2BE2A

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with r221239
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Crystal Structures for HIV-1 Reverse Transcriptase in Complexes with Three Pyridinone Derivatives: A New Class of Non-Nucleoside Inhibitors Effective against a Broad Range of Drug-Resistant Strains.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 148
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2be2A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2be2A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2be2A05
4O44A 1S9FA 2IBKA 4HCBA 1NK4A 3NGDA 1RT2B 3KLFA 2IM3A 5J1EB 4DTXA 2OPRB 2D3ZA 1XWLA 4CEFA 3QETA 3CO9A 3OS0A 3SQ0A 2OZMA 2WB4A 3VQ7A 2BRLA 3KK3B 1S0MA 5HRSA 1UWBB 5SWMA 1SKWA 1C1BA 4H4OA 4NLOA 4DEZA 1BQNB 3QINA 1JXLA 1TKZA 1RILA 4CHOA 1IH7A 3QERA 2Y1IA 4ZP8A 3NBPB 4DL4A 3SFGA 3SPYA 4Q8EA 5L9XA 1BIZA 2W9AA 1S1VB 4DSEA 3QEPA 1REVB 2AGOA 3PVXA 4BWJA 1S10A 4C8LA 3CJ0A 4JS5A 4ZPDA 4LSLB 3L2WA 1RT3A 1X1PA 2BE2A 2YNIA 1HRHA 5C24B 1VRUA 4CHYA 4DF4A 4MQ3A 5EWFA 2XI3A 4EBCA 1DTTA 1CZBA 1HYVA 4CHPA 2OYQA 2YNFB 1NOYA 2AGQA 3DI6A 1T05B 1RBUA 2XO7A 2FVRA 5DG7A 1TL3A 3D0PA 3CFPA 4J9SA 3G6XA 4FJLA 4KB0A 3DRSA 5KT2A 2VWKA 2X78A 3L2QA 4AHRA 3MFHA 3ALYA 2R8KA 2F8EX 3OL7A 3OLBA 4DG1B 4CEOA 3NGZA 3S3NA 1RT6B 5KG1A 4DTMA 4UQGA 3HJFA 3VQQA 3G10A 4Z4CA 3LPUA 5HLFA 4M41A 1C6VA 3EYZA 3TAMB 4DL5A 4DQIA 4J2AA 3K5OA 3H4BA 4IBNA 3OJSA 5J2NB 1TGOA 5EWEA 3PR4A 2KQ2A 1BISA 3QLHA 1NOZA 2VG5B 1TKXA 1FKPA 1RCHA 2J6SA 3I5AA 5KFWA 4E3SA 3FFIB 1RDBA 4ECWA 2OPSB 1WSGA 4FJNA 4ZTFA 2UVRA 1RT1B 3RMCA 4IR9A 1U04A 1ZTWA 4WZQA 1BHLA 3DMJB 4ICLB 3I0SB 2W7OA 1RBTA 3D5MA 4DLGA 3NF6A 4F4WA 4H54A 2XGPA 2BQRA 4R8UA 2FVQA 4E0DA 4DSIA 3ZSOA 4WE1A 1RBVA 4DWIA 4L8RB 4WXOA 4JUZA 3GIIA 3BQ1A 3BR9A 3K59A 3GILA 2B5JB 3DRPA 3V9XA 1NJYA 3KLGA 1ZBFA 3MFIA 3MR6A 3IGVA 3L2RA 4IFVA 1NNDA 3LZIA 5J2MB 3ICLA 4O4RA 3RBDA 4M3UA 1VSLA 5JS1A 4QWAA 2P51A 5KT7A 5KRSA 4ZTJA 1RT4B 4M3ZA 1U47A 4WFXA 3CJ2A 3TAGA 2RF2B 1N4LA 1RBSA 4KHSA 1TK8A 2P5OA 3AV9A 1LW2B 3AVKA 1C1CA 2CKWA 5KFNA 2XWYA 3M8RA 4W5RA 4DF8A 3CWJA 1TKDA 2J6UA 1RT5B 4CJUA 3SI8A 3ZT2A 4ECVA 3VQEA 2FLLA 4NCAA 2RPIA 3SQ2A 3CJ3A 4EP5A 3L3VA 1D5AA 4KHRA 2G8VA 4DLEA 4J9KA 4F4KA 3MR5A 4TY8B 4ECTA 3DLEA 1XI1A 3MEGB 1ZETA 4K50A 3M8PB 1RTIA 1LAVA 5KG7A 1RYRA 1BQMB 4KHMA 2HHUA 1HYZA 3NFAA 4M94A 3DOLA 5SZTA 4CK2A 1LWFA 3N6MA 3K5NA 4ED2A 4F4XA 2HHSA 1JXBA 4QWCA 3LP2A 3H5XA 1K1SA 5DK5A 4IFYA 1S49A 4MH8A 2HNDB 4DSLA 3A2FA 3AA5X 3D45A 4DTSA 2HNZA 4IDKB 1D9FA 2FC0A 4JV1A 2HWHA 3VQ8A 1CLQA 4CIGA 4H4OB 4DFKA 1Y97A 3PV8A 4EYIB 2FBXA 3GV7B 3VQ5A 3ZT4A 2BRKA 3SZ2A 1RAJA 3H40A 2YKMA 3MXMA 1XR6A 5L1KA 1RNHA 4MIBA 4IRKA 1NK0A 2V4QA 4CIFA 2KZZA 4CHNA 4PY5A 1RT3B 3N6LA 2A1RA 1XHZA 2BE2B 4C8NA 1IM4A 2W9CA 1VK0A 2YNIB 4ID1A 4CF1A 4GVMA 4FLUA 1VRUB 4I2QA 3ZSRA 2EC0A 3HKWA 4FYDA 3T5JA 3AA2A 2R7YA 3DI6B 4ELVA 1FK9B 3H4DA 1U48A 1QS4A 4DTRA 1NKEA 3PW0A 3DRSB 2O5DA 1Z4UA 3OY9A 4NZ0A 3PO5A 2VG7A 3JYTA 2YNHB 4KTZA 2AQ4A 2GIRA 3CJ4A 4Z4IA 4GC6A 2ASLA 4C8OA 3SUOA 5HBMB 2G8HA 2D3UA 2DPIA 4ZP6A 2C2RA 4ELUA 3VQAA 4BDYA 3LP0A 3K58A 3C6TA 2WRMA 2XCPA 3RTVA 1YVFA 4FK2A 5KFUA 1HMVB 4ZVGA 4C8KA 4JRPA 4EEYA 3O3HA 3E01A 2FLNA 3ZT0A 4FLYA 1S1TB 2F8TA 3H08A 4YNQA 4XIUA 2HHXA 3CIZA 3MEEA 1N56A 4HUEA 2W9BA 5KFQA 3QLHB 4XPEA 5DG8A 1I39A 4KPYA 4IH6A 3H5SA 1TKXB 4CK1A 1KLMA 1ZBHA 3L8BA 2JLEA 3PJWA 3RRHA 4IKFA 3VQ9A 3RAXA 2E9RX 4E1MA 2OZSA 3GV8B 3BGRA 3B6PA 1S9EA 2XCAA 1SUQA 3V6JA 3E51A 2X74A 4FLWA 3U6FA 2BANA 2AWZA 1F21A 3QIDA 4ED0A 3DM2A 4NCGA 4WE1B 3M9NB 3KJVB 2W8LA 1NKBA 3NKYA 3LALA 1FKOA 4MKBA 1I3AA 3CFOA 3I8DA 2VA3A 1C2PA 1A5WA 4DTNA 4RW8B 2HB5A 1SH3A 3V6KA 2JGUA 3AVMA 3KLGB 4CK3A 2RDIA 2PYLA 1R0AA 3DLKB 3KLEB 4IFVB 4OVLA 4GW6A 2RDJA 1WSFA 3WNHA 4FW2A 4EBDA 2KTQA 1JL2A 2IS3A 4IQXA 4ELTA 4LQ9A 3ISNC 3SUNA 4CJKA 4B9NA 4KSEB 2KFZA 4RU9A 4U6PA 4B8AB 4K4TA 4DQRA 1SL0A 2G8WA 4YQWA 2ZD1A 1XR7A 4ZMMA 2IGIA 3AA3A 2IAJB 4Q45A 1ZBLA 4TY9A 4CFAA 1WN7A 5CYMA 1VSHA 4NYZA 3OL6A 4WFZA 5C25B 4GMJB 3LWMA 3V1QA 3NAEA 2I5JA 4QW8A 3LAMA 4R0EA 4KO0A 4J9OA 4O55A 4K4VA 1CXUA 1TV6A 3DLEB 3O3FA 1WSEA 1IO2A 4DMNA 3OL9A 4R5PA 3RB3A 1RTIB 3SNNA 1KVCA 4DTUA 1S1XA 4EO8A 4J2BA 1ZBUA 1WAJA 3DOLB 4KAIA 2FVCA 3RMBA 3JSMA 1C0UB 1LWFB 4ED8A 2P5GA 4QW9A 2YNGB 2JEJA 1RTHA 2ILYA 4Z4HA 4Z4FA 3LP2B 4KREA 2UUWA 5K14A 3PO4A 4JV2A 1RDRA 4DSFA 2HNZB 3KK1B 3GYNA 2ZQBA 4J2DA 3AVIA 4KV8A 4MIAA 5C42A 3FSIA 2RKIA 4YR2A 2E6LA 1HQEA 4RW6A 4BWMA 3ZT3A 4LY7A 2YKMB 2W7PA 2RN2A 5KTQA 1U09A 5DLFA 4NLGA 4G1QA 3ULDA 4E89A 1QUVA 3MXIA 2ASJA 2W8KA 1N6QA 5KFHA 1D0EA 3EZ5A 5D3GA 2FLPA 3NGIA 1TKTA 3P83D 2W9CB 4CF2A 4J9LA 4RW4B 4I2QB 3ISND 3CYMA 1LV5A 4HKQA 1SL1A 5F8GA 3OYGA 4F3TA 4RNFA 2W42A 3CQ8A 3IS9A 2JEIA 1HYSA 4N41A 4M3XA 1GX6A 4Q8FA 3SJJA 3QIOA 4Y2AA 3D28A 4QWEA 4FJIA 2C2EA 3M9MB 4M3WA 3HVAA 4CEZA 2VG7B 3JYTB 4DU3A 3AO2A 3IAYA 1QTMA 4KHNA 4JLHA 1CSJA 2JEFA 3VA0A 3GIMA 3QGIA 2R2TA 1NJWA 1JL1A 1NJXA 3SFUA 1LWEA 1KVAA 3LP0B 4I9QA 3ASMA 4CEDA 4PQUA 1G15A 2AJQA 3E01B 4OPJA 2IJNA 3OYHA 1W25A 4MFBB 3OHBA 4PWDA 4TYAA 1C0MA 3QNNA 5HROA 4K4ZA 3KLHB 3F73A 3IRXA 4KB7A 2W9BB 3HPGA 4CIEA 3TWHA 2E6MA 4OLBA 3VN5A 1TP7A 1TVRA 4AHCA 4Q44A 4DTOA 1KLMB 1RT7A 2YKNA 1QE1A 4FM1A 2Q3SA 4KKOB 1TL1A 2JEGA 5I3UB 2DFEA 3DYAB 4G3IA 4CESA 2VA2A 2BGGA 1NK9A 1S9EB 4I2PB 5KG5A 3PX6A 4RW9A 1J5OA 4IH7A 4CEAA 1SUQB 4KAZA 2BANB 3MAQA 2EX3A 3LZJA 4KFBA 4F4YA 1VSKA 3IGNA 3HP6A 3DM2B 3V6DA 1JLEA 4NCGB 2UUTA 4ECZA 4W5NA 4NLWA 2O4IA 1FKOB 3KLIB 4ECXA 3QIPA 4QPXA 4I9LA 1YVUA 1EKEA 3MEDA 4ECRA 5EU7A 4FJ7A 4ED3A 1R0AB 2VG6A 4ZVHA 3V1RA 4IOBA 4ED7A 4OGCA 3OS1A 1JLAA 4Z4EA 2IC3B 1QAIA 5JXSA 3VQ6A 3LDSA 1C1AA 4CJVA 2QXFA 3S3MA 3NH2A 3TAQA 2R2SA 1NHVA 3OYMA 1C0TB 5F8HA 3ZSVA 1IKVA 3AVJA 2ZD1B 2FJWA 5I42A 4J2EA 2GUIA 3C6UA 4FJKA 2HHWA 4K4UA 4CJFA 1S1WA 4NLXA 4Z4GA 5DGAA 2HWIA 4F3OA 5CYMB 1UOCA 5KG2A 4Y2CA 2WOMA 3HM9A 4KI6A 4M95A 4KHUA 4FJHA 3ZSZA 4NLTA 4B8CA 4B9TA 4DQSA 2I5JB 4H4MA 5KG4A 4ED1A 3PUFA 4O3NA 1TV6B 3AVGA 1WNSA 4W5OA 5KFAA 4FJMA 3V4IA 1S1XB 4DFPA 3OYJA 3OYNA 3MF5A 4F2SA 1RA7A 3ZSXA 1ZBIA 4ID5A 2Z1HA 3KNAA 1RDCA 2R8JA 1MU2B 4HCCA 3M8SA 3M9OB 5DQHA 1UA1A 1U49A 2FJXA 3K5LA 4BDZA 3TAPA 1JLCA 3L2VA 5KG6A 2GBZA 1T94A 4F8RA 4LH4A 2KZMA 4DS4A 4FS2A 4EO6A 3QZ7A 1Z26A 1BI4A 1IKXA 3HO1A 1BCOA 5J2PB 4NLVA 4YR3A 2JC1A 1S9GA 5C42B 3HSTB 2RKIB 2ZE2A 1SV5B 3M8QA 1VSDA 1JLQA 2V9WA 1QSYA 4O44B 1D9DA 3TABA 3V9UA 2F8SA 3GV5B 3BSOA 1T7PA 4FM2A 4G1QB 4FBTA 3C95A 3MTKA 3KLFB 1I6JA 5KFDA 4NRTA 1CXQA 4CEQA 3QEXA 2DTUA 4O3PA 3V81A 3O3GA 4ZVEA 4FJXA 1N6QB 3V9SA 5D3GB 3MECA 3RBEA 4K4XA 4OL8A 4CGFA 4E19A 1JLBA 1YTUA 1S6QA 4Y1DA 5F9NA 1C1BB 4RW7A 1NK5A 1TKZB 1BL3A 1JLFA 3L3UA 1DTQA 1GOBA 3S9HA 4EZ9A 2QKBA 5F9LA 4FS1A 5DQIA 2B43A 3BSAA 1HYSB 4CF8A 4DS5A 1WSIA 2PY5A 1TAQA 3OLAA 4ZHRA 4CJEA 5DMRA 5CZ1A 3KOAA 1S0OA 4E7LA 1KFSA 3CVKA 2R8GA 4CJQA 4M45A 5L1JA 4NLQA 3BQ0A 3T1AA 5T14A 3LPTA 1IKYA 1DTTB 1X9WA 1IKWA 4TQRA 3L2UA 1LWEB 3TVKA 2OPRA 1IG9A 4IRCA 5KT5A 1VRTA 3Q8RB 4Y1CA 1TL3B 1K6YA 4PQUB 2PZSA 2EHGA 4RNOA 1U45A 3OYFA 4FJJA 4KB1A 4ZP7A 3G86A 3PY8A 1Q9XA 1BQNA 1DLOA 5HROB 2G8KA 5J2QA 1YT3A 4KBIA 4YP3A 4K4WA 3DLRA 1RBRA 3QGHA 4PA1A 4CHZA 5KFMA 3ITHA 1TVRB 4FZYA 1RT7B 1QE1B 4Q5VA 4RG8A 4DTPA 1HARA 3Q8SB 3MR2A 3LP3A 1EETA 3NH0A 3KD5E 1O1WA 4LSLA 5HLFB 2ASDA 4FVMA 3KLVA 1ZYQA 4NCBA 1J5OB 2I1RA 3AO1A 5C24A 3UDLA 1W0HA 4J9QA 1N5YA 4IG0A 3LP1A 3WNGA 4IR1A 4KFBB 1Q8IA 5KGXA 1J9AA 5HP1A 2HNYA 1T8EA 3V6DB 5F8NA 1JLEB 5KRTA 3HT3A 1D1UA 3OYDA 1FKPB 3PHEA 1XR5A 3OYBA 4DL7A 3QIPB 4KTQA 3MEDB 2E9TA 4WYWA 1NK7A 4ZPBA 4DQQA 1LW0A 4HUFA 3N6NA 2R8IA 3K2PA 3RR8A 1K1QA 1JLAB 3SCXA 3PW7A 3SUQA 1BCMA 4J9RA 1W9HA 4O4GA 4NYFA 1B9DA 4NLSA 2YHAA 4R8UB 1NKCA 4GC7A 3QNOA 1IKVB 2OPPA 4FZZA 4URGA 5I42B 3HVTA 3AO3A 3PJXA 4XO0A 2D41A 4B9MA 5J2NA 3DRPB 1L3TA 1HJRA 3HXMA 5KFOA 5KT6A 4W5TA 1EP4A 2WHOA 1RTDA 2IMWP 4M3TA 4Y3CA 4WZMA 4N56A 4B9VA 4FW1A 1ZTTA 4B9UA 4B9SA 4OLAA 4ED6A 5KI6A 5FRNA 3FFIA 2OPSA 4NLUA 4IKAA 3V4IB 1RT1A 3SYZA 2HVIA 4WFYA 1KLNA 1C1CB 1ASUA 3NF7A 1BGXT 4ICLA 4ID5B 2XRIA 1WNEA 4YMEA 4JRQA 1JLCB 4LQ3A 2GIQA 3NMAA 3DOKA 1BIUA 3FRZA 4HVJA 4LH5A 4DQPA 3T5HA 5KGWA 4PUOA 4DU4A 3EZUA 4O0JA 4CF9A 3AVAA 5CY4A 1S5JA 5KFCA 3M8QB 4X2BA 5KFBA 3PW4A 1JLQB 1LWCA 4MK8A 5F8LA 4B3OA 2AGPA 1RT4A 3UQSA 3KKRA 2HMIA 3TARA 2RF2A 3ZSQA 3RRGA 3AVCA 4KTWA 3V1OA 2IM1A 2IA6A 1A5VA 4IFYB 2Z1JA 3V81B 1OS5A 1TQLA 4CJTA 4XPCA 3MECB 4OKJA 3TI0A 1J54A 1KSPA 4OPKA 3RAQA 3RWUA 4TXSA 1S6QB 4Q43A 1HNVA 3ZSWA 2HHQA 3KIOA 1S4FA 3EPGA 1JLFB 5DG9A 1KRPA 2WCXA 4K4YA 1SKRA 1QSSA 1B9FA 1JKHA 3NHGA 4E7JA 3DLBA 4BDPA 4TN2A 4FLXA 3PR5B 4BE2A 4O3OA 1JX4A 3MEGA 3OJUA 5C5JA 2QKKA 2ALZA 4LD0A 2R2UA 1BQMA 1TAUA 5HRRA 5DGBA 3BDPA 4QOZB 3AVFA 5HRNA 1IKYB 1IKWB 4CJ5A 4IG3A 4EZ6A 3NH1A 3OVNA 3AVHA 5KFPA 3ZT1A 4QWBA 3MR3A 1SKSA 1VRTB 2HNDA 4FJ8A 2R2RA 3V9ZA 3TAEA 4IDKA 2KFNA 1QAJA 1WSHA 5CYQA 4E7KA 4CF0A 1HNIA 3P5JA 1DLOB 4FJ5A 5J2QB 3ZSYA 5KFXA 2UVVA 4DFJA 3CM6A 2ETJA 3ITHB 3DRRA 2A1SA 1WSJA 3HL8A 3C6TB 2F96A 3Q8QB 2NUBA 4O3QA 1TK5A 3OS2A 4FBUA 4CE9A 1EETB 1XHXA 2DFFA 3AVLA 3KMSA 1X9MA 3VQSA 2IM0A 3PW5A 5KG3A 3QO9A 2AU0A 1N5YB 3HYFA 4IG0B 1L5UA 2FBTA 3LP1B 3MEEB 3OHAA 4TQSA 5HP1B 5EDWA 3LWLA 2HNYB 4NLYA 1MMLA 5F8MA 5FROA 4Q0BA 3FDSA 4CGHA 1FK9A 3OSNA 3SV4A 3KK2A 4J9MA 1S6PA 3U3YA 1VSFA 5KFYA 1KCFA 2X6SA 3KTQA 2OPQA 5JUMA 2AX1A 2YNHA 3HK2A 5KT4A 3O4NA 1LW0B 2BQ3A 3BGRB 4CJ3A 3V9WA 2B4JA 2AX0A 1ASVA 3G6VA 3RR7A 1Q9YA 5HBMA 2WK4A 3GIJA 4DSJA 4O4GB 3G6YA 1WAFA 1ASWA 4HTUA 2B6AA 3WNFA 4DSKA 4EP4A 1QSLA 2FBYA 3PW2A 1SH0A 3KHHA 4O3RA 4Z0UA 1SH2A 2OPPB 1HMVA 5FDLA 4RUCA 3HVTB 1S1UA 3HPHA 3KMQA 3NF9A 4CJSA 1S1TA 4F4ZA 1J53A 4ECQA 4ZPAA 5JS2A 4FLTA 2KW4A 5KT3A 3IG1A 4RZRA 3Q8PB 4FM0A 2LSNA 1XC9A 1EP4B 2XY8A 4KHYA 4NYNA 1RTDB 4TYBA 2V4RA 1TK0A 4ZP9A 4BACA 1LAWA 3BQ2A 2ZKUA 4F2RA 2WONA 2E4LA 2XI2A 1CZ9A 3UPFA 4RUAA 4FXDA 4CERA 1HQUA 3NAIA 4NLDA 3I5CA 4MK9A 2GC8A 2DPJA 4BE0A 3MXJA 1RTJA 3CM5A 3PX4A 4TSXA 5KFRA 4CCHA 4AHTA 3KJVA 4ZPCA 1X9SA 3DOKB 3NAHA 2IOCA 1KVBA 3NF8A 4KE5A 3EPIA 4KO0B 2ILZA 1UAXA 4AH9A 4RW8A 2XY7A 1T03A 4PUOB 3AVNA 4R5PB 4TLRA 4JS4A 1GOCA 3DLKA 3KLEA 4CJ4A 2OA8A 2DY4A 4N5SA 5T7BA 2PYJA 3SV3A 4CJLA 4CFDA 4KI4A 1LWCB 3H5YA 4I7FA 2HHVA 1VSEA 4B3OB 3JSMB 3QESA 2VWJA 4E7IA 2HMIB 2D0BA 3O4QA 1FXXA 1RTHB 2UVUA 5K14B 3CJ5A 4YFUA 3SUPA 2IAJA 2HW3A 3KKSA 3V6HA 4F50A 4OKKA 1D8YA 3DLGA 4AILC 4FJ9A 4EYHB 4KV8B 1HNVB 4WXWA 1NJZA 5C25A 2XGQA 1HQEB 4RW6B 1JKHB 4NLPA 2CJQA 5KFEA 4LSNA 2XY5A 2HHTA 1EX4A 1WLJA 3ZCMA 4B9LA 2QE5A 1JLGA 4CGJA 4CEBA 3OYLA 3BJYA 4CGDA 3GQCA 3VQPA 2HVHA 1VSIA 4JV0A 4J9NA 1TKTB 3SQ1A 5KFIA 4WYLA 2D0AA 3KD1E 1HPZA 2BQUA 1C0UA 1S97A 2IJFA 4URQU 4FK4A 3HP9A 2YNGA 2OH2A 4IG3B 3I0RA 4M3RA 1SL2A 3AVBA 3OYEA 4E7HA 3T19A 1S0NA 5CZ2A 3OYIA 4B08A 3IS9B 4U7CA 2ITGA 3QZ8A 2IM2A 5KFLA 4CECA 4DL3A 5CYQB 4IRDA 3KK1A 3B6OA 4KHQA 4YR0A 4ECSA 3KHGA 3QEVA 1GOAA 1HNIB 1A5XA 5L1LA 2JC0A 4DU1A 3HPOA 2Z1IA 4O0IA 3VQ4A 2UVWA 1JXEA 4HHTA 3DRRB 1RA6A 3P1GA 3T3FA 5E41A 1RT2A 3NL0A 3QEWA 3RMDA 5J1EA 4ECUA 1EXQA 3H98A 2G8IA 1ITGA 3NE6A 3QEIA 3GIKA 3VQBA 4J9PA 3KK3A 4RW4A 3HVRA 5KFZA 3IN5A 3QO9B 1UWBA 4O3SA 1QQCA 4PWDB 2C22A 4OJRA 4OGEA 3IRXB 3NBPA 4Q0BB 1S1VA 3KHLA 4FLZA 3SQ4A 1KTQA 2P1JA 3KK2B 3CDUA 1U4BA 1S6PB 3BREA 2YKNB 2ATLA 3NDKA 4IH5A 1REVA 3T5KA 1TL1B 2DFHA 3AO4A 3KHRA 2OPQB 4CJRA 2O4GA 1S48A 2FBVA 4Y34A 4AHUA 4RW9B 5L1IA 3BSCA 2FVSA 4HUGA 3LAKA 3K57A 4QCLA 2YNFA 2B6AB 2G8FA 4URSA 1T05A 3SPZA 2HAIA 3OL8A 4K8XA 4CGIA 5FDLB 4RNHA 1S1UB 5KFKA 3S3OA 1QHTA 4MFBA 3BSNA 3VA3A 2C2DA 4EBEA 4K8ZA 5DQGA 3KLHA 1VSMA 2VG6B 3IG1B 2D5RA 5EWGA 4CFBA 4DG1A 5KFGA 4DFMA 4FK0A 3SI6A 5HRPA 1RT6A 3H59A 5KFJA 1Z25A 3OYAA 4KKOA 3CFRA 3PX0A 5I3UA 1NK6A 5KG0A 3DYAA 2Y1JA 2WONB 3TAFA 3AO5A 3NGYA 2XY6A 4I2PA 3C6UB 3TAMA 4FCYA 3QYYA 3NCIA 3LANA 1S1WB 1KHVA 1VSJA 1HQUB 3TR8A 3PZPA 3DLHA 2WOMB 1RTJB 1KHWA 4KHWA 3H5UA 2VG5A 2FVPA 4DTJA 3KLIA 1L3VA 4H4MB 5KFSA 5F8JA 4N76A 3CDEA 4CHQA 1T03B 2YHBA 1T3NA 4KRFA 2V0NA 1RDAA 1B92A 2R8HA 4C8MA 3DMJA 3I0SA 1NK8A 2IC3A 4M42A 4I7FB 4CJWA 1RDDA 3HHKA 1L3UA 4HYKA 3HVWA 1C0TA 3UR0A 5KFVA 4AHVA 3C94A 3RMAA 4N47A 1KFDA 2FJVA 3RB4A 4MKAA 1YTAA 4BE1A 2BR0A 3I5BA 2X6NA 5KFTA 3OSPA 3TANA 3VQDA 2B5JA 3THVA 1BI4B 1IKXB 2IDOA 3QGGA 4CGGA 3DLGB 2XC9A 4FJGA 4QAGA 1S9GB 5J2MA 4K4SA 2ZE2B 2C28A 2WTFA 2Z1GA 3K5MA 3CDWA 4OKEA 5KFFA 4LSNB 2XHBA 4ZVFA 4DL6A 1RYSA 3U3GA 4RNMA 3EY1A 2QK9A 4M3YA 4ECYA 2BDPA 1JLGB 2G8UA 1NHUA 2YV0X 2ATQA 1LW2A 4CJPA 5DLGA 1N48A 4W5QA 3RB6A 2GV9A 4O5BA 1UA0A 1MU2A 1HPZB 5EUHA 1RT5A 1JLBB 3WNEA 2QV6A 1JIHA 2D7SA 2E9ZA 3AA4A 4RW7B 3OYCA 4FZXC 3VQCA 3I0RB 1DTQB 2J6TA 5F8IA 3UIQA 4CEEA 3DDKA 3FQKA 2D0CA 1GX5A 4MK7A 4CFCA 4AHSA 4TY8A 3G0ZA 3T5LA 4DL2A 4ZHRB 4NRUA 4E1NA 3RB0A 3M8PA 3TQ1A 4RNNA 3FQLA 5J2PA 3OYKA 4FLVA 1SV5A 4NLRA 4H8KA 3F9KA 5FRMA 3CG7A 3H2LA 1L3SA 4QWDA
chains in the Genus database with same CATH superfamily
4OV6A 3D6HB 4B1ZA 1S9FA 4P7VA 1K8KB 2P9LA 1RT2B 4EIAA 5J1EB 2MPUA 2OPRB 1XWLA 2D3ZA 1KR4A 3DN9A 2HSEB 2PAVA 3VQ7A 3WEEB 1S0MA 3LDPA 5HRSA 1UWBB 1SKWA 2IRUA 4FN5A 1BQNB 3UDEA 1IH7A 4ZP8A 1VDHA 3SPYA 4AQYJ 3H8YA 2W9AA 4JI8K 4DSEA 2RQCA 4GKJF 3M2UA 5DS7A 4FNHA 2ZHAA 2AGOA 1N34K 2HBJA 2RHQB 5IC6B 4GV3A 2BXJA 1V3ZA 1FXRA 4BR4A 4QIVA 2HHPA 2VF3A 5A2QY 1HRHA 4DR7J 1DBDA 2EEYA 4MDAA 2E7WA 2XI3A 3U02A 1HYVA 4CHPA 2V50A 1KN6A 2WFBA 2AGQA 4WTOB 5DG7A 3H45C 3D0PA 1ZAWA 2C3YA 1DEJA 5F3TA 3BN7A 3PXGa 2A6MA 3QDKA 3DOMB 1M90T 5HI7A 2VWKA 1OQ6A 2W4DA 3RSEB 4AHRA 3P3DA 1RBLA 3MFHA 5AXLA 2BV3A 1LCUA 3KKFA 4DG1B 2E5IA 4CVNE 2HFUA 1CJKB 4DTMA 2EFOA 2VH7A 1NGGA 4GV9A 2BYCA 4CT8A 5K8NA 1TYQB 3LPUA 4GO7X 1IV0A 1FT8A 4M41A 1C6VA 1YJNS 3K5OA 3H4BA 5L8RC 1NM2A 2C2KB 4CO0A 3D7EO 1G99A 1Q18A 3G6EN 1QDUB 1JJ2R 2KQ2A 1Y7PA 3QLHA 3J7AP 1FKPA 3M6UA 1RCHA 1WSGA 4ZTFA 3CCSS 3RMCA 2LXUA 4YB5A 3TUIC 3H1VX 4YB7A 3I0SB 2GVDB 3BH7B 4AQYF 3W2VB 4LMZA 4DLGA 5E33A 2A40A 2HEKA 3UNGC 4LFAJ 2C1EB 4DSIA 4WE1A 2VHGA 1RAIB 1DJ0A 3VQTA 3HFZB 2P8IA 1RU1A 1NM1A 3BF1A 3HD2A 3VAKA 3BR9A 5SUHA 2CADA 2K1RB 1HLWA 2DHSA 2B5JB 3V9XA 4DR7F 4WKYA 3F41A 3RAMA 3IGVA 1D8ZA 1HKAA 5J2MB 2DGWA 2OEJA 1YHQN 2AP6A 3UKRA 2KJVA 3W66A 2KKZA 4CO1A 4M3UA 4BBYA 2MXYA 4QWAA 3O5TB 5KT7A 4J90A 2GWKA 4TVAB 3V5RA 4ZTJA 1MN9A 3GYGA 1U47A 3D2EA 5M1KA 3F0NA 1GEHA 3ENBA 1TK8A 2QIFA 4LRDA 5D0GA 3D2FA 3OV7A 5RUBA 1U2VB 3UNYA 2P9NB 3A5OC 4O8UA 5KFNA 1UJ6A 3LL3A 5M1PA 3MGJA 3M8RA 2ZH8A 4CW7B 1VQ4N 1Y5NB 3MMCB 4CJUA 3DXBA 4B1WB 5BPLA 2MJUA 1R8BA 1D5AA 4KHRA 3EMTA 3OVSA 2G8VA 4DLEA 3G71S 1NGJA 4ECTA 1XI1A 2WVEA 2IVPA 4OX9K 4WFNL 5B0BA 2IDEA 1RTIA 3GB0A 3P38A 2JDJA 1CS4B 3MM7A 2HGLA 1U1LA 4P74A 1RYRA 1F60B 3ZZRA 4CM2A 4OYMA 2E1ZA 1HYZA 3IWXA 3NFAA 4WF9Q 3DOLA 1EWQA 4LIWA 5SZTA 4WK3A 1DHMA 2P9KB 1LWFA 3K5NA 4BRFA 3GONA 2HHSA 4PRFA 4K8RA 2F4VK 3H5XA 4IFYA 4C1NK 3KJNB 1KQKA 1LOUA 4OJ3A 4XTTA 4DTSA 4ID8A 3MCOA 4B17A 4PG8A 4B3TJ 4CIGA 3R2CJ 4OIXA 2FLOA 4EYIB 4LFAF 3MD3A 1ZA1B 5AZJA 2BRKA 3PIOL 4DV3K 2YKMA 2ZBPA 3M7VA 3M2UB 4MKYA 3W7BA 5L1KA 4YB6A 2LLZA 1B99A 1GLLO 4PY5A 2A1RA 4JV5K 1IM4A 2W9CA 4CI6A 1N32K 1KAZA 4FLUA 4I2QA 2DPNA 1V6HA 1R0BG 1RHJB 3M6WA 1TL4A 1U48A 2H5IB 4DTRA 4WQ4A 2O5DA 1URRA 1X3NA 1Z4UA 3D4JA 3FZHA 4C8OA 2OLWA 5HBMB 1G2EA 3N0VA 3NOGA 4ZP6A 1FE4A 4ELUA 3MM5A 3VQAA 3LP0A 3K58A 3GDQA 1JJCB 4RBTA 5T41A 3N28A 1YVFA 3AJDA 5KFUA 4ZVGA 4FVCA 3O3HA 3E01A 2FLNA 3AHPA 1UMJA 1FRHA 4GVLA 2F8TA 2E1YA 2CPFA 1E3MA 1WWHA 3CIZA 3H7HB 4WWSA 2PMWA 4GKJK 4HUEA 3PRDA 3QLHB 1C4CA 3EX7B 1FHTA 2XLIA 4ZN3A 2VD3A 3H5SA 2PGCA 4M5JA 3L8BA 2J7KA 2JLEA 5JMNA 1MWYA 2E9RX 4ZOSA 4B3TF 3JTOA 2MQ8A 3O3LA 1NLKL 1MNEA 3B6PA 3OTCA 4WIQA 1Y9OA 1H2TZ 5CR4A 3V6JA 2NZ4A 4MLEA 1RDWX 1IBKJ 3BKFA 3U6FA 1T6CA 2NRTA 4QZVB 2XO6A 4WE1B 4LUBA 3M9NB 3NKYA 1NH7A 3CFOA 3EJMA 1I3AA 2VA3A 3SJHA 5IT0A 2F8MA 4RW8B 2HB5A 1SH3A 3V6KA 4I6YA 4GRSA 3U27A 3DLKB 4OVLA 3DC2A 2ZNYA 3NVKA 1VR6A 1BWEA 3JXUA 4FW2A 2J4RA 1JMTA 5A8RA 1PGZA 4LQ9A 4NI2B 1LK5A 3ISNC 4B9NA 3D2EB 2H3EB 2WSFC 5J1NA 2G8WA 3D2FB 2Q3PA 2ZD1A 1XR7A 3WT0A 2IGIA 2EBEA 2GQQA 4J5OA 1OH5A 2UP1A 2YTCA 1ZBLA 3DKDA 3CCJS 3CJ9A 4TY9A 5ETNA 3WBZA 3HD1A 4DPWA 1WN7A 5CYMA 1VSHA 1X0PA 2ZH5A 4NYZA 3PHTA 2KRRA 3BH6B 5FPEA 4A8YA 4QW8A 1V4SA 2IVYA 3LAMA 5JLHA 1TV6A 4R5PA 1BE4A 2BVZA 1RTIB 1RZMA 2JVRA 4AQYK 3MM7B 2V34A 5IS2A 1LNQA 5GIPA 4TNOA 1OSDA 3CCUN 3DOLB 3RMBA 2EK1A 3GL1A 1C0UB 1LWFB 3OPKA 1JXVA 4QW9A 2YNGB 2JEJA 1U6FA 3LW5C 2ILYA 4KREA 2XS2A 5K14A 5AXNA 4BRHA 4DR7K 2P9UA 2VC1A 1EARA 5HL7Q 1BOTO 2YWGA 2OJ3A 1IBKF 4J2DA 2B56A 4H5TA 1PAEX 4YR2A 4NA3A 3RU0A 3H46O 5AZJB 3ZT3A 2MLZA 3C15B 4LY7A 2YKMB 1YJNN 3ULDA 4HI1A 1A7GE 1SPBP 5FLXO 3D1QA 5D3GA 3VEWA 1TKTA 2W9CB 4CZCA 4YDUC 2J8AA 4FXWA 4I2QB 4LRAA 1LV5A 3KWIA 2QM1A 1B70B 3CCSN 3X3UA 4RKUC 3CQ8A 3IS9A 1Q0NA 4F67A 1ITPA 1YTYA 4QWEA 2C2EA 2MQPA 3M9MB 1NGDA 1T0TV 1YBUA 2C3MA 4DU3A 2J9EA 3WIUA 2DVIA 4FWNA 2LFVA 3VA0A 4QU6A 3QGIA 3L7PA 3MM5B 1UZDA 1U2CA 1JL1A 3LP0B 4B1VA 3CD5A 4I9QA 1VIXA 1HW9A 4WCEL 2MKCA 2NPFA 4ERDA 2Y0BB 2DY1A 4CO4A 3VGUA 3IWNC 1N0VC 3E01B 2H1YA 2HQCA 4LFAK 1WC5A 5CD4H 4TKTA 4FOIA 4JI5J 3CQYA 3IMQJ 2ZH7A 3TWHA 3CIMA 5CZVA 3N4WA 1RT7A 4GKKJ 4ZJLA 2VWBA 4E98A 2Q3SA 4KKOB 1OWXA 3ZTQA 3FBCA 2DFEA 1SC4B 2MJNA 5JVHQ 3CI5A 4G3IA 2YHWA 2VA2A 2BGGA 3VESA 4IH7A 5IT9U 4TLQA 4KAZA 3GSIA 1GMVA 2FHOB 3WC2A 1UPPA 4C1NI 3LZJA 2PSZA 1NU0A 4G9ZA 4NLWA 1NDCA 3ENWA 3O9UA 1LFPA 2RB7A 2RUSA 5EU7A 4UUXA 3EEQA 2EI5A 2J8SA 1JLAA 2VQEJ 3IAM9 3CCMN 3LDSA 1GXLA 4CJVA 2QXFA 3S3MA 4L3QA 3MDQA 1IKVA 2ZD1B 4J2EA 4DOZA 2GUIA 3C6UA 2RNEA 3SCJE 4DN9A 1SQGA 2GNKA 3TZWA 2NRVA 4IZ9A 1RK8A 5CYMB 1XNQJ 1UOCA 3HM9A 4Y0FA 3M8WA 3US5A 4MIWA 1YF5L 3ZSZA 4BRQA 2HWTA 3J7YU 2ZJPL 3PUFA 1TV6B 3AVGA 3OR2B 4W5OA 1VQ9N 5LMUJ 4A8FA 4IEEA 2PO4A 3HI0A 5HJXA 4JI5F 3ET6A 1R6YA 2Z1HA 1OH7A 1U1KA 1QTNB 2FJXA 3EE3A 4PYDA 3K5LA 3MOJB 4GKKF 4CD3A 3L2VA 4I56A 4LH4A 4MJKA 2KZMA 4KGVB 3ENQA 4HR2A 4DS4A 2XLJA 2IYIA 1NDLA 1RWKB 2L08A 2VOOA 1OMSA 4EO6A 3DDIA 1Q7YT 1IKXA 5GAHU 5LXYA 4ILGB 2JC1A 2Z2YB 2ZE2A 3M8QA 5LJVA 1QSYA 1MWMA 3K89A 4KC5A 1N52B 3CHWA 3C95A 1UEKA 3MTKA 3QAUA 3VOVA 1CXQA 4CEQA 5BPMA 1GK8A 2DTUA 4O3PA 1U8SA 3O3GA 1SC3B 5D3GB 3MECA 3RBEA 5CCMA 4IOAL 2GX8A 2UUBJ 4JNEA 1JLBA 4NZ7A 1S6QA 1TKZB 1BL3A 3D3CJ 3L3UA 1GOBA 2N82B 3S9HA 1HKGA 1Z2LA 2QKBA 3U8XA 5DQIA 2CJKA 4HL9A 4DS5A 2PY5A 1TAQA 4E7LA 3KOAA 1SJ4P 3W2WB 2FGCA 3C16A 3CCES 5BRDA 3M4XA 3A8IA 2CWKA 3GOIA 3GYXB 4QR2A 3M6VA 3UWTA 3A8JA 3HHLC 3TVKA 2PI4A 4IRCA 1WB9A 1IR0A 5KT5A 1U6ZA 2JWKA 1TL3B 1K6YA 5LMUF 4PL7A 2VU5A 4KH0B 3RRKA 3IKMA 1T9UA 4FJJA 3WX4A 4KB1A 4JB8B 3G86A 3T9NA 2E88A 2G8KA 1OO0B 3M30B 4MO5A 4KH6A 2ASYA 3DLRA 1Y10A 2PI5A 4CHZA 4ANCA 1RT7B 5L9NA 3CCJN 3SMSA 3I6PA 4WFBQ 2F3JA 1HBUA 3I33A 1HARA 3AY0A 3MX5A 4FVMA 2ASDA 3KYLA 1S3XA 5BYRA 2I1RA 4CM0A 4M5DA 4IG0A 3LP1A 4QIFA 4OYXA 3BR8A 3TEHB 1SB6A 1Q8IA 3IM9A 5KGXA 4X84A 4DUYJ 2VDHA 1T8EA 5ELZA 2NZTA 1IR2A 1N54B 2FJDB 2CNKB 4KIAA 5D77A 4LFBJ 3PHEA 3OYBA 4OFZA 3KDNA 1BG3A 1XK8A 1U8WA 1F9HA 2UUBF 1NK7A 1OJ4A 3D6TB 4HUFA 2W7AA 3N6NA 4NL5A 3K2PA 2UXDK 1JLAB 3SUQA 1BCMA 4OHZA 4ZVPB 1JJHA 5A8WB 4ZCMA 3R9PA 3M6XA 4NLSA 3DGVA 1PBAA 1NXIA 2O8BA 3QNOA 1IKVB 2OPPA 3FEZA 3PJXA 3D6FB 5J2NA 1WKLA 2FZCB 2FIUA 2R7RA 3BGLA 4BR5A 5KT6A 5HVFA 2UZAA 5E3CA 2M2BA 2WHOA 3GG1A 1UFLA 4N56A 4L75A 4B9VA 3DU5A 4FW1A 4B9UA 4B9SA 2HF3A 4OLAA 5DO2A 4NLUA 5AZIA 1RT1A 4HH1A 3S41A 2YI1A 1KLNA 3E66A 1ASUA 1FESA 2ZBQA 1GLDG 4C3KA 3QSIA 1Q53A 1WNEA 4YMEA 2JRSA 2BA9A 1HHTP 3OT9A 3MMJA 4KR0B 3CGIA 3DOKA 4XAKA 1K9MT 2FDNA 3P45B 5KGWA 3ZETA 4E8UA 3CJTA 2NYIA 3M8QB 4X2BA 1KEKA 4DUYF 1RT4A 4DV2J 4BC4A 1RAAB 4LFBF 2RF2A 3ZSQA 4KGZB 2IA6A 1RWWB 4WU3A 1XN9A 4FYXB 3R1HA 4NLBA 3CCRS 1TQLA 1NMEB 3ZZOA 3J7Z5 4XPCA 3MECB 1MG7A 2D9PA 4OKJA 1RUSA 3GP9A 2Y8YA 1F1BB 2RH3A 3TI0A 4Y28C 1J54A 4CI0B 1QAYA 1S6QB 2V2QA 2HHQA 1S4FA 1ELOA 1JKHA 3NHGA 2BEFA 2FTRA 4ILMA 3MWPA 2CGJA 2AYEA 1JX4A 2FF6A 1Z6RA 3MM9A 3TUJC 1BQMA 2M9KA 3RJMB 4F04B 4GKKK 4P2SA 2G13A 3A12A 1DAXA 5HRNA 3OW2R 1U1NA 3R6LB 1Q8LA 5HAOA 2QWQA 3ZZPA 1UW9A 3NH1A 5H1SQ 1ZH5A 4QWBA 3CMES 2EKNA 4X4OA 3Q7BA 2ZHBA 2COLA 1ZM9A 5CYQA 4E7KA 2DYAA 2ZWOA 5JICA 5IQQA 3KG0A 2DH8A 5H9FJ 3BO3A 3MMAA 3DAWA 3VTHA 3PTWA 2UVVA 3IBFB 4YHHK 1S72S 1NAQA 5K8OA 2ETJA 5EHHA 1XTZA 1P8GA 2MY7A 3C6TB 3C8YA 1AT1B 2GJIA 2F96A 2HK2A 1HBUB 3OHRA 2PE8A 4CE9A 2Z8QA 2DFFA 3E9OA 5AQXA 3VQSA 2MHNA 4M5DB 2AU0A 5LJ5Y 4IG0B 1EKSA 5TKYA 1QVGR 4DV2F 3LP1B 3MEEB 3FJ2A 5EDWA 3W9JA 3LWLA 4K0KJ 5F8MA 3R2DJ 3O9RA 1FK9A 3MD1A 1S6PA 3U3YA 3UE2A 3HHDA 5KFYA 1KCFA 2CRLA 2PC6A 4QBUA 4LFCK 1JNZB 5KT4A 3Q22A 2B4JA 1ASVA 3BDEA 1Q9YA 1NGAA 5TKWA 4DR5J 3GJSB 2M52A 4FWRA 3G6YA 5LMUK 3D67A 4LF8J 1RHRB 2FBYA 2O8BB 2V51B 3KHHA 2OPPB 1EX8A 1N8RT 2KXFA 1S1UA 3KMQA 1U1MA 3AOCA 1KKHA 4EAHD 4F4ZA 3M6GA 5GMEA 5MAOA 5KT3A 3IG1A 2LDIA 4RZRA 4FM0A 4CTAA 1XC9A 2XY8A 4KHYA 5ITHA 4DR4J 1WORA 4TYBA 3VENA 5JVGQ 1LAWA 1EO1A 1F9EB 1XQSC 5BR9A 2HQFA 2WONA 3K8VA 4BG8A 3K5PA 2HURA 4RUAA 3CJAA 2QLJB 1HQUA 4NLDA 1ZM4A 2CQ2A 3UD4P 3HLUA 2FD2A 3I5CA 2GC8A 4BE0A 3MXJA 2F65A 4PL8A 5KFRA 4CCHA 1X9JA 2CDRB 2MQLA 3DOKB 3W63A 1GMUA 2IOCA 3CCEN 4KO0B 2ILZA 3BZQA 2MY8A 3PYEA 2Z58B 4Y2KA 3ZETB 1GOCA 1IJFB 4CJ4A 2OA8A 3Q8VA 4I0WA 5IT4A 4OI2A 3SV3A 1RWVB 4CFDA 1RAHB 3D6RA 4K0KF 4I7FA 2HHVA 1XUPO 3L3CA 3MDFA 3R6GB 3JSMB 2VWJA 2D0BA 2QN6B 3ZZTA 1FXXA 1BLUA 5D6GA 3T9ZA 5C2GA 2UVUA 1NJIO 4YFUA 2VPZB 3VMFB 2IAJA 3ZTOA 1XBWA 1IQZA 4C9DA 3DLGA 1ZAXA 4AILC 4DR5F 4FJ9A 1NGEA 4WXWA 5C25A 4L6V3 4LF8F 1HQEB 2F7VA 2I6WA 1JKHB 4O5FA 5LOQA 4Z7YA 5M1NA 2XY5A 3ZCMA 1M1KO 4DV7K 3MM9B 2YQ0A 4K7QA 3E9PA 4BC2A 1RKIA 4CGDA 3SSRA 2HVHA 2Z30B 4OZ5A 4JV0A 3HBTA 5KFIA 4WYLA 3KD1E 2Z2MA 3L4BC 4M1KA 1UPMB 4DR4F 1CC8A 5I9EB 3HP9A 1FWLA 3BBBA 4DX5A 2W40A 5BR8J 3BN4A 3AVBA 1O51A 4E7HA 1YZ7A 5CZ2A 2L9DA 3OYIA 1R3NA 4B08A 3J7YP 5HMZA 2IM2A 4OI1A 5CYQB 2ZVIA 4QIEA 4B1UB 3KK1A 4Z2XA 4KHQA 4YR0A 5A6WA 3QEVA 1A5XA 3MMAB 1NHKL 3HPOA 3GU0A 2MSSA 6FD1A 2KB2A 4LFBK 1HQ2A 3Q2SC 3QWPA 1O8BA 3OFFA 1KQFB 1RA6A 4OZLA 4YDXA 2I0XA 3DLLQ 5E41A 2CQBA 1DARA 2Q2RA 2N4DA 4ECUA 1EXQA 3LO3A 1ITGA 3NE6A 3VQBA 2QEXS 3SDEA 5D8HB 4O3SA 1Q86T 2XMKA 4OJRA 4WQ5A 3IRXB 2VBXA 1TMMA 1H6KX 4KH1B 2CZVC 2X51A 1SAZA 1FJCA 1Z05A 1H74A 2P1JA 1U4BA 1S6PB 3GFXA 4X64J 2ATLA 3GR1A 1DQ8A 5B0EA 1SJFA 3Q2TC 2NXNA 3L95X 1HHSA 3T5KA 1TL1B 3TQEA 3AO4A 4CJRA 3M3ZA 4DXLA 2O4GA 4NXNJ 2CPIA 2HGMA 1DRZA 2RHKA 3MOZA 3R5AA 3FRYA 2GGPA 1YZ6A 5L1IA 2YXLA 3F44A 2DCUB 3FFKB 1NGHA 4RBUA 4A59A 5GADU 2A2CA 4URSA 1T05A 2HAIA 1V5VA 3VAHA 1FRLA 1VQ8N 4K8XA 4CGIA 1YITN 1S1UB 3EDRB 2EFVA 2YH0A 2KM8C 4MFBA 2F9TA 4AFFA 2X1GA 1NRKA 4QPTA 1S79A 2QA4S 5IT9O 2D5RA 3IG1B 4CTAB 2Z4PA 4CLZA 2FF3B 2WSCC 5BR8F 5E5NA 5HRPA 1G4CA 2F8HA 3NOCA 2C42A 3ILLA 3OYAA 4BRAA 4P2FA 3PX0A 4USHA 1NK6A 3K9KA 2WONB 4I2PA 1I94F 2KVQE 4DV2K 3IXQA 1VC0A 4ISFA 3NCIA 1O6XA 1P6TA 3GFHA 1HQUB 1VSJA 2V8VA 1N5QA 2RE2A 2EWSA 5AQQA 2WOMB 4ILHA 2WBNA 4OHYA 3MUTP 1SJ3P 5LL6Z 2QLFB 3KLIA 3BBCA 1REGX 3EICA 5KFSA 5F8JA 2VGNA 2JFDA 1RTZA 4CHQA 1YRTA 2GQ2A 2LU1A 2V0NA 1GNKA 5HANA 3T1YJ 4C8MA 3DMJA 3CMEN 4ZITA 4U96A 4I7FB 1X60A 3HHKA 4X64F 4JKCA 3WXLA 4OLPA 3RMAA 4NXNF 1YTAA 4BE1A 3I5BA 5D4NA 3B4DA 3SLCA 1JWWA 4LF4J 5AQLA 1F3FA 1NSAA 1S72N 3ATUA 3TANA 4CGGA 3DLGB 2DBBA 2CQCA 5BREA 4QAGA 3FVYA 1S9GB 4K4SA 1VQKN 2CJ9A 3R3LA 2YKPA 2Z1GA 4CIOA 3ZC4A 2CVIA 2JLGA 4NASA 3ZX2A 4DL6A 1K8AT 4F36A 2QK9A 2QO3A 2F9WA 3HT0A 1LW2A 4CJPA 5AQPA 1TUGB 5AQSA 3CMAS 3C46A 2UXBK 2GV9A 5EUHA 2MB0B 4KT0C 4DV1J 2HVDA 3AA4A 2E66A 4FZXC 4W92B 3VQCA 2AMCB 4C3LA 3UIQA 3H20A 2D0OA 3UVJA 4AHSA 3T5LA 2UXCJ 2JJ4D 4LF5J 2OUGA 4E1NA 3M8PA 2WVCA 4RNNA 4K0KK 3RZAA 2CPEA 3OYKA 1SV5A 4H8KA 3F9KA 5LT5A 3JS9A 3QMQA 1AXQA 4QWDA 3R5DA 2Q6CA 4ZVTB 2IBKA 5BN8A 1FTCA 4JKDA 1H1VA 3KLFA 3KHYA 1R8AA 5A6PA 3CO9A 3QJJA 3C6HA 1YK9A 2OZMA 4DR5K 3T1YF 2CQ4A 3SDEB 2OTJN 3BYPA 4LF8K 5SWMA 2R7WA 2KRBA 4DL4A 3S01A 2NLWA 5L9XA 1VLOA 2IVFB 1YJ7A 3UD3P 1PBUA 4E1JA 4H5WA 1O5JA 4LF4F 2IVOA 4I6MA 4BHQA 2DEIA 2PFUA 4BWJA 1WOQA 2MTLA 4PG6A 4DR4K 5THWA 2CUYA 4ZPDA 4LSLB 3L2WA 2YNIA 4WF9L 5BXIA 3JSRA 4DF4A 3BF4A 2X7IA 3FKBA 5AQUA 4MQ3A 5EWFA 1DTTA 1KVKA 5G0RA 5D0EA 3HKZD 3BP8A 1T05B 3PLAA 1RBUA 1UP1A 1WEXA 2V67A 5DDOC 2HBRB 4FJLA 4KB0A 4GV6A 4FF3A 2AYBA 5KT2A 2NZCA 4QS9A 3VGKA 1TU0B 4YY3J 4DV1F 2QL9B 1W97L 2LXIA 1WHXA 5KG1A 4LRCA 4NYOA 2VKRA 4UQGA 4AM6A 3NMRA 3VQQA 5HMXA 2UXCF 4A8KA 4FF4A 2DHHA 1WKJA 1ZZNA 5HVHA 3TUZC 4NEYA 2KG0A 2NNWA 4J2AA 1VQSA 2AKWB 4IBNA 2RQ4A 1TGOA 3SBGA 1FJGJ 3QATA 4UF4A 3U4LA 4NMLA 2ERRA 1WDTA 4X65J 1WC3A 1BISA 2DXEA 5GAGU 2VBWA 2V6AA 2ZJQQ 3QT5A 1NGFA 1RCXB 5KFWA 3QJPA 3MK6A 3FFIB 1RDBA 4ECWA 3R8YA 3MCAB 2O1PA 4DHVA 1WTFA 4WZQA 1BHLA 3DMJB 2W7OA 1VQMS 1HBMA 2ABYA 4CO3A 4NWBA 4F4WA 1XNRJ 4H54A 2NUUG 4IFEA 4R8UA 3ZSOA 1GLJO 4DWIA 4L8RB 4JI0J 1Y11A 3GIIA 1XIQA 3TSUA 2FC8A 2BE9B 1NJYA 2DHGA 3KLGA 5BR8K 1ATNA 3L2RA 1KC8T 4DV4F 3ICLA 3CJKA 4NE9C 1UL3A 4BRKA 4H5VA 1OH8A 1VSLA 2KG1A 4M3ZA 5EY4A 3JXOA 4C97A 1I94K 3A8EA 4OYIA 3AV9A 4OHWA 1LW2B 3SK3A 4YY3F 2GHVC 3CC4S 4WP8A 3FE1A 4HTLA 2AJ0A 2J6UA 4DR3J 3FNNA 3SI8A 3ZT2A 4NCAA 1FDDA 2EPIA 5DM7Q 4A8SA 3POTA 4J9KA 3DLEA 4OJGA 3MAHA 3MEGB 4BR2A 1A0OB 3M8PB 4PAAA 3PM9A 1B7FA 3DLJA 1LAVA 1FJGF 1FRKA 2YX6A 2L41A 4X65F 1VQPS 1FFSB 2PFFB 3M2VB 2NSBA 2KXNB 4F4XA 2EFNA 2CGKA 4DDFA 1RGVA 4GNIA 3LP2A 4B1XB 5DK5A 3RBXA 4MH8A 4M7XA 1HJOA 3MPVA 1CJUA 4QU7A 3A2FA 3AA5X 4IDKB 3K2YA 2Y3YA 4JV1A 4CLFA 1Y97A 4KHPJ 2DNNA 3FZBA 3QFHA 3N01A 1XNRF 3FBBA 2P6SA 3SZ2A 1RAJA 3R1LA 4JI0F 2YH1A 1A6LA 4AYBD 4I6MB 5IM0A 5C2FA 4BRNA 4CHNA 2ZH6A 1VK0A 2YNIB 2WUSA 3CJBA 3MM6A 4GVMA 4HLBA 3ZSRA 4DJBA 1MDUB 3QQCD 4Y0WA 3THWA 3EKUA 5M2UA 2Y1LB 4ELVA 1G6BA 2VFRA 2H54B 1RKJA 1AROP 1NKEA 2BACA 3FZMA 4PABA 3UKUA 1CEZA 2KI2A 2HS0A 3C65A 3OY9A 3PO5A 5IV3A 4DR3F 2AQ4A 3CJ4A 4ZLNA 4X4QA 1KDNA 4GC6A 2ASLA 1S99A 1MLAA 2C2RA 5AXMA 3TO8A 4N8NA 1NSKL 1TMJA 3EVWA 4JOUA 3T69A 5AQMA 3RTVA 5CA5A 4FK2A 2LXFA 1U1QA 3J80U 5DDQC 3IC1A 4EEYA 4FLYA 1S1TB 4XIUA 2HHXA 1GTEA 4Y2MA 1F0XA 5E3QA 1N56A 2W9BA 5KFQA 2GAGC 4LF4K 1I39A 5FLXY 2N3LA 4CK1A 1WC6A 2NXUA 1KLMA 4CLKA 2YWFA 3CMAN 3NY0A 1UW4A 4IKFA 3VGTA 1R89A 2F9DA 3R5BA 2GO9A 2CA9A 3FZLA 3BGRA 1FRIA 4KHPF 3GCXP 2EXUA 1MN7A 2XCAA 1SUQA 3E51A 3BGOP 1F21A 3Q0AA 2YWKA 3ZZZA 1T9WA 1B64A 4HT5A 3KJVB 2W8LA 4CP5A 4MKBA 2XG8A 1ESVA 1A5WA 4DV1K 3GR0A 3MZIA 3MPYA 4M8LA 3VGMA 4ZPTR 2JGUA 3AVMA 3FMBA 5BN9A 3ZZUA 3KLGB 4CK3A 2RDIA 2RS8A 2XHWA 1X4FA 1YIJS 3CJKB 3QGPA 2UXCK 4I6AA 1HIYA 1HX1A 4EBDA 2KTQA 3I8BA 1KQSR 4M5HA 5GAHI 2O8FB 2IS3A 2G1HA 4ELTA 3M2RB 3H1QA 3TTFA 4CJKA 4KSEB 1KS2A 1CZAN 4DQRA 3FEXB 4BR0A 4OHVA 2XMVA 3KXDA 5JVHL 1VFJA 4ZMMA 2MKIA 2DXDA 4Q45A 2OSQA 5KAKA 1QD1A 2VBYA 4HHJA 4CFAA 2VFSA 1V3RA 2IRYA 2XTJP 2YBVA 2ZZNA 4JI1J 4J9OA 1YJVA 2VC0A 2MKKA 4K4VA 3DLEB 1F2GA 3RB3A 1KVCA 4DTUA 1S1XA 4BS2A 2QT7A 4DV5J 2BMBA 4P2MA 1WAJA 3IAS9 3G87A 2P5GA 1RTHA 4Z4HA 3LP2B 5DRKA 3PO4A 2V9KA 2AJFE 2Z2ZA 1RDRA 4DSFA 1B3TA 5LMNJ 1V4TA 2UU9K 4DV4K 1FERA 2V68A 1H72C 4KGKA 2ZQBA 4KV8A 1RQ0A 1YDLA 5C42A 2MQOA 2RKIA 2IRXA 3TJAA 3CJCA 5J1PA 3ZZ0A 3PEHA 4RW6A 1KAYA 4HDHA 1FD8A 2Q66A 4OJ1A 2GMHA 1ATRA 4YY3K 1EQYA 3AD7C 3I82A 3ZNJ1 3WXJA 5IM0B 4DCJB 2A3JA 2WVDA 1D0EA 2DGOA 2HRYA 3EZ5A 1WC0A 3NGIA 2VIHA 2GX9A 2HQIA 4RW4B 4I6WA 5EX3A 3P49B 2VGMA 3ISND 2HGNA 3CYMA 4UY85 5F8GA 3THWB 4OLOA 1M5OC 1TZ0A 2B9YA 3FCWA 3OYGA 4F3TA 1OVQA 2JEIA 1HYSA 4CBXA 4M3XA 1FJGK 1HFEL 4FJIA 4BGBA 4X65K 4M3WA 1TL7B 4RLEA 1Q4RA 3CB4A 3IAYA 5AJ3J 3N5FA 2CQDA 4KHNA 2DNHA 1CSJA 4ZCLA 2DIUA 3TZXA 1Q16B 4JI1F 3HI9A 2CQHA 1CQMA 3CJ7A 4FOEA 1VK8A 4LF7J 2AA4A 2NRRA 2LKZA 4YEAA 3NNCA 3OYHA 1XNRK 4DV5F 1PAUB 3H2UB 5MLCQ 2AP1A 2AW0A 1W2BM 1X4AA 5HROA 3F73A 3G4SS 2W9BB 1WELA 2WW4A 2VQFJ 4DR2J 3VN5A 3DRXA 2F1FA 3GE1A 1XMQJ 1QVFM 4DTOA 1KLMB 1QE1A 5LMNF 2FUG9 2KT2A 3OTEA 3DYAB 3PX6A 1J5OA 2VICA 1N88A 5DDRC 1SUQB 4B9QA 1BWVA 2POKA 4HACA 4PKGA 1VRQC 2XMTA 4F4YA 3I56S 3V6DA 1JLEA 1TELA 4AXIA 1YLXA 2YKAA 3GFYA 4DR3K 1VQPN 1Z1ZA 4U7BA 4OO1J 1NMDA 4CZFA 4QPXA 4I9LA 3O1WA 2Q1LA 4OZNA 4ED3A 1HWUA 3UN3A 2VFTA 2VG6A 4U8YA 4IOBA 4ED7A 2I7NA 3V1RA 3OS1A 2IC3B 3VQ6A 1HI0P 1RWUA 4OYPA 4NA1A 2ZH3A 3TAQA 5ETKA 2XS5A 2B4UA 3OYMA 5F8HA 2JFKA 5HMWA 4X4TA 2HBQB 1F5AA 3CD6N 4K4UA 2CG8A 5AJ3F 4U7UK 4NXMJ 4NLXA 4OYWA 4Z4GA 4F3OA 3QFUA 4Y2CA 2AJ2A 4KHUA 4FJHA 4H4MA 1RADB 1IG8A 3TOQA 4LF7F 4KHPK 4FJMA 4XEIA 5U47A 1S1XB 4DFPA 3OYJA 1RCOB 1P9QC 3OTOJ 3OYNA 1FFGB 3MF5A 4F2SA 1RA7A 3UE5A 3ZSXA 2VQFF 4DR2F 2P5VA 2QXLA 2R8JA 1MU2B 4I68A 1FRJA 1U49A 1XMQF 3UCZP 1D09B 2J9CA 2E44A 1MWQA 2VUGA 4FS2A 3ATVA 5L38A 3KG1A 3QZ7A 2QMXA 3Q8YA 4OYBA 2R7QA 4BRIA 1HWIA 5C42B 2RKIB 2DNLA 1JCFA 1JLQA 3P4UB 4RR5A 2V9WA 4O44B 3G82A 1D9DA 5KPZA 3Q23A 3Q7CA 1NZ8A 2X3GA 3GV5B 4WQ4C 1T7PA 1VJWA 3OBIA 2RU9A 3NWGA 2ZBRA 3QEXA 4ZVEA 4FJXA 3V9SA 4CGFA 2Q6BA 3G8TA 1HL6A 1YTUA 1C1BB 5F9NA 2ZDPA 2U1AA 2HRTA 5ETLA 4P71A 4RW7A 3RW7A 1NK5A 3MWTA 3N4PA 4FYVB 2JSXA 3GPAA 4EZ9A 5F9LA 1HYSB 3G25A 1WSIA 1FXLA 3OLAA 4TU7A 4ZHRA 3MN6A 2VFVA 1F5CA 2MZJA 5DMRA 3O44A 5HMYA 4NXMF 3ZX0A 4C8ZA 4UOFA 1I5OB 2BKNA 4CJQA 1WG1A 1P8ZA 4MTPA 1B0PA 3F56A 4IUFA 4RWTA 3EXYA 4M45A 5GAEU 3R97A 3O08A 3C19A 4V1Ak 3LPTA 3QT7A 4I1TA 2ZVSA 1Y5LB 3I9V9 2X3DA 4JKHA 2OPRA 1IG9A 4HWIA 2D1KA 1VRTA 1TFYA 3RBZA 3Q8RB 4Y1CA 3HMJG 4V19X 4KH4A 1T3OA 2PZSA 4BRMA 3OTOF 1L3KA 2YKQA 1U45A 1EB0A 1JJ4A 4ZP7A 3QT8A 2R7XA 3PRBA 2JLFA 4BGAA 1Q9XA 1BQNA 5HROB 3VETA 3Q89A 1SJRA 3NGUA 4G65A 4KBIA 4W98A 4YP3A 1RGIA 4AE5A 1RBRA 2RVJA 3TA1A 3QGHA 4IO9L 1VQ4S 1QE1B 4Q5VA 4RG8A 1PG5B 4DTPA 1EKRA 3Q8SB 3LP3A 2IIRA 4PKIA 2BKPA 2YQ1A 1O1WA 5HLFB 2F4VJ 1J5OB 4JKBA 3ZX3A 2P9IA 2OELA 3UDLA 1W0HA 3IDHA 1K0TA 3A3PB 3GFZA 4DL0C 2YKOA 4IO8A 3WNGA 4IR1A 2AIRB 1J9AA 2HFNA 2DHXA 1T3VA 3V6DB 5D4OA 1JLEB 2RQMA 5KRTA 1XR5A 1X4BA 4YOXA 5CCLA 4DV3J 3E9LA 3HHLA 3LDOA 2R8IA 2N7CA 1RBOB 3SCXA 3PW7A 3O8MA 3D54A 1IJJA 1CJKA 1W9HA 2LQBA 4IQMA 2EWHA 3JQJA 3R7SB 3ILJA 2YHAA 1NKCA 3NGSA 4DV5K 4FZZA 3IR6B 1WI8A 2V69A 4DPXA 3HVTA 3AO3A 5C0YA 4DZ6A 1C0FA 4WFNQ 1M5VC 3DRPB 2PDAA 3SCKE 1KD1T 4X4SA 2C3OA 3H2VE 2DO4A 4ZLLA 4FSVA 2K7KA 3HHLD 4W5TA 4BCAA 4EWTA 1YXQA 4M5IA 5LMNK 2VV5A 1MW7A 2IMWP 4M3TA 4WZMA 5B7WA 3ZLJA 3DCAA 4PXBA 3DHWC 3LA0A 3B82A 4IKAA 1NCLA 2QLXA 4WFYA 2XHCA 1C1CB 3A3OB 4CBUA 2WBMA 3QT6A 1R8PA 3MR7A 3KUHA 2AEMA 2W4CA 2DR5A 3WIVA 5DJBA 2ZZTA 2GIQA 2GVZB 3PIOQ 1T02A 3FRZA 5HK4A 2F4VF 4DQPA 3T5HA 5F1XA 2VZ9A 2ZOMA 3WXKA 3C3LA 3EZUA 4M5KA 1GLFO 4QOTA 4O0JA 1KOOA 4CF9A 4L76A 2B0GA 3ETMA 3BM7A 5KFBA 2Y0SD 3PW4A 1JLQB 1G3OA 2Y8WA 3G82B 3AB2B 3N79A 2ZNZA 1FD2A 4O23A 3KKRA 3GSDA 4JK8A 5JVGL 3V1OA 4KTWA 5AJ3K 1VBZA 4DV3F 1A5VA 1APSA 2Z1JA 3AJ1A 2RRNA 1OS5A 2FY8A 2P9NA 2BOPA 3G4SN 4CJTA 3OA9A 2QZ8A 3MUMP 4OPKA 1VHFA 5F0UA 4K25A 5EX0A 2Q43A 4LF7K 2WCXA 4K4YA 1B9FA 5AQVA 3DLBA 4BDPA 2CQIA 4ZS6A 3AQOA 2D69A 1CS4A 2VQFK 4DR2K 4HEA9 1VHIA 2QI2A 3I56N 3HFKA 1XMQK 1HD1A 2OTLS 4PKHA 1K9MO 2GV1A 2P9KA 2IVNA 1HHQA 4CLWA 4EZ6A 3OVNA 3ZT1A 2QSWA 3MR3A 3AY9A 1VRTB 2GZOA 2R2RA 4FJ8A 3QRQA 4OPHA 2P9EA 5LJWA 3TAEA 5GADI 1WSHA 4A48A 3AA8A 1SKUB 1HNIA 2DR8A 3P5JA 3CCVS 4FJ5A 5I3QA 1AW0A 5KFXA 2GA7A 2X1AA 2YHXA 1UFWA 3DRRA 3G8QA 2ACMA 3MXHP 4BREA 1HKBA 2NUBA 4O3QA 4USJC 1TK5A 1ZM2A 3IBWA 1NSQA 4CZLA 1QUPA 2HRUA 4DV6J 6FDRA 3KMSA 2P9IB 4DR1J 3PW5A 5KG3A 3QO9A 2RT3A 5K8MA 3D1OA 1L5UA 1NWKA 2BOAA 2IVMA 1RHUB 1M0SA 3CCUS 3FDSA 4NXMK 2XS7A 2VASA 1MSWD 3D0IE 3SV4A 3KK2A 4G6VB 3TA2A 3PYDA 2QA4G 3KTQA 3J80O 3HHLB 1U1RA 2NRZA 3O4NA 3CSKA 2K2PA 3G6VA 4H5RA 4CH1A 3KK7A 3BB5A 5HBMA 3UCUP 1UVNA 2WK4A 3QNWB 3CT9A 1K73T 3ZZYA 3VCDA 5FIIA 3AD9C 4HTUA 1FJ7A 4EP4A 3OTOK 4RU2A 1QSLA 3PW2A 1BWFO 3CCLN 4Z0UA 1SH2A 4RUCA 3HVTB 3R5CA 3HPHA 3H6EA 3J7AN 4RCHA 4DU8A 4DR6J 1J53A 4QJVA 2MQQA 4ECQA 3DXKB 4ZPAA 3FC9A 5JS2A 5AQGA 4FLTA 2KW4A 2NSCA 1X4DA 4X62J 5C10A 4P73A 1HI1A 1NUEA 4DU7A 4NYNA 1B0VA 2RDDA 3MCNA 1YGYA 4EK2A 4YN3B 4JN4A 4BACA 3HDSA 3BQ2A 1KAXA 3DNCA 2E4LA 2E5GA 3ENHA 3R1XA 1U7LA 2AF6A 2QMUB 3UPFA 4CNZA 3K9JA 3ILIA 2DPJA 1RTJA 3CM5A 4OYAA 4F9OA 4AHTA 4C11A 4CH0S 3TPQA 3W64A 3NF8A 2N7YA 1UAXA 4DV6F 4RW8A 1RHKB 4CZHA 4CYUA 4DR1F 1QQMA 3DLKA 4N5SA 1P90A 4CJLA 3IR7B 1N8RO 4NI2A 4P52A 4JAXA 3NS5A 4LF9J 1H0HB 1SQEA 2P9SA 4V19S 5M1OA 3LTOA 4LVOP 4AF1A 3SUPA 1AZSB 5IT9Y 1AB8A 5KPRA 4QR1A 3NP5A 4F50A 5HJYA 2HIQA 3I4PA 4ES3A 4CRJA 3VF4A 5B09A 5E3AA 4B3MJ 3EGZA 5C2CA 1HBNA 2HQGA 7FDRA 3BO4A 2XGQA 3NRBA 4NLPA 2MZQA 4LSNA 4OX7A 3C14A 1EX4A 3EWGA 5BRFA 4DR6F 4WCEQ 2AT1B 1NBWA 5CHIA 2NYHA 2VCPA 3MEKA 3VQPA 2CFXA 4X62F 5CZXA 2R7TA 1HPZA 1UVMA 2DNKA 1C0UA 2IJFA 4URQU 2YNGA 4C6AA 5EX5A 4PXEA 5AE3A 2ALYB 3FSYA 1S0NA 4USVA 3CCMS 3HHNB 4U7CA 2ITGA 5KFLA 4DL3A 2Q79A 5D78A 3KHGA 2HOEA 1LXJA 4BQZA 1HNIB 4ZDNA 5L1LA 2JC0A 3VQ4A 3KWMA 3EO3A 2E29A 1JXEA 3C15A 2BJ3A 1ACMB 4H0PA 3DRRB 3P1GA 1FX2A 4WFAQ 1CULA 3LPYA 1JK9B 2B4OA 3H98A 1H7WA 3EGVA 2MGZA 1WEZA 3A8KA 1WHWA 3GIKA 3DHXA 2G4BA 3IN5A 2LMIA 3IFRA 3QO9B 1VQ9S 4PWDB 4U8VA 1RAFB 2C22A 5M2PA 5E3RA 3JTNA 2E1MC 4LF9F 1FE0A 4AL7A 3KHLA 4FLZA 1E6VA 3UW1A 1KTQA 4JK9A 2OO4A 1ZM3A 3KK2B 2YKNB 1Q95G 3I31A 3NDKA 4IH5A 1REVA 2DFHA 4QYRA 4C3MA 4P75A 4B3MF 3AOBA 4GVEA 4Y34A 4AHUA 4RW9B 3AJ2A 1Y4ZB 2G2ZA 1T9VA 1OQ3A 2L3MA 1U1PA 2KT3A 3OUYB 2DRDA 4UTGA 4QCLA 3J81Y 2YNFA 2G8FA 2AD9A 4NX9A 3UR3C 1S6UA 3MPDA 3OL8A 4RNHA 2ZJPQ 4H4KC 3JAMO 3EUNA 1IXKA 4B02A 5KFKA 3MWBA 1FNOA 3ZEUA 2ZJRL 3VA3A 4ILJA 4BR9A 1VISA 4DPUA 1U0HA 2R7VA 4K8ZA 5DQGA 1VSMA 3TSPA 2CIMA 1KNZA 5EWGA 4CFBA 5KFGA 2VL1A 2D4WA 3HOTA 5GAEP 2G2YA 3FR0A 5KFJA 4IO1A 3TW0A 1Z25A 4KKOA 2CAJA 3LQVA 2BE7D 4JI3J 3JB9k 3TAMA 3QYYA 1QAXA 3LANA 1IQTA 1S1WB 3THTA 1KHVA 2MDAA 3CE8A 1R0CB 1RLDA 3TR8A 1N0UA 3VAIA 1UJ4A 3AQPA 2I7PA 1RTJB 4FWSA 4KHWA 1CVJA 3IM8A 3ADAC 5D4PA 4C11B 2V8DA 2L9NA 1MA9B 3CJQA 2DNRA 5IQ6A 2OTLN 3SSSA 1FI4A 2D9OA 1YUWA 2Z2LA 1T3NA 3TR5A 4CYUB 4KRFA 4FF1A 1RDAA 4NB4A 5M2RA 3RVCA 2MKJA 1KQGB 1VQYA 1PJ6A 4IOAQ 4F3QA 1L3UA 3UR0A 3JTPA 5KFVA 1HWJA 3MPWA 3C94A 2P9SB 3CCVN 2XEXA 5KFTA 3OSPA 5A76A 3MTJA 4NOHA 3THVA 1BI4B 2MHEA 3QGGA 3UB5A 3J7ZO 4FJGA 2XQCA 1HBNB 4B3SJ 1W7WA 2DR9A 1UZHA 3O2IA 4LSNB 3W8GA 3C14B 2UXDJ 4M3YA 4C98A 3OR2A 4ISGA 1FW6A 2MYFA 2BDPA 1NHUA 4EU0A 2ATQA 4JKAA 2OSRA 5DLGA 1Q82T 3RB6A 2PMHA 1RACB 1HPZB 2LDYA 2XZDB 2B9XA 2HBMA 4BRDA 1X3MA 2D7SA 4JI6J 1RXOB 1NGCA 2B8PA 4DV6K 1DTQB 4IOCQ 3MN5A 5F8IA 4DR1K 2WSEC 4JI3F 4S0MA 3KZBA 3TUPA 2BM0A 2EG1A 4TY8A 4Y6IA 3PKYA 3G0ZA 1FRXA 4NRUA 3RB0A 1NH8A 1FNXH 4NLRA 3QMLA 5FRMA 2MZ1A 2ZH1A 1U2FA 2KVIA 3SAHA 4L3KA 1NK4A 3NGDA 1CULB 3BKTA 3BUZB 5JJBA 2HVEA 2BZ2A 2MGZB 5ETRA 3SQ0A 2BUPA 4ENOA 2BRLA 4H0YB 4KJIA 1K8AO 3M1FA 4JYAJ 2J9DE 3QINA 1JXLA 1TKZA 1RILA 2E2NA 3QERA 2Y1IA 3T1HJ 3SFGA 1HI8A 2DD8S 5I3PA 1VBYA 1BIZA 4DR6K 4LREA 2QWPA 1E6VB 1NNEA 4H0XB 4X62K 7AT1B 1REVB 5CQGA 3PVXA 4BR7A 3W2WA 5B0AA 2D3O1 3CJ0A 1UEVA 2Z56B 3O4WA 5HATA 2B8QA 4B3SF 5C24B 1VRUA 4CHYA 1VQNS 3P39A 2OKQA 4EBCA 4J9VA 2CQ1A 2UXDF 2YNFB 1PILA 3G96A 2OYQA 3NGRA 1NOYA 3DI6A 2FPHX 2FVRA 3HZ6A 1TL3A 4OYOA 3CJRA 2BUNA 1Q5YA 3ZEUB 3FZ2A 2X78A 3ULHA 1U0HB 2CQ0A 3M30A 3U9DA 2R8KA 2F8EX 4JI6F 1UVJA 3NGZA 4A8XA 3KJFB 3OBWA 1KTVA 3VEVA 1M5KC 3HJFA 3MCMA 2K3IA 3G10A 2DKOB 1ULRA 3OTDA 2J0WA 4FPIA 2LVWA 4D3GA 1VC5A 3THXA 1FCAA 4P10A 1RJJA 3EYZA 3TAMB 4QYZJ 4DL5A 4DQIA 2Z0GA 2KXHA 2V4JA 5EWEA 4LF9K 1X4GA 2VOPA 5K8PA 1AUSL 4P6QA 1YKWA 2V2KA 1FNMA 3MMBA 1IVZA 1U6BA 2W2QP 2VONA 1NOZA 4ZVRB 2NXCA 5H9EJ 1TKXA 4YHHJ 4DCHA 4B3MK 1GT8A 3HSGA 3OVAA 2OPSB 1MMDA 2ZITA 4L3NA 1X5PA 2UVRA 2E20A 2HHHJ 3DGPB 4JYAF 3GWCA 2OIHA 4IR9A 1U04A 4WJBA 1ZTWA 3T41A 4ICLB 3T1HF 1EQ0A 1LFWA 5BPNA 2KM8B 3NF6A 1Y3KA 5A8WA 1X5TA 4HTIA 2BQRA 4BC3A 3SCIE 1F9FA 4WXOA 4JUZA 2O8EB 3TJ8A 1RWPB 4F26A 3K59A 2Q1NA 3OFGA 2HLUA 1FJEB 1OPIA 3MFIA 1Q78A 1VBXA 4A46A 3NS7B 1Q8KA 4X4RA 4CZJA 4O4RA 3RBDA 2X1BA 3D6MB 4LFCJ 5JS1A 2P51A 4AT1B 3OFEA 5KRSA 4WFXA 2QJ3A 4ZVQB 3TAGA 1N4LA 1RBSA 4A61A 2P5OA 4F25A 3AVKA 2CKWA 1F5BA 3VAMA 1OYEA 3O9QA 4QS7A 4DF8A 5AQFA 1LQ9A 3CWJA 1TKDA 4HVZA 2ROEA 3O6WA 4FPAA 3CJ3A 2W1BA 1M1HA 3CPWM 3U1MA 4KRWA 3MR5A 4TY8B 2J5AA 5AQWA 5AR0A 1ZETA 4K50A 2D3OR 1ZZFA 3U9ZA 3IA0A 4ED5A 2KH9A 1XC3A 4KHMA 1BU6O 2HHUA 1RHQB 1RWMB 3R7BB 3CPEA 4OZ1A 1NZAA 1VS3A 2M0GB 4ED2A 1JXBA 4YHHF 1K1SA 4F3MA 3QPIA 3TU5A 2HNDB 2C2NA 5G4DA 2HHHF 3D45A 2G0JA 5AXKA 2HNZA 1D9FA 2FC0A 2HWHA 1CLQA 2HZCA 4UOCA 4DFKA 4A2BA 2A18A 3BPDA 4CNYA 4WKRA 2IIHA 4FO0A 2DRAA 4WTYA 1T6DA 2FBXA 4BC7A 3GV7B 4OYZA 3TNVA 2CWXA 9RUBA 2R9LA 3H40A 4WK1A 3C2PA 3VAJA 3L4QA 1XR6A 3K8WA 3BEXA 4MIBA 1SS6A 1VJQA 2W24A 3CD7A 2J76E 3J81j 2V4QA 4CIFA 4PCQA 2CQPA 4YOWA 4C8NA 2V5HG 4ID1A 2GMLA 4CF1A 2YCHA 3R6MA 4I64A 4LFCF 1VRUB 2N4CA 1GLEG 2VB6A 4QIGA 4JI3K 4FYDA 3AA2A 5AT1B 3DI6B 2O8CA 1GXUA 1YAGA 4ED4A 1XMBA 3H4DA 4DHYA 1SZ2A 4LF1A 1QS4A 3GIRA 4OPAA 4NZ0A 4E2FB 3JYTA 2YNHB 3EZOA 2GIRA 1RAGB 4DV7J 4Z4IA 4IJAA 2JL9A 3SUOA 2OMLA 2VYPA 3CC2N 2IPOB 1FA0A 4BDYA 3WXMB 3C6TA 2WRMA 1EHWA 2XMUA 2GW8A 3THXB 2XCPA 2PIIA 4UOGA 1BXNA 3ID6A 1HMVB 4QQBA 3KDOA 1IWGA 1X4HA 3ZT0A 3AGKA 3H08A 1J27A 3LH2S 4YNQA 2V4JB 2CQ3A 1O13A 3MEEA 1IBLK 4NEZA 1HNZJ 3KUEA 3MMBB 1X31C 4XPEA 5DG8A 4UZBA 4KPYA 1TKXB 3CTRA 4DB3A 3ZNUA 3VQ9A 3RAXA 5KOXA 4ER8A 4B3SK 2OZSA 2APOA 3ENVA 4YB1P 2QW9A 1AFJA 2JNJA 1F2HA 2MQMA 3BGFA 3CXCM 2AWZA 1ZBSA 1T95A 1MROA 4ED0A 2XMWA 3OXLA 2LEPA 4F0HA 3HF5A 1FKOA 1UKUA 2E5JA 4WBFA 3M32B 4JI6K 1R0AA 3KLEB 5ETSA 4A57A 2RIJA 4YOEA 3D0HE 2GHWA 3WNHA 3SCLE 3N9UC 1R43A 2YWWA 3CERA 3HHEA 3SUNA 2KFZA 2F5GA 4B8AB 2H48B 4U6PA 4K4TA 1SL0A 3ID8A 1W2IA 2XWXA 4YQWA 5HQMA 4A8WA 3AA3A 1UCNA 2GJ2A 1E4FT 4DV7F 4A8OA 1VOMA 4PPDA 4J37A 3H3NO 3O9SA 4AUKA 3OL6A 2DEJA 4GMJB 1SQKA 3LWMA 3V1QA 4BLGA 3H3OB 2I5JA 4JYAK 3C0BA 4KO0A 4O55A 1CXUA 1WSEA 1VQNN 4DMNA 3T1HK 4BVOA 2XMJA 1VQ8S 1YITS 2HS3A 1HNZF 3WUHA 1HD0A 4KAIA 3JSMA 2B4PA 4ED8A 1BUPA 2YVSA 4Z4FA 7FD1A 4C0OC 2FJEB 3CW2C 3TVYA 4JV2A 1CJVA 4FWQA 2HNZB 1X5OA 1JB0C 2XSJA 5KQDA 4IYQA 3JSBA 2R3VA 4MIAA 4H5NA 5C2DA 4UT4A 2EC2A 1HQEA 2YWHA 4BC5A 3GMGA 1AYEA 4BWMA 2RN2A 5KTQA 1U09A 5DLFA 3TX0A 4G1QA 1H2UX 5EOYA 3KG4A 3VV2B 3MXIA 4I69A 2V94A 3ENOA 1N6QA 5KFHA 3U7JA 3P83D 2OAUA 4A5BA 4J9LA 3E1YA 3L6QA 4QYZK 2IDLA 1HUXA 1U24A 4PXDA 2O8CB 1IWAA 3OR1A 5LSRA 4RNFA 2W42A 3VF2A 4N41A 1GX6A 4Q8FA 4Y2AA 3D28A 1YX2A 1S76D 2QLBB 3VTIA 2W2OP 2QRRA 2BBEA 3HVAA 4J8FA 3JYTB 3AO2A 5H9EK 1QTMA 1WKKA 6AT1B 5K9FA 4DX8H 2DITA 3UD5A 1N5SA 4OV1A 3ETOA 3CNQP 1CLFA 1RWNB 2UXBJ 4BRPA 2HHHK 2RE1A 2Q36A 1XJWB 3KNGA 1VQKS 4KPCA 3ASMA 5D4LA 5FPDA 4CEDA 1VQ7S 4PQUA 3AODA 1G15A 2AJQA 1GH8A 2IJNA 2VODA 1W25A 2MKSA 3OHBA 4TYAA 1C0MA 4Z94A 1ZS6A 3TTCA 4PQAA 4K4ZA 3KLHB 3IRXA 2QMWA 4KB7A 2E8AA 3GG0A 4ZCIA 1TP7A 1TVRA 2CPZA 2QLWA 3VWSA 2XNRA 2LQJA 2HLTA 1TL1A 2JEGA 1GLBG 5I3UB 2UUAJ 3A8YA 3AAWB 4CESA 4Z37A 5KG5A 4CLLA 4CEAA 2KKHA 2QC3A 1G1XA 2QGFB 3KJQB 4GVBA 4KFBA 2AZ1A 1MROB 4PWUA 3MI7X 1NDKA 4ECZA 2LQ8A 1FKOB 1URNA 3B54A 3W5ZA 4K2JA 3QIPA 1YVUA 3HULA 3MEDA 4ECRA 1EKEA 4FJ7A 1QLNA 1R0AB 4ZVHA 3SQGA 3HSCA 2H4YB 1VQLN 3BO2A 4OGCA 5KOWA 1QAIA 5JXSA 2OTJS 4ZLPA 1C1AA 4ISEA 4IWVA 3NH2A 4DX7A 5ADXH 2PEBA 3AAPA 2CH5A 2R2SA 2BW2A 1C0TB 1YSJA 4I67A 2E7VA 1KONA 2LA4A 1X5SA 1UVLA 4N7TA 4F0KA 2FJWA 1VQ5S 4A4JA 2PA3A 2FHKA 2HHWA 4CJFA 3PDNA 2OEMA 1NPPA 2WBRA 2HWIA 1BHNA 3MCSA 4LSZB 4UOHA 3SQOP 5C7PA 3FZFA 2WOMA 2O3DA 2UXBF 4KI6A 2RRAA 4M95A 2GCFA 4CD1A 2B9EA 4NLTA 4B9TA 4B8CA 2I5JB 2RJZA 5KG4A 1PIEA 4XH5A 3QFWA 4O3NA 4ETXA 3PG9A 2XYHB 3V4IA 3LDQA 3VVUA 4EFAC 2PEHA 3CF5Q 1PSDA 2B3TB 3T6BA 5ETQA 5T7LA 1ZBIA 3FGVA 4ID5A 3KNAA 2DR6A 4HCCA 3M8SA 3M9OB 5DQHA 1VK3A 5DM6Q 1UA1A 2PN6A 2JVOA 3DRYA 4BDZA 3TAPA 1JLCA 2KDOA 2AZ3A 5KG6A 1T94A 2UUAF 3CQXA 3EVOA 5B0CA 1S7HA 2HBZB 1CJVB 1M5HA 5CHCB 4BC9A 3KFWX 2PBDA 2XSJB 4LBPA 3HO1A 3LDLA 5J2PB 1WC4A 4NLVA 3VF6A 1S9GA 3PJ9A 3W5YA 3HSTB 4JI7J 1SCJB 4ES1A 2H9ZA 4OI6A 2PA8D 3S6EA 5L39A 3TABA 2F8SA 1VBKA 3I55S 4G1QB 2JOQA 5K20B 4FBTA 4IDHA 2P9LB 4P9SA 3I32A 2QYCA 4NRTA 3V81A 1N6QB 2XZTB 4C23A 2RS2A 4OL8A 3W9IA 2RAQA 2R7SA 8ATCB 4FWPA 3IRWP 3OR1B 5AQTA 3P5BP 2B43A 3BSAA 1X8DA 2MEWA 1JCGA 1OKJA 5E84A 3FK4A 4CJEA 4PXCA 5GMKa 1HNZK 4FXVA 5CZ1A 4NA2A 3CVKA 2XB2D 1I94J 1FWPA 3A1YG 3NXZA 5D0HA 3L7UA 3TVZA 1HW8A 2V7YA 2K8GA 4NLQA 4KH5A 3T1AA 5T14A 2DNGA 4M63A 1OY6A 1X9WA 4TQRA 2OP5A 3L2UA 2DGSA 3P4IA 4PQUB 1WUAA 4RL1A 2EHGA 4CT9A 3UDVA 4FPRA 1T9TA 4YS2A 2CXEA 4K4WA 1VAZA 4TU9A 3ITHA 1TVRB 4K41A 2HMPA 4UQTA 3TP2A 2GUPA 2DH7A 2F9JA 5D15A 3MR2A 3NH0A 3HOSA 4LSLA 3KLVA 1RBAA 1ZYQA 4NCBA 4JI7F 3NEKA 5KPTA 2H4WB 3AO1A 4DQ8A 2CPJA 4DPYA 2FJAB 3H42A 4O0NA 4GVBB 4KFBB 5HP1A 3CEDA 2HNYA 1FEEA 3ULEA 2HZVA 1U1OA 3HT3A 1D1UA 3OYDA 1FKPB 5FD1A