2BE2A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with r221239
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2be2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2be2A05
2XCAA 2ITGA 1JLCA 2C2RA 4DSJA 4CF9A 4DQSA 3IGNA 3IS9A 4I9LA 1RT6A 2DY4A 4F2SA 3MFHA 1GOCA 4R8UA 4J9NA 4JV2A 2E9RX 3MEDA 3SUOA 4DFJA 3QYYA 2VG5A 3S3NA 4PY5A 4KI6A 3OSNA 3BSOA 4TLRA 1S1XB 4E7JA 3HVTB 3H08A 3NMAA 2A1RA 4OL8A 3DRSA 1S1WA 4PWDB 5KFSA 1T8EA 3FFIB 4DTXA 2KQ2A 4RNNA 1JIHA 4DL3A 3UPFA 3AO4A 4I2PA 5KT4A 2X6NA 3NGDA 3FSIA 1D5AA 4M3WA 5I42B 1REVA 3H2LA 2HW3A 1W0HA 1LAWA 5KFVA 2JLEA 2QV6A 4ID5A 3AVMA 2YNHB 4NLXA 4KO0A 4TQRA 3KMQA 3DDKA 3C6TA 1JXBA 4NLQA 4YR3A 4CEEA 5JS1A 5K14A 5EWEA 4DL4A 4CGIA 4U7CA 1WN7A 2W42A 1C2PA 1FKPA 3HKWA 1S4FA 3QEVA 4O3QA 2ZKUA 2HHXA 2P5OA 1CZ9A 2FVCA 4RW8A 1RBRA 5KFMA 3G10A 1RTDA 1ZBUA 5KFFA 3PX4A 2E9TA 1SV5A 3NCIA 4F4XA 4KKOA 3HSTB 2IM3A 3D0PA 4FJ5A 4I7FA 1L3SA 3NFAA 3ISND 1TQLA 5J1EB 3N6LA 1JXLA 3VQCA 4IRDA 3QZ8A 1B9FA 3KK1B 4E0DA 1BQMB 5J2PB 3CFPA 4OGEA 4FLWA 4DQPA 1JXEA 2HHUA 1KLMB 2RKIB 5KG4A 3I8DA 3DM2B 4CK1A 1GX5A 2JC1A 4QWEA 4FJ9A 1S1UA 2R8KA 2IBKA 3LWMA 4ED7A 5KT5A 4Y2CA 3ITHA 3RBDA 4O44B 3ZSVA 5KG3A 4RUCA 4J9QA 1RNHA 4J9SA 4M3YA 1X9SA 1S9FA 4MFBB 2PZSA 3E51A 3KJVA 5HBMA 1B92A 3K59A 2YHBA 4DTSA 2IM0A 4ECTA 3HM9A 3RMAA 4CEBA 1Q9YA 4Q45A 1L3VA 1KCFA 4B9MA 3OYHA 2HHVA 1A5VA 4NLTA 1TL3A 4Y1DA 1WSGA 4MKBA 1CLQA 3NF7A 1XR6A 1S9GA 2YNFA 1BI4A 1U48A 3TWHA 5KG0A 3ZSYA 4F4KA 2HNZB 4AILC 4BDPA 4KFBB 1NK5A 4ELUA 5KFJA 3RTVA 3WNHA 3QGGA 1UOCA 4IRCA 2PYJA 4IKFA 1HPZA 4HCBA 1EKEA 4DL2A 4K4XA 4TQSA 3KKSA 1LWCA 4XIUA 1BIUA 2FBTA 3AO2A 3S3OA 3RRHA 4H4MA 1IKVA 5DGAA 3L3UA 3V6HA 4N47A 2AJQA 5F8HA 4B9TA 1FK9B 4KV8A 1S97A 3L2QA 3JYTB 1ZETA 2FVSA 1X9MA 4XPCA 3TQ1A 1RBVA 1TKZB 2WK4A 3OYAA 1Q8IA 1S48A 1RT4A 2GC8A 3ZSRA 1RYSA 4FJNA 1UWBA 3CG7A 4OKJA 4KBIA 2BANB 1HYSA 2E6MA 4ECRA 1GOBA 3CJ2A 3MTKA 1XHXA 3M9MB 4QPXA 2HHTA 3QEXA 3QLHA 1O1WA 1JKHB 5KFIA 3MXIA 2W9CA 3NDKA 3OS1A 4DL6A 1SL2A 3T5LA 3NH1A 4DL5A 2AWZA 2YKMA 1JL2A 3THVA 2AGQA 4KTZA 4FS1A 4DMNA 3T5JA 4IG0B 1TKXA 3GQCA 4RW4B 3F9KA 1VSFA 3PV8A 1BISA 2WB4A 1ASUA 2FBXA 4CGFA 4FK0A 4CJPA 1TVRA 4GC6A 1F21A 2YKNA 2EX3A 4JUZA 3OL8A 3CM6A 3QIDA 3MF5A 4YR0A 1EETB 4FVMA 3DMJA 3LZJA 1VSEA 3KNAA 2KFZA 1VRUA 4BDYA 1VK0A 4WFZA 3IAYA 4NLPA 5CZ1A 3DLEA 1C0MA 1ZBLA 1TKTB 3HHKA 2DPJA 4YFUA 3V6KA 3C6UB 4O3OA 3SPYA 2W9BA 3E01A 4CHPA 4ELTA 2YNIB 4DQRA 4H4OA 4ZHRB 2OZMA 1EP4A 4CJTA 3V9XA 2VG7A 1VRTA 4CEDA 4CF2A 4RZRA 4RW7B 3O3FA 1NK4A 1N5YA 1J5OB 1RTIB 3VQEA 2E9ZA 4LSNA 1S6QA 4ZVGA 3GILA 3KD1E 4C8NA 3H59A 3I0SB 4ZPDA 2B6AA 4Y2AA 2AX0A 4Z4HA 1WSJA 3LP1A 1S1VB 2F8EX 4KTWA 5I3UB 2WCXA 4B8CA 5KT6A 2D3UA 1WSHA 4O3RA 5DMRA 2I5JA 1SL0A 3RB0A 1JX4A 3QO9A 3BGRB 4HYKA 1LWFB 4IRKA 4CJLA 1FKOA 2OPRA 3V81B 4FW1A 3PW5A 4NLOA 2V4QA 4B9SA 5D3GB 4C8OA 2WTFA 2I1RA 1QSLA 5KFUA 3QIOA 4ZTFA 2R7YA 4ECWA 2BE2A 4E1NA 3OYDA 4N56A 4CFDA 4W5QA 4FW2A 4WE1B 3HVAA 1NKEA 1TV6B 1RT5A 4J9OA 4M3ZA 4URGA 3L3VA 1BQNB 1I3AA 5KRTA 5KG6A 2XO7A 4H54A 3QIPB 4O55A 1S49A 3OLBA 1LW2B 4ED6A 2XY6A 1JLEB 1YVFA 2Z1JA 1KVAA 3NGYA 4QCLA 4CE9A 5C42B 4CGDA 4Z4FA 1YTUA 3KHHA 3OS0A 3K58A 4FLZA 2AU0A 1JLBA 4WYLA 4IDKB 3T5KA 3VQ8A 3BQ2A 3OYKA 4CJ5A 3QESA 4KHYA 4M94A 1ASVA 3L2WA 4FJ7A 4BWJA 5HROB 4M42A 1JL1A 4KSEB 4NZ0A 1BCMA 4CGJA 2FJVA 4ED3A 1KFSA 4ELVA 4YP3A 2IMWP 3L8BA 3TAQA 3TAPA 4GMJB 4KHNA 1D9FA 4RW6B 4O3PA 3OL7A 3HP9A 3IRXB 3HJFA 1BIZA 2GV9A 3G6YA 3PW4A 4KREA 3V9ZA 4WFYA 1S1XA 1VSDA 3HVTA 4ZP7A 4PWDA 3FFIA 3Q8RB 3LANA 1TP7A 1WAJA 3DLGB 4DU4A 2DFFA 4BE2A 1IKXB 1VSJA 3WNFA 4HVJA 4QWDA 3U3YA 4ZPCA 5I42A 4YNQA 5HRPA 5KG1A 4DLGA 3NAHA 3NH2A 1JLGB 3MXMA 3DOLB 3NF6A 3BREA 2YNHA 1NOYA 2W8LA 2HHQA 1RDBA 4RNMA 3D45A 3SI8A 4QWCA 1C0TA 3V1QA 1NJWA 2RF2B 3GIKA 4CEAA 2OZSA 3BQ0A 4NLSA 4EBDA 1RDDA 2IS3A 5F8GA 4DS5A 4ED8A 3MEGA 4KPYA 2G8WA 4K4TA 4FK4A 2J6UA 2XY7A 2YNGB 2IJFA 5DK5A 4CECA 4TYAA 3V9WA 3H40A 4FJGA 1N4LA 3O4NA 4NCGA 3NE6A 1A5XA 1K6YA 3OYBA 5CYMB 2HVHA 4B8AB 3HPHA 5J1EA 2D0BA 2XY5A 3CO9A 1S1TB 3KK1A 4TY9A 4KHQA 4F8RA 1NK9A 2ZE2B 1ITGA 5J2PA 1KHVA 3SV4A 2FBYA 4CJFA 4DQIA 4BE1A 2RKIA 3DM2A 4B9NA 1S0NA 4FLXA 3TAEA 2WONB 5HP1B 4CEZA 3PO5A 3C94A 4O44A 1R0AB 2PYLA 2JEJA 4FBTA 3LDSA 1XWLA 4E19A 1S0MA 3RRGA 1HNIB 4MFBA 3PO4A 3QETA 4J9RA 1X9WA 3LALA 1QTMA 4DTMA 3N6MA 1FXXA 4CK2A 2FJWA 2VWKA 1IKYB 4CEFA 4NRTA 3SUNA 3V9SA 3U6FA 4JRPA 4F2RA 2KW4A 3SUQA 3M8PB 1W25A 4FM0A 3VQQA 3HPOA 4FM2A 3CDUA 5J2NA 2JEGA 4B08A 2FC0A 1T05B 1IKWB 3CDWA 1RDCA 3T3FA 4DG1B 1L3UA 1I39A 4DFKA 5EU7A 2OPQB 2HNZA 2G8KA 4KFBA 3ZCMA 5HRSA 1QS4A 5KFHA 4DSEA 2F8TA 4IFVB 1KRPA 4IR9A 1ZBHA 3H5XA 5F8NA 4HUGA 3RAXA 3SQ2A 1J9AA 4NYNA 4ZTJA 1W9HA 1SH2A 3ZT0A 3T1AA 2WRMA 3LZIA 1TK0A 4NLWA 2HWHA 3CJ4A 4EEYA 1FK9A 2OPSB 2IGIA 2PY5A 3JYTA 2OPPB 4EYIB 3RB3A 4O3SA 4FJXA 3DLBA 5L1IA 2NUBA 5JS2A 4AHVA 1JLFB 4PUOB 5KFZA 4DSKA 1TKZA 4CESA 3SNNA 4DSIA 1VSHA 4M45A 4N76A 1N56A 3OYCA 1EX4A 4BDZA 4Z4EA 1JLQB 3BSCA 5C24B 4CHYA 3O4QA 4FS2A 1U09A 4E3SA 4Z4IA 3TAMB 3NKYA 2BANA 2X78A 3EZUA 2XWYA 3VA0A 1RT7A 3ASMA 3QEWA 3PZPA 5KFEA 3MAQA 1SUQA 1S9EA 1JKHA 2D0CA 3AVFA 3OJUA 4OLBA 3V9UA 3KLIB 5KT2A 3VQ4A 2D0AA 2ASDA 1VSMA 4CJUA 3FRZA 3KIOA 3VQPA 4IG0A 4HHTA 4HUFA 4CIFA 2P51A 1HQUB 1DLOB 5DLFA 2WOMA 1Z4UA 1JLAB 4RG8A 4OJRA 3OHBA 4DEZA 3V6DB 3PW0A 1Y97A 3KHGA 4B9VA 5SZTA 4PA1A 2Y1IA 2D7SA 4LH5A 1EETA 4I2QB 3RR7A 4EBCA 4K4SA 3RB6A 3SFUA 5F9NA 1K1QA 4R5PA 2F96A 1TKTA 2G8IA 4K4VA 3C6UA 4C8KA 2XCPA 3PY8A 5L1JA 4ECVA 1C1CB 4Z4CA 1XC9A 2XHBA 2YV0X 4ZHRA 3DRPB 5F8IA 3QGHA 1DTQA 4Q44A 4RW7A 4IR1A 1BCOA 1J5OA 4IH7A 1RTIA 3H5YA 4BWMA 4CJWA 1TAUA 4Q8EA 3JSMB 4JS4A 4FJKA 4ID5B 3PR4A 4KO0B 2FLLA 3I0SA 3M8QB 4CJKA 2IAJB 1EXQA 2FLNA 2GBZA 3IGVA 3H4BA 3ZT1A 1C6VA 2HB5A 2C2EA 3CDEA 1RT1B 3OYFA 4DF4A 2F8SA 3KHRA 4IOBA 4KTQA 1TAQA 3QZ7A 1SL1A 4AH9A 2VA3A 5I3UA 2UUWA 1UAXA 2ZD1B 4CJEA 1RYRA 3NBPB 4RW8B 2XGQA 2XRIA 2BGGA 3BGRA 1S10A 4L8RB 3ISNC 3I5BA 5C5JA 3V81A 4TYBA 4QW9A 1RDAA 1NK8A 4K8XA 5D3GA 4CGHA 2Z1GA 1SH3A 4IH6A 3ZT3A 4EYHB 4ECUA 1RBSA 5HLFB 5T7BA 3LP0A 3G0ZA 3KLHB 4J9KA 1TGOA 1TV6A 2IM2A 4PQUB 4FXDA 4FLTA 3AO1A 5C25A 4ECSA 5L1LA 3WNEA 1BQNA 1LV5A 5KFRA 5KFBA 3UDLA 1X1PA 4FBUA 4URQU 1LW2A 4DSLA 2RDJA 2HVIA 1JLEA 4AHSA 4WXWA 3NGZA 1IM4A 4IG3B 5C42A 2CJQA 3KJVB 5FRNA 2UUTA 1NHVA 2DFEA 1TK5A 3KKRA 3ALYA 4NCBA 2QE5A 2O4IA 3K5NA 3NF9A 4O0IA 3NH0A 1IH7A 4MK8A 5KG5A 1LWEA 2R8IA 4F4ZA 3HK2A 5CYQB 2HMIA 5F8JA 3A2FA 5HROA 1UA1A 4O4GB 1S9GB 4NYZA 1T94A 3SI6A 1N6QA 4K4YA 1NJYA 3WNGA 4FJLA 1IG9A 4C8MA 4RW6A 4LQ3A 3FDSA 3KLEB 3KK2B 3RAQA 3IRXA 2RDIA 2ALZA 1RTJA 4DTJA 5KG2A 3KHLA 2QXFA 3BJYA 1QE1B 4M3TA 3TANA 4FJMA 1CXUA 5KFWA 2D5RA 2DPIA 1IKVB 5KFKA 4TXSA 1QHTA 3UQSA 3DLGA 4E7IA 1BGXT 4XO0A 1T03B 1IKXA 4M3RA 4ZP6A 1NK0A 1ZTWA 1LW0B 1HYZA 4LSLA 4TY8B 2HHWA 4WFXA 5EWFA 2C2DA 2XI2A 3K57A 1SKRA 1JLGA 5F9LA 5J2QB 3DOLA 5DGBA 4KB0A 5DG8A 4DTUA 3FQKA 1KHWA 1BL3A 2HNDB 3OYIA 1RBTA 5SWMA 2RF2A 1CSJA 5KFTA 1KFDA 4B3OA 3GIJA 4Q0BB 3PHEA 2VG6B 5KFDA 3VQSA 4M3XA 1BHLA 4ED2A 4AHCA 4CHOA 4CERA 2BRKA 3RWUA 2VWJA 3SZ2A 2YNGA 3GV5B 4G1QB 3LAKA 2ASLA 3CFRA 4ECYA 5CY4A 1C1BB 2RN2A 4Y1CA 4CIGA 5CYMA 3PR5B 4FLYA 2E6LA 4ICLB 4F4WA 3LP2A 1S1TA 3H5UA 3DLKA 3CVKA 5KFLA 3S3MA 2ZE2A 3OL9A 5KFOA 1SH0A 4CGGA 3SFGA 4AHTA 2X74A 4U6PA 3AO5A 2WONA 5HP1A 1S6PB 1R0AA 4K4ZA 3KLVA 1G15A 5KRSA 1CZBA 4FCYA 1VRUB 3EPGA 5J2MB 2ASJA 3HVWA 1HNIA 4RNOA 2UVRA 3TI0A 3NGIA 2B5JB 3NF8A 3OYEA 3O3GA 4KHUA 3DOKB 1IKYA 5FDLB 4RNHA 4Q43A 3EZ5A 3E01B 4FZZA 1ZYQA 3L2VA 3SUPA 1HJRA 3M8PA 1GX6A 3AVJA 3V6JA 5FRMA 2J6TA 2ETJA 4Z0UA 5L9XA 4FM1A 1HQEB 3MEEB 4DS4A 2W7OA 1T05A 1IKWA 4J9MA 5CZ2A 4DG1A 1L5UA 4DFPA 4RU9A 1XR5A 2OPQA 2B6AB 3CJ3A 4CEOA 3L2UA 1L3TA 2G8VA 4DF8A 2R2UA 4IFVA 1NNDA 3I5AA 3SV3A 3GYNA 3LP1B 3PW7A 4CJ3A 5KT3A 3IG1B 4FJJA 3KK3B 4JRQA 1HNVB 4DWIA 1NK7A 5KFYA 3AA4A 2BQ3A 3SYZA 5JXSA 3AVAA 2OPSA 1Z26A 1RCHA 1UA0A 2UVVA 4LD0A 4JV1A 1RAJA 1JLFA 2C28A 4KRFA 4PUOA 2FVQA 3DRRB 1NOZA 4EP5A 1A5WA 5F8MA 1J53A 3OY9A 4B9UA 4LH4A 3ZSZA 1JLQA 4F3TA 3B6PA 4W5RA 3CQ8A 5C24A 4CF8A 1YVUA 2KTQA 3GIIA 3TAFA 3QERA 3SJJA 3TAMA 3D5MA 3S9HA 1RT2B 1BQMA 3K2PA 2ATQA 1CXQA 4IBNA 3K5LA 1KLMA 4UQGA 4FZYA 3TARA 3KLGB 1KLNA 4RUAA 3HP6A 3KLIA 3ZSWA 2ZQBA 1DTTB 3RB4A 5DQGA 3QEIA 2IOCA 3F73A 1ZTTA 2DTUA 4EZ6A 4WXOA 3VQ6A 3AA3A 3TVKA 1HMVB 4MKAA 1HQUA 2O5DA 1DLOA 1LAVA 5F8LA 3AVGA 2RPIA 1JLAA 4BACA 3HYFA 3O3HA 2W8KA 2IA6A 3V6DA 3CIZA 4TN2A 3VQBA 4CJQA 3TAGA 1XI1A 1TL1B 3K5MA 4I2QA 2IM1A 2EC0A 2YHAA 3OL6A 2LSNA 3MR5A 4HKQA 4IH5A 4CJSA 1TK8A 4KAZA 3DI6B 2ILZA 4HTUA 3MECB 3AA5X 3V4IB 2IDOA 4FJHA 4E7LA 4ID1A 4EBEA 1NHUA 2HNYB 4LQ9A 1C1CA 2V0NA 3M8RA 2R8GA 4EO6A 4K8ZA 5JUMA 3DRPA 3I0RB 4RW9B 1C0UB 2Z1HA 3SPZA 3JSMA 1RTHB 2KZZA 4C8LA 2Y1JA 1NKBA 3KLFB 4N5SA 5KTQA 3DYAB 2BQRA 3M8QA 4CF0A 2IAJA 3VQDA 2CKWA 1MU2B 1C0TB 5EWGA 4K4UA 3T5HA 1RT1A 3CWJA 4EZ9A 4FLUA 1U49A 3HL8A 4OKEA 2ZD1A 1RA7A 3NBPA 2R2RA 4NLGA 4NRUA 3MEGB 4KB1A 1HARA 1YT3A 4E1MA 3VQAA 1RDRA 1RT3B 4NCGB 4KHRA 3RMCA 4J2DA 3BSAA 3M8SA 1QQCA 3PUFA 3ZSQA 5HLFA 4Y3CA 2XGPA 1VSIA 1XHZA 3UR0A 4DTPA 3KLHA 4XPEA 3ICLA 5DG9A 4CJRA 4PQUA 4MIBA 5DQIA 1RILA 4W5NA 3QGIA 3UIQA 1VSKA 2G8UA 4RW4A 2IC3B 4YR2A 4OGCA 3OHAA 1NKCA 1B9DA 4IFYB 1RA6A 2A1SA 4ZVHA 4K4WA 4FJ8A 2BDPA 5KFPA 1HRHA 1JLCB 2R2TA 1K1SA 3PW2A 2UVWA 3IS9B 1RT6B 3VN5A 5KFNA 2BR0A 1WSEA 4IG3A 1C1AA 4R8UB 2P1JA 3MEDB 2VG5B 5DG7A 2ATLA 2FVPA 4H8KA 3BDPA 4J2BA 3DLRA 3ZSXA 5KG7A 1WNEA 2XY8A 3LPTA 3DRSB 5CYQA 1S1WB 4CHNA 5J2NB 1RBUA 2XI3A 4O4GA 2YNIA 4AHRA 3OYLA 4O5BA 3H5SA 1KTQA 3PX6A 4I2PB 4HUEA 3N6NA 3G86A 3KLEA 1S0OA 3KK2A 4NCAA 1REVB 3PJXA 3P1GA 3Q8PB 3VQ5A 2G8FA 1QE1A 4O4RA 3GV8B 5HRRA 4B9LA 4RNFA 4X2BA 1QSYA 3C6TB 4KHWA 3K5OA 3VQ7A 2C22A 4DLEA 5K14B 4J2AA 3CM5A 4W5OA 3IN5A 3AVHA 1S1VA 1FKPB 2JC0A 1Z25A 4J9PA 1T03A 3OJSA 2AX1A 1T3NA 4OKKA 3V1OA 1RTDB 5DLGA 1LW0A 3AA2A 1LWFA 4TY8A 1SV5B 3EPIA 3OYNA 1NK6A 4KKOB 1D0EA 1XR7A 5J2QA 3KTQA 4YQWA 3TABA 3SCXA 4I7FB 5KFQA 4DTNA 4FZXC 1WNSA 4DTRA 2HNDA 3HVRA 4KHSA 3VA3A 4Y34A 2WHOA 1GOAA 3HT3A 3HXMA 5KFGA 4AHUA 4Q0BA 2UVUA 2VG6A 3PVXA 1RT7B 4WE1A 4ZVEA 2R8HA 2HAIA 1SUQB 4ZP8A 1S9EB 4KB7A 3MR2A 2QKBA 1S1UB 4MQ3A 2BRLA 4E7HA 2E4LA 3ITHB 4G1QA 3QIPA 4OVLA 2O4GA 2XC9A 1C1BA 4QWAA 3CYMA 2VA2A 4ICLA 4IQXA 5HBMB 4ZPAA 4ECZA 3QNNA 4JV0A 4E89A 2WOMB 3RBEA 3LWLA 2GUIA 4IDKA 5DQHA 3H98A 3FQLA 1TL3B 1SKSA 3AVLA 1S6PA 1ZBIA 2YNFB 3CJ5A 2Q3SA 3KOAA 1BI4B 4J2EA 3NAIA 4DTOA 5J2MA 3B6OA 3MFIA 3NL0A 3AVIA 3AVCA 4BE0A 4F3OA 1WLJA 4R5PB 4Z4GA 1U47A 3U3GA 2B5JA 2GIRA 3DOKA 1HPZB 5FDLA 4K50A 2FBVA 1LWCB 4GC7A 4KAIA 3T19A 2V4RA 4QWBA 4ZMMA 2IJNA 2FJXA 4H4MB 4R0EA 1DTQB 3M9NB 4URSA 3Q8SB 1HQEA 4CCHA 3MEEA 4KV8B 3EY1A 4GW6A 1HYVA 1ASWA 4ED1A 4I9QA 3EYZA 3AO3A 3AV9A 2P5GA 4FJIA 4MIAA 3MXJA 2FLPA 3OYGA 4Q5VA 3P5JA 3AVNA 4CHQA 3IG1A 3Q8QB 4CFAA 1RT4B 3KK3A 5KFXA 3BSNA 2X6SA 1HNVA 2J6SA 1UWBB 4CEQA 1KVCA 4ED0A 3V1RA 1KVBA 4ECQA 1VSLA 1HYSB 4M41A 2FVRA 3ZSOA 2HHSA 3QLHB 4MK9A 4YMEA 1QUVA 2W9CB 3DRRA 4QOZB 3QINA 3BQ1A 5EDWA 3LP0B 4F50A 3NAEA 2BQUA 2KZMA 4TSXA 3GV7B 4JLHA 3AVKA 2YKMB 4W5TA 3ZT2A 2EHGA 4KI4A 5EUHA 4CIEA 4DFMA 4CJVA 1WSIA 3OSPA 1TKXB 5C25B 1TKDA 2OYQA 2HWIA 1SKWA 2OA8A 1D1UA 1U45A 1RT2A 1U04A 4CJ4A 1MMLA 3LAMA 4DU1A 3MR3A 4O3NA 2W9AA 4JS5A 1TVRB 1OS5A 4G3IA 2YKNB 3KLGA 2D41A 2B43A 4EP4A 2G8HA 4DU3A 1DTTA 3DMJB 3RMDA 4OPJA 1NJZA 1KSPA 2R2SA 4QAGA 4E7KA 4KHMA 4FK2A 3DLEB 3LPUA 1LWEB 4OPKA 1U4BA 3OS2A 3D28A 4NLUA 2HMIB 2AQ4A 1HMVA 4WZQA 3DLHA 1YTAA 2W9BB 3HO1A 3RR8A 4Q8FA 4ZP9A 2QKKA 1N6QB 2QK9A 4FYDA 4H4OB 4J9LA 3KD5E 3VQ9A 1EP4B 4CFCA 1QAJA 1TL1A 2VG7B 1VRTB 3PJWA 1N5YB 1RTJB 1WSFA 5KGWA 4LSNB 4ZPBA 1S6QB 3DI6A 4QW8A 3MECA 3V4IA 3ULDA 4O0JA 3QEPA 1WAFA 3P83D 3BR9A 4IKAA 5L1KA 2OH2A 4NYFA 2KFNA 5KFCA 2JGUA 2HNYA 3I5CA 3CJ0A 1S5JA 3MR6A 4ECXA 3I0RA 2I5JB 4F4YA 4FLVA 1D8YA 3QO9B 5KFAA 4RW9A 2AGOA 4ZVFA 1C0UA 4LSLB 2AGPA 4GVMA 3SQ0A 3M9OB 2OPPA 1RTHA 1N48A 3KLFA 3ZT4A 3NHGA 3DYAA 3G6XA 5HRNA 1NJXA 4M3UA 1FKOB 2OPRB 3OYJA 2Z1IA 2V9WA 5KI6A 1QSSA 1MU2A 1QAIA 3GIMA 4OLAA 4DSFA 4CF1A 4KE5A 4LY7A 4CK3A 4B3OB 2DFHA 4WYWA 2BE2B 3HPGA 1Q9XA 4M95A 4CHZA 3LP3A 2JEFA 1RT5B 3QNOA 5E41A 3SQ1A 4N41A 2B4JA 5KGXA 2D3ZA 3L2RA 4NLRA 3TR8A 4DL7A 1RT3A 4WZMA 1D9DA 3CFOA 4MK7A 3AVBA 2R8JA 3C95A 5FROA 2ILYA 3OLAA 3LP2B 4EO8A 4DQQA 3PX0A 1J54A 3DLKB 5T14A 1T7PA 3H4DA 1I6JA 5KT7A 3KMSA 3RMBA 3OYMA 4HCCA 4NLDA 1IO2A 4NLVA 2W7PA 1JLBB 2JEIA 4MH8A 2IC3A 2GIQA 3G6VA 3OVNA 4CFBA 4NLYA 4IFYA 3SQ4A 1ZBFA
chains in the Genus database with same CATH superfamily
2HBJA 4CZLA 1LFPA 2CQIA 4DSJA 4DQSA 1T6DA 4CF9A 3WHIA 3EGZA 1HBUB 1XMQK 4JV2A 2E9RX 3SUOA 2Z8QA 1XQSC 2VG5A 4A8MP 4E7JA 4CLWA 2BUPA 4X66F 2G9OA 4FWPA 4X62K 5KFSA 2DH7A 2K06A 3ELHA 1ELOA 3I9V9 2ASYA 4UOFA 5GAGP 1WOSA 1WUUA 3UPFA 4ENOA 1MN7A 2VGMA 1HKAA 2OSRA 2WAQD 2ZOMA 4H4KA 5I42B 4WK1A 5KFVA 3ENVA 2QV6A 3MPUB 1D09B 1JQGA 4J5OA 3AVMA 4NLXA 3IXQA 4KO0A 2AYEA 1OO0B 3KMQA 4HT5A 2RMLA 4LRAA 4OI2A 2LYVA 3J81U 2DRBA 4CGIA 1YSJA 3KXDA 1FE0A 3MM9B 4LVNP 2RB7A 2P5OA 3NMRA 1RBRA 1ZXOA 4BC4A 5BN9A 1AB8A 4X4TA 2R7QA 3D0IE 4F4XA 1FDAA 4B3SK 4L6V3 1YITN 3OFEA 3D0PA 4FJ5A 1IBKF 4W92B 3ISND 5IT9O 3QPIA 4EI2A 3VESA 2QRRA 2CQ3A 4IRDA 1KR4A 1M5VC 1F0XA 1RWXB 4ZOSA 3ZX0A 5J2PB 4OGEA 2I9SA 4HLBA 4FLWA 4OIXA 1GLLO 1JXEA 6FDRA 2HHUA 5KG4A 4FYWB 3DM2B 3I8DA 5AXNA 1U8WA 4QWEA 4FJ9A 3PRVA 4LRDA 3R5GA 2IBKA 3LWMA 4ED7A 3LPEA 3ITHA 4GKKK 1UETA 2PMWA 4RUCA 2Y0BB 1GH8A 2PZSA 3K59A 2YHBA 4DTSA 2C1EB 1JCEA 3HM9A 1QM9A 4KHPK 3M30A 4Q45A 1X4DA 3VCDA 5D4PA 3Q22A 1KCFA 4JI7K 4CNZA 1A5VA 2W4CA 1R8BA 5HJXA 2V8HA 3MMBA 1TL3A 5K8PA 1WSGA 1CLQA 1U1OA 1XR6A 2NQPA 1U48A 1U0HB 5KPRA 3DHXA 2HNZB 2V8VA 4KFBB 2V6AA 4IKFA 4WWSA 1XC3A 2J4RA 1YHQN 2MPUA 4HCBA 6FD1A 3SBGA 1FVQA 4B9TA 4M5HA 3DU6A 2ZJQQ 1ZETA 3IKMA 1VJQA 5GMEA 2DNGA 4FWNA 3IWXA 3FZLA 4EFAC 1TKZB 3A5MC 4GKJJ 2WK4A 1FEHA 1S48A 1RT4A 1PCAA 4KGVB 3ZSRA 4OKJA 2YX1A 3IFEA 2FZCB 2E1RA 3M2RA 1HYSA 4OV6A 3M05A 3A1YG 3GMGA 1JKHB 3KDNA 1N8RT 3NDKA 1SQGA 1SL2A 4DR2F 1N33K 4NI2B 1CPZA 5GVQA 3D2WA 4B9QA 2AWZA 4K2JA 3NVKA 4I56A 4QU7A 4DMNA 1TKXA 3UKRA 4YY3J 2QGFB 5D8HB 3CCTA 2OEMA 4RBTA 4CGFA 1Q79A 1TVRA 2AJ2A 3IC1A 2QWQA 5AFUH 1B0PA 1NB2A 4YR0A 1EETB 1HWLA 1VK0A 2R7RA 3DLEA 4QPTA 4QR2A 4PR6A 5DRKA 3ZXWA 1K8KA 4JD2B 4BRPA 1REGX 1F3VA 1MDUB 3E01A 2ZC4A 2XO6A 1HA1A 3T9NA 3N4QA 4CJTA 5F2RA 3THYA 1N54B 3CF5L 3J7YI 4W98A 4ZVGA 4AL6A 7FDRA 3KWGA 1HQ2A 5C15A 2MQ8A 3LP1A 5I3UB 1GLAG 1OQ3A 2X1AA 3VF4A 4YOYA 2HS0A 3NGKA 2I5JA 4LFCK 1IR0A 1VQ4N 1YJUA 1LWFB 3CNQP 3HD1A 4K0KF 1MWMA 4DUZK 2N82B 2RNEA 1FKOA 1G3OA 4NLOA 3T1YF 2WTFA 1X5SA 3T1HJ 4PQAA 3QIOA 3EVMA 2R7YA 2CQ0A 1I3OB 5A2QU 4E1NA 1UVMA 4FW2A 1RQ0A 1NKEA 1TV6B 1VQPN 4I6AA 1HFEL 2LU2A 2DTJA 5KRTA 2XO7A 3D9BA 4LF7F 4K2XA 3IWNC 1M5OC 5K8NA 4ED6A 3J7YU 1JLEB 5AQZA 3FK4A 1QZ6A 4CZEA 4CGDA 4WFAQ 3AJDA 2XZWA 2AU0A 1JLBA 3M6VA 3T5KA 1CC7A 3R8YA 3JQMA 3QESA 4KHYA 4BWJA 5HROB 4M42A 2J76E 1ZM2A 4KSEB 2RQCA 2MLYA 4K5RA 4GMJB 1PC4A 4O3PA 1Q86O 3MN7A 1URRA 4DBQA 1GLBG 1VK8A 3ENAA 4MO5A 1SJQA 4IOCQ 3D2EA 3G6YA 2OIHA 5AQUA 4WFYA 3HVTA 3HMJG 3LL3A 5IV3A 1NEEA 4PWDA 1R31A 3OR2A 3FFIA 4DL0C 4P7TA 1NLKL 1WEXA 3DLGB 1BA0A 2JFKA 2P9KA 2A1BA 2DFFA 3O44A 4BE2A 1IKXB 2V2ZA 2GHVC 5HRPA 5KG1A 3KUGA 3BREA 4R79A 1FXLA 4RNMA 2DEJA 2PI5A 3V1QA 4I1TA 4MJKA 4CEAA 2X3GA 1RDDA 3L4QA 3BBBA 3CMAN 5F41A 2VF3A 4ED8A 3D6FB 3MEGA 4USKA 2FD2A 1KQKA 3KWIA 3A5NC 4FK4A 1N52B 2J6UA 2DGUA 2YKPA 2BA9A 2IJFA 2F9TA 4H5WA 4TYAA 1M5PC 2L9NA 2FLOA 2FF3B 3H40A 4NCGA 3NE6A 1A5XA 3G82A 4X4UA 2MQLA 2CG4A 1OH6A 4AFFA 4KHQA 5IWAF 1NK9A 1ITGA 3R97A 2UU9F 4OYPA 3U9ZA 2LQBA 3ZZUA 2RKIA 3D0GE 4FLXA 5HP1B 4GO5X 4U8YA 2RT3A 2GNKA 4O44A 2MKHA 3QQCD 2JEJA 2YHWA 2P5VA 3LDSA 1XWLA 3OTDA 4JKGB 4LF4F 2BM1A 4J9RA 1X9WA 3N6MA 1FXXA 4CEFA 2VOOA 3U6FA 1PILA 1H72C 4RTFD 1YJWS 2X1BA 3M8PB 4LF8J 3VQQA 3HPOA 2WBRA 2JEGA 4B08A 1ZAVA 4KR0B 4OYBA 1RDCA 3T3FA 3QB0A 4HDHA 3BP8A 2WSEC 3MMJA 3L6QA 1NMDA 1N34F 3VGUA 5H9EJ 5IM0B 3BEXA 1QS4A 2BV3A 1UFLA 1XMOJ 1NGIA 4CLUA 4HUGA 3E66A 3MD3A 2QFJA 2HFUA 4NYNA 5AZJA 1SH2A 2DNNA 2WRMA 1HNWF 3LZIA 3MPWA 4NLWA 1I94F 1FK9A 2OPSB 4DUYF 3CCRN 3DKDA 3JYTA 5D0EA 2BJ1A 2F8HA 1HW9A 1U6FA 5B0CA 2NUBA 4M63A 5H1SV 4DSKA 2POKA 5E3AA 4CESA 4DSIA 2DITA 4DV1K 2XS5A 3OYCA 5ETRA 3G8SA 1JLQB 2C3YA 4FS2A 1CEZA 3H8YA 4A57A 3K8WA 4HR2A 3BKTA 2IIHA 3M8WA 4K8RA 3AXMA 2MZRA 4Y2IA 2XWYA 2MHNA 1RT7A 4CNYA 3CCVN 3QEWA 5LT5A 3PZPA 3BZCA 3WX8A 1BC6A 1NLVA 4C3KA 1U6BA 5AR0A 1VQNN 1VC0A 4OX9F 3VERA 2ASDA 2KG0A 1SJ1A 1PGZA 3GSDA 2UXDK 2YX4A 5K9FA 4IG0A 5AT1B 4HI2A 4DX5A 4HUFA 1RHRB 3BYPA 5KPZA 4PG4A 3KHYA 1DLOB 5DLFA 2RILA 3N9UC 2Q3PA 4RG8A 4OJRA 3PW0A 2XMVA 3NWRA 3KHGA 4B9VA 5SZTA 4XH4A 3M4XA 3N5BA 4C48A 3J7YP 2YTCA 2ZNZA 4PXEA 1WF1A 3HHLB 4K4SA 3RW7A 4XAKA 4RJVA 2DO0A 3MM8A 5FPEA 1TKTA 4K4VA 3ENBA 4C8KA 5THWA 3CDAA 5L1JA 4LFBK 3FKBA 4CH7A 4ECVA 3WC0A 5BRFA 3K7RA 2XHBA 2I2YA 5JICA 1RHKB 2XS2A 5F8IA 4DV0F 4M7XA 4N77A 2F4VK 3B8HA 3MCOA 3QGHA 4Z37A 1O0PA 1DRZA 4OYXA 2E7XA 4IR1A 4IH7A 1RTIA 4BWMA 3W3DA 3OTOJ 3BF3A 4OFZA 3E1YA 3M32B 4FJKA 5H9FK 3VAMA 4KO0B 2FLLA 3M8QB 2OSQA 3FSXA 4B1VA 2MLXA 5B0GA 2HF4A 3IGVA 2KHOA 2HB5A 4UY8O 3PJ9A 2QWOA 4IOBA 3THTA 4JI8F 3HZ6A 4JI5K 2FPHX 4ANDA 1RYRA 4DV3K 1N36K 4CYUB 3G6EN 1NUEA 4DPXA 4RUHA 4H0YB 3ISNC 4NE9C 4OYZA 4ZITA 3BGUA 2FGCA 2OJ3A 2KKHA 4P2MA 3HJVA 1AA1B 1NK8A 4DV2J 5D3GA 4JI1J 3VTIA 4ECUA 4EFHA 5HLFB 2MKCA 3G0ZA 3SMZA 1GXTA 5L9NA 5DETA 4JI2J 3WBZA 3DLLL 2Z2ZA 3UFCX 4PQUB 1BWFO 3I32A 4X84A 2DR9A 3AO1A 5C25A 4ECSA 2CVIA 4P2FA 2CPHA 1LV5A 5KFRA 1HR0J 2HQGA 3CCLS 1JJ2M 5GMKa 3RGIA 2AYBA 4YORA 4DSLA 2RDJA 2HVIA 4QYZK 1QQNA 1FXRA 5FPNA 3RUBL 5C42A 2UUTA 3EXYA 4JI6J 3H1VX 2DEIA 3ONQA 3K5NA 2BVZA 5CYJA 4LSZB 4WU3A 1IH7A 1GLDG 3WXIA 3IBCB 2HMIA 3A2FA 5FLXO 2QYCA 2E2OA 4ED5A 4ZS6A 2NXEA 4O4GB 4NYZA 3IUCA 2ACMA 4K4YA 3TQEA 2DGVA 1RK8A 1FJ7A 4RW6A 4G65A 3FDSA 4DV7K 3KLEB 2BM0A 3DXKA 2LQ8A 3QFHA 2HBYB 4DTJA 1QE1B 4M3TA 3TANA 2MZJA 2KJWA 3GL1A 2D5RA 3QGPA 2P9CA 2CGJA 4CBXA 4TXSA 4M8LA 4JI3J 4RUBA 2WVEA 4DCOB 4LJMA 3VPZA 1BGXT 5A8WA 2MB0B 5IT9U 4ZP6A 4OX7A 5JJBA 1ZTWA 3TW0A 4TY8B 2XI2A 1SKRA 4PG5A 4BRHA 5J2QB 3MR7A 1VQNS 2QO3A 2W4PA 1ZA1B 3CXCR 2XYHB 3FQKA 2W2OP 5LMNJ 1KHWA 1BL3A 1GMUA 1TUVA 2K7KA 3M2RB 1RZMA 4G1IA 2VG6B 1MG7A 4U67Q 2AKWB 2E8AA 4GMKA 4DR1J 4NASA 2Y9HA 4RR5A 3ENQA 3VGTA 2W2PP 4BR2A 3GFZA 3RBZA 2XZDB 2EK6A 1FNOA 2ADCA 3EE8A 3LAKA 2ASLA 5CY4A 4LIWA 3M8ZA 1C1BB 2RN2A 4Y1CA 1N5SA 4CIGA 4CH1A 2XWXA 1QLNA 4ICLB 1U1PA 4F36A 3H5UA 3I6PA 1KQFB 3UD4P 5KFLA 3TTFA 1TZ0A 4I0WA 1SH0A 2RUGA 3A3PB 1XMQJ 4F26A 4U6PA 2NCKL 2CPXA 4CZKA 2DXFA 1O51A 2FF6A 3NMUA 1Q81O 3QSYB 4L72B 1MWQA 3EPGA 4X62J 3PKMA 3H7HB 4A2BA 1NJIO 4ZN3A 2B5JB 3DOKB 1K8KB 4RBVA 1IKYA 5FDLB 4RNHA 3EZ5A 4FZZA 3E01B 2XMWA 2CUYA 1ZYQA 2PFUA 3SUPA 1FXDA 4WQ5C 3AODA 4F0MA 5FRMA 2J6TA 5L9XA 3DLJA 3SAFA 1HQEB 2ZWPA 1VQON 1T05A 4I6MA 1IKWA 4LF9K 5CZ2A 2ZH9A 3OW2M 2J9DA 1Y5IB 1YJRA 3L2UA 1L3TA 2JOQA 3A5LC 4DF8A 2HG4A 4IFVA 1R27B 5K8MA 2RE1A 2ADBA 3UDCA 1T9TA 3LP1B 5M1OA 5KT3A 2Q43A 1LKZA 1YRUA 1PAUB 4GKJF 1MW7A 3HHLD 4B3SJ 1UL3A 3SYZA 2O8BB 3RRKA 4DZDA 4I67A 5JVHL 2OAUA 4BR9A 2H3EB 3K2YA 1TMJA 3O9RA 2QSFA 4JV1A 2VQFF 4M5LA 1RAJA 4FF1A 4KH5A 4KRFA 4PUOA 1U25A 1WHVA 4CO0A 1NOZA 1A5WA 2HBZB 1J53A 4BQZA 3GFHA 3R7BB 5KQ8A 1VCTA 5C24A 1G2EA 2FY8A 4RCHA 3O4WA 2JNJA 4GKKJ 2OTLN 3D5MA 2HS4A 3S9HA 1BQMA 3H42A 4YY3F 5D0HA 1IG8A 4UQGA 1JMTA 1CULA 4KHPJ 1L3KA 3PRDA 2D3O1 3ZSWA 2QN6B 3DDNA 3ILIA 3RB4A 4JI7J 4DU8A 2IOCA 2EBEA 1ZTTA 2DTUA 4MLHA 2IRUA 2V5HG 3ADAC 8AT1B 1OYEA 2VC1A 4Y2KA 3IMXA 1H7XA 3TVKA 1HMVB 4MKAA 3CCES 2G0JA 4LF1A 5F8LA 1JLAA 1PIEA 4CZGA 2W8KA 4UQTA 4G1PA 3CIZA 5GAHU 3VQBA 1DEJA 4UW2A 2HQFA 2HS3A 1W7WA 2EC0A 1XNQF 4C97A 4KAZA 3DI6B 3NGTA 1NXIA 1DKGD 4FJHA 4OI1A 4E7LA 1SC3B 1B99A 4TU7A 1NHUA 2KLAA 3L7OA 4PHTX 4LQ9A 1RAAB 2IVPA 2HOEA 4EO6A 5C2GA 4K8ZA 2QL5B 3J80O 3GJQB 3C6AA 4NOHA 3I0RB 2CQ4A 1HWJA 4MIWA 4RW9B 4OO1J 2Z1HA 2R7WA 4HVZA 4C8LA 3ZO7A 5KTQA 3FCVA 3DYAB 1U2FA 1NMNA 4B1XB 1S12A 3US5A 2MZ1A 4KGXB 1IBLK 1RT1A 3CWJA 3ZC4A 3G8QA 3THXA 1FTCA 1U49A 3GIRA 4OKEA 2ZD1A 1RA7A 1F2GA 2PO4A 1KVKA 4NLGA 1Q7YT 3VEVA 1N33J 2XNRA 3MEGB 4KB1A 5AQLA 3FSYA 3I55N 2YWFA 3VQAA 3NOGA 2NPFA 3M7VA 5LXYA 1RT3B 2Z58B 4V19S 5BYRA 3NGSA 4NCGB 3FZBA 3EO3A 5K8OA 5AE1A 3R6GB 2Z56B 3PUFA 3ZSQA 3CSKA 2XGPA 4DX7A 5BPNA 3V2UC 3PIOL 2ZH8A 4C9DA 2BMBA 4CJRA 2KI2A 2YY3A 1RILA 3QBWA 1Y0HA 3UIQA 3IO1A 2ZH2A 4RW4A 4OGCA 4DHYA 1C4CA 1RXOB 2DNZA 3IMQJ 2M5YA 1B9DA 4YHHF 2A1SA 2BKOA 2R2TA 1K1SA 1WBDA 5M1FA 1WOOA 5KFNA 3WXJA 4IG3A 1C1AA 3TJAA 4F4AA 3MEDB 2G1HA 2HGNA 5DG7A 2GWKA 1FWPA 4J2BA 3UVJB 3DLRA 4XH1A 2YWEA 3DRSB 5CYQA 1S1WB 1E6VA 4OZ2A 2E1CA 2B8PA 3AOAA 1JJCB 1E6YA 4NMXA 3VZIA 1RBUA 2YNIA 3H5SA 1O6XA 2N7YA 1JJ2R 1YQHA 2K3KA 3G86A 1S0OA 3IP0A 1M90T 3P1GA 4MDAA 2G8FA 4LFCJ 4B9LA 5HRRA 5AZJB 4X2BA 1NSAA 3ZEUA 3N4WA 3K5OA 3VQ7A 2C22A 1U1QA 4A47A 4DUZJ 1V6HA 4DLEA 2FSNA 3AVHA 7AT1B 1S1VA 4CZJA 1FKPB 3DDIA 2GMLA 4U9RA 1T3NA 1G4CA 3V1OA 1RTDB 3AA2A 5I9EB 3O80A 2HZAA 2DK2A 1SV5B 3EPIA 1RADB 2KB2A 1KAZA 2QA4N 2VC0A 1IVZA 1TFYA 3OTEA 3A12A 3KTQA 4H0VB 2K1RB 5CZXA 3HVRA 4KHSA 3VA3A 2Q0RA 3MWBA 4AD6A 4ILLA 3CB4A 2GMHA 2GTDA 5T7LB 1ITPA 2UVUA 3PVXA 1RT7B 4KQZA 4WQ4C 2R8HA 2HAIA 1I51B 4CI0B 2O8EA 1RABB 4K0KK 1RAGB 2EKNA 3AQOA 3UO0A 4E7HA 4GV9A 2F3JA 3QIPA 5CAAA 2HBLA 2CPIA 4IJNA 4OI4A 2VA2A 1HJOA 5G0RA 1R43A 3PM9A 1T3VA 2H48B 4IQXA 4TVAB 4E89A 1PJ5A 3BBCA 1B7YB 1S6OA 4ZVRB 2GUIA 3MM5B 2HHHK 1J2VA 3W9IA 2NS1B 3FQLA 2G0CA 2MSSA 1RCOB 1JK9B 1SKSA 3AVLA 1S6PA 4LF7K 1ZBIA 4LF8F 1VLOA 4J2EA 1UTAA 2O1PA 1W2IA 5J2MA 1DQ9A 2QJ3A 4Z4GA 2AIRB 1BG3A 2FBVA 4GC7A 4C1NI 2V4RA 1XMOF 4ZMMA 2R7XA 2FJXA 1HLUA 2NLXA 4H4MB 1NSQA 2JWNA 3W66A 1EKRA 3MZIA 4IFEA 5GAHP 5HK4A 4ED1A 2DH8A 3PTWA 3EYZA 2HIQA 1UVKA 1BXNA 4PWUA 3MXJA 3OYGA 4Q5VA 2CDQA 3JSRA 5CQGA 2V2KA 1WKKA 5JVGL 2MQQA 3A3NB 4CHQA 3IG1A 3D1HA 4ZCIA 4C4WA 5M2UA 3BSNA 3U4LA 2J6SA 3IA0A 1JNZB 1Q0NA 2NRZA 4ED0A 4BRMA 1W2BR 1VSLA 4USUA 2ZH1A 3C0BA 1VQ6N 3VETA 3VOVA 5ETTA 3CC2N 3QLHB 4MK9A 3OFHA 3H0PA 2VZ9A 5ETKA 1DT9A 2W9CB 2A41A 1U1MA 3QINA 4WKYA 5EDWA 4F50A 4GVBB 2KZMA 1WEZA 4TSXA 2XBPA 3ZZRA 3AVKA 1Z2ZA 2VFTA 2Y3YA 2EHGA 3TEHB 1PC5A 5HI7A 1YRTA 5C25B 1SKWA 2OA8A 1U45A 3KK7A 1CJUA 1RT2A 3K8VA 3MOJB 1WHXA 1ZOTA 1LNQA 3LAMA 3J81Y 2HK2A 3O6QA 1F3FA 4G3IA 4HACA 4WK3A 1XERA 4TLQA 3R1HA 2D41A 4NYPA 1EWRA 4LREA 2B8QA 1GAOA 4UT4A 3C16B 1DTTA 1A6LA 1TELA 1RUSA 2RVJA 2O67A 1T9WA 3AXKA 2D9OA 4OPKA 1Q82O 5IWAK 2HMIB 2UU9K 4X4SA 3M2UB 3FE1A 2QK9A 4FYDA 1NPPA 4H4OB 3KD5E 3VQ9A 2GHPA 4DN0A 1TL1A 2VG7B 1VRTB 1MROB 3UKUA 2A18A 2A3ZA 1N5YB 1ZA2B 3H2UB 3WXKA 4OYAA 4ZPBA 2RAQA 1FHTA 2A6MA 2QA4S 1KXPA 4O0JA 1KONA 3OTOF 5L1KA 5DDPC 4CLTA 4J8FA 4X4QA 3WEEA 3I5CA 3MAAB 2BABA 4ZN1A 3MR6A 1RBOB 4OLPA 5A8WB 3R3TA 5ETPA 4OZ1A 4DV1J 3QO9B 2AGOA 2AGPA 2F65A 3LDOA 4GVMA 2OPPA 3G96A 1RTHA 2XG8A 1QUPA 2LQ5A 3C14A 1WF0A 1A7GE 2M2BA 3IR6B 3D2FA 3NHGA 4ILGB 1N34K 4IYQA 1MU2A 4ZLNA 1S59A 3GIMA 3L0QA 1M5KC 5DJBA 4CF1A 2B9YA 1BDGA 3RVCA 4WYWA 1S5ZA 3QT7A 3SDEB 3HPGA 4CZMA 1HNWK 4JI1F 1WUAA 2V7YA 2P9LB 4M95A 1XQIA 4CHZA 1IQZA 3B8AX 3LP3A 1YIJS 1I94K 3FJ2A 4N41A 4JI2F 3L2RA 1ZBTA 2O8CA 2UXDJ 4LBIA 3A8EA 2OP5A 2JWKA 1D9DA 2ZVIA 4MK7A 2M4MA 2R8JA 1HR0F 3C95A 5FLXU 1CVJA 3E2EA 2CNOB 3RG6A 3EN9A 1AFJA 1BOTO 2QLJB 4ZDNA 3DRYA 5T14A 1PJ6A 3RMBA 3OBYA 4JKEA 4HCCA 1BWEA 3GDQA 2JEIA 1VISA 4MH8A 3VALA 1HKCA 3A8IA 3G6VA 2J8SA 4CFBA 5HQMA 1CG2A 3KUHA 2XCAA 2ITGA 5EHHA 3GJSB 3UW1A 1JLCA 2C2RA 4OX9K 3C6HA 4LFBJ 2WC9A 4R8UA 4J9NA 1ICEB 3VGSA 4IZ9A 3S3NA 4PY5A 4KI6A 2F4VJ 2ASMA 3OSNA 3H20A 3BSOA 4TLRA 4M5MA 2YWKA 4OL8A 3U8XA 3KNGA 4B17A 1T8EA 3C7NA 4DTXA 4RNNA 5H9FJ 4DL3A 2M88A 2GQQA 4CO2A 2LDYA 3VHQA 1UFWA 2X6NA 5KT4A 4JI3F 1WC1A 2JLEA 4JI5J 2BJ8A 2YNHB 1U02A 4DV3J 1N36J 4YOWA 3C6TA 3FCWA 1JXBA 4NLQA 5JS1A 5K14A 5EWEA 1VAZA 3BGOP 3SCJE 5LMNF 3HKWA 1S4FA 1UVIA 1VMBA 4O3QA 4DV0K 4JB8B 1VIOA 3QRRA 4WFBL 5KFMA 3G10A 3LM2A 2G2YA 3HSJA 1ZBUA 2ZDPA 4F3QA 5LOQA 4KKOA 3P39A 3CC7N 3HSTB 3VVUA 1MNEA 2DIUA 3OVSA 1OMSA 1Q86T 1WSVA 1VQ9N 5KQDA 3NFAA 1TQLA 5J1EB 3N6LA 4CJ7A 2YKQA 3BN4A 4X64K 1WD6A 3NGUA 3QZ8A 3KK1B 4JI8K 2P9UA 1BQMB 3P4UB 4QYZJ 2LLZA 1Q95G 2VJVA 2ZJRQ 4DQPA 3GZ7A 1VRQC 1X31C 2JC1A 3MEKA 1S1UA 2DYAA 1HBMB 2BJ9A 2J7WA 4JEPA 5LL6Z 2FQQB 3ZSVA 4J9QA 2QLWA 3EDRB 3POTA 2VBXA 1X9SA 1CJVA 4OV1A 1S9FA 1YZ7A 2WUSA 5HBMA 2HVDA 2CIMA 2HFSA 3VV2B 4X62F 4PL8A 1L3VA 2OHDA 5DZ6A 2RE2A 2CQDA 3NRBA 4DV7J 2VCPA 2HHVA 2UUCK 5CXTA 2QWMA 4NLTA 1U8SA 5DDOC 2K8GA 1D9AA 2HGMA 4MKBA 2H5IB 3DOMA 1FWLA 3MM6A 3FZ2A 2YNFA 1LXNA 3TSQA 4HH0A 1BI4A 4IEIA 1BY9A 3RZAA 2DY9A 2GS8A 4WKRA 3ZSYA 4F4KA 1NK5A 4ELUA 3NNCA 1WC6A 1HPZA 5EX3A 1H1VA 1SKUB 1EKEA 4K4XA 3W9HA 4M1KA 2OO4A 1BIUA 1VQ7S 3BH7B 4KYZA 1WC4A 2DNQA 4N47A 3ATVA 2NRXA 1S97A 2K7JA 2FVSA 4B3SF 5IQQA 1FD8A 5A8KB 1AUSL 3TQ1A 3TUJC 4A46A 2VD3A 4FXWA 2B9XA 1RBVA 4KY3A 2HIYA 3OYAA 3O1WA 1Q8IA 2YVSA 2GC8A 2A6AA 4YOEA 4FJNA 4DU7A 1UWBA 3CG7A 3FUYA 4M5NA 4DDFA 4OI0A 1RCXB 2E6MA 3M9MB 2CH6A 3QEXA 4GKKF 1XEZA 3CJKA 1DZ5A 3F9MA 4QJVA 3OBWA 3HLUA 2NRVA 4IO9L 1YJ9S 2QEXN 3T5LA 4DL5A 4A8QA 4LRBA 3CEDA 4KHPF 1RDWX 1GMVA 2AGQA 3T5JA 3VF6A 4RW4B 3F9KA 3JAMO 2RJZA 1X5TA 4FK0A 4CJPA 4A48A 4GC6A 2EX3A 3QIDA 3MF5A 1Q7LB 2E7WA 1C0FA 4FVMA 3D6RA 3LZJA 1A9NB 3J80U 3AB4B 4NLPA 3A8KA 3SJHA 1ZBLA 3G71S 3I31A 2DPJA 1HNXF 4LF9J 2F8MA 1NSPA 2W9BA 1E6YB 3K17A 2D74B 4ELTA 2YNIB 2MY8A 2OZMA 4YN3B 3D7EO 2WZ1A 4OZJA 4U7UD 4CEDA 3MTJA 2DXDA 4RZRA 4RW7B 2COLA 2AP6A 1J5OB 4LSNA 2O8FB 2AMCB 1S6QA 3L95X 4C8NA 4H5RA 3DGPA 3H59A 5F0XA 2YX7A 3THWA 2M3DA 3AA8A 2WBNA 2D69A 3TUIC 2F63A 2VGNA 3MMAB 3CD6N 1S1VB 2KHCA 1V4SA 3L4IA 2ZH6A 3ZTPA 4O3RA 3RB0A 3D67A 3BGRB 4QS9A 1N33F 4CJLA 4J91A 2OMOA 1NGJA 2AP1A 3R9PA 3C15A 2OPRA 3V81B 1VQLN 3EGNA 3T7ZA 2IYGA 4B9SA 4C8OA 3WT0A 9ATCB 1QSLA 2EKYA 2BE2A 2NRTA 1IJJA 3QFWA 3FZHA 1HLWA 3EXCX 1NG9A 1RT5A 2CFXA 5KOXA 4J9OA 3L3VA 4QIVA 1AUDA 1BA1A 4F02A 3GSIA 3QIPB 2VQFK 1LW2B 2GWJA 3KJFB 2XY6A 1YVFA 3NGYA 4QCLA 2QMWA 3TR5A 5LXRA 3CCSS 4HT7A 3OV7A 2DGWA 1WBBA 2QLFB 1VOMA 4FLZA 3DHWC 4WQ5A 3VQ8A 3L2WA 5IOLA 1BCMA 3W2WB 1Z1ZA 3CPWR 4ELVA 2FHKA 1K9MO 3TAQA 4KHNA 1HBUA 3GWCA 3G4SS 3HP9A 5E3CA 3CCJS 3HJFA 4FF2A 4KREA 1LK7A 4LFAF 1VSDA 2IMOA 4YOUA 4ZP7A 1VDHA 3VVTA 3Q8RB 3AHPA 4LFCF 3N28A 4BC3A 4JKBA 1TP7A 4TKTA 4DU4A 4NLCA 1U2VB 4HVJA 3G87A 4QWDA 1IBLJ 3NNHA 1TU0B 5EN1A 4E1JA 5I42A 1RU1A 1XNQK 4DLGA 3NH2A 3KKFA 3QJLA 1FTRA 3MXMA 4GO7X 1NOYA 3TA2A 2HHQA 4IXCA 1NH8A 4QWCA 1HIYA 2YHXA 1C0TA 1WG5A 2RF2B 3GIKA 3GYXB 2LFVA 4WFNQ 3MM9A 2IS3A 3CD5A 4DS5A 2MHEA 4KPYA 5TKWA 2G8WA 1GK8A 5RUBA 1SS6A 4H5TA 3D54A 2XY7A 3L7UA 1M1HA 4IEEA 3V9WA 1N4LA 3O4NA 1R3NA 1K6YA 5E84A 3OYBA 5CYMB 2HVHA 2D1KA 2KU7A 3I56N 2EG2A 2AT1B 2D0BA 3HPHA 3OTBA 1VQMN 2AZ3A 3AAQA 3CO9A 1S1TB 5ETMA 2GGPA 4F8RA 2MEWA 2ZE2B 5J2PA 1KHVA 1V9OA 3SV4A 4DQIA 4CJFA 3HSZA 2MTLA 5C7PA 3DM2A 3EJMA 2E5HA 3ZLJA 2BYCA 1P90A 3VR1A 4DV5K 4CEZA 3PO5A 1R0AB 2F7TA 4MKVA 3I82A 4BRQA 1HWKA 3QFPA 2C2ZB 2U2FA 5IV4A 3H6EA 2B9WA 2GA7A 1HNIB 1S7IA 2V94A 1QTMA 1XIQA 4DTMA 1DJ0A 3M6WA 5KPTA 1B64A 5FPDA 3SUNA 2A42A 2UV8A 3V9SA 3RW6A 3A4TA 4FM0A 4FM2A 1Q1KA 1EQ0A 2KHDA 3QBXA 1WC0A 4YHHK 1J27A 5HL7L 4CZHA 2FC0A 2UUAK 1T9UA 4DG1B 1L3UA 3TZXA 1U0HA 4Q7AA 5D77A 2CAJA 1ZAXA 2G8KA 2HNZA 1SZ2A 4KFBA 1YKWA 3C65A 2E1ZA 5CZVA 4DSEA 5EX0A 1KQSR 3SQ2A 3WEEB 2BTFA 4FPIA 4ZTJA 3P4IA 3DXSX 4TNOA 2HLUA 1NZ8A 5AQRA 4EEYA 2P9PB 2IGIA 4DQ8A 2PY5A 2ZOGA 2FJAB 2OPPB 4EYIB 1VR6A 4OZLA 1VHFA 3RB3A 2NUHA 3D2FB 3KVGA 1BMQB 4FJXA 5L1IA 3PYEA 3TTDA 1TKZA 4BQLA 2MGZB 4XH5A 3EZWA 4N76A 1Q81T 4BDZA 2LXUA 4K0KJ 3BSCA 2DNRA 4CHYA 3O4QA 3TZWA 1U09A 2ROPA 1NJIT 3TAMB 2ZITA 4IOXA 2X78A 3EZUA 1BD6A 2OELA 1PYSB 3J7ZO 1UKUA 2BZ2A 2HF3A 3MAQA 4LMZA 1S9EA 1JKHA 1MSWD 3AOCA 1OPIA 1S77D 3OJUA 4F67A 4NI2A 4DR7K 3KLIB 5IT9Y 3VQ4A 1FDDA 4MAKA 2HHHJ 1VSMA 4BR0A 4L75A 1QJHA 2W2NP 2W4DA 4LF7J 4BRFA 5GADI 3M5RA 3TJ8A 4CIFA 2P51A 1HQUB 2M9KA 2XQCA 4RKUC 4F0KA 5M1QA 1X4CA 3C2PA 4DEZA 2LP4A 2XM3A 3DXBA 4FL9A 2FXUA 3CCQS 2Y1IA 5ADXA 2D7SA 4LH5A 3UE2A 1EETA 3RU0A 3SAGA 3TRGA 4CM2A 1YLXA 2YI1A 3VAJA 3RB6A 3SFUA 1K1QA 1DARA 3LOUA 2CZ9A 3QJPA 2NYIA 2CPYA 1E4GT 4JD2A 3VEOA 2CWXA 4KT0C 3I87A 2LXFA 3W5YA 3DRPB 2C2MB 2DGTA 4Q44A 3J7AP 3JSMB 3Q0AA 3PR4A 3P5BP 4CJKA 1Y64A 2FLNA 3PIPL 2GBZA 1OVQA 4ZJOA 4QU6A 4BHQA 4GNIA 3MN6A 3FEYB 4DF4A 3OYFA 3KHRA 4KTQA 1TAQA 1JB0C 2VA3A 5I3UA 2EEYA 4FN5A 3OHRA 5D0GA 3SLCA 3NBPB 4WU2A 2ERRA 1YAGA 3OFGA 1PAEX 2CWKA 1S10A 4L8RB 3Q23A 1N32F 3I5BA 4OLOA 4QW9A 1RDAA 1CLFA 2DGXA 3TZYA 1Y11A 4I68A 2Z1GA 4JV5K 4EYHB 2GUPA 5AXMA 1W26A 3LP0A 1PJ7A 2Q79A 2YPYA 1M1KO 1WC5A 2AW0A 3CJSA 5AQTA 5BR9A 4XK8C 2CNLB 4RPFA 1TGOA 5E3PA 3W64A 1TV6A 1WACA 1V4TA 2Y8WA 4FLTA 4EGLA 4ZCLA 1T0TV 2KRBA 3WNEA 2MJUA 5KFBA 1X1PA 1LCUA 2L08A 4IUFA 2LQ9A 3POTB 3P5TL 1JLEA 5IWAJ 2UU9J 1CJVB 2W2MP 2ZHOA 3FCHA 3O1BA 2CJQA 5FRNA 2DFEA 4NCBA 2QE5A 2Q0UA 5D78A 1YK9A 3NH0A 2CG8A 4MK8A 1GLCG 2WBMA 4QZVB 5KG5A 2R8IA 4F4ZA 2XMTA 5HROA 2F4VF 2GJFA 3VGLA 3MM6B 1PBAA 2D1CA 3W62A 1IG9A 2DNLA 2E1AA 4C8MA 4QIEA 4C1NK 3KK2B 3RAQA 4G9ZA 2NLWA 2ALZA 1FJGK 3O3LA 4LF5K 1B70B 3LH2S 1Z6RA 3WXMB 4FJMA 4P74A 4JI5F 1GNKA 4DV3F 1N36F 1QHTA 1RAHB 3SXLA 2BJ7A 3DLGA 5GAEI 3OQ2A 1SI9A 4XO0A 3U7JA 4CW7B 1IKXA 2ZZMA 3CQYA 4DI6A 1LW0B 2C2DA 1HNWJ 5F9LA 3EDQB 4WIIA 1I94J 1EWQA 1NDLA 5ELZA 2HNDB 3LQVA 1RBTA 5SWMA 1YF5L 1KFDA 2XLJA 3GIJA 4BREA 2RH3A 2V4JB 3ZZTA 4M3XA 3CW2C 5K20B 4AHCA 2I38A 2UXBF 2BRKA 4L3NA 5LSOA 2Z2MA 4G1QB 2F9JA 3UN2A 5GIOA 4ECYA 3GB0A 2D9PA 4CTAB 2E1PA 4FLYA 1Q5VA 2HHPA 3SBMA 4F4WA 2GAHC 3LP2A 2ZOFA 1FFGB 3DLKA 1U1NA 3BZKA 2YXLA 1I1GA 3S3MA 4FOEA 2F9DA 1BWVA 3NGRA 4CGGA 4OX9J 1HD1A 2CXEA 2X74A 3TPQA 1W7AA 3KFWX 5CE3A 5HP1A 1X3MA 2VFUA 4DV7F 5AE2A 2PT0A 4ALZA 4C3LA 5KRSA 3PNIA 4FCYA 3OVBA 2NRHA 3W60A 2P9NB 4LRCA 3NF8A 3OYEA 1P8GA 3EKSA 3QT5A 3O3GA 2MMYA 4Q43A 3L2VA 1WF2A 1HJRA 3CCMS 4L3KA 3M8PA 1GX6A 1X4FA 3EMTA 3V6JA 2BOAA 2GIFA 3U1MA 2VICA 2RHSB 4Z0UA 3TZZA 3UWTA 3MEEB 4CQ1A 4DS4A 2W7OA 2LA4A 3D1OA 1L5UA 4FOIA 4EU0A 3DGPB 2G4BA 3EX7B 5IM0A 4PZVA 4OZ3A 2G8VA 5HVFA 5ADXH 2QWPA 5I3PA 2OEJA 4FWOA 4CJ3A 3OPKA 1Q8BA 3FZKA 3RSEA 2G2ZA 4HHJA 2MZTA 2PA8D 5JXSA 2OPSA 4YOTA 1SCJB 2L9WA 3BB5A 4ERDA 1UA0A 4ZLJA 3C15B 4OQJA 4X64J 2C28A 4JI8J 3DRRB 1S72S 3JAMU 1OSDA 1EJ7L 4GVEA 2D0OA 4LH4A 1ZBSA 1JLQA 3B6PA 1J5EK 1YVUA 1FFSB 3TAFA 3QERA 1NPRA 2AJ4A 3K5LA 3K0JA 3TARA 1NB7A 3KLGB 1UFKA 1VGYA 1KLNA 2A10A 4IOAL 1JCFA 2ZQBA 3BYRA 2E5LK 5DQGA 2EFVA 2H51B 2JZ5A 2Z30B 5DM7Q 2UUCJ 1H2TZ 2YWGA 3VQ6A 2X1GA 3NCQA 3AA3A 2HFZA 1DLOA 1LAVA 3AVGA 3CMEN 2V50A 3P96A 5HN0A 2F4FA 2FUG9 2YKAA 1NGFA 3O3HA 3B6BA 2IA6A 4LF9F 4USJC 4FVCA 4UUXA 4OJGA 1BUPA 1XI1A 3HM8A 1N8RO 4V1Ak 1EQMA 4C7QA 3R5BA 2LSNA 3MR5A 4HKQA 4IH5A 1TK8A 3HHLA 4DR6F 2DJWA 4MDBA 1P1TA 4JOUA 4ANCA 3JSYA 2JHEA 2V63A 3MM7B 3SAHA 3IAS9 2V0NA 2FGOA 3CT9A 2R8GA 1HKBA 4YB6A 3HX9A 4ZVQB 3CCUS 3ZETB 3R27A 1C0UB 1VQ5N 1EO1A 3S7RA 3SPZA 2YCHA 2VONA 4CD3A 3M32A 3DC2A 3KLFB 3PEJA 3WQPA 1RHQB 3M8QA 4CF0A 3EGVA 4H4KC 2CKWA 1WG1A 4JI4K 3H1QA 1C0TB 4K4UA 2CQ1A 2QL9B 4PG8A 1R0CB 1VJWA 3CHWA 4CYUA 1IBCB 1Q82T 2EBGA 1VBXA 4PKDB 3UNGC 1NGEA 2CQCA 1X4EA 1OY6A 4F7VA 3R7NB 3C3LA 5HLFA 3MCSA 1YJNN 2GGPB 4Y3CA 4GRSA 4QBUA 2WW8A 4XPEA 3ICLA 4PQUA 5DQIA 4L73A 4OMFG 3QGIA 2IC3B 1WDDA 1HPMA 1AZSB 2DT9A 3H90A 4K4WA 4YB1P 1KC8O 5KFPA 3KUEA 1ZPVA 1K73O 3JQJA 3M1FA 4V19J 3PW2A 3OXLA 3IS9B 1RT6B 1VBKA 3BGFA 3R5DA 1WSEA 2B51A 2HQ3A 2P1JA 2JLFA 4DOZA 3LDPA 2MLZA 2ZBPA 4X65K 4H8KA 3BDPA 3CC4S 2F7VA 2XSJB 5KG7A 3LPTA 1G7CB 4BVOA 4BRNA 4KC5A 4ZLLA 2FC9A 3SK3A 4O4GA 2EWHA 3LO3A 5A6PA 3OYLA 4O5BA 3PX6A 4Y00A 4I2PB 3CJBA 5M1NA 1KDNA 3EE9A 4HUEA 3N6NA 3KLEA 3HI0A 1REVB 3PJXA 4ZPWR 4EMDA 3A0IX 2DHAA 1QE1A 3GV8B 1IBLF 3SQGB 1X9JA 3BY5A 1QSYA 4IO8A 3AJ2A 1HNXK 5BRDA 2EFQA 1NGAA 3CM5A 3HRGA 4W5OA 3R2CJ 2FB0A 1N0UA 3R6LB 2JC0A 2JLGA 3H2VE 2ZBRA 2HBKA 2EFGA 1DFDA 2PN6A 4TY8A 4OX8A 3MK6A 1NK6A 1D0EA 3TTCA 5J2QA 4BC2A 2MQMA 4AT1B 3A3OB 1CQNA 3UCGA 4I7FB 4DTNA 3CMQA 3CTRA 1WNSA 3ZX2A 1XK8A 2QL7B 3HT3A 3HXMA 1GOAA 5KFGA 2GW8A 2VQFJ 2VG6A 2YH0A 4WE1A 4N7TA 4CZCA 1MMNA 4ZP8A 1S9EB 4KB7A 2MQPA 3FEXB 2E4LA 2UXCK 4K41A 2HMPA 3ZTSA 1C1BA 2CADA 1VQKN 4A2AA 4O23A 4ICLA 2KT3A 3FVYA 5AQMA 1CZAN 3R8EA 3D6HB 5ETOA 2WB1D 2UP1A 1GXLA 2QA4G 4WCEL 2Q6CA 5DQHA 3LDNA 4YDDB 4ILRA 2CGLA 1RFQA 3FR0A 3WDOA 1NGCA 3ETOA 1T11A 2LEAA 2I7PA 4FWLA 4S0MA 3UE5A 1YBTA 3CJ5A 1F9HA 4Q2LA 4DTOA 1FRIA 3NL0A 2Z0GA 3AVIA 3DCAA 4F3OA 2WVBA 3W2VB 2B5JA 1NDKA 2GIRA 5CCLA 3DOKA 5FDLA 2GJ2A 3M2VA 5FLXY 4K50A 1LWCB 3T19A 5B09A 2IJNA 1XNQJ 4PEOA 4R0EA 5AE3A 2C3MA 1HQEA 4ER8A 4KV8B 5IC6B 4D3GA 1IJEB 3IDHA 1ASWA 5CHIA 3HT0A 2QSWA 4I9QA 5HOOA 4FJIA 1YITS 1O13A 4LF6K 4RWTA 2FLPA 4ED4A 5AQGA 3P5JA 1DGKN 4LFAK 4DX8H 2Q66A 1Y4ZB 3S41A 2N4CA 1QVGR 3Q8QB 4CFAA 3VAHA 4USHA 2ZJPQ 2VL1A 4CI6A 3D0HE 3V1RA 4B3TF 1KVBA 2O8BA 3IFRA 2PC6A 3ISZA 2DR6A 1NDPA 2HHSA 4QIWD 2LXIA 2E20A 5E3QA 6AT1B 4FYXB 1R6YA 1WI8A 3O5TB 1VS3A 4QOZB 2ZBQA 3W65A 4MYUA 4LR8A 3LP0B 1X4AA 3IRWP 4OZ0A 1LXJA 4W5TA 2YKMB 1YRXA 3ZT2A 2QMXA 2GJIA 1AYEA 4DV5J 1F6TA 2KFYA 1TKDA 2HHHF 2OYQA 2HWIA 2W1BA 2JVOA 2QC3A 2KG1A 3CETA 4O3NA 1RJJA 2W9AA 1WI6A 4JS5A 2YKNB 2J0SD 1X4GA 5B0AA 3VAIA 2XB2D 4EHUA 1F5CA 2RIJA 3Q89A 3DMJB 4CWBA 3K89A 4OPJA 4FVUA 4P73A 4UY85 4YS2A 2R2SA 5HSPA 4QAGA 2QWRA 4FK2A 1YHQS 4YHHJ 3LPUA 3OS2A 4NLUA 1S79A 2UUAJ 1HMVA 1R8HA 5HAOA 2NPIA 2ZBCA 3RR8A 1Y3KA 2VWBA 4ZP9A 2QKKA 2AJ0A 4J9LA 1EP4B 4OX6A 3MCMA 4ES2A 4M7YA 3PJWA 2P9SB 1RWOB 1WSFA 3KWMA 3DI6A 3EWGA 4QW8A 4DR4K 1AXQA 4IKAA 2V8PA 3SMPA 3AAWB 2QYGA 1Q18A 1S5JA 2O66A 3TYTA 4ECXA 3I0RA 3E9LA 3NVMA 4RW9A 1VBYA 4GY2B 3LTOA 3SQ0A 3DYAA 5HRNA 2LVWA 4M3UA 1TL5A 2Z1IA 2V9WA 1QSSA 3ZZYA 2EFNA 1LEOA 2C42A 1Q5YA 3WIUA 4LY7A 2DFHA 5ETQA 1Q9XA 2ZUGA 2OUGA 2B56A 2XEXA 4I6WA 2KYZA 4DR7J 3QNOA 5E41A 3SQ1A 3LGNA 4NLRA 1ACMB 4KH6A 2CYYA 1RT3A 3MWTA 4WZMA 2RSQA 2ZZTA 3WUHA 3OR1A 5JMVA 4FKXA 4CLKA 2J8AA 3KG4A 3AVBA 2Y0SD 5FROA 2ZM6F 2ILYA 3LP2B 4EO8A 5DM6L 1H74A 2PIIA 2Y1LB 2E2PA 4DQQA 1J54A 3DLKB 1T7PA 3SQOP 3KMSA 3U02A 4NLVA 2XSFA 3MCAB 1NMEB 4NEYA 1YGYA 2V8GA 3OVNA 2WSCC 2MYFA 4M5DB 4JK8A 2IRYA 1RWUA 1ZBFA 3VEWA 3RAMA 3CJ1A 5C2FA 3IGNA 4I9LA 2DY4A 1RHMB 1GOCA 4O5FA 1UWAA 3MEDA 4DFJA 3QYYA 2AJ1A 4ZVOB 1E4FT 3W61A 1S1XB 1FESA 3AA9A 3UVJA 2A1RA 3DRSA 1S1WA 3F41A 1VQ8N 1IM6A 2KQ2A 4DB3A 3VF0B 2Z2LA 1JIHA 4JYAK 3SEOA 2HFOA 1VQ4S 3ZTRA 3BBFA 3TOQA 3AO4A 3ET6A 1KP6A 3NGDA 4QS8A 2R4FA 5M1PA 2GEMA 1URNA 4WF9L 2EC2A 3H2LA 2HW3A 3IBFB 4X4PA 1F60B 1LAWA 3HOTA 4TQRA 3DDKA 4RU2A 1FNXH 1ZM4A 3J80Y 3RSEB 4YR3A 3HHEA 4U7UK 5E33A 2CGKA 1WN7A 4BRLA 1C2PA 1FKPA 1JNRB 1ZPWX 1VQPS 1H2UX 2HHXA 2ZC3A 1CZ9A 2FVCA 4RW8A 4JV5J 4A5BA 5L38A 1RTDA 4PXDA 3CCWA 5KFFA 1SV5A 3R1LA 3NCIA 2HVEA 2CPZA 1UPMB 2FZGB 1K9MT 4OZNA 4H5NA 2CJ9A 2CPEA 2IVFB 1L3SA 2K1RA 5I3QA 2YWHA 2KVIA 2XYPB 1JXLA 5HJYA 4E0DA 1B9FA 5T7LA 2OTJN 1QQMA 3GE9A 2HKEA 3JXUA 1FI4A 1GX5A 3NG8A 4H0TB 2J0WA 4HEA9 2R8KA 1APSA 1N32K 4HTIA 5KT5A 2YPZA 4BC9A 2UZAA 4Y2CA 3RBDA 3W9JA 4CBUA 2VFRA 1RAFB 5KG3A 3IBWA 5A2QO 4AL7A 2CPDA 3JS9A 4MFBB 1PG5B 4Z7CA 4ECTA 1Q9YA 4CEBA 3F2KA 4I69A 4B9MA 3OYHA 3MM5A 1KOHA 3DWLA 1QDUB 3O08A 4B3RK 1FJGJ 2ZHBA 4BRCA 1S9GA 4LF5J 5A8RA 1H6KX 3TWHA 5KG0A 4AILC 2BH1A 5KFJA 3WNHA 3QGGA 1UOCA 4IRCA 2PYJA 4A8SA 3GE1A 4TQSA 1B0VA 3KKSA 2V51B 2FBTA 1LFWA 4HH1A 3AO2A 3RRHA 5J1NA 4H4MA 1IKVA 5DGAA 3CJCA 3L3UA 1WB9A 3M1VB 3CMAS 3C19A 5GAGI 1U1RA 3L2QA 4PXCA 2IVYA 1X9MA 5AQPA 4XPCA 3A13A 2JWLA 2FJDB 2HWTA 3CF5Q 4OJHA 4X64F 2ZFHA 3LM9A 4ES1A 3MMCB 1RBLA 5LJVA 2BANB 4ECRA 1GOBA 3CJ2A 1XHXA 2I7NA 2XTJP 4QPXA 2V2VA 4QR1A 3QLHA 1O1WA 4B02A 2JFDA 3K9KA 2W9CA 3OFFA 4HL9A 2GAGC 2GQ2A 4GVBA 4A8YA 5F3TA 1JL2A 4GV6A 2BKPA 3KG0A 5KAKA 3AY0A 4KTZA 4FS1A 2M7SA 3PACA 2UUCF 3GQCA 1VSFA 2J0XA 3ZX3A 2FBXA 4OI3A 2UXBK 1FWKA 2OI2A 1UZHA 5EGYA 4JUZA 4DCJB 5GAGU 4NA1A 5GINA 3CM6A 3PDNA 2GFFA 3C16A 4R25A 2K2PA 3L9ZA 4WFZA 4X4NA 3JSBA 1H0HB 2VHGA 1PBUA 2ASPA 7FD1A 2ZJQL 3C6UB 3SPYA 3R6MA 4CHPA 3M2UA 1WORA 4LRFA 4H4OA 4ZHRB 1Q78A 1OIAA 3V9XA 3CCRS 4N8NA 2VG7A 1K0TA 1VRTA 1MROA 1NK4A 4USMA 1N5YA 3EM1A 1UPPA 2W25A 3J7ZT 2D0PA 3VAGA 2VDIA 3I0SB 2B6AA 1CC8A 1X7VA 3B54A 4FDFA 2MKIA 4DV6K 2DGOA 2N4DA 1WSJA 3MAAA 3IWLA 2F8EX 3BDEA 4KTWA 4B8CA 2D3UA 4JBCA 1JX4A 3CCVS 3QO9A 1RWKB 4GVLA 2NUUG 5HMYA 1J5EJ 4Y6IA 4FW1A 2LECA 3LF0A 2GV1A 2V4QA 3B4DA 1QD1A 1QAYA 1R8AA 3ZTOA 3PLAA 4ZTFA 5DZ7A 4PABA 3SDEA 4CFDA 5HQ8A 4WE1B 2P9LA 3HVAA 4M3ZA 5B0EA 4RBUA 4URGA 1BQNB 2E5LJ 5A0YB 2B7BB 2H1YA 4O55A 1S49A 4QOTA 5F0UA 2Z1JA 4CE9A 2DB1A 1YTUA 3KHHA 3CJQA 2R9LA 3OS0A 2JDJA 4WYLA 3FC9A 3BQ2A 3OYKA 4CJ5A 4M94A 3M8YA 1ASVA 4QIFA 1UEVA 4FJ7A 1XNRF 1SQKA 2H4WB 4CGJA 2FJVA 1DAXA 1CJTB 3L8BA 2IMWP 3TAPA 1QY7A 3GYGA 2VYPA 4FZVA 3IRXB 2KXFA 4WBFA 4O8UA 5BYSA 3GG0A 3MGJA 4RO0A 3M2VB 1H7WA 3V9ZA 3FMWA 3Q8YA 2G1DA 4AYBD 3HOSA 2FYXA 2HBQB 1M1KT 2B4OA 2CQGA 3G6ES 1WAJA 4DR3K 1KWMA 2HQCA 3HI9A 2ALYB 4NPOA 4WJBA 4JI4J 1VSJA 3WNFA 5B7WA 4X4RA 1NPKA 3U3YA 4ZPCA 4KIAA 4YNQA 1GMWD 3PEHA 1YJTA 4DR6K 3L4BC 5AZIB 3X3UA 1JLGB 4USVA 3DOLB 2YNHA 1OY8A 1RDBA 4QIGA 4CZIA 1WKJA 5LSLA 1ESVA 1NJWA 5EOYA 3H25A 4OYMA 3KDOA 2OZSA 3BQ0A 4A62A 2QWLA 4BCAA 5F8GA 3HFVA 4HHUA 2JVRA 2HPUA 1V5VA 2QW9A 4WFAL 2YNGB 1R59O 5DK5A 4DR5F 4C0HA 3MMVA 4B8AB 5J1EA 4NYOA 2XY5A 4Y0WA 3KK1A 3IAM9 2LEPA 3BGLA 1R89A 2EW9A 4Z94A 2FBYA 1OH7A 4BE1A 4WTYA 3E9PA 2J9DE 2ZH5A 1T44A 4OJ1A 1LQ9A 2QTDA 1S0NA 2CZ4A 2ROGA 3TAEA 1HBMA 4IOCL 2WONB 2AJFE 2M8DB 1S4EA 2AEJA 2OLWA 1NGDA 4X65J 3SCIE 2Q1NA 3R5JB 3RRGA 2WFBA 3BPSP 3TNVA 3PO4A 3QETA 1AFIA 3LALA 4PRFA 4MKYA 2BOPA 2E88A 4DPOA 4CK2A 4NXNK 3GTYX 4JRPA 1DQAA 4LBPA 2KW4A 1HWIA 2KM8C 2SXLA 5J2NA 1T9VA 1VFJA 2BJEA 2BJ3A 2VKRA 3CDWA 4U95A 2F9WA 1RWWB 1HNXJ 1I39A 4DFKA 5EU7A 2OPQB 5U47A 3FBCA 1V3RA 5AQQA 2DGQA 3GG1A 4IR9A 1ZBHA 3H5XA 2RDDA 4F04B 5ETNA 2ZDOA 5B0DA 3RYLA 2PMHA 3ZT0A 2P2CB 2P9EA 3GR1A 4ES3A 1F1BB 1G6BA 2NXNA 2BBEA 3CJ4A 4ZLPA 4O3SA 3PYDA 3QNWB 1Z05A 4MO4A 1V5IB 3DLBA 3BM7A 5A8KA 2Q6BA 2PFDA 1JLFB 1FA0A 5KFZA 3R5AA 4M45A 3JTNA 4Z4EA 3I96A 4Z4IA 4PAAA 3QJJA 2QG9B 1S3XA 2UXCJ 2GX8A 1OY9A 1WDTA 3PYGA 1TR0A 1FF2A 3VA0A 1IWAA 3ASMA 4DV5F 2C2OB 2CPJA 1SUQA 1SPBP 3AOBA 4U7BA 2D0CA 2CJKA 1GTHA 3OR1B 4A4JA 2KT2A 5CD4H 4KGZB 2HSTA 3V9UA 1MWZA 2E2QA 4C8ZA 1D4XA 2D0AA 3ETMA 1K0VA 4CJUA 3FRZA 3MWPA 2DNYA 1RWNB 3TU5A 1ATRA 4HHTA 2WOMA 1Z4UA 2E66A 4ZK7M 3OHBA 5BRHA 2UUAF 3V6DB 3N0VA 1VQOS 1MA9B 2PEBA 4KH0B 3DLLQ 1EAYC 4M5JA 4K59A 2E7VA 1H73A 4I2QB 3RR7A 2X7IA 3QAEA 5IXUA 1RGIA 2X51A 4XTTA 3OUYB 4R5PA 2QWNA 2XCPA 1C1CB 4Z4CA 3BO3A 4DUTA 5HANA 2YV0X 4LF6J 3ET6B 1DTQA 4YEAA 4RW7A 1BCOA 4LFAJ 1J5OA 4Q8EA 2O8FA 3FGVA 5BN8A 1YJ7A 5LMUK 4V19X 3EVWA 4JHDB 3C46A 2IAJB 3TO8A 3BS9A 1TFWA 1QVFM 3H4BA 1KAXA 3ZT1A 1C6VA 3OVAA 4L74A 3MMAA 2V68A 2J0QD 1NGHA 5SUHA 1SIWB 4AH9A 1K47A 4DXLA 1UAXA 4M5GA 1NDCA 1UAWA 2OTLS 3HULA 1U2CA 3H3NO 4FWQA 4RW8B 2OD4A 3CDBA 2XGQA 5AQYA 3PSFA 2BGGA 3BGRA 3R9LA 3VGMA 1KD1O 4EAHD 1X0FA 5AXLA 2ZH4A 4BLGA 2HFNA 4JKFA 1F2HA 4DR7F 3MD1A 3V81A 4TYBA 3CD7A 2EG1A 2CQ2A 5CHCB 4NLBA 4CGHA 1QQOA 1SH3A 1TL4A 4IH6A 2IDEA 2BE9B 3E8OA 5T7BA 4CLSA 1S7HA 3KLHB 4I4BA 4J9KA 4CLYA 4FXDA 1T3OA 1K8AO 3ZZPA 4B3TK 2MZQA 4P71A 3HZGA 1PO6A 3UDLA 1FERA 1GLFO 4FBUA 3VMFB 1LW2A 5B8HA 2HQIA 2DCUB 2V52B 4AHSA 3NGZA 2V7ZA 1NHVA 2RRBA 3ALYA 4AE5A 2VPWB 2O4IA 3NF9A 3IM9A 3WC2A 3JAMY 4OYOA 5D4LA 1T02A 4BRKA 3FMBA 5F8JA 1FX4A 2H4YB 4DR4J 2BUNA 2D4WA 1UA1A 1S9GB 3W2WA 1WWHA 1T94A 1VHIA 5A8RB 2GMJA 3OXGA 2FHJD 1FDNA 4LQ3A 1NCLA 3FBFA 4P9SA 2RS8A 2I0XA 2VPZB 4QS7A 5JLFA 3S1TA 4FF3A 2QXFA 4DV4K 2J7UA 3BJYA 3ID8A 3UCZP 1CXUA 2R7OA 4FYVB 2N7CA 4DZ6A 3NS7B 2DPIA 2VU5A 1IKVB 2DR5A 5IFMA 1IBMK 2BKNA 1YJWN 3Q24A 4C11B 4AF1A 1T03B 3I55S 1ZZNA 1U2VA 2XNQA 1NK0A 3AY9A 2HHWA 1IUJA 4JV5F 4KB0A 5DG8A 1KC8T 1K73T 1NHKL 3O9TA 3OYIA 2RF2A 1CSJA 5KFTA 4JKAA 4KJIA 1UJ6A 4B3OA 4Q0BB 3VAKA 3PHEA 4BGBA 1EQYA 1PSDA 4CHOA 4ED2A 3MPVA 1RE1B 1IJFB 4BR7A 3OW2R 3GOIA 3DXMB 1NM1A 3UD3P 2VWJA 1AT1B 4P2SA 1GT8A 2QXLA 5JVHQ 1X8DA 5CYMA 1G1XA 2NSBA 5G4DA 1S1TA 5BR8K 1S6UA 3CVKA 2ZE2A 3OL9A 3PCOB 5KFOA 3TEGA 2Z2YB 1RAOA 3SFGA 4AHTA 2W2QP 2VODA 4KGMA 2C3UA 3FZFA