3ZX0A

Ntpdase1 in complex with heptamolybdate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
404
structure length
385
Chain Sequence
KYGIVLDAGSSHTNLYIYKWVVQQLEECQVKGPGISKYAQKTDEIAAYLAECMKMSTERIPASKQHQTPVYLGATAGMRLLRMESKQSADEVLAAVSRSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFKGSTFGALDLGGSSTQITFVPLNSTLEAPETSLQFRLYGTDYTVYTHSFLCYGKDQALWQKLAQDIQVSSGGILKDPCFYPGYKKVVNVSELYGTPCTKRFEKKLPFNQFQVQGTGDYEQCHQSILKIFNCPYSQCAFNGVFLPPLQGSFGAFSAFYFVMDFFKKMASSQEKMTEITKNFCSKPWEEVKASYPTVKEKYLSEYCFSGTYILSLLLQGYNFTGTSWDQIHFMGKIKDSNAGWTLGYMLNLTNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ECTONUCLEOSIDE TRIPHOSPHATE DIPHOSPHOHYDROLASE 1
publication title Crystallographic evidence for a domain motion in rat nucleoside triphosphate diphosphohydrolase (NTPDase) 1.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 117
structure length 385
sequence length 404
chains with identical sequence B, C, D
ec nomenclature ec 3.6.1.5: Apyrase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01150 GDA1_CD39 GDA1/CD39 (nucleoside phosphatase) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3zx0A01
3.30.420.150 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Exopolyphosphatase. Domain 2 3zx0A02
3ULEA 1Z05A 3FLCO 3DXMA 1C0FA 3EN9A 3JXUA 1NLVA 2QWRA 1GLBG 3ENOA 1BU6O 1HJOA 2FSKA 4BC2A 4BC3A 1ATSA 2ITMA 4E1JA 1YVNA 3FZHA 5AQLA 3VEOA 3WXKA 3LM2A 1T44A 3R9PA 3D2FA 3H1QA 1R59O 2E1YA 4FWRA 4QS8A 2GUPA 2D0OA 1SAZA 2YJEA 3LDQA 1J6ZA 4BC5A 4H5NA 4MLHA 3UE5A 1QZ6A 1BA0A 3UKRB 3CIPA 2QWNA 2BUPA 5E26A 3GOIA 3W3DA 1DEJA 1V4SA 2Q1NA 5AQIA 2H3GX 3CQYA 4CBXA 3KHYA 4Y0WA 3MN6A 3DWLA 3I33A 1HKCA 1NGIA 5E84A 5BN8A 3CJ7A 4J8FA 3WEEB 1NGJA 1GLAG 2P9NB 4IWVA 3LDLA 3WEEA 3VEZA 3ZEUB 3UKUA 2P9NA 5AFUA 3FZKA 3WQTA 4H0YB 1MWKA 2IVNA 4PL8A 2IVPA 5AQNA 3VENA 1IG8A 2YHXA 4FWNA 4WQ5A 3FFKB 1YAGA 1HPMA 1E4GT 3ZX2A 3QFPA 5AZIA 3HZ6A 3EKSA 5BPMA 1XUPO 2Q36A 1BO5O 2UYTA 2ASPA 2P9PB 3VEYA 5BRDA 4BVOA 3C7NB 4CJ7A 2YHYA 4ISGA 2WUSA 3C7NA 2CH6A 4QS7A 3EKUA 3L4IA 3BF3A 3VGMA 2V52B 4AM6A 1RGIA 5JLFA 1P8ZA 4BVPA 3BUZB 3IDHA 5LJVA 1MDUB 2E8AA 3A0IX 1HLUA 3LM9A 5AFUH 3IFRA 3GG4A 1NGCA 3CJ1A 4EFHA 2V7YA 3GDQA 2W40A 1KXPA 5JICA 2I7NA 3G25A 2Q0UA 1KAYA 4FWKA 1DKGD 4RCHA 4JAXA 3IUCA 4H5VA 1YXQA 4BR5A 1S3XA 2P9IB 3C0BA 4H5RA 4CZLA 4KBOA 2P9IA 1QQNA 3H1VX 3HI0A 1H1VA 5AQSA 5F0XA 5FPDA 2QM1A 4BRKA 1NGGA 4FWSA 4HTLA 2QWPA 3O1BA 3LDPA 2QWLA 4I6MB 3ATUA 1ZXOA 1TUYA 3WQUA 4CZEA 4HWIA 3B8AX 3VGKA 4XH5A 1T6CA 2YI1A 2PBDA 1Q18A 3QBWA 3A8YA 4K41A 5EY4A 4QS9A 2QWQA 3VPZA 4B1ZA 4DHYA 2J4RA 3U9ZA 4BRHA 1RDWX 5AZJB 3L0QA 5BR9A 4B1VA 2YHWA 2A40A 3SMSA 1DGKN 3QBXA 5AZJA 1ATRA 4RTFD 4PL7A 5I9EB 1IJJA 3HBTA 4FPBA 1BWFO 3WXIA 4NB4A 1YUWA 4FWMA 1CZAN 2GEMA 1GLLO 2CGKA 3DAWA 5AQMA 2IIRA 2FF3B 3VEWA 5AQJA 2A5XA 3VESA 3KVGA 4FWOA 4CBUA 1TUUA 3QMLA 1RFQA 3DJCA 3GE1A 3WXJA 4EHUA 2FSNA 2ZGYA 4BRPA 3S41A 2AP1A 4XH4A 3SK3A 3A5NC 3UKRA 2Q2RA 5EOYA 3U8XA 1WUAA 2E1ZA 1NMDA 1NWKA 2E2PA 4CZKA 2P9LB 5KPRA 3MN7A 4BC4A 1QQOA 1GLFO 1C0GA 3ID8A 1MWMA 2P9LA 3M1FA 3FR0A 2F9WA 3TPQA 4BRMA 4C23A 1NGHA 3MN5A 4H0PA 4A2BA 3ZX3A 4CZGA 2AA4A 1X9JA 1NGAA 5AQRA 4CI6A 3UB5A 1NGBA 3MMVA 3ZEUA 1NBWA 2ZF5O 3WT0A 5F2RA 2CH5A 3MCPA 4H5TA 4BROA 5EXWA 3LL3A 2P9UB 5AQOA 3AAQA 3W0LA 1JCGA 1KAXA 2E2QA 2P9UA 2FXUA 4H5WA 4CZIA 3SMPA 5JLHA 4PKIA 2P9PA 4FOIA 5KQ8A 1GLJO 5ELZA 2IVOA 4BRDA 5AQUA 3VOVA 3O4WA 3FZMA 5AQWA 4CZJA 5AQGA 3MN9A 5FPEA 2YCHA 1NGEA 4GNIA 4FWQA 2YJFA 3HTVA 5AQKA 3O1WA 4B1XB 3CETA 4BRCA 1ZBSA 3VF6A 3QICA 3CHWA 4IJNA 2A6AA 2HOEA 2ASOA 4BRFA 2A42A 1HUXA 4LC9B 3D2EB 3M6GA 5BPNA 1NM1A 5FPNA 1SZ2A 2I7PA 4K25A 4DB3A 1U6ZA 3D2EA 1QHAA 2CGJA 3VERA 5AR0A 3AARA 4IXCA 3GBTA 3VEXA 3LDOA 4Z94A 5BPLA 4ISEA 5AQHA 5BREA 2E2NA 3AAPA 2KHOA 1KAZA 3H3NO 2D4WA 1HKBA 4B1UB 1S22A 4A2AA 2FLOA 3EZWA 2GTDA 4JNEA 3A5MC 4H03B 4M7XA 2HMPA 4ISFA 5ADXA 5AQTA 2E88A 2HF3A 4CZMA 3FGUA 5AQZA 4I6MA 4A61A 4H0XB 4O8KA 2D1KA 4FWPA 2D0PA 3ENHA 3U9DA 4BRQA 4A62A 5EVZA 2F9TA 5BRFA 5JMVA 5TKYA 4EHTA 3BF1A 4RWTA 1GLDG 4BRLA 2GELA 3M3ZA 5B8HA 2VYPA 1TYQB 2DPNA 3MDQA 2ASMA 1BUPA 3O80A 3ULEB 1BG3A 3ZETB 1ESVA 3FE1A 1TYQA 4BQZA 4FPAA 3SLCA 4MLEA 2V7ZA 1X3MA 4BGBA 3VF2A 3ZETA 5LJWA 3R6MA 3CQXA 4DQ8A 3OHRA 5AQXA 5BRHA 5ADXH 3P4IA 4IO8A 5AQVA 3D7EO 3VGLA 3QB0A 1Y64A 1OKJA 3H45C 4EIAA 1JCFA 5KPTA 1K8KB 1JCEA 4MO5A 1ATNA 3U4LA 4BRGA 1NGFA 3D2FB 4M7YA 1Z6RA 3BEXA 1K8KA 4JN4A 4FSVA 2P9KB 5AQPA 3RSEB 1E4FT 3JS6A 1V4TA 2QWOA 3H6EA 2P9KA 3RSEA 2Q0RA 1XC3A 4BR0A 5CE3A 2HF4A 5LY3A 3A5OC 1QQMA 4MO4A 5AQFA 1WOQA 4BRNA 1BA1A 4BREA 3DXKB 4XH1A 1SQKA 3CJCA 4H0VB 4FL9A 4DCHA 1BOTO 3DXKA 4L3QA 4NO7A 1XQSC 2A41A 3FZLA 4GY2B 1ZC6A 2E20A 3J8AA 3F9MA 4YDUA 4EAHD 3UKUB 1EQYA 2BTFA 2GWKA 5BN9A 2NRHA 4YDUC 4B1WB 4M63C 4BR7A 3TU5A 3ZX0A 1HX1A 2W41A 3MK6A 2EWSA 5F1XA 3VETA 4FOEA 2OANA 3BP8A 3CERA 5AZIB 3CI5A 4BQLA 4BG8A 4H0OA 3O08A 5FPMA 4CZHA 5AQYA 3R8EA 2QW9A 4WQ5C 1GLCG 1LOTB 4BR9A 3LDNA 1MA9B 5KQDA 3WUHA 1T6DA 4CD1A 1U2VB 5AQQA 5KPZA 1G99A 1NGDA 3IMXA 4O5FA 4JD2B 4BR2A 4H0TB 1U2VA 4K42A 2VCPA 2E2OA 3A5LC 4JD2A 5EX5A 4F9OA 4BR4A 2V51B 3HM8A 3EO3A 3L6QA 1GLEG 2Q31A 2NZTA 3I8BA 3H46O 2QXLA 1BDGA 4FO0A 2NLXA 2QWMA 4WQ4A 4JHDB 4PKHA 2FF6A 3VEVA 4IJAA 4PKGA 3SJHA 4JHDA 2P9SB 1HKGA 3O6WA 2Q97A 4WQ4C 3KZBA 3ATVA 3AY9A 3CJ9A 3FZFA 3QFUA 2ZGZA 4K43A 2P9SA 3HSCA 2ZWHA 4AM7A 4CD3A 4BG9A 4B9QA 4CZFA 1X3NA 4WYBA 3O8MA 2PAVA 2GWJA 4CBWA 4FWLA 3CJAA 1D4XA 1QZ5A 4BRAA 3GL1A 3WXLA 1LCUA 4BGAA 3H3OB 4B1YB 2FSJA 3VF4A 4IZ9A 2VWBA 3O5BA 3EL2A 2A3ZA 2CGLA 4XEIA 3DXMB 3QDKA 4BRIA 3CJBA
chains in the Genus database with same CATH superfamily
1OH6A 1BCMA 3FLCO 1C0FA 3EN9A 3JXUA 4KPYA 2QWRA 3NH1A 2VG6A 4H4MA 3ENOA 1IH7A 2Q3SA 3NMUA 2FSKA 4BC2A 1S1VA 4B3MK 2NRZA 1IKVA 2FBVA 3FZHA 5AQLA 3OYFA 2XY6A 3WXKA 1S5JA 3LM2A 2VQFK 4Q0BA 4F3TA 2OTJN 1R59O 3V9ZA 2LSNA 4FWRA 3PX4A 1X9SA 2D0OA 4DWIA 5A2QO 3DMJA 3AO4A 3HVTA 1WBBA 4JI3K 4MLHA 1L5UA 4M3XA 3UE5A 4CFAA 1QZ6A 1NG9A 3CIPA 1V4SA 3OYBA 1UAXA 1L3SA 3CQYA 4F4KA 3K58A 3MN6A 3TTDA 4DV5K 3QLHA 4O0JA 1SV5A 3SCXA 1NK9A 3SPZA 1S9GA 4CHQA 1GLAG 5M1NA 4IEEA 3AVAA 3C95A 2Z1GA 3FZKA 4E0DA 1MWKA 4CK3A 3C6UA 1U4BA 1C0UA 4WQ5A 5FDLA 1HPMA 3V9WA 2JGUA 3VN5A 3HZ6A 4CJ5A 4DSLA 4OGEA 1E3MA 2O8DB 2W42A 1XUPO 5BRDA 4E7LA 4CJ7A 1VSLA 2YHYA 3ZT4A 5LMNK 1W97L 3N4QA 2CH6A 3VGMA 5HLFA 1Q82O 3E01A 1NKBA 5HRNA 4AF1A 4DQPA 3IDHA 5LJVA 5J2NA 1MDUB 3TAQA 3P83D 2D0BA 4AQYK 3IFRA 1JLAA 3ZSVA 4EFHA 4CJFA 2V7YA 4ID5A 2W40A 3LANA 2DFHA 4CEQA 3F9KA 2I7NA 3AVJA 3QO9A 4E7KA 3E66A 4JAXA 1FW6A 2HHWA 4BWMA 2P9IB 1Q7YO 5J2QA 1JLBA 4CZLA 2PYJA 4K8XA 4DUYK 3H1VX 5AQSA 1H1VA 5FPDA 1RTIA 1HR0K 4YOYA 1YF5L 3KK7A 3KLFA 2Z1HA 3U3YA 3VQQA 3ATUA 2YNGA 3AVFA 3QBWA 3VQEA 3L2WA 4JKBA 2HSTA 4DHYA 5C25A 3LAKA 2NUBA 4B1VA 3V9SA 4CJUA 3SV4A 4AILC 4FYDA 2FBTA 4KH4A 1BQNA 3NBPA 3OTOK 3ASMA 1BI4B 3SJJA 3E1YA 3G0ZA 3AV9A 4FPBA 1RBRA 1YUWA 3PSIA 4FWMA 3DRPA 3CC4N 4DSEA 2A5XA 4HTUA 1EX4A 4DLGA 3GE1A 1NK7A 4FLUA 4BRPA 1NJXA 3QEIA 4CEAA 1VQMN 3A5NC 5EOYA 2E2PA 2P9LB 5KPRA 2YKMA 4DR4K 1QQOA 4RW9A 3O3FA 3J80O 3F2KA 2R7YA 3NH2A 1MWMA 1DTTA 1YTAA 4CK1A 3CYMA 4C23A 3MWTA 3OYCA 4BDYA 3DLEA 4CZGA 4RG8A 1C6VA 3O4NA 4M42A 4WCEL 1X9JA 4B3RK 3KWGA 1S72N 3S3OA 5HRRA 1NBWA 3AO3A 3AVMA 3B6PA 3WT0A 3ZEUA 4JKHA 3ZT3A 1Q8IA 1UA0A 3L4QA 1N5YA 5MLCQ 4H5TA 5JVGL 3LL3A 5AQOA 3W0LA 3LAMA 2HHQA 1L3TA 1KAXA 1TVRA 2E2QA 4CZIA 5HP1A 1YVUA 2P9PA 5I42A 5KQ8A 5ELZA 2IVOA 1VQPN 1RBSA 1DT9A 1VRUA 5AQWA 4CZJA 4DQRA 3QETA 4MQ3A 3NF6A 3BZKA 4FWQA 4IG3A 3TAGA 3SBTA 4B1XB 3O1WA 3CETA 3V1RA 4BRCA 1ITGA 3VTIA 1JLQA 3P39A 3AA3A 2A6AA 3NVKA 1JKHA 3O3GA 2YNHA 2I7PA 3E9PA 2XHBA 4PHTX 4FM1A 1TK5A 2CGJA 4DQQA 5AR0A 1J9AA 2GV9A 3AARA 4IXCA 2HB5A 3LDOA 3NGIA 4C1NK 4WFAL 1LV5A 3VQ9A 5KRSA 3H3NO 4B1UB 4JK8A 4BY9C 4A2AA 3EZWA 4JNEA 4JKAA 4HUFA 3A5MC 5CYQA 4NCAA 3KWIA 1G15A 3KK3A 5AQTA 2HF3A 4CZMA 4LFCK 2QEXN 4F3OA 5CYMA 1VSJA 4O8KA 1HNIA 2D1KA 1REVA 2D0PA 3RRGA 1A5XA 2F9TA 2QK9A 3DM2A 5TKYA 4GV9A 4EHTA 3BF1A 1GLDG 3ZSRA 4I2PA 1C1BA 3NHGA 4J2EA 2VYPA 1M1KO 1BUPA 4JKGB 1A5WA 4CGIA 3TWHA 3ZETB 1EXQA 2BANA 2BH1A 1X3MA 1MU2A 3VF2A 3CQXA 3EE9A 5BRHA 3THYB 3D7EO 3VGLA 5C15A 1B9DA 1JCEA 3O9SA 1HYSA 3ZYYX 4M7YA 2WONA 4IBNA 1K8KA 4JN4A 3OYIA 1V4TA 1X9WA 1S1WA 4ZHRA 4CW7B 1XHZA 4NCBA 3KD1E 3HVRA 3A5OC 2WBNA 3DLGA 4KTZA 4MO4A 1WOQA 2OTLN 4BRNA 4L8RB 1VHXA 1U49A 1XNQK 4OGCA 2G8IA 4DF8A 3CJCA 4H0VB 4IKFA 4BWJA 4CEEA 4NO7A 4EP4A 4GKJK 1M90O 4RW4A 1N8RO 3ZSOA 3F9MA 4Y1CA 2JLEA 3UKUB 4ZTFA 3PO5A 4Z4EA 1RTJA 3HOTA 1XNRK 4YDUC 4GVMA 4BR7A 3ZX0A 3TI0A 3CCEN 2EWSA 4C1NI 2E4LA 4E89A 4GV6A 3NVMA 2OANA 4BQLA 4BG8A 5M1KA 3OYDA 1LWFA 3O08A 2KW4A 3HXMA 3MX2A 3T3FA 2QW9A 3ZCMA 3JAMO 4ELVA 1RTDA 1LOTB 2HNDA 4NLBA 1J5EK 3LDNA 1MA9B 3MAQA 4YOUA 1JXBA 1T6DA 5AQQA 1NGDA 3DLLL 5J1EA 2YNIA 3RMDA 5EX5A 1VQLN 4AHVA 4F9OA 4BR4A 4F8RA 3HM8A 3EO3A 2I5JA 3OW2M 3T7ZA 1BDGA 2QXLA 3CM6A 3VQ6A 2QWMA 4JKCA 3T19A 4U67L 3THWA 3L8BA 2DY4A 4CHNA 4JHDB 4PKHA 2G8WA 2FF6A 4JI0K 2WOMA 3VQ8A 2Q97A 2GUIA 3AY9A 2NRXA 3NF9A 3SAFA 2ZM6K 2RPIA 4EZ6A 4YOVA 2KZZA 1ZBIA 4LH5A 4FWLA 4CJKA 1D4XA 1Q86O 1QTMA 3HSTB 4XEIA 2KKZA 1L3UA 3SV3A 1QHTA 3ZSWA 4YOWA 3ULEA 4KB1A 1Z05A 3DXMA 1WSHA 4DSKA 3DLRA 2UXCK 4FZXC 3HRGA 2EHGA 1UWBA 2F4VK 3VMFB 3CFRA 4E1JA 3SYZA 1B92A 4M41A 1S6QA 1YITN 4JI1K 1TKDA 3AA2A 1T44A 4WF9L 4CIEA 3D2FA 1UOCA 3DLKA 3VA3A 1FKOA 1B9FA 3LDQA 2F96A 3AGKA 4BC5A 1BGXT 3E9OA 4B9SA 1RT6A 3LDSA 1RDCA 4B9TA 5CZ2A 3BY5A 4LSNA 2QWNA 3P5JA 5E26A 5C2FA 1DEJA 4LF5K 5AQIA 1EP4A 2VGNA 4JEPA 3OBYA 4Y0WA 5BN8A 1NGIA 5E84A 3SQ0A 1CZBA 4EZ9A 3TAEA 4NYFA 1HYVA 2UXDK 2P9NB 4E1MA 3LP3A 3LDLA 3MCAB 3RMCA 3PSFA 1T05A 2QTDA 1VSKA 3WQTA 4PL8A 4FM0A 4FJKA 5AQNA 5LMUK 4DR6K 3NGYA 4DTOA 3IS9A 2G8VA 1YAGA 1RBUA 4O8UA 1E4GT 1HPZA 3CFOA 3TSPA 3C94A 3T1HK 1K73O 2JWKA 3TAFA 4FK0A 5BPMA 2F8TA 3VEYA 1BO5O 2ASPA 2RKIA 4DR3K 4J2DA 4BVOA 2O8DA 1NU0A 5C0YA 2WUSA 4B9UA 1IBKK 4QS7A 3BF3A 2KTQA 4AM6A 4WFNL 3T1YK 1RGIA 5JLFA 2OPPA 3MWPA 2ETJA 3BUZB 4CFBA 1TAUA 1HLUA 3LM9A 1GOAA 3G6EN 2VGMA 3GG4A 5I3UA 3GDQA 4DTXA 3MEEA 2QKBA 4HHTA 4KHSA 4FJJA 1OH7A 2Q0UA 4FWKA 3ENBA 3CG7A 1YXQA 2O8CA 4DUZK 4Z4GA 4FW2A 1N32K 4KHUA 4KBOA 2P9IA 1QQNA 3HI0A 2QM1A 2P5GA 4OLAA 3RWUA 2QWLA 4I6MB 2G8KA 1ZXOA 3WQUA 3P31A 4IFEA 4DU3A 4JK9A 2YI1A 2PBDA 1Q18A 1KTQA 4LH4A 1QSSA 4B1ZA 4PY5A 1BHLA 4BRHA 5H1SQ 2B4JA 5BR9A 2YHWA 1XWLA 3AVKA 4CGFA 1IO2A 3CPWM 2D0CA 4N56A 4PL7A 5I9EB 5SZTA 2VG5A 3WXIA 5K14A 1BI4A 1CZAN 4G1QA 3K5NA 2GEMA 2CGKA 1XMQK 5AQMA 4DV4K 1WLJA 4FWOA 1KFSA 3TSQA 1NOYA 1RFQA 3DJCA 2NRRA 1KVCA 1HNWK 3K5MA 2ZGYA 3S41A 4JS4A 3SK3A 1HQUA 3UKRA 1HYZA 3O9QA 3U8XA 1NMDA 1NWKA 4CZKA 3HPGA 4LD0A 1QSLA 1CLQA 1C0GA 2P9LA 2D5RA 3DLBA 2B5JA 3M1FA 2RF2A 3NF8A 4BRMA 1NGHA 3HYFA 3LP0A 5C24A 4A2BA 3LPUA 3CD6N 1CZ9A 3HT3A 2AA4A 1TV6A 5AQRA 4DU4A 3NE6A 3AVBA 4AHCA 4JKFA 2ZF5O 2HMIA 5FRNA 1W0HA 4CVNE 2CH5A 4CF1A 2O4GA 2WFBA 3MCPA 2KFZA 5C42A 3OYNA 4HCBA 2P9UB 4CJEA 4JRPA 3LALA 1JCGA 3ZSXA 1RDAA 3SMPA 3K2PA 4PKIA 1GLJO 4BRDA 4W5RA 3HPOA 1VQ4N 5AQGA 2WC9A 2UUAK 1RNHA 5FROA 4BE2A 1YJ9N 1ZBSA 1KLNA 4Y1DA 3L2UA 2HOEA 1VQKN 4LF9K 2O8FB 2A42A 3D2EB 2O8BB 5HRSA 4DR2K 1RBVA 1SZ2A 4DB3A 1QHAA 3VERA 5M1PA 2F7TA 3GBTA 3HL8A 3QINA 2KLAA 3SUNA 5AQHA 5BREA 2E2NA 3KLHA 2KHOA 1KAZA 5T7BA 4QAGA 4JI5K 2FLOA 2GTDA 1HQEA 5TKWA 4H03B 1LW2A 4M7XA 3HK2A 3CCRN 2HMPA 5ADXA 3OBWA 1IKWA 3FGUA 5AQZA 2ZJQL 1KRPA 1NJIO 3ENHA 4LF6K 5JMVA 2NRTA 4EP5A 4ILHA 1K9MO 2Y1IA 4DU1A 2XY5A 3CMAN 4CCHA 3R3LA 4KH5A 4BRLA 4YOXA 3PV8A 1WAFA 3E9LA 2DPNA 3PUFA 3O80A 3JSMA 4AHSA 4BQZA 4BGBA 3ZETA 3R6MA 1ZBFA 2WTUA 5AQXA 5ADXH 1U45A 4M3WA 3P4IA 5AQVA 1RCHA 3QB0A 4FM2A 4DR7K 5KPTA 3THYA 5CHIA 1J53A 3LZJA 1NGFA 3NAEA 4FSVA 1EETA 5KI6A 3DRSA 3JS6A 1SL1A 2G8FA 4CEZA 3M8QA 3EY1A 3G71N 3V9XA 2BGGA 4M3UA 1S1TA 4BR0A 3QIOA 5CE3A 2HF4A 5AQFA 4CEFA 3G4SN 1U04A 3KLEA 1BA1A 4BREA 5DMRA 3DXKB 1VQ7N 4NXNK 4XH1A 5KRTA 3KLGA 4DCHA 1BOTO 1VSIA 3DOKA 4DTNA 4FLYA 4L3QA 2UUBK 1XQSC 1L3VA 2KZMA 1Z25A 2GBZA 3BZCA 3D45A 3FZLA 1I94K 1VRTA 3Q7CA 2E20A 4CESA 4YDUA 4R5PA 3U6FA 1X9MA 4EAHD 3K59A 4LSLA 1D8YA 4OJRA 4ILJA 5BN9A 3CCJN 3S3NA 2HVIA 4B9LA 2NRHA 4M63C 4CHPA 4CECA 3MK6A 5F1XA 3LP2A 4DQIA 3VETA 3ID6A 3BP8A 4ELTA 4KAZA 5FPMA 4M3RA 4CZHA 3LPTA 5AQYA 3R8EA 3L2QA 5GAHP 2OA8A 4DFKA 4WQ5C 1GLCG 3I55N 3VQBA 5GADP 5FRMA 4KB0A 4KTWA 4B3TK 4K0KK 3EZ5A 3TABA 5M1OA 3RVCA 4CJ3A 2HHSA 4KFBA 4CF0A 3V4IA 3A5LC 1TK0A 3SBGA 2BDPA 4CJVA 1YJNN 3BDPA 3TARA 4DKWA 1ASWA 1VSEA 2A1SA 3AO2A 3VQ5A 1YTUA 4DTMA 2PZSA 1ZYQA 5KGWA 4LY7A 4M3ZA 4FO0A 2NLXA 5GINA 5HRPA 3SPYA 3M5RA 3J7YP 1OVQA 4IJAA 1LWCA 3SJHA 4JHDA 1LAWA 4DTSA 2P9SB 1HKGA 2FBXA 4JK7A 3KZBA 4C8LA 3CJ9A 3THVA 3MXJA 3HSCA 3J7AP 5IWAK 4CZFA 2ZD1A 3O8MA 3ZT1A 3CJAA 2YX6A 3WXLA 1WNSA 4BGAA 1SKWA 4B1YB 3ZT2A 3VF4A 2XY7A 3J81O 3AA5X 2A3ZA 3EL2A 4YNQA 3C65A 1IG9A 3PO4A 4CE9A 4IFVA 1WSIA 4FLVA 3CJBA 4HUEA 5GAEP 4B08A 4B9VA 4W5QA 3CPEA 3ALYA 1GLBG 1KFDA 3TANA 1NOZA 4BC3A 2UXBK 3LP1A 4KTQA 1GOBA 1T7PA 1YVNA 2DFEA 3VEOA 3EEQA 3I0RA 4JV5K 3O4QA 2NNWA 3R9PA 3H1QA 1Q9YA 2E1YA 1X1PA 4A5AA 3OS0A 1IBLK 2YJEA 3SQ1A 1HJRA 1J6ZA 3K57A 4M45A 3TSUA 4E7IA 4JKEA 2X74A 4FJIA 3HP9A 1KC8O 4KHPK 1BA0A 2BUPA 3GOIA 5HBMA 2Q1NA 4BE1A 4DR5K 5LL6Z 1KCFA 3O9RA 3RR7A 3DWLA 1HMVA 1N33K 4B3SK 2G8HA 2X6NA 1SUQA 1RDBA 4J8FA 3KJVA 2O8EA 3WEEB 4CIGA 4IWVA 1J54A 1TAQA 3ZEUB 2QI2A 3VEZA 4N41A 2P9NA 1KQSM 5AFUA 3THXB 4H0YB 2OPRA 4R79A 3MEDA 1SS6A 4PA1A 2YHXA 1RT2A 4FWNA 1NJYA 2PFUA 3F73A 3FFKB 4CJPA 4OKKA 1IKXA 5AZIA 1T3VA 4CEOA 4Z4HA 4DV6K 2Q36A 2P9PB 2UYTA 3TTCA 3C7NB 4CHOA 3MXIA 3VA0A 4A5BA 4ISGA 3EKUA 3L4IA 1SKRA 3LWMA 1OVYA 2V52B 3OYMA 1Y97A 4IFYA 1P8ZA 3AVNA 3SQ4A 2E8AA 5AFUH 4W5OA 1UA1A 3CJ1A 2E6LA 2YNFA 3V6DA 3CF5L 1U47A 4ELUA 3WNFA 1RTHA 3RRHA 3IUCA 4DV2K 4H5VA 2HBKA 4BR5A 1S3XA 1ASVA 4LFBK 3OYAA 2XRIA 4FJ7A 4OO1J 5F0XA 3D6RA 2P1JA 1VK0A 4GKKK 1NGGA 1JLEA 4FWSA 4HTLA 2QWPA 1EKEA 3O1BA 3V1OA 3NDKA 4JRQA 3PX0A 1TUYA 3HPHA 4FJ5A 4KREA 3VGKA 1T6CA 3V1QA 4K41A 3A8YA 4O44A 4WE1A 1T8EA 3VPZA 2J4RA 4CEBA 5AZJB 3L0QA 2A40A 3IRXA 3SMSA 3QBXA 5HROA 2ZE2A 4C8OA 4FJLA 3M8RA 1DLOA 2VWJA 2VQEK 1IJJA 3HBTA 1QVGM 2VWKA 1J5OA 1VSDA 2YKNA 4MDBA 3DAWA 1C1AA 2EX3A 4A57A 3KVGA 4Z0UA 3QMLA 3WXJA 4O4GA 1W2BM 4IOAL 4W5NA 1HNXK 4BDPA 3QEWA 5BR8K 1FXXA 3N4PA 4CJTA 1T03A 3MX5A 1TGOA 1WUAA 2E1ZA 3SQ2A 2DTUA 3MN7A 4BC4A 5M1FA 1GLFO 3P38A 1CXQA 3ID8A 4FJXA 2Y1JA 4FVUA 3FR0A 2F9WA 4DFJA 3ZX3A 4JI8K 1NGAA 2GX9A 3UB5A 4DSIA 5CR4A 1JLFA 4DQSA 1ZBLA 1F21A 4CF9A 1TK8A 4X65K 3C6TA 1QSYA 4BROA 3CCMN 4UQGA 4JI2K 4DV0K 3SUOA 4GV3A 2P9UA 3ISNC 4H5WA 4DV7K 1NK4A 5JLHA 4M3TA 3KK1A 4O55A 4FOIA 5AQUA 3VOVA 3O4WA 3FZMA 3U3GA 2AJQA 4KRFA 5SWMA 1CXUA 2YJFA 4LF8K 5AQKA 1JL2A 4WFBL 3VF6A 1WAJA 3QICA 4IJNA 4OKEA 4CFDA 2OPSA 3M6GA 5BPNA 1NK8A 4KHYA 1DTQA 1BISA 1U6ZA 2O8FA 3D2EA 1W7AA 3CCLN 4FK4A 4CGDA 1K8AO 2ITGA 4X62K 3ZSYA 5GIOA 1QQCA 4Z94A 5BPLA 1NJWA 4CGHA 3AAPA 2PY5A 1HKBA 1S22A 1KVBA 1VQ8N 4FLZA 3THWB 5C2DA 2E88A 1KD1O 4OPKA 2QA4N 1NK0A 3PIOL 3CFPA 3ZSQA 4X66K 3U9DA 4BRQA 4A62A 4C8KA 4CJQA 4UY8O 5BRFA 4FCYA 1WN7A 4OLBA 1S1XA 3SAHA 4RWTA 4FLWA 1JXEA 3OJSA 4DSJA 3QERA 2GELA 3G10A 3HOSA 1TYQB 3ULEB 3FE1A 3S9HA 3Q7BA 4FXDA 3SLCA 2KFNA 4MLEA 3CCUN 4U7BA 3OHRA 4QCLA 1Y64A 1OKJA 3H45C 1JLCA 2RE2A 1JCFA 4MO5A 1ATNA 3U4LA 3D2FB 3CMEN 3C6HA 3K5OA 1Z6RA 3BEXA 3HP6A 2P9KB 5AQPA 3RSEB 1E4FT 1LAVA 2QWOA 3H6EA 1Z26A 3QEVA 2Q0RA 2A1RA 1TKTA 4X64K 1WSFA 5GAGP 3KIOA 4GW6A 3HM9A 2HBJA 1IKYA 4CIFA 2RHKA 3S3MA 1O1WA 1SQKA 3KLIA 4FZYA 4LF4K 4Z4FA 3DXKA 5J2PA 2A41A 3QNOA 1Q81O 4CJ4A 4GY2B 1NJZA 1ZC6A 3V81A 4N76A 3J8AA 3L3VA 4CF8A 2OZSA 5M1QA 1YI2N 1FJGK 4FJHA 3J7ZO 3TU5A 1RT7A 1HX1A 3QEPA 2HHXA 3KTQA 3CI5A 4DMNA 4B9MA 4CGJA 4JI7K 1S6PA 3EE8A 2IGIA 1RT1A 2IC3A 4B8AB 4FLXA 1QE1A 4E1NA 4BR9A 4E7HA 1RT3A 1I3AA 4MFBA 4CF2A 5GIPA 4BACA 1VSMA 1U2VB 4CJSA 5E41A 4JD2B 4BR2A 4H0TB 3AVHA 2E2OA 2DFFA 4CHYA 1YHQN 1YIJN 3F5TA 1K6YA 4PQUA 2W6KA 4AHTA 2NRVA 2HW3A 1GLEG 4I7FA 2Q31A 3SAGA 2HNZA 1VAZA 1D9FA 1JJ2M 2O8CB 2QKKA 3L3UA 4YFUA 4DV3K 1W9HA 4PKGA 3OVNA 2UUCK 3M8SA 3O6WA 4WQ4C 1Q9XA 1EWQA 4NLCA 3RTVA 2F8SA 2P9SA 2ZWHA 4CD3A 3OS2A 4BG9A 4O0IA 4WYBA 2PAVA 1ZBUA 4RW8A 4CBWA 3I56N 1S1UA 1QZ5A 4BRAA 1LCUA 3H3OB 5C10A 4IZ9A 2VWBA 3VQAA 4JYAK 3KKSA 3TR8A 3QDKA 4BRIA 4JKGA 4OX9K 4E7JA 3AA4A 1NLVA 3SUQA 1BU6O 1HJOA 4FW1A 1ATSA 2QXFA 2ITMA 2E5LK 2G8UA 3ULDA 2OYQA 3KKRA 4KV8A 5EU7A 1R0AA 3UIQA 4QS8A 4FJNA 2GUPA 1KSPA 1SAZA 2X6SA 1IBMK 2YHAA 1XC9A 3PLAA 3OA9A 4H5NA 3ITHA 3UKRB 2B6AA 5DK5A 1GOCA 1HRHA 1RDUA 3ZT0A 3M8PA 3W3DA 4FVMA 2H3GX 4CBXA 3NCIA 4KI4A 3KHYA 4CERA 2IS3A 3I33A 1RILA 2XO7A 1HKCA 4CHZA 3CJ7A 1I39A 5CY4A 1VQ6N 4KHWA 3AGRA 1NGJA 4HCCA 2ZJRL 2IOCA 3WEEA 3UKUA 1QVFM 3VQCA 4H8KA 5C12A 4DFPA 2IVNA 2IVPA 3DOLA 4V19S 3VENA 1IG8A 4O5BA 3THXA 3DI6A 1ASUA 1TL3A 1KLMA 3ZX2A 1LW0A 4B8CA 3AVLA 3QFPA 4DSFA 5J2MA 1OH5A 1NMNA 3EKSA 3I0SA 2FC0A 1VQ5N 3D0PA 4QOZB 4IDHA 1BQMA 2HHHK 4CJRA 3C7NA 1NKEA 4AHRA 3B6OA 4BVPA 4DF4A 2ZQBA 3A0IX 2NRWA 4FZZA 1NGCA 4JS5A 1ZBHA 1C1CA 1KXPA 1NNEA 4NYNA 5JICA 4G9ZA 3G25A 4ILGB 4FK2A 1KAYA 3MEGA 1DKGD 4RCHA 1WB9A 4CJWA 3C0BA 4H5RA 1N34K 4FLTA 4AH9A 4BRKA 3WNHA 3AVGA 4BDZA 4FJ9A 3VQ7A 3LDPA 1WBDA 3JYTA 2HHTA 3AO5A 2HBMA 4KI6A 4YHHK 3AVCA 4CZEA 4HWIA 4IOXA 3B8AX 2FBYA 4XH5A 3C6AA 5EY4A 3AO1A 1RDDA 1N36K 1VQNN 4QS9A 2QWQA 3U9ZA 2RN2A 1RDWX 4KKOA 2P5OA 1DGKN 3QEXA 3VQ4A 5AZJA 1ATRA 4RTFD 3O3HA 5DM7L 3V9UA 5AJ3K 4ICLA 4GMJB 2HVHA 4YORA 2IAJA 3WXMB 1BWFO 4NB4A 1GLLO 3PX6A 2IIRA 2FF3B 3VEWA 5AQJA 3P1GA 5JVHL 3VESA 3CM5A 3K9KA 3PY8A 2YHBA 4CBUA 1TUUA 4Q5VA 4E19A 3SI6A 4EHUA 3CC2N 2FSNA 2YV0X 4J2BA 1JL1A 2AP1A 4XH4A 4DLEA 4YY3K 5IT9O 2Q2RA 4CK2A 2W6LA 3NFAA 4A59A 4DG1A 3CCSN 1YT3A 4OPJA 4IOCL 4PUOA 2P51A 3TPQA 1D9DA 3MN5A 4H0PA 5CZ1A 3OS1A 4MDAA 3OJUA 3QNNA 4FJGA 4CI6A 1NGBA 3MMVA 4K8ZA 4DR1K 4N5SA 3VTHA 5JS1A 5F2RA 2HNYA 2HHVA 3VQPA 4Z4CA 5HOOA 5EXWA 1JLGA 3NH0A 4NCGA 3AAQA 1HNZK 1SKSA 4KHQA 3MECA 3K0SA 3O9TA 1N6QA 4KO0A 2FXUA 3L2VA 3A2FA 4FJ8A 5KTQA 4DTUA 2OPQA 1NKCA 1BCOA 4CEDA 3MN9A 3NF7A 5FPEA 2YCHA 1NGEA 2KQ2A 4GNIA 1TL1A 3HTVA 4JKDA 3BGRA 4KH6A 1A5VA 3CHWA 2ASOA 2Z1JA 4PWDA 4BRFA 1HUXA 4LC9B 1NM1A 5FPNA 4K25A 3KK2A 2E6MA 1U48A 4F2SA 3VEXA 4ISEA 1P90A 3WNEA 1WSEA 2OZMA 3CQ8A 4Z4IA 4OPHA 3CXCM 3K5LA 2D4WA 1O13A 3RMAA 3TTFA 3WNGA 1NK6A 4I2QA 4M3YA 3OYLA 1BL3A 4ISFA 2ZJPL 2PYLA 1FKPA 4I6MA 4N47A 1BIZA 4A61A 4BE0A 3RMBA 4H0XB 5HL7L 1WSJA 4FWPA 4ID1A 3RR8A 2D0AA 1ILYA 1HNVA 3K9JA 4OVLA 5EVZA 4CJLA 3L2RA 4GVEA 1LWEA 3IKMA 3QIPA 3M3ZA 4DS4A 3MXMA 4I9LA 1VQ9N 2JWLA 4DTJA 3HJFA 5B8HA 1VQON 4DFMA 3MDQA 4IG0A 3KD5E 1BIUA 2ASMA 4C8MA 3CC7N 3NGZA 1BG3A 1ESVA 2XY8A 1TYQA 1RBTA 4FPAA 2V7ZA 5LJWA 2OCEA 1SL0A 4DQ8A 4HVJA 1XMOK 4IO8A 4HUGA 1C0TA 3O9UA 4EIAA 1SL2A 4JI4K 1K8KB 1TKZA 4BRGA 1C0MA 4YOTA 4CGGA 3FFIA 1TKXA 1VSHA 5KGXA 3TAPA 5D3GA 2P9KA 3RSEA 1XC3A 4LF7K 3SNNA 4CFCA 5FLXO 1VSFA 3T69A 5LY3A 4W5TA 1QQMA 4ZTJA 2Z1IA 4TSXA 3SZ2A 3IG1A 1IV0A 4FL9A 3R1XA 1WSGA 4B9NA 3OYHA 4RW7A 2BE2A 1EWRA 3CCQN 2O4IA 2O8EB 4OKJA 1EO1A 3QESA 3OYKA 2UU9K 3OYGA 4C8NA 1EQYA 2BTFA 2GWKA 2IDOA 1NK5A 4B1WB 2W41A 3OYEA 4OPAA 4FOEA 4RW6A 3CERA 5AZIB 3DYAA 4FJMA 1D5AA 4H0OA 1FK9A 3PIPL 4IEIA 4DS5A 3CCVN 4NXMK 4IDKA 5JS2A 3VQDA 1XI1A 4E3SA 4B3OA 5KQDA 3WUHA 3HO1A 2O8BA 4DTPA 3OYJA 5DM6L 4CD1A 5KPZA 1G99A 3IMXA 4O5FA 3ZLJA 1OH8A 3DLHA 3SUPA 1YJWN 4LFAK 1U2VA 4K42A 2VCPA 3AVIA 3IAYA 4XIUA 4JD2A 1XHXA 4IO9L 3EYZA 2V51B 3L6QA 4JI6K 1S9EA 3I8DA 3OY9A 2NZTA 3TAMA 3I8BA 4AHUA 3H46O 2ATQA 4DV1K 4WQ4A 4J2AA 1RT4A 3LWLA 3ZSZA 1KVAA 3VEVA 3DRRA 2HBLA 2HHUA 4JLHA 3LZIA 3ATVA 3FZFA 4H4OA 3H08A 3QFUA 2ZGZA 4K43A 4AM7A 4B9QA 1X3NA 2VG7A 1QS4A 2GWJA 2X78A 4DTRA 3T1AA 3GL1A 4I9QA 2FSJA 3O5BA 1RT5A 2CGLA 4F2RA 4KHNA 3DXMB
chains in the Genus database with same CATH topology
3ULEA 5GAEP 1Z05A 3FLCO 3DXMA 1C0FA 3EN9A 3JXUA 3CPEA 1NLVA 2QWRA 1GLBG 3ENOA 3NMUA 1BU6O 1HJOA 2FSKA 3HRGA 4BC2A 4BC3A 1ATSA 3VMFB 2ITMA 2NRZA 4E1JA 1YVNA 3FZHA 5AQLA 3VEOA 1YITN 3WXKA 3LM2A 1T44A 4WF9L 2NNWA 3D2FA 3H1QA 1R59O 2E1YA 4FWRA 3R9PA 2OTJN 4QS8A 2GUPA 2D0OA 4A5AA 1SAZA 2YJEA 3LDQA 1J6ZA 3AGKA 4BC5A 3TSUA 3E9OA 3PLAA 3OA9A 4H5NA 4JKEA 4MLHA 3UE5A 1QZ6A 1KC8O 1BA0A 3UKRB 3CIPA 2QWNA 1RDUA 2BUPA 5E26A 3GOIA 3W3DA 5C2FA 1DEJA 1V4SA 2Q1NA 5AQIA 2H3GX 3CQYA 2VGNA 3O9RA 4JEPA 4CBXA 3KHYA 3OBYA 4Y0WA 3MN6A 3DWLA 3I33A 1HKCA 1NGIA 5E84A 3TTDA 5BN8A 3CJ7A 1VQ6N 4J8FA 3AGRA 3WEEB 1NGJA 1GLAG 2P9NB 2ZJRL 4IWVA 5M1NA 3LDLA 3MCAB 2QI2A 4IEEA 3UKUA 3VEZA 2P9NA 3WEEA 3ZEUB 1KQSM 5AFUA 1QVFM 3FZKA 2QTDA 3WQTA 5C12A 4H0YB 1MWKA 2IVNA 4PL8A 4R79A 2IVPA 5AQNA 3VENA 1IG8A 1SS6A 2YHXA 4FWNA 2PFUA 4WQ5A 3FFKB 1YAGA 1HPMA 4O8UA 1E4GT 3ZX2A 3QFPA 5AZIA 3TSPA 1K73O 1T3VA 3HZ6A 2JWKA 3EKSA 5BPMA 1XUPO 1VQ5N 2Q36A 1BO5O 2UYTA 2ASPA 2P9PB 3VEYA 3TTCA 5BRDA 4BVOA 3C7NB 4IDHA 4CJ7A 2YHYA 5C0YA 4A5BA 4ISGA 1W97L 2WUSA 3N4QA 3C7NA 2CH6A 4QS7A 3EKUA 3L4IA 3BF3A 3VGMA 1OVYA 2V52B 4AM6A 1Q82O 4WFNL 1RGIA 5JLFA 1P8ZA 3MWPA 4AF1A 4BVPA 3BUZB 3IDHA 5LJVA 1MDUB 2E8AA 2NRWA 1HLUA 3A0IX 3LM9A 5AFUH 3IFRA 3G6EN 2VGMA 3GG4A 1NGCA 3CJ1A 4EFHA 2V7YA 3GDQA 2W40A 3CF5L 1KXPA 5JICA 4G9ZA 2I7NA 3G25A 2Q0UA 4ILGB 1KAYA 4FWKA 3ENBA 1DKGD 3E66A 4RCHA 4JAXA 3IUCA 4H5VA 1YXQA 2HBKA 4BR5A 1S3XA 2P9IB 3C0BA 1Q7YO 4H5RA 4CZLA 4KBOA 2P9IA 1QQNA 3H1VX 3HI0A 1H1VA 5AQSA 5F0XA 4OO1J 3D6RA 5FPDA 2QM1A 4BRKA 1NGGA 4YOYA 4FWSA 4HTLA 1YF5L 2QWPA 3KK7A 3O1BA 3LDPA 2QWLA 4I6MB 3ATUA 1ZXOA 1TUYA 2HBMA 3WQUA 4CZEA 3P31A 4IFEA 4HWIA 4IOXA 3B8AX 3VGKA 4JK9A 4XH5A 1T6CA 2YI1A 3C6AA 2PBDA 1Q18A 3QBWA 3A8YA 4K41A 5EY4A 4JKBA 1VQNN 2HSTA 2QWQA 4QS9A 3VPZA 4B1ZA 2J4RA 3U9ZA 4BRHA 1RDWX 5AZJB 4DHYA 5H1SQ 3L0QA 5BR9A 4B1VA 2YHWA 2A40A 3SMSA 1DGKN 3QBXA 5AZJA 1ATRA 4RTFD 5DM7L 3CPWM 4KH4A 4PL7A 5I9EB 1IJJA 3HBTA 4YORA 3WXMB 1QVGM 3E1YA 4FPBA 1BWFO 3WXIA 4NB4A 1YUWA 4FWMA 1CZAN 3CC4N 2GEMA 4MDBA 1GLLO 2CGKA 3DAWA 5AQMA 2IIRA 2FF3B 3VEWA 5AQJA 5JVHL 2A5XA 3VESA 4A57A 3K9KA 3KVGA 4FWOA 4CBUA 1TUUA 3TSQA 3QMLA 1RFQA 3DJCA 2NRRA 3GE1A 3WXJA 4EHUA 3CC2N 2FSNA 1W2BM 4IOAL 2ZGYA 4BRPA 3S41A 2AP1A 3N4PA 4XH4A 1VQMN 3MX5A 3A5NC 3SK3A 3UKRA 2Q2RA 3O9QA 5EOYA 1WUAA 3U8XA 2E1ZA 1NMDA 1NWKA 2E2PA 4CZKA 2P9LB 5KPRA 3MN7A 4BC4A 1QQOA 5M1FA 3F2KA 1GLFO 4A59A 1C0GA 3P38A 3ID8A 1MWMA 2P9LA 3CCSN 3M1FA 4FVUA 3FR0A 4IOCL 2F9WA 3TPQA 4BRMA 4C23A 1NGHA 3MWTA 3MN5A 4H0PA 4A2BA 3CD6N 4MDAA 3ZX3A 4CZGA 2AA4A 4WCEL 1X9JA 1NGAA 5AQRA 3KWGA 2GX9A 3UB5A 4CI6A 1S72N 1NGBA 3MMVA 5CR4A 4JKFA 1NBWA 2ZF5O 3WT0A 3VTHA 3ZEUA 4JKHA 5F2RA 2CH5A 2WFBA 3L4QA 3MCPA 5MLCQ 4H5TA 5HOOA 4BROA 3CCMN 5JVGL 5EXWA 3LL3A 2P9UB 5AQOA 3AAQA 3W0LA 4GV3A 1JCGA 1KAXA 2E2QA 2P9UA 3O9TA 2FXUA 4H5WA 4CZIA 3SMPA 5JLHA 4PKIA 2P9PA 4FOIA 5KQ8A 1GLJO 5ELZA 2IVOA 1VQPN 4BRDA 5AQUA 3VOVA 3O4WA 3FZMA 1DT9A 1VQ4N 5AQWA 4CZJA 5AQGA 3MN9A 5FPEA 2YCHA 1NGEA 2WC9A 4GNIA 4FWQA 2YJFA 3HTVA 4JKDA 3SBTA 1YJ9N 5AQKA 3O1WA 4KH6A 3CETA 4B1XB 4BRCA 4WFBL 3VTIA 1ZBSA 3P39A 3VF6A 3QICA 3CHWA 4IJNA 2A6AA 2HOEA 2ASOA 1VQKN 4BRFA 2A42A 1HUXA 4LC9B 3D2EB 3NVKA 3M6GA 5BPNA 1NM1A 5FPNA 1SZ2A 2I7PA 3E9PA 4K25A 4DB3A 1U6ZA 4PHTX 3D2EA 1QHAA 3CCLN 2CGJA 3VERA 5M1PA 1K8AO 5AR0A 2F7TA 3AARA 4IXCA 5GIOA 3GBTA 3VEXA 3LDOA 2KLAA 4Z94A 5BPLA 4ISEA 1P90A 4C1NK 5AQHA 4WFAL 5BREA 2E2NA 3AAPA 2KHOA 1KAZA 4OPHA 3CXCM 3H3NO 2D4WA 1HKBA 1O13A 1S22A 4JK8A 4B1UB 4A2AA 4BY9C 2FLOA 3TTFA 3EZWA 2GTDA 4JNEA 1VQ8N 4JKAA 5TKWA 3A5MC 4H03B 4M7XA 3KWIA 3CCRN 2HMPA 4ISFA 5ADXA 2ZJPL 5AQTA 5C2DA 2E88A 1KD1O 2HF3A 3OBWA 4CZMA 3FGUA 5AQZA 2ZJQL 4I6MA 2QEXN 4A61A 2QA4N 4H0XB 4O8KA 3PIOL 5HL7L 1NJIO 2D1KA 4FWPA 2D0PA 3ENHA 3U9DA 1ILYA 3K9JA 4A62A 5EVZA 4BRQA 4UY8O 2F9TA 5BRFA 5JMVA 2NRTA 4ILHA 1K9MO 5TKYA 4GV9A 4EHTA 4GVEA 3SAHA 3BF1A 4RWTA 3IKMA 3CMAN 1GLDG 3R3LA 4KH5A 4BRLA 4YOXA 2GELA 3M3ZA 1VQ9N 2JWLA 3E9LA 5B8HA 2VYPA 1TYQB 3HOSA 2DPNA 3MDQA 1VQON 1M1KO 2ASMA 1BUPA 4JKGB 3O80A 3CC7N 3ULEB 1BG3A 3ZETB 1ESVA 3FE1A 1TYQA 3Q7BA 4BQZA 4FPAA 3SLCA 4MLEA 2BH1A 2V7ZA 1X3MA 4BGBA 3VF2A 3ZETA 5LJWA 3R6MA 3CQXA 3CCUN 4DQ8A 4U7BA 3EE9A 3OHRA 5AQXA 5BRHA 5ADXH 3P4IA 4IO8A 5AQVA 3D7EO 3VGLA 3QB0A 1Y64A 1OKJA 3H45C 5C15A 3O9UA 2RE2A 4EIAA 1JCFA 5KPTA 1K8KB 1JCEA 4MO5A 5CHIA 1ATNA 3O9SA 3U4LA 4BRGA 1NGFA 4YOTA 3D2FB 3ZYYX 3CMEN 3C6HA 4M7YA 1Z6RA 3BEXA 1K8KA 4JN4A 4FSVA 2P9KB 5AQPA 3RSEB 1E4FT 3JS6A 1V4TA 2QWOA 3H6EA 2P9KA 3RSEA 2Q0RA 3G71N 1XC3A 5GAGP 4BR0A 5CE3A 2HF4A 3T69A 5LY3A 3A5OC 2WBNA 1QQMA 4MO4A 5AQFA 1WOQA 2HBJA 4BRNA 3G4SN 2OTLN 1BA1A 2RHKA 4BREA 3DXKB 1VQ7N 4XH1A 1SQKA 3CJCA 4H0VB 4FL9A 3R1XA 4DCHA 1BOTO 3DXKA 4L3QA 4NO7A 1XQSC 2A41A 1Q81O 3CCQN 3FZLA 4GY2B 1M90O 3Q7CA 1ZC6A 2E20A 1EO1A 1N8RO 3J8AA 3F9MA 4YDUA 4EAHD 3UKUB 1EQYA 5M1QA 4ILJA 2BTFA 2GWKA 3HOTA 5BN9A 3CCJN 1YI2N 2NRHA 4YDUC 4B1WB 4M63C 3J7ZO 4BR7A 3TU5A 3ZX0A 3CCEN 1HX1A 2W41A 3MK6A 2EWSA 4OPAA 4C1NI 3VETA 5F1XA 4GV6A 4FOEA 3NVMA 3ID6A 2OANA 3BP8A 3CERA 5AZIB 3CI5A 4BQLA 4BG8A 5M1KA 3PIPL 4H0OA 3O08A 4IEIA 5FPMA 3EE8A 3CCVN 4CZHA 3MX2A 5AQYA 3R8EA 2QW9A 5GAHP 4WQ5C 1GLCG 3I55N 1LOTB 4NLBA 4BR9A 3LDNA 5GADP 1MA9B 5KQDA 4YOUA 3WUHA 5GIPA 1T6DA 4CD1A 5DM6L 1U2VB 5AQQA 5KPZA 1G99A 1NGDA 3IMXA 4O5FA 4JD2B 4BR2A 4H0TB 5M1OA 3RVCA 3DLLL 1YJWN 1U2VA 4K42A 2VCPA 2E2OA 3A5LC 4JD2A 5EX5A 1VQLN 4IO9L 3SBGA 1YHQN 4F9OA 4BR4A 1YIJN 1YJNN 4DKWA 3F5TA 2V51B 3HM8A 3EO3A 3L6QA 2NRVA 1GLEG 3OW2M 2Q31A 2NZTA 3T7ZA 3SAGA 3I8BA 1VAZA 3H46O 2QXLA 1BDGA 1JJ2M 4FO0A 2NLXA 2QWMA 4JKCA 4U67L 5GINA 4WQ4A 3M5RA 4JHDB 4PKHA 2FF6A 3VEVA 4IJAA 4PKGA 3SJHA 2HBLA 4JHDA 2P9SB 1HKGA 3O6WA 2Q97A 4WQ4C 4JK7A 3KZBA 3ATVA 3AY9A 3CJ9A 3FZFA 4NLCA 2NRXA 3QFUA 2ZGZA 4K43A 2P9SA 3HSCA 2ZWHA 4AM7A 4CD3A 3SAFA 4BG9A 4B9QA 4CZFA 4YOVA 1X3NA 4WYBA 3O8MA 2PAVA 2GWJA 4CBWA 4FWLA 3I56N 3CJAA 2YX6A 1D4XA 1QZ5A 4BRAA 3GL1A 3WXLA 1LCUA 4BGAA 3H3OB 4B1YB 2FSJA 3VF4A 5C10A 1Q86O 4IZ9A 2VWBA 3O5BA 2A3ZA 3EL2A 2CGLA 3C65A 4XEIA 2KKZA 3DXMB 3QDKA 4BRIA 3CJBA 4JKGA 4YOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULE A;  1Z05 A;  3FLC O;  3DXM A;  1C0F A;  3EN9 A;  3JXU A;  1NLV A;  2QWR A;  1GLB G;  3ENO A;  1BU6 O;  1HJO A;  2FSK A;  4BC2 A;  4BC3 A;  1ATS A;  2ITM A;  4E1J A;  1YVN A;  3FZH A;  5AQL A;  3VEO A;  3WXK A;  3LM2 A;  1T44 A;  3R9P A;  3D2F A;  3H1Q A;  1R59 O;  2E1Y A;  4FWR A;  4QS8 A;  2GUP A;  2D0O A;  1SAZ A;  2YJE A;  3LDQ A;  1J6Z A;  4BC5 A;  4H5N A;  4MLH A;  3UE5 A;  1QZ6 A;  1BA0 A;  3UKR B;  3CIP A;  2QWN A;  2BUP A;  5E26 A;  3GOI A;  3W3D A;  1DEJ A;  1V4S A;  2Q1N A;  5AQI A;  2H3G X;  3CQY A;  4CBX A;  3KHY A;  4Y0W A;  3MN6 A;  3DWL A;  3I33 A;  1HKC A;  1NGI A;  5E84 A;  5BN8 A;  3CJ7 A;  4J8F A;  3WEE B;  1NGJ A;  1GLA G;  2P9N B;  4IWV A;  3LDL A;  3WEE A;  3VEZ A;  3ZEU B;  3UKU A;  2P9N A;  5AFU A;  3FZK A;  3WQT A;  4H0Y B;  1MWK A;  2IVN A;  4PL8 A;  2IVP A;  5AQN A;  3VEN A;  1IG8 A;  2YHX A;  4FWN A;  4WQ5 A;  3FFK B;  1YAG A;  1HPM A;  1E4G T;  3ZX2 A;  3QFP A;  5AZI A;  3HZ6 A;  3EKS A;  5BPM A;  1XUP O;  2Q36 A;  1BO5 O;  2UYT A;  2ASP A;  2P9P B;  3VEY A;  5BRD A;  4BVO A;  3C7N B;  4CJ7 A;  2YHY A;  4ISG A;  2WUS A;  3C7N A;  2CH6 A;  4QS7 A;  3EKU A;  3L4I A;  3BF3 A;  3VGM A;  2V52 B;  4AM6 A;  1RGI A;  5JLF A;  1P8Z A;  4BVP A;  3BUZ B;  3IDH A;  5LJV A;  1MDU B;  2E8A A;  3A0I X;  1HLU A;  3LM9 A;  5AFU H;  3IFR A;  3GG4 A;  1NGC A;  3CJ1 A;  4EFH A;  2V7Y A;  3GDQ A;  2W40 A;  1KXP A;  5JIC A;  2I7N A;  3G25 A;  2Q0U A;  1KAY A;  4FWK A;  1DKG D;  4RCH A;  4JAX A;  3IUC A;  4H5V A;  1YXQ A;  4BR5 A;  1S3X A;  2P9I B;  3C0B A;  4H5R A;  4CZL A;  4KBO A;  2P9I A;  1QQN A;  3H1V X;  3HI0 A;  1H1V A;  5AQS A;  5F0X A;  5FPD A;  2QM1 A;  4BRK A;  1NGG A;  4FWS A;  4HTL A;  2QWP A;  3O1B A;  3LDP A;  2QWL A;  4I6M B;  3ATU A;  1ZXO A;  1TUY A;  3WQU A;  4CZE A;  4HWI A;  3B8A X;  3VGK A;  4XH5 A;  1T6C A;  2YI1 A;  2PBD A;  1Q18 A;  3QBW A;  3A8Y A;  4K41 A;  5EY4 A;  4QS9 A;  2QWQ A;  3VPZ A;  4B1Z A;  4DHY A;  2J4R A;  3U9Z A;  4BRH A;  1RDW X;  5AZJ B;  3L0Q A;  5BR9 A;  4B1V A;  2YHW A;  2A40 A;  3SMS A;  1DGK N;  3QBX A;  5AZJ A;  1ATR A;  4RTF D;  4PL7 A;  5I9E B;  1IJJ A;  3HBT A;  4FPB A;  1BWF O;  3WXI A;  4NB4 A;  1YUW A;  4FWM A;  1CZA N;  2GEM A;  1GLL O;  2CGK A;  3DAW A;  5AQM A;  2IIR A;  2FF3 B;  3VEW A;  5AQJ A;  2A5X A;  3VES A;  3KVG A;  4FWO A;  4CBU A;  1TUU A;  3QML A;  1RFQ A;  3DJC A;  3GE1 A;  3WXJ A;  4EHU A;  2FSN A;  2ZGY A;  4BRP A;  3S41 A;  2AP1 A;  4XH4 A;  3SK3 A;  3A5N C;  3UKR A;  2Q2R A;  5EOY A;  3U8X A;  1WUA A;  2E1Z A;  1NMD A;  1NWK A;  2E2P A;  4CZK A;  2P9L B;  5KPR A;  3MN7 A;  4BC4 A;  1QQO A;  1GLF O;  1C0G A;  3ID8 A;  1MWM A;  2P9L A;  3M1F A;  3FR0 A;  2F9W A;  3TPQ A;  4BRM A;  4C23 A;  1NGH A;  3MN5 A;  4H0P A;  4A2B A;  3ZX3 A;  4CZG A;  2AA4 A;  1X9J A;  1NGA A;  5AQR A;  4CI6 A;  3UB5 A;  1NGB A;  3MMV A;  3ZEU A;  1NBW A;  2ZF5 O;  3WT0 A;  5F2R A;  2CH5 A;  3MCP A;  4H5T A;  4BRO A;  5EXW A;  3LL3 A;  2P9U B;  5AQO A;  3AAQ A;  3W0L A;  1JCG A;  1KAX A;  2E2Q A;  2P9U A;  2FXU A;  4H5W A;  4CZI A;  3SMP A;  5JLH A;  4PKI A;  2P9P A;  4FOI A;  5KQ8 A;  1GLJ O;  5ELZ A;  2IVO A;  4BRD A;  5AQU A;  3VOV A;  3O4W A;  3FZM A;  5AQW A;  4CZJ A;  5AQG A;  3MN9 A;  5FPE A;  2YCH A;  1NGE A;  4GNI A;  4FWQ A;  2YJF A;  3HTV A;  5AQK A;  3O1W A;  4B1X B;  3CET A;  4BRC A;  1ZBS A;  3VF6 A;  3QIC A;  3CHW A;  4IJN A;  2A6A A;  2HOE A;  2ASO A;  4BRF A;  2A42 A;  1HUX A;  4LC9 B;  3D2E B;  3M6G A;  5BPN A;  1NM1 A;  5FPN A;  1SZ2 A;  2I7P A;  4K25 A;  4DB3 A;  1U6Z A;  3D2E A;  1QHA A;  2CGJ A;  3VER A;  5AR0 A;  3AAR A;  4IXC A;  3GBT A;  3VEX A;  3LDO A;  4Z94 A;  5BPL A;  4ISE A;  5AQH A;  5BRE A;  2E2N A;  3AAP A;  2KHO A;  1KAZ A;  3H3N O;  2D4W A;  1HKB A;  4B1U B;  1S22 A;  4A2A A;  2FLO A;  3EZW A;  2GTD A;  4JNE A;  3A5M C;  4H03 B;  4M7X A;  2HMP A;  4ISF A;  5ADX A;  5AQT A;  2E88 A;  2HF3 A;  4CZM A;  3FGU A;  5AQZ A;  4I6M A;  4A61 A;  4H0X B;  4O8K A;  2D1K A;  4FWP A;  2D0P A;  3ENH A;  3U9D A;  4BRQ A;  4A62 A;  5EVZ A;  2F9T A;  5BRF A;  5JMV A;  5TKY A;  4EHT A;  3BF1 A;  4RWT A;  1GLD G;  4BRL A;  2GEL A;  3M3Z A;  5B8H A;  2VYP A;  1TYQ B;  2DPN A;  3MDQ A;  2ASM A;  1BUP A;  3O80 A;  3ULE B;  1BG3 A;  3ZET B;  1ESV A;  3FE1 A;  1TYQ A;  4BQZ A;  4FPA A;  3SLC A;  4MLE A;  2V7Z A;  1X3M A;  4BGB A;  3VF2 A;  3ZET A;  5LJW A;  3R6M A;  3CQX A;  4DQ8 A;  3OHR A;  5AQX A;  5BRH A;  5ADX H;  3P4I A;  4IO8 A;  5AQV A;  3D7E O;  3VGL A;  3QB0 A;  1Y64 A;  1OKJ A;  3H45 C;  4EIA A;  1JCF A;  5KPT A;  1K8K B;  1JCE A;  4MO5 A;  1ATN A;  3U4L A;  4BRG A;  1NGF A;  3D2F B;  4M7Y A;  1Z6R A;  3BEX A;  1K8K A;  4JN4 A;  4FSV A;  2P9K B;  5AQP A;  3RSE B;  1E4F T;  3JS6 A;  1V4T A;  2QWO A;  3H6E A;  2P9K A;  3RSE A;  2Q0R A;  1XC3 A;  4BR0 A;  5CE3 A;  2HF4 A;  5LY3 A;  3A5O C;  1QQM A;  4MO4 A;  5AQF A;  1WOQ A;  4BRN A;  1BA1 A;  4BRE A;  3DXK B;  4XH1 A;  1SQK A;  3CJC A;  4H0V B;  4FL9 A;  4DCH A;  1BOT O;  3DXK A;  4L3Q A;  4NO7 A;  1XQS C;  2A41 A;  3FZL A;  4GY2 B;  1ZC6 A;  2E20 A;  3J8A A;  3F9M A;  4YDU A;  4EAH D;  3UKU B;  1EQY A;  2BTF A;  2GWK A;  5BN9 A;  2NRH A;  4YDU C;  4B1W B;  4M63 C;  4BR7 A;  3TU5 A;  3ZX0 A;  1HX1 A;  2W41 A;  3MK6 A;  2EWS A;  5F1X A;  3VET A;  4FOE A;  2OAN A;  3BP8 A;  3CER A;  5AZI B;  3CI5 A;  4BQL A;  4BG8 A;  4H0O A;  3O08 A;  5FPM A;  4CZH A;  5AQY A;  3R8E A;  2QW9 A;  4WQ5 C;  1GLC G;  1LOT B;  4BR9 A;  3LDN A;  1MA9 B;  5KQD A;  3WUH A;  1T6D A;  4CD1 A;  1U2V B;  5AQQ A;  5KPZ A;  1G99 A;  1NGD A;  3IMX A;  4O5F A;  4JD2 B;  4BR2 A;  4H0T B;  1U2V A;  4K42 A;  2VCP A;  2E2O A;  3A5L C;  4JD2 A;  5EX5 A;  4F9O A;  4BR4 A;  2V51 B;  3HM8 A;  3EO3 A;  3L6Q A;  1GLE G;  2Q31 A;  2NZT A;  3I8B A;  3H46 O;  2QXL A;  1BDG A;  4FO0 A;  2NLX A;  2QWM A;  4WQ4 A;  4JHD B;  4PKH A;  2FF6 A;  3VEV A;  4IJA A;  4PKG A;  3SJH A;  4JHD A;  2P9S B;  1HKG A;  3O6W A;  2Q97 A;  4WQ4 C;  3KZB A;  3ATV A;  3AY9 A;  3CJ9 A;  3FZF A;  3QFU A;  2ZGZ A;  4K43 A;  2P9S A;  3HSC A;  2ZWH A;  4AM7 A;  4CD3 A;  4BG9 A;  4B9Q A;  4CZF A;  1X3N A;  4WYB A;  3O8M A;  2PAV A;  2GWJ A;  4CBW A;  4FWL A;  3CJA A;  1D4X A;  1QZ5 A;  4BRA A;  3GL1 A;  3WXL A;  1LCU A;  4BGA A;  3H3O B;  4B1Y B;  2FSJ A;  3VF4 A;  4IZ9 A;  2VWB A;  3O5B A;  3EL2 A;  2A3Z A;  2CGL A;  4XEI A;  3DXM B;  3QDK A;  4BRI A;  3CJB A; 
#chains in the Genus database with same CATH topology
 1OH6 A;  1BCM A;  3FLC O;  1C0F A;  3EN9 A;  3JXU A;  4KPY A;  2QWR A;  3NH1 A;  2VG6 A;  4H4M A;  3ENO A;  1IH7 A;  2Q3S A;  3NMU A;  2FSK A;  4BC2 A;  1S1V A;  4B3M K;  2NRZ A;  1IKV A;  2FBV A;  3FZH A;  5AQL A;  3OYF A;  2XY6 A;  3WXK A;  1S5J A;  3LM2 A;  2VQF K;  4Q0B A;  4F3T A;  2OTJ N;  1R59 O;  3V9Z A;  2LSN A;  4FWR A;  3PX4 A;  1X9S A;  2D0O A;  4DWI A;  5A2Q O;  3DMJ A;  3AO4 A;  3HVT A;  1WBB A;  4JI3 K;  4MLH A;  1L5U A;  4M3X A;  3UE5 A;  4CFA A;  1QZ6 A;  1NG9 A;  3CIP A;  1V4S A;  3OYB A;  1UAX A;  1L3S A;  3CQY A;  4F4K A;  3K58 A;  3MN6 A;  3TTD A;  4DV5 K;  3QLH A;  4O0J A;  1SV5 A;  3SCX A;  1NK9 A;  3SPZ A;  1S9G A;  4CHQ A;  1GLA G;  5M1N A;  4IEE A;  3AVA A;  3C95 A;  2Z1G A;  3FZK A;  4E0D A;  1MWK A;  4CK3 A;  3C6U A;  1U4B A;  1C0U A;  4WQ5 A;  5FDL A;  1HPM A;  3V9W A;  2JGU A;  3VN5 A;  3HZ6 A;  4CJ5 A;  4DSL A;  4OGE A;  1E3M A;  2O8D B;  2W42 A;  1XUP O;  5BRD A;  4E7L A;  4CJ7 A;  1VSL A;  2YHY A;  3ZT4 A;  5LMN K;  1W97 L;  3N4Q A;  2CH6 A;  3VGM A;  5HLF A;  1Q82 O;  3E01 A;  1NKB A;  5HRN A;  4AF1 A;  4DQP A;  3IDH A;  5LJV A;  5J2N A;  1MDU B;  3TAQ A;  3P83 D;  2D0B A;  4AQY K;  3IFR A;  1JLA A;  3ZSV A;  4EFH A;  4CJF A;  2V7Y A;  4ID5 A;  2W40 A;  3LAN A;  2DFH A;  4CEQ A;  3F9K A;  2I7N A;  3AVJ A;  3QO9 A;  4E7K A;  3E66 A;  4JAX A;  1FW6 A;  2HHW A;  4BWM A;  2P9I B;  1Q7Y O;  5J2Q A;  1JLB A;  4CZL A;  2PYJ A;  4K8X A;  4DUY K;  3H1V X;  5AQS A;  1H1V A;  5FPD A;  1RTI A;  1HR0 K;  4YOY A;  1YF5 L;  3KK7 A;  3KLF A;  2Z1H A;  3U3Y A;  3VQQ A;  3ATU A;  2YNG A;  3AVF A;  3QBW A;  3VQE A;  3L2W A;  4JKB A;  2HST A;  4DHY A;  5C25 A;  3LAK A;  2NUB A;  4B1V A;  3V9S A;  4CJU A;  3SV4 A;  4AIL C;  4FYD A;  2FBT A;  4KH4 A;  1BQN A;  3NBP A;  3OTO K;  3ASM A;  1BI4 B;  3SJJ A;  3E1Y A;  3G0Z A;  3AV9 A;  4FPB A;  1RBR A;  1YUW A;  3PSI A;  4FWM A;  3DRP A;  3CC4 N;  4DSE A;  2A5X A;  4HTU A;  1EX4 A;  4DLG A;  3GE1 A;  1NK7 A;  4FLU A;  4BRP A;  1NJX A;  3QEI A;  4CEA A;  1VQM N;  3A5N C;  5EOY A;  2E2P A;  2P9L B;  5KPR A;  2YKM A;  4DR4 K;  1QQO A;  4RW9 A;  3O3F A;  3J80 O;  3F2K A;  2R7Y A;  3NH2 A;  1MWM A;  1DTT A;  1YTA A;  4CK1 A;  3CYM A;  4C23 A;  3MWT A;  3OYC A;  4BDY A;  3DLE A;  4CZG A;  4RG8 A;  1C6V A;  3O4N A;  4M42 A;  4WCE L;  1X9J A;  4B3R K;  3KWG A;  1S72 N;  3S3O A;  5HRR A;  1NBW A;  3AO3 A;  3AVM A;  3B6P A;  3WT0 A;  3ZEU A;  4JKH A;  3ZT3 A;  1Q8I A;  1UA0 A;  3L4Q A;  1N5Y A;  5MLC Q;  4H5T A;  5JVG L;  3LL3 A;  5AQO A;  3W0L A;  3LAM A;  2HHQ A;  1L3T A;  1KAX A;  1TVR A;  2E2Q A;  4CZI A;  5HP1 A;  1YVU A;  2P9P A;  5I42 A;  5KQ8 A;  5ELZ A;  2IVO A;  1VQP N;  1RBS A;  1DT9 A;  1VRU A;  5AQW A;  4CZJ A;  4DQR A;  3QET A;  4MQ3 A;  3NF6 A;  3BZK A;  4FWQ A;  4IG3 A;  3TAG A;  3SBT A;  4B1X B;  3O1W A;  3CET A;  3V1R A;  4BRC A;  1ITG A;  3VTI A;  1JLQ A;  3P39 A;  3AA3 A;  2A6A A;  3NVK A;  1JKH A;  3O3G A;  2YNH A;  2I7P A;  3E9P A;  2XHB A;  4PHT X;  4FM1 A;  1TK5 A;  2CGJ A;  4DQQ A;  5AR0 A;  1J9A A;  2GV9 A;  3AAR A;  4IXC A;  2HB5 A;  3LDO A;  3NGI A;  4C1N K;  4WFA L;  1LV5 A;  3VQ9 A;  5KRS A;  3H3N O;  4B1U B;  4JK8 A;  4BY9 C;  4A2A A;  3EZW A;  4JNE A;  4JKA A;  4HUF A;  3A5M C;  5CYQ A;  4NCA A;  3KWI A;  1G15 A;  3KK3 A;  5AQT A;  2HF3 A;  4CZM A;  4LFC K;  2QEX N;  4F3O A;  5CYM A;  1VSJ A;  4O8K A;  1HNI A;  2D1K A;  1REV A;  2D0P A;  3RRG A;  1A5X A;  2F9T A;  2QK9 A;  3DM2 A;  5TKY A;  4GV9 A;  4EHT A;  3BF1 A;  1GLD G;  3ZSR A;  4I2P A;  1C1B A;  3NHG A;  4J2E A;  2VYP A;  1M1K O;  1BUP A;  4JKG B;  1A5W A;  4CGI A;  3TWH A;  3ZET B;  1EXQ A;  2BAN A;  2BH1 A;  1X3M A;  1MU2 A;  3VF2 A;  3CQX A;  3EE9 A;  5BRH A;  3THY B;  3D7E O;  3VGL A;  5C15 A;  1B9D A;  1JCE A;  3O9S A;  1HYS A;  3ZYY X;  4M7Y A;  2WON A;  4IBN A;  1K8K A;  4JN4 A;  3OYI A;  1V4T A;  1X9W A;  1S1W A;  4ZHR A;  4CW7 B;  1XHZ A;  4NCB A;  3KD1 E;  3HVR A;  3A5O C;  2WBN A;  3DLG A;  4KTZ A;  4MO4 A;  1WOQ A;  2OTL N;  4BRN A;  4L8R B;  1VHX A;  1U49 A;  1XNQ K;  4OGC A;  2G8I A;  4DF8 A;  3CJC A;  4H0V B;  4IKF A;  4BWJ A;  4CEE A;  4NO7 A;  4EP4 A;  4GKJ K;  1M90 O;  4RW4 A;  1N8R O;  3ZSO A;  3F9M A;  4Y1C A;  2JLE A;  3UKU B;  4ZTF A;  3PO5 A;  4Z4E A;  1RTJ A;  3HOT A;  1XNR K;  4YDU C;  4GVM A;  4BR7 A;  3ZX0 A;  3TI0 A;  3CCE N;  2EWS A;  4C1N I;  2E4L A;  4E89 A;  4GV6 A;  3NVM A;  2OAN A;  4BQL A;  4BG8 A;  5M1K A;  3OYD A;  1LWF A;  3O08 A;  2KW4 A;  3HXM A;  3MX2 A;  3T3F A;  2QW9 A;  3ZCM A;  3JAM O;  4ELV A;  1RTD A;  1LOT B;  2HND A;  4NLB A;  1J5E K;  3LDN A;  1MA9 B;  3MAQ A;  4YOU A;  1JXB A;  1T6D A;  5AQQ A;  1NGD A;  3DLL L;  5J1E A;  2YNI A;  3RMD A;  5EX5 A;  1VQL N;  4AHV A;  4F9O A;  4BR4 A;  4F8R A;  3HM8 A;  3EO3 A;  2I5J A;  3OW2 M;  3T7Z A;  1BDG A;  2QXL A;  3CM6 A;  3VQ6 A;  2QWM A;  4JKC A;  3T19 A;  4U67 L;  3THW A;  3L8B A;  2DY4 A;  4CHN A;  4JHD B;  4PKH A;  2G8W A;  2FF6 A;  4JI0 K;  2WOM A;  3VQ8 A;  2Q97 A;  2GUI A;  3AY9 A;  2NRX A;  3NF9 A;  3SAF A;  2ZM6 K;  2RPI A;  4EZ6 A;  4YOV A;  2KZZ A;  1ZBI A;  4LH5 A;  4FWL A;  4CJK A;  1D4X A;  1Q86 O;  1QTM A;  3HST B;  4XEI A;  2KKZ A;  1L3U A;  3SV3 A;  1QHT A;  3ZSW A;  4YOW A;  3ULE A;  4KB1 A;  1Z05 A;  3DXM A;  1WSH A;  4DSK A;  3DLR A;  2UXC K;  4FZX C;  3HRG A;  2EHG A;  1UWB A;  2F4V K;  3VMF B;  3CFR A;  4E1J A;  3SYZ A;  1B92 A;  4M41 A;  1S6Q A;  1YIT N;  4JI1 K;  1TKD A;  3AA2 A;  1T44 A;  4WF9 L;  4CIE A;  3D2F A;  1UOC A;  3DLK A;  3VA3 A;  1FKO A;  1B9F A;  3LDQ A;  2F96 A;  3AGK A;  4BC5 A;  1BGX T;  3E9O A;  4B9S A;  1RT6 A;  3LDS A;  1RDC A;  4B9T A;  5CZ2 A;  3BY5 A;  4LSN A;  2QWN A;  3P5J A;  5E26 A;  5C2F A;  1DEJ A;  4LF5 K;  5AQI A;  1EP4 A;  2VGN A;  4JEP A;  3OBY A;  4Y0W A;  5BN8 A;  1NGI A;  5E84 A;  3SQ0 A;  1CZB A;  4EZ9 A;  3TAE A;  4NYF A;  1HYV A;  2UXD K;  2P9N B;  4E1M A;  3LP3 A;  3LDL A;  3MCA B;  3RMC A;  3PSF A;  1T05 A;  2QTD A;  1VSK A;  3WQT A;  4PL8 A;  4FM0 A;  4FJK A;  5AQN A;  5LMU K;  4DR6 K;  3NGY A;  4DTO A;  3IS9 A;  2G8V A;  1YAG A;  1RBU A;  4O8U A;  1E4G T;  1HPZ A;  3CFO A;  3TSP A;  3C94 A;  3T1H K;  1K73 O;  2JWK A;  3TAF A;  4FK0 A;  5BPM A;  2F8T A;  3VEY A;  1BO5 O;  2ASP A;  2RKI A;  4DR3 K;  4J2D A;  4BVO A;  2O8D A;  1NU0 A;  5C0Y A;  2WUS A;  4B9U A;  1IBK K;  4QS7 A;  3BF3 A;  2KTQ A;  4AM6 A;  4WFN L;  3T1Y K;  1RGI A;  5JLF A;  2OPP A;  3MWP A;  2ETJ A;  3BUZ B;  4CFB A;  1TAU A;  1HLU A;  3LM9 A;  1GOA A;  3G6E N;  2VGM A;  3GG4 A;  5I3U A;  3GDQ A;  4DTX A;  3MEE A;  2QKB A;  4HHT A;  4KHS A;  4FJJ A;  1OH7 A;  2Q0U A;  4FWK A;  3ENB A;  3CG7 A;  1YXQ A;  2O8C A;  4DUZ K;  4Z4G A;  4FW2 A;  1N32 K;  4KHU A;  4KBO A;  2P9I A;  1QQN A;  3HI0 A;  2QM1 A;  2P5G A;  4OLA A;  3RWU A;  2QWL A;  4I6M B;  2G8K A;  1ZXO A;  3WQU A;  3P31 A;  4IFE A;  4DU3 A;  4JK9 A;  2YI1 A;  2PBD A;  1Q18 A;  1KTQ A;  4LH4 A;  1QSS A;  4B1Z A;  4PY5 A;  1BHL A;  4BRH A;  5H1S Q;  2B4J A;  5BR9 A;  2YHW A;  1XWL A;  3AVK A;  4CGF A;  1IO2 A;  3CPW M;  2D0C A;  4N56 A;  4PL7 A;  5I9E B;  5SZT A;  2VG5 A;  3WXI A;  5K14 A;  1BI4 A;  1CZA N;  4G1Q A;  3K5N A;  2GEM A;  2CGK A;  1XMQ K;  5AQM A;  4DV4 K;  1WLJ A;  4FWO A;  1KFS A;  3TSQ A;  1NOY A;  1RFQ A;  3DJC A;  2NRR A;  1KVC A;  1HNW K;  3K5M A;  2ZGY A;  3S41 A;  4JS4 A;  3SK3 A;  1HQU A;  3UKR A;  1HYZ A;  3O9Q A;  3U8X A;  1NMD A;  1NWK A;  4CZK A;  3HPG A;  4LD0 A;  1QSL A;  1CLQ A;  1C0G A;  2P9L A;  2D5R A;  3DLB A;  2B5J A;  3M1F A;  2RF2 A;  3NF8 A;  4BRM A;  1NGH A;  3HYF A;  3LP0 A;  5C24 A;  4A2B A;  3LPU A;  3CD6 N;  1CZ9 A;  3HT3 A;  2AA4 A;  1TV6 A;  5AQR A;  4DU4 A;  3NE6 A;  3AVB A;  4AHC A;  4JKF A;  2ZF5 O;  2HMI A;  5FRN A;  1W0H A;  4CVN E;  2CH5 A;  4CF1 A;  2O4G A;  2WFB A;  3MCP A;  2KFZ A;  5C42 A;  3OYN A;  4HCB A;  2P9U B;  4CJE A;  4JRP A;  3LAL A;  1JCG A;  3ZSX A;  1RDA A;  3SMP A;  3K2P A;  4PKI A;  1GLJ O;  4BRD A;  4W5R A;  3HPO A;  1VQ4 N;  5AQG A;  2WC9 A;  2UUA K;  1RNH A;  5FRO A;  4BE2 A;  1YJ9 N;  1ZBS A;  1KLN A;  4Y1D A;  3L2U A;  2HOE A;  1VQK N;  4LF9 K;  2O8F B;  2A42 A;  3D2E B;  2O8B B;  5HRS A;  4DR2 K;  1RBV A;  1SZ2 A;  4DB3 A;  1QHA A;  3VER A;  5M1P A;  2F7T A;  3GBT A;  3HL8 A;  3QIN A;  2KLA A;  3SUN A;  5AQH A;  5BRE A;  2E2N A;  3KLH A;  2KHO A;  1KAZ A;  5T7B A;  4QAG A;  4JI5 K;  2FLO A;  2GTD A;  1HQE A;  5TKW A;  4H03 B;  1LW2 A;  4M7X A;  3HK2 A;  3CCR N;  2HMP A;  5ADX A;  3OBW A;  1IKW A;  3FGU A;  5AQZ A;  2ZJQ L;  1KRP A;  1NJI O;  3ENH A;  4LF6 K;  5JMV A;  2NRT A;  4EP5 A;  4ILH A;  1K9M O;  2Y1I A;  4DU1 A;  2XY5 A;  3CMA N;  4CCH A;  3R3L A;  4KH5 A;  4BRL A;  4YOX A;  3PV8 A;  1WAF A;  3E9L A;  2DPN A;  3PUF A;  3O80 A;  3JSM A;  4AHS A;  4BQZ A;  4BGB A;  3ZET A;  3R6M A;  1ZBF A;  2WTU A;  5AQX A;  5ADX H;  1U45 A;  4M3W A;  3P4I A;  5AQV A;  1RCH A;  3QB0 A;  4FM2 A;  4DR7 K;  5KPT A;  3THY A;  5CHI A;  1J53 A;  3LZJ A;  1NGF A;  3NAE A;  4FSV A;  1EET A;  5KI6 A;  3DRS A;  3JS6 A;  1SL1 A;  2G8F A;  4CEZ A;  3M8Q A;  3EY1 A;  3G71 N;  3V9X A;  2BGG A;  4M3U A;  1S1T A;  4BR0 A;  3QIO A;  5CE3 A;  2HF4 A;  5AQF A;  4CEF A;  3G4S N;  1U04 A;  3KLE A;  1BA1 A;  4BRE A;  5DMR A;  3DXK B;  1VQ7 N;  4NXN K;  4XH1 A;  5KRT A;  3KLG A;  4DCH A;  1BOT O;  1VSI A;  3DOK A;  4DTN A;  4FLY A;  4L3Q A;  2UUB K;  1XQS C;  1L3V A;  2KZM A;  1Z25 A;  2GBZ A;  3BZC A;  3D45 A;  3FZL A;  1I94 K;  1VRT A;  3Q7C A;  2E20 A;  4CES A;  4YDU A;  4R5P A;  3U6F A;  1X9M A;  4EAH D;  3K59 A;  4LSL A;  1D8Y A;  4OJR A;  4ILJ A;  5BN9 A;  3CCJ N;  3S3N A;  2HVI A;  4B9L A;  2NRH A;  4M63 C;  4CHP A;  4CEC A;  3MK6 A;  5F1X A;  3LP2 A;  4DQI A;  3VET A;  3ID6 A;  3BP8 A;  4ELT A;  4KAZ A;  5FPM A;  4M3R A;  4CZH A;  3LPT A;  5AQY A;  3R8E A;  3L2Q A;  5GAH P;  2OA8 A;  4DFK A;  4WQ5 C;  1GLC G;  3I55 N;  3VQB A;  5GAD P;  5FRM A;  4KB0 A;  4KTW A;  4B3T K;  4K0K K;  3EZ5 A;  3TAB A;  5M1O A;  3RVC A;  4CJ3 A;  2HHS A;  4KFB A;  4CF0 A;  3V4I A;  3A5L C;  1TK0 A;  3SBG A;  2BDP A;  4CJV A;  1YJN N;  3BDP A;  3TAR A;  4DKW A;  1ASW A;  1VSE A;  2A1S A;  3AO2 A;  3VQ5 A;  1YTU A;  4DTM A;  2PZS A;  1ZYQ A;  5KGW A;  4LY7 A;  4M3Z A;  4FO0 A;  2NLX A;  5GIN A;  5HRP A;  3SPY A;  3M5R A;  3J7Y P;  1OVQ A;  4IJA A;  1LWC A;  3SJH A;  4JHD A;  1LAW A;  4DTS A;  2P9S B;  1HKG A;  2FBX A;  4JK7 A;  3KZB A;  4C8L A;  3CJ9 A;  3THV A;  3MXJ A;  3HSC A;  3J7A P;  5IWA K;  4CZF A;  2ZD1 A;  3O8M A;  3ZT1 A;  3CJA A;  2YX6 A;  3WXL A;  1WNS A;  4BGA A;  1SKW A;  4B1Y B;  3ZT2 A;  3VF4 A;  2XY7 A;  3J81 O;  3AA5 X;  2A3Z A;  3EL2 A;  4YNQ A;  3C65 A;  1IG9 A;  3PO4 A;  4CE9 A;  4IFV A;  1WSI A;  4FLV A;  3CJB A;  4HUE A;  5GAE P;  4B08 A;  4B9V A;  4W5Q A;  3CPE A;  3ALY A;  1GLB G;  1KFD A;  3TAN A;  1NOZ A;  4BC3 A;  2UXB K;  3LP1 A;  4KTQ A;  1GOB A;  1T7P A;  1YVN A;  2DFE A;  3VEO A;  3EEQ A;  3I0R A;  4JV5 K;  3O4Q A;  2NNW A;  3R9P A;  3H1Q A;  1Q9Y A;  2E1Y A;  1X1P A;  4A5A A;  3OS0 A;  1IBL K;  2YJE A;  3SQ1 A;  1HJR A;  1J6Z A;  3K57 A;  4M45 A;  3TSU A;  4E7I A;  4JKE A;  2X74 A;  4FJI A;  3HP9 A;  1KC8 O;  4KHP K;  1BA0 A;  2BUP A;  3GOI A;  5HBM A;  2Q1N A;  4BE1 A;  4DR5 K;  5LL6 Z;  1KCF A;  3O9R A;  3RR7 A;  3DWL A;  1HMV A;  1N33 K;  4B3S K;  2G8H A;  2X6N A;  1SUQ A;  1RDB A;  4J8F A;  3KJV A;  2O8E A;  3WEE B;  4CIG A;  4IWV A;  1J54 A;  1TAQ A;  3ZEU B;  2QI2 A;  3VEZ A;  4N41 A;  2P9N A;  1KQS M;  5AFU A;  3THX B;  4H0Y B;  2OPR A;  4R79 A;  3MED A;  1SS6 A;  4PA1 A;  2YHX A;  1RT2 A;  4FWN A;  1NJY A;  2PFU A;  3F73 A;  3FFK B;  4CJP A;  4OKK A;  1IKX A;  5AZI A;  1T3V A;  4CEO A;  4Z4H A;  4DV6 K;  2Q36 A;  2P9P B;  2UYT A;  3TTC A;  3C7N B;  4CHO A;  3MXI A;  3VA0 A;  4A5B A;  4ISG A;  3EKU A;  3L4I A;  1SKR A;  3LWM A;  1OVY A;  2V52 B;  3OYM A;  1Y97 A;  4IFY A;  1P8Z A;  3AVN A;  3SQ4 A;  2E8A A;  5AFU H;  4W5O A;  1UA1 A;  3CJ1 A;  2E6L A;  2YNF A;  3V6D A;  3CF5 L;  1U47 A;  4ELU A;  3WNF A;  1RTH A;  3RRH A;  3IUC A;  4DV2 K;  4H5V A;  2HBK A;  4BR5 A;  1S3X A;  1ASV A;  4LFB K;  3OYA A;  2XRI A;  4FJ7 A;  4OO1 J;  5F0X A;  3D6R A;  2P1J A;  1VK0 A;  4GKK K;  1NGG A;  1JLE A;  4FWS A;  4HTL A;  2QWP A;  1EKE A;  3O1B A;  3V1O A;  3NDK A;  4JRQ A;  3PX0 A;  1TUY A;  3HPH A;  4FJ5 A;  4KRE A;  3VGK A;  1T6C A;  3V1Q A;  4K41 A;  3A8Y A;  4O44 A;  4WE1 A;  1T8E A;  3VPZ A;  2J4R A;  4CEB A;  5AZJ B;  3L0Q A;  2A40 A;  3IRX A;  3SMS A;  3QBX A;  5HRO A;  2ZE2 A;  4C8O A;  4FJL A;  3M8R A;  1DLO A;  2VWJ A;  2VQE K;  1IJJ A;  3HBT A;  1QVG M;  2VWK A;  1J5O A;  1VSD A;  2YKN A;  4MDB A;  3DAW A;  1C1A A;  2EX3 A;  4A57 A;  3KVG A;  4Z0U A;  3QML A;  3WXJ A;  4O4G A;  1W2B M;  4IOA L;  4W5N A;  1HNX K;  4BDP A;  3QEW A;  5BR8 K;  1FXX A;  3N4P A;  4CJT A;  1T03 A;  3MX5 A;  1TGO A;  1WUA A;  2E1Z A;  3SQ2 A;  2DTU A;  3MN7 A;  4BC4 A;  5M1F A;  1GLF O;  3P38 A;  1CXQ A;  3ID8 A;  4FJX A;  2Y1J A;  4FVU A;  3FR0 A;  2F9W A;  4DFJ A;  3ZX3 A;  4JI8 K;  1NGA A;  2GX9 A;  3UB5 A;  4DSI A;  5CR4 A;  1JLF A;  4DQS A;  1ZBL A;  1F21 A;  4CF9 A;  1TK8 A;  4X65 K;  3C6T A;  1QSY A;  4BRO A;  3CCM N;  4UQG A;  4JI2 K;  4DV0 K;  3SUO A;  4GV3 A;  2P9U A;  3ISN C;  4H5W A;  4DV7 K;  1NK4 A;  5JLH A;  4M3T A;  3KK1 A;  4O55 A;  4FOI A;  5AQU A;  3VOV A;  3O4W A;  3FZM A;  3U3G A;  2AJQ A;  4KRF A;  5SWM A;  1CXU A;  2YJF A;  4LF8 K;  5AQK A;  1JL2 A;  4WFB L;  3VF6 A;  1WAJ A;  3QIC A;  4IJN A;  4OKE A;  4CFD A;  2OPS A;  3M6G A;  5BPN A;  1NK8 A;  4KHY A;  1DTQ A;  1BIS A;  1U6Z A;  2O8F A;  3D2E A;  1W7A A;  3CCL N;  4FK4 A;  4CGD A;  1K8A O;  2ITG A;  4X62 K;  3ZSY A;  5GIO A;  1QQC A;  4Z94 A;  5BPL A;  1NJW A;  4CGH A;  3AAP A;  2PY5 A;  1HKB A;  1S22 A;  1KVB A;  1VQ8 N;  4FLZ A;  3THW B;  5C2D A;  2E88 A;  1KD1 O;  4OPK A;  2QA4 N;  1NK0 A;  3PIO L;  3CFP A;  3ZSQ A;  4X66 K;  3U9D A;  4BRQ A;  4A62 A;  4C8K A;  4CJQ A;  4UY8 O;  5BRF A;  4FCY A;  1WN7 A;  4OLB A;  1S1X A;  3SAH A;  4RWT A;  4FLW A;  1JXE A;  3OJS A;  4DSJ A;  3QER A;  2GEL A;  3G10 A;  3HOS A;  1TYQ B;  3ULE B;  3FE1 A;  3S9H A;  3Q7B A;  4FXD A;  3SLC A;  2KFN A;  4MLE A;  3CCU N;  4U7B A;  3OHR A;  4QCL A;  1Y64 A;  1OKJ A;  3H45 C;  1JLC A;  2RE2 A;  1JCF A;  4MO5 A;  1ATN A;  3U4L A;  3D2F B;  3CME N;  3C6H A;  3K5O A;  1Z6R A;  3BEX A;  3HP6 A;  2P9K B;  5AQP A;  3RSE B;  1E4F T;  1LAV A;  2QWO A;  3H6E A;  1Z26 A;  3QEV A;  2Q0R A;  2A1R A;  1TKT A;  4X64 K;  1WSF A;  5GAG P;  3KIO A;  4GW6 A;  3HM9 A;  2HBJ A;  1IKY A;  4CIF A;  2RHK A;  3S3M A;  1O1W A;  1SQK A;  3KLI A;  4FZY A;  4LF4 K;  4Z4F A;  3DXK A;  5J2P A;  2A41 A;  3QNO A;  1Q81 O;  4CJ4 A;  4GY2 B;  1NJZ A;  1ZC6 A;  3V81 A;  4N76 A;  3J8A A;  3L3V A;  4CF8 A;  2OZS A;  5M1Q A;  1YI2 N;  1FJG K;  4FJH A;  3J7Z O;  3TU5 A;  1RT7 A;  1HX1 A;  3QEP A;  2HHX A;  3KTQ A;  3CI5 A;  4DMN A;  4B9M A;  4CGJ A;  4JI7 K;  1S6P A;  3EE8 A;  2IGI A;  1RT1 A;  2IC3 A;  4B8A B;  4FLX A;  1QE1 A;  4E1N A;  4BR9 A;  4E7H A;  1RT3 A;  1I3A A;  4MFB A;  4CF2 A;  5GIP A;  4BAC A;  1VSM A;  1U2V B;  4CJS A;  5E41 A;  4JD2 B;  4BR2 A;  4H0T B;  3AVH A;  2E2O A;  2DFF A;  4CHY A;  1YHQ N;  1YIJ N;  3F5T A;  1K6Y A;  4PQU A;  2W6K A;  4AHT A;  2NRV A;  2HW3 A;  1GLE G;  4I7F A;  2Q31 A;  3SAG A;  2HNZ A;  1VAZ A;  1D9F A;  1JJ2 M;  2O8C B;  2QKK A;  3L3U A;  4YFU A;  4DV3 K;  1W9H A;  4PKG A;  3OVN A;  2UUC K;  3M8S A;  3O6W A;  4WQ4 C;  1Q9X A;  1EWQ A;  4NLC A;  3RTV A;  2F8S A;  2P9S A;  2ZWH A;  4CD3 A;  3OS2 A;  4BG9 A;  4O0I A;  4WYB A;  2PAV A;  1ZBU A;  4RW8 A;  4CBW A;  3I56 N;  1S1U A;  1QZ5 A;  4BRA A;  1LCU A;  3H3O B;  5C10 A;  4IZ9 A;  2VWB A;  3VQA A;  4JYA K;  3KKS A;  3TR8 A;  3QDK A;  4BRI A;  4JKG A;  4OX9 K;  4E7J A;  3AA4 A;  1NLV A;  3SUQ A;  1BU6 O;  1HJO A;  4FW1 A;  1ATS A;  2QXF A;  2ITM A;  2E5L K;  2G8U A;  3ULD A;  2OYQ A;  3KKR A;  4KV8 A;  5EU7 A;  1R0A A;  3UIQ A;  4QS8 A;  4FJN A;  2GUP A;  1KSP A;  1SAZ A;  2X6S A;  1IBM K;  2YHA A;  1XC9 A;  3PLA A;  3OA9 A;  4H5N A;  3ITH A;  3UKR B;  2B6A A;  5DK5 A;  1GOC A;  1HRH A;  1RDU A;  3ZT0 A;  3M8P A;  3W3D A;  4FVM A;  2H3G X;  4CBX A;  3NCI A;  4KI4 A;  3KHY A;  4CER A;  2IS3 A;  3I33 A;  1RIL A;  2XO7 A;  1HKC A;  4CHZ A;  3CJ7 A;  1I39 A;  5CY4 A;  1VQ6 N;  4KHW A;  3AGR A;  1NGJ A;  4HCC A;  2ZJR L;  2IOC A;  3WEE A;  3UKU A;  1QVF M;  3VQC A;  4H8K A;  5C12 A;  4DFP A;  2IVN A;  2IVP A;  3DOL A;  4V19 S;  3VEN A;  1IG8 A;  4O5B A;  3THX A;  3DI6 A;  1ASU A;  1TL3 A;  1KLM A;  3ZX2 A;  1LW0 A;  4B8C A;  3AVL A;  3QFP A;  4DSF A;  5J2M A;  1OH5 A;  1NMN A;  3EKS A;  3I0S A;  2FC0 A;  1VQ5 N;  3D0P A;  4QOZ B;  4IDH A;  1BQM A;  2HHH K;  4CJR A;  3C7N A;  1NKE A;  4AHR A;  3B6O A;  4BVP A;  4DF4 A;  2ZQB A;  3A0I X;  2NRW A;  4FZZ A;  1NGC A;  4JS5 A;  1ZBH A;  1C1C A;  1KXP A;  1NNE A;  4NYN A;  5JIC A;  4G9Z A;  3G25 A;  4ILG B;  4FK2 A;  1KAY A;  3MEG A;  1DKG D;  4RCH A;  1WB9 A;  4CJW A;  3C0B A;  4H5R A;  1N34 K;  4FLT A;  4AH9 A;  4BRK A;  3WNH A;  3AVG A;  4BDZ A;  4FJ9 A;  3VQ7 A;  3LDP A;  1WBD A;  3JYT A;  2HHT A;  3AO5 A;  2HBM A;  4KI6 A;  4YHH K;  3AVC A;  4CZE A;  4HWI A;  4IOX A;  3B8A X;  2FBY A;  4XH5 A;  3C6A A;  5EY4 A;  3AO1 A;  1RDD A;  1N36 K;  1VQN N;  4QS9 A;  2QWQ A;  3U9Z A;  2RN2 A;  1RDW X;  4KKO A;  2P5O A;  1DGK N;  3QEX A;  3VQ4 A;  5AZJ A;  1ATR A;  4RTF D;  3O3H A;  5DM7 L;  3V9U A;  5AJ3 K;  4ICL A;  4GMJ B;  2HVH A;  4YOR A;  2IAJ A;  3WXM B;  1BWF O;  4NB4 A;  1GLL O;  3PX6 A;  2IIR A;  2FF3 B;  3VEW A;  5AQJ A;  3P1G A;  5JVH L;  3VES A;  3CM5 A;  3K9K A;  3PY8 A;  2YHB A;  4CBU A;  1TUU A;  4Q5V A;  4E19 A;  3SI6 A;  4EHU A;  3CC2 N;  2FSN A;  2YV0 X;  4J2B A;  1JL1 A;  2AP1 A;  4XH4 A;  4DLE A;  4YY3 K;  5IT9 O;  2Q2R A;  4CK2 A;  2W6L A;  3NFA A;  4A59 A;  4DG1 A;  3CCS N;  1YT3 A;  4OPJ A;  4IOC L;  4PUO A;  2P51 A;  3TPQ A;  1D9D A;  3MN5 A;  4H0P A;  5CZ1 A;  3OS1 A;  4MDA A;  3OJU A;  3QNN A;  4FJG A;  4CI6 A;  1NGB A;  3MMV A;  4K8Z A;  4DR1 K;  4N5S A;  3VTH A;  5JS1 A;  5F2R A;  2HNY A;  2HHV A;  3VQP A;  4Z4C A;  5HOO A;  5EXW A;  1JLG A;  3NH0 A;  4NCG A;  3AAQ A;  1HNZ K;  1SKS A;  4KHQ A;  3MEC A;  3K0S A;  3O9T A;  1N6Q A;  4KO0 A;  2FXU A;  3L2V A;  3A2F A;  4FJ8 A;  5KTQ A;  4DTU A;  2OPQ A;  1NKC A;  1BCO A;  4CED A;  3MN9 A;  3NF7 A;  5FPE A;  2YCH A;  1NGE A;  2KQ2 A;  4GNI A;  1TL1 A;  3HTV A;  4JKD A;  3BGR A;  4KH6 A;  1A5V A;  3CHW A;  2ASO A;  2Z1J A;  4PWD A;  4BRF A;  1HUX A;  4LC9 B;  1NM1 A;  5FPN A;  4K25 A;  3KK2 A;  2E6M A;  1U48 A;  4F2S A;  3VEX A;  4ISE A;  1P90 A;  3WNE A;  1WSE A;  2OZM A;  3CQ8 A;  4Z4I A;  4OPH A;  3CXC M;  3K5L A;  2D4W A;  1O13 A;  3RMA A;  3TTF A;  3WNG A;  1NK6 A;  4I2Q A;  4M3Y A;  3OYL A;  1BL3 A;  4ISF A;  2ZJP L;  2PYL A;  1FKP A;  4I6M A;  4N47 A;  1BIZ A;  4A61 A;  4BE0 A;  3RMB A;  4H0X B;  5HL7 L;  1WSJ A;  4FWP A;  4ID1 A;  3RR8 A;  2D0A A;  1ILY A;  1HNV A;  3K9J A;  4OVL A;  5EVZ A;  4CJL A;  3L2R A;  4GVE A;  1LWE A;  3IKM A;  3QIP A;  3M3Z A;  4DS4 A;  3MXM A;  4I9L A;  1VQ9 N;  2JWL A;  4DTJ A;  3HJF A;  5B8H A;  1VQO N;  4DFM A;  3MDQ A;  4IG0 A;  3KD5 E;  1BIU A;  2ASM A;  4C8M A;  3CC7 N;  3NGZ A;  1BG3 A;  1ESV A;  2XY8 A;  1TYQ A;  1RBT A;  4FPA A;  2V7Z A;  5LJW A;  2OCE A;  1SL0 A;  4DQ8 A;  4HVJ A;  1XMO K;  4IO8 A;  4HUG A;  1C0T A;  3O9U A;  4EIA A;  1SL2 A;  4JI4 K;  1K8K B;  1TKZ A;  4BRG A;  1C0M A;  4YOT A;  4CGG A;  3FFI A;  1TKX A;  1VSH A;  5KGX A;  3TAP A;  5D3G A;  2P9K A;  3RSE A;  1XC3 A;  4LF7 K;  3SNN A;  4CFC A;  5FLX O;  1VSF A;  3T69 A;  5LY3 A;  4W5T A;  1QQM A;  4ZTJ A;  2Z1I A;  4TSX A;  3SZ2 A;  3IG1 A;  1IV0 A;  4FL9 A;  3R1X A;  1WSG A;  4B9N A;  3OYH A;  4RW7 A;  2BE2 A;  1EWR A;  3CCQ N;  2O4I A;  2O8E B;  4OKJ A;  1EO1 A;  3QES A;  3OYK A;  2UU9 K;  3OYG A;  4C8N A;  1EQY A;  2BTF A;  2GWK A;  2IDO A;  1NK5 A;  4B1W B;  2W41 A;  3OYE A;  4OPA A;  4FOE A;  4RW6 A;  3CER A;  5AZI B;  3DYA A;  4FJM A;  1D5A A;  4H0O A;  1FK9 A;  3PIP L;  4IEI A;  4DS5 A;  3CCV N;  4NXM K;  4IDK A;  5JS2 A;  3VQD A;  1XI1 A;  4E3S A;  4B3O A;  5KQD A;  3WUH A;  3HO1 A;  2O8B A;  4DTP A;  3OYJ A;  5DM6 L;  4CD1 A;  5KPZ A;  1G99 A;  3IMX A;  4O5F A;  3ZLJ A;  1OH8 A;  3DLH A;  3SUP A;  1YJW N;  4LFA K;  1U2V A;  4K42 A;  2VCP A;  3AVI A;  3IAY A;  4XIU A;  4JD2 A;  1XHX A;  4IO9 L;  3EYZ A;  2V51 B;  3L6Q A;  4JI6 K;  1S9E A;  3I8D A;  3OY9 A;  2NZT A;  3TAM A;  3I8B A;  4AHU A;  3H46 O;  2ATQ A;  4DV1 K;  4WQ4 A;  4J2A A;  1RT4 A;  3LWL A;  3ZSZ A;  1KVA A;  3VEV A;  3DRR A;  2HBL A;  2HHU A;  4JLH A;  3LZI A;  3ATV A;  3FZF A;  4H4O A;  3H08 A;  3QFU A;  2ZGZ A;  4K43 A;  4AM7 A;  4B9Q A;  1X3N A;  2VG7 A;  1QS4 A;  2GWJ A;  2X78 A;  4DTR A;  3T1A A;  3GL1 A;  4I9Q A;  2FSJ A;  3O5B A;  1RT5 A;  2CGL A;  4F2R A;  4KHN A;  3DXM B; 
#chains in the Genus database with same CATH homology
 3ULE A;  5GAE P;  1Z05 A;  3FLC O;  3DXM A;  1C0F A;  3EN9 A;  3JXU A;  3CPE A;  1NLV A;  2QWR A;  1GLB G;  3ENO A;  3NMU A;  1BU6 O;  1HJO A;  2FSK A;  3HRG A;  4BC2 A;  4BC3 A;  1ATS A;  3VMF B;  2ITM A;  2NRZ A;  4E1J A;  1YVN A;  3FZH A;  5AQL A;  3VEO A;  1YIT N;  3WXK A;  3LM2 A;  1T44 A;  4WF9 L;  2NNW A;  3D2F A;  3H1Q A;  1R59 O;  2E1Y A;  4FWR A;  3R9P A;  2OTJ N;  4QS8 A;  2GUP A;  2D0O A;  4A5A A;  1SAZ A;  2YJE A;  3LDQ A;  1J6Z A;  3AGK A;  4BC5 A;  3TSU A;  3E9O A;  3PLA A;  3OA9 A;  4H5N A;  4JKE A;  4MLH A;  3UE5 A;  1QZ6 A;  1KC8 O;  1BA0 A;  3UKR B;  3CIP A;  2QWN A;  1RDU A;  2BUP A;  5E26 A;  3GOI A;  3W3D A;  5C2F A;  1DEJ A;  1V4S A;  2Q1N A;  5AQI A;  2H3G X;  3CQY A;  2VGN A;  3O9R A;  4JEP A;  4CBX A;  3KHY A;  3OBY A;  4Y0W A;  3MN6 A;  3DWL A;  3I33 A;  1HKC A;  1NGI A;  5E84 A;  3TTD A;  5BN8 A;  3CJ7 A;  1VQ6 N;  4J8F A;  3AGR A;  3WEE B;  1NGJ A;  1GLA G;  2P9N B;  2ZJR L;  4IWV A;  5M1N A;  3LDL A;  3MCA B;  2QI2 A;  4IEE A;  3UKU A;  3VEZ A;  2P9N A;  3WEE A;  3ZEU B;  1KQS M;  5AFU A;  1QVF M;  3FZK A;  2QTD A;  3WQT A;  5C12 A;  4H0Y B;  1MWK A;  2IVN A;  4PL8 A;  4R79 A;  2IVP A;  5AQN A;  3VEN A;  1IG8 A;  1SS6 A;  2YHX A;  4FWN A;  2PFU A;  4WQ5 A;  3FFK B;  1YAG A;  1HPM A;  4O8U A;  1E4G T;  3ZX2 A;  3QFP A;  5AZI A;  3TSP A;  1K73 O;  1T3V A;  3HZ6 A;  2JWK A;  3EKS A;  5BPM A;  1XUP O;  1VQ5 N;  2Q36 A;  1BO5 O;  2UYT A;  2ASP A;  2P9P B;  3VEY A;  3TTC A;  5BRD A;  4BVO A;  3C7N B;  4IDH A;  4CJ7 A;  2YHY A;  5C0Y A;  4A5B A;  4ISG A;  1W97 L;  2WUS A;  3N4Q A;  3C7N A;  2CH6 A;  4QS7 A;  3EKU A;  3L4I A;  3BF3 A;  3VGM A;  1OVY A;  2V52 B;  4AM6 A;  1Q82 O;  4WFN L;  1RGI A;  5JLF A;  1P8Z A;  3MWP A;  4AF1 A;  4BVP A;  3BUZ B;  3IDH A;  5LJV A;  1MDU B;  2E8A A;  2NRW A;  1HLU A;  3A0I X;  3LM9 A;  5AFU H;  3IFR A;  3G6E N;  2VGM A;  3GG4 A;  1NGC A;  3CJ1 A;  4EFH A;  2V7Y A;  3GDQ A;  2W40 A;  3CF5 L;  1KXP A;  5JIC A;  4G9Z A;  2I7N A;  3G25 A;  2Q0U A;  4ILG B;  1KAY A;  4FWK A;  3ENB A;  1DKG D;  3E66 A;  4RCH A;  4JAX A;  3IUC A;  4H5V A;  1YXQ A;  2HBK A;  4BR5 A;  1S3X A;  2P9I B;  3C0B A;  1Q7Y O;  4H5R A;  4CZL A;  4KBO A;  2P9I A;  1QQN A;  3H1V X;  3HI0 A;  1H1V A;  5AQS A;  5F0X A;  4OO1 J;  3D6R A;  5FPD A;  2QM1 A;  4BRK A;  1NGG A;  4YOY A;  4FWS A;  4HTL A;  1YF5 L;  2QWP A;  3KK7 A;  3O1B A;  3LDP A;  2QWL A;  4I6M B;  3ATU A;  1ZXO A;  1TUY A;  2HBM A;  3WQU A;  4CZE A;  3P31 A;  4IFE A;  4HWI A;  4IOX A;  3B8A X;  3VGK A;  4JK9 A;  4XH5 A;  1T6C A;  2YI1 A;  3C6A A;  2PBD A;  1Q18 A;  3QBW A;  3A8Y A;  4K41 A;  5EY4 A;  4JKB A;  1VQN N;  2HST A;  2QWQ A;  4QS9 A;  3VPZ A;  4B1Z A;  2J4R A;  3U9Z A;  4BRH A;  1RDW X;  5AZJ B;  4DHY A;  5H1S Q;  3L0Q A;  5BR9 A;  4B1V A;  2YHW A;  2A40 A;  3SMS A;  1DGK N;  3QBX A;  5AZJ A;  1ATR A;  4RTF D;  5DM7 L;  3CPW M;  4KH4 A;  4PL7 A;  5I9E B;  1IJJ A;  3HBT A;  4YOR A;  3WXM B;  1QVG M;  3E1Y A;  4FPB A;  1BWF O;  3WXI A;  4NB4 A;  1YUW A;  4FWM A;  1CZA N;  3CC4 N;  2GEM A;  4MDB A;  1GLL O;  2CGK A;  3DAW A;  5AQM A;  2IIR A;  2FF3 B;  3VEW A;  5AQJ A;  5JVH L;  2A5X A;  3VES A;  4A57 A;  3K9K A;  3KVG A;  4FWO A;  4CBU A;  1TUU A;  3TSQ A;  3QML A;  1RFQ A;  3DJC A;  2NRR A;  3GE1 A;  3WXJ A;  4EHU A;  3CC2 N;  2FSN A;  1W2B M;  4IOA L;  2ZGY A;  4BRP A;  3S41 A;  2AP1 A;  3N4P A;  4XH4 A;  1VQM N;  3MX5 A;  3A5N C;  3SK3 A;  3UKR A;  2Q2R A;  3O9Q A;  5EOY A;  1WUA A;  3U8X A;  2E1Z A;  1NMD A;  1NWK A;  2E2P A;  4CZK A;  2P9L B;  5KPR A;  3MN7 A;  4BC4 A;  1QQO A;  5M1F A;  3F2K A;  1GLF O;  4A59 A;  1C0G A;  3P38 A;  3ID8 A;  1MWM A;  2P9L A;  3CCS N;  3M1F A;  4FVU A;  3FR0 A;  4IOC L;  2F9W A;  3TPQ A;  4BRM A;  4C23 A;  1NGH A;  3MWT A;  3MN5 A;  4H0P A;  4A2B A;  3CD6 N;  4MDA A;  3ZX3 A;  4CZG A;  2AA4 A;  4WCE L;  1X9J A;  1NGA A;  5AQR A;  3KWG A;  2GX9 A;  3UB5 A;  4CI6 A;  1S72 N;  1NGB A;  3MMV A;  5CR4 A;  4JKF A;  1NBW A;  2ZF5 O;  3WT0 A;  3VTH A;  3ZEU A;  4JKH A;  5F2R A;  2CH5 A;  2WFB A;  3L4Q A;  3MCP A;  5MLC Q;  4H5T A;  5HOO A;  4BRO A;  3CCM N;  5JVG L;  5EXW A;  3LL3 A;  2P9U B;  5AQO A;  3AAQ A;  3W0L A;  4GV3 A;  1JCG A;  1KAX A;  2E2Q A;  2P9U A;  3O9T A;  2FXU A;  4H5W A;  4CZI A;  3SMP A;  5JLH A;  4PKI A;  2P9P A;  4FOI A;  5KQ8 A;  1GLJ O;  5ELZ A;  2IVO A;  1VQP N;  4BRD A;  5AQU A;  3VOV A;  3O4W A;  3FZM A;  1DT9 A;  1VQ4 N;  5AQW A;  4CZJ A;  5AQG A;  3MN9 A;  5FPE A;  2YCH A;  1NGE A;  2WC9 A;  4GNI A;  4FWQ A;  2YJF A;  3HTV A;  4JKD A;  3SBT A;  1YJ9 N;  5AQK A;  3O1W A;  4KH6 A;  3CET A;  4B1X B;  4BRC A;  4WFB L;  3VTI A;  1ZBS A;  3P39 A;  3VF6 A;  3QIC A;  3CHW A;  4IJN A;  2A6A A;  2HOE A;  2ASO A;  1VQK N;  4BRF A;  2A42 A;  1HUX A;  4LC9 B;  3D2E B;  3NVK A;  3M6G A;  5BPN A;  1NM1 A;  5FPN A;  1SZ2 A;  2I7P A;  3E9P A;  4K25 A;  4DB3 A;  1U6Z A;  4PHT X;  3D2E A;  1QHA A;  3CCL N;  2CGJ A;  3VER A;  5M1P A;  1K8A O;  5AR0 A;  2F7T A;  3AAR A;  4IXC A;  5GIO A;  3GBT A;  3VEX A;  3LDO A;  2KLA A;  4Z94 A;  5BPL A;  4ISE A;  1P90 A;  4C1N K;  5AQH A;  4WFA L;  5BRE A;  2E2N A;  3AAP A;  2KHO A;  1KAZ A;  4OPH A;  3CXC M;  3H3N O;  2D4W A;  1HKB A;  1O13 A;  1S22 A;  4JK8 A;  4B1U B;  4A2A A;  4BY9 C;  2FLO A;  3TTF A;  3EZW A;  2GTD A;  4JNE A;  1VQ8 N;  4JKA A;  5TKW A;  3A5M C;  4H03 B;  4M7X A;  3KWI A;  3CCR N;  2HMP A;  4ISF A;  5ADX A;  2ZJP L;  5AQT A;  5C2D A;  2E88 A;  1KD1 O;  2HF3 A;  3OBW A;  4CZM A;  3FGU A;  5AQZ A;  2ZJQ L;  4I6M A;  2QEX N;  4A61 A;  2QA4 N;  4H0X B;  4O8K A;  3PIO L;  5HL7 L;  1NJI O;  2D1K A;  4FWP A;  2D0P A;  3ENH A;  3U9D A;  1ILY A;  3K9J A;  4A62 A;  5EVZ A;  4BRQ A;  4UY8 O;  2F9T A;  5BRF A;  5JMV A;  2NRT A;  4ILH A;  1K9M O;  5TKY A;  4GV9 A;  4EHT A;  4GVE A;  3SAH A;  3BF1 A;  4RWT A;  3IKM A;  3CMA N;  1GLD G;  3R3L A;  4KH5 A;  4BRL A;  4YOX A;  2GEL A;  3M3Z A;  1VQ9 N;  2JWL A;  3E9L A;  5B8H A;  2VYP A;  1TYQ B;  3HOS A;  2DPN A;  3MDQ A;  1VQO N;  1M1K O;  2ASM A;  1BUP A;  4JKG B;  3O80 A;  3CC7 N;  3ULE B;  1BG3 A;  3ZET B;  1ESV A;  3FE1 A;  1TYQ A;  3Q7B A;  4BQZ A;  4FPA A;  3SLC A;  4MLE A;  2BH1 A;  2V7Z A;  1X3M A;  4BGB A;  3VF2 A;  3ZET A;  5LJW A;  3R6M A;  3CQX A;  3CCU N;  4DQ8 A;  4U7B A;  3EE9 A;  3OHR A;  5AQX A;  5BRH A;  5ADX H;  3P4I A;  4IO8 A;  5AQV A;  3D7E O;  3VGL A;  3QB0 A;  1Y64 A;  1OKJ A;  3H45 C;  5C15 A;  3O9U A;  2RE2 A;  4EIA A;  1JCF A;  5KPT A;  1K8K B;  1JCE A;  4MO5 A;  5CHI A;  1ATN A;  3O9S A;  3U4L A;  4BRG A;  1NGF A;  4YOT A;  3D2F B;  3ZYY X;  3CME N;  3C6H A;  4M7Y A;  1Z6R A;  3BEX A;  1K8K A;  4JN4 A;  4FSV A;  2P9K B;  5AQP A;  3RSE B;  1E4F T;  3JS6 A;  1V4T A;  2QWO A;  3H6E A;  2P9K A;  3RSE A;  2Q0R A;  3G71 N;  1XC3 A;  5GAG P;  4BR0 A;  5CE3 A;  2HF4 A;  3T69 A;  5LY3 A;  3A5O C;  2WBN A;  1QQM A;  4MO4 A;  5AQF A;  1WOQ A;  2HBJ A;  4BRN A;  3G4S N;  2OTL N;  1BA1 A;  2RHK A;  4BRE A;  3DXK B;  1VQ7 N;  4XH1 A;  1SQK A;  3CJC A;  4H0V B;  4FL9 A;  3R1X A;  4DCH A;  1BOT O;  3DXK A;  4L3Q A;  4NO7 A;  1XQS C;  2A41 A;  1Q81 O;  3CCQ N;  3FZL A;  4GY2 B;  1M90 O;  3Q7C A;  1ZC6 A;  2E20 A;  1EO1 A;  1N8R O;  3J8A A;  3F9M A;  4YDU A;  4EAH D;  3UKU B;  1EQY A;  5M1Q A;  4ILJ A;  2BTF A;  2GWK A;  3HOT A;  5BN9 A;  3CCJ N;  1YI2 N;  2NRH A;  4YDU C;  4B1W B;  4M63 C;  3J7Z O;  4BR7 A;  3TU5 A;  3ZX0 A;  3CCE N;  1HX1 A;  2W41 A;  3MK6 A;  2EWS A;  4OPA A;  4C1N I;  3VET A;  5F1X A;  4GV6 A;  4FOE A;  3NVM A;  3ID6 A;  2OAN A;  3BP8 A;  3CER A;  5AZI B;  3CI5 A;  4BQL A;  4BG8 A;  5M1K A;  3PIP L;  4H0O A;  3O08 A;  4IEI A;  5FPM A;  3EE8 A;  3CCV N;  4CZH A;  3MX2 A;  5AQY A;  3R8E A;  2QW9 A;  5GAH P;  4WQ5 C;  1GLC G;  3I55 N;  1LOT B;  4NLB A;  4BR9 A;  3LDN A;  5GAD P;  1MA9 B;  5KQD A;  4YOU A;  3WUH A;  5GIP A;  1T6D A;  4CD1 A;  5DM6 L;  1U2V B;  5AQQ A;  5KPZ A;  1G99 A;  1NGD A;  3IMX A;  4O5F A;  4JD2 B;  4BR2 A;  4H0T B;  5M1O A;  3RVC A;  3DLL L;  1YJW N;  1U2V A;  4K42 A;  2VCP A;  2E2O A;  3A5L C;  4JD2 A;  5EX5 A;  1VQL N;  4IO9 L;  3SBG A;  1YHQ N;  4F9O A;  4BR4 A;  1YIJ N;  1YJN N;  4DKW A;  3F5T A;  2V51 B;  3HM8 A;  3EO3 A;  3L6Q A;  2NRV A;  1GLE G;  3OW2 M;  2Q31 A;  2NZT A;  3T7Z A;  3SAG A;  3I8B A;  1VAZ A;  3H46 O;  2QXL A;  1BDG A;  1JJ2 M;  4FO0 A;  2NLX A;  2QWM A;  4JKC A;  4U67 L;  5GIN A;  4WQ4 A;  3M5R A;  4JHD B;  4PKH A;  2FF6 A;  3VEV A;  4IJA A;  4PKG A;  3SJH A;  2HBL A;  4JHD A;  2P9S B;  1HKG A;  3O6W A;  2Q97 A;  4WQ4 C;  4JK7 A;  3KZB A;  3ATV A;  3AY9 A;  3CJ9 A;  3FZF A;  4NLC A;  2NRX A;  3QFU A;  2ZGZ A;  4K43 A;  2P9S A;  3HSC A;  2ZWH A;  4AM7 A;  4CD3 A;  3SAF A;  4BG9 A;  4B9Q A;  4CZF A;  4YOV A;  1X3N A;  4WYB A;  3O8M A;  2PAV A;  2GWJ A;  4CBW A;  4FWL A;  3I56 N;  3CJA A;  2YX6 A;  1D4X A;  1QZ5 A;  4BRA A;  3GL1 A;  3WXL A;  1LCU A;  4BGA A;  3H3O B;  4B1Y B;  2FSJ A;  3VF4 A;  5C10 A;  1Q86 O;  4IZ9 A;  2VWB A;  3O5B A;  2A3Z A;  3EL2 A;  2CGL A;  3C65 A;  4XEI A;  2KKZ A;  3DXM B;  3QDK A;  4BRI A;  3CJB A;  4JKG A;  4YOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...