3VQ8A

Hiv-1 in core domain in complex with (3r)-3,4-dihydro-2h-chromen-3-ylmethanol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
136
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 51
structure length 136
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq8A00
4KPYA 1TKTA 3AVLA 2FC0A 4F2SA 3C95A 3NGZA 4FM2A 2Z1HA 4FK4A 4PQUA 5K14A 1BL3A 2YNGA 1N6QA 4Z4GA 1Q8IA 3ITHA 3KKRA 3KLIA 4MFBA 4E0DA 1BISA 4KHSA 4N76A 1ZBLA 1QSSA 2Z1IA 1VSDA 3K5MA 4FLYA 2OPRA 3T3FA 3ZSRA 1IG9A 2P1JA 4IBNA 3VQ5A 2QKBA 3AVAA 3NGIA 1XC9A 4HTUA 4FJJA 3ULDA 2GV9A 3DMJA 3HP9A 4M3WA 1S1VA 3AVGA 3DLGA 3AO4A 3OS2A 3O4QA 3RRGA 4K8XA 1GOCA 3S9HA 3ZSYA 4KAZA 4ID5A 5E41A 3CFOA 4GMJB 4ELVA 1J54A 4J2EA 1J5OA 1WAJA 1HYVA 2Z1JA 1ZYQA 2HHVA 3ZT1A 4JS5A 4PUOA 1NK6A 1VSIA 3MEEA 4CEQA 3DLRA 4CHQA 3LWLA 4M41A 4DFKA 3WNGA 3U6FA 4Z4IA 1EX4A 1JLGA 2E4LA 2P5OA 3ZT3A 3L2VA 3ZT4A 4DU4A 4OKKA 2YNIA 3JSMA 3NHGA 4CJFA 3SCXA 5HRNA 2G8FA 3HPOA 4ELUA 1RTIA 1D5AA 4DSKA 4AHTA 2F96A 1KVAA 4DF8A 4CERA 5HRSA 3OY9A 4C8MA 3SQ1A 4MQ3A 4BDPA 1U4BA 2E6LA 1TAQA 2YNFA 3CYMA 3M8QA 4L8RB 1TAUA 3MXMA 4W5NA 2RPIA 2LSNA 3FFIA 3SUOA 1RT1A 2BE2A 4ID1A 3VQQA 3SNNA 3AO1A 4DQSA 3L2QA 4DQIA 4HCBA 3C94A 1G15A 3PX0A 3AVKA 1T05A 2DTUA 4DTMA 4NCGA 4CK1A 3O3GA 4KRFA 4M3UA 3O4NA 1TL1A 1C1CA 1Z25A 4O0IA 1JLAA 5J2NA 3NH1A 3K5LA 3BDPA 5JS1A 4JS4A 2KW4A 3KK3A 3TR8A 1RBRA 4K8ZA 1RT7A 4CK3A 4KB0A 1F21A 3RMAA 2G8UA 3KKSA 4W5OA 3SPYA 2X6NA 3K2PA 1Q9YA 3VQBA 4IFVA 5FRMA 3OYEA 3NH0A 1GOAA 2D0CA 3O3FA 4OVLA 3VQDA 2R7YA 1VSKA 5FRNA 4HHTA 1QQCA 4E7JA 1B9FA 5I3UA 1VRUA 2Z1GA 1NK8A 1W9HA 3WNHA 4FVMA 2HNZA 2ZD1A 3DLKA 3THVA 1IKVA 2PZSA 4IG3A 3TWHA 2AJQA 3HL8A 3TAQA 1NK4A 3E01A 1W0HA 4EP5A 3NBPA 3QINA 4CJ3A 4AHUA 2ETJA 2E6MA 3WNEA 2KZZA 4J2DA 1BQMA 4DTNA 1WSIA 4KTWA 4M3TA 3MXIA 1B92A 3SUPA 2BGGA 2KZMA 4CJRA 3D0PA 1U04A 2A1RA 4FLWA 3VA3A 1ASWA 1J9AA 4W5TA 1EKEA 3G10A 3MAQA 1NJYA 2ZE2A 1KFSA 5DK5A 4CHPA 5CY4A 3TI0A 4FJ5A 3NGYA 1U45A 4N47A 2YKNA 4B9LA 4FJGA 4KHWA 1T03A 3ZSVA 3A2FA 2NUBA 2VG7A 3S3MA 3SV4A 3IG1A 1XWLA 3DLHA 5KRTA 4M3YA 3NF9A 3L3VA 4N56A 1WLJA 1BI4B 4OKEA 3ZSZA 1KLNA 4C8LA 2B4JA 4FJXA 4CK2A 3TAMA 3SYZA 1WN7A 3AA3A 3OVNA 4CJUA 1BHLA 2G8KA 2IGIA 4CEBA 3K5OA 3SQ0A 3EZ5A 3OYGA 3V9XA 4CJ5A 4LY7A 1KFDA 1TVRA 2HHWA 4DSEA 1MU2A 4B08A 4OGCA 4CJLA 2FBTA 1BCMA 1VSFA 1WSFA 3VQ7A 4DTPA 2KTQA 4HVJA 3NF8A 2EX3A 2OPQA 3HSTB 3L2WA 4E7HA 4M3RA 4RG8A 1RTJA 4Z4EA 3I0RA 1KSPA 1ZBUA 2O4IA 4RW4A 4O44A 4CHZA 2HHXA 2X74A 1NK0A 1KVBA 4CJKA 1FKOA 3CQ8A 2ATQA 4LSNA 4CJTA 1UA0A 1REVA 3G0ZA 2OZSA 1FK9A 1L3VA 4FLZA 4EZ6A 4DQPA 4EP4A 3LAMA 1QS4A 4AHCA 3OYNA 2B5JA 3SV3A 2WONA 1TK8A 4FJ7A 3SJJA 4JLHA 3QEWA 4CGHA 4E19A 1NKCA 4KHUA 2QK9A 1HPZA 4DSJA 1D8YA 3RTVA 1QHTA 1A5VA 1C6VA 3K58A 4CGDA 2DY4A 1NKEA 1VSMA 3DRRA 4CGGA 3KJVA 5KRSA 3OJSA 4GW6A 3C6TA 4DQQA 4AILC 4C8OA 4FJKA 1I39A 3MECA 3VN5A 1HJRA 1ASVA 1FXXA 3HPGA 2FBYA 4LH5A 4CGFA 3B6OA 4CFDA 1Q9XA 3PV8A 4QCLA 1X9SA 2W42A 4Z4HA 3RWUA 4BACA 1CZ9A 1QE1A 3ISNC 2BDPA 4FJ9A 5CYMA 4CJSA 3V9WA 3OYKA 4F3TA 3AVIA 2HMIA 3L2RA 3U3GA 4FZZA 4FXDA 4CJPA 4DS4A 3RMDA 4DF4A 4CHNA 5KGXA 4DTSA 3AA5X 1C1BA 1BI4A 1JL1A 4CF0A 4B9TA 4DTRA 4W5RA 3NF7A 4HUGA 3AA2A 1SKRA 1A5XA 4GVMA 3B6PA 3HP6A 2I5JA 1X9MA 5HRPA 4W5QA 2XY6A 1RDDA 1VRTA 3CG7A 4CEZA 4B9SA 3AVJA 3BGRA 3OYBA 4CHYA 1RNHA 1S1TA 5SZTA 4KI6A 4KHQA 2XY5A 1YVUA 2VWKA 3OYMA 3V9ZA 3V4IA 4IG0A 1NK5A 1JLEA 4RW6A 4WE1A 5CYQA 1NKBA 3PO4A 4CJ4A 3SQ4A 3ALYA 4CE9A 4NYFA 4DLEA 3TAEA 4FW2A 2X6SA 4KTZA 5J2QA 1TK0A 3DLBA 1XI1A 3LZJA 1RT2A 1QTMA 4RW9A 4PA1A 2VG6A 3M8SA 3KTQA 1KVCA 1HNIA 1RBUA 3LPTA 3DRPA 1NJWA 4KREA 4KKOA 3NE6A 1U48A 1VSJA 4C8NA 3I0SA 1L3UA 4JRPA 1S5JA 5I42A 3ZSOA 1SL0A 3HK2A 4FCYA 3AVFA 2JGUA 2YHAA 2YHBA 4FZXC 3O3HA 2PYJA 1RDCA 3D45A 3PUFA 3CFRA 3QEVA 1HNVA 4CFCA 4FYDA 4B9NA 2OPSA 1QSYA 4E7LA 3KLHA 3OJUA 3OYAA 3JYTA 4KO0A 4B3OA 3EY1A 1TL3A 2DFHA 3AVNA 1FKPA 2IDOA 1B9DA 2YKMA 3LP1A 3M8PA 1Z26A 3ASMA 3EYZA 2XY8A 3NCIA 3QEIA 2RN2A 3HM9A 5CZ2A 1WSHA 2HW3A 1SUQA 1EETA 1DLOA 4M45A 1TKZA 2X78A 3QEXA 1LAWA 4B8AB 1ZBFA 3LP0A 1BIZA 1S9EA 4ZTJA 2YNHA 4DSFA 1JL2A 3QETA 5D3GA 3NH2A 1S6QA 2D0BA 1VK0A 5JS2A 4CF1A 2D5RA 4FW1A 4CJWA 4ZHRA 5C24A 5HLFA 1T8EA 4ELTA 1RILA 4FK2A 4Q0BA 1S1WA 1WAFA 3DOKA 4DQRA 1KLMA 4AHRA 2BANA 1VSLA 4FM0A 4Z4FA 4OJRA 3VQAA 3VQ8A 3P5JA 3ZCMA 5C25A 4G1QA 4QOZB 4KHYA 3IAYA 3HVTA 3V1RA 2HB5A 1SKWA 1TKDA 2D0AA 3TABA 1TKXA 4FLVA 4F8RA 4J2BA 5DMRA 2XHBA 1JLBA 2YV0X 1R0AA 2PYLA 4FJNA 2OZMA 3KD5E 1TK5A 1XHZA 1ASUA 4E1NA 3KK2A 1RDBA 1NOYA 4FJHA 1RCHA 4J2AA 1U49A 1RT6A 3AVBA 3KK1A 1BCOA 1Y97A 3V9SA 3SUNA 2XY7A 5SWMA 4I9LA 1NJZA 1L3SA 4B9UA 1S6PA 2FBVA 1RBTA 3PX4A 3CM6A 1NK7A 1IO2A 1RDAA 3OYIA 3L8BA 3TARA 4IKFA 5CZ1A 5HBMA 2VG5A 1A5WA 2F8SA 1D9DA 5EU7A 3AA4A 2OPPA 1BGXT 4DG1A 4I9QA 4KV8A 4QAGA 4KFBA 4RW8A 1D9FA 3PO5A 4KTQA 3VQ4A 1UWBA 1LWFA 1RT5A 4AHVA 2IAJA 4KB1A 1CXQA 2XRIA 4OPJA 3OYCA 2HHUA 1IKYA 1C1AA 4I7FA 3RRHA 1JLQA 3QO9A 4I2QA 1L3TA 4CGIA 1RBSA 2B6AA 4IDKA 4CF8A 3NDKA 1SL1A 1JXEA 2WOMA 3KLGA 1DTQA 2IC3A 4FJMA 3VQ6A 3HXMA 3I8DA 4FJLA 1S1XA 3KLEA 1YTUA 4CEDA 3K59A 1ZBHA 1BIUA 4CFBA 4B9VA 1TV6A 4O5BA 4DS5A 4H4MA 4Q5VA 1LW0A 3TANA 1L5UA 4O4GA 3ZSXA 4BE2A 4FJIA 4FK0A 4UQGA 4CEFA 1IKWA 3V81A 3LAKA 3QIPA 3SZ2A 4DFJA 1HQEA 1IKXA 3OS1A 4AH9A 4HCCA 3QNOA 1ITGA 3NFAA 1NJXA 1JXBA 4YNQA 2IOCA 4O0JA 3KIOA 5J2PA 3DM2A 1YTAA 1K6YA 3S3OA 3AVMA 2QXFA 4CEAA 4R5PA 4FZYA 4NCAA 3VQ9A 3AO2A 4E3SA 4E7IA 3IRXA 4CFAA 4H8KA 4DTJA 4CECA 2O4GA 3VQEA 4DWIA 4E89A 3T1AA 3VA0A 4RW7A 1VSHA 1RTHA 4CEEA 2KQ2A 3LPUA 1LAVA 3RMBA 4Y1CA 4B8CA 1C0MA 4CHOA 2Y1IA 4C8KA 2G8WA 4OLAA 3HPHA 3T19A 3QLHA 4HUEA 4E7KA 3TAFA 3V1QA 3OS0A 4DFMA 4E1MA 1UOCA 1IH7A 5KGWA 4DMNA 3LWMA 4DU3A 4N41A 3PY8A 1C0TA 4IFYA 1KRPA 2DFEA 4OLBA 3RMCA 3NAEA 2P51A 4FLUA 2ZQBA 3LALA 4M3XA 3MXJA 4F3OA 3HO1A 1YT3A 1BQNA 1HYSA 1C0UA 1WSJA 3SI6A 4Y1DA 1LV5A 5HRRA 4DTOA 3QNNA 1QSLA 4B9MA 3DOLA 1J53A 3NF6A 4OGEA 3ZT2A 2Q3SA 4LSLA 1HRHA 1RT3A 4LD0A 3L3UA 3VQCA 4DSIA 4Z4CA 3OYJA 4N5SA 1SL2A 4NCBA 5KI6A 4DTXA 5FROA 1WNSA 4DFPA 1DTTA 1KCFA 4F4KA 4DLGA 2RF2A 3K57A 4BE1A 3HT3A 3LP3A 5J2MA 3OYDA 2HNYA 4I2PA 5KTQA 3LZIA 1I3AA 3P83D 4CGJA 1HQUA 4CJQA 2A1SA 3MEDA 1S1UA 3DYAA 1LW2A 1KTQA 4TSXA 3CM5A 1RT4A 4CIGA 3QESA 5T7BA 3VQPA 4CJVA 4YFUA 1CLQA 1T7PA 1JLCA 3AO5A 2RKIA 4AHSA 4CF2A 4M42A 3ZT0A 3P1GA 3UIQA 3S3NA 4O55A 4H4OA 3TAGA 1UA1A 3C6UA 1X9WA 4BWJA 2QKKA 1LWEA 3OYHA 2F8TA 3IS9A 1RTDA 4OPKA 4EZ9A 1TGOA 2ITGA 4LH4A 5HP1A 4BDYA 1SV5A 2P5GA 2HVIA 4F2RA 3PX6A 4BWMA 3TAPA 4KI4A 2HNDA 2DFFA 3AVCA 3L2UA 2G8HA 3HYFA 2G8VA 1WSGA 1EP4A 1CZBA 3HVRA 1HMVA 1VSEA 4BE0A 4CIEA 4DTUA 4KHNA 3V6DA 2IS3A 1SKSA 4CJEA 3ZSQA 1JLFA 4CESA 3SPZA 4M3ZA 3K5NA 3LANA 2G8IA 2XO7A 2EHGA 2GUIA 4CEOA 1ZBIA 3DLEA 4JRQA 4FLTA 5FDLA 5HROA 2OA8A 1NK9A 2HHTA 3SQ2A 2HHQA 3LP2A 3MEGA 4CIFA 1X1PA 1S9GA 3KD1E 3V9UA 4ZTFA 4ICLA 2FBXA 3AVHA 3CFPA 1JKHA 1O1WA 4DSLA 3V1OA 1HYZA 1RBVA 3M8RA 3LDSA 4OKJA 1UAXA 4FM1A 4FJ8A 3OYLA 3DI6A 3F9KA 4NYNA 2PY5A 2GBZA 1EXQA 3AO3A 2Y1JA 1N5YA 3F73A 1WSEA 2JLEA 4HUFA 4PWDA 5C42A 4Z0UA 4XIUA 3H08A 3WNFA 1XHXA 2VWJA 1GOBA 4DU1A 1CXUA 3QERA 3OYFA 5J1EA 3RR7A 2OYQA 4PY5A 3ZSWA 4BDZA 4FLXA 4CF9A 3U3YA 4CCHA 3SUQA 3QIOA 3DRSA 3QEPA 2HVHA 2KFNA 2HHSA 1LWCA 3KLFA 1NOZA 3AV9A 1U47A 3RR8A 3HJFA 2KFZA
chains in the Genus database with same CATH superfamily
3AVLA 3C95A 1VHXA 5C2DA 4EAHD 2ZJQL 2IVNA 1Q8IA 3KKRA 5AQIA 1X9JA 3BP8A 1QSSA 4OPHA 1QQOA 4FLYA 2P9SB 2OPRA 3VEXA 3ZSRA 3AVAA 1D4XA 2GV9A 3R8EA 1KXPA 3WT0A 1S1VA 3AVGA 2E8AA 5EOYA 3OS2A 3VF4A 1GOCA 3S9HA 3H46O 4KAZA 5E41A 5M1QA 1J5OA 1WAJA 1HYVA 3AARA 4H0OA 4PUOA 1NK6A 4JKAA 3U6FA 1T3VA 1MDUB 2E4LA 2P5OA 3EN9A 3QBXA 4DU4A 3NHGA 3P38A 2VGNA 2YCHA 3HPOA 3O80A 5BPLA 3EEQA 4M7XA 4FSVA 4DHYA 2E6LA 4JK8A 1TAUA 5TKWA 3OBWA 3FFIA 4BVPA 4CI6A 1RT1A 5GIOA 1KC8O 4JKBA 4CZEA 4NCGA 3O3GA 1N8RO 2P9PA 3FZLA 5IT9O 3SLCA 1C1CA 1BUPA 5GADP 4JS4A 4KB0A 3I8BA 3KKSA 2UXDK 3VQBA 5FRMA 3CF5L 3OYEA 3RVCA 3NH0A 3A5NC 1VSKA 5AQKA 1HPMA 2VWBA 4K25A 1DEJA 1NK8A 1W9HA 4RTFD 2IVOA 3FZHA 2AJQA 1C0GA 3HL8A 3E01A 2O8FA 2AA4A 3O08A 5AQZA 3QINA 2ZGZA 2KZZA 4J2DA 1YAGA 4DTNA 1WSIA 4KTWA 4M3TA 3MXIA 1W2BM 3SUPA 2UXBK 4CJRA 2A1RA 4FWOA 3VA3A 1DGKN 1O13A 4DCHA 3ZEUA 3CXCM 3S3MA 4C8LA 1S22A 1SAZA 2B4JA 3EE9A 3SYZA 3AA3A 3BEXA 1BHLA 3SQ0A 3EZ5A 3V9XA 2WC9A 4BC5A 5C2FA 4K0KK 1WBBA 4WYBA 4DSEA 2P9IA 3VTHA 4WCEL 1KD1O 4CJLA 2FBTA 1VSFA 2KTQA 4DTPA 3C6HA 3NF8A 4Z4EA 5BR9A 3J8AA 3WUHA 4Z94A 4RW4A 4O44A 2HHXA 2X74A 4JKGA 3VEOA 4CJKA 1FKOA 4ILHA 2ATQA 4U7BA 1UA0A 1REVA 2OZSA 4JI5K 1ILYA 4KBOA 2A6AA 3E9OA 2ZGYA 3ZX3A 2UUCK 4JLHA 4KHUA 1VQ6N 2E1ZA 4DSJA 1HNWK 1D8YA 2DY4A 4CGDA 1VSMA 1KAZA 3VPZA 4GW6A 3C6TA 4FJKA 1V4SA 1M1KO 1I39A 3MECA 3HPGA 1ASVA 1FXXA 4CFDA 2W42A 5JVGL 1MWMA 1QE1A 3D2FB 4KH4A 3OYKA 3PIPL 4LF8K 3TSQA 1HJOA 4XEIA 3SAFA 3HOTA 4DV2K 3R9PA 5DM6L 4MLEA 3CCMN 4A62A 4H0VB 2OCEA 4A57A 4B9SA 2QWRA 3AVJA 3BGRA 3OYBA 5SZTA 3O9RA 4H0YB 3LDLA 3CETA 2WFBA 4WE1A 3VGMA 1ZXOA 4CE9A 4Z4IA 1XI1A 4JV5K 3LZJA 1RT2A 4PA1A 1LCUA 4C23A 2VQEK 2YHXA 5AQPA 3CC4N 4BG9A 3NE6A 4GVEA 4CVNE 4U67L 1XMQK 3P31A 4GKJK 1S5JA 4FCYA 2I7PA 4FZXC 2NNWA 3O3HA 3CFRA 1HNVA 4B9NA 4HWIA 3OJUA 5LMNK 3OYAA 1XMOK 4KO0A 3VEWA 1FKPA 3SNNA 1B9DA 1Z26A 3NCIA 3UKRA 2XY8A 2P9UA 2BH1A 2QXLA 4JI2K 1SUQA 1EETA 4V19S 1DLOA 5BREA 4M45A 4B8AB 1YJWN 1JL2A 1VAZA 1RFQA 1S6QA 1T6DA 5GIPA 1QQNA 1OVQA 4CJWA 2D5RA 1T8EA 1S1WA 4BRPA 2BANA 5C25A 2NRVA 3IAYA 1SKWA 2QWLA 3V1RA 1TKXA 4JKFA 5AJ3K 3I33A 2ASPA 1RDWX 4J2BA 2XHBA 2PYLA 5FPDA 1XHZA 4E1NA 3KK2A 1RCHA 2P9KB 3ENHA 3KK1A 1Y97A 2XY7A 5SWMA 1S6PA 3FFKB 1RBTA 4AM7A 1NK7A 3L8BA 3TARA 4IKFA 4ISEA 1LOTB 3AA4A 2OPPA 1BGXT 4DG1A 3O1BA 4KV8A 4I9QA 3U9ZA 4BR2A 4OPJA 1IKYA 3ID8A 2FF3B 2HMPA 4RCHA 1L3TA 2UUBK 4CFBA 4DS5A 4O5FA 1K8KB 1EWQA 4Q5VA 3TANA 1IKWA 3V81A 3LAKA 1W97L 4LFBK 1HQEA 3THYB 3OS1A 4AH9A 3CCQN 2P9NB 4H0PA 4YNQA 1VQ8N 3AVMA 1Z6RA 2QXFA 4X65K 4A2AA 4E3SA 4CFAA 2WUSA 2QWPA 2O4GA 5HL7L 4DWIA 1RTHA 4CEEA 1NJIO 4PKGA 4B8CA 3NMUA 4B3TK 5LY3A 4E1MA 2E2OA 3LDQA 1C0TA 3SJHA 3HSCA 4M3XA 3LALA 3HO1A 2P9KA 4Y1DA 5HRRA 1X3MA 4CZGA 1QSLA 1S72N 4LSLA 3VQCA 1U6ZA 3L3UA 2V7YA 1KCFA 3OYDA 3H1VX 3WQTA 1YJ9N 3LZIA 3P83D 5AQYA 4CJQA 1NG9A 2BUPA 3MEDA 4YDUC 3FZFA 3L6QA 4TSXA 3CM5A 4IO9L 3KK7A 3VQPA 2FSKA 2ZJRL 1K8AO 2V51B 3CCSN 2RKIA 4GKKK 2O8EB 1OVYA 2E2PA 3C6UA 3L4QA 4YDUA 5LJVA 2F8TA 1JJ2M 1RTDA 5C10A 1YF5L 2P5GA 4F2RA 1K8KA 3TAPA 2HNDA 2YI1A 2G8HA 1VQ5N 1WSGA 4B1ZA 4BE0A 3UKUA 3THWB 5AZIB 4KHNA 4WQ5C 1SKSA 2QTDA 2V52B 3KWGA 3K5NA 1Q86O 4JK9A 4BC2A 2GUIA 3DLEA 4JRQA 5HROA 2HHTA 2HHQA 3LP2A 4NXMK 3H3NO 4WQ5A 4ICLA 3AVHA 1JKHA 1BG3A 1UAXA 3DI6A 3N4QA 2PY5A 2GELA 1N5YA 3MMVA 1WSEA 1WUAA 4HUFA 5C42A 4ILGB 1ESVA 4NB4A 3C7NA 5J1EA 3ZSWA 4FLXA 3T7ZA 5A2QO 3U3YA 3SUQA 2HVHA 4XH1A 1U47A 3Q7BA 2ZJPL 4KPYA 2FC0A 4F2SA 3NGZA 4C1NI 4FM2A 1HKGA 1N6QA 4Z4GA 1GLEG 3ITHA 1BISA 3MN6A 1ZBLA 1FW6A 5AQLA 4JD2B 2P1JA 3VQ5A 1XC9A 3MN9A 4FJJA 1I94K 3CJBA 3CJ9A 3DMJA 3HP9A 3M6GA 4BRDA 2O8EA 3E9PA 3MWPA 1XUPO 2YJFA 3DLGA 4MLHA 3O4QA 3ZSYA 1YVNA 4ID5A 4BR7A 4IOCL 1OH5A 3OBYA 1J54A 1GLDG 4J2EA 3JXUA 2VCPA 3ZT1A 4JS5A 3DLRA 4FWKA 4MDAA 3HRGA 5AZIA 4AQYK 4I6MB 2YNIA 4OKKA 2H3GX 3JSMA 3J7YP 3SCXA 5HRNA 1Y64A 2F4VK 4DSKA 1D5AA 2F96A 5HRSA 1NGAA 4C8MA 1EWRA 1HKBA 4MQ3A 3VOVA 4WF9L 1XQSC 4BDPA 1TAQA 3CCLN 4L8RB 1U2VB 2YJEA 2LSNA 3VENA 4HCBA 2BE2A 5GINA 4DQSA 3L2QA 1G15A 3AVKA 4DTMA 4KRFA 3ATVA 3UB5A 3O4NA 5AFUH 1TL1A 1VQ7N 3SMPA 1JLAA 1RGIA 3K5LA 3BDPA 5JS1A 3KK3A 1RBRA 4K8ZA 5AQNA 4CK3A 4KH6A 2G8UA 1IV0A 3TSUA 2X6NA 4IFVA 3LDPA 3P4IA 4M7YA 3O3FA 4OVLA 4MDBA 5I3UA 1VQ9N 4JN4A 2CGJA 4JD2A 2PZSA 1GLCG 3G4SN 4FWMA 5FPEA 3TAQA 1NK4A 2W40A 1W0HA 3NBPA 2PAVA 2NRZA 3GL1A 2E6MA 1QZ6A 1BQMA 1B92A 3D0PA 1U04A 3A5MC 1ASWA 1EKEA 2F7TA 3G10A 5DK5A 4CHPA 5CY4A 4FJ5A 3CJAA 4NXNK 3TPQA 4N47A 5BRHA 2YKNA 1U45A 4FJGA 2UU9K 3R3LA 3ZSVA 3A2FA 4BRCA 2VG7A 4N56A 1WLJA 3L4IA 4OKEA 3CJ7A 5AQVA 1E4FT 3WQUA 2FLOA 4CK2A 4BRFA 4CJUA 3K9JA 3OYGA 1BCMA 1WSFA 3HSTB 4GY2B 4LF9K 3I0RA 2KKZA 2O4IA 3MX2A 5AQTA 1Q18A 3SAHA 1QVGM 2F9WA 4CJTA 4FWNA 4FLZA 4DQPA 4EP4A 5KPTA 4LF4K 4JKEA 3OYNA 2B5JA 4FJ7A 3SJJA 3VETA 1NKCA 2QK9A 5F1XA 1HPZA 3VEZA 3CJCA 3KJVA 3G6EN 2Q31A 3ID6A 3VN5A 3CQYA 4CGFA 2FBYA 3DXMA 3B6OA 1Q9XA 3PV8A 3LL3A 1NWKA 4Z4HA 3RWUA 2KHOA 1HUXA 4EHUA 2BDPA 5CYMA 4CJSA 2HMIA 5ADXA 1BWFO 3WXIA 3OA9A 3AA5X 4CW7B 4B9TA 4DTRA 3NF7A 4HUGA 2ZF5O 1NLVA 1Z05A 3B6PA 5HRPA 3AGKA 4W5QA 2QM1A 1RDDA 4CEZA 4DKWA 4B9QA 4KI6A 3TSPA 4ILJA 4DR7K 2XY5A 1YVUA 3R1XA 3ZYYX 4IG0A 5AZJA 4RW6A 3U4LA 1XNQK 5FPMA 4YOVA 4NYFA 4DLEA 3TAEA 3DLBA 2X6SA 3G71N 4IJNA 2VG6A 3KTQA 3LPTA 3TTCA 3DRPA 1NJWA 4KREA 4KKOA 1JCGA 1U48A 4YOWA 2GX9A 2P9SA 1YITN 3I0SA 1QVFM 5JICA 3AVFA 2JGUA 3D45A 2O8CB 2OPSA 5GAGP 4BRAA 3AVNA 3QDKA 3LP1A 3QFUA 1C0FA 3IKMA 5CZ2A 1BO5O 1WSHA 3FZKA 3M3ZA 4EFHA 1IG8A 1VQ4N 2ZWHA 3CCRN 1S9EA 1WOQA 4DSFA 1VK0A 4CF1A 4FW1A 4BR0A 4FK2A 3L0QA 4L3QA 4BQLA 3CERA 3DOKA 2QW9A 4FM0A 4Z4FA 4OJRA 1E3MA 1EQYA 3P39A 4KHYA 3A8YA 2HB5A 1TKDA 3TABA 1DKGD 1JLBA 1TK5A 1ASUA 4HTLA 1RDBA 4FJHA 4BGBA 1RT6A 1NJZA 3O4WA 5GAHP 1YXQA 2FSNA 3UE5A 2FBVA 4M63C 4JI1K 3PX4A 4GNIA 4CD1A 4GV3A 2QWOA 1RDAA 4BRHA 3EKUA 2Q97A 1D9FA 4QAGA 1KQSM 3H6EA 4XH5A 1UWBA 4NLBA 4PHTX 2HHUA 3WXMB 1C1AA 3J7ZO 1JLQA 3D7EO 1MA9B 3DWLA 3MN5A 4GV6A 2VQFK 2B6AA 4CF8A 3NDKA 4IOXA 2WOMA 4J8FA 3HXMA 4FJLA 1YTUA 3K59A 2UXCK 4QS8A 4O4GA 4KH5A 2HBKA 3A5LC 1N34K 1NGJA 2IOCA 3DM2A 4ISGA 1YTAA 3S3OA 4PKHA 2FF6A 4CEAA 3VF6A 5AQUA 3AO2A 4E7IA 3T1AA 1LAVA 4DV5K 2Y1IA 4JI0K 4CHOA 4C8KA 4OLAA 5M1OA 4HUEA 1K73O 4CZJA 4DFMA 4DV7K 1UOCA 4BR5A 4N41A 3F5TA 3CC2N 2OTLN 1HNXK 2DFEA 1KRPA 4FLUA 2P51A 1YT3A 1BQNA 3PSFA 1LV5A 3QMLA 1J53A 3NF6A 4FPBA 4CZMA 4FWRA 1HRHA 4JYAK 4Z4CA 4N5SA 5FROA 2E20A 3LP3A 5J2MA 3LDNA 2HNYA 4I2PA 4CGJA 1HQUA 2A1SA 1X3NA 1RT4A 1W7AA 5JLHA 3VTIA 1CLQA 3IMXA 3ZT0A 3TAGA 1IBLK 1X9WA 2QKKA 4G9ZA 4CBUA 4EZ9A 1TGOA 2HBJA 3PX6A 4BWMA 4KI4A 2GTDA 2DFFA 3HYFA 2G8VA 3D2FA 1CZBA 1HMVA 5JMVA 4CIEA 4JI8K 1BDGA 4CJEA 4M3ZA 3AAQA 3SPZA 3D2EB 2XO7A 1ZBIA 2OA8A 5EVZA 4JI6K 4CIFA 1X1PA 3KD1E 3O8MA 4ZTFA 3IUCA 2FBXA 1VQMN 4YOYA 1O1WA 1RBVA 2NRXA 2BTFA 5AQJA 3LDSA 2V7ZA 3VGKA 3OYLA 2GBZA 3MCPA 2Y1JA 4PWDA 2VWJA 3QERA 3BZKA 3RR7A 4BR4A 4PY5A 3CD6N 4BDZA 3KWIA 4CCHA 3KZBA 3QIOA 4KHPK 2KFNA 4CBWA 1LWCA 1NOZA 3AV9A 4FWSA 3IDHA 1VQLN 3RR8A 1K9MO 5EXWA 2KFZA 2CGLA 2Q2RA 4FK4A 5K14A 2YNGA 3CPWM 1SQKA 3KLIA 4KHSA 4JEPA 4N76A 4B1XB 1VSDA 3K5MA 2QKBA 3H3OB 4M3WA 2JWLA 1HX1A 2QA4N 5LL6Z 4K8XA 3VEYA 5AQQA 3ULEB 3JAMO 4ELVA 2NZTA 5BPNA 2HHVA 1ZYQA 2E88A 2QWNA 2P9LB 3T69A 1NGCA 1VSIA 3HBTA 3MEEA 3DJCA 4CHQA 4M41A 5I9EB 3WNGA 4IO8A 2ZM6K 3ZT4A 3H45C 4OO1J 3ZETB 3D2EA 3TTDA 1TUYA 4ELUA 1RTIA 1NGDA 3SQ1A 4DF8A 4CERA 3OY9A 1T44A 1T6CA 1U4BA 3M8QA 3CYMA 3E1YA 1TYQB 4W5NA 2RPIA 3VQQA 4NO7A 3AO1A 1S3XA 1NGIA 3PX0A 3D6RA 1KAYA 4M3UA 1BA0A 4R79A 4X64K 1Z25A 5J2NA 3NH1A 4BC4A 1RT7A 3ENOA 3RMAA 4W5OA 3K2PA 1Q9YA 4IZ9A 4B1VA 3F9MA 1GOAA 2D0CA 5IWAK 3CMAN 5FRNA 4E7JA 1QQCA 5TKYA 5MLCQ 1VRUA 2Z1GA 1GLJO 3WNHA 4CZKA 2QEXN 4FVMA 3CCUN 3DLKA 2ZD1A 1IKVA 3TWHA 4H5RA 5F2RA 3I55N 2GWKA 4FO0A 4AHUA 3THYA 2ETJA 3JS6A 2P9NA 2BGGA 3MAQA 2HBLA 4FVUA 1KFSA 1NNEA 3TI0A 5AR0A 3NGYA 4KHWA 4BREA 4DR2K 2NUBA 3IG1A 4B3SK 1XWLA 3DLHA 3ZSZA 4FJXA 4DQ8A 3TAMA 3ZETA 1WN7A 4LFCK 2G8KA 4FWLA 4CEBA 2A3ZA 3K5OA 4CBXA 1N36K 4CJ5A 4LY7A 2HHWA 2WTUA 2NRTA 5FLXO 4OGCA 3VQ7A 2CH6A 5F0XA 3K0SA 4HVJA 4A2BA 3THXB 1MWKA 4E7HA 4M3RA 1RTJA 1H1VA 1KSPA 3BF1A 1FJGK 1NK0A 2NRHA 3TTFA 1FK9A 1TUUA 3LAMA 1QS4A 4AHCA 2WONA 4DV0K 1KAXA 4IXCA 3BY5A 4CGHA 3QEWA 1OH8A 3DLLL 3HM8A 2VGMA 5KQ8A 4UY8O 3K58A 3DRRA 4CGGA 5KRSA 3T1YK 4DQQA 3GBTA 4AILC 4C8OA 1JCEA 1HJRA 4B1WB 3THWA 2HSTA 4QCLA 1X9SA 3LM9A 4BROA 2QWMA 2RHKA 4A5AA 3W0LA 3SAGA 4F3TA 4CJPA 4DS4A 3RMDA 3CQXA 4CHNA 3ZLJA 1C1BA 4MO5A 1JL1A 3AA2A 1SKRA 1A5XA 4GVMA 4PL8A 2I5JA 1X9MA 2XY6A 3C0BA 3CG7A 3ZX2A 2ASMA 4FL9A 1RNHA 3RSEB 3OYMA 3SBGA 3V4IA 3THXA 1JLEA 5CYQA 1NKBA 5E84A 1Q7YO 3ALYA 2ITMA 2WBNA 4FW2A 4RW9A 2YX6A 1KVCA 1RBUA 1VSJA 1L3UA 4JRPA 1ATRA 5I42A 3EL2A 1WB9A 3HK2A 2YHAA 2AP1A 2YHBA 4K42A 4DUZK 1RDCA 3PIOL 2J4RA 4CFCA 4E7LA 3KLHA 3JYTA 2A5XA 2YKMA 2IDOA 4CZHA 3QEIA 1NBWA 3ASMA 4B1UB 3FZMA 2RN2A 3HM9A 2HOEA 5B8HA 2HW3A 5AQRA 2E5LK 1BIZA 3M5RA 5BRFA 4ZTJA 5AQFA 3QETA 4I6MA 2D0BA 3G25A 3SK3A 2NRWA 1EO1A 4ELTA 4Q0BA 1WAFA 4K41A 1KLMA 4AHRA 3S41A 3VQAA 3VQ8A 3P5JA 4QOZB 4G1QA 3HVTA 2D0AA 1U2VA 2NRRA 3AY9A 5DMRA 2YV0X 1R0AA 4FJNA 1G99A 3KD5E 3CMEN 1U49A 4YOXA 3AVBA 3V9SA 1BCOA 3GE1A 3SUNA 3WXKA 1L3SA 3CM6A 3OYIA 2VG5A 2F9TA 4H0TB 2EWSA 1D9DA 5BRDA 3VQ4A 1LWFA 1RT5A 4AHVA 2IAJA 4JKDA 3OYCA 1CZAN 1J6ZA 3E66A 3QO9A 3BUZB 1SS6A 4CZFA 3K9KA 4F9OA 1VQON 1JXEA 2IC3A 3QBWA 3VQ6A 4YOUA 2HF4A 1YJNN 1ZBHA 5AQXA 4B9VA 1L5UA 3ZSXA 4FJIA 4FK0A 2O8FB 4CEFA 1N33K 3QIPA 3SZ2A 4DFJA 4DR4K 3VERA 1IKXA 5AQMA 4HCCA 1NGHA 1ITGA 4IWVA 3NFAA 1NJXA 1JXBA 3KIOA 5J2PA 3KHYA 3CCVN 4NCAA 3EZWA 3VQ9A 2D0OA 3IRXA 4LF6K 4DTJA 4H5TA 2CGKA 3ZEUB 4RW7A 4BRIA 4WFBL 3O1WA 2D4WA 1P90A 2G8WA 2QI2A 3QLHA 2RE2A 3T19A 4E7KA 3OS0A 3OW2M 3TAFA 4JI7K 5C12A 1BA1A 4LC9B 3PY8A 4IFYA 4OLBA 4OPAA 5CR4A 5LJWA 2ZQBA 3LM2A 3MXJA 4F3OA 2P9IB 1BU6O 1C0UA 1WSJA 3SI6A 2GWJA 3WXLA 3QNNA 3ZT2A 2Q3SA 1RT3A 3A0IX 4X62K 3OYJA 5KI6A 4DTXA 4A59A 3J80O 1ZC6A 5BN8A 4LFAK 4DLGA 2RF2A 4BE1A 3J81O 4JKGB 1R59O 1I3AA 3NVMA 3DYAA 1KTQA 4CIGA 3QESA 4JI3K 4CJVA 3AO5A 4AHSA 4M42A 3P1GA 3C65A 3UIQA 3R6MA 5E26A 3S3NA 4BWJA 3OYHA 4CD3A 3IS9A 5C15A 5HP1A 4BDYA 1SV5A 2HVIA 1HLUA 1YIJN 4RWTA 3AVCA 4BRLA 3L2UA 3HVRA 4X66K 1VSEA 4H5NA 4DTUA 3V6DA 4H5WA 1JLFA 2EHGA 2A42A 5FDLA 2O8DB 1S9GA 5AQHA 3V9UA 1YHQN 4O8UA 4OKJA 1Q82O 2HF3A 3F9KA 3MK6A 1EXQA 3AO3A 3VMFB 4XIUA 4Z0UA 3Q7CA 4XH4A 5AQGA 3WNFA 2CH5A 3H08A 1XHXA 2PBDA 4Y0WA 1E4GT 2I7NA 2OYQA 3VESA 3CI5A 3QEPA 3CPEA 2HHSA 2FSJA 2NLXA 3O5BA 3SBTA 3GDQA 1TKTA 4IOAL 2Z1HA 4PQUA 1BL3A 2YHYA 4MFBA 4E0DA 1ATSA 1VQNN 4AM6A 2Z1IA 4DB3A 2O8CA 5CE3A 3T3FA 2W6KA 1IG9A 4DR5K 4IBNA 3NGIA 1OKJA 1HKCA 4MO4A 4HTUA 3ULDA 3LDOA 4BGAA 3T1HK 3AO4A 5H1SQ 3RRGA 4YOTA 3W3DA 3CFOA 5EX5A 4H0XB 4GMJB 3IFRA 3UKRB 4BQZA 4IJAA 2P9UB 2Z1JA 4CEQA 3LWLA 4DFKA 3PLAA 1EX4A 1JLGA 3ZT3A 3L2VA 3DXKB 4CJFA 3U8XA 2G8FA 3FE1A 2E2NA 1BOTO 4AHTA 1KVAA 2O8DA 2JWKA 2YNFA 2HBMA 1QHAA 3MXMA 3FR0A 3SUOA 4DQIA 4ID1A 4JI4K 5BN9A 3EE8A 3C94A 1T05A 2DTUA 4IEEA 4CK1A 2Q1NA 3CIPA 3HOSA 4O0IA 4CZIA 4DR3K 2KW4A 3TR8A 5BPMA 1F21A 5AFUA 3CHWA 4DV4K 4FPAA 3SPYA 3PSIA 3DAWA 3WEEB 4YORA 2R7YA 3VQDA 5JVHL 1NMDA 4HHTA 1B9FA 1HR0K 2HNZA 3THVA 4WFNL 1NMNA 4IG3A 4JK7A 1XNRK 5BR8K 1NGFA 4EP5A 5M1KA 4FWPA 4CJ3A 3WNEA 4DV6K 2KZMA 2A40A 3O9UA 4FLWA 1J9AA 4W5TA 1NGBA 1NJYA 2ZE2A 2GUPA 5KPRA 3O9SA 4B9LA 5GAEP 1T03A 4BY9C 5LMUK 3SV4A 5KRTA 4M3YA 3NF9A 3L3VA 3DXKA 1KLNA 1BI4B 4PL7A 3CC7N 3HZ6A 3OVNA 1NM1A 2IGIA 2O8BB 1KFDA 1TVRA 1IBMK 4EIAA 3QB0A 1MU2A 4B08A 1YI2N 1VQPN 1ZBSA 5AQOA 3VGLA 1GLLO 2EX3A 2OPQA 3L2WA 2FXUA 4RG8A 1ZBUA 2W41A 3O6WA 1QQMA 4CHZA 2IIRA 3AAPA 2Q36A 1KVBA 3CQ8A 3NVKA 4LSNA 3G0ZA 2ASOA 1L3VA 4EZ6A 2W6LA 1IBKK 4B3RK 3WEEA 3SV3A 3QFPA 3OTOK 1TK8A 4EHTA 4BR9A 4E19A 3RTVA 1QHTA 1C6VA 1A5VA 1NKEA 4AF1A 4JHDB 3OJSA 1Q81O 4LF7K 4LH5A 5ADXH 2VYPA 4BACA 1CZ9A 3ISNC 4FJ9A 4H03B 3V9WA 3UKUB 3AVIA 3O9QA 3L2RA 3U3GA 4FZZA 4FXDA 1ATNA 5C0YA 4PKIA 5KPZA 4DF4A 4CJ7A 5KGXA 3OHRA 4DTSA 3H1QA 1BI4A 5CHIA 3AGRA 4CF0A 3EKSA 4W5RA 3HP6A 2Q0UA 3MN7A 2O8BA 1VRTA 4CHYA 1SZ2A 1S1TA 1YUWA 4KHQA 5AQSA 1J5EK 2VWKA 4DV1K 2YHWA 3V9ZA 1NK5A 1OH6A 1WBDA 3PO4A 1DT9A 3C7NB 4CJ4A 3SQ4A 4KTZA 5J2QA 1TK0A 2DPNA 1QTMA 1GLAG 4IFEA 3M8SA 1RDUA 4OX9K 1HNIA 5FPNA 5ELZA 4C8NA 1SL0A 1P8ZA 3ZSOA 3HTVA 4BC3A 2PYJA 3PUFA 3HI0A 3QEVA 3MDQA 4FYDA 1QSYA 4K43A 4B3OA 3EY1A 1TL3A 2DFHA 3ULEA 3M8PA 3EYZA 2HHHK 3CCEN 3KVGA 4JHDA 2P9LA 5JLFA 3ZX0A 4BRNA 1TKZA 2X78A 3QEXA 4B1YB 1LAWA 1ZBFA 3LP0A 1XC3A 4BRGA 2YNHA 5D3GA 3NH2A 5JS2A 3SMSA 4ZHRA 5C24A 5HLFA 1IJJA 1RILA 3O9TA 4QS9A 4DQRA 1VSLA 1NGEA 3ZCMA 3F2KA 1TYQA 1GLBG 4F8RA 4FLVA 5AQWA 3GG4A 4O8KA 3WXJA 3I56N 2OZMA 1NOYA 2Q0RA 4J2AA 4I9LA 4B9UA 1QZ5A 1IO2A 4IEIA 5CZ1A 5HBMA 1A5WA 4YY3K 2F8SA 5M1NA 4BRQA 2KLAA 5EU7A 3PO5A 4KFBA 4RW8A 4KTQA 4E1JA 4KB1A 1CXQA 2XRIA 4I7FA 3RRHA 3MX5A 4I2QA 4CGIA 3ATUA 1RBSA 4IDKA 1SL1A 3TU5A 4JNEA 3KLGA 1DTQA 4FJMA 4FWQA 3I8DA 1S1XA 3KLEA 4CEDA 1BIUA 4YHHK 1TV6A 4O5BA 3GOIA 4H4MA 1LW0A 4BRMA 4BE2A 4UQGA 2UUAK 3QNOA 4O0JA 2UYTA 3C6AA 1K6YA 3A5OC 4JKHA 4R5PA 4FZYA 5M1FA 5EY4A 4H8KA 4CECA 3VQEA 4E89A 3VEVA 3VA0A 1VSHA 2KQ2A 3LPUA 3RMBA 4Y1CA 1C0MA 3HPHA 2PFUA 3V1QA 2IVPA 4WFAL 3CJ1A 1IH7A 3M1FA 5KGWA 2D1KA 4DMNA 3LWMA 4DU3A 3J7AP 3RMCA 3NAEA 1HYSA 1GLFO 4BRKA 3EO3A 4DTOA 4B9MA 4DV3K 3DOLA 4A61A 2D0PA 4OGEA 4A5BA 4LD0A 4DSIA 1SL2A 4NCBA 1WNSA 4DFPA 1DTTA 4F4KA 4H5VA 3K57A 3HT3A 1VQKN 3CCJN 5KTQA 2E2QA 4DUYK 1S1UA 1LW2A 3FGUA 2OANA 2E1YA 3MCAB 5DM7L 5T7BA 4YFUA 3BF3A 4C1NK 1T7PA 1JLCA 4GV9A 4CF2A 4JKCA 3MWTA 4O55A 4H4OA 1UA1A 1HNZK 1LWEA 1NU0A 4B3MK 3QICA 4OPKA 2ITGA 4LH4A 3BZCA 3U9DA 4DR6K 4BG8A 4FOIA 4CZLA 1OH7A 1EP4A 4DR1K 4JAXA 3DXMB 5M1PA 2IS3A 1V4TA 4IDHA 3ZSQA 4CESA 4NLCA 4LF5K 4WQ4C 3LANA 4ISFA 2G8IA 4CEOA 4FLTA 2A41A 1NK9A 3SQ2A 3MEGA 1N32K 3ENBA 1M90O 1NGGA 3CFPA 4DSLA 3V1OA 1HYZA 3B8AX 4WQ4A 3M8RA 4FM1A 1JCFA 3E9LA 4FJ8A 4NYNA 3N4PA 4QS7A 3RSEA 2QWQA 3F73A 2JLEA 2OTJN 5HOOA 4BVOA 4FOEA 4DU1A 1GOBA 1CXUA 2P9PB 3OYFA 5KQDA 4CF9A 5AZJB 3VF2A 2GEMA 3DRSA 3KLFA 3HJFA 3FLCO
chains in the Genus database with same CATH topology
4KPYA 1TKTA 3AVLA 2FC0A 4F2SA 3C95A 3NGZA 4FM2A 2Z1HA 4FK4A 4PQUA 5K14A 1BL3A 2YNGA 1N6QA 4Z4GA 1Q8IA 3ITHA 3KKRA 3KLIA 4MFBA 4E0DA 1BISA 4KHSA 4N76A 1ZBLA 1QSSA 2Z1IA 1VSDA 3K5MA 4FLYA 2OPRA 3T3FA 3ZSRA 1IG9A 2P1JA 4IBNA 3VQ5A 2QKBA 3AVAA 3NGIA 1XC9A 4HTUA 4FJJA 3ULDA 2GV9A 3DMJA 3HP9A 4M3WA 1S1VA 3AVGA 3DLGA 3AO4A 3OS2A 3O4QA 3RRGA 4K8XA 1GOCA 3S9HA 3ZSYA 4KAZA 4ID5A 5E41A 3CFOA 4GMJB 4ELVA 1J54A 4J2EA 1J5OA 1WAJA 1HYVA 2Z1JA 1ZYQA 2HHVA 3ZT1A 4JS5A 4PUOA 1NK6A 1VSIA 3MEEA 4CEQA 3DLRA 4CHQA 3LWLA 4M41A 4DFKA 3WNGA 3U6FA 4Z4IA 1EX4A 1JLGA 2E4LA 2P5OA 3ZT3A 3L2VA 3ZT4A 4DU4A 4OKKA 2YNIA 3JSMA 3NHGA 4CJFA 3SCXA 5HRNA 2G8FA 3HPOA 4ELUA 1RTIA 1D5AA 4DSKA 4AHTA 2F96A 1KVAA 4DF8A 4CERA 5HRSA 3OY9A 4C8MA 3SQ1A 4MQ3A 4BDPA 1U4BA 2E6LA 1TAQA 2YNFA 3CYMA 3M8QA 4L8RB 1TAUA 3MXMA 4W5NA 2RPIA 2LSNA 3FFIA 3SUOA 1RT1A 2BE2A 4ID1A 3VQQA 3SNNA 3AO1A 4DQSA 3L2QA 4DQIA 4HCBA 3C94A 1G15A 3PX0A 3AVKA 1T05A 2DTUA 4DTMA 4NCGA 4CK1A 3O3GA 4KRFA 4M3UA 3O4NA 1TL1A 1C1CA 1Z25A 4O0IA 1JLAA 5J2NA 3NH1A 3K5LA 3BDPA 5JS1A 4JS4A 2KW4A 3KK3A 3TR8A 1RBRA 4K8ZA 1RT7A 4CK3A 4KB0A 1F21A 3RMAA 2G8UA 3KKSA 4W5OA 3SPYA 2X6NA 3K2PA 1Q9YA 3VQBA 4IFVA 5FRMA 3OYEA 3NH0A 1GOAA 2D0CA 3O3FA 4OVLA 3VQDA 2R7YA 1VSKA 5FRNA 4HHTA 1QQCA 4E7JA 1B9FA 5I3UA 1VRUA 2Z1GA 1NK8A 1W9HA 3WNHA 4FVMA 2HNZA 2ZD1A 3DLKA 3THVA 1IKVA 2PZSA 4IG3A 3TWHA 2AJQA 3HL8A 3TAQA 1NK4A 3E01A 1W0HA 4EP5A 3NBPA 3QINA 4CJ3A 4AHUA 2ETJA 2E6MA 3WNEA 2KZZA 4J2DA 1BQMA 4DTNA 1WSIA 4KTWA 4M3TA 3MXIA 1B92A 3SUPA 2BGGA 2KZMA 4CJRA 3D0PA 1U04A 2A1RA 4FLWA 3VA3A 1ASWA 1J9AA 4W5TA 1EKEA 3G10A 3MAQA 1NJYA 2ZE2A 1KFSA 5DK5A 4CHPA 5CY4A 3TI0A 4FJ5A 3NGYA 1U45A 4N47A 2YKNA 4B9LA 4FJGA 4KHWA 1T03A 3ZSVA 3A2FA 2NUBA 2VG7A 3S3MA 3SV4A 3IG1A 1XWLA 3DLHA 5KRTA 4M3YA 3NF9A 3L3VA 4N56A 1WLJA 1BI4B 4OKEA 3ZSZA 1KLNA 4C8LA 2B4JA 4FJXA 4CK2A 3TAMA 3SYZA 1WN7A 3AA3A 3OVNA 4CJUA 1BHLA 2G8KA 2IGIA 4CEBA 3K5OA 3SQ0A 3EZ5A 3OYGA 3V9XA 4CJ5A 4LY7A 1KFDA 1TVRA 2HHWA 4DSEA 1MU2A 4B08A 4OGCA 4CJLA 2FBTA 1BCMA 1VSFA 1WSFA 3VQ7A 4DTPA 2KTQA 4HVJA 3NF8A 2EX3A 2OPQA 3HSTB 3L2WA 4E7HA 4M3RA 4RG8A 1RTJA 4Z4EA 3I0RA 1KSPA 1ZBUA 2O4IA 4RW4A 4O44A 4CHZA 2HHXA 2X74A 1NK0A 1KVBA 4CJKA 1FKOA 3CQ8A 2ATQA 4LSNA 4CJTA 1UA0A 1REVA 3G0ZA 2OZSA 1FK9A 1L3VA 4FLZA 4EZ6A 4DQPA 4EP4A 3LAMA 1QS4A 4AHCA 3OYNA 2B5JA 3SV3A 2WONA 1TK8A 4FJ7A 3SJJA 4JLHA 3QEWA 4CGHA 4E19A 1NKCA 4KHUA 2QK9A 1HPZA 4DSJA 1D8YA 3RTVA 1QHTA 1A5VA 1C6VA 3K58A 4CGDA 2DY4A 1NKEA 1VSMA 3DRRA 4CGGA 3KJVA 5KRSA 3OJSA 4GW6A 3C6TA 4DQQA 4AILC 4C8OA 4FJKA 1I39A 3MECA 3VN5A 1HJRA 1ASVA 1FXXA 3HPGA 2FBYA 4LH5A 4CGFA 3B6OA 4CFDA 1Q9XA 3PV8A 4QCLA 1X9SA 2W42A 4Z4HA 3RWUA 4BACA 1CZ9A 1QE1A 3ISNC 2BDPA 4FJ9A 5CYMA 4CJSA 3V9WA 3OYKA 4F3TA 3AVIA 2HMIA 3L2RA 3U3GA 4FZZA 4FXDA 4CJPA 4DS4A 3RMDA 4DF4A 4CHNA 5KGXA 4DTSA 3AA5X 1C1BA 1BI4A 1JL1A 4CF0A 4B9TA 4DTRA 4W5RA 3NF7A 4HUGA 3AA2A 1SKRA 1A5XA 4GVMA 3B6PA 3HP6A 2I5JA 1X9MA 5HRPA 4W5QA 2XY6A 1RDDA 1VRTA 3CG7A 4CEZA 4B9SA 3AVJA 3BGRA 3OYBA 4CHYA 1RNHA 1S1TA 5SZTA 4KI6A 4KHQA 2XY5A 1YVUA 2VWKA 3OYMA 3V9ZA 3V4IA 4IG0A 1NK5A 1JLEA 4RW6A 4WE1A 5CYQA 1NKBA 3PO4A 4CJ4A 3SQ4A 3ALYA 4CE9A 4NYFA 4DLEA 3TAEA 4FW2A 2X6SA 4KTZA 5J2QA 1TK0A 3DLBA 1XI1A 3LZJA 1RT2A 1QTMA 4RW9A 4PA1A 2VG6A 3M8SA 3KTQA 1KVCA 1HNIA 1RBUA 3LPTA 3DRPA 1NJWA 4KREA 4KKOA 3NE6A 1U48A 1VSJA 4C8NA 3I0SA 1L3UA 4JRPA 1S5JA 5I42A 3ZSOA 1SL0A 3HK2A 4FCYA 3AVFA 2JGUA 2YHAA 2YHBA 4FZXC 3O3HA 2PYJA 1RDCA 3D45A 3PUFA 3CFRA 3QEVA 1HNVA 4CFCA 4FYDA 4B9NA 2OPSA 1QSYA 4E7LA 3KLHA 3OJUA 3OYAA 3JYTA 4KO0A 4B3OA 3EY1A 1TL3A 2DFHA 3AVNA 1FKPA 2IDOA 1B9DA 2YKMA 3LP1A 3M8PA 1Z26A 3ASMA 3EYZA 2XY8A 3NCIA 3QEIA 2RN2A 3HM9A 5CZ2A 1WSHA 2HW3A 1SUQA 1EETA 1DLOA 4M45A 1TKZA 2X78A 3QEXA 1LAWA 4B8AB 1ZBFA 3LP0A 1BIZA 1S9EA 4ZTJA 2YNHA 4DSFA 1JL2A 3QETA 5D3GA 3NH2A 1S6QA 2D0BA 1VK0A 5JS2A 4CF1A 2D5RA 4FW1A 4CJWA 4ZHRA 5C24A 5HLFA 1T8EA 4ELTA 1RILA 4FK2A 4Q0BA 1S1WA 1WAFA 3DOKA 4DQRA 1KLMA 4AHRA 2BANA 1VSLA 4FM0A 4Z4FA 4OJRA 3VQAA 3VQ8A 3P5JA 3ZCMA 5C25A 4G1QA 4QOZB 4KHYA 3IAYA 3HVTA 3V1RA 2HB5A 1SKWA 1TKDA 2D0AA 3TABA 1TKXA 4FLVA 4F8RA 4J2BA 5DMRA 2XHBA 1JLBA 2YV0X 1R0AA 2PYLA 4FJNA 2OZMA 3KD5E 1TK5A 1XHZA 1ASUA 4E1NA 3KK2A 1RDBA 1NOYA 4FJHA 1RCHA 4J2AA 1U49A 1RT6A 3AVBA 3KK1A 1BCOA 1Y97A 3V9SA 3SUNA 2XY7A 5SWMA 4I9LA 1NJZA 1L3SA 4B9UA 1S6PA 2FBVA 1RBTA 3PX4A 3CM6A 1NK7A 1IO2A 1RDAA 3OYIA 3L8BA 3TARA 4IKFA 5CZ1A 5HBMA 2VG5A 1A5WA 2F8SA 1D9DA 5EU7A 3AA4A 2OPPA 1BGXT 4DG1A 4I9QA 4KV8A 4QAGA 4KFBA 4RW8A 1D9FA 3PO5A 4KTQA 3VQ4A 1UWBA 1LWFA 1RT5A 4AHVA 2IAJA 4KB1A 1CXQA 2XRIA 4OPJA 3OYCA 2HHUA 1IKYA 1C1AA 4I7FA 3RRHA 1JLQA 3QO9A 4I2QA 1L3TA 4CGIA 1RBSA 2B6AA 4IDKA 4CF8A 3NDKA 1SL1A 1JXEA 2WOMA 3KLGA 1DTQA 2IC3A 4FJMA 3VQ6A 3HXMA 3I8DA 4FJLA 1S1XA 3KLEA 1YTUA 4CEDA 3K59A 1ZBHA 1BIUA 4CFBA 4B9VA 1TV6A 4O5BA 4DS5A 4H4MA 4Q5VA 1LW0A 3TANA 1L5UA 4O4GA 3ZSXA 4BE2A 4FJIA 4FK0A 4UQGA 4CEFA 1IKWA 3V81A 3LAKA 3QIPA 3SZ2A 4DFJA 1HQEA 1IKXA 3OS1A 4AH9A 4HCCA 3QNOA 1ITGA 3NFAA 1NJXA 1JXBA 4YNQA 2IOCA 4O0JA 3KIOA 5J2PA 3DM2A 1YTAA 1K6YA 3S3OA 3AVMA 2QXFA 4CEAA 4R5PA 4FZYA 4NCAA 3VQ9A 3AO2A 4E3SA 4E7IA 3IRXA 4CFAA 4H8KA 4DTJA 4CECA 2O4GA 3VQEA 4DWIA 4E89A 3T1AA 3VA0A 4RW7A 1VSHA 1RTHA 4CEEA 2KQ2A 3LPUA 1LAVA 3RMBA 4Y1CA 4B8CA 1C0MA 4CHOA 2Y1IA 4C8KA 2G8WA 4OLAA 3HPHA 3T19A 3QLHA 4HUEA 4E7KA 3TAFA 3V1QA 3OS0A 4DFMA 4E1MA 1UOCA 1IH7A 5KGWA 4DMNA 3LWMA 4DU3A 4N41A 3PY8A 1C0TA 4IFYA 1KRPA 2DFEA 4OLBA 3RMCA 3NAEA 2P51A 4FLUA 2ZQBA 3LALA 4M3XA 3MXJA 4F3OA 3HO1A 1YT3A 1BQNA 1HYSA 1C0UA 1WSJA 3SI6A 4Y1DA 1LV5A 5HRRA 4DTOA 3QNNA 1QSLA 4B9MA 3DOLA 1J53A 3NF6A 4OGEA 3ZT2A 2Q3SA 4LSLA 1HRHA 1RT3A 4LD0A 3L3UA 3VQCA 4DSIA 4Z4CA 3OYJA 4N5SA 1SL2A 4NCBA 5KI6A 4DTXA 5FROA 1WNSA 4DFPA 1DTTA 1KCFA 4F4KA 4DLGA 2RF2A 3K57A 4BE1A 3HT3A 3LP3A 5J2MA 3OYDA 2HNYA 4I2PA 5KTQA 3LZIA 1I3AA 3P83D 4CGJA 1HQUA 4CJQA 2A1SA 3MEDA 1S1UA 3DYAA 1LW2A 1KTQA 4TSXA 3CM5A 1RT4A 4CIGA 3QESA 5T7BA 3VQPA 4CJVA 4YFUA 1CLQA 1T7PA 1JLCA 3AO5A 2RKIA 4AHSA 4CF2A 4M42A 3ZT0A 3P1GA 3UIQA 3S3NA 4O55A 4H4OA 3TAGA 1UA1A 3C6UA 1X9WA 4BWJA 2QKKA 1LWEA 3OYHA 2F8TA 3IS9A 1RTDA 4OPKA 4EZ9A 1TGOA 2ITGA 4LH4A 5HP1A 4BDYA 1SV5A 2P5GA 2HVIA 4F2RA 3PX6A 4BWMA 3TAPA 4KI4A 2HNDA 2DFFA 3AVCA 3L2UA 2G8HA 3HYFA 2G8VA 1WSGA 1EP4A 1CZBA 3HVRA 1HMVA 1VSEA 4BE0A 4CIEA 4DTUA 4KHNA 3V6DA 2IS3A 1SKSA 4CJEA 3ZSQA 1JLFA 4CESA 3SPZA 4M3ZA 3K5NA 3LANA 2G8IA 2XO7A 2EHGA 2GUIA 4CEOA 1ZBIA 3DLEA 4JRQA 4FLTA 5FDLA 5HROA 2OA8A 1NK9A 2HHTA 3SQ2A 2HHQA 3LP2A 3MEGA 4CIFA 1X1PA 1S9GA 3KD1E 3V9UA 4ZTFA 4ICLA 2FBXA 3AVHA 3CFPA 1JKHA 1O1WA 4DSLA 3V1OA 1HYZA 1RBVA 3M8RA 3LDSA 4OKJA 1UAXA 4FM1A 4FJ8A 3OYLA 3DI6A 3F9KA 4NYNA 2PY5A 2GBZA 1EXQA 3AO3A 2Y1JA 1N5YA 3F73A 1WSEA 2JLEA 4HUFA 4PWDA 5C42A 4Z0UA 4XIUA 3H08A 3WNFA 1XHXA 2VWJA 1GOBA 4DU1A 1CXUA 3QERA 3OYFA 5J1EA 3RR7A 2OYQA 4PY5A 3ZSWA 4BDZA 4FLXA 4CF9A 3U3YA 4CCHA 3SUQA 3QIOA 3DRSA 3QEPA 2HVHA 2KFNA 2HHSA 1LWCA 3KLFA 1NOZA 3AV9A 1U47A 3RR8A 3HJFA 2KFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPY A;  1TKT A;  3AVL A;  2FC0 A;  4F2S A;  3C95 A;  3NGZ A;  4FM2 A;  2Z1H A;  4FK4 A;  4PQU A;  5K14 A;  1BL3 A;  2YNG A;  1N6Q A;  4Z4G A;  1Q8I A;  3ITH A;  3KKR A;  3KLI A;  4MFB A;  4E0D A;  1BIS A;  4KHS A;  4N76 A;  1ZBL A;  1QSS A;  2Z1I A;  1VSD A;  3K5M A;  4FLY A;  2OPR A;  3T3F A;  3ZSR A;  1IG9 A;  2P1J A;  4IBN A;  3VQ5 A;  2QKB A;  3AVA A;  3NGI A;  1XC9 A;  4HTU A;  4FJJ A;  3ULD A;  2GV9 A;  3DMJ A;  3HP9 A;  4M3W A;  1S1V A;  3AVG A;  3DLG A;  3AO4 A;  3OS2 A;  3O4Q A;  3RRG A;  4K8X A;  1GOC A;  3S9H A;  3ZSY A;  4KAZ A;  4ID5 A;  5E41 A;  3CFO A;  4GMJ B;  4ELV A;  1J54 A;  4J2E A;  1J5O A;  1WAJ A;  1HYV A;  2Z1J A;  1ZYQ A;  2HHV A;  3ZT1 A;  4JS5 A;  4PUO A;  1NK6 A;  1VSI A;  3MEE A;  4CEQ A;  3DLR A;  4CHQ A;  3LWL A;  4M41 A;  4DFK A;  3WNG A;  3U6F A;  4Z4I A;  1EX4 A;  1JLG A;  2E4L A;  2P5O A;  3ZT3 A;  3L2V A;  3ZT4 A;  4DU4 A;  4OKK A;  2YNI A;  3JSM A;  3NHG A;  4CJF A;  3SCX A;  5HRN A;  2G8F A;  3HPO A;  4ELU A;  1RTI A;  1D5A A;  4DSK A;  4AHT A;  2F96 A;  1KVA A;  4DF8 A;  4CER A;  5HRS A;  3OY9 A;  4C8M A;  3SQ1 A;  4MQ3 A;  4BDP A;  1U4B A;  2E6L A;  1TAQ A;  2YNF A;  3CYM A;  3M8Q A;  4L8R B;  1TAU A;  3MXM A;  4W5N A;  2RPI A;  2LSN A;  3FFI A;  3SUO A;  1RT1 A;  2BE2 A;  4ID1 A;  3VQQ A;  3SNN A;  3AO1 A;  4DQS A;  3L2Q A;  4DQI A;  4HCB A;  3C94 A;  1G15 A;  3PX0 A;  3AVK A;  1T05 A;  2DTU A;  4DTM A;  4NCG A;  4CK1 A;  3O3G A;  4KRF A;  4M3U A;  3O4N A;  1TL1 A;  1C1C A;  1Z25 A;  4O0I A;  1JLA A;  5J2N A;  3NH1 A;  3K5L A;  3BDP A;  5JS1 A;  4JS4 A;  2KW4 A;  3KK3 A;  3TR8 A;  1RBR A;  4K8Z A;  1RT7 A;  4CK3 A;  4KB0 A;  1F21 A;  3RMA A;  2G8U A;  3KKS A;  4W5O A;  3SPY A;  2X6N A;  3K2P A;  1Q9Y A;  3VQB A;  4IFV A;  5FRM A;  3OYE A;  3NH0 A;  1GOA A;  2D0C A;  3O3F A;  4OVL A;  3VQD A;  2R7Y A;  1VSK A;  5FRN A;  4HHT A;  1QQC A;  4E7J A;  1B9F A;  5I3U A;  1VRU A;  2Z1G A;  1NK8 A;  1W9H A;  3WNH A;  4FVM A;  2HNZ A;  2ZD1 A;  3DLK A;  3THV A;  1IKV A;  2PZS A;  4IG3 A;  3TWH A;  2AJQ A;  3HL8 A;  3TAQ A;  1NK4 A;  3E01 A;  1W0H A;  4EP5 A;  3NBP A;  3QIN A;  4CJ3 A;  4AHU A;  2ETJ A;  2E6M A;  3WNE A;  2KZZ A;  4J2D A;  1BQM A;  4DTN A;  1WSI A;  4KTW A;  4M3T A;  3MXI A;  1B92 A;  3SUP A;  2BGG A;  2KZM A;  4CJR A;  3D0P A;  1U04 A;  2A1R A;  4FLW A;  3VA3 A;  1ASW A;  1J9A A;  4W5T A;  1EKE A;  3G10 A;  3MAQ A;  1NJY A;  2ZE2 A;  1KFS A;  5DK5 A;  4CHP A;  5CY4 A;  3TI0 A;  4FJ5 A;  3NGY A;  1U45 A;  4N47 A;  2YKN A;  4B9L A;  4FJG A;  4KHW A;  1T03 A;  3ZSV A;  3A2F A;  2NUB A;  2VG7 A;  3S3M A;  3SV4 A;  3IG1 A;  1XWL A;  3DLH A;  5KRT A;  4M3Y A;  3NF9 A;  3L3V A;  4N56 A;  1WLJ A;  1BI4 B;  4OKE A;  3ZSZ A;  1KLN A;  4C8L A;  2B4J A;  4FJX A;  4CK2 A;  3TAM A;  3SYZ A;  1WN7 A;  3AA3 A;  3OVN A;  4CJU A;  1BHL A;  2G8K A;  2IGI A;  4CEB A;  3K5O A;  3SQ0 A;  3EZ5 A;  3OYG A;  3V9X A;  4CJ5 A;  4LY7 A;  1KFD A;  1TVR A;  2HHW A;  4DSE A;  1MU2 A;  4B08 A;  4OGC A;  4CJL A;  2FBT A;  1BCM A;  1VSF A;  1WSF A;  3VQ7 A;  4DTP A;  2KTQ A;  4HVJ A;  3NF8 A;  2EX3 A;  2OPQ A;  3HST B;  3L2W A;  4E7H A;  4M3R A;  4RG8 A;  1RTJ A;  4Z4E A;  3I0R A;  1KSP A;  1ZBU A;  2O4I A;  4RW4 A;  4O44 A;  4CHZ A;  2HHX A;  2X74 A;  1NK0 A;  1KVB A;  4CJK A;  1FKO A;  3CQ8 A;  2ATQ A;  4LSN A;  4CJT A;  1UA0 A;  1REV A;  3G0Z A;  2OZS A;  1FK9 A;  1L3V A;  4FLZ A;  4EZ6 A;  4DQP A;  4EP4 A;  3LAM A;  1QS4 A;  4AHC A;  3OYN A;  2B5J A;  3SV3 A;  2WON A;  1TK8 A;  4FJ7 A;  3SJJ A;  4JLH A;  3QEW A;  4CGH A;  4E19 A;  1NKC A;  4KHU A;  2QK9 A;  1HPZ A;  4DSJ A;  1D8Y A;  3RTV A;  1QHT A;  1A5V A;  1C6V A;  3K58 A;  4CGD A;  2DY4 A;  1NKE A;  1VSM A;  3DRR A;  4CGG A;  3KJV A;  5KRS A;  3OJS A;  4GW6 A;  3C6T A;  4DQQ A;  4AIL C;  4C8O A;  4FJK A;  1I39 A;  3MEC A;  3VN5 A;  1HJR A;  1ASV A;  1FXX A;  3HPG A;  2FBY A;  4LH5 A;  4CGF A;  3B6O A;  4CFD A;  1Q9X A;  3PV8 A;  4QCL A;  1X9S A;  2W42 A;  4Z4H A;  3RWU A;  4BAC A;  1CZ9 A;  1QE1 A;  3ISN C;  2BDP A;  4FJ9 A;  5CYM A;  4CJS A;  3V9W A;  3OYK A;  4F3T A;  3AVI A;  2HMI A;  3L2R A;  3U3G A;  4FZZ A;  4FXD A;  4CJP A;  4DS4 A;  3RMD A;  4DF4 A;  4CHN A;  5KGX A;  4DTS A;  3AA5 X;  1C1B A;  1BI4 A;  1JL1 A;  4CF0 A;  4B9T A;  4DTR A;  4W5R A;  3NF7 A;  4HUG A;  3AA2 A;  1SKR A;  1A5X A;  4GVM A;  3B6P A;  3HP6 A;  2I5J A;  1X9M A;  5HRP A;  4W5Q A;  2XY6 A;  1RDD A;  1VRT A;  3CG7 A;  4CEZ A;  4B9S A;  3AVJ A;  3BGR A;  3OYB A;  4CHY A;  1RNH A;  1S1T A;  5SZT A;  4KI6 A;  4KHQ A;  2XY5 A;  1YVU A;  2VWK A;  3OYM A;  3V9Z A;  3V4I A;  4IG0 A;  1NK5 A;  1JLE A;  4RW6 A;  4WE1 A;  5CYQ A;  1NKB A;  3PO4 A;  4CJ4 A;  3SQ4 A;  3ALY A;  4CE9 A;  4NYF A;  4DLE A;  3TAE A;  4FW2 A;  2X6S A;  4KTZ A;  5J2Q A;  1TK0 A;  3DLB A;  1XI1 A;  3LZJ A;  1RT2 A;  1QTM A;  4RW9 A;  4PA1 A;  2VG6 A;  3M8S A;  3KTQ A;  1KVC A;  1HNI A;  1RBU A;  3LPT A;  3DRP A;  1NJW A;  4KRE A;  4KKO A;  3NE6 A;  1U48 A;  1VSJ A;  4C8N A;  3I0S A;  1L3U A;  4JRP A;  1S5J A;  5I42 A;  3ZSO A;  1SL0 A;  3HK2 A;  4FCY A;  3AVF A;  2JGU A;  2YHA A;  2YHB A;  4FZX C;  3O3H A;  2PYJ A;  1RDC A;  3D45 A;  3PUF A;  3CFR A;  3QEV A;  1HNV A;  4CFC A;  4FYD A;  4B9N A;  2OPS A;  1QSY A;  4E7L A;  3KLH A;  3OJU A;  3OYA A;  3JYT A;  4KO0 A;  4B3O A;  3EY1 A;  1TL3 A;  2DFH A;  3AVN A;  1FKP A;  2IDO A;  1B9D A;  2YKM A;  3LP1 A;  3M8P A;  1Z26 A;  3ASM A;  3EYZ A;  2XY8 A;  3NCI A;  3QEI A;  2RN2 A;  3HM9 A;  5CZ2 A;  1WSH A;  2HW3 A;  1SUQ A;  1EET A;  1DLO A;  4M45 A;  1TKZ A;  2X78 A;  3QEX A;  1LAW A;  4B8A B;  1ZBF A;  3LP0 A;  1BIZ A;  1S9E A;  4ZTJ A;  2YNH A;  4DSF A;  1JL2 A;  3QET A;  5D3G A;  3NH2 A;  1S6Q A;  2D0B A;  1VK0 A;  5JS2 A;  4CF1 A;  2D5R A;  4FW1 A;  4CJW A;  4ZHR A;  5C24 A;  5HLF A;  1T8E A;  4ELT A;  1RIL A;  4FK2 A;  4Q0B A;  1S1W A;  1WAF A;  3DOK A;  4DQR A;  1KLM A;  4AHR A;  2BAN A;  1VSL A;  4FM0 A;  4Z4F A;  4OJR A;  3VQA A;  3VQ8 A;  3P5J A;  3ZCM A;  5C25 A;  4G1Q A;  4QOZ B;  4KHY A;  3IAY A;  3HVT A;  3V1R A;  2HB5 A;  1SKW A;  1TKD A;  2D0A A;  3TAB A;  1TKX A;  4FLV A;  4F8R A;  4J2B A;  5DMR A;  2XHB A;  1JLB A;  2YV0 X;  1R0A A;  2PYL A;  4FJN A;  2OZM A;  3KD5 E;  1TK5 A;  1XHZ A;  1ASU A;  4E1N A;  3KK2 A;  1RDB A;  1NOY A;  4FJH A;  1RCH A;  4J2A A;  1U49 A;  1RT6 A;  3AVB A;  3KK1 A;  1BCO A;  1Y97 A;  3V9S A;  3SUN A;  2XY7 A;  5SWM A;  4I9L A;  1NJZ A;  1L3S A;  4B9U A;  1S6P A;  2FBV A;  1RBT A;  3PX4 A;  3CM6 A;  1NK7 A;  1IO2 A;  1RDA A;  3OYI A;  3L8B A;  3TAR A;  4IKF A;  5CZ1 A;  5HBM A;  2VG5 A;  1A5W A;  2F8S A;  1D9D A;  5EU7 A;  3AA4 A;  2OPP A;  1BGX T;  4DG1 A;  4I9Q A;  4KV8 A;  4QAG A;  4KFB A;  4RW8 A;  1D9F A;  3PO5 A;  4KTQ A;  3VQ4 A;  1UWB A;  1LWF A;  1RT5 A;  4AHV A;  2IAJ A;  4KB1 A;  1CXQ A;  2XRI A;  4OPJ A;  3OYC A;  2HHU A;  1IKY A;  1C1A A;  4I7F A;  3RRH A;  1JLQ A;  3QO9 A;  4I2Q A;  1L3T A;  4CGI A;  1RBS A;  2B6A A;  4IDK A;  4CF8 A;  3NDK A;  1SL1 A;  1JXE A;  2WOM A;  3KLG A;  1DTQ A;  2IC3 A;  4FJM A;  3VQ6 A;  3HXM A;  3I8D A;  4FJL A;  1S1X A;  3KLE A;  1YTU A;  4CED A;  3K59 A;  1ZBH A;  1BIU A;  4CFB A;  4B9V A;  1TV6 A;  4O5B A;  4DS5 A;  4H4M A;  4Q5V A;  1LW0 A;  3TAN A;  1L5U A;  4O4G A;  3ZSX A;  4BE2 A;  4FJI A;  4FK0 A;  4UQG A;  4CEF A;  1IKW A;  3V81 A;  3LAK A;  3QIP A;  3SZ2 A;  4DFJ A;  1HQE A;  1IKX A;  3OS1 A;  4AH9 A;  4HCC A;  3QNO A;  1ITG A;  3NFA A;  1NJX A;  1JXB A;  4YNQ A;  2IOC A;  4O0J A;  3KIO A;  5J2P A;  3DM2 A;  1YTA A;  1K6Y A;  3S3O A;  3AVM A;  2QXF A;  4CEA A;  4R5P A;  4FZY A;  4NCA A;  3VQ9 A;  3AO2 A;  4E3S A;  4E7I A;  3IRX A;  4CFA A;  4H8K A;  4DTJ A;  4CEC A;  2O4G A;  3VQE A;  4DWI A;  4E89 A;  3T1A A;  3VA0 A;  4RW7 A;  1VSH A;  1RTH A;  4CEE A;  2KQ2 A;  3LPU A;  1LAV A;  3RMB A;  4Y1C A;  4B8C A;  1C0M A;  4CHO A;  2Y1I A;  4C8K A;  2G8W A;  4OLA A;  3HPH A;  3T19 A;  3QLH A;  4HUE A;  4E7K A;  3TAF A;  3V1Q A;  3OS0 A;  4DFM A;  4E1M A;  1UOC A;  1IH7 A;  5KGW A;  4DMN A;  3LWM A;  4DU3 A;  4N41 A;  3PY8 A;  1C0T A;  4IFY A;  1KRP A;  2DFE A;  4OLB A;  3RMC A;  3NAE A;  2P51 A;  4FLU A;  2ZQB A;  3LAL A;  4M3X A;  3MXJ A;  4F3O A;  3HO1 A;  1YT3 A;  1BQN A;  1HYS A;  1C0U A;  1WSJ A;  3SI6 A;  4Y1D A;  1LV5 A;  5HRR A;  4DTO A;  3QNN A;  1QSL A;  4B9M A;  3DOL A;  1J53 A;  3NF6 A;  4OGE A;  3ZT2 A;  2Q3S A;  4LSL A;  1HRH A;  1RT3 A;  4LD0 A;  3L3U A;  3VQC A;  4DSI A;  4Z4C A;  3OYJ A;  4N5S A;  1SL2 A;  4NCB A;  5KI6 A;  4DTX A;  5FRO A;  1WNS A;  4DFP A;  1DTT A;  1KCF A;  4F4K A;  4DLG A;  2RF2 A;  3K57 A;  4BE1 A;  3HT3 A;  3LP3 A;  5J2M A;  3OYD A;  2HNY A;  4I2P A;  5KTQ A;  3LZI A;  1I3A A;  3P83 D;  4CGJ A;  1HQU A;  4CJQ A;  2A1S A;  3MED A;  1S1U A;  3DYA A;  1LW2 A;  1KTQ A;  4TSX A;  3CM5 A;  1RT4 A;  4CIG A;  3QES A;  5T7B A;  3VQP A;  4CJV A;  4YFU A;  1CLQ A;  1T7P A;  1JLC A;  3AO5 A;  2RKI A;  4AHS A;  4CF2 A;  4M42 A;  3ZT0 A;  3P1G A;  3UIQ A;  3S3N A;  4O55 A;  4H4O A;  3TAG A;  1UA1 A;  3C6U A;  1X9W A;  4BWJ A;  2QKK A;  1LWE A;  3OYH A;  2F8T A;  3IS9 A;  1RTD A;  4OPK A;  4EZ9 A;  1TGO A;  2ITG A;  4LH4 A;  5HP1 A;  4BDY A;  1SV5 A;  2P5G A;  2HVI A;  4F2R A;  3PX6 A;  4BWM A;  3TAP A;  4KI4 A;  2HND A;  2DFF A;  3AVC A;  3L2U A;  2G8H A;  3HYF A;  2G8V A;  1WSG A;  1EP4 A;  1CZB A;  3HVR A;  1HMV A;  1VSE A;  4BE0 A;  4CIE A;  4DTU A;  4KHN A;  3V6D A;  2IS3 A;  1SKS A;  4CJE A;  3ZSQ A;  1JLF A;  4CES A;  3SPZ A;  4M3Z A;  3K5N A;  3LAN A;  2G8I A;  2XO7 A;  2EHG A;  2GUI A;  4CEO A;  1ZBI A;  3DLE A;  4JRQ A;  4FLT A;  5FDL A;  5HRO A;  2OA8 A;  1NK9 A;  2HHT A;  3SQ2 A;  2HHQ A;  3LP2 A;  3MEG A;  4CIF A;  1X1P A;  1S9G A;  3KD1 E;  3V9U A;  4ZTF A;  4ICL A;  2FBX A;  3AVH A;  3CFP A;  1JKH A;  1O1W A;  4DSL A;  3V1O A;  1HYZ A;  1RBV A;  3M8R A;  3LDS A;  4OKJ A;  1UAX A;  4FM1 A;  4FJ8 A;  3OYL A;  3DI6 A;  3F9K A;  4NYN A;  2PY5 A;  2GBZ A;  1EXQ A;  3AO3 A;  2Y1J A;  1N5Y A;  3F73 A;  1WSE A;  2JLE A;  4HUF A;  4PWD A;  5C42 A;  4Z0U A;  4XIU A;  3H08 A;  3WNF A;  1XHX A;  2VWJ A;  1GOB A;  4DU1 A;  1CXU A;  3QER A;  3OYF A;  5J1E A;  3RR7 A;  2OYQ A;  4PY5 A;  3ZSW A;  4BDZ A;  4FLX A;  4CF9 A;  3U3Y A;  4CCH A;  3SUQ A;  3QIO A;  3DRS A;  3QEP A;  2HVH A;  2KFN A;  2HHS A;  1LWC A;  3KLF A;  1NOZ A;  3AV9 A;  1U47 A;  3RR8 A;  3HJF A;  2KFZ A; 
#chains in the Genus database with same CATH topology
 3AVL A;  3C95 A;  1VHX A;  5C2D A;  4EAH D;  2ZJQ L;  2IVN A;  1Q8I A;  3KKR A;  5AQI A;  1X9J A;  3BP8 A;  1QSS A;  4OPH A;  1QQO A;  4FLY A;  2P9S B;  2OPR A;  3VEX A;  3ZSR A;  3AVA A;  1D4X A;  2GV9 A;  3R8E A;  1KXP A;  3WT0 A;  1S1V A;  3AVG A;  2E8A A;  5EOY A;  3OS2 A;  3VF4 A;  1GOC A;  3S9H A;  3H46 O;  4KAZ A;  5E41 A;  5M1Q A;  1J5O A;  1WAJ A;  1HYV A;  3AAR A;  4H0O A;  4PUO A;  1NK6 A;  4JKA A;  3U6F A;  1T3V A;  1MDU B;  2E4L A;  2P5O A;  3EN9 A;  3QBX A;  4DU4 A;  3NHG A;  3P38 A;  2VGN A;  2YCH A;  3HPO A;  3O80 A;  5BPL A;  3EEQ A;  4M7X A;  4FSV A;  4DHY A;  2E6L A;  4JK8 A;  1TAU A;  5TKW A;  3OBW A;  3FFI A;  4BVP A;  4CI6 A;  1RT1 A;  5GIO A;  1KC8 O;  4JKB A;  4CZE A;  4NCG A;  3O3G A;  1N8R O;  2P9P A;  3FZL A;  5IT9 O;  3SLC A;  1C1C A;  1BUP A;  5GAD P;  4JS4 A;  4KB0 A;  3I8B A;  3KKS A;  2UXD K;  3VQB A;  5FRM A;  3CF5 L;  3OYE A;  3RVC A;  3NH0 A;  3A5N C;  1VSK A;  5AQK A;  1HPM A;  2VWB A;  4K25 A;  1DEJ A;  1NK8 A;  1W9H A;  4RTF D;  2IVO A;  3FZH A;  2AJQ A;  1C0G A;  3HL8 A;  3E01 A;  2O8F A;  2AA4 A;  3O08 A;  5AQZ A;  3QIN A;  2ZGZ A;  2KZZ A;  4J2D A;  1YAG A;  4DTN A;  1WSI A;  4KTW A;  4M3T A;  3MXI A;  1W2B M;  3SUP A;  2UXB K;  4CJR A;  2A1R A;  4FWO A;  3VA3 A;  1DGK N;  1O13 A;  4DCH A;  3ZEU A;  3CXC M;  3S3M A;  4C8L A;  1S22 A;  1SAZ A;  2B4J A;  3EE9 A;  3SYZ A;  3AA3 A;  3BEX A;  1BHL A;  3SQ0 A;  3EZ5 A;  3V9X A;  2WC9 A;  4BC5 A;  5C2F A;  4K0K K;  1WBB A;  4WYB A;  4DSE A;  2P9I A;  3VTH A;  4WCE L;  1KD1 O;  4CJL A;  2FBT A;  1VSF A;  2KTQ A;  4DTP A;  3C6H A;  3NF8 A;  4Z4E A;  5BR9 A;  3J8A A;  3WUH A;  4Z94 A;  4RW4 A;  4O44 A;  2HHX A;  2X74 A;  4JKG A;  3VEO A;  4CJK A;  1FKO A;  4ILH A;  2ATQ A;  4U7B A;  1UA0 A;  1REV A;  2OZS A;  4JI5 K;  1ILY A;  4KBO A;  2A6A A;  3E9O A;  2ZGY A;  3ZX3 A;  2UUC K;  4JLH A;  4KHU A;  1VQ6 N;  2E1Z A;  4DSJ A;  1HNW K;  1D8Y A;  2DY4 A;  4CGD A;  1VSM A;  1KAZ A;  3VPZ A;  4GW6 A;  3C6T A;  4FJK A;  1V4S A;  1M1K O;  1I39 A;  3MEC A;  3HPG A;  1ASV A;  1FXX A;  4CFD A;  2W42 A;  5JVG L;  1MWM A;  1QE1 A;  3D2F B;  4KH4 A;  3OYK A;  3PIP L;  4LF8 K;  3TSQ A;  1HJO A;  4XEI A;  3SAF A;  3HOT A;  4DV2 K;  3R9P A;  5DM6 L;  4MLE A;  3CCM N;  4A62 A;  4H0V B;  2OCE A;  4A57 A;  4B9S A;  2QWR A;  3AVJ A;  3BGR A;  3OYB A;  5SZT A;  3O9R A;  4H0Y B;  3LDL A;  3CET A;  2WFB A;  4WE1 A;  3VGM A;  1ZXO A;  4CE9 A;  4Z4I A;  1XI1 A;  4JV5 K;  3LZJ A;  1RT2 A;  4PA1 A;  1LCU A;  4C23 A;  2VQE K;  2YHX A;  5AQP A;  3CC4 N;  4BG9 A;  3NE6 A;  4GVE A;  4CVN E;  4U67 L;  1XMQ K;  3P31 A;  4GKJ K;  1S5J A;  4FCY A;  2I7P A;  4FZX C;  2NNW A;  3O3H A;  3CFR A;  1HNV A;  4B9N A;  4HWI A;  3OJU A;  5LMN K;  3OYA A;  1XMO K;  4KO0 A;  3VEW A;  1FKP A;  3SNN A;  1B9D A;  1Z26 A;  3NCI A;  3UKR A;  2XY8 A;  2P9U A;  2BH1 A;  2QXL A;  4JI2 K;  1SUQ A;  1EET A;  4V19 S;  1DLO A;  5BRE A;  4M45 A;  4B8A B;  1YJW N;  1JL2 A;  1VAZ A;  1RFQ A;  1S6Q A;  1T6D A;  5GIP A;  1QQN A;  1OVQ A;  4CJW A;  2D5R A;  1T8E A;  1S1W A;  4BRP A;  2BAN A;  5C25 A;  2NRV A;  3IAY A;  1SKW A;  2QWL A;  3V1R A;  1TKX A;  4JKF A;  5AJ3 K;  3I33 A;  2ASP A;  1RDW X;  4J2B A;  2XHB A;  2PYL A;  5FPD A;  1XHZ A;  4E1N A;  3KK2 A;  1RCH A;  2P9K B;  3ENH A;  3KK1 A;  1Y97 A;  2XY7 A;  5SWM A;  1S6P A;  3FFK B;  1RBT A;  4AM7 A;  1NK7 A;  3L8B A;  3TAR A;  4IKF A;  4ISE A;  1LOT B;  3AA4 A;  2OPP A;  1BGX T;  4DG1 A;  3O1B A;  4KV8 A;  4I9Q A;  3U9Z A;  4BR2 A;  4OPJ A;  1IKY A;  3ID8 A;  2FF3 B;  2HMP A;  4RCH A;  1L3T A;  2UUB K;  4CFB A;  4DS5 A;  4O5F A;  1K8K B;  1EWQ A;  4Q5V A;  3TAN A;  1IKW A;  3V81 A;  3LAK A;  1W97 L;  4LFB K;  1HQE A;  3THY B;  3OS1 A;  4AH9 A;  3CCQ N;  2P9N B;  4H0P A;  4YNQ A;  1VQ8 N;  3AVM A;  1Z6R A;  2QXF A;  4X65 K;  4A2A A;  4E3S A;  4CFA A;  2WUS A;  2QWP A;  2O4G A;  5HL7 L;  4DWI A;  1RTH A;  4CEE A;  1NJI O;  4PKG A;  4B8C A;  3NMU A;  4B3T K;  5LY3 A;  4E1M A;  2E2O A;  3LDQ A;  1C0T A;  3SJH A;  3HSC A;  4M3X A;  3LAL A;  3HO1 A;  2P9K A;  4Y1D A;  5HRR A;  1X3M A;  4CZG A;  1QSL A;  1S72 N;  4LSL A;  3VQC A;  1U6Z A;  3L3U A;  2V7Y A;  1KCF A;  3OYD A;  3H1V X;  3WQT A;  1YJ9 N;  3LZI A;  3P83 D;  5AQY A;  4CJQ A;  1NG9 A;  2BUP A;  3MED A;  4YDU C;  3FZF A;  3L6Q A;  4TSX A;  3CM5 A;  4IO9 L;  3KK7 A;  3VQP A;  2FSK A;  2ZJR L;  1K8A O;  2V51 B;  3CCS N;  2RKI A;  4GKK K;  2O8E B;  1OVY A;  2E2P A;  3C6U A;  3L4Q A;  4YDU A;  5LJV A;  2F8T A;  1JJ2 M;  1RTD A;  5C10 A;  1YF5 L;  2P5G A;  4F2R A;  1K8K A;  3TAP A;  2HND A;  2YI1 A;  2G8H A;  1VQ5 N;  1WSG A;  4B1Z A;  4BE0 A;  3UKU A;  3THW B;  5AZI B;  4KHN A;  4WQ5 C;  1SKS A;  2QTD A;  2V52 B;  3KWG A;  3K5N A;  1Q86 O;  4JK9 A;  4BC2 A;  2GUI A;  3DLE A;  4JRQ A;  5HRO A;  2HHT A;  2HHQ A;  3LP2 A;  4NXM K;  3H3N O;  4WQ5 A;  4ICL A;  3AVH A;  1JKH A;  1BG3 A;  1UAX A;  3DI6 A;  3N4Q A;  2PY5 A;  2GEL A;  1N5Y A;  3MMV A;  1WSE A;  1WUA A;  4HUF A;  5C42 A;  4ILG B;  1ESV A;  4NB4 A;  3C7N A;  5J1E A;  3ZSW A;  4FLX A;  3T7Z A;  5A2Q O;  3U3Y A;  3SUQ A;  2HVH A;  4XH1 A;  1U47 A;  3Q7B A;  2ZJP L;  4KPY A;  2FC0 A;  4F2S A;  3NGZ A;  4C1N I;  4FM2 A;  1HKG A;  1N6Q A;  4Z4G A;  1GLE G;  3ITH A;  1BIS A;  3MN6 A;  1ZBL A;  1FW6 A;  5AQL A;  4JD2 B;  2P1J A;  3VQ5 A;  1XC9 A;  3MN9 A;  4FJJ A;  1I94 K;  3CJB A;  3CJ9 A;  3DMJ A;  3HP9 A;  3M6G A;  4BRD A;  2O8E A;  3E9P A;  3MWP A;  1XUP O;  2YJF A;  3DLG A;  4MLH A;  3O4Q A;  3ZSY A;  1YVN A;  4ID5 A;  4BR7 A;  4IOC L;  1OH5 A;  3OBY A;  1J54 A;  1GLD G;  4J2E A;  3JXU A;  2VCP A;  3ZT1 A;  4JS5 A;  3DLR A;  4FWK A;  4MDA A;  3HRG A;  5AZI A;  4AQY K;  4I6M B;  2YNI A;  4OKK A;  2H3G X;  3JSM A;  3J7Y P;  3SCX A;  5HRN A;  1Y64 A;  2F4V K;  4DSK A;  1D5A A;  2F96 A;  5HRS A;  1NGA A;  4C8M A;  1EWR A;  1HKB A;  4MQ3 A;  3VOV A;  4WF9 L;  1XQS C;  4BDP A;  1TAQ A;  3CCL N;  4L8R B;  1U2V B;  2YJE A;  2LSN A;  3VEN A;  4HCB A;  2BE2 A;  5GIN A;  4DQS A;  3L2Q A;  1G15 A;  3AVK A;  4DTM A;  4KRF A;  3ATV A;  3UB5 A;  3O4N A;  5AFU H;  1TL1 A;  1VQ7 N;  3SMP A;  1JLA A;  1RGI A;  3K5L A;  3BDP A;  5JS1 A;  3KK3 A;  1RBR A;  4K8Z A;  5AQN A;  4CK3 A;  4KH6 A;  2G8U A;  1IV0 A;  3TSU A;  2X6N A;  4IFV A;  3LDP A;  3P4I A;  4M7Y A;  3O3F A;  4OVL A;  4MDB A;  5I3U A;  1VQ9 N;  4JN4 A;  2CGJ A;  4JD2 A;  2PZS A;  1GLC G;  3G4S N;  4FWM A;  5FPE A;  3TAQ A;  1NK4 A;  2W40 A;  1W0H A;  3NBP A;  2PAV A;  2NRZ A;  3GL1 A;  2E6M A;  1QZ6 A;  1BQM A;  1B92 A;  3D0P A;  1U04 A;  3A5M C;  1ASW A;  1EKE A;  2F7T A;  3G10 A;  5DK5 A;  4CHP A;  5CY4 A;  4FJ5 A;  3CJA A;  4NXN K;  3TPQ A;  4N47 A;  5BRH A;  2YKN A;  1U45 A;  4FJG A;  2UU9 K;  3R3L A;  3ZSV A;  3A2F A;  4BRC A;  2VG7 A;  4N56 A;  1WLJ A;  3L4I A;  4OKE A;  3CJ7 A;  5AQV A;  1E4F T;  3WQU A;  2FLO A;  4CK2 A;  4BRF A;  4CJU A;  3K9J A;  3OYG A;  1BCM A;  1WSF A;  3HST B;  4GY2 B;  4LF9 K;  3I0R A;  2KKZ A;  2O4I A;  3MX2 A;  5AQT A;  1Q18 A;  3SAH A;  1QVG M;  2F9W A;  4CJT A;  4FWN A;  4FLZ A;  4DQP A;  4EP4 A;  5KPT A;  4LF4 K;  4JKE A;  3OYN A;  2B5J A;  4FJ7 A;  3SJJ A;  3VET A;  1NKC A;  2QK9 A;  5F1X A;  1HPZ A;  3VEZ A;  3CJC A;  3KJV A;  3G6E N;  2Q31 A;  3ID6 A;  3VN5 A;  3CQY A;  4CGF A;  2FBY A;  3DXM A;  3B6O A;  1Q9X A;  3PV8 A;  3LL3 A;  1NWK A;  4Z4H A;  3RWU A;  2KHO A;  1HUX A;  4EHU A;  2BDP A;  5CYM A;  4CJS A;  2HMI A;  5ADX A;  1BWF O;  3WXI A;  3OA9 A;  3AA5 X;  4CW7 B;  4B9T A;  4DTR A;  3NF7 A;  4HUG A;  2ZF5 O;  1NLV A;  1Z05 A;  3B6P A;  5HRP A;  3AGK A;  4W5Q A;  2QM1 A;  1RDD A;  4CEZ A;  4DKW A;  4B9Q A;  4KI6 A;  3TSP A;  4ILJ A;  4DR7 K;  2XY5 A;  1YVU A;  3R1X A;  3ZYY X;  4IG0 A;  5AZJ A;  4RW6 A;  3U4L A;  1XNQ K;  5FPM A;  4YOV A;  4NYF A;  4DLE A;  3TAE A;  3DLB A;  2X6S A;  3G71 N;  4IJN A;  2VG6 A;  3KTQ A;  3LPT A;  3TTC A;  3DRP A;  1NJW A;  4KRE A;  4KKO A;  1JCG A;  1U48 A;  4YOW A;  2GX9 A;  2P9S A;  1YIT N;  3I0S A;  1QVF M;  5JIC A;  3AVF A;  2JGU A;  3D45 A;  2O8C B;  2OPS A;  5GAG P;  4BRA A;  3AVN A;  3QDK A;  3LP1 A;  3QFU A;  1C0F A;  3IKM A;  5CZ2 A;  1BO5 O;  1WSH A;  3FZK A;  3M3Z A;  4EFH A;  1IG8 A;  1VQ4 N;  2ZWH A;  3CCR N;  1S9E A;  1WOQ A;  4DSF A;  1VK0 A;  4CF1 A;  4FW1 A;  4BR0 A;  4FK2 A;  3L0Q A;  4L3Q A;  4BQL A;  3CER A;  3DOK A;  2QW9 A;  4FM0 A;  4Z4F A;  4OJR A;  1E3M A;  1EQY A;  3P39 A;  4KHY A;  3A8Y A;  2HB5 A;  1TKD A;  3TAB A;  1DKG D;  1JLB A;  1TK5 A;  1ASU A;  4HTL A;  1RDB A;  4FJH A;  4BGB A;  1RT6 A;  1NJZ A;  3O4W A;  5GAH P;  1YXQ A;  2FSN A;  3UE5 A;  2FBV A;  4M63 C;  4JI1 K;  3PX4 A;  4GNI A;  4CD1 A;  4GV3 A;  2QWO A;  1RDA A;  4BRH A;  3EKU A;  2Q97 A;  1D9F A;  4QAG A;  1KQS M;  3H6E A;  4XH5 A;  1UWB A;  4NLB A;  4PHT X;  2HHU A;  3WXM B;  1C1A A;  3J7Z O;  1JLQ A;  3D7E O;  1MA9 B;  3DWL A;  3MN5 A;  4GV6 A;  2VQF K;  2B6A A;  4CF8 A;  3NDK A;  4IOX A;  2WOM A;  4J8F A;  3HXM A;  4FJL A;  1YTU A;  3K59 A;  2UXC K;  4QS8 A;  4O4G A;  4KH5 A;  2HBK A;  3A5L C;  1N34 K;  1NGJ A;  2IOC A;  3DM2 A;  4ISG A;  1YTA A;  3S3O A;  4PKH A;  2FF6 A;  4CEA A;  3VF6 A;  5AQU A;  3AO2 A;  4E7I A;  3T1A A;  1LAV A;  4DV5 K;  2Y1I A;  4JI0 K;  4CHO A;  4C8K A;  4OLA A;  5M1O A;  4HUE A;  1K73 O;  4CZJ A;  4DFM A;  4DV7 K;  1UOC A;  4BR5 A;  4N41 A;  3F5T A;  3CC2 N;  2OTL N;  1HNX K;  2DFE A;  1KRP A;  4FLU A;  2P51 A;  1YT3 A;  1BQN A;  3PSF A;  1LV5 A;  3QML A;  1J53 A;  3NF6 A;  4FPB A;  4CZM A;  4FWR A;  1HRH A;  4JYA K;  4Z4C A;  4N5S A;  5FRO A;  2E20 A;  3LP3 A;  5J2M A;  3LDN A;  2HNY A;  4I2P A;  4CGJ A;  1HQU A;  2A1S A;  1X3N A;  1RT4 A;  1W7A A;  5JLH A;  3VTI A;  1CLQ A;  3IMX A;  3ZT0 A;  3TAG A;  1IBL K;  1X9W A;  2QKK A;  4G9Z A;  4CBU A;  4EZ9 A;  1TGO A;  2HBJ A;  3PX6 A;  4BWM A;  4KI4 A;  2GTD A;  2DFF A;  3HYF A;  2G8V A;  3D2F A;  1CZB A;  1HMV A;  5JMV A;  4CIE A;  4JI8 K;  1BDG A;  4CJE A;  4M3Z A;  3AAQ A;  3SPZ A;  3D2E B;  2XO7 A;  1ZBI A;  2OA8 A;  5EVZ A;  4JI6 K;  4CIF A;  1X1P A;  3KD1 E;  3O8M A;  4ZTF A;  3IUC A;  2FBX A;  1VQM N;  4YOY A;  1O1W A;  1RBV A;  2NRX A;  2BTF A;  5AQJ A;  3LDS A;  2V7Z A;  3VGK A;  3OYL A;  2GBZ A;  3MCP A;  2Y1J A;  4PWD A;  2VWJ A;  3QER A;  3BZK A;  3RR7 A;  4BR4 A;  4PY5 A;  3CD6 N;  4BDZ A;  3KWI A;  4CCH A;  3KZB A;  3QIO A;  4KHP K;  2KFN A;  4CBW A;  1LWC A;  1NOZ A;  3AV9 A;  4FWS A;  3IDH A;  1VQL N;  3RR8 A;  1K9M O;  5EXW A;  2KFZ A;  2CGL A;  2Q2R A;  4FK4 A;  5K14 A;  2YNG A;  3CPW M;  1SQK A;  3KLI A;  4KHS A;  4JEP A;  4N76 A;  4B1X B;  1VSD A;  3K5M A;  2QKB A;  3H3O B;  4M3W A;  2JWL A;  1HX1 A;  2QA4 N;  5LL6 Z;  4K8X A;  3VEY A;  5AQQ A;  3ULE B;  3JAM O;  4ELV A;  2NZT A;  5BPN A;  2HHV A;  1ZYQ A;  2E88 A;  2QWN A;  2P9L B;  3T69 A;  1NGC A;  1VSI A;  3HBT A;  3MEE A;  3DJC A;  4CHQ A;  4M41 A;  5I9E B;  3WNG A;  4IO8 A;  2ZM6 K;  3ZT4 A;  3H45 C;  4OO1 J;  3ZET B;  3D2E A;  3TTD A;  1TUY A;  4ELU A;  1RTI A;  1NGD A;  3SQ1 A;  4DF8 A;  4CER A;  3OY9 A;  1T44 A;  1T6C A;  1U4B A;  3M8Q A;  3CYM A;  3E1Y A;  1TYQ B;  4W5N A;  2RPI A;  3VQQ A;  4NO7 A;  3AO1 A;  1S3X A;  1NGI A;  3PX0 A;  3D6R A;  1KAY A;  4M3U A;  1BA0 A;  4R79 A;  4X64 K;  1Z25 A;  5J2N A;  3NH1 A;  4BC4 A;  1RT7 A;  3ENO A;  3RMA A;  4W5O A;  3K2P A;  1Q9Y A;  4IZ9 A;  4B1V A;  3F9M A;  1GOA A;  2D0C A;  5IWA K;  3CMA N;  5FRN A;  4E7J A;  1QQC A;  5TKY A;  5MLC Q;  1VRU A;  2Z1G A;  1GLJ O;  3WNH A;  4CZK A;  2QEX N;  4FVM A;  3CCU N;  3DLK A;  2ZD1 A;  1IKV A;  3TWH A;  4H5R A;  5F2R A;  3I55 N;  2GWK A;  4FO0 A;  4AHU A;  3THY A;  2ETJ A;  3JS6 A;  2P9N A;  2BGG A;  3MAQ A;  2HBL A;  4FVU A;  1KFS A;  1NNE A;  3TI0 A;  5AR0 A;  3NGY A;  4KHW A;  4BRE A;  4DR2 K;  2NUB A;  3IG1 A;  4B3S K;  1XWL A;  3DLH A;  3ZSZ A;  4FJX A;  4DQ8 A;  3TAM A;  3ZET A;  1WN7 A;  4LFC K;  2G8K A;  4FWL A;  4CEB A;  2A3Z A;  3K5O A;  4CBX A;  1N36 K;  4CJ5 A;  4LY7 A;  2HHW A;  2WTU A;  2NRT A;  5FLX O;  4OGC A;  3VQ7 A;  2CH6 A;  5F0X A;  3K0S A;  4HVJ A;  4A2B A;  3THX B;  1MWK A;  4E7H A;  4M3R A;  1RTJ A;  1H1V A;  1KSP A;  3BF1 A;  1FJG K;  1NK0 A;  2NRH A;  3TTF A;  1FK9 A;  1TUU A;  3LAM A;  1QS4 A;  4AHC A;  2WON A;  4DV0 K;  1KAX A;  4IXC A;  3BY5 A;  4CGH A;  3QEW A;  1OH8 A;  3DLL L;  3HM8 A;  2VGM A;  5KQ8 A;  4UY8 O;  3K58 A;  3DRR A;  4CGG A;  5KRS A;  3T1Y K;  4DQQ A;  3GBT A;  4AIL C;  4C8O A;  1JCE A;  1HJR A;  4B1W B;  3THW A;  2HST A;  4QCL A;  1X9S A;  3LM9 A;  4BRO A;  2QWM A;  2RHK A;  4A5A A;  3W0L A;  3SAG A;  4F3T A;  4CJP A;  4DS4 A;  3RMD A;  3CQX A;  4CHN A;  3ZLJ A;  1C1B A;  4MO5 A;  1JL1 A;  3AA2 A;  1SKR A;  1A5X A;  4GVM A;  4PL8 A;  2I5J A;  1X9M A;  2XY6 A;  3C0B A;  3CG7 A;  3ZX2 A;  2ASM A;  4FL9 A;  1RNH A;  3RSE B;  3OYM A;  3SBG A;  3V4I A;  3THX A;  1JLE A;  5CYQ A;  1NKB A;  5E84 A;  1Q7Y O;  3ALY A;  2ITM A;  2WBN A;  4FW2 A;  4RW9 A;  2YX6 A;  1KVC A;  1RBU A;  1VSJ A;  1L3U A;  4JRP A;  1ATR A;  5I42 A;  3EL2 A;  1WB9 A;  3HK2 A;  2YHA A;  2AP1 A;  2YHB A;  4K42 A;  4DUZ K;  1RDC A;  3PIO L;  2J4R A;  4CFC A;  4E7L A;  3KLH A;  3JYT A;  2A5X A;  2YKM A;  2IDO A;  4CZH A;  3QEI A;  1NBW A;  3ASM A;  4B1U B;  3FZM A;  2RN2 A;  3HM9 A;  2HOE A;  5B8H A;  2HW3 A;  5AQR A;  2E5L K;  1BIZ A;  3M5R A;  5BRF A;  4ZTJ A;  5AQF A;  3QET A;  4I6M A;  2D0B A;  3G25 A;  3SK3 A;  2NRW A;  1EO1 A;  4ELT A;  4Q0B A;  1WAF A;  4K41 A;  1KLM A;  4AHR A;  3S41 A;  3VQA A;  3VQ8 A;  3P5J A;  4QOZ B;  4G1Q A;  3HVT A;  2D0A A;  1U2V A;  2NRR A;  3AY9 A;  5DMR A;  2YV0 X;  1R0A A;  4FJN A;  1G99 A;  3KD5 E;  3CME N;  1U49 A;  4YOX A;  3AVB A;  3V9S A;  1BCO A;  3GE1 A;  3SUN A;  3WXK A;  1L3S A;  3CM6 A;  3OYI A;  2VG5 A;  2F9T A;  4H0T B;  2EWS A;  1D9D A;  5BRD A;  3VQ4 A;  1LWF A;  1RT5 A;  4AHV A;  2IAJ A;  4JKD A;  3OYC A;  1CZA N;  1J6Z A;  3E66 A;  3QO9 A;  3BUZ B;  1SS6 A;  4CZF A;  3K9K A;  4F9O A;  1VQO N;  1JXE A;  2IC3 A;  3QBW A;  3VQ6 A;  4YOU A;  2HF4 A;  1YJN N;  1ZBH A;  5AQX A;  4B9V A;  1L5U A;  3ZSX A;  4FJI A;  4FK0 A;  2O8F B;  4CEF A;  1N33 K;  3QIP A;  3SZ2 A;  4DFJ A;  4DR4 K;  3VER A;  1IKX A;  5AQM A;  4HCC A;  1NGH A;  1ITG A;  4IWV A;  3NFA A;  1NJX A;  1JXB A;  3KIO A;  5J2P A;  3KHY A;  3CCV N;  4NCA A;  3EZW A;  3VQ9 A;  2D0O A;  3IRX A;  4LF6 K;  4DTJ A;  4H5T A;  2CGK A;  3ZEU B;  4RW7 A;  4BRI A;  4WFB L;  3O1W A;  2D4W A;  1P90 A;  2G8W A;  2QI2 A;  3QLH A;  2RE2 A;  3T19 A;  4E7K A;  3OS0 A;  3OW2 M;  3TAF A;  4JI7 K;  5C12 A;  1BA1 A;  4LC9 B;  3PY8 A;  4IFY A;  4OLB A;  4OPA A;  5CR4 A;  5LJW A;  2ZQB A;  3LM2 A;  3MXJ A;  4F3O A;  2P9I B;  1BU6 O;  1C0U A;  1WSJ A;  3SI6 A;  2GWJ A;  3WXL A;  3QNN A;  3ZT2 A;  2Q3S A;  1RT3 A;  3A0I X;  4X62 K;  3OYJ A;  5KI6 A;  4DTX A;  4A59 A;  3J80 O;  1ZC6 A;  5BN8 A;  4LFA K;  4DLG A;  2RF2 A;  4BE1 A;  3J81 O;  4JKG B;  1R59 O;  1I3A A;  3NVM A;  3DYA A;  1KTQ A;  4CIG A;  3QES A;  4JI3 K;  4CJV A;  3AO5 A;  4AHS A;  4M42 A;  3P1G A;  3C65 A;  3UIQ A;  3R6M A;  5E26 A;  3S3N A;  4BWJ A;  3OYH A;  4CD3 A;  3IS9 A;  5C15 A;  5HP1 A;  4BDY A;  1SV5 A;  2HVI A;  1HLU A;  1YIJ N;  4RWT A;  3AVC A;  4BRL A;  3L2U A;  3HVR A;  4X66 K;  1VSE A;  4H5N A;  4DTU A;  3V6D A;  4H5W A;  1JLF A;  2EHG A;  2A42 A;  5FDL A;  2O8D B;  1S9G A;  5AQH A;  3V9U A;  1YHQ N;  4O8U A;  4OKJ A;  1Q82 O;  2HF3 A;  3F9K A;  3MK6 A;  1EXQ A;  3AO3 A;  3VMF B;  4XIU A;  4Z0U A;  3Q7C A;  4XH4 A;  5AQG A;  3WNF A;  2CH5 A;  3H08 A;  1XHX A;  2PBD A;  4Y0W A;  1E4G T;  2I7N A;  2OYQ A;  3VES A;  3CI5 A;  3QEP A;  3CPE A;  2HHS A;  2FSJ A;  2NLX A;  3O5B A;  3SBT A;  3GDQ A;  1TKT A;  4IOA L;  2Z1H A;  4PQU A;  1BL3 A;  2YHY A;  4MFB A;  4E0D A;  1ATS A;  1VQN N;  4AM6 A;  2Z1I A;  4DB3 A;  2O8C A;  5CE3 A;  3T3F A;  2W6K A;  1IG9 A;  4DR5 K;  4IBN A;  3NGI A;  1OKJ A;  1HKC A;  4MO4 A;  4HTU A;  3ULD A;  3LDO A;  4BGA A;  3T1H K;  3AO4 A;  5H1S Q;  3RRG A;  4YOT A;  3W3D A;  3CFO A;  5EX5 A;  4H0X B;  4GMJ B;  3IFR A;  3UKR B;  4BQZ A;  4IJA A;  2P9U B;  2Z1J A;  4CEQ A;  3LWL A;  4DFK A;  3PLA A;  1EX4 A;  1JLG A;  3ZT3 A;  3L2V A;  3DXK B;  4CJF A;  3U8X A;  2G8F A;  3FE1 A;  2E2N A;  1BOT O;  4AHT A;  1KVA A;  2O8D A;  2JWK A;  2YNF A;  2HBM A;  1QHA A;  3MXM A;  3FR0 A;  3SUO A;  4DQI A;  4ID1 A;  4JI4 K;  5BN9 A;  3EE8 A;  3C94 A;  1T05 A;  2DTU A;  4IEE A;  4CK1 A;  2Q1N A;  3CIP A;  3HOS A;  4O0I A;  4CZI A;  4DR3 K;  2KW4 A;  3TR8 A;  5BPM A;  1F21 A;  5AFU A;  3CHW A;  4DV4 K;  4FPA A;  3SPY A;  3PSI A;  3DAW A;  3WEE B;  4YOR A;  2R7Y A;  3VQD A;  5JVH L;  1NMD A;  4HHT A;  1B9F A;  1HR0 K;  2HNZ A;  3THV A;  4WFN L;  1NMN A;  4IG3 A;  4JK7 A;  1XNR K;  5BR8 K;  1NGF A;  4EP5 A;  5M1K A;  4FWP A;  4CJ3 A;  3WNE A;  4DV6 K;  2KZM A;  2A40 A;  3O9U A;  4FLW A;  1J9A A;  4W5T A;  1NGB A;  1NJY A;  2ZE2 A;  2GUP A;  5KPR A;  3O9S A;  4B9L A;  5GAE P;  1T03 A;  4BY9 C;  5LMU K;  3SV4 A;  5KRT A;  4M3Y A;  3NF9 A;  3L3V A;  3DXK A;  1KLN A;  1BI4 B;  4PL7 A;  3CC7 N;  3HZ6 A;  3OVN A;  1NM1 A;  2IGI A;  2O8B B;  1KFD A;  1TVR A;  1IBM K;  4EIA A;  3QB0 A;  1MU2 A;  4B08 A;  1YI2 N;  1VQP N;  1ZBS A;  5AQO A;  3VGL A;  1GLL O;  2EX3 A;  2OPQ A;  3L2W A;  2FXU A;  4RG8 A;  1ZBU A;  2W41 A;  3O6W A;  1QQM A;  4CHZ A;  2IIR A;  3AAP A;  2Q36 A;  1KVB A;  3CQ8 A;  3NVK A;  4LSN A;  3G0Z A;  2ASO A;  1L3V A;  4EZ6 A;  2W6L A;  1IBK K;  4B3R K;  3WEE A;  3SV3 A;  3QFP A;  3OTO K;  1TK8 A;  4EHT A;  4BR9 A;  4E19 A;  3RTV A;  1QHT A;  1C6V A;  1A5V A;  1NKE A;  4AF1 A;  4JHD B;  3OJS A;  1Q81 O;  4LF7 K;  4LH5 A;  5ADX H;  2VYP A;  4BAC A;  1CZ9 A;  3ISN C;  4FJ9 A;  4H03 B;  3V9W A;  3UKU B;  3AVI A;  3O9Q A;  3L2R A;  3U3G A;  4FZZ A;  4FXD A;  1ATN A;  5C0Y A;  4PKI A;  5KPZ A;  4DF4 A;  4CJ7 A;  5KGX A;  3OHR A;  4DTS A;  3H1Q A;  1BI4 A;  5CHI A;  3AGR A;  4CF0 A;  3EKS A;  4W5R A;  3HP6 A;  2Q0U A;  3MN7 A;  2O8B A;  1VRT A;  4CHY A;  1SZ2 A;  1S1T A;  1YUW A;  4KHQ A;  5AQS A;  1J5E K;  2VWK A;  4DV1 K;  2YHW A;  3V9Z A;  1NK5 A;  1OH6 A;  1WBD A;  3PO4 A;  1DT9 A;  3C7N B;  4CJ4 A;  3SQ4 A;  4KTZ A;  5J2Q A;  1TK0 A;  2DPN A;  1QTM A;  1GLA G;  4IFE A;  3M8S A;  1RDU A;  4OX9 K;  1HNI A;  5FPN A;  5ELZ A;  4C8N A;  1SL0 A;  1P8Z A;  3ZSO A;  3HTV A;  4BC3 A;  2PYJ A;  3PUF A;  3HI0 A;  3QEV A;  3MDQ A;  4FYD A;  1QSY A;  4K43 A;  4B3O A;  3EY1 A;  1TL3 A;  2DFH A;  3ULE A;  3M8P A;  3EYZ A;  2HHH K;  3CCE N;  3KVG A;  4JHD A;  2P9L A;  5JLF A;  3ZX0 A;  4BRN A;  1TKZ A;  2X78 A;  3QEX A;  4B1Y B;  1LAW A;  1ZBF A;  3LP0 A;  1XC3 A;  4BRG A;  2YNH A;  5D3G A;  3NH2 A;  5JS2 A;  3SMS A;  4ZHR A;  5C24 A;  5HLF A;  1IJJ A;  1RIL A;  3O9T A;  4QS9 A;  4DQR A;  1VSL A;  1NGE A;  3ZCM A;  3F2K A;  1TYQ A;  1GLB G;  4F8R A;  4FLV A;  5AQW A;  3GG4 A;  4O8K A;  3WXJ A;  3I56 N;  2OZM A;  1NOY A;  2Q0R A;  4J2A A;  4I9L A;  4B9U A;  1QZ5 A;  1IO2 A;  4IEI A;  5CZ1 A;  5HBM A;  1A5W A;  4YY3 K;  2F8S A;  5M1N A;  4BRQ A;  2KLA A;  5EU7 A;  3PO5 A;  4KFB A;  4RW8 A;  4KTQ A;  4E1J A;  4KB1 A;  1CXQ A;  2XRI A;  4I7F A;  3RRH A;  3MX5 A;  4I2Q A;  4CGI A;  3ATU A;  1RBS A;  4IDK A;  1SL1 A;  3TU5 A;  4JNE A;  3KLG A;  1DTQ A;  4FJM A;  4FWQ A;  3I8D A;  1S1X A;  3KLE A;  4CED A;  1BIU A;  4YHH K;  1TV6 A;  4O5B A;  3GOI A;  4H4M A;  1LW0 A;  4BRM A;  4BE2 A;  4UQG A;  2UUA K;  3QNO A;  4O0J A;  2UYT A;  3C6A A;  1K6Y A;  3A5O C;  4JKH A;  4R5P A;  4FZY A;  5M1F A;  5EY4 A;  4H8K A;  4CEC A;  3VQE A;  4E89 A;  3VEV A;  3VA0 A;  1VSH A;  2KQ2 A;  3LPU A;  3RMB A;  4Y1C A;  1C0M A;  3HPH A;  2PFU A;  3V1Q A;  2IVP A;  4WFA L;  3CJ1 A;  1IH7 A;  3M1F A;  5KGW A;  2D1K A;  4DMN A;  3LWM A;  4DU3 A;  3J7A P;  3RMC A;  3NAE A;  1HYS A;  1GLF O;  4BRK A;  3EO3 A;  4DTO A;  4B9M A;  4DV3 K;  3DOL A;  4A61 A;  2D0P A;  4OGE A;  4A5B A;  4LD0 A;  4DSI A;  1SL2 A;  4NCB A;  1WNS A;  4DFP A;  1DTT A;  4F4K A;  4H5V A;  3K57 A;  3HT3 A;  1VQK N;  3CCJ N;  5KTQ A;  2E2Q A;  4DUY K;  1S1U A;  1LW2 A;  3FGU A;  2OAN A;  2E1Y A;  3MCA B;  5DM7 L;  5T7B A;  4YFU A;  3BF3 A;  4C1N K;  1T7P A;  1JLC A;  4GV9 A;  4CF2 A;  4JKC A;  3MWT A;  4O55 A;  4H4O A;  1UA1 A;  1HNZ K;  1LWE A;  1NU0 A;  4B3M K;  3QIC A;  4OPK A;  2ITG A;  4LH4 A;  3BZC A;  3U9D A;  4DR6 K;  4BG8 A;  4FOI A;  4CZL A;  1OH7 A;  1EP4 A;  4DR1 K;  4JAX A;  3DXM B;  5M1P A;  2IS3 A;  1V4T A;  4IDH A;  3ZSQ A;  4CES A;  4NLC A;  4LF5 K;  4WQ4 C;  3LAN A;  4ISF A;  2G8I A;  4CEO A;  4FLT A;  2A41 A;  1NK9 A;  3SQ2 A;  3MEG A;  1N32 K;  3ENB A;  1M90 O;  1NGG A;  3CFP A;  4DSL A;  3V1O A;  1HYZ A;  3B8A X;  4WQ4 A;  3M8R A;  4FM1 A;  1JCF A;  3E9L A;  4FJ8 A;  4NYN A;  3N4P A;  4QS7 A;  3RSE A;  2QWQ A;  3F73 A;  2JLE A;  2OTJ N;  5HOO A;  4BVO A;  4FOE A;  4DU1 A;  1GOB A;  1CXU A;  2P9P B;  3OYF A;  5KQD A;  4CF9 A;  5AZJ B;  3VF2 A;  2GEM A;  3DRS A;  3KLF A;  3HJF A;  3FLC O; 
#chains in the Genus database with same CATH homology
 4KPY A;  1TKT A;  3AVL A;  2FC0 A;  4F2S A;  3C95 A;  3NGZ A;  4FM2 A;  2Z1H A;  4FK4 A;  4PQU A;  5K14 A;  1BL3 A;  2YNG A;  1N6Q A;  4Z4G A;  1Q8I A;  3ITH A;  3KKR A;  3KLI A;  4MFB A;  4E0D A;  1BIS A;  4KHS A;  4N76 A;  1ZBL A;  1QSS A;  2Z1I A;  1VSD A;  3K5M A;  4FLY A;  2OPR A;  3T3F A;  3ZSR A;  1IG9 A;  2P1J A;  4IBN A;  3VQ5 A;  2QKB A;  3AVA A;  3NGI A;  1XC9 A;  4HTU A;  4FJJ A;  3ULD A;  2GV9 A;  3DMJ A;  3HP9 A;  4M3W A;  1S1V A;  3AVG A;  3DLG A;  3AO4 A;  3OS2 A;  3O4Q A;  3RRG A;  4K8X A;  1GOC A;  3S9H A;  3ZSY A;  4KAZ A;  4ID5 A;  5E41 A;  3CFO A;  4GMJ B;  4ELV A;  1J54 A;  4J2E A;  1J5O A;  1WAJ A;  1HYV A;  2Z1J A;  1ZYQ A;  2HHV A;  3ZT1 A;  4JS5 A;  4PUO A;  1NK6 A;  1VSI A;  3MEE A;  4CEQ A;  3DLR A;  4CHQ A;  3LWL A;  4M41 A;  4DFK A;  3WNG A;  3U6F A;  4Z4I A;  1EX4 A;  1JLG A;  2E4L A;  2P5O A;  3ZT3 A;  3L2V A;  3ZT4 A;  4DU4 A;  4OKK A;  2YNI A;  3JSM A;  3NHG A;  4CJF A;  3SCX A;  5HRN A;  2G8F A;  3HPO A;  4ELU A;  1RTI A;  1D5A A;  4DSK A;  4AHT A;  2F96 A;  1KVA A;  4DF8 A;  4CER A;  5HRS A;  3OY9 A;  4C8M A;  3SQ1 A;  4MQ3 A;  4BDP A;  1U4B A;  2E6L A;  1TAQ A;  2YNF A;  3CYM A;  3M8Q A;  4L8R B;  1TAU A;  3MXM A;  4W5N A;  2RPI A;  2LSN A;  3FFI A;  3SUO A;  1RT1 A;  2BE2 A;  4ID1 A;  3VQQ A;  3SNN A;  3AO1 A;  4DQS A;  3L2Q A;  4DQI A;  4HCB A;  3C94 A;  1G15 A;  3PX0 A;  3AVK A;  1T05 A;  2DTU A;  4DTM A;  4NCG A;  4CK1 A;  3O3G A;  4KRF A;  4M3U A;  3O4N A;  1TL1 A;  1C1C A;  1Z25 A;  4O0I A;  1JLA A;  5J2N A;  3NH1 A;  3K5L A;  3BDP A;  5JS1 A;  4JS4 A;  2KW4 A;  3KK3 A;  3TR8 A;  1RBR A;  4K8Z A;  1RT7 A;  4CK3 A;  4KB0 A;  1F21 A;  3RMA A;  2G8U A;  3KKS A;  4W5O A;  3SPY A;  2X6N A;  3K2P A;  1Q9Y A;  3VQB A;  4IFV A;  5FRM A;  3OYE A;  3NH0 A;  1GOA A;  2D0C A;  3O3F A;  4OVL A;  3VQD A;  2R7Y A;  1VSK A;  5FRN A;  4HHT A;  1QQC A;  4E7J A;  1B9F A;  5I3U A;  1VRU A;  2Z1G A;  1NK8 A;  1W9H A;  3WNH A;  4FVM A;  2HNZ A;  2ZD1 A;  3DLK A;  3THV A;  1IKV A;  2PZS A;  4IG3 A;  3TWH A;  2AJQ A;  3HL8 A;  3TAQ A;  1NK4 A;  3E01 A;  1W0H A;  4EP5 A;  3NBP A;  3QIN A;  4CJ3 A;  4AHU A;  2ETJ A;  2E6M A;  3WNE A;  2KZZ A;  4J2D A;  1BQM A;  4DTN A;  1WSI A;  4KTW A;  4M3T A;  3MXI A;  1B92 A;  3SUP A;  2BGG A;  2KZM A;  4CJR A;  3D0P A;  1U04 A;  2A1R A;  4FLW A;  3VA3 A;  1ASW A;  1J9A A;  4W5T A;  1EKE A;  3G10 A;  3MAQ A;  1NJY A;  2ZE2 A;  1KFS A;  5DK5 A;  4CHP A;  5CY4 A;  3TI0 A;  4FJ5 A;  3NGY A;  1U45 A;  4N47 A;  2YKN A;  4B9L A;  4FJG A;  4KHW A;  1T03 A;  3ZSV A;  3A2F A;  2NUB A;  2VG7 A;  3S3M A;  3SV4 A;  3IG1 A;  1XWL A;  3DLH A;  5KRT A;  4M3Y A;  3NF9 A;  3L3V A;  4N56 A;  1WLJ A;  1BI4 B;  4OKE A;  3ZSZ A;  1KLN A;  4C8L A;  2B4J A;  4FJX A;  4CK2 A;  3TAM A;  3SYZ A;  1WN7 A;  3AA3 A;  3OVN A;  4CJU A;  1BHL A;  2G8K A;  2IGI A;  4CEB A;  3K5O A;  3SQ0 A;  3EZ5 A;  3OYG A;  3V9X A;  4CJ5 A;  4LY7 A;  1KFD A;  1TVR A;  2HHW A;  4DSE A;  1MU2 A;  4B08 A;  4OGC A;  4CJL A;  2FBT A;  1BCM A;  1VSF A;  1WSF A;  3VQ7 A;  4DTP A;  2KTQ A;  4HVJ A;  3NF8 A;  2EX3 A;  2OPQ A;  3HST B;  3L2W A;  4E7H A;  4M3R A;  4RG8 A;  1RTJ A;  4Z4E A;  3I0R A;  1KSP A;  1ZBU A;  2O4I A;  4RW4 A;  4O44 A;  4CHZ A;  2HHX A;  2X74 A;  1NK0 A;  1KVB A;  4CJK A;  1FKO A;  3CQ8 A;  2ATQ A;  4LSN A;  4CJT A;  1UA0 A;  1REV A;  3G0Z A;  2OZS A;  1FK9 A;  1L3V A;  4FLZ A;  4EZ6 A;  4DQP A;  4EP4 A;  3LAM A;  1QS4 A;  4AHC A;  3OYN A;  2B5J A;  3SV3 A;  2WON A;  1TK8 A;  4FJ7 A;  3SJJ A;  4JLH A;  3QEW A;  4CGH A;  4E19 A;  1NKC A;  4KHU A;  2QK9 A;  1HPZ A;  4DSJ A;  1D8Y A;  3RTV A;  1QHT A;  1A5V A;  1C6V A;  3K58 A;  4CGD A;  2DY4 A;  1NKE A;  1VSM A;  3DRR A;  4CGG A;  3KJV A;  5KRS A;  3OJS A;  4GW6 A;  3C6T A;  4DQQ A;  4AIL C;  4C8O A;  4FJK A;  1I39 A;  3MEC A;  3VN5 A;  1HJR A;  1ASV A;  1FXX A;  3HPG A;  2FBY A;  4LH5 A;  4CGF A;  3B6O A;  4CFD A;  1Q9X A;  3PV8 A;  4QCL A;  1X9S A;  2W42 A;  4Z4H A;  3RWU A;  4BAC A;  1CZ9 A;  1QE1 A;  3ISN C;  2BDP A;  4FJ9 A;  5CYM A;  4CJS A;  3V9W A;  3OYK A;  4F3T A;  3AVI A;  2HMI A;  3L2R A;  3U3G A;  4FZZ A;  4FXD A;  4CJP A;  4DS4 A;  3RMD A;  4DF4 A;  4CHN A;  5KGX A;  4DTS A;  3AA5 X;  1C1B A;  1BI4 A;  1JL1 A;  4CF0 A;  4B9T A;  4DTR A;  4W5R A;  3NF7 A;  4HUG A;  3AA2 A;  1SKR A;  1A5X A;  4GVM A;  3B6P A;  3HP6 A;  2I5J A;  1X9M A;  5HRP A;  4W5Q A;  2XY6 A;  1RDD A;  1VRT A;  3CG7 A;  4CEZ A;  4B9S A;  3AVJ A;  3BGR A;  3OYB A;  4CHY A;  1RNH A;  1S1T A;  5SZT A;  4KI6 A;  4KHQ A;  2XY5 A;  1YVU A;  2VWK A;  3OYM A;  3V9Z A;  3V4I A;  4IG0 A;  1NK5 A;  1JLE A;  4RW6 A;  4WE1 A;  5CYQ A;  1NKB A;  3PO4 A;  4CJ4 A;  3SQ4 A;  3ALY A;  4CE9 A;  4NYF A;  4DLE A;  3TAE A;  4FW2 A;  2X6S A;  4KTZ A;  5J2Q A;  1TK0 A;  3DLB A;  1XI1 A;  3LZJ A;  1RT2 A;  1QTM A;  4RW9 A;  4PA1 A;  2VG6 A;  3M8S A;  3KTQ A;  1KVC A;  1HNI A;  1RBU A;  3LPT A;  3DRP A;  1NJW A;  4KRE A;  4KKO A;  3NE6 A;  1U48 A;  1VSJ A;  4C8N A;  3I0S A;  1L3U A;  4JRP A;  1S5J A;  5I42 A;  3ZSO A;  1SL0 A;  3HK2 A;  4FCY A;  3AVF A;  2JGU A;  2YHA A;  2YHB A;  4FZX C;  3O3H A;  2PYJ A;  1RDC A;  3D45 A;  3PUF A;  3CFR A;  3QEV A;  1HNV A;  4CFC A;  4FYD A;  4B9N A;  2OPS A;  1QSY A;  4E7L A;  3KLH A;  3OJU A;  3OYA A;  3JYT A;  4KO0 A;  4B3O A;  3EY1 A;  1TL3 A;  2DFH A;  3AVN A;  1FKP A;  2IDO A;  1B9D A;  2YKM A;  3LP1 A;  3M8P A;  1Z26 A;  3ASM A;  3EYZ A;  2XY8 A;  3NCI A;  3QEI A;  2RN2 A;  3HM9 A;  5CZ2 A;  1WSH A;  2HW3 A;  1SUQ A;  1EET A;  1DLO A;  4M45 A;  1TKZ A;  2X78 A;  3QEX A;  1LAW A;  4B8A B;  1ZBF A;  3LP0 A;  1BIZ A;  1S9E A;  4ZTJ A;  2YNH A;  4DSF A;  1JL2 A;  3QET A;  5D3G A;  3NH2 A;  1S6Q A;  2D0B A;  1VK0 A;  5JS2 A;  4CF1 A;  2D5R A;  4FW1 A;  4CJW A;  4ZHR A;  5C24 A;  5HLF A;  1T8E A;  4ELT A;  1RIL A;  4FK2 A;  4Q0B A;  1S1W A;  1WAF A;  3DOK A;  4DQR A;  1KLM A;  4AHR A;  2BAN A;  1VSL A;  4FM0 A;  4Z4F A;  4OJR A;  3VQA A;  3VQ8 A;  3P5J A;  3ZCM A;  5C25 A;  4G1Q A;  4QOZ B;  4KHY A;  3IAY A;  3HVT A;  3V1R A;  2HB5 A;  1SKW A;  1TKD A;  2D0A A;  3TAB A;  1TKX A;  4FLV A;  4F8R A;  4J2B A;  5DMR A;  2XHB A;  1JLB A;  2YV0 X;  1R0A A;  2PYL A;  4FJN A;  2OZM A;  3KD5 E;  1TK5 A;  1XHZ A;  1ASU A;  4E1N A;  3KK2 A;  1RDB A;  1NOY A;  4FJH A;  1RCH A;  4J2A A;  1U49 A;  1RT6 A;  3AVB A;  3KK1 A;  1BCO A;  1Y97 A;  3V9S A;  3SUN A;  2XY7 A;  5SWM A;  4I9L A;  1NJZ A;  1L3S A;  4B9U A;  1S6P A;  2FBV A;  1RBT A;  3PX4 A;  3CM6 A;  1NK7 A;  1IO2 A;  1RDA A;  3OYI A;  3L8B A;  3TAR A;  4IKF A;  5CZ1 A;  5HBM A;  2VG5 A;  1A5W A;  2F8S A;  1D9D A;  5EU7 A;  3AA4 A;  2OPP A;  1BGX T;  4DG1 A;  4I9Q A;  4KV8 A;  4QAG A;  4KFB A;  4RW8 A;  1D9F A;  3PO5 A;  4KTQ A;  3VQ4 A;  1UWB A;  1LWF A;  1RT5 A;  4AHV A;  2IAJ A;  4KB1 A;  1CXQ A;  2XRI A;  4OPJ A;  3OYC A;  2HHU A;  1IKY A;  1C1A A;  4I7F A;  3RRH A;  1JLQ A;  3QO9 A;  4I2Q A;  1L3T A;  4CGI A;  1RBS A;  2B6A A;  4IDK A;  4CF8 A;  3NDK A;  1SL1 A;  1JXE A;  2WOM A;  3KLG A;  1DTQ A;  2IC3 A;  4FJM A;  3VQ6 A;  3HXM A;  3I8D A;  4FJL A;  1S1X A;  3KLE A;  1YTU A;  4CED A;  3K59 A;  1ZBH A;  1BIU A;  4CFB A;  4B9V A;  1TV6 A;  4O5B A;  4DS5 A;  4H4M A;  4Q5V A;  1LW0 A;  3TAN A;  1L5U A;  4O4G A;  3ZSX A;  4BE2 A;  4FJI A;  4FK0 A;  4UQG A;  4CEF A;  1IKW A;  3V81 A;  3LAK A;  3QIP A;  3SZ2 A;  4DFJ A;  1HQE A;  1IKX A;  3OS1 A;  4AH9 A;  4HCC A;  3QNO A;  1ITG A;  3NFA A;  1NJX A;  1JXB A;  4YNQ A;  2IOC A;  4O0J A;  3KIO A;  5J2P A;  3DM2 A;  1YTA A;  1K6Y A;  3S3O A;  3AVM A;  2QXF A;  4CEA A;  4R5P A;  4FZY A;  4NCA A;  3VQ9 A;  3AO2 A;  4E3S A;  4E7I A;  3IRX A;  4CFA A;  4H8K A;  4DTJ A;  4CEC A;  2O4G A;  3VQE A;  4DWI A;  4E89 A;  3T1A A;  3VA0 A;  4RW7 A;  1VSH A;  1RTH A;  4CEE A;  2KQ2 A;  3LPU A;  1LAV A;  3RMB A;  4Y1C A;  4B8C A;  1C0M A;  4CHO A;  2Y1I A;  4C8K A;  2G8W A;  4OLA A;  3HPH A;  3T19 A;  3QLH A;  4HUE A;  4E7K A;  3TAF A;  3V1Q A;  3OS0 A;  4DFM A;  4E1M A;  1UOC A;  1IH7 A;  5KGW A;  4DMN A;  3LWM A;  4DU3 A;  4N41 A;  3PY8 A;  1C0T A;  4IFY A;  1KRP A;  2DFE A;  4OLB A;  3RMC A;  3NAE A;  2P51 A;  4FLU A;  2ZQB A;  3LAL A;  4M3X A;  3MXJ A;  4F3O A;  3HO1 A;  1YT3 A;  1BQN A;  1HYS A;  1C0U A;  1WSJ A;  3SI6 A;  4Y1D A;  1LV5 A;  5HRR A;  4DTO A;  3QNN A;  1QSL A;  4B9M A;  3DOL A;  1J53 A;  3NF6 A;  4OGE A;  3ZT2 A;  2Q3S A;  4LSL A;  1HRH A;  1RT3 A;  4LD0 A;  3L3U A;  3VQC A;  4DSI A;  4Z4C A;  3OYJ A;  4N5S A;  1SL2 A;  4NCB A;  5KI6 A;  4DTX A;  5FRO A;  1WNS A;  4DFP A;  1DTT A;  1KCF A;  4F4K A;  4DLG A;  2RF2 A;  3K57 A;  4BE1 A;  3HT3 A;  3LP3 A;  5J2M A;  3OYD A;  2HNY A;  4I2P A;  5KTQ A;  3LZI A;  1I3A A;  3P83 D;  4CGJ A;  1HQU A;  4CJQ A;  2A1S A;  3MED A;  1S1U A;  3DYA A;  1LW2 A;  1KTQ A;  4TSX A;  3CM5 A;  1RT4 A;  4CIG A;  3QES A;  5T7B A;  3VQP A;  4CJV A;  4YFU A;  1CLQ A;  1T7P A;  1JLC A;  3AO5 A;  2RKI A;  4AHS A;  4CF2 A;  4M42 A;  3ZT0 A;  3P1G A;  3UIQ A;  3S3N A;  4O55 A;  4H4O A;  3TAG A;  1UA1 A;  3C6U A;  1X9W A;  4BWJ A;  2QKK A;  1LWE A;  3OYH A;  2F8T A;  3IS9 A;  1RTD A;  4OPK A;  4EZ9 A;  1TGO A;  2ITG A;  4LH4 A;  5HP1 A;  4BDY A;  1SV5 A;  2P5G A;  2HVI A;  4F2R A;  3PX6 A;  4BWM A;  3TAP A;  4KI4 A;  2HND A;  2DFF A;  3AVC A;  3L2U A;  2G8H A;  3HYF A;  2G8V A;  1WSG A;  1EP4 A;  1CZB A;  3HVR A;  1HMV A;  1VSE A;  4BE0 A;  4CIE A;  4DTU A;  4KHN A;  3V6D A;  2IS3 A;  1SKS A;  4CJE A;  3ZSQ A;  1JLF A;  4CES A;  3SPZ A;  4M3Z A;  3K5N A;  3LAN A;  2G8I A;  2XO7 A;  2EHG A;  2GUI A;  4CEO A;  1ZBI A;  3DLE A;  4JRQ A;  4FLT A;  5FDL A;  5HRO A;  2OA8 A;  1NK9 A;  2HHT A;  3SQ2 A;  2HHQ A;  3LP2 A;  3MEG A;  4CIF A;  1X1P A;  1S9G A;  3KD1 E;  3V9U A;  4ZTF A;  4ICL A;  2FBX A;  3AVH A;  3CFP A;  1JKH A;  1O1W A;  4DSL A;  3V1O A;  1HYZ A;  1RBV A;  3M8R A;  3LDS A;  4OKJ A;  1UAX A;  4FM1 A;  4FJ8 A;  3OYL A;  3DI6 A;  3F9K A;  4NYN A;  2PY5 A;  2GBZ A;  1EXQ A;  3AO3 A;  2Y1J A;  1N5Y A;  3F73 A;  1WSE A;  2JLE A;  4HUF A;  4PWD A;  5C42 A;  4Z0U A;  4XIU A;  3H08 A;  3WNF A;  1XHX A;  2VWJ A;  1GOB A;  4DU1 A;  1CXU A;  3QER A;  3OYF A;  5J1E A;  3RR7 A;  2OYQ A;  4PY5 A;  3ZSW A;  4BDZ A;  4FLX A;  4CF9 A;  3U3Y A;  4CCH A;  3SUQ A;  3QIO A;  3DRS A;  3QEP A;  2HVH A;  2KFN A;  2HHS A;  1LWC A;  3KLF A;  1NOZ A;  3AV9 A;  1U47 A;  3RR8 A;  3HJF A;  2KFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...