O4GA 4C8NA 4HUGA 1ASUA 1EETA 5HBMA 4E1NA 2WOMA 1KLNA 3QEXA 1NKBA 4CJFA 3QERA 3QIOA 1S6QA 4Q0BA 2QKKA 1HNIA 4DU1A 5KRTA 4M42A 2HNYA 4O0JA 2X6SA 1UOCA 3EZ5A 3L8BA 3U3YA 4N47A 4H4MA 4FM2A 4I7FA 4RW9A 1NK6A 3OS0A 4FJNA 2B5JA 3OJSA 5KGWA 1QSYA 4HTUA 3AVMA 3AO2A 1JLQA 3DOLA 3S3NA 4FLXA 1GOAA 3QEWA 3PY8A 4ICLA 4EP5A 2DTUA 2EHGA 3RWUA 1C1BA 3HP6A 4CF1A 1BIUA 3DRSA 4GW6A 1DTTA 1CZ9A 2W42A 2X78A 1F21A 4B9UA 1X9MA 4I2PA 2G8VA 4BE0A 1X9SA 1L3SA 2IS3A 1NOZA 4BDYA 1IKXA 1RT1A 3ZT4A 1SUQA 2G8IA 2PYJA 1L3TA 1RDCA 3L2WA 4B9MA 4JRQA 2RKIA 3LZJA 1NJYA 5K14A 1LWEA 4DSEA 1UWBA 4FK0A 4Z4GA 3QNOA 3SUNA 2VWJA 1JLEA 1R0AA 4Z4EA 4CJUA 1C0TA 3LZIA 1TKDA 2KZMA 2HW3A 3TANA 4J2EA 1B92A 2HHSA 4DTMA 3LDSA 1ZBUA 3AVIA 2NUBA 2EX3A 1W0HA 4C8LA 4H4OA 1ASWA 1WNSA 2F8SA 4AHUA 4FCYA 3V9WA 2A1RA 4OGEA 3MXIA 4AH9A 3SUPA 4CEOA 4KTWA 3RMDA 1RDBA 4XIUA 3ZSRA 3CFRA 5D3GA 1HRHA 1T7PA 2ETJA 2WONA 4N76A 3RMAA 4LH4A 2X74A 4W5QA 1RTIA 1TL3A 1VSMA 1K6YA 2F96A 3MEEA 1T8EA 3RR7A 4CJRA 3JSMA 4DSIA 3AVHA 4CIGA
chains in the Genus database with same CATH superfamily
3WNGA 1EP4A 3KLGA 1I94K 5C42A 4EAHD 3A8YA 3AO4A 2Z1HA 1HKGA 1QQCA 2ZQBA 3DJCA 4M63C 4RW8A 4BGAA 4IDKA 1NGFA 4DF8A 3R8EA 2NNWA 4CGFA 5LY3A 3DWLA 3D0PA 1C0MA 4CJEA 5AR0A 3SNNA 4IXCA 1N8RO 2HNZA 5AQUA 4AILC 1C6VA 3RSEB 4ZHRA 3ENBA 2O8EA 5KI6A 3VOVA 3DLHA 2V51B 3LDNA 2NRWA 3HBTA 4M3WA 4LF4K 3V9XA 4LSNA 3M8QA 5AQNA 3AGKA 4BGBA 4N41A 4K8XA 2BE2A 3G0ZA 1HPMA 3TABA 1QQNA 3AV9A 3AVAA 5F2RA 4Z4FA 4DHYA 4OKEA 1TV6A 3FZKA 3MWTA 1JKHA 4NYFA 1QSSA 4OVLA 2UUBK 2OCEA 2WUSA 3RRHA 5JVHL 3F9MA 1KFSA 3ITHA 1RBSA 3KK3A 5BR9A 4FLVA 3L4IA 3MCAB 3TSUA 3OTOK 3GDQA 5I42A 3KZBA 3AA2A 3PX0A 4DR2K 4BACA 4CZHA 5EVZA 3ZSZA 4CE9A 3DLBA 4H5VA 2P5GA 3VA0A 4CBUA 3WNEA 1T3VA 5SZTA 3VF2A 3PX4A 3G6EN 3G71N 5LJWA 4DG1A 1N32K 3EL2A 2HVHA 3KK2A 2QK9A 3TTDA 1K73O 1NGGA 2VGMA 4ZTFA 4DQIA 4EHUA 4IEEA 3K58A 4CGDA 3RSEA 4B1ZA 4CJPA 4CJWA 5J2QA 4OJRA 3NE6A 4F4KA 3M1FA 1RT3A 3ZT1A 4JKHA 3O3FA 1FKOA 5C12A 4C1NK 3S3MA 3IKMA 3H08A 4C8KA 1EKEA 4XH5A 2GUIA 2B4JA 3OYAA 1S6PA 2O4IA 2ZGZA 4I9QA 5GINA 5JICA 4YFUA 3ZSXA 1LOTB 2DFFA 1VHXA 5CYQA 1Q18A 3DRRA 3I8DA 3NFAA 4H0TB 1ZBLA 5HRNA 3CCQN 2ZJRL 4OKKA 2CH5A 4FM1A 2NLXA 4CF0A 1RBRA 4BR9A 4JI1K 2PYLA 3OS2A 1QVGM 3K5MA 2Q3SA 2VQFK 3DAWA 4BWJA 1DGKN 4PL8A 2HSTA 4A2BA 1GLEG 3CG7A 1EWRA 4DTSA 2KZZA 1S1VA 4FJXA 1U48A 3P38A 1SL0A 3CCLN 3VMFB 3HI0A 1VRUA 2PBDA 3P4IA 1T05A 2ZM6K 1NMDA 4FJ8A 3HT3A 2AP1A 1CZAN 3SQ1A 2DFHA 1CXUA 1U2VB 4GKJK 4H8KA 1R59O 4KRFA 3MK6A 2BGGA 4YOWA 4AHSA 1BI4A 3VQ6A 4CZKA 3NCIA 1NK4A 3ASMA 4DS5A 5FDLA 4GVEA 3B6PA 4NCAA 3CCEN 4RW6A 5JS2A 4KH6A 2Y1IA 3SJJA 4RW4A 1QZ6A 3O3GA 3OYGA 4KB0A 4CJQA 4EIAA 3VQCA 4PA1A 2QXLA 3EE9A 3VQAA 1ZXOA 3P39A 1WOQA 4CIEA 4CZFA 1YJWN 3EKSA 3KLHA 4DU3A 1WLJA 3J7ZO 2FSKA 2OZSA 2P9KB 3AVLA 2ASPA 1XQSC 2FC0A 3ZX3A 1BQNA 4LF8K 1B9FA 3THXB 1S5JA 4R5PA 3UKRB 4CEZA 4I2QA 2XHBA 3E9LA 3C65A 3LP0A 3T19A 3MX2A 4GV6A 1ZC6A 1N6QA 4WFNL 5F1XA 3KHYA 3RTVA 5C0YA 4GKKK 4DLGA 4DUZK 3SK3A 1QHAA 4CD1A 1QTMA 4OX9K 3A5NC 2OYQA 1RDAA 2P9NA 1JLBA 1SKSA 1YVNA 3KJVA 5AQLA 4ILJA 3O9TA 2KKZA 4IFEA 3OS1A 1SKWA 3CCJN 1N33K 2DPNA 1GOBA 4DFMA 4H0PA 3NH2A 4K25A 1WB9A 4FWKA 4E7JA 1HQUA 5CZ1A 4KO0A 5BPNA 3CQ8A 5AQHA 1ZBIA 2G8WA 1U47A 4IKFA 1RCHA 1GLBG 3HL8A 4JK8A 3U9ZA 2YJEA 1HYSA 4F3OA 4CZJA 1OKJA 3ZCMA 2G8KA 4FJMA 3O8MA 3VQ7A 3JS6A 3T1YK 3KKRA 3M6GA 2I5JA 2Q97A 3C6UA 4AHCA 3WNHA 3I56N 3EZWA 3PO4A 1HUXA 3O5BA 3KLFA 3I0SA 1LCUA 3CPWM 3E66A 3THXA 3MWPA 1HYVA 2RN2A 3LDOA 2KFNA 1Z26A 2PFUA 1VQ9N 2IDOA 1YXQA 4RCHA 1BA1A 1RBUA 3OBYA 1NK7A 3ZEUA 4BRLA 3V9SA 3CETA 4LSLA 3HXMA 4CEQA 3VGKA 4B9QA 4DTRA 1WSFA 4Y1CA 2CGKA 4YDUC 4B3SK 3BZKA 1YTUA 3OY9A 3THWB 4EFHA 4DV6K 4PKIA 5AZIB 1VSDA 1WN7A 4BRGA 4YDUA 3VQ9A 2A3ZA 1NGCA 1W7AA 1CZBA 1S1TA 3UKUB 1JLFA 4JS4A 4FLTA 1WSHA 1QE1A 4DCHA 4DTOA 4WQ5C 4DU4A 1D9FA 5FROA 3LDQA 3KIOA 4A59A 2FXUA 1TVRA 4YORA 4KHSA 2KW4A 1M90O 4TSXA 1LV5A 4WQ5A 3H3OB 2P9IB 4O0IA 3K2PA 3I8BA 1K8AO 4PL7A 4LH5A 3CD6N 5IT9O 2WC9A 1OH6A 4CFCA 4BR4A 4O4GA 1REVA 3CF5L 2XY7A 4CJVA 5AQRA 1ZYQA 4BC2A 2VWKA 3ZETA 1NJXA 4DFJA 1YIJN 1K8KB 4IG3A 4FLYA 1IG8A 3DXMA 3T3FA 1KVBA 1U4BA 5FPMA 4E1NA 2WOMA 1HKCA 1NKBA 3QIOA 1S6QA 2HOEA 3EZ5A 1UOCA 3U3YA 3L8BA 4N47A 2YCHA 2O8DB 4NB4A 4FJNA 3THYA 3AY9A 2B5JA 5KGWA 1QSYA 3S3NA 4E1JA 1GOAA 4ICLA 1BIUA 2X78A 4IEIA 3OBWA 2G8VA 1HR0K 4BG8A 2E1YA 1SS6A 2D4WA 3ZT4A 2HHHK 3FZFA 3VESA 3K9KA 2RKIA 5AZJB 3LZJA 4CZLA 4Z4GA 2NRRA 3QNOA 4IO8A 2VWJA 2H3GX 1C0TA 3LZIA 1Q7YO 3PIPL 3TANA 5FPNA 3MN6A 2D0OA 4CD3A 2F8SA 4FCYA 2A1RA 4YOVA 1HRHA 1T7PA 4N76A 1NGEA 1RTIA 1T8EA 4FWMA 3RR7A 4CJRA 1NMNA 3AVHA 4IG0A 4CF8A 4DMNA 4CFAA 3VN5A 3AA4A 4CFDA 4OLBA 4CHPA 4FJLA 4CJTA 3PV8A 4HCBA 3NF6A 3MCPA 3CIPA 2OZMA 2P9UA 4E7IA 1JLCA 4BROA 4H0OA 4JKBA 4HWIA 1ZBSA 3SUOA 3AVJA 1NG9A 3HK2A 1Z6RA 2P9PB 5JS1A 5LMUK 4IWVA 4GV3A 2IC3A 3HVRA 2P9SA 4DQRA 4KHQA 1X1PA 4B08A 3E01A 5ELZA 4CEFA 4FJ9A 4Z94A 4CHZA 1IKVA 1XC3A 5JMVA 2KLAA 1GOCA 2FSJA 4J8FA 4YNQA 3HPOA 1U45A 3RR8A 5AZJA 3QINA 5AQGA 1JXEA 1WUAA 3MDQA 3HPHA 2Z1JA 5JLHA 4FXDA 1VSJA 3F2KA 1D9DA 3KVGA 1RILA 3NF8A 1U6ZA 4BY9C 3ZSWA 4W5NA 3ULDA 1J9AA 1NGAA 1XHXA 3U8XA 1C0UA 5HL7L 5KPTA 3CMEN 3G25A 4BVOA 1NJIO 4F3TA 2YJFA 4JK9A 2D0PA 4CBWA 4CEBA 3B6OA 4A5BA 4Y1DA 4KTQA 2KHOA 1ZBHA 2O8EB 1TYQA 4FOEA 3J8AA 4BVPA 1HMVA 5IWAK 3MN9A 3PSFA 3P1GA 2I7NA 4E3SA 4KFBA 3CERA 1X3NA 3DXKB 4GMJB 4ID1A 4CF9A 1BHLA 5F0XA 2A42A 1IKWA 4NCGA 2IVPA 1XUPO 4R79A 1N34K 4BR5A 2FBTA 2D5RA 1RGIA 1VQ8N 1W97L 5AJ3K 3TU5A 3H6EA 4WFAL 4CEEA 4KKOA 2XY8A 3JXUA 2HHXA 5AQSA 1IKYA 5GAGP 3P83D 4N56A 4M45A 1N5YA 1ESVA 2YNHA 3BF3A 3JYTA 1BA0A 3BUZB 4MLEA 4M3XA 4DV3K 3C95A 3QETA 1MDUB 5KRSA 4O5BA 3AVBA 3J81O 3BY5A 4YOUA 3LP2A 4F2RA 3VPZA 4JRPA 1SKRA 4CESA 1HPZA 4O8UA 3TWHA 1NGHA 3DLRA 4K41A 4FLZA 2GTDA 4BDZA 3O9UA 5KPRA 2UYTA 2Q36A 1HKBA 1XWLA 3WT0A 2IAJA 4KAZA 3BP8A 3CC2N 2W41A 2FSNA 2DY4A 4PY5A 1FK9A 4QS8A 1Q9XA 2Q0RA 3Q7CA 4CEDA 3I0RA 4B1VA 3TPQA 5J2MA 3AARA 3DXKA 4RG8A 2WBNA 4KREA 3CCSN 3A5MC 1NKCA 2O8FA 2IOCA 4ISGA 2NRTA 5C15A 4DUYK 4B8AB 1T6CA 1HNZK 5I3UA 1A5VA 5EX5A 3BF1A 4M3UA 3ZLJA 4JI0K 3FR0A 4JKGA 3CCRN 4DLEA 2LSNA 4CJKA 1EXQA 3P31A 4JKEA 5AQOA 2IGIA 3EYZA 4KHYA 3SAFA 1SV5A 1BOTO 5C24A 1IJJA 2KFZA 4UY8O 1L5UA 3QMLA 3M8RA 1XNQK 4KPYA 4DV4K 4LF6K 4CJ7A 3G10A 3EN9A 4JI6K 1MU2A 3MXJA 2GWKA 3K0SA 5C10A 3HSCA 1A5XA 4Q5VA 1QS4A 3LDLA 2O8CA 4OPJA 4MLHA 4BWMA 4FLUA 3VA3A 5M1QA 1KQSM 5BRHA 5CE3A 1BI4B 4JS5A 4L3QA 3AO5A 4BRFA 1J5OA 1T03A 1RDDA 3O4NA 1ATRA 5M1NA 3SQ4A 1NU0A 4BRMA 4MFBA 4DTPA 3M8PA 3TSPA 4CJ5A 1Z25A 3LAKA 4BDPA 1J53A 1S72N 4B1XB 4HVJA 3LWLA 2HBLA 4CHNA 4BC5A 5J1EA 2IVNA 1RBVA 2G8UA 1FXXA 2QEXN 4DR5K 5AFUA 1VQON 2GWJA 2J4RA 2E88A 4LFBK 3SYZA 4DB3A 2QTDA 3NDKA 4AQYK 3KWIA 4CHOA 4FZYA 1GLLO 1TKXA 2VCPA 4BQZA 4C23A 4CCHA 3J7AP 1C0GA 1S9EA 4FJ5A 3K5NA 2UUCK 3VQQA 1TAQA 3L3UA 3SCXA 3O1WA 4M3ZA 4LF5K 1TK5A 1LAVA 2YKMA 3DLGA 1FKPA 3WQUA 2P9NB 3VEZA 3J80O 2O8BA 4DV2K 4NO7A 3CM5A 4KBOA 4M7YA 3QEIA 1SL1A 3CC4N 2YNFA 4M41A 2HHVA 1RBTA 4OLAA 4X65K 2E1ZA 4FWPA 4FLWA 1X3MA 5FRNA 1JL1A 1VQMN 4HHTA 4YOTA 1VSIA 1Z05A 2UXDK 3LWMA 1KRPA 5AQFA 1VSLA 4KHNA 3VTIA 4J2BA 4CZEA 3OJUA 5CYMA 1NGIA 5C2DA 3LALA 1BGXT 1YVUA 1V4SA 4MO4A 4M3TA 4B8CA 4CGJA 4AHVA 3SAGA 1Q9YA 5B8HA 3GL1A 1LAWA 2RE2A 2HHUA 4H5NA 4M3RA 3NVMA 5LL6Z 4WYBA 1IV0A 4DTJA 1JLAA 5HP1A 3Q7BA 1RDWX 5HOOA 1KD1O 4FJGA 5DM6L 2FBYA 2YI1A 3ZEUB 3TAQA 1IO2A 3OYBA 1Q82O 4FK2A 3KLIA 1E4FT 4CERA 5HRPA 3QNNA 3D6RA 3ZT2A 4CGIA 3KD5E 4G9ZA 1MWKA 2I7PA 3TAMA 4KHUA 1ASUA 3R1XA 1KLNA 4IJAA 4CJFA 3QERA 3ID8A 4DU1A 2HNYA 4O0JA 2E2OA 1NK6A 5BRDA 1BG3A 5DM7L 3G4SN 4MDBA 2CGJA 4CF1A 4LC9B 3VERA 4GW6A 1DTTA 2W42A 4BR0A 3C6HA 3L4QA 4B9UA 3SLCA 2IVOA 4BE0A 1X9SA 1L3SA 2IS3A 1NOZA 4BDYA 3KWGA 4FWRA 3HZ6A 1L3TA 3J7YP 2PYJA 4B9MA 4JRQA 1YAGA 1LWEA 3U9DA 4Z4EA 4CJUA 5BR8K 2KZMA 2HW3A 4DTMA 2NUBA 3RVCA 5AFUH 4C8LA 4H4OA 1ASWA 3ZETB 4OGEA 1P8ZA 3CFRA 3DXMB 3O08A 3CCUN 2JWLA 3HOSA 3RMAA 1TL3A 3ENHA 4H03B 3MX5A 1TKTA 4U7BA 3MN7A 2ZGYA 5LMNK 4FVMA 3FGUA 4A5AA 4FSVA 3ZYYX 4HUEA 3THYB 1C1AA 5AQPA 3VQ5A 4DSFA 4KH4A 4JN4A 3SAHA 3NF9A 3FZLA 4KH5A 4DQQA 3OYIA 2QWLA 1VQ4N 1J54A 4JKAA 4DTXA 1D5AA 4E7HA 2GBZA 3OYEA 2EWSA 3N4PA 3HP9A 3QEPA 2HHTA 1NLVA 3WEEA 3F5TA 3LP1A 5KPZA 1GLDG 3I33A 1ASVA 2VYPA 3ENOA 1HNXK 3U3GA 2YHXA 4JD2A 1TK8A 3L2VA 2A1SA 1NK8A 2XY5A 1YI2N 2NRXA 4Z4CA 3AA5X 1RNHA 3IG1A 3VEOA 3D2FA 1IBKK 2XY6A 4FJ7A 3IFRA 3HPGA 1BDGA 4QOZB 3UE5A 3TR8A 4IZ9A 4E0DA 1VSHA 4LY7A 1RTDA 3PUFA 2VWBA 2YHYA 3ZSQA 1L3VA 2QWNA 2E2PA 2P9UB 3ATVA 3QESA 3A5OC 5FLXO 4PUOA 3AO3A 3BZCA 3CJAA 3D2EA 1NGBA 4LF7K 3SV4A 4I6MB 2HMIA 3MEDA 2P9SB 3OYLA 3T1AA 4BR2A 3VEWA 1P90A 1Y97A 3VQ4A 5FPEA 2E6MA 3KLEA 4WE1A 2BANA 1ATSA 4OGCA 3IS9A 4Q0BA 1ZBFA 3NH0A 1RTJA 3VQEA 4ILHA 4CW7B 3SI6A 4JEPA 3HJFA 1WSJA 3CM6A 3NBPA 2B6AA 4CZMA 1NK9A 2QI2A 4B9TA 1RT5A 3ZT0A 2QWOA 1KXPA 5CZ2A 1G99A 4IFYA 2E20A 3E9PA 3OYKA 4KI4A 4JI3K 4IJNA 2D0BA 3QBWA 4FPAA 1C1CA 3CJ7A 3QIPA 2GX9A 4K43A 1K9MO 1TAUA 3CJ1A 3ALYA 1TYQB 3DMJA 5C25A 3CI5A 3GBTA 1RTHA 3VGMA 1WSEA 4KV8A 1DKGD 3C0BA 3E1YA 4AHTA 3V81A 3CYMA 2OPQA 3L3VA 1KSPA 3ZSYA 3NAEA 5BRFA 2R7YA 5E84A 4I6MA 2WFBA 2GV9A 3OYMA 3OA9A 1QVFM 3GOIA 4HUFA 4RTFD 1NKEA 5BN9A 1VQ6N 3LL3A 2JLEA 1SZ2A 1G15A 1GLCG 5KQDA 3MECA 3H45C 2ZWHA 1WBBA 1KTQA 4BRHA 4ELUA 5FRMA 4CZIA 1JXBA 1BO5O 4PHTX 3K57A 3SMPA 1JCGA 3SJHA 4E19A 1FJGK 2OPRA 2ZD1A 2E5LK 2D0CA 2OPSA 4H5RA 2P1JA 1S3XA 4QCLA 3DLKA 4FZZA 1S9GA 4WF9L 2FBXA 3U4LA 1HQEA 4IOCL 3AGRA 2OA8A 3RMBA 1NWKA 3D45A 2Z1GA 4DQ8A 4XH4A 4I9LA 4XEIA 1BIZA 3UIQA 4FL9A 3O6WA 3L0QA 2HBJA 3D7EO 2HB5A 1I39A 2FLOA 4JYAK 1KCFA 2HNDA 4IDHA 4BRKA 1HJRA 1DLOA 1NJWA 4FJKA 4U67L 3HSTB 3GG4A 1S1UA 4YY3K 4K8ZA 4DKWA 3OYJA 3AVNA 4DR6K 2G8HA 2O8FB 3CXCM 4H0VB 3ZX2A 3O1BA 4RWTA 1YJNN 4H0XB 4Y0WA 1XC9A 3QBXA 1U49A 4BRQA 4JKGB 4A2AA 4M3YA 3HM8A 4B1UB 3AVKA 4JHDA 4X66K 4AHRA 1KFDA 4JI5K 5KGXA 1KAYA 3PSIA 3HO1A 3AVFA 5KTQA 1XMOK 3CCMN 3VF4A 3M8SA 2A41A 2Y1JA 3AAPA 3LM2A 1VSKA 3SZ2A 2HVIA 2ATQA 4Z0UA 3VEXA 1HLUA 4FWNA 2XRIA 3F9KA 2O8CB 3VQBA 3T1HK 4B9LA 1TUYA 1BUPA 3A0IX 5EY4A 1OH7A 2UXCK 3FZMA 5AQTA 4J2AA 1QQMA 2FBVA 4BRDA 2HHWA 3OYHA 3LAMA 1XMQK 5SWMA 4OPKA 3W0LA 5BPMA 1TUUA 4GV9A 3TTCA 3WXIA 4QAGA 1HJOA 4CFBA 3ISNC 4X62K 3C94A 5DK5A 4H0YB 1RT2A 5GAHP 1VAZA 3VEVA 4MDAA 3FLCO 1LW2A 4IO9L 4KHPK 3U6FA 3QFPA 1NGJA 2YHBA 3V4IA 4B3OA 5J2NA 3CPEA 5M1PA 4EZ6A 3KTQA 4WFBL 1JCFA 2BH1A 2F9TA 4GVMA 2VG5A 4JKFA 1YT3A 3NGYA 1D8YA 1X9WA 1XNRK 3CMAN 5CHIA 1WAFA 1W2BM 2DFEA 4PQUA 2NRVA 4CVNE 1B9DA 1ITGA 3ULEA 3WXKA 3WXMB 4FW2A 2Q31A 3K5LA 4O5FA 4E1MA 1LW0A 3O9SA 3KK7A 4NLBA 1MWMA 4MO5A 1TL1A 4FWLA 2KTQA 2O8BB 4JI2K 3IUCA 3SQ0A 2P9LA 4DTUA 4CIFA 4BRAA 3TI0A 1BQMA 4N5SA 4NXNK 3DI6A 4CECA 3LPUA 1KAXA 5HRRA 2VG6A 2E6LA 2HF4A 2P51A 2O4GA 1JJ2M 5HBMA 3QEXA 3W3DA 2QKKA 4DV5K 4M42A 1E4GT 1T6DA 4QS7A 4H4MA 2VGNA 4I7FA 4RW9A 2ITMA 4V19S 3T7ZA 3OJSA 4HTUA 3AVMA 3PY8A 4FLXA 3QEWA 4EP5A 2EHGA 1C1BA 3HP6A 2V7YA 3DRSA 4FO0A 1CZ9A 1RFQA 3VENA 1F21A 4M7XA 5TKWA 4CI6A 4BC3A 4DV0K 2BUPA 2FF6A 1HNWK 1IKXA 1NGDA 1OH5A 2G8IA 2ZJPL 1RDCA 3L2WA 1QQOA 2IIRA 1NJYA 2YHWA 5K14A 1KAZA 1UWBA 1JLEA 4NXMK 4J2EA 1B92A 4FWSA 1ZBUA 3B8AX 4AM7A 3E9OA 4AHUA 3V9WA 2CH6A 4XIUA 4OPAA 3MN5A 3R3LA 3C7NB 4LH4A 2F96A 4DSIA 2F4VK 5GAEP 4ISEA 5BN8A 1J6ZA 5AQJA 3S3OA 1T44A 3AO1A 4KHWA 1VQPN 3KK1A 4BC4A 5E26A 4JI7K 4CK2A 2YV0X 4AM6A 3OVNA 3SPYA 3NGIA 1OVYA 4O55A 3WXLA 4W5OA 3V1QA 3QEVA 3A2FA 5AQWA 4JNEA 3VTHA 3IAYA 4F9OA 3QFUA 4DR4K 3F73A 2E2NA 4WCEL 1YITN 3MXMA 1EWQA 3NVKA 3FE1A 2JGUA 1SAZA 2Z1IA 4F2SA 2PAVA 1VQLN 1HNVA 1DT9A 1WSGA 3IRXA 3VQ8A 5E41A 4IBNA 2BTFA 3BEXA 5CR4A 4W5TA 4EHTA 4BE2A 4BRCA 3AVGA 3EKUA 2XO7A 4KTZA 3BDPA 2ZJQL 4JI4K 4CZGA 2GUPA 4B3MK 1BL3A 3WNFA 2QWQA 4CJLA 1NJZA 4KB1A 3VGLA 4FYDA 2GEMA 2OTJN 5HRSA 4DR3K 3T69A 4CBXA 2G8FA 1FW6A 4CHQA 4W5RA 3SV3A 4PKHA 4JKDA 1JLGA 1CLQA 3C7NA 1YJ9N 4O44A 3FFIA 3SPZA 5AQIA 4H5WA 5JLFA 2OPPA 3O9RA 2AJQA 3LANA 2Q0UA 3EE8A 4DSJA 3ATUA 4JAXA 2OTLN 4B9NA 1N36K 1GLFO 3IDHA 4BRIA 5AQQA 3VF6A 3WEEB 3TARA 1RT7A 4BR7A 4ZTJA 4NCBA 3QDKA 4IOXA 1VSFA 1NM1A 1XI1A 1XHZA 3ZSVA 3HOTA 4K42A 2YNIA 1BWFO 4ELVA 3L2QA 4C8MA 3GE1A 4CJ4A 1MA9B 1DEJA 1DTQA 4JD2B 4UQGA 3I55N 3M5RA 4XH1A 3MEGA 2V52B 1U2VA 1X9JA 3FZHA 3CFOA 3VQDA 4DFKA 5FPDA 3AVCA 3D2FB 3EO3A 3PO5A 4H5TA 2ITGA 4CGGA 3JAMO 3CCVN 3CFPA 3DRPA 4FW1A 2QWRA 2F8TA 3WXJA 3HYFA 3H1VX 4JLHA 3TAGA 1WSIA 3V6DA 2HMPA 3PIOL 4FJJA 2RHKA 3LPTA 4A62A 1E3MA 3O4WA 1VQNN 2Q1NA 4BRPA 4A57A 4CEAA 2E4LA 5AQYA 3OHRA 3QO9A 1VRTA 3D2EB 2E2QA 3SBTA 4PKGA 4DF4A 3LP3A 1TKZA 4FOIA 3S9HA 1Q86O 2P9KA 4B3TK 2QM1A 1A5WA 4E7LA 5H1SQ 3WQTA 3SUQA 3THVA 3ZX0A 3NMUA 3ZSOA 1ILYA 2ASOA 4G1QA 1YTAA 3UKRA 5A2QO 2VQEK 4E89A 3V9UA 1BCMA 4J2DA 3TSQA 1Q8IA 3DLEA 2QWPA 3FFKB 3EY1A 4IOAL 5LJVA 4OKJA 2QA4N 1Q81O 4HCCA 2QKBA 3SMSA 2ASMA 2HBMA 2W40A 4FWOA 2A5XA 1EX4A 3A5LC 1NOYA 3TAPA 4CJ3A 4FJHA 1HYZA 3SQ2A 1U04A 1NK5A 2V7ZA 1EQYA 4IFVA 3R9PA 4CF2A 4DQSA 3BGRA 4DSLA 3KD1E 5AQXA 4LD0A 1VQKN 4DR7K 4LFAK 2PY5A 4BG9A 3UB5A 1YHQN 3OYNA 3RRGA 4B3RK 4JV5K 1UA1A 1IH7A 2NRZA 3CHWA 4FWQA 4FZXC 5ADXA 3OW2M 1BCOA 4E7KA 4JI8K 1W9HA 2YKNA 1I3AA 3ZT3A 3C6TA 1CXQA 3DOKA 2UUAK 3DLLL 2E8AA 4Z4HA 5EU7A 1NBWA 2QW9A 4BE1A 4EP4A 1EO1A 5BREA 1BISA 3O9QA 5M1OA 3V9ZA 3NHGA 1VQ5N 3N4QA 4Z4IA 1S1WA 1C0FA 1J5EK 4BRNA 4B1YB 2FF3B 2HHQA 4YHHK 3MMVA 2JWKA 1M1KO 4FPBA 2OANA 3TAFA 3O4QA 2X6NA 1IBLK 1NK0A 2GELA 3DYAA 3AA3A 4DTNA 1UA0A 1KVCA 3RMCA 3HTVA 3QLHA 3THWA 4ELTA 3OYCA 4FVUA 5AZIA 3MAQA 1RDUA 4LF9K 4HTLA 4KI6A 4ID5A 4OO1J 1RT4A 5M1FA 3UKUA 3L2UA 3HM9A 4JK7A 3OYFA 3M3ZA 4DR1K 3L6QA 3KKSA 4FJIA 4DV1K 5C2FA 5GIOA 1IG9A 2CGLA 3QB0A 4NYNA 4L8RB 1VQ7N 2QWMA 1OVQA 5AQMA 2RF2A 2P5OA 1TK0A 4DFPA 4B9VA 2RPIA 5I9EB 1QSLA 4GNIA 2HHSA 1VSEA 4DSKA 4B1WB 4DS4A 3IMXA 1V4TA 3PX6A 3R6MA 2P9IA 3LM9A 2YHAA 1JCEA 4OPHA 3V1RA 1L3UA 1TGOA 5DMRA 1YUWA 3HVTA 2PZSA 2VG7A 3TTFA 3C6AA 1KLMA 1QHTA 4CK1A 3ID6A 3VQPA 4CJSA 4PWDA 4RW7A 5M1KA 4DWIA 3NH1A 3V1OA 4GY2B 1K8KA 4YOXA 3HRGA 1KC8O 1SL2A 5T7BA 5AQKA 5HROA 2KQ2A 2QXFA 3H1QA 1WAJA 1NNEA 3H46O 2NRHA 4CGHA 4JHDB 5BPLA 4YOYA 3O3HA 4DQPA 2O8DA 1VK0A 3QICA 4ISFA 5GADP 5JVGL 3CQYA 1LWFA 2HF3A 3K5OA 5EOYA 5J2PA 3CC7N 1UAXA 4AF1A 3NGZA 2D0AA 3OYDA 3K59A 3NF7A 3AAQA 1OH8A 2BDPA 1RT6A 5MLCQ 5TKYA 1JL2A 5CY4A 3VEYA 4FM0A 4O8KA 1WBDA 1KVAA 3H3NO 4B9SA 2A6AA 4F8RA 2A40A 3EEQA 3TAEA 5EXWA 2AA4A 4CHYA 1ATNA 4MQ3A 3L2RA 2UU9K 1O13A 2W6KA 1LWCA 3DM2A 4EZ9A 1O1WA 3K9JA 4FK4A 4ILGB 2NZTA 5AQZA 4C1NI 3CQXA 5HLFA 2ZE2A 2YNGA 4CK3A 1S1XA 2YX6A 1QZ5A 4C8OA 4QS9A 4NLCA 3P5JA 4C8NA 2F9WA 4HUGA 2UXBK 1EETA 5ADXH 1HNIA 5KRTA 2X6SA 4FM2A 3OS0A 3CJBA 1GLAG 1H1VA 3AO2A 1JLQA 1GLJO 3DOLA 4K0KK 2DTUA 2W6LA 1S22A 3RWUA 2ZF5O 3PLAA 4WQ4C 1IBMK 1SQKA 3S41A 2P9PA 2Q2RA 4I2PA 1X9MA 2HBKA 5GIPA 3CJCA 2D1KA 1RT1A 3O80A 4JKCA 1SUQA 4WQ4A 3ULEB 3WUHA 4X64K 5KQ8A 3LDPA 4LFCK 3SBGA 4BREA 4FK0A 4DSEA 4A61A 5AQVA 3CJ9A 3SUNA 1YF5L 1R0AA 1TKDA 4BQLA 3LDSA 2P9LB 3AVIA 2F7TA 1D4XA 2EX3A 1W0HA 1WNSA 3VETA 2WTUA 3MXIA 4AH9A 3SUPA 4CEOA 4KTWA 3RMDA 1RDBA 3ZSRA 5D3GA 2ETJA 2WONA 2X74A 1Y64A 4W5QA 1VSMA 3MEEA 1K6YA 3JSMA 1HX1A 1BU6O 4DV7K 4CIGA
chains in the Genus database with same CATH topology
4IG0A 3WNGA 1EP4A 3KLGA 4FVMA 4CF8A 4DMNA 4CFAA 5C42A 3VN5A 4HUEA 3AA4A 3AO4A 4CFDA 2Z1HA 4CHPA 3S3OA 4OLBA 1C1AA 3VQ5A 3AO1A 1QQCA 4FJLA 4DSFA 2ZQBA 4CJTA 4RW8A 3PV8A 4HCBA 4KHWA 3NF6A 3NF9A 4IDKA 3KK1A 4DF8A 2OZMA 4CGFA 4E7IA 1JLCA 4CK2A 2YV0X 3D0PA 3OVNA 1C0MA 4CJEA 3NGIA 4DQQA 3SPYA 3SNNA 4O55A 4W5OA 2HNZA 3OYIA 3SUOA 4AILC 3V1QA 3AVJA 3HK2A 1C6VA 4ZHRA 3QEVA 1J54A 3A2FA 4DTXA 1D5AA 3IAYA 5JS1A 4E7HA 2GBZA 5KI6A 3OYEA 3F73A 3MXMA 2IC3A 3HP9A 3HVRA 3QEPA 3DLHA 2HHTA 4DQRA 2JGUA 4KHQA 2KZZA 1X1PA 4B08A 2Z1IA 4F2SA 3E01A 4CEFA 4FJ9A 1HNVA 1WSGA 3IRXA 4M3WA 3V9XA 3LP1A 4LSNA 4CHZA 3VQ8A 3M8QA 1IKVA 5E41A 1ASVA 4N41A 4K8XA 2BE2A 1GOCA 4IBNA 3G0ZA 3U3GA 4W5TA 1TK8A 3TABA 4YNQA 3HPOA 3L2VA 4BE2A 1U45A 2A1SA 1NK8A 3AV9A 3AVAA 2XY5A 4Z4FA 3AVGA 4OKEA 1TV6A 4Z4CA 4KTZA 3AA5X 2XO7A 3RR8A 1JKHA 1RNHA 3QINA 1JXEA 4NYFA 1QSSA 3IG1A 3BDPA 4OVLA 2XY6A 3RRHA 3HPHA 1BL3A 2Z1JA 3WNFA 4CJLA 1NJZA 4KB1A 4FXDA 1VSJA 4FJ7A 4FYDA 3HPGA 1KFSA 3ITHA 4QOZB 1D9DA 1RBSA 3KK3A 1RILA 3TR8A 3NF8A 5HRSA 4FLVA 3ZSWA 4E0DA 1VSHA 1J9AA 4LY7A 3ULDA 5I42A 1RTDA 3PUFA 1XHXA 2G8FA 3AA2A 3PX0A 4CHQA 4W5RA 4BACA 1C0UA 3ZSQA 3SV3A 1L3VA 3ZSZA 3DLBA 1JLGA 4CE9A 2P5GA 3VA0A 1CLQA 4F3TA 3WNEA 4O44A 3FFIA 3QESA 5SZTA 3SPZA 4PUOA 3AO3A 3PX4A 2AJQA 2OPPA 3LANA 4CEBA 3B6OA 4Y1DA 4KTQA 4DG1A 3SV4A 1ZBHA 2HMIA 4DSJA 2HVHA 3KK2A 4B9NA 2QK9A 3MEDA 1HMVA 3OYLA 3T1AA 3P1GA 3TARA 1RT7A 4E3SA 4KFBA 4ZTJA 4NCBA 4ZTFA 1VSFA 4GMJB 4ID1A 1XI1A 1XHZA 4DQIA 3ZSVA 4CF9A 1BHLA 4CGDA 1Y97A 3VQ4A 3K58A 2YNIA 4CJPA 1IKWA 4NCGA 4CJWA 2E6MA 5J2QA 4ELVA 3KLEA 4C8MA 3L2QA 4WE1A 4OJRA 4CJ4A 3NE6A 4F4KA 2BANA 4OGCA 2FBTA 3IS9A 2D5RA 1ZBFA 1RT3A 1RTJA 3VQEA 3ZT1A 1DTQA 4UQGA 3NH0A 3O3FA 3MEGA 3SI6A 1FKOA 4CEEA 3S3MA 3HJFA 3H08A 3CFOA 1EKEA 4KKOA 2XY8A 4C8KA 2GUIA 2B4JA 1WSJA 1IKYA 3VQDA 3OYAA 4DFKA 2HHXA 3P83D 3AVCA 1S6PA 3CM6A 2B6AA 3NBPA 4N56A 3PO5A 4M45A 2O4IA 4I9QA 2ITGA 4CGGA 1NK9A 1N5YA 3CFPA 2YNHA 3DRPA 4FW1A 2F8TA 3JYTA 4YFUA 4B9TA 3ZSXA 3HYFA 1RT5A 4JLHA 3ZT0A 2DFFA 5CZ2A 5CYQA 3TAGA 4M3XA 4W5NA 1WSIA 4IFYA 3DRRA 3I8DA 3V6DA 3NFAA 4FJJA 1ZBLA 3C95A 3QETA 3LPTA 5HRNA 3OYKA 5KRSA 4OKKA 4KI4A 4FM1A 4O5BA 4CF0A 4CEAA 2D0BA 1TKTA 1RBRA 2E4LA 3AVBA 3QO9A 2PYLA 1VRTA 3OS2A 3K5MA 1C1CA 2Q3SA 3QIPA 4BWJA 3LP2A 4F2RA 1TAUA 4JRPA 1SKRA 4CESA 4DF4A 3LP3A 3ALYA 1TKZA 1HPZA 3S9HA 3DMJA 5C25A 3TWHA 3CG7A 3DLRA 1RTHA 4FLZA 1A5WA 1S1VA 4E7LA 4DTSA 4FJXA 1WSEA 4BDZA 4KV8A 1U48A 4AHTA 3V81A 3SUQA 3THVA 3ZSOA 3CYMA 2OPQA 3L3VA 4G1QA 1SL0A 1YTAA 1KSPA 1XWLA 3ZSYA 3NAEA 1VRUA 4E89A 3V9UA 1BCMA 4J2DA 1T05A 2IAJA 4KAZA 2R7YA 4FJ8A 3HT3A 2DY4A 4PY5A 1FK9A 1Q8IA 2GV9A 3DLEA 1Q9XA 3OYMA 3SQ1A 4HUFA 2DFHA 4CEDA 3EY1A 3I0RA 1CXUA 4OKJA 4H8KA 1NKEA 5J2MA 4KRFA 4HCCA 2BGGA 4AHSA 2JLEA 2QKBA 1G15A 4RG8A 1BI4A 3VQ6A 3MECA 4KREA 1NKCA 3NCIA 1EX4A 1KTQA 2IOCA 3ASMA 4DS5A 1NK4A 5FDLA 4ELUA 5FRMA 1NOYA 3TAPA 3B6PA 4B8AB 4CJ3A 4NCAA 4RW6A 5JS2A 3SJJA 1JXBA 2Y1IA 5I3UA 4FJHA 1A5VA 4RW4A 3O3GA 3OYGA 3K57A 1HYZA 4KB0A 4CJQA 4M3UA 3VQCA 4PA1A 3SQ2A 1U04A 1NK5A 4E19A 2LSNA 3VQAA 4DLEA 4CJKA 1EXQA 2OPRA 4CIEA 2ZD1A 4IFVA 4DQSA 2IGIA 4CF2A 3BGRA 3EYZA 2D0CA 2OPSA 3KLHA 1SV5A 4KHYA 5C24A 2P1JA 4DU3A 4DSLA 4LD0A 3KD1E 1WLJA 2KFZA 4QCLA 3DLKA 1L5UA 4FZZA 3M8RA 1S9GA 2PY5A 2FBXA 2OZSA 4KPYA 3AVLA 1HQEA 2FC0A 3OYNA 1BQNA 3RRGA 3G10A 2OA8A 1B9FA 1MU2A 3MXJA 3D45A 3RMBA 1UA1A 1S5JA 2Z1GA 1IH7A 4R5PA 4FZXC 4CEZA 4I9LA 4I2QA 1BCOA 4E7KA 2XHBA 1W9HA 1BIZA 3UIQA 1A5XA 4Q5VA 3LP0A 2YKNA 3T19A 1QS4A 1I3AA 3ZT3A 3C6TA 1CXQA 1N6QA 4OPJA 3DOKA 4BWMA 4Z4HA 5EU7A 3RTVA 2HB5A 4DLGA 1I39A 4BE1A 1KCFA 4EP4A 4FLUA 2HNDA 1BISA 3VA3A 1QTMA 3V9ZA 1HJRA 1DLOA 3NHGA 1NJWA 4FJKA 3HSTB 2OYQA 4K8ZA 1S1UA 1RDAA 4Z4IA 1S1WA 1BI4B 1JLBA 4JS5A 1SKSA 3AO5A 3OYJA 3AVNA 3KJVA 2HHQA 1J5OA 1T03A 2G8HA 1RDDA 3O4NA 3TAFA 3O4QA 3SQ4A 2X6NA 3OS1A 1NK0A 1XC9A 3DYAA 4MFBA 4DTPA 3AA3A 4DTNA 1SKWA 3M8PA 1UA0A 1U49A 1GOBA 1KVCA 4CJ5A 3RMCA 1Z25A 4DFMA 3LAKA 3QLHA 1J53A 4BDPA 4M3YA 3NH2A 4HVJA 3LWLA 4ELTA 3OYCA 4E7JA 3MAQA 1HQUA 5CZ1A 4CHNA 5J1EA 4KO0A 1RBVA 2G8UA 3AVKA 4KI6A 1FXXA 4ID5A 3CQ8A 1RT4A 4AHRA 1ZBIA 1KFDA 2G8WA 3L2UA 5KGXA 3HM9A 1U47A 4IKFA 1RCHA 3SYZA 3AVFA 3OYFA 3HO1A 3HL8A 3NDKA 5KTQA 3KKSA 4FJIA 1HYSA 4F3OA 4CHOA 4FZYA 3M8SA 2Y1JA 3ZCMA 3SZ2A 1VSKA 1IG9A 2HVIA 1TKXA 2G8KA 4FJMA 4NYNA 4L8RB 2ATQA 4Z0UA 2RF2A 3VQ7A 2P5OA 1TK0A 4CCHA 2XRIA 3F9KA 4DFPA 1S9EA 2RPIA 3VQBA 1QSLA 4B9VA 4FJ5A 3KKRA 3K5NA 1VSEA 2I5JA 3C6UA 4AHCA 3WNHA 3VQQA 4B9LA 4DS4A 4DSKA 3PO4A 1TAQA 3PX6A 4J2AA 3KLFA 3L3UA 3SCXA 4M3ZA 3I0SA 2FBVA 2HHWA 3OYHA 3LAMA 1TK5A 1HYVA 1LAVA 2YKMA 3DLGA 1FKPA 2RN2A 2YHAA 5SWMA 4OPKA 1L3UA 3V1RA 2KFNA 1Z26A 1TGOA 2IDOA 5DMRA 3HVTA 2PZSA 2VG7A 1RBUA 1NK7A 1KLMA 1QHTA 4QAGA 4CFBA 4CK1A 3ISNC 3V9SA 3CM5A 3C94A 5DK5A 4LSLA 3VQPA 4CEQA 4CJSA 4RW7A 3HXMA 3QEIA 4PWDA 4DWIA 1RT2A 3NH1A 3V1OA 1WSFA 4DTRA 4Y1CA 1SL1A 2YNFA 1LW2A 4M41A 2HHVA 3U6FA 1RBTA 1SL2A 4OLAA 1YTUA 5T7BA 2YHBA 3OY9A 3V4IA 5HROA 4B3OA 2KQ2A 2QXFA 4FLWA 5J2NA 5FRNA 4EZ6A 1JL1A 1VSDA 1WN7A 1WAJA 4HHTA 4CGHA 3VQ9A 1VSIA 3O3HA 3KTQA 4DQPA 1CZBA 1S1TA 1VK0A 3LWMA 1KRPA 1JLFA 4JS4A 1LWFA 4FLTA 1VSLA 1WSHA 3K5OA 5J2PA 4J2BA 4KHNA 4GVMA 1UAXA 3NGZA 2VG5A 1QE1A 2D0AA 1YT3A 3NGYA 3OYDA 3OJUA 3NF7A 5CYMA 3K59A 4DTOA 1X9WA 1D8YA 2BDPA 1RT6A 4DU4A 3LALA 1BGXT 1WAFA 5FROA 2DFEA 1D9FA 1YVUA 1JL2A 4PQUA 3KIOA 1TVRA 5CY4A 4FM0A 4B8CA 4CGJA 4M3TA 4AHVA 1Q9YA 4KHSA 1KVAA 2KW4A 1B9DA 1ITGA 4B9SA 1LAWA 4F8RA 2HHUA 4TSXA 3K5LA 4FW2A 1LV5A 3TAEA 4M3RA 4O0IA 4E1MA 4CHYA 1LW0A 3K2PA 4MQ3A 4LH5A 3L2RA 4DTJA 1JLAA 1LWCA 3DM2A 5HP1A 4EZ9A 1O1WA 4FK4A 4CFCA 4O4GA 4FJGA 1REVA 1TL1A 2XY7A 2KTQA 2FBYA 3TAQA 4CJVA 1IO2A 3SQ0A 5HLFA 1ZYQA 3OYBA 2ZE2A 4DTUA 4FK2A 2YNGA 3KLIA 2VWKA 4CIFA 4CK3A 4CERA 5HRPA 3QNNA 3TI0A 3ZT2A 4CGIA 1NJXA 3KD5E 1S1XA 1BQMA 4N5SA 4DFJA 4IG3A 3DI6A 4FLYA 4CECA 3TAMA 4C8OA 3LPUA 4KHUA 3T3FA 1KVBA 1U4BA 3P5JA 2VG6A 2E6LA 5HRRA 2P51A 2O4GA 4C8NA 4HUGA 1ASUA 1EETA 5HBMA 4E1NA 2WOMA 1KLNA 3QEXA 1NKBA 4CJFA 3QERA 3QIOA 1S6QA 4Q0BA 2QKKA 1HNIA 4DU1A 5KRTA 4M42A 2HNYA 4O0JA 2X6SA 1UOCA 3EZ5A 3L8BA 3U3YA 4N47A 4H4MA 4FM2A 4I7FA 4RW9A 1NK6A 3OS0A 4FJNA 2B5JA 3OJSA 5KGWA 1QSYA 4HTUA 3AVMA 3AO2A 1JLQA 3DOLA 3S3NA 4FLXA 1GOAA 3QEWA 3PY8A 4ICLA 4EP5A 2DTUA 2EHGA 3RWUA 1C1BA 3HP6A 4CF1A 1BIUA 3DRSA 4GW6A 1DTTA 1CZ9A 2W42A 2X78A 1F21A 4B9UA 1X9MA 4I2PA 2G8VA 4BE0A 1X9SA 1L3SA 2IS3A 1NOZA 4BDYA 1IKXA 1RT1A 3ZT4A 1SUQA 2G8IA 2PYJA 1L3TA 1RDCA 3L2WA 4B9MA 4JRQA 2RKIA 3LZJA 1NJYA 5K14A 1LWEA 4DSEA 1UWBA 4FK0A 4Z4GA 3QNOA 3SUNA 2VWJA 1JLEA 1R0AA 4Z4EA 4CJUA 1C0TA 3LZIA 1TKDA 2KZMA 2HW3A 3TANA 4J2EA 1B92A 2HHSA 4DTMA 3LDSA 1ZBUA 3AVIA 2NUBA 2EX3A 1W0HA 4C8LA 4H4OA 1ASWA 1WNSA 2F8SA 4AHUA 4FCYA 3V9WA 2A1RA 4OGEA 3MXIA 4AH9A 3SUPA 4CEOA 4KTWA 3RMDA 1RDBA 4XIUA 3ZSRA 3CFRA 5D3GA 1HRHA 1T7PA 2ETJA 2WONA 4N76A 3RMAA 4LH4A 2X74A 4W5QA 1RTIA 1TL3A 1VSMA 1K6YA 2F96A 3MEEA 1T8EA 3RR7A 4CJRA 3JSMA 4DSIA 3AVHA 4CIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IG0 A;  3WNG A;  1EP4 A;  3KLG A;  4FVM A;  4CF8 A;  4DMN A;  4CFA A;  5C42 A;  3VN5 A;  4HUE A;  3AA4 A;  3AO4 A;  4CFD A;  2Z1H A;  4CHP A;  3S3O A;  4OLB A;  1C1A A;  3VQ5 A;  3AO1 A;  1QQC A;  4FJL A;  4DSF A;  2ZQB A;  4CJT A;  4RW8 A;  3PV8 A;  4HCB A;  4KHW A;  3NF6 A;  3NF9 A;  4IDK A;  3KK1 A;  4DF8 A;  2OZM A;  4CGF A;  4E7I A;  1JLC A;  4CK2 A;  2YV0 X;  3D0P A;  3OVN A;  1C0M A;  4CJE A;  3NGI A;  4DQQ A;  3SPY A;  3SNN A;  4O55 A;  4W5O A;  2HNZ A;  3OYI A;  3SUO A;  4AIL C;  3V1Q A;  3AVJ A;  3HK2 A;  1C6V A;  4ZHR A;  3QEV A;  1J54 A;  3A2F A;  4DTX A;  1D5A A;  3IAY A;  5JS1 A;  4E7H A;  2GBZ A;  5KI6 A;  3OYE A;  3F73 A;  3MXM A;  2IC3 A;  3HP9 A;  3HVR A;  3QEP A;  3DLH A;  2HHT A;  4DQR A;  2JGU A;  4KHQ A;  2KZZ A;  1X1P A;  4B08 A;  2Z1I A;  4F2S A;  3E01 A;  4CEF A;  4FJ9 A;  1HNV A;  1WSG A;  3IRX A;  4M3W A;  3V9X A;  3LP1 A;  4LSN A;  4CHZ A;  3VQ8 A;  3M8Q A;  1IKV A;  5E41 A;  1ASV A;  4N41 A;  4K8X A;  2BE2 A;  1GOC A;  4IBN A;  3G0Z A;  3U3G A;  4W5T A;  1TK8 A;  3TAB A;  4YNQ A;  3HPO A;  3L2V A;  4BE2 A;  1U45 A;  2A1S A;  1NK8 A;  3AV9 A;  3AVA A;  2XY5 A;  4Z4F A;  3AVG A;  4OKE A;  1TV6 A;  4Z4C A;  4KTZ A;  3AA5 X;  2XO7 A;  3RR8 A;  1JKH A;  1RNH A;  3QIN A;  1JXE A;  4NYF A;  1QSS A;  3IG1 A;  3BDP A;  4OVL A;  2XY6 A;  3RRH A;  3HPH A;  1BL3 A;  2Z1J A;  3WNF A;  4CJL A;  1NJZ A;  4KB1 A;  4FXD A;  1VSJ A;  4FJ7 A;  4FYD A;  3HPG A;  1KFS A;  3ITH A;  4QOZ B;  1D9D A;  1RBS A;  3KK3 A;  1RIL A;  3TR8 A;  3NF8 A;  5HRS A;  4FLV A;  3ZSW A;  4E0D A;  1VSH A;  1J9A A;  4LY7 A;  3ULD A;  5I42 A;  1RTD A;  3PUF A;  1XHX A;  2G8F A;  3AA2 A;  3PX0 A;  4CHQ A;  4W5R A;  4BAC A;  1C0U A;  3ZSQ A;  3SV3 A;  1L3V A;  3ZSZ A;  3DLB A;  1JLG A;  4CE9 A;  2P5G A;  3VA0 A;  1CLQ A;  4F3T A;  3WNE A;  4O44 A;  3FFI A;  3QES A;  5SZT A;  3SPZ A;  4PUO A;  3AO3 A;  3PX4 A;  2AJQ A;  2OPP A;  3LAN A;  4CEB A;  3B6O A;  4Y1D A;  4KTQ A;  4DG1 A;  3SV4 A;  1ZBH A;  2HMI A;  4DSJ A;  2HVH A;  3KK2 A;  4B9N A;  2QK9 A;  3MED A;  1HMV A;  3OYL A;  3T1A A;  3P1G A;  3TAR A;  1RT7 A;  4E3S A;  4KFB A;  4ZTJ A;  4NCB A;  4ZTF A;  1VSF A;  4GMJ B;  4ID1 A;  1XI1 A;  1XHZ A;  4DQI A;  3ZSV A;  4CF9 A;  1BHL A;  4CGD A;  1Y97 A;  3VQ4 A;  3K58 A;  2YNI A;  4CJP A;  1IKW A;  4NCG A;  4CJW A;  2E6M A;  5J2Q A;  4ELV A;  3KLE A;  4C8M A;  3L2Q A;  4WE1 A;  4OJR A;  4CJ4 A;  3NE6 A;  4F4K A;  2BAN A;  4OGC A;  2FBT A;  3IS9 A;  2D5R A;  1ZBF A;  1RT3 A;  1RTJ A;  3VQE A;  3ZT1 A;  1DTQ A;  4UQG A;  3NH0 A;  3O3F A;  3MEG A;  3SI6 A;  1FKO A;  4CEE A;  3S3M A;  3HJF A;  3H08 A;  3CFO A;  1EKE A;  4KKO A;  2XY8 A;  4C8K A;  2GUI A;  2B4J A;  1WSJ A;  1IKY A;  3VQD A;  3OYA A;  4DFK A;  2HHX A;  3P83 D;  3AVC A;  1S6P A;  3CM6 A;  2B6A A;  3NBP A;  4N56 A;  3PO5 A;  4M45 A;  2O4I A;  4I9Q A;  2ITG A;  4CGG A;  1NK9 A;  1N5Y A;  3CFP A;  2YNH A;  3DRP A;  4FW1 A;  2F8T A;  3JYT A;  4YFU A;  4B9T A;  3ZSX A;  3HYF A;  1RT5 A;  4JLH A;  3ZT0 A;  2DFF A;  5CZ2 A;  5CYQ A;  3TAG A;  4M3X A;  4W5N A;  1WSI A;  4IFY A;  3DRR A;  3I8D A;  3V6D A;  3NFA A;  4FJJ A;  1ZBL A;  3C95 A;  3QET A;  3LPT A;  5HRN A;  3OYK A;  5KRS A;  4OKK A;  4KI4 A;  4FM1 A;  4O5B A;  4CF0 A;  4CEA A;  2D0B A;  1TKT A;  1RBR A;  2E4L A;  3AVB A;  3QO9 A;  2PYL A;  1VRT A;  3OS2 A;  3K5M A;  1C1C A;  2Q3S A;  3QIP A;  4BWJ A;  3LP2 A;  4F2R A;  1TAU A;  4JRP A;  1SKR A;  4CES A;  4DF4 A;  3LP3 A;  3ALY A;  1TKZ A;  1HPZ A;  3S9H A;  3DMJ A;  5C25 A;  3TWH A;  3CG7 A;  3DLR A;  1RTH A;  4FLZ A;  1A5W A;  1S1V A;  4E7L A;  4DTS A;  4FJX A;  1WSE A;  4BDZ A;  4KV8 A;  1U48 A;  4AHT A;  3V81 A;  3SUQ A;  3THV A;  3ZSO A;  3CYM A;  2OPQ A;  3L3V A;  4G1Q A;  1SL0 A;  1YTA A;  1KSP A;  1XWL A;  3ZSY A;  3NAE A;  1VRU A;  4E89 A;  3V9U A;  1BCM A;  4J2D A;  1T05 A;  2IAJ A;  4KAZ A;  2R7Y A;  4FJ8 A;  3HT3 A;  2DY4 A;  4PY5 A;  1FK9 A;  1Q8I A;  2GV9 A;  3DLE A;  1Q9X A;  3OYM A;  3SQ1 A;  4HUF A;  2DFH A;  4CED A;  3EY1 A;  3I0R A;  1CXU A;  4OKJ A;  4H8K A;  1NKE A;  5J2M A;  4KRF A;  4HCC A;  2BGG A;  4AHS A;  2JLE A;  2QKB A;  1G15 A;  4RG8 A;  1BI4 A;  3VQ6 A;  3MEC A;  4KRE A;  1NKC A;  3NCI A;  1EX4 A;  1KTQ A;  2IOC A;  3ASM A;  4DS5 A;  1NK4 A;  5FDL A;  4ELU A;  5FRM A;  1NOY A;  3TAP A;  3B6P A;  4B8A B;  4CJ3 A;  4NCA A;  4RW6 A;  5JS2 A;  3SJJ A;  1JXB A;  2Y1I A;  5I3U A;  4FJH A;  1A5V A;  4RW4 A;  3O3G A;  3OYG A;  3K57 A;  1HYZ A;  4KB0 A;  4CJQ A;  4M3U A;  3VQC A;  4PA1 A;  3SQ2 A;  1U04 A;  1NK5 A;  4E19 A;  2LSN A;  3VQA A;  4DLE A;  4CJK A;  1EXQ A;  2OPR A;  4CIE A;  2ZD1 A;  4IFV A;  4DQS A;  2IGI A;  4CF2 A;  3BGR A;  3EYZ A;  2D0C A;  2OPS A;  3KLH A;  1SV5 A;  4KHY A;  5C24 A;  2P1J A;  4DU3 A;  4DSL A;  4LD0 A;  3KD1 E;  1WLJ A;  2KFZ A;  4QCL A;  3DLK A;  1L5U A;  4FZZ A;  3M8R A;  1S9G A;  2PY5 A;  2FBX A;  2OZS A;  4KPY A;  3AVL A;  1HQE A;  2FC0 A;  3OYN A;  1BQN A;  3RRG A;  3G10 A;  2OA8 A;  1B9F A;  1MU2 A;  3MXJ A;  3D45 A;  3RMB A;  1UA1 A;  1S5J A;  2Z1G A;  1IH7 A;  4R5P A;  4FZX C;  4CEZ A;  4I9L A;  4I2Q A;  1BCO A;  4E7K A;  2XHB A;  1W9H A;  1BIZ A;  3UIQ A;  1A5X A;  4Q5V A;  3LP0 A;  2YKN A;  3T19 A;  1QS4 A;  1I3A A;  3ZT3 A;  3C6T A;  1CXQ A;  1N6Q A;  4OPJ A;  3DOK A;  4BWM A;  4Z4H A;  5EU7 A;  3RTV A;  2HB5 A;  4DLG A;  1I39 A;  4BE1 A;  1KCF A;  4EP4 A;  4FLU A;  2HND A;  1BIS A;  3VA3 A;  1QTM A;  3V9Z A;  1HJR A;  1DLO A;  3NHG A;  1NJW A;  4FJK A;  3HST B;  2OYQ A;  4K8Z A;  1S1U A;  1RDA A;  4Z4I A;  1S1W A;  1BI4 B;  1JLB A;  4JS5 A;  1SKS A;  3AO5 A;  3OYJ A;  3AVN A;  3KJV A;  2HHQ A;  1J5O A;  1T03 A;  2G8H A;  1RDD A;  3O4N A;  3TAF A;  3O4Q A;  3SQ4 A;  2X6N A;  3OS1 A;  1NK0 A;  1XC9 A;  3DYA A;  4MFB A;  4DTP A;  3AA3 A;  4DTN A;  1SKW A;  3M8P A;  1UA0 A;  1U49 A;  1GOB A;  1KVC A;  4CJ5 A;  3RMC A;  1Z25 A;  4DFM A;  3LAK A;  3QLH A;  1J53 A;  4BDP A;  4M3Y A;  3NH2 A;  4HVJ A;  3LWL A;  4ELT A;  3OYC A;  4E7J A;  3MAQ A;  1HQU A;  5CZ1 A;  4CHN A;  5J1E A;  4KO0 A;  1RBV A;  2G8U A;  3AVK A;  4KI6 A;  1FXX A;  4ID5 A;  3CQ8 A;  1RT4 A;  4AHR A;  1ZBI A;  1KFD A;  2G8W A;  3L2U A;  5KGX A;  3HM9 A;  1U47 A;  4IKF A;  1RCH A;  3SYZ A;  3AVF A;  3OYF A;  3HO1 A;  3HL8 A;  3NDK A;  5KTQ A;  3KKS A;  4FJI A;  1HYS A;  4F3O A;  4CHO A;  4FZY A;  3M8S A;  2Y1J A;  3ZCM A;  3SZ2 A;  1VSK A;  1IG9 A;  2HVI A;  1TKX A;  2G8K A;  4FJM A;  4NYN A;  4L8R B;  2ATQ A;  4Z0U A;  2RF2 A;  3VQ7 A;  2P5O A;  1TK0 A;  4CCH A;  2XRI A;  3F9K A;  4DFP A;  1S9E A;  2RPI A;  3VQB A;  1QSL A;  4B9V A;  4FJ5 A;  3KKR A;  3K5N A;  1VSE A;  2I5J A;  3C6U A;  4AHC A;  3WNH A;  3VQQ A;  4B9L A;  4DS4 A;  4DSK A;  3PO4 A;  1TAQ A;  3PX6 A;  4J2A A;  3KLF A;  3L3U A;  3SCX A;  4M3Z A;  3I0S A;  2FBV A;  2HHW A;  3OYH A;  3LAM A;  1TK5 A;  1HYV A;  1LAV A;  2YKM A;  3DLG A;  1FKP A;  2RN2 A;  2YHA A;  5SWM A;  4OPK A;  1L3U A;  3V1R A;  2KFN A;  1Z26 A;  1TGO A;  2IDO A;  5DMR A;  3HVT A;  2PZS A;  2VG7 A;  1RBU A;  1NK7 A;  1KLM A;  1QHT A;  4QAG A;  4CFB A;  4CK1 A;  3ISN C;  3V9S A;  3CM5 A;  3C94 A;  5DK5 A;  4LSL A;  3VQP A;  4CEQ A;  4CJS A;  4RW7 A;  3HXM A;  3QEI A;  4PWD A;  4DWI A;  1RT2 A;  3NH1 A;  3V1O A;  1WSF A;  4DTR A;  4Y1C A;  1SL1 A;  2YNF A;  1LW2 A;  4M41 A;  2HHV A;  3U6F A;  1RBT A;  1SL2 A;  4OLA A;  1YTU A;  5T7B A;  2YHB A;  3OY9 A;  3V4I A;  5HRO A;  4B3O A;  2KQ2 A;  2QXF A;  4FLW A;  5J2N A;  5FRN A;  4EZ6 A;  1JL1 A;  1VSD A;  1WN7 A;  1WAJ A;  4HHT A;  4CGH A;  3VQ9 A;  1VSI A;  3O3H A;  3KTQ A;  4DQP A;  1CZB A;  1S1T A;  1VK0 A;  3LWM A;  1KRP A;  1JLF A;  4JS4 A;  1LWF A;  4FLT A;  1VSL A;  1WSH A;  3K5O A;  5J2P A;  4J2B A;  4KHN A;  4GVM A;  1UAX A;  3NGZ A;  2VG5 A;  1QE1 A;  2D0A A;  1YT3 A;  3NGY A;  3OYD A;  3OJU A;  3NF7 A;  5CYM A;  3K59 A;  4DTO A;  1X9W A;  1D8Y A;  2BDP A;  1RT6 A;  4DU4 A;  3LAL A;  1BGX T;  1WAF A;  5FRO A;  2DFE A;  1D9F A;  1YVU A;  1JL2 A;  4PQU A;  3KIO A;  1TVR A;  5CY4 A;  4FM0 A;  4B8C A;  4CGJ A;  4M3T A;  4AHV A;  1Q9Y A;  4KHS A;  1KVA A;  2KW4 A;  1B9D A;  1ITG A;  4B9S A;  1LAW A;  4F8R A;  2HHU A;  4TSX A;  3K5L A;  4FW2 A;  1LV5 A;  3TAE A;  4M3R A;  4O0I A;  4E1M A;  4CHY A;  1LW0 A;  3K2P A;  4MQ3 A;  4LH5 A;  3L2R A;  4DTJ A;  1JLA A;  1LWC A;  3DM2 A;  5HP1 A;  4EZ9 A;  1O1W A;  4FK4 A;  4CFC A;  4O4G A;  4FJG A;  1REV A;  1TL1 A;  2XY7 A;  2KTQ A;  2FBY A;  3TAQ A;  4CJV A;  1IO2 A;  3SQ0 A;  5HLF A;  1ZYQ A;  3OYB A;  2ZE2 A;  4DTU A;  4FK2 A;  2YNG A;  3KLI A;  2VWK A;  4CIF A;  4CK3 A;  4CER A;  5HRP A;  3QNN A;  3TI0 A;  3ZT2 A;  4CGI A;  1NJX A;  3KD5 E;  1S1X A;  1BQM A;  4N5S A;  4DFJ A;  4IG3 A;  3DI6 A;  4FLY A;  4CEC A;  3TAM A;  4C8O A;  3LPU A;  4KHU A;  3T3F A;  1KVB A;  1U4B A;  3P5J A;  2VG6 A;  2E6L A;  5HRR A;  2P51 A;  2O4G A;  4C8N A;  4HUG A;  1ASU A;  1EET A;  5HBM A;  4E1N A;  2WOM A;  1KLN A;  3QEX A;  1NKB A;  4CJF A;  3QER A;  3QIO A;  1S6Q A;  4Q0B A;  2QKK A;  1HNI A;  4DU1 A;  5KRT A;  4M42 A;  2HNY A;  4O0J A;  2X6S A;  1UOC A;  3EZ5 A;  3L8B A;  3U3Y A;  4N47 A;  4H4M A;  4FM2 A;  4I7F A;  4RW9 A;  1NK6 A;  3OS0 A;  4FJN A;  2B5J A;  3OJS A;  5KGW A;  1QSY A;  4HTU A;  3AVM A;  3AO2 A;  1JLQ A;  3DOL A;  3S3N A;  4FLX A;  1GOA A;  3QEW A;  3PY8 A;  4ICL A;  4EP5 A;  2DTU A;  2EHG A;  3RWU A;  1C1B A;  3HP6 A;  4CF1 A;  1BIU A;  3DRS A;  4GW6 A;  1DTT A;  1CZ9 A;  2W42 A;  2X78 A;  1F21 A;  4B9U A;  1X9M A;  4I2P A;  2G8V A;  4BE0 A;  1X9S A;  1L3S A;  2IS3 A;  1NOZ A;  4BDY A;  1IKX A;  1RT1 A;  3ZT4 A;  1SUQ A;  2G8I A;  2PYJ A;  1L3T A;  1RDC A;  3L2W A;  4B9M A;  4JRQ A;  2RKI A;  3LZJ A;  1NJY A;  5K14 A;  1LWE A;  4DSE A;  1UWB A;  4FK0 A;  4Z4G A;  3QNO A;  3SUN A;  2VWJ A;  1JLE A;  1R0A A;  4Z4E A;  4CJU A;  1C0T A;  3LZI A;  1TKD A;  2KZM A;  2HW3 A;  3TAN A;  4J2E A;  1B92 A;  2HHS A;  4DTM A;  3LDS A;  1ZBU A;  3AVI A;  2NUB A;  2EX3 A;  1W0H A;  4C8L A;  4H4O A;  1ASW A;  1WNS A;  2F8S A;  4AHU A;  4FCY A;  3V9W A;  2A1R A;  4OGE A;  3MXI A;  4AH9 A;  3SUP A;  4CEO A;  4KTW A;  3RMD A;  1RDB A;  4XIU A;  3ZSR A;  3CFR A;  5D3G A;  1HRH A;  1T7P A;  2ETJ A;  2WON A;  4N76 A;  3RMA A;  4LH4 A;  2X74 A;  4W5Q A;  1RTI A;  1TL3 A;  1VSM A;  1K6Y A;  2F96 A;  3MEE A;  1T8E A;  3RR7 A;  4CJR A;  3JSM A;  4DSI A;  3AVH A;  4CIG A; 
#chains in the Genus database with same CATH topology
 3WNG A;  1EP4 A;  3KLG A;  1I94 K;  5C42 A;  4EAH D;  3A8Y A;  3AO4 A;  2Z1H A;  1HKG A;  1QQC A;  2ZQB A;  3DJC A;  4M63 C;  4RW8 A;  4BGA A;  4IDK A;  1NGF A;  4DF8 A;  3R8E A;  2NNW A;  4CGF A;  5LY3 A;  3DWL A;  3D0P A;  1C0M A;  4CJE A;  5AR0 A;  3SNN A;  4IXC A;  1N8R O;  2HNZ A;  5AQU A;  4AIL C;  1C6V A;  3RSE B;  4ZHR A;  3ENB A;  2O8E A;  5KI6 A;  3VOV A;  3DLH A;  2V51 B;  3LDN A;  2NRW A;  3HBT A;  4M3W A;  4LF4 K;  3V9X A;  4LSN A;  3M8Q A;  5AQN A;  3AGK A;  4BGB A;  4N41 A;  4K8X A;  2BE2 A;  3G0Z A;  1HPM A;  3TAB A;  1QQN A;  3AV9 A;  3AVA A;  5F2R A;  4Z4F A;  4DHY A;  4OKE A;  1TV6 A;  3FZK A;  3MWT A;  1JKH A;  4NYF A;  1QSS A;  4OVL A;  2UUB K;  2OCE A;  2WUS A;  3RRH A;  5JVH L;  3F9M A;  1KFS A;  3ITH A;  1RBS A;  3KK3 A;  5BR9 A;  4FLV A;  3L4I A;  3MCA B;  3TSU A;  3OTO K;  3GDQ A;  5I42 A;  3KZB A;  3AA2 A;  3PX0 A;  4DR2 K;  4BAC A;  4CZH A;  5EVZ A;  3ZSZ A;  4CE9 A;  3DLB A;  4H5V A;  2P5G A;  3VA0 A;  4CBU A;  3WNE A;  1T3V A;  5SZT A;  3VF2 A;  3PX4 A;  3G6E N;  3G71 N;  5LJW A;  4DG1 A;  1N32 K;  3EL2 A;  2HVH A;  3KK2 A;  2QK9 A;  3TTD A;  1K73 O;  1NGG A;  2VGM A;  4ZTF A;  4DQI A;  4EHU A;  4IEE A;  3K58 A;  4CGD A;  3RSE A;  4B1Z A;  4CJP A;  4CJW A;  5J2Q A;  4OJR A;  3NE6 A;  4F4K A;  3M1F A;  1RT3 A;  3ZT1 A;  4JKH A;  3O3F A;  1FKO A;  5C12 A;  4C1N K;  3S3M A;  3IKM A;  3H08 A;  4C8K A;  1EKE A;  4XH5 A;  2GUI A;  2B4J A;  3OYA A;  1S6P A;  2O4I A;  2ZGZ A;  4I9Q A;  5GIN A;  5JIC A;  4YFU A;  3ZSX A;  1LOT B;  2DFF A;  1VHX A;  5CYQ A;  1Q18 A;  3DRR A;  3I8D A;  3NFA A;  4H0T B;  1ZBL A;  5HRN A;  3CCQ N;  2ZJR L;  4OKK A;  2CH5 A;  4FM1 A;  2NLX A;  4CF0 A;  1RBR A;  4BR9 A;  4JI1 K;  2PYL A;  3OS2 A;  1QVG M;  3K5M A;  2Q3S A;  2VQF K;  3DAW A;  4BWJ A;  1DGK N;  4PL8 A;  2HST A;  4A2B A;  1GLE G;  3CG7 A;  1EWR A;  4DTS A;  2KZZ A;  1S1V A;  4FJX A;  1U48 A;  3P38 A;  1SL0 A;  3CCL N;  3VMF B;  3HI0 A;  1VRU A;  2PBD A;  3P4I A;  1T05 A;  2ZM6 K;  1NMD A;  4FJ8 A;  3HT3 A;  2AP1 A;  1CZA N;  3SQ1 A;  2DFH A;  1CXU A;  1U2V B;  4GKJ K;  4H8K A;  1R59 O;  4KRF A;  3MK6 A;  2BGG A;  4YOW A;  4AHS A;  1BI4 A;  3VQ6 A;  4CZK A;  3NCI A;  1NK4 A;  3ASM A;  4DS5 A;  5FDL A;  4GVE A;  3B6P A;  4NCA A;  3CCE N;  4RW6 A;  5JS2 A;  4KH6 A;  2Y1I A;  3SJJ A;  4RW4 A;  1QZ6 A;  3O3G A;  3OYG A;  4KB0 A;  4CJQ A;  4EIA A;  3VQC A;  4PA1 A;  2QXL A;  3EE9 A;  3VQA A;  1ZXO A;  3P39 A;  1WOQ A;  4CIE A;  4CZF A;  1YJW N;  3EKS A;  3KLH A;  4DU3 A;  1WLJ A;  3J7Z O;  2FSK A;  2OZS A;  2P9K B;  3AVL A;  2ASP A;  1XQS C;  2FC0 A;  3ZX3 A;  1BQN A;  4LF8 K;  1B9F A;  3THX B;  1S5J A;  4R5P A;  3UKR B;  4CEZ A;  4I2Q A;  2XHB A;  3E9L A;  3C65 A;  3LP0 A;  3T19 A;  3MX2 A;  4GV6 A;  1ZC6 A;  1N6Q A;  4WFN L;  5F1X A;  3KHY A;  3RTV A;  5C0Y A;  4GKK K;  4DLG A;  4DUZ K;  3SK3 A;  1QHA A;  4CD1 A;  1QTM A;  4OX9 K;  3A5N C;  2OYQ A;  1RDA A;  2P9N A;  1JLB A;  1SKS A;  1YVN A;  3KJV A;  5AQL A;  4ILJ A;  3O9T A;  2KKZ A;  4IFE A;  3OS1 A;  1SKW A;  3CCJ N;  1N33 K;  2DPN A;  1GOB A;  4DFM A;  4H0P A;  3NH2 A;  4K25 A;  1WB9 A;  4FWK A;  4E7J A;  1HQU A;  5CZ1 A;  4KO0 A;  5BPN A;  3CQ8 A;  5AQH A;  1ZBI A;  2G8W A;  1U47 A;  4IKF A;  1RCH A;  1GLB G;  3HL8 A;  4JK8 A;  3U9Z A;  2YJE A;  1HYS A;  4F3O A;  4CZJ A;  1OKJ A;  3ZCM A;  2G8K A;  4FJM A;  3O8M A;  3VQ7 A;  3JS6 A;  3T1Y K;  3KKR A;  3M6G A;  2I5J A;  2Q97 A;  3C6U A;  4AHC A;  3WNH A;  3I56 N;  3EZW A;  3PO4 A;  1HUX A;  3O5B A;  3KLF A;  3I0S A;  1LCU A;  3CPW M;  3E66 A;  3THX A;  3MWP A;  1HYV A;  2RN2 A;  3LDO A;  2KFN A;  1Z26 A;  2PFU A;  1VQ9 N;  2IDO A;  1YXQ A;  4RCH A;  1BA1 A;  1RBU A;  3OBY A;  1NK7 A;  3ZEU A;  4BRL A;  3V9S A;  3CET A;  4LSL A;  3HXM A;  4CEQ A;  3VGK A;  4B9Q A;  4DTR A;  1WSF A;  4Y1C A;  2CGK A;  4YDU C;  4B3S K;  3BZK A;  1YTU A;  3OY9 A;  3THW B;  4EFH A;  4DV6 K;  4PKI A;  5AZI B;  1VSD A;  1WN7 A;  4BRG A;  4YDU A;  3VQ9 A;  2A3Z A;  1NGC A;  1W7A A;  1CZB A;  1S1T A;  3UKU B;  1JLF A;  4JS4 A;  4FLT A;  1WSH A;  1QE1 A;  4DCH A;  4DTO A;  4WQ5 C;  4DU4 A;  1D9F A;  5FRO A;  3LDQ A;  3KIO A;  4A59 A;  2FXU A;  1TVR A;  4YOR A;  4KHS A;  2KW4 A;  1M90 O;  4TSX A;  1LV5 A;  4WQ5 A;  3H3O B;  2P9I B;  4O0I A;  3K2P A;  3I8B A;  1K8A O;  4PL7 A;  4LH5 A;  3CD6 N;  5IT9 O;  2WC9 A;  1OH6 A;  4CFC A;  4BR4 A;  4O4G A;  1REV A;  3CF5 L;  2XY7 A;  4CJV A;  5AQR A;  1ZYQ A;  4BC2 A;  2VWK A;  3ZET A;  1NJX A;  4DFJ A;  1YIJ N;  1K8K B;  4IG3 A;  4FLY A;  1IG8 A;  3DXM A;  3T3F A;  1KVB A;  1U4B A;  5FPM A;  4E1N A;  2WOM A;  1HKC A;  1NKB A;  3QIO A;  1S6Q A;  2HOE A;  3EZ5 A;  1UOC A;  3U3Y A;  3L8B A;  4N47 A;  2YCH A;  2O8D B;  4NB4 A;  4FJN A;  3THY A;  3AY9 A;  2B5J A;  5KGW A;  1QSY A;  3S3N A;  4E1J A;  1GOA A;  4ICL A;  1BIU A;  2X78 A;  4IEI A;  3OBW A;  2G8V A;  1HR0 K;  4BG8 A;  2E1Y A;  1SS6 A;  2D4W A;  3ZT4 A;  2HHH K;  3FZF A;  3VES A;  3K9K A;  2RKI A;  5AZJ B;  3LZJ A;  4CZL A;  4Z4G A;  2NRR A;  3QNO A;  4IO8 A;  2VWJ A;  2H3G X;  1C0T A;  3LZI A;  1Q7Y O;  3PIP L;  3TAN A;  5FPN A;  3MN6 A;  2D0O A;  4CD3 A;  2F8S A;  4FCY A;  2A1R A;  4YOV A;  1HRH A;  1T7P A;  4N76 A;  1NGE A;  1RTI A;  1T8E A;  4FWM A;  3RR7 A;  4CJR A;  1NMN A;  3AVH A;  4IG0 A;  4CF8 A;  4DMN A;  4CFA A;  3VN5 A;  3AA4 A;  4CFD A;  4OLB A;  4CHP A;  4FJL A;  4CJT A;  3PV8 A;  4HCB A;  3NF6 A;  3MCP A;  3CIP A;  2OZM A;  2P9U A;  4E7I A;  1JLC A;  4BRO A;  4H0O A;  4JKB A;  4HWI A;  1ZBS A;  3SUO A;  3AVJ A;  1NG9 A;  3HK2 A;  1Z6R A;  2P9P B;  5JS1 A;  5LMU K;  4IWV A;  4GV3 A;  2IC3 A;  3HVR A;  2P9S A;  4DQR A;  4KHQ A;  1X1P A;  4B08 A;  3E01 A;  5ELZ A;  4CEF A;  4FJ9 A;  4Z94 A;  4CHZ A;  1IKV A;  1XC3 A;  5JMV A;  2KLA A;  1GOC A;  2FSJ A;  4J8F A;  4YNQ A;  3HPO A;  1U45 A;  3RR8 A;  5AZJ A;  3QIN A;  5AQG A;  1JXE A;  1WUA A;  3MDQ A;  3HPH A;  2Z1J A;  5JLH A;  4FXD A;  1VSJ A;  3F2K A;  1D9D A;  3KVG A;  1RIL A;  3NF8 A;  1U6Z A;  4BY9 C;  3ZSW A;  4W5N A;  3ULD A;  1J9A A;  1NGA A;  1XHX A;  3U8X A;  1C0U A;  5HL7 L;  5KPT A;  3CME N;  3G25 A;  4BVO A;  1NJI O;  4F3T A;  2YJF A;  4JK9 A;  2D0P A;  4CBW A;  4CEB A;  3B6O A;  4A5B A;  4Y1D A;  4KTQ A;  2KHO A;  1ZBH A;  2O8E B;  1TYQ A;  4FOE A;  3J8A A;  4BVP A;  1HMV A;  5IWA K;  3MN9 A;  3PSF A;  3P1G A;  2I7N A;  4E3S A;  4KFB A;  3CER A;  1X3N A;  3DXK B;  4GMJ B;  4ID1 A;  4CF9 A;  1BHL A;  5F0X A;  2A42 A;  1IKW A;  4NCG A;  2IVP A;  1XUP O;  4R79 A;  1N34 K;  4BR5 A;  2FBT A;  2D5R A;  1RGI A;  1VQ8 N;  1W97 L;  5AJ3 K;  3TU5 A;  3H6E A;  4WFA L;  4CEE A;  4KKO A;  2XY8 A;  3JXU A;  2HHX A;  5AQS A;  1IKY A;  5GAG P;  3P83 D;  4N56 A;  4M45 A;  1N5Y A;  1ESV A;  2YNH A;  3BF3 A;  3JYT A;  1BA0 A;  3BUZ B;  4MLE A;  4M3X A;  4DV3 K;  3C95 A;  3QET A;  1MDU B;  5KRS A;  4O5B A;  3AVB A;  3J81 O;  3BY5 A;  4YOU A;  3LP2 A;  4F2R A;  3VPZ A;  4JRP A;  1SKR A;  4CES A;  1HPZ A;  4O8U A;  3TWH A;  1NGH A;  3DLR A;  4K41 A;  4FLZ A;  2GTD A;  4BDZ A;  3O9U A;  5KPR A;  2UYT A;  2Q36 A;  1HKB A;  1XWL A;  3WT0 A;  2IAJ A;  4KAZ A;  3BP8 A;  3CC2 N;  2W41 A;  2FSN A;  2DY4 A;  4PY5 A;  1FK9 A;  4QS8 A;  1Q9X A;  2Q0R A;  3Q7C A;  4CED A;  3I0R A;  4B1V A;  3TPQ A;  5J2M A;  3AAR A;  3DXK A;  4RG8 A;  2WBN A;  4KRE A;  3CCS N;  3A5M C;  1NKC A;  2O8F A;  2IOC A;  4ISG A;  2NRT A;  5C15 A;  4DUY K;  4B8A B;  1T6C A;  1HNZ K;  5I3U A;  1A5V A;  5EX5 A;  3BF1 A;  4M3U A;  3ZLJ A;  4JI0 K;  3FR0 A;  4JKG A;  3CCR N;  4DLE A;  2LSN A;  4CJK A;  1EXQ A;  3P31 A;  4JKE A;  5AQO A;  2IGI A;  3EYZ A;  4KHY A;  3SAF A;  1SV5 A;  1BOT O;  5C24 A;  1IJJ A;  2KFZ A;  4UY8 O;  1L5U A;  3QML A;  3M8R A;  1XNQ K;  4KPY A;  4DV4 K;  4LF6 K;  4CJ7 A;  3G10 A;  3EN9 A;  4JI6 K;  1MU2 A;  3MXJ A;  2GWK A;  3K0S A;  5C10 A;  3HSC A;  1A5X A;  4Q5V A;  1QS4 A;  3LDL A;  2O8C A;  4OPJ A;  4MLH A;  4BWM A;  4FLU A;  3VA3 A;  5M1Q A;  1KQS M;  5BRH A;  5CE3 A;  1BI4 B;  4JS5 A;  4L3Q A;  3AO5 A;  4BRF A;  1J5O A;  1T03 A;  1RDD A;  3O4N A;  1ATR A;  5M1N A;  3SQ4 A;  1NU0 A;  4BRM A;  4MFB A;  4DTP A;  3M8P A;  3TSP A;  4CJ5 A;  1Z25 A;  3LAK A;  4BDP A;  1J53 A;  1S72 N;  4B1X B;  4HVJ A;  3LWL A;  2HBL A;  4CHN A;  4BC5 A;  5J1E A;  2IVN A;  1RBV A;  2G8U A;  1FXX A;  2QEX N;  4DR5 K;  5AFU A;  1VQO N;  2GWJ A;  2J4R A;  2E88 A;  4LFB K;  3SYZ A;  4DB3 A;  2QTD A;  3NDK A;  4AQY K;  3KWI A;  4CHO A;  4FZY A;  1GLL O;  1TKX A;  2VCP A;  4BQZ A;  4C23 A;  4CCH A;  3J7A P;  1C0G A;  1S9E A;  4FJ5 A;  3K5N A;  2UUC K;  3VQQ A;  1TAQ A;  3L3U A;  3SCX A;  3O1W A;  4M3Z A;  4LF5 K;  1TK5 A;  1LAV A;  2YKM A;  3DLG A;  1FKP A;  3WQU A;  2P9N B;  3VEZ A;  3J80 O;  2O8B A;  4DV2 K;  4NO7 A;  3CM5 A;  4KBO A;  4M7Y A;  3QEI A;  1SL1 A;  3CC4 N;  2YNF A;  4M41 A;  2HHV A;  1RBT A;  4OLA A;  4X65 K;  2E1Z A;  4FWP A;  4FLW A;  1X3M A;  5FRN A;  1JL1 A;  1VQM N;  4HHT A;  4YOT A;  1VSI A;  1Z05 A;  2UXD K;  3LWM A;  1KRP A;  5AQF A;  1VSL A;  4KHN A;  3VTI A;  4J2B A;  4CZE A;  3OJU A;  5CYM A;  1NGI A;  5C2D A;  3LAL A;  1BGX T;  1YVU A;  1V4S A;  4MO4 A;  4M3T A;  4B8C A;  4CGJ A;  4AHV A;  3SAG A;  1Q9Y A;  5B8H A;  3GL1 A;  1LAW A;  2RE2 A;  2HHU A;  4H5N A;  4M3R A;  3NVM A;  5LL6 Z;  4WYB A;  1IV0 A;  4DTJ A;  1JLA A;  5HP1 A;  3Q7B A;  1RDW X;  5HOO A;  1KD1 O;  4FJG A;  5DM6 L;  2FBY A;  2YI1 A;  3ZEU B;  3TAQ A;  1IO2 A;  3OYB A;  1Q82 O;  4FK2 A;  3KLI A;  1E4F T;  4CER A;  5HRP A;  3QNN A;  3D6R A;  3ZT2 A;  4CGI A;  3KD5 E;  4G9Z A;  1MWK A;  2I7P A;  3TAM A;  4KHU A;  1ASU A;  3R1X A;  1KLN A;  4IJA A;  4CJF A;  3QER A;  3ID8 A;  4DU1 A;  2HNY A;  4O0J A;  2E2O A;  1NK6 A;  5BRD A;  1BG3 A;  5DM7 L;  3G4S N;  4MDB A;  2CGJ A;  4CF1 A;  4LC9 B;  3VER A;  4GW6 A;  1DTT A;  2W42 A;  4BR0 A;  3C6H A;  3L4Q A;  4B9U A;  3SLC A;  2IVO A;  4BE0 A;  1X9S A;  1L3S A;  2IS3 A;  1NOZ A;  4BDY A;  3KWG A;  4FWR A;  3HZ6 A;  1L3T A;  3J7Y P;  2PYJ A;  4B9M A;  4JRQ A;  1YAG A;  1LWE A;  3U9D A;  4Z4E A;  4CJU A;  5BR8 K;  2KZM A;  2HW3 A;  4DTM A;  2NUB A;  3RVC A;  5AFU H;  4C8L A;  4H4O A;  1ASW A;  3ZET B;  4OGE A;  1P8Z A;  3CFR A;  3DXM B;  3O08 A;  3CCU N;  2JWL A;  3HOS A;  3RMA A;  1TL3 A;  3ENH A;  4H03 B;  3MX5 A;  1TKT A;  4U7B A;  3MN7 A;  2ZGY A;  5LMN K;  4FVM A;  3FGU A;  4A5A A;  4FSV A;  3ZYY X;  4HUE A;  3THY B;  1C1A A;  5AQP A;  3VQ5 A;  4DSF A;  4KH4 A;  4JN4 A;  3SAH A;  3NF9 A;  3FZL A;  4KH5 A;  4DQQ A;  3OYI A;  2QWL A;  1VQ4 N;  1J54 A;  4JKA A;  4DTX A;  1D5A A;  4E7H A;  2GBZ A;  3OYE A;  2EWS A;  3N4P A;  3HP9 A;  3QEP A;  2HHT A;  1NLV A;  3WEE A;  3F5T A;  3LP1 A;  5KPZ A;  1GLD G;  3I33 A;  1ASV A;  2VYP A;  3ENO A;  1HNX K;  3U3G A;  2YHX A;  4JD2 A;  1TK8 A;  3L2V A;  2A1S A;  1NK8 A;  2XY5 A;  1YI2 N;  2NRX A;  4Z4C A;  3AA5 X;  1RNH A;  3IG1 A;  3VEO A;  3D2F A;  1IBK K;  2XY6 A;  4FJ7 A;  3IFR A;  3HPG A;  1BDG A;  4QOZ B;  3UE5 A;  3TR8 A;  4IZ9 A;  4E0D A;  1VSH A;  4LY7 A;  1RTD A;  3PUF A;  2VWB A;  2YHY A;  3ZSQ A;  1L3V A;  2QWN A;  2E2P A;  2P9U B;  3ATV A;  3QES A;  3A5O C;  5FLX O;  4PUO A;  3AO3 A;  3BZC A;  3CJA A;  3D2E A;  1NGB A;  4LF7 K;  3SV4 A;  4I6M B;  2HMI A;  3MED A;  2P9S B;  3OYL A;  3T1A A;  4BR2 A;  3VEW A;  1P90 A;  1Y97 A;  3VQ4 A;  5FPE A;  2E6M A;  3KLE A;  4WE1 A;  2BAN A;  1ATS A;  4OGC A;  3IS9 A;  4Q0B A;  1ZBF A;  3NH0 A;  1RTJ A;  3VQE A;  4ILH A;  4CW7 B;  3SI6 A;  4JEP A;  3HJF A;  1WSJ A;  3CM6 A;  3NBP A;  2B6A A;  4CZM A;  1NK9 A;  2QI2 A;  4B9T A;  1RT5 A;  3ZT0 A;  2QWO A;  1KXP A;  5CZ2 A;  1G99 A;  4IFY A;  2E20 A;  3E9P A;  3OYK A;  4KI4 A;  4JI3 K;  4IJN A;  2D0B A;  3QBW A;  4FPA A;  1C1C A;  3CJ7 A;  3QIP A;  2GX9 A;  4K43 A;  1K9M O;  1TAU A;  3CJ1 A;  3ALY A;  1TYQ B;  3DMJ A;  5C25 A;  3CI5 A;  3GBT A;  1RTH A;  3VGM A;  1WSE A;  4KV8 A;  1DKG D;  3C0B A;  3E1Y A;  4AHT A;  3V81 A;  3CYM A;  2OPQ A;  3L3V A;  1KSP A;  3ZSY A;  3NAE A;  5BRF A;  2R7Y A;  5E84 A;  4I6M A;  2WFB A;  2GV9 A;  3OYM A;  3OA9 A;  1QVF M;  3GOI A;  4HUF A;  4RTF D;  1NKE A;  5BN9 A;  1VQ6 N;  3LL3 A;  2JLE A;  1SZ2 A;  1G15 A;  1GLC G;  5KQD A;  3MEC A;  3H45 C;  2ZWH A;  1WBB A;  1KTQ A;  4BRH A;  4ELU A;  5FRM A;  4CZI A;  1JXB A;  1BO5 O;  4PHT X;  3K57 A;  3SMP A;  1JCG A;  3SJH A;  4E19 A;  1FJG K;  2OPR A;  2ZD1 A;  2E5L K;  2D0C A;  2OPS A;  4H5R A;  2P1J A;  1S3X A;  4QCL A;  3DLK A;  4FZZ A;  1S9G A;  4WF9 L;  2FBX A;  3U4L A;  1HQE A;  4IOC L;  3AGR A;  2OA8 A;  3RMB A;  1NWK A;  3D45 A;  2Z1G A;  4DQ8 A;  4XH4 A;  4I9L A;  4XEI A;  1BIZ A;  3UIQ A;  4FL9 A;  3O6W A;  3L0Q A;  2HBJ A;  3D7E O;  2HB5 A;  1I39 A;  2FLO A;  4JYA K;  1KCF A;  2HND A;  4IDH A;  4BRK A;  1HJR A;  1DLO A;  1NJW A;  4FJK A;  4U67 L;  3HST B;  3GG4 A;  1S1U A;  4YY3 K;  4K8Z A;  4DKW A;  3OYJ A;  3AVN A;  4DR6 K;  2G8H A;  2O8F B;  3CXC M;  4H0V B;  3ZX2 A;  3O1B A;  4RWT A;  1YJN N;  4H0X B;  4Y0W A;  1XC9 A;  3QBX A;  1U49 A;  4BRQ A;  4JKG B;  4A2A A;  4M3Y A;  3HM8 A;  4B1U B;  3AVK A;  4JHD A;  4X66 K;  4AHR A;  1KFD A;  4JI5 K;  5KGX A;  1KAY A;  3PSI A;  3HO1 A;  3AVF A;  5KTQ A;  1XMO K;  3CCM N;  3VF4 A;  3M8S A;  2A41 A;  2Y1J A;  3AAP A;  3LM2 A;  1VSK A;  3SZ2 A;  2HVI A;  2ATQ A;  4Z0U A;  3VEX A;  1HLU A;  4FWN A;  2XRI A;  3F9K A;  2O8C B;  3VQB A;  3T1H K;  4B9L A;  1TUY A;  1BUP A;  3A0I X;  5EY4 A;  1OH7 A;  2UXC K;  3FZM A;  5AQT A;  4J2A A;  1QQM A;  2FBV A;  4BRD A;  2HHW A;  3OYH A;  3LAM A;  1XMQ K;  5SWM A;  4OPK A;  3W0L A;  5BPM A;  1TUU A;  4GV9 A;  3TTC A;  3WXI A;  4QAG A;  1HJO A;  4CFB A;  3ISN C;  4X62 K;  3C94 A;  5DK5 A;  4H0Y B;  1RT2 A;  5GAH P;  1VAZ A;  3VEV A;  4MDA A;  3FLC O;  1LW2 A;  4IO9 L;  4KHP K;  3U6F A;  3QFP A;  1NGJ A;  2YHB A;  3V4I A;  4B3O A;  5J2N A;  3CPE A;  5M1P A;  4EZ6 A;  3KTQ A;  4WFB L;  1JCF A;  2BH1 A;  2F9T A;  4GVM A;  2VG5 A;  4JKF A;  1YT3 A;  3NGY A;  1D8Y A;  1X9W A;  1XNR K;  3CMA N;  5CHI A;  1WAF A;  1W2B M;  2DFE A;  4PQU A;  2NRV A;  4CVN E;  1B9D A;  1ITG A;  3ULE A;  3WXK A;  3WXM B;  4FW2 A;  2Q31 A;  3K5L A;  4O5F A;  4E1M A;  1LW0 A;  3O9S A;  3KK7 A;  4NLB A;  1MWM A;  4MO5 A;  1TL1 A;  4FWL A;  2KTQ A;  2O8B B;  4JI2 K;  3IUC A;  3SQ0 A;  2P9L A;  4DTU A;  4CIF A;  4BRA A;  3TI0 A;  1BQM A;  4N5S A;  4NXN K;  3DI6 A;  4CEC A;  3LPU A;  1KAX A;  5HRR A;  2VG6 A;  2E6L A;  2HF4 A;  2P51 A;  2O4G A;  1JJ2 M;  5HBM A;  3QEX A;  3W3D A;  2QKK A;  4DV5 K;  4M42 A;  1E4G T;  1T6D A;  4QS7 A;  4H4M A;  2VGN A;  4I7F A;  4RW9 A;  2ITM A;  4V19 S;  3T7Z A;  3OJS A;  4HTU A;  3AVM A;  3PY8 A;  4FLX A;  3QEW A;  4EP5 A;  2EHG A;  1C1B A;  3HP6 A;  2V7Y A;  3DRS A;  4FO0 A;  1CZ9 A;  1RFQ A;  3VEN A;  1F21 A;  4M7X A;  5TKW A;  4CI6 A;  4BC3 A;  4DV0 K;  2BUP A;  2FF6 A;  1HNW K;  1IKX A;  1NGD A;  1OH5 A;  2G8I A;  2ZJP L;  1RDC A;  3L2W A;  1QQO A;  2IIR A;  1NJY A;  2YHW A;  5K14 A;  1KAZ A;  1UWB A;  1JLE A;  4NXM K;  4J2E A;  1B92 A;  4FWS A;  1ZBU A;  3B8A X;  4AM7 A;  3E9O A;  4AHU A;  3V9W A;  2CH6 A;  4XIU A;  4OPA A;  3MN5 A;  3R3L A;  3C7N B;  4LH4 A;  2F96 A;  4DSI A;  2F4V K;  5GAE P;  4ISE A;  5BN8 A;  1J6Z A;  5AQJ A;  3S3O A;  1T44 A;  3AO1 A;  4KHW A;  1VQP N;  3KK1 A;  4BC4 A;  5E26 A;  4JI7 K;  4CK2 A;  2YV0 X;  4AM6 A;  3OVN A;  3SPY A;  3NGI A;  1OVY A;  4O55 A;  3WXL A;  4W5O A;  3V1Q A;  3QEV A;  3A2F A;  5AQW A;  4JNE A;  3VTH A;  3IAY A;  4F9O A;  3QFU A;  4DR4 K;  3F73 A;  2E2N A;  4WCE L;  1YIT N;  3MXM A;  1EWQ A;  3NVK A;  3FE1 A;  2JGU A;  1SAZ A;  2Z1I A;  4F2S A;  2PAV A;  1VQL N;  1HNV A;  1DT9 A;  1WSG A;  3IRX A;  3VQ8 A;  5E41 A;  4IBN A;  2BTF A;  3BEX A;  5CR4 A;  4W5T A;  4EHT A;  4BE2 A;  4BRC A;  3AVG A;  3EKU A;  2XO7 A;  4KTZ A;  3BDP A;  2ZJQ L;  4JI4 K;  4CZG A;  2GUP A;  4B3M K;  1BL3 A;  3WNF A;  2QWQ A;  4CJL A;  1NJZ A;  4KB1 A;  3VGL A;  4FYD A;  2GEM A;  2OTJ N;  5HRS A;  4DR3 K;  3T69 A;  4CBX A;  2G8F A;  1FW6 A;  4CHQ A;  4W5R A;  3SV3 A;  4PKH A;  4JKD A;  1JLG A;  1CLQ A;  3C7N A;  1YJ9 N;  4O44 A;  3FFI A;  3SPZ A;  5AQI A;  4H5W A;  5JLF A;  2OPP A;  3O9R A;  2AJQ A;  3LAN A;  2Q0U A;  3EE8 A;  4DSJ A;  3ATU A;  4JAX A;  2OTL N;  4B9N A;  1N36 K;  1GLF O;  3IDH A;  4BRI A;  5AQQ A;  3VF6 A;  3WEE B;  3TAR A;  1RT7 A;  4BR7 A;  4ZTJ A;  4NCB A;  3QDK A;  4IOX A;  1VSF A;  1NM1 A;  1XI1 A;  1XHZ A;  3ZSV A;  3HOT A;  4K42 A;  2YNI A;  1BWF O;  4ELV A;  3L2Q A;  4C8M A;  3GE1 A;  4CJ4 A;  1MA9 B;  1DEJ A;  1DTQ A;  4JD2 B;  4UQG A;  3I55 N;  3M5R A;  4XH1 A;  3MEG A;  2V52 B;  1U2V A;  1X9J A;  3FZH A;  3CFO A;  3VQD A;  4DFK A;  5FPD A;  3AVC A;  3D2F B;  3EO3 A;  3PO5 A;  4H5T A;  2ITG A;  4CGG A;  3JAM O;  3CCV N;  3CFP A;  3DRP A;  4FW1 A;  2QWR A;  2F8T A;  3WXJ A;  3HYF A;  3H1V X;  4JLH A;  3TAG A;  1WSI A;  3V6D A;  2HMP A;  3PIO L;  4FJJ A;  2RHK A;  3LPT A;  4A62 A;  1E3M A;  3O4W A;  1VQN N;  2Q1N A;  4BRP A;  4A57 A;  4CEA A;  2E4L A;  5AQY A;  3OHR A;  3QO9 A;  1VRT A;  3D2E B;  2E2Q A;  3SBT A;  4PKG A;  4DF4 A;  3LP3 A;  1TKZ A;  4FOI A;  3S9H A;  1Q86 O;  2P9K A;  4B3T K;  2QM1 A;  1A5W A;  4E7L A;  5H1S Q;  3WQT A;  3SUQ A;  3THV A;  3ZX0 A;  3NMU A;  3ZSO A;  1ILY A;  2ASO A;  4G1Q A;  1YTA A;  3UKR A;  5A2Q O;  2VQE K;  4E89 A;  3V9U A;  1BCM A;  4J2D A;  3TSQ A;  1Q8I A;  3DLE A;  2QWP A;  3FFK B;  3EY1 A;  4IOA L;  5LJV A;  4OKJ A;  2QA4 N;  1Q81 O;  4HCC A;  2QKB A;  3SMS A;  2ASM A;  2HBM A;  2W40 A;  4FWO A;  2A5X A;  1EX4 A;  3A5L C;  1NOY A;  3TAP A;  4CJ3 A;  4FJH A;  1HYZ A;  3SQ2 A;  1U04 A;  1NK5 A;  2V7Z A;  1EQY A;  4IFV A;  3R9P A;  4CF2 A;  4DQS A;  3BGR A;  4DSL A;  3KD1 E;  5AQX A;  4LD0 A;  1VQK N;  4DR7 K;  4LFA K;  2PY5 A;  4BG9 A;  3UB5 A;  1YHQ N;  3OYN A;  3RRG A;  4B3R K;  4JV5 K;  1UA1 A;  1IH7 A;  2NRZ A;  3CHW A;  4FWQ A;  4FZX C;  5ADX A;  3OW2 M;  1BCO A;  4E7K A;  4JI8 K;  1W9H A;  2YKN A;  1I3A A;  3ZT3 A;  3C6T A;  1CXQ A;  3DOK A;  2UUA K;  3DLL L;  2E8A A;  4Z4H A;  5EU7 A;  1NBW A;  2QW9 A;  4BE1 A;  4EP4 A;  1EO1 A;  5BRE A;  1BIS A;  3O9Q A;  5M1O A;  3V9Z A;  3NHG A;  1VQ5 N;  3N4Q A;  4Z4I A;  1S1W A;  1C0F A;  1J5E K;  4BRN A;  4B1Y B;  2FF3 B;  2HHQ A;  4YHH K;  3MMV A;  2JWK A;  1M1K O;  4FPB A;  2OAN A;  3TAF A;  3O4Q A;  2X6N A;  1IBL K;  1NK0 A;  2GEL A;  3DYA A;  3AA3 A;  4DTN A;  1UA0 A;  1KVC A;  3RMC A;  3HTV A;  3QLH A;  3THW A;  4ELT A;  3OYC A;  4FVU A;  5AZI A;  3MAQ A;  1RDU A;  4LF9 K;  4HTL A;  4KI6 A;  4ID5 A;  4OO1 J;  1RT4 A;  5M1F A;  3UKU A;  3L2U A;  3HM9 A;  4JK7 A;  3OYF A;  3M3Z A;  4DR1 K;  3L6Q A;  3KKS A;  4FJI A;  4DV1 K;  5C2F A;  5GIO A;  1IG9 A;  2CGL A;  3QB0 A;  4NYN A;  4L8R B;  1VQ7 N;  2QWM A;  1OVQ A;  5AQM A;  2RF2 A;  2P5O A;  1TK0 A;  4DFP A;  4B9V A;  2RPI A;  5I9E B;  1QSL A;  4GNI A;  2HHS A;  1VSE A;  4DSK A;  4B1W B;  4DS4 A;  3IMX A;  1V4T A;  3PX6 A;  3R6M A;  2P9I A;  3LM9 A;  2YHA A;  1JCE A;  4OPH A;  3V1R A;  1L3U A;  1TGO A;  5DMR A;  1YUW A;  3HVT A;  2PZS A;  2VG7 A;  3TTF A;  3C6A A;  1KLM A;  1QHT A;  4CK1 A;  3ID6 A;  3VQP A;  4CJS A;  4PWD A;  4RW7 A;  5M1K A;  4DWI A;  3NH1 A;  3V1O A;  4GY2 B;  1K8K A;  4YOX A;  3HRG A;  1KC8 O;  1SL2 A;  5T7B A;  5AQK A;  5HRO A;  2KQ2 A;  2QXF A;  3H1Q A;  1WAJ A;  1NNE A;  3H46 O;  2NRH A;  4CGH A;  4JHD B;  5BPL A;  4YOY A;  3O3H A;  4DQP A;  2O8D A;  1VK0 A;  3QIC A;  4ISF A;  5GAD P;  5JVG L;  3CQY A;  1LWF A;  2HF3 A;  3K5O A;  5EOY A;  5J2P A;  3CC7 N;  1UAX A;  4AF1 A;  3NGZ A;  2D0A A;  3OYD A;  3K59 A;  3NF7 A;  3AAQ A;  1OH8 A;  2BDP A;  1RT6 A;  5MLC Q;  5TKY A;  1JL2 A;  5CY4 A;  3VEY A;  4FM0 A;  4O8K A;  1WBD A;  1KVA A;  3H3N O;  4B9S A;  2A6A A;  4F8R A;  2A40 A;  3EEQ A;  3TAE A;  5EXW A;  2AA4 A;  4CHY A;  1ATN A;  4MQ3 A;  3L2R A;  2UU9 K;  1O13 A;  2W6K A;  1LWC A;  3DM2 A;  4EZ9 A;  1O1W A;  3K9J A;  4FK4 A;  4ILG B;  2NZT A;  5AQZ A;  4C1N I;  3CQX A;  5HLF A;  2ZE2 A;  2YNG A;  4CK3 A;  1S1X A;  2YX6 A;  1QZ5 A;  4C8O A;  4QS9 A;  4NLC A;  3P5J A;  4C8N A;  2F9W A;  4HUG A;  2UXB K;  1EET A;  5ADX H;  1HNI A;  5KRT A;  2X6S A;  4FM2 A;  3OS0 A;  3CJB A;  1GLA G;  1H1V A;  3AO2 A;  1JLQ A;  1GLJ O;  3DOL A;  4K0K K;  2DTU A;  2W6L A;  1S22 A;  3RWU A;  2ZF5 O;  3PLA A;  4WQ4 C;  1IBM K;  1SQK A;  3S41 A;  2P9P A;  2Q2R A;  4I2P A;  1X9M A;  2HBK A;  5GIP A;  3CJC A;  2D1K A;  1RT1 A;  3O80 A;  4JKC A;  1SUQ A;  4WQ4 A;  3ULE B;  3WUH A;  4X64 K;  5KQ8 A;  3LDP A;  4LFC K;  3SBG A;  4BRE A;  4FK0 A;  4DSE A;  4A61 A;  5AQV A;  3CJ9 A;  3SUN A;  1YF5 L;  1R0A A;  1TKD A;  4BQL A;  3LDS A;  2P9L B;  3AVI A;  2F7T A;  1D4X A;  2EX3 A;  1W0H A;  1WNS A;  3VET A;  2WTU A;  3MXI A;  4AH9 A;  3SUP A;  4CEO A;  4KTW A;  3RMD A;  1RDB A;  3ZSR A;  5D3G A;  2ETJ A;  2WON A;  2X74 A;  1Y64 A;  4W5Q A;  1VSM A;  3MEE A;  1K6Y A;  3JSM A;  1HX1 A;  1BU6 O;  4DV7 K;  4CIG A; 
#chains in the Genus database with same CATH homology
 4IG0 A;  3WNG A;  1EP4 A;  3KLG A;  4FVM A;  4CF8 A;  4DMN A;  4CFA A;  5C42 A;  3VN5 A;  4HUE A;  3AA4 A;  3AO4 A;  4CFD A;  2Z1H A;  4CHP A;  3S3O A;  4OLB A;  1C1A A;  3VQ5 A;  3AO1 A;  1QQC A;  4FJL A;  4DSF A;  2ZQB A;  4CJT A;  4RW8 A;  3PV8 A;  4HCB A;  4KHW A;  3NF6 A;  3NF9 A;  4IDK A;  3KK1 A;  4DF8 A;  2OZM A;  4CGF A;  4E7I A;  1JLC A;  4CK2 A;  2YV0 X;  3D0P A;  3OVN A;  1C0M A;  4CJE A;  3NGI A;  4DQQ A;  3SPY A;  3SNN A;  4O55 A;  4W5O A;  2HNZ A;  3OYI A;  3SUO A;  4AIL C;  3V1Q A;  3AVJ A;  3HK2 A;  1C6V A;  4ZHR A;  3QEV A;  1J54 A;  3A2F A;  4DTX A;  1D5A A;  3IAY A;  5JS1 A;  4E7H A;  2GBZ A;  5KI6 A;  3OYE A;  3F73 A;  3MXM A;  2IC3 A;  3HP9 A;  3HVR A;  3QEP A;  3DLH A;  2HHT A;  4DQR A;  2JGU A;  4KHQ A;  2KZZ A;  1X1P A;  4B08 A;  2Z1I A;  4F2S A;  3E01 A;  4CEF A;  4FJ9 A;  1HNV A;  1WSG A;  3IRX A;  4M3W A;  3V9X A;  3LP1 A;  4LSN A;  4CHZ A;  3VQ8 A;  3M8Q A;  1IKV A;  5E41 A;  1ASV A;  4N41 A;  4K8X A;  2BE2 A;  1GOC A;  4IBN A;  3G0Z A;  3U3G A;  4W5T A;  1TK8 A;  3TAB A;  4YNQ A;  3HPO A;  3L2V A;  4BE2 A;  1U45 A;  2A1S A;  1NK8 A;  3AV9 A;  3AVA A;  2XY5 A;  4Z4F A;  3AVG A;  4OKE A;  1TV6 A;  4Z4C A;  4KTZ A;  3AA5 X;  2XO7 A;  3RR8 A;  1JKH A;  1RNH A;  3QIN A;  1JXE A;  4NYF A;  1QSS A;  3IG1 A;  3BDP A;  4OVL A;  2XY6 A;  3RRH A;  3HPH A;  1BL3 A;  2Z1J A;  3WNF A;  4CJL A;  1NJZ A;  4KB1 A;  4FXD A;  1VSJ A;  4FJ7 A;  4FYD A;  3HPG A;  1KFS A;  3ITH A;  4QOZ B;  1D9D A;  1RBS A;  3KK3 A;  1RIL A;  3TR8 A;  3NF8 A;  5HRS A;  4FLV A;  3ZSW A;  4E0D A;  1VSH A;  1J9A A;  4LY7 A;  3ULD A;  5I42 A;  1RTD A;  3PUF A;  1XHX A;  2G8F A;  3AA2 A;  3PX0 A;  4CHQ A;  4W5R A;  4BAC A;  1C0U A;  3ZSQ A;  3SV3 A;  1L3V A;  3ZSZ A;  3DLB A;  1JLG A;  4CE9 A;  2P5G A;  3VA0 A;  1CLQ A;  4F3T A;  3WNE A;  4O44 A;  3FFI A;  3QES A;  5SZT A;  3SPZ A;  4PUO A;  3AO3 A;  3PX4 A;  2AJQ A;  2OPP A;  3LAN A;  4CEB A;  3B6O A;  4Y1D A;  4KTQ A;  4DG1 A;  3SV4 A;  1ZBH A;  2HMI A;  4DSJ A;  2HVH A;  3KK2 A;  4B9N A;  2QK9 A;  3MED A;  1HMV A;  3OYL A;  3T1A A;  3P1G A;  3TAR A;  1RT7 A;  4E3S A;  4KFB A;  4ZTJ A;  4NCB A;  4ZTF A;  1VSF A;  4GMJ B;  4ID1 A;  1XI1 A;  1XHZ A;  4DQI A;  3ZSV A;  4CF9 A;  1BHL A;  4CGD A;  1Y97 A;  3VQ4 A;  3K58 A;  2YNI A;  4CJP A;  1IKW A;  4NCG A;  4CJW A;  2E6M A;  5J2Q A;  4ELV A;  3KLE A;  4C8M A;  3L2Q A;  4WE1 A;  4OJR A;  4CJ4 A;  3NE6 A;  4F4K A;  2BAN A;  4OGC A;  2FBT A;  3IS9 A;  2D5R A;  1ZBF A;  1RT3 A;  1RTJ A;  3VQE A;  3ZT1 A;  1DTQ A;  4UQG A;  3NH0 A;  3O3F A;  3MEG A;  3SI6 A;  1FKO A;  4CEE A;  3S3M A;  3HJF A;  3H08 A;  3CFO A;  1EKE A;  4KKO A;  2XY8 A;  4C8K A;  2GUI A;  2B4J A;  1WSJ A;  1IKY A;  3VQD A;  3OYA A;  4DFK A;  2HHX A;  3P83 D;  3AVC A;  1S6P A;  3CM6 A;  2B6A A;  3NBP A;  4N56 A;  3PO5 A;  4M45 A;  2O4I A;  4I9Q A;  2ITG A;  4CGG A;  1NK9 A;  1N5Y A;  3CFP A;  2YNH A;  3DRP A;  4FW1 A;  2F8T A;  3JYT A;  4YFU A;  4B9T A;  3ZSX A;  3HYF A;  1RT5 A;  4JLH A;  3ZT0 A;  2DFF A;  5CZ2 A;  5CYQ A;  3TAG A;  4M3X A;  4W5N A;  1WSI A;  4IFY A;  3DRR A;  3I8D A;  3V6D A;  3NFA A;  4FJJ A;  1ZBL A;  3C95 A;  3QET A;  3LPT A;  5HRN A;  3OYK A;  5KRS A;  4OKK A;  4KI4 A;  4FM1 A;  4O5B A;  4CF0 A;  4CEA A;  2D0B A;  1TKT A;  1RBR A;  2E4L A;  3AVB A;  3QO9 A;  2PYL A;  1VRT A;  3OS2 A;  3K5M A;  1C1C A;  2Q3S A;  3QIP A;  4BWJ A;  3LP2 A;  4F2R A;  1TAU A;  4JRP A;  1SKR A;  4CES A;  4DF4 A;  3LP3 A;  3ALY A;  1TKZ A;  1HPZ A;  3S9H A;  3DMJ A;  5C25 A;  3TWH A;  3CG7 A;  3DLR A;  1RTH A;  4FLZ A;  1A5W A;  1S1V A;  4E7L A;  4DTS A;  4FJX A;  1WSE A;  4BDZ A;  4KV8 A;  1U48 A;  4AHT A;  3V81 A;  3SUQ A;  3THV A;  3ZSO A;  3CYM A;  2OPQ A;  3L3V A;  4G1Q A;  1SL0 A;  1YTA A;  1KSP A;  1XWL A;  3ZSY A;  3NAE A;  1VRU A;  4E89 A;  3V9U A;  1BCM A;  4J2D A;  1T05 A;  2IAJ A;  4KAZ A;  2R7Y A;  4FJ8 A;  3HT3 A;  2DY4 A;  4PY5 A;  1FK9 A;  1Q8I A;  2GV9 A;  3DLE A;  1Q9X A;  3OYM A;  3SQ1 A;  4HUF A;  2DFH A;  4CED A;  3EY1 A;  3I0R A;  1CXU A;  4OKJ A;  4H8K A;  1NKE A;  5J2M A;  4KRF A;  4HCC A;  2BGG A;  4AHS A;  2JLE A;  2QKB A;  1G15 A;  4RG8 A;  1BI4 A;  3VQ6 A;  3MEC A;  4KRE A;  1NKC A;  3NCI A;  1EX4 A;  1KTQ A;  2IOC A;  3ASM A;  4DS5 A;  1NK4 A;  5FDL A;  4ELU A;  5FRM A;  1NOY A;  3TAP A;  3B6P A;  4B8A B;  4CJ3 A;  4NCA A;  4RW6 A;  5JS2 A;  3SJJ A;  1JXB A;  2Y1I A;  5I3U A;  4FJH A;  1A5V A;  4RW4 A;  3O3G A;  3OYG A;  3K57 A;  1HYZ A;  4KB0 A;  4CJQ A;  4M3U A;  3VQC A;  4PA1 A;  3SQ2 A;  1U04 A;  1NK5 A;  4E19 A;  2LSN A;  3VQA A;  4DLE A;  4CJK A;  1EXQ A;  2OPR A;  4CIE A;  2ZD1 A;  4IFV A;  4DQS A;  2IGI A;  4CF2 A;  3BGR A;  3EYZ A;  2D0C A;  2OPS A;  3KLH A;  1SV5 A;  4KHY A;  5C24 A;  2P1J A;  4DU3 A;  4DSL A;  4LD0 A;  3KD1 E;  1WLJ A;  2KFZ A;  4QCL A;  3DLK A;  1L5U A;  4FZZ A;  3M8R A;  1S9G A;  2PY5 A;  2FBX A;  2OZS A;  4KPY A;  3AVL A;  1HQE A;  2FC0 A;  3OYN A;  1BQN A;  3RRG A;  3G10 A;  2OA8 A;  1B9F A;  1MU2 A;  3MXJ A;  3D45 A;  3RMB A;  1UA1 A;  1S5J A;  2Z1G A;  1IH7 A;  4R5P A;  4FZX C;  4CEZ A;  4I9L A;  4I2Q A;  1BCO A;  4E7K A;  2XHB A;  1W9H A;  1BIZ A;  3UIQ A;  1A5X A;  4Q5V A;  3LP0 A;  2YKN A;  3T19 A;  1QS4 A;  1I3A A;  3ZT3 A;  3C6T A;  1CXQ A;  1N6Q A;  4OPJ A;  3DOK A;  4BWM A;  4Z4H A;  5EU7 A;  3RTV A;  2HB5 A;  4DLG A;  1I39 A;  4BE1 A;  1KCF A;  4EP4 A;  4FLU A;  2HND A;  1BIS A;  3VA3 A;  1QTM A;  3V9Z A;  1HJR A;  1DLO A;  3NHG A;  1NJW A;  4FJK A;  3HST B;  2OYQ A;  4K8Z A;  1S1U A;  1RDA A;  4Z4I A;  1S1W A;  1BI4 B;  1JLB A;  4JS5 A;  1SKS A;  3AO5 A;  3OYJ A;  3AVN A;  3KJV A;  2HHQ A;  1J5O A;  1T03 A;  2G8H A;  1RDD A;  3O4N A;  3TAF A;  3O4Q A;  3SQ4 A;  2X6N A;  3OS1 A;  1NK0 A;  1XC9 A;  3DYA A;  4MFB A;  4DTP A;  3AA3 A;  4DTN A;  1SKW A;  3M8P A;  1UA0 A;  1U49 A;  1GOB A;  1KVC A;  4CJ5 A;  3RMC A;  1Z25 A;  4DFM A;  3LAK A;  3QLH A;  1J53 A;  4BDP A;  4M3Y A;  3NH2 A;  4HVJ A;  3LWL A;  4ELT A;  3OYC A;  4E7J A;  3MAQ A;  1HQU A;  5CZ1 A;  4CHN A;  5J1E A;  4KO0 A;  1RBV A;  2G8U A;  3AVK A;  4KI6 A;  1FXX A;  4ID5 A;  3CQ8 A;  1RT4 A;  4AHR A;  1ZBI A;  1KFD A;  2G8W A;  3L2U A;  5KGX A;  3HM9 A;  1U47 A;  4IKF A;  1RCH A;  3SYZ A;  3AVF A;  3OYF A;  3HO1 A;  3HL8 A;  3NDK A;  5KTQ A;  3KKS A;  4FJI A;  1HYS A;  4F3O A;  4CHO A;  4FZY A;  3M8S A;  2Y1J A;  3ZCM A;  3SZ2 A;  1VSK A;  1IG9 A;  2HVI A;  1TKX A;  2G8K A;  4FJM A;  4NYN A;  4L8R B;  2ATQ A;  4Z0U A;  2RF2 A;  3VQ7 A;  2P5O A;  1TK0 A;  4CCH A;  2XRI A;  3F9K A;  4DFP A;  1S9E A;  2RPI A;  3VQB A;  1QSL A;  4B9V A;  4FJ5 A;  3KKR A;  3K5N A;  1VSE A;  2I5J A;  3C6U A;  4AHC A;  3WNH A;  3VQQ A;  4B9L A;  4DS4 A;  4DSK A;  3PO4 A;  1TAQ A;  3PX6 A;  4J2A A;  3KLF A;  3L3U A;  3SCX A;  4M3Z A;  3I0S A;  2FBV A;  2HHW A;  3OYH A;  3LAM A;  1TK5 A;  1HYV A;  1LAV A;  2YKM A;  3DLG A;  1FKP A;  2RN2 A;  2YHA A;  5SWM A;  4OPK A;  1L3U A;  3V1R A;  2KFN A;  1Z26 A;  1TGO A;  2IDO A;  5DMR A;  3HVT A;  2PZS A;  2VG7 A;  1RBU A;  1NK7 A;  1KLM A;  1QHT A;  4QAG A;  4CFB A;  4CK1 A;  3ISN C;  3V9S A;  3CM5 A;  3C94 A;  5DK5 A;  4LSL A;  3VQP A;  4CEQ A;  4CJS A;  4RW7 A;  3HXM A;  3QEI A;  4PWD A;  4DWI A;  1RT2 A;  3NH1 A;  3V1O A;  1WSF A;  4DTR A;  4Y1C A;  1SL1 A;  2YNF A;  1LW2 A;  4M41 A;  2HHV A;  3U6F A;  1RBT A;  1SL2 A;  4OLA A;  1YTU A;  5T7B A;  2YHB A;  3OY9 A;  3V4I A;  5HRO A;  4B3O A;  2KQ2 A;  2QXF A;  4FLW A;  5J2N A;  5FRN A;  4EZ6 A;  1JL1 A;  1VSD A;  1WN7 A;  1WAJ A;  4HHT A;  4CGH A;  3VQ9 A;  1VSI A;  3O3H A;  3KTQ A;  4DQP A;  1CZB A;  1S1T A;  1VK0 A;  3LWM A;  1KRP A;  1JLF A;  4JS4 A;  1LWF A;  4FLT A;  1VSL A;  1WSH A;  3K5O A;  5J2P A;  4J2B A;  4KHN A;  4GVM A;  1UAX A;  3NGZ A;  2VG5 A;  1QE1 A;  2D0A A;  1YT3 A;  3NGY A;  3OYD A;  3OJU A;  3NF7 A;  5CYM A;  3K59 A;  4DTO A;  1X9W A;  1D8Y A;  2BDP A;  1RT6 A;  4DU4 A;  3LAL A;  1BGX T;  1WAF A;  5FRO A;  2DFE A;  1D9F A;  1YVU A;  1JL2 A;  4PQU A;  3KIO A;  1TVR A;  5CY4 A;  4FM0 A;  4B8C A;  4CGJ A;  4M3T A;  4AHV A;  1Q9Y A;  4KHS A;  1KVA A;  2KW4 A;  1B9D A;  1ITG A;  4B9S A;  1LAW A;  4F8R A;  2HHU A;  4TSX A;  3K5L A;  4FW2 A;  1LV5 A;  3TAE A;  4M3R A;  4O0I A;  4E1M A;  4CHY A;  1LW0 A;  3K2P A;  4MQ3 A;  4LH5 A;  3L2R A;  4DTJ A;  1JLA A;  1LWC A;  3DM2 A;  5HP1 A;  4EZ9 A;  1O1W A;  4FK4 A;  4CFC A;  4O4G A;  4FJG A;  1REV A;  1TL1 A;  2XY7 A;  2KTQ A;  2FBY A;  3TAQ A;  4CJV A;  1IO2 A;  3SQ0 A;  5HLF A;  1ZYQ A;  3OYB A;  2ZE2 A;  4DTU A;  4FK2 A;  2YNG A;  3KLI A;  2VWK A;  4CIF A;  4CK3 A;  4CER A;  5HRP A;  3QNN A;  3TI0 A;  3ZT2 A;  4CGI A;  1NJX A;  3KD5 E;  1S1X A;  1BQM A;  4N5S A;  4DFJ A;  4IG3 A;  3DI6 A;  4FLY A;  4CEC A;  3TAM A;  4C8O A;  3LPU A;  4KHU A;  3T3F A;  1KVB A;  1U4B A;  3P5J A;  2VG6 A;  2E6L A;  5HRR A;  2P51 A;  2O4G A;  4C8N A;  4HUG A;  1ASU A;  1EET A;  5HBM A;  4E1N A;  2WOM A;  1KLN A;  3QEX A;  1NKB A;  4CJF A;  3QER A;  3QIO A;  1S6Q A;  4Q0B A;  2QKK A;  1HNI A;  4DU1 A;  5KRT A;  4M42 A;  2HNY A;  4O0J A;  2X6S A;  1UOC A;  3EZ5 A;  3L8B A;  3U3Y A;  4N47 A;  4H4M A;  4FM2 A;  4I7F A;  4RW9 A;  1NK6 A;  3OS0 A;  4FJN A;  2B5J A;  3OJS A;  5KGW A;  1QSY A;  4HTU A;  3AVM A;  3AO2 A;  1JLQ A;  3DOL A;  3S3N A;  4FLX A;  1GOA A;  3QEW A;  3PY8 A;  4ICL A;  4EP5 A;  2DTU A;  2EHG A;  3RWU A;  1C1B A;  3HP6 A;  4CF1 A;  1BIU A;  3DRS A;  4GW6 A;  1DTT A;  1CZ9 A;  2W42 A;  2X78 A;  1F21 A;  4B9U A;  1X9M A;  4I2P A;  2G8V A;  4BE0 A;  1X9S A;  1L3S A;  2IS3 A;  1NOZ A;  4BDY A;  1IKX A;  1RT1 A;  3ZT4 A;  1SUQ A;  2G8I A;  2PYJ A;  1L3T A;  1RDC A;  3L2W A;  4B9M A;  4JRQ A;  2RKI A;  3LZJ A;  1NJY A;  5K14 A;  1LWE A;  4DSE A;  1UWB A;  4FK0 A;  4Z4G A;  3QNO A;  3SUN A;  2VWJ A;  1JLE A;  1R0A A;  4Z4E A;  4CJU A;  1C0T A;  3LZI A;  1TKD A;  2KZM A;  2HW3 A;  3TAN A;  4J2E A;  1B92 A;  2HHS A;  4DTM A;  3LDS A;  1ZBU A;  3AVI A;  2NUB A;  2EX3 A;  1W0H A;  4C8L A;  4H4O A;  1ASW A;  1WNS A;  2F8S A;  4AHU A;  4FCY A;  3V9W A;  2A1R A;  4OGE A;  3MXI A;  4AH9 A;  3SUP A;  4CEO A;  4KTW A;  3RMD A;  1RDB A;  4XIU A;  3ZSR A;  3CFR A;  5D3G A;  1HRH A;  1T7P A;  2ETJ A;  2WON A;  4N76 A;  3RMA A;  4LH4 A;  2X74 A;  4W5Q A;  1RTI A;  1TL3 A;  1VSM A;  1K6Y A;  2F96 A;  3MEE A;  1T8E A;  3RR7 A;  4CJR A;  3JSM A;  4DSI A;  3AVH A;  4CIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...