3ZX0A

Ntpdase1 in complex with heptamolybdate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
404
structure length
385
Chain Sequence
b'KYGIVLDAGSSHTNLYIYKWVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGSSTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
publication title Crystallographic evidence for a domain motion in rat nucleoside triphosphate diphosphohydrolase (NTPDase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 117
structure length 385
sequence length 404
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx0A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx0A02
4JNEA 2P9LA 1ZXOA 1MA9B 4K42A 1NLVA 4I6MA 3KVGA 4BRHA 4B1WB 5AZJB 3WEEB 3BP8A 3R6MA 4BVOA 4DQ8A 3MK6A 2E2OA 1QHAA 4BQZA 4C23A 3L0QA 3VETA 1S3XA 3VGMA 1QQOA 4MLEA 2CGJA 1NM1A 4K43A 4BR9A 5LJVA 1HJOA 4MO5A 3R9PA 3P4IA 4BRKA 4CZIA 1YXQA 4K41A 2I7PA 5JICA 2CGLA 2ZWHA 3ULEB 4FWNA 4WQ4C 4B1XB 2HOEA 3UE5A 3H6EA 3VERA 2Q31A 3GG4A 1GLFO 3MMVA 3RSEA 1BDGA 1BWFO 4QS7A 3VF6A 3CETA 3H3OB 4RTFD 3WXLA 3O6WA 2P9KB 4IJAA 1HUXA 2BTFA 1BO5O 1NGJA 3DXKA 3FFKB 3GL1A 3H3NO 3LDLA 5AQFA 4BGBA 5B8HA 4B1ZA 1MDUB 1TUUA 4WQ4A 5KPRA 3VENA 1K8KB 4GNIA 4BC3A 3U9DA 2GEMA 4KBOA 2ITMA 4BQLA 3AARA 3R8EA 3VEYA 2FF3B 5FPMA 1XC3A 3J8AA 3DAWA 2E2PA 1NGBA 2P9IB 1TYQA 4DCHA 1BA1A 2W40A 3MDQA 3CI5A 3IFRA 2Q0UA 1NGHA 2GTDA 4FWPA 4I6MB 3BF1A 5FPNA 4BRLA 1WOQA 3LDPA 1EQYA 3ZETA 3IDHA 2DPNA 1RGIA 1X9JA 3GE1A 2PBDA 4RCHA 5ADXH 2FXUA 4NO7A 2IVOA 5EXWA 4A2AA 5E84A 4MLHA 3WUHA 3EKSA 4DHYA 2HF3A 3C7NA 1RDWX 3QICA 2QWMA 3GOIA 5TKYA 2P9NA 1HKCA 4FOIA 5AQQA 3QB0A 4H0OA 4EFHA 2IVNA 3WXJA 1HX1A 1ATSA 4BRFA 3DJCA 4FWOA 1RFQA 2A42A 1U2VA 3QFPA 1Y64A 4FPAA 3D2FA 1V4TA 4K25A 3A5LC 5BPLA 5BRDA 4FSVA 4EHUA 2YHYA 4FO0A 4BC2A 2E2NA 3LM2A 2OANA 4XH1A 2CGKA 5AQYA 5AZIB 4IZ9A 3B8AX 4BRQA 1HKBA 3CIPA 3U9ZA 2YI1A 3JS6A 2P9PA 3W3DA 4BRPA 3WXIA 4L3QA 3CJ9A 1MWMA 1XQSC 3QFUA 4YDUA 2FLOA 1IG8A 2UYTA 5F2RA 2QXLA 2E1ZA 4PL7A 5I9EB 5KPZA 2ZF5O 4PKIA 4ISGA 1HPMA 4FWRA 4BR4A 4A62A 3ZX0A 4B1YB 4AM7A 4JD2B 4BRMA 5F0XA 1OKJA 1T6CA 4WQ5A 2QWNA 1Q18A 3VGKA 1CZAN 5BN8A 1JCEA 3DWLA 3LDOA 5AQGA 2HF4A 4JAXA 3UB5A 4LC9B 1QZ5A 2I7NA 4CZFA 2E88A 1HLUA 3VF4A 4BR2A 2Q36A 4Y0WA 1ZBSA 2QM1A 4BRAA 1XUPO 3SLCA 3VF2A 2KHOA 3AAQA 3FR0A 1KAZA 1SQKA 1NGDA 2QWPA 3WT0A 3SMPA 2D4WA 4BC5A 3D2FB 4FWKA 3WQUA 5BPNA 3ZEUA 5AQWA 5FPEA 4BG9A 1U6ZA 4WYBA 3WQTA 4EHTA 1X3NA 4IWVA 5EOYA 4BROA 4B1VA 3DXMA 1P8ZA 2Q97A 2P9UB 1T6DA 3L6QA 4JHDA 5BN9A 1G99A 5ELZA 2E1YA 1NGAA 2GELA 4CZMA 4CZLA 1NGIA 4JN4A 5EX5A 4FL9A 1H1VA 5BPMA 2V7ZA 5AQRA 2P9LB 1DKGD 2H3GX 3OHRA 3QBXA 4H0XB 4HTLA 5E26A 4F9OA 5AQTA 4IXCA 1NGGA 1R59O 4H0PA 1ATNA 1E4GT 4O5FA 3LDNA 4MO4A 4BG8A 3VOVA 3CERA 4M7XA 3CQYA 2ZGZA 2VCPA 3CJ1A 5LJWA 2FSJA 2PAVA 3H1QA 3HBTA 1V4SA 4J8FA 3H46O 4PKHA 4ISEA 3D2EA 4IJNA 3M6GA 5AQHA 1NMDA 4H5VA 4E1JA 1ZC6A 2J4RA 2QW9A 3UKUA 3IUCA 3EL2A 4FWSA 2Q0RA 4CZEA 2CH6A 4HWIA 4BRDA 2F9TA 5AZJA 3JXUA 5AQMA 2W41A 3CJBA 3WEEA 5AQIA 2A41A 3VEOA 2VYPA 2A3ZA 5ADXA 3S41A 1J6ZA 1YVNA 1Z6RA 3RSEB 5FPDA 4BREA 1SAZA 5BREA 3HTVA 2Q1NA 1DEJA 1BA0A 4CZJA 3SK3A 4FWLA 3CJCA 3DXKB 3QMLA 1GLAG 2FSKA 5AQUA 3MN7A 3ULEA 1YAGA 2ZGYA 3VEXA 4BRNA 4YDUC 1YUWA 4GY2B 3DXMB 4O8KA 4H5NA 4BR7A 4JHDB 4NB4A 4CD1A 3L4IA 3H45C 4PKGA 1TYQB 3M3ZA 1DGKN 3C0BA 3BF3A 1BOTO 2V7YA 3A5MC 1TUYA 4H03B 1K8KA 1QZ6A 2QWOA 3A5NC 3ENHA 3HM8A 3I33A 3SJHA 3QDKA 1GLLO 3VESA 4CZGA 1IJJA 1GLJO 3I8BA 4QS9A 4WQ5C 3ZETB 5AQOA 4H0TB 3H1VX 4BC4A 3KHYA 3ATVA 4FWMA 2QWLA 1BG3A 3W0LA 3ZX2A 2D0OA 5F1XA 2ASPA 3BUZB 1GLCG 3ZX3A 2A6AA 2P9IA 2E20A 3C7NB 3EN9A 4ISFA 3VEZA 2Q2RA 2D0PA 2P9SA 1GLEG 2ASOA 3FE1A 4QS8A 2P9NB 2D1KA 5BRHA 4BGAA 4BR5A 2AA4A 3D7EO 5LY3A 4CJ7A 2VWBA 3SMSA 3WXKA 2NLXA 3EKUA 4FWQA 1LOTB 2IVPA 3FGUA 2YJFA 2V52B 3O80A 3MN6A 5CE3A 5AQNA 3QBWA 4CBWA 2GWKA 3FZLA 1S22A 3FZHA 4B9QA 1QQNA 4BRGA 3O8MA 4M63C 4DB3A 2ASMA 4A2BA 1U2VB 3MN5A 2FF6A 5EVZA 1QQMA 2EWSA 3A5OC 4FPBA 1MWKA 1NGEA 5AQZA 4EIAA 3A0IX 2QWQA 3O08A 3CJAA 1E4FT 1BUPA 3VEWA 5AQJA 1SZ2A 2P9PB 3VEVA 5KPTA 3ENOA 3GBTA 3UKRA 3CQXA 4BRCA 1GLDG 3FZFA 4CI6A 4CBUA 3ATUA 2YHWA 2HMPA 3U8XA 1Z05A 2V51B 5AZIA 1NGCA 2F9WA 1D4XA 2E2QA 1ESVA 2AP1A 4FOEA 3MN9A 4XEIA 4IO8A 4H0VB 4A61A 5JMVA 5BRFA 4PL8A 2P9SB 3KZBA 4XH4A 5KQ8A 2NRHA 5AQLA 3A8YA 3G25A 3VGLA 2NZTA 2A5XA 3AAPA 1C0GA 1LCUA 2GWJA 3FZKA 1KAXA 3TU5A 3FZMA 5AQPA 3EZWA 3EO3A 4H5WA 5EY4A 2YCHA 3LL3A 1KXPA 3BEXA 4BRIA 4H0YB 3HI0A 3M1FA 3ID8A 4B1UB 3VPZA 1KAYA 5BR9A 4BR0A 1X3MA 4JD2A 2A40A 4CZKA 1BU6O 5AQSA 1HKGA 4CBXA 2E8AA 4H5TA 3O1BA 3ZEUB 3FLCO 2GUPA 5AFUH 3CHWA 3LM9A 4CZHA 1JCGA 2CH5A 1ATRA 1NBWA 1C0FA 4BVPA 5AQVA 3IMXA 2P9KA 3HZ6A 2YHXA 1NGFA 2BUPA 5AQXA 3LDQA 5JLFA 3TPQA 2WUSA 3UKRB 2YJEA 5AFUA 4AM6A 3U4LA 5KQDA 2IIRA 3CJ7A 1WUAA 2QWRA 3F9MA 4M7YA 1GLBG 4EAHD 1JCFA 2P9UA 4XH5A 5AR0A 3MCPA 3O5BA 3HSCA 1T44A 3GDQA 3AY9A 3D2EB 4RWTA 3O4WA 3O1WA 1NWKA 2FSNA 4H5RA 4CD3A 5JLHA 5AQKA 3UKUB 4Z94A
chains in the Genus database with same CATH superfamily
2Z1GA 3BZCA 4CEQA 4I6MA 3SQ4A 4BRHA 2ITGA 4CJWA 3MK6A 3L0QA 5C42A 4MLEA 4K43A 3OS0A 3P4IA 1YXQA 4I9QA 3OBWA 4CJUA 1S6QA 4KI4A 2ZWHA 4B1XB 4FWNA 4OPJA 3UE5A 1W7AA 3DLKA 1K73O 3VERA 3RSEA 3DRSA 5HROA 3CETA 3H3OB 3WXLA 2BTFA 2A1SA 1NGJA 3GL1A 4BGBA 3LDLA 4KV8A 2OPPA 3PIPL 4AILC 2OTJN 3LP1A 3JYTA 3VQQA 3K58A 3VTHA 3QNNA 3V6DA 4IEEA 4FJIA 2YNHA 3VEYA 2QA4N 1EWQA 2O8EB 1XC3A 2IGIA 3CPEA 3DAWA 1NGBA 4JKDA 1TYQA 5HRNA 3VQPA 4E7HA 4IOXA 3E66A 3IFRA 3ENBA 4FWPA 1KD1O 1BIZA 3S3OA 1NK7A 1NJYA 1YT3A 3IDHA 4DR3K 4CEBA 3L2UA 5EXWA 3CM5A 1WSIA 3AV9A 3C7NA 2YNIA 2IDOA 4B9MA 3GOIA 3U3YA 1HKCA 4HUEA 3HSTB 1NKCA 4ID5A 1BHLA 1JL2A 2OTLN 3WXJA 4B3OA 3ZSYA 1T8EA 1HX1A 2HNDA 2VGNA 4BRFA 1RBUA 3AVGA 5GAGP 1HQUA 3WNEA 1U2VA 1Y64A 4FPAA 3M8QA 3I0RA 4DSFA 3NGIA 1VQMN 2FBXA 1VQ8N 3IAYA 2BGGA 2YHYA 4B3RK 4FO0A 4BC2A 4PWDA 3OYMA 4Q0BA 2E2NA 3LM2A 4G9ZA 4XH1A 2CGKA 5AQYA 3DLEA 3QETA 4M42A 4TSXA 4YFUA 3SQ0A 2P9PA 4Z4GA 4JI0K 4OVLA 1D9FA 3P1GA 4YDUA 4LH5A 3QLHA 2E1ZA 4PL7A 4CJPA 5LMUK 3TI0A 3K9JA 4AHRA 4U67L 2UUCK 3O9RA 1JLGA 4J2EA 4KRFA 3TAMA 4CE9A 3ZX0A 4CK2A 4AM7A 4KFBA 4KTQA 3MXIA 3O3HA 3TSQA 4LF6K 2QWNA 4M3TA 1JCEA 3LDOA 4JI4K 3HVRA 2HHWA 4CVNE 4CJRA 4YOWA 5SZTA 4CJ5A 4NLBA 1HLUA 1NMNA 4KAZA 3VQ7A 3TSUA 3RWUA 4B9VA 4Y0WA 4OKKA 3FR0A 1NGDA 1OH7A 4KHNA 4H4OA 3BGRA 4YOTA 1S1XA 5FPEA 4BG9A 1U6ZA 3WQTA 3VN5A 4EHTA 2F8SA 4BROA 1VQ4N 4B8AB 1NKEA 2HBKA 2X74A 3ZT0A 1T6DA 1WSGA 2O4GA 3NF8A 2IAJA 2GELA 1NGIA 4JN4A 3OYJA 3S9HA 4C8MA 2D0CA 3TTFA 1HNIA 1DKGD 2H3GX 3MEDA 5GIPA 4F9OA 5AQTA 1NGGA 1WSHA 2FBTA 1ATNA 1HNXK 3DLHA 4DWIA 2O8CB 1EXQA 4IFEA 4BG8A 1YHQN 4DF8A 2ZGZA 4DSLA 4F2SA 1G15A 5C2FA 3HBTA 1RBSA 4PKHA 3I55N 4FJMA 4H5VA 1Q8IA 2QW9A 4CJVA 3IUCA 3EL2A 1L3VA 3AO2A 2E4LA 3C6HA 4B9SA 5J2QA 1ZBUA 2O8FB 2W41A 2IC3A 1IO2A 3TAFA 4OGEA 3WEEA 1VSKA 5C0YA 4UQGA 2VYPA 2O8DA 2YX6A 1Z6RA 2VG6A 4PY5A 2Q1NA 1BA0A 1U04A 4H4MA 1KVAA 3V9WA 4N41A 3OJUA 1UAXA 3VA0A 5C24A 4KO0A 1FKPA 3SUPA 1SL1A 3ULEA 5SWMA 3KLFA 3CCVN 4GV3A 3K5MA 3VQEA 1TK0A 3DXMB 3HL8A 1D5AA 4NCAA 3G4SN 1NG9A 2O4IA 3M3ZA 2ZJQL 3OS2A 4H03B 1K8KA 1QZ6A 1J9AA 3CCEN 3AO5A 4X65K 3QDKA 1GLLO 3VESA 3UIQA 4WQ5C 4DSIA 3KHYA 3LWMA 2QWLA 3DI6A 2D0OA 2WOMA 3PX6A 1HNWK 4BWJA 1BI4A 3E9LA 4LD0A 2E20A 4ISFA 3VEZA 1XMQK 3ZLJA 1QQCA 4QS8A 1XC9A 2D1KA 2FBVA 4JK9A 2AA4A 3D7EO 3EKUA 5C2DA 4IG0A 1FXXA 3MN6A 3LDSA 3FZLA 4CERA 1T7PA 1C0MA 4OPKA 2ETJA 1S22A 4W5RA 3FZHA 4B9QA 5JS2A 1NJZA 1QQNA 4EP4A 5KTQA 1NKBA 4A2BA 4WFAL 1QQMA 2EWSA 1MWKA 1OH8A 3IS9A 4GV9A 4YOUA 4JKFA 3GBTA 3UKRA 2KLAA 1YJ9N 4W5OA 3AVLA 1GLDG 4CI6A 1O1WA 4DSKA 4CBUA 1VQPN 3CC2N 4DTRA 3J81O 1YJNN 1C0TA 4EZ6A 1IG9A 5AZIA 5LMNK 3L2RA 1D4XA 1EETA 1TL1A 1HPZA 5C15A 2HMIA 1JKHA 1TL3A 4CESA 4FOEA 1T3VA 4NYNA 1BQMA 3T3FA 3EE9A 1GOAA 4H0VB 3WXMB 4PL8A 3CCLN 1NJXA 3P83D 4Z4CA 1VSMA 2P9SB 3NE6A 2WONA 2NRHA 5AQLA 2NZTA 2A5XA 1KQSM 4FLTA 1C0GA 4BDZA 2GWJA 3FZKA 1KAXA 4H5WA 4CJFA 4H0YB 4JKGA 1WAJA 3ID8A 3VPZA 2G8WA 1KAYA 1WN7A 1KCFA 1RDCA 1VSJA 4R79A 4K8ZA 2YHAA 4JD2A 1NU0A 3OYIA 2HHHK 4CEZA 3O1BA 1N33K 2GUPA 5AFUH 3LM9A 4CZHA 1HNZK 1ATRA 4LFAK 3EE8A 4CGJA 4CEFA 2KZMA 1N34K 1L5UA 4KHWA 2UXCK 2VQEK 4YOVA 4NCBA 2P9KA 3AVBA 2YHXA 5AQXA 2BUPA 4BE1A 2WUSA 1BL3A 3SCXA 3U4LA 5CYMA 4YOXA 1WUAA 2QWRA 1A5WA 4CGFA 2NRTA 4DTJA 1JCFA 4XH5A 5AR0A 3IG1A 4FJ9A 3H08A 1JLAA 5JVGL 2UU9K 1TK5A 3MCAB 3RR8A 2FSNA 2GUIA 5JLHA 1Q86O 1VQ7N 2P9LA 1ZXOA 5M1OA 5KGXA 1NLVA 3ZSQA 2O8BB 5M1NA 1P90A 5AZJB 2F7TA 1XNRK 3P5JA 5J1EA 1QHAA 4BQZA 2WFBA 3VETA 3KWGA 4KHSA 2KKZA 2CGJA 3NF7A 1RBTA 3EEQA 3R9PA 1HMVA 4K41A 1A5VA 3SZ2A 2JLEA 2E6MA 4WQ4C 2HOEA 3SPZA 3VQ4A 1A5XA 3H6EA 3SUQA 3THYA 2Q31A 4ELTA 4QS7A 1BWFO 4RTFD 4W5QA 2NRXA 3O6WA 4IJAA 3T1AA 3RRHA 3MWTA 4JYAK 3TANA 1WNSA 3V9SA 4F4KA 4WQ4A 4JI2K 4M3RA 4A5BA 4HUFA 2ZM6K 4GNIA 3IRXA 3U9DA 4NLCA 2GEMA 4FLWA 3IKMA 2ITMA 4BQLA 3NVKA 3K2PA 3J7YP 3R1XA 5M1FA 2G8FA 1IBLK 3J8AA 3AA2A 2E2PA 2NRRA 3B6OA 4ILHA 4DCHA 1BA1A 3AO4A 3F73A 4CK1A 3CI5A 4JKCA 3OYBA 3CCSN 1NGHA 2GTDA 4I6MB 5FPNA 4BRLA 3NBPA 5DK5A 3J80O 1RT7A 3LDPA 4JKHA 4JK8A 2DPNA 3SV4A 3C6UA 3LP2A 4AHSA 3LPUA 5ADXH 4OPAA 2IVOA 4A2AA 2FC0A 1C1AA 1HYVA 4WFBL 4MLHA 3EKSA 4FLZA 1RT3A 1TAQA 4M3UA 1B9FA 1EKEA 2BE2A 4KTZA 1XWLA 1GOCA 5AQQA 1WBBA 1REVA 4EFHA 3OBYA 1WBDA 3SV3A 2WC9A 4Z4EA 1RILA 1VSIA 2DY4A 4FJGA 3HK2A 4FWOA 1RFQA 2VGMA 3SYZA 1V4TA 3F2KA 2WBNA 4YHHK 5FRMA 2W6KA 3KKRA 3CF5L 4O0JA 3C95A 1KC8O 3SI6A 4DSJA 2OANA 4JI1K 4FM1A 1C1BA 1IKVA 3B8AX 2ZQBA 5GAEP 4BRQA 3U9ZA 1FKOA 3JS6A 4C8OA 4BRPA 1YTUA 3WXIA 3CJ9A 3QFUA 3TABA 2HBJA 1IG8A 2UYTA 3CXCM 5I9EB 4AQYK 4DFPA 4DSEA 5CR4A 1YITN 4F8RA 4I9LA 1VQKN 3KLEA 4FLXA 4FWRA 1S1UA 5LL6Z 4B08A 4BR4A 4Y1CA 4E19A 4CECA 4A62A 4B1YB 1OKJA 4CHZA 2R7YA 1Q18A 3RTVA 4FJ5A 5JS1A 2P5OA 3HJFA 3EZ5A 4Z4IA 4HTUA 4NCGA 2ATQA 4O44A 1QZ5A 4CZFA 1OH6A 4C1NK 3ASMA 1ZBSA 3TWHA 2NRVA 3SLCA 1UOCA 2E6LA 1SQKA 3ZSXA 4FK2A 3OYHA 4BC5A 3AA3A 4OX9K 4FWKA 2IS3A 4BACA 3ZEUA 4DTUA 3Q7BA 1RTHA 2UXBK 1QSSA 4IWVA 1NK0A 3L4QA 3MX5A 3S3NA 3L6QA 4JHDA 5BN9A 3PV8A 3VQDA 2E1YA 4CZLA 3CCMN 4J2DA 5EX5A 3O9UA 4FL9A 1H1VA 5BPMA 2V7ZA 3OHRA 4H0XB 1VSFA 4OKEA 4HTLA 5E26A 3VA3A 2QK9A 4CJSA 3NFAA 4IXCA 4W5NA 1E4GT 3PO4A 3NVMA 3VOVA 3ZT3A 4DV4K 4M7XA 3CQYA 2FSJA 4MQ3A 3HM9A 4FLVA 3B6PA 1V4SA 4J8FA 1TKDA 1SV5A 4ID1A 4IJNA 4AF1A 1Y97A 1ZC6A 3RMBA 2XRIA 1VQ5N 2Q0RA 1JLFA 1JLBA 4HWIA 4DR2K 1D9DA 3L2WA 2F9TA 5AQMA 2EHGA 3SUNA 2QKBA 1TGOA 3LANA 4O8UA 3QERA 3KKSA 3HTVA 1CXUA 1DEJA 4KTWA 3TSPA 3DXKB 2XO7A 1NNEA 3QMLA 2VWJA 4RW8A 1N5YA 3CM6A 3MN7A 2OZSA 1RTIA 1RBVA 3SQ1A 2ZGYA 3VEXA 4YDUC 4GY2B 1IH7A 1NK9A 4H5NA 1U47A 4DLEA 1EX4A 5M1QA 1VHXA 4LF7K 4FLYA 4GV6A 4KB1A 1N32K 1RT5A 1BGXT 2V7YA 1TUYA 4I2PA 1Q9YA 3VENA 3A5NC 3SJHA 3AVJA 1IJJA 3SPYA 2E5LK 3I8BA 1ZBIA 2KQ2A 3ZETB 3H1VX 4BC4A 3SBGA 3ATVA 4ELUA 2O8EA 3ZX2A 1Q81O 1K8AO 4AHVA 2ASPA 4F3OA 1GLCG 4GVEA 2A6AA 3ZX3A 1O13A 1LV5A 3QEIA 2XY7A 3LP3A 4IBNA 3K59A 5HRPA 2P9NB 2B6AA 5BRHA 4BR5A 4DFKA 4FJJA 1LOTB 2IVPA 3FGUA 4MFBA 3LZIA 3D6RA 1K9MO 5CE3A 4BWMA 4CBWA 2GWKA 1TAUA 4LH4A 3ZCMA 3O9TA 3ISNC 4FJXA 1NOYA 3V1QA 3QEPA 3OYGA 3WNFA 2QXFA 5AQZA 3A0IX 4F3TA 1MU2A 2OPQA 4DU1A 3CC7N 2AJQA 1BUPA 1TV6A 1S1VA 1RBRA 2QI2A 3ULDA 2DTUA 3BZKA 1QE1A 2Z1HA 1SZ2A 4OJRA 4CIGA 3NCIA 4FXDA 2HHTA 3ZT2A 2GV9A 4BRCA 2G8HA 4LF9K 2VG7A 4FJHA 4FLUA 3THXB 4OPHA 3OYEA 2QTDA 2YNFA 1Z05A 2V51B 1T05A 1NGCA 2F9WA 4DUYK 2E2QA 5EU7A 4N56A 4Q5VA 4HCBA 3T69A 4XEIA 2Y1JA 4IO8A 1JLCA 4U7BA 4YNQA 2UXDK 5JMVA 2HHUA 5BRFA 2QEXN 3KZBA 4XH4A 3M5RA 3A8YA 1CXQA 1RTJA 3G25A 4LSNA 1KFDA 4DQPA 3M8RA 5AQPA 4CW7B 3EZWA 1JLQA 5EY4A 4DQQA 1S9GA 1TKXA 3HO1A 1BCMA 4BRIA 4Z4FA 3QIPA 2VWKA 3HXMA 5BR9A 4BR0A 2A40A 4CHOA 1ZYQA 4H5TA 1IKXA 5GINA 3F5TA 3NHGA 3OVNA 4WF9L 1VQ6N 1ASWA 1YTAA 1C6VA 1NBWA 5KI6A 3OYAA 3T7ZA 1WLJA 1KFSA 2GX9A 3AVAA 3HT3A 5J2PA 4PUOA 3UKRB 2YHBA 1XHXA 5AFUA 3DYAA 2IIRA 3JSMA 4LSLA 2G8VA 1GLBG 4EAHD 1YJWN 1RDAA 3MCPA 3O5BA 4O5BA 1T44A 1JLEA 3AY9A 3GDQA 4FW1A 3D2EB 4DV0K 3THWB 3UKUB 3TAQA 1HRHA 1DTQA 3TTDA 1MA9B 3NH1A 3THVA 1VQNN 2P51A 4JI5K 1N36K 3CQ8A 2RE2A 1FW6A 3BP8A 3R6MA 4JLHA 2F96A 4BVOA 3U6FA 4DQ8A 3EYZA 4YOYA 2E2OA 4OKJA 1N8RO 1NM1A 5LJVA 3VMFB 1HJOA 3DOKA 3LWLA 4MO5A 4BRKA 1W0HA 4NYFA 4CJTA 2I7PA 4FJ8A 5JICA 2CGLA 4QCLA 1VRUA 4E7KA 3KK7A 2O8FA 1ZBFA 2XY8A 3GG4A 1GLFO 3MMVA 3TAPA 1SL0A 2P9KB 4MDAA 1HUXA 4Z0UA 3H3NO 5B8HA 4DTOA 1RT4A 4B1ZA 1MDUB 1TUUA 3T19A 4DS4A 4CFCA 5HRSA 4E7JA 4F2RA 4KBOA 3F9KA 5A2QO 1L3UA 3AARA 2FF3B 5FPMA 1YF5L 4NXMK 3KIOA 4DV5K 2P9IB 4Y1DA 3QESA 2W40A 3SBTA 3MDQA 3WNGA 3OS1A 2Q0UA 3BF1A 3K5OA 3AGRA 3CCJN 1J54A 4DTNA 1VSLA 1M1KO 3GE1A 4RCHA 4O0IA 5MLCQ 4IDKA 1KVBA 4NO7A 3JAMO 1S9EA 4FM0A 2RN2A 3ZYYX 4C8KA 2HF3A 3TTCA 3CCQN 1RDWX 4GVMA 4BE0A 5TKYA 1LWCA 4OGCA 4FOIA 3QB0A 3THYB 1IBKK 1OVYA 1BQNA 2D0AA 5KGWA 3AVKA 1ATSA 2W6LA 1FK9A 4CGHA 4DTMA 4DKWA 4KB0A 4DV2K 3QFPA 3AA5X 3D2FA 3VQCA 1HYSA 3RVCA 4K25A 3WNHA 4KPYA 5BRDA 4FSVA 5E41A 4EHUA 3J7ZO 2NUBA 1RT1A 3NH2A 3D0PA 2EX3A 4IZ9A 5C10A 3MEGA 3CIPA 4C8LA 2RF2A 5I3UA 4JEPA 1RDUA 3W3DA 1MWMA 1XQSC 2FLOA 1L3TA 2D5RA 4A5AA 3S3MA 2YKMA 4PKIA 3CG7A 3D45A 4FW2A 4ISGA 5HRRA 3E9OA 1RTDA 1HPMA 5M1KA 4AHCA 4CFBA 2HHSA 4EZ9A 4FZYA 4JKEA 3BDPA 5F0XA 1T6CA 3NH0A 5FDLA 3VGKA 1CZAN 3DWLA 5AQGA 3OW2M 2HF4A 3UB5A 1X1PA 3C94A 3I0SA 4W5TA 3DOLA 3VF4A 4CF8A 3QIOA 2QM1A 4BRAA 5KRTA 3AAQA 4JKAA 4AHTA 2KZZA 1KAZA 4C1NI 1CLQA 4IOAL 3SMPA 2D4WA 3AVMA 5J2MA 1NJWA 4GKKK 4CJKA 3P38A 5AQWA 4FK4A 4WYBA 1S6PA 1X3NA 4B1VA 1QTMA 4M3XA 2P9UB 3P39A 3EY1A 1M90O 1G99A 5ELZA 2X6SA 3KJVA 1ZBLA 4DU3A 4HVJA 5AQRA 3QBXA 4CJLA 3L2VA 1Q9XA 5GIOA 4KHQA 3LZJA 3CD6N 4H0PA 5IT9O 5CY4A 1WSEA 1T03A 3LAMA 5LJWA 1I39A 2PAVA 3RRGA 1X9WA 3OYKA 3KD5E 4ISEA 3ALYA 1NMDA 4E1JA 2J4RA 1W97L 4JV5K 4FWSA 4CZEA 4DMNA 3PIOL 2CH6A 5C25A 2O8BA 4DR1K 5AZJA 1HQEA 3AVFA 5AQIA 3DM2A 1KSPA 1WSFA 1J6ZA 1YVNA 1B9DA 1TKZA 1VSDA 4ILJA 3RSEB 3NMUA 2HB5A 1UA1A 5BREA 2ZJPL 3SAGA 4CZJA 3SK3A 3QO9A 4FWLA 1VAZA 3V1RA 1LW0A 1GLAG 3CMAN 4FYDA 1EP4A 3CFPA 1XNQK 1VQON 4FCYA 2BDPA 3PX4A 4J2BA 3K5LA 5FRNA 3PY8A 3LAKA 4IKFA 4K8XA 4DQRA 5GADP 3ZSZA 1J5OA 4CF0A 3VQ8A 4IFYA 4JHDB 2OZMA 1VRTA 4CD1A 2HNZA 1KTQA 1RNHA 3H45C 4PKGA 1TYQB 1VSEA 2Q3SA 1QSYA 1DGKN 3C0BA 3BF3A 1CZBA 3RMCA 2PY5A 3I33A 3ENHA 4M41A 3HM8A 4B9LA 1KVCA 4WE1A 4KHPK 2F4VK 3MECA 1SKRA 3KLGA 4WFNL 5AQOA 3OYDA 1SKWA 3C6TA 3VQ9A 3NGZA 4FWMA 3MWPA 3W0LA 1BG3A 5F1XA 4DUZK 2BH1A 2HNYA 3BUZB 3NF9A 3ZT4A 5KRSA 1QS4A 1LWEA 1UA0A 5DM6L 4O55A 3C7NB 3EN9A 3I8DA 2Q2RA 2ZE2A 2D0PA 1BIUA 3G0ZA 4HUGA 4CEOA 4BGAA 4CF9A 5LY3A 4DV7K 3WXKA 2NLXA 3QEWA 2LSNA 3O80A 2JGUA 1EWRA 3BY5A 2OPRA 4M63C 2WTUA 4B8CA 4DB3A 3O3GA 2ASMA 1U2VB 3MN5A 2FF6A 3PUFA 3A5OC 4FPBA 1IBMK 4DG1A 3RR7A 1JXEA 2HSTA 4BDPA 4CHPA 4M3WA 5DMRA 3CJAA 4KI6A 4YY3K 4H8KA 3ZT1A 3MXMA 3QEVA 1EO1A 2HVIA 2G8KA 4M3ZA 3VEWA 1RCHA 1J5EK 1S72N 2P9PB 3VEVA 1XHZA 3KTQA 2NRZA 1B92A 1W2BM 1NK4A 3FZFA 3O9QA 3AO3A 3CPWM 3J7AP 4BY9C 2YHWA 2HVHA 4FJNA 4J2AA 1SKSA 3N4PA 3M8PA 4K0KK 3AA4A 5D3GA 4RG8A 3V81A 5KQ8A 1DTTA 3HYFA 4LF5K 3VGLA 3CCRN 4KH6A 3SAFA 1LCUA 4JRPA 4CHQA 4N76A 3TU5A 3HPGA 2XY6A 4GMJB 1C1CA 1S5JA 2RHKA 2YCHA 1IKWA 3M1FA 4B1UB 1X9SA 4JI3K 3VTIA 2OA8A 2W42A 1JL1A 4CZKA 4WCEL 5AQSA 1HKGA 4CBXA 2E8AA 3L8BA 4FK0A 1CZ9A 3CHWA 2CH5A 1C0FA 4KKOA 4CIEA 3DRPA 4BVPA 5AQVA 3HZ6A 2HBLA 4E89A 5HOOA 3O9SA 1U48A 1NJIO 5TKWA 2HW3A 1YVUA 4AM6A 3ZSRA 4CFDA 4ZHRA 5FLXO 1SUQA 4N47A 4IOCL 3KLIA 1Z25A 4B3MK 1HYZA 3E1YA 4M7YA 1IV0A 1L3SA 3C6AA 4CGIA 5T7BA 4CEDA 4E7LA 4FVUA 3HSCA 4DTSA 4RWTA 4FM2A 3O1WA 1W9HA 4CD3A 4H5RA 3HOSA 1YIJN 4CJ7A 3U3GA 1ASVA 2FBYA 4Z94A 1N6QA 4JNEA 3V1OA 4K42A 4MDBA 4KHUA 3KVGA 4IEIA 3K0SA 4IG3A 4B1WB 4PQUA 3DRRA 3KK2A 2Z1IA 2PFUA 3K9KA 3HOTA 3WEEB 4DU4A 4CF2A 2O8DB 4I7FA 2NRWA 4C23A 2KW4A 1S3XA 4DR5K 3VGMA 1QQOA 5CHIA 4BR9A 4DQSA 1X9MA 3TAEA 4ZTFA 3KD1E 3L3VA 4CZIA 4NXNK 3R3LA 4CGGA 2VQFK 2IOCA 5IWAK 3ULEB 3KK1A 1I3AA 4DR4K 3NGYA 1BDGA 3VF6A 3TARA 3CFRA 3A2FA 1BO5O 3FFKB 3DXKA 5AQFA 3K5NA 2X78A 5BR8K 3MAQA 4E0DA 4AH9A 5KPRA 1U49A 1K8KB 4BC3A 3ZSOA 3DLBA 2UUBK 4B3TK 1RT6A 3R8EA 4E1MA 3VQ5A 4CF1A 3HP9A 3V4IA 4OO1J 2RKIA 1BI4B 4JRQA 2HHQA 4BE2A 5CZ1A 2Z1JA 3O4NA 1WOQA 2KFZA 1ITGA 3G10A 3CCUN 1EQYA 2ZD1A 3ZETA 1TK8A 1C0UA 1RGIA 1X9JA 1E3MA 3FFIA 4GW6A 2PBDA 1KRPA 4QOZB 2FXUA 1HR0K 3ID6A 5E84A 3WUHA 3K57A 4DHYA 1UWBA 3RMDA 4CK3A 3KLHA 3QICA 4BDYA 2QWMA 4X66K 2P9NA 3HRGA 2XY5A 2VG5A 4H0OA 2IVNA 5JVHL 4CJ3A 1D8YA 3CFOA 4HCCA 1WSJA 3CYMA 1DT9A 4C8NA 3DJCA 3LP0A 2A42A 1NOZA 1ILYA 3A5LC 5BPLA 1NK5A 2XHBA 4ICLA 3PLAA 2DFFA 3RMAA 4B9UA 4HHTA 3PSIA 1RDDA 5AZIB 1VQLN 1HKBA 2NNWA 2DFHA 3ITHA 2YI1A 4KH4A 2P1JA 4L3QA 4CEAA 1Q7YO 3DLRA 4KHYA 5F2RA 2QXLA 2OPSA 5KPZA 3THXA 3AO1A 2O8CA 3E01A 1K6YA 4A57A 2ZF5O 5HL7L 3AVHA 4JI6K 5K14A 1GOBA 4JKGB 3PSFA 2HBMA 3CMEN 1RT2A 3G6EN 4JD2B 4BRMA 4WQ5A 2YNGA 1J53A 3O4QA 4DV1K 1FJGK 4E7IA 5BN8A 3AGKA 4CHYA 2PZSA 1JXBA 3OJSA 1LWFA 4CJQA 4JAXA 5DM7L 4LC9B 3V9UA 2X6NA 2I7NA 4E3SA 2E88A 4XIUA 2ZJRL 4BR2A 2Q36A 4CHNA 2HHXA 4X64K 1XUPO 1RDBA 3VF2A 2KHOA 4A59A 4ZTJA 3WT0A 3TR8A 2QWPA 3OA9A 1I94K 3I56N 2HHVA 3M8SA 3D2FB 4CCHA 3WQUA 5BPNA 3O3FA 5EOYA 2OYQA 4V19S 3DXMA 1P8ZA 2Q97A 4B9NA 2RPIA 1XI1A 3NF6A 4I2QA 1QVFM 1KLMA 1NGAA 4JS5A 4CZMA 4PHTX 2QKKA 3SQ2A 3MX2A 2D0BA 2JWKA 2P9LB 4FZZA 3CC4N 4DLGA 3AVCA 1R59O 3T1HK 4O5FA 3LDNA 4MO4A 3CERA 3AVIA 2I5JA 2VCPA 4DR6K 3CJ1A 3H1QA 4JI7K 3H46O 4DTXA 3D2EA 5AQHA 3M6GA 3THWA 3KK3A 3UKUA 3SUOA 1BCOA 4R5PA 1NK6A 3E9PA 1LAVA 4BRDA 4X62K 3NAEA 3JXUA 1IKYA 3CJBA 3NDKA 2A41A 3VEOA 4FJ7A 2A3ZA 5ADXA 3S41A 4IFVA 5FPDA 4BREA 1SAZA 4ILGB 3CJCA 4GKJK 4G1QA 4RW7A 2FSKA 5AQUA 4CFAA 5HLFA 4JK7A 4IDHA 1YAGA 2G8UA 2PYLA 5CZ2A 1VSHA 3DMJA 4BRNA 3MXJA 3HPHA 1YUWA 3VQAA 5GAHP 4O8KA 3QNOA 1LW2A 4BR7A 4NB4A 3L4IA 4RW6A 4B9TA 3OY9A 4LF4K 1S1WA 2P5GA 1BOTO 4LFBK 3A5MC 3DLGA 3T1YK 1HJRA 4ELVA 2QWOA 4CZGA 1GLJO 1WAFA 4DV6K 2F8TA 1SL2A 4QS9A 1NK8A 4H0TB 1VK0A 4FZXC 3OYLA 5AJ3K 3DLLL 3SAHA 4IO9L 4JI8K 2B4JA 4DTPA 2P9IA 1TVRA 4DS5A 5M1PA 3V9XA 2P9SA 3AVNA 1GLEG 2ASOA 3FE1A 1JJ2M 3OYNA 3QINA 1U4BA 4RW9A 2VWBA 3SMSA 4DQIA 2KTQA 4FWQA 2YJFA 2V52B 2GBZA 4OLBA 5AQNA 3QBWA 1QSLA 3HPOA 2UUAK 4M45A 3MEEA 1ZBHA 4LFCK 4BRGA 3O8MA 3OTOK 2KFNA 5EVZA 4LF8K 2BANA 1NGEA 4EIAA 3O08A 2QWQA 4KH5A 4CJEA 1HNVA 3ZSVA 1E4FT 2JWLA 4Z4HA 1ASUA 5AQJA 4KREA 3SNNA 5KPTA 3QEXA 3ENOA 4YORA 4FJLA 3L3UA 3V9ZA 3CQXA 2Y1IA 2A1RA 4PA1A 4B3SK 3KWIA 2B5JA 4UY8O 3C65A 4OLAA 3TAGA 3ATUA 2HMPA 3U8XA 3LPTA 4O4GA 1VQ9N 4DF4A 3L2QA 3LALA 1KLNA 1QHTA 5HBMA 1ESVA 4LY7A 5FROA 2AP1A 5J2NA 1WB9A 1OVQA 3MN9A 5C12A 2OCEA 4A61A 1DLOA 1F21A 1SS6A 3OYFA 4EP5A 3VQ6A 5CYQA 4CEEA 3AAPA 3HVTA 4FVMA 3FZMA 1R0AA 1BISA 3EO3A 5H1SQ 3LL3A 1KXPA 3BEXA 2YV0X 3HI0A 3P31A 3OYCA 3ZSWA 4CIFA 1X3MA 4JS4A 1U45A 1BU6O 1XMOK 4JKBA 4DR7K 4DFJA 3ZEUB 3FLCO 3N4QA 4CGDA 1JCGA 1Z26A 5HP1A 3VQBA 4CJ4A 4N5SA 3IMXA 1TKTA 1S1TA 3Q7CA 1NGFA 4AHUA 5JLFA 3LDQA 2G8IA 2PYJA 4FJKA 3TPQA 3HP6A 4L8RB 1YI2N 2YJEA 4M3YA 5KQDA 3CJ7A 3PO5A 1OH5A 4DFMA 3F9MA 2YKNA 4DV3K 2P9UA 4E1NA 4QAGA 1QVGM 3SJJA 3PX0A 1LAWA 5I42A 3O4WA 1Q82O 1NWKA 4RW4A 5AQKA 2DFEA 3G71N
chains in the Genus database with same CATH topology
4JNEA 2P9LA 1ZXOA 1MA9B 5M1OA 4K42A 4MDBA 3TTDA 1NLVA 4I6MA 3KVGA 4IEIA 1VQNN 4BRHA 5M1NA 1P90A 2RE2A 4B1WB 5AZJB 2F7TA 3HOTA 2PFUA 3K9KA 3WEEB 3BP8A 3R6MA 4BVOA 4DQ8A 3MK6A 2NRWA 4YOYA 2E2OA 1QHAA 4BQZA 2WFBA 4C23A 3L0QA 3VETA 3KWGA 1S3XA 1N8RO 2KKZA 3VGMA 1QQOA 4MLEA 2CGJA 5CHIA 1NM1A 4K43A 4BR9A 5LJVA 3VMFB 1HJOA 4MO5A 3R9PA 3P4IA 4BRKA 4CZIA 3R3LA 1YXQA 4K41A 3OBWA 2I7PA 5JICA 2CGLA 2ZWHA 3ULEB 4FWNA 4WQ4C 4B1XB 2HOEA 3UE5A 3KK7A 3H6EA 1K73O 3VERA 2Q31A 3GG4A 1GLFO 3MMVA 3RSEA 1BDGA 1BWFO 4QS7A 3VF6A 3CETA 3H3OB 4RTFD 2NRXA 3WXLA 3O6WA 2P9KB 4IJAA 4MDAA 1HUXA 2BTFA 3MWTA 1BO5O 1NGJA 3DXKA 3FFKB 3GL1A 3H3NO 3LDLA 5AQFA 4BGBA 5B8HA 3PIPL 4B1ZA 1MDUB 1TUUA 2OTJN 4WQ4A 4A5BA 5KPRA 3VENA 1K8KB 4GNIA 3VTHA 4BC3A 3U9DA 4NLCA 2GEMA 4KBOA 3IKMA 2ITMA 4BQLA 3NVKA 4IEEA 3AARA 3R1XA 3R8EA 3VEYA 5M1FA 2QA4N 2FF3B 4OO1J 5FPMA 1YF5L 1XC3A 3CPEA 3J8AA 3DAWA 2E2PA 1NGBA 2NRRA 2P9IB 4JKDA 1TYQA 4ILHA 4DCHA 1BA1A 2W40A 4IOXA 3SBTA 3E66A 3MDQA 3CI5A 4JKCA 3IFRA 2Q0UA 3ENBA 3CCSN 1NGHA 2GTDA 4FWPA 4I6MB 3BF1A 5FPNA 4BRLA 1KD1O 1WOQA 3AGRA 3CCUN 3LDPA 3CCJN 1EQYA 4JKHA 3ZETA 4JK8A 3IDHA 2DPNA 1RGIA 1X9JA 1M1KO 3GE1A 2PBDA 4RCHA 5MLCQ 5ADXH 2FXUA 4NO7A 2IVOA 4OPAA 5EXWA 4A2AA 3ID6A 4WFBL 5E84A 4MLHA 3WUHA 3EKSA 3ZYYX 4DHYA 2HF3A 3C7NA 3TTCA 3CCQN 1RDWX 3QICA 2QWMA 3GOIA 5TKYA 2P9NA 1HKCA 3HRGA 4FOIA 5AQQA 3QB0A 4H0OA 4EFHA 1OVYA 2IVNA 3OBYA 2OTLN 3WXJA 5JVHL 2WC9A 1HX1A 1ATSA 2VGNA 1DT9A 4BRFA 3DJCA 4DKWA 4FWOA 5GAGP 1RFQA 2A42A 1U2VA 2VGMA 3QFPA 1Y64A 4FPAA 3D2FA 1V4TA 3F2KA 1ILYA 3RVCA 2WBNA 4K25A 3A5LC 5BPLA 1VQ8N 5BRDA 4FSVA 3CF5L 1VQMN 3PLAA 4EHUA 2YHYA 4FO0A 4BC2A 3J7ZO 1KC8O 2E2NA 3LM2A 2OANA 4XH1A 4G9ZA 2CGKA 5AQYA 5AZIB 4IZ9A 3B8AX 5C10A 1VQLN 5GAEP 4BRQA 1HKBA 3CIPA 3U9ZA 2NNWA 4JEPA 1RDUA 2YI1A 2P9PA 3JS6A 4KH4A 3W3DA 4BRPA 3WXIA 4L3QA 3CJ9A 1MWMA 1Q7YO 1XQSC 3QFUA 4YDUA 2FLOA 2HBJA 1IG8A 2UYTA 5F2RA 2QXLA 2E1ZA 4PL7A 3CXCM 5I9EB 5KPZA 4A5AA 3K9JA 4A57A 4U67L 2ZF5O 3O9RA 4PKIA 5CR4A 5HL7L 1YITN 4ISGA 1VQKN 3E9OA 1HPMA 5M1KA 4FWRA 4JKGB 4BR4A 4A62A 2HBMA 3ZX0A 3CMEN 4JKEA 4B1YB 4AM7A 3G6EN 4JD2B 4BRMA 5F0XA 1OKJA 1T6CA 4WQ5A 3TSQA 3G71N 2QWNA 1Q18A 3VGKA 1CZAN 5BN8A 1JCEA 3DWLA 3LDOA 5AQGA 3AGKA 3OW2M 2HF4A 4JAXA 3UB5A 4LC9B 5DM7L 4YOWA 1QZ5A 2I7NA 4NLBA 2E88A 1HLUA 4C1NK 4CZFA 2ZJRL 3TSUA 3VF4A 4BR2A 2Q36A 4Y0WA 1ZBSA 2QM1A 4BRAA 1XUPO 2NRVA 3SLCA 3VF2A 3AAQA 2KHOA 4JKAA 3FR0A 1KAZA 4A59A 4C1NI 1SQKA 1NGDA 2QWPA 3OA9A 3WT0A 4IOAL 3SMPA 3I56N 2D4WA 4BC5A 3D2FB 4FWKA 4YOTA 3WQUA 5BPNA 3ZEUA 3P38A 5AQWA 5FPEA 3Q7BA 4BG9A 1U6ZA 4WYBA 3WQTA 4EHTA 1X3NA 4IWVA 5EOYA 4BROA 1VQ4N 4B1VA 3L4QA 3MX5A 3DXMA 1P8ZA 2Q97A 2P9UB 2HBKA 3P39A 1M90O 1T6DA 3L6QA 4JHDA 5BN9A 1G99A 5ELZA 1QVFM 2E1YA 1NGAA 2GELA 4CZMA 4PHTX 4CZLA 1NGIA 4JN4A 3CCMN 3MX2A 5EX5A 3O9UA 2JWKA 1H1VA 4FL9A 5BPMA 2V7ZA 5AQRA 2P9LB 1DKGD 2H3GX 3OHRA 3QBXA 4H0XB 4HTLA 3TTFA 5E26A 5GIPA 3CC4N 4F9OA 5AQTA 5GIOA 4IXCA 1NGGA 1R59O 3CD6N 4H0PA 1ATNA 1E4GT 3NVMA 4O5FA 3LDNA 4IFEA 4MO4A 3VOVA 3CERA 4BG8A 1YHQN 4M7XA 2ZGZA 3CQYA 2VCPA 3CJ1A 5LJWA 2FSJA 2PAVA 3H1QA 5C2FA 3HBTA 1V4SA 4J8FA 3H46O 4PKHA 4ISEA 3D2EA 4IJNA 3M6GA 5AQHA 4AF1A 3I55N 1NMDA 4H5VA 4E1JA 1ZC6A 2J4RA 1W97L 2QW9A 3UKUA 1VQ5N 3IUCA 3EL2A 4FWSA 2Q0RA 4CZEA 3PIOL 2CH6A 4HWIA 3C6HA 3E9PA 4BRDA 2F9TA 5AZJA 3JXUA 5AQMA 2W41A 3CJBA 3WEEA 5AQIA 2A41A 5C0YA 3VEOA 2VYPA 2A3ZA 2YX6A 5ADXA 3S41A 1J6ZA 1YVNA 1Z6RA 4ILJA 4O8UA 3RSEB 5FPDA 4BREA 3NMUA 1SAZA 5BREA 3HTVA 2ZJPL 2Q1NA 4ILGB 1DEJA 1BA0A 4CZJA 3SK3A 3TSPA 3SAGA 4FWLA 3CJCA 1VAZA 3DXKB 3QMLA 3CCEN 1GLAG 2FSKA 5AQUA 3MN7A 3CMAN 1VQON 4JK7A 4IDHA 3ULEA 1YAGA 3CCVN 4GV3A 2ZGYA 3VEXA 4BRNA 5GADP 4YDUC 1YUWA 4GY2B 3DXMB 5GAHP 4O8KA 4H5NA 4BR7A 4JHDB 4NB4A 4CD1A 3L4IA 3H45C 5M1QA 4PKGA 1TYQB 3G4SN 4GV6A 3M3ZA 1DGKN 3C0BA 2ZJQL 3BF3A 1BOTO 2V7YA 3A5MC 1TUYA 4H03B 1K8KA 1QZ6A 2QWOA 3A5NC 3ENHA 3HM8A 3I33A 3SJHA 3QDKA 1GLLO 3VESA 4CZGA 1IJJA 1GLJO 3I8BA 4QS9A 4WQ5C 3ZETB 4WFNL 5AQOA 4H0TB 3H1VX 4BC4A 3SBGA 3KHYA 3ATVA 3MWPA 4FWMA 2QWLA 1BG3A 3W0LA 3ZX2A 2D0OA 5F1XA 3DLLL 1Q81O 2BH1A 1K8AO 2ASPA 3BUZB 3SAHA 1GLCG 4GVEA 2A6AA 3ZX3A 4IO9L 1O13A 2P9IA 3E9LA 2E20A 5DM6L 5M1PA 3C7NB 3EN9A 4ISFA 3VEZA 2Q2RA 2D0PA 2P9SA 1JJ2M 1GLEG 2ASOA 3FE1A 4QS8A 2P9NB 2D1KA 4JK9A 5BRHA 4BGAA 4BR5A 2AA4A 3D7EO 5LY3A 4CJ7A 2VWBA 3SMSA 3WXKA 2NLXA 3EKUA 4FWQA 1LOTB 2IVPA 3FGUA 2YJFA 2V52B 3D6RA 5C2DA 1K9MO 3O80A 3MN6A 5CE3A 5AQNA 3QBWA 4CBWA 2GWKA 3FZLA 1S22A 3FZHA 4B9QA 1QQNA 4BRGA 3O8MA 4M63C 3O9TA 4DB3A 2ASMA 4A2BA 1U2VB 4WFAL 3MN5A 2FF6A 5EVZA 1QQMA 2EWSA 3A5OC 4FPBA 1MWKA 2HSTA 1NGEA 5AQZA 4EIAA 3A0IX 2QWQA 3O08A 4KH5A 4GV9A 3CJAA 1E4FT 3CC7N 1EO1A 1BUPA 2JWLA 3VEWA 2QI2A 1S72N 5AQJA 1SZ2A 2P9PB 4YOUA 3VEVA 5KPTA 3ENOA 4JKFA 3GBTA 4YORA 3UKRA 2KLAA 1YJ9N 2NRZA 3CQXA 1W2BM 4BRCA 1GLDG 3FZFA 4CI6A 3O9QA 3KWIA 4UY8O 3CPWM 3C65A 4CBUA 4BY9C 1VQPN 3CC2N 4OPHA 3ATUA 2YHWA 2HMPA 3U8XA 1YJNN 2QTDA 1Z05A 2V51B 5AZIA 1VQ9N 1NGCA 2F9WA 1D4XA 2E2QA 5C15A 1ESVA 2AP1A 3N4PA 1T3VA 3MN9A 4FOEA 4XEIA 4IO8A 3EE9A 3T69A 4H0VB 3WXMB 5C12A 4U7BA 4A61A 5JMVA 5BRFA 1SS6A 4PL8A 2QEXN 3CCLN 2P9SB 3KZBA 4XH4A 5KQ8A 2NRHA 5AQLA 3M5RA 3A8YA 3G25A 3VGLA 2NZTA 3CCRN 2A5XA 4KH6A 3AAPA 1KQSM 3SAFA 1C0GA 1LCUA 2GWJA 3FZKA 1KAXA 3TU5A 3FZMA 5AQPA 3EZWA 3EO3A 4H5WA 5EY4A 2RHKA 2YCHA 3LL3A 5H1SQ 1KXPA 3BEXA 4BRIA 4H0YB 3HI0A 4JKGA 3M1FA 3ID8A 4B1UB 3VPZA 3P31A 1KAYA 3VTIA 4R79A 5BR9A 4BR0A 1X3MA 4JD2A 2A40A 4CZKA 4WCEL 1BU6O 5AQSA 4JKBA 1HKGA 4CBXA 2E8AA 4H5TA 3O1BA 5GINA 3ZEUB 3F5TA 3FLCO 2GUPA 5AFUH 3CHWA 4WF9L 3LM9A 1VQ6N 3N4QA 4CZHA 1JCGA 2CH5A 1ATRA 1NBWA 3EE8A 1C0FA 4BVPA 3T7ZA 5AQVA 3IMXA 3Q7CA 2GX9A 4YOVA 2P9KA 3HZ6A 2HBLA 2YHXA 1NGFA 2BUPA 3O9SA 3LDQA 5AQXA 5JLFA 5HOOA 3TPQA 2WUSA 3UKRB 1NJIO 5TKWA 1YI2N 2YJEA 5AFUA 4AM6A 3U4LA 4YOXA 5KQDA 2IIRA 3CJ7A 1WUAA 2QWRA 4IOCL 3F9MA 3E1YA 2NRTA 4M7YA 3C6AA 1GLBG 4EAHD 1JCFA 1YJWN 2P9UA 4XH5A 5AR0A 3MCPA 3O5BA 4FVUA 3HSCA 1T44A 3GDQA 3AY9A 5JVGL 1QVGM 3D2EB 3MCAB 4RWTA 3O4WA 3O1WA 1NWKA 2FSNA 4H5RA 4CD3A 5JLHA 3HOSA 1YIJN 5AQKA 1Q82O 1Q86O 3UKUB 4Z94A 1VQ7N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JNE A;  2P9L A;  1ZXO A;  1MA9 B;  4K42 A;  1NLV A;  4I6M A;  3KVG A;  4BRH A;  4B1W B;  5AZJ B;  3WEE B;  3BP8 A;  3R6M A;  4BVO A;  4DQ8 A;  3MK6 A;  2E2O A;  1QHA A;  4BQZ A;  4C23 A;  3L0Q A;  3VET A;  1S3X A;  3VGM A;  1QQO A;  4MLE A;  2CGJ A;  1NM1 A;  4K43 A;  4BR9 A;  5LJV A;  1HJO A;  4MO5 A;  3R9P A;  3P4I A;  4BRK A;  4CZI A;  1YXQ A;  4K41 A;  2I7P A;  5JIC A;  2CGL A;  2ZWH A;  3ULE B;  4FWN A;  4WQ4 C;  4B1X B;  2HOE A;  3UE5 A;  3H6E A;  3VER A;  2Q31 A;  3GG4 A;  1GLF O;  3MMV A;  3RSE A;  1BDG A;  1BWF O;  4QS7 A;  3VF6 A;  3CET A;  3H3O B;  4RTF D;  3WXL A;  3O6W A;  2P9K B;  4IJA A;  1HUX A;  2BTF A;  1BO5 O;  1NGJ A;  3DXK A;  3FFK B;  3GL1 A;  3H3N O;  3LDL A;  5AQF A;  4BGB A;  5B8H A;  4B1Z A;  1MDU B;  1TUU A;  4WQ4 A;  5KPR A;  3VEN A;  1K8K B;  4GNI A;  4BC3 A;  3U9D A;  2GEM A;  4KBO A;  2ITM A;  4BQL A;  3AAR A;  3R8E A;  3VEY A;  2FF3 B;  5FPM A;  1XC3 A;  3J8A A;  3DAW A;  2E2P A;  1NGB A;  2P9I B;  1TYQ A;  4DCH A;  1BA1 A;  2W40 A;  3MDQ A;  3CI5 A;  3IFR A;  2Q0U A;  1NGH A;  2GTD A;  4FWP A;  4I6M B;  3BF1 A;  5FPN A;  4BRL A;  1WOQ A;  3LDP A;  1EQY A;  3ZET A;  3IDH A;  2DPN A;  1RGI A;  1X9J A;  3GE1 A;  2PBD A;  4RCH A;  5ADX H;  2FXU A;  4NO7 A;  2IVO A;  5EXW A;  4A2A A;  5E84 A;  4MLH A;  3WUH A;  3EKS A;  4DHY A;  2HF3 A;  3C7N A;  1RDW X;  3QIC A;  2QWM A;  3GOI A;  5TKY A;  2P9N A;  1HKC A;  4FOI A;  5AQQ A;  3QB0 A;  4H0O A;  4EFH A;  2IVN A;  3WXJ A;  1HX1 A;  1ATS A;  4BRF A;  3DJC A;  4FWO A;  1RFQ A;  2A42 A;  1U2V A;  3QFP A;  1Y64 A;  4FPA A;  3D2F A;  1V4T A;  4K25 A;  3A5L C;  5BPL A;  5BRD A;  4FSV A;  4EHU A;  2YHY A;  4FO0 A;  4BC2 A;  2E2N A;  3LM2 A;  2OAN A;  4XH1 A;  2CGK A;  5AQY A;  5AZI B;  4IZ9 A;  3B8A X;  4BRQ A;  1HKB A;  3CIP A;  3U9Z A;  2YI1 A;  3JS6 A;  2P9P A;  3W3D A;  4BRP A;  3WXI A;  4L3Q A;  3CJ9 A;  1MWM A;  1XQS C;  3QFU A;  4YDU A;  2FLO A;  1IG8 A;  2UYT A;  5F2R A;  2QXL A;  2E1Z A;  4PL7 A;  5I9E B;  5KPZ A;  2ZF5 O;  4PKI A;  4ISG A;  1HPM A;  4FWR A;  4BR4 A;  4A62 A;  3ZX0 A;  4B1Y B;  4AM7 A;  4JD2 B;  4BRM A;  5F0X A;  1OKJ A;  1T6C A;  4WQ5 A;  2QWN A;  1Q18 A;  3VGK A;  1CZA N;  5BN8 A;  1JCE A;  3DWL A;  3LDO A;  5AQG A;  2HF4 A;  4JAX A;  3UB5 A;  4LC9 B;  1QZ5 A;  2I7N A;  4CZF A;  2E88 A;  1HLU A;  3VF4 A;  4BR2 A;  2Q36 A;  4Y0W A;  1ZBS A;  2QM1 A;  4BRA A;  1XUP O;  3SLC A;  3VF2 A;  2KHO A;  3AAQ A;  3FR0 A;  1KAZ A;  1SQK A;  1NGD A;  2QWP A;  3WT0 A;  3SMP A;  2D4W A;  4BC5 A;  3D2F B;  4FWK A;  3WQU A;  5BPN A;  3ZEU A;  5AQW A;  5FPE A;  4BG9 A;  1U6Z A;  4WYB A;  3WQT A;  4EHT A;  1X3N A;  4IWV A;  5EOY A;  4BRO A;  4B1V A;  3DXM A;  1P8Z A;  2Q97 A;  2P9U B;  1T6D A;  3L6Q A;  4JHD A;  5BN9 A;  1G99 A;  5ELZ A;  2E1Y A;  1NGA A;  2GEL A;  4CZM A;  4CZL A;  1NGI A;  4JN4 A;  5EX5 A;  4FL9 A;  1H1V A;  5BPM A;  2V7Z A;  5AQR A;  2P9L B;  1DKG D;  2H3G X;  3OHR A;  3QBX A;  4H0X B;  4HTL A;  5E26 A;  4F9O A;  5AQT A;  4IXC A;  1NGG A;  1R59 O;  4H0P A;  1ATN A;  1E4G T;  4O5F A;  3LDN A;  4MO4 A;  4BG8 A;  3VOV A;  3CER A;  4M7X A;  3CQY A;  2ZGZ A;  2VCP A;  3CJ1 A;  5LJW A;  2FSJ A;  2PAV A;  3H1Q A;  3HBT A;  1V4S A;  4J8F A;  3H46 O;  4PKH A;  4ISE A;  3D2E A;  4IJN A;  3M6G A;  5AQH A;  1NMD A;  4H5V A;  4E1J A;  1ZC6 A;  2J4R A;  2QW9 A;  3UKU A;  3IUC A;  3EL2 A;  4FWS A;  2Q0R A;  4CZE A;  2CH6 A;  4HWI A;  4BRD A;  2F9T A;  5AZJ A;  3JXU A;  5AQM A;  2W41 A;  3CJB A;  3WEE A;  5AQI A;  2A41 A;  3VEO A;  2VYP A;  2A3Z A;  5ADX A;  3S41 A;  1J6Z A;  1YVN A;  1Z6R A;  3RSE B;  5FPD A;  4BRE A;  1SAZ A;  5BRE A;  3HTV A;  2Q1N A;  1DEJ A;  1BA0 A;  4CZJ A;  3SK3 A;  4FWL A;  3CJC A;  3DXK B;  3QML A;  1GLA G;  2FSK A;  5AQU A;  3MN7 A;  3ULE A;  1YAG A;  2ZGY A;  3VEX A;  4BRN A;  4YDU C;  1YUW A;  4GY2 B;  3DXM B;  4O8K A;  4H5N A;  4BR7 A;  4JHD B;  4NB4 A;  4CD1 A;  3L4I A;  3H45 C;  4PKG A;  1TYQ B;  3M3Z A;  1DGK N;  3C0B A;  3BF3 A;  1BOT O;  2V7Y A;  3A5M C;  1TUY A;  4H03 B;  1K8K A;  1QZ6 A;  2QWO A;  3A5N C;  3ENH A;  3HM8 A;  3I33 A;  3SJH A;  3QDK A;  1GLL O;  3VES A;  4CZG A;  1IJJ A;  1GLJ O;  3I8B A;  4QS9 A;  4WQ5 C;  3ZET B;  5AQO A;  4H0T B;  3H1V X;  4BC4 A;  3KHY A;  3ATV A;  4FWM A;  2QWL A;  1BG3 A;  3W0L A;  3ZX2 A;  2D0O A;  5F1X A;  2ASP A;  3BUZ B;  1GLC G;  3ZX3 A;  2A6A A;  2P9I A;  2E20 A;  3C7N B;  3EN9 A;  4ISF A;  3VEZ A;  2Q2R A;  2D0P A;  2P9S A;  1GLE G;  2ASO A;  3FE1 A;  4QS8 A;  2P9N B;  2D1K A;  5BRH A;  4BGA A;  4BR5 A;  2AA4 A;  3D7E O;  5LY3 A;  4CJ7 A;  2VWB A;  3SMS A;  3WXK A;  2NLX A;  3EKU A;  4FWQ A;  1LOT B;  2IVP A;  3FGU A;  2YJF A;  2V52 B;  3O80 A;  3MN6 A;  5CE3 A;  5AQN A;  3QBW A;  4CBW A;  2GWK A;  3FZL A;  1S22 A;  3FZH A;  4B9Q A;  1QQN A;  4BRG A;  3O8M A;  4M63 C;  4DB3 A;  2ASM A;  4A2B A;  1U2V B;  3MN5 A;  2FF6 A;  5EVZ A;  1QQM A;  2EWS A;  3A5O C;  4FPB A;  1MWK A;  1NGE A;  5AQZ A;  4EIA A;  3A0I X;  2QWQ A;  3O08 A;  3CJA A;  1E4F T;  1BUP A;  3VEW A;  5AQJ A;  1SZ2 A;  2P9P B;  3VEV A;  5KPT A;  3ENO A;  3GBT A;  3UKR A;  3CQX A;  4BRC A;  1GLD G;  3FZF A;  4CI6 A;  4CBU A;  3ATU A;  2YHW A;  2HMP A;  3U8X A;  1Z05 A;  2V51 B;  5AZI A;  1NGC A;  2F9W A;  1D4X A;  2E2Q A;  1ESV A;  2AP1 A;  4FOE A;  3MN9 A;  4XEI A;  4IO8 A;  4H0V B;  4A61 A;  5JMV A;  5BRF A;  4PL8 A;  2P9S B;  3KZB A;  4XH4 A;  5KQ8 A;  2NRH A;  5AQL A;  3A8Y A;  3G25 A;  3VGL A;  2NZT A;  2A5X A;  3AAP A;  1C0G A;  1LCU A;  2GWJ A;  3FZK A;  1KAX A;  3TU5 A;  3FZM A;  5AQP A;  3EZW A;  3EO3 A;  4H5W A;  5EY4 A;  2YCH A;  3LL3 A;  1KXP A;  3BEX A;  4BRI A;  4H0Y B;  3HI0 A;  3M1F A;  3ID8 A;  4B1U B;  3VPZ A;  1KAY A;  5BR9 A;  4BR0 A;  1X3M A;  4JD2 A;  2A40 A;  4CZK A;  1BU6 O;  5AQS A;  1HKG A;  4CBX A;  2E8A A;  4H5T A;  3O1B A;  3ZEU B;  3FLC O;  2GUP A;  5AFU H;  3CHW A;  3LM9 A;  4CZH A;  1JCG A;  2CH5 A;  1ATR A;  1NBW A;  1C0F A;  4BVP A;  5AQV A;  3IMX A;  2P9K A;  3HZ6 A;  2YHX A;  1NGF A;  2BUP A;  5AQX A;  3LDQ A;  5JLF A;  3TPQ A;  2WUS A;  3UKR B;  2YJE A;  5AFU A;  4AM6 A;  3U4L A;  5KQD A;  2IIR A;  3CJ7 A;  1WUA A;  2QWR A;  3F9M A;  4M7Y A;  1GLB G;  4EAH D;  1JCF A;  2P9U A;  4XH5 A;  5AR0 A;  3MCP A;  3O5B A;  3HSC A;  1T44 A;  3GDQ A;  3AY9 A;  3D2E B;  4RWT A;  3O4W A;  3O1W A;  1NWK A;  2FSN A;  4H5R A;  4CD3 A;  5JLH A;  5AQK A;  3UKU B;  4Z94 A; 
#chains in the Genus database with same CATH topology
 2Z1G A;  3BZC A;  4CEQ A;  4I6M A;  3SQ4 A;  4BRH A;  2ITG A;  4CJW A;  3MK6 A;  3L0Q A;  5C42 A;  4MLE A;  4K43 A;  3OS0 A;  3P4I A;  1YXQ A;  4I9Q A;  3OBW A;  4CJU A;  1S6Q A;  4KI4 A;  2ZWH A;  4B1X B;  4FWN A;  4OPJ A;  3UE5 A;  1W7A A;  3DLK A;  1K73 O;  3VER A;  3RSE A;  3DRS A;  5HRO A;  3CET A;  3H3O B;  3WXL A;  2BTF A;  2A1S A;  1NGJ A;  3GL1 A;  4BGB A;  3LDL A;  4KV8 A;  2OPP A;  3PIP L;  4AIL C;  2OTJ N;  3LP1 A;  3JYT A;  3VQQ A;  3K58 A;  3VTH A;  3QNN A;  3V6D A;  4IEE A;  4FJI A;  2YNH A;  3VEY A;  2QA4 N;  1EWQ A;  2O8E B;  1XC3 A;  2IGI A;  3CPE A;  3DAW A;  1NGB A;  4JKD A;  1TYQ A;  5HRN A;  3VQP A;  4E7H A;  4IOX A;  3E66 A;  3IFR A;  3ENB A;  4FWP A;  1KD1 O;  1BIZ A;  3S3O A;  1NK7 A;  1NJY A;  1YT3 A;  3IDH A;  4DR3 K;  4CEB A;  3L2U A;  5EXW A;  3CM5 A;  1WSI A;  3AV9 A;  3C7N A;  2YNI A;  2IDO A;  4B9M A;  3GOI A;  3U3Y A;  1HKC A;  4HUE A;  3HST B;  1NKC A;  4ID5 A;  1BHL A;  1JL2 A;  2OTL N;  3WXJ A;  4B3O A;  3ZSY A;  1T8E A;  1HX1 A;  2HND A;  2VGN A;  4BRF A;  1RBU A;  3AVG A;  5GAG P;  1HQU A;  3WNE A;  1U2V A;  1Y64 A;  4FPA A;  3M8Q A;  3I0R A;  4DSF A;  3NGI A;  1VQM N;  2FBX A;  1VQ8 N;  3IAY A;  2BGG A;  2YHY A;  4B3R K;  4FO0 A;  4BC2 A;  4PWD A;  3OYM A;  4Q0B A;  2E2N A;  3LM2 A;  4G9Z A;  4XH1 A;  2CGK A;  5AQY A;  3DLE A;  3QET A;  4M42 A;  4TSX A;  4YFU A;  3SQ0 A;  2P9P A;  4Z4G A;  4JI0 K;  4OVL A;  1D9F A;  3P1G A;  4YDU A;  4LH5 A;  3QLH A;  2E1Z A;  4PL7 A;  4CJP A;  5LMU K;  3TI0 A;  3K9J A;  4AHR A;  4U67 L;  2UUC K;  3O9R A;  1JLG A;  4J2E A;  4KRF A;  3TAM A;  4CE9 A;  3ZX0 A;  4CK2 A;  4AM7 A;  4KFB A;  4KTQ A;  3MXI A;  3O3H A;  3TSQ A;  4LF6 K;  2QWN A;  4M3T A;  1JCE A;  3LDO A;  4JI4 K;  3HVR A;  2HHW A;  4CVN E;  4CJR A;  4YOW A;  5SZT A;  4CJ5 A;  4NLB A;  1HLU A;  1NMN A;  4KAZ A;  3VQ7 A;  3TSU A;  3RWU A;  4B9V A;  4Y0W A;  4OKK A;  3FR0 A;  1NGD A;  1OH7 A;  4KHN A;  4H4O A;  3BGR A;  4YOT A;  1S1X A;  5FPE A;  4BG9 A;  1U6Z A;  3WQT A;  3VN5 A;  4EHT A;  2F8S A;  4BRO A;  1VQ4 N;  4B8A B;  1NKE A;  2HBK A;  2X74 A;  3ZT0 A;  1T6D A;  1WSG A;  2O4G A;  3NF8 A;  2IAJ A;  2GEL A;  1NGI A;  4JN4 A;  3OYJ A;  3S9H A;  4C8M A;  2D0C A;  3TTF A;  1HNI A;  1DKG D;  2H3G X;  3MED A;  5GIP A;  4F9O A;  5AQT A;  1NGG A;  1WSH A;  2FBT A;  1ATN A;  1HNX K;  3DLH A;  4DWI A;  2O8C B;  1EXQ A;  4IFE A;  4BG8 A;  1YHQ N;  4DF8 A;  2ZGZ A;  4DSL A;  4F2S A;  1G15 A;  5C2F A;  3HBT A;  1RBS A;  4PKH A;  3I55 N;  4FJM A;  4H5V A;  1Q8I A;  2QW9 A;  4CJV A;  3IUC A;  3EL2 A;  1L3V A;  3AO2 A;  2E4L A;  3C6H A;  4B9S A;  5J2Q A;  1ZBU A;  2O8F B;  2W41 A;  2IC3 A;  1IO2 A;  3TAF A;  4OGE A;  3WEE A;  1VSK A;  5C0Y A;  4UQG A;  2VYP A;  2O8D A;  2YX6 A;  1Z6R A;  2VG6 A;  4PY5 A;  2Q1N A;  1BA0 A;  1U04 A;  4H4M A;  1KVA A;  3V9W A;  4N41 A;  3OJU A;  1UAX A;  3VA0 A;  5C24 A;  4KO0 A;  1FKP A;  3SUP A;  1SL1 A;  3ULE A;  5SWM A;  3KLF A;  3CCV N;  4GV3 A;  3K5M A;  3VQE A;  1TK0 A;  3DXM B;  3HL8 A;  1D5A A;  4NCA A;  3G4S N;  1NG9 A;  2O4I A;  3M3Z A;  2ZJQ L;  3OS2 A;  4H03 B;  1K8K A;  1QZ6 A;  1J9A A;  3CCE N;  3AO5 A;  4X65 K;  3QDK A;  1GLL O;  3VES A;  3UIQ A;  4WQ5 C;  4DSI A;  3KHY A;  3LWM A;  2QWL A;  3DI6 A;  2D0O A;  2WOM A;  3PX6 A;  1HNW K;  4BWJ A;  1BI4 A;  3E9L A;  4LD0 A;  2E20 A;  4ISF A;  3VEZ A;  1XMQ K;  3ZLJ A;  1QQC A;  4QS8 A;  1XC9 A;  2D1K A;  2FBV A;  4JK9 A;  2AA4 A;  3D7E O;  3EKU A;  5C2D A;  4IG0 A;  1FXX A;  3MN6 A;  3LDS A;  3FZL A;  4CER A;  1T7P A;  1C0M A;  4OPK A;  2ETJ A;  1S22 A;  4W5R A;  3FZH A;  4B9Q A;  5JS2 A;  1NJZ A;  1QQN A;  4EP4 A;  5KTQ A;  1NKB A;  4A2B A;  4WFA L;  1QQM A;  2EWS A;  1MWK A;  1OH8 A;  3IS9 A;  4GV9 A;  4YOU A;  4JKF A;  3GBT A;  3UKR A;  2KLA A;  1YJ9 N;  4W5O A;  3AVL A;  1GLD G;  4CI6 A;  1O1W A;  4DSK A;  4CBU A;  1VQP N;  3CC2 N;  4DTR A;  3J81 O;  1YJN N;  1C0T A;  4EZ6 A;  1IG9 A;  5AZI A;  5LMN K;  3L2R A;  1D4X A;  1EET A;  1TL1 A;  1HPZ A;  5C15 A;  2HMI A;  1JKH A;  1TL3 A;  4CES A;  4FOE A;  1T3V A;  4NYN A;  1BQM A;  3T3F A;  3EE9 A;  1GOA A;  4H0V B;  3WXM B;  4PL8 A;  3CCL N;  1NJX A;  3P83 D;  4Z4C A;  1VSM A;  2P9S B;  3NE6 A;  2WON A;  2NRH A;  5AQL A;  2NZT A;  2A5X A;  1KQS M;  4FLT A;  1C0G A;  4BDZ A;  2GWJ A;  3FZK A;  1KAX A;  4H5W A;  4CJF A;  4H0Y B;  4JKG A;  1WAJ A;  3ID8 A;  3VPZ A;  2G8W A;  1KAY A;  1WN7 A;  1KCF A;  1RDC A;  1VSJ A;  4R79 A;  4K8Z A;  2YHA A;  4JD2 A;  1NU0 A;  3OYI A;  2HHH K;  4CEZ A;  3O1B A;  1N33 K;  2GUP A;  5AFU H;  3LM9 A;  4CZH A;  1HNZ K;  1ATR A;  4LFA K;  3EE8 A;  4CGJ A;  4CEF A;  2KZM A;  1N34 K;  1L5U A;  4KHW A;  2UXC K;  2VQE K;  4YOV A;  4NCB A;  2P9K A;  3AVB A;  2YHX A;  5AQX A;  2BUP A;  4BE1 A;  2WUS A;  1BL3 A;  3SCX A;  3U4L A;  5CYM A;  4YOX A;  1WUA A;  2QWR A;  1A5W A;  4CGF A;  2NRT A;  4DTJ A;  1JCF A;  4XH5 A;  5AR0 A;  3IG1 A;  4FJ9 A;  3H08 A;  1JLA A;  5JVG L;  2UU9 K;  1TK5 A;  3MCA B;  3RR8 A;  2FSN A;  2GUI A;  5JLH A;  1Q86 O;  1VQ7 N;  2P9L A;  1ZXO A;  5M1O A;  5KGX A;  1NLV A;  3ZSQ A;  2O8B B;  5M1N A;  1P90 A;  5AZJ B;  2F7T A;  1XNR K;  3P5J A;  5J1E A;  1QHA A;  4BQZ A;  2WFB A;  3VET A;  3KWG A;  4KHS A;  2KKZ A;  2CGJ A;  3NF7 A;  1RBT A;  3EEQ A;  3R9P A;  1HMV A;  4K41 A;  1A5V A;  3SZ2 A;  2JLE A;  2E6M A;  4WQ4 C;  2HOE A;  3SPZ A;  3VQ4 A;  1A5X A;  3H6E A;  3SUQ A;  3THY A;  2Q31 A;  4ELT A;  4QS7 A;  1BWF O;  4RTF D;  4W5Q A;  2NRX A;  3O6W A;  4IJA A;  3T1A A;  3RRH A;  3MWT A;  4JYA K;  3TAN A;  1WNS A;  3V9S A;  4F4K A;  4WQ4 A;  4JI2 K;  4M3R A;  4A5B A;  4HUF A;  2ZM6 K;  4GNI A;  3IRX A;  3U9D A;  4NLC A;  2GEM A;  4FLW A;  3IKM A;  2ITM A;  4BQL A;  3NVK A;  3K2P A;  3J7Y P;  3R1X A;  5M1F A;  2G8F A;  1IBL K;  3J8A A;  3AA2 A;  2E2P A;  2NRR A;  3B6O A;  4ILH A;  4DCH A;  1BA1 A;  3AO4 A;  3F73 A;  4CK1 A;  3CI5 A;  4JKC A;  3OYB A;  3CCS N;  1NGH A;  2GTD A;  4I6M B;  5FPN A;  4BRL A;  3NBP A;  5DK5 A;  3J80 O;  1RT7 A;  3LDP A;  4JKH A;  4JK8 A;  2DPN A;  3SV4 A;  3C6U A;  3LP2 A;  4AHS A;  3LPU A;  5ADX H;  4OPA A;  2IVO A;  4A2A A;  2FC0 A;  1C1A A;  1HYV A;  4WFB L;  4MLH A;  3EKS A;  4FLZ A;  1RT3 A;  1TAQ A;  4M3U A;  1B9F A;  1EKE A;  2BE2 A;  4KTZ A;  1XWL A;  1GOC A;  5AQQ A;  1WBB A;  1REV A;  4EFH A;  3OBY A;  1WBD A;  3SV3 A;  2WC9 A;  4Z4E A;  1RIL A;  1VSI A;  2DY4 A;  4FJG A;  3HK2 A;  4FWO A;  1RFQ A;  2VGM A;  3SYZ A;  1V4T A;  3F2K A;  2WBN A;  4YHH K;  5FRM A;  2W6K A;  3KKR A;  3CF5 L;  4O0J A;  3C95 A;  1KC8 O;  3SI6 A;  4DSJ A;  2OAN A;  4JI1 K;  4FM1 A;  1C1B A;  1IKV A;  3B8A X;  2ZQB A;  5GAE P;  4BRQ A;  3U9Z A;  1FKO A;  3JS6 A;  4C8O A;  4BRP A;  1YTU A;  3WXI A;  3CJ9 A;  3QFU A;  3TAB A;  2HBJ A;  1IG8 A;  2UYT A;  3CXC M;  5I9E B;  4AQY K;  4DFP A;  4DSE A;  5CR4 A;  1YIT N;  4F8R A;  4I9L A;  1VQK N;  3KLE A;  4FLX A;  4FWR A;  1S1U A;  5LL6 Z;  4B08 A;  4BR4 A;  4Y1C A;  4E19 A;  4CEC A;  4A62 A;  4B1Y B;  1OKJ A;  4CHZ A;  2R7Y A;  1Q18 A;  3RTV A;  4FJ5 A;  5JS1 A;  2P5O A;  3HJF A;  3EZ5 A;  4Z4I A;  4HTU A;  4NCG A;  2ATQ A;  4O44 A;  1QZ5 A;  4CZF A;  1OH6 A;  4C1N K;  3ASM A;  1ZBS A;  3TWH A;  2NRV A;  3SLC A;  1UOC A;  2E6L A;  1SQK A;  3ZSX A;  4FK2 A;  3OYH A;  4BC5 A;  3AA3 A;  4OX9 K;  4FWK A;  2IS3 A;  4BAC A;  3ZEU A;  4DTU A;  3Q7B A;  1RTH A;  2UXB K;  1QSS A;  4IWV A;  1NK0 A;  3L4Q A;  3MX5 A;  3S3N A;  3L6Q A;  4JHD A;  5BN9 A;  3PV8 A;  3VQD A;  2E1Y A;  4CZL A;  3CCM N;  4J2D A;  5EX5 A;  3O9U A;  4FL9 A;  1H1V A;  5BPM A;  2V7Z A;  3OHR A;  4H0X B;  1VSF A;  4OKE A;  4HTL A;  5E26 A;  3VA3 A;  2QK9 A;  4CJS A;  3NFA A;  4IXC A;  4W5N A;  1E4G T;  3PO4 A;  3NVM A;  3VOV A;  3ZT3 A;  4DV4 K;  4M7X A;  3CQY A;  2FSJ A;  4MQ3 A;  3HM9 A;  4FLV A;  3B6P A;  1V4S A;  4J8F A;  1TKD A;  1SV5 A;  4ID1 A;  4IJN A;  4AF1 A;  1Y97 A;  1ZC6 A;  3RMB A;  2XRI A;  1VQ5 N;  2Q0R A;  1JLF A;  1JLB A;  4HWI A;  4DR2 K;  1D9D A;  3L2W A;  2F9T A;  5AQM A;  2EHG A;  3SUN A;  2QKB A;  1TGO A;  3LAN A;  4O8U A;  3QER A;  3KKS A;  3HTV A;  1CXU A;  1DEJ A;  4KTW A;  3TSP A;  3DXK B;  2XO7 A;  1NNE A;  3QML A;  2VWJ A;  4RW8 A;  1N5Y A;  3CM6 A;  3MN7 A;  2OZS A;  1RTI A;  1RBV A;  3SQ1 A;  2ZGY A;  3VEX A;  4YDU C;  4GY2 B;  1IH7 A;  1NK9 A;  4H5N A;  1U47 A;  4DLE A;  1EX4 A;  5M1Q A;  1VHX A;  4LF7 K;  4FLY A;  4GV6 A;  4KB1 A;  1N32 K;  1RT5 A;  1BGX T;  2V7Y A;  1TUY A;  4I2P A;  1Q9Y A;  3VEN A;  3A5N C;  3SJH A;  3AVJ A;  1IJJ A;  3SPY A;  2E5L K;  3I8B A;  1ZBI A;  2KQ2 A;  3ZET B;  3H1V X;  4BC4 A;  3SBG A;  3ATV A;  4ELU A;  2O8E A;  3ZX2 A;  1Q81 O;  1K8A O;  4AHV A;  2ASP A;  4F3O A;  1GLC G;  4GVE A;  2A6A A;  3ZX3 A;  1O13 A;  1LV5 A;  3QEI A;  2XY7 A;  3LP3 A;  4IBN A;  3K59 A;  5HRP A;  2P9N B;  2B6A A;  5BRH A;  4BR5 A;  4DFK A;  4FJJ A;  1LOT B;  2IVP A;  3FGU A;  4MFB A;  3LZI A;  3D6R A;  1K9M O;  5CE3 A;  4BWM A;  4CBW A;  2GWK A;  1TAU A;  4LH4 A;  3ZCM A;  3O9T A;  3ISN C;  4FJX A;  1NOY A;  3V1Q A;  3QEP A;  3OYG A;  3WNF A;  2QXF A;  5AQZ A;  3A0I X;  4F3T A;  1MU2 A;  2OPQ A;  4DU1 A;  3CC7 N;  2AJQ A;  1BUP A;  1TV6 A;  1S1V A;  1RBR A;  2QI2 A;  3ULD A;  2DTU A;  3BZK A;  1QE1 A;  2Z1H A;  1SZ2 A;  4OJR A;  4CIG A;  3NCI A;  4FXD A;  2HHT A;  3ZT2 A;  2GV9 A;  4BRC A;  2G8H A;  4LF9 K;  2VG7 A;  4FJH A;  4FLU A;  3THX B;  4OPH A;  3OYE A;  2QTD A;  2YNF A;  1Z05 A;  2V51 B;  1T05 A;  1NGC A;  2F9W A;  4DUY K;  2E2Q A;  5EU7 A;  4N56 A;  4Q5V A;  4HCB A;  3T69 A;  4XEI A;  2Y1J A;  4IO8 A;  1JLC A;  4U7B A;  4YNQ A;  2UXD K;  5JMV A;  2HHU A;  5BRF A;  2QEX N;  3KZB A;  4XH4 A;  3M5R A;  3A8Y A;  1CXQ A;  1RTJ A;  3G25 A;  4LSN A;  1KFD A;  4DQP A;  3M8R A;  5AQP A;  4CW7 B;  3EZW A;  1JLQ A;  5EY4 A;  4DQQ A;  1S9G A;  1TKX A;  3HO1 A;  1BCM A;  4BRI A;  4Z4F A;  3QIP A;  2VWK A;  3HXM A;  5BR9 A;  4BR0 A;  2A40 A;  4CHO A;  1ZYQ A;  4H5T A;  1IKX A;  5GIN A;  3F5T A;  3NHG A;  3OVN A;  4WF9 L;  1VQ6 N;  1ASW A;  1YTA A;  1C6V A;  1NBW A;  5KI6 A;  3OYA A;  3T7Z A;  1WLJ A;  1KFS A;  2GX9 A;  3AVA A;  3HT3 A;  5J2P A;  4PUO A;  3UKR B;  2YHB A;  1XHX A;  5AFU A;  3DYA A;  2IIR A;  3JSM A;  4LSL A;  2G8V A;  1GLB G;  4EAH D;  1YJW N;  1RDA A;  3MCP A;  3O5B A;  4O5B A;  1T44 A;  1JLE A;  3AY9 A;  3GDQ A;  4FW1 A;  3D2E B;  4DV0 K;  3THW B;  3UKU B;  3TAQ A;  1HRH A;  1DTQ A;  3TTD A;  1MA9 B;  3NH1 A;  3THV A;  1VQN N;  2P51 A;  4JI5 K;  1N36 K;  3CQ8 A;  2RE2 A;  1FW6 A;  3BP8 A;  3R6M A;  4JLH A;  2F96 A;  4BVO A;  3U6F A;  4DQ8 A;  3EYZ A;  4YOY A;  2E2O A;  4OKJ A;  1N8R O;  1NM1 A;  5LJV A;  3VMF B;  1HJO A;  3DOK A;  3LWL A;  4MO5 A;  4BRK A;  1W0H A;  4NYF A;  4CJT A;  2I7P A;  4FJ8 A;  5JIC A;  2CGL A;  4QCL A;  1VRU A;  4E7K A;  3KK7 A;  2O8F A;  1ZBF A;  2XY8 A;  3GG4 A;  1GLF O;  3MMV A;  3TAP A;  1SL0 A;  2P9K B;  4MDA A;  1HUX A;  4Z0U A;  3H3N O;  5B8H A;  4DTO A;  1RT4 A;  4B1Z A;  1MDU B;  1TUU A;  3T19 A;  4DS4 A;  4CFC A;  5HRS A;  4E7J A;  4F2R A;  4KBO A;  3F9K A;  5A2Q O;  1L3U A;  3AAR A;  2FF3 B;  5FPM A;  1YF5 L;  4NXM K;  3KIO A;  4DV5 K;  2P9I B;  4Y1D A;  3QES A;  2W40 A;  3SBT A;  3MDQ A;  3WNG A;  3OS1 A;  2Q0U A;  3BF1 A;  3K5O A;  3AGR A;  3CCJ N;  1J54 A;  4DTN A;  1VSL A;  1M1K O;  3GE1 A;  4RCH A;  4O0I A;  5MLC Q;  4IDK A;  1KVB A;  4NO7 A;  3JAM O;  1S9E A;  4FM0 A;  2RN2 A;  3ZYY X;  4C8K A;  2HF3 A;  3TTC A;  3CCQ N;  1RDW X;  4GVM A;  4BE0 A;  5TKY A;  1LWC A;  4OGC A;  4FOI A;  3QB0 A;  3THY B;  1IBK K;  1OVY A;  1BQN A;  2D0A A;  5KGW A;  3AVK A;  1ATS A;  2W6L A;  1FK9 A;  4CGH A;  4DTM A;  4DKW A;  4KB0 A;  4DV2 K;  3QFP A;  3AA5 X;  3D2F A;  3VQC A;  1HYS A;  3RVC A;  4K25 A;  3WNH A;  4KPY A;  5BRD A;  4FSV A;  5E41 A;  4EHU A;  3J7Z O;  2NUB A;  1RT1 A;  3NH2 A;  3D0P A;  2EX3 A;  4IZ9 A;  5C10 A;  3MEG A;  3CIP A;  4C8L A;  2RF2 A;  5I3U A;  4JEP A;  1RDU A;  3W3D A;  1MWM A;  1XQS C;  2FLO A;  1L3T A;  2D5R A;  4A5A A;  3S3M A;  2YKM A;  4PKI A;  3CG7 A;  3D45 A;  4FW2 A;  4ISG A;  5HRR A;  3E9O A;  1RTD A;  1HPM A;  5M1K A;  4AHC A;  4CFB A;  2HHS A;  4EZ9 A;  4FZY A;  4JKE A;  3BDP A;  5F0X A;  1T6C A;  3NH0 A;  5FDL A;  3VGK A;  1CZA N;  3DWL A;  5AQG A;  3OW2 M;  2HF4 A;  3UB5 A;  1X1P A;  3C94 A;  3I0S A;  4W5T A;  3DOL A;  3VF4 A;  4CF8 A;  3QIO A;  2QM1 A;  4BRA A;  5KRT A;  3AAQ A;  4JKA A;  4AHT A;  2KZZ A;  1KAZ A;  4C1N I;  1CLQ A;  4IOA L;  3SMP A;  2D4W A;  3AVM A;  5J2M A;  1NJW A;  4GKK K;  4CJK A;  3P38 A;  5AQW A;  4FK4 A;  4WYB A;  1S6P A;  1X3N A;  4B1V A;  1QTM A;  4M3X A;  2P9U B;  3P39 A;  3EY1 A;  1M90 O;  1G99 A;  5ELZ A;  2X6S A;  3KJV A;  1ZBL A;  4DU3 A;  4HVJ A;  5AQR A;  3QBX A;  4CJL A;  3L2V A;  1Q9X A;  5GIO A;  4KHQ A;  3LZJ A;  3CD6 N;  4H0P A;  5IT9 O;  5CY4 A;  1WSE A;  1T03 A;  3LAM A;  5LJW A;  1I39 A;  2PAV A;  3RRG A;  1X9W A;  3OYK A;  3KD5 E;  4ISE A;  3ALY A;  1NMD A;  4E1J A;  2J4R A;  1W97 L;  4JV5 K;  4FWS A;  4CZE A;  4DMN A;  3PIO L;  2CH6 A;  5C25 A;  2O8B A;  4DR1 K;  5AZJ A;  1HQE A;  3AVF A;  5AQI A;  3DM2 A;  1KSP A;  1WSF A;  1J6Z A;  1YVN A;  1B9D A;  1TKZ A;  1VSD A;  4ILJ A;  3RSE B;  3NMU A;  2HB5 A;  1UA1 A;  5BRE A;  2ZJP L;  3SAG A;  4CZJ A;  3SK3 A;  3QO9 A;  4FWL A;  1VAZ A;  3V1R A;  1LW0 A;  1GLA G;  3CMA N;  4FYD A;  1EP4 A;  3CFP A;  1XNQ K;  1VQO N;  4FCY A;  2BDP A;  3PX4 A;  4J2B A;  3K5L A;  5FRN A;  3PY8 A;  3LAK A;  4IKF A;  4K8X A;  4DQR A;  5GAD P;  3ZSZ A;  1J5O A;  4CF0 A;  3VQ8 A;  4IFY A;  4JHD B;  2OZM A;  1VRT A;  4CD1 A;  2HNZ A;  1KTQ A;  1RNH A;  3H45 C;  4PKG A;  1TYQ B;  1VSE A;  2Q3S A;  1QSY A;  1DGK N;  3C0B A;  3BF3 A;  1CZB A;  3RMC A;  2PY5 A;  3I33 A;  3ENH A;  4M41 A;  3HM8 A;  4B9L A;  1KVC A;  4WE1 A;  4KHP K;  2F4V K;  3MEC A;  1SKR A;  3KLG A;  4WFN L;  5AQO A;  3OYD A;  1SKW A;  3C6T A;  3VQ9 A;  3NGZ A;  4FWM A;  3MWP A;  3W0L A;  1BG3 A;  5F1X A;  4DUZ K;  2BH1 A;  2HNY A;  3BUZ B;  3NF9 A;  3ZT4 A;  5KRS A;  1QS4 A;  1LWE A;  1UA0 A;  5DM6 L;  4O55 A;  3C7N B;  3EN9 A;  3I8D A;  2Q2R A;  2ZE2 A;  2D0P A;  1BIU A;  3G0Z A;  4HUG A;  4CEO A;  4BGA A;  4CF9 A;  5LY3 A;  4DV7 K;  3WXK A;  2NLX A;  3QEW A;  2LSN A;  3O80 A;  2JGU A;  1EWR A;  3BY5 A;  2OPR A;  4M63 C;  2WTU A;  4B8C A;  4DB3 A;  3O3G A;  2ASM A;  1U2V B;  3MN5 A;  2FF6 A;  3PUF A;  3A5O C;  4FPB A;  1IBM K;  4DG1 A;  3RR7 A;  1JXE A;  2HST A;  4BDP A;  4CHP A;  4M3W A;  5DMR A;  3CJA A;  4KI6 A;  4YY3 K;  4H8K A;  3ZT1 A;  3MXM A;  3QEV A;  1EO1 A;  2HVI A;  2G8K A;  4M3Z A;  3VEW A;  1RCH A;  1J5E K;  1S72 N;  2P9P B;  3VEV A;  1XHZ A;  3KTQ A;  2NRZ A;  1B92 A;  1W2B M;  1NK4 A;  3FZF A;  3O9Q A;  3AO3 A;  3CPW M;  3J7A P;  4BY9 C;  2YHW A;  2HVH A;  4FJN A;  4J2A A;  1SKS A;  3N4P A;  3M8P A;  4K0K K;  3AA4 A;  5D3G A;  4RG8 A;  3V81 A;  5KQ8 A;  1DTT A;  3HYF A;  4LF5 K;  3VGL A;  3CCR N;  4KH6 A;  3SAF A;  1LCU A;  4JRP A;  4CHQ A;  4N76 A;  3TU5 A;  3HPG A;  2XY6 A;  4GMJ B;  1C1C A;  1S5J A;  2RHK A;  2YCH A;  1IKW A;  3M1F A;  4B1U B;  1X9S A;  4JI3 K;  3VTI A;  2OA8 A;  2W42 A;  1JL1 A;  4CZK A;  4WCE L;  5AQS A;  1HKG A;  4CBX A;  2E8A A;  3L8B A;  4FK0 A;  1CZ9 A;  3CHW A;  2CH5 A;  1C0F A;  4KKO A;  4CIE A;  3DRP A;  4BVP A;  5AQV A;  3HZ6 A;  2HBL A;  4E89 A;  5HOO A;  3O9S A;  1U48 A;  1NJI O;  5TKW A;  2HW3 A;  1YVU A;  4AM6 A;  3ZSR A;  4CFD A;  4ZHR A;  5FLX O;  1SUQ A;  4N47 A;  4IOC L;  3KLI A;  1Z25 A;  4B3M K;  1HYZ A;  3E1Y A;  4M7Y A;  1IV0 A;  1L3S A;  3C6A A;  4CGI A;  5T7B A;  4CED A;  4E7L A;  4FVU A;  3HSC A;  4DTS A;  4RWT A;  4FM2 A;  3O1W A;  1W9H A;  4CD3 A;  4H5R A;  3HOS A;  1YIJ N;  4CJ7 A;  3U3G A;  1ASV A;  2FBY A;  4Z94 A;  1N6Q A;  4JNE A;  3V1O A;  4K42 A;  4MDB A;  4KHU A;  3KVG A;  4IEI A;  3K0S A;  4IG3 A;  4B1W B;  4PQU A;  3DRR A;  3KK2 A;  2Z1I A;  2PFU A;  3K9K A;  3HOT A;  3WEE B;  4DU4 A;  4CF2 A;  2O8D B;  4I7F A;  2NRW A;  4C23 A;  2KW4 A;  1S3X A;  4DR5 K;  3VGM A;  1QQO A;  5CHI A;  4BR9 A;  4DQS A;  1X9M A;  3TAE A;  4ZTF A;  3KD1 E;  3L3V A;  4CZI A;  4NXN K;  3R3L A;  4CGG A;  2VQF K;  2IOC A;  5IWA K;  3ULE B;  3KK1 A;  1I3A A;  4DR4 K;  3NGY A;  1BDG A;  3VF6 A;  3TAR A;  3CFR A;  3A2F A;  1BO5 O;  3FFK B;  3DXK A;  5AQF A;  3K5N A;  2X78 A;  5BR8 K;  3MAQ A;  4E0D A;  4AH9 A;  5KPR A;  1U49 A;  1K8K B;  4BC3 A;  3ZSO A;  3DLB A;  2UUB K;  4B3T K;  1RT6 A;  3R8E A;  4E1M A;  3VQ5 A;  4CF1 A;  3HP9 A;  3V4I A;  4OO1 J;  2RKI A;  1BI4 B;  4JRQ A;  2HHQ A;  4BE2 A;  5CZ1 A;  2Z1J A;  3O4N A;  1WOQ A;  2KFZ A;  1ITG A;  3G10 A;  3CCU N;  1EQY A;  2ZD1 A;  3ZET A;  1TK8 A;  1C0U A;  1RGI A;  1X9J A;  1E3M A;  3FFI A;  4GW6 A;  2PBD A;  1KRP A;  4QOZ B;  2FXU A;  1HR0 K;  3ID6 A;  5E84 A;  3WUH A;  3K57 A;  4DHY A;  1UWB A;  3RMD A;  4CK3 A;  3KLH A;  3QIC A;  4BDY A;  2QWM A;  4X66 K;  2P9N A;  3HRG A;  2XY5 A;  2VG5 A;  4H0O A;  2IVN A;  5JVH L;  4CJ3 A;  1D8Y A;  3CFO A;  4HCC A;  1WSJ A;  3CYM A;  1DT9 A;  4C8N A;  3DJC A;  3LP0 A;  2A42 A;  1NOZ A;  1ILY A;  3A5L C;  5BPL A;  1NK5 A;  2XHB A;  4ICL A;  3PLA A;  2DFF A;  3RMA A;  4B9U A;  4HHT A;  3PSI A;  1RDD A;  5AZI B;  1VQL N;  1HKB A;  2NNW A;  2DFH A;  3ITH A;  2YI1 A;  4KH4 A;  2P1J A;  4L3Q A;  4CEA A;  1Q7Y O;  3DLR A;  4KHY A;  5F2R A;  2QXL A;  2OPS A;  5KPZ A;  3THX A;  3AO1 A;  2O8C A;  3E01 A;  1K6Y A;  4A57 A;  2ZF5 O;  5HL7 L;  3AVH A;  4JI6 K;  5K14 A;  1GOB A;  4JKG B;  3PSF A;  2HBM A;  3CME N;  1RT2 A;  3G6E N;  4JD2 B;  4BRM A;  4WQ5 A;  2YNG A;  1J53 A;  3O4Q A;  4DV1 K;  1FJG K;  4E7I A;  5BN8 A;  3AGK A;  4CHY A;  2PZS A;  1JXB A;  3OJS A;  1LWF A;  4CJQ A;  4JAX A;  5DM7 L;  4LC9 B;  3V9U A;  2X6N A;  2I7N A;  4E3S A;  2E88 A;  4XIU A;  2ZJR L;  4BR2 A;  2Q36 A;  4CHN A;  2HHX A;  4X64 K;  1XUP O;  1RDB A;  3VF2 A;  2KHO A;  4A59 A;  4ZTJ A;  3WT0 A;  3TR8 A;  2QWP A;  3OA9 A;  1I94 K;  3I56 N;  2HHV A;  3M8S A;  3D2F B;  4CCH A;  3WQU A;  5BPN A;  3O3F A;  5EOY A;  2OYQ A;  4V19 S;  3DXM A;  1P8Z A;  2Q97 A;  4B9N A;  2RPI A;  1XI1 A;  3NF6 A;  4I2Q A;  1QVF M;  1KLM A;  1NGA A;  4JS5 A;  4CZM A;  4PHT X;  2QKK A;  3SQ2 A;  3MX2 A;  2D0B A;  2JWK A;  2P9L B;  4FZZ A;  3CC4 N;  4DLG A;  3AVC A;  1R59 O;  3T1H K;  4O5F A;  3LDN A;  4MO4 A;  3CER A;  3AVI A;  2I5J A;  2VCP A;  4DR6 K;  3CJ1 A;  3H1Q A;  4JI7 K;  3H46 O;  4DTX A;  3D2E A;  5AQH A;  3M6G A;  3THW A;  3KK3 A;  3UKU A;  3SUO A;  1BCO A;  4R5P A;  1NK6 A;  3E9P A;  1LAV A;  4BRD A;  4X62 K;  3NAE A;  3JXU A;  1IKY A;  3CJB A;  3NDK A;  2A41 A;  3VEO A;  4FJ7 A;  2A3Z A;  5ADX A;  3S41 A;  4IFV A;  5FPD A;  4BRE A;  1SAZ A;  4ILG B;  3CJC A;  4GKJ K;  4G1Q A;  4RW7 A;  2FSK A;  5AQU A;  4CFA A;  5HLF A;  4JK7 A;  4IDH A;  1YAG A;  2G8U A;  2PYL A;  5CZ2 A;  1VSH A;  3DMJ A;  4BRN A;  3MXJ A;  3HPH A;  1YUW A;  3VQA A;  5GAH P;  4O8K A;  3QNO A;  1LW2 A;  4BR7 A;  4NB4 A;  3L4I A;  4RW6 A;  4B9T A;  3OY9 A;  4LF4 K;  1S1W A;  2P5G A;  1BOT O;  4LFB K;  3A5M C;  3DLG A;  3T1Y K;  1HJR A;  4ELV A;  2QWO A;  4CZG A;  1GLJ O;  1WAF A;  4DV6 K;  2F8T A;  1SL2 A;  4QS9 A;  1NK8 A;  4H0T B;  1VK0 A;  4FZX C;  3OYL A;  5AJ3 K;  3DLL L;  3SAH A;  4IO9 L;  4JI8 K;  2B4J A;  4DTP A;  2P9I A;  1TVR A;  4DS5 A;  5M1P A;  3V9X A;  2P9S A;  3AVN A;  1GLE G;  2ASO A;  3FE1 A;  1JJ2 M;  3OYN A;  3QIN A;  1U4B A;  4RW9 A;  2VWB A;  3SMS A;  4DQI A;  2KTQ A;  4FWQ A;  2YJF A;  2V52 B;  2GBZ A;  4OLB A;  5AQN A;  3QBW A;  1QSL A;  3HPO A;  2UUA K;  4M45 A;  3MEE A;  1ZBH A;  4LFC K;  4BRG A;  3O8M A;  3OTO K;  2KFN A;  5EVZ A;  4LF8 K;  2BAN A;  1NGE A;  4EIA A;  3O08 A;  2QWQ A;  4KH5 A;  4CJE A;  1HNV A;  3ZSV A;  1E4F T;  2JWL A;  4Z4H A;  1ASU A;  5AQJ A;  4KRE A;  3SNN A;  5KPT A;  3QEX A;  3ENO A;  4YOR A;  4FJL A;  3L3U A;  3V9Z A;  3CQX A;  2Y1I A;  2A1R A;  4PA1 A;  4B3S K;  3KWI A;  2B5J A;  4UY8 O;  3C65 A;  4OLA A;  3TAG A;  3ATU A;  2HMP A;  3U8X A;  3LPT A;  4O4G A;  1VQ9 N;  4DF4 A;  3L2Q A;  3LAL A;  1KLN A;  1QHT A;  5HBM A;  1ESV A;  4LY7 A;  5FRO A;  2AP1 A;  5J2N A;  1WB9 A;  1OVQ A;  3MN9 A;  5C12 A;  2OCE A;  4A61 A;  1DLO A;  1F21 A;  1SS6 A;  3OYF A;  4EP5 A;  3VQ6 A;  5CYQ A;  4CEE A;  3AAP A;  3HVT A;  4FVM A;  3FZM A;  1R0A A;  1BIS A;  3EO3 A;  5H1S Q;  3LL3 A;  1KXP A;  3BEX A;  2YV0 X;  3HI0 A;  3P31 A;  3OYC A;  3ZSW A;  4CIF A;  1X3M A;  4JS4 A;  1U45 A;  1BU6 O;  1XMO K;  4JKB A;  4DR7 K;  4DFJ A;  3ZEU B;  3FLC O;  3N4Q A;  4CGD A;  1JCG A;  1Z26 A;  5HP1 A;  3VQB A;  4CJ4 A;  4N5S A;  3IMX A;  1TKT A;  1S1T A;  3Q7C A;  1NGF A;  4AHU A;  5JLF A;  3LDQ A;  2G8I A;  2PYJ A;  4FJK A;  3TPQ A;  3HP6 A;  4L8R B;  1YI2 N;  2YJE A;  4M3Y A;  5KQD A;  3CJ7 A;  3PO5 A;  1OH5 A;  4DFM A;  3F9M A;  2YKN A;  4DV3 K;  2P9U A;  4E1N A;  4QAG A;  1QVG M;  3SJJ A;  3PX0 A;  1LAW A;  5I42 A;  3O4W A;  1Q82 O;  1NWK A;  4RW4 A;  5AQK A;  2DFE A;  3G71 N; 
#chains in the Genus database with same CATH homology
 4JNE A;  2P9L A;  1ZXO A;  1MA9 B;  5M1O A;  4K42 A;  4MDB A;  3TTD A;  1NLV A;  4I6M A;  3KVG A;  4IEI A;  1VQN N;  4BRH A;  5M1N A;  1P90 A;  2RE2 A;  4B1W B;  5AZJ B;  2F7T A;  3HOT A;  2PFU A;  3K9K A;  3WEE B;  3BP8 A;  3R6M A;  4BVO A;  4DQ8 A;  3MK6 A;  2NRW A;  4YOY A;  2E2O A;  1QHA A;  4BQZ A;  2WFB A;  4C23 A;  3L0Q A;  3VET A;  3KWG A;  1S3X A;  1N8R O;  2KKZ A;  3VGM A;  1QQO A;  4MLE A;  2CGJ A;  5CHI A;  1NM1 A;  4K43 A;  4BR9 A;  5LJV A;  3VMF B;  1HJO A;  4MO5 A;  3R9P A;  3P4I A;  4BRK A;  4CZI A;  3R3L A;  1YXQ A;  4K41 A;  3OBW A;  2I7P A;  5JIC A;  2CGL A;  2ZWH A;  3ULE B;  4FWN A;  4WQ4 C;  4B1X B;  2HOE A;  3UE5 A;  3KK7 A;  3H6E A;  1K73 O;  3VER A;  2Q31 A;  3GG4 A;  1GLF O;  3MMV A;  3RSE A;  1BDG A;  1BWF O;  4QS7 A;  3VF6 A;  3CET A;  3H3O B;  4RTF D;  2NRX A;  3WXL A;  3O6W A;  2P9K B;  4IJA A;  4MDA A;  1HUX A;  2BTF A;  3MWT A;  1BO5 O;  1NGJ A;  3DXK A;  3FFK B;  3GL1 A;  3H3N O;  3LDL A;  5AQF A;  4BGB A;  5B8H A;  3PIP L;  4B1Z A;  1MDU B;  1TUU A;  2OTJ N;  4WQ4 A;  4A5B A;  5KPR A;  3VEN A;  1K8K B;  4GNI A;  3VTH A;  4BC3 A;  3U9D A;  4NLC A;  2GEM A;  4KBO A;  3IKM A;  2ITM A;  4BQL A;  3NVK A;  4IEE A;  3AAR A;  3R1X A;  3R8E A;  3VEY A;  5M1F A;  2QA4 N;  2FF3 B;  4OO1 J;  5FPM A;  1YF5 L;  1XC3 A;  3CPE A;  3J8A A;  3DAW A;  2E2P A;  1NGB A;  2NRR A;  2P9I B;  4JKD A;  1TYQ A;  4ILH A;  4DCH A;  1BA1 A;  2W40 A;  4IOX A;  3SBT A;  3E66 A;  3MDQ A;  3CI5 A;  4JKC A;  3IFR A;  2Q0U A;  3ENB A;  3CCS N;  1NGH A;  2GTD A;  4FWP A;  4I6M B;  3BF1 A;  5FPN A;  4BRL A;  1KD1 O;  1WOQ A;  3AGR A;  3CCU N;  3LDP A;  3CCJ N;  1EQY A;  4JKH A;  3ZET A;  4JK8 A;  3IDH A;  2DPN A;  1RGI A;  1X9J A;  1M1K O;  3GE1 A;  2PBD A;  4RCH A;  5MLC Q;  5ADX H;  2FXU A;  4NO7 A;  2IVO A;  4OPA A;  5EXW A;  4A2A A;  3ID6 A;  4WFB L;  5E84 A;  4MLH A;  3WUH A;  3EKS A;  3ZYY X;  4DHY A;  2HF3 A;  3C7N A;  3TTC A;  3CCQ N;  1RDW X;  3QIC A;  2QWM A;  3GOI A;  5TKY A;  2P9N A;  1HKC A;  3HRG A;  4FOI A;  5AQQ A;  3QB0 A;  4H0O A;  4EFH A;  1OVY A;  2IVN A;  3OBY A;  2OTL N;  3WXJ A;  5JVH L;  2WC9 A;  1HX1 A;  1ATS A;  2VGN A;  1DT9 A;  4BRF A;  3DJC A;  4DKW A;  4FWO A;  5GAG P;  1RFQ A;  2A42 A;  1U2V A;  2VGM A;  3QFP A;  1Y64 A;  4FPA A;  3D2F A;  1V4T A;  3F2K A;  1ILY A;  3RVC A;  2WBN A;  4K25 A;  3A5L C;  5BPL A;  1VQ8 N;  5BRD A;  4FSV A;  3CF5 L;  1VQM N;  3PLA A;  4EHU A;  2YHY A;  4FO0 A;  4BC2 A;  3J7Z O;  1KC8 O;  2E2N A;  3LM2 A;  2OAN A;  4XH1 A;  4G9Z A;  2CGK A;  5AQY A;  5AZI B;  4IZ9 A;  3B8A X;  5C10 A;  1VQL N;  5GAE P;  4BRQ A;  1HKB A;  3CIP A;  3U9Z A;  2NNW A;  4JEP A;  1RDU A;  2YI1 A;  2P9P A;  3JS6 A;  4KH4 A;  3W3D A;  4BRP A;  3WXI A;  4L3Q A;  3CJ9 A;  1MWM A;  1Q7Y O;  1XQS C;  3QFU A;  4YDU A;  2FLO A;  2HBJ A;  1IG8 A;  2UYT A;  5F2R A;  2QXL A;  2E1Z A;  4PL7 A;  3CXC M;  5I9E B;  5KPZ A;  4A5A A;  3K9J A;  4A57 A;  4U67 L;  2ZF5 O;  3O9R A;  4PKI A;  5CR4 A;  5HL7 L;  1YIT N;  4ISG A;  1VQK N;  3E9O A;  1HPM A;  5M1K A;  4FWR A;  4JKG B;  4BR4 A;  4A62 A;  2HBM A;  3ZX0 A;  3CME N;  4JKE A;  4B1Y B;  4AM7 A;  3G6E N;  4JD2 B;  4BRM A;  5F0X A;  1OKJ A;  1T6C A;  4WQ5 A;  3TSQ A;  3G71 N;  2QWN A;  1Q18 A;  3VGK A;  1CZA N;  5BN8 A;  1JCE A;  3DWL A;  3LDO A;  5AQG A;  3AGK A;  3OW2 M;  2HF4 A;  4JAX A;  3UB5 A;  4LC9 B;  5DM7 L;  4YOW A;  1QZ5 A;  2I7N A;  4NLB A;  2E88 A;  1HLU A;  4C1N K;  4CZF A;  2ZJR L;  3TSU A;  3VF4 A;  4BR2 A;  2Q36 A;  4Y0W A;  1ZBS A;  2QM1 A;  4BRA A;  1XUP O;  2NRV A;  3SLC A;  3VF2 A;  3AAQ A;  2KHO A;  4JKA A;  3FR0 A;  1KAZ A;  4A59 A;  4C1N I;  1SQK A;  1NGD A;  2QWP A;  3OA9 A;  3WT0 A;  4IOA L;  3SMP A;  3I56 N;  2D4W A;  4BC5 A;  3D2F B;  4FWK A;  4YOT A;  3WQU A;  5BPN A;  3ZEU A;  3P38 A;  5AQW A;  5FPE A;  3Q7B A;  4BG9 A;  1U6Z A;  4WYB A;  3WQT A;  4EHT A;  1X3N A;  4IWV A;  5EOY A;  4BRO A;  1VQ4 N;  4B1V A;  3L4Q A;  3MX5 A;  3DXM A;  1P8Z A;  2Q97 A;  2P9U B;  2HBK A;  3P39 A;  1M90 O;  1T6D A;  3L6Q A;  4JHD A;  5BN9 A;  1G99 A;  5ELZ A;  1QVF M;  2E1Y A;  1NGA A;  2GEL A;  4CZM A;  4PHT X;  4CZL A;  1NGI A;  4JN4 A;  3CCM N;  3MX2 A;  5EX5 A;  3O9U A;  2JWK A;  1H1V A;  4FL9 A;  5BPM A;  2V7Z A;  5AQR A;  2P9L B;  1DKG D;  2H3G X;  3OHR A;  3QBX A;  4H0X B;  4HTL A;  3TTF A;  5E26 A;  5GIP A;  3CC4 N;  4F9O A;  5AQT A;  5GIO A;  4IXC A;  1NGG A;  1R59 O;  3CD6 N;  4H0P A;  1ATN A;  1E4G T;  3NVM A;  4O5F A;  3LDN A;  4IFE A;  4MO4 A;  3VOV A;  3CER A;  4BG8 A;  1YHQ N;  4M7X A;  2ZGZ A;  3CQY A;  2VCP A;  3CJ1 A;  5LJW A;  2FSJ A;  2PAV A;  3H1Q A;  5C2F A;  3HBT A;  1V4S A;  4J8F A;  3H46 O;  4PKH A;  4ISE A;  3D2E A;  4IJN A;  3M6G A;  5AQH A;  4AF1 A;  3I55 N;  1NMD A;  4H5V A;  4E1J A;  1ZC6 A;  2J4R A;  1W97 L;  2QW9 A;  3UKU A;  1VQ5 N;  3IUC A;  3EL2 A;  4FWS A;  2Q0R A;  4CZE A;  3PIO L;  2CH6 A;  4HWI A;  3C6H A;  3E9P A;  4BRD A;  2F9T A;  5AZJ A;  3JXU A;  5AQM A;  2W41 A;  3CJB A;  3WEE A;  5AQI A;  2A41 A;  5C0Y A;  3VEO A;  2VYP A;  2A3Z A;  2YX6 A;  5ADX A;  3S41 A;  1J6Z A;  1YVN A;  1Z6R A;  4ILJ A;  4O8U A;  3RSE B;  5FPD A;  4BRE A;  3NMU A;  1SAZ A;  5BRE A;  3HTV A;  2ZJP L;  2Q1N A;  4ILG B;  1DEJ A;  1BA0 A;  4CZJ A;  3SK3 A;  3TSP A;  3SAG A;  4FWL A;  3CJC A;  1VAZ A;  3DXK B;  3QML A;  3CCE N;  1GLA G;  2FSK A;  5AQU A;  3MN7 A;  3CMA N;  1VQO N;  4JK7 A;  4IDH A;  3ULE A;  1YAG A;  3CCV N;  4GV3 A;  2ZGY A;  3VEX A;  4BRN A;  5GAD P;  4YDU C;  1YUW A;  4GY2 B;  3DXM B;  5GAH P;  4O8K A;  4H5N A;  4BR7 A;  4JHD B;  4NB4 A;  4CD1 A;  3L4I A;  3H45 C;  5M1Q A;  4PKG A;  1TYQ B;  3G4S N;  4GV6 A;  3M3Z A;  1DGK N;  3C0B A;  2ZJQ L;  3BF3 A;  1BOT O;  2V7Y A;  3A5M C;  1TUY A;  4H03 B;  1K8K A;  1QZ6 A;  2QWO A;  3A5N C;  3ENH A;  3HM8 A;  3I33 A;  3SJH A;  3QDK A;  1GLL O;  3VES A;  4CZG A;  1IJJ A;  1GLJ O;  3I8B A;  4QS9 A;  4WQ5 C;  3ZET B;  4WFN L;  5AQO A;  4H0T B;  3H1V X;  4BC4 A;  3SBG A;  3KHY A;  3ATV A;  3MWP A;  4FWM A;  2QWL A;  1BG3 A;  3W0L A;  3ZX2 A;  2D0O A;  5F1X A;  3DLL L;  1Q81 O;  2BH1 A;  1K8A O;  2ASP A;  3BUZ B;  3SAH A;  1GLC G;  4GVE A;  2A6A A;  3ZX3 A;  4IO9 L;  1O13 A;  2P9I A;  3E9L A;  2E20 A;  5DM6 L;  5M1P A;  3C7N B;  3EN9 A;  4ISF A;  3VEZ A;  2Q2R A;  2D0P A;  2P9S A;  1JJ2 M;  1GLE G;  2ASO A;  3FE1 A;  4QS8 A;  2P9N B;  2D1K A;  4JK9 A;  5BRH A;  4BGA A;  4BR5 A;  2AA4 A;  3D7E O;  5LY3 A;  4CJ7 A;  2VWB A;  3SMS A;  3WXK A;  2NLX A;  3EKU A;  4FWQ A;  1LOT B;  2IVP A;  3FGU A;  2YJF A;  2V52 B;  3D6R A;  5C2D A;  1K9M O;  3O80 A;  3MN6 A;  5CE3 A;  5AQN A;  3QBW A;  4CBW A;  2GWK A;  3FZL A;  1S22 A;  3FZH A;  4B9Q A;  1QQN A;  4BRG A;  3O8M A;  4M63 C;  3O9T A;  4DB3 A;  2ASM A;  4A2B A;  1U2V B;  4WFA L;  3MN5 A;  2FF6 A;  5EVZ A;  1QQM A;  2EWS A;  3A5O C;  4FPB A;  1MWK A;  2HST A;  1NGE A;  5AQZ A;  4EIA A;  3A0I X;  2QWQ A;  3O08 A;  4KH5 A;  4GV9 A;  3CJA A;  1E4F T;  3CC7 N;  1EO1 A;  1BUP A;  2JWL A;  3VEW A;  2QI2 A;  1S72 N;  5AQJ A;  1SZ2 A;  2P9P B;  4YOU A;  3VEV A;  5KPT A;  3ENO A;  4JKF A;  3GBT A;  4YOR A;  3UKR A;  2KLA A;  1YJ9 N;  2NRZ A;  3CQX A;  1W2B M;  4BRC A;  1GLD G;  3FZF A;  4CI6 A;  3O9Q A;  3KWI A;  4UY8 O;  3CPW M;  3C65 A;  4CBU A;  4BY9 C;  1VQP N;  3CC2 N;  4OPH A;  3ATU A;  2YHW A;  2HMP A;  3U8X A;  1YJN N;  2QTD A;  1Z05 A;  2V51 B;  5AZI A;  1VQ9 N;  1NGC A;  2F9W A;  1D4X A;  2E2Q A;  5C15 A;  1ESV A;  2AP1 A;  3N4P A;  1T3V A;  3MN9 A;  4FOE A;  4XEI A;  4IO8 A;  3EE9 A;  3T69 A;  4H0V B;  3WXM B;  5C12 A;  4U7B A;  4A61 A;  5JMV A;  5BRF A;  1SS6 A;  4PL8 A;  2QEX N;  3CCL N;  2P9S B;  3KZB A;  4XH4 A;  5KQ8 A;  2NRH A;  5AQL A;  3M5R A;  3A8Y A;  3G25 A;  3VGL A;  2NZT A;  3CCR N;  2A5X A;  4KH6 A;  3AAP A;  1KQS M;  3SAF A;  1C0G A;  1LCU A;  2GWJ A;  3FZK A;  1KAX A;  3TU5 A;  3FZM A;  5AQP A;  3EZW A;  3EO3 A;  4H5W A;  5EY4 A;  2RHK A;  2YCH A;  3LL3 A;  5H1S Q;  1KXP A;  3BEX A;  4BRI A;  4H0Y B;  3HI0 A;  4JKG A;  3M1F A;  3ID8 A;  4B1U B;  3VPZ A;  3P31 A;  1KAY A;  3VTI A;  4R79 A;  5BR9 A;  4BR0 A;  1X3M A;  4JD2 A;  2A40 A;  4CZK A;  4WCE L;  1BU6 O;  5AQS A;  4JKB A;  1HKG A;  4CBX A;  2E8A A;  4H5T A;  3O1B A;  5GIN A;  3ZEU B;  3F5T A;  3FLC O;  2GUP A;  5AFU H;  3CHW A;  4WF9 L;  3LM9 A;  1VQ6 N;  3N4Q A;  4CZH A;  1JCG A;  2CH5 A;  1ATR A;  1NBW A;  3EE8 A;  1C0F A;  4BVP A;  3T7Z A;  5AQV A;  3IMX A;  3Q7C A;  2GX9 A;  4YOV A;  2P9K A;  3HZ6 A;  2HBL A;  2YHX A;  1NGF A;  2BUP A;  3O9S A;  3LDQ A;  5AQX A;  5JLF A;  5HOO A;  3TPQ A;  2WUS A;  3UKR B;  1NJI O;  5TKW A;  1YI2 N;  2YJE A;  5AFU A;  4AM6 A;  3U4L A;  4YOX A;  5KQD A;  2IIR A;  3CJ7 A;  1WUA A;  2QWR A;  4IOC L;  3F9M A;  3E1Y A;  2NRT A;  4M7Y A;  3C6A A;  1GLB G;  4EAH D;  1JCF A;  1YJW N;  2P9U A;  4XH5 A;  5AR0 A;  3MCP A;  3O5B A;  4FVU A;  3HSC A;  1T44 A;  3GDQ A;  3AY9 A;  5JVG L;  1QVG M;  3D2E B;  3MCA B;  4RWT A;  3O4W A;  3O1W A;  1NWK A;  2FSN A;  4H5R A;  4CD3 A;  5JLH A;  3HOS A;  1YIJ N;  5AQK A;  1Q82 O;  1Q86 O;  3UKU B;  4Z94 A;  1VQ7 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...