3VQ8A

Hiv-1 in core domain in complex with (3r)-3,4-dihydro-2h-chromen-3-ylmethanol
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
136
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 51
structure length 136
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vq8A00
4FYDA 3TAQA 3TAMA 1RDAA 3MAQA 4KAZA 3QEXA 3NF6A 2VG5A 4CGIA 5J2MA 4FJIA 4JRPA 2DFHA 1HNVA 3OYDA 4DTRA 1KLNA 1X9WA 1VSMA 3LZJA 3TAFA 3AV9A 2ATQA 2E6MA 2Z1GA 5K14A 3V6DA 4NCAA 4CJSA 1D5AA 1TAUA 3KD5E 4KHSA 2BANA 4IG3A 3DRPA 1RBRA 2OPRA 1LAVA 3SCXA 3QINA 1KRPA 3CFPA 3CG7A 1JLFA 1BIZA 1RBVA 3F9KA 3SQ4A 1EXQA 3VQDA 4CJ3A 3PX4A 4BACA 1NK5A 3ULDA 1NKCA 2WONA 3KTQA 4M3UA 1JLAA 3PY8A 4CEAA 1S5JA 3I0SA 4KKOA 3V9ZA 3AVFA 1T03A 4F8RA 1KFSA 2DY4A 1NK7A 3QETA 3DLKA 4K8XA 1TKXA 2RF2A 4KTWA 3L3VA 3V9XA 1RTHA 1XWLA 3SQ2A 2BDPA 4EZ9A 4Z4FA 1S1WA 4AILC 3WNHA 2OZMA 1LWCA 3HXMA 1VSKA 2ZE2A 2G8WA 3VQ8A 4FJ7A 1BCOA 1IKYA 1RBUA 3B6PA 4I9LA 1SKRA 4JS4A 3K57A 2W42A 4OKJA 4MQ3A 4DWIA 5JS1A 3RMCA 4QOZB 2KFZA 3LPTA 4W5QA 4DS4A 4PWDA 4FW2A 4FZZA 1RILA 4HCBA 3SV4A 4FLZA 5HRSA 3M8RA 4E7HA 1GOBA 3K5MA 1RT5A 1NJZA 4DSLA 1YTUA 3LAMA 4W5TA 3OYNA 1MU2A 1KVCA 1TKZA 1S6QA 2HMIA 4E89A 1VSHA 4FM2A 1IO2A 3L2RA 3RMAA 2YNGA 3MEDA 4I2QA 4Q0BA 2AJQA 4PY5A 3H08A 1WSFA 1A5VA 4FCYA 1KLMA 3MEEA 3OYKA 5J1EA 4DF4A 3VQCA 3SUPA 3G10A 1CLQA 3RWUA 2IAJA 1BL3A 4CEQA 1RNHA 1RDCA 4L8RB 4CIEA 2XHBA 4JLHA 3DOKA 1HYSA 3VQ4A 4RW6A 3IAYA 3LP2A 1FKOA 2E6LA 2RPIA 5EU7A 1SL1A 2BGGA 2VG7A 5C24A 4BE1A 4CERA 1NKBA 4H4OA 1HYVA 1NKEA 4ID5A 3F73A 2IC3A 5KTQA 4FJHA 1D8YA 1WAJA 3LZIA 4H8KA 4M3RA 3OJUA 4CJKA 3KKSA 4RW7A 1BQNA 4RW9A 2HHQA 1S9GA 3NF8A 2G8KA 4B9SA 3O3GA 4LH4A 3P5JA 3RTVA 2OPQA 1KVAA 2X6NA 3MECA 2Y1JA 5CYMA 1VSIA 3VN5A 4HUGA 4DMNA 1IKXA 3SQ1A 3HP9A 3AVKA 1LWFA 1SV5A 1YTAA 4AHTA 4HVJA 4N41A 1SUQA 1VK0A 4FLVA 2D5RA 4J2EA 4KHQA 4CESA 3LANA 4IG0A 3OYEA 4J2BA 3AVLA 5HBMA 1L3TA 1S9EA 1TGOA 1RTJA 2D0AA 3M8PA 1B92A 3T3FA 4KHWA 1C1AA 5CZ1A 4DLGA 3NH2A 2HNYA 4HHTA 3SYZA 4HCCA 3LPUA 3S3OA 3O3FA 3DLGA 5HP1A 1NJXA 1RTDA 1RTIA 1ZBFA 4E19A 2OA8A 4FZXC 2IOCA 3TAEA 1RT6A 3SV3A 3V9SA 2FBXA 4IFVA 3C6UA 3QIOA 2HHWA 3QEVA 2YNHA 3KLGA 3AA5X 4BDZA 4ELTA 3KK1A 2Q3SA 4FLTA 1VRUA 1RT4A 2VG6A 5I3UA 4FLUA 2X6SA 3HYFA 3TI0A 4DG1A 1X9MA 4F3TA 3VQBA 4CJRA 1S1XA 3ZCMA 1FXXA 4IBNA 1JLEA 3K5NA 1LAWA 2F96A 4ZHRA 1IH7A 3MXMA 4KI4A 2XY6A 1T7PA 1J5OA 1JLQA 4CHPA 3NGZA 4M3ZA 3NF7A 2DFEA 2XRIA 3A2FA 3ITHA 4CFBA 4UQGA 5KGWA 3HP6A 3OYLA 1BQMA 3NBPA 3L2UA 3I0RA 2A1RA 4KHNA 4O55A 3RMDA 2IGIA 2KZZA 3HT3A 4CGJA 1UA1A 1I39A 1ZBUA 3AVIA 1G15A 1RT3A 1HQUA 3HSTB 3L2WA 1RBTA 3PUFA 4CGFA 5KRSA 3U6FA 4DU1A 1QSYA 2EHGA 2B4JA 1L3VA 3ZSWA 4HUFA 1WSGA 3RRHA 2F8SA 3HK2A 3U3YA 4M3TA 3MEGA 4CHQA 4OPJA 4KB0A 5D3GA 3VQ7A 2F8TA 2KZMA 1UOCA 1HYZA 1RT2A 3LAKA 4CFAA 4FJMA 4PQUA 4K8ZA 2QKBA 4CECA 3AO3A 1ZBIA 1DTTA 3G0ZA 4KPYA 4CJFA 1UA0A 4O5BA 3ZSQA 4FZYA 4E7JA 1NK8A 1LV5A 4B9VA 5C25A 1KCFA 5FRMA 4LSLA 4OGEA 1BGXT 4OVLA 4DTPA 2HB5A 3VA3A 3V9WA 1S1VA 2YNIA 3IS9A 1QTMA 3AO4A 3HJFA 1IG9A 2RKIA 3HPHA 4OJRA 4DQRA 3BDPA 3V1OA 4KHYA 4OLAA 4OLBA 1K6YA 3NAEA 1U47A 3PX6A 2DTUA 2IDOA 5KRTA 3DM2A 3QLHA 3NH1A 1NJWA 1XC9A 1TK0A 1FKPA 3ZT4A 3RMBA 3NE6A 3NGYA 1B9FA 4AHVA 4KB1A 2ETJA 2ITGA 1W0HA 3U3GA 1L5UA 2QKKA 4JRQA 2I5JA 4HTUA 2P5GA 1YVUA 2KFNA 3ZSZA 1LW0A 3LP0A 3QO9A 3QEIA 3AA2A 1J54A 2FC0A 3AVNA 3HM9A 1JXEA 1D9DA 3TAPA 1YT3A 4OKKA 3OYGA 5HRPA 3OYMA 4CEEA 2LSNA 1EETA 1N6QA 3EYZA 4DFMA 4F2SA 4M3YA 2YKMA 1U48A 4GMJB 3TAGA 4J2AA 4O4GA 2YKNA 3AA3A 3L8BA 4NYNA 1NOZA 2B5JA 2QXFA 4DF8A 3QESA 5HRRA 4BWJA 2P5OA 4AH9A 4BE2A 2HVHA 3LP1A 2D0BA 1CZBA 4CHYA 2R7YA 1QHTA 3ZSOA 4QAGA 3AVAA 4FJ5A 2XY5A 2HHVA 3OYHA 4Z4EA 4DSKA 3OYCA 4BWMA 4CIFA 3AVBA 1JLCA 4DTUA 1LWEA 3SZ2A 2B6AA 3OS2A 4FJNA 1WN7A 3DMJA 2Y1IA 4CJ4A 4CF0A 3PV8A 3ISNC 1JXBA 2ZQBA 2Z1IA 3HPOA 1KSPA 3RR7A 4ELUA 3C94A 5J2QA 4B9MA 4XIUA 3D45A 3O3HA 3SUQA 2OPPA 1WSEA 2ZD1A 4KFBA 1RDBA 4KHUA 2HHSA 3V81A 1UWBA 4DFPA 3MXIA 4M42A 4CGGA 4E3SA 4Z4HA 4E7LA 3M8SA 2EX3A 3EY1A 1VSDA 5KGXA 3CQ8A 3C95A 4CCHA 3KLEA 5SZTA 3KD1E 3C6TA 1HQEA 4JS5A 1R0AA 1TL1A 1JKHA 2GBZA 1EP4A 3NCIA 2G8FA 5FDLA 3VQ9A 1NK4A 3P83D 3OS1A 3KLHA 1ITGA 3SQ0A 3RRGA 1JL2A 1HPZA 1Y97A 5CYQA 5FROA 4PA1A 1CXUA 1FK9A 3OYIA 3ZSRA 3TARA 4FJGA 1HJRA 2X74A 2YHAA 4CF9A 3DYAA 1DLOA 3AVGA 4E1MA 3QEWA 4B9UA 1QS4A 4KTZA 4KTQA 1ZBHA 4CE9A 2E4LA 1BIUA 4CJLA 3VQ6A 4DTMA 3S3MA 4DS5A 1C1CA 4DTXA 1N5YA 4RW4A 2D0CA 1B9DA 4M41A 3AA4A 4CJ5A 3E01A 3VQQA 4KI6A 4N47A 4CEFA 1U04A 2G8HA 4B8CA 1NK9A 4M3XA 1XI1A 3ZSYA 4DQPA 3AVJA 3LWMA 1ASWA 4G1QA 4E7IA 3QEPA 4PUOA 5CZ2A 3ZSVA 3V1RA 3O4NA 1C0TA 1QE1A 3OS0A 1JL1A 4OKEA 3DRSA 1SL0A 4LH5A 1Z26A 3WNGA 3SI6A 4NCGA 3QNNA 1A5XA 4Z4IA 4C8OA 2Z1JA 3ZT0A 4W5RA 3VQAA 3NGIA 4GW6A 1XHXA 3TABA 1T05A 3HPGA 2YNFA 3HVRA 2VWKA 3ZSXA 3BGRA 1REVA 4FLWA 4DFKA 3SPYA 2HHUA 4CF2A 4I7FA 3K58A 2FBTA 4DFJA 2O4IA 1ZBLA 2GUIA 3RR8A 3ZT1A 4J2DA 4Z4GA 4M3WA 4NYFA 3IG1A 4HUEA 1Z25A 3ASMA 3CFOA 3UIQA 4AHSA 4Y1CA 4N56A 4EP4A 4MFBA 1T8EA 1KVBA 4FW1A 3DLHA 1HNIA 4FVMA 4C8MA 5HLFA 4AHUA 1C6VA 1J53A 4GVMA 1SKWA 2JGUA 4CJUA 4B9NA 4FJLA 4LY7A 5I42A 3B6OA 1BI4B 3OYJA 1Q9YA 3PX0A 3MXJA 4BDPA 3L3UA 1WAFA 5FRNA 4IDKA 4EZ6A 4O44A 1RT7A 2YHBA 4W5OA 4DTJA 3VQPA 3THVA 2OZSA 1TAQA 4CHZA 1U45A 4CF1A 1VSLA 4CJVA 3DRRA 4FJXA 4WE1A 3V9UA 4YFUA 4ZTFA 4I9QA 4DTOA 1X1PA 4DTSA 3TWHA 4CFDA 4DQQA 2JLEA 2HNZA 3ZT2A 4DSFA 4LSNA 4EP5A 1NK0A 1CXQA 3KK3A 3NH0A 4CEOA 1DTQA 1RBSA 3OYAA 3LDSA 4CHNA 3CM6A 3S9HA 1LW2A 1QSSA 4W5NA 1S1UA 1ASVA 2KW4A 4FM1A 1TVRA 3SJJA 2XY7A 1BHLA 4FK2A 1UAXA 3HO1A 1KTQA 4AHCA 1GOAA 1NOYA 4KV8A 3HVTA 3JSMA 4CJQA 3NF9A 1C1BA 1WLJA 4CJTA 2FBVA 4CK3A 3OJSA 4RW8A 2HHTA 1WSHA 2XY8A 4QCLA 4CEZA 2FBYA 3K5LA 2PYJA 4BDYA 3V1QA 3IRXA 1WNSA 3SNNA 1BCMA 1NJYA 2NUBA 1EX4A 2X78A 3AO2A 3QIPA 1D9FA 4C8KA 4DSIA 4KO0A 3DLRA 1TKDA 4C8LA 4ELVA 4O0IA 4Y1DA 4IFYA 3VQ5A 3KK2A 5DMRA 4FJ9A 4NCBA 4I2PA 3LALA 3TR8A 4DQIA 3FFIA 3VQEA 2G8UA 1GOCA 3CFRA 4CF8A 4CGHA 3PO4A 3SPZA 2HNDA 3JYTA 4BE0A 3LWLA 1ASUA 2IS3A 4CJPA 3AVHA 1WSIA 2KQ2A 3OVNA 3T1AA 4Z4CA 3EZ5A 4DSJA 4M45A 4OPKA 1W9HA 3NHGA 4B9TA 4OGCA 1JLBA 4DQSA 5T7BA 1F21A 3WNFA 3SUNA 1U49A 4CEBA 1Q9XA 1TV6A 3LP3A 4ICLA 4CJWA 2OPSA 4KRFA 3PO5A 1O1WA 3TANA 1TK8A 3KIOA 1RT1A 4N76A 1QQCA 3NFAA 4CEDA 1A5WA 1HMVA 3KJVA 2OYQA 4F2RA 3QNOA 1X9SA 1I3AA 1ZYQA 2PZSA 4N5SA 5J2PA 5HRNA 4FK4A 5E41A 4KREA 4DTNA 1VRTA 4FM0A 4B9LA 1VSFA 4Q5VA 4O0JA 1SKSA 5C42A 4RG8A 3OYBA 4H4MA 5HROA 3HL8A 5J2NA 2QK9A 1IKVA 2PYLA 2A1SA 3DI6A 4FLXA 5JS2A 3ALYA 3O4QA 3WNEA 3D0PA 4FLYA 2VWJA 2PY5A 4IKFA 4CK1A 2P1JA 4CFCA 2O4GA 2GV9A 3DOLA 4FJ8A 2HW3A 2G8VA 4C8NA 2RN2A 3V4IA 4CJEA 1TL3A 4CK2A 1NK6A 1L3UA 4ID1A 4AHRA 4FJKA 1RCHA 2DFFA 4E7KA 4CIGA 4B08A 3OYFA 3AVMA 3KLFA 3AVCA 4ZTJA 1CZ9A 2YV0X 1BISA 1XHZA 1EKEA 3K2PA 4F4KA 3M8QA 4FJJA 4DLEA 3P1GA 4E1NA 3KKRA 1C0MA 4B8AB 4DSEA 3T19A 5SWMA 3DLBA 1RDDA 3CM5A 3VA0A 2KTQA 1TK5A 1IKWA 5CY4A 2Z1HA 1J9AA 1HRHA 4LD0A 4FXDA 4FK0A 1BI4A 5DK5A 1TKTA 4YNQA 1QSLA 3K5OA 3I8DA 2HVIA 2P51A 4DU3A 4DU4A 1U4BA 1C0UA 3KLIA 3CYMA 1KFDA 2XO7A 1SL2A 1L3SA 1VSJA 4CGDA 4E0DA 4TSXA 2BE2A 3ZT3A 3L2QA 3K59A 2HHXA 3NDKA 5KI6A 2WOMA 3AO5A 3DLEA 4CHOA 3S3NA 1S1TA 4Z0UA 1WSJA 2G8IA 1VSEA 1JLGA 3OY9A 4B3OA 3SUOA 1S6PA 1Q8IA 3AO1A 4R5PA 3L2VA 3QERA 4F3OA
chains in the Genus database with same CATH superfamily
3TAMA 3MAQA 5AQQA 3QEXA 5AQSA 2VG5A 5EY4A 3SAGA 1NMDA 1HNVA 1BO5O 2QEXN 1NGCA 4YY3K 3THYB 1VSMA 3AV9A 2A40A 3O6WA 5C15A 3SCXA 3CFPA 3WEEB 1JLFA 1RBVA 5KPRA 3P39A 5AQYA 3JS6A 1NKCA 2WBNA 1NGJA 3HM8A 3V9ZA 4BC3A 4IOXA 4M3XA 2F9TA 1T6DA 1QQNA 4C23A 2BDPA 2I7PA 4AILC 1LWCA 3HXMA 3HOTA 1IKYA 1RBUA 3MDQA 1RILA 5HRSA 3M8RA 1GOBA 4FL9A 3K5MA 4DSLA 3OYNA 1MU2A 1KVCA 3QFUA 1VSHA 4FM2A 1Z6RA 3AARA 5AQWA 2YNGA 3MEDA 4I2QA 3H08A 1A5VA 3SJHA 3MEEA 3OYKA 4DF4A 3SUPA 1NGFA 3W0LA 4F9OA 4XH5A 3DOKA 1VQON 1HYSA 3T1HK 5EU7A 3GE1A 2VG7A 3P38A 2IC3A 5KTQA 4FO0A 3OJUA 2V51B 1H1VA 4RW9A 3SBGA 3IMXA 3VF4A 1K73O 2HHQA 3BZKA 5KQDA 4BROA 1FJGK 2OPQA 5CYMA 3SQ1A 3MN9A 1IKXA 3HP9A 3AVKA 1VQ5N 1SV5A 3PSFA 4JI1K 3WQUA 4AHTA 5GINA 4FLVA 2D5RA 4J2EA 4CESA 4IG0A 4JK8A 4IXCA 1ESVA 5HBMA 4DUYK 1Q7YO 1L3TA 2A6AA 4BRFA 4BRLA 3M8PA 4BRKA 4DLGA 5CZ1A 2HNYA 5AQXA 4X62K 5HP1A 1NJXA 1GLEG 3TAEA 1RT6A 3IFRA 2YX6A 4FOEA 3C6UA 3QIOA 4IFVA 3VEVA 2HF4A 4BG9A 3EKSA 3QEVA 3KLGA 1N32K 2HHWA 4JHDB 4ELTA 5C12A 3E1YA 4B3RK 4DG1A 4F3TA 2GWKA 4IBNA 3K5NA 4BRAA 1J5OA 1JLQA 4CHPA 3NGZA 2HSTA 4UQGA 4DR2K 1BQMA 2A1RA 4KHNA 4O55A 4X66K 2D0PA 4CGJA 1ZBUA 3AVIA 1RT3A 1HQUA 3L2WA 4CZGA 4DU1A 5EOYA 3ZSWA 4HUFA 2IIRA 2F8SA 1O13A 1TUUA 3E9PA 3U3YA 4DR5K 3MEGA 5D3GA 1X3MA 4KB0A 5AQHA 4CFAA 3MN6A 3EN9A 3KHYA 4CECA 1JCEA 3ZSQA 1D4XA 3DJCA 4E7JA 1LV5A 4B9VA 1KCFA 4LSLA 4OGEA 2HB5A 3W3DA 1S1VA 1QTMA 2GEMA 2RKIA 4FWNA 2WFBA 3FZFA 4OJRA 1U47A 3PX6A 3DM2A 2W6KA 3UKRA 1BG3A 3CQYA 4A59A 4BR7A 3KWGA 4HWIA 1B9FA 4AHVA 1VQ6N 2ITGA 1W0HA 3U3GA 4IFEA 3ZSZA 1LW0A 3QEIA 1ILYA 3AVNA 2FC0A 3HM9A 4OKKA 4LF7K 1VQNN 2P9IA 3THWA 1U48A 3TAGA 1NU0A 1HX1A 4JEPA 4AH9A 4H5WA 2HVHA 3LP1A 5LJWA 3ZSOA 3CD6N 4JK9A 2HHVA 1QHAA 4DR1K 4DSKA 4BWMA 3B8AX 1LWEA 4DR3K 3DMJA 1Y64A 3CERA 4CF0A 1JXBA 3HPOA 4ELUA 3D45A 4GKKK 2ZD1A 4KFBA 3CJ1A 4OO1J 3V81A 2O8BB 4BVOA 3QICA 3MWPA 3KD1E 4B1WB 1MWKA 2NRHA 1TL1A 1JKHA 4BY9C 4JI2K 1NK4A 3BUZB 3TSPA 1JL2A 5CYQA 5FROA 1FK9A 4FJGA 2X74A 3BP8A 3PIPL 3DYAA 1KC8O 3S41A 4KTZA 1VQ4N 3H1QA 3S3MA 1BIUA 4DTMA 4DS5A 2V7ZA 4QS7A 3D2FA 1N5YA 4CJ5A 3VQQA 2P9UA 4FWSA 3VEXA 1U04A 2G8HA 1YXQA 1XI1A 4E7IA 3QEPA 5CZ2A 2W41A 1W97L 5B8HA 4LH5A 1VQ8N 5KPTA 3U9ZA 3J7ZO 2Z1JA 3VQAA 1KQSM 1SAZA 3NGIA 1XHXA 2YNFA 1NJIO 3HVRA 4C1NK 4WQ4C 3BGRA 1REVA 2QWLA 4FLWA 3SPYA 3K58A 4I7FA 4DFJA 1C0FA 1ZBLA 3RR8A 4OPHA 4H03B 2QXLA 4N56A 4EP4A 4EHTA 4CJ7A 3DLHA 3CMEN 5HLFA 2O8FA 1SKWA 1QVGM 1S22A 4B9NA 2GTDA 4FJLA 4LY7A 3AGRA 4MDAA 1Q9YA 3MXJA 4BDPA 2ZF5O 5FRNA 3THVA 2P9KB 4FWLA 1VSLA 4JD2B 3O9TA 4I9QA 4DTOA 3TWHA 4CFDA 4DSFA 2JLEA 2A42A 3O80A 4LSNA 4M63C 4BRHA 4LF5K 2O8CA 1DTQA 3F5TA 3LDSA 1EQYA 4W5NA 1LW2A 2KW4A 2XY7A 1KAZA 1NOYA 5GIOA 1NBWA 1DT9A 1OKJA 3JSMA 4CJQA 3NF9A 1C1BA 2PAVA 3EE8A 3OJSA 2HHTA 1YTUA 1WNSA 4GV9A 2X78A 3K9KA 4Y1DA 3ID6A 3VTHA 2G8UA 3SLCA 4BE0A 2ZGYA 3EEQA 3LWLA 1MWMA 1ASUA 1WOQA 4IOAL 4FSVA 2E1ZA 3EZ5A 1SS6A 3NHGA 4OGCA 5EX5A 4DQSA 4IEEA 1Q9XA 5F0XA 3LDPA 2O8DA 2UUBK 4CEDA 1HMVA 4F2RA 4LFBK 1ZYQA 3KK7A 4WQ5A 4N5SA 1V4SA 4Q5VA 2HBKA 4RG8A 5HROA 3HL8A 3T1YK 1VQ7N 3C0BA 2QWPA 2A1SA 3ALYA 3O4QA 4FWKA 3WNEA 4FLYA 2PY5A 5IT9O 4QS8A 4CK2A 4BR5A 4ID1A 4FJKA 2DFFA 5IWAK 4CIGA 4B08A 3AVMA 4JKEA 2WUSA 3AVCA 2YV0X 2D0OA 1BOTO 3C6HA 2UUCK 4F4KA 4FJJA 4MO4A 3KKRA 4LF9K 4DV2K 3HZ6A 2ITMA 4BGAA 4LD0A 2J4RA 3SAHA 3K5OA 1HPMA 2F9WA 3G71N 1SL2A 4IJNA 2PBDA 4CGDA 4TSXA 2FSJA 3L2QA 5KI6A 3AAPA 3AO5A 4CHOA 4DQ8A 5CE3A 3KVGA 1VSEA 4E1JA 3OY9A 1Q8IA 3CXCM 5BPNA 4FYDA 3HSCA 4H0XB 3OYDA 2P9PA 3TAFA 4B3MK 3V6DA 4V19S 4CJSA 4IG3A 3P31A 3DRPA 2OPRA 4K42A 3L4IA 3M5RA 1BIZA 3SQ4A 3F9KA 3O4WA 1EXQA 4GNIA 3PX4A 4Q0BA 3KTQA 2P9NB 3I0SA 3AVFA 1NK7A 3GL1A 1TKXA 4KTWA 3TTFA 4EZ9A 1S1WA 4J8FA 1VSKA 4BQLA 2FSKA 3MCAB 3K57A 2W42A 1YIJN 4OKJA 1XMQK 4DWIA 4DS4A 4FW2A 4HCBA 5BRFA 3CPWM 1YUWA 3ZYYX 1NJZA 4LFAK 4DHYA 2YJEA 5M1NA 4E89A 2NRRA 1GLLO 4GVEA 4MLHA 5JMVA 4PY5A 1WSFA 3A5LC 2Q0UA 3KZBA 4L8RB 5BR9A 2XHBA 3IAYA 1FKOA 2W6LA 3UKUA 4BE1A 1NKBA 1HYVA 3F73A 3CCUN 2YHXA 3LZIA 4H8KA 4M3RA 4CJKA 3SAFA 1S9GA 3BZCA 1KVAA 1NNEA 2Y1JA 3VN5A 1VSIA 4HUGA 1J6ZA 4BR0A 2UU9K 1YTAA 1T6CA 1VK0A 3K0SA 2D0AA 3L0QA 3S3OA 2OA8A 2IOCA 4YHHK 4XH4A 4BQZA 4BDZA 4CZHA 1MA9B 2Q3SA 3VGKA 4FLTA 2D4WA 2NZTA 1I94K 3HBTA 2VG6A 1RFQA 1YITN 1X9MA 2Q31A 1G99A 1LAWA 2F96A 4KI4A 3GOIA 4H5VA 3A5MC 3WEEA 2DFEA 3A2FA 1EWRA 5KGWA 1RDWX 3NBPA 2KZZA 3RMDA 1IG8A 2O8DB 4BR9A 4CGFA 1HKCA 5KRSA 3VOVA 2EHGA 2B4JA 1YF5L 5LMNK 3HI0A 4CHQA 4OPJA 2F8TA 4O5FA 3VQ7A 2KZMA 1RT2A 4FJMA 4PQUA 3R3LA 2VQFK 3VENA 4FWOA 3QBWA 4O5BA 3SK3A 1NK8A 5FRMA 1BGXT 3EKUA 4BRCA 3V9WA 3IS9A 2OCEA 3ZETA 3HJFA 4DQRA 3V1OA 1SZ2A 1OH8A 3DLLL 3O5BA 4DR6K 1NJWA 3ZT4A 3NGYA 4JI4K 1L5UA 2P9LA 2V7YA 2I5JA 4HTUA 4GV6A 4YOVA 3QO9A 3VEYA 3AA2A 1JXEA 5HRPA 1SQKA 4CEEA 4IO8A 3UKUB 4F2SA 4Y0WA 4GMJB 2HHHK 3IDHA 4O4GA 3L8BA 3J7AP 2QXFA 3MCPA 1QHTA 2CH5A 4FJ5A 1QQOA 2XY5A 4QS9A 4Z4EA 4JNEA 1OH5A 3AVBA 1JLCA 4DTUA 5AQOA 3SZ2A 2B6AA 3OS2A 4FJNA 1WN7A 1GLFO 2Y1IA 1V4TA 1IJJA 2Z1IA 2ZQBA 4KH4A 4B1YB 3C94A 3MK6A 5J2QA 4B9MA 3O3HA 3SUQA 2OPPA 4K41A 4M42A 4CGGA 4E3SA 4E7LA 3M8SA 4BC2A 3EY1A 5KGXA 4IOCL 3H45C 5AQTA 4CCHA 5SZTA 5FPEA 4ILHA 4UY8O 2GBZA 3NCIA 2G8FA 1GLDG 3RRGA 4JKDA 3TARA 3OYIA 3ZSRA 1HJRA 5HOOA 1GLAG 4CF9A 4E1MA 2FF3B 2ASOA 2VCPA 1K8KB 1VQKN 2E4LA 4CJLA 3WT0A 4DTXA 1B9DA 5BPMA 4CEFA 2UUAK 3H1VX 1YJWN 1ASWA 4CI6A 4PKHA 1EWQA 3VGMA 3O4NA 3ZX0A 4LF4K 3CJ7A 3WNGA 5AQUA 2O8EB 4Z4IA 5BPLA 3ZT0A 2P9SB 4EFHA 4W5RA 1T05A 5C0YA 1XUPO 3PSIA 2HHUA 4DFKA 4CF2A 2FBTA 2O4IA 1OVQA 3ZT1A 4U67L 4M3WA 4NYFA 3IG1A 4Y1CA 4MFBA 2AP1A 2YCHA 2RHKA 4C8MA 2IVNA 4AHUA 4JN4A 4GVMA 3GG4A 4EIAA 3PX0A 5LL6Z 1WAFA 4WF9L 5GAHP 3ZEUA 1ZXOA 5GAGP 4DTJA 5I9EB 3VQPA 1TAQA 4CHZA 1U45A 4CF1A 1XQSC 3N4QA 4WE1A 3RVCA 3V9UA 3M6GA 3ZT2A 3AGKA 3D2EA 4JKGA 3S9HA 2QWQA 4CVNE 1NMNA 3D6RA 1QSSA 1TYQA 1S1UA 4FM1A 3SJJA 3C65A 1BHLA 4GKJK 2WC9A 3HO1A 1KTQA 1GOAA 3CCVN 5BRDA 5F1XA 4YOWA 2VQEK 4CK3A 4CJTA 2FBVA 4H0YB 4RW8A 3CCSN 2XY8A 4QCLA 2O8CB 3SNNA 3AO2A 3O9UA 4C8KA 4DSIA 4KO0A 3CCJN 2IVPA 4ELVA 4FJ9A 4IFYA 4NCBA 4I2PA 3LALA 4DQIA 3FFIA 1WBBA 1EO1A 2ASPA 5AQNA 3PO4A 5AQZA 5LJVA 1YJ9N 2HNDA 3JYTA 2P9IB 1M1KO 2GWJA 3R1XA 4DSJA 3FZLA 2KQ2A 4Z4CA 3MWTA 1W9HA 2P9SA 3WNFA 4CEBA 4ICLA 4KRFA 1O1WA 3TANA 4XH1A 2QWOA 3QNOA 1I3AA 5FPNA 5J2PA 4H0TB 4FK4A 1BA0A 1VRTA 3U4LA 5AZJB 4O0JA 1SKSA 3TSQA 1WUAA 1E4GT 3VEWA 4BRPA 1NGEA 1NGGA 2O8BA 3DI6A 4FLXA 5JS2A 4IKFA 1WB9A 4RTFD 3RSEA 2O4GA 4CFCA 4FJ8A 4C8NA 2RN2A 3V4IA 1TL3A 4JI3K 3MN5A 2Q2RA 1RGIA 2NRTA 3KLFA 4ZTJA 1CZ9A 1XHZA 3K2PA 3RSEB 3P1GA 1C0MA 3PIOL 5AQJA 3KWIA 4DSEA 3T19A 5SWMA 2GX9A 2KTQA 4K25A 1IKWA 4ISFA 2P9UB 5CY4A 2GELA 4FXDA 4FK0A 1BI4A 5DK5A 1QSLA 1S72N 4B3SK 3THWB 4DU3A 4H0VB 1C0UA 2XO7A 1VSJA 4NLCA 3DLEA 3HTVA 4DV1K 4Z0UA 4I6MA 1JLGA 4NB4A 4B3OA 2NRXA 4IZ9A 3SUOA 3QERA 4F3OA 4R5PA 3TAQA 1RDAA 1HKGA 3NF6A 4FJIA 5AQRA 4JRPA 3AY9A 3FZKA 2DFHA 4O8KA 5FLXO 4DTRA 3TTDA 1KLNA 1E3MA 4I6MB 3LZJA 2E6MA 2Z1GA 2BTFA 4NCAA 1D5AA 3KD5E 2BANA 5AZIB 3IUCA 5AR0A 1LAVA 4ILGB 1CZAN 3Q7BA 1MDUB 4BACA 4M3UA 3ULDA 3F9MA 3PY8A 4CEAA 1S5JA 4KKOA 2ZJQL 4BREA 2DY4A 3MN7A 3CI5A 4K8XA 3E9LA 3L3VA 3V9XA 1RTHA 1XWLA 3SQ2A 1N8RO 4YOTA 3P4IA 2G8WA 4B1UB 5DM7L 4FJ7A 1BCOA 1TYQB 3BEXA 3UE5A 2VGMA 4MQ3A 1LOTB 5JS1A 2KFZA 3LPTA 4W5QA 4PWDA 3CIPA 4MLEA 3SV4A 1BA1A 4FLZA 4E7HA 3TPQA 1RT5A 3LL3A 5ADXH 4W5TA 5BN8A 2E2PA 5AZJA 3L2RA 3RMAA 3O08A 2AJQA 3CJCA 2GUPA 1KLMA 4CBWA 2NRZA 3A5NC 2QM1A 3VQCA 2IAJA 4CEQA 1RNHA 1RDCA 4JLHA 4JI5K 3R6MA 3VQ4A 2BGGA 3LP2A 1SL1A 3A0IX 4CERA 4H4OA 1NKEA 1D8YA 1WAJA 5ELZA 5AJ3K 2RE2A 3QDKA 3OHRA 1BQNA 2VWBA 3NF8A 4JKCA 2HBLA 4H5RA 3O3GA 4LH4A 5EXWA 3MECA 4NXMK 4HVJA 5JLFA 4N41A 1W7AA 3OYEA 3LANA 4BGBA 3UB5A 1S9EA 1K8KA 1RTJA 3VERA 1B92A 4KHWA 4YDUC 4PKGA 3LPUA 1W2BM 4HCCA 3L4QA 3O3FA 3DLGA 3QB0A 1RTDA 1RTIA 3BF3A 1HNWK 3SV3A 3V9SA 3CQXA 3C6AA 5AFUA 4PL7A 1WBDA 3R8EA 4FLUA 3TI0A 4NXNK 3VQBA 3ZCMA 4A5BA 1FXXA 4RCHA 1JLEA 3ULEB 1IH7A 3MXMA 1QVFM 1T7PA 3E66A 3ENHA 4M3ZA 3NF7A 2XRIA 3ITHA 3LDLA 4K43A 3L2UA 2P9NA 3HT3A 1I39A 2W40A 1G15A 3HSTB 1XC3A 1RBTA 5M1FA 3J80O 1QSYA 1L3VA 1WSGA 1U2VA 3C7NA 5AQKA 3RRHA 3HK2A 4M3TA 3FFKB 4WYBA 1UOCA 1IV0A 1HYZA 3LAKA 5CHIA 3G0ZA 2H3GX 3UKRB 1UA0A 5C25A 2EWSA 1U2VB 5H1SQ 3ID8A 1OVYA 2YNIA 3WXLA 5TKWA 3HPHA 3BDPA 4KHYA 2DTUA 3ATVA 3DWLA 4OLBA 2IDOA 3QLHA 4DB3A 3NH1A 4CZMA 4H5TA 3RMBA 3NE6A 2OTLN 1KD1O 2ETJA 2QA4N 4A57A 1HLUA 2P5GA 1YVUA 3LP0A 1J54A 3VEOA 4LC9B 3OYGA 3OYMA 2LSNA 1N6QA 4M3YA 4FPAA 1T44A 4OPAA 3AA3A 4NYNA 1NOZA 4AM6A 2B5JA 4DF8A 3QESA 2CGLA 4BG8A 1CZBA 4CHYA 3TU5A 4M7XA 3AVAA 4QAGA 4H0OA 2O8FB 3OYHA 3NMUA 3EL2A 4B1XB 5JLHA 1KXPA 1KAYA 3U9DA 3I56N 4NO7A 3G25A 1DGKN 3U8XA 4CJ4A 1OH6A 2P9PB 1KSPA 4XIUA 2HHSA 4IEIA 4DFPA 2EX3A 1VSDA 2HOEA 4JKHA 1IBKK 3C95A 2NNWA 4JS5A 5A2QO 1R0AA 3CC2N 3CC7N 3P83D 3OS1A 2I7NA 2DPNA 3KLHA 3SQ0A 1HPZA 1Y97A 1GLJO 1CXUA 4PA1A 1TUYA 4CD1A 3WXKA 2KLAA 3QEWA 4KTQA 4CE9A 3VQ6A 4GY2B 3IKMA 4BRNA 4H0PA 4KI6A 3CCMN 1NK9A 4WQ5C 1LCUA 2A5XA 4DQPA 1ZBSA 3NVMA 4G1QA 3LWMA 2ZJRL 4WFBL 3CJAA 1C0TA 1QE1A 3OS0A 1JL1A 1VQPN 4CZJA 3DRSA 1SL0A 1Z26A 3QNNA 4ISEA 1A5XA 4C8OA 5EVZA 4JI6K 4RWTA 4DV7K 4GW6A 4G9ZA 3TABA 2NRWA 3DXMB 5FPDA 2VGNA 2GUIA 1K8AO 4J2DA 1OH7A 4HUEA 3UIQA 3CFOA 4FW1A 1HNIA 1NGBA 1C6VA 2AA4A 4CJUA 3FZMA 3C7NB 5I42A 2HBMA 2YHWA 3FZHA 3L3UA 4O44A 3HRGA 2YHBA 2OZSA 5FPMA 4CJVA 3DRRA 4JKFA 2CH6A 3QBXA 4YFUA 3EZWA 3DXKB 4YORA 4DTSA 1NK0A 4EZ6A 2QI2A 4A61A 3KK3A 4JAXA 4CEOA 4K8ZA 1RBSA 3CPEA 3CM6A 4BRQA 1ASVA 4KBOA 1TVRA 4PKIA 4FK2A 1K9MO 4ISGA 5DM6L 2A41A 1WLJA 3T7ZA 1WSHA 1BDGA 4CEZA 2HBJA 4CW7B 3TSUA 1NWKA 2PYJA 3H46O 4BDYA 3V1QA 1HUXA 3IRXA 1D9FA 4DUZK 2NUBA 1EX4A 4C8LA 4O0IA 1T3VA 3CCEN 1GLBG 1X9JA 3VQEA 1N36K 4CF8A 4CGHA 4BRMA 5KQ8A 1NGIA 4FWQA 3VESA 2FXUA 4CJPA 1Z05A 5KPZA 3AVHA 4WQ4A 2O8EA 4M45A 1VAZA 4OPKA 3BF1A 5T7BA 3LM2A 4FVUA 4CJWA 2OPSA 4LF8K 1HNZK 3PO5A 1RT1A 1A5WA 2ZJPL 3KJVA 1X9SA 2PZSA 4BR2A 5C10A 3A5OC 5E41A 4B9LA 4FM0A 4DV3K 5C42A 3OYBA 4H4MA 5AQGA 4YOUA 5J2NA 1QQMA 5M1QA 5MLCQ 2QK9A 1IKVA 2PYLA 4BRDA 2VWJA 4CK1A 3LM9A 2HW3A 2GV9A 4IO9L 3O1WA 1YI2N 2G8VA 4A62A 4H5NA 4AHRA 3LDQA 3ZETB 1RCHA 4MO5A 4AF1A 4E7KA 3VPZA 3THXA 2HMPA 3OYFA 3CF5L 3VF2A 3D2FB 3JXUA 4BRIA 3K9JA 4BRGA 2FLOA 4JV5K 3OBYA 5AQVA 3VA0A 4JKBA 4LF6K 1HKBA 2Z1HA 4A2BA 1HRHA 3I8DA 1DEJA 2E5LK 4EAHD 2P51A 4DU4A 3KLIA 1R59O 3CYMA 1L3SA 3M3ZA 3ZT3A 1JJ2M 3NDKA 2KHOA 2OANA 2WOMA 3S3NA 3FE1A 3WUHA 4DV5K 2G8IA 4PHTX 5BN9A 3AO1A 3L2VA 5AZIA 5HL7L 1RDUA 1YVNA 4JKGB 4KAZA 3VETA 4CGIA 5J2MA 3T69A 3O8MA 2F7TA 1ATNA 1X9WA 3G4SN 5K14A 2ATQA 3THXB 2BUPA 1TAUA 3ZEUB 4KHSA 1RBRA 2ZGZA 3QINA 1KRPA 3CG7A 5AFUH 5AQIA 3JAMO 3VQDA 2E20A 4CJ3A 1NK5A 5C2FA 2WONA 2F4VK 1JLAA 2Q36A 4NLBA 1T03A 4F8RA 1KFSA 1JCFA 2QTDA 3QFPA 3ENOA 3QETA 3DLKA 1ATRA 2RF2A 4Z4FA 2VYPA 3J81O 4AM7A 2E1YA 4CBXA 3WNHA 2OZMA 1QZ5A 2ZE2A 4JI7K 4BC4A 1X3NA 3VQ8A 3ZLJA 3B6PA 4I9LA 4JHDA 1SKRA 4JS4A 5JVHL 3O1BA 3RMCA 4QOZB 3LDNA 3SMSA 5ADXA 4FZZA 4X64K 4A5AA 3LAMA 1TKZA 1S6QA 5AQLA 3ENBA 2HMIA 1IO2A 3NVKA 4AQYK 3CCQN 4FCYA 5J1EA 3E9OA 3G10A 1CLQA 3RWUA 1BL3A 1HJOA 4CIEA 4YOXA 3L6QA 4RW6A 4B9QA 2E6LA 2RPIA 4EHUA 3DAWA 3SBTA 5C24A 4XEIA 4ID5A 3Q7CA 4B1ZA 3N4PA 4FJHA 2ASMA 2FF6A 3WQTA 1Q81O 3VGLA 3CMAN 3KKSA 4RW7A 1C0GA 2G8KA 4B9SA 3R9PA 3P5JA 3RTVA 2X6NA 1BWFO 4DMNA 4WFNL 5E26A 4JYAK 3ZX2A 1LWFA 3G6EN 4KHUA 4KHQA 3J7YP 1SUQA 4J2BA 5AQMA 3AVLA 1TGOA 1YAGA 2QWNA 1E4FT 3T3FA 1C1AA 1BU6O 3NH2A 5GADP 4HHTA 3SYZA 3VF6A 4GV3A 4FZXC 1ZBFA 4E19A 2YJFA 2FBXA 3CCRN 2YNHA 3AA5X 4CZFA 3KK1A 4K0KK 1VRUA 1RT4A 5I3UA 2X6SA 3HYFA 4B3TK 4CJRA 1S1XA 3OW2M 2HF3A 4ZHRA 2XY6A 3M1FA 2Q0RA 4BC5A 4CFBA 3HP6A 3OYLA 3MX5A 3I0RA 3EO3A 2IGIA 4FPBA 1UA1A 4YOYA 3WXIA 3PUFA 3QMLA 3U6FA 2WTUA 2FSNA 4FOIA 5AQFA 5JICA 3LDOA 4A2AA 2QKBA 1VQMN 3AO3A 1ZBIA 1DTTA 4KPYA 4CJFA 5M1OA 1P90A 4FZYA 4DTPA 4OVLA 1NGAA 5GAEP 3CC4N 1Q18A 3VA3A 3AO4A 1ZC6A 1IG9A 4OLAA 1K6YA 3NAEA 4DR7K 5KRTA 3PLAA 1XC9A 1TK0A 1FKPA 1Q82O 3CCLN 2KKZA 4KB1A 1U6ZA 1P8ZA 2QKKA 4JRQA 4YDUA 2KFNA 1J5EK 1D9DA 3O9RA 4KHPK 3OTOK 3TAPA 1YT3A 3O9SA 2NLXA 2Q97A 1EETA 1HNXK 3EYZA 4DFMA 2YKMA 3DXKA 2V52B 3DXMA 3I55N 4J2AA 4Z94A 1HR0K 5GIPA 2YKNA 4CZIA 5HRRA 4BWJA 1JCGA 2P5OA 1S3XA 4BE2A 2D0BA 4DKWA 2R7YA 2QW9A 5C2DA 4FWRA 3D7EO 5TKYA 3OYCA 4CIFA 4DCHA 3H6EA 2QWMA 4DV0K 3PV8A 3ISNC 5AQPA 3FLCO 3RR7A 1GLCG 4IJAA 2A3ZA 1WSEA 1RDBA 4CZEA 4KH6A 1UWBA 3MXIA 2YI1A 4Z4HA 4CD3A 3CQ8A 3KLEA 3C6TA 1HQEA 1M90O 1YJNN 1EP4A 5FDLA 3VQ9A 3VTIA 1ITGA 3I33A 1YHQN 4DR4K 2YHAA 2CGJA 4M7YA 3HOSA 3ULEA 1N34K 1DLOA 2YHYA 3AVGA 4B9UA 1QS4A 1DKGD 5LMUK 1ZBHA 4BR4A 5JVGL 1C1CA 4RW4A 2D0CA 3FR0A 4M41A 3AA4A 3E01A 1KAXA 4N47A 4B8CA 3AVJA 4PUOA 3ZSVA 3V1RA 4OKEA 3ATUA 3SI6A 4NCGA 3H3NO 3OBWA 1VQLN 3HPGA 2UXCK 3SMPA 2VWKA 2E88A 3ZSXA 4R79A 3WXJA 4MDBA 4Z4GA 4KH5A 1Z25A 3ASMA 4AHSA 1T8EA 1BUPA 1KVBA 4CBUA 4FVMA 1NG9A 3GBTA 1J53A 2E8AA 1ATSA 2JGUA 3B6OA 1BI4B 3OYJA 3CJ9A 4IDKA 1RT7A 4W5OA 4DV4K 3ZX3A 2UXBK 4FJXA 4FWMA 2OTJN 4ZTFA 1X1PA 4DQQA 2HNZA 2JWKA 2UYTA 4EP5A 1CXQA 4IWVA 3NH0A 3OYAA 4CHNA 1FW6A 1UAXA 4AHCA 4KV8A 3AAQA 3HVTA 4U7BA 4JKAA 3EE9A 1QZ6A 4X65K 3CHWA 3F2KA 2FBYA 3K5LA 2E2NA 3H3OB 1NJYA 1BCMA 3QIPA 1XNQK 3DLRA 1TKDA 1XNRK 3KK2A 3VQ5A 5DMRA 2P9LB 3TR8A 3I8BA 5CR4A 2PFUA 1GOCA 3GDQA 5F2RA 3CFRA 2D1KA 3J8AA 3A8YA 3SPZA 4C1NI 5BREA 3OA9A 2IS3A 2CGKA 4O8UA 4WFAL 1WSIA 3OVNA 3T1AA 1IBLK 1NGHA 3CJBA 1VHXA 1XMOK 5E84A 2E2QA 4DV6K 4B9TA 1JLBA 3TTCA 3SUNA 1F21A 2ZM6K 1U49A 3THYA 1TV6A 3LP3A 3VEZA 5LY3A 1NM1A 1TK8A 3KIOA 4N76A 1Q86O 1NGDA 1QQCA 3NFAA 2OYQA 2ZWHA 4IDHA 5HRNA 4KREA 4DTNA 3WXMB 1VSFA 2IVOA 5BR8K 4ILJA 5BRHA 3BY5A 4BVPA 4JK7A 3D0PA 2E2OA 2P1JA 4JD2A 3DOLA 4WCEL 2UXDK 2P9KA 2JWLA 1NK6A 4CJEA 1L3UA 2Q1NA 2NRVA 3CETA 4CZKA 3D2EB 4PL8A 1BISA 4LFCK 1VQ9N 1EKEA 3FGUA 3M8QA 4DLEA 1NLVA 3MMVA 4E1NA 4HTLA 4B8AB 2QWRA 2BH1A 1RDDA 3CM5A 5M1PA 3DLBA 4L3QA 3VMFB 1TK5A 4JI8K 1J9AA 1N33K 3O9QA 2HVIA 4YNQA 1TKTA 4OX9K 1U4BA 4CZLA 1KFDA 1IBMK 4E0DA 4FWPA 2BE2A 3K59A 2HHXA 4JI0K 4B1VA 1S1TA 1WSJA 5M1KA 3MX2A 1S6PA 3ZSYA
chains in the Genus database with same CATH topology
4FYDA 3TAQA 3TAMA 1RDAA 3MAQA 4KAZA 3QEXA 3NF6A 2VG5A 4CGIA 5J2MA 4FJIA 4JRPA 2DFHA 1HNVA 3OYDA 4DTRA 1KLNA 1X9WA 1VSMA 3LZJA 3TAFA 3AV9A 2ATQA 2E6MA 2Z1GA 5K14A 3V6DA 4NCAA 4CJSA 1D5AA 1TAUA 3KD5E 4KHSA 2BANA 4IG3A 3DRPA 1RBRA 2OPRA 1LAVA 3SCXA 3QINA 1KRPA 3CFPA 3CG7A 1JLFA 1BIZA 1RBVA 3F9KA 3SQ4A 1EXQA 3VQDA 4CJ3A 3PX4A 4BACA 1NK5A 3ULDA 1NKCA 2WONA 3KTQA 4M3UA 1JLAA 3PY8A 4CEAA 1S5JA 3I0SA 4KKOA 3V9ZA 3AVFA 1T03A 4F8RA 1KFSA 2DY4A 1NK7A 3QETA 3DLKA 4K8XA 1TKXA 2RF2A 4KTWA 3L3VA 3V9XA 1RTHA 1XWLA 3SQ2A 2BDPA 4EZ9A 4Z4FA 1S1WA 4AILC 3WNHA 2OZMA 1LWCA 3HXMA 1VSKA 2ZE2A 2G8WA 3VQ8A 4FJ7A 1BCOA 1IKYA 1RBUA 3B6PA 4I9LA 1SKRA 4JS4A 3K57A 2W42A 4OKJA 4MQ3A 4DWIA 5JS1A 3RMCA 4QOZB 2KFZA 3LPTA 4W5QA 4DS4A 4PWDA 4FW2A 4FZZA 1RILA 4HCBA 3SV4A 4FLZA 5HRSA 3M8RA 4E7HA 1GOBA 3K5MA 1RT5A 1NJZA 4DSLA 1YTUA 3LAMA 4W5TA 3OYNA 1MU2A 1KVCA 1TKZA 1S6QA 2HMIA 4E89A 1VSHA 4FM2A 1IO2A 3L2RA 3RMAA 2YNGA 3MEDA 4I2QA 4Q0BA 2AJQA 4PY5A 3H08A 1WSFA 1A5VA 4FCYA 1KLMA 3MEEA 3OYKA 5J1EA 4DF4A 3VQCA 3SUPA 3G10A 1CLQA 3RWUA 2IAJA 1BL3A 4CEQA 1RNHA 1RDCA 4L8RB 4CIEA 2XHBA 4JLHA 3DOKA 1HYSA 3VQ4A 4RW6A 3IAYA 3LP2A 1FKOA 2E6LA 2RPIA 5EU7A 1SL1A 2BGGA 2VG7A 5C24A 4BE1A 4CERA 1NKBA 4H4OA 1HYVA 1NKEA 4ID5A 3F73A 2IC3A 5KTQA 4FJHA 1D8YA 1WAJA 3LZIA 4H8KA 4M3RA 3OJUA 4CJKA 3KKSA 4RW7A 1BQNA 4RW9A 2HHQA 1S9GA 3NF8A 2G8KA 4B9SA 3O3GA 4LH4A 3P5JA 3RTVA 2OPQA 1KVAA 2X6NA 3MECA 2Y1JA 5CYMA 1VSIA 3VN5A 4HUGA 4DMNA 1IKXA 3SQ1A 3HP9A 3AVKA 1LWFA 1SV5A 1YTAA 4AHTA 4HVJA 4N41A 1SUQA 1VK0A 4FLVA 2D5RA 4J2EA 4KHQA 4CESA 3LANA 4IG0A 3OYEA 4J2BA 3AVLA 5HBMA 1L3TA 1S9EA 1TGOA 1RTJA 2D0AA 3M8PA 1B92A 3T3FA 4KHWA 1C1AA 5CZ1A 4DLGA 3NH2A 2HNYA 4HHTA 3SYZA 4HCCA 3LPUA 3S3OA 3O3FA 3DLGA 5HP1A 1NJXA 1RTDA 1RTIA 1ZBFA 4E19A 2OA8A 4FZXC 2IOCA 3TAEA 1RT6A 3SV3A 3V9SA 2FBXA 4IFVA 3C6UA 3QIOA 2HHWA 3QEVA 2YNHA 3KLGA 3AA5X 4BDZA 4ELTA 3KK1A 2Q3SA 4FLTA 1VRUA 1RT4A 2VG6A 5I3UA 4FLUA 2X6SA 3HYFA 3TI0A 4DG1A 1X9MA 4F3TA 3VQBA 4CJRA 1S1XA 3ZCMA 1FXXA 4IBNA 1JLEA 3K5NA 1LAWA 2F96A 4ZHRA 1IH7A 3MXMA 4KI4A 2XY6A 1T7PA 1J5OA 1JLQA 4CHPA 3NGZA 4M3ZA 3NF7A 2DFEA 2XRIA 3A2FA 3ITHA 4CFBA 4UQGA 5KGWA 3HP6A 3OYLA 1BQMA 3NBPA 3L2UA 3I0RA 2A1RA 4KHNA 4O55A 3RMDA 2IGIA 2KZZA 3HT3A 4CGJA 1UA1A 1I39A 1ZBUA 3AVIA 1G15A 1RT3A 1HQUA 3HSTB 3L2WA 1RBTA 3PUFA 4CGFA 5KRSA 3U6FA 4DU1A 1QSYA 2EHGA 2B4JA 1L3VA 3ZSWA 4HUFA 1WSGA 3RRHA 2F8SA 3HK2A 3U3YA 4M3TA 3MEGA 4CHQA 4OPJA 4KB0A 5D3GA 3VQ7A 2F8TA 2KZMA 1UOCA 1HYZA 1RT2A 3LAKA 4CFAA 4FJMA 4PQUA 4K8ZA 2QKBA 4CECA 3AO3A 1ZBIA 1DTTA 3G0ZA 4KPYA 4CJFA 1UA0A 4O5BA 3ZSQA 4FZYA 4E7JA 1NK8A 1LV5A 4B9VA 5C25A 1KCFA 5FRMA 4LSLA 4OGEA 1BGXT 4OVLA 4DTPA 2HB5A 3VA3A 3V9WA 1S1VA 2YNIA 3IS9A 1QTMA 3AO4A 3HJFA 1IG9A 2RKIA 3HPHA 4OJRA 4DQRA 3BDPA 3V1OA 4KHYA 4OLAA 4OLBA 1K6YA 3NAEA 1U47A 3PX6A 2DTUA 2IDOA 5KRTA 3DM2A 3QLHA 3NH1A 1NJWA 1XC9A 1TK0A 1FKPA 3ZT4A 3RMBA 3NE6A 3NGYA 1B9FA 4AHVA 4KB1A 2ETJA 2ITGA 1W0HA 3U3GA 1L5UA 2QKKA 4JRQA 2I5JA 4HTUA 2P5GA 1YVUA 2KFNA 3ZSZA 1LW0A 3LP0A 3QO9A 3QEIA 3AA2A 1J54A 2FC0A 3AVNA 3HM9A 1JXEA 1D9DA 3TAPA 1YT3A 4OKKA 3OYGA 5HRPA 3OYMA 4CEEA 2LSNA 1EETA 1N6QA 3EYZA 4DFMA 4F2SA 4M3YA 2YKMA 1U48A 4GMJB 3TAGA 4J2AA 4O4GA 2YKNA 3AA3A 3L8BA 4NYNA 1NOZA 2B5JA 2QXFA 4DF8A 3QESA 5HRRA 4BWJA 2P5OA 4AH9A 4BE2A 2HVHA 3LP1A 2D0BA 1CZBA 4CHYA 2R7YA 1QHTA 3ZSOA 4QAGA 3AVAA 4FJ5A 2XY5A 2HHVA 3OYHA 4Z4EA 4DSKA 3OYCA 4BWMA 4CIFA 3AVBA 1JLCA 4DTUA 1LWEA 3SZ2A 2B6AA 3OS2A 4FJNA 1WN7A 3DMJA 2Y1IA 4CJ4A 4CF0A 3PV8A 3ISNC 1JXBA 2ZQBA 2Z1IA 3HPOA 1KSPA 3RR7A 4ELUA 3C94A 5J2QA 4B9MA 4XIUA 3D45A 3O3HA 3SUQA 2OPPA 1WSEA 2ZD1A 4KFBA 1RDBA 4KHUA 2HHSA 3V81A 1UWBA 4DFPA 3MXIA 4M42A 4CGGA 4E3SA 4Z4HA 4E7LA 3M8SA 2EX3A 3EY1A 1VSDA 5KGXA 3CQ8A 3C95A 4CCHA 3KLEA 5SZTA 3KD1E 3C6TA 1HQEA 4JS5A 1R0AA 1TL1A 1JKHA 2GBZA 1EP4A 3NCIA 2G8FA 5FDLA 3VQ9A 1NK4A 3P83D 3OS1A 3KLHA 1ITGA 3SQ0A 3RRGA 1JL2A 1HPZA 1Y97A 5CYQA 5FROA 4PA1A 1CXUA 1FK9A 3OYIA 3ZSRA 3TARA 4FJGA 1HJRA 2X74A 2YHAA 4CF9A 3DYAA 1DLOA 3AVGA 4E1MA 3QEWA 4B9UA 1QS4A 4KTZA 4KTQA 1ZBHA 4CE9A 2E4LA 1BIUA 4CJLA 3VQ6A 4DTMA 3S3MA 4DS5A 1C1CA 4DTXA 1N5YA 4RW4A 2D0CA 1B9DA 4M41A 3AA4A 4CJ5A 3E01A 3VQQA 4KI6A 4N47A 4CEFA 1U04A 2G8HA 4B8CA 1NK9A 4M3XA 1XI1A 3ZSYA 4DQPA 3AVJA 3LWMA 1ASWA 4G1QA 4E7IA 3QEPA 4PUOA 5CZ2A 3ZSVA 3V1RA 3O4NA 1C0TA 1QE1A 3OS0A 1JL1A 4OKEA 3DRSA 1SL0A 4LH5A 1Z26A 3WNGA 3SI6A 4NCGA 3QNNA 1A5XA 4Z4IA 4C8OA 2Z1JA 3ZT0A 4W5RA 3VQAA 3NGIA 4GW6A 1XHXA 3TABA 1T05A 3HPGA 2YNFA 3HVRA 2VWKA 3ZSXA 3BGRA 1REVA 4FLWA 4DFKA 3SPYA 2HHUA 4CF2A 4I7FA 3K58A 2FBTA 4DFJA 2O4IA 1ZBLA 2GUIA 3RR8A 3ZT1A 4J2DA 4Z4GA 4M3WA 4NYFA 3IG1A 4HUEA 1Z25A 3ASMA 3CFOA 3UIQA 4AHSA 4Y1CA 4N56A 4EP4A 4MFBA 1T8EA 1KVBA 4FW1A 3DLHA 1HNIA 4FVMA 4C8MA 5HLFA 4AHUA 1C6VA 1J53A 4GVMA 1SKWA 2JGUA 4CJUA 4B9NA 4FJLA 4LY7A 5I42A 3B6OA 1BI4B 3OYJA 1Q9YA 3PX0A 3MXJA 4BDPA 3L3UA 1WAFA 5FRNA 4IDKA 4EZ6A 4O44A 1RT7A 2YHBA 4W5OA 4DTJA 3VQPA 3THVA 2OZSA 1TAQA 4CHZA 1U45A 4CF1A 1VSLA 4CJVA 3DRRA 4FJXA 4WE1A 3V9UA 4YFUA 4ZTFA 4I9QA 4DTOA 1X1PA 4DTSA 3TWHA 4CFDA 4DQQA 2JLEA 2HNZA 3ZT2A 4DSFA 4LSNA 4EP5A 1NK0A 1CXQA 3KK3A 3NH0A 4CEOA 1DTQA 1RBSA 3OYAA 3LDSA 4CHNA 3CM6A 3S9HA 1LW2A 1QSSA 4W5NA 1S1UA 1ASVA 2KW4A 4FM1A 1TVRA 3SJJA 2XY7A 1BHLA 4FK2A 1UAXA 3HO1A 1KTQA 4AHCA 1GOAA 1NOYA 4KV8A 3HVTA 3JSMA 4CJQA 3NF9A 1C1BA 1WLJA 4CJTA 2FBVA 4CK3A 3OJSA 4RW8A 2HHTA 1WSHA 2XY8A 4QCLA 4CEZA 2FBYA 3K5LA 2PYJA 4BDYA 3V1QA 3IRXA 1WNSA 3SNNA 1BCMA 1NJYA 2NUBA 1EX4A 2X78A 3AO2A 3QIPA 1D9FA 4C8KA 4DSIA 4KO0A 3DLRA 1TKDA 4C8LA 4ELVA 4O0IA 4Y1DA 4IFYA 3VQ5A 3KK2A 5DMRA 4FJ9A 4NCBA 4I2PA 3LALA 3TR8A 4DQIA 3FFIA 3VQEA 2G8UA 1GOCA 3CFRA 4CF8A 4CGHA 3PO4A 3SPZA 2HNDA 3JYTA 4BE0A 3LWLA 1ASUA 2IS3A 4CJPA 3AVHA 1WSIA 2KQ2A 3OVNA 3T1AA 4Z4CA 3EZ5A 4DSJA 4M45A 4OPKA 1W9HA 3NHGA 4B9TA 4OGCA 1JLBA 4DQSA 5T7BA 1F21A 3WNFA 3SUNA 1U49A 4CEBA 1Q9XA 1TV6A 3LP3A 4ICLA 4CJWA 2OPSA 4KRFA 3PO5A 1O1WA 3TANA 1TK8A 3KIOA 1RT1A 4N76A 1QQCA 3NFAA 4CEDA 1A5WA 1HMVA 3KJVA 2OYQA 4F2RA 3QNOA 1X9SA 1I3AA 1ZYQA 2PZSA 4N5SA 5J2PA 5HRNA 4FK4A 5E41A 4KREA 4DTNA 1VRTA 4FM0A 4B9LA 1VSFA 4Q5VA 4O0JA 1SKSA 5C42A 4RG8A 3OYBA 4H4MA 5HROA 3HL8A 5J2NA 2QK9A 1IKVA 2PYLA 2A1SA 3DI6A 4FLXA 5JS2A 3ALYA 3O4QA 3WNEA 3D0PA 4FLYA 2VWJA 2PY5A 4IKFA 4CK1A 2P1JA 4CFCA 2O4GA 2GV9A 3DOLA 4FJ8A 2HW3A 2G8VA 4C8NA 2RN2A 3V4IA 4CJEA 1TL3A 4CK2A 1NK6A 1L3UA 4ID1A 4AHRA 4FJKA 1RCHA 2DFFA 4E7KA 4CIGA 4B08A 3OYFA 3AVMA 3KLFA 3AVCA 4ZTJA 1CZ9A 2YV0X 1BISA 1XHZA 1EKEA 3K2PA 4F4KA 3M8QA 4FJJA 4DLEA 3P1GA 4E1NA 3KKRA 1C0MA 4B8AB 4DSEA 3T19A 5SWMA 3DLBA 1RDDA 3CM5A 3VA0A 2KTQA 1TK5A 1IKWA 5CY4A 2Z1HA 1J9AA 1HRHA 4LD0A 4FXDA 4FK0A 1BI4A 5DK5A 1TKTA 4YNQA 1QSLA 3K5OA 3I8DA 2HVIA 2P51A 4DU3A 4DU4A 1U4BA 1C0UA 3KLIA 3CYMA 1KFDA 2XO7A 1SL2A 1L3SA 1VSJA 4CGDA 4E0DA 4TSXA 2BE2A 3ZT3A 3L2QA 3K59A 2HHXA 3NDKA 5KI6A 2WOMA 3AO5A 3DLEA 4CHOA 3S3NA 1S1TA 4Z0UA 1WSJA 2G8IA 1VSEA 1JLGA 3OY9A 4B3OA 3SUOA 1S6PA 1Q8IA 3AO1A 4R5PA 3L2VA 3QERA 4F3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FYD A;  3TAQ A;  3TAM A;  1RDA A;  3MAQ A;  4KAZ A;  3QEX A;  3NF6 A;  2VG5 A;  4CGI A;  5J2M A;  4FJI A;  4JRP A;  2DFH A;  1HNV A;  3OYD A;  4DTR A;  1KLN A;  1X9W A;  1VSM A;  3LZJ A;  3TAF A;  3AV9 A;  2ATQ A;  2E6M A;  2Z1G A;  5K14 A;  3V6D A;  4NCA A;  4CJS A;  1D5A A;  1TAU A;  3KD5 E;  4KHS A;  2BAN A;  4IG3 A;  3DRP A;  1RBR A;  2OPR A;  1LAV A;  3SCX A;  3QIN A;  1KRP A;  3CFP A;  3CG7 A;  1JLF A;  1BIZ A;  1RBV A;  3F9K A;  3SQ4 A;  1EXQ A;  3VQD A;  4CJ3 A;  3PX4 A;  4BAC A;  1NK5 A;  3ULD A;  1NKC A;  2WON A;  3KTQ A;  4M3U A;  1JLA A;  3PY8 A;  4CEA A;  1S5J A;  3I0S A;  4KKO A;  3V9Z A;  3AVF A;  1T03 A;  4F8R A;  1KFS A;  2DY4 A;  1NK7 A;  3QET A;  3DLK A;  4K8X A;  1TKX A;  2RF2 A;  4KTW A;  3L3V A;  3V9X A;  1RTH A;  1XWL A;  3SQ2 A;  2BDP A;  4EZ9 A;  4Z4F A;  1S1W A;  4AIL C;  3WNH A;  2OZM A;  1LWC A;  3HXM A;  1VSK A;  2ZE2 A;  2G8W A;  3VQ8 A;  4FJ7 A;  1BCO A;  1IKY A;  1RBU A;  3B6P A;  4I9L A;  1SKR A;  4JS4 A;  3K57 A;  2W42 A;  4OKJ A;  4MQ3 A;  4DWI A;  5JS1 A;  3RMC A;  4QOZ B;  2KFZ A;  3LPT A;  4W5Q A;  4DS4 A;  4PWD A;  4FW2 A;  4FZZ A;  1RIL A;  4HCB A;  3SV4 A;  4FLZ A;  5HRS A;  3M8R A;  4E7H A;  1GOB A;  3K5M A;  1RT5 A;  1NJZ A;  4DSL A;  1YTU A;  3LAM A;  4W5T A;  3OYN A;  1MU2 A;  1KVC A;  1TKZ A;  1S6Q A;  2HMI A;  4E89 A;  1VSH A;  4FM2 A;  1IO2 A;  3L2R A;  3RMA A;  2YNG A;  3MED A;  4I2Q A;  4Q0B A;  2AJQ A;  4PY5 A;  3H08 A;  1WSF A;  1A5V A;  4FCY A;  1KLM A;  3MEE A;  3OYK A;  5J1E A;  4DF4 A;  3VQC A;  3SUP A;  3G10 A;  1CLQ A;  3RWU A;  2IAJ A;  1BL3 A;  4CEQ A;  1RNH A;  1RDC A;  4L8R B;  4CIE A;  2XHB A;  4JLH A;  3DOK A;  1HYS A;  3VQ4 A;  4RW6 A;  3IAY A;  3LP2 A;  1FKO A;  2E6L A;  2RPI A;  5EU7 A;  1SL1 A;  2BGG A;  2VG7 A;  5C24 A;  4BE1 A;  4CER A;  1NKB A;  4H4O A;  1HYV A;  1NKE A;  4ID5 A;  3F73 A;  2IC3 A;  5KTQ A;  4FJH A;  1D8Y A;  1WAJ A;  3LZI A;  4H8K A;  4M3R A;  3OJU A;  4CJK A;  3KKS A;  4RW7 A;  1BQN A;  4RW9 A;  2HHQ A;  1S9G A;  3NF8 A;  2G8K A;  4B9S A;  3O3G A;  4LH4 A;  3P5J A;  3RTV A;  2OPQ A;  1KVA A;  2X6N A;  3MEC A;  2Y1J A;  5CYM A;  1VSI A;  3VN5 A;  4HUG A;  4DMN A;  1IKX A;  3SQ1 A;  3HP9 A;  3AVK A;  1LWF A;  1SV5 A;  1YTA A;  4AHT A;  4HVJ A;  4N41 A;  1SUQ A;  1VK0 A;  4FLV A;  2D5R A;  4J2E A;  4KHQ A;  4CES A;  3LAN A;  4IG0 A;  3OYE A;  4J2B A;  3AVL A;  5HBM A;  1L3T A;  1S9E A;  1TGO A;  1RTJ A;  2D0A A;  3M8P A;  1B92 A;  3T3F A;  4KHW A;  1C1A A;  5CZ1 A;  4DLG A;  3NH2 A;  2HNY A;  4HHT A;  3SYZ A;  4HCC A;  3LPU A;  3S3O A;  3O3F A;  3DLG A;  5HP1 A;  1NJX A;  1RTD A;  1RTI A;  1ZBF A;  4E19 A;  2OA8 A;  4FZX C;  2IOC A;  3TAE A;  1RT6 A;  3SV3 A;  3V9S A;  2FBX A;  4IFV A;  3C6U A;  3QIO A;  2HHW A;  3QEV A;  2YNH A;  3KLG A;  3AA5 X;  4BDZ A;  4ELT A;  3KK1 A;  2Q3S A;  4FLT A;  1VRU A;  1RT4 A;  2VG6 A;  5I3U A;  4FLU A;  2X6S A;  3HYF A;  3TI0 A;  4DG1 A;  1X9M A;  4F3T A;  3VQB A;  4CJR A;  1S1X A;  3ZCM A;  1FXX A;  4IBN A;  1JLE A;  3K5N A;  1LAW A;  2F96 A;  4ZHR A;  1IH7 A;  3MXM A;  4KI4 A;  2XY6 A;  1T7P A;  1J5O A;  1JLQ A;  4CHP A;  3NGZ A;  4M3Z A;  3NF7 A;  2DFE A;  2XRI A;  3A2F A;  3ITH A;  4CFB A;  4UQG A;  5KGW A;  3HP6 A;  3OYL A;  1BQM A;  3NBP A;  3L2U A;  3I0R A;  2A1R A;  4KHN A;  4O55 A;  3RMD A;  2IGI A;  2KZZ A;  3HT3 A;  4CGJ A;  1UA1 A;  1I39 A;  1ZBU A;  3AVI A;  1G15 A;  1RT3 A;  1HQU A;  3HST B;  3L2W A;  1RBT A;  3PUF A;  4CGF A;  5KRS A;  3U6F A;  4DU1 A;  1QSY A;  2EHG A;  2B4J A;  1L3V A;  3ZSW A;  4HUF A;  1WSG A;  3RRH A;  2F8S A;  3HK2 A;  3U3Y A;  4M3T A;  3MEG A;  4CHQ A;  4OPJ A;  4KB0 A;  5D3G A;  3VQ7 A;  2F8T A;  2KZM A;  1UOC A;  1HYZ A;  1RT2 A;  3LAK A;  4CFA A;  4FJM A;  4PQU A;  4K8Z A;  2QKB A;  4CEC A;  3AO3 A;  1ZBI A;  1DTT A;  3G0Z A;  4KPY A;  4CJF A;  1UA0 A;  4O5B A;  3ZSQ A;  4FZY A;  4E7J A;  1NK8 A;  1LV5 A;  4B9V A;  5C25 A;  1KCF A;  5FRM A;  4LSL A;  4OGE A;  1BGX T;  4OVL A;  4DTP A;  2HB5 A;  3VA3 A;  3V9W A;  1S1V A;  2YNI A;  3IS9 A;  1QTM A;  3AO4 A;  3HJF A;  1IG9 A;  2RKI A;  3HPH A;  4OJR A;  4DQR A;  3BDP A;  3V1O A;  4KHY A;  4OLA A;  4OLB A;  1K6Y A;  3NAE A;  1U47 A;  3PX6 A;  2DTU A;  2IDO A;  5KRT A;  3DM2 A;  3QLH A;  3NH1 A;  1NJW A;  1XC9 A;  1TK0 A;  1FKP A;  3ZT4 A;  3RMB A;  3NE6 A;  3NGY A;  1B9F A;  4AHV A;  4KB1 A;  2ETJ A;  2ITG A;  1W0H A;  3U3G A;  1L5U A;  2QKK A;  4JRQ A;  2I5J A;  4HTU A;  2P5G A;  1YVU A;  2KFN A;  3ZSZ A;  1LW0 A;  3LP0 A;  3QO9 A;  3QEI A;  3AA2 A;  1J54 A;  2FC0 A;  3AVN A;  3HM9 A;  1JXE A;  1D9D A;  3TAP A;  1YT3 A;  4OKK A;  3OYG A;  5HRP A;  3OYM A;  4CEE A;  2LSN A;  1EET A;  1N6Q A;  3EYZ A;  4DFM A;  4F2S A;  4M3Y A;  2YKM A;  1U48 A;  4GMJ B;  3TAG A;  4J2A A;  4O4G A;  2YKN A;  3AA3 A;  3L8B A;  4NYN A;  1NOZ A;  2B5J A;  2QXF A;  4DF8 A;  3QES A;  5HRR A;  4BWJ A;  2P5O A;  4AH9 A;  4BE2 A;  2HVH A;  3LP1 A;  2D0B A;  1CZB A;  4CHY A;  2R7Y A;  1QHT A;  3ZSO A;  4QAG A;  3AVA A;  4FJ5 A;  2XY5 A;  2HHV A;  3OYH A;  4Z4E A;  4DSK A;  3OYC A;  4BWM A;  4CIF A;  3AVB A;  1JLC A;  4DTU A;  1LWE A;  3SZ2 A;  2B6A A;  3OS2 A;  4FJN A;  1WN7 A;  3DMJ A;  2Y1I A;  4CJ4 A;  4CF0 A;  3PV8 A;  3ISN C;  1JXB A;  2ZQB A;  2Z1I A;  3HPO A;  1KSP A;  3RR7 A;  4ELU A;  3C94 A;  5J2Q A;  4B9M A;  4XIU A;  3D45 A;  3O3H A;  3SUQ A;  2OPP A;  1WSE A;  2ZD1 A;  4KFB A;  1RDB A;  4KHU A;  2HHS A;  3V81 A;  1UWB A;  4DFP A;  3MXI A;  4M42 A;  4CGG A;  4E3S A;  4Z4H A;  4E7L A;  3M8S A;  2EX3 A;  3EY1 A;  1VSD A;  5KGX A;  3CQ8 A;  3C95 A;  4CCH A;  3KLE A;  5SZT A;  3KD1 E;  3C6T A;  1HQE A;  4JS5 A;  1R0A A;  1TL1 A;  1JKH A;  2GBZ A;  1EP4 A;  3NCI A;  2G8F A;  5FDL A;  3VQ9 A;  1NK4 A;  3P83 D;  3OS1 A;  3KLH A;  1ITG A;  3SQ0 A;  3RRG A;  1JL2 A;  1HPZ A;  1Y97 A;  5CYQ A;  5FRO A;  4PA1 A;  1CXU A;  1FK9 A;  3OYI A;  3ZSR A;  3TAR A;  4FJG A;  1HJR A;  2X74 A;  2YHA A;  4CF9 A;  3DYA A;  1DLO A;  3AVG A;  4E1M A;  3QEW A;  4B9U A;  1QS4 A;  4KTZ A;  4KTQ A;  1ZBH A;  4CE9 A;  2E4L A;  1BIU A;  4CJL A;  3VQ6 A;  4DTM A;  3S3M A;  4DS5 A;  1C1C A;  4DTX A;  1N5Y A;  4RW4 A;  2D0C A;  1B9D A;  4M41 A;  3AA4 A;  4CJ5 A;  3E01 A;  3VQQ A;  4KI6 A;  4N47 A;  4CEF A;  1U04 A;  2G8H A;  4B8C A;  1NK9 A;  4M3X A;  1XI1 A;  3ZSY A;  4DQP A;  3AVJ A;  3LWM A;  1ASW A;  4G1Q A;  4E7I A;  3QEP A;  4PUO A;  5CZ2 A;  3ZSV A;  3V1R A;  3O4N A;  1C0T A;  1QE1 A;  3OS0 A;  1JL1 A;  4OKE A;  3DRS A;  1SL0 A;  4LH5 A;  1Z26 A;  3WNG A;  3SI6 A;  4NCG A;  3QNN A;  1A5X A;  4Z4I A;  4C8O A;  2Z1J A;  3ZT0 A;  4W5R A;  3VQA A;  3NGI A;  4GW6 A;  1XHX A;  3TAB A;  1T05 A;  3HPG A;  2YNF A;  3HVR A;  2VWK A;  3ZSX A;  3BGR A;  1REV A;  4FLW A;  4DFK A;  3SPY A;  2HHU A;  4CF2 A;  4I7F A;  3K58 A;  2FBT A;  4DFJ A;  2O4I A;  1ZBL A;  2GUI A;  3RR8 A;  3ZT1 A;  4J2D A;  4Z4G A;  4M3W A;  4NYF A;  3IG1 A;  4HUE A;  1Z25 A;  3ASM A;  3CFO A;  3UIQ A;  4AHS A;  4Y1C A;  4N56 A;  4EP4 A;  4MFB A;  1T8E A;  1KVB A;  4FW1 A;  3DLH A;  1HNI A;  4FVM A;  4C8M A;  5HLF A;  4AHU A;  1C6V A;  1J53 A;  4GVM A;  1SKW A;  2JGU A;  4CJU A;  4B9N A;  4FJL A;  4LY7 A;  5I42 A;  3B6O A;  1BI4 B;  3OYJ A;  1Q9Y A;  3PX0 A;  3MXJ A;  4BDP A;  3L3U A;  1WAF A;  5FRN A;  4IDK A;  4EZ6 A;  4O44 A;  1RT7 A;  2YHB A;  4W5O A;  4DTJ A;  3VQP A;  3THV A;  2OZS A;  1TAQ A;  4CHZ A;  1U45 A;  4CF1 A;  1VSL A;  4CJV A;  3DRR A;  4FJX A;  4WE1 A;  3V9U A;  4YFU A;  4ZTF A;  4I9Q A;  4DTO A;  1X1P A;  4DTS A;  3TWH A;  4CFD A;  4DQQ A;  2JLE A;  2HNZ A;  3ZT2 A;  4DSF A;  4LSN A;  4EP5 A;  1NK0 A;  1CXQ A;  3KK3 A;  3NH0 A;  4CEO A;  1DTQ A;  1RBS A;  3OYA A;  3LDS A;  4CHN A;  3CM6 A;  3S9H A;  1LW2 A;  1QSS A;  4W5N A;  1S1U A;  1ASV A;  2KW4 A;  4FM1 A;  1TVR A;  3SJJ A;  2XY7 A;  1BHL A;  4FK2 A;  1UAX A;  3HO1 A;  1KTQ A;  4AHC A;  1GOA A;  1NOY A;  4KV8 A;  3HVT A;  3JSM A;  4CJQ A;  3NF9 A;  1C1B A;  1WLJ A;  4CJT A;  2FBV A;  4CK3 A;  3OJS A;  4RW8 A;  2HHT A;  1WSH A;  2XY8 A;  4QCL A;  4CEZ A;  2FBY A;  3K5L A;  2PYJ A;  4BDY A;  3V1Q A;  3IRX A;  1WNS A;  3SNN A;  1BCM A;  1NJY A;  2NUB A;  1EX4 A;  2X78 A;  3AO2 A;  3QIP A;  1D9F A;  4C8K A;  4DSI A;  4KO0 A;  3DLR A;  1TKD A;  4C8L A;  4ELV A;  4O0I A;  4Y1D A;  4IFY A;  3VQ5 A;  3KK2 A;  5DMR A;  4FJ9 A;  4NCB A;  4I2P A;  3LAL A;  3TR8 A;  4DQI A;  3FFI A;  3VQE A;  2G8U A;  1GOC A;  3CFR A;  4CF8 A;  4CGH A;  3PO4 A;  3SPZ A;  2HND A;  3JYT A;  4BE0 A;  3LWL A;  1ASU A;  2IS3 A;  4CJP A;  3AVH A;  1WSI A;  2KQ2 A;  3OVN A;  3T1A A;  4Z4C A;  3EZ5 A;  4DSJ A;  4M45 A;  4OPK A;  1W9H A;  3NHG A;  4B9T A;  4OGC A;  1JLB A;  4DQS A;  5T7B A;  1F21 A;  3WNF A;  3SUN A;  1U49 A;  4CEB A;  1Q9X A;  1TV6 A;  3LP3 A;  4ICL A;  4CJW A;  2OPS A;  4KRF A;  3PO5 A;  1O1W A;  3TAN A;  1TK8 A;  3KIO A;  1RT1 A;  4N76 A;  1QQC A;  3NFA A;  4CED A;  1A5W A;  1HMV A;  3KJV A;  2OYQ A;  4F2R A;  3QNO A;  1X9S A;  1I3A A;  1ZYQ A;  2PZS A;  4N5S A;  5J2P A;  5HRN A;  4FK4 A;  5E41 A;  4KRE A;  4DTN A;  1VRT A;  4FM0 A;  4B9L A;  1VSF A;  4Q5V A;  4O0J A;  1SKS A;  5C42 A;  4RG8 A;  3OYB A;  4H4M A;  5HRO A;  3HL8 A;  5J2N A;  2QK9 A;  1IKV A;  2PYL A;  2A1S A;  3DI6 A;  4FLX A;  5JS2 A;  3ALY A;  3O4Q A;  3WNE A;  3D0P A;  4FLY A;  2VWJ A;  2PY5 A;  4IKF A;  4CK1 A;  2P1J A;  4CFC A;  2O4G A;  2GV9 A;  3DOL A;  4FJ8 A;  2HW3 A;  2G8V A;  4C8N A;  2RN2 A;  3V4I A;  4CJE A;  1TL3 A;  4CK2 A;  1NK6 A;  1L3U A;  4ID1 A;  4AHR A;  4FJK A;  1RCH A;  2DFF A;  4E7K A;  4CIG A;  4B08 A;  3OYF A;  3AVM A;  3KLF A;  3AVC A;  4ZTJ A;  1CZ9 A;  2YV0 X;  1BIS A;  1XHZ A;  1EKE A;  3K2P A;  4F4K A;  3M8Q A;  4FJJ A;  4DLE A;  3P1G A;  4E1N A;  3KKR A;  1C0M A;  4B8A B;  4DSE A;  3T19 A;  5SWM A;  3DLB A;  1RDD A;  3CM5 A;  3VA0 A;  2KTQ A;  1TK5 A;  1IKW A;  5CY4 A;  2Z1H A;  1J9A A;  1HRH A;  4LD0 A;  4FXD A;  4FK0 A;  1BI4 A;  5DK5 A;  1TKT A;  4YNQ A;  1QSL A;  3K5O A;  3I8D A;  2HVI A;  2P51 A;  4DU3 A;  4DU4 A;  1U4B A;  1C0U A;  3KLI A;  3CYM A;  1KFD A;  2XO7 A;  1SL2 A;  1L3S A;  1VSJ A;  4CGD A;  4E0D A;  4TSX A;  2BE2 A;  3ZT3 A;  3L2Q A;  3K59 A;  2HHX A;  3NDK A;  5KI6 A;  2WOM A;  3AO5 A;  3DLE A;  4CHO A;  3S3N A;  1S1T A;  4Z0U A;  1WSJ A;  2G8I A;  1VSE A;  1JLG A;  3OY9 A;  4B3O A;  3SUO A;  1S6P A;  1Q8I A;  3AO1 A;  4R5P A;  3L2V A;  3QER A;  4F3O A; 
#chains in the Genus database with same CATH topology
 3TAM A;  3MAQ A;  5AQQ A;  3QEX A;  5AQS A;  2VG5 A;  5EY4 A;  3SAG A;  1NMD A;  1HNV A;  1BO5 O;  2QEX N;  1NGC A;  4YY3 K;  3THY B;  1VSM A;  3AV9 A;  2A40 A;  3O6W A;  5C15 A;  3SCX A;  3CFP A;  3WEE B;  1JLF A;  1RBV A;  5KPR A;  3P39 A;  5AQY A;  3JS6 A;  1NKC A;  2WBN A;  1NGJ A;  3HM8 A;  3V9Z A;  4BC3 A;  4IOX A;  4M3X A;  2F9T A;  1T6D A;  1QQN A;  4C23 A;  2BDP A;  2I7P A;  4AIL C;  1LWC A;  3HXM A;  3HOT A;  1IKY A;  1RBU A;  3MDQ A;  1RIL A;  5HRS A;  3M8R A;  1GOB A;  4FL9 A;  3K5M A;  4DSL A;  3OYN A;  1MU2 A;  1KVC A;  3QFU A;  1VSH A;  4FM2 A;  1Z6R A;  3AAR A;  5AQW A;  2YNG A;  3MED A;  4I2Q A;  3H08 A;  1A5V A;  3SJH A;  3MEE A;  3OYK A;  4DF4 A;  3SUP A;  1NGF A;  3W0L A;  4F9O A;  4XH5 A;  3DOK A;  1VQO N;  1HYS A;  3T1H K;  5EU7 A;  3GE1 A;  2VG7 A;  3P38 A;  2IC3 A;  5KTQ A;  4FO0 A;  3OJU A;  2V51 B;  1H1V A;  4RW9 A;  3SBG A;  3IMX A;  3VF4 A;  1K73 O;  2HHQ A;  3BZK A;  5KQD A;  4BRO A;  1FJG K;  2OPQ A;  5CYM A;  3SQ1 A;  3MN9 A;  1IKX A;  3HP9 A;  3AVK A;  1VQ5 N;  1SV5 A;  3PSF A;  4JI1 K;  3WQU A;  4AHT A;  5GIN A;  4FLV A;  2D5R A;  4J2E A;  4CES A;  4IG0 A;  4JK8 A;  4IXC A;  1ESV A;  5HBM A;  4DUY K;  1Q7Y O;  1L3T A;  2A6A A;  4BRF A;  4BRL A;  3M8P A;  4BRK A;  4DLG A;  5CZ1 A;  2HNY A;  5AQX A;  4X62 K;  5HP1 A;  1NJX A;  1GLE G;  3TAE A;  1RT6 A;  3IFR A;  2YX6 A;  4FOE A;  3C6U A;  3QIO A;  4IFV A;  3VEV A;  2HF4 A;  4BG9 A;  3EKS A;  3QEV A;  3KLG A;  1N32 K;  2HHW A;  4JHD B;  4ELT A;  5C12 A;  3E1Y A;  4B3R K;  4DG1 A;  4F3T A;  2GWK A;  4IBN A;  3K5N A;  4BRA A;  1J5O A;  1JLQ A;  4CHP A;  3NGZ A;  2HST A;  4UQG A;  4DR2 K;  1BQM A;  2A1R A;  4KHN A;  4O55 A;  4X66 K;  2D0P A;  4CGJ A;  1ZBU A;  3AVI A;  1RT3 A;  1HQU A;  3L2W A;  4CZG A;  4DU1 A;  5EOY A;  3ZSW A;  4HUF A;  2IIR A;  2F8S A;  1O13 A;  1TUU A;  3E9P A;  3U3Y A;  4DR5 K;  3MEG A;  5D3G A;  1X3M A;  4KB0 A;  5AQH A;  4CFA A;  3MN6 A;  3EN9 A;  3KHY A;  4CEC A;  1JCE A;  3ZSQ A;  1D4X A;  3DJC A;  4E7J A;  1LV5 A;  4B9V A;  1KCF A;  4LSL A;  4OGE A;  2HB5 A;  3W3D A;  1S1V A;  1QTM A;  2GEM A;  2RKI A;  4FWN A;  2WFB A;  3FZF A;  4OJR A;  1U47 A;  3PX6 A;  3DM2 A;  2W6K A;  3UKR A;  1BG3 A;  3CQY A;  4A59 A;  4BR7 A;  3KWG A;  4HWI A;  1B9F A;  4AHV A;  1VQ6 N;  2ITG A;  1W0H A;  3U3G A;  4IFE A;  3ZSZ A;  1LW0 A;  3QEI A;  1ILY A;  3AVN A;  2FC0 A;  3HM9 A;  4OKK A;  4LF7 K;  1VQN N;  2P9I A;  3THW A;  1U48 A;  3TAG A;  1NU0 A;  1HX1 A;  4JEP A;  4AH9 A;  4H5W A;  2HVH A;  3LP1 A;  5LJW A;  3ZSO A;  3CD6 N;  4JK9 A;  2HHV A;  1QHA A;  4DR1 K;  4DSK A;  4BWM A;  3B8A X;  1LWE A;  4DR3 K;  3DMJ A;  1Y64 A;  3CER A;  4CF0 A;  1JXB A;  3HPO A;  4ELU A;  3D45 A;  4GKK K;  2ZD1 A;  4KFB A;  3CJ1 A;  4OO1 J;  3V81 A;  2O8B B;  4BVO A;  3QIC A;  3MWP A;  3KD1 E;  4B1W B;  1MWK A;  2NRH A;  1TL1 A;  1JKH A;  4BY9 C;  4JI2 K;  1NK4 A;  3BUZ B;  3TSP A;  1JL2 A;  5CYQ A;  5FRO A;  1FK9 A;  4FJG A;  2X74 A;  3BP8 A;  3PIP L;  3DYA A;  1KC8 O;  3S41 A;  4KTZ A;  1VQ4 N;  3H1Q A;  3S3M A;  1BIU A;  4DTM A;  4DS5 A;  2V7Z A;  4QS7 A;  3D2F A;  1N5Y A;  4CJ5 A;  3VQQ A;  2P9U A;  4FWS A;  3VEX A;  1U04 A;  2G8H A;  1YXQ A;  1XI1 A;  4E7I A;  3QEP A;  5CZ2 A;  2W41 A;  1W97 L;  5B8H A;  4LH5 A;  1VQ8 N;  5KPT A;  3U9Z A;  3J7Z O;  2Z1J A;  3VQA A;  1KQS M;  1SAZ A;  3NGI A;  1XHX A;  2YNF A;  1NJI O;  3HVR A;  4C1N K;  4WQ4 C;  3BGR A;  1REV A;  2QWL A;  4FLW A;  3SPY A;  3K58 A;  4I7F A;  4DFJ A;  1C0F A;  1ZBL A;  3RR8 A;  4OPH A;  4H03 B;  2QXL A;  4N56 A;  4EP4 A;  4EHT A;  4CJ7 A;  3DLH A;  3CME N;  5HLF A;  2O8F A;  1SKW A;  1QVG M;  1S22 A;  4B9N A;  2GTD A;  4FJL A;  4LY7 A;  3AGR A;  4MDA A;  1Q9Y A;  3MXJ A;  4BDP A;  2ZF5 O;  5FRN A;  3THV A;  2P9K B;  4FWL A;  1VSL A;  4JD2 B;  3O9T A;  4I9Q A;  4DTO A;  3TWH A;  4CFD A;  4DSF A;  2JLE A;  2A42 A;  3O80 A;  4LSN A;  4M63 C;  4BRH A;  4LF5 K;  2O8C A;  1DTQ A;  3F5T A;  3LDS A;  1EQY A;  4W5N A;  1LW2 A;  2KW4 A;  2XY7 A;  1KAZ A;  1NOY A;  5GIO A;  1NBW A;  1DT9 A;  1OKJ A;  3JSM A;  4CJQ A;  3NF9 A;  1C1B A;  2PAV A;  3EE8 A;  3OJS A;  2HHT A;  1YTU A;  1WNS A;  4GV9 A;  2X78 A;  3K9K A;  4Y1D A;  3ID6 A;  3VTH A;  2G8U A;  3SLC A;  4BE0 A;  2ZGY A;  3EEQ A;  3LWL A;  1MWM A;  1ASU A;  1WOQ A;  4IOA L;  4FSV A;  2E1Z A;  3EZ5 A;  1SS6 A;  3NHG A;  4OGC A;  5EX5 A;  4DQS A;  4IEE A;  1Q9X A;  5F0X A;  3LDP A;  2O8D A;  2UUB K;  4CED A;  1HMV A;  4F2R A;  4LFB K;  1ZYQ A;  3KK7 A;  4WQ5 A;  4N5S A;  1V4S A;  4Q5V A;  2HBK A;  4RG8 A;  5HRO A;  3HL8 A;  3T1Y K;  1VQ7 N;  3C0B A;  2QWP A;  2A1S A;  3ALY A;  3O4Q A;  4FWK A;  3WNE A;  4FLY A;  2PY5 A;  5IT9 O;  4QS8 A;  4CK2 A;  4BR5 A;  4ID1 A;  4FJK A;  2DFF A;  5IWA K;  4CIG A;  4B08 A;  3AVM A;  4JKE A;  2WUS A;  3AVC A;  2YV0 X;  2D0O A;  1BOT O;  3C6H A;  2UUC K;  4F4K A;  4FJJ A;  4MO4 A;  3KKR A;  4LF9 K;  4DV2 K;  3HZ6 A;  2ITM A;  4BGA A;  4LD0 A;  2J4R A;  3SAH A;  3K5O A;  1HPM A;  2F9W A;  3G71 N;  1SL2 A;  4IJN A;  2PBD A;  4CGD A;  4TSX A;  2FSJ A;  3L2Q A;  5KI6 A;  3AAP A;  3AO5 A;  4CHO A;  4DQ8 A;  5CE3 A;  3KVG A;  1VSE A;  4E1J A;  3OY9 A;  1Q8I A;  3CXC M;  5BPN A;  4FYD A;  3HSC A;  4H0X B;  3OYD A;  2P9P A;  3TAF A;  4B3M K;  3V6D A;  4V19 S;  4CJS A;  4IG3 A;  3P31 A;  3DRP A;  2OPR A;  4K42 A;  3L4I A;  3M5R A;  1BIZ A;  3SQ4 A;  3F9K A;  3O4W A;  1EXQ A;  4GNI A;  3PX4 A;  4Q0B A;  3KTQ A;  2P9N B;  3I0S A;  3AVF A;  1NK7 A;  3GL1 A;  1TKX A;  4KTW A;  3TTF A;  4EZ9 A;  1S1W A;  4J8F A;  1VSK A;  4BQL A;  2FSK A;  3MCA B;  3K57 A;  2W42 A;  1YIJ N;  4OKJ A;  1XMQ K;  4DWI A;  4DS4 A;  4FW2 A;  4HCB A;  5BRF A;  3CPW M;  1YUW A;  3ZYY X;  1NJZ A;  4LFA K;  4DHY A;  2YJE A;  5M1N A;  4E89 A;  2NRR A;  1GLL O;  4GVE A;  4MLH A;  5JMV A;  4PY5 A;  1WSF A;  3A5L C;  2Q0U A;  3KZB A;  4L8R B;  5BR9 A;  2XHB A;  3IAY A;  1FKO A;  2W6L A;  3UKU A;  4BE1 A;  1NKB A;  1HYV A;  3F73 A;  3CCU N;  2YHX A;  3LZI A;  4H8K A;  4M3R A;  4CJK A;  3SAF A;  1S9G A;  3BZC A;  1KVA A;  1NNE A;  2Y1J A;  3VN5 A;  1VSI A;  4HUG A;  1J6Z A;  4BR0 A;  2UU9 K;  1YTA A;  1T6C A;  1VK0 A;  3K0S A;  2D0A A;  3L0Q A;  3S3O A;  2OA8 A;  2IOC A;  4YHH K;  4XH4 A;  4BQZ A;  4BDZ A;  4CZH A;  1MA9 B;  2Q3S A;  3VGK A;  4FLT A;  2D4W A;  2NZT A;  1I94 K;  3HBT A;  2VG6 A;  1RFQ A;  1YIT N;  1X9M A;  2Q31 A;  1G99 A;  1LAW A;  2F96 A;  4KI4 A;  3GOI A;  4H5V A;  3A5M C;  3WEE A;  2DFE A;  3A2F A;  1EWR A;  5KGW A;  1RDW X;  3NBP A;  2KZZ A;  3RMD A;  1IG8 A;  2O8D B;  4BR9 A;  4CGF A;  1HKC A;  5KRS A;  3VOV A;  2EHG A;  2B4J A;  1YF5 L;  5LMN K;  3HI0 A;  4CHQ A;  4OPJ A;  2F8T A;  4O5F A;  3VQ7 A;  2KZM A;  1RT2 A;  4FJM A;  4PQU A;  3R3L A;  2VQF K;  3VEN A;  4FWO A;  3QBW A;  4O5B A;  3SK3 A;  1NK8 A;  5FRM A;  1BGX T;  3EKU A;  4BRC A;  3V9W A;  3IS9 A;  2OCE A;  3ZET A;  3HJF A;  4DQR A;  3V1O A;  1SZ2 A;  1OH8 A;  3DLL L;  3O5B A;  4DR6 K;  1NJW A;  3ZT4 A;  3NGY A;  4JI4 K;  1L5U A;  2P9L A;  2V7Y A;  2I5J A;  4HTU A;  4GV6 A;  4YOV A;  3QO9 A;  3VEY A;  3AA2 A;  1JXE A;  5HRP A;  1SQK A;  4CEE A;  4IO8 A;  3UKU B;  4F2S A;  4Y0W A;  4GMJ B;  2HHH K;  3IDH A;  4O4G A;  3L8B A;  3J7A P;  2QXF A;  3MCP A;  1QHT A;  2CH5 A;  4FJ5 A;  1QQO A;  2XY5 A;  4QS9 A;  4Z4E A;  4JNE A;  1OH5 A;  3AVB A;  1JLC A;  4DTU A;  5AQO A;  3SZ2 A;  2B6A A;  3OS2 A;  4FJN A;  1WN7 A;  1GLF O;  2Y1I A;  1V4T A;  1IJJ A;  2Z1I A;  2ZQB A;  4KH4 A;  4B1Y B;  3C94 A;  3MK6 A;  5J2Q A;  4B9M A;  3O3H A;  3SUQ A;  2OPP A;  4K41 A;  4M42 A;  4CGG A;  4E3S A;  4E7L A;  3M8S A;  4BC2 A;  3EY1 A;  5KGX A;  4IOC L;  3H45 C;  5AQT A;  4CCH A;  5SZT A;  5FPE A;  4ILH A;  4UY8 O;  2GBZ A;  3NCI A;  2G8F A;  1GLD G;  3RRG A;  4JKD A;  3TAR A;  3OYI A;  3ZSR A;  1HJR A;  5HOO A;  1GLA G;  4CF9 A;  4E1M A;  2FF3 B;  2ASO A;  2VCP A;  1K8K B;  1VQK N;  2E4L A;  4CJL A;  3WT0 A;  4DTX A;  1B9D A;  5BPM A;  4CEF A;  2UUA K;  3H1V X;  1YJW N;  1ASW A;  4CI6 A;  4PKH A;  1EWQ A;  3VGM A;  3O4N A;  3ZX0 A;  4LF4 K;  3CJ7 A;  3WNG A;  5AQU A;  2O8E B;  4Z4I A;  5BPL A;  3ZT0 A;  2P9S B;  4EFH A;  4W5R A;  1T05 A;  5C0Y A;  1XUP O;  3PSI A;  2HHU A;  4DFK A;  4CF2 A;  2FBT A;  2O4I A;  1OVQ A;  3ZT1 A;  4U67 L;  4M3W A;  4NYF A;  3IG1 A;  4Y1C A;  4MFB A;  2AP1 A;  2YCH A;  2RHK A;  4C8M A;  2IVN A;  4AHU A;  4JN4 A;  4GVM A;  3GG4 A;  4EIA A;  3PX0 A;  5LL6 Z;  1WAF A;  4WF9 L;  5GAH P;  3ZEU A;  1ZXO A;  5GAG P;  4DTJ A;  5I9E B;  3VQP A;  1TAQ A;  4CHZ A;  1U45 A;  4CF1 A;  1XQS C;  3N4Q A;  4WE1 A;  3RVC A;  3V9U A;  3M6G A;  3ZT2 A;  3AGK A;  3D2E A;  4JKG A;  3S9H A;  2QWQ A;  4CVN E;  1NMN A;  3D6R A;  1QSS A;  1TYQ A;  1S1U A;  4FM1 A;  3SJJ A;  3C65 A;  1BHL A;  4GKJ K;  2WC9 A;  3HO1 A;  1KTQ A;  1GOA A;  3CCV N;  5BRD A;  5F1X A;  4YOW A;  2VQE K;  4CK3 A;  4CJT A;  2FBV A;  4H0Y B;  4RW8 A;  3CCS N;  2XY8 A;  4QCL A;  2O8C B;  3SNN A;  3AO2 A;  3O9U A;  4C8K A;  4DSI A;  4KO0 A;  3CCJ N;  2IVP A;  4ELV A;  4FJ9 A;  4IFY A;  4NCB A;  4I2P A;  3LAL A;  4DQI A;  3FFI A;  1WBB A;  1EO1 A;  2ASP A;  5AQN A;  3PO4 A;  5AQZ A;  5LJV A;  1YJ9 N;  2HND A;  3JYT A;  2P9I B;  1M1K O;  2GWJ A;  3R1X A;  4DSJ A;  3FZL A;  2KQ2 A;  4Z4C A;  3MWT A;  1W9H A;  2P9S A;  3WNF A;  4CEB A;  4ICL A;  4KRF A;  1O1W A;  3TAN A;  4XH1 A;  2QWO A;  3QNO A;  1I3A A;  5FPN A;  5J2P A;  4H0T B;  4FK4 A;  1BA0 A;  1VRT A;  3U4L A;  5AZJ B;  4O0J A;  1SKS A;  3TSQ A;  1WUA A;  1E4G T;  3VEW A;  4BRP A;  1NGE A;  1NGG A;  2O8B A;  3DI6 A;  4FLX A;  5JS2 A;  4IKF A;  1WB9 A;  4RTF D;  3RSE A;  2O4G A;  4CFC A;  4FJ8 A;  4C8N A;  2RN2 A;  3V4I A;  1TL3 A;  4JI3 K;  3MN5 A;  2Q2R A;  1RGI A;  2NRT A;  3KLF A;  4ZTJ A;  1CZ9 A;  1XHZ A;  3K2P A;  3RSE B;  3P1G A;  1C0M A;  3PIO L;  5AQJ A;  3KWI A;  4DSE A;  3T19 A;  5SWM A;  2GX9 A;  2KTQ A;  4K25 A;  1IKW A;  4ISF A;  2P9U B;  5CY4 A;  2GEL A;  4FXD A;  4FK0 A;  1BI4 A;  5DK5 A;  1QSL A;  1S72 N;  4B3S K;  3THW B;  4DU3 A;  4H0V B;  1C0U A;  2XO7 A;  1VSJ A;  4NLC A;  3DLE A;  3HTV A;  4DV1 K;  4Z0U A;  4I6M A;  1JLG A;  4NB4 A;  4B3O A;  2NRX A;  4IZ9 A;  3SUO A;  3QER A;  4F3O A;  4R5P A;  3TAQ A;  1RDA A;  1HKG A;  3NF6 A;  4FJI A;  5AQR A;  4JRP A;  3AY9 A;  3FZK A;  2DFH A;  4O8K A;  5FLX O;  4DTR A;  3TTD A;  1KLN A;  1E3M A;  4I6M B;  3LZJ A;  2E6M A;  2Z1G A;  2BTF A;  4NCA A;  1D5A A;  3KD5 E;  2BAN A;  5AZI B;  3IUC A;  5AR0 A;  1LAV A;  4ILG B;  1CZA N;  3Q7B A;  1MDU B;  4BAC A;  4M3U A;  3ULD A;  3F9M A;  3PY8 A;  4CEA A;  1S5J A;  4KKO A;  2ZJQ L;  4BRE A;  2DY4 A;  3MN7 A;  3CI5 A;  4K8X A;  3E9L A;  3L3V A;  3V9X A;  1RTH A;  1XWL A;  3SQ2 A;  1N8R O;  4YOT A;  3P4I A;  2G8W A;  4B1U B;  5DM7 L;  4FJ7 A;  1BCO A;  1TYQ B;  3BEX A;  3UE5 A;  2VGM A;  4MQ3 A;  1LOT B;  5JS1 A;  2KFZ A;  3LPT A;  4W5Q A;  4PWD A;  3CIP A;  4MLE A;  3SV4 A;  1BA1 A;  4FLZ A;  4E7H A;  3TPQ A;  1RT5 A;  3LL3 A;  5ADX H;  4W5T A;  5BN8 A;  2E2P A;  5AZJ A;  3L2R A;  3RMA A;  3O08 A;  2AJQ A;  3CJC A;  2GUP A;  1KLM A;  4CBW A;  2NRZ A;  3A5N C;  2QM1 A;  3VQC A;  2IAJ A;  4CEQ A;  1RNH A;  1RDC A;  4JLH A;  4JI5 K;  3R6M A;  3VQ4 A;  2BGG A;  3LP2 A;  1SL1 A;  3A0I X;  4CER A;  4H4O A;  1NKE A;  1D8Y A;  1WAJ A;  5ELZ A;  5AJ3 K;  2RE2 A;  3QDK A;  3OHR A;  1BQN A;  2VWB A;  3NF8 A;  4JKC A;  2HBL A;  4H5R A;  3O3G A;  4LH4 A;  5EXW A;  3MEC A;  4NXM K;  4HVJ A;  5JLF A;  4N41 A;  1W7A A;  3OYE A;  3LAN A;  4BGB A;  3UB5 A;  1S9E A;  1K8K A;  1RTJ A;  3VER A;  1B92 A;  4KHW A;  4YDU C;  4PKG A;  3LPU A;  1W2B M;  4HCC A;  3L4Q A;  3O3F A;  3DLG A;  3QB0 A;  1RTD A;  1RTI A;  3BF3 A;  1HNW K;  3SV3 A;  3V9S A;  3CQX A;  3C6A A;  5AFU A;  4PL7 A;  1WBD A;  3R8E A;  4FLU A;  3TI0 A;  4NXN K;  3VQB A;  3ZCM A;  4A5B A;  1FXX A;  4RCH A;  1JLE A;  3ULE B;  1IH7 A;  3MXM A;  1QVF M;  1T7P A;  3E66 A;  3ENH A;  4M3Z A;  3NF7 A;  2XRI A;  3ITH A;  3LDL A;  4K43 A;  3L2U A;  2P9N A;  3HT3 A;  1I39 A;  2W40 A;  1G15 A;  3HST B;  1XC3 A;  1RBT A;  5M1F A;  3J80 O;  1QSY A;  1L3V A;  1WSG A;  1U2V A;  3C7N A;  5AQK A;  3RRH A;  3HK2 A;  4M3T A;  3FFK B;  4WYB A;  1UOC A;  1IV0 A;  1HYZ A;  3LAK A;  5CHI A;  3G0Z A;  2H3G X;  3UKR B;  1UA0 A;  5C25 A;  2EWS A;  1U2V B;  5H1S Q;  3ID8 A;  1OVY A;  2YNI A;  3WXL A;  5TKW A;  3HPH A;  3BDP A;  4KHY A;  2DTU A;  3ATV A;  3DWL A;  4OLB A;  2IDO A;  3QLH A;  4DB3 A;  3NH1 A;  4CZM A;  4H5T A;  3RMB A;  3NE6 A;  2OTL N;  1KD1 O;  2ETJ A;  2QA4 N;  4A57 A;  1HLU A;  2P5G A;  1YVU A;  3LP0 A;  1J54 A;  3VEO A;  4LC9 B;  3OYG A;  3OYM A;  2LSN A;  1N6Q A;  4M3Y A;  4FPA A;  1T44 A;  4OPA A;  3AA3 A;  4NYN A;  1NOZ A;  4AM6 A;  2B5J A;  4DF8 A;  3QES A;  2CGL A;  4BG8 A;  1CZB A;  4CHY A;  3TU5 A;  4M7X A;  3AVA A;  4QAG A;  4H0O A;  2O8F B;  3OYH A;  3NMU A;  3EL2 A;  4B1X B;  5JLH A;  1KXP A;  1KAY A;  3U9D A;  3I56 N;  4NO7 A;  3G25 A;  1DGK N;  3U8X A;  4CJ4 A;  1OH6 A;  2P9P B;  1KSP A;  4XIU A;  2HHS A;  4IEI A;  4DFP A;  2EX3 A;  1VSD A;  2HOE A;  4JKH A;  1IBK K;  3C95 A;  2NNW A;  4JS5 A;  5A2Q O;  1R0A A;  3CC2 N;  3CC7 N;  3P83 D;  3OS1 A;  2I7N A;  2DPN A;  3KLH A;  3SQ0 A;  1HPZ A;  1Y97 A;  1GLJ O;  1CXU A;  4PA1 A;  1TUY A;  4CD1 A;  3WXK A;  2KLA A;  3QEW A;  4KTQ A;  4CE9 A;  3VQ6 A;  4GY2 B;  3IKM A;  4BRN A;  4H0P A;  4KI6 A;  3CCM N;  1NK9 A;  4WQ5 C;  1LCU A;  2A5X A;  4DQP A;  1ZBS A;  3NVM A;  4G1Q A;  3LWM A;  2ZJR L;  4WFB L;  3CJA A;  1C0T A;  1QE1 A;  3OS0 A;  1JL1 A;  1VQP N;  4CZJ A;  3DRS A;  1SL0 A;  1Z26 A;  3QNN A;  4ISE A;  1A5X A;  4C8O A;  5EVZ A;  4JI6 K;  4RWT A;  4DV7 K;  4GW6 A;  4G9Z A;  3TAB A;  2NRW A;  3DXM B;  5FPD A;  2VGN A;  2GUI A;  1K8A O;  4J2D A;  1OH7 A;  4HUE A;  3UIQ A;  3CFO A;  4FW1 A;  1HNI A;  1NGB A;  1C6V A;  2AA4 A;  4CJU A;  3FZM A;  3C7N B;  5I42 A;  2HBM A;  2YHW A;  3FZH A;  3L3U A;  4O44 A;  3HRG A;  2YHB A;  2OZS A;  5FPM A;  4CJV A;  3DRR A;  4JKF A;  2CH6 A;  3QBX A;  4YFU A;  3EZW A;  3DXK B;  4YOR A;  4DTS A;  1NK0 A;  4EZ6 A;  2QI2 A;  4A61 A;  3KK3 A;  4JAX A;  4CEO A;  4K8Z A;  1RBS A;  3CPE A;  3CM6 A;  4BRQ A;  1ASV A;  4KBO A;  1TVR A;  4PKI A;  4FK2 A;  1K9M O;  4ISG A;  5DM6 L;  2A41 A;  1WLJ A;  3T7Z A;  1WSH A;  1BDG A;  4CEZ A;  2HBJ A;  4CW7 B;  3TSU A;  1NWK A;  2PYJ A;  3H46 O;  4BDY A;  3V1Q A;  1HUX A;  3IRX A;  1D9F A;  4DUZ K;  2NUB A;  1EX4 A;  4C8L A;  4O0I A;  1T3V A;  3CCE N;  1GLB G;  1X9J A;  3VQE A;  1N36 K;  4CF8 A;  4CGH A;  4BRM A;  5KQ8 A;  1NGI A;  4FWQ A;  3VES A;  2FXU A;  4CJP A;  1Z05 A;  5KPZ A;  3AVH A;  4WQ4 A;  2O8E A;  4M45 A;  1VAZ A;  4OPK A;  3BF1 A;  5T7B A;  3LM2 A;  4FVU A;  4CJW A;  2OPS A;  4LF8 K;  1HNZ K;  3PO5 A;  1RT1 A;  1A5W A;  2ZJP L;  3KJV A;  1X9S A;  2PZS A;  4BR2 A;  5C10 A;  3A5O C;  5E41 A;  4B9L A;  4FM0 A;  4DV3 K;  5C42 A;  3OYB A;  4H4M A;  5AQG A;  4YOU A;  5J2N A;  1QQM A;  5M1Q A;  5MLC Q;  2QK9 A;  1IKV A;  2PYL A;  4BRD A;  2VWJ A;  4CK1 A;  3LM9 A;  2HW3 A;  2GV9 A;  4IO9 L;  3O1W A;  1YI2 N;  2G8V A;  4A62 A;  4H5N A;  4AHR A;  3LDQ A;  3ZET B;  1RCH A;  4MO5 A;  4AF1 A;  4E7K A;  3VPZ A;  3THX A;  2HMP A;  3OYF A;  3CF5 L;  3VF2 A;  3D2F B;  3JXU A;  4BRI A;  3K9J A;  4BRG A;  2FLO A;  4JV5 K;  3OBY A;  5AQV A;  3VA0 A;  4JKB A;  4LF6 K;  1HKB A;  2Z1H A;  4A2B A;  1HRH A;  3I8D A;  1DEJ A;  2E5L K;  4EAH D;  2P51 A;  4DU4 A;  3KLI A;  1R59 O;  3CYM A;  1L3S A;  3M3Z A;  3ZT3 A;  1JJ2 M;  3NDK A;  2KHO A;  2OAN A;  2WOM A;  3S3N A;  3FE1 A;  3WUH A;  4DV5 K;  2G8I A;  4PHT X;  5BN9 A;  3AO1 A;  3L2V A;  5AZI A;  5HL7 L;  1RDU A;  1YVN A;  4JKG B;  4KAZ A;  3VET A;  4CGI A;  5J2M A;  3T69 A;  3O8M A;  2F7T A;  1ATN A;  1X9W A;  3G4S N;  5K14 A;  2ATQ A;  3THX B;  2BUP A;  1TAU A;  3ZEU B;  4KHS A;  1RBR A;  2ZGZ A;  3QIN A;  1KRP A;  3CG7 A;  5AFU H;  5AQI A;  3JAM O;  3VQD A;  2E20 A;  4CJ3 A;  1NK5 A;  5C2F A;  2WON A;  2F4V K;  1JLA A;  2Q36 A;  4NLB A;  1T03 A;  4F8R A;  1KFS A;  1JCF A;  2QTD A;  3QFP A;  3ENO A;  3QET A;  3DLK A;  1ATR A;  2RF2 A;  4Z4F A;  2VYP A;  3J81 O;  4AM7 A;  2E1Y A;  4CBX A;  3WNH A;  2OZM A;  1QZ5 A;  2ZE2 A;  4JI7 K;  4BC4 A;  1X3N A;  3VQ8 A;  3ZLJ A;  3B6P A;  4I9L A;  4JHD A;  1SKR A;  4JS4 A;  5JVH L;  3O1B A;  3RMC A;  4QOZ B;  3LDN A;  3SMS A;  5ADX A;  4FZZ A;  4X64 K;  4A5A A;  3LAM A;  1TKZ A;  1S6Q A;  5AQL A;  3ENB A;  2HMI A;  1IO2 A;  3NVK A;  4AQY K;  3CCQ N;  4FCY A;  5J1E A;  3E9O A;  3G10 A;  1CLQ A;  3RWU A;  1BL3 A;  1HJO A;  4CIE A;  4YOX A;  3L6Q A;  4RW6 A;  4B9Q A;  2E6L A;  2RPI A;  4EHU A;  3DAW A;  3SBT A;  5C24 A;  4XEI A;  4ID5 A;  3Q7C A;  4B1Z A;  3N4P A;  4FJH A;  2ASM A;  2FF6 A;  3WQT A;  1Q81 O;  3VGL A;  3CMA N;  3KKS A;  4RW7 A;  1C0G A;  2G8K A;  4B9S A;  3R9P A;  3P5J A;  3RTV A;  2X6N A;  1BWF O;  4DMN A;  4WFN L;  5E26 A;  4JYA K;  3ZX2 A;  1LWF A;  3G6E N;  4KHU A;  4KHQ A;  3J7Y P;  1SUQ A;  4J2B A;  5AQM A;  3AVL A;  1TGO A;  1YAG A;  2QWN A;  1E4F T;  3T3F A;  1C1A A;  1BU6 O;  3NH2 A;  5GAD P;  4HHT A;  3SYZ A;  3VF6 A;  4GV3 A;  4FZX C;  1ZBF A;  4E19 A;  2YJF A;  2FBX A;  3CCR N;  2YNH A;  3AA5 X;  4CZF A;  3KK1 A;  4K0K K;  1VRU A;  1RT4 A;  5I3U A;  2X6S A;  3HYF A;  4B3T K;  4CJR A;  1S1X A;  3OW2 M;  2HF3 A;  4ZHR A;  2XY6 A;  3M1F A;  2Q0R A;  4BC5 A;  4CFB A;  3HP6 A;  3OYL A;  3MX5 A;  3I0R A;  3EO3 A;  2IGI A;  4FPB A;  1UA1 A;  4YOY A;  3WXI A;  3PUF A;  3QML A;  3U6F A;  2WTU A;  2FSN A;  4FOI A;  5AQF A;  5JIC A;  3LDO A;  4A2A A;  2QKB A;  1VQM N;  3AO3 A;  1ZBI A;  1DTT A;  4KPY A;  4CJF A;  5M1O A;  1P90 A;  4FZY A;  4DTP A;  4OVL A;  1NGA A;  5GAE P;  3CC4 N;  1Q18 A;  3VA3 A;  3AO4 A;  1ZC6 A;  1IG9 A;  4OLA A;  1K6Y A;  3NAE A;  4DR7 K;  5KRT A;  3PLA A;  1XC9 A;  1TK0 A;  1FKP A;  1Q82 O;  3CCL N;  2KKZ A;  4KB1 A;  1U6Z A;  1P8Z A;  2QKK A;  4JRQ A;  4YDU A;  2KFN A;  1J5E K;  1D9D A;  3O9R A;  4KHP K;  3OTO K;  3TAP A;  1YT3 A;  3O9S A;  2NLX A;  2Q97 A;  1EET A;  1HNX K;  3EYZ A;  4DFM A;  2YKM A;  3DXK A;  2V52 B;  3DXM A;  3I55 N;  4J2A A;  4Z94 A;  1HR0 K;  5GIP A;  2YKN A;  4CZI A;  5HRR A;  4BWJ A;  1JCG A;  2P5O A;  1S3X A;  4BE2 A;  2D0B A;  4DKW A;  2R7Y A;  2QW9 A;  5C2D A;  4FWR A;  3D7E O;  5TKY A;  3OYC A;  4CIF A;  4DCH A;  3H6E A;  2QWM A;  4DV0 K;  3PV8 A;  3ISN C;  5AQP A;  3FLC O;  3RR7 A;  1GLC G;  4IJA A;  2A3Z A;  1WSE A;  1RDB A;  4CZE A;  4KH6 A;  1UWB A;  3MXI A;  2YI1 A;  4Z4H A;  4CD3 A;  3CQ8 A;  3KLE A;  3C6T A;  1HQE A;  1M90 O;  1YJN N;  1EP4 A;  5FDL A;  3VQ9 A;  3VTI A;  1ITG A;  3I33 A;  1YHQ N;  4DR4 K;  2YHA A;  2CGJ A;  4M7Y A;  3HOS A;  3ULE A;  1N34 K;  1DLO A;  2YHY A;  3AVG A;  4B9U A;  1QS4 A;  1DKG D;  5LMU K;  1ZBH A;  4BR4 A;  5JVG L;  1C1C A;  4RW4 A;  2D0C A;  3FR0 A;  4M41 A;  3AA4 A;  3E01 A;  1KAX A;  4N47 A;  4B8C A;  3AVJ A;  4PUO A;  3ZSV A;  3V1R A;  4OKE A;  3ATU A;  3SI6 A;  4NCG A;  3H3N O;  3OBW A;  1VQL N;  3HPG A;  2UXC K;  3SMP A;  2VWK A;  2E88 A;  3ZSX A;  4R79 A;  3WXJ A;  4MDB A;  4Z4G A;  4KH5 A;  1Z25 A;  3ASM A;  4AHS A;  1T8E A;  1BUP A;  1KVB A;  4CBU A;  4FVM A;  1NG9 A;  3GBT A;  1J53 A;  2E8A A;  1ATS A;  2JGU A;  3B6O A;  1BI4 B;  3OYJ A;  3CJ9 A;  4IDK A;  1RT7 A;  4W5O A;  4DV4 K;  3ZX3 A;  2UXB K;  4FJX A;  4FWM A;  2OTJ N;  4ZTF A;  1X1P A;  4DQQ A;  2HNZ A;  2JWK A;  2UYT A;  4EP5 A;  1CXQ A;  4IWV A;  3NH0 A;  3OYA A;  4CHN A;  1FW6 A;  1UAX A;  4AHC A;  4KV8 A;  3AAQ A;  3HVT A;  4U7B A;  4JKA A;  3EE9 A;  1QZ6 A;  4X65 K;  3CHW A;  3F2K A;  2FBY A;  3K5L A;  2E2N A;  3H3O B;  1NJY A;  1BCM A;  3QIP A;  1XNQ K;  3DLR A;  1TKD A;  1XNR K;  3KK2 A;  3VQ5 A;  5DMR A;  2P9L B;  3TR8 A;  3I8B A;  5CR4 A;  2PFU A;  1GOC A;  3GDQ A;  5F2R A;  3CFR A;  2D1K A;  3J8A A;  3A8Y A;  3SPZ A;  4C1N I;  5BRE A;  3OA9 A;  2IS3 A;  2CGK A;  4O8U A;  4WFA L;  1WSI A;  3OVN A;  3T1A A;  1IBL K;  1NGH A;  3CJB A;  1VHX A;  1XMO K;  5E84 A;  2E2Q A;  4DV6 K;  4B9T A;  1JLB A;  3TTC A;  3SUN A;  1F21 A;  2ZM6 K;  1U49 A;  3THY A;  1TV6 A;  3LP3 A;  3VEZ A;  5LY3 A;  1NM1 A;  1TK8 A;  3KIO A;  4N76 A;  1Q86 O;  1NGD A;  1QQC A;  3NFA A;  2OYQ A;  2ZWH A;  4IDH A;  5HRN A;  4KRE A;  4DTN A;  3WXM B;  1VSF A;  2IVO A;  5BR8 K;  4ILJ A;  5BRH A;  3BY5 A;  4BVP A;  4JK7 A;  3D0P A;  2E2O A;  2P1J A;  4JD2 A;  3DOL A;  4WCE L;  2UXD K;  2P9K A;  2JWL A;  1NK6 A;  4CJE A;  1L3U A;  2Q1N A;  2NRV A;  3CET A;  4CZK A;  3D2E B;  4PL8 A;  1BIS A;  4LFC K;  1VQ9 N;  1EKE A;  3FGU A;  3M8Q A;  4DLE A;  1NLV A;  3MMV A;  4E1N A;  4HTL A;  4B8A B;  2QWR A;  2BH1 A;  1RDD A;  3CM5 A;  5M1P A;  3DLB A;  4L3Q A;  3VMF B;  1TK5 A;  4JI8 K;  1J9A A;  1N33 K;  3O9Q A;  2HVI A;  4YNQ A;  1TKT A;  4OX9 K;  1U4B A;  4CZL A;  1KFD A;  1IBM K;  4E0D A;  4FWP A;  2BE2 A;  3K59 A;  2HHX A;  4JI0 K;  4B1V A;  1S1T A;  1WSJ A;  5M1K A;  3MX2 A;  1S6P A;  3ZSY A; 
#chains in the Genus database with same CATH homology
 4FYD A;  3TAQ A;  3TAM A;  1RDA A;  3MAQ A;  4KAZ A;  3QEX A;  3NF6 A;  2VG5 A;  4CGI A;  5J2M A;  4FJI A;  4JRP A;  2DFH A;  1HNV A;  3OYD A;  4DTR A;  1KLN A;  1X9W A;  1VSM A;  3LZJ A;  3TAF A;  3AV9 A;  2ATQ A;  2E6M A;  2Z1G A;  5K14 A;  3V6D A;  4NCA A;  4CJS A;  1D5A A;  1TAU A;  3KD5 E;  4KHS A;  2BAN A;  4IG3 A;  3DRP A;  1RBR A;  2OPR A;  1LAV A;  3SCX A;  3QIN A;  1KRP A;  3CFP A;  3CG7 A;  1JLF A;  1BIZ A;  1RBV A;  3F9K A;  3SQ4 A;  1EXQ A;  3VQD A;  4CJ3 A;  3PX4 A;  4BAC A;  1NK5 A;  3ULD A;  1NKC A;  2WON A;  3KTQ A;  4M3U A;  1JLA A;  3PY8 A;  4CEA A;  1S5J A;  3I0S A;  4KKO A;  3V9Z A;  3AVF A;  1T03 A;  4F8R A;  1KFS A;  2DY4 A;  1NK7 A;  3QET A;  3DLK A;  4K8X A;  1TKX A;  2RF2 A;  4KTW A;  3L3V A;  3V9X A;  1RTH A;  1XWL A;  3SQ2 A;  2BDP A;  4EZ9 A;  4Z4F A;  1S1W A;  4AIL C;  3WNH A;  2OZM A;  1LWC A;  3HXM A;  1VSK A;  2ZE2 A;  2G8W A;  3VQ8 A;  4FJ7 A;  1BCO A;  1IKY A;  1RBU A;  3B6P A;  4I9L A;  1SKR A;  4JS4 A;  3K57 A;  2W42 A;  4OKJ A;  4MQ3 A;  4DWI A;  5JS1 A;  3RMC A;  4QOZ B;  2KFZ A;  3LPT A;  4W5Q A;  4DS4 A;  4PWD A;  4FW2 A;  4FZZ A;  1RIL A;  4HCB A;  3SV4 A;  4FLZ A;  5HRS A;  3M8R A;  4E7H A;  1GOB A;  3K5M A;  1RT5 A;  1NJZ A;  4DSL A;  1YTU A;  3LAM A;  4W5T A;  3OYN A;  1MU2 A;  1KVC A;  1TKZ A;  1S6Q A;  2HMI A;  4E89 A;  1VSH A;  4FM2 A;  1IO2 A;  3L2R A;  3RMA A;  2YNG A;  3MED A;  4I2Q A;  4Q0B A;  2AJQ A;  4PY5 A;  3H08 A;  1WSF A;  1A5V A;  4FCY A;  1KLM A;  3MEE A;  3OYK A;  5J1E A;  4DF4 A;  3VQC A;  3SUP A;  3G10 A;  1CLQ A;  3RWU A;  2IAJ A;  1BL3 A;  4CEQ A;  1RNH A;  1RDC A;  4L8R B;  4CIE A;  2XHB A;  4JLH A;  3DOK A;  1HYS A;  3VQ4 A;  4RW6 A;  3IAY A;  3LP2 A;  1FKO A;  2E6L A;  2RPI A;  5EU7 A;  1SL1 A;  2BGG A;  2VG7 A;  5C24 A;  4BE1 A;  4CER A;  1NKB A;  4H4O A;  1HYV A;  1NKE A;  4ID5 A;  3F73 A;  2IC3 A;  5KTQ A;  4FJH A;  1D8Y A;  1WAJ A;  3LZI A;  4H8K A;  4M3R A;  3OJU A;  4CJK A;  3KKS A;  4RW7 A;  1BQN A;  4RW9 A;  2HHQ A;  1S9G A;  3NF8 A;  2G8K A;  4B9S A;  3O3G A;  4LH4 A;  3P5J A;  3RTV A;  2OPQ A;  1KVA A;  2X6N A;  3MEC A;  2Y1J A;  5CYM A;  1VSI A;  3VN5 A;  4HUG A;  4DMN A;  1IKX A;  3SQ1 A;  3HP9 A;  3AVK A;  1LWF A;  1SV5 A;  1YTA A;  4AHT A;  4HVJ A;  4N41 A;  1SUQ A;  1VK0 A;  4FLV A;  2D5R A;  4J2E A;  4KHQ A;  4CES A;  3LAN A;  4IG0 A;  3OYE A;  4J2B A;  3AVL A;  5HBM A;  1L3T A;  1S9E A;  1TGO A;  1RTJ A;  2D0A A;  3M8P A;  1B92 A;  3T3F A;  4KHW A;  1C1A A;  5CZ1 A;  4DLG A;  3NH2 A;  2HNY A;  4HHT A;  3SYZ A;  4HCC A;  3LPU A;  3S3O A;  3O3F A;  3DLG A;  5HP1 A;  1NJX A;  1RTD A;  1RTI A;  1ZBF A;  4E19 A;  2OA8 A;  4FZX C;  2IOC A;  3TAE A;  1RT6 A;  3SV3 A;  3V9S A;  2FBX A;  4IFV A;  3C6U A;  3QIO A;  2HHW A;  3QEV A;  2YNH A;  3KLG A;  3AA5 X;  4BDZ A;  4ELT A;  3KK1 A;  2Q3S A;  4FLT A;  1VRU A;  1RT4 A;  2VG6 A;  5I3U A;  4FLU A;  2X6S A;  3HYF A;  3TI0 A;  4DG1 A;  1X9M A;  4F3T A;  3VQB A;  4CJR A;  1S1X A;  3ZCM A;  1FXX A;  4IBN A;  1JLE A;  3K5N A;  1LAW A;  2F96 A;  4ZHR A;  1IH7 A;  3MXM A;  4KI4 A;  2XY6 A;  1T7P A;  1J5O A;  1JLQ A;  4CHP A;  3NGZ A;  4M3Z A;  3NF7 A;  2DFE A;  2XRI A;  3A2F A;  3ITH A;  4CFB A;  4UQG A;  5KGW A;  3HP6 A;  3OYL A;  1BQM A;  3NBP A;  3L2U A;  3I0R A;  2A1R A;  4KHN A;  4O55 A;  3RMD A;  2IGI A;  2KZZ A;  3HT3 A;  4CGJ A;  1UA1 A;  1I39 A;  1ZBU A;  3AVI A;  1G15 A;  1RT3 A;  1HQU A;  3HST B;  3L2W A;  1RBT A;  3PUF A;  4CGF A;  5KRS A;  3U6F A;  4DU1 A;  1QSY A;  2EHG A;  2B4J A;  1L3V A;  3ZSW A;  4HUF A;  1WSG A;  3RRH A;  2F8S A;  3HK2 A;  3U3Y A;  4M3T A;  3MEG A;  4CHQ A;  4OPJ A;  4KB0 A;  5D3G A;  3VQ7 A;  2F8T A;  2KZM A;  1UOC A;  1HYZ A;  1RT2 A;  3LAK A;  4CFA A;  4FJM A;  4PQU A;  4K8Z A;  2QKB A;  4CEC A;  3AO3 A;  1ZBI A;  1DTT A;  3G0Z A;  4KPY A;  4CJF A;  1UA0 A;  4O5B A;  3ZSQ A;  4FZY A;  4E7J A;  1NK8 A;  1LV5 A;  4B9V A;  5C25 A;  1KCF A;  5FRM A;  4LSL A;  4OGE A;  1BGX T;  4OVL A;  4DTP A;  2HB5 A;  3VA3 A;  3V9W A;  1S1V A;  2YNI A;  3IS9 A;  1QTM A;  3AO4 A;  3HJF A;  1IG9 A;  2RKI A;  3HPH A;  4OJR A;  4DQR A;  3BDP A;  3V1O A;  4KHY A;  4OLA A;  4OLB A;  1K6Y A;  3NAE A;  1U47 A;  3PX6 A;  2DTU A;  2IDO A;  5KRT A;  3DM2 A;  3QLH A;  3NH1 A;  1NJW A;  1XC9 A;  1TK0 A;  1FKP A;  3ZT4 A;  3RMB A;  3NE6 A;  3NGY A;  1B9F A;  4AHV A;  4KB1 A;  2ETJ A;  2ITG A;  1W0H A;  3U3G A;  1L5U A;  2QKK A;  4JRQ A;  2I5J A;  4HTU A;  2P5G A;  1YVU A;  2KFN A;  3ZSZ A;  1LW0 A;  3LP0 A;  3QO9 A;  3QEI A;  3AA2 A;  1J54 A;  2FC0 A;  3AVN A;  3HM9 A;  1JXE A;  1D9D A;  3TAP A;  1YT3 A;  4OKK A;  3OYG A;  5HRP A;  3OYM A;  4CEE A;  2LSN A;  1EET A;  1N6Q A;  3EYZ A;  4DFM A;  4F2S A;  4M3Y A;  2YKM A;  1U48 A;  4GMJ B;  3TAG A;  4J2A A;  4O4G A;  2YKN A;  3AA3 A;  3L8B A;  4NYN A;  1NOZ A;  2B5J A;  2QXF A;  4DF8 A;  3QES A;  5HRR A;  4BWJ A;  2P5O A;  4AH9 A;  4BE2 A;  2HVH A;  3LP1 A;  2D0B A;  1CZB A;  4CHY A;  2R7Y A;  1QHT A;  3ZSO A;  4QAG A;  3AVA A;  4FJ5 A;  2XY5 A;  2HHV A;  3OYH A;  4Z4E A;  4DSK A;  3OYC A;  4BWM A;  4CIF A;  3AVB A;  1JLC A;  4DTU A;  1LWE A;  3SZ2 A;  2B6A A;  3OS2 A;  4FJN A;  1WN7 A;  3DMJ A;  2Y1I A;  4CJ4 A;  4CF0 A;  3PV8 A;  3ISN C;  1JXB A;  2ZQB A;  2Z1I A;  3HPO A;  1KSP A;  3RR7 A;  4ELU A;  3C94 A;  5J2Q A;  4B9M A;  4XIU A;  3D45 A;  3O3H A;  3SUQ A;  2OPP A;  1WSE A;  2ZD1 A;  4KFB A;  1RDB A;  4KHU A;  2HHS A;  3V81 A;  1UWB A;  4DFP A;  3MXI A;  4M42 A;  4CGG A;  4E3S A;  4Z4H A;  4E7L A;  3M8S A;  2EX3 A;  3EY1 A;  1VSD A;  5KGX A;  3CQ8 A;  3C95 A;  4CCH A;  3KLE A;  5SZT A;  3KD1 E;  3C6T A;  1HQE A;  4JS5 A;  1R0A A;  1TL1 A;  1JKH A;  2GBZ A;  1EP4 A;  3NCI A;  2G8F A;  5FDL A;  3VQ9 A;  1NK4 A;  3P83 D;  3OS1 A;  3KLH A;  1ITG A;  3SQ0 A;  3RRG A;  1JL2 A;  1HPZ A;  1Y97 A;  5CYQ A;  5FRO A;  4PA1 A;  1CXU A;  1FK9 A;  3OYI A;  3ZSR A;  3TAR A;  4FJG A;  1HJR A;  2X74 A;  2YHA A;  4CF9 A;  3DYA A;  1DLO A;  3AVG A;  4E1M A;  3QEW A;  4B9U A;  1QS4 A;  4KTZ A;  4KTQ A;  1ZBH A;  4CE9 A;  2E4L A;  1BIU A;  4CJL A;  3VQ6 A;  4DTM A;  3S3M A;  4DS5 A;  1C1C A;  4DTX A;  1N5Y A;  4RW4 A;  2D0C A;  1B9D A;  4M41 A;  3AA4 A;  4CJ5 A;  3E01 A;  3VQQ A;  4KI6 A;  4N47 A;  4CEF A;  1U04 A;  2G8H A;  4B8C A;  1NK9 A;  4M3X A;  1XI1 A;  3ZSY A;  4DQP A;  3AVJ A;  3LWM A;  1ASW A;  4G1Q A;  4E7I A;  3QEP A;  4PUO A;  5CZ2 A;  3ZSV A;  3V1R A;  3O4N A;  1C0T A;  1QE1 A;  3OS0 A;  1JL1 A;  4OKE A;  3DRS A;  1SL0 A;  4LH5 A;  1Z26 A;  3WNG A;  3SI6 A;  4NCG A;  3QNN A;  1A5X A;  4Z4I A;  4C8O A;  2Z1J A;  3ZT0 A;  4W5R A;  3VQA A;  3NGI A;  4GW6 A;  1XHX A;  3TAB A;  1T05 A;  3HPG A;  2YNF A;  3HVR A;  2VWK A;  3ZSX A;  3BGR A;  1REV A;  4FLW A;  4DFK A;  3SPY A;  2HHU A;  4CF2 A;  4I7F A;  3K58 A;  2FBT A;  4DFJ A;  2O4I A;  1ZBL A;  2GUI A;  3RR8 A;  3ZT1 A;  4J2D A;  4Z4G A;  4M3W A;  4NYF A;  3IG1 A;  4HUE A;  1Z25 A;  3ASM A;  3CFO A;  3UIQ A;  4AHS A;  4Y1C A;  4N56 A;  4EP4 A;  4MFB A;  1T8E A;  1KVB A;  4FW1 A;  3DLH A;  1HNI A;  4FVM A;  4C8M A;  5HLF A;  4AHU A;  1C6V A;  1J53 A;  4GVM A;  1SKW A;  2JGU A;  4CJU A;  4B9N A;  4FJL A;  4LY7 A;  5I42 A;  3B6O A;  1BI4 B;  3OYJ A;  1Q9Y A;  3PX0 A;  3MXJ A;  4BDP A;  3L3U A;  1WAF A;  5FRN A;  4IDK A;  4EZ6 A;  4O44 A;  1RT7 A;  2YHB A;  4W5O A;  4DTJ A;  3VQP A;  3THV A;  2OZS A;  1TAQ A;  4CHZ A;  1U45 A;  4CF1 A;  1VSL A;  4CJV A;  3DRR A;  4FJX A;  4WE1 A;  3V9U A;  4YFU A;  4ZTF A;  4I9Q A;  4DTO A;  1X1P A;  4DTS A;  3TWH A;  4CFD A;  4DQQ A;  2JLE A;  2HNZ A;  3ZT2 A;  4DSF A;  4LSN A;  4EP5 A;  1NK0 A;  1CXQ A;  3KK3 A;  3NH0 A;  4CEO A;  1DTQ A;  1RBS A;  3OYA A;  3LDS A;  4CHN A;  3CM6 A;  3S9H A;  1LW2 A;  1QSS A;  4W5N A;  1S1U A;  1ASV A;  2KW4 A;  4FM1 A;  1TVR A;  3SJJ A;  2XY7 A;  1BHL A;  4FK2 A;  1UAX A;  3HO1 A;  1KTQ A;  4AHC A;  1GOA A;  1NOY A;  4KV8 A;  3HVT A;  3JSM A;  4CJQ A;  3NF9 A;  1C1B A;  1WLJ A;  4CJT A;  2FBV A;  4CK3 A;  3OJS A;  4RW8 A;  2HHT A;  1WSH A;  2XY8 A;  4QCL A;  4CEZ A;  2FBY A;  3K5L A;  2PYJ A;  4BDY A;  3V1Q A;  3IRX A;  1WNS A;  3SNN A;  1BCM A;  1NJY A;  2NUB A;  1EX4 A;  2X78 A;  3AO2 A;  3QIP A;  1D9F A;  4C8K A;  4DSI A;  4KO0 A;  3DLR A;  1TKD A;  4C8L A;  4ELV A;  4O0I A;  4Y1D A;  4IFY A;  3VQ5 A;  3KK2 A;  5DMR A;  4FJ9 A;  4NCB A;  4I2P A;  3LAL A;  3TR8 A;  4DQI A;  3FFI A;  3VQE A;  2G8U A;  1GOC A;  3CFR A;  4CF8 A;  4CGH A;  3PO4 A;  3SPZ A;  2HND A;  3JYT A;  4BE0 A;  3LWL A;  1ASU A;  2IS3 A;  4CJP A;  3AVH A;  1WSI A;  2KQ2 A;  3OVN A;  3T1A A;  4Z4C A;  3EZ5 A;  4DSJ A;  4M45 A;  4OPK A;  1W9H A;  3NHG A;  4B9T A;  4OGC A;  1JLB A;  4DQS A;  5T7B A;  1F21 A;  3WNF A;  3SUN A;  1U49 A;  4CEB A;  1Q9X A;  1TV6 A;  3LP3 A;  4ICL A;  4CJW A;  2OPS A;  4KRF A;  3PO5 A;  1O1W A;  3TAN A;  1TK8 A;  3KIO A;  1RT1 A;  4N76 A;  1QQC A;  3NFA A;  4CED A;  1A5W A;  1HMV A;  3KJV A;  2OYQ A;  4F2R A;  3QNO A;  1X9S A;  1I3A A;  1ZYQ A;  2PZS A;  4N5S A;  5J2P A;  5HRN A;  4FK4 A;  5E41 A;  4KRE A;  4DTN A;  1VRT A;  4FM0 A;  4B9L A;  1VSF A;  4Q5V A;  4O0J A;  1SKS A;  5C42 A;  4RG8 A;  3OYB A;  4H4M A;  5HRO A;  3HL8 A;  5J2N A;  2QK9 A;  1IKV A;  2PYL A;  2A1S A;  3DI6 A;  4FLX A;  5JS2 A;  3ALY A;  3O4Q A;  3WNE A;  3D0P A;  4FLY A;  2VWJ A;  2PY5 A;  4IKF A;  4CK1 A;  2P1J A;  4CFC A;  2O4G A;  2GV9 A;  3DOL A;  4FJ8 A;  2HW3 A;  2G8V A;  4C8N A;  2RN2 A;  3V4I A;  4CJE A;  1TL3 A;  4CK2 A;  1NK6 A;  1L3U A;  4ID1 A;  4AHR A;  4FJK A;  1RCH A;  2DFF A;  4E7K A;  4CIG A;  4B08 A;  3OYF A;  3AVM A;  3KLF A;  3AVC A;  4ZTJ A;  1CZ9 A;  2YV0 X;  1BIS A;  1XHZ A;  1EKE A;  3K2P A;  4F4K A;  3M8Q A;  4FJJ A;  4DLE A;  3P1G A;  4E1N A;  3KKR A;  1C0M A;  4B8A B;  4DSE A;  3T19 A;  5SWM A;  3DLB A;  1RDD A;  3CM5 A;  3VA0 A;  2KTQ A;  1TK5 A;  1IKW A;  5CY4 A;  2Z1H A;  1J9A A;  1HRH A;  4LD0 A;  4FXD A;  4FK0 A;  1BI4 A;  5DK5 A;  1TKT A;  4YNQ A;  1QSL A;  3K5O A;  3I8D A;  2HVI A;  2P51 A;  4DU3 A;  4DU4 A;  1U4B A;  1C0U A;  3KLI A;  3CYM A;  1KFD A;  2XO7 A;  1SL2 A;  1L3S A;  1VSJ A;  4CGD A;  4E0D A;  4TSX A;  2BE2 A;  3ZT3 A;  3L2Q A;  3K59 A;  2HHX A;  3NDK A;  5KI6 A;  2WOM A;  3AO5 A;  3DLE A;  4CHO A;  3S3N A;  1S1T A;  4Z0U A;  1WSJ A;  2G8I A;  1VSE A;  1JLG A;  3OY9 A;  4B3O A;  3SUO A;  1S6P A;  1Q8I A;  3AO1 A;  4R5P A;  3L2V A;  3QER A;  4F3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...