4CJ5A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cj5A00
4FLUA 3AO4A 5HBMA 2D0AA 3DLKA 3AO2A 3RMCA 3NH0A 2W42A 3LP0A 4E7IA 1UA1A 3EZ5A 1EXQA 1BHLA 1ZBLA 4LH4A 1BL3A 4PY5A 4AHVA 1WSGA 3AA5X 2F96A 3DMJA 3ZSOA 1RBTA 4WE1A 4ID1A 2XY6A 1L3VA 2QKBA 4BACA 2YNHA 3S3OA 1IKYA 5J2MA 3LALA 2QK9A 1Q9YA 4RW7A 1NOZA 3KJVA 3VQ4A 4DQPA 4CJ5A 3SUOA 4MFBA 1A5XA 5K14A 4FLYA 1FK9A 4HTUA 2HNYA 3MECA 1XC9A 3HYFA 4Z4GA 3LDSA 1CZ9A 4YNQA 1NJXA 4AHRA 2FBVA 4Z4HA 1WAFA 1KLMA 4KHYA 2HHWA 2XRIA 3CYMA 4CFCA 2X6NA 3KLHA 3I8DA 4FM2A 4BDZA 4DFPA 1HNVA 4CJ4A 4IKFA 3AVNA 3CFOA 4DLGA 3UIQA 3QLHA 2OPSA 2RF2A 2Z1IA 1DLOA 1LW2A 1WSHA 4CHQA 3TABA 3U3YA 3PO5A 1WN7A 3KLFA 3NF9A 3DOKA 4OKKA 2QKKA 3D0PA 4AHCA 1EX4A 2YNGA 1HMVA 2XY5A 1R0AA 1KLNA 4CHNA 3TAEA 4FCYA 1LV5A 4DTPA 4DTOA 3AO1A 3H08A 3ZT1A 1ASVA 1JXBA 3L3VA 2DTUA 4N76A 2PYJA 4FJ8A 5DK5A 4CHZA 3TANA 1SL2A 1Q9XA 1KSPA 4C8OA 3JYTA 3QIPA 3QESA 1JLGA 3DOLA 3OYFA 1J9AA 3QERA 1NK5A 4N47A 4B8AB 3OYDA 3ULDA 1F21A 1BCMA 4FLTA 1NKCA 2OPPA 1D9DA 2HNDA 3NHGA 1S1UA 4H8KA 5KRSA 4Y1DA 4B9VA 3KK1A 4F8RA 5D3GA 1W9HA 1JLFA 2A1SA 3QINA 4AH9A 4IG0A 4I9LA 1JLCA 4CK1A 3SV3A 4KPYA 2KZMA 1HYZA 4KTZA 4CK3A 4CHOA 3RTVA 1RDDA 4QOZB 2OZSA 2E6MA 1ZBUA 2F8SA 4I2QA 4RW6A 4EP5A 4DFMA 5FRMA 2FBTA 3F73A 2IOCA 1I3AA 4OKEA 2KZZA 2PYLA 2ZD1A 1X9MA 3HVRA 1VRTA 1NK9A 3SZ2A 3OS0A 4ID5A 4KHWA 4CCHA 1HYVA 3QEWA 1YTAA 1IKXA 2KFNA 4KHUA 3C6UA 3D45A 3F9KA 4FK2A 3IS9A 1RBUA 1S5JA 2XY8A 3K5NA 4CIGA 1WSJA 1D8YA 3DI6A 3HO1A 2ZE2A 1HQEA 3O3GA 4DMNA 3HP6A 5CYQA 1U4BA 2DFHA 4E19A 2RKIA 4E1MA 3QEVA 5HROA 4FM0A 4FJXA 4FJNA 4IFYA 1KRPA 1T8EA 2ZQBA 3OYAA 3L2RA 4EZ6A 4FJJA 4NCGA 4W5RA 4B9SA 1U47A 3OVNA 3HM9A 1U45A 2DFFA 3OYCA 2XHBA 3M8QA 1SKSA 1L3UA 4HCBA 1RBRA 4LY7A 4E7KA 1QE1A 3MAQA 4B9NA 1WSIA 5C42A 3LAKA 3OJUA 4OVLA 3A2FA 1K6YA 3LANA 2JLEA 4CF1A 3OYHA 1UAXA 2OA8A 5T7BA 4L8RB 3TWHA 3KKSA 2IS3A 3ZSVA 4R5PA 1X1PA 2G8HA 1JXEA 3SCXA 3HPGA 4FW1A 1TAUA 2OPQA 3PY8A 1VSMA 3KLIA 2VWKA 1S9EA 4RW4A 4E1NA 2YHAA 4JRPA 1NKBA 1C0MA 3VQQA 4FJ7A 3AVBA 3IRXA 4FZXC 4DS5A 3HPOA 3RMDA 1KFSA 2FC0A 3SUNA 4JRQA 1RTJA 2BE2A 1X9SA 4OKJA 4J2BA 4AHTA 4CEBA 2GV9A 3CM6A 4O44A 4LD0A 3K57A 4HUEA 3RRGA 1ZBHA 1WLJA 4J2DA 2E4LA 4CJKA 1HRHA 3ASMA 3C95A 3CG7A 3L3UA 3AVJA 1B92A 1S1TA 4FZYA 1ITGA 1XI1A 3PO4A 1CLQA 3ITHA 3AV9A 2HHQA 1TL1A 2BGGA 5CY4A 4CEEA 3V9WA 4BE2A 4C8LA 4F2SA 1CXQA 3PV8A 3LPTA 4FLVA 4FM1A 5HP1A 3KKRA 4NCAA 4AILC 2HMIA 3OYBA 2D5RA 3ZSWA 1RILA 1RTIA 5FRNA 2QXFA 2Y1IA 2F8TA 3MEGA 4EP4A 1IKWA 4TSXA 1Z25A 4M3UA 3SJJA 1GOCA 1BI4A 2O4GA 2HHXA 4KB1A 2VG7A 4FW2A 3VA0A 3V1QA 4CK2A 1JLQA 1SL0A 3O4QA 4FJMA 4KI4A 1RT5A 4DQQA 5KGXA 1RDBA 4CESA 1DTQA 4G1QA 5HRNA 2B5JA 2RPIA 4PWDA 4KAZA 1JLEA 2KTQA 3M8SA 3KD5E 1YTUA 2HHUA 2D0CA 4IDKA 5J2NA 4B9MA 3IG1A 3MXIA 4FVMA 1JLAA 4CJLA 1HYSA 4N5SA 1QQCA 1NK7A 3LPUA 1HPZA 3ZCMA 1KVBA 4CJSA 4Z4IA 2HHTA 2A1RA 4BDYA 1VSHA 3K2PA 3KTQA 3SQ1A 3RMBA 4LH5A 4GMJB 4M41A 5FROA 3THVA 4DQIA 4FZZA 3OS1A 1KFDA 4M3WA 4OJRA 4RW9A 2LSNA 3AVGA 4O4GA 4CJEA 1VSFA 4PA1A 2G8IA 4DF4A 3SV4A 2EHGA 3ZT4A 3DLEA 1TK8A 5J2PA 1NK0A 3U3GA 4BE1A 4CECA 1UA0A 4FK0A 4OGCA 3M8RA 4KFBA 4CIEA 1IG9A 3QEIA 3TAPA 4B9TA 1ZBFA 2HHVA 1ASWA 3DRRA 3AVHA 4Q0BA 3NFAA 1VSJA 1BQNA 1LAWA 3NF6A 4CF2A 4FJ9A 4JLHA 4DSKA 2Y1JA 3NGZA 1DTTA 2Q3SA 3ZSQA 2X74A 2Z1JA 3SQ2A 2WOMA 4CGJA 3HK2A 1NJZA 1TL3A 1A5WA 2E6LA 4DTXA 2X6SA 3VQ5A 4DFKA 3AVAA 4CHYA 4J2EA 1U04A 1JL1A 2FBYA 3O3HA 3VQPA 2YV0X 3CM5A 3V9XA 4M42A 3VQ8A 4AHUA 4CHPA 4DU1A 2ITGA 3O4NA 5I3UA 1GOAA 3P1GA 5KTQA 2G8WA 1XHXA 4CEDA 1O1WA 3AVCA 3S3NA 4CEZA 1TGOA 3E01A 2AJQA 1TKDA 1L5UA 4CERA 3RRHA 2XY7A 4E7JA 1IKVA 3OS2A 1NJWA 3IAYA 1TK5A 1XWLA 4KHQA 4FK4A 1Y97A 3OYLA 4DTNA 2HW3A 2YHBA 3NGYA 3OYJA 3VQ9A 1BIZA 3M8PA 1VRUA 4ZTJA 5DMRA 2KQ2A 4IBNA 4O0JA 3AVLA 4DTMA 5EU7A 4C8NA 4KRFA 3VQ7A 2P5OA 3VQCA 3L8BA 3LZJA 4M3ZA 5CZ2A 2G8VA 1S1XA 2B4JA 4FJKA 4QAGA 5FDLA 4N41A 3AVKA 3K5MA 3VQDA 3WNFA 2ATQA 4GW6A 3L2UA 1TV6A 3TR8A 1RDAA 5KGWA 3L2QA 1S1VA 4CFBA 2P51A 2XO7A 3AA3A 2PY5A 1VSKA 1QSYA 3WNGA 2I5JA 4O0IA 2RN2A 1VSEA 4DSEA 1SKWA 3V1RA 3AVMA 1NK6A 3ZSYA 4PUOA 1RDCA 3PX4A 1JKHA 2Z1GA 1EKEA 4CJRA 4RG8A 4IG3A 3KK2A 1VSIA 4E0DA 3V81A 3SQ0A 1TKXA 3FFIA 3I0SA 3LP2A 2IAJA 4CJWA 1HQUA 2G8UA 1SV5A 4CJQA 3KIOA 3B6OA 3ZT2A 3OYIA 3RMAA 1KCFA 1KTQA 4DF8A 3RR7A 4FJGA 3AO3A 4K8ZA 3SUQA 3ISNC 1QSSA 1TKZA 2BANA 4CFDA 3NH2A 1UOCA 4O5BA 1GOBA 2HHSA 3QNNA 1Z26A 3OYNA 2KW4A 3I0RA 4FLWA 4C8MA 2HB5A 3OJSA 1C1CA 1S6QA 3K58A 3T19A 4EZ9A 4DTUA 1SL1A 1G15A 4W5QA 1LW0A 3V1OA 3TARA 4QCLA 1KVCA 2P1JA 1EETA 2YNIA 4B08A 4KTWA 4Z0UA 4CJFA 3LZIA 3HPHA 3L2WA 4F2RA 3AVFA 3ZSZA 4DFJA 1C1BA 4F3OA 2B6AA 4JS4A 1NK4A 3ZT0A 1TK0A 3OYKA 4I9QA 2BDPA 4C8KA 1J54A 3VQBA 4DLEA 1S6PA 5C24A 3CFPA 1BIUA 3DYAA 1RNHA 4UQGA 3L2VA 4CF0A 1D5AA 1MU2A 1UWBA 3QETA 3TAQA 4DQSA 2HVIA 4OPJA 3G10A 3P5JA 4KO0A 4N56A 1CZBA 3O3FA 4F4KA 2EX3A 5JS2A 1BGXT 4M3RA 4CEFA 3K59A 2VG5A 2Z1HA 1LAVA 5CZ1A 4CFAA 1YVUA 1VSDA 2YKNA 4RW8A 3SPZA 1VSLA 3CQ8A 4PQUA 3C94A 3BDPA 4IFVA 2JGUA 3DRSA 1C6VA 4FJHA 4NCBA 1QS4A 4CF9A 4E7LA 3TI0A 1LWFA 3WNEA 4HCCA 3C6TA 3HL8A 3P83D 1ZYQA 4CJ3A 2GBZA 4KREA 3ZSRA 4DS4A 1L3TA 2YNFA 4FLXA 1RCHA 4CF8A 3KLEA 1FKPA 1SKRA 3AA4A 3NH1A 1J53A 3HVTA 1RT1A 1ASUA 3OYEA 4DSJA 4I7FA 3MEDA 4AHSA 1TKTA 4CEQA 4JS5A 5JS1A 1RBVA 1FKOA 2YKMA 4OGEA 4E7HA 3G0ZA 4LSNA 2OPRA 4XIUA 3TAFA 2G8KA 3AA2A 1C0TA 3KLGA 1HNIA 4BWMA 4DWIA 4DTJA 3ZT3A 3LWMA 2IDOA 2IGIA 4KV8A 1C1AA 3VN5A 3MXMA 2ETJA 3PUFA 4H4OA 4DTRA 2OZMA 4B3OA 5KRTA 1CXUA 2DFEA 4HUFA 1NJYA 1X9WA 4Z4FA 4ELUA 4FXDA 2FBXA 3HP9A 4Z4CA 2OYQA 4Q5VA 2DY4A 4FJLA 1QTMA 4MQ3A 1NK8A 3PX6A 3QEPA 4W5TA 1Q8IA 1WAJA 1T05A 4M3TA 4E3SA 1WSFA 4BE0A 3LP3A 3EYZA 4K8XA 2R7YA 5C25A 1S9GA 5SWMA 5HLFA 1NKEA 4FJ5A 1RT2A 4M45A 1RT7A 4CJTA 1QSLA 2X78A 1REVA 4OLAA 3MEEA 4CE9A 4KI6A 3V9ZA 3NBPA 5E41A 4HVJA 3S9HA 1B9FA 2P5GA 4CGGA 1RT4A 4CIFA 2HVHA 1U48A 4CJVA 1NOYA 1TAQA 4ZTFA 1U49A 1IH7A 3OYGA 1IO2A 1JLBA 1WSEA 3ZSXA 1N6QA 4DSLA 1KVAA 3SPYA 4DQRA 3K5LA 1BI4B 4W5OA 4LSLA 3V9SA 2D0BA 1WNSA 1S1WA 2VWJA 1BQMA 4Y1CA 3T1AA 4CJUA 1JL2A 1ZBIA 5HRPA 1RTDA 3SI6A 2NUBA 1SUQA 1A5VA 3KK3A 4CGIA 4YFUA 1TVRA 4DSIA 4BDPA 4ELVA 3S3MA 3DLBA 3DLHA 5HRRA 5SZTA 3VA3A 4KHNA 3LWLA 4Z4EA 1W0HA 1C0UA 5J2QA 2IC3A 3PX0A 2G8FA 4FLZA 3HJFA 1I39A 3QEXA 4DU4A 2VG6A 4ELTA 2PZSA 4O55A 3QO9A 3RWUA 3DM2A 4OPKA 3B6PA 4KHSA 3LAMA 3VQAA 3TAMA 1XHZA 3NE6A 3NAEA 3V4IA 3DLRA 1B9DA 5I42A 4OLBA 1J5OA 3SUPA 4FJIA 3HT3A 3SQ4A 5HRSA 4DSFA 2HNZA 4CJPA 4E89A 1N5YA 4M3YA 4CEOA 3LP1A 1T7PA 1YT3A 3VQ6A 4B9LA 1VK0A 4KB0A 3CFRA 1RBSA 4M3XA 1BCOA 4KKOA 3HXMA 3AVIA 1RT3A 4F3TA 4DG1A 3NGIA 3NCIA 4BWJA 3QIOA 3SYZA 4NYFA 3BGRA 4W5NA 3QNOA 2O4IA 4GVMA 4ZHRA 3OYMA 4NYNA 1QHTA 4H4MA 4B9UA 4FYDA 1RT6A 3WNHA 3DRPA 2WONA 4I2PA 3OY9A 3DLGA 2KFZA 3MXJA 3NF7A 5KI6A 1L3SA 4ICLA 1HJRA 1LWEA 4CGDA 4B8CA 3SNNA 3KD1E 3AO5A 4J2AA 3V6DA 3K5OA 4DU3A 1BISA 4CGFA 1RTHA 3TAGA 1FXXA 3NF8A 4CGHA 3ALYA 3VQEA 5CYMA 3NDKA 1EP4A 1LWCA 4DTSA 2GUIA 3RR8A 5J1EA 3U6FA 4KTQA 1D9FA 3EY1A 3V9UA 1T03A 3JSMA 4HHTA 4CEAA 4HUGA 3HSTB 3T3FA
chains in the Genus database with same CATH superfamily
3AO4A 3MX5A 3O80A 5LJVA 3O9UA 3RMCA 3LP0A 4E7IA 3EZ5A 3L0QA 4AF1A 1RBTA 4WE1A 4ID1A 1L3VA 2QK9A 3TSUA 1GLFO 3SUOA 4ISGA 5K14A 1JCGA 4YOWA 3CD6N 2QWLA 4YDUC 2Q97A 3TTDA 4Z4GA 1CZ9A 4YNQA 4AHRA 3VEOA 1WAFA 5C2DA 4CFCA 3KLHA 1BA1A 4CJ4A 3A8YA 1OH5A 4IKFA 3FZMA 4DLGA 3CFOA 4JKDA 3CJAA 3QLHA 3PO5A 4LFBK 2D4WA 3D0PA 4AHCA 2YNGA 4CHNA 4FCYA 1MA9B 3H08A 1JXBA 2ZGYA 1NBWA 4DR6K 3M1FA 2HBJA 4BRIA 4CHZA 3TANA 2NNWA 1WBDA 3QIPA 2ASMA 4B8AB 1NKCA 2OPPA 2HNDA 3NHGA 1S1UA 5KRSA 3THWA 4BRHA 4F8RA 2NZTA 5D3GA 1N32K 1JLFA 4JK9A 4I9LA 4BRMA 2A3ZA 3M3ZA 4QOZB 1EWRA 2HOEA 5AQNA 3D2FA 4BRLA 3CC2N 1I3AA 5JLHA 2PYLA 2P9PB 3SZ2A 3OS0A 4ID5A 4NXMK 4CBXA 2RHKA 3ZEUB 3C6UA 1KAXA 3JXUA 1RDUA 3HO1A 4E1MA 4IFYA 5AFUA 4A5AA 4LC9B 4DV0K 3DXMB 1QQMA 3OVNA 3HM9A 4DV5K 1U47A 1L3UA 2QTDA 4E7KA 3HSCA 1NLVA 4OVLA 1K6YA 3LANA 2JLEA 2WFBA 3KKSA 3K0SA 4KBOA 3SCXA 4FW1A 3PY8A 1VSMA 2VWKA 2IVPA 4RW4A 3CCLN 4FJ7A 3VQQA 3CJ1A 3RMDA 2FC0A 2KKZA 3LDPA 2P9LA 1RTJA 3RSEB 5BREA 4JRQA 2BE2A 4B1ZA 4CBUA 5AQRA 1X9SA 3H46O 4LD0A 1ZBHA 1WLJA 2HBLA 3ASMA 3C95A 3L3UA 4FOEA 1S1TA 1CZAN 4MLEA 1XI1A 3VGKA 4H5TA 4YOTA 5CY4A 3WXLA 4F2SA 1CXQA 4FM1A 2A40A 3KKRA 4AILC 4K0KK 2F8TA 2ITMA 4M3UA 4BGBA 5EY4A 3PLAA 4BR9A 2O4GA 3CMAN 4FW2A 1SL0A 4FJMA 1RT5A 4NXNK 1RDBA 4EHTA 2FSNA 5BN8A 4KAZA 1JLEA 4JKAA 4B1WB 4ILHA 3KD5E 2D0CA 4IDKA 5J2NA 4B9MA 5AQIA 1HYSA 4N5SA 1QQCA 5GIPA 1HPZA 4CJSA 1NGBA 1QHAA 2HHTA 4YOYA 2A1RA 3KTQA 3RMBA 4LH5A 3H3OB 4M3WA 1KFDA 4O4GA 4UY8O 4PA1A 5DM6L 3ZT4A 2A5XA 3MDQA 3SV4A 5J2PA 5BRDA 3AARA 4IJNA 4CECA 1UA0A 4FK0A 3O8MA 4OGCA 1BUPA 3M8RA 4KFBA 1BG3A 1BDGA 3QEIA 1XUPO 1VQMN 2HHVA 1ASWA 5EXWA 1NGJA 1VQ8N 4WYBA 3NFAA 4CZGA 5FPMA 1YXQA 4FJ9A 1DTTA 3KVGA 3H45C 1NMNA 1TL3A 1A5WA 1Z6RA 3F5TA 1U04A 4H0YB 4CHPA 5I3UA 3J7YP 5KTQA 1O1WA 3AVCA 3S3NA 3EEQA 2AJQA 1TKDA 1VQ7N 3VGLA 3RRHA 2XY7A 3P38A 4FK4A 1Y97A 4I6MA 3OYJA 4H0PA 4X65K 4ZTJA 5DMRA 3FE1A 4IBNA 3C6AA 3LDNA 3VQCA 4B9QA 3LZJA 2YHXA 3CJCA 4G9ZA 4KH5A 3VQDA 3AGRA 4GW6A 3VF6A 3LL3A 1XNRK 4IWVA 1S1VA 1GLDG 2E2NA 2F9TA 2XO7A 1OH6A 2I5JA 2RN2A 1SKWA 5KPTA 3AVMA 2YX6A 3SQ0A 1TKXA 2P9UB 1N36K 2QA4N 5BPLA 1I94K 1SV5A 3B6OA 5DM7L 3THXB 4FJGA 4DF8A 3LDOA 2ZJQL 3CHWA 1QSSA 1TKZA 3NH2A 4O5BA 1GOBA 2O8DB 4JI6K 5M1NA 3VF2A 3VENA 5AQUA 1SL1A 4W5QA 3TARA 3FZHA 4WQ4A 3WXJA 4GV6A 2YNIA 4FPBA 1HX1A 2HW3A 2VQFK 3LZIA 4F2RA 4F3OA 2O8EA 4JS4A 1TK0A 2V52B 5GAGP 4C8KA 4DLEA 4YY3K 4DQSA 2W6KA 4OPJA 4BQZA 3P5JA 4CZLA 4F4KA 2EX3A 5JS2A 4EFHA 1KC8O 3K59A 3U9DA 1VSLA 3DRSA 5AZIB 1W2BM 4H5NA 3TI0A 3HL8A 1ZYQA 3P83D 1L3TA 2YNFA 1NJIO 1FKPA 1SKRA 3AA4A 4BRAA 3OYEA 4DSJA 4I7FA 3D6RA 1TKTA 4AHSA 3A0IX 4JS5A 4JK8A 4OGEA 5C15A 4E7HA 4PL7A 3AA2A 4A2AA 1HNIA 4DWIA 3ZT3A 1OVYA 4KV8A 1C1AA 4RCHA 3VERA 3PIOL 2ETJA 2HF3A 3PUFA 2OTJN 2DFEA 1NJYA 5LMNK 3CPEA 2QWNA 1HKGA 4Q5VA 4MQ3A 5KQDA 4E3SA 4FJ5A 5HLFA 2UUBK 5MLCQ 1U6ZA 1VQLN 4CE9A 2YJEA 1NWKA 1B9FA 1RT4A 1U48A 2WUSA 1U49A 5JMVA 1BOTO 1N6QA 3R9PA 1HJOA 4A5BA 1Q7YO 3KWIA 4DQRA 4WCEL 4JI3K 3QMLA 1ZBIA 2NUBA 2QWQA 2V7ZA 1A5VA 1YVNA 1XMQK 3DLHA 5HRRA 5SZTA 1ATSA 3LWLA 2O8CA 4Z4EA 5J2QA 3PX0A 2D0PA 4FLZA 5A2QO 1JCEA 4BRKA 3ZX3A 5FPDA 4M63C 2JWLA 3LAMA 4JKEA 3O9QA 4H5VA 4BRGA 1B9DA 3J7AP 1J5OA 3MX2A 5HRSA 2HNZA 3HI0A 1N5YA 1T7PA 3VGMA 3VQ6A 3IFRA 1VK0A 2VGNA 1BCOA 4BRCA 1ATRA 3NGIA 2FF3B 4H0OA 3ZX0A 4NYFA 2NRHA 1KQSM 1X3MA 1N34K 4BR4A 3WNHA 2Q31A 4B3RK 2WTUA 3NF7A 4CGDA 4B8CA 3AO5A 1YAGA 4DU3A 1BISA 4U67L 4WQ4C 3NF8A 3NDKA 1NGEA 3S41A 4DTSA 2GUIA 5J1EA 3V9UA 3H1VX 4B1XB 3JSMA 4JD2A 4E7JA 4FLUA 2UXDK 1MDUB 3AO2A 1NG9A 1K8KA 2KLAA 1EXQA 1BHLA 4FWQA 4K41A 2F96A 5FLXO 3LALA 2HSTA 1NOZA 3ENOA 3SLCA 2A41A 4IDHA 4JK7A 4CJ5A 2UUCK 1VQ5N 4MFBA 1YITN 1BO5O 1FK9A 5FPNA 3MECA 1YJNN 1XC9A 4O8KA 3LDSA 4PKHA 4Z4HA 3CYMA 4FM2A 4BDZA 3THYB 3I55N 3UIQA 2OPSA 1DLOA 4JI5K 3U3YA 4IO9L 3C6HA 4WFNL 1EX4A 1HMVA 1R0AA 1HKCA 3TAEA 2AP1A 1LV5A 3J8AA 3PSIA 1DGKN 5AQYA 2DTUA 4BQLA 1XQSC 5EOYA 4BRPA 2UUAK 2Q0RA 1SL2A 2BTFA 1Q9XA 3N4PA 3QESA 1JLGA 3DOLA 3OYFA 4MO5A 3QERA 3ENHA 5CE3A 3I33A 4FLTA 3OYDA 3ULDA 1F21A 3DXKA 1D9DA 4B9VA 5BRFA 3KK1A 1W9HA 4AH9A 4V19S 3G6EN 1JCFA 3D2EA 1RDDA 4FSVA 2OZSA 4BR0A 4BR5A 4I2QA 4EP5A 1DT9A 4DFMA 2FBTA 2IOCA 4PHTX 2ZD1A 4FWKA 1VRTA 5GIOA 3CCMN 1S3XA 4IZ9A 1YTAA 3D45A 3F9KA 1S5JA 2XY8A 5CR4A 4JI2K 3J81O 4MDBA 3O3GA 5CYQA 3QEVA 4EAHD 1EQYA 2P9IA 1KRPA 1QVFM 1YJ9N 4FJJA 3CETA 4W5RA 4B9SA 3NVMA 2GX9A 2DFFA 3OYCA 3M8QA 4HCBA 4LY7A 1VQ9N 3MAQA 1Y64A 2A42A 3JAMO 3OJUA 2O8FB 3N4QA 3QICA 3SAGA 1V4TA 3IMXA 5T7BA 3TWHA 4DV7K 2P9KA 3ZSVA 2G8HA 1JXEA 3HPGA 3WT0A 3AGKA 3KLIA 3CJ9A 4E1NA 5M1QA 4JRPA 4GVEA 4DV4K 3AVBA 1KFSA 3SUNA 5GINA 3WXMB 4OKJA 3ULEA 1KAZA 4CEBA 3K57A 1ZC6A 4HUEA 1HRHA 2QWOA 1D4XA 2BGGA 4CEEA 3V9WA 4C8LA 4FLVA 5HP1A 3H3NO 4NCAA 1RILA 2QXFA 4IXCA 3MEGA 1IKWA 1KAYA 4TSXA 1GOCA 4B3MK 1S22A 2E2OA 2OCEA 3VA0A 3V1QA 3ZETA 4KI4A 3O4QA 3CMEN 4B1UB 3VF4A 3P39A 1YHQN 4CESA 1DTQA 4Z94A 2B5JA 2RPIA 5AQMA 4LF7K 5BPNA 2KTQA 2FXUA 3CCQN 1JLAA 4CZIA 3KZBA 3O9TA 4Z4IA 1Q82O 4BDYA 1NGAA 3SQ1A 3QFUA 1K8AO 1QVGM 3WEEA 1VSFA 4MLHA 2EHGA 1TK8A 3U3GA 1BU6O 4BREA 2QW9A 5AQOA 1KD1O 1U2VA 5AQKA 4Q0BA 1BQNA 4JLHA 3ZSQA 3TTFA 4CGJA 5AZJA 3HK2A 1BA0A 1NJZA 2E6LA 3VTIA 3VQ5A 4JHDB 3AVAA 4DV2K 3O3HA 3VQPA 1S72N 3CM5A 4MDAA 3V9XA 3HBTA 1RFQA 4DU1A 1YUWA 2ITGA 3O4NA 1WB9A 2G8WA 4CEZA 1TGOA 5H1SQ 4BC2A 3CF5L 3PSFA 3OS2A 1NJWA 5LMUK 1TK5A 3IKMA 3AAQA 4FVUA 1BIZA 1N8RO 1VQKN 4DV1K 4IO8A 2KQ2A 5EVZA 5M1FA 3AVLA 5EU7A 3I8BA 4KRFA 3VQ7A 1KXPA 5CZ2A 1S1XA 4QAGA 5FDLA 4O8UA 1NGIA 3K5MA 3WNFA 2ATQA 3L2UA 1TV6A 3TR8A 2P51A 5TKYA 1VSKA 2WBNA 1QSYA 3WNGA 3CCUN 1IBMK 4O0IA 1VQNN 4DSEA 5JLFA 2FLOA 1RDCA 1JKHA 4DQ8A 4IG3A 3KK2A 1VSIA 1K9MO 3V81A 4JYAK 3FFIA 3U4LA 4NLCA 3RMAA 4H0TB 3P4IA 3RR7A 2CGKA 3AO3A 3T1HK 3SUQA 4CFDA 4EHUA 1Z26A 3OYNA 2ZWHA 4FLWA 4C8MA 3E66A 3KHYA 1S6QA 4YORA 1QQNA 1G15A 3V1OA 3LM2A 2OANA 3HOTA 2P1JA 4FWLA 3AVFA 3ZSZA 1YI2N 4OPHA 1NK4A 2NRWA 3ZT0A 4IEEA 3OYKA 3OHRA 2BDPA 4B1YB 1D5AA 1MU2A 2UXCK 3TAQA 2HVIA 4KO0A 4DR2K 5C10A 3QBWA 4CEFA 2Z1HA 2P9PA 1VSDA 4H5RA 4PQUA 3CQ8A 3C94A 3FR0A 3BDPA 4FJHA 2P9SB 3DJCA 3GOIA 2E2QA 3ZEUA 5E84A 1LWFA 1ATNA 4CJ3A 2GBZA 3FZKA 3GL1A 4CF8A 3KLEA 5I9EB 3GBTA 3NH1A 1ASUA 2D0OA 1IV0A 1FKOA 3DXMA 4XIUA 2P9NA 3TAFA 3ENBA 4BWMA 3LWMA 3L4IA 3ID6A 3FGUA 3R1XA 5KRTA 3EE9A 1CXUA 4GY2B 5HOOA 1X9WA 4BVOA 3HP9A 2E20A 3QEPA 4BE0A 4K8XA 3O5BA 5C25A 5AQHA 1JJ2M 1RT2A 4M45A 3RSEA 2X78A 2OTLN 3SJHA 1P90A 5AQSA 4KI6A 4QS7A 3V9ZA 4XH5A 4K25A 4CGGA 3TSQA 4ZTFA 4DR5K 3FZLA 5KPRA 1IO2A 3CCEN 3VEZA 3BZCA 4HTLA 4DSLA 1BI4B 4W5OA 4FWPA 4DUZK 4LSLA 3V9SA 2ZGZA 1WNSA 2VWJA 4CJUA 5HRPA 3SI6A 4BVPA 4FOIA 1TVRA 1VHXA 3S3MA 2G8FA 1EWQA 1M90O 3DWLA 2QEXN 4O55A 2GTDA 3IDHA 4OPKA 1XHZA 5TKWA 3VEVA 3HT3A 4CEOA 1XNQK 4M3XA 4JNEA 4KKOA 3JS6A 2QWMA 3NCIA 4BWJA 3VESA 4WFBL 2Q36A 4DUYK 4BGAA 2CGLA 1SAZA 4GVMA 4ZHRA 3OYMA 4NYNA 1QHTA 1RT6A 4AM7A 2KFZA 1LWEA 2KHOA 3V6DA 5AQFA 3VEYA 5ELZA 3LM9A 1FXXA 4CGHA 4IFEA 4C1NK 2V7YA 3U6FA 4KTQA 1D9FA 1NU0A 3HSTB 5ADXH 2VGMA 3QBXA 2D0AA 3DLKA 1IBLK 1UA1A 1T3VA 3VMFB 4LH4A 1BL3A 3AA5X 3ZSOA 1SS6A 4BACA 4RW7A 3F2KA 4IOXA 4FLYA 4A57A 4HTUA 2HNYA 1Z05A 2FBVA 3MCPA 4NLBA 1KLMA 4KHYA 2XRIA 4AM6A 4DFPA 3GE1A 1HNVA 3AVNA 3FZFA 3R8EA 3T7ZA 1LW2A 1WSHA 3TABA 3DAWA 1WN7A 3KLFA 1RDWX 4DHYA 3T1YK 4YOVA 2GWKA 3TSPA 4DTOA 3K9JA 3FFKB 1HNWK 3THXA 3CJ7A 2PYJA 4FJ8A 4C8OA 3JYTA 2O8DA 1NK5A 1J9AA 3BF3A 4N47A 4M3ZA 3ZYYX 4H8KA 4Y1DA 2A1SA 3QINA 2KZMA 3E9PA 5AJ3K 5JS1A 3SV3A 4KPYA 1LCUA 2HHHK 4KTZA 4CK3A 4CHOA 3RTVA 4JD2B 2F8SA 4RW6A 3SBTA 3F73A 2KZZA 1K8KB 1X9MA 3BEXA 4CCHA 4DB3A 1HYVA 3QEWA 1IKXA 2E88A 4KHUA 4FK2A 3K5NA 1RBUA 4X62K 1D8YA 1E4GT 2EWSA 3O1BA 4DMNA 5AZIA 1U4BA 4DCHA 4FJXA 4FM0A 5GAEP 3W0LA 1T8EA 4EZ6A 3OYAA 2E1YA 4NCGA 3UKRB 1O13A 1E4FT 4K43A 2XHBA 4B9NA 4BRDA 5M1OA 3KK7A 3LAKA 4CF1A 1UAXA 2OA8A 4R5PA 3UKUB 4IJAA 1TAUA 4QS9A 1DKGD 3SMSA 2OPQA 3F9MA 2GELA 3NMUA 4DR3K 1S9EA 2YHAA 4FZXC 4DS5A 2W40A 3ZX2A 3HPOA 3C7NB 3EO3A 3SAFA 4AHTA 2GV9A 4H03B 2HBKA 4IEIA 5E26A 3CCRN 3O9RA 4AQYK 1B92A 4FZYA 1ITGA 3ITHA 3AV9A 2HHQA 1TL1A 3TTCA 4BROA 4BE2A 3OBYA 3LPTA 2GUPA 3P31A 3PV8A 4B3SK 2HMIA 3OYBA 3ZSWA 5BRHA 1RTIA 4XEIA 2Y1IA 4A59A 4YHHK 4EP4A 3SJJA 3CCJN 4KB1A 2VG7A 3EE8A 4CK2A 2PFUA 1JLQA 3R3LA 4G1QA 3D7EO 5KPZA 3ATUA 4CI6A 3IG1A 3MN5A 4FVMA 4CJLA 4GKKK 4JKGB 1NK7A 3LPUA 4U7BA 3G25A 1FW6A 1VSHA 3K2PA 2H3GX 1SQKA 2P9IB 4FZZA 3OS1A 5BR8K 4OJRA 2LSNA 3AVGA 4CJEA 2G8IA 1NK0A 4CBWA 2V51B 4XH4A 4ILJA 3EKSA 1E3MA 4LF5K 5B8HA 2ZJPL 2F7TA 4CF2A 3NF6A 3CCSN 2E1ZA 2Y1JA 5AQGA 2Q3SA 3NGZA 5IWAK 2X74A 4DTXA 4BR2A 4DFKA 1YF5L 3M6GA 3BUZB 4CHYA 3SAHA 4A62A 2FBYA 1JL1A 3VOVA 4QS8A 1TYQA 4FWOA 4DR7K 4O5FA 3CQXA 1GOAA 3P1GA 2DPNA 1XHXA 2IVNA 4ISEA 1L5UA 4CERA 1IKVA 1XMOK 3CC7N 2A6AA 2FF6A 3OYLA 1TUUA 2JWKA 5C12A 2NRXA 5AQZA 3TPQA 1ZXOA 4B3TK 2B4JA 3O4WA 1VQ4N 1RDAA 3L2QA 4CFBA 2PBDA 2PY5A 1GLCG 2QWPA 3SBGA 2BUPA 1NGDA 1VSEA 4H0XB 3THYA 1NK6A 4CJRA 1EKEA 3WXIA 4RG8A 2IAJA 4CJWA 4FPAA 1WOQA 1KTQA 2QWRA 3K9KA 4E1JA 2WC9A 4R79A 1U2VB 4ISFA 1UOCA 2HHSA 4JI7K 4CZJA 3QNNA 1VAZA 2HB5A 2E8AA 1HNXK 3OJSA 4EZ9A 4DTUA 2IIRA 5AZJB 3THWB 1LW0A 3ID8A 4QCLA 4DKWA 4CD3A 2NRVA 4PUOA 4B08A 4KTWA 3OW2M 4X64K 4DFJA 1C1BA 2CH5A 2B6AA 2I7NA 3BF1A 3D2FB 1J54A 1S6PA 5C24A 3CFPA 1BIUA 1RNHA 4UQGA 1UWBA 3QETA 3O1WA 3O3FA 3R6MA 1BGXT 3E9LA 1LAVA 4CFAA 4KH4A 2YKNA 4RW8A 3SPZA 1NM1A 2JGUA 1C6VA 4NCBA 1GLAG 1QS4A 4JKCA 4CF9A 4E7LA 3WNEA 3C6TA 3ZSRA 4DS4A 4DR4K 4FLXA 1RCHA 3WUHA 2YHWA 3HVTA 3O08A 1RT1A 3A5MC 3O6WA 2UU9K 2O8BA 1YJWN 3VETA 2YKMA 2IVOA 1NMDA 3KLGA 3KWGA 4DTJA 4LF4K 4NO7A 5BPMA 3VN5A 2O8FA 4H4OA 2OZMA 2UXBK 1Q86O 4HUFA 4Z4FA 4ELUA 4EIAA 2FBXA 2NRZA 1H1VA 2P9LB 5C0YA 1QTMA 3PX6A 4M3TA 4W5TA 1T05A 1WSFA 3LP3A 3AY9A 3EYZA 1NKEA 4CZMA 3OBWA 1REVA 3MEEA 3NBPA 4JN4A 5E41A 4HVJA 2P5GA 5F0XA 2HVHA 4CIFA 1TAQA 3A5OC 4JEPA 1IH7A 3ZSXA 3H6EA 3L6QA 1HR0K 1KVAA 3SPYA 3A5LC 3VEXA 3MN6A 4Y1CA 1GLBG 1RTDA 4BG8A 2Q0UA 1SUQA 3KK3A 4DSIA 2J4RA 3OA9A 3DLBA 1TUYA 4LF9K 2GEMA 1C0UA 2VQEK 3HJFA 3EKUA 1I39A 3WXKA 3QEXA 3WQUA 3CERA 2VG6A 4ELTA 2PZSA 3RWUA 3DM2A 3MK6A 3VQAA 3NAEA 3DLRA 5I42A 4OLBA 3M5RA 3CXCM 3SUPA 3U8XA 4DSFA 4CJPA 4E89A 4M7YA 3LP1A 4KB0A 3CFRA 1RBSA 3H1QA 5GAHP 2P9NB 3AVIA 1RT3A 5JVHL 4CZKA 4DG1A 2FSKA 4H0VB 3SYZA 3BGRA 4W5NA 2QXLA 2NLXA 1NGHA 2O4IA 1K73O 4H4MA 4FYDA 3DRPA 1N33K 5C2FA 2WONA 5BN9A 3DLGA 3MXJA 5KI6A 1L3SA 1HJRA 4J2AA 5AQJA 4CGFA 1RTHA 3ALYA 5CYMA 4JHDA 3A5NC 2VYPA 4HHTA 4CEAA 4HUGA 1QZ5A 3T3FA 5HBMA 3NH0A 2W42A 2HBMA 4CD1A 1ZBLA 4I6MB 1OH7A 4PY5A 4AHVA 1WSGA 3DMJA 4GV3A 5ADXA 4GNIA 2XY6A 3BY5A 2QKBA 2YNHA 3S3OA 1IKYA 5J2MA 4JV5K 1X9JA 1C0GA 1Q9YA 3KJVA 3VQ4A 3TU5A 4DQPA 1ILYA 1OH8A 1A5XA 3HYFA 1NJXA 4BC3A 2HHWA 2X6NA 3I8DA 2I7PA 1HUXA 2HMPA 1OVQA 3MWPA 2RF2A 2Z1IA 3CPWM 4PKGA 4CHQA 1LOTB 3NF9A 3HTVA 3DOKA 1BWFO 4OKKA 2QKKA 3LDLA 2XY5A 1KLNA 1T6CA 2QI2A 4DTPA 1QQOA 3AO1A 3ZT1A 1ASVA 4OPAA 4JKBA 5AR0A 3L3VA 3MMVA 4L3QA 4BRQA 4N76A 1SZ2A 1IG8A 5DK5A 4CZHA 1KSPA 1WBBA 2O8EB 1HNZK 1BCMA 4CK1A 4IG0A 1JLCA 1HYZA 2ZJRL 4BR7A 2E6MA 2RE2A 1ZBUA 5AQPA 3ZLJA 5LL6Z 1W7AA 5FRMA 4BRNA 4HWIA 3ATVA 4OKEA 3HVRA 1NK9A 4FWRA 4KHWA 4JI8K 2KFNA 1OKJA 3IS9A 5AFUH 4JI1K 1WSJA 4CIGA 3VEWA 3MCAB 3DI6A 2ZE2A 1HQEA 3HP6A 2P9SA 3Q7CA 4BG9A 2DFHA 4E19A 2RKIA 5HROA 4FJNA 2ZQBA 4B1VA 3BP8A 3L2RA 1U45A 1SKSA 1RBRA 1QE1A 5GADP 1WSIA 1IJJA 3C0BA 5C42A 3A2FA 1G99A 4FO0A 5FPEA 3OYHA 4L8RB 4DV3K 2IS3A 1R59O 1X1PA 4J8FA 1WUAA 1NKBA 1C0MA 3CI5A 3IRXA 5CHIA 5BR9A 4CW7B 4J2BA 4WQ5A 3CM6A 4O44A 3U9ZA 3RRGA 1GLLO 4J2DA 2E4LA 2HF4A 4CJKA 3CG7A 3AVJA 3PO4A 1CLQA 3CIPA 5AQWA 4LFAK 4JI4K 3RVCA 1Q81O 1XC3A 2D5RA 5FRNA 1J6ZA 3HZ6A 1Z25A 1BI4A 2HHXA 5F2RA 2O8CB 4DQQA 5KGXA 5HRNA 4PWDA 5AQLA 3OTOK 3M8SA 1YTUA 4BRFA 2HHUA 3MXIA 3HRGA 3ZCMA 1KVBA 4GMJB 4M41A 5FROA 3THVA 4DQIA 1NGCA 3QB0A 4RW9A 4C23A 4DF4A 4BC5A 3DLEA 4CJ7A 4BE1A 4JI0K 2P9UA 4F9OA 4CIEA 5KQ8A 1IG9A 4WFAL 3TAPA 4B9TA 1ZBFA 3DRRA 3AVHA 1VSJA 1LAWA 2E2PA 3O9SA 1HKBA 4DSKA 3PIPL 2F9WA 2Z1JA 3SQ2A 2WOMA 3GG4A 1T6DA 2ASPA 2FSJA 2W6LA 2X6SA 2YHYA 5AQQA 4J2EA 2YV0X 4M42A 3VQ8A 4AHUA 3E1YA 3EZWA 4CEDA 3E01A 3QDKA 2Q1NA 5JVGL 4JKFA 3IAYA 1XWLA 4KHQA 3CJBA 4DTNA 2YHBA 3NGYA 3VQ9A 3NVKA 3M8PA 1VRUA 4O0JA 4PKIA 4DTMA 4C8NA 1ZBSA 2P5OA 3L8BA 3G4SN 2G8VA 4FJKA 3MN7A 4N41A 1YIJN 3AVKA 3I56N 4DV6K 4OX9K 5KGWA 3AA3A 4A2BA 4RTFD 3V1RA 3Q7BA 3UE5A 5M1PA 3ZSYA 4XH1A 3PX4A 2Z1GA 1V4SA 4E0DA 1GLEG 3I0SA 3LP2A 1T44A 1HQUA 2G8UA 4FL9A 4CJQA 3KIOA 4FWSA 4PL8A 3ZT2A 3OYIA 1EO1A 1QZ6A 3L4QA 1KCFA 4K8ZA 3ISNC 4FWMA 1C0FA 3HM8A 4JAXA 2BANA 4LF6K 3E9OA 2KW4A 3I0RA 1VQPN 4JKHA 4WQ5C 1C1CA 3K58A 2YI1A 3DXKB 3T19A 2ZM6K 1KVCA 3D2EB 1EETA 4Z0UA 4CJFA 3HPHA 3L2WA 3AAPA 4I9QA 1TYQB 2Q2RA 3VQBA 3DYAA 4ILGB 1FJGK 4OO1J 3L2VA 4CF0A 1DEJA 4IOAL 3G10A 4A61A 4N56A 4YOUA 1CZBA 2F4VK 4RWTA 3B8AX 3VPZA 4M3RA 2VG5A 5CZ1A 1YVUA 4MO4A 4IFVA 4CZEA 5LY3A 4HCCA 4YDUA 4KREA 4KHPK 1NGGA 1J53A 2BH1A 1MWKA 3MWTA 5HL7L 3MEDA 2QM1A 4CEQA 5LJWA 1RBVA 2ASOA 1ESVA 4WF9L 3UKRA 3G0ZA 4LSNA 2OPRA 5AQXA 4IOCL 2G8KA 4LF8K 2YJFA 1C0TA 2UYTA 2P9KB 2IDOA 2IGIA 1NNEA 3MXMA 1X3NA 3QFPA 4DTRA 4B3OA 4LFCK 3W3DA 3WQTA 3CC4N 3MN9A 3UKUA 3DLLL 2AA4A 4FXDA 4Z4CA 2OYQA 1HPMA 2CH6A 3CCVN 2DY4A 4FJLA 1NK8A 3ULEB 1Q8IA 1WAJA 2VCPA 1P8ZA 3LDQA 2R7YA 1S9GA 4FWNA 3VTHA 5SWMA 4NB4A 1RT7A 2VWBA 3C7NA 4CJTA 1QSLA 4OLAA 3S9HA 1M1KO 3FLCO 3SK3A 1RGIA 1HLUA 4H5WA 4CJVA 1NOYA 4M7XA 2NRTA 3OYGA 1VQ6N 1JLBA 3GDQA 3J80O 1WSEA 3K5LA 4C1NI 4YOXA 2D0BA 3ZETB 1S1WA 1BQMA 3T1AA 2GWJA 1JL2A 1GLJO 4CGIA 4YFUA 4BC4A 3EL2A 1Q18A 4X66K 3G71N 1J5EK 4BDPA 4ELVA 5IT9O 3SMPA 3VA3A 4KHNA 1W0HA 2NRRA 2IC3A 1NGFA 5F1XA 1IBKK 4DU4A 2E5LK 3QO9A 3B6PA 1VQON 4KHSA 4GKJK 4GV9A 3TAMA 3J7ZO 3WEEB 3NE6A 3IUCA 5AQTA 4JKGA 3V4IA 5AQVA 4K42A 2ZF5O 4FJIA 5JICA 3SQ4A 4M3YA 2YCHA 2O8BB 4B9LA 1YT3A 3C65A 3HXMA 3BZKA 4F3TA 3CQYA 3UB5A 3QIOA 2W41A 3EN9A 1W97L 3T69A 3QNOA 4CZFA 5EX5A 2PAVA 4B9UA 4I2PA 4Y0WA 5M1KA 3OY9A 4ICLA 3SNNA 3KD1E 1MWMA 4BY9C 2D1KA 3K5OA 4DR1K 3HOSA 3TAGA 3VQEA 2CGJA 1EP4A 1LWCA 4KH6A 3RR8A 3EY1A 1T03A 4CVNE
chains in the Genus database with same CATH topology
4FLUA 3AO4A 5HBMA 2D0AA 3DLKA 3AO2A 3RMCA 3NH0A 2W42A 3LP0A 4E7IA 1UA1A 3EZ5A 1EXQA 1BHLA 1ZBLA 4LH4A 1BL3A 4PY5A 4AHVA 1WSGA 3AA5X 2F96A 3DMJA 3ZSOA 1RBTA 4WE1A 4ID1A 2XY6A 1L3VA 2QKBA 4BACA 2YNHA 3S3OA 1IKYA 5J2MA 3LALA 2QK9A 1Q9YA 4RW7A 1NOZA 3KJVA 3VQ4A 4DQPA 4CJ5A 3SUOA 4MFBA 1A5XA 5K14A 4FLYA 1FK9A 4HTUA 2HNYA 3MECA 1XC9A 3HYFA 4Z4GA 3LDSA 1CZ9A 4YNQA 1NJXA 4AHRA 2FBVA 4Z4HA 1WAFA 1KLMA 4KHYA 2HHWA 2XRIA 3CYMA 4CFCA 2X6NA 3KLHA 3I8DA 4FM2A 4BDZA 4DFPA 1HNVA 4CJ4A 4IKFA 3AVNA 3CFOA 4DLGA 3UIQA 3QLHA 2OPSA 2RF2A 2Z1IA 1DLOA 1LW2A 1WSHA 4CHQA 3TABA 3U3YA 3PO5A 1WN7A 3KLFA 3NF9A 3DOKA 4OKKA 2QKKA 3D0PA 4AHCA 1EX4A 2YNGA 1HMVA 2XY5A 1R0AA 1KLNA 4CHNA 3TAEA 4FCYA 1LV5A 4DTPA 4DTOA 3AO1A 3H08A 3ZT1A 1ASVA 1JXBA 3L3VA 2DTUA 4N76A 2PYJA 4FJ8A 5DK5A 4CHZA 3TANA 1SL2A 1Q9XA 1KSPA 4C8OA 3JYTA 3QIPA 3QESA 1JLGA 3DOLA 3OYFA 1J9AA 3QERA 1NK5A 4N47A 4B8AB 3OYDA 3ULDA 1F21A 1BCMA 4FLTA 1NKCA 2OPPA 1D9DA 2HNDA 3NHGA 1S1UA 4H8KA 5KRSA 4Y1DA 4B9VA 3KK1A 4F8RA 5D3GA 1W9HA 1JLFA 2A1SA 3QINA 4AH9A 4IG0A 4I9LA 1JLCA 4CK1A 3SV3A 4KPYA 2KZMA 1HYZA 4KTZA 4CK3A 4CHOA 3RTVA 1RDDA 4QOZB 2OZSA 2E6MA 1ZBUA 2F8SA 4I2QA 4RW6A 4EP5A 4DFMA 5FRMA 2FBTA 3F73A 2IOCA 1I3AA 4OKEA 2KZZA 2PYLA 2ZD1A 1X9MA 3HVRA 1VRTA 1NK9A 3SZ2A 3OS0A 4ID5A 4KHWA 4CCHA 1HYVA 3QEWA 1YTAA 1IKXA 2KFNA 4KHUA 3C6UA 3D45A 3F9KA 4FK2A 3IS9A 1RBUA 1S5JA 2XY8A 3K5NA 4CIGA 1WSJA 1D8YA 3DI6A 3HO1A 2ZE2A 1HQEA 3O3GA 4DMNA 3HP6A 5CYQA 1U4BA 2DFHA 4E19A 2RKIA 4E1MA 3QEVA 5HROA 4FM0A 4FJXA 4FJNA 4IFYA 1KRPA 1T8EA 2ZQBA 3OYAA 3L2RA 4EZ6A 4FJJA 4NCGA 4W5RA 4B9SA 1U47A 3OVNA 3HM9A 1U45A 2DFFA 3OYCA 2XHBA 3M8QA 1SKSA 1L3UA 4HCBA 1RBRA 4LY7A 4E7KA 1QE1A 3MAQA 4B9NA 1WSIA 5C42A 3LAKA 3OJUA 4OVLA 3A2FA 1K6YA 3LANA 2JLEA 4CF1A 3OYHA 1UAXA 2OA8A 5T7BA 4L8RB 3TWHA 3KKSA 2IS3A 3ZSVA 4R5PA 1X1PA 2G8HA 1JXEA 3SCXA 3HPGA 4FW1A 1TAUA 2OPQA 3PY8A 1VSMA 3KLIA 2VWKA 1S9EA 4RW4A 4E1NA 2YHAA 4JRPA 1NKBA 1C0MA 3VQQA 4FJ7A 3AVBA 3IRXA 4FZXC 4DS5A 3HPOA 3RMDA 1KFSA 2FC0A 3SUNA 4JRQA 1RTJA 2BE2A 1X9SA 4OKJA 4J2BA 4AHTA 4CEBA 2GV9A 3CM6A 4O44A 4LD0A 3K57A 4HUEA 3RRGA 1ZBHA 1WLJA 4J2DA 2E4LA 4CJKA 1HRHA 3ASMA 3C95A 3CG7A 3L3UA 3AVJA 1B92A 1S1TA 4FZYA 1ITGA 1XI1A 3PO4A 1CLQA 3ITHA 3AV9A 2HHQA 1TL1A 2BGGA 5CY4A 4CEEA 3V9WA 4BE2A 4C8LA 4F2SA 1CXQA 3PV8A 3LPTA 4FLVA 4FM1A 5HP1A 3KKRA 4NCAA 4AILC 2HMIA 3OYBA 2D5RA 3ZSWA 1RILA 1RTIA 5FRNA 2QXFA 2Y1IA 2F8TA 3MEGA 4EP4A 1IKWA 4TSXA 1Z25A 4M3UA 3SJJA 1GOCA 1BI4A 2O4GA 2HHXA 4KB1A 2VG7A 4FW2A 3VA0A 3V1QA 4CK2A 1JLQA 1SL0A 3O4QA 4FJMA 4KI4A 1RT5A 4DQQA 5KGXA 1RDBA 4CESA 1DTQA 4G1QA 5HRNA 2B5JA 2RPIA 4PWDA 4KAZA 1JLEA 2KTQA 3M8SA 3KD5E 1YTUA 2HHUA 2D0CA 4IDKA 5J2NA 4B9MA 3IG1A 3MXIA 4FVMA 1JLAA 4CJLA 1HYSA 4N5SA 1QQCA 1NK7A 3LPUA 1HPZA 3ZCMA 1KVBA 4CJSA 4Z4IA 2HHTA 2A1RA 4BDYA 1VSHA 3K2PA 3KTQA 3SQ1A 3RMBA 4LH5A 4GMJB 4M41A 5FROA 3THVA 4DQIA 4FZZA 3OS1A 1KFDA 4M3WA 4OJRA 4RW9A 2LSNA 3AVGA 4O4GA 4CJEA 1VSFA 4PA1A 2G8IA 4DF4A 3SV4A 2EHGA 3ZT4A 3DLEA 1TK8A 5J2PA 1NK0A 3U3GA 4BE1A 4CECA 1UA0A 4FK0A 4OGCA 3M8RA 4KFBA 4CIEA 1IG9A 3QEIA 3TAPA 4B9TA 1ZBFA 2HHVA 1ASWA 3DRRA 3AVHA 4Q0BA 3NFAA 1VSJA 1BQNA 1LAWA 3NF6A 4CF2A 4FJ9A 4JLHA 4DSKA 2Y1JA 3NGZA 1DTTA 2Q3SA 3ZSQA 2X74A 2Z1JA 3SQ2A 2WOMA 4CGJA 3HK2A 1NJZA 1TL3A 1A5WA 2E6LA 4DTXA 2X6SA 3VQ5A 4DFKA 3AVAA 4CHYA 4J2EA 1U04A 1JL1A 2FBYA 3O3HA 3VQPA 2YV0X 3CM5A 3V9XA 4M42A 3VQ8A 4AHUA 4CHPA 4DU1A 2ITGA 3O4NA 5I3UA 1GOAA 3P1GA 5KTQA 2G8WA 1XHXA 4CEDA 1O1WA 3AVCA 3S3NA 4CEZA 1TGOA 3E01A 2AJQA 1TKDA 1L5UA 4CERA 3RRHA 2XY7A 4E7JA 1IKVA 3OS2A 1NJWA 3IAYA 1TK5A 1XWLA 4KHQA 4FK4A 1Y97A 3OYLA 4DTNA 2HW3A 2YHBA 3NGYA 3OYJA 3VQ9A 1BIZA 3M8PA 1VRUA 4ZTJA 5DMRA 2KQ2A 4IBNA 4O0JA 3AVLA 4DTMA 5EU7A 4C8NA 4KRFA 3VQ7A 2P5OA 3VQCA 3L8BA 3LZJA 4M3ZA 5CZ2A 2G8VA 1S1XA 2B4JA 4FJKA 4QAGA 5FDLA 4N41A 3AVKA 3K5MA 3VQDA 3WNFA 2ATQA 4GW6A 3L2UA 1TV6A 3TR8A 1RDAA 5KGWA 3L2QA 1S1VA 4CFBA 2P51A 2XO7A 3AA3A 2PY5A 1VSKA 1QSYA 3WNGA 2I5JA 4O0IA 2RN2A 1VSEA 4DSEA 1SKWA 3V1RA 3AVMA 1NK6A 3ZSYA 4PUOA 1RDCA 3PX4A 1JKHA 2Z1GA 1EKEA 4CJRA 4RG8A 4IG3A 3KK2A 1VSIA 4E0DA 3V81A 3SQ0A 1TKXA 3FFIA 3I0SA 3LP2A 2IAJA 4CJWA 1HQUA 2G8UA 1SV5A 4CJQA 3KIOA 3B6OA 3ZT2A 3OYIA 3RMAA 1KCFA 1KTQA 4DF8A 3RR7A 4FJGA 3AO3A 4K8ZA 3SUQA 3ISNC 1QSSA 1TKZA 2BANA 4CFDA 3NH2A 1UOCA 4O5BA 1GOBA 2HHSA 3QNNA 1Z26A 3OYNA 2KW4A 3I0RA 4FLWA 4C8MA 2HB5A 3OJSA 1C1CA 1S6QA 3K58A 3T19A 4EZ9A 4DTUA 1SL1A 1G15A 4W5QA 1LW0A 3V1OA 3TARA 4QCLA 1KVCA 2P1JA 1EETA 2YNIA 4B08A 4KTWA 4Z0UA 4CJFA 3LZIA 3HPHA 3L2WA 4F2RA 3AVFA 3ZSZA 4DFJA 1C1BA 4F3OA 2B6AA 4JS4A 1NK4A 3ZT0A 1TK0A 3OYKA 4I9QA 2BDPA 4C8KA 1J54A 3VQBA 4DLEA 1S6PA 5C24A 3CFPA 1BIUA 3DYAA 1RNHA 4UQGA 3L2VA 4CF0A 1D5AA 1MU2A 1UWBA 3QETA 3TAQA 4DQSA 2HVIA 4OPJA 3G10A 3P5JA 4KO0A 4N56A 1CZBA 3O3FA 4F4KA 2EX3A 5JS2A 1BGXT 4M3RA 4CEFA 3K59A 2VG5A 2Z1HA 1LAVA 5CZ1A 4CFAA 1YVUA 1VSDA 2YKNA 4RW8A 3SPZA 1VSLA 3CQ8A 4PQUA 3C94A 3BDPA 4IFVA 2JGUA 3DRSA 1C6VA 4FJHA 4NCBA 1QS4A 4CF9A 4E7LA 3TI0A 1LWFA 3WNEA 4HCCA 3C6TA 3HL8A 3P83D 1ZYQA 4CJ3A 2GBZA 4KREA 3ZSRA 4DS4A 1L3TA 2YNFA 4FLXA 1RCHA 4CF8A 3KLEA 1FKPA 1SKRA 3AA4A 3NH1A 1J53A 3HVTA 1RT1A 1ASUA 3OYEA 4DSJA 4I7FA 3MEDA 4AHSA 1TKTA 4CEQA 4JS5A 5JS1A 1RBVA 1FKOA 2YKMA 4OGEA 4E7HA 3G0ZA 4LSNA 2OPRA 4XIUA 3TAFA 2G8KA 3AA2A 1C0TA 3KLGA 1HNIA 4BWMA 4DWIA 4DTJA 3ZT3A 3LWMA 2IDOA 2IGIA 4KV8A 1C1AA 3VN5A 3MXMA 2ETJA 3PUFA 4H4OA 4DTRA 2OZMA 4B3OA 5KRTA 1CXUA 2DFEA 4HUFA 1NJYA 1X9WA 4Z4FA 4ELUA 4FXDA 2FBXA 3HP9A 4Z4CA 2OYQA 4Q5VA 2DY4A 4FJLA 1QTMA 4MQ3A 1NK8A 3PX6A 3QEPA 4W5TA 1Q8IA 1WAJA 1T05A 4M3TA 4E3SA 1WSFA 4BE0A 3LP3A 3EYZA 4K8XA 2R7YA 5C25A 1S9GA 5SWMA 5HLFA 1NKEA 4FJ5A 1RT2A 4M45A 1RT7A 4CJTA 1QSLA 2X78A 1REVA 4OLAA 3MEEA 4CE9A 4KI6A 3V9ZA 3NBPA 5E41A 4HVJA 3S9HA 1B9FA 2P5GA 4CGGA 1RT4A 4CIFA 2HVHA 1U48A 4CJVA 1NOYA 1TAQA 4ZTFA 1U49A 1IH7A 3OYGA 1IO2A 1JLBA 1WSEA 3ZSXA 1N6QA 4DSLA 1KVAA 3SPYA 4DQRA 3K5LA 1BI4B 4W5OA 4LSLA 3V9SA 2D0BA 1WNSA 1S1WA 2VWJA 1BQMA 4Y1CA 3T1AA 4CJUA 1JL2A 1ZBIA 5HRPA 1RTDA 3SI6A 2NUBA 1SUQA 1A5VA 3KK3A 4CGIA 4YFUA 1TVRA 4DSIA 4BDPA 4ELVA 3S3MA 3DLBA 3DLHA 5HRRA 5SZTA 3VA3A 4KHNA 3LWLA 4Z4EA 1W0HA 1C0UA 5J2QA 2IC3A 3PX0A 2G8FA 4FLZA 3HJFA 1I39A 3QEXA 4DU4A 2VG6A 4ELTA 2PZSA 4O55A 3QO9A 3RWUA 3DM2A 4OPKA 3B6PA 4KHSA 3LAMA 3VQAA 3TAMA 1XHZA 3NE6A 3NAEA 3V4IA 3DLRA 1B9DA 5I42A 4OLBA 1J5OA 3SUPA 4FJIA 3HT3A 3SQ4A 5HRSA 4DSFA 2HNZA 4CJPA 4E89A 1N5YA 4M3YA 4CEOA 3LP1A 1T7PA 1YT3A 3VQ6A 4B9LA 1VK0A 4KB0A 3CFRA 1RBSA 4M3XA 1BCOA 4KKOA 3HXMA 3AVIA 1RT3A 4F3TA 4DG1A 3NGIA 3NCIA 4BWJA 3QIOA 3SYZA 4NYFA 3BGRA 4W5NA 3QNOA 2O4IA 4GVMA 4ZHRA 3OYMA 4NYNA 1QHTA 4H4MA 4B9UA 4FYDA 1RT6A 3WNHA 3DRPA 2WONA 4I2PA 3OY9A 3DLGA 2KFZA 3MXJA 3NF7A 5KI6A 1L3SA 4ICLA 1HJRA 1LWEA 4CGDA 4B8CA 3SNNA 3KD1E 3AO5A 4J2AA 3V6DA 3K5OA 4DU3A 1BISA 4CGFA 1RTHA 3TAGA 1FXXA 3NF8A 4CGHA 3ALYA 3VQEA 5CYMA 3NDKA 1EP4A 1LWCA 4DTSA 2GUIA 3RR8A 5J1EA 3U6FA 4KTQA 1D9FA 3EY1A 3V9UA 1T03A 3JSMA 4HHTA 4CEAA 4HUGA 3HSTB 3T3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLU A;  3AO4 A;  5HBM A;  2D0A A;  3DLK A;  3AO2 A;  3RMC A;  3NH0 A;  2W42 A;  3LP0 A;  4E7I A;  1UA1 A;  3EZ5 A;  1EXQ A;  1BHL A;  1ZBL A;  4LH4 A;  1BL3 A;  4PY5 A;  4AHV A;  1WSG A;  3AA5 X;  2F96 A;  3DMJ A;  3ZSO A;  1RBT A;  4WE1 A;  4ID1 A;  2XY6 A;  1L3V A;  2QKB A;  4BAC A;  2YNH A;  3S3O A;  1IKY A;  5J2M A;  3LAL A;  2QK9 A;  1Q9Y A;  4RW7 A;  1NOZ A;  3KJV A;  3VQ4 A;  4DQP A;  4CJ5 A;  3SUO A;  4MFB A;  1A5X A;  5K14 A;  4FLY A;  1FK9 A;  4HTU A;  2HNY A;  3MEC A;  1XC9 A;  3HYF A;  4Z4G A;  3LDS A;  1CZ9 A;  4YNQ A;  1NJX A;  4AHR A;  2FBV A;  4Z4H A;  1WAF A;  1KLM A;  4KHY A;  2HHW A;  2XRI A;  3CYM A;  4CFC A;  2X6N A;  3KLH A;  3I8D A;  4FM2 A;  4BDZ A;  4DFP A;  1HNV A;  4CJ4 A;  4IKF A;  3AVN A;  3CFO A;  4DLG A;  3UIQ A;  3QLH A;  2OPS A;  2RF2 A;  2Z1I A;  1DLO A;  1LW2 A;  1WSH A;  4CHQ A;  3TAB A;  3U3Y A;  3PO5 A;  1WN7 A;  3KLF A;  3NF9 A;  3DOK A;  4OKK A;  2QKK A;  3D0P A;  4AHC A;  1EX4 A;  2YNG A;  1HMV A;  2XY5 A;  1R0A A;  1KLN A;  4CHN A;  3TAE A;  4FCY A;  1LV5 A;  4DTP A;  4DTO A;  3AO1 A;  3H08 A;  3ZT1 A;  1ASV A;  1JXB A;  3L3V A;  2DTU A;  4N76 A;  2PYJ A;  4FJ8 A;  5DK5 A;  4CHZ A;  3TAN A;  1SL2 A;  1Q9X A;  1KSP A;  4C8O A;  3JYT A;  3QIP A;  3QES A;  1JLG A;  3DOL A;  3OYF A;  1J9A A;  3QER A;  1NK5 A;  4N47 A;  4B8A B;  3OYD A;  3ULD A;  1F21 A;  1BCM A;  4FLT A;  1NKC A;  2OPP A;  1D9D A;  2HND A;  3NHG A;  1S1U A;  4H8K A;  5KRS A;  4Y1D A;  4B9V A;  3KK1 A;  4F8R A;  5D3G A;  1W9H A;  1JLF A;  2A1S A;  3QIN A;  4AH9 A;  4IG0 A;  4I9L A;  1JLC A;  4CK1 A;  3SV3 A;  4KPY A;  2KZM A;  1HYZ A;  4KTZ A;  4CK3 A;  4CHO A;  3RTV A;  1RDD A;  4QOZ B;  2OZS A;  2E6M A;  1ZBU A;  2F8S A;  4I2Q A;  4RW6 A;  4EP5 A;  4DFM A;  5FRM A;  2FBT A;  3F73 A;  2IOC A;  1I3A A;  4OKE A;  2KZZ A;  2PYL A;  2ZD1 A;  1X9M A;  3HVR A;  1VRT A;  1NK9 A;  3SZ2 A;  3OS0 A;  4ID5 A;  4KHW A;  4CCH A;  1HYV A;  3QEW A;  1YTA A;  1IKX A;  2KFN A;  4KHU A;  3C6U A;  3D45 A;  3F9K A;  4FK2 A;  3IS9 A;  1RBU A;  1S5J A;  2XY8 A;  3K5N A;  4CIG A;  1WSJ A;  1D8Y A;  3DI6 A;  3HO1 A;  2ZE2 A;  1HQE A;  3O3G A;  4DMN A;  3HP6 A;  5CYQ A;  1U4B A;  2DFH A;  4E19 A;  2RKI A;  4E1M A;  3QEV A;  5HRO A;  4FM0 A;  4FJX A;  4FJN A;  4IFY A;  1KRP A;  1T8E A;  2ZQB A;  3OYA A;  3L2R A;  4EZ6 A;  4FJJ A;  4NCG A;  4W5R A;  4B9S A;  1U47 A;  3OVN A;  3HM9 A;  1U45 A;  2DFF A;  3OYC A;  2XHB A;  3M8Q A;  1SKS A;  1L3U A;  4HCB A;  1RBR A;  4LY7 A;  4E7K A;  1QE1 A;  3MAQ A;  4B9N A;  1WSI A;  5C42 A;  3LAK A;  3OJU A;  4OVL A;  3A2F A;  1K6Y A;  3LAN A;  2JLE A;  4CF1 A;  3OYH A;  1UAX A;  2OA8 A;  5T7B A;  4L8R B;  3TWH A;  3KKS A;  2IS3 A;  3ZSV A;  4R5P A;  1X1P A;  2G8H A;  1JXE A;  3SCX A;  3HPG A;  4FW1 A;  1TAU A;  2OPQ A;  3PY8 A;  1VSM A;  3KLI A;  2VWK A;  1S9E A;  4RW4 A;  4E1N A;  2YHA A;  4JRP A;  1NKB A;  1C0M A;  3VQQ A;  4FJ7 A;  3AVB A;  3IRX A;  4FZX C;  4DS5 A;  3HPO A;  3RMD A;  1KFS A;  2FC0 A;  3SUN A;  4JRQ A;  1RTJ A;  2BE2 A;  1X9S A;  4OKJ A;  4J2B A;  4AHT A;  4CEB A;  2GV9 A;  3CM6 A;  4O44 A;  4LD0 A;  3K57 A;  4HUE A;  3RRG A;  1ZBH A;  1WLJ A;  4J2D A;  2E4L A;  4CJK A;  1HRH A;  3ASM A;  3C95 A;  3CG7 A;  3L3U A;  3AVJ A;  1B92 A;  1S1T A;  4FZY A;  1ITG A;  1XI1 A;  3PO4 A;  1CLQ A;  3ITH A;  3AV9 A;  2HHQ A;  1TL1 A;  2BGG A;  5CY4 A;  4CEE A;  3V9W A;  4BE2 A;  4C8L A;  4F2S A;  1CXQ A;  3PV8 A;  3LPT A;  4FLV A;  4FM1 A;  5HP1 A;  3KKR A;  4NCA A;  4AIL C;  2HMI A;  3OYB A;  2D5R A;  3ZSW A;  1RIL A;  1RTI A;  5FRN A;  2QXF A;  2Y1I A;  2F8T A;  3MEG A;  4EP4 A;  1IKW A;  4TSX A;  1Z25 A;  4M3U A;  3SJJ A;  1GOC A;  1BI4 A;  2O4G A;  2HHX A;  4KB1 A;  2VG7 A;  4FW2 A;  3VA0 A;  3V1Q A;  4CK2 A;  1JLQ A;  1SL0 A;  3O4Q A;  4FJM A;  4KI4 A;  1RT5 A;  4DQQ A;  5KGX A;  1RDB A;  4CES A;  1DTQ A;  4G1Q A;  5HRN A;  2B5J A;  2RPI A;  4PWD A;  4KAZ A;  1JLE A;  2KTQ A;  3M8S A;  3KD5 E;  1YTU A;  2HHU A;  2D0C A;  4IDK A;  5J2N A;  4B9M A;  3IG1 A;  3MXI A;  4FVM A;  1JLA A;  4CJL A;  1HYS A;  4N5S A;  1QQC A;  1NK7 A;  3LPU A;  1HPZ A;  3ZCM A;  1KVB A;  4CJS A;  4Z4I A;  2HHT A;  2A1R A;  4BDY A;  1VSH A;  3K2P A;  3KTQ A;  3SQ1 A;  3RMB A;  4LH5 A;  4GMJ B;  4M41 A;  5FRO A;  3THV A;  4DQI A;  4FZZ A;  3OS1 A;  1KFD A;  4M3W A;  4OJR A;  4RW9 A;  2LSN A;  3AVG A;  4O4G A;  4CJE A;  1VSF A;  4PA1 A;  2G8I A;  4DF4 A;  3SV4 A;  2EHG A;  3ZT4 A;  3DLE A;  1TK8 A;  5J2P A;  1NK0 A;  3U3G A;  4BE1 A;  4CEC A;  1UA0 A;  4FK0 A;  4OGC A;  3M8R A;  4KFB A;  4CIE A;  1IG9 A;  3QEI A;  3TAP A;  4B9T A;  1ZBF A;  2HHV A;  1ASW A;  3DRR A;  3AVH A;  4Q0B A;  3NFA A;  1VSJ A;  1BQN A;  1LAW A;  3NF6 A;  4CF2 A;  4FJ9 A;  4JLH A;  4DSK A;  2Y1J A;  3NGZ A;  1DTT A;  2Q3S A;  3ZSQ A;  2X74 A;  2Z1J A;  3SQ2 A;  2WOM A;  4CGJ A;  3HK2 A;  1NJZ A;  1TL3 A;  1A5W A;  2E6L A;  4DTX A;  2X6S A;  3VQ5 A;  4DFK A;  3AVA A;  4CHY A;  4J2E A;  1U04 A;  1JL1 A;  2FBY A;  3O3H A;  3VQP A;  2YV0 X;  3CM5 A;  3V9X A;  4M42 A;  3VQ8 A;  4AHU A;  4CHP A;  4DU1 A;  2ITG A;  3O4N A;  5I3U A;  1GOA A;  3P1G A;  5KTQ A;  2G8W A;  1XHX A;  4CED A;  1O1W A;  3AVC A;  3S3N A;  4CEZ A;  1TGO A;  3E01 A;  2AJQ A;  1TKD A;  1L5U A;  4CER A;  3RRH A;  2XY7 A;  4E7J A;  1IKV A;  3OS2 A;  1NJW A;  3IAY A;  1TK5 A;  1XWL A;  4KHQ A;  4FK4 A;  1Y97 A;  3OYL A;  4DTN A;  2HW3 A;  2YHB A;  3NGY A;  3OYJ A;  3VQ9 A;  1BIZ A;  3M8P A;  1VRU A;  4ZTJ A;  5DMR A;  2KQ2 A;  4IBN A;  4O0J A;  3AVL A;  4DTM A;  5EU7 A;  4C8N A;  4KRF A;  3VQ7 A;  2P5O A;  3VQC A;  3L8B A;  3LZJ A;  4M3Z A;  5CZ2 A;  2G8V A;  1S1X A;  2B4J A;  4FJK A;  4QAG A;  5FDL A;  4N41 A;  3AVK A;  3K5M A;  3VQD A;  3WNF A;  2ATQ A;  4GW6 A;  3L2U A;  1TV6 A;  3TR8 A;  1RDA A;  5KGW A;  3L2Q A;  1S1V A;  4CFB A;  2P51 A;  2XO7 A;  3AA3 A;  2PY5 A;  1VSK A;  1QSY A;  3WNG A;  2I5J A;  4O0I A;  2RN2 A;  1VSE A;  4DSE A;  1SKW A;  3V1R A;  3AVM A;  1NK6 A;  3ZSY A;  4PUO A;  1RDC A;  3PX4 A;  1JKH A;  2Z1G A;  1EKE A;  4CJR A;  4RG8 A;  4IG3 A;  3KK2 A;  1VSI A;  4E0D A;  3V81 A;  3SQ0 A;  1TKX A;  3FFI A;  3I0S A;  3LP2 A;  2IAJ A;  4CJW A;  1HQU A;  2G8U A;  1SV5 A;  4CJQ A;  3KIO A;  3B6O A;  3ZT2 A;  3OYI A;  3RMA A;  1KCF A;  1KTQ A;  4DF8 A;  3RR7 A;  4FJG A;  3AO3 A;  4K8Z A;  3SUQ A;  3ISN C;  1QSS A;  1TKZ A;  2BAN A;  4CFD A;  3NH2 A;  1UOC A;  4O5B A;  1GOB A;  2HHS A;  3QNN A;  1Z26 A;  3OYN A;  2KW4 A;  3I0R A;  4FLW A;  4C8M A;  2HB5 A;  3OJS A;  1C1C A;  1S6Q A;  3K58 A;  3T19 A;  4EZ9 A;  4DTU A;  1SL1 A;  1G15 A;  4W5Q A;  1LW0 A;  3V1O A;  3TAR A;  4QCL A;  1KVC A;  2P1J A;  1EET A;  2YNI A;  4B08 A;  4KTW A;  4Z0U A;  4CJF A;  3LZI A;  3HPH A;  3L2W A;  4F2R A;  3AVF A;  3ZSZ A;  4DFJ A;  1C1B A;  4F3O A;  2B6A A;  4JS4 A;  1NK4 A;  3ZT0 A;  1TK0 A;  3OYK A;  4I9Q A;  2BDP A;  4C8K A;  1J54 A;  3VQB A;  4DLE A;  1S6P A;  5C24 A;  3CFP A;  1BIU A;  3DYA A;  1RNH A;  4UQG A;  3L2V A;  4CF0 A;  1D5A A;  1MU2 A;  1UWB A;  3QET A;  3TAQ A;  4DQS A;  2HVI A;  4OPJ A;  3G10 A;  3P5J A;  4KO0 A;  4N56 A;  1CZB A;  3O3F A;  4F4K A;  2EX3 A;  5JS2 A;  1BGX T;  4M3R A;  4CEF A;  3K59 A;  2VG5 A;  2Z1H A;  1LAV A;  5CZ1 A;  4CFA A;  1YVU A;  1VSD A;  2YKN A;  4RW8 A;  3SPZ A;  1VSL A;  3CQ8 A;  4PQU A;  3C94 A;  3BDP A;  4IFV A;  2JGU A;  3DRS A;  1C6V A;  4FJH A;  4NCB A;  1QS4 A;  4CF9 A;  4E7L A;  3TI0 A;  1LWF A;  3WNE A;  4HCC A;  3C6T A;  3HL8 A;  3P83 D;  1ZYQ A;  4CJ3 A;  2GBZ A;  4KRE A;  3ZSR A;  4DS4 A;  1L3T A;  2YNF A;  4FLX A;  1RCH A;  4CF8 A;  3KLE A;  1FKP A;  1SKR A;  3AA4 A;  3NH1 A;  1J53 A;  3HVT A;  1RT1 A;  1ASU A;  3OYE A;  4DSJ A;  4I7F A;  3MED A;  4AHS A;  1TKT A;  4CEQ A;  4JS5 A;  5JS1 A;  1RBV A;  1FKO A;  2YKM A;  4OGE A;  4E7H A;  3G0Z A;  4LSN A;  2OPR A;  4XIU A;  3TAF A;  2G8K A;  3AA2 A;  1C0T A;  3KLG A;  1HNI A;  4BWM A;  4DWI A;  4DTJ A;  3ZT3 A;  3LWM A;  2IDO A;  2IGI A;  4KV8 A;  1C1A A;  3VN5 A;  3MXM A;  2ETJ A;  3PUF A;  4H4O A;  4DTR A;  2OZM A;  4B3O A;  5KRT A;  1CXU A;  2DFE A;  4HUF A;  1NJY A;  1X9W A;  4Z4F A;  4ELU A;  4FXD A;  2FBX A;  3HP9 A;  4Z4C A;  2OYQ A;  4Q5V A;  2DY4 A;  4FJL A;  1QTM A;  4MQ3 A;  1NK8 A;  3PX6 A;  3QEP A;  4W5T A;  1Q8I A;  1WAJ A;  1T05 A;  4M3T A;  4E3S A;  1WSF A;  4BE0 A;  3LP3 A;  3EYZ A;  4K8X A;  2R7Y A;  5C25 A;  1S9G A;  5SWM A;  5HLF A;  1NKE A;  4FJ5 A;  1RT2 A;  4M45 A;  1RT7 A;  4CJT A;  1QSL A;  2X78 A;  1REV A;  4OLA A;  3MEE A;  4CE9 A;  4KI6 A;  3V9Z A;  3NBP A;  5E41 A;  4HVJ A;  3S9H A;  1B9F A;  2P5G A;  4CGG A;  1RT4 A;  4CIF A;  2HVH A;  1U48 A;  4CJV A;  1NOY A;  1TAQ A;  4ZTF A;  1U49 A;  1IH7 A;  3OYG A;  1IO2 A;  1JLB A;  1WSE A;  3ZSX A;  1N6Q A;  4DSL A;  1KVA A;  3SPY A;  4DQR A;  3K5L A;  1BI4 B;  4W5O A;  4LSL A;  3V9S A;  2D0B A;  1WNS A;  1S1W A;  2VWJ A;  1BQM A;  4Y1C A;  3T1A A;  4CJU A;  1JL2 A;  1ZBI A;  5HRP A;  1RTD A;  3SI6 A;  2NUB A;  1SUQ A;  1A5V A;  3KK3 A;  4CGI A;  4YFU A;  1TVR A;  4DSI A;  4BDP A;  4ELV A;  3S3M A;  3DLB A;  3DLH A;  5HRR A;  5SZT A;  3VA3 A;  4KHN A;  3LWL A;  4Z4E A;  1W0H A;  1C0U A;  5J2Q A;  2IC3 A;  3PX0 A;  2G8F A;  4FLZ A;  3HJF A;  1I39 A;  3QEX A;  4DU4 A;  2VG6 A;  4ELT A;  2PZS A;  4O55 A;  3QO9 A;  3RWU A;  3DM2 A;  4OPK A;  3B6P A;  4KHS A;  3LAM A;  3VQA A;  3TAM A;  1XHZ A;  3NE6 A;  3NAE A;  3V4I A;  3DLR A;  1B9D A;  5I42 A;  4OLB A;  1J5O A;  3SUP A;  4FJI A;  3HT3 A;  3SQ4 A;  5HRS A;  4DSF A;  2HNZ A;  4CJP A;  4E89 A;  1N5Y A;  4M3Y A;  4CEO A;  3LP1 A;  1T7P A;  1YT3 A;  3VQ6 A;  4B9L A;  1VK0 A;  4KB0 A;  3CFR A;  1RBS A;  4M3X A;  1BCO A;  4KKO A;  3HXM A;  3AVI A;  1RT3 A;  4F3T A;  4DG1 A;  3NGI A;  3NCI A;  4BWJ A;  3QIO A;  3SYZ A;  4NYF A;  3BGR A;  4W5N A;  3QNO A;  2O4I A;  4GVM A;  4ZHR A;  3OYM A;  4NYN A;  1QHT A;  4H4M A;  4B9U A;  4FYD A;  1RT6 A;  3WNH A;  3DRP A;  2WON A;  4I2P A;  3OY9 A;  3DLG A;  2KFZ A;  3MXJ A;  3NF7 A;  5KI6 A;  1L3S A;  4ICL A;  1HJR A;  1LWE A;  4CGD A;  4B8C A;  3SNN A;  3KD1 E;  3AO5 A;  4J2A A;  3V6D A;  3K5O A;  4DU3 A;  1BIS A;  4CGF A;  1RTH A;  3TAG A;  1FXX A;  3NF8 A;  4CGH A;  3ALY A;  3VQE A;  5CYM A;  3NDK A;  1EP4 A;  1LWC A;  4DTS A;  2GUI A;  3RR8 A;  5J1E A;  3U6F A;  4KTQ A;  1D9F A;  3EY1 A;  3V9U A;  1T03 A;  3JSM A;  4HHT A;  4CEA A;  4HUG A;  3HST B;  3T3F A; 
#chains in the Genus database with same CATH topology
 3AO4 A;  3MX5 A;  3O80 A;  5LJV A;  3O9U A;  3RMC A;  3LP0 A;  4E7I A;  3EZ5 A;  3L0Q A;  4AF1 A;  1RBT A;  4WE1 A;  4ID1 A;  1L3V A;  2QK9 A;  3TSU A;  1GLF O;  3SUO A;  4ISG A;  5K14 A;  1JCG A;  4YOW A;  3CD6 N;  2QWL A;  4YDU C;  2Q97 A;  3TTD A;  4Z4G A;  1CZ9 A;  4YNQ A;  4AHR A;  3VEO A;  1WAF A;  5C2D A;  4CFC A;  3KLH A;  1BA1 A;  4CJ4 A;  3A8Y A;  1OH5 A;  4IKF A;  3FZM A;  4DLG A;  3CFO A;  4JKD A;  3CJA A;  3QLH A;  3PO5 A;  4LFB K;  2D4W A;  3D0P A;  4AHC A;  2YNG A;  4CHN A;  4FCY A;  1MA9 B;  3H08 A;  1JXB A;  2ZGY A;  1NBW A;  4DR6 K;  3M1F A;  2HBJ A;  4BRI A;  4CHZ A;  3TAN A;  2NNW A;  1WBD A;  3QIP A;  2ASM A;  4B8A B;  1NKC A;  2OPP A;  2HND A;  3NHG A;  1S1U A;  5KRS A;  3THW A;  4BRH A;  4F8R A;  2NZT A;  5D3G A;  1N32 K;  1JLF A;  4JK9 A;  4I9L A;  4BRM A;  2A3Z A;  3M3Z A;  4QOZ B;  1EWR A;  2HOE A;  5AQN A;  3D2F A;  4BRL A;  3CC2 N;  1I3A A;  5JLH A;  2PYL A;  2P9P B;  3SZ2 A;  3OS0 A;  4ID5 A;  4NXM K;  4CBX A;  2RHK A;  3ZEU B;  3C6U A;  1KAX A;  3JXU A;  1RDU A;  3HO1 A;  4E1M A;  4IFY A;  5AFU A;  4A5A A;  4LC9 B;  4DV0 K;  3DXM B;  1QQM A;  3OVN A;  3HM9 A;  4DV5 K;  1U47 A;  1L3U A;  2QTD A;  4E7K A;  3HSC A;  1NLV A;  4OVL A;  1K6Y A;  3LAN A;  2JLE A;  2WFB A;  3KKS A;  3K0S A;  4KBO A;  3SCX A;  4FW1 A;  3PY8 A;  1VSM A;  2VWK A;  2IVP A;  4RW4 A;  3CCL N;  4FJ7 A;  3VQQ A;  3CJ1 A;  3RMD A;  2FC0 A;  2KKZ A;  3LDP A;  2P9L A;  1RTJ A;  3RSE B;  5BRE A;  4JRQ A;  2BE2 A;  4B1Z A;  4CBU A;  5AQR A;  1X9S A;  3H46 O;  4LD0 A;  1ZBH A;  1WLJ A;  2HBL A;  3ASM A;  3C95 A;  3L3U A;  4FOE A;  1S1T A;  1CZA N;  4MLE A;  1XI1 A;  3VGK A;  4H5T A;  4YOT A;  5CY4 A;  3WXL A;  4F2S A;  1CXQ A;  4FM1 A;  2A40 A;  3KKR A;  4AIL C;  4K0K K;  2F8T A;  2ITM A;  4M3U A;  4BGB A;  5EY4 A;  3PLA A;  4BR9 A;  2O4G A;  3CMA N;  4FW2 A;  1SL0 A;  4FJM A;  1RT5 A;  4NXN K;  1RDB A;  4EHT A;  2FSN A;  5BN8 A;  4KAZ A;  1JLE A;  4JKA A;  4B1W B;  4ILH A;  3KD5 E;  2D0C A;  4IDK A;  5J2N A;  4B9M A;  5AQI A;  1HYS A;  4N5S A;  1QQC A;  5GIP A;  1HPZ A;  4CJS A;  1NGB A;  1QHA A;  2HHT A;  4YOY A;  2A1R A;  3KTQ A;  3RMB A;  4LH5 A;  3H3O B;  4M3W A;  1KFD A;  4O4G A;  4UY8 O;  4PA1 A;  5DM6 L;  3ZT4 A;  2A5X A;  3MDQ A;  3SV4 A;  5J2P A;  5BRD A;  3AAR A;  4IJN A;  4CEC A;  1UA0 A;  4FK0 A;  3O8M A;  4OGC A;  1BUP A;  3M8R A;  4KFB A;  1BG3 A;  1BDG A;  3QEI A;  1XUP O;  1VQM N;  2HHV A;  1ASW A;  5EXW A;  1NGJ A;  1VQ8 N;  4WYB A;  3NFA A;  4CZG A;  5FPM A;  1YXQ A;  4FJ9 A;  1DTT A;  3KVG A;  3H45 C;  1NMN A;  1TL3 A;  1A5W A;  1Z6R A;  3F5T A;  1U04 A;  4H0Y B;  4CHP A;  5I3U A;  3J7Y P;  5KTQ A;  1O1W A;  3AVC A;  3S3N A;  3EEQ A;  2AJQ A;  1TKD A;  1VQ7 N;  3VGL A;  3RRH A;  2XY7 A;  3P38 A;  4FK4 A;  1Y97 A;  4I6M A;  3OYJ A;  4H0P A;  4X65 K;  4ZTJ A;  5DMR A;  3FE1 A;  4IBN A;  3C6A A;  3LDN A;  3VQC A;  4B9Q A;  3LZJ A;  2YHX A;  3CJC A;  4G9Z A;  4KH5 A;  3VQD A;  3AGR A;  4GW6 A;  3VF6 A;  3LL3 A;  1XNR K;  4IWV A;  1S1V A;  1GLD G;  2E2N A;  2F9T A;  2XO7 A;  1OH6 A;  2I5J A;  2RN2 A;  1SKW A;  5KPT A;  3AVM A;  2YX6 A;  3SQ0 A;  1TKX A;  2P9U B;  1N36 K;  2QA4 N;  5BPL A;  1I94 K;  1SV5 A;  3B6O A;  5DM7 L;  3THX B;  4FJG A;  4DF8 A;  3LDO A;  2ZJQ L;  3CHW A;  1QSS A;  1TKZ A;  3NH2 A;  4O5B A;  1GOB A;  2O8D B;  4JI6 K;  5M1N A;  3VF2 A;  3VEN A;  5AQU A;  1SL1 A;  4W5Q A;  3TAR A;  3FZH A;  4WQ4 A;  3WXJ A;  4GV6 A;  2YNI A;  4FPB A;  1HX1 A;  2HW3 A;  2VQF K;  3LZI A;  4F2R A;  4F3O A;  2O8E A;  4JS4 A;  1TK0 A;  2V52 B;  5GAG P;  4C8K A;  4DLE A;  4YY3 K;  4DQS A;  2W6K A;  4OPJ A;  4BQZ A;  3P5J A;  4CZL A;  4F4K A;  2EX3 A;  5JS2 A;  4EFH A;  1KC8 O;  3K59 A;  3U9D A;  1VSL A;  3DRS A;  5AZI B;  1W2B M;  4H5N A;  3TI0 A;  3HL8 A;  1ZYQ A;  3P83 D;  1L3T A;  2YNF A;  1NJI O;  1FKP A;  1SKR A;  3AA4 A;  4BRA A;  3OYE A;  4DSJ A;  4I7F A;  3D6R A;  1TKT A;  4AHS A;  3A0I X;  4JS5 A;  4JK8 A;  4OGE A;  5C15 A;  4E7H A;  4PL7 A;  3AA2 A;  4A2A A;  1HNI A;  4DWI A;  3ZT3 A;  1OVY A;  4KV8 A;  1C1A A;  4RCH A;  3VER A;  3PIO L;  2ETJ A;  2HF3 A;  3PUF A;  2OTJ N;  2DFE A;  1NJY A;  5LMN K;  3CPE A;  2QWN A;  1HKG A;  4Q5V A;  4MQ3 A;  5KQD A;  4E3S A;  4FJ5 A;  5HLF A;  2UUB K;  5MLC Q;  1U6Z A;  1VQL N;  4CE9 A;  2YJE A;  1NWK A;  1B9F A;  1RT4 A;  1U48 A;  2WUS A;  1U49 A;  5JMV A;  1BOT O;  1N6Q A;  3R9P A;  1HJO A;  4A5B A;  1Q7Y O;  3KWI A;  4DQR A;  4WCE L;  4JI3 K;  3QML A;  1ZBI A;  2NUB A;  2QWQ A;  2V7Z A;  1A5V A;  1YVN A;  1XMQ K;  3DLH A;  5HRR A;  5SZT A;  1ATS A;  3LWL A;  2O8C A;  4Z4E A;  5J2Q A;  3PX0 A;  2D0P A;  4FLZ A;  5A2Q O;  1JCE A;  4BRK A;  3ZX3 A;  5FPD A;  4M63 C;  2JWL A;  3LAM A;  4JKE A;  3O9Q A;  4H5V A;  4BRG A;  1B9D A;  3J7A P;  1J5O A;  3MX2 A;  5HRS A;  2HNZ A;  3HI0 A;  1N5Y A;  1T7P A;  3VGM A;  3VQ6 A;  3IFR A;  1VK0 A;  2VGN A;  1BCO A;  4BRC A;  1ATR A;  3NGI A;  2FF3 B;  4H0O A;  3ZX0 A;  4NYF A;  2NRH A;  1KQS M;  1X3M A;  1N34 K;  4BR4 A;  3WNH A;  2Q31 A;  4B3R K;  2WTU A;  3NF7 A;  4CGD A;  4B8C A;  3AO5 A;  1YAG A;  4DU3 A;  1BIS A;  4U67 L;  4WQ4 C;  3NF8 A;  3NDK A;  1NGE A;  3S41 A;  4DTS A;  2GUI A;  5J1E A;  3V9U A;  3H1V X;  4B1X B;  3JSM A;  4JD2 A;  4E7J A;  4FLU A;  2UXD K;  1MDU B;  3AO2 A;  1NG9 A;  1K8K A;  2KLA A;  1EXQ A;  1BHL A;  4FWQ A;  4K41 A;  2F96 A;  5FLX O;  3LAL A;  2HST A;  1NOZ A;  3ENO A;  3SLC A;  2A41 A;  4IDH A;  4JK7 A;  4CJ5 A;  2UUC K;  1VQ5 N;  4MFB A;  1YIT N;  1BO5 O;  1FK9 A;  5FPN A;  3MEC A;  1YJN N;  1XC9 A;  4O8K A;  3LDS A;  4PKH A;  4Z4H A;  3CYM A;  4FM2 A;  4BDZ A;  3THY B;  3I55 N;  3UIQ A;  2OPS A;  1DLO A;  4JI5 K;  3U3Y A;  4IO9 L;  3C6H A;  4WFN L;  1EX4 A;  1HMV A;  1R0A A;  1HKC A;  3TAE A;  2AP1 A;  1LV5 A;  3J8A A;  3PSI A;  1DGK N;  5AQY A;  2DTU A;  4BQL A;  1XQS C;  5EOY A;  4BRP A;  2UUA K;  2Q0R A;  1SL2 A;  2BTF A;  1Q9X A;  3N4P A;  3QES A;  1JLG A;  3DOL A;  3OYF A;  4MO5 A;  3QER A;  3ENH A;  5CE3 A;  3I33 A;  4FLT A;  3OYD A;  3ULD A;  1F21 A;  3DXK A;  1D9D A;  4B9V A;  5BRF A;  3KK1 A;  1W9H A;  4AH9 A;  4V19 S;  3G6E N;  1JCF A;  3D2E A;  1RDD A;  4FSV A;  2OZS A;  4BR0 A;  4BR5 A;  4I2Q A;  4EP5 A;  1DT9 A;  4DFM A;  2FBT A;  2IOC A;  4PHT X;  2ZD1 A;  4FWK A;  1VRT A;  5GIO A;  3CCM N;  1S3X A;  4IZ9 A;  1YTA A;  3D45 A;  3F9K A;  1S5J A;  2XY8 A;  5CR4 A;  4JI2 K;  3J81 O;  4MDB A;  3O3G A;  5CYQ A;  3QEV A;  4EAH D;  1EQY A;  2P9I A;  1KRP A;  1QVF M;  1YJ9 N;  4FJJ A;  3CET A;  4W5R A;  4B9S A;  3NVM A;  2GX9 A;  2DFF A;  3OYC A;  3M8Q A;  4HCB A;  4LY7 A;  1VQ9 N;  3MAQ A;  1Y64 A;  2A42 A;  3JAM O;  3OJU A;  2O8F B;  3N4Q A;  3QIC A;  3SAG A;  1V4T A;  3IMX A;  5T7B A;  3TWH A;  4DV7 K;  2P9K A;  3ZSV A;  2G8H A;  1JXE A;  3HPG A;  3WT0 A;  3AGK A;  3KLI A;  3CJ9 A;  4E1N A;  5M1Q A;  4JRP A;  4GVE A;  4DV4 K;  3AVB A;  1KFS A;  3SUN A;  5GIN A;  3WXM B;  4OKJ A;  3ULE A;  1KAZ A;  4CEB A;  3K57 A;  1ZC6 A;  4HUE A;  1HRH A;  2QWO A;  1D4X A;  2BGG A;  4CEE A;  3V9W A;  4C8L A;  4FLV A;  5HP1 A;  3H3N O;  4NCA A;  1RIL A;  2QXF A;  4IXC A;  3MEG A;  1IKW A;  1KAY A;  4TSX A;  1GOC A;  4B3M K;  1S22 A;  2E2O A;  2OCE A;  3VA0 A;  3V1Q A;  3ZET A;  4KI4 A;  3O4Q A;  3CME N;  4B1U B;  3VF4 A;  3P39 A;  1YHQ N;  4CES A;  1DTQ A;  4Z94 A;  2B5J A;  2RPI A;  5AQM A;  4LF7 K;  5BPN A;  2KTQ A;  2FXU A;  3CCQ N;  1JLA A;  4CZI A;  3KZB A;  3O9T A;  4Z4I A;  1Q82 O;  4BDY A;  1NGA A;  3SQ1 A;  3QFU A;  1K8A O;  1QVG M;  3WEE A;  1VSF A;  4MLH A;  2EHG A;  1TK8 A;  3U3G A;  1BU6 O;  4BRE A;  2QW9 A;  5AQO A;  1KD1 O;  1U2V A;  5AQK A;  4Q0B A;  1BQN A;  4JLH A;  3ZSQ A;  3TTF A;  4CGJ A;  5AZJ A;  3HK2 A;  1BA0 A;  1NJZ A;  2E6L A;  3VTI A;  3VQ5 A;  4JHD B;  3AVA A;  4DV2 K;  3O3H A;  3VQP A;  1S72 N;  3CM5 A;  4MDA A;  3V9X A;  3HBT A;  1RFQ A;  4DU1 A;  1YUW A;  2ITG A;  3O4N A;  1WB9 A;  2G8W A;  4CEZ A;  1TGO A;  5H1S Q;  4BC2 A;  3CF5 L;  3PSF A;  3OS2 A;  1NJW A;  5LMU K;  1TK5 A;  3IKM A;  3AAQ A;  4FVU A;  1BIZ A;  1N8R O;  1VQK N;  4DV1 K;  4IO8 A;  2KQ2 A;  5EVZ A;  5M1F A;  3AVL A;  5EU7 A;  3I8B A;  4KRF A;  3VQ7 A;  1KXP A;  5CZ2 A;  1S1X A;  4QAG A;  5FDL A;  4O8U A;  1NGI A;  3K5M A;  3WNF A;  2ATQ A;  3L2U A;  1TV6 A;  3TR8 A;  2P51 A;  5TKY A;  1VSK A;  2WBN A;  1QSY A;  3WNG A;  3CCU N;  1IBM K;  4O0I A;  1VQN N;  4DSE A;  5JLF A;  2FLO A;  1RDC A;  1JKH A;  4DQ8 A;  4IG3 A;  3KK2 A;  1VSI A;  1K9M O;  3V81 A;  4JYA K;  3FFI A;  3U4L A;  4NLC A;  3RMA A;  4H0T B;  3P4I A;  3RR7 A;  2CGK A;  3AO3 A;  3T1H K;  3SUQ A;  4CFD A;  4EHU A;  1Z26 A;  3OYN A;  2ZWH A;  4FLW A;  4C8M A;  3E66 A;  3KHY A;  1S6Q A;  4YOR A;  1QQN A;  1G15 A;  3V1O A;  3LM2 A;  2OAN A;  3HOT A;  2P1J A;  4FWL A;  3AVF A;  3ZSZ A;  1YI2 N;  4OPH A;  1NK4 A;  2NRW A;  3ZT0 A;  4IEE A;  3OYK A;  3OHR A;  2BDP A;  4B1Y B;  1D5A A;  1MU2 A;  2UXC K;  3TAQ A;  2HVI A;  4KO0 A;  4DR2 K;  5C10 A;  3QBW A;  4CEF A;  2Z1H A;  2P9P A;  1VSD A;  4H5R A;  4PQU A;  3CQ8 A;  3C94 A;  3FR0 A;  3BDP A;  4FJH A;  2P9S B;  3DJC A;  3GOI A;  2E2Q A;  3ZEU A;  5E84 A;  1LWF A;  1ATN A;  4CJ3 A;  2GBZ A;  3FZK A;  3GL1 A;  4CF8 A;  3KLE A;  5I9E B;  3GBT A;  3NH1 A;  1ASU A;  2D0O A;  1IV0 A;  1FKO A;  3DXM A;  4XIU A;  2P9N A;  3TAF A;  3ENB A;  4BWM A;  3LWM A;  3L4I A;  3ID6 A;  3FGU A;  3R1X A;  5KRT A;  3EE9 A;  1CXU A;  4GY2 B;  5HOO A;  1X9W A;  4BVO A;  3HP9 A;  2E20 A;  3QEP A;  4BE0 A;  4K8X A;  3O5B A;  5C25 A;  5AQH A;  1JJ2 M;  1RT2 A;  4M45 A;  3RSE A;  2X78 A;  2OTL N;  3SJH A;  1P90 A;  5AQS A;  4KI6 A;  4QS7 A;  3V9Z A;  4XH5 A;  4K25 A;  4CGG A;  3TSQ A;  4ZTF A;  4DR5 K;  3FZL A;  5KPR A;  1IO2 A;  3CCE N;  3VEZ A;  3BZC A;  4HTL A;  4DSL A;  1BI4 B;  4W5O A;  4FWP A;  4DUZ K;  4LSL A;  3V9S A;  2ZGZ A;  1WNS A;  2VWJ A;  4CJU A;  5HRP A;  3SI6 A;  4BVP A;  4FOI A;  1TVR A;  1VHX A;  3S3M A;  2G8F A;  1EWQ A;  1M90 O;  3DWL A;  2QEX N;  4O55 A;  2GTD A;  3IDH A;  4OPK A;  1XHZ A;  5TKW A;  3VEV A;  3HT3 A;  4CEO A;  1XNQ K;  4M3X A;  4JNE A;  4KKO A;  3JS6 A;  2QWM A;  3NCI A;  4BWJ A;  3VES A;  4WFB L;  2Q36 A;  4DUY K;  4BGA A;  2CGL A;  1SAZ A;  4GVM A;  4ZHR A;  3OYM A;  4NYN A;  1QHT A;  1RT6 A;  4AM7 A;  2KFZ A;  1LWE A;  2KHO A;  3V6D A;  5AQF A;  3VEY A;  5ELZ A;  3LM9 A;  1FXX A;  4CGH A;  4IFE A;  4C1N K;  2V7Y A;  3U6F A;  4KTQ A;  1D9F A;  1NU0 A;  3HST B;  5ADX H;  2VGM A;  3QBX A;  2D0A A;  3DLK A;  1IBL K;  1UA1 A;  1T3V A;  3VMF B;  4LH4 A;  1BL3 A;  3AA5 X;  3ZSO A;  1SS6 A;  4BAC A;  4RW7 A;  3F2K A;  4IOX A;  4FLY A;  4A57 A;  4HTU A;  2HNY A;  1Z05 A;  2FBV A;  3MCP A;  4NLB A;  1KLM A;  4KHY A;  2XRI A;  4AM6 A;  4DFP A;  3GE1 A;  1HNV A;  3AVN A;  3FZF A;  3R8E A;  3T7Z A;  1LW2 A;  1WSH A;  3TAB A;  3DAW A;  1WN7 A;  3KLF A;  1RDW X;  4DHY A;  3T1Y K;  4YOV A;  2GWK A;  3TSP A;  4DTO A;  3K9J A;  3FFK B;  1HNW K;  3THX A;  3CJ7 A;  2PYJ A;  4FJ8 A;  4C8O A;  3JYT A;  2O8D A;  1NK5 A;  1J9A A;  3BF3 A;  4N47 A;  4M3Z A;  3ZYY X;  4H8K A;  4Y1D A;  2A1S A;  3QIN A;  2KZM A;  3E9P A;  5AJ3 K;  5JS1 A;  3SV3 A;  4KPY A;  1LCU A;  2HHH K;  4KTZ A;  4CK3 A;  4CHO A;  3RTV A;  4JD2 B;  2F8S A;  4RW6 A;  3SBT A;  3F73 A;  2KZZ A;  1K8K B;  1X9M A;  3BEX A;  4CCH A;  4DB3 A;  1HYV A;  3QEW A;  1IKX A;  2E88 A;  4KHU A;  4FK2 A;  3K5N A;  1RBU A;  4X62 K;  1D8Y A;  1E4G T;  2EWS A;  3O1B A;  4DMN A;  5AZI A;  1U4B A;  4DCH A;  4FJX A;  4FM0 A;  5GAE P;  3W0L A;  1T8E A;  4EZ6 A;  3OYA A;  2E1Y A;  4NCG A;  3UKR B;  1O13 A;  1E4F T;  4K43 A;  2XHB A;  4B9N A;  4BRD A;  5M1O A;  3KK7 A;  3LAK A;  4CF1 A;  1UAX A;  2OA8 A;  4R5P A;  3UKU B;  4IJA A;  1TAU A;  4QS9 A;  1DKG D;  3SMS A;  2OPQ A;  3F9M A;  2GEL A;  3NMU A;  4DR3 K;  1S9E A;  2YHA A;  4FZX C;  4DS5 A;  2W40 A;  3ZX2 A;  3HPO A;  3C7N B;  3EO3 A;  3SAF A;  4AHT A;  2GV9 A;  4H03 B;  2HBK A;  4IEI A;  5E26 A;  3CCR N;  3O9R A;  4AQY K;  1B92 A;  4FZY A;  1ITG A;  3ITH A;  3AV9 A;  2HHQ A;  1TL1 A;  3TTC A;  4BRO A;  4BE2 A;  3OBY A;  3LPT A;  2GUP A;  3P31 A;  3PV8 A;  4B3S K;  2HMI A;  3OYB A;  3ZSW A;  5BRH A;  1RTI A;  4XEI A;  2Y1I A;  4A59 A;  4YHH K;  4EP4 A;  3SJJ A;  3CCJ N;  4KB1 A;  2VG7 A;  3EE8 A;  4CK2 A;  2PFU A;  1JLQ A;  3R3L A;  4G1Q A;  3D7E O;  5KPZ A;  3ATU A;  4CI6 A;  3IG1 A;  3MN5 A;  4FVM A;  4CJL A;  4GKK K;  4JKG B;  1NK7 A;  3LPU A;  4U7B A;  3G25 A;  1FW6 A;  1VSH A;  3K2P A;  2H3G X;  1SQK A;  2P9I B;  4FZZ A;  3OS1 A;  5BR8 K;  4OJR A;  2LSN A;  3AVG A;  4CJE A;  2G8I A;  1NK0 A;  4CBW A;  2V51 B;  4XH4 A;  4ILJ A;  3EKS A;  1E3M A;  4LF5 K;  5B8H A;  2ZJP L;  2F7T A;  4CF2 A;  3NF6 A;  3CCS N;  2E1Z A;  2Y1J A;  5AQG A;  2Q3S A;  3NGZ A;  5IWA K;  2X74 A;  4DTX A;  4BR2 A;  4DFK A;  1YF5 L;  3M6G A;  3BUZ B;  4CHY A;  3SAH A;  4A62 A;  2FBY A;  1JL1 A;  3VOV A;  4QS8 A;  1TYQ A;  4FWO A;  4DR7 K;  4O5F A;  3CQX A;  1GOA A;  3P1G A;  2DPN A;  1XHX A;  2IVN A;  4ISE A;  1L5U A;  4CER A;  1IKV A;  1XMO K;  3CC7 N;  2A6A A;  2FF6 A;  3OYL A;  1TUU A;  2JWK A;  5C12 A;  2NRX A;  5AQZ A;  3TPQ A;  1ZXO A;  4B3T K;  2B4J A;  3O4W A;  1VQ4 N;  1RDA A;  3L2Q A;  4CFB A;  2PBD A;  2PY5 A;  1GLC G;  2QWP A;  3SBG A;  2BUP A;  1NGD A;  1VSE A;  4H0X B;  3THY A;  1NK6 A;  4CJR A;  1EKE A;  3WXI A;  4RG8 A;  2IAJ A;  4CJW A;  4FPA A;  1WOQ A;  1KTQ A;  2QWR A;  3K9K A;  4E1J A;  2WC9 A;  4R79 A;  1U2V B;  4ISF A;  1UOC A;  2HHS A;  4JI7 K;  4CZJ A;  3QNN A;  1VAZ A;  2HB5 A;  2E8A A;  1HNX K;  3OJS A;  4EZ9 A;  4DTU A;  2IIR A;  5AZJ B;  3THW B;  1LW0 A;  3ID8 A;  4QCL A;  4DKW A;  4CD3 A;  2NRV A;  4PUO A;  4B08 A;  4KTW A;  3OW2 M;  4X64 K;  4DFJ A;  1C1B A;  2CH5 A;  2B6A A;  2I7N A;  3BF1 A;  3D2F B;  1J54 A;  1S6P A;  5C24 A;  3CFP A;  1BIU A;  1RNH A;  4UQG A;  1UWB A;  3QET A;  3O1W A;  3O3F A;  3R6M A;  1BGX T;  3E9L A;  1LAV A;  4CFA A;  4KH4 A;  2YKN A;  4RW8 A;  3SPZ A;  1NM1 A;  2JGU A;  1C6V A;  4NCB A;  1GLA G;  1QS4 A;  4JKC A;  4CF9 A;  4E7L A;  3WNE A;  3C6T A;  3ZSR A;  4DS4 A;  4DR4 K;  4FLX A;  1RCH A;  3WUH A;  2YHW A;  3HVT A;  3O08 A;  1RT1 A;  3A5M C;  3O6W A;  2UU9 K;  2O8B A;  1YJW N;  3VET A;  2YKM A;  2IVO A;  1NMD A;  3KLG A;  3KWG A;  4DTJ A;  4LF4 K;  4NO7 A;  5BPM A;  3VN5 A;  2O8F A;  4H4O A;  2OZM A;  2UXB K;  1Q86 O;  4HUF A;  4Z4F A;  4ELU A;  4EIA A;  2FBX A;  2NRZ A;  1H1V A;  2P9L B;  5C0Y A;  1QTM A;  3PX6 A;  4M3T A;  4W5T A;  1T05 A;  1WSF A;  3LP3 A;  3AY9 A;  3EYZ A;  1NKE A;  4CZM A;  3OBW A;  1REV A;  3MEE A;  3NBP A;  4JN4 A;  5E41 A;  4HVJ A;  2P5G A;  5F0X A;  2HVH A;  4CIF A;  1TAQ A;  3A5O C;  4JEP A;  1IH7 A;  3ZSX A;  3H6E A;  3L6Q A;  1HR0 K;  1KVA A;  3SPY A;  3A5L C;  3VEX A;  3MN6 A;  4Y1C A;  1GLB G;  1RTD A;  4BG8 A;  2Q0U A;  1SUQ A;  3KK3 A;  4DSI A;  2J4R A;  3OA9 A;  3DLB A;  1TUY A;  4LF9 K;  2GEM A;  1C0U A;  2VQE K;  3HJF A;  3EKU A;  1I39 A;  3WXK A;  3QEX A;  3WQU A;  3CER A;  2VG6 A;  4ELT A;  2PZS A;  3RWU A;  3DM2 A;  3MK6 A;  3VQA A;  3NAE A;  3DLR A;  5I42 A;  4OLB A;  3M5R A;  3CXC M;  3SUP A;  3U8X A;  4DSF A;  4CJP A;  4E89 A;  4M7Y A;  3LP1 A;  4KB0 A;  3CFR A;  1RBS A;  3H1Q A;  5GAH P;  2P9N B;  3AVI A;  1RT3 A;  5JVH L;  4CZK A;  4DG1 A;  2FSK A;  4H0V B;  3SYZ A;  3BGR A;  4W5N A;  2QXL A;  2NLX A;  1NGH A;  2O4I A;  1K73 O;  4H4M A;  4FYD A;  3DRP A;  1N33 K;  5C2F A;  2WON A;  5BN9 A;  3DLG A;  3MXJ A;  5KI6 A;  1L3S A;  1HJR A;  4J2A A;  5AQJ A;  4CGF A;  1RTH A;  3ALY A;  5CYM A;  4JHD A;  3A5N C;  2VYP A;  4HHT A;  4CEA A;  4HUG A;  1QZ5 A;  3T3F A;  5HBM A;  3NH0 A;  2W42 A;  2HBM A;  4CD1 A;  1ZBL A;  4I6M B;  1OH7 A;  4PY5 A;  4AHV A;  1WSG A;  3DMJ A;  4GV3 A;  5ADX A;  4GNI A;  2XY6 A;  3BY5 A;  2QKB A;  2YNH A;  3S3O A;  1IKY A;  5J2M A;  4JV5 K;  1X9J A;  1C0G A;  1Q9Y A;  3KJV A;  3VQ4 A;  3TU5 A;  4DQP A;  1ILY A;  1OH8 A;  1A5X A;  3HYF A;  1NJX A;  4BC3 A;  2HHW A;  2X6N A;  3I8D A;  2I7P A;  1HUX A;  2HMP A;  1OVQ A;  3MWP A;  2RF2 A;  2Z1I A;  3CPW M;  4PKG A;  4CHQ A;  1LOT B;  3NF9 A;  3HTV A;  3DOK A;  1BWF O;  4OKK A;  2QKK A;  3LDL A;  2XY5 A;  1KLN A;  1T6C A;  2QI2 A;  4DTP A;  1QQO A;  3AO1 A;  3ZT1 A;  1ASV A;  4OPA A;  4JKB A;  5AR0 A;  3L3V A;  3MMV A;  4L3Q A;  4BRQ A;  4N76 A;  1SZ2 A;  1IG8 A;  5DK5 A;  4CZH A;  1KSP A;  1WBB A;  2O8E B;  1HNZ K;  1BCM A;  4CK1 A;  4IG0 A;  1JLC A;  1HYZ A;  2ZJR L;  4BR7 A;  2E6M A;  2RE2 A;  1ZBU A;  5AQP A;  3ZLJ A;  5LL6 Z;  1W7A A;  5FRM A;  4BRN A;  4HWI A;  3ATV A;  4OKE A;  3HVR A;  1NK9 A;  4FWR A;  4KHW A;  4JI8 K;  2KFN A;  1OKJ A;  3IS9 A;  5AFU H;  4JI1 K;  1WSJ A;  4CIG A;  3VEW A;  3MCA B;  3DI6 A;  2ZE2 A;  1HQE A;  3HP6 A;  2P9S A;  3Q7C A;  4BG9 A;  2DFH A;  4E19 A;  2RKI A;  5HRO A;  4FJN A;  2ZQB A;  4B1V A;  3BP8 A;  3L2R A;  1U45 A;  1SKS A;  1RBR A;  1QE1 A;  5GAD P;  1WSI A;  1IJJ A;  3C0B A;  5C42 A;  3A2F A;  1G99 A;  4FO0 A;  5FPE A;  3OYH A;  4L8R B;  4DV3 K;  2IS3 A;  1R59 O;  1X1P A;  4J8F A;  1WUA A;  1NKB A;  1C0M A;  3CI5 A;  3IRX A;  5CHI A;  5BR9 A;  4CW7 B;  4J2B A;  4WQ5 A;  3CM6 A;  4O44 A;  3U9Z A;  3RRG A;  1GLL O;  4J2D A;  2E4L A;  2HF4 A;  4CJK A;  3CG7 A;  3AVJ A;  3PO4 A;  1CLQ A;  3CIP A;  5AQW A;  4LFA K;  4JI4 K;  3RVC A;  1Q81 O;  1XC3 A;  2D5R A;  5FRN A;  1J6Z A;  3HZ6 A;  1Z25 A;  1BI4 A;  2HHX A;  5F2R A;  2O8C B;  4DQQ A;  5KGX A;  5HRN A;  4PWD A;  5AQL A;  3OTO K;  3M8S A;  1YTU A;  4BRF A;  2HHU A;  3MXI A;  3HRG A;  3ZCM A;  1KVB A;  4GMJ B;  4M41 A;  5FRO A;  3THV A;  4DQI A;  1NGC A;  3QB0 A;  4RW9 A;  4C23 A;  4DF4 A;  4BC5 A;  3DLE A;  4CJ7 A;  4BE1 A;  4JI0 K;  2P9U A;  4F9O A;  4CIE A;  5KQ8 A;  1IG9 A;  4WFA L;  3TAP A;  4B9T A;  1ZBF A;  3DRR A;  3AVH A;  1VSJ A;  1LAW A;  2E2P A;  3O9S A;  1HKB A;  4DSK A;  3PIP L;  2F9W A;  2Z1J A;  3SQ2 A;  2WOM A;  3GG4 A;  1T6D A;  2ASP A;  2FSJ A;  2W6L A;  2X6S A;  2YHY A;  5AQQ A;  4J2E A;  2YV0 X;  4M42 A;  3VQ8 A;  4AHU A;  3E1Y A;  3EZW A;  4CED A;  3E01 A;  3QDK A;  2Q1N A;  5JVG L;  4JKF A;  3IAY A;  1XWL A;  4KHQ A;  3CJB A;  4DTN A;  2YHB A;  3NGY A;  3VQ9 A;  3NVK A;  3M8P A;  1VRU A;  4O0J A;  4PKI A;  4DTM A;  4C8N A;  1ZBS A;  2P5O A;  3L8B A;  3G4S N;  2G8V A;  4FJK A;  3MN7 A;  4N41 A;  1YIJ N;  3AVK A;  3I56 N;  4DV6 K;  4OX9 K;  5KGW A;  3AA3 A;  4A2B A;  4RTF D;  3V1R A;  3Q7B A;  3UE5 A;  5M1P A;  3ZSY A;  4XH1 A;  3PX4 A;  2Z1G A;  1V4S A;  4E0D A;  1GLE G;  3I0S A;  3LP2 A;  1T44 A;  1HQU A;  2G8U A;  4FL9 A;  4CJQ A;  3KIO A;  4FWS A;  4PL8 A;  3ZT2 A;  3OYI A;  1EO1 A;  1QZ6 A;  3L4Q A;  1KCF A;  4K8Z A;  3ISN C;  4FWM A;  1C0F A;  3HM8 A;  4JAX A;  2BAN A;  4LF6 K;  3E9O A;  2KW4 A;  3I0R A;  1VQP N;  4JKH A;  4WQ5 C;  1C1C A;  3K58 A;  2YI1 A;  3DXK B;  3T19 A;  2ZM6 K;  1KVC A;  3D2E B;  1EET A;  4Z0U A;  4CJF A;  3HPH A;  3L2W A;  3AAP A;  4I9Q A;  1TYQ B;  2Q2R A;  3VQB A;  3DYA A;  4ILG B;  1FJG K;  4OO1 J;  3L2V A;  4CF0 A;  1DEJ A;  4IOA L;  3G10 A;  4A61 A;  4N56 A;  4YOU A;  1CZB A;  2F4V K;  4RWT A;  3B8A X;  3VPZ A;  4M3R A;  2VG5 A;  5CZ1 A;  1YVU A;  4MO4 A;  4IFV A;  4CZE A;  5LY3 A;  4HCC A;  4YDU A;  4KRE A;  4KHP K;  1NGG A;  1J53 A;  2BH1 A;  1MWK A;  3MWT A;  5HL7 L;  3MED A;  2QM1 A;  4CEQ A;  5LJW A;  1RBV A;  2ASO A;  1ESV A;  4WF9 L;  3UKR A;  3G0Z A;  4LSN A;  2OPR A;  5AQX A;  4IOC L;  2G8K A;  4LF8 K;  2YJF A;  1C0T A;  2UYT A;  2P9K B;  2IDO A;  2IGI A;  1NNE A;  3MXM A;  1X3N A;  3QFP A;  4DTR A;  4B3O A;  4LFC K;  3W3D A;  3WQT A;  3CC4 N;  3MN9 A;  3UKU A;  3DLL L;  2AA4 A;  4FXD A;  4Z4C A;  2OYQ A;  1HPM A;  2CH6 A;  3CCV N;  2DY4 A;  4FJL A;  1NK8 A;  3ULE B;  1Q8I A;  1WAJ A;  2VCP A;  1P8Z A;  3LDQ A;  2R7Y A;  1S9G A;  4FWN A;  3VTH A;  5SWM A;  4NB4 A;  1RT7 A;  2VWB A;  3C7N A;  4CJT A;  1QSL A;  4OLA A;  3S9H A;  1M1K O;  3FLC O;  3SK3 A;  1RGI A;  1HLU A;  4H5W A;  4CJV A;  1NOY A;  4M7X A;  2NRT A;  3OYG A;  1VQ6 N;  1JLB A;  3GDQ A;  3J80 O;  1WSE A;  3K5L A;  4C1N I;  4YOX A;  2D0B A;  3ZET B;  1S1W A;  1BQM A;  3T1A A;  2GWJ A;  1JL2 A;  1GLJ O;  4CGI A;  4YFU A;  4BC4 A;  3EL2 A;  1Q18 A;  4X66 K;  3G71 N;  1J5E K;  4BDP A;  4ELV A;  5IT9 O;  3SMP A;  3VA3 A;  4KHN A;  1W0H A;  2NRR A;  2IC3 A;  1NGF A;  5F1X A;  1IBK K;  4DU4 A;  2E5L K;  3QO9 A;  3B6P A;  1VQO N;  4KHS A;  4GKJ K;  4GV9 A;  3TAM A;  3J7Z O;  3WEE B;  3NE6 A;  3IUC A;  5AQT A;  4JKG A;  3V4I A;  5AQV A;  4K42 A;  2ZF5 O;  4FJI A;  5JIC A;  3SQ4 A;  4M3Y A;  2YCH A;  2O8B B;  4B9L A;  1YT3 A;  3C65 A;  3HXM A;  3BZK A;  4F3T A;  3CQY A;  3UB5 A;  3QIO A;  2W41 A;  3EN9 A;  1W97 L;  3T69 A;  3QNO A;  4CZF A;  5EX5 A;  2PAV A;  4B9U A;  4I2P A;  4Y0W A;  5M1K A;  3OY9 A;  4ICL A;  3SNN A;  3KD1 E;  1MWM A;  4BY9 C;  2D1K A;  3K5O A;  4DR1 K;  3HOS A;  3TAG A;  3VQE A;  2CGJ A;  1EP4 A;  1LWC A;  4KH6 A;  3RR8 A;  3EY1 A;  1T03 A;  4CVN E; 
#chains in the Genus database with same CATH homology
 4FLU A;  3AO4 A;  5HBM A;  2D0A A;  3DLK A;  3AO2 A;  3RMC A;  3NH0 A;  2W42 A;  3LP0 A;  4E7I A;  1UA1 A;  3EZ5 A;  1EXQ A;  1BHL A;  1ZBL A;  4LH4 A;  1BL3 A;  4PY5 A;  4AHV A;  1WSG A;  3AA5 X;  2F96 A;  3DMJ A;  3ZSO A;  1RBT A;  4WE1 A;  4ID1 A;  2XY6 A;  1L3V A;  2QKB A;  4BAC A;  2YNH A;  3S3O A;  1IKY A;  5J2M A;  3LAL A;  2QK9 A;  1Q9Y A;  4RW7 A;  1NOZ A;  3KJV A;  3VQ4 A;  4DQP A;  4CJ5 A;  3SUO A;  4MFB A;  1A5X A;  5K14 A;  4FLY A;  1FK9 A;  4HTU A;  2HNY A;  3MEC A;  1XC9 A;  3HYF A;  4Z4G A;  3LDS A;  1CZ9 A;  4YNQ A;  1NJX A;  4AHR A;  2FBV A;  4Z4H A;  1WAF A;  1KLM A;  4KHY A;  2HHW A;  2XRI A;  3CYM A;  4CFC A;  2X6N A;  3KLH A;  3I8D A;  4FM2 A;  4BDZ A;  4DFP A;  1HNV A;  4CJ4 A;  4IKF A;  3AVN A;  3CFO A;  4DLG A;  3UIQ A;  3QLH A;  2OPS A;  2RF2 A;  2Z1I A;  1DLO A;  1LW2 A;  1WSH A;  4CHQ A;  3TAB A;  3U3Y A;  3PO5 A;  1WN7 A;  3KLF A;  3NF9 A;  3DOK A;  4OKK A;  2QKK A;  3D0P A;  4AHC A;  1EX4 A;  2YNG A;  1HMV A;  2XY5 A;  1R0A A;  1KLN A;  4CHN A;  3TAE A;  4FCY A;  1LV5 A;  4DTP A;  4DTO A;  3AO1 A;  3H08 A;  3ZT1 A;  1ASV A;  1JXB A;  3L3V A;  2DTU A;  4N76 A;  2PYJ A;  4FJ8 A;  5DK5 A;  4CHZ A;  3TAN A;  1SL2 A;  1Q9X A;  1KSP A;  4C8O A;  3JYT A;  3QIP A;  3QES A;  1JLG A;  3DOL A;  3OYF A;  1J9A A;  3QER A;  1NK5 A;  4N47 A;  4B8A B;  3OYD A;  3ULD A;  1F21 A;  1BCM A;  4FLT A;  1NKC A;  2OPP A;  1D9D A;  2HND A;  3NHG A;  1S1U A;  4H8K A;  5KRS A;  4Y1D A;  4B9V A;  3KK1 A;  4F8R A;  5D3G A;  1W9H A;  1JLF A;  2A1S A;  3QIN A;  4AH9 A;  4IG0 A;  4I9L A;  1JLC A;  4CK1 A;  3SV3 A;  4KPY A;  2KZM A;  1HYZ A;  4KTZ A;  4CK3 A;  4CHO A;  3RTV A;  1RDD A;  4QOZ B;  2OZS A;  2E6M A;  1ZBU A;  2F8S A;  4I2Q A;  4RW6 A;  4EP5 A;  4DFM A;  5FRM A;  2FBT A;  3F73 A;  2IOC A;  1I3A A;  4OKE A;  2KZZ A;  2PYL A;  2ZD1 A;  1X9M A;  3HVR A;  1VRT A;  1NK9 A;  3SZ2 A;  3OS0 A;  4ID5 A;  4KHW A;  4CCH A;  1HYV A;  3QEW A;  1YTA A;  1IKX A;  2KFN A;  4KHU A;  3C6U A;  3D45 A;  3F9K A;  4FK2 A;  3IS9 A;  1RBU A;  1S5J A;  2XY8 A;  3K5N A;  4CIG A;  1WSJ A;  1D8Y A;  3DI6 A;  3HO1 A;  2ZE2 A;  1HQE A;  3O3G A;  4DMN A;  3HP6 A;  5CYQ A;  1U4B A;  2DFH A;  4E19 A;  2RKI A;  4E1M A;  3QEV A;  5HRO A;  4FM0 A;  4FJX A;  4FJN A;  4IFY A;  1KRP A;  1T8E A;  2ZQB A;  3OYA A;  3L2R A;  4EZ6 A;  4FJJ A;  4NCG A;  4W5R A;  4B9S A;  1U47 A;  3OVN A;  3HM9 A;  1U45 A;  2DFF A;  3OYC A;  2XHB A;  3M8Q A;  1SKS A;  1L3U A;  4HCB A;  1RBR A;  4LY7 A;  4E7K A;  1QE1 A;  3MAQ A;  4B9N A;  1WSI A;  5C42 A;  3LAK A;  3OJU A;  4OVL A;  3A2F A;  1K6Y A;  3LAN A;  2JLE A;  4CF1 A;  3OYH A;  1UAX A;  2OA8 A;  5T7B A;  4L8R B;  3TWH A;  3KKS A;  2IS3 A;  3ZSV A;  4R5P A;  1X1P A;  2G8H A;  1JXE A;  3SCX A;  3HPG A;  4FW1 A;  1TAU A;  2OPQ A;  3PY8 A;  1VSM A;  3KLI A;  2VWK A;  1S9E A;  4RW4 A;  4E1N A;  2YHA A;  4JRP A;  1NKB A;  1C0M A;  3VQQ A;  4FJ7 A;  3AVB A;  3IRX A;  4FZX C;  4DS5 A;  3HPO A;  3RMD A;  1KFS A;  2FC0 A;  3SUN A;  4JRQ A;  1RTJ A;  2BE2 A;  1X9S A;  4OKJ A;  4J2B A;  4AHT A;  4CEB A;  2GV9 A;  3CM6 A;  4O44 A;  4LD0 A;  3K57 A;  4HUE A;  3RRG A;  1ZBH A;  1WLJ A;  4J2D A;  2E4L A;  4CJK A;  1HRH A;  3ASM A;  3C95 A;  3CG7 A;  3L3U A;  3AVJ A;  1B92 A;  1S1T A;  4FZY A;  1ITG A;  1XI1 A;  3PO4 A;  1CLQ A;  3ITH A;  3AV9 A;  2HHQ A;  1TL1 A;  2BGG A;  5CY4 A;  4CEE A;  3V9W A;  4BE2 A;  4C8L A;  4F2S A;  1CXQ A;  3PV8 A;  3LPT A;  4FLV A;  4FM1 A;  5HP1 A;  3KKR A;  4NCA A;  4AIL C;  2HMI A;  3OYB A;  2D5R A;  3ZSW A;  1RIL A;  1RTI A;  5FRN A;  2QXF A;  2Y1I A;  2F8T A;  3MEG A;  4EP4 A;  1IKW A;  4TSX A;  1Z25 A;  4M3U A;  3SJJ A;  1GOC A;  1BI4 A;  2O4G A;  2HHX A;  4KB1 A;  2VG7 A;  4FW2 A;  3VA0 A;  3V1Q A;  4CK2 A;  1JLQ A;  1SL0 A;  3O4Q A;  4FJM A;  4KI4 A;  1RT5 A;  4DQQ A;  5KGX A;  1RDB A;  4CES A;  1DTQ A;  4G1Q A;  5HRN A;  2B5J A;  2RPI A;  4PWD A;  4KAZ A;  1JLE A;  2KTQ A;  3M8S A;  3KD5 E;  1YTU A;  2HHU A;  2D0C A;  4IDK A;  5J2N A;  4B9M A;  3IG1 A;  3MXI A;  4FVM A;  1JLA A;  4CJL A;  1HYS A;  4N5S A;  1QQC A;  1NK7 A;  3LPU A;  1HPZ A;  3ZCM A;  1KVB A;  4CJS A;  4Z4I A;  2HHT A;  2A1R A;  4BDY A;  1VSH A;  3K2P A;  3KTQ A;  3SQ1 A;  3RMB A;  4LH5 A;  4GMJ B;  4M41 A;  5FRO A;  3THV A;  4DQI A;  4FZZ A;  3OS1 A;  1KFD A;  4M3W A;  4OJR A;  4RW9 A;  2LSN A;  3AVG A;  4O4G A;  4CJE A;  1VSF A;  4PA1 A;  2G8I A;  4DF4 A;  3SV4 A;  2EHG A;  3ZT4 A;  3DLE A;  1TK8 A;  5J2P A;  1NK0 A;  3U3G A;  4BE1 A;  4CEC A;  1UA0 A;  4FK0 A;  4OGC A;  3M8R A;  4KFB A;  4CIE A;  1IG9 A;  3QEI A;  3TAP A;  4B9T A;  1ZBF A;  2HHV A;  1ASW A;  3DRR A;  3AVH A;  4Q0B A;  3NFA A;  1VSJ A;  1BQN A;  1LAW A;  3NF6 A;  4CF2 A;  4FJ9 A;  4JLH A;  4DSK A;  2Y1J A;  3NGZ A;  1DTT A;  2Q3S A;  3ZSQ A;  2X74 A;  2Z1J A;  3SQ2 A;  2WOM A;  4CGJ A;  3HK2 A;  1NJZ A;  1TL3 A;  1A5W A;  2E6L A;  4DTX A;  2X6S A;  3VQ5 A;  4DFK A;  3AVA A;  4CHY A;  4J2E A;  1U04 A;  1JL1 A;  2FBY A;  3O3H A;  3VQP A;  2YV0 X;  3CM5 A;  3V9X A;  4M42 A;  3VQ8 A;  4AHU A;  4CHP A;  4DU1 A;  2ITG A;  3O4N A;  5I3U A;  1GOA A;  3P1G A;  5KTQ A;  2G8W A;  1XHX A;  4CED A;  1O1W A;  3AVC A;  3S3N A;  4CEZ A;  1TGO A;  3E01 A;  2AJQ A;  1TKD A;  1L5U A;  4CER A;  3RRH A;  2XY7 A;  4E7J A;  1IKV A;  3OS2 A;  1NJW A;  3IAY A;  1TK5 A;  1XWL A;  4KHQ A;  4FK4 A;  1Y97 A;  3OYL A;  4DTN A;  2HW3 A;  2YHB A;  3NGY A;  3OYJ A;  3VQ9 A;  1BIZ A;  3M8P A;  1VRU A;  4ZTJ A;  5DMR A;  2KQ2 A;  4IBN A;  4O0J A;  3AVL A;  4DTM A;  5EU7 A;  4C8N A;  4KRF A;  3VQ7 A;  2P5O A;  3VQC A;  3L8B A;  3LZJ A;  4M3Z A;  5CZ2 A;  2G8V A;  1S1X A;  2B4J A;  4FJK A;  4QAG A;  5FDL A;  4N41 A;  3AVK A;  3K5M A;  3VQD A;  3WNF A;  2ATQ A;  4GW6 A;  3L2U A;  1TV6 A;  3TR8 A;  1RDA A;  5KGW A;  3L2Q A;  1S1V A;  4CFB A;  2P51 A;  2XO7 A;  3AA3 A;  2PY5 A;  1VSK A;  1QSY A;  3WNG A;  2I5J A;  4O0I A;  2RN2 A;  1VSE A;  4DSE A;  1SKW A;  3V1R A;  3AVM A;  1NK6 A;  3ZSY A;  4PUO A;  1RDC A;  3PX4 A;  1JKH A;  2Z1G A;  1EKE A;  4CJR A;  4RG8 A;  4IG3 A;  3KK2 A;  1VSI A;  4E0D A;  3V81 A;  3SQ0 A;  1TKX A;  3FFI A;  3I0S A;  3LP2 A;  2IAJ A;  4CJW A;  1HQU A;  2G8U A;  1SV5 A;  4CJQ A;  3KIO A;  3B6O A;  3ZT2 A;  3OYI A;  3RMA A;  1KCF A;  1KTQ A;  4DF8 A;  3RR7 A;  4FJG A;  3AO3 A;  4K8Z A;  3SUQ A;  3ISN C;  1QSS A;  1TKZ A;  2BAN A;  4CFD A;  3NH2 A;  1UOC A;  4O5B A;  1GOB A;  2HHS A;  3QNN A;  1Z26 A;  3OYN A;  2KW4 A;  3I0R A;  4FLW A;  4C8M A;  2HB5 A;  3OJS A;  1C1C A;  1S6Q A;  3K58 A;  3T19 A;  4EZ9 A;  4DTU A;  1SL1 A;  1G15 A;  4W5Q A;  1LW0 A;  3V1O A;  3TAR A;  4QCL A;  1KVC A;  2P1J A;  1EET A;  2YNI A;  4B08 A;  4KTW A;  4Z0U A;  4CJF A;  3LZI A;  3HPH A;  3L2W A;  4F2R A;  3AVF A;  3ZSZ A;  4DFJ A;  1C1B A;  4F3O A;  2B6A A;  4JS4 A;  1NK4 A;  3ZT0 A;  1TK0 A;  3OYK A;  4I9Q A;  2BDP A;  4C8K A;  1J54 A;  3VQB A;  4DLE A;  1S6P A;  5C24 A;  3CFP A;  1BIU A;  3DYA A;  1RNH A;  4UQG A;  3L2V A;  4CF0 A;  1D5A A;  1MU2 A;  1UWB A;  3QET A;  3TAQ A;  4DQS A;  2HVI A;  4OPJ A;  3G10 A;  3P5J A;  4KO0 A;  4N56 A;  1CZB A;  3O3F A;  4F4K A;  2EX3 A;  5JS2 A;  1BGX T;  4M3R A;  4CEF A;  3K59 A;  2VG5 A;  2Z1H A;  1LAV A;  5CZ1 A;  4CFA A;  1YVU A;  1VSD A;  2YKN A;  4RW8 A;  3SPZ A;  1VSL A;  3CQ8 A;  4PQU A;  3C94 A;  3BDP A;  4IFV A;  2JGU A;  3DRS A;  1C6V A;  4FJH A;  4NCB A;  1QS4 A;  4CF9 A;  4E7L A;  3TI0 A;  1LWF A;  3WNE A;  4HCC A;  3C6T A;  3HL8 A;  3P83 D;  1ZYQ A;  4CJ3 A;  2GBZ A;  4KRE A;  3ZSR A;  4DS4 A;  1L3T A;  2YNF A;  4FLX A;  1RCH A;  4CF8 A;  3KLE A;  1FKP A;  1SKR A;  3AA4 A;  3NH1 A;  1J53 A;  3HVT A;  1RT1 A;  1ASU A;  3OYE A;  4DSJ A;  4I7F A;  3MED A;  4AHS A;  1TKT A;  4CEQ A;  4JS5 A;  5JS1 A;  1RBV A;  1FKO A;  2YKM A;  4OGE A;  4E7H A;  3G0Z A;  4LSN A;  2OPR A;  4XIU A;  3TAF A;  2G8K A;  3AA2 A;  1C0T A;  3KLG A;  1HNI A;  4BWM A;  4DWI A;  4DTJ A;  3ZT3 A;  3LWM A;  2IDO A;  2IGI A;  4KV8 A;  1C1A A;  3VN5 A;  3MXM A;  2ETJ A;  3PUF A;  4H4O A;  4DTR A;  2OZM A;  4B3O A;  5KRT A;  1CXU A;  2DFE A;  4HUF A;  1NJY A;  1X9W A;  4Z4F A;  4ELU A;  4FXD A;  2FBX A;  3HP9 A;  4Z4C A;  2OYQ A;  4Q5V A;  2DY4 A;  4FJL A;  1QTM A;  4MQ3 A;  1NK8 A;  3PX6 A;  3QEP A;  4W5T A;  1Q8I A;  1WAJ A;  1T05 A;  4M3T A;  4E3S A;  1WSF A;  4BE0 A;  3LP3 A;  3EYZ A;  4K8X A;  2R7Y A;  5C25 A;  1S9G A;  5SWM A;  5HLF A;  1NKE A;  4FJ5 A;  1RT2 A;  4M45 A;  1RT7 A;  4CJT A;  1QSL A;  2X78 A;  1REV A;  4OLA A;  3MEE A;  4CE9 A;  4KI6 A;  3V9Z A;  3NBP A;  5E41 A;  4HVJ A;  3S9H A;  1B9F A;  2P5G A;  4CGG A;  1RT4 A;  4CIF A;  2HVH A;  1U48 A;  4CJV A;  1NOY A;  1TAQ A;  4ZTF A;  1U49 A;  1IH7 A;  3OYG A;  1IO2 A;  1JLB A;  1WSE A;  3ZSX A;  1N6Q A;  4DSL A;  1KVA A;  3SPY A;  4DQR A;  3K5L A;  1BI4 B;  4W5O A;  4LSL A;  3V9S A;  2D0B A;  1WNS A;  1S1W A;  2VWJ A;  1BQM A;  4Y1C A;  3T1A A;  4CJU A;  1JL2 A;  1ZBI A;  5HRP A;  1RTD A;  3SI6 A;  2NUB A;  1SUQ A;  1A5V A;  3KK3 A;  4CGI A;  4YFU A;  1TVR A;  4DSI A;  4BDP A;  4ELV A;  3S3M A;  3DLB A;  3DLH A;  5HRR A;  5SZT A;  3VA3 A;  4KHN A;  3LWL A;  4Z4E A;  1W0H A;  1C0U A;  5J2Q A;  2IC3 A;  3PX0 A;  2G8F A;  4FLZ A;  3HJF A;  1I39 A;  3QEX A;  4DU4 A;  2VG6 A;  4ELT A;  2PZS A;  4O55 A;  3QO9 A;  3RWU A;  3DM2 A;  4OPK A;  3B6P A;  4KHS A;  3LAM A;  3VQA A;  3TAM A;  1XHZ A;  3NE6 A;  3NAE A;  3V4I A;  3DLR A;  1B9D A;  5I42 A;  4OLB A;  1J5O A;  3SUP A;  4FJI A;  3HT3 A;  3SQ4 A;  5HRS A;  4DSF A;  2HNZ A;  4CJP A;  4E89 A;  1N5Y A;  4M3Y A;  4CEO A;  3LP1 A;  1T7P A;  1YT3 A;  3VQ6 A;  4B9L A;  1VK0 A;  4KB0 A;  3CFR A;  1RBS A;  4M3X A;  1BCO A;  4KKO A;  3HXM A;  3AVI A;  1RT3 A;  4F3T A;  4DG1 A;  3NGI A;  3NCI A;  4BWJ A;  3QIO A;  3SYZ A;  4NYF A;  3BGR A;  4W5N A;  3QNO A;  2O4I A;  4GVM A;  4ZHR A;  3OYM A;  4NYN A;  1QHT A;  4H4M A;  4B9U A;  4FYD A;  1RT6 A;  3WNH A;  3DRP A;  2WON A;  4I2P A;  3OY9 A;  3DLG A;  2KFZ A;  3MXJ A;  3NF7 A;  5KI6 A;  1L3S A;  4ICL A;  1HJR A;  1LWE A;  4CGD A;  4B8C A;  3SNN A;  3KD1 E;  3AO5 A;  4J2A A;  3V6D A;  3K5O A;  4DU3 A;  1BIS A;  4CGF A;  1RTH A;  3TAG A;  1FXX A;  3NF8 A;  4CGH A;  3ALY A;  3VQE A;  5CYM A;  3NDK A;  1EP4 A;  1LWC A;  4DTS A;  2GUI A;  3RR8 A;  5J1E A;  3U6F A;  4KTQ A;  1D9F A;  3EY1 A;  3V9U A;  1T03 A;  3JSM A;  4HHT A;  4CEA A;  4HUG A;  3HST B;  3T3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...