2BE2A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with r221239
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2be2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2be2A05
1OS5A 5KG0A 3ZSYA 4CFCA 1MU2A 1GOAA 4H4MA 5EWGA 3OS1A 3K59A 4JV2A 4LY7A 3LAMA 5KTQA 1EXQA 5J1EA 4K4SA 2XY8A 1GOCA 1K6YA 5K14A 4N47A 4ZVHA 4E7HA 4DFKA 3RBEA 3DOLB 4PA1A 3T5JA 4K8XA 4Q8FA 4K4YA 1X1PA 4C8OA 1HMVA 3NHGA 2DFEA 3ZSOA 4FCYA 2E9ZA 4FJXA 4HVJA 4DSIA 4O3SA 5CY4A 4ECUA 3LALA 5SZTA 4J9QA 3CVKA 1B92A 3SCXA 3VQDA 3I8DA 1HQUB 2WOMA 3OVNA 1WSEA 4CJTA 1HYVA 4OKJA 4ECWA 4IRKA 1U09A 4RZRA 4PUOB 1HARA 4OLAA 3V9XA 3VQ7A 4RNNA 3I0SB 4QAGA 1JLFB 1S4FA 4M3RA 3BQ1A 1BGXT 5HRNA 4FLXA 3FSIA 2DY4A 4BDYA 3TAMB 1I3AA 1XWLA 4CEAA 3KK3B 3N6LA 2R8IA 2JEJA 3O3HA 3NAEA 4KHRA 1RYSA 4DU3A 2QV6A 4KTZA 5KFHA 3SZ2A 2AGPA 2JLEA 1TL1B 2WK4A 5EDWA 2JC0A 3TAGA 4HUEA 2VG7B 4B9VA 2AGOA 4NLYA 1REVA 4AH9A 1RT6A 3NF7A 4C8MA 3EYZA 4TQRA 1JLEA 1WSFA 4M41A 4ZMMA 4QWEA 3OYHA 2G8FA 4KHSA 1JIHA 5FDLA 2OPRA 5KFUA 2R8GA 4QPXA 2HNZA 2W9AA 4CK3A 2FLLA 1DTTB 1I39A 2HHQA 2IC3B 3ZSWA 3AVJA 5KFJA 3LP1B 4Y1CA 1JL2A 4AHSA 3H98A 4CJRA 4KV8B 3BDPA 3HPHA 3H4BA 4FJHA 4KKOB 1C1BA 3RMBA 2VG7A 4MK9A 3M8PA 3Q8RB 1QAJA 4CJSA 1SV5B 4TYBA 3LP0A 2IBKA 4J9PA 1QUVA 2A1RA 1WAJA 3IN5A 2EX3A 4GC7A 1L5UA 4GVMA 1J9AA 3V9SA 4OGCA 3MXIA 1WSIA 5F8LA 3DRPB 2BQUA 2FJVA 1A5WA 3AVLA 1KCFA 4BWJA 2E6MA 4KI4A 3DLKB 4QWCA 1ASVA 3NF6A 3QEVA 3HM9A 4I9QA 4RW8A 5KFLA 3NCIA 4KB7A 3OYBA 3K5MA 4B8AB 5HROB 3DM2A 3SI8A 5J2QA 4CGJA 5HROA 3NFAA 4AHVA 1NK9A 4RNMA 3LWLA 1N5YA 2O5DA 3HP9A 3IS9B 4FJ8A 3VQAA 4KHMA 1T05A 1UA0A 4PWDA 2KZZA 2FVPA 4Z4EA 2YNIA 1QSLA 4CHNA 4DQRA 5KI6A 1VSJA 3U3GA 5KFVA 3AO1A 4ELUA 4NCAA 1GOBA 4B9SA 3RR8A 3JYTA 5F9NA 3KK2B 5L9XA 3AVGA 4ZTJA 2W8KA 3VQ8A 3V6HA 3VQ5A 4EZ6A 1L3VA 3M8PB 4ZPAA 4J9SA 4OLBA 5C42A 2O4IA 2FJXA 3H40A 4BDZA 4HCCA 4CIGA 3V1RA 1RT3A 4RNOA 3DLEA 5KT5A 3KMQA 4DTMA 3QESA 2C28A 4CGDA 4EO8A 4HHTA 2G8KA 3L2RA 1DTTA 3SUNA 3DMJB 4AHCA 5FDLB 3CJ3A 1S1TA 4CJPA 2WONA 1RT5A 1JLEB 3GYNA 1RDCA 4YR2A 4CJEA 4RU9A 3OYNA 3C6UA 1S9GA 3G6VA 3V6KA 4WFXA 4DS4A 4G3IA 5FRNA 4QOZB 4E7LA 3T19A 4JLHA 3PY8A 5KFAA 1N56A 2E6LA 1S1WA 1XR7A 1TAUA 3DI6B 2B5JA 1SL1A 2BANA 3MEDB 3KK3A 4CFDA 2YKMA 3V4IA 3ITHB 3LANA 4Q43A 3NF8A 1SL0A 3Q8PB 2F8TA 3MR3A 1S1VB 1IKWB 5F8GA 2W8LA 4J9NA 4DTXA 5KFWA 1FKOA 4H4OA 3KTQA 3CM6A 3LDSA 3HO1A 2ZE2A 4LD0A 2FVRA 4CHPA 4K4TA 4ZP8A 1VSFA 4DTJA 1JLGB 1QSYA 4CFAA 1RAJA 2IM2A 1D8YA 4Y3CA 4TY8B 3QIOA 3VA0A 3H5YA 3EZ5A 4B3OA 3CJ4A 4RG8A 1VSLA 4CJLA 4DQSA 2B5JB 4URQU 4DEZA 3CYMA 1HMVB 3RTVA 1HRHA 1TKZA 4ED7A 5J2PA 3KHLA 1J5OA 2IAJA 3SQ1A 3V81B 3QZ8A 3CIZA 1Y97A 3ZT2A 1J53A 3NKYA 5C5JA 1C1CB 1TKXA 4E7IA 3DOKA 1SUQB 1K1SA 4E3SA 2VA3A 1NK4A 2LSNA 2V4QA 3ZT1A 4IR1A 4K4VA 5KFCA 1S0MA 1LAWA 3PO4A 2HWIA 3SUQA 3CJ2A 1T3NA 3RB4A 4O3OA 1QS4A 1D0EA 1S1UA 1HNVB 1UWBB 4G1QA 5D3GB 3D28A 5HLFA 1WSHA 3DRSB 3HVTB 5J2NA 4EBEA 1S97A 4FJGA 4ID5B 1CXQA 2E4LA 1IM4A 4W5OA 2P5GA 4E89A 3S9HA 3ALYA 2KTQA 3N6MA 1BI4A 2AWZA 1ZBFA 2UUTA 1HYZA 2JGUA 4IDKA 2RN2A 2AU0A 1N6QA 3JYTB 3CDEA 5CZ1A 2R2RA 3QGIA 5HRSA 1YTAA 5KFQA 4J9OA 4ECSA 3RB6A 1D1UA 5EUHA 2FLPA 5KT3A 4W5TA 3SPZA 4NZ0A 3OY9A 2X6NA 3PX6A 2VWKA 1TV6B 1JL1A 4N41A 3CFRA 4CIEA 3UIQA 4PWDB 1TK8A 1KRPA 3IG1B 1RTIA 3LAKA 4FJIA 2QKBA 4CF8A 1TP7A 3V9UA 3WNGA 4YQWA 5KGWA 3O3GA 3QERA 2G8VA 1NHUA 1BHLA 3QEPA 3NAIA 4ZHRB 1C6VA 1Z25A 4DTRA 5KFIA 3CJ0A 3NH1A 2KFZA 3UR0A 4EP5A 2VG6A 4IH5A 4F4KA 4FW1A 4E19A 1JLAA 2DPJA 1JXBA 1RBTA 1NJZA 1JXLA 3ZT0A 3BGRA 4CEZA 3OYGA 4J9RA 3AVAA 2JEGA 3VQ6A 4Z4IA 4LSNA 4DTNA 1LW2B 1NNDA 1LWFB 1LWCA 4DSEA 5EU7A 5KFDA 2P1JA 3NE6A 4NYZA 3QNNA 3S3OA 1FKPA 4NYNA 4WE1A 2D0BA 3PW2A 3KLFA 2BQRA 1JLBA 2R2SA 1XHXA 1DLOB 4Y2CA 3GIIA 4FLVA 2EC0A 1G15A 2I5JA 2IMWP 2ZD1A 3VQPA 4QW9A 2HHSA 4EZ9A 2R2TA 5J2MA 4IG3A 2G8UA 4NYFA 4RW7A 3PJWA 3BQ2A 1TL3A 3HK2A 4PQUB 4HUFA 4O44A 2XI2A 1WSGA 4DWIA 4YP3A 4NLPA 4F3TA 2OH2A 3HKWA 2G8IA 5CYQB 4ECZA 2WB4A 3TANA 3DLGB 1HPZA 4NLTA 4JRPA 1NK7A 1JLQA 2I5JB 1ZYQA 4KO0A 2OPRB 4O44B 3NMAA 4K8ZA 2XHBA 3MEEA 1JLBB 2B6AA 3KJVA 4O3PA 1S5JA 4RW7B 1FKPB 3KOAA 1EKEA 4FJLA 1S48A 4HCBA 2ZD1B 4MFBB 2B43A 3JSMA 4FBTA 2OPPB 4LSNB 2G8HA 5KFTA 3NL0A 4H54A 3MXMA 2OPSB 2AX1A 1TGOA 3KLVA 3PJXA 2HMIA 3QO9B 2ZKUA 3O4QA 1LWCB 1LWFA 2IS3A 1LV5A 2V9WA 1TK0A 1NJWA 1S6QB 4OPKA 3AO5A 1S10A 4FLZA 3TWHA 4CJ4A 4ZHRA 4BWMA 2RKIA 2DFHA 1HQEB 5I3UB 2HNYA 2D3ZA 3PW7A 2KFNA 1C0TA 4E7JA 1C0MA 1XR5A 5KG6A 4E0DA 3DYAA 2VWJA 3OYFA 2OZMA 4EO6A 3RAXA 3S3NA 3H5UA 4DFJA 4DL6A 4CE9A 3LZJA 1EETA 1LAVA 4BE0A 4NLOA 3ZSQA 4XO0A 1KHWA 1IH7A 3QIPB 4DU4A 3MF5A 2F96A 3H5XA 3E51A 4I9LA 1C1AA 2FVCA 4CERA 3SQ0A 1KTQA 3HPOA 3HHKA 4FK0A 2ITGA 3ZSRA 4FXDA 4KAZA 1N6QB 3ASMA 3E01B 3VQBA 4RW6A 4O55A 3MAQA 4XIUA 3ZT3A 3U3YA 4TYAA 1S1UB 4NLDA 3UDLA 3V6DA 4OKEA 4EBDA 3VQ4A 3Q8SB 4CF9A 4K4WA 4MK7A 5E41A 3ZSZA 1S0OA 5J2NB 3HVTA 4RW6B 4O0JA 3RR7A 1RT1A 1BCOA 4ECYA 3G0ZA 4G1QB 5D3GA 4KFBB 3WNEA 2BE2A 4EP4A 3KK1A 1QE1B 4M94A 5FROA 3V81A 1RYRA 4FZYA 4KB1A 1L3UA 4NLVA 4NLXA 4TY9A 2I1RA 3OL6A 5HP1A 3AO4A 3SV4A 4RNFA 1LW0A 3TARA 3GV8B 3AO2A 3PZPA 3HP6A 4O0IA 1EETB 3OYCA 5KFPA 4PY5A 3TAQA 3GQCA 3AVCA 4KHYA 2Z1HA 4K50A 3U6FA 4FM1A 1XHZA 2QK9A 5DGAA 1D9DA 4MKBA 3OL9A 1D9FA 4J9KA 3OYLA 3C94A 4ZP9A 3V9WA 2FLNA 1J54A 4RW4B 4J2EA 4IKAA 3KLHB 1T94A 2XGPA 2CKWA 2YHAA 4ZPBA 2YHBA 4I2PA 1EX4A 2HNYB 1HQEA 5I3UA 3MTKA 4O4GB 4QWBA 3OYJA 3VQ9A 4TY8A 5KT2A 2HW3A 1W25A 1QAIA 1IKWA 1S1VA 4URGA 1JLGA 3RBDA 4QWAA 1YVUA 5JS2A 4Y34A 4KHQA 4H4OB 1FK9B 3FRZA 2OPSA 2AGQA 2GUIA 4BACA 1TK5A 1S6QA 2X74A 1B9FA 3TR8A 4DQIA 3NGIA 5DQIA 3V4IB 4W5QA 1TAQA 4MFBA 1CLQA 2J6SA 3C6UB 1QTMA 4JV0A 3F9KA 1RT5B 2VA2A 4DG1B 1N48A 4F2SA 2P51A 3D45A 4ZPDA 3OL7A 1TVRB 3GILA 5KT7A 3D5MA 4KO0B 2D41A 4J2AA 1SH0A 4M3WA 4ZVFA 1NKCA 2HHUA 2QKKA 3KLEA 1BQMA 1KLNA 4M3UA 4KTWA 3TAEA 4YR3A 2DFFA 3CWJA 3DLEB 2WHOA 3HYFA 5C25A 5KT6A 3T5KA 3RMDA 3MXJA 3AV9A 4KAIA 1XC9A 1DTQB 1S9EB 4DQPA 3GIKA 1IKVB 3EY1A 4DL2A 5J2MB 1ZTWA 3M9OB 2YNIB 2ASJA 3KK2A 3H08A 2YKNB 5KT4A 1CSJA 3OJSA 3TABA 3BGRB 4CHOA 3VQEA 3KHHA 4WYWA 2IA6A 3P1GA 3ZSXA 4FJ9A 1RTJB 2VG6B 4DTOA 3I5CA 5DLGA 3G86A 1WSJA 4O3QA 4U7CA 3FFIB 4IFYB 3D0PA 2XI3A 3TI0A 2D5RA 3WNFA 4DSJA 4J2BA 3TVKA 1RNHA 3O3FA 5FRMA 5KG7A 1JLAB 4QW8A 1FXXA 2FBYA 1KVBA 2F8SA 4EYIB 5L1LA 3FFIA 2HNDA 4IFYA 2XY7A 5EWFA 1R0AB 4RW8B 4N5SA 1L3TA 3KMSA 2VG5B 5KFZA 3DLKA 4NCBA 1NJYA 1TKTB 3VQQA 4Q44A 3IG1A 3LPUA 3OYMA 5DG7A 3K57A 4IDKB 1Z26A 4ED8A 1TV6A 3LP0B 4FS1A 3FDSA 3KNAA 3G10A 4FM2A 4DS5A 3OSNA 1YVFA 3LP2A 1UA1A 3H59A 4JV1A 4M45A 5C25B 2W7PA 3V9ZA 3DRSA 2GIRA 2DTUA 3RRHA 3SFUA 3TQ1A 4ECRA 5HRRA 1HNVA 2HHWA 2RDIA 3V1OA 4W5NA 3EPGA 2WRMA 4CHQA 4DF4A 1KVCA 1SKWA 2RF2B 1JKHB 3RB0A 4C8NA 4KV8A 3KHGA 2IJNA 1TVRA 4CESA 3QLHB 4IQXA 2Z1IA 3AVFA 4FLWA 1SUQA 3DOKB 3VQCA 1UWBA 2GIQA 3S3MA 3OL8A 4ELTA 2GC8A 2V0NA 5KG3A 2J6UA 1HYSA 1S9FA 4ID1A 5KFNA 2X78A 1ASWA 1S1XA 1U4BA 2HHVA 1NOYA 1TKDA 4QCLA 3MECA 2KZMA 3AVHA 3H5SA 4JS5A 1ZBUA 4RW9A 5T7BA 4DF8A 4B3OB 4FK4A 1WN7A 4NRTA 1YT3A 5J2PB 3I0SA 4M3XA 4CEQA 2JC1A 3N6NA 5L1KA 2R7YA 2ZE2B 4HTUA 2WOMB 1HQUA 4Z0UA 1RT4A 4K4UA 3L2VA 4FJJA 4Q45A 2XGQA 3PX4A 1RT4B 4Z4HA 1RBUA 1UAXA 1NOZA 2A1SA 2HHTA 4I2PB 4AHTA 2BGGA 4CEEA 2BANB 3MEDA 4DL4A 4X2BA 3KLHA 3P83D 3OYEA 4MIAA 3P5JA 1JX4A 4FZXC 1W9HA 3HPGA 3OHBA 3DOLA 1FKOB 1WNEA 2FVQA 3HVWA 4Z4FA 5JXSA 3ITHA 5HBMA 4DFPA 2W9BA 4ED6A 4CJQA 3L2UA 4RUAA 1S1WB 4H4MB 5KFBA 1MU2B 1S1TB 3ISND 1ASUA 1HYSB 1CZBA 1Q8IA 4DL7A 2O4GA 3DMJA 3G6YA 4Y1DA 3NGZA 1Q9YA 4NCGA 4CJKA 5DG8A 1S9GB 5J1EB 3FQKA 4O5BA 1ZBLA 3DLHA 4L8RB 4KI6A 3AA5X 2KQ2A 4ZP7A 2WONB 3PW5A 1U47A 1RT3B 1IO2A 4TQSA 3G6XA 5DK5A 5C42B 4CEFA 1T03A 1NHVA 2BR0A 3BSOA 1VRUB 4ZP6A 4FJ7A 5CYMA 3I5AA 4FBUA 2ILYA 3K5OA 1VRUA 2UVUA 4F4WA 3QYYA 1KSPA 1UOCA 1C0UB 1VSHA 2FC0A 1D5AA 2XRIA 4F4ZA 3LP2B 1KLMA 4CF1A 2XCAA 3SJJA 1ZBHA 1KHVA 4NCGB 2X6SA 3AVIA 3HVRA 4DLEA 2OA8A 3QIPA 3AVNA 1TKTA 4OGEA 4I2QA 1SH2A 3QGHA 3OYKA 3SQ4A 1GX6A 2ILZA 2W9CA 1U04A 4CEDA 4WYLA 2R8JA 3OJUA 4CGFA 2W9BB 1R0AA 4ICLB 5HBMB 3HL8A 4NLRA 4MIBA 5DQHA 4J9MA 3DYAB 3CO9A 2RPIA 4ECVA 3QGGA 4JS4A 4GMJB 3IS9A 5KG4A 3HJFA 2E9TA 1N5YB 4TN2A 4K4XA 4E7KA 1HNIB 2RKIB 4FYDA 3DLBA 4WZMA 3QNOA 3NH0A 3RB3A 3L2WA 2HVHA 3OHAA 3DM2B 3TAPA 3PO5A 4YMEA 3LP3A 4DTSA 4DTUA 3QO9A 2AQ4A 2OPQA 4I7FB 4ELVA 3K5NA 4B08A 3C95A 4URSA 4GC6A 4IH7A 1N4LA 5KFRA 3T3FA 4U6PA 2UVVA 4ED3A 4B9LA 4ECQA 2HAIA 5KRSA 1SV5A 4KREA 4MKAA 4ZVEA 5KFMA 3BJYA 3KJVB 4N56A 2B6AB 1QQCA 4KKOA 4IH6A 5DGBA 2PYLA 4B9NA 1RDDA 4HYKA 5F8MA 4YNQA 1S1XB 2NUBA 1LWEA 3CDWA 3M9NB 3LP1A 4C8KA 5KFFA 1RT7A 4KHNA 4FK2A 1BQMB 2AJQA 5CYQA 4TLRA 2IGIA 1IKXB 3T5HA 4DSKA 3DLRA 2XC9A 1CZ9A 3SFGA 2BDPA 1YTUA 2Y1JA 3QLHA 2YNHA 1TL3B 4CK1A 3CM5A 2D0AA 3GIJA 3GV5B 2ATQA 1JKHA 1KFSA 2IC3A 4FVMA 4LH4A 1IKXA 2XY5A 4FLYA 1VRTB 5L1JA 3IAYA 2Y1IA 4OVLA 1TL1A 4DG1A 3KLFB 4IR9A 4AHRA 1NK6A 3HXMA 3THVA 1RT6B 3B6PA 2D3UA 5KFGA 1REVB 1RCHA 2WTFA 4ED1A 3UQSA 2R8HA 3RMAA 4CJ3A 1RA7A 3PVXA 2YNFA 5KFYA 4KB0A 3LZIA 4DU1A 5KFXA 4CEOA 4FLTA 1JLCA 1JXEA 2RDJA 3F73A 4W5RA 4WFYA 2VG5A 2ETJA 3TAMA 3BQ0A 4F3OA 3LPTA 4N76A 1SKRA 1JLFA 1TQLA 4LSLA 2HHXA 1O1WA 4M42A 4CF0A 4DMNA 1A5VA 4OJRA 4IRCA 1WAFA 3ZCMA 3OS0A 1X9SA 4OPJA 4WFZA 1GX5A 3A2FA 3BSCA 4TXSA 5KG1A 4KE5A 4ZPCA 3ZSVA 3PX0A 3TAFA 4DL5A 2Z1GA 3I5BA 2C22A 1VSDA 3MFHA 1NK0A 3VN5A 2G8WA 3UPFA 4ICLA 3I0RA 3HSTB 2ATLA 3OLBA 3SNNA 2HVIA 4IG0B 3NBPB 1Q9XA 5HP1B 2YKNA 4CF2A 5F8IA 3K2PA 4M3YA 1VSIA 3QETA 3V1QA 4CJUA 1IKYA 3L3UA 1QE1A 2IM1A 1KVAA 1RT1B 2QXFA 1IKVA 1RDBA 4ID5A 1KLMB 1BIZA 3L8BA 3AVKA 4CHYA 1DTQA 1S9EA 3QEWA 5L1IA 2YV0X 4ED0A 4DQQA 5JS1A 1ZTTA 1C0UA 2EHGA 3KLGA 5KFOA 5F8JA 3C6TB 1RDAA 4LQ9A 5EWEA 3V6DB 1RBSA 3QZ7A 3KLEB 1U45A 3M8QB 4CGIA 4FJNA 2ALZA 3E01A 1BQNA 2JEFA 2PYJA 1C1CA 1TKXB 3RWUA 3PHEA 2OYQA 4IFVB 4HKQA 4WXOA 4E1NA 2ASLA 1J5OB 3QIDA 1RTDB 4DSLA 2YNGA 4LQ3A 4AHUA 2FBVA 4JUZA 1MMLA 4NLUA 3MEGA 3M8RA 4CCHA 4FLUA 5DG9A 5KRTA 1EP4A 4CGGA 4HUGA 4IKFA 2DPIA 3ULDA 1ZETA 4RUCA 2IDOA 5KG5A 3VA3A 2GV9A 3KHRA 1C0TB 1RA6A 3PW4A 2PZSA 4B9TA 3IRXA 3PUFA 4E1MA 4CJFA 5KG2A 4J9LA 4EBCA 3BREA 4B9UA 2UVRA 3L2QA 3ICLA 2QE5A 4J2DA 3Q8QB 4AILC 2IOCA 4NLQA 2IM3A 5F9LA 4DFMA 4QWDA 3DI6A 3EPIA 2GBZA 1NKBA 5C24A 5DMRA 4C8LA 1L3SA 1HJRA 4F50A 4BE2A 4RW4A 4K4ZA 3QEXA 1RTDA 3KLIB 4KRFA 5KFEA 3IGNA 4RW9B 4R5PA 4Q0BA 4TSXA 4KTQA 2KW4A 3OYIA 3H4DA 1RBRA 1RT2B 3MEGB 3MECB 2UVWA 1BQNB 5F8HA 1BIUA 1SH3A 5F8NA 4DSFA 1HPZB 1C2PA 3DLGA 4RNHA 4BDPA 2D0CA 4B8CA 3KK1B 2B4JA 4CECA 3AA3A 3V6JA 5HRPA 1RDRA 5DQGA 3SV3A 3M8QA 5I42B 4NLGA 3LWMA 2E9RX 3KIOA 2IM0A 4IG3B 2RF2A 4YR0A 3NDKA 1QSSA 1IKYB 2J6TA 2FBTA 3FQLA 3GIMA 3KLGB 2C2RA 4EYHB 3RRGA 3NBPA 4Q8EA 1KFDA 2R8KA 4IG0A 2C2DA 3PR4A 3DRRA 4ECTA 2HWHA 1S6PA 4KSEB 3BR9A 2BRLA 4KHWA 3DDKA 3OSPA 2HB5A 3K58A 3QEIA 4O4RA 1BISA 1T05B 3SUPA 3M9MB 4Q5VA 3MR5A 1BL3A 4FJKA 4DL3A 4M95A 4F4YA 2XY6A 3I0RB 3SI6A 3HVAA 2XCPA 4H8KA 3MR6A 4CFBA 4YFUA 2R2UA 5J2QB 4FS2A 1U49A 4LSLB 5KGXA 3T5LA 2HNDB 4CJ5A 3PR5B 4CJWA 3CDUA 4NRUA 1JLCB 2IJFA 4JRQA 1B9DA 3DRPA 3CFPA 1S49A 1RILA 3OLAA 1ITGA 5SWMA 3KKRA 4KBIA 1F21A 4O3NA 1S6PB 3KD1E 2HMIB 1RTJA 3KKSA 3BSAA 2ASDA 2UUWA 3SPYA 1T8EA 3MR2A 3AVMA 3NF9A 3AO3A 2W42A 2YNFB 4BE1A 4DTPA 2V4RA 4DLGA 1BI4B 2OPPA 3SYZA 3JSMB 2AX0A 3L3VA 1C1BB 1SL2A 5CZ2A 4KPYA 3DRRB 4NLSA 3AA4A 3H2LA 5I42A 2W7OA 3MEEB 4CGHA 4M3TA 1WNSA 2BQ3A 4CEBA 1JLQB 1VRTA 3AVBA 5KFKA 4ZTFA 4CK2A 4LH5A 2HNZB 3BSNA 1RT7B 4WXWA 3NGYA 1IG9A 1VK0A 2YNHB 2PY5A 1LWEB 4B9MA 1SKSA 4Z4GA 3CFOA 4FW2A 4PQUA 3RAQA 2BRKA 3T1AA 4R5PB 4Q0BB 4FJMA 4IOBA 2IAJB 4OKKA 3OYAA 1TKZB 2XWYA 4R0EA 2OZSA 1DLOA 1RT2A 1X9WA 4MQ3A 1VSKA 1NKEA 4XPEA 2CJQA 4IBNA 4M3ZA 5C24B 4F2RA 3RMCA 4WE1B 3OS2A 2Z1JA 4I7FA 2OPQB 3KLIA 1I6JA 1XI1A 1LW2A 1NK8A 2D7SA 4ECXA 1RBVA 1S0NA 1VSMA 1FK9A 4PUOA 3ZT4A 2Q3SA 2C2EA 1K1QA 3OYDA 3SUOA 2FBXA 3HT3A 5KFSA 1ZBIA 3KD5E 1QHTA 2ZQBA 4F8RA 3NGDA 3ISNC 4EEYA 3CG7A 4FJ5A 4UQGA 3VQSA 1U48A 3EZUA 3B6OA 3AA2A 2YKMB 4Z4CA 2XO7A 4O4GA 1HNIA 2F8EX 2JEIA 4O3RA 4CHZA 3IRXB 2W9CB 4F4XA 4FM0A 1T7PA 4I2QB 4MK8A 4ZVGA 1RTIB 3GV7B 4FZZA 2FJWA 4ED2A 5K14B 1NK5A 5DLFA 4MH8A 2YNGB 3M8SA 3IGVA 1XR6A 3K5LA 1NJXA 4IFVA 1EP4B 1Z4UA 1RTHA 3QINA 1W0HA 3SQ2A 5T14A 1LW0B 4XPCA 4GW6A 4Y2AA 1BCMA 4WZQA 4NLWA 4CIFA 4R8UB 2BE2B 4KFBA 2FVSA 2WCXA 3CQ8A 5JUMA 4CJVA 4R8UA 1X9MA 1CXUA 4IRDA 4OL8A 3WNHA 5HLFB 3NH2A 3PW0A 3PV8A 5CYMB 3CJ5A 3C6TA 1T03B 4KHUA 3MFIA 1VSEA 1WLJA 2P5OA 1A5XA 1RTHB 3NAHA 3O4NA
chains in the Genus database with same CATH superfamily
4H4MA 5EWGA 4GVEA 4JK7A 1MMDA 1F0XA 3CJRA 4NXMJ 1HNZK 3OR1B 4DV3K 2XS7A 2XY8A 4N47A 2UV8A 2CQPA 3VQTA 2Q97A 3PRBA 3DOLB 3CCWA 4YB1P 3T5JA 4C8OA 3FK4A 3ZSOA 1LKZA 1NJIO 1EKRA 4JD2B 4DSIA 1FDAA 1HHQA 3AAPA 3D1QA 3KG0A 4J9QA 5DDPC 3KYLA 3CVKA 2M8HA 3SCXA 3VQDA 1A9NB 3ILLA 4LF2A 1MN9A 4UT4A 3DNCA 2YY3A 1VOMA 4B3SF 1KQSR 1ZM4A 3TZZA 5DM7L 4QAGA 3W3DA 4ZOSA 5U47A 5HRNA 3SSQA 4FLXA 5DDQC 5AE3A 2DY4A 4BDYA 2DITA 4CO1A 1XMQJ 3AD8C 3N6LA 2EWSA 3O3HA 2QA4N 3NAEA 4KHRA 1BLUA 1AA1B 2QV6A 5KFHA 2AGPA 4ZVUB 4PXBA 2PIIA 2V52B 2VQFF 1BXNA 2JC0A 3TAGA 4NZ7A 1V3RA 4B9VA 4YDUC 1JLEA 3MD1A 1NMNA 1UEVA 1SJQA 2YKAA 4J37A 5C2CA 1YRUA 1BA0A 4YOXA 3DOMB 2G8FA 1KR4A 1JIHA 2EG1A 2R8GA 3H0PA 4QPXA 2HGNA 1R59O 1T6CA 3UCGA 2EVZA 2O8BA 2HHQA 1YKWA 2IC3B 5IQQA 3LP1B 2ZH3A 4QOTA 3H98A 1WORA 5EN1A 5A8WA 5EY4A 4DV0K 4KKOB 1FD2A 3KVGA 2XS5A 3IN5A 4JI5J 3WBZA 1JMTA 1M1HA 2EX3A 5HMXA 1WJ9A 3UDVA 3GCXP 4OI2A 5M2UA 4JKHA 1WSIA 1KCFA 1RSCA 4JV5J 2HFZA 1PC5A 2CPHA 4KI4A 1UWAA 4QWCA 4C11B 3EEQA 5GADI 4X4UA 3E66A 3FGVA 3PJ9A 2J0QD 5E0OA 3D7SB 1VQOS 2D0OA 3NFAA 3MWBA 2E2PA 4UY8T 4ZVTB 3LWLA 2P9KB 3H1QA 3CCZA 3ENOA 3HHDA 1YX2A 1RUSA 1RHKB 2VC0A 1T05A 4Z4EA 1NGGA 2YNIA 2YH0A 1QSLA 2QLJB 3TWZA 4DQRA 1ZC6A 5BRFA 4LIWA 3AO1A 4QR1A 4B9SA 3SCKE 3RR8A 4LF5K 2DRAA 2ZJQL 4XAKA 2AJ1A 3VQ5A 1T9TA 4EZ6A 2RU3A 3CCRS 1XNQJ 3OTDA 3H40A 4CIGA 1RWWB 1KVJA 4WF9L 3F2KA 3BF3A 3V1RA 1RT3A 4RNOA 4DPWA 5KT5A 1WG1A 4AQYK 3KMQA 3VVTA 4X4PA 2C28A 3JS6A 3L2RA 5FLXY 2AV5A 2OHDA 3VETA 3R3TA 2ZDPA 3CJ3A 4CYUB 4ES1A 2J0SD 3NP5A 4NI2B 4RBTA 4CJPA 3LH2S 1YBAA 2LEAA 4YR2A 2WC9A 4CJEA 3OYNA 3C6UA 4ZCIA 2UUBF 2O8DA 3BH6B 5FRNA 4DR2F 5ITHA 2P9IB 3M8ZA 1MDUB 3PY8A 1XR7A 1TAUA 1M5HA 4CFDA 3DHXA 3PYDA 3DRYA 1SL0A 1S1VB 5KFWA 1FKOA 3KTQA 3LDSA 2UXCK 2VICA 5A0YA 2DXDA 3AD9C 5GMDA 3H2VE 1QSYA 2YQ3A 3MX5A 1D8YA 4Y3CA 1EQMA 4Y0WA 3H5YA 3CJ4A 1B70B 3PLAA 2FQQB 1VSLA 4CJLA 5HJXA 3OUYB 2ZGYA 1TKZA 3RG6A 5J2PA 4Y65A 5RUBA 2J4RA 3KHLA 2F9DA 2IAJA 2DJWA 3A5NC 2CVIA 4Y28C 5C5JA 4NASA 4E7IA 2LP4A 4E3SA 2VA3A 2X1GA 2GV1A 2V4QA 1AZSB 4IR1A 2O01C 3H90A 4DV2F 2V67A 4AM6A 2HFSA 5JMNA 2NLXA 5LSOA 2HWIA 3SUQA 4O3OA 1WC3A 1VQKS 1S1UA 1UWBB 3I82A 4G1QA 1Q8BA 2C3MA 3D28A 3J80Y 1FTRA 1YJWS 4Y00A 3DRSB 1WDDA 5J2NA 2C2KB 1S97A 2RNEA 4ID5B 1X31C 2VJVA 4PZVA 1IBLK 3O6QA 4CLLA 4W5OA 2P5GA 1YIJS 4E89A 2O3DA 1OH5A 1FNMA 4ZPVR 1ZBFA 3VV2B 4H03B 2O8CB 3M8YA 3UNGC 2RN2A 2AU0A 1N6QA 4F7VA 3OV7A 2NYHA 3VGUA 3EJMA 3EGZA 1CJVB 3J7ZO 2OANA 3RB6A 5KT3A 2NRRA 3RAMA 1FXRA 2VWKA 3G87A 4CIEA 1VLOA 4PWDB 2CVEA 4U9RA 1RTIA 1HI1A 3AODA 1NUEA 5D0RA 3WNGA 3LDQA 5BREA 1BHLA 2UXCF 1C6VA 3GG4A 3THTA 4DTRA 2F7VA 4LT6A 4FYXB 1GXLA 1FESA 3UR0A 4FWLA 2Z8QA 2EXUA 3I33A 4C23A 1AYEA 4F4KA 1RGVA 2MY7A 4OZ2A 2W6KA 4QYZK 2DY1A 4YOUA 1NJZA 2MLZA 3ID6A 3ZT0A 3OYGA 2HIYA 4J9RA 1A6LA 4TNOA 3AVAA 2JEGA 4LSNA 4DTNA 3RJMB 5EX5A 1NNDA 4DSEA 4A47A 1VHXA 4XDCA 5KFDA 3ZLJA 3NE6A 4JKBA 3S3OA 3QQCD 3M6VA 2XM3A 4WE1A 3PW2A 3KLFA 3D0HE 2R2SA 3CMES 3VAHA 2VQFK 3S01A 4JB8B 3GIIA 2I5JA 2WUSA 3PACA 1UMJA 1M5SA 3CDBA 2IMWP 3PYEA 2CQHA 5J2MA 1G6BA 3WQPA 4RW7A 3PJWA 5GAHI 4PQUB 3GYGA 3IWXA 4PR6A 2VPWB 1MSWD 2AP6A 2XI2A 3D2WA 4EIAA 4YP3A 1WELA 2G8IA 2D4WA 3DLGB 4NLTA 4UOCA 1CS4A 3WEEA 4JHDA 2I5JB 5K8NA 1KNZA 1ZYQA 3AGRA 2CJAA 2OPRB 4O44B 1XC3A 1H74A 3SCJE 2XHBA 3MEEA 5BYSA 3TVZA 2B6AA 2VCPA 5C2FA 3R1LA 1S48A 3K17A 2ZD1B 3ZX3A 4A8MP 5HL7L 1HKAA 5M1QA 4FBTA 2OPPB 2Y1LB 6FDRA 1IWAA 3NL0A 1Q79A 3KLVA 1HBOB 3CNQP 4QU6A 4H5TA 4LRDA 3KK7A 5AQZA 2AZ1A 2PN6A 3PJXA 4YHHJ 2BE7D 3O4QA 1GTHA 4HEA9 2GAHC 1LWCB 2B4UA 2V9WA 2CJKA 3AO5A 1S10A 2E1ZA 1N36J 3TWHA 4CJ4A 4BWMA 3CI5A 2RKIA 4CWBA 1YWXA 4V19S 4ED4A 4U96A 1T02A 1N34K 1V9OA 3VF6A 2GVDA 1T9WA 4H0XB 4EO6A 3S3NA 4CE9A 2A10A 2G2OA 1EETA 1UVJA 3QFWA 1LQ9A 1Y3KA 2HBYB 4NLOA 1KHWA 5TKWA 3GLJA 3QIPB 4DU4A 2BUPA 3I32A 2F96A 3G71S 4H0PA 5AQHA 3P8BB 2BVZA 4RX6A 3HOTA 3VCDA 2ITGA 2AEFA 4Z7YA 5D0GA 3T69A 3ASMA 4WKRA 2KT5A 3UWTA 1G7CB 1TUYA 2AW0A 1K8AO 1RK8A 4Y0FA 2P9PA 4LRFA 4NLDA 5BRHA 3VQ4A 2CFXA 1KQFB 4PCQA 3ZSZA 1S0OA 2HF3A 4B17A 1G99A 4RW6B 4F4AA 2VODA 2W40A 3G0ZA 5D3GA 5AQUA 3WNEA 2BE2A 4XEIA 5K8PA 4AQYJ 1YZ7A 2DNKA 1KP6A 2BW2A 1L3UA 1U0SA 4HT5A 4NLVA 1VQ9N 3HFZB 3IFEA 3CCTA 3D2FB 3KHYA 2DHSA 3T1HF 3HP6A 1YJRA 3JTNA 3AVCA 4YDUA 4AXJA 4RJVA 1FI4A 2RS2A 4FM1A 2YQ0A 2H65B 3FEZA 1Q1KA 4IKAA 3CCSS 2XGPA 3A8IA 5A0YB 4ZPBA 3ZZOA 3IXQA 4I2PA 3AFGA 3M2RB 4ANDA 1TYQB 4O4GB 5C7PA 1S4EA 4AL6A 3VQ9A 5KT2A 3CMEN 5F3ZA 1W25A 4TLQA 1S1VA 4URGA 1JLGA 3D3CJ 3G82B 4AT1B 4FPRA 1H6KX 3CIMA 1YVUA 1R6YA 1TELA 1GNKA 4KHQA 2X1AA 2OPSA 2GUIA 2XHWA 1IJFB 3TR8A 2VKZG 1Z6RA 4DQIA 3J81Y 3RUBL 1DGKN 5AQIA 3TJ9A 3GU0A 1TAQA 4MFBA 1SBRA 2J6SA 3C6UB 1QTMA 3AA8A 2VA2A 3R8EA 4I0WA 2MKCA 1HKCA 1KOHA 4ETXA 2FPHX 1N48A 4FWMA 2P51A 3AOBA 1T95A 3EDRB 4ZPDA 1GLBG 5E3CA 3WXLA 5LL6Z 3DLJA 1YXQA 2NQPA 5H9EK 3HSGA 5KT7A 2D41A 3WDOA 4J2AA 4L74A 3VZIA 3CCMS 4C2MA 1Q53A 3KLEA 4JI4K 1YSJA 4DV4F 4M3UA 4KTWA 5CHCB 4YR3A 2F4VF 3CWJA 3HYFA 1R6VA 3MXJA 4KAIA 3J7YU 4DR3J 1S9EB 3IC1A 3WXJA 2DNQA 1IKVB 4DL2A 5J2MB 2NZ4A 1PGZA 3GE1A 4DR7F 2YNIB 1PBUA 3KK2A 3C6AA 1CSJA 2K3KA 2ZH5A 3OA9A 4HDGA 2E66A 3IAS9 1WHVA 4WYWA 1H73A 1HHSA 4YORA 3I5CA 2NLWA 3D0PA 2D5RA 2DGSA 3FKBA 2FSKA 1OYDA 1QAYA 3D6TB 5KG7A 3VAKA 3BBCA 1SC1B 1QD1A 4YOVA 4BHQA 2F8SA 2A2CA 2F9WA 5L1LA 2XWXA 4IFYA 2DGOA 1Q86O 1R0AB 3Q8VA 2VG5B 2DPNA 5KFZA 2EKNA 2LMIA 2AD9A 1IN0A 3DLKA 4OI6A 1TKTB 1F5CA 1Q5VA 1WG5A 5DG7A 2BOAA 3QRPA 4ED8A 5BN9A 3FDSA 1RGIA 2Y1RI 4R0JA 2KJWA 3OSNA 5D6GA 3H59A 4DHVA 3R2CJ 1K0TA 3L4QA 5C25B 4R25A 4FYWB 1YJ9S 1OQ6A 3V9ZA 2V50A 4I6MB 4BR0A 1E6VA 2FY8A 3DGPB 3RRHA 4LF6J 1HNVA 1T6DA 4BROA 4NEZA 1YJWN 4CHQA 3S6EA 1SKWA 4AFFA 4C8NA 3KHGA 3UVJB 2GX9A 2NRZA 4IQXA 4LF5J 5AQKA 5BN8A 4OO1J 3DOKB 1RADB 2A6AA 1FRIA 4JI4J 4CZMA 3SDEA 2DH9A 4CI6A 4WKYA 5B0GA 4JP8A 1FF2A 3MUTP 4ID1A 2J7UA 1ASWA 4K42A 3AOCA 1TKDA 3BF4A 3KZBA 3DU5A 3K9JA 4M7YA 5T7BA 1VFJA 3UN5A 4RU2A 2N4CA 1WN7A 2Q31A 2WSFC 5CR4A 5J2PB 3I0SA 3OPKA 2XG8A 3U1LA 4BCAA 2B9WA 4M3XA 3FUYA 4DV5K 3OT9A 2R7YA 4OYPA 2ZE2B 3M6WA 1OY9A 4FJJA 3LW5C 1TFYA 3AXMA 4Q45A 3DN9A 2F7TA 2AMCB 3RSEB 3VEYA 3O9TA 1WEYA 2QT7A 1N52B 4LVNP 4DU7A 1U8SA 2BANB 1TR0A 4X2BA 3KLHA 3KJFB 3OYEA 3P5JA 3CJ7A 4FZXC 1FKOB 2FVQA 2JSXA 2KB2A 4Z4FA 2Y8YA 4A8SA 2VC1A 2MMYA 4CD3A 2GMHA 2ZC4A 3J81U 4RUAA 2RMLA 5LY3A 5E3AA 2K06A 2KHCA 3U7JA 3ISND 4WP3A 1ASUA 1Q8IA 1CZBA 4NEYA 2IHR1 4Y1DA 5DG8A 1S9GB 3CMQA 3DLHA 1GLDG 1NLVA 4BR5A 4OX6A 2KI2A 4ZP7A 1SJ1A 4Z7CA 4NXMF 5B08A 3GJSB 1HBMA 3UCUP 3MOZA 2VGNA 1P1LA 3QMLA 5DK5A 4MO5A 4OZNA 4CP5A 3EXCX 1NHVA 3AARA 4HLBA 3BY5A 3VGTA 1VRUA 1W7WA 4CT8A 2UVUA 2ADCA 1KSPA 1C0UB 2XRIA 1DARA 2AIRB 1Z2ZA 2NXCA 3HTVA 4BGAA 3LP2B 5EX3A 3TQEA 3E9OA 1KHVA 1QVFM 4QYRA 1X60A 2OA8A 3AVNA 1LWXA 2HF4A 1TKTA 4OGEA 4I2QA 2Z0GA 1GX6A 4IZ9A 3BO4A 2C2NA 3CCLS 3GPAA 1U04A 2K8GA 4CGFA 1R0AA 4HT7A 5HBMB 1HWUA 3HZEA 5C12A 3FCWA 1PJ5A 2C1EB 2D69A 6FD1A 4C0OC 4GMJB 2RD5C 5KG4A 1RFQA 2KFYA 2P9KA 4E7KA 1NJIT 4FYDA 3PKMA 2Q1LA 3UDEA 3NH0A 3RB3A 2HVHA 3L2WA 3DM2B 2V2VA 5FPDA 2J7KA 2VF3A 4DTUA 5GAGI 1EAYC 3VAIA 4WBFA 5CXTA 2CH6A 3FZHA 1IBMJ 4URSA 2GO9A 1SB6A 1U2VB 2F5GA 3FZMA 5BR8F 4ECQA 4B1VA 2IPOB 3TTDA 4KREA 4MKAA 2FSJA 1VBYA 3P45B 3KJVB 1QQCA 4X4QA 4H5VA 3CC2N 1VCTA 5BXIA 2HQCA 4B9NA 2MQLA 2BJ7A 3WIVA 4YNQA 3LM2A 3CCMN 4LF7K 3W8PA 4MIWA 2E5GA 2E5LK 2V2KA 2IA0A 4KHNA 4C8YA 1RT7A 1BC6A 4A5BA 4DSKA 2XC9A 3HRGA 4IJAA 2Z2YB 2GHWA 4DV3F 2BDPA 3SMSA 3QLHA 3NY0A 1U26A 2JVOA 1FNXH 4B3RF 2IC3A 3QBCA 1IKXA 3BKTA 1VRTB 4OVLA 1N5QA 2A2DA 3J7A1 5AXMA 4DHYA 1Y10A 1GTEA 4AL7A 2H51B 1REVB 5K8MA 4ED1A 1KXPA 3P5TL 4IYQA 1S79A 1UFKA 2XS2A 3HSDA 2IRXA 5KFXA 3EVOA 2UUAJ 1B7FA 1WC1A 4KGVB 2DH8A 4WFYA 3MM7B 3O2IA 1RJJA 1FXLA 1H98A 1O13A 5E5NA 4LSLA 3ZFVA 3ZCMA 3O5TB 2XTJP 4WFZA 3RGIA 3BDEA 1OSDA 2DHAA 2YJFA 3CMAN 5KG1A 3DAWA 2AYMA 4KE5A 1SKUB 4YOWA 1SS6A 1NSAA 1G4CA 3TAFA 4FZVA 4DV3J 3WZ0A 4DL5A 3I5BA 1KS2A 3MFHA 2HGLA 2VFSA 3HJVA 1N36K 2F3JA 3O44A 3UPFA 4ICLA 3I0RA 1YJUA 3SNNA 3THXA 1NZAA 1EJ7L 3OHRA 4X66K 5F8IA 1Q18A 1X5PA 1VSIA 4NL5A 1F3VA 3L3UA 2IM1A 2H9ZA 5MLCV 3AAWB 3TR5A 4IO8A 1BIZA 4Z37A 1DTQA 1K47A 4P2FA 2K7KA 2YV0X 4RPFA 1BOTO 5KFOA 1VQLN 5M2RA 3QZ7A 2F9TA 3M8QB 2C2OB 3EZWA 3M6GA 1HBMB 3K89A 1RTZA 2VD3A 4E1NA 1J5OB 2ACYA 3QIDA 1RTDB 2EK6A 4FF2A 1J5EJ 4JUZA 2Q43A 2YWHA 4G65A 2RHKA 2YWKA 4DV6J 2MDAA 1EP4A 4CGGA 3CCJN 4IDHA 1WF1A 2UU9J 4IUFA 3NCRA 4RUCA 4MMOA 2UUCK 4I6AA 1QVGR 2GQCA 4P75A 3MPVA 3Q2SC 2GV9A 3O1LA 4E1MA 1WBBA 4EBCA 4B9UA 3L3CA 4UZCA 3K0JA 3L2QA 3C0BA 1MROB 2QE5A 2MJUA 3PFEA 1Y00A 5IS2A 1RWNB 4QWDA 4GVBA 2OD6A 2HBRB 4BRNA 1HBOA 4ILMA 4BE2A 1BG3A 5LJVA 2CJBA 4K4ZA 1M90T 3V2UC 2AKWB 1X4EA 1VQYA 5KFEA 4GO5X 4TSXA 2U2FA 2GTDA 3MEKA 4PABA 2BV3A 3MECB 1BQNB 1U0HB 4ZKAA 3VGMA 5F8NA 4CLZA 1C2PA 3ETMA 3DLGA 5CH7B 4BDPA 3ENBA 1HNZJ 4NXMK 2QX0A 3FC9A 2E7WA 2OI2A 1VHFA 2IFXA 1OMSA 4FWNA 3W0LA 3CJCA 3WUHA 2FJBB 3M8QA 4NLGA 1NSKL 2IM0A 1DBDA 2A18A 4IG3B 4LFCK 2HAFA 2BKPA 4MYUA 2DY9A 2GMJA 3EZOA 3FQLA 3GIMA 2C2RA 2VBZA 2J9DA 4BQZA 3H8YA 3JQMA 4IXCA 3R7NB 2IY5B 2ERRA 4BRAA 2HWHA 4ITSA 4KSEB 2H1YA 5DZ6A 1X3MA 1EARA 3OSPA 1BISA 3SUPA 3M9MB 4LJMA 4DV7K 3R1HA 3MX2A 1KC8T 4M63C 1YUWA 2ZZNA 4C1NK 2DNOA 3GFXA 3I0RB 5AJ3K 2DCUB 1U1LA 5JVHL 1WI8A 1YJTA 4FS2A 2CDRB 1K9MT 1QVGM 2H4YB 5HJYA 1CQNA 4CJWA 3PM9A 3I4HX 2Q66A 1IBKK 4NZ6A 2AYGA 3DRPA 1HBUB 3CF5L 3SK3A 1RILA 1O6XA 3EMTA 2A5XA 1KAYA 1F21A 1S6PB 4L76A 3SPYA 3MAHA 2HK2A 3MR2A 3AVMA 4JI2F 3NF9A 2OLWA 2F4FA 4CNYA 3AO3A 4BE1A 1GFWB 3VALA 3HDSA 3JSMB 1NBEB 4A8FA 4DV4J 4CO5A 3PXGa 3L4IA 2GX8A 3A13A 2J7WA 4NLSA 3MCPA 3VZHA 1OQ3A 3R2DJ 4FKYA 1GMWD 4FF1A 1WNSA 3MHYA 3EDQB 4LR9A 4CEBA 3AVBA 4ZTFA 3D6RA 2FGCA 4NA1A 3BBFA 5IT4A 3BN4A 3ZTRA 3MN6A 3NGYA 1IG9A 1VK0A 2GS8A 1U6ZA 2IYGA 2OIHA 4Z4GA 4HACB 2P9SA 2DO4A 2JNJA 4UY85 4Q0BB 3CD5A 2IAJB 4PPDA 2RRAA 1TKZB 2MZ1A 5ETTA 2K7JA 1JQGA 1RT2A 2HRYA 4F2RA 4I7FA 1V3SA 1LNQA 3SMPA 2LFVA 5CABA 1BHNA 5GVQA 1XI1A 3SAHA 4ZLPA 3OXFA 3W5ZA 1DAXA 2J8SA 4PXEA 6AT1B 1ZBIA 4B9QA 2P5VA 1QHTA 2MZTA 1FE0A 1KAXA 3CG7A 4M5LA 3O3LA 3J7ZT 1S6UA 4Z4CA 4O4GA 1ZAVA 2RRBA 2BJ3A 1XERA 3CCJS 4MKVA 4CM2A 3C66A 1N36F 4ED2A 1NK5A 2ACMA 4XH5A 8AT1B 4F26A 2YNGB 1R43A 5E3RA 2HQ3A 2F4VJ 4RTFD 4BRLA 4DKWA 4MDAA 2DEJA 1VQSA 4XH4A 1CC8A 2Z2MA 1WI6A 4GKKJ 2ZBRA 1B4SA 2K1RA 3E9PA 3BYPA 4NLWA 2BE2B 2WCXA 5JUMA 4FNIA 4W98A 2O66A 2AEMA 1X9MA 2CQCA 4IRDA 3WNHA 2CJYB 1Z05A 3C6TA 3HSZA 1T03B 3MFIA 2KG0A 1VSEA 2MLYA 2KU7A 2OO4A 3RRKA 3MUMP 4DL0C 2ZWHA 4KIAA 1RTHB 2C3YA 2L08A 3O4NA 1MU2A 5AQVA 5DS7A 2VOOA 4JV2A 2RU9A 1RU2A 2QYCA 4FP9A 2NRHA 2ZWOA 3OXLA 4B3RJ 3CJ9A 2W1BA 1VK8A 1HMVA 2DFEA 2E9ZA 4FJXA 2HFUA 1C4CA 1UKUA 2W2NP 1VQPS 1X7VA 1PJ6A 2ZH2A 4O3SA 2YHXA 4ECUA 2QA1A 1PCAA 4OJ3A 4OYBA 2EFVA 3FBBA 3VWSA 4BC5A 1XMOF 3I8DA 3OVNA 1WSEA 1HYVA 4ECWA 4RZRA 5CZXA 3B6BA 2KJVA 5LSLA 3VQ7A 3AAQA 1JLFB 2WBNA 1J6ZA 4ZVQB 4FYYB 3TAMB 1XWLA 2DYAA 1RWUA 5CE3A 2JEJA 1J2VA 1RYSA 4DU3A 4KTZA 3SLCA 4A48A 3SZ2A 4DN9A 3ATVA 4X65K 2JLEA 2WK4A 5EDWA 5BR9A 2VG7B 1HI8A 4CRJA 5H9FK 4K0KF 2VU5A 2HQDA 3MM5A 1RT6A 1WSFA 3UDCA 4M41A 4G1IA 4ZMMA 3OYHA 5FDLA 3ILJA 2HNZA 2J0WA 4CK3A 2FLLA 1PYTA 1DTTB 1I39A 1NLKL 1S7HA 2QA2A 2KM8B 4AHSA 2PFDA 3MGJA 2N4DA 3QWPA 4KV8B 3P4UB 2ZJRL 3VGSA 5I3QA 3HPHA 1BDGA 1WC5A 2V6AA 3BF1A 1C1BA 3H1VX 4MK9A 4DPUA 5IT9O 1VBXA 4AYBD 1TUVA 2HIQA 2BJDA 4J9PA 2O8FA 1VQ5S 4ES3A 5K20B 1RDUA 4JI1K 1J9AA 4JKGA 1GK8A 3V9SA 5HK4A 1KAZA 1EQ0A 5F8LA 2E6MA 3LDNA 3DLKB 2QGFB 2GELA 3NF6A 2CZ4A 3QEVA 3HM9A 2HFNA 2KXNB 4H4KA 4JKCA 3JSBA 4USJC 1ULRA 3J8AA 4EAHD 1KC8O 4OZLA 2LU1A 1VQ9S 2HS4A 3VERA 1N5YA 3HP9A 2RSQA 1JNZB 2A6OA 3MUVP 2FHMA 2FVPA 4LFAK 4CLKA 1VBKA 3OR1A 4YOTA 3BEXA 4J9UE 4KPCA 4K7QA 3H25A 2HBKA 4JI4F 2G13A 3KK2B 2DKOB 2JRSA 5KQDA 2RQCA 3DU6A 1WF2A 3M8PB 3QBWA 4ZPAA 1CJUA 4BGBA 4CVNE 4OLBA 2B8QA 3AQPA 3JAMU 4NMXA 4IJNA 2FJXA 4BDZA 4OI0A 5IWAK 4KR0B 4BY9C 5ETMA 4KBOA 1PYOB 3I31A 3QESA 1Q82O 2YWEA 4EO8A 4LC9B 2G0IA 1VR6A 1Y9OA 3SUNA 4AHCA 1M5VC 5FDLB 3R1XA 1MA9B 3GMGA 2AA4A 1S1TA 1YQHA 3QJLA 3QJJA 2WONA 3CJQA 1RT5A 3KFWX 1RDCA 3I96A 5IM0B 3OBIA 1QTNB 2VPXB 3IKMA 4AQYF 4DS4A 4G3IA 3AB4B 4O5FA 3IDHA 2O8EA 1T3VA 1B0PA 1HNWF 4R79A 5KFAA 1N56A 2VQEF 3DI6B 2B5JA 1IUJA 3D4JA 4A46A 3V4IA 3O1WA 2XMKA 3LANA 4Q43A 1X5OA 4BLGA 3Q8PB 3CTRA 3MR3A 4A8YA 1OPIA 1ROFA 2DO0A 1NBWA 1SJ4P 1F9EB 1CULA 1WOQA 1QZ5A 2ZE2A 3N9UC 4K4TA 4DTJA 3D6HB 2CA9A 3OBWA 4IOXA 5GMEA 3K2YA 2K3IA 2DEIA 1EWRA 3VA0A 4Z2XA 4B3OA 1RKIA 1ZM2A 1VQNS 1SQFA 5F0UA 3TUZC 4ED7A 4LR8A 3L09A 5A8RA 3TW0A 3V5RA 3HHLA 3SCIE 1U24A 3V81B 3CIZA 2P9UA 1Y97A 1U6BA 4LBIA 2KYZA 1C1CB 4W4MA 2HRUA 5A2QU 4B3TF 2WW8A 2R42A 4FN5A 4RL1A 1AUDA 2XMWA 1Q81O 4EHTA 4TU9A 2E1RA 3RB4A 1QS4A 2P9CA 3NS5A 3GFHA 1NGDA 4DX7A 5HLFA 1P8GA 5C15A 1IBKJ 1CXQA 2E4LA 4DV6F 1K8KA 3O4WA 3UE5A 1B3TA 2KTQA 3N6MA 2AWZA 2GFFA 4BQLA 5A2QO 1YGYA 1R89A 3W8GA 1RKJA 2JGUA 1RHUB 4IDKA 2MSTA 2E2NA 1S76D 5KFQA 1OO0B 4J9OA 4KGKA 5EUHA 5CD4H 1WUUA 1MN7A 1JL1A 3CFRA 3R5DA 3UIQA 1KRPA 3IG1B 2CG8A 1NSQA 1VRQC 1D8ZA 4B3MK 4FJIA 4WQ5C 4FOEA 4N77A 4YQWA 5KGWA 3SBGA 1NHUA 1Q95G 1VJWA 2GA7A 3OTEA 1GAOA 4WFNQ 3PNIA 3TPQA 4EFHA 3THWA 5IV3A 3Q23A 1P1TA 2VG6A 1NCLA 1VQ5N 3FEXB 1VBZA 1APSA 2DPJA 1RBTA 3IBCB 4C11A 4P10A 1JXLA 3G4SN 1BWFO 3CCUS 4OPAA 3VQ6A 4Z4IA 1LW2B 3N01A 2ZHAA 1LWFB 5LMNF 4JYAK 1R7IA 5H1SV 4B3MJ 3PTWA 2CPFA 4FLVA 2EC0A 4DR6K 2VDIA 1XN9A 5LJWA 2G8UA 3HK2A 2MQQA 3A8YA 2P9SB 1BUPA 4HUFA 4V1Ak 2HQIA 4U7UD 4USTA 2O67A 2OH2A 3HKWA 1VQ7N 2W7AA 2L41A 2MEWA 4DR4K 3TANA 1HPZA 4JRPA 4H0YB 4CH0S 4CLUA 2HVZA 2D9PA 5M1OA 2E8AA 2YKPA 4KO0A 4K8ZA 2QTDA 4K25A 4RW7B 3KOAA 3MZIA 1EKEA 2Z2LA 2B3TB 4HCBA 4MFBB 3DJCA 3O80A 3JSMA 1U2VA 5KFTA 2OPSB 1UL3A 2H5IB 3SQOP 2QA4G 3FFKB 3NMUA 4JK8A 3BM7A 4JI1F 3CJAA 2ZKUA 2JL9A 3W9JA 2Q79A 4KGXB 1S6QB 1XMQF 4OPKA 3VENA 2Z30B 1JJ2R 2FLOA 1ZM3A 2V69A 2DFHA 2VKRA 1NPKA 4OLOA 4E7JA 2WBRA 2YWFA 1XR5A 1S72N 5KG6A 4E0DA 5LXRA 1WG4A 2OZMA 4FL9A 3R9LA 3LUYA 1OH8A 3ZZYA 3LZJA 1GMUA 1ZPWX 2DNGA 2GW8A 2AZ3A 4DX5A 5ETNA 2B9EA 4RO0A 4ZJLA 3MF5A 4L72B 3H5XA 1LXNA 1HWLA 2Z2ZA 1QDUB 4JI0J 3CPWM 3HT0A 2XYHB 3SQ0A 1PAUB 3HHKA 1FHTA 3ZSRA 4KAZA 4K2XA 2DGXA 2C3UA 3PKYA 3PYFA 4RW6A 4CZFA 4DR7J 1N5TA 3U3YA 4TYAA 1Q5YA 3FZKA 3V6DA 4OKEA 3R5GA 1RB0A 4TKTA 1RABB 5E41A 3Q22A 5HL7Q 1NGFA 4DR4F 3RU0A 1HD0A 4RR5A 3HVTA 3A8JA 2ZJRQ 3DXMB 3RR7A 2HKEA 1RT1A 4G1QB 3OBYA 4X4TA 3KK1A 4M94A 3V81A 4JI0K 4KB1A 2IBOA 3NCPA 4USKA 3AO4A 1LW0A 3WC0A 3GV8B 3OR2B 3H3NO 4BRGA 3HBTA 1DY3A 3D67A 2IDLA 3GJRB 4DR3K 3OYCA 2QTWA 3TAQA 4JKAA 2Z1HA 5IXUA 4C6AA 4HTIA 4QBUA 5DGAA 2QA4S 1VQNN 5GADU 4J9KA 3OYLA 1J54A 4J2EA 3KLHB 2HEKA 1T94A 1UP1A 2QIFA 2HNYB 4CZJA 3MTKA 1CULB 4JI3K 4TY8A 1U8WA 1QAIA 1W26A 3CCSN 1JJ2M 2ROPA 4S0MA 1I5OB 4I1TA 3JXOA 3RBDA 4JI6K 5AQYA 3KJQB 5JS2A 4LF9J 1UJ6A 2AGQA 1BUXA 1TK5A 2O8EB 1S6QA 2X74A 1R8BA 3NGIA 4W5QA 3ADAC 4JV0A 4W90B 3F9KA 5EHHA 1RT5B 2UUAK 5F0XA 1FE4A 2YPZA 1U1PA 3M3ZA 1IJEB 1DKGD 4A2AA 3SDEB 5M1FA 1T0TV 1YZ6A 1IR2A 2IVMA 1J5EK 1S5ZA 4PG6A 4F9OA 4KH4A 3HCXA 2QI2A 2GWKA 1UPPA 4EGLA 4KO0B 3W7BA 3EGVA 4B02A 2HHUA 2QKKA 1TUUA 3DGPA 3TZWA 4PG7A 5C25A 5KT6A 2OD4A 4BVOA 1VQ6S 3OVBA 2V63A 4BRDA 3EY1A 5AXKA 2NXUA 3M9OB 4C48A 2ASJA 4J91A 3H08A 2YKNB 5KT4A 5AZIA 3BGRB 4CHOA 2VBXA 3KHHA 4U7UK 4BR7A 3AA9A 3MM6B 2IA6A 2VFRA 4U8VA 3P1GA 2IVNA 4EU0A 2JFKA 5DLGA 4O3QA 4U7CA 4IFYB 2QWQA 5HANA 4JI8F 4QW8A 2VASA 1FXXA 2FBYA 1V5IB 5LT5A 3ZYYX 1VAZA 4EYIB 1OYEA 1A0OB 1C0GA 2XY7A 5EWFA 4NOHA 2DR8A 4RW8B 4N5SA 1L3TA 4YB5A 1FJ7A 4WQ4C 4FF4A 1NGJA 1NJYA 3EVMA 3VQQA 3OYMA 1NM1A 1HI0P 5AQFA 1ZA2B 1FKAF 3G10A 2FC9A 3P96A 3UD4P 2HBLA 4CBXA 2W2OP 4X62K 4M45A 2CQGA 5ETVA 3DRSA 1ATRA 4M5NA 3KWMA 3SFUA 1XUPO 4ECRA 2W4CA 3V1OA 4RWXA 5B0BA 1TU0B 4DBQA 2OUGA 1R0BG 2EWHA 1TVRA 1AZSA 4CESA 3QLHB 3U4LA 2Z1IA 1TZ0A 4HL9A 1JB0C 2HHHJ 3M8WA 2DTJA 2IMOA 3MM5B 3VQCA 4EUVA 2P9NA 2GIQA 4IOAL 2O8BB 1T9UA 2IVFB 2GC8A 3W9IA 1HYSA 4PYDA 1UJ5A 2YI1A 1FNOA 1U4BA 2HHVA 1NOYA 4Y2KA 3AVHA 3H5SA 4CZKA 1SXLA 3IUCA 4PKGA 2P9LA 3CMAS 2JVRA 4DF8A 3IM8A 1OVQA 4FK4A 3U02A 3HM8A 4JNEA 1KONA 3CEDA 4EWTA 3WX8A 3N6NA 1KD1T 5L1KA 1SC4B 1XJWB 3QNWB 2W2QP 3PYGA 2OMOA 1XMQK 2WOMB 1HQUA 4K4UA 1REGX 4A62A 2XMJA 3I87A 2K2PA 2XGQA 5JMVA 3CXCM 3O08A 1RT4B 4Z4HA 1RBUA 1NOZA 2LEBA 1P9QC 4CEEA 3G6ES 1DQ8A 5EOYA 1JX4A 3RBXA 4ERDA 3HPGA 2OTJN 1HPMA 1WNEA 2ZHOA 3TTFA 5JXSA 3SEOA 3ITHA 5AQLA 4JV5F 1X4HA 3MPUB 4USVA 3F44A 3L2UA 1S1WB 3NGUA 1MU2B 2RIJA 3W65A 1FRKA 5AJ3J 2Y0BB 1CZAN 4DL7A 3HSCA 3CCLN 4IWVA 3ZX0A 2FTRA 3NGZA 1NGAA 5J1EB 1S6OA 4L8RB 4C3KA 1FRHA 2WONB 3PW5A 3SSSA 1NH7A 3KUEA 3G6XA 3BSOA 4ZP6A 4QIGA 2K1RB 2E20A 2QM1A 3I5AA 1P9YA 2UU9F 2QLWA 3ET6B 4F4WA 5KOWA 2FC0A 2B8PA 4DQ8A 1D5AA 2XZWA 3WXKA 3WHIA 3X1LB 2MGZA 3ENVA 4ZLLA 3M5RA 3LGMA 1ZBHA 4NCGB 3O9RA 2CGLA 4EK2A 1YJVA 3QIPA 1FJGJ 1H0HB 3M30B 4U67L 5ETRA 2J9EA 3QGHA 2KDOA 2R8JA 2W9BB 2DR7A 3HL8A 1FO1A 4MIBA 3UE2A 3TVYA 1JWWA 5DQHA 4J9MA 3K0SA 3HULA 3W60A 2YX6A 2YH1A 4ZK7M 2DNZA 1FRMA 1N5YB 3A5MC 5B8HA 4K4XA 3GFZA 3MPYA 3W2WA 1HNIB 4NMLA 5BR8K 3ZEUB 1UVNA 1F3FA 4UOGA 3QNOA 2VOPA 3K5PA 1MNEA 3RBZA 3OHAA 3TAPA 3R97A 3MN9A 3HD2A 4DTSA 3QO9A 2AQ4A 2OPQA 3K5NA 2XLJA 1CPZA 2E5LF 5ETOA 5DM6L 2E1MC 3TOQA 3SQGB 1N4LA 5KFRA 3T3FA 3I6PA 4BRCA 4WQ4A 5HSPA 4ED3A 1Y5IB 3FZBA 2HAIA 3I56N 2OMLA 3BJYA 5E33A 2B6AB 1SAZA 1QQMA 2EFOA 2W2PP 4IH6A 3JAMY 1FWPA 3BP8A 3DWLA 5FPMA 3ZETB 3M9NB 2HG4A 3ULEB 3LP1A 4WP8A 4C8KA 1J5EF 3QFHA 3CUNA 2QMXA 1S7IA 2AJQA 5ETQA 4TLRA 4U67Q 2Q6CA 3T5HA 3DLRA 1OJ4A 5GIPA 2GO8A 3EL2A 4OX9F 3TZXA 3TP2A 1YTUA 2Y1JA 2YNHA 1U02A 1WHWA 4H0VB 4HDHA 4LF7F 3OW2M 3IAYA 2Y1IA 4AM7A 3A4TA 1N8RO 3KLFB 4IR9A 1MWZA 3BR8A 4JN4A 1NK6A 1IBMK 1RT6B 4WFBL 2PE8A 3B6PA 1XMOK 4CZGA 4DV5J 3QGPA 2DR5A 4F04B 1NB2A 2YNFA 2OKQA 2PGCA 4KB0A 2ASPA 2NZTA 3QPIA 2UYTA 3O8WA 1JLCA 2RDJA 3U9DA 5A6WA 5C0YA 4F3OA 3QAEA 4N76A 3T9ZA 2ZH8A 1JLFA 3QICA 2HHXA 4NLBA 4CF0A 4IRCA 5LL6d 2NRTA 1GX5A 3A2FA 3R3LA 5L9NA 2AJ2A 4CW7B 4CZCA 4OX9J 3PX0A 4BC7A 4H0OA 2LDYA 1M0SA 2BMBA 1VSDA 2ZDOA 1NK0A 4LREA 2G8WA 4E2FB 4P74A 4CO4A 4OHYA 4AD6A 2RE1A 5JICA 1R27B 1OVYA 4C1NI 5G4DA 1Q9XA 5HP1B 2ZF5O 4CF2A 1TTHB 3K2PA 3QETA 1CG2A 1IKYA 2DK2A 3W62A 1ICEB 2LQJA 3ENAA 1RT1B 1IKVA 2EI5A 3ONQA 1S9EA 5K5MA 2YBVA 4PRFA 1N33F 1X4DA 4ED0A 1BWVA 4BRPA 1ZTTA 5JS1A 3T41A 2G0CA 1RDAA 4LQ9A 5EWEA 1RBSA 3J80U 3IR6B 5CA5A 5FLXU 3KLEB 1U45A 2GVZB 1WTFA 3HHNB 4HH0A 2J5AA 1M5OC 1BQNA 1F2HA 4C0HA 3THYB 4UZBA 3PHEA 3RWUA 1HWJA 2UUCF 4P2MA 4IFVB 3CW2C 4WXOA 4YY3J 1CJKB 2JWNA 3QFUA 4LQ3A 2FBVA 1MMLA 4NLUA 3MEGA 3WXMB 1FTCA 2LEPA 4UOHA 4HUGA 2WSCC 3SXLA 2J8AA 3D9BA 3ULDA 1NG9A 4FF3A 5KG5A 2BUNA 3I55N 1RWXB 3W5YA 2R9LA 3KHRA 3PW4A 1RA6A 4ZPTR 5AR0A 4UY8O 2E44A 4J9LA 4OYXA 4L3QA 3BREA 4QIFA 3LGHA 4ZS6A 3ENHA 5G0RA 1RBLA 1ZOTA 2IOCA 1VDHA 4NLQA 4WPAA 4ILLA 2KRRA 5CQGA 3U1NA 3Q24A 3ZNJ1 2ROEA 1FJGK 5DM6Q 1NMDA 4C8LA 1YRXA 1HJRA 2XYGB 4NPOA 3MMBB 3NGRA 4I4BA 1YBUA 4NE9C 5THWA 3NS7B 4MTPA 1RTDA 5KOXA 1BE4A 3IGNA 4OIXA 1E3MA 4R5PA 1UFWA 3H4DA 1RT2B 1B99A 2FJDB 4CYUA 2JLFA 4BC3A 3D2FA 2Q36A 3MAAB 2NXEA 1HPZB 4RNHA 1RXOB 2D0CA 1VQ7S 4L73A 4WYBA 4B8CA 4LR7A 3NOGA 2ZOMA 1R0CB 3V6JA 5HRPA 5DQGA 2E9RX 2RF2A 5ETPA 2XLIA 2RQKA 3PEJA 1X4FA 2FBTA 4MLHA 1QM9A 2VQEK 3W66A 2AHOB 2E5IA 2WW4A 1KFDA 2R7SA 2C2DA 3VTHA 2YKQA 3CGIA 3PR4A 4P6QA 4M7XA 5DZ7A 4HH1A 1H2TZ 2QWOA 3DDKA 2QW9A 4RUHA 4K8RA 3K58A 2CPDA 4M5GA 1OSCA 1BL3A 5B0AA 4F4YA 1CJTB 2XY6A 2YJEA 4O23A 1QHAA 3SI6A 2XCPA 3MR6A 4CFBA 3DC2A 5LMNJ 2Q1NA 4LSLB 1GLJO 1DRZA 1RAAB 1VYAA 7AT1B 3G2XA 3MMAB 1X4GA 3CDUA 2QN6B 4DV7F 4F67A 2IJFA 1WC0A 1YTYA 4I67A 1NDLA 4F25A 2HMPA 3S8SA 4CM0A 1ITGA 1GLLO 5SWMA 3AHPA 4KBIA 4ISGA 2VUGA 1XNRK 5GAGP 4FWOA 1RHJB 4O3NA 3KD1E 2HMIB 5BPMA 2UUWA 2F9JA 1WOSA 1T8EA 2NREA 2YNFB 1Y5LB 3FMWA 2B9XA 2FHJD 2MQOA 4LF5F 1BI4B 1IR0A 3M2UA 1WF0A 1SL2A 2JH3A 4KPYA 3AA4A 2BA9A 3AY0A 3MEEB 2HQFA 1S99A 3BPDA 4CLFA 8ATCB 3Q8YA 4ZN3A 4JHDB 2QLXA 1YVNA 4CK2A 5GAHU 3CHWA 4LF4J 1OY8A 3SIPB 3BSNA 4BG9A 3MM8A 1RT7B 4DV0J 1YJNS 2HBZB 2YNHB 2PY5A 3MAAA 3HSJA 4PQAA 2Y3YA 4WK1A 2P9UB 5GAEI 2CNOB 4ETZA 3DKDA 3EUNA 2DHXA 5FLXO 3OYAA 1NDKA 1PYSB 1IBMF 2VBWA 2OZSA 3MMBA 4G1PA 1NWKA 1NKEA 1VSKA 4IBNA 3GG0A 4WE1B 4ZJOA 2NS1B 4FYVB 3EM1A 3KLIA 1I6JA 2EK1A 3AXKA 4OYWA 2BJ9A 4HHUA 3VAFA 5AT1B 1LCUA 2YPYA 1NK8A 2E7VA 4RWTA 2D7SA 2CQ4A 3SQGA 2EFGA 5IT9U 1A7GE 5G0RB 1FK9A 1S0NA 1NHKL 1K1QA 1WB9A 4M63A 3SUOA 3HT3A 2FBXA 4USIA 3CERA 3KD5E 5LMNK 3EGWB 1O51A 4CBUA 3M05A 3NGDA 1UCNA 2RILA 4EEYA 2E1PA 2PAVA 4FJ5A 3G8TA 3EZUA 4CO3A 3B6OA 3AA2A 4DOZA 1EKSA 3MM9A 9RUBA 4B3SK 3R5JB 4PWWA 2VB6A 2F8EX 5F3TA 2W9CB 5I9EB 4F4XA 1XNRF 4LF8J 4FM0A 2JFDA 4ZVGA 3N5BA 1ZXOA 2YXLA 3GV7B 2LECA 1ZZNA 1TL7B 1VQLS 5DLFA 2FHKA 1S77D 2R7OA 4IFVA 5CYJA 3THYA 5C10A 3FCHA 1PILA 3T1YF 4E1JA 3SQ2A 5T14A 1LW0B 1BCMA 2F65A 1OIAA 3MK6A 3T1HJ 3D2EB 3CQ8A 1N33K 2H3EB 4USMA 4CJVA 4R8UA 1R3NA 3L9ZA 2XZDB 3IP0A 4HVZA 3PV8A 4XDDA 4QR2A 1SQGA 2KO1A 4OLPA 1WLJA 4H0TB 3N4PA 4LRCA 1DJ0A 1VC5A 4WFAL 3ZSYA 4CFCA 2FGOA 3IO1A 4LY7A 2Y9HA 2KN4A 2HYIB 5KTQA 1EXQA 5J1EA 3VGLA 5F0WA 3ZXWA 1GOCA 1K6YA 3MR7A 2AJ4A 4ZVHA 4E7HA 3KNGA 4PA1A 2MXYA 1RBOB 4Q8FA 4K4YA 1X1PA 1ZZFA 3THXB 1NO8A 3NHGA 1F9FA 2NNWA 2QXLA 5IWAJ 2ASYA 3QRRA 1C4AA 3LALA 2J9CA 3PRDA 3KG1A 7FD1A 4BRFA 4DR5F 1Y11A 4M5MA 3VTIA 3RVCA 2DBBA 4IRKA 4ZPWR 2EFPA 1HARA 4OLAA 4RNNA 3I0SB 4M3RA 3VGVA 3FSIA 4P9SA 4I56A 4ZIVA 5FPEA 3A3PB 3CETA 4LFBF 1UW4A 2R8IA 5HAOA 3JTPA 2CNKB 3K7RA 4LF8K 3CQYA 4L6V3 4FPAA 2QEXN 2RS8A 2F63A 1T44A 1TL1B 5A76A 4HUEA 3CPWR 2AGOA 4L3KA 4JKFA 1REVA 5HN0A 4ES2A 4AH9A 3NF7A 2FXUA 2XHCA 2WVDA 4OZJA 5KFUA 2VFUA 3FBFA 2W9AA 4YDDB 5JLFA 4YY3K 3NWRA 5AQJA 3O6WA 4X65F 3ZSWA 1UVIA 3AVJA 1HFEL 4Y1CA 4CH7A 3ULEA 1MMNA 4E8UA 2NRVA 1ATSA 2ATCB 4CJRA 3J81O 1GMVA 5AXLA 3H4BA 5AQQA 3M2UB 1YJ7A 3RMBA 4OI3A 2VG7A 7FDRA 4B1ZA 1PAEX 1F9HA 1RAOA 5HVHA 2V2ZA 2P6SA 3NOCA 2H48B 1WAJA 5LM7E 1FEEA 1QVFR 3IBFB 4GC7A 5DO2A 4PG4A 4PG5A 1UPMB 4GVMA 3QRQA 1ZS6A 2YKOA 3MXIA 2BQUA 4KH5A 2FJVA 3ZTQA 2V51B 4BWJA 4BC4A 3CJ8A 2XBPA 2F8MA 3PFOA 4RW8A 5KFLA 3NCIA 4KB7A 2QLFB 1H1VA 3OYBA 5LJ3Y 4N8NA 2ZBCA 4B8AB 5HROB 3DM2A 2F1FA 3EN9A 2YHWA 3PCOB 5HROA 3UD5A 1VQPN 1CQMA 1NK9A 4RNMA 4NB4A 1GXUA 3CC4S 2XSJA 2O5DA 3IS9B 2AF6A 5MAOA 4FJ8A 3VQAA 4KHMA 5D8HB 2GHVC 1R8HA 1YIJN 3FE1A 2CYYA 2ZZMA 4CHNA 2DGUA 1VSJA 1ILYA 4TU7A 2FYXA 1GOBA 2G2ZA 1VQKN 3JYTA 4MT1A 5F9NA 3VEVA 5L9XA 1YJ9N 5L46A 3VAGA 1PO6A 2V8DA 1VQ4N 1HNXK 2OTLN 1L3VA 4IO9Q 4J9SA 1PSDA 3NWGA 1IV0A 2DHGA 1D9AA 1FA0A 2P6TA 2MQMA 4F0HA 3DLEA 4M5DA 3JSYA 4DTMA 3SCLE 4WCEL 2KXHA 4HHTA 2G8KA 3R8YA 1KDNA 3GWCA 3HFVA 1FWLA 2IVPA 1JLEB 2DGQA 4ALZA 5IWAF 1S9GA 3G6VA 1GH8A 3V6KA 2PI5A 2ZH7A 1X4CA 3T19A 4JLHA 3J7AN 3NGTA 4F02A 3MEDB 4ER8A 4C4WA 1RAEB 8RUCA 3NF8A 3UKUB 2F8TA 3Q7CA 4H4OA 5H9EJ 3OTOJ 3CM6A 3GE9A 1KQSM 4WFBQ 2E1CA 2X3DA 3HO1A 4LD0A 2KXFA 4YHHF 4CHPA 5KQ8A 3IA0A 4NXNJ 1VSFA 1UEUA 3E8OA 4CFAA 1RAJA 1WSRA 2HVEA 3HHEA 1I1GA 4TY8B 4EFAC 2HWTA 3QIOA 3D0IE 4F0KA 2LYVA 3AD7C 3EZ5A 4B1WB 3S41A 4DQSA 2B5JB 3UW1A 3GSDA 5AZJA 3RTVA 1WWHA 2ZOFA 1HRHA 4GKKF 1WOOA 4F36A 4LF1A 3TX0A 4LF9F 3HF5A 3SQ1A 1FFGB 4X66J 1J53A 3NKYA 5T41A 1TKXA 1ZBSA 2DNNA 2ZNZA 2L9WA 3C14A 3ZT1A 3HI9A 5M1NA 4K4VA 4JI8J 3GG1A 3VEZA 5D4LA 3GP9A 3CJ2A 1S59A 1D0EA 3D0GE 3HVTB 4FJGA 1HLWA 1FW6A 4P72A 1WEXA 5HMYA 4K2JA 3S9HA 1ITPA 5T7LB 4Z94A 3CCUN 4KHPJ 2XYPB 4E98A 1HYZA 4ZCLA 3A12A 1RACB 1NU0A 1GLEG 3F5TA 3CDEA 1VQ4S 1QAXA 5CZ1A 2R2RA 3QGIA 4DR2K 2CPIA 1VISA 1XK8A 2JOQA 4LRAA 2CIMA 2JDJA 3EICA 3H20A 1D1UA 1VS3A 5IQ6A 4W5TA 3SPZA 2ROGA 3OY9A 2HHHF 3MURP 2OGUA 1TV6B 4O0NA 3CCES 2VL1A 2R7RA 4LBHA 1TK8A 9ATCB 2QKBA 2MB0B 1TP7A 3V9UA 3O3GA 2G8VA 3QERA 1LEOA 4HI1A 1DEJA 3UN3A 2FIUA 3NAIA 4JV5K 3CJ0A 2KFZA 3MDFA 1S57A 4EP5A 2ZZTA 1IQTA 1JLAA 1O0PA 1JXBA 4DR6F 1U6FA 3IRWP 3BGRA 4GRSA 2HBJA 1KVIA 3AGKA 1V4SA 5EU7A 4NYZA 3QNNA 1FKPA 5D0HA 4NYNA 3ZZRA 1Q7YT 2D0BA 2W2MP 4N7TA 1XHXA 4DV1K 4YB6A 3R5BA 3BGOP 3EXYA 3TUIC 1RHRB 3FZFA 2WVEA 1YDLA 2R2TA 4IG3A 1WKKA 4NYFA 1SCJB 1FERA 3MWPA 3IAM9 1S22A 1F2GA 4OHXA 4A4JA 5HATA 4NLPA 4O8KA 3EX7B 5CYQB 4QQBA 2AEJA 2WB4A 1V4TA 1IBLF 3HOSA 1NK7A 3PSIA 1JLQA 2CXEA 1U0HA 5HVFA 2KT2A 2IIRA 3R7BB 3NMAA 5AXNA 4KQZA 2EPIA 4O3PA 1FKPB 4FJLA 3QT7A 5BYRA 1K9MO 2B43A 1IXKA 4LSNB 3M4XA 3PSFA 2G8HA 1ACMB 3MXMA 1HNXJ 3R5CA 4CZHA 2B7BB 1HWKA 2DIUA 3FRYA 4DPYA 2HMIA 3QO9B 1K73O 2WSEC 1LWFA 1Q82T 1TK0A 1NJWA 3MCOA 5ETKA 4FLZA 3DXSX 4M1KA 2W6LA 5E3PA 2HNYA 2X7IA 3LPYA 1RWVB 2KFNA 1C0TA 1KOOA 1LK5A 2E2QA 4OQJA 2HQGA 4WWSA 4K5SA 4A5AA 1E6YB 4YUDA 2VWJA 4P2SA 3CDAA 4PEOA 3OYFA 3Q8UA 1I94J 1U2RA 2RDDA 3H5UA 4DFJA 3AT1B 4DL6A 2N3OA 4ANCA 2GAGC 3JS9A 5ADZA 1LAVA 4BE0A 2V7YA 1IH7A 4K43A 2FVCA 4CERA 2HRTA 2HOEA 3HPOA 4B3SJ 4FK0A 4CO0A 3E01B 3IBWA 1X0PA 2BX6A 3MAQA 1HNXF 4XIUA 4UOFA 3CQXA 3TA1A 1FEHA 3LDOA 1CEZA 2E29A 1S1UB 3CXCR 3G71N 3UDLA 2RUSA 3Q8SB 4CF9A 2MZSA 3CJKB 5L8RC 4PL7A 3F9MA 3C8YA 1X9JA 1BCOA 4ECYA 4KFBB 2E5JA 4EP4A 1G3OA 2CZVC 2QWRA 2F4VK 4I64A 1N0UA 4NLXA 3HLUA 2I1RA 2PT0A 3SV4A 3CCVN 3AO2A 3AB2B 4O0IA 4JKDA 4JI3F 5KFPA 3GQCA 2KG1A 2KLAA 4KHYA 1HWIA 3M7VA 4JI6F 3TTCA 1XHZA 2QK9A 1D9DA 3M6UA 1R8CA 5A8RB 4ZP9A 3V9WA 2DRDA 1VMBA 5B09A 4BBYA 5AE2A 2YHAA 1LXJA 1PIEA 1HQEA 5I3UA 1UFLA 1YAGA 1LFWA 2DR6A 4QWBA 1SVDA 4KH6A 2HFOA 3F41A 3TSQA 3OYJA 1DHMA 5D15A 3CE8A 4QWAA 2E88A 4K0KJ 4ILJA 3D54A 3VF0B 1JNRB 4DR2J 2RQMA 4M8LA 1L3KA 1YITN 2P9LB 3QT8A 3V4IB 1CLQA 3EO3A 1W7AA 2MKIA 4DG1B 1FWKA 3Q86A 1N32F 4F2SA 3GFYA 4BR4A 1Q8KA 3OL7A 2KRBA 1HIYA 1TVRB 3D5MA 3CC7S 4DB3A 1SH0A 4M3WA 4OMFG 3G8QA 1H3DA 1NKCA 1BQMA 3TAEA 2ZVSA 4ENOA 4ISFA 2DFFA 4M5IA 3T5KA 2O1PA 3CCRN 4P7TA 2QWNA 3AV9A 2QZ8A 4DQPA 4CLWA 2QC3A 3GIKA 3TUPA 1ZTWA 2KM8C 4OHWA 3VESA 1VC6A 4DX8H 2GHPA 1R8AA 2V8VA 2E1AA 3OJSA 3TABA 4FWRA 2LU2A 4P52A 5IT9Y 2A6MA 4PKHA 4LSZB 3VQEA 4ZVPB 1OKJA 5HQMA 4FJ9A 1RTJB 4RWWA 2IYIA 1W2BM 2VG6B 4DTOA 2GGPB 1WSJA 1SIZA 4FVCA 4DV5F 1WTBA 5GIOA 5HVGA 2XI3A 3TI0A 3WNFA 2M3DA 4J2BA 3EE9A 3TVKA 1RNHA 2R3VA 5M1KA 3DFEA 2UP1A 3CT9A 1JLAB 1KVBA 3T1YJ 4ZA1A 3FFIA 2HNDA 5DM7Q 5A8KB 1KWMA 2WVFA 2VQFJ 2GWJA 3MTJA 1N34J 1KEKA 3I9ZA 2L9NA 1WKJA 3IR7B 1KQGB 2FJEB 1X5TA 4IDKB 1Z26A 3GB0A 1TV6A 4C97A 4FS1A 1YK9A 3TA2A 4FM2A 1KVKA 4DV1F 3ZO7A 1YVFA 3LP2A 5FPNA 3PIOQ 1T9YA 2RB7A 2X1FA 1QY7A 3DXBA 2W7PA 2GIRA 2C2MB 4C3LA 3EKUA 3TQ1A 3ZTPA 2HHWA 2RDIA 3BBBA 3OTBA 4CT9A 4W5NA 3EPGA 2APOA 4PL8A 2KKHA 4DDFA 3UD3P 4DF4A 2Y0SD 1KVCA 2RVJA 1JKHB 2XMTA 2BJEA 4KV8A 2IJNA 2QWPA 2IDEA 4FLWA 1SUQA 2CDQA 1UWBA 3CD7A 1S72S 1S9FA 5KPRA 5KFNA 2X78A 2ZOGA 2DHHA 1GLAG 1XNQF 4N8OA 3MECA 3ETOA 1ZBUA 4RW9A 3NNAA 2HBQB 4B3OB 2IVYA 1U1NA 1YT3A 4DR4J 1AFJA 1IBCB 3QFPA 3IMXA 5BJRA 2JC1A 3MWTA 2B4PA 4ZCKA 3CF5Q 4ZN1A 3ELHA 4DI6A 3ILOA 1MWQA 3OFFA 4KRWA 2BW7A 3M1VA 4YB7A 2LDIA 2FSNA 1FVQA 5LXYA 3PX4A 1RE1B 2E5LJ 2A1SA 2HHTA 4AHTA 2GJFA 4DL4A 1T3OA 1HNWJ 2DRBA 3M6XA 3DOLA 1EX8A 4OZ0A 4UUWA 2V5HG 2W9BA 4ED6A 4CJQA 3SBMA 3A3NB 1OH6A 3ID8A 4H4MB 3U27A 1S1TB 2Q3PA 3HZ6A 3M30A 4DV7J 2P9IA 1IVZA 3OD2A 5J1PA 3DMJA 2QSFA 3MMJA 4NCGA 1I51B 4CJKA 3LDLA 3AA5X 3LOUA 3M2VA 4AL5A 2DNHA 1YHQS 1IG8A 2CQ2A 3POTA 4CI0B 1U47A 1IO2A 4FO0A 4TQSA 3H2UB 2CRLA 4B1XB 5C42B 2LXFA 1T03A 4CEFA 2BR0A 3CIPA 1FDBA 1TMMA 3OTCA 4FBUA 2ILYA 5GAEU 5DJBA 1E6VB 1UOCA 1VSHA 2JWLA 2HK3A 5BRDA 2FF3B 4F4ZA 4FSVA 1KLMA 4ZVSB 4DR5J 1UVKA 3SJJA 2WAQD 4USUA 2X6SA 3HVRA 1HQ2A 3SQ4A 2ILZA 2EKYA 4YEAA 2W9CA 4DZ6A 2NCKL 4JEPA 3OJUA 4ICLB 4OZ3A 3L4BC 3TO8A 4ZLJA 5A8KA 3DYAB 2RPIA 3QGGA 3IS9A 1IM6A 2YX7A 1T9XA 4LFAJ 5LJ5Y 2CAJA 4USWA 3DLBA 2W01A 3W63A 1RWOB 4OI4A 1VQMN 1HBNA 3LP3A 2FD2A 4PG8A 4JKGB 3UNYA 1NU4A 2HSEB 4B08A 4GV3A