1G15A

Co-crystal of e. coli rnase hi with two mn2+ ions bound in the the active site
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
150
structure length
141
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHAEVILSTDSQYVRQGITQWIHNWKARGWKPVKNVDLWQRLDAALGQHQIKWEWVGHPENERADELARAAAMNPTLEDTGYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RIBONUCLEASE HI
publication title Co-crystal of Escherichia coli RNase HI with Mn2+ ions reveals two divalent metals bound in the active site.
pubmed doi rcsb
source organism Escherichia coli
total genus 47
structure length 141
sequence length 150
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1g15A00
2KFNA 3JSMA 4KREA 2QXFA 2XHBA 4HCCA 4H4MA 3AO5A 1DLOA 4OKKA 3ZSZA 4PUOA 3ZT3A 1NK8A 1HNVA 1UWBA 3NBPA 3OYMA 3CQ8A 1U45A 3SUOA 3NGIA 2DFFA 4HUEA 1DTQA 4XIUA 2G8IA 3NH2A 3HYFA 3CFOA 4CF8A 3VQPA 2P51A 2ZE2A 5J2PA 1EX4A 3QEWA 3CYMA 4GW6A 3OS2A 4FJJA 3O4NA 3L2WA 3DLHA 1VSIA 2I5JA 2X6NA 1T05A 2YNHA 3VA0A 4DLEA 1YTAA 3TABA 3VQBA 2OYQA 4PQUA 3ISNC 4CIEA 3S3MA 2DFEA 4LSNA 1VSDA 1TL3A 3RTVA 3B6PA 3HT3A 2G8VA 1FKPA 2D0AA 3AA5X 3OYJA 3L3UA 1IG9A 4KB1A 1LWEA 3HO1A 1J53A 2VG5A 2BANA 4F4KA 2YHAA 5HRNA 5HBMA 4N56A 1NKEA 1KFDA 2YKNA 3FFIA 3T3FA 3DLEA 1TK8A 4EP4A 1X9WA 4UQGA 3HVTA 4RW9A 3HVRA 1SKWA 4CGHA 3HM9A 3VQ6A 3MEDA 3NCIA 3MXIA 4E7LA 1C1CA 1WSJA 4J2DA 4Y1DA 3QNOA 3RR7A 4HUGA 3NF6A 4J2BA 1Q8IA 3NGYA 2G8KA 1YT3A 4OGCA 1RTJA 3BDPA 3L2QA 4BE1A 1RILA 4E89A 1B92A 4HHTA 4ZTJA 3L8BA 2IDOA 5J1EA 3MXMA 1WAFA 1TAUA 1FKOA 2ETJA 1HMVA 2G8HA 3SQ0A 1W9HA 4M3WA 4FJLA 1RT4A 4K8ZA 3KKSA 3VQEA 3HP6A 2KZZA 2JGUA 4Q5VA 4DU4A 4DSFA 2O4GA 4N76A 4OJRA 4W5OA 3AVBA 3OY9A 1RT7A 3DRPA 1LV5A 4CCHA 2WOMA 4EP5A 5CY4A 3VQDA 4ID5A 3L2UA 1BQNA 1WNSA 4F2SA 1NJYA 3K5OA 2DY4A 4CEDA 2KQ2A 3AA4A 3ZT4A 1K6YA 3PY8A 4J2AA 4M3UA 2HNYA 4F2RA 4PWDA 1WLJA 3D45A 4K8XA 3VA3A 2QK9A 2XRIA 1ITGA 3SYZA 3QEXA 2Z1IA 3KK3A 4BDPA 1S1VA 1UOCA 4DG1A 4DFPA 3AV9A 4AHVA 4DQRA 1QSSA 1T7PA 1VSEA 1JLAA 4DSEA 4DTXA 3SQ2A 4FYDA 4C8MA 3OYLA 4GMJB 4N47A 3HL8A 3IG1A 4OPJA 2OZSA 4FZZA 2E6LA 4CJQA 1J9AA 2VG7A 3UIQA 1EXQA 1TKXA 4FW2A 3OVNA 2KFZA 4DTNA 2NUBA 1RT2A 4CJFA 4FCYA 5SWMA 4KV8A 1QSLA 1S1XA 4OLBA 2IOCA 3NF7A 4FLYA 4DU1A 2YKMA 4DS5A 1DTTA 1LAVA 5JS1A 2PZSA 2YNGA 1TVRA 3V1QA 3SZ2A 1Q9XA 2Q3SA 1QS4A 5DK5A 3O3HA 1JLBA 1L3VA 3L2VA 3OYAA 4Z0UA 3OYCA 4CJRA 4O0IA 1BL3A 3B6OA 4YNQA 4FJ5A 4F8RA 1VRTA 1TL1A 1S1UA 3QIOA 2G8UA 3AVMA 1NJXA 4QOZB 3EY1A 1IO2A 4FLWA 3S9HA 1U49A 4B9LA 4DTOA 2OPRA 2RKIA 3VQ7A 4CEBA 1TKDA 3WNHA 3TI0A 1O1WA 4ELVA 4FJHA 4CF1A 3ZT0A 4KPYA 3AVGA 3AVHA 5CZ1A 3TAEA 4BE2A 3KLIA 3QINA 2XY6A 1SKRA 1LW2A 4GVMA 4M41A 3ZSXA 3QEIA 2FBYA 4DSJA 4HCBA 4FJ8A 2HHVA 1YVUA 2ATQA 3IAYA 3M8RA 3V1RA 3DRRA 3VQ4A 1KTQA 4CF9A 4CHNA 3KIOA 4PA1A 3LP3A 4FXDA 5KRTA 1Z26A 3DM2A 4KTWA 5HRRA 4DQQA 4DS4A 1RTDA 4CGFA 3EYZA 5I3UA 3I0SA 4DTRA 2W42A 2AJQA 1C0UA 2Z1JA 4Y1CA 3BGRA 4IG0A 3HPHA 4BE0A 3O4QA 1VRUA 4KHSA 1HYSA 1VK0A 3A2FA 3IS9A 2HHUA 4AHSA 5CZ2A 3LAMA 1XC9A 4CJUA 1S9GA 3V9XA 1D9DA 4W5RA 4M3ZA 4B9UA 3RRGA 4FK4A 1RDDA 1WN7A 1RTIA 1KLNA 3TAFA 3LAKA 4CIGA 4CECA 5E41A 2XY7A 2QKKA 4MFBA 3SI6A 1XI1A 1HYVA 3HK2A 1ZBLA 4CERA 1TKZA 3KK1A 4OKJA 1UAXA 1TKTA 4C8KA 1X1PA 2Z1GA 4LY7A 1A5WA 4OPKA 2G8WA 2DTUA 4PY5A 5KGXA 2F96A 4FZYA 4CFAA 1RNHA 2HVIA 3CFPA 5DMRA 4E3SA 1Q9YA 3LPUA 4B9SA 4J2EA 4O0JA 3L2RA 2GBZA 4E1NA 1J5OA 2JLEA 3MECA 3KK2A 4RW7A 4NCBA 4DQPA 2ZD1A 1VSJA 2VWKA 4ID1A 4E7IA 1BIUA 4Z4EA 3V1OA 4CGDA 4FLZA 4NCAA 4E7KA 4KTQA 4DFMA 4B8CA 3OS0A 1ZYQA 3K58A 1LAWA 3OYFA 3NAEA 3DLRA 1KVBA 1FK9A 5CYQA 3JYTA 2D0BA 3AA3A 3DRSA 3QO9A 2RPIA 4HUFA 3QETA 3AVLA 3C95A 4IKFA 4JLHA 3ZT2A 3AVIA 4H8KA 4W5NA 4LH5A 3LZJA 4CEEA 3KD5E 3AVNA 3NH0A 1HYZA 1S5JA 3RWUA 4KHWA 1B9DA 3OYGA 1BCOA 1QSYA 4CE9A 4E1MA 3PUFA 2HVHA 1WSGA 2YHBA 4CJPA 1NK7A 1CLQA 5CYMA 2ITGA 1IH7A 3M8QA 5FRNA 1NOZA 3C6TA 3G0ZA 4MQ3A 4CJEA 4O5BA 3LWLA 4E7HA 3LP2A 1WSHA 3ZSWA 4H4OA 3PV8A 4CGJA 1WSFA 3RMAA 4HVJA 3TAPA 4FJXA 1WAJA 4CGGA 4CHOA 3SNNA 1N6QA 3RRHA 4DQIA 1YTUA 1REVA 3AO2A 1VSKA 3HPOA 4I9QA 4BDYA 1RBSA 3TWHA 4CJ3A 3ZSYA 4RG8A 5HRPA 1UA1A 5C24A 4E19A 5FRMA 3OJUA 1U47A 1HQUA 2P5OA 2X78A 4E7JA 3ZSRA 1EP4A 3RR8A 4C8OA 2FBTA 3S3OA 2FC0A 1A5VA 3AVCA 3KLGA 4B9TA 3T1AA 1JLGA 4IDKA 4KRFA 4NCGA 4CHQA 3NF8A 4CIFA 3OYBA 4M3XA 3HP9A 2RF2A 3SCXA 4C8LA 1G15A 3MXJA 1ZBFA 4I2QA 1NKCA 1HPZA 1CZBA 5J2QA 5SZTA 2ZQBA 3DLBA 1JXEA 3PO5A 1VSHA 4OGEA 3O3FA 4BWMA 2B5JA 1ASVA 1NK9A 4KHNA 2KW4A 4DTUA 1TK0A 4CFCA 1BQMA 2R7YA 2O4IA 2HHSA 4CK1A 3LPTA 3EZ5A 5KGWA 1RDBA 2IGIA 4I2PA 1KRPA 1RBVA 3PX6A 3C94A 4KHUA 4M42A 1QE1A 3CG7A 4FM0A 4Z4FA 3V9SA 1L3UA 4I9LA 1BCMA 3V9ZA 4CEZA 4JS4A 2HNDA 5FROA 3LALA 3OYKA 4OLAA 1SL0A 4CF2A 2P5GA 4FK0A 2XY8A 1SL1A 3NFAA 4CJVA 4ELTA 4DF8A 2FBXA 1C1AA 1TAQA 3QIPA 3HPGA 1CZ9A 3LDSA 1WSIA 1UA0A 4EZ9A 3QERA 3QNNA 3QEVA 1WSEA 1JXBA 1S6PA 3SUNA 1ASUA 4ZHRA 4YFUA 1S6QA 2YNIA 3AA2A 3VQ8A 1IKVA 4CEOA 2PY5A 4B3OA 3AVAA 4CJLA 4FK2A 4W5TA 3OYHA 1KVAA 2B6AA 3O3GA 4F3TA 1U04A 4B9NA 1A5XA 1KFSA 4NYFA 4QAGA 4FVMA 1GOCA 1TV6A 3SQ1A 2HHXA 4Q0BA 4CGIA 3MAQA 4FW1A 4CJTA 1HRHA 3TAGA 3V4IA 1RCHA 3L3VA 1BI4B 3DLKA 4R5PA 4Z4HA 3OYDA 1NK5A 1CXUA 1SL2A 4CHPA 1JKHA 4BWJA 3K5NA 4CJSA 3KTQA 1RBRA 4FJNA 2IAJA 1L5UA 3IRXA 3AO4A 4EZ6A 5C25A 3LZIA 4CFDA 4IG3A 4ICLA 3SPZA 4KTZA 5T7BA 1NK6A 3KLHA 1C6VA 1HQEA 4FJ7A 3V81A 1D8YA 1EKEA 1JLCA 4RW4A 4CEFA 4BDZA 4TSXA 3TARA 4KAZA 1BHLA 3RMCA 2Y1JA 4JRPA 4CJWA 3NH1A 1S1WA 3U6FA 1QHTA 1Z25A 3QEPA 3U3YA 3SUPA 2FBVA 3THVA 1U48A 1NJWA 1BIZA 1IKWA 4DTPA 3G10A 2KTQA 3TR8A 3F73A 3K5MA 5KRSA 4KI4A 1S1TA 1X9SA 4DU3A 2OZMA 2EX3A 4FM1A 2HHTA 1RBTA 1NJZA 2Y1IA 3M8PA 4DMNA 1N5YA 4CF0A 3VQAA 5JS2A 2HHQA 1NOYA 4ZTFA 1XWLA 4CFBA 3LP0A 3AVJA 3VQ5A 1JL1A 3SUQA 3LP1A 3QLHA 4HTUA 5D3GA 1L3TA 2IS3A 1JL2A 4B9VA 3AO3A 3VQ9A 2D0CA 4FJIA 2X6SA 4RW8A 3KLEA 3KJVA 2OPQA 4KO0A 1RT5A 1FXXA 4WE1A 3NDKA 2OPSA 4JRQA 3I0RA 3PX0A 3SJJA 4O55A 1NK4A 4BACA 3AO1A 3WNEA 4FJGA 3HJFA 3HSTB 3I8DA 3ALYA 2RN2A 3WNGA 3DMJA 3PO4A 2E6MA 3K59A 2QKBA 3TAQA 1JLFA 1RT6A 1VSLA 4RW6A 4B08A 1C0TA 3T19A 4CESA 3OJSA 1KSPA 2YNFA 2KZMA 1LWCA 4IFYA 3OYEA 3HXMA 3SQ4A 3D0PA 2LSNA 1RDCA 4O44A 3LANA 1D9FA 2A1SA 3PX4A 3RMDA 1R0AA 4DWIA 5FDLA 1KCFA 1RDAA 2GV9A 3DOLA 5KI6A 3MEEA 4CHYA 4FLTA 4FLVA 2PYLA 1GOAA 5HP1A 4N41A 4JS5A 4FZXC 1MU2A 1VSMA 1HJRA 3F9KA 3ITHA 1XHXA 3DLGA 2EHGA 3AVFA 1D5AA 4IBNA 3ZSOA 3P5JA 4N5SA 4G1QA 4DLGA 3ZSQA 4DSKA 4FJ9A 1X9MA 3KKRA 1RTHA 4AH9A 3LWMA 4FLXA 3QESA 4W5QA 4DSIA 2HW3A 1W0HA 3V9WA 3KLFA 5HROA 2BGGA 1QTMA 4AHCA 2HNZA 4DQSA 5J2NA 3NHGA 2A1RA 3WNFA 1B9FA 2D5RA 3OYIA 2OA8A 4AHUA 3P1GA 2G8FA 4M3TA 4M3RA 2HHWA 4DTSA 4FJKA 3TAMA 3DYAA 5I42A 4O4GA 3ASMA 3OYNA 1JLEA 1SUQA 3VQCA 3ZCMA 4CEQA 2P1JA 1S9EA 2WONA 4NYNA 4Z4CA 3OS1A 1KVCA 3VN5A 5J2MA 3KD1E 1ZBIA 4CK2A 3RMBA 4FLUA 1T03A 2B4JA 5HLFA 4LH4A 3NE6A 3CM6A 1L3SA 1NKBA 4KHQA 5C42A 3VQQA 1BI4A 3DI6A 3MEGA 3CM5A 4DF4A 4E0DA 4I7FA 1QQCA 4CK3A 2VWJA 3NGZA 4M3YA 2VG6A 1CXQA 1Y97A 3K2PA 1RBUA 1BGXT 4AHTA 4FM2A 4LD0A 3C6UA 1ASWA 4AHRA 4C8NA 1C0MA 3ZSVA 4FJMA 3K57A 4OVLA 2BDPA 3V6DA 4KKOA 4DTMA 2XY5A 3ULDA 4ELUA 1I3AA 1SV5A 2XO7A 1C1BA 3P83D 5EU7A 5K14A 4CHZA 4AILC 1RT3A 3CFRA 4Z4IA 3DOKA 4F3OA 1NK0A 3V9UA 4Z4GA 2PYJA 4B9MA 2F8TA 4DSLA 4CJKA 2X74A 2HB5A 2Z1HA 4LSLA 1VSFA 4CJ5A 4B8AB 5KTQA 4DTJA 1IKYA 3S3NA 3K5LA 4DFKA 1ZBUA 1XHZA 1RT1A 1HNIA 1BISA 1F21A 4QCLA 4KB0A 1TK5A 4KI6A 1KLMA 3E01A 1JLQA 1LWFA 2HMIA 1IKXA 2OPPA 3TANA 1ZBHA 1I39A 3SV4A 2E4LA 4CEAA 3NF9A 1U4BA 5HRSA 1GOBA 2GUIA 3U3GA 1SKSA 4L8RB 2F8SA 1T8EA 3AVKA 3M8SA 4M45A 1LW0A 3SV3A 1TGOA 4CJ4A 4DFJA 1EETA 4KFBA 2BE2A 3SPYA 4OKEA 2DFHA 2YV0X 4KHYA 4IFVA 2IC3A 3H08A 3ZT1A 1J54A
chains in the Genus database with same CATH superfamily
4DV4K 2XHBA 4H4MA 3AO5A 2YHXA 2ZJPL 4PUOA 1OH8A 4LF9K 1NK8A 3NBPA 1U45A 1DT9A 2DFFA 3C6HA 3NH2A 1VAZA 2P51A 3IUCA 3M5RA 3THYB 3AY9A 2HBLA 1T05A 3VA0A 3O1WA 2QWOA 1TL3A 3D2FB 1OH6A 3HI0A 3AA5X 3HO1A 4JI0K 3CCSN 4FVUA 1KFDA 3T3FA 4BRIA 1TK8A 1BO5O 2HBJA 4UQGA 5GINA 5H1SQ 1N36K 1X9JA 1R59O 4KH4A 3QNOA 4HUGA 4FL9A 3NGYA 2O8DA 5HL7L 3SBGA 1RTJA 1RILA 1U6ZA 3L8BA 1WAFA 2G8HA 2ETJA 1HMVA 1W9HA 4CD1A 3KKSA 3HP6A 3LDOA 4DU4A 4DSFA 3WQUA 4N76A 3AVBA 3OY9A 1D4XA 4F2SA 2DY4A 4ID5A 3L2UA 3K5OA 4OX9K 4BQLA 2P9IB 4PWDA 1WLJA 5ADXA 3QEXA 4YOWA 3AV9A 4DQRA 1JLAA 2V52B 3HSCA 2YHWA 3OYLA 4GMJB 4XH4A 4DV0K 4N47A 3VENA 4OPJA 2OZSA 2E6LA 4CJQA 3UKRA 2E2NA 2NUBA 1RT2A 4CJFA 4OLBA 1QSLA 3W3DA 2IOCA 4I6MB 1DTTA 2PZSA 1TVRA 3SZ2A 2Q3SA 1QS4A 1RDWX 3LDNA 4BRLA 4Z0UA 4HTLA 3OYCA 2P9LA 4FJ5A 5BPMA 3QIOA 2G8UA 4QOZB 3EY1A 5LMNK 4IOAL 4DTOA 2NRWA 3VF6A 5AQNA 3S41A 1O1WA 5M1FA 4JI4K 4KPYA 4LF4K 3AVHA 3CPEA 2HF3A 3THYA 4GVMA 3QEIA 4DSJA 3E9PA 3A5LC 2H3GX 5AZIA 4JHDB 3N4QA 4CHNA 1W7AA 3KIOA 3LP3A 5KRTA 5HRRA 3DM2A 1EWRA 3N4PA 1Z05A 4FWSA 2AJQA 2Z1JA 3RVCA 4BE0A 2CGLA 4KHSA 1VK0A 3A2FA 3IS9A 3AGKA 1XC9A 1IBKK 1S9GA 3EN9A 4W5RA 3IMXA 4JNEA 1YI2N 4LY7A 4G9ZA 4PY5A 4CFAA 1RNHA 4CW7B 4E3SA 3LPUA 4B9SA 1JJ2M 4DQPA 2P9IA 3I8BA 4CGDA 3PLAA 4DFMA 1WUAA 4BR2A 5AQXA 1ZYQA 3K58A 1LAWA 3NAEA 2E5LK 3DLRA 1FK9A 5CYQA 4IKFA 3DRSA 4HUFA 1TUYA 4JLHA 3AVIA 4H8KA 4W5NA 4CEEA 1DKGD 3TU5A 4YOXA 1BCOA 1QSYA 4CE9A 5B8HA 2O8CA 1XMQK 3BUZB 4I6MA 1NK7A 2PFUA 1CLQA 4FWMA 1NOZA 2DPNA 3LWLA 3CCRN 1WSHA 4H4OA 4CGJA 1WSFA 3TAPA 4HVJA 4CHOA 3RRHA 4HWIA 1RBSA 4CJ3A 1UA1A 3CC7N 5C24A 5FRMA 4DQ8A 3LDQA 1U47A 2P5OA 4WFBL 3RSEB 3H1QA 3HBTA 5C15A 1YF5L 3OBYA 3AVCA 3A5MC 4B9TA 3FR0A 4PKGA 3IKMA 4IDKA 4KRFA 4CHQA 4BR5A 3PSIA 1TYQB 2P9PA 4CIFA 4M3XA 2RF2A 4E1JA 4JHDA 4I2QA 1CZBA 5J2QA 4CVNE 1JXEA 4DV5K 3PO5A 2EWSA 5F2RA 2O4IA 2HHSA 5KGWA 5KPTA 2IGIA 4I2PA 1RBVA 2GUPA 3PX6A 4FSVA 3GDQA 3V9SA 1L3UA 4I9LA 3MDQA 3V9ZA 5AQPA 2QXLA 1X3MA 3FE1A 4CZGA 1SL0A 2CGKA 2XY8A 4M7YA 3U9DA 2FBXA 3QIPA 1T6CA 3LDSA 3QNNA 3SUNA 3R8EA 4ZHRA 2YNIA 4CEOA 4LF5K 1BOTO 3AVAA 3G71N 3PSFA 3BY5A 1KVAA 2E88A 3CJ7A 4FWQA 4NYFA 1GOCA 1K9MO 4JI8K 2ASPA 4CGIA 3MAQA 4FW1A 1I94K 4AF1A 3T69A 3L3VA 5M1NA 5EY4A 1SL2A 3K5NA 3ZEUB 3LZIA 4CFDA 4IG3A 3D2EB 4ICLA 3CMAN 3SPZA 4JK7A 4FJ7A 4UY8O 1E3MA 1HQEA 3V81A 4CEFA 1BHLA 2Y1JA 1QSSA 3NH1A 3QEPA 1BIZA 1IKWA 5AQSA 3F73A 3K5MA 4CBXA 4KI4A 1S1TA 4K43A 1X9SA 4DU3A 2EX3A 2HHTA 1QQOA 4DMNA 1N5YA 4CF0A 3VQAA 4H0OA 4X65K 4CFBA 3TTFA 4DR3K 5E26A 4BRQA 2IS3A 1WOQA 1HKBA 3AO3A 4GNIA 2D0CA 2Q31A 3A8YA 3KLEA 1TYQA 4KO0A 2OPSA 1NK4A 4O55A 3HJFA 4PL7A 3ALYA 1Q82O 3PO4A 3K59A 4IWVA 4RW6A 2JWKA 3OJSA 3CC2N 1VQ9N 2D4WA 2YNFA 5FPDA 3D0PA 2A5XA 3CCMN 3PX4A 4X62K 1KCFA 4H5TA 2GV9A 2PYLA 3CCJN 3F9KA 2EHGA 4PKHA 4N5SA 4G1QA 3NVKA 1MWMA 3W0LA 5AQZA 2QI2A 1X9MA 4AH9A 3KVGA 4W5QA 3ZYYX 2HW3A 1W0HA 3KLFA 1QTMA 4AHCA 3OYIA 1B9FA 2D5RA 2G8FA 4WCEL 3DYAA 3VEWA 1SUQA 3BEXA 3VQCA 1Z6RA 3EO3A 1NM1A 3DXKB 4ILJA 4Z4CA 3VN5A 2YJEA 2YHYA 3UB5A 4CK2A 4OO1J 3H1VX 4AQYK 5BRHA 4Y0WA 1L3SA 1NKBA 3VQQA 1IG8A 3MN6A 3CM5A 5F1XA 4E0DA 4YOTA 3BF3A 4A5BA 1QQCA 3ZEUA 1Y97A 3K2PA 1RBUA 1HPMA 5GAGP 1S22A 4IO8A 3THWA 3ZX0A 4YY3K 3ULDA 2P9SB 1SV5A 2Q0RA 3P39A 1VQ6N 1NK0A 5AQFA 1XC3A 4CJ5A 4B8AB 1XHZA 3ID8A 1OH5A 2RE2A 2E8AA 1NMNA 1KAYA 1E4FT 1E4GT 2GELA 1BISA 4A57A 1KC8O 4KI6A 1HUXA 4WQ4C 4PL8A 3D7EO 3HM8A 2HMPA 2E4LA 3O9RA 1HNXK 1KAXA 2FSNA 3OHRA 1GOBA 1SKSA 4C1NI 5DM7L 4M45A 4CJ4A 4U7BA 1T3VA 4KFBA 3SPYA 2DFHA 3MCPA 5KQ8A 3A5OC 4OKKA 5AZJB 4DV1K 3SUOA 4HUEA 2NRVA 2F9WA 2G8IA 3ENHA 3CFOA 4JAXA 4ISEA 3VQPA 1XMOK 3AAPA 3QICA 3OBWA 1NLVA 4BVPA 4GW6A 4C23A 3L2WA 3DLHA 1U2VA 1VSIA 5JLFA 4WQ4A 3VQBA 3S3MA 3VEOA 1FKPA 2D0AA 4JI1K 4F4KA 5HRNA 1NKEA 5HBMA 3FFIA 3DLEA 2O8BB 4EP4A 4LFAK 3DXKA 3HVTA 4RW9A 3ENBA 4CGHA 3CCQN 1NGCA 3VQ6A 3NCIA 1NWKA 2NRRA 4E7LA 1WSJA 1C0GA 2I7NA 4J2DA 3H45C 4GY2B 1NGGA 1T6DA 1Q8IA 5A2QO 3J8AA 3U4LA 4OGCA 3OTOK 3L4QA 4E89A 2IVOA 3CQYA 4HHTA 5TKWA 5J1EA 4DR1K 2OTJN 1JCGA 3WT0A 1H1VA 2JGUA 2O4GA 4JKEA 1RT7A 3DRPA 3SLCA 1OKJA 4H5VA 4CEDA 2KQ2A 4BRDA 4J2AA 3LDPA 4F2RA 2QK9A 3THXA 2KHOA 3KK3A 1S1VA 4DG1A 3BZCA 4AHVA 1VQLN 4DSEA 2YI1A 3SBTA 3EEQA 5GIPA 3HL8A 3IG1A 4FZZA 2VG7A 4A62A 4PKIA 1NNEA 4FW2A 5JVGL 3B8AX 4DTNA 3O9UA 4KV8A 1S1XA 4FLYA 2YKMA 5JS1A 1LAVA 3V1QA 1Q9XA 5DK5A 3R9PA 1JLBA 3HRGA 3L6QA 3OYAA 4CJRA 2WFBA 1BL3A 2E20A 1NU0A 4F8RA 4DR4K 1NJIO 1NJXA 2ZM6K 5AZJA 2PAVA 4DR2K 4B9LA 1TKDA 3QBXA 1T44A 2UUBK 3CCEN 4BE2A 1HLUA 3CIPA 3QINA 5BR9A 3ZSXA 4FJ8A 2FBYA 3VOVA 1YVUA 2ATQA 4BREA 3IAYA 3M8RA 3DRRA 3VQ4A 3SAFA 1X3NA 4PA1A 4DV2K 1BU6O 4B3TK 3CI5A 4H0PA 5ELZA 4DS4A 3ZLJA 3O08A 4Y1CA 3BGRA 5DM6L 3HPHA 3O4QA 5LY3A 1VRUA 4H03B 3BP8A 5LL6Z 1D9DA 4M3ZA 3PIOL 4B9UA 3RRGA 1WN7A 1RTIA 3TAFA 3LAKA 4CIGA 1SS6A 5E41A 3SI6A 1HYVA 5BPLA 4CERA 1TKZA 3KK1A 5CHIA 1QQNA 1X1PA 4C8KA 1LOTB 2FSJA 2QEXN 2GX9A 2GEMA 1WB9A 2HVIA 3CFPA 3FZLA 4FO0A 3L2RA 1J5OA 3MECA 3VETA 4YOVA 4NCBA 4H5NA 2NNWA 3MWTA 2ZD1A 2VWKA 4ISGA 4E7IA 1BIUA 3FZHA 4FLZA 4NCAA 4B8CA 3D6RA 5LJWA 4H0VB 2QWRA 3OS0A 1O13A 3OYFA 1SL1A 1SKWA 3QEVA 2RPIA 5BREA 3ZT2A 4FPAA 3LZJA 3KD5E 3NH0A 4XEIA 5IT9O 3O9TA 1B9DA 3OYGA 2ZWHA 1BA0A 5AFUH 4E1MA 3PUFA 4JV5K 2HVHA 4CJPA 1K8KB 3JS6A 1NGDA 5CYMA 2ITGA 3M8QA 1NGHA 4O5BA 5JLHA 4OPHA 3T1YK 3LP2A 1SZ2A 4KHQA 3VESA 4A2AA 1N6QA 1REVA 1GLCG 5FPEA 4I9QA 1KD1O 4FPBA 3ZSYA 5HRPA 4E19A 3ULEB 4BR4A 3WEEA 4L3QA 3EE8A 3ZSRA 1EP4A 3O9SA 4C8OA 2FBTA 3S3OA 5M1PA 3KLGA 1FW6A 4FWRA 3GE1A 4NB4A 2NRXA 2D0OA 3HP9A 3EZWA 1NKCA 1HPZA 4MLHA 5SZTA 2VWBA 1VQON 4OGEA 2KW4A 1TK0A 1NGBA 4BR0A 1BQMA 1VQ7N 1NGAA 3VGMA 4DB3A 3PIPL 4Z4FA 4CEZA 3CCLN 3LALA 2V51B 4CF2A 2P5GA 4CJVA 4DF8A 4BRGA 4BRKA 1TAQA 1CZ9A 3QBWA 2GTDA 4YFUA 3D2FA 3CJCA 1A5XA 1KFSA 4QAGA 3SQ1A 3CPWM 3TAGA 3G4SN 1BI4B 2UXCK 4R5PA 4Z4HA 3OYDA 1NK5A 1VQPN 1JKHA 3CJBA 4J8FA 2IAJA 1L5UA 2UUAK 4LC9B 3CERA 1C6VA 2I7PA 3VMFB 1D8YA 1EKEA 1JLCA 4RW4A 3TARA 4KAZA 1U48A 1Z25A 3U3YA 1VQ5N 2FBVA 3DJCA 4H0XB 2AA4A 5IWAK 3TSPA 3CF5L 2NRHA 2HHQA 5JS2A 3ULEA 3SMSA 3EKSA 4HTUA 1ATNA 4DR5K 1TUUA 4FJIA 2X6SA 3KJVA 3PX0A 3I0RA 4FJGA 4BACA 3AO1A 3HSTB 3MN9A 3TAQA 1RT6A 4B08A 4BGBA 3OYEA 2OANA 3SQ4A 2LSNA 1RDCA 4JK9A 3LANA 4CZEA 4YHHK 5C10A 4QS7A 3E66A 4FLVA 4CZIA 1WBBA 1ZBSA 1SQKA 5HP1A 4N41A 4JS5A 4FZXC 1W97L 1VSMA 3CCVN 4QS9A 4IBNA 4OPAA 4GV6A 2NRTA 2CGJA 4ILHA 3KKRA 1RTHA 2D0PA 4FLXA 3QESA 1MA9B 1VQMN 5HROA 1GLBG 5J2NA 1KAZA 2HNZA 3NHGA 3J81O 4BC4A 1GLDG 3P1GA 4M3RA 4DTSA 3ID6A 1HR0K 3J7YP 4RWTA 3TAMA 5I42A 1JLEA 3ZCMA 4CEQA 4X66K 4CD3A 3OS1A 5J2MA 3WUHA 5GAHP 4H0YB 1T03A 2B4JA 5AQKA 5HLFA 4LH4A 2P9NB 2VGNA 1BI4A 4CZKA 5C2FA 2VWJA 3MMVA 4M3YA 3NMUA 1VHXA 3C6UA 1ASWA 3UKUB 3O5BA 3V6DA 4DTMA 4EFHA 4GVEA 3CFRA 2QWNA 4F9OA 2PYJA 5CE3A 2Z1HA 2QM1A 4H0TB 4DTJA 3S3NA 3K5LA 4DFKA 1ZBUA 3VF2A 1MDUB 3BZKA 1HNIA 4BROA 3M6GA 5BPNA 3MK6A 5LJVA 3U9ZA 2QWPA 3E01A 1JLQA 4NLBA 2HMIA 2OPPA 3QFUA 3L4IA 1ZBHA 3VTIA 1I39A 3SV4A 4IOCL 3NF9A 1M1KO 3MX2A 3U3GA 4CZFA 3VPZA 1T8EA 2QA4N 3Q7CA 4BRHA 2YV0X 4KHYA 2QTDA 3H08A 4K0KK 1P90A 1Q18A 3IFRA 1QZ5A 3JSMA 4KREA 2QXFA 4HCCA 3R3LA 1DLOA 3ZT3A 1UWBA 5AR0A 2OTLN 1YVNA 2FF6A 1XNQK 3NGIA 1DTQA 4XIUA 4DR7K 3AARA 3HYFA 4CF8A 5J2PA 1GLEG 3QEWA 3CETA 3RSEA 3OS2A 3MN5A 2X6NA 2BH1A 4DLEA 3TSQA 3ISNC 4BRNA 4CIEA 2DFEA 4IEEA 4IDHA 3RTVA 2G8VA 2ZJQL 1IG9A 1LWEA 4JI6K 2VG5A 4AM6A 3O4WA 2BANA 5FPNA 2YHAA 4BC5A 5TKYA 2YKNA 3KWIA 1ESVA 3MEDA 3MXIA 1C1CA 3RR7A 3QDKA 4J2BA 3I33A 3WXLA 2P9NA 1FJGK 2G8KA 1YT3A 1EWQA 3BDPA 4WFNL 4ZTJA 2IDOA 3MXMA 4M3WA 3VQEA 3O80A 4W5OA 1CZAN 5AQGA 3WQTA 4A61A 1LV5A 4CCHA 2WOMA 4EP5A 5CY4A 3VQDA 1BQNA 1WNSA 5KPZA 1NJYA 3PY8A 3AA4A 1K6YA 3WXKA 3E9OA 4K8XA 1S3XA 2XRIA 4BDPA 1M90O 1T7PA 4B9QA 3SQ2A 4FYDA 1BA1A 4QS8A 4IEIA 1EXQA 1TKXA 4CJ7A 3OVNA 4LFCK 2RHKA 4DU1A 4DS5A 3D2EA 2W41A 4WFAL 3O3HA 3L2VA 4IZ9A 4YNQA 2VQEK 1IBLK 1TL1A 1S1UA 5ADXH 3O8MA 3HTVA 1U49A 3C7NB 2OPRA 2RKIA 3VQ7A 1Y64A 4K41A 3WNHA 1NGFA 4GV9A 5EVZA 1OH7A 1OVQA 3KLIA 1LW2A 1BUPA 4HCBA 1S72N 2HHVA 1BG3A 4CZHA 1ZC6A 3V1RA 5BR8K 1KTQA 4FXDA 4BR7A 3H6EA 1K8AO 1RTDA 3I0SA 2W42A 1C0UA 4XH5A 4BRMA 3ATVA 4AHSA 5CZ2A 4YORA 1HKCA 4FK4A 1RDDA 5BN8A 1RFQA 3H46O 1ZBLA 3I55N 1N34K 2KLAA 4OKJA 1UAXA 1TKTA 2W40A 2Z1GA 4OPKA 1A5WA 2G8WA 5KGXA 4FZYA 4J2EA 2GBZA 2P9KB 4E1NA 1Q81O 2JLEA 4BG8A 5KQDA 4RW7A 1MWKA 1Q86O 2YJFA 1VSJA 3AAQA 4V19S 4Z4EA 3V1OA 5AQVA 1KVBA 3JYTA 2HHXA 3AA3A 5AQUA 2BUPA 2CH5A 3C95A 3CJ1A 3AVNA 1EQYA 3RWUA 3KZBA 4KHWA 1EO1A 1WBDA 5EXWA 5BN9A 5EOYA 4B1YB 2O8EB 1WSGA 2YHBA 3CMEN 3F2KA 3JAMO 3CXCM 3WXJA 1IH7A 1YJ9N 3G0ZA 4FWOA 4B1WB 3MWPA 2A3ZA 2P9SA 3CD6N 1N32K 3PV8A 1WAJA 4CGGA 4B1UB 3SNNA 4DQIA 1VSKA 4BDYA 3TWHA 4KH6A 3I56N 3ZX2A 1YHQN 3OJUA 2GWKA 1NBWA 4E7JA 3MX5A 1A5VA 2HOEA 1JLGA 3FGUA 2E2QA 3SCXA 4C8LA 1ZBFA 2GWJA 2ZQBA 3DLBA 1VSHA 3VGLA 2B5JA 1ASVA 1NK9A 1HJOA 4DTUA 2YCHA 4CFCA 2R7YA 3LPTA 3CCUN 4MO4A 5JVHL 4B3SK 1RDBA 4JI2K 1KRPA 5GAEP 1QE1A 4FM0A 5M1QA 1BCMA 5C0YA 2HNDA 5FROA 1HNWK 3OYKA 4OLAA 3QFPA 4FK0A 3NFAA 4ELTA 1JCEA 3HPGA 1WSIA 3QERA 1WSEA 1S6PA 1ASUA 1RGIA 1S6QA 1IV0A 4B3OA 4JN4A 3G25A 3OYHA 4F3TA 4BC2A 4B9NA 3FZMA 1G99A 5C2DA 1TV6A 5AQMA 2O8BA 4DUZK 4BQZA 4KHPK 4B3MK 1RCHA 3VEXA 3DLKA 1CXUA 3UKRB 3KTQA 3NVMA 1DGKN 4CJSA 3IRXA 5BRDA 3AO4A 1BDGA 3F5TA 5C25A 2HBMA 5AJ3K 2E2OA 4BVOA 2A40A 4DV7K 2F4VK 1DEJA 3H3NO 2V7YA 4YOYA 3C0BA 1S1WA 2AP1A 3SUPA 1NJWA 2P9LB 4WQ5C 4DTPA 3TR8A 5KRSA 2FXUA 4FM1A 1RBTA 3C65A 1NJZA 4GKKK 3A0IX 2Y1IA 4JKGB 1QQMA 1XWLA 3LP0A 3AVJA 2WC9A 5AQIA 3VQ5A 2Q36A 5D3GA 1L3TA 5AZIB 3SMPA 1JL2A 4B9VA 4B3RK 4CZJA 1FXXA 2KTQA 4WE1A 1GLAG 4NO7A 3WNEA 4IXCA 4CBUA 4IOXA 2RN2A 3WNGA 3DMJA 2UUCK 2NLXA 4KH5A 4CBWA 1JLFA 3Q7BA 1VSLA 4CESA 3T19A 2KZMA 3LM9A 1LWCA 4WQ5A 2VQFK 3RMDA 4H5RA 4DWIA 5FDLA 1P8ZA 3CHWA 5KI6A 3MEEA 4FLTA 5AQTA 3VEVA 1GOAA 4O8UA 4JKFA 1HJRA 3ITHA 1VQKN 1XHXA 3DLGA 3L0QA 3P5JA 4DLGA 1YITN 4FJ9A 1ATSA 5AQYA 4DSIA 1HX1A 3V9WA 2P9UB 2NRZA 4DKWA 5I9EB 3AGRA 1ILYA 2OA8A 3SAHA 5JMVA 1RDUA 3VEZA 2HHWA 4FJKA 4DCHA 4O4GA 3OYNA 1S9EA 2WONA 4NYNA 4LFBK 4NXMK 3VGKA 5LMUK 3RMBA 3K0SA 3NE6A 1ZXOA 1Q7YO 4DF4A 1NGJA 4I7FA 4B1VA 4CK3A 3TSUA 3DXMB 3EL2A 3FZKA 4C1NK 2VG6A 1CXQA 2O8CB 4AHTA 1BGXT 2UYTA 3SAGA 4FJMA 4OVLA 2BDPA 4DR6K 3DAWA 4KKOA 2XY5A 2D1KA 2XO7A 4K25A 1N8RO 2QWQA 5K14A 5EU7A 4CHZA 4AILC 4DUYK 1RT3A 4Z4IA 3DOKA 4F3OA 4Z4GA 3V9UA 4B9MA 3HZ6A 4DSLA 4CI6A 4FJLA 2HB5A 4LSLA 1N33K 1RT1A 3KHYA 4LF8K 4JKGA 2HHHK 2A42A 3A5NC 3F9MA 1VQNN 3P4IA 4QCLA 4KB0A 1TK5A 5E84A 1IKXA 4FWKA 2YX6A 3U8XA 3HOTA 2P9PB 2ZGYA 4CEAA 1U4BA 2GUIA 5AQHA 3AVKA 3M8SA 3SV3A 1LW0A 4BC3A 1TGOA 3SK3A 4IO9L 4DFJA 1EETA 2BE2A 1K8KA 3ZT1A 4A2BA 1J54A 2KFNA 3ZSZA 1HNVA 3OYMA 3CQ8A 1QZ6A 5FLXO 3BF1A 3VERA 5JICA 2IVNA 3E9LA 4H5WA 2ZE2A 4MDBA 2KKZA 1EX4A 4MO5A 1YAGA 3CYMA 1VQ4N 4FJJA 3O4NA 2I5JA 2ZJRL 2YNHA 5F0XA 1YTAA 1C0FA 2P9UA 3TABA 2OYQA 4PQUA 4LSNA 1VSDA 3B6PA 3HT3A 4DV6K 4JD2B 3OYJA 3L3UA 4KB1A 4BRFA 1J53A 4CZMA 4N56A 4PHTX 4FOEA 4FWNA 1X9WA 3HVRA 3HM9A 4Y1DA 3GL1A 3NF6A 3M3ZA 4MDAA 1LCUA 2V7ZA 3TTDA 2HF4A 2Q97A 3L2QA 3GG4A 4XH1A 4BE1A 3DXMA 1B92A 3CJ9A 5AQWA 1TAUA 1FKOA 4A5AA 3SQ0A 1GLLO 1RT4A 1QVGM 4ILGB 4K8ZA 2KZZA 3LDLA 4Q5VA 1ATRA 4OJRA 2OZMA 3TPQA 1QHAA 2NZTA 3ZT4A 4M3UA 2HNYA 3J7ZO 1NMDA 5M1OA 3D45A 1GLFO 3VA3A 1ITGA 3SYZA 2Z1IA 3UE5A 4EIAA 1UOCA 4YOUA 4DFPA 1VSEA 4EHTA 3T1HK 4DTXA 4C8MA 3UIQA 1J9AA 4X64K 4BG9A 4WF9L 2UXBK 2KFZA 4FCYA 5SWMA 3NF7A 3QB0A 4EHUA 3JXUA 2YNGA 1L3VA 2QWLA 3ZX3A 4O0IA 3B6OA 1VRTA 3AVMA 2E2PA 1IO2A 2J4RA 2W6KA 3ZETB 4FLWA 3S9HA 4CEBA 4JK8A 2W6LA 5AQLA 3TI0A 2E1ZA 4ELVA 4FJHA 4CF1A 3ZT0A 2E1YA 3AVGA 5CZ1A 3TAEA 1IJJA 3E1YA 4BY9C 2XY6A 1SKRA 2IIRA 4M41A 1YIJN 4K42A 3OA9A 4CF9A 3WXMB 4JD2A 2WTUA 1Z26A 4KTWA 1W2BM 4DQQA 4RCHA 4CGFA 3EYZA 3P31A 5I3UA 4DTRA 3ATUA 4IG0A 3KWGA 3P38A 1YUWA 1HYSA 2HHUA 3LAMA 4CJUA 3V9XA 2ASMA 2FSKA 5AQQA 3HOSA 1KLNA 3CC4N 4JKAA 4FOIA 2QKKA 4CECA 2XY7A 2ASOA 4MFBA 1XI1A 3HK2A 1V4SA 3GBTA 3THWB 3SJHA 3VTHA 5AFUA 1NGIA 4DHYA 2DTUA 3FZFA 2F96A 2JWLA 5DMRA 1Q9YA 1XUPO 4O0JA 4DV3K 3KK2A 4GV3A 4BRCA 4ID1A 4AM7A 2QW9A 3EE9A 4E7KA 4KTQA 1J5EK 3O1BA 3EKUA 2D0BA 3QO9A 3GOIA 3VEYA 3QETA 3AVLA 4LH5A 4BR9A 1HYZA 1S5JA 4FWLA 4B1XB 3UKUA 4NXNK 5FRNA 3C6TA 4MQ3A 4CJEA 4E7HA 4LF6K 3ZSWA 3RMAA 4FJXA 2Q1NA 2BGGA 1QVFM 1YTUA 3AO2A 4O5FA 3HPOA 2O8FB 3MCAB 4LF7K 5GADP 3ZETA 4RG8A 3J7AP 1K73O 1HQUA 4R79A 2X78A 1U2VB 3RR8A 5AQRA 2FC0A 3CJAA 2UXDK 3T1AA 2ZF5O 4NCGA 3NF8A 1XQSC 3OYBA 4IJNA 1G15A 3MXJA 2F9TA 2BTFA 4Z94A 3O3FA 4ISFA 1YJNN 4BWMA 4KHNA 1YXQA 3DWLA 3R6MA 4CK1A 3EZ5A 4CZLA 3FFKB 3C94A 4KHUA 1SAZA 3CG7A 3IDHA 4M63C 2ITMA 3TTCA 4JYAK 4JS4A 2FLOA 1VQ8N 1NG9A 1HNZK 5AQJA 2F7TA 1IBMK 5KPRA 1C1AA 1UA0A 4EZ9A 1BWFO 2Q0UA 1JXBA 3QMLA 2PY5A 3AA2A 3VQ8A 1IKVA 4A59A 4CJLA 4FK2A 4W5TA 2B6AA 3O3GA 1U04A 1OVYA 3THXB 4FVMA 4Q0BA 2FF3B 4CJTA 1HRHA 3V4IA 2VCPA 5C12A 4CHPA 4FJNA 2Q2RA 4BWJA 4GKJK 1RBRA 2WBNA 4EZ6A 5HOOA 4KTZA 2PBDA 5T7BA 3KLHA 1NK6A 4JKCA 2WUSA 1KQSM 2OCEA 4BDZA 4TSXA 4RTFD 4WYBA 4BGAA 3RMCA 3O9QA 2HSTA 4MLEA 4JRPA 4CJWA 3U6FA 1QHTA 3THVA 2A6AA 3G10A 4IFEA 5MLCQ 3H3OB 2O8FA 1YJWN 1V4TA 3M8PA 4M7XA 1NOYA 3FLCO 4ZTFA 3OW2M 1NGEA 1JL1A 3SUQA 3LP1A 3QLHA 5AQOA 3WXIA 3MN7A 3VQ9A 4RW8A 3NDKA 4JI3K 2OPQA 1RT5A 4JRQA 3SJJA 3T7ZA 4JI5K 3I8DA 5CR4A 2E6MA 4JKBA 3J80O 2QKBA 4BRPA 4M42A 1XNRK 1KSPA 1C0TA 3HXMA 4IFYA 3O6WA 4KBOA 4O44A 1D9FA 2A1SA 1R0AA 5EX5A 4FWPA 1RDAA 3DOLA 4CHYA 4JEPA 2UU9K 1MU2A 4IJAA 3ENOA 3AVFA 1D5AA 3ZSOA 3R1XA 3C7NA 3ZSQA 4DSKA 4BRAA 2QWMA 3LWMA 5GIOA 1J6ZA 4DQSA 2A1RA 3G6EN 3WNFA 4M3TA 5FPMA 3LL3A 4AHUA 3ASMA 4JKDA 4U67L 2P1JA 3KD1E 1ZBIA 1KVCA 4YDUC 1GLJO 4FLUA 2IVPA 3CM6A 3LM2A 5BRFA 5C42A 3DI6A 2O8DB 4EAHD 3MEGA 2CH6A 3NGZA 2ZGZA 4FM2A 4LD0A 3M1FA 3K9KA 4AHRA 4C8NA 1C0MA 3ZSVA 3K57A 2A41A 4ELUA 1I3AA 4JKHA 1C1BA 3P83D 4O8KA 4JI7K 4B1ZA 2P9KA 3K9JA 5M1KA 1JCFA 2F8TA 4YDUA 3C6AA 2X74A 4CJKA 5KTQA 1VSFA 3KK7A 1IKYA 3WEEB 3CQXA 1F21A 4NLCA 1KLMA 2VGMA 1LWFA 3TANA 3VF4A 5HRSA 4L8RB 2F8SA 3DLLL 2VYPA 2HBKA 2O8EA 1KXPA 4OKEA 4IFVA 2IC3A 1HKGA
chains in the Genus database with same CATH topology
2KFNA 3JSMA 4KREA 2QXFA 2XHBA 4HCCA 4H4MA 3AO5A 1DLOA 4OKKA 3ZSZA 4PUOA 3ZT3A 1NK8A 1HNVA 1UWBA 3NBPA 3OYMA 3CQ8A 1U45A 3SUOA 3NGIA 2DFFA 4HUEA 1DTQA 4XIUA 2G8IA 3NH2A 3HYFA 3CFOA 4CF8A 3VQPA 2P51A 2ZE2A 5J2PA 1EX4A 3QEWA 3CYMA 4GW6A 3OS2A 4FJJA 3O4NA 3L2WA 3DLHA 1VSIA 2I5JA 2X6NA 1T05A 2YNHA 3VA0A 4DLEA 1YTAA 3TABA 3VQBA 2OYQA 4PQUA 3ISNC 4CIEA 3S3MA 2DFEA 4LSNA 1VSDA 1TL3A 3RTVA 3B6PA 3HT3A 2G8VA 1FKPA 2D0AA 3AA5X 3OYJA 3L3UA 1IG9A 4KB1A 1LWEA 3HO1A 1J53A 2VG5A 2BANA 4F4KA 2YHAA 5HRNA 5HBMA 4N56A 1NKEA 1KFDA 2YKNA 3FFIA 3T3FA 3DLEA 1TK8A 4EP4A 1X9WA 4UQGA 3HVTA 4RW9A 3HVRA 1SKWA 4CGHA 3HM9A 3VQ6A 3MEDA 3NCIA 3MXIA 4E7LA 1C1CA 1WSJA 4J2DA 4Y1DA 3QNOA 3RR7A 4HUGA 3NF6A 4J2BA 1Q8IA 3NGYA 2G8KA 1YT3A 4OGCA 1RTJA 3BDPA 3L2QA 4BE1A 1RILA 4E89A 1B92A 4HHTA 4ZTJA 3L8BA 2IDOA 5J1EA 3MXMA 1WAFA 1TAUA 1FKOA 2ETJA 1HMVA 2G8HA 3SQ0A 1W9HA 4M3WA 4FJLA 1RT4A 4K8ZA 3KKSA 3VQEA 3HP6A 2KZZA 2JGUA 4Q5VA 4DU4A 4DSFA 2O4GA 4N76A 4OJRA 4W5OA 3AVBA 3OY9A 1RT7A 3DRPA 1LV5A 4CCHA 2WOMA 4EP5A 5CY4A 3VQDA 4ID5A 3L2UA 1BQNA 1WNSA 4F2SA 1NJYA 3K5OA 2DY4A 4CEDA 2KQ2A 3AA4A 3ZT4A 1K6YA 3PY8A 4J2AA 4M3UA 2HNYA 4F2RA 4PWDA 1WLJA 3D45A 4K8XA 3VA3A 2QK9A 2XRIA 1ITGA 3SYZA 3QEXA 2Z1IA 3KK3A 4BDPA 1S1VA 1UOCA 4DG1A 4DFPA 3AV9A 4AHVA 4DQRA 1QSSA 1T7PA 1VSEA 1JLAA 4DSEA 4DTXA 3SQ2A 4FYDA 4C8MA 3OYLA 4GMJB 4N47A 3HL8A 3IG1A 4OPJA 2OZSA 4FZZA 2E6LA 4CJQA 1J9AA 2VG7A 3UIQA 1EXQA 1TKXA 4FW2A 3OVNA 2KFZA 4DTNA 2NUBA 1RT2A 4CJFA 4FCYA 5SWMA 4KV8A 1QSLA 1S1XA 4OLBA 2IOCA 3NF7A 4FLYA 4DU1A 2YKMA 4DS5A 1DTTA 1LAVA 5JS1A 2PZSA 2YNGA 1TVRA 3V1QA 3SZ2A 1Q9XA 2Q3SA 1QS4A 5DK5A 3O3HA 1JLBA 1L3VA 3L2VA 3OYAA 4Z0UA 3OYCA 4CJRA 4O0IA 1BL3A 3B6OA 4YNQA 4FJ5A 4F8RA 1VRTA 1TL1A 1S1UA 3QIOA 2G8UA 3AVMA 1NJXA 4QOZB 3EY1A 1IO2A 4FLWA 3S9HA 1U49A 4B9LA 4DTOA 2OPRA 2RKIA 3VQ7A 4CEBA 1TKDA 3WNHA 3TI0A 1O1WA 4ELVA 4FJHA 4CF1A 3ZT0A 4KPYA 3AVGA 3AVHA 5CZ1A 3TAEA 4BE2A 3KLIA 3QINA 2XY6A 1SKRA 1LW2A 4GVMA 4M41A 3ZSXA 3QEIA 2FBYA 4DSJA 4HCBA 4FJ8A 2HHVA 1YVUA 2ATQA 3IAYA 3M8RA 3V1RA 3DRRA 3VQ4A 1KTQA 4CF9A 4CHNA 3KIOA 4PA1A 3LP3A 4FXDA 5KRTA 1Z26A 3DM2A 4KTWA 5HRRA 4DQQA 4DS4A 1RTDA 4CGFA 3EYZA 5I3UA 3I0SA 4DTRA 2W42A 2AJQA 1C0UA 2Z1JA 4Y1CA 3BGRA 4IG0A 3HPHA 4BE0A 3O4QA 1VRUA 4KHSA 1HYSA 1VK0A 3A2FA 3IS9A 2HHUA 4AHSA 5CZ2A 3LAMA 1XC9A 4CJUA 1S9GA 3V9XA 1D9DA 4W5RA 4M3ZA 4B9UA 3RRGA 4FK4A 1RDDA 1WN7A 1RTIA 1KLNA 3TAFA 3LAKA 4CIGA 4CECA 5E41A 2XY7A 2QKKA 4MFBA 3SI6A 1XI1A 1HYVA 3HK2A 1ZBLA 4CERA 1TKZA 3KK1A 4OKJA 1UAXA 1TKTA 4C8KA 1X1PA 2Z1GA 4LY7A 1A5WA 4OPKA 2G8WA 2DTUA 4PY5A 5KGXA 2F96A 4FZYA 4CFAA 1RNHA 2HVIA 3CFPA 5DMRA 4E3SA 1Q9YA 3LPUA 4B9SA 4J2EA 4O0JA 3L2RA 2GBZA 4E1NA 1J5OA 2JLEA 3MECA 3KK2A 4RW7A 4NCBA 4DQPA 2ZD1A 1VSJA 2VWKA 4ID1A 4E7IA 1BIUA 4Z4EA 3V1OA 4CGDA 4FLZA 4NCAA 4E7KA 4KTQA 4DFMA 4B8CA 3OS0A 1ZYQA 3K58A 1LAWA 3OYFA 3NAEA 3DLRA 1KVBA 1FK9A 5CYQA 3JYTA 2D0BA 3AA3A 3DRSA 3QO9A 2RPIA 4HUFA 3QETA 3AVLA 3C95A 4IKFA 4JLHA 3ZT2A 3AVIA 4H8KA 4W5NA 4LH5A 3LZJA 4CEEA 3KD5E 3AVNA 3NH0A 1HYZA 1S5JA 3RWUA 4KHWA 1B9DA 3OYGA 1BCOA 1QSYA 4CE9A 4E1MA 3PUFA 2HVHA 1WSGA 2YHBA 4CJPA 1NK7A 1CLQA 5CYMA 2ITGA 1IH7A 3M8QA 5FRNA 1NOZA 3C6TA 3G0ZA 4MQ3A 4CJEA 4O5BA 3LWLA 4E7HA 3LP2A 1WSHA 3ZSWA 4H4OA 3PV8A 4CGJA 1WSFA 3RMAA 4HVJA 3TAPA 4FJXA 1WAJA 4CGGA 4CHOA 3SNNA 1N6QA 3RRHA 4DQIA 1YTUA 1REVA 3AO2A 1VSKA 3HPOA 4I9QA 4BDYA 1RBSA 3TWHA 4CJ3A 3ZSYA 4RG8A 5HRPA 1UA1A 5C24A 4E19A 5FRMA 3OJUA 1U47A 1HQUA 2P5OA 2X78A 4E7JA 3ZSRA 1EP4A 3RR8A 4C8OA 2FBTA 3S3OA 2FC0A 1A5VA 3AVCA 3KLGA 4B9TA 3T1AA 1JLGA 4IDKA 4KRFA 4NCGA 4CHQA 3NF8A 4CIFA 3OYBA 4M3XA 3HP9A 2RF2A 3SCXA 4C8LA 1G15A 3MXJA 1ZBFA 4I2QA 1NKCA 1HPZA 1CZBA 5J2QA 5SZTA 2ZQBA 3DLBA 1JXEA 3PO5A 1VSHA 4OGEA 3O3FA 4BWMA 2B5JA 1ASVA 1NK9A 4KHNA 2KW4A 4DTUA 1TK0A 4CFCA 1BQMA 2R7YA 2O4IA 2HHSA 4CK1A 3LPTA 3EZ5A 5KGWA 1RDBA 2IGIA 4I2PA 1KRPA 1RBVA 3PX6A 3C94A 4KHUA 4M42A 1QE1A 3CG7A 4FM0A 4Z4FA 3V9SA 1L3UA 4I9LA 1BCMA 3V9ZA 4CEZA 4JS4A 2HNDA 5FROA 3LALA 3OYKA 4OLAA 1SL0A 4CF2A 2P5GA 4FK0A 2XY8A 1SL1A 3NFAA 4CJVA 4ELTA 4DF8A 2FBXA 1C1AA 1TAQA 3QIPA 3HPGA 1CZ9A 3LDSA 1WSIA 1UA0A 4EZ9A 3QERA 3QNNA 3QEVA 1WSEA 1JXBA 1S6PA 3SUNA 1ASUA 4ZHRA 4YFUA 1S6QA 2YNIA 3AA2A 3VQ8A 1IKVA 4CEOA 2PY5A 4B3OA 3AVAA 4CJLA 4FK2A 4W5TA 3OYHA 1KVAA 2B6AA 3O3GA 4F3TA 1U04A 4B9NA 1A5XA 1KFSA 4NYFA 4QAGA 4FVMA 1GOCA 1TV6A 3SQ1A 2HHXA 4Q0BA 4CGIA 3MAQA 4FW1A 4CJTA 1HRHA 3TAGA 3V4IA 1RCHA 3L3VA 1BI4B 3DLKA 4R5PA 4Z4HA 3OYDA 1NK5A 1CXUA 1SL2A 4CHPA 1JKHA 4BWJA 3K5NA 4CJSA 3KTQA 1RBRA 4FJNA 2IAJA 1L5UA 3IRXA 3AO4A 4EZ6A 5C25A 3LZIA 4CFDA 4IG3A 4ICLA 3SPZA 4KTZA 5T7BA 1NK6A 3KLHA 1C6VA 1HQEA 4FJ7A 3V81A 1D8YA 1EKEA 1JLCA 4RW4A 4CEFA 4BDZA 4TSXA 3TARA 4KAZA 1BHLA 3RMCA 2Y1JA 4JRPA 4CJWA 3NH1A 1S1WA 3U6FA 1QHTA 1Z25A 3QEPA 3U3YA 3SUPA 2FBVA 3THVA 1U48A 1NJWA 1BIZA 1IKWA 4DTPA 3G10A 2KTQA 3TR8A 3F73A 3K5MA 5KRSA 4KI4A 1S1TA 1X9SA 4DU3A 2OZMA 2EX3A 4FM1A 2HHTA 1RBTA 1NJZA 2Y1IA 3M8PA 4DMNA 1N5YA 4CF0A 3VQAA 5JS2A 2HHQA 1NOYA 4ZTFA 1XWLA 4CFBA 3LP0A 3AVJA 3VQ5A 1JL1A 3SUQA 3LP1A 3QLHA 4HTUA 5D3GA 1L3TA 2IS3A 1JL2A 4B9VA 3AO3A 3VQ9A 2D0CA 4FJIA 2X6SA 4RW8A 3KLEA 3KJVA 2OPQA 4KO0A 1RT5A 1FXXA 4WE1A 3NDKA 2OPSA 4JRQA 3I0RA 3PX0A 3SJJA 4O55A 1NK4A 4BACA 3AO1A 3WNEA 4FJGA 3HJFA 3HSTB 3I8DA 3ALYA 2RN2A 3WNGA 3DMJA 3PO4A 2E6MA 3K59A 2QKBA 3TAQA 1JLFA 1RT6A 1VSLA 4RW6A 4B08A 1C0TA 3T19A 4CESA 3OJSA 1KSPA 2YNFA 2KZMA 1LWCA 4IFYA 3OYEA 3HXMA 3SQ4A 3D0PA 2LSNA 1RDCA 4O44A 3LANA 1D9FA 2A1SA 3PX4A 3RMDA 1R0AA 4DWIA 5FDLA 1KCFA 1RDAA 2GV9A 3DOLA 5KI6A 3MEEA 4CHYA 4FLTA 4FLVA 2PYLA 1GOAA 5HP1A 4N41A 4JS5A 4FZXC 1MU2A 1VSMA 1HJRA 3F9KA 3ITHA 1XHXA 3DLGA 2EHGA 3AVFA 1D5AA 4IBNA 3ZSOA 3P5JA 4N5SA 4G1QA 4DLGA 3ZSQA 4DSKA 4FJ9A 1X9MA 3KKRA 1RTHA 4AH9A 3LWMA 4FLXA 3QESA 4W5QA 4DSIA 2HW3A 1W0HA 3V9WA 3KLFA 5HROA 2BGGA 1QTMA 4AHCA 2HNZA 4DQSA 5J2NA 3NHGA 2A1RA 3WNFA 1B9FA 2D5RA 3OYIA 2OA8A 4AHUA 3P1GA 2G8FA 4M3TA 4M3RA 2HHWA 4DTSA 4FJKA 3TAMA 3DYAA 5I42A 4O4GA 3ASMA 3OYNA 1JLEA 1SUQA 3VQCA 3ZCMA 4CEQA 2P1JA 1S9EA 2WONA 4NYNA 4Z4CA 3OS1A 1KVCA 3VN5A 5J2MA 3KD1E 1ZBIA 4CK2A 3RMBA 4FLUA 1T03A 2B4JA 5HLFA 4LH4A 3NE6A 3CM6A 1L3SA 1NKBA 4KHQA 5C42A 3VQQA 1BI4A 3DI6A 3MEGA 3CM5A 4DF4A 4E0DA 4I7FA 1QQCA 4CK3A 2VWJA 3NGZA 4M3YA 2VG6A 1CXQA 1Y97A 3K2PA 1RBUA 1BGXT 4AHTA 4FM2A 4LD0A 3C6UA 1ASWA 4AHRA 4C8NA 1C0MA 3ZSVA 4FJMA 3K57A 4OVLA 2BDPA 3V6DA 4KKOA 4DTMA 2XY5A 3ULDA 4ELUA 1I3AA 1SV5A 2XO7A 1C1BA 3P83D 5EU7A 5K14A 4CHZA 4AILC 1RT3A 3CFRA 4Z4IA 3DOKA 4F3OA 1NK0A 3V9UA 4Z4GA 2PYJA 4B9MA 2F8TA 4DSLA 4CJKA 2X74A 2HB5A 2Z1HA 4LSLA 1VSFA 4CJ5A 4B8AB 5KTQA 4DTJA 1IKYA 3S3NA 3K5LA 4DFKA 1ZBUA 1XHZA 1RT1A 1HNIA 1BISA 1F21A 4QCLA 4KB0A 1TK5A 4KI6A 1KLMA 3E01A 1JLQA 1LWFA 2HMIA 1IKXA 2OPPA 3TANA 1ZBHA 1I39A 3SV4A 2E4LA 4CEAA 3NF9A 1U4BA 5HRSA 1GOBA 2GUIA 3U3GA 1SKSA 4L8RB 2F8SA 1T8EA 3AVKA 3M8SA 4M45A 1LW0A 3SV3A 1TGOA 4CJ4A 4DFJA 1EETA 4KFBA 2BE2A 3SPYA 4OKEA 2DFHA 2YV0X 4KHYA 4IFVA 2IC3A 3H08A 3ZT1A 1J54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFN A;  3JSM A;  4KRE A;  2QXF A;  2XHB A;  4HCC A;  4H4M A;  3AO5 A;  1DLO A;  4OKK A;  3ZSZ A;  4PUO A;  3ZT3 A;  1NK8 A;  1HNV A;  1UWB A;  3NBP A;  3OYM A;  3CQ8 A;  1U45 A;  3SUO A;  3NGI A;  2DFF A;  4HUE A;  1DTQ A;  4XIU A;  2G8I A;  3NH2 A;  3HYF A;  3CFO A;  4CF8 A;  3VQP A;  2P51 A;  2ZE2 A;  5J2P A;  1EX4 A;  3QEW A;  3CYM A;  4GW6 A;  3OS2 A;  4FJJ A;  3O4N A;  3L2W A;  3DLH A;  1VSI A;  2I5J A;  2X6N A;  1T05 A;  2YNH A;  3VA0 A;  4DLE A;  1YTA A;  3TAB A;  3VQB A;  2OYQ A;  4PQU A;  3ISN C;  4CIE A;  3S3M A;  2DFE A;  4LSN A;  1VSD A;  1TL3 A;  3RTV A;  3B6P A;  3HT3 A;  2G8V A;  1FKP A;  2D0A A;  3AA5 X;  3OYJ A;  3L3U A;  1IG9 A;  4KB1 A;  1LWE A;  3HO1 A;  1J53 A;  2VG5 A;  2BAN A;  4F4K A;  2YHA A;  5HRN A;  5HBM A;  4N56 A;  1NKE A;  1KFD A;  2YKN A;  3FFI A;  3T3F A;  3DLE A;  1TK8 A;  4EP4 A;  1X9W A;  4UQG A;  3HVT A;  4RW9 A;  3HVR A;  1SKW A;  4CGH A;  3HM9 A;  3VQ6 A;  3MED A;  3NCI A;  3MXI A;  4E7L A;  1C1C A;  1WSJ A;  4J2D A;  4Y1D A;  3QNO A;  3RR7 A;  4HUG A;  3NF6 A;  4J2B A;  1Q8I A;  3NGY A;  2G8K A;  1YT3 A;  4OGC A;  1RTJ A;  3BDP A;  3L2Q A;  4BE1 A;  1RIL A;  4E89 A;  1B92 A;  4HHT A;  4ZTJ A;  3L8B A;  2IDO A;  5J1E A;  3MXM A;  1WAF A;  1TAU A;  1FKO A;  2ETJ A;  1HMV A;  2G8H A;  3SQ0 A;  1W9H A;  4M3W A;  4FJL A;  1RT4 A;  4K8Z A;  3KKS A;  3VQE A;  3HP6 A;  2KZZ A;  2JGU A;  4Q5V A;  4DU4 A;  4DSF A;  2O4G A;  4N76 A;  4OJR A;  4W5O A;  3AVB A;  3OY9 A;  1RT7 A;  3DRP A;  1LV5 A;  4CCH A;  2WOM A;  4EP5 A;  5CY4 A;  3VQD A;  4ID5 A;  3L2U A;  1BQN A;  1WNS A;  4F2S A;  1NJY A;  3K5O A;  2DY4 A;  4CED A;  2KQ2 A;  3AA4 A;  3ZT4 A;  1K6Y A;  3PY8 A;  4J2A A;  4M3U A;  2HNY A;  4F2R A;  4PWD A;  1WLJ A;  3D45 A;  4K8X A;  3VA3 A;  2QK9 A;  2XRI A;  1ITG A;  3SYZ A;  3QEX A;  2Z1I A;  3KK3 A;  4BDP A;  1S1V A;  1UOC A;  4DG1 A;  4DFP A;  3AV9 A;  4AHV A;  4DQR A;  1QSS A;  1T7P A;  1VSE A;  1JLA A;  4DSE A;  4DTX A;  3SQ2 A;  4FYD A;  4C8M A;  3OYL A;  4GMJ B;  4N47 A;  3HL8 A;  3IG1 A;  4OPJ A;  2OZS A;  4FZZ A;  2E6L A;  4CJQ A;  1J9A A;  2VG7 A;  3UIQ A;  1EXQ A;  1TKX A;  4FW2 A;  3OVN A;  2KFZ A;  4DTN A;  2NUB A;  1RT2 A;  4CJF A;  4FCY A;  5SWM A;  4KV8 A;  1QSL A;  1S1X A;  4OLB A;  2IOC A;  3NF7 A;  4FLY A;  4DU1 A;  2YKM A;  4DS5 A;  1DTT A;  1LAV A;  5JS1 A;  2PZS A;  2YNG A;  1TVR A;  3V1Q A;  3SZ2 A;  1Q9X A;  2Q3S A;  1QS4 A;  5DK5 A;  3O3H A;  1JLB A;  1L3V A;  3L2V A;  3OYA A;  4Z0U A;  3OYC A;  4CJR A;  4O0I A;  1BL3 A;  3B6O A;  4YNQ A;  4FJ5 A;  4F8R A;  1VRT A;  1TL1 A;  1S1U A;  3QIO A;  2G8U A;  3AVM A;  1NJX A;  4QOZ B;  3EY1 A;  1IO2 A;  4FLW A;  3S9H A;  1U49 A;  4B9L A;  4DTO A;  2OPR A;  2RKI A;  3VQ7 A;  4CEB A;  1TKD A;  3WNH A;  3TI0 A;  1O1W A;  4ELV A;  4FJH A;  4CF1 A;  3ZT0 A;  4KPY A;  3AVG A;  3AVH A;  5CZ1 A;  3TAE A;  4BE2 A;  3KLI A;  3QIN A;  2XY6 A;  1SKR A;  1LW2 A;  4GVM A;  4M41 A;  3ZSX A;  3QEI A;  2FBY A;  4DSJ A;  4HCB A;  4FJ8 A;  2HHV A;  1YVU A;  2ATQ A;  3IAY A;  3M8R A;  3V1R A;  3DRR A;  3VQ4 A;  1KTQ A;  4CF9 A;  4CHN A;  3KIO A;  4PA1 A;  3LP3 A;  4FXD A;  5KRT A;  1Z26 A;  3DM2 A;  4KTW A;  5HRR A;  4DQQ A;  4DS4 A;  1RTD A;  4CGF A;  3EYZ A;  5I3U A;  3I0S A;  4DTR A;  2W42 A;  2AJQ A;  1C0U A;  2Z1J A;  4Y1C A;  3BGR A;  4IG0 A;  3HPH A;  4BE0 A;  3O4Q A;  1VRU A;  4KHS A;  1HYS A;  1VK0 A;  3A2F A;  3IS9 A;  2HHU A;  4AHS A;  5CZ2 A;  3LAM A;  1XC9 A;  4CJU A;  1S9G A;  3V9X A;  1D9D A;  4W5R A;  4M3Z A;  4B9U A;  3RRG A;  4FK4 A;  1RDD A;  1WN7 A;  1RTI A;  1KLN A;  3TAF A;  3LAK A;  4CIG A;  4CEC A;  5E41 A;  2XY7 A;  2QKK A;  4MFB A;  3SI6 A;  1XI1 A;  1HYV A;  3HK2 A;  1ZBL A;  4CER A;  1TKZ A;  3KK1 A;  4OKJ A;  1UAX A;  1TKT A;  4C8K A;  1X1P A;  2Z1G A;  4LY7 A;  1A5W A;  4OPK A;  2G8W A;  2DTU A;  4PY5 A;  5KGX A;  2F96 A;  4FZY A;  4CFA A;  1RNH A;  2HVI A;  3CFP A;  5DMR A;  4E3S A;  1Q9Y A;  3LPU A;  4B9S A;  4J2E A;  4O0J A;  3L2R A;  2GBZ A;  4E1N A;  1J5O A;  2JLE A;  3MEC A;  3KK2 A;  4RW7 A;  4NCB A;  4DQP A;  2ZD1 A;  1VSJ A;  2VWK A;  4ID1 A;  4E7I A;  1BIU A;  4Z4E A;  3V1O A;  4CGD A;  4FLZ A;  4NCA A;  4E7K A;  4KTQ A;  4DFM A;  4B8C A;  3OS0 A;  1ZYQ A;  3K58 A;  1LAW A;  3OYF A;  3NAE A;  3DLR A;  1KVB A;  1FK9 A;  5CYQ A;  3JYT A;  2D0B A;  3AA3 A;  3DRS A;  3QO9 A;  2RPI A;  4HUF A;  3QET A;  3AVL A;  3C95 A;  4IKF A;  4JLH A;  3ZT2 A;  3AVI A;  4H8K A;  4W5N A;  4LH5 A;  3LZJ A;  4CEE A;  3KD5 E;  3AVN A;  3NH0 A;  1HYZ A;  1S5J A;  3RWU A;  4KHW A;  1B9D A;  3OYG A;  1BCO A;  1QSY A;  4CE9 A;  4E1M A;  3PUF A;  2HVH A;  1WSG A;  2YHB A;  4CJP A;  1NK7 A;  1CLQ A;  5CYM A;  2ITG A;  1IH7 A;  3M8Q A;  5FRN A;  1NOZ A;  3C6T A;  3G0Z A;  4MQ3 A;  4CJE A;  4O5B A;  3LWL A;  4E7H A;  3LP2 A;  1WSH A;  3ZSW A;  4H4O A;  3PV8 A;  4CGJ A;  1WSF A;  3RMA A;  4HVJ A;  3TAP A;  4FJX A;  1WAJ A;  4CGG A;  4CHO A;  3SNN A;  1N6Q A;  3RRH A;  4DQI A;  1YTU A;  1REV A;  3AO2 A;  1VSK A;  3HPO A;  4I9Q A;  4BDY A;  1RBS A;  3TWH A;  4CJ3 A;  3ZSY A;  4RG8 A;  5HRP A;  1UA1 A;  5C24 A;  4E19 A;  5FRM A;  3OJU A;  1U47 A;  1HQU A;  2P5O A;  2X78 A;  4E7J A;  3ZSR A;  1EP4 A;  3RR8 A;  4C8O A;  2FBT A;  3S3O A;  2FC0 A;  1A5V A;  3AVC A;  3KLG A;  4B9T A;  3T1A A;  1JLG A;  4IDK A;  4KRF A;  4NCG A;  4CHQ A;  3NF8 A;  4CIF A;  3OYB A;  4M3X A;  3HP9 A;  2RF2 A;  3SCX A;  4C8L A;  1G15 A;  3MXJ A;  1ZBF A;  4I2Q A;  1NKC A;  1HPZ A;  1CZB A;  5J2Q A;  5SZT A;  2ZQB A;  3DLB A;  1JXE A;  3PO5 A;  1VSH A;  4OGE A;  3O3F A;  4BWM A;  2B5J A;  1ASV A;  1NK9 A;  4KHN A;  2KW4 A;  4DTU A;  1TK0 A;  4CFC A;  1BQM A;  2R7Y A;  2O4I A;  2HHS A;  4CK1 A;  3LPT A;  3EZ5 A;  5KGW A;  1RDB A;  2IGI A;  4I2P A;  1KRP A;  1RBV A;  3PX6 A;  3C94 A;  4KHU A;  4M42 A;  1QE1 A;  3CG7 A;  4FM0 A;  4Z4F A;  3V9S A;  1L3U A;  4I9L A;  1BCM A;  3V9Z A;  4CEZ A;  4JS4 A;  2HND A;  5FRO A;  3LAL A;  3OYK A;  4OLA A;  1SL0 A;  4CF2 A;  2P5G A;  4FK0 A;  2XY8 A;  1SL1 A;  3NFA A;  4CJV A;  4ELT A;  4DF8 A;  2FBX A;  1C1A A;  1TAQ A;  3QIP A;  3HPG A;  1CZ9 A;  3LDS A;  1WSI A;  1UA0 A;  4EZ9 A;  3QER A;  3QNN A;  3QEV A;  1WSE A;  1JXB A;  1S6P A;  3SUN A;  1ASU A;  4ZHR A;  4YFU A;  1S6Q A;  2YNI A;  3AA2 A;  3VQ8 A;  1IKV A;  4CEO A;  2PY5 A;  4B3O A;  3AVA A;  4CJL A;  4FK2 A;  4W5T A;  3OYH A;  1KVA A;  2B6A A;  3O3G A;  4F3T A;  1U04 A;  4B9N A;  1A5X A;  1KFS A;  4NYF A;  4QAG A;  4FVM A;  1GOC A;  1TV6 A;  3SQ1 A;  2HHX A;  4Q0B A;  4CGI A;  3MAQ A;  4FW1 A;  4CJT A;  1HRH A;  3TAG A;  3V4I A;  1RCH A;  3L3V A;  1BI4 B;  3DLK A;  4R5P A;  4Z4H A;  3OYD A;  1NK5 A;  1CXU A;  1SL2 A;  4CHP A;  1JKH A;  4BWJ A;  3K5N A;  4CJS A;  3KTQ A;  1RBR A;  4FJN A;  2IAJ A;  1L5U A;  3IRX A;  3AO4 A;  4EZ6 A;  5C25 A;  3LZI A;  4CFD A;  4IG3 A;  4ICL A;  3SPZ A;  4KTZ A;  5T7B A;  1NK6 A;  3KLH A;  1C6V A;  1HQE A;  4FJ7 A;  3V81 A;  1D8Y A;  1EKE A;  1JLC A;  4RW4 A;  4CEF A;  4BDZ A;  4TSX A;  3TAR A;  4KAZ A;  1BHL A;  3RMC A;  2Y1J A;  4JRP A;  4CJW A;  3NH1 A;  1S1W A;  3U6F A;  1QHT A;  1Z25 A;  3QEP A;  3U3Y A;  3SUP A;  2FBV A;  3THV A;  1U48 A;  1NJW A;  1BIZ A;  1IKW A;  4DTP A;  3G10 A;  2KTQ A;  3TR8 A;  3F73 A;  3K5M A;  5KRS A;  4KI4 A;  1S1T A;  1X9S A;  4DU3 A;  2OZM A;  2EX3 A;  4FM1 A;  2HHT A;  1RBT A;  1NJZ A;  2Y1I A;  3M8P A;  4DMN A;  1N5Y A;  4CF0 A;  3VQA A;  5JS2 A;  2HHQ A;  1NOY A;  4ZTF A;  1XWL A;  4CFB A;  3LP0 A;  3AVJ A;  3VQ5 A;  1JL1 A;  3SUQ A;  3LP1 A;  3QLH A;  4HTU A;  5D3G A;  1L3T A;  2IS3 A;  1JL2 A;  4B9V A;  3AO3 A;  3VQ9 A;  2D0C A;  4FJI A;  2X6S A;  4RW8 A;  3KLE A;  3KJV A;  2OPQ A;  4KO0 A;  1RT5 A;  1FXX A;  4WE1 A;  3NDK A;  2OPS A;  4JRQ A;  3I0R A;  3PX0 A;  3SJJ A;  4O55 A;  1NK4 A;  4BAC A;  3AO1 A;  3WNE A;  4FJG A;  3HJF A;  3HST B;  3I8D A;  3ALY A;  2RN2 A;  3WNG A;  3DMJ A;  3PO4 A;  2E6M A;  3K59 A;  2QKB A;  3TAQ A;  1JLF A;  1RT6 A;  1VSL A;  4RW6 A;  4B08 A;  1C0T A;  3T19 A;  4CES A;  3OJS A;  1KSP A;  2YNF A;  2KZM A;  1LWC A;  4IFY A;  3OYE A;  3HXM A;  3SQ4 A;  3D0P A;  2LSN A;  1RDC A;  4O44 A;  3LAN A;  1D9F A;  2A1S A;  3PX4 A;  3RMD A;  1R0A A;  4DWI A;  5FDL A;  1KCF A;  1RDA A;  2GV9 A;  3DOL A;  5KI6 A;  3MEE A;  4CHY A;  4FLT A;  4FLV A;  2PYL A;  1GOA A;  5HP1 A;  4N41 A;  4JS5 A;  4FZX C;  1MU2 A;  1VSM A;  1HJR A;  3F9K A;  3ITH A;  1XHX A;  3DLG A;  2EHG A;  3AVF A;  1D5A A;  4IBN A;  3ZSO A;  3P5J A;  4N5S A;  4G1Q A;  4DLG A;  3ZSQ A;  4DSK A;  4FJ9 A;  1X9M A;  3KKR A;  1RTH A;  4AH9 A;  3LWM A;  4FLX A;  3QES A;  4W5Q A;  4DSI A;  2HW3 A;  1W0H A;  3V9W A;  3KLF A;  5HRO A;  2BGG A;  1QTM A;  4AHC A;  2HNZ A;  4DQS A;  5J2N A;  3NHG A;  2A1R A;  3WNF A;  1B9F A;  2D5R A;  3OYI A;  2OA8 A;  4AHU A;  3P1G A;  2G8F A;  4M3T A;  4M3R A;  2HHW A;  4DTS A;  4FJK A;  3TAM A;  3DYA A;  5I42 A;  4O4G A;  3ASM A;  3OYN A;  1JLE A;  1SUQ A;  3VQC A;  3ZCM A;  4CEQ A;  2P1J A;  1S9E A;  2WON A;  4NYN A;  4Z4C A;  3OS1 A;  1KVC A;  3VN5 A;  5J2M A;  3KD1 E;  1ZBI A;  4CK2 A;  3RMB A;  4FLU A;  1T03 A;  2B4J A;  5HLF A;  4LH4 A;  3NE6 A;  3CM6 A;  1L3S A;  1NKB A;  4KHQ A;  5C42 A;  3VQQ A;  1BI4 A;  3DI6 A;  3MEG A;  3CM5 A;  4DF4 A;  4E0D A;  4I7F A;  1QQC A;  4CK3 A;  2VWJ A;  3NGZ A;  4M3Y A;  2VG6 A;  1CXQ A;  1Y97 A;  3K2P A;  1RBU A;  1BGX T;  4AHT A;  4FM2 A;  4LD0 A;  3C6U A;  1ASW A;  4AHR A;  4C8N A;  1C0M A;  3ZSV A;  4FJM A;  3K57 A;  4OVL A;  2BDP A;  3V6D A;  4KKO A;  4DTM A;  2XY5 A;  3ULD A;  4ELU A;  1I3A A;  1SV5 A;  2XO7 A;  1C1B A;  3P83 D;  5EU7 A;  5K14 A;  4CHZ A;  4AIL C;  1RT3 A;  3CFR A;  4Z4I A;  3DOK A;  4F3O A;  1NK0 A;  3V9U A;  4Z4G A;  2PYJ A;  4B9M A;  2F8T A;  4DSL A;  4CJK A;  2X74 A;  2HB5 A;  2Z1H A;  4LSL A;  1VSF A;  4CJ5 A;  4B8A B;  5KTQ A;  4DTJ A;  1IKY A;  3S3N A;  3K5L A;  4DFK A;  1ZBU A;  1XHZ A;  1RT1 A;  1HNI A;  1BIS A;  1F21 A;  4QCL A;  4KB0 A;  1TK5 A;  4KI6 A;  1KLM A;  3E01 A;  1JLQ A;  1LWF A;  2HMI A;  1IKX A;  2OPP A;  3TAN A;  1ZBH A;  1I39 A;  3SV4 A;  2E4L A;  4CEA A;  3NF9 A;  1U4B A;  5HRS A;  1GOB A;  2GUI A;  3U3G A;  1SKS A;  4L8R B;  2F8S A;  1T8E A;  3AVK A;  3M8S A;  4M45 A;  1LW0 A;  3SV3 A;  1TGO A;  4CJ4 A;  4DFJ A;  1EET A;  4KFB A;  2BE2 A;  3SPY A;  4OKE A;  2DFH A;  2YV0 X;  4KHY A;  4IFV A;  2IC3 A;  3H08 A;  3ZT1 A;  1J54 A; 
#chains in the Genus database with same CATH topology
 4DV4 K;  2XHB A;  4H4M A;  3AO5 A;  2YHX A;  2ZJP L;  4PUO A;  1OH8 A;  4LF9 K;  1NK8 A;  3NBP A;  1U45 A;  1DT9 A;  2DFF A;  3C6H A;  3NH2 A;  1VAZ A;  2P51 A;  3IUC A;  3M5R A;  3THY B;  3AY9 A;  2HBL A;  1T05 A;  3VA0 A;  3O1W A;  2QWO A;  1TL3 A;  3D2F B;  1OH6 A;  3HI0 A;  3AA5 X;  3HO1 A;  4JI0 K;  3CCS N;  4FVU A;  1KFD A;  3T3F A;  4BRI A;  1TK8 A;  1BO5 O;  2HBJ A;  4UQG A;  5GIN A;  5H1S Q;  1N36 K;  1X9J A;  1R59 O;  4KH4 A;  3QNO A;  4HUG A;  4FL9 A;  3NGY A;  2O8D A;  5HL7 L;  3SBG A;  1RTJ A;  1RIL A;  1U6Z A;  3L8B A;  1WAF A;  2G8H A;  2ETJ A;  1HMV A;  1W9H A;  4CD1 A;  3KKS A;  3HP6 A;  3LDO A;  4DU4 A;  4DSF A;  3WQU A;  4N76 A;  3AVB A;  3OY9 A;  1D4X A;  4F2S A;  2DY4 A;  4ID5 A;  3L2U A;  3K5O A;  4OX9 K;  4BQL A;  2P9I B;  4PWD A;  1WLJ A;  5ADX A;  3QEX A;  4YOW A;  3AV9 A;  4DQR A;  1JLA A;  2V52 B;  3HSC A;  2YHW A;  3OYL A;  4GMJ B;  4XH4 A;  4DV0 K;  4N47 A;  3VEN A;  4OPJ A;  2OZS A;  2E6L A;  4CJQ A;  3UKR A;  2E2N A;  2NUB A;  1RT2 A;  4CJF A;  4OLB A;  1QSL A;  3W3D A;  2IOC A;  4I6M B;  1DTT A;  2PZS A;  1TVR A;  3SZ2 A;  2Q3S A;  1QS4 A;  1RDW X;  3LDN A;  4BRL A;  4Z0U A;  4HTL A;  3OYC A;  2P9L A;  4FJ5 A;  5BPM A;  3QIO A;  2G8U A;  4QOZ B;  3EY1 A;  5LMN K;  4IOA L;  4DTO A;  2NRW A;  3VF6 A;  5AQN A;  3S41 A;  1O1W A;  5M1F A;  4JI4 K;  4KPY A;  4LF4 K;  3AVH A;  3CPE A;  2HF3 A;  3THY A;  4GVM A;  3QEI A;  4DSJ A;  3E9P A;  3A5L C;  2H3G X;  5AZI A;  4JHD B;  3N4Q A;  4CHN A;  1W7A A;  3KIO A;  3LP3 A;  5KRT A;  5HRR A;  3DM2 A;  1EWR A;  3N4P A;  1Z05 A;  4FWS A;  2AJQ A;  2Z1J A;  3RVC A;  4BE0 A;  2CGL A;  4KHS A;  1VK0 A;  3A2F A;  3IS9 A;  3AGK A;  1XC9 A;  1IBK K;  1S9G A;  3EN9 A;  4W5R A;  3IMX A;  4JNE A;  1YI2 N;  4LY7 A;  4G9Z A;  4PY5 A;  4CFA A;  1RNH A;  4CW7 B;  4E3S A;  3LPU A;  4B9S A;  1JJ2 M;  4DQP A;  2P9I A;  3I8B A;  4CGD A;  3PLA A;  4DFM A;  1WUA A;  4BR2 A;  5AQX A;  1ZYQ A;  3K58 A;  1LAW A;  3NAE A;  2E5L K;  3DLR A;  1FK9 A;  5CYQ A;  4IKF A;  3DRS A;  4HUF A;  1TUY A;  4JLH A;  3AVI A;  4H8K A;  4W5N A;  4CEE A;  1DKG D;  3TU5 A;  4YOX A;  1BCO A;  1QSY A;  4CE9 A;  5B8H A;  2O8C A;  1XMQ K;  3BUZ B;  4I6M A;  1NK7 A;  2PFU A;  1CLQ A;  4FWM A;  1NOZ A;  2DPN A;  3LWL A;  3CCR N;  1WSH A;  4H4O A;  4CGJ A;  1WSF A;  3TAP A;  4HVJ A;  4CHO A;  3RRH A;  4HWI A;  1RBS A;  4CJ3 A;  1UA1 A;  3CC7 N;  5C24 A;  5FRM A;  4DQ8 A;  3LDQ A;  1U47 A;  2P5O A;  4WFB L;  3RSE B;  3H1Q A;  3HBT A;  5C15 A;  1YF5 L;  3OBY A;  3AVC A;  3A5M C;  4B9T A;  3FR0 A;  4PKG A;  3IKM A;  4IDK A;  4KRF A;  4CHQ A;  4BR5 A;  3PSI A;  1TYQ B;  2P9P A;  4CIF A;  4M3X A;  2RF2 A;  4E1J A;  4JHD A;  4I2Q A;  1CZB A;  5J2Q A;  4CVN E;  1JXE A;  4DV5 K;  3PO5 A;  2EWS A;  5F2R A;  2O4I A;  2HHS A;  5KGW A;  5KPT A;  2IGI A;  4I2P A;  1RBV A;  2GUP A;  3PX6 A;  4FSV A;  3GDQ A;  3V9S A;  1L3U A;  4I9L A;  3MDQ A;  3V9Z A;  5AQP A;  2QXL A;  1X3M A;  3FE1 A;  4CZG A;  1SL0 A;  2CGK A;  2XY8 A;  4M7Y A;  3U9D A;  2FBX A;  3QIP A;  1T6C A;  3LDS A;  3QNN A;  3SUN A;  3R8E A;  4ZHR A;  2YNI A;  4CEO A;  4LF5 K;  1BOT O;  3AVA A;  3G71 N;  3PSF A;  3BY5 A;  1KVA A;  2E88 A;  3CJ7 A;  4FWQ A;  4NYF A;  1GOC A;  1K9M O;  4JI8 K;  2ASP A;  4CGI A;  3MAQ A;  4FW1 A;  1I94 K;  4AF1 A;  3T69 A;  3L3V A;  5M1N A;  5EY4 A;  1SL2 A;  3K5N A;  3ZEU B;  3LZI A;  4CFD A;  4IG3 A;  3D2E B;  4ICL A;  3CMA N;  3SPZ A;  4JK7 A;  4FJ7 A;  4UY8 O;  1E3M A;  1HQE A;  3V81 A;  4CEF A;  1BHL A;  2Y1J A;  1QSS A;  3NH1 A;  3QEP A;  1BIZ A;  1IKW A;  5AQS A;  3F73 A;  3K5M A;  4CBX A;  4KI4 A;  1S1T A;  4K43 A;  1X9S A;  4DU3 A;  2EX3 A;  2HHT A;  1QQO A;  4DMN A;  1N5Y A;  4CF0 A;  3VQA A;  4H0O A;  4X65 K;  4CFB A;  3TTF A;  4DR3 K;  5E26 A;  4BRQ A;  2IS3 A;  1WOQ A;  1HKB A;  3AO3 A;  4GNI A;  2D0C A;  2Q31 A;  3A8Y A;  3KLE A;  1TYQ A;  4KO0 A;  2OPS A;  1NK4 A;  4O55 A;  3HJF A;  4PL7 A;  3ALY A;  1Q82 O;  3PO4 A;  3K59 A;  4IWV A;  4RW6 A;  2JWK A;  3OJS A;  3CC2 N;  1VQ9 N;  2D4W A;  2YNF A;  5FPD A;  3D0P A;  2A5X A;  3CCM N;  3PX4 A;  4X62 K;  1KCF A;  4H5T A;  2GV9 A;  2PYL A;  3CCJ N;  3F9K A;  2EHG A;  4PKH A;  4N5S A;  4G1Q A;  3NVK A;  1MWM A;  3W0L A;  5AQZ A;  2QI2 A;  1X9M A;  4AH9 A;  3KVG A;  4W5Q A;  3ZYY X;  2HW3 A;  1W0H A;  3KLF A;  1QTM A;  4AHC A;  3OYI A;  1B9F A;  2D5R A;  2G8F A;  4WCE L;  3DYA A;  3VEW A;  1SUQ A;  3BEX A;  3VQC A;  1Z6R A;  3EO3 A;  1NM1 A;  3DXK B;  4ILJ A;  4Z4C A;  3VN5 A;  2YJE A;  2YHY A;  3UB5 A;  4CK2 A;  4OO1 J;  3H1V X;  4AQY K;  5BRH A;  4Y0W A;  1L3S A;  1NKB A;  3VQQ A;  1IG8 A;  3MN6 A;  3CM5 A;  5F1X A;  4E0D A;  4YOT A;  3BF3 A;  4A5B A;  1QQC A;  3ZEU A;  1Y97 A;  3K2P A;  1RBU A;  1HPM A;  5GAG P;  1S22 A;  4IO8 A;  3THW A;  3ZX0 A;  4YY3 K;  3ULD A;  2P9S B;  1SV5 A;  2Q0R A;  3P39 A;  1VQ6 N;  1NK0 A;  5AQF A;  1XC3 A;  4CJ5 A;  4B8A B;  1XHZ A;  3ID8 A;  1OH5 A;  2RE2 A;  2E8A A;  1NMN A;  1KAY A;  1E4F T;  1E4G T;  2GEL A;  1BIS A;  4A57 A;  1KC8 O;  4KI6 A;  1HUX A;  4WQ4 C;  4PL8 A;  3D7E O;  3HM8 A;  2HMP A;  2E4L A;  3O9R A;  1HNX K;  1KAX A;  2FSN A;  3OHR A;  1GOB A;  1SKS A;  4C1N I;  5DM7 L;  4M45 A;  4CJ4 A;  4U7B A;  1T3V A;  4KFB A;  3SPY A;  2DFH A;  3MCP A;  5KQ8 A;  3A5O C;  4OKK A;  5AZJ B;  4DV1 K;  3SUO A;  4HUE A;  2NRV A;  2F9W A;  2G8I A;  3ENH A;  3CFO A;  4JAX A;  4ISE A;  3VQP A;  1XMO K;  3AAP A;  3QIC A;  3OBW A;  1NLV A;  4BVP A;  4GW6 A;  4C23 A;  3L2W A;  3DLH A;  1U2V A;  1VSI A;  5JLF A;  4WQ4 A;  3VQB A;  3S3M A;  3VEO A;  1FKP A;  2D0A A;  4JI1 K;  4F4K A;  5HRN A;  1NKE A;  5HBM A;  3FFI A;  3DLE A;  2O8B B;  4EP4 A;  4LFA K;  3DXK A;  3HVT A;  4RW9 A;  3ENB A;  4CGH A;  3CCQ N;  1NGC A;  3VQ6 A;  3NCI A;  1NWK A;  2NRR A;  4E7L A;  1WSJ A;  1C0G A;  2I7N A;  4J2D A;  3H45 C;  4GY2 B;  1NGG A;  1T6D A;  1Q8I A;  5A2Q O;  3J8A A;  3U4L A;  4OGC A;  3OTO K;  3L4Q A;  4E89 A;  2IVO A;  3CQY A;  4HHT A;  5TKW A;  5J1E A;  4DR1 K;  2OTJ N;  1JCG A;  3WT0 A;  1H1V A;  2JGU A;  2O4G A;  4JKE A;  1RT7 A;  3DRP A;  3SLC A;  1OKJ A;  4H5V A;  4CED A;  2KQ2 A;  4BRD A;  4J2A A;  3LDP A;  4F2R A;  2QK9 A;  3THX A;  2KHO A;  3KK3 A;  1S1V A;  4DG1 A;  3BZC A;  4AHV A;  1VQL N;  4DSE A;  2YI1 A;  3SBT A;  3EEQ A;  5GIP A;  3HL8 A;  3IG1 A;  4FZZ A;  2VG7 A;  4A62 A;  4PKI A;  1NNE A;  4FW2 A;  5JVG L;  3B8A X;  4DTN A;  3O9U A;  4KV8 A;  1S1X A;  4FLY A;  2YKM A;  5JS1 A;  1LAV A;  3V1Q A;  1Q9X A;  5DK5 A;  3R9P A;  1JLB A;  3HRG A;  3L6Q A;  3OYA A;  4CJR A;  2WFB A;  1BL3 A;  2E20 A;  1NU0 A;  4F8R A;  4DR4 K;  1NJI O;  1NJX A;  2ZM6 K;  5AZJ A;  2PAV A;  4DR2 K;  4B9L A;  1TKD A;  3QBX A;  1T44 A;  2UUB K;  3CCE N;  4BE2 A;  1HLU A;  3CIP A;  3QIN A;  5BR9 A;  3ZSX A;  4FJ8 A;  2FBY A;  3VOV A;  1YVU A;  2ATQ A;  4BRE A;  3IAY A;  3M8R A;  3DRR A;  3VQ4 A;  3SAF A;  1X3N A;  4PA1 A;  4DV2 K;  1BU6 O;  4B3T K;  3CI5 A;  4H0P A;  5ELZ A;  4DS4 A;  3ZLJ A;  3O08 A;  4Y1C A;  3BGR A;  5DM6 L;  3HPH A;  3O4Q A;  5LY3 A;  1VRU A;  4H03 B;  3BP8 A;  5LL6 Z;  1D9D A;  4M3Z A;  3PIO L;  4B9U A;  3RRG A;  1WN7 A;  1RTI A;  3TAF A;  3LAK A;  4CIG A;  1SS6 A;  5E41 A;  3SI6 A;  1HYV A;  5BPL A;  4CER A;  1TKZ A;  3KK1 A;  5CHI A;  1QQN A;  1X1P A;  4C8K A;  1LOT B;  2FSJ A;  2QEX N;  2GX9 A;  2GEM A;  1WB9 A;  2HVI A;  3CFP A;  3FZL A;  4FO0 A;  3L2R A;  1J5O A;  3MEC A;  3VET A;  4YOV A;  4NCB A;  4H5N A;  2NNW A;  3MWT A;  2ZD1 A;  2VWK A;  4ISG A;  4E7I A;  1BIU A;  3FZH A;  4FLZ A;  4NCA A;  4B8C A;  3D6R A;  5LJW A;  4H0V B;  2QWR A;  3OS0 A;  1O13 A;  3OYF A;  1SL1 A;  1SKW A;  3QEV A;  2RPI A;  5BRE A;  3ZT2 A;  4FPA A;  3LZJ A;  3KD5 E;  3NH0 A;  4XEI A;  5IT9 O;  3O9T A;  1B9D A;  3OYG A;  2ZWH A;  1BA0 A;  5AFU H;  4E1M A;  3PUF A;  4JV5 K;  2HVH A;  4CJP A;  1K8K B;  3JS6 A;  1NGD A;  5CYM A;  2ITG A;  3M8Q A;  1NGH A;  4O5B A;  5JLH A;  4OPH A;  3T1Y K;  3LP2 A;  1SZ2 A;  4KHQ A;  3VES A;  4A2A A;  1N6Q A;  1REV A;  1GLC G;  5FPE A;  4I9Q A;  1KD1 O;  4FPB A;  3ZSY A;  5HRP A;  4E19 A;  3ULE B;  4BR4 A;  3WEE A;  4L3Q A;  3EE8 A;  3ZSR A;  1EP4 A;  3O9S A;  4C8O A;  2FBT A;  3S3O A;  5M1P A;  3KLG A;  1FW6 A;  4FWR A;  3GE1 A;  4NB4 A;  2NRX A;  2D0O A;  3HP9 A;  3EZW A;  1NKC A;  1HPZ A;  4MLH A;  5SZT A;  2VWB A;  1VQO N;  4OGE A;  2KW4 A;  1TK0 A;  1NGB A;  4BR0 A;  1BQM A;  1VQ7 N;  1NGA A;  3VGM A;  4DB3 A;  3PIP L;  4Z4F A;  4CEZ A;  3CCL N;  3LAL A;  2V51 B;  4CF2 A;  2P5G A;  4CJV A;  4DF8 A;  4BRG A;  4BRK A;  1TAQ A;  1CZ9 A;  3QBW A;  2GTD A;  4YFU A;  3D2F A;  3CJC A;  1A5X A;  1KFS A;  4QAG A;  3SQ1 A;  3CPW M;  3TAG A;  3G4S N;  1BI4 B;  2UXC K;  4R5P A;  4Z4H A;  3OYD A;  1NK5 A;  1VQP N;  1JKH A;  3CJB A;  4J8F A;  2IAJ A;  1L5U A;  2UUA K;  4LC9 B;  3CER A;  1C6V A;  2I7P A;  3VMF B;  1D8Y A;  1EKE A;  1JLC A;  4RW4 A;  3TAR A;  4KAZ A;  1U48 A;  1Z25 A;  3U3Y A;  1VQ5 N;  2FBV A;  3DJC A;  4H0X B;  2AA4 A;  5IWA K;  3TSP A;  3CF5 L;  2NRH A;  2HHQ A;  5JS2 A;  3ULE A;  3SMS A;  3EKS A;  4HTU A;  1ATN A;  4DR5 K;  1TUU A;  4FJI A;  2X6S A;  3KJV A;  3PX0 A;  3I0R A;  4FJG A;  4BAC A;  3AO1 A;  3HST B;  3MN9 A;  3TAQ A;  1RT6 A;  4B08 A;  4BGB A;  3OYE A;  2OAN A;  3SQ4 A;  2LSN A;  1RDC A;  4JK9 A;  3LAN A;  4CZE A;  4YHH K;  5C10 A;  4QS7 A;  3E66 A;  4FLV A;  4CZI A;  1WBB A;  1ZBS A;  1SQK A;  5HP1 A;  4N41 A;  4JS5 A;  4FZX C;  1W97 L;  1VSM A;  3CCV N;  4QS9 A;  4IBN A;  4OPA A;  4GV6 A;  2NRT A;  2CGJ A;  4ILH A;  3KKR A;  1RTH A;  2D0P A;  4FLX A;  3QES A;  1MA9 B;  1VQM N;  5HRO A;  1GLB G;  5J2N A;  1KAZ A;  2HNZ A;  3NHG A;  3J81 O;  4BC4 A;  1GLD G;  3P1G A;  4M3R A;  4DTS A;  3ID6 A;  1HR0 K;  3J7Y P;  4RWT A;  3TAM A;  5I42 A;  1JLE A;  3ZCM A;  4CEQ A;  4X66 K;  4CD3 A;  3OS1 A;  5J2M A;  3WUH A;  5GAH P;  4H0Y B;  1T03 A;  2B4J A;  5AQK A;  5HLF A;  4LH4 A;  2P9N B;  2VGN A;  1BI4 A;  4CZK A;  5C2F A;  2VWJ A;  3MMV A;  4M3Y A;  3NMU A;  1VHX A;  3C6U A;  1ASW A;  3UKU B;  3O5B A;  3V6D A;  4DTM A;  4EFH A;  4GVE A;  3CFR A;  2QWN A;  4F9O A;  2PYJ A;  5CE3 A;  2Z1H A;  2QM1 A;  4H0T B;  4DTJ A;  3S3N A;  3K5L A;  4DFK A;  1ZBU A;  3VF2 A;  1MDU B;  3BZK A;  1HNI A;  4BRO A;  3M6G A;  5BPN A;  3MK6 A;  5LJV A;  3U9Z A;  2QWP A;  3E01 A;  1JLQ A;  4NLB A;  2HMI A;  2OPP A;  3QFU A;  3L4I A;  1ZBH A;  3VTI A;  1I39 A;  3SV4 A;  4IOC L;  3NF9 A;  1M1K O;  3MX2 A;  3U3G A;  4CZF A;  3VPZ A;  1T8E A;  2QA4 N;  3Q7C A;  4BRH A;  2YV0 X;  4KHY A;  2QTD A;  3H08 A;  4K0K K;  1P90 A;  1Q18 A;  3IFR A;  1QZ5 A;  3JSM A;  4KRE A;  2QXF A;  4HCC A;  3R3L A;  1DLO A;  3ZT3 A;  1UWB A;  5AR0 A;  2OTL N;  1YVN A;  2FF6 A;  1XNQ K;  3NGI A;  1DTQ A;  4XIU A;  4DR7 K;  3AAR A;  3HYF A;  4CF8 A;  5J2P A;  1GLE G;  3QEW A;  3CET A;  3RSE A;  3OS2 A;  3MN5 A;  2X6N A;  2BH1 A;  4DLE A;  3TSQ A;  3ISN C;  4BRN A;  4CIE A;  2DFE A;  4IEE A;  4IDH A;  3RTV A;  2G8V A;  2ZJQ L;  1IG9 A;  1LWE A;  4JI6 K;  2VG5 A;  4AM6 A;  3O4W A;  2BAN A;  5FPN A;  2YHA A;  4BC5 A;  5TKY A;  2YKN A;  3KWI A;  1ESV A;  3MED A;  3MXI A;  1C1C A;  3RR7 A;  3QDK A;  4J2B A;  3I33 A;  3WXL A;  2P9N A;  1FJG K;  2G8K A;  1YT3 A;  1EWQ A;  3BDP A;  4WFN L;  4ZTJ A;  2IDO A;  3MXM A;  4M3W A;  3VQE A;  3O80 A;  4W5O A;  1CZA N;  5AQG A;  3WQT A;  4A61 A;  1LV5 A;  4CCH A;  2WOM A;  4EP5 A;  5CY4 A;  3VQD A;  1BQN A;  1WNS A;  5KPZ A;  1NJY A;  3PY8 A;  3AA4 A;  1K6Y A;  3WXK A;  3E9O A;  4K8X A;  1S3X A;  2XRI A;  4BDP A;  1M90 O;  1T7P A;  4B9Q A;  3SQ2 A;  4FYD A;  1BA1 A;  4QS8 A;  4IEI A;  1EXQ A;  1TKX A;  4CJ7 A;  3OVN A;  4LFC K;  2RHK A;  4DU1 A;  4DS5 A;  3D2E A;  2W41 A;  4WFA L;  3O3H A;  3L2V A;  4IZ9 A;  4YNQ A;  2VQE K;  1IBL K;  1TL1 A;  1S1U A;  5ADX H;  3O8M A;  3HTV A;  1U49 A;  3C7N B;  2OPR A;  2RKI A;  3VQ7 A;  1Y64 A;  4K41 A;  3WNH A;  1NGF A;  4GV9 A;  5EVZ A;  1OH7 A;  1OVQ A;  3KLI A;  1LW2 A;  1BUP A;  4HCB A;  1S72 N;  2HHV A;  1BG3 A;  4CZH A;  1ZC6 A;  3V1R A;  5BR8 K;  1KTQ A;  4FXD A;  4BR7 A;  3H6E A;  1K8A O;  1RTD A;  3I0S A;  2W42 A;  1C0U A;  4XH5 A;  4BRM A;  3ATV A;  4AHS A;  5CZ2 A;  4YOR A;  1HKC A;  4FK4 A;  1RDD A;  5BN8 A;  1RFQ A;  3H46 O;  1ZBL A;  3I55 N;  1N34 K;  2KLA A;  4OKJ A;  1UAX A;  1TKT A;  2W40 A;  2Z1G A;  4OPK A;  1A5W A;  2G8W A;  5KGX A;  4FZY A;  4J2E A;  2GBZ A;  2P9K B;  4E1N A;  1Q81 O;  2JLE A;  4BG8 A;  5KQD A;  4RW7 A;  1MWK A;  1Q86 O;  2YJF A;  1VSJ A;  3AAQ A;  4V19 S;  4Z4E A;  3V1O A;  5AQV A;  1KVB A;  3JYT A;  2HHX A;  3AA3 A;  5AQU A;  2BUP A;  2CH5 A;  3C95 A;  3CJ1 A;  3AVN A;  1EQY A;  3RWU A;  3KZB A;  4KHW A;  1EO1 A;  1WBD A;  5EXW A;  5BN9 A;  5EOY A;  4B1Y B;  2O8E B;  1WSG A;  2YHB A;  3CME N;  3F2K A;  3JAM O;  3CXC M;  3WXJ A;  1IH7 A;  1YJ9 N;  3G0Z A;  4FWO A;  4B1W B;  3MWP A;  2A3Z A;  2P9S A;  3CD6 N;  1N32 K;  3PV8 A;  1WAJ A;  4CGG A;  4B1U B;  3SNN A;  4DQI A;  1VSK A;  4BDY A;  3TWH A;  4KH6 A;  3I56 N;  3ZX2 A;  1YHQ N;  3OJU A;  2GWK A;  1NBW A;  4E7J A;  3MX5 A;  1A5V A;  2HOE A;  1JLG A;  3FGU A;  2E2Q A;  3SCX A;  4C8L A;  1ZBF A;  2GWJ A;  2ZQB A;  3DLB A;  1VSH A;  3VGL A;  2B5J A;  1ASV A;  1NK9 A;  1HJO A;  4DTU A;  2YCH A;  4CFC A;  2R7Y A;  3LPT A;  3CCU N;  4MO4 A;  5JVH L;  4B3S K;  1RDB A;  4JI2 K;  1KRP A;  5GAE P;  1QE1 A;  4FM0 A;  5M1Q A;  1BCM A;  5C0Y A;  2HND A;  5FRO A;  1HNW K;  3OYK A;  4OLA A;  3QFP A;  4FK0 A;  3NFA A;  4ELT A;  1JCE A;  3HPG A;  1WSI A;  3QER A;  1WSE A;  1S6P A;  1ASU A;  1RGI A;  1S6Q A;  1IV0 A;  4B3O A;  4JN4 A;  3G25 A;  3OYH A;  4F3T A;  4BC2 A;  4B9N A;  3FZM A;  1G99 A;  5C2D A;  1TV6 A;  5AQM A;  2O8B A;  4DUZ K;  4BQZ A;  4KHP K;  4B3M K;  1RCH A;  3VEX A;  3DLK A;  1CXU A;  3UKR B;  3KTQ A;  3NVM A;  1DGK N;  4CJS A;  3IRX A;  5BRD A;  3AO4 A;  1BDG A;  3F5T A;  5C25 A;  2HBM A;  5AJ3 K;  2E2O A;  4BVO A;  2A40 A;  4DV7 K;  2F4V K;  1DEJ A;  3H3N O;  2V7Y A;  4YOY A;  3C0B A;  1S1W A;  2AP1 A;  3SUP A;  1NJW A;  2P9L B;  4WQ5 C;  4DTP A;  3TR8 A;  5KRS A;  2FXU A;  4FM1 A;  1RBT A;  3C65 A;  1NJZ A;  4GKK K;  3A0I X;  2Y1I A;  4JKG B;  1QQM A;  1XWL A;  3LP0 A;  3AVJ A;  2WC9 A;  5AQI A;  3VQ5 A;  2Q36 A;  5D3G A;  1L3T A;  5AZI B;  3SMP A;  1JL2 A;  4B9V A;  4B3R K;  4CZJ A;  1FXX A;  2KTQ A;  4WE1 A;  1GLA G;  4NO7 A;  3WNE A;  4IXC A;  4CBU A;  4IOX A;  2RN2 A;  3WNG A;  3DMJ A;  2UUC K;  2NLX A;  4KH5 A;  4CBW A;  1JLF A;  3Q7B A;  1VSL A;  4CES A;  3T19 A;  2KZM A;  3LM9 A;  1LWC A;  4WQ5 A;  2VQF K;  3RMD A;  4H5R A;  4DWI A;  5FDL A;  1P8Z A;  3CHW A;  5KI6 A;  3MEE A;  4FLT A;  5AQT A;  3VEV A;  1GOA A;  4O8U A;  4JKF A;  1HJR A;  3ITH A;  1VQK N;  1XHX A;  3DLG A;  3L0Q A;  3P5J A;  4DLG A;  1YIT N;  4FJ9 A;  1ATS A;  5AQY A;  4DSI A;  1HX1 A;  3V9W A;  2P9U B;  2NRZ A;  4DKW A;  5I9E B;  3AGR A;  1ILY A;  2OA8 A;  3SAH A;  5JMV A;  1RDU A;  3VEZ A;  2HHW A;  4FJK A;  4DCH A;  4O4G A;  3OYN A;  1S9E A;  2WON A;  4NYN A;  4LFB K;  4NXM K;  3VGK A;  5LMU K;  3RMB A;  3K0S A;  3NE6 A;  1ZXO A;  1Q7Y O;  4DF4 A;  1NGJ A;  4I7F A;  4B1V A;  4CK3 A;  3TSU A;  3DXM B;  3EL2 A;  3FZK A;  4C1N K;  2VG6 A;  1CXQ A;  2O8C B;  4AHT A;  1BGX T;  2UYT A;  3SAG A;  4FJM A;  4OVL A;  2BDP A;  4DR6 K;  3DAW A;  4KKO A;  2XY5 A;  2D1K A;  2XO7 A;  4K25 A;  1N8R O;  2QWQ A;  5K14 A;  5EU7 A;  4CHZ A;  4AIL C;  4DUY K;  1RT3 A;  4Z4I A;  3DOK A;  4F3O A;  4Z4G A;  3V9U A;  4B9M A;  3HZ6 A;  4DSL A;  4CI6 A;  4FJL A;  2HB5 A;  4LSL A;  1N33 K;  1RT1 A;  3KHY A;  4LF8 K;  4JKG A;  2HHH K;  2A42 A;  3A5N C;  3F9M A;  1VQN N;  3P4I A;  4QCL A;  4KB0 A;  1TK5 A;  5E84 A;  1IKX A;  4FWK A;  2YX6 A;  3U8X A;  3HOT A;  2P9P B;  2ZGY A;  4CEA A;  1U4B A;  2GUI A;  5AQH A;  3AVK A;  3M8S A;  3SV3 A;  1LW0 A;  4BC3 A;  1TGO A;  3SK3 A;  4IO9 L;  4DFJ A;  1EET A;  2BE2 A;  1K8K A;  3ZT1 A;  4A2B A;  1J54 A;  2KFN A;  3ZSZ A;  1HNV A;  3OYM A;  3CQ8 A;  1QZ6 A;  5FLX O;  3BF1 A;  3VER A;  5JIC A;  2IVN A;  3E9L A;  4H5W A;  2ZE2 A;  4MDB A;  2KKZ A;  1EX4 A;  4MO5 A;  1YAG A;  3CYM A;  1VQ4 N;  4FJJ A;  3O4N A;  2I5J A;  2ZJR L;  2YNH A;  5F0X A;  1YTA A;  1C0F A;  2P9U A;  3TAB A;  2OYQ A;  4PQU A;  4LSN A;  1VSD A;  3B6P A;  3HT3 A;  4DV6 K;  4JD2 B;  3OYJ A;  3L3U A;  4KB1 A;  4BRF A;  1J53 A;  4CZM A;  4N56 A;  4PHT X;  4FOE A;  4FWN A;  1X9W A;  3HVR A;  3HM9 A;  4Y1D A;  3GL1 A;  3NF6 A;  3M3Z A;  4MDA A;  1LCU A;  2V7Z A;  3TTD A;  2HF4 A;  2Q97 A;  3L2Q A;  3GG4 A;  4XH1 A;  4BE1 A;  3DXM A;  1B92 A;  3CJ9 A;  5AQW A;  1TAU A;  1FKO A;  4A5A A;  3SQ0 A;  1GLL O;  1RT4 A;  1QVG M;  4ILG B;  4K8Z A;  2KZZ A;  3LDL A;  4Q5V A;  1ATR A;  4OJR A;  2OZM A;  3TPQ A;  1QHA A;  2NZT A;  3ZT4 A;  4M3U A;  2HNY A;  3J7Z O;  1NMD A;  5M1O A;  3D45 A;  1GLF O;  3VA3 A;  1ITG A;  3SYZ A;  2Z1I A;  3UE5 A;  4EIA A;  1UOC A;  4YOU A;  4DFP A;  1VSE A;  4EHT A;  3T1H K;  4DTX A;  4C8M A;  3UIQ A;  1J9A A;  4X64 K;  4BG9 A;  4WF9 L;  2UXB K;  2KFZ A;  4FCY A;  5SWM A;  3NF7 A;  3QB0 A;  4EHU A;  3JXU A;  2YNG A;  1L3V A;  2QWL A;  3ZX3 A;  4O0I A;  3B6O A;  1VRT A;  3AVM A;  2E2P A;  1IO2 A;  2J4R A;  2W6K A;  3ZET B;  4FLW A;  3S9H A;  4CEB A;  4JK8 A;  2W6L A;  5AQL A;  3TI0 A;  2E1Z A;  4ELV A;  4FJH A;  4CF1 A;  3ZT0 A;  2E1Y A;  3AVG A;  5CZ1 A;  3TAE A;  1IJJ A;  3E1Y A;  4BY9 C;  2XY6 A;  1SKR A;  2IIR A;  4M41 A;  1YIJ N;  4K42 A;  3OA9 A;  4CF9 A;  3WXM B;  4JD2 A;  2WTU A;  1Z26 A;  4KTW A;  1W2B M;  4DQQ A;  4RCH A;  4CGF A;  3EYZ A;  3P31 A;  5I3U A;  4DTR A;  3ATU A;  4IG0 A;  3KWG A;  3P38 A;  1YUW A;  1HYS A;  2HHU A;  3LAM A;  4CJU A;  3V9X A;  2ASM A;  2FSK A;  5AQQ A;  3HOS A;  1KLN A;  3CC4 N;  4JKA A;  4FOI A;  2QKK A;  4CEC A;  2XY7 A;  2ASO A;  4MFB A;  1XI1 A;  3HK2 A;  1V4S A;  3GBT A;  3THW B;  3SJH A;  3VTH A;  5AFU A;  1NGI A;  4DHY A;  2DTU A;  3FZF A;  2F96 A;  2JWL A;  5DMR A;  1Q9Y A;  1XUP O;  4O0J A;  4DV3 K;  3KK2 A;  4GV3 A;  4BRC A;  4ID1 A;  4AM7 A;  2QW9 A;  3EE9 A;  4E7K A;  4KTQ A;  1J5E K;  3O1B A;  3EKU A;  2D0B A;  3QO9 A;  3GOI A;  3VEY A;  3QET A;  3AVL A;  4LH5 A;  4BR9 A;  1HYZ A;  1S5J A;  4FWL A;  4B1X B;  3UKU A;  4NXN K;  5FRN A;  3C6T A;  4MQ3 A;  4CJE A;  4E7H A;  4LF6 K;  3ZSW A;  3RMA A;  4FJX A;  2Q1N A;  2BGG A;  1QVF M;  1YTU A;  3AO2 A;  4O5F A;  3HPO A;  2O8F B;  3MCA B;  4LF7 K;  5GAD P;  3ZET A;  4RG8 A;  3J7A P;  1K73 O;  1HQU A;  4R79 A;  2X78 A;  1U2V B;  3RR8 A;  5AQR A;  2FC0 A;  3CJA A;  2UXD K;  3T1A A;  2ZF5 O;  4NCG A;  3NF8 A;  1XQS C;  3OYB A;  4IJN A;  1G15 A;  3MXJ A;  2F9T A;  2BTF A;  4Z94 A;  3O3F A;  4ISF A;  1YJN N;  4BWM A;  4KHN A;  1YXQ A;  3DWL A;  3R6M A;  4CK1 A;  3EZ5 A;  4CZL A;  3FFK B;  3C94 A;  4KHU A;  1SAZ A;  3CG7 A;  3IDH A;  4M63 C;  2ITM A;  3TTC A;  4JYA K;  4JS4 A;  2FLO A;  1VQ8 N;  1NG9 A;  1HNZ K;  5AQJ A;  2F7T A;  1IBM K;  5KPR A;  1C1A A;  1UA0 A;  4EZ9 A;  1BWF O;  2Q0U A;  1JXB A;  3QML A;  2PY5 A;  3AA2 A;  3VQ8 A;  1IKV A;  4A59 A;  4CJL A;  4FK2 A;  4W5T A;  2B6A A;  3O3G A;  1U04 A;  1OVY A;  3THX B;  4FVM A;  4Q0B A;  2FF3 B;  4CJT A;  1HRH A;  3V4I A;  2VCP A;  5C12 A;  4CHP A;  4FJN A;  2Q2R A;  4BWJ A;  4GKJ K;  1RBR A;  2WBN A;  4EZ6 A;  5HOO A;  4KTZ A;  2PBD A;  5T7B A;  3KLH A;  1NK6 A;  4JKC A;  2WUS A;  1KQS M;  2OCE A;  4BDZ A;  4TSX A;  4RTF D;  4WYB A;  4BGA A;  3RMC A;  3O9Q A;  2HST A;  4MLE A;  4JRP A;  4CJW A;  3U6F A;  1QHT A;  3THV A;  2A6A A;  3G10 A;  4IFE A;  5MLC Q;  3H3O B;  2O8F A;  1YJW N;  1V4T A;  3M8P A;  4M7X A;  1NOY A;  3FLC O;  4ZTF A;  3OW2 M;  1NGE A;  1JL1 A;  3SUQ A;  3LP1 A;  3QLH A;  5AQO A;  3WXI A;  3MN7 A;  3VQ9 A;  4RW8 A;  3NDK A;  4JI3 K;  2OPQ A;  1RT5 A;  4JRQ A;  3SJJ A;  3T7Z A;  4JI5 K;  3I8D A;  5CR4 A;  2E6M A;  4JKB A;  3J80 O;  2QKB A;  4BRP A;  4M42 A;  1XNR K;  1KSP A;  1C0T A;  3HXM A;  4IFY A;  3O6W A;  4KBO A;  4O44 A;  1D9F A;  2A1S A;  1R0A A;  5EX5 A;  4FWP A;  1RDA A;  3DOL A;  4CHY A;  4JEP A;  2UU9 K;  1MU2 A;  4IJA A;  3ENO A;  3AVF A;  1D5A A;  3ZSO A;  3R1X A;  3C7N A;  3ZSQ A;  4DSK A;  4BRA A;  2QWM A;  3LWM A;  5GIO A;  1J6Z A;  4DQS A;  2A1R A;  3G6E N;  3WNF A;  4M3T A;  5FPM A;  3LL3 A;  4AHU A;  3ASM A;  4JKD A;  4U67 L;  2P1J A;  3KD1 E;  1ZBI A;  1KVC A;  4YDU C;  1GLJ O;  4FLU A;  2IVP A;  3CM6 A;  3LM2 A;  5BRF A;  5C42 A;  3DI6 A;  2O8D B;  4EAH D;  3MEG A;  2CH6 A;  3NGZ A;  2ZGZ A;  4FM2 A;  4LD0 A;  3M1F A;  3K9K A;  4AHR A;  4C8N A;  1C0M A;  3ZSV A;  3K57 A;  2A41 A;  4ELU A;  1I3A A;  4JKH A;  1C1B A;  3P83 D;  4O8K A;  4JI7 K;  4B1Z A;  2P9K A;  3K9J A;  5M1K A;  1JCF A;  2F8T A;  4YDU A;  3C6A A;  2X74 A;  4CJK A;  5KTQ A;  1VSF A;  3KK7 A;  1IKY A;  3WEE B;  3CQX A;  1F21 A;  4NLC A;  1KLM A;  2VGM A;  1LWF A;  3TAN A;  3VF4 A;  5HRS A;  4L8R B;  2F8S A;  3DLL L;  2VYP A;  2HBK A;  2O8E A;  1KXP A;  4OKE A;  4IFV A;  2IC3 A;  1HKG A; 
#chains in the Genus database with same CATH homology
 2KFN A;  3JSM A;  4KRE A;  2QXF A;  2XHB A;  4HCC A;  4H4M A;  3AO5 A;  1DLO A;  4OKK A;  3ZSZ A;  4PUO A;  3ZT3 A;  1NK8 A;  1HNV A;  1UWB A;  3NBP A;  3OYM A;  3CQ8 A;  1U45 A;  3SUO A;  3NGI A;  2DFF A;  4HUE A;  1DTQ A;  4XIU A;  2G8I A;  3NH2 A;  3HYF A;  3CFO A;  4CF8 A;  3VQP A;  2P51 A;  2ZE2 A;  5J2P A;  1EX4 A;  3QEW A;  3CYM A;  4GW6 A;  3OS2 A;  4FJJ A;  3O4N A;  3L2W A;  3DLH A;  1VSI A;  2I5J A;  2X6N A;  1T05 A;  2YNH A;  3VA0 A;  4DLE A;  1YTA A;  3TAB A;  3VQB A;  2OYQ A;  4PQU A;  3ISN C;  4CIE A;  3S3M A;  2DFE A;  4LSN A;  1VSD A;  1TL3 A;  3RTV A;  3B6P A;  3HT3 A;  2G8V A;  1FKP A;  2D0A A;  3AA5 X;  3OYJ A;  3L3U A;  1IG9 A;  4KB1 A;  1LWE A;  3HO1 A;  1J53 A;  2VG5 A;  2BAN A;  4F4K A;  2YHA A;  5HRN A;  5HBM A;  4N56 A;  1NKE A;  1KFD A;  2YKN A;  3FFI A;  3T3F A;  3DLE A;  1TK8 A;  4EP4 A;  1X9W A;  4UQG A;  3HVT A;  4RW9 A;  3HVR A;  1SKW A;  4CGH A;  3HM9 A;  3VQ6 A;  3MED A;  3NCI A;  3MXI A;  4E7L A;  1C1C A;  1WSJ A;  4J2D A;  4Y1D A;  3QNO A;  3RR7 A;  4HUG A;  3NF6 A;  4J2B A;  1Q8I A;  3NGY A;  2G8K A;  1YT3 A;  4OGC A;  1RTJ A;  3BDP A;  3L2Q A;  4BE1 A;  1RIL A;  4E89 A;  1B92 A;  4HHT A;  4ZTJ A;  3L8B A;  2IDO A;  5J1E A;  3MXM A;  1WAF A;  1TAU A;  1FKO A;  2ETJ A;  1HMV A;  2G8H A;  3SQ0 A;  1W9H A;  4M3W A;  4FJL A;  1RT4 A;  4K8Z A;  3KKS A;  3VQE A;  3HP6 A;  2KZZ A;  2JGU A;  4Q5V A;  4DU4 A;  4DSF A;  2O4G A;  4N76 A;  4OJR A;  4W5O A;  3AVB A;  3OY9 A;  1RT7 A;  3DRP A;  1LV5 A;  4CCH A;  2WOM A;  4EP5 A;  5CY4 A;  3VQD A;  4ID5 A;  3L2U A;  1BQN A;  1WNS A;  4F2S A;  1NJY A;  3K5O A;  2DY4 A;  4CED A;  2KQ2 A;  3AA4 A;  3ZT4 A;  1K6Y A;  3PY8 A;  4J2A A;  4M3U A;  2HNY A;  4F2R A;  4PWD A;  1WLJ A;  3D45 A;  4K8X A;  3VA3 A;  2QK9 A;  2XRI A;  1ITG A;  3SYZ A;  3QEX A;  2Z1I A;  3KK3 A;  4BDP A;  1S1V A;  1UOC A;  4DG1 A;  4DFP A;  3AV9 A;  4AHV A;  4DQR A;  1QSS A;  1T7P A;  1VSE A;  1JLA A;  4DSE A;  4DTX A;  3SQ2 A;  4FYD A;  4C8M A;  3OYL A;  4GMJ B;  4N47 A;  3HL8 A;  3IG1 A;  4OPJ A;  2OZS A;  4FZZ A;  2E6L A;  4CJQ A;  1J9A A;  2VG7 A;  3UIQ A;  1EXQ A;  1TKX A;  4FW2 A;  3OVN A;  2KFZ A;  4DTN A;  2NUB A;  1RT2 A;  4CJF A;  4FCY A;  5SWM A;  4KV8 A;  1QSL A;  1S1X A;  4OLB A;  2IOC A;  3NF7 A;  4FLY A;  4DU1 A;  2YKM A;  4DS5 A;  1DTT A;  1LAV A;  5JS1 A;  2PZS A;  2YNG A;  1TVR A;  3V1Q A;  3SZ2 A;  1Q9X A;  2Q3S A;  1QS4 A;  5DK5 A;  3O3H A;  1JLB A;  1L3V A;  3L2V A;  3OYA A;  4Z0U A;  3OYC A;  4CJR A;  4O0I A;  1BL3 A;  3B6O A;  4YNQ A;  4FJ5 A;  4F8R A;  1VRT A;  1TL1 A;  1S1U A;  3QIO A;  2G8U A;  3AVM A;  1NJX A;  4QOZ B;  3EY1 A;  1IO2 A;  4FLW A;  3S9H A;  1U49 A;  4B9L A;  4DTO A;  2OPR A;  2RKI A;  3VQ7 A;  4CEB A;  1TKD A;  3WNH A;  3TI0 A;  1O1W A;  4ELV A;  4FJH A;  4CF1 A;  3ZT0 A;  4KPY A;  3AVG A;  3AVH A;  5CZ1 A;  3TAE A;  4BE2 A;  3KLI A;  3QIN A;  2XY6 A;  1SKR A;  1LW2 A;  4GVM A;  4M41 A;  3ZSX A;  3QEI A;  2FBY A;  4DSJ A;  4HCB A;  4FJ8 A;  2HHV A;  1YVU A;  2ATQ A;  3IAY A;  3M8R A;  3V1R A;  3DRR A;  3VQ4 A;  1KTQ A;  4CF9 A;  4CHN A;  3KIO A;  4PA1 A;  3LP3 A;  4FXD A;  5KRT A;  1Z26 A;  3DM2 A;  4KTW A;  5HRR A;  4DQQ A;  4DS4 A;  1RTD A;  4CGF A;  3EYZ A;  5I3U A;  3I0S A;  4DTR A;  2W42 A;  2AJQ A;  1C0U A;  2Z1J A;  4Y1C A;  3BGR A;  4IG0 A;  3HPH A;  4BE0 A;  3O4Q A;  1VRU A;  4KHS A;  1HYS A;  1VK0 A;  3A2F A;  3IS9 A;  2HHU A;  4AHS A;  5CZ2 A;  3LAM A;  1XC9 A;  4CJU A;  1S9G A;  3V9X A;  1D9D A;  4W5R A;  4M3Z A;  4B9U A;  3RRG A;  4FK4 A;  1RDD A;  1WN7 A;  1RTI A;  1KLN A;  3TAF A;  3LAK A;  4CIG A;  4CEC A;  5E41 A;  2XY7 A;  2QKK A;  4MFB A;  3SI6 A;  1XI1 A;  1HYV A;  3HK2 A;  1ZBL A;  4CER A;  1TKZ A;  3KK1 A;  4OKJ A;  1UAX A;  1TKT A;  4C8K A;  1X1P A;  2Z1G A;  4LY7 A;  1A5W A;  4OPK A;  2G8W A;  2DTU A;  4PY5 A;  5KGX A;  2F96 A;  4FZY A;  4CFA A;  1RNH A;  2HVI A;  3CFP A;  5DMR A;  4E3S A;  1Q9Y A;  3LPU A;  4B9S A;  4J2E A;  4O0J A;  3L2R A;  2GBZ A;  4E1N A;  1J5O A;  2JLE A;  3MEC A;  3KK2 A;  4RW7 A;  4NCB A;  4DQP A;  2ZD1 A;  1VSJ A;  2VWK A;  4ID1 A;  4E7I A;  1BIU A;  4Z4E A;  3V1O A;  4CGD A;  4FLZ A;  4NCA A;  4E7K A;  4KTQ A;  4DFM A;  4B8C A;  3OS0 A;  1ZYQ A;  3K58 A;  1LAW A;  3OYF A;  3NAE A;  3DLR A;  1KVB A;  1FK9 A;  5CYQ A;  3JYT A;  2D0B A;  3AA3 A;  3DRS A;  3QO9 A;  2RPI A;  4HUF A;  3QET A;  3AVL A;  3C95 A;  4IKF A;  4JLH A;  3ZT2 A;  3AVI A;  4H8K A;  4W5N A;  4LH5 A;  3LZJ A;  4CEE A;  3KD5 E;  3AVN A;  3NH0 A;  1HYZ A;  1S5J A;  3RWU A;  4KHW A;  1B9D A;  3OYG A;  1BCO A;  1QSY A;  4CE9 A;  4E1M A;  3PUF A;  2HVH A;  1WSG A;  2YHB A;  4CJP A;  1NK7 A;  1CLQ A;  5CYM A;  2ITG A;  1IH7 A;  3M8Q A;  5FRN A;  1NOZ A;  3C6T A;  3G0Z A;  4MQ3 A;  4CJE A;  4O5B A;  3LWL A;  4E7H A;  3LP2 A;  1WSH A;  3ZSW A;  4H4O A;  3PV8 A;  4CGJ A;  1WSF A;  3RMA A;  4HVJ A;  3TAP A;  4FJX A;  1WAJ A;  4CGG A;  4CHO A;  3SNN A;  1N6Q A;  3RRH A;  4DQI A;  1YTU A;  1REV A;  3AO2 A;  1VSK A;  3HPO A;  4I9Q A;  4BDY A;  1RBS A;  3TWH A;  4CJ3 A;  3ZSY A;  4RG8 A;  5HRP A;  1UA1 A;  5C24 A;  4E19 A;  5FRM A;  3OJU A;  1U47 A;  1HQU A;  2P5O A;  2X78 A;  4E7J A;  3ZSR A;  1EP4 A;  3RR8 A;  4C8O A;  2FBT A;  3S3O A;  2FC0 A;  1A5V A;  3AVC A;  3KLG A;  4B9T A;  3T1A A;  1JLG A;  4IDK A;  4KRF A;  4NCG A;  4CHQ A;  3NF8 A;  4CIF A;  3OYB A;  4M3X A;  3HP9 A;  2RF2 A;  3SCX A;  4C8L A;  1G15 A;  3MXJ A;  1ZBF A;  4I2Q A;  1NKC A;  1HPZ A;  1CZB A;  5J2Q A;  5SZT A;  2ZQB A;  3DLB A;  1JXE A;  3PO5 A;  1VSH A;  4OGE A;  3O3F A;  4BWM A;  2B5J A;  1ASV A;  1NK9 A;  4KHN A;  2KW4 A;  4DTU A;  1TK0 A;  4CFC A;  1BQM A;  2R7Y A;  2O4I A;  2HHS A;  4CK1 A;  3LPT A;  3EZ5 A;  5KGW A;  1RDB A;  2IGI A;  4I2P A;  1KRP A;  1RBV A;  3PX6 A;  3C94 A;  4KHU A;  4M42 A;  1QE1 A;  3CG7 A;  4FM0 A;  4Z4F A;  3V9S A;  1L3U A;  4I9L A;  1BCM A;  3V9Z A;  4CEZ A;  4JS4 A;  2HND A;  5FRO A;  3LAL A;  3OYK A;  4OLA A;  1SL0 A;  4CF2 A;  2P5G A;  4FK0 A;  2XY8 A;  1SL1 A;  3NFA A;  4CJV A;  4ELT A;  4DF8 A;  2FBX A;  1C1A A;  1TAQ A;  3QIP A;  3HPG A;  1CZ9 A;  3LDS A;  1WSI A;  1UA0 A;  4EZ9 A;  3QER A;  3QNN A;  3QEV A;  1WSE A;  1JXB A;  1S6P A;  3SUN A;  1ASU A;  4ZHR A;  4YFU A;  1S6Q A;  2YNI A;  3AA2 A;  3VQ8 A;  1IKV A;  4CEO A;  2PY5 A;  4B3O A;  3AVA A;  4CJL A;  4FK2 A;  4W5T A;  3OYH A;  1KVA A;  2B6A A;  3O3G A;  4F3T A;  1U04 A;  4B9N A;  1A5X A;  1KFS A;  4NYF A;  4QAG A;  4FVM A;  1GOC A;  1TV6 A;  3SQ1 A;  2HHX A;  4Q0B A;  4CGI A;  3MAQ A;  4FW1 A;  4CJT A;  1HRH A;  3TAG A;  3V4I A;  1RCH A;  3L3V A;  1BI4 B;  3DLK A;  4R5P A;  4Z4H A;  3OYD A;  1NK5 A;  1CXU A;  1SL2 A;  4CHP A;  1JKH A;  4BWJ A;  3K5N A;  4CJS A;  3KTQ A;  1RBR A;  4FJN A;  2IAJ A;  1L5U A;  3IRX A;  3AO4 A;  4EZ6 A;  5C25 A;  3LZI A;  4CFD A;  4IG3 A;  4ICL A;  3SPZ A;  4KTZ A;  5T7B A;  1NK6 A;  3KLH A;  1C6V A;  1HQE A;  4FJ7 A;  3V81 A;  1D8Y A;  1EKE A;  1JLC A;  4RW4 A;  4CEF A;  4BDZ A;  4TSX A;  3TAR A;  4KAZ A;  1BHL A;  3RMC A;  2Y1J A;  4JRP A;  4CJW A;  3NH1 A;  1S1W A;  3U6F A;  1QHT A;  1Z25 A;  3QEP A;  3U3Y A;  3SUP A;  2FBV A;  3THV A;  1U48 A;  1NJW A;  1BIZ A;  1IKW A;  4DTP A;  3G10 A;  2KTQ A;  3TR8 A;  3F73 A;  3K5M A;  5KRS A;  4KI4 A;  1S1T A;  1X9S A;  4DU3 A;  2OZM A;  2EX3 A;  4FM1 A;  2HHT A;  1RBT A;  1NJZ A;  2Y1I A;  3M8P A;  4DMN A;  1N5Y A;  4CF0 A;  3VQA A;  5JS2 A;  2HHQ A;  1NOY A;  4ZTF A;  1XWL A;  4CFB A;  3LP0 A;  3AVJ A;  3VQ5 A;  1JL1 A;  3SUQ A;  3LP1 A;  3QLH A;  4HTU A;  5D3G A;  1L3T A;  2IS3 A;  1JL2 A;  4B9V A;  3AO3 A;  3VQ9 A;  2D0C A;  4FJI A;  2X6S A;  4RW8 A;  3KLE A;  3KJV A;  2OPQ A;  4KO0 A;  1RT5 A;  1FXX A;  4WE1 A;  3NDK A;  2OPS A;  4JRQ A;  3I0R A;  3PX0 A;  3SJJ A;  4O55 A;  1NK4 A;  4BAC A;  3AO1 A;  3WNE A;  4FJG A;  3HJF A;  3HST B;  3I8D A;  3ALY A;  2RN2 A;  3WNG A;  3DMJ A;  3PO4 A;  2E6M A;  3K59 A;  2QKB A;  3TAQ A;  1JLF A;  1RT6 A;  1VSL A;  4RW6 A;  4B08 A;  1C0T A;  3T19 A;  4CES A;  3OJS A;  1KSP A;  2YNF A;  2KZM A;  1LWC A;  4IFY A;  3OYE A;  3HXM A;  3SQ4 A;  3D0P A;  2LSN A;  1RDC A;  4O44 A;  3LAN A;  1D9F A;  2A1S A;  3PX4 A;  3RMD A;  1R0A A;  4DWI A;  5FDL A;  1KCF A;  1RDA A;  2GV9 A;  3DOL A;  5KI6 A;  3MEE A;  4CHY A;  4FLT A;  4FLV A;  2PYL A;  1GOA A;  5HP1 A;  4N41 A;  4JS5 A;  4FZX C;  1MU2 A;  1VSM A;  1HJR A;  3F9K A;  3ITH A;  1XHX A;  3DLG A;  2EHG A;  3AVF A;  1D5A A;  4IBN A;  3ZSO A;  3P5J A;  4N5S A;  4G1Q A;  4DLG A;  3ZSQ A;  4DSK A;  4FJ9 A;  1X9M A;  3KKR A;  1RTH A;  4AH9 A;  3LWM A;  4FLX A;  3QES A;  4W5Q A;  4DSI A;  2HW3 A;  1W0H A;  3V9W A;  3KLF A;  5HRO A;  2BGG A;  1QTM A;  4AHC A;  2HNZ A;  4DQS A;  5J2N A;  3NHG A;  2A1R A;  3WNF A;  1B9F A;  2D5R A;  3OYI A;  2OA8 A;  4AHU A;  3P1G A;  2G8F A;  4M3T A;  4M3R A;  2HHW A;  4DTS A;  4FJK A;  3TAM A;  3DYA A;  5I42 A;  4O4G A;  3ASM A;  3OYN A;  1JLE A;  1SUQ A;  3VQC A;  3ZCM A;  4CEQ A;  2P1J A;  1S9E A;  2WON A;  4NYN A;  4Z4C A;  3OS1 A;  1KVC A;  3VN5 A;  5J2M A;  3KD1 E;  1ZBI A;  4CK2 A;  3RMB A;  4FLU A;  1T03 A;  2B4J A;  5HLF A;  4LH4 A;  3NE6 A;  3CM6 A;  1L3S A;  1NKB A;  4KHQ A;  5C42 A;  3VQQ A;  1BI4 A;  3DI6 A;  3MEG A;  3CM5 A;  4DF4 A;  4E0D A;  4I7F A;  1QQC A;  4CK3 A;  2VWJ A;  3NGZ A;  4M3Y A;  2VG6 A;  1CXQ A;  1Y97 A;  3K2P A;  1RBU A;  1BGX T;  4AHT A;  4FM2 A;  4LD0 A;  3C6U A;  1ASW A;  4AHR A;  4C8N A;  1C0M A;  3ZSV A;  4FJM A;  3K57 A;  4OVL A;  2BDP A;  3V6D A;  4KKO A;  4DTM A;  2XY5 A;  3ULD A;  4ELU A;  1I3A A;  1SV5 A;  2XO7 A;  1C1B A;  3P83 D;  5EU7 A;  5K14 A;  4CHZ A;  4AIL C;  1RT3 A;  3CFR A;  4Z4I A;  3DOK A;  4F3O A;  1NK0 A;  3V9U A;  4Z4G A;  2PYJ A;  4B9M A;  2F8T A;  4DSL A;  4CJK A;  2X74 A;  2HB5 A;  2Z1H A;  4LSL A;  1VSF A;  4CJ5 A;  4B8A B;  5KTQ A;  4DTJ A;  1IKY A;  3S3N A;  3K5L A;  4DFK A;  1ZBU A;  1XHZ A;  1RT1 A;  1HNI A;  1BIS A;  1F21 A;  4QCL A;  4KB0 A;  1TK5 A;  4KI6 A;  1KLM A;  3E01 A;  1JLQ A;  1LWF A;  2HMI A;  1IKX A;  2OPP A;  3TAN A;  1ZBH A;  1I39 A;  3SV4 A;  2E4L A;  4CEA A;  3NF9 A;  1U4B A;  5HRS A;  1GOB A;  2GUI A;  3U3G A;  1SKS A;  4L8R B;  2F8S A;  1T8E A;  3AVK A;  3M8S A;  4M45 A;  1LW0 A;  3SV3 A;  1TGO A;  4CJ4 A;  4DFJ A;  1EET A;  4KFB A;  2BE2 A;  3SPY A;  4OKE A;  2DFH A;  2YV0 X;  4KHY A;  4IFV A;  2IC3 A;  3H08 A;  3ZT1 A;  1J54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...