1G15A

Co-crystal of e. coli rnase hi with two mn2+ ions bound in the the active site
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
141
Chain Sequence
b'KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHAEVILSTDSQYVRQGITQWIHNWKARGWKPVKNVDLWQRLDAALGQHQIKWEWVGHPENERADELARAAAMNPTLEDTGYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HI
publication title Co-crystal of Escherichia coli RNase HI with Mn2+ ions reveals two divalent metals bound in the active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 47
structure length 141
sequence length 150
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1g15A00
1RT3A 4M45A 4M3WA 4AHCA 3VQQA 4UQGA 4FW1A 2G8WA 3OYEA 3DLEA 3V81A 3SNNA 4J2BA 1JXEA 3VQAA 1XHZA 4DTPA 1L3SA 3ZCMA 1EXQA 3SPYA 3TAFA 1BCMA 1TK0A 3NF7A 3ZSQA 1Q9XA 1X9MA 1RT2A 2YHAA 4FM2A 2P5GA 4KHYA 3KKRA 3TI0A 4DFJA 3RMBA 1D5AA 4FVMA 2XY6A 2Q3SA 2D0CA 1QSSA 2XY8A 2P51A 1BIUA 3V4IA 3VA3A 2HMIA 4CJWA 3KD5E 3VQDA 1C0TA 1TK5A 3LALA 3E01A 3KKSA 2FBXA 4FJ8A 3LPTA 4O0JA 1GOBA 4KREA 2AJQA 4PY5A 3QIOA 3DM2A 4N47A 4ELVA 4R5PA 1HNVA 1S9EA 5KI6A 1J9AA 3OVNA 5CY4A 4CF1A 4DSLA 3K5LA 3VN5A 1C1AA 5J1EA 5KGXA 3CFOA 4DTJA 3TAEA 3CG7A 4DQQA 3RRGA 4O4GA 2IC3A 3ZSZA 3P1GA 1VSLA 2D0BA 3L2RA 2B4JA 4AHSA 3QEVA 4DSEA 1RTIA 3JSMA 4BACA 4HHTA 1LV5A 1Q9YA 3HL8A 4H4MA 4E7KA 1U04A 4DQSA 4ZTFA 3VQ7A 4M3ZA 1JLGA 4HUGA 1BQMA 4I2QA 2EHGA 4F2SA 4PUOA 1A5VA 1YT3A 5DK5A 4CJPA 3U3GA 1NK8A 2HHSA 1VSJA 3EYZA 3B6OA 4OPKA 4FLWA 3V9WA 4CEBA 4FJJA 1WSJA 4C8MA 4E1NA 4Z4CA 3DYAA 1R0AA 4Y1CA 3KLFA 1XI1A 2PYLA 3OYKA 1J54A 1UWBA 3AVMA 3DLKA 4CJ4A 5J2MA 4DSIA 3QESA 4CGIA 4FJ7A 3RR8A 3VQ5A 4IDKA 2PZSA 2OPRA 5KRTA 3PO5A 1VRTA 1X9WA 3MEGA 1TV6A 1L5UA 4KFBA 4CJ5A 4CHNA 4BE1A 3TABA 1RCHA 3IAYA 4DSKA 2DFEA 4DU4A 4FJIA 3G0ZA 1QHTA 1L3VA 3AVHA 4OJRA 2QKKA 4AHRA 1QS4A 4CF8A 3HT3A 3TAGA 2HVIA 2Z1JA 1XC9A 1C1CA 4FYDA 1VSEA 4KHQA 3NF6A 4DLGA 4J2DA 3CFPA 1NJWA 1S1UA 3AVIA 4RG8A 1RDDA 1TL1A 3M8PA 4HUEA 2Z1HA 4RW9A 1JLQA 2WOMA 4CJKA 2EX3A 4B8AB 1KSPA 4FZXC 1J53A 5HBMA 4E19A 3LPUA 4F4KA 3IS9A 3V1OA 2X74A 4CHQA 5SZTA 4DWIA 4KPYA 4FK2A 2OPSA 1TAQA 3ZSVA 4Y1DA 4H4OA 5K14A 3SUPA 4B3OA 1B92A 3DRPA 1T8EA 3PO4A 3AVGA 4G1QA 3NF9A 4PA1A 4CCHA 4KHNA 1YVUA 4BDPA 1TVRA 3A2FA 1D8YA 2HHXA 3OYLA 2DFHA 1IH7A 2IS3A 2O4IA 3QNOA 3OYFA 1S1TA 3H08A 3SZ2A 5HROA 5HLFA 3ZT2A 4CEFA 3QNNA 2VG7A 4CFDA 3C6TA 3QEIA 3T1AA 4KTZA 4WE1A 1VSDA 4CF0A 2KZZA 2YNGA 3OYNA 1CZBA 2VG6A 3SCXA 1BI4A 3K2PA 3NE6A 3K5NA 2G8UA 1VSMA 2FBTA 3ZSYA 2YNHA 4LSNA 1LWFA 1ZBUA 4CJLA 1UAXA 4O44A 1ZBFA 4DG1A 4DS4A 3SQ2A 4FZZA 3EZ5A 1CLQA 4BDZA 4XIUA 1KLMA 1S1WA 4FLUA 1U4BA 4B9NA 4FJGA 1KLNA 2O4GA 1JLEA 1TKZA 3RTVA 4DTRA 3L3UA 3NFAA 3MECA 3S3MA 2A1RA 4JLHA 4FK0A 4KI4A 4KAZA 1RBSA 2D5RA 4QCLA 5KRSA 4CJRA 3CQ8A 4KHSA 1KCFA 3HO1A 1BI4B 1TAUA 4CK2A 1HYVA 1K6YA 1Z26A 4TSXA 4M3YA 3QLHA 3K5OA 3ZSRA 5JS2A 1S6QA 3HPGA 1UA1A 3BDPA 1RBUA 3SQ1A 4HCBA 3HSTB 4O0IA 4CGGA 4JRPA 1KVCA 4BE2A 1BCOA 1Q8IA 1HYZA 1D9DA 2HVHA 3KJVA 1QTMA 4ICLA 4N5SA 1I3AA 4FW2A 1TK8A 2KFNA 4ID1A 4M3UA 4FM0A 2XRIA 1NKCA 1T7PA 1XHXA 3HYFA 4CEQA 4DTSA 1I39A 1G15A 2I5JA 2JLEA 4DU1A 1NK5A 4W5QA 3NH1A 2PYJA 2HHUA 4DQRA 4CEAA 1KVBA 4KHUA 4DFMA 3RRHA 3OYGA 3U3YA 1NK9A 2DFFA 3F73A 3RR7A 3DLRA 4CJFA 1DTQA 1S6PA 1B9DA 1SL1A 1BHLA 3QO9A 2YNFA 5I42A 1CZ9A 1FKOA 3AVFA 4KKOA 3THVA 4GVMA 4CHZA 5CYMA 1WSEA 1HRHA 4FCYA 3SQ0A 1NOYA 3TARA 1VK0A 3DRSA 4CFBA 1REVA 1LAVA 3ZSXA 5FRNA 3C94A 4LH4A 1VSFA 4CFAA 4I9QA 2B5JA 4HUFA 2F8SA 3S3OA 3MXIA 2IGIA 1A5XA 1LAWA 3DRRA 1NK0A 3BGRA 2Z1GA 1CXQA 4IBNA 2E6LA 4MFBA 4BDYA 4N41A 5CZ1A 3KLHA 4NCAA 2A1SA 1EX4A 2HNYA 4CK1A 5FRMA 5HRNA 4CEEA 4K8XA 1Y97A 3VQ8A 2GV9A 4LH5A 1SL2A 3V6DA 1IO2A 1EP4A 1RT1A 4E3SA 1JLAA 1WLJA 4I2PA 1RT7A 1RT5A 3LANA 5J2QA 3TAMA 4FM1A 1U47A 5J2NA 3NHGA 2G8FA 2FC0A 5I3UA 3B6PA 4FZYA 3LAKA 1S1XA 1ASWA 4CJSA 3RMDA 1HJRA 3PUFA 4DMNA 4CECA 3D45A 1NOZA 4EZ9A 1BIZA 4NCGA 1A5WA 1HQUA 1ITGA 3L8BA 4ELTA 5HP1A 1JXBA 2G8KA 3C95A 4KV8A 4CIGA 3CM5A 4M3XA 3VQEA 1HPZA 4AHUA 2OYQA 3OYCA 1HNIA 3AVCA 3KD1E 3TAQA 1J5OA 3MEDA 4RW6A 4RW8A 2W42A 2G8IA 3SQ4A 1NK4A 3KLIA 3WNHA 3QIPA 4DTMA 3AA5X 5D3GA 1RBVA 4CIFA 3UIQA 3PV8A 3P5JA 3OJUA 1HYSA 1BGXT 2BE2A 4IG0A 3AA2A 3WNEA 4RW4A 4CEDA 3ZT3A 3VQCA 3MXMA 4CF9A 2P1JA 3K58A 3VQ6A 1JKHA 3NF8A 1U49A 4ELUA 1CXUA 3ZSWA 1D9FA 4OKEA 3NGYA 4KO0A 3QEXA 3T3FA 4OVLA 3SUOA 3O3FA 3LP3A 1WN7A 4HTUA 4KI6A 1TL3A 4NCBA 2YV0X 1LWCA 3O3HA 1FK9A 1NJXA 3O3GA 1GOAA 2WONA 1KFDA 4C8NA 3I8DA 5T7BA 1RTHA 2F8TA 2HNDA 3ITHA 2HW3A 1IKYA 3ISNC 3QINA 1RTJA 4GW6A 3ZT1A 4CGDA 3SYZA 1KFSA 3T19A 2PY5A 3V1QA 4QOZB 1RT6A 3RMCA 3KLGA 4N56A 4E7JA 3LZIA 3LAMA 5EU7A 4M3RA 4YNQA 4DTUA 4CJQA 1T05A 4FJXA 2KTQA 3MEEA 2RKIA 3L2WA 4KB1A 3DOLA 2XY5A 4CJEA 4OLAA 1WSFA 4B9TA 3VQBA 4ID5A 3WNFA 4CJVA 1TKTA 1IKXA 3ZT4A 1BL3A 3WNGA 4B8CA 3M8RA 4J2AA 4QAGA 2ZE2A 5C24A 4CFCA 2QK9A 1U45A 3I0RA 4CEZA 2G8HA 3SPZA 1KVAA 4CJ3A 2RF2A 4O55A 2IDOA 2IOCA 2FBVA 3NCIA 3S3NA 2OPPA 2KW4A 1U48A 4K8ZA 4E1MA 4OLBA 5FROA 3V9UA 4CGJA 4O5BA 4W5OA 1LW2A 3NDKA 1NJZA 1BQNA 3NH2A 3VA0A 4F3OA 4C8KA 2X6NA 1QSYA 4MQ3A 4J2EA 4CGFA 4IG3A 3OYMA 2BDPA 3TR8A 3L2QA 3TAPA 4KRFA 4M3TA 2HHQA 2B6AA 4L8RB 3HJFA 2E6MA 2VWJA 2YKMA 2VWKA 3OYAA 2HHTA 2KZMA 3K59A 1TGOA 4CF2A 3NGIA 1L3UA 1RBRA 4CERA 1FKPA 3O4QA 4EZ6A 2BGGA 3V1RA 3CYMA 4KTWA 1IKVA 2HB5A 2ITGA 3KK3A 3NGZA 5KGWA 2VG5A 1TKXA 1ZBIA 3JYTA 3QERA 3SJJA 4F3TA 4HVJA 3OS1A 3DLBA 4DSJA 4OGEA 4CJUA 3PY8A 4FJ9A 3NAEA 5C42A 3OS2A 3EY1A 1Z25A 3I0SA 4IFYA 4F2RA 1DLOA 1RDCA 4F8RA 4FJLA 4FJMA 4CESA 1C0UA 1WAFA 3AV9A 4DQIA 5E41A 3MAQA 4DQPA 4DF8A 1SKSA 2GUIA 3DOKA 1NJYA 1F21A 3QEPA 5FDLA 3OYBA 2LSNA 5HRPA 3K57A 4JS4A 4E7HA 1N5YA 1YTUA 1NKBA 5SWMA 3U6FA 3AVJA 3F9KA 3ZT0A 2RPIA 4Z4GA 3DLGA 4Z0UA 3LWLA 3KTQA 1WNSA 4B9UA 4AHVA 4PQUA 1RDAA 3HPOA 3C6UA 3HK2A 4IKFA 1WSHA 4DTOA 3M8SA 3DLHA 4Z4EA 4FJKA 3L3VA 4W5NA 1VRUA 3AVBA 3ASMA 4FK4A 3PX4A 3ULDA 2OZSA 1ASVA 1X1PA 4E0DA 2HHWA 3HP6A 2YKNA 1S9GA 1SV5A 4CHYA 4Z4HA 2HNZA 4FJNA 4HCCA 3AVKA 3HP9A 4Q5VA 4E7LA 4CJTA 1KTQA 3IRXA 1RBTA 3OYIA 2GBZA 3LP1A 4AHTA 3K5MA 3CFRA 4DLEA 2Y1JA 3KK1A 4I7FA 2E4LA 2KQ2A 3HXMA 4DU3A 4KB0A 1VSIA 4KTQA 3SV4A 1VSKA 4JRQA 3TANA 1ASUA 1L3TA 4JS5A 3IG1A 1QE1A 1N6QA 3VQPA 3SV3A 5KTQA 4B9VA 1JL1A 3AO1A 3AO5A 3SI6A 4BWJA 3AO3A 1RDBA 3HM9A 3V9SA 1WAJA 1JLFA 1IG9A 1B9FA 3QETA 4AH9A 4C8OA 4H8KA 1JLBA 4ZHRA 4CK3A 4N76A 3NBPA 1RTDA 1SUQA 2BANA 4I9LA 5C25A 4OKKA 3OYHA 5DMRA 2XHBA 4OKJA 1S1VA 1HQEA 1QSLA 2JGUA 4EP5A 1X9SA 4M41A 4FLTA 1YTAA 4E7IA 3AVLA 2Y1IA 2QKBA 1S5JA 1RT4A 3MXJA 3FFIA 1W0HA 4DFKA 3P83D 3OYJA 4B9MA 1NKEA 2OPQA 3NH0A 4M42A 2X78A 4OGCA 4CE9A 3RWUA 4RW7A 1O1WA 4AILC 1EETA 4B9LA 4PWDA 2DTUA 1SL0A 4LSLA 3OYDA 3RMAA 2G8VA 2ATQA 3HPHA 1WSIA 2D0AA 4FLZA 4CGHA 1NK6A 4Z4IA 1LWEA 4BWMA 1DTTA 5JS1A 4CHPA 4CEOA 3DI6A 4C8LA 4FJHA 1C6VA 1W9HA 3CM6A 4FLXA 3PX0A 3S9HA 1BISA 3AA3A 4LD0A 4CHOA 1WSGA 3OJSA 3L2VA 4DS5A 4DF4A 3LP2A 4W5RA 3D0PA 1ZYQA 4NYFA 4DFPA 2XY7A 1EKEA 3G10A 1LW0A 3QEWA 2FBYA 2YHBA 4NYNA 5CYQA 1IKWA 3V9XA 1ZBLA 4FJ5A 4B9SA 3L2UA 1UOCA 1C0MA 1RNHA 3V9ZA 2HHVA 4FLVA 1VSHA 3ALYA 4LY7A 1KRPA 2DY4A 1T03A 1UA0A 3VQ4A 3ZSOA 4DTNA 3LP0A 2IAJA 4ZTJA 1JLCA 1HMVA 4FLYA 1JL2A 2XO7A 1SKWA 2P5OA 2RN2A 2X6SA 1FXXA 2Z1IA 2KFZA 1ZBHA 1MU2A 2ZD1A 3AVNA 5HRSA 1XWLA 2QXFA 1QQCA 3KK2A 3HVRA 3DMJA 1SKRA 4KHWA 4Q0BA 3AA4A 3VQ9A 4GMJB 3OS0A 3HVTA 3KLEA 3SUQA 1RILA 1GOCA 3AVAA 2ETJA 3KIOA 4DSFA 4DTXA 1NK7A 1TKDA 2OZMA 4Z4FA 4FXDA 5CZ2A 3M8QA 4IFVA 4CIEA 3O4NA 4E89A 3SUNA 2YNIA 4EP4A 4YFUA 3TWHA 4B08A 4BE0A 4OPJA 3LZJA 2OA8A 2R7YA 3AO2A 1C1BA 3OY9A 2ZQBA 2F96A 3LWMA 3LDSA 5J2PA 3PX6A 4W5TA 2NUBA 3AO4A 5HRRA
chains in the Genus database with same CATH superfamily
1RT3A 4XH1A 4BC5A 3V81A 2G8WA 4KHPK 3C65A 1XHZA 3ZCMA 3SPYA 4EIAA 1BCMA 3NF7A 2YHAA 4RCHA 4KHYA 3TI0A 4JI7K 4DFJA 2XY6A 2QWOA 4MO5A 3SMSA 2H3GX 3NVMA 3LM2A 2FSJA 2YHYA 3LALA 1TK5A 5DM6L 3E01A 4CZLA 4PY5A 3QIOA 4N47A 4R5PA 1HNVA 3K5LA 1C1AA 3RRGA 3CG7A 5AQPA 3FGUA 3CCQN 2B4JA 4BVPA 3QEVA 2F9TA 4DSEA 1LV5A 4E7KA 3MN6A 4JI1K 2EHGA 4QS8A 1BA1A 3J7ZO 4IJAA 1A5VA 4KBOA 3U3GA 1NK8A 3EYZA 2O8FA 3B6OA 4CZMA 3OHRA 4FLWA 4CEBA 5CE3A 1U2VA 4E1NA 1FW6A 4H0YB 5BN9A 1R0AA 3KLFA 1UWBA 3DLKA 3QESA 2PZSA 2GUPA 2OPRA 1X9WA 3MEGA 4KFBA 4XH4A 4CJ5A 4DSKA 3O9UA 3OW2M 1MWKA 1QHTA 1L3VA 4OJRA 1Y64A 4AHRA 4CF8A 3TAGA 5KPZA 4KHQA 3NF6A 3ZEUB 4J2DA 3CFPA 4DR4K 4RG8A 3M8PA 4HUEA 4RW9A 5LL6Z 2PFUA 2WOMA 2A3ZA 3IS9A 4CHQA 4FK2A 3JAMO 3ZSVA 1TAQA 2F7TA 4B3OA 5AQTA 1B92A 3PO4A 4PA1A 4G1QA 1KAXA 3NF9A 3DLLL 4CCHA 4KHNA 2HHXA 2YI1A 2DFHA 1IH7A 3CCUN 2O4IA 3BF3A 3SZ2A 4AF1A 3ZT2A 4CEFA 4K25A 4B1ZA 3C6TA 3T1AA 1WB9A 4BRDA 1KQSM 2YNGA 1CZBA 3AGRA 1BI4A 3WXMB 3D2EB 2E20A 4B3RK 1NGIA 1LWFA 4DG1A 4O44A 1ZBFA 4BDZA 4J8FA 1KLMA 1S1WA 4FLUA 1QQMA 3N4QA 2O4GA 5AQLA 2IIRA 4H0XB 2A1RA 3L3UA 3THXA 3IKMA 5GADP 4KI4A 5KRSA 4FWQA 4CJRA 3O08A 5AQMA 1J6ZA 5GIPA 4CK2A 4NO7A 4BR0A 4FPBA 4IOAL 1GLCG 3L6QA 1S6QA 3BDPA 4WFNL 4HCBA 4O0IA 1KVCA 3WT0A 1BCOA 1Q8IA 1LCUA 4ICLA 4FW2A 5AQWA 2GX9A 4JI3K 5TKYA 2Q31A 1XHXA 3HYFA 2P9KB 4CEQA 5BPMA 3SMPA 3FZKA 2CGLA 1HJOA 3NH1A 3A5OC 4CEAA 3M6GA 4BROA 4YDUA 3RRHA 1NK9A 4HWIA 1B9DA 4DKWA 4JYAK 1CZ9A 2HBJA 4GVMA 1XMOK 3F2KA 3QMLA 4OO1J 1HRHA 4PKHA 4M7YA 2WTUA 4FCYA 1K9MO 3A8YA 3DRSA 3T1HK 4CFBA 3ENOA 1SZ2A 2F8SA 3MXIA 1A5XA 1NK0A 3DRRA 1CXQA 2E2NA 5C10A 4BRAA 4RWTA 4A61A 2Q97A 1JLAA 1WLJA 4I2PA 2CH5A 1U47A 4FM1A 4I6MA 2G8FA 3NHGA 2FC0A 3LAKA 3E66A 1ASWA 3RMDA 1HJRA 5AQUA 5CR4A 4EZ9A 3D45A 2I7PA 1A5WA 4CIGA 1HPZA 4AHUA 4IOXA 3KD1E 3KWIA 3MEDA 2W42A 3KWGA 2G8IA 3P4IA 1NK4A 1X9JA 3QIPA 4DR1K 1HX1A 3UKRA 4CZFA 4DV6K 1EWQA 3PV8A 3P5JA 1BGXT 1YF5L 3WNEA 3CETA 2P1JA 3MWTA 3K58A 1JKHA 4DV4K 3BZKA 3ULEB 2O8DA 3SUOA 4OVLA 4ISGA 1WN7A 4A5AA 1Q86O 4JK9A 3O3HA 1FK9A 4IXCA 3VPZA 1GOAA 3SAHA 2OTLN 4C8NA 1KFDA 4A2AA 5FPEA 1RTHA 2HNDA 1JCGA 2FF3B 1IKYA 3ISNC 3ZT1A 5BR9A 3RMCA 3IDHA 3KLGA 3LZIA 3AAQA 4M3RA 1J5EK 4DTUA 4KB1A 3L2WA 3MN5A 1ATSA 1WSFA 1SQKA 2F9WA 4B8CA 3ZT4A 4J2AA 4V19S 2QK9A 4QAGA 5C24A 4BRHA 4CFCA 3K9JA 4CEZA 3C7NA 3UKUA 3I56N 3SPZA 2RHKA 2RF2A 4CJ3A 2IOCA 2FBVA 3HRGA 3JS6A 4OLBA 5FROA 4CGJA 5BRDA 2E2OA 2QM1A 1QSYA 3VESA 3F5TA 3O5BA 4KRFA 4M3TA 2B6AA 4DR3K 1QQNA 2E6MA 3CCRN 2WUSA 4GY2B 2HHTA 2KZMA 1RBRA 4EZ6A 5JICA 3SK3A 4JKDA 5KGWA 3FZHA 3Q7BA 4HVJA 3D6RA 4OGEA 1Z25A 2P9NA 3OBYA 1Q81O 4JK8A 3AV9A 4DF8A 2UXCK 3QEPA 1YTUA 1N5YA 3G6EN 5JVHL 4WQ5C 2YJEA 3THYA 3O9QA 1D4XA 4Z4EA 4DB3A 1OVQA 2OZSA 3ULDA 4E0DA 4H0PA 1X1PA 5C12A 2HNZA 4FJNA 5BREA 4WCEL 4CJTA 2EWSA 4DLEA 4I7FA 1Q18A 4BC2A 4KTQA 5C2DA 1L3TA 1W7AA 5EVZA 1N6QA 3PIOL 1ZXOA 5KTQA 3AO5A 4CZJA 4BWJA 3AO3A 3VGMA 1WAJA 5GAEP 1JLFA 4GKJK 1B9FA 3QETA 4C8OA 1JLBA 4UY8O 4JKFA 4LF5K 4FWLA 4OKKA 5DMRA 3O9TA 4OKJA 4O8KA 4MDBA 4BGAA 2QWMA 4AQYK 2A6AA 2Y1IA 2QKBA 1HLUA 4BR4A 1K8KB 3AAPA 3OYJA 2OPQA 4B1VA 2X78A 4CE9A 4BVOA 4B9LA 2D4WA 2G8VA 1NK6A 2YHXA 2P9LB 3EE8A 4CGHA 4Z4IA 4BWMA 4XH5A 5M1QA 4C8LA 4FJHA 1C6VA 1L3UA 4LD0A 4DS5A 3L2VA 1T03A 1QVFM 4DFPA 2XY7A 2GWKA 2OTJN 2FBYA 2YHBA 4NYNA 5CYQA 1IKWA 5AZJB 4CZGA 1ZBLA 4LF6K 1C0MA 3EKSA 3CMAN 3V9ZA 4FLVA 1KD1O 3SLCA 3VQ4A 4YOXA 2IAJA 3WXJA 1HMVA 1IBMK 2XO7A 1I94K 1FXXA 4BRCA 5EX5A 1ZBHA 3AVNA 1XWLA 2QXFA 3L4IA 1SKRA 4KHWA 5LJWA 2VQEK 1RILA 3WEEB 2ETJA 3KZBA 2OZMA 5CZ2A 3VERA 4E89A 3O4NA 1OH8A 1Z6RA 2FF6A 2P9IB 3LZJA 5LY3A 1XQSC 3LWMA 3PX6A 2ZQBA 2F96A 2D0OA 4M45A 4AHCA 3WXLA 2UU9K 1OKJA 3VQAA 3H1QA 3R3LA 1L3SA 3TAFA 3ZSQA 1N8RO 3ZX2A 1RT2A 2P5GA 3CI5A 3KKRA 3VEXA 4FVMA 3VETA 1QSSA 4FL9A 2O8EB 2P51A 1BIUA 3K9KA 5HL7L 3IUCA 3MWPA 3V4IA 1JCFA 1HUXA 5AR0A 3EKUA 3LDLA 3A0IX 4FJ8A 4X62K 1GOBA 4IEEA 4KREA 2GWJA 1RFQA 2ZM6K 3R1XA 4JKBA 4DQQA 3ZSZA 3P1GA 4K43A 2CGJA 2D0BA 4AHSA 2FSKA 3O1BA 1RTIA 1ESVA 4H4MA 2QWPA 3U4LA 2NRRA 3VQ7A 4HUGA 4DR5K 4YHHK 4PUOA 3VF4A 4AM7A 4FJJA 3NMUA 2VGNA 4C8MA 3DYAA 5FLXO 2PYLA 3OYKA 4DSIA 4H5TA 4CJ7A 5J2MA 5KRTA 3PO5A 2P9SB 5IWAK 1L5UA 4FPAA 4BE1A 4DU4A 4FJIA 1HPMA 5M1KA 4ISEA 3HT3A 2Z1JA 3VOVA 4DHYA 4RTFD 1QQOA 1NMDA 1NJWA 1S1UA 4OX9K 1JLQA 3VGLA 1OVYA 1YJ9N 4BRQA 4FZXC 3BEXA 4NXMK 3LPUA 3SUPA 3DRPA 3AVGA 2NRTA 1TVRA 2GTDA 4JHDA 2CGKA 5HROA 1BDGA 4DR6K 2KZZA 3FR0A 2VG6A 4MLEA 3A5MC 3NE6A 3K5NA 4QS7A 3CJBA 2FBTA 3ZSYA 2YNHA 3E9LA 4LSNA 4DS4A 4FZZA 3EEQA 1CLQA 1KC8O 1BU6O 1U4BA 1XNQK 1KLNA 4WF9L 4JD2B 1TKZA 3MECA 4JNEA 5LMNK 1RBSA 3IFRA 2FLOA 3CQ8A 5KQ8A 3HO1A 1KCFA 1NGDA 1TAUA 5BN8A 3RSEA 4TSXA 3QLHA 2BH1A 4JKGB 5E84A 4CZIA 3I8BA 4FOEA 1RBUA 2HVHA 1QTMA 1NGFA 4N5SA 4FSVA 5AQYA 1TK8A 1BUPA 4JKAA 4M3UA 5F2RA 3HOTA 1T7PA 2E1ZA 4R79A 4DTSA 2I5JA 2JLEA 3MDQA 4DU1A 1NK5A 4W5QA 2PYJA 1MDUB 4B3MK 3EN9A 3TSUA 4DFMA 2W6LA 3OYGA 3U3YA 1DEJA 2PBDA 4EHTA 4CJFA 1SL1A 1VAZA 1HNXK 4DCHA 1FKOA 3AVFA 4KKOA 3THVA 3D2FA 4CHZA 1WSEA 5AFUA 2OCEA 4IO9L 2P9PB 3SQ0A 1NOYA 5KQDA 3TARA 5E26A 5FRNA 5AQIA 3C94A 4LH4A 4HUFA 4DUZK 1YIJN 2VGMA 1TYQA 2Z1GA 4MFBA 2E6LA 4N41A 3CHWA 4NCAA 2A1SA 3ZYYX 1EX4A 2HNYA 3GOIA 4CK1A 4YOVA 3VQ8A 1YJWN 2GV9A 1FJGK 3O80A 4LH5A 1SL2A 1RT1A 3I55N 4E3SA 3ID6A 4BRKA 1RT5A 5J2QA 2E88A 5I3UA 4FZYA 1S1XA 2DPNA 5DM7L 4CECA 1NOZA 1BIZA 1NGJA 4MO4A 1HQUA 3L8BA 1OH7A 4ELTA 3CERA 3LDQA 4M3XA 3VQEA 4U7BA 4K42A 5AQXA 1K73O 1Q82O 1TUYA 2O8CA 1J5OA 4LF9K 3SQ4A 1VQ6N 1ZC6A 3KLIA 1IJJA 5D3GA 3CCEN 1VQMN 3O9RA 5KPRA 4IG0A 4CEDA 3P31A 4CF9A 4BRGA 1K8AO 3VQ6A 3NF8A 4ELUA 3B8AX 4OKEA 4CZHA 3NGYA 5AQVA 2E2QA 3QEXA 3O3FA 4HTUA 4KI6A 1TL3A 1QVGM 2Q0UA 4GV6A 1ZBSA 2F8TA 4FO0A 4H5VA 2IVNA 1W2BM 4YOYA 4CGDA 3MX2A 3FLCO 3T19A 2QEXN 4G9ZA 4QOZB 3N4PA 4H0VB 4H03B 5BPNA 5KPTA 5EU7A 4YNQA 4N56A 4E7JA 1VQNN 4FJXA 3ZETA 2P9UB 2A42A 4B9TA 1ATRA 3DXMB 4CJVA 2KFNA 1IKXA 2YCHA 1U45A 2HOEA 3I0RA 4JI2K 4ILJA 4O55A 1V4TA 4W5OA 4O5BA 1LW2A 3VA0A 4MQ3A 4J2EA 4CGFA 3H46O 4IOCL 3TR8A 5AZIA 3TAPA 2GEMA 4DV3K 1HKGA 4IJNA 1VQ4N 4H0OA 3J7YP 2YKMA 2ZGZA 2BTFA 3MN9A 1FKPA 3O4QA 2BGGA 3PLAA 2HMPA 4BR5A 3NGZA 2HBKA 2VG5A 3A5NC 3JYTA 5TKWA 3OTOK 4DSJA 3HI0A 5C42A 3OS2A 3QDKA 5LMUK 2E1YA 4F2RA 4IZ9A 3VGKA 1C0UA 4DQIA 5E41A 4L3QA 1NJYA 3OYBA 2LSNA 5HRPA 4PL7A 5SWMA 3U6FA 2YX6A 3F9KA 2RPIA 3DLGA 4Z0UA 3LWLA 1C0GA 1WNSA 3KTQA 4KH5A 3HK2A 4FWRA 1QZ6A 4DTOA 2ITMA 3M8SA 3SBTA 3DLHA 3L3VA 3DXKA 1VRUA 4FK4A 3PX4A 2NRWA 4CHYA 2A41A 3AVKA 3CXCM 4LFAK 3IRXA 4GV3A 4CBUA 2FXUA 4KB0A 3CCLN 3UB5A 4GKKK 1ASUA 1GLLO 4JS5A 3IG1A 3HOSA 3SV3A 3SJHA 3AO1A 5F0XA 3SI6A 1RDBA 2QWNA 4AH9A 1VQ7N 4CK3A 1RTDA 2BANA 4I9LA 3WQUA 3OYHA 4JI8K 4BR9A 1QSLA 2JGUA 1VQPN 3G4SN 1S5JA 5AQKA 1NKEA 3RWUA 4C23A 4AILC 4WQ4A 1EETA 3LL3A 4PWDA 2DTUA 1SL0A 5AQRA 3OYDA 2V51B 4FLZA 2D0AA 2V7ZA 4QS9A 3VEYA 4BR2A 5JLHA 1XC3A 3DI6A 3S9HA 1NNEA 1WSGA 1LOTB 4DF4A 3D0PA 4NYFA 3TTCA 2J4RA 1EKEA 4Z94A 4GVEA 1LW0A 3QEWA 3CCJN 4B9SA 3L2UA 1UOCA 1RNHA 3CCMN 1HNZK 2HHVA 3THWA 3H3OB 5ADXH 2DY4A 4DTNA 1JL2A 4YOTA 1XNRK 4MLHA 4BRIA 2X6SA 4O8UA 3O6WA 3KK2A 3AVAA 1GOCA 3KIOA 4DTXA 4Z4FA 2ASPA 4FXDA 3M8QA 4IFVA 4CIEA 4LC9B 4EP4A 2OA8A 3AO2A 3LDSA 4M3WA 2IVPA 3VQQA 4UQGA 4FW1A 3OYEA 2WC9A 3SNNA 4DTPA 1EXQA 2D0PA 3L0QA 1Q9XA 1CZAN 3LM9A 4K0KK 3EE9A 1G99A 3RMBA 1D5AA 4JN4A 2D0CA 2HSTA 3KVGA 2O8BB 4F9OA 1BO5O 1YITN 3VA3A 2HMIA 4CJWA 4A2BA 3KKSA 4O0JA 2AJQA 1YVNA 3CIPA 1HKBA 3DM2A 3QFPA 4ELVA 5KI6A 3L4QA 4DSLA 3VN5A 5J1EA 3CFOA 4O4GA 3CC2N 1E3MA 1VSLA 3H45C 3L2RA 3CPEA 1P90A 3AGKA 3G25A 4CD1A 5AFUH 4NXNK 1ATNA 4BACA 1DT9A 1Q9YA 3HL8A 4DQSA 1U04A 1EQYA 3E9PA 1BQMA 4I2QA 1M90O 2A40A 4F2SA 3OBWA 1YT3A 4PKGA 5DK5A 4CJPA 2HHSA 4BRLA 4BY9C 4OPKA 3V9WA 3ZEUA 3DAWA 1WSJA 4Z4CA 1XI1A 1T3VA 1J54A 5M1OA 4CGIA 3RR8A 1VRTA 1TV6A 3IAYA 1S3XA 3TABA 4CHNA 3E9OA 4LF8K 2DFEA 2QXLA 3T7ZA 3G0ZA 1GLFO 3J80O 2QKKA 2HVIA 2O8FB 1XC9A 3GE1A 2FSNA 4BQLA 4DLGA 1U2VB 4H5WA 1RDDA 1QHAA 1O13A 4CJKA 2RE2A 3CC4N 1KSPA 4JKEA 3VEZA 4E19A 4F4KA 3V1OA 4H5NA 5SZTA 4DWIA 4LFCK 3TTFA 3CQYA 4KPYA 2OPSA 4Y1DA 2NLXA 3D2EA 1YVUA 1D8YA 3OYLA 2IS3A 3QNOA 1S1TA 3H08A 2BUPA 3QEIA 3SAGA 4X66K 1VSDA 4K41A 3SCXA 1S72N 3K2PA 3ZX3A 1OH6A 2G8UA 5ELZA 3ATVA 1VSMA 3QICA 5IT9O 1ILYA 3FZMA 3O8MA 1UAXA 1YJNN 2HBLA 2F4VK 2ZGYA 1MWMA 4FJGA 1HNWK 2V7YA 1JLEA 3R8EA 3NFAA 4FK0A 4JLHA 4OPAA 4QCLA 4IWVA 3BUZB 2P9KA 1BI4B 1Z26A 1P8ZA 4M3YA 2UUAK 3K5OA 5JS2A 3KK7A 3HPGA 3SQ1A 4JRPA 2ZWHA 3MCPA 1HR0K 4YDUC 1HYZA 1D9DA 3R9PA 1IV0A 3THXB 3C0BA 1I3AA 4FM0A 1NKCA 4A59A 3ZLJA 2JWKA 2HHUA 4DQRA 2CH6A 1KVBA 4JV5K 4KHUA 4JI4K 3F73A 1BG3A 3DLRA 5AJ3K 2KHOA 1S6PA 1WOQA 1BHLA 3QO9A 2YNFA 5I42A 4B1YB 1W97L 3MX5A 4B3TK 4DR2K 1REVA 3ZSXA 3VEWA 3CQXA 3GDQA 1VSFA 3H3NO 4I9QA 2QA4N 3J81O 3I33A 2IGIA 4H0TB 3CJ9A 4IBNA 4BDYA 2QI2A 3ATUA 5FRMA 2HBMA 5HRNA 4K8XA 1GLJO 3V6DA 1IO2A 1EP4A 3TTDA 1RT7A 3VEVA 3LANA 3SAFA 4GV9A 3PUFA 1N34K 3FFKB 4NCGA 3ULEA 1JXBA 2G8KA 1T6CA 3C95A 4KV8A 1Z05A 2OYQA 3ENBA 1HNIA 1YUWA 3AVCA 5JLFA 1M1KO 4BG9A 3TU5A 4RW6A 2ZJPL 3WNHA 1RBVA 3OA9A 3UIQA 4I6MB 4KH6A 2BE2A 3AA2A 4RW4A 3MXMA 1CXUA 4BRNA 3VEOA 4X65K 4KO0A 3CCVN 5AQJA 1VHXA 2YV0X 3O3GA 2WONA 5ADXA 1IBLK 3UKRB 1E4GT 3ITHA 2HW3A 4GW6A 3QINA 1RTJA 3TSQA 2PY5A 3V1QA 4FWMA 5F1XA 4CZEA 4XEIA 2O8DB 2E5LK 4EFHA 3A5LC 4FWSA 4CJQA 3MEEA 2RKIA 2JWLA 4CJEA 2Q0RA 4DR7K 3WNFA 1TKTA 3WNGA 5HOOA 1T6DA 3VMFB 2G8HA 3TPQA 1KVAA 3PSFA 4CD3A 2IDOA 3NCIA 2OPPA 2KW4A 3HSCA 3R6MA 4E1MA 4JI5K 3NDKA 4O5FA 3NH2A 4C8KA 1NWKA 3JXUA 4IG3A 2BDPA 2W6KA 4LF4K 2I7NA 2HHQA 2KLAA 1T44A 2VWJA 4FOIA 3C7NB 3UKUB 1NMNA 2IVOA 4B1XB 4DV7K 3MMVA 5AQGA 3UE5A 4KTWA 1IKVA 3AARA 3ZX0A 3CCSN 2ITGA 1HKCA 1TKXA 1ZBIA 3SJJA 5EY4A 3OS1A 4PKIA 3DLBA 4FJ9A 3EY1A 4IFYA 4F8RA 1WAFA 4DQPA 1SKSA 4YY3K 5GAHP 1IBKK 3K57A 1GLDG 1NKBA 3AVJA 4YOUA 3ZT0A 2D1KA 2QWQA 4Z4GA 3K0SA 3Q7CA 4GNIA 4B9UA 4A62A 4AHVA 3HPOA 3C6UA 3AVBA 3MCAB 5GIOA 2P9NB 2YKNA 1S9GA 1SV5A 4Q5VA 5AQZA 4C1NI 2ZJQL 2NRXA 4AHTA 3LP1A 1GLAG 3AY9A 3KK1A 4WQ5A 2KQ2A 3HXMA 3G71N 4DU3A 2UYTA 1VSKA 5BPLA 5LJVA 3THYB 3QBXA 1K8KA 4B9VA 3LDOA 3M1FA 1JL1A 2VYPA 4IFEA 1EO1A 3V9SA 3QFUA 1IG9A 4H8KA 4N76A 2Q2RA 4M7XA 1VQLN 3NBPA 1SUQA 2XHBA 1S1VA 4MDAA 2P9LA 4EP5A 1X9SA 4M41A 4Y0WA 2UUCK 4FLTA 4E7IA 4BREA 3AVLA 5BR8K 4EHUA 4DFKA 1W0HA 3GL1A 1YAGA 2AA4A 3T69A 3EO3A 1SS6A 4B9MA 2QWLA 1V4SA 5AZJA 1KAYA 1O1WA 3C6HA 1VQKN 1SAZA 3PIPL 3RMAA 3HPHA 1WSIA 4WFAL 1LWEA 4CHPA 2VQFK 4CEOA 1W9HA 2HF4A 3CM6A 5AQFA 4FLXA 3PX0A 1BISA 3TSPA 4CHOA 3OJSA 5HLFA 3U9ZA 2QW9A 4PL8A 3WEEA 3G10A 5BRFA 3HTVA 3H6EA 2AP1A 4FWNA 1JCEA 4LY7A 1KRPA 2P9IA 1UA0A 3O1WA 1YI2N 3RVCA 1SKWA 2RN2A 4IEIA 1NM1A 2Z1IA 2KFZA 4Q0BA 3HVRA 1QQCA 3AA4A 3OS0A 3SUQA 1OH5A 1NK7A 4NLCA 3SUNA 5FPDA 4B08A 3BY5A 2R7YA 1C1BA 3OY9A 2O8EA 1NBWA 1R59O 2NUBA 2Q1NA 5HRRA 2QWRA 5JMVA 3DLEA 4J2BA 1JXEA 1TK0A 4JI6K 1H1VA 1X9MA 4FM2A 2ASOA 2WFBA 1WBDA 3IMXA 5GINA 2Q3SA 2XY8A 2ASMA 4BRMA 1RDUA 3VQDA 4BG8A 1C0TA 3KD5E 4NB4A 4DUYK 2FBXA 2NZTA 3LPTA 3SBGA 3J7AP 4U67L 1VQ5N 1S9EA 4BQZA 1J9AA 3OVNA 5CY4A 5AQHA 4CF1A 3TAEA 5KGXA 4DTJA 1NGEA 4C1NK 2IC3A 3CD6N 3U9DA 3JSMA 4HHTA 4OPHA 4ZTFA 2P9SA 4M3ZA 1JLGA 1NLVA 5FPNA 1BA0A 1DKGD 1VSJA 4DV5K 4YORA 1BOTO 4Y1CA 4HTLA 3AVMA 4CJ4A 4FJ7A 3VQ5A 4IDKA 2NRZA 2PAVA 5C15A 1RCHA 4JK7A 4DV0K 2YJFA 2NNWA 2NRVA 1GLEG 3AVHA 1QS4A 3CJ7A 1VQON 1C1CA 4FYDA 1VSEA 2E2PA 3AVIA 3KHYA 5JVGL 1TL1A 2Z1HA 5I9EB 4B9QA 4JKCA 2EX3A 4B8AB 4FWKA 1J53A 5HBMA 1RGIA 2OANA 2X74A 1RDWX 3J8AA 4E1JA 1S22A 4WYBA 4H4OA 5K14A 1NGAA 1T8EA 4BDPA 3A2FA 1NU0A 3ENHA 3FZLA 3OYFA 2HHHK 1YXQA 4JD2A 3QNNA 2VG7A 4CFDA 1VQ8N 4BC4A 4KTZA 4WE1A 3VTIA 4CF0A 3P38A 3OYNA 4BC3A 3C6AA 4JKGA 1ZBUA 4CJLA 3SQ2A 4JHDB 3EZ5A 4A57A 4XIUA 4JAXA 2E8AA 4B9NA 3FZFA 3RTVA 4DTRA 3S3MA 4KAZA 2D5RA 3ID8A 1HYVA 1K6YA 5AQQA 3CC7N 3ZSRA 2YHWA 1UA1A 3HSTB 4CGGA 4BE2A 4LF7K 4CVNE 3KJVA 4BGBA 2WBNA 4ID1A 4M63C 2XRIA 3WXKA 2P9PA 1I39A 1G15A 3RSEB 1N33K 3QBWA 2UXBK 2DFFA 3RR7A 3O4WA 5FPMA 1DTQA 3D7EO 1NJIO 1JJ2M 4CZKA 5CYMA 4IO8A 4B1WB 3S41A 1VK0A 1TUUA 1LAVA 4CFAA 4DQ8A 2B5JA 3S3OA 2HF3A 1LAWA 3BGRA 1N32K 3E1YA 5CZ1A 3KLHA 4KH4A 3WXIA 4CEEA 1Y97A 3D2FB 4FWPA 4BRFA 3TAMA 4AM6A 5J2NA 2ZF5O 3B6PA 4KHSA 4CJSA 1KAZA 2GELA 4DMNA 2KKZA 5BRHA 1ITGA 1C0FA 1TYQB 5HP1A 3CM5A 4JI0K 3OYCA 3TAQA 3HM8A 4RW8A 4DTMA 3AA5X 3F9MA 4CIFA 5AQSA 3CJCA 1HYSA 1NGHA 3OJUA 3ZT3A 3VQCA 2VWBA 1U49A 3GG4A 5M1PA 1WBBA 3ZSWA 1D9FA 4ISFA 3T3FA 3LP3A 2P9UA 3GBTA 4NCBA 1LWCA 3VTHA 2O8CB 4JEPA 3WQTA 3DXMA 1NJXA 5C2FA 3W0LA 4JKHA 3I8DA 5T7BA 2QTDA 4IDHA 1XUPO 3VENA 3SYZA 2W40A 4FVUA 1KFSA 5AQNA 3T1YK 3H1VX 2A5XA 1RT6A 1N36K 3LAMA 3NVKA 5M1FA 1T05A 4DV2K 2KTQA 4YOWA 4OLAA 3DOLA 2XY5A 3CMEN 1U6ZA 2W41A 3QB0A 2UUBK 3VQBA 5GAGP 4ID5A 3M8RA 1NGGA 1BL3A 2ZE2A 5EOYA 3VF2A 1U48A 4K8ZA 3S3NA 1WUAA 3HBTA 3V9UA 4F3OA 1NJZA 1BQNA 2X6NA 2UXDK 3ZETB 3OYMA 1NGBA 3L2QA 1X3MA 4CBWA 4B3SK 4L8RB 3HJFA 4ILHA 2VWKA 3OYAA 4A5BA 1XMQK 3K59A 1TGOA 4CF2A 3NGIA 1VQ9N 2V52B 4CERA 3V1RA 3M5RA 3CYMA 1Q7YO 2HB5A 3KK3A 4CBXA 3QERA 5AZIB 3P39A 4F3TA 3DJCA 4WFBL 5AQOA 4CJUA 3PY8A 3NAEA 3I0SA 1DLOA 1RDCA 4FJLA 4FJMA 4CESA 3MAQA 2GUIA 3DOKA 1F21A 5FDLA 3VF6A 5A2QO 4JS4A 4E7HA 3DWLA 1DGKN 2NRHA 4PQUA 1RDAA 4IKFA 3MN7A 1WSHA 1QZ5A 4FJKA 4W5NA 3ASMA 2HHWA 1ASVA 5B8HA 3HP6A 4Z4HA 3WUHA 4HCCA 3HP9A 4E7LA 1KTQA 1RBTA 3OYIA 2GBZA 3K5MA 3W3DA 3CFRA 3EL2A 1E4FT 2Y1JA 1NG9A 2E4LA 2Q36A 4PHTX 1VSIA 3SV4A 5MLCQ 4JRQA 3TANA 1QE1A 3HZ6A 4B1UB 3VQPA 1KXPA 3DXKB 5CHIA 3HM9A 4CW7B 4ZHRA 5C25A 4WQ4C 3M3ZA 1HQEA 4BRPA 4CI6A 3PSIA 1YTAA 5M1NA 3CPWM 1NGCA 1RT4A 3MXJA 3FFIA 3P83D 4H5RA 3BP8A 2ZJRL 3NH0A 4M42A 3CF5L 4OGCA 4RW7A 4FWOA 1MA9B 3LDPA 4LSLA 2ATQA 1DTTA 1BWFO 1GLBG 5JS1A 3AA3A 1ZYQA 3LDNA 3LP2A 4W5RA 4ILGB 5EXWA 4NLBA 3V9XA 4FJ5A 3U8XA 4X64K 5H1SQ 3BZCA 1VSHA 3ALYA 3CJ1A 4LFBK 3ZSOA 3LP0A 4EAHD 4ZTJA 1JLCA 1YHQN 4FLYA 2P5OA 3CJAA 1MU2A 2ZD1A 4BR7A 1IG8A 3FE1A 5HRSA 3DMJA 1X3NA 3VQ9A 4GMJB 3HVTA 3KLEA 4DSFA 1TKDA 3MK6A 5C0YA 2YNIA 4DV1K 4YFUA 3TWHA 4BE0A 3O9SA 4OPJA 3THWB 1EWRA 3EZWA 2VCPA 5J2PA 3BF1A 4W5TA 2O8BA 3AO4A
chains in the Genus database with same CATH topology
1RT3A 4M45A 4M3WA 4AHCA 3VQQA 4UQGA 4FW1A 2G8WA 3OYEA 3DLEA 3V81A 3SNNA 4J2BA 1JXEA 3VQAA 1XHZA 4DTPA 1L3SA 3ZCMA 1EXQA 3SPYA 3TAFA 1BCMA 1TK0A 3NF7A 3ZSQA 1Q9XA 1X9MA 1RT2A 2YHAA 4FM2A 2P5GA 4KHYA 3KKRA 3TI0A 4DFJA 3RMBA 1D5AA 4FVMA 2XY6A 2Q3SA 2D0CA 1QSSA 2XY8A 2P51A 1BIUA 3V4IA 3VA3A 2HMIA 4CJWA 3KD5E 3VQDA 1C0TA 1TK5A 3LALA 3E01A 3KKSA 2FBXA 4FJ8A 3LPTA 4O0JA 1GOBA 4KREA 2AJQA 4PY5A 3QIOA 3DM2A 4N47A 4ELVA 4R5PA 1HNVA 1S9EA 5KI6A 1J9AA 3OVNA 5CY4A 4CF1A 4DSLA 3K5LA 3VN5A 1C1AA 5J1EA 5KGXA 3CFOA 4DTJA 3TAEA 3CG7A 4DQQA 3RRGA 4O4GA 2IC3A 3ZSZA 3P1GA 1VSLA 2D0BA 3L2RA 2B4JA 4AHSA 3QEVA 4DSEA 1RTIA 3JSMA 4BACA 4HHTA 1LV5A 1Q9YA 3HL8A 4H4MA 4E7KA 1U04A 4DQSA 4ZTFA 3VQ7A 4M3ZA 1JLGA 4HUGA 1BQMA 4I2QA 2EHGA 4F2SA 4PUOA 1A5VA 1YT3A 5DK5A 4CJPA 3U3GA 1NK8A 2HHSA 1VSJA 3EYZA 3B6OA 4OPKA 4FLWA 3V9WA 4CEBA 4FJJA 1WSJA 4C8MA 4E1NA 4Z4CA 3DYAA 1R0AA 4Y1CA 3KLFA 1XI1A 2PYLA 3OYKA 1J54A 1UWBA 3AVMA 3DLKA 4CJ4A 5J2MA 4DSIA 3QESA 4CGIA 4FJ7A 3RR8A 3VQ5A 4IDKA 2PZSA 2OPRA 5KRTA 3PO5A 1VRTA 1X9WA 3MEGA 1TV6A 1L5UA 4KFBA 4CJ5A 4CHNA 4BE1A 3TABA 1RCHA 3IAYA 4DSKA 2DFEA 4DU4A 4FJIA 3G0ZA 1QHTA 1L3VA 3AVHA 4OJRA 2QKKA 4AHRA 1QS4A 4CF8A 3HT3A 3TAGA 2HVIA 2Z1JA 1XC9A 1C1CA 4FYDA 1VSEA 4KHQA 3NF6A 4DLGA 4J2DA 3CFPA 1NJWA 1S1UA 3AVIA 4RG8A 1RDDA 1TL1A 3M8PA 4HUEA 2Z1HA 4RW9A 1JLQA 2WOMA 4CJKA 2EX3A 4B8AB 1KSPA 4FZXC 1J53A 5HBMA 4E19A 3LPUA 4F4KA 3IS9A 3V1OA 2X74A 4CHQA 5SZTA 4DWIA 4KPYA 4FK2A 2OPSA 1TAQA 3ZSVA 4Y1DA 4H4OA 5K14A 3SUPA 4B3OA 1B92A 3DRPA 1T8EA 3PO4A 3AVGA 4G1QA 3NF9A 4PA1A 4CCHA 4KHNA 1YVUA 4BDPA 1TVRA 3A2FA 1D8YA 2HHXA 3OYLA 2DFHA 1IH7A 2IS3A 2O4IA 3QNOA 3OYFA 1S1TA 3H08A 3SZ2A 5HROA 5HLFA 3ZT2A 4CEFA 3QNNA 2VG7A 4CFDA 3C6TA 3QEIA 3T1AA 4KTZA 4WE1A 1VSDA 4CF0A 2KZZA 2YNGA 3OYNA 1CZBA 2VG6A 3SCXA 1BI4A 3K2PA 3NE6A 3K5NA 2G8UA 1VSMA 2FBTA 3ZSYA 2YNHA 4LSNA 1LWFA 1ZBUA 4CJLA 1UAXA 4O44A 1ZBFA 4DG1A 4DS4A 3SQ2A 4FZZA 3EZ5A 1CLQA 4BDZA 4XIUA 1KLMA 1S1WA 4FLUA 1U4BA 4B9NA 4FJGA 1KLNA 2O4GA 1JLEA 1TKZA 3RTVA 4DTRA 3L3UA 3NFAA 3MECA 3S3MA 2A1RA 4JLHA 4FK0A 4KI4A 4KAZA 1RBSA 2D5RA 4QCLA 5KRSA 4CJRA 3CQ8A 4KHSA 1KCFA 3HO1A 1BI4B 1TAUA 4CK2A 1HYVA 1K6YA 1Z26A 4TSXA 4M3YA 3QLHA 3K5OA 3ZSRA 5JS2A 1S6QA 3HPGA 1UA1A 3BDPA 1RBUA 3SQ1A 4HCBA 3HSTB 4O0IA 4CGGA 4JRPA 1KVCA 4BE2A 1BCOA 1Q8IA 1HYZA 1D9DA 2HVHA 3KJVA 1QTMA 4ICLA 4N5SA 1I3AA 4FW2A 1TK8A 2KFNA 4ID1A 4M3UA 4FM0A 2XRIA 1NKCA 1T7PA 1XHXA 3HYFA 4CEQA 4DTSA 1I39A 1G15A 2I5JA 2JLEA 4DU1A 1NK5A 4W5QA 3NH1A 2PYJA 2HHUA 4DQRA 4CEAA 1KVBA 4KHUA 4DFMA 3RRHA 3OYGA 3U3YA 1NK9A 2DFFA 3F73A 3RR7A 3DLRA 4CJFA 1DTQA 1S6PA 1B9DA 1SL1A 1BHLA 3QO9A 2YNFA 5I42A 1CZ9A 1FKOA 3AVFA 4KKOA 3THVA 4GVMA 4CHZA 5CYMA 1WSEA 1HRHA 4FCYA 3SQ0A 1NOYA 3TARA 1VK0A 3DRSA 4CFBA 1REVA 1LAVA 3ZSXA 5FRNA 3C94A 4LH4A 1VSFA 4CFAA 4I9QA 2B5JA 4HUFA 2F8SA 3S3OA 3MXIA 2IGIA 1A5XA 1LAWA 3DRRA 1NK0A 3BGRA 2Z1GA 1CXQA 4IBNA 2E6LA 4MFBA 4BDYA 4N41A 5CZ1A 3KLHA 4NCAA 2A1SA 1EX4A 2HNYA 4CK1A 5FRMA 5HRNA 4CEEA 4K8XA 1Y97A 3VQ8A 2GV9A 4LH5A 1SL2A 3V6DA 1IO2A 1EP4A 1RT1A 4E3SA 1JLAA 1WLJA 4I2PA 1RT7A 1RT5A 3LANA 5J2QA 3TAMA 4FM1A 1U47A 5J2NA 3NHGA 2G8FA 2FC0A 5I3UA 3B6PA 4FZYA 3LAKA 1S1XA 1ASWA 4CJSA 3RMDA 1HJRA 3PUFA 4DMNA 4CECA 3D45A 1NOZA 4EZ9A 1BIZA 4NCGA 1A5WA 1HQUA 1ITGA 3L8BA 4ELTA 5HP1A 1JXBA 2G8KA 3C95A 4KV8A 4CIGA 3CM5A 4M3XA 3VQEA 1HPZA 4AHUA 2OYQA 3OYCA 1HNIA 3AVCA 3KD1E 3TAQA 1J5OA 3MEDA 4RW6A 4RW8A 2W42A 2G8IA 3SQ4A 1NK4A 3KLIA 3WNHA 3QIPA 4DTMA 3AA5X 5D3GA 1RBVA 4CIFA 3UIQA 3PV8A 3P5JA 3OJUA 1HYSA 1BGXT 2BE2A 4IG0A 3AA2A 3WNEA 4RW4A 4CEDA 3ZT3A 3VQCA 3MXMA 4CF9A 2P1JA 3K58A 3VQ6A 1JKHA 3NF8A 1U49A 4ELUA 1CXUA 3ZSWA 1D9FA 4OKEA 3NGYA 4KO0A 3QEXA 3T3FA 4OVLA 3SUOA 3O3FA 3LP3A 1WN7A 4HTUA 4KI6A 1TL3A 4NCBA 2YV0X 1LWCA 3O3HA 1FK9A 1NJXA 3O3GA 1GOAA 2WONA 1KFDA 4C8NA 3I8DA 5T7BA 1RTHA 2F8TA 2HNDA 3ITHA 2HW3A 1IKYA 3ISNC 3QINA 1RTJA 4GW6A 3ZT1A 4CGDA 3SYZA 1KFSA 3T19A 2PY5A 3V1QA 4QOZB 1RT6A 3RMCA 3KLGA 4N56A 4E7JA 3LZIA 3LAMA 5EU7A 4M3RA 4YNQA 4DTUA 4CJQA 1T05A 4FJXA 2KTQA 3MEEA 2RKIA 3L2WA 4KB1A 3DOLA 2XY5A 4CJEA 4OLAA 1WSFA 4B9TA 3VQBA 4ID5A 3WNFA 4CJVA 1TKTA 1IKXA 3ZT4A 1BL3A 3WNGA 4B8CA 3M8RA 4J2AA 4QAGA 2ZE2A 5C24A 4CFCA 2QK9A 1U45A 3I0RA 4CEZA 2G8HA 3SPZA 1KVAA 4CJ3A 2RF2A 4O55A 2IDOA 2IOCA 2FBVA 3NCIA 3S3NA 2OPPA 2KW4A 1U48A 4K8ZA 4E1MA 4OLBA 5FROA 3V9UA 4CGJA 4O5BA 4W5OA 1LW2A 3NDKA 1NJZA 1BQNA 3NH2A 3VA0A 4F3OA 4C8KA 2X6NA 1QSYA 4MQ3A 4J2EA 4CGFA 4IG3A 3OYMA 2BDPA 3TR8A 3L2QA 3TAPA 4KRFA 4M3TA 2HHQA 2B6AA 4L8RB 3HJFA 2E6MA 2VWJA 2YKMA 2VWKA 3OYAA 2HHTA 2KZMA 3K59A 1TGOA 4CF2A 3NGIA 1L3UA 1RBRA 4CERA 1FKPA 3O4QA 4EZ6A 2BGGA 3V1RA 3CYMA 4KTWA 1IKVA 2HB5A 2ITGA 3KK3A 3NGZA 5KGWA 2VG5A 1TKXA 1ZBIA 3JYTA 3QERA 3SJJA 4F3TA 4HVJA 3OS1A 3DLBA 4DSJA 4OGEA 4CJUA 3PY8A 4FJ9A 3NAEA 5C42A 3OS2A 3EY1A 1Z25A 3I0SA 4IFYA 4F2RA 1DLOA 1RDCA 4F8RA 4FJLA 4FJMA 4CESA 1C0UA 1WAFA 3AV9A 4DQIA 5E41A 3MAQA 4DQPA 4DF8A 1SKSA 2GUIA 3DOKA 1NJYA 1F21A 3QEPA 5FDLA 3OYBA 2LSNA 5HRPA 3K57A 4JS4A 4E7HA 1N5YA 1YTUA 1NKBA 5SWMA 3U6FA 3AVJA 3F9KA 3ZT0A 2RPIA 4Z4GA 3DLGA 4Z0UA 3LWLA 3KTQA 1WNSA 4B9UA 4AHVA 4PQUA 1RDAA 3HPOA 3C6UA 3HK2A 4IKFA 1WSHA 4DTOA 3M8SA 3DLHA 4Z4EA 4FJKA 3L3VA 4W5NA 1VRUA 3AVBA 3ASMA 4FK4A 3PX4A 3ULDA 2OZSA 1ASVA 1X1PA 4E0DA 2HHWA 3HP6A 2YKNA 1S9GA 1SV5A 4CHYA 4Z4HA 2HNZA 4FJNA 4HCCA 3AVKA 3HP9A 4Q5VA 4E7LA 4CJTA 1KTQA 3IRXA 1RBTA 3OYIA 2GBZA 3LP1A 4AHTA 3K5MA 3CFRA 4DLEA 2Y1JA 3KK1A 4I7FA 2E4LA 2KQ2A 3HXMA 4DU3A 4KB0A 1VSIA 4KTQA 3SV4A 1VSKA 4JRQA 3TANA 1ASUA 1L3TA 4JS5A 3IG1A 1QE1A 1N6QA 3VQPA 3SV3A 5KTQA 4B9VA 1JL1A 3AO1A 3AO5A 3SI6A 4BWJA 3AO3A 1RDBA 3HM9A 3V9SA 1WAJA 1JLFA 1IG9A 1B9FA 3QETA 4AH9A 4C8OA 4H8KA 1JLBA 4ZHRA 4CK3A 4N76A 3NBPA 1RTDA 1SUQA 2BANA 4I9LA 5C25A 4OKKA 3OYHA 5DMRA 2XHBA 4OKJA 1S1VA 1HQEA 1QSLA 2JGUA 4EP5A 1X9SA 4M41A 4FLTA 1YTAA 4E7IA 3AVLA 2Y1IA 2QKBA 1S5JA 1RT4A 3MXJA 3FFIA 1W0HA 4DFKA 3P83D 3OYJA 4B9MA 1NKEA 2OPQA 3NH0A 4M42A 2X78A 4OGCA 4CE9A 3RWUA 4RW7A 1O1WA 4AILC 1EETA 4B9LA 4PWDA 2DTUA 1SL0A 4LSLA 3OYDA 3RMAA 2G8VA 2ATQA 3HPHA 1WSIA 2D0AA 4FLZA 4CGHA 1NK6A 4Z4IA 1LWEA 4BWMA 1DTTA 5JS1A 4CHPA 4CEOA 3DI6A 4C8LA 4FJHA 1C6VA 1W9HA 3CM6A 4FLXA 3PX0A 3S9HA 1BISA 3AA3A 4LD0A 4CHOA 1WSGA 3OJSA 3L2VA 4DS5A 4DF4A 3LP2A 4W5RA 3D0PA 1ZYQA 4NYFA 4DFPA 2XY7A 1EKEA 3G10A 1LW0A 3QEWA 2FBYA 2YHBA 4NYNA 5CYQA 1IKWA 3V9XA 1ZBLA 4FJ5A 4B9SA 3L2UA 1UOCA 1C0MA 1RNHA 3V9ZA 2HHVA 4FLVA 1VSHA 3ALYA 4LY7A 1KRPA 2DY4A 1T03A 1UA0A 3VQ4A 3ZSOA 4DTNA 3LP0A 2IAJA 4ZTJA 1JLCA 1HMVA 4FLYA 1JL2A 2XO7A 1SKWA 2P5OA 2RN2A 2X6SA 1FXXA 2Z1IA 2KFZA 1ZBHA 1MU2A 2ZD1A 3AVNA 5HRSA 1XWLA 2QXFA 1QQCA 3KK2A 3HVRA 3DMJA 1SKRA 4KHWA 4Q0BA 3AA4A 3VQ9A 4GMJB 3OS0A 3HVTA 3KLEA 3SUQA 1RILA 1GOCA 3AVAA 2ETJA 3KIOA 4DSFA 4DTXA 1NK7A 1TKDA 2OZMA 4Z4FA 4FXDA 5CZ2A 3M8QA 4IFVA 4CIEA 3O4NA 4E89A 3SUNA 2YNIA 4EP4A 4YFUA 3TWHA 4B08A 4BE0A 4OPJA 3LZJA 2OA8A 2R7YA 3AO2A 1C1BA 3OY9A 2ZQBA 2F96A 3LWMA 3LDSA 5J2PA 3PX6A 4W5TA 2NUBA 3AO4A 5HRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RT3 A;  4M45 A;  4M3W A;  4AHC A;  3VQQ A;  4UQG A;  4FW1 A;  2G8W A;  3OYE A;  3DLE A;  3V81 A;  3SNN A;  4J2B A;  1JXE A;  3VQA A;  1XHZ A;  4DTP A;  1L3S A;  3ZCM A;  1EXQ A;  3SPY A;  3TAF A;  1BCM A;  1TK0 A;  3NF7 A;  3ZSQ A;  1Q9X A;  1X9M A;  1RT2 A;  2YHA A;  4FM2 A;  2P5G A;  4KHY A;  3KKR A;  3TI0 A;  4DFJ A;  3RMB A;  1D5A A;  4FVM A;  2XY6 A;  2Q3S A;  2D0C A;  1QSS A;  2XY8 A;  2P51 A;  1BIU A;  3V4I A;  3VA3 A;  2HMI A;  4CJW A;  3KD5 E;  3VQD A;  1C0T A;  1TK5 A;  3LAL A;  3E01 A;  3KKS A;  2FBX A;  4FJ8 A;  3LPT A;  4O0J A;  1GOB A;  4KRE A;  2AJQ A;  4PY5 A;  3QIO A;  3DM2 A;  4N47 A;  4ELV A;  4R5P A;  1HNV A;  1S9E A;  5KI6 A;  1J9A A;  3OVN A;  5CY4 A;  4CF1 A;  4DSL A;  3K5L A;  3VN5 A;  1C1A A;  5J1E A;  5KGX A;  3CFO A;  4DTJ A;  3TAE A;  3CG7 A;  4DQQ A;  3RRG A;  4O4G A;  2IC3 A;  3ZSZ A;  3P1G A;  1VSL A;  2D0B A;  3L2R A;  2B4J A;  4AHS A;  3QEV A;  4DSE A;  1RTI A;  3JSM A;  4BAC A;  4HHT A;  1LV5 A;  1Q9Y A;  3HL8 A;  4H4M A;  4E7K A;  1U04 A;  4DQS A;  4ZTF A;  3VQ7 A;  4M3Z A;  1JLG A;  4HUG A;  1BQM A;  4I2Q A;  2EHG A;  4F2S A;  4PUO A;  1A5V A;  1YT3 A;  5DK5 A;  4CJP A;  3U3G A;  1NK8 A;  2HHS A;  1VSJ A;  3EYZ A;  3B6O A;  4OPK A;  4FLW A;  3V9W A;  4CEB A;  4FJJ A;  1WSJ A;  4C8M A;  4E1N A;  4Z4C A;  3DYA A;  1R0A A;  4Y1C A;  3KLF A;  1XI1 A;  2PYL A;  3OYK A;  1J54 A;  1UWB A;  3AVM A;  3DLK A;  4CJ4 A;  5J2M A;  4DSI A;  3QES A;  4CGI A;  4FJ7 A;  3RR8 A;  3VQ5 A;  4IDK A;  2PZS A;  2OPR A;  5KRT A;  3PO5 A;  1VRT A;  1X9W A;  3MEG A;  1TV6 A;  1L5U A;  4KFB A;  4CJ5 A;  4CHN A;  4BE1 A;  3TAB A;  1RCH A;  3IAY A;  4DSK A;  2DFE A;  4DU4 A;  4FJI A;  3G0Z A;  1QHT A;  1L3V A;  3AVH A;  4OJR A;  2QKK A;  4AHR A;  1QS4 A;  4CF8 A;  3HT3 A;  3TAG A;  2HVI A;  2Z1J A;  1XC9 A;  1C1C A;  4FYD A;  1VSE A;  4KHQ A;  3NF6 A;  4DLG A;  4J2D A;  3CFP A;  1NJW A;  1S1U A;  3AVI A;  4RG8 A;  1RDD A;  1TL1 A;  3M8P A;  4HUE A;  2Z1H A;  4RW9 A;  1JLQ A;  2WOM A;  4CJK A;  2EX3 A;  4B8A B;  1KSP A;  4FZX C;  1J53 A;  5HBM A;  4E19 A;  3LPU A;  4F4K A;  3IS9 A;  3V1O A;  2X74 A;  4CHQ A;  5SZT A;  4DWI A;  4KPY A;  4FK2 A;  2OPS A;  1TAQ A;  3ZSV A;  4Y1D A;  4H4O A;  5K14 A;  3SUP A;  4B3O A;  1B92 A;  3DRP A;  1T8E A;  3PO4 A;  3AVG A;  4G1Q A;  3NF9 A;  4PA1 A;  4CCH A;  4KHN A;  1YVU A;  4BDP A;  1TVR A;  3A2F A;  1D8Y A;  2HHX A;  3OYL A;  2DFH A;  1IH7 A;  2IS3 A;  2O4I A;  3QNO A;  3OYF A;  1S1T A;  3H08 A;  3SZ2 A;  5HRO A;  5HLF A;  3ZT2 A;  4CEF A;  3QNN A;  2VG7 A;  4CFD A;  3C6T A;  3QEI A;  3T1A A;  4KTZ A;  4WE1 A;  1VSD A;  4CF0 A;  2KZZ A;  2YNG A;  3OYN A;  1CZB A;  2VG6 A;  3SCX A;  1BI4 A;  3K2P A;  3NE6 A;  3K5N A;  2G8U A;  1VSM A;  2FBT A;  3ZSY A;  2YNH A;  4LSN A;  1LWF A;  1ZBU A;  4CJL A;  1UAX A;  4O44 A;  1ZBF A;  4DG1 A;  4DS4 A;  3SQ2 A;  4FZZ A;  3EZ5 A;  1CLQ A;  4BDZ A;  4XIU A;  1KLM A;  1S1W A;  4FLU A;  1U4B A;  4B9N A;  4FJG A;  1KLN A;  2O4G A;  1JLE A;  1TKZ A;  3RTV A;  4DTR A;  3L3U A;  3NFA A;  3MEC A;  3S3M A;  2A1R A;  4JLH A;  4FK0 A;  4KI4 A;  4KAZ A;  1RBS A;  2D5R A;  4QCL A;  5KRS A;  4CJR A;  3CQ8 A;  4KHS A;  1KCF A;  3HO1 A;  1BI4 B;  1TAU A;  4CK2 A;  1HYV A;  1K6Y A;  1Z26 A;  4TSX A;  4M3Y A;  3QLH A;  3K5O A;  3ZSR A;  5JS2 A;  1S6Q A;  3HPG A;  1UA1 A;  3BDP A;  1RBU A;  3SQ1 A;  4HCB A;  3HST B;  4O0I A;  4CGG A;  4JRP A;  1KVC A;  4BE2 A;  1BCO A;  1Q8I A;  1HYZ A;  1D9D A;  2HVH A;  3KJV A;  1QTM A;  4ICL A;  4N5S A;  1I3A A;  4FW2 A;  1TK8 A;  2KFN A;  4ID1 A;  4M3U A;  4FM0 A;  2XRI A;  1NKC A;  1T7P A;  1XHX A;  3HYF A;  4CEQ A;  4DTS A;  1I39 A;  1G15 A;  2I5J A;  2JLE A;  4DU1 A;  1NK5 A;  4W5Q A;  3NH1 A;  2PYJ A;  2HHU A;  4DQR A;  4CEA A;  1KVB A;  4KHU A;  4DFM A;  3RRH A;  3OYG A;  3U3Y A;  1NK9 A;  2DFF A;  3F73 A;  3RR7 A;  3DLR A;  4CJF A;  1DTQ A;  1S6P A;  1B9D A;  1SL1 A;  1BHL A;  3QO9 A;  2YNF A;  5I42 A;  1CZ9 A;  1FKO A;  3AVF A;  4KKO A;  3THV A;  4GVM A;  4CHZ A;  5CYM A;  1WSE A;  1HRH A;  4FCY A;  3SQ0 A;  1NOY A;  3TAR A;  1VK0 A;  3DRS A;  4CFB A;  1REV A;  1LAV A;  3ZSX A;  5FRN A;  3C94 A;  4LH4 A;  1VSF A;  4CFA A;  4I9Q A;  2B5J A;  4HUF A;  2F8S A;  3S3O A;  3MXI A;  2IGI A;  1A5X A;  1LAW A;  3DRR A;  1NK0 A;  3BGR A;  2Z1G A;  1CXQ A;  4IBN A;  2E6L A;  4MFB A;  4BDY A;  4N41 A;  5CZ1 A;  3KLH A;  4NCA A;  2A1S A;  1EX4 A;  2HNY A;  4CK1 A;  5FRM A;  5HRN A;  4CEE A;  4K8X A;  1Y97 A;  3VQ8 A;  2GV9 A;  4LH5 A;  1SL2 A;  3V6D A;  1IO2 A;  1EP4 A;  1RT1 A;  4E3S A;  1JLA A;  1WLJ A;  4I2P A;  1RT7 A;  1RT5 A;  3LAN A;  5J2Q A;  3TAM A;  4FM1 A;  1U47 A;  5J2N A;  3NHG A;  2G8F A;  2FC0 A;  5I3U A;  3B6P A;  4FZY A;  3LAK A;  1S1X A;  1ASW A;  4CJS A;  3RMD A;  1HJR A;  3PUF A;  4DMN A;  4CEC A;  3D45 A;  1NOZ A;  4EZ9 A;  1BIZ A;  4NCG A;  1A5W A;  1HQU A;  1ITG A;  3L8B A;  4ELT A;  5HP1 A;  1JXB A;  2G8K A;  3C95 A;  4KV8 A;  4CIG A;  3CM5 A;  4M3X A;  3VQE A;  1HPZ A;  4AHU A;  2OYQ A;  3OYC A;  1HNI A;  3AVC A;  3KD1 E;  3TAQ A;  1J5O A;  3MED A;  4RW6 A;  4RW8 A;  2W42 A;  2G8I A;  3SQ4 A;  1NK4 A;  3KLI A;  3WNH A;  3QIP A;  4DTM A;  3AA5 X;  5D3G A;  1RBV A;  4CIF A;  3UIQ A;  3PV8 A;  3P5J A;  3OJU A;  1HYS A;  1BGX T;  2BE2 A;  4IG0 A;  3AA2 A;  3WNE A;  4RW4 A;  4CED A;  3ZT3 A;  3VQC A;  3MXM A;  4CF9 A;  2P1J A;  3K58 A;  3VQ6 A;  1JKH A;  3NF8 A;  1U49 A;  4ELU A;  1CXU A;  3ZSW A;  1D9F A;  4OKE A;  3NGY A;  4KO0 A;  3QEX A;  3T3F A;  4OVL A;  3SUO A;  3O3F A;  3LP3 A;  1WN7 A;  4HTU A;  4KI6 A;  1TL3 A;  4NCB A;  2YV0 X;  1LWC A;  3O3H A;  1FK9 A;  1NJX A;  3O3G A;  1GOA A;  2WON A;  1KFD A;  4C8N A;  3I8D A;  5T7B A;  1RTH A;  2F8T A;  2HND A;  3ITH A;  2HW3 A;  1IKY A;  3ISN C;  3QIN A;  1RTJ A;  4GW6 A;  3ZT1 A;  4CGD A;  3SYZ A;  1KFS A;  3T19 A;  2PY5 A;  3V1Q A;  4QOZ B;  1RT6 A;  3RMC A;  3KLG A;  4N56 A;  4E7J A;  3LZI A;  3LAM A;  5EU7 A;  4M3R A;  4YNQ A;  4DTU A;  4CJQ A;  1T05 A;  4FJX A;  2KTQ A;  3MEE A;  2RKI A;  3L2W A;  4KB1 A;  3DOL A;  2XY5 A;  4CJE A;  4OLA A;  1WSF A;  4B9T A;  3VQB A;  4ID5 A;  3WNF A;  4CJV A;  1TKT A;  1IKX A;  3ZT4 A;  1BL3 A;  3WNG A;  4B8C A;  3M8R A;  4J2A A;  4QAG A;  2ZE2 A;  5C24 A;  4CFC A;  2QK9 A;  1U45 A;  3I0R A;  4CEZ A;  2G8H A;  3SPZ A;  1KVA A;  4CJ3 A;  2RF2 A;  4O55 A;  2IDO A;  2IOC A;  2FBV A;  3NCI A;  3S3N A;  2OPP A;  2KW4 A;  1U48 A;  4K8Z A;  4E1M A;  4OLB A;  5FRO A;  3V9U A;  4CGJ A;  4O5B A;  4W5O A;  1LW2 A;  3NDK A;  1NJZ A;  1BQN A;  3NH2 A;  3VA0 A;  4F3O A;  4C8K A;  2X6N A;  1QSY A;  4MQ3 A;  4J2E A;  4CGF A;  4IG3 A;  3OYM A;  2BDP A;  3TR8 A;  3L2Q A;  3TAP A;  4KRF A;  4M3T A;  2HHQ A;  2B6A A;  4L8R B;  3HJF A;  2E6M A;  2VWJ A;  2YKM A;  2VWK A;  3OYA A;  2HHT A;  2KZM A;  3K59 A;  1TGO A;  4CF2 A;  3NGI A;  1L3U A;  1RBR A;  4CER A;  1FKP A;  3O4Q A;  4EZ6 A;  2BGG A;  3V1R A;  3CYM A;  4KTW A;  1IKV A;  2HB5 A;  2ITG A;  3KK3 A;  3NGZ A;  5KGW A;  2VG5 A;  1TKX A;  1ZBI A;  3JYT A;  3QER A;  3SJJ A;  4F3T A;  4HVJ A;  3OS1 A;  3DLB A;  4DSJ A;  4OGE A;  4CJU A;  3PY8 A;  4FJ9 A;  3NAE A;  5C42 A;  3OS2 A;  3EY1 A;  1Z25 A;  3I0S A;  4IFY A;  4F2R A;  1DLO A;  1RDC A;  4F8R A;  4FJL A;  4FJM A;  4CES A;  1C0U A;  1WAF A;  3AV9 A;  4DQI A;  5E41 A;  3MAQ A;  4DQP A;  4DF8 A;  1SKS A;  2GUI A;  3DOK A;  1NJY A;  1F21 A;  3QEP A;  5FDL A;  3OYB A;  2LSN A;  5HRP A;  3K57 A;  4JS4 A;  4E7H A;  1N5Y A;  1YTU A;  1NKB A;  5SWM A;  3U6F A;  3AVJ A;  3F9K A;  3ZT0 A;  2RPI A;  4Z4G A;  3DLG A;  4Z0U A;  3LWL A;  3KTQ A;  1WNS A;  4B9U A;  4AHV A;  4PQU A;  1RDA A;  3HPO A;  3C6U A;  3HK2 A;  4IKF A;  1WSH A;  4DTO A;  3M8S A;  3DLH A;  4Z4E A;  4FJK A;  3L3V A;  4W5N A;  1VRU A;  3AVB A;  3ASM A;  4FK4 A;  3PX4 A;  3ULD A;  2OZS A;  1ASV A;  1X1P A;  4E0D A;  2HHW A;  3HP6 A;  2YKN A;  1S9G A;  1SV5 A;  4CHY A;  4Z4H A;  2HNZ A;  4FJN A;  4HCC A;  3AVK A;  3HP9 A;  4Q5V A;  4E7L A;  4CJT A;  1KTQ A;  3IRX A;  1RBT A;  3OYI A;  2GBZ A;  3LP1 A;  4AHT A;  3K5M A;  3CFR A;  4DLE A;  2Y1J A;  3KK1 A;  4I7F A;  2E4L A;  2KQ2 A;  3HXM A;  4DU3 A;  4KB0 A;  1VSI A;  4KTQ A;  3SV4 A;  1VSK A;  4JRQ A;  3TAN A;  1ASU A;  1L3T A;  4JS5 A;  3IG1 A;  1QE1 A;  1N6Q A;  3VQP A;  3SV3 A;  5KTQ A;  4B9V A;  1JL1 A;  3AO1 A;  3AO5 A;  3SI6 A;  4BWJ A;  3AO3 A;  1RDB A;  3HM9 A;  3V9S A;  1WAJ A;  1JLF A;  1IG9 A;  1B9F A;  3QET A;  4AH9 A;  4C8O A;  4H8K A;  1JLB A;  4ZHR A;  4CK3 A;  4N76 A;  3NBP A;  1RTD A;  1SUQ A;  2BAN A;  4I9L A;  5C25 A;  4OKK A;  3OYH A;  5DMR A;  2XHB A;  4OKJ A;  1S1V A;  1HQE A;  1QSL A;  2JGU A;  4EP5 A;  1X9S A;  4M41 A;  4FLT A;  1YTA A;  4E7I A;  3AVL A;  2Y1I A;  2QKB A;  1S5J A;  1RT4 A;  3MXJ A;  3FFI A;  1W0H A;  4DFK A;  3P83 D;  3OYJ A;  4B9M A;  1NKE A;  2OPQ A;  3NH0 A;  4M42 A;  2X78 A;  4OGC A;  4CE9 A;  3RWU A;  4RW7 A;  1O1W A;  4AIL C;  1EET A;  4B9L A;  4PWD A;  2DTU A;  1SL0 A;  4LSL A;  3OYD A;  3RMA A;  2G8V A;  2ATQ A;  3HPH A;  1WSI A;  2D0A A;  4FLZ A;  4CGH A;  1NK6 A;  4Z4I A;  1LWE A;  4BWM A;  1DTT A;  5JS1 A;  4CHP A;  4CEO A;  3DI6 A;  4C8L A;  4FJH A;  1C6V A;  1W9H A;  3CM6 A;  4FLX A;  3PX0 A;  3S9H A;  1BIS A;  3AA3 A;  4LD0 A;  4CHO A;  1WSG A;  3OJS A;  3L2V A;  4DS5 A;  4DF4 A;  3LP2 A;  4W5R A;  3D0P A;  1ZYQ A;  4NYF A;  4DFP A;  2XY7 A;  1EKE A;  3G10 A;  1LW0 A;  3QEW A;  2FBY A;  2YHB A;  4NYN A;  5CYQ A;  1IKW A;  3V9X A;  1ZBL A;  4FJ5 A;  4B9S A;  3L2U A;  1UOC A;  1C0M A;  1RNH A;  3V9Z A;  2HHV A;  4FLV A;  1VSH A;  3ALY A;  4LY7 A;  1KRP A;  2DY4 A;  1T03 A;  1UA0 A;  3VQ4 A;  3ZSO A;  4DTN A;  3LP0 A;  2IAJ A;  4ZTJ A;  1JLC A;  1HMV A;  4FLY A;  1JL2 A;  2XO7 A;  1SKW A;  2P5O A;  2RN2 A;  2X6S A;  1FXX A;  2Z1I A;  2KFZ A;  1ZBH A;  1MU2 A;  2ZD1 A;  3AVN A;  5HRS A;  1XWL A;  2QXF A;  1QQC A;  3KK2 A;  3HVR A;  3DMJ A;  1SKR A;  4KHW A;  4Q0B A;  3AA4 A;  3VQ9 A;  4GMJ B;  3OS0 A;  3HVT A;  3KLE A;  3SUQ A;  1RIL A;  1GOC A;  3AVA A;  2ETJ A;  3KIO A;  4DSF A;  4DTX A;  1NK7 A;  1TKD A;  2OZM A;  4Z4F A;  4FXD A;  5CZ2 A;  3M8Q A;  4IFV A;  4CIE A;  3O4N A;  4E89 A;  3SUN A;  2YNI A;  4EP4 A;  4YFU A;  3TWH A;  4B08 A;  4BE0 A;  4OPJ A;  3LZJ A;  2OA8 A;  2R7Y A;  3AO2 A;  1C1B A;  3OY9 A;  2ZQB A;  2F96 A;  3LWM A;  3LDS A;  5J2P A;  3PX6 A;  4W5T A;  2NUB A;  3AO4 A;  5HRR A; 
#chains in the Genus database with same CATH topology
 1RT3 A;  4XH1 A;  4BC5 A;  3V81 A;  2G8W A;  4KHP K;  3C65 A;  1XHZ A;  3ZCM A;  3SPY A;  4EIA A;  1BCM A;  3NF7 A;  2YHA A;  4RCH A;  4KHY A;  3TI0 A;  4JI7 K;  4DFJ A;  2XY6 A;  2QWO A;  4MO5 A;  3SMS A;  2H3G X;  3NVM A;  3LM2 A;  2FSJ A;  2YHY A;  3LAL A;  1TK5 A;  5DM6 L;  3E01 A;  4CZL A;  4PY5 A;  3QIO A;  4N47 A;  4R5P A;  1HNV A;  3K5L A;  1C1A A;  3RRG A;  3CG7 A;  5AQP A;  3FGU A;  3CCQ N;  2B4J A;  4BVP A;  3QEV A;  2F9T A;  4DSE A;  1LV5 A;  4E7K A;  3MN6 A;  4JI1 K;  2EHG A;  4QS8 A;  1BA1 A;  3J7Z O;  4IJA A;  1A5V A;  4KBO A;  3U3G A;  1NK8 A;  3EYZ A;  2O8F A;  3B6O A;  4CZM A;  3OHR A;  4FLW A;  4CEB A;  5CE3 A;  1U2V A;  4E1N A;  1FW6 A;  4H0Y B;  5BN9 A;  1R0A A;  3KLF A;  1UWB A;  3DLK A;  3QES A;  2PZS A;  2GUP A;  2OPR A;  1X9W A;  3MEG A;  4KFB A;  4XH4 A;  4CJ5 A;  4DSK A;  3O9U A;  3OW2 M;  1MWK A;  1QHT A;  1L3V A;  4OJR A;  1Y64 A;  4AHR A;  4CF8 A;  3TAG A;  5KPZ A;  4KHQ A;  3NF6 A;  3ZEU B;  4J2D A;  3CFP A;  4DR4 K;  4RG8 A;  3M8P A;  4HUE A;  4RW9 A;  5LL6 Z;  2PFU A;  2WOM A;  2A3Z A;  3IS9 A;  4CHQ A;  4FK2 A;  3JAM O;  3ZSV A;  1TAQ A;  2F7T A;  4B3O A;  5AQT A;  1B92 A;  3PO4 A;  4PA1 A;  4G1Q A;  1KAX A;  3NF9 A;  3DLL L;  4CCH A;  4KHN A;  2HHX A;  2YI1 A;  2DFH A;  1IH7 A;  3CCU N;  2O4I A;  3BF3 A;  3SZ2 A;  4AF1 A;  3ZT2 A;  4CEF A;  4K25 A;  4B1Z A;  3C6T A;  3T1A A;  1WB9 A;  4BRD A;  1KQS M;  2YNG A;  1CZB A;  3AGR A;  1BI4 A;  3WXM B;  3D2E B;  2E20 A;  4B3R K;  1NGI A;  1LWF A;  4DG1 A;  4O44 A;  1ZBF A;  4BDZ A;  4J8F A;  1KLM A;  1S1W A;  4FLU A;  1QQM A;  3N4Q A;  2O4G A;  5AQL A;  2IIR A;  4H0X B;  2A1R A;  3L3U A;  3THX A;  3IKM A;  5GAD P;  4KI4 A;  5KRS A;  4FWQ A;  4CJR A;  3O08 A;  5AQM A;  1J6Z A;  5GIP A;  4CK2 A;  4NO7 A;  4BR0 A;  4FPB A;  4IOA L;  1GLC G;  3L6Q A;  1S6Q A;  3BDP A;  4WFN L;  4HCB A;  4O0I A;  1KVC A;  3WT0 A;  1BCO A;  1Q8I A;  1LCU A;  4ICL A;  4FW2 A;  5AQW A;  2GX9 A;  4JI3 K;  5TKY A;  2Q31 A;  1XHX A;  3HYF A;  2P9K B;  4CEQ A;  5BPM A;  3SMP A;  3FZK A;  2CGL A;  1HJO A;  3NH1 A;  3A5O C;  4CEA A;  3M6G A;  4BRO A;  4YDU A;  3RRH A;  1NK9 A;  4HWI A;  1B9D A;  4DKW A;  4JYA K;  1CZ9 A;  2HBJ A;  4GVM A;  1XMO K;  3F2K A;  3QML A;  4OO1 J;  1HRH A;  4PKH A;  4M7Y A;  2WTU A;  4FCY A;  1K9M O;  3A8Y A;  3DRS A;  3T1H K;  4CFB A;  3ENO A;  1SZ2 A;  2F8S A;  3MXI A;  1A5X A;  1NK0 A;  3DRR A;  1CXQ A;  2E2N A;  5C10 A;  4BRA A;  4RWT A;  4A61 A;  2Q97 A;  1JLA A;  1WLJ A;  4I2P A;  2CH5 A;  1U47 A;  4FM1 A;  4I6M A;  2G8F A;  3NHG A;  2FC0 A;  3LAK A;  3E66 A;  1ASW A;  3RMD A;  1HJR A;  5AQU A;  5CR4 A;  4EZ9 A;  3D45 A;  2I7P A;  1A5W A;  4CIG A;  1HPZ A;  4AHU A;  4IOX A;  3KD1 E;  3KWI A;  3MED A;  2W42 A;  3KWG A;  2G8I A;  3P4I A;  1NK4 A;  1X9J A;  3QIP A;  4DR1 K;  1HX1 A;  3UKR A;  4CZF A;  4DV6 K;  1EWQ A;  3PV8 A;  3P5J A;  1BGX T;  1YF5 L;  3WNE A;  3CET A;  2P1J A;  3MWT A;  3K58 A;  1JKH A;  4DV4 K;  3BZK A;  3ULE B;  2O8D A;  3SUO A;  4OVL A;  4ISG A;  1WN7 A;  4A5A A;  1Q86 O;  4JK9 A;  3O3H A;  1FK9 A;  4IXC A;  3VPZ A;  1GOA A;  3SAH A;  2OTL N;  4C8N A;  1KFD A;  4A2A A;  5FPE A;  1RTH A;  2HND A;  1JCG A;  2FF3 B;  1IKY A;  3ISN C;  3ZT1 A;  5BR9 A;  3RMC A;  3IDH A;  3KLG A;  3LZI A;  3AAQ A;  4M3R A;  1J5E K;  4DTU A;  4KB1 A;  3L2W A;  3MN5 A;  1ATS A;  1WSF A;  1SQK A;  2F9W A;  4B8C A;  3ZT4 A;  4J2A A;  4V19 S;  2QK9 A;  4QAG A;  5C24 A;  4BRH A;  4CFC A;  3K9J A;  4CEZ A;  3C7N A;  3UKU A;  3I56 N;  3SPZ A;  2RHK A;  2RF2 A;  4CJ3 A;  2IOC A;  2FBV A;  3HRG A;  3JS6 A;  4OLB A;  5FRO A;  4CGJ A;  5BRD A;  2E2O A;  2QM1 A;  1QSY A;  3VES A;  3F5T A;  3O5B A;  4KRF A;  4M3T A;  2B6A A;  4DR3 K;  1QQN A;  2E6M A;  3CCR N;  2WUS A;  4GY2 B;  2HHT A;  2KZM A;  1RBR A;  4EZ6 A;  5JIC A;  3SK3 A;  4JKD A;  5KGW A;  3FZH A;  3Q7B A;  4HVJ A;  3D6R A;  4OGE A;  1Z25 A;  2P9N A;  3OBY A;  1Q81 O;  4JK8 A;  3AV9 A;  4DF8 A;  2UXC K;  3QEP A;  1YTU A;  1N5Y A;  3G6E N;  5JVH L;  4WQ5 C;  2YJE A;  3THY A;  3O9Q A;  1D4X A;  4Z4E A;  4DB3 A;  1OVQ A;  2OZS A;  3ULD A;  4E0D A;  4H0P A;  1X1P A;  5C12 A;  2HNZ A;  4FJN A;  5BRE A;  4WCE L;  4CJT A;  2EWS A;  4DLE A;  4I7F A;  1Q18 A;  4BC2 A;  4KTQ A;  5C2D A;  1L3T A;  1W7A A;  5EVZ A;  1N6Q A;  3PIO L;  1ZXO A;  5KTQ A;  3AO5 A;  4CZJ A;  4BWJ A;  3AO3 A;  3VGM A;  1WAJ A;  5GAE P;  1JLF A;  4GKJ K;  1B9F A;  3QET A;  4C8O A;  1JLB A;  4UY8 O;  4JKF A;  4LF5 K;  4FWL A;  4OKK A;  5DMR A;  3O9T A;  4OKJ A;  4O8K A;  4MDB A;  4BGA A;  2QWM A;  4AQY K;  2A6A A;  2Y1I A;  2QKB A;  1HLU A;  4BR4 A;  1K8K B;  3AAP A;  3OYJ A;  2OPQ A;  4B1V A;  2X78 A;  4CE9 A;  4BVO A;  4B9L A;  2D4W A;  2G8V A;  1NK6 A;  2YHX A;  2P9L B;  3EE8 A;  4CGH A;  4Z4I A;  4BWM A;  4XH5 A;  5M1Q A;  4C8L A;  4FJH A;  1C6V A;  1L3U A;  4LD0 A;  4DS5 A;  3L2V A;  1T03 A;  1QVF M;  4DFP A;  2XY7 A;  2GWK A;  2OTJ N;  2FBY A;  2YHB A;  4NYN A;  5CYQ A;  1IKW A;  5AZJ B;  4CZG A;  1ZBL A;  4LF6 K;  1C0M A;  3EKS A;  3CMA N;  3V9Z A;  4FLV A;  1KD1 O;  3SLC A;  3VQ4 A;  4YOX A;  2IAJ A;  3WXJ A;  1HMV A;  1IBM K;  2XO7 A;  1I94 K;  1FXX A;  4BRC A;  5EX5 A;  1ZBH A;  3AVN A;  1XWL A;  2QXF A;  3L4I A;  1SKR A;  4KHW A;  5LJW A;  2VQE K;  1RIL A;  3WEE B;  2ETJ A;  3KZB A;  2OZM A;  5CZ2 A;  3VER A;  4E89 A;  3O4N A;  1OH8 A;  1Z6R A;  2FF6 A;  2P9I B;  3LZJ A;  5LY3 A;  1XQS C;  3LWM A;  3PX6 A;  2ZQB A;  2F96 A;  2D0O A;  4M45 A;  4AHC A;  3WXL A;  2UU9 K;  1OKJ A;  3VQA A;  3H1Q A;  3R3L A;  1L3S A;  3TAF A;  3ZSQ A;  1N8R O;  3ZX2 A;  1RT2 A;  2P5G A;  3CI5 A;  3KKR A;  3VEX A;  4FVM A;  3VET A;  1QSS A;  4FL9 A;  2O8E B;  2P51 A;  1BIU A;  3K9K A;  5HL7 L;  3IUC A;  3MWP A;  3V4I A;  1JCF A;  1HUX A;  5AR0 A;  3EKU A;  3LDL A;  3A0I X;  4FJ8 A;  4X62 K;  1GOB A;  4IEE A;  4KRE A;  2GWJ A;  1RFQ A;  2ZM6 K;  3R1X A;  4JKB A;  4DQQ A;  3ZSZ A;  3P1G A;  4K43 A;  2CGJ A;  2D0B A;  4AHS A;  2FSK A;  3O1B A;  1RTI A;  1ESV A;  4H4M A;  2QWP A;  3U4L A;  2NRR A;  3VQ7 A;  4HUG A;  4DR5 K;  4YHH K;  4PUO A;  3VF4 A;  4AM7 A;  4FJJ A;  3NMU A;  2VGN A;  4C8M A;  3DYA A;  5FLX O;  2PYL A;  3OYK A;  4DSI A;  4H5T A;  4CJ7 A;  5J2M A;  5KRT A;  3PO5 A;  2P9S B;  5IWA K;  1L5U A;  4FPA A;  4BE1 A;  4DU4 A;  4FJI A;  1HPM A;  5M1K A;  4ISE A;  3HT3 A;  2Z1J A;  3VOV A;  4DHY A;  4RTF D;  1QQO A;  1NMD A;  1NJW A;  1S1U A;  4OX9 K;  1JLQ A;  3VGL A;  1OVY A;  1YJ9 N;  4BRQ A;  4FZX C;  3BEX A;  4NXM K;  3LPU A;  3SUP A;  3DRP A;  3AVG A;  2NRT A;  1TVR A;  2GTD A;  4JHD A;  2CGK A;  5HRO A;  1BDG A;  4DR6 K;  2KZZ A;  3FR0 A;  2VG6 A;  4MLE A;  3A5M C;  3NE6 A;  3K5N A;  4QS7 A;  3CJB A;  2FBT A;  3ZSY A;  2YNH A;  3E9L A;  4LSN A;  4DS4 A;  4FZZ A;  3EEQ A;  1CLQ A;  1KC8 O;  1BU6 O;  1U4B A;  1XNQ K;  1KLN A;  4WF9 L;  4JD2 B;  1TKZ A;  3MEC A;  4JNE A;  5LMN K;  1RBS A;  3IFR A;  2FLO A;  3CQ8 A;  5KQ8 A;  3HO1 A;  1KCF A;  1NGD A;  1TAU A;  5BN8 A;  3RSE A;  4TSX A;  3QLH A;  2BH1 A;  4JKG B;  5E84 A;  4CZI A;  3I8B A;  4FOE A;  1RBU A;  2HVH A;  1QTM A;  1NGF A;  4N5S A;  4FSV A;  5AQY A;  1TK8 A;  1BUP A;  4JKA A;  4M3U A;  5F2R A;  3HOT A;  1T7P A;  2E1Z A;  4R79 A;  4DTS A;  2I5J A;  2JLE A;  3MDQ A;  4DU1 A;  1NK5 A;  4W5Q A;  2PYJ A;  1MDU B;  4B3M K;  3EN9 A;  3TSU A;  4DFM A;  2W6L A;  3OYG A;  3U3Y A;  1DEJ A;  2PBD A;  4EHT A;  4CJF A;  1SL1 A;  1VAZ A;  1HNX K;  4DCH A;  1FKO A;  3AVF A;  4KKO A;  3THV A;  3D2F A;  4CHZ A;  1WSE A;  5AFU A;  2OCE A;  4IO9 L;  2P9P B;  3SQ0 A;  1NOY A;  5KQD A;  3TAR A;  5E26 A;  5FRN A;  5AQI A;  3C94 A;  4LH4 A;  4HUF A;  4DUZ K;  1YIJ N;  2VGM A;  1TYQ A;  2Z1G A;  4MFB A;  2E6L A;  4N41 A;  3CHW A;  4NCA A;  2A1S A;  3ZYY X;  1EX4 A;  2HNY A;  3GOI A;  4CK1 A;  4YOV A;  3VQ8 A;  1YJW N;  2GV9 A;  1FJG K;  3O80 A;  4LH5 A;  1SL2 A;  1RT1 A;  3I55 N;  4E3S A;  3ID6 A;  4BRK A;  1RT5 A;  5J2Q A;  2E88 A;  5I3U A;  4FZY A;  1S1X A;  2DPN A;  5DM7 L;  4CEC A;  1NOZ A;  1BIZ A;  1NGJ A;  4MO4 A;  1HQU A;  3L8B A;  1OH7 A;  4ELT A;  3CER A;  3LDQ A;  4M3X A;  3VQE A;  4U7B A;  4K42 A;  5AQX A;  1K73 O;  1Q82 O;  1TUY A;  2O8C A;  1J5O A;  4LF9 K;  3SQ4 A;  1VQ6 N;  1ZC6 A;  3KLI A;  1IJJ A;  5D3G A;  3CCE N;  1VQM N;  3O9R A;  5KPR A;  4IG0 A;  4CED A;  3P31 A;  4CF9 A;  4BRG A;  1K8A O;  3VQ6 A;  3NF8 A;  4ELU A;  3B8A X;  4OKE A;  4CZH A;  3NGY A;  5AQV A;  2E2Q A;  3QEX A;  3O3F A;  4HTU A;  4KI6 A;  1TL3 A;  1QVG M;  2Q0U A;  4GV6 A;  1ZBS A;  2F8T A;  4FO0 A;  4H5V A;  2IVN A;  1W2B M;  4YOY A;  4CGD A;  3MX2 A;  3FLC O;  3T19 A;  2QEX N;  4G9Z A;  4QOZ B;  3N4P A;  4H0V B;  4H03 B;  5BPN A;  5KPT A;  5EU7 A;  4YNQ A;  4N56 A;  4E7J A;  1VQN N;  4FJX A;  3ZET A;  2P9U B;  2A42 A;  4B9T A;  1ATR A;  3DXM B;  4CJV A;  2KFN A;  1IKX A;  2YCH A;  1U45 A;  2HOE A;  3I0R A;  4JI2 K;  4ILJ A;  4O55 A;  1V4T A;  4W5O A;  4O5B A;  1LW2 A;  3VA0 A;  4MQ3 A;  4J2E A;  4CGF A;  3H46 O;  4IOC L;  3TR8 A;  5AZI A;  3TAP A;  2GEM A;  4DV3 K;  1HKG A;  4IJN A;  1VQ4 N;  4H0O A;  3J7Y P;  2YKM A;  2ZGZ A;  2BTF A;  3MN9 A;  1FKP A;  3O4Q A;  2BGG A;  3PLA A;  2HMP A;  4BR5 A;  3NGZ A;  2HBK A;  2VG5 A;  3A5N C;  3JYT A;  5TKW A;  3OTO K;  4DSJ A;  3HI0 A;  5C42 A;  3OS2 A;  3QDK A;  5LMU K;  2E1Y A;  4F2R A;  4IZ9 A;  3VGK A;  1C0U A;  4DQI A;  5E41 A;  4L3Q A;  1NJY A;  3OYB A;  2LSN A;  5HRP A;  4PL7 A;  5SWM A;  3U6F A;  2YX6 A;  3F9K A;  2RPI A;  3DLG A;  4Z0U A;  3LWL A;  1C0G A;  1WNS A;  3KTQ A;  4KH5 A;  3HK2 A;  4FWR A;  1QZ6 A;  4DTO A;  2ITM A;  3M8S A;  3SBT A;  3DLH A;  3L3V A;  3DXK A;  1VRU A;  4FK4 A;  3PX4 A;  2NRW A;  4CHY A;  2A41 A;  3AVK A;  3CXC M;  4LFA K;  3IRX A;  4GV3 A;  4CBU A;  2FXU A;  4KB0 A;  3CCL N;  3UB5 A;  4GKK K;  1ASU A;  1GLL O;  4JS5 A;  3IG1 A;  3HOS A;  3SV3 A;  3SJH A;  3AO1 A;  5F0X A;  3SI6 A;  1RDB A;  2QWN A;  4AH9 A;  1VQ7 N;  4CK3 A;  1RTD A;  2BAN A;  4I9L A;  3WQU A;  3OYH A;  4JI8 K;  4BR9 A;  1QSL A;  2JGU A;  1VQP N;  3G4S N;  1S5J A;  5AQK A;  1NKE A;  3RWU A;  4C23 A;  4AIL C;  4WQ4 A;  1EET A;  3LL3 A;  4PWD A;  2DTU A;  1SL0 A;  5AQR A;  3OYD A;  2V51 B;  4FLZ A;  2D0A A;  2V7Z A;  4QS9 A;  3VEY A;  4BR2 A;  5JLH A;  1XC3 A;  3DI6 A;  3S9H A;  1NNE A;  1WSG A;  1LOT B;  4DF4 A;  3D0P A;  4NYF A;  3TTC A;  2J4R A;  1EKE A;  4Z94 A;  4GVE A;  1LW0 A;  3QEW A;  3CCJ N;  4B9S A;  3L2U A;  1UOC A;  1RNH A;  3CCM N;  1HNZ K;  2HHV A;  3THW A;  3H3O B;  5ADX H;  2DY4 A;  4DTN A;  1JL2 A;  4YOT A;  1XNR K;  4MLH A;  4BRI A;  2X6S A;  4O8U A;  3O6W A;  3KK2 A;  3AVA A;  1GOC A;  3KIO A;  4DTX A;  4Z4F A;  2ASP A;  4FXD A;  3M8Q A;  4IFV A;  4CIE A;  4LC9 B;  4EP4 A;  2OA8 A;  3AO2 A;  3LDS A;  4M3W A;  2IVP A;  3VQQ A;  4UQG A;  4FW1 A;  3OYE A;  2WC9 A;  3SNN A;  4DTP A;  1EXQ A;  2D0P A;  3L0Q A;  1Q9X A;  1CZA N;  3LM9 A;  4K0K K;  3EE9 A;  1G99 A;  3RMB A;  1D5A A;  4JN4 A;  2D0C A;  2HST A;  3KVG A;  2O8B B;  4F9O A;  1BO5 O;  1YIT N;  3VA3 A;  2HMI A;  4CJW A;  4A2B A;  3KKS A;  4O0J A;  2AJQ A;  1YVN A;  3CIP A;  1HKB A;  3DM2 A;  3QFP A;  4ELV A;  5KI6 A;  3L4Q A;  4DSL A;  3VN5 A;  5J1E A;  3CFO A;  4O4G A;  3CC2 N;  1E3M A;  1VSL A;  3H45 C;  3L2R A;  3CPE A;  1P90 A;  3AGK A;  3G25 A;  4CD1 A;  5AFU H;  4NXN K;  1ATN A;  4BAC A;  1DT9 A;  1Q9Y A;  3HL8 A;  4DQS A;  1U04 A;  1EQY A;  3E9P A;  1BQM A;  4I2Q A;  1M90 O;  2A40 A;  4F2S A;  3OBW A;  1YT3 A;  4PKG A;  5DK5 A;  4CJP A;  2HHS A;  4BRL A;  4BY9 C;  4OPK A;  3V9W A;  3ZEU A;  3DAW A;  1WSJ A;  4Z4C A;  1XI1 A;  1T3V A;  1J54 A;  5M1O A;  4CGI A;  3RR8 A;  1VRT A;  1TV6 A;  3IAY A;  1S3X A;  3TAB A;  4CHN A;  3E9O A;  4LF8 K;  2DFE A;  2QXL A;  3T7Z A;  3G0Z A;  1GLF O;  3J80 O;  2QKK A;  2HVI A;  2O8F B;  1XC9 A;  3GE1 A;  2FSN A;  4BQL A;  4DLG A;  1U2V B;  4H5W A;  1RDD A;  1QHA A;  1O13 A;  4CJK A;  2RE2 A;  3CC4 N;  1KSP A;  4JKE A;  3VEZ A;  4E19 A;  4F4K A;  3V1O A;  4H5N A;  5SZT A;  4DWI A;  4LFC K;  3TTF A;  3CQY A;  4KPY A;  2OPS A;  4Y1D A;  2NLX A;  3D2E A;  1YVU A;  1D8Y A;  3OYL A;  2IS3 A;  3QNO A;  1S1T A;  3H08 A;  2BUP A;  3QEI A;  3SAG A;  4X66 K;  1VSD A;  4K41 A;  3SCX A;  1S72 N;  3K2P A;  3ZX3 A;  1OH6 A;  2G8U A;  5ELZ A;  3ATV A;  1VSM A;  3QIC A;  5IT9 O;  1ILY A;  3FZM A;  3O8M A;  1UAX A;  1YJN N;  2HBL A;  2F4V K;  2ZGY A;  1MWM A;  4FJG A;  1HNW K;  2V7Y A;  1JLE A;  3R8E A;  3NFA A;  4FK0 A;  4JLH A;  4OPA A;  4QCL A;  4IWV A;  3BUZ B;  2P9K A;  1BI4 B;  1Z26 A;  1P8Z A;  4M3Y A;  2UUA K;  3K5O A;  5JS2 A;  3KK7 A;  3HPG A;  3SQ1 A;  4JRP A;  2ZWH A;  3MCP A;  1HR0 K;  4YDU C;  1HYZ A;  1D9D A;  3R9P A;  1IV0 A;  3THX B;  3C0B A;  1I3A A;  4FM0 A;  1NKC A;  4A59 A;  3ZLJ A;  2JWK A;  2HHU A;  4DQR A;  2CH6 A;  1KVB A;  4JV5 K;  4KHU A;  4JI4 K;  3F73 A;  1BG3 A;  3DLR A;  5AJ3 K;  2KHO A;  1S6P A;  1WOQ A;  1BHL A;  3QO9 A;  2YNF A;  5I42 A;  4B1Y B;  1W97 L;  3MX5 A;  4B3T K;  4DR2 K;  1REV A;  3ZSX A;  3VEW A;  3CQX A;  3GDQ A;  1VSF A;  3H3N O;  4I9Q A;  2QA4 N;  3J81 O;  3I33 A;  2IGI A;  4H0T B;  3CJ9 A;  4IBN A;  4BDY A;  2QI2 A;  3ATU A;  5FRM A;  2HBM A;  5HRN A;  4K8X A;  1GLJ O;  3V6D A;  1IO2 A;  1EP4 A;  3TTD A;  1RT7 A;  3VEV A;  3LAN A;  3SAF A;  4GV9 A;  3PUF A;  1N34 K;  3FFK B;  4NCG A;  3ULE A;  1JXB A;  2G8K A;  1T6C A;  3C95 A;  4KV8 A;  1Z05 A;  2OYQ A;  3ENB A;  1HNI A;  1YUW A;  3AVC A;  5JLF A;  1M1K O;  4BG9 A;  3TU5 A;  4RW6 A;  2ZJP L;  3WNH A;  1RBV A;  3OA9 A;  3UIQ A;  4I6M B;  4KH6 A;  2BE2 A;  3AA2 A;  4RW4 A;  3MXM A;  1CXU A;  4BRN A;  3VEO A;  4X65 K;  4KO0 A;  3CCV N;  5AQJ A;  1VHX A;  2YV0 X;  3O3G A;  2WON A;  5ADX A;  1IBL K;  3UKR B;  1E4G T;  3ITH A;  2HW3 A;  4GW6 A;  3QIN A;  1RTJ A;  3TSQ A;  2PY5 A;  3V1Q A;  4FWM A;  5F1X A;  4CZE A;  4XEI A;  2O8D B;  2E5L K;  4EFH A;  3A5L C;  4FWS A;  4CJQ A;  3MEE A;  2RKI A;  2JWL A;  4CJE A;  2Q0R A;  4DR7 K;  3WNF A;  1TKT A;  3WNG A;  5HOO A;  1T6D A;  3VMF B;  2G8H A;  3TPQ A;  1KVA A;  3PSF A;  4CD3 A;  2IDO A;  3NCI A;  2OPP A;  2KW4 A;  3HSC A;  3R6M A;  4E1M A;  4JI5 K;  3NDK A;  4O5F A;  3NH2 A;  4C8K A;  1NWK A;  3JXU A;  4IG3 A;  2BDP A;  2W6K A;  4LF4 K;  2I7N A;  2HHQ A;  2KLA A;  1T44 A;  2VWJ A;  4FOI A;  3C7N B;  3UKU B;  1NMN A;  2IVO A;  4B1X B;  4DV7 K;  3MMV A;  5AQG A;  3UE5 A;  4KTW A;  1IKV A;  3AAR A;  3ZX0 A;  3CCS N;  2ITG A;  1HKC A;  1TKX A;  1ZBI A;  3SJJ A;  5EY4 A;  3OS1 A;  4PKI A;  3DLB A;  4FJ9 A;  3EY1 A;  4IFY A;  4F8R A;  1WAF A;  4DQP A;  1SKS A;  4YY3 K;  5GAH P;  1IBK K;  3K57 A;  1GLD G;  1NKB A;  3AVJ A;  4YOU A;  3ZT0 A;  2D1K A;  2QWQ A;  4Z4G A;  3K0S A;  3Q7C A;  4GNI A;  4B9U A;  4A62 A;  4AHV A;  3HPO A;  3C6U A;  3AVB A;  3MCA B;  5GIO A;  2P9N B;  2YKN A;  1S9G A;  1SV5 A;  4Q5V A;  5AQZ A;  4C1N I;  2ZJQ L;  2NRX A;  4AHT A;  3LP1 A;  1GLA G;  3AY9 A;  3KK1 A;  4WQ5 A;  2KQ2 A;  3HXM A;  3G71 N;  4DU3 A;  2UYT A;  1VSK A;  5BPL A;  5LJV A;  3THY B;  3QBX A;  1K8K A;  4B9V A;  3LDO A;  3M1F A;  1JL1 A;  2VYP A;  4IFE A;  1EO1 A;  3V9S A;  3QFU A;  1IG9 A;  4H8K A;  4N76 A;  2Q2R A;  4M7X A;  1VQL N;  3NBP A;  1SUQ A;  2XHB A;  1S1V A;  4MDA A;  2P9L A;  4EP5 A;  1X9S A;  4M41 A;  4Y0W A;  2UUC K;  4FLT A;  4E7I A;  4BRE A;  3AVL A;  5BR8 K;  4EHU A;  4DFK A;  1W0H A;  3GL1 A;  1YAG A;  2AA4 A;  3T69 A;  3EO3 A;  1SS6 A;  4B9M A;  2QWL A;  1V4S A;  5AZJ A;  1KAY A;  1O1W A;  3C6H A;  1VQK N;  1SAZ A;  3PIP L;  3RMA A;  3HPH A;  1WSI A;  4WFA L;  1LWE A;  4CHP A;  2VQF K;  4CEO A;  1W9H A;  2HF4 A;  3CM6 A;  5AQF A;  4FLX A;  3PX0 A;  1BIS A;  3TSP A;  4CHO A;  3OJS A;  5HLF A;  3U9Z A;  2QW9 A;  4PL8 A;  3WEE A;  3G10 A;  5BRF A;  3HTV A;  3H6E A;  2AP1 A;  4FWN A;  1JCE A;  4LY7 A;  1KRP A;  2P9I A;  1UA0 A;  3O1W A;  1YI2 N;  3RVC A;  1SKW A;  2RN2 A;  4IEI A;  1NM1 A;  2Z1I A;  2KFZ A;  4Q0B A;  3HVR A;  1QQC A;  3AA4 A;  3OS0 A;  3SUQ A;  1OH5 A;  1NK7 A;  4NLC A;  3SUN A;  5FPD A;  4B08 A;  3BY5 A;  2R7Y A;  1C1B A;  3OY9 A;  2O8E A;  1NBW A;  1R59 O;  2NUB A;  2Q1N A;  5HRR A;  2QWR A;  5JMV A;  3DLE A;  4J2B A;  1JXE A;  1TK0 A;  4JI6 K;  1H1V A;  1X9M A;  4FM2 A;  2ASO A;  2WFB A;  1WBD A;  3IMX A;  5GIN A;  2Q3S A;  2XY8 A;  2ASM A;  4BRM A;  1RDU A;  3VQD A;  4BG8 A;  1C0T A;  3KD5 E;  4NB4 A;  4DUY K;  2FBX A;  2NZT A;  3LPT A;  3SBG A;  3J7A P;  4U67 L;  1VQ5 N;  1S9E A;  4BQZ A;  1J9A A;  3OVN A;  5CY4 A;  5AQH A;  4CF1 A;  3TAE A;  5KGX A;  4DTJ A;  1NGE A;  4C1N K;  2IC3 A;  3CD6 N;  3U9D A;  3JSM A;  4HHT A;  4OPH A;  4ZTF A;  2P9S A;  4M3Z A;  1JLG A;  1NLV A;  5FPN A;  1BA0 A;  1DKG D;  1VSJ A;  4DV5 K;  4YOR A;  1BOT O;  4Y1C A;  4HTL A;  3AVM A;  4CJ4 A;  4FJ7 A;  3VQ5 A;  4IDK A;  2NRZ A;  2PAV A;  5C15 A;  1RCH A;  4JK7 A;  4DV0 K;  2YJF A;  2NNW A;  2NRV A;  1GLE G;  3AVH A;  1QS4 A;  3CJ7 A;  1VQO N;  1C1C A;  4FYD A;  1VSE A;  2E2P A;  3AVI A;  3KHY A;  5JVG L;  1TL1 A;  2Z1H A;  5I9E B;  4B9Q A;  4JKC A;  2EX3 A;  4B8A B;  4FWK A;  1J53 A;  5HBM A;  1RGI A;  2OAN A;  2X74 A;  1RDW X;  3J8A A;  4E1J A;  1S22 A;  4WYB A;  4H4O A;  5K14 A;  1NGA A;  1T8E A;  4BDP A;  3A2F A;  1NU0 A;  3ENH A;  3FZL A;  3OYF A;  2HHH K;  1YXQ A;  4JD2 A;  3QNN A;  2VG7 A;  4CFD A;  1VQ8 N;  4BC4 A;  4KTZ A;  4WE1 A;  3VTI A;  4CF0 A;  3P38 A;  3OYN A;  4BC3 A;  3C6A A;  4JKG A;  1ZBU A;  4CJL A;  3SQ2 A;  4JHD B;  3EZ5 A;  4A57 A;  4XIU A;  4JAX A;  2E8A A;  4B9N A;  3FZF A;  3RTV A;  4DTR A;  3S3M A;  4KAZ A;  2D5R A;  3ID8 A;  1HYV A;  1K6Y A;  5AQQ A;  3CC7 N;  3ZSR A;  2YHW A;  1UA1 A;  3HST B;  4CGG A;  4BE2 A;  4LF7 K;  4CVN E;  3KJV A;  4BGB A;  2WBN A;  4ID1 A;  4M63 C;  2XRI A;  3WXK A;  2P9P A;  1I39 A;  1G15 A;  3RSE B;  1N33 K;  3QBW A;  2UXB K;  2DFF A;  3RR7 A;  3O4W A;  5FPM A;  1DTQ A;  3D7E O;  1NJI O;  1JJ2 M;  4CZK A;  5CYM A;  4IO8 A;  4B1W B;  3S41 A;  1VK0 A;  1TUU A;  1LAV A;  4CFA A;  4DQ8 A;  2B5J A;  3S3O A;  2HF3 A;  1LAW A;  3BGR A;  1N32 K;  3E1Y A;  5CZ1 A;  3KLH A;  4KH4 A;  3WXI A;  4CEE A;  1Y97 A;  3D2F B;  4FWP A;  4BRF A;  3TAM A;  4AM6 A;  5J2N A;  2ZF5 O;  3B6P A;  4KHS A;  4CJS A;  1KAZ A;  2GEL A;  4DMN A;  2KKZ A;  5BRH A;  1ITG A;  1C0F A;  1TYQ B;  5HP1 A;  3CM5 A;  4JI0 K;  3OYC A;  3TAQ A;  3HM8 A;  4RW8 A;  4DTM A;  3AA5 X;  3F9M A;  4CIF A;  5AQS A;  3CJC A;  1HYS A;  1NGH A;  3OJU A;  3ZT3 A;  3VQC A;  2VWB A;  1U49 A;  3GG4 A;  5M1P A;  1WBB A;  3ZSW A;  1D9F A;  4ISF A;  3T3F A;  3LP3 A;  2P9U A;  3GBT A;  4NCB A;  1LWC A;  3VTH A;  2O8C B;  4JEP A;  3WQT A;  3DXM A;  1NJX A;  5C2F A;  3W0L A;  4JKH A;  3I8D A;  5T7B A;  2QTD A;  4IDH A;  1XUP O;  3VEN A;  3SYZ A;  2W40 A;  4FVU A;  1KFS A;  5AQN A;  3T1Y K;  3H1V X;  2A5X A;  1RT6 A;  1N36 K;  3LAM A;  3NVK A;  5M1F A;  1T05 A;  4DV2 K;  2KTQ A;  4YOW A;  4OLA A;  3DOL A;  2XY5 A;  3CME N;  1U6Z A;  2W41 A;  3QB0 A;  2UUB K;  3VQB A;  5GAG P;  4ID5 A;  3M8R A;  1NGG A;  1BL3 A;  2ZE2 A;  5EOY A;  3VF2 A;  1U48 A;  4K8Z A;  3S3N A;  1WUA A;  3HBT A;  3V9U A;  4F3O A;  1NJZ A;  1BQN A;  2X6N A;  2UXD K;  3ZET B;  3OYM A;  1NGB A;  3L2Q A;  1X3M A;  4CBW A;  4B3S K;  4L8R B;  3HJF A;  4ILH A;  2VWK A;  3OYA A;  4A5B A;  1XMQ K;  3K59 A;  1TGO A;  4CF2 A;  3NGI A;  1VQ9 N;  2V52 B;  4CER A;  3V1R A;  3M5R A;  3CYM A;  1Q7Y O;  2HB5 A;  3KK3 A;  4CBX A;  3QER A;  5AZI B;  3P39 A;  4F3T A;  3DJC A;  4WFB L;  5AQO A;  4CJU A;  3PY8 A;  3NAE A;  3I0S A;  1DLO A;  1RDC A;  4FJL A;  4FJM A;  4CES A;  3MAQ A;  2GUI A;  3DOK A;  1F21 A;  5FDL A;  3VF6 A;  5A2Q O;  4JS4 A;  4E7H A;  3DWL A;  1DGK N;  2NRH A;  4PQU A;  1RDA A;  4IKF A;  3MN7 A;  1WSH A;  1QZ5 A;  4FJK A;  4W5N A;  3ASM A;  2HHW A;  1ASV A;  5B8H A;  3HP6 A;  4Z4H A;  3WUH A;  4HCC A;  3HP9 A;  4E7L A;  1KTQ A;  1RBT A;  3OYI A;  2GBZ A;  3K5M A;  3W3D A;  3CFR A;  3EL2 A;  1E4F T;  2Y1J A;  1NG9 A;  2E4L A;  2Q36 A;  4PHT X;  1VSI A;  3SV4 A;  5MLC Q;  4JRQ A;  3TAN A;  1QE1 A;  3HZ6 A;  4B1U B;  3VQP A;  1KXP A;  3DXK B;  5CHI A;  3HM9 A;  4CW7 B;  4ZHR A;  5C25 A;  4WQ4 C;  3M3Z A;  1HQE A;  4BRP A;  4CI6 A;  3PSI A;  1YTA A;  5M1N A;  3CPW M;  1NGC A;  1RT4 A;  3MXJ A;  3FFI A;  3P83 D;  4H5R A;  3BP8 A;  2ZJR L;  3NH0 A;  4M42 A;  3CF5 L;  4OGC A;  4RW7 A;  4FWO A;  1MA9 B;  3LDP A;  4LSL A;  2ATQ A;  1DTT A;  1BWF O;  1GLB G;  5JS1 A;  3AA3 A;  1ZYQ A;  3LDN A;  3LP2 A;  4W5R A;  4ILG B;  5EXW A;  4NLB A;  3V9X A;  4FJ5 A;  3U8X A;  4X64 K;  5H1S Q;  3BZC A;  1VSH A;  3ALY A;  3CJ1 A;  4LFB K;  3ZSO A;  3LP0 A;  4EAH D;  4ZTJ A;  1JLC A;  1YHQ N;  4FLY A;  2P5O A;  3CJA A;  1MU2 A;  2ZD1 A;  4BR7 A;  1IG8 A;  3FE1 A;  5HRS A;  3DMJ A;  1X3N A;  3VQ9 A;  4GMJ B;  3HVT A;  3KLE A;  4DSF A;  1TKD A;  3MK6 A;  5C0Y A;  2YNI A;  4DV1 K;  4YFU A;  3TWH A;  4BE0 A;  3O9S A;  4OPJ A;  3THW B;  1EWR A;  3EZW A;  2VCP A;  5J2P A;  3BF1 A;  4W5T A;  2O8B A;  3AO4 A; 
#chains in the Genus database with same CATH homology
 1RT3 A;  4M45 A;  4M3W A;  4AHC A;  3VQQ A;  4UQG A;  4FW1 A;  2G8W A;  3OYE A;  3DLE A;  3V81 A;  3SNN A;  4J2B A;  1JXE A;  3VQA A;  1XHZ A;  4DTP A;  1L3S A;  3ZCM A;  1EXQ A;  3SPY A;  3TAF A;  1BCM A;  1TK0 A;  3NF7 A;  3ZSQ A;  1Q9X A;  1X9M A;  1RT2 A;  2YHA A;  4FM2 A;  2P5G A;  4KHY A;  3KKR A;  3TI0 A;  4DFJ A;  3RMB A;  1D5A A;  4FVM A;  2XY6 A;  2Q3S A;  2D0C A;  1QSS A;  2XY8 A;  2P51 A;  1BIU A;  3V4I A;  3VA3 A;  2HMI A;  4CJW A;  3KD5 E;  3VQD A;  1C0T A;  1TK5 A;  3LAL A;  3E01 A;  3KKS A;  2FBX A;  4FJ8 A;  3LPT A;  4O0J A;  1GOB A;  4KRE A;  2AJQ A;  4PY5 A;  3QIO A;  3DM2 A;  4N47 A;  4ELV A;  4R5P A;  1HNV A;  1S9E A;  5KI6 A;  1J9A A;  3OVN A;  5CY4 A;  4CF1 A;  4DSL A;  3K5L A;  3VN5 A;  1C1A A;  5J1E A;  5KGX A;  3CFO A;  4DTJ A;  3TAE A;  3CG7 A;  4DQQ A;  3RRG A;  4O4G A;  2IC3 A;  3ZSZ A;  3P1G A;  1VSL A;  2D0B A;  3L2R A;  2B4J A;  4AHS A;  3QEV A;  4DSE A;  1RTI A;  3JSM A;  4BAC A;  4HHT A;  1LV5 A;  1Q9Y A;  3HL8 A;  4H4M A;  4E7K A;  1U04 A;  4DQS A;  4ZTF A;  3VQ7 A;  4M3Z A;  1JLG A;  4HUG A;  1BQM A;  4I2Q A;  2EHG A;  4F2S A;  4PUO A;  1A5V A;  1YT3 A;  5DK5 A;  4CJP A;  3U3G A;  1NK8 A;  2HHS A;  1VSJ A;  3EYZ A;  3B6O A;  4OPK A;  4FLW A;  3V9W A;  4CEB A;  4FJJ A;  1WSJ A;  4C8M A;  4E1N A;  4Z4C A;  3DYA A;  1R0A A;  4Y1C A;  3KLF A;  1XI1 A;  2PYL A;  3OYK A;  1J54 A;  1UWB A;  3AVM A;  3DLK A;  4CJ4 A;  5J2M A;  4DSI A;  3QES A;  4CGI A;  4FJ7 A;  3RR8 A;  3VQ5 A;  4IDK A;  2PZS A;  2OPR A;  5KRT A;  3PO5 A;  1VRT A;  1X9W A;  3MEG A;  1TV6 A;  1L5U A;  4KFB A;  4CJ5 A;  4CHN A;  4BE1 A;  3TAB A;  1RCH A;  3IAY A;  4DSK A;  2DFE A;  4DU4 A;  4FJI A;  3G0Z A;  1QHT A;  1L3V A;  3AVH A;  4OJR A;  2QKK A;  4AHR A;  1QS4 A;  4CF8 A;  3HT3 A;  3TAG A;  2HVI A;  2Z1J A;  1XC9 A;  1C1C A;  4FYD A;  1VSE A;  4KHQ A;  3NF6 A;  4DLG A;  4J2D A;  3CFP A;  1NJW A;  1S1U A;  3AVI A;  4RG8 A;  1RDD A;  1TL1 A;  3M8P A;  4HUE A;  2Z1H A;  4RW9 A;  1JLQ A;  2WOM A;  4CJK A;  2EX3 A;  4B8A B;  1KSP A;  4FZX C;  1J53 A;  5HBM A;  4E19 A;  3LPU A;  4F4K A;  3IS9 A;  3V1O A;  2X74 A;  4CHQ A;  5SZT A;  4DWI A;  4KPY A;  4FK2 A;  2OPS A;  1TAQ A;  3ZSV A;  4Y1D A;  4H4O A;  5K14 A;  3SUP A;  4B3O A;  1B92 A;  3DRP A;  1T8E A;  3PO4 A;  3AVG A;  4G1Q A;  3NF9 A;  4PA1 A;  4CCH A;  4KHN A;  1YVU A;  4BDP A;  1TVR A;  3A2F A;  1D8Y A;  2HHX A;  3OYL A;  2DFH A;  1IH7 A;  2IS3 A;  2O4I A;  3QNO A;  3OYF A;  1S1T A;  3H08 A;  3SZ2 A;  5HRO A;  5HLF A;  3ZT2 A;  4CEF A;  3QNN A;  2VG7 A;  4CFD A;  3C6T A;  3QEI A;  3T1A A;  4KTZ A;  4WE1 A;  1VSD A;  4CF0 A;  2KZZ A;  2YNG A;  3OYN A;  1CZB A;  2VG6 A;  3SCX A;  1BI4 A;  3K2P A;  3NE6 A;  3K5N A;  2G8U A;  1VSM A;  2FBT A;  3ZSY A;  2YNH A;  4LSN A;  1LWF A;  1ZBU A;  4CJL A;  1UAX A;  4O44 A;  1ZBF A;  4DG1 A;  4DS4 A;  3SQ2 A;  4FZZ A;  3EZ5 A;  1CLQ A;  4BDZ A;  4XIU A;  1KLM A;  1S1W A;  4FLU A;  1U4B A;  4B9N A;  4FJG A;  1KLN A;  2O4G A;  1JLE A;  1TKZ A;  3RTV A;  4DTR A;  3L3U A;  3NFA A;  3MEC A;  3S3M A;  2A1R A;  4JLH A;  4FK0 A;  4KI4 A;  4KAZ A;  1RBS A;  2D5R A;  4QCL A;  5KRS A;  4CJR A;  3CQ8 A;  4KHS A;  1KCF A;  3HO1 A;  1BI4 B;  1TAU A;  4CK2 A;  1HYV A;  1K6Y A;  1Z26 A;  4TSX A;  4M3Y A;  3QLH A;  3K5O A;  3ZSR A;  5JS2 A;  1S6Q A;  3HPG A;  1UA1 A;  3BDP A;  1RBU A;  3SQ1 A;  4HCB A;  3HST B;  4O0I A;  4CGG A;  4JRP A;  1KVC A;  4BE2 A;  1BCO A;  1Q8I A;  1HYZ A;  1D9D A;  2HVH A;  3KJV A;  1QTM A;  4ICL A;  4N5S A;  1I3A A;  4FW2 A;  1TK8 A;  2KFN A;  4ID1 A;  4M3U A;  4FM0 A;  2XRI A;  1NKC A;  1T7P A;  1XHX A;  3HYF A;  4CEQ A;  4DTS A;  1I39 A;  1G15 A;  2I5J A;  2JLE A;  4DU1 A;  1NK5 A;  4W5Q A;  3NH1 A;  2PYJ A;  2HHU A;  4DQR A;  4CEA A;  1KVB A;  4KHU A;  4DFM A;  3RRH A;  3OYG A;  3U3Y A;  1NK9 A;  2DFF A;  3F73 A;  3RR7 A;  3DLR A;  4CJF A;  1DTQ A;  1S6P A;  1B9D A;  1SL1 A;  1BHL A;  3QO9 A;  2YNF A;  5I42 A;  1CZ9 A;  1FKO A;  3AVF A;  4KKO A;  3THV A;  4GVM A;  4CHZ A;  5CYM A;  1WSE A;  1HRH A;  4FCY A;  3SQ0 A;  1NOY A;  3TAR A;  1VK0 A;  3DRS A;  4CFB A;  1REV A;  1LAV A;  3ZSX A;  5FRN A;  3C94 A;  4LH4 A;  1VSF A;  4CFA A;  4I9Q A;  2B5J A;  4HUF A;  2F8S A;  3S3O A;  3MXI A;  2IGI A;  1A5X A;  1LAW A;  3DRR A;  1NK0 A;  3BGR A;  2Z1G A;  1CXQ A;  4IBN A;  2E6L A;  4MFB A;  4BDY A;  4N41 A;  5CZ1 A;  3KLH A;  4NCA A;  2A1S A;  1EX4 A;  2HNY A;  4CK1 A;  5FRM A;  5HRN A;  4CEE A;  4K8X A;  1Y97 A;  3VQ8 A;  2GV9 A;  4LH5 A;  1SL2 A;  3V6D A;  1IO2 A;  1EP4 A;  1RT1 A;  4E3S A;  1JLA A;  1WLJ A;  4I2P A;  1RT7 A;  1RT5 A;  3LAN A;  5J2Q A;  3TAM A;  4FM1 A;  1U47 A;  5J2N A;  3NHG A;  2G8F A;  2FC0 A;  5I3U A;  3B6P A;  4FZY A;  3LAK A;  1S1X A;  1ASW A;  4CJS A;  3RMD A;  1HJR A;  3PUF A;  4DMN A;  4CEC A;  3D45 A;  1NOZ A;  4EZ9 A;  1BIZ A;  4NCG A;  1A5W A;  1HQU A;  1ITG A;  3L8B A;  4ELT A;  5HP1 A;  1JXB A;  2G8K A;  3C95 A;  4KV8 A;  4CIG A;  3CM5 A;  4M3X A;  3VQE A;  1HPZ A;  4AHU A;  2OYQ A;  3OYC A;  1HNI A;  3AVC A;  3KD1 E;  3TAQ A;  1J5O A;  3MED A;  4RW6 A;  4RW8 A;  2W42 A;  2G8I A;  3SQ4 A;  1NK4 A;  3KLI A;  3WNH A;  3QIP A;  4DTM A;  3AA5 X;  5D3G A;  1RBV A;  4CIF A;  3UIQ A;  3PV8 A;  3P5J A;  3OJU A;  1HYS A;  1BGX T;  2BE2 A;  4IG0 A;  3AA2 A;  3WNE A;  4RW4 A;  4CED A;  3ZT3 A;  3VQC A;  3MXM A;  4CF9 A;  2P1J A;  3K58 A;  3VQ6 A;  1JKH A;  3NF8 A;  1U49 A;  4ELU A;  1CXU A;  3ZSW A;  1D9F A;  4OKE A;  3NGY A;  4KO0 A;  3QEX A;  3T3F A;  4OVL A;  3SUO A;  3O3F A;  3LP3 A;  1WN7 A;  4HTU A;  4KI6 A;  1TL3 A;  4NCB A;  2YV0 X;  1LWC A;  3O3H A;  1FK9 A;  1NJX A;  3O3G A;  1GOA A;  2WON A;  1KFD A;  4C8N A;  3I8D A;  5T7B A;  1RTH A;  2F8T A;  2HND A;  3ITH A;  2HW3 A;  1IKY A;  3ISN C;  3QIN A;  1RTJ A;  4GW6 A;  3ZT1 A;  4CGD A;  3SYZ A;  1KFS A;  3T19 A;  2PY5 A;  3V1Q A;  4QOZ B;  1RT6 A;  3RMC A;  3KLG A;  4N56 A;  4E7J A;  3LZI A;  3LAM A;  5EU7 A;  4M3R A;  4YNQ A;  4DTU A;  4CJQ A;  1T05 A;  4FJX A;  2KTQ A;  3MEE A;  2RKI A;  3L2W A;  4KB1 A;  3DOL A;  2XY5 A;  4CJE A;  4OLA A;  1WSF A;  4B9T A;  3VQB A;  4ID5 A;  3WNF A;  4CJV A;  1TKT A;  1IKX A;  3ZT4 A;  1BL3 A;  3WNG A;  4B8C A;  3M8R A;  4J2A A;  4QAG A;  2ZE2 A;  5C24 A;  4CFC A;  2QK9 A;  1U45 A;  3I0R A;  4CEZ A;  2G8H A;  3SPZ A;  1KVA A;  4CJ3 A;  2RF2 A;  4O55 A;  2IDO A;  2IOC A;  2FBV A;  3NCI A;  3S3N A;  2OPP A;  2KW4 A;  1U48 A;  4K8Z A;  4E1M A;  4OLB A;  5FRO A;  3V9U A;  4CGJ A;  4O5B A;  4W5O A;  1LW2 A;  3NDK A;  1NJZ A;  1BQN A;  3NH2 A;  3VA0 A;  4F3O A;  4C8K A;  2X6N A;  1QSY A;  4MQ3 A;  4J2E A;  4CGF A;  4IG3 A;  3OYM A;  2BDP A;  3TR8 A;  3L2Q A;  3TAP A;  4KRF A;  4M3T A;  2HHQ A;  2B6A A;  4L8R B;  3HJF A;  2E6M A;  2VWJ A;  2YKM A;  2VWK A;  3OYA A;  2HHT A;  2KZM A;  3K59 A;  1TGO A;  4CF2 A;  3NGI A;  1L3U A;  1RBR A;  4CER A;  1FKP A;  3O4Q A;  4EZ6 A;  2BGG A;  3V1R A;  3CYM A;  4KTW A;  1IKV A;  2HB5 A;  2ITG A;  3KK3 A;  3NGZ A;  5KGW A;  2VG5 A;  1TKX A;  1ZBI A;  3JYT A;  3QER A;  3SJJ A;  4F3T A;  4HVJ A;  3OS1 A;  3DLB A;  4DSJ A;  4OGE A;  4CJU A;  3PY8 A;  4FJ9 A;  3NAE A;  5C42 A;  3OS2 A;  3EY1 A;  1Z25 A;  3I0S A;  4IFY A;  4F2R A;  1DLO A;  1RDC A;  4F8R A;  4FJL A;  4FJM A;  4CES A;  1C0U A;  1WAF A;  3AV9 A;  4DQI A;  5E41 A;  3MAQ A;  4DQP A;  4DF8 A;  1SKS A;  2GUI A;  3DOK A;  1NJY A;  1F21 A;  3QEP A;  5FDL A;  3OYB A;  2LSN A;  5HRP A;  3K57 A;  4JS4 A;  4E7H A;  1N5Y A;  1YTU A;  1NKB A;  5SWM A;  3U6F A;  3AVJ A;  3F9K A;  3ZT0 A;  2RPI A;  4Z4G A;  3DLG A;  4Z0U A;  3LWL A;  3KTQ A;  1WNS A;  4B9U A;  4AHV A;  4PQU A;  1RDA A;  3HPO A;  3C6U A;  3HK2 A;  4IKF A;  1WSH A;  4DTO A;  3M8S A;  3DLH A;  4Z4E A;  4FJK A;  3L3V A;  4W5N A;  1VRU A;  3AVB A;  3ASM A;  4FK4 A;  3PX4 A;  3ULD A;  2OZS A;  1ASV A;  1X1P A;  4E0D A;  2HHW A;  3HP6 A;  2YKN A;  1S9G A;  1SV5 A;  4CHY A;  4Z4H A;  2HNZ A;  4FJN A;  4HCC A;  3AVK A;  3HP9 A;  4Q5V A;  4E7L A;  4CJT A;  1KTQ A;  3IRX A;  1RBT A;  3OYI A;  2GBZ A;  3LP1 A;  4AHT A;  3K5M A;  3CFR A;  4DLE A;  2Y1J A;  3KK1 A;  4I7F A;  2E4L A;  2KQ2 A;  3HXM A;  4DU3 A;  4KB0 A;  1VSI A;  4KTQ A;  3SV4 A;  1VSK A;  4JRQ A;  3TAN A;  1ASU A;  1L3T A;  4JS5 A;  3IG1 A;  1QE1 A;  1N6Q A;  3VQP A;  3SV3 A;  5KTQ A;  4B9V A;  1JL1 A;  3AO1 A;  3AO5 A;  3SI6 A;  4BWJ A;  3AO3 A;  1RDB A;  3HM9 A;  3V9S A;  1WAJ A;  1JLF A;  1IG9 A;  1B9F A;  3QET A;  4AH9 A;  4C8O A;  4H8K A;  1JLB A;  4ZHR A;  4CK3 A;  4N76 A;  3NBP A;  1RTD A;  1SUQ A;  2BAN A;  4I9L A;  5C25 A;  4OKK A;  3OYH A;  5DMR A;  2XHB A;  4OKJ A;  1S1V A;  1HQE A;  1QSL A;  2JGU A;  4EP5 A;  1X9S A;  4M41 A;  4FLT A;  1YTA A;  4E7I A;  3AVL A;  2Y1I A;  2QKB A;  1S5J A;  1RT4 A;  3MXJ A;  3FFI A;  1W0H A;  4DFK A;  3P83 D;  3OYJ A;  4B9M A;  1NKE A;  2OPQ A;  3NH0 A;  4M42 A;  2X78 A;  4OGC A;  4CE9 A;  3RWU A;  4RW7 A;  1O1W A;  4AIL C;  1EET A;  4B9L A;  4PWD A;  2DTU A;  1SL0 A;  4LSL A;  3OYD A;  3RMA A;  2G8V A;  2ATQ A;  3HPH A;  1WSI A;  2D0A A;  4FLZ A;  4CGH A;  1NK6 A;  4Z4I A;  1LWE A;  4BWM A;  1DTT A;  5JS1 A;  4CHP A;  4CEO A;  3DI6 A;  4C8L A;  4FJH A;  1C6V A;  1W9H A;  3CM6 A;  4FLX A;  3PX0 A;  3S9H A;  1BIS A;  3AA3 A;  4LD0 A;  4CHO A;  1WSG A;  3OJS A;  3L2V A;  4DS5 A;  4DF4 A;  3LP2 A;  4W5R A;  3D0P A;  1ZYQ A;  4NYF A;  4DFP A;  2XY7 A;  1EKE A;  3G10 A;  1LW0 A;  3QEW A;  2FBY A;  2YHB A;  4NYN A;  5CYQ A;  1IKW A;  3V9X A;  1ZBL A;  4FJ5 A;  4B9S A;  3L2U A;  1UOC A;  1C0M A;  1RNH A;  3V9Z A;  2HHV A;  4FLV A;  1VSH A;  3ALY A;  4LY7 A;  1KRP A;  2DY4 A;  1T03 A;  1UA0 A;  3VQ4 A;  3ZSO A;  4DTN A;  3LP0 A;  2IAJ A;  4ZTJ A;  1JLC A;  1HMV A;  4FLY A;  1JL2 A;  2XO7 A;  1SKW A;  2P5O A;  2RN2 A;  2X6S A;  1FXX A;  2Z1I A;  2KFZ A;  1ZBH A;  1MU2 A;  2ZD1 A;  3AVN A;  5HRS A;  1XWL A;  2QXF A;  1QQC A;  3KK2 A;  3HVR A;  3DMJ A;  1SKR A;  4KHW A;  4Q0B A;  3AA4 A;  3VQ9 A;  4GMJ B;  3OS0 A;  3HVT A;  3KLE A;  3SUQ A;  1RIL A;  1GOC A;  3AVA A;  2ETJ A;  3KIO A;  4DSF A;  4DTX A;  1NK7 A;  1TKD A;  2OZM A;  4Z4F A;  4FXD A;  5CZ2 A;  3M8Q A;  4IFV A;  4CIE A;  3O4N A;  4E89 A;  3SUN A;  2YNI A;  4EP4 A;  4YFU A;  3TWH A;  4B08 A;  4BE0 A;  4OPJ A;  3LZJ A;  2OA8 A;  2R7Y A;  3AO2 A;  1C1B A;  3OY9 A;  2ZQB A;  2F96 A;  3LWM A;  3LDS A;  5J2P A;  3PX6 A;  4W5T A;  2NUB A;  3AO4 A;  5HRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...