1G15A

Co-crystal of e. coli rnase hi with two mn2+ ions bound in the the active site
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
141
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHAEVILSTDSQYVRQGITQWIHNWKARGWKPVKNVDLWQRLDAALGQHQIKWEWVGHPENERADELARAAAMNPTLEDTGYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-crystal of Escherichia coli RNase HI with Mn2+ ions reveals two divalent metals bound in the active site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HI
total genus 47
structure length 141
sequence length 150
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1g15A00
4DSIA 4IFYA 4KHNA 4M3XA 1KLMA 4Y1DA 1TV6A 3LAKA 4CFCA 1J53A 2VG5A 3NF6A 4CJVA 3NF8A 1X9SA 4I7FA 1WSHA 3K5OA 4W5RA 3M8SA 4CK3A 1U47A 2I5JA 2OPSA 3NF7A 1WN7A 4PWDA 1HYSA 3EY1A 1J54A 3LDSA 2Q3SA 3AVBA 4RW6A 1NKBA 4MQ3A 1FKPA 3F73A 1EP4A 1RNHA 3AVMA 4ELVA 4CEEA 2D5RA 1S9EA 4KTZA 3NE6A 4ZHRA 3O3FA 5CYQA 4JRPA 1B9DA 1C0MA 3AVCA 3MXMA 1LW0A 4OGCA 3OYBA 1LW2A 3ZT4A 3QESA 3VQ6A 3KKSA 1BGXT 3K2PA 2XY5A 5DMRA 2G8IA 4IBNA 4CESA 1RTIA 4CE9A 3VA3A 1JL2A 1XHZA 3ZT0A 2HVIA 1X1PA 4RW7A 4HVJA 4ICLA 1SV5A 3CFOA 1S1UA 3VN5A 4CHZA 3SYZA 4F3OA 3OYLA 3CQ8A 5HP1A 4PA1A 3OYHA 4DMNA 3H08A 3K57A 1QTMA 1QSLA 2E6MA 3NH0A 2QKBA 3TI0A 3V1OA 1S6QA 4I9QA 1CZBA 3PX6A 1C1AA 4NYNA 4E1NA 2YV0X 3DM2A 3K58A 1I39A 3B6PA 1RTJA 3DOLA 3LPUA 4ELTA 2G8KA 1JLAA 1U45A 2FBTA 2PYJA 4OPKA 4FJJA 1Q9XA 4HCBA 3HVRA 2X6SA 1Z25A 2HMIA 2LSNA 1MU2A 3HL8A 3HPHA 4Z4GA 5E41A 4LH5A 3ZSVA 4CHNA 1RT6A 3SV4A 2G8HA 4FJNA 3S3OA 1RT5A 4FJMA 1A5VA 3QNOA 3DLEA 3SJJA 4ZTFA 1BCOA 1BQNA 3O3GA 3V81A 5CY4A 3OS1A 1TKDA 1NKCA 3L8BA 2KFNA 3LZJA 4KPYA 3S9HA 3T19A 3TAPA 3DLGA 4B9SA 4DU4A 4CHOA 4DSJA 4E7IA 3EZ5A 1IKVA 3DLHA 3AVFA 3AVGA 1XC9A 3SUPA 1RBSA 1HRHA 4BE2A 4FXDA 2GUIA 4B9TA 4O0IA 3AO4A 4FLWA 3HJFA 1VSEA 4CGJA 1R0AA 1KSPA 1HMVA 5CYMA 5HRRA 3OS0A 1Z26A 5KTQA 1W0HA 1JL1A 4E3SA 3PO4A 3KD1E 4PUOA 4F2SA 4CHPA 3OJUA 3E01A 3LAMA 1QE1A 3WNGA 2HHTA 4EZ9A 1YT3A 2YNHA 4CERA 1TK0A 3ZSWA 4BE1A 1A5WA 1B9FA 5D3GA 4CFAA 3OVNA 3U3GA 1Q8IA 2HNZA 1U48A 1U49A 4O55A 4DTOA 4KB0A 5KRSA 1QS4A 1L3SA 1L3UA 3D45A 1BI4B 3RR8A 4KTWA 3QIOA 1IKWA 4NCBA 1NOZA 2WONA 3P5JA 1FKOA 3ALYA 1ZBLA 4BDPA 4KHYA 3O4QA 1VSJA 4O44A 1WNSA 4N5SA 3LP2A 3RRHA 4F4KA 4FLZA 4Z4IA 3DRPA 4MFBA 3JYTA 1Q9YA 4TSXA 3NGZA 3DRSA 3MEEA 3KLIA 4OPJA 1T8EA 4KAZA 2KTQA 3MXIA 4CF2A 2Z1GA 4E89A 3QEWA 2OZSA 1VSFA 1KVBA 4LY7A 1RBVA 4CEQA 4CGDA 3V9SA 1SL0A 3HM9A 4KKOA 1LWFA 2OZMA 5HLFA 1BHLA 1RT7A 4ID1A 4CF9A 4OGEA 4CIFA 1JLCA 1HQEA 3TAEA 3OYIA 1J9AA 5HRSA 3AVKA 1VRTA 3PY8A 3VQ5A 3C94A 4DQQA 3SUQA 2DTUA 3OYFA 3KLGA 3SPZA 4FLYA 4CJQA 3HPGA 4DSLA 1NK8A 5FRNA 3HP9A 2HW3A 1TKZA 1JXEA 4W5NA 3PO5A 4PQUA 4DTPA 1UA0A 1UOCA 3QETA 4FZYA 1NJZA 2FBXA 1S5JA 4DS5A 3S3MA 4I2PA 3SNNA 3AVAA 3QNNA 3HSTB 1SL1A 4F3TA 1ZBIA 1QQCA 4KV8A 4EP4A 1XHXA 4O5BA 2HHSA 3ZCMA 4M41A 2YNIA 5JS1A 3A2FA 4FJKA 2HVHA 1ZYQA 3HYFA 4C8MA 1NK7A 3I8DA 1S1TA 1J5OA 2ITGA 4BDZA 2OPQA 1RT1A 1QSYA 1HQUA 1F21A 2B4JA 5KRTA 1NK9A 4B3OA 2P51A 4CJ5A 4J2DA 3QERA 2QK9A 3AVJA 1IG9A 4W5OA 3PV8A 2HHWA 2B6AA 4H4OA 5FDLA 4CEAA 1KLNA 1JKHA 5J2PA 3LPTA 4KHWA 1XI1A 2YHBA 1YTAA 4CF0A 4B9LA 4M3WA 3LZIA 3V9UA 3TABA 5J1EA 4JLHA 3DLRA 2OYQA 3HO1A 3C6UA 4IG3A 4O0JA 1TK5A 4M3RA 2JGUA 5KGXA 4FLUA 3VQPA 1CXQA 3HVTA 5HBMA 1WSFA 3QIPA 4DG1A 4FLTA 3T3FA 4FJ7A 1IH7A 3RMCA 1TAUA 4CEOA 1YTUA 2O4GA 1NK6A 2XRIA 4E7LA 4H8KA 3V4IA 1D9DA 3VQ9A 4FK0A 3KKRA 4FW1A 3B6OA 4FJHA 1LV5A 1KFDA 1RBRA 2RF2A 4CGHA 4DFMA 3OYJA 2YKMA 5HROA 1X9MA 3SZ2A 1IO2A 4Q5VA 1LWEA 1D5AA 1VSKA 2VG7A 3NBPA 3WNHA 1N6QA 2HHUA 4CEFA 4E1MA 1C6VA 4DTUA 3SQ0A 1ASWA 4C8KA 1RTHA 5SZTA 1QHTA 1UAXA 4AH9A 3AA4A 3KLEA 3KIOA 4E7KA 4FZZA 4J2BA 1G15A 4CEDA 1GOCA 3THVA 2G8WA 2R7YA 3K59A 1LWCA 3O3HA 2Y1IA 1ASUA 2IS3A 3MEDA 3ZSYA 4CJUA 1HNVA 3F9KA 3V1QA 4Z4HA 4I2QA 2G8UA 3AA5X 3NDKA 3U3YA 2P5OA 4DQPA 4B8CA 2DFFA 1KTQA 3L2UA 4KI4A 4XIUA 4R5PA 5FRMA 4DTJA 1WAFA 3LP0A 4RW9A 3RMDA 4KRFA 2XY6A 3NGIA 3AVHA 2ZQBA 5HRPA 2BDPA 3IRXA 2PYLA 3L3VA 1S1WA 3NAEA 2DFHA 3P1GA 4GW6A 2AJQA 3LP1A 1YVUA 2NUBA 5J2QA 4FW2A 3LWLA 5I42A 1RBTA 3S3NA 1RCHA 3OJSA 2KFZA 1GOBA 3ZSQA 2WOMA 3SV3A 1JLBA 3IAYA 1S1VA 1EX4A 2B5JA 3ASMA 2FC0A 2YNFA 1D8YA 4CJ3A 4PY5A 3TAMA 4ELUA 3KTQA 4C8LA 4OLBA 1ZBUA 3OYCA 3SPYA 3AO3A 1RT3A 2OPRA 5CZ1A 4N76A 3OS2A 4FJ9A 3HT3A 4E7HA 4HUFA 1IKYA 1SKRA 3VQAA 1TK8A 3TAGA 3VQ8A 4CFDA 3RMBA 3TARA 3HK2A 3QEXA 3RWUA 3VQ7A 3SI6A 1HJRA 3NCIA 3OYDA 2IC3A 1L3TA 3VQQA 1XWLA 2HB5A 4KO0A 4CF8A 2W42A 4DSEA 3SUNA 3KLHA 2A1SA 4BE0A 4DF8A 2QXFA 2Z1HA 1NJWA 1VRUA 3DLBA 3BDPA 1UWBA 3OYAA 1NK5A 1DTQA 5SWMA 3NH2A 1SL2A 3VQCA 3CM5A 4B9UA 2ZD1A 2YNGA 3TANA 1JLQA 4LD0A 3ITHA 1RBUA 4Z4EA 4Z0UA 1BI4A 4AHCA 3L2RA 3DOKA 3TAFA 4B9VA 4KHSA 1A5XA 5DK5A 1NOYA 3RRGA 1WSGA 1SKWA 1C0TA 4IFVA 2X78A 4IKFA 3OYMA 2F8TA 2PZSA 3ZSXA 3RTVA 3AA3A 3SQ2A 4HUEA 1RTDA 1N5YA 4QOZB 1LAWA 1HYZA 2JLEA 2YKNA 4CEZA 5HRNA 3AO2A 4IG0A 1EETA 1VSMA 3OYGA 4FCYA 3QEIA 4FLXA 3KK2A 1BCMA 3V6DA 3L2VA 4WE1A 5C42A 3O4NA 4CF1A 3TWHA 1VSLA 1CZ9A 1X9WA 4GMJB 4DLEA 5J2NA 4AILC 1NJXA 4CJEA 4RG8A 1UA1A 1K6YA 4O4GA 3CG7A 3RR7A 4M3UA 4C8OA 3V9WA 3QO9A 2Z1IA 4OKEA 4CJFA 3L3UA 1RT4A 3K5NA 4FJIA 3L2QA 4FK2A 1KFSA 3AV9A 3VQEA 4DWIA 1EKEA 2E6LA 4JS5A 1RT2A 4IDKA 4I9LA 2YHAA 1D9FA 4BDYA 2PY5A 2IGIA 3K5LA 2OPPA 3WNEA 4AHRA 2XY7A 4KHUA 4DFJA 1HNIA 4KHQA 1BIUA 4JRQA 1T05A 1S9GA 3VQ4A 4HUGA 4FM2A 2F8SA 1BIZA 3K5MA 4DU3A 4K8XA 4DQRA 3PUFA 3TAQA 1TGOA 4ZTJA 3L2WA 3PX4A 4F2RA 4NYFA 2IAJA 4DFKA 3CYMA 5KGWA 1IKXA 3LALA 3EYZA 4CJPA 2ATQA 3KD5E 2D0BA 1ITGA 2VG6A 3ZSRA 4CJ4A 4E0DA 4AHTA 1EXQA 2KW4A 3FFIA 3ZT2A 5J2MA 2IOCA 1S6PA 4G1QA 4CK1A 4F8RA 2IDOA 4NCAA 1WAJA 4CGGA 3DYAA 4B08A 4DTRA 3SUOA 4QCLA 1KCFA 1VK0A 1JXBA 4UQGA 4QAGA 3DLKA 3ZSOA 3U6FA 3AVNA 3KLFA 3LANA 4NCGA 4N47A 3LP3A 3LWMA 4FVMA 4KTQA 3OY9A 3MXJA 5C24A 4J2EA 3QLHA 4CHYA 2P1JA 3I0SA 2P5GA 4M3YA 2DY4A 4FLVA 4KB1A 1RDAA 1KVCA 2HNYA 3AVLA 4YFUA 1C1BA 4CJTA 4AHSA 4DU1A 3IG1A 3HXMA 4Z4CA 2E4LA 3CFPA 1WLJA 1GOAA 2XO7A 1VSHA 1C1CA 3DI6A 4CJKA 1QSSA 3ZT3A 1SUQA 4OJRA 4Q0BA 3M8PA 3G10A 4CGIA 4EZ6A 4B8AB 4BACA 4KI6A 1T03A 3IS9A 4DTMA 1S1XA 1TL3A 3ISNC 4LSLA 4LSNA 3RMAA 1WSIA 4N41A 1T7PA 1JLFA 1FK9A 4FJ5A 4LH4A 3QEVA 4CECA 1KRPA 3VQDA 4HTUA 4W5TA 5I3UA 1B92A 3PX0A 3MAQA 4HHTA 2G8VA 4BWJA 4RW8A 2D0AA 3ZSZA 2ZE2A 2XHBA 4DF4A 3KK1A 1RDBA 2Z1JA 4FJGA 1DLOA 4DTNA 4FM0A 4DSFA 1NJYA 4M3TA 3CM6A 1ZBFA 1O1WA 4H4MA 5CZ2A 3QINA 4C8NA 2O4IA 3NH1A 2KZZA 4CIEA 2VWKA 1TAQA 2G8FA 4Z4FA 4K8ZA 3G0ZA 1TL1A 4B9NA 3M8RA 4CJRA 4CEBA 1TKTA 4FZXC 2GV9A 4KREA 1SKSA 1CLQA 1L3VA 3AVIA 1I3AA 2EX3A 1TVRA 4ID5A 4E7JA 1NK4A 3UIQA 4FJLA 1W9HA 2RPIA 1U04A 2XY8A 4CGFA 3HPOA 4DQIA 4DQSA 1DTTA 3WNFA 5KI6A 4CCHA 4M42A 1WSEA 4RW4A 4HCCA 1NK0A 5FROA 5T7BA 3QEPA 3HP6A 3OYNA 2EHGA 1RILA 3CFRA 1BISA 3NFAA 1RDCA 5K14A 4DS4A 4Y1CA 1WSJA 4CHQA 2VWJA 4EP5A 4N56A 2A1RA 2OA8A 1CXUA 3SCXA 2BGGA 4W5QA 1Y97A 3MECA 3V1RA 4B9MA 2HHQA 3I0RA 1JLEA 1HYVA 1BQMA 2DFEA 3NF9A 4M45A 4KFBA 3NGYA 3M8QA 4AHVA 4CJLA 4GVMA 1VSDA 4DTSA 2FBVA 2GBZA 3AA2A 2RN2A 2X74A 1VSIA 4E19A 3OYEA 3P83D 3VQBA 1RDDA 3OYKA 2F96A 4YNQA 1ZBHA 2HHXA 3VA0A 2KZMA 1JLGA 2BANA 4FM1A 4DTXA 4OKKA 5JS2A 4DSKA 3MEGA 3C6TA 1LAVA 3V9XA 1KVAA 1FXXA 3TR8A 4CK2A 4J2AA 4CJWA 2BE2A 3T1AA 3NHGA 5C25A 3SQ4A 3JSMA 1BL3A 2FBYA 3DRRA 2D0CA 4M3ZA 3BGRA 2HHVA 4BWMA 3KK3A 4DLGA 2RKIA 4CJSA 3D0PA 2ETJA 4L8RB 1REVA 5EU7A 4FJ8A 1HPZA 4OKJA 2QKKA 2X6NA 3AO1A 4AHUA 4CIGA 1U4BA 4FK4A 3ZT1A 3C95A 1C0UA 1NKEA 1L5UA 4JS4A 1ASVA 3AO5A 3DMJA 4CFBA 3KJVA 4DFPA 1TKXA 3V9ZA 3SQ1A 2KQ2A 4FJXA 4OLAA 4OVLA 2HNDA 3ULDA 4FYDA 2Y1JA
chains in the Genus database with same CATH superfamily
2YI1A 4BVPA 3FGUA 4IFYA 5BRDA 1KLMA 2VG5A 3NF6A 1QQMA 4BGAA 1D4XA 1OH7A 3K5OA 3E1YA 2HF3A 2I5JA 3TSQA 1W7AA 3F73A 1FKPA 1X3NA 2D5RA 4BRKA 4DUYK 1MWKA 5AQOA 5CYQA 5M1NA 3MXMA 3T7ZA 4XEIA 4A2AA 4GV9A 4BC5A 5GAEP 4YY3K 2I7NA 1JCFA 4B1YB 2O8BA 1NGEA 3K2PA 2JWLA 1ZC6A 5DMRA 2A6AA 2P9SA 3Q7CA 1JL2A 1NJIO 2HVIA 1QQOA 4RW7A 2ASMA 1NMNA 4PKIA 1BU6O 5E26A 2E88A 4DV1K 3NH0A 2OTJN 5C2FA 4I9QA 1CZBA 1C1AA 2YV0X 3EE8A 3LPUA 4H5VA 2G8KA 2ITMA 1U45A 1VQ7N 4OPKA 1KC8O 1Q9XA 3HVRA 3EL2A 3CQXA 4WQ5C 2GTDA 4LF4K 4CHNA 1RT6A 4EIAA 4FJMA 1SAZA 3OBYA 5AQTA 3OBWA 3T1HK 3NVMA 5AZIA 2YHWA 5DM7L 3OS1A 1TKDA 1NU0A 4IXCA 3LZJA 3TAPA 4DSJA 4DU4A 3EZ5A 2W40A 2BUPA 3SUPA 2F9TA 4BE2A 4O0IA 3THXB 3HJFA 4CGJA 4JK8A 5AQNA 4E3SA 3KD1E 5JLFA 4CHPA 3OJUA 3LAMA 1QE1A 2HHTA 1HNZK 1N34K 1A5WA 3A5NC 2HNZA 4O55A 4KB0A 2QEXN 1BI4B 4WF9L 4KTWA 1M90O 1IKWA 3DXMB 3P5JA 4BDPA 2YHXA 4KHYA 2HMPA 4WQ5A 3R1XA 3RRHA 5ADXH 2QW9A 4YOWA 1Q9YA 1YAGA 3NGZA 3MEEA 4O8UA 2KTQA 3IDHA 4O5FA 2Z1GA 4E89A 3QEWA 3G25A 5BR8K 3V9SA 4H0TB 3HM9A 4OGEA 4MDAA 3OYIA 5HRSA 3AVKA 3FZHA 3SUQA 3KWGA 3MWPA 1N32K 2DTUA 4FLYA 5GADP 3F5TA 4K25A 4B3MK 1E3MA 3VEZA 4PQUA 2P9SB 1S5JA 4U7BA 3S3MA 2ASOA 3SNNA 5GAGP 4KV8A 1DT9A 4FSVA 1ZYQA 1NM1A 3HYFA 1S1TA 3UE5A 5EVZA 1QSYA 1HQUA 1F21A 2QWLA 2P51A 1XQSC 4CJ5A 3TPQA 1GLAG 3CMAN 4W5OA 4H4OA 5FDLA 3H46O 2YHBA 1YTAA 4CF0A 4JLHA 2OYQA 3HO1A 2JGUA 4FLUA 1U2VA 3FLCO 1YTUA 3VPZA 3L4IA 3LL3A 1D9DA 3D2EA 4FW1A 3B6OA 1LV5A 1KFDA 5AQZA 3OYJA 5HROA 3MN6A 1N6QA 2E8AA 3BUZB 3SQ0A 1C6VA 3CCLN 4C8KA 1NNEA 5LL6Z 3SAFA 2RHKA 4J2BA 4CEDA 3THWB 2UXDK 2R7YA 4JI4K 3K59A 1LWCA 3ZSYA 2IS3A 3MEDA 3F9KA 4IEIA 4Z4HA 2G8UA 2P9UB 2P5OA 2A3ZA 2DFFA 1YF5L 3QBXA 3EKUA 1HKCA 3HZ6A 4KRFA 5I42A 5J2QA 3AGKA 3O9TA 3D2FA 3OJSA 3BP8A 2WOMA 3SV3A 3IAYA 2B5JA 3CQYA 4CJ3A 3TAMA 4B3SK 3KTQA 4OLBA 3T1YK 4FJ9A 3OS2A 3HT3A 3MN9A 3TSPA 3VQAA 1TK8A 5AQJA 4FO0A 3VQ7A 5AQKA 1L3TA 1XWLA 3L6QA 3SUNA 2A1SA 2D4WA 2FF3B 1CZAN 1QVGM 1UWBA 1T6CA 1DTQA 3NH2A 1SL2A 3G71N 3IUCA 2YNGA 4LD0A 3TAFA 3L2RA 4H5WA 1A5XA 3U9DA 1HKBA 1SKWA 4IFVA 2F8TA 4IKFA 1K8AO 3AA3A 1KAXA 4HUEA 1N5YA 3EN9A 5AQUA 1JJ2M 4BGBA 4WCEL 3V6DA 4CF1A 1VSLA 4CZMA 4CJEA 3MDQA 3LM2A 4O4GA 1NGFA 4DV7K 2QA4N 4M3UA 4C8OA 1RT4A 4FJIA 2V51B 1KFSA 3AV9A 4DWIA 4J8FA 1EKEA 4RCHA 2YHAA 2QI2A 2PY5A 3K5LA 4AHRA 1RGIA 5JVHL 1OKJA 3VEWA 3ZYYX 4JRQA 3N4PA 1BIZA 3RVCA 1LOTB 2ZJRL 1MWMA 3CYMA 1C0GA 2O8FB 3D2EB 3LDQA 4FWMA 2D0BA 3OHRA 3ZSRA 2ZGZA 3JXUA 4CJ4A 2FXUA 5BR9A 3FFIA 3CXCM 4G1QA 4CK1A 4EHTA 1IV0A 1TYQA 3SUOA 1VK0A 4UQGA 4DV0K 3CJAA 2W6KA 3M3ZA 3ZSOA 3J7AP 3OW2M 3CCVN 1RFQA 4CBXA 4NCGA 4N47A 4KTQA 3MXJA 3QLHA 2P5GA 4M3YA 1R59O 1RDAA 2HNYA 2IVNA 3AVLA 1C1BA 4DU1A 3IMXA 2E4LA 3CFPA 4CJKA 1NGDA 3ZT3A 1QQNA 1SUQA 1QSSA 4CGIA 3G10A 3I8BA 1GLLO 3WUHA 3FE1A 3MN5A 3ISNC 1T7PA 1JLFA 2WFBA 1V4TA 3VQDA 4FPAA 5I3UA 1VHXA 2G8VA 1HPMA 2XHBA 4YOTA 1DLOA 4DTNA 3TSUA 4LFBK 4BRDA 3AGRA 4K8ZA 4JKGB 4A5BA 4B9NA 3M8RA 4CZJA 4CJRA 2W41A 2OANA 4FJLA 1TVRA 3WXIA 2RPIA 1U04A 4JYAK 2Q31A 1RDWX 4DQSA 1WSEA 4BR0A 3CFRA 1BISA 1Q82O 1RDCA 4BQZA 1WSJA 3SCXA 2WBNA 3Q7BA 3VOVA 3HSCA 3TU5A 4BR5A 1BQMA 3QB0A 3CCMN 3J81O 2O8EB 2E2OA 1TUUA 3AA2A 2RN2A 4R79A 2GEMA 1I94K 1RDDA 3VF6A 1P8ZA 2V52B 4NXNK 2HHXA 2KZMA 5JS2A 1QHAA 3MEGA 3C6TA 1LAVA 3TR8A 3NHGA 5C25A 3O4WA 2FBYA 3DRRA 5ELZA 2H3GX 5GAHP 3O6WA 4L8RB 1REVA 4B9QA 5F0XA 2QKKA 2X6NA 4AHUA 2HBKA 4CIGA 2GWJA 2NRVA 3OA9A 3DMJA 3K9KA 4FJXA 3V9ZA 5KQDA 3N4QA 4OLAA 1EWRA 4JKAA 1OH5A 4Y1DA 1GLDG 4CFCA 4BC4A 3VMFB 4CK3A 1U47A 2OPSA 1WN7A 4PWDA 4H03B 1HYSA 4JKEA 3LDSA 1NKBA 4RW6A 1LCUA 1RNHA 3AVMA 4ELVA 2Q0RA 4KTZA 4JRPA 4IJAA 3CCSN 1LW0A 4OGCA 4GKJK 3MX2A 3ZT4A 4DB3A 4JD2A 3K9JA 2XY5A 4JKGA 4IBNA 4CE9A 1U6ZA 3RSEA 4ICLA 3P31A 3CFOA 1S1UA 3VN5A 3OYLA 3BF1A 5HP1A 4PA1A 3K57A 3H08A 1QSLA 3V1OA 1O13A 3DM2A 4QS7A 2E2QA 5AQRA 3B6PA 2UUAK 1RTJA 3DOLA 1DKGD 1JLAA 5BRHA 1NGIA 1NGHA 1EWQA 4HCBA 2X6SA 1Z25A 1VQ9N 2HMIA 4BRGA 4M7XA 5E41A 3SV4A 3ENHA 4BVOA 3S3OA 5AQQA 1RT5A 5BPNA 1BQNA 3O3GA 3R9PA 1T44A 3OTOK 4K0KK 4B9SA 4NB4A 4IO8A 4E7IA 1IKVA 3AVFA 3AVGA 5EXWA 4Y0WA 2D1KA 1XC9A 4KH6A 2GUIA 3AO4A 2UU9K 4CZGA 1KSPA 5HRRA 4CJ7A 5KTQA 4F2SA 3R8EA 2ZGYA 3WNGA 4BE1A 5FPMA 5D3GA 1Q8IA 1HX1A 4ISEA 3MCPA 5KRSA 1L3SA 3D45A 2FSJA 2NRRA 2PFUA 1BA0A 4NCBA 3S41A 1WNSA 4FVUA 3SBGA 4F4KA 2E2NA 3DRPA 2P9LB 3JYTA 4TSXA 3HOSA 4BRNA 4OPJA 2ZWHA 2OZSA 1VSFA 3SMPA 3VF4A 4CEQA 3CPEA 4DV5K 4KKOA 2OZMA 3DJCA 4ID1A 4CZFA 1VRTA 5A2QO 4CJQA 1TKZA 4DTPA 5AQGA 1UOCA 3C65A 4NLBA 4V19S 2FBXA 4DS5A 1YI2N 4ILJA 3HSTB 4F3TA 2O8EA 3HBTA 1ZBIA 2HHSA 3ZEUB 3ZCMA 4M41A 4FJKA 3QICA 4C8MA 3VGMA 1GLJO 1NK7A 3I8DA 2ITGA 2B4JA 3GL1A 1NK9A 1J5EK 3QERA 2QK9A 1IG9A 2B6AA 1KLNA 5J2PA 4KHWA 1VQMN 3CCRN 1BG3A 2UYTA 1KQSM 3C6UA 4IG3A 5KGXA 3HVTA 1WSFA 3ID6A 3QIPA 4LF6K 3G4SN 4M7YA 4CEOA 2WTUA 2XRIA 3O1WA 3L4QA 5AFUH 4YDUC 4YOXA 3VQ9A 4FK0A 3KKRA 4YHHK 1RBRA 4DFMA 5AQYA 1W2BM 4OPAA 1HNWK 4Q5VA 1VSKA 1D5AA 3NBPA 4KHPK 4E1MA 4KBOA 3WQUA 1RTHA 3KLEA 1XNRK 4GV3A 1G15A 4YDUA 4DR1K 2G8WA 4H0YB 1VQ4N 1VQ5N 3AY9A 3CC4N 1VQKN 4CJUA 1HNVA 5AQMA 2J4RA 3V1QA 3NDKA 4GY2B 4JI2K 2Q1NA 4KI4A 4XIUA 4DTJA 3LP0A 4H5TA 1Q18A 3AVHA 2BDPA 3MK6A 3IRXA 2JWKA 2NRZA 1S1WA 4AM7A 4KB1A 3C6HA 4FW2A 3LWLA 1RBTA 3S3NA 1RCHA 3DXKB 4PY5A 4ELUA 2EWSA 3DXMA 1NWKA 3OYCA 1Q7YO 2QWNA 5EY4A 4N76A 4E7HA 1SKRA 1IKYA 3RMBA 3VQ8A 3TARA 3H3OB 3BZCA 2P9PB 3CJ7A 3O9RA 2P9KB 1HJRA 4DR2K 3OYDA 1S72N 4FWPA 2GUPA 1JCEA 5H1SQ 2Z1HA 4JEPA 2VWBA 5SWMA 3LDLA 1JLQA 3F2KA 1RBUA 4KHSA 5AQVA 1NOYA 2QTDA 4B1ZA 3CCUN 4H0PA 1C0TA 2X78A 3OYMA 1WBDA 4JD2B 3T69A 3ZSXA 3SQ2A 4EAHD 3SJHA 1LAWA 1HYZA 4IEEA 2YKNA 3ZETB 4K43A 3AO2A 4IG0A 4MO5A 1HLUA 3QEIA 2UXCK 4FLXA 3KK2A 1BCMA 3L2VA 3O80A 4FOEA 3TWHA 5DM6L 2GX9A 3MMVA 5J2NA 1ATSA 4AILC 3M1FA 4CZLA 1H1VA 3RR7A 3V9WA 2OCEA 3L3UA 4CJFA 1K73O 3K5NA 4GV6A 4FK2A 5HL7L 3ZX0A 3EEQA 1S22A 4IDKA 1D9FA 3CJ1A 2I7PA 2OPPA 2XY7A 1QVFM 4KHUA 1HNIA 1BIUA 4BREA 5JLHA 3VQ4A 5IWAK 4FM2A 3H1QA 4XH1A 4DU3A 3CI5A 4K8XA 3TAQA 4ZTJA 1VQ6N 2HHHK 2ZF5O 3PX4A 3U8XA 2F4VK 4DFKA 4DKWA 4PKGA 3EYZA 2QXLA 3QDKA 2DPNA 4FWOA 3WXLA 2IOCA 1S6PA 2V7ZA 4F8RA 4QCLA 4DTRA 3DYAA 3F9MA 1BA1A 4MLHA 3DLKA 3U6FA 1VQLN 1HKGA 4DR3K 3LANA 3LWMA 4J2EA 4CHYA 2P9KA 2DY4A 1BWFO 1IBMK 2P9NB 4CJTA 4Z4CA 1WLJA 1JCGA 2XO7A 1NGBA 4NO7A 3SAGA 4B8AB 4KI6A 4DTMA 3RMAA 2A5XA 4FJ5A 1FK9A 3VEOA 3AAQA 4W5TA 4HHTA 2WUSA 3O9SA 2D0AA 3ZSZA 1GLBG 4DF4A 4X65K 4FM0A 3O08A 3QINA 4BR7A 1TAQA 3FZLA 4Z4FA 3DWLA 3TTFA 2KKZA 1TKTA 4CD1A 4FZXC 1N33K 4KREA 3AVIA 3D6RA 2EX3A 3UIQA 2IIRA 4JN4A 3THXA 4CGFA 2YJFA 2ASPA 5KI6A 4HCCA 5FROA 5T7BA 3HP6A 3DLLL 3NFAA 4DS4A 1QZ6A 1ESVA 3O9QA 1Y97A 1N8RO 3PSIA 5EX5A 2HSTA 5HRPA 4M45A 4AHVA 1XMQK 2IVPA 4GVMA 3EZWA 4ISGA 2FBVA 3VESA 4QS9A 2X74A 1VSIA 3P83D 3VQBA 3OYKA 2F96A 1JLGA 4FM1A 4EHUA 1FXXA 4CK2A 3UKUB 4J2AA 2BE2A 4CZEA 4JK9A 2Q36A 1BL3A 2HHVA 4IDHA 4CJSA 3D0PA 2ETJA 2NLXA 5EU7A 4YORA 5BPMA 2O8BB 1YJNN 1U4BA 4FK4A 3ZT1A 5FPNA 3E9PA 3CCJN 3C95A 1C0UA 1ASVA 4IOAL 3SQ1A 4JKFA 3JAMO 4RTFD 3ULDA 4DF8A 2Y1JA 4DSIA 4B1VA 3PSFA 4M3XA 4O8KA 3CJ9A 3LAKA 3MWTA 4CJVA 3NF8A 1X9SA 4WQ4A 4DUZK 3QMLA 3EY1A 4H0OA 3AVBA 2NRWA 2ZM6K 4I6MB 1S9EA 5CE3A 3QFUA 4ZHRA 1ILYA 1B9DA 2A41A 4EFHA 3OYBA 2G8IA 4CESA 4JI3K 3VA3A 1XHZA 3ZT0A 5TKYA 1VQNN 3HRGA 5GIOA 2D0PA 3OYHA 4DMNA 1P90A 4JI8K 3TI0A 1S6QA 2CGKA 3PX6A 4NYNA 4E1NA 1I39A 4ELTA 2FBTA 2PYJA 4FJJA 4FWRA 2LSNA 1MU2A 3HPHA 4LH5A 3ZSVA 1SQKA 4FJNA 4C1NK 1XUPO 3WXKA 1A5VA 3QNOA 4LF7K 3NMUA 4ZTFA 5GIPA 4LFCK 4DR5K 1NKCA 3L8BA 4DV2K 2KFNA 4KPYA 3CETA 3S9HA 3T19A 3DLGA 4CHOA 3CF5L 2FSKA 1KD1O 1RBSA 1HRHA 5LJWA 3LDNA 3VENA 4FLWA 1VSEA 1HMVA 1W97L 5CYMA 3OS0A 1Z26A 1W0HA 1JL1A 4PUOA 4ILHA 4JNEA 1N36K 3E01A 2NRXA 4JKHA 4EZ9A 2YNHA 3H3NO 3ZSWA 3OVNA 3U3GA 1U48A 4QS8A 4LF8K 1HJOA 4DTOA 3KK7A 1L3UA 3SBTA 3RR8A 2AA4A 4FWQA 3QIOA 3THWA 1NOZA 2V7YA 1NMDA 1G99A 1VQPN 1VSJA 1EO1A 4Z4IA 3LP2A 4FLZA 4JI0K 5EOYA 3GG4A 3DRSA 5AQIA 3KLIA 3KVGA 1T8EA 4KAZA 3MXIA 4CF2A 5KPRA 1VQ8N 4CGDA 1KVBA 5HLFA 3PIPL 1JLCA 1E4FT 3CD6N 1J9AA 3ZX3A 3PY8A 1MDUB 3C94A 4DQQA 3OYFA 3SPZA 4DSLA 5FRNA 4X66K 1NK8A 1WBBA 1ZXOA 3A0IX 4W5NA 1UA0A 4DR6K 3QFPA 1VQON 1WOQA 2CGLA 1SL1A 3GOIA 4EP4A 4CVNE 5AFUA 5JS1A 3A2FA 2HOEA 3P4IA 5BN8A 1J5OA 4BDZA 3ZX2A 1RT1A 1NG9A 1SS6A 5KRTA 5MLCQ 2O8FA 3EO3A 1OH6A 1Z05A 3AVJA 4FWLA 5AQFA 1T3VA 1JKHA 5BPLA 4B9LA 3LZIA 5M1PA 2O8DB 5J1EA 3DLRA 1OVYA 4O0JA 4M3RA 3VQPA 5HBMA 4A59A 4FLTA 3RMCA 1TAUA 3THYA 2O4GA 2UUBK 1V4SA 4DV3K 4E7LA 3CJBA 5B8HA 4FJHA 2RF2A 4CGHA 2QWQA 3FR0A 1K8KB 4FWSA 1IO2A 4FWNA 2VG7A 2ZJPL 1ASWA 5JMVA 1UAXA 4LF5K 5CR4A 3AA4A 3EE9A 3G6EN 4E7KA 4FZZA 4DHYA 4CZIA 1GOCA 5TKWA 4WYBA 3O3HA 2Y1IA 4BR9A 2VCPA 1SZ2A 4BC2A 4I2QA 3AA5X 3U3YA 4DQPA 3ATUA 2VGMA 5FRMA 4RW9A 3J80O 3RMDA 2XY6A 3NGIA 4B3RK 3L3VA 3NAEA 2DFHA 4GW6A 1GLCG 3MX5A 2NUBA 2KFZA 1GOBA 3ZSQA 1FJGK 3BY5A 1EX4A 1ATRA 3O1BA 5M1QA 2FC0A 4YOYA 5M1OA 4C8LA 2HF4A 3SPYA 3C0BA 1RT3A 2GWKA 2UUCK 4JI7K 4HUFA 3TAGA 3FZKA 4CFDA 3QEXA 3ID8A 3SI6A 1Z6RA 3VGLA 3NCIA 3QBWA 2E1ZA 2IC3A 2HB5A 4CF8A 4BE0A 2QXFA 1YHQN 3BDPA 4G9ZA 3OYAA 4DV4K 4A62A 5IT9O 3VQCA 3CM5A 4B9UA 2ZD1A 3ENBA 3TANA 3ITHA 4Z0UA 1BI4A 4AHCA 3BZKA 1BDGA 2F9WA 4LF9K 3RRGA 3DXKA 5GINA 5LY3A 3GE1A 5C10A 4JKDA 2JLEA 4CEZA 1VSMA 4K42A 5C42A 1RDUA 5F2RA 4DV6K 2P9IB 1UA1A 3CG7A 5BRFA 2Z1IA 4OKEA 4B1UB 3A8YA 3L2QA 3VQEA 1IJJA 3ULEA 2E6LA 4JS5A 4FWKA 4AF1A 1YXQA 1IBLK 4IJNA 4BDYA 4CBUA 2IGIA 1DEJA 1T05A 4HUGA 1TGOA 3L2WA 5C15A 4NYFA 4F2RA 2P9IA 5KGWA 1IKXA 3U9ZA 2VYPA 3KD5E 4BG9A 2FLOA 2VG6A 4E0DA 4H5RA 5ADXA 1YJWN 3JS6A 1BUPA 4DR4K 2HBLA 4AHTA 1YJ9N 1EXQA 2KW4A 3ZT2A 2IDOA 3VTHA 1WAJA 3UKRB 4ISFA 4B08A 1KCFA 1JXBA 3CERA 3A5OC 3KLFA 4CI6A 5AZJB 4FVMA 3OY9A 5C24A 3CCEN 4WQ4C 3PIOL 4AHSA 4OX9K 1WUAA 1MA9B 3IG1A 3HXMA 2IVOA 1VSHA 3VF2A 3DI6A 4Q0BA 3UKUA 4OJRA 4EZ6A 2YX6A 3IS9A 2QWOA 1WSIA 3P38A 1GLFO 4PHTX 3BEXA 4CECA 4HTUA 3PX0A 3MAQA 2NZTA 4BWJA 4RW8A 5AQSA 3KK1A 1RDBA 4FJGA 4M3TA 3J7YP 1ZBFA 1O1WA 4H4MA 4JAXA 5CZ2A 3RSEB 2O4IA 3NH1A 4CIEA 2VWKA 4BRHA 4BRQA 3SMSA 2WC9A 2Q0UA 3I55N 5AR0A 4CEBA 4LC9B 2GV9A 1CLQA 1SKSA 1L3VA 4ID5A 1NK4A 1W9HA 2XY8A 4DQIA 2A40A 1DTTA 3WNFA 2E2PA 4CCHA 4XH4A 1NK0A 4DCHA 2EHGA 1K8KA 4CD3A 4BRLA 4A5AA 4CHQA 2VWJA 4N56A 2A1RA 2OA8A 1CXUA 4LFAK 1YVNA 1IBKK 3MECA 1NGGA 3EKSA 3I0RA 4JHDB 1HYVA 3NF9A 3HTVA 4KFBA 3NGYA 5AZIB 1VSDA 2GBZA 4HTLA 4E19A 1U2VB 3BF3A 1YUWA 3HOTA 3GDQA 4JI6K 2BANA 4X62K 4DTXA 4OKKA 3V9XA 3C7NA 3LDPA 3SQ4A 4OPHA 4M3ZA 3BGRA 3KK3A 1IG8A 4GVEA 2FSNA 4IOCL 4FJ8A 4OKJA 3SAHA 2E1YA 1TYQB 3A5LC 3FFKB 3KJVA 3AO5A 4CFBA 1TKXA 3A5MC 2KQ2A 4OVLA 2HNDA 3VTIA 1J6ZA 4WFNL 1K9MO 4KHNA 1TV6A 1J53A 4I7FA 1WSHA 4W5RA 4CZKA 3M8SA 3NF7A 1J54A 2Q3SA 4BY9C 2ZJQL 4MQ3A 1EP4A 5KPTA 5C0YA 4B1XB 4CEEA 3NE6A 3O3FA 3VETA 1C0MA 3AVCA 2O8CA 1LW2A 3UKRA 3QESA 2FF6A 3KKSA 3VQ6A 1BGXT 3ZETA 4JV5K 1BOTO 2P9UA 1RTIA 1X1PA 4HVJA 4F3OA 1SV5A 3R3LA 4CHZA 3SYZA 3CQ8A 1QTMA 2E6MA 2QKBA 4WFAL 1QZ5A 5LMNK 4H0XB 3K58A 3TTCA 2YJEA 3KWIA 3PLAA 2E5LK 3HL8A 4Z4GA 4PL7A 4I6MA 2G8HA 3B8AX 2PBDA 2QWRA 1E4GT 4U67L 3DLEA 3SJJA 1BCOA 5C12A 4BC3A 5CY4A 3V81A 3O8MA 3THYB 4MLEA 4FOIA 5AZJA 3DLHA 3ATVA 4FXDA 4B9TA 3J7ZO 1R0AA 4BROA 3CJCA 5LMUK 3PO4A 2GELA 1YT3A 3HM8A 4CERA 1TK0A 3GBTA 1B9FA 3H1VX 4CFAA 3AAPA 1U49A 1QS4A 5AQWA 1WB9A 3ENOA 3CIPA 2WONA 1FKOA 3ALYA 1ZBLA 4AM6A 4B3TK 1Q81O 3O4QA 4O44A 1X3MA 3VEXA 3MN7A 3E9OA 4C23A 2PAVA 4N5SA 4MFBA 2NRHA 5KQ8A 3MCAB 3I33A 4M63C 4LY7A 1RBVA 4BQLA 4PL8A 4ILGB 1SL0A 3CC7N 1LWFA 3WT0A 1BHLA 1RT7A 4CF9A 4GNIA 4CIFA 1HQEA 2NNWA 3TAEA 5BN9A 3C7NB 3VQ5A 4X64K 3KLGA 3HPGA 3HP9A 2HW3A 3KHYA 1ZBSA 1JXEA 3J8AA 5FLXO 3PO5A 3QETA 4FZYA 1NJZA 4K41A 4I2PA 3AVAA 3QNNA 1NGCA 1QQCA 5E84A 1XHXA 4O5BA 2YNIA 5KPZA 1NLVA 5CHIA 4A61A 4L3QA 3U4LA 3D7EO 2OPQA 2YCHA 4B3OA 3VGKA 4J2DA 4BRMA 3O9UA 3PV8A 2HHWA 3LM9A 4BRPA 4IOXA 4CEAA 3LPTA 1XI1A 4M3WA 1VAZA 3V9UA 3TABA 3CHWA 1TK5A 1CXQA 4FJ7A 4DG1A 3T3FA 2VGNA 5F1XA 1IH7A 4NLCA 1NK6A 3IKMA 4H8KA 2CH6A 4YOVA 3V4IA 2HBJA 4MDBA 2YKMA 1X9MA 3ZLJA 3SZ2A 2NRTA 1LWEA 4IFEA 3WNHA 2HHUA 4CEFA 4DTUA 4BR4A 3VERA 5SZTA 1QHTA 4AH9A 4NXMK 3CMEN 2O8CB 3AARA 3KIOA 3L0QA 2VQEK 3THVA 4IWVA 1ASUA 5FPEA 1KAYA 4B8CA 1KTQA 3L2UA 1OVQA 1HUXA 4R5PA 3KZBA 1WAFA 5LJVA 1YITN 3NVKA 3C6AA 4DQ8A 2ZQBA 2PYLA 3D2FB 2AJQA 4E1JA 3P1GA 3LP1A 1YVUA 3IFRA 1KXPA 4HWIA 5FPDA 1JLBA 1S1VA 4F9OA 3ASMA 2YNFA 3WEEA 1D8YA 1Q86O 1ZBUA 4UY8O 3AO3A 4C1NI 2OPRA 2QM1A 5CZ1A 4CZHA 5AQHA 2P9NA 3HK2A 3RWUA 2KHOA 2VQFK 4JI5K 3VQQA 4DSEA 4KO0A 2W42A 3KLHA 1NJWA 1VRUA 4FL9A 3DLBA 5AQLA 1NK5A 2BH1A 4CBWA 1TUYA 2CH5A 3FZMA 4Z4EA 1DGKN 4B9VA 3DOKA 1Y64A 4YOUA 3SK3A 5DK5A 3R6MA 1WSGA 3W0LA 4H5NA 2RE2A 2PZSA 4PKHA 3RTVA 1RTDA 3M6GA 4QOZB 1HR0K 3ZEUA 5HRNA 5M1FA 3OYGA 1EETA 4FCYA 4A2BA 4WE1A 3O4NA 1CZ9A 3CCQN 1X9WA 4GMJB 4DLEA 1NJXA 4BRFA 3W3DA 4RG8A 1K6YA 1S3XA 5BREA 3QO9A 3WEEB 5JVGL 4OO1J 4BRIA 3I56N 2QWPA 1RT2A 4BRAA 2O8DA 4I9LA 4XH5A 5AJ3K 3WNEA 4DFJA 4KHQA 3P39A 1S9GA 4WFBL 3E9LA 3E66A 2F8SA 3K5MA 1BO5O 4DQRA 3PUFA 2P9PA 2IAJA 3LDOA 3LALA 2A42A 4CJPA 2ATQA 1ITGA 1XMOK 1NGJA 4RWTA 3VEVA 4B1WB 5J2MA 2HBMA 4NCAA 2HVHA 4CGGA 5I9EB 4FPBA 3ULEB 1XC3A 3H6EA 4QAGA 3AVNA 4KH4A 3LP3A 5HOOA 4CW7B 2P1JA 3I0SA 4FLVA 4JHDA 1KVCA 4BRCA 4YFUA 4BR2A 1HNXK 1GOAA 4KH5A 1C1CA 1T6DA 3M8PA 3WQTA 1EQYA 2F7TA 5JICA 4BACA 1T03A 3WXJA 2CGJA 1S1XA 1TL3A 3K0SA 4LSLA 4LSNA 4N41A 4DR7K 2AP1A 4LH4A 4MO4A 4AQYK 3QEVA 1KRPA 4JKCA 1B92A 4A57A 2W6LA 1C0FA 2E20A 5AQXA 2ZE2A 2Z1JA 2UXBK 5AQPA 2D0OA 4DSFA 1NJYA 3CM6A 4H0VB 3HI0A 4C8NA 5M1KA 1YIJN 2KZZA 2BTFA 2G8FA 3VEYA 3G0ZA 1TL1A 3H45C 1I3AA 4E7JA 3FZFA 4JI1K 3HPOA 1KAZA 2QWMA 4M42A 4IZ9A 4RW4A 4Z94A 3QEPA 2Q97A 3OYNA 3TTDA 2OTLN 1GLEG 1RILA 5K14A 4Y1CA 4JK7A 4EP5A 1X9JA 3O5BA 2BGGA 1ATNA 4W5QA 1NBWA 3V1RA 1FW6A 4B9MA 2HHQA 2YHYA 1JLEA 2DFEA 3M8QA 4CJLA 4DTSA 3DAWA 1XNQK 2KLAA 4IO9L 3OYEA 3CPWM 2P9LA 3M5RA 4YNQA 1ZBHA 3VA0A 3SLCA 4DSKA 1KVAA 1NGAA 4CJWA 3T1AA 3JSMA 2D0CA 1OH8A 4BWMA 4DLGA 2RKIA 4JKBA 2Q2RA 1HPZA 3WXMB 3UB5A 3AO1A 5C2DA 1NKEA 1L5UA 4JS4A 4DFPA 4GKKK 1M1KO 3CC2N 4BG8A 4FYDA
chains in the Genus database with same CATH topology
4DSIA 4IFYA 4KHNA 4M3XA 1KLMA 4Y1DA 1TV6A 3LAKA 4CFCA 1J53A 2VG5A 3NF6A 4CJVA 3NF8A 1X9SA 4I7FA 1WSHA 3K5OA 4W5RA 3M8SA 4CK3A 1U47A 2I5JA 2OPSA 3NF7A 1WN7A 4PWDA 1HYSA 3EY1A 1J54A 3LDSA 2Q3SA 3AVBA 4RW6A 1NKBA 4MQ3A 1FKPA 3F73A 1EP4A 1RNHA 3AVMA 4ELVA 4CEEA 2D5RA 1S9EA 4KTZA 3NE6A 4ZHRA 3O3FA 5CYQA 4JRPA 1B9DA 1C0MA 3AVCA 3MXMA 1LW0A 4OGCA 3OYBA 1LW2A 3ZT4A 3QESA 3VQ6A 3KKSA 1BGXT 3K2PA 2XY5A 5DMRA 2G8IA 4IBNA 4CESA 1RTIA 4CE9A 3VA3A 1JL2A 1XHZA 3ZT0A 2HVIA 1X1PA 4RW7A 4HVJA 4ICLA 1SV5A 3CFOA 1S1UA 3VN5A 4CHZA 3SYZA 4F3OA 3OYLA 3CQ8A 5HP1A 4PA1A 3OYHA 4DMNA 3H08A 3K57A 1QTMA 1QSLA 2E6MA 3NH0A 2QKBA 3TI0A 3V1OA 1S6QA 4I9QA 1CZBA 3PX6A 1C1AA 4NYNA 4E1NA 2YV0X 3DM2A 3K58A 1I39A 3B6PA 1RTJA 3DOLA 3LPUA 4ELTA 2G8KA 1JLAA 1U45A 2FBTA 2PYJA 4OPKA 4FJJA 1Q9XA 4HCBA 3HVRA 2X6SA 1Z25A 2HMIA 2LSNA 1MU2A 3HL8A 3HPHA 4Z4GA 5E41A 4LH5A 3ZSVA 4CHNA 1RT6A 3SV4A 2G8HA 4FJNA 3S3OA 1RT5A 4FJMA 1A5VA 3QNOA 3DLEA 3SJJA 4ZTFA 1BCOA 1BQNA 3O3GA 3V81A 5CY4A 3OS1A 1TKDA 1NKCA 3L8BA 2KFNA 3LZJA 4KPYA 3S9HA 3T19A 3TAPA 3DLGA 4B9SA 4DU4A 4CHOA 4DSJA 4E7IA 3EZ5A 1IKVA 3DLHA 3AVFA 3AVGA 1XC9A 3SUPA 1RBSA 1HRHA 4BE2A 4FXDA 2GUIA 4B9TA 4O0IA 3AO4A 4FLWA 3HJFA 1VSEA 4CGJA 1R0AA 1KSPA 1HMVA 5CYMA 5HRRA 3OS0A 1Z26A 5KTQA 1W0HA 1JL1A 4E3SA 3PO4A 3KD1E 4PUOA 4F2SA 4CHPA 3OJUA 3E01A 3LAMA 1QE1A 3WNGA 2HHTA 4EZ9A 1YT3A 2YNHA 4CERA 1TK0A 3ZSWA 4BE1A 1A5WA 1B9FA 5D3GA 4CFAA 3OVNA 3U3GA 1Q8IA 2HNZA 1U48A 1U49A 4O55A 4DTOA 4KB0A 5KRSA 1QS4A 1L3SA 1L3UA 3D45A 1BI4B 3RR8A 4KTWA 3QIOA 1IKWA 4NCBA 1NOZA 2WONA 3P5JA 1FKOA 3ALYA 1ZBLA 4BDPA 4KHYA 3O4QA 1VSJA 4O44A 1WNSA 4N5SA 3LP2A 3RRHA 4F4KA 4FLZA 4Z4IA 3DRPA 4MFBA 3JYTA 1Q9YA 4TSXA 3NGZA 3DRSA 3MEEA 3KLIA 4OPJA 1T8EA 4KAZA 2KTQA 3MXIA 4CF2A 2Z1GA 4E89A 3QEWA 2OZSA 1VSFA 1KVBA 4LY7A 1RBVA 4CEQA 4CGDA 3V9SA 1SL0A 3HM9A 4KKOA 1LWFA 2OZMA 5HLFA 1BHLA 1RT7A 4ID1A 4CF9A 4OGEA 4CIFA 1JLCA 1HQEA 3TAEA 3OYIA 1J9AA 5HRSA 3AVKA 1VRTA 3PY8A 3VQ5A 3C94A 4DQQA 3SUQA 2DTUA 3OYFA 3KLGA 3SPZA 4FLYA 4CJQA 3HPGA 4DSLA 1NK8A 5FRNA 3HP9A 2HW3A 1TKZA 1JXEA 4W5NA 3PO5A 4PQUA 4DTPA 1UA0A 1UOCA 3QETA 4FZYA 1NJZA 2FBXA 1S5JA 4DS5A 3S3MA 4I2PA 3SNNA 3AVAA 3QNNA 3HSTB 1SL1A 4F3TA 1ZBIA 1QQCA 4KV8A 4EP4A 1XHXA 4O5BA 2HHSA 3ZCMA 4M41A 2YNIA 5JS1A 3A2FA 4FJKA 2HVHA 1ZYQA 3HYFA 4C8MA 1NK7A 3I8DA 1S1TA 1J5OA 2ITGA 4BDZA 2OPQA 1RT1A 1QSYA 1HQUA 1F21A 2B4JA 5KRTA 1NK9A 4B3OA 2P51A 4CJ5A 4J2DA 3QERA 2QK9A 3AVJA 1IG9A 4W5OA 3PV8A 2HHWA 2B6AA 4H4OA 5FDLA 4CEAA 1KLNA 1JKHA 5J2PA 3LPTA 4KHWA 1XI1A 2YHBA 1YTAA 4CF0A 4B9LA 4M3WA 3LZIA 3V9UA 3TABA 5J1EA 4JLHA 3DLRA 2OYQA 3HO1A 3C6UA 4IG3A 4O0JA 1TK5A 4M3RA 2JGUA 5KGXA 4FLUA 3VQPA 1CXQA 3HVTA 5HBMA 1WSFA 3QIPA 4DG1A 4FLTA 3T3FA 4FJ7A 1IH7A 3RMCA 1TAUA 4CEOA 1YTUA 2O4GA 1NK6A 2XRIA 4E7LA 4H8KA 3V4IA 1D9DA 3VQ9A 4FK0A 3KKRA 4FW1A 3B6OA 4FJHA 1LV5A 1KFDA 1RBRA 2RF2A 4CGHA 4DFMA 3OYJA 2YKMA 5HROA 1X9MA 3SZ2A 1IO2A 4Q5VA 1LWEA 1D5AA 1VSKA 2VG7A 3NBPA 3WNHA 1N6QA 2HHUA 4CEFA 4E1MA 1C6VA 4DTUA 3SQ0A 1ASWA 4C8KA 1RTHA 5SZTA 1QHTA 1UAXA 4AH9A 3AA4A 3KLEA 3KIOA 4E7KA 4FZZA 4J2BA 1G15A 4CEDA 1GOCA 3THVA 2G8WA 2R7YA 3K59A 1LWCA 3O3HA 2Y1IA 1ASUA 2IS3A 3MEDA 3ZSYA 4CJUA 1HNVA 3F9KA 3V1QA 4Z4HA 4I2QA 2G8UA 3AA5X 3NDKA 3U3YA 2P5OA 4DQPA 4B8CA 2DFFA 1KTQA 3L2UA 4KI4A 4XIUA 4R5PA 5FRMA 4DTJA 1WAFA 3LP0A 4RW9A 3RMDA 4KRFA 2XY6A 3NGIA 3AVHA 2ZQBA 5HRPA 2BDPA 3IRXA 2PYLA 3L3VA 1S1WA 3NAEA 2DFHA 3P1GA 4GW6A 2AJQA 3LP1A 1YVUA 2NUBA 5J2QA 4FW2A 3LWLA 5I42A 1RBTA 3S3NA 1RCHA 3OJSA 2KFZA 1GOBA 3ZSQA 2WOMA 3SV3A 1JLBA 3IAYA 1S1VA 1EX4A 2B5JA 3ASMA 2FC0A 2YNFA 1D8YA 4CJ3A 4PY5A 3TAMA 4ELUA 3KTQA 4C8LA 4OLBA 1ZBUA 3OYCA 3SPYA 3AO3A 1RT3A 2OPRA 5CZ1A 4N76A 3OS2A 4FJ9A 3HT3A 4E7HA 4HUFA 1IKYA 1SKRA 3VQAA 1TK8A 3TAGA 3VQ8A 4CFDA 3RMBA 3TARA 3HK2A 3QEXA 3RWUA 3VQ7A 3SI6A 1HJRA 3NCIA 3OYDA 2IC3A 1L3TA 3VQQA 1XWLA 2HB5A 4KO0A 4CF8A 2W42A 4DSEA 3SUNA 3KLHA 2A1SA 4BE0A 4DF8A 2QXFA 2Z1HA 1NJWA 1VRUA 3DLBA 3BDPA 1UWBA 3OYAA 1NK5A 1DTQA 5SWMA 3NH2A 1SL2A 3VQCA 3CM5A 4B9UA 2ZD1A 2YNGA 3TANA 1JLQA 4LD0A 3ITHA 1RBUA 4Z4EA 4Z0UA 1BI4A 4AHCA 3L2RA 3DOKA 3TAFA 4B9VA 4KHSA 1A5XA 5DK5A 1NOYA 3RRGA 1WSGA 1SKWA 1C0TA 4IFVA 2X78A 4IKFA 3OYMA 2F8TA 2PZSA 3ZSXA 3RTVA 3AA3A 3SQ2A 4HUEA 1RTDA 1N5YA 4QOZB 1LAWA 1HYZA 2JLEA 2YKNA 4CEZA 5HRNA 3AO2A 4IG0A 1EETA 1VSMA 3OYGA 4FCYA 3QEIA 4FLXA 3KK2A 1BCMA 3V6DA 3L2VA 4WE1A 5C42A 3O4NA 4CF1A 3TWHA 1VSLA 1CZ9A 1X9WA 4GMJB 4DLEA 5J2NA 4AILC 1NJXA 4CJEA 4RG8A 1UA1A 1K6YA 4O4GA 3CG7A 3RR7A 4M3UA 4C8OA 3V9WA 3QO9A 2Z1IA 4OKEA 4CJFA 3L3UA 1RT4A 3K5NA 4FJIA 3L2QA 4FK2A 1KFSA 3AV9A 3VQEA 4DWIA 1EKEA 2E6LA 4JS5A 1RT2A 4IDKA 4I9LA 2YHAA 1D9FA 4BDYA 2PY5A 2IGIA 3K5LA 2OPPA 3WNEA 4AHRA 2XY7A 4KHUA 4DFJA 1HNIA 4KHQA 1BIUA 4JRQA 1T05A 1S9GA 3VQ4A 4HUGA 4FM2A 2F8SA 1BIZA 3K5MA 4DU3A 4K8XA 4DQRA 3PUFA 3TAQA 1TGOA 4ZTJA 3L2WA 3PX4A 4F2RA 4NYFA 2IAJA 4DFKA 3CYMA 5KGWA 1IKXA 3LALA 3EYZA 4CJPA 2ATQA 3KD5E 2D0BA 1ITGA 2VG6A 3ZSRA 4CJ4A 4E0DA 4AHTA 1EXQA 2KW4A 3FFIA 3ZT2A 5J2MA 2IOCA 1S6PA 4G1QA 4CK1A 4F8RA 2IDOA 4NCAA 1WAJA 4CGGA 3DYAA 4B08A 4DTRA 3SUOA 4QCLA 1KCFA 1VK0A 1JXBA 4UQGA 4QAGA 3DLKA 3ZSOA 3U6FA 3AVNA 3KLFA 3LANA 4NCGA 4N47A 3LP3A 3LWMA 4FVMA 4KTQA 3OY9A 3MXJA 5C24A 4J2EA 3QLHA 4CHYA 2P1JA 3I0SA 2P5GA 4M3YA 2DY4A 4FLVA 4KB1A 1RDAA 1KVCA 2HNYA 3AVLA 4YFUA 1C1BA 4CJTA 4AHSA 4DU1A 3IG1A 3HXMA 4Z4CA 2E4LA 3CFPA 1WLJA 1GOAA 2XO7A 1VSHA 1C1CA 3DI6A 4CJKA 1QSSA 3ZT3A 1SUQA 4OJRA 4Q0BA 3M8PA 3G10A 4CGIA 4EZ6A 4B8AB 4BACA 4KI6A 1T03A 3IS9A 4DTMA 1S1XA 1TL3A 3ISNC 4LSLA 4LSNA 3RMAA 1WSIA 4N41A 1T7PA 1JLFA 1FK9A 4FJ5A 4LH4A 3QEVA 4CECA 1KRPA 3VQDA 4HTUA 4W5TA 5I3UA 1B92A 3PX0A 3MAQA 4HHTA 2G8VA 4BWJA 4RW8A 2D0AA 3ZSZA 2ZE2A 2XHBA 4DF4A 3KK1A 1RDBA 2Z1JA 4FJGA 1DLOA 4DTNA 4FM0A 4DSFA 1NJYA 4M3TA 3CM6A 1ZBFA 1O1WA 4H4MA 5CZ2A 3QINA 4C8NA 2O4IA 3NH1A 2KZZA 4CIEA 2VWKA 1TAQA 2G8FA 4Z4FA 4K8ZA 3G0ZA 1TL1A 4B9NA 3M8RA 4CJRA 4CEBA 1TKTA 4FZXC 2GV9A 4KREA 1SKSA 1CLQA 1L3VA 3AVIA 1I3AA 2EX3A 1TVRA 4ID5A 4E7JA 1NK4A 3UIQA 4FJLA 1W9HA 2RPIA 1U04A 2XY8A 4CGFA 3HPOA 4DQIA 4DQSA 1DTTA 3WNFA 5KI6A 4CCHA 4M42A 1WSEA 4RW4A 4HCCA 1NK0A 5FROA 5T7BA 3QEPA 3HP6A 3OYNA 2EHGA 1RILA 3CFRA 1BISA 3NFAA 1RDCA 5K14A 4DS4A 4Y1CA 1WSJA 4CHQA 2VWJA 4EP5A 4N56A 2A1RA 2OA8A 1CXUA 3SCXA 2BGGA 4W5QA 1Y97A 3MECA 3V1RA 4B9MA 2HHQA 3I0RA 1JLEA 1HYVA 1BQMA 2DFEA 3NF9A 4M45A 4KFBA 3NGYA 3M8QA 4AHVA 4CJLA 4GVMA 1VSDA 4DTSA 2FBVA 2GBZA 3AA2A 2RN2A 2X74A 1VSIA 4E19A 3OYEA 3P83D 3VQBA 1RDDA 3OYKA 2F96A 4YNQA 1ZBHA 2HHXA 3VA0A 2KZMA 1JLGA 2BANA 4FM1A 4DTXA 4OKKA 5JS2A 4DSKA 3MEGA 3C6TA 1LAVA 3V9XA 1KVAA 1FXXA 3TR8A 4CK2A 4J2AA 4CJWA 2BE2A 3T1AA 3NHGA 5C25A 3SQ4A 3JSMA 1BL3A 2FBYA 3DRRA 2D0CA 4M3ZA 3BGRA 2HHVA 4BWMA 3KK3A 4DLGA 2RKIA 4CJSA 3D0PA 2ETJA 4L8RB 1REVA 5EU7A 4FJ8A 1HPZA 4OKJA 2QKKA 2X6NA 3AO1A 4AHUA 4CIGA 1U4BA 4FK4A 3ZT1A 3C95A 1C0UA 1NKEA 1L5UA 4JS4A 1ASVA 3AO5A 3DMJA 4CFBA 3KJVA 4DFPA 1TKXA 3V9ZA 3SQ1A 2KQ2A 4FJXA 4OLAA 4OVLA 2HNDA 3ULDA 4FYDA 2Y1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSI A;  4IFY A;  4KHN A;  4M3X A;  1KLM A;  4Y1D A;  1TV6 A;  3LAK A;  4CFC A;  1J53 A;  2VG5 A;  3NF6 A;  4CJV A;  3NF8 A;  1X9S A;  4I7F A;  1WSH A;  3K5O A;  4W5R A;  3M8S A;  4CK3 A;  1U47 A;  2I5J A;  2OPS A;  3NF7 A;  1WN7 A;  4PWD A;  1HYS A;  3EY1 A;  1J54 A;  3LDS A;  2Q3S A;  3AVB A;  4RW6 A;  1NKB A;  4MQ3 A;  1FKP A;  3F73 A;  1EP4 A;  1RNH A;  3AVM A;  4ELV A;  4CEE A;  2D5R A;  1S9E A;  4KTZ A;  3NE6 A;  4ZHR A;  3O3F A;  5CYQ A;  4JRP A;  1B9D A;  1C0M A;  3AVC A;  3MXM A;  1LW0 A;  4OGC A;  3OYB A;  1LW2 A;  3ZT4 A;  3QES A;  3VQ6 A;  3KKS A;  1BGX T;  3K2P A;  2XY5 A;  5DMR A;  2G8I A;  4IBN A;  4CES A;  1RTI A;  4CE9 A;  3VA3 A;  1JL2 A;  1XHZ A;  3ZT0 A;  2HVI A;  1X1P A;  4RW7 A;  4HVJ A;  4ICL A;  1SV5 A;  3CFO A;  1S1U A;  3VN5 A;  4CHZ A;  3SYZ A;  4F3O A;  3OYL A;  3CQ8 A;  5HP1 A;  4PA1 A;  3OYH A;  4DMN A;  3H08 A;  3K57 A;  1QTM A;  1QSL A;  2E6M A;  3NH0 A;  2QKB A;  3TI0 A;  3V1O A;  1S6Q A;  4I9Q A;  1CZB A;  3PX6 A;  1C1A A;  4NYN A;  4E1N A;  2YV0 X;  3DM2 A;  3K58 A;  1I39 A;  3B6P A;  1RTJ A;  3DOL A;  3LPU A;  4ELT A;  2G8K A;  1JLA A;  1U45 A;  2FBT A;  2PYJ A;  4OPK A;  4FJJ A;  1Q9X A;  4HCB A;  3HVR A;  2X6S A;  1Z25 A;  2HMI A;  2LSN A;  1MU2 A;  3HL8 A;  3HPH A;  4Z4G A;  5E41 A;  4LH5 A;  3ZSV A;  4CHN A;  1RT6 A;  3SV4 A;  2G8H A;  4FJN A;  3S3O A;  1RT5 A;  4FJM A;  1A5V A;  3QNO A;  3DLE A;  3SJJ A;  4ZTF A;  1BCO A;  1BQN A;  3O3G A;  3V81 A;  5CY4 A;  3OS1 A;  1TKD A;  1NKC A;  3L8B A;  2KFN A;  3LZJ A;  4KPY A;  3S9H A;  3T19 A;  3TAP A;  3DLG A;  4B9S A;  4DU4 A;  4CHO A;  4DSJ A;  4E7I A;  3EZ5 A;  1IKV A;  3DLH A;  3AVF A;  3AVG A;  1XC9 A;  3SUP A;  1RBS A;  1HRH A;  4BE2 A;  4FXD A;  2GUI A;  4B9T A;  4O0I A;  3AO4 A;  4FLW A;  3HJF A;  1VSE A;  4CGJ A;  1R0A A;  1KSP A;  1HMV A;  5CYM A;  5HRR A;  3OS0 A;  1Z26 A;  5KTQ A;  1W0H A;  1JL1 A;  4E3S A;  3PO4 A;  3KD1 E;  4PUO A;  4F2S A;  4CHP A;  3OJU A;  3E01 A;  3LAM A;  1QE1 A;  3WNG A;  2HHT A;  4EZ9 A;  1YT3 A;  2YNH A;  4CER A;  1TK0 A;  3ZSW A;  4BE1 A;  1A5W A;  1B9F A;  5D3G A;  4CFA A;  3OVN A;  3U3G A;  1Q8I A;  2HNZ A;  1U48 A;  1U49 A;  4O55 A;  4DTO A;  4KB0 A;  5KRS A;  1QS4 A;  1L3S A;  1L3U A;  3D45 A;  1BI4 B;  3RR8 A;  4KTW A;  3QIO A;  1IKW A;  4NCB A;  1NOZ A;  2WON A;  3P5J A;  1FKO A;  3ALY A;  1ZBL A;  4BDP A;  4KHY A;  3O4Q A;  1VSJ A;  4O44 A;  1WNS A;  4N5S A;  3LP2 A;  3RRH A;  4F4K A;  4FLZ A;  4Z4I A;  3DRP A;  4MFB A;  3JYT A;  1Q9Y A;  4TSX A;  3NGZ A;  3DRS A;  3MEE A;  3KLI A;  4OPJ A;  1T8E A;  4KAZ A;  2KTQ A;  3MXI A;  4CF2 A;  2Z1G A;  4E89 A;  3QEW A;  2OZS A;  1VSF A;  1KVB A;  4LY7 A;  1RBV A;  4CEQ A;  4CGD A;  3V9S A;  1SL0 A;  3HM9 A;  4KKO A;  1LWF A;  2OZM A;  5HLF A;  1BHL A;  1RT7 A;  4ID1 A;  4CF9 A;  4OGE A;  4CIF A;  1JLC A;  1HQE A;  3TAE A;  3OYI A;  1J9A A;  5HRS A;  3AVK A;  1VRT A;  3PY8 A;  3VQ5 A;  3C94 A;  4DQQ A;  3SUQ A;  2DTU A;  3OYF A;  3KLG A;  3SPZ A;  4FLY A;  4CJQ A;  3HPG A;  4DSL A;  1NK8 A;  5FRN A;  3HP9 A;  2HW3 A;  1TKZ A;  1JXE A;  4W5N A;  3PO5 A;  4PQU A;  4DTP A;  1UA0 A;  1UOC A;  3QET A;  4FZY A;  1NJZ A;  2FBX A;  1S5J A;  4DS5 A;  3S3M A;  4I2P A;  3SNN A;  3AVA A;  3QNN A;  3HST B;  1SL1 A;  4F3T A;  1ZBI A;  1QQC A;  4KV8 A;  4EP4 A;  1XHX A;  4O5B A;  2HHS A;  3ZCM A;  4M41 A;  2YNI A;  5JS1 A;  3A2F A;  4FJK A;  2HVH A;  1ZYQ A;  3HYF A;  4C8M A;  1NK7 A;  3I8D A;  1S1T A;  1J5O A;  2ITG A;  4BDZ A;  2OPQ A;  1RT1 A;  1QSY A;  1HQU A;  1F21 A;  2B4J A;  5KRT A;  1NK9 A;  4B3O A;  2P51 A;  4CJ5 A;  4J2D A;  3QER A;  2QK9 A;  3AVJ A;  1IG9 A;  4W5O A;  3PV8 A;  2HHW A;  2B6A A;  4H4O A;  5FDL A;  4CEA A;  1KLN A;  1JKH A;  5J2P A;  3LPT A;  4KHW A;  1XI1 A;  2YHB A;  1YTA A;  4CF0 A;  4B9L A;  4M3W A;  3LZI A;  3V9U A;  3TAB A;  5J1E A;  4JLH A;  3DLR A;  2OYQ A;  3HO1 A;  3C6U A;  4IG3 A;  4O0J A;  1TK5 A;  4M3R A;  2JGU A;  5KGX A;  4FLU A;  3VQP A;  1CXQ A;  3HVT A;  5HBM A;  1WSF A;  3QIP A;  4DG1 A;  4FLT A;  3T3F A;  4FJ7 A;  1IH7 A;  3RMC A;  1TAU A;  4CEO A;  1YTU A;  2O4G A;  1NK6 A;  2XRI A;  4E7L A;  4H8K A;  3V4I A;  1D9D A;  3VQ9 A;  4FK0 A;  3KKR A;  4FW1 A;  3B6O A;  4FJH A;  1LV5 A;  1KFD A;  1RBR A;  2RF2 A;  4CGH A;  4DFM A;  3OYJ A;  2YKM A;  5HRO A;  1X9M A;  3SZ2 A;  1IO2 A;  4Q5V A;  1LWE A;  1D5A A;  1VSK A;  2VG7 A;  3NBP A;  3WNH A;  1N6Q A;  2HHU A;  4CEF A;  4E1M A;  1C6V A;  4DTU A;  3SQ0 A;  1ASW A;  4C8K A;  1RTH A;  5SZT A;  1QHT A;  1UAX A;  4AH9 A;  3AA4 A;  3KLE A;  3KIO A;  4E7K A;  4FZZ A;  4J2B A;  1G15 A;  4CED A;  1GOC A;  3THV A;  2G8W A;  2R7Y A;  3K59 A;  1LWC A;  3O3H A;  2Y1I A;  1ASU A;  2IS3 A;  3MED A;  3ZSY A;  4CJU A;  1HNV A;  3F9K A;  3V1Q A;  4Z4H A;  4I2Q A;  2G8U A;  3AA5 X;  3NDK A;  3U3Y A;  2P5O A;  4DQP A;  4B8C A;  2DFF A;  1KTQ A;  3L2U A;  4KI4 A;  4XIU A;  4R5P A;  5FRM A;  4DTJ A;  1WAF A;  3LP0 A;  4RW9 A;  3RMD A;  4KRF A;  2XY6 A;  3NGI A;  3AVH A;  2ZQB A;  5HRP A;  2BDP A;  3IRX A;  2PYL A;  3L3V A;  1S1W A;  3NAE A;  2DFH A;  3P1G A;  4GW6 A;  2AJQ A;  3LP1 A;  1YVU A;  2NUB A;  5J2Q A;  4FW2 A;  3LWL A;  5I42 A;  1RBT A;  3S3N A;  1RCH A;  3OJS A;  2KFZ A;  1GOB A;  3ZSQ A;  2WOM A;  3SV3 A;  1JLB A;  3IAY A;  1S1V A;  1EX4 A;  2B5J A;  3ASM A;  2FC0 A;  2YNF A;  1D8Y A;  4CJ3 A;  4PY5 A;  3TAM A;  4ELU A;  3KTQ A;  4C8L A;  4OLB A;  1ZBU A;  3OYC A;  3SPY A;  3AO3 A;  1RT3 A;  2OPR A;  5CZ1 A;  4N76 A;  3OS2 A;  4FJ9 A;  3HT3 A;  4E7H A;  4HUF A;  1IKY A;  1SKR A;  3VQA A;  1TK8 A;  3TAG A;  3VQ8 A;  4CFD A;  3RMB A;  3TAR A;  3HK2 A;  3QEX A;  3RWU A;  3VQ7 A;  3SI6 A;  1HJR A;  3NCI A;  3OYD A;  2IC3 A;  1L3T A;  3VQQ A;  1XWL A;  2HB5 A;  4KO0 A;  4CF8 A;  2W42 A;  4DSE A;  3SUN A;  3KLH A;  2A1S A;  4BE0 A;  4DF8 A;  2QXF A;  2Z1H A;  1NJW A;  1VRU A;  3DLB A;  3BDP A;  1UWB A;  3OYA A;  1NK5 A;  1DTQ A;  5SWM A;  3NH2 A;  1SL2 A;  3VQC A;  3CM5 A;  4B9U A;  2ZD1 A;  2YNG A;  3TAN A;  1JLQ A;  4LD0 A;  3ITH A;  1RBU A;  4Z4E A;  4Z0U A;  1BI4 A;  4AHC A;  3L2R A;  3DOK A;  3TAF A;  4B9V A;  4KHS A;  1A5X A;  5DK5 A;  1NOY A;  3RRG A;  1WSG A;  1SKW A;  1C0T A;  4IFV A;  2X78 A;  4IKF A;  3OYM A;  2F8T A;  2PZS A;  3ZSX A;  3RTV A;  3AA3 A;  3SQ2 A;  4HUE A;  1RTD A;  1N5Y A;  4QOZ B;  1LAW A;  1HYZ A;  2JLE A;  2YKN A;  4CEZ A;  5HRN A;  3AO2 A;  4IG0 A;  1EET A;  1VSM A;  3OYG A;  4FCY A;  3QEI A;  4FLX A;  3KK2 A;  1BCM A;  3V6D A;  3L2V A;  4WE1 A;  5C42 A;  3O4N A;  4CF1 A;  3TWH A;  1VSL A;  1CZ9 A;  1X9W A;  4GMJ B;  4DLE A;  5J2N A;  4AIL C;  1NJX A;  4CJE A;  4RG8 A;  1UA1 A;  1K6Y A;  4O4G A;  3CG7 A;  3RR7 A;  4M3U A;  4C8O A;  3V9W A;  3QO9 A;  2Z1I A;  4OKE A;  4CJF A;  3L3U A;  1RT4 A;  3K5N A;  4FJI A;  3L2Q A;  4FK2 A;  1KFS A;  3AV9 A;  3VQE A;  4DWI A;  1EKE A;  2E6L A;  4JS5 A;  1RT2 A;  4IDK A;  4I9L A;  2YHA A;  1D9F A;  4BDY A;  2PY5 A;  2IGI A;  3K5L A;  2OPP A;  3WNE A;  4AHR A;  2XY7 A;  4KHU A;  4DFJ A;  1HNI A;  4KHQ A;  1BIU A;  4JRQ A;  1T05 A;  1S9G A;  3VQ4 A;  4HUG A;  4FM2 A;  2F8S A;  1BIZ A;  3K5M A;  4DU3 A;  4K8X A;  4DQR A;  3PUF A;  3TAQ A;  1TGO A;  4ZTJ A;  3L2W A;  3PX4 A;  4F2R A;  4NYF A;  2IAJ A;  4DFK A;  3CYM A;  5KGW A;  1IKX A;  3LAL A;  3EYZ A;  4CJP A;  2ATQ A;  3KD5 E;  2D0B A;  1ITG A;  2VG6 A;  3ZSR A;  4CJ4 A;  4E0D A;  4AHT A;  1EXQ A;  2KW4 A;  3FFI A;  3ZT2 A;  5J2M A;  2IOC A;  1S6P A;  4G1Q A;  4CK1 A;  4F8R A;  2IDO A;  4NCA A;  1WAJ A;  4CGG A;  3DYA A;  4B08 A;  4DTR A;  3SUO A;  4QCL A;  1KCF A;  1VK0 A;  1JXB A;  4UQG A;  4QAG A;  3DLK A;  3ZSO A;  3U6F A;  3AVN A;  3KLF A;  3LAN A;  4NCG A;  4N47 A;  3LP3 A;  3LWM A;  4FVM A;  4KTQ A;  3OY9 A;  3MXJ A;  5C24 A;  4J2E A;  3QLH A;  4CHY A;  2P1J A;  3I0S A;  2P5G A;  4M3Y A;  2DY4 A;  4FLV A;  4KB1 A;  1RDA A;  1KVC A;  2HNY A;  3AVL A;  4YFU A;  1C1B A;  4CJT A;  4AHS A;  4DU1 A;  3IG1 A;  3HXM A;  4Z4C A;  2E4L A;  3CFP A;  1WLJ A;  1GOA A;  2XO7 A;  1VSH A;  1C1C A;  3DI6 A;  4CJK A;  1QSS A;  3ZT3 A;  1SUQ A;  4OJR A;  4Q0B A;  3M8P A;  3G10 A;  4CGI A;  4EZ6 A;  4B8A B;  4BAC A;  4KI6 A;  1T03 A;  3IS9 A;  4DTM A;  1S1X A;  1TL3 A;  3ISN C;  4LSL A;  4LSN A;  3RMA A;  1WSI A;  4N41 A;  1T7P A;  1JLF A;  1FK9 A;  4FJ5 A;  4LH4 A;  3QEV A;  4CEC A;  1KRP A;  3VQD A;  4HTU A;  4W5T A;  5I3U A;  1B92 A;  3PX0 A;  3MAQ A;  4HHT A;  2G8V A;  4BWJ A;  4RW8 A;  2D0A A;  3ZSZ A;  2ZE2 A;  2XHB A;  4DF4 A;  3KK1 A;  1RDB A;  2Z1J A;  4FJG A;  1DLO A;  4DTN A;  4FM0 A;  4DSF A;  1NJY A;  4M3T A;  3CM6 A;  1ZBF A;  1O1W A;  4H4M A;  5CZ2 A;  3QIN A;  4C8N A;  2O4I A;  3NH1 A;  2KZZ A;  4CIE A;  2VWK A;  1TAQ A;  2G8F A;  4Z4F A;  4K8Z A;  3G0Z A;  1TL1 A;  4B9N A;  3M8R A;  4CJR A;  4CEB A;  1TKT A;  4FZX C;  2GV9 A;  4KRE A;  1SKS A;  1CLQ A;  1L3V A;  3AVI A;  1I3A A;  2EX3 A;  1TVR A;  4ID5 A;  4E7J A;  1NK4 A;  3UIQ A;  4FJL A;  1W9H A;  2RPI A;  1U04 A;  2XY8 A;  4CGF A;  3HPO A;  4DQI A;  4DQS A;  1DTT A;  3WNF A;  5KI6 A;  4CCH A;  4M42 A;  1WSE A;  4RW4 A;  4HCC A;  1NK0 A;  5FRO A;  5T7B A;  3QEP A;  3HP6 A;  3OYN A;  2EHG A;  1RIL A;  3CFR A;  1BIS A;  3NFA A;  1RDC A;  5K14 A;  4DS4 A;  4Y1C A;  1WSJ A;  4CHQ A;  2VWJ A;  4EP5 A;  4N56 A;  2A1R A;  2OA8 A;  1CXU A;  3SCX A;  2BGG A;  4W5Q A;  1Y97 A;  3MEC A;  3V1R A;  4B9M A;  2HHQ A;  3I0R A;  1JLE A;  1HYV A;  1BQM A;  2DFE A;  3NF9 A;  4M45 A;  4KFB A;  3NGY A;  3M8Q A;  4AHV A;  4CJL A;  4GVM A;  1VSD A;  4DTS A;  2FBV A;  2GBZ A;  3AA2 A;  2RN2 A;  2X74 A;  1VSI A;  4E19 A;  3OYE A;  3P83 D;  3VQB A;  1RDD A;  3OYK A;  2F96 A;  4YNQ A;  1ZBH A;  2HHX A;  3VA0 A;  2KZM A;  1JLG A;  2BAN A;  4FM1 A;  4DTX A;  4OKK A;  5JS2 A;  4DSK A;  3MEG A;  3C6T A;  1LAV A;  3V9X A;  1KVA A;  1FXX A;  3TR8 A;  4CK2 A;  4J2A A;  4CJW A;  2BE2 A;  3T1A A;  3NHG A;  5C25 A;  3SQ4 A;  3JSM A;  1BL3 A;  2FBY A;  3DRR A;  2D0C A;  4M3Z A;  3BGR A;  2HHV A;  4BWM A;  3KK3 A;  4DLG A;  2RKI A;  4CJS A;  3D0P A;  2ETJ A;  4L8R B;  1REV A;  5EU7 A;  4FJ8 A;  1HPZ A;  4OKJ A;  2QKK A;  2X6N A;  3AO1 A;  4AHU A;  4CIG A;  1U4B A;  4FK4 A;  3ZT1 A;  3C95 A;  1C0U A;  1NKE A;  1L5U A;  4JS4 A;  1ASV A;  3AO5 A;  3DMJ A;  4CFB A;  3KJV A;  4DFP A;  1TKX A;  3V9Z A;  3SQ1 A;  2KQ2 A;  4FJX A;  4OLA A;  4OVL A;  2HND A;  3ULD A;  4FYD A;  2Y1J A; 
#chains in the Genus database with same CATH topology
 2YI1 A;  4BVP A;  3FGU A;  4IFY A;  5BRD A;  1KLM A;  2VG5 A;  3NF6 A;  1QQM A;  4BGA A;  1D4X A;  1OH7 A;  3K5O A;  3E1Y A;  2HF3 A;  2I5J A;  3TSQ A;  1W7A A;  3F73 A;  1FKP A;  1X3N A;  2D5R A;  4BRK A;  4DUY K;  1MWK A;  5AQO A;  5CYQ A;  5M1N A;  3MXM A;  3T7Z A;  4XEI A;  4A2A A;  4GV9 A;  4BC5 A;  5GAE P;  4YY3 K;  2I7N A;  1JCF A;  4B1Y B;  2O8B A;  1NGE A;  3K2P A;  2JWL A;  1ZC6 A;  5DMR A;  2A6A A;  2P9S A;  3Q7C A;  1JL2 A;  1NJI O;  2HVI A;  1QQO A;  4RW7 A;  2ASM A;  1NMN A;  4PKI A;  1BU6 O;  5E26 A;  2E88 A;  4DV1 K;  3NH0 A;  2OTJ N;  5C2F A;  4I9Q A;  1CZB A;  1C1A A;  2YV0 X;  3EE8 A;  3LPU A;  4H5V A;  2G8K A;  2ITM A;  1U45 A;  1VQ7 N;  4OPK A;  1KC8 O;  1Q9X A;  3HVR A;  3EL2 A;  3CQX A;  4WQ5 C;  2GTD A;  4LF4 K;  4CHN A;  1RT6 A;  4EIA A;  4FJM A;  1SAZ A;  3OBY A;  5AQT A;  3OBW A;  3T1H K;  3NVM A;  5AZI A;  2YHW A;  5DM7 L;  3OS1 A;  1TKD A;  1NU0 A;  4IXC A;  3LZJ A;  3TAP A;  4DSJ A;  4DU4 A;  3EZ5 A;  2W40 A;  2BUP A;  3SUP A;  2F9T A;  4BE2 A;  4O0I A;  3THX B;  3HJF A;  4CGJ A;  4JK8 A;  5AQN A;  4E3S A;  3KD1 E;  5JLF A;  4CHP A;  3OJU A;  3LAM A;  1QE1 A;  2HHT A;  1HNZ K;  1N34 K;  1A5W A;  3A5N C;  2HNZ A;  4O55 A;  4KB0 A;  2QEX N;  1BI4 B;  4WF9 L;  4KTW A;  1M90 O;  1IKW A;  3DXM B;  3P5J A;  4BDP A;  2YHX A;  4KHY A;  2HMP A;  4WQ5 A;  3R1X A;  3RRH A;  5ADX H;  2QW9 A;  4YOW A;  1Q9Y A;  1YAG A;  3NGZ A;  3MEE A;  4O8U A;  2KTQ A;  3IDH A;  4O5F A;  2Z1G A;  4E89 A;  3QEW A;  3G25 A;  5BR8 K;  3V9S A;  4H0T B;  3HM9 A;  4OGE A;  4MDA A;  3OYI A;  5HRS A;  3AVK A;  3FZH A;  3SUQ A;  3KWG A;  3MWP A;  1N32 K;  2DTU A;  4FLY A;  5GAD P;  3F5T A;  4K25 A;  4B3M K;  1E3M A;  3VEZ A;  4PQU A;  2P9S B;  1S5J A;  4U7B A;  3S3M A;  2ASO A;  3SNN A;  5GAG P;  4KV8 A;  1DT9 A;  4FSV A;  1ZYQ A;  1NM1 A;  3HYF A;  1S1T A;  3UE5 A;  5EVZ A;  1QSY A;  1HQU A;  1F21 A;  2QWL A;  2P51 A;  1XQS C;  4CJ5 A;  3TPQ A;  1GLA G;  3CMA N;  4W5O A;  4H4O A;  5FDL A;  3H46 O;  2YHB A;  1YTA A;  4CF0 A;  4JLH A;  2OYQ A;  3HO1 A;  2JGU A;  4FLU A;  1U2V A;  3FLC O;  1YTU A;  3VPZ A;  3L4I A;  3LL3 A;  1D9D A;  3D2E A;  4FW1 A;  3B6O A;  1LV5 A;  1KFD A;  5AQZ A;  3OYJ A;  5HRO A;  3MN6 A;  1N6Q A;  2E8A A;  3BUZ B;  3SQ0 A;  1C6V A;  3CCL N;  4C8K A;  1NNE A;  5LL6 Z;  3SAF A;  2RHK A;  4J2B A;  4CED A;  3THW B;  2UXD K;  2R7Y A;  4JI4 K;  3K59 A;  1LWC A;  3ZSY A;  2IS3 A;  3MED A;  3F9K A;  4IEI A;  4Z4H A;  2G8U A;  2P9U B;  2P5O A;  2A3Z A;  2DFF A;  1YF5 L;  3QBX A;  3EKU A;  1HKC A;  3HZ6 A;  4KRF A;  5I42 A;  5J2Q A;  3AGK A;  3O9T A;  3D2F A;  3OJS A;  3BP8 A;  2WOM A;  3SV3 A;  3IAY A;  2B5J A;  3CQY A;  4CJ3 A;  3TAM A;  4B3S K;  3KTQ A;  4OLB A;  3T1Y K;  4FJ9 A;  3OS2 A;  3HT3 A;  3MN9 A;  3TSP A;  3VQA A;  1TK8 A;  5AQJ A;  4FO0 A;  3VQ7 A;  5AQK A;  1L3T A;  1XWL A;  3L6Q A;  3SUN A;  2A1S A;  2D4W A;  2FF3 B;  1CZA N;  1QVG M;  1UWB A;  1T6C A;  1DTQ A;  3NH2 A;  1SL2 A;  3G71 N;  3IUC A;  2YNG A;  4LD0 A;  3TAF A;  3L2R A;  4H5W A;  1A5X A;  3U9D A;  1HKB A;  1SKW A;  4IFV A;  2F8T A;  4IKF A;  1K8A O;  3AA3 A;  1KAX A;  4HUE A;  1N5Y A;  3EN9 A;  5AQU A;  1JJ2 M;  4BGB A;  4WCE L;  3V6D A;  4CF1 A;  1VSL A;  4CZM A;  4CJE A;  3MDQ A;  3LM2 A;  4O4G A;  1NGF A;  4DV7 K;  2QA4 N;  4M3U A;  4C8O A;  1RT4 A;  4FJI A;  2V51 B;  1KFS A;  3AV9 A;  4DWI A;  4J8F A;  1EKE A;  4RCH A;  2YHA A;  2QI2 A;  2PY5 A;  3K5L A;  4AHR A;  1RGI A;  5JVH L;  1OKJ A;  3VEW A;  3ZYY X;  4JRQ A;  3N4P A;  1BIZ A;  3RVC A;  1LOT B;  2ZJR L;  1MWM A;  3CYM A;  1C0G A;  2O8F B;  3D2E B;  3LDQ A;  4FWM A;  2D0B A;  3OHR A;  3ZSR A;  2ZGZ A;  3JXU A;  4CJ4 A;  2FXU A;  5BR9 A;  3FFI A;  3CXC M;  4G1Q A;  4CK1 A;  4EHT A;  1IV0 A;  1TYQ A;  3SUO A;  1VK0 A;  4UQG A;  4DV0 K;  3CJA A;  2W6K A;  3M3Z A;  3ZSO A;  3J7A P;  3OW2 M;  3CCV N;  1RFQ A;  4CBX A;  4NCG A;  4N47 A;  4KTQ A;  3MXJ A;  3QLH A;  2P5G A;  4M3Y A;  1R59 O;  1RDA A;  2HNY A;  2IVN A;  3AVL A;  1C1B A;  4DU1 A;  3IMX A;  2E4L A;  3CFP A;  4CJK A;  1NGD A;  3ZT3 A;  1QQN A;  1SUQ A;  1QSS A;  4CGI A;  3G10 A;  3I8B A;  1GLL O;  3WUH A;  3FE1 A;  3MN5 A;  3ISN C;  1T7P A;  1JLF A;  2WFB A;  1V4T A;  3VQD A;  4FPA A;  5I3U A;  1VHX A;  2G8V A;  1HPM A;  2XHB A;  4YOT A;  1DLO A;  4DTN A;  3TSU A;  4LFB K;  4BRD A;  3AGR A;  4K8Z A;  4JKG B;  4A5B A;  4B9N A;  3M8R A;  4CZJ A;  4CJR A;  2W41 A;  2OAN A;  4FJL A;  1TVR A;  3WXI A;  2RPI A;  1U04 A;  4JYA K;  2Q31 A;  1RDW X;  4DQS A;  1WSE A;  4BR0 A;  3CFR A;  1BIS A;  1Q82 O;  1RDC A;  4BQZ A;  1WSJ A;  3SCX A;  2WBN A;  3Q7B A;  3VOV A;  3HSC A;  3TU5 A;  4BR5 A;  1BQM A;  3QB0 A;  3CCM N;  3J81 O;  2O8E B;  2E2O A;  1TUU A;  3AA2 A;  2RN2 A;  4R79 A;  2GEM A;  1I94 K;  1RDD A;  3VF6 A;  1P8Z A;  2V52 B;  4NXN K;  2HHX A;  2KZM A;  5JS2 A;  1QHA A;  3MEG A;  3C6T A;  1LAV A;  3TR8 A;  3NHG A;  5C25 A;  3O4W A;  2FBY A;  3DRR A;  5ELZ A;  2H3G X;  5GAH P;  3O6W A;  4L8R B;  1REV A;  4B9Q A;  5F0X A;  2QKK A;  2X6N A;  4AHU A;  2HBK A;  4CIG A;  2GWJ A;  2NRV A;  3OA9 A;  3DMJ A;  3K9K A;  4FJX A;  3V9Z A;  5KQD A;  3N4Q A;  4OLA A;  1EWR A;  4JKA A;  1OH5 A;  4Y1D A;  1GLD G;  4CFC A;  4BC4 A;  3VMF B;  4CK3 A;  1U47 A;  2OPS A;  1WN7 A;  4PWD A;  4H03 B;  1HYS A;  4JKE A;  3LDS A;  1NKB A;  4RW6 A;  1LCU A;  1RNH A;  3AVM A;  4ELV A;  2Q0R A;  4KTZ A;  4JRP A;  4IJA A;  3CCS N;  1LW0 A;  4OGC A;  4GKJ K;  3MX2 A;  3ZT4 A;  4DB3 A;  4JD2 A;  3K9J A;  2XY5 A;  4JKG A;  4IBN A;  4CE9 A;  1U6Z A;  3RSE A;  4ICL A;  3P31 A;  3CFO A;  1S1U A;  3VN5 A;  3OYL A;  3BF1 A;  5HP1 A;  4PA1 A;  3K57 A;  3H08 A;  1QSL A;  3V1O A;  1O13 A;  3DM2 A;  4QS7 A;  2E2Q A;  5AQR A;  3B6P A;  2UUA K;  1RTJ A;  3DOL A;  1DKG D;  1JLA A;  5BRH A;  1NGI A;  1NGH A;  1EWQ A;  4HCB A;  2X6S A;  1Z25 A;  1VQ9 N;  2HMI A;  4BRG A;  4M7X A;  5E41 A;  3SV4 A;  3ENH A;  4BVO A;  3S3O A;  5AQQ A;  1RT5 A;  5BPN A;  1BQN A;  3O3G A;  3R9P A;  1T44 A;  3OTO K;  4K0K K;  4B9S A;  4NB4 A;  4IO8 A;  4E7I A;  1IKV A;  3AVF A;  3AVG A;  5EXW A;  4Y0W A;  2D1K A;  1XC9 A;  4KH6 A;  2GUI A;  3AO4 A;  2UU9 K;  4CZG A;  1KSP A;  5HRR A;  4CJ7 A;  5KTQ A;  4F2S A;  3R8E A;  2ZGY A;  3WNG A;  4BE1 A;  5FPM A;  5D3G A;  1Q8I A;  1HX1 A;  4ISE A;  3MCP A;  5KRS A;  1L3S A;  3D45 A;  2FSJ A;  2NRR A;  2PFU A;  1BA0 A;  4NCB A;  3S41 A;  1WNS A;  4FVU A;  3SBG A;  4F4K A;  2E2N A;  3DRP A;  2P9L B;  3JYT A;  4TSX A;  3HOS A;  4BRN A;  4OPJ A;  2ZWH A;  2OZS A;  1VSF A;  3SMP A;  3VF4 A;  4CEQ A;  3CPE A;  4DV5 K;  4KKO A;  2OZM A;  3DJC A;  4ID1 A;  4CZF A;  1VRT A;  5A2Q O;  4CJQ A;  1TKZ A;  4DTP A;  5AQG A;  1UOC A;  3C65 A;  4NLB A;  4V19 S;  2FBX A;  4DS5 A;  1YI2 N;  4ILJ A;  3HST B;  4F3T A;  2O8E A;  3HBT A;  1ZBI A;  2HHS A;  3ZEU B;  3ZCM A;  4M41 A;  4FJK A;  3QIC A;  4C8M A;  3VGM A;  1GLJ O;  1NK7 A;  3I8D A;  2ITG A;  2B4J A;  3GL1 A;  1NK9 A;  1J5E K;  3QER A;  2QK9 A;  1IG9 A;  2B6A A;  1KLN A;  5J2P A;  4KHW A;  1VQM N;  3CCR N;  1BG3 A;  2UYT A;  1KQS M;  3C6U A;  4IG3 A;  5KGX A;  3HVT A;  1WSF A;  3ID6 A;  3QIP A;  4LF6 K;  3G4S N;  4M7Y A;  4CEO A;  2WTU A;  2XRI A;  3O1W A;  3L4Q A;  5AFU H;  4YDU C;  4YOX A;  3VQ9 A;  4FK0 A;  3KKR A;  4YHH K;  1RBR A;  4DFM A;  5AQY A;  1W2B M;  4OPA A;  1HNW K;  4Q5V A;  1VSK A;  1D5A A;  3NBP A;  4KHP K;  4E1M A;  4KBO A;  3WQU A;  1RTH A;  3KLE A;  1XNR K;  4GV3 A;  1G15 A;  4YDU A;  4DR1 K;  2G8W A;  4H0Y B;  1VQ4 N;  1VQ5 N;  3AY9 A;  3CC4 N;  1VQK N;  4CJU A;  1HNV A;  5AQM A;  2J4R A;  3V1Q A;  3NDK A;  4GY2 B;  4JI2 K;  2Q1N A;  4KI4 A;  4XIU A;  4DTJ A;  3LP0 A;  4H5T A;  1Q18 A;  3AVH A;  2BDP A;  3MK6 A;  3IRX A;  2JWK A;  2NRZ A;  1S1W A;  4AM7 A;  4KB1 A;  3C6H A;  4FW2 A;  3LWL A;  1RBT A;  3S3N A;  1RCH A;  3DXK B;  4PY5 A;  4ELU A;  2EWS A;  3DXM A;  1NWK A;  3OYC A;  1Q7Y O;  2QWN A;  5EY4 A;  4N76 A;  4E7H A;  1SKR A;  1IKY A;  3RMB A;  3VQ8 A;  3TAR A;  3H3O B;  3BZC A;  2P9P B;  3CJ7 A;  3O9R A;  2P9K B;  1HJR A;  4DR2 K;  3OYD A;  1S72 N;  4FWP A;  2GUP A;  1JCE A;  5H1S Q;  2Z1H A;  4JEP A;  2VWB A;  5SWM A;  3LDL A;  1JLQ A;  3F2K A;  1RBU A;  4KHS A;  5AQV A;  1NOY A;  2QTD A;  4B1Z A;  3CCU N;  4H0P A;  1C0T A;  2X78 A;  3OYM A;  1WBD A;  4JD2 B;  3T69 A;  3ZSX A;  3SQ2 A;  4EAH D;  3SJH A;  1LAW A;  1HYZ A;  4IEE A;  2YKN A;  3ZET B;  4K43 A;  3AO2 A;  4IG0 A;  4MO5 A;  1HLU A;  3QEI A;  2UXC K;  4FLX A;  3KK2 A;  1BCM A;  3L2V A;  3O80 A;  4FOE A;  3TWH A;  5DM6 L;  2GX9 A;  3MMV A;  5J2N A;  1ATS A;  4AIL C;  3M1F A;  4CZL A;  1H1V A;  3RR7 A;  3V9W A;  2OCE A;  3L3U A;  4CJF A;  1K73 O;  3K5N A;  4GV6 A;  4FK2 A;  5HL7 L;  3ZX0 A;  3EEQ A;  1S22 A;  4IDK A;  1D9F A;  3CJ1 A;  2I7P A;  2OPP A;  2XY7 A;  1QVF M;  4KHU A;  1HNI A;  1BIU A;  4BRE A;  5JLH A;  3VQ4 A;  5IWA K;  4FM2 A;  3H1Q A;  4XH1 A;  4DU3 A;  3CI5 A;  4K8X A;  3TAQ A;  4ZTJ A;  1VQ6 N;  2HHH K;  2ZF5 O;  3PX4 A;  3U8X A;  2F4V K;  4DFK A;  4DKW A;  4PKG A;  3EYZ A;  2QXL A;  3QDK A;  2DPN A;  4FWO A;  3WXL A;  2IOC A;  1S6P A;  2V7Z A;  4F8R A;  4QCL A;  4DTR A;  3DYA A;  3F9M A;  1BA1 A;  4MLH A;  3DLK A;  3U6F A;  1VQL N;  1HKG A;  4DR3 K;  3LAN A;  3LWM A;  4J2E A;  4CHY A;  2P9K A;  2DY4 A;  1BWF O;  1IBM K;  2P9N B;  4CJT A;  4Z4C A;  1WLJ A;  1JCG A;  2XO7 A;  1NGB A;  4NO7 A;  3SAG A;  4B8A B;  4KI6 A;  4DTM A;  3RMA A;  2A5X A;  4FJ5 A;  1FK9 A;  3VEO A;  3AAQ A;  4W5T A;  4HHT A;  2WUS A;  3O9S A;  2D0A A;  3ZSZ A;  1GLB G;  4DF4 A;  4X65 K;  4FM0 A;  3O08 A;  3QIN A;  4BR7 A;  1TAQ A;  3FZL A;  4Z4F A;  3DWL A;  3TTF A;  2KKZ A;  1TKT A;  4CD1 A;  4FZX C;  1N33 K;  4KRE A;  3AVI A;  3D6R A;  2EX3 A;  3UIQ A;  2IIR A;  4JN4 A;  3THX A;  4CGF A;  2YJF A;  2ASP A;  5KI6 A;  4HCC A;  5FRO A;  5T7B A;  3HP6 A;  3DLL L;  3NFA A;  4DS4 A;  1QZ6 A;  1ESV A;  3O9Q A;  1Y97 A;  1N8R O;  3PSI A;  5EX5 A;  2HST A;  5HRP A;  4M45 A;  4AHV A;  1XMQ K;  2IVP A;  4GVM A;  3EZW A;  4ISG A;  2FBV A;  3VES A;  4QS9 A;  2X74 A;  1VSI A;  3P83 D;  3VQB A;  3OYK A;  2F96 A;  1JLG A;  4FM1 A;  4EHU A;  1FXX A;  4CK2 A;  3UKU B;  4J2A A;  2BE2 A;  4CZE A;  4JK9 A;  2Q36 A;  1BL3 A;  2HHV A;  4IDH A;  4CJS A;  3D0P A;  2ETJ A;  2NLX A;  5EU7 A;  4YOR A;  5BPM A;  2O8B B;  1YJN N;  1U4B A;  4FK4 A;  3ZT1 A;  5FPN A;  3E9P A;  3CCJ N;  3C95 A;  1C0U A;  1ASV A;  4IOA L;  3SQ1 A;  4JKF A;  3JAM O;  4RTF D;  3ULD A;  4DF8 A;  2Y1J A;  4DSI A;  4B1V A;  3PSF A;  4M3X A;  4O8K A;  3CJ9 A;  3LAK A;  3MWT A;  4CJV A;  3NF8 A;  1X9S A;  4WQ4 A;  4DUZ K;  3QML A;  3EY1 A;  4H0O A;  3AVB A;  2NRW A;  2ZM6 K;  4I6M B;  1S9E A;  5CE3 A;  3QFU A;  4ZHR A;  1ILY A;  1B9D A;  2A41 A;  4EFH A;  3OYB A;  2G8I A;  4CES A;  4JI3 K;  3VA3 A;  1XHZ A;  3ZT0 A;  5TKY A;  1VQN N;  3HRG A;  5GIO A;  2D0P A;  3OYH A;  4DMN A;  1P90 A;  4JI8 K;  3TI0 A;  1S6Q A;  2CGK A;  3PX6 A;  4NYN A;  4E1N A;  1I39 A;  4ELT A;  2FBT A;  2PYJ A;  4FJJ A;  4FWR A;  2LSN A;  1MU2 A;  3HPH A;  4LH5 A;  3ZSV A;  1SQK A;  4FJN A;  4C1N K;  1XUP O;  3WXK A;  1A5V A;  3QNO A;  4LF7 K;  3NMU A;  4ZTF A;  5GIP A;  4LFC K;  4DR5 K;  1NKC A;  3L8B A;  4DV2 K;  2KFN A;  4KPY A;  3CET A;  3S9H A;  3T19 A;  3DLG A;  4CHO A;  3CF5 L;  2FSK A;  1KD1 O;  1RBS A;  1HRH A;  5LJW A;  3LDN A;  3VEN A;  4FLW A;  1VSE A;  1HMV A;  1W97 L;  5CYM A;  3OS0 A;  1Z26 A;  1W0H A;  1JL1 A;  4PUO A;  4ILH A;  4JNE A;  1N36 K;  3E01 A;  2NRX A;  4JKH A;  4EZ9 A;  2YNH A;  3H3N O;  3ZSW A;  3OVN A;  3U3G A;  1U48 A;  4QS8 A;  4LF8 K;  1HJO A;  4DTO A;  3KK7 A;  1L3U A;  3SBT A;  3RR8 A;  2AA4 A;  4FWQ A;  3QIO A;  3THW A;  1NOZ A;  2V7Y A;  1NMD A;  1G99 A;  1VQP N;  1VSJ A;  1EO1 A;  4Z4I A;  3LP2 A;  4FLZ A;  4JI0 K;  5EOY A;  3GG4 A;  3DRS A;  5AQI A;  3KLI A;  3KVG A;  1T8E A;  4KAZ A;  3MXI A;  4CF2 A;  5KPR A;  1VQ8 N;  4CGD A;  1KVB A;  5HLF A;  3PIP L;  1JLC A;  1E4F T;  3CD6 N;  1J9A A;  3ZX3 A;  3PY8 A;  1MDU B;  3C94 A;  4DQQ A;  3OYF A;  3SPZ A;  4DSL A;  5FRN A;  4X66 K;  1NK8 A;  1WBB A;  1ZXO A;  3A0I X;  4W5N A;  1UA0 A;  4DR6 K;  3QFP A;  1VQO N;  1WOQ A;  2CGL A;  1SL1 A;  3GOI A;  4EP4 A;  4CVN E;  5AFU A;  5JS1 A;  3A2F A;  2HOE A;  3P4I A;  5BN8 A;  1J5O A;  4BDZ A;  3ZX2 A;  1RT1 A;  1NG9 A;  1SS6 A;  5KRT A;  5MLC Q;  2O8F A;  3EO3 A;  1OH6 A;  1Z05 A;  3AVJ A;  4FWL A;  5AQF A;  1T3V A;  1JKH A;  5BPL A;  4B9L A;  3LZI A;  5M1P A;  2O8D B;  5J1E A;  3DLR A;  1OVY A;  4O0J A;  4M3R A;  3VQP A;  5HBM A;  4A59 A;  4FLT A;  3RMC A;  1TAU A;  3THY A;  2O4G A;  2UUB K;  1V4S A;  4DV3 K;  4E7L A;  3CJB A;  5B8H A;  4FJH A;  2RF2 A;  4CGH A;  2QWQ A;  3FR0 A;  1K8K B;  4FWS A;  1IO2 A;  4FWN A;  2VG7 A;  2ZJP L;  1ASW A;  5JMV A;  1UAX A;  4LF5 K;  5CR4 A;  3AA4 A;  3EE9 A;  3G6E N;  4E7K A;  4FZZ A;  4DHY A;  4CZI A;  1GOC A;  5TKW A;  4WYB A;  3O3H A;  2Y1I A;  4BR9 A;  2VCP A;  1SZ2 A;  4BC2 A;  4I2Q A;  3AA5 X;  3U3Y A;  4DQP A;  3ATU A;  2VGM A;  5FRM A;  4RW9 A;  3J80 O;  3RMD A;  2XY6 A;  3NGI A;  4B3R K;  3L3V A;  3NAE A;  2DFH A;  4GW6 A;  1GLC G;  3MX5 A;  2NUB A;  2KFZ A;  1GOB A;  3ZSQ A;  1FJG K;  3BY5 A;  1EX4 A;  1ATR A;  3O1B A;  5M1Q A;  2FC0 A;  4YOY A;  5M1O A;  4C8L A;  2HF4 A;  3SPY A;  3C0B A;  1RT3 A;  2GWK A;  2UUC K;  4JI7 K;  4HUF A;  3TAG A;  3FZK A;  4CFD A;  3QEX A;  3ID8 A;  3SI6 A;  1Z6R A;  3VGL A;  3NCI A;  3QBW A;  2E1Z A;  2IC3 A;  2HB5 A;  4CF8 A;  4BE0 A;  2QXF A;  1YHQ N;  3BDP A;  4G9Z A;  3OYA A;  4DV4 K;  4A62 A;  5IT9 O;  3VQC A;  3CM5 A;  4B9U A;  2ZD1 A;  3ENB A;  3TAN A;  3ITH A;  4Z0U A;  1BI4 A;  4AHC A;  3BZK A;  1BDG A;  2F9W A;  4LF9 K;  3RRG A;  3DXK A;  5GIN A;  5LY3 A;  3GE1 A;  5C10 A;  4JKD A;  2JLE A;  4CEZ A;  1VSM A;  4K42 A;  5C42 A;  1RDU A;  5F2R A;  4DV6 K;  2P9I B;  1UA1 A;  3CG7 A;  5BRF A;  2Z1I A;  4OKE A;  4B1U B;  3A8Y A;  3L2Q A;  3VQE A;  1IJJ A;  3ULE A;  2E6L A;  4JS5 A;  4FWK A;  4AF1 A;  1YXQ A;  1IBL K;  4IJN A;  4BDY A;  4CBU A;  2IGI A;  1DEJ A;  1T05 A;  4HUG A;  1TGO A;  3L2W A;  5C15 A;  4NYF A;  4F2R A;  2P9I A;  5KGW A;  1IKX A;  3U9Z A;  2VYP A;  3KD5 E;  4BG9 A;  2FLO A;  2VG6 A;  4E0D A;  4H5R A;  5ADX A;  1YJW N;  3JS6 A;  1BUP A;  4DR4 K;  2HBL A;  4AHT A;  1YJ9 N;  1EXQ A;  2KW4 A;  3ZT2 A;  2IDO A;  3VTH A;  1WAJ A;  3UKR B;  4ISF A;  4B08 A;  1KCF A;  1JXB A;  3CER A;  3A5O C;  3KLF A;  4CI6 A;  5AZJ B;  4FVM A;  3OY9 A;  5C24 A;  3CCE N;  4WQ4 C;  3PIO L;  4AHS A;  4OX9 K;  1WUA A;  1MA9 B;  3IG1 A;  3HXM A;  2IVO A;  1VSH A;  3VF2 A;  3DI6 A;  4Q0B A;  3UKU A;  4OJR A;  4EZ6 A;  2YX6 A;  3IS9 A;  2QWO A;  1WSI A;  3P38 A;  1GLF O;  4PHT X;  3BEX A;  4CEC A;  4HTU A;  3PX0 A;  3MAQ A;  2NZT A;  4BWJ A;  4RW8 A;  5AQS A;  3KK1 A;  1RDB A;  4FJG A;  4M3T A;  3J7Y P;  1ZBF A;  1O1W A;  4H4M A;  4JAX A;  5CZ2 A;  3RSE B;  2O4I A;  3NH1 A;  4CIE A;  2VWK A;  4BRH A;  4BRQ A;  3SMS A;  2WC9 A;  2Q0U A;  3I55 N;  5AR0 A;  4CEB A;  4LC9 B;  2GV9 A;  1CLQ A;  1SKS A;  1L3V A;  4ID5 A;  1NK4 A;  1W9H A;  2XY8 A;  4DQI A;  2A40 A;  1DTT A;  3WNF A;  2E2P A;  4CCH A;  4XH4 A;  1NK0 A;  4DCH A;  2EHG A;  1K8K A;  4CD3 A;  4BRL A;  4A5A A;  4CHQ A;  2VWJ A;  4N56 A;  2A1R A;  2OA8 A;  1CXU A;  4LFA K;  1YVN A;  1IBK K;  3MEC A;  1NGG A;  3EKS A;  3I0R A;  4JHD B;  1HYV A;  3NF9 A;  3HTV A;  4KFB A;  3NGY A;  5AZI B;  1VSD A;  2GBZ A;  4HTL A;  4E19 A;  1U2V B;  3BF3 A;  1YUW A;  3HOT A;  3GDQ A;  4JI6 K;  2BAN A;  4X62 K;  4DTX A;  4OKK A;  3V9X A;  3C7N A;  3LDP A;  3SQ4 A;  4OPH A;  4M3Z A;  3BGR A;  3KK3 A;  1IG8 A;  4GVE A;  2FSN A;  4IOC L;  4FJ8 A;  4OKJ A;  3SAH A;  2E1Y A;  1TYQ B;  3A5L C;  3FFK B;  3KJV A;  3AO5 A;  4CFB A;  1TKX A;  3A5M C;  2KQ2 A;  4OVL A;  2HND A;  3VTI A;  1J6Z A;  4WFN L;  1K9M O;  4KHN A;  1TV6 A;  1J53 A;  4I7F A;  1WSH A;  4W5R A;  4CZK A;  3M8S A;  3NF7 A;  1J54 A;  2Q3S A;  4BY9 C;  2ZJQ L;  4MQ3 A;  1EP4 A;  5KPT A;  5C0Y A;  4B1X B;  4CEE A;  3NE6 A;  3O3F A;  3VET A;  1C0M A;  3AVC A;  2O8C A;  1LW2 A;  3UKR A;  3QES A;  2FF6 A;  3KKS A;  3VQ6 A;  1BGX T;  3ZET A;  4JV5 K;  1BOT O;  2P9U A;  1RTI A;  1X1P A;  4HVJ A;  4F3O A;  1SV5 A;  3R3L A;  4CHZ A;  3SYZ A;  3CQ8 A;  1QTM A;  2E6M A;  2QKB A;  4WFA L;  1QZ5 A;  5LMN K;  4H0X B;  3K58 A;  3TTC A;  2YJE A;  3KWI A;  3PLA A;  2E5L K;  3HL8 A;  4Z4G A;  4PL7 A;  4I6M A;  2G8H A;  3B8A X;  2PBD A;  2QWR A;  1E4G T;  4U67 L;  3DLE A;  3SJJ A;  1BCO A;  5C12 A;  4BC3 A;  5CY4 A;  3V81 A;  3O8M A;  3THY B;  4MLE A;  4FOI A;  5AZJ A;  3DLH A;  3ATV A;  4FXD A;  4B9T A;  3J7Z O;  1R0A A;  4BRO A;  3CJC A;  5LMU K;  3PO4 A;  2GEL A;  1YT3 A;  3HM8 A;  4CER A;  1TK0 A;  3GBT A;  1B9F A;  3H1V X;  4CFA A;  3AAP A;  1U49 A;  1QS4 A;  5AQW A;  1WB9 A;  3ENO A;  3CIP A;  2WON A;  1FKO A;  3ALY A;  1ZBL A;  4AM6 A;  4B3T K;  1Q81 O;  3O4Q A;  4O44 A;  1X3M A;  3VEX A;  3MN7 A;  3E9O A;  4C23 A;  2PAV A;  4N5S A;  4MFB A;  2NRH A;  5KQ8 A;  3MCA B;  3I33 A;  4M63 C;  4LY7 A;  1RBV A;  4BQL A;  4PL8 A;  4ILG B;  1SL0 A;  3CC7 N;  1LWF A;  3WT0 A;  1BHL A;  1RT7 A;  4CF9 A;  4GNI A;  4CIF A;  1HQE A;  2NNW A;  3TAE A;  5BN9 A;  3C7N B;  3VQ5 A;  4X64 K;  3KLG A;  3HPG A;  3HP9 A;  2HW3 A;  3KHY A;  1ZBS A;  1JXE A;  3J8A A;  5FLX O;  3PO5 A;  3QET A;  4FZY A;  1NJZ A;  4K41 A;  4I2P A;  3AVA A;  3QNN A;  1NGC A;  1QQC A;  5E84 A;  1XHX A;  4O5B A;  2YNI A;  5KPZ A;  1NLV A;  5CHI A;  4A61 A;  4L3Q A;  3U4L A;  3D7E O;  2OPQ A;  2YCH A;  4B3O A;  3VGK A;  4J2D A;  4BRM A;  3O9U A;  3PV8 A;  2HHW A;  3LM9 A;  4BRP A;  4IOX A;  4CEA A;  3LPT A;  1XI1 A;  4M3W A;  1VAZ A;  3V9U A;  3TAB A;  3CHW A;  1TK5 A;  1CXQ A;  4FJ7 A;  4DG1 A;  3T3F A;  2VGN A;  5F1X A;  1IH7 A;  4NLC A;  1NK6 A;  3IKM A;  4H8K A;  2CH6 A;  4YOV A;  3V4I A;  2HBJ A;  4MDB A;  2YKM A;  1X9M A;  3ZLJ A;  3SZ2 A;  2NRT A;  1LWE A;  4IFE A;  3WNH A;  2HHU A;  4CEF A;  4DTU A;  4BR4 A;  3VER A;  5SZT A;  1QHT A;  4AH9 A;  4NXM K;  3CME N;  2O8C B;  3AAR A;  3KIO A;  3L0Q A;  2VQE K;  3THV A;  4IWV A;  1ASU A;  5FPE A;  1KAY A;  4B8C A;  1KTQ A;  3L2U A;  1OVQ A;  1HUX A;  4R5P A;  3KZB A;  1WAF A;  5LJV A;  1YIT N;  3NVK A;  3C6A A;  4DQ8 A;  2ZQB A;  2PYL A;  3D2F B;  2AJQ A;  4E1J A;  3P1G A;  3LP1 A;  1YVU A;  3IFR A;  1KXP A;  4HWI A;  5FPD A;  1JLB A;  1S1V A;  4F9O A;  3ASM A;  2YNF A;  3WEE A;  1D8Y A;  1Q86 O;  1ZBU A;  4UY8 O;  3AO3 A;  4C1N I;  2OPR A;  2QM1 A;  5CZ1 A;  4CZH A;  5AQH A;  2P9N A;  3HK2 A;  3RWU A;  2KHO A;  2VQF K;  4JI5 K;  3VQQ A;  4DSE A;  4KO0 A;  2W42 A;  3KLH A;  1NJW A;  1VRU A;  4FL9 A;  3DLB A;  5AQL A;  1NK5 A;  2BH1 A;  4CBW A;  1TUY A;  2CH5 A;  3FZM A;  4Z4E A;  1DGK N;  4B9V A;  3DOK A;  1Y64 A;  4YOU A;  3SK3 A;  5DK5 A;  3R6M A;  1WSG A;  3W0L A;  4H5N A;  2RE2 A;  2PZS A;  4PKH A;  3RTV A;  1RTD A;  3M6G A;  4QOZ B;  1HR0 K;  3ZEU A;  5HRN A;  5M1F A;  3OYG A;  1EET A;  4FCY A;  4A2B A;  4WE1 A;  3O4N A;  1CZ9 A;  3CCQ N;  1X9W A;  4GMJ B;  4DLE A;  1NJX A;  4BRF A;  3W3D A;  4RG8 A;  1K6Y A;  1S3X A;  5BRE A;  3QO9 A;  3WEE B;  5JVG L;  4OO1 J;  4BRI A;  3I56 N;  2QWP A;  1RT2 A;  4BRA A;  2O8D A;  4I9L A;  4XH5 A;  5AJ3 K;  3WNE A;  4DFJ A;  4KHQ A;  3P39 A;  1S9G A;  4WFB L;  3E9L A;  3E66 A;  2F8S A;  3K5M A;  1BO5 O;  4DQR A;  3PUF A;  2P9P A;  2IAJ A;  3LDO A;  3LAL A;  2A42 A;  4CJP A;  2ATQ A;  1ITG A;  1XMO K;  1NGJ A;  4RWT A;  3VEV A;  4B1W B;  5J2M A;  2HBM A;  4NCA A;  2HVH A;  4CGG A;  5I9E B;  4FPB A;  3ULE B;  1XC3 A;  3H6E A;  4QAG A;  3AVN A;  4KH4 A;  3LP3 A;  5HOO A;  4CW7 B;  2P1J A;  3I0S A;  4FLV A;  4JHD A;  1KVC A;  4BRC A;  4YFU A;  4BR2 A;  1HNX K;  1GOA A;  4KH5 A;  1C1C A;  1T6D A;  3M8P A;  3WQT A;  1EQY A;  2F7T A;  5JIC A;  4BAC A;  1T03 A;  3WXJ A;  2CGJ A;  1S1X A;  1TL3 A;  3K0S A;  4LSL A;  4LSN A;  4N41 A;  4DR7 K;  2AP1 A;  4LH4 A;  4MO4 A;  4AQY K;  3QEV A;  1KRP A;  4JKC A;  1B92 A;  4A57 A;  2W6L A;  1C0F A;  2E20 A;  5AQX A;  2ZE2 A;  2Z1J A;  2UXB K;  5AQP A;  2D0O A;  4DSF A;  1NJY A;  3CM6 A;  4H0V B;  3HI0 A;  4C8N A;  5M1K A;  1YIJ N;  2KZZ A;  2BTF A;  2G8F A;  3VEY A;  3G0Z A;  1TL1 A;  3H45 C;  1I3A A;  4E7J A;  3FZF A;  4JI1 K;  3HPO A;  1KAZ A;  2QWM A;  4M42 A;  4IZ9 A;  4RW4 A;  4Z94 A;  3QEP A;  2Q97 A;  3OYN A;  3TTD A;  2OTL N;  1GLE G;  1RIL A;  5K14 A;  4Y1C A;  4JK7 A;  4EP5 A;  1X9J A;  3O5B A;  2BGG A;  1ATN A;  4W5Q A;  1NBW A;  3V1R A;  1FW6 A;  4B9M A;  2HHQ A;  2YHY A;  1JLE A;  2DFE A;  3M8Q A;  4CJL A;  4DTS A;  3DAW A;  1XNQ K;  2KLA A;  4IO9 L;  3OYE A;  3CPW M;  2P9L A;  3M5R A;  4YNQ A;  1ZBH A;  3VA0 A;  3SLC A;  4DSK A;  1KVA A;  1NGA A;  4CJW A;  3T1A A;  3JSM A;  2D0C A;  1OH8 A;  4BWM A;  4DLG A;  2RKI A;  4JKB A;  2Q2R A;  1HPZ A;  3WXM B;  3UB5 A;  3AO1 A;  5C2D A;  1NKE A;  1L5U A;  4JS4 A;  4DFP A;  4GKK K;  1M1K O;  3CC2 N;  4BG8 A;  4FYD A; 
#chains in the Genus database with same CATH homology
 4DSI A;  4IFY A;  4KHN A;  4M3X A;  1KLM A;  4Y1D A;  1TV6 A;  3LAK A;  4CFC A;  1J53 A;  2VG5 A;  3NF6 A;  4CJV A;  3NF8 A;  1X9S A;  4I7F A;  1WSH A;  3K5O A;  4W5R A;  3M8S A;  4CK3 A;  1U47 A;  2I5J A;  2OPS A;  3NF7 A;  1WN7 A;  4PWD A;  1HYS A;  3EY1 A;  1J54 A;  3LDS A;  2Q3S A;  3AVB A;  4RW6 A;  1NKB A;  4MQ3 A;  1FKP A;  3F73 A;  1EP4 A;  1RNH A;  3AVM A;  4ELV A;  4CEE A;  2D5R A;  1S9E A;  4KTZ A;  3NE6 A;  4ZHR A;  3O3F A;  5CYQ A;  4JRP A;  1B9D A;  1C0M A;  3AVC A;  3MXM A;  1LW0 A;  4OGC A;  3OYB A;  1LW2 A;  3ZT4 A;  3QES A;  3VQ6 A;  3KKS A;  1BGX T;  3K2P A;  2XY5 A;  5DMR A;  2G8I A;  4IBN A;  4CES A;  1RTI A;  4CE9 A;  3VA3 A;  1JL2 A;  1XHZ A;  3ZT0 A;  2HVI A;  1X1P A;  4RW7 A;  4HVJ A;  4ICL A;  1SV5 A;  3CFO A;  1S1U A;  3VN5 A;  4CHZ A;  3SYZ A;  4F3O A;  3OYL A;  3CQ8 A;  5HP1 A;  4PA1 A;  3OYH A;  4DMN A;  3H08 A;  3K57 A;  1QTM A;  1QSL A;  2E6M A;  3NH0 A;  2QKB A;  3TI0 A;  3V1O A;  1S6Q A;  4I9Q A;  1CZB A;  3PX6 A;  1C1A A;  4NYN A;  4E1N A;  2YV0 X;  3DM2 A;  3K58 A;  1I39 A;  3B6P A;  1RTJ A;  3DOL A;  3LPU A;  4ELT A;  2G8K A;  1JLA A;  1U45 A;  2FBT A;  2PYJ A;  4OPK A;  4FJJ A;  1Q9X A;  4HCB A;  3HVR A;  2X6S A;  1Z25 A;  2HMI A;  2LSN A;  1MU2 A;  3HL8 A;  3HPH A;  4Z4G A;  5E41 A;  4LH5 A;  3ZSV A;  4CHN A;  1RT6 A;  3SV4 A;  2G8H A;  4FJN A;  3S3O A;  1RT5 A;  4FJM A;  1A5V A;  3QNO A;  3DLE A;  3SJJ A;  4ZTF A;  1BCO A;  1BQN A;  3O3G A;  3V81 A;  5CY4 A;  3OS1 A;  1TKD A;  1NKC A;  3L8B A;  2KFN A;  3LZJ A;  4KPY A;  3S9H A;  3T19 A;  3TAP A;  3DLG A;  4B9S A;  4DU4 A;  4CHO A;  4DSJ A;  4E7I A;  3EZ5 A;  1IKV A;  3DLH A;  3AVF A;  3AVG A;  1XC9 A;  3SUP A;  1RBS A;  1HRH A;  4BE2 A;  4FXD A;  2GUI A;  4B9T A;  4O0I A;  3AO4 A;  4FLW A;  3HJF A;  1VSE A;  4CGJ A;  1R0A A;  1KSP A;  1HMV A;  5CYM A;  5HRR A;  3OS0 A;  1Z26 A;  5KTQ A;  1W0H A;  1JL1 A;  4E3S A;  3PO4 A;  3KD1 E;  4PUO A;  4F2S A;  4CHP A;  3OJU A;  3E01 A;  3LAM A;  1QE1 A;  3WNG A;  2HHT A;  4EZ9 A;  1YT3 A;  2YNH A;  4CER A;  1TK0 A;  3ZSW A;  4BE1 A;  1A5W A;  1B9F A;  5D3G A;  4CFA A;  3OVN A;  3U3G A;  1Q8I A;  2HNZ A;  1U48 A;  1U49 A;  4O55 A;  4DTO A;  4KB0 A;  5KRS A;  1QS4 A;  1L3S A;  1L3U A;  3D45 A;  1BI4 B;  3RR8 A;  4KTW A;  3QIO A;  1IKW A;  4NCB A;  1NOZ A;  2WON A;  3P5J A;  1FKO A;  3ALY A;  1ZBL A;  4BDP A;  4KHY A;  3O4Q A;  1VSJ A;  4O44 A;  1WNS A;  4N5S A;  3LP2 A;  3RRH A;  4F4K A;  4FLZ A;  4Z4I A;  3DRP A;  4MFB A;  3JYT A;  1Q9Y A;  4TSX A;  3NGZ A;  3DRS A;  3MEE A;  3KLI A;  4OPJ A;  1T8E A;  4KAZ A;  2KTQ A;  3MXI A;  4CF2 A;  2Z1G A;  4E89 A;  3QEW A;  2OZS A;  1VSF A;  1KVB A;  4LY7 A;  1RBV A;  4CEQ A;  4CGD A;  3V9S A;  1SL0 A;  3HM9 A;  4KKO A;  1LWF A;  2OZM A;  5HLF A;  1BHL A;  1RT7 A;  4ID1 A;  4CF9 A;  4OGE A;  4CIF A;  1JLC A;  1HQE A;  3TAE A;  3OYI A;  1J9A A;  5HRS A;  3AVK A;  1VRT A;  3PY8 A;  3VQ5 A;  3C94 A;  4DQQ A;  3SUQ A;  2DTU A;  3OYF A;  3KLG A;  3SPZ A;  4FLY A;  4CJQ A;  3HPG A;  4DSL A;  1NK8 A;  5FRN A;  3HP9 A;  2HW3 A;  1TKZ A;  1JXE A;  4W5N A;  3PO5 A;  4PQU A;  4DTP A;  1UA0 A;  1UOC A;  3QET A;  4FZY A;  1NJZ A;  2FBX A;  1S5J A;  4DS5 A;  3S3M A;  4I2P A;  3SNN A;  3AVA A;  3QNN A;  3HST B;  1SL1 A;  4F3T A;  1ZBI A;  1QQC A;  4KV8 A;  4EP4 A;  1XHX A;  4O5B A;  2HHS A;  3ZCM A;  4M41 A;  2YNI A;  5JS1 A;  3A2F A;  4FJK A;  2HVH A;  1ZYQ A;  3HYF A;  4C8M A;  1NK7 A;  3I8D A;  1S1T A;  1J5O A;  2ITG A;  4BDZ A;  2OPQ A;  1RT1 A;  1QSY A;  1HQU A;  1F21 A;  2B4J A;  5KRT A;  1NK9 A;  4B3O A;  2P51 A;  4CJ5 A;  4J2D A;  3QER A;  2QK9 A;  3AVJ A;  1IG9 A;  4W5O A;  3PV8 A;  2HHW A;  2B6A A;  4H4O A;  5FDL A;  4CEA A;  1KLN A;  1JKH A;  5J2P A;  3LPT A;  4KHW A;  1XI1 A;  2YHB A;  1YTA A;  4CF0 A;  4B9L A;  4M3W A;  3LZI A;  3V9U A;  3TAB A;  5J1E A;  4JLH A;  3DLR A;  2OYQ A;  3HO1 A;  3C6U A;  4IG3 A;  4O0J A;  1TK5 A;  4M3R A;  2JGU A;  5KGX A;  4FLU A;  3VQP A;  1CXQ A;  3HVT A;  5HBM A;  1WSF A;  3QIP A;  4DG1 A;  4FLT A;  3T3F A;  4FJ7 A;  1IH7 A;  3RMC A;  1TAU A;  4CEO A;  1YTU A;  2O4G A;  1NK6 A;  2XRI A;  4E7L A;  4H8K A;  3V4I A;  1D9D A;  3VQ9 A;  4FK0 A;  3KKR A;  4FW1 A;  3B6O A;  4FJH A;  1LV5 A;  1KFD A;  1RBR A;  2RF2 A;  4CGH A;  4DFM A;  3OYJ A;  2YKM A;  5HRO A;  1X9M A;  3SZ2 A;  1IO2 A;  4Q5V A;  1LWE A;  1D5A A;  1VSK A;  2VG7 A;  3NBP A;  3WNH A;  1N6Q A;  2HHU A;  4CEF A;  4E1M A;  1C6V A;  4DTU A;  3SQ0 A;  1ASW A;  4C8K A;  1RTH A;  5SZT A;  1QHT A;  1UAX A;  4AH9 A;  3AA4 A;  3KLE A;  3KIO A;  4E7K A;  4FZZ A;  4J2B A;  1G15 A;  4CED A;  1GOC A;  3THV A;  2G8W A;  2R7Y A;  3K59 A;  1LWC A;  3O3H A;  2Y1I A;  1ASU A;  2IS3 A;  3MED A;  3ZSY A;  4CJU A;  1HNV A;  3F9K A;  3V1Q A;  4Z4H A;  4I2Q A;  2G8U A;  3AA5 X;  3NDK A;  3U3Y A;  2P5O A;  4DQP A;  4B8C A;  2DFF A;  1KTQ A;  3L2U A;  4KI4 A;  4XIU A;  4R5P A;  5FRM A;  4DTJ A;  1WAF A;  3LP0 A;  4RW9 A;  3RMD A;  4KRF A;  2XY6 A;  3NGI A;  3AVH A;  2ZQB A;  5HRP A;  2BDP A;  3IRX A;  2PYL A;  3L3V A;  1S1W A;  3NAE A;  2DFH A;  3P1G A;  4GW6 A;  2AJQ A;  3LP1 A;  1YVU A;  2NUB A;  5J2Q A;  4FW2 A;  3LWL A;  5I42 A;  1RBT A;  3S3N A;  1RCH A;  3OJS A;  2KFZ A;  1GOB A;  3ZSQ A;  2WOM A;  3SV3 A;  1JLB A;  3IAY A;  1S1V A;  1EX4 A;  2B5J A;  3ASM A;  2FC0 A;  2YNF A;  1D8Y A;  4CJ3 A;  4PY5 A;  3TAM A;  4ELU A;  3KTQ A;  4C8L A;  4OLB A;  1ZBU A;  3OYC A;  3SPY A;  3AO3 A;  1RT3 A;  2OPR A;  5CZ1 A;  4N76 A;  3OS2 A;  4FJ9 A;  3HT3 A;  4E7H A;  4HUF A;  1IKY A;  1SKR A;  3VQA A;  1TK8 A;  3TAG A;  3VQ8 A;  4CFD A;  3RMB A;  3TAR A;  3HK2 A;  3QEX A;  3RWU A;  3VQ7 A;  3SI6 A;  1HJR A;  3NCI A;  3OYD A;  2IC3 A;  1L3T A;  3VQQ A;  1XWL A;  2HB5 A;  4KO0 A;  4CF8 A;  2W42 A;  4DSE A;  3SUN A;  3KLH A;  2A1S A;  4BE0 A;  4DF8 A;  2QXF A;  2Z1H A;  1NJW A;  1VRU A;  3DLB A;  3BDP A;  1UWB A;  3OYA A;  1NK5 A;  1DTQ A;  5SWM A;  3NH2 A;  1SL2 A;  3VQC A;  3CM5 A;  4B9U A;  2ZD1 A;  2YNG A;  3TAN A;  1JLQ A;  4LD0 A;  3ITH A;  1RBU A;  4Z4E A;  4Z0U A;  1BI4 A;  4AHC A;  3L2R A;  3DOK A;  3TAF A;  4B9V A;  4KHS A;  1A5X A;  5DK5 A;  1NOY A;  3RRG A;  1WSG A;  1SKW A;  1C0T A;  4IFV A;  2X78 A;  4IKF A;  3OYM A;  2F8T A;  2PZS A;  3ZSX A;  3RTV A;  3AA3 A;  3SQ2 A;  4HUE A;  1RTD A;  1N5Y A;  4QOZ B;  1LAW A;  1HYZ A;  2JLE A;  2YKN A;  4CEZ A;  5HRN A;  3AO2 A;  4IG0 A;  1EET A;  1VSM A;  3OYG A;  4FCY A;  3QEI A;  4FLX A;  3KK2 A;  1BCM A;  3V6D A;  3L2V A;  4WE1 A;  5C42 A;  3O4N A;  4CF1 A;  3TWH A;  1VSL A;  1CZ9 A;  1X9W A;  4GMJ B;  4DLE A;  5J2N A;  4AIL C;  1NJX A;  4CJE A;  4RG8 A;  1UA1 A;  1K6Y A;  4O4G A;  3CG7 A;  3RR7 A;  4M3U A;  4C8O A;  3V9W A;  3QO9 A;  2Z1I A;  4OKE A;  4CJF A;  3L3U A;  1RT4 A;  3K5N A;  4FJI A;  3L2Q A;  4FK2 A;  1KFS A;  3AV9 A;  3VQE A;  4DWI A;  1EKE A;  2E6L A;  4JS5 A;  1RT2 A;  4IDK A;  4I9L A;  2YHA A;  1D9F A;  4BDY A;  2PY5 A;  2IGI A;  3K5L A;  2OPP A;  3WNE A;  4AHR A;  2XY7 A;  4KHU A;  4DFJ A;  1HNI A;  4KHQ A;  1BIU A;  4JRQ A;  1T05 A;  1S9G A;  3VQ4 A;  4HUG A;  4FM2 A;  2F8S A;  1BIZ A;  3K5M A;  4DU3 A;  4K8X A;  4DQR A;  3PUF A;  3TAQ A;  1TGO A;  4ZTJ A;  3L2W A;  3PX4 A;  4F2R A;  4NYF A;  2IAJ A;  4DFK A;  3CYM A;  5KGW A;  1IKX A;  3LAL A;  3EYZ A;  4CJP A;  2ATQ A;  3KD5 E;  2D0B A;  1ITG A;  2VG6 A;  3ZSR A;  4CJ4 A;  4E0D A;  4AHT A;  1EXQ A;  2KW4 A;  3FFI A;  3ZT2 A;  5J2M A;  2IOC A;  1S6P A;  4G1Q A;  4CK1 A;  4F8R A;  2IDO A;  4NCA A;  1WAJ A;  4CGG A;  3DYA A;  4B08 A;  4DTR A;  3SUO A;  4QCL A;  1KCF A;  1VK0 A;  1JXB A;  4UQG A;  4QAG A;  3DLK A;  3ZSO A;  3U6F A;  3AVN A;  3KLF A;  3LAN A;  4NCG A;  4N47 A;  3LP3 A;  3LWM A;  4FVM A;  4KTQ A;  3OY9 A;  3MXJ A;  5C24 A;  4J2E A;  3QLH A;  4CHY A;  2P1J A;  3I0S A;  2P5G A;  4M3Y A;  2DY4 A;  4FLV A;  4KB1 A;  1RDA A;  1KVC A;  2HNY A;  3AVL A;  4YFU A;  1C1B A;  4CJT A;  4AHS A;  4DU1 A;  3IG1 A;  3HXM A;  4Z4C A;  2E4L A;  3CFP A;  1WLJ A;  1GOA A;  2XO7 A;  1VSH A;  1C1C A;  3DI6 A;  4CJK A;  1QSS A;  3ZT3 A;  1SUQ A;  4OJR A;  4Q0B A;  3M8P A;  3G10 A;  4CGI A;  4EZ6 A;  4B8A B;  4BAC A;  4KI6 A;  1T03 A;  3IS9 A;  4DTM A;  1S1X A;  1TL3 A;  3ISN C;  4LSL A;  4LSN A;  3RMA A;  1WSI A;  4N41 A;  1T7P A;  1JLF A;  1FK9 A;  4FJ5 A;  4LH4 A;  3QEV A;  4CEC A;  1KRP A;  3VQD A;  4HTU A;  4W5T A;  5I3U A;  1B92 A;  3PX0 A;  3MAQ A;  4HHT A;  2G8V A;  4BWJ A;  4RW8 A;  2D0A A;  3ZSZ A;  2ZE2 A;  2XHB A;  4DF4 A;  3KK1 A;  1RDB A;  2Z1J A;  4FJG A;  1DLO A;  4DTN A;  4FM0 A;  4DSF A;  1NJY A;  4M3T A;  3CM6 A;  1ZBF A;  1O1W A;  4H4M A;  5CZ2 A;  3QIN A;  4C8N A;  2O4I A;  3NH1 A;  2KZZ A;  4CIE A;  2VWK A;  1TAQ A;  2G8F A;  4Z4F A;  4K8Z A;  3G0Z A;  1TL1 A;  4B9N A;  3M8R A;  4CJR A;  4CEB A;  1TKT A;  4FZX C;  2GV9 A;  4KRE A;  1SKS A;  1CLQ A;  1L3V A;  3AVI A;  1I3A A;  2EX3 A;  1TVR A;  4ID5 A;  4E7J A;  1NK4 A;  3UIQ A;  4FJL A;  1W9H A;  2RPI A;  1U04 A;  2XY8 A;  4CGF A;  3HPO A;  4DQI A;  4DQS A;  1DTT A;  3WNF A;  5KI6 A;  4CCH A;  4M42 A;  1WSE A;  4RW4 A;  4HCC A;  1NK0 A;  5FRO A;  5T7B A;  3QEP A;  3HP6 A;  3OYN A;  2EHG A;  1RIL A;  3CFR A;  1BIS A;  3NFA A;  1RDC A;  5K14 A;  4DS4 A;  4Y1C A;  1WSJ A;  4CHQ A;  2VWJ A;  4EP5 A;  4N56 A;  2A1R A;  2OA8 A;  1CXU A;  3SCX A;  2BGG A;  4W5Q A;  1Y97 A;  3MEC A;  3V1R A;  4B9M A;  2HHQ A;  3I0R A;  1JLE A;  1HYV A;  1BQM A;  2DFE A;  3NF9 A;  4M45 A;  4KFB A;  3NGY A;  3M8Q A;  4AHV A;  4CJL A;  4GVM A;  1VSD A;  4DTS A;  2FBV A;  2GBZ A;  3AA2 A;  2RN2 A;  2X74 A;  1VSI A;  4E19 A;  3OYE A;  3P83 D;  3VQB A;  1RDD A;  3OYK A;  2F96 A;  4YNQ A;  1ZBH A;  2HHX A;  3VA0 A;  2KZM A;  1JLG A;  2BAN A;  4FM1 A;  4DTX A;  4OKK A;  5JS2 A;  4DSK A;  3MEG A;  3C6T A;  1LAV A;  3V9X A;  1KVA A;  1FXX A;  3TR8 A;  4CK2 A;  4J2A A;  4CJW A;  2BE2 A;  3T1A A;  3NHG A;  5C25 A;  3SQ4 A;  3JSM A;  1BL3 A;  2FBY A;  3DRR A;  2D0C A;  4M3Z A;  3BGR A;  2HHV A;  4BWM A;  3KK3 A;  4DLG A;  2RKI A;  4CJS A;  3D0P A;  2ETJ A;  4L8R B;  1REV A;  5EU7 A;  4FJ8 A;  1HPZ A;  4OKJ A;  2QKK A;  2X6N A;  3AO1 A;  4AHU A;  4CIG A;  1U4B A;  4FK4 A;  3ZT1 A;  3C95 A;  1C0U A;  1NKE A;  1L5U A;  4JS4 A;  1ASV A;  3AO5 A;  3DMJ A;  4CFB A;  3KJV A;  4DFP A;  1TKX A;  3V9Z A;  3SQ1 A;  2KQ2 A;  4FJX A;  4OLA A;  4OVL A;  2HND A;  3ULD A;  4FYD A;  2Y1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...