3VQ8A

Hiv-1 in core domain in complex with (3r)-3,4-dihydro-2h-chromen-3-ylmethanol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
136
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 51
structure length 136
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq8A00
1LWCA 4FM0A 2I5JA 5HRSA 2G8KA 3OYMA 3NH0A 4MFBA 4TSXA 4CJSA 4QAGA 4DFPA 4IG3A 4CJ3A 4IFVA 2FBVA 4AHSA 3M8SA 3NGIA 3KLHA 2PZSA 1KRPA 3L2RA 4DTNA 3OYBA 2XO7A 3OYDA 4FVMA 5KI6A 1BISA 4JRPA 4KHNA 3RMDA 4B9TA 4Z4FA 1JLQA 3ITHA 4NYNA 4N47A 4KI6A 3LANA 3S3MA 3V4IA 1X9SA 1GOBA 4N76A 3P83D 3ZSXA 4FK2A 3SPYA 3QEVA 4I2QA 4CERA 4CJVA 2HVHA 1GOCA 1QTMA 2FBXA 2QK9A 4CK2A 3K5MA 3K59A 4CHYA 1YTAA 4DLEA 3RRHA 4KHQA 2IS3A 3VQ8A 3AA2A 3SUQA 3FFIA 1CXQA 4C8MA 4DTJA 1KVAA 1HYSA 4ZHRA 1T7PA 1FK9A 1TAUA 3BGRA 4C8OA 4OLBA 5C42A 3RMAA 3SQ2A 2F96A 3DRPA 1S1XA 3P5JA 3KD5E 4O4GA 2X78A 1L3VA 2HVIA 1WAJA 1C0TA 1RBSA 1VSDA 2KW4A 2YNHA 5KTQA 1RTJA 3NHGA 4I2PA 4DQSA 5I3UA 4K8ZA 3LP0A 5FRMA 4QCLA 4FJIA 4CJQA 3QIPA 3NH2A 4FLYA 4KHSA 4KTQA 2D0CA 1KVBA 3RMCA 1SL2A 3JSMA 3V9UA 3NDKA 1TKXA 1F21A 3G10A 3TABA 4KPYA 1X9MA 3DLEA 1U04A 3OYGA 1NK4A 4DSKA 1FKPA 2GUIA 1D9FA 1NOYA 3CM5A 3L2VA 3VQ4A 1YVUA 3AVBA 1WSIA 1BCMA 3V9XA 3V1RA 5J2PA 3O3HA 3OYJA 3V9SA 4CJFA 1HMVA 1N5YA 1CXUA 1C0MA 3G0ZA 5CYMA 3HP6A 4FK0A 4FJJA 2WONA 4IFYA 3CFRA 3NCIA 1WSEA 1K6YA 4OKEA 1NJXA 1B92A 1SKRA 1WSJA 2NUBA 3MEEA 1EP4A 3MXJA 1RT2A 4KV8A 1UA1A 4J2BA 2XY8A 2F8TA 2FC0A 3KLEA 3V9WA 2YNFA 4CEBA 1TV6A 3KJVA 1JL1A 1JLGA 4GMJB 4M41A 4M3ZA 1BGXT 1ASWA 2OPQA 2QKKA 4CEDA 1ZBLA 1QQCA 4C8LA 5E41A 4ZTJA 1S6PA 1JLCA 1TKZA 3QIOA 4RW7A 4CCHA 5KRSA 1RDBA 5SZTA 2G8UA 4EP4A 3M8QA 3RR8A 1BI4B 1XHZA 4MQ3A 1S6QA 1ITGA 3D0PA 4ELUA 4FM1A 2Q3SA 1J53A 4L8RB 2G8FA 4KFBA 3VQAA 2Z1JA 4IDKA 1NJWA 2EHGA 3DLKA 1UOCA 3AO1A 3CFPA 1TGOA 5J2MA 4DTRA 4M3UA 3NGZA 1KSPA 5HRRA 4F3OA 2HNDA 3B6OA 3L3UA 4BE2A 3HM9A 4CGHA 1RBUA 3ALYA 4OKKA 4Z4HA 3V9ZA 3V81A 1RT1A 2OZSA 3SQ1A 3AVLA 4FW1A 4FJHA 4OLAA 4CF8A 4PQUA 4CJUA 1ZBUA 2QKBA 4LD0A 1CZ9A 3NF9A 3MAQA 4HCBA 4KHYA 4CEEA 4CHNA 2HHUA 3NBPA 1S1VA 1RTHA 1ZBFA 2YKMA 4B9UA 4FLXA 4HUFA 4F2RA 4CGGA 3TAGA 3AVAA 2FBTA 4DSLA 1RBVA 4NCBA 4AHVA 3DI6A 2XHBA 4DU1A 1BQNA 3LZIA 1TVRA 1Z25A 4E19A 3RR7A 4LY7A 3K5NA 1ASVA 1KTQA 3VQ6A 1NK0A 3OVNA 3AO4A 4B9MA 1W9HA 5FRNA 1NK5A 2Z1HA 3ZSWA 2ZD1A 3B6PA 2VWKA 4FLVA 1WSGA 3LAKA 4FJ7A 4J2AA 3QO9A 1S9GA 4JS4A 3K58A 3NFAA 4AH9A 4E3SA 4FM2A 4DLGA 3SQ0A 3AO2A 4EZ6A 3C6UA 4BDPA 1TKTA 2EX3A 3C95A 2B6AA 4CJTA 3ULDA 4ELVA 3KKSA 4CHQA 1CLQA 2QXFA 1RCHA 4O44A 4DSEA 4O5BA 1UWBA 2G8HA 3CQ8A 1IKWA 4KTZA 1D9DA 3ASMA 4KHUA 1WSFA 3WNGA 4KI4A 5FDLA 2G8WA 3H08A 3VN5A 3AVCA 3PO5A 4N56A 3NF6A 1BIZA 4Q0BA 4BWJA 2HNZA 2P51A 3VQCA 3LPTA 4LH5A 3SZ2A 1SV5A 1ZYQA 4OPJA 4O55A 3WNEA 3WNHA 4FJ8A 3AVKA 1Q9XA 3MXIA 4DS5A 3NGYA 1TKDA 4F4KA 3PX4A 4CESA 4EP5A 4Z4CA 1CZBA 4FJ9A 2Y1JA 2PYLA 3KKRA 3MECA 4J2DA 3ZT3A 2IGIA 2HHVA 2B5JA 4M3WA 4CEFA 2KFNA 4RW8A 5HLFA 4CEOA 4C8NA 3RTVA 3OJSA 3VA0A 3PV8A 4KREA 3QEPA 5J2NA 4RW9A 4ICLA 1RBRA 4W5RA 1RT6A 3QEXA 5HP1A 2FBYA 4BWMA 4ZTFA 1KFSA 3AA3A 3HVRA 4OVLA 4N5SA 4F3TA 1TL1A 1NKBA 4KTWA 1BCOA 2B4JA 1S1UA 3THVA 2XY7A 1Y97A 4B9SA 1VSJA 5HROA 2YNIA 2P5OA 1HQEA 3LP1A 1J54A 3SPZA 1KLMA 2DTUA 4NYFA 2XY6A 4OGEA 4FZZA 1QE1A 3PX6A 1NKCA 2XRIA 4KAZA 4FJXA 1HQUA 4NCGA 5J2QA 4Z4EA 1WN7A 3T3FA 2KTQA 2YHAA 3U6FA 4DSIA 4HUEA 3V1QA 2RKIA 3ZSVA 2OPRA 3AV9A 2DFEA 3AVMA 4CJEA 3VQ7A 3OS1A 2Y1IA 3TAQA 4W5NA 1EXQA 2IAJA 2BE2A 3CYMA 4CJPA 4Y1CA 5JS2A 3UIQA 4FZYA 2BGGA 3DLBA 3K57A 3L8BA 4ID5A 4DFKA 1IG9A 4DQIA 1RDDA 1JKHA 4KB0A 3EZ5A 4KO0A 3DMJA 5CZ1A 4E7LA 1DTQA 2X6NA 1LAWA 4IBNA 2OA8A 1NOZA 1UAXA 1DLOA 3HP9A 4M42A 4ELTA 4RG8A 4DTOA 4WE1A 3QEIA 2WOMA 4E7KA 4EZ9A 1EKEA 3C6TA 1S5JA 3NE6A 4J2EA 2ZQBA 2GBZA 4CHZA 5HRNA 3O3GA 2BDPA 2HHTA 3M8PA 2E4LA 4CJLA 4XIUA 1VRUA 3SNNA 4JLHA 4LH4A 1C0UA 3KD1E 4RW6A 2VG6A 1S1WA 3LP3A 4K8XA 4LSLA 3QERA 1DTTA 3AO5A 4GVMA 4CFCA 1VSHA 4DU3A 2YKNA 2XY5A 4I9QA 2HW3A 4YFUA 4F8RA 3AA5X 3VQQA 4B08A 1KCFA 1KFDA 4QOZB 2KFZA 1KLNA 2X6SA 3DRSA 3HSTB 4DG1A 1QSLA 3QLHA 1VRTA 1RT7A 4E1MA 3VA3A 4W5OA 4OGCA 2Z1GA 4CFDA 1C1AA 3KLFA 1ASUA 2AJQA 3AVNA 2E6LA 4I9LA 3DRRA 2JGUA 4CEAA 4CGIA 4CK3A 1SKWA 2O4IA 4CF1A 3C94A 3HPOA 2HHXA 1L5UA 2KZZA 1JLAA 3ZSQA 4FW2A 1VSKA 4NCAA 4CEZA 4AHTA 5KRTA 3NH1A 3LZJA 4FCYA 4F2SA 3V1OA 1TL3A 3SUPA 4FJNA 4AHRA 3U3YA 1J5OA 1B9DA 3PUFA 3TARA 4AHCA 3OJUA 1JLFA 3OYEA 1GOAA 3TAMA 2YNGA 4Y1DA 4B9LA 4CGFA 3VQEA 1D8YA 1N6QA 5DK5A 1Q8IA 1VSMA 4FLUA 4DQRA 1TAQA 5HRPA 4AHUA 3ZT0A 3OS2A 1VK0A 4CECA 3IRXA 3KIOA 4CIEA 3KK2A 4FLTA 1KVCA 2RPIA 1SL1A 4DQPA 1IO2A 1A5XA 3SUNA 3PY8A 3HJFA 4BDYA 3IS9A 1U4BA 4CF2A 3LPUA 4CJKA 3AVIA 4CJWA 4B8AB 3KK3A 4HUGA 3SV4A 1HJRA 4O0JA 3T19A 3L3VA 1JL2A 1VSFA 1T8EA 4DWIA 3ZCMA 5KGWA 1IKVA 3IAYA 3F9KA 1J9AA 3DLRA 2PY5A 1ZBHA 4CEQA 4H4MA 3L2QA 1U45A 3TAEA 3VQBA 3LDSA 3K5OA 5CYQA 4DTXA 1IKYA 2DFFA 1W0HA 4CHOA 3L2UA 4FJGA 1X1PA 2HMIA 4FXDA 4YNQA 1LV5A 3LWMA 3TANA 1NK8A 4G1QA 4CGJA 3TAPA 5J1EA 4CK1A 5DMRA 4DF4A 1RBTA 4M3RA 3A2FA 3P1GA 3ZSOA 1RT5A 3ZT2A 1ZBIA 3LALA 1REVA 4CF0A 4DTMA 3RMBA 3DLHA 1NJYA 3HXMA 2P1JA 3O4QA 3T1AA 4Z4GA 3V6DA 3OYNA 3HPGA 4BDZA 5CZ2A 5C25A 1JXBA 3O4NA 4CFAA 1L3UA 3ZT4A 4KB1A 2X74A 3AVFA 2LSNA 3ZSZA 3S3OA 4OKJA 4DU4A 4BACA 1C1BA 4BE1A 4FJLA 3VQ5A 3JYTA 4FJMA 3M8RA 1XHXA 2Z1IA 4Z4IA 2JLEA 3I8DA 2P5GA 4M3YA 1LWEA 1G15A 2YV0X 3MEGA 3S3NA 4PWDA 2HB5A 2O4GA 3HO1A 1RNHA 1FXXA 2IC3A 1TK5A 4I7FA 2ITGA 1L3SA 2D0BA 1NKEA 4HCCA 3PO4A 1RT3A 4H4OA 1LW2A 1NJZA 1RTDA 5KGXA 3RWUA 2HHQA 1XWLA 3E01A 2VG7A 4DF8A 1X9WA 1QSSA 3K2PA 4FJ5A 4PUOA 1VSIA 3SQ4A 3CFOA 5EU7A 3WNFA 1YTUA 1JLEA 1LWFA 3AA4A 1O1WA 4M45A 4W5QA 1S9EA 1SL0A 4CJ5A 2HHWA 1BL3A 1MU2A 4CIFA 3SYZA 3I0SA 1TK8A 1L3TA 2IOCA 2RN2A 1JLBA 4DFJA 3TAFA 1NK6A 4FJKA 4CJRA 1EX4A 1VSLA 3VQ9A 1Z26A 4CJ4A 5T7BA 3EYZA 5I42A 2IDOA 3KK1A 2A1RA 4PY5A 1RTIA 4CF9A 4CGDA 1B9FA 2ETJA 4JRQA 4HHTA 4E89A 4CFBA 3BDPA 4AILC 1T03A 3DM2A 3DOKA 5K14A 4DTUA 1VSEA 3F73A 2VWJA 3QEWA 3NF8A 3EY1A 4M3TA 3HK2A 1S1TA 2YHBA 2DY4A 1FKOA 3ISNC 1NK7A 4FZXC 3AVJA 4OJRA 4HTUA 3ZT1A 3S9HA 1SUQA 3AVGA 3OYAA 3LAMA 1XC9A 4OPKA 3DLGA 4KHWA 3ZSRA 2VG5A 1HNVA 4E1NA 3LWLA 3SUOA 3U3GA 4DSFA 3MEDA 3MXMA 2DFHA 4CHPA 2HNYA 2OPPA 3IG1A 4E7JA 2OYQA 4KRFA 1Q9YA 1WAFA 3DYAA 4IG0A 2R7YA 4DFMA 3QESA 4UQGA 4B9VA 2D0AA 3CG7A 3HL8A 3HPHA 4N41A 4FLZA 3O3FA 3OYLA 1HYVA 1JXEA 4B8CA 3ZSYA 4HVJA 3OYHA 3QNNA 4FYDA 1BIUA 4FLWA 1I39A 1XI1A 2GV9A 1R0AA 1LAVA 3L2WA 3SJJA 1QSYA 1RDCA 2F8SA 4FK4A 1HPZA 3AVHA 1C1CA 3TR8A 3I0RA 3VQPA 3RRGA 2HHSA 1WSHA 5C24A 1UA0A 2ZE2A 4O0IA 3DOLA 3QINA 3SI6A 1RILA 4B3OA 3QETA 1U49A 1QHTA 4CIGA 3NAEA 1A5WA 3K5LA 1NK9A 2BANA 3TWHA 4DTSA 3KTQA 1HRHA 4PA1A 4DSJA 1YT3A 4M3XA 2E6MA 4LSNA 4JS5A 1D5AA 4E7IA 4IKFA 3NF7A 5SWMA 4H8KA 5FROA 3HVTA 3TI0A 3LP2A 5D3GA 5HBMA 2RF2A 1C6VA 1IH7A 1SKSA 1T05A 3KLIA 2OPSA 1U48A 2KZMA 4DS4A 1EETA 3D45A 3SCXA 1WLJA 3OYFA 4E0DA 1IKXA 2A1SA 4DTPA 1TK0A 1BHLA 3PX0A 1WNSA 2ATQA 4R5PA 2PYJA 2OZMA 1LW0A 2G8IA 5JS1A 3CM6A 1A5VA 4C8KA 2G8VA 3VQDA 3OYCA 3OYKA 4ID1A 4RW4A 4E7HA 1RDAA 4Q5VA 1I3AA 3OY9A 4Z0UA 1BQMA 3KLGA 1HYZA 4CE9A 3AO3A 2KQ2A 4W5TA 1RT4A 4GW6A 3HT3A 4DQQA 4DMNA 4BE0A 1HNIA 3QNOA 3OS0A 5CY4A 1QS4A 4KKOA 3HYFA 1U47A 3OYIA 2D5RA 1BI4A 3SV3A 2W42A 4B9NA
chains in the Genus database with same CATH superfamily
4FM0A 1WBDA 4M63C 3VPZA 3OYMA 4MFBA 4CJSA 4DR5K 4DFPA 4IG3A 4CJ3A 4IFVA 3CCQN 4AHSA 4DV2K 3A0IX 3KLHA 3L2RA 2F9TA 2XO7A 3G71N 4X65K 3OYDA 3GL1A 4BRDA 5KI6A 4JRPA 2NLXA 4B9TA 1JLQA 4KI6A 3O5BA 1GLJO 2A5XA 2V52B 4O5FA 1X9SA 2CGJA 2CGLA 4JAXA 4I2QA 3HI0A 4CJVA 1QTMA 4CHYA 1YTAA 4DLEA 3D6RA 3VEOA 3FFIA 1CXQA 4C8MA 4DTJA 1HYSA 1FK9A 2NRWA 3LDNA 1TAUA 5LMUK 4JI6K 4OLBA 1NNEA 3ZETB 5H1SQ 1S1XA 4CZFA 3E9OA 2X78A 1C0GA 2F7TA 1X3MA 1VSDA 2KW4A 2QWLA 4JN4A 4CJQA 5DM7L 4FLYA 4CZGA 2Q0RA 4KHSA 2D0CA 4M7YA 3QBWA 3V9UA 1F21A 4KPYA 2UUCK 3TTFA 3THWB 2A41A 3CM5A 2YHWA 3L2VA 3WQTA 1WSIA 1BCMA 1DGKN 1GLAG 3OYJA 1N5YA 5JMVA 1HLUA 4FK0A 3CCSN 3NCIA 1NJXA 1SKRA 3VEZA 1WSJA 3MEEA 1UA1A 2F8TA 2FC0A 3KJVA 1JL1A 1JLGA 4M41A 2QWPA 4BR5A 4YDUC 4WQ4A 1Q82O 4CCHA 1RDBA 4AM7A 4DV3K 2P9LA 2IIRA 3VQAA 1NJWA 4DV0K 2O8CB 4DTRA 1KSPA 5HRRA 5BPLA 2UXDK 3V81A 1RT1A 2OZSA 4J8FA 4GY2B 4PQUA 4CJUA 1E4GT 3MAQA 4HCBA 3D2FB 4OO1J 1RTHA 4B9UA 2D4WA 4F2RA 4CBUA 4DSLA 1RBVA 4DU1A 3THYA 3K5NA 4PKHA 1ASVA 1KTQA 5FRNA 3MCPA 5GIPA 4DV1K 4ISFA 2Z1HA 1NK5A 2HMPA 3ZX0A 5LMNK 4FJ7A 3LM9A 4EAHD 1EQYA 4E3SA 2A6AA 3T7ZA 3AO2A 4BDPA 2EX3A 4JKCA 4JK9A 4FWPA 4CHQA 1IV0A 1CLQA 4GKKK 3WXJA 1IKWA 4KTZA 1D9DA 1YJNN 1VHXA 4KHUA 3PIPL 1W2BM 3ENBA 2G8WA 3VN5A 3PSFA 3NF6A 5AQTA 3VQCA 2HNZA 2P51A 3LPTA 3SZ2A 4A5BA 2FSKA 4QS9A 3CPEA 3WNHA 4DS5A 3ZX3A 1TKDA 4GNIA 1JCGA 1CZBA 3JS6A 1BU6O 1GLEG 3WEEB 3EZWA 4M3WA 4CEOA 4JNEA 4C8NA 3OJSA 3VA0A 4DHYA 3AAPA 3UKUB 1RBRA 2P9PA 5AZJB 1N34K 5GIOA 5C0YA 4KTWA 1BCOA 4IXCA 3VETA 4B9SA 1VSJA 1HQEA 3LP1A 4JKBA 4NYFA 4OGEA 3PX6A 1NKCA 2P9SA 5BR9A 3TSQA 2XRIA 4NCGA 3NVMA 1WN7A 4IO8A 3V1QA 2RKIA 4ILHA 3OS1A 4W5NA 1X9JA 1Q81O 1EXQA 3CYMA 2BE2A 2BGGA 3DLBA 3L8BA 3BP8A 1RDDA 4E7LA 1DTQA 3O9RA 4IBNA 3I8BA 1UAXA 4LFCK 4ELTA 2WOMA 3CQXA 4B3TK 4BVOA 5EX5A 5HRNA 3O3GA 2BDPA 2HHTA 4BC5A 4U7BA 3VERA 4K8XA 4LSLA 1DTTA 4DU3A 1OKJA 3AA5X 3VQQA 3WUHA 2W6LA 3OW2M 1KLNA 3UB5A 3HSTB 3DRSA 3EE9A 4FOEA 1SAZA 4CI6A 3RSEB 2Z1GA 4CZLA 3AVNA 2AJQA 4A5AA 3DRRA 2V7YA 4CF1A 1L5UA 2KZZA 3ZSQA 2P9IA 3MN5A 1BA1A 4FWOA 5KRTA 3LZJA 3MWPA 3PIOL 1J5OA 1B9DA 3KK7A 1NGDA 3KWGA 1XMOK 2P9KB 2ZJPL 3VQEA 1YVNA 4AHUA 3ZT0A 4CECA 4CIEA 1BA0A 1IBLK 1KVCA 4QS7A 3SUNA 3TU5A 4C1NI 2Q36A 4CF2A 4CJWA 3GDQA 4B8AB 1T8EA 2GWJA 4JKEA 4DWIA 1J9AA 2GELA 2PY5A 4CEQA 1ATSA 3K5OA 5CYQA 4A2BA 3L2UA 2ASPA 4G1QA 3VEXA 5J1EA 4DF4A 3PSIA 4M3RA 1ZBIA 1REVA 3DLHA 1NJYA 2P1JA 3T1AA 3V6DA 3CMEN 3JAMO 2Q31A 5CZ2A 4BDZA 3O4NA 4Y0WA 4KB1A 3ZSZA 3O4WA 1HKCA 3VMFB 2JLEA 3FFKB 4BVPA 3HO1A 4B1UB 3CJ7A 1TK5A 2P9NA 4I7FA 1RDWX 3CQYA 1NKEA 4H4OA 1LW2A 1NJZA 1RTDA 3E01A 4DF8A 3FZLA 1TYQA 3C65A 4PUOA 4M45A 4W5QA 1S9EA 3QICA 1TK8A 4CIFA 2QWNA 5T7BA 4K42A 3EYZA 2UXCK 4YORA 2IDOA 2E5LK 3CXCM 4CF9A 4PHTX 1NG9A 1E3MA 5K14A 1NLVA 4DTUA 5F0XA 3F73A 4M3TA 3CI5A 4JHDB 4BRGA 2WFBA 3AVJA 3MN6A 4GV6A 3HSCA 3WQUA 1U6ZA 4E1NA 3E1YA 3WT0A 2DFHA 2QXLA 3WXLA 4CHPA 3WXKA 1WAFA 4UQGA 1Q86O 3E9PA 4HVJA 3QNNA 3OYHA 4LC9B 2HBJA 1GLDG 1XI1A 5MLCQ 1R0AA 1NGHA 5C2DA 3I33A 3ZEUA 2CGKA 3HM8A 4CJ7A 5C24A 4O0IA 1RILA 1U49A 2ZM6K 4DSJA 3CC2N 5SWMA 4H8KA 3TSUA 5FROA 5GINA 5D3GA 3TSPA 1T05A 3KLIA 2OPSA 3J8AA 1WLJA 4EFHA 3E66A 4R5PA 2PYJA 1A5VA 4C8KA 1NGIA 1KXPA 3CJCA 2O8BA 3OYKA 4RW4A 2Q1NA 4DR7K 5AQMA 5C10A 4WFNL 2KQ2A 4BRFA 1RT4A 4GW6A 4W5TA 1D4XA 1ESVA 4LF7K 1HNIA 3OS0A 1JJ2M 2E8AA 1QS4A 4DV6K 1GLCG 4KKOA 5AQPA 3QEIA 2W42A 2PFUA 2UXBK 2I5JA 3DJCA 3P38A 3VEWA 4R79A 4TSXA 4QAGA 1VQPN 2PZSA 3NGIA 1VQLN 4N76A 3T1HK 3P83D 2H3GX 2VQEK 4FK2A 3SPYA 4QS8A 4CERA 2HVHA 2QK9A 4CZKA 4CK2A 2P9UB 1Z6RA 3K59A 2VWBA 3RRHA 4KHQA 2V7ZA 1ZC6A 3MN7A 3VQ8A 5AQWA 4ZHRA 1HPMA 3F5TA 3GG4A 4C8OA 3RMAA 2F96A 3SK3A 3KD5E 4OPHA 1ATRA 1LCUA 1WAJA 2YNHA 3AARA 4NO7A 1NGJA 1KAZA 4K8ZA 1RTJA 4I2PA 3J7AP 2E88A 4HWIA 5BN8A 3RMCA 4IJNA 4OX9K 3VTHA 3A5LC 2P9LB 3TABA 2KLAA 1OH7A 3OYGA 3OA9A 2FF3B 3FR0A 3SAGA 1NOYA 1YVUA 4F9OA 1BOTO 1C0MA 5CYMA 2WONA 3CFRA 3OBYA 2UUBK 5KPTA 3M1FA 2IVOA 4OKEA 2NUBA 4KV8A 2XY8A 3KLEA 1N32K 2YNFA 4CEBA 2O8DA 4BR0A 4GMJB 3ULEB 3C6AA 1ASWA 3THYB 4C8LA 1KAXA 1S6PA 2QW9A 4RW7A 5M1NA 2QA4N 2G8UA 1HX1A 5BR8K 5AFUA 1XHZA 4MQ3A 4ELUA 4FM1A 2Q3SA 4IDKA 3MWTA 1UOCA 3AO1A 1TGOA 5J2MA 3NGZA 4C23A 3B6OA 3L3UA 4BE2A 4DR3K 5CE3A 4OKKA 2I7NA 1ZBUA 2NNWA 3NF9A 4O8UA 4CHNA 3NBPA 1XMQK 1ZBFA 3FGUA 4FLXA 4HUFA 3AVAA 2FBTA 4NCBA 1TVRA 4E19A 4LY7A 4X66K 3VQ6A 4K0KK 4B9MA 3ZSWA 3B6PA 4LFAK 4FLVA 3CJBA 3LAKA 3QO9A 3QMLA 4YHHK 4AH9A 3EE8A 4FM2A 3CC7N 3SQ0A 4EZ6A 5AQKA 1TKTA 3C95A 4CJTA 5JLFA 1WOQA 2QWRA 4H0OA 4DSEA 3CPWM 3CQ8A 4BY9C 3ZLJA 1K8AO 5FDLA 3IDHA 3VENA 3AVCA 3PO5A 2WTUA 3CJAA 1RDUA 4FL9A 1ZYQA 3Q7BA 3AVKA 2GUPA 3NGYA 4BRLA 1Y64A 2PYLA 3KKRA 3MECA 4WYBA 1C0FA 3ZT3A 4J2DA 2KFNA 5HLFA 4WQ4C 5JVHL 3QEPA 5J2NA 1W7AA 4RW9A 2VYPA 3O80A 1RT6A 3IMXA 3QEXA 4LF9K 4BWMA 4KH4A 5LY3A 2QI2A 3AA3A 5KQDA 3HVRA 4OVLA 3LDLA 2HF4A 3C7NB 4IWVA 4F3TA 1NKBA 3THVA 1Y97A 5HROA 1N33K 2P5OA 5KQ8A 1WB9A 2XY6A 1H1VA 4FZZA 1QE1A 1HQUA 4L3QA 3R8EA 3U6FA 1BG3A 4DSIA 3TAQA 5BRDA 4Y1CA 3BUZB 4FZYA 4DUYK 3K57A 2P9IB 4ID5A 1K8KB 4DQIA 1YAGA 1NOZA 1DLOA 4BC3A 4M42A 1TUUA 4DTOA 4EZ9A 2CH6A 2ZQBA 2E20A 3M8PA 3H3OB 4JI4K 4XIUA 2W6KA 3DAWA 3LP3A 2HW3A 1VSHA 4V19S 4NXMK 1XNQK 5AQGA 1QQOA 4B08A 1KCFA 1QSLA 2E2OA 4JKGA 4BR2A 3QLHA 2HBKA 1RT7A 2QTDA 1ASUA 3O1BA 2O4IA 4FW2A 1VSKA 2WC9A 4FCYA 5M1OA 3V1OA 1S22A 1TL3A 3SUPA 5EXWA 3OJUA 1GOAA 4Y1DA 1W97L 1N6QA 4WFAL 3M6GA 5DK5A 1Q8IA 3SJHA 2CH5A 5KPRA 3OS2A 2NZTA 3KIOA 3KK2A 1SL1A 2WBNA 3PY8A 1HKGA 4BDYA 2Q97A 3SBTA 4CJKA 5AQLA 4AF1A 4HUGA 2P9NB 4O0JA 1VSFA 1NJIO 3IAYA 1ZBHA 4H0TB 4H4MA 1NGGA 1IKYA 1W0HA 2QWOA 4CHOA 3K0SA 1X1PA 2HMIA 4FXDA 2YI1A 5E84A 3LWMA 1HKBA 2KKZA 4CGJA 3QDKA 5F1XA 1RBTA 1NGEA 2E2NA 3P1GA 1RT5A 4CF0A 3RMBA 4JYAK 3HXMA 4H0VB 3GOIA 2F4VK 5C25A 1KQSM 3P4IA 2X74A 4B1XB 4BACA 4BE1A 4FJLA 3VQ5A 3JYTA 1KD1O 4FJMA 4ILJA 1SQKA 4NB4A 2YV0X 3MEGA 2HB5A 4JI2K 3EKUA 5AQUA 1L3SA 2D0BA 4DR6K 3PO4A 2FF6A 2YHYA 4Z94A 5JLHA 1P90A 3K2PA 1GLFO 2JWKA 4JI0K 1VSIA 3UKRA 3SQ4A 1JLEA 1O1WA 4BG8A 5BPNA 4CJ5A 4DV7K 1MU2A 1RFQA 1DKGD 2QWQA 3SYZA 1ZBSA 3OBWA 1L3TA 2HBMA 5AQNA 2ZF5O 3ZEUB 1VSLA 3VQ9A 1GLLO 2NRTA 2A1RA 1RTIA 2O8EB 4CFBA 1N8RO 4DV4K 3CJ9A 3BZKA 1HNXK 1S1TA 5BREA 2YHBA 1FKOA 1NK7A 3A5MC 4H5VA 5LJWA 4H0XB 3OYAA 4OPKA 3DLGA 3QBXA 4KHWA 2VG5A 2WUSA 4IJAA 3U3GA 3MEDA 4GV3A 2OCEA 4E7JA 3L6QA 2QEXN 2O8BB 2D0AA 3HL8A 3HPHA 1OVQA 2QM1A 3DXKB 3ZSYA 4YOYA 3G4SN 1I39A 4RCHA 1QZ6A 2FLOA 2GV9A 1VQ5N 1RDCA 2F8SA 5ADXA 3VQPA 3I0RA 4YY3K 4BGAA 4BRNA 2ZE2A 3QINA 5GAGP 3SI6A 1IJJA 3QETA 1QHTA 4BROA 3K5LA 3IUCA 3OTOK 4M3XA 2D0PA 4JS5A 1D5AA 4IKFA 3THWA 2QWMA 4O8KA 3TI0A 5AZIA 3LP2A 5FPMA 5HBMA 3VEVA 1C6VA 1SKSA 4JI8K 3AGKA 1VQNN 5CHIA 5BRFA 1IKXA 2A1SA 3C6HA 1YHQN 1TK0A 4KHPK 3PX0A 1WNSA 2ATQA 5GAEP 3CM6A 4M7XA 2I7PA 3FZKA 4Q5VA 3TPQA 1G99A 3AO3A 4BRCA 4BE0A 2AP1A 3HYFA 2O8FB 1DT9A 1U47A 3OYIA 4A57A 4CJ4A 2XY5A 1LWCA 3VTIA 4YOWA 1MWMA 2G8KA 1VQON 2O8CA 3M8SA 2ZGYA 3ID6A 4DTNA 3OYBA 3FZFA 4FVMA 2HSTA 3W0LA 5C15A 1BISA 4KHNA 4Z4FA 3RMDA 2UU9K 1V4SA 1J6ZA 3V4IA 2ASOA 2VQFK 3QEVA 1GOCA 2FBXA 5TKWA 1KVAA 1VQMN 3O9TA 3J7ZO 3CCEN 3DXMB 1EWQA 4BRQA 3SQ2A 4EIAA 4O4GA 2O8DB 1L3VA 1C0TA 2HHUA 3O1WA 5I3UA 5FRMA 5KTQA 1YJWN 3LP0A 4EHTA 4BRIA 3CERA 3H46O 3JSMA 3OHRA 3NMUA 3NDKA 1TKXA 2Q2RA 1QQNA 1X9MA 1U04A 1NK4A 1SZ2A 3CETA 4B3SK 3MX2A 1WUAA 2E1YA 3VQ4A 3S41A 3AVBA 1T3VA 3FZMA 1JCFA 5FLXO 2GWKA 5LJVA 1HMVA 2OTJN 4FJJA 4IFYA 5A2QO 1EO1A 3D2EA 1WSEA 1K6YA 1OH8A 4FWQA 2RHKA 4J2BA 1FJGK 3V9WA 1TV6A 3G6EN 4AQYK 3O8MA 4M3ZA 1VQ4N 3PLAA 1BUPA 4BRPA 5AZJA 3G25A 4ZTJA 3QIOA 5KRSA 4JD2B 2W41A 3M8QA 1HR0K 5JICA 1BI4B 3LM2A 3D0PA 1S6QA 4L8RB 2NRZA 2Z1JA 2YJEA 1JCEA 2EHGA 2F9WA 3CFPA 4PKIA 3CCVN 4M3UA 3LL3A 4IFEA 1U2VA 3HM9A 1RBUA 3V9ZA 4Z4HA 3SQ1A 3AVLA 2NRHA 3EL2A 4LD0A 1CZ9A 4CEEA 2NRRA 4FWKA 2YKMA 4CGGA 3TAGA 4WQ5A 4AHVA 2XHBA 1BQNA 1Z25A 3RR7A 4XH1A 1NK0A 3L0QA 3OVNA 1W9HA 4DCHA 2VWKA 5FPNA 1ATNA 1Z05A 5LL6Z 4J2AA 4A59A 4BC2A 5ELZA 3FLCO 4DLGA 3CC4N 3SAHA 3KWIA 4YOVA 3ULDA 3FZHA 3KKSA 1NWKA 4ILGB 4O44A 4O5BA 2G8HA 3U8XA 3ASMA 1WSFA 5BRHA 4KI4A 4LF4K 4NLBA 3I56N 3A5OC 1WBBA 4Q0BA 4BWJA 4LH5A 4NXNK 1SV5A 3F9MA 4OPJA 1Q9XA 3BZCA 4F4KA 4H5RA 3VGLA 4IO9L 4CESA 4Z4CA 4FJ9A 4A2AA 3O9SA 2IGIA 2B5JA 4KREA 3KZBA 3PV8A 1KAYA 1XUPO 4K41A 4WF9L 4ICLA 5HP1A 2FBYA 2ZWHA 3CCUN 4ZTFA 4N5SA 1YF5L 5AQHA 4I6MA 3FE1A 3NVKA 1TL1A 3VGKA 1J54A 2GEMA 3SPZA 2DTUA 1OH5A 4FJXA 4JKGB 2OTLN 2KTQA 2NRXA 2YHAA 5M1QA 3ZSVA 2OPRA 3AV9A 2DFEA 3AVMA 4MDBA 2Y1IA 4IEIA 3H1VX 5JS2A 3UIQA 5AJ3K 1VAZA 1YITN 3QB0A 4DFKA 1IG9A 4GV9A 4KB0A 4KO0A 5CZ1A 3THXA 3VF2A 2X6NA 4JKHA 5EOYA 4FPAA 3HP9A 4HTLA 3HBTA 5AQXA 4WE1A 4JI3K 5AQZA 3A8YA 3U4LA 1EKEA 4E7KA 4J2EA 1S5JA 1K73O 5DM6L 4CHZA 2W40A 1HUXA 2E4LA 2GX9A 1NU0A 1VRUA 3SNNA 4JLHA 4LH4A 1C0UA 4RW6A 3MK6A 3QERA 4GVMA 4I9QA 2YKNA 4F8RA 1KFDA 2X6SA 4DG1A 5AQQA 4FO0A 4W5OA 3R9PA 4CFDA 4E1JA 1YJ9N 4I9LA 4MDAA 4CEAA 2JGUA 4CGIA 4CK3A 3HPOA 4JKFA 1E4FT 4CEZA 1VQKN 3NH1A 1BWFO 4AHRA 3BEXA 3U3YA 4AHCA 4JHDA 1BO5O 3MMVA 2YNGA 4B9LA 1NMNA 4KBOA 1D8YA 5M1PA 2YJFA 4FLUA 4BG9A 2DPNA 1TAQA 4H5WA 1I94K 3R6MA 4FLTA 4DQPA 1IO2A 1A5XA 2J4RA 2P9PB 3HJFA 3IFRA 3IS9A 4FWSA 1OVYA 1U4BA 3AVIA 3KK3A 1HJRA 4H0YB 1JL2A 3WXMB 5KGWA 1IKVA 3DLRA 3L2QA 1U45A 3TAEA 3VQBA 4EHUA 4DTXA 2DFFA 2P9SB 5BN9A 1LV5A 3TANA 3TAPA 4GVEA 5DMRA 4DTMA 1YXQA 4JV5K 4Z4GA 4CZEA 1JXBA 4CFAA 1NMDA 3AVFA 2LSNA 4CD1A 3BF1A 4OKJA 4DU4A 4YOXA 1C1BA 4X64K 5AFUH 1NGAA 3BF3A 4JI5K 3I8DA 1J5EK 2P5GA 1LWEA 3S3NA 2O4GA 2HBLA 2A40A 1RNHA 1FXXA 2IC3A 3KHYA 2ITGA 3AY9A 4DR4K 4HCCA 3RVCA 1TUYA 5KGXA 3RWUA 4CZIA 5KPZA 2HHQA 2YCHA 2VG7A 1QSSA 2NRVA 4WFBL 5AQYA 4FJ5A 3WNFA 5HL7L 3LDOA 1LWFA 3AA4A 1SL0A 5I9EB 1BL3A 3I0SA 3J81O 2D0OA 2IOCA 2RN2A 1JLBA 4DFJA 4FJKA 4CJRA 1EX4A 1QQMA 3F2KA 1Z26A 5I42A 4PY5A 2E2PA 4PKGA 4CGDA 3CCMN 1B9FA 4JRQA 3BDPA 3AGRA 4AILC 3CCJN 1T03A 3DOKA 3CHWA 2VWJA 3EY1A 3VF6A 3VF4A 4DQ8A 5AZIB 4OJRA 4B3RK 4ISEA 4MO4A 3AVGA 1XC9A 2P9UA 2HOEA 1HNVA 3LWLA 3SUOA 3HZ6A 1XC3A 4DSFA 2HNYA 1O13A 1Q9YA 5BPMA 3DYAA 4DFMA 4B9VA 3UE5A 3IKMA 5GAHP 4BC4A 3O3FA 1JXEA 4FYDA 1BIUA 4XH4A 4FLWA 1NM1A 1LAVA 3SJJA 2VGNA 1HPZA 1C1CA 5TKYA 1WSHA 1UA0A 3DOLA 3K9KA 1VQ6N 3N4PA 4CIGA 3NAEA 3TWHA 3ID8A 4B1YB 4CZJA 4B3MK 3NF7A 4IEEA 5F2RA 5HOOA 3CIPA 2RF2A 1IH7A 2KZMA 4DS4A 1EETA 3D45A 3SCXA 4E0DA 1HNWK 3B8AX 1BHLA 1NGFA 3KVGA 1LW0A 2G8VA 1YI2N 4ID1A 1RDAA 3OY9A 2UUAK 3N4QA 1BQMA 3ULEA 4CE9A 4XH5A 3HT3A 4K43A 4FOIA 3QNOA 1TYQB 5CY4A 3Q7CA 1EWRA 3O6WA 4YDUA 5EY4A 5GADP 5HRSA 1LOTB 4CD3A 3NH0A 4DB3A 2FBVA 1KRPA 1Q18A 3A5NC 3ITHA 4NYNA 4N47A 3LANA 3S3MA 1GOBA 3ZSXA 2A3ZA 3H1QA 1R59O 3K5MA 2IS3A 3DWLA 3AA2A 3SUQA 5EVZA 1T7PA 2BTFA 3D2EB 3BGRA 3VESA 5C42A 3DRPA 3P5JA 4IDHA 2HVIA 1RBSA 3NHGA 4OPAA 4DQSA 4QCLA 4CZMA 2GTDA 4BREA 4DV5K 4FJIA 3QIPA 3NH2A 4CBWA 4KTQA 1KVBA 1SL2A 4H03B 1T6CA 3G10A 3DLEA 4CVNE 4DSKA 1FKPA 2GUIA 1ILYA 1D9FA 1S3XA 4XEIA 3SBGA 1U2VB 3V9XA 3H6EA 2HF3A 3SMPA 3V1RA 3J7YP 3O3HA 3CMAN 5J2PA 3V9SA 3MDQA 4CJFA 4YOTA 1CXUA 1T6DA 3G0ZA 3HP6A 3U9DA 1IG8A 4LFBK 1P8ZA 1B92A 1EP4A 2FSJA 3ENOA 3MXJA 1RT2A 3ZETA 3J80O 3VGMA 3LDPA 2UYTA 1QVFM 1BGXT 2OPQA 2QKKA 4CEDA 1ZBLA 1QQCA 4UY8O 5E41A 1JLCA 1TKZA 5AQIA 3I55N 5SZTA 4EP4A 4BRKA 3C7NA 3M3ZA 3RR8A 5E26A 1ITGA 1J53A 3H45C 2G8FA 4JK7A 4KFBA 1CZAN 1HJOA 2ZJRL 3DLKA 3MX5A 4BQZA 4F3OA 2HNDA 4CGHA 3ALYA 3P31A 5M1FA 1KC8O 4FW1A 3EN9A 4ISGA 4CF8A 4FJHA 4OLAA 2QKBA 4KHYA 4A61A 3L4QA 1K8KA 1S1VA 1NGCA 4AM6A 5AQOA 5M1KA 3DI6A 3LZIA 2PAVA 3H3NO 3QFPA 3D7EO 1ZXOA 2FXUA 3AO4A 5FPDA 2ZD1A 1WSGA 1S9GA 3BY5A 4JS4A 3K58A 3NFAA 1V4TA 5IT9O 3C6UA 4ELVA 4LF8K 2B6AA 4I6MB 4IOCL 3SLCA 2QXFA 1RCHA 4JI7K 1UWBA 3HOTA 4YOUA 4CW7B 1T44A 5AQJA 4B1VA 3T1YK 3GE1A 3WNGA 2JWLA 3D2FA 1DEJA 3H08A 3ATVA 4JEPA 3O9UA 4N56A 1BIZA 3ZYYX 4O55A 3WNEA 4FJ8A 3GBTA 4FWNA 3MXIA 3P39A 3CCRN 5C12A 3PX4A 4BR9A 4EP5A 4DR1K 5ADXH 2Y1JA 3M5RA 3THXB 2HHVA 4CEFA 4RW8A 3RTVA 1X3NA 1XNRK 4A62A 4W5RA 3T69A 4JI1K 4IOXA 4JKAA 1KFSA 1NGBA 1OH6A 3TTCA 1XQSC 2B4JA 1S1UA 4BRMA 2XY7A 2YNIA 2ITMA 1KLMA 4FVUA 5JVGL 4KAZA 5B8HA 5J2QA 2VGMA 3T3FA 4Z4EA 4HUEA 4CJEA 3VQ7A 2IAJA 4CJPA 4WQ5C 3ZX2A 1JKHA 3WEEA 3EZ5A 3DMJA 4C1NK 2OA8A 1LAWA 1M90O 4RG8A 2V51B 3UKUA 4BGBA 3C6TA 3NE6A 4H5NA 2IVNA 2GBZA 2PBDA 4CJLA 5AQRA 2YHXA 3KD1E 4BQLA 2VG6A 1S1WA 3AO5A 4CFCA 4YFUA 4QOZB 2KFZA 4H0PA 3U9ZA 2E1ZA 1VQ7N 1VRTA 1FW6A 1IBMK 3CF5L 4E1MA 3VA3A 3QFUA 4OGCA 3KLFA 1C1AA 3CCLN 2E6LA 1SKWA 3HOSA 3C94A 3R3LA 4RWTA 3WXIA 2HHXA 1JLAA 2O8EA 4NCAA 4AHTA 4CBXA 3CJ1A 4MLEA 4F2SA 4BR4A 1MA9B 4BRAA 2BUPA 4FJNA 4B9QA 3PUFA 3TARA 1QVGM 1JLFA 3OYEA 3TAMA 1QHAA 2OANA 4CGFA 4B1WB 4B1ZA 4GKJK 4FPBA 4K25A 1VSMA 3AAQA 4DKWA 4DQRA 5HRPA 1VK0A 3IRXA 1K9MO 2RPIA 4RTFD 4CZHA 3LPUA 3DXKA 3SV4A 3T19A 3L3VA 3K9JA 3MN9A 3RSEA 3ZCMA 3CD6N 3F9KA 2IVPA 3EKSA 3W3DA 3E9LA 3LDSA 2YX6A 4FJGA 4YNQA 2RE2A 1NK8A 3C0BA 4IOAL 4CK1A 3A2FA 1RGIA 3ZSOA 3ZT2A 3LALA 3O4QA 3R1XA 2P9KA 3OYNA 3HPGA 4MO5A 1IBKK 3L4IA 2AA4A 1L3UA 3ZT4A 4KH6A 3S3OA 4IZ9A 2BH1A 2E2QA 4U67L 3TTDA 3M8RA 1XHXA 2Z1IA 4G9ZA 5AR0A 2A42A 4Z4IA 3O08A 3SAFA 4M3YA 1G15A 1SS6A 4PWDA 3VEYA 3MCAB 4LF5K 5IWAK 4MLHA 4X62K 3DLLL 1RT3A 2D1KA 4FSVA 1Q7YO 3ENHA 1XWLA 4BR7A 5AQSA 1X9WA 5AQFA 3HTVA 4PL8A 2O8FA 3CFOA 3ATUA 5EU7A 1YTUA 2Q0UA 4DUZK 4JK8A 4H5TA 3O9QA 4NLCA 5C2FA 4FWRA 4FWMA 4WCEL 3TAFA 1NK6A 3KK1A 1MDUB 1YIJN 2ETJA 4HHTA 4E89A 3DM2A 1HNZK 1VSEA 3QEWA 3NF8A 3HK2A 4DR2K 4LF6K 4PL7A 2DY4A 3ISNC 4FZXC 4HTUA 3ZT1A 3S9HA 1SUQA 2VCPA 4KH5A 3LAMA 5CR4A 1NBWA 3ZSRA 3MXMA 3IG1A 2OPPA 1S72N 2OYQA 4KRFA 4IG0A 2R7YA 3QESA 3DXMA 4N41A 3CG7A 4FLZA 3OYLA 1HYVA 4B8CA 2FSNA 3L2WA 1BDGA 1MWKA 1QSYA 4FK4A 3AVHA 3TR8A 3RRGA 2HHSA 1VQ9N 1VQ8N 2ZGZA 4B3OA 5AQVA 3EO3A 1M1KO 1A5WA 1GLBG 1NK9A 2BANA 4DTSA 3KTQA 2HHWA 1HRHA 4PA1A 1YT3A 2E6MA 2ASMA 4LSNA 4E7IA 3VOVA 3HVTA 2ZJQL 1U48A 1N36K 3OYFA 3HRGA 4DTPA 5FPEA 2OZMA 5JS1A 2G8IA 2HHHK 3JXUA 3VQDA 3OYCA 4E7HA 2EWSA 1I3AA 4FWLA 4Z0UA 3KLGA 1HYZA 4JKDA 2KHOA 4DQQA 4DMNA 1YUWA 3SMSA 4BRHA 3LDQA 3EEQA 4JD2A 3UKRB 2D5RA 1BI4A 3SV3A 4B9NA 1QZ5A
chains in the Genus database with same CATH topology
1LWCA 4FM0A 2I5JA 5HRSA 2G8KA 3OYMA 3NH0A 4MFBA 4TSXA 4CJSA 4QAGA 4DFPA 4IG3A 4CJ3A 4IFVA 2FBVA 4AHSA 3M8SA 3NGIA 3KLHA 2PZSA 1KRPA 3L2RA 4DTNA 3OYBA 2XO7A 3OYDA 4FVMA 5KI6A 1BISA 4JRPA 4KHNA 3RMDA 4B9TA 4Z4FA 1JLQA 3ITHA 4NYNA 4N47A 4KI6A 3LANA 3S3MA 3V4IA 1X9SA 1GOBA 4N76A 3P83D 3ZSXA 4FK2A 3SPYA 3QEVA 4I2QA 4CERA 4CJVA 2HVHA 1GOCA 1QTMA 2FBXA 2QK9A 4CK2A 3K5MA 3K59A 4CHYA 1YTAA 4DLEA 3RRHA 4KHQA 2IS3A 3VQ8A 3AA2A 3SUQA 3FFIA 1CXQA 4C8MA 4DTJA 1KVAA 1HYSA 4ZHRA 1T7PA 1FK9A 1TAUA 3BGRA 4C8OA 4OLBA 5C42A 3RMAA 3SQ2A 2F96A 3DRPA 1S1XA 3P5JA 3KD5E 4O4GA 2X78A 1L3VA 2HVIA 1WAJA 1C0TA 1RBSA 1VSDA 2KW4A 2YNHA 5KTQA 1RTJA 3NHGA 4I2PA 4DQSA 5I3UA 4K8ZA 3LP0A 5FRMA 4QCLA 4FJIA 4CJQA 3QIPA 3NH2A 4FLYA 4KHSA 4KTQA 2D0CA 1KVBA 3RMCA 1SL2A 3JSMA 3V9UA 3NDKA 1TKXA 1F21A 3G10A 3TABA 4KPYA 1X9MA 3DLEA 1U04A 3OYGA 1NK4A 4DSKA 1FKPA 2GUIA 1D9FA 1NOYA 3CM5A 3L2VA 3VQ4A 1YVUA 3AVBA 1WSIA 1BCMA 3V9XA 3V1RA 5J2PA 3O3HA 3OYJA 3V9SA 4CJFA 1HMVA 1N5YA 1CXUA 1C0MA 3G0ZA 5CYMA 3HP6A 4FK0A 4FJJA 2WONA 4IFYA 3CFRA 3NCIA 1WSEA 1K6YA 4OKEA 1NJXA 1B92A 1SKRA 1WSJA 2NUBA 3MEEA 1EP4A 3MXJA 1RT2A 4KV8A 1UA1A 4J2BA 2XY8A 2F8TA 2FC0A 3KLEA 3V9WA 2YNFA 4CEBA 1TV6A 3KJVA 1JL1A 1JLGA 4GMJB 4M41A 4M3ZA 1BGXT 1ASWA 2OPQA 2QKKA 4CEDA 1ZBLA 1QQCA 4C8LA 5E41A 4ZTJA 1S6PA 1JLCA 1TKZA 3QIOA 4RW7A 4CCHA 5KRSA 1RDBA 5SZTA 2G8UA 4EP4A 3M8QA 3RR8A 1BI4B 1XHZA 4MQ3A 1S6QA 1ITGA 3D0PA 4ELUA 4FM1A 2Q3SA 1J53A 4L8RB 2G8FA 4KFBA 3VQAA 2Z1JA 4IDKA 1NJWA 2EHGA 3DLKA 1UOCA 3AO1A 3CFPA 1TGOA 5J2MA 4DTRA 4M3UA 3NGZA 1KSPA 5HRRA 4F3OA 2HNDA 3B6OA 3L3UA 4BE2A 3HM9A 4CGHA 1RBUA 3ALYA 4OKKA 4Z4HA 3V9ZA 3V81A 1RT1A 2OZSA 3SQ1A 3AVLA 4FW1A 4FJHA 4OLAA 4CF8A 4PQUA 4CJUA 1ZBUA 2QKBA 4LD0A 1CZ9A 3NF9A 3MAQA 4HCBA 4KHYA 4CEEA 4CHNA 2HHUA 3NBPA 1S1VA 1RTHA 1ZBFA 2YKMA 4B9UA 4FLXA 4HUFA 4F2RA 4CGGA 3TAGA 3AVAA 2FBTA 4DSLA 1RBVA 4NCBA 4AHVA 3DI6A 2XHBA 4DU1A 1BQNA 3LZIA 1TVRA 1Z25A 4E19A 3RR7A 4LY7A 3K5NA 1ASVA 1KTQA 3VQ6A 1NK0A 3OVNA 3AO4A 4B9MA 1W9HA 5FRNA 1NK5A 2Z1HA 3ZSWA 2ZD1A 3B6PA 2VWKA 4FLVA 1WSGA 3LAKA 4FJ7A 4J2AA 3QO9A 1S9GA 4JS4A 3K58A 3NFAA 4AH9A 4E3SA 4FM2A 4DLGA 3SQ0A 3AO2A 4EZ6A 3C6UA 4BDPA 1TKTA 2EX3A 3C95A 2B6AA 4CJTA 3ULDA 4ELVA 3KKSA 4CHQA 1CLQA 2QXFA 1RCHA 4O44A 4DSEA 4O5BA 1UWBA 2G8HA 3CQ8A 1IKWA 4KTZA 1D9DA 3ASMA 4KHUA 1WSFA 3WNGA 4KI4A 5FDLA 2G8WA 3H08A 3VN5A 3AVCA 3PO5A 4N56A 3NF6A 1BIZA 4Q0BA 4BWJA 2HNZA 2P51A 3VQCA 3LPTA 4LH5A 3SZ2A 1SV5A 1ZYQA 4OPJA 4O55A 3WNEA 3WNHA 4FJ8A 3AVKA 1Q9XA 3MXIA 4DS5A 3NGYA 1TKDA 4F4KA 3PX4A 4CESA 4EP5A 4Z4CA 1CZBA 4FJ9A 2Y1JA 2PYLA 3KKRA 3MECA 4J2DA 3ZT3A 2IGIA 2HHVA 2B5JA 4M3WA 4CEFA 2KFNA 4RW8A 5HLFA 4CEOA 4C8NA 3RTVA 3OJSA 3VA0A 3PV8A 4KREA 3QEPA 5J2NA 4RW9A 4ICLA 1RBRA 4W5RA 1RT6A 3QEXA 5HP1A 2FBYA 4BWMA 4ZTFA 1KFSA 3AA3A 3HVRA 4OVLA 4N5SA 4F3TA 1TL1A 1NKBA 4KTWA 1BCOA 2B4JA 1S1UA 3THVA 2XY7A 1Y97A 4B9SA 1VSJA 5HROA 2YNIA 2P5OA 1HQEA 3LP1A 1J54A 3SPZA 1KLMA 2DTUA 4NYFA 2XY6A 4OGEA 4FZZA 1QE1A 3PX6A 1NKCA 2XRIA 4KAZA 4FJXA 1HQUA 4NCGA 5J2QA 4Z4EA 1WN7A 3T3FA 2KTQA 2YHAA 3U6FA 4DSIA 4HUEA 3V1QA 2RKIA 3ZSVA 2OPRA 3AV9A 2DFEA 3AVMA 4CJEA 3VQ7A 3OS1A 2Y1IA 3TAQA 4W5NA 1EXQA 2IAJA 2BE2A 3CYMA 4CJPA 4Y1CA 5JS2A 3UIQA 4FZYA 2BGGA 3DLBA 3K57A 3L8BA 4ID5A 4DFKA 1IG9A 4DQIA 1RDDA 1JKHA 4KB0A 3EZ5A 4KO0A 3DMJA 5CZ1A 4E7LA 1DTQA 2X6NA 1LAWA 4IBNA 2OA8A 1NOZA 1UAXA 1DLOA 3HP9A 4M42A 4ELTA 4RG8A 4DTOA 4WE1A 3QEIA 2WOMA 4E7KA 4EZ9A 1EKEA 3C6TA 1S5JA 3NE6A 4J2EA 2ZQBA 2GBZA 4CHZA 5HRNA 3O3GA 2BDPA 2HHTA 3M8PA 2E4LA 4CJLA 4XIUA 1VRUA 3SNNA 4JLHA 4LH4A 1C0UA 3KD1E 4RW6A 2VG6A 1S1WA 3LP3A 4K8XA 4LSLA 3QERA 1DTTA 3AO5A 4GVMA 4CFCA 1VSHA 4DU3A 2YKNA 2XY5A 4I9QA 2HW3A 4YFUA 4F8RA 3AA5X 3VQQA 4B08A 1KCFA 1KFDA 4QOZB 2KFZA 1KLNA 2X6SA 3DRSA 3HSTB 4DG1A 1QSLA 3QLHA 1VRTA 1RT7A 4E1MA 3VA3A 4W5OA 4OGCA 2Z1GA 4CFDA 1C1AA 3KLFA 1ASUA 2AJQA 3AVNA 2E6LA 4I9LA 3DRRA 2JGUA 4CEAA 4CGIA 4CK3A 1SKWA 2O4IA 4CF1A 3C94A 3HPOA 2HHXA 1L5UA 2KZZA 1JLAA 3ZSQA 4FW2A 1VSKA 4NCAA 4CEZA 4AHTA 5KRTA 3NH1A 3LZJA 4FCYA 4F2SA 3V1OA 1TL3A 3SUPA 4FJNA 4AHRA 3U3YA 1J5OA 1B9DA 3PUFA 3TARA 4AHCA 3OJUA 1JLFA 3OYEA 1GOAA 3TAMA 2YNGA 4Y1DA 4B9LA 4CGFA 3VQEA 1D8YA 1N6QA 5DK5A 1Q8IA 1VSMA 4FLUA 4DQRA 1TAQA 5HRPA 4AHUA 3ZT0A 3OS2A 1VK0A 4CECA 3IRXA 3KIOA 4CIEA 3KK2A 4FLTA 1KVCA 2RPIA 1SL1A 4DQPA 1IO2A 1A5XA 3SUNA 3PY8A 3HJFA 4BDYA 3IS9A 1U4BA 4CF2A 3LPUA 4CJKA 3AVIA 4CJWA 4B8AB 3KK3A 4HUGA 3SV4A 1HJRA 4O0JA 3T19A 3L3VA 1JL2A 1VSFA 1T8EA 4DWIA 3ZCMA 5KGWA 1IKVA 3IAYA 3F9KA 1J9AA 3DLRA 2PY5A 1ZBHA 4CEQA 4H4MA 3L2QA 1U45A 3TAEA 3VQBA 3LDSA 3K5OA 5CYQA 4DTXA 1IKYA 2DFFA 1W0HA 4CHOA 3L2UA 4FJGA 1X1PA 2HMIA 4FXDA 4YNQA 1LV5A 3LWMA 3TANA 1NK8A 4G1QA 4CGJA 3TAPA 5J1EA 4CK1A 5DMRA 4DF4A 1RBTA 4M3RA 3A2FA 3P1GA 3ZSOA 1RT5A 3ZT2A 1ZBIA 3LALA 1REVA 4CF0A 4DTMA 3RMBA 3DLHA 1NJYA 3HXMA 2P1JA 3O4QA 3T1AA 4Z4GA 3V6DA 3OYNA 3HPGA 4BDZA 5CZ2A 5C25A 1JXBA 3O4NA 4CFAA 1L3UA 3ZT4A 4KB1A 2X74A 3AVFA 2LSNA 3ZSZA 3S3OA 4OKJA 4DU4A 4BACA 1C1BA 4BE1A 4FJLA 3VQ5A 3JYTA 4FJMA 3M8RA 1XHXA 2Z1IA 4Z4IA 2JLEA 3I8DA 2P5GA 4M3YA 1LWEA 1G15A 2YV0X 3MEGA 3S3NA 4PWDA 2HB5A 2O4GA 3HO1A 1RNHA 1FXXA 2IC3A 1TK5A 4I7FA 2ITGA 1L3SA 2D0BA 1NKEA 4HCCA 3PO4A 1RT3A 4H4OA 1LW2A 1NJZA 1RTDA 5KGXA 3RWUA 2HHQA 1XWLA 3E01A 2VG7A 4DF8A 1X9WA 1QSSA 3K2PA 4FJ5A 4PUOA 1VSIA 3SQ4A 3CFOA 5EU7A 3WNFA 1YTUA 1JLEA 1LWFA 3AA4A 1O1WA 4M45A 4W5QA 1S9EA 1SL0A 4CJ5A 2HHWA 1BL3A 1MU2A 4CIFA 3SYZA 3I0SA 1TK8A 1L3TA 2IOCA 2RN2A 1JLBA 4DFJA 3TAFA 1NK6A 4FJKA 4CJRA 1EX4A 1VSLA 3VQ9A 1Z26A 4CJ4A 5T7BA 3EYZA 5I42A 2IDOA 3KK1A 2A1RA 4PY5A 1RTIA 4CF9A 4CGDA 1B9FA 2ETJA 4JRQA 4HHTA 4E89A 4CFBA 3BDPA 4AILC 1T03A 3DM2A 3DOKA 5K14A 4DTUA 1VSEA 3F73A 2VWJA 3QEWA 3NF8A 3EY1A 4M3TA 3HK2A 1S1TA 2YHBA 2DY4A 1FKOA 3ISNC 1NK7A 4FZXC 3AVJA 4OJRA 4HTUA 3ZT1A 3S9HA 1SUQA 3AVGA 3OYAA 3LAMA 1XC9A 4OPKA 3DLGA 4KHWA 3ZSRA 2VG5A 1HNVA 4E1NA 3LWLA 3SUOA 3U3GA 4DSFA 3MEDA 3MXMA 2DFHA 4CHPA 2HNYA 2OPPA 3IG1A 4E7JA 2OYQA 4KRFA 1Q9YA 1WAFA 3DYAA 4IG0A 2R7YA 4DFMA 3QESA 4UQGA 4B9VA 2D0AA 3CG7A 3HL8A 3HPHA 4N41A 4FLZA 3O3FA 3OYLA 1HYVA 1JXEA 4B8CA 3ZSYA 4HVJA 3OYHA 3QNNA 4FYDA 1BIUA 4FLWA 1I39A 1XI1A 2GV9A 1R0AA 1LAVA 3L2WA 3SJJA 1QSYA 1RDCA 2F8SA 4FK4A 1HPZA 3AVHA 1C1CA 3TR8A 3I0RA 3VQPA 3RRGA 2HHSA 1WSHA 5C24A 1UA0A 2ZE2A 4O0IA 3DOLA 3QINA 3SI6A 1RILA 4B3OA 3QETA 1U49A 1QHTA 4CIGA 3NAEA 1A5WA 3K5LA 1NK9A 2BANA 3TWHA 4DTSA 3KTQA 1HRHA 4PA1A 4DSJA 1YT3A 4M3XA 2E6MA 4LSNA 4JS5A 1D5AA 4E7IA 4IKFA 3NF7A 5SWMA 4H8KA 5FROA 3HVTA 3TI0A 3LP2A 5D3GA 5HBMA 2RF2A 1C6VA 1IH7A 1SKSA 1T05A 3KLIA 2OPSA 1U48A 2KZMA 4DS4A 1EETA 3D45A 3SCXA 1WLJA 3OYFA 4E0DA 1IKXA 2A1SA 4DTPA 1TK0A 1BHLA 3PX0A 1WNSA 2ATQA 4R5PA 2PYJA 2OZMA 1LW0A 2G8IA 5JS1A 3CM6A 1A5VA 4C8KA 2G8VA 3VQDA 3OYCA 3OYKA 4ID1A 4RW4A 4E7HA 1RDAA 4Q5VA 1I3AA 3OY9A 4Z0UA 1BQMA 3KLGA 1HYZA 4CE9A 3AO3A 2KQ2A 4W5TA 1RT4A 4GW6A 3HT3A 4DQQA 4DMNA 4BE0A 1HNIA 3QNOA 3OS0A 5CY4A 1QS4A 4KKOA 3HYFA 1U47A 3OYIA 2D5RA 1BI4A 3SV3A 2W42A 4B9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWC A;  4FM0 A;  2I5J A;  5HRS A;  2G8K A;  3OYM A;  3NH0 A;  4MFB A;  4TSX A;  4CJS A;  4QAG A;  4DFP A;  4IG3 A;  4CJ3 A;  4IFV A;  2FBV A;  4AHS A;  3M8S A;  3NGI A;  3KLH A;  2PZS A;  1KRP A;  3L2R A;  4DTN A;  3OYB A;  2XO7 A;  3OYD A;  4FVM A;  5KI6 A;  1BIS A;  4JRP A;  4KHN A;  3RMD A;  4B9T A;  4Z4F A;  1JLQ A;  3ITH A;  4NYN A;  4N47 A;  4KI6 A;  3LAN A;  3S3M A;  3V4I A;  1X9S A;  1GOB A;  4N76 A;  3P83 D;  3ZSX A;  4FK2 A;  3SPY A;  3QEV A;  4I2Q A;  4CER A;  4CJV A;  2HVH A;  1GOC A;  1QTM A;  2FBX A;  2QK9 A;  4CK2 A;  3K5M A;  3K59 A;  4CHY A;  1YTA A;  4DLE A;  3RRH A;  4KHQ A;  2IS3 A;  3VQ8 A;  3AA2 A;  3SUQ A;  3FFI A;  1CXQ A;  4C8M A;  4DTJ A;  1KVA A;  1HYS A;  4ZHR A;  1T7P A;  1FK9 A;  1TAU A;  3BGR A;  4C8O A;  4OLB A;  5C42 A;  3RMA A;  3SQ2 A;  2F96 A;  3DRP A;  1S1X A;  3P5J A;  3KD5 E;  4O4G A;  2X78 A;  1L3V A;  2HVI A;  1WAJ A;  1C0T A;  1RBS A;  1VSD A;  2KW4 A;  2YNH A;  5KTQ A;  1RTJ A;  3NHG A;  4I2P A;  4DQS A;  5I3U A;  4K8Z A;  3LP0 A;  5FRM A;  4QCL A;  4FJI A;  4CJQ A;  3QIP A;  3NH2 A;  4FLY A;  4KHS A;  4KTQ A;  2D0C A;  1KVB A;  3RMC A;  1SL2 A;  3JSM A;  3V9U A;  3NDK A;  1TKX A;  1F21 A;  3G10 A;  3TAB A;  4KPY A;  1X9M A;  3DLE A;  1U04 A;  3OYG A;  1NK4 A;  4DSK A;  1FKP A;  2GUI A;  1D9F A;  1NOY A;  3CM5 A;  3L2V A;  3VQ4 A;  1YVU A;  3AVB A;  1WSI A;  1BCM A;  3V9X A;  3V1R A;  5J2P A;  3O3H A;  3OYJ A;  3V9S A;  4CJF A;  1HMV A;  1N5Y A;  1CXU A;  1C0M A;  3G0Z A;  5CYM A;  3HP6 A;  4FK0 A;  4FJJ A;  2WON A;  4IFY A;  3CFR A;  3NCI A;  1WSE A;  1K6Y A;  4OKE A;  1NJX A;  1B92 A;  1SKR A;  1WSJ A;  2NUB A;  3MEE A;  1EP4 A;  3MXJ A;  1RT2 A;  4KV8 A;  1UA1 A;  4J2B A;  2XY8 A;  2F8T A;  2FC0 A;  3KLE A;  3V9W A;  2YNF A;  4CEB A;  1TV6 A;  3KJV A;  1JL1 A;  1JLG A;  4GMJ B;  4M41 A;  4M3Z A;  1BGX T;  1ASW A;  2OPQ A;  2QKK A;  4CED A;  1ZBL A;  1QQC A;  4C8L A;  5E41 A;  4ZTJ A;  1S6P A;  1JLC A;  1TKZ A;  3QIO A;  4RW7 A;  4CCH A;  5KRS A;  1RDB A;  5SZT A;  2G8U A;  4EP4 A;  3M8Q A;  3RR8 A;  1BI4 B;  1XHZ A;  4MQ3 A;  1S6Q A;  1ITG A;  3D0P A;  4ELU A;  4FM1 A;  2Q3S A;  1J53 A;  4L8R B;  2G8F A;  4KFB A;  3VQA A;  2Z1J A;  4IDK A;  1NJW A;  2EHG A;  3DLK A;  1UOC A;  3AO1 A;  3CFP A;  1TGO A;  5J2M A;  4DTR A;  4M3U A;  3NGZ A;  1KSP A;  5HRR A;  4F3O A;  2HND A;  3B6O A;  3L3U A;  4BE2 A;  3HM9 A;  4CGH A;  1RBU A;  3ALY A;  4OKK A;  4Z4H A;  3V9Z A;  3V81 A;  1RT1 A;  2OZS A;  3SQ1 A;  3AVL A;  4FW1 A;  4FJH A;  4OLA A;  4CF8 A;  4PQU A;  4CJU A;  1ZBU A;  2QKB A;  4LD0 A;  1CZ9 A;  3NF9 A;  3MAQ A;  4HCB A;  4KHY A;  4CEE A;  4CHN A;  2HHU A;  3NBP A;  1S1V A;  1RTH A;  1ZBF A;  2YKM A;  4B9U A;  4FLX A;  4HUF A;  4F2R A;  4CGG A;  3TAG A;  3AVA A;  2FBT A;  4DSL A;  1RBV A;  4NCB A;  4AHV A;  3DI6 A;  2XHB A;  4DU1 A;  1BQN A;  3LZI A;  1TVR A;  1Z25 A;  4E19 A;  3RR7 A;  4LY7 A;  3K5N A;  1ASV A;  1KTQ A;  3VQ6 A;  1NK0 A;  3OVN A;  3AO4 A;  4B9M A;  1W9H A;  5FRN A;  1NK5 A;  2Z1H A;  3ZSW A;  2ZD1 A;  3B6P A;  2VWK A;  4FLV A;  1WSG A;  3LAK A;  4FJ7 A;  4J2A A;  3QO9 A;  1S9G A;  4JS4 A;  3K58 A;  3NFA A;  4AH9 A;  4E3S A;  4FM2 A;  4DLG A;  3SQ0 A;  3AO2 A;  4EZ6 A;  3C6U A;  4BDP A;  1TKT A;  2EX3 A;  3C95 A;  2B6A A;  4CJT A;  3ULD A;  4ELV A;  3KKS A;  4CHQ A;  1CLQ A;  2QXF A;  1RCH A;  4O44 A;  4DSE A;  4O5B A;  1UWB A;  2G8H A;  3CQ8 A;  1IKW A;  4KTZ A;  1D9D A;  3ASM A;  4KHU A;  1WSF A;  3WNG A;  4KI4 A;  5FDL A;  2G8W A;  3H08 A;  3VN5 A;  3AVC A;  3PO5 A;  4N56 A;  3NF6 A;  1BIZ A;  4Q0B A;  4BWJ A;  2HNZ A;  2P51 A;  3VQC A;  3LPT A;  4LH5 A;  3SZ2 A;  1SV5 A;  1ZYQ A;  4OPJ A;  4O55 A;  3WNE A;  3WNH A;  4FJ8 A;  3AVK A;  1Q9X A;  3MXI A;  4DS5 A;  3NGY A;  1TKD A;  4F4K A;  3PX4 A;  4CES A;  4EP5 A;  4Z4C A;  1CZB A;  4FJ9 A;  2Y1J A;  2PYL A;  3KKR A;  3MEC A;  4J2D A;  3ZT3 A;  2IGI A;  2HHV A;  2B5J A;  4M3W A;  4CEF A;  2KFN A;  4RW8 A;  5HLF A;  4CEO A;  4C8N A;  3RTV A;  3OJS A;  3VA0 A;  3PV8 A;  4KRE A;  3QEP A;  5J2N A;  4RW9 A;  4ICL A;  1RBR A;  4W5R A;  1RT6 A;  3QEX A;  5HP1 A;  2FBY A;  4BWM A;  4ZTF A;  1KFS A;  3AA3 A;  3HVR A;  4OVL A;  4N5S A;  4F3T A;  1TL1 A;  1NKB A;  4KTW A;  1BCO A;  2B4J A;  1S1U A;  3THV A;  2XY7 A;  1Y97 A;  4B9S A;  1VSJ A;  5HRO A;  2YNI A;  2P5O A;  1HQE A;  3LP1 A;  1J54 A;  3SPZ A;  1KLM A;  2DTU A;  4NYF A;  2XY6 A;  4OGE A;  4FZZ A;  1QE1 A;  3PX6 A;  1NKC A;  2XRI A;  4KAZ A;  4FJX A;  1HQU A;  4NCG A;  5J2Q A;  4Z4E A;  1WN7 A;  3T3F A;  2KTQ A;  2YHA A;  3U6F A;  4DSI A;  4HUE A;  3V1Q A;  2RKI A;  3ZSV A;  2OPR A;  3AV9 A;  2DFE A;  3AVM A;  4CJE A;  3VQ7 A;  3OS1 A;  2Y1I A;  3TAQ A;  4W5N A;  1EXQ A;  2IAJ A;  2BE2 A;  3CYM A;  4CJP A;  4Y1C A;  5JS2 A;  3UIQ A;  4FZY A;  2BGG A;  3DLB A;  3K57 A;  3L8B A;  4ID5 A;  4DFK A;  1IG9 A;  4DQI A;  1RDD A;  1JKH A;  4KB0 A;  3EZ5 A;  4KO0 A;  3DMJ A;  5CZ1 A;  4E7L A;  1DTQ A;  2X6N A;  1LAW A;  4IBN A;  2OA8 A;  1NOZ A;  1UAX A;  1DLO A;  3HP9 A;  4M42 A;  4ELT A;  4RG8 A;  4DTO A;  4WE1 A;  3QEI A;  2WOM A;  4E7K A;  4EZ9 A;  1EKE A;  3C6T A;  1S5J A;  3NE6 A;  4J2E A;  2ZQB A;  2GBZ A;  4CHZ A;  5HRN A;  3O3G A;  2BDP A;  2HHT A;  3M8P A;  2E4L A;  4CJL A;  4XIU A;  1VRU A;  3SNN A;  4JLH A;  4LH4 A;  1C0U A;  3KD1 E;  4RW6 A;  2VG6 A;  1S1W A;  3LP3 A;  4K8X A;  4LSL A;  3QER A;  1DTT A;  3AO5 A;  4GVM A;  4CFC A;  1VSH A;  4DU3 A;  2YKN A;  2XY5 A;  4I9Q A;  2HW3 A;  4YFU A;  4F8R A;  3AA5 X;  3VQQ A;  4B08 A;  1KCF A;  1KFD A;  4QOZ B;  2KFZ A;  1KLN A;  2X6S A;  3DRS A;  3HST B;  4DG1 A;  1QSL A;  3QLH A;  1VRT A;  1RT7 A;  4E1M A;  3VA3 A;  4W5O A;  4OGC A;  2Z1G A;  4CFD A;  1C1A A;  3KLF A;  1ASU A;  2AJQ A;  3AVN A;  2E6L A;  4I9L A;  3DRR A;  2JGU A;  4CEA A;  4CGI A;  4CK3 A;  1SKW A;  2O4I A;  4CF1 A;  3C94 A;  3HPO A;  2HHX A;  1L5U A;  2KZZ A;  1JLA A;  3ZSQ A;  4FW2 A;  1VSK A;  4NCA A;  4CEZ A;  4AHT A;  5KRT A;  3NH1 A;  3LZJ A;  4FCY A;  4F2S A;  3V1O A;  1TL3 A;  3SUP A;  4FJN A;  4AHR A;  3U3Y A;  1J5O A;  1B9D A;  3PUF A;  3TAR A;  4AHC A;  3OJU A;  1JLF A;  3OYE A;  1GOA A;  3TAM A;  2YNG A;  4Y1D A;  4B9L A;  4CGF A;  3VQE A;  1D8Y A;  1N6Q A;  5DK5 A;  1Q8I A;  1VSM A;  4FLU A;  4DQR A;  1TAQ A;  5HRP A;  4AHU A;  3ZT0 A;  3OS2 A;  1VK0 A;  4CEC A;  3IRX A;  3KIO A;  4CIE A;  3KK2 A;  4FLT A;  1KVC A;  2RPI A;  1SL1 A;  4DQP A;  1IO2 A;  1A5X A;  3SUN A;  3PY8 A;  3HJF A;  4BDY A;  3IS9 A;  1U4B A;  4CF2 A;  3LPU A;  4CJK A;  3AVI A;  4CJW A;  4B8A B;  3KK3 A;  4HUG A;  3SV4 A;  1HJR A;  4O0J A;  3T19 A;  3L3V A;  1JL2 A;  1VSF A;  1T8E A;  4DWI A;  3ZCM A;  5KGW A;  1IKV A;  3IAY A;  3F9K A;  1J9A A;  3DLR A;  2PY5 A;  1ZBH A;  4CEQ A;  4H4M A;  3L2Q A;  1U45 A;  3TAE A;  3VQB A;  3LDS A;  3K5O A;  5CYQ A;  4DTX A;  1IKY A;  2DFF A;  1W0H A;  4CHO A;  3L2U A;  4FJG A;  1X1P A;  2HMI A;  4FXD A;  4YNQ A;  1LV5 A;  3LWM A;  3TAN A;  1NK8 A;  4G1Q A;  4CGJ A;  3TAP A;  5J1E A;  4CK1 A;  5DMR A;  4DF4 A;  1RBT A;  4M3R A;  3A2F A;  3P1G A;  3ZSO A;  1RT5 A;  3ZT2 A;  1ZBI A;  3LAL A;  1REV A;  4CF0 A;  4DTM A;  3RMB A;  3DLH A;  1NJY A;  3HXM A;  2P1J A;  3O4Q A;  3T1A A;  4Z4G A;  3V6D A;  3OYN A;  3HPG A;  4BDZ A;  5CZ2 A;  5C25 A;  1JXB A;  3O4N A;  4CFA A;  1L3U A;  3ZT4 A;  4KB1 A;  2X74 A;  3AVF A;  2LSN A;  3ZSZ A;  3S3O A;  4OKJ A;  4DU4 A;  4BAC A;  1C1B A;  4BE1 A;  4FJL A;  3VQ5 A;  3JYT A;  4FJM A;  3M8R A;  1XHX A;  2Z1I A;  4Z4I A;  2JLE A;  3I8D A;  2P5G A;  4M3Y A;  1LWE A;  1G15 A;  2YV0 X;  3MEG A;  3S3N A;  4PWD A;  2HB5 A;  2O4G A;  3HO1 A;  1RNH A;  1FXX A;  2IC3 A;  1TK5 A;  4I7F A;  2ITG A;  1L3S A;  2D0B A;  1NKE A;  4HCC A;  3PO4 A;  1RT3 A;  4H4O A;  1LW2 A;  1NJZ A;  1RTD A;  5KGX A;  3RWU A;  2HHQ A;  1XWL A;  3E01 A;  2VG7 A;  4DF8 A;  1X9W A;  1QSS A;  3K2P A;  4FJ5 A;  4PUO A;  1VSI A;  3SQ4 A;  3CFO A;  5EU7 A;  3WNF A;  1YTU A;  1JLE A;  1LWF A;  3AA4 A;  1O1W A;  4M45 A;  4W5Q A;  1S9E A;  1SL0 A;  4CJ5 A;  2HHW A;  1BL3 A;  1MU2 A;  4CIF A;  3SYZ A;  3I0S A;  1TK8 A;  1L3T A;  2IOC A;  2RN2 A;  1JLB A;  4DFJ A;  3TAF A;  1NK6 A;  4FJK A;  4CJR A;  1EX4 A;  1VSL A;  3VQ9 A;  1Z26 A;  4CJ4 A;  5T7B A;  3EYZ A;  5I42 A;  2IDO A;  3KK1 A;  2A1R A;  4PY5 A;  1RTI A;  4CF9 A;  4CGD A;  1B9F A;  2ETJ A;  4JRQ A;  4HHT A;  4E89 A;  4CFB A;  3BDP A;  4AIL C;  1T03 A;  3DM2 A;  3DOK A;  5K14 A;  4DTU A;  1VSE A;  3F73 A;  2VWJ A;  3QEW A;  3NF8 A;  3EY1 A;  4M3T A;  3HK2 A;  1S1T A;  2YHB A;  2DY4 A;  1FKO A;  3ISN C;  1NK7 A;  4FZX C;  3AVJ A;  4OJR A;  4HTU A;  3ZT1 A;  3S9H A;  1SUQ A;  3AVG A;  3OYA A;  3LAM A;  1XC9 A;  4OPK A;  3DLG A;  4KHW A;  3ZSR A;  2VG5 A;  1HNV A;  4E1N A;  3LWL A;  3SUO A;  3U3G A;  4DSF A;  3MED A;  3MXM A;  2DFH A;  4CHP A;  2HNY A;  2OPP A;  3IG1 A;  4E7J A;  2OYQ A;  4KRF A;  1Q9Y A;  1WAF A;  3DYA A;  4IG0 A;  2R7Y A;  4DFM A;  3QES A;  4UQG A;  4B9V A;  2D0A A;  3CG7 A;  3HL8 A;  3HPH A;  4N41 A;  4FLZ A;  3O3F A;  3OYL A;  1HYV A;  1JXE A;  4B8C A;  3ZSY A;  4HVJ A;  3OYH A;  3QNN A;  4FYD A;  1BIU A;  4FLW A;  1I39 A;  1XI1 A;  2GV9 A;  1R0A A;  1LAV A;  3L2W A;  3SJJ A;  1QSY A;  1RDC A;  2F8S A;  4FK4 A;  1HPZ A;  3AVH A;  1C1C A;  3TR8 A;  3I0R A;  3VQP A;  3RRG A;  2HHS A;  1WSH A;  5C24 A;  1UA0 A;  2ZE2 A;  4O0I A;  3DOL A;  3QIN A;  3SI6 A;  1RIL A;  4B3O A;  3QET A;  1U49 A;  1QHT A;  4CIG A;  3NAE A;  1A5W A;  3K5L A;  1NK9 A;  2BAN A;  3TWH A;  4DTS A;  3KTQ A;  1HRH A;  4PA1 A;  4DSJ A;  1YT3 A;  4M3X A;  2E6M A;  4LSN A;  4JS5 A;  1D5A A;  4E7I A;  4IKF A;  3NF7 A;  5SWM A;  4H8K A;  5FRO A;  3HVT A;  3TI0 A;  3LP2 A;  5D3G A;  5HBM A;  2RF2 A;  1C6V A;  1IH7 A;  1SKS A;  1T05 A;  3KLI A;  2OPS A;  1U48 A;  2KZM A;  4DS4 A;  1EET A;  3D45 A;  3SCX A;  1WLJ A;  3OYF A;  4E0D A;  1IKX A;  2A1S A;  4DTP A;  1TK0 A;  1BHL A;  3PX0 A;  1WNS A;  2ATQ A;  4R5P A;  2PYJ A;  2OZM A;  1LW0 A;  2G8I A;  5JS1 A;  3CM6 A;  1A5V A;  4C8K A;  2G8V A;  3VQD A;  3OYC A;  3OYK A;  4ID1 A;  4RW4 A;  4E7H A;  1RDA A;  4Q5V A;  1I3A A;  3OY9 A;  4Z0U A;  1BQM A;  3KLG A;  1HYZ A;  4CE9 A;  3AO3 A;  2KQ2 A;  4W5T A;  1RT4 A;  4GW6 A;  3HT3 A;  4DQQ A;  4DMN A;  4BE0 A;  1HNI A;  3QNO A;  3OS0 A;  5CY4 A;  1QS4 A;  4KKO A;  3HYF A;  1U47 A;  3OYI A;  2D5R A;  1BI4 A;  3SV3 A;  2W42 A;  4B9N A; 
#chains in the Genus database with same CATH topology
 4FM0 A;  1WBD A;  4M63 C;  3VPZ A;  3OYM A;  4MFB A;  4CJS A;  4DR5 K;  4DFP A;  4IG3 A;  4CJ3 A;  4IFV A;  3CCQ N;  4AHS A;  4DV2 K;  3A0I X;  3KLH A;  3L2R A;  2F9T A;  2XO7 A;  3G71 N;  4X65 K;  3OYD A;  3GL1 A;  4BRD A;  5KI6 A;  4JRP A;  2NLX A;  4B9T A;  1JLQ A;  4KI6 A;  3O5B A;  1GLJ O;  2A5X A;  2V52 B;  4O5F A;  1X9S A;  2CGJ A;  2CGL A;  4JAX A;  4I2Q A;  3HI0 A;  4CJV A;  1QTM A;  4CHY A;  1YTA A;  4DLE A;  3D6R A;  3VEO A;  3FFI A;  1CXQ A;  4C8M A;  4DTJ A;  1HYS A;  1FK9 A;  2NRW A;  3LDN A;  1TAU A;  5LMU K;  4JI6 K;  4OLB A;  1NNE A;  3ZET B;  5H1S Q;  1S1X A;  4CZF A;  3E9O A;  2X78 A;  1C0G A;  2F7T A;  1X3M A;  1VSD A;  2KW4 A;  2QWL A;  4JN4 A;  4CJQ A;  5DM7 L;  4FLY A;  4CZG A;  2Q0R A;  4KHS A;  2D0C A;  4M7Y A;  3QBW A;  3V9U A;  1F21 A;  4KPY A;  2UUC K;  3TTF A;  3THW B;  2A41 A;  3CM5 A;  2YHW A;  3L2V A;  3WQT A;  1WSI A;  1BCM A;  1DGK N;  1GLA G;  3OYJ A;  1N5Y A;  5JMV A;  1HLU A;  4FK0 A;  3CCS N;  3NCI A;  1NJX A;  1SKR A;  3VEZ A;  1WSJ A;  3MEE A;  1UA1 A;  2F8T A;  2FC0 A;  3KJV A;  1JL1 A;  1JLG A;  4M41 A;  2QWP A;  4BR5 A;  4YDU C;  4WQ4 A;  1Q82 O;  4CCH A;  1RDB A;  4AM7 A;  4DV3 K;  2P9L A;  2IIR A;  3VQA A;  1NJW A;  4DV0 K;  2O8C B;  4DTR A;  1KSP A;  5HRR A;  5BPL A;  2UXD K;  3V81 A;  1RT1 A;  2OZS A;  4J8F A;  4GY2 B;  4PQU A;  4CJU A;  1E4G T;  3MAQ A;  4HCB A;  3D2F B;  4OO1 J;  1RTH A;  4B9U A;  2D4W A;  4F2R A;  4CBU A;  4DSL A;  1RBV A;  4DU1 A;  3THY A;  3K5N A;  4PKH A;  1ASV A;  1KTQ A;  5FRN A;  3MCP A;  5GIP A;  4DV1 K;  4ISF A;  2Z1H A;  1NK5 A;  2HMP A;  3ZX0 A;  5LMN K;  4FJ7 A;  3LM9 A;  4EAH D;  1EQY A;  4E3S A;  2A6A A;  3T7Z A;  3AO2 A;  4BDP A;  2EX3 A;  4JKC A;  4JK9 A;  4FWP A;  4CHQ A;  1IV0 A;  1CLQ A;  4GKK K;  3WXJ A;  1IKW A;  4KTZ A;  1D9D A;  1YJN N;  1VHX A;  4KHU A;  3PIP L;  1W2B M;  3ENB A;  2G8W A;  3VN5 A;  3PSF A;  3NF6 A;  5AQT A;  3VQC A;  2HNZ A;  2P51 A;  3LPT A;  3SZ2 A;  4A5B A;  2FSK A;  4QS9 A;  3CPE A;  3WNH A;  4DS5 A;  3ZX3 A;  1TKD A;  4GNI A;  1JCG A;  1CZB A;  3JS6 A;  1BU6 O;  1GLE G;  3WEE B;  3EZW A;  4M3W A;  4CEO A;  4JNE A;  4C8N A;  3OJS A;  3VA0 A;  4DHY A;  3AAP A;  3UKU B;  1RBR A;  2P9P A;  5AZJ B;  1N34 K;  5GIO A;  5C0Y A;  4KTW A;  1BCO A;  4IXC A;  3VET A;  4B9S A;  1VSJ A;  1HQE A;  3LP1 A;  4JKB A;  4NYF A;  4OGE A;  3PX6 A;  1NKC A;  2P9S A;  5BR9 A;  3TSQ A;  2XRI A;  4NCG A;  3NVM A;  1WN7 A;  4IO8 A;  3V1Q A;  2RKI A;  4ILH A;  3OS1 A;  4W5N A;  1X9J A;  1Q81 O;  1EXQ A;  3CYM A;  2BE2 A;  2BGG A;  3DLB A;  3L8B A;  3BP8 A;  1RDD A;  4E7L A;  1DTQ A;  3O9R A;  4IBN A;  3I8B A;  1UAX A;  4LFC K;  4ELT A;  2WOM A;  3CQX A;  4B3T K;  4BVO A;  5EX5 A;  5HRN A;  3O3G A;  2BDP A;  2HHT A;  4BC5 A;  4U7B A;  3VER A;  4K8X A;  4LSL A;  1DTT A;  4DU3 A;  1OKJ A;  3AA5 X;  3VQQ A;  3WUH A;  2W6L A;  3OW2 M;  1KLN A;  3UB5 A;  3HST B;  3DRS A;  3EE9 A;  4FOE A;  1SAZ A;  4CI6 A;  3RSE B;  2Z1G A;  4CZL A;  3AVN A;  2AJQ A;  4A5A A;  3DRR A;  2V7Y A;  4CF1 A;  1L5U A;  2KZZ A;  3ZSQ A;  2P9I A;  3MN5 A;  1BA1 A;  4FWO A;  5KRT A;  3LZJ A;  3MWP A;  3PIO L;  1J5O A;  1B9D A;  3KK7 A;  1NGD A;  3KWG A;  1XMO K;  2P9K B;  2ZJP L;  3VQE A;  1YVN A;  4AHU A;  3ZT0 A;  4CEC A;  4CIE A;  1BA0 A;  1IBL K;  1KVC A;  4QS7 A;  3SUN A;  3TU5 A;  4C1N I;  2Q36 A;  4CF2 A;  4CJW A;  3GDQ A;  4B8A B;  1T8E A;  2GWJ A;  4JKE A;  4DWI A;  1J9A A;  2GEL A;  2PY5 A;  4CEQ A;  1ATS A;  3K5O A;  5CYQ A;  4A2B A;  3L2U A;  2ASP A;  4G1Q A;  3VEX A;  5J1E A;  4DF4 A;  3PSI A;  4M3R A;  1ZBI A;  1REV A;  3DLH A;  1NJY A;  2P1J A;  3T1A A;  3V6D A;  3CME N;  3JAM O;  2Q31 A;  5CZ2 A;  4BDZ A;  3O4N A;  4Y0W A;  4KB1 A;  3ZSZ A;  3O4W A;  1HKC A;  3VMF B;  2JLE A;  3FFK B;  4BVP A;  3HO1 A;  4B1U B;  3CJ7 A;  1TK5 A;  2P9N A;  4I7F A;  1RDW X;  3CQY A;  1NKE A;  4H4O A;  1LW2 A;  1NJZ A;  1RTD A;  3E01 A;  4DF8 A;  3FZL A;  1TYQ A;  3C65 A;  4PUO A;  4M45 A;  4W5Q A;  1S9E A;  3QIC A;  1TK8 A;  4CIF A;  2QWN A;  5T7B A;  4K42 A;  3EYZ A;  2UXC K;  4YOR A;  2IDO A;  2E5L K;  3CXC M;  4CF9 A;  4PHT X;  1NG9 A;  1E3M A;  5K14 A;  1NLV A;  4DTU A;  5F0X A;  3F73 A;  4M3T A;  3CI5 A;  4JHD B;  4BRG A;  2WFB A;  3AVJ A;  3MN6 A;  4GV6 A;  3HSC A;  3WQU A;  1U6Z A;  4E1N A;  3E1Y A;  3WT0 A;  2DFH A;  2QXL A;  3WXL A;  4CHP A;  3WXK A;  1WAF A;  4UQG A;  1Q86 O;  3E9P A;  4HVJ A;  3QNN A;  3OYH A;  4LC9 B;  2HBJ A;  1GLD G;  1XI1 A;  5MLC Q;  1R0A A;  1NGH A;  5C2D A;  3I33 A;  3ZEU A;  2CGK A;  3HM8 A;  4CJ7 A;  5C24 A;  4O0I A;  1RIL A;  1U49 A;  2ZM6 K;  4DSJ A;  3CC2 N;  5SWM A;  4H8K A;  3TSU A;  5FRO A;  5GIN A;  5D3G A;  3TSP A;  1T05 A;  3KLI A;  2OPS A;  3J8A A;  1WLJ A;  4EFH A;  3E66 A;  4R5P A;  2PYJ A;  1A5V A;  4C8K A;  1NGI A;  1KXP A;  3CJC A;  2O8B A;  3OYK A;  4RW4 A;  2Q1N A;  4DR7 K;  5AQM A;  5C10 A;  4WFN L;  2KQ2 A;  4BRF A;  1RT4 A;  4GW6 A;  4W5T A;  1D4X A;  1ESV A;  4LF7 K;  1HNI A;  3OS0 A;  1JJ2 M;  2E8A A;  1QS4 A;  4DV6 K;  1GLC G;  4KKO A;  5AQP A;  3QEI A;  2W42 A;  2PFU A;  2UXB K;  2I5J A;  3DJC A;  3P38 A;  3VEW A;  4R79 A;  4TSX A;  4QAG A;  1VQP N;  2PZS A;  3NGI A;  1VQL N;  4N76 A;  3T1H K;  3P83 D;  2H3G X;  2VQE K;  4FK2 A;  3SPY A;  4QS8 A;  4CER A;  2HVH A;  2QK9 A;  4CZK A;  4CK2 A;  2P9U B;  1Z6R A;  3K59 A;  2VWB A;  3RRH A;  4KHQ A;  2V7Z A;  1ZC6 A;  3MN7 A;  3VQ8 A;  5AQW A;  4ZHR A;  1HPM A;  3F5T A;  3GG4 A;  4C8O A;  3RMA A;  2F96 A;  3SK3 A;  3KD5 E;  4OPH A;  1ATR A;  1LCU A;  1WAJ A;  2YNH A;  3AAR A;  4NO7 A;  1NGJ A;  1KAZ A;  4K8Z A;  1RTJ A;  4I2P A;  3J7A P;  2E88 A;  4HWI A;  5BN8 A;  3RMC A;  4IJN A;  4OX9 K;  3VTH A;  3A5L C;  2P9L B;  3TAB A;  2KLA A;  1OH7 A;  3OYG A;  3OA9 A;  2FF3 B;  3FR0 A;  3SAG A;  1NOY A;  1YVU A;  4F9O A;  1BOT O;  1C0M A;  5CYM A;  2WON A;  3CFR A;  3OBY A;  2UUB K;  5KPT A;  3M1F A;  2IVO A;  4OKE A;  2NUB A;  4KV8 A;  2XY8 A;  3KLE A;  1N32 K;  2YNF A;  4CEB A;  2O8D A;  4BR0 A;  4GMJ B;  3ULE B;  3C6A A;  1ASW A;  3THY B;  4C8L A;  1KAX A;  1S6P A;  2QW9 A;  4RW7 A;  5M1N A;  2QA4 N;  2G8U A;  1HX1 A;  5BR8 K;  5AFU A;  1XHZ A;  4MQ3 A;  4ELU A;  4FM1 A;  2Q3S A;  4IDK A;  3MWT A;  1UOC A;  3AO1 A;  1TGO A;  5J2M A;  3NGZ A;  4C23 A;  3B6O A;  3L3U A;  4BE2 A;  4DR3 K;  5CE3 A;  4OKK A;  2I7N A;  1ZBU A;  2NNW A;  3NF9 A;  4O8U A;  4CHN A;  3NBP A;  1XMQ K;  1ZBF A;  3FGU A;  4FLX A;  4HUF A;  3AVA A;  2FBT A;  4NCB A;  1TVR A;  4E19 A;  4LY7 A;  4X66 K;  3VQ6 A;  4K0K K;  4B9M A;  3ZSW A;  3B6P A;  4LFA K;  4FLV A;  3CJB A;  3LAK A;  3QO9 A;  3QML A;  4YHH K;  4AH9 A;  3EE8 A;  4FM2 A;  3CC7 N;  3SQ0 A;  4EZ6 A;  5AQK A;  1TKT A;  3C95 A;  4CJT A;  5JLF A;  1WOQ A;  2QWR A;  4H0O A;  4DSE A;  3CPW M;  3CQ8 A;  4BY9 C;  3ZLJ A;  1K8A O;  5FDL A;  3IDH A;  3VEN A;  3AVC A;  3PO5 A;  2WTU A;  3CJA A;  1RDU A;  4FL9 A;  1ZYQ A;  3Q7B A;  3AVK A;  2GUP A;  3NGY A;  4BRL A;  1Y64 A;  2PYL A;  3KKR A;  3MEC A;  4WYB A;  1C0F A;  3ZT3 A;  4J2D A;  2KFN A;  5HLF A;  4WQ4 C;  5JVH L;  3QEP A;  5J2N A;  1W7A A;  4RW9 A;  2VYP A;  3O80 A;  1RT6 A;  3IMX A;  3QEX A;  4LF9 K;  4BWM A;  4KH4 A;  5LY3 A;  2QI2 A;  3AA3 A;  5KQD A;  3HVR A;  4OVL A;  3LDL A;  2HF4 A;  3C7N B;  4IWV A;  4F3T A;  1NKB A;  3THV A;  1Y97 A;  5HRO A;  1N33 K;  2P5O A;  5KQ8 A;  1WB9 A;  2XY6 A;  1H1V A;  4FZZ A;  1QE1 A;  1HQU A;  4L3Q A;  3R8E A;  3U6F A;  1BG3 A;  4DSI A;  3TAQ A;  5BRD A;  4Y1C A;  3BUZ B;  4FZY A;  4DUY K;  3K57 A;  2P9I B;  4ID5 A;  1K8K B;  4DQI A;  1YAG A;  1NOZ A;  1DLO A;  4BC3 A;  4M42 A;  1TUU A;  4DTO A;  4EZ9 A;  2CH6 A;  2ZQB A;  2E20 A;  3M8P A;  3H3O B;  4JI4 K;  4XIU A;  2W6K A;  3DAW A;  3LP3 A;  2HW3 A;  1VSH A;  4V19 S;  4NXM K;  1XNQ K;  5AQG A;  1QQO A;  4B08 A;  1KCF A;  1QSL A;  2E2O A;  4JKG A;  4BR2 A;  3QLH A;  2HBK A;  1RT7 A;  2QTD A;  1ASU A;  3O1B A;  2O4I A;  4FW2 A;  1VSK A;  2WC9 A;  4FCY A;  5M1O A;  3V1O A;  1S22 A;  1TL3 A;  3SUP A;  5EXW A;  3OJU A;  1GOA A;  4Y1D A;  1W97 L;  1N6Q A;  4WFA L;  3M6G A;  5DK5 A;  1Q8I A;  3SJH A;  2CH5 A;  5KPR A;  3OS2 A;  2NZT A;  3KIO A;  3KK2 A;  1SL1 A;  2WBN A;  3PY8 A;  1HKG A;  4BDY A;  2Q97 A;  3SBT A;  4CJK A;  5AQL A;  4AF1 A;  4HUG A;  2P9N B;  4O0J A;  1VSF A;  1NJI O;  3IAY A;  1ZBH A;  4H0T B;  4H4M A;  1NGG A;  1IKY A;  1W0H A;  2QWO A;  4CHO A;  3K0S A;  1X1P A;  2HMI A;  4FXD A;  2YI1 A;  5E84 A;  3LWM A;  1HKB A;  2KKZ A;  4CGJ A;  3QDK A;  5F1X A;  1RBT A;  1NGE A;  2E2N A;  3P1G A;  1RT5 A;  4CF0 A;  3RMB A;  4JYA K;  3HXM A;  4H0V B;  3GOI A;  2F4V K;  5C25 A;  1KQS M;  3P4I A;  2X74 A;  4B1X B;  4BAC A;  4BE1 A;  4FJL A;  3VQ5 A;  3JYT A;  1KD1 O;  4FJM A;  4ILJ A;  1SQK A;  4NB4 A;  2YV0 X;  3MEG A;  2HB5 A;  4JI2 K;  3EKU A;  5AQU A;  1L3S A;  2D0B A;  4DR6 K;  3PO4 A;  2FF6 A;  2YHY A;  4Z94 A;  5JLH A;  1P90 A;  3K2P A;  1GLF O;  2JWK A;  4JI0 K;  1VSI A;  3UKR A;  3SQ4 A;  1JLE A;  1O1W A;  4BG8 A;  5BPN A;  4CJ5 A;  4DV7 K;  1MU2 A;  1RFQ A;  1DKG D;  2QWQ A;  3SYZ A;  1ZBS A;  3OBW A;  1L3T A;  2HBM A;  5AQN A;  2ZF5 O;  3ZEU B;  1VSL A;  3VQ9 A;  1GLL O;  2NRT A;  2A1R A;  1RTI A;  2O8E B;  4CFB A;  1N8R O;  4DV4 K;  3CJ9 A;  3BZK A;  1HNX K;  1S1T A;  5BRE A;  2YHB A;  1FKO A;  1NK7 A;  3A5M C;  4H5V A;  5LJW A;  4H0X B;  3OYA A;  4OPK A;  3DLG A;  3QBX A;  4KHW A;  2VG5 A;  2WUS A;  4IJA A;  3U3G A;  3MED A;  4GV3 A;  2OCE A;  4E7J A;  3L6Q A;  2QEX N;  2O8B B;  2D0A A;  3HL8 A;  3HPH A;  1OVQ A;  2QM1 A;  3DXK B;  3ZSY A;  4YOY A;  3G4S N;  1I39 A;  4RCH A;  1QZ6 A;  2FLO A;  2GV9 A;  1VQ5 N;  1RDC A;  2F8S A;  5ADX A;  3VQP A;  3I0R A;  4YY3 K;  4BGA A;  4BRN A;  2ZE2 A;  3QIN A;  5GAG P;  3SI6 A;  1IJJ A;  3QET A;  1QHT A;  4BRO A;  3K5L A;  3IUC A;  3OTO K;  4M3X A;  2D0P A;  4JS5 A;  1D5A A;  4IKF A;  3THW A;  2QWM A;  4O8K A;  3TI0 A;  5AZI A;  3LP2 A;  5FPM A;  5HBM A;  3VEV A;  1C6V A;  1SKS A;  4JI8 K;  3AGK A;  1VQN N;  5CHI A;  5BRF A;  1IKX A;  2A1S A;  3C6H A;  1YHQ N;  1TK0 A;  4KHP K;  3PX0 A;  1WNS A;  2ATQ A;  5GAE P;  3CM6 A;  4M7X A;  2I7P A;  3FZK A;  4Q5V A;  3TPQ A;  1G99 A;  3AO3 A;  4BRC A;  4BE0 A;  2AP1 A;  3HYF A;  2O8F B;  1DT9 A;  1U47 A;  3OYI A;  4A57 A;  4CJ4 A;  2XY5 A;  1LWC A;  3VTI A;  4YOW A;  1MWM A;  2G8K A;  1VQO N;  2O8C A;  3M8S A;  2ZGY A;  3ID6 A;  4DTN A;  3OYB A;  3FZF A;  4FVM A;  2HST A;  3W0L A;  5C15 A;  1BIS A;  4KHN A;  4Z4F A;  3RMD A;  2UU9 K;  1V4S A;  1J6Z A;  3V4I A;  2ASO A;  2VQF K;  3QEV A;  1GOC A;  2FBX A;  5TKW A;  1KVA A;  1VQM N;  3O9T A;  3J7Z O;  3CCE N;  3DXM B;  1EWQ A;  4BRQ A;  3SQ2 A;  4EIA A;  4O4G A;  2O8D B;  1L3V A;  1C0T A;  2HHU A;  3O1W A;  5I3U A;  5FRM A;  5KTQ A;  1YJW N;  3LP0 A;  4EHT A;  4BRI A;  3CER A;  3H46 O;  3JSM A;  3OHR A;  3NMU A;  3NDK A;  1TKX A;  2Q2R A;  1QQN A;  1X9M A;  1U04 A;  1NK4 A;  1SZ2 A;  3CET A;  4B3S K;  3MX2 A;  1WUA A;  2E1Y A;  3VQ4 A;  3S41 A;  3AVB A;  1T3V A;  3FZM A;  1JCF A;  5FLX O;  2GWK A;  5LJV A;  1HMV A;  2OTJ N;  4FJJ A;  4IFY A;  5A2Q O;  1EO1 A;  3D2E A;  1WSE A;  1K6Y A;  1OH8 A;  4FWQ A;  2RHK A;  4J2B A;  1FJG K;  3V9W A;  1TV6 A;  3G6E N;  4AQY K;  3O8M A;  4M3Z A;  1VQ4 N;  3PLA A;  1BUP A;  4BRP A;  5AZJ A;  3G25 A;  4ZTJ A;  3QIO A;  5KRS A;  4JD2 B;  2W41 A;  3M8Q A;  1HR0 K;  5JIC A;  1BI4 B;  3LM2 A;  3D0P A;  1S6Q A;  4L8R B;  2NRZ A;  2Z1J A;  2YJE A;  1JCE A;  2EHG A;  2F9W A;  3CFP A;  4PKI A;  3CCV N;  4M3U A;  3LL3 A;  4IFE A;  1U2V A;  3HM9 A;  1RBU A;  3V9Z A;  4Z4H A;  3SQ1 A;  3AVL A;  2NRH A;  3EL2 A;  4LD0 A;  1CZ9 A;  4CEE A;  2NRR A;  4FWK A;  2YKM A;  4CGG A;  3TAG A;  4WQ5 A;  4AHV A;  2XHB A;  1BQN A;  1Z25 A;  3RR7 A;  4XH1 A;  1NK0 A;  3L0Q A;  3OVN A;  1W9H A;  4DCH A;  2VWK A;  5FPN A;  1ATN A;  1Z05 A;  5LL6 Z;  4J2A A;  4A59 A;  4BC2 A;  5ELZ A;  3FLC O;  4DLG A;  3CC4 N;  3SAH A;  3KWI A;  4YOV A;  3ULD A;  3FZH A;  3KKS A;  1NWK A;  4ILG B;  4O44 A;  4O5B A;  2G8H A;  3U8X A;  3ASM A;  1WSF A;  5BRH A;  4KI4 A;  4LF4 K;  4NLB A;  3I56 N;  3A5O C;  1WBB A;  4Q0B A;  4BWJ A;  4LH5 A;  4NXN K;  1SV5 A;  3F9M A;  4OPJ A;  1Q9X A;  3BZC A;  4F4K A;  4H5R A;  3VGL A;  4IO9 L;  4CES A;  4Z4C A;  4FJ9 A;  4A2A A;  3O9S A;  2IGI A;  2B5J A;  4KRE A;  3KZB A;  3PV8 A;  1KAY A;  1XUP O;  4K41 A;  4WF9 L;  4ICL A;  5HP1 A;  2FBY A;  2ZWH A;  3CCU N;  4ZTF A;  4N5S A;  1YF5 L;  5AQH A;  4I6M A;  3FE1 A;  3NVK A;  1TL1 A;  3VGK A;  1J54 A;  2GEM A;  3SPZ A;  2DTU A;  1OH5 A;  4FJX A;  4JKG B;  2OTL N;  2KTQ A;  2NRX A;  2YHA A;  5M1Q A;  3ZSV A;  2OPR A;  3AV9 A;  2DFE A;  3AVM A;  4MDB A;  2Y1I A;  4IEI A;  3H1V X;  5JS2 A;  3UIQ A;  5AJ3 K;  1VAZ A;  1YIT N;  3QB0 A;  4DFK A;  1IG9 A;  4GV9 A;  4KB0 A;  4KO0 A;  5CZ1 A;  3THX A;  3VF2 A;  2X6N A;  4JKH A;  5EOY A;  4FPA A;  3HP9 A;  4HTL A;  3HBT A;  5AQX A;  4WE1 A;  4JI3 K;  5AQZ A;  3A8Y A;  3U4L A;  1EKE A;  4E7K A;  4J2E A;  1S5J A;  1K73 O;  5DM6 L;  4CHZ A;  2W40 A;  1HUX A;  2E4L A;  2GX9 A;  1NU0 A;  1VRU A;  3SNN A;  4JLH A;  4LH4 A;  1C0U A;  4RW6 A;  3MK6 A;  3QER A;  4GVM A;  4I9Q A;  2YKN A;  4F8R A;  1KFD A;  2X6S A;  4DG1 A;  5AQQ A;  4FO0 A;  4W5O A;  3R9P A;  4CFD A;  4E1J A;  1YJ9 N;  4I9L A;  4MDA A;  4CEA A;  2JGU A;  4CGI A;  4CK3 A;  3HPO A;  4JKF A;  1E4F T;  4CEZ A;  1VQK N;  3NH1 A;  1BWF O;  4AHR A;  3BEX A;  3U3Y A;  4AHC A;  4JHD A;  1BO5 O;  3MMV A;  2YNG A;  4B9L A;  1NMN A;  4KBO A;  1D8Y A;  5M1P A;  2YJF A;  4FLU A;  4BG9 A;  2DPN A;  1TAQ A;  4H5W A;  1I94 K;  3R6M A;  4FLT A;  4DQP A;  1IO2 A;  1A5X A;  2J4R A;  2P9P B;  3HJF A;  3IFR A;  3IS9 A;  4FWS A;  1OVY A;  1U4B A;  3AVI A;  3KK3 A;  1HJR A;  4H0Y B;  1JL2 A;  3WXM B;  5KGW A;  1IKV A;  3DLR A;  3L2Q A;  1U45 A;  3TAE A;  3VQB A;  4EHU A;  4DTX A;  2DFF A;  2P9S B;  5BN9 A;  1LV5 A;  3TAN A;  3TAP A;  4GVE A;  5DMR A;  4DTM A;  1YXQ A;  4JV5 K;  4Z4G A;  4CZE A;  1JXB A;  4CFA A;  1NMD A;  3AVF A;  2LSN A;  4CD1 A;  3BF1 A;  4OKJ A;  4DU4 A;  4YOX A;  1C1B A;  4X64 K;  5AFU H;  1NGA A;  3BF3 A;  4JI5 K;  3I8D A;  1J5E K;  2P5G A;  1LWE A;  3S3N A;  2O4G A;  2HBL A;  2A40 A;  1RNH A;  1FXX A;  2IC3 A;  3KHY A;  2ITG A;  3AY9 A;  4DR4 K;  4HCC A;  3RVC A;  1TUY A;  5KGX A;  3RWU A;  4CZI A;  5KPZ A;  2HHQ A;  2YCH A;  2VG7 A;  1QSS A;  2NRV A;  4WFB L;  5AQY A;  4FJ5 A;  3WNF A;  5HL7 L;  3LDO A;  1LWF A;  3AA4 A;  1SL0 A;  5I9E B;  1BL3 A;  3I0S A;  3J81 O;  2D0O A;  2IOC A;  2RN2 A;  1JLB A;  4DFJ A;  4FJK A;  4CJR A;  1EX4 A;  1QQM A;  3F2K A;  1Z26 A;  5I42 A;  4PY5 A;  2E2P A;  4PKG A;  4CGD A;  3CCM N;  1B9F A;  4JRQ A;  3BDP A;  3AGR A;  4AIL C;  3CCJ N;  1T03 A;  3DOK A;  3CHW A;  2VWJ A;  3EY1 A;  3VF6 A;  3VF4 A;  4DQ8 A;  5AZI B;  4OJR A;  4B3R K;  4ISE A;  4MO4 A;  3AVG A;  1XC9 A;  2P9U A;  2HOE A;  1HNV A;  3LWL A;  3SUO A;  3HZ6 A;  1XC3 A;  4DSF A;  2HNY A;  1O13 A;  1Q9Y A;  5BPM A;  3DYA A;  4DFM A;  4B9V A;  3UE5 A;  3IKM A;  5GAH P;  4BC4 A;  3O3F A;  1JXE A;  4FYD A;  1BIU A;  4XH4 A;  4FLW A;  1NM1 A;  1LAV A;  3SJJ A;  2VGN A;  1HPZ A;  1C1C A;  5TKY A;  1WSH A;  1UA0 A;  3DOL A;  3K9K A;  1VQ6 N;  3N4P A;  4CIG A;  3NAE A;  3TWH A;  3ID8 A;  4B1Y B;  4CZJ A;  4B3M K;  3NF7 A;  4IEE A;  5F2R A;  5HOO A;  3CIP A;  2RF2 A;  1IH7 A;  2KZM A;  4DS4 A;  1EET A;  3D45 A;  3SCX A;  4E0D A;  1HNW K;  3B8A X;  1BHL A;  1NGF A;  3KVG A;  1LW0 A;  2G8V A;  1YI2 N;  4ID1 A;  1RDA A;  3OY9 A;  2UUA K;  3N4Q A;  1BQM A;  3ULE A;  4CE9 A;  4XH5 A;  3HT3 A;  4K43 A;  4FOI A;  3QNO A;  1TYQ B;  5CY4 A;  3Q7C A;  1EWR A;  3O6W A;  4YDU A;  5EY4 A;  5GAD P;  5HRS A;  1LOT B;  4CD3 A;  3NH0 A;  4DB3 A;  2FBV A;  1KRP A;  1Q18 A;  3A5N C;  3ITH A;  4NYN A;  4N47 A;  3LAN A;  3S3M A;  1GOB A;  3ZSX A;  2A3Z A;  3H1Q A;  1R59 O;  3K5M A;  2IS3 A;  3DWL A;  3AA2 A;  3SUQ A;  5EVZ A;  1T7P A;  2BTF A;  3D2E B;  3BGR A;  3VES A;  5C42 A;  3DRP A;  3P5J A;  4IDH A;  2HVI A;  1RBS A;  3NHG A;  4OPA A;  4DQS A;  4QCL A;  4CZM A;  2GTD A;  4BRE A;  4DV5 K;  4FJI A;  3QIP A;  3NH2 A;  4CBW A;  4KTQ A;  1KVB A;  1SL2 A;  4H03 B;  1T6C A;  3G10 A;  3DLE A;  4CVN E;  4DSK A;  1FKP A;  2GUI A;  1ILY A;  1D9F A;  1S3X A;  4XEI A;  3SBG A;  1U2V B;  3V9X A;  3H6E A;  2HF3 A;  3SMP A;  3V1R A;  3J7Y P;  3O3H A;  3CMA N;  5J2P A;  3V9S A;  3MDQ A;  4CJF A;  4YOT A;  1CXU A;  1T6D A;  3G0Z A;  3HP6 A;  3U9D A;  1IG8 A;  4LFB K;  1P8Z A;  1B92 A;  1EP4 A;  2FSJ A;  3ENO A;  3MXJ A;  1RT2 A;  3ZET A;  3J80 O;  3VGM A;  3LDP A;  2UYT A;  1QVF M;  1BGX T;  2OPQ A;  2QKK A;  4CED A;  1ZBL A;  1QQC A;  4UY8 O;  5E41 A;  1JLC A;  1TKZ A;  5AQI A;  3I55 N;  5SZT A;  4EP4 A;  4BRK A;  3C7N A;  3M3Z A;  3RR8 A;  5E26 A;  1ITG A;  1J53 A;  3H45 C;  2G8F A;  4JK7 A;  4KFB A;  1CZA N;  1HJO A;  2ZJR L;  3DLK A;  3MX5 A;  4BQZ A;  4F3O A;  2HND A;  4CGH A;  3ALY A;  3P31 A;  5M1F A;  1KC8 O;  4FW1 A;  3EN9 A;  4ISG A;  4CF8 A;  4FJH A;  4OLA A;  2QKB A;  4KHY A;  4A61 A;  3L4Q A;  1K8K A;  1S1V A;  1NGC A;  4AM6 A;  5AQO A;  5M1K A;  3DI6 A;  3LZI A;  2PAV A;  3H3N O;  3QFP A;  3D7E O;  1ZXO A;  2FXU A;  3AO4 A;  5FPD A;  2ZD1 A;  1WSG A;  1S9G A;  3BY5 A;  4JS4 A;  3K58 A;  3NFA A;  1V4T A;  5IT9 O;  3C6U A;  4ELV A;  4LF8 K;  2B6A A;  4I6M B;  4IOC L;  3SLC A;  2QXF A;  1RCH A;  4JI7 K;  1UWB A;  3HOT A;  4YOU A;  4CW7 B;  1T44 A;  5AQJ A;  4B1V A;  3T1Y K;  3GE1 A;  3WNG A;  2JWL A;  3D2F A;  1DEJ A;  3H08 A;  3ATV A;  4JEP A;  3O9U A;  4N56 A;  1BIZ A;  3ZYY X;  4O55 A;  3WNE A;  4FJ8 A;  3GBT A;  4FWN A;  3MXI A;  3P39 A;  3CCR N;  5C12 A;  3PX4 A;  4BR9 A;  4EP5 A;  4DR1 K;  5ADX H;  2Y1J A;  3M5R A;  3THX B;  2HHV A;  4CEF A;  4RW8 A;  3RTV A;  1X3N A;  1XNR K;  4A62 A;  4W5R A;  3T69 A;  4JI1 K;  4IOX A;  4JKA A;  1KFS A;  1NGB A;  1OH6 A;  3TTC A;  1XQS C;  2B4J A;  1S1U A;  4BRM A;  2XY7 A;  2YNI A;  2ITM A;  1KLM A;  4FVU A;  5JVG L;  4KAZ A;  5B8H A;  5J2Q A;  2VGM A;  3T3F A;  4Z4E A;  4HUE A;  4CJE A;  3VQ7 A;  2IAJ A;  4CJP A;  4WQ5 C;  3ZX2 A;  1JKH A;  3WEE A;  3EZ5 A;  3DMJ A;  4C1N K;  2OA8 A;  1LAW A;  1M90 O;  4RG8 A;  2V51 B;  3UKU A;  4BGB A;  3C6T A;  3NE6 A;  4H5N A;  2IVN A;  2GBZ A;  2PBD A;  4CJL A;  5AQR A;  2YHX A;  3KD1 E;  4BQL A;  2VG6 A;  1S1W A;  3AO5 A;  4CFC A;  4YFU A;  4QOZ B;  2KFZ A;  4H0P A;  3U9Z A;  2E1Z A;  1VQ7 N;  1VRT A;  1FW6 A;  1IBM K;  3CF5 L;  4E1M A;  3VA3 A;  3QFU A;  4OGC A;  3KLF A;  1C1A A;  3CCL N;  2E6L A;  1SKW A;  3HOS A;  3C94 A;  3R3L A;  4RWT A;  3WXI A;  2HHX A;  1JLA A;  2O8E A;  4NCA A;  4AHT A;  4CBX A;  3CJ1 A;  4MLE A;  4F2S A;  4BR4 A;  1MA9 B;  4BRA A;  2BUP A;  4FJN A;  4B9Q A;  3PUF A;  3TAR A;  1QVG M;  1JLF A;  3OYE A;  3TAM A;  1QHA A;  2OAN A;  4CGF A;  4B1W B;  4B1Z A;  4GKJ K;  4FPB A;  4K25 A;  1VSM A;  3AAQ A;  4DKW A;  4DQR A;  5HRP A;  1VK0 A;  3IRX A;  1K9M O;  2RPI A;  4RTF D;  4CZH A;  3LPU A;  3DXK A;  3SV4 A;  3T19 A;  3L3V A;  3K9J A;  3MN9 A;  3RSE A;  3ZCM A;  3CD6 N;  3F9K A;  2IVP A;  3EKS A;  3W3D A;  3E9L A;  3LDS A;  2YX6 A;  4FJG A;  4YNQ A;  2RE2 A;  1NK8 A;  3C0B A;  4IOA L;  4CK1 A;  3A2F A;  1RGI A;  3ZSO A;  3ZT2 A;  3LAL A;  3O4Q A;  3R1X A;  2P9K A;  3OYN A;  3HPG A;  4MO5 A;  1IBK K;  3L4I A;  2AA4 A;  1L3U A;  3ZT4 A;  4KH6 A;  3S3O A;  4IZ9 A;  2BH1 A;  2E2Q A;  4U67 L;  3TTD A;  3M8R A;  1XHX A;  2Z1I A;  4G9Z A;  5AR0 A;  2A42 A;  4Z4I A;  3O08 A;  3SAF A;  4M3Y A;  1G15 A;  1SS6 A;  4PWD A;  3VEY A;  3MCA B;  4LF5 K;  5IWA K;  4MLH A;  4X62 K;  3DLL L;  1RT3 A;  2D1K A;  4FSV A;  1Q7Y O;  3ENH A;  1XWL A;  4BR7 A;  5AQS A;  1X9W A;  5AQF A;  3HTV A;  4PL8 A;  2O8F A;  3CFO A;  3ATU A;  5EU7 A;  1YTU A;  2Q0U A;  4DUZ K;  4JK8 A;  4H5T A;  3O9Q A;  4NLC A;  5C2F A;  4FWR A;  4FWM A;  4WCE L;  3TAF A;  1NK6 A;  3KK1 A;  1MDU B;  1YIJ N;  2ETJ A;  4HHT A;  4E89 A;  3DM2 A;  1HNZ K;  1VSE A;  3QEW A;  3NF8 A;  3HK2 A;  4DR2 K;  4LF6 K;  4PL7 A;  2DY4 A;  3ISN C;  4FZX C;  4HTU A;  3ZT1 A;  3S9H A;  1SUQ A;  2VCP A;  4KH5 A;  3LAM A;  5CR4 A;  1NBW A;  3ZSR A;  3MXM A;  3IG1 A;  2OPP A;  1S72 N;  2OYQ A;  4KRF A;  4IG0 A;  2R7Y A;  3QES A;  3DXM A;  4N41 A;  3CG7 A;  4FLZ A;  3OYL A;  1HYV A;  4B8C A;  2FSN A;  3L2W A;  1BDG A;  1MWK A;  1QSY A;  4FK4 A;  3AVH A;  3TR8 A;  3RRG A;  2HHS A;  1VQ9 N;  1VQ8 N;  2ZGZ A;  4B3O A;  5AQV A;  3EO3 A;  1M1K O;  1A5W A;  1GLB G;  1NK9 A;  2BAN A;  4DTS A;  3KTQ A;  2HHW A;  1HRH A;  4PA1 A;  1YT3 A;  2E6M A;  2ASM A;  4LSN A;  4E7I A;  3VOV A;  3HVT A;  2ZJQ L;  1U48 A;  1N36 K;  3OYF A;  3HRG A;  4DTP A;  5FPE A;  2OZM A;  5JS1 A;  2G8I A;  2HHH K;  3JXU A;  3VQD A;  3OYC A;  4E7H A;  2EWS A;  1I3A A;  4FWL A;  4Z0U A;  3KLG A;  1HYZ A;  4JKD A;  2KHO A;  4DQQ A;  4DMN A;  1YUW A;  3SMS A;  4BRH A;  3LDQ A;  3EEQ A;  4JD2 A;  3UKR B;  2D5R A;  1BI4 A;  3SV3 A;  4B9N A;  1QZ5 A; 
#chains in the Genus database with same CATH homology
 1LWC A;  4FM0 A;  2I5J A;  5HRS A;  2G8K A;  3OYM A;  3NH0 A;  4MFB A;  4TSX A;  4CJS A;  4QAG A;  4DFP A;  4IG3 A;  4CJ3 A;  4IFV A;  2FBV A;  4AHS A;  3M8S A;  3NGI A;  3KLH A;  2PZS A;  1KRP A;  3L2R A;  4DTN A;  3OYB A;  2XO7 A;  3OYD A;  4FVM A;  5KI6 A;  1BIS A;  4JRP A;  4KHN A;  3RMD A;  4B9T A;  4Z4F A;  1JLQ A;  3ITH A;  4NYN A;  4N47 A;  4KI6 A;  3LAN A;  3S3M A;  3V4I A;  1X9S A;  1GOB A;  4N76 A;  3P83 D;  3ZSX A;  4FK2 A;  3SPY A;  3QEV A;  4I2Q A;  4CER A;  4CJV A;  2HVH A;  1GOC A;  1QTM A;  2FBX A;  2QK9 A;  4CK2 A;  3K5M A;  3K59 A;  4CHY A;  1YTA A;  4DLE A;  3RRH A;  4KHQ A;  2IS3 A;  3VQ8 A;  3AA2 A;  3SUQ A;  3FFI A;  1CXQ A;  4C8M A;  4DTJ A;  1KVA A;  1HYS A;  4ZHR A;  1T7P A;  1FK9 A;  1TAU A;  3BGR A;  4C8O A;  4OLB A;  5C42 A;  3RMA A;  3SQ2 A;  2F96 A;  3DRP A;  1S1X A;  3P5J A;  3KD5 E;  4O4G A;  2X78 A;  1L3V A;  2HVI A;  1WAJ A;  1C0T A;  1RBS A;  1VSD A;  2KW4 A;  2YNH A;  5KTQ A;  1RTJ A;  3NHG A;  4I2P A;  4DQS A;  5I3U A;  4K8Z A;  3LP0 A;  5FRM A;  4QCL A;  4FJI A;  4CJQ A;  3QIP A;  3NH2 A;  4FLY A;  4KHS A;  4KTQ A;  2D0C A;  1KVB A;  3RMC A;  1SL2 A;  3JSM A;  3V9U A;  3NDK A;  1TKX A;  1F21 A;  3G10 A;  3TAB A;  4KPY A;  1X9M A;  3DLE A;  1U04 A;  3OYG A;  1NK4 A;  4DSK A;  1FKP A;  2GUI A;  1D9F A;  1NOY A;  3CM5 A;  3L2V A;  3VQ4 A;  1YVU A;  3AVB A;  1WSI A;  1BCM A;  3V9X A;  3V1R A;  5J2P A;  3O3H A;  3OYJ A;  3V9S A;  4CJF A;  1HMV A;  1N5Y A;  1CXU A;  1C0M A;  3G0Z A;  5CYM A;  3HP6 A;  4FK0 A;  4FJJ A;  2WON A;  4IFY A;  3CFR A;  3NCI A;  1WSE A;  1K6Y A;  4OKE A;  1NJX A;  1B92 A;  1SKR A;  1WSJ A;  2NUB A;  3MEE A;  1EP4 A;  3MXJ A;  1RT2 A;  4KV8 A;  1UA1 A;  4J2B A;  2XY8 A;  2F8T A;  2FC0 A;  3KLE A;  3V9W A;  2YNF A;  4CEB A;  1TV6 A;  3KJV A;  1JL1 A;  1JLG A;  4GMJ B;  4M41 A;  4M3Z A;  1BGX T;  1ASW A;  2OPQ A;  2QKK A;  4CED A;  1ZBL A;  1QQC A;  4C8L A;  5E41 A;  4ZTJ A;  1S6P A;  1JLC A;  1TKZ A;  3QIO A;  4RW7 A;  4CCH A;  5KRS A;  1RDB A;  5SZT A;  2G8U A;  4EP4 A;  3M8Q A;  3RR8 A;  1BI4 B;  1XHZ A;  4MQ3 A;  1S6Q A;  1ITG A;  3D0P A;  4ELU A;  4FM1 A;  2Q3S A;  1J53 A;  4L8R B;  2G8F A;  4KFB A;  3VQA A;  2Z1J A;  4IDK A;  1NJW A;  2EHG A;  3DLK A;  1UOC A;  3AO1 A;  3CFP A;  1TGO A;  5J2M A;  4DTR A;  4M3U A;  3NGZ A;  1KSP A;  5HRR A;  4F3O A;  2HND A;  3B6O A;  3L3U A;  4BE2 A;  3HM9 A;  4CGH A;  1RBU A;  3ALY A;  4OKK A;  4Z4H A;  3V9Z A;  3V81 A;  1RT1 A;  2OZS A;  3SQ1 A;  3AVL A;  4FW1 A;  4FJH A;  4OLA A;  4CF8 A;  4PQU A;  4CJU A;  1ZBU A;  2QKB A;  4LD0 A;  1CZ9 A;  3NF9 A;  3MAQ A;  4HCB A;  4KHY A;  4CEE A;  4CHN A;  2HHU A;  3NBP A;  1S1V A;  1RTH A;  1ZBF A;  2YKM A;  4B9U A;  4FLX A;  4HUF A;  4F2R A;  4CGG A;  3TAG A;  3AVA A;  2FBT A;  4DSL A;  1RBV A;  4NCB A;  4AHV A;  3DI6 A;  2XHB A;  4DU1 A;  1BQN A;  3LZI A;  1TVR A;  1Z25 A;  4E19 A;  3RR7 A;  4LY7 A;  3K5N A;  1ASV A;  1KTQ A;  3VQ6 A;  1NK0 A;  3OVN A;  3AO4 A;  4B9M A;  1W9H A;  5FRN A;  1NK5 A;  2Z1H A;  3ZSW A;  2ZD1 A;  3B6P A;  2VWK A;  4FLV A;  1WSG A;  3LAK A;  4FJ7 A;  4J2A A;  3QO9 A;  1S9G A;  4JS4 A;  3K58 A;  3NFA A;  4AH9 A;  4E3S A;  4FM2 A;  4DLG A;  3SQ0 A;  3AO2 A;  4EZ6 A;  3C6U A;  4BDP A;  1TKT A;  2EX3 A;  3C95 A;  2B6A A;  4CJT A;  3ULD A;  4ELV A;  3KKS A;  4CHQ A;  1CLQ A;  2QXF A;  1RCH A;  4O44 A;  4DSE A;  4O5B A;  1UWB A;  2G8H A;  3CQ8 A;  1IKW A;  4KTZ A;  1D9D A;  3ASM A;  4KHU A;  1WSF A;  3WNG A;  4KI4 A;  5FDL A;  2G8W A;  3H08 A;  3VN5 A;  3AVC A;  3PO5 A;  4N56 A;  3NF6 A;  1BIZ A;  4Q0B A;  4BWJ A;  2HNZ A;  2P51 A;  3VQC A;  3LPT A;  4LH5 A;  3SZ2 A;  1SV5 A;  1ZYQ A;  4OPJ A;  4O55 A;  3WNE A;  3WNH A;  4FJ8 A;  3AVK A;  1Q9X A;  3MXI A;  4DS5 A;  3NGY A;  1TKD A;  4F4K A;  3PX4 A;  4CES A;  4EP5 A;  4Z4C A;  1CZB A;  4FJ9 A;  2Y1J A;  2PYL A;  3KKR A;  3MEC A;  4J2D A;  3ZT3 A;  2IGI A;  2HHV A;  2B5J A;  4M3W A;  4CEF A;  2KFN A;  4RW8 A;  5HLF A;  4CEO A;  4C8N A;  3RTV A;  3OJS A;  3VA0 A;  3PV8 A;  4KRE A;  3QEP A;  5J2N A;  4RW9 A;  4ICL A;  1RBR A;  4W5R A;  1RT6 A;  3QEX A;  5HP1 A;  2FBY A;  4BWM A;  4ZTF A;  1KFS A;  3AA3 A;  3HVR A;  4OVL A;  4N5S A;  4F3T A;  1TL1 A;  1NKB A;  4KTW A;  1BCO A;  2B4J A;  1S1U A;  3THV A;  2XY7 A;  1Y97 A;  4B9S A;  1VSJ A;  5HRO A;  2YNI A;  2P5O A;  1HQE A;  3LP1 A;  1J54 A;  3SPZ A;  1KLM A;  2DTU A;  4NYF A;  2XY6 A;  4OGE A;  4FZZ A;  1QE1 A;  3PX6 A;  1NKC A;  2XRI A;  4KAZ A;  4FJX A;  1HQU A;  4NCG A;  5J2Q A;  4Z4E A;  1WN7 A;  3T3F A;  2KTQ A;  2YHA A;  3U6F A;  4DSI A;  4HUE A;  3V1Q A;  2RKI A;  3ZSV A;  2OPR A;  3AV9 A;  2DFE A;  3AVM A;  4CJE A;  3VQ7 A;  3OS1 A;  2Y1I A;  3TAQ A;  4W5N A;  1EXQ A;  2IAJ A;  2BE2 A;  3CYM A;  4CJP A;  4Y1C A;  5JS2 A;  3UIQ A;  4FZY A;  2BGG A;  3DLB A;  3K57 A;  3L8B A;  4ID5 A;  4DFK A;  1IG9 A;  4DQI A;  1RDD A;  1JKH A;  4KB0 A;  3EZ5 A;  4KO0 A;  3DMJ A;  5CZ1 A;  4E7L A;  1DTQ A;  2X6N A;  1LAW A;  4IBN A;  2OA8 A;  1NOZ A;  1UAX A;  1DLO A;  3HP9 A;  4M42 A;  4ELT A;  4RG8 A;  4DTO A;  4WE1 A;  3QEI A;  2WOM A;  4E7K A;  4EZ9 A;  1EKE A;  3C6T A;  1S5J A;  3NE6 A;  4J2E A;  2ZQB A;  2GBZ A;  4CHZ A;  5HRN A;  3O3G A;  2BDP A;  2HHT A;  3M8P A;  2E4L A;  4CJL A;  4XIU A;  1VRU A;  3SNN A;  4JLH A;  4LH4 A;  1C0U A;  3KD1 E;  4RW6 A;  2VG6 A;  1S1W A;  3LP3 A;  4K8X A;  4LSL A;  3QER A;  1DTT A;  3AO5 A;  4GVM A;  4CFC A;  1VSH A;  4DU3 A;  2YKN A;  2XY5 A;  4I9Q A;  2HW3 A;  4YFU A;  4F8R A;  3AA5 X;  3VQQ A;  4B08 A;  1KCF A;  1KFD A;  4QOZ B;  2KFZ A;  1KLN A;  2X6S A;  3DRS A;  3HST B;  4DG1 A;  1QSL A;  3QLH A;  1VRT A;  1RT7 A;  4E1M A;  3VA3 A;  4W5O A;  4OGC A;  2Z1G A;  4CFD A;  1C1A A;  3KLF A;  1ASU A;  2AJQ A;  3AVN A;  2E6L A;  4I9L A;  3DRR A;  2JGU A;  4CEA A;  4CGI A;  4CK3 A;  1SKW A;  2O4I A;  4CF1 A;  3C94 A;  3HPO A;  2HHX A;  1L5U A;  2KZZ A;  1JLA A;  3ZSQ A;  4FW2 A;  1VSK A;  4NCA A;  4CEZ A;  4AHT A;  5KRT A;  3NH1 A;  3LZJ A;  4FCY A;  4F2S A;  3V1O A;  1TL3 A;  3SUP A;  4FJN A;  4AHR A;  3U3Y A;  1J5O A;  1B9D A;  3PUF A;  3TAR A;  4AHC A;  3OJU A;  1JLF A;  3OYE A;  1GOA A;  3TAM A;  2YNG A;  4Y1D A;  4B9L A;  4CGF A;  3VQE A;  1D8Y A;  1N6Q A;  5DK5 A;  1Q8I A;  1VSM A;  4FLU A;  4DQR A;  1TAQ A;  5HRP A;  4AHU A;  3ZT0 A;  3OS2 A;  1VK0 A;  4CEC A;  3IRX A;  3KIO A;  4CIE A;  3KK2 A;  4FLT A;  1KVC A;  2RPI A;  1SL1 A;  4DQP A;  1IO2 A;  1A5X A;  3SUN A;  3PY8 A;  3HJF A;  4BDY A;  3IS9 A;  1U4B A;  4CF2 A;  3LPU A;  4CJK A;  3AVI A;  4CJW A;  4B8A B;  3KK3 A;  4HUG A;  3SV4 A;  1HJR A;  4O0J A;  3T19 A;  3L3V A;  1JL2 A;  1VSF A;  1T8E A;  4DWI A;  3ZCM A;  5KGW A;  1IKV A;  3IAY A;  3F9K A;  1J9A A;  3DLR A;  2PY5 A;  1ZBH A;  4CEQ A;  4H4M A;  3L2Q A;  1U45 A;  3TAE A;  3VQB A;  3LDS A;  3K5O A;  5CYQ A;  4DTX A;  1IKY A;  2DFF A;  1W0H A;  4CHO A;  3L2U A;  4FJG A;  1X1P A;  2HMI A;  4FXD A;  4YNQ A;  1LV5 A;  3LWM A;  3TAN A;  1NK8 A;  4G1Q A;  4CGJ A;  3TAP A;  5J1E A;  4CK1 A;  5DMR A;  4DF4 A;  1RBT A;  4M3R A;  3A2F A;  3P1G A;  3ZSO A;  1RT5 A;  3ZT2 A;  1ZBI A;  3LAL A;  1REV A;  4CF0 A;  4DTM A;  3RMB A;  3DLH A;  1NJY A;  3HXM A;  2P1J A;  3O4Q A;  3T1A A;  4Z4G A;  3V6D A;  3OYN A;  3HPG A;  4BDZ A;  5CZ2 A;  5C25 A;  1JXB A;  3O4N A;  4CFA A;  1L3U A;  3ZT4 A;  4KB1 A;  2X74 A;  3AVF A;  2LSN A;  3ZSZ A;  3S3O A;  4OKJ A;  4DU4 A;  4BAC A;  1C1B A;  4BE1 A;  4FJL A;  3VQ5 A;  3JYT A;  4FJM A;  3M8R A;  1XHX A;  2Z1I A;  4Z4I A;  2JLE A;  3I8D A;  2P5G A;  4M3Y A;  1LWE A;  1G15 A;  2YV0 X;  3MEG A;  3S3N A;  4PWD A;  2HB5 A;  2O4G A;  3HO1 A;  1RNH A;  1FXX A;  2IC3 A;  1TK5 A;  4I7F A;  2ITG A;  1L3S A;  2D0B A;  1NKE A;  4HCC A;  3PO4 A;  1RT3 A;  4H4O A;  1LW2 A;  1NJZ A;  1RTD A;  5KGX A;  3RWU A;  2HHQ A;  1XWL A;  3E01 A;  2VG7 A;  4DF8 A;  1X9W A;  1QSS A;  3K2P A;  4FJ5 A;  4PUO A;  1VSI A;  3SQ4 A;  3CFO A;  5EU7 A;  3WNF A;  1YTU A;  1JLE A;  1LWF A;  3AA4 A;  1O1W A;  4M45 A;  4W5Q A;  1S9E A;  1SL0 A;  4CJ5 A;  2HHW A;  1BL3 A;  1MU2 A;  4CIF A;  3SYZ A;  3I0S A;  1TK8 A;  1L3T A;  2IOC A;  2RN2 A;  1JLB A;  4DFJ A;  3TAF A;  1NK6 A;  4FJK A;  4CJR A;  1EX4 A;  1VSL A;  3VQ9 A;  1Z26 A;  4CJ4 A;  5T7B A;  3EYZ A;  5I42 A;  2IDO A;  3KK1 A;  2A1R A;  4PY5 A;  1RTI A;  4CF9 A;  4CGD A;  1B9F A;  2ETJ A;  4JRQ A;  4HHT A;  4E89 A;  4CFB A;  3BDP A;  4AIL C;  1T03 A;  3DM2 A;  3DOK A;  5K14 A;  4DTU A;  1VSE A;  3F73 A;  2VWJ A;  3QEW A;  3NF8 A;  3EY1 A;  4M3T A;  3HK2 A;  1S1T A;  2YHB A;  2DY4 A;  1FKO A;  3ISN C;  1NK7 A;  4FZX C;  3AVJ A;  4OJR A;  4HTU A;  3ZT1 A;  3S9H A;  1SUQ A;  3AVG A;  3OYA A;  3LAM A;  1XC9 A;  4OPK A;  3DLG A;  4KHW A;  3ZSR A;  2VG5 A;  1HNV A;  4E1N A;  3LWL A;  3SUO A;  3U3G A;  4DSF A;  3MED A;  3MXM A;  2DFH A;  4CHP A;  2HNY A;  2OPP A;  3IG1 A;  4E7J A;  2OYQ A;  4KRF A;  1Q9Y A;  1WAF A;  3DYA A;  4IG0 A;  2R7Y A;  4DFM A;  3QES A;  4UQG A;  4B9V A;  2D0A A;  3CG7 A;  3HL8 A;  3HPH A;  4N41 A;  4FLZ A;  3O3F A;  3OYL A;  1HYV A;  1JXE A;  4B8C A;  3ZSY A;  4HVJ A;  3OYH A;  3QNN A;  4FYD A;  1BIU A;  4FLW A;  1I39 A;  1XI1 A;  2GV9 A;  1R0A A;  1LAV A;  3L2W A;  3SJJ A;  1QSY A;  1RDC A;  2F8S A;  4FK4 A;  1HPZ A;  3AVH A;  1C1C A;  3TR8 A;  3I0R A;  3VQP A;  3RRG A;  2HHS A;  1WSH A;  5C24 A;  1UA0 A;  2ZE2 A;  4O0I A;  3DOL A;  3QIN A;  3SI6 A;  1RIL A;  4B3O A;  3QET A;  1U49 A;  1QHT A;  4CIG A;  3NAE A;  1A5W A;  3K5L A;  1NK9 A;  2BAN A;  3TWH A;  4DTS A;  3KTQ A;  1HRH A;  4PA1 A;  4DSJ A;  1YT3 A;  4M3X A;  2E6M A;  4LSN A;  4JS5 A;  1D5A A;  4E7I A;  4IKF A;  3NF7 A;  5SWM A;  4H8K A;  5FRO A;  3HVT A;  3TI0 A;  3LP2 A;  5D3G A;  5HBM A;  2RF2 A;  1C6V A;  1IH7 A;  1SKS A;  1T05 A;  3KLI A;  2OPS A;  1U48 A;  2KZM A;  4DS4 A;  1EET A;  3D45 A;  3SCX A;  1WLJ A;  3OYF A;  4E0D A;  1IKX A;  2A1S A;  4DTP A;  1TK0 A;  1BHL A;  3PX0 A;  1WNS A;  2ATQ A;  4R5P A;  2PYJ A;  2OZM A;  1LW0 A;  2G8I A;  5JS1 A;  3CM6 A;  1A5V A;  4C8K A;  2G8V A;  3VQD A;  3OYC A;  3OYK A;  4ID1 A;  4RW4 A;  4E7H A;  1RDA A;  4Q5V A;  1I3A A;  3OY9 A;  4Z0U A;  1BQM A;  3KLG A;  1HYZ A;  4CE9 A;  3AO3 A;  2KQ2 A;  4W5T A;  1RT4 A;  4GW6 A;  3HT3 A;  4DQQ A;  4DMN A;  4BE0 A;  1HNI A;  3QNO A;  3OS0 A;  5CY4 A;  1QS4 A;  4KKO A;  3HYF A;  1U47 A;  3OYI A;  2D5R A;  1BI4 A;  3SV3 A;  2W42 A;  4B9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...