2BE2A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with r221239
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2be2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2be2A05
3MEGB 4ZTFA 3L3UA 3NH2A 3PW5A 2AQ4A 4CECA 4EEYA 1NKBA 2KFNA 4FJ9A 2E9RX 5SZTA 4HYKA 2JGUA 4TYBA 4CHNA 3TAPA 2AU0A 3NL0A 1IO2A 1U09A 1Y97A 5K14A 4NRTA 4DTMA 3LP1B 3OYAA 1RTJB 2E9ZA 4Q0BB 1SH2A 5SWMA 4QWBA 4PUOB 3SQ2A 3M8QA 4W5QA 4N41A 4F3OA 4JV0A 4QPXA 5J2QA 5F8MA 2ZKUA 1HQUB 3DLGB 1TL3B 1RYRA 1I39A 3KLGB 3RB4A 4KHNA 1VSEA 3KD5E 3ZSYA 4EBEA 3KK1A 1CXQA 1UA1A 4KHWA 1KSPA 4DL4A 4E7HA 4KI4A 1TL1B 4QWDA 2D0AA 4FVMA 3ITHA 3V6DB 3WNHA 4FZXC 3HVWA 4PWDB 1IKXA 4B9MA 4DL6A 3DOLB 3KLHB 4M41A 3CJ0A 2BANB 4IFYB 1ZTWA 4DTXA 3H5UA 3IS9A 1MMLA 4NLGA 4RW7A 4DQSA 4KB0A 3KJVB 2RPIA 1ASUA 1QE1A 5KFBA 4URQU 2ATQA 1ASWA 3PR4A 4DWIA 1CXUA 4GW6A 2OPRA 2RF2B 2Z1JA 2JC1A 4M42A 2R7YA 4CCHA 4DU1A 4OKJA 3V9WA 3L8BA 3OJUA 3BJYA 2R8KA 3ALYA 3QEPA 2G8IA 3MEEA 3Q8SB 3AVBA 3HHKA 3P5JA 3BSOA 4KSEB 2IOCA 4F50A 2DPIA 1W0HA 1IKYA 1CLQA 3FQLA 3SQ0A 3TAEA 4G3IA 3N6LA 1RDAA 1VK0A 2P51A 3H40A 3P1GA 4EP4A 1U48A 1ZBIA 1S6QA 3L2RA 2J6SA 2HHQA 3QGGA 4KPYA 3CG7A 4M95A 4Q8EA 3OYIA 3DLHA 4J9MA 3L2VA 3MTKA 3EY1A 3TWHA 4NLXA 2IA6A 2VWJA 2AGQA 1S6PB 3M8QB 4DQRA 3RAQA 3OS0A 3UDLA 4ECVA 2HB5A 3DLEB 1DTTA 3EZUA 2FBTA 1JXEA 3KKSA 3SUPA 3QIPB 5EDWA 2W7OA 3UR0A 3QERA 3KK1B 4URGA 1TK8A 3OYGA 2HAIA 1S97A 1HYSA 4K4XA 2ILYA 3I5CA 5CYQA 2IBKA 5DGAA 1S10A 1WSGA 5FDLB 4W5RA 3QEWA 2I5JA 4I2QA 3VQSA 4IDKA 3ITHB 2B4JA 4MKAA 3AVGA 3BSAA 4TQRA 2UVVA 3DLRA 1JLFA 3PX4A 5KFNA 3V6HA 4R8UB 3IS9B 4B8AB 4RW7B 3VQ8A 3IAYA 3CDEA 4J2AA 3S3OA 5KFSA 1QE1B 2VWKA 1S0NA 4KHUA 3TAFA 3RRHA 4C8OA 2R8JA 1BHLA 2OPRB 2OZSA 5J2PA 1S1WA 3G0ZA 3CIZA 4TQSA 5KFKA 3H4DA 4QOZB 2YV0X 2JC0A 1X9WA 4J9OA 4K50A 1RT1A 3MEEB 4CIGA 2OPPB 4B9SA 4FYDA 4K4WA 1RTIB 4CFCA 1GX5A 5KFZA 4FS2A 3KIOA 3SFUA 4ECQA 1IKYB 2VG7B 1O1WA 3PW2A 4BE1A 4FJMA 3V1RA 4CHOA 4UQGA 4ZP6A 3VQAA 4LQ9A 3U3YA 2XRIA 2C2DA 1JLBA 4CHQA 4E3SA 4O3QA 1J54A 1VRTA 4K8ZA 4R0EA 3DI6A 2YHBA 3AO3A 3K5NA 2G8HA 4FLYA 4FJXA 2Z1GA 4E7KA 4KAIA 2E9TA 3ZSQA 2FLLA 5JUMA 3B6OA 4ELUA 3QGHA 1NJXA 4DU4A 3OYMA 1RT7A 5F8NA 1RBRA 4OKKA 1S1XA 1NK0A 1WSIA 2OH2A 4TN2A 4CJFA 4FBUA 3PR5B 3ZT3A 3ZSXA 4JRPA 1EETA 5C25A 1C0TB 4Z4EA 3T3FA 1HYSB 4NLDA 3LWMA 1N4LA 4JRQA 1BQMB 5DGBA 5C42A 1NK5A 4FK0A 2I5JB 4I2QB 4CJTA 3ZSOA 4IDKB 1S1UA 4BACA 3AVNA 3NDKA 1DLOA 3GIIA 3FFIB 1SKRA 1JLFB 1VSLA 4O5BA 5EWFA 4MIBA 3F9KA 2XY8A 5KT4A 2IS3A 1HPZA 3M9OB 1JXLA 1NJYA 2IJFA 4OKEA 4KRFA 3KMQA 3M8PA 1WAJA 3RBEA 5KG4A 4DTJA 3AA3A 4CEOA 2G8UA 3GIMA 2KQ2A 4NCGA 3K57A 3DMJA 4PQUB 3WNFA 1RT1B 2R8GA 4XO0A 2D3ZA 4KFBB 4RNFA 3SI6A 4R5PA 5JXSA 5F9NA 5JS1A 5KFPA 4CHYA 3OYKA 4W5NA 2B43A 2ASDA 2HNYA 1RT5A 4ECYA 4NZ0A 3CM6A 5FRMA 1QAIA 2HVIA 4CGFA 3IGVA 5HRPA 3MEDA 5C5JA 4DL2A 2QK9A 3NF8A 1FKPA 4X2BA 4PY5A 3KD1E 1C6VA 4IOBA 2WONB 4DQQA 2FJWA 3VQ7A 4CFAA 3DYAA 4ECSA 3PUFA 3SV3A 5L1IA 3LANA 4ELVA 1NHVA 1RT7B 4WZMA 1VSFA 1WSJA 3CFPA 4IR9A 2YNHA 4RW6B 4ECUA 4CEDA 1TQLA 2ETJA 3K5OA 3SPYA 4F4YA 1EETB 5C25B 4ECWA 3BQ0A 4DS5A 3LP2A 4FBTA 3QZ8A 3SI8A 2ZE2B 4FZZA 2O5DA 1JX4A 5C42B 4QW8A 5KFFA 3L3VA 4WYLA 3HO1A 1EX4A 2PZSA 1RTHA 2YNIA 3HVTA 3H4BA 1LAVA 1N5YB 2FJVA 1TKTA 1RBUA 2VA3A 5KFTA 4NLOA 3BGRA 3CJ3A 2JLEA 3CDWA 5KFJA 3K59A 3NF9A 3OHBA 3PJXA 3I0RA 3M8PB 3JSMA 4K4TA 1XWLA 2V0NA 5KFGA 1DTQA 1TV6A 3KHHA 4NCGB 3I0SA 1IKWB 3NBPB 3L2WA 1XC9A 2D5RA 3C95A 1C0MA 3G6XA 3TARA 4ZP7A 1NK8A 1KRPA 4M94A 2PY5A 4MK8A 1S49A 3CJ5A 3G10A 3D28A 2QKBA 4R5PB 3DLKA 2D0BA 3ASMA 3V9ZA 4KAZA 1S4FA 2JEFA 4EYIB 2HWHA 3SUQA 1RT5B 3QNOA 4OGEA 4DF8A 3UPFA 3UIQA 4FJKA 1BQNB 3HK2A 3LP1A 3MEDB 4DQIA 1CZBA 5JS2A 1RTJA 3ISNC 4OGCA 4LD0A 4IR1A 3AO1A 4LSNA 4O3PA 5C24B 2YKMB 3PJWA 2AX0A 4MFBB 4M45A 4FJGA 4RW8B 1WNSA 3H2LA 3K5LA 1HQUA 3DLGA 4KTZA 2W8LA 3KLGA 4MQ3A 4DL7A 4HKQA 4BE0A 4FLUA 4NCBA 4TYAA 4ED6A 3O3GA 4B8CA 3HXMA 2FBYA 3OS2A 3M9MB 4IRDA 3L2QA 4RNHA 2HHXA 3LP2B 5KFEA 3V6DA 1IG9A 4PWDA 4WFZA 2ATLA 3OYJA 3VA3A 4DS4A 4KREA 3HVTB 2BANA 2F8SA 3HJFA 3LZJA 4TY8A 3D0PA 4M3ZA 1TVRB 1NJZA 4HCBA 3LALA 1QSSA 2E6LA 4AHSA 2RF2A 3ZT0A 3C6TA 3QYYA 2OZMA 1DTQB 1UWBB 2DY4A 5KT2A 3I0SB 4LY7A 3TANA 2GC8A 3GV5B 2BQUA 1LW0B 3MXMA 3DLKB 4ZVEA 3MXJA 3HT3A 1RDCA 1TP7A 3ULDA 5KGXA 4HUFA 3V4IA 4F4XA 4O3NA 4ICLA 1WSHA 1T05A 5J2NA 2V4QA 1FXXA 3ZSZA 1BIUA 4NLTA 4KHMA 4CGDA 2C28A 1HJRA 4LSNB 5EWGA 1JKHB 1WSFA 1QSYA 1S6PA 4ELTA 3H5XA 2W9BB 5DQIA 3DLEA 3NH0A 4H4MA 3KKRA 3QIPA 2AJQA 1HQEA 4AHRA 5KFIA 2F8TA 3RMAA 4TY9A 1NK7A 2JEJA 2DFHA 2LSNA 4J9QA 5FDLA 5KFOA 3NAEA 3SQ4A 2IM2A 2CKWA 1N56A 3FRZA 4EBCA 3B6PA 4FJIA 3KLIB 4CK2A 2O4GA 5FROA 2FVSA 3HL8A 3QIOA 1G15A 4R8UA 3G6YA 3RWUA 3ZCMA 4TY8B 4DFKA 5KT5A 5D3GB 4DF4A 2IM3A 1T03A 4LQ3A 3QNNA 3DM2A 1RT3B 4JS5A 4N5SA 3PO4A 4NLYA 3MR6A 4O55A 4WZQA 4Z4CA 3C6TB 5KFYA 5T7BA 5HRRA 2IM0A 4Q43A 2GIRA 4E7LA 4WXOA 4K4UA 3TI0A 2XY6A 4DSJA 2FBVA 3KK3B 3IN5A 1SL0A 1WAFA 2OPPA 5DK5A 3RRGA 4DFJA 1RTIA 4ECRA 5HBMA 2AX1A 2KW4A 3AO2A 4M3YA 1GOCA 4I2PA 1K1QA 4ZPBA 3TR8A 1JLCA 2VG7A 4QW9A 2RKIB 3S9HA 3VQ6A 3AA4A 3U3GA 3MECB 1BCOA 3OYEA 1KLNA 3V6JA 4ECTA 4FM1A 2DFEA 2R2TA 3SFGA 4RG8A 1NKCA 3V4IB 5KFLA 4YNQA 4F2RA 4ICLB 5KT3A 1T05B 5J2NB 3V81B 4CHZA 4YFUA 4KI6A 5KTQA 4M3UA 2B6AA 4FXDA 3OYBA 1NJWA 4J9NA 5J1EB 1RYSA 2QE5A 4CK3A 2HHSA 4CGHA 3T1AA 3A2FA 4B9UA 2P5GA 4H4MB 1KLMB 5L9XA 4ZTJA 3O4NA 1HQEB 2HW3A 1HARA 3CFRA 1SKSA 1C0TA 4LH5A 5I42A 3HVAA 5L1KA 1LWFB 1C0UB 1BQMA 1S48A 3N6NA 1GOAA 3LPUA 4ED2A 3LWLA 3PX0A 4K4YA 5KT7A 3FFIA 4JLHA 2R8IA 4DFPA 4CFBA 4E19A 1W25A 1J53A 1T03B 1RBTA 3RMDA 4YP3A 2BRKA 1RNHA 4B9NA 3DM2B 3NE6A 3TABA 4B08A 2YKNA 1Q8IA 4FLTA 2FLPA 2VG6A 4ED1A 4I7FA 3C6UB 4CJLA 1ZBHA 3NGZA 4E7JA 2HNDA 4WYWA 3I8DA 3TAGA 5EWEA 4PQUA 1LWCB 1IKVB 4Y34A 3HKWA 5DG7A 5DQGA 4FK2A 4KB1A 4IG0B 4KFBA 1JLEA 3KK2B 3NAHA 5HBMB 1TAQA 4Y1DA 3GYNA 4DMNA 3MXIA 4I2PB 5KG0A 4JUZA 1JLCB 1UOCA 3D5MA 4J2DA 3LP0B 3HP6A 3IG1A 3TQ1A 3AVAA 3QEVA 3S3NA 3AVIA 4Z4HA 2UVRA 5HROB 3H98A 3CJ4A 4DTRA 4CJ4A 2WONA 3G6VA 3FDSA 1QTMA 3V9UA 4FK4A 2B6AB 1T94A 4KTQA 2WHOA 1EP4B 2XI3A 1S0MA 3JYTB 1XR5A 1X9SA 2CJQA 3T5LA 3ZSRA 4DL5A 4CEAA 4RW6A 4M3WA 4IG3B 4YR2A 5KFDA 4FW2A 3SNNA 2Y1IA 3SJJA 1A5XA 4DFMA 5I42B 3KOAA 4J9PA 4CIFA 3RMBA 4E7IA 3AVMA 3G86A 1X9MA 4B9TA 2ZE2A 4DTNA 1U49A 4NYZA 3VQ5A 2UUWA 4ED8A 1N5YA 4Q5VA 2UVWA 2ZD1A 1REVA 3MFHA 4CGJA 4FM0A 3AO4A 2E6MA 4ZVGA 3LAMA 3KHGA 2YKNB 3ZSVA 3SUOA 2EX3A 4EYHB 1CZ9A 4CEQA 2VG6B 3RAXA 1RAJA 4I7FB 4Y2AA 3GV8B 2WTFA 4CF2A 3V9SA 4CEEA 1IKWA 3NBPA 3LP3A 5KRSA 2HNDB 1NK9A 2I1RA 3T19A 1NHUA 3VQEA 4FZYA 1JLEB 2FBXA 4MK9A 1Z26A 1GOBA 3H08A 2G8WA 1S0OA 1TKZA 3Q8RB 1NK4A 1VSJA 3QO9B 1BQNA 4DTOA 3SQ1A 3IG1B 4C8KA 5DMRA 1BL3A 1Z4UA 2ASJA 5C24A 4BDZA 4G1QA 1BIZA 4FJJA 3NGDA 2D0CA 2YKMA 1QS4A 3FQKA 4MFBA 1UAXA 5CY4A 3GIJA 2X74A 4RW8A 5KFVA 1S9FA 4ZPDA 3P83D 4Q8FA 3DRPB 1KVBA 3EZ5A 3GV7B 1OS5A 1LWEA 2XHBA 3QLHB 1IH7A 4BWMA 1SH0A 2DPJA 1U04A 1ZBLA 3OYFA 2GUIA 2NUBA 1HMVA 1BISA 4KB7A 4MIAA 2C22A 2IAJB 4RUAA 4BE2A 3CM5A 4HVJA 3QGIA 4CJ5A 4J9LA 1T8EA 4H4OA 4HHTA 3RB6A 1ZETA 2BDPA 1JLAB 2WK4A 5HLFB 5KG6A 2YNGB 4RUCA 3BSNA 3NF7A 1RT2A 4AHUA 4FW1A 2HWIA 2ZD1B 1REVB 3SCXA 2HHTA 3OY9A 1TVRA 1TKDA 1D9FA 5I3UB 4Z0UA 4CGGA 5KG3A 1MU2B 4MK7A 3QIDA 3GILA 3BREA 3KMSA 2YNFA 3HPHA 4M3XA 3V9XA 4EZ6A 1UWBA 4LSLB 1ZYQA 1LW2A 3VQPA 2XC9A 2W8KA 4CERA 4CF8A 2W9CA 4KTWA 1RCHA 4EO6A 3QZ7A 2D41A 1LW0A 4B9LA 4CJVA 5FRNA 4IKFA 4Z4GA 4EO8A 1NKEA 1S1TA 3HPOA 2B5JA 2HVHA 4N76A 5CZ2A 1TKZB 4KV8A 3E51A 4U6PA 2OPQB 1ZTTA 2P1JA 2R2RA 1KVAA 5HRNA 2VA2A 3I5BA 4TLRA 4ID1A 2R2SA 5EUHA 1JKHA 1F21A 4OL8A 2IM1A 3PW0A 4J2EA 4G1QB 2QKKA 1RT4A 2XCAA 1XR6A 2X78A 2YHAA 3Q8QB 2WRMA 2W9BA 3NGYA 3SPZA 3EPIA 5EU7A 4IH7A 4BWJA 2WB4A 2OPSA 5KG1A 5F8HA 2E4LA 3WNGA 1HNIB 3RBDA 2X6NA 1LWEB 2JEGA 1BI4A 4NLUA 1HMVB 4CF0A 3BQ2A 4XIUA 1VSHA 1N48A 2V4RA 4F4ZA 4IBNA 2IDOA 2A1RA 3KLIA 4H4OB 5DQHA 3PHEA 4CEBA 3QETA 3VQ4A 3OHAA 1RT2B 4YR3A 4ED3A 5D3GA 4JV2A 4NLVA 4LH4A 4Y2CA 2ITGA 3NFAA 1RT3A 3CYMA 4OLAA 1QAJA 4MH8A 3FSIA 1WNEA 1RBSA 3MF5A 3AA2A 1Q9YA 2YNFB 2XY7A 1LW2B 4AILC 3KK3A 4IRKA 3HVRA 2W9CB 4OLBA 2RN2A 2Z1IA 2IC3A 1U47A 1C2PA 1RBVA 3NGIA 4DQPA 4GC6A 1B92A 2RKIA 3SZ2A 4I9QA 5HP1B 2KZZA 1YVUA 1S1TB 3MECA 2B5JB 2EHGA 2WCXA 4E89A 1WLJA 4J9KA 4KV8B 4QCLA 1W9HA 2EC0A 1A5VA 3V81A 1YTAA 1D1UA 4J9SA 1YT3A 1RT6A 2GV9A 3S3MA 3K2PA 2FVRA 3OVNA 1RT4B 5J1EA 2VG5A 3BSCA 5KFHA 4W5OA 3V1OA 3OL7A 4J9RA 2OPSB 3WNEA 1KLMA 4BDYA 1WN7A 1RDDA 3AV9A 3NF6A 4CJRA 4Z4FA 4CJKA 3IRXB 1BI4B 1LWFA 1RTDA 1C0UA 4O3OA 3T5JA 4FJHA 5KFWA 3T5HA 3KLEB 4ZPAA 3VQBA 2ASLA 3OL9A 4ZP9A 4Z4IA 1XI1A 3V1QA 4RNOA 4N47A 5KG2A 4ZP8A 5L1JA 1CSJA 4WE1A 4AHCA 3E01A 4F4WA 4HUGA 2F96A 4EZ9A 4FM2A 3IGNA 2BQ3A 4DG1B 4HCCA 4O0JA 3PV8A 4NLSA 1N6QB 3C6UA 2DFFA 4OJRA 4QWEA 3ICLA 1IM4A 2R2UA 3KLFA 4WFYA 4MKBA 1LWCA 1IKVA 4O0IA 5KFMA 1VSMA 4ZVFA 4K8XA 4IG0A 3KK2A 1SH3A 4NLQA 2G8KA 1YTUA 2HHWA 4CJUA 3PY8A 2IC3B 1KFDA 4F8RA 2DTUA 3KHRA 5T14A 4O4GB 1HYZA 1ITGA 4N56A 5KFRA 4ZMMA 3LP0A 4QWAA 3VQCA 1VRUB 1ZBUA 5CYMA 5DLGA 4YQWA 4NRUA 1Z25A 4QAGA 1TKXA 1KFSA 3PW4A 1EXQA 2F8EX 5HROA 2Y1JA 4RW4A 2XO7A 1FKOA 4KHYA 2JEIA 4E1MA 3NH1A 3OSPA 1RT6B 2X6SA 4NYNA 2G8VA 4Y3CA 2PYLA 1ASVA 3OYHA 2AGOA 2VG5B 1UA0A 4FCYA 1S9EA 1EP4A 3KLVA 1L3UA 5K14B 3O3FA 3NAIA 3I5AA 3JYTA 3OS1A 1U45A 4WXWA 4DSFA 2RDIA 4IG3A 4HUEA 4DEZA 3H5SA 1RTDB 1RA7A 2IGIA 4RZRA 3MFIA 3PO5A 2C2EA 4CF1A 2XGPA 2OA8A 5J2QB 3CFOA 4C8LA 3BDPA 5KG7A 4CEFA 4OPKA 3DRRA 3BQ1A 5KI6A 4IFVA 2RDJA 4WE1B 1VSIA 4XPEA 3E01B 1S9GA 2HMIA 3TAMA 3PZPA 4DSKA 3KTQA 2WOMA 5CZ1A 3T5KA 4IQXA 4O4RA 1TK5A 3VQ9A 4XPCA 2GBZA 4JV1A 3ISND 1SKWA 3HM9A 3RMCA 1IKXB 3AVCA 3QINA 4CF9A 4ED7A 1J9AA 4DLGA 3QEXA 3KLFB 1FK9A 3EYZA 3M8SA 2V9WA 1D0EA 4CJWA 1NOZA 5KT6A 1JIHA 2P5OA 1I3AA 3K5MA 1T7PA 5J2MA 2ILZA 1S1VA 5L1LA 1Q9XA 3QO9A 2W42A 5CYMB 4DSLA 1TKXB 4EBDA 3CQ8A 2XI2A 4RW4B 1XHZA 1FKOB 1NK6A 3O4QA 3CWJA 1C1CA 4FLZA 2XGQA 4CIEA 2W9AA 4FJ7A 3DRSA 3DRPA 1S9EB 1J5OA 4EP5A 1S6QB 2J6TA 1KCFA 3QLHA 3L2UA 4CE9A 3RR7A 2GIQA 4TSXA 1D5AA 4CJPA 1SUQA 3HPGA 4FLVA 2IAJA 4B9VA 3N6MA 3H59A 1HNVA 2BR0A 1X1PA 4ZHRA 3M9NB 2KZMA 4RW9A 4KO0A 1DTTB 1KHWA 1JLAA 2XWYA 3O3HA 5HLFA 2YNGA 1KHVA 2BE2A 3DRRB 3NKYA 1A5WA 4W5TA 3NMAA 1XHXA 4IFVB 5DG9A 2KTQA 3VQDA 3OL8A 2HNZA 5F9LA 1L5UA 4WFXA 1JL2A 2HMIB 1S9GB 3TAMB 3AVFA 5I3UA 1JXBA 2WOMB 5CYQB 4F3TA 3LAKA 1MU2A 4DSEA 4Y1CA 1HRHA 5F8IA 3ZT1A 5DLFA 3CJ2A 4KHSA 2FC0A 1YVFA 3OSNA 1SV5A 5KFCA 3ZT2A 2A1SA 4LSLA 4DTUA 1RILA 3RTVA 1FK9B 3F73A 5KFQA 5F8JA 4CJQA 4DTSA 4NLRA 1VSDA 2UUTA 4AH9A 3PVXA 4TXSA 5J2PB 4H54A 1S1WB 3OYNA 4HTUA 3CO9A 5J2MB 4YMEA 1RA6A 1HYVA 1JLGA 4E1NA 1S1VB 4JS4A 4NYFA 3DOKA 1QUVA 4FLXA 2OPQA 3ZT4A 2C2RA 4CEZA 4J2BA 2PYJA 3NCIA 3AVHA 4E0DA 2R8HA 5KG5A 4I9LA 1TAUA 1C1CB 4L8RB 2IJNA 2W7PA 2Z1HA 3KHLA 4AHTA 4BDPA 4FLWA 1L3VA 1JLBB 3DRSB 1VRTB 4FS1A 3NHGA 1J5OB 3PX6A 3MR2A 4O44A 2FVPA 3Q8PB 1HNIA 1EKEA 4IRCA 3DI6B 4ID5A 2OYQA 2IMWP 1C1BA 3SV4A 2QXFA 1LAWA 1SUQB 1QQCA 2FJXA 3ZSWA 4ECZA 1JLQA 1HNVB 3LPTA 3DLBA 4NLPA 4YR0A 4CJ3A 4F4KA 4ZHRB 4RW9B 4KO0B 2XCPA 2QV6A 1L3SA 5E41A 2ALZA 1S1XB 3D45A 1D9DA 2BE2B 3KNAA 5F8GA 5DG8A 2HNZB 4B3OA 3QEIA 4GVMA 4DU3A 3AVKA 1R0AA 4CFDA 4FJ8A 1D8YA 1XR7A 3SYZA 3V6KA 4F2SA 4ECXA 4KKOA 3OLBA 2Q3SA 1NNDA 4DL3A 1S1UB 3GIKA 2ZQBA 1SV5B 1DLOB 3UQSA 3CVKA 2UVUA 2BGGA 2KFZA 2FLNA 4CESA 1KVCA 4QWCA 4DLEA 4RU9A 4RNMA 1HPZB 3OYCA 2FVCA 1L3TA 1RDRA 4KBIA 4DSIA 5HP1A 4C8MA 4FJNA 4FJLA 4NCAA 3GQCA 2D3UA 1K1SA 3RR8A 3THVA 1JLGB 3DDKA 2XY5A 3DOKB 3DMJB 4ED0A 3M8RA 3HP9A 1T3NA 3MEGA 5KGWA 3VA0A 1U4BA 3LZIA 4AHVA 5KFUA 4KHRA 3CDUA 1RDBA 4K4ZA 5HRSA 4RNNA 4M3TA 4CK1A 2FVQA 3AVJA 1K6YA 3LDSA 1BGXT 2HNYB 4ZPCA 1NOYA 1B9FA 3OL6A 3HSTB 1I6JA 1BCMA 4PA1A 1TGOA 4Q44A 4O44B 4ID5B 1C1BB 3SUNA 4Q0BA 4NLWA 4KE5A 3BR9A 1FKPB 2BRLA 3IRXA 4PUOA 3RB3A 3MR5A 3OYLA 3KLEA 1JL1A 3DYAB 1JLQB 4GC7A 1LV5A 1QHTA 1B9DA 4O3SA 4IH6A 1TL3A 4O3RA 3AA5X 1QSLA 1SL2A 4CJEA 3QESA 4CHPA 2YNHB 2HHVA 3MR3A 3AVLA 3TAQA 3U6FA 4K4SA 3OJSA 4B3OB 1TL1A 1SL1A 3PW7A 3TVKA 4OPJA 1R0AB 2G8FA 4DG1A 4CJSA 4OVLA 4IH5A 5KFXA 4GMJB 2O4IA 3DOLA 4KKOB 3KLHA 1N6QA 3EPGA 4C8NA 1RTHB 2YNIB 4IFYA 3H5YA 2D7SA 1TKTB 3OYDA 3K58A 4Q45A 3KJVA 3AO5A 3BGRB 1C1AA 3RB0A 1TK0A 3C94A 4U7CA 4FJ5A 4K4VA 2AGPA 5F8LA 1WSEA 2HHUA 3HYFA 2BQRA 4URSA 3I0RB 3OLAA 3JSMB 4CGIA 2J6UA 4IKAA 5KFAA 4O4GA 4M3RA 1VSKA 1TV6B 3VQQA 1GX6A 4ZVHA 5KRTA 4DTPA 4KHQA 1KTQA 1VRUA 2AWZA 3VN5A 4H8KA 1ZBFA 3MAQA 1S5JA
chains in the Genus database with same CATH superfamily
3MEGB 1M1HA 4FJ9A 3OTEA 2JGUA 1EWQA 3NL0A 4A46A 2H54B 1UVNA 2VPWB 5CQGA 2HFVA 2XYPB 5K14A 3AGRA 3MN5A 3WXJA 3CJAA 1WDTA 3LQVA 4DTMA 3LP1B 1H74A 3MCSA 1CG2A 5SWMA 3CCES 3SQ2A 1S7IA 4CRJA 3H20A 4F3OA 2NRVA 4KRWA 4JV0A 4DR7K 4ZVOB 4CZMA 5IQ6A 5F8MA 2ZM6K 3K9JA 1EO1A 1I39A 3RB4A 1SJ3P 2MSTA 3KK1A 1UA1A 3OXGA 1HWJA 2HQ3A 3QMQA 5ETKA 2BUNA 4UUXA 1WBBA 4A8QA 4B3TK 4KI4A 2RS2A 3IM9A 4LF7F 4OYPA 1SVDA 2OFGX 2WZ1A 1S79A 1IKXA 1R3NA 2X3DA 2BANB 5AJ3K 4IFYB 4B1WB 1TTHB 5G0RB 3RAMA 4LFAF 4DTXA 5D0HA 4NLGA 2DR7A 1XIQA 2RPIA 3QJPA 5KFBA 4DWIA 2ATQA 5CXTA 4W4MA 2ZH9A 1NBEB 1DQAA 4GW6A 1ATNA 3L09A 2HKEA 3K89A 4CVNE 2ASYA 2JC1A 4PXCA 2Z56B 1KBRA 5LL6Z 3KG1A 3O8MA 3L8BA 2MQ8A 3GPAA 2UYTA 1Y64A 3MEEA 1GXLA 3HHKA 3JS9A 4ZLNA 2OD6A 1WOQA 1KTVA 1HR0K 1N33K 5F3ZA 2AT1B 4DZ6A 4X66F 4JI6F 4ZITA 4TU9A 1RGVA 2KKHA 4HACA 2HFZA 3R6MA 2GO8A 2BEFA 2AF6A 4DR7J 3VAJA 1ZBIA 1S6QA 4B3SF 5LXRA 5A2QY 3QGGA 2EK1A 3OYIA 2ZM6J 1SJ4P 5B09A 3K2YA 4PEOA 3MTKA 4OI4A 2DNNA 4DCOB 3B6BA 1AFJA 2VWJA 2AGQA 3VGTA 2LFVA 1S6PB 2VJVA 4DOZA 1WEZA 3WXLA 3RAQA 3OS0A 4ZJOA 4B3TJ 3H42A 3DU6A 3EZOA 2FXUA 5B0DA 3C65A 1JXEA 3QIPB 5EDWA 4K25A 2MDAA 3UR0A 2QL9B 1S97A 1PO6A 1P1LA 2ILYA 5AJ3J 3I5CA 3PNIA 3PIPL 2FC8A 1S7HA 1WSGA 5FDLB 4DX5A 1O51A 4I2QA 2VL1A 4HDGA 3AB4B 3AVGA 1JLFA 5KFNA 2FIUA 3CDEA 1QD1A 3EVMA 4A8XA 1JNRB 3L3CA 4IOAL 1S1WA 5HQMA 1HR0J 1RHQB 3DOMA 1N33J 4R0JA 2ZGZA 5KFKA 4K41A 2JC0A 1X9WA 1VHXA 3FK4A 2J8SA 1RT1A 2DYAA 4H5RA 2GHVC 3SCLE 3KVGA 4BC2A 4WFBL 5KFZA 1B0VA 1DARA 5A6WA 3ENHA 2HVDA 1Y5LB 4DV7F 4ZP6A 5A2QO 2GAGC 1KS2A 4M5DB 3BGOP 1VRTA 4QS9A 3DI6A 2O3DA 4JKDA 2H3GX 1RXOB 5AQNA 3GFXA 3CC7N 1D09B 3PFOA 3AARA 4ELUA 3QGHA 2QWNA 5TKWA 3DAWA 4X4TA 1IQZA 3QJJA 1VRQC 3HI0A 1S1XA 1WSIA 3PIOQ 2WSEC 4JHDA 3ZT3A 3ZSXA 4Z4EA 4PR6A 1DEJA 4PYAA 3M2UB 3LWMA 4C8ZA 3MM9B 4JRQA 4M5JA 4IYQA 4Y65A 5C42A 1CJTB 1NK5A 1R7IA 4B02A 3ZSOA 4Y2KA 1YQHA 2OKQA 1NGIA 5M1FA 3CCJN 2GCFA 1SKRA 2CJXB 2AEFA 2DO4A 1R0BG 1F9EB 1CULB 2NZCA 3M9OB 3C8YA 1WAJA 4KPCA 2G8UA 3GIMA 1XMBA 4DV2J 4QIWD 3DMJA 2A0FB 4ZVQB 2MXYA 1IN0A 5K8PA 4XO0A 4JV5F 5E3CA 2I8EA 1T0TV 4R79A 5JXSA 2Q36A 4WF9L 3J7YU 3L6QA 4W5NA 1MA9B 2B43A 2ASDA 1P6TA 1FD2A 5DO2A 1B0TA 4ECYA 3CIMA 3DXKA 1ZH5A 3DCAA 2DITA 4X4QA 3HSJA 4CGFA 4FOEA 3HOSA 3CPWR 3MEDA 4DL2A 5CHIA 1Q5VA 4ERDA 4JI4K 4DPXA 2WONB 3NNAA 4DQQA 2QX0A 4IDHA 4H0VB 4FYXB 1NXIA 4ECSA 4IEIA 3PDNA 1Q79A 5GAGP 2D3OR 3ILJA 4JK9A 1OSDA 5M1QA 4WZMA 1P27B 3BUZB 1HNXK 4IR9A 4ECUA 3BM7A 3SPYA 4F4YA 1Y5NB 4CZKA 4DB3A 3LUYA 4AXIA 1QLNA 3OPKA 3BQ0A 2LDYA 3P45B 4FBTA 3M32A 1RLCL 3R2CJ 1JX4A 3E9PA 2QTWA 3HO1A 3CE8A 2DPNA 3OW2R 2DEJA 2ZH4A 2VA3A 1DQ8A 3E3XA 4P7TA 4DPWA 5B0CA 2X51A 4K7QA 3BGRA 3CJ3A 4ANCA 2JLEA 3THXB 5KFJA 1S5ZA 2P9EA 2WB1D 5HVHA 3MPWA 1OH7A 4OI6A 2CQ1A 2V34A 1BD6A 2UUCF 1N5SA 3FSXA 4QIVA 3L2WA 3SBMA 4ZP7A 3PJ9A 4OV1A 4M94A 3MCNA 4ANEA 4EMDA 2CNKB 3CJ5A 2YWGA 3G10A 3D28A 3VALA 2K8GA 2MKYA 3CCSS 1NLKL 4JI4J 1S4FA 3M2RB 4CYUA 2HWHA 3SUQA 1RT5B 5JLFA 3MGJA 3HSDA 3K8WA 2V9KA 3W63A 1RTJA 3ISNC 4M63C 2KI2A 4OGCA 3AO1A 2OTLN 2DHHA 3GJTB 1HNXJ 3O4WA 3PJWA 2AX0A 1H2VZ 1VQNN 2XMTA 4KYZA 3C6AA 3IM8A 4FJGA 5F2RA 1WNSA 1OSCA 5DM6L 2M0GB 2KYZA 4RWTA 4MQ3A 4DL7A 3U9ZA 4HKQA 3MPVA 4BE0A 1GFWB 2P9IB 4ED6A 1DAXA 4B8CA 3HXMA 4J9UE 3UKUA 3NOCA 4CLFA 2XS5A 1KNZA 1FTCA 5KFEA 3V6DA 1ZAXA 3BF4A 3HHLA 2DJWA 4PWDA 2ATLA 4DS4A 4KREA 2A10A 3P8BB 4WU2A 1QQMA 5GAEU 3HJFA 1FX4A 2K1RA 4ISFA 3LZJA 2O8DA 2BV3A 1TVRB 3VEWA 2N3LA 2ZZTA 1QSSA 3AA9A 3OQ2A 1G4CA 3RZAA 2XS2A 2OZMA 1DTQB 1UWBB 3RGIA 4LY7A 5C10A 5HN0A 2RH3A 3GFZA 4HWIA 1H1VA 4OI0A 1Q82T 3MXMA 4QIEA 4BC3A 1YITS 4ZVEA 3MXJA 3PM9A 2L3MA 1RDCA 1VLOA 3OFEA 3ULDA 2CXEA 4NE9C 2E7WA 3M7VA 2C3MA 1ACMB 1T05A 5I4MA 1FXXA 4YN3B 3ZSZA 4NLTA 3P39A 4JK7A 1NH8A 3EKUA 2CDRB 4ELTA 4OX7A 3H1QA 3E9OA 2A3ZA 5ETTA 3RU0A 2AJQA 1HQEA 4QZVB 2YX7A 4C23A 1NPKA 3SBGA 2HBQB 4TY9A 4J37A 3KWMA 3FSYA 1JNZB 2QA4S 1OYDA 3QFPA 4WU3A 3DXSX 1N56A 4EBCA 3KLIB 3NS7B 2FVSA 3HL8A 1X4BA 4R8UA 3G6YA 4MYTA 2IA0A 5D3GB 5KT5A 1WDDA 4ZVPB 4LQ3A 1DBDA 4TLQA 3EWGA 3L7UA 4N5SA 4A8KA 4CLSA 4NLYA 2HSTA 4LT6A 1HWIA 4BR4A 5T7BA 2O66A 3M1VA 2XO6A 1HWKA 4CLLA 4E7LA 4WXOA 2OELA 3T6BA 3FFKB 3IN5A 1S72S 2OPPA 3RRGA 2AX1A 1OH6A 2V67A 1RE1B 1V3RA 1UWAA 1T9UA 2U1AA 3TR8A 2AYMA 3CCRS 2VG7A 1GMUA 1FE4A 2GJFA 3AA4A 5AQWA 2FLOA 3V6JA 4FM1A 1VQKS 2L41A 2LP4A 4F2RA 2EFNA 1CQMA 4CHZA 3JXUA 1Q16B 4OQJA 2FUG9 3D68A 4B3RK 2LYVA 3OYBA 1HLWA 5GMKa 5J1EB 2QWLA 2ZJPL 2QE5A 4CGHA 2GWJA 1VCTA 4H4MB 2P9PB 1HBOA 4ZTJA 3IAS9 2KKZA 1CJVA 3CFRA 3NXZA 2BE7D 1C0TA 4LH5A 1RAHB 1C0UB 4ZK7M 2ZH1A 3KG0A 1GOAA 2DRDA 4NOHA 3QNWB 5M2UA 2M5YA 4FDFA 2VODA 3FFIA 4LF6K 2MQNA 4DV1K 2UXCF 5FJ4A 1W25A 1KVJA 1RBTA 3RMDA 1X4FA 2MB0B 2CPXA 3NE6A 1Q8IA 2FLPA 3MI7X 3ADAC 2NXJA 3W64A 4ED1A 1XMQK 5A8RA 3SSRA 1S99A 1YJWN 5HQLA 4RKUC 1GNKA 4PQUA 2AJ2A 2QLXA 1IKVB 4EAHD 5DQGA 4KB1A 2AEJA 3NAHA 3BGLA 3L7OA 4TU8A 1TAQA 4Y1DA 3ONQA 2O8BB 1NMNA 3T1YK 4DMNA 3MXIA 4I2PB 4C3LA 1PJ5A 3ZETB 1IBMK 4IOCQ 1JLCB 3A5OC 1M1KT 3O8WA 2ZH6A 4YOUA 4B3RJ 2BZ2A 4Q2LA 1V4TA 3HZGA 2B4OA 4LFBK 2RB7A 4CBUA 2R7TA 3TA0A 2UVRA 5D4PA 2HZCA 3CJ4A 2DNYA 4ZPWR 1Y4ZB 5IC6B 4CJ4A 2BJEA 3EZWA 2B6AB 2MHNA 2RUSA 1V3SA 2WHOA 2F3JA 1EHWA 2EW9A 2CJQA 4DL5A 3PHTA 1VI7A 5LJ5Y 4IG3B 3M6VA 3A4TA 4YR2A 2Y1IA 4Q7AA 4LF6J 2VB6A 3KOAA 2V8DA 1W97L 3OXLA 2KHDA 3FGVA 3G86A 4H5NA 4CLUA 4DBQA 1U49A 3EE3A 3HOTA 3FRYA 3VQ5A 2E8AA 4X62K 3NOGA 2FZCB 5LT5A 3X1LB 1U1MA 4KR0B 3WEEB 1XMQJ 2ZD1A 1REVA 1M1GA 2QWMA 1EIYB 3J81U 1F9FA 2E6MA 2FZKB 5AQIA 2Q66A 3ZSVA 1HL6A 1N88A 1CZ9A 1RAJA 3PSFA 2WTFA 3T1YJ 3OBYA 3IP0A 1IBMJ 1IKWA 2M8HA 3LP3A 2MSSA 3MMAA 2FBXA 1U1QA 4LFBJ 3QRQA 1AYEA 1FNOA 1HW9A 3CJ8A 3IR6B 4ILRA 3KWGA 1ZAVA 3PYDA 2HWTA 2YI1A 4MJKA 1NK4A 2W4CA 1VSJA 2VF3A 4DTOA 4ES2A 2QWRA 4C8KA 4K0KF 2RQMA 3OFHA 2UP1A 1WHYA 4WQ5C 4G1QA 3VEXA 4FJJA 2D0CA 5E84A 5BPLA 1MWZA 1BUPA 4RW8A 1KVBA 3EZ5A 4YORA 2KVQE 3QLHB 3TZWA 2DPJA 2CH6A 4PWUA 1WI8A 4JI5F 1QUPA 2CG4A 3MWBA 3A5LC 4MIAA 2CA9A 3CM5A 2QEXS 3ENQA 3R8YA 4HVJA 2MLYA 1A9NB 2K7KA 4UQTA 4ZLJA 3CMEN 4J9LA 3PG9A 3HBTA 3RB6A 2WK4A 4GNIA 3CPWM 3MM6A 3SCXA 1RBOB 2CPDA 1P9QC 4MK7A 1H7WA 3H0PA 3GILA 1CC8A 4Y0FA 3HPHA 1U2RA 1ZYQA 2W40A 5K9FA 3FZMA 4C0HA 1BXNA 4H5TA 4OYBA 4CLYA 4CERA 4G65A 2CQPA 3VQTA 3FVYA 3TYTA 4DN0A 4KGVB 3QZ7A 3BO3A 2IVFB 1WC4A 1LW0A 4CJVA 4PL7A 1HNZK 1S1TA 3OW2M 2B5JA 5CZ2A 1TKZB 4U6PA 2HHHK 3CC2N 3AGKA 3ISZA 1SI9A 2YQ0A 2GX9A 4G1IA 2XHCA 3CCLS 3DXMB 3PYFA 4EUVA 3LOUA 1E4GT 3I5BA 3N01A 5EUHA 3S8SA 1JKHA 2JVOA 4OL8A 1XR6A 2FY1A 2P9CA 2CQ4A 1O13A 2HLTA 5L39A 1VYAA 3Q8QB 2W9BA 3EPIA 5EU7A 1XNQJ 2K06A 1Q8LA 3WNGA 3RBDA 1U1OA 1LWEB 3OD2A 2JEGA 2AW0A 4JI1J 1BMQB 3CXCR 2OEMA 2IVOA 3CCQN 5AZIB 4AXJA 3VOVA 2CQHA 1YAGA 4F4ZA 1AUSL 4IBNA 4M5HA 1R8HA 4MKYA 1S0VA 2PO4A 3DNCA 2D74B 3C0BA 4YR3A 3C14B 2GUPA 1FNMA 4EFHA 4JV2A 2QYCA 2JFDA 4DPOA 3NFAA 3MPDA 1WELA 3PYGA 1RT3A 1FDBA 3O3LA 2PBDA 3CYMA 3DLLL 3EX7B 3D2FB 3FSIA 2B0GA 3LA0A 1UW4A 4DV4F 3AA2A 1RWKB 1MLAA 1N36F 3GIRA 3JAMU 2XY7A 3DHXA 1J5EK 3TVZA 1CS4B 3CHWA 2HHHJ 1U6FA 2UXDF 4YB5A 4E8UA 2Z1IA 2IC3A 1U47A 1U0HA 3C19A 5LY3A 4DV6K 3SZ2A 3I4PA 3S01A 2HQCA 2WCXA 4E89A 1Z05A 4KV8B 2CUYA 3UN2A 1NSKL 1W9HA 2V7ZA 2EC0A 1A5VA 1YJ7A 1YTAA 3T6JA 3OR2A 4A8WA 4DUYK 1RT6A 2KLAA 3K2PA 2HRTA 3JXOA 2HBYB 3EXYA 3EDRB 5K8OA 4H5VA 3AJDA 2VG5A 3R6LB 1Y9OA 4UY85 1B4SA 3CJTA 3FE1A 2QGFB 1M5PC 2HBLA 3N4PA 1SJFA 4V19S 2ZDPA 1XNRF 1LWFA 4O3OA 3T5JA 2BMBA 3T5HA 4JYAJ 5KOXA 4G1PA 3VQBA 2G2ZA 2X7IA 2ASLA 4ZP9A 1HHTP 1VQ8S 3J7AN 5FLXY 1XI1A 3V1QA 4RNOA 2M88A 2ZDOA 4F02A 4WE1A 1G2EA 1XERA 1Q86T 1NU0A 4BRFA 3OTDA 1AZSA 4IO9L 3CMAS 4ES3A 1J5EJ 5LMUK 4FM2A 4TNOA 3T1HF 4HCCA 2DIVA 3BY5A 2H4WB 2QL5B 2N4DA 1Y10A 3MCPA 4HTJA 1SCJB 2HQIA 4DV6J 4EHUA 4MKBA 3ZTQA 1OY8A 5A6PA 1VSMA 1KKHA 1SH3A 3QBCA 4NLQA 2G8KA 1YTUA 4KH5A 9ATCB 5BN8A 3NMRA 3WZ0A 3HZ6A 1HYZA 5L8RC 5CYMA 2CGKA 4YQWA 3W9JA 1TKXA 3WT0A 4P75A 3PW4A 4CDIA 5HROA 2Y1JA 4OHVA 3TTCA 2C2OB 3H7HB 5GAHP 4KHYA 3G71S 1O8BA 2DGXA 3PRBA 1RCOB 2ZJQQ 4CNZA 3JB9k 5IC4B 4FYYB 1S9EA 1OH5A 1EP4A 5H9FK 1UVJA 5K14B 2C42A 4K5SA 2PSZA 3JS6A 3QB0A 1HWLA 4BCAA 2MGZA 3R5BA 2HGMA 2Q3PA 2HYIB 2MQPA 3PXGa 1RA7A 2DXFA 2ERRA 2DGUA 2J9EA 5FLXO 1CJKA 1X5SA 3EE8A 4RL1A 5LMUJ 3PLAA 4JK8A 1VQSA 5HAOA 5KG7A 4O8KA 1FJGF 4CEFA 4OPKA 2YPYA 1IQTA 2PI4A 4LFAK 4IFVA 3ZX2A 4RJVA 2RILA 1NGFA 1YHQS 1S9GA 3TAMA 2YQ1A 2IFXA 3K7RA 4O4RA 1FXRA 1GT8A 3EGZA 5AE2A 1NM1A 4NA1A 4P71A 1IKXB 4NB4A 3R27A 2FJDB 2MKSA 2XSFA 4KC5A 3QEXA 3H6EA 3KLFB 3UD4P 4DZDA 4NXNK 4M5LA 4AM7A 2XM3A 4X66K 2V7YA 3DU5A 1YWXA 5L1LA 1Q9XA 4B3SK 3QO9A 1X4EA 4JKEA 2IVMA 1FFGB 3WIVA 2V51B 1FRXA 5H9FJ 4EBDA 4KGMA 1WUUA 3CQ8A 4NEYA 1VQOS 5GAHI 4BQZA 5J1NA 3FZLA 1C1CA 2XGQA 3I87A 3MEKA 3PCOB 3RSEB 4HACB 4FJ7A 3DRSA 2W1BA 1D3WA 4EP5A 1S6QB 4I6MB 4DU7A 2J6TA 3BS9A 3QMLA 3CI5A 1FJ7A 2P9KB 1D5AA 4LFAJ 3O5BA 4LF9F 1VQYA 2HGLA 3N6MA 2B4UA 1NJIO 4HI2A 2KZMA 3CCTA 4WQ4A 2P9LB 5HLFA 2NXEA 2YNGA 2BE2A 3SCKE 5KOWA 4BG9A 1XHXA 3OL8A 2HNZA 4LR9A 1VQ7N 2AJ4A 1JL2A 3EICA 2LECA 2R9LA 2B51A 3ZEUA 5F8IA 3CJ1A 4NXNJ 3OT9A 2FC0A 3R7SB 4X66J 3A8IA 3QQCD 1SV5A 2YX6A 2BUPA 5F8JA 2HRUA 4B3SJ 4DTSA 5D0GA 4YOXA 4TXSA 3JAMY 1S1WB 4N8NA 3CO9A 2JSXA 1JLGA 1QUVA 4FLXA 1WOPA 2G2OA 2MQMA 2OPQA 3ZT4A 1RAOA 2QJ3A 1RKJA 4UOFA 3FZ2A 3NCIA 3DLJA 4B1VA 1T44A 3NCPA 3FNNA 1GEHA 3US5A 5H9EK 3P6YC 2HS3A 2IJNA 1YI2S 4AHTA 4FLWA 4FNHA 1BY9A 5JVGQ 1VRTB 3PX6A 3DI6B 3PTWA 4KHPF 2OYQA 4BBYA 4JKAA 2V8HA 1QQCA 4WK3A 4ECZA 4CBWA 4MDAA 4ES1A 1VQ9S 3DXBA 3BO2A 2IVYA 2AYGA 4DL0C 4YR0A 3NNCA 2J4RA 4ZHRB 2XCPA 2LEAA 2QLFB 4P2SA 4RPFA 2ALZA 1S1XB 4OI1A 5DG8A 2MKIA 4F3QA 2HK3A 2HBKA 4PCQA 4OPAA 4OHXA 3BZQA 1B0PA 4S0MA 4I56A 1XR7A 3V6KA 1J6ZA 1GLAG 2ZGYA 3E8OA 4KH4A 1QZ5A 4QJVA 3FMWA 2FHOB 1RDUA 2CPYA 5CHCB 2NREA 2WAQD 4JV5K 2HS4A 4CESA 1KVCA 4QWCA 2ZHAA 4RNMA 2XTJP 3JAMO 3TUIC 4IOXA 2V4JB 3TSQA 3NGUA 4C2MA 1F5AA 4FJNA 4FJLA 1UJ4A 2KO1A 3THVA 5H9EJ 3DMJB 3U4LA 3M8RA 2YKOA 3MEGA 4NA3A 3AQOA 4NWBA 4X4SA 3BZKA 1JJ2M 1U4BA 2I0XA 1AXQA 5GMDA 1XUPO 3RYLA 4K4ZA 2K2PA 1UJ6A 4CK1A 5AQYA 2FVQA 3C6HA 1K6YA 2QFJA 4CO1A 1B9FA 3NGSA 3NWRA 1BCMA 4PA1A 3OVBA 4Q44A 3SK3A 2J76E 3CJBA 3RW6A 3MR5A 5I3PA 1FDAA 2A42A 4ITSA 1VBXA 1SC4B 3AA5X 2GA7A 3DC2A 4HT7A 3A12A 2LA6A 3CCVN 4F25A 4CHPA 1XMOK 1OQ6A 4AFFA 4DR1F 3U6FA 1X5TA 4ZCKA 4Y2IA 2MPUA 3W62A 3PIOL 1NLVA 1CPZA 4UY8T 4OX9K 5C12A 4XH1A 1CVJA 2QXLA 2G8FA 3M32B 1PC4A 4DG1A 1YTYA 4OVLA 2ZM6F 2XZDB 1HBMB 3EPGA 2IHR1 3P4UB 4IFYA 1QAYA 3NCQA 3QRPA 4Q45A 1PSDA 5IWAK 1N5QA 3CXCM 3BGRB 2LQJA 4XTTA 4ZVRB 4FJ5A 3CCSN 3W9IA 1VQ6N 5K5MA 2R7SA 2FZGB 3RG6A 4CGIA 4IKAA 1ZM2A 4O4GA 1Z2ZA 3LDQA 5KRTA 4KHQA 1KTQA 1VRUA 3I8BA 2AZ3A 1FVSA 4PXEA 5C2GA 3MAQA 1XQSC 1S5JA 2MKJA 4LUBA 4ZTFA 3L3UA 3NH2A 3HD1A 4LVOP 2AQ4A 1NKBA 2F9JA 2Z4PA 2E1PA 5LSOA 1U7LA 4C97A 1R8BA 5ADXH 1FRKA 4PKIA 1U09A 2GX8A 3CQXA 2KL8A 3FBCA 1V3ZA 4PKHA 4HTLA 2BJ9A 2OUGA 1YJNS 3OYAA 1RTJB 1W7WA 2E9ZA 4Q0BB 5AQMA 3OHRA 3M3ZA 2QA4G 1XMOJ 1HR0F 3O9QA 2MKHA 2AV5A 4FKYA 2KRBA 2ZFHA 5J2QA 1JWWA 1BE4A 4NZ6A 4OX9J 3F56A 3UD3P 1TL3B 4FSVA 1N52B 4M8LA 3WHIA 1WHVA 5U47A 3U7JA 4OZ2A 4E7HA 5IWAJ 1TL1B 3CPEA 3NGRA 1LQ9A 2D0AA 4FVMA 3V6DB 2E5JA 3HHLB 4PWDB 5DDOC 3CJ0A 2VICA 2ROGA 2H5JB 2K1RB 5I3QA 1MMLA 4KB0A 4LR7A 4DDFA 5DJBA 1U1LA 2DK2A 4WKYA 1YITN 1ASWA 2PE8A 1W2BR 1VK8A 4CM0A 4C3KA 4A47A 2J0QD 3UCUP 2Z1JA 3KJNB 4M42A 2R7YA 2MJUA 3U1LA 4DU1A 1H73A 2W2MP 3QEPA 2W25A 5JJBA 1ZBTA 1GLBG 3W5ZA 3P5JA 4KSEB 3HCXA 2VPXB 2IOCA 2DPIA 1B7YB 1RHKB 3HT0A 4PAAA 4G3IA 3LGNA 3N6LA 3P1GA 4M5DA 4CI0B 5AE1A 1U48A 4CBXA 3QBWA 2J6SA 2HHQA 4ETZA 4KPYA 2FHMA 4M95A 4JKCA 5AXKA 4P7VA 2P9UB 3VF2A 2QA4N 1CLFA 3L2VA 2VFUA 5HOOA 3EY1A 3TWHA 4NLXA 4DV2F 2IA6A 2R7UA 3QFUA 2ZH2A 3ILLA 3UDLA 4C1NK 1WI6A 3KKSA 3C7NB 2RRBA 3QERA 1TK8A 2DIUA 3KUGA 1QDUB 1NBWA 3MM9A 5CYQA 5DZ6A 3WQTA 1CJTA 1VGYA 3QEWA 3B4MA 3VQSA 3QT6A 4DCHA 3ITHB 4MKAA 3QPIA 3BSAA 3MX5A 4TQRA 2UVVA 3PX4A 4U9RA 4R8UB 1IJFB 2H65B 1QE1B 2YHYA 3CCRN 4FWNA 3E66A 2YWEA 1HWUA 5B0AA 5HO4A 3RRHA 1BHLA 3K8VA 2OZSA 3VPZA 3AXKA 3G0ZA 1YBTA 3CIZA 3M1VB 3R5GA 1VQKN 2O01C 3H4DA 4QOZB 2G0CA 4J9OA 2QWOA 1F60B 2OPPB 4N77A 4CFCA 1BC6A 1IR0A 2CQDA 2CJ9A 2CADA 3KIOA 4ECQA 1IKYB 2VG7B 1O1WA 3PW2A 5KQ8A 3UFCX 3V1RA 4UQGA 1M5VC 1NSAA 2H3EB 4KBOA 3VQAA 5LSLA 4LQ9A 4LRAA 3U3YA 1JLBA 4O3QA 1V6HA 1J54A 5AQVA 4K8ZA 4YS2A 4R0EA 3CJCA 2YHBA 1SPBP 3VAMA 3K5NA 1X7VA 2G8HA 1B99A 1K0TA 3B8HA 3IBWA 2Z1GA 2E9TA 1X31C 2FLLA 5BPMA 2UV8G 4WIQA 3VTIA 1BWFO 4DU4A 1UVKA 5DS7A 3CB4A 1NK0A 1XQIA 4FBUA 3NS5A 1C0TB 3T3FA 1HYSB 5T7LA 3WC2A 4JI4F 5HL7L 2D1CA 1WHWA 1T9TA 4WFNQ 1OYEA 3SBTA 1S6OA 1T11A 2JVRA 1T9WA 2PMWA 1PBAA 4OZLA 2I5JB 4CJTA 1VS3A 4IDKB 1S1UA 4BACA 3AFGA 3N28A 1DLOA 1RAGB 3FFIB 2PA3A 3BEXA 5MAOA 3JSBA 5F41A 2J0SD 3THXA 3BH6B 5KT4A 4K43A 1VISA 2OFHX 4DTJA 3AA3A 1RWXB 4MKVA 2V8GA 2DNZA 1UZDA 4PQUB 3DGPA 5K8MA 4DPUA 4WTOB 3SI6A 1VJQA 5JVHQ 5C2DA 2C3PA 5F9NA 3OYKA 4KH6A 4PHTX 1U1PA 4K8RA 2VBYA 1RT5A 3ZX3A 5BYRA 3CM6A 3PEHA 2HVIA 5FPEA 4FPRA 2R7QA 5HRPA 3GYXB 5C5JA 4OHWA 2HOEA 1FKPA 5GIPA 4X2BA 3BPSP 2IPOB 1FRJA 2QC3A 4CD1A 2FJWA 3J7YI 3DYAA 1F0XA 2DGSA 5EXWA 2DEIA 2BKPA 4OJ1A 4F67A 4ZVSB 2OIHA 4ELVA 4ED4A 3TA2A 2E1MC 4QBUA 3CFPA 3NEKA 1VQMS 2P9IA 4BRNA 2ETJA 3K5OA 4CZGA 1EETB 3QT5A 1FA0A 2BJ3A 4F04B 2MZTA 4DS5A 1VC5A 1UW9A 3TU5A 4QW8A 3O2IA 1U1KA 1Q0NA 1RTHA 1LAVA 1MWMA 1RBUA 3LO3A 1EQ0A 4NLOA 2NRHA 2XNQA 3OHBA 4JEPA 4K4TA 1XWLA 2B9YA 3ZZTA 4JI3F 3I56N 1DTQA 2GW8A 4EWTA 3D6HB 4NCGB 1IKWB 3FCWA 3TARA 4GV3A 4ZLLA 3MMAB 4QU6A 4MK8A 3MCAB 4K0KK 5CYJA 1R8CA 1MMDA 3ASMA 4CQ1A 2DNQA 4KAZA 3D7EO 2JEFA 4EYIB 4HI1A 4IOCL 3UIQA 4FJKA 5A0YB 4DQIA 2Q1LA 4JI5K 2QEXN 4MO5A 1YJVA 3OR1A 4O3PA 3M5RA 3R5AA 3MAHA 3O44A 4ZOSA 4RW8B 1SC6A 3VHQA 4KTZA 2GQCA 3J7Z5 2FYXA 1WSRA 1D8ZA 2QWQA 1ESVA 2QFIA 3M9MB 4IRDA 2GO9A 3EMTA 2AJ0A 2VC0A 2P9SA 3D66A 3D2WA 2Z8QA 2XMVA 3OYJA 2F8SA 2U2FA 3GWCA 4USKA 3MM6B 1DFDA 2A2CA 3NGKA 4C8YA 3D0PA 4M3ZA 1T3VA 4LBPA 1UJ5A 4BGAA 5BRHA 4HCBA 2YX1A 2E6LA 2RF2A 4K0KJ 2HZVA 4A2BA 3SQGB 3VEOA 2OI2A 1IV0A 1H98A 1SQEA 5KT2A 3I0SB 3CCLN 2VV5A 3TANA 2Q97A 1PIEA 3GV5B 1LW0B 4JI5J 2Z0GA 2AP1A 1WKJA 1TP7A 1WF0A 2VBZA 3BBCA 3WIUA 3TR5A 1H3DA 3IFEA 1QY7A 3VENA 5KPZA 1S59A 1PJ6A 3BKTA 2V4QA 2HGNA 1QQNA 4CGDA 1HJRA 4LSNB 3QFWA 3A8JA 1JKHB 4NPOA 5CH7B 1QSYA 1GLFO 3A0IX 3CERA 2XQCA 2W9BB 1RHMB 5DQIA 3DLEA 2R3VA 3C16B 4H4MA 2VQEF 2P9PA 1TZ0A 2EPIA 4RUBA 4EHTA 2F8TA 4H5WA 1NK7A 4AQYK 2DFHA 1HA1A 1UFLA 3RUBL 2W24A 1FXDA 3NAEA 3HHEA 2HBJA 1N36K 4FJIA 4LF4F 2H4YB 3THPA 4CK2A 2O4GA 4AM6A 1UETA 2JWKA 3LW5C 3ZCMA 3RWUA 4TY8B 3QNNA 4EK2A 1RT3B 2YTCA 5BREA 4WZQA 3C6TB 2AP6A 5EX3A 1EKSA 3HSCA 5ETPA 2DGVA 5MLCV 1KAZA 4LF6F 4PKGA 3UKRB 1RAAB 4DSJA 2VOOA 2QTDA 1RTIA 4ECRA 3S41A 2Q31A 1U0HB 2O8BA 4I2PA 4ZPBA 1V9OA 3BN4A 1JLCA 1XMQF 3S9HA 2CDQA 3VQ6A 3VEVA 4LR8A 4ECTA 4MYUA 2R2TA 2V2QA 4AL6A 3V4IB 5KFLA 1I94F 1RHRB 5FD1A 1W2BM 3OR2B 1CQNA 4DPYA 1LFPA 4AQYJ 2B6AA 3ETMA 3D1QA 4FXDA 2FB0A 1NJWA 4J9NA 2EG2A 1SJQA 4CK3A 3TPQA 3T1AA 4NO7A 2P5GA 4FN5A 2PEBA 4LFBF 4ZCMA 1RAEB 1HARA 1N36J 3CMAN 1RJJA 2ZH7A 1KDNA 3A3OB 4C48A 5L1KA 1LWFB 2E2QA 3PRDA 3T1HK 1DJ0A 4A8MP 3N6NA 1AUDA 5K20B 4OZ5A 4DCJB 1V5IB 3A1YG 4LRDA 2UU9K 2R8IA 4DFPA 2A2DA 3J81j 4CFBA 5IOLA 1AZSB 1T03B 2GV1A 5EX0A 1J53A 2BRKA 1RNHA 3F44A 3TO8A 2MQLA 3TABA 2ABYA 3CGIA 4OX6A 4DMZA 2HS0A 4OYZA 4RBUA 3HJVA 3RBZA 4NX9A 3NCRA 4FK2A 4KFBA 1KR4A 3G71N 5GAHU 2XLJA 5HBMB 4LRFA 3F9MA 4AYBD 1PYTA 1IJJA 4FYWB 4FOIA 1GLJO 4JKGB 3K17A 1IM6A 3D5MA 4LFCK 2HVEA 4NZ7A 4I1TA 1YJTA 1RTZA 2M8DB 3S3NA 2ZC3A 3FC9A 1PG5B 5HROB 2DVIA 3EGNA 4A4JA 3G6VA 3L95X 1CBKA 1UFWA 4OFZA 4FVUA 1RFQA 2J8AA 3T1HJ 1EP4B 2MYFA 1S0MA 1X9SA 1YHQN 3OV7A 4M3WA 4H4KA 3CIPA 4FW2A 5AQSA 2FJBB 4DFMA 2UU9J 3RMBA 3AODA 1CJKB 2XMJA 2CQCA 1KQSM 2ZE2A 2ZKTA 3EVWA 4NYZA 1C4AA 1VHFA 2CVIA 2UVWA 2G0JA 1Q8KA 2DH9A 3MFHA 3IKMA 3AD8C 2Q79A 2Y8WA 1KXPA 4FM0A 1RKIA 4ZVGA 5IQQA 2X1BA 3LAMA 5ETQA 1K47A 1D9AA 1XNQF 3SCJE 2VHGA 2YKNB 2BM1A 4U95A 3CD7A 5E3QA 2VG6B 4Y2AA 4JI1F 5KRSA 1G3OA 2HNDB 4X64K 1VQON 3SDEA 4KY3A 3T19A 5GADP 4LFCJ 4BREA 1JLEB 2C2MB 4O23A 4MK9A 4H0OA 3ZZZA 3IWNC 4CO3A 1TKZA 3Q8RB 2P9GA 2J7WA 3QO9B 1BQNA 2ZNZA 4I69A 1GK8A 5DMRA 1BL3A 2UUAK 3DXMA 2EXUA 2EBEA 2PC6A 2DR9A 3DRXA 5B08A 4LF9K 1ILYA 3CNQP 3WQPA 3NGDA 4Q2MA 2YKMA 2EFVA 4MFBA 1QHAA 2X74A 2LQ5A 5AQHA 3D3BJ 2HHHF 3ZNJ1 3CF5L 3HFZB 1LWEA 2XHBA 1IH7A 3SXLA 3VVTA 1U04A 1F5BA 1ZBLA 2IRXA 3BBFA 4ZA1A 4AL7A 3FGUA 1BISA 4KB7A 8ATCB 3FBBA 3W8GA 4OI2A 4B1ZA 3OTBA 3QGIA 4CJ5A 2VBWA 5IT9U 1MSWD 1ZETA 2AYBA 5HLFB 2YNGB 1FF2A 3NF7A 4AHUA 3C14A 3KXDA 2D4WA 1VMBA 2V8VA 2HWIA 4M5KA 1HI8A 2F9DA 2W6KA 4Z0UA 4X64J 1HUXA 3D2FA 5KG3A 3J7ZT 3QIDA 1IBKF 2RS8A 1GH8A 3NMUA 4W90B 3E1YA 2R7OA 4M3XA 1Q81O 2WSFC 2VD3A 3V9XA 1XN9A 1N32K 3TOQA 2DCUB 3AOCA 1Q81T 4H0YB 1CS4A 4JYAF 1NM2A 3MD1A 3L4QA 2B4PA 4KTWA 3I82A 2VDHA 8RUCA 1YI2N 3VAKA 2UUAJ 4B9LA 1PJ7A 4Z4GA 2RU9A 4BQLA 4LF9J 4JAXA 2HVHA 4KV8A 3SIPB 2FF6A 2OPQB 2P1JA 1XTZA 4KHPK 1RU2A 4I6WA 5CZVA 2HEKA 1LXJA 1VQ9N 2VA2A 1HNWJ 4TLRA 4Y6IA 4ID1A 2NXUA 2ZH8A 4HDHA 3O6QA 4DV6F 4OV6A 1FRIA 2XCAA 2YHAA 2PGCA 3C15A 3GU0A 2PAVA 3NGYA 1NUEA 4IH7A 1NGGA 2APOA 2KN4A 3EL2A 3L4BC 1HMVB 4CF0A 4XIUA 3VAHA 4WJBA 3MMCA 1VSHA 1MWQA 4QS7A 2DNPA 2IDOA 4H4OB 3VQ4A 3OHAA 1RT2B 2BJ1A 4YDUA 1FEHA 1OPIA 4ZLPA 1K0VA 4NLVA 3U1MA 4LH4A 4Y2CA 3TUJC 1E6YA 3AH6A 1N32J 1K8AO 1WF1A 4CLPA 4MH8A 4BRDA 1WNEA 4FO0A 3MF5A 1NWKA 4HHUA 2YNFB 2BJDA 3ZC4A 1FW6A 2W2NP 3UI3A 3Q0AA 2QM1A 2R7WA 2O8FB 2CRLA 3KK3A 4WP9A 2ZF5O 3QICA 4NMXA 4IRKA 3HVRA 2W9CB 4OLBA 1U25A 4ILHA 4IXCA 5LMUF 4KHPJ 3OTOK 2UXBK 2C3YA 2V63A 2F4VK 2KZZA 3ID6A 1YVUA 2EHGA 3H90A 2E1ZA 1OO0B 1TR0A 3FKBA 3TJAA 3LM2A 4IWVA 2R7RA 4QCLA 1LEOA 1TU0B 2YHWA 2MKCA 4OZNA 3Q89A 3AY0A 4B3MK 3V81A 4OJ3A 3M8YA 3TTFA 2GV9A 3ENVA 3S3MA 3HLUA 5C7PA 3BSCA 3FEXB 2W2PP 3MM7A 4WPAA 3OL7A 1TELA 2KT5A 4WIIA 4J9RA 1KLMA 1MWYA 4BDYA 2Z57B 2FGCA 1F9HA 2H51B 4AL5A 5AFUA 3AV9A 4DR1K 4Z4FA 4CJKA 1MMNA 3RJMB 2CJBA 3KDOA 1VK3A 4ISGA 5KFWA 3QRRA 4JN4A 1M5KC 3A8KA 3MX2A 4CZJA 4N47A 4ZP8A 4OO1J 3UDVA 3P49B 2PT0A 5LOQA 4HUGA 1N0UA 4RLEA 1NGHA 3VMFB 4DG1B 3KZBA 4O0JA 5D4NA 3F5TA 3OTOJ 2FGOA 3A8EA 2UXBJ 3SAHA 4DXLA 3ICLA 4PPZA 2F4VJ 2R2UA 3KLFA 2ZH5A 1LWCA 3FZKA 4O0IA 5KFMA 1YX2A 2M7SA 4PL8A 4F8RA 4B3MJ 1I51B 5T14A 4O4GB 2BTFA 1Q95G 4YOYA 4N56A 3LP0A 2MY8A 1YF5L 1VRUB 1LXNA 1YJNN 1N8RO 3RRKA 4QAGA 4CI6A 4NXNF 5HMYA 1N8RT 4V19J 3BDEA 3D6TB 2JEIA 4E1MA 4L3NA 4DR1J 2X6SA 3RSEA 1ASVA 1TUGB 4W98A 2RMLA 3KLVA 1TFWA 4I6MA 2JLFA 1DKGD 3I5AA 1U45A 3OS1A 4DSFA 2P9KA 2Q1NA 3HD2A 4BC9A 3GFHA 1WC0A 1RBAA 4JOUA 1RTDB 1UMJA 4RZRA 3MFIA 4CLZA 2DTJA 2XGPA 5J2QB 4FWMA 4C8LA 3CJSA 2P9LA 4BRKA 1FKAF 3BQ1A 2P6TA 3AT1B 2RDJA 5CZXA 1VSIA 2FPHX 3E01B 1ULRA 3KTQA 5CZ1A 2GVDA 1TK5A 4IQXA 3BGFA 4XPCA 3ISND 1SKWA 2GMHA 4K42A 3T7ZA 1V5VA 3AVCA 2W41A 1FWPA 2NRWA 4ED7A 3C2PA 1J9AA 4DLGA 4OYIA 1OJ4A 3EYZA 2NPFA 3M8SA 4ZIVA 2V9WA 1KC8O 4CJWA 1NOZA 5KT6A 3G4SS 1JIHA 1G7CB 3Q8YA 4I68A 1NDPA 2IDLA 2NSBA 3K5MA 1I3AA 2MZSA 4YOEA 2ZNYA 4MIWA 3NGTA 2OTJS 1BUXA 1SQGA 3W3SA 4A8YA 5FPDA 2HURA 2W42A 1YJRA 2RE2A 3KUHA 5THWA 9RUBA 3BEGB 2YBVA 2ZVIA 4DV3K 1FJEB 3MK6A 2E5HA 1NK6A 4DV2K 3O4QA 4B1UB 4FLZA 3VAGA 3HF5A 2MY7A 3MCMA 3UD5A 3ZFVA 2HBRB 4XH5A 4C9DA 3PKMA 4ZCIA 3Q86A 2P8IA 2GIQA 4TSXA 5D78A 4B9VA 4O8UA 4DX7A 3SAFA 4FZVA 4FVCA 1U2FA 2YVSA 2ZHBA 4ZHRA 3UDCA 3JSRA 1Y11A 1KHWA 1JLAA 1KHVA 2ZUAA 1A5WA 3NKYA 4W5TA 5DG9A 2KTQA 5F9LA 1L5UA 1FEEA 2YWWA 1NSQA 3W7BA 5HI7A 2GMJA 2DBBA 5CYQB 3B82A 4F3TA 4GY2B 3LAKA 2CGJA 1MU2A 5KPTA 3L4IA 3ZT1A 5DLFA 3ZZYA 1IVZA 3CJ2A 4KHSA 4UOGA 1R0CB 3GONA 4MT1A 4DTUA 3WXKA 1NGAA 5AE3A 2JL9A 4CJQA 3P5BP 3M05A 5H1SQ 2V4JA 2UUTA 4LF8F 2UUBF 4AH9A 3RW7A 1AROP 1O0PA 4DV3J 3CSKA 5HJYA 4E1NA 4JI2K 4JS4A 4NYFA 4AUKA 3AVHA 4E0DA 1URNA 3BYRA 4YEAA 4NYPA 2NLXA 2W7PA 2GVZB 3KHLA 1YIJN 1NPRA 4D3GA 3WDOA 1G6BA 1L3VA 4BRAA 4Z94A 1JLBB 3NHGA 1J5OB 1EKEA 2FVPA 3CCWA 3Q8PB 2Y1LB 3SV4A 5FIIA 5AQUA 4H0XB 5HATA 1HNVB 3UB5A 4FPBA 4NLPA 1NB2A 3CEDA 4I6YA 4RW9B 5JMNA 4KO0B 2HAFA 1GAOA 2QV6A 4GV6A 2OANA 5E41A 3D45A 5HVFA 2BJ8A 2CZ4A 4DX6A 4TVAB 5T7LB 2DD8S 5ETLA 2VKZG 2NXCA 3AVKA 1SIZA 4CFDA 4FJ8A 3M2VA 1HBMA 1NCLA 2Q3SA 4DL3A 1S1UB 3ULHA 2XHWA 1DLOB 1G1XA 1XMOF 3CVKA 2H9ZA 4CP5A 4JI2J 5LMNK 4F3MA 4DLEA 4RU9A 4OX9F 3E9LA 1NO8A 5FPNA 1L3TA 1RDRA 2XMKA 4NCAA 1NU4A 1K1SA 3RR8A 3ILIA 2KT3A 3IWLA 2XY5A 3DOKB 1IBLF 5ETRA 4ED0A 2RHKA 5IWAF 2ZITA 1T3NA 3DWLA 5KGWA 5D0EA 3DGPB 1MN7A 1ZM9A 3CDUA 3M4XA 2BVZA 2W01A 4RNNA 4QOTA 5EN1A 2YKAA 1NOYA 3OL6A 3A3PB 4FWOA 3O1BA 4CW7B 1BG3A 3W0LA 2NRRA 2P6SA 4O44B 4ID5B 4I64A 1TL7B 2COLA 1C1BB 3SMSA 4Q0BA 3SUNA 4KE5A 4U67L 1FKPB 4H4KC 3IRXA 3KJQB 3OYLA 1IBCB 5GIOA 1JL1A 3DYAB 4OZ3A 1JLQB 1LV5A 1QHTA 2NNWA 1ATSA 5GAGI 4UF4A 1TL3A 4O3RA 1QSLA 4CJEA 4C4WA 4A48A 2HHVA 3MR3A 2LKZA 3AVLA 1HKBA 1TL1A 3TVKA 3EO3A 1R0AB 4PG6A 5LMNJ 3WXIA 3ENOA 2H5EA 2VJUA 2O4IA 4WFNL 2JOQA 1N6QA 4JI3K 1RTHB 5IM0B 1YVNA 3IWXA 3L7PA 3TRGA 2D7SA 5DDQC 1JXVA 1X4CA 1MG7A 2CZ9A 2V52B 1TK0A 4BS2A 3O9UA 2G2YA 3MURP 3HYFA 2BQRA 3JQKA 2NRZA 5KFAA 3QAEA 1VSKA 2QI2A 1X8DA 2AWZA 2JDJA 4H8KA 1ZBFA 3Q23A 3PW5A 4CECA 4IFEA 4EEYA 2KFNA 2MMYA 2OGUA 4TYBA 4PZVA 2AU0A 3DJCA 1Y97A 3GG0A 3I9V9 1BHNA 4UZCA 3VF4A 2HFOA 3U1NA 3UVJB 4BC5A 5BRDA 5AQRA 2P9UA 4OIXA 3HKZD 1E6VB 1N5VA 3OR1B 4QWBA 4PWWA 4W5QA 3CTRA 5CR4A 2EI5A 2ZKUA 4NXMF 1RYRA 3C7NA 4GVEA 1VSEA 3ZSYA 4EBEA 1RBLA 3L0QA 3QWPA 1CXQA 4KHWA 4JI3J 1W2IA 4DL4A 2XYHB 3SLCA 2IIRA 5G4DA 4CIOA 1TUWA 3EE9A 3O1LA 4QWDA 1UFKA 3ITHA 2P9SB 2GEMA 3WNHA 1BQXA 4B9MA 4DL6A 4M41A 2A6MA 4ZPTR 4DQSA 2VONA 2L9DA 2Q43A 1ASUA 1QE1A 3FJ2A 5JICA 2VZ9A 3PR4A 4DV0J 1N0VC 2RF2B 4ZCLA 3V2UC 5BXIA 3S6EA 1TMMA 4CZEA 2K3KA 4CCHA 1BO5O 4OKJA 2YJFA 2VFTA 3G8QA 2KXNB 2R8KA 2G8IA 4AE5A 3Q8SB 1RDWX 5HMZA 3MXHP 3BSOA 1Q7YO 4F50A 1NEEA 3F0NA 4QR0A 4USTA 4Z2XA 1KD1O 3W5YA 3EN9A 1IKYA 3NVMA 1CLQA 3SQ0A 1Q7YT 3F2KA 1RDAA 1VK0A 3HZEA 4BLGA 2P51A 3H40A 2MEWA 1FVQA 1KD1T 2WVFA 2VQEK 4EP4A 4KIAA 4P2MA 3CG7A 3DLHA 4J9MA 4YB6A 2QLBB 2EFPA 4MMOA 4P72A 3Q83A 2BW2A 2HIQA 3M8QB 4DQRA 5SUHA 4JI8J 4P73A 5C2CA 1NAQA 2HB5A 3DLEB 1DTTA 4JNEA 4LF4K 1RUSA 4DQ8A 3SUPA 4X4UA 2FJAB 3U02A 1PBUA 3KKFA 3VWSA 4DKWA 2HFSA 4LIWA 2ZJRL 2HAIA 4YDUC 1YRXA 1HYSA 4K4XA 2RIJA 1KOOA 1ZAWA 4FNIA 4JBCA 1KEKA 3QJLA 5DGAA 1HIYA 3KFWX 2I5JA 2CQ3A 4IDKA 2X1FA 1M0SA 2O8EB 3VZIA 3U27A 3IS9B 4B8AB 4RW7B 4P2XA 3VQ8A 4FWPA 2QW9A 4J2AA 3S3OA 1H72C 2VWKA 1S77D 1FX2A 2PA8D 5F0UA 4KHUA 5BYQA 1NB7A 4C8OA 1F1BB 2OPRB 4KGXB 5J2PA 3M30B 4TQSA 3VVUA 3O08A 2KDOA 2B9EA 2YV0X 3Q8VA 1VHIA 3R7NB 4K50A 2POKA 2GJIA 2Z2MA 1I94K 2CQIA 4DR4K 2VQEJ 4B9SA 2EKNA 4YHHF 4K4WA 1RTIB 1A7GE 3P96A 3QT8A 1GX5A 3IC1A 3D1OA 2QT7A 1L3KA 3SFUA 4UOCA 4FJMA 1QTNB 5D6GA 2C2DA 1GLLO 4CHQA 3BH7B 2F63A 4BVPA 3AO3A 4LF4J 4FJXA 3A5NC 2EBGA 3G8SA 2AJFE 3D4JA 3B6OA 5HQ8A 3LPYA 4J5OA 5LXYA 1NJXA 4JI7F 4MLHA 5A8WB 5F8NA 1RBRA 2PDAA 4OKKA 2M2BA 2OH2A 3LDLA 4CJFA 4WP8A 4JRPA 1EETA 1FWKA 4NLDA 2AKWB 5EGYA 3S1TA 5EY4A 5DGBA 3H46O 3FR0A 4FK0A 3W66A 3HHNB 2BJ7A 3GE1A 1EB0A 2ZZNA 1F3FA 3AVNA 2FQQB 4K59A 3NDKA 4Y2MA 3GIIA 2I7PA 5BRFA 1Z6RA 1H38A 1VSLA 5AQZA 3F9KA 3QDKA 2XY8A 3GDQA 3ZTPA 2IS3A 1HPZA 1I94J 4DR4J 5D4OA 1JXLA 2IJFA 2L9NA 4KRFA 3RBEA 5KG4A 4CEOA 2KQ2A 4NCGA 1T02A 1YRTA 2D3ZA 4KFBB 1LK7A 2GS8A 3OBIA 4RNFA 2Q0RA 1RB0A 2NZTA 5F0WA 4CD3A 4ZN3A 2A1BA 1RACB 5AQQA 1IG8A 5GINA 2ZBCA 2IJRA 4Y28C 4NZ0A 1ICEB 1U8SA 5FRMA 2VPYB 1VQ4S 1YGYA 5A0YA 3M8WA 2VKRA 2CH5A 3NF8A 4PY5A 5AQKA 3KD1E 1C6VA 4IOBA 4IZ9A 3PACA 2NYHA 1LK5A 2QRRA 4CFAA 3NP5A 3UN3A 4DUZJ 3MM8B 4FF2A 5L1IA 3LANA 1RT7B 1WC1A 3LH2S 1VSFA 1M5HA 3D0HE 2HPUA 2YNHA 1KQGB 4CEDA 4IO9Q 3O80A 5C25B 4CH7A 5M2RA 2NUUG 1BOTO 1XNQK 1T9XA 4KGKA 3QZ8A 2ZE2B 1JCFA 2O5DA 3L3VA 5KFFA 1JMTA 2N7YA 3GFYA 4WYLA 2OSQA 2YNIA 4JI1K 2ZOGA 2KM8C 3VF0B 2FJVA 2XG8A 3EKSA 5GADU 2YKQA 1N34J 3CDWA 3SJHA 2GHWA 3K59A 3I4HX 1H0HB 3PJXA 3SQGA 1CZAN 3C46A 3M8PB 3JSMA 2Y0SD 1ZOTA 2DGOA 5KFGA 4DJBA 4GRSA 1TV6A 2OMOA 3KHHA 2E88A 3I0SA 1XC9A 4A57A 2D5RA 3C95A 1C0MA 2HZAA 3G6XA 3SDEB 1NK8A 4U7BA 2PY5A 1S49A 1BDGA 1DGKN 2BYCA 2ACMA 2JRSA 2V5HG 2ZBPA 2QKBA 4R5PB 3VEZA 2D0BA 2RRAA 2KYXA 2RE1A 4NLCA 2HIYA 5RUBA 3EM1A 2MZRA 3QNOA 4DF8A 3UPFA 4DR5K 1BQNB 3HK2A 1YXQA 1CZBA 1VQ5S 4LD0A 4IR1A 3R6GB 4LSNA 2JX2A 2YKMB 2OD4A 4MFBB 4M45A 3AHPA 1GMWD 3C16A 2B9XA 1HQUA 3ENWA 4CO2A 3DLGA 2MZ1A 3KLGA 1BA1A 3MDFA 1OQ3A 2WBMA 3OBWA 4NCBA 1MN9A 2YX4A 4TYAA 2ASPA 5GMEA 2A18A 2FBYA 3L2QA 4OYXA 4X4PA 1IBKK 2HHXA 1YUWA 1YJ9N 3LP2B 1UTAA 2GELA 3VA3A 1R6VA 2GAHC 3HVTB 3AY9A 1ZBSA 4TY8A 4QIGA 2WVCA 4JYAK 3VZHA 4AQYF 2GZOA 5HANA 3D6RA 5L38A 4O5FA 2HBZB 4DR6K 3LALA 4AHSA 3ZT0A 1VBKA 2Y0BB 3C6TA 2F4FA 1QVGR 4ZJLA 3GZ7A 1B3TA 1UPPA 2DY4A 3V4MA 3UKRA 2ZBQA 4NYOA 2JWLA 2VCPA 2CQ2A 1U6BA 4DR5J 1GTHA 2DISA 4ILLA 4FP9A 4B9QA 3KYLA 2BQUA 1OY9A 3DLKB 1JJCB 3FCHA 3HT3A 4BVOA 3A13A 2WVBA 4DR2F 1RGIA 5KGXA 5D8HB 4HUFA 3V4IA 3TSUA 1WSHA 3FLCO 7AT1B 3QAUA 4KHMA 4F26A 2C28A 5EWGA 1WSFA 3GE9A 4YY3K 2QMUB 2JWNA 2FHJD 3CCUS 3H5XA 3C15B 3NH0A 2RJZA 5GVQA 2LMIA 1IBKJ 3KKRA 5HJXA 2B56A 5KFIA 3RMAA 2EFGA 2F9WA 1Q1KA 3K9KA 4F7VA 4ZVTB 2LSNA 4BGBA 4W92B 1UVIA 2PFFB 4B1XB 4WCEQ 4CZCA 3JQJA 3MMCB 4OX8A 4H0PA 5KFOA 3AB2B 4ZKAA 4DR6J 1UEVA 3AAQA 2IM2A 5EVZA 3FRZA 4IO1A 2V69A 3HDSA 5FROA 3QIOA 5A76A 2PI5A 1G15A 4USMA 1GXTA 2XEXA 3P38A 1Z1ZA 4I0WA 5IS2A 2QL7B 4DF4A 2IM3A 1T03A 1E6YB 4CO5A 2VFVA 4JS5A 1H2TZ 4O55A 4CZLA 4X65F 4Z4CA 3CO0P 3CD6S 2E1AA 3J81Y 3TI0A 2UU9F 1NMDA 2XY6A 3CJRA 1UL3A 3KK3B 1SL0A 5DK5A 2XZTB 5HBMA 2RSQA 2KW4A 2QSWA 1GOCA 1K1QA 4OLPA 2QLJB 5E7OB 3BGUA 4JKGA 3EJMA 5AT1B 4QW9A 1BCOA 3OYEA 3BB5A 1KOHA 1KLNA 4RR5A 4YY3J 1FD8A 3G82B 4RG8A 3CCEN 3D6FB 1NH7A 4ICLB 3Q2SC 2NRXA 5J2NB 3V81B 3UO0A 4KI6A 3T69A 4GVBA 2B7BB 3NRBA 1HX1A 4WQ5A 4M3UA 1VIXA 4A59A 2YWFA 2B8QA 1SS6A 2ZBIA 3MM7B 4TU7A 4LFCF 2HHSA 2QMWA 3A2FA 4B9UA 5F3TA 1KN6A 3G87A 1KLMB 1UVMA 3ZNUA 2HK2A 1GLCG 3HVAA 4DU8A 4A5BA 1BQMA 2RU3A 2LQ8A 1S48A 3Q22A 4BHQA 3HHLC 3LWLA 3PX0A 3MZIA 3M8ZA 4K4YA 2MKKA 5KT7A 4JLHA 1IWAA 4A8OA 1WF2A 4YP3A 5AR0A 4BR0A 4B9NA 4EIAA 3DM2B 5LL6d 3ET6B 4B08A 4RBVA 1VQ7S 4KQZA 2YKNA 2AMCB 2VG6A 3J81O 1E3MA 4DUTA 4CJLA 1ZBHA 5AXMA 4E7JA 2HNDA 4WYWA 2VGMA 3TAGA 2O67A 1WKLA 1LWCB 1NDCA 2UV8A 1HW8A 1JLEA 3NS6A 4HLBA 2EC2A 2IRUA 3GYNA 3H25A 3W8PA 2LVWA 5KG0A 2DB1A 1UOCA 3LP0B 3HP6A 1TUUA 3D9BA 3IR7B 4X64F 1VBZA 3TQ1A 3C66A 1KONA 3D7SB 3AVIA 5C0YA 1IJEB 1FT8A 2YJEA 5BPNA 1FERA 1FRHA 1EZZB 2N7CA 4DTRA 3FDSA 3M6WA 1QTMA 1QM9A 2PFUA 4FK4A 4J9VA 1T94A 4KTQA 3CCMS 1MDUB 3GYGA 3R1XA 4HTIA 1HHSA 4X4VA 1MNEA 2UUAF 4RW6A 3ATUA 5KFDA 3AA8A 3SNNA 2PMHA 3SJJA 5C15A 5I42B 4CIFA 4J9PA 4E7IA 3ZZ0A 3AVMA 5K8NA 1X9MA 1S6UA 4B9TA 1WKKA 1PYOB 4DTNA 4RX6A 1GTEA 3SCIE 1NJIT 3M6XA 1N5YA 1HNWF 3VGKA 3G4SN 3CJKA 3AAPA 4CLTA 5JLHA 4CGJA 5DETA 3AO4A 3E2EA 3ZZPA 4HH0A 2GVDB 4LMZA 2OTJN 2WTUA 1DQ9A 4EYHB 3RAXA 4NLBA 4I7FB 1M90O 3GV8B 2KM8B 2G9OA 5E26A 3V9SA 2KVIA 3NBPA 4HR2A 2QWPA 1M90T 1NK9A 3ZYYX 4NEZA 4P74A 3G2XA 4CJ7A 1NHUA 1PAEX 4FZYA 2OMLA 5KPRA 4CZFA 4C0OC 1X5OA 2BKNA 1GOBA 3H08A 3UCZP 2KHCA 6FDRA 2C1EB 4UW2A 4QR2A 1N32F 3SQ1A 3IG1B 4BRLA 5B0GA 4OHZA 4ZJQA 2ASJA 1B70B 5BR8F 2NYIA 3N4QA 2D9OA 5DDPC 2F8MA 4GKJF 4QR1A 5C24A 4BDZA 2YY3A 3O5TB 1BIZA 4DN9A 2VFSA 1UAXA 4C7QA 1N54B 3MMJA 1FESA 4ZPDA 1I5OB 3GV7B 1SIWB 1OS5A 3QATA 4BWMA 3CC4S 2DR6A 3OYFA 1RWOB 2GUIA 2I7NA 2NUBA 1HMVA 2MJNA 2C22A 2F8HA 4TKTA 4RUAA 1WUAA 4BE2A 4PXBA 1NDLA 2E5IA 4N8OA 2J9CA 3H1VX 2NCKL 3R7BB 1T8EA 3I55S 4H4OA 1JLAB 4BC7A 4L6V3 4RUCA 3ZO7A 3QBXA 1RT2A 2QO3A 3BP8A 2KH9A 2VGNA 3TEGA 3OY9A 1TKDA 1D9FA 3CCVS 1P8ZA 4CGGA 4LF8K 1MU2B