4CJ5A

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cj5A00
1NOZA 4KB1A 4E7HA 3QLHA 4H8KA 1BIUA 2EX3A 3HL8A 3MXJA 1TL1A 4DTOA 3TAGA 4AHUA 4KPYA 1YVUA 4BE0A 4CHQA 1NK7A 3K5OA 1HYSA 1JKHA 3JSMA 2FBVA 3EZ5A 3CFPA 2HHSA 3AVBA 2A1RA 1U48A 3SZ2A 4M3TA 4Z4CA 2QK9A 1B92A 1VSIA 3AVCA 3K2PA 4J2DA 1RTJA 3LZJA 4HCBA 4DFMA 4DU4A 1BIZA 4MFBA 3TAEA 1CXQA 3OYBA 3DMJA 1U4BA 1X9MA 3LWMA 1B9DA 4L8RB 2F8SA 3RRHA 1TVRA 4RW9A 3OJSA 4CGHA 2YNHA 4DLEA 1T03A 3NBPA 4FJ8A 4M42A 4N76A 3AO5A 1S6PA 3AVFA 3L2WA 4I7FA 4N5SA 2HB5A 4UQGA 3HP9A 4BWMA 3LWLA 2Y1JA 3TARA 2OPPA 4Z4EA 3O3GA 4IG0A 3LP3A 1A5VA 3QEVA 4CK1A 2Z1JA 3F9KA 3G10A 5KRSA 3QINA 3OYGA 3TANA 2Z1GA 2Q3SA 2YKNA 3ZSZA 4FW2A 1TKTA 4J2AA 2E6MA 2HW3A 3SJJA 2KW4A 3CM5A 4AHRA 3AVAA 3KTQA 1I39A 1RDBA 3AA4A 4FJJA 4FJNA 5EU7A 2G8KA 4K8XA 1SUQA 4KREA 3T19A 3VQDA 2NUBA 3A2FA 1S1XA 1UA0A 4GVMA 5JS2A 3OJUA 4E19A 1HYZA 3D0PA 4KFBA 4W5NA 1J53A 1T7PA 4FLYA 4OLBA 2VG5A 3ZSYA 2G8WA 3V1QA 4ZTFA 1BQMA 3E01A 1WSHA 2B5JA 4DSEA 3AO4A 1RT5A 2WONA 3DI6A 1BHLA 2XY8A 4CIFA 3SI6A 3DRPA 3HPOA 4F2RA 4HHTA 4CJLA 3OYFA 3PO5A 1D5AA 3CG7A 4DTJA 2ZD1A 3VQBA 4B9SA 4FZZA 5C24A 3ZT3A 4F3TA 1WSFA 4CJFA 1ITGA 4CJ3A 3VQ7A 4FJMA 1IKVA 1SL1A 2QKBA 3EYZA 1BISA 5E41A 2HVIA 2IDOA 1TKXA 1SKWA 3AVIA 5HBMA 3KIOA 4CJWA 3OYHA 4CEQA 3V9UA 2F8TA 3QNNA 2IOCA 3V4IA 4BDYA 4CERA 2HNDA 2G8IA 3O4NA 1FXXA 4M3ZA 3S3NA 4RG8A 4HUFA 1N6QA 4KTZA 4B9UA 1JXEA 3M8RA 1ASVA 4OGEA 5SZTA 4LD0A 2HHQA 3S3MA 1UAXA 1XI1A 1Q9YA 2LSNA 1RBUA 1LAWA 5I3UA 3AO1A 1J9AA 4KB0A 1NK6A 1WSEA 4ID5A 3WNFA 1RBVA 4DTPA 1Z26A 4NYFA 1S5JA 3G0ZA 1ZBLA 2DFHA 3K5MA 4FZXC 1VSHA 4J2EA 3PX0A 4DFKA 1Y97A 2YHBA 3AO3A 3NF6A 2FC0A 4DSFA 4FZYA 1WSIA 4DU3A 3OY9A 1N5YA 1REVA 4CGDA 3OS2A 1U47A 1KLNA 1UOCA 3CYMA 4ICLA 4CEFA 4B9TA 4GW6A 3QEPA 3NE6A 3OYMA 4FJIA 4CK3A 1B9FA 4E89A 1HRHA 3L2VA 3BDPA 3SUNA 3C94A 2QKKA 5J2QA 3MEGA 4M45A 4CESA 1XWLA 3I8DA 1IKWA 1TAUA 1HYVA 3K57A 3DLEA 2XY7A 2DTUA 3QIPA 2ATQA 1IH7A 2E4LA 3P83D 3ITHA 1KTQA 3HT3A 3KK3A 3TAQA 1R0AA 1C1BA 4DLGA 4OKJA 3SUPA 2X78A 2O4IA 3ZT0A 4WE1A 4O4GA 3V9ZA 1EKEA 3PO4A 1IKXA 3D45A 1LV5A 4RW6A 3DLRA 4PUOA 4EZ9A 3C95A 3LAMA 2AJQA 4J2BA 5KGXA 1TAQA 3HPGA 2PYLA 3V9XA 3IRXA 4B9LA 4M3UA 1VSFA 2XY6A 3OYDA 3KJVA 1U45A 3HXMA 1EETA 4M3RA 1HJRA 1EX4A 2YNIA 3CM6A 4FJ5A 2DY4A 3HYFA 5CZ1A 3B6OA 1GOAA 3SQ2A 3EY1A 1SL0A 1O1WA 4JLHA 4LSNA 5FRNA 1NJYA 3DYAA 3OYCA 4YFUA 4EZ6A 4PWDA 3KD1E 2Z1IA 4FM0A 4OLAA 1L3VA 3HO1A 4IG3A 1RBSA 3RMAA 1KCFA 4KHSA 1KLMA 4CGFA 4E7KA 4FLXA 1C0TA 4FVMA 3HVTA 4OKKA 4MQ3A 4C8MA 2DFFA 3V6DA 4M41A 4BE1A 1HPZA 1C1AA 1ZBHA 1LWEA 2OYQA 1WAFA 4W5RA 1RT3A 2D0CA 4B9MA 1RDAA 5HROA 2P5OA 4AILC 1UA1A 1FKPA 4FYDA 1KVBA 3WNEA 4CE9A 4O55A 2HHUA 2D5RA 4KHQA 3NH1A 1TV6A 1BGXT 4F4KA 1WNSA 2KFZA 3U3GA 5J2MA 4FJ9A 2D0BA 2JLEA 2YHAA 1TK5A 4B9VA 1NK4A 3LPUA 4AH9A 5KI6A 4CJPA 3OYNA 4HUGA 1Z25A 4I9LA 4RW7A 4DTMA 4E0DA 4IDKA 3L2UA 4B3OA 5HRSA 4KI6A 4NCBA 5KGWA 4DMNA 1YTUA 2KZMA 1YTAA 3QEWA 4QOZB 3SPZA 3NHGA 5HLFA 1C0UA 3PUFA 3ZCMA 1S1WA 3VQEA 4AHVA 5KRTA 3L8BA 2X6NA 2WOMA 2JGUA 4W5OA 4F2SA 4CEZA 2OZSA 4N47A 4KHUA 4OKEA 1LWCA 3V9SA 3THVA 1VSLA 1HQEA 4ELTA 4KKOA 1D8YA 4OVLA 4O44A 4OPJA 1KFDA 5K14A 1RDCA 4AHCA 1NKCA 5I42A 3OYJA 2RF2A 1JLBA 3DLKA 4FK2A 3DOLA 1RT4A 4DS4A 4DTSA 1J54A 1RBRA 2HHTA 3TR8A 1BL3A 3TAPA 4AHSA 1ASUA 4CGGA 1NK5A 1TKZA 1RT6A 1X1PA 1XC9A 3M8SA 2KZZA 3DRSA 3LANA 5HRRA 3CFRA 1W0HA 4Z4GA 4Z4HA 2HVHA 3CFOA 3KLIA 3LP1A 4I9QA 3SNNA 3OVNA 4FJKA 4O0JA 3KLHA 4ZTJA 1CZBA 3M8QA 3QIOA 4IFYA 4DSJA 3PY8A 3AVMA 1VRUA 4NCGA 3OS1A 3V81A 2G8FA 4BWJA 1DLOA 1NK9A 4AHTA 4FM1A 2I5JA 2FBYA 3ZSWA 3NH0A 3V9WA 3NF9A 3SUQA 3IS9A 1KVCA 1IKYA 4FLUA 4ID1A 4K8ZA 2P5GA 5CYQA 1JL1A 4KI4A 3LP2A 3RR7A 2GBZA 4B8AB 4DU1A 4CJRA 4E1MA 1QE1A 4Z0UA 1DTTA 1RNHA 4IBNA 4JS5A 3HSTB 4RW8A 3KK2A 5J2PA 3U6FA 4FXDA 2BE2A 3LDSA 3AVKA 3HPHA 1QHTA 3QETA 1X9WA 3HJFA 4I2QA 1RT7A 4Z4IA 1JLFA 4C8NA 1NK0A 3VQ5A 1FKOA 1JLAA 1W9HA 4CJUA 1EP4A 1T8EA 3DLHA 3BGRA 3DM2A 3NH2A 4DF4A 4E3SA 1KFSA 3AVLA 3P1GA 3L2QA 4KAZA 2PZSA 1LW0A 2X6SA 4FLVA 4FK0A 4TSXA 3OS0A 1BCOA 4GMJB 3VA0A 1A5WA 4CFAA 3HVRA 2VWKA 3VQQA 4BE2A 1NJXA 4C8LA 2KTQA 1BI4B 4CHNA 4LSLA 3MXMA 3ZSRA 4Y1DA 1F21A 4CK2A 4N56A 4CCHA 3VA3A 4PY5A 2HHXA 3RMDA 4QAGA 2X74A 3NF7A 3AVJA 3CQ8A 3PV8A 2PY5A 1VSKA 3ZSQA 3DOKA 3LALA 4DTRA 3DRRA 4Q5VA 1BCMA 4M3YA 2FBTA 4FJGA 4HTUA 2YKMA 4CJQA 3B6PA 4FM2A 1NKEA 1D9FA 4CGJA 2IAJA 3RR8A 3OYIA 5JS1A 4BDZA 3NCIA 5D3GA 3TAMA 1QSYA 3IAYA 4CEBA 1FK9A 2IGIA 1S6QA 4E7IA 3RRGA 1QSSA 3I0RA 4ELUA 1WAJA 3SQ4A 1SL2A 1VSMA 4KV8A 3AA3A 3JYTA 4DSIA 1GOBA 5SWMA 4Y1CA 2BANA 3AA5X 3L2RA 3MEEA 2FBXA 3K5LA 3LZIA 1HMVA 3SV3A 1SKRA 4H4MA 1NOYA 1WLJA 4H4OA 4KHNA 1WSJA 3AVHA 3AVGA 4OGCA 1RTHA 5DK5A 3QESA 3SQ0A 3LPTA 3F73A 3VQPA 1IO2A 1J5OA 4DQIA 4FJHA 4I2PA 1U04A 3SV4A 3TABA 1EXQA 5C25A 4E1NA 4FJXA 3RMCA 4G1QA 4PQUA 1ASWA 1XHXA 1QQCA 3ZT4A 4CF2A 1IG9A 4OPKA 1S1VA 5CY4A 3WNGA 4JRQA 3IG1A 4FCYA 1S9EA 3KLFA 3I0SA 1TK0A 3C6TA 1UWBA 4M3XA 2YNFA 1LW2A 2VG6A 2GUIA 2XO7A 3SCXA 3L3UA 4DFPA 3KKSA 3ZT1A 4NCAA 2D0AA 5CYMA 3AA2A 5FDLA 1GOCA 3VQ4A 4CEEA 4CIGA 5J1EA 1Q8IA 2GV9A 4DS5A 4KRFA 1NKBA 1RILA 4DWIA 3LAKA 4W5QA 4EP5A 2XY5A 1WSGA 2XRIA 4RW4A 4CJVA 3MAQA 3K59A 3TAFA 4DSKA 1S1TA 3MEDA 4FLWA 2OPQA 2YNGA 4CFBA 3SYZA 3KD5E 2O4GA 3UIQA 1HNIA 1K6YA 4CHOA 1KSPA 4CHPA 4O5BA 2HMIA 1ZBIA 4E7LA 4FLZA 1SKSA 4F8RA 3S9HA 1VSEA 3KLEA 2OPRA 4E7JA 3ZSVA 4CEAA 4DQRA 3KK1A 3HM9A 1JLGA 3M8PA 3U3YA 2G8VA 1RT1A 1KVAA 3DLGA 4OJRA 4LH5A 4IKFA 3VQCA 4CJSA 4CJKA 5T7BA 2BGGA 1RTIA 4IFVA 4O0IA 2RPIA 4HCCA 4CHZA 4DTNA 4Q0BA 2HHVA 3VQ6A 2VG7A 3QEXA 3TI0A 4JRPA 1MU2A 2A1SA 1JLEA 3WNHA 1ZBFA 3C6UA 3SPYA 4CEOA 3NFAA 2OPSA 4CF1A 2HNYA 4CF9A 4YNQA 4LH4A 1VSDA 1JLQA 1RDDA 1KRPA 1A5XA 4JS4A 3PX6A 1QSLA 3OYLA 4CHYA 3ZT2A 4QCLA 2ZQBA 4R5PA 4LY7A 3PX4A 4CJ4A 3QERA 4KTWA 3ISNC 4CFDA 1CXUA 2RKIA 3RMBA 3ZSXA 1JLCA 3NAEA 1XHZA 4N41A 2B4JA 3T1AA 4KHWA 1ZBUA 1BQNA 2XHBA 3NGIA 2PYJA 3ULDA 2G8HA 3NGYA 3VQAA 4KO0A 4CECA 3QNOA 4CJ5A 2F96A 1Q9XA 5DMRA 1BI4A 2KFNA 3LP0A 1I3AA 4DF8A 1LWFA 3OYKA 4CF0A 4F3OA 4KTQA 1VK0A 1RBTA 2YV0X 1YT3A 4DSLA 1G15A 2ETJA 3ASMA 4DG1A 4FJ7A 2ITGA 2E6LA 4ZHRA 2OZMA 3SUOA 1NJWA 1RTDA 5KTQA 4C8OA 2KQ2A 2DFEA 1L3SA 1CZ9A 4DQPA 1VRTA 1TL3A 3QO9A 3NDKA 2BDPA 3AV9A 3HK2A 2OA8A 3KLGA 4CFCA 2HHWA 4CF8A 2B6AA 3VQ8A 1L5UA 4Z4FA 3DLBA 2RN2A 2ZE2A 3P5JA 2P51A 3OYAA 3ALYA 1X9SA 1TKDA 4CJEA 1NK8A 2VWJA 1L3UA 1D9DA 4B9NA 1DTQA 2Z1HA 1LAVA 4XIUA 4FLTA 1T05A 4M3WA 4HUEA 1C0MA 3VQ9A 3RTVA 2G8UA 4ELVA 1VSJA 1RCHA 4EP4A 3O3FA 3K5NA 1HQUA 4DQQA 4BACA 3NGZA 1C1CA 1RT2A 1SV5A 2IS3A 1JL2A 1WN7A 3MXIA 3L3VA 2EHGA 4B8CA 5CZ2A 3K58A 1JXBA 3V1RA 4FW1A 3O4QA 2W42A 4CEDA 3TWHA 3T3FA 4DFJA 3MECA 2Y1IA 3SQ1A 5HP1A 1L3TA 3S3OA 2QXFA 3FFIA 1S1UA 4B08A 3HP6A 2P1JA 5FRMA 2R7YA 5HRPA 4FK4A 5J2NA 4CIEA 5HRNA 3QEIA 4W5TA 3VN5A 1QTMA 3ZSOA 4CGIA 4CJTA 4HVJA 1QS4A 5FROA 4DTXA 1TGOA 2HNZA 1C6VA 3OYEA 4DTUA 3NF8A 4DQSA 4FJLA 3AO2A 3AVNA 3H08A 3KKRA 1NJZA 1TK8A 1ZYQA 1CLQA 3V1OA 2IC3A 3RWUA 5C42A 1U49A 4KHYA 4C8KA 4BDPA 4NYNA 4PA1A 1S9GA 3O3HA 1HNVA
chains in the Genus database with same CATH superfamily
4KB1A 3WXJA 1RDUA 4BE0A 4CHQA 1I94K 3K5OA 4JHDB 2P9NB 2FBVA 4M3TA 2P9UB 4Z4CA 1K73O 3CHWA 3E9OA 3K2PA 1RTJA 4YOYA 5BRHA 3TAEA 4IO8A 1X9MA 3DMJA 1XNQK 4JKEA 1HUXA 1T03A 4M42A 3HZ6A 3CMEN 1S6PA 4WQ5A 2OPPA 3EE9A 4IG0A 3I33A 2Z1JA 4K25A 4WCEL 4J2AA 3CJ7A 4GKKK 3G25A 1RDBA 4K8XA 1SUQA 3T19A 1JCEA 3BY5A 4FWPA 4XH5A 4BRLA 4KFBA 1T7PA 4BRKA 4FLYA 4H5WA 3V1QA 1WSHA 3QBXA 4FL9A 3MMVA 1NGDA 4X66K 3DRPA 1WBDA 1D5AA 3U8XA 2E8AA 4F3TA 3VQ7A 3ENOA 1NGCA 4FJMA 5B8HA 3EYZA 2HVIA 3ZX2A 4BGBA 4NO7A 5HBMA 2F8TA 5FLXO 2IOCA 3OW2M 3I8BA 1P90A 4BDYA 3O4NA 4M3ZA 4B9UA 4CZFA 3F9MA 4OGEA 3K9JA 1UAXA 1HJOA 3OA9A 2GX9A 4JN4A 2ASMA 2IVPA 3AO1A 4KB0A 1OVQA 3WNFA 4NYFA 4JI7K 3PX0A 2V51B 3GOIA 4DSFA 3ZETA 1S22A 1WSIA 4DU3A 3CF5L 1MWMA 3OS2A 1KLNA 4ICLA 5LL6Z 4B9TA 4CEFA 3QEPA 3NVMA 4FJIA 4CK3A 3J80O 1B9FA 3C94A 3CQXA 4CJ7A 1HYVA 3UKRA 4O5FA 3VEYA 4CD1A 3HT3A 3D2EA 4XH4A 5ADXH 2ZJPL 2O4IA 1G99A 3ZT0A 2E1ZA 5C2FA 3D45A 4RW6A 3CPEA 4EZ9A 4J2BA 3R6MA 3HPGA 2PYLA 4I6MA 3V9XA 5AQZA 3OYDA 4NB4A 4FWSA 4H5TA 1OH8A 3HYFA 2I7NA 1SL0A 3ID8A 4JLHA 4JK8A 3D2EB 5FRNA 3OYCA 1DGKN 4EZ6A 4PWDA 1YITN 1RBSA 4KHSA 1KLMA 2ASOA 3RSEB 4W5RA 5FPMA 2ZF5O 3WNEA 5BR8K 2GEMA 1RGIA 2HHUA 1BGXT 1WNSA 3WEEB 3U3GA 2YHAA 3LPUA 4AH9A 3I56N 4DV6K 3UE5A 4BR9A 5JVGL 5KGWA 3WXMB 4QOZB 4LF9K 1S1WA 4AHVA 3L8BA 2X6NA 4CEZA 2OZSA 4OKEA 1LWCA 2IVOA 3THVA 1HQEA 5JLFA 3RVCA 4AF1A 4O44A 4AHCA 4FK2A 3DOLA 4DS4A 3TR8A 4BR7A 1YUWA 1XC9A 3M8SA 5HRRA 4Z4HA 3CFOA 3CC7N 4FJKA 3GDQA 4BRNA 1WBBA 3M8QA 2NRXA 4BQLA 2CGKA 4GKJK 3OS1A 3V81A 2G8FA 3CD6N 1NGJA 4AHTA 3NH0A 3CJCA 3THXA 3SUQA 3IS9A 4FLUA 5I9EB 4K8ZA 3VEVA 5CYQA 4KI4A 3LP2A 4IJNA 2GBZA 3GE1A 4CJRA 4E1MA 4JS5A 3U6FA 2BE2A 3LDSA 3QETA 5M1FA 1RT7A 1NK0A 2V7YA 2ZWHA 4M63C 3LDNA 3OTOK 3AARA 1EP4A 2JWKA 3BGRA 1SQKA 2Q2RA 4E3SA 2O8BA 1KFSA 3P1GA 4JV5K 2X6SA 1KAXA 4TSXA 1BCOA 2HMPA 1A5WA 3MX2A 3VA0A 3KVGA 2KTQA 4CHNA 3MXMA 3ZSRA 4N56A 3VA3A 2HHXA 3NF7A 3CERA 2PY5A 3ZSQA 4BR4A 4DTRA 4M3YA 2FBTA 3H46O 4G9ZA 4HTUA 4FM2A 1E3MA 4CGJA 5LJVA 2H3GX 2NNWA 5JS1A 5D3GA 1QSYA 4YOUA 4FWNA 4CEBA 1FK9A 3RRGA 1QSSA 3I0RA 4ELUA 4JKGB 2QM1A 1SL2A 2YHYA 4KV8A 1BOTO 1Q18A 5KPRA 4DSIA 3H3NO 4CW7B 3L2RA 3MEEA 3LZIA 1SKRA 1VQPN 4H4MA 1NOYA 1WLJA 1KD1O 4KHNA 3AVHA 1RTHA 5DK5A 3LPTA 1BDGA 3E9LA 3O6WA 3VQPA 4DQIA 3L4IA 1U04A 2QWRA 3TTFA 4H0OA 2QWQA 3RMCA 4G1QA 1IG9A 1QQCA 4OPKA 1S1VA 1WUAA 1S9EA 3KLFA 4FSVA 3SCXA 5FDLA 3VQ4A 1GOCA 4CEEA 4CIGA 4U7BA 4BC2A 4KRFA 5AZIB 4PKHA 2Q1NA 4DWIA 3O08A 4BRAA 4IOXA 3UIQA 2O4GA 3O9TA 4CHPA 3WXIA 4E7LA 5M1NA 1SKSA 3VEZA 4DQRA 3HM9A 1JLGA 3SAFA 4OJRA 3VQCA 4CJSA 4CJKA 2BGGA 3DJCA 4HCCA 3VQ6A 3BZKA 3QEXA 3AAPA 1MU2A 5BN8A 1NNEA 3AAQA 4JKCA 4IEIA 5EOYA 2NZTA 2HNYA 4YNQA 4GV6A 5IWAK 3VPZA 4JS4A 5FPNA 4R5PA 3QB0A 4BG8A 1JLCA 4FO0A 2B4JA 3T1AA 4KHWA 2XHBA 3CCLN 4GNIA 3NGYA 3VQAA 1YAGA 2HF4A 3DWLA 4CJ5A 2F96A 4DB3A 4EFHA 1YVNA 5DMRA 4H5RA 3OYKA 4CF0A 4F3OA 3ZX0A 1OH7A 1VHXA 4JI8K 4DSLA 4RTFD 4FJ7A 2Q97A 5KTQA 2YHXA 1V4TA 3A5LC 1TL3A 1QQMA 3Q7CA 2OA8A 4CFCA 4CF8A 2P9KA 3VF6A 2B6AA 1L5UA 2ZE2A 3P5JA 4RCHA 2Z1HA 3E1YA 4FLTA 3VQ9A 3RTVA 4GY2B 3O3FA 4BRCA 4JI1K 2HOEA 5LY3A 1HQUA 1VQ8N 3MXIA 1JL2A 4JK9A 5CZ2A 3MCAB 3TWHA 2IVNA 3O4QA 5FPEA 4CEDA 3S3OA 2QXFA 3FFIA 3D2FB 4CZLA 5FRMA 5JVHL 3BF3A 5BN9A 4CGIA 4CJTA 5FPDA 2OTJN 1C6VA 3NF8A 3H08A 3KKRA 1TK8A 3PIOL 2IC3A 1M90O 3RWUA 1U49A 4BDPA 3O3HA 1HNVA 2P9LB 1NJIO 2NRWA 1CZAN 3QLHA 5AZJA 5AQKA 3SBTA 1YVUA 2YX6A 1JKHA 3A5NC 2A1RA 1U48A 3CIPA 4BRGA 4DV3K 4J2DA 3THWB 3HSCA 1ZXOA 3VETA 1ZBSA 4DU4A 1U4BA 4BRQA 4ILJA 4L8RB 4ILGB 3RRHA 1U6ZA 2YNHA 2A40A 3JXUA 4I7FA 2Y1JA 1RDWX 4PL7A 3LP3A 3TANA 3DXMA 5AQRA 2HHHK 2E6MA 2HW3A 1WOQA 2KW4A 4CZIA 4AHRA 3VGKA 2KLAA 5AFUH 5EU7A 2G8KA 2Q0RA 4KREA 5EX5A 3A2FA 4MDAA 4H0YB 1EWRA 4OLBA 2VG5A 4DHYA 3ZSYA 5E26A 4ZTFA 1IJJA 1BQMA 3QFPA 2B5JA 3AO4A 4BRDA 4CIFA 3DI6A 3SI6A 4DR3K 4X64K 4DTJA 2ZD1A 2P9PA 3VQBA 4DR1K 4CJFA 4CJ3A 1FW6A 4E1JA 2E88A 2UYTA 1BISA 5E41A 1TKXA 1SKWA 3AVIA 4CJWA 3OYHA 4CEQA 2UUCK 2O8EB 1GLAG 3TTCA 3QNNA 3DXKB 4CERA 4X62K 3S3NA 3QFUA 3PIPL 4RG8A 4HUFA 5AQXA 2VQFK 1LOTB 4WFNL 3ATUA 4FVUA 4HTLA 4AM6A 5SZTA 2ZGZA 5M1OA 1KC8O 1Q9YA 2LSNA 1RBUA 5I3UA 3NMUA 1WSEA 3PY8A 4DTPA 1QQOA 4EIAA 1Z26A 1ZBLA 2DFHA 3K5MA 2IIRA 2WC9A 1VQMN 3G71N 3VEXA 4H0VB 3OYMA 4E89A 2W6LA 3SUNA 1NG9A 2QKKA 2WBNA 3ENBA 4CESA 1XWLA 3I8DA 2FXUA 1TAUA 3DLEA 1IH7A 2EWSA 2V52B 2FF3B 1ATNA 4JHDA 1R0AA 2P9NA 4OKJA 2X78A 2V7ZA 3CQYA 4WE1A 4O4GA 1KAYA 1EKEA 2P9UA 1IKXA 4PUOA 3LAMA 1HPMA 2W6KA 4B9LA 2F4VK 3TU5A 2XY6A 3HXMA 1EETA 2YNIA 4FJ5A 3C0BA 5CZ1A 1GOAA 3EY1A 2BH1A 1O1WA 1W2BM 3P31A 3DYAA 4KHPK 5GAEP 3KD1E 4FWMA 1L3VA 1JJ2M 3HO1A 4H5VA 4IG3A 1OVYA 1Z05A 4JD2B 4E7KA 4FLXA 3GBTA 4JKHA 1YI2N 5LMUK 1QZ5A 2DFFA 3V6DA 4H5NA 4IDHA 1HPZA 1LWEA 4B9MA 1RDAA 5AQGA 4DQ8A 1S3XA 1FKPA 5BREA 4BRHA 4O55A 3MWTA 1JCGA 4WQ4A 4YY3K 4WFBL 1TK5A 2OTLN 4L3QA 4B9VA 1Z25A 3R1XA 4I9LA 4RW7A 5CHIA 3L2UA 4KI6A 3KZBA 4DMNA 4J8FA 2KZMA 1YTAA 3QEWA 3SPZA 5HLFA 5C2DA 3PUFA 5KRTA 2WOMA 2HSTA 1K8AO 3PLAA 4F2SA 3V9SA 4ELTA 1NMDA 3VGMA 4OVLA 1KFDA 4DCHA 1K9MO 1NKCA 4IJAA 3J7ZO 1RT4A 2HHTA 1BL3A 3TAPA 1TKZA 3MCPA 3LDOA 3JS6A 3CFRA 4Z4GA 2VCPA 4GV3A 4JKBA 4I9QA 3TTDA 3SNNA 1CZBA 3QIOA 4IFYA 4CD3A 3AVMA 5AQVA 1VRUA 4BWJA 1DLOA 4FM1A 2I5JA 4FPAA 3ZYYX 1ATSA 1HKCA 1NBWA 3RR7A 5CE3A 1QE1A 1RNHA 3HSTB 4RW8A 5J2PA 4FWQA 4YOTA 4FXDA 4JI2K 4B3SK 4DR6K 3HPHA 1E4FT 1QHTA 1JLFA 3VQ5A 3D7EO 3A5OC 2E20A 1T8EA 3BZCA 4WF9L 2NRTA 2A41A 3L6QA 4OPHA 4AQYK 3LDLA 3WQTA 1LW0A 4GMJB 1NJXA 1BI4B 4CK2A 3RMDA 2X74A 3AVJA 4LFCK 5GIPA 3DOKA 1GLEG 1BCMA 3GG4A 4NLCA 4F9OA 3T69A 3B6PA 1NKEA 1D9FA 4DR5K 1XC3A 3O80A 3UKUB 2CH5A 3RSEA 3SQ4A 1D4XA 1GOBA 2BANA 3AA5X 4BRMA 1HMVA 3SV3A 5F1XA 3WEEA 4H4OA 4DV4K 2UU9K 3QESA 3SQ0A 3Q7BA 1V4SA 3F73A 3SV4A 4QS8A 4IFEA 1VQ7N 1NLVA 2ZM6K 4CZHA 4FOIA 4FCYA 3WNGA 4JRQA 1HKGA 3K0SA 1N8RO 4IEEA 2YNFA 3AGKA 3VENA 1GLJO 3L3UA 3ZEUB 4NCAA 4B1UB 2D0AA 5CYMA 3AA2A 4B9QA 3U9DA 2CH6A 4EHUA 3T1YK 1NKBA 5BPLA 3LL3A 1HX1A 3LAKA 4NXNK 1WSGA 2XRIA 3MAQA 5LJWA 2BUPA 4CZMA 4FLWA 3HTVA 5GAHP 1KSPA 4FOEA 4CHOA 1IBMK 4O5BA 1MDUB 1ZBIA 3LDPA 3SMSA 3S9HA 1YHQN 4CEAA 3KK1A 2G8VA 3KWGA 1RT1A 3T7ZA 4C1NI 1YIJN 3C65A 4KH5A 2QW9A 2RPIA 3O9SA 5EXWA 2VG7A 4KH6A 5AQIA 2HHVA 2A1SA 5KPTA 4MLEA 4CF1A 5HL7L 3U4LA 4LH4A 2QA4N 3CCMN 1RDDA 1A5XA 4NLBA 3ZT2A 3PX4A 3QERA 2FF6A 2FLOA 1CXUA 3RMBA 3ZSXA 1HR0K 4N41A 1O13A 2PYJA 3ULDA 4CECA 3VOVA 1Q9XA 2VGNA 5AQLA 3BF1A 3LP0A 1I3AA 4DF8A 1LWFA 2O8DB 3ASMA 1IBLK 3BUZB 2E6LA 2OZMA 3SUOA 1L3SA 1CZ9A 2QWPA 4YOVA 2BDPA 3HK2A 3KLGA 5JLHA 2ZJQL 2PBDA 3CJ9A 4Z4FA 3D6RA 4JKGA 3ALYA 1WB9A 1NK8A 1X3NA 1LAVA 1T6DA 3SLCA 4HUEA 2G8UA 1RCHA 3K5NA 1NGBA 4OPAA 3NGZA 5BRFA 3L3VA 3OBWA 3K58A 1JXBA 2W42A 3SQ1A 3T3FA 5HP1A 1L3TA 3MN6A 3OBYA 2P1JA 4A59A 5HRPA 4FK4A 3VGLA 4DV2K 3CCEN 4CIEA 5HRNA 5AQWA 3VN5A 1QTMA 3CCUN 2W40A 4HVJA 4DTXA 2QWOA 2HNZA 3OYEA 4LFBK 5AZIA 1ZYQA 3V1OA 2QKBA 4KHYA 4NYNA 3V4IA 4N76A 1NOZA 5C12A 2EX3A 3HL8A 1Z6RA 3MXJA 1TL1A 3QICA 4GV9A 3P4IA 2A5XA 1HYSA 5M1QA 3JSMA 1NGIA 3AVBA 2YJEA 1B92A 1VSIA 3AVCA 4HCBA 4DFMA 4MFBA 1KAZA 1B9DA 2F8SA 2QWMA 4CGHA 3NBPA 3AO5A 3AVFA 4N5SA 2RHKA 2FSJA 4Z4EA 2GTDA 3O3GA 4IWVA 4LF5K 3QEVA 4CK1A 3G10A 5F2RA 3OYGA 2D0OA 2Z1GA 1Q7YO 3TPQA 2D0PA 4FW2A 1TKTA 5JMVA 1E4GT 1GLLO 3CI5A 2O8CA 5DM7L 3AA4A 3SAGA 4FJNA 2YJFA 1NMNA 2WUSA 3VQDA 1S1XA 1FJGK 1UA0A 4GVMA 3OJUA 3HRGA 1HYZA 3MN7A 3D0PA 4W5NA 4KBOA 1K8KB 5ELZA 2Q36A 5GIOA 2UXCK 2A42A 5BR9A 1BHLA 4F2RA 5EY4A 4CJLA 4HHTA 3OYFA 3PO5A 3CG7A 4FZZA 1XNRK 2O8CB 3ZT3A 2J4RA 1IKVA 3SMPA 3J81O 1W7AA 5C0YA 2E2PA 4YDUC 4B1VA 3KIOA 4BVPA 1N34K 4A57A 2G8IA 1IG8A 4KTZA 4FWLA 4MLHA 1NGEA 4JNEA 3IMXA 1DEJA 1J9AA 2DPNA 5AQSA 1RBVA 3D2FA 1SL1A 3G0ZA 2UXDK 3KWIA 3NF6A 2FC0A 4FZYA 1N5YA 1REVA 4CGDA 1UOCA 3O9RA 1T44A 3THYB 1NU0A 5AJ3K 4BR5A 3L2VA 3BDPA 1T3VA 1SS6A 5J2QA 3FZLA 3MEGA 4M45A 2P9LA 1IKWA 2ITMA 3QIPA 2ATQA 4CI6A 4MDBA 1C0GA 3A8YA 1XMQK 1KTQA 1C1BA 4DLGA 5C10A 3EO3A 4CBXA 4LF4K 3V9ZA 3PO4A 1LV5A 2AJQA 3THWA 3B8AX 5KGXA 3IRXA 3CCJN 2NLXA 1VQON 3PSFA 3H1QA 5GINA 4M3RA 1QVGM 1EX4A 3J7YP 3SQ2A 2VYPA 1NJYA 4A2AA 3AGRA 4FM0A 4KH4A 3RMAA 4UY8O 1KCFA 5AQHA 1C0TA 4OKKA 3HBTA 1IBKK 1YJ9N 4M41A 4BE1A 1ZBHA 2D0CA 2P5OA 1UA1A 4K43A 1DKGD 1KVBA 4WYBA 2KKZA 4LF6K 2YCHA 1BWFO 3NH1A 4F4KA 2KFZA 3T1HK 5J2MA 4FJ9A 2JLEA 4ILHA 2E1YA 1OH6A 1NK4A 3LM2A 5KI6A 3OYNA 4K42A 4DTMA 4B3OA 3E66A 4LF8K 1BUPA 4NCBA 3TSQA 4ISFA 1YTUA 2O8FA 3O9QA 1C0UA 3VQEA 1OKJA 4W5OA 4FWRA 2O8EA 2P9SB 5AQUA 3DXKA 1VSLA 1BU6O 3WXKA 1GLDG 5M1KA 1Y64A 4OPJA 5K14A 1RDCA 5I42A 3M5RA 3DLKA 4DTSA 2O8FB 4AHSA 1RT6A 1X1PA 2KZZA 3DRSA 3LANA 2OANA 4O8UA 1W0HA 1NGHA 4ISGA 3KLIA 3LP1A 5TKYA 4ZTJA 5AQTA 3VF2A 4PKIA 5EVZA 2GWJA 2Q0UA 1NK9A 3V9WA 3CJBA 3NF9A 3N4QA 3VESA 4ID1A 4V19S 2P5GA 1JL1A 1XQSC 1HKBA 4B8AB 5ADXA 4DV1K 2AP1A 1DTTA 4YHHK 1ATRA 4B3MK 1QZ6A 4JI4K 1TYQB 1X9WA 4C8NA 4B3TK 1FKOA 1W9HA 4CJUA 2FSKA 3DM2A 3HOSA 3AVLA 4KAZA 4YOXA 4FLVA 4FK0A 1VQ4N 3G6EN 3HVRA 2VWKA 3R9PA 3VQQA 4BQZA 4Z94A 3SAHA 4C8LA 4LSLA 1F21A 4CCHA 2UXBK 4PY5A 1ILYA 3CQ8A 1VSKA 3LALA 3A5MC 4FJGA 4EAHD 2YKMA 3RR8A 4JD2A 4WQ5C 1DT9A 4BDZA 4DKWA 1VSMA 4Y1CA 1YXQA 5KQ8A 3K5LA 2WTUA 1WSJA 3AVGA 4CZKA 3K9KA 4FJHA 2ASPA 1U2VB 3TABA 1EXQA 4U67L 4E1NA 3CCQN 2A3ZA 3O9UA 4FJXA 2VWBA 4PQUA 3C6AA 1ASWA 1XHXA 3IG1A 5AQOA 3I0SA 1TK0A 2P9IB 1LW2A 5AQFA 2GUIA 2XO7A 2YHWA 3ZT1A 4BRFA 4JKAA 5F0XA 4W5QA 2XY5A 3SJHA 4CJVA 3SYZA 1HNIA 1K6YA 4FLZA 2CGJA 4O8KA 1VSEA 4A5BA 2OPRA 3KLEA 4E7JA 3ZSVA 3FFKB 2WFBA 1HNZK 4DV5K 1OH5A 2QI2A 1W97L 3M8PA 4R79A 1HNXK 3DAWA 4LF7K 3O1BA 4B3RK 1KVAA 4LH5A 4IKFA 4DR4K 3DLLL 5T7BA 1RTIA 4IFVA 4ISEA 4O0IA 3P39A 4Q0BA 3S41A 3TI0A 4JRPA 1JLEA 4JK7A 3WNHA 1ZBFA 3C6UA 5AQPA 3SPYA 5MLCQ 4CEOA 5GADP 1EWQA 1KQSM 4CZJA 3H45C 1VSDA 1JLQA 1LCUA 3W3DA 1QSLA 3OYLA 4CHYA 4CJ4A 4KTWA 1VAZA 4CFDA 5HOOA 2RKIA 1BQNA 2G8HA 4KO0A 1BI4A 5AQQA 4PHTX 3WUHA 3VMFB 1VK0A 2YV0X 1YT3A 4BC4A 1G15A 2ITGA 1NJWA 1RTDA 4J2EA 4C8OA 3VERA 2KQ2A 1NGFA 4BR0A 3AV9A 3FE1A 3ZLJA 3UKUA 2HHWA 3DLBA 5AR0A 1X9SA 1TKDA 4CJEA 1L3UA 4B9NA 4XIUA 1YJNN 1T05A 4M3WA 1C0MA 4XEIA 4ELVA 1VSJA 3WXLA 4EP4A 3IFRA 3QDKA 4DQQA 3EN9A 1C1CA 1WN7A 2VGMA 4IOCL 2EHGA 3FZHA 3L4QA 3L0QA 3CETA 2Y1IA 3MECA 2QWLA 5E84A 3MN9A 3HP6A 3HOTA 1BG3A 5A2QO 3QEIA 2E2NA 3ZEUA 3ZETB 1QS4A 5FROA 2QWNA 1TGOA 3O5BA 4DQSA 4FJLA 4BC5A 1NJZA 2Q31A 2KHOA 5CR4A 2HBKA 5AQNA 5C42A 4C8KA 4PA1A 3ENHA 3UKRB 4E7HA 1KXPA 4H8KA 1BIUA 4DTOA 3TAGA 1VQ5N 4AHUA 1NK7A 4QS9A 3EL2A 3EZ5A 3TSUA 3CFPA 2HHSA 2NRHA 3SZ2A 1H1VA 2QK9A 4BREA 2F9WA 2HBJA 3FZKA 3LZJA 1BIZA 4H0XB 4A61A 4I6MB 1CXQA 3OYBA 3C6HA 2BTFA 4IXCA 3LWMA 1HNWK 1TVRA 4RW9A 4BRIA 3OJSA 1J6ZA 4DLEA 4FJ8A 3IUCA 3L2WA 3LWLA 2HB5A 4UQGA 3HP9A 4BWMA 3TARA 4CVNE 1A5VA 3F9KA 5KRSA 4YOWA 4JYAK 3QINA 1VQ6N 4CZEA 2Q3SA 1QHAA 2YKNA 4NXMK 3ZSZA 1BO5O 3SJJA 3CM5A 3KTQA 3AVAA 4CZGA 1I39A 4FJJA 1BA1A 2E2OA 3ID6A 2NUBA 3BP8A 1VQLN 4IOAL 5JS2A 4E19A 3VTIA 1J53A 5BPMA 2CGLA 1NGGA 2G8WA 2O8DA 1MA9B 4JKDA 1R59O 1RFQA 3BEXA 2A6AA 3E01A 4DSEA 1RT5A 2WONA 2XY8A 2F7TA 4H0PA 3HPOA 1EQYA 5DM6L 2HBLA 4B9SA 5C24A 1WSFA 1ITGA 4PKGA 4X65K 2IDOA 4BG9A 2E2QA 1VQ9N 3V9UA 3W0LA 4JKFA 4JI0K 2HNDA 4JI5K 1FXXA 4CBUA 4H0TB 2NRZA 1N6QA 1JXEA 4BVOA 3M8RA 1ASVA 2GUPA 4LD0A 2HHQA 4MO5A 3S3MA 1XI1A 4CBWA 1LAWA 4A5AA 1NK6A 1SZ2A 4ID5A 4RWTA 2DY4A 1S5JA 4FZXC 1VSHA 4DFKA 1Y97A 2YHBA 3AO3A 3CC2N 1U47A 3IDHA 3CYMA 4GW6A 3NE6A 2NRVA 4H03B 1HRHA 1J5EK 3THXB 1YJWN 3K57A 2XY7A 2DTUA 2E4LA 3P83D 3EZWA 3ITHA 2UUBK 4C1NK 3KK3A 3TAQA 3FR0A 4DV7K 3SUPA 3VTHA 3KK7A 3DLRA 3C95A 2JWLA 1TAQA 4M3UA 1VSFA 2GWKA 3KJVA 1U45A 5M1PA 2O8BB 2W41A 1HJRA 3CM6A 1BA0A 1NM1A 2HF3A 3B6OA 3VF4A 2RE2A 4LSNA 4M7YA 3O1WA 4YFUA 1TUUA 4FWOA 2Z1IA 4OLAA 4DUYK 3CPWM 1QVFM 3FLCO 5AFUA 1GLBG 1NGAA 3E9PA 4CGFA 5IT9O 4FVMA 3HVTA 4MQ3A 4C8MA 3SK3A 1C1AA 2OYQA 4B1XB 1WAFA 4BRPA 1RT3A 5HROA 4AILC 4FYDA 2PAVA 4MO4A 4QS7A 4CE9A 2D5RA 4KHQA 1TV6A 1K8KA 3ATVA 2D0BA 3FZFA 4CJPA 4HUGA 4JI3K 3C7NA 4E0DA 4IDKA 5HRSA 1ZC6A 3CCVN 3FZMA 3CCRN 1N36K 3NHGA 5TKWA 4PL8A 4B1ZA 3F5TA 3ZCMA 4BC3A 1P8ZA 2JGUA 4BGAA 4KHUA 4N47A 4LC9B 3M1FA 4EHTA 3I55N 3U9ZA 2UUAK 4KKOA 4M7XA 1D8YA 3C7NB 2RF2A 3OYJA 1JLBA 1IV0A 4BROA 1J54A 1RBRA 4CGGA 1ASUA 1NK5A 2E5LK 2HVHA 3OVNA 4O0JA 3KLHA 3N4PA 2QXLA 4DSJA 4DR7K 4NCGA 3THYA 3H6EA 2FBYA 3J8AA 3ZSWA 4YORA 1KVCA 1IKYA 2GELA 4Y0WA 4DU1A 1JCFA 3M3ZA 4Z0UA 4IBNA 3O4WA 4B1YB 3KK2A 3IKMA 3AVKA 3HJFA 4I2QA 5BPNA 4Z4IA 4IZ9A 4OO1J 1JLAA 1T6CA 4BR2A 3DLHA 5LMNK 1VQNN 3NH2A 4DF4A 1S72N 1Q86O 3L2QA 2PZSA 3OS0A 4CFAA 5H1SQ 4BE2A 4XH1A 4Y1DA 4QAGA 3PV8A 1SAZA 3DRRA 1YF5L 4Q5VA 3CXCM 4YDUA 3CC4N 4CJQA 2IAJA 3OYIA 3CJAA 4A2BA 3M6GA 3MX5A 3NCIA 3TAMA 5JICA 3IAYA 2P9KB 2ZGYA 2IGIA 1S6QA 4E7IA 1GLFO 1WAJA 3SBGA 3JYTA 3AA3A 1ESVA 3OHRA 5SWMA 3FGUA 3ULEA 2FBXA 5BRDA 4BY9C 4K41A 4OGCA 4B1WB 2VQEK 1VQKN 4JEPA 1IO2A 1J5OA 3MN5A 4I2PA 2PFUA 4HWIA 5C25A 1C0FA 3MDQA 3R3LA 3ZT4A 5GAGP 3UB5A 4CF2A 5CY4A 3H3OB 4GVEA 4DV0K 3C6TA 1UWBA 3ULEB 4M3XA 2VG6A 2P9SA 4DFPA 3KKSA 5J1EA 1Q8IA 2GV9A 4C23A 4DS5A 2F9TA 1TUYA 3EKSA 1RILA 3QMLA 1X3MA 4EP5A 1XMOK 4DSKA 3WQUA 4RW4A 5KPZA 3K59A 3TAFA 1S1TA 3MEDA 3KD5E 2OPQA 2YNGA 4CFBA 3R8EA 4A62A 1XUPO 2HMIA 5AZJB 3CMAN 2YI1A 3QBWA 4F8RA 4AM7A 3TSPA 3G4SN 3WT0A 3U3YA 2D4WA 3DLGA 4JAXA 4CHZA 4DTNA 3P38A 5KQDA 1Q82O 2HBMA 3EKUA 3KHYA 4LFAK 4WFAL 3NFAA 2OPSA 4CF9A 2AA4A 1KRPA 1N33K 3PX6A 3GL1A 3AY9A 1TYQA 3DXMB 3A0IX 3JAMO 4QCLA 2ZQBA 4LY7A 1NWKA 5AQYA 3H1VX 3ISNC 3F2KA 2QEXN 1XHZA 3NAEA 1Q81O 4JI6K 3LDQA 1ZBUA 3NGIA 3QNOA 1GLCG 4DUZK 2KFNA 2FSNA 1MWKA 4KTQA 1RBTA 3O8MA 4DG1A 2ETJA 4ZHRA 4DQPA 4KPYA 2DFEA 1VRTA 3QO9A 3NDKA 5C15A 2P9PB 2NRRA 1M1KO 3EE8A 3VQ8A 2RN2A 2P51A 3OYAA 4OX9K 1X9JA 2I7PA 2VWJA 1D9DA 1DTQA 1HLUA 1N32K 5AQJA 4IO9L 2OCEA 3LM9A 4BACA 1U2VA 1QQNA 1RT2A 1SV5A 2IS3A 3MK6A 3HI0A 4B8CA 3VEWA 1EO1A 3J7AP 3V1RA 4FW1A 4FWKA 4DFJA 3NVKA 4DR2K 4WQ4C 3ZX3A 1S1UA 4B08A 2R7YA 2ZJRL 3MWPA 2P9IA 5J2NA 3HM8A 2QTDA 5AQMA 4W5TA 3ZSOA 3CCSN 3EEQA 4DTUA 4FPBA 4K0KK 3AO2A 3AVNA 3VEOA 3CJ1A 3PSIA 2D1KA 1CLQA 3OY9A 1S9GA
chains in the Genus database with same CATH topology
1NOZA 4KB1A 4E7HA 3QLHA 4H8KA 1BIUA 2EX3A 3HL8A 3MXJA 1TL1A 4DTOA 3TAGA 4AHUA 4KPYA 1YVUA 4BE0A 4CHQA 1NK7A 3K5OA 1HYSA 1JKHA 3JSMA 2FBVA 3EZ5A 3CFPA 2HHSA 3AVBA 2A1RA 1U48A 3SZ2A 4M3TA 4Z4CA 2QK9A 1B92A 1VSIA 3AVCA 3K2PA 4J2DA 1RTJA 3LZJA 4HCBA 4DFMA 4DU4A 1BIZA 4MFBA 3TAEA 1CXQA 3OYBA 3DMJA 1U4BA 1X9MA 3LWMA 1B9DA 4L8RB 2F8SA 3RRHA 1TVRA 4RW9A 3OJSA 4CGHA 2YNHA 4DLEA 1T03A 3NBPA 4FJ8A 4M42A 4N76A 3AO5A 1S6PA 3AVFA 3L2WA 4I7FA 4N5SA 2HB5A 4UQGA 3HP9A 4BWMA 3LWLA 2Y1JA 3TARA 2OPPA 4Z4EA 3O3GA 4IG0A 3LP3A 1A5VA 3QEVA 4CK1A 2Z1JA 3F9KA 3G10A 5KRSA 3QINA 3OYGA 3TANA 2Z1GA 2Q3SA 2YKNA 3ZSZA 4FW2A 1TKTA 4J2AA 2E6MA 2HW3A 3SJJA 2KW4A 3CM5A 4AHRA 3AVAA 3KTQA 1I39A 1RDBA 3AA4A 4FJJA 4FJNA 5EU7A 2G8KA 4K8XA 1SUQA 4KREA 3T19A 3VQDA 2NUBA 3A2FA 1S1XA 1UA0A 4GVMA 5JS2A 3OJUA 4E19A 1HYZA 3D0PA 4KFBA 4W5NA 1J53A 1T7PA 4FLYA 4OLBA 2VG5A 3ZSYA 2G8WA 3V1QA 4ZTFA 1BQMA 3E01A 1WSHA 2B5JA 4DSEA 3AO4A 1RT5A 2WONA 3DI6A 1BHLA 2XY8A 4CIFA 3SI6A 3DRPA 3HPOA 4F2RA 4HHTA 4CJLA 3OYFA 3PO5A 1D5AA 3CG7A 4DTJA 2ZD1A 3VQBA 4B9SA 4FZZA 5C24A 3ZT3A 4F3TA 1WSFA 4CJFA 1ITGA 4CJ3A 3VQ7A 4FJMA 1IKVA 1SL1A 2QKBA 3EYZA 1BISA 5E41A 2HVIA 2IDOA 1TKXA 1SKWA 3AVIA 5HBMA 3KIOA 4CJWA 3OYHA 4CEQA 3V9UA 2F8TA 3QNNA 2IOCA 3V4IA 4BDYA 4CERA 2HNDA 2G8IA 3O4NA 1FXXA 4M3ZA 3S3NA 4RG8A 4HUFA 1N6QA 4KTZA 4B9UA 1JXEA 3M8RA 1ASVA 4OGEA 5SZTA 4LD0A 2HHQA 3S3MA 1UAXA 1XI1A 1Q9YA 2LSNA 1RBUA 1LAWA 5I3UA 3AO1A 1J9AA 4KB0A 1NK6A 1WSEA 4ID5A 3WNFA 1RBVA 4DTPA 1Z26A 4NYFA 1S5JA 3G0ZA 1ZBLA 2DFHA 3K5MA 4FZXC 1VSHA 4J2EA 3PX0A 4DFKA 1Y97A 2YHBA 3AO3A 3NF6A 2FC0A 4DSFA 4FZYA 1WSIA 4DU3A 3OY9A 1N5YA 1REVA 4CGDA 3OS2A 1U47A 1KLNA 1UOCA 3CYMA 4ICLA 4CEFA 4B9TA 4GW6A 3QEPA 3NE6A 3OYMA 4FJIA 4CK3A 1B9FA 4E89A 1HRHA 3L2VA 3BDPA 3SUNA 3C94A 2QKKA 5J2QA 3MEGA 4M45A 4CESA 1XWLA 3I8DA 1IKWA 1TAUA 1HYVA 3K57A 3DLEA 2XY7A 2DTUA 3QIPA 2ATQA 1IH7A 2E4LA 3P83D 3ITHA 1KTQA 3HT3A 3KK3A 3TAQA 1R0AA 1C1BA 4DLGA 4OKJA 3SUPA 2X78A 2O4IA 3ZT0A 4WE1A 4O4GA 3V9ZA 1EKEA 3PO4A 1IKXA 3D45A 1LV5A 4RW6A 3DLRA 4PUOA 4EZ9A 3C95A 3LAMA 2AJQA 4J2BA 5KGXA 1TAQA 3HPGA 2PYLA 3V9XA 3IRXA 4B9LA 4M3UA 1VSFA 2XY6A 3OYDA 3KJVA 1U45A 3HXMA 1EETA 4M3RA 1HJRA 1EX4A 2YNIA 3CM6A 4FJ5A 2DY4A 3HYFA 5CZ1A 3B6OA 1GOAA 3SQ2A 3EY1A 1SL0A 1O1WA 4JLHA 4LSNA 5FRNA 1NJYA 3DYAA 3OYCA 4YFUA 4EZ6A 4PWDA 3KD1E 2Z1IA 4FM0A 4OLAA 1L3VA 3HO1A 4IG3A 1RBSA 3RMAA 1KCFA 4KHSA 1KLMA 4CGFA 4E7KA 4FLXA 1C0TA 4FVMA 3HVTA 4OKKA 4MQ3A 4C8MA 2DFFA 3V6DA 4M41A 4BE1A 1HPZA 1C1AA 1ZBHA 1LWEA 2OYQA 1WAFA 4W5RA 1RT3A 2D0CA 4B9MA 1RDAA 5HROA 2P5OA 4AILC 1UA1A 1FKPA 4FYDA 1KVBA 3WNEA 4CE9A 4O55A 2HHUA 2D5RA 4KHQA 3NH1A 1TV6A 1BGXT 4F4KA 1WNSA 2KFZA 3U3GA 5J2MA 4FJ9A 2D0BA 2JLEA 2YHAA 1TK5A 4B9VA 1NK4A 3LPUA 4AH9A 5KI6A 4CJPA 3OYNA 4HUGA 1Z25A 4I9LA 4RW7A 4DTMA 4E0DA 4IDKA 3L2UA 4B3OA 5HRSA 4KI6A 4NCBA 5KGWA 4DMNA 1YTUA 2KZMA 1YTAA 3QEWA 4QOZB 3SPZA 3NHGA 5HLFA 1C0UA 3PUFA 3ZCMA 1S1WA 3VQEA 4AHVA 5KRTA 3L8BA 2X6NA 2WOMA 2JGUA 4W5OA 4F2SA 4CEZA 2OZSA 4N47A 4KHUA 4OKEA 1LWCA 3V9SA 3THVA 1VSLA 1HQEA 4ELTA 4KKOA 1D8YA 4OVLA 4O44A 4OPJA 1KFDA 5K14A 1RDCA 4AHCA 1NKCA 5I42A 3OYJA 2RF2A 1JLBA 3DLKA 4FK2A 3DOLA 1RT4A 4DS4A 4DTSA 1J54A 1RBRA 2HHTA 3TR8A 1BL3A 3TAPA 4AHSA 1ASUA 4CGGA 1NK5A 1TKZA 1RT6A 1X1PA 1XC9A 3M8SA 2KZZA 3DRSA 3LANA 5HRRA 3CFRA 1W0HA 4Z4GA 4Z4HA 2HVHA 3CFOA 3KLIA 3LP1A 4I9QA 3SNNA 3OVNA 4FJKA 4O0JA 3KLHA 4ZTJA 1CZBA 3M8QA 3QIOA 4IFYA 4DSJA 3PY8A 3AVMA 1VRUA 4NCGA 3OS1A 3V81A 2G8FA 4BWJA 1DLOA 1NK9A 4AHTA 4FM1A 2I5JA 2FBYA 3ZSWA 3NH0A 3V9WA 3NF9A 3SUQA 3IS9A 1KVCA 1IKYA 4FLUA 4ID1A 4K8ZA 2P5GA 5CYQA 1JL1A 4KI4A 3LP2A 3RR7A 2GBZA 4B8AB 4DU1A 4CJRA 4E1MA 1QE1A 4Z0UA 1DTTA 1RNHA 4IBNA 4JS5A 3HSTB 4RW8A 3KK2A 5J2PA 3U6FA 4FXDA 2BE2A 3LDSA 3AVKA 3HPHA 1QHTA 3QETA 1X9WA 3HJFA 4I2QA 1RT7A 4Z4IA 1JLFA 4C8NA 1NK0A 3VQ5A 1FKOA 1JLAA 1W9HA 4CJUA 1EP4A 1T8EA 3DLHA 3BGRA 3DM2A 3NH2A 4DF4A 4E3SA 1KFSA 3AVLA 3P1GA 3L2QA 4KAZA 2PZSA 1LW0A 2X6SA 4FLVA 4FK0A 4TSXA 3OS0A 1BCOA 4GMJB 3VA0A 1A5WA 4CFAA 3HVRA 2VWKA 3VQQA 4BE2A 1NJXA 4C8LA 2KTQA 1BI4B 4CHNA 4LSLA 3MXMA 3ZSRA 4Y1DA 1F21A 4CK2A 4N56A 4CCHA 3VA3A 4PY5A 2HHXA 3RMDA 4QAGA 2X74A 3NF7A 3AVJA 3CQ8A 3PV8A 2PY5A 1VSKA 3ZSQA 3DOKA 3LALA 4DTRA 3DRRA 4Q5VA 1BCMA 4M3YA 2FBTA 4FJGA 4HTUA 2YKMA 4CJQA 3B6PA 4FM2A 1NKEA 1D9FA 4CGJA 2IAJA 3RR8A 3OYIA 5JS1A 4BDZA 3NCIA 5D3GA 3TAMA 1QSYA 3IAYA 4CEBA 1FK9A 2IGIA 1S6QA 4E7IA 3RRGA 1QSSA 3I0RA 4ELUA 1WAJA 3SQ4A 1SL2A 1VSMA 4KV8A 3AA3A 3JYTA 4DSIA 1GOBA 5SWMA 4Y1CA 2BANA 3AA5X 3L2RA 3MEEA 2FBXA 3K5LA 3LZIA 1HMVA 3SV3A 1SKRA 4H4MA 1NOYA 1WLJA 4H4OA 4KHNA 1WSJA 3AVHA 3AVGA 4OGCA 1RTHA 5DK5A 3QESA 3SQ0A 3LPTA 3F73A 3VQPA 1IO2A 1J5OA 4DQIA 4FJHA 4I2PA 1U04A 3SV4A 3TABA 1EXQA 5C25A 4E1NA 4FJXA 3RMCA 4G1QA 4PQUA 1ASWA 1XHXA 1QQCA 3ZT4A 4CF2A 1IG9A 4OPKA 1S1VA 5CY4A 3WNGA 4JRQA 3IG1A 4FCYA 1S9EA 3KLFA 3I0SA 1TK0A 3C6TA 1UWBA 4M3XA 2YNFA 1LW2A 2VG6A 2GUIA 2XO7A 3SCXA 3L3UA 4DFPA 3KKSA 3ZT1A 4NCAA 2D0AA 5CYMA 3AA2A 5FDLA 1GOCA 3VQ4A 4CEEA 4CIGA 5J1EA 1Q8IA 2GV9A 4DS5A 4KRFA 1NKBA 1RILA 4DWIA 3LAKA 4W5QA 4EP5A 2XY5A 1WSGA 2XRIA 4RW4A 4CJVA 3MAQA 3K59A 3TAFA 4DSKA 1S1TA 3MEDA 4FLWA 2OPQA 2YNGA 4CFBA 3SYZA 3KD5E 2O4GA 3UIQA 1HNIA 1K6YA 4CHOA 1KSPA 4CHPA 4O5BA 2HMIA 1ZBIA 4E7LA 4FLZA 1SKSA 4F8RA 3S9HA 1VSEA 3KLEA 2OPRA 4E7JA 3ZSVA 4CEAA 4DQRA 3KK1A 3HM9A 1JLGA 3M8PA 3U3YA 2G8VA 1RT1A 1KVAA 3DLGA 4OJRA 4LH5A 4IKFA 3VQCA 4CJSA 4CJKA 5T7BA 2BGGA 1RTIA 4IFVA 4O0IA 2RPIA 4HCCA 4CHZA 4DTNA 4Q0BA 2HHVA 3VQ6A 2VG7A 3QEXA 3TI0A 4JRPA 1MU2A 2A1SA 1JLEA 3WNHA 1ZBFA 3C6UA 3SPYA 4CEOA 3NFAA 2OPSA 4CF1A 2HNYA 4CF9A 4YNQA 4LH4A 1VSDA 1JLQA 1RDDA 1KRPA 1A5XA 4JS4A 3PX6A 1QSLA 3OYLA 4CHYA 3ZT2A 4QCLA 2ZQBA 4R5PA 4LY7A 3PX4A 4CJ4A 3QERA 4KTWA 3ISNC 4CFDA 1CXUA 2RKIA 3RMBA 3ZSXA 1JLCA 3NAEA 1XHZA 4N41A 2B4JA 3T1AA 4KHWA 1ZBUA 1BQNA 2XHBA 3NGIA 2PYJA 3ULDA 2G8HA 3NGYA 3VQAA 4KO0A 4CECA 3QNOA 4CJ5A 2F96A 1Q9XA 5DMRA 1BI4A 2KFNA 3LP0A 1I3AA 4DF8A 1LWFA 3OYKA 4CF0A 4F3OA 4KTQA 1VK0A 1RBTA 2YV0X 1YT3A 4DSLA 1G15A 2ETJA 3ASMA 4DG1A 4FJ7A 2ITGA 2E6LA 4ZHRA 2OZMA 3SUOA 1NJWA 1RTDA 5KTQA 4C8OA 2KQ2A 2DFEA 1L3SA 1CZ9A 4DQPA 1VRTA 1TL3A 3QO9A 3NDKA 2BDPA 3AV9A 3HK2A 2OA8A 3KLGA 4CFCA 2HHWA 4CF8A 2B6AA 3VQ8A 1L5UA 4Z4FA 3DLBA 2RN2A 2ZE2A 3P5JA 2P51A 3OYAA 3ALYA 1X9SA 1TKDA 4CJEA 1NK8A 2VWJA 1L3UA 1D9DA 4B9NA 1DTQA 2Z1HA 1LAVA 4XIUA 4FLTA 1T05A 4M3WA 4HUEA 1C0MA 3VQ9A 3RTVA 2G8UA 4ELVA 1VSJA 1RCHA 4EP4A 3O3FA 3K5NA 1HQUA 4DQQA 4BACA 3NGZA 1C1CA 1RT2A 1SV5A 2IS3A 1JL2A 1WN7A 3MXIA 3L3VA 2EHGA 4B8CA 5CZ2A 3K58A 1JXBA 3V1RA 4FW1A 3O4QA 2W42A 4CEDA 3TWHA 3T3FA 4DFJA 3MECA 2Y1IA 3SQ1A 5HP1A 1L3TA 3S3OA 2QXFA 3FFIA 1S1UA 4B08A 3HP6A 2P1JA 5FRMA 2R7YA 5HRPA 4FK4A 5J2NA 4CIEA 5HRNA 3QEIA 4W5TA 3VN5A 1QTMA 3ZSOA 4CGIA 4CJTA 4HVJA 1QS4A 5FROA 4DTXA 1TGOA 2HNZA 1C6VA 3OYEA 4DTUA 3NF8A 4DQSA 4FJLA 3AO2A 3AVNA 3H08A 3KKRA 1NJZA 1TK8A 1ZYQA 1CLQA 3V1OA 2IC3A 3RWUA 5C42A 1U49A 4KHYA 4C8KA 4BDPA 4NYNA 4PA1A 1S9GA 3O3HA 1HNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NOZ A;  4KB1 A;  4E7H A;  3QLH A;  4H8K A;  1BIU A;  2EX3 A;  3HL8 A;  3MXJ A;  1TL1 A;  4DTO A;  3TAG A;  4AHU A;  4KPY A;  1YVU A;  4BE0 A;  4CHQ A;  1NK7 A;  3K5O A;  1HYS A;  1JKH A;  3JSM A;  2FBV A;  3EZ5 A;  3CFP A;  2HHS A;  3AVB A;  2A1R A;  1U48 A;  3SZ2 A;  4M3T A;  4Z4C A;  2QK9 A;  1B92 A;  1VSI A;  3AVC A;  3K2P A;  4J2D A;  1RTJ A;  3LZJ A;  4HCB A;  4DFM A;  4DU4 A;  1BIZ A;  4MFB A;  3TAE A;  1CXQ A;  3OYB A;  3DMJ A;  1U4B A;  1X9M A;  3LWM A;  1B9D A;  4L8R B;  2F8S A;  3RRH A;  1TVR A;  4RW9 A;  3OJS A;  4CGH A;  2YNH A;  4DLE A;  1T03 A;  3NBP A;  4FJ8 A;  4M42 A;  4N76 A;  3AO5 A;  1S6P A;  3AVF A;  3L2W A;  4I7F A;  4N5S A;  2HB5 A;  4UQG A;  3HP9 A;  4BWM A;  3LWL A;  2Y1J A;  3TAR A;  2OPP A;  4Z4E A;  3O3G A;  4IG0 A;  3LP3 A;  1A5V A;  3QEV A;  4CK1 A;  2Z1J A;  3F9K A;  3G10 A;  5KRS A;  3QIN A;  3OYG A;  3TAN A;  2Z1G A;  2Q3S A;  2YKN A;  3ZSZ A;  4FW2 A;  1TKT A;  4J2A A;  2E6M A;  2HW3 A;  3SJJ A;  2KW4 A;  3CM5 A;  4AHR A;  3AVA A;  3KTQ A;  1I39 A;  1RDB A;  3AA4 A;  4FJJ A;  4FJN A;  5EU7 A;  2G8K A;  4K8X A;  1SUQ A;  4KRE A;  3T19 A;  3VQD A;  2NUB A;  3A2F A;  1S1X A;  1UA0 A;  4GVM A;  5JS2 A;  3OJU A;  4E19 A;  1HYZ A;  3D0P A;  4KFB A;  4W5N A;  1J53 A;  1T7P A;  4FLY A;  4OLB A;  2VG5 A;  3ZSY A;  2G8W A;  3V1Q A;  4ZTF A;  1BQM A;  3E01 A;  1WSH A;  2B5J A;  4DSE A;  3AO4 A;  1RT5 A;  2WON A;  3DI6 A;  1BHL A;  2XY8 A;  4CIF A;  3SI6 A;  3DRP A;  3HPO A;  4F2R A;  4HHT A;  4CJL A;  3OYF A;  3PO5 A;  1D5A A;  3CG7 A;  4DTJ A;  2ZD1 A;  3VQB A;  4B9S A;  4FZZ A;  5C24 A;  3ZT3 A;  4F3T A;  1WSF A;  4CJF A;  1ITG A;  4CJ3 A;  3VQ7 A;  4FJM A;  1IKV A;  1SL1 A;  2QKB A;  3EYZ A;  1BIS A;  5E41 A;  2HVI A;  2IDO A;  1TKX A;  1SKW A;  3AVI A;  5HBM A;  3KIO A;  4CJW A;  3OYH A;  4CEQ A;  3V9U A;  2F8T A;  3QNN A;  2IOC A;  3V4I A;  4BDY A;  4CER A;  2HND A;  2G8I A;  3O4N A;  1FXX A;  4M3Z A;  3S3N A;  4RG8 A;  4HUF A;  1N6Q A;  4KTZ A;  4B9U A;  1JXE A;  3M8R A;  1ASV A;  4OGE A;  5SZT A;  4LD0 A;  2HHQ A;  3S3M A;  1UAX A;  1XI1 A;  1Q9Y A;  2LSN A;  1RBU A;  1LAW A;  5I3U A;  3AO1 A;  1J9A A;  4KB0 A;  1NK6 A;  1WSE A;  4ID5 A;  3WNF A;  1RBV A;  4DTP A;  1Z26 A;  4NYF A;  1S5J A;  3G0Z A;  1ZBL A;  2DFH A;  3K5M A;  4FZX C;  1VSH A;  4J2E A;  3PX0 A;  4DFK A;  1Y97 A;  2YHB A;  3AO3 A;  3NF6 A;  2FC0 A;  4DSF A;  4FZY A;  1WSI A;  4DU3 A;  3OY9 A;  1N5Y A;  1REV A;  4CGD A;  3OS2 A;  1U47 A;  1KLN A;  1UOC A;  3CYM A;  4ICL A;  4CEF A;  4B9T A;  4GW6 A;  3QEP A;  3NE6 A;  3OYM A;  4FJI A;  4CK3 A;  1B9F A;  4E89 A;  1HRH A;  3L2V A;  3BDP A;  3SUN A;  3C94 A;  2QKK A;  5J2Q A;  3MEG A;  4M45 A;  4CES A;  1XWL A;  3I8D A;  1IKW A;  1TAU A;  1HYV A;  3K57 A;  3DLE A;  2XY7 A;  2DTU A;  3QIP A;  2ATQ A;  1IH7 A;  2E4L A;  3P83 D;  3ITH A;  1KTQ A;  3HT3 A;  3KK3 A;  3TAQ A;  1R0A A;  1C1B A;  4DLG A;  4OKJ A;  3SUP A;  2X78 A;  2O4I A;  3ZT0 A;  4WE1 A;  4O4G A;  3V9Z A;  1EKE A;  3PO4 A;  1IKX A;  3D45 A;  1LV5 A;  4RW6 A;  3DLR A;  4PUO A;  4EZ9 A;  3C95 A;  3LAM A;  2AJQ A;  4J2B A;  5KGX A;  1TAQ A;  3HPG A;  2PYL A;  3V9X A;  3IRX A;  4B9L A;  4M3U A;  1VSF A;  2XY6 A;  3OYD A;  3KJV A;  1U45 A;  3HXM A;  1EET A;  4M3R A;  1HJR A;  1EX4 A;  2YNI A;  3CM6 A;  4FJ5 A;  2DY4 A;  3HYF A;  5CZ1 A;  3B6O A;  1GOA A;  3SQ2 A;  3EY1 A;  1SL0 A;  1O1W A;  4JLH A;  4LSN A;  5FRN A;  1NJY A;  3DYA A;  3OYC A;  4YFU A;  4EZ6 A;  4PWD A;  3KD1 E;  2Z1I A;  4FM0 A;  4OLA A;  1L3V A;  3HO1 A;  4IG3 A;  1RBS A;  3RMA A;  1KCF A;  4KHS A;  1KLM A;  4CGF A;  4E7K A;  4FLX A;  1C0T A;  4FVM A;  3HVT A;  4OKK A;  4MQ3 A;  4C8M A;  2DFF A;  3V6D A;  4M41 A;  4BE1 A;  1HPZ A;  1C1A A;  1ZBH A;  1LWE A;  2OYQ A;  1WAF A;  4W5R A;  1RT3 A;  2D0C A;  4B9M A;  1RDA A;  5HRO A;  2P5O A;  4AIL C;  1UA1 A;  1FKP A;  4FYD A;  1KVB A;  3WNE A;  4CE9 A;  4O55 A;  2HHU A;  2D5R A;  4KHQ A;  3NH1 A;  1TV6 A;  1BGX T;  4F4K A;  1WNS A;  2KFZ A;  3U3G A;  5J2M A;  4FJ9 A;  2D0B A;  2JLE A;  2YHA A;  1TK5 A;  4B9V A;  1NK4 A;  3LPU A;  4AH9 A;  5KI6 A;  4CJP A;  3OYN A;  4HUG A;  1Z25 A;  4I9L A;  4RW7 A;  4DTM A;  4E0D A;  4IDK A;  3L2U A;  4B3O A;  5HRS A;  4KI6 A;  4NCB A;  5KGW A;  4DMN A;  1YTU A;  2KZM A;  1YTA A;  3QEW A;  4QOZ B;  3SPZ A;  3NHG A;  5HLF A;  1C0U A;  3PUF A;  3ZCM A;  1S1W A;  3VQE A;  4AHV A;  5KRT A;  3L8B A;  2X6N A;  2WOM A;  2JGU A;  4W5O A;  4F2S A;  4CEZ A;  2OZS A;  4N47 A;  4KHU A;  4OKE A;  1LWC A;  3V9S A;  3THV A;  1VSL A;  1HQE A;  4ELT A;  4KKO A;  1D8Y A;  4OVL A;  4O44 A;  4OPJ A;  1KFD A;  5K14 A;  1RDC A;  4AHC A;  1NKC A;  5I42 A;  3OYJ A;  2RF2 A;  1JLB A;  3DLK A;  4FK2 A;  3DOL A;  1RT4 A;  4DS4 A;  4DTS A;  1J54 A;  1RBR A;  2HHT A;  3TR8 A;  1BL3 A;  3TAP A;  4AHS A;  1ASU A;  4CGG A;  1NK5 A;  1TKZ A;  1RT6 A;  1X1P A;  1XC9 A;  3M8S A;  2KZZ A;  3DRS A;  3LAN A;  5HRR A;  3CFR A;  1W0H A;  4Z4G A;  4Z4H A;  2HVH A;  3CFO A;  3KLI A;  3LP1 A;  4I9Q A;  3SNN A;  3OVN A;  4FJK A;  4O0J A;  3KLH A;  4ZTJ A;  1CZB A;  3M8Q A;  3QIO A;  4IFY A;  4DSJ A;  3PY8 A;  3AVM A;  1VRU A;  4NCG A;  3OS1 A;  3V81 A;  2G8F A;  4BWJ A;  1DLO A;  1NK9 A;  4AHT A;  4FM1 A;  2I5J A;  2FBY A;  3ZSW A;  3NH0 A;  3V9W A;  3NF9 A;  3SUQ A;  3IS9 A;  1KVC A;  1IKY A;  4FLU A;  4ID1 A;  4K8Z A;  2P5G A;  5CYQ A;  1JL1 A;  4KI4 A;  3LP2 A;  3RR7 A;  2GBZ A;  4B8A B;  4DU1 A;  4CJR A;  4E1M A;  1QE1 A;  4Z0U A;  1DTT A;  1RNH A;  4IBN A;  4JS5 A;  3HST B;  4RW8 A;  3KK2 A;  5J2P A;  3U6F A;  4FXD A;  2BE2 A;  3LDS A;  3AVK A;  3HPH A;  1QHT A;  3QET A;  1X9W A;  3HJF A;  4I2Q A;  1RT7 A;  4Z4I A;  1JLF A;  4C8N A;  1NK0 A;  3VQ5 A;  1FKO A;  1JLA A;  1W9H A;  4CJU A;  1EP4 A;  1T8E A;  3DLH A;  3BGR A;  3DM2 A;  3NH2 A;  4DF4 A;  4E3S A;  1KFS A;  3AVL A;  3P1G A;  3L2Q A;  4KAZ A;  2PZS A;  1LW0 A;  2X6S A;  4FLV A;  4FK0 A;  4TSX A;  3OS0 A;  1BCO A;  4GMJ B;  3VA0 A;  1A5W A;  4CFA A;  3HVR A;  2VWK A;  3VQQ A;  4BE2 A;  1NJX A;  4C8L A;  2KTQ A;  1BI4 B;  4CHN A;  4LSL A;  3MXM A;  3ZSR A;  4Y1D A;  1F21 A;  4CK2 A;  4N56 A;  4CCH A;  3VA3 A;  4PY5 A;  2HHX A;  3RMD A;  4QAG A;  2X74 A;  3NF7 A;  3AVJ A;  3CQ8 A;  3PV8 A;  2PY5 A;  1VSK A;  3ZSQ A;  3DOK A;  3LAL A;  4DTR A;  3DRR A;  4Q5V A;  1BCM A;  4M3Y A;  2FBT A;  4FJG A;  4HTU A;  2YKM A;  4CJQ A;  3B6P A;  4FM2 A;  1NKE A;  1D9F A;  4CGJ A;  2IAJ A;  3RR8 A;  3OYI A;  5JS1 A;  4BDZ A;  3NCI A;  5D3G A;  3TAM A;  1QSY A;  3IAY A;  4CEB A;  1FK9 A;  2IGI A;  1S6Q A;  4E7I A;  3RRG A;  1QSS A;  3I0R A;  4ELU A;  1WAJ A;  3SQ4 A;  1SL2 A;  1VSM A;  4KV8 A;  3AA3 A;  3JYT A;  4DSI A;  1GOB A;  5SWM A;  4Y1C A;  2BAN A;  3AA5 X;  3L2R A;  3MEE A;  2FBX A;  3K5L A;  3LZI A;  1HMV A;  3SV3 A;  1SKR A;  4H4M A;  1NOY A;  1WLJ A;  4H4O A;  4KHN A;  1WSJ A;  3AVH A;  3AVG A;  4OGC A;  1RTH A;  5DK5 A;  3QES A;  3SQ0 A;  3LPT A;  3F73 A;  3VQP A;  1IO2 A;  1J5O A;  4DQI A;  4FJH A;  4I2P A;  1U04 A;  3SV4 A;  3TAB A;  1EXQ A;  5C25 A;  4E1N A;  4FJX A;  3RMC A;  4G1Q A;  4PQU A;  1ASW A;  1XHX A;  1QQC A;  3ZT4 A;  4CF2 A;  1IG9 A;  4OPK A;  1S1V A;  5CY4 A;  3WNG A;  4JRQ A;  3IG1 A;  4FCY A;  1S9E A;  3KLF A;  3I0S A;  1TK0 A;  3C6T A;  1UWB A;  4M3X A;  2YNF A;  1LW2 A;  2VG6 A;  2GUI A;  2XO7 A;  3SCX A;  3L3U A;  4DFP A;  3KKS A;  3ZT1 A;  4NCA A;  2D0A A;  5CYM A;  3AA2 A;  5FDL A;  1GOC A;  3VQ4 A;  4CEE A;  4CIG A;  5J1E A;  1Q8I A;  2GV9 A;  4DS5 A;  4KRF A;  1NKB A;  1RIL A;  4DWI A;  3LAK A;  4W5Q A;  4EP5 A;  2XY5 A;  1WSG A;  2XRI A;  4RW4 A;  4CJV A;  3MAQ A;  3K59 A;  3TAF A;  4DSK A;  1S1T A;  3MED A;  4FLW A;  2OPQ A;  2YNG A;  4CFB A;  3SYZ A;  3KD5 E;  2O4G A;  3UIQ A;  1HNI A;  1K6Y A;  4CHO A;  1KSP A;  4CHP A;  4O5B A;  2HMI A;  1ZBI A;  4E7L A;  4FLZ A;  1SKS A;  4F8R A;  3S9H A;  1VSE A;  3KLE A;  2OPR A;  4E7J A;  3ZSV A;  4CEA A;  4DQR A;  3KK1 A;  3HM9 A;  1JLG A;  3M8P A;  3U3Y A;  2G8V A;  1RT1 A;  1KVA A;  3DLG A;  4OJR A;  4LH5 A;  4IKF A;  3VQC A;  4CJS A;  4CJK A;  5T7B A;  2BGG A;  1RTI A;  4IFV A;  4O0I A;  2RPI A;  4HCC A;  4CHZ A;  4DTN A;  4Q0B A;  2HHV A;  3VQ6 A;  2VG7 A;  3QEX A;  3TI0 A;  4JRP A;  1MU2 A;  2A1S A;  1JLE A;  3WNH A;  1ZBF A;  3C6U A;  3SPY A;  4CEO A;  3NFA A;  2OPS A;  4CF1 A;  2HNY A;  4CF9 A;  4YNQ A;  4LH4 A;  1VSD A;  1JLQ A;  1RDD A;  1KRP A;  1A5X A;  4JS4 A;  3PX6 A;  1QSL A;  3OYL A;  4CHY A;  3ZT2 A;  4QCL A;  2ZQB A;  4R5P A;  4LY7 A;  3PX4 A;  4CJ4 A;  3QER A;  4KTW A;  3ISN C;  4CFD A;  1CXU A;  2RKI A;  3RMB A;  3ZSX A;  1JLC A;  3NAE A;  1XHZ A;  4N41 A;  2B4J A;  3T1A A;  4KHW A;  1ZBU A;  1BQN A;  2XHB A;  3NGI A;  2PYJ A;  3ULD A;  2G8H A;  3NGY A;  3VQA A;  4KO0 A;  4CEC A;  3QNO A;  4CJ5 A;  2F96 A;  1Q9X A;  5DMR A;  1BI4 A;  2KFN A;  3LP0 A;  1I3A A;  4DF8 A;  1LWF A;  3OYK A;  4CF0 A;  4F3O A;  4KTQ A;  1VK0 A;  1RBT A;  2YV0 X;  1YT3 A;  4DSL A;  1G15 A;  2ETJ A;  3ASM A;  4DG1 A;  4FJ7 A;  2ITG A;  2E6L A;  4ZHR A;  2OZM A;  3SUO A;  1NJW A;  1RTD A;  5KTQ A;  4C8O A;  2KQ2 A;  2DFE A;  1L3S A;  1CZ9 A;  4DQP A;  1VRT A;  1TL3 A;  3QO9 A;  3NDK A;  2BDP A;  3AV9 A;  3HK2 A;  2OA8 A;  3KLG A;  4CFC A;  2HHW A;  4CF8 A;  2B6A A;  3VQ8 A;  1L5U A;  4Z4F A;  3DLB A;  2RN2 A;  2ZE2 A;  3P5J A;  2P51 A;  3OYA A;  3ALY A;  1X9S A;  1TKD A;  4CJE A;  1NK8 A;  2VWJ A;  1L3U A;  1D9D A;  4B9N A;  1DTQ A;  2Z1H A;  1LAV A;  4XIU A;  4FLT A;  1T05 A;  4M3W A;  4HUE A;  1C0M A;  3VQ9 A;  3RTV A;  2G8U A;  4ELV A;  1VSJ A;  1RCH A;  4EP4 A;  3O3F A;  3K5N A;  1HQU A;  4DQQ A;  4BAC A;  3NGZ A;  1C1C A;  1RT2 A;  1SV5 A;  2IS3 A;  1JL2 A;  1WN7 A;  3MXI A;  3L3V A;  2EHG A;  4B8C A;  5CZ2 A;  3K58 A;  1JXB A;  3V1R A;  4FW1 A;  3O4Q A;  2W42 A;  4CED A;  3TWH A;  3T3F A;  4DFJ A;  3MEC A;  2Y1I A;  3SQ1 A;  5HP1 A;  1L3T A;  3S3O A;  2QXF A;  3FFI A;  1S1U A;  4B08 A;  3HP6 A;  2P1J A;  5FRM A;  2R7Y A;  5HRP A;  4FK4 A;  5J2N A;  4CIE A;  5HRN A;  3QEI A;  4W5T A;  3VN5 A;  1QTM A;  3ZSO A;  4CGI A;  4CJT A;  4HVJ A;  1QS4 A;  5FRO A;  4DTX A;  1TGO A;  2HNZ A;  1C6V A;  3OYE A;  4DTU A;  3NF8 A;  4DQS A;  4FJL A;  3AO2 A;  3AVN A;  3H08 A;  3KKR A;  1NJZ A;  1TK8 A;  1ZYQ A;  1CLQ A;  3V1O A;  2IC3 A;  3RWU A;  5C42 A;  1U49 A;  4KHY A;  4C8K A;  4BDP A;  4NYN A;  4PA1 A;  1S9G A;  3O3H A;  1HNV A; 
#chains in the Genus database with same CATH topology
 4KB1 A;  3WXJ A;  1RDU A;  4BE0 A;  4CHQ A;  1I94 K;  3K5O A;  4JHD B;  2P9N B;  2FBV A;  4M3T A;  2P9U B;  4Z4C A;  1K73 O;  3CHW A;  3E9O A;  3K2P A;  1RTJ A;  4YOY A;  5BRH A;  3TAE A;  4IO8 A;  1X9M A;  3DMJ A;  1XNQ K;  4JKE A;  1HUX A;  1T03 A;  4M42 A;  3HZ6 A;  3CME N;  1S6P A;  4WQ5 A;  2OPP A;  3EE9 A;  4IG0 A;  3I33 A;  2Z1J A;  4K25 A;  4WCE L;  4J2A A;  3CJ7 A;  4GKK K;  3G25 A;  1RDB A;  4K8X A;  1SUQ A;  3T19 A;  1JCE A;  3BY5 A;  4FWP A;  4XH5 A;  4BRL A;  4KFB A;  1T7P A;  4BRK A;  4FLY A;  4H5W A;  3V1Q A;  1WSH A;  3QBX A;  4FL9 A;  3MMV A;  1NGD A;  4X66 K;  3DRP A;  1WBD A;  1D5A A;  3U8X A;  2E8A A;  4F3T A;  3VQ7 A;  3ENO A;  1NGC A;  4FJM A;  5B8H A;  3EYZ A;  2HVI A;  3ZX2 A;  4BGB A;  4NO7 A;  5HBM A;  2F8T A;  5FLX O;  2IOC A;  3OW2 M;  3I8B A;  1P90 A;  4BDY A;  3O4N A;  4M3Z A;  4B9U A;  4CZF A;  3F9M A;  4OGE A;  3K9J A;  1UAX A;  1HJO A;  3OA9 A;  2GX9 A;  4JN4 A;  2ASM A;  2IVP A;  3AO1 A;  4KB0 A;  1OVQ A;  3WNF A;  4NYF A;  4JI7 K;  3PX0 A;  2V51 B;  3GOI A;  4DSF A;  3ZET A;  1S22 A;  1WSI A;  4DU3 A;  3CF5 L;  1MWM A;  3OS2 A;  1KLN A;  4ICL A;  5LL6 Z;  4B9T A;  4CEF A;  3QEP A;  3NVM A;  4FJI A;  4CK3 A;  3J80 O;  1B9F A;  3C94 A;  3CQX A;  4CJ7 A;  1HYV A;  3UKR A;  4O5F A;  3VEY A;  4CD1 A;  3HT3 A;  3D2E A;  4XH4 A;  5ADX H;  2ZJP L;  2O4I A;  1G99 A;  3ZT0 A;  2E1Z A;  5C2F A;  3D45 A;  4RW6 A;  3CPE A;  4EZ9 A;  4J2B A;  3R6M A;  3HPG A;  2PYL A;  4I6M A;  3V9X A;  5AQZ A;  3OYD A;  4NB4 A;  4FWS A;  4H5T A;  1OH8 A;  3HYF A;  2I7N A;  1SL0 A;  3ID8 A;  4JLH A;  4JK8 A;  3D2E B;  5FRN A;  3OYC A;  1DGK N;  4EZ6 A;  4PWD A;  1YIT N;  1RBS A;  4KHS A;  1KLM A;  2ASO A;  3RSE B;  4W5R A;  5FPM A;  2ZF5 O;  3WNE A;  5BR8 K;  2GEM A;  1RGI A;  2HHU A;  1BGX T;  1WNS A;  3WEE B;  3U3G A;  2YHA A;  3LPU A;  4AH9 A;  3I56 N;  4DV6 K;  3UE5 A;  4BR9 A;  5JVG L;  5KGW A;  3WXM B;  4QOZ B;  4LF9 K;  1S1W A;  4AHV A;  3L8B A;  2X6N A;  4CEZ A;  2OZS A;  4OKE A;  1LWC A;  2IVO A;  3THV A;  1HQE A;  5JLF A;  3RVC A;  4AF1 A;  4O44 A;  4AHC A;  4FK2 A;  3DOL A;  4DS4 A;  3TR8 A;  4BR7 A;  1YUW A;  1XC9 A;  3M8S A;  5HRR A;  4Z4H A;  3CFO A;  3CC7 N;  4FJK A;  3GDQ A;  4BRN A;  1WBB A;  3M8Q A;  2NRX A;  4BQL A;  2CGK A;  4GKJ K;  3OS1 A;  3V81 A;  2G8F A;  3CD6 N;  1NGJ A;  4AHT A;  3NH0 A;  3CJC A;  3THX A;  3SUQ A;  3IS9 A;  4FLU A;  5I9E B;  4K8Z A;  3VEV A;  5CYQ A;  4KI4 A;  3LP2 A;  4IJN A;  2GBZ A;  3GE1 A;  4CJR A;  4E1M A;  4JS5 A;  3U6F A;  2BE2 A;  3LDS A;  3QET A;  5M1F A;  1RT7 A;  1NK0 A;  2V7Y A;  2ZWH A;  4M63 C;  3LDN A;  3OTO K;  3AAR A;  1EP4 A;  2JWK A;  3BGR A;  1SQK A;  2Q2R A;  4E3S A;  2O8B A;  1KFS A;  3P1G A;  4JV5 K;  2X6S A;  1KAX A;  4TSX A;  1BCO A;  2HMP A;  1A5W A;  3MX2 A;  3VA0 A;  3KVG A;  2KTQ A;  4CHN A;  3MXM A;  3ZSR A;  4N56 A;  3VA3 A;  2HHX A;  3NF7 A;  3CER A;  2PY5 A;  3ZSQ A;  4BR4 A;  4DTR A;  4M3Y A;  2FBT A;  3H46 O;  4G9Z A;  4HTU A;  4FM2 A;  1E3M A;  4CGJ A;  5LJV A;  2H3G X;  2NNW A;  5JS1 A;  5D3G A;  1QSY A;  4YOU A;  4FWN A;  4CEB A;  1FK9 A;  3RRG A;  1QSS A;  3I0R A;  4ELU A;  4JKG B;  2QM1 A;  1SL2 A;  2YHY A;  4KV8 A;  1BOT O;  1Q18 A;  5KPR A;  4DSI A;  3H3N O;  4CW7 B;  3L2R A;  3MEE A;  3LZI A;  1SKR A;  1VQP N;  4H4M A;  1NOY A;  1WLJ A;  1KD1 O;  4KHN A;  3AVH A;  1RTH A;  5DK5 A;  3LPT A;  1BDG A;  3E9L A;  3O6W A;  3VQP A;  4DQI A;  3L4I A;  1U04 A;  2QWR A;  3TTF A;  4H0O A;  2QWQ A;  3RMC A;  4G1Q A;  1IG9 A;  1QQC A;  4OPK A;  1S1V A;  1WUA A;  1S9E A;  3KLF A;  4FSV A;  3SCX A;  5FDL A;  3VQ4 A;  1GOC A;  4CEE A;  4CIG A;  4U7B A;  4BC2 A;  4KRF A;  5AZI B;  4PKH A;  2Q1N A;  4DWI A;  3O08 A;  4BRA A;  4IOX A;  3UIQ A;  2O4G A;  3O9T A;  4CHP A;  3WXI A;  4E7L A;  5M1N A;  1SKS A;  3VEZ A;  4DQR A;  3HM9 A;  1JLG A;  3SAF A;  4OJR A;  3VQC A;  4CJS A;  4CJK A;  2BGG A;  3DJC A;  4HCC A;  3VQ6 A;  3BZK A;  3QEX A;  3AAP A;  1MU2 A;  5BN8 A;  1NNE A;  3AAQ A;  4JKC A;  4IEI A;  5EOY A;  2NZT A;  2HNY A;  4YNQ A;  4GV6 A;  5IWA K;  3VPZ A;  4JS4 A;  5FPN A;  4R5P A;  3QB0 A;  4BG8 A;  1JLC A;  4FO0 A;  2B4J A;  3T1A A;  4KHW A;  2XHB A;  3CCL N;  4GNI A;  3NGY A;  3VQA A;  1YAG A;  2HF4 A;  3DWL A;  4CJ5 A;  2F96 A;  4DB3 A;  4EFH A;  1YVN A;  5DMR A;  4H5R A;  3OYK A;  4CF0 A;  4F3O A;  3ZX0 A;  1OH7 A;  1VHX A;  4JI8 K;  4DSL A;  4RTF D;  4FJ7 A;  2Q97 A;  5KTQ A;  2YHX A;  1V4T A;  3A5L C;  1TL3 A;  1QQM A;  3Q7C A;  2OA8 A;  4CFC A;  4CF8 A;  2P9K A;  3VF6 A;  2B6A A;  1L5U A;  2ZE2 A;  3P5J A;  4RCH A;  2Z1H A;  3E1Y A;  4FLT A;  3VQ9 A;  3RTV A;  4GY2 B;  3O3F A;  4BRC A;  4JI1 K;  2HOE A;  5LY3 A;  1HQU A;  1VQ8 N;  3MXI A;  1JL2 A;  4JK9 A;  5CZ2 A;  3MCA B;  3TWH A;  2IVN A;  3O4Q A;  5FPE A;  4CED A;  3S3O A;  2QXF A;  3FFI A;  3D2F B;  4CZL A;  5FRM A;  5JVH L;  3BF3 A;  5BN9 A;  4CGI A;  4CJT A;  5FPD A;  2OTJ N;  1C6V A;  3NF8 A;  3H08 A;  3KKR A;  1TK8 A;  3PIO L;  2IC3 A;  1M90 O;  3RWU A;  1U49 A;  4BDP A;  3O3H A;  1HNV A;  2P9L B;  1NJI O;  2NRW A;  1CZA N;  3QLH A;  5AZJ A;  5AQK A;  3SBT A;  1YVU A;  2YX6 A;  1JKH A;  3A5N C;  2A1R A;  1U48 A;  3CIP A;  4BRG A;  4DV3 K;  4J2D A;  3THW B;  3HSC A;  1ZXO A;  3VET A;  1ZBS A;  4DU4 A;  1U4B A;  4BRQ A;  4ILJ A;  4L8R B;  4ILG B;  3RRH A;  1U6Z A;  2YNH A;  2A40 A;  3JXU A;  4I7F A;  2Y1J A;  1RDW X;  4PL7 A;  3LP3 A;  3TAN A;  3DXM A;  5AQR A;  2HHH K;  2E6M A;  2HW3 A;  1WOQ A;  2KW4 A;  4CZI A;  4AHR A;  3VGK A;  2KLA A;  5AFU H;  5EU7 A;  2G8K A;  2Q0R A;  4KRE A;  5EX5 A;  3A2F A;  4MDA A;  4H0Y B;  1EWR A;  4OLB A;  2VG5 A;  4DHY A;  3ZSY A;  5E26 A;  4ZTF A;  1IJJ A;  1BQM A;  3QFP A;  2B5J A;  3AO4 A;  4BRD A;  4CIF A;  3DI6 A;  3SI6 A;  4DR3 K;  4X64 K;  4DTJ A;  2ZD1 A;  2P9P A;  3VQB A;  4DR1 K;  4CJF A;  4CJ3 A;  1FW6 A;  4E1J A;  2E88 A;  2UYT A;  1BIS A;  5E41 A;  1TKX A;  1SKW A;  3AVI A;  4CJW A;  3OYH A;  4CEQ A;  2UUC K;  2O8E B;  1GLA G;  3TTC A;  3QNN A;  3DXK B;  4CER A;  4X62 K;  3S3N A;  3QFU A;  3PIP L;  4RG8 A;  4HUF A;  5AQX A;  2VQF K;  1LOT B;  4WFN L;  3ATU A;  4FVU A;  4HTL A;  4AM6 A;  5SZT A;  2ZGZ A;  5M1O A;  1KC8 O;  1Q9Y A;  2LSN A;  1RBU A;  5I3U A;  3NMU A;  1WSE A;  3PY8 A;  4DTP A;  1QQO A;  4EIA A;  1Z26 A;  1ZBL A;  2DFH A;  3K5M A;  2IIR A;  2WC9 A;  1VQM N;  3G71 N;  3VEX A;  4H0V B;  3OYM A;  4E89 A;  2W6L A;  3SUN A;  1NG9 A;  2QKK A;  2WBN A;  3ENB A;  4CES A;  1XWL A;  3I8D A;  2FXU A;  1TAU A;  3DLE A;  1IH7 A;  2EWS A;  2V52 B;  2FF3 B;  1ATN A;  4JHD A;  1R0A A;  2P9N A;  4OKJ A;  2X78 A;  2V7Z A;  3CQY A;  4WE1 A;  4O4G A;  1KAY A;  1EKE A;  2P9U A;  1IKX A;  4PUO A;  3LAM A;  1HPM A;  2W6K A;  4B9L A;  2F4V K;  3TU5 A;  2XY6 A;  3HXM A;  1EET A;  2YNI A;  4FJ5 A;  3C0B A;  5CZ1 A;  1GOA A;  3EY1 A;  2BH1 A;  1O1W A;  1W2B M;  3P31 A;  3DYA A;  4KHP K;  5GAE P;  3KD1 E;  4FWM A;  1L3V A;  1JJ2 M;  3HO1 A;  4H5V A;  4IG3 A;  1OVY A;  1Z05 A;  4JD2 B;  4E7K A;  4FLX A;  3GBT A;  4JKH A;  1YI2 N;  5LMU K;  1QZ5 A;  2DFF A;  3V6D A;  4H5N A;  4IDH A;  1HPZ A;  1LWE A;  4B9M A;  1RDA A;  5AQG A;  4DQ8 A;  1S3X A;  1FKP A;  5BRE A;  4BRH A;  4O55 A;  3MWT A;  1JCG A;  4WQ4 A;  4YY3 K;  4WFB L;  1TK5 A;  2OTL N;  4L3Q A;  4B9V A;  1Z25 A;  3R1X A;  4I9L A;  4RW7 A;  5CHI A;  3L2U A;  4KI6 A;  3KZB A;  4DMN A;  4J8F A;  2KZM A;  1YTA A;  3QEW A;  3SPZ A;  5HLF A;  5C2D A;  3PUF A;  5KRT A;  2WOM A;  2HST A;  1K8A O;  3PLA A;  4F2S A;  3V9S A;  4ELT A;  1NMD A;  3VGM A;  4OVL A;  1KFD A;  4DCH A;  1K9M O;  1NKC A;  4IJA A;  3J7Z O;  1RT4 A;  2HHT A;  1BL3 A;  3TAP A;  1TKZ A;  3MCP A;  3LDO A;  3JS6 A;  3CFR A;  4Z4G A;  2VCP A;  4GV3 A;  4JKB A;  4I9Q A;  3TTD A;  3SNN A;  1CZB A;  3QIO A;  4IFY A;  4CD3 A;  3AVM A;  5AQV A;  1VRU A;  4BWJ A;  1DLO A;  4FM1 A;  2I5J A;  4FPA A;  3ZYY X;  1ATS A;  1HKC A;  1NBW A;  3RR7 A;  5CE3 A;  1QE1 A;  1RNH A;  3HST B;  4RW8 A;  5J2P A;  4FWQ A;  4YOT A;  4FXD A;  4JI2 K;  4B3S K;  4DR6 K;  3HPH A;  1E4F T;  1QHT A;  1JLF A;  3VQ5 A;  3D7E O;  3A5O C;  2E20 A;  1T8E A;  3BZC A;  4WF9 L;  2NRT A;  2A41 A;  3L6Q A;  4OPH A;  4AQY K;  3LDL A;  3WQT A;  1LW0 A;  4GMJ B;  1NJX A;  1BI4 B;  4CK2 A;  3RMD A;  2X74 A;  3AVJ A;  4LFC K;  5GIP A;  3DOK A;  1GLE G;  1BCM A;  3GG4 A;  4NLC A;  4F9O A;  3T69 A;  3B6P A;  1NKE A;  1D9F A;  4DR5 K;  1XC3 A;  3O80 A;  3UKU B;  2CH5 A;  3RSE A;  3SQ4 A;  1D4X A;  1GOB A;  2BAN A;  3AA5 X;  4BRM A;  1HMV A;  3SV3 A;  5F1X A;  3WEE A;  4H4O A;  4DV4 K;  2UU9 K;  3QES A;  3SQ0 A;  3Q7B A;  1V4S A;  3F73 A;  3SV4 A;  4QS8 A;  4IFE A;  1VQ7 N;  1NLV A;  2ZM6 K;  4CZH A;  4FOI A;  4FCY A;  3WNG A;  4JRQ A;  1HKG A;  3K0S A;  1N8R O;  4IEE A;  2YNF A;  3AGK A;  3VEN A;  1GLJ O;  3L3U A;  3ZEU B;  4NCA A;  4B1U B;  2D0A A;  5CYM A;  3AA2 A;  4B9Q A;  3U9D A;  2CH6 A;  4EHU A;  3T1Y K;  1NKB A;  5BPL A;  3LL3 A;  1HX1 A;  3LAK A;  4NXN K;  1WSG A;  2XRI A;  3MAQ A;  5LJW A;  2BUP A;  4CZM A;  4FLW A;  3HTV A;  5GAH P;  1KSP A;  4FOE A;  4CHO A;  1IBM K;  4O5B A;  1MDU B;  1ZBI A;  3LDP A;  3SMS A;  3S9H A;  1YHQ N;  4CEA A;  3KK1 A;  2G8V A;  3KWG A;  1RT1 A;  3T7Z A;  4C1N I;  1YIJ N;  3C65 A;  4KH5 A;  2QW9 A;  2RPI A;  3O9S A;  5EXW A;  2VG7 A;  4KH6 A;  5AQI A;  2HHV A;  2A1S A;  5KPT A;  4MLE A;  4CF1 A;  5HL7 L;  3U4L A;  4LH4 A;  2QA4 N;  3CCM N;  1RDD A;  1A5X A;  4NLB A;  3ZT2 A;  3PX4 A;  3QER A;  2FF6 A;  2FLO A;  1CXU A;  3RMB A;  3ZSX A;  1HR0 K;  4N41 A;  1O13 A;  2PYJ A;  3ULD A;  4CEC A;  3VOV A;  1Q9X A;  2VGN A;  5AQL A;  3BF1 A;  3LP0 A;  1I3A A;  4DF8 A;  1LWF A;  2O8D B;  3ASM A;  1IBL K;  3BUZ B;  2E6L A;  2OZM A;  3SUO A;  1L3S A;  1CZ9 A;  2QWP A;  4YOV A;  2BDP A;  3HK2 A;  3KLG A;  5JLH A;  2ZJQ L;  2PBD A;  3CJ9 A;  4Z4F A;  3D6R A;  4JKG A;  3ALY A;  1WB9 A;  1NK8 A;  1X3N A;  1LAV A;  1T6D A;  3SLC A;  4HUE A;  2G8U A;  1RCH A;  3K5N A;  1NGB A;  4OPA A;  3NGZ A;  5BRF A;  3L3V A;  3OBW A;  3K58 A;  1JXB A;  2W42 A;  3SQ1 A;  3T3F A;  5HP1 A;  1L3T A;  3MN6 A;  3OBY A;  2P1J A;  4A59 A;  5HRP A;  4FK4 A;  3VGL A;  4DV2 K;  3CCE N;  4CIE A;  5HRN A;  5AQW A;  3VN5 A;  1QTM A;  3CCU N;  2W40 A;  4HVJ A;  4DTX A;  2QWO A;  2HNZ A;  3OYE A;  4LFB K;  5AZI A;  1ZYQ A;  3V1O A;  2QKB A;  4KHY A;  4NYN A;  3V4I A;  4N76 A;  1NOZ A;  5C12 A;  2EX3 A;  3HL8 A;  1Z6R A;  3MXJ A;  1TL1 A;  3QIC A;  4GV9 A;  3P4I A;  2A5X A;  1HYS A;  5M1Q A;  3JSM A;  1NGI A;  3AVB A;  2YJE A;  1B92 A;  1VSI A;  3AVC A;  4HCB A;  4DFM A;  4MFB A;  1KAZ A;  1B9D A;  2F8S A;  2QWM A;  4CGH A;  3NBP A;  3AO5 A;  3AVF A;  4N5S A;  2RHK A;  2FSJ A;  4Z4E A;  2GTD A;  3O3G A;  4IWV A;  4LF5 K;  3QEV A;  4CK1 A;  3G10 A;  5F2R A;  3OYG A;  2D0O A;  2Z1G A;  1Q7Y O;  3TPQ A;  2D0P A;  4FW2 A;  1TKT A;  5JMV A;  1E4G T;  1GLL O;  3CI5 A;  2O8C A;  5DM7 L;  3AA4 A;  3SAG A;  4FJN A;  2YJF A;  1NMN A;  2WUS A;  3VQD A;  1S1X A;  1FJG K;  1UA0 A;  4GVM A;  3OJU A;  3HRG A;  1HYZ A;  3MN7 A;  3D0P A;  4W5N A;  4KBO A;  1K8K B;  5ELZ A;  2Q36 A;  5GIO A;  2UXC K;  2A42 A;  5BR9 A;  1BHL A;  4F2R A;  5EY4 A;  4CJL A;  4HHT A;  3OYF A;  3PO5 A;  3CG7 A;  4FZZ A;  1XNR K;  2O8C B;  3ZT3 A;  2J4R A;  1IKV A;  3SMP A;  3J81 O;  1W7A A;  5C0Y A;  2E2P A;  4YDU C;  4B1V A;  3KIO A;  4BVP A;  1N34 K;  4A57 A;  2G8I A;  1IG8 A;  4KTZ A;  4FWL A;  4MLH A;  1NGE A;  4JNE A;  3IMX A;  1DEJ A;  1J9A A;  2DPN A;  5AQS A;  1RBV A;  3D2F A;  1SL1 A;  3G0Z A;  2UXD K;  3KWI A;  3NF6 A;  2FC0 A;  4FZY A;  1N5Y A;  1REV A;  4CGD A;  1UOC A;  3O9R A;  1T44 A;  3THY B;  1NU0 A;  5AJ3 K;  4BR5 A;  3L2V A;  3BDP A;  1T3V A;  1SS6 A;  5J2Q A;  3FZL A;  3MEG A;  4M45 A;  2P9L A;  1IKW A;  2ITM A;  3QIP A;  2ATQ A;  4CI6 A;  4MDB A;  1C0G A;  3A8Y A;  1XMQ K;  1KTQ A;  1C1B A;  4DLG A;  5C10 A;  3EO3 A;  4CBX A;  4LF4 K;  3V9Z A;  3PO4 A;  1LV5 A;  2AJQ A;  3THW A;  3B8A X;  5KGX A;  3IRX A;  3CCJ N;  2NLX A;  1VQO N;  3PSF A;  3H1Q A;  5GIN A;  4M3R A;  1QVG M;  1EX4 A;  3J7Y P;  3SQ2 A;  2VYP A;  1NJY A;  4A2A A;  3AGR A;  4FM0 A;  4KH4 A;  3RMA A;  4UY8 O;  1KCF A;  5AQH A;  1C0T A;  4OKK A;  3HBT A;  1IBK K;  1YJ9 N;  4M41 A;  4BE1 A;  1ZBH A;  2D0C A;  2P5O A;  1UA1 A;  4K43 A;  1DKG D;  1KVB A;  4WYB A;  2KKZ A;  4LF6 K;  2YCH A;  1BWF O;  3NH1 A;  4F4K A;  2KFZ A;  3T1H K;  5J2M A;  4FJ9 A;  2JLE A;  4ILH A;  2E1Y A;  1OH6 A;  1NK4 A;  3LM2 A;  5KI6 A;  3OYN A;  4K42 A;  4DTM A;  4B3O A;  3E66 A;  4LF8 K;  1BUP A;  4NCB A;  3TSQ A;  4ISF A;  1YTU A;  2O8F A;  3O9Q A;  1C0U A;  3VQE A;  1OKJ A;  4W5O A;  4FWR A;  2O8E A;  2P9S B;  5AQU A;  3DXK A;  1VSL A;  1BU6 O;  3WXK A;  1GLD G;  5M1K A;  1Y64 A;  4OPJ A;  5K14 A;  1RDC A;  5I42 A;  3M5R A;  3DLK A;  4DTS A;  2O8F B;  4AHS A;  1RT6 A;  1X1P A;  2KZZ A;  3DRS A;  3LAN A;  2OAN A;  4O8U A;  1W0H A;  1NGH A;  4ISG A;  3KLI A;  3LP1 A;  5TKY A;  4ZTJ A;  5AQT A;  3VF2 A;  4PKI A;  5EVZ A;  2GWJ A;  2Q0U A;  1NK9 A;  3V9W A;  3CJB A;  3NF9 A;  3N4Q A;  3VES A;  4ID1 A;  4V19 S;  2P5G A;  1JL1 A;  1XQS C;  1HKB A;  4B8A B;  5ADX A;  4DV1 K;  2AP1 A;  1DTT A;  4YHH K;  1ATR A;  4B3M K;  1QZ6 A;  4JI4 K;  1TYQ B;  1X9W A;  4C8N A;  4B3T K;  1FKO A;  1W9H A;  4CJU A;  2FSK A;  3DM2 A;  3HOS A;  3AVL A;  4KAZ A;  4YOX A;  4FLV A;  4FK0 A;  1VQ4 N;  3G6E N;  3HVR A;  2VWK A;  3R9P A;  3VQQ A;  4BQZ A;  4Z94 A;  3SAH A;  4C8L A;  4LSL A;  1F21 A;  4CCH A;  2UXB K;  4PY5 A;  1ILY A;  3CQ8 A;  1VSK A;  3LAL A;  3A5M C;  4FJG A;  4EAH D;  2YKM A;  3RR8 A;  4JD2 A;  4WQ5 C;  1DT9 A;  4BDZ A;  4DKW A;  1VSM A;  4Y1C A;  1YXQ A;  5KQ8 A;  3K5L A;  2WTU A;  1WSJ A;  3AVG A;  4CZK A;  3K9K A;  4FJH A;  2ASP A;  1U2V B;  3TAB A;  1EXQ A;  4U67 L;  4E1N A;  3CCQ N;  2A3Z A;  3O9U A;  4FJX A;  2VWB A;  4PQU A;  3C6A A;  1ASW A;  1XHX A;  3IG1 A;  5AQO A;  3I0S A;  1TK0 A;  2P9I B;  1LW2 A;  5AQF A;  2GUI A;  2XO7 A;  2YHW A;  3ZT1 A;  4BRF A;  4JKA A;  5F0X A;  4W5Q A;  2XY5 A;  3SJH A;  4CJV A;  3SYZ A;  1HNI A;  1K6Y A;  4FLZ A;  2CGJ A;  4O8K A;  1VSE A;  4A5B A;  2OPR A;  3KLE A;  4E7J A;  3ZSV A;  3FFK B;  2WFB A;  1HNZ K;  4DV5 K;  1OH5 A;  2QI2 A;  1W97 L;  3M8P A;  4R79 A;  1HNX K;  3DAW A;  4LF7 K;  3O1B A;  4B3R K;  1KVA A;  4LH5 A;  4IKF A;  4DR4 K;  3DLL L;  5T7B A;  1RTI A;  4IFV A;  4ISE A;  4O0I A;  3P39 A;  4Q0B A;  3S41 A;  3TI0 A;  4JRP A;  1JLE A;  4JK7 A;  3WNH A;  1ZBF A;  3C6U A;  5AQP A;  3SPY A;  5MLC Q;  4CEO A;  5GAD P;  1EWQ A;  1KQS M;  4CZJ A;  3H45 C;  1VSD A;  1JLQ A;  1LCU A;  3W3D A;  1QSL A;  3OYL A;  4CHY A;  4CJ4 A;  4KTW A;  1VAZ A;  4CFD A;  5HOO A;  2RKI A;  1BQN A;  2G8H A;  4KO0 A;  1BI4 A;  5AQQ A;  4PHT X;  3WUH A;  3VMF B;  1VK0 A;  2YV0 X;  1YT3 A;  4BC4 A;  1G15 A;  2ITG A;  1NJW A;  1RTD A;  4J2E A;  4C8O A;  3VER A;  2KQ2 A;  1NGF A;  4BR0 A;  3AV9 A;  3FE1 A;  3ZLJ A;  3UKU A;  2HHW A;  3DLB A;  5AR0 A;  1X9S A;  1TKD A;  4CJE A;  1L3U A;  4B9N A;  4XIU A;  1YJN N;  1T05 A;  4M3W A;  1C0M A;  4XEI A;  4ELV A;  1VSJ A;  3WXL A;  4EP4 A;  3IFR A;  3QDK A;  4DQQ A;  3EN9 A;  1C1C A;  1WN7 A;  2VGM A;  4IOC L;  2EHG A;  3FZH A;  3L4Q A;  3L0Q A;  3CET A;  2Y1I A;  3MEC A;  2QWL A;  5E84 A;  3MN9 A;  3HP6 A;  3HOT A;  1BG3 A;  5A2Q O;  3QEI A;  2E2N A;  3ZEU A;  3ZET B;  1QS4 A;  5FRO A;  2QWN A;  1TGO A;  3O5B A;  4DQS A;  4FJL A;  4BC5 A;  1NJZ A;  2Q31 A;  2KHO A;  5CR4 A;  2HBK A;  5AQN A;  5C42 A;  4C8K A;  4PA1 A;  3ENH A;  3UKR B;  4E7H A;  1KXP A;  4H8K A;  1BIU A;  4DTO A;  3TAG A;  1VQ5 N;  4AHU A;  1NK7 A;  4QS9 A;  3EL2 A;  3EZ5 A;  3TSU A;  3CFP A;  2HHS A;  2NRH A;  3SZ2 A;  1H1V A;  2QK9 A;  4BRE A;  2F9W A;  2HBJ A;  3FZK A;  3LZJ A;  1BIZ A;  4H0X B;  4A61 A;  4I6M B;  1CXQ A;  3OYB A;  3C6H A;  2BTF A;  4IXC A;  3LWM A;  1HNW K;  1TVR A;  4RW9 A;  4BRI A;  3OJS A;  1J6Z A;  4DLE A;  4FJ8 A;  3IUC A;  3L2W A;  3LWL A;  2HB5 A;  4UQG A;  3HP9 A;  4BWM A;  3TAR A;  4CVN E;  1A5V A;  3F9K A;  5KRS A;  4YOW A;  4JYA K;  3QIN A;  1VQ6 N;  4CZE A;  2Q3S A;  1QHA A;  2YKN A;  4NXM K;  3ZSZ A;  1BO5 O;  3SJJ A;  3CM5 A;  3KTQ A;  3AVA A;  4CZG A;  1I39 A;  4FJJ A;  1BA1 A;  2E2O A;  3ID6 A;  2NUB A;  3BP8 A;  1VQL N;  4IOA L;  5JS2 A;  4E19 A;  3VTI A;  1J53 A;  5BPM A;  2CGL A;  1NGG A;  2G8W A;  2O8D A;  1MA9 B;  4JKD A;  1R59 O;  1RFQ A;  3BEX A;  2A6A A;  3E01 A;  4DSE A;  1RT5 A;  2WON A;  2XY8 A;  2F7T A;  4H0P A;  3HPO A;  1EQY A;  5DM6 L;  2HBL A;  4B9S A;  5C24 A;  1WSF A;  1ITG A;  4PKG A;  4X65 K;  2IDO A;  4BG9 A;  2E2Q A;  1VQ9 N;  3V9U A;  3W0L A;  4JKF A;  4JI0 K;  2HND A;  4JI5 K;  1FXX A;  4CBU A;  4H0T B;  2NRZ A;  1N6Q A;  1JXE A;  4BVO A;  3M8R A;  1ASV A;  2GUP A;  4LD0 A;  2HHQ A;  4MO5 A;  3S3M A;  1XI1 A;  4CBW A;  1LAW A;  4A5A A;  1NK6 A;  1SZ2 A;  4ID5 A;  4RWT A;  2DY4 A;  1S5J A;  4FZX C;  1VSH A;  4DFK A;  1Y97 A;  2YHB A;  3AO3 A;  3CC2 N;  1U47 A;  3IDH A;  3CYM A;  4GW6 A;  3NE6 A;  2NRV A;  4H03 B;  1HRH A;  1J5E K;  3THX B;  1YJW N;  3K57 A;  2XY7 A;  2DTU A;  2E4L A;  3P83 D;  3EZW A;  3ITH A;  2UUB K;  4C1N K;  3KK3 A;  3TAQ A;  3FR0 A;  4DV7 K;  3SUP A;  3VTH A;  3KK7 A;  3DLR A;  3C95 A;  2JWL A;  1TAQ A;  4M3U A;  1VSF A;  2GWK A;  3KJV A;  1U45 A;  5M1P A;  2O8B B;  2W41 A;  1HJR A;  3CM6 A;  1BA0 A;  1NM1 A;  2HF3 A;  3B6O A;  3VF4 A;  2RE2 A;  4LSN A;  4M7Y A;  3O1W A;  4YFU A;  1TUU A;  4FWO A;  2Z1I A;  4OLA A;  4DUY K;  3CPW M;  1QVF M;  3FLC O;  5AFU A;  1GLB G;  1NGA A;  3E9P A;  4CGF A;  5IT9 O;  4FVM A;  3HVT A;  4MQ3 A;  4C8M A;  3SK3 A;  1C1A A;  2OYQ A;  4B1X B;  1WAF A;  4BRP A;  1RT3 A;  5HRO A;  4AIL C;  4FYD A;  2PAV A;  4MO4 A;  4QS7 A;  4CE9 A;  2D5R A;  4KHQ A;  1TV6 A;  1K8K A;  3ATV A;  2D0B A;  3FZF A;  4CJP A;  4HUG A;  4JI3 K;  3C7N A;  4E0D A;  4IDK A;  5HRS A;  1ZC6 A;  3CCV N;  3FZM A;  3CCR N;  1N36 K;  3NHG A;  5TKW A;  4PL8 A;  4B1Z A;  3F5T A;  3ZCM A;  4BC3 A;  1P8Z A;  2JGU A;  4BGA A;  4KHU A;  4N47 A;  4LC9 B;  3M1F A;  4EHT A;  3I55 N;  3U9Z A;  2UUA K;  4KKO A;  4M7X A;  1D8Y A;  3C7N B;  2RF2 A;  3OYJ A;  1JLB A;  1IV0 A;  4BRO A;  1J54 A;  1RBR A;  4CGG A;  1ASU A;  1NK5 A;  2E5L K;  2HVH A;  3OVN A;  4O0J A;  3KLH A;  3N4P A;  2QXL A;  4DSJ A;  4DR7 K;  4NCG A;  3THY A;  3H6E A;  2FBY A;  3J8A A;  3ZSW A;  4YOR A;  1KVC A;  1IKY A;  2GEL A;  4Y0W A;  4DU1 A;  1JCF A;  3M3Z A;  4Z0U A;  4IBN A;  3O4W A;  4B1Y B;  3KK2 A;  3IKM A;  3AVK A;  3HJF A;  4I2Q A;  5BPN A;  4Z4I A;  4IZ9 A;  4OO1 J;  1JLA A;  1T6C A;  4BR2 A;  3DLH A;  5LMN K;  1VQN N;  3NH2 A;  4DF4 A;  1S72 N;  1Q86 O;  3L2Q A;  2PZS A;  3OS0 A;  4CFA A;  5H1S Q;  4BE2 A;  4XH1 A;  4Y1D A;  4QAG A;  3PV8 A;  1SAZ A;  3DRR A;  1YF5 L;  4Q5V A;  3CXC M;  4YDU A;  3CC4 N;  4CJQ A;  2IAJ A;  3OYI A;  3CJA A;  4A2B A;  3M6G A;  3MX5 A;  3NCI A;  3TAM A;  5JIC A;  3IAY A;  2P9K B;  2ZGY A;  2IGI A;  1S6Q A;  4E7I A;  1GLF O;  1WAJ A;  3SBG A;  3JYT A;  3AA3 A;  1ESV A;  3OHR A;  5SWM A;  3FGU A;  3ULE A;  2FBX A;  5BRD A;  4BY9 C;  4K41 A;  4OGC A;  4B1W B;  2VQE K;  1VQK N;  4JEP A;  1IO2 A;  1J5O A;  3MN5 A;  4I2P A;  2PFU A;  4HWI A;  5C25 A;  1C0F A;  3MDQ A;  3R3L A;  3ZT4 A;  5GAG P;  3UB5 A;  4CF2 A;  5CY4 A;  3H3O B;  4GVE A;  4DV0 K;  3C6T A;  1UWB A;  3ULE B;  4M3X A;  2VG6 A;  2P9S A;  4DFP A;  3KKS A;  5J1E A;  1Q8I A;  2GV9 A;  4C23 A;  4DS5 A;  2F9T A;  1TUY A;  3EKS A;  1RIL A;  3QML A;  1X3M A;  4EP5 A;  1XMO K;  4DSK A;  3WQU A;  4RW4 A;  5KPZ A;  3K59 A;  3TAF A;  1S1T A;  3MED A;  3KD5 E;  2OPQ A;  2YNG A;  4CFB A;  3R8E A;  4A62 A;  1XUP O;  2HMI A;  5AZJ B;  3CMA N;  2YI1 A;  3QBW A;  4F8R A;  4AM7 A;  3TSP A;  3G4S N;  3WT0 A;  3U3Y A;  2D4W A;  3DLG A;  4JAX A;  4CHZ A;  4DTN A;  3P38 A;  5KQD A;  1Q82 O;  2HBM A;  3EKU A;  3KHY A;  4LFA K;  4WFA L;  3NFA A;  2OPS A;  4CF9 A;  2AA4 A;  1KRP A;  1N33 K;  3PX6 A;  3GL1 A;  3AY9 A;  1TYQ A;  3DXM B;  3A0I X;  3JAM O;  4QCL A;  2ZQB A;  4LY7 A;  1NWK A;  5AQY A;  3H1V X;  3ISN C;  3F2K A;  2QEX N;  1XHZ A;  3NAE A;  1Q81 O;  4JI6 K;  3LDQ A;  1ZBU A;  3NGI A;  3QNO A;  1GLC G;  4DUZ K;  2KFN A;  2FSN A;  1MWK A;  4KTQ A;  1RBT A;  3O8M A;  4DG1 A;  2ETJ A;  4ZHR A;  4DQP A;  4KPY A;  2DFE A;  1VRT A;  3QO9 A;  3NDK A;  5C15 A;  2P9P B;  2NRR A;  1M1K O;  3EE8 A;  3VQ8 A;  2RN2 A;  2P51 A;  3OYA A;  4OX9 K;  1X9J A;  2I7P A;  2VWJ A;  1D9D A;  1DTQ A;  1HLU A;  1N32 K;  5AQJ A;  4IO9 L;  2OCE A;  3LM9 A;  4BAC A;  1U2V A;  1QQN A;  1RT2 A;  1SV5 A;  2IS3 A;  3MK6 A;  3HI0 A;  4B8C A;  3VEW A;  1EO1 A;  3J7A P;  3V1R A;  4FW1 A;  4FWK A;  4DFJ A;  3NVK A;  4DR2 K;  4WQ4 C;  3ZX3 A;  1S1U A;  4B08 A;  2R7Y A;  2ZJR L;  3MWP A;  2P9I A;  5J2N A;  3HM8 A;  2QTD A;  5AQM A;  4W5T A;  3ZSO A;  3CCS N;  3EEQ A;  4DTU A;  4FPB A;  4K0K K;  3AO2 A;  3AVN A;  3VEO A;  3CJ1 A;  3PSI A;  2D1K A;  1CLQ A;  3OY9 A;  1S9G A; 
#chains in the Genus database with same CATH homology
 1NOZ A;  4KB1 A;  4E7H A;  3QLH A;  4H8K A;  1BIU A;  2EX3 A;  3HL8 A;  3MXJ A;  1TL1 A;  4DTO A;  3TAG A;  4AHU A;  4KPY A;  1YVU A;  4BE0 A;  4CHQ A;  1NK7 A;  3K5O A;  1HYS A;  1JKH A;  3JSM A;  2FBV A;  3EZ5 A;  3CFP A;  2HHS A;  3AVB A;  2A1R A;  1U48 A;  3SZ2 A;  4M3T A;  4Z4C A;  2QK9 A;  1B92 A;  1VSI A;  3AVC A;  3K2P A;  4J2D A;  1RTJ A;  3LZJ A;  4HCB A;  4DFM A;  4DU4 A;  1BIZ A;  4MFB A;  3TAE A;  1CXQ A;  3OYB A;  3DMJ A;  1U4B A;  1X9M A;  3LWM A;  1B9D A;  4L8R B;  2F8S A;  3RRH A;  1TVR A;  4RW9 A;  3OJS A;  4CGH A;  2YNH A;  4DLE A;  1T03 A;  3NBP A;  4FJ8 A;  4M42 A;  4N76 A;  3AO5 A;  1S6P A;  3AVF A;  3L2W A;  4I7F A;  4N5S A;  2HB5 A;  4UQG A;  3HP9 A;  4BWM A;  3LWL A;  2Y1J A;  3TAR A;  2OPP A;  4Z4E A;  3O3G A;  4IG0 A;  3LP3 A;  1A5V A;  3QEV A;  4CK1 A;  2Z1J A;  3F9K A;  3G10 A;  5KRS A;  3QIN A;  3OYG A;  3TAN A;  2Z1G A;  2Q3S A;  2YKN A;  3ZSZ A;  4FW2 A;  1TKT A;  4J2A A;  2E6M A;  2HW3 A;  3SJJ A;  2KW4 A;  3CM5 A;  4AHR A;  3AVA A;  3KTQ A;  1I39 A;  1RDB A;  3AA4 A;  4FJJ A;  4FJN A;  5EU7 A;  2G8K A;  4K8X A;  1SUQ A;  4KRE A;  3T19 A;  3VQD A;  2NUB A;  3A2F A;  1S1X A;  1UA0 A;  4GVM A;  5JS2 A;  3OJU A;  4E19 A;  1HYZ A;  3D0P A;  4KFB A;  4W5N A;  1J53 A;  1T7P A;  4FLY A;  4OLB A;  2VG5 A;  3ZSY A;  2G8W A;  3V1Q A;  4ZTF A;  1BQM A;  3E01 A;  1WSH A;  2B5J A;  4DSE A;  3AO4 A;  1RT5 A;  2WON A;  3DI6 A;  1BHL A;  2XY8 A;  4CIF A;  3SI6 A;  3DRP A;  3HPO A;  4F2R A;  4HHT A;  4CJL A;  3OYF A;  3PO5 A;  1D5A A;  3CG7 A;  4DTJ A;  2ZD1 A;  3VQB A;  4B9S A;  4FZZ A;  5C24 A;  3ZT3 A;  4F3T A;  1WSF A;  4CJF A;  1ITG A;  4CJ3 A;  3VQ7 A;  4FJM A;  1IKV A;  1SL1 A;  2QKB A;  3EYZ A;  1BIS A;  5E41 A;  2HVI A;  2IDO A;  1TKX A;  1SKW A;  3AVI A;  5HBM A;  3KIO A;  4CJW A;  3OYH A;  4CEQ A;  3V9U A;  2F8T A;  3QNN A;  2IOC A;  3V4I A;  4BDY A;  4CER A;  2HND A;  2G8I A;  3O4N A;  1FXX A;  4M3Z A;  3S3N A;  4RG8 A;  4HUF A;  1N6Q A;  4KTZ A;  4B9U A;  1JXE A;  3M8R A;  1ASV A;  4OGE A;  5SZT A;  4LD0 A;  2HHQ A;  3S3M A;  1UAX A;  1XI1 A;  1Q9Y A;  2LSN A;  1RBU A;  1LAW A;  5I3U A;  3AO1 A;  1J9A A;  4KB0 A;  1NK6 A;  1WSE A;  4ID5 A;  3WNF A;  1RBV A;  4DTP A;  1Z26 A;  4NYF A;  1S5J A;  3G0Z A;  1ZBL A;  2DFH A;  3K5M A;  4FZX C;  1VSH A;  4J2E A;  3PX0 A;  4DFK A;  1Y97 A;  2YHB A;  3AO3 A;  3NF6 A;  2FC0 A;  4DSF A;  4FZY A;  1WSI A;  4DU3 A;  3OY9 A;  1N5Y A;  1REV A;  4CGD A;  3OS2 A;  1U47 A;  1KLN A;  1UOC A;  3CYM A;  4ICL A;  4CEF A;  4B9T A;  4GW6 A;  3QEP A;  3NE6 A;  3OYM A;  4FJI A;  4CK3 A;  1B9F A;  4E89 A;  1HRH A;  3L2V A;  3BDP A;  3SUN A;  3C94 A;  2QKK A;  5J2Q A;  3MEG A;  4M45 A;  4CES A;  1XWL A;  3I8D A;  1IKW A;  1TAU A;  1HYV A;  3K57 A;  3DLE A;  2XY7 A;  2DTU A;  3QIP A;  2ATQ A;  1IH7 A;  2E4L A;  3P83 D;  3ITH A;  1KTQ A;  3HT3 A;  3KK3 A;  3TAQ A;  1R0A A;  1C1B A;  4DLG A;  4OKJ A;  3SUP A;  2X78 A;  2O4I A;  3ZT0 A;  4WE1 A;  4O4G A;  3V9Z A;  1EKE A;  3PO4 A;  1IKX A;  3D45 A;  1LV5 A;  4RW6 A;  3DLR A;  4PUO A;  4EZ9 A;  3C95 A;  3LAM A;  2AJQ A;  4J2B A;  5KGX A;  1TAQ A;  3HPG A;  2PYL A;  3V9X A;  3IRX A;  4B9L A;  4M3U A;  1VSF A;  2XY6 A;  3OYD A;  3KJV A;  1U45 A;  3HXM A;  1EET A;  4M3R A;  1HJR A;  1EX4 A;  2YNI A;  3CM6 A;  4FJ5 A;  2DY4 A;  3HYF A;  5CZ1 A;  3B6O A;  1GOA A;  3SQ2 A;  3EY1 A;  1SL0 A;  1O1W A;  4JLH A;  4LSN A;  5FRN A;  1NJY A;  3DYA A;  3OYC A;  4YFU A;  4EZ6 A;  4PWD A;  3KD1 E;  2Z1I A;  4FM0 A;  4OLA A;  1L3V A;  3HO1 A;  4IG3 A;  1RBS A;  3RMA A;  1KCF A;  4KHS A;  1KLM A;  4CGF A;  4E7K A;  4FLX A;  1C0T A;  4FVM A;  3HVT A;  4OKK A;  4MQ3 A;  4C8M A;  2DFF A;  3V6D A;  4M41 A;  4BE1 A;  1HPZ A;  1C1A A;  1ZBH A;  1LWE A;  2OYQ A;  1WAF A;  4W5R A;  1RT3 A;  2D0C A;  4B9M A;  1RDA A;  5HRO A;  2P5O A;  4AIL C;  1UA1 A;  1FKP A;  4FYD A;  1KVB A;  3WNE A;  4CE9 A;  4O55 A;  2HHU A;  2D5R A;  4KHQ A;  3NH1 A;  1TV6 A;  1BGX T;  4F4K A;  1WNS A;  2KFZ A;  3U3G A;  5J2M A;  4FJ9 A;  2D0B A;  2JLE A;  2YHA A;  1TK5 A;  4B9V A;  1NK4 A;  3LPU A;  4AH9 A;  5KI6 A;  4CJP A;  3OYN A;  4HUG A;  1Z25 A;  4I9L A;  4RW7 A;  4DTM A;  4E0D A;  4IDK A;  3L2U A;  4B3O A;  5HRS A;  4KI6 A;  4NCB A;  5KGW A;  4DMN A;  1YTU A;  2KZM A;  1YTA A;  3QEW A;  4QOZ B;  3SPZ A;  3NHG A;  5HLF A;  1C0U A;  3PUF A;  3ZCM A;  1S1W A;  3VQE A;  4AHV A;  5KRT A;  3L8B A;  2X6N A;  2WOM A;  2JGU A;  4W5O A;  4F2S A;  4CEZ A;  2OZS A;  4N47 A;  4KHU A;  4OKE A;  1LWC A;  3V9S A;  3THV A;  1VSL A;  1HQE A;  4ELT A;  4KKO A;  1D8Y A;  4OVL A;  4O44 A;  4OPJ A;  1KFD A;  5K14 A;  1RDC A;  4AHC A;  1NKC A;  5I42 A;  3OYJ A;  2RF2 A;  1JLB A;  3DLK A;  4FK2 A;  3DOL A;  1RT4 A;  4DS4 A;  4DTS A;  1J54 A;  1RBR A;  2HHT A;  3TR8 A;  1BL3 A;  3TAP A;  4AHS A;  1ASU A;  4CGG A;  1NK5 A;  1TKZ A;  1RT6 A;  1X1P A;  1XC9 A;  3M8S A;  2KZZ A;  3DRS A;  3LAN A;  5HRR A;  3CFR A;  1W0H A;  4Z4G A;  4Z4H A;  2HVH A;  3CFO A;  3KLI A;  3LP1 A;  4I9Q A;  3SNN A;  3OVN A;  4FJK A;  4O0J A;  3KLH A;  4ZTJ A;  1CZB A;  3M8Q A;  3QIO A;  4IFY A;  4DSJ A;  3PY8 A;  3AVM A;  1VRU A;  4NCG A;  3OS1 A;  3V81 A;  2G8F A;  4BWJ A;  1DLO A;  1NK9 A;  4AHT A;  4FM1 A;  2I5J A;  2FBY A;  3ZSW A;  3NH0 A;  3V9W A;  3NF9 A;  3SUQ A;  3IS9 A;  1KVC A;  1IKY A;  4FLU A;  4ID1 A;  4K8Z A;  2P5G A;  5CYQ A;  1JL1 A;  4KI4 A;  3LP2 A;  3RR7 A;  2GBZ A;  4B8A B;  4DU1 A;  4CJR A;  4E1M A;  1QE1 A;  4Z0U A;  1DTT A;  1RNH A;  4IBN A;  4JS5 A;  3HST B;  4RW8 A;  3KK2 A;  5J2P A;  3U6F A;  4FXD A;  2BE2 A;  3LDS A;  3AVK A;  3HPH A;  1QHT A;  3QET A;  1X9W A;  3HJF A;  4I2Q A;  1RT7 A;  4Z4I A;  1JLF A;  4C8N A;  1NK0 A;  3VQ5 A;  1FKO A;  1JLA A;  1W9H A;  4CJU A;  1EP4 A;  1T8E A;  3DLH A;  3BGR A;  3DM2 A;  3NH2 A;  4DF4 A;  4E3S A;  1KFS A;  3AVL A;  3P1G A;  3L2Q A;  4KAZ A;  2PZS A;  1LW0 A;  2X6S A;  4FLV A;  4FK0 A;  4TSX A;  3OS0 A;  1BCO A;  4GMJ B;  3VA0 A;  1A5W A;  4CFA A;  3HVR A;  2VWK A;  3VQQ A;  4BE2 A;  1NJX A;  4C8L A;  2KTQ A;  1BI4 B;  4CHN A;  4LSL A;  3MXM A;  3ZSR A;  4Y1D A;  1F21 A;  4CK2 A;  4N56 A;  4CCH A;  3VA3 A;  4PY5 A;  2HHX A;  3RMD A;  4QAG A;  2X74 A;  3NF7 A;  3AVJ A;  3CQ8 A;  3PV8 A;  2PY5 A;  1VSK A;  3ZSQ A;  3DOK A;  3LAL A;  4DTR A;  3DRR A;  4Q5V A;  1BCM A;  4M3Y A;  2FBT A;  4FJG A;  4HTU A;  2YKM A;  4CJQ A;  3B6P A;  4FM2 A;  1NKE A;  1D9F A;  4CGJ A;  2IAJ A;  3RR8 A;  3OYI A;  5JS1 A;  4BDZ A;  3NCI A;  5D3G A;  3TAM A;  1QSY A;  3IAY A;  4CEB A;  1FK9 A;  2IGI A;  1S6Q A;  4E7I A;  3RRG A;  1QSS A;  3I0R A;  4ELU A;  1WAJ A;  3SQ4 A;  1SL2 A;  1VSM A;  4KV8 A;  3AA3 A;  3JYT A;  4DSI A;  1GOB A;  5SWM A;  4Y1C A;  2BAN A;  3AA5 X;  3L2R A;  3MEE A;  2FBX A;  3K5L A;  3LZI A;  1HMV A;  3SV3 A;  1SKR A;  4H4M A;  1NOY A;  1WLJ A;  4H4O A;  4KHN A;  1WSJ A;  3AVH A;  3AVG A;  4OGC A;  1RTH A;  5DK5 A;  3QES A;  3SQ0 A;  3LPT A;  3F73 A;  3VQP A;  1IO2 A;  1J5O A;  4DQI A;  4FJH A;  4I2P A;  1U04 A;  3SV4 A;  3TAB A;  1EXQ A;  5C25 A;  4E1N A;  4FJX A;  3RMC A;  4G1Q A;  4PQU A;  1ASW A;  1XHX A;  1QQC A;  3ZT4 A;  4CF2 A;  1IG9 A;  4OPK A;  1S1V A;  5CY4 A;  3WNG A;  4JRQ A;  3IG1 A;  4FCY A;  1S9E A;  3KLF A;  3I0S A;  1TK0 A;  3C6T A;  1UWB A;  4M3X A;  2YNF A;  1LW2 A;  2VG6 A;  2GUI A;  2XO7 A;  3SCX A;  3L3U A;  4DFP A;  3KKS A;  3ZT1 A;  4NCA A;  2D0A A;  5CYM A;  3AA2 A;  5FDL A;  1GOC A;  3VQ4 A;  4CEE A;  4CIG A;  5J1E A;  1Q8I A;  2GV9 A;  4DS5 A;  4KRF A;  1NKB A;  1RIL A;  4DWI A;  3LAK A;  4W5Q A;  4EP5 A;  2XY5 A;  1WSG A;  2XRI A;  4RW4 A;  4CJV A;  3MAQ A;  3K59 A;  3TAF A;  4DSK A;  1S1T A;  3MED A;  4FLW A;  2OPQ A;  2YNG A;  4CFB A;  3SYZ A;  3KD5 E;  2O4G A;  3UIQ A;  1HNI A;  1K6Y A;  4CHO A;  1KSP A;  4CHP A;  4O5B A;  2HMI A;  1ZBI A;  4E7L A;  4FLZ A;  1SKS A;  4F8R A;  3S9H A;  1VSE A;  3KLE A;  2OPR A;  4E7J A;  3ZSV A;  4CEA A;  4DQR A;  3KK1 A;  3HM9 A;  1JLG A;  3M8P A;  3U3Y A;  2G8V A;  1RT1 A;  1KVA A;  3DLG A;  4OJR A;  4LH5 A;  4IKF A;  3VQC A;  4CJS A;  4CJK A;  5T7B A;  2BGG A;  1RTI A;  4IFV A;  4O0I A;  2RPI A;  4HCC A;  4CHZ A;  4DTN A;  4Q0B A;  2HHV A;  3VQ6 A;  2VG7 A;  3QEX A;  3TI0 A;  4JRP A;  1MU2 A;  2A1S A;  1JLE A;  3WNH A;  1ZBF A;  3C6U A;  3SPY A;  4CEO A;  3NFA A;  2OPS A;  4CF1 A;  2HNY A;  4CF9 A;  4YNQ A;  4LH4 A;  1VSD A;  1JLQ A;  1RDD A;  1KRP A;  1A5X A;  4JS4 A;  3PX6 A;  1QSL A;  3OYL A;  4CHY A;  3ZT2 A;  4QCL A;  2ZQB A;  4R5P A;  4LY7 A;  3PX4 A;  4CJ4 A;  3QER A;  4KTW A;  3ISN C;  4CFD A;  1CXU A;  2RKI A;  3RMB A;  3ZSX A;  1JLC A;  3NAE A;  1XHZ A;  4N41 A;  2B4J A;  3T1A A;  4KHW A;  1ZBU A;  1BQN A;  2XHB A;  3NGI A;  2PYJ A;  3ULD A;  2G8H A;  3NGY A;  3VQA A;  4KO0 A;  4CEC A;  3QNO A;  4CJ5 A;  2F96 A;  1Q9X A;  5DMR A;  1BI4 A;  2KFN A;  3LP0 A;  1I3A A;  4DF8 A;  1LWF A;  3OYK A;  4CF0 A;  4F3O A;  4KTQ A;  1VK0 A;  1RBT A;  2YV0 X;  1YT3 A;  4DSL A;  1G15 A;  2ETJ A;  3ASM A;  4DG1 A;  4FJ7 A;  2ITG A;  2E6L A;  4ZHR A;  2OZM A;  3SUO A;  1NJW A;  1RTD A;  5KTQ A;  4C8O A;  2KQ2 A;  2DFE A;  1L3S A;  1CZ9 A;  4DQP A;  1VRT A;  1TL3 A;  3QO9 A;  3NDK A;  2BDP A;  3AV9 A;  3HK2 A;  2OA8 A;  3KLG A;  4CFC A;  2HHW A;  4CF8 A;  2B6A A;  3VQ8 A;  1L5U A;  4Z4F A;  3DLB A;  2RN2 A;  2ZE2 A;  3P5J A;  2P51 A;  3OYA A;  3ALY A;  1X9S A;  1TKD A;  4CJE A;  1NK8 A;  2VWJ A;  1L3U A;  1D9D A;  4B9N A;  1DTQ A;  2Z1H A;  1LAV A;  4XIU A;  4FLT A;  1T05 A;  4M3W A;  4HUE A;  1C0M A;  3VQ9 A;  3RTV A;  2G8U A;  4ELV A;  1VSJ A;  1RCH A;  4EP4 A;  3O3F A;  3K5N A;  1HQU A;  4DQQ A;  4BAC A;  3NGZ A;  1C1C A;  1RT2 A;  1SV5 A;  2IS3 A;  1JL2 A;  1WN7 A;  3MXI A;  3L3V A;  2EHG A;  4B8C A;  5CZ2 A;  3K58 A;  1JXB A;  3V1R A;  4FW1 A;  3O4Q A;  2W42 A;  4CED A;  3TWH A;  3T3F A;  4DFJ A;  3MEC A;  2Y1I A;  3SQ1 A;  5HP1 A;  1L3T A;  3S3O A;  2QXF A;  3FFI A;  1S1U A;  4B08 A;  3HP6 A;  2P1J A;  5FRM A;  2R7Y A;  5HRP A;  4FK4 A;  5J2N A;  4CIE A;  5HRN A;  3QEI A;  4W5T A;  3VN5 A;  1QTM A;  3ZSO A;  4CGI A;  4CJT A;  4HVJ A;  1QS4 A;  5FRO A;  4DTX A;  1TGO A;  2HNZ A;  1C6V A;  3OYE A;  4DTU A;  3NF8 A;  4DQS A;  4FJL A;  3AO2 A;  3AVN A;  3H08 A;  3KKR A;  1NJZ A;  1TK8 A;  1ZYQ A;  1CLQ A;  3V1O A;  2IC3 A;  3RWU A;  5C42 A;  1U49 A;  4KHY A;  4C8K A;  4BDP A;  4NYN A;  4PA1 A;  1S9G A;  3O3H A;  1HNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...