4CJ5A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cj5A00
4LSLA 4KV8A 2OYQA 1QSLA 1LW2A 2WONA 4CEQA 3QIOA 4I9LA 3MXIA 3L3VA 4CHPA 4E7LA 4DSEA 4KHUA 4IDKA 1JXEA 4DMNA 3PV8A 5HP1A 3C6TA 4CIEA 3K5LA 1TKZA 5CY4A 3QNNA 3QEVA 1ASUA 1Q9YA 3QLHA 4AHVA 1C6VA 1BI4B 4B8AB 1VSKA 3HP6A 2D0AA 5CYQA 4FJ5A 1RDDA 4Q5VA 5SWMA 3MEGA 1FKOA 3VQEA 4Z4CA 3OS1A 4DFMA 1KFSA 4FJIA 1GOBA 3PUFA 3TWHA 3CFRA 4LY7A 4R5PA 1QE1A 3NF6A 4IG3A 1ITGA 1C1CA 4HTUA 1BL3A 3SUPA 4FYDA 4W5QA 1W0HA 1RBRA 3WNHA 4B9LA 4E3SA 3TAMA 3HL8A 3K5MA 4RW9A 3SZ2A 1IO2A 4K8ZA 4EZ9A 3NBPA 4TSXA 4CJ4A 3PO5A 4CE9A 3AO5A 4Z0UA 4FLVA 3NDKA 3SV3A 1TV6A 2HHQA 2HHWA 1SL0A 1UAXA 1BI4A 1D8YA 3NHGA 4CECA 3KK1A 4OKEA 2KW4A 1WSHA 2E6LA 1WSEA 4FK2A 1FK9A 2G8VA 5E41A 4CEBA 1TK8A 4FK4A 4E1NA 1NK6A 2KFNA 3SPZA 1TKXA 1WLJA 3ITHA 1TK5A 4O55A 4DTSA 1K6YA 4CJEA 2ETJA 3QNOA 1WSFA 1JLFA 3AVAA 3T1AA 4AHRA 5D3GA 3NGZA 3NAEA 5J2QA 4CCHA 1LWEA 3DM2A 1EKEA 4CJVA 1WAJA 4FLYA 3S3OA 4CFCA 3T3FA 4CEFA 4Z4EA 3OYFA 2VG7A 2PY5A 1KSPA 1TAQA 1IKWA 3AA5X 1DTQA 1VSDA 4CHYA 1QS4A 4AHSA 4CEEA 4Z4IA 3ZT3A 2FC0A 3ZSRA 2VG6A 1RILA 3EY1A 3CYMA 2YNIA 4KHSA 1S1XA 1U48A 1L5UA 3L3UA 3AO2A 4L8RB 3AO4A 1JL2A 4FLTA 1HYVA 1D9DA 4CGFA 3M8SA 3QEWA 3CQ8A 4CERA 1T7PA 4CIFA 2VG5A 4EP4A 4FJMA 1HJRA 4HVJA 3V1QA 1Z26A 3BGRA 2B5JA 1NJZA 4HCBA 1KTQA 4CF9A 4EP5A 2A1SA 3NFAA 4NYFA 4RW8A 3ZT0A 4DFJA 1RT7A 2X74A 4J2EA 1NK5A 4N56A 1HNIA 4M45A 3ZT4A 3TAFA 4CK2A 4B3OA 2Q3SA 1I39A 3ZSOA 1LAWA 4FJ7A 1T03A 1RBSA 4E1MA 2BDPA 3AVHA 3DRSA 3P1GA 1D9FA 4KO0A 4K8XA 4OGEA 4E89A 3U3GA 2A1RA 1UA0A 2DY4A 3VQ8A 2GBZA 4OLBA 4F2RA 3ASMA 1RBVA 5HROA 5KGWA 4I9QA 4FXDA 1O1WA 4ELVA 5JS2A 5J1EA 1BCMA 4M41A 1ZBLA 3D45A 1XHZA 3S3NA 3L2RA 3A2FA 3OYEA 2KTQA 1KLMA 2BANA 4M3RA 4N76A 1BQMA 1KVBA 3MEDA 3LP1A 1DTTA 4FLUA 1EP4A 1A5XA 4F2SA 1S5JA 1RDBA 1Y97A 3IAYA 4CF8A 2I5JA 4I7FA 3TARA 1NK9A 3WNFA 3SQ1A 3V81A 4CJKA 4AHTA 1NK0A 4FJLA 4DSJA 1IG9A 1JL1A 1F21A 2HHTA 3OYDA 1EXQA 1WSIA 2B4JA 3TAEA 1QTMA 3K2PA 1VSEA 4NCGA 4MQ3A 3V9WA 3K57A 1JKHA 2G8WA 4C8KA 3TAQA 2IC3A 2HVIA 3JYTA 5HLFA 3PX4A 3O4QA 1VSMA 4CHNA 2KFZA 4J2BA 1ASWA 4DTPA 5HBMA 1MU2A 3AA2A 3AV9A 3NH0A 4KREA 1JXBA 3LANA 1BIZA 4CGHA 3VQ5A 3V9XA 1L3VA 4OKKA 5J2NA 3TANA 3TAPA 4IBNA 3IRXA 2PYJA 4PQUA 3MECA 4FM1A 3WNEA 1J5OA 4M3TA 3LP0A 2KZMA 1X9SA 2ATQA 3OYMA 2BE2A 3IG1A 1QQCA 2HHVA 1D5AA 4F3OA 1HRHA 3O3FA 2IS3A 3C6UA 2R7YA 4B9VA 1T8EA 3O3GA 3SYZA 3DMJA 3VQ4A 4CJFA 4FJJA 4WE1A 3SPYA 5FDLA 3T19A 4MFBA 1DLOA 3FFIA 3OYLA 1IKVA 1FXXA 4BDZA 3AVNA 1TL1A 4B08A 4CF1A 4DTUA 4JRQA 4M42A 4LD0A 3NF7A 5FRMA 2O4IA 3S9HA 1X9MA 3V1OA 4CJSA 3U6FA 1BGXT 1SV5A 1YTUA 2HB5A 5SZTA 1C1AA 4DF8A 3QO9A 3NF9A 1C0UA 1RT2A 2RF2A 3HVTA 4RW4A 3QINA 3OYIA 4OPJA 3L2WA 3U3YA 2RN2A 1JLBA 3ZT1A 4CJ5A 3LP2A 4BE0A 1HPZA 3IS9A 1TK0A 1RTHA 2OZSA 4DSLA 4PUOA 1NKEA 4JLHA 4RG8A 2E6MA 2D0CA 3VQAA 3D0PA 1WN7A 4HUGA 4DTMA 1S1WA 3MXMA 2XY7A 4RW6A 1KVAA 4C8OA 4ELTA 4JS4A 1RBTA 1SUQA 4FW2A 3V6DA 4DQRA 4FJ9A 3F9KA 3KIOA 3SUQA 1VRUA 3AVGA 4CFBA 5KRTA 2NUBA 1QHTA 2HNYA 3AVLA 3ZSWA 3OS2A 4BE2A 1KRPA 1X1PA 1ZBHA 1NKBA 1WNSA 2OPPA 1JLAA 3HYFA 5J2MA 3UIQA 4DTNA 4G1QA 4F8RA 4FJKA 2G8IA 1CZ9A 1S6PA 2Z1GA 3PX6A 4Z4GA 1BHLA 1HQUA 2XRIA 3CM6A 3K5OA 5HRNA 3RRHA 3SNNA 3QIPA 3EZ5A 1GOCA 1L3SA 4FJGA 2YV0X 4DF4A 1RBUA 4JS5A 1HNVA 4BACA 3AVCA 1TKDA 4E7JA 4H8KA 4CJRA 1BCOA 3E01A 3HT3A 4CEDA 1B9DA 2WOMA 4FJXA 1A5VA 4O44A 2FBXA 3TI0A 2QKKA 2FBVA 4BWMA 4C8LA 4FZYA 1J54A 4HUFA 4CJQA 1KFDA 4DFKA 1C1BA 4XIUA 1ZYQA 1VRTA 5EU7A 3KLFA 1KVCA 4FM2A 3WNGA 2G8KA 3DLHA 3RR7A 3S3MA 3OYAA 4OPKA 4Z4HA 4DQPA 3HSTB 3RMCA 4J2AA 4M3WA 4HUEA 2IGIA 4DLEA 1U47A 3M8QA 4CEOA 4CJLA 4LH4A 3K5NA 4F4KA 3C94A 1N6QA 4Q0BA 2YNGA 4AH9A 4CK1A 3O3HA 2P5OA 3QETA 1RT4A 1TVRA 1CLQA 4OJRA 1IH7A 3TAGA 3DYAA 4DTOA 2OPSA 3F73A 3KLIA 1NK4A 4J2DA 3NE6A 1HMVA 3HJFA 4DQQA 1BISA 5DMRA 1TAUA 4CGDA 3B6OA 3V4IA 4I2PA 1SL1A 3DLRA 3HPHA 4KB0A 2YKNA 4CGJA 4CF2A 4B8CA 4ZTFA 5CYMA 3NF8A 1YVUA 4ZHRA 3DLKA 3OYCA 4O0JA 4W5NA 1QSYA 1LAVA 3AVIA 2E4LA 3LDSA 4F3TA 1G15A 2JGUA 2HVHA 1R0AA 2KZZA 4ZTJA 4FW1A 3B6PA 4O4GA 3OY9A 3ZSVA 5C42A 3RTVA 3KTQA 2OZMA 4YFUA 4M3ZA 1JLCA 1IKYA 3OYKA 3AO3A 4YNQA 2YNHA 3MEEA 1SKSA 3VQPA 1TGOA 4CIGA 4B9NA 3I8DA 3NGIA 1YT3A 3VQBA 1T05A 4FJNA 2YNFA 2P5GA 3RMBA 1S9EA 4CGIA 3HO1A 1VK0A 4DSFA 2GUIA 1NK7A 1L3TA 2OA8A 3LAKA 4ELUA 4M3UA 3SUOA 1NK8A 1ZBIA 4CJUA 5T7BA 4HCCA 2QXFA 2XHBA 3LWMA 1ZBFA 3V1RA 1IKXA 3ULDA 2HHUA 4DG1A 4KAZA 2ZE2A 2BGGA 4E0DA 1RT6A 3SQ4A 2AJQA 1UWBA 1EX4A 1JLGA 3AVBA 2OPQA 1L3UA 4DFPA 4ID1A 4KPYA 3EYZA 2O4GA 3C95A 1C0MA 5C24A 4IFVA 3NH2A 3KK3A 1RTIA 2YHAA 3AA3A 1U49A 4CJPA 4FK0A 4W5RA 4Z4FA 1XHXA 2F8TA 4GVMA 3SUNA 2X78A 3HK2A 4HHTA 3M8RA 4BWJA 1U45A 1B92A 2IAJA 3KKRA 2ITGA 3DLEA 2X6SA 3OJUA 4KHNA 3KLGA 2HNDA 3ZSQA 2YKMA 1S6QA 2P1JA 3DLGA 4KI4A 3VA3A 2IOCA 4CHZA 3AO1A 4DTJA 1CZBA 4NCAA 1CXUA 2VWKA 1FKPA 1LW0A 3SI6A 1U4BA 4C8NA 4AHUA 3I0SA 3M8PA 4LSNA 3OS0A 1RCHA 1REVA 3G10A 3HXMA 4GW6A 2XY6A 2HHXA 1SKRA 1VSHA 1SKWA 1HYZA 2X6NA 4DSIA 2GV9A 2F96A 3AVMA 5DK5A 5FROA 3MAQA 1NKCA 3QEXA 3VQDA 4DU4A 2ZD1A 3DI6A 3P83D 3HPOA 2Z1IA 3VQQA 4E7KA 1NOZA 3SQ0A 2JLEA 4O0IA 2DTUA 4W5OA 2PZSA 4N47A 4FZXC 4DS4A 5I42A 1JLQA 3MXJA 1NJXA 1Z25A 3AVJA 4B9SA 2QKBA 5KRSA 3HPGA 4W5TA 2DFHA 3DRRA 4H4OA 2XO7A 2Z1HA 1RDCA 4OLAA 1UOCA 4UQGA 4M3XA 2DFEA 3KD5E 4E19A 4BE1A 3LALA 3ZT2A 3H08A 2W42A 4FLXA 4B9MA 2HW3A 1RT5A 2RPIA 4BDYA 3KKSA 2LSNA 1S1TA 1UA1A 1X9WA 1BIUA 4FJHA 2G8UA 1WAFA 4KHQA 2FBTA 4CJWA 3RMAA 3DOLA 1JLEA 3VQ9A 3THVA 4NYNA 4KFBA 5HRRA 2Z1JA 4DTXA 5I3UA 2D5RA 1VSLA 3NGYA 3PO4A 1LWFA 1S1UA 3OVNA 3ZSZA 3ZSYA 3OYGA 4ICLA 1VSFA 4Y1DA 4C8MA 2EHGA 3QERA 3PX0A 2IDOA 2HMIA 2Y1JA 2RKIA 3L2VA 4AILC 1GOAA 2HNZA 1XC9A 1HQEA 3SCXA 3O4NA 4CFDA 3K59A 1NJYA 4KHWA 4LH5A 3CM5A 5HRPA 5JS1A 1W9HA 3KLEA 3RR8A 4CEAA 4CJ3A 3LAMA 4RW7A 3TABA 4KTQA 2OPRA 4EZ6A 2EX3A 4B9TA 4FM0A 3QESA 4OVLA 5J2PA 2XY8A 1RTJA 2KQ2A 3LP3A 4O5BA 3VN5A 1ASVA 3KJVA 3ALYA 3L2UA 1S1VA 1VSJA 4Y1CA 5C25A 3VA0A 2G8FA 4GMJB 3VQ6A 4FVMA 4QAGA 4E7IA 1A5WA 1QSSA 3RWUA 4PWDA 3KK2A 2PYLA 4KHYA 5CZ1A 4DWIA 3HP9A 1WSJA 4ID5A 4CESA 4CGGA 3V9SA 1EETA 2ZQBA 4CJTA 1J53A 1KLNA 5KTQA 4DU1A 2G8HA 1YTAA 4I2QA 4PA1A 1RNHA 4FLWA 3BDPA 4IFYA 4CFAA 3V9UA 3DOKA 4CF0A 3SQ2A 1CXQA 1RT3A 5KI6A 2XY5A 1SL2A 4B9UA 5FRNA 3CFPA 1U04A 5K14A 1BQNA 1XI1A 4DQSA 3RMDA 4N41A 2HHSA 1Q8IA 1TL3A 1N5YA 4KTWA 4CHQA 3OYHA 3OJSA 3TR8A 3LWLA 4KKOA 4NCBA 4FZZA 4DS5A 1VSIA 4DLGA 5KGXA 4DU3A 3CFOA 4DQIA 1RTDA 3LPUA 1TKTA 3OYNA 4N5SA 2VWJA 1Q9XA 1J9AA 3RRGA 1LV5A 1ZBUA 4CK3A 1I3AA 1NJWA 1HYSA 1LWCA 4KTZA 3KLHA 5CZ2A 3DRPA 3HVRA 3L8BA 3QEPA 4IG0A 3KD1E 2FBYA 3NCIA 4DSKA 4KB1A 3K58A 3G0ZA 2F8SA 3LZIA 3HM9A 4FLZA 3DLBA 4QOZB 3OYJA 3AVKA 2DFFA 2QK9A 3ZCMA 2D0BA 1WSGA 3AA4A 4OGCA 3JSMA 3QEIA 2Y1IA 2B6AA 1NOYA 1RT1A 4KI6A 3LPTA 2P51A 4OKJA 4H4MA 1C0TA 3VQCA 3I0RA 4JRPA 4PY5A 4M3YA 4KRFA 3OYBA 3CG7A 3P5JA 1XWLA 1S9GA 1RDAA 4CEZA 4FJ8A 3NH1A 4BDPA 4IKFA 3AVFA 4FCYA 3ISNC 3VQ7A 5HRSA 1B9FA 4E7HA 4AHCA 1KCFA 3LZJA 4QCLA 3ZSXA 3SV4A 2YHBA 4CHOA 4DTRA 3SJJA 3PY8A 3V9ZA 3L2QA
chains in the Genus database with same CATH superfamily
3SMPA 3LDLA 4WFNL 5EXWA 4I9LA 3L3VA 4IDKA 5EY4A 4DMNA 3PV8A 2AP1A 5HP1A 3GG4A 4CIEA 3THYB 2OCEA 3QNNA 3QEVA 1Q9YA 1K8KA 4OPAA 1WB9A 1BI4B 3B8AX 1VSKA 1V4SA 4YDUA 3HP6A 3R8EA 4Z4CA 3ATUA 3H46O 5LMUK 4DFMA 3TWHA 4LY7A 2V51B 3QBXA 1C1CA 4HTUA 2HBMA 3D2EB 2E88A 1IV0A 3IFRA 4B9LA 4BG8A 3TAMA 3SZ2A 4K8ZA 5JVGL 4KHPK 3PO5A 2Q0UA 4FWMA 3ZETB 4DR7K 3QFUA 2HHWA 3R3LA 1UAXA 4B1ZA 3L0QA 4CECA 3U9DA 4FK2A 1KQSM 1FK9A 2G8VA 4FK4A 4E1NA 1TK5A 4DTSA 1K6YA 2Q0RA 2ETJA 3CD6N 4MDAA 3DM2A 4FLYA 3S3OA 1NJIO 2PY5A 4YOVA 1IKWA 1KC8O 4IOCL 4Z4IA 1BWFO 1RILA 3EY1A 1S1XA 1D9DA 1HYVA 3QEWA 3CQ8A 4CERA 2ZM6K 4FJMA 1QQMA 4A59A 1Z26A 1MA9B 1RT7A 2Q3SA 1I39A 4DCHA 2WUSA 4BG9A 4YOXA 4FJ7A 4E1MA 3AVHA 3MN7A 4JI1K 4KO0A 2OANA 3CJCA 2DY4A 4OLBA 2GBZA 1QVFM 5HROA 1RBVA 3TPQA 5JS2A 5J1EA 1VQMN 3S3NA 3L2RA 3A2FA 1KLMA 4N76A 1BQMA 2Q97A 3LP1A 2HOEA 4A5BA 5AFUH 4BROA 4FL9A 1KD1O 3IAYA 4CF8A 3WNFA 3V81A 4AHTA 1NMDA 1IG9A 4K25A 2IIRA 1S72N 4AM6A 1GLLO 1WSIA 2B4JA 3TAEA 2UU9K 3MCAB 4DUYK 4MQ3A 3V9WA 1W2BM 3K57A 1JKHA 2IC3A 2QWLA 1HKBA 5HBMA 4KREA 3QB0A 3O1BA 3LANA 4CGHA 2HF4A 3IKMA 5J2NA 2PYJA 4IBNA 4FM1A 5GAEP 3KWIA 3DXMB 4NB4A 4BRIA 1K73O 2ATQA 2BE2A 3MWTA 3DXKA 1HRHA 3RSEB 3DMJA 4CJFA 2UYTA 4FJJA 2W6LA 3SPYA 3OYLA 3EE9A 1FXXA 2A40A 3CCUN 2F4VK 4DTUA 5H1SQ 4X62K 3NF7A 2O4IA 4AM7A 5SZTA 1K8AO 3MK6A 3HVTA 5E84A 1JLBA 3IS9A 4JLHA 3ULEB 4HUGA 2D0CA 3VQAA 4PL7A 3OTOK 4DTMA 2XY7A 1KVAA 1ZXOA 2WTUA 3V6DA 4DQRA 4CZIA 2FXUA 3ZSWA 1CZAN 2P9IA 1WNSA 2OPPA 4DTNA 1CZ9A 4BVPA 5FPNA 2Z1GA 4BRDA 3PX6A 5AQRA 1HQUA 3K5OA 3EZ5A 4CZKA 1L3SA 4FJGA 4DV1K 3FR0A 2HBKA 3CHWA 4DF4A 4BACA 1TKDA 3K9JA 1B9DA 2WOMA 5C2DA 1HX1A 4YORA 3VEVA 5BREA 2H3GX 2QM1A 1JCEA 3UE5A 4BWMA 4XEIA 1J54A 4DFKA 4JI5K 1VRTA 3DLHA 1KVCA 2IVOA 2G8KA 3RR7A 1QZ6A 3BZCA 3S3MA 3HSTB 3OBYA 4BRMA 3CJ7A 4CJLA 4BGBA 3JXUA 2P9SA 3C94A 3E9PA 2YNGA 2P5OA 3O3HA 4BQLA 4A5AA 3F73A 3KLIA 1HMVA 3FZHA 1BISA 4CGDA 3B6OA 2ASPA 3V4IA 1SL1A 1TYQB 3HPHA 4MLHA 4CF2A 5ADXH 3NF8A 3LDQA 2A42A 3T1HK 4ZHRA 3DLKA 3SBGA 1DGKN 1QSYA 1W7AA 5BRHA 1G15A 2HVHA 4O4GA 2YJFA 1VQ5N 1IKYA 2YHXA 4LF6K 4B9NA 4BR7A 1OVQA 3A5NC 5IWAK 3JAMO 3VQBA 5FPDA 1T05A 2P5GA 4BRCA 1S9EA 4CGIA 3HO1A 1VK0A 3WQTA 3ATVA 4M3UA 1NGCA 3PSFA 1NK8A 4CJUA 2ZGZA 4RWTA 2RE2A 1X9JA 2XHBA 1Q7YO 1IKXA 2ITMA 3CCQN 4KAZA 1RT6A 3SQ4A 1UWBA 1K8KB 4DFPA 2A41A 5AQHA 3W3DA 4DV0K 1NNEA 4IFVA 2YHAA 5BR9A 4DR5K 4GVMA 3THXA 2HSTA 1RDUA 4WCEL 4YOTA 3VEOA 1S6QA 3L4QA 1M1KO 3DLGA 1D4XA 2NNWA 4DTJA 4DB3A 2VWKA 3O08A 1FKPA 3VPZA 4C8NA 4AHUA 4CZFA 1RCHA 3WXMB 3HXMA 2YHWA 1VQON 1VSHA 1SKWA 4ILGB 2X6NA 5AFUA 5DK5A 3QEXA 3VQDA 4JI4K 3HPOA 3VQQA 1NOZA 3TTFA 2DTUA 2YX6A 2PZSA 3PIOL 1JLQA 5KPRA 2QKBA 4HWIA 3DRRA 4H4OA 1Y64A 2Z1HA 3UB5A 4BRLA 4CBWA 1I94K 4JKBA 3H08A 1KAYA 1SAZA 2HW3A 4GKKK 4JAXA 1S1TA 4CJ7A 4FOEA 4BR5A 3DOLA 3O6WA 5HRRA 2D5RA 4JKGB 4CZMA 1LWFA 3OVNA 1ESVA 3QERA 5JS1A 1VSFA 4C8MA 3PX0A 4IZ9A 3CJAA 2F7TA 3L2VA 1GOAA 2HNZA 5FPMA 1XC9A 3SCXA 5GINA 3HBTA 3CM5A 4CJ3A 3LAMA 5FLXO 2EX3A 1C0GA 3BP8A 3KJVA 3L2UA 4O5BA 3VN5A 3M3ZA 3O8MA 1S1VA 5C25A 3VQ6A 4JNEA 4QAGA 3RWUA 4NO7A 1WSJA 4G9ZA 2JWLA 5TKWA 1EETA 4CJTA 3QFPA 5CHIA 4DKWA 4I2QA 2G8HA 4V19S 4IFYA 4IO8A 3V9UA 4JKAA 2XY5A 5AZJA 3CFPA 1U04A 1XI1A 4IFEA 3RMDA 4KTWA 3OYHA 1VSIA 4DLGA 5KGXA 4DQIA 2O8BA 4ILJA 3OYNA 4EIAA 4CK3A 1HYSA 3VGMA 3DRPA 3HVRA 1GLEG 2FBYA 4K41A 3VOVA 1WBDA 2QK9A 5DM6L 2UUAK 1RT1A 4OKJA 5BR8K 4I6MA 3I0RA 4PY5A 4H5WA 5GIPA 1QHAA 3MDQA 1RDAA 5AR0A 5DM7L 4IKFA 3AVFA 4Y0WA 1B9FA 3A0IX 4QCLA 3KVGA 3ZSXA 2W41A 2YHBA 3ZEUA 4DV3K 3SV4A 4A62A 3PY8A 4JKDA 3HSCA 3EN9A 3E1YA 4LSLA 2OYQA 1G99A 4JEPA 2UXDK 1JXEA 1MWMA 3C6TA 1NGIA 2NZTA 1ASUA 4CZEA 3P39A 3QLHA 3H45C 3BUZB 4JV5K 1NM1A 5ADXA 4FJ5A 1RDDA 3U8XA 3MEGA 3HOSA 3VQEA 1KFSA 3OS1A 4FJIA 4R79A 3CFRA 4C1NI 4IG3A 3NF6A 1YITN 1ITGA 1BL3A 3SUPA 4M63C 4FYDA 1RBRA 5C10A 4E3SA 3SAHA 3KWGA 3K5MA 4BRGA 1IO2A 3NBPA 4H5RA 3JS6A 4ISFA 3WQUA 3AO5A 4Z0UA 4CE9A 2VGNA 4FLVA 3NDKA 3SMSA 1NU0A 3SV3A 1SL0A 3VEYA 2GWKA 2P9PA 4OKEA 1WSHA 5KQDA 1TK8A 2V52B 3SPZA 1TKXA 3TTDA 2VQEK 1JCGA 3QNOA 1KXPA 1JLFA 3I55N 3T1AA 5D3GA 2ZJQL 3C6HA 3NGZA 2P9SB 3NAEA 4CJVA 1EKEA 5AJ3K 1TAQA 3O9UA 5LMNK 1VSDA 2ASOA 1C0FA 3ZT3A 2FC0A 4F9OA 3ZSRA 4AQYK 5BN9A 4KHSA 3LDOA 1JL2A 1E3MA 3N4PA 4CIFA 2VG5A 2P9NA 3BGRA 4HCBA 4EP5A 1VQPN 1YAGA 4M45A 1N33K 4B3OA 3ZSOA 3U4LA 1T03A 1RBSA 2BDPA 2NLXA 3R9PA 4K8XA 2F9TA 2A1RA 1NGAA 5GIOA 4I9QA 1VQNN 4JHDB 1VQ4N 1GLFO 3OYEA 2KTQA 1KVBA 1DTTA 3ID6A 4LF8K 3J81O 1YJNN 1RDBA 1Y97A 3SBTA 1NK9A 3SQ1A 4CJKA 3OW2M 3G71N 4FJLA 3CJ9A 3VENA 2HHTA 2PBDA 1OVYA 3VF4A 3K2PA 1VSEA 2G8WA 2HVIA 1YJ9N 3THXB 4KH4A 4CHNA 1HNWK 2P9LB 3AV9A 3KHYA 4CVNE 4B1XB 2NRXA 3TANA 5AZIB 3MECA 3ZLJA 2Q31A 3PIPL 3D2FA 3I56N 3OYMA 1T3VA 3IG1A 1QQCA 1D5AA 4F3OA 1X3MA 5ELZA 1N32K 4GV3A 2IS3A 3C6UA 2R7YA 4B9VA 1T8EA 3SYZA 3MX5A 3HZ6A 4JN4A 3VQ4A 3P4IA 1W97L 3I33A 2JWKA 3IMXA 4MFBA 1XC3A 1IKVA 2YCHA 1T44A 3S9HA 3U6FA 4EHUA 3A5OC 4RCHA 2HB5A 4DF8A 1N36K 4WF9L 1RT2A 2RF2A 4OPJA 3WXJA 4CJ5A 3LP2A 2FSNA 2O8EB 1RTHA 3ENHA 3D0PA 4JD2A 2HMPA 4C8OA 5KPZA 1RBTA 1SUQA 3M6GA 4PKHA 2NRHA 3MWPA 3AVGA 2HNYA 3AVLA 4L3QA 3OS2A 3BY5A 3UKUA 2VQFK 1HUXA 2D0PA 3CM6A 3SNNA 5I9EB 3QIPA 1P90A 5M1OA 4GV9A 1HNVA 5F1XA 4CD1A 4E7JA 4FPBA 4H8KA 1A5VA 3O80A 2FBXA 2E2NA 3TI0A 2FBVA 4HUFA 1C1BA 4XIUA 5EU7A 3KLFA 3WNGA 1MDUB 3N4QA 4DQPA 4KH6A 4J2AA 2BTFA 2BUPA 4CEOA 4YOYA 1GLDG 4B1UB 4LH4A 2CH6A 4Q0BA 1DEJA 4CK1A 2I7NA 3TTCA 4X64K 5E26A 1LOTB 2O8BB 3TAGA 1IH7A 1Z6RA 3EL2A 3VEZA 2VCPA 4I2PA 4X66K 4KB0A 4B8CA 3H3OB 3DWLA 1YVUA 1SS6A 1YIJN 4KBOA 3AVIA 1OH6A 4F3TA 2A3ZA 2KZZA 2Q36A 3B6PA 4U67L 3ZSVA 3RTVA 3BZKA 3KTQA 3OYKA 4LF7K 1H1VA 4MDBA 1TGOA 3J7ZO 3I8DA 4FJNA 3QICA 3T1YK 3CJ1A 3ZEUB 2GUIA 5AQTA 3THWA 2QXFA 4MLEA 1ZBFA 1NMNA 2HHUA 3EE8A 2AJQA 5GADP 1JLGA 4IOXA 2FSKA 5AQMA 3G25A 5BPLA 3NVMA 4FOIA 3AGKA 2ZJPL 1C0MA 5C24A 3KK3A 4Z4FA 2F8TA 3HK2A 4HHTA 1LCUA 3OA9A 2CH5A 1U45A 3KKRA 2ITGA 3E9LA 3DLEA 2X6SA 1NGEA 3VA3A 2IOCA 1LW0A 3I0SA 2XY6A 3CCVN 1FJGK 2UXCK 4DSIA 2BH1A 5FROA 1NKCA 4DU4A 2ZD1A 3P83D 4EHTA 2Z1IA 2JLEA 2P9UA 4W5OA 4FZXC 4N47A 5I42A 4QS8A 3MXJA 4YOUA 1Z25A 3VTIA 3HPGA 4W5TA 2XO7A 3FZKA 1UOCA 4UQGA 4M3XA 4FSVA 4E19A 3LALA 2W42A 4FLXA 4B9MA 1RT5A 1UA1A 2LSNA 4FJHA 3NVKA 4QS7A 3K0SA 4CZGA 2QTDA 4CJWA 1JLEA 3THVA 4NYNA 2O8FA 2GEMA 4DTXA 2P9NB 1HJOA 1VSLA 2HMIA 2IDOA 2Y1JA 4GY2B 3F5TA 2HF3A 3A5LC 3C7NA 1HQEA 2WFBA 3O4NA 4CFDA 4KHWA 2VYPA 4FVUA 4CEAA 3TABA 4H5TA 4KTQA 4BC5A 3WXKA 4FM0A 5J2PA 5AQOA 1RTJA 3LP3A 3HRGA 4HTLA 4Y1CA 1VSJA 4GMJB 2KLAA 4FVMA 4YY3K 4PWDA 4DV5K 5AQUA 4NXNK 4KHYA 5CZ1A 4CESA 4JKFA 3V9SA 2ZQBA 1KLNA 5KTQA 4WYBA 2A5XA 3BDPA 4GVEA 3DOKA 4CF0A 1SL2A 1RT3A 5KI6A 5FRNA 4B9UA 1BQNA 4W5NA 4DR2K 1N5YA 4B1WB 5CE3A 1HNXK 5HL7L 4DU3A 1OKJA 4N5SA 1J9AA 1R59O 1I3AA 1NJWA 1LWCA 4KTZA 5CZ2A 3QEPA 5TKYA 3NCIA 3D2FB 3G0ZA 2F8SA 1RGIA 3LZIA 4FLZA 3AVKA 2W6KA 4CD3A 2D0BA 1WSGA 2YJEA 3QEIA 2B6AA 4KI6A 3SAGA 2P51A 3VQCA 5EX5A 5C15A 3P5JA 4JI2K 1XWLA 1S9GA 4O8UA 4CEZA 4BDPA 3ISNC 3VQ7A 1QVGM 4XH1A 1IG8A 1XQSC 4AHCA 4BQZA 3SJJA 3V9ZA 3L2QA 2UUCK 4KV8A 1QSLA 4Z94A 1LW2A 4DQ8A 2E1ZA 4JI0K 3S41A 4E7LA 4X65K 3T7ZA 3E9OA 3WEEA 1TKZA 5CY4A 4JD2B 3LDNA 1XMQK 3CCRN 5M1NA 3M1FA 2ZF5O 4B8AB 2D0AA 5CYQA 1XNQK 5SWMA 1FKOA 1SZ2A 3PUFA 3QMLA 2QWNA 2QWOA 5M1QA 3CJBA 1EQYA 5JMVA 1W0HA 3WNHA 4BR0A 1KAZA 4RW9A 4XH5A 4EZ9A 4TSXA 3E66A 4CJ4A 5BN8A 3ENBA 2Q1NA 4YHHK 3DJCA 2E2QA 2KHOA 4H5VA 1TV6A 1BI4A 3MCPA 1D8YA 3KK1A 2KW4A 1NGBA 1WSEA 5E41A 4CEBA 1NK6A 2KFNA 2NRWA 1WLJA 4OX9K 4CJEA 3AVAA 4OO1J 3L4IA 5J2QA 5C0YA 4CCHA 1LWEA 3FGUA 1WAJA 4CFCA 3T3FA 4Z4EA 3OYFA 3BEXA 2VG7A 1KSPA 4CHYA 3HOTA 4AHSA 4BRFA 4LF5K 5AQYA 1ZBSA 1GLCG 3AO4A 1T7PA 1HJRA 1NJZA 1T6CA 1NLVA 3NFAA 3ZT0A 4DFJA 4XH4A 3ZT4A 3TAFA 4CK2A 3F9MA 1LAWA 5AQNA 3O9TA 3DRSA 3P1GA 3SLCA 1D9FA 3U3GA 1UA0A 3VQ8A 3ASMA 4ISGA 4ELVA 1BCMA 4M41A 1ZBLA 1XHZA 3EKUA 4IOAL 3MEDA 1IBMK 3CXCM 4PKIA 4FLUA 1EP4A 3VEWA 4DV6K 2I5JA 2NRRA 1JL1A 1F21A 3J80O 3DXKB 1QTMA 2NRVA 4NCGA 3TAQA 4LFCK 3JYTA 5HLFA 3O4QA 1VSMA 4DTPA 3AA2A 5AQXA 5AQKA 4LFBK 1BIZA 3V9XA 4PQUA 3TAPA 4GV6A 1J5OA 5IT9O 1JJ2M 2HHVA 1VQ6N 4M7XA 5B8HA 4DR3K 1BOTO 4WE1A 1SQKA 5FDLA 3T19A 4CBXA 1DLOA 3FFIA 3ZYYX 2P9UB 1YHQN 2P9IB 5AQLA 4M42A 4DR1K 5KQ8A 5FRMA 3CPEA 4H03B 1X9MA 2ASMA 4CJSA 3EEQA 1SV5A 3P38A 3QO9A 4NLCA 3NF9A 1C0UA 4FWSA 3OYIA 3U3YA 3DXMA 1TK0A 2RN2A 2OZSA 4BE0A 4DSLA 4PUOA 1QZ5A 2E6MA 3T69A 1Q82O 1WN7A 3MXMA 4UY8O 1J5EK 4BGAA 4JS4A 4FW2A 4FJ9A 3F9KA 2NUBA 1ZBHA 2P9KA 1NKBA 4FJKA 2G8IA 3CCSN 5J2MA 3UIQA 4F8RA 1ZC6A 2V7ZA 5AQWA 2QEXN 4JI3K 1BG3A 1S6PA 2IVPA 4JKEA 4Z4GA 2XRIA 3IUCA 3G4SN 4JI7K 1K9MO 5GAHP 1J6ZA 2YV0X 4JKCA 3FZLA 3AVCA 3ULEA 4LC9B 1BCOA 3E01A 3HT3A 4CEDA 3CCMN 4O44A 3R6MA 1WBBA 2QKKA 4C8LA 3Q7BA 4FZYA 3CQXA 4BRKA 3CC7N 4CJQA 1KFDA 3AAPA 1ZYQA 4FM2A 3OYAA 4Z4HA 2HHHK 1VQ8N 4DLEA 4U7BA 5LJWA 4F4KA 1ATNA 1N6QA 4AH9A 3CCLN 3QETA 4YDUC 4BVOA 1RT4A 4K43A 4OJRA 3DYAA 4DTOA 1MWKA 2A6AA 3HJFA 1TAUA 1NWKA 2QWQA 3DLRA 2YKNA 1V4TA 4BRPA 1NGJA 5CYMA 1OH5A 3EZWA 4O0JA 4PHTX 1LAVA 1VHXA 1R0AA 3I8BA 4CBUA 5C42A 1N34K 4E1JA 1JLCA 5HOOA 4YNQA 1BUPA 3LM2A 3MEEA 3VQPA 1YT3A 2YNFA 3MN5A 4ISEA 3R1XA 3VF6A 3LAKA 1ILYA 1ZBIA 5T7BA 2E1YA 1XMOK 3V1RA 4YOWA 2D4WA 5BPMA 4DG1A 3U9ZA 1VQKN 3W0LA 3AVBA 2OPQA 3MN9A 4IXCA 3C95A 1U49A 3AA3A 4CJPA 4BR9A 4JI6K 3GL1A 3SUNA 2X78A 1HLUA 4BWJA 1B92A 3QDKA 2IAJA 3OHRA 3H1QA 2J4RA 2F9WA 3KLGA 2HNDA 4A2AA 2YKMA 1EWQA 2D1KA 1IBLK 4CHZA 1CXUA 3SI6A 2ZGYA 1U4BA 3MN6A 3H6EA 3M8PA 4LSNA 5C12A 1REVA 3OS0A 4GW6A 1GLBG 3CF5L 2NRZA 4BC4A 2GV9A 3AVMA 3MAQA 3DI6A 1Q18A 4E7KA 3AGRA 3J7YP 4BC2A 3AVJA 4B9SA 5KRSA 2DFHA 4OLAA 4GNIA 2DFEA 3KD5E 4BE1A 1YF5L 4IWVA 3J7AP 4BDYA 3KKSA 1BIUA 5JLHA 4JK8A 4KHQA 3CETA 2FBTA 5AQQA 3VQ9A 3L6QA 2Z1JA 2ZWHA 4KH5A 3NGYA 5JVHL 1S1UA 3ZSZA 5GAGP 3ZSYA 4IJNA 4PKGA 4C1NK 4AILC 1X3NA 2KKZA 1NJYA 4LH5A 5AZJB 5HRPA 3KLEA 3RR8A 3H1VX 2QI2A 4EZ6A 4B9TA 4OVLA 1VQ7N 1WUAA 2KQ2A 3SJHA 3ALYA 4WFBL 3VF2A 3VA0A 4E7IA 1A5WA 2RHKA 3KK2A 2PYLA 4JKGA 1NG9A 3HP9A 4ID5A 4CGGA 5F2RA 3ID8A 2HBJA 4O5FA 4DU1A 2QW9A 4PA1A 4FLWA 3NMUA 3BF1A 3LM9A 3SQ2A 4CZJA 5CR4A 5C2FA 5K14A 4FWNA 4DQSA 4I6MB 5AQGA 4BRAA 1Q8IA 2YHYA 4CHQA 4CZLA 3OJSA 4DS5A 1Q86O 1RTDA 2AA4A 3CI5A 2VWJA 5AQZA 4RTFD 3HI0A 3KLHA 3VMFB 4B3TK 3P31A 3KD1E 4O8KA 1HR0K 1DT9A 3DLBA 3VESA 4QOZB 1NOYA 2Y1IA 3CC2N 1C0TA 4JRPA 4M3YA 3OYBA 3CG7A 2GELA 2FLOA 4FJ8A 3NH1A 1RFQA 3C65A 5HRSA 4DV4K 4E7HA 1KCFA 3LZJA 3ZX3A 4CHOA 4DTRA 2E2OA 4FWPA 2CGLA 3WT0A 2WONA 2E5LK 4JKHA 3QIOA 4CEQA 3C6AA 3MXIA 4DSEA 4CHPA 4KHUA 3K5LA 4AHVA 1C6VA 2QWMA 3BF3A 2P9PB 2P9KB 4BR2A 3CMEN 5AQIA 4Q5VA 1GOBA 4DHYA 4R5PA 2O8DA 3FLCO 1QE1A 3GBTA 3CCJN 3CCEN 4H0PA 4W5QA 2WC9A 5EVZA 1GLAG 3HL8A 1U2VA 3M5RA 1HNZK 5EOYA 5JLFA 3O9QA 4JYAK 2HHQA 4DR6K 3NHGA 2FSJA 2E6LA 1IBKK 1XUPO 3IDHA 3O9RA 4JK7A 3ITHA 4O55A 3H3NO 4B3RK 1WSFA 4K42A 4AHRA 3TSUA 1TUYA 4NXMK 4AF1A 4CEFA 4WQ5C 5LY3A 3CIPA 2O8CA 5M1FA 3AA5X 1DTQA 3EKSA 1QS4A 4CEEA 1YUWA 4LFAK 2VG6A 3CYMA 2YNIA 3O1WA 3K9KA 1U48A 3TSPA 3L3UA 3AO2A 3CMAN 1L5UA 4L8RB 4FLTA 3VETA 4CGFA 3M8SA 1HKGA 2QWPA 1GLJO 3UKRA 4EP4A 4A57A 4HVJA 3V1QA 2B5JA 1KTQA 4CF9A 2A1SA 4NYFA 4RW8A 2X74A 4J2EA 3CC4N 1NK5A 1E4FT 3VGLA 4N56A 1HNIA 2I7PA 4BRNA 2PAVA 5F0XA 4OGEA 4E89A 5M1KA 4WFAL 2UUBK 4FWOA 4F2RA 5KGWA 4FXDA 1O1WA 4H0XB 4B3SK 3D45A 1VQ9N 4B3MK 1YJWN 3J8AA 2BANA 4M3RA 4DV7K 4BY9C 1A5XA 4F2SA 1S5JA 1NGHA 4I7FA 3TARA 2EWSA 4EFHA 1NK0A 4DSJA 3GDQA 3OYDA 1EXQA 4CI6A 4JK9A 3A5MC 3C0BA 4C8KA 3WXLA 2V7YA 2GX9A 4J8FA 3PX4A 1OH7A 1YVNA 4JHDA 2KFZA 4J2BA 1OH8A 1ASWA 3NH0A 1MU2A 1P8ZA 1JXBA 1BO5O 3VQ5A 1L3VA 4OKKA 3IRXA 3WNEA 4M3TA 2KZMA 3LP0A 1X9SA 3EO3A 1S22A 4H0YB 4LF4K 3O3FA 4WQ5A 1RDWX 3O3GA 4IEEA 4BDZA 1M90O 4K0KK 3AVNA 3UKUB 1TL1A 4B08A 4CF1A 2P9LA 4JRQA 4PL8A 3FFKB 4LD0A 3V1OA 1BGXT 4DUZK 1YTUA 1C1AA 5AZIA 1QQOA 4RW4A 3L2WA 3QINA 3RRGA 3ZT1A 1HPZA 4MO4A 1NKEA 3SK3A 4RG8A 1S1WA 1ATSA 4BRHA 3CQYA 3THYA 4RW6A 3ZX0A 4ELTA 5BRDA 3SUQA 3KIOA 3PSIA 1VRUA 4CFBA 5KRTA 1QHTA 4BRQA 1KRPA 4BE2A 1X1PA 2Q2RA 5MLCQ 1JLAA 3HYFA 2E8AA 3LL3A 4G1QA 3O4WA 3HM8A 1NGGA 1BHLA 3RRHA 5HRNA 1T6DA 3D2EA 1GOCA 2O8EA 1RBUA 4JS5A 1Q81O 2OTLN 4CJRA 3DLLL 4FJXA 2PFUA 3ZETA 4A2BA 5LJVA 4IJAA 4OPKA 3RMCA 4M3WA 4HUEA 2IGIA 3AARA 1U47A 3M8QA 2D0OA 4MO5A 3K5NA 1HKCA 3VGKA 2FF6A 1TVRA 1CLQA 5AQJA 1NBWA 2OPSA 3SAFA 1NK4A 4J2DA 4EAHD 3NE6A 2GUPA 3AAQA 3CPWM 4DQQA 5DMRA 1E4GT 3OBWA 4FWKA 4FPAA 4CGJA 2GWJA 3THWB 4ZTFA 4ILHA 3KZBA 4WQ4C 4QS9A 4FWQA 3OYCA 5BRFA 2E4LA 3LDSA 2GTDA 2JGUA 4ZTJA 4FW1A 3RVCA 3OY9A 4H0OA 2OZMA 2FF3B 4YFUA 4CW7B 3O9SA 4M3ZA 5FPEA 3AO3A 1EWRA 2YNHA 1SKSA 4CZHA 2DPNA 4CIGA 3O5BA 3NGIA 3RMBA 4DSFA 1NK7A 1L3TA 4ELUA 2OA8A 1YI2N 3SUOA 3ENOA 4HCCA 1N8RO 4C23A 3LWMA 3TSQA 5LL6Z 2VWBA 3ULDA 2WBNA 2ZE2A 2BGGA 4E0DA 1EX4A 1L3UA 4IDHA 1XNRK 1HPMA 3FZFA 4ID1A 4KPYA 1BU6O 2O4GA 3EYZA 3NH2A 1RTIA 3FZMA 4FK0A 5JICA 4W5RA 1XHXA 4H5NA 3CERA 2QA4N 3M8RA 2O8DB 4DR4K 3OJUA 4KHNA 1BA1A 3ZSQA 4BC3A 3GOIA 1JCFA 2P1JA 4KI4A 3AO1A 1U2VB 1CZBA 4NCAA 1TUUA 4A61A 3G10A 2HHXA 1SKRA 1HYZA 3RSEA 2CGJA 2F96A 5A2QO 3QBWA 2O8FB 2QWRA 3SQ0A 4O0IA 3AY9A 4DS4A 1KAXA 1NJXA 2NRTA 2HBLA 5AQPA 3C7NB 1RDCA 4WQ4A 2O8CB 1EO1A 2YI1A 3ZT2A 1YXQA 3D6RA 1O13A 2RPIA 1X9WA 1S3XA 4DV2K 5KPTA 2G8UA 1WAFA 3HTVA 3RMAA 1BDGA 1VAZA 3GE1A 3UKRB 2CGKA 1QQNA 4H0TB 4KFBA 5I3UA 5AQVA 1NGDA 3PO4A 3OYGA 4ICLA 4Y1DA 2EHGA 3FE1A 2RKIA 4M7YA 3K59A 1W9HA 1Z05A 2VGMA 4RW7A 2OPRA 3WXIA 3QESA 2XY8A 2QXLA 3VEXA 1ASVA 2G8FA 3D7EO 3MMVA 1QSSA 2OTJN 4B1YB 1NGFA 4DWIA 4FO0A 1J53A 1IJJA 1YTAA 2IVNA 1RNHA 4CFAA 4NLBA 1CXQA 3MX2A 3WUHA 1DKGD 4B1VA 3VTHA 4N41A 2HHSA 1TL3A 4NCBA 4FZZA 3TR8A 3LWLA 4KKOA 4B9QA 4OPHA 3CFOA 4JI8K 2E2PA 3LPUA 5AQFA 1TKTA 5BPNA 4IO9L 1BA0A 3KK7A 1Q9XA 5M1PA 3ZX2A 1LV5A 1ZBUA 2W40A 4IEIA 2ZJRL 1TYQA 3L8BA 4LF9K 2UXBK 4IG0A 4KB1A 4DSKA 3K58A 4FWRA 3HM9A 2E20A 3OYJA 1WOQA 2DFFA 3VERA 3AA4A 4OGCA 3ZCMA 3WEEB 3JSMA 3A8YA 1ATRA 3LPTA 4H4MA 4BREA 4KRFA 1FW6A 3F2KA 1U6ZA 3PLAA 3Q7CA 4BR4A 4FCYA 3G6EN 4H0VB 4GKJK 3LDPA 4FWLA 3TU5A 3DAWA 1VQLN 5AQSA
chains in the Genus database with same CATH topology
4LSLA 4KV8A 2OYQA 1QSLA 1LW2A 2WONA 4CEQA 3QIOA 4I9LA 3MXIA 3L3VA 4CHPA 4E7LA 4DSEA 4KHUA 4IDKA 1JXEA 4DMNA 3PV8A 5HP1A 3C6TA 4CIEA 3K5LA 1TKZA 5CY4A 3QNNA 3QEVA 1ASUA 1Q9YA 3QLHA 4AHVA 1C6VA 1BI4B 4B8AB 1VSKA 3HP6A 2D0AA 5CYQA 4FJ5A 1RDDA 4Q5VA 5SWMA 3MEGA 1FKOA 3VQEA 4Z4CA 3OS1A 4DFMA 1KFSA 4FJIA 1GOBA 3PUFA 3TWHA 3CFRA 4LY7A 4R5PA 1QE1A 3NF6A 4IG3A 1ITGA 1C1CA 4HTUA 1BL3A 3SUPA 4FYDA 4W5QA 1W0HA 1RBRA 3WNHA 4B9LA 4E3SA 3TAMA 3HL8A 3K5MA 4RW9A 3SZ2A 1IO2A 4K8ZA 4EZ9A 3NBPA 4TSXA 4CJ4A 3PO5A 4CE9A 3AO5A 4Z0UA 4FLVA 3NDKA 3SV3A 1TV6A 2HHQA 2HHWA 1SL0A 1UAXA 1BI4A 1D8YA 3NHGA 4CECA 3KK1A 4OKEA 2KW4A 1WSHA 2E6LA 1WSEA 4FK2A 1FK9A 2G8VA 5E41A 4CEBA 1TK8A 4FK4A 4E1NA 1NK6A 2KFNA 3SPZA 1TKXA 1WLJA 3ITHA 1TK5A 4O55A 4DTSA 1K6YA 4CJEA 2ETJA 3QNOA 1WSFA 1JLFA 3AVAA 3T1AA 4AHRA 5D3GA 3NGZA 3NAEA 5J2QA 4CCHA 1LWEA 3DM2A 1EKEA 4CJVA 1WAJA 4FLYA 3S3OA 4CFCA 3T3FA 4CEFA 4Z4EA 3OYFA 2VG7A 2PY5A 1KSPA 1TAQA 1IKWA 3AA5X 1DTQA 1VSDA 4CHYA 1QS4A 4AHSA 4CEEA 4Z4IA 3ZT3A 2FC0A 3ZSRA 2VG6A 1RILA 3EY1A 3CYMA 2YNIA 4KHSA 1S1XA 1U48A 1L5UA 3L3UA 3AO2A 4L8RB 3AO4A 1JL2A 4FLTA 1HYVA 1D9DA 4CGFA 3M8SA 3QEWA 3CQ8A 4CERA 1T7PA 4CIFA 2VG5A 4EP4A 4FJMA 1HJRA 4HVJA 3V1QA 1Z26A 3BGRA 2B5JA 1NJZA 4HCBA 1KTQA 4CF9A 4EP5A 2A1SA 3NFAA 4NYFA 4RW8A 3ZT0A 4DFJA 1RT7A 2X74A 4J2EA 1NK5A 4N56A 1HNIA 4M45A 3ZT4A 3TAFA 4CK2A 4B3OA 2Q3SA 1I39A 3ZSOA 1LAWA 4FJ7A 1T03A 1RBSA 4E1MA 2BDPA 3AVHA 3DRSA 3P1GA 1D9FA 4KO0A 4K8XA 4OGEA 4E89A 3U3GA 2A1RA 1UA0A 2DY4A 3VQ8A 2GBZA 4OLBA 4F2RA 3ASMA 1RBVA 5HROA 5KGWA 4I9QA 4FXDA 1O1WA 4ELVA 5JS2A 5J1EA 1BCMA 4M41A 1ZBLA 3D45A 1XHZA 3S3NA 3L2RA 3A2FA 3OYEA 2KTQA 1KLMA 2BANA 4M3RA 4N76A 1BQMA 1KVBA 3MEDA 3LP1A 1DTTA 4FLUA 1EP4A 1A5XA 4F2SA 1S5JA 1RDBA 1Y97A 3IAYA 4CF8A 2I5JA 4I7FA 3TARA 1NK9A 3WNFA 3SQ1A 3V81A 4CJKA 4AHTA 1NK0A 4FJLA 4DSJA 1IG9A 1JL1A 1F21A 2HHTA 3OYDA 1EXQA 1WSIA 2B4JA 3TAEA 1QTMA 3K2PA 1VSEA 4NCGA 4MQ3A 3V9WA 3K57A 1JKHA 2G8WA 4C8KA 3TAQA 2IC3A 2HVIA 3JYTA 5HLFA 3PX4A 3O4QA 1VSMA 4CHNA 2KFZA 4J2BA 1ASWA 4DTPA 5HBMA 1MU2A 3AA2A 3AV9A 3NH0A 4KREA 1JXBA 3LANA 1BIZA 4CGHA 3VQ5A 3V9XA 1L3VA 4OKKA 5J2NA 3TANA 3TAPA 4IBNA 3IRXA 2PYJA 4PQUA 3MECA 4FM1A 3WNEA 1J5OA 4M3TA 3LP0A 2KZMA 1X9SA 2ATQA 3OYMA 2BE2A 3IG1A 1QQCA 2HHVA 1D5AA 4F3OA 1HRHA 3O3FA 2IS3A 3C6UA 2R7YA 4B9VA 1T8EA 3O3GA 3SYZA 3DMJA 3VQ4A 4CJFA 4FJJA 4WE1A 3SPYA 5FDLA 3T19A 4MFBA 1DLOA 3FFIA 3OYLA 1IKVA 1FXXA 4BDZA 3AVNA 1TL1A 4B08A 4CF1A 4DTUA 4JRQA 4M42A 4LD0A 3NF7A 5FRMA 2O4IA 3S9HA 1X9MA 3V1OA 4CJSA 3U6FA 1BGXT 1SV5A 1YTUA 2HB5A 5SZTA 1C1AA 4DF8A 3QO9A 3NF9A 1C0UA 1RT2A 2RF2A 3HVTA 4RW4A 3QINA 3OYIA 4OPJA 3L2WA 3U3YA 2RN2A 1JLBA 3ZT1A 4CJ5A 3LP2A 4BE0A 1HPZA 3IS9A 1TK0A 1RTHA 2OZSA 4DSLA 4PUOA 1NKEA 4JLHA 4RG8A 2E6MA 2D0CA 3VQAA 3D0PA 1WN7A 4HUGA 4DTMA 1S1WA 3MXMA 2XY7A 4RW6A 1KVAA 4C8OA 4ELTA 4JS4A 1RBTA 1SUQA 4FW2A 3V6DA 4DQRA 4FJ9A 3F9KA 3KIOA 3SUQA 1VRUA 3AVGA 4CFBA 5KRTA 2NUBA 1QHTA 2HNYA 3AVLA 3ZSWA 3OS2A 4BE2A 1KRPA 1X1PA 1ZBHA 1NKBA 1WNSA 2OPPA 1JLAA 3HYFA 5J2MA 3UIQA 4DTNA 4G1QA 4F8RA 4FJKA 2G8IA 1CZ9A 1S6PA 2Z1GA 3PX6A 4Z4GA 1BHLA 1HQUA 2XRIA 3CM6A 3K5OA 5HRNA 3RRHA 3SNNA 3QIPA 3EZ5A 1GOCA 1L3SA 4FJGA 2YV0X 4DF4A 1RBUA 4JS5A 1HNVA 4BACA 3AVCA 1TKDA 4E7JA 4H8KA 4CJRA 1BCOA 3E01A 3HT3A 4CEDA 1B9DA 2WOMA 4FJXA 1A5VA 4O44A 2FBXA 3TI0A 2QKKA 2FBVA 4BWMA 4C8LA 4FZYA 1J54A 4HUFA 4CJQA 1KFDA 4DFKA 1C1BA 4XIUA 1ZYQA 1VRTA 5EU7A 3KLFA 1KVCA 4FM2A 3WNGA 2G8KA 3DLHA 3RR7A 3S3MA 3OYAA 4OPKA 4Z4HA 4DQPA 3HSTB 3RMCA 4J2AA 4M3WA 4HUEA 2IGIA 4DLEA 1U47A 3M8QA 4CEOA 4CJLA 4LH4A 3K5NA 4F4KA 3C94A 1N6QA 4Q0BA 2YNGA 4AH9A 4CK1A 3O3HA 2P5OA 3QETA 1RT4A 1TVRA 1CLQA 4OJRA 1IH7A 3TAGA 3DYAA 4DTOA 2OPSA 3F73A 3KLIA 1NK4A 4J2DA 3NE6A 1HMVA 3HJFA 4DQQA 1BISA 5DMRA 1TAUA 4CGDA 3B6OA 3V4IA 4I2PA 1SL1A 3DLRA 3HPHA 4KB0A 2YKNA 4CGJA 4CF2A 4B8CA 4ZTFA 5CYMA 3NF8A 1YVUA 4ZHRA 3DLKA 3OYCA 4O0JA 4W5NA 1QSYA 1LAVA 3AVIA 2E4LA 3LDSA 4F3TA 1G15A 2JGUA 2HVHA 1R0AA 2KZZA 4ZTJA 4FW1A 3B6PA 4O4GA 3OY9A 3ZSVA 5C42A 3RTVA 3KTQA 2OZMA 4YFUA 4M3ZA 1JLCA 1IKYA 3OYKA 3AO3A 4YNQA 2YNHA 3MEEA 1SKSA 3VQPA 1TGOA 4CIGA 4B9NA 3I8DA 3NGIA 1YT3A 3VQBA 1T05A 4FJNA 2YNFA 2P5GA 3RMBA 1S9EA 4CGIA 3HO1A 1VK0A 4DSFA 2GUIA 1NK7A 1L3TA 2OA8A 3LAKA 4ELUA 4M3UA 3SUOA 1NK8A 1ZBIA 4CJUA 5T7BA 4HCCA 2QXFA 2XHBA 3LWMA 1ZBFA 3V1RA 1IKXA 3ULDA 2HHUA 4DG1A 4KAZA 2ZE2A 2BGGA 4E0DA 1RT6A 3SQ4A 2AJQA 1UWBA 1EX4A 1JLGA 3AVBA 2OPQA 1L3UA 4DFPA 4ID1A 4KPYA 3EYZA 2O4GA 3C95A 1C0MA 5C24A 4IFVA 3NH2A 3KK3A 1RTIA 2YHAA 3AA3A 1U49A 4CJPA 4FK0A 4W5RA 4Z4FA 1XHXA 2F8TA 4GVMA 3SUNA 2X78A 3HK2A 4HHTA 3M8RA 4BWJA 1U45A 1B92A 2IAJA 3KKRA 2ITGA 3DLEA 2X6SA 3OJUA 4KHNA 3KLGA 2HNDA 3ZSQA 2YKMA 1S6QA 2P1JA 3DLGA 4KI4A 3VA3A 2IOCA 4CHZA 3AO1A 4DTJA 1CZBA 4NCAA 1CXUA 2VWKA 1FKPA 1LW0A 3SI6A 1U4BA 4C8NA 4AHUA 3I0SA 3M8PA 4LSNA 3OS0A 1RCHA 1REVA 3G10A 3HXMA 4GW6A 2XY6A 2HHXA 1SKRA 1VSHA 1SKWA 1HYZA 2X6NA 4DSIA 2GV9A 2F96A 3AVMA 5DK5A 5FROA 3MAQA 1NKCA 3QEXA 3VQDA 4DU4A 2ZD1A 3DI6A 3P83D 3HPOA 2Z1IA 3VQQA 4E7KA 1NOZA 3SQ0A 2JLEA 4O0IA 2DTUA 4W5OA 2PZSA 4N47A 4FZXC 4DS4A 5I42A 1JLQA 3MXJA 1NJXA 1Z25A 3AVJA 4B9SA 2QKBA 5KRSA 3HPGA 4W5TA 2DFHA 3DRRA 4H4OA 2XO7A 2Z1HA 1RDCA 4OLAA 1UOCA 4UQGA 4M3XA 2DFEA 3KD5E 4E19A 4BE1A 3LALA 3ZT2A 3H08A 2W42A 4FLXA 4B9MA 2HW3A 1RT5A 2RPIA 4BDYA 3KKSA 2LSNA 1S1TA 1UA1A 1X9WA 1BIUA 4FJHA 2G8UA 1WAFA 4KHQA 2FBTA 4CJWA 3RMAA 3DOLA 1JLEA 3VQ9A 3THVA 4NYNA 4KFBA 5HRRA 2Z1JA 4DTXA 5I3UA 2D5RA 1VSLA 3NGYA 3PO4A 1LWFA 1S1UA 3OVNA 3ZSZA 3ZSYA 3OYGA 4ICLA 1VSFA 4Y1DA 4C8MA 2EHGA 3QERA 3PX0A 2IDOA 2HMIA 2Y1JA 2RKIA 3L2VA 4AILC 1GOAA 2HNZA 1XC9A 1HQEA 3SCXA 3O4NA 4CFDA 3K59A 1NJYA 4KHWA 4LH5A 3CM5A 5HRPA 5JS1A 1W9HA 3KLEA 3RR8A 4CEAA 4CJ3A 3LAMA 4RW7A 3TABA 4KTQA 2OPRA 4EZ6A 2EX3A 4B9TA 4FM0A 3QESA 4OVLA 5J2PA 2XY8A 1RTJA 2KQ2A 3LP3A 4O5BA 3VN5A 1ASVA 3KJVA 3ALYA 3L2UA 1S1VA 1VSJA 4Y1CA 5C25A 3VA0A 2G8FA 4GMJB 3VQ6A 4FVMA 4QAGA 4E7IA 1A5WA 1QSSA 3RWUA 4PWDA 3KK2A 2PYLA 4KHYA 5CZ1A 4DWIA 3HP9A 1WSJA 4ID5A 4CESA 4CGGA 3V9SA 1EETA 2ZQBA 4CJTA 1J53A 1KLNA 5KTQA 4DU1A 2G8HA 1YTAA 4I2QA 4PA1A 1RNHA 4FLWA 3BDPA 4IFYA 4CFAA 3V9UA 3DOKA 4CF0A 3SQ2A 1CXQA 1RT3A 5KI6A 2XY5A 1SL2A 4B9UA 5FRNA 3CFPA 1U04A 5K14A 1BQNA 1XI1A 4DQSA 3RMDA 4N41A 2HHSA 1Q8IA 1TL3A 1N5YA 4KTWA 4CHQA 3OYHA 3OJSA 3TR8A 3LWLA 4KKOA 4NCBA 4FZZA 4DS5A 1VSIA 4DLGA 5KGXA 4DU3A 3CFOA 4DQIA 1RTDA 3LPUA 1TKTA 3OYNA 4N5SA 2VWJA 1Q9XA 1J9AA 3RRGA 1LV5A 1ZBUA 4CK3A 1I3AA 1NJWA 1HYSA 1LWCA 4KTZA 3KLHA 5CZ2A 3DRPA 3HVRA 3L8BA 3QEPA 4IG0A 3KD1E 2FBYA 3NCIA 4DSKA 4KB1A 3K58A 3G0ZA 2F8SA 3LZIA 3HM9A 4FLZA 3DLBA 4QOZB 3OYJA 3AVKA 2DFFA 2QK9A 3ZCMA 2D0BA 1WSGA 3AA4A 4OGCA 3JSMA 3QEIA 2Y1IA 2B6AA 1NOYA 1RT1A 4KI6A 3LPTA 2P51A 4OKJA 4H4MA 1C0TA 3VQCA 3I0RA 4JRPA 4PY5A 4M3YA 4KRFA 3OYBA 3CG7A 3P5JA 1XWLA 1S9GA 1RDAA 4CEZA 4FJ8A 3NH1A 4BDPA 4IKFA 3AVFA 4FCYA 3ISNC 3VQ7A 5HRSA 1B9FA 4E7HA 4AHCA 1KCFA 3LZJA 4QCLA 3ZSXA 3SV4A 2YHBA 4CHOA 4DTRA 3SJJA 3PY8A 3V9ZA 3L2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSL A;  4KV8 A;  2OYQ A;  1QSL A;  1LW2 A;  2WON A;  4CEQ A;  3QIO A;  4I9L A;  3MXI A;  3L3V A;  4CHP A;  4E7L A;  4DSE A;  4KHU A;  4IDK A;  1JXE A;  4DMN A;  3PV8 A;  5HP1 A;  3C6T A;  4CIE A;  3K5L A;  1TKZ A;  5CY4 A;  3QNN A;  3QEV A;  1ASU A;  1Q9Y A;  3QLH A;  4AHV A;  1C6V A;  1BI4 B;  4B8A B;  1VSK A;  3HP6 A;  2D0A A;  5CYQ A;  4FJ5 A;  1RDD A;  4Q5V A;  5SWM A;  3MEG A;  1FKO A;  3VQE A;  4Z4C A;  3OS1 A;  4DFM A;  1KFS A;  4FJI A;  1GOB A;  3PUF A;  3TWH A;  3CFR A;  4LY7 A;  4R5P A;  1QE1 A;  3NF6 A;  4IG3 A;  1ITG A;  1C1C A;  4HTU A;  1BL3 A;  3SUP A;  4FYD A;  4W5Q A;  1W0H A;  1RBR A;  3WNH A;  4B9L A;  4E3S A;  3TAM A;  3HL8 A;  3K5M A;  4RW9 A;  3SZ2 A;  1IO2 A;  4K8Z A;  4EZ9 A;  3NBP A;  4TSX A;  4CJ4 A;  3PO5 A;  4CE9 A;  3AO5 A;  4Z0U A;  4FLV A;  3NDK A;  3SV3 A;  1TV6 A;  2HHQ A;  2HHW A;  1SL0 A;  1UAX A;  1BI4 A;  1D8Y A;  3NHG A;  4CEC A;  3KK1 A;  4OKE A;  2KW4 A;  1WSH A;  2E6L A;  1WSE A;  4FK2 A;  1FK9 A;  2G8V A;  5E41 A;  4CEB A;  1TK8 A;  4FK4 A;  4E1N A;  1NK6 A;  2KFN A;  3SPZ A;  1TKX A;  1WLJ A;  3ITH A;  1TK5 A;  4O55 A;  4DTS A;  1K6Y A;  4CJE A;  2ETJ A;  3QNO A;  1WSF A;  1JLF A;  3AVA A;  3T1A A;  4AHR A;  5D3G A;  3NGZ A;  3NAE A;  5J2Q A;  4CCH A;  1LWE A;  3DM2 A;  1EKE A;  4CJV A;  1WAJ A;  4FLY A;  3S3O A;  4CFC A;  3T3F A;  4CEF A;  4Z4E A;  3OYF A;  2VG7 A;  2PY5 A;  1KSP A;  1TAQ A;  1IKW A;  3AA5 X;  1DTQ A;  1VSD A;  4CHY A;  1QS4 A;  4AHS A;  4CEE A;  4Z4I A;  3ZT3 A;  2FC0 A;  3ZSR A;  2VG6 A;  1RIL A;  3EY1 A;  3CYM A;  2YNI A;  4KHS A;  1S1X A;  1U48 A;  1L5U A;  3L3U A;  3AO2 A;  4L8R B;  3AO4 A;  1JL2 A;  4FLT A;  1HYV A;  1D9D A;  4CGF A;  3M8S A;  3QEW A;  3CQ8 A;  4CER A;  1T7P A;  4CIF A;  2VG5 A;  4EP4 A;  4FJM A;  1HJR A;  4HVJ A;  3V1Q A;  1Z26 A;  3BGR A;  2B5J A;  1NJZ A;  4HCB A;  1KTQ A;  4CF9 A;  4EP5 A;  2A1S A;  3NFA A;  4NYF A;  4RW8 A;  3ZT0 A;  4DFJ A;  1RT7 A;  2X74 A;  4J2E A;  1NK5 A;  4N56 A;  1HNI A;  4M45 A;  3ZT4 A;  3TAF A;  4CK2 A;  4B3O A;  2Q3S A;  1I39 A;  3ZSO A;  1LAW A;  4FJ7 A;  1T03 A;  1RBS A;  4E1M A;  2BDP A;  3AVH A;  3DRS A;  3P1G A;  1D9F A;  4KO0 A;  4K8X A;  4OGE A;  4E89 A;  3U3G A;  2A1R A;  1UA0 A;  2DY4 A;  3VQ8 A;  2GBZ A;  4OLB A;  4F2R A;  3ASM A;  1RBV A;  5HRO A;  5KGW A;  4I9Q A;  4FXD A;  1O1W A;  4ELV A;  5JS2 A;  5J1E A;  1BCM A;  4M41 A;  1ZBL A;  3D45 A;  1XHZ A;  3S3N A;  3L2R A;  3A2F A;  3OYE A;  2KTQ A;  1KLM A;  2BAN A;  4M3R A;  4N76 A;  1BQM A;  1KVB A;  3MED A;  3LP1 A;  1DTT A;  4FLU A;  1EP4 A;  1A5X A;  4F2S A;  1S5J A;  1RDB A;  1Y97 A;  3IAY A;  4CF8 A;  2I5J A;  4I7F A;  3TAR A;  1NK9 A;  3WNF A;  3SQ1 A;  3V81 A;  4CJK A;  4AHT A;  1NK0 A;  4FJL A;  4DSJ A;  1IG9 A;  1JL1 A;  1F21 A;  2HHT A;  3OYD A;  1EXQ A;  1WSI A;  2B4J A;  3TAE A;  1QTM A;  3K2P A;  1VSE A;  4NCG A;  4MQ3 A;  3V9W A;  3K57 A;  1JKH A;  2G8W A;  4C8K A;  3TAQ A;  2IC3 A;  2HVI A;  3JYT A;  5HLF A;  3PX4 A;  3O4Q A;  1VSM A;  4CHN A;  2KFZ A;  4J2B A;  1ASW A;  4DTP A;  5HBM A;  1MU2 A;  3AA2 A;  3AV9 A;  3NH0 A;  4KRE A;  1JXB A;  3LAN A;  1BIZ A;  4CGH A;  3VQ5 A;  3V9X A;  1L3V A;  4OKK A;  5J2N A;  3TAN A;  3TAP A;  4IBN A;  3IRX A;  2PYJ A;  4PQU A;  3MEC A;  4FM1 A;  3WNE A;  1J5O A;  4M3T A;  3LP0 A;  2KZM A;  1X9S A;  2ATQ A;  3OYM A;  2BE2 A;  3IG1 A;  1QQC A;  2HHV A;  1D5A A;  4F3O A;  1HRH A;  3O3F A;  2IS3 A;  3C6U A;  2R7Y A;  4B9V A;  1T8E A;  3O3G A;  3SYZ A;  3DMJ A;  3VQ4 A;  4CJF A;  4FJJ A;  4WE1 A;  3SPY A;  5FDL A;  3T19 A;  4MFB A;  1DLO A;  3FFI A;  3OYL A;  1IKV A;  1FXX A;  4BDZ A;  3AVN A;  1TL1 A;  4B08 A;  4CF1 A;  4DTU A;  4JRQ A;  4M42 A;  4LD0 A;  3NF7 A;  5FRM A;  2O4I A;  3S9H A;  1X9M A;  3V1O A;  4CJS A;  3U6F A;  1BGX T;  1SV5 A;  1YTU A;  2HB5 A;  5SZT A;  1C1A A;  4DF8 A;  3QO9 A;  3NF9 A;  1C0U A;  1RT2 A;  2RF2 A;  3HVT A;  4RW4 A;  3QIN A;  3OYI A;  4OPJ A;  3L2W A;  3U3Y A;  2RN2 A;  1JLB A;  3ZT1 A;  4CJ5 A;  3LP2 A;  4BE0 A;  1HPZ A;  3IS9 A;  1TK0 A;  1RTH A;  2OZS A;  4DSL A;  4PUO A;  1NKE A;  4JLH A;  4RG8 A;  2E6M A;  2D0C A;  3VQA A;  3D0P A;  1WN7 A;  4HUG A;  4DTM A;  1S1W A;  3MXM A;  2XY7 A;  4RW6 A;  1KVA A;  4C8O A;  4ELT A;  4JS4 A;  1RBT A;  1SUQ A;  4FW2 A;  3V6D A;  4DQR A;  4FJ9 A;  3F9K A;  3KIO A;  3SUQ A;  1VRU A;  3AVG A;  4CFB A;  5KRT A;  2NUB A;  1QHT A;  2HNY A;  3AVL A;  3ZSW A;  3OS2 A;  4BE2 A;  1KRP A;  1X1P A;  1ZBH A;  1NKB A;  1WNS A;  2OPP A;  1JLA A;  3HYF A;  5J2M A;  3UIQ A;  4DTN A;  4G1Q A;  4F8R A;  4FJK A;  2G8I A;  1CZ9 A;  1S6P A;  2Z1G A;  3PX6 A;  4Z4G A;  1BHL A;  1HQU A;  2XRI A;  3CM6 A;  3K5O A;  5HRN A;  3RRH A;  3SNN A;  3QIP A;  3EZ5 A;  1GOC A;  1L3S A;  4FJG A;  2YV0 X;  4DF4 A;  1RBU A;  4JS5 A;  1HNV A;  4BAC A;  3AVC A;  1TKD A;  4E7J A;  4H8K A;  4CJR A;  1BCO A;  3E01 A;  3HT3 A;  4CED A;  1B9D A;  2WOM A;  4FJX A;  1A5V A;  4O44 A;  2FBX A;  3TI0 A;  2QKK A;  2FBV A;  4BWM A;  4C8L A;  4FZY A;  1J54 A;  4HUF A;  4CJQ A;  1KFD A;  4DFK A;  1C1B A;  4XIU A;  1ZYQ A;  1VRT A;  5EU7 A;  3KLF A;  1KVC A;  4FM2 A;  3WNG A;  2G8K A;  3DLH A;  3RR7 A;  3S3M A;  3OYA A;  4OPK A;  4Z4H A;  4DQP A;  3HST B;  3RMC A;  4J2A A;  4M3W A;  4HUE A;  2IGI A;  4DLE A;  1U47 A;  3M8Q A;  4CEO A;  4CJL A;  4LH4 A;  3K5N A;  4F4K A;  3C94 A;  1N6Q A;  4Q0B A;  2YNG A;  4AH9 A;  4CK1 A;  3O3H A;  2P5O A;  3QET A;  1RT4 A;  1TVR A;  1CLQ A;  4OJR A;  1IH7 A;  3TAG A;  3DYA A;  4DTO A;  2OPS A;  3F73 A;  3KLI A;  1NK4 A;  4J2D A;  3NE6 A;  1HMV A;  3HJF A;  4DQQ A;  1BIS A;  5DMR A;  1TAU A;  4CGD A;  3B6O A;  3V4I A;  4I2P A;  1SL1 A;  3DLR A;  3HPH A;  4KB0 A;  2YKN A;  4CGJ A;  4CF2 A;  4B8C A;  4ZTF A;  5CYM A;  3NF8 A;  1YVU A;  4ZHR A;  3DLK A;  3OYC A;  4O0J A;  4W5N A;  1QSY A;  1LAV A;  3AVI A;  2E4L A;  3LDS A;  4F3T A;  1G15 A;  2JGU A;  2HVH A;  1R0A A;  2KZZ A;  4ZTJ A;  4FW1 A;  3B6P A;  4O4G A;  3OY9 A;  3ZSV A;  5C42 A;  3RTV A;  3KTQ A;  2OZM A;  4YFU A;  4M3Z A;  1JLC A;  1IKY A;  3OYK A;  3AO3 A;  4YNQ A;  2YNH A;  3MEE A;  1SKS A;  3VQP A;  1TGO A;  4CIG A;  4B9N A;  3I8D A;  3NGI A;  1YT3 A;  3VQB A;  1T05 A;  4FJN A;  2YNF A;  2P5G A;  3RMB A;  1S9E A;  4CGI A;  3HO1 A;  1VK0 A;  4DSF A;  2GUI A;  1NK7 A;  1L3T A;  2OA8 A;  3LAK A;  4ELU A;  4M3U A;  3SUO A;  1NK8 A;  1ZBI A;  4CJU A;  5T7B A;  4HCC A;  2QXF A;  2XHB A;  3LWM A;  1ZBF A;  3V1R A;  1IKX A;  3ULD A;  2HHU A;  4DG1 A;  4KAZ A;  2ZE2 A;  2BGG A;  4E0D A;  1RT6 A;  3SQ4 A;  2AJQ A;  1UWB A;  1EX4 A;  1JLG A;  3AVB A;  2OPQ A;  1L3U A;  4DFP A;  4ID1 A;  4KPY A;  3EYZ A;  2O4G A;  3C95 A;  1C0M A;  5C24 A;  4IFV A;  3NH2 A;  3KK3 A;  1RTI A;  2YHA A;  3AA3 A;  1U49 A;  4CJP A;  4FK0 A;  4W5R A;  4Z4F A;  1XHX A;  2F8T A;  4GVM A;  3SUN A;  2X78 A;  3HK2 A;  4HHT A;  3M8R A;  4BWJ A;  1U45 A;  1B92 A;  2IAJ A;  3KKR A;  2ITG A;  3DLE A;  2X6S A;  3OJU A;  4KHN A;  3KLG A;  2HND A;  3ZSQ A;  2YKM A;  1S6Q A;  2P1J A;  3DLG A;  4KI4 A;  3VA3 A;  2IOC A;  4CHZ A;  3AO1 A;  4DTJ A;  1CZB A;  4NCA A;  1CXU A;  2VWK A;  1FKP A;  1LW0 A;  3SI6 A;  1U4B A;  4C8N A;  4AHU A;  3I0S A;  3M8P A;  4LSN A;  3OS0 A;  1RCH A;  1REV A;  3G10 A;  3HXM A;  4GW6 A;  2XY6 A;  2HHX A;  1SKR A;  1VSH A;  1SKW A;  1HYZ A;  2X6N A;  4DSI A;  2GV9 A;  2F96 A;  3AVM A;  5DK5 A;  5FRO A;  3MAQ A;  1NKC A;  3QEX A;  3VQD A;  4DU4 A;  2ZD1 A;  3DI6 A;  3P83 D;  3HPO A;  2Z1I A;  3VQQ A;  4E7K A;  1NOZ A;  3SQ0 A;  2JLE A;  4O0I A;  2DTU A;  4W5O A;  2PZS A;  4N47 A;  4FZX C;  4DS4 A;  5I42 A;  1JLQ A;  3MXJ A;  1NJX A;  1Z25 A;  3AVJ A;  4B9S A;  2QKB A;  5KRS A;  3HPG A;  4W5T A;  2DFH A;  3DRR A;  4H4O A;  2XO7 A;  2Z1H A;  1RDC A;  4OLA A;  1UOC A;  4UQG A;  4M3X A;  2DFE A;  3KD5 E;  4E19 A;  4BE1 A;  3LAL A;  3ZT2 A;  3H08 A;  2W42 A;  4FLX A;  4B9M A;  2HW3 A;  1RT5 A;  2RPI A;  4BDY A;  3KKS A;  2LSN A;  1S1T A;  1UA1 A;  1X9W A;  1BIU A;  4FJH A;  2G8U A;  1WAF A;  4KHQ A;  2FBT A;  4CJW A;  3RMA A;  3DOL A;  1JLE A;  3VQ9 A;  3THV A;  4NYN A;  4KFB A;  5HRR A;  2Z1J A;  4DTX A;  5I3U A;  2D5R A;  1VSL A;  3NGY A;  3PO4 A;  1LWF A;  1S1U A;  3OVN A;  3ZSZ A;  3ZSY A;  3OYG A;  4ICL A;  1VSF A;  4Y1D A;  4C8M A;  2EHG A;  3QER A;  3PX0 A;  2IDO A;  2HMI A;  2Y1J A;  2RKI A;  3L2V A;  4AIL C;  1GOA A;  2HNZ A;  1XC9 A;  1HQE A;  3SCX A;  3O4N A;  4CFD A;  3K59 A;  1NJY A;  4KHW A;  4LH5 A;  3CM5 A;  5HRP A;  5JS1 A;  1W9H A;  3KLE A;  3RR8 A;  4CEA A;  4CJ3 A;  3LAM A;  4RW7 A;  3TAB A;  4KTQ A;  2OPR A;  4EZ6 A;  2EX3 A;  4B9T A;  4FM0 A;  3QES A;  4OVL A;  5J2P A;  2XY8 A;  1RTJ A;  2KQ2 A;  3LP3 A;  4O5B A;  3VN5 A;  1ASV A;  3KJV A;  3ALY A;  3L2U A;  1S1V A;  1VSJ A;  4Y1C A;  5C25 A;  3VA0 A;  2G8F A;  4GMJ B;  3VQ6 A;  4FVM A;  4QAG A;  4E7I A;  1A5W A;  1QSS A;  3RWU A;  4PWD A;  3KK2 A;  2PYL A;  4KHY A;  5CZ1 A;  4DWI A;  3HP9 A;  1WSJ A;  4ID5 A;  4CES A;  4CGG A;  3V9S A;  1EET A;  2ZQB A;  4CJT A;  1J53 A;  1KLN A;  5KTQ A;  4DU1 A;  2G8H A;  1YTA A;  4I2Q A;  4PA1 A;  1RNH A;  4FLW A;  3BDP A;  4IFY A;  4CFA A;  3V9U A;  3DOK A;  4CF0 A;  3SQ2 A;  1CXQ A;  1RT3 A;  5KI6 A;  2XY5 A;  1SL2 A;  4B9U A;  5FRN A;  3CFP A;  1U04 A;  5K14 A;  1BQN A;  1XI1 A;  4DQS A;  3RMD A;  4N41 A;  2HHS A;  1Q8I A;  1TL3 A;  1N5Y A;  4KTW A;  4CHQ A;  3OYH A;  3OJS A;  3TR8 A;  3LWL A;  4KKO A;  4NCB A;  4FZZ A;  4DS5 A;  1VSI A;  4DLG A;  5KGX A;  4DU3 A;  3CFO A;  4DQI A;  1RTD A;  3LPU A;  1TKT A;  3OYN A;  4N5S A;  2VWJ A;  1Q9X A;  1J9A A;  3RRG A;  1LV5 A;  1ZBU A;  4CK3 A;  1I3A A;  1NJW A;  1HYS A;  1LWC A;  4KTZ A;  3KLH A;  5CZ2 A;  3DRP A;  3HVR A;  3L8B A;  3QEP A;  4IG0 A;  3KD1 E;  2FBY A;  3NCI A;  4DSK A;  4KB1 A;  3K58 A;  3G0Z A;  2F8S A;  3LZI A;  3HM9 A;  4FLZ A;  3DLB A;  4QOZ B;  3OYJ A;  3AVK A;  2DFF A;  2QK9 A;  3ZCM A;  2D0B A;  1WSG A;  3AA4 A;  4OGC A;  3JSM A;  3QEI A;  2Y1I A;  2B6A A;  1NOY A;  1RT1 A;  4KI6 A;  3LPT A;  2P51 A;  4OKJ A;  4H4M A;  1C0T A;  3VQC A;  3I0R A;  4JRP A;  4PY5 A;  4M3Y A;  4KRF A;  3OYB A;  3CG7 A;  3P5J A;  1XWL A;  1S9G A;  1RDA A;  4CEZ A;  4FJ8 A;  3NH1 A;  4BDP A;  4IKF A;  3AVF A;  4FCY A;  3ISN C;  3VQ7 A;  5HRS A;  1B9F A;  4E7H A;  4AHC A;  1KCF A;  3LZJ A;  4QCL A;  3ZSX A;  3SV4 A;  2YHB A;  4CHO A;  4DTR A;  3SJJ A;  3PY8 A;  3V9Z A;  3L2Q A; 
#chains in the Genus database with same CATH topology
 3SMP A;  3LDL A;  4WFN L;  5EXW A;  4I9L A;  3L3V A;  4IDK A;  5EY4 A;  4DMN A;  3PV8 A;  2AP1 A;  5HP1 A;  3GG4 A;  4CIE A;  3THY B;  2OCE A;  3QNN A;  3QEV A;  1Q9Y A;  1K8K A;  4OPA A;  1WB9 A;  1BI4 B;  3B8A X;  1VSK A;  1V4S A;  4YDU A;  3HP6 A;  3R8E A;  4Z4C A;  3ATU A;  3H46 O;  5LMU K;  4DFM A;  3TWH A;  4LY7 A;  2V51 B;  3QBX A;  1C1C A;  4HTU A;  2HBM A;  3D2E B;  2E88 A;  1IV0 A;  3IFR A;  4B9L A;  4BG8 A;  3TAM A;  3SZ2 A;  4K8Z A;  5JVG L;  4KHP K;  3PO5 A;  2Q0U A;  4FWM A;  3ZET B;  4DR7 K;  3QFU A;  2HHW A;  3R3L A;  1UAX A;  4B1Z A;  3L0Q A;  4CEC A;  3U9D A;  4FK2 A;  1KQS M;  1FK9 A;  2G8V A;  4FK4 A;  4E1N A;  1TK5 A;  4DTS A;  1K6Y A;  2Q0R A;  2ETJ A;  3CD6 N;  4MDA A;  3DM2 A;  4FLY A;  3S3O A;  1NJI O;  2PY5 A;  4YOV A;  1IKW A;  1KC8 O;  4IOC L;  4Z4I A;  1BWF O;  1RIL A;  3EY1 A;  1S1X A;  1D9D A;  1HYV A;  3QEW A;  3CQ8 A;  4CER A;  2ZM6 K;  4FJM A;  1QQM A;  4A59 A;  1Z26 A;  1MA9 B;  1RT7 A;  2Q3S A;  1I39 A;  4DCH A;  2WUS A;  4BG9 A;  4YOX A;  4FJ7 A;  4E1M A;  3AVH A;  3MN7 A;  4JI1 K;  4KO0 A;  2OAN A;  3CJC A;  2DY4 A;  4OLB A;  2GBZ A;  1QVF M;  5HRO A;  1RBV A;  3TPQ A;  5JS2 A;  5J1E A;  1VQM N;  3S3N A;  3L2R A;  3A2F A;  1KLM A;  4N76 A;  1BQM A;  2Q97 A;  3LP1 A;  2HOE A;  4A5B A;  5AFU H;  4BRO A;  4FL9 A;  1KD1 O;  3IAY A;  4CF8 A;  3WNF A;  3V81 A;  4AHT A;  1NMD A;  1IG9 A;  4K25 A;  2IIR A;  1S72 N;  4AM6 A;  1GLL O;  1WSI A;  2B4J A;  3TAE A;  2UU9 K;  3MCA B;  4DUY K;  4MQ3 A;  3V9W A;  1W2B M;  3K57 A;  1JKH A;  2IC3 A;  2QWL A;  1HKB A;  5HBM A;  4KRE A;  3QB0 A;  3O1B A;  3LAN A;  4CGH A;  2HF4 A;  3IKM A;  5J2N A;  2PYJ A;  4IBN A;  4FM1 A;  5GAE P;  3KWI A;  3DXM B;  4NB4 A;  4BRI A;  1K73 O;  2ATQ A;  2BE2 A;  3MWT A;  3DXK A;  1HRH A;  3RSE B;  3DMJ A;  4CJF A;  2UYT A;  4FJJ A;  2W6L A;  3SPY A;  3OYL A;  3EE9 A;  1FXX A;  2A40 A;  3CCU N;  2F4V K;  4DTU A;  5H1S Q;  4X62 K;  3NF7 A;  2O4I A;  4AM7 A;  5SZT A;  1K8A O;  3MK6 A;  3HVT A;  5E84 A;  1JLB A;  3IS9 A;  4JLH A;  3ULE B;  4HUG A;  2D0C A;  3VQA A;  4PL7 A;  3OTO K;  4DTM A;  2XY7 A;  1KVA A;  1ZXO A;  2WTU A;  3V6D A;  4DQR A;  4CZI A;  2FXU A;  3ZSW A;  1CZA N;  2P9I A;  1WNS A;  2OPP A;  4DTN A;  1CZ9 A;  4BVP A;  5FPN A;  2Z1G A;  4BRD A;  3PX6 A;  5AQR A;  1HQU A;  3K5O A;  3EZ5 A;  4CZK A;  1L3S A;  4FJG A;  4DV1 K;  3FR0 A;  2HBK A;  3CHW A;  4DF4 A;  4BAC A;  1TKD A;  3K9J A;  1B9D A;  2WOM A;  5C2D A;  1HX1 A;  4YOR A;  3VEV A;  5BRE A;  2H3G X;  2QM1 A;  1JCE A;  3UE5 A;  4BWM A;  4XEI A;  1J54 A;  4DFK A;  4JI5 K;  1VRT A;  3DLH A;  1KVC A;  2IVO A;  2G8K A;  3RR7 A;  1QZ6 A;  3BZC A;  3S3M A;  3HST B;  3OBY A;  4BRM A;  3CJ7 A;  4CJL A;  4BGB A;  3JXU A;  2P9S A;  3C94 A;  3E9P A;  2YNG A;  2P5O A;  3O3H A;  4BQL A;  4A5A A;  3F73 A;  3KLI A;  1HMV A;  3FZH A;  1BIS A;  4CGD A;  3B6O A;  2ASP A;  3V4I A;  1SL1 A;  1TYQ B;  3HPH A;  4MLH A;  4CF2 A;  5ADX H;  3NF8 A;  3LDQ A;  2A42 A;  3T1H K;  4ZHR A;  3DLK A;  3SBG A;  1DGK N;  1QSY A;  1W7A A;  5BRH A;  1G15 A;  2HVH A;  4O4G A;  2YJF A;  1VQ5 N;  1IKY A;  2YHX A;  4LF6 K;  4B9N A;  4BR7 A;  1OVQ A;  3A5N C;  5IWA K;  3JAM O;  3VQB A;  5FPD A;  1T05 A;  2P5G A;  4BRC A;  1S9E A;  4CGI A;  3HO1 A;  1VK0 A;  3WQT A;  3ATV A;  4M3U A;  1NGC A;  3PSF A;  1NK8 A;  4CJU A;  2ZGZ A;  4RWT A;  2RE2 A;  1X9J A;  2XHB A;  1Q7Y O;  1IKX A;  2ITM A;  3CCQ N;  4KAZ A;  1RT6 A;  3SQ4 A;  1UWB A;  1K8K B;  4DFP A;  2A41 A;  5AQH A;  3W3D A;  4DV0 K;  1NNE A;  4IFV A;  2YHA A;  5BR9 A;  4DR5 K;  4GVM A;  3THX A;  2HST A;  1RDU A;  4WCE L;  4YOT A;  3VEO A;  1S6Q A;  3L4Q A;  1M1K O;  3DLG A;  1D4X A;  2NNW A;  4DTJ A;  4DB3 A;  2VWK A;  3O08 A;  1FKP A;  3VPZ A;  4C8N A;  4AHU A;  4CZF A;  1RCH A;  3WXM B;  3HXM A;  2YHW A;  1VQO N;  1VSH A;  1SKW A;  4ILG B;  2X6N A;  5AFU A;  5DK5 A;  3QEX A;  3VQD A;  4JI4 K;  3HPO A;  3VQQ A;  1NOZ A;  3TTF A;  2DTU A;  2YX6 A;  2PZS A;  3PIO L;  1JLQ A;  5KPR A;  2QKB A;  4HWI A;  3DRR A;  4H4O A;  1Y64 A;  2Z1H A;  3UB5 A;  4BRL A;  4CBW A;  1I94 K;  4JKB A;  3H08 A;  1KAY A;  1SAZ A;  2HW3 A;  4GKK K;  4JAX A;  1S1T A;  4CJ7 A;  4FOE A;  4BR5 A;  3DOL A;  3O6W A;  5HRR A;  2D5R A;  4JKG B;  4CZM A;  1LWF A;  3OVN A;  1ESV A;  3QER A;  5JS1 A;  1VSF A;  4C8M A;  3PX0 A;  4IZ9 A;  3CJA A;  2F7T A;  3L2V A;  1GOA A;  2HNZ A;  5FPM A;  1XC9 A;  3SCX A;  5GIN A;  3HBT A;  3CM5 A;  4CJ3 A;  3LAM A;  5FLX O;  2EX3 A;  1C0G A;  3BP8 A;  3KJV A;  3L2U A;  4O5B A;  3VN5 A;  3M3Z A;  3O8M A;  1S1V A;  5C25 A;  3VQ6 A;  4JNE A;  4QAG A;  3RWU A;  4NO7 A;  1WSJ A;  4G9Z A;  2JWL A;  5TKW A;  1EET A;  4CJT A;  3QFP A;  5CHI A;  4DKW A;  4I2Q A;  2G8H A;  4V19 S;  4IFY A;  4IO8 A;  3V9U A;  4JKA A;  2XY5 A;  5AZJ A;  3CFP A;  1U04 A;  1XI1 A;  4IFE A;  3RMD A;  4KTW A;  3OYH A;  1VSI A;  4DLG A;  5KGX A;  4DQI A;  2O8B A;  4ILJ A;  3OYN A;  4EIA A;  4CK3 A;  1HYS A;  3VGM A;  3DRP A;  3HVR A;  1GLE G;  2FBY A;  4K41 A;  3VOV A;  1WBD A;  2QK9 A;  5DM6 L;  2UUA K;  1RT1 A;  4OKJ A;  5BR8 K;  4I6M A;  3I0R A;  4PY5 A;  4H5W A;  5GIP A;  1QHA A;  3MDQ A;  1RDA A;  5AR0 A;  5DM7 L;  4IKF A;  3AVF A;  4Y0W A;  1B9F A;  3A0I X;  4QCL A;  3KVG A;  3ZSX A;  2W41 A;  2YHB A;  3ZEU A;  4DV3 K;  3SV4 A;  4A62 A;  3PY8 A;  4JKD A;  3HSC A;  3EN9 A;  3E1Y A;  4LSL A;  2OYQ A;  1G99 A;  4JEP A;  2UXD K;  1JXE A;  1MWM A;  3C6T A;  1NGI A;  2NZT A;  1ASU A;  4CZE A;  3P39 A;  3QLH A;  3H45 C;  3BUZ B;  4JV5 K;  1NM1 A;  5ADX A;  4FJ5 A;  1RDD A;  3U8X A;  3MEG A;  3HOS A;  3VQE A;  1KFS A;  3OS1 A;  4FJI A;  4R79 A;  3CFR A;  4C1N I;  4IG3 A;  3NF6 A;  1YIT N;  1ITG A;  1BL3 A;  3SUP A;  4M63 C;  4FYD A;  1RBR A;  5C10 A;  4E3S A;  3SAH A;  3KWG A;  3K5M A;  4BRG A;  1IO2 A;  3NBP A;  4H5R A;  3JS6 A;  4ISF A;  3WQU A;  3AO5 A;  4Z0U A;  4CE9 A;  2VGN A;  4FLV A;  3NDK A;  3SMS A;  1NU0 A;  3SV3 A;  1SL0 A;  3VEY A;  2GWK A;  2P9P A;  4OKE A;  1WSH A;  5KQD A;  1TK8 A;  2V52 B;  3SPZ A;  1TKX A;  3TTD A;  2VQE K;  1JCG A;  3QNO A;  1KXP A;  1JLF A;  3I55 N;  3T1A A;  5D3G A;  2ZJQ L;  3C6H A;  3NGZ A;  2P9S B;  3NAE A;  4CJV A;  1EKE A;  5AJ3 K;  1TAQ A;  3O9U A;  5LMN K;  1VSD A;  2ASO A;  1C0F A;  3ZT3 A;  2FC0 A;  4F9O A;  3ZSR A;  4AQY K;  5BN9 A;  4KHS A;  3LDO A;  1JL2 A;  1E3M A;  3N4P A;  4CIF A;  2VG5 A;  2P9N A;  3BGR A;  4HCB A;  4EP5 A;  1VQP N;  1YAG A;  4M45 A;  1N33 K;  4B3O A;  3ZSO A;  3U4L A;  1T03 A;  1RBS A;  2BDP A;  2NLX A;  3R9P A;  4K8X A;  2F9T A;  2A1R A;  1NGA A;  5GIO A;  4I9Q A;  1VQN N;  4JHD B;  1VQ4 N;  1GLF O;  3OYE A;  2KTQ A;  1KVB A;  1DTT A;  3ID6 A;  4LF8 K;  3J81 O;  1YJN N;  1RDB A;  1Y97 A;  3SBT A;  1NK9 A;  3SQ1 A;  4CJK A;  3OW2 M;  3G71 N;  4FJL A;  3CJ9 A;  3VEN A;  2HHT A;  2PBD A;  1OVY A;  3VF4 A;  3K2P A;  1VSE A;  2G8W A;  2HVI A;  1YJ9 N;  3THX B;  4KH4 A;  4CHN A;  1HNW K;  2P9L B;  3AV9 A;  3KHY A;  4CVN E;  4B1X B;  2NRX A;  3TAN A;  5AZI B;  3MEC A;  3ZLJ A;  2Q31 A;  3PIP L;  3D2F A;  3I56 N;  3OYM A;  1T3V A;  3IG1 A;  1QQC A;  1D5A A;  4F3O A;  1X3M A;  5ELZ A;  1N32 K;  4GV3 A;  2IS3 A;  3C6U A;  2R7Y A;  4B9V A;  1T8E A;  3SYZ A;  3MX5 A;  3HZ6 A;  4JN4 A;  3VQ4 A;  3P4I A;  1W97 L;  3I33 A;  2JWK A;  3IMX A;  4MFB A;  1XC3 A;  1IKV A;  2YCH A;  1T44 A;  3S9H A;  3U6F A;  4EHU A;  3A5O C;  4RCH A;  2HB5 A;  4DF8 A;  1N36 K;  4WF9 L;  1RT2 A;  2RF2 A;  4OPJ A;  3WXJ A;  4CJ5 A;  3LP2 A;  2FSN A;  2O8E B;  1RTH A;  3ENH A;  3D0P A;  4JD2 A;  2HMP A;  4C8O A;  5KPZ A;  1RBT A;  1SUQ A;  3M6G A;  4PKH A;  2NRH A;  3MWP A;  3AVG A;  2HNY A;  3AVL A;  4L3Q A;  3OS2 A;  3BY5 A;  3UKU A;  2VQF K;  1HUX A;  2D0P A;  3CM6 A;  3SNN A;  5I9E B;  3QIP A;  1P90 A;  5M1O A;  4GV9 A;  1HNV A;  5F1X A;  4CD1 A;  4E7J A;  4FPB A;  4H8K A;  1A5V A;  3O80 A;  2FBX A;  2E2N A;  3TI0 A;  2FBV A;  4HUF A;  1C1B A;  4XIU A;  5EU7 A;  3KLF A;  3WNG A;  1MDU B;  3N4Q A;  4DQP A;  4KH6 A;  4J2A A;  2BTF A;  2BUP A;  4CEO A;  4YOY A;  1GLD G;  4B1U B;  4LH4 A;  2CH6 A;  4Q0B A;  1DEJ A;  4CK1 A;  2I7N A;  3TTC A;  4X64 K;  5E26 A;  1LOT B;  2O8B B;  3TAG A;  1IH7 A;  1Z6R A;  3EL2 A;  3VEZ A;  2VCP A;  4I2P A;  4X66 K;  4KB0 A;  4B8C A;  3H3O B;  3DWL A;  1YVU A;  1SS6 A;  1YIJ N;  4KBO A;  3AVI A;  1OH6 A;  4F3T A;  2A3Z A;  2KZZ A;  2Q36 A;  3B6P A;  4U67 L;  3ZSV A;  3RTV A;  3BZK A;  3KTQ A;  3OYK A;  4LF7 K;  1H1V A;  4MDB A;  1TGO A;  3J7Z O;  3I8D A;  4FJN A;  3QIC A;  3T1Y K;  3CJ1 A;  3ZEU B;  2GUI A;  5AQT A;  3THW A;  2QXF A;  4MLE A;  1ZBF A;  1NMN A;  2HHU A;  3EE8 A;  2AJQ A;  5GAD P;  1JLG A;  4IOX A;  2FSK A;  5AQM A;  3G25 A;  5BPL A;  3NVM A;  4FOI A;  3AGK A;  2ZJP L;  1C0M A;  5C24 A;  3KK3 A;  4Z4F A;  2F8T A;  3HK2 A;  4HHT A;  1LCU A;  3OA9 A;  2CH5 A;  1U45 A;  3KKR A;  2ITG A;  3E9L A;  3DLE A;  2X6S A;  1NGE A;  3VA3 A;  2IOC A;  1LW0 A;  3I0S A;  2XY6 A;  3CCV N;  1FJG K;  2UXC K;  4DSI A;  2BH1 A;  5FRO A;  1NKC A;  4DU4 A;  2ZD1 A;  3P83 D;  4EHT A;  2Z1I A;  2JLE A;  2P9U A;  4W5O A;  4FZX C;  4N47 A;  5I42 A;  4QS8 A;  3MXJ A;  4YOU A;  1Z25 A;  3VTI A;  3HPG A;  4W5T A;  2XO7 A;  3FZK A;  1UOC A;  4UQG A;  4M3X A;  4FSV A;  4E19 A;  3LAL A;  2W42 A;  4FLX A;  4B9M A;  1RT5 A;  1UA1 A;  2LSN A;  4FJH A;  3NVK A;  4QS7 A;  3K0S A;  4CZG A;  2QTD A;  4CJW A;  1JLE A;  3THV A;  4NYN A;  2O8F A;  2GEM A;  4DTX A;  2P9N B;  1HJO A;  1VSL A;  2HMI A;  2IDO A;  2Y1J A;  4GY2 B;  3F5T A;  2HF3 A;  3A5L C;  3C7N A;  1HQE A;  2WFB A;  3O4N A;  4CFD A;  4KHW A;  2VYP A;  4FVU A;  4CEA A;  3TAB A;  4H5T A;  4KTQ A;  4BC5 A;  3WXK A;  4FM0 A;  5J2P A;  5AQO A;  1RTJ A;  3LP3 A;  3HRG A;  4HTL A;  4Y1C A;  1VSJ A;  4GMJ B;  2KLA A;  4FVM A;  4YY3 K;  4PWD A;  4DV5 K;  5AQU A;  4NXN K;  4KHY A;  5CZ1 A;  4CES A;  4JKF A;  3V9S A;  2ZQB A;  1KLN A;  5KTQ A;  4WYB A;  2A5X A;  3BDP A;  4GVE A;  3DOK A;  4CF0 A;  1SL2 A;  1RT3 A;  5KI6 A;  5FRN A;  4B9U A;  1BQN A;  4W5N A;  4DR2 K;  1N5Y A;  4B1W B;  5CE3 A;  1HNX K;  5HL7 L;  4DU3 A;  1OKJ A;  4N5S A;  1J9A A;  1R59 O;  1I3A A;  1NJW A;  1LWC A;  4KTZ A;  5CZ2 A;  3QEP A;  5TKY A;  3NCI A;  3D2F B;  3G0Z A;  2F8S A;  1RGI A;  3LZI A;  4FLZ A;  3AVK A;  2W6K A;  4CD3 A;  2D0B A;  1WSG A;  2YJE A;  3QEI A;  2B6A A;  4KI6 A;  3SAG A;  2P51 A;  3VQC A;  5EX5 A;  5C15 A;  3P5J A;  4JI2 K;  1XWL A;  1S9G A;  4O8U A;  4CEZ A;  4BDP A;  3ISN C;  3VQ7 A;  1QVG M;  4XH1 A;  1IG8 A;  1XQS C;  4AHC A;  4BQZ A;  3SJJ A;  3V9Z A;  3L2Q A;  2UUC K;  4KV8 A;  1QSL A;  4Z94 A;  1LW2 A;  4DQ8 A;  2E1Z A;  4JI0 K;  3S41 A;  4E7L A;  4X65 K;  3T7Z A;  3E9O A;  3WEE A;  1TKZ A;  5CY4 A;  4JD2 B;  3LDN A;  1XMQ K;  3CCR N;  5M1N A;  3M1F A;  2ZF5 O;  4B8A B;  2D0A A;  5CYQ A;  1XNQ K;  5SWM A;  1FKO A;  1SZ2 A;  3PUF A;  3QML A;  2QWN A;  2QWO A;  5M1Q A;  3CJB A;  1EQY A;  5JMV A;  1W0H A;  3WNH A;  4BR0 A;  1KAZ A;  4RW9 A;  4XH5 A;  4EZ9 A;  4TSX A;  3E66 A;  4CJ4 A;  5BN8 A;  3ENB A;  2Q1N A;  4YHH K;  3DJC A;  2E2Q A;  2KHO A;  4H5V A;  1TV6 A;  1BI4 A;  3MCP A;  1D8Y A;  3KK1 A;  2KW4 A;  1NGB A;  1WSE A;  5E41 A;  4CEB A;  1NK6 A;  2KFN A;  2NRW A;  1WLJ A;  4OX9 K;  4CJE A;  3AVA A;  4OO1 J;  3L4I A;  5J2Q A;  5C0Y A;  4CCH A;  1LWE A;  3FGU A;  1WAJ A;  4CFC A;  3T3F A;  4Z4E A;  3OYF A;  3BEX A;  2VG7 A;  1KSP A;  4CHY A;  3HOT A;  4AHS A;  4BRF A;  4LF5 K;  5AQY A;  1ZBS A;  1GLC G;  3AO4 A;  1T7P A;  1HJR A;  1NJZ A;  1T6C A;  1NLV A;  3NFA A;  3ZT0 A;  4DFJ A;  4XH4 A;  3ZT4 A;  3TAF A;  4CK2 A;  3F9M A;  1LAW A;  5AQN A;  3O9T A;  3DRS A;  3P1G A;  3SLC A;  1D9F A;  3U3G A;  1UA0 A;  3VQ8 A;  3ASM A;  4ISG A;  4ELV A;  1BCM A;  4M41 A;  1ZBL A;  1XHZ A;  3EKU A;  4IOA L;  3MED A;  1IBM K;  3CXC M;  4PKI A;  4FLU A;  1EP4 A;  3VEW A;  4DV6 K;  2I5J A;  2NRR A;  1JL1 A;  1F21 A;  3J80 O;  3DXK B;  1QTM A;  2NRV A;  4NCG A;  3TAQ A;  4LFC K;  3JYT A;  5HLF A;  3O4Q A;  1VSM A;  4DTP A;  3AA2 A;  5AQX A;  5AQK A;  4LFB K;  1BIZ A;  3V9X A;  4PQU A;  3TAP A;  4GV6 A;  1J5O A;  5IT9 O;  1JJ2 M;  2HHV A;  1VQ6 N;  4M7X A;  5B8H A;  4DR3 K;  1BOT O;  4WE1 A;  1SQK A;  5FDL A;  3T19 A;  4CBX A;  1DLO A;  3FFI A;  3ZYY X;  2P9U B;  1YHQ N;  2P9I B;  5AQL A;  4M42 A;  4DR1 K;  5KQ8 A;  5FRM A;  3CPE A;  4H03 B;  1X9M A;  2ASM A;  4CJS A;  3EEQ A;  1SV5 A;  3P38 A;  3QO9 A;  4NLC A;  3NF9 A;  1C0U A;  4FWS A;  3OYI A;  3U3Y A;  3DXM A;  1TK0 A;  2RN2 A;  2OZS A;  4BE0 A;  4DSL A;  4PUO A;  1QZ5 A;  2E6M A;  3T69 A;  1Q82 O;  1WN7 A;  3MXM A;  4UY8 O;  1J5E K;  4BGA A;  4JS4 A;  4FW2 A;  4FJ9 A;  3F9K A;  2NUB A;  1ZBH A;  2P9K A;  1NKB A;  4FJK A;  2G8I A;  3CCS N;  5J2M A;  3UIQ A;  4F8R A;  1ZC6 A;  2V7Z A;  5AQW A;  2QEX N;  4JI3 K;  1BG3 A;  1S6P A;  2IVP A;  4JKE A;  4Z4G A;  2XRI A;  3IUC A;  3G4S N;  4JI7 K;  1K9M O;  5GAH P;  1J6Z A;  2YV0 X;  4JKC A;  3FZL A;  3AVC A;  3ULE A;  4LC9 B;  1BCO A;  3E01 A;  3HT3 A;  4CED A;  3CCM N;  4O44 A;  3R6M A;  1WBB A;  2QKK A;  4C8L A;  3Q7B A;  4FZY A;  3CQX A;  4BRK A;  3CC7 N;  4CJQ A;  1KFD A;  3AAP A;  1ZYQ A;  4FM2 A;  3OYA A;  4Z4H A;  2HHH K;  1VQ8 N;  4DLE A;  4U7B A;  5LJW A;  4F4K A;  1ATN A;  1N6Q A;  4AH9 A;  3CCL N;  3QET A;  4YDU C;  4BVO A;  1RT4 A;  4K43 A;  4OJR A;  3DYA A;  4DTO A;  1MWK A;  2A6A A;  3HJF A;  1TAU A;  1NWK A;  2QWQ A;  3DLR A;  2YKN A;  1V4T A;  4BRP A;  1NGJ A;  5CYM A;  1OH5 A;  3EZW A;  4O0J A;  4PHT X;  1LAV A;  1VHX A;  1R0A A;  3I8B A;  4CBU A;  5C42 A;  1N34 K;  4E1J A;  1JLC A;  5HOO A;  4YNQ A;  1BUP A;  3LM2 A;  3MEE A;  3VQP A;  1YT3 A;  2YNF A;  3MN5 A;  4ISE A;  3R1X A;  3VF6 A;  3LAK A;  1ILY A;  1ZBI A;  5T7B A;  2E1Y A;  1XMO K;  3V1R A;  4YOW A;  2D4W A;  5BPM A;  4DG1 A;  3U9Z A;  1VQK N;  3W0L A;  3AVB A;  2OPQ A;  3MN9 A;  4IXC A;  3C95 A;  1U49 A;  3AA3 A;  4CJP A;  4BR9 A;  4JI6 K;  3GL1 A;  3SUN A;  2X78 A;  1HLU A;  4BWJ A;  1B92 A;  3QDK A;  2IAJ A;  3OHR A;  3H1Q A;  2J4R A;  2F9W A;  3KLG A;  2HND A;  4A2A A;  2YKM A;  1EWQ A;  2D1K A;  1IBL K;  4CHZ A;  1CXU A;  3SI6 A;  2ZGY A;  1U4B A;  3MN6 A;  3H6E A;  3M8P A;  4LSN A;  5C12 A;  1REV A;  3OS0 A;  4GW6 A;  1GLB G;  3CF5 L;  2NRZ A;  4BC4 A;  2GV9 A;  3AVM A;  3MAQ A;  3DI6 A;  1Q18 A;  4E7K A;  3AGR A;  3J7Y P;  4BC2 A;  3AVJ A;  4B9S A;  5KRS A;  2DFH A;  4OLA A;  4GNI A;  2DFE A;  3KD5 E;  4BE1 A;  1YF5 L;  4IWV A;  3J7A P;  4BDY A;  3KKS A;  1BIU A;  5JLH A;  4JK8 A;  4KHQ A;  3CET A;  2FBT A;  5AQQ A;  3VQ9 A;  3L6Q A;  2Z1J A;  2ZWH A;  4KH5 A;  3NGY A;  5JVH L;  1S1U A;  3ZSZ A;  5GAG P;  3ZSY A;  4IJN A;  4PKG A;  4C1N K;  4AIL C;  1X3N A;  2KKZ A;  1NJY A;  4LH5 A;  5AZJ B;  5HRP A;  3KLE A;  3RR8 A;  3H1V X;  2QI2 A;  4EZ6 A;  4B9T A;  4OVL A;  1VQ7 N;  1WUA A;  2KQ2 A;  3SJH A;  3ALY A;  4WFB L;  3VF2 A;  3VA0 A;  4E7I A;  1A5W A;  2RHK A;  3KK2 A;  2PYL A;  4JKG A;  1NG9 A;  3HP9 A;  4ID5 A;  4CGG A;  5F2R A;  3ID8 A;  2HBJ A;  4O5F A;  4DU1 A;  2QW9 A;  4PA1 A;  4FLW A;  3NMU A;  3BF1 A;  3LM9 A;  3SQ2 A;  4CZJ A;  5CR4 A;  5C2F A;  5K14 A;  4FWN A;  4DQS A;  4I6M B;  5AQG A;  4BRA A;  1Q8I A;  2YHY A;  4CHQ A;  4CZL A;  3OJS A;  4DS5 A;  1Q86 O;  1RTD A;  2AA4 A;  3CI5 A;  2VWJ A;  5AQZ A;  4RTF D;  3HI0 A;  3KLH A;  3VMF B;  4B3T K;  3P31 A;  3KD1 E;  4O8K A;  1HR0 K;  1DT9 A;  3DLB A;  3VES A;  4QOZ B;  1NOY A;  2Y1I A;  3CC2 N;  1C0T A;  4JRP A;  4M3Y A;  3OYB A;  3CG7 A;  2GEL A;  2FLO A;  4FJ8 A;  3NH1 A;  1RFQ A;  3C65 A;  5HRS A;  4DV4 K;  4E7H A;  1KCF A;  3LZJ A;  3ZX3 A;  4CHO A;  4DTR A;  2E2O A;  4FWP A;  2CGL A;  3WT0 A;  2WON A;  2E5L K;  4JKH A;  3QIO A;  4CEQ A;  3C6A A;  3MXI A;  4DSE A;  4CHP A;  4KHU A;  3K5L A;  4AHV A;  1C6V A;  2QWM A;  3BF3 A;  2P9P B;  2P9K B;  4BR2 A;  3CME N;  5AQI A;  4Q5V A;  1GOB A;  4DHY A;  4R5P A;  2O8D A;  3FLC O;  1QE1 A;  3GBT A;  3CCJ N;  3CCE N;  4H0P A;  4W5Q A;  2WC9 A;  5EVZ A;  1GLA G;  3HL8 A;  1U2V A;  3M5R A;  1HNZ K;  5EOY A;  5JLF A;  3O9Q A;  4JYA K;  2HHQ A;  4DR6 K;  3NHG A;  2FSJ A;  2E6L A;  1IBK K;  1XUP O;  3IDH A;  3O9R A;  4JK7 A;  3ITH A;  4O55 A;  3H3N O;  4B3R K;  1WSF A;  4K42 A;  4AHR A;  3TSU A;  1TUY A;  4NXM K;  4AF1 A;  4CEF A;  4WQ5 C;  5LY3 A;  3CIP A;  2O8C A;  5M1F A;  3AA5 X;  1DTQ A;  3EKS A;  1QS4 A;  4CEE A;  1YUW A;  4LFA K;  2VG6 A;  3CYM A;  2YNI A;  3O1W A;  3K9K A;  1U48 A;  3TSP A;  3L3U A;  3AO2 A;  3CMA N;  1L5U A;  4L8R B;  4FLT A;  3VET A;  4CGF A;  3M8S A;  1HKG A;  2QWP A;  1GLJ O;  3UKR A;  4EP4 A;  4A57 A;  4HVJ A;  3V1Q A;  2B5J A;  1KTQ A;  4CF9 A;  2A1S A;  4NYF A;  4RW8 A;  2X74 A;  4J2E A;  3CC4 N;  1NK5 A;  1E4F T;  3VGL A;  4N56 A;  1HNI A;  2I7P A;  4BRN A;  2PAV A;  5F0X A;  4OGE A;  4E89 A;  5M1K A;  4WFA L;  2UUB K;  4FWO A;  4F2R A;  5KGW A;  4FXD A;  1O1W A;  4H0X B;  4B3S K;  3D45 A;  1VQ9 N;  4B3M K;  1YJW N;  3J8A A;  2BAN A;  4M3R A;  4DV7 K;  4BY9 C;  1A5X A;  4F2S A;  1S5J A;  1NGH A;  4I7F A;  3TAR A;  2EWS A;  4EFH A;  1NK0 A;  4DSJ A;  3GDQ A;  3OYD A;  1EXQ A;  4CI6 A;  4JK9 A;  3A5M C;  3C0B A;  4C8K A;  3WXL A;  2V7Y A;  2GX9 A;  4J8F A;  3PX4 A;  1OH7 A;  1YVN A;  4JHD A;  2KFZ A;  4J2B A;  1OH8 A;  1ASW A;  3NH0 A;  1MU2 A;  1P8Z A;  1JXB A;  1BO5 O;  3VQ5 A;  1L3V A;  4OKK A;  3IRX A;  3WNE A;  4M3T A;  2KZM A;  3LP0 A;  1X9S A;  3EO3 A;  1S22 A;  4H0Y B;  4LF4 K;  3O3F A;  4WQ5 A;  1RDW X;  3O3G A;  4IEE A;  4BDZ A;  1M90 O;  4K0K K;  3AVN A;  3UKU B;  1TL1 A;  4B08 A;  4CF1 A;  2P9L A;  4JRQ A;  4PL8 A;  3FFK B;  4LD0 A;  3V1O A;  1BGX T;  4DUZ K;  1YTU A;  1C1A A;  5AZI A;  1QQO A;  4RW4 A;  3L2W A;  3QIN A;  3RRG A;  3ZT1 A;  1HPZ A;  4MO4 A;  1NKE A;  3SK3 A;  4RG8 A;  1S1W A;  1ATS A;  4BRH A;  3CQY A;  3THY A;  4RW6 A;  3ZX0 A;  4ELT A;  5BRD A;  3SUQ A;  3KIO A;  3PSI A;  1VRU A;  4CFB A;  5KRT A;  1QHT A;  4BRQ A;  1KRP A;  4BE2 A;  1X1P A;  2Q2R A;  5MLC Q;  1JLA A;  3HYF A;  2E8A A;  3LL3 A;  4G1Q A;  3O4W A;  3HM8 A;  1NGG A;  1BHL A;  3RRH A;  5HRN A;  1T6D A;  3D2E A;  1GOC A;  2O8E A;  1RBU A;  4JS5 A;  1Q81 O;  2OTL N;  4CJR A;  3DLL L;  4FJX A;  2PFU A;  3ZET A;  4A2B A;  5LJV A;  4IJA A;  4OPK A;  3RMC A;  4M3W A;  4HUE A;  2IGI A;  3AAR A;  1U47 A;  3M8Q A;  2D0O A;  4MO5 A;  3K5N A;  1HKC A;  3VGK A;  2FF6 A;  1TVR A;  1CLQ A;  5AQJ A;  1NBW A;  2OPS A;  3SAF A;  1NK4 A;  4J2D A;  4EAH D;  3NE6 A;  2GUP A;  3AAQ A;  3CPW M;  4DQQ A;  5DMR A;  1E4G T;  3OBW A;  4FWK A;  4FPA A;  4CGJ A;  2GWJ A;  3THW B;  4ZTF A;  4ILH A;  3KZB A;  4WQ4 C;  4QS9 A;  4FWQ A;  3OYC A;  5BRF A;  2E4L A;  3LDS A;  2GTD A;  2JGU A;  4ZTJ A;  4FW1 A;  3RVC A;  3OY9 A;  4H0O A;  2OZM A;  2FF3 B;  4YFU A;  4CW7 B;  3O9S A;  4M3Z A;  5FPE A;  3AO3 A;  1EWR A;  2YNH A;  1SKS A;  4CZH A;  2DPN A;  4CIG A;  3O5B A;  3NGI A;  3RMB A;  4DSF A;  1NK7 A;  1L3T A;  4ELU A;  2OA8 A;  1YI2 N;  3SUO A;  3ENO A;  4HCC A;  1N8R O;  4C23 A;  3LWM A;  3TSQ A;  5LL6 Z;  2VWB A;  3ULD A;  2WBN A;  2ZE2 A;  2BGG A;  4E0D A;  1EX4 A;  1L3U A;  4IDH A;  1XNR K;  1HPM A;  3FZF A;  4ID1 A;  4KPY A;  1BU6 O;  2O4G A;  3EYZ A;  3NH2 A;  1RTI A;  3FZM A;  4FK0 A;  5JIC A;  4W5R A;  1XHX A;  4H5N A;  3CER A;  2QA4 N;  3M8R A;  2O8D B;  4DR4 K;  3OJU A;  4KHN A;  1BA1 A;  3ZSQ A;  4BC3 A;  3GOI A;  1JCF A;  2P1J A;  4KI4 A;  3AO1 A;  1U2V B;  1CZB A;  4NCA A;  1TUU A;  4A61 A;  3G10 A;  2HHX A;  1SKR A;  1HYZ A;  3RSE A;  2CGJ A;  2F96 A;  5A2Q O;  3QBW A;  2O8F B;  2QWR A;  3SQ0 A;  4O0I A;  3AY9 A;  4DS4 A;  1KAX A;  1NJX A;  2NRT A;  2HBL A;  5AQP A;  3C7N B;  1RDC A;  4WQ4 A;  2O8C B;  1EO1 A;  2YI1 A;  3ZT2 A;  1YXQ A;  3D6R A;  1O13 A;  2RPI A;  1X9W A;  1S3X A;  4DV2 K;  5KPT A;  2G8U A;  1WAF A;  3HTV A;  3RMA A;  1BDG A;  1VAZ A;  3GE1 A;  3UKR B;  2CGK A;  1QQN A;  4H0T B;  4KFB A;  5I3U A;  5AQV A;  1NGD A;  3PO4 A;  3OYG A;  4ICL A;  4Y1D A;  2EHG A;  3FE1 A;  2RKI A;  4M7Y A;  3K59 A;  1W9H A;  1Z05 A;  2VGM A;  4RW7 A;  2OPR A;  3WXI A;  3QES A;  2XY8 A;  2QXL A;  3VEX A;  1ASV A;  2G8F A;  3D7E O;  3MMV A;  1QSS A;  2OTJ N;  4B1Y B;  1NGF A;  4DWI A;  4FO0 A;  1J53 A;  1IJJ A;  1YTA A;  2IVN A;  1RNH A;  4CFA A;  4NLB A;  1CXQ A;  3MX2 A;  3WUH A;  1DKG D;  4B1V A;  3VTH A;  4N41 A;  2HHS A;  1TL3 A;  4NCB A;  4FZZ A;  3TR8 A;  3LWL A;  4KKO A;  4B9Q A;  4OPH A;  3CFO A;  4JI8 K;  2E2P A;  3LPU A;  5AQF A;  1TKT A;  5BPN A;  4IO9 L;  1BA0 A;  3KK7 A;  1Q9X A;  5M1P A;  3ZX2 A;  1LV5 A;  1ZBU A;  2W40 A;  4IEI A;  2ZJR L;  1TYQ A;  3L8B A;  4LF9 K;  2UXB K;  4IG0 A;  4KB1 A;  4DSK A;  3K58 A;  4FWR A;  3HM9 A;  2E20 A;  3OYJ A;  1WOQ A;  2DFF A;  3VER A;  3AA4 A;  4OGC A;  3ZCM A;  3WEE B;  3JSM A;  3A8Y A;  1ATR A;  3LPT A;  4H4M A;  4BRE A;  4KRF A;  1FW6 A;  3F2K A;  1U6Z A;  3PLA A;  3Q7C A;  4BR4 A;  4FCY A;  3G6E N;  4H0V B;  4GKJ K;  3LDP A;  4FWL A;  3TU5 A;  3DAW A;  1VQL N;  5AQS A; 
#chains in the Genus database with same CATH homology
 4LSL A;  4KV8 A;  2OYQ A;  1QSL A;  1LW2 A;  2WON A;  4CEQ A;  3QIO A;  4I9L A;  3MXI A;  3L3V A;  4CHP A;  4E7L A;  4DSE A;  4KHU A;  4IDK A;  1JXE A;  4DMN A;  3PV8 A;  5HP1 A;  3C6T A;  4CIE A;  3K5L A;  1TKZ A;  5CY4 A;  3QNN A;  3QEV A;  1ASU A;  1Q9Y A;  3QLH A;  4AHV A;  1C6V A;  1BI4 B;  4B8A B;  1VSK A;  3HP6 A;  2D0A A;  5CYQ A;  4FJ5 A;  1RDD A;  4Q5V A;  5SWM A;  3MEG A;  1FKO A;  3VQE A;  4Z4C A;  3OS1 A;  4DFM A;  1KFS A;  4FJI A;  1GOB A;  3PUF A;  3TWH A;  3CFR A;  4LY7 A;  4R5P A;  1QE1 A;  3NF6 A;  4IG3 A;  1ITG A;  1C1C A;  4HTU A;  1BL3 A;  3SUP A;  4FYD A;  4W5Q A;  1W0H A;  1RBR A;  3WNH A;  4B9L A;  4E3S A;  3TAM A;  3HL8 A;  3K5M A;  4RW9 A;  3SZ2 A;  1IO2 A;  4K8Z A;  4EZ9 A;  3NBP A;  4TSX A;  4CJ4 A;  3PO5 A;  4CE9 A;  3AO5 A;  4Z0U A;  4FLV A;  3NDK A;  3SV3 A;  1TV6 A;  2HHQ A;  2HHW A;  1SL0 A;  1UAX A;  1BI4 A;  1D8Y A;  3NHG A;  4CEC A;  3KK1 A;  4OKE A;  2KW4 A;  1WSH A;  2E6L A;  1WSE A;  4FK2 A;  1FK9 A;  2G8V A;  5E41 A;  4CEB A;  1TK8 A;  4FK4 A;  4E1N A;  1NK6 A;  2KFN A;  3SPZ A;  1TKX A;  1WLJ A;  3ITH A;  1TK5 A;  4O55 A;  4DTS A;  1K6Y A;  4CJE A;  2ETJ A;  3QNO A;  1WSF A;  1JLF A;  3AVA A;  3T1A A;  4AHR A;  5D3G A;  3NGZ A;  3NAE A;  5J2Q A;  4CCH A;  1LWE A;  3DM2 A;  1EKE A;  4CJV A;  1WAJ A;  4FLY A;  3S3O A;  4CFC A;  3T3F A;  4CEF A;  4Z4E A;  3OYF A;  2VG7 A;  2PY5 A;  1KSP A;  1TAQ A;  1IKW A;  3AA5 X;  1DTQ A;  1VSD A;  4CHY A;  1QS4 A;  4AHS A;  4CEE A;  4Z4I A;  3ZT3 A;  2FC0 A;  3ZSR A;  2VG6 A;  1RIL A;  3EY1 A;  3CYM A;  2YNI A;  4KHS A;  1S1X A;  1U48 A;  1L5U A;  3L3U A;  3AO2 A;  4L8R B;  3AO4 A;  1JL2 A;  4FLT A;  1HYV A;  1D9D A;  4CGF A;  3M8S A;  3QEW A;  3CQ8 A;  4CER A;  1T7P A;  4CIF A;  2VG5 A;  4EP4 A;  4FJM A;  1HJR A;  4HVJ A;  3V1Q A;  1Z26 A;  3BGR A;  2B5J A;  1NJZ A;  4HCB A;  1KTQ A;  4CF9 A;  4EP5 A;  2A1S A;  3NFA A;  4NYF A;  4RW8 A;  3ZT0 A;  4DFJ A;  1RT7 A;  2X74 A;  4J2E A;  1NK5 A;  4N56 A;  1HNI A;  4M45 A;  3ZT4 A;  3TAF A;  4CK2 A;  4B3O A;  2Q3S A;  1I39 A;  3ZSO A;  1LAW A;  4FJ7 A;  1T03 A;  1RBS A;  4E1M A;  2BDP A;  3AVH A;  3DRS A;  3P1G A;  1D9F A;  4KO0 A;  4K8X A;  4OGE A;  4E89 A;  3U3G A;  2A1R A;  1UA0 A;  2DY4 A;  3VQ8 A;  2GBZ A;  4OLB A;  4F2R A;  3ASM A;  1RBV A;  5HRO A;  5KGW A;  4I9Q A;  4FXD A;  1O1W A;  4ELV A;  5JS2 A;  5J1E A;  1BCM A;  4M41 A;  1ZBL A;  3D45 A;  1XHZ A;  3S3N A;  3L2R A;  3A2F A;  3OYE A;  2KTQ A;  1KLM A;  2BAN A;  4M3R A;  4N76 A;  1BQM A;  1KVB A;  3MED A;  3LP1 A;  1DTT A;  4FLU A;  1EP4 A;  1A5X A;  4F2S A;  1S5J A;  1RDB A;  1Y97 A;  3IAY A;  4CF8 A;  2I5J A;  4I7F A;  3TAR A;  1NK9 A;  3WNF A;  3SQ1 A;  3V81 A;  4CJK A;  4AHT A;  1NK0 A;  4FJL A;  4DSJ A;  1IG9 A;  1JL1 A;  1F21 A;  2HHT A;  3OYD A;  1EXQ A;  1WSI A;  2B4J A;  3TAE A;  1QTM A;  3K2P A;  1VSE A;  4NCG A;  4MQ3 A;  3V9W A;  3K57 A;  1JKH A;  2G8W A;  4C8K A;  3TAQ A;  2IC3 A;  2HVI A;  3JYT A;  5HLF A;  3PX4 A;  3O4Q A;  1VSM A;  4CHN A;  2KFZ A;  4J2B A;  1ASW A;  4DTP A;  5HBM A;  1MU2 A;  3AA2 A;  3AV9 A;  3NH0 A;  4KRE A;  1JXB A;  3LAN A;  1BIZ A;  4CGH A;  3VQ5 A;  3V9X A;  1L3V A;  4OKK A;  5J2N A;  3TAN A;  3TAP A;  4IBN A;  3IRX A;  2PYJ A;  4PQU A;  3MEC A;  4FM1 A;  3WNE A;  1J5O A;  4M3T A;  3LP0 A;  2KZM A;  1X9S A;  2ATQ A;  3OYM A;  2BE2 A;  3IG1 A;  1QQC A;  2HHV A;  1D5A A;  4F3O A;  1HRH A;  3O3F A;  2IS3 A;  3C6U A;  2R7Y A;  4B9V A;  1T8E A;  3O3G A;  3SYZ A;  3DMJ A;  3VQ4 A;  4CJF A;  4FJJ A;  4WE1 A;  3SPY A;  5FDL A;  3T19 A;  4MFB A;  1DLO A;  3FFI A;  3OYL A;  1IKV A;  1FXX A;  4BDZ A;  3AVN A;  1TL1 A;  4B08 A;  4CF1 A;  4DTU A;  4JRQ A;  4M42 A;  4LD0 A;  3NF7 A;  5FRM A;  2O4I A;  3S9H A;  1X9M A;  3V1O A;  4CJS A;  3U6F A;  1BGX T;  1SV5 A;  1YTU A;  2HB5 A;  5SZT A;  1C1A A;  4DF8 A;  3QO9 A;  3NF9 A;  1C0U A;  1RT2 A;  2RF2 A;  3HVT A;  4RW4 A;  3QIN A;  3OYI A;  4OPJ A;  3L2W A;  3U3Y A;  2RN2 A;  1JLB A;  3ZT1 A;  4CJ5 A;  3LP2 A;  4BE0 A;  1HPZ A;  3IS9 A;  1TK0 A;  1RTH A;  2OZS A;  4DSL A;  4PUO A;  1NKE A;  4JLH A;  4RG8 A;  2E6M A;  2D0C A;  3VQA A;  3D0P A;  1WN7 A;  4HUG A;  4DTM A;  1S1W A;  3MXM A;  2XY7 A;  4RW6 A;  1KVA A;  4C8O A;  4ELT A;  4JS4 A;  1RBT A;  1SUQ A;  4FW2 A;  3V6D A;  4DQR A;  4FJ9 A;  3F9K A;  3KIO A;  3SUQ A;  1VRU A;  3AVG A;  4CFB A;  5KRT A;  2NUB A;  1QHT A;  2HNY A;  3AVL A;  3ZSW A;  3OS2 A;  4BE2 A;  1KRP A;  1X1P A;  1ZBH A;  1NKB A;  1WNS A;  2OPP A;  1JLA A;  3HYF A;  5J2M A;  3UIQ A;  4DTN A;  4G1Q A;  4F8R A;  4FJK A;  2G8I A;  1CZ9 A;  1S6P A;  2Z1G A;  3PX6 A;  4Z4G A;  1BHL A;  1HQU A;  2XRI A;  3CM6 A;  3K5O A;  5HRN A;  3RRH A;  3SNN A;  3QIP A;  3EZ5 A;  1GOC A;  1L3S A;  4FJG A;  2YV0 X;  4DF4 A;  1RBU A;  4JS5 A;  1HNV A;  4BAC A;  3AVC A;  1TKD A;  4E7J A;  4H8K A;  4CJR A;  1BCO A;  3E01 A;  3HT3 A;  4CED A;  1B9D A;  2WOM A;  4FJX A;  1A5V A;  4O44 A;  2FBX A;  3TI0 A;  2QKK A;  2FBV A;  4BWM A;  4C8L A;  4FZY A;  1J54 A;  4HUF A;  4CJQ A;  1KFD A;  4DFK A;  1C1B A;  4XIU A;  1ZYQ A;  1VRT A;  5EU7 A;  3KLF A;  1KVC A;  4FM2 A;  3WNG A;  2G8K A;  3DLH A;  3RR7 A;  3S3M A;  3OYA A;  4OPK A;  4Z4H A;  4DQP A;  3HST B;  3RMC A;  4J2A A;  4M3W A;  4HUE A;  2IGI A;  4DLE A;  1U47 A;  3M8Q A;  4CEO A;  4CJL A;  4LH4 A;  3K5N A;  4F4K A;  3C94 A;  1N6Q A;  4Q0B A;  2YNG A;  4AH9 A;  4CK1 A;  3O3H A;  2P5O A;  3QET A;  1RT4 A;  1TVR A;  1CLQ A;  4OJR A;  1IH7 A;  3TAG A;  3DYA A;  4DTO A;  2OPS A;  3F73 A;  3KLI A;  1NK4 A;  4J2D A;  3NE6 A;  1HMV A;  3HJF A;  4DQQ A;  1BIS A;  5DMR A;  1TAU A;  4CGD A;  3B6O A;  3V4I A;  4I2P A;  1SL1 A;  3DLR A;  3HPH A;  4KB0 A;  2YKN A;  4CGJ A;  4CF2 A;  4B8C A;  4ZTF A;  5CYM A;  3NF8 A;  1YVU A;  4ZHR A;  3DLK A;  3OYC A;  4O0J A;  4W5N A;  1QSY A;  1LAV A;  3AVI A;  2E4L A;  3LDS A;  4F3T A;  1G15 A;  2JGU A;  2HVH A;  1R0A A;  2KZZ A;  4ZTJ A;  4FW1 A;  3B6P A;  4O4G A;  3OY9 A;  3ZSV A;  5C42 A;  3RTV A;  3KTQ A;  2OZM A;  4YFU A;  4M3Z A;  1JLC A;  1IKY A;  3OYK A;  3AO3 A;  4YNQ A;  2YNH A;  3MEE A;  1SKS A;  3VQP A;  1TGO A;  4CIG A;  4B9N A;  3I8D A;  3NGI A;  1YT3 A;  3VQB A;  1T05 A;  4FJN A;  2YNF A;  2P5G A;  3RMB A;  1S9E A;  4CGI A;  3HO1 A;  1VK0 A;  4DSF A;  2GUI A;  1NK7 A;  1L3T A;  2OA8 A;  3LAK A;  4ELU A;  4M3U A;  3SUO A;  1NK8 A;  1ZBI A;  4CJU A;  5T7B A;  4HCC A;  2QXF A;  2XHB A;  3LWM A;  1ZBF A;  3V1R A;  1IKX A;  3ULD A;  2HHU A;  4DG1 A;  4KAZ A;  2ZE2 A;  2BGG A;  4E0D A;  1RT6 A;  3SQ4 A;  2AJQ A;  1UWB A;  1EX4 A;  1JLG A;  3AVB A;  2OPQ A;  1L3U A;  4DFP A;  4ID1 A;  4KPY A;  3EYZ A;  2O4G A;  3C95 A;  1C0M A;  5C24 A;  4IFV A;  3NH2 A;  3KK3 A;  1RTI A;  2YHA A;  3AA3 A;  1U49 A;  4CJP A;  4FK0 A;  4W5R A;  4Z4F A;  1XHX A;  2F8T A;  4GVM A;  3SUN A;  2X78 A;  3HK2 A;  4HHT A;  3M8R A;  4BWJ A;  1U45 A;  1B92 A;  2IAJ A;  3KKR A;  2ITG A;  3DLE A;  2X6S A;  3OJU A;  4KHN A;  3KLG A;  2HND A;  3ZSQ A;  2YKM A;  1S6Q A;  2P1J A;  3DLG A;  4KI4 A;  3VA3 A;  2IOC A;  4CHZ A;  3AO1 A;  4DTJ A;  1CZB A;  4NCA A;  1CXU A;  2VWK A;  1FKP A;  1LW0 A;  3SI6 A;  1U4B A;  4C8N A;  4AHU A;  3I0S A;  3M8P A;  4LSN A;  3OS0 A;  1RCH A;  1REV A;  3G10 A;  3HXM A;  4GW6 A;  2XY6 A;  2HHX A;  1SKR A;  1VSH A;  1SKW A;  1HYZ A;  2X6N A;  4DSI A;  2GV9 A;  2F96 A;  3AVM A;  5DK5 A;  5FRO A;  3MAQ A;  1NKC A;  3QEX A;  3VQD A;  4DU4 A;  2ZD1 A;  3DI6 A;  3P83 D;  3HPO A;  2Z1I A;  3VQQ A;  4E7K A;  1NOZ A;  3SQ0 A;  2JLE A;  4O0I A;  2DTU A;  4W5O A;  2PZS A;  4N47 A;  4FZX C;  4DS4 A;  5I42 A;  1JLQ A;  3MXJ A;  1NJX A;  1Z25 A;  3AVJ A;  4B9S A;  2QKB A;  5KRS A;  3HPG A;  4W5T A;  2DFH A;  3DRR A;  4H4O A;  2XO7 A;  2Z1H A;  1RDC A;  4OLA A;  1UOC A;  4UQG A;  4M3X A;  2DFE A;  3KD5 E;  4E19 A;  4BE1 A;  3LAL A;  3ZT2 A;  3H08 A;  2W42 A;  4FLX A;  4B9M A;  2HW3 A;  1RT5 A;  2RPI A;  4BDY A;  3KKS A;  2LSN A;  1S1T A;  1UA1 A;  1X9W A;  1BIU A;  4FJH A;  2G8U A;  1WAF A;  4KHQ A;  2FBT A;  4CJW A;  3RMA A;  3DOL A;  1JLE A;  3VQ9 A;  3THV A;  4NYN A;  4KFB A;  5HRR A;  2Z1J A;  4DTX A;  5I3U A;  2D5R A;  1VSL A;  3NGY A;  3PO4 A;  1LWF A;  1S1U A;  3OVN A;  3ZSZ A;  3ZSY A;  3OYG A;  4ICL A;  1VSF A;  4Y1D A;  4C8M A;  2EHG A;  3QER A;  3PX0 A;  2IDO A;  2HMI A;  2Y1J A;  2RKI A;  3L2V A;  4AIL C;  1GOA A;  2HNZ A;  1XC9 A;  1HQE A;  3SCX A;  3O4N A;  4CFD A;  3K59 A;  1NJY A;  4KHW A;  4LH5 A;  3CM5 A;  5HRP A;  5JS1 A;  1W9H A;  3KLE A;  3RR8 A;  4CEA A;  4CJ3 A;  3LAM A;  4RW7 A;  3TAB A;  4KTQ A;  2OPR A;  4EZ6 A;  2EX3 A;  4B9T A;  4FM0 A;  3QES A;  4OVL A;  5J2P A;  2XY8 A;  1RTJ A;  2KQ2 A;  3LP3 A;  4O5B A;  3VN5 A;  1ASV A;  3KJV A;  3ALY A;  3L2U A;  1S1V A;  1VSJ A;  4Y1C A;  5C25 A;  3VA0 A;  2G8F A;  4GMJ B;  3VQ6 A;  4FVM A;  4QAG A;  4E7I A;  1A5W A;  1QSS A;  3RWU A;  4PWD A;  3KK2 A;  2PYL A;  4KHY A;  5CZ1 A;  4DWI A;  3HP9 A;  1WSJ A;  4ID5 A;  4CES A;  4CGG A;  3V9S A;  1EET A;  2ZQB A;  4CJT A;  1J53 A;  1KLN A;  5KTQ A;  4DU1 A;  2G8H A;  1YTA A;  4I2Q A;  4PA1 A;  1RNH A;  4FLW A;  3BDP A;  4IFY A;  4CFA A;  3V9U A;  3DOK A;  4CF0 A;  3SQ2 A;  1CXQ A;  1RT3 A;  5KI6 A;  2XY5 A;  1SL2 A;  4B9U A;  5FRN A;  3CFP A;  1U04 A;  5K14 A;  1BQN A;  1XI1 A;  4DQS A;  3RMD A;  4N41 A;  2HHS A;  1Q8I A;  1TL3 A;  1N5Y A;  4KTW A;  4CHQ A;  3OYH A;  3OJS A;  3TR8 A;  3LWL A;  4KKO A;  4NCB A;  4FZZ A;  4DS5 A;  1VSI A;  4DLG A;  5KGX A;  4DU3 A;  3CFO A;  4DQI A;  1RTD A;  3LPU A;  1TKT A;  3OYN A;  4N5S A;  2VWJ A;  1Q9X A;  1J9A A;  3RRG A;  1LV5 A;  1ZBU A;  4CK3 A;  1I3A A;  1NJW A;  1HYS A;  1LWC A;  4KTZ A;  3KLH A;  5CZ2 A;  3DRP A;  3HVR A;  3L8B A;  3QEP A;  4IG0 A;  3KD1 E;  2FBY A;  3NCI A;  4DSK A;  4KB1 A;  3K58 A;  3G0Z A;  2F8S A;  3LZI A;  3HM9 A;  4FLZ A;  3DLB A;  4QOZ B;  3OYJ A;  3AVK A;  2DFF A;  2QK9 A;  3ZCM A;  2D0B A;  1WSG A;  3AA4 A;  4OGC A;  3JSM A;  3QEI A;  2Y1I A;  2B6A A;  1NOY A;  1RT1 A;  4KI6 A;  3LPT A;  2P51 A;  4OKJ A;  4H4M A;  1C0T A;  3VQC A;  3I0R A;  4JRP A;  4PY5 A;  4M3Y A;  4KRF A;  3OYB A;  3CG7 A;  3P5J A;  1XWL A;  1S9G A;  1RDA A;  4CEZ A;  4FJ8 A;  3NH1 A;  4BDP A;  4IKF A;  3AVF A;  4FCY A;  3ISN C;  3VQ7 A;  5HRS A;  1B9F A;  4E7H A;  4AHC A;  1KCF A;  3LZJ A;  4QCL A;  3ZSX A;  3SV4 A;  2YHB A;  4CHO A;  4DTR A;  3SJJ A;  3PY8 A;  3V9Z A;  3L2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...