1T05A

Hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords oligonucleotide template
publication title Structures of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 138
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t05A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t05A05
4DG1B 4OPKA 3VQSA 2BR0A 2YNFA 3O4QA 1W0HA 1S1VB 3K5LA 3MTKA 4FLVA 3H4BA 1U45A 4YR0A 3TQ1A 4CIGA 3K5NA 4FXDA 1N48A 2WONA 3GIMA 2PYJA 3DYAB 1SH3A 3V9ZA 2BGGA 1FKPB 2XCPA 4MIBA 3M8RA 4F8RA 3AVKA 1WSJA 1RT1B 4NLVA 4FK0A 1LW2A 3KLFA 4J2DA 2ZKUA 3A2FA 1JLFA 3G6XA 4HCCA 4CFDA 1RYRA 2X6NA 1C2PA 1KCFA 4J9NA 4KAZA 1NHUA 3CJ4A 1JLAB 4NLYA 4OL8A 3BSCA 2GIQA 3PHEA 3NF6A 4FLXA 5KT2A 4B8AB 3RTVA 4J9LA 1RT6B 1MU2A 4DFJA 4I7FA 3PW4A 3VQEA 2VG6B 5SZTA 1TV6B 3HK2A 3M9NB 3NH2A 4CIFA 4FZXC 4NRTA 1CLQA 5T14A 4TN2A 1KVCA 4LSNA 3FQLA 5KFCA 3HPGA 4J2BA 4J9SA 4MH8A 4J9RA 1C1AA 4EP5A 3KLIB 4H4OA 1TK8A 1UA1A 1SH0A 3TI0A 1IKVA 2VG7A 4ZTFA 2D0AA 1HYZA 2KTQA 4R5PA 1QAIA 1LAVA 4K8XA 4BDZA 3VQ8A 3TARA 3KKSA 3PVXA 1KHVA 3K58A 4RW6B 3PX0A 4KTWA 4WFYA 1D9DA 1FKOA 3CJ2A 4KTQA 3VQQA 1RA6A 4E7KA 4M3WA 1NK9A 2AWZA 3SI8A 4FJKA 3GV7B 1RAJA 1U49A 4QWDA 3OYNA 3RB6A 2ALZA 3HJFA 3L2RA 4CJUA 4DMNA 4B9UA 4BDPA 4HUFA 3LAKA 4RW7A 4C8OA 3JSMA 3T19A 2RKIA 3L8BA 3I0SA 2ZE2B 1RTDB 5CYQA 3M9MB 4CF9A 4ZTJA 1IG9A 2YKMB 2DTUA 1TKDA 2W7PA 4EBDA 2VG5B 4RNMA 2UUTA 5KFAA 3U6FA 4ZHRA 2BQUA 4CJEA 1VRUB 5F8IA 3SQ0A 1IKWB 3P83D 4DQPA 1C0MA 1GOAA 4Y2CA 3QNOA 4FW1A 4Z4GA 4CJ3A 2B6AB 4KBIA 3IS9B 2XI3A 3SI6A 4WZMA 1HMVB 2IMWP 4GC6A 4YQWA 1C0TA 4XPCA 3QEPA 3ULDA 3V6HA 3SUQA 1DTQA 5CZ1A 4KE5A 2ASJA 4CF8A 4DLGA 4FLUA 4U7CA 4W5NA 1C0UA 2HNDB 3WNEA 4O44B 2JGUA 4C8MA 4M3UA 3QO9B 1VSKA 3V6DB 3H5UA 3T3FA 2ZD1B 3ISND 5KFHA 4E1NA 1KFSA 3HO1A 5SWMA 3M9OB 3PR4A 3OS0A 4IRDA 3HVTA 4DG1A 3CWJA 1B92A 4BACA 1JXEA 3HM9A 3H5YA 4YNQA 3KNAA 1LW0B 4OKKA 4K50A 4H8KA 1RDCA 4PA1A 2QK9A 2IM1A 1NKBA 4EYHB 4QAGA 5L1JA 1I6JA 4ECUA 3BQ0A 4OLBA 3NH1A 4BDYA 1BCMA 1VSMA 1FKPA 5F8GA 3OVNA 1B9DA 1YTAA 1HYVA 1IO2A 5I3UB 3SJJA 2W9AA 3MEGB 4ED2A 4AHCA 1J5OB 1LWFB 1TKXB 2IJNA 5CY4A 4KB1A 4ZVEA 3HT3A 1U04A 3RMAA 4ZVGA 4AHSA 4RW8B 5J2NB 1WAFA 1RNHA 5KI6A 2Z1IA 1TVRA 1IKYB 1N4LA 4CFCA 1S1UB 3KK1B 1DLOA 3LP2A 2RDJA 4HYKA 1N6QA 2LSNA 1TV6A 1S0OA 3HL8A 4Z4HA 1U48A 1EETA 4CK1A 3BDPA 1S48A 1U4BA 4FJHA 3KK2B 1ZETA 1IH7A 1WSEA 4AHTA 3LANA 2ETJA 4KKOB 3QERA 3GV5B 4Z4IA 1CXUA 5KFDA 3OYKA 2ATQA 3MXIA 4O3RA 3KLGA 5EWFA 3KLIA 3CJ3A 2AGPA 4KO0A 2QE5A 1LWCB 1NHVA 3H40A 5HRSA 3SQ2A 3DRSB 4FK2A 4CJWA 4IDKB 4DU1A 5E41A 4CECA 3VN5A 2G8UA 1JLQA 2OH2A 4RW4B 2UVUA 4IOBA 4FJ5A 3SNNA 1JIHA 1QAJA 4CFAA 1S1WB 3OYHA 1TKZA 3OHBA 4I2QB 2W9BB 4XO0A 4I9QA 3BSAA 3BSNA 3SPYA 4O4GB 5KGXA 3AVJA 4Q44A 2FC0A 2AU0A 4WE1B 4NLQA 2FVSA 3VQPA 5J1EA 4GC7A 2A1RA 2Z1JA 4QWCA 4HUEA 1RTDA 2IDOA 5F8HA 5KFBA 4KREA 1KRPA 4PWDB 1ZBIA 3PX4A 4KHUA 1ZBFA 3OL9A 2ILYA 1HPZA 3KLEA 2BANB 4E19A 5F8MA 1HQEA 2QKBA 3KTQA 3GV8B 1IKWA 5T7BA 5JS2A 3MFIA 4CGJA 2QKKA 1S9GB 1QSLA 2B5JA 2B6AA 2JC0A 1RBRA 1SKWA 4FZYA 4H4MB 4LSLB 3U3GA 3DI6B 3CJ5A 1QHTA 2FBYA 4N47A 3OS1A 3LDSA 3O3FA 4R8UB 1VSDA 4JV2A 4IG0B 1XR7A 2XHBA 4TYBA 4IRCA 2BRLA 4FS1A 4I2PB 3OY9A 5C25B 3GYNA 4MQ3A 2HNDA 4DL2A 3QO9A 2RDIA 3NBPA 2R2UA 2ZD1A 3TAQA 5KFJA 1N5YA 2W7OA 4B9NA 2V9WA 4DTJA 4FJIA 1HRHA 1SKRA 2B43A 3MEDA 4F2RA 5KFPA 2JLEA 3JYTB 4K4ZA 3AVFA 2JC1A 4CEAA 1NJWA 3CO9A 1Q8IA 2JEGA 3I0RA 4DFPA 4RUCA 1RBSA 4IKFA 4BE1A 1LW0A 1FK9A 1VSHA 1UAXA 4FM2A 3SCXA 3CM6A 4B9TA 4JLHA 4CGFA 4QW8A 4ID5A 4O3PA 3DOKA 3KD5E 1T94A 3KD1E 3CJ0A 3CYMA 1QE1B 5EDWA 5I3UA 3ICLA 2R8IA 4URGA 3CM5A 4LQ3A 3MEGA 2W9CB 3MAQA 1J5OA 1TKXA 2HNZA 2HHVA 4Q8EA 2C2RA 2WB4A 3V1OA 2O4GA 2YNGA 1SL1A 5J2NA 4QWBA 2RF2A 3QZ7A 3PW7A 1D5AA 1RT7B 1RT3A 4M3ZA 3OYCA 1S1UA 3KK1A 1TP7A 1REVB 2XY6A 4KHSA 2WOMB 1WSFA 5KG0A 1WLJA 3C95A 4DS5A 2DFEA 4Y34A 2Z1GA 3NGDA 2KW4A 2I5JA 3SV3A 4KV8A 4O5BA 4Q43A 3CFRA 1S1XB 1TL3B 2IAJB 3MXMA 3UIQA 3OYAA 1L3SA 3HVWA 4KHMA 3NGZA 2DPJA 4W5TA 3NF9A 4CEOA 2YNHB 2XCAA 3PX6A 1KTQA 4MFBB 3PY8A 3DLBA 1LWCA 3OYLA 1JLGA 4IDKA 3TAEA 4CHOA 3H5XA 2D7SA 5CZ2A 4ICLA 2DPIA 3LP3A 2P5GA 2XI2A 3I8DA 5CYMA 4NLUA 3PJWA 5KFYA 3BSOA 1QQCA 1S1WA 3RB3A 4KB7A 3E01A 2IC3A 2XO7A 3N6NA 4I2QA 3H2LA 4FM1A 3PW2A 3RR7A 1SV5A 3TVKA 1W25A 4HCBA 4Y1CA 4NZ0A 4QCLA 4O4GA 3EZUA 1KLMB 2KZMA 1TGOA 1HNIB 3M8QB 2GIRA 4DF4A 4KRFA 3CDEA 4TQSA 4K4VA 5HLFB 3DRPB 1VSJA 4J9OA 5KFVA 2Y1JA 4BE0A 3L3UA 4O55A 4XPEA 3KHHA 4C8NA 4N56A 3LP1B 2WTFA 2G8VA 4GW6A 4KB0A 4FJXA 4B3OA 1F21A 3BQ1A 3SQ4A 3NF8A 5C24B 2BRKA 4LSLA 1T8EA 5C42A 2E9ZA 4DL7A 1WAJA 2HVIA 1S1TB 4NLTA 3KK3A 1JL2A 4M95A 4IG0A 3RMDA 4Q0BB 4HKQA 3QEWA 1NNDA 1RILA 1Q9XA 3NFAA 2HWHA 3SV4A 4Z4EA 3L2WA 1S9EB 1Z25A 3OYDA 5C5JA 4EO6A 3P1GA 1JKHA 2F8TA 2OPRB 3DLHA 4TLRA 4CFBA 2D3ZA 3Q8QB 4J9QA 3WNHA 3JYTA 3CG7A 4DF8A 1XR6A 1NK8A 5KFTA 4MIAA 2E6MA 4G1QB 3QYYA 4EZ6A 5KT7A 3EY1A 3G6VA 2XC9A 4YMEA 3AV9A 5KFGA 1A5VA 4OPJA 5DGAA 3MECA 4G3IA 3DM2A 1VSLA 3T5JA 4J2EA 3OYIA 1S10A 1VRTA 3VQ7A 3AO3A 3OYJA 5EWEA 3G6YA 4E7IA 4ZP6A 4J9KA 2V4RA 3BGRB 2YNIA 5I42B 1X9SA 4IG3B 1WNEA 2HMIA 4CHQA 3TAMA 2JEJA 2ATLA 4RW9B 1JLBB 4FLWA 3DLKA 1T3NA 2ZQBA 4NCBA 1RBTA 1NOZA 3DLGB 5KFUA 4KAIA 4FJJA 1KLNA 1HNVA 3EZ5A 2G8KA 5L1LA 1RT7A 5F9LA 3AVCA 4FLTA 3RBDA 5KFSA 1K6YA 3FQKA 1BQNA 3CIZA 4CJFA 2J6SA 3LALA 2J6TA 5EWGA 4FYDA 5FDLB 2WOMA 3CDUA 1RDDA 3HKWA 3L2VA 5D3GB 3L2QA 3HVRA 4DU3A 5J2MB 4DSJA 4E7HA 1T05A 3K59A 4E1MA 2WK4A 5KFRA 1S1XA 3HHKA 1S6PB 1TL3A 4E89A 4CCHA 3SUOA 3RRHA 1CZ9A 4Z0UA 4JUZA 1KVAA 4KPYA 3DMJB 3SUPA 1C1BA 2R8HA 2R8KA 1C1CB 2YNHA 5JXSA 4CGIA 4U6PA 3QIPA 4MFBA 3SUNA 3MR5A 1VK0A 5DK5A 4MK8A 5J2QB 2R8GA 2GC8A 3DRRB 4ZVHA 4FCYA 1TL1A 4CJ4A 1XR5A 1JLEB 1UWBB 3GILA 2W8KA 4ED7A 3F9KA 1BI4B 3C6UB 3H08A 2YKNA 1EX4A 1Z4UA 4IKAA 5F8NA 5HRNA 3D0PA 1KLMA 4CERA 4HTUA 3KMSA 3K57A 5EUHA 4DQIA 2HW3A 4ECVA 3K5OA 2AX0A 3U3YA 3ZCMA 5KG4A 4DS4A 4CF2A 4IH6A 1RT5B 5DQIA 4K4XA 5HLFA 2IM2A 3C6TB 5HBMB 3IGNA 1HARA 2OZSA 2FVCA 1S1VA 2DY4A 4F4ZA 2HNYB 4E7JA 3DLEB 4FLZA 3LP1A 3TWHA 4DU4A 3OLBA 5L1IA 3LZIA 2D3UA 5C24A 1OS5A 4TXSA 2OPSB 2HHUA 3S3NA 2FVQA 5KRTA 3DYAA 1S1TA 3FFIB 5J2PB 4J9MA 3DDKA 4YP3A 1G15A 3LP0B 4IH5A 3M8SA 4ELVA 1RT1A 4Q0BA 2FBXA 3QETA 2EX3A 4ED8A 3NCIA 3TABA 2G8HA 4RZRA 3MR2A 2FJVA 4ELTA 3NF7A 1S9EA 1TKTB 4MK7A 4NYZA 4F3TA 4Q8FA 1JLAA 3OHAA 3AA5X 3KJVB 4ECXA 3T5HA 4WYLA 3V1QA 2PZSA 2KZZA 1RT6A 4G1QA 2VG6A 4AHRA 5DQHA 5HRPA 4NYNA 5KT3A 2KFNA 3MR6A 3V6JA 3I5BA 3PJXA 2XGPA 1LWEB 4NLXA 2FLLA 2C2DA 2X6SA 5KG1A 5HROB 3T5KA 4NRUA 3V9WA 4BWMA 1HJRA 2V4QA 2OYQA 4EZ9A 4PY5A 1WSHA 1X1PA 4RNOA 4IG3A 4WFZA 1JXBA 1WSGA 3AO5A 4DWIA 4LY7A 2AGQA 1RT4B 1KHWA 2D5RA 1GX6A 2JEFA 3DLGA 1N56A 3GIJA 4DSLA 4JRQA 4F2SA 4F4WA 4RW6A 1ZBLA 4E3SA 1GOBA 2BE2B 2XY8A 2YV0X 5FDLA 4O3OA 4B9VA 3I5CA 3RAXA 2R2SA 3HP6A 5D3GA 2IOCA 3CFPA 5J2MA 3IG1B 4DTRA 2ZE2A 2F8SA 4FJMA 1D9FA 2YKMA 4PQUB 3TAPA 1LAWA 2CKWA 2VG5A 4K4TA 3DMJA 4WXOA 3F73A 5KG2A 3NAHA 1VRUA 3V6KA 3NL0A 1BCOA 3EYZA 4UQGA 4DTSA 1HQUB 3ITHB 4F4XA 2Z1HA 4ECTA 4DTXA 3IS9A 4CJLA 1MMLA 1IM4A 3Q8SB 3BR9A 1HMVA 1K1SA 5KG3A 1L5UA 3ZSYA 2YNFB 1UWBA 4KHYA 1I39A 2BQ3A 3PW5A 4M3XA 1QTMA 2FBVA 4ECRA 1SKSA 4JS4A 4O44A 2YHBA 4FJ8A 3V6DA 4CF1A 2V0NA 4RG8A 3V9UA 3RMBA 4M3YA 3NH0A 3PZPA 4C8LA 4KFBB 3HPHA 5HP1B 4IRKA 4HUGA 3SZ2A 3FRZA 1LW2B 4B9SA 3C6TA 5HBMA 4Q45A 1JLFB 4CJSA 2JEIA 3ZSXA 3H5SA 3NDKA 3ALYA 4ZPCA 3ISNC 2GBZA 3KOAA 3RR8A 3C94A 3LZJA 3IRXB 4TY8B 3VA3A 4DSKA 1JX4A 1RA7A 4LH5A 4ED1A 2OPSA 4IFVB 3D45A 1MU2B 4I7FB 4FVMA 1Z26A 3FFIA 3TR8A 5KG5A 3NGIA 3V81B 3T5LA 2KFZA 4F3OA 1LWFA 1NK5A 5KFLA 1UOCA 3S3OA 2G8WA 1TKTA 3FSIA 3FDSA 5KFMA 3AA3A 4JS5A 4M45A 3V4IB 4RW8A 4HVJA 3NKYA 1I3AA 3HSTB 1ASVA 4B9MA 1TK0A 3NE6A 1SL0A 1YVUA 4H4OB 1IKYA 3OLAA 2OPQB 1IKVB 2VG7B 5JUMA 3N6LA 1NKCA 2FVPA 4E7LA 3RRGA 5KFKA 2IS3A 4J2AA 4EP4A 4F4KA 1IKXB 3D5MA 3OJUA 1D1UA 4ED0A 3QEXA 4YFUA 1FKOB 4EBEA 3HPOA 3KK2A 2HHXA 1J53A 3VQ9A 4F4YA 2P5OA 4KKOA 1QUVA 5DLGA 5KFEA 4K4UA 4FJGA 3AVHA 4Z4CA 3OSPA 2EHGA 3I0SB 4NCGB 4QPXA 3DRSA 4OVLA 1TK5A 3KLHB 1VSFA 2R2RA 3RWUA 3I5AA 4RW4A 3LPUA 4ZP7A 2PY5A 4EO8A 3AVAA 4M41A 1EP4B 1RT2B 4NLOA 3ZT3A 1RBUA 3QIDA 2ASDA 1HYSB 4QOZB 4K4WA 5L1KA 1S0MA 2BE2A 4GVMA 2W9BA 4CEDA 2XGQA 3VQAA 3AA4A 1C0TB 3EPIA 4ELUA 4NLSA 4RNHA 4WE1A 4W5QA 3IG1A 3V1RA 5FROA 4CJ5A 4EBCA 2X78A 4QWAA 3UPFA 1VSIA 3M8PB 4NCAA 3RB4A 4KHWA 2QXFA 4PWDA 2AX1A 3KMQA 5DG7A 4CEEA 2BANA 3MF5A 1C0UB 4CEZA 3QGHA 3O4NA 4ZMMA 4DEZA 1QS4A 3ZSRA 5KFNA 1T7PA 1K1QA 4ZPBA 1HQUA 1S9GA 1RCHA 3Q8RB 1RYSA 4FJ7A 3CQ8A 3S3MA 3PO5A 4KI4A 4H4MA 3WNFA 3DI6A 1VSEA 4Y2AA 3L2UA 3MXJA 1RDRA 4RU9A 3LWMA 4DSIA 4TYAA 4R8UA 1EKEA 4I2PA 5KFQA 4AHVA 5C25A 4QW9A 4O3NA 1NJYA 1ASUA 4N5SA 4FLYA 1BQMB 5KGWA 2UVRA 3THVA 4KFBA 2ITGA 5HP1A 1Q9YA 3G10A 3K5MA 2OZMA 1RTIB 3IGVA 3OYGA 3H98A 4ZPDA 1S6QB 4DFMA 3RMCA 3GIIA 2VWJA 3QEVA 2HWIA 1L3UA 2HHWA 4ECQA 3IRXA 3PV8A 1TVRB 3OYFA 2ASLA 4TY8A 2Y1IA 3KIOA 4N76A 1JL1A 2RPIA 4YR2A 1CXQA 2P1JA 4IFVA 1DLOB 3LP2B 2KQ2A 4MK9A 1N6QB 4J9PA 1ITGA 4CEFA 4OGCA 3V9SA 1QE1A 3RBEA 1L3VA 3UR0A 3V81A 5K14B 4O0IA 1EETB 4NLDA 2W9CA 1YT3A 3PO4A 1CZBA 3TAFA 3OS2A 4W5OA 4E0DA 3L3VA 3KLVA 3E51A 3V4IA 2R8JA 2IGIA 1ZBUA 1NK6A 1KVBA 2YHAA 4OKEA 3KLGB 1FXXA 2HHTA 4KO0B 2OPQA 5JS1A 4QWEA 3TANA 2EC0A 4ZP8A 1REVA 4NYFA 4DLEA 3SFGA 2FJWA 1JLQB 1A5XA 2AGOA 3GIKA 2W42A 2R7YA 1IKXA 4KHQA 2GV9A 2CJQA 4DL5A 4CGGA 4CHPA 4CEBA 4EYIB 3AO1A 2IAJA 3QGGA 1TKZB 3UQSA 3MEEB 4O4RA 2GUIA 3VA0A 3MFHA 3VQDA 1NOYA 2O4IA 4CE9A 4ECSA 5J1EB 4NCGA 4WFXA 3KLHA 3ZSVA 1HPZB 2XRIA 5L9XA 3KLEB 4RNNA 2E9RX 1HQEB 3WNGA 4PUOB 1EP4A 4IFYB 1RT2A 3BJYA 4FW2A 1ZTWA 4ED3A 3T1AA 1XHZA 1HYSA 5HRRA 5KFZA 4FS2A 4ECWA 4RNFA 2B5JB 2NUBA 4CJPA 2D41A 1BGXT 5KT4A 4NLRA 3OL7A 1JXLA 1HNIA 1XWLA 4CESA 3M8QA 3M8PA 1O1WA 4C8KA 2E4LA 5KRSA 3EPGA 1EXQA 1WSIA 3ZSWA 3ZT2A 1D8YA 3BREA 4FJLA 3KHRA 1S5JA 2UVVA 2VA2A 3DRPA 2RN2A 1RTJB 2DFHA 4OGEA 3QINA 2O5DA 3NBPB 1XHXA 4IR1A 1N5YB 4OKJA 4CJRA 3HYFA 4WXWA 4KHRA 3SQ1A 3MEDB 1Y97A 2XWYA 2IM3A 5DG8A 1S97A 3ZSZA 4CK2A 1X9WA 3AVLA 3VQ6A 1JLCB 3I0RB 4FBTA 4ZVFA 3GQCA 1RBVA 4GMJB 1FK9B 2I1RA 3KKRA 4NLGA 4X2BA 2AJQA 1J9AA 4B08A 3CDWA 4FZZA 3QLHB 4HHTA 2FBTA 3O3HA 1DTTB 1NKEA 4CK3A 3TAGA 4IBNA 4ID5B 1BQMA 1J54A 4CHNA 3LAMA 3DOKB 4W5RA 2OPRA 1TQLA 2FLNA 4CJKA 4I9LA 4DL4A 1XI1A 1KFDA 1RDBA 3AA2A 4CF0A 1RTIA 4NLPA 4DL3A 3AO4A 2HNZB 1S6QA 4LD0A 4URSA 3G86A 4B8CA 5FRNA 2YNGB 5DGBA 2RF2B 4R0EA 3OYMA 2G8FA 5DQGA 3QESA 1RT3B 3OYBA 3O3GA 2C2EA 1RTHB 2OPPB 4AILC 3BGRA 4DSEA 5I42A 2B4JA 4K4SA 5K14A 4FJNA 2I5JB 5DMRA 4RW9A 1JLBA 4KV8B 3G0ZA 1XC9A 1QSYA 3AVBA 4KHNA 3SYZA 5FRMA 3OSNA 1TAQA 3HVAA 2P51A 1QSSA 4CHYA 4Y3CA 3QZ8A 4EEYA 1WN7A 1JLGB 2R2TA 4CGDA 4OLAA 5KT6A 2HAIA 4ICLB 2W8LA 5CYMB 1T03B 3AVIA 4K8ZA 4TY9A 3DOLB 2HHQA 4N41A 1GX5A 2F8EX 2PYLA 4M42A 3AVMA 1SUQB 3SFUA 1S6PA 3OL8A 3E01B 5F9NA 2IC3B 2FLPA 4CJVA 1L3TA 4K4YA 2IJFA 1SV5B 3OYEA 4FK4A 2XY7A 3MEEA 1C1CA 1S9FA 4URQU 4DQQA 3NAIA 4ID1A 1R0AB 3RAQA 1KSPA 2QV6A 3NAEA 2ILZA 2WRMA 4KSEB 5J2QA 4DL6A 3DRRA 4WZQA 1UA0A 4CJQA 3CFOA 3D28A 3VQ5A 1JLEA 1ASWA 4PUOA 3KHGA 4IFYA 4XIUA 2C28A 3VQBA 2IA6A 1BI4A 3C6UA 3H4DA 1BIZA 3HXMA 2G8IA 4CJTA 1YTUA 4B3OB 1S4FA 3DLRA 3N6MA 4BE2A 5C42B 4MKBA 4JV0A 3AVNA 2WONB 3ZT1A 3SPZA 5F8JA 3KK3B 3BQ2A 2VWKA 1RT5A 1S0NA 3KLFB 3UDLA 4TQRA 4CHZA 1RTJA 2F96A 3QGIA 1ZYQA 5KT5A 4RUAA 3RB0A 3ZT4A 1WNSA 3ASMA 2HVHA 1JKHB 2HNYA 3B6OA 3QNNA 3KHLA 3DLEA 2IM0A 4MKAA 4FM0A 2WHOA 3ZSQA 4IR9A 1B9FA 2IBKA 1JLCA 2HHSA 3NGYA 2Q3SA 4B9LA 1RDAA 5J2PA 4O3QA 3LPTA 3OJSA 3LP0A 4LQ9A 3H59A 2C22A 1C6VA 4DQSA 1NJZA 2BQRA 1SL2A 3NHGA 1A5WA 4F50A 3QLHA 3S9HA 3HP9A 4OJRA 3MECB 3DM2B 4LSNB 1DTTA 1VRTB 4Q5VA 3IAYA 1NK7A 4O0JA 2FJXA 3NMAA 4CGHA 4Y1DA 4L8RB 4DTNA 2BDPA 4ZPAA 3PR5B 4KI6A 4AHUA 2YNIB 1NJXA 4DQRA 3QIOA 2HMIB 3TAMB 3KJVA 2J6UA 4Z4FA 3DLKB 1GOCA 1NK0A 4R5PB 1BISA 3ZT0A 3AVGA 3P5JA 4FBUA 3B6PA 4M3TA 1CSJA 5EU7A 1HNVB 5DLFA 3VQCA 1YVFA 2A1SA 4NLWA 1LWEA 4IQXA 5KG7A 2VA3A 5F8LA 4JRPA 4IH7A 5HROA 5KFWA 4DFKA 1RTHA 1BQNB 5DG9A 2OPPA 1S49A 4CEQA 2D0BA 4M94A 2AQ4A 4M3RA 1BIUA 3LWLA 4RW7B 1LV5A 5KFFA 2HB5A 5KTQA 3OL6A 3JSMB 1BHLA 2E6LA 2RKIB 3PUFA 1T05B 4ED6A 3PW0A 1RT4A 5CYQB 2E9TA 2D0CA 4FJ9A 2UUWA 4ECYA 1TAUA 3K2PA 1C1BB 1ZBHA 4ZHRB 4ECZA 4DTPA 3V9XA 1D0EA 2X74A 3CVKA 3QIPB 1NK4A 2FVRA 4KTZA 1SH2A 4DTUA 4JV1A 3VQ4A 3IN5A 2XY5A 5KG6A 4DTMA 4YR3A 1T03A 4AH9A 1U09A 1TL1B 4LH4A 3DOLA 5KFXA 4BWJA 1W9HA 4O3SA 1BL3A 1SUQA 1DTQB 3MR3A 4PQUA 2YKNB 4H54A 4TSXA 4DTOA 5KFIA 2WCXA 2DFFA 5KFOA 4DSFA 4CIEA 4WYWA 3Q8PB 2UVWA 1X9MA 1U47A 1R0AA 3ITHA 3AO2A 1ZTTA 4ZP9A 3ZSOA 3QEIA 2OA8A 3HVTB
chains in the Genus database with same CATH superfamily
4OPKA 3VQSA 2G0IA 3KG0A 3CB4A 2CNOB 4LF4K 4BRQA 4N8OA 2ZNZA 3B82A 3HJVA 2CZVC 3M8ZA 2FF6A 3K89A 1Z2ZA 3TQ1A 4A47A 2C1EB 4FXDA 1F9EB 1AW0A 4DB3A 2PYJA 1SH3A 5F3TA 1UFWA 2BGGA 3CETA 3LGHA 3A8KA 1D4XA 2P9SB 3OBWA 2DXEA 1NDCA 2OTJN 3KLFA 3A2FA 1ITPA 1TUYA 1KCFA 4KAZA 3UD3P 2PA8D 4NLYA 1VOMA 3R5CA 4B8AB 3Q8YA 3KWGA 3VF2A 3OTDA 1SPBP 3S8SA 3PW4A 3VQEA 4HLBA 5SZTA 2NUUG 3F0NA 4GKKK 4NXNK 1QTNB 4DV3F 3MEKA 2DY9A 4CIFA 3BM7A 4NRTA 3OVBA 2K3IA 4TN2A 3W9JA 1KVCA 4LSNA 4PPDA 4J2BA 3M32A 3ZX0A 1MWQA 4J9SA 4J9RA 3GJSB 5HMXA 2DGTA 1C1AA 4EP5A 4DMZA 3KLIB 2RJZA 4H4OA 1UA1A 1NGGA 3WC0A 5D4NA 1P8GA 2D0AA 1QVGM 3K8VA 4R5PA 2DK2A 4K8XA 1X3NA 4BDZA 3TARA 1A0OB 1UVMA 1E6YB 4DPTA 1KAZA 4LFBJ 4WFYA 1D9DA 1FKOA 3CCTA 4KTQA 3VQQA 4E7KA 3NGRA 4FJKA 2WW4A 1RWXB 4H0PA 3TVYA 1KQFB 4BDPA 4J8FA 1KBRA 2DHXA 1REGX 4C8OA 3T19A 1KD1T 4X66F 1EAYC 3HHLD 3M9MB 4CF9A 1CBKA 4DV0J 4MO5A 4LF8K 2VG5B 4ZHRA 4CJEA 5F8IA 3D6FB 1ULRA 1Q18A 2U1AA 4JI5J 2HFSA 3QNOA 3C19A 2LEBA 3R1LA 4Z4GA 3SI6A 2V4JB 2RNEA 2R7SA 2ZVSA 5KQDA 4ZJOA 1GLEG 4A4JA 4Z37A 2CH6A 1YXQA 2K2PA 2G1DA 3M8YA 4KE5A 4DLGA 2ASJA 3FNNA 1R31A 2ZEJA 1GLBG 2QTDA 3WNEA 2JGUA 4M3UA 3T3FA 2DHGA 2E1RA 4BC4A 3T1YJ 2ZD1B 2NRRA 4FYVB 1ESVA 1BQXA 1RADB 1HIYA 3TJAA 1PYTA 4YDUA 3M9OB 2Z4PA 3OS0A 1ZAXA 3POTA 4DG1A 4F7VA 3CWJA 1B92A 4BACA 3LDOA 2OJ3A 3H5YA 3KNAA 4ZS6A 4V19S 3Q0AA 5JVGL 5HI7A 2UXBF 2D1KA 1VQSA 5AXMA 3ZZRA 1K9MT 5A8WA 4L74A 2DKOB 1BCMA 1R43A 4PG7A 2UUCJ 3AD9C 3ZZPA 2XMVA 1KEKA 4YOVA 2FJAB 3PRDA 5L46A 3MMAA 1BA1A 1I1GA 1T6DA 4BG8A 4ED2A 4AHCA 3BV8A 4KB1A 5LSOA 4IDHA 4AHSA 2MKKA 1FKAF 1S57A 2AJ1A 2GWJA 3KG4A 3NCPA 2PE8A 4UOCA 2F40A 3M2RA 1N4LA 1WKLA 4CFCA 3KK1B 3K17A 1DLOA 2GV1A 2MZSA 1N6QA 2AIRB 3PM9A 5ETTA 2CPFA 2YTCA 3KVGA 2VQEK 3BUZB 5CA5A 4B1XB 3CW2C 3UDVA 3BDPA 4QIVA 1ZZNA 1SC4B 4X4NA 3SBTA 1IH7A 1VQ6N 3ET6A 4UTGA 3QERA 1VQMN 4Z4IA 1CXUA 3OYKA 2HRYA 4O3RA 2LKZA 3KLGA 1Z1ZA 1SJ1A 3EICA 3CC7N 4BS2A 2RMLA 1LWCB 1NHVA 3PXGa 4PKIA 4IDKB 4DU1A 5E41A 1YJNN 2PMHA 2Y1LB 1UWAA 5DRKA 2MKCA 2RE2A 2YX1A 1CULB 2DIUA 3OTBA 3NY0A 2UVUA 1JIHA 4HACA 3BS9A 1OPZA 4EAHD 2XS7A 1G99A 2H9ZA 3OHBA 1SI9A 2W9BB 3MM6A 5KGXA 3MMCB 4Q44A 3H20A 2AU0A 2ROEA 5J1EA 4GC7A 5LT5A 4M5DA 3V5RA 2Z1JA 4P75A 2IDOA 5DM6L 1ZBIA 3K8WA 1HPZA 3BB5A 2BANB 1P8ZA 2BOAA 2FHKA 2PN6A 3TZZA 2RHKA 3KTQA 3TPQA 1JCGA 1XBWA 4CGJA 3AOCA 3A12A 1U2VB 5A6PA 3M6UA 3OFFA 4LREA 2B3TB 2G2YA 4BC2A 1QHTA 1RABB 2D74B 4LFCJ 4JI8J 4IOCL 3OS1A 4OZ0A 3NLCA 3LDSA 1HD1A 3O3FA 4IG0B 4I2PB 3GYNA 2LFVA 1KC8T 4DL2A 3QO9A 3NBPA 2J7KA 1N5YA 3QAUA 1W2BR 2K7JA 4AT1B 5E0OA 2QLWA 2HKEA 3G8TA 1HRHA 2GHVC 4LF6K 2AYBA 3JYTB 3L9ZA 3BF4A 5D0RA 5J1NA 1N32J 3PEJA 1NJWA 1YIJN 1Q1KA 2O8EA 4C98A 2ZUGA 4BE1A 4YB5A 1FK9A 3D2EA 1WC1A 4R79A 4FWSA 4M1KA 3SCXA 3CM6A 3U8XA 3ULHA 4LF4J 2RILA 1VHXA 2AJ4A 1OJ4A 1B7FA 1QLNA 1PJ5A 3CJ0A 1FT8A 2YQ3A 3NS7B 3VF0B 1HKBA 3ZZOA 5AQIA 3BH7B 2R8IA 3DNCA 3C3LA 5EOYA 3MAQA 4CH0S 1TKXA 2V69A 2HHVA 1U25A 3ZZUA 4JI1F 3HFZB 3QZ7A 4TLQA 1RT7B 2E5LF 3CC4S 1RT3A 4ZVTB 1S1UA 5D0GA 4YOYA 2GA7A 5DZ6A 2X3GA 5M2RA 1R89A 1WSFA 4DS5A 2GO8A 5GINA 4Y34A 2Z1GA 3ENHA 4DR1F 2KW4A 4NYOA 4EK2A 4FF3A 2G0CA 3TZXA 4GKKJ 1OH8A 4NXNJ 3HVWA 3H1VX 2K8GA 4CRJA 2DPJA 4W5TA 2MGZB 1HBUB 4CNZA 1HLWA 4MFBB 3FCHA 3FZBA 3KJNB 3LQVA 4CHOA 5CZ2A 4ICLA 1KOOA 3LP3A 3GJTB 5CYMA 1TZ0A 3BSOA 4HI2A 1GEHA 1VBXA 1QQCA 4A46A 1MG7A 5B09A 1S1WA 3D4JA 4FM1A 3MCOA 2N3LA 4CLFA 4NZ0A 3EZUA 4CT8A 4GNIA 1RKJA 2UUBK 1FNOA 1NSAA 1K73O 4CTAB 3M8WA 3PCOB 2XEXA 4TQSA 4IFEA 3P31A 4BVOA 4PG5A 2Y1JA 3EKUA 4BE0A 5HSPA 2Z8QA 4W4MA 2QWMA 2PAVA 1LQ9A 4LF8J 4NPOA 3EMTA 4RUBA 3KHHA 4C8NA 2WTFA 4JKDA 1WSRA 2KVQE 3SQ4A 2A18A 4DL7A 2HVIA 1WAJA 1DARA 3CJSA 4NLTA 3R7NB 2CRLA 1JL2A 4FPRA 2AD9A 4M95A 5GMKa 2BYCA 3RMDA 1NNDA 4TU9A 1H3DA 3MPDA 3EGZA 3T1HF 2MMYA 3MUVP 3FRYA 2BVZA 3R97A 4BBYA 1H0HB 5C5JA 4EO6A 3D54A 2OPRB 3DLHA 4P9SA 5CZVA 1O0PA 2A5XA 3Q8QB 4J9QA 2DBBA 4BC7A 3WNHA 2YX4A 4DF8A 5H1SV 4JYAF 4EZ6A 5KT7A 3P45B 2XC9A 3ULEA 3HHDA 4MKYA 3AV9A 2CQIA 4CDIA 1A5VA 2C2NA 3DM2A 1VSLA 3T5JA 1G3OA 3VQ7A 4P6QA 3Q2SC 3AO3A 2CQPA 3NP5A 3G6YA 4OYPA 1DEJA 5I42B 4L76A 1X9SA 2HMIA 4NZ6A 4OIXA 4UZCA 3SDEB 1TL7A 3RW6A 1JLBB 2CWKA 2ZQBA 1T3NA 3D1QA 2WSCC 4CNYA 3QAEA 4CVNE 1NOZA 3MM8B 5KFUA 1KLNA 3GFHA 2G8KA 4H4KC 2OTLS 3FSYA 1IR0A 1VCTA 4M63C 3D3BJ 3FQKA 1BQNA 1W97L 3TW0A 2J6SA 2J6TA 5EWGA 5FDLB 2JFDA 4NE9C 1F2GA 2ZGZA 3UFCX 3L2VA 3DXMA 2V7ZA 2ZBPA 3GG4A 4OJ3A 5J2MB 2OANA 2YVSA 1YWXA 3K59A 1HHTP 4E1MA 2WK4A 3MCMA 1TL3A 2VQEJ 1ZA2B 1WDDA 4G65A 3DMJB 3SUPA 1C1BA 2HLUA 3O9TA 2YNHA 2FD2A 4U6PA 1M1KO 3QIPA 1LKZA 2CG4A 5F0UA 5L8RC 3W2VA 1VK0A 4MK8A 3MMVA 3IO1A 4ZVHA 4W90B 4C7QA 2CNLB 5AXNA 1UWBB 3BPSP 2W8KA 3A3PB 3MMBB 2C2ZB 2MQNA 1BI4B 1W2BM 1JQGA 4IKAA 4OYZA 5M1KA 3SJHA 1U1RA 3C2PA 5HAOA 3A0IX 3K57A 4DQ8A 1B0PA 2V50A 4YB1P 4DS4A 1RT5B 2NSBA 4YY3F 1UW9A 3C6TB 1FNXH 1FRIA 2CQ1A 3CF5L 4F4ZA 4M5LA 2V51B 4E7JA 3G4SS 4JK8A 1YSJA 3DLEB 4OMFG 3LP1A 2E2NA 3TWHA 5L1IA 1Q53A 1YRXA 4MDBA 4U9RA 1F0XA 3O2IA 5A2QY 3SCIE 4AFFA 2B8QA 1NAQA 1S1TA 3FFIB 4P2MA 1G15A 5LJVA 1UJ5A 1V3RA 3AXKA 4CZMA 2P9SA 2FBXA 4DV3K 1RLCL 2G8HA 3AA8A 5LM7E 1NM2A 3NF7A 1S9EA 1TKTB 4MK7A 2Q0UA 4NYZA 1QD1A 1J2VA 1SIWB 5FJ4A 3W60A 5LJWA 5CYJA 2ZUAA 2VWBA 1UVNA 1U0HA 4V19X 3T6BA 5HVHA 1MLAA 1VHFA 3T5HA 4PXDA 5ETRA 2PZSA 2IPOB 4AHRA 4LF6J 5DQHA 5HRPA 2UXCK 4BC3A 3LF0A 1T95A 4LMZA 2P9UB 2IY5B 2XGPA 4NLXA 2V94A 1NBWA 3G6EN 1W2IA 1IWGA 1GT8A 2DO4A 5AQTA 3GIRA 1HJRA 2V4QA 1PSDA 2IDLA 6FDRA 4IG3A 4WFZA 3LW5C 1VK3A 2JZ5A 5D6GA 2FGOA 4X66K 3KUHA 2V68A 3CDAA 1NH8A 2ZJPQ 3DDIA 5A8KB 1PAEX 1N5VA 1JXVA 4DSLA 2FF3B 4JRQA 2EG1A 4BRIA 5BR9A 5BPNA 1ZBLA 4A8MP 4D3GA 2VDHA 3FUYA 3QJLA 3QRRA 5AQHA 4DR5F 2BX6A 2MHNA 3I5CA 5GAEI 5AZJB 5KPZA 3CFPA 5LMNF 3UN5A 1QHAA 1RHJB 3HCXA 2UUAF 3TAPA 1LAWA 1Y00A 3AJ2A 4CO2A 1OPIA 2VG5A 1RWKB 4WXOA 3BR8A 4USTA 4HTJA 4FSVA 4UQGA 4DTSA 4J90A 4DTXA 3CCJS 3O3LA 5I4MA 4CJLA 2KVIA 2W4CA 1K1SA 2V4JA 2N3OA 2YNFB 2BQ3A 3BYRA 2ZH2A 2CQDA 1RHKB 3VAJA 2HQCA 3MD3A 3GMGA 2NPIA 4ZN3A 3AH6A 4OLPA 4CF1A 4LF9F 2V0NA 3RMBA 1VLYA 4M3YA 2DR7A 5AQQA 1RWUA 4PWUA 3HPHA 4IRKA 2D9PA 2J8AA 3LH2S 4WFAL 1MROA 3UN3A 2UUBJ 1LW2B 1WTBA 4EHTA 1S7IA 2HS4A 1JLFB 3TUJC 1X31C 3OBIA 2ZH6A 4RJVA 3ALYA 2GBZA 3KOAA 3IRXB 2F5GA 4TY8B 3VA3A 4OX8A 2RQCA 2M70A 2WVDA 3FZFA 1JX4A 3CCRS 1RA7A 1V5IB 2C2KB 4YDDB 4DV2F 2LDYA 2HVZA 3D45A 1BXNA 4J7CA 2Z0GA 1YJUA 1HBOB 4FNHA 3NGIA 2HBRB 1RWWB 2Q1NA 1UOCA 2QT7A 3BH6B 2G8WA 4WK1A 4JS5A 3V4IB 2P5VA 4HVJA 3HSTB 4JD2B 1TK0A 3NE6A 3X1LB 3OLAA 1M5HA 2WB1D 5JUMA 5EGYA 3N6LA 5HJXA 1WF1A 2GMLA 1TU0B 4LRFA 3KUGA 5KFKA 2IS3A 3CC2N 4EP4A 3MURP 4FWKA 3HPOA 2EFOA 3FEXB 1J53A 4WCEL 5T41A 3R5GA 4FWRA 1VMBA 4F4YA 4RBTA 2Q6CA 5DLGA 4K4UA 4F36A 2RVJA 1EWQA 4HH0A 5IV3A 2MY8A 3CCMN 4DI6A 3A8JA 2BACA 3ID8A 1K73T 1CULA 1WC4A 4AQYK 4EO8A 2A40A 1VC6A 4FF1A 4BQLA 2DGWA 1RBUA 1Q86T 5L1KA 2JOQA 2BE2A 4GVMA 2B9EA 2W9BA 1N8RO 4C4WA 2XQCA 4CEDA 3VQAA 4BRMA 3IG1A 3J7YI 2CDRB 4CJ5A 4FO0A 4CJ7A 1MN9A 4QR0A 4QWAA 3RB4A 2WVCA 1KVJA 4CEEA 2BANA 2L3MA 4HT7A 1N0UA 5BR8K 2VBWA 4YS2A 1NU4A 4P7TA 5KFNA 4PXCA 1FF2A 1K1QA 2NLXA 1ELOA 3R5DA 1RCHA 2QI2A 2FSNA 3S3MA 3PO5A 1OH6A 1CJTB 3DC2A 2OO4A 3WNFA 1VQOS 3DGVA 1VSEA 2DTJA 3MN5A 3E2EA 2QL5B 3LWMA 2VGMA 1EQYA 4I2PA 2CDQA 4O3NA 1MDUB 1IQZA 1BQMB 5KGWA 1I3OB 4WF9L 2ITGA 3NGSA 3BF3A 2A0FB 2WVEA 3IAM9 2OEMA 3VEWA 3DFEA 1HI8A 3QNWB 3OYGA 4USWA 4ATNA 2GX9A 2NNWA 3I9ZA 2HWIA 5T7LA 4Z94A 2QXLA 1YUWA 3JXUA 2Y1IA 3H2VE 3KIOA 1R8PA 4YR2A 3LDQA 3NGKA 3LP2B 2HQDA 2KQ2A 4X4RA 4J9PA 1BWFO 2EI5A 1M90T 4KJIA 2ADBA 3RBEA 1L3VA 2PFFB 1JJ4A 3AJ1A 5CE3A 4A8XA 2VBYA 3OS2A 2OAUA 3J7A1 3E51A 3CCLN 4DV3J 4CW7B 3TA2A 4OKEA 1DJ0A 2NRXA 3B8AX 2HQIA 4ANEA 5JS1A 3TANA 3N79A 2EC0A 4YHHK 2EVZA 4ZP8A 4USIA 4CZHA 1M1KT 2ZOGA 3TVZA 1Q7YO 1H6KX 4DLEA 1GNKA 2ZGYA 3THXB 4KHQA 1B0VA 3OFHA 5IC6B 2AEFA 4CGGA 4CEBA 3QGGA 1TKZB 5M1PA 4ZJLA 2DNGA 5ADXA 2LQJA 3MEEB 2HZCA 3VA0A 2MGZA 1HBUA 5M1FA 4B1WB 5AQZA 1RHQB 4B3RF 3KLHA 2XHWA 3ZSVA 1SJFA 3CCQN 4Z7CA 1EQ0A 1Y11A 5L9XA 1VQLN 3VV2B 1HQEB 3PYGA 2ZITA 4X66J 4PUOB 1EP4A 4JKBA 1OMSA 4DV6F 2PI4A 3T1AA 2NS1B 5CHIA 3BKFA 2DCLA 2NUBA 1BGXT 3EEQA 1Q8BA 4WTYA 3IUCA 3RUBL 2GEMA 1XWLA 1M1GA 3S6EA 4C8KA 4F0MA 2XO6A 3VGSA 5D4PA 1VS3A 3ZT2A 3I9V9 1S5JA 3IBFB 1O13A 3IFEA 1RTJB 3HLUA 4ZLJA 5IV4A 3TRGA 2DGVA 2Z2YB 8AT1B 3DXSX 4ZVQB 4CLKA 1Q4RA 3SMSA 3GG0A 1OQ6A 4CT9A 3CPWR 2G13A 3C14B 4JYAK 3I0RB 4E1JA 4FBTA 1GFWB 3GQCA 1VQKS 4IWVA 3WIUA 5GAHI 1BE4A 4OPAA 4ZVSB 3E3XA 3IR5B 4F4AA 1NKEA 4IBNA 2XHCA 3MPWA 1J54A 3DOKB 4W5RA 1YITN 2OPRA 2Q2RA 2LECA 4CLZA 2FLNA 4CJKA 2QA2A 4DL4A 1XI1A 1KFDA 1RDBA 3QWUA 4CF0A 4LFAK 1S6QA 4LD0A 2RRAA 3PSIA 2QWOA 5FRNA 3N01A 4JI6F 4C3LA 3W0LA 4NWBA 4CIOA 2DGQA 5AQXA 4EMDA 3W7BA 2C2EA 2OMLA 4F67A 4H5WA 5GAGP 4OI6A 2LVWA 4AILC 4P71A 4DSEA 5I42A 3SEOA 1BG3A 3GR0A 3G25A 5ETKA 5K14A 1VBYA 5KPRA 2I5JB 1JLBA 4JKHA 2RUSA 4DR6F 3OSNA 4IZ9A 2KXNB 3MM8A 3FGVA 5D15A 4NMXA 4CHYA 1GLJO 1DRZA 4A8WA 4X84A 2GMHA 1JLGB 2UXDK 4OLAA 5KT6A 3R6GB 2WFBA 4DN9A 4QYRA 3S41A 2HEKA 2W8LA 3AVIA 3R27A 4K8ZA 3DOLB 4KGXB 2XYPB 3QSYB 4N41A 3J81U 1MWMA 1SUQB 3EO3A 4JV5F 4DR2F 5F9NA 2FLPA 2NZCA 1L3TA 1UPPA 2VDIA 3OYEA 3CJ9A 2XY7A 1JMTA 3VERA 2IBOA 4Y0FA 3WEEB 5BREA 4IOAQ 4C1NK 3HSZA 4ID1A 3RAQA 1KSPA 2WRMA 1J5EK 4GMKA 4IYQA 2OD6A 4MYUA 3HRGA 1H38A 2AEMA 2YCHA 5MAOA 4WZQA 1LXJA 2UV8A 1UA0A 3D28A 3VQ5A 5C2CA 4AYBD 3FZHA 3MMBA 2LQ5A 4BR0A 1BI4A 3W9IA 3UKRB 4AQYJ 2BXJA 2JX2A 3IM8A 4B3OB 4CP5A 4YOXA 3DLRA 5ETLA 5GMEA 1R8CA 4BE2A 5LJ5Y 3QFWA 3AVNA 4FDFA 4CZEA 1S12A 3RSEA 2AHOB 3KK3B 5AZIB 1WUAA 3BQ2A 1SBRA 2EBEA 1Y5LB 1RT5A 3UDLA 4RUAA 3T6JA 3OXGA 3VESA 5LL6Z 4QJVA 4ETZA 3C65A 3DLEA 3OR1B 4L73A 4FM0A 2ZKTA 2HBZB 1IG8A 5BN9A 3WUHA 1X60A 5IT0A 1KTVA 4X4SA 3NGYA 1KXPA 4B9LA 2EG2A 1QQMA 1U2RA 3OJSA 2C22A 1SL2A 2VQFF 4PKHA 3IDHA 3UWTA 5AXKA 2WZ1A 4B3TK 3PTWA 3ZZYA 4ZPAA 1F3VA 1H7XA 2VFUA 4KI6A 2YNIB 1NJXA 3H3OB 4EFAC 3BO2A 3M6XA 1AFIA 4Z4FA 4QIFA 1FTCA 2E7XA 4UY85 3DLKB 1NGJA 1Y5NB 1NK0A 3ZT0A 5E3QA 1SC1B 5A0YB 3P5JA 3MWPA 2ZF5O 5GADI 1MSWD 1P1LA 3VQCA 1YVFA 2W4DA 2A1SA 2VA3A 4IQXA 3SSRA 4HTIA 2NLWA 2V63A 4IH7A 4JRPA 2C42A 1RTHA 3R2DJ 2EFVA 5DG9A 2LEPA 4CEQA 2HHHF 2D0BA 2HLTA 2A2DA 4DJBA 2N82B 2E5LJ 4DPWA 4RW7B 2VB6A 1LV5A 4C0HA 5KTQA 4TU7A 3CCSS 2R9LA 4QZVB 5LMNK 3PW0A 3OD2A 3K2YA 2UUAK 4BR9A 4FJ9A 4JHDA 2UUWA 2GNKA 2FLOA 4TVAB 3RGIA 4CYUB 4DR1J 4F02A 4DZDA 3V9XA 4IO8A 2O8CB 4Q7AA 3L3CA 1Z6RA 1VQPN 1SH2A 4CO3A 3IN5A 5E5NA 3I4HX 8RUCA 2ZNYA 1RHRB 4YOTA 1XNRK 3EJMA 3F5TA 1BL3A 2DGXA 4H54A 2GGPB 2I7PA 2BJEA 5EVZA 2DFFA 4C8ZA 3EL2A 5G0RA 4LF9K 3OHRA 3CPWM 1MMNA 4K43A 3P5TL 4FF2A 4YDXA 3RZAA 2OA8A 2EC2A 2BR0A 1ZBSA 2J0QD 2YNFA 4F3MA 4NLBA 1W0HA 3K5LA 4OZJA 4DUZK 3H4BA 3OR2B 5G4DA 3H46O 3ENWA 4YR0A 4QPTA 4QIWD 4DV2K 2WONA 3CJRA 3GIMA 2NXNA 1FKPB 2QRRA 1N34F 7FDRA 3M8RA 3OTCA 4F8RA 3RBXA 4DV5F 1FRKA 1LW2A 3BN4A 4NX9A 1JLFA 3G6XA 4HCCA 3DOMB 4J9NA 3J8AA 1NHUA 3NRBA 2CG8A 3BSCA 3NF6A 2ZDPA 2VUGA 4V19J 1EQMA 1ZS6A 2WSEC 2B4OA 3JTPA 2VG6B 3UCUP 1TV6B 3D2WA 2E66A 1Q7YT 3O9SA 4JYAJ 1UEVA 5SUHA 3NH2A 1TL5A 4A8FA 4QR2A 3US5A 5FPMA 5T14A 1RLDA 3HPGA 3HTVA 4MH8A 3NG8A 5E7OB 4JD2A 1MW7A 1GXUA 3T7ZA 2YWHA 2ZM6F 2KXFA 2E88A 2KTQA 3ATVA 3L7PA 3PFOA 4LFAJ 4DR3F 2FSJA 4YORA 1KHVA 4RW6B 5F1XA 2CYYA 1U2CA 4QS8A 1RSCA 4M8LA 4ILLA 4M3WA 3OXLA 2NRTA 1TTHB 3OTOK 1RAJA 1U49A 3RB6A 4B9UA 4CJUA 4HUFA 2W25A 4DU7A 2O3DA 3LAKA 4OV1A 3JSMA 3ILOA 1C4CA 2MHEA 3L8BA 4OQJA 3JSBA 1RTDB 4CD3A 3AB2B 4LIWA 4WP3A 3THWB 2DTUA 3KWIA 3IBCB 5L39A 2UUTA 5KFAA 2BQUA 4LR9A 4USHA 1GOAA 4XAKA 4DV1K 1KR4A 2JNJA 4KBIA 1QZ6A 2XI3A 1WUUA 5DZ7A 4GC6A 4YQWA 3JXOA 4EWTA 2QIFA 2ZWHA 5IOLA 2UXDJ 1HWJA 3V6HA 1DTQA 3W2WB 4XH4A 2GS8A 2HYIB 4FLUA 4U7CA 4W5NA 2OFHX 2XM3A 4O44B 1UEKA 4C8MA 1S59A 3GYXB 1BWVA 3ISND 4H5RA 2FQQB 5RUBA 3GE1A 3L4IA 5KFHA 2JLFA 1JNZB 1LFWA 3JTOA 1CJTA 3PR4A 3CO0P 1AT1B 4U7BA 2E1YA 1AXQA 1J5EJ 4KIAA 4P2SA 1NGEA 3PLAA 2G9OA 2QWQA 4H8KA 4YY3J 1RDCA 4PA1A 2DGSA 4G6VB 1NKBA 3M7VA 1XMBA 1SQGA 3BQ0A 3NH1A 3R3TA 2HS0A 3BGUA 1VSMA 1IBKF 2GX8A 1X5TA 1FRMA 1B9DA 4M63A 1HYVA 2QL9B 1H2UX 4DOZA 1FDNA 3LUYA 4YOEA 1OH7A 1WEYA 1LWFB 2IJNA 4ZVEA 1U04A 1APSA 3RMAA 1T3VA 1QAYA 3KXDA 2W4PA 3ONQA 2RDDA 2CGJA 1RNHA 1QJHA 2Z1IA 4C1NI 1IKYB 1KVIA 1NZAA 4JKGA 1RACB 3LP2A 3R7SB 2ZH5A 1GMUA 4P72A 3MM5B 1U48A 2KYZA 3P39A 2KM8C 5CAAA 4DUYF 4C3MA 3ELHA 4OYIA 3G8QA 4U67L 2PEBA 2MZJA 1VQ9S 1OSDA 1M5VC 5CR4A 3ZZ0A 3N5FA 2AGPA 2QE5A 4GV6A 3SQ2A 3DRSB 2XMKA 5GAEU 2ZWOA 2UZAA 3VN5A 5AFUA 1BO5O 3THXA 3J80U 2E2OA 1QAJA 2LDIA 4CFAA 3R9PA 1YBUA 3FLCO 2E5GA 4JI2K 2HIQA 1TKZA 4I2QB 4EGLA 1KQKA 4A2AA 4XO0A 3LGMA 3BSAA 3CD7A 1X5PA 5HL7Q 3SIPB 5LSRA 1FESA 2KU7A 1LK7A 2FC0A 4NLQA 3V2UC 1G2EA 4DR4K 4QWCA 4HUEA 4CLPA 2H65B 3AOAA 1YJWN 5L9NA 1NPRA 1EKSA 4OYMA 2P9NA 4KHUA 2DNMA 3OL9A 5BRDA 2CJ9A 4KR0B 2I2YA 1PJ6A 3E8OA 4E19A 5F8MA 1HQEA 5LMNJ 2XBPA 2EFGA 5IT9U 1IKWA 5T7BA 2UUAJ 5JS2A 3MFIA 1YI2S 1FD2A 3G71N 2QKKA 1S9GB 2B6AA 2GQQA 2UU9F 4QU7A 2BKOA 1OO0B 4I6MB 1X7VA 1M0SA 4LSLB 3DI6B 3CJ5A 1RBOB 2QO3A 4OFZA 1Y9OA 2V5HG 2FBYA 3N5BA 3VZHA 2ZC4A 3LDLA 3QBXA 4P10A 1HL6A 4U7UD 3JS6A 1V6HA 2BRLA 4FS1A 3OY9A 5C25B 3B54A 4K7QA 2HNDA 5HN0A 2RDIA 2R2UA 5IFMA 5KFJA 2BTFA 4H0XB 2W7OA 4DTJA 4JI3K 4FJIA 2Q66A 1SKRA 1VK8A 3ZNUA 4LF9J 4OV6A 1NJIO 2LXIA 4K4ZA 3ZNJ1 5EX5A 4CEAA 4JBCA 3C14A 4RO0A 3I0RA 2ZH7A 4IKFA 1LW0A 3HULA 4PG8A 1RFQA 3EE3A 2LLZA 3B4DA 4QIEA 1UAXA 4FM2A 2XNRA 3NOGA 4CGFA 3VALA 3OUYB 4UW2A 4MJKA 4DUZJ 3DOKA 3KD5E 5BRHA 1BY9A 6AT1B 3KD1E 4KH5A 3CYMA 4L3KA 1QE1B 5AQUA 4HDGA 5I3UA 1NUEA 4U96A 3ICLA 3CM5A 4DV2J 1W26A 1B64A 3MEGA 2VASA 3VETA 1J5OA 2LEAA 3MX2A 4JNEA 1FNMA 4XH5A 4DR6K 2C2RA 5J2NA 4QWBA 4XDDA 2EEYA 2QN6B 4FWNA 3P49B 3IMQJ 3HT0A 3VAMA 3OYCA 5CCLA 1TP7A 2B4VA 4FXWA 4KHSA 5KG0A 2DFEA 3NGDA 4Y28C 2I5JA 4CZCA 4Q43A 3CFRA 2IAJB 5K8OA 4ES1A 2HZVA 3NGZA 4CEOA 1JCEA 2NRWA 3VAHA 3PX6A 1E4FT 1KTQA 2BM1A 1R6VA 3P8BB 4CM0A 4DPXA 2F8HA 3W63A 2ZFHA 2ZZTA 1JLGA 2HZAA 2M9KA 3CMES 3FCVA 4NLUA 2Y1RI 3J7YU 3QQCD 4LF7F 4PXBA 2HMPA 2PMWA 3RB3A 2HRTA 1PKUA 2DNPA 5CH7B 5B0CA 2RQKA 3H2LA 4QYZK 2BE9B 2B8PA 1LOUA 3TVKA 1W25A 3WEEA 4O4GA 2GMJA 2CJKA 2HBJA 4UT4A 2PMZD 2VYPA 2B7CB 2B9WA 3CMAS 1W7WA 2PBDA 3ZTQA 1ZZFA 4DF4A 4KRFA 1WC5A 3ADAC 4IQMA 3AA9A 1NGAA 5HLFB 1SCJB 4J9OA 1VSJA 2VICA 1WHWA 1V3ZA 3L3UA 3GCXP 3D0GE 1XK8A 3UKRA 2KB2A 5B0EA 4JI0F 2BJ1A 1FJCA 2HG4A 2G8VA 1T6CA 1AROP 1FFGB 4B3OA 2OI2A 3KJQB 3BQ1A 5C24B 4DV1J 4BGAA 3KK3A 4ZA1A 2XS2A 2MLXA 4Q0BB 2VQFK 1Q9XA 2HBQB 2CNKB 3MAAA 2GVDA 3HSJA 4Z4EA 1Z25A 1TMJA 3PIOL 2N7CA 3GJQB 3NXZA 1ZA1B 2D3ZA 1FERA 3G82B 3CG7A 2Q1LA 4I68A 1A7GE 1PC5A 3FJ2A 3HDSA 2MEWA 1VC5A 4H0TB 3MUMP 3DRXA 5DGAA 1DURA 1HW9A 4J2EA 5H9FK 3H25A 2MLYA 3OYJA 5EWEA 4E7IA 2HHHK 4ZP6A 4DR7F 4J9KA 1CLFA 4ITSA 3BGRB 2AP6A 4OI1A 2YNIA 2J0SD 3IR6B 3O9QA 4CHQA 4FLWA 3DLKA 4CLWA 1VYAA 2ZBRA 3HZEA 1RWVB 5A0YA 4FP9A 3U1MA 3W8PA 3DKDA 1L3KA 4WYBA 2RRBA 3RBDA 3PJ9A 5KFSA 4MMOA 3LPYA 1IBLK 3I33A 4HT5A 1JB0C 4CLLA 3CCRN 3CIZA 1HNZF 4UOFA 1Q5YA 3WT0A 2WOMA 3CDUA 1J6ZA 2E1CA 3W62A 4DU3A 2VL1A 2B51A 2IRYA 1CJKB 1F2HA 3FZ2A 2Z58B 3Q7CA 1S1XA 1Q7LB 3HHKA 3GP9A 3NWGA 3QFPA 2BJ7A 3SUOA 5C10A 1JWWA 2R8KA 4Y2KA 2WBNA 2O8CA 5DJBA 2D4WA 1HBMA 3ATUA 4K0KF 4LBIA 4ZCMA 4C2MA 3EKSA 3TYTA 4OHXA 2GQ2A 1N33K 1FE4A 2R8GA 1V3SA 3I55S 4BVPA 5DM7L 4CJ4A 1RU1A 1XR5A 1JLEB 2RHSB 4OZLA 2C3MA 1XUPO 2HF3A 1K0TA 4ED7A 3UCZP 2NXUA 2R7VA 3C8YA 1EX4A 5DDRC 2GGPA 4DCJB 3ZTSA 4M7YA 1KLMA 3JQKA 4HTUA 4JI2J 1RAOA 5EUHA 2HW3A 4CZLA 1DGKN 3K5OA 1N34K 2AX0A 3C16A 3O6WA 1MWZA 3U3YA 3ZCMA 5BN8A 5KG4A 4QIGA 2RAQA 4DCOB 5DQIA 3IGNA 3D6TB 4AUKA 1Q8LA 4DR4J 1AYEA 2EWSA 3OV7A 5TKYA 3DGPA 1RI7A 5GAHU 2MZQA 3IAS9 2KM8B 4G1IA 2DVIA 4RUHA 1X4GA 1NU0A 3OR2A 2GJIA 4DV4F 1ZBTA 4BRGA 1LFPA 3A5OC 4B3SF 1YJ9S 3DDKA 4YP3A 4UQTA 4IH5A 3AY0A 7AT1B 3D3CJ 1WTFA 1RAGB 3M6GA 3NCIA 3MZIA 1TUGB 4RZRA 4ELTA 3J7Z5 5K8MA 3O9UA 2XZDB 3DOMA 1NWKA 4AD6A 3J81Y 4Q8FA 3BGFA 3CT9A 3N28A 3Q89A 5AR0A 1U7LA 1G4CA 3MM9B 1HNWF 3OHAA 4I6AA 1DZ5A 2ZM6K 3HKZD 3IKMA 4ECXA 2VH7A 3NOCA 3TO8A 4WYLA 3EN9A 2CGKA 1VQON 4JI3J 4G1QA 2VG6A 4WFBQ 4NYNA 3QMQA 1R3NA 3MR6A 1Z2LA 3V6JA 1VC0A 4DV7K 2VHGA 3CI5A 2E44A 1YRTA 5D0EA 5HROB 2P9LB 2YX6A 2HVDA 1MNEA 3T9NA 2ROGA 2OYQA 4PY5A 4B1YB 1JXBA 4DWIA 4USMA 4LY7A 1RT4B 4UF4A 2FJEB 1RXOB 2QLJB 2DCUB 1CJUB 2JEFA 3DLGA 3GIJA 2K1RB 4F4WA 4RW6A 3TTDA 5M1QA 2VPXB 4GRSA 4DR6J 3R8EA 2FHJA 4USJC 3K9KA 1WOQA 3UVJB 2XY8A 1OVYA 3AB4B 2YV0X 3RAXA 1Q79A 2R2SA 3HP6A 5D3GA 3NWRA 3LOUA 2FZKB 1TFWA 4BRKA 2G4BA 1AFJA 3T1YK 4PQUB 4UZBA 1TMMA 2OTJS 1RCOB 3CQYA 3M1VB 1K8KB 2F4VK 5KG2A 3NAHA 3UKUB 4JV5J 2CQCA 3ENAA 3EYZA 4DR2J 2CJXB 4F4XA 5A8RB 2Z1HA 3FKBA 4ECTA 2YQ1A 3OT9A 3HHLC 1IM4A 5CXTA 1L5UA 1GTHA 5IQ6A 4QBUA 5F0XA 4KHYA 1I39A 1UPMB 4C11B 3M2UB 4NO7A 3PW5A 2WBRA 4DX6A 1UP1A 2FBVA 1EKRA 4OI0A 3F44A 1SKSA 4JS4A 4O44A 4UY8O 2V2VA 2BBEA 3V9UA 1IBCB 3WXMB 4QYZJ 3F2KA 5HP1B 4NZ7A 2OUGA 4H0OA 1RGIA 3NCRA 3FRZA 4PKDB 4RU2A 5B08A 4UOHA 5HBMA 2M8HA 4I0WA 3AXMA 3H5SA 3NDKA 3RR8A 2Q0RA 3D1OA 4QR1A 4LH5A 4B17A 2OPSA 3JB9k 3BKUA 4IFVB 1HWIA 1CVJA 2FB0A 1MU2B 1Z26A 3KDOA 3CJ1A 3B78A 4F3OA 4JI4K 1LWFA 1GAOA 1NK5A 4W98A 4DUYK 1RKIA 3FSIA 3FDSA 5KFMA 3AA3A 5GADU 1FDDA 2VQFJ 3NKYA 1ASVA 2KT5A 1FVQA 3O6QA 1YVUA 1IKYA 4L75A 5LY3A 1HI1A 5GIOA 1IKVB 3TTFA 3G96A 3ETOA 2FVPA 1YDLA 2VPYB 4E7LA 3FBFA 3MM5A 1XN9A 4J2AA 1VQ5S 1VQKN 1IKXB 3D5MA 3OJUA 3OVAA 1D1UA 1XEZA 1NG9A 1O8BA 1CQNA 2P5OA 5LOQA 5KFEA 1U1QA 2ZJQQ 2LXFA 3TUPA 2O8DB 4Z4CA 1K8AO 1UCNA 5H9FJ 3I0SB 3M6WA 3DRSA 2HHHJ 2R2RA 2OCEA 3TUIC 2HQ3A 4OHWA 3CMQA 5IS2A 2CXEA 3LPUA 3C0BA 3HOSA 1F5AA 2CPEA 4CH1A 1RT2B 3ZT3A 2OSQA 3QIDA 1OYEA 3HSDA 1S0MA 4BRNA 2UU9K 4F26A 2BZ2A 3GR1A 4NLSA 2O01C 1YJRA 4DPUA 1IBLJ 4EBCA 1FFWB 2B56A 2X1FA 4X65F 3EUNA 3M8PB 2AJ2A 4PAAA 4NCAA 3PEHA 3AD7C 2R7WA 2AX1A 4DX7A 2C2MB 5C2DA 3KMQA 5CABA 5AQGA 3MF5A 3QGHA 4ZMMA 1HX1A 1QS4A 4CD1A 4ZPBA 2IVFB 1HKGA 1HQUA 3HF5A 2FC8A 1S9GA 4Y6IA 1HPMA 3CQ8A 2M4MA 3NVKA 3DI6A 1KP6A 3LM2A 3U7JA 4ANDA 1N33J 2W2NP 4JKFA 4OYAA 3A5LC 1YG0A 2CQ0A 2HFZA 5C25A 2OSRA 1QY7A 3UCGA 2DGOA 3BDEA 4CLYA 1NJYA 1CZAN 3UW1A 1ASUA 1NGCA 2Z57B 4K5RA 3THVA 4B1UB 4KFBA 1Q9YA 3CC7S 3G10A 4YN3B 1RTIB 3DRYA 3H98A 3TA0A 3VAKA 4JI7F 1N34J 2GFFA 3LDPA 4FWMA 1XIQA 2F3JA 3CEDA 2E2QA 4DV5J 3CHWA 2VWJA 3QRQA 1L3UA 1S0VA 3PV8A 4I64A 4MAKA 1TVRB 2RPIA 2KLAA 2P1JA 1VGYA 3R5AA 2DNYA 4OGCA 1QE1A 3V81A 1EETB 4NLDA 1YT3A 3QBWA 5ETMA 3NNCA 2D0PA 2QMXA 3ZTRA 2IYIA 2IGIA 5E2QA 2Q36A 2YHAA 2Z30B 1MWYA 3J81O 2YBVA 2HHTA 4KO0B 2OPQA 2IIHA 3GE9A 4QWEA 4ZLLA 1JLQB 1A5XA 3GDQA 2AGOA 3GIKA 2ZM6J 2GV9A 2CJQA 3ILJA 2GELA 1RAAB 3AODA 2CADA 1QM9A 1WJ9A 2FPHX 2IAJA 3HM8A 5JLFA 3F56A 3GFZA 4DR3J 3TQEA 4CZIA 4DV7J 1YKWA 1BD6A 3VQDA 2O4IA 4CE9A 3A3OB 1YLXA 3CPEA 4NCGA 2AZ3A 2NSCA 4Z7YA 2CNNB 3CD5A 4LR8A 1Q81T 2RRNA 2E5IA 3KLEB 2DNLA 1RUSA 3CD0A 2MQPA 5AQSA 3I32A 1F5BA 2A3JA 1ZTWA 3P4IA 3SLCA 1HYSA 5HRRA 1UETA 4BRDA 4PL8A 1YVNA 1A6LA 3CJ7A 5JICA 4ILHA 4NLRA 2GO9A 4Y2IA 1YBAA 3MAHA 4CESA 3CCSN 3VVTA 3HZ6A 1U6BA 2E4LA 3KHRA 2VONA 2UVVA 2LP4A 3DDNA 3QINA 4RTFD 1GLCG 4OKJA 5B0FA 1RGVA 2V9KA 2F4VJ 4I4BA 1N36F 1K44A 3MEDB 1VISA 2XWYA 2IM3A 5DG8A 2HS3A 1FDAA 1X9WA 1N88A 2P8IA 3AVLA 2LQBA 3VQ6A 2QJ3A 4ZVFA 2MJUA 4GMJB 1K0VA 4C0BA 1WB9A 2I1RA 3VWSA 3KKRA 3CDWA 3NS6A 2NRHA 2FBTA 3D0IE 2E1MC 4F3QA 3DLLQ 1DTTB 4BRFA 2B4UA 4AXIA 3J80Y 3TAGA 1ZM2A 3JAMU 3MOJB 4I9LA 1WI6A 4PHTX 2OFGX 1NGHA 4M7XA 1SJ4P 4CO1A 4PG6A 3ZETB 3M05A 3L4QA 4NLPA 3BGOP 4A8SA 1IBKJ 5C2GA 2POKA 4URSA 2W6KA 4I67A 4H5TA 2D69A 2P9PB 2YXLA 2KG1A 2VU5A 1CG2A 2G8FA 1UZHA 3TSUA 1ZM4A 3QESA 3E9LA 4KC5A 3O3GA 5IT9Y 4ZCIA 2NUHA 1HNZK 2GVZB 1HNXF 3BGRA 3UE5A 4RBVA 1RISA 3HHLB 4E2FB 2GJ2A 3GONA 4OX6A 3G0ZA 1XC9A 4BLGA 3AVBA 2MYFA 3W61A 4LF1A 1TAQA 3ZTOA 1TYQB 1ZPWX 4JI4J 2C3OA 1QSSA 2NR0A 4LR7A 3CCWA 4DUYJ 3MR7A 4Y3CA 3AGKA 2CPYA 3NVMA 1JK9B 4EEYA 4I6YA 3AARA 5ETOA 1T03B 3CTRA 4TY9A 3MWTA 1GX5A 4LVNP 4YUDA 4M42A 4PKGA 3E01B 1Q16B 4FK4A 1IM6A 5LMUK 2PSZA 4ANCA 2QLFB 4URQU 1YBTA 3NAIA 1R0AB 3LGNA 2QV6A 4GVBB 4UY8T 3W3SA 4NL5A 4C3KA 4ZCKA 3BBFA 5KOXA 5AQNA 4DL6A 1KVKA 1KKHA 3GOIA 2OHDA 3CFOA 5M2UA 1JLEA 1GLDG 2RSQA 1NCLA 3KHGA 4IFYA 4XIUA 2C28A 3VQBA 3GLJA 2IA6A 4ZPTR 3H4DA 1BIZA 2XNQA 2G8IA 1S4FA 2NXCA 4DV4K 5C42B 1D9AA 3D2FA 2UU9J 4B3SK 2J7UA 2J76E 2VWKA 3L09A 1S0NA 3KLFB 1CS4A 1PCAA 3L95X 4CHZA 2IIRA 5M2PA 1GLLO 2XMUA 4LF4F 3ENBA 2Y0SD 4KY3A 3C7NA 3B6OA 2IM0A 1HNWK 2YJFA 4KBOA 4MLEA 3TX0A 4BG9A 3ZSQA 2AYEA 4IR9A 1B9FA 2IBKA 1IV0A 1JLCA 2HHSA 3CCZA 3MN7A 1BUXA 3U9DA 4DQSA 5DS7A 3NHGA 1XC3A 1WORA 3QLHA 1CPZA 3T41A 5CHCB 1HI0P 4LSNB 3C15B 1ATSA 1S6UA 1VRTB 3M32B 1NO8A 4Q5VA 2CQBA 4O0JA 1Q95G 4OHZA 3PR5B 2DNOA 3ILLA 4AHUA 3MM9A 4HH1A 1NPKA 3EGVA 2YQ0A 4WPAA 3EXCX 3FBBA 2DNQA 1K8AT 2GHWA 4R5PB 1WC6A 2KH9A 3AVGA 3PDNA 3MCPA 4GKKF 3B6PA 1F3FA 5EU7A 1HNVB 5ETQA 3TA1A 5DLFA 1Y7PA 4B9QA 4NLWA 1RJJA 1E3MA 1NMDA 5F8LA 3BYPA 5HROA 2P9LA 4DFKA 2KKZA 2ZBCA 2X1AA 2OPPA 4ES3A 4M94A 2JDJA 2AQ4A 2ZOMA 1BIUA 5B0AA 2KRRA 5AQPA 3LWLA 5KFFA 2ERRA 1UEUA 1FI4A 4ED6A 1RT4A 2E9TA 4Z2XA 2D0CA 2ZWPA 2WTUA 4WFNQ 2HURA 1B7YB 1CJUA 4ECYA 1TAUA 2PFUA 2W7AA 3PIPQ 4ZHRB 5DDOC 4DTPA 4H5VA 2EXUA 1FXLA 3A1YG 1NK4A 3MCNA 3KK7A 2FVRA 4KTZA 5IZHA 1SQKA 4DTUA 4JV1A 1VQ4S 3UVJA 2XY5A 5KG6A 2BUPA 5AQRA 5BJRA 4AH9A 1VIOA 1TL1B 4LH4A 2XB2D 2OP5A 1W9HA 3HSCA 4OZ1A 2A10A 2VC1A 3MR3A 4PQUA 3CJCA 2YKNB 3UDEA 4TSXA 2WCXA 5KFOA 4CLSA 4CIEA 2W24A 2SXLA 1ZPVA 5A8RA 1ZTTA 4ZP9A 2EW9A 2IVYA 1B99A 1NGDA 3POTB 4FF4A 4DG1B 3DXBA 1YX2A 5HOOA 5JMVA 3D7SB 3O4QA 1S1VB 1SQFA 1S22A 3BO4A 3MTKA 4FLVA 2E1PA 2VFTA 1NGBA 4CIGA 1WG4A 1N48A 4JI0J 3DYAB 3V9ZA 2XCPA 4MIBA 3L7OA 2DIVA 2XSFA 1WSJA 2LCWA 4NLVA 3NS5A 3MMAB 8ATCB 4J2DA 2ZKUA 4J9VA 2FZGB 1RYRA 3VHQA 2X6NA 3OPKA 3QBCA 4FXVA 2IRXA 3CJ4A 2XWXA 5J1PA 2V2QA 3A8IA 5GAGI 2ACYA 3PHEA 1TFYA 5KT2A 3RTVA 3ETMA 3CJKB 1FXDA 3CD6S 1MU2A 3MPUB 3FK4A 3H6EA 1NMEB 1S5ZA 4IJNA 3Q8UA 2DH8A 2GQCA 3T69A 3M9NB 1UFKA 3WXIA 4FZXC 4FKYA 3D6HB 4B1ZA 3FQLA 1WD6A 2GJFA 5DDPC 1BDGA 2KJVA 1Y64A 1TK8A 3J80O 3TI0A 2HF4A 5ETNA 5DETA 1IKVA 4ZTFA 1HYZA 1IQTA 4DR7J 1QAIA 1LAVA 2I8EA 4M5HA 3VQ8A 3D0HE 2VQEF 2V2KA 1HR0F 4KH4A 3PVXA 3W65A 1MMDA 3PX0A 1HW8A 5M1OA 1RA6A 1NK9A 2AWZA 3SI8A 2J8SA 3GV7B 3HJFA 3MPVA 3L2RA 4DMNA 2ZBIA 3QT8A 2FY8A 3SMPA 2O8DA 2Y9HA 5IT9O 2HHPA 3U4LA 4HDHA 2RKIA 3I0SA 3R2CJ 1HNZJ 4X65K 2CPXA 1XMOF 5CYQA 2VOPA 3DLJA 1IG9A 2YKMB 2VFRA 3ZX2A 4EBDA 4M5NA 3U6FA 3AGRA 5JVHQ 1X4HA 3SQ0A 3P83D 4DQPA 1C0MA 4Y2CA 4BGBA 3MM7B 3I31A 2E7VA 4FW1A 3IS9B 1Y3KA 4DUTA 3J7ZO 4WZMA 1HMVB 4KGVB 3VPZA 2IMWP 2P9KA 1VIXA 5BYSA 5A76A 4ZCLA 4CF8A 1U1NA 1HBNB 3G8SA 3EGWB 3TOQA 5AFUH 3QO9B 1UKUA 3V6DB 3H5UA 2W41A 1YRUA 1S72N 2ZOFA 4E1NA 1KFSA 3HO1A 5LMUJ 4IRDA 5D77A 3HVTA 3CMEN 1YHQN 3MDFA 2VZ9A 4YNQA 4MT1A 4OKKA 1O6XA 1NPPA 4K50A 1YZ7A 2IM1A 4ID8A 4EYHB 4B3MF 5LJ3Y 4NEZA 1I6JA 2OIHA 4OLBA 2NREA 1NNEA 4PZVA 4BDYA 3CMAN 1YTAA 5F41A 1EARA 4DV4J 2W9AA 1TKXB 1NB2A 5CY4A 4ZVPB 4B3SJ 2GZOA 4ZVGA 1YJTA 4P7VA 3M6VA 2IVNA 1N54B 1K9MO 1WAFA 3C66A 1TVRA 3FC9A 2QWNA 1U26A 1WHXA 1R8BA 1Q82O 1PG5B 1S1UB 2OLWA 4NA1A 1HNWJ 2LSNA 3HL8A 5K8PA 2FGCA 1EETA 3WQTA 4FYYB 3MCSA 2HK2A 1IWAA 4FJHA 3KK2B 2E1AA 1ZETA 3VEXA 3AFGA 3I4PA 2ETJA 4KKOB 2CZ9A 1U6FA 3GV5B 5KFDA 1FJ7A 3MXIA 5EWFA 3KLIA 3H1QA 4YOWA 4KO0A 5HRSA 2V8HA 4FK2A 2QYCA 2L9WA 3SQGB 2V34A 4CECA 4H0YB 1S7HA 2QWLA 1JLQA 4A5BA 4RW4B 2M8DB 1E6YA 4IOBA 4C8YA 3VEVA 2VPWB 2BABA 2H3EB 1QVGR 2DY1A 1NDLA 1S1WB 3THPA 4KGMA 3BP8A 2EK1A 1S6OA 2DNHA 3BSNA 3SPYA 1QUPA 1R59O 3AVJA 5E26A 1E6VB 3SBMA 2W6LA 5KFBA 3L6QA 4KREA 1KRPA 4PWDB 2RD5C 1ZBFA 5AXLA 2ILYA 3KLEA 3ILIA 5C0YA 2QKBA 1OH5A 2BM0A 4L6V3 4HWIA 3W64A 2HGMA 3AAPA 3K7RA 1DT9A 1QSLA 2EK6A 1JNRB 2W01A 3Q83A 1N36K 1RBRA 4H4MB 2MQQA 2UUBF 4IUFA 5AQFA 4RL1A 2AYMA 3CJ8A 4JV2A 2UXBK 2XHBA 2OD4A 2ZZNA 2D1CA 4PL7A 3I8BA 1WELA 2NYHA 2ZD1A 2U2FA 3TAQA 1WHVA 4DXLA 3IP0A 2XLIA 2V9WA 4ZKAA 3MEDA 5KFPA 1PC4A 1ROFA 4TNOA 1IBMF 2JC1A 3EZOA 5BYRA 1Q8IA 3VCDA 4TKTA 1RBSA 1FFSB 1KC8O 1YZ6A 1DQ8A 1VSHA 3QATA 2ZJPL 4B9TA 2W2OP 4O3PA 3ENOA 3W3DA 1T94A 4A8QA 1HNXK 3O1BA 1X8DA 2G0JA 3VF6A 4OHYA 2YWWA 3ZETA 4LQ3A 2W9CB 3U27A 4JP8A 3PRBA 1LOTB 3CCQS 1VQLS 4Q8EA 2XMWA 2WB4A 3V1OA 1X5OA 2P9PA 1D5AA 3MN9A 1LNQA 4X4QA 1UW4A 3ZXWA 4K42A 3KK1A 1REVB 3R1XA 3J81j 2XY6A 3FMBA 2MKIA 2AF6A 3RBZA 1BWEA 3C95A 3DXMB 3SXLA 1Q78A 3HHLA 5B8HA 3SV3A 1JJCB 1TL3B 3WQUA 2L08A 3OYAA 4KHMA 1TYQA 2MXYA 3NF9A 5GVQA 1B0TA 2YNHB 4PR6A 2KN4A 2L9NA 3DLBA 1LWCA 3VF4A 3OYLA 1GQEA 3W2VB 2MKHA 4IDKA 1KDNA 1HD0A 3CCUN 2H54B 2DPIA 4BHQA 3PHTA 2P5GA 2XI2A 2LXUA 2N7YA 1KQSR 4NYPA 2CIMA 3BBBA 2H5EA 4CO5A 1RAHB 4K2XA 3MUTP 3E01A 1RB0A 2XO7A 3N6NA 2VIHA 3PW2A 3RR7A 4HCBA 4QCLA 1QQOA 2KZMA 4JKEA 3MMCA 1HNIB 3EDRB 4GVBA 2E2PA 3M8QB 1I5OB 2IVMA 3TSPA 3CDEA 3TTCA 2P6TA 2RQMA 4K4VA 5C7PA 2IDEA 4X65J 4CZGA 4P73A 3FZLA 1U2VA 1HHSA 3PKMA 4N56A 3LP1B 2YKAA 1WBDA 2Y0BB 4GW6A 4FJXA 3D66A 3ENVA 4PEOA 3NF8A 1OY6A 4OJGA 2BRKA 2ABYA 2M3DA 5C42A 2E9ZA 1P1TA 1S1TB 4ILJA 4K8RA 4IG0A 2FXUA 4Q2LA 3THTA 1UJ4A 1RILA 3AAQA 3SAFA 2LA4A 4ZLPA 2XMTA 3SV4A 1RDUA 4RWTA 1ICEB 3L2WA 1PO6A 1S9EB 1FJGF 1UMJA 3OYDA 3HI0A 1RE1B 3DWLA 2F8TA 4TLRA 3NNAA 4CFBA 2V6AA 3WDOA 1U0HB 3JYTA 1WOSA 1XR6A 1SZ2A 1SQEA 5KFTA 3UI3A 1UZDA 4QS9A 3QYYA 3EY1A 3G6VA 3FGUA 4YMEA 3IXQA 4JI1K 1Y4ZB 5KFGA 1VQNS 3TNVA 4JI7J 3VMFB 3E9PA 2E5LK 4JK7A 4YEAA 4G3IA 3UDCA 4FPAA 3C15A 4HEA9 1R6YA 3OYIA 1U1OA 1VRTA 4OX9F 5EY4A 2NCKL 4WIIA 2V4RA 3QFHA 4RR5A 4IG3B 1WNEA 5JVGQ 4BRHA 4DR1K 4RW9B 2JLGA 1RBTA 2M88A 2UXCF 4N7TA 2EFPA 1R7IA 4KAIA 4FJJA 1HNVA 2I9SA 5L1LA 2E29A 1WEXA 1RT7A 3AVCA 1K6YA 1CC7A 3EDQB 1YJ7A 5IWAF 2AT1B 3L2QA 3HVRA 1ZM3A 4V1Ak 3J7ZT 4DSJA 2A42A 1SB6A 5C15A 4E7HA 5LXYA 5KFRA 3CJAA 4E89A 2DR9A 3VVUA 4CCHA 3RRHA 1CZ9A 4LF5F 2XS5A 4Z0UA 4JUZA 1KVAA 4KPYA 1NDPA 1U6ZA 2MPUA 3GFYA 1T02A 1ZXOA 4CGIA 5F2RA 2YHYA 4MFBA 2QEXN 4WK3A 5HK4A 3BBCA 5ADZA 3J7AP 3JAMY 1LK5A 2PC6A 3BN7A 1TL1A 1S4EA 3ENQA 1VQ5N 3GILA 4LT6A 3ZTPA 3F9KA 3C6UB 3A5MC 2YKNA 2IMOA 4BRCA 1Z4UA 2QYGA 4LBHA 1AZSB 1FX2A 2HFVA 5H9EK 4M5MA 3D0PA 2JHEA 3L7UA 2HVEA 4Y2MA 3KMSA 1FWKA 4DQIA 4CO4A 4X62F 4FYXB 3C46A 5ELZA 4CTAA 6FD1A 1ATNA 1V4SA 1MROB 2IM2A 5D8HB 3T1HK 3WIVA 3BEGB 4CI0B 1S1VA 2DY4A 2PDAA 2DJWA 2V8VA 2GCFA 4BR2A 5AQKA 4FWQA 3OLBA 4OLOA 1PJ7A 3LZIA 2D3UA 1VHIA 5DM6Q 1OS5A 4TXSA 2F65A 3UB5A 3BO3A 1S76D 3S3NA 3DYAA 2DPNA 3RJMB 1N36J 5KPTA 1YGYA 1Q82T 5J2PB 1RHMB 4J9MA 3M8SA 4ELVA 2ZJRL 3QETA 2EX3A 2WC9A 2FJVA 1BHNA 3IFRA 1H73A 3R6MA 5B0GA 2UXBJ 4ED4A 2PI5A 3TP2A 4X4VA 2MQLA 4IOCQ 2P9CA 2O66A 1VQPS 3CJKA 2DRBA 1ACMB 4EU0A 3V1QA 4XH1A 1ILYA 1H1VA 1IJJA 1CC8A 3FR0A 1HR0K 1F5CA 3THYB 2M0GB 1IN0A 3WX4A 4HL9A 1LWEB 2C2DA 3O9RA 1M5PC 3MXHP 2ITMA 1KONA 3B4MA 1SJRA 1X1PA 2P2CB 3M1FA 4HTLA 1KQSM 3AO5A 1JJ2R 2AGQA 3SDEA 2P6SA 1XMOK 1HNXJ 1FRXA 2D5RA 2OEKA 3TZYA 3TJ9A 1OWXA 4F2SA 1VFJA 3NNHA 3K0SA 2PFDA 2BE2B 5FDLA 1GLFO 4B9VA 4RX6A 2IOCA 3E66A 3VR1A 1WC0A 5J2MA 3IG1B 2CPIA 4DTRA 1BMQB 3KFWX 2F8SA 2YKMA 2X3DA 2CPHA 1HWLA 2CKWA 4K4TA 4AQYF 3DMJA 1H2TZ 3U9ZA 1F6TA 3F73A 2BJ3A 3V6KA 3NL0A 3GBTA 3MM7A 4ZN1A 5KAKA 3IS9A 1MMLA 5HVFA 3W5YA 5D0HA 1HMVA 4PYDA 5KG3A 4YY3K 3ZSYA 1UWBA 2Z2ZA 1XJWB 2XMAA 2AA4A 1FHTA 2Q79A 4M3XA 2KDOA 2RE1A 1HBNA 4ECRA 3R9LA 4KT0C 4B3MK 2XTJP 4FJ8A 3V6DA 5BR8F 2Y8WA 4RG8A 3PZPA 4FYWB 4C8LA 4CLTA 2VGNA 1X4CA 3H0PA 4A8OA 4GO5X 3HD2A 4HUGA 3SZ2A 4KH1B 4NI2B 1FE0A 4ZVOB 4CZJA 1LWXA 3JQMA 3C6TA 4Q45A 1X4EA 4CJSA 2JEIA 3LA0A 4I1TA 2AJFE 3KDNA 4O0NA 4ZPCA 3QSIA 3ISNC 5T7LB 2VKRA 1FCAA 3LO3A 3WXLA 4WP8A 4USKA 2YHXA 4F0KA 4DSKA 4OHVA 4EI2A 4ED1A 1PILA 3HHEA 3UE2A 4DU8A 4I7FB 3FFIA 1DAXA