3ZX0A

Ntpdase1 in complex with heptamolybdate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
404
structure length
385
Chain Sequence
KYGIVLDAGSSHTNLYIYKWVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGSSTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
publication title Crystallographic evidence for a domain motion in rat nucleoside triphosphate diphosphohydrolase (NTPDase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 117
structure length 385
sequence length 404
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx0A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx0A02
4B1ZA 1XQSC 3IFRA 2NRHA 3WXLA 3WT0A 3EKSA 3WEEA 3P4IA 2KHOA 4BROA 4E1JA 3QBXA 1NBWA 4JD2A 3GE1A 2QWMA 3ULEA 4M7YA 3VERA 1NGJA 3VF6A 1NGIA 4I6MB 3IDHA 5F1XA 5AZJB 5BR9A 2V51B 1TUYA 3LDNA 1NGFA 2E20A 2OANA 4K25A 2P9IB 4QS8A 3VGLA 3R8EA 2FLOA 1E4FT 3AAQA 4A2AA 3BEXA 3O08A 4MLHA 1ATSA 5F2RA 1C0GA 5KPRA 3CI5A 4CJ7A 5AZIB 2CH5A 2FSJA 3IUCA 3HSCA 3VEOA 2Q31A 5FPNA 5AQNA 3WQUA 3M6GA 4M7XA 3L6QA 1RGIA 2WUSA 3O5BA 3MCPA 3VOVA 1GLJO 2GWKA 4A2BA 4K41A 3VESA 5AQTA 5I9EB 4DHYA 3QBWA 4XEIA 4YDUC 5BPLA 3JS6A 4FOIA 1DKGD 4WQ4A 2A3ZA 4H0XB 4BR4A 1Z6RA 1ATNA 5AQFA 5FPDA 3ENHA 1LOTB 3ZEUB 2I7NA 5FPEA 4FSVA 3I8BA 4O5FA 5BN8A 1R59O 5AQJA 2ITMA 3KVGA 4FWLA 2P9KB 1RFQA 4CZFA 4BG8A 1J6ZA 2ASMA 3LDLA 4XH1A 1KAZA 1TYQB 3UKRB 4B1UB 1Q18A 2CGJA 4PL7A 5ADXH 1HX1A 2P9PA 1HPMA 3SLCA 4MO4A 1CZAN 2W40A 3LDPA 4RTFD 1NWKA 5E84A 3VF4A 1ATRA 1GLDG 1HLUA 2P9SB 2ASPA 2IVOA 4RWTA 1HUXA 2HF4A 4EIAA 2A5XA 4FPBA 2ZWHA 2V7YA 4BRKA 4BRAA 4WYBA 1ZBSA 1X3MA 3J8AA 5KQ8A 5BPMA 2F9TA 2P9UA 4H5TA 2GELA 1SQKA 3BF3A 3DJCA 3VGKA 3WXKA 4ISEA 1YUWA 3AAPA 4H5WA 4BVPA 3W0LA 4BC2A 2BTFA 2A41A 2GEMA 3O1BA 2D0PA 3WEEB 4H0TB 3U4LA 1T6DA 4CZJA 4CBWA 3VEYA 3FR0A 3VEVA 1BG3A 4JD2B 2F9WA 3HBTA 4IO8A 5AQWA 3ULEB 3GBTA 4BRHA 2QWPA 4CZGA 1BA1A 2Q0RA 4JAXA 4QS7A 4BRDA 3TU5A 5AQYA 1SZ2A 5AFUH 4FOEA 5AQUA 4BRCA 5AQQA 2GTDA 3QFPA 2VWBA 4FWQA 3WQTA 1XC3A 2E88A 3VEWA 3HTVA 2QWLA 3HI0A 4WQ5C 3O1WA 2NZTA 4B1YB 2GUPA 3BF1A 3DAWA 1T6CA 2QWOA 3QB0A 2E2PA 1KAYA 1BUPA 4FL9A 2Q2RA 4FWRA 3IMXA 5BRDA 3U9DA 3O80A 2QWRA 3WUHA 3FE1A 1BOTO 5LJVA 1NGEA 5BN9A 3ZX3A 3VGMA 3G25A 2VCPA 4BRIA 2E1YA 2ZGYA 4RCHA 1JCGA 4FO0A 4BR9A 3MN9A 3CQYA 1S22A 2GWJA 3H1QA 3O6WA 4CZHA 4CI6A 3H1VX 4EHTA 4FWPA 2PAVA 3SMPA 4EHUA 3H6EA 1GLFO 2H3GX 1EQYA 2A6AA 4FWNA 5ADXA 1U2VA 5EXWA 3WXJA 3EN9A 3EZWA 1BWFO 1BA0A 3FFKB 3FZHA 4H0VB 4EFHA 3H3OB 4GNIA 1QZ6A 4BGBA 2ZGZA 1V4SA 3EKUA 3BUZB 1GLLO 3CJAA 3DXKA 3CIPA 4H5RA 1U6ZA 3CJCA 4JN4A 3CERA 1KAXA 1X9JA 4B1WB 2EWSA 4LC9B 3D2EA 5AQSA 4A62A 2A40A 3CQXA 3U8XA 4FPAA 3W3DA 3ENOA 2P9LA 5AQMA 1KXPA 4H03B 3A5MC 4CD1A 5AZJA 1QQMA 3UKUA 4F9OA 3U9ZA 4H0YB 4CZLA 4BC5A 4FWOA 1QQNA 4CD3A 3MDQA 3BP8A 3EL2A 2HMPA 4MO5A 2YHXA 5AQHA 4K42A 4L3QA 4IJNA 4BC3A 3A0IX 4Z94A 1GLCG 2HOEA 5B8HA 4HWIA 2ZF5O 4FWMA 2QWNA 5AQKA 5E26A 5AQZA 3ZETA 2V7ZA 2YHWA 3FLCO 2P9NA 3F9MA 3KZBA 4H0PA 4BREA 1T44A 1SAZA 2Q97A 5JLFA 3H46O 4JHDA 3FZFA 4C23A 1HJOA 5EOYA 4MLEA 1BO5O 3M3ZA 4GY2B 3CJ9A 3ZEUA 1IG8A 2QXLA 1NGDA 1MWMA 3DXMA 3H45C 3SK3A 2HF3A 4PKGA 3C7NA 3HM8A 1G99A 1K8KA 2E8AA 3OHRA 3QICA 3RSEA 1JCEA 3D7EO 4KBOA 1Z05A 1DEJA 4CZIA 2CGLA 4BRQA 4WQ4C 2W41A 4HTLA 5TKYA 4YDUA 3O8MA 4JNEA 2QM1A 3FGUA 4QS9A 2FXUA 5ELZA 3WXIA 4BRLA 1LCUA 5AQXA 3UB5A 5FPMA 3AY9A 3LM9A 3D2FA 2FF6A 4BGAA 1BU6O 3LDQA 2YI1A 5BRFA 3A5LC 1U2VB 2V52B 3ATUA 3CJBA 4BC4A 2AP1A 1NM1A 4CBUA 5EVZA 4Y0WA 4BQZA 3DXKB 2YHYA 2CGKA 2Q1NA 4B1VA 3VENA 2D0OA 4ISFA 1XUPO 1X3NA 2BUPA 2PBDA 1NMDA 2UYTA 5KPTA 1NGHA 2QW9A 3D2EB 3DWLA 3GDQA 1DGKN 3LDOA 3LL3A 1V4TA 3A8YA 2P9LB 2Q0UA 3H3NO 5JMVA 5CE3A 1WOQA 2DPNA 3ZX2A 3UKUB 4IXCA 2E1ZA 3C0BA 2P9PB 5AQVA 4BVOA 1GLBG 3CETA 5EY4A 3SJHA 3FZMA 1HKBA 1RDWX 3FZKA 4IWVA 4BR7A 1GLAG 3UE5A 3ZETB 4B9QA 4BRPA 1MWKA 1ZC6A 5AR0A 4IJAA 2P9NB 4O8KA 3VETA 3MMVA 1NGCA 2P9UB 4EAHD 1YAGA 4CZEA 1IJJA 1ESVA 1NGBA 1MA9B 3EO3A 5F0XA 4I6MA 3TPQA 3VEZA 1C0FA 2E2NA 2FF3B 5BPNA 3MN5A 4J8FA 4JHDB 5AQPA 4M63C 3GOIA 3VEXA 4BQLA 2P9IA 3I33A 4BRMA 4DQ8A 1HKGA 4PL8A 3HZ6A 2FSNA 4FWSA 1MDUB 4DCHA 4WQ5A 5AQRA 3DXMB 4PKIA 4PKHA 4BR5A 1OKJA 4H0OA 5AQLA 3C7NB 5AFUA 5AZIA 3AARA 4BG9A 1K8KB 1QQOA 3SMSA 4CZMA 3A5OC 3RSEB 3L4IA 2I7PA 4NB4A 3QFUA 5JLHA 2D1KA 1BDGA 3QMLA 3ZX0A 2IVNA 1E4GT 1YVNA 4DB3A 3A5NC 4A61A 2J4RA 2YCHA 3ATVA 3CJ1A 1H1VA 4BRNA 4CBXA 2FSKA 2YJFA 3O4WA 3GL1A 1D4XA 3VF2A 1WUAA 2ASOA 1P8ZA 3CJ7A 3D2FB 1JCFA 3CHWA 4CZKA 3MN6A 3M1FA 5AQOA 2VYPA 5BRHA 2IIRA 4ISGA 1ZXOA 4XH5A 1S3XA 4AM7A 3QDKA 2YJEA 5EX5A 2P9KA 4K43A 5BREA 3FZLA 4B1XB 1QHAA 1NLVA 1TYQA 2CH6A 3UKRA 3KHYA 5KPZA 2QWQA 3R9PA 2E2QA 5JICA 4AM6A 5LY3A 1QZ5A 4BRGA 3R6MA 3S41A 1NGGA 2D4WA 3L0QA 3VPZA 5KQDA 5AQIA 1GLEG 2A42A 2P9SA 1HKCA 5LJWA 3JXUA 1TUUA 5AQGA 3GG4A 3B8AX 3ID8A 4BRFA 1YXQA 1Y64A 2NLXA 2Q36A 2E2OA 4FWKA 4NO7A 4IZ9A 3MN7A 2AA4A 4BR0A 3MK6A 2IVPA 4BR2A 4H5NA 4XH4A 4H5VA 3LM2A 1NGAA
chains in the Genus database with same CATH superfamily
1NJXA 3IFRA 2NRHA 3PIPL 3P4IA 3Q7BA 1FK9A 3CM6A 2P5OA 4Q0BA 1NBWA 4CK1A 2QWMA 3ULEA 1RT3A 4KO0A 5FLXO 3QNOA 1EWQA 1IKXA 3VF6A 5AZJB 1YT3A 4M42A 1TUYA 3SUQA 1NOZA 2E20A 2BE2A 4QS8A 3VGLA 2FLOA 5DM6L 4A2AA 3G4SN 3O08A 4CGIA 3V9WA 3KWIA 4N41A 1RDAA 3OJSA 4JI5K 4J2EA 3ZSWA 5JS2A 3AO5A 1JLAA 2KFZA 1HNXK 3HSCA 3VEOA 4ID5A 4JRPA 4KHPK 5FPNA 3WQUA 1LV5A 4M7XA 3V9ZA 1RGIA 3VOVA 1VAZA 3VESA 4CJ3A 4XEIA 2O8EB 1DT9A 3AO3A 5BPLA 3JS6A 4FOIA 4WQ4A 4H0XB 2HVIA 2GBZA 3F2KA 5FPDA 4CEFA 3ZEUB 4O8UA 1N36K 5J2QA 1WSIA 5BN8A 1R59O 4M41A 4CGFA 4IEEA 4AHTA 3K9JA 1KAZA 2HSTA 2P51A 1RILA 4B1UB 3UKRB 1Q18A 2CGJA 3VQ9A 4EP4A 4PL7A 4M3RA 5ADXH 2P9PA 3SLCA 3CFOA 2OYQA 4WFBL 3R3LA 2W40A 4IG3A 4RTFD 1CLQA 1J53A 4F2SA 1WSGA 4K8XA 2ASPA 3F73A 4H4OA 4E19A 4FVMA 3K5MA 4WYBA 1X3MA 3J8AA 4KI4A 2B6AA 2NRZA 4H5TA 4JK7A 2GELA 3SAHA 3VA3A 3DJCA 1ZBUA 3THVA 3VGKA 3EE9A 1S6PA 4ISEA 3SQ2A 4H5WA 3G10A 4BVPA 3W0LA 2IC3A 4RW4A 4PY5A 4KH5A 4JI4K 3ZT1A 3J7YP 3O1BA 4DSFA 1Q86O 3SZ2A 4FJIA 1W2BM 1J54A 1XWLA 2D0PA 2YNFA 2F7TA 1T6DA 4CZJA 4WF9L 2G8WA 3VEYA 1SL1A 1O1WA 5AQWA 3ULEB 3GBTA 2QWPA 4KREA 4QS7A 4EP5A 4OKEA 2X78A 1BCMA 3PV8A 2W42A 4E89A 4CJRA 3KD1E 3I8DA 4OPJA 1QS4A 4GV3A 5KRTA 2QWLA 3HI0A 3UIQA 4J2BA 3T1HK 4JKBA 3O1WA 4B1YB 4DFJA 3DAWA 4CFAA 5DM7L 5DMRA 1RDDA 3KLIA 3PLAA 3O9SA 1TGOA 1S9GA 2B5JA 3AGKA 3SPZA 4FWRA 3IMXA 5GAGP 1HR0K 4CHNA 3WUHA 3RMBA 3FE1A 3KJVA 4IDKA 1LW2A 3LALA 2XY8A 3ZX3A 2JGUA 3AVNA 1C0TA 1EX4A 3G25A 1A5XA 2VCPA 1VRUA 2ZGYA 4DTUA 2RE2A 1JL2A 4N5SA 4W5QA 4CEBA 4FO0A 5K14A 3TTCA 2QA4N 4CI6A 3U3GA 2PAVA 3CF5L 4EHUA 4DV7K 1GLFO 2H3GX 4HCCA 3TAFA 3QEWA 3EN9A 4J2AA 3HXMA 3EZWA 1BA0A 3FZHA 4H0VB 3H3OB 4GNIA 1QZ6A 2ZGZA 2YNHA 3WNFA 4PHTX 1GLLO 3PO4A 4LSLA 4XIUA 4BY9C 2X74A 2NRRA 1IBMK 1KRPA 3CJCA 4K8ZA 3RMAA 1U48A 5GIOA 3D2EA 3M5RA 4A62A 4CFBA 3RMDA 4LF5K 4KI6A 3PSFA 5GIPA 1KQSM 1WSFA 4IG0A 1JXBA 4HVJA 3ALYA 3ENOA 2RN2A 3T1YK 3IRXA 4H03B 1TKDA 2XHBA 3A5MC 4M45A 3QERA 4HUFA 4CZLA 2OPPA 4FWOA 1QQNA 3MDQA 2HMPA 4CFCA 1N8RO 2FC0A 1X1PA 1Q82O 1JLCA 5B8HA 4YOXA 4RW7A 4CVNE 3FLCO 4DFPA 3KZBA 4DS4A 1VQPN 2KKZA 4BREA 4JKAA 3O3FA 5C24A 1VSLA 2IGIA 3C95A 3LDSA 5JLFA 3H46O 4BDZA 4BWMA 1T8EA 4PUOA 4F8RA 3EZ5A 3BZCA 4PQUA 3CJ9A 4CF8A 4E7KA 3M8PA 4B8CA 2B4JA 4CGDA 1JXEA 2G8IA 1IG8A 5AJ3K 2DFFA 4BACA 3SK3A 1NU0A 4PKGA 3C6TA 3D7EO 4TSXA 3DM2A 5M1FA 2CGLA 2JWLA 3E9OA 1N33K 4DV5K 3NGZA 3NVKA 3O8MA 4JNEA 2FXUA 1I39A 2E6LA 1SKWA 1VQON 4YOTA 1K8AO 3CC7N 3D2FA 1BU6O 3CCUN 4FZXC 4IBNA 1VSMA 3SYZA 5BRFA 4Z4GA 1W7AA 4JI3K 3CMEN 2Z1IA 3KK1A 1U04A 4ID1A 4BC4A 1KSPA 2AP1A 1N5YA 4B9LA 1VK0A 2FBTA 4LFAK 4Y0WA 1XMOK 2CGKA 3HPGA 3Q7CA 3VENA 4YY3K 1B92A 2BUPA 4WCEL 2BANA 4FM0A 1NGHA 1M1KO 3D2EB 2X6SA 3D6RA 3OY9A 3A8YA 4JS5A 4FLWA 3NMUA 2Q0UA 3ZX2A 1CXQA 1T05A 4IXCA 2NRXA 1YIJN 3K58A 4LFCK 2KQ2A 3FZKA 4IWVA 4BR7A 4ZTJA 3UE5A 3DOLA 4BRPA 1K6YA 1MWKA 4GMJB 3J80O 3VETA 1IJJA 3CCEN 4I6MA 3TPQA 2UXCK 4A5BA 4C1NK 2FF3B 3VQ7A 4J8FA 4FXDA 3V6DA 4DR2K 2F4VK 3I33A 4BRMA 3HZ6A 2QTDA 3V81A 3KTQA 4KPYA 4FWSA 5J2PA 3E01A 4OPAA 4DCHA 4WQ5A 3O9QA 2R7YA 2HHXA 4PKIA 4BR5A 3V1OA 3TABA 1RBTA 1T7PA 3ZT4A 2NRVA 4H0OA 4C8OA 4NB4A 4WE1A 3NDKA 2JLEA 4O5BA 5JLHA 5GINA 2IVNA 4C8LA 4C8KA 1E4GT 3QEIA 4DB3A 4LF8K 2J4RA 4DUYK 4U67L 4CBXA 4CIFA 5LL6Z 1EO1A 2UU9K 1CXUA 4CEQA 3CJ7A 3D2FB 1VQ5N 4CZKA 3HP9A 1ZXOA 1NK6A 3DRSA 5FRNA 5EX5A 2P9KA 1S1XA 5HRSA 3M8SA 4RW9A 4LD0A 3R1XA 4R5PA 5M1QA 1XNRK 1C0MA 1QZ5A 4DU4A 3C94A 4IOXA 3DLEA 3S41A 3VPZA 4WFAL 3K57A 4I9LA 5KQDA 5AQIA 1D5AA 1EWRA 2P9SA 3CC4N 1UWBA 1GOCA 3ID8A 3DYAA 4BRFA 4KHNA 2FBVA 3E1YA 1NK5A 4JKFA 4KB0A 3I0RA 4JI8K 1XI1A 1WLJA 1S1WA 3LWMA 4OGCA 3ZSOA 3MK6A 2IVPA 4BR2A 4H5NA 4H5VA 3AVLA 1XQSC 3WT0A 2DY4A 3EKSA 3DRPA 2Z1GA 1WNSA 4FW1A 5H1SQ 4E1JA 4M3WA 4CJ5A 4FLTA 3VERA 1OH8A 2WOMA 4I6MB 3IDHA 5BR9A 2VGNA 1FW6A 3LDNA 3F5TA 3MXJA 2QKKA 3CD6N 3R8EA 4H4MA 1E4FT 1LAWA 3ZYYX 4AHUA 4MLHA 3QEPA 1C0GA 3CI5A 3I56N 4DQRA 5MLCQ 3QESA 3BGRA 1ASUA 3SV3A 4DR4K 4DR1K 2Q31A 4BE0A 4YORA 1XHXA 4DSKA 1S1TA 2ZD1A 1ASWA 2GWKA 4K41A 3P38A 3VQQA 4BR4A 2A1SA 4YNQA 3OS0A 3ENHA 1C6VA 4N47A 2PZSA 4NYFA 2F96A 3LAKA 1TK5A 4KB1A 3L4QA 3I8BA 1NK4A 2RHKA 3IAYA 1RTIA 4IFVA 3OYLA 2P9KB 4CZFA 1J6ZA 2ASMA 3CQ8A 5FDLA 3QNNA 3G0ZA 5SWMA 3LZIA 3ZSYA 1HPMA 1CZAN 4CK2A 3QIOA 4CIEA 3LDPA 1SV5A 1NWKA 4CFDA 3S3MA 1HLUA 2P9SB 2OCEA 4RWTA 4DKWA 4EIAA 2ZWHA 3KLHA 2WTUA 3CPEA 3K5OA 4BRKA 2VG7A 2QKBA 1EKEA 5KQ8A 3MAQA 3K9KA 4IKFA 3BF3A 4CCHA 4FJXA 3K2PA 4CHOA 4BC2A 4QAGA 2BTFA 3P31A 1S6QA 3P83D 4UQGA 4FJ9A 5LMNK 3BDPA 3U4LA 4JYAK 2HW3A 2D0CA 4M3UA 3VEVA 4H8KA 1BG3A 3G71N 2F9WA 3HBTA 4IO8A 4CZGA 3O9UA 3KK2A 4BRDA 4FJKA 4A5AA 3DOKA 3PIOL 4BRCA 3OS1A 2Z1JA 4FWQA 2G8UA 1HQEA 1XC3A 2ITGA 3NF8A 2HMIA 4LFBK 1BI4A 1J5OA 1VSHA 2ETJA 4GVMA 3D45A 5CR4A 1YJWN 3RRGA 1TKZA 2NZTA 4RG8A 2GUPA 1T6CA 4AF1A 2HBLA 2QWOA 3ZSZA 3CFPA 1OH7A 3L3UA 1KAYA 2WBNA 4FL9A 2Q2RA 4JKDA 1Q81O 1KD1O 2PYJA 1BCOA 4G9ZA 3DLGA 4B9SA 1NGEA 1TK8A 3TAEA 4C1NI 5HROA 4RCHA 4N56A 4E7HA 1J5EK 1JCGA 2NRWA 3OBYA 1WSJA 4OLAA 3H1VX 4EHTA 3SMPA 4FJ5A 2ZM6K 1HQUA 3HRGA 4F2RA 3SV4A 1RTDA 3WXJA 1YHQN 2RKIA 4KHQA 1BWFO 3K0SA 3FFKB 4YHHK 4BGBA 1NK9A 4M3ZA 4GV9A 3K5LA 1V4SA 1DTTA 3EKUA 4DTJA 5GADP 3CJAA 4AHVA 2BGGA 4RW6A 3CIPA 3AA4A 3KK7A 1KAXA 1RBVA 4CJFA 3RR7A 4LC9B 1VQ4N 2XO7A 5AQSA 3RR8A 1VHXA 3CQXA 3N4QA 3ID6A 3W3DA 4LF4K 5AQMA 1WSHA 4CGHA 3OYIA 5KGXA 1SUQA 4F9OA 1VQKN 4U7BA 1S72N 4BC5A 3NF7A 4CD3A 3S3NA 1RBSA 2E6MA 1DLOA 2HOEA 1VRTA 4HWIA 5D3GA 5C42A 5AQKA 3ZETA 3LAMA 5E26A 3NF9A 1L3SA 4OPKA 4B9UA 3F9MA 4JLHA 1KVAA 1BISA 1CZBA 1JLBA 4JHDA 4CF2A 1YJNN 1HJOA 3NH2A 4FJLA 3KIOA 1BO5O 3M3ZA 4GY2B 4YFUA 1VQNN 4BWJA 3SJJA 3TARA 1TKTA 4IFEA 3H45C 3V9XA 2HF3A 3HSTB 3HM8A 1WBDA 1G99A 4CHPA 2E8AA 3AVGA 2F8SA 4GKKK 1JCEA 2NNWA 4JI2K 1VSDA 1F21A 4DTRA 4ELUA 2VG5A 4DSIA 1DEJA 4CZIA 5J2MA 4BRQA 5EU7A 4WQ4C 4KV8A 4YDUA 4DQPA 2QM1A 4QS9A 3WXIA 4BRLA 1LCUA 3ZSRA 3OYEA 3UB5A 3TANA 3AO2A 4CERA 3AY9A 2HNDA 4BGAA 1EXQA 4FM1A 4LSNA 2KW4A 3ATUA 1L3UA 3QLHA 1SS6A 4B3RK 4CBUA 4CHZA 3F9KA 1QSSA 3T7ZA 5C25A 2HBKA 3J7ZO 4B1VA 2O8BA 3OYAA 3A2FA 5TKWA 4CECA 1NMDA 5M1KA 4CJQA 3B6OA 1EETA 3VQ8A 4OX9K 3U6FA 4JV5K 3ZSQA 5CE3A 4KHSA 4Z0UA 4DQIA 4DFMA 1LWEA 1C1AA 4DF8A 3K59A 4GKJK 1W0HA 2P9PB 3T69A 4BVOA 4FCYA 2XRIA 1KFSA 1RDWX 4B9VA 5JS1A 1IH7A 4CF1A 3HO1A 3DI6A 1BIUA 1GLAG 3ZETB 4B9QA 4B3SK 4E1NA 3BZKA 1RDUA 1NGCA 3KD5E 4IDHA 5JVGL 1WAFA 4Z4IA 1ESVA 1NGBA 3EO3A 5F0XA 3ISNC 4AHCA 3MEGA 4O44A 1ITGA 4JHDB 4W5TA 1Q9XA 4M63C 3GOIA 3VEXA 2DFEA 2P9IA 4ZTFA 4DQ8A 3P39A 3SCXA 1JLEA 2OPSA 2UUCK 2FSNA 4DSJA 4JKGA 1N34K 3T19A 3MXIA 1QSYA 1OKJA 3QIPA 3CCQN 5AZIA 3I0SA 1QQOA 5I3UA 3SMSA 3A5OC 3CCVN 2WFBA 2Z1HA 1VQ7N 3L4IA 2G8HA 2OZMA 4LF6K 4DSEA 3QFUA 3WNGA 1W97L 1RTJA 3QMLA 1TL1A 5M1PA 1YVNA 1VSFA 1BHLA 1YJ9N 4AH9A 1KLNA 4FZYA 2YNGA 4DS5A 3P1GA 2YCHA 3CJ1A 1H1VA 3CYMA 2GV9A 4DUZK 5KRSA 3VF2A 3KLFA 2ASOA 1JCFA 4IOAL 2KZZA 3MN6A 5HRPA 5AQOA 3J7AP 1S3XA 2HNZA 3QDKA 2YJEA 4K43A 2VWJA 3TTDA 4B1XB 3NBPA 3RRHA 2E5LK 3HJFA 1S9EA 3OYCA 3PUFA 3CG7A 2O8DA 2QWQA 4J2DA 2O8BB 4QOZB 3V1QA 3L0QA 2D4WA 3ZT2A 3RMCA 3QO9A 4HUGA 4FLVA 4CEAA 3L8BA 3L2RA 3IKMA 5AQGA 3GG4A 3DRRA 3JYTA 4WFNL 3MEEA 4OKKA 4OPHA 3TSQA 4O55A 4FWKA 4IZ9A 4O4GA 2AA4A 4M3XA 4XH4A 3H08A 5CY4A 4B1ZA 4CIGA 3PX6A 2PY5A 4DWIA 3WXLA 3ZSVA 2HBMA 3L2QA 3PO5A 2F8TA 3QBXA 3TAQA 4FJJA 3VQ6A 3L2VA 2VQEK 4M7YA 2KFNA 4DV1K 3CCLN 1NGJA 4OVLA 3AVMA 5BR8K 3ITHA 3NGIA 2OANA 4YOVA 5C10A 2P9IB 1YTUA 5LMUK 1D8YA 3AAQA 3BEXA 4KTQA 4JKGB 3O4NA 1ATSA 4CJ4A 3AVCA 4CW7B 2G8VA 5C2DA 1NJIO 4B9MA 1U4BA 5AZIB 4F4KA 3NFAA 2CH5A 2FSJA 2UXBK 1NG9A 5A2QO 1TAQA 4Z4CA 5J1EA 2WUSA 1CZ9A 3NGYA 3MCPA 3O5BA 1GLJO 1X9MA 3P5JA 4A2BA 1L3TA 5I9EB 4DHYA 3QBWA 5GAHP 1DKGD 2A3ZA 1GOAA 1Z6RA 1ATNA 3CXCM 1LOTB 4JKCA 4KHUA 2I7NA 3NCIA 1QTMA 5FPEA 4O5FA 3T1AA 3THXA 5AQJA 2ITMA 3KVGA 1RFQA 3TWHA 1NJWA 3IG1A 3AVHA 3NHGA 1OVQA 1YITN 2O8DB 4CEZA 3DLBA 5J2NA 3VQDA 4LF9K 3AO1A 3VF4A 3SAGA 2IVOA 2HF4A 4OGEA 3E9LA 1Z25A 3G6EN 2IOCA 5FROA 3EE8A 2NUBA 2P9UA 3NAEA 5C2FA 1SQKA 4IOCL 3HK2A 3ZLJA 2KZMA 4CJSA 3HP6A 2A41A 5HOOA 1JLGA 3NH1A 4H0TB 4HHTA 1W9HA 3AVKA 2VGMA 4CK3A 3FR0A 2ATQA 2QI2A 3TSUA 4BRHA 3EYZA 3THWA 1BIZA 3THYA 1K73O 1BA1A 4CJLA 4B3OA 3TU5A 5AQYA 1ZBIA 5AFUH 3CCJN 4FOEA 3SNNA 5AQUA 5AQQA 4C8NA 2GTDA 4Y1CA 5E41A 2VWBA 4OLBA 5M1OA 2E88A 3HTVA 4NLBA 3HPHA 5KGWA 4WQ5C 3HL8A 1BQMA 4B9TA 1IKVA 4MDAA 3SPYA 1A5WA 2O8FA 4CGJA 4LH4A 3N4PA 1RDBA 4NYNA 3O80A 2QWRA 5LJVA 1S5JA 2GUIA 2YKMA 1T03A 1X9SA 3NF6A 3VGMA 5FRMA 4BR9A 3QEVA 3CQYA 1S22A 2XY5A 3H1QA 2A1RA 3THXB 2ZJRL 3H6EA 3HM9A 1EQYA 2A6AA 4DU3A 4FWNA 1U2VA 5EXWA 4ZHRA 4IO9L 4BE2A 3B6PA 3KWGA 2YV0X 4KTZA 1GOBA 3DXKA 1VSJA 4H5RA 1U6ZA 4JN4A 4CESA 2EWSA 4O0IA 4E7JA 4B9NA 4M3YA 1WB9A 1HNVA 1KVCA 4ELTA 4NXMK 2A40A 4FJNA 1FXXA 3AGRA 4FPAA 1BQNA 3AA3A 4I2PA 2P9LA 1KXPA 4AHSA 4YOUA 4CD1A 5AZJA 1QQMA 3PX4A 2EHGA 3U9ZA 3E66A 2QK9A 1RBRA 4MO5A 1BGXT 4JKHA 1OH5A 4CJTA 4IJNA 1NJZA 3SBGA 3NH0A 3A0IX 1GLCG 4YOYA 3WNEA 3CM5A 3OYHA 3PX0A 1HPZA 1HYZA 4A57A 2ZF5O 4BE1A 1RDCA 3THYB 4FWMA 2QWNA 5AQZA 2D5RA 2YHWA 4H0PA 1XNQK 3S3OA 1WAJA 3CCSN 1JLFA 3FFIA 3OBWA 2HHWA 2Q97A 3FZFA 4C23A 4JI1K 5CZ2A 4MLEA 1U45A 2PYLA 4FK4A 1N6QA 4CF0A 4KHYA 4V19S 1S1VA 3ZEUA 1ILYA 1NGDA 1NNEA 1MWMA 2O8FB 3RTVA 3HOSA 3C7NA 4DLEA 3QICA 4ILHA 4CJWA 3C65A 4L8RB 3L2UA 4GW6A 1Z05A 1VQMN 1RT4A 4DTNA 2O4IA 1VSKA 4B3TK 2KTQA 3DLHA 1O13A 4HTLA 2HVHA 5TKYA 3FGUA 3C6UA 5FPMA 1TKXA 3LM9A 2FF6A 3LDQA 3SQ0A 3TSPA 4CJKA 3A5LC 1U2VB 1VSIA 2V52B 3CJBA 2HHHK 3T3FA 1NM1A 1YVUA 2XY6A 2HHTA 3SBTA 4BQZA 3LPUA 3DXKB 3OYDA 4E7IA 5C12A 2D0OA 1B9DA 1OVYA 1X3NA 2PBDA 3KLGA 1UOCA 5KPTA 2QW9A 1RT1A 3NVMA 2VG6A 3AVIA 4DR7K 1DGKN 1EP4A 4O0JA 2P9LB 1UA1A 4DTSA 2HNYA 5JMVA 2ZQBA 1NK8A 3J81O 2FBXA 2E4LA 4I7FA 2E1ZA 1GLBG 3CETA 5EY4A 4K0KK 4F3TA 3FZMA 2OZSA 3U3YA 3SAFA 3LZJA 2OTLN 4IFYA 4IJAA 3MMVA 4DLGA 4EAHD 4OO1J 3L2WA 1MA9B 1REVA 1HJRA 2E2NA 5BPNA 3QINA 4LH5A 3MN5A 5AQPA 3HT3A 4EZ6A 1BL3A 3TAPA 4W5NA 4PL8A 3KK3A 3S9HA 1NOYA 4DV6K 3M8QA 3VQPA 1Z26A 4OKJA 3PSIA 4NXNK 5AQLA 3C7NB 5AFUA 1C1CA 1C0UA 2RPIA 1C1BA 2DTUA 3AARA 3MX5A 4JI6K 2JWKA 4BG9A 4CZMA 1KTQA 3ZT3A 1HNIA 1ASVA 3IS9A 4FK0A 4FLZA 4DR6K 4QCLA 4N76A 5DK5A 3A5NC 4DTMA 2ZJQL 3TAMA 4DTOA 1RTHA 4DQSA 4ILGB 1BI4B 1HRHA 3AVAA 4KH6A 1Y97A 4HTUA 2YJFA 2XY7A 3GL1A 1LW0A 1P8ZA 4EZ9A 3CHWA 2ZJPL 3BY5A 2IIRA 4ISGA 4XH5A 2W6KA 4OJRA 1RBUA 2HHQA 1QHAA 3MX2A 3V4IA 1YI2N 1TYQA 2CH6A 3KHYA 3OYFA 1SKRA 2I5JA 5LY3A 4JK9A 5IT9O 1NMNA 3ZT0A 1HMVA 1YTAA 1HYSA 1HKCA 2LSNA 5LJWA 3JXUA 4JK8A 4FLYA 1ZYQA 3B8AX 1J9AA 3RVCA 3JSMA 3TTFA 1HNZK 4DR3K 1HNWK 4JKEA 2Q36A 5GAEP 5M1NA 2E2OA 3OYGA 3OTOK 1Q8IA 4KRFA 4LF7K 3MN7A 4BR0A 4FJMA 1IO2A 1I3AA 4X65K 1FKOA 4UY8O 3OYNA 3LM2A 1NGAA 1G15A 3MCAB 3VN5A 1RNHA 4I2QA 2KLAA 1B9FA 3WEEA 1JKHA 3OYJA 2KHOA 4BROA 4DU1A 3V9UA 4Z4FA 4JD2A 3GE1A 1JLQA 3CCMN 3LP0A 1U47A 1NGIA 4FJHA 3V1RA 5F1XA 3AA2A 2V51B 1D9FA 4W5RA 3CMAN 1NGFA 4K25A 4B8AB 4FJ7A 4FVUA 3AV9A 5I42A 5HL7L 2Y1JA 1D9DA 3VA0A 1LWCA 1XC9A 1RT7A 5F2RA 5KPRA 1JL1A 3M8RA 1IBLK 4FZZA 1IBKK 4CJ7A 1R0AA 4CF9A 3I55N 3IUCA 1QHTA 3AVJA 5AQNA 3M6GA 1IG9A 4DSLA 1YF5L 3L6QA 2O8CA 3OW2M 1K9MO 5AQTA 3QETA 4YDUC 1L5UA 5AQFA 4DV2K 2YHBA 3SQ1A 4Z4EA 3SQ4A 4HCBA 4FSVA 2OPRA 4BDYA 3AA5X 3NE6A 1RT6A 3OYKA 4FWLA 4DF4A 4AILC 4BG8A 2OTJN 4XH1A 2YKNA 1WSEA 3LDLA 1TYQB 1KCFA 2UUAK 2WONA 1HX1A 4MO4A 1QVGM 5HP1A 5E84A 1NK0A 1ATRA 1GLDG 4MDBA 1IV0A 4X64K 4CHYA 1HUXA 3WXMB 3DLRA 4YOWA 2A5XA 1NJYA 4FPBA 3O4QA 4CJEA 1QE1A 2V7YA 1SL0A 4BRAA 1ZBSA 3OVNA 4CHQA 5BPMA 2F9TA 4DMNA 3CC2N 3OA9A 5C15A 1FKPA 3ENBA 4KFBA 3JAMO 4IEIA 3WXKA 4FYDA 1YUWA 3AAPA 1JJ2M 3MWPA 3AVBA 3ZCMA 2GEMA 2UUBK 3WEEB 1KVBA 4CBWA 4JD2B 5JVHL 2G8FA 2Q0RA 4JAXA 1TVRA 4F3OA 1SZ2A 3HVTA 1KFDA 4DTXA 3PY8A 4Q5VA 3QFPA 4X66K 3HPOA 1E3MA 3WQTA 3AO4A 3MECA 2BDPA 4GV6A 3VEWA 4B08A 4PA1A 3KLEA 1XHZA 3HOTA 3OYMA 4W5OA 1SKSA 5CYQA 3BF1A 3CFRA 3V9SA 3L3VA 1ZBFA 3WNHA 3VQ5A 1A5VA 3QB0A 3DMJA 2E2PA 1TV6A 2Y1IA 1BUPA 5BRDA 2O8CB 3U9DA 3O3HA 2OPQA 3VQEA 4NLCA 1BOTO 3AVFA 4KHWA 5BN9A 3CPWM 3K5NA 4BRIA 2E1YA 5SZTA 3SUPA 4MFBA 3MN9A 4RW8A 2GWJA 3O6WA 1T3VA 4CZHA 4A59A 3VTIA 4JRQA 4FWPA 3ULDA 3O3GA 3SUNA 2VWKA 5ADXA 2D0BA 2HHSA 5HLFA 4KAZA 4DV4K 4EFHA 3BUZB 2WC9A 1Q9YA 4E0DA 4CJPA 2HB5A 3VQ4A 5CZ1A 4JI0K 1DTQA 4B1WB 1X9JA 3CERA 4R79A 1FJGK 3VQBA 3O9RA 4GVEA 1RT2A 3U8XA 3OJUA 4AQYK 2Q3SA 4B3MK 3ASMA 1WBBA 1OH6A 1UA0A 3UKUA 3LP3A 4H0YB 4JEPA 2QXFA 4DG1A 1L3VA 3BP8A 2VQFK 3EL2A 2YHXA 5AQHA 4K42A 4CEOA 4L3QA 4BC3A 4Z94A 2YNIA 3TI0A 2V7ZA 4FK2A 1TL3A 2P9NA 1Q7YO 4E1MA 1U49A 3LWLA 1QSLA 1T44A 1SAZA 3EY1A 3RWUA 4FW2A 4KKOA 4DTPA 3VQCA 1MU2A 3DLKA 5EOYA 4BDPA 1VQLN 1QVFM 2IAJA 2AJQA 2QXLA 5IWAK 4DR5K 1X9WA 3DXMA 1VSEA 4FJGA 1NK7A 4Z4HA 4AHRA 3VTHA 2W6LA 3MEDA 1K8KA 3OHRA 3RSEA 2IDOA 4KBOA 1ZBHA 3E9PA 4FLXA 3KKSA 3HVRA 4MQ3A 2W41A 4E7LA 1TAUA 5ELZA 1I94K 1IKYA 5AQXA 4ELVA 3VMFB 1UAXA 3MWTA 4CJVA 5CYMA 2YI1A 4FJ8A 2FBYA 4KH4A 4E3SA 1VQ9N 2HHUA 3LP2A 5HBMA 1LAVA 1KC8O 5EVZA 4PWDA 2HHVA 4ICLA 4C8MA 2YHYA 2Q1NA 1SL2A 4ISFA 3LP1A 1HYVA 1XUPO 3D0PA 4DQQA 1KLMA 1LWFA 2UYTA 1WN7A 2X6NA 4KTWA 3DWLA 4DV0K 4I9QA 3GDQA 2EX3A 3LDOA 2DFHA 3LL3A 1V4TA 4HUEA 3VQAA 4X62K 3OYBA 3H3NO 1WOQA 2DPNA 1TK0A 2GX9A 3UKUB 2PFUA 2OA8A 1QQCA 3C0BA 3EEQA 5AQVA 2P1JA 3SJHA 1HKBA 3C6HA 1RCHA 3C6AA 1S1UA 4CGGA 5CHIA 4G1QA 4JS4A 1ZC6A 5AR0A 2UXDK 3MXMA 2P9NB 4O8KA 4CJUA 2HBJA 1VQ8N 2P9UB 1YAGA 4ILJA 4NCGA 4CZEA 3LANA 1IKWA 3VEZA 1C0FA 4BQLA 2IS3A 2YX6A 4CE9A 3SUOA 1HKGA 1N32K 4NCAA 1MDUB 5AQRA 3DXMB 4PKHA 5C0YA 3THWB 4FM2A 1K8KB 2P5GA 3RSEB 1NKBA 2I7PA 2D1KA 2BH1A 5KI6A 1BDGA 2O4GA 3ZX0A 4A61A 1M90O 3ATVA 3OS2A 2O8EA 4BRNA 3LPTA 2FSKA 3O4WA 1XMQK 1NKCA 4JI7K 1D4XA 1WUAA 3M1FA 2VYPA 5BRHA 3KKRA 5HRRA 2G8KA 1NKEA 3ZSXA 4AM7A 5T7BA 3O9TA 5BREA 3FZLA 1NLVA 3UKRA 2ZE2A 4CEEA 5KPZA 3R9PA 2E2QA 5JICA 4AM6A 4FLUA 4LY7A 4BRGA 3R6MA 1NGGA 4DFKA 4Y1DA 3SI6A 2D0AA 1GLEG 2A42A 4NCBA 4M3TA 1RT5A 1TUUA 1ZBLA 1VQ6N 3DLLL 1YXQA 4CEDA 3TR8A 1Y64A 2NLXA 3CCRN 3QEXA 2YHAA 3HYFA 2NRTA 1P90A 5HRNA 4NO7A 5KTQA 2QEXN 2RF2A 4DV3K 3TAGA
chains in the Genus database with same CATH topology
4B1ZA 3MCAB 1XQSC 2KLAA 3IFRA 2NRHA 3WXLA 3WT0A 3EKSA 3WEEA 3PIPL 3P4IA 2HBMA 3Q7BA 2KHOA 4BROA 5H1SQ 4E1JA 3QBXA 1NBWA 4JD2A 3GE1A 2QWMA 3ULEA 4M7YA 3VERA 3CCLN 3CCMN 1NGJA 3VF6A 1NGIA 4I6MB 3IDHA 5F1XA 5AZJB 5BR9A 2V51B 2VGNA 1TUYA 3CMAN 3LDNA 1NGFA 2E20A 2OANA 3F5TA 4YOVA 4K25A 5C10A 3CD6N 2P9IB 4QS8A 3VGLA 3R8EA 2FLOA 1E4FT 4FVUA 5DM6L 3ZYYX 3AAQA 4A2AA 3G4SN 5HL7L 3BEXA 3O08A 4MLHA 4JKGB 3KWIA 1ATSA 5F2RA 1C0GA 5KPRA 3CI5A 3I56N 5C2DA 1NJIO 5MLCQ 4CJ7A 5AZIB 2CH5A 3I55N 2FSJA 3IUCA 3HSCA 3VEOA 2Q31A 5FPNA 5AQNA 4YORA 3WQUA 3M6GA 4M7XA 1YF5L 3L6QA 1RGIA 2WUSA 3O5BA 3MCPA 3OW2M 3VOVA 1K9MO 1GLJO 1VAZA 2GWKA 4A2BA 4K41A 3VESA 5AQTA 5I9EB 3P38A 4DHYA 3QBWA 4XEIA 1DT9A 4YDUC 5BPLA 3JS6A 4FOIA 1DKGD 4WQ4A 2A3ZA 4H0XB 4BR4A 5GAHP 1Z6RA 1ATNA 3F2KA 5AQFA 5FPDA 3ENHA 3CXCM 1LOTB 4JKCA 3ZEUB 2I7NA 4O8UA 5FPEA 4FSVA 3L4QA 3I8BA 4O5FA 2RHKA 5BN8A 1R59O 5AQJA 2ITMA 3KVGA 4FWLA 2P9KB 1RFQA 4CZFA 4IEEA 4BG8A 3K9JA 2OTJN 1J6ZA 2ASMA 3LDLA 4XH1A 1KAZA 2HSTA 1YITN 1TYQB 3UKRB 4B1UB 1Q18A 2CGJA 4PL7A 5ADXH 1HX1A 2P9PA 1HPMA 3SLCA 4MO4A 1CZAN 4WFBL 3R3LA 2W40A 3LDPA 4RTFD 1QVGM 1NWKA 5E84A 3VF4A 1ATRA 3SAGA 1GLDG 1HLUA 2P9SB 2ASPA 2IVOA 4MDBA 4RWTA 4DKWA 1HUXA 2HF4A 3WXMB 4EIAA 4YOWA 2A5XA 3E9LA 3G6EN 4FPBA 2ZWHA 2V7YA 3CPEA 4BRKA 4BRAA 4WYBA 1ZBSA 3EE8A 1X3MA 3J8AA 5KQ8A 5BPMA 2F9TA 2NRZA 2P9UA 3K9KA 3CC2N 4H5TA 3OA9A 4JK7A 2GELA 5C15A 1SQKA 5C2FA 3BF3A 3SAHA 3ENBA 4IOCL 3DJCA 4IEIA 3VGKA 3WXKA 3EE9A 4ISEA 1YUWA 3AAPA 4H5WA 1JJ2M 4BVPA 3W0LA 3MWPA 4BC2A 2BTFA 4KH5A 3P31A 2A41A 2GEMA 3O1BA 1Q86O 5HOOA 1W2BM 2D0PA 3WEEB 4H0TB 3U4LA 2F7TA 1T6DA 4CZJA 4CBWA 2VGMA 3VEYA 4WF9L 3FR0A 3VEVA 1BG3A 3G71N 4JD2B 2F9WA 3HBTA 4IO8A 5AQWA 3ULEB 2QI2A 3TSUA 3GBTA 4BRHA 2QWPA 4CZGA 3O9UA 1BA1A 5JVHL 1K73O 2Q0RA 4JAXA 4QS7A 4BRDA 3TU5A 5AQYA 1SZ2A 5AFUH 4A5AA 3CCJN 4FOEA 3PIOL 5AQUA 4BRCA 5AQQA 2GTDA 3QFPA 2VWBA 4FWQA 3WQTA 1XC3A 5M1OA 2E88A 4GV3A 3VEWA 3HTVA 4GV6A 4NLBA 2QWLA 3HI0A 3HOTA 4WQ5C 5CR4A 1YJWN 4JKBA 3O1WA 4MDAA 2NZTA 4B1YB 2GUPA 3BF1A 3DAWA 5DM7L 1T6CA 4AF1A 2HBLA 2QWOA 3QB0A 3PLAA 3O9SA 2E2PA 1KAYA 1BUPA 2WBNA 3N4PA 4FL9A 3AGKA 2Q2RA 4JKDA 4FWRA 1Q81O 3IMXA 5BRDA 3U9DA 3O80A 5GAGP 1KD1O 2QWRA 3WUHA 4G9ZA 3FE1A 1BOTO 4NLCA 5LJVA 1NGEA 5BN9A 3ZX3A 3CPWM 3VGMA 3G25A 2VCPA 4BRIA 2E1YA 2ZGYA 4C1NI 2RE2A 4RCHA 1JCGA 4FO0A 2NRWA 3OBYA 4BR9A 3MN9A 3CQYA 1S22A 2GWJA 3H1QA 1T3VA 3O6WA 3TTCA 4A59A 3H1VX 3VTIA 4CI6A 4CZHA 4FWPA 4EHTA 2PAVA 3SMPA 2ZJRL 4EHUA 3CF5L 3H6EA 1GLFO 2H3GX 1EQYA 2A6AA 3HRGA 4FWNA 5ADXA 1U2VA 5EXWA 3WXJA 3EN9A 4IO9L 3EZWA 1YHQN 1BWFO 1BA0A 3FFKB 3FZHA 4H0VB 4EFHA 3H3OB 4GNIA 1QZ6A 3KWGA 4BGBA 2ZGZA 4GV9A 1V4SA 4PHTX 3EKUA 3BUZB 1GLLO 2WC9A 3CJAA 5GADP 3DXKA 4BY9C 2NRRA 3CIPA 4H5RA 1U6ZA 3KK7A 3CJCA 4JN4A 1KAXA 1X9JA 3CERA 4B1WB 4R79A 2EWSA 4LC9B 3O9RA 1VQ4N 5GIOA 3D2EA 4GVEA 3M5RA 5AQSA 4A62A 2A40A 3CQXA 3AGRA 3U8XA 4FPAA 3N4QA 3ID6A 5GIPA 1KQSM 3W3DA 3ENOA 2P9LA 5AQMA 1KXPA 4H03B 3A5MC 4YOUA 4CD1A 2QA4N 5AZJA 1QQMA 3UKUA 4F9OA 1VQKN 3U9ZA 4H0YB 4CZLA 4U7BA 3E66A 1S72N 4JEPA 4BC5A 4FWOA 1QQNA 4CD3A 3MDQA 3BP8A 3EL2A 2HMPA 1N8RO 4MO5A 2YHXA 5AQHA 4K42A 4JKHA 4L3QA 4IJNA 3SBGA 4BC3A 1Q82O 3A0IX 4Z94A 1GLCG 2HOEA 4YOYA 5B8HA 4HWIA 4YOXA 4A57A 2ZF5O 4FWMA 2QWNA 5AQKA 5E26A 5AQZA 3ZETA 2V7ZA 2YHWA 3FLCO 2P9NA 3F9MA 3KZBA 1VQPN 2KKZA 1Q7YO 4H0PA 4BREA 4JKAA 3CCSN 1T44A 1SAZA 3OBWA 2Q97A 5JLFA 3H46O 4JHDA 1YJNN 3FZFA 4C23A 1HJOA 5EOYA 1QVFM 1VQLN 4MLEA 1BO5O 3M3ZA 4GY2B 3CJ9A 1VQNN 3ZEUA 1ILYA 1IG8A 2QXLA 1NGDA 1MWMA 3DXMA 4IFEA 3H45C 3SK3A 3VTHA 2HF3A 3HOSA 4PKGA 3C7NA 3HM8A 1G99A 1K8KA 2E8AA 3OHRA 3QICA 3RSEA 4ILHA 1JCEA 2NNWA 3D7EO 3C65A 4KBOA 3E9PA 1Z05A 1VQMN 1DEJA 4CZIA 5M1FA 2CGLA 4BRQA 2JWLA 3E9OA 1O13A 4WQ4C 3NVKA 2W41A 4HTLA 5TKYA 4YDUA 3O8MA 4JNEA 2QM1A 3FGUA 4QS9A 2FXUA 5ELZA 3WXIA 4BRLA 1LCUA 1VQON 5AQXA 3UB5A 5FPMA 4YOTA 3AY9A 3LM9A 1K8AO 3VMFB 3CC7N 3D2FA 2FF6A 4BGAA 3MWTA 1BU6O 3LDQA 3CCUN 2YI1A 3TSPA 5BRFA 3A5LC 1U2VB 2V52B 4KH4A 3CMEN 3ATUA 3CJBA 1VQ9N 1SS6A 4BC4A 2AP1A 1NM1A 4CBUA 1KC8O 5EVZA 4Y0WA 3SBTA 4BQZA 3DXKB 3T7ZA 2YHYA 2CGKA 2HBKA 2Q1NA 3J7ZO 4B1VA 3Q7CA 3VENA 2D0OA 4ISFA 5TKWA 5C12A 1XUPO 1OVYA 1X3NA 2BUPA 2PBDA 4WCEL 1NMDA 2UYTA 5KPTA 1NGHA 5M1KA 2QW9A 3NVMA 1M1KO 3D2EB 3DWLA 3GDQA 3D6RA 1DGKN 3LDOA 3LL3A 1V4TA 3A8YA 2P9LB 3NMUA 2Q0UA 3H3NO 5JMVA 5CE3A 1WOQA 2DPNA 3ZX2A 2GX9A 3UKUB 2PFUA 4IXCA 2E1ZA 3C0BA 2P9PB 3T69A 5AQVA 4BVOA 1GLBG 3CETA 5EY4A 3SJHA 2NRXA 3FZMA 1HKBA 1YIJN 1RDWX 3C6HA 3C6AA 3SAFA 5CHIA 3FZKA 4IWVA 4BR7A 2OTLN 1GLAG 3UE5A 3ZETB 4B9QA 4BRPA 1MWKA 1ZC6A 5AR0A 4IJAA 2P9NB 4O8KA 3VETA 1VQ8N 2HBJA 1RDUA 3MMVA 1NGCA 2P9UB 4EAHD 4OO1J 1YAGA 4ILJA 4CZEA 4IDHA 5JVGL 1IJJA 1ESVA 1NGBA 1MA9B 3EO3A 5F0XA 3CCEN 4I6MA 3TPQA 3VEZA 1C0FA 4A5BA 2E2NA 2FF3B 4C1NK 5BPNA 3MN5A 4J8FA 4JHDB 5AQPA 4M63C 3GOIA 3VEXA 4BQLA 2P9IA 2YX6A 3I33A 4BRMA 4DQ8A 1HKGA 3P39A 4PL8A 3HZ6A 2QTDA 2FSNA 4FWSA 4JKGA 1MDUB 4OPAA 4DCHA 4WQ5A 3O9QA 5AQRA 3DXMB 4PKIA 4PKHA 4BR5A 1OKJA 5C0YA 2NRVA 4H0OA 5AQLA 3C7NB 5AFUA 3CCQN 5AZIA 3AARA 3MX5A 1K8KB 1QQOA 2JWKA 3SMSA 3A5OC 3RSEB 4BG9A 4CZMA 2WFBA 3CCVN 1VQ7N 3L4IA 2I7PA 4NB4A 3QFUA 5JLHA 1W97L 2D1KA 5GINA 2BH1A 1BDGA 3QMLA 3ZX0A 2IVNA 5M1PA 1E4GT 1YVNA 4DB3A 3A5NC 4A61A 1YJ9N 2ZJQL 2J4RA 1M90O 2YCHA 3ATVA 3CJ1A 1H1VA 4ILGB 4BRNA 4KH6A 4U67L 4CBXA 2FSKA 2YJFA 3O4WA 3GL1A 1EO1A 1D4XA 3VF2A 1WUAA 2ASOA 1P8ZA 3CJ7A 3D2FB 1JCFA 3CHWA 4CZKA 3MN6A 2ZJPL 1VQ5N 4IOAL 3M1FA 5AQOA 2VYPA 5BRHA 2IIRA 4ISGA 1ZXOA 4XH5A 1S3XA 4AM7A 3QDKA 2YJEA 5EX5A 2P9KA 4K43A 3O9TA 5BREA 3FZLA 3TTDA 4B1XB 1QHAA 3MX2A 1NLVA 1YI2N 1TYQA 2CH6A 3R1XA 3KHYA 3UKRA 2QWQA 3R9PA 5KPZA 2E2QA 5JICA 4AM6A 5M1QA 5LY3A 1QZ5A 4JK9A 4BRGA 3R6MA 4IOXA 1NGGA 2D4WA 3L0QA 3S41A 3VPZA 4WFAL 5KQDA 5AQIA 1GLEG 2A42A 2P9SA 1HKCA 3IKMA 5LJWA 3JXUA 1TUUA 4JK8A 3GG4A 3B8AX 5AQGA 3CC4N 1VQ6N 3RVCA 3DLLL 3ID8A 4BRFA 3TTFA 1YXQA 1Y64A 2NLXA 3E1YA 2Q36A 4JKEA 5GAEP 4JKFA 4WFNL 3CCRN 4OPHA 2NRTA 5M1NA 2E2OA 3TSQA 1P90A 4FWKA 4NO7A 4IZ9A 3MN7A 2AA4A 4BR0A 3MK6A 2QEXN 4UY8O 2IVPA 4BR2A 4H5NA 4XH4A 4H5VA 3LM2A 1NGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B1Z A;  1XQS C;  3IFR A;  2NRH A;  3WXL A;  3WT0 A;  3EKS A;  3WEE A;  3P4I A;  2KHO A;  4BRO A;  4E1J A;  3QBX A;  1NBW A;  4JD2 A;  3GE1 A;  2QWM A;  3ULE A;  4M7Y A;  3VER A;  1NGJ A;  3VF6 A;  1NGI A;  4I6M B;  3IDH A;  5F1X A;  5AZJ B;  5BR9 A;  2V51 B;  1TUY A;  3LDN A;  1NGF A;  2E20 A;  2OAN A;  4K25 A;  2P9I B;  4QS8 A;  3VGL A;  3R8E A;  2FLO A;  1E4F T;  3AAQ A;  4A2A A;  3BEX A;  3O08 A;  4MLH A;  1ATS A;  5F2R A;  1C0G A;  5KPR A;  3CI5 A;  4CJ7 A;  5AZI B;  2CH5 A;  2FSJ A;  3IUC A;  3HSC A;  3VEO A;  2Q31 A;  5FPN A;  5AQN A;  3WQU A;  3M6G A;  4M7X A;  3L6Q A;  1RGI A;  2WUS A;  3O5B A;  3MCP A;  3VOV A;  1GLJ O;  2GWK A;  4A2B A;  4K41 A;  3VES A;  5AQT A;  5I9E B;  4DHY A;  3QBW A;  4XEI A;  4YDU C;  5BPL A;  3JS6 A;  4FOI A;  1DKG D;  4WQ4 A;  2A3Z A;  4H0X B;  4BR4 A;  1Z6R A;  1ATN A;  5AQF A;  5FPD A;  3ENH A;  1LOT B;  3ZEU B;  2I7N A;  5FPE A;  4FSV A;  3I8B A;  4O5F A;  5BN8 A;  1R59 O;  5AQJ A;  2ITM A;  3KVG A;  4FWL A;  2P9K B;  1RFQ A;  4CZF A;  4BG8 A;  1J6Z A;  2ASM A;  3LDL A;  4XH1 A;  1KAZ A;  1TYQ B;  3UKR B;  4B1U B;  1Q18 A;  2CGJ A;  4PL7 A;  5ADX H;  1HX1 A;  2P9P A;  1HPM A;  3SLC A;  4MO4 A;  1CZA N;  2W40 A;  3LDP A;  4RTF D;  1NWK A;  5E84 A;  3VF4 A;  1ATR A;  1GLD G;  1HLU A;  2P9S B;  2ASP A;  2IVO A;  4RWT A;  1HUX A;  2HF4 A;  4EIA A;  2A5X A;  4FPB A;  2ZWH A;  2V7Y A;  4BRK A;  4BRA A;  4WYB A;  1ZBS A;  1X3M A;  3J8A A;  5KQ8 A;  5BPM A;  2F9T A;  2P9U A;  4H5T A;  2GEL A;  1SQK A;  3BF3 A;  3DJC A;  3VGK A;  3WXK A;  4ISE A;  1YUW A;  3AAP A;  4H5W A;  4BVP A;  3W0L A;  4BC2 A;  2BTF A;  2A41 A;  2GEM A;  3O1B A;  2D0P A;  3WEE B;  4H0T B;  3U4L A;  1T6D A;  4CZJ A;  4CBW A;  3VEY A;  3FR0 A;  3VEV A;  1BG3 A;  4JD2 B;  2F9W A;  3HBT A;  4IO8 A;  5AQW A;  3ULE B;  3GBT A;  4BRH A;  2QWP A;  4CZG A;  1BA1 A;  2Q0R A;  4JAX A;  4QS7 A;  4BRD A;  3TU5 A;  5AQY A;  1SZ2 A;  5AFU H;  4FOE A;  5AQU A;  4BRC A;  5AQQ A;  2GTD A;  3QFP A;  2VWB A;  4FWQ A;  3WQT A;  1XC3 A;  2E88 A;  3VEW A;  3HTV A;  2QWL A;  3HI0 A;  4WQ5 C;  3O1W A;  2NZT A;  4B1Y B;  2GUP A;  3BF1 A;  3DAW A;  1T6C A;  2QWO A;  3QB0 A;  2E2P A;  1KAY A;  1BUP A;  4FL9 A;  2Q2R A;  4FWR A;  3IMX A;  5BRD A;  3U9D A;  3O80 A;  2QWR A;  3WUH A;  3FE1 A;  1BOT O;  5LJV A;  1NGE A;  5BN9 A;  3ZX3 A;  3VGM A;  3G25 A;  2VCP A;  4BRI A;  2E1Y A;  2ZGY A;  4RCH A;  1JCG A;  4FO0 A;  4BR9 A;  3MN9 A;  3CQY A;  1S22 A;  2GWJ A;  3H1Q A;  3O6W A;  4CZH A;  4CI6 A;  3H1V X;  4EHT A;  4FWP A;  2PAV A;  3SMP A;  4EHU A;  3H6E A;  1GLF O;  2H3G X;  1EQY A;  2A6A A;  4FWN A;  5ADX A;  1U2V A;  5EXW A;  3WXJ A;  3EN9 A;  3EZW A;  1BWF O;  1BA0 A;  3FFK B;  3FZH A;  4H0V B;  4EFH A;  3H3O B;  4GNI A;  1QZ6 A;  4BGB A;  2ZGZ A;  1V4S A;  3EKU A;  3BUZ B;  1GLL O;  3CJA A;  3DXK A;  3CIP A;  4H5R A;  1U6Z A;  3CJC A;  4JN4 A;  3CER A;  1KAX A;  1X9J A;  4B1W B;  2EWS A;  4LC9 B;  3D2E A;  5AQS A;  4A62 A;  2A40 A;  3CQX A;  3U8X A;  4FPA A;  3W3D A;  3ENO A;  2P9L A;  5AQM A;  1KXP A;  4H03 B;  3A5M C;  4CD1 A;  5AZJ A;  1QQM A;  3UKU A;  4F9O A;  3U9Z A;  4H0Y B;  4CZL A;  4BC5 A;  4FWO A;  1QQN A;  4CD3 A;  3MDQ A;  3BP8 A;  3EL2 A;  2HMP A;  4MO5 A;  2YHX A;  5AQH A;  4K42 A;  4L3Q A;  4IJN A;  4BC3 A;  3A0I X;  4Z94 A;  1GLC G;  2HOE A;  5B8H A;  4HWI A;  2ZF5 O;  4FWM A;  2QWN A;  5AQK A;  5E26 A;  5AQZ A;  3ZET A;  2V7Z A;  2YHW A;  3FLC O;  2P9N A;  3F9M A;  3KZB A;  4H0P A;  4BRE A;  1T44 A;  1SAZ A;  2Q97 A;  5JLF A;  3H46 O;  4JHD A;  3FZF A;  4C23 A;  1HJO A;  5EOY A;  4MLE A;  1BO5 O;  3M3Z A;  4GY2 B;  3CJ9 A;  3ZEU A;  1IG8 A;  2QXL A;  1NGD A;  1MWM A;  3DXM A;  3H45 C;  3SK3 A;  2HF3 A;  4PKG A;  3C7N A;  3HM8 A;  1G99 A;  1K8K A;  2E8A A;  3OHR A;  3QIC A;  3RSE A;  1JCE A;  3D7E O;  4KBO A;  1Z05 A;  1DEJ A;  4CZI A;  2CGL A;  4BRQ A;  4WQ4 C;  2W41 A;  4HTL A;  5TKY A;  4YDU A;  3O8M A;  4JNE A;  2QM1 A;  3FGU A;  4QS9 A;  2FXU A;  5ELZ A;  3WXI A;  4BRL A;  1LCU A;  5AQX A;  3UB5 A;  5FPM A;  3AY9 A;  3LM9 A;  3D2F A;  2FF6 A;  4BGA A;  1BU6 O;  3LDQ A;  2YI1 A;  5BRF A;  3A5L C;  1U2V B;  2V52 B;  3ATU A;  3CJB A;  4BC4 A;  2AP1 A;  1NM1 A;  4CBU A;  5EVZ A;  4Y0W A;  4BQZ A;  3DXK B;  2YHY A;  2CGK A;  2Q1N A;  4B1V A;  3VEN A;  2D0O A;  4ISF A;  1XUP O;  1X3N A;  2BUP A;  2PBD A;  1NMD A;  2UYT A;  5KPT A;  1NGH A;  2QW9 A;  3D2E B;  3DWL A;  3GDQ A;  1DGK N;  3LDO A;  3LL3 A;  1V4T A;  3A8Y A;  2P9L B;  2Q0U A;  3H3N O;  5JMV A;  5CE3 A;  1WOQ A;  2DPN A;  3ZX2 A;  3UKU B;  4IXC A;  2E1Z A;  3C0B A;  2P9P B;  5AQV A;  4BVO A;  1GLB G;  3CET A;  5EY4 A;  3SJH A;  3FZM A;  1HKB A;  1RDW X;  3FZK A;  4IWV A;  4BR7 A;  1GLA G;  3UE5 A;  3ZET B;  4B9Q A;  4BRP A;  1MWK A;  1ZC6 A;  5AR0 A;  4IJA A;  2P9N B;  4O8K A;  3VET A;  3MMV A;  1NGC A;  2P9U B;  4EAH D;  1YAG A;  4CZE A;  1IJJ A;  1ESV A;  1NGB A;  1MA9 B;  3EO3 A;  5F0X A;  4I6M A;  3TPQ A;  3VEZ A;  1C0F A;  2E2N A;  2FF3 B;  5BPN A;  3MN5 A;  4J8F A;  4JHD B;  5AQP A;  4M63 C;  3GOI A;  3VEX A;  4BQL A;  2P9I A;  3I33 A;  4BRM A;  4DQ8 A;  1HKG A;  4PL8 A;  3HZ6 A;  2FSN A;  4FWS A;  1MDU B;  4DCH A;  4WQ5 A;  5AQR A;  3DXM B;  4PKI A;  4PKH A;  4BR5 A;  1OKJ A;  4H0O A;  5AQL A;  3C7N B;  5AFU A;  5AZI A;  3AAR A;  4BG9 A;  1K8K B;  1QQO A;  3SMS A;  4CZM A;  3A5O C;  3RSE B;  3L4I A;  2I7P A;  4NB4 A;  3QFU A;  5JLH A;  2D1K A;  1BDG A;  3QML A;  3ZX0 A;  2IVN A;  1E4G T;  1YVN A;  4DB3 A;  3A5N C;  4A61 A;  2J4R A;  2YCH A;  3ATV A;  3CJ1 A;  1H1V A;  4BRN A;  4CBX A;  2FSK A;  2YJF A;  3O4W A;  3GL1 A;  1D4X A;  3VF2 A;  1WUA A;  2ASO A;  1P8Z A;  3CJ7 A;  3D2F B;  1JCF A;  3CHW A;  4CZK A;  3MN6 A;  3M1F A;  5AQO A;  2VYP A;  5BRH A;  2IIR A;  4ISG A;  1ZXO A;  4XH5 A;  1S3X A;  4AM7 A;  3QDK A;  2YJE A;  5EX5 A;  2P9K A;  4K43 A;  5BRE A;  3FZL A;  4B1X B;  1QHA A;  1NLV A;  1TYQ A;  2CH6 A;  3UKR A;  3KHY A;  5KPZ A;  2QWQ A;  3R9P A;  2E2Q A;  5JIC A;  4AM6 A;  5LY3 A;  1QZ5 A;  4BRG A;  3R6M A;  3S41 A;  1NGG A;  2D4W A;  3L0Q A;  3VPZ A;  5KQD A;  5AQI A;  1GLE G;  2A42 A;  2P9S A;  1HKC A;  5LJW A;  3JXU A;  1TUU A;  5AQG A;  3GG4 A;  3B8A X;  3ID8 A;  4BRF A;  1YXQ A;  1Y64 A;  2NLX A;  2Q36 A;  2E2O A;  4FWK A;  4NO7 A;  4IZ9 A;  3MN7 A;  2AA4 A;  4BR0 A;  3MK6 A;  2IVP A;  4BR2 A;  4H5N A;  4XH4 A;  4H5V A;  3LM2 A;  1NGA A; 
#chains in the Genus database with same CATH topology
 1NJX A;  3IFR A;  2NRH A;  3PIP L;  3P4I A;  3Q7B A;  1FK9 A;  3CM6 A;  2P5O A;  4Q0B A;  1NBW A;  4CK1 A;  2QWM A;  3ULE A;  1RT3 A;  4KO0 A;  5FLX O;  3QNO A;  1EWQ A;  1IKX A;  3VF6 A;  5AZJ B;  1YT3 A;  4M42 A;  1TUY A;  3SUQ A;  1NOZ A;  2E20 A;  2BE2 A;  4QS8 A;  3VGL A;  2FLO A;  5DM6 L;  4A2A A;  3G4S N;  3O08 A;  4CGI A;  3V9W A;  3KWI A;  4N41 A;  1RDA A;  3OJS A;  4JI5 K;  4J2E A;  3ZSW A;  5JS2 A;  3AO5 A;  1JLA A;  2KFZ A;  1HNX K;  3HSC A;  3VEO A;  4ID5 A;  4JRP A;  4KHP K;  5FPN A;  3WQU A;  1LV5 A;  4M7X A;  3V9Z A;  1RGI A;  3VOV A;  1VAZ A;  3VES A;  4CJ3 A;  4XEI A;  2O8E B;  1DT9 A;  3AO3 A;  5BPL A;  3JS6 A;  4FOI A;  4WQ4 A;  4H0X B;  2HVI A;  2GBZ A;  3F2K A;  5FPD A;  4CEF A;  3ZEU B;  4O8U A;  1N36 K;  5J2Q A;  1WSI A;  5BN8 A;  1R59 O;  4M41 A;  4CGF A;  4IEE A;  4AHT A;  3K9J A;  1KAZ A;  2HST A;  2P51 A;  1RIL A;  4B1U B;  3UKR B;  1Q18 A;  2CGJ A;  3VQ9 A;  4EP4 A;  4PL7 A;  4M3R A;  5ADX H;  2P9P A;  3SLC A;  3CFO A;  2OYQ A;  4WFB L;  3R3L A;  2W40 A;  4IG3 A;  4RTF D;  1CLQ A;  1J53 A;  4F2S A;  1WSG A;  4K8X A;  2ASP A;  3F73 A;  4H4O A;  4E19 A;  4FVM A;  3K5M A;  4WYB A;  1X3M A;  3J8A A;  4KI4 A;  2B6A A;  2NRZ A;  4H5T A;  4JK7 A;  2GEL A;  3SAH A;  3VA3 A;  3DJC A;  1ZBU A;  3THV A;  3VGK A;  3EE9 A;  1S6P A;  4ISE A;  3SQ2 A;  4H5W A;  3G10 A;  4BVP A;  3W0L A;  2IC3 A;  4RW4 A;  4PY5 A;  4KH5 A;  4JI4 K;  3ZT1 A;  3J7Y P;  3O1B A;  4DSF A;  1Q86 O;  3SZ2 A;  4FJI A;  1W2B M;  1J54 A;  1XWL A;  2D0P A;  2YNF A;  2F7T A;  1T6D A;  4CZJ A;  4WF9 L;  2G8W A;  3VEY A;  1SL1 A;  1O1W A;  5AQW A;  3ULE B;  3GBT A;  2QWP A;  4KRE A;  4QS7 A;  4EP5 A;  4OKE A;  2X78 A;  1BCM A;  3PV8 A;  2W42 A;  4E89 A;  4CJR A;  3KD1 E;  3I8D A;  4OPJ A;  1QS4 A;  4GV3 A;  5KRT A;  2QWL A;  3HI0 A;  3UIQ A;  4J2B A;  3T1H K;  4JKB A;  3O1W A;  4B1Y B;  4DFJ A;  3DAW A;  4CFA A;  5DM7 L;  5DMR A;  1RDD A;  3KLI A;  3PLA A;  3O9S A;  1TGO A;  1S9G A;  2B5J A;  3AGK A;  3SPZ A;  4FWR A;  3IMX A;  5GAG P;  1HR0 K;  4CHN A;  3WUH A;  3RMB A;  3FE1 A;  3KJV A;  4IDK A;  1LW2 A;  3LAL A;  2XY8 A;  3ZX3 A;  2JGU A;  3AVN A;  1C0T A;  1EX4 A;  3G25 A;  1A5X A;  2VCP A;  1VRU A;  2ZGY A;  4DTU A;  2RE2 A;  1JL2 A;  4N5S A;  4W5Q A;  4CEB A;  4FO0 A;  5K14 A;  3TTC A;  2QA4 N;  4CI6 A;  3U3G A;  2PAV A;  3CF5 L;  4EHU A;  4DV7 K;  1GLF O;  2H3G X;  4HCC A;  3TAF A;  3QEW A;  3EN9 A;  4J2A A;  3HXM A;  3EZW A;  1BA0 A;  3FZH A;  4H0V B;  3H3O B;  4GNI A;  1QZ6 A;  2ZGZ A;  2YNH A;  3WNF A;  4PHT X;  1GLL O;  3PO4 A;  4LSL A;  4XIU A;  4BY9 C;  2X74 A;  2NRR A;  1IBM K;  1KRP A;  3CJC A;  4K8Z A;  3RMA A;  1U48 A;  5GIO A;  3D2E A;  3M5R A;  4A62 A;  4CFB A;  3RMD A;  4LF5 K;  4KI6 A;  3PSF A;  5GIP A;  1KQS M;  1WSF A;  4IG0 A;  1JXB A;  4HVJ A;  3ALY A;  3ENO A;  2RN2 A;  3T1Y K;  3IRX A;  4H03 B;  1TKD A;  2XHB A;  3A5M C;  4M45 A;  3QER A;  4HUF A;  4CZL A;  2OPP A;  4FWO A;  1QQN A;  3MDQ A;  2HMP A;  4CFC A;  1N8R O;  2FC0 A;  1X1P A;  1Q82 O;  1JLC A;  5B8H A;  4YOX A;  4RW7 A;  4CVN E;  3FLC O;  4DFP A;  3KZB A;  4DS4 A;  1VQP N;  2KKZ A;  4BRE A;  4JKA A;  3O3F A;  5C24 A;  1VSL A;  2IGI A;  3C95 A;  3LDS A;  5JLF A;  3H46 O;  4BDZ A;  4BWM A;  1T8E A;  4PUO A;  4F8R A;  3EZ5 A;  3BZC A;  4PQU A;  3CJ9 A;  4CF8 A;  4E7K A;  3M8P A;  4B8C A;  2B4J A;  4CGD A;  1JXE A;  2G8I A;  1IG8 A;  5AJ3 K;  2DFF A;  4BAC A;  3SK3 A;  1NU0 A;  4PKG A;  3C6T A;  3D7E O;  4TSX A;  3DM2 A;  5M1F A;  2CGL A;  2JWL A;  3E9O A;  1N33 K;  4DV5 K;  3NGZ A;  3NVK A;  3O8M A;  4JNE A;  2FXU A;  1I39 A;  2E6L A;  1SKW A;  1VQO N;  4YOT A;  1K8A O;  3CC7 N;  3D2F A;  1BU6 O;  3CCU N;  4FZX C;  4IBN A;  1VSM A;  3SYZ A;  5BRF A;  4Z4G A;  1W7A A;  4JI3 K;  3CME N;  2Z1I A;  3KK1 A;  1U04 A;  4ID1 A;  4BC4 A;  1KSP A;  2AP1 A;  1N5Y A;  4B9L A;  1VK0 A;  2FBT A;  4LFA K;  4Y0W A;  1XMO K;  2CGK A;  3HPG A;  3Q7C A;  3VEN A;  4YY3 K;  1B92 A;  2BUP A;  4WCE L;  2BAN A;  4FM0 A;  1NGH A;  1M1K O;  3D2E B;  2X6S A;  3D6R A;  3OY9 A;  3A8Y A;  4JS5 A;  4FLW A;  3NMU A;  2Q0U A;  3ZX2 A;  1CXQ A;  1T05 A;  4IXC A;  2NRX A;  1YIJ N;  3K58 A;  4LFC K;  2KQ2 A;  3FZK A;  4IWV A;  4BR7 A;  4ZTJ A;  3UE5 A;  3DOL A;  4BRP A;  1K6Y A;  1MWK A;  4GMJ B;  3J80 O;  3VET A;  1IJJ A;  3CCE N;  4I6M A;  3TPQ A;  2UXC K;  4A5B A;  4C1N K;  2FF3 B;  3VQ7 A;  4J8F A;  4FXD A;  3V6D A;  4DR2 K;  2F4V K;  3I33 A;  4BRM A;  3HZ6 A;  2QTD A;  3V81 A;  3KTQ A;  4KPY A;  4FWS A;  5J2P A;  3E01 A;  4OPA A;  4DCH A;  4WQ5 A;  3O9Q A;  2R7Y A;  2HHX A;  4PKI A;  4BR5 A;  3V1O A;  3TAB A;  1RBT A;  1T7P A;  3ZT4 A;  2NRV A;  4H0O A;  4C8O A;  4NB4 A;  4WE1 A;  3NDK A;  2JLE A;  4O5B A;  5JLH A;  5GIN A;  2IVN A;  4C8L A;  4C8K A;  1E4G T;  3QEI A;  4DB3 A;  4LF8 K;  2J4R A;  4DUY K;  4U67 L;  4CBX A;  4CIF A;  5LL6 Z;  1EO1 A;  2UU9 K;  1CXU A;  4CEQ A;  3CJ7 A;  3D2F B;  1VQ5 N;  4CZK A;  3HP9 A;  1ZXO A;  1NK6 A;  3DRS A;  5FRN A;  5EX5 A;  2P9K A;  1S1X A;  5HRS A;  3M8S A;  4RW9 A;  4LD0 A;  3R1X A;  4R5P A;  5M1Q A;  1XNR K;  1C0M A;  1QZ5 A;  4DU4 A;  3C94 A;  4IOX A;  3DLE A;  3S41 A;  3VPZ A;  4WFA L;  3K57 A;  4I9L A;  5KQD A;  5AQI A;  1D5A A;  1EWR A;  2P9S A;  3CC4 N;  1UWB A;  1GOC A;  3ID8 A;  3DYA A;  4BRF A;  4KHN A;  2FBV A;  3E1Y A;  1NK5 A;  4JKF A;  4KB0 A;  3I0R A;  4JI8 K;  1XI1 A;  1WLJ A;  1S1W A;  3LWM A;  4OGC A;  3ZSO A;  3MK6 A;  2IVP A;  4BR2 A;  4H5N A;  4H5V A;  3AVL A;  1XQS C;  3WT0 A;  2DY4 A;  3EKS A;  3DRP A;  2Z1G A;  1WNS A;  4FW1 A;  5H1S Q;  4E1J A;  4M3W A;  4CJ5 A;  4FLT A;  3VER A;  1OH8 A;  2WOM A;  4I6M B;  3IDH A;  5BR9 A;  2VGN A;  1FW6 A;  3LDN A;  3F5T A;  3MXJ A;  2QKK A;  3CD6 N;  3R8E A;  4H4M A;  1E4F T;  1LAW A;  3ZYY X;  4AHU A;  4MLH A;  3QEP A;  1C0G A;  3CI5 A;  3I56 N;  4DQR A;  5MLC Q;  3QES A;  3BGR A;  1ASU A;  3SV3 A;  4DR4 K;  4DR1 K;  2Q31 A;  4BE0 A;  4YOR A;  1XHX A;  4DSK A;  1S1T A;  2ZD1 A;  1ASW A;  2GWK A;  4K41 A;  3P38 A;  3VQQ A;  4BR4 A;  2A1S A;  4YNQ A;  3OS0 A;  3ENH A;  1C6V A;  4N47 A;  2PZS A;  4NYF A;  2F96 A;  3LAK A;  1TK5 A;  4KB1 A;  3L4Q A;  3I8B A;  1NK4 A;  2RHK A;  3IAY A;  1RTI A;  4IFV A;  3OYL A;  2P9K B;  4CZF A;  1J6Z A;  2ASM A;  3CQ8 A;  5FDL A;  3QNN A;  3G0Z A;  5SWM A;  3LZI A;  3ZSY A;  1HPM A;  1CZA N;  4CK2 A;  3QIO A;  4CIE A;  3LDP A;  1SV5 A;  1NWK A;  4CFD A;  3S3M A;  1HLU A;  2P9S B;  2OCE A;  4RWT A;  4DKW A;  4EIA A;  2ZWH A;  3KLH A;  2WTU A;  3CPE A;  3K5O A;  4BRK A;  2VG7 A;  2QKB A;  1EKE A;  5KQ8 A;  3MAQ A;  3K9K A;  4IKF A;  3BF3 A;  4CCH A;  4FJX A;  3K2P A;  4CHO A;  4BC2 A;  4QAG A;  2BTF A;  3P31 A;  1S6Q A;  3P83 D;  4UQG A;  4FJ9 A;  5LMN K;  3BDP A;  3U4L A;  4JYA K;  2HW3 A;  2D0C A;  4M3U A;  3VEV A;  4H8K A;  1BG3 A;  3G71 N;  2F9W A;  3HBT A;  4IO8 A;  4CZG A;  3O9U A;  3KK2 A;  4BRD A;  4FJK A;  4A5A A;  3DOK A;  3PIO L;  4BRC A;  3OS1 A;  2Z1J A;  4FWQ A;  2G8U A;  1HQE A;  1XC3 A;  2ITG A;  3NF8 A;  2HMI A;  4LFB K;  1BI4 A;  1J5O A;  1VSH A;  2ETJ A;  4GVM A;  3D45 A;  5CR4 A;  1YJW N;  3RRG A;  1TKZ A;  2NZT A;  4RG8 A;  2GUP A;  1T6C A;  4AF1 A;  2HBL A;  2QWO A;  3ZSZ A;  3CFP A;  1OH7 A;  3L3U A;  1KAY A;  2WBN A;  4FL9 A;  2Q2R A;  4JKD A;  1Q81 O;  1KD1 O;  2PYJ A;  1BCO A;  4G9Z A;  3DLG A;  4B9S A;  1NGE A;  1TK8 A;  3TAE A;  4C1N I;  5HRO A;  4RCH A;  4N56 A;  4E7H A;  1J5E K;  1JCG A;  2NRW A;  3OBY A;  1WSJ A;  4OLA A;  3H1V X;  4EHT A;  3SMP A;  4FJ5 A;  2ZM6 K;  1HQU A;  3HRG A;  4F2R A;  3SV4 A;  1RTD A;  3WXJ A;  1YHQ N;  2RKI A;  4KHQ A;  1BWF O;  3K0S A;  3FFK B;  4YHH K;  4BGB A;  1NK9 A;  4M3Z A;  4GV9 A;  3K5L A;  1V4S A;  1DTT A;  3EKU A;  4DTJ A;  5GAD P;  3CJA A;  4AHV A;  2BGG A;  4RW6 A;  3CIP A;  3AA4 A;  3KK7 A;  1KAX A;  1RBV A;  4CJF A;  3RR7 A;  4LC9 B;  1VQ4 N;  2XO7 A;  5AQS A;  3RR8 A;  1VHX A;  3CQX A;  3N4Q A;  3ID6 A;  3W3D A;  4LF4 K;  5AQM A;  1WSH A;  4CGH A;  3OYI A;  5KGX A;  1SUQ A;  4F9O A;  1VQK N;  4U7B A;  1S72 N;  4BC5 A;  3NF7 A;  4CD3 A;  3S3N A;  1RBS A;  2E6M A;  1DLO A;  2HOE A;  1VRT A;  4HWI A;  5D3G A;  5C42 A;  5AQK A;  3ZET A;  3LAM A;  5E26 A;  3NF9 A;  1L3S A;  4OPK A;  4B9U A;  3F9M A;  4JLH A;  1KVA A;  1BIS A;  1CZB A;  1JLB A;  4JHD A;  4CF2 A;  1YJN N;  1HJO A;  3NH2 A;  4FJL A;  3KIO A;  1BO5 O;  3M3Z A;  4GY2 B;  4YFU A;  1VQN N;  4BWJ A;  3SJJ A;  3TAR A;  1TKT A;  4IFE A;  3H45 C;  3V9X A;  2HF3 A;  3HST B;  3HM8 A;  1WBD A;  1G99 A;  4CHP A;  2E8A A;  3AVG A;  2F8S A;  4GKK K;  1JCE A;  2NNW A;  4JI2 K;  1VSD A;  1F21 A;  4DTR A;  4ELU A;  2VG5 A;  4DSI A;  1DEJ A;  4CZI A;  5J2M A;  4BRQ A;  5EU7 A;  4WQ4 C;  4KV8 A;  4YDU A;  4DQP A;  2QM1 A;  4QS9 A;  3WXI A;  4BRL A;  1LCU A;  3ZSR A;  3OYE A;  3UB5 A;  3TAN A;  3AO2 A;  4CER A;  3AY9 A;  2HND A;  4BGA A;  1EXQ A;  4FM1 A;  4LSN A;  2KW4 A;  3ATU A;  1L3U A;  3QLH A;  1SS6 A;  4B3R K;  4CBU A;  4CHZ A;  3F9K A;  1QSS A;  3T7Z A;  5C25 A;  2HBK A;  3J7Z O;  4B1V A;  2O8B A;  3OYA A;  3A2F A;  5TKW A;  4CEC A;  1NMD A;  5M1K A;  4CJQ A;  3B6O A;  1EET A;  3VQ8 A;  4OX9 K;  3U6F A;  4JV5 K;  3ZSQ A;  5CE3 A;  4KHS A;  4Z0U A;  4DQI A;  4DFM A;  1LWE A;  1C1A A;  4DF8 A;  3K59 A;  4GKJ K;  1W0H A;  2P9P B;  3T69 A;  4BVO A;  4FCY A;  2XRI A;  1KFS A;  1RDW X;  4B9V A;  5JS1 A;  1IH7 A;  4CF1 A;  3HO1 A;  3DI6 A;  1BIU A;  1GLA G;  3ZET B;  4B9Q A;  4B3S K;  4E1N A;  3BZK A;  1RDU A;  1NGC A;  3KD5 E;  4IDH A;  5JVG L;  1WAF A;  4Z4I A;  1ESV A;  1NGB A;  3EO3 A;  5F0X A;  3ISN C;  4AHC A;  3MEG A;  4O44 A;  1ITG A;  4JHD B;  4W5T A;  1Q9X A;  4M63 C;  3GOI A;  3VEX A;  2DFE A;  2P9I A;  4ZTF A;  4DQ8 A;  3P39 A;  3SCX A;  1JLE A;  2OPS A;  2UUC K;  2FSN A;  4DSJ A;  4JKG A;  1N34 K;  3T19 A;  3MXI A;  1QSY A;  1OKJ A;  3QIP A;  3CCQ N;  5AZI A;  3I0S A;  1QQO A;  5I3U A;  3SMS A;  3A5O C;  3CCV N;  2WFB A;  2Z1H A;  1VQ7 N;  3L4I A;  2G8H A;  2OZM A;  4LF6 K;  4DSE A;  3QFU A;  3WNG A;  1W97 L;  1RTJ A;  3QML A;  1TL1 A;  5M1P A;  1YVN A;  1VSF A;  1BHL A;  1YJ9 N;  4AH9 A;  1KLN A;  4FZY A;  2YNG A;  4DS5 A;  3P1G A;  2YCH A;  3CJ1 A;  1H1V A;  3CYM A;  2GV9 A;  4DUZ K;  5KRS A;  3VF2 A;  3KLF A;  2ASO A;  1JCF A;  4IOA L;  2KZZ A;  3MN6 A;  5HRP A;  5AQO A;  3J7A P;  1S3X A;  2HNZ A;  3QDK A;  2YJE A;  4K43 A;  2VWJ A;  3TTD A;  4B1X B;  3NBP A;  3RRH A;  2E5L K;  3HJF A;  1S9E A;  3OYC A;  3PUF A;  3CG7 A;  2O8D A;  2QWQ A;  4J2D A;  2O8B B;  4QOZ B;  3V1Q A;  3L0Q A;  2D4W A;  3ZT2 A;  3RMC A;  3QO9 A;  4HUG A;  4FLV A;  4CEA A;  3L8B A;  3L2R A;  3IKM A;  5AQG A;  3GG4 A;  3DRR A;  3JYT A;  4WFN L;  3MEE A;  4OKK A;  4OPH A;  3TSQ A;  4O55 A;  4FWK A;  4IZ9 A;  4O4G A;  2AA4 A;  4M3X A;  4XH4 A;  3H08 A;  5CY4 A;  4B1Z A;  4CIG A;  3PX6 A;  2PY5 A;  4DWI A;  3WXL A;  3ZSV A;  2HBM A;  3L2Q A;  3PO5 A;  2F8T A;  3QBX A;  3TAQ A;  4FJJ A;  3VQ6 A;  3L2V A;  2VQE K;  4M7Y A;  2KFN A;  4DV1 K;  3CCL N;  1NGJ A;  4OVL A;  3AVM A;  5BR8 K;  3ITH A;  3NGI A;  2OAN A;  4YOV A;  5C10 A;  2P9I B;  1YTU A;  5LMU K;  1D8Y A;  3AAQ A;  3BEX A;  4KTQ A;  4JKG B;  3O4N A;  1ATS A;  4CJ4 A;  3AVC A;  4CW7 B;  2G8V A;  5C2D A;  1NJI O;  4B9M A;  1U4B A;  5AZI B;  4F4K A;  3NFA A;  2CH5 A;  2FSJ A;  2UXB K;  1NG9 A;  5A2Q O;  1TAQ A;  4Z4C A;  5J1E A;  2WUS A;  1CZ9 A;  3NGY A;  3MCP A;  3O5B A;  1GLJ O;  1X9M A;  3P5J A;  4A2B A;  1L3T A;  5I9E B;  4DHY A;  3QBW A;  5GAH P;  1DKG D;  2A3Z A;  1GOA A;  1Z6R A;  1ATN A;  3CXC M;  1LOT B;  4JKC A;  4KHU A;  2I7N A;  3NCI A;  1QTM A;  5FPE A;  4O5F A;  3T1A A;  3THX A;  5AQJ A;  2ITM A;  3KVG A;  1RFQ A;  3TWH A;  1NJW A;  3IG1 A;  3AVH A;  3NHG A;  1OVQ A;  1YIT N;  2O8D B;  4CEZ A;  3DLB A;  5J2N A;  3VQD A;  4LF9 K;  3AO1 A;  3VF4 A;  3SAG A;  2IVO A;  2HF4 A;  4OGE A;  3E9L A;  1Z25 A;  3G6E N;  2IOC A;  5FRO A;  3EE8 A;  2NUB A;  2P9U A;  3NAE A;  5C2F A;  1SQK A;  4IOC L;  3HK2 A;  3ZLJ A;  2KZM A;  4CJS A;  3HP6 A;  2A41 A;  5HOO A;  1JLG A;  3NH1 A;  4H0T B;  4HHT A;  1W9H A;  3AVK A;  2VGM A;  4CK3 A;  3FR0 A;  2ATQ A;  2QI2 A;  3TSU A;  4BRH A;  3EYZ A;  3THW A;  1BIZ A;  3THY A;  1K73 O;  1BA1 A;  4CJL A;  4B3O A;  3TU5 A;  5AQY A;  1ZBI A;  5AFU H;  3CCJ N;  4FOE A;  3SNN A;  5AQU A;  5AQQ A;  4C8N A;  2GTD A;  4Y1C A;  5E41 A;  2VWB A;  4OLB A;  5M1O A;  2E88 A;  3HTV A;  4NLB A;  3HPH A;  5KGW A;  4WQ5 C;  3HL8 A;  1BQM A;  4B9T A;  1IKV A;  4MDA A;  3SPY A;  1A5W A;  2O8F A;  4CGJ A;  4LH4 A;  3N4P A;  1RDB A;  4NYN A;  3O80 A;  2QWR A;  5LJV A;  1S5J A;  2GUI A;  2YKM A;  1T03 A;  1X9S A;  3NF6 A;  3VGM A;  5FRM A;  4BR9 A;  3QEV A;  3CQY A;  1S22 A;  2XY5 A;  3H1Q A;  2A1R A;  3THX B;  2ZJR L;  3H6E A;  3HM9 A;  1EQY A;  2A6A A;  4DU3 A;  4FWN A;  1U2V A;  5EXW A;  4ZHR A;  4IO9 L;  4BE2 A;  3B6P A;  3KWG A;  2YV0 X;  4KTZ A;  1GOB A;  3DXK A;  1VSJ A;  4H5R A;  1U6Z A;  4JN4 A;  4CES A;  2EWS A;  4O0I A;  4E7J A;  4B9N A;  4M3Y A;  1WB9 A;  1HNV A;  1KVC A;  4ELT A;  4NXM K;  2A40 A;  4FJN A;  1FXX A;  3AGR A;  4FPA A;  1BQN A;  3AA3 A;  4I2P A;  2P9L A;  1KXP A;  4AHS A;  4YOU A;  4CD1 A;  5AZJ A;  1QQM A;  3PX4 A;  2EHG A;  3U9Z A;  3E66 A;  2QK9 A;  1RBR A;  4MO5 A;  1BGX T;  4JKH A;  1OH5 A;  4CJT A;  4IJN A;  1NJZ A;  3SBG A;  3NH0 A;  3A0I X;  1GLC G;  4YOY A;  3WNE A;  3CM5 A;  3OYH A;  3PX0 A;  1HPZ A;  1HYZ A;  4A57 A;  2ZF5 O;  4BE1 A;  1RDC A;  3THY B;  4FWM A;  2QWN A;  5AQZ A;  2D5R A;  2YHW A;  4H0P A;  1XNQ K;  3S3O A;  1WAJ A;  3CCS N;  1JLF A;  3FFI A;  3OBW A;  2HHW A;  2Q97 A;  3FZF A;  4C23 A;  4JI1 K;  5CZ2 A;  4MLE A;  1U45 A;  2PYL A;  4FK4 A;  1N6Q A;  4CF0 A;  4KHY A;  4V19 S;  1S1V A;  3ZEU A;  1ILY A;  1NGD A;  1NNE A;  1MWM A;  2O8F B;  3RTV A;  3HOS A;  3C7N A;  4DLE A;  3QIC A;  4ILH A;  4CJW A;  3C65 A;  4L8R B;  3L2U A;  4GW6 A;  1Z05 A;  1VQM N;  1RT4 A;  4DTN A;  2O4I A;  1VSK A;  4B3T K;  2KTQ A;  3DLH A;  1O13 A;  4HTL A;  2HVH A;  5TKY A;  3FGU A;  3C6U A;  5FPM A;  1TKX A;  3LM9 A;  2FF6 A;  3LDQ A;  3SQ0 A;  3TSP A;  4CJK A;  3A5L C;  1U2V B;  1VSI A;  2V52 B;  3CJB A;  2HHH K;  3T3F A;  1NM1 A;  1YVU A;  2XY6 A;  2HHT A;  3SBT A;  4BQZ A;  3LPU A;  3DXK B;  3OYD A;  4E7I A;  5C12 A;  2D0O A;  1B9D A;  1OVY A;  1X3N A;  2PBD A;  3KLG A;  1UOC A;  5KPT A;  2QW9 A;  1RT1 A;  3NVM A;  2VG6 A;  3AVI A;  4DR7 K;  1DGK N;  1EP4 A;  4O0J A;  2P9L B;  1UA1 A;  4DTS A;  2HNY A;  5JMV A;  2ZQB A;  1NK8 A;  3J81 O;  2FBX A;  2E4L A;  4I7F A;  2E1Z A;  1GLB G;  3CET A;  5EY4 A;  4K0K K;  4F3T A;  3FZM A;  2OZS A;  3U3Y A;  3SAF A;  3LZJ A;  2OTL N;  4IFY A;  4IJA A;  3MMV A;  4DLG A;  4EAH D;  4OO1 J;  3L2W A;  1MA9 B;  1REV A;  1HJR A;  2E2N A;  5BPN A;  3QIN A;  4LH5 A;  3MN5 A;  5AQP A;  3HT3 A;  4EZ6 A;  1BL3 A;  3TAP A;  4W5N A;  4PL8 A;  3KK3 A;  3S9H A;  1NOY A;  4DV6 K;  3M8Q A;  3VQP A;  1Z26 A;  4OKJ A;  3PSI A;  4NXN K;  5AQL A;  3C7N B;  5AFU A;  1C1C A;  1C0U A;  2RPI A;  1C1B A;  2DTU A;  3AAR A;  3MX5 A;  4JI6 K;  2JWK A;  4BG9 A;  4CZM A;  1KTQ A;  3ZT3 A;  1HNI A;  1ASV A;  3IS9 A;  4FK0 A;  4FLZ A;  4DR6 K;  4QCL A;  4N76 A;  5DK5 A;  3A5N C;  4DTM A;  2ZJQ L;  3TAM A;  4DTO A;  1RTH A;  4DQS A;  4ILG B;  1BI4 B;  1HRH A;  3AVA A;  4KH6 A;  1Y97 A;  4HTU A;  2YJF A;  2XY7 A;  3GL1 A;  1LW0 A;  1P8Z A;  4EZ9 A;  3CHW A;  2ZJP L;  3BY5 A;  2IIR A;  4ISG A;  4XH5 A;  2W6K A;  4OJR A;  1RBU A;  2HHQ A;  1QHA A;  3MX2 A;  3V4I A;  1YI2 N;  1TYQ A;  2CH6 A;  3KHY A;  3OYF A;  1SKR A;  2I5J A;  5LY3 A;  4JK9 A;  5IT9 O;  1NMN A;  3ZT0 A;  1HMV A;  1YTA A;  1HYS A;  1HKC A;  2LSN A;  5LJW A;  3JXU A;  4JK8 A;  4FLY A;  1ZYQ A;  3B8A X;  1J9A A;  3RVC A;  3JSM A;  3TTF A;  1HNZ K;  4DR3 K;  1HNW K;  4JKE A;  2Q36 A;  5GAE P;  5M1N A;  2E2O A;  3OYG A;  3OTO K;  1Q8I A;  4KRF A;  4LF7 K;  3MN7 A;  4BR0 A;  4FJM A;  1IO2 A;  1I3A A;  4X65 K;  1FKO A;  4UY8 O;  3OYN A;  3LM2 A;  1NGA A;  1G15 A;  3MCA B;  3VN5 A;  1RNH A;  4I2Q A;  2KLA A;  1B9F A;  3WEE A;  1JKH A;  3OYJ A;  2KHO A;  4BRO A;  4DU1 A;  3V9U A;  4Z4F A;  4JD2 A;  3GE1 A;  1JLQ A;  3CCM N;  3LP0 A;  1U47 A;  1NGI A;  4FJH A;  3V1R A;  5F1X A;  3AA2 A;  2V51 B;  1D9F A;  4W5R A;  3CMA N;  1NGF A;  4K25 A;  4B8A B;  4FJ7 A;  4FVU A;  3AV9 A;  5I42 A;  5HL7 L;  2Y1J A;  1D9D A;  3VA0 A;  1LWC A;  1XC9 A;  1RT7 A;  5F2R A;  5KPR A;  1JL1 A;  3M8R A;  1IBL K;  4FZZ A;  1IBK K;  4CJ7 A;  1R0A A;  4CF9 A;  3I55 N;  3IUC A;  1QHT A;  3AVJ A;  5AQN A;  3M6G A;  1IG9 A;  4DSL A;  1YF5 L;  3L6Q A;  2O8C A;  3OW2 M;  1K9M O;  5AQT A;  3QET A;  4YDU C;  1L5U A;  5AQF A;  4DV2 K;  2YHB A;  3SQ1 A;  4Z4E A;  3SQ4 A;  4HCB A;  4FSV A;  2OPR A;  4BDY A;  3AA5 X;  3NE6 A;  1RT6 A;  3OYK A;  4FWL A;  4DF4 A;  4AIL C;  4BG8 A;  2OTJ N;  4XH1 A;  2YKN A;  1WSE A;  3LDL A;  1TYQ B;  1KCF A;  2UUA K;  2WON A;  1HX1 A;  4MO4 A;  1QVG M;  5HP1 A;  5E84 A;  1NK0 A;  1ATR A;  1GLD G;  4MDB A;  1IV0 A;  4X64 K;  4CHY A;  1HUX A;  3WXM B;  3DLR A;  4YOW A;  2A5X A;  1NJY A;  4FPB A;  3O4Q A;  4CJE A;  1QE1 A;  2V7Y A;  1SL0 A;  4BRA A;  1ZBS A;  3OVN A;  4CHQ A;  5BPM A;  2F9T A;  4DMN A;  3CC2 N;  3OA9 A;  5C15 A;  1FKP A;  3ENB A;  4KFB A;  3JAM O;  4IEI A;  3WXK A;  4FYD A;  1YUW A;  3AAP A;  1JJ2 M;  3MWP A;  3AVB A;  3ZCM A;  2GEM A;  2UUB K;  3WEE B;  1KVB A;  4CBW A;  4JD2 B;  5JVH L;  2G8F A;  2Q0R A;  4JAX A;  1TVR A;  4F3O A;  1SZ2 A;  3HVT A;  1KFD A;  4DTX A;  3PY8 A;  4Q5V A;  3QFP A;  4X66 K;  3HPO A;  1E3M A;  3WQT A;  3AO4 A;  3MEC A;  2BDP A;  4GV6 A;  3VEW A;  4B08 A;  4PA1 A;  3KLE A;  1XHZ A;  3HOT A;  3OYM A;  4W5O A;  1SKS A;  5CYQ A;  3BF1 A;  3CFR A;  3V9S A;  3L3V A;  1ZBF A;  3WNH A;  3VQ5 A;  1A5V A;  3QB0 A;  3DMJ A;  2E2P A;  1TV6 A;  2Y1I A;  1BUP A;  5BRD A;  2O8C B;  3U9D A;  3O3H A;  2OPQ A;  3VQE A;  4NLC A;  1BOT O;  3AVF A;  4KHW A;  5BN9 A;  3CPW M;  3K5N A;  4BRI A;  2E1Y A;  5SZT A;  3SUP A;  4MFB A;  3MN9 A;  4RW8 A;  2GWJ A;  3O6W A;  1T3V A;  4CZH A;  4A59 A;  3VTI A;  4JRQ A;  4FWP A;  3ULD A;  3O3G A;  3SUN A;  2VWK A;  5ADX A;  2D0B A;  2HHS A;  5HLF A;  4KAZ A;  4DV4 K;  4EFH A;  3BUZ B;  2WC9 A;  1Q9Y A;  4E0D A;  4CJP A;  2HB5 A;  3VQ4 A;  5CZ1 A;  4JI0 K;  1DTQ A;  4B1W B;  1X9J A;  3CER A;  4R79 A;  1FJG K;  3VQB A;  3O9R A;  4GVE A;  1RT2 A;  3U8X A;  3OJU A;  4AQY K;  2Q3S A;  4B3M K;  3ASM A;  1WBB A;  1OH6 A;  1UA0 A;  3UKU A;  3LP3 A;  4H0Y B;  4JEP A;  2QXF A;  4DG1 A;  1L3V A;  3BP8 A;  2VQF K;  3EL2 A;  2YHX A;  5AQH A;  4K42 A;  4CEO A;  4L3Q A;  4BC3 A;  4Z94 A;  2YNI A;  3TI0 A;  2V7Z A;  4FK2 A;  1TL3 A;  2P9N A;  1Q7Y O;  4E1M A;  1U49 A;  3LWL A;  1QSL A;  1T44 A;  1SAZ A;  3EY1 A;  3RWU A;  4FW2 A;  4KKO A;  4DTP A;  3VQC A;  1MU2 A;  3DLK A;  5EOY A;  4BDP A;  1VQL N;  1QVF M;  2IAJ A;  2AJQ A;  2QXL A;  5IWA K;  4DR5 K;  1X9W A;  3DXM A;  1VSE A;  4FJG A;  1NK7 A;  4Z4H A;  4AHR A;  3VTH A;  2W6L A;  3MED A;  1K8K A;  3OHR A;  3RSE A;  2IDO A;  4KBO A;  1ZBH A;  3E9P A;  4FLX A;  3KKS A;  3HVR A;  4MQ3 A;  2W41 A;  4E7L A;  1TAU A;  5ELZ A;  1I94 K;  1IKY A;  5AQX A;  4ELV A;  3VMF B;  1UAX A;  3MWT A;  4CJV A;  5CYM A;  2YI1 A;  4FJ8 A;  2FBY A;  4KH4 A;  4E3S A;  1VQ9 N;  2HHU A;  3LP2 A;  5HBM A;  1LAV A;  1KC8 O;  5EVZ A;  4PWD A;  2HHV A;  4ICL A;  4C8M A;  2YHY A;  2Q1N A;  1SL2 A;  4ISF A;  3LP1 A;  1HYV A;  1XUP O;  3D0P A;  4DQQ A;  1KLM A;  1LWF A;  2UYT A;  1WN7 A;  2X6N A;  4KTW A;  3DWL A;  4DV0 K;  4I9Q A;  3GDQ A;  2EX3 A;  3LDO A;  2DFH A;  3LL3 A;  1V4T A;  4HUE A;  3VQA A;  4X62 K;  3OYB A;  3H3N O;  1WOQ A;  2DPN A;  1TK0 A;  2GX9 A;  3UKU B;  2PFU A;  2OA8 A;  1QQC A;  3C0B A;  3EEQ A;  5AQV A;  2P1J A;  3SJH A;  1HKB A;  3C6H A;  1RCH A;  3C6A A;  1S1U A;  4CGG A;  5CHI A;  4G1Q A;  4JS4 A;  1ZC6 A;  5AR0 A;  2UXD K;  3MXM A;  2P9N B;  4O8K A;  4CJU A;  2HBJ A;  1VQ8 N;  2P9U B;  1YAG A;  4ILJ A;  4NCG A;  4CZE A;  3LAN A;  1IKW A;  3VEZ A;  1C0F A;  4BQL A;  2IS3 A;  2YX6 A;  4CE9 A;  3SUO A;  1HKG A;  1N32 K;  4NCA A;  1MDU B;  5AQR A;  3DXM B;  4PKH A;  5C0Y A;  3THW B;  4FM2 A;  1K8K B;  2P5G A;  3RSE B;  1NKB A;  2I7P A;  2D1K A;  2BH1 A;  5KI6 A;  1BDG A;  2O4G A;  3ZX0 A;  4A61 A;  1M90 O;  3ATV A;  3OS2 A;  2O8E A;  4BRN A;  3LPT A;  2FSK A;  3O4W A;  1XMQ K;  1NKC A;  4JI7 K;  1D4X A;  1WUA A;  3M1F A;  2VYP A;  5BRH A;  3KKR A;  5HRR A;  2G8K A;  1NKE A;  3ZSX A;  4AM7 A;  5T7B A;  3O9T A;  5BRE A;  3FZL A;  1NLV A;  3UKR A;  2ZE2 A;  4CEE A;  5KPZ A;  3R9P A;  2E2Q A;  5JIC A;  4AM6 A;  4FLU A;  4LY7 A;  4BRG A;  3R6M A;  1NGG A;  4DFK A;  4Y1D A;  3SI6 A;  2D0A A;  1GLE G;  2A42 A;  4NCB A;  4M3T A;  1RT5 A;  1TUU A;  1ZBL A;  1VQ6 N;  3DLL L;  1YXQ A;  4CED A;  3TR8 A;  1Y64 A;  2NLX A;  3CCR N;  3QEX A;  2YHA A;  3HYF A;  2NRT A;  1P90 A;  5HRN A;  4NO7 A;  5KTQ A;  2QEX N;  2RF2 A;  4DV3 K;  3TAG A; 
#chains in the Genus database with same CATH homology
 4B1Z A;  3MCA B;  1XQS C;  2KLA A;  3IFR A;  2NRH A;  3WXL A;  3WT0 A;  3EKS A;  3WEE A;  3PIP L;  3P4I A;  2HBM A;  3Q7B A;  2KHO A;  4BRO A;  5H1S Q;  4E1J A;  3QBX A;  1NBW A;  4JD2 A;  3GE1 A;  2QWM A;  3ULE A;  4M7Y A;  3VER A;  3CCL N;  3CCM N;  1NGJ A;  3VF6 A;  1NGI A;  4I6M B;  3IDH A;  5F1X A;  5AZJ B;  5BR9 A;  2V51 B;  2VGN A;  1TUY A;  3CMA N;  3LDN A;  1NGF A;  2E20 A;  2OAN A;  3F5T A;  4YOV A;  4K25 A;  5C10 A;  3CD6 N;  2P9I B;  4QS8 A;  3VGL A;  3R8E A;  2FLO A;  1E4F T;  4FVU A;  5DM6 L;  3ZYY X;  3AAQ A;  4A2A A;  3G4S N;  5HL7 L;  3BEX A;  3O08 A;  4MLH A;  4JKG B;  3KWI A;  1ATS A;  5F2R A;  1C0G A;  5KPR A;  3CI5 A;  3I56 N;  5C2D A;  1NJI O;  5MLC Q;  4CJ7 A;  5AZI B;  2CH5 A;  3I55 N;  2FSJ A;  3IUC A;  3HSC A;  3VEO A;  2Q31 A;  5FPN A;  5AQN A;  4YOR A;  3WQU A;  3M6G A;  4M7X A;  1YF5 L;  3L6Q A;  1RGI A;  2WUS A;  3O5B A;  3MCP A;  3OW2 M;  3VOV A;  1K9M O;  1GLJ O;  1VAZ A;  2GWK A;  4A2B A;  4K41 A;  3VES A;  5AQT A;  5I9E B;  3P38 A;  4DHY A;  3QBW A;  4XEI A;  1DT9 A;  4YDU C;  5BPL A;  3JS6 A;  4FOI A;  1DKG D;  4WQ4 A;  2A3Z A;  4H0X B;  4BR4 A;  5GAH P;  1Z6R A;  1ATN A;  3F2K A;  5AQF A;  5FPD A;  3ENH A;  3CXC M;  1LOT B;  4JKC A;  3ZEU B;  2I7N A;  4O8U A;  5FPE A;  4FSV A;  3L4Q A;  3I8B A;  4O5F A;  2RHK A;  5BN8 A;  1R59 O;  5AQJ A;  2ITM A;  3KVG A;  4FWL A;  2P9K B;  1RFQ A;  4CZF A;  4IEE A;  4BG8 A;  3K9J A;  2OTJ N;  1J6Z A;  2ASM A;  3LDL A;  4XH1 A;  1KAZ A;  2HST A;  1YIT N;  1TYQ B;  3UKR B;  4B1U B;  1Q18 A;  2CGJ A;  4PL7 A;  5ADX H;  1HX1 A;  2P9P A;  1HPM A;  3SLC A;  4MO4 A;  1CZA N;  4WFB L;  3R3L A;  2W40 A;  3LDP A;  4RTF D;  1QVG M;  1NWK A;  5E84 A;  3VF4 A;  1ATR A;  3SAG A;  1GLD G;  1HLU A;  2P9S B;  2ASP A;  2IVO A;  4MDB A;  4RWT A;  4DKW A;  1HUX A;  2HF4 A;  3WXM B;  4EIA A;  4YOW A;  2A5X A;  3E9L A;  3G6E N;  4FPB A;  2ZWH A;  2V7Y A;  3CPE A;  4BRK A;  4BRA A;  4WYB A;  1ZBS A;  3EE8 A;  1X3M A;  3J8A A;  5KQ8 A;  5BPM A;  2F9T A;  2NRZ A;  2P9U A;  3K9K A;  3CC2 N;  4H5T A;  3OA9 A;  4JK7 A;  2GEL A;  5C15 A;  1SQK A;  5C2F A;  3BF3 A;  3SAH A;  3ENB A;  4IOC L;  3DJC A;  4IEI A;  3VGK A;  3WXK A;  3EE9 A;  4ISE A;  1YUW A;  3AAP A;  4H5W A;  1JJ2 M;  4BVP A;  3W0L A;  3MWP A;  4BC2 A;  2BTF A;  4KH5 A;  3P31 A;  2A41 A;  2GEM A;  3O1B A;  1Q86 O;  5HOO A;  1W2B M;  2D0P A;  3WEE B;  4H0T B;  3U4L A;  2F7T A;  1T6D A;  4CZJ A;  4CBW A;  2VGM A;  3VEY A;  4WF9 L;  3FR0 A;  3VEV A;  1BG3 A;  3G71 N;  4JD2 B;  2F9W A;  3HBT A;  4IO8 A;  5AQW A;  3ULE B;  2QI2 A;  3TSU A;  3GBT A;  4BRH A;  2QWP A;  4CZG A;  3O9U A;  1BA1 A;  5JVH L;  1K73 O;  2Q0R A;  4JAX A;  4QS7 A;  4BRD A;  3TU5 A;  5AQY A;  1SZ2 A;  5AFU H;  4A5A A;  3CCJ N;  4FOE A;  3PIO L;  5AQU A;  4BRC A;  5AQQ A;  2GTD A;  3QFP A;  2VWB A;  4FWQ A;  3WQT A;  1XC3 A;  5M1O A;  2E88 A;  4GV3 A;  3VEW A;  3HTV A;  4GV6 A;  4NLB A;  2QWL A;  3HI0 A;  3HOT A;  4WQ5 C;  5CR4 A;  1YJW N;  4JKB A;  3O1W A;  4MDA A;  2NZT A;  4B1Y B;  2GUP A;  3BF1 A;  3DAW A;  5DM7 L;  1T6C A;  4AF1 A;  2HBL A;  2QWO A;  3QB0 A;  3PLA A;  3O9S A;  2E2P A;  1KAY A;  1BUP A;  2WBN A;  3N4P A;  4FL9 A;  3AGK A;  2Q2R A;  4JKD A;  4FWR A;  1Q81 O;  3IMX A;  5BRD A;  3U9D A;  3O80 A;  5GAG P;  1KD1 O;  2QWR A;  3WUH A;  4G9Z A;  3FE1 A;  1BOT O;  4NLC A;  5LJV A;  1NGE A;  5BN9 A;  3ZX3 A;  3CPW M;  3VGM A;  3G25 A;  2VCP A;  4BRI A;  2E1Y A;  2ZGY A;  4C1N I;  2RE2 A;  4RCH A;  1JCG A;  4FO0 A;  2NRW A;  3OBY A;  4BR9 A;  3MN9 A;  3CQY A;  1S22 A;  2GWJ A;  3H1Q A;  1T3V A;  3O6W A;  3TTC A;  4A59 A;  3H1V X;  3VTI A;  4CI6 A;  4CZH A;  4FWP A;  4EHT A;  2PAV A;  3SMP A;  2ZJR L;  4EHU A;  3CF5 L;  3H6E A;  1GLF O;  2H3G X;  1EQY A;  2A6A A;  3HRG A;  4FWN A;  5ADX A;  1U2V A;  5EXW A;  3WXJ A;  3EN9 A;  4IO9 L;  3EZW A;  1YHQ N;  1BWF O;  1BA0 A;  3FFK B;  3FZH A;  4H0V B;  4EFH A;  3H3O B;  4GNI A;  1QZ6 A;  3KWG A;  4BGB A;  2ZGZ A;  4GV9 A;  1V4S A;  4PHT X;  3EKU A;  3BUZ B;  1GLL O;  2WC9 A;  3CJA A;  5GAD P;  3DXK A;  4BY9 C;  2NRR A;  3CIP A;  4H5R A;  1U6Z A;  3KK7 A;  3CJC A;  4JN4 A;  1KAX A;  1X9J A;  3CER A;  4B1W B;  4R79 A;  2EWS A;  4LC9 B;  3O9R A;  1VQ4 N;  5GIO A;  3D2E A;  4GVE A;  3M5R A;  5AQS A;  4A62 A;  2A40 A;  3CQX A;  3AGR A;  3U8X A;  4FPA A;  3N4Q A;  3ID6 A;  5GIP A;  1KQS M;  3W3D A;  3ENO A;  2P9L A;  5AQM A;  1KXP A;  4H03 B;  3A5M C;  4YOU A;  4CD1 A;  2QA4 N;  5AZJ A;  1QQM A;  3UKU A;  4F9O A;  1VQK N;  3U9Z A;  4H0Y B;  4CZL A;  4U7B A;  3E66 A;  1S72 N;  4JEP A;  4BC5 A;  4FWO A;  1QQN A;  4CD3 A;  3MDQ A;  3BP8 A;  3EL2 A;  2HMP A;  1N8R O;  4MO5 A;  2YHX A;  5AQH A;  4K42 A;  4JKH A;  4L3Q A;  4IJN A;  3SBG A;  4BC3 A;  1Q82 O;  3A0I X;  4Z94 A;  1GLC G;  2HOE A;  4YOY A;  5B8H A;  4HWI A;  4YOX A;  4A57 A;  2ZF5 O;  4FWM A;  2QWN A;  5AQK A;  5E26 A;  5AQZ A;  3ZET A;  2V7Z A;  2YHW A;  3FLC O;  2P9N A;  3F9M A;  3KZB A;  1VQP N;  2KKZ A;  1Q7Y O;  4H0P A;  4BRE A;  4JKA A;  3CCS N;  1T44 A;  1SAZ A;  3OBW A;  2Q97 A;  5JLF A;  3H46 O;  4JHD A;  1YJN N;  3FZF A;  4C23 A;  1HJO A;  5EOY A;  1QVF M;  1VQL N;  4MLE A;  1BO5 O;  3M3Z A;  4GY2 B;  3CJ9 A;  1VQN N;  3ZEU A;  1ILY A;  1IG8 A;  2QXL A;  1NGD A;  1MWM A;  3DXM A;  4IFE A;  3H45 C;  3SK3 A;  3VTH A;  2HF3 A;  3HOS A;  4PKG A;  3C7N A;  3HM8 A;  1G99 A;  1K8K A;  2E8A A;  3OHR A;  3QIC A;  3RSE A;  4ILH A;  1JCE A;  2NNW A;  3D7E O;  3C65 A;  4KBO A;  3E9P A;  1Z05 A;  1VQM N;  1DEJ A;  4CZI A;  5M1F A;  2CGL A;  4BRQ A;  2JWL A;  3E9O A;  1O13 A;  4WQ4 C;  3NVK A;  2W41 A;  4HTL A;  5TKY A;  4YDU A;  3O8M A;  4JNE A;  2QM1 A;  3FGU A;  4QS9 A;  2FXU A;  5ELZ A;  3WXI A;  4BRL A;  1LCU A;  1VQO N;  5AQX A;  3UB5 A;  5FPM A;  4YOT A;  3AY9 A;  3LM9 A;  1K8A O;  3VMF B;  3CC7 N;  3D2F A;  2FF6 A;  4BGA A;  3MWT A;  1BU6 O;  3LDQ A;  3CCU N;  2YI1 A;  3TSP A;  5BRF A;  3A5L C;  1U2V B;  2V52 B;  4KH4 A;  3CME N;  3ATU A;  3CJB A;  1VQ9 N;  1SS6 A;  4BC4 A;  2AP1 A;  1NM1 A;  4CBU A;  1KC8 O;  5EVZ A;  4Y0W A;  3SBT A;  4BQZ A;  3DXK B;  3T7Z A;  2YHY A;  2CGK A;  2HBK A;  2Q1N A;  3J7Z O;  4B1V A;  3Q7C A;  3VEN A;  2D0O A;  4ISF A;  5TKW A;  5C12 A;  1XUP O;  1OVY A;  1X3N A;  2BUP A;  2PBD A;  4WCE L;  1NMD A;  2UYT A;  5KPT A;  1NGH A;  5M1K A;  2QW9 A;  3NVM A;  1M1K O;  3D2E B;  3DWL A;  3GDQ A;  3D6R A;  1DGK N;  3LDO A;  3LL3 A;  1V4T A;  3A8Y A;  2P9L B;  3NMU A;  2Q0U A;  3H3N O;  5JMV A;  5CE3 A;  1WOQ A;  2DPN A;  3ZX2 A;  2GX9 A;  3UKU B;  2PFU A;  4IXC A;  2E1Z A;  3C0B A;  2P9P B;  3T69 A;  5AQV A;  4BVO A;  1GLB G;  3CET A;  5EY4 A;  3SJH A;  2NRX A;  3FZM A;  1HKB A;  1YIJ N;  1RDW X;  3C6H A;  3C6A A;  3SAF A;  5CHI A;  3FZK A;  4IWV A;  4BR7 A;  2OTL N;  1GLA G;  3UE5 A;  3ZET B;  4B9Q A;  4BRP A;  1MWK A;  1ZC6 A;  5AR0 A;  4IJA A;  2P9N B;  4O8K A;  3VET A;  1VQ8 N;  2HBJ A;  1RDU A;  3MMV A;  1NGC A;  2P9U B;  4EAH D;  4OO1 J;  1YAG A;  4ILJ A;  4CZE A;  4IDH A;  5JVG L;  1IJJ A;  1ESV A;  1NGB A;  1MA9 B;  3EO3 A;  5F0X A;  3CCE N;  4I6M A;  3TPQ A;  3VEZ A;  1C0F A;  4A5B A;  2E2N A;  2FF3 B;  4C1N K;  5BPN A;  3MN5 A;  4J8F A;  4JHD B;  5AQP A;  4M63 C;  3GOI A;  3VEX A;  4BQL A;  2P9I A;  2YX6 A;  3I33 A;  4BRM A;  4DQ8 A;  1HKG A;  3P39 A;  4PL8 A;  3HZ6 A;  2QTD A;  2FSN A;  4FWS A;  4JKG A;  1MDU B;  4OPA A;  4DCH A;  4WQ5 A;  3O9Q A;  5AQR A;  3DXM B;  4PKI A;  4PKH A;  4BR5 A;  1OKJ A;  5C0Y A;  2NRV A;  4H0O A;  5AQL A;  3C7N B;  5AFU A;  3CCQ N;  5AZI A;  3AAR A;  3MX5 A;  1K8K B;  1QQO A;  2JWK A;  3SMS A;  3A5O C;  3RSE B;  4BG9 A;  4CZM A;  2WFB A;  3CCV N;  1VQ7 N;  3L4I A;  2I7P A;  4NB4 A;  3QFU A;  5JLH A;  1W97 L;  2D1K A;  5GIN A;  2BH1 A;  1BDG A;  3QML A;  3ZX0 A;  2IVN A;  5M1P A;  1E4G T;  1YVN A;  4DB3 A;  3A5N C;  4A61 A;  1YJ9 N;  2ZJQ L;  2J4R A;  1M90 O;  2YCH A;  3ATV A;  3CJ1 A;  1H1V A;  4ILG B;  4BRN A;  4KH6 A;  4U67 L;  4CBX A;  2FSK A;  2YJF A;  3O4W A;  3GL1 A;  1EO1 A;  1D4X A;  3VF2 A;  1WUA A;  2ASO A;  1P8Z A;  3CJ7 A;  3D2F B;  1JCF A;  3CHW A;  4CZK A;  3MN6 A;  2ZJP L;  1VQ5 N;  4IOA L;  3M1F A;  5AQO A;  2VYP A;  5BRH A;  2IIR A;  4ISG A;  1ZXO A;  4XH5 A;  1S3X A;  4AM7 A;  3QDK A;  2YJE A;  5EX5 A;  2P9K A;  4K43 A;  3O9T A;  5BRE A;  3FZL A;  3TTD A;  4B1X B;  1QHA A;  3MX2 A;  1NLV A;  1YI2 N;  1TYQ A;  2CH6 A;  3R1X A;  3KHY A;  3UKR A;  2QWQ A;  3R9P A;  5KPZ A;  2E2Q A;  5JIC A;  4AM6 A;  5M1Q A;  5LY3 A;  1QZ5 A;  4JK9 A;  4BRG A;  3R6M A;  4IOX A;  1NGG A;  2D4W A;  3L0Q A;  3S41 A;  3VPZ A;  4WFA L;  5KQD A;  5AQI A;  1GLE G;  2A42 A;  2P9S A;  1HKC A;  3IKM A;  5LJW A;  3JXU A;  1TUU A;  4JK8 A;  3GG4 A;  3B8A X;  5AQG A;  3CC4 N;  1VQ6 N;  3RVC A;  3DLL L;  3ID8 A;  4BRF A;  3TTF A;  1YXQ A;  1Y64 A;  2NLX A;  3E1Y A;  2Q36 A;  4JKE A;  5GAE P;  4JKF A;  4WFN L;  3CCR N;  4OPH A;  2NRT A;  5M1N A;  2E2O A;  3TSQ A;  1P90 A;  4FWK A;  4NO7 A;  4IZ9 A;  3MN7 A;  2AA4 A;  4BR0 A;  3MK6 A;  2QEX N;  4UY8 O;  2IVP A;  4BR2 A;  4H5N A;  4XH4 A;  4H5V A;  3LM2 A;  1NGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...