2BE2A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with r221239
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2be2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2be2A05
3L2VA 4J2BA 1JXBA 3HP9A 3PY8A 4HKQA 4GC6A 3MEEB 5EDWA 1T03A 1S1VB 3CDUA 4M3ZA 1UWBA 4EBEA 2R2RA 1BIZA 4RW9A 1Q9YA 2RKIB 3RBEA 3IN5A 3JYTB 1C0TA 4ECWA 2RN2A 3GIMA 3ZT3A 1FKPA 4JV0A 3GIJA 4KO0A 3VQ9A 5KFQA 3PO5A 1RTIA 5KFUA 3QERA 5JS1A 4B08A 2KQ2A 4KKOB 1YTUA 2JGUA 1JKHA 1SV5B 3I5BA 3TAGA 4TY9A 1RTIB 3H4BA 4ED3A 3PVXA 4DTOA 5DLGA 5KRTA 3AVHA 3PZPA 1Z4UA 1TK0A 4DQIA 2R8GA 4FCYA 2UVWA 4ECQA 3HJFA 4K4ZA 4WZQA 4EO8A 5EU7A 1N48A 3NAHA 4LSNB 3SYZA 4CJSA 3HXMA 3LWLA 1JLGA 4IKAA 4HTUA 3UDLA 4DSJA 2IBKA 4RNMA 4QOZB 4CEZA 3I0SB 3OYMA 1JXEA 4BACA 3ITHB 5KGWA 1RT5B 4CGJA 1L3VA 4CFBA 2FVQA 4DL3A 2R2SA 4K4SA 4AHUA 1DTQB 4QWEA 1DTTA 2D0CA 5C24B 4QWDA 4EEYA 3ZT1A 4YR3A 2ILYA 2BR0A 4CJUA 1RT4B 2AJQA 2RF2A 3K2PA 4PY5A 1DTTB 3AO3A 4F4WA 1LAWA 3U3YA 3BSOA 1VRTA 1U45A 4QWCA 2QK9A 3T5HA 1YVUA 4FZXC 4J9RA 4W5OA 1S5JA 3AVIA 4KHWA 4DSKA 4W5QA 3KJVA 3OSNA 4O44A 4ECZA 3NHGA 4DQQA 4M41A 3D5MA 5HRRA 4OPKA 3VQBA 3LAKA 3L2WA 4E1NA 3EY1A 4FJXA 2FVRA 2FJXA 2X78A 3KLHB 1BCOA 5KG1A 3CJ4A 3FDSA 3GV8B 1NNDA 1XI1A 2OH2A 2XI3A 1RT6A 1T8EA 2GV9A 4QWAA 4CIEA 2PZSA 2X6NA 5CYMB 5KFTA 3TWHA 1LWFA 3T3FA 4AILC 1B9FA 2RDJA 1X1PA 5KG4A 2OPSB 2F8EX 3TARA 3V9WA 4DL4A 1QAIA 5KFOA 3HPOA 3G6YA 4NRTA 1ZYQA 2F96A 3VQAA 1ZBUA 3RMDA 4O3SA 5C5JA 3PR5B 3RB6A 4N5SA 4J9PA 1RBRA 3VQ6A 3T5JA 3L2UA 3ZSYA 3O3FA 4JS4A 1RTDB 5CY4A 4CJ3A 4Q0BB 2D3UA 4IFYA 3GV7B 4YNQA 3OS1A 3FFIA 5DQGA 2FBVA 4Q5VA 4J9NA 3OJUA 4K4XA 3CFPA 1SUQA 4G3IA 3AVLA 3AA4A 3C94A 1REVB 3QO9A 1IKWA 4DMNA 3DRPB 3VQSA 4EP4A 3KHLA 3HT3A 1JLFA 1KHWA 5KFSA 5KFCA 3OHBA 3M8PA 3FQKA 3ICLA 4QW9A 1HMVA 1S6QB 4ED6A 2R8JA 5DG9A 4CECA 1L3SA 4MKBA 4XPEA 4KTWA 4FJJA 3VA0A 4CJWA 1VRUB 4DTPA 3BSNA 3V4IB 4ZPBA 3K59A 2AWZA 3CJ0A 4EBDA 5CYQB 1ZBFA 5DLFA 5KFFA 1RT3A 1QS4A 1KLNA 3K5NA 5KFAA 2IC3B 2WONA 4M45A 3NH1A 5KT6A 5KFJA 1BQMA 3FSIA 4EO6A 4FW2A 1VSFA 3DI6B 3BSCA 5DGAA 4F4YA 4BWJA 1IKXA 3NGIA 1BQMB 3QGGA 3ZSVA 3M8QB 3OL6A 4ZMMA 4OLBA 3AA2A 3M8SA 3OYNA 5HRSA 1U09A 1JL2A 3C6UB 3SUQA 4M3TA 2AGQA 3DMJA 4O4GB 1LW0A 4KTZA 3IG1A 3SV4A 2YNGA 4Y1DA 5L1IA 1LW0B 5KFGA 3KLFA 2ASLA 4B9SA 4NYFA 3M9NB 4EYIB 1BQNB 1ZTTA 3QLHB 1EETA 2BQUA 1VSJA 1TVRB 1JLBA 4C8OA 3QLHA 2ASJA 2FVCA 3RB0A 3LALA 2HNYB 4B9NA 4E7HA 2VWKA 3NF7A 1HQEB 2B43A 2FBXA 4YR0A 4NLXA 1S9GA 4PA1A 4IRCA 2QV6A 4CJEA 1HQEA 2FBTA 1N56A 3TAMB 1NJXA 2HNDB 3OVNA 1MU2A 1JX4A 4W5TA 3DLRA 1J53A 4ZPDA 2EHGA 4J9OA 2HVIA 4RW8A 5KFPA 1WN7A 4O0JA 2UVUA 5KFVA 4EZ9A 4KHYA 3NH0A 2OPQB 4MK8A 3PW2A 3DOKB 4CFDA 5FRNA 4NYZA 5L1JA 2DFEA 1RTJA 4NLYA 2IM1A 4QAGA 3G10A 4I7FB 3PO4A 2FJVA 3GIIA 4Y1CA 4X2BA 3CG7A 5L1LA 3OYIA 2J6UA 4EBCA 3MEGA 1QQCA 2R2UA 3B6OA 3M9MB 4FZYA 1XR6A 3C95A 4IG3A 1VSMA 5KFRA 2D41A 3L2QA 1UOCA 3CJ3A 3DOLB 5JXSA 4LQ9A 1ZBIA 4OGEA 1S1WB 4FLVA 1TAQA 3HPGA 1CXUA 4RU9A 3G86A 1Q8IA 3LP2A 3OY9A 4J2AA 2YKNB 4DTRA 4NLOA 4N56A 3H5UA 3ZT0A 4DEZA 4H8KA 4FJ8A 3H5SA 2ZE2A 3OYLA 4WZMA 1X9MA 2YKNA 3PX6A 4LSLA 3PR4A 3MECA 4MH8A 4DFPA 2B5JA 1TQLA 4ELUA 4DFJA 3KLIA 3SV3A 3OL8A 4FM2A 4EYHB 2YNIA 4ECRA 3CDWA 2A1RA 1T03B 5F9NA 4ZHRA 3P5JA 4Z4HA 2YNIB 4IRKA 2E4LA 1C1CA 1D1UA 3QGHA 3KLVA 4FK4A 1S0OA 2C2EA 2RKIA 4WYWA 2HVHA 3JYTA 3IRXB 2E9RX 4ZVFA 3ASMA 2WB4A 3F9KA 4FYDA 2W9AA 4BDZA 2DY4A 5KRSA 1C1CB 4L8RB 1GX5A 1HNVB 2Q3SA 2FBYA 2AX0A 5F8NA 1HNVA 2XY8A 3VN5A 2D3ZA 1KFDA 5F8GA 1WSGA 4Y2CA 4W5RA 3V9ZA 5JS2A 3AVGA 2IJNA 4JUZA 4ZP7A 2G8IA 4CJVA 1HYZA 4HHTA 1NHUA 4WE1B 2AX1A 2XY5A 1D9FA 3CM5A 4TN2A 4CJFA 5HROA 4TYAA 2R8IA 1ASWA 4Q8FA 4ZVGA 2YHBA 3LP1B 5KT3A 1NKBA 5J2NA 4KHUA 3AVFA 4J9LA 5C42B 3AVAA 4KHQA 5J2PB 5FDLB 1FKOB 3NF9A 2YNHB 5J2MA 3DYAA 4B9LA 4DTJA 1RT4A 2RF2B 1ITGA 4PQUA 5FROA 1C6VA 4N41A 1A5VA 2VG7B 3KK1A 1S0MA 3THVA 5KFIA 3SPZA 4PQUB 2VG7A 3KK1B 4QWBA 4DG1B 1ZTWA 1Q9XA 1QAJA 2BQRA 3AVNA 1UA0A 1LWCB 4O44B 4C8NA 4G1QA 3VQPA 5F9LA 1ZETA 3Q8QB 4IH7A 4DS4A 3C6TA 4DTXA 2DPIA 3I5AA 3OYDA 2Y1JA 4K8XA 1TK8A 1Z25A 3V6DB 1U47A 3KLHA 1SH2A 3N6NA 1SKRA 4OLAA 4ECYA 3NL0A 2G8HA 4IDKB 1QHTA 4NLTA 5HLFB 2E9TA 4MFBA 1D0EA 3DLHA 3H2LA 2XHBA 3NGDA 2P51A 2KZZA 3FQLA 1J9AA 1KVCA 4CHOA 3K5MA 5J2QA 4FM1A 1G15A 1BHLA 3SUNA 1IG9A 1HARA 4CJPA 1TKXA 1RDCA 1J5OA 1TAUA 2YHAA 4O3OA 1T3NA 1QSLA 4O4RA 3QIPA 1IKYB 1TKXB 2IGIA 4IG0A 4AHSA 3MFHA 3OS2A 2PY5A 5HBMA 2ASDA 4CEOA 4Z4EA 4LH4A 2F8SA 2HNZA 3BJYA 4B9MA 5FRMA 3PUFA 3KK2B 3HVAA 1NK4A 2AU0A 5K14B 3G6VA 4J2DA 3KLGA 3OYFA 4IRDA 4M94A 3KK2A 1IKWB 2W9CA 4CEEA 1S6PA 1L3TA 1R0AA 4F8RA 3V6JA 4ECUA 4O55A 4LQ3A 3GIKA 1BCMA 4K4YA 3AVBA 1KHVA 3HHKA 4NZ0A 5KFNA 3KIOA 5EWGA 2V4QA 2VA3A 2EC0A 3SQ4A 1UWBB 3SNNA 1TKTB 3MTKA 4WFXA 1TL1A 3MEDA 1RBVA 3MXIA 4RUAA 3RAQA 4RW9B 4NLGA 1X9WA 1KCFA 4CGDA 3LP0B 1U04A 1CSJA 2DTUA 3IGNA 3NAIA 5T14A 4WFYA 4NLDA 3PJXA 4KAZA 5C25B 4GVMA 4FM0A 1RT7A 3O4QA 1BISA 2XWYA 3DLEA 2XO7A 4DU4A 3QEXA 3HVTB 1I6JA 4IKFA 4M42A 4E0DA 3TVKA 1IKXB 4DLEA 5I42B 4RW4A 4ZPAA 5EWFA 1S49A 4F50A 2W7PA 3NMAA 1RYSA 2AQ4A 1XWLA 4KKOA 1NKCA 3AO5A 1JLGB 2HHTA 4OGCA 3DMJB 1SKSA 3H98A 3AA3A 4E7JA 3FRZA 3OL7A 2RDIA 3CIZA 5KG0A 2HHXA 5SZTA 2FLLA 3CFRA 4F2SA 1GOCA 5I3UA 3KHGA 3RB4A 4CJLA 2ZKUA 2Y1IA 2NUBA 4Z4FA 1DTQA 3HSTB 1GOAA 5I3UB 2AGPA 3QNNA 1S9FA 3S9HA 4DL7A 1KVBA 1RT5A 4IFVA 5KFKA 1W0HA 1NK0A 4CK3A 2HNYA 3N6LA 1SL0A 4ZVEA 4AHRA 1KVAA 3TAFA 4NLWA 3SQ1A 3KK3A 1IM4A 3VQ7A 1LV5A 1DLOB 1RDAA 3O3GA 3HO1A 5DQHA 4XO0A 3AVJA 3TAMA 2D0BA 4CHYA 1RBTA 1KFSA 4C8LA 5KFEA 4E89A 2O4GA 1XHXA 1VRTB 4RW8B 1C2PA 1K1SA 1HYVA 4Y3CA 3M8RA 3MXJA 4ED7A 2P1JA 2HWHA 4KB1A 4ZP9A 2FC0A 3OYHA 2G8KA 3DOKA 4ZTJA 5KFZA 2HHSA 2W42A 4CGGA 1HRHA 3NDKA 4FLYA 4AHTA 1N5YA 3NAEA 4H4MA 1QE1A 3MR3A 3H59A 3ULDA 4M3RA 4B9VA 1RT2B 2OPPB 1WAJA 3F73A 3NKYA 1TV6B 4KFBA 2DFHA 1RT2A 4TY8A 4XIUA 4JRQA 3RWUA 4IG3B 2XRIA 1RT6B 4FZZA 4KAIA 3EZ5A 4ZPCA 5EUHA 4FS1A 4OKJA 4FVMA 2E6LA 2FVPA 3RMBA 2CKWA 2WOMA 3A2FA 3CFOA 1C1BA 1LWEA 1WLJA 4Q0BA 4JV1A 4JLHA 5F8MA 4IFYB 1W25A 4J9QA 3IAYA 3FFIB 4CF8A 5F8IA 4TYBA 3MECB 1CXQA 3CM6A 3V81B 1D8YA 1JL1A 3SI6A 4O3QA 3QO9B 3P83D 3DRPA 3AO2A 3V81A 1VSIA 3RRGA 2FLNA 5KFWA 3NF6A 4BE0A 1QTMA 3N6MA 1CZBA 4ZHRB 2A1SA 2XCAA 3TAQA 1WSEA 1REVA 1JIHA 2VWJA 2C22A 4N47A 1TL3B 3MAQA 3DLKB 4O3RA 4FK0A 1IH7A 1S1TA 2RPIA 2VG5B 1NHVA 3DLKA 1RTHB 3RTVA 1CZ9A 4TLRA 1I39A 5EWEA 1S1TB 1N6QA 2BE2A 1A5XA 4CHNA 4K4VA 3QETA 4HUEA 4R5PA 4KB7A 4DFMA 2E6MA 2W7OA 2KFNA 4FS2A 3ZT4A 4K4TA 2QE5A 3DRRB 5CYQA 1T94A 2C2RA 3T19A 2WRMA 4DL2A 2J6SA 2IC3A 3V9SA 2UVRA 5HROB 4IQXA 1S4FA 2VG6B 2UVVA 3V1OA 4DFKA 4DF8A 3U6FA 3LP1A 1IKVA 2PYJA 3UIQA 1U4BA 5J2NB 3WNGA 3TQ1A 3I5CA 3MF5A 5L1KA 1NJZA 2HMIA 4PUOA 4MIAA 3M8QA 3H4DA 1C0UA 3PW4A 5J2PA 1HNIB 3AVCA 3L2RA 2HMIB 4DSFA 1NOYA 3KD5E 2F8TA 4CK2A 4Q44A 4YMEA 4F2RA 2C28A 1RDDA 2ATQA 2JC0A 4OVLA 3WNFA 1HNIA 3QEWA 3E01B 4Y34A 2FVSA 4CE9A 3UR0A 4E3SA 1LW2B 1IO2A 1RNHA 4FK2A 3QEVA 1RCHA 4DG1A 4IH6A 1VSDA 3BDPA 2KZMA 4CCHA 3MFIA 4K8ZA 2BANA 3MR6A 1TVRA 2E9ZA 3NFAA 3SPYA 2HNDA 1J54A 3K5OA 3Q8SB 3LPTA 1K6YA 3C6TB 2BANB 2FLPA 4O0IA 1NKEA 1L5UA 2IA6A 4CIFA 4CERA 4B9TA 1Z26A 1T7PA 3V6DA 2HW3A 1S1XB 4ECVA 2GC8A 4FJNA 3E51A 4J9KA 1WAFA 2IM0A 4DSEA 2LSNA 4YP3A 3LPUA 5KTQA 2BGGA 2IJFA 1JLAB 2YKMB 1NK8A 5HLFA 4CEBA 1GX6A 2G8UA 4TSXA 4WXOA 3HM9A 5HRNA 4RW7A 1HYSB 2YKMA 1TKDA 4F3OA 3DLGB 1ZBHA 2OPQA 4DSIA 2JEGA 1NK5A 3QZ8A 4I9QA 1RYRA 1RTJB 3MXMA 1WSJA 3PW0A 2XCPA 4JS5A 4J9MA 3DLGA 5J1EB 3BQ1A 3OSPA 2DPJA 1J5OB 3SFGA 2IDOA 3K5LA 3AO1A 4LD0A 2B6AB 4MKAA 3TABA 1WSIA 4DTUA 3MEGB 3T1AA 4I2PA 1Y97A 2W9BA 2VA2A 3JSMB 3D0PA 2IAJB 3KNAA 2D5RA 4DQSA 3DM2A 2B4JA 3QZ7A 3D45A 3NGYA 4IOBA 4CFCA 3GILA 3EZUA 4CHPA 3DDKA 4TXSA 3SJJA 2Z1GA 1JLCB 4OPJA 5K14A 3S3OA 5KFBA 3B6PA 2UUWA 4O3NA 4M3XA 4RNHA 4GC7A 4LH5A 3V6KA 1JLCA 1VSKA 4E1MA 4B3OB 5KG7A 2V4RA 4FLTA 4HCCA 1JLEB 4NYNA 3AO4A 4B3OA 3H08A 3I0RA 4IH5A 1JLEA 4NLUA 3BSAA 4J2EA 2O5DA 3D28A 3LZIA 4Q45A 3MR5A 2HB5A 1TKTA 4KBIA 2O4IA 4FJ5A 3MEEA 1SKWA 2BDPA 4BE2A 4ECTA 3IS9B 4K4WA 5KFXA 3K58A 1JLQA 1T05B 1C0TB 3OYCA 2DFFA 4CGHA 4FXDA 3VQ5A 3PV8A 4KI6A 4KO0B 3PW7A 2PYLA 4KRFA 1S9EA 2YV0X 3DLEB 1KSPA 1MMLA 5D3GB 1EXQA 2JLEA 2GIRA 4JV2A 1JKHB 1NJWA 1KRPA 4NLPA 3VQ8A 5D3GA 3QYYA 2X74A 5DG8A 3CJ5A 4ICLB 4NCGA 4DSLA 3AVKA 4F4ZA 4H54A 3KHRA 4YR2A 3CJ2A 2HHUA 4ICLA 4NCGB 1HPZA 1SV5A 3SUPA 2I1RA 3TI0A 4UQGA 3ISNC 3CVKA 4E7IA 4FJMA 3KMQA 1HPZB 4WE1A 3ITHA 3GYNA 2IS3A 4LSNA 2YNHA 5J2MB 3G0ZA 4FJLA 4TQRA 4BDPA 1O1WA 4IBNA 3ZSXA 3CQ8A 3QEPA 4CHQA 1VK0A 3I0SA 4WXWA 3V1QA 1RDRA 3PHEA 4FJKA 4KHMA 3ZT2A 4CEFA 4CF0A 5F8HA 4MK9A 5FDLA 2ATLA 1FKOA 2CJQA 3VQCA 4YFUA 3DYAB 4CK1A 3KOAA 5CZ1A 2KTQA 3BREA 1SH0A 2GIQA 5C24A 4CEQA 4DU3A 3RMCA 3K57A 4HCBA 3I8DA 2IMWP 5SWMA 4F4XA 1XR5A 3NCIA 3WNHA 1XC9A 3KJVB 4CEAA 4O3PA 1BGXT 4CJKA 4CEDA 1HQUB 4C8MA 3VQQA 1LWCA 3L3VA 4G1QB 1RILA 3ZSRA 4YQWA 3BGRA 1HQUA 2IM3A 4F3TA 1N5YB 3CYMA 4R8UB 4K50A 4AH9A 5DG7A 3BGRB 1WNEA 2OZMA 3DLBA 4R8UA 4M3UA 4ID1A 4DS5A 4TY8B 2W8LA 2UUTA 4CF9A 1LWFB 4E7KA 1U48A 4KHRA 3GQCA 4MFBB 3NF8A 1KLMB 2Z1HA 3QIDA 4Q8EA 1F21A 1RBSA 4CF2A 1LAVA 4ID5B 1S0NA 5CYMA 3S3NA 2GBZA 4OJRA 2JEFA 3NE6A 2OPSA 5DMRA 5F8JA 4DLGA 1RTDA 4DL6A 4OKEA 1SL2A 4FW1A 1HJRA 3ZCMA 1TKZA 1KTQA 2HNZB 3BQ2A 2OPRB 4WYLA 1TKZB 4BDYA 2R7YA 4U6PA 5L9XA 1OS5A 3KLGB 4QPXA 1ZBLA 3OYJA 4C8KA 2OPRA 3V9XA 3NGZA 3HKWA 4FLWA 3M8PB 1SUQB 4CESA 2IM2A 1S6PB 3ZSOA 3KLEB 4FLUA 4MK7A 4CF1A 3MEDB 5KT5A 1GOBA 3L3UA 4B8CA 3LP0A 4URGA 3Q8RB 1SL1A 3KLEA 4NLRA 2G8WA 3V4IA 3EYZA 4OKKA 3RB3A 4NCBA 1N6QB 2J6TA 1RBUA 4K4UA 1RT7B 5F8LA 2QKBA 1ASVA 1I3AA 2WONB 2V9WA 4FJ7A 4J9SA 3EPGA 3DRRA 1VRUA 4ECSA 4RW4B 4ELVA 3KD1E 5DK5A 1FKPB 3ZSZA 2XY7A 5C25A 2VG6A 2HAIA 4BWMA 4FLZA 2AGOA 3HVTA 4URSA 3C6UA 2R8KA 5I42A 4O4GA 1C0UB 2V0NA 5KFYA 4FJIA 3ALYA 4RNFA 3DI6A 1EKEA 2WTFA 4FBTA 4O5BA 2YNGB 1WSHA 1WNSA 1BQNA 3H5XA 4MIBA 5KFLA 3HP6A 4IFVB 3KKRA 3V1RA 2G8VA 1A5WA 4KV8B 2G8FA 3KK3B 4H4OA 3KLFB 1DLOA 4Z0UA 2D0AA 3MR2A 3RR8A 3GV5B 4KV8A 1S9GB 1EETB 4CIGA 4H4OB 3CO9A 4RZRA 1QUVA 1D9DA 3AV9A 1JLBB 1C1AA 1RAJA 3HPHA 5HRPA 2ZD1A 1MU2B 5KG3A 3RRHA 3H5YA 3VA3A 4ZP8A 2ZD1B 4FJGA 3TANA 4CJQA 1JLAA 3SFUA 4QCLA 3OYAA 4NCAA 3RBDA 3PX0A 3LP3A 4KREA 4NLSA 2W8KA 3O3HA 2HWIA 1QE1B 2QXFA 4ED2A 1B92A 4B8AB 3O4NA 3SQ2A 3RMAA 5E41A 1TV6A 4KFBB 3OHAA 4DTMA 1JXLA 3V9UA 2X6SA 1YT3A 1EX4A 3KMSA 3LWMA 4OL8A 4H4MB 2WCXA 1RA7A 3QGIA 3T5LA 4I7FA 1L3UA 2OPPA 4M3YA 2HHWA 4Y2AA 3PX4A 3AA5X 2YNFB 4MQ3A 4CGFA 3DM2B 4I9LA 2XY6A 4HVJA 3QINA 2GUIA 4U7CA 2XGPA 3P1GA 2YNFA 3G6XA 3HL8A 4FLXA 2WOMB 3SQ0A 1BIUA 1TK5A 3HK2A 3QEIA 3LP2B 3TAEA 2WK4A 4FJHA 4DTSA 4IR9A 4CJRA 4FJ9A 2EX3A 4LSLB 3HYFA 2OZSA 3CWJA 4IR1A 1UA1A 5KFMA 1C1BB 1LWEB 4E19A 3VQ4A 2B5JB 3I0RB 3KLIB 4EZ6A 1VSLA 4PWDA 3OLBA 2QKKA 3H40A 4ZVHA 4CHZA 4ZP6A 4EP5A 4KSEB 4NLVA 2C2DA 3UQSA 4PWDB 4CJTA 3IS9A 4Z4IA 3V6HA 5DQIA 1U49A 1JLQB 1T05A 1RTHA 1JLFB 3LZJA 1S9EB 1RA6A 4CGIA 1TGOA 2BE2B 1TL3A 1YTAA 3QNOA 4I2QB 4KB0A 3OYGA 1SH3A 2BRKA 2D7SA 1HMVB 1S6QA 4R5PB 3LDSA 2IOCA 2P5GA 4XPCA 4RUCA 5KGXA 3IRXA 2VG5A 1NK9A 4BE1A 2I5JB 4I2QA 4DL5A 1QSYA 1S10A 5T7BA 2I5JA 4NRUA 5KG2A 4HUFA 4RNOA 1B9DA 1RT1B 1NK6A 1RT3B 4HUGA 3SCXA 4E7LA 1YVFA 2Z1JA 4B9UA 1UAXA 5KT7A 3VQEA 4GW6A 2OYQA 1RT1A 1BI4B 4R0EA 3PW5A 4DTNA 3HVWA 2BRLA 3QESA 4F4KA 2JEJA 3OJSA 5C42A 4KPYA 1BI4A 1IKVB 3SZ2A 1EP4A 4ECXA 3ISND 1K1QA 1FK9A 3U3GA 5CZ2A 4WFZA 4PUOB 1LW2A 1EP4B 4HYKA 5JUMA 2BQ3A 3IG1B 1FK9B 3M9OB 1VSHA 1S97A 4KHNA 4GMJB 5KI6A 3OLAA 4FBUA 4Z4CA 3HVRA 3OYBA 1NJYA 3IGVA 4KTQA 3E01A 3SI8A 4W5NA 1X9SA 1NK7A 2R8HA 3AVMA 2ITGA 4DF4A 2JC1A 1VSEA 5DGBA 2OA8A 2R2TA 3KKSA 3RAXA 2ZQBA 2XGQA 4RG8A 1XR7A 4TQSA 5KT2A 2KW4A 2ILZA 1S48A 3Q8PB 4IDKA 1S1XA 2Z1IA 2WHOA 4Z4GA 3L8BA 1HYSA 3NH2A 3LAMA 4URQU 2XI2A 1NOZA 3OYEA 4AHVA 4ED8A 3CDEA 4N76A 1KLMA 4CJ4A 5J1EA 3DRSA 3OL9A 4Q43A 4RW7B 3WNEA 3NBPB 5J2QB 1N4LA 2B6AA 3BR9A 5KFHA 4I2PB 2HHVA 3DRSB 1TP7A 2W9BB 3UPFA 1RDBA 4ID5A 3JSMA 3NBPA 3OS0A 2HHQA 3RR7A 1IKYA 3KHHA 2XC9A 4ELTA 5HBMB 4ED0A 3T5KA 4JRPA 3S3MA 3LANA 1D5AA 2IAJA 4DQPA 1S1UA 1QSSA 4LY7A 3OYKA 2KFZA 3SUOA 3QIPB 5KT4A 4ED1A 4IG0B 3DOLA 1ASUA 4M3WA 4RW6B 2JEIA 1S1UB 2ALZA 1S1WA 3VQDA 4AHCA 3ZSWA 4DQRA 4KE5A 2W9CB 4DWIA 3QIOA 4KI4A 3KTQA 4CFAA 1WSFA 2ETJA 4RW6A 5HP1A 3PJWA 1FXXA 2FJWA 4QW8A 5KG5A 1BL3A 1C0MA 3TAPA 2ZE2B 3ZSQA 4NLQA 4RNNA 4KHSA 1CLQA 4DU1A 1XHZA 5HP1B 4CJ5A 5KFDA 4ZTFA 3EPIA 1R0AB 5KG6A 3TR8A 1TL1B 1W9HA 4M95A 2P5OA 1S1VA 3BQ0A
chains in the Genus database with same CATH superfamily
1JXBA 3PY8A 4GC6A 1FRMA 1T03A 1PIEA 1YGYA 2NXJA 4M3ZA 1WHVA 1RWNB 5K8OA 4FZVA 3OFHA 3IN5A 1N5QA 1BMQB 4NI2A 3MDQA 5KFUA 3QERA 5JS1A 2KQ2A 2XS5A 2JGUA 3R8EA 4DUZJ 1RTIB 4ED3A 2ZJRQ 3AVHA 1TK0A 2R8GA 1VQMN 2ERRA 2UVWA 2AT1B 3HJFA 4K4ZA 4WQ4C 2E1ZA 4ZVOB 1N48A 3WT0A 2C3PA 4MO5A 1S6OA 1VJWA 2ZITA 2Y0SD 4DBQA 3W3SA 3K9KA 1AT1B 3OT9A 2WSFC 1YJUA 4AUKA 4C8ZA 3ZC4A 1JXEA 3GLJA 3IR5B 4ZCIA 2G2YA 4CFBA 1OY6A 4DL3A 1VBYA 4JI2J 4AHUA 1UW4A 3R7SB 1WD6A 4QWEA 2D0CA 5C24B 4QIVA 4DR2J 2FY8A 2V51B 2AJQA 2RF2A 2WAQD 4PY5A 1DTTB 3GSIA 4JAXA 4WK1A 1LAWA 1T9VA 3CQXA 2Z2MA 2ZOMA 3FKBA 3M1VB 4FZXC 4J9RA 3UD4P 5BYSA 4DSKA 3O1WA 3Q7CA 5LM7E 4WF9L 4O44A 3LH2S 5LMUF 3KWGA 3Q8UA 1EWRA 3VQBA 3SAFA 4H0OA 3VGKA 3EY1A 5JLHA 2MJNA 4IOAL 2FVRA 5E84A 1HNZJ 4LVNP 1M5VC 3ID6A 5KG1A 3ZZUA 2DO0A 1U2VB 3IM9A 2GV9A 1MA9B 2KG0A 5CYMB 5KFTA 4C4WA 1F3FA 1SJFA 2F8EX 2P9CA 1MW7A 3MAHA 3G6YA 2PO4A 2VICA 3E9OA 4JI1F 1V3ZA 1GXLA 2E5GA 2VPYB 4WPAA 3JQJA 3UWTA 1RHUB 3P39A 3ULHA 3RB6A 3K5PA 4AQYF 1XMQJ 2YQ0A 1DURA 3L2UA 3O3FA 4V19X 3DOMB 2M52A 2D0PA 1CEZA 3BDEA 1YHQS 2FBVA 5DQGA 1Y0HA 3P49B 3G71S 4G3IA 3AVLA 1TU0B 4A47A 2P9PA 2HFOA 1IKWA 3F5TA 4DMNA 4UZCA 5JLFA 1OVQA 2RILA 1KHWA 5KFSA 1RAAB 4HT7A 3ICLA 3ETOA 3CC2N 4Y6IA 5IT0A 5DG9A 2PFFB 4MKBA 4XPEA 5KOWA 4KTWA 2CVEA 2R3VA 1E6YA 1BXNA 5AQSA 1XEZA 2O8FA 3MOJB 3K59A 1LFWA 1HA1A 2AW0A 5GAHP 1NDPA 4IO1A 4QYRA 3LW5C 4WFAL 4NYPA 1KLNA 2A2CA 2MHNA 3Q23A 5A2QO 5L38A 1S7HA 2CJAA 2O67A 3FSIA 1AXQA 4EO6A 3UN3A 3CJAA 1VSFA 4F4YA 2P9IB 1GLLO 4NYOA 3VGMA 3ZSVA 3OL6A 1H1VA 5GAGI 4LF8K 5HRSA 1JL2A 1APSA 1UPMB 4O4GB 2BUPA 3SV4A 5FPNA 1CJUA 4WFBL 5L1IA 2ASLA 1YIJN 1VIXA 3DCAA 4R25A 3VMFB 1PC5A 3DGPA 4IDHA 2EKNA 3Q22A 5LMNK 2VBYA 3O6QA 2AP1A 2YWKA 5AQPA 2FVCA 3RB0A 2QEXS 3VALA 3MMAA 3LALA 2HNYB 4E7HA 4HACA 4MDAA 3EGVA 4UUWA 1XUPO 4PA1A 2G0IA 2V8DA 4IRCA 3TYTA 1HQEA 3J7A1 2FBTA 1FX4A 1N56A 2WBNA 1NJXA 4FXVA 2GX9A 5LOQA 2NUHA 3BBFA 4W5TA 3HDSA 3GL1A 1N54B 2IVYA 2EHGA 2XHWA 4PWUA 3M8WA 4O0JA 1JCEA 1GEHA 3LDQA 2YKAA 3ZTQA 5H1SQ 4KHYA 2YWGA 4MK8A 3PW2A 3DOKB 1WF1A 1E3MA 1TMJA 3MAAA 2Z58B 3EGNA 2HIQA 1RBAA 2M5YA 2KHCA 3CG7A 3W9HA 5L1LA 4BRFA 3CCWA 4EBCA 3OPKA 2R2UA 1HD0A 3M9MB 3C95A 4ETZA 2HG4A 4OX9F 2UUCK 5EN1A 5KFRA 2KJVA 1VQKS 4KT0C 5JXSA 1ZBIA 1RB0A 4CBXA 2BMBA 4AF1A 1CXUA 2MY8A 4KC5A 4C7QA 4DUYF 4J2AA 1HBMB 1HNXF 1WI8A 4J37A 4LRAA 3H5UA 4FJ8A 3H5SA 2ZE2A 2DGQA 3QBCA 2QSWA 3MWTA 1NCLA 4M8LA 1EQYA 4USJC 3NWRA 5LJ3Y 2KN4A 2B5JA 1TQLA 4DFJA 5DRKA 4DV2K 3KLIA 4FWPA 5AQFA 2C2MB 3HSGA 2VODA 4X4UA 4OZNA 2VQFK 3IM8A 1T03B 4FVUA 2RVJA 3D6MB 5F9NA 1LCUA 3P5JA 1YBTA 2C2OB 2YNIB 4KGZB 4Z4HA 3BPDA 3M32A 6FDRA 1RI7A 2RKIA 1EHWA 3O44A 2P9KB 2E9RX 4BQLA 2WB4A 3F9KA 2W9AA 5KRSA 3TA1A 4IO8A 2LECA 1GX5A 3D6RA 2ZC3A 3BYPA 2FBYA 1ZM3A 2AX0A 1LXNA 3VN5A 5IT9U 1NH8A 4JYAK 5JS2A 3AVGA 2IJNA 4P71A 2IDEA 1HYZA 2B9XA 3CM5A 3SQGB 5EHHA 4TN2A 4LBPA 5HROA 1ASWA 2HWTA 4DR6J 2A6AA 2XLIA 1NKBA 1UVMA 5J2NA 2NLWA 5IQQA 4LF5F 1FWKA 1WG1A 2OKQA 2Z2ZA 5J2PB 5FDLB 4XDDA 5C0YA 2HSTA 3DYAA 4B9LA 1RT4A 5GVQA 5A2QU 1ITGA 4N41A 1FRKA 2N82B 5HMWA 4CH1A 1N34F 4JI7F 5KFIA 3SPZA 1QVGR 3KK1B 4QWBA 4GRSA 1IBLJ 1QAJA 4B3RJ 3AVNA 4B3SF 4WQ5C 1LWCB 4FWKA 4C8NA 4G1QA 1MWYA 3VQPA 5F9LA 5M2UA 4DTXA 3UE5A 3OYDA 5ETTA 2Y1JA 2A41A 3MN9A 2VC0A 4CD1A 3SMSA 2R7XA 1DQ8A 3NL0A 5ETMA 3UW1A 4CLYA 4NLTA 1HNWK 1YXQA 1OQ3A 1N88A 2E9TA 1EX8A 1ZM2A 1MSWD 3J80U 1J5EJ 4CZLA 2EVZA 2XS7A 4R79A 1S5ZA 2DCUB 2XZTB 2KZZA 1J9AA 2IVFB 1JCFA 4DXLA 3K5MA 4CHOA 3SUNA 3FR0A 2DNOA 3UVJA 3CMAS 1EARA 3GJRB 2X1GA 1M5SA 4O3OA 5AXMA 3L95X 1T3NA 1K8KB 3QIPA 1TKXB 2X1FA 1WEZA 4AHSA 4LJMA 3ETMA 3OS2A 3IR7B 5KQDA 1ZA1B 2F8SA 3BJYA 5CYJA 3PUFA 1VAZA 2YHXA 5K14B 3DXSX 4J2DA 3OYFA 3SQOP 3CHWA 4M94A 2DT9A 4DU7A 3ZYYX 3EZOA 4KJIA 3GIKA 1NPPA 1PYSB 4A57A 2BJ1A 3G71N 3PXGa 2QZ8A 3TSQA 3ZEUA 1HWUA 3MTKA 1UJ4A 5LJ5Y 4MO4A 1NH7A 4WFXA 1TL1A 1RBVA 4NLGA 3FBCA 4CGDA 1UVIA 1IG8A 2HHHJ 3NAIA 4PG5A 1X60A 3AD7C 2NXUA 4NLDA 2FF6A 1KDNA 1Q0NA 1ZA2B 2ZJPQ 5CR4A 5C25B 2HZAA 4FM0A 4YY3J 3PEHA 1HL6A 5I4MA 4WK3A 3CUNA 4ZPAA 1YAGA 5CAAA 1KTVA 2QO3A 1JNRB 1TUGB 2FIUA 2E7VA 1NKCA 4IJNA 2HHTA 3TTCA 3H98A 3MCMA 5JVHQ 3CIZA 3SBGA 3M2UB 4OMFG 3W1YC 2FLLA 3CFRA 2MZQA 3IAS9 1GOCA 1DY3A 2ZKUA 2Y1IA 2A0FB 3JSRA 4KHPF 1T02A 1PJ7A 1GOAA 5ELZA 3ZLJA 1HWKA 2Z0GA 3TNVA 2JWNA 2AGPA 3QNNA 3S9HA 4DL7A 2HNYA 3KK7A 4LF7F 4AHRA 1KVAA 3TAFA 4NLWA 2CG8A 1LV5A 1BA1A 4C3MA 3PRDA 2GEMA 1IBCB 2AYEA 5DQHA 3AVJA 3TAMA 5LMNF 2GIFA 2XNRA 4I68A 4X66F 4C8LA 1VQ6S 2UXBJ 1MWMA 2HWHA 2MQPA 3S8SA 2G8KA 1M90O 2F1FA 4LRFA 4OPAA 2V94A 5F3ZA 1HX1A 2W42A 2M0GB 3H3OB 1Y9OA 2VGMA 1Z1ZA 3SBMA 2HF3A 3H59A 4B9VA 3P38A 4EIAA 3G25A 5AJ3K 4CZIA 2KLAA 4XIUA 4JRQA 2HRTA 4IG3B 1A0OB 3W5YA 2XRIA 3W9IA 1RT6B 4FZZA 4KAIA 3EZ5A 4RL1A 4QYZJ 2BJDA 4K59A 2Y8YA 3MMBB 1P1TA 1IR0A 1WHYA 2LXFA 1WDTA 4RBVA 3FFKB 1NNEA 4FVMA 1VBXA 5ETOA 3DXBA 4JI0F 3RMBA 1Q86T 3LM9A 2YX7A 1YJRA 2CKWA 2YXLA 2GAHC 1WLJA 4O8UA 5F8MA 4IFYB 1FI4A 4J9QA 3T69A 1BQXA 4TYBA 5BYRA 2EBGA 1CXQA 3V81B 3NWGA 1D8YA 1JL1A 2DH7A 3H7HB 4JI6K 2JWLA 2HZVA 3J7AN 1VSIA 5KFWA 1BDGA 4BE0A 1CZBA 1O13A 2XQCA 1VQPS 3CCLS 2XCAA 1YZ7A 3TAQA 2HBMA 4YUDA 2C22A 1CS4B 3DLKB 2EW9A 1XBWA 3EM1A 3TW0A 1IN0A 2VG5B 4H0PA 5BRDA 4OI1A 5EWEA 2AJ1A 1S1TB 2YX1A 2KH9A 1A5XA 1NSQA 4CHNA 3GU0A 3K9JA 4R5PA 4DUTA 2OCEA 3J7ZT 2P9EA 5CYQA 2WRMA 1ITPA 2BKPA 3CJSA 5LJVA 3IA0A 3I96A 2UVRA 1S4FA 4RTFD 3PACA 4YDDB 1QVGM 4DF8A 5J2NB 4OZLA 3WNGA 3MF5A 1I94J 3FEXB 2A10A 1NJZA 2GHVC 2ZH3A 2LEAA 2FJDB 3NNHA 3H4DA 1C0UA 2GCFA 1HNIB 2ALYB 4ER8A 2F8TA 2OTJN 4M5JA 4WQ5A 2ATQA 3MM5A 1JK9B 2CZ9A 4OVLA 3MN5A 3NP5A 5IV3A 3H20A 3E01B 4CE9A 1IO2A 4G6VB 5HL7L 2VFRA 3POTA 3QEVA 3N5FA 1HJOA 4LBHA 3MFIA 2BANA 1YJ7A 3MR6A 3ENVA 3NFAA 2GGPB 2BXJA 2FC9A 4DV6F 1J54A 3K5OA 4LIRA 3C6TB 1T3VA 2BANB 3QWUA 1M1KO 3O2IA 3V6DA 2HW3A 1S1XB 1Q7LB 4ECVA 2OEJA 3KWMA 3BO3A 1JLAB 1ZAXA 4H0VB 1XC3A 3L0QA 5AE2A 2HS4A 1GX6A 2ACYA 3IDHA 3BYRA 3HM9A 1WEYA 1TKDA 1GH8A 3CT9A 2GQCA 5C15A 4P2SA 2CPFA 3MAAB 2B9WA 2BE7D 2DH8A 3KG0A 3OSPA 5J1EB 1NU0A 1I94F 3K5LA 3AO1A 4LD0A 4KPCA 4DTUA 1HPMA 3T1AA 2NCKL 1Y97A 3E9PA 3JSMB 4HVZA 2D5RA 3GYGA 5GAHI 1B64A 2G2OA 3DM2A 3LA0A 2HEKA 1RHMB 3NGYA 4IOBA 4PQAA 2J9CA 4CFCA 2BABA 2VFTA 2LXIA 1JLCB 1M90T 5K8MA 1KAZA 5KFBA 3K17A 3T6JA 2UUWA 4A8OA 4O3NA 3DFEA 3I6PA 2CWKA 3RW6A 5D0HA 2K7JA 4E1MA 1SQFA 3O8WA 3HLUA 1YLXA 4FPRA 2NRWA 1JLEB 3VCDA 1IJJA 4B1UB 4P2FA 2ZF5O 3MUVP 2V4JA 4A62A 1TL7A 4CRJA 4DV4J 2LDYA 3LZIA 1DQ9A 1I1GA 3NGSA 1KVIA 4KBIA 4FJ5A 1H73A 2IVMA 3AOAA 3EVOA 3IS9B 4DCPB 4MYTA 5K8PA 5HK4A 4MLEA 5KFXA 3MWBA 5H1SV 1UJ5A 3K58A 4ZJOA 1JLQA 1C0TB 4CGHA 2BTFA 3PV8A 4RLEA 4KO0B 3PW7A 2PYLA 2FHOB 3DXKA 3DWLA 3P4IA 4X4RA 1MMLA 5D3GB 4YEAA 2DNKA 2QWPA 3VQ8A 3KJFB 3C19A 3ILJA 4GKJF 1V3RA 3CJ5A 4Y2KA 4H54A 4A8FA 3QPIA 3IMXA 4X4SA 3CJ2A 4OX9K 2GUPA 1SVDA 2BKOA 1HPZA 2HRYA 1SV5A 3SUPA 4DQ8A 1VQ4S 3F41A 1CG2A 4E7IA 2QC3A 3HHLA 4CQ1A 4LSNA 3G96A 3HSJA 1FE4A 1KOOA 2KKHA 4TQRA 1OH8A 1BHNA 4AT1B 2AJ2A 4IBNA 3CQ8A 2W41A 3EVWA 3KG4A 3ZX2A 1WKKA 4WXWA 2VPWB 2VCPA 4U9RA 3W9JA 2HQFA 4FJKA 4MK9A 1FKOA 1KVKA 3G82A 4TU7A 4ZLPA 3OBYA 3VTHA 1Q53A 3RMCA 2YQ3A 2ASYA 4HCBA 4C3KA 5SWMA 1V5VA 4F4XA 3MX2A 4DCHA 2VPZB 5KPZA 3GDQA 1BGXT 5IWAK 4CEDA 4C8MA 3VQQA 1LWCA 2ZC4A 4G1QB 3R27A 4L6V3 1RILA 3ZSRA 3BGRA 1HQUA 4F3TA 1N5YB 1T9UA 1UFKA 3PRVA 1F9HA 3CEDA 4HHUA 4CP5A 5BR8K 4A8XA 4R8UA 3MPWA 1U2FA 1WF2A 1KONA 4CF9A 4K5RA 4P52A 4MFBB 3NF8A 4B1ZA 5TKWA 4MKVA 2Z1HA 2DNRA 3AY9A 1RBSA 1W7WA 1H72C 1LAVA 4ID5B 5CYMA 2V2KA 3CJQA 2GBZA 4LF5K 5JMNA 4BY9C 2OELA 2BM1A 3ADAC 2OPSA 5DMRA 3QBXA 1YRTA 2LLZA 3P5BP 4KGKA 3GCXP 4QU6A 4RBTA 4F0MA 4K0KF 3H2UB 1AYEA 3HHDA 1T44A 3SXLA 2PMWA 3QFHA 1RK8A 5GAHU 4KIAA 2FF3B 1XIQA 4BDYA 4U6PA 1FDAA 2IIRA 4IEEA 2ASMA 1GLAG 3TU5A 3ZZPA 3M8PB 1SUQB 4JB8B 5A8KA 3K89A 5EX5A 1Z05A 3LP0A 3Q8RB 5M1PA 2AF6A 3KLEA 1YHQN 2Q43A 3UD3P 2G8WA 2HGNA 3EYZA 5GMDA 2J6TA 3IO1A 2GVDB 1RLCL 1XNRK 1RT7B 1N5SA 2QKBA 4JKGA 1T11A 4GKKF 2WONB 3ENHA 3DRRA 3C6HA 1IBMJ 4CO5A 2ZWHA 5AE3A 1VQ8N 3SDEB 3VF2A 3KD1E 2QLFB 5DK5A 2CDRB 1RTZA 1FKPB 3J81Y 5C25A 1FRIA 3DC2A 4I56A 4NA1A 5B09A 2AGOA 4URSA 3TUIC 5I42A 1NHKL 1R43A 3FZKA 1N36K 1C0UB 2V0NA 5KFYA 3IFRA 4FBTA 1NMNA 3L3CA 1E4FT 3EUNA 3OXFA 5M1KA 1PBUA 4UOHA 2H51B 4FO0A 4B3TK 4MIBA 3HP6A 3QAEA 2OEMA 2CAJA 1GQEA 4KV8B 1U2CA 2G8FA 3KK3B 3THTA 1JJ2R 4PEOA 3AA8A 1YBAA 3DAWA 1YWXA 4QS7A 1EETB 2QG9B 4RZRA 1QUVA 1D9DA 3CIPA 4M63C 4CO4A 3M30A 2CFXA 2NR0A 1PKUA 2CPXA 1MU2B 3TQEA 3T1YF 5KG3A 4A46A 2ZH6A 3BM7A 4OZJA 4USHA 4G65A 1SAZA 2UXCK 4QCLA 3OYAA 5DDOC 3PYEA 4ES2A 3TZWA 3RBDA 4PKGA 1KD1O 1F0XA 1QE1B 4U7UD 2HBZB 3MPYA 4FVCA 2C2KB 4ED2A 1B92A 3RMAA 3SQ2A 5E41A 3OHAA 3EL2A 2KRRA 1JXLA 5F1XA 4YY3F 3C15A 2RAQA 2X6SA 3NNCA 2MB0B 3I31A 1CJKA 3KMSA 2RRBA 4OL8A 5C12A 1RA7A 5DETA 4IOCL 1L3UA 4F3MA 4F25A 3PX4A 1H74A 4R0JA 4CGFA 3QFWA 1EB0A 3C16B 4BGBA 2A5XA 3FBEA 4RWWA 3QB0A 3BUZB 4JI8K 3HD1A 1BIUA 3HK2A 3B6BA 3C16A 1WC3A 4PZVA 3QEIA 3MM8B 1OVYA 3C65A 3DNCA 3M05A 2X3DA 4JI3F 4FJ9A 3SCLE 3M8ZA 3R7NB 3HYFA 2OZSA 4IR1A 1LWEB 3O5TB 2GS8A 4FDFA 1R59O 2NLXA 1HNWJ 3VQ4A 2BV3A 5F0XA 3I0RB 3PHTA 3KLIB 1UEUA 2PEHA 4PWDA 5CZXA 3OLBA 4H0TB 3R7BB 4ZVHA 3OW2M 2H4WB 4NLVA 2ROEA 3UQSA 2E5JA 1VIOA 3IS9A 3ATUA 3D68A 5GAEI 4BRQA 4CTAB 4BLGA 3MPUB 2ZVSA 1M5HA 1JLQB 3MK6A 4B02A 4U7UK 3N4PA 4DV1K 3VHQA 4PL7A 1JJ2M 2VBXA 3LZJA 1S9EB 4DR1K 2EXUA 1SH3A 4KHPK 3QGPA 2MYFA 3BS9A 2NRTA 3IRXA 3CD0A 4X66K 4BE1A 3QMQA 2I5JB 1TUVA 2H4YB 5CCLA 4CBUA 3QJLA 2GMHA 4NRUA 3NMUA 4HUGA 4E7LA 1UWAA 1YVFA 2YX4A 4R0EA 4QR0A 3EXYA 2DHHA 1X5SA 2P9NA 2EK6A 3HVWA 2F63A 4F4KA 2JEJA 1F2GA 3OJSA 5C42A 1AA1B 1FESA 1YF5L 4WFNL 2F4VF 3SZ2A 2BA9A 1EP4A 3SSSA 4FL9A 4B3RF 1FK9A 2E2PA 3U3GA 3NXZA 2L9WA 2AV5A 4HYKA 5JUMA 4UZBA 3IG1B 2NPFA 1S97A 2CPDA 3VEOA 4HHJA 4NXNJ 3OLAA 4OYIA 3O9QA 3OYBA 3IGVA 3E01A 3SI8A 1HR0F 3AVMA 1Y11A 3KDOA 2UV8A 2ITGA 1MWQA 3CC2S 4LFAJ 3PIPQ 1VHFA 4LF5J 1K73T 3RAXA 2ZQBA 4V19S 2VJUA 2AEFA 1OY9A 4DR6F 1YJWS 1Y64A 4EFAC 2KW4A 2BH1A 4NMLA 3HFZB 1S48A 2ZWOA 3TA0A 2Z1IA 2WHOA 1RE1B 3QWPA 4M5MA 4URQU 2VJVA 1HI8A 3IMQJ 3OYEA 4ED8A 4CJ4A 4M7YA 1XTZA 4RW7B 4BC2A 5HQLA 1N4LA 2B6AA 2IMOA 5KFHA 3DRSB 4PYDA 4M5NA 4ID5A 4LT6A 3NBPA 3P96A 5K5MA 2HHQA 3RR7A 1BD6A 1AW0A 3R5BA 3SSQA 3BH6B 3DXMB 5HBMB 1FDNA 3S3MA 5RUBA 1S3XA 2IAJA 2J0WA 4DQPA 4LY7A 1NEEA 1LOTB 2I7NA 2YBVA 3DOLA 4M3WA 5T7LB 3A5LC 2KT5A 4RW6B 4I64A 1S1WA 4FWNA 3ZSWA 1EQ0A 1PYTA 1ZZNA 3KTQA 3IXQA 3BB5A 3BN4A 2C3OA 1VQ9S 3AGRA 1X9JA 2Q1NA 7FDRA 2DGUA 3VGTA 2HRUA 2MKIA 2LP4A 2V8VA 2FJWA 4QW8A 1C0MA 3TAPA 4RNNA 5HVFA 4KH4A 1S6UA 1OJ4A 5AQJA 3EPIA 2ROPA 1QZ6A 1R0AB 3OR1A 5KG6A 3MZIA 4DPWA 4L72B 4J91A 4DV0F 1S1VA 3IBFB 3LGNA 3L2VA 4J2BA 3HP9A 4HKQA 1GXUA 3QRQA 3NVKA 3CDUA 4DN0A 4YN3B 4JN4A 4DDFA 2R2RA 1BIZA 3MM6B 2AJ0A 3JYTB 1C0TA 3GIMA 3GWCA 4JV0A 2RH3A 3I82A 1FRHA 4KO0A 3VQ9A 5KFQA 3PO5A 1SC4B 5IM0B 1RTIA 3GE9A 3SSRA 1NGFA 1FNXH 4DX5A 4B08A 3LF0A 2GMJA 3A5NC 1JKHA 3I5BA 3AAWB 4NI2B 1D3WA 3PVXA 4OYWA 4DQIA 4FCYA 1RWPB 1K0TA 1YZ6A 5DM7Q 4WZQA 4EAHD 3MUTP 3TUPA 4LSNB 3SYZA 4GY2B 4CJSA 2W01A 3LWLA 3J7AP 1JLGA 4HTUA 4RNMA 2KJWA 4ISGA 3ELHA 1X5PA 3OYMA 1UAWA 3MGJA 3EKSA 1UW9A 1HIYA 2CUYA 1QY7A 3LGMA 4K4SA 2R2SA 2XYPB 3E8OA 1QJHA 2HHPA 3ONQA 3QT6A 1SJQA 2FPHX 2Q0UA 4EEYA 3ZT1A 2D3OR 3K2PA 2ZHOA 2O01C 3U3YA 4FWSA 3CGIA 1VRTA 3SBTA 5AXLA 2JLFA 2UXDK 2V7ZA 1IBLF 3J80O 2WZ1A 1UL3A 5HJYA 1UEKA 4DU8A 4H5RA 2FJEB 1U1RA 3MN7A 3AD8C 5J1NA 3NHGA 1NB2A 3ID8A 1RHRB 3LAKA 2Z2LA 1K9MT 2F65A 1ZPVA 5E3QA 3HT0A 3T41A 3T1HK 1W2BR 3KLHB 3P4UB 1Q82O 3P3DA 2CJKA 5J1PA 1B99A 3GV8B 1B0VA 1NNDA 4GKKK 2UZAA 1R89A 5AQXA 4QWAA 1WELA 4CIEA 4AD6A 1FXRA 3TEGA 2LA4A 1SS6A 3TWHA 3T3FA 3D2EB 1B9FA 2RDJA 1JQGA 1X1PA 1R8PA 5KG4A 4Y65A 4KR0B 4DL4A 1QAIA 3HPOA 3A8KA 2OUGA 4DUZF 4YOWA 2F96A 3VQAA 3U1NA 4O3SA 4N5SA 3PFEA 4AE5A 4RWTA 3VQ6A 4WTYA 5D78A 4JS4A 5CY4A 1QVFR 4Q0BB 1YITS 2KFYA 3VPZA 2B56A 4YNQA 3CPEA 3OS1A 4Q5VA 1WC5A 4L73A 3CFPA 1SUQA 1GLJO 3AA4A 3C94A 2E7XA 1G4CA 3RUBL 5D4OA 2XHCA 2ZHAA 3MMJA 2IPOB 2E2OA 4PXDA 3WQTA 3UN2A 4Y0FA 3VAGA 3QT8A 3LTOA 2R8JA 3MPDA 4LF9F 2CYYA 1L3SA 1J5EK 1F2HA 1R3NA 2YY3A 3GR1A 6FD1A 3VA0A 4CJWA 1NGEA 1VOMA 5A8RA 3O1LA 1WUUA 3CCZA 3BKTA 4OYOA 4C98A 4D3HA 3G6EN 5KFAA 2IC3B 2EBEA 4M45A 3NH1A 2NRVA 2P9IA 3AA9A 1BQMA 1RXOB 1M1GA 2P9LB 3DI6B 3S6EA 4WIQA 5DGAA 1IKXA 2V2QA 5LMUJ 3QGGA 2DNNA 3M8QB 2WB1D 4DR5K 1U09A 3C6UB 2WFBA 3M2VA 3Q24A 1LW0A 2RJZA 1P8GA 1VQ4N 3GJQB 4Y2MA 2ZDPA 5KFGA 3KLFA 2HBKA 4NYFA 3K2YA 1HKGA 3QLHB 4JKAA 1IJFB 1RADB 1JLBA 4C8OA 3QLHA 2ASJA 1V6HA 4QJVA 2AD9A 2ASOA 2HVEA 2GA7A 2VWKA 1PAUB 4NLXA 2DR5A 4WKRA 1CULB 1XNRJ 3TAMB 2UV8G 3GYXB 3Q2SC 3WZ0A 1JX4A 2B9YA 4BRKA 2GELA 3F0NA 2HVIA 2WVBA 4EK2A 2W2QP 2UVUA 5C2DA 1X4AA 5G4DA 2CQIA 3NH0A 4HH0A 4CFDA 1F9FA 3VAJA 2DHSA 3WIVA 3W66A 1NMDA 3U1LA 4I7FB 4FP9A 3ZTSA 4F3QA 2D1KA 4Y1CA 4RU2A 5BR9A 2NNWA 2W2NP 2KG1A 4YOEA 2WVEA 3M3ZA 3PFOA 4GVBB 2QXLA 3BF1A 4JKEA 2DY1A 5LSLA 8ATCB 4I69A 3CTRA 3LO3A 3JQMA 3CCMN 1WF0A 4K2XA 1HBNA 3HD2A 8RUCA 4DV0J 5FPDA 1PGZA 3CJ3A 3DOLB 4J7CA 4WFBQ 4FLVA 5A76A 5LXRA 3FSXA 3BPSP 5JICA 1SB6A 3HPGA 4RU9A 4E2FB 3G86A 1OWXA 3LP2A 3OY9A 1NWKA 4DTRA 4BRMA 1UCNA 3ZT0A 4DEZA 2FZCB 3D0HE 1L3KA 5BR8J 4ZVSB 4DHVA 1X9MA 4NZ6A 3AD9C 4LSLA 3WIUA 1TL7B 3VGSA 1M5OC 2QT7A 4ELUA 5EGYA 4CTAA 2KU7A 2EPIA 3SV3A 2YNIA 4ECRA 3HFVA 2I9SA 4PPZA 1R8CA 2DJWA 2GW8A 5EVZA 4ZHRA 2E4LA 2O8BB 2XSFA 4ZIWA 1V9OA 3QGHA 2V7YA 4KGXB 2E66A 3K8WA 2JLGA 1RGIA 1HNWF 1RWOB 4H0XB 2Z8QA 4CWBA 3MCAB 2Q3SA 2QL7B 4M5GA 2IRUA 4ZLLA 3PNIA 5AQRA 5F8NA 4WU3A 4Y2CA 2YVSA 2GV1A 4W5RA 1PG5B 3V9ZA 2DTJA 4X62J 2G8IA 2BOAA 4HHTA 4JHDA 1HFEL 3J81U 3RG6A 3A3OB 4ZVGA 1V3SA 2LEPA 1P8ZA 4KHUA 2DGTA 3R2CJ 4YS2A 4WP3A 5THWA 1O5JA 4GO7X 5LMUK 1RHQB 3NF9A 5C2CA 1HR0J 3G8SA 1HLWA 2RF2B 4DR3F 2EFOA 1OQ6A 4JD2A 2UU9F 3D6FB 1IBMK 2ZH4A 4LF1A 1H2UX 5GIOA 2NZ4A 3TJ8A 3R1XA 2VG7A 1FDBA 1WHXA 1NDKA 1QQNA 1KQSM 4J5OA 1V4SA 1ZETA 3Q8QB 4IH7A 3C6TA 3I5AA 2Z30B 3K8VA 2N7CA 3V6DB 3JS9A 3M6WA 2NRRA 3CERA 2HK3A 4L74A 3L4BC 2G8HA 4IDKB 3CD6N 1WOPA 1HKCA 3DDIA 5H9FK 5HLFB 1NZ8A 3Q83A 4FWRA 4X64K 3O3LA 5LL6Z 3H2LA 4FPIA 1SJ4P 2VHGA 3NGDA 4FSVA 1KVCA 3L7PA 4HI1A 5J2QA 1G15A 1BHLA 2X1BA 4GV9A 1HARA 4TLQA 1K8KA 2YPYA 4CJPA 1TKXA 1J5OA 1TAUA 2RS8A 1WJ9A 3UVJB 1IKYB 3B4MA 3N4WA 4IG0A 3VENA 3MFHA 1TUUA 4CEOA 1WDDA 4LH4A 1AZSA 4CIOA 4B9MA 5FRMA 4U67Q 3KK2B 1ZH5A 1NK4A 3CMEN 3FZMA 3G6VA 1DT9A 2V50A 4G1IA 2W9CA 4DR4K 5GAEU 4CEEA 4CLWA 4OZ5A 1R0AA 4F8RA 3V6JA 4ECUA 1G7CB 4CZEA 5E3CA 3HX9A 4DR6K 4K5SA 3CJBA 2A42A 1P90A 1KHVA 3LDPA 4NZ0A 2H3GX 2QEXN 2F9WA 4OX9J 2EC0A 4JBCA 1UWBB 2HBRB 3VR1A 4RUAA 3RAQA 1TYQB 3WHIA 4GVEA 4MYUA 2ASPA 1VQNN 1PILA 3L6QA 2J7WA 4E1JA 4USMA 1NDCA 3HHLD 3AY0A 2MMYA 1IM6A 1WB9A 2D1CA 4ZVTB 2XWYA 3DLEA 4ZS6A 2W1BA 1QD1A 3L4QA 3R5DA 2DVIA 2W7PA 3NMAA 1Y4ZB 1XWLA 1RYSA 1NRKA 4KKOA 1JLGB 1M1HA 1ZZFA 4OGCA 4LUBA 3DMJB 1PJ5A 1KQGB 4E7JA 4BRPA 2RDIA 5KG0A 2HHXA 1N0UA 4OI0A 2AZ3A 5I3UA 5IT9O 4WQ4A 1MROB 5GIPA 2NUBA 4OI2A 2DHGA 2A3JA 4LFAF 3D1OA 1QM9A 3AARA 2QWRA 5GAGP 5M1OA 5HL7Q 4DV4K 1AROP 1M0SA 1NM2A 1RT5A 3KJQB 4K8RA 3SK3A 4ZVEA 1EAYC 4LC9B 2IBOA 1R8HA 3KK3A 1IM4A 3CCSN 1RDAA 2O8DB 3HO1A 3ZZ0A 3T6BA 4XO0A 1H38A 3G82B 4CHYA 1RBTA 2GJIA 1KFSA 2O8DA 1XHXA 2F4VJ 2BBEA 2KL8A 4RW8B 1ROFA 3M8RA 2OP5A 2V52B 3MXJA 4ED7A 2P1JA 5DM6L 2FC0A 3OYHA 1CJVB 4YOVA 3OFFA 2FSJA 2HKEA 4JV5J 4CGGA 1HRHA 3BF4A 2H9ZA 4AHTA 3G9CA 4BR7A 3TJ9A 1QE1A 2EK1A 4M3RA 1M5KC 3CCTA 1SZ2A 1IBMF 3KKFA 4K2JA 4K7QA 3OUYB 4KFBA 2NREA 1RAHB 1YI2N 1RDWX 1H6KX 2MY7A 4ZPCA 4LFCK 5EUHA 2Q66A 3C14A 3DJCA 1FJCA 1XMQK 5D4LA 2N3LA 2OGUA 3CB4A 2PA8D 4WCEL 2WOMA 3A2FA 3CFOA 1LWEA 4Q0BA 4JV1A 4IUFA 2JH3A 4KGVB 4ZVQB 1NJIO 3B82A 1B0PA 4O23A 4OYPA 4A59A 3SI6A 4O3QA 2NRXA 3QO9B 4X62K 3G4SN 3H0PA 3NGKA 1RWUA 3AO2A 3TX8A 1SIZA 2FLNA 3FJ2A 1QTMA 3N6MA 4JI0J 4CLFA 2UUBK 2B51A 3ILOA 1WSEA 1REVA 3H1VX 1H7WA 2P9PB 3PCOB 2MQNA 2J5AA 1RBLA 2DR7A 3PKYA 2YQ1A 4O3RA 4FK0A 3WQPA 1NHVA 3DLKA 3RTVA 1VC0A 1N32J 2IY5B 1I39A 2KHOA 4K4VA 3QETA 3J80Y 1HBOA 2ZOGA 3IWLA 4X4QA 3CJCA 5DZ6A 4FS2A 2QE5A 1IBKK 1U26A 1DFDA 1T94A 2PMZD 5JJBA 3CNQP 4DL2A 4PABA 2J6SA 5HOOA 3FNNA 1YJ9S 3WXJA 4CH7A 2VG6B 2UVVA 3PJ9A 3U6FA 3UIQA 2PYJA 1U4BA 4B1YB 2MTLA 4JI6F 4PUOA 2Q6CA 1DGKN 2BUNA 5HVHA 5J2PA 2BACA 4TNOA 3U8XA 1ICEB 2AKWB 2HMIB 4KH0B 1NOYA 5LMNJ 4F2RA 2RQCA 1RDDA 2JC0A 4LF4F 2BJ7A 4X64J 4Y34A 2FVSA 4PPDA 4LF7J 3UR0A 1RP5A 2CGJA 4E3SA 4ZCKA 1LK7A 1NUEA 1PJ6A 1RNHA 4NEYA 2R7WA 2K1RA 4NO7A 2L3MA 4DG1A 4C2MA 3N4QA 1WBBA 3NGUA 3DU6A 2L41A 3EXCX 3FZBA 2HNDA 3Q8SB 1BG3A 3LPTA 4L75A 3S1TA 4BVOA 2IA6A 2PIIA 4PAAA 4B9TA 4CERA 1MG7A 4KH6A 2GC8A 2IM0A 2H48B 4DCOB 4JI8F 2MSSA 1O8BA 3PSIA 2KYXA 5T41A 1YRXA 2I7PA 4BRCA 4RW7A 1N36J 4BHQA 4YHHF 2ZKTA 2DNQA 3DLGB 2DRBA 2M70A 2YKQA 2HK2A 2J7UA 4GKKJ 3MXMA 1WSJA 3WQUA 3US5A 3EN9A 3BQ1A 2E88A 3FUYA 2DIUA 2V5HG 3L09A 1OMSA 2OD4A 5LSOA 2CQBA 1ACMB 4I2PA 2W9BA 3L4IA 4GVBA 3KNAA 1N5VA 2Z57B 3QZ7A 3D45A 5TKYA 2MKKA 2VASA 4CHPA 4DV4F 2A18A 3FZLA 3EE8A 1FRXA 3DDKA 4TXSA 3SJJA 4OPJA 3S3OA 2ZWPA 3LPEA 1VQON 2Q2RA 1WHWA 2CQHA 2ATCB 3VEXA 3B6PA 3V6KA 1EIYB 1JLCA 5KG7A 2V4RA 3QDKA 3KG1A 4AXJA 1Y3KA 3P5TL 4B3OA 3I0RA 1JLEA 2VIHA 3KUEA 4NLUA 4J2EA 3FMBA 3GB0A 2M8HA 4Q45A 2DXDA 4PWWA 2RDDA 2EFVA 3R97A 1U1MA 1SKWA 4BE2A 1DEJA 1VYAA 4ECTA 1W7AA 4K4WA 1Q5YA 1RHJB 3R6LB 1T05B 7AT1B 4KI6A 1HW9A 4H4KC 2HBYB 1U1NA 2NRZA 3ZXWA 4DV3K 1QAXA 2DNZA 1NJWA 3A1YG 5K8NA 2YWEA 3DXKB 3OVAA 4NLPA 5EY4A 2W7AA 4BC7A 5D3GA 1CBKA 4DSLA 3AVKA 1RUSA 5IM0A 4DV0K 4H5VA 4A8MP 2KXNB 4ICLA 2JL9A 2I1RA 3TI0A 1IWGA 1CLFA 3AOCA 3LDLA 2XMTA 4WE1A 1FA0A 4LF2A 2HZCA 4FJLA 2C3YA 1U24A 3VTIA 2Q31A 4PKHA 4CHQA 2KT3A 1UETA 4FYWB 2BW2A 1GT8A 2QW9A 4JK7A 1RDRA 1HW8A 4CEFA 5FDLA 4FKXA 1PC4A 2ZBIA 1RACB 3DYAB 4NXNF 2KTQA 1QVFM 2WC9A 2UUBF 1SH0A 2GIQA 4CEQA 4DU3A 5B8HA 5EX0A 1S99A 2DIVA 4LR9A 1NBWA 2HFUA 1LXJA 3I8DA 1MLAA 3NCIA 1GMWD 1WTBA 3NS5A 4O3PA 4LF7K 1AUSL 3VEZA 3C0BA 3HI9A 5IT4A 4DR7K 3VF0B 1H3DA 5G0RB 1KNZA 2VFVA 2D3O1 3CYMA 3H25A 5GAGU 4AM6A 5ETVA 3HMJG 5ETSA 3BGRB 5K20B 4LFBJ 5BPNA 1RAGB 1WNEA 2M7SA 3DLBA 4G1PA 3JTOA 3U7JA 1ZM4A 4M3UA 4KHPJ 3HBTA 5HQMA 1RCOB 4TY8B 4DMZA 2MEWA 2HF4A 3W8PA 1U48A 1KQFB 1KLMB 2PD1A 1YSJA 4Q8EA 2CQDA 4CZHA 2HQIA 1S0NA 3S3NA 2GO8A 1B0TA 4OJRA 4IO9L 3NE6A 4A8WA 2AJFE 3O4WA 2R42A 2HSEB 1YJNN 2QWMA 4DI6A 1VQOS 3L7UA 2Z4PA 1VQLS 3R6MA 3W60A 5BXIA 2OPRB 4C23A 1TKZB 3CF5Q 3ZZYA 2WVFA 1OS5A 3FE1A 4QS8A 3KLGB 1OSDA 1ZBLA 4C8KA 3OYJA 2OPRA 2AYMA 3ZX0A 2RHKA 3NGZA 1MWZA 4FLWA 2CVIA 4DR3K 3KLEB 4FLUA 4MK7A 4BRNA 5KT5A 3L3UA 3G2XA 2COLA 2ZHBA 2ZVIA 4URGA 2Y3YA 3OQ2A 3FC9A 5DDRC 2QIFA 5LY3A 2RE2A 1F1BB 2PE8A 1HBOB 3AAPA 5MLCQ 5F8LA 4NXMF 2X7IA 4J9SA 4Z37A 3EPGA 3D4JA 4QR1A 2HGMA 1RLDA 3AJ2A 3ZSZA 1Y7PA 3GONA 1Q18A 2HAIA 4FLZA 4BC5A 2FB0A 2R8KA 3NCPA 4O4GA 4FJIA 3ALYA 2VWBA 1EKEA 2WTFA 1MROA 4YB1P 2FUG9 3TJAA 1U25A 4PXEA 4LRDA 4DV6J 2B7BB 2QWQA 1BA0A 5KFLA 4IFVB 4KGMA 1TL5A 1R6VA 3KKRA 3V1RA 1XMOK 1URRA 3WXIA 1NGAA 3Q7BA 3RR8A 1RBOB 3HULA 3GV5B 4X64F 1YX2A 1S9GB 2J9EA 3CO9A 5BJRA 3OXLA 2QGFB 1JLBB 3KNGA 4M5KA 3BZKA 3J81O 4MLHA 4CD3A 2J9DE 4NXMK 2BVZA 3H5YA 3VA3A 4DUYK 1TELA 1OKJA 4FJGA 3OTBA 1JMTA 5GADI 4CYUA 3TANA 1JLAA 2E7WA 1F60B 5B0EA 1SI9A 1N34J 3PX0A 3LP3A 4GV3A 2HWIA 3H8YA 3GFHA 3DHWC 1UP1A 4OI3A 2QA4N 2V8PA 4EUVA 2ZH9A 4DTMA 4H4KA 2GWKA 1YT3A 1B70B 1EX4A 4JI7K 2J8AA 4MMOA 5CA5A 3LWMA 3ENBA 4H4MB 2WCXA 1N32F 2OPPA 5A0YA 3CJRA 3DM2B 2XY6A 4HVJA 2LQJA 4FN5A 4ZITA 2CNKB 3HL8A 3G6ES 1MMNA 5ETNA 1O6XA 1TK5A 3F2KA 3SQ0A 2R7OA 3W5XA 1VQYA 3TAEA 3RSEB 2WK4A 4FJHA 2G4BA 1EQMA 1R8BA 4N8NA 4EFHA 4DR7F 4JYAF 5LL6d 2EX3A 3CWJA 4BC9A 4M63A 4E19A 3QBWA 2FSKA 3ILIA 5AZIA 1FJEB 1Q8BA 3KYLA 2Q79A 2QKKA 3H40A 1VQ9N 4JI4J 2F4VK 2E2NA 3CCJS 4ZLJA 2B9EA 2C2DA 4A5AA 1S72S 1B7FA 3KDNA 2HFSA 4Z4IA 3V6HA 3T1HJ 2ZH8A 2BJ3A 4X4PA 2V69A 1AFJA 3OD2A 4TKTA 5AQQA 5JMVA 1RTHA 1JLFB 4M5DA 2O3DA 1RWXB 1RA6A 4CGIA 1YTAA 3M1FA 4ZVUB 4KB0A 1TMMA 1JJCB 3TTFA 2P5GA 3E66A 3VGVA 2VG5A 1NK9A 1J5EF 3SAHA 5T7BA 3WDOA 1YK9A 2E1MC 4HTIA 4RNOA 4DV2J 1NK6A 3IKMA 4F26A 2CJXB 2WSCC 4B9UA 2X51A 2CRLA 4GW6A 3D2FA 1RT1A 1HI0P 2XYHB 5MLCV 2O8CA 3PW5A 1RKJA 2BRLA 1W26A 1WG4A 2GFFA 2RQ4A 5H9EJ 5BYQA 1O0PA 4XDCA 1IKVB 1QQMA 1NSPA 1G6BA 4B3SJ 3OFEA 4PUOB 2YWHA 1LW2A 4FYXB 4XK8C 3FZ2A 3EX7B 3JSYA 3O9SA 4GMJB 4DR2F 4FBUA 4Z4CA 4QBUA 4WKYA 3HVRA 1PAEX 3OTOJ 2RRAA 4KTQA 4W5NA 1FJGF 1NK7A 3DGPB 4X4TA 5BPLA 4W92B 1ZC6A 4WCEQ 2NZTA 5DGBA 1BO5O 1MDUB 2OA8A 3HOSA 2YH0A 2Q6BA 4OHXA 1FT8A 3QNWB 2PFUA 5KT2A 5M2RA 2GHPA 2ILZA 3FRYA 2QM1A 3Q8PB 4IDKA 1S1XA 1SPBP 4HEA9 4Z4GA 4QS9A 4HHHA 1OYEA 3B4DA 3KHYA 2QWOA 2MQLA 4AHVA 1NG9A 2LQ8A 1U6BA 2KT2A 5J1EA 3DRSA 3OL9A 5CQGA 4Q43A 2K2PA 1B4SA 1U8WA 3HRGA 1TP7A 1IXKA 3JSMA 1J6ZA 5DDQC 1RSCA 3SCJE 4RBUA 4BVPA 3U9DA 2V9KA 3GG0A 1IKYA 1PYOB 2R7VA 3EE9A 4LFCJ 2G2ZA 2PI5A 1KN6A 3KHHA 2IYIA 3NOGA 3CCRN 1UZHA 2CPJA 3CCVN 1VQ7N 4MT1A 5T7LA 2XMMA 5FPEA 1S1UA 2QFIA 5K9FA 1WSRA 4DZ6A 2KFZA 3UKRA 3I8BA 2Q0RA 1HWLA 3CCLN 1N33K 3BY5A 3BF3A 4KI4A 1WSFA 1X8DA 4G9ZA 3AQPA 4K42A 4H03B 4Z2XA 1DRZA 2CH5A 5KG5A 3ZTPA 3AXMA 2ZE2B 1CLQA 4N7TA 1XHZA 3M5RA 5D0GA 4ZTFA 2AIRB 3MD3A 2MLXA 4RPFA 4OZ0A 3TR8A 1TL1B 5AXKA 2B8QA 1TYQA 2WUSA 2VH7A 2N7YA 2ZJPL 3ENQA 2CNOB 1FXDA 1R31A 1VHXA 1BY9A 2HFNA 1YJWN 5EDWA 3W2WA 3CMES 5DZ7A 3F9MA 2O8BA 4LR8A 4LRBA 3MPVA 5B0DA 4RW9A 1Q9YA 2RKIB 5ITHA 3ZT3A 1T6CA 3RAMA 3GG4A 3GIJA 3MM6A 4JI2K 1P1LA 3ILLA 1YTUA 4UQTA 1SV5B 3TAGA 3H4BA 5DLGA 3PZPA 1SXLA 5E3AA 3O9UA 4BQZA 3QJPA 3ULEB 4GV6A 4PRFA 3LOUA 1IR2A 3T1YK 2IBKA 3ULEA 2KRBA 5HMZA 4CEZA 5E26A 4ILLA 5KGWA 2MQMA 2HBJA 1RT5B 4CGJA 2CNLB 3CPWM 2QX0A 1YG0A 3HHEA 2FVQA 1Z2ZA 4JI7J 2RU3A 1UMJA 2WBRA 1DTTA 1YI2S 2F7TA 4QWDA 3WEEA 4YR3A 3ZZZA 2ILYA 2BR0A 4CJUA 1PSDA 1RT4B 1HNZK 4B3SK 3U4LA 5GMKa 3AO3A 4F4WA 3WEEB 2OTJS 3N5BA 5LXYA 4NZ7A 2V2ZA 3T5HA 3QRRA 4W5OA 4Z7CA 1RKIA 3C46A 4KHWA 2M4MA 1ZBTA 2KDOA 3KJVA 5IT9Y 4ECZA 2GJ2A 1U1LA 1K8AO 1TZ0A 3GZ7A 4W90B 4PCQA 1NSKL 4DQQA 4M41A 4LMZA 3D5MA 5I3PA 4BG8A 5HRRA 4OPKA 3D66A 4E1NA 4FJXA 1E6VB 5B0GA 3BKUA 1Q5VA 2DR8A 3CJ4A 3RGIA 3KXDA 2MQ8A 2P9UB 1XI1A 1Z2LA 4X65F 3UCUP 2XI3A 1RT6A 2PZSA 5AQYA 1VBKA 1HKAA 4AILC 3N01A 4F36A 4A48A 3E1YA 3TARA 4OV1A 1VFJA 5IZHA 2ZM6F 5C5JA 3PR5B 3C6AA 2V6AA 1REGX 1VS3A 4J9PA 3FZHA 3GR0A 3ZSYA 3TRGA 1VQ5S 1RTDB 4FOEA 3KWIA 5MAOA 4XAKA 1BE4A 4CJ3A 2D3UA 4IFYA 3MI7X 4BR0A 1Y00A 3GV7B 2QTDA 2O66A 3PG9A 3FFIA 4J9NA 2PGCA 2KHDA 4UT4A 3EMTA 4CO3A 2XULA 1M1KT 3L7OA 4AL5A 1SQGA 1LWXA 4ZK7M 3NEKA 1NPRA 3VQSA 3KHLA 5B0AA 3HT3A 4JI1J 4LRCA 5KFCA 3OHBA 1GLCG 3M8PA 5A8KB 3MM7A 5A6PA 4QW9A 3LDNA 1S6QB 5A6WA 2R7TA 3R9PA 3CJTA 1F5CA 1X3MA 1VRUB 4DTPA 2CWXA 3EICA 4XH4A 3BSNA 3R5AA 3R5CA 4DV5K 4ZPBA 5FJ4A 3GCWP 3CJ0A 3OTOK 3TZYA 5CYQB 4WU2A 5DLFA 4W4MA 1ZBFA 2OEKA 5KFFA 2OFHX 4CO0A 1RT3A 2ZJQL 2XZWA 2WONA 1S0VA 1VK8A 2ZH7A 4WF9Q 1F5BA 3TP2A 2BE9B 4BWJA 1TUYA 5LJWA 3NGIA 2J7KA 1BQMB 2PSZA 4OLBA 3M8SA 3AA2A 4M3TA 3SUQA 2V2VA 5C2FA 4BR2A 3DMJA 3DU5A 2ZUGA 3NCQA 4FWMA 2XMKA 3HOTA 2J9DA 2EWSA 1OH6A 2YNGA 1LW0B 3EZWA 2OHDA 4B9SA 1IVZA 4EYIB 1BQNB 2FHMA 4NLCA 4Z7YA 2E1CA 4EMDA 1EETA 1KEKA 2BQUA 4LR7A 5LSRA 1VSJA 3X3UA 4DV3J 3W3DA 5E33A 3THYB 1AB8A 4CO2A 2F5GA 4RJVA 4JI2F 1XERA 4MIWA 2B43A 1NGIA 2KYZA 3M2RA 1S9GA 2MQQA 5AFUH 2RHSB 4P10A 3BGFA 4K25A 2HNDB 3W64A 3OVNA 1UKUA 3DLRA 3A8EA 2HMPA 4RW8A 3CE8A 1N33J 5KFPA 1WN7A 1KKHA 4EWTA 1TR0A 3B54A 3CC4S 4OZ3A 5FRNA 4NYZA 2DFEA 1RTJA 4NLYA 5BN9A 5HMYA 5HQ8A 3IWNC 4LF8F 4CH0S 4CVNE 1KAXA 3GIIA 4X2BA 4C8YA 3OYIA 4RR5A 3ZNJ1 2C42A 4OYMA 1UVNA 2D0OA 3B6OA 4LF9J 4FZYA 1XR6A 3MOZA 4NEZA 4P72A 4IG3A 2DGXA 3R3LA 3RVCA 4C97A 1JCGA 2D41A 4OJGA 1T9YA 1XQSC 1OH5A 1EJ7L 4OGEA 2BKNA 2YKNB 2DNGA 3HZEA 3SLCA 2UYTA 4N56A 4H8KA 3OYLA 4WZMA 1HBMA 2YKNA 3PR4A 3MECA 3FCWA 2J0SD 3THXB 4DFPA 3TPQA 3OR1B 4AQYJ 3I55N 1SBRA 2VV5A 2F4FA 1Q81T 4K0KJ 3OR2A 2DKOB 4MJKA 4Y00A 4BGAA 3GP9A 4DR1J 1ZBSA 2FHKA 1Q16B 3W2WB 4IRKA 2JWKA 3MX5A 1C1CA 2Y1LB 3KLVA 4FK4A 2LFVA 1WKLA 3JYTA 3CC7N 4ZVFA 2DY4A 1GNKA 1Y5IB 2CIMA 5B0CA 1HNVB 2P9KA 1P6TA 1VK3A 3Q89A 2YCHA 2CADA 4UY85 4NLBA 4ZJQA 3FVYA 2AHOB 2D3ZA 1KFDA 5AQGA 3K0SA 1IR1A 4CNYA 1WSGA 3D2FB 3GFXA 4FOIA 3DN9A 4JUZA 1I3OB 3QRPA 1NHUA 2AX1A 2XY5A 1D9FA 1GMUA 4CJFA 2KKZA 4Q8FA 2E5LJ 2QLJB 2YHBA 4DPOA 3RYLA 3J8AA 3UN5A 4DPUA 1U1PA 1VQ5N 3TZXA 4DTJA 1F3VA 3MM9A 4MAKA 3MM5B 4PQUA 2VOOA 2YHYA 2VG7B 2YWFA 2FLOA 1V5IB 2IFXA 4WP9A 1S0MA 4CT9A 2EEYA 1Q95G 2XMWA 2ZBCA 4PQUB 1OY8A 2JDJA 3E2EA 3RW7A 1Q9XA 3M6GA 4OJHA 2BQRA 2E5IA 4LIWA 3D1QA 1FNOA 1YTYA 4O44B 2GO9A 1TFYA 1EO1A 2VQEK 5M1QA 4IXCA 4FYVB 4DS4A 2DPIA 1NB7A 4YB5A 4JI0K 4DR4F 2P8IA 4ZOSA 1U47A 4DB3A 2OAUA 3KLHA 1SH2A 3DRXA 3VAFA 3N6NA 1SKRA 4OLAA 1QHTA 3EWGA 2VU5A 2B8PA 2HPUA 2IYGA 1D0EA 3DLHA 5B0BA 2XMVA 1YQHA 3OBIA 4USIA 3BO4A 4DUZK 3WC0A 2XHBA 3FQLA 4LF6F 4FM1A 1IG9A 3G8TA 3A3PB 4YY3K 3D7EO 2R4FA 2YHAA 5GADU 2E5HA 4CM2A 5A8WA 1QSLA 3NGTA 5F0UA 2IGIA 2CJBA 1AZSB 2HQGA 5HBMA 2ASDA 2UUAF 4M7XA 4OI6A 4LF9K 3UFCX 3H6EA 4PG7A 2DGSA 1CPZA 1SJRA 2IVOA 3UCZP 5ETRA 2CQCA 1WOOA 3HVAA 2AU0A 2FDNA 3KLGA 4IRDA 5AXNA 2DK2A 1IKWB 4AYBD 1T3OA 1HNXJ 2HFZA 5L9NA 3A12A 1L3TA 2UUAK 3O9RA 3VF6A 2OIHA 1WSVA 5IWAF 2IRXA 1RWKB 1BCMA 5HSPA 3AVBA 3FGUA 2AYBA 1X31C 3KIOA 2NRHA 3WBZA 2VA3A 2U1AA 1TKTB 4AM7A 1RAOA 1NM1A 2QA4S 4NA3A 3MEDA 3MXIA 4RW9B 1N8RT 4JKGB 2XEXA 4DPYA 3LP0B 3O1BA 1HHQA 2RT3A 1CSJA 2DTUA 3UCGA 5T14A 2F3JA 1WOSA 1FNMA 2HLUA 2IVNA 5AQOA 4BR5A 1RT7A 3O4QA 4DV7F 2XO7A 3QEXA 5D8HB 3HVTB 1I6JA 5CD4H 4IKFA 4M42A 1IKXB 4DLEA 5I42B 4RW4A 5EWFA 4UW2A 2AQ4A 5L46A 1BOTO 2KVQE 2ZZTA 3R5JB 3CXCM 3FRZA 3OL7A 4ATNA 4ALZA 5SZTA 1X0PA 4F67A 3KHGA 2Q3PA 3EDQB 3M2UA 4Z4FA 3KJNB 5H9FJ 5I3UB 2LU2A 3A5OC 1EKSA 4HTLA 4IFVA 5KFKA 1NK0A 1SL0A 1RABB 3UE2A 3M2RB 3SQ1A 3AQOA 3VQ7A 1DLOB 3O3GA 1X3NA 3VGLA 4C11B 4UY8T 2D0BA 4W98A 1FFWB 4NPOA 5AJ3J 2MZRA 2O4GA 1VRTB 1K1SA 3VEYA 3CSKA 3R5GA 1FWPA 2DHXA 3MCPA 5E5NA 4PHTX 2P9SB 1AFIA 1ZAWA 4ZTJA 3R2DJ 3OTCA 1Q4RA 4ED5A 2HHSA 2GWJA 1CJVA 2XTJP 2P9UA 3NDKA 4FLYA 3FSYA 4WBFA 2CQ0A 4QIFA 1WAJA 3F73A 3D2EA 2PI4A 1TV6B 1W2IA 5BN8A 3RWUA 4OHWA 1S4EA 2ITMA 2CGLA 2VKZG 2I38A 4FS1A 1FCAA 1KWMA 3UKUA 3TOQA 3K7RA 1B3TA 1UJ6A 3MD1A 3J81j 3PIPL 4OYXA 2F9JA 3QJJA 2E6LA 3MDFA 4QIWD 4OX8A 1FD8A 1F6TA 1GLDG 4OX7A 1C1BA 4K41A 3FFIB 4CF8A 3CJ1A 3CM6A 4I0WA 2DEIA 4ZJLA 3FEYB 1A6LA 3RRGA 3UDCA 2CQ3A 1LK5A 4ZHRB 2CQ2A 2OJ3A 1SQKA 2C3UA 4IYQA 2DHAA 2VWJA 4N47A 1FERA 3CJ7A 4MKYA 4BBYA 4DPTA 3MURP 1DAXA 2K06A 2VQFF 1S1TA 2H54B 4X4NA 1RTHB 4TLRA 4AFFA 1Q7YT 2BE2A 2AEMA 3PIOQ 4HUEA 4KB7A 1J2VA 2RD5C 2O1PA 1U6ZA 2Y9HA 2E6MA 2W7OA 4FNHA 4ANDA 3ZO7A 2FXUA 1XMOJ 1HNZF 3QICA 3DRRB 4ISEA 2APOA 3Q2TC 3T19A 3WX4A 3SQGA 1ZM9A 2IC3A 3V9SA 5HROB 3FEZA 2PAVA 3CMAN 3QFPA 5JVHL 4H5TA 2W40A 3I5CA 5L1KA 3BZQA 2UUCJ 5HMXA 1XQIA 1RU1A 1YBUA 4B3MJ 5AE1A 3T1YJ 4RX6A 1ZPWX 4DSFA 3KD5E 2CPHA 4Q44A 1Y5NB 3WNFA 2DPNA 1OIAA 3S41A 4F0KA 3VZIA 2AA4A 4TU8A 1LW2B 2EG2A 3VGUA 4DV7K 3BDPA 1BC6A 1U6FA 4JI1K 4CCHA 4ZDNA 1X4CA 3CPWR 2Z56B 5B08A 1CULA 2E9ZA 2G1HA 3SPYA 1BUPA 3OTEA 2WVCA 4BC4A 3J7YU 1K6YA 3VAMA 4UUXA 1NKEA 4JP8A 3PDNA 2FLPA 3VVUA 4CIFA 3THWB 1Z26A 3C66A 4FJNA 2M2BA 4CZJA 2LSNA 3LPUA 5KTQA 2GTDA 2BGGA 1GFWB 4DV3F 1RFQA 2YKMB 1NK8A 5HLFA 4CEBA 2JOQA 4WXOA 4P75A 4TSXA 1OYDA 2XSJA 1SKUB 3AAQA 2YKMA 1HD1A 2JEGA 5AQMA 1NK5A 4PR6A 3QZ8A 1ILYA 1RYRA 1RTJB 3PW0A 4K43A 1NGGA 4B3MF 4J9MA 3DLGA 2HHHF 2NYHA 3LDOA 1RDUA 2MGZA 2B6AB 3TABA 1G1XA 3MEGB 1WG5A 3QSYB 2B4JA 4P2XA 1N32K 2D74B 3NCRA 3THPA 3EZUA 2VL1A 3RZAA 3E9LA 2Z1GA 1P9YA 5K14A 2C1EB 2FSNA 3W2VB 4NXNK 4RNHA 2F9DA 3HHNB 3THXA 4B3TF 4RKUC 2FZKB 4UOCA 2LCWA