1T05A

Hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
molecule keywords oligonucleotide template
total genus 138
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t05A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t05A05
2C2EA 5DLGA 3GV5B 2ZE2A 4MK9A 2E9TA 3BREA 2D0BA 2R8JA 5K14B 1C0UA 3HJFA 1ZTWA 2WCXA 3N6MA 4DF4A 3V6JA 3SQ4A 4NLVA 3QEPA 3WNHA 1HNVA 1XHXA 5J2MB 3KJVB 1LWCA 4FJKA 1L3SA 4M42A 4CEAA 4NLTA 1N6QB 3P5JA 5KG7A 4JV2A 4RZRA 2HVHA 3G0ZA 3OLBA 4ED0A 3HXMA 1T03B 2YNGA 3NF8A 4WZQA 3PY8A 1RYRA 3DI6B 4YQWA 1IO2A 4B9TA 3TQ1A 5CYQA 2OPSB 4E7JA 2D3ZA 1RT2B 3LDSA 3ULDA 4NYFA 3G6VA 3UR0A 3LALA 5HBMB 2FVPA 1RT4B 4HYKA 1DLOB 4LH5A 2ALZA 1DTQA 4F2RA 4Y34A 3AA3A 2X74A 4CF8A 4KHNA 4B9NA 3I5CA 1HJRA 2BANA 4QWBA 4KHRA 4FJJA 1JLFA 2VG7B 4O4GB 3U3GA 3GIIA 4K8ZA 3ALYA 1XR7A 3F9KA 3KTQA 5T7BA 4NZ0A 4AHRA 1MU2A 5KFAA 4WXOA 3HP9A 4BACA 1BIZA 5J1EA 1RTJB 3BJYA 3PV8A 5HLFB 3SCXA 4FLVA 3RAXA 4O44B 3RBEA 3HPHA 3NGIA 4G3IA 3G6XA 4DFKA 4K4ZA 3GIMA 3IGNA 2FBYA 4I2PA 1UOCA 4C8LA 4ELTA 3SPZA 2BE2A 4M3RA 3ZSRA 3M8SA 1QSSA 2W42A 3MAQA 1C1BA 4FM2A 3C6TA 1LWFB 4EYHB 4B3OB 2HHUA 1UWBA 4Y2AA 4HHTA 3PZPA 5HRSA 4YMEA 3N6NA 1RTJA 1XC9A 4M3WA 3FRZA 4CF1A 4R8UA 3QO9B 4FS2A 1K6YA 2W7PA 2AJQA 3TAMA 1N56A 2P5GA 4DTSA 1LWEB 1HNVB 3WNGA 5KFVA 3K5MA 4H4OA 4ZPBA 1D0EA 1NJXA 3OYLA 3VQBA 3H59A 4QW8A 4LSNB 3DMJA 1JKHA 5C25A 5DQGA 1WSJA 4M3UA 1J5OA 5JUMA 4CERA 2BGGA 1S97A 4O3QA 4OL8A 2YNHB 4ECSA 2YNGB 4CGDA 3OYNA 1VRTB 2D5RA 4ID5A 1KVBA 3NFAA 4E7LA 3VQ6A 1QSLA 4OKEA 3LP2A 4RW6B 2O5DA 2O4GA 5KT3A 3GQCA 3RB4A 3UDLA 4B9MA 4KPYA 3D5MA 1WSIA 1RTDA 3RRHA 3OYBA 2OPQB 3AVBA 4OKKA 4O3NA 3HHKA 1KLNA 4WE1A 2HNDB 4CEDA 5EWGA 3MXJA 2C2RA 4EP4A 4J2BA 3ICLA 2OPPA 4JLHA 3NGZA 3G6YA 3QINA 3JYTB 1LV5A 1KFSA 2P1JA 2ILYA 1NNDA 3ZSYA 3PX4A 3KK3A 4ED6A 3MECA 2P5OA 1N5YA 1X9MA 4AHCA 3LP2B 3H4DA 4DL2A 5L1LA 3V81A 3T5KA 3IN5A 4LH4A 1HYSB 5KFYA 1SKSA 3VQAA 1TKZA 2GC8A 1D8YA 4DG1B 4QWCA 3OYHA 4TLRA 1IKWB 3BQ2A 3AO4A 1KVAA 3IRXA 4HTUA 4ED7A 3C6UA 3CDEA 1JLBA 2BRLA 3OSPA 5KG3A 3DLHA 3M9OB 3GV7B 3D45A 4IFVB 4YR0A 3QEWA 3ZSVA 2W9AA 4FJ9A 4K4UA 1TP7A 4DU3A 4O4RA 3TAMB 4IRCA 3TAPA 1XHZA 2AQ4A 4N5SA 1SV5A 3MEGB 1XR6A 3S3OA 2C22A 4CGIA 1TL1B 3DDKA 3L2QA 3SQ1A 1ZYQA 3C94A 2YHAA 5EUHA 1QQCA 3DMJB 2DFEA 3EPGA 3ZSQA 4K4TA 1EX4A 5DGBA 5J2PA 3PUFA 3TAQA 1RT5A 3KK2B 2WB4A 3NH1A 5KFHA 3AVJA 3OYAA 4KB1A 3H4BA 5C42B 5HROB 1QAJA 4EBDA 3QIDA 1GOAA 1KVCA 1I6JA 4RW6A 4FLYA 5L9XA 5D3GB 3RMDA 3QIPA 1HARA 2XY7A 5KRSA 1DTTB 4O3OA 4QWEA 4N47A 1LWCB 4NLPA 4ZPAA 2AX1A 2XI3A 1NJYA 4WE1B 4CF0A 4KHSA 1SL0A 1LW2B 4ECTA 1RNHA 3CJ4A 5J2PB 3T19A 2ZQBA 3H2LA 1RT5B 5L1KA 4J2DA 1U49A 2V4QA 1S49A 3DRSB 1JL2A 4CHZA 1S9EA 1WNSA 3OS2A 2BRKA 2R8HA 4DFJA 5HROA 3ITHA 4PWDB 5I3UA 4DSIA 1QAIA 3QO9A 4ED3A 4M45A 3K2PA 5J2NB 2XY5A 4F4KA 1JLGB 3SV4A 4NCGB 1DTTA 1FXXA 2FJXA 5F8MA 2W9BA 4CJTA 1RT3B 2GBZA 3HVTA 5SZTA 2IC3B 1JLFB 2VG7A 4FJHA 5KFZA 1C1CB 3LAMA 2XRIA 2RDIA 2B6AB 1SH3A 1C1AA 3KKRA 4EEYA 4ZP8A 3SUNA 2FLPA 3TANA 2VG5A 2IM2A 1N48A 1NKBA 4RUCA 2IDOA 3BQ1A 3DLKA 3FDSA 4BDYA 3I0RB 2IJNA 1JLGA 3PO4A 3DRPA 3NMAA 3MEGA 2D3UA 5KG2A 1TL1A 3M9NB 2HHVA 2R2UA 5DGAA 2HNDA 3K5OA 3HVWA 4X2BA 4DTUA 3H40A 2OPPB 5KFXA 2IM0A 3KLVA 3LAKA 3GV8B 1W25A 1VSDA 5DQIA 1I39A 4ZHRA 2FLLA 2EC0A 3DLGB 5I42A 4CE9A 1S0NA 3H98A 1IKXA 3MEEA 4ECXA 2F96A 5L1IA 1S10A 3TVKA 3KLFA 3M9MB 3OJUA 3RAQA 3OHBA 1U48A 4FK0A 4FLXA 5L1JA 5EWEA 2JGUA 3O3GA 5C25B 2JEGA 1J5OB 4FCYA 4DSFA 2V4RA 2WHOA 2FJWA 3TABA 4NLXA 2JC1A 1EETA 3KD5E 4M3YA 3PW5A 1RDDA 2A1SA 1JXLA 3DLGA 5I42B 2FBVA 4BWJA 4U7CA 3SFGA 3PR4A 4PA1A 3KLFB 3NHGA 2QK9A 1WAJA 4NLGA 2RF2B 3L2RA 3BDPA 4I7FB 4EBCA 3OYGA 3MTKA 2E9RX 4EZ9A 4DS5A 2OYQA 5F8LA 3AVGA 4C8NA 3AVLA 2B5JB 4QOZB 4IH5A 4TY9A 2QXFA 1Y97A 3WNFA 1IKVA 3KHRA 3L8BA 4CF9A 3V6DA 1C6VA 4PUOB 4NLDA 3MFHA 1TKZB 2B4JA 3M8PB 1S0OA 3V4IA 1TL3A 4CHNA 1IKWA 2V9WA 3EY1A 3EZ5A 4KSEB 4ZP7A 4CIGA 4KO0B 4BDPA 4KKOA 2PY5A 4RW4A 4NYZA 4MKAA 3B6OA 4CF2A 3QYYA 3JSMA 4J9RA 4GVMA 5KRTA 1TAQA 4FJNA 4CJRA 3B6PA 4CK3A 4KI4A 1T05B 3AV9A 3PW2A 2D0AA 4YR3A 4IQXA 3TR8A 3GIKA 2JEFA 1JXEA 4CGGA 5DG9A 3H5YA 1Q9XA 4URSA 4NCGA 1TKXB 5DG7A 4TYBA 3MEEB 4AHVA 1XR5A 4K50A 3HVTB 3T5JA 4FLTA 3OYCA 1RDRA 4QAGA 2IGIA 1CLQA 1ZBUA 4URGA 4ZVFA 3S9HA 3QEIA 4DTPA 4CJPA 4J2AA 4CGJA 3VQSA 4KE5A 3AA5X 1TGOA 4KAZA 1S6QA 4PQUB 2X6SA 4IOBA 3CJ5A 4O55A 4IR9A 3OL9A 3TWHA 1S1WA 1WAFA 1L5UA 1NKCA 2AGQA 4Q45A 3NAIA 1RT1B 1SH0A 1TV6A 3V9XA 4NRTA 4M3TA 4B8AB 1CXQA 3AVHA 1FKPB 1TKDA 4I7FA 1YTAA 5KG4A 4FJIA 5KFBA 1LW2A 3VQ4A 3RMAA 1I3AA 3M8RA 4R0EA 4F50A 3KJVA 3CJ2A 1Q9YA 3LP3A 1RA7A 2HAIA 2JEIA 4DSEA 3ISNC 1N6QA 3RRGA 3HK2A 3DOKA 2KFZA 2XC9A 4OJRA 3M8QA 1VSIA 3KK1A 1JLCB 1VK0A 4F4YA 4ICLB 4ZHRB 2I1RA 4AILC 4IG0A 4JS4A 1RT1A 4J9LA 4W5QA 1S9FA 1JLQA 1RBTA 2VG6A 1VSEA 4PY5A 1S1UA 2IBKA 4N56A 2J6UA 2G8WA 4KRFA 3TARA 4ZTJA 3KLEA 3Q8SB 4RW8A 4JV0A 4KO0A 3QZ8A 3UIQA 4KKOB 4KV8A 4Q8EA 3RMBA 2FVQA 1RBUA 1HMVB 2KZMA 1QS4A 3NF7A 3U3YA 4DSKA 4Z4FA 1ZETA 3P1GA 2PYJA 1T05A 1L3VA 1B9FA 4E3SA 1QUVA 1XWLA 2WTFA 2G8KA 4Z0UA 1JLQB 5K14A 4I9LA 2UUWA 4CIFA 4DL3A 2HNYB 3PHEA 3PW7A 4FBTA 4IH7A 3H5XA 4HUGA 1VSMA 2W9CB 4DTXA 4RUAA 2D41A 1S4FA 1REVB 4YP3A 4MFBA 5FDLA 5HRPA 3VQCA 5KFRA 1RT7A 5EU7A 2R2SA 1QHTA 5F8HA 3DI6A 2QKBA 4NLQA 2OPSA 3V9SA 1BISA 3KLIA 1WSFA 3CWJA 4FZYA 2W7OA 2R8KA 4OGCA 1CZBA 1S1TB 4Y1DA 4E89A 3SJJA 4B9LA 2FJVA 5CZ2A 3KOAA 1JX4A 4RW4B 4CJEA 3CQ8A 4IKFA 1HRHA 1B92A 4B9SA 2ASDA 2OPRA 4LSNA 3E01B 4IG3A 4MKBA 4CFBA 4B08A 3CJ0A 1S1XA 2QKKA 3H5UA 2IJFA 3PW0A 1VRTA 4EP5A 2G8VA 4DSLA 2QV6A 1TKXA 3EZUA 4CHOA 1WSGA 3SV3A 1R0AB 1C0UB 1BHLA 4TYAA 4RNHA 4TY8B 3L3UA 5CZ1A 2RF2A 3KHGA 1RT6A 2C2DA 1O1WA 3ZT4A 4E7HA 4DTOA 2OPRB 3PX6A 4DL7A 4IG3B 3NH2A 1S6QB 1FK9A 1C1BB 2WRMA 1U4BA 3FQKA 3PR5B 2VA3A 5E41A 3VA0A 3OY9A 4ZP9A 1KRPA 2DPIA 3DYAA 4CEOA 1QTMA 1EP4A 2Q3SA 1K1SA 4CFAA 3NE6A 4TY8A 1FKPA 3MR2A 4KREA 4WXWA 2YNIB 4YR2A 4W5RA 4DLGA 4FLZA 2R2RA 4ID1A 5KFWA 2G8HA 2ITGA 5KFKA 4W5TA 3FFIB 4DU4A 4Q43A 4J9SA 1F21A 1KCFA 4DFMA 3NBPA 1BQMB 4DL5A 1FK9B 5KI6A 1LAVA 1JXBA 4Y1CA 3MXMA 3NAHA 4Y2CA 3DYAB 4O5BA 1EP4B 3RBDA 2HHXA 4H4MA 3O4QA 2P51A 4GW6A 4FJ5A 2XO7A 4OLAA 2A1RA 3KLEB 3DLRA 2Y1IA 1ASVA 3ZT0A 3SI6A 4CESA 1SV5B 1ZBHA 4TQSA 3HVRA 4B9VA 4FVMA 1HQEA 4CFDA 4FZZA 4Z4EA 4CEBA 1VRUB 4R5PB 4E19A 1SUQA 1LWFA 1T03A 3IAYA 1S1WB 2O4IA 2YKNB 1CSJA 5KFGA 5DMRA 2R2TA 2UVRA 1NJWA 2E4LA 1RBRA 3NGYA 1J9AA 4HKQA 4QCLA 4I9QA 3RB6A 1W9HA 1DLOA 4E1MA 2KQ2A 1QE1A 1NK0A 1ZBLA 3DRRA 4O3SA 4DFPA 3MR6A 4H4OB 3HPGA 4ECQA 4IKAA 2DFFA 3AA4A 4DQPA 4O0JA 3NCIA 1NOYA 1RCHA 3AO5A 3AVIA 1X9WA 2LSNA 2YNHA 2ILZA 4TXSA 1IG9A 5F8NA 1XI1A 3OL6A 1VSKA 3ITHB 4KB7A 4NLOA 4J9QA 3THVA 4FJ8A 3RR7A 4FYDA 4URQU 4DQSA 4BE2A 4FLUA 3AVCA 5KT5A 4CJKA 3G10A 4Z4GA 4CK2A 2Y1JA 1S0MA 3NGDA 4WZMA 2GIRA 2F8TA 3L3VA 1U47A 1U45A 2FVSA 4FBUA 2AX0A 1C1CA 4IFYA 2G8IA 4J9KA 5C24A 2AGPA 2JEJA 1KLMB 4HCCA 3UPFA 4KTWA 3QETA 3QNOA 1SL2A 4KFBB 4M41A 3OJSA 1R0AA 4B8CA 1RDBA 3S3NA 5KFIA 3SUOA 4CGHA 5D3GA 2XGQA 2J6SA 1YVUA 4CEFA 1K1QA 4GMJB 1GOBA 4XPCA 4ECVA 5CYMA 2I5JB 5CY4A 4ED1A 1VRUA 4R5PA 4FM1A 1NK7A 5C24B 3DRSA 3AVFA 3FQLA 1TQLA 4F2SA 4MIAA 2ZD1A 1JL1A 3DLEA 2VWKA 4U6PA 4CIEA 4KFBA 5F8IA 4FJXA 4HUEA 3KHLA 3RWUA 2YKMB 4IDKA 2ZKUA 2Z1IA 3KNAA 1HYVA 3DRRB 5J2MA 2XI2A 1HQUA 3N6LA 5KFSA 2AGOA 2BE2B 1ASUA 3OHAA 1Z25A 1KHWA 4J9MA 3OSNA 1KSPA 3C6TB 1S1XB 4NLSA 3L2UA 1UWBB 2HMIB 3KLHB 3MECB 3CVKA 3ZSXA 4FM0A 5C42A 1TK8A 3LWMA 4N41A 3I5AA 3KHHA 3SUPA 3MXIA 3DOLB 2BR0A 4FZXC 4Q8FA 1RT4A 2YKMA 5KFEA 4FLWA 3FSIA 3OYJA 3I0RA 3NF6A 1RT6B 4KHUA 1CXUA 4EYIB 1HQEB 1RDAA 2HNZB 3BGRB 2FVRA 2BQUA 2Z1HA 4QPXA 4AH9A 1VSJA 1ITGA 1MMLA 4OPKA 4FW1A 1X1PA 1SKWA 2VA2A 1SUQB 2E9ZA 4K4VA 4OKJA 1GX6A 4FJLA 1MU2B 2D7SA 5KT6A 4Z4HA 4E0DA 2NUBA 2DTUA 2HB5A 2B5JA 4I2QB 5J1EB 3VQEA 4RW9B 4O44A 4Q44A 1G15A 4MK7A 3V6DB 5J2NA 5F8GA 2XGPA 3KMSA 1D5AA 3QLHA 2XCPA 3M8PA 4IR1A 4I2PB 1S5JA 2GV9A 4AHUA 3DLBA 2XHBA 1RTDB 2IAJB 3H08A 4ZTFA 4KHYA 2OPQA 3FFIA 4M3ZA 1RT3A 4JRPA 4W5OA 1BQMA 4DQQA 4CFCA 4DTJA 3TAFA 3HL8A 1TK5A 3AVKA 4Y3CA 3ISND 2F8SA 4FW2A 4H4MB 4DTNA 4G1QB 1NHUA 2G8UA 3DLKB 5JXSA 4M95A 4ELVA 1DTQB 1S6PB 3KLGB 4DG1A 4ZMMA 4E1NA 1BCMA 3MF5A 5DG8A 3C95A 3IG1A 2R8GA 3KKSA 4H54A 2EX3A 1KTQA 4O4GA 1SH2A 1JLBB 4F8RA 4MH8A 1KLMA 4RNFA 4IFVA 5KG5A 2C28A 3I5BA 3KLHA 4RNNA 2ZE2B 4EO6A 3NF9A 3D28A 4ELUA 5I3UB 1LAWA 3VQPA 4NRUA 4GC6A 3LWLA 5FRMA 2IM1A 2E6MA 3RR8A 5DK5A 1S6PA 3KLGA 4CHYA 3Q8PB 4F3OA 1NOZA 4WFZA 4NLRA 4KB0A 2AWZA 5F9NA 3G86A 2IC3A 2ASLA 5CYMB 3IGVA 3QZ7A 2B6AA 3K59A 4N76A 2V0NA 4B3OA 3HPOA 1BI4B 3KK3B 2G8FA 3LPTA 2ZD1B 1T3NA 4I2QA 1IH7A 3QIOA 1WN7A 1BIUA 1SL1A 4DL4A 2HHSA 4RW9A 1NK9A 3SZ2A 3V81B 4O0IA 4RU9A 3HKWA 4JV1A 5KFNA 1NK8A 1TAUA 4C8KA 1LWEA 5KG0A 3V9ZA 1T7PA 4DL6A 4YFUA 4CCHA 3D0PA 1RTIB 4TN2A 1JKHB 3T3FA 4RNMA 1UAXA 3O3FA 1S9EB 3QGHA 3GYNA 4CJLA 2Z1JA 2WONB 2J6TA 5JS2A 5HRRA 3CM5A 4ID5B 3AA2A 5HLFA 5KG1A 2BQ3A 3HSTB 2UVWA 4MK8A 3BSCA 2WOMA 2FBXA 1RILA 4F4XA 1A5VA 1J53A 1BCOA 4HVJA 4ECZA 3VA3A 4CJWA 1TV6B 3QNNA 1RTHB 2IOCA 3KD1E 4QWAA 2HVIA 2HNYA 3VQ5A 3QGIA 4CJQA 4FJGA 2W9CA 3OL7A 4EZ6A 3MFIA 3A2FA 1Z26A 4HUFA 4IRKA 2VWJA 2KFNA 3HVAA 5FDLB 3KIOA 3DLEB 3CDWA 4NLWA 3V6HA 3DM2A 1J54A 3RMCA 5KFJA 4R8UB 3QLHB 2OZMA 3QIPB 1D9DA 4F3TA 4CJ5A 4W5NA 3F73A 4K4YA 4KHWA 3IRXB 1WNEA 2KTQA 1LW0B 4KV8B 5J2QA 3PX0A 2BQRA 4RW7A 3VQ9A 3BQ0A 3GIJA 3OLAA 1ASWA 1X9SA 2HMIA 5KFTA 3GILA 5EWFA 1RAJA 1NKEA 4PQUA 4PWDA 4BWMA 3ZCMA 3DOLA 4G1QA 4IRDA 1C0TA 3CM6A 4TSXA 4Q0BB 3MR3A 2CKWA 3E51A 3RTVA 1TL3B 3K57A 4ECUA 2OH2A 2PZSA 2HNZA 3BGRA 2HHQA 3IG1B 2XY8A 4QWDA 5EDWA 3NDKA 1LW0A 2PYLA 2XY6A 1FKOA 3KK2A 4IH6A 2X6NA 4DEZA 3OYFA 4L8RB 3HYFA 5KFUA 3AVNA 4KTZA 3SFUA 1SKRA 3LPUA 4JUZA 4NYNA 2RKIB 2DPJA 2WONA 3HO1A 2UUTA 1RT7B 3KK1B 1BGXT 2AU0A 2JLEA 2ASJA 4OGEA 1HNIB 3H5SA 4FJMA 3CFRA 2RN2A 1U04A 1IM4A 4M94A 1S1UB 4UQGA 1S1TA 3QESA 3SUQA 2W8LA 4NCBA 2YNIA 4CJ4A 4CJVA 4NLYA 4O3PA 4F4ZA 3C6UB 2YNFB 3CO9A 4QW9A 3S3MA 1TVRB 1BI4A 3HT3A 3ZT1A 3NBPB 4CJUA 4DQIA 5DQHA 3ZT3A 1IKVB 1JLAA 2HWHA 2EHGA 4ZVGA 1WSHA 4LD0A 3U6FA 1HNIA 1W0HA 2HWIA 4KTQA 2FBTA 2ATQA 5HRNA 1KFDA 2YHBA 3Q8QB 3RB0A 1OS5A 2ATLA 2X78A 3OYKA 1RTIA 4DS4A 3PVXA 3QERA 1IKYB 2UVVA 1ZBIA 3V1QA 4DLEA 1A5XA 5J2QB 3PO5A 2FVCA 1RA6A 1REVA 4MFBB 4NLUA 1YVFA 1TVRA 3CJ3A 3MR5A 3CFPA 3LZJA 5KFDA 2DFHA 2IM3A 4ECRA 1C0MA 4EBEA 1JLCA 2D0CA 4ZP6A 2R7YA 2HW3A 2FLNA 5F8JA 3T1AA 3ZT2A 3QGGA 2OZSA 2KZZA 4XIUA 4WFXA 1RBVA 4CJSA 1RTHA 4FXDA 3WNEA 3K5LA 1JIHA 5FRNA 4FK2A 3Q8RB 2R8IA 3ZSOA 1HYZA 4K8XA 4KHMA 1RBSA 4HCBA 1GOCA 2HHWA 1FKOB 4J9OA 1HMVA 4Q5VA 4DWIA 2GIQA 1VSFA 3TI0A 3CDUA 3DM2B 4M3XA 2XWYA 1BQNA 3TAEA 1KHVA 3VQDA 3EYZA 3NAEA 2CJQA 4C8OA 5FROA 4CEEA 1UA0A 1NK6A 1NK4A 2QE5A 3I0SA 5HP1B 3PJWA 3OVNA 3BSNA 3V4IB 1L3UA 1IKXB 4RG8A 1RT2A 3OS0A 4K4XA 3CG7A 4B9UA 4FK4A 2GUIA 4OLBA 4CEZA 2B43A 2W9BB 2Z1GA 4ZPCA 1VSLA 4RNOA 3TAGA 3LP1A 1TK0A 2WK4A 5JS1A 5KT4A 4Z4CA 1VSHA 4RW7B 3OS1A 5KT7A 3IS9A 3K58A 3QEXA 4JS5A 4WYWA 3AVMA 2BANB 4J2EA 1A5WA 1EETB 2BDPA 2VG5B 4EO8A 3VQQA 5KFQA 2XCAA 4AHSA 4C8MA 3OYMA 2DY4A 1C0TB 5KGXA 3ZSWA 4ICLA 2F8EX 2WOMB 3LZIA 4DMNA 4Q0BA 2YKNA 4IG0B 4BDZA 3KLIB 3SPYA 3DRPB 5F9LA 3L2WA 2IMWP 4KAIA 3OYIA 4KHQA 1RDCA 3SQ0A 1IKYA 1D9FA 5KFMA 4ED8A 3LP1B 3V1OA 4LQ9A 4ZVEA 1S9GA 3L2VA 3LANA 4ECWA 3T5LA 4OPJA 3ASMA 2OA8A 3BR9A 2IA6A 3AO2A 4TQRA 1Z4UA 3ZSZA 3SYZA 1YTUA 4FS1A 1D1UA 1GX5A 1QSYA 4XO0A 3CYMA 4XPEA 2RDJA 4YNQA 1HPZB 3VQ8A 4Z4IA 1S48A 3SNNA 1EXQA 3OL8A 4FJ7A 3LP0A 4ZPDA 4LSLA 1NHVA 1HQUB 4IBNA 1S9GB 3JSMB 5KG6A 4AHTA 4CJFA 4DU1A 4H8KA 4IFYB 4ED2A 4MIBA 3VN5A 1NK5A 4GC7A 1BQNB 4CEQA 4F4WA 3CIZA 3SI8A 1B9DA 1JLEB 3EPIA 3I0SB 5HP1A 1Q8IA 3VQ7A 1L3TA 4KI6A 2W8KA 4E7KA 3P83D 5KFLA 4DQRA 4CHPA 3V9WA 5T14A 3AO1A 2UVUA 4CECA 1QE1B 2KW4A 1HPZA 4RW8B 4ECYA 3OYDA 1TKTA 4MQ3A 2FC0A 3QEVA 1UA1A 2RKIA 3PJXA 2E6LA 4CHQA 1WSEA 1C2PA 2HHTA 4BE0A 3V6KA 2RPIA 4DSJA 3O4NA 4WFYA 4J9PA 4LQ3A 4NCAA 1JLEA 1CZ9A 4PUOA 1N5YB 1EKEA 3CFOA 4CGFA 1NJZA 5KTQA 5CYQB 3BSOA 1S1VB 5KGWA 3OYEA 5HBMA 4O3RA 3SQ2A 4IDKB 3MEDA 4E7IA 1HYSA 1WLJA 3NKYA 1T94A 5KT2A 4WYLA 2YNFA 1YT3A 1TKTB 1T8EA 2IAJA 5DLFA 3HP6A 4ZVHA 3UQSA 1ZTTA 1BL3A 4DTMA 4LY7A 3HM9A 3DOKB 4J9NA 4BE1A 3M8QB 4OVLA 5KFCA 3K5NA 3AVAA 3PW4A 3RB3A 1JLAB 1RYSA 4DF8A 5SWMA 2YV0X 4KBIA 3V9UA 1ZBFA 3T5HA 3V1RA 3I8DA 2VG6B 4JRQA 5KFFA 1S1VA 4CJ3A 3MEDB 3NH0A 4DTRA 2IS3A 5KFOA 3LP0B 4LSLB 3O3HA 2JC0A 4K4SA 2ETJA 3IS9B 1N4LA 4CK1A 5C5JA 3BSAA 3E01A 2I5JA 5KFPA 1U09A 4K4WA 3JYTA 3NL0A 3AO3A 3KMQA
chains in the Genus database with same CATH superfamily
2C2EA 2XLKA 5DLGA 4QPTA 2HWTA 3BREA 2D0BA 6FD1A 5K14B 4DV5F 5F0WA 4CP5A 2B9XA 4DV0F 3V6JA 2CUYA 5CD4A 2UXDF 3QEPA 4DV6F 3VWSA 1WC3A 1GXUA 1P90A 4ANDA 1WKKA 5IV4A 3IAS9 2HPUA 3BYPA 1DJ0A 1FEEA 3P5JA 3NS5A 1KVJA 4FNHA 3LDLA 4A8WA 1SKUB 4ED0A 4ITSA 2QO3A 3PTWA 1B0PA 5AQKA 4X64K 1FRHA 1QAYA 3HXMA 2YNGA 4WZQA 2CQCA 5CYQA 4F4AA 4V19X 4E7JA 2D3ZA 1RT2B 1BDGA 2FHJD 2LA4A 3ULDA 3UR0A 2FVPA 4B3MK 1DLOB 4LH5A 4F2RA 4BGBA 1MSWD 4CLWA 2FHMA 4KGVB 2X74A 4B9NA 2V7YA 2BANA 2YVSA 3UKUB 2G0IA 2WC9A 2IVPA 1XR7A 2ALYB 3KTQA 2ASMA 2CA9A 4NZ0A 1BMQB 1B70B 5KFAA 4WXOA 1WF0A 4BACA 3FRYA 4FWNA 4JP8A 3ZTOA 4IEIA 2YBVA 3NNAA 1SC4B 2NUUG 1REGX 3D0HE 5D4NA 5F41A 1UOCA 4USKA 3ZZTA 1HR0J 4A61A 3ILLA 3ZSRA 5A76A 2H51B 1QSSA 2QFJA 3M6UA 2AKWB 3MAQA 4LF5J 1C1BA 2CJBA 3S6EA 4YMEA 4M3WA 3G8QA 4OPHA 2AJQA 3K17A 2G2ZA 2CH6A 1D0EA 2ADBA 3OUYA 3OYLA 1WDTA 3I6PA 4QW8A 3BGOP 1JKHA 2MDAA 4PG6A 5C25A 5DQGA 2IYGA 5JUMA 2VFVA 4CERA 2BGGA 1S97A 4O3QA 4BRMA 2M8DB 2RH3A 3FZKA 3H6EA 3NFAA 1S12A 4E7LA 4OKEA 3B4MA 2DR5A 4LF6J 4ETZA 5LJVA 1NPPA 4ZS6A 2O4GA 4YOWA 5KT3A 1H72C 4KPYA 3UDLA 4JI0K 2FHJA 2PE8A 2OPQB 2HBJA 3HHKA 1KLNA 2Z57B 2C2KB 1RU1A 4FF2A 2IRUA 4LVNP 3O3LA 4J2BA 4KHPF 4DV7K 2ZNYA 2NS1B 4NA2A 4DR5F 4ZVQB 3ZSYA 2J9DE 4DX8H 1X9MA 4WWSA 3BY5A 5AE2A 3J7Z5 3H4DA 3ZNUA 3V81A 1SKSA 2CQIA 2GC8A 1D8YA 3AY9A 3GWCA 3K2YA 1FJEB 1NM2A 1XMQK 5MAOA 2QW9A 3RG6A 5F3TA 4WK1A 2C42A 1R6YA 4NEZA 3SSQA 2VBXA 1KVAA 4WFBQ 1YRXA 4HTUA 5BR9A 4DV6K 3TA1A 2Q36A 2P5VA 2KT5A 3G82A 3CW2C 3DLHA 2OTJS 5AQQA 4YR0A 2DNHA 3VTHA 3HF5A 2ZUAA 4Y6IA 2E5GA 4IRCA 1VLOA 1JCEA 2CQ3A 3MEGB 4CNYA 1XR6A 4BVPA 2C22A 3F41A 3L2QA 3MM7A 4DR5J 2OSQA 3OTOK 5DGBA 2W40A 3PUFA 2AW0A 3TAQA 1RT5A 3KK2B 2HS3A 2WB4A 2QWLA 4AD6A 3F0NA 4OI4A 5KFHA 2VBYA 3H4BA 2AP6A 1QAJA 4YS2A 3QIDA 5A2QO 3A0IX 3WXIA 2A6OA 3EEQA 3CD0A 5K8MA 2FJBB 4OX9J 1HARA 1XNRJ 5ETKA 5KRSA 2YQ1A 3S8SA 2OEJA 2AT1B 2FY1A 1NJYA 4WE1B 4AQYF 3C14A 3GDQA 4CF0A 4CZEA 1LW2B 5J2PB 2FPHX 3UB5A 4C3LA 1VQPN 1VQ6N 1JL2A 1S9EA 2W2NP 4U9RA 1WNSA 2R8HA 3AARA 4I6AA 5HROA 2BJ7A 1PILA 3ITHA 5F0UA 5AQGA 1GMWA 4QU6A 1TMJA 3TZYA 4I6MA 3DXKB 3LW5C 3QBCA 3SV4A 3ZZZA 1SC3B 1ZM2A 2FJXA 1VFJA 1T11A 2W9BA 5SZTA 1V3ZA 4JKBA 2FF3B 2XRIA 3THTA 5FIIA 4UY85 3TWZA 3KKRA 3SUNA 2VQFK 1Q53A 2VG5A 3K8WA 1DQ9A 1RQ0A 2GJIA 3C6AA 1CJKA 4LR7A 3DLKA 1SC1B 3N4PA 3I0RB 4BDYA 5B0DA 2NRTA 3VGTA 1R8PA 1IBMK 4JI2J 3SEOA 2COLA 4DTUA 1QVGM 3OFHA 4DX6A 5KFXA 1BHNA 4LRFA 3DGVA 3AAWB 3KLVA 3SDEA 2UU9F 3GV8B 2XQCA 1PGZA 1W25A 2GQ2A 1KQSM 2G4BA 4ZHRA 2FLLA 1XIQA 3DLGB 2O8DB 3ZC4A 3BGUA 2EFPA 1IKXA 2EFGA 1JQGA 3MEEA 1Y9OA 4HHJA 3KLFA 2FYXA 1IBLF 3OHBA 4FK0A 5EWEA 3F56A 2JEGA 1RHKB 1CJUB 4WPAA 3W8PA 4DV3F 4TNOA 1GLBG 2B0GA 4FCYA 2CQGA 3KZBA 5LMNJ 2FJWA 4UOHA 4JI5K 4U7UK 1WTBA 3Q0AA 1ZBTA 2Q6CA 1UP1A 4ILGB 2NRWA 4CLYA 4IUFA 1JJ2M 1UVJA 1JXLA 2VL1A 2DNKA 2LECA 1QD1A 3KUGA 1DHMA 4FXWA 3TVZA 3TZXA 5IT9U 3TUIC 2V8VA 4LF9F 3T6BA 3ZEUA 4QZVB 2RF2B 3BDPA 4FWRA 2AD9A 4EZ9A 5FPDA 2QMXA 1VQ9N 2DH7A 2VKRA 5G0RB 3AVGA 2ROPA 2N7CA 3VZIA 2V2KA 4QOZB 1WKLA 4PUOB 3AODA 2LFVA 1TKZB 1T9YA 4CO0A 4CHNA 1IKWA 1VQ7N 3IKMA 4LRAA 2Q0UA 3RBZA 3O1BA 2GTDA 3GB0A 4CIGA 2DBBA 4C6AA 1E6VA 2OD6A 2YPYA 4Y2IA 4KRWA 1X8DA 4FJNA 3B6PA 1PKUA 1YXQA 2JFDA 2VICA 4MO5A 3GYGA 2UXCK 5EOYA 4OZLA 4I56A 4YR3A 4YOEA 4ISGA 3CPEA 1NH7A 1RABB 4CGGA 1W26A 4I6MB 5D6GA 3CQYA 2DGWA 2RNEA 5DG7A 4TYBA 4AHVA 1HQ2A 4K50A 4C8ZA 2Q1LA 1EKSA 4JKHA 3TX8A 3CDBA 1RDRA 2BVZA 2QC3A 2IGIA 1CLQA 3CXCR 2WBRA 1HIYA 3S9HA 1OPZA 3R97A 2VPZB 3EGZA 1I94K 1RJJA 4J2AA 3U9ZA 2BOAA 5AQJA 1TGOA 4I6YA 3CCUS 2HGLA 1YVNA 3O1LA 4PQUB 2ROGA 4LREA 1Y10A 2F9DA 4QS8A 3CJ5A 4M5DA 3DOMB 4PG4A 3OL9A 5AQIA 4FF3A 2P9EA 2LXUA 3A8KA 2PGCA 1SH0A 1VQ7S 1ESVA 4M3TA 5CCLA 3J8AA 1NWKA 5IQQA 1OVYA 1NH8A 2OP5A 4IOCL 4ILMA 1T95A 3DAWA 5H9EK 4IZ9A 3VGSA 3HSGA 3KJVA 3AAQA 3EO3A 4GV6A 3VAHA 3LP3A 2G13A 2Q97A 3WXJA 4DSEA 5AQYA 1N6QA 3RRGA 3R27A 2XC9A 1W7AA 2IDEA 1WSRA 4JKEA 3OVAA 1JLCB 3M32A 4DR2F 4ICLB 4ZHRB 3MWBA 2RMLA 2I1RA 3C15A 3VCDA 4WFNQ 4DV2F 4RPFA 3SK3A 4ZKAA 2VG6A 1PJ5A 2BXJA 3CIMA 4BRFA 4EGLA 4N56A 4ZPVR 2J6UA 4KRFA 5JVGL 4ZTJA 1VBKA 4JV0A 4BRGA 3QZ8A 3D67A 4KV8A 3RMBA 2FVQA 1RBUA 4EFHA 5AQUA 3ZZ0A 1GLCG 1BXNA 3D1HA 3FBBA 1XNRK 4DSKA 4CZMA 4OX9K 3UCGA 2E1CA 4HI1A 4Z4FA 1T05A 3HHLB 6FDRA 3Q83A 3CT9A 2DCUB 4WU2A 1XWLA 1Y5LB 3ISZA 5K14A 2MMYA 4I9LA 2ADCA 4LFAK 3PHEA 3PNIA 3POTA 5D15A 1KDNA 1VQ5N 4DTXA 4RUAA 2H9ZA 2O8CA 1S4FA 2HFNA 2MSTA 4MFBA 2V50A 1M1KT 4DI6A 4FOIA 4UZBA 4CH1A 3MPUB 4CZLA 1W2IA 2J9EA 5CA5A 2A6AA 3SAGA 5HMXA 1NSAA 1O51A 2EPIA 2H54B 2P9UA 2CPXA 2ZFHA 2J0WA 1NDKA 4DR7J 2QKBA 4WTYA 3BZQA 4DU7A 2DNGA 2FY8A 2E7VA 1EJ7L 3MM8B 2W7OA 2R8KA 3BBCA 4IO1A 3CJBA 2QYGA 1NAQA 2MQLA 5CZ2A 4Z94A 1J27A 3KOAA 3MPVA 1JX4A 1WELA 2HZAA 1IBMF 2E2QA 3SQGB 2HRUA 4B3MJ 2UXDK 3ZNJ1 4FYYB 1CJTA 1VQ6S 3H5UA 3T1HK 2CJXB 3MAAB 1EARA 4CHOA 3SV3A 2YHXA 1R0AB 1BHLA 4RNHA 4TY8B 4NA1A 3L3UA 5CZ1A 1R31A 1RHJB 1RT6A 1O1WA 1EQMA 3M8ZA 4M8LA 5THWA 2FSKA 5BREA 3CTRA 4E7HA 3ADAC 4DTOA 2OPRB 2D9OA 3W2WA 1I51B 5E2QA 3MMVA 4IG3B 5LXYA 1S6QB 1C1BB 1U4BA 1N8RO 4M5DB 4ISFA 3EZOA 4JI0J 1ILYA 4OYZA 1KRPA 2XG8A 2L41A 4UOGA 2BMBA 2NRXA 4YUDA 3NE6A 1U1NA 5FPEA 2W41A 4KREA 4WXWA 1PYTA 3C16B 4DLGA 2L9DA 2CQ4A 2R2RA 4ILJA 5KFKA 2BE9B 4W5TA 1GK8A 4DU4A 4Q43A 4J9SA 1F21A 1N32K 1R6VA 4RU2A 1KP6A 2LXFA 4LF5F 3ENAA 4Y1CA 3E9LA 3VEWA 3C66A 4Y2CA 3DYAB 3RBDA 4PABA 2HHXA 3MM8A 2CYYA 3NS6A 5ITHA 4GW6A 2YKPA 2ZC3A 2BUNA 2XO7A 2A1RA 3TVYA 2Y1IA 4P10A 2YWKA 3SI6A 4CESA 1RAHB 1M5PC 1ZBHA 2GJ2A 4B9VA 4FVMA 4ED4A 5CH7B 3QAUA 2UXBF 2HIQA 4ER8A 1OJ4A 3UCZP 4ZJQA 5F2RA 1VRUB 4E19A 1LWFA 4BBYA 1T44A 4BRAA 3QSIA 2FZCB 4KJIA 2CQPA 3G71S 3TO8A 1RBRA 4I6WA 4QS9A 1ULRA 4DV3J 3RB6A 4GVBB 1W9HA 3NOGA 3WZ0A 2KQ2A 1QE1A 2OUGA 4O3SA 2PBDA 1VK8A 4PKIA 4DQPA 2PFDA 1NOYA 1XMQF 3HHDA 3Q86A 2ZJPQ 1XQSC 2ACYA 2R42A 2MJUA 3HI0A 4ZCLA 3HI9A 3OL6A 4DV1F 3ITHB 4C11B 2AZ3A 4URQU 4BE2A 3OTOJ 4HWIA 4DR5K 5KT5A 5DJBA 4K7QA 4Z4GA 2Y1JA 1G7CB 2CJ9A 2ZC4A 3SMPA 2HHHJ 3NVKA 3RYLA 1SJ4P 4OZNA 1U47A 2HQDA 2E66A 2AX0A 1NG9A 1YHQS 1HLWA 5L8RC 3M2RA 2LMIA 4J9KA 2JEJA 4KTWA 4NXNK 1GLEG 3QNOA 1DY3A 3G96A 1RDBA 3BO3A 1UFLA 2DXEA 5DDPC 3SUOA 2MLZA 2J6SA 5D3GA 3ENWA 2ZOGA 3A8EA 4WFAQ 3MWTA 3Q7BA 3MM5B 2HZVA 3MCOA 3PJ9A 1X60A 1PAUB 1AROP 3KG4A 4R5PA 1NK7A 5C24B 3U7JA 3AVFA 4MIAA 4MYTA 5AJ3J 3VQTA 4FJXA 4HUEA 3KHLA 3R2DJ 4IDKA 1FDBA 2G0JA 1GXLA 3W9JA 4P7VA 1ZBSA 3MDFA 1HQUA 5KFSA 1RK8A 3IUCA 2HVEA 3NGTA 4X4TA 1FESA 4XK8C 2CJYB 3C6TB 1KSPA 1CC7A 3L2UA 4B1YB 2XTJP 3MCMA 5DS7A 2R3VA 2SXLA 3MECB 4FM0A 4RUBA 3OHRA 3LWMA 3V2UC 4N41A 2KRBA 3SUPA 3SLCA 3G25A 2BR0A 3ATVA 2RU9A 4CLZA 2KXHA 3TP2A 4M5JA 3D66A 2FD2A 1VQON 3PYGA 2FVRA 2DTJA 4AH9A 1YJTA 1RWWB 1TTHB 3BKTA 3KDOA 1SKWA 2VC0A 3UWTA 4K4VA 1MU2B 1G3OA 4Z4HA 1YJ7A 2B5JA 4CO2A 4I2QB 3UN2A 4CBXA 2QTWA 5K9FA 5IT0A 3R1XA 3D6TB 2BW2A 4Q44A 1G15A 1VBZA 3V6DB 4CH7A 5F8GA 2XGPA 2LLZA 2O8DA 1VQMN 1XERA 4IR1A 1UJ6A 2GV9A 1HBUA 3DLBA 3P8BB 1RTDB 5ELZA 4KHYA 4OYXA 4BRNA 1A9NB 1UPPA 3JAMY 3AAPA 1WB9A 2CZ9A 2NRRA 4YY3F 2JLFA 4JKGB 5GIOA 3CPWM 3TAFA 2DVIA 1N52B 1X5SA 1Q7YO 2CPJA 3W62A 2RB7A 4E8UA 4ZIWA 2F8SA 3PYEA 1NBEB 3NWGA 2MB0B 4C11A 4DR4F 4EIAA 1LQ9A 2EFVA 4G1QB 5GIPA 5K20B 1NHUA 3M2UA 3L6QA 4V19J 2Z30B 5D4OA 3HM8A 4E1NA 2VWBA 1M5KC 1Z1ZA 2NRZA 3IG1A 3D0IE 1UJ5A 2EX3A 2CVIA 1KAYA 4O4GA 2CZ4A 4DV1K 4BC9A 4MLHA 1LK5A 4P75A 4F8RA 2F4FA 1OSCA 2V5HG 4RNNA 2XHCA 5I3UB 2X1AA 1JCFA 1LAWA 2ZHBA 3VQPA 5I9EB 3MR7A 1GH8A 1NEEA 2IM1A 1KQGB 1J2VA 3TSQA 3MWPA 1SJ3P 3H3OB 4JI5F 1S79A 1TUUA 5EXWA 1NOZA 4NLRA 4H4KA 4ES2A 1MW7A 2IC3A 3W65A 5HVGA 1HWJA 3IGVA 3QZ7A 2JVOA 1J5EK 3J80O 2B6AA 1NO8A 2V0NA 1ATSA 4DR4J 1BI4B 2CNKB 4I2QA 2RHQB 1WN7A 1BIUA 2VBZA 4A5AA 4LC9B 4PEOA 4RW9A 4JI6K 3SZ2A 2L9NA 3V81B 4O0IA 3GL1A 1J6ZA 4D3HA 3D3CJ 1IM6A 2HLUA 2IVOA 3EE9A 2IMOA 4C8KA 1B64A 3D7SB 4OI1A 5KG0A 2NXEA 3V9ZA 1T7PA 4A8FA 4PL7A 5E5NA 2GMLA 3VAGA 2Z58B 3KYLA 4OI3A 3O3FA 1S9EB 4LRBA 1OMSA 9RUBA 3AA2A 4OFZA 5HLFA 1F1BB 3PSFA 2PO4A 2QSWA 1MG7A 2JWLA 2FBXA 4HACB 4RCHA 1A5VA 1J53A 1BCOA 4HVJA 2CPHA 3VA3A 4CJWA 4CT8A 2J9DA 4U67Q 5B8HA 3KD1E 1HFEL 2HVIA 2HNYA 3W2VA 5HJXA 3UDEA 4EZ6A 2EFQA 2UU9J 2KFNA 2VWJA 3PIPL 4YOTA 2V9KA 2EG2A 1PJ7A 3VGUA 4S0MA 3CJKB 3RAMA 2APOA 3V6HA 3ZFVA 1J54A 3EVWA 5J1NA 3M32B 3MD3A 4R8UB 3CF5L 1V9OA 3W66A 1F6TA 4F3TA 4BRCA 3R5BA 3TOQA 4DR3F 2A5XA 2I9SA 2K1RB 3CSKA 3P39A 1IWGA 1GLAG 4KV8B 2MGZB 1RE1B 2UZAA 1ASWA 3HHLC 4XDDA 4PQAA 2HMIA 5KFTA 5BR8K 3GILA 1Q95G 5EWFA 1IJJA 3I55N 2RQKA 4DBQA 4G1QA 1CBKA 4IRDA 1C0TA 2FC9A 1M5SA 3QNWB 3DXKA 1RXOB 4TSXA 3FGVA 3MR3A 2RIJA 1K73O 3ILJA 4C98A 1PC4A 2PZSA 3CEDA 3BGRA 2FHKA 2VJUA 2Y0BB 2RU3A 3UDVA 3W5ZA 1V3RA 4JI3J 2GCFA 1GLFO 4L8RB 1U1KA 1YJWN 1SKRA 4NYNA 4JUZA 2CDQA 2QTDA 2YXLA 4DPXA 1YHQN 3KK1B 2JL9A 4OGEA 1N34J 1Q82T 4FWQA 3CFRA 2RN2A 4KGZB 4FPAA 3US5A 1U04A 1IM4A 4M94A 1OKJA 4JK7A 3R6LB 4RKUC 4CJ4A 2XMKA 4CJVA 1UVNA 4NLYA 1N0UA 3C6UB 3CO9A 4ALZA 4KQZA 2HBKA 3S3MA 5HOOA 1TVRB 4YDXA 4QYZJ 3G9CA 3NBPB 4V19S 4CJUA 1BA0A 3VETA 3U6FA 2QWMA 1HNIA 2QLBB 1W0HA 5LL6Z 2HWIA 4KTQA 3M3ZA 1TZ0A 2FF6A 5JLFA 1OS5A 1UAWA 4UUWA 3OYKA 1RTIA 4DS4A 4HL9A 4HH0A 1ZBIA 3V1QA 2CJKA 4U7UD 3HRGA 3FR0A 3CJ3A 3LZJA 4DR1K 2IM3A 5AXMA 4ECRA 4AM6A 1TL4A 1C0MA 1P27B 3O9QA 1S6OA 2D0CA 2A1BA 4MYUA 2NRVA 2R7YA 1H7XA 3AA8A 1QTNB 5F8JA 1K47A 3CMAN 3T1AA 4JI4F 3QGGA 3ZT2A 4WFBL 4WFXA 3M4XA 3GIRA 4OX7A 2KHOA 3DJCA 3A5MC 2R8IA 2F4VK 1FRJA 4K8XA 4HCBA 4Q5VA 3QICA 5AXLA 1X9JA 2W2MP 2D0OA 5GAHI 4R79A 3GTYX 5C2FA 3ZZYA 2E5IA 1F2GA 1T9VA 2V52B 1WG5A 3MM9A 3VQDA 5TKYA 2HBQB 2DNPA 2G1HA 1I94F 1NK6A 1NK4A 3D9BA 2QE5A 3PJWA 2V8DA 1SQFA 1RT2A 3FBFA 3JTOA 2XMVA 2B43A 2NXNA 4ZPCA 3R6MA 1VIXA 4X84A 2WK4A 2DR9A 5KT4A 1MROB 2DXFA 3OS1A 5KT7A 5IC6B 1T6DA 1IBKF 4J2EA 2GMJA 4EO8A 3RU0A 4F0KA 2DY4A 1C0TB 3PIPQ 1AUSL 2WOMB 2DH9A 4FF4A 4KYZA 4Q0BA 4P71A 1H7WA 3NGUA 3KLIB 1Y11A 3DRPB 2AJ4A 3I33A 1M0SA 4MDAA 4K2JA 5KFMA 2B4OA 1ZZNA 3CNQP 4ED8A 4QQBA 1NXIA 4CYUA 1K9MO 3V1OA 1GTEA 1S9GA 3LANA 1G99A 4DV4J 2P9IA 3C8YA 5LM7E 5D0EA 1HI1A 2V4JB 3ASMA 2P9KB 1HJOA 4U8YA 3ZSZA 1HI0P 2NSBA 4OHXA 3SYZA 2B56A 3EDRB 2HS4A 4XO0A 2HURA 3VQ8A 4Z4IA 3SNNA 3MUTP 3OL8A 5E7OB 2M4MA 1NHVA 1HQUB 4OJHA 4M5LA 4K0KF 3E8OA 1BE4A 2ZVIA 4CJFA 3HDSA 1U6ZA 1NK5A 2V51B 4DV0K 3CIZA 5M1FA 3SI8A 3CJTA 1M90O 4B3RK 1JNRB 4PG5A 2E2OA 3VEXA 4KIAA 4ILLA 2NYIA 5HN0A 5KFLA 3P31A 4DQRA 1X4HA 5T14A 2V6AA 2RS2A 1FE4A 3AO1A 4Z37A 4CLTA 3GSDA 4CECA 4USIA 2MKHA 4A5BA 3R3LA 3FC9A 4A8YA 2FSNA 2C3UA 3QEVA 2WAQD 2RKIA 3TUPA 4LUBA 1WSEA 2IIRA 3TA0A 2HHTA 4BE0A 2W2QP 4YB5A 4WFYA 3O9TA 4LJMA 1PO6A 2MQQA 2FIUA 1XTZA 2M8HA 4DUYJ 4EU0A 3GCXP 3IR5B 1S1VB 2OO4A 2DY9A 4O3RA 2LEBA 5D0RA 4IDKB 4E7IA 1HYSA 3TZWA 4M5HA 1HX1A 9ATCB 4RWXA 4W4MA 3NCPA 3DXSX 1T8EA 1YT3A 1NM1A 5CQGA 4NXMK 2CPZA 4LBHA 1ZTTA 1BL3A 2H4WB 4BE1A 4JYAF 3AVAA 2ZBPA 3PW4A 3OR1A 4WP8A 1RAEB 3T5HA 3I8DA 2DEJA 5IWAK 5HK4A 2PI4A 2DISA 3A8IA 3CCZA 5DRKA 3ZTQA 4CJ3A 3MEDB 4EFAC 3QGPA 3HMJG 3C16A 2ITMA 3NXZA 1RB0A 5KFOA 4HDHA 1N32J 5AFUH 2JC0A 3WX8A 4DN9A 5C5JA 4DKWA 3ID6A 5DO2A 2HFVA 1B0TA 1AFIA 4BR7A 1U09A 2LYVA 3JYTA 1GFWB 1ATRA 2ZE2A 3MOJB 2O8EA 3MMCB 4ATNA 3ULHA 3CERA 1O0PA 1MDUB 4GO7X 3A13A 1SJFA 1HNVA 4CLFA 1XHXA 1LWCA 4M42A 3RW6A 4OJ3A 4CEAA 2YX4A 1YSJA 3G0ZA 4F7VA 3OLBA 3HX9A 2ZBRA 4BVOA 3VENA 4CW7B 4ZN3A 2MQOA 3NF8A 1BG3A 3DI6B 3RRKA 4YQWA 1IO2A 5AXNA 5GMKa 4LFCF 3G6VA 3LALA 1RT4B 4HYKA 1CQMA 3LH2S 4DV7F 3AA3A 3CC4S 3CJ1A 1OIAA 4OYIA 3I5CA 4QWBA 1QLNA 1X5PA 1OY8A 4O4GB 3GIIA 4K8ZA 1HPMA 3ALYA 3D68A 1ITPA 5T7BA 5HQMA 3Q22A 4CLSA 1RTJB 3PV8A 3RAXA 3HPHA 1F3VA 1CJKB 5AE3A 4G3IA 2HVDA 3F5TA 4PZVA 2J4RA 4O23A 3HD2A 3HSJA 3ILOA 4C8LA 4ELTA 1FKAF 1F2HA 2Q31A 4I69A 4H0OA 3AA9A 3M8SA 2DXDA 1M5HA 3EE3A 1VQKN 5HQ8A 3A8YA 2J0XA 2UXBJ 4PR6A 3MTJA 3L4QA 4BCAA 4JK8A 3KG1A 4B3OB 1U2CA 1UWBA 2YCHA 4HHTA 1Q79A 3PZPA 1XC9A 4JOUA 4FS2A 3QO9B 1BC6A 1K6YA 3FCVA 3TAMA 2DGQA 1S0VA 3CC4N 4DTSA 2QLFB 4BRKA 3WNGA 5KFVA 4DDFA 4ZPBA 3M5RA 2VH7A 3I56N 3VQBA 3QSYB 1UKUA 2EK6A 1WSJA 2MY8A 4FWKA 3UCUP 1ZH5A 5M1PA 3THWB 1FE0A 2DITA 1KVBA 2O8FA 4AFFA 4RW6B 4FKXA 1FJ7A 2O5DA 2MZRA 4M63C 3GQCA 1HKAA 2KT3A 4H5TA 5A8KA 3AVBA 4ZVTB 4C7QA 3O9RA 2F7VA 3DLLL 5EWGA 2C2RA 3F9MA 2OPPA 2KI2A 3NEKA 4BR5A 3JYTB 3QINA 3OFEA 3OXLA 1KFSA 2ILYA 4EAHD 1OH7A 3PX4A 4X65J 3KK3A 2JVRA 3MECA 1N5YA 4AYBD 4BRHA 2HK2A 3T5KA 3IN5A 2KJWA 5KFYA 1VC6A 1TKZA 1RZMA 4LT6A 3LDOA 3OYHA 3QT8A 1IKWB 4OYWA 3P45B 1FHTA 1KQSR 3OA9A 3VEZA 4JKFA 2V67A 3OBYA 4DR7F 3T9NA 3C6UA 3CDEA 4BRDA 1JLBA 4WKRA 3P96A 4C3KA 3M9OB 5SUHA 3D45A 4LFBF 2W9AA 3C7NB 2X1BA 2IRXA 4FJ9A 5E0OA 1N5VA 2OFGX 1VHFA 2QA4N 3TAMB 3TAPA 2AQ4A 4N5SA 1SV5A 1VIOA 1S5ZA 1W2BR 1K8KB 4CGIA 3DMJB 2DFEA 1RAGB 3EPGA 3ZSQA 4K4TA 4CZHA 4RJVA 2CQ1A 1R8AA 3AVJA 3NH1A 3OYAA 4H5WA 4KB1A 3HT0A 2QWNA 3NGRA 3JTNA 1YJUA 3FK4A 1GOAA 2QXLA 2BA9A 4JI2K 1I6JA 2GUPA 1URNA 4FLYA 2RAQA 2VFRA 5L9XA 1YJNS 2VQEK 1Z05A 3UR3C 2XY7A 2EI5A 4O3OA 3L7UA 4QWEA 3MXHP 1T3OA 4NLPA 1U02A 2AX1A 2XI3A 1U0SA 3J80U 1XMOK 1HWLA 4KHSA 4ECTA 1RNHA 1YIJS 3G8SA 4LF4F 1VHXA 3T19A 3B6BA 3H2LA 1RT5B 3QRPA 4J2DA 1FRIA 2V4QA 3DRSB 4YDUC 2BRKA 2ZEJA 1H73A 3MDQA 2AIRB 2CDRB 1FFSB 4PWDB 5I3UA 3MM9B 4IOCQ 1PBUA 1DURA 1HNXK 3X1LB 2W6KA 3CUNA 4FOEA 3GBTA 4PKGA 4LF2A 1WD6A 4OZ0A 4ZITA 1V3SA 2VFTA 4CJTA 2GBZA 2IC3B 1YUWA 1FWPA 4J91A 2HFSA 1SH3A 4UW2A 3D6RA 4EEYA 4BR0A 3M8YA 3TANA 4PXDA 4X62K 4DUZK 1S3XA 2CWXA 4FPRA 2BE7D 3W60A 2IJNA 3THYA 3DRPA 3NMAA 2VQEF 4JYAJ 3CCSS 1TL1A 3CMEN 3POTB 4JI2F 3K5OA 3MMBB 3H40A 3PACA 2IM0A 2HAFA 4JNEA 3LAKA 4BR2A 5AQSA 4QYRA 2P9IB 2YHWA 1HNXF 3WQPA 5DQIA 3VGKA 1I39A 2LA6A 2W24A 2Z2YB 3HJVA 4FP9A 1JXVA 3FZMA 3CCES 4ZVSB 3I4HX 1VQNS 4DR6J 3CMQA 2ACMA 1RWUA 4YEAA 4FLXA 3HKZD 3O3GA 3MCNA 1KC8T 1XC3A 4UTGA 5CCMA 3NMRA 3QT7A 2Q79A 1YZ6A 5AQTA 4CI6A 5A6WA 2JC1A 1CZAN 1KTVA 2I6WA 3FKBA 3IMQJ 2JHEA 2X51A 1VISA 2E7WA 3HBTA 4DCOB 1OWXA 3DLGA 2FBVA 4JBCA 3OVSA 4PKHA 2QWRA 2Y8YA 4ZCKA 3SFGA 3T1YK 5A8WA 5GAEP 2F5GA 1WAJA 2I2YA 3J7AN 3L2RA 1RTZA 4LF7K 1L3KA 5LSOA 3EN9A 3TX0A 3O9SA 1Q82O 3LQVA 2DHXA 1NPRA 2QM1A 2OYQA 2LU1A 2C2MB 4B3TF 1IN0A 2QL7B 1GQEA 1X5TA 4A46A 1R8CA 3MHYA 1T9WA 3UKRB 3L8BA 4CF9A 3H0PA 4DR4K 4B9QA 3AJ2A 3MFHA 3Q23A 1X5OA 4CZIA 2MY7A 4OHVA 2UUAF 3EY1A 3KUHA 1V4SA 4JI3K 2ZDOA 4YY3K 4FPIA 2HQCA 2PY5A 4NYZA 1TMMA 4MKAA 3WHIA 3B6OA 3QYYA 3EX7B 5KRTA 4HH1A 1TAQA 4NMLA 4KI4A 4CK3A 1X3MA 3PW2A 5A6PA 1T02A 4IQXA 2FJDB 1JXEA 4DPOA 3H5YA 3FZBA 1Q9XA 3M6XA 4URSA 3PYFA 3ENHA 1X7VA 2DNOA 4DU8A 5CAAA 1K0TA 4QAGA 3MPDA 4URGA 3UN5A 1LCUA 4DTPA 4CJPA 5HI7A 3TEHB 2HQIA 2XMWA 3VQSA 4KE5A 4DV0J 2ZGZA 2VFSA 4KAZA 5IQ6A 1S77D 4B3RJ 1CJVA 1HKGA 4IR9A 2E88A 3TWHA 1L5UA 2EKYA 4Q45A 2ZH3A 3Q8YA 1RT1B 3V9XA 1CXQA 3AVHA 2VD3A 1TKDA 4I7FA 1WOOA 1NGFA 5FPMA 1I3AA 3M8RA 1Q9YA 4NXNF 2NYHA 1VR6A 2HAIA 3D6FB 2JEIA 3N5FA 3ISNC 3GJSB 2NCKL 4OJRA 3IA0A 1O5JA 2XBPA 4F4YA 2ZBIA 1VK3A 3OTCA 4AILC 1K73T 3UVJB 4J9LA 5GAHU 1RBTA 4PY5A 3W1YC 2IBKA 2RE2A 2ZZMA 3QFWA 3TARA 3KLEA 2JOQA 4RW8A 3AXMA 4KO0A 3LDNA 4KKOB 5ETOA 4Q8EA 2AJ1A 5DM6Q 1ZZFA 1HMVB 3HLUA 3KXDA 3HSZA 3BF4A 2ZH6A 2KL8A 3CC2N 1EWQA 1VQLN 1QQOA 2YKAA 2QN6B 2P9NB 2ZHAA 1L3VA 1B9FA 3EVMA 1QUVA 1WI6A 1MWQA 3U4LA 3ZETB 5FD1A 2WTFA 3DFEA 4JI5J 2KXNB 2G8KA 3NMUA 4Z0UA 1VQ9S 3UD4P 1KOHA 1OH5A 2XLJA 5A2QY 2UUBK 4IH7A 4HUGA 4F26A 2D41A 2E2PA 1REVB 4Y0FA 3VR1A 5HRPA 4OX8A 4IXCA 1ACMB 1GMVA 5H9FJ 2ZHOA 4ETXA 1CJVB 5EU7A 3WEEA 3BYRA 3UKRA 4DX5A 3VGVA 4HR2A 3T69A 1GNKA 1CQNA 2QFIA 1NZAA 4NLQA 3VAJA 1YWXA 3KLIA 2UUAJ 5D77A 1S1TB 4E89A 3SJJA 5E26A 3B8AX 5B0CA 4X4NA 2DHAA 2L48A 1X0FA 1IVZA 4RW4B 4CJEA 1E6YB 1HRHA 1FNMA 5E3PA 2Z2MA 2RQCA 5C15A 4LF5K 2H3EB 2KU7A 4USHA 4IG3A 4MKBA 2R7TA 3ENVA 4JYAK 4A47A 3CJ0A 3FSXA 1LXJA 2J8SA 5KQDA 4NXMF 1LFWA 4DV3K 2IJFA 3D2EA 4DMZA 4DSLA 2CGKA 5AQMA 3EZUA 1MWZA 1IBLK 1C0UB 2RF2A 3KHGA 2C2DA 1WWHA 5LJWA 4ES1A 1SAZA 3ZZUA 2H5JB 5ETVA 3SQGA 1QZ5A 1ATNA 2E5LJ 3PR5B 3ENBA 1LXNA 2ZM6K 4DCJB 3VA0A 3PSIA 3OY9A 4GVEA 3ZETA 2Q3SA 3MPWA 2A18A 2V8GA 5IV3A 4W5RA 5AFUA 4Q7AA 3KJQB 2G8HA 3CE8A 1KCFA 2OLWA 4DV7J 5HAOA 1BQMB 4DL5A 4A8QA 2V7ZA 2V69A 4OYBA 1LAVA 2VDIA 3VAIA 3MXMA 3ONQA 3RSEA 1VQSA 1G4CA 4O5BA 3QRRA 3O4QA 2P51A 4QR1A 2FHOB 3KLEB 3PHTA 2JZ5A 3SJHA 1ELOA 3CO0P 3HVRA 2R7RA 3K89A 3JSRA 4Z4EA 2PEHA 3NNHA 4CEBA 2DD8S 1QUPA 1SUQA 2QWPA 1T03A 3IAYA 4G1PA 2YKNB 2HK3A 4WP9A 2R2TA 1H74A 3PIOQ 4NX9A 1J9AA 4HKQA 1PYSB 2JFKA 3ZYYX 5B0AA 4I9QA 3MCPA 3OTDA 1DLOA 4E1MA 2CADA 2X3GA 1WF2A 3DRRA 5GAGI 3MR6A 1NU0A 2IDLA 4ECQA 2J7KA 4JEPA 2GEMA 1N5QA 1YIJN 4O0JA 2OMLA 3AO5A 1U7LA 2CXEA 2LSNA 2YNHA 2ILZA 5GMDA 2R9LA 3GZ7A 2QSFA 1T9XA 4H0TB 3JQKA 1XEZA 4C3MA 4J9QA 4FJ8A 4FYDA 4IO8A 1Q18A 3MURP 4GVBA 4H0XB 5DZ6A 4CJKA 3ILIA 1S0MA 2GIRA 2F8TA 3A5LC 3G4SS 1H2TZ 1U45A 4ZVRB 2FVSA 4FBUA 3M8WA 3Q24A 4XAKA 2G8IA 5C24A 1DFDA 3S7RA 3DU6A 2B3TB 3BEGB 1Y5IB 4GKJJ 3GR0A 4EHTA 4M41A 2BBEA 2VGNA 2F4VF 2AZ1A 1N0VC 3S3NA 5KFIA 3WC0A 2GHVC 4QOTA 1YVUA 1D9AA 4CEFA 1XJWB 4KH6A 4GMJB 1GOBA 4XPCA 2UUCK 1N8RT 2I5JB 3DU5A 5CY4A 4ED1A 1TQLA 4JI7K 4F2SA 3GSIA 1RAIB 1JL1A 4CIEA 2N4CA 5ETPA 2UV8A 5ETRA 3BH6B 3J7A1 2HGMA 3RWUA 4GKKJ 3DKDA 4HLBA 3VV2B 3FEZA 2RQMA 1Q86O 2G2OA 5J2MA 3G4SN 2ZH2A 3UE5A 1NRKA 3H45C 2YHYA 2UXCF 1KHWA 2MKYA 5DETA 4J9MA 4GKJF 5HL7Q 3OSNA 2ZITA 1S1XB 4OLOA 1UWBB 2FB0A 3TJ8A 2HF4A 3GR1A 3U27A 1TK8A 2M3DA 3AGKA 2AYEA 4CH0S 1I3OB 4FZXC 2YKMA 4C1NK 5ETMA 3FSIA 1FWLA 4J37A 3OYJA 4KHUA 3H3NO 1KKHA 1HBUB 3SCJE 1HQEB 1RDAA 3W7BA 4K5SA 1B7FA 4QPXA 3IM9A 1D3WA 1VSJA 1KAXA 4OV1A 2E1ZA 1ITGA 4OPKA 4FW1A 5B7WA 1SUQB 2CPIA 4BC5A 3THPA 4OHWA 3H42A 4ILRA 2D7SA 2HB5A 3CC2S 5J1EB 4QR2A 2EK1A 3VQEA 1NU4A 3VEOA 3QBXA 3KDNA 2E5LK 1RI7A 4MK7A 2GQQA 5AQNA 2HZCA 4YDUA 1Z6RA 2XCPA 4AHUA 5K8PA 1N36J 2XHBA 3H08A 2BJEA 3FFIA 4X66F 1U1QA 1HNWK 2KJVA 4NI2B 2OEKA 3OR2A 1FEHA 3IRWP 3HL8A 3AVKA 4A8XA 3ISND 1U8SA 3UO0A 2YPZA 4FW2A 5E3RA 4DTNA 1MWKA 2XS2A 4CJ7A 4K2XA 4DJBA 4NYPA 3X3UA 2CQ0A 4LR9A 1M1HA 3MF5A 3KKSA 4QS7A 3HHLD 2H48B 2AEJA 4MH8A 3JXOA 1KLMA 4RNFA 4IFVA 4DUYF 2C28A 3I5BA 4PL8A 3KLHA 4EO6A 1IBKJ 3NF9A 2YH1A 1YX2A 1SB6A 2DIVA 4H0YB 2QEXS 3Q89A 3P5BP 3W3DA 3GU0A 3Q8PB 4CHYA 2MPUA 1RHMB 4F9OA 2J7WA 3C65A 4CDIA 5BR8F 2HFUA 4BR9A 5F9NA 4JI1J 2VDHA 2ASLA 3G86A 5CYMB 2E2NA 1CJUA 3K59A 5GINA 3JB9k 1NJIO 2IIHA 3LPTA 2ZD1B 2ZWPA 4LBIA 4BC3A 1GXTA 4JV1A 3FFKB 1NK8A 1LWEA 2ASYA 1R89A 3J81Y 1G6BA 3A12A 3OUYB 1D4XA 4JI6F 1JKHB 1FA0A 2H4YB 4RNMA 2IFXA 2RJZA 3C0BA 3IFEA 4J90A 3QGHA 2DT9A 2WONB 2J6TA 4ID5B 1FD2A 1YG0A 2G0CA 1NGCA 3RJMB 4MK8A 1N32F 1JWWA 2D4WA 2WOMA 1RILA 3BKUA 3IM8A 2AEMA 5IT9Y 2IHR1 3SCIE 2CJAA 3V5RA 2QZ8A 4QWAA 4O8KA 3QGIA 1GT8A 4CJQA 3BN7A 2W9CA 4WQ5C 4IRKA 5FLXO 5FDLB 3SMSA 4DUYK 1NJIT 1BY9A 3KIOA 3DLEB 3EE8A 1B7YB 3DM2A 2ZUGA 3R7NB 4ZN1A 5ADXH 4R25A 4HACA 4B02A 1H2VZ 2VPYB 1D9DA 3TSUA 2KM8B 1YRUA 2WBMA 4KHPJ 4CJ5A 1HW9A 2J76E 3F73A 4GY2B 4K4YA 2XLIA 2GVZB 2BQRA 3LGMA 2CG8A 2Y8WA 2D69A 2D9PA 1N34K 1NKEA 4PWDA 4DR7K 3ZCMA 3VVTA 5L39A 4X66K 2Z8QA 3E51A 3K57A 3P49B 3QT5A 1U0HA 2OH2A 3CCRS 2HNZA 2K1RA 2A40A 5EDWA 1LOTB 3N01A 5KOWA 1FKOA 3ZXWA 2MLYA 2BJ9A 3OYFA 1FXDA 5KFUA 3AVNA 3O6WA 3SFUA 2RKIB 2DPJA 2B7CB 3HO1A 4JKDA 3Q8VA 2FSJA 2AU0A 3H8YA 1FTCA 3NCQA 3TYTA 1UPMB 1UZHA 4BC7A 4NMXA 4K42A 1S22A 2M70A 3QESA 3UNGC 2PN6A 4ZLLA 2JJ4D 4O3PA 1NGEA 2CNOB 3M30B 4MDBA 2VHGA 3UW1A 3HT3A 3ZT1A 2DPNA 3WXLA 2XSFA 2CVEA 2ZNZA 4OX9F 3T7ZA 1R43A 4X4UA 4ZVGA 1WSHA 1X4GA 4LD0A 2EVZA 4PXEA 2YI1A 3MZIA 1BOTO 1F9HA 3RB0A 4X62J 4DUZJ 3AHPA 3A1YG 3PVXA 4FWSA 4A8SA 8RUCA 2BW7A 2DGOA 4DLEA 5JVGQ 3CHWA 3WXKA 3FSYA 4MFBB 1YVFA 3MD1A 2H65B 4M5GA 2DFHA 2LEPA 1RSCA 4P6QA 1N36K 4EBEA 1ZM3A 4YORA 3ZZRA 2D1KA 2L3MA 3ZZOA 1U8WA 2GVDB 2ZJPL 4MMOA 4CNZA 4CJSA 2ZH5A 4ID8A 4P52A 3WNEA 3K5LA 3Q8RB 4CLLA 8ATCB 3JAMU 1HYZA 4KHMA 4NXNJ 5CYJA 2O01C 5MLCQ 2ZZNA 2E1YA 5J1PA 4M7YA 2GIQA 1TYQA 4DV4K 1VJQA 2ASPA 1SS6A 1VSFA 3TI0A 2DRBA 2PFFB 3DM2B 4ZLJA 4M3XA 3TAEA 1KHVA 4C8OA 5FROA 1S72N 4F0HA 1EQYA 3OVNA 4FO0A 5BPLA 1L3UA 1IKXB 4RG8A 4K4XA 2XS5A 4LMZA 4FK4A 2NUHA 4A2AA 3M2VA 5AQLA 3HSDA 4CYUB 4ZIVA 1PYOB 1RWOB 3IS9A 3ATUA 1Q1KA 2IRYA 4LF9K 2BDPA 1Q8BA 3K7RA 1EKRA 1S6UA 2F9JA 3ZSWA 3I87A 2F8EX 1Q81T 3DHXA 3LZIA 2WVCA 4DMNA 1VQKS 4IG0B 3H7HB 4BDZA 1N5TA 2J0QD 2I38A 2P9SB 3DGPA 5F9LA 4L75A 4KAIA 2IMWP 4KHQA 2RILA 3GG4A 1IKYA 1D9FA 4HTJA 3E9OA 3LP1B 1UW9A 1A6LA 2GX9A 1MROA 3D0GE 3TUJC 1UVLA 1U25A 1TELA 4ECWA 3T5LA 2KVIA 4UF4A 2AJ2A 3CCTA 4Y2KA 4OPJA 2OA8A 3BR9A 3KJNB 2IA6A 4UY8O 1Z4UA 2MZSA 1YTUA 1F5CA 1D1UA 2DO0A 3CD6S 1GX5A 3TTCA 1Q78A 4PPZA 4XPEA 2RDJA 4YNQA 2AP1A 3AT1B 4F0MA 3R8EA 1P8GA 4X64J 2Z0GA 2M0GB 3L95X 3H1QA 4L3QA 4DHYA 1GMUA 1YRTA 2GO9A 5HMYA 3UKUA 3EXYA 4IFYB 2HKEA 3BB5A 1FFWB 5RUBA 1BQNB 1B9DA 1YI2S 2PD1A 3EPIA 5HP1A 5CR4A 2VIHA 3AQOA 1T3VA 1L3TA 2W8KA 1LFPA 2HBLA 3J81U 3OFFA 3P83D 3ZEUB 3V9WA 4I0WA 1QZ6A 4IFEA 1QE1B 2KW4A 1HPZA 1EAYC 4NZ6A 3I55S 5BN8A 3LM9A 4ZJOA 2DGSA 1Q5YA 4ERDA 4PWWA 3SBMA 4K41A 1C2PA 2ZGYA 2YY3A 3V6KA 2RPIA 4DSJA 1AA1B 2PI5A 4FDFA 5BRHA 1JLEA 4BLGA 2B51A 3BSOA 1XNQJ 2ZBQA 5HBMA 3J80Y 2LDIA 3MEDA 1WLJA 4X65F 3FGUA 1WOSA 1T94A 5KT2A 1YBTA 3NP5A 1FRKA 3T1HF 1TKTB 2LQBA 2IAJA 3RUBL 1TYQB 1ZS6A 2JRSA 4ZVHA 5AQOA 3PRVA 5LXRA 3HM9A 3NOCA 2M9KA 3WQTA 2AYBA 4LSZB 2PMZD 4B1VA 4KT0C 4QYZK 1M5VC 2W6LA 3V1RA 2MKSA 5M1NA 4JRQA 1VQLS 1S1VA 5DM6L 1BQXA 1NSQA 3GG1A 3JQJA 4Q2MA 1RLCL 2DNQA 2VV5A 1HR0F 1YK9A 3BF1A 4LSLB 4H03B 3O3HA 3B78A 4K4SA 1N4LA 4I64A 1YJNN 1RGVA 1FERA 1VYAA 2BH1A 2QT7A 3F44A 1B99A 4K8RA 4CTAA 4A59A 4YB7A 2DEIA 3AO3A 2QG9B 1FJGJ 4PG7A 1J5EJ 2F9TA 4MK9A 3FZ2A 2P9SA 1C0UA 1YJRA 2WTUA 2WCXA 2XYHB 3SQ4A 4WIIA 3UNYA 4NLVA 4KGKA 3W3SA 2WB1D 1JNZB 3KJVB 3EL2A 3R5AA 1KR4A 4FJKA 3QJPA 4PWUA 4NLTA 1N6QB 5JMNA 5KG7A 4JV2A 4RZRA 1VS3A 2XYGB 2HVHA 1MMNA 2XMJA 3CCQS 2C2NA 3VAFA 1T03B 2E5LF 3GMGA 1RYRA 3W9IA 3TR5A 3HSCA 4LF7J 1WHVA 3CCLS 3O6QA 3LL3A 5HBMB 4BRIA 2AEFA 3AD7C 1VAZA 4MT1A 1R8BA 2ALZA 3I8BA 1DTQA 1MWYA 5AJ3F 4Y34A 4KHNA 1E4GT 5CXTA 2R7UA 4KHRA 3KJFB 4FJJA 2N7YA 3MPYA 3U3GA 2KVQE 1GLLO 1E3MA 3F9KA 1FXRA 5BYQA 1BUPA 5A8RA 1DZ5A 1NLVA 1MA9B 1Q16B 4AHRA 1MU2A 2GZOA 3HTVA 5HVFA 4USWA 3K0SA 3BJYA 3SCXA 4O44B 3RBEA 1AT1B 4X4QA 1HNZF 2AHOB 3G6XA 1ZC6A 4DFKA 3I4PA 4K4ZA 2NREA 3THYB 3IGNA 2FBYA 2HHPA 3SPZA 1CC8A 2BE2A 5EHHA 3DN9A 2M88A 2NZCA 4YOYA 3UE2A 2DH8A 2U1AA 1N36F 3LDPA 2W42A 2X3DA 3CCMS 3C6TA 1UZDA 3SXLA 4EYHB 2Q43A 4Y2AA 4DZDA 3CCLN 3N6NA 1RTJA 2CQDA 3UI3A 4CF1A 2CGJA 2W7PA 4JI7F 2P5GA 4LF1A 1LWEB 2QL5B 1R27B 1RAAB 4FWMA 5HMZA 4LSNB 4Y65A 4FWLA 2VONA 3WIUA 2C3OA 2MXYA 4M3UA 2HQ3A 1J5OA 4LF8F 1AZSB 4OL8A 2YNHB 3LPYA 2YNGB 3N0VA 5KPZA 4CGDA 2IA0A 2D3O1 1ZXOA 3OYNA 2D5RA 5BPNA 4GKJK 4ID5A 3VQ6A 1QSLA 1IXKA 3LP2A 3IDHA 2ATCB 4B9MA 1JJ4A 3D5MA 1WSIA 2QGFB 3QATA 1FF2A 4DR1F 1RTDA 3RRHA 3OYBA 2F3JA 4O3NA 4WE1A 4CBUA 4EP4A 2MQMA 3EXCX 4JLHA 3NGZA 5BR8J 5BYSA 1LV5A 2PSZA 1EB0A 3D54A 2QRRA 4ED6A 1TL5A 4JI7J 4U7BA 3IXQA 4LFCK 1X31C 1FVSA 4WJBA 4LF7F 3ZX3A 2CZVC 1OH6A 1Y3JA 2J7UA 4LH4A 1HYSB 2D3OR 2LQ9A 2F9WA 1NCLA 2WSFC 1QAXA 3BQ2A 2F40A 2HQGA 3IRXA 4FPBA 3I82A 2OCEA 3QFPA 4ED7A 2BRLA 4OQJA 5D8HB 2XHWA 1OQ3A 3MMAA 4YOXA 3OR1B 3FEXB 1NBWA 5D0GA 2CRLA 4IOAL 2LCWA 3JAMO 4K4UA 4WCEQ 4JI8K 1QHAA 5CHIA 4DU3A 4O4RA 2JNJA 2I7PA 1HKBA 4B17A 4NPOA 2D1CA 2KKZA 1TFYA 1IR0A 2DNZA 2EEYA 3TU5A 2YHAA 3KWGA 3CJCA 2F1FA 1EX4A 3JSYA 4RBTA 2GQCA 4NA3A 2JLGA 4NB4A 1I5OB 5E3CA 2Q0RA 5H1SV 2A6MA 1KVCA 1PG5B 3PCOB 3CC7S 1AYEA 5ETTA 1UJ4A 3TSPA 2EW9A 5D3GB 2K06A 3RMDA 4DCHA 3QIPA 2HEKA 1DTTB 1K0VA 1LWCB 5H9FK 1SL0A 3Q7CA 2WW8A 2ZQBA 3W5YA 3DRYA 1U49A 1S49A 3OPKA 4CHZA 4NLCA 3ZTPA 3OS2A 1ZM4A 4DFJA 2XB2D 3BGFA 2UXBK 4CZGA 1QVFR 1OO0B 3R2CJ 1QAIA 2KT2A 4BG8A 1S72S 3K2PA 5J2NB 2XY5A 4F4KA 4LR8A 1KVIA 1JLGB 4IOAQ 1S57A 2YX6A 1FXXA 1P6TA 1RKJA 1IR2A 2GIFA 1CULA 3FJ2A 1JJCB 1U1RA 4AM7A 4KGXB 4G6VB 1SXLA 3O08A 5LMUK 1JLFB 2VG7A 4FJHA 1RBLA 1C1CB 3LAMA 3FMBA 2RDIA 3M2RB 2LEAA 1YQHA 2FGCA 4NI2A 1C1AA 4QU7A 4HVZA 4ZLPA 4DPUA 2FLPA 3IO1A 2HVZA 2BOPA 4K59A 4C4WA 1N48A 4LIWA 1NKBA 3CC7N 2M52A 2IDOA 4AQYK 1XMOF 1NZ8A 3FDSA 2B8PA 5FLXY 1W7WA 2K3IA 3PO4A 2MKIA 3MEGA 1RHUB 2D3UA 2B7BB 5KG2A 2X7IA 2CNNB 2R2UA 4X2BA 1DEJA 2MKJA 3HFZB 3QB0A 2DGXA 3E66A 2XM3A 1F9EB 3Q2SC 2EFNA 1VSDA 3CETA 2R7VA 3WEEB 4KR0B 2YH0A 5HO4A 2EC0A 5I42A 4AQYJ 4CE9A 3H98A 1GMWD 4ECXA 1QY7A 2F96A 2MHEA 3TVKA 2W4DA 1T6CA 3D6HB 5L1JA 1J5EF 2JGUA 2W4CA 2L08A 2DHHA 1KOOA 1IR1A 5M1KA 5DM7Q 2V4RA 2WHOA 4JI1K 3TABA 4UY8T 3KD5E 4DV6J 2GX8A 4I1TA 1RDDA 1URRA 1VOMA 1OPIA 3JTPA 2KYXA 3R6GB 3U02A 4BWJA 1U1MA 4P72A 2EKNA 4U7CA 3D1OA 1VI7A 3PR4A 2HIYA 3NHGA 2QK9A 3KVGA 4NLGA 5M2PA 2GVZA 4EBCA 3UDCA 3IAM9 3MTKA 3OYGA 2NZ4A 3KKFA 2C3MA 4G65A 4DS5A 4KH0B 3H20A 5F8LA 2B5JB 4IH5A 4NL5A 3AJDA 1VBYA 3WNFA 1IKVA 3DDNA 4ZVPB 4ZK7M 3V6DA 1C6VA 3C15B 4NLDA 2B4JA 3M8PB 1S0OA 2V68A 5B0EA 4LFAJ 1RBAA 2V9WA 1QVGR 4NXMJ 5LY3A 2VFUA 3BZKA 2Y1RI 3EZ5A 4KSEB 4ZP7A 3D6MB 5ETLA 4ZCIA 1UL3A 2M5YA 2R7OA 2A0FB 1C0GA 5CZXA 2FZGB 1YGYA 4CWBA 3JSMA 4J9RA 4GVMA 1GTHA 1YDLA 2A41A 3A5OC 4JI4K 1T05B 3AV9A 5AQPA 2Y3YA 2DO4A 2D0AA 1CJTB 4CD3A 3TR8A 2JEFA 5IFMA 2NPFA 4CO4A 4USVA 3M6WA 1UFWA 1FDDA 2C2ZB 4OV6A 3MEEB 1XR5A 4DPWA 4EHUA 1LKZA 4FLTA 3OYCA 1IJEB 1S7IA 2WZ1A 4KHPK 3L0QA 3TNVA 5LMNK 4ZVUB 3QEIA 1NPKA 4CGJA 2QYCA 4HTIA 3AA5X 2Q3PA 2O8BA 1JJ2R 1S6QA 2V4JA 4IOBA 4BC4A 2E1AA 3H2UB 2HMPA 2P9UB 1WAFA 2LDYA 2OI2A 2AGQA 4M5KA 5JMVA 2XMMA 2PFUA 2DYAA 2LQ5A 4AL6A 4B8AB 3RGIA 1NGAA 1F0XA 1FKPB 4JD2B 4DX7A 2CH5A 1YTAA 4RL1A 3H46O 2W2OP 2RRNA 3VQ4A 3RMAA 1TUYA 4BQLA 1HHSA 1U1OA 4R0EA 1YLXA 5LSLA 2I0XA 1RA7A 3SDEB 1KAZA 4IWVA 3HK2A 2KFZA 3WT0A 2G1DA 4K43A 1VSIA 2GAGC 1YAGA 3AB2B 1VK0A 2P9CA 3NVMA 4KBOA 2P9PA 4B1ZA 3VHQA 5EX5A 2E44A 4JS4A 1RT1A 4W5QA 4B3SJ 1JLQA 4FNIA 1H3DA 1WC5A 4XDCA 5B09A 4Z7CA 3BBBA 4ZLNA 5BJRA 1WHXA 3VPZA 4FZVA 3AOAA 1EZZB 3GFYA 3PFOA 1QS4A 2I7NA 3NF7A 2ZZTA 4PRFA 3U3YA 2O66A 4P2XA 1ZETA 5I4MA 3P1GA 1KONA 4CZKA 2PYJA 1IQTA 4H0PA 2WUSA 1OSDA 3FBEA 3OQ2A 2W01A 1LOUA 3BEXA 2CPDA 3W63A 4CIFA 4DL3A 2HNYB 4TVAB 3W2VB 4TLQA 4A57A 3SAHA 1SIZA 4FL9A 2ZJRL 4E2FB 3IMXA 1HHQA 1RWMB 4WYBA 3M7VA 1YKWA 3VQCA 4OMFG 2P9LB 5D4PA 2P9NA 2NXUA 4WQ5A 2P8IA 1AW0A 2GMHA 3WXMB 3AOBA 4U67L 1QHTA 2VYPA 5F8HA 3CULA 3FUYA 1NDCA 3V9SA 4CLUA 3CWJA 1SZ2A 4FZYA 4OGCA 1CZBA 2BABA 2E5JA 3O9UA 4X64F 2EXUA 2VF3A 4M63A 2EC2A 3LTOA 3W64A 4EUVA 4H5NA 1ROFA 2G9OA 1KEKA 3CQ8A 1KXPA 4IKFA 1B92A 2ZJQL 2ASDA 2MSSA 2ASOA 3W9HA 2K7KA 4LSNA 3CJ8A 3E01B 4CFBA 1N34F 2DNMA 1S1XA 2XSJA 5A8RB 1H6KX 3H2VE 2RS8A 2QKKA 2ZWHA 3PW0A 4EP5A 2QV6A 2QA4G 1VBXA 4RO0A 1E4FT 1WSGA 2PA3A 4TYAA 4C9DA 3SIPB 2B4PA 3CD6N 3ZT4A 5CZVA 3DXBA 2J9CA 3D2FA 1M1KO 2YQ0A 2ZM6F 3VVUA 1EO1A 3PX6A 1VQ8N 2VOPA 4DL7A 1KS2A 1FK9A 2DGTA 2WRMA 1YF5L 3DOMA 5E41A 2VA3A 4ZP9A 1PAEX 3IBFB 1EP4A 2F8HA 3IR6B 3VF6A 5M1OA 4CFAA 4XTTA 4PKDB 1YITS 1FKPA 4JD2A 2YNIB 4ZVOB 3VMFB 4FLZA 4ID1A 5KFWA 4IOXA 2HS0A 4L76A 3FFIB 4Q2LA 1WJ9A 3VESA 1T0TV 2P6SA 4DFMA 3NBPA 1HD1A 4X62F 4DUZF 1JXBA 2ZJRQ 3NAHA 2MJNA 1WF1A 3LGNA 2MKCA 3S41A 4FJ5A 3DXMA 4F04B 2V94A 3DLRA 1C4AA 4TQSA 1VQ4S 3IC1A 4DHVA 3H1VX 4GNIA 4R5PB 3HOTA 5U47A 1RGIA 4JV5F 4LF8J 5IT9O 2C1EB 2MQPA 1S1WB 5AQZA 1CSJA 5DMRA 2UVRA 1NJWA 3NGYA 1XNQK 4QCLA 2UUCJ 3KUEA 4FVUA 4B1WB 2JH3A 4DFPA 5HSPA 4H4OB 2FQQB 4IKAA 2DFFA 4YB6A 2KXFA 2P9LA 3N28A 2YTCA 4FVCA 1RCHA 4GV9A 1WC6A 1U6BA 4ANCA 3AVIA 1X9WA 2GAHC 4TXSA 1IG9A 5F8NA 1XI1A 3D2WA 3HHEA 1VSKA 4NLOA 3K5PA 4FF1A 3RR7A 4DQSA 4WQ4A 4OZ5A 3N4WA 4FLUA 3AVCA 1R0CB 3B54A 3G10A 4WZMA 4AT1B 1VQ4N 1Q5VA 5E3QA 3L3VA 3T1HJ 3OXFA 3R5CA 3CCJN 4ED5A 4X4RA 1C1CA 1UCNA 3VTIA 2C3PA 4JI0F 3P6YC 3U1NA 4PYDA 4WF9L 1SL2A 2UXDJ 4K5RA 5C7PA