1T05A

Hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
molecule keywords oligonucleotide template
total genus 138
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t05A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t05A05
4FZYA 4E7JA 5KG6A 3IGVA 1XWLA 3KLIB 4FVMA 4ID1A 4LQ3A 2WTFA 1RT1A 3SUQA 1XHZA 3K57A 2HVIA 3U6FA 5C42B 3OS2A 4B9MA 4IRKA 3VA0A 1JLQA 3GIKA 4W5RA 4OKEA 5DLGA 5J2QB 2B5JA 3V9UA 1TK8A 4KI6A 1C1BB 2W8LA 2G8HA 3VQCA 5JXSA 3RRGA 3DMJB 4MFBB 4H8KA 4J9LA 1W9HA 3KLEA 1Q9XA 1YVFA 4FBTA 2Z1JA 4KHNA 4E1NA 2P5GA 5D3GA 4EO8A 2ILYA 2XGPA 4CHZA 3BREA 3LAKA 4E7IA 3EYZA 2F8EX 2UVWA 3AO1A 1TL3A 2BQUA 3GIJA 1S0OA 1EP4B 5HLFA 4FBUA 3E01A 2D5RA 3UDLA 4DFMA 1C6VA 4FJIA 4FJKA 1WSFA 3C6UA 2IM1A 4YP3A 1K6YA 3NE6A 4J2DA 3LZJA 3QIOA 1B9DA 3RWUA 5EU7A 3V1QA 2KZZA 4LSNB 3CO9A 3ZSOA 4IH7A 4NRTA 2IC3A 1HARA 4TY8B 1TKZA 1LV5A 2HWIA 1RTDA 2G8VA 4NCBA 3G86A 1EP4A 2JEJA 4CK2A 3AO2A 4BWMA 2FJWA 5KFBA 1JLBA 1GOAA 1ZTTA 5KGWA 5KFWA 4CIFA 1ZBUA 4RW8B 2DFFA 3D28A 3P83D 4CEQA 1D1UA 4NLXA 1S1XA 1ZBLA 3T1AA 2YNIB 4CFDA 2I5JB 1EETA 4C8KA 3PJWA 2BRLA 3H5XA 2J6TA 1C0TB 3H5YA 4TYAA 4Y34A 1VSLA 3CDUA 4URQU 5KFXA 3BQ1A 2XY8A 4E7HA 1WNSA 1IKVA 1RBTA 3QGIA 3DOLB 1JLBB 1JLQB 4URGA 4IFYA 3SJJA 4PWDB 1LW0B 1JL2A 4M3TA 2VG5A 3VQ6A 2X6SA 3AVBA 2WOMA 3HT3A 5KG1A 3V4IB 4HHTA 5FDLA 4Q5VA 4OLBA 1QSLA 1BI4A 4FLWA 2HMIA 3JYTA 2KQ2A 2RF2A 4ZTFA 3V1RA 3DOLA 4YNQA 1IKXA 3WNEA 2ZE2A 3NMAA 1KLNA 1R0AB 3MR3A 4DL6A 2FBVA 3CM6A 4F4KA 4W5NA 3FSIA 2Z1IA 4CF2A 2BE2B 1J9AA 1RT7B 3NHGA 4CJEA 1RDCA 2AWZA 2PYJA 5JS2A 2IAJA 3SUOA 3G10A 4RW9A 1QUVA 1LWEB 4FJNA 5HRRA 4QOZB 3H40A 1S9GA 3RBDA 3V9ZA 2YKMA 3L3VA 3CJ4A 4LH4A 4E7KA 3KLGB 2R2TA 5J2MA 1UA0A 1JLFA 3ZSXA 3G6XA 3WNFA 3DM2B 4DG1B 3FDSA 4I9LA 4E1MA 4MIAA 2IMWP 4CFAA 1BQNB 2XY6A 1T03B 3HJFA 5L1LA 1GX6A 3PX0A 4F8RA 4EP4A 3BSCA 3DLRA 4FJXA 3QIPA 5K14B 2I5JA 3QGGA 1HQUB 3QEPA 3QO9B 2V0NA 4IDKB 3ISNC 3TABA 1X9MA 4FM2A 1RYSA 1TQLA 1BQMB 3OS1A 3I0SA 3TAGA 3MXIA 3AVKA 3DYAA 4XIUA 5KT7A 2HVHA 4IKAA 3LPTA 4ZVHA 4R8UB 3U3YA 1BGXT 2WOMB 5K14A 1SUQB 4ELVA 4O4RA 4YR3A 3ALYA 3MTKA 4ID5A 3HKWA 1BI4B 1BQMA 1S4FA 3NF6A 2E9TA 4Z4HA 3ZT3A 5CYQA 5CZ2A 1L3SA 1QHTA 2YNGB 1D8YA 1GOCA 3DRPB 4FJLA 2HNDB 3SZ2A 1TK0A 4KTWA 2R8HA 5KFEA 3DI6A 5I3UB 1NHVA 4MKBA 2G8UA 4FZZA 4HYKA 2RN2A 3HXMA 2JLEA 3UR0A 5F8HA 4DTUA 4TN2A 4HUEA 4HVJA 3ZSVA 3PW7A 4KHWA 1NJXA 1LWEA 2I1RA 3DRPA 3LP3A 2ZD1B 4WFXA 4O3SA 3GV7B 4M3UA 3K5MA 3SV3A 3VQ9A 5J2PA 1D0EA 3VQDA 4J9OA 4J9MA 4KFBB 3V6DA 3IGNA 2C2DA 4ZP8A 3NH1A 1REVA 3BDPA 2KFNA 1RTIB 3H5UA 3U3GA 3RB0A 4DLEA 2IM0A 4H4MA 1TKTA 3OS0A 3RRHA 4QCLA 3DLEA 3CDWA 4FLZA 1S1UB 3FQLA 3GILA 4C8NA 5CZ1A 1TVRB 3KKRA 3TAPA 5F8JA 3DLKB 4Q0BB 3NAIA 5I42B 1TL1B 3TQ1A 3M8QB 1MU2B 2HWHA 3SCXA 3DRRA 4IG3A 3EZ5A 3EPGA 3HVAA 4J9NA 3H4DA 3MECB 5F8MA 2KFZA 4DQSA 4CJVA 1VRTB 2HNDA 4KO0A 3AA5X 4DSKA 4CFBA 3TWHA 2ZKUA 1SH3A 3OYFA 1N4LA 1JLGB 4NZ0A 5KT6A 3LZIA 4K4VA 5KFAA 1QE1B 4K8XA 1KRPA 1VK0A 3DLGB 5DQGA 4B3OA 1QAJA 2D0CA 3LP2B 3MECA 4EZ6A 4MH8A 3HL8A 4OVLA 1KVBA 3THVA 2G8IA 4IR9A 3HVTB 4M42A 4MQ3A 1JKHA 1N6QA 4FLVA 4QWBA 3DDKA 2LSNA 4QPXA 4FLTA 3SQ2A 1EXQA 2CKWA 3H08A 3PUFA 1KSPA 2HAIA 5DLFA 4LQ9A 1KVCA 2WRMA 3KK2B 4QWEA 2OPQB 4I2PA 4ECQA 2C28A 3ZSZA 2YV0X 3DMJA 2F96A 4JLHA 3VQQA 1ZETA 1TAQA 4RUAA 5EDWA 2W7PA 3RB3A 1WAJA 5I42A 4CJRA 4BACA 4DSIA 2OPQA 4M94A 4MKAA 3C94A 5KFDA 4E0DA 5C24A 1D9DA 2C22A 4I7FA 3VQPA 4K50A 2D41A 4DLGA 2HNZA 1J5OB 5KFGA 5L1IA 2IM3A 4RW6A 3BSOA 2P51A 3NBPB 5HLFB 4QAGA 3E01B 1NK4A 3PW4A 2IOCA 1U04A 2JC0A 2X74A 3L3UA 1JLGA 2GIRA 3HPHA 2KTQA 1D5AA 4NLOA 1QE1A 4IH5A 2UUWA 1TKXB 3L2VA 3A2FA 5C25B 1IO2A 1IKXB 4N5SA 3KHGA 2OZMA 2JC1A 3RTVA 5T14A 1RDAA 4CJWA 3CJ3A 3S3OA 1C1AA 3PVXA 4RU9A 2HHVA 5KT2A 2E9RX 1WNEA 3CWJA 4EBEA 1IKYA 2UUTA 4DTXA 1C0TA 5DMRA 1JLCA 4F4XA 2XY7A 3OSPA 2GIQA 4RW8A 1U49A 4O5BA 4WXOA 1RTJB 3ASMA 3M8RA 3LP0A 4IFVB 4KV8A 5CY4A 2HHSA 4CCHA 3O4QA 3KLFA 3KOAA 5DGAA 3NGYA 3MF5A 3MFIA 4FW1A 4DWIA 1NK8A 3SQ0A 4XPEA 2B43A 4ED0A 2UVRA 3CFPA 4M3WA 2W9CA 1N48A 5KFZA 1TGOA 1RDDA 2ZE2B 3FQKA 4F2RA 1R0AA 5J1EB 4CEFA 3QEVA 3QZ8A 1ASVA 1KCFA 5KI6A 1TKZB 5HP1A 3NH2A 3KKSA 3BR9A 3CDEA 4O3PA 2YHBA 1RAJA 4LSLB 4ED3A 2FJVA 1X1PA 2CJQA 4FK4A 2B6AA 2A1SA 1S9FA 4G1QA 4JS5A 2W9CB 4H4OA 4GMJB 4KHSA 2KW4A 3PX6A 3L2QA 2DY4A 3PV8A 4NCAA 2HHUA 1RCHA 2AGQA 4CJUA 3RAXA 4NLSA 4R0EA 4RNMA 3OJSA 2RDIA 1RBVA 5EWEA 4JRPA 4ECZA 4QWCA 2O4GA 1IKVB 4OGCA 4OL8A 3QEIA 3CM5A 2A1RA 4DFJA 4AILC 3MR6A 3M9OB 4H4OB 4H54A 4Y2CA 4OPJA 4DSJA 2VG6A 3D5MA 4NLUA 2JEIA 3QNOA 1IH7A 2YKMB 1FKOA 3V81B 1JXBA 4M45A 4B9SA 1DTQB 3SPYA 1U48A 1ZTWA 3AVLA 3KD1E 1RT4B 4IKFA 1BCOA 2P1JA 3KHHA 1SL0A 4ZP9A 2OPPA 2BR0A 4CEAA 1QQCA 4CJLA 2BDPA 1HNVA 4Q8EA 4CHOA 5KGXA 5F8GA 1L3VA 3OYBA 3T19A 1EKEA 2ITGA 4IH6A 4CJ3A 1S0MA 3OL9A 3CFOA 1XR7A 4FLXA 1ZYQA 1X9SA 3QIPB 3SPZA 1KVAA 1FKOB 1HQUA 1DLOA 4CJPA 4B9VA 4FK2A 3KLFB 4TQRA 3BSNA 4IRCA 4WFYA 1BISA 4K4TA 3S9HA 1WLJA 2XHBA 4CJFA 4ECSA 4Y2AA 1L3TA 4R8UA 4N56A 1RT6A 3G6YA 1RT3B 4NYNA 1NK7A 4Q43A 5L1KA 3MEEA 3AVHA 1DLOB 4M3ZA 4N41A 5HP1B 5J2MB 3KLGA 4WZMA 5KT4A 3DI6B 4DL7A 4AHUA 4HTUA 3ZSQA 1IKWA 5KG5A 4K4WA 4CJTA 4KPYA 4ED2A 3OYNA 3DM2A 3GIMA 4KHYA 4CK3A 4IG0B 5FRNA 3FRZA 1JXEA 3I5CA 1S1UA 1WSIA 3NAEA 4G1QB 2YNGA 1ASUA 3D0PA 3RMBA 1A5VA 4GW6A 3LP1A 4Z4FA 1RT6B 3HPOA 4Q0BA 3OYCA 2YNFA 4RNOA 3KJVB 2Z1HA 5KRSA 3NGDA 1EX4A 2D3ZA 3AA4A 5I3UA 4DQQA 3KLHA 4IDKA 1D9FA 2QKBA 1HMVA 4WE1A 4CJ5A 4CGJA 4ECUA 2G8WA 1S1VA 4ICLB 5DK5A 4ZHRA 3OL6A 3S3NA 4C8LA 3SYZA 4OJRA 3C6TA 1QS4A 4AHRA 4ZVFA 1DTQA 3OYDA 3T5JA 1GOBA 1LWCA 4TQSA 4PY5A 5KFVA 5KTQA 2Y1IA 4OPKA 1S1WB 4TYBA 3NAHA 1HYZA 2W9BA 4M3YA 3DLKA 4MK7A 3HVWA 4FLUA 2KZMA 1UAXA 3RBEA 5KT5A 3OYKA 3IAYA 3SI8A 3PW0A 2AU0A 2YNHA 5DG7A 2QXFA 2VWKA 2VA2A 1RBSA 4ECXA 5DGBA 1GX5A 1FKPA 2FVCA 4RW4B 4CF1A 1RBRA 5KFNA 2OZSA 1MMLA 3ISND 2Q3SA 1T7PA 4CJKA 3MEEB 4CGHA 4RG8A 4DL2A 4NCGB 2HNYB 1B9FA 1CLQA 3ITHA 1SH2A 4O44B 4PQUA 4Q8FA 4DL3A 1JLAB 4KFBA 1UWBA 3GV8B 2AX0A 5DG9A 3LP2A 1O1WA 3KMQA 3OYLA 5KFTA 2D0BA 4I7FB 4LH5A 2R8IA 2XGQA 3KLVA 1HMVB 4WE1B 2W9AA 4IBNA 1C2PA 1QTMA 4JV1A 3VQEA 3MAQA 1LAWA 1U4BA 2JEFA 1KFDA 4B8AB 3HO1A 1S10A 1NOYA 4YFUA 2F8TA 4CJ4A 1HPZB 1WSHA 5KFJA 5J2QA 4CEZA 2D7SA 3OYJA 3CFRA 3LAMA 3VQ7A 4J2BA 1MU2A 1C1BA 4J9KA 5KFCA 2PY5A 3N6LA 4U7CA 4GC6A 3OLBA 2FVQA 4IG3B 3SUNA 4ZVEA 4MFBA 3VQ5A 4BE2A 3RMDA 3AVFA 1JIHA 4CJSA 4O3OA 4WZQA 2FLNA 1TKXA 5C25A 2WHOA 5KFUA 1U45A 5D3GB 3PJXA 1RT2A 4TY9A 1WSGA 3MEDB 3QLHA 3RR8A 2VG7B 1S9EA 2OPRA 2FLPA 4J9SA 3DOKA 3H98A 1TL3B 3TAMA 2HHWA 1JL1A 5SWMA 3HSTB 3ZT2A 4DQIA 1XR5A 2ASLA 3VQ8A 3JYTB 5C42A 4B3OB 5FRMA 4E7LA 2O4IA 4AHVA 4ECTA 4FJHA 4CF8A 3PY8A 1TAUA 1TV6A 5F8NA 4KV8B 2BE2A 4PQUB 4ZVGA 1J5OA 3OHAA 3BQ0A 4BE0A 1VSFA 2W8KA 3Q8QB 5L1JA 1ZBIA 2ASDA 5HRNA 3OYIA 4O4GB 4Z4CA 4PA1A 3T5LA 2OPSB 3KNAA 2WB4A 2ILZA 5EUHA 2R2SA 3SFGA 1BHLA 2ASJA 3WNHA 1VSDA 1IM4A 1S5JA 3O3GA 3KIOA 4NYZA 3KK3A 4LSLA 1T3NA 2RDJA 4DU1A 2O5DA 3QYYA 4DS5A 4WXWA 5KG2A 1KHWA 2AJQA 4CEEA 4CJQA 1QSYA 3L2WA 2RPIA 4KREA 3CJ0A 3I0RB 2B4JA 4GVMA 1LW2B 4KKOB 1DTTA 4QWAA 1VSHA 1CXUA 2R7YA 2E6MA 3FFIB 2ATLA 1U09A 3SV4A 3Q8SB 3AVIA 3QO9A 2AGPA 1RT1B 5CYMB 2IC3B 4TY8A 2IA6A 4FJ5A 5HRPA 4B8CA 2QK9A 4ECRA 1J53A 3NL0A 1RTDB 1JLCB 2DPJA 2IJFA 4KTZA 3NBPA 3I0SB 2E6LA 1NK9A 3VA3A 1UOCA 1RTJA 3MEDA 3QLHB 1A5WA 4YR0A 4KKOA 3LP0B 2V4RA 4B9LA 3TARA 1SUQA 4FM0A 3TAQA 3MR2A 3ZT0A 3D45A 4L8RB 4B08A 1Q8IA 5J2NB 1TP7A 3KLEB 3H4BA 4OKKA 3ZSYA 3MXMA 4KB0A 4F4YA 2JEGA 1XI1A 3RMCA 3HP9A 4DU3A 5F8IA 4PWDA 3PO4A 2BGGA 3NCIA 4ZPAA 2ETJA 4KB7A 4FLYA 4CHYA 5FROA 3SNNA 4B9UA 3V4IA 1JLFB 3LALA 4C8MA 1IKYB 2AGOA 3K59A 3V6KA 4RNFA 4XO0A 3NFAA 4FW2A 4J2AA 1WAFA 1S6PA 1NJYA 3C6UB 4O4GA 2GBZA 5KFMA 4DL4A 3Q8RB 3BQ2A 5KT3A 4KHRA 2E9ZA 3UPFA 4OLAA 2BQ3A 3SQ4A 4KAZA 4M41A 3N6NA 3HPGA 2VWJA 3QGHA 4B9NA 2QV6A 3V6DB 1S6QA 1KTQA 1YVUA 4O55A 3OL7A 2HHXA 4KHUA 4WYLA 4ZMMA 3CQ8A 2VG6B 3I0RA 1DTTB 1G15A 3V81A 5J1EA 1HNIA 3GQCA 3ZSWA 4QW9A 4CIGA 4EBCA 3OSNA 1NKBA 3M8PB 5DQHA 5HBMB 4HUFA 4DSLA 5KFRA 4EP5A 4KI4A 4ZPCA 2ZQBA 4RW7A 2R2RA 1JLEA 5CYQB 4F2SA 1ITGA 4W5QA 4DSEA 1XC9A 3I5AA 5F8LA 3VN5A 5KG7A 4X2BA 3NGIA 4M95A 1VSMA 1TK5A 3K5NA 4HKQA 2WK4A 1RT3A 4CGGA 3AVNA 3Q8PB 4F50A 3QETA 4E19A 1RDBA 2DFHA 2XCPA 3HHKA 1LWCB 1HQEA 2C2EA 5KFFA 4FJJA 2RF2B 3JSMA 1NK6A 1C0UA 4CERA 2X6NA 2XCAA 1T94A 3LP1B 3IRXA 3UIQA 3O3HA 3OYHA 3AO4A 1BIUA 4ECVA 3LDSA 1NJWA 4DSFA 4DQPA 3H2LA 5J2PB 3O4NA 3HVRA 1NOZA 2C2RA 3TANA 2XI2A 2IAJB 2AQ4A 4QWDA 1SKSA 1S6PB 1HNVB 1UA1A 4F4WA 4HCBA 1NKEA 3P5JA 1REVB 3DLGA 1S1TB 2W7OA 4K4XA 2YNFB 3LANA 2OH2A 1FK9B 2BQRA 1CXQA 1A5XA 4RNNA 3KLHB 2WONB 2Y1JA 3AVGA 2HHTA 4ZPBA 3NF7A 2EX3A 1XR6A 4CHNA 3PZPA 4R5PA 3GIIA 3GYNA 4YQWA 1BQNA 4FM1A 4JV2A 4DF4A 2HW3A 1K1QA 4EYHB 4IQXA 2GC8A 1Q9YA 5KFOA 3OVNA 1FK9A 4DTMA 2DFEA 5T7BA 2WONA 4NLWA 4FS1A 1S49A 4WYWA 4CEDA 1CZ9A 3VQBA 3DRRB 5JUMA 1RA6A 3PX4A 3NGZA 2FLLA 4RW7B 2AX1A 1C1CA 5KRTA 2R8JA 1S1WA 3OYMA 2DPIA 4CESA 1FKPB 1RTIA 4RW4A 2XO7A 4DS4A 1T05A 1HPZA 1VRUA 4Z4IA 4TSXA 3TAFA 4H4MB 4JV0A 3KLIA 4NCGA 1HQEB 3SQ1A 4ED1A 3E51A 5KFQA 4NLYA 3AA2A 3K5LA 4ICLA 4BDYA 3N6MA 3K5OA 4BDZA 4K4SA 4AHCA 3M9NB 4ZHRB 4W5TA 2ALZA 4ECWA 3CG7A 3IN5A 1T05B 3OYAA 4FJ9A 2FVRA 4W5OA 1LWFA 4XPCA 3CYMA 1N6QB 4CK1A 3DOKB 1ZBFA 2BRKA 1NK0A 4WFZA 3AVCA 3TR8A 3V9XA 4ED8A 3KMSA 3MEGA 1Z25A 4DTJA 2FJXA 2J6SA 2XY5A 4DTOA 4GC7A 3KK2A 3IS9A 2ZD1A 4DMNA 4NLDA 3PO5A 3MR5A 3DLHA 5KG0A 4OKJA 5HRSA 3I8DA 4KE5A 1LWFB 4G3IA 1BCMA 3C95A 1WN7A 1QSSA 3EZUA 1YTUA 2YNHB 3QZ7A 2QE5A 5C5JA 2NUBA 1CSJA 3BGRB 3BSAA 3OYEA 4KTQA 4Z4GA 1S0NA 1SV5A 3EPIA 3AVAA 3SI6A 4RNHA 3KK1B 4EBDA 1TKTB 1NKCA 4IFVA 3TI0A 2EHGA 2PYLA 3KD5E 1RILA 5EWGA 4OGEA 1CZBA 1S97A 3BGRA 3ZSRA 4U6PA 1VRUB 3RR7A 3VQSA 4EO6A 2VG7A 4CGFA 3T5KA 3KK1A 4FZXC 3FFIA 3VQ4A 1VSKA 2YNIA 1N5YB 1W0HA 4O0IA 4I2PB 1X9WA 5CYMA 1ASWA 2WCXA 3F9KA 4FJ8A 3QERA 2B6AB 4HUGA 1WSEA 1SKWA 4EZ9A 2IS3A 3DRSB 4IFYB 4DTSA 1SL1A 4KB1A 4LD0A 4FJ7A 1TV6B 2IM2A 3T5HA 3SUPA 2IBKA 4C8OA 3V1OA 2D0AA 3KTQA 4CGIA 5L9XA 4CFCA 2HMIB 4RZRA 4CIEA 3O3FA 4E89A 3IS9B 3DRSA 2FVSA 4EEYA 4LSNA 3EY1A 2E4LA 1LW2A 2B5JB 4I2QA 3M9MB 4JUZA 5KG3A 1JKHB 1LAVA 2W42A 4K8ZA 1S1XB 1WSJA 3TAMB 4IOBA 3RB6A 1RA7A 1EETB 4HCCA 1VSJA 1RT4A 3KK3B 1NHUA 2OPPB 1J54A 3ZT4A 3V9WA 5HROA 2R8KA 4N76A 3NDKA 4I9QA 2IDOA 3L2UA 3I5BA 2YKNA 1U47A 2R8GA 3CJ2A 1SL2A 1L5UA 1HRHA 2IGIA 1NNDA 3P1GA 4N47A 5FDLB 3LPUA 5J2NA 4CHQA 3V6HA 1SH0A 4MK9A 4CECA 2Z1GA 1KFSA 1LW0A 4YR2A 3G6VA 3QIDA 3PW5A 2VG5B 2EC0A 4F3OA 1BIZA 4TLRA 3GV5B 2OPSA 1YTAA 4DTRA 4FXDA 3OHBA 1N5YA 1NK5A 2OA8A 3L8BA 4KAIA 1RT5B 4RUCA 4JRQA 4Q45A 4ECYA 4YMEA 1FXXA 4CHPA 1RT7A 4CEBA 4O0JA 4ELUA 3AV9A 2DTUA 1Z26A 5DG8A 4NLGA 4NLQA 4NYFA 4BWJA 2RKIB 5KFPA 3AA3A 5F9LA 4RW9B 4K4YA 3PW2A 5KFIA 5F9NA 3KJVA 3HK2A 5E41A 4FYDA 4DU4A 3OL8A 2XI3A 1RT5A 3QNNA 1RBUA 1YT3A 3ULDA 4FK0A 4Y1CA 3K2PA 3ICLA 3HP6A 2GUIA 3AVMA 1S6QB 3JSMB 2RKIA 4QW8A 4DEZA 4ED7A 1T03A 3MFHA 1RNHA 3IRXB 3KHRA 4I2QB 3S3MA 1HYSB 4ZTJA 3B6OA 3LWLA 4CF0A 1F21A 1RTHA 2J6UA 5KFSA 2G8FA 3DLBA 1W25A 4DG1A 4BE1A 4FJMA 4J9RA 4CEOA 2OYQA 3NF9A 3IG1B 1JLEB 5HROB 4UQGA 2W9BB 1HNIB 2YKNB 3BJYA 4MIBA 2HB5A 3CIZA 3M8PA 5HBMA 1XHXA 5JS1A 1RDRA 3T3FA 1VSIA 3QEXA 1TKDA 2P5OA 2BANA 3QESA 1IG9A 4KHQA 4ZPDA 1OS5A 2XRIA 5SZTA 3IG1A 3SFUA 1S48A 4DFKA 2FBXA 4K4ZA 4NLVA 1S9GB 4AHTA 3V9SA 3QINA 3CVKA 4O3QA 2XC9A 4CE9A 3AO5A 4IRDA 2FVPA 3H59A 2BANB 2V9WA 2F8SA 1C1CB 2VA3A 1C0UB 1NJZA 1VSEA 1KHVA 4ED6A 1Y97A 3MXJA 3L2RA 3NKYA 2FC0A 3WNGA 2V4QA 4FJGA 1UWBB 3KHLA 1BL3A 4O3NA 3C6TB 3NF8A 2UVUA 2QKKA 4DF8A 3TAEA 4Q44A 3M8QA 4Y3CA 3B6PA 1KLMB 4DFPA 1B92A 1IKWB 3ZCMA 3OYGA 4ELTA 4DTNA 3QEWA 3DYAB 3K58A 2FBTA 4M3RA 2YHAA 1SKRA 4Y1DA 1L3UA 1K1SA 3HYFA 1RYRA 1HJRA 4NRUA 1HYSA 2FBYA 5EWFA 4NLPA 2R2UA 4Z4EA 3CJ5A 1JX4A 1RTHB 3RAQA 4NLRA 1N56A 3TVKA 4ID5B 4R5PB 4TXSA 4E3SA 4J9PA 4B9TA 2X78A 3F73A 1I3AA 1I6JA 4ZP6A 3V6JA 4CF9A 4FCYA 4K4UA 2GV9A 1TVRA 1I39A 1T8EA 1ZBHA 3OY9A 1RT2B 3OJUA 2UVVA 3UQSA 2PZSA 2OPRB 3G0ZA 3ITHB 4FS2A 4IR1A 1JLAA 3PR4A 1JXLA 5KFYA 5KFHA 4KHMA 4DL5A 4ZP7A 1S1TA 3RB4A 3M8SA 1QAIA 4PUOA 4F3TA 1SV5B 1VRTA 3HM9A 4KRFA 4KO0B 2G8KA 3ZT1A 1TL1A 2JGUA 5KFLA 1C0MA 5KG4A 2ATQA 4KBIA 4IG0A 2XWYA 3MEGB 3H5SA 4M3XA 1Z4UA 4NLTA 4LY7A 3AVJA 2D3UA 4F4ZA 4PUOB 3LWMA 3OLAA 3RMAA 3AO3A 5C24B 3HVTA 4Z0UA 2HNYA 1KLMA 4DQRA 3PHEA 4J2EA 2HHQA 3VQAA 3DLEB 4URSA 4O44A 3PR5B 4DTPA 2HNZB 4JS4A 4KSEB 4EYIB 1S1VB 4RW6B 5DQIA 4MK8A 4AHSA 4O3RA 4BDPA 3NH0A 4J9QA 4AH9A 2IJNA 4CGDA 5KFKA 1HYVA 1S9EB
chains in the Genus database with same CATH superfamily
1F3VA 2V8GA 1Y3KA 3V2UC 3KLIB 4FVMA 4ID1A 4LQ3A 3CD6S 1XHZA 3FBEA 5E0OA 5C42B 4DPUA 4FF2A 5LMNJ 3VA0A 3GIKA 2HF4A 3L6QA 2O8DB 3G8QA 3MPYA 4W5RA 5IV3A 2ZH4A 2B9EA 4HTJA 1TK8A 4WKRA 3KUHA 4JKGB 3CQYA 5JXSA 4H8KA 4NXNK 4J9LA 1VS3A 4FBTA 3DGVA 3GFXA 3ZYYX 2CPDA 2KJWA 2KO1A 2ILYA 3VTIA 4PABA 1WSVA 1P6TA 4DR4K 2NCKL 4UY8O 1TL3A 2J9DA 3GIJA 5FLXU 3MPWA 2NYHA 4OV1A 4WFAL 5HLFA 3UDLA 4DFMA 3KYLA 3FBCA 3C6UA 1WSFA 3QB0A 4NXMJ 3NE6A 3QIOA 1Q86O 1CULA 1WTFA 1X4GA 4DR6J 3PTWA 1RHMB 4OYPA 4NRTA 1N36F 1YRXA 1TKZA 2KHDA 2F9WA 4PKDB 3O9SA 2G8VA 2NSBA 3G86A 2OO4A 2JEJA 4CK2A 5KFBA 2E7VA 5E84A 4EU0A 1GOAA 1ZTTA 1Z2LA 4CIFA 3AD7C 3ZZYA 2V8VA 3HZGA 1WOQA 4DCJB 4NLXA 1ZBLA 3T1AA 5C0YA 1W7AA 4CFDA 2BRLA 2E5LK 1C0TB 3MK6A 4TYAA 1VSLA 4AF1A 3CDUA 2XY8A 5GAGI 2DTJA 5BYQA 2KT3A 1HKBA 4ILHA 3KUGA 2HLUA 1JLQB 4URGA 3SJJA 4PWDB 1LW0B 4M3TA 2BVZA 3CCRS 1ZM2A 4IEIA 5KG1A 4JKGA 1VQ8S 4X64K 1GK8A 3OTOF 1UP1A 4PG8A 3JYTA 2P9IA 4M5IA 3V1RA 3VZIA 1FD2A 3ISZA 4JV5J 2ZE2A 3NMAA 4WFAQ 1R3NA 8RUCA 3EUNA 3O08A 2ZZNA 1I51B 2R9LA 5GADP 3I8BA 2VL1A 2HQIA 3NHGA 4OHYA 3C14A 2QRRA 3GJTB 2PYJA 3BKFA 2AYGA 2FYXA 2IAJA 3SUOA 3UW1A 4RBTA 1OSCA 4N7TA 1R59O 1WKLA 1QUVA 5C2DA 2VH7A 5BRDA 2GV1A 2QWNA 2YKMA 4LF8J 3L3VA 3CJ4A 3KFWX 5F0XA 4DR2K 3G6XA 4ID8A 1HBNA 4DG1B 2IMWP 3D67A 2HSTA 2XM3A 1T03B 3HJFA 4FL9A 1FERA 3MWBA 3PX0A 4DX8H 4EP4A 1VISA 2XQCA 4EHUA 2DHAA 1NM2A 5IT0A 2E5LF 1U0SA 3ZZZA 4ZPTR 1SCJB 5DRKA 4XIUA 4QJVA 5KT7A 5BR8F 4DOZA 3D2FB 3K0JA 4ZVHA 1UETA 2H5JB 2CPJA 3MN9A 1G7CB 3OTOK 3CJQA 4LFAJ 1BI4B 4B3SJ 3G87A 4YDXA 2OD6A 4JI2K 1GOCA 1HR0F 3DRPB 3MMAB 4DR7F 2HNDB 2R7WA 3W2VB 4KTWA 5BPNA 1OH7A 3DI6A 5I3UB 1EQMA 4HYKA 5C7PA 3BS9A 1RWWB 1TL7A 4X4NA 3UR0A 1OQ6A 1RBLA 1Z05A 3UKRB 3W3DA 1UZDA 3ZSVA 3PW7A 1WELA 2DRDA 5L38A 4WFXA 2B8PA 3TA1A 4BRDA 4NE9C 1WHWA 3IWLA 1V3ZA 5J2PA 5EX5A 1KVKA 2E7XA 4KFBB 3NH1A 4PKIA 4MTPA 4R0JA 2AJ1A 1REVA 2OKQA 1RTIB 1PJ6A 3NGRA 3RB0A 1H72C 2C1EB 4YN3B 4F3QA 1RAAB 2Y1LB 3JAMU 1TKTA 3OS0A 3MN6A 3HHEA 5A8RA 2JL9A 1R43A 4GVBA 5CZVA 3DLEA 3CDWA 2FC8A 2ZH2A 1K0TA 4I6MA 3CCMN 2KU7A 5FPDA 5D0GA 4BC9A 3FQLA 2W2MP 5C15A 4JI1F 4Q0BB 3Q86A 3EX7B 2JHEA 5I42B 4PXDA 1GLDG 4B3TK 3A3NB 2NRHA 2XBPA 5AQOA 3TQ1A 1S6OA 2C3PA 1U1PA 4Y0FA 1RGIA 3CCWA 3BF1A 5HVGA 3C46A 4BRGA 1D4XA 1Y10A 2PMZD 3EZ5A 4J9NA 4DQSA 5DS7A 4CJVA 1VRTB 3T6JA 2HNDA 4K25A 3TWHA 4HLBA 2ASYA 3RAMA 4Z7CA 1SH3A 1N4LA 1JLGB 4Y6IA 4DMZA 4K4VA 4OI1A 1FE0A 4JOUA 4PWWA 1Q95G 1EJ7L 3TX8A 4OYZA 3D1HA 1VR6A 3P4IA 2V50A 3NS6A 3LP2B 1KVBA 4LIRA 5LSLA 4IR9A 1PBAA 4DUYK 2Z57B 3RU0A 1JKHA 4KHPF 4QWBA 4FPIA 2F7TA 4BREA 4QPXA 3THWB 4QBUA 4L76A 1Q82T 3PUFA 1KSPA 2P9SB 4LQ9A 2V67A 3TNVA 1HHQA 4QWEA 3CMAN 4DR1J 1F9HA 2G0IA 1WUUA 1RWNB 3K89A 2VYPA 4QYZJ 1WEYA 3ZZPA 1RBOB 1HWLA 2XZDB 2YV0X 4MMOA 2Q0UA 2VFTA 3C6HA 3FE1A 2ROEA 1ZETA 1TAQA 4RUAA 1J2VA 3L7OA 1XUPO 5E3RA 1EQYA 2GGPA 4M94A 4MKAA 3PSIA 3A8KA 2OFHX 1D9DA 4I7FA 2MLYA 4K50A 5LXRA 2D41A 2EBEA 2EK6A 4NMLA 2P5VA 4DLGA 5KFGA 2VOPA 4JI4F 3D2EB 2IM3A 2XNQA 4OYMA 3MR7A 1NSQA 3RJMB 4QS8A 3T1YF 1NK4A 5IC4B 3MM7A 1KAXA 3SQOP 2X74A 3TSQA 4BC4A 4E8UA 2MPUA 2EKNA 2GUPA 3HPHA 3TX0A 3NMUA 5AQUA 2QI2A 1WC4A 4FYYB 1HLWA 2UUWA 2RAQA 1SJ4P 1IKXB 4N5SA 3KHGA 4Z37A 5T14A 1GAOA 1FJEB 1C1AA 5F1XA 4B1XB 3CWJA 2QA4G 1RAEB 2C3UA 2UUTA 1M5PC 1C0TA 3VEXA 4NEZA 5KOXA 5DMRA 1JLCA 3E8OA 1RADB 2PSZA 3CGIA 2HGMA 4LF7K 2GIQA 5E3AA 2MHNA 3ASMA 4IFVB 4KV8A 4PAAA 4A57A 2ZOFA 4ZVSB 1VCTA 1OY8A 3NGYA 2ZF5O 2I38A 4NX9A 3UR3C 4DWIA 1NK8A 2IJRA 4M3WA 3S8SA 4OHXA 2UVRA 5K8OA 2ZE2B 4JD2A 3FQKA 1R0AA 2W6KA 2K8GA 5J1EB 3SBGA 1VBXA 4A8FA 1KCFA 2NRWA 1LKZA 3MAAB 2W24A 2FZGB 3I56N 3BR9A 4AL7A 4LSLB 2FJVA 2J4RA 4FK4A 1R7IA 1I94F 2A1SA 1S9FA 1TL4A 3P5TL 1T9YA 2W9CB 3DNCA 4H4OA 5HL7Q 3OTDA 2ZC4A 2WSFC 4LF9F 3TTCA 2X1FA 2GJ2A 4RNMA 5DZ6A 1OY9A 2RDIA 3BZCA 1S0VA 3ILOA 4TVAB 3LPYA 2XWXA 1ATRA 1IKVB 4EMDA 2A1RA 3HFKA 4H4OB 2XS2A 3TOQA 4YB7A 4Y2CA 4DSJA 3L9ZA 4NLUA 4CTAA 4UW2A 1X7VA 1FKOA 1U1NA 4M45A 4B9SA 1DTQB 3R3LA 3WQPA 2AA4A 2P1JA 2JFKA 2FJDB 4JKBA 5F8GA 4BBYA 4DJBA 3T19A 4DR6K 4IH6A 5GAGP 1D3WA 4IDHA 5AQJA 1CC7A 1R0BG 1X9SA 2KVQE 1FKOB 1U1LA 4DV5K 2W4DA 2G2OA 4NYPA 1PKUA 3U27A 2E1PA 4FVCA 3TR5A 4XDCA 4UTGA 3DLJA 5GAHI 1BISA 4K4TA 5DM7Q 1WLJA 4CJFA 2IBOA 4ECSA 2MTLA 1EARA 1SC6A 2IVFB 5ETMA 3QJPA 4Q43A 3O80A 1DLOB 4N41A 5HP1B 5J2MB 3KLGA 3DDNA 4HTUA 3M2VB 1F9FA 4CJTA 4FF1A 3DM2A 3GIMA 4K2XA 1JXEA 3I5CA 4CH0S 1WSIA 3NAEA 2H4YB 2YNGA 2B8QA 2PMHA 3E9PA 2BM1A 3OYCA 4RNOA 2D3ZA 5I3UA 2UXBJ 3L09A 4MYUA 1D9FA 4OX9F 2ZJRQ 4WE1A 3J7AP 2XSJB 2RRAA 3NCQA 5IC6B 1O8BA 4BROA 4X65J 3SLCA 5DK5A 3FFKB 3OL6A 4C98A 1KXPA 1FT8A 5ADXH 4C0OC 3SYZA 3EZWA 1V4TA 1QS4A 1DTQA 4LJMA 3OYDA 2AJ4A 3ILLA 3SQGA 3T5JA 4OZ3A 3AA8A 1C0GA 4B17A 1HX1A 3E9OA 2Y1IA 1HNWK 3W61A 3UE5A 1TMMA 1AUSL 3DLLL 4KJIA 1VRQC 4M3YA 3DLKA 1RUSA 4FLUA 3RBEA 4ERDA 1NB2A 2V4JA 3OR1B 3IAYA 2QYGA 2JRSA 3EWGA 2YNHA 3DXKB 2EG2A 5MLCQ 2VA2A 4CF1A 3Q8VA 5KFNA 1QUPA 3UDCA 3W5XA 3ENAA 4ES2A 3NP5A 3MEEB 1J27A 3UN2A 3UO0A 3K9JA 4O44B 4D3GA 4Q8FA 1IBLK 2ZFHA 5ETNA 3CDAA 5MLCV 3J80O 1UWBA 3EVMA 1KS2A 4ZIVA 4A5AA 5DG9A 1O1WA 4H4KA 2XMWA 3C15A 1YBUA 3OYLA 4LH5A 3KLVA 2W9AA 4IBNA 1C2PA 1BC6A 1RJJA 1QTMA 3JQMA 4OLOA 3O2IA 3WT0A 4OFZA 2A6OA 4CJ4A 5KFJA 3ENBA 2Y3YA 3VQ7A 1OVQA 2PY5A 3OXLA 3I55N 3H1QA 2FVQA 3SUNA 2HVEA 4MFBA 4S0MA 1HNZF 4YB1P 4FWNA 2JX2A 2O67A 4WU2A 2WHOA 2GX9A 3LUYA 1RAHB 3PJXA 1RT2A 4TY9A 3QLHA 1MROB 4EFHA 2V68A 1N32F 3M8WA 1XNQF 3A5NC 3A3OB 1FNOA 3A12A 1MMNA 2HHWA 3EE3A 4KGXB 3NS5A 4K2JA 4A46A 4K5RA 2GQQA 3VQ8A 4CZJA 5E5NA 5AJ3J 3ZLJA 3PY8A 2DJWA 2DNLA 4KHPJ 2AV5A 5F8NA 1CJVA 1YWXA 2JJ4D 3EGZA 3LGHA 4PQUB 5THWA 1J5OA 4BE0A 3P6YC 1VSFA 2NRTA 2IVPA 2QSFA 3Q8QB 5L1JA 1ZZFA 2LYVA 2CJBA 2HZAA 1Q82O 4WBFA 3OVAA 4PA1A 3T5LA 1MA9B 2F8MA 3AH6A 3KNAA 2VQEF 4WF9Q 2KVIA 2R2SA 3SFGA 3GFYA 3WNHA 4DPWA 3AB2B 3HTVA 3CJBA 1REGX 3IDHA 3O3GA 2L48A 2ZH6A 4A8WA 5E7OB 2RDJA 2UXCF 2O5DA 2I8EA 1H98A 2A6AA 2UXBK 1HBUB 2AJQA 2ZJQL 2N7CA 3L2WA 2B4JA 3I0RB 4GVMA 1LW2B 3R5JB 5GADI 1TR0A 2E6MA 2BZ2A 2PDAA 3FFIB 1XBWA 5K8NA 1HLUA 1N36K 2ATLA 1U09A 1XNRF 3AOCA 2NYIA 2MZQA 4TY8A 4CT8A 3ID8A 1HNZK 2IA6A 5HRPA 1V3RA 1YKWA 1JLCB 4KTZA 1TYQB 2E6LA 5CHIA 4ZLNA 1UOCA 1RTJA 3QLHB 4PWUA 5BJRA 4DV1K 3PM9A 2QM1A 1NHKL 3TAQA 3ZT0A 1OY6A 4A8KA 3VAGA 3PEHA 3R8EA 3H4BA 4DV4J 3ADAC 4F4YA 2JEGA 4BGAA 5F8IA 4PWDA 2GVZB 1ZZNA 3NCIA 2ETJA 1FF2A 4QIGA 1X5SA 2VDHA 2IVMA 3D6RA 3SNNA 4OYIA 3M05A 3V4IA 3J7A1 3W3SA 2FSKA 3V6KA 1NM1A 3HBTA 2RNEA 1DHMA 2HIYA 4CO3A 1H2VZ 3J81j 3H0PA 4BR5A 4KHRA 3Q2SC 4OJHA 2BQ3A 1Q8BA 2FD2A 4M41A 3HPGA 2VWJA 2CNLB 1KTQA 1VI7A 4O55A 3OL7A 1HI8A 3GE9A 3CQ8A 5EX3A 3IKMA 1G15A 1D09B 3RW7A 2FF3B 1HNIA 3A13A 4MT1A 4CIGA 4EBCA 1NKBA 4DR2F 3GIRA 3M8PB 5DQHA 1TTHB 1VQ9S 5KFRA 3GDQA 4KI4A 1Q7YT 4F2SA 1ITGA 1FWKA 3JS9A 3I5AA 5F8LA 2WFBA 3VN5A 4DV1F 3L7PA 4X2BA 1J6ZA 4M95A 2KDOA 3MCNA 3CI5A 1VSMA 3DWLA 4HKQA 5CE3A 3AVNA 2D4WA 3SCIE 3P38A 4HACA 5IFMA 3T9NA 4DV7J 2C2EA 2AIRB 2ZDOA 2RF2B 2W2OP 2YWFA 3MCPA 1X4EA 4CERA 2KYXA 2X6NA 2Y8YA 2XCAA 1C0FA 4DPTA 3OYHA 3RW6A 3WX4A 3CMES 1X3MA 2EI5A 5J2PB 4LVOP 4M5MA 1U1KA 2CJAA 2FLOA 2OI2A 3RUBL 3G4SN 4MKVA 3PG9A 4MO5A 2AHOB 3CNQP 1HNVB 4F4WA 3QT5A 3DLGA 2E5GA 1XC3A 1F3FA 2OH2A 3CC2N 1WHVA 1VIXA 1CXQA 5H9FK 4WIIA 1IQTA 2DNOA 3MM6A 1KNZA 2RS8A 2DD8S 2HHTA 3THYB 1XR6A 4C3LA 1YHQN 4CHNA 4R5PA 3GIIA 4CZGA 2BV3A 2XEXA 4FM1A 2PC6A 3MCMA 4JV2A 3AAPA 3ATUA 4IYQA 3R8YA 5KOWA 1RXOB 3OTOJ 3BGOP 4R25A 4NLWA 1I5OB 1CZ9A 4CZMA 2FLLA 4GRSA 4RW7B 2AX1A 2R8JA 1S1WA 2RQMA 2XO7A 2CPYA 5CABA 2N4DA 2BEFA 3CJ7A 2JWNA 4NCGA 4L75A 3SQ1A 3CC4N 4M7YA 4C97A 2CPEA 3L7UA 5E3CA 2NXCA 2Q43A 2BOAA 5LT5A 2UV8A 3AA2A 1Q7YO 4I69A 1M1HA 2N7YA 5KPRA 2CQGA 2FJBB 4JI1K 3C8YA 2FJEB 3QRPA 1ZA2B 2RRBA 3VZHA 5AE1A 2F4FA 1I94J 2DGSA 3CYMA 3KG4A 3DOKB 2GHWA 5F0WA 2NZTA 2G2ZA 4CQ1A 3AVCA 3MEGA 4PPDA 1Z25A 3MDFA 4DZDA 7FDRA 4WCEQ 3B54A 3CCQS 4IOAL 4LF5F 1QHAA 5D15A 3DLHA 5KG0A 5HRSA 1LWFB 3C95A 3IFRA 1QSSA 4FWQA 2ALYB 2YNHB 3DXKA 2MQOA 4B9QA 1HPMA 1RP5A 1B4SA 1CSJA 2XTJP 2DXFA 3BSAA 1KD1O 2EEYA 1X4AA 2W40A 3KK1B 4ZJQA 4EBDA 3CCVN 4WFNL 1ZAWA 1IBKF 4KHPK 3BGLA 2DR5A 2ZVIA 3R2DJ 1SC4B 4H0VB 3O9UA 1NWKA 4ZLPA 3K17A 3N5FA 2ZWPA 3MM8B 3BGRA 1UPMB 3QJLA 3SBMA 1NMEB 1FNXH 4EO6A 1K8KA 4CGFA 1WF0A 2QX0A 3L4BC 3FFIA 1VC6A 5GAEI 3TSUA 4FWKA 3VQ4A 1VSKA 1VQNN 5A76A 1ASWA 1RFQA 1VFJA 3NWRA 1WSEA 4EZ9A 2IS3A 2BA9A 2AJ2A 4LD0A 2ACMA 4FJ7A 1VHFA 3THTA 5C12A 2BJ3A 1TV6B 5HL7L 4BR2A 5M1PA 4CZCA 3SUPA 3UKUA 4C8OA 3O6WA 1S12A 4RO0A 4YHHJ 1RZMA 3I4HX 3O3FA 1H3DA 1BWVA 4CNYA 3EY1A 3Q7BA 2B5JB 1SAZA 1JKHB 3CCLS 2W42A 3IC1A 3TAMB 3RB6A 2A5XA 2LLZA 4HCCA 3KK3B 2J7UA 3MXHP 3GL1A 3O9TA 5AJ3F 2R7VA 4TNOA 1J54A 3NNHA 5KPTA 3NDKA 1X5OA 4QIEA 3I5BA 2R8GA 2XMMA 2QGFB 1SL2A 4Y00A 1HRHA 2J0XA 3EE9A 1OH8A 3JAMO 3SSQA 3ZNUA 3LL3A 1HWUA 4CHQA 1SH0A 3PRDA 3QIDA 3PW5A 5AQXA 3GV5B 1YTAA 1DGKN 2RQ4A 4DTRA 4FXDA 1Y4ZB 3FZ2A 1N5YA 1U2CA 2OA8A 3NGSA 4YMEA 2VQFJ 5CH7B 5HI7A 2MSTA 4NA3A 2EKYA 1ELOA 4O0JA 3EGWB 3AV9A 2DTUA 4Y2IA 3M32B 5F9LA 4K4YA 2FIUA 4NB4A 1S57A 1NPRA 3HK2A 3VQTA 4FYDA 3OL8A 4M5NA 1VBYA 1K73T 1RBUA 2CPZA 3CF5Q 1BD6A 5CHCB 2OEMA 2X1GA 2GUIA 3AVMA 1S6QB 1SJRA 2DO0A 5BREA 3JSMB 5IQ6A 2DGOA 4OZNA 4GVLA 3W5YA 4DEZA 4ED7A 1RNHA 3C0BA 3GMGA 4I2QB 2XB2D 1HYSB 4WQ4C 2JFDA 2VBYA 3IBWA 1DZ5A 3ZZRA 4EUVA 2J6UA 3DLBA 3PYGA 3G82A 4M63A 4J9RA 4CEOA 2OYQA 1JLEB 3D4JA 5H9EJ 2DH7A 2M88A 3M5RA 2OLWA 3GYGA 1NGAA 3W5ZA 1HW9A 2WVDA 4JKAA 4BVOA 2YKNB 3BJYA 3CIZA 5HBMA 4J5OA 1XHXA 1VSIA 3L4QA 2JLFA 4FWSA 2P9LB 3KWIA 2ZBIA 5SZTA 3SFUA 2C3MA 2YJFA 2FBXA 3ZZOA 1SQFA 4NLVA 2DBBA 2X3DA 1S9GB 1FJCA 3V9SA 3PRVA 3QINA 2B51A 2FJAB 3D7EO 3AO5A 1JWWA 2BANB 2VV5A 3NKYA 3WNGA 2Q6BA 4JNEA 3FBFA 1WG5A 3CUNA 2RB7A 1BL3A 3C6TB 1YRTA 4ILLA 1APSA 2RH3A 3TAEA 3B6PA 1KLMB 3VAMA 2EFGA 4DFPA 2E2NA 3W9JA 3FMBA 1DJ0A 1SC1B 3S6EA 2BUNA 3QEWA 3DYAB 3S7RA 1SKRA 4Y1DA 4BQLA 2F5GA 3VMFB 3HYFA 3PIPL 3TA2A 3FZMA 1RYRA 5EWFA 3MM5B 2RU3A 1GH8A 2R2UA 4ED5A 3IR5B 3MWTA 3THYA 2FGOA 2I2YA 3GTYX 4OZ1A 2AEMA 1NGFA 2N4CA 4FCYA 2GV9A 4P75A 5BRHA 1M1KT 2YWKA 2KXHA 2QLXA 1RT2B 4PXCA 2ZWOA 2VBXA 2UVVA 3UQSA 2PZSA 4YDDB 3HD1A 2OPRB 4BRPA 2HG4A 3IA0A 4IOXA 1FRMA 4PZVA 3ZO7A 2R7SA 5KFHA 1N33J 2Z4PA 3W2WA 2QEXS 5AXNA 2MZSA 4KRFA 5KFLA 5KG4A 1RABB 3MEGB 1E6VB 3R5DA 2VPZB 4OI3A 2HK2A 1Z4UA 4NLTA 3H1VX 1U1RA 2E5JA 4JI0K 3LWMA 2R3VA 3OLAA 3VVTA 3LTOA 4YHHF 1Q53A 2L9DA 1GXUA 5C24B 3HVTA 3K8WA 5FLXO 5M1FA 4URSA 4JS4A 3ZTSA 4ZDNA 3HI0A 4AHSA 1IG8A 2ASOA 3CJ9A 1FJ7A 1SIZA 3NH0A 3OVSA 2O8DA 2AJ0A 4ZKAA 1N34J 1EWRA 1UFKA 4RR5A 1S9EB 3AD9C 2E5IA 1VQ9N 1Y7PA 2A41A 3JAMY 4DR7J 2HFOA 3BZKA 3CMEN 1AZSA 3OS2A 3OTBA 2OP5A 5A8KA 4FZVA 2W41A 3DRYA 1JLQA 1WUAA 5DLGA 1BA1A 4WIQA 3MCAB 1OWXA 1C1BB 4NZ6A 1NXIA 3IM8A 2W8LA 2G8HA 1FFSB 1YTYA 3CCMS 1Q81T 3RRGA 3N01A 1W9HA 3WXJA 1SPBP 3KLEA 4TU9A 2Z1JA 4KHNA 4P2XA 1GXTA 3DU6A 4CHZA 2IYIA 1XNQK 4DV6F 4XEIA 5U47A 2K7JA 4B1YB 2QA4N 2F8EX 2YQ1A 4PYDA 3EDQB 3IAM9 2DEIA 1N88A 3OT9A 1EP4B 1YRUA 2D5RA 2HGLA 1N34K 2IM1A 1K6YA 3FZLA 2M3DA 4IWVA 4YHHK 4J2DA 1H1VA 1LFPA 3GBTA 5EU7A 2KZZA 4CD3A 4LSNB 3ZSOA 4LFAK 1WKJA 3HSJA 2E1CA 2VFVA 2R7TA 1V4SA 3QBWA 4JI1J 2C2KB 3GFZA 3ENVA 3AO2A 4BWMA 1GXLA 1QVFM 4MDBA 3CJCA 3A3PB 1RCOB 2DFFA 3S41A 1WI8A 3HULA 2GHPA 1EETA 3PJWA 3H5XA 2J6TA 4PEOA 1FJGJ 4URQU 3BQ1A 4E7HA 3EKUA 4LT6A 3NRBA 4LMZA 5IWAF 1S59A 1P9QC 1XNQJ 4QYZK 4WTYA 3G9CA 1JL2A 3MHYA 5AQKA 2MB0B 3FEYB 3TTFA 3UCUP 2X6SA 4CM2A 1KKHA 1RHRB 4HHTA 9ATCB 3SMPA 2DHGA 4Q5VA 4OLBA 4FLWA 2EFQA 2W2NP 3B8HA 1SQEA 4X4VA 2PA3A 4GO7X 3MR3A 3CM6A 4WKYA 3LH2S 3D3BJ 3FSIA 4L3QA 3VV2B 1WORA 5L46A 3QAEA 4I64A 4CF2A 2BE2B 2NSCA 1J9AA 4CJEA 4LF4F 5L9NA 3P3DA 3EICA 3G10A 4RW9A 3VOVA 4FJNA 2HZVA 5HRRA 3H40A 5JVHL 3V9ZA 5AQIA 4G9ZA 4CZIA 2Z0GA 4LH4A 2W01A 1UA0A 5DM6Q 2GJFA 2FHKA 4E1MA 4LF1A 4Q2LA 2RUGA 5B7WA 4JD2B 4OZ5A 4F8RA 1Y5IB 3DLRA 5K14B 3NOCA 2I5JA 3QEPA 3LGNA 3M4XA 3QO9B 3PKMA 3NVMA 2VPYB 5AQQA 1RYSA 4JV5F 1GTEA 4P71A 1XMQF 1ATSA 3K9KA 2V94A 4I6MB 3DGPB 2YX6A 4IKAA 4K8RA 4I56A 3W8PA 2CQ0A 1T9UA 3ZX3A 1JJ2R 3H20A 1BGXT 4ZIWA 3FSXA 2WOMB 1SUQB 3KWGA 2P9CA 3PLAA 3TQEA 4O4RA 3ALYA 1LXNA 3MTKA 4ID5A 5HQLA 4FNIA 2QL9B 5CZ2A 5IT9U 1QHTA 4FWPA 1D8YA 1FJGF 1NGDA 4FOIA 1RHUB 2HVZA 1H7XA 3SZ2A 1OO0B 5FLXY 2R8HA 3BH6B 1LFWA 3W7BA 5LOQA 2G8UA 3SCJE 4BRIA 4F9OA 3PNIA 3VAHA 2DIVA 3MN7A 1U6ZA 5FJ4A 1UCNA 2BM0A 2VGNA 5F8HA 5IOLA 1B0VA 4TN2A 2ZHBA 1LWEA 2ZD1B 3MMAA 4O3SA 3UN3A 4M3UA 3K5MA 5A8RB 2IY5B 3VQDA 1RAOA 4CH1A 3IGNA 4WFBQ 2C2DA 2LEAA 4ZP8A 2CGKA 2XMUA 2OTLN 5B0BA 3BDPA 2G1HA 1V3SA 3Q0AA 1E6YA 2XMAA 4DLEA 3CXCM 3RRHA 4QCLA 3W9IA 3KJQB 1RWMB 2P9KA 5H1SQ 4IOCL 3DU5A 4DV5J 3KUEA 3TAPA 3KKRA 5F8JA 1HI1A 4FWMA 4QR2A 4X64J 2LXIA 2F40A 2F63A 3TZXA 5C2GA 4PCQA 2CDRB 1WC1A 3SCXA 3CCRN 2Q1NA 3DRRA 4IG3A 3ILIA 5ADZA 2BJEA 1UKUA 4CLTA 3H4DA 3MAHA 3MECB 3MOZA 4KO0A 3AA5X 2ADBA 3H7HB 2HWTA 2NXJA 4FP9A 3OYFA 1X4BA 4AM7A 1KVIA 1T6DA 5E2QA 5KT6A 2YKAA 4USVA 3LZIA 5KFAA 2YI1A 4ZCLA 3WXLA 1YXQA 4XAKA 1KRPA 3DLGB 4KGVB 3H6EA 4JEPA 3LPEA 4ZVTB 3MECA 4MH8A 4OVLA 3QBXA 1YUWA 1IV0A 4MQ3A 2DR6A 2CWKA 3LDPA 3IXQA 1N6QA 4A5BA 4FLVA 5AFUH 3Q83A 3U4LA 2Z8QA 3OD2A 2CKWA 2F9JA 2GA7A 2HAIA 4JKCA 1KVCA 4QIFA 1ATNA 2OPQB 4IOCQ 3VCDA 3UVJA 2DT9A 2DVIA 3CCUS 3N5BA 1NGIA 5AQSA 4ECQA 3WQUA 2CVIA 3BR8A 3T41A 1GMVA 2IVOA 1Q4RA 3U1LA 3TTDA 5JLHA 1M1KO 4YY3J 2DNGA 3HMJG 5EDWA 4DSIA 3RB3A 4CJRA 2OPQA 2IDEA 4FOEA 5KFDA 1MWQA 3BB5A 2QN6B 4JHDA 1YJTA 2QTWA 2HNZA 2A40A 1SVDA 3OFHA 5AFUA 5GAHP 3BSOA 2P51A 3QT8A 4GV9A 1ZAXA 3E01B 2Z56B 1U24A 3UDEA 1UVLA 5LMUF 2KXNB 1VQMN 3MDQA 1SQGA 3W62A 1QQOA 3EEQA 3M1VA 4NMXA 1D5AA 3Q89A 2BXJA 1JQGA 4IH5A 1NZ8A 3G71N 1S22A 4O5FA 3A2FA 1OQ3A 1DRZA 3VERA 1IO2A 2AZ1A 4G6VB 2ZGZA 3CJ3A 4TU8A 3S3OA 3N9UC 2KHCA 4QIVA 2F1FA 3CIPA 4CBWA 3K8VA 2MKKA 1VK3A 1NGGA 2O8FB 3P49B 2PAVA 5DZ7A 2XY7A 4IFEA 1BHNA 2KKHA 1U49A 5CR4A 3M8RA 4IJNA 1NDKA 3VAFA 3J81Y 2RUSA 3LP0A 4WP8A 3TZWA 3VEZA 2OSRA 4CCHA 3AJ2A 5DGAA 5LM7E 3EDRB 3MF5A 1JCGA 1RU2A 2DXDA 1N48A 2SXLA 3EZOA 1TGOA 4GKJK 3CMQA 1GT8A 4BVPA 5B08A 1NJIO 1WDDA 4CWBA 3NH2A 3OTEA 3M2VA 1RAJA 1OPZA 4JBCA 3OR2A 5LMUK 4G1QA 3DGPA 3W63A 3LQVA 3IFEA 4KHSA 3DAWA 3PX6A 2GVZA 1Q81O 2IYGA 3GJRB 1TFYA 4ILMA 4WQ5A 2AGQA 2CG8A 3RAXA 2XS5A 4F67A 2W2PP 3OFEA 1RBVA 5EWEA 3OHRA 5ELZA 3GG4A 1BLUA 4ECZA 2O4GA 3THPA 1LEOA 4OGCA 4OL8A 3CM5A 3MMCA 4AILC 3TEGA 1SJQA 1H7WA 4BRNA 3G8TA 3D5MA 3LDNA 4USHA 1JXBA 1HKGA 3Q22A 3SPYA 3CXCR 1FESA 3KD1E 1NH8A 1BCOA 4AYBD 2RT3A 4ZP9A 2OPPA 2BR0A 2YHYA 5HOOA 2QA4S 2BDPA 5KGXA 2H48B 1L3VA 2HMPA 1EKEA 4CJ3A 3CFOA 5ETRA 3D6TB 1MWKA 2AKWB 3QIPB 3BBCA 1HQUA 1DLOA 4CJPA 2O8EA 3AOAA 1P90A 3KLFB 2KFYA 4BCAA 5DDPC 4TQRA 4IRCA 4WFYA 1RI7A 3M1FA 1U2VB 4GKJF 4PRFA 1L3TA 1QVGR 1RT3B 1U8WA 1NK7A 1NLKL 3P5BP 3MEEA 3R2CJ 3W1YC 4C8YA 2XSFA 1VQ4S 5KT4A 4DL7A 1Q86T 4KR0B 5KG5A 4K4WA 4KPYA 4C7QA 1NBEB 2PEBA 4H5TA 1SIWB 1S1UA 1A5VA 1CJTA 4F04B 1FRJA 3LP1A 1RT6B 3E66A 4Q0BA 4IUFA 2VQFF 1U2RA 1WJ9A 2Z1HA 3NGDA 1YJRA 3TEHB 1EX4A 3AA4A 4DQQA 1W2BR 4J9UE 2W4PA 2QFJA 4BRKA 4CJ5A 4CGJA 1KWMA 3QRRA 1T0TV 5GADU 1K0VA 3D6FB 2M2BA 5IS2A 2UUAJ 4RWWA 1B99A 2NQPA 1N52B 2Q36A 1BU6O 3DHWC 4AHRA 3O1LA 2HS0A 5ETKA 1URNA 1GOBA 1C4CA 1Y0HA 1LWCA 1HNXF 3CCLN 4TQSA 3ZTOA 3NVKA 2ZH7A 3JS6A 1NB7A 5K20B 2BE7D 4OPKA 3GR0A 4J7CA 2W9BA 4HI2A 1RWVB 5DM7L 3HVWA 5KT5A 4X4UA 3SI8A 2D3O1 2FXUA 2XULA 3E9LA 2QXFA 3HF5A 3SCLE 1RBSA 3G6ES 5DGBA 1GX5A 3AAWB 1FKPA 3EXYA 1MMLA 2HQ3A 1CS4B 2Q31A 4M5LA 3MI7X 4RG8A 1RWXB 1CLQA 3DOMA 2VUGA 2FY1A 4NWBA 5HQMA 4NLBA 4F0MA 5FPMA 3HX9A 4W4MA 2JH3A 4LF8K 1ZPWX 2VBWA 2KHOA 3MN5A 2LQ8A 1K44A 3GV8B 3KMQA 2GGPB 3IR7B 5KFTA 3JTOA 3L95X 1YAGA 4N8NA 4WE1B 3L3CA 3CHWA 4ZN1A 4JV1A 2VWBA 3MAQA 3VQEA 3IM9A 2LU1A 3GE1A 4B8AB 3HO1A 1S10A 3NEKA 1NOYA 4NA1A 4YFUA 4GO5X 1HPZB 1KR4A 1WSHA 1MN7A 5J2QA 1A9NB 4FKXA 4J2BA 1WKKA 1QVGM 3OW2R 4U7CA 4GC6A 1HHTP 1Z6RA 3OLBA 4LVNP 4OIXA 2KH9A 2DRBA 4NXNF 1TKXA 5C25A 4ANEA 5KFUA 1WSGA 3RR8A 4ISFA 4M7XA 1RWPB 4ZPVR 1K8KB 4LRDA 3MPVA 1F5BA 2FLPA 3EJMA 4J9SA 3ZXWA 3DOKA 1TL3B 3TAMA 3GCXP 5SWMA 4OZJA 4DQIA 1XR5A 4U9RA 1XTZA 4OI4A 5FRMA 1S77D 1CS4A 1M5SA 1CJUA 4E7LA 4AHVA 4LUBA 2CADA 1TAUA 2X3GA 4KIAA 1TV6A 2KYZA 4CO0A 3C3LA 1I1GA 4P74A 3FBBA 2OMOA 3D6MB 3ET6B 2V2ZA 2ZKTA 1HHSA 2DNPA 2QFIA 4OLPA 1HBOA 2G1DA 7AT1B 1PSDA 2WB4A 3ZZUA 2ZBQA 3O6QA 1XMOK 3LGMA 2C3OA 2E5HA 2WSEC 3KIOA 1KQKA 1P9YA 1T3NA 4DU1A 3QYYA 2AMCB 1RBAA 1G2EA 2J8SA 1N32J 1N34F 1KHWA 2QMWA 5F0UA 3B82A 4KREA 3CJ0A 3GPAA 1M5OC 4KKOB 1DTTA 1CXUA 4CH7A 2IVNA 3Q8SB 3QO9A 1RT1B 2ZM6J 1J53A 1RTDB 4CO2A 2IJFA 2YWGA 3TZZA 3SAHA 2OJ3A 3PDNA 4YR0A 4ZVOB 5B0AA 4KKOA 5AQMA 3LP0B 4PPZA 2V4RA 2UUAK 4B9LA 2QG9B 4M8LA 4F02A 3HZ6A 3WHIA 4XH1A 5BN8A 3UD3P 4L8RB 1Q8IA 3DXBA 2PFUA 4IO8A 3BN4A 4KGKA 4FWOA 2P9UB 5IWAK 2ZEJA 4ILJA 4JP8A 3HP9A 4UOGA 2BYCA 4DU3A 4JI4J 1X4CA 2BGGA 2J7KA 3D0HE 1HWJA 4KB7A 4DR3J 1KAZA 3M7VA 5FROA 4IEEA 2O8EB 1B7FA 4B9UA 2ZNZA 2ZH5A 1IKYB 3K59A 3VENA 4P52A 2HBKA 5M1KA 4NXMK 1S7HA 4J2AA 3VEVA 1IBMJ 4DL4A 4I0WA 3UPFA 4OLAA 3SQ4A 4LF6F 3D1QA 2EVZA 1FO1A 4B9NA 3V6DB 1S6QA 2HFNA 3R3TA 4JN4A 3ILJA 4DUZK 2HHXA 3DHXA 4KHUA 2CUYA 4MIWA 4FPBA 1N33F 1QY7A 2FSJA 1H38A 4HH0A 4QW9A 1R8CA 2MLZA 3OSNA 2P2CB 1DEJA 1ZS6A 4KH6A 4HUFA 3LW5C 4ZPCA 1N54B 4KRWA 3OFGA 2RQCA 3OR2B 4DSEA 1XC9A 3RVCA 2HBRB 1HJOA 1DAXA 1HR0K 1TK5A 3K5NA 2WK4A 1K73O 4F50A 3Q8PB 1RDBA 4AM6A 4HHUA 3X3UA 2YXLA 2EFPA 3GSDA 3HOTA 4FYVB 4FJJA 5A2QU 1NK6A 1MW7A 2M70A 2XHCA 1T94A 3SBTA 1U0HA 3LP1B 3IRXA 3CD6N 3UIQA 2DGXA 1S99A 2FC9A 4WP9A 3AO4A 1NJWA 1BIUA 3LDSA 1EO1A 4DQPA 1O0PA 2A1BA 1NOZA 2P9PA 4ZOSA 2BX6A 2AQ4A 2JLGA 1SKSA 1UA1A 1X9JA 2I6WA 1S1TB 5ETPA 3RRKA 1UW4A 2UV8G 3L4IA 1A5XA 1X0FA 4RNNA 3KLHB 3HHLC 3CD7A 3VGUA 1V5IB 4OMFG 2K2PA 2Y1JA 2N3LA 3AVGA 1J5EF 1F2GA 3NS7B 2FHOB 1BQNA 1HI0P 4BRAA 3R5CA 3MUVP 3WXMB 1HWIA 4EYHB 4IQXA 2GC8A 3M2UB 1Q9YA 5KFOA 2CQBA 3UVJB 1IVZA 1BMQB 2ABYA 5T7BA 1W26A 2WONA 4FS1A 1S49A 1EIYB 4DV6J 1DQ8A 2BW7A 2EPIA 1RA6A 2V7YA 1IBKJ 2HQGA 1U6BA 4HVZA 1YITN 1NEEA 1T05A 4Z4IA 5CYJA 4DUYJ 3J8AA 3KLIA 1U02A 9RUBA 2LKZA 2MZJA 3TUZC 4I68A 2O8CB 5IV4A 3K5LA 4BDZA 4BR0A 2QWRA 5E3QA 1R0CB 3E2EA 3CCZA 2ALZA 4DR1K 4BC5A 4FJ9A 4W5OA 3A8JA 1X4FA 5DDQC 2BRKA 2HZCA 1NK0A 4DUTA 3ZETA 3QT7A 1WOSA 3TJ8A 2XY5A 4DTOA 2CGLA 1YI2N 3OTCA 1QLNA 4ZJLA 4X62K 3I8DA 4KE5A 2V4JB 4NYOA 3T1HJ 4G3IA 1BCMA 1J5EK 1WN7A 3EZUA 3G4SS 4OHWA 1U7LA 3ZETB 4OZ2A 2ZBPA 2PA8D 2NUBA 2MQLA 2M0GB 3HSCA 3OYEA 4Z4GA 3PXGa 1SV5A 3EPIA 1T3VA 3AVAA 3SI6A 4RNHA 5AZIB 4HHJA 2A0FB 1TKTB 2AEFA 3QFWA 1NKCA 3VVUA 4GVBB 4IFVA 6AT1B 4KYZA 2EHGA 5LMNK 1PBUA 2PYLA 1RILA 4CNZA 3OA9A 5EWGA 4OGEA 3KD5E 2UXDK 3J7ZT 1G3OA 1JJCB 1HBUA 4B3TJ 3VQSA 4MLHA 3CJKB 4CZFA 3KK1A 3SSSA 1VQMS 1ULRA 4FZXC 1N5YB 3LM9A 5CYMA 4A48A 4DV3J 3IBCB 4UY8T 1HBMB 3QERA 2H1YA 4CVNE 4HUGA 2B3TB 2CJKA 1SKWA 1F1BB 3DRSB 2DNKA 1SL1A 2E1YA 4KB1A 1IR1A 4Z2XA 2IM2A 1DURA 2QTDA 3MMJA 3C16B 1DT9A 2KJVA 3U9DA 5L9XA 4CFCA 2I7NA 4RZRA 4NLCA 2AYBA 4LF2A 4LFCF 3IS9B 2D1CA 2FVSA 4LF7F 4EEYA 2VOOA 2X1BA 1ZM4A 1LW2A 1MLAA 4JUZA 5D4NA 3AODA 2ROGA 1LAVA 1S1XB 4P7TA 3H46O 1RA7A 4UF4A 4E2FB 3ZX0A 1RT4A 1NHUA 4F36A 5HVFA 1VBZA 2ASPA 4H03B 1Y11A 2MY7A 3V9WA 2F4VK 1MDUB 1LCUA 3VGTA 3L2UA 3O1WA 3TW0A 4I4BA 3CJ1A 3CJ2A 3UWTA 2LA6A 2RRNA 5GMDA 1CEZA 3HI9A 1NNDA 4N47A 5FDLB 4FNHA 1AXQA 4KBOA 5J2NA 2DISA 1LOTB 3TO8A 5I3PA 4MK9A 4CECA 4K42A 1KD1T 3QFUA 1LW0A 5H1SV 1WD6A 4F3OA 2OPSA 3OHBA 1NK5A 1NLVA 2E88A 2OANA 4KAIA 4DX5A 4Q45A 1FXXA 4CHPA 1RT7A 1F5AA 1IJJA 3H2UB 2G0CA 2EG1A 4ELUA 2E1MC 1EB0A 2GJIA 4NLGA 4NYFA 2R42A 4BWJA 5KFPA 1UVKA 2VU5A 4B3RJ 2AP1A 3KJVA 1VLOA 5E41A 3I9ZA 2XI3A 1YZ7A 3PEJA 3QNWB 3BYRA 1YT3A 4FK0A 1RQ0A 4HDHA 2GFFA 4Y1CA 1DQAA 3ICLA 3FLCO 1D9AA 2YHXA 2RKIA 4QW8A 4XDDA 3ZEUA 4DKWA 2IRYA 3IRXB 2F9DA 3KHRA 4OPAA 3S3MA 5BXIA 5BR8J 4ZTJA 4LIWA 1F21A 4CLPA 3C6AA 1RTHA 2LDYA 1RHJB 2G8FA 4DG1A 1QTNB 4RWXA 4BE1A 4FJMA 4A8SA 2F4VF 4EWTA 3N79A 3VGMA 2HVDA 2XYGB 5M2RA 2GNKA 2NLWA 4QYRA 1QQNA 3BGFA 3GLJA 3IAS9 4JI6K 2QT7A 5K9FA 2HB5A 2IVYA 2Y0BB 4A8MP 5JS1A 1RDRA 2O3DA 2HBZB 3ATVA 3CEDA 3D7SB 1IG9A 1A7GE 4PL7A 4KHQA 4ZPDA 1OS5A 1Y64A 1M5HA 1PC5A 3KHYA 4I6YA 4FDFA 2XMJA 2ITMA 4O3QA 2KB2A 5LXYA 2P9KB 3J81U 3HT0A 3H59A 2G4BA 2DK2A 2Z2MA 2F8SA 4L3NA 1VSEA 4ED6A 2FC0A 4A2BA 4H0XB 3KHLA 3NF8A 1RKIA 2QKKA 1S72N 2L9WA 5IM0B 4BC3A 4Q44A 3M8QA 2GAGC 3R7NB 4Y3CA 1B92A 4C6AA 3TPQA 3R97A 3ZCMA 2YKOA 2CQ1A 1FEHA 1RISA 2KM8C 1UTAA 4ELTA 1HNWF 4M3RA 4DPYA 2KXFA 1WOPA 1L3UA 1K1SA 4DHYA 1B7YB 4X66K 2HQFA 2FBYA 3I87A 3O8WA 1JX4A 1RTHB 3RAQA 2E1AA 2B0GA 4F7VA 4AUKA 2YH0A 5EHHA 4TXSA 4YOYA 3QJJA 1A6LA 3CT9A 1PO6A 3F73A 4K4UA 4BHQA 4DX7A 1EAYC 1QM9A 3KKFA 1FE4A 1RHKB 3CCES 2QA1A 3ITHB 2HRUA 2BOPA 1Q16B 4RWTA 4JKEA 1JLAA 3HRGA 1X5TA 2Y1RI 4ZCMA 4U67L 5HSPA 4ZP7A 1QAIA 3WC2A 4PUOA 1PAEX 3ONQA 4DV3F 1SV5B 3C15B 3HM9A 2DH9A 4QS7A 2LDIA 2VIHA 1VJQA 1NDPA 4YOVA 3HZEA 3H25A 4KBIA 4IG0A 2XWYA 5KAKA 5TKWA 4M3XA 1RAIB 3AVJA 4PUOB 1E4FT 5LJ3Y 3I32A 1UEKA 2MEWA 2P9NA 1KVJA 1NZAA 2DHHA 2H65B 4JYAK 1KLMA 1RB0A 4DQRA 3RBZA 4J2EA 2HHQA 1FA0A 4OX8A 4JI7F 4O44A 1ITPA 3HFVA 4KGZB 4DTPA 2CPXA 4EYIB 3EN9A 4RW6B 3QGPA 4D3HA 1M5KC 4LF8F 1B0PA 3O4WA 4X66F 4BDPA 3A8YA 2LVWA 2CRLA 4AH9A 2IJNA 1Q18A 1HJRA 3U1MA 4FZYA 4X84A 2EWSA 5GAEP 4LFCJ 4E7JA 3IGVA 4DV4F 1CC8A 4PG4A 2WTFA 1PGZA 1VQ5S 1RT1A 4UZCA 3CF5L 4BLGA 2V2QA 2HVIA 3U6FA 4ZVPB 3G25A 4LR8A 4IRKA 1ZM9A 4OKEA 3GFHA 1PYOB 2B5JA 4OPHA 2DKOB 2WW8A 4KI6A 1JXVA 3AQPA 2KL8A 4GV6A 4MFBB 2WSCC 3NNCA 1YVFA 1NPPA 2ZNYA 2P5GA 4XH4A 3CMAS 4EO8A 2BJ8A 2XGPA 3CCVS 3BREA 1VQ4N 3LAKA 4E7IA 3EYZA 2C2OB 2Y0SD 2OAUA 2CQ2A 4A59A 4XK8C 1V5VA 4FBUA 3E01A 3I4PA 2BJ1A 1C6VA 4FJIA 4FJKA 4YP3A 5HJXA 3J7Z5 1B9DA 3V1QA 2D69A 4FYWB 2ZOGA 4IH7A 2E2OA 4DPOA 4TY8B 1HARA 3WEEA 3O5BA 2WAQD 3MM9B 4RL1A 2Z2LA 1FRLA 1H2UX 3M6UA 3QPIA 4BRHA 5KGWA 3OW2M 1CG2A 1P1TA 1ZBUA 4RW8B 3D28A 3P83D 4CEQA 1SBRA 4DV4K 1VQ5N 2YNIB 2I5JB 4C8KA 3TU5A 1X60A 3T1YJ 4USMA 3CD0A 1HBMA 4CO4A 2GX8A 3DOLB 1JLBB 2IPOB 3RG6A 5G0RB 2NZ4A 3VAIA 1Y5NB 2J0WA 1ESVA 4LFBF 2VG5A 4A8YA 3VQ6A 1ZC6A 3RBXA 3AVBA 2YY3A 3NG8A 2R7QA 5BPMA 3WQTA 4X4RA 3BO4A 2HMIA 3F2KA 1YBTA 2KQ2A 2RF2A 4ZTFA 5BYSA 1HNXJ 2YPZA 4O8KA 1OH6A 1EKRA 2HHHF 1KLNA 3ELHA 4DL6A 4F4KA 2NUUG 4W5NA 2Z1IA 4NZ7A 3IWXA 4ENOA 1RT7B 3GJQB 1RDCA 3I6PA 5JS2A 3PIPQ 4WQ5C 1PAUB 3SDEA 2DITA 1LWEB 1N8RO 3RBDA 3QRQA 1IXKA 2FHJD 2LEBA 4V19J 3J81O 2RD5C 4FPRA 4E7KA 3W64A 2R2TA 1TUWA 1JLFA 3MOJB 1SB6A 2VF3A 3WNFA 3DM2B 4JI8J 4OI0A 1RDUA 4I9LA 4CFAA 4I6WA 1QQMA 1BQNB 2GHVC 1KDNA 4DCOB 5L1LA 4KH0B 1OH5A 2YQ3A 1HQUB 2AD9A 3KJFB 4H5RA 3ISNC 3KZBA 1T44A 4FM2A 1TQLA 2ZC3A 1VLYA 1AFIA 5ETQA 3I0SA 3TAGA 3DYAA 3HHNB 2NPFA 2HVHA 2DY1A 3U3YA 2PN6A 3FGVA 4KH4A 5K14A 4OHVA 3CW2C 5HATA 4O23A 4X64F 2MDAA 4B3TF 4CLKA 4NI2A 3US5A 4WK3A 4ELVA 3MD1A 1R8PA 1PYSB 4IJAA 1HIYA 3PRBA 3CCQN 5KQ8A 1S4FA 3S01A 3NF6A 4K41A 4CBUA 4Z4HA 3MMCB 5CYQA 2HHHK 3ZZ0A 4H0OA 1KN6A 2CPFA 4USJC 5KFEA 1RWKB 3OFFA 1NHVA 4MKBA 4FZZA 4HL9A 2RN2A 4LBHA 2MQQA 5AT1B 4DTUA 4HUEA 4KHWA 1NJXA 4HTIA 5AXMA 3DRPA 4NXNJ 3LP3A 3EGVA 2PI4A 2V6AA 2ROPA 2B4OA 3VQ9A 1D0EA 3FNNA 4Q2MA 3I55S 4J9OA 4J9MA 4BY9C 4PXEA 5B0EA 4JI5J 3QMLA 4LF6J 3U3GA 4ES3A 4GMKA 1JMTA 3W65A 5A2QY 3O9QA 2IM0A 5F41A 3HHLA 5DDOC 3R1XA 4YOWA 2E2QA 4BQZA 2GELA 1BOTO 5BR8K 4OZLA 1S1UB 3GILA 4C8NA 3FZHA 2YTCA 3HCXA 1U25A 1S5ZA 3BY5A 5D0EA 2MSSA 1TL1B 2ZJPQ 2HS4A 4OYWA 4DUZJ 1WHXA 1NMNA 2PI5A 4U96A 4X4TA 4OYXA 2IFXA 2HBYB 3EPGA 3HVAA 4DBQA 2KFZA 5F8MA 3T1YK 2GAHC 4PXBA 2CH5A 1RSCA 5D6GA 4GKKF 3AHPA 2HFZA 2ZKUA 4CLUA 1WBBA 3JB9k 3VGKA 4K8XA 3VWSA 1SJ3P 1VK0A 5DQGA 3B78A 1RWUA 4B3OA 4DR1F 4ATNA 3F0NA 2R7UA 4QPTA 3THVA 2G8IA 3N28A 2NR0A 3HM8A 2NNWA 4M42A 1AUDA 5M2UA 4K5SA 1FRKA 1IBKK 3DJCA 1S6UA 4LBIA 3DDKA 4LBPA 4ANDA 2LSNA 2ATCB 4FLTA 1EXQA 4F4AA 2HBJA 2LQJA 1Q8LA 1C4AA 4C11A 3LDLA 3BEGB 3AJ1A 4X62F 2HOEA 2C2ZB 2D74B 2C28A 4N8OA 2IDLA 3DXMB 2HF3A 3DMJA 3SAFA 3VQQA 1LQ9A 5M1OA 2W7PA 4BACA 3THXA 4GVEA 3C94A 1OMSA 1VQPN 2B56A 2MKCA 2C22A 1HW8A 1YI2S 2G2YA 3VQPA 3FZKA 3A5OC 3MAAA 2P6TA 2UXDF 1FXLA 4RW6A 4UUXA 5HLFB 3LO3A 2FUG9 2EFNA 4PYAA 4OX6A 4QAGA 3PW4A 2IOCA 1I94K 2JC0A 5IQQA 3THXB 3L3UA 1HA1A 3CPWM 5IZHA 1K9MT 1H6KX 5JVGL 1CLFA 5GAEU 4NLOA 4CW7B 4J90A 1UEVA 1FWPA 1H73A 5C25B 1RTZA 5HMWA 1Q5VA 2JC1A 4WF9L 4CJWA 2W4CA 5D0HA 4CO1A 3PVXA 4RU9A 2MQNA 1ZM3A 5KT2A 3C16A 3MURP 2E9RX 2HHVA 1ZBSA 3VPZA 1T02A 2WUSA 4EBEA 2RHKA 1YJVA 1AROP 3T9ZA 2E29A 4BRFA 3WC0A 2DHSA 1FCAA 3SDEB 3OSPA 3IRWP 4RUHA 3MMBB 4O5BA 1SI9A 4WXOA 3CCSS 2YCHA 1ZOTA 3CCTA 4BG8A 2KM8B 3P39A 1L3KA 4K0KK 2HHSA 3O4QA 1YQHA 2FQQB 2Q3PA 2V5HG 2FSNA 2A42A 3EE8A 4Y65A 4LF9J 4ED0A 3CFPA 4FF3A 1UVMA 5KFZA 1GLFO 3PYFA 1OSDA 5D77A 4F2RA 2Z58B 1W7WA 5F3TA 4JHDB 4CEFA 3QEVA 1B64A 4CJ7A 4JI4K 5KI6A 4FXWA 5HP1A 3JXUA 1UVJA 3CDEA 1YF5L 2YHBA 1M90T 2E2PA 4ED3A 2DY9A 1X1PA 2B6AA 4DU7A 4RU2A 1T9VA 4GMJB 2KW4A 3L2QA 1YJWS 1TUUA 1UW9A 4NLSA 4R0EA 3OJSA 3BN7A 1YJNS 2B9XA 1Q78A 1KC8O 3IMXA 4OJ3A 8ATCB 3G82B 1RCXB 4OX9K 4QWCA 2V51B 3QEIA 4LF7J 1HBNB 5CD4H 3VTHA 3ZX2A 4DFJA 3I33A 4H54A 1G6BA 4OPJA 3ETMA 2V63A 1IH7A 4ANCA 2YKMB 2D0PA 3ENOA 1RE1B 3CSKA 1ZTWA 3AVLA 2U2FA 2POKA 1RT4B 1U1MA 3KHHA 5ETTA 1QQCA 4CJLA 1JNZB 2WB1D 4Q8EA 3JTPA 4CHOA 3K7RA 3E1YA 3OYBA 4AL6A 1S0MA 3SJHA 1XR7A 4FLXA 1ZYQA 2OCEA 1KVAA 4DV7K 4B9VA 2XLKA 4FK2A 2QWPA 4CLSA 5ETSA 3BSNA 3QFHA 3BP8A 2PGCA 2N82B 4DN0A 2HK3A 2BTFA 4R8UA 1RT6A 1JJ2M 3AA9A 3CJSA 4OV6A 1RGVA 2JWLA 1SKUB 4JI6F 3AVHA 5AQFA 1SJFA 2UUBK 3C2PA 2OTJS 3DI6B 3ZSQA 1IKWA 2VJVA 4A2AA 2YHWA 5I4MA 4H0YB 1XERA 2CAJA 3EM1A 3BO2A 1K47A 3F5TA 4G1QB 3D0PA 1U2VA 4IO1A 1XMBA 3UD4P 2YNFA 3KJVB 3ZZTA 2O66A 1RKJA 3KLHA 4B1WB 4IDKA 1KAYA 4RBUA 1HMVA 1IR2A 1AFJA 4TKTA 4ECUA 2G8WA 2Z2YB 2O8CA 1S1VA 3ZTPA 1YG0A 1FEEA 2H3EB 3H90A 1N8RT 3TZYA 3D2FA 4A61A 1QDUB 3S3NA 4NOHA 3QBCA 5MAOA 3M6WA 3R9PA 3C6TA 3HSGA 4ZVFA 4B1VA 4CBXA 4P7VA 3OXGA 2DR8A 5LJWA 2Z2ZA 4PY5A 3DRXA 5H9EK 5GVQA 5CD4A 2A10A 3UE2A 4DN9A 4DR6F 1GMWD 1S1WB 4TYBA 1XNRJ 1JK9B 3MPUB 4R79A 3BDEA 3M2UA 3KG1A 4MK7A 5E33A 4HI1A 2KZMA 2BE9B 1UAXA 4JAXA 4FKYA 4AT1B 3PW0A 3Q8UA 4M5JA 2AU0A 4X65K 4CYUA 1WG1A 2DNNA 4ECXA 1EX8A 2FVCA 1T95A 4RW4B 1RBRA 2OZSA 3MX5A 1F5CA 4CJKA 4JI8K 3LF0A 4DL2A 2B4PA 1VQ7N 2HNYB 5B0CA 1B9FA 3PIOL 3ITHA 1SH2A 2CQ3A 5EY4A 2CPIA 1JLAB 4DL3A 4F0HA 4KFBA 1QAYA 2Q2RA 5GMKa 2VFSA 2GIFA 3GONA 2QA2A 3T69A 2AX0A 4WTOB 2COLA 3M8YA 2YX7A 2D0BA 2A2DA 2VQEK 2R8IA 3SXLA 1HNWJ 4X62J 4FWLA 1LAWA 4DR4J 2UXCK 3R27A 3ZTQA 1PYTA 3WX8A 2UXBF 3MM5A 3BBBA 3CFRA 2D7SA 2HFVA 4PG6A 2J8AA 1V9OA 1SQKA 1MU2A 5M2PA 1C1BA 4JI7K 4J9KA 3SCKE 3UNYA 2MJNA 1XNRK 3GOIA 1NCLA 1X4DA 4CJSA 2BUPA 1JIHA 2GCFA 4O3OA 4WZQA 2FLNA 2P8IA 3ID6A 2UZAA 2I9SA 1SJ1A 2D9OA 5D3GB 3MEDB 2VG7B 1UFWA 3H98A 2MZRA 3PFEA 3DC2A 5M1NA 3ZT2A 1ZH5A 4A47A 3NY0A 4LF5J 5C42A 2NXEA 4B3OB 2P9IB 2O4IA 4FWRA 1FVSA 3CJTA 1T9WA 1KTVA 1YJWN 3A5MC 3BF3A 2VODA 4KV8B 2MJUA 1E4GT 1WF1A 3BQ0A 2W8KA 4YY3K 2F8HA 2IRXA 2ASDA 1WI6A 2APOA 3OPKA 5HRNA 3PSFA 3OYIA 3J80U 5DETA 4HH1A 4TU7A 2NXNA 2OPSB 4L73A 2VFRA 1XMQJ 1BHLA 1OJ4A 2V2VA 3VF4A 1VSDA 2ZVSA 1YJUA 1S72S 1IM4A 3MD3A 4NYZA 5ETOA 3SK3A 3KK3A 1WACA 4LSLA 2J9DE 4DS5A 2MQMA 3KVGA 5AQWA 4CJQA 1QSYA 4L72B 2RPIA 2QIFA 1VSHA 2R7YA 3R1HA 5DJBA 2GMHA 3SV4A 1VYAA 4W98A 2AGPA 5CYMB 3CJ8A 4FJ5A 4ECRA 3E3XA 3NL0A 4U8VA 4CZLA 2C3YA 3QMQA 2MQPA 5D78A 4PG5A 2QL5B 1NK9A 1ACMB 4LRFA 3IUCA 2ZBRA 3MEDA 2O1PA 1J5EJ 2M5YA 4M63C 1SUQA 3QICA 4FM0A 2VDIA 3MR2A 3D45A 4HACB 4B08A 3KLEB 4OX9J 3MXMA 3PYDA 1XI1A 5GMEA 3RMCA 2BH1A 4LFBK 2MMYA 6FDRA 1QJHA 3CETA 1RDWX 4ZPAA 4CHYA 5LL6d 1VQKS 4CZEA 4KY3A 1JLFB 1PC4A 3LALA 5CAAA 1O6XA 4RNFA 1N5VA 1WAFA