1T05A

Hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords oligonucleotide template
publication title Structures of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
total genus 138
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t05A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t05A05
4CFAA 4R8UB 1VSLA 4N47A 3RMBA 3NMAA 2OPQB 3EZ5A 3DLGB 2UUTA 2XCAA 1SL0A 1C1BA 4PQUA 2HNYA 3HP9A 2D3ZA 4EO8A 4ID1A 5KFAA 1NK8A 4IRKA 3DM2B 5JS1A 1VSMA 1XHXA 4FM2A 1FKOB 2VG7A 3DDKA 3ZSOA 5EU7A 1NKBA 1WSJA 4PWDB 3GIMA 4L8RB 3PJXA 3AA4A 4LQ9A 4ZPDA 4H4OB 1GOCA 4FJ8A 4CIGA 4K8XA 4BWMA 4ELUA 3OYDA 3NGDA 4I2QA 1EXQA 1BQMA 1S1WB 3SPZA 3M8PB 4LSNA 1UAXA 4UQGA 4U7CA 4MH8A 4WZMA 1QQCA 2VG6B 2B6AA 1JLAB 2KFZA 4NLSA 4FLUA 1JLGB 2CJQA 2O5DA 4DTXA 2ETJA 5J2PB 5KFNA 4J9OA 3OYLA 2W7PA 2G8UA 3RBEA 4IR9A 2P5GA 1YVUA 3Q8RB 1T94A 4FBTA 3JYTA 3DRSA 1VK0A 3LALA 4RNMA 3A2FA 1LWCA 1TL3A 3SNNA 4HCBA 3GV7B 3NGZA 3I0SB 2W8KA 1TKDA 3MR3A 4CEQA 5L9XA 5KG7A 5KT7A 3GIJA 4EEYA 4LY7A 4MQ3A 4Q5VA 3T5HA 1HRHA 3G0ZA 4IH6A 5DGAA 2XY7A 4B3OA 4DU3A 3RAQA 5FRMA 4OKKA 4DL5A 4B8CA 3H4BA 4ELVA 3KD1E 4KRFA 2YNHA 1X1PA 2QK9A 4ICLB 2OZSA 4C8NA 3N6MA 2BANB 3H5SA 5KFWA 3OJUA 2G8WA 1HNVB 3HVTB 1LWFA 2C2EA 4ECQA 4OPJA 1DTQA 4FZXC 5K14B 3ULDA 4M42A 4YR0A 3L2QA 2ITGA 3MXMA 1C0UB 1SH2A 5KI6A 1TAQA 4BACA 2OPPA 4CJWA 1KRPA 3N6LA 1RBVA 1ZETA 3JSMB 2AU0A 1EKEA 1JLBB 4DS4A 3KHGA 1I3AA 4IFYB 3NAHA 2ASDA 5T7BA 4C8MA 2IS3A 3B6OA 4B9UA 5C25A 4KKOB 3IS9A 4NRUA 1HNIA 1HYSB 3HT3A 4FYDA 5L1KA 4WFYA 2AGQA 1QAIA 4N41A 1A5WA 2WCXA 4IKAA 1SH3A 5HLFA 3QGIA 3AVJA 1TKXA 3G6YA 1BISA 4DU1A 4M3WA 3S3NA 4KI6A 2IM3A 2RF2A 4F50A 4O3RA 2DFHA 2ASJA 4URSA 5EWFA 1ZBHA 4NCGA 1REVA 5KFVA 5C42B 4ZHRA 4IFVA 2ZKUA 4IG0B 1RT5B 1QSSA 2Z1JA 1TL1B 3KLHB 3ZCMA 3NHGA 4K4VA 2R2RA 4DMNA 1RDAA 5KGWA 4FK4A 5HP1B 2P1JA 3HSTB 4DG1B 1SKRA 1JXBA 4ID5B 3O3HA 5L1LA 2G8IA 1LWEA 4O3PA 4DLEA 4F4ZA 1VRTA 4WFZA 3V81A 3L8BA 4IH5A 1T8EA 3SQ0A 5HROB 5HRSA 2O4IA 4ZVGA 1T05B 3PX4A 5KG4A 3AVKA 1NK4A 3D28A 2D7SA 4RW7A 4I7FA 5KFFA 3UDLA 1DLOB 4EBEA 4FJXA 2BQRA 4M95A 4ZTFA 4CJSA 5DG9A 3ZSZA 2HW3A 4NLYA 4AILC 4FLYA 1TKTB 3OYJA 3VQBA 1K1QA 1TVRB 3ICLA 1CZBA 5KFSA 3KLEA 3ZT2A 2W7OA 3CWJA 1XHZA 4KO0B 4N5SA 2IBKA 4OKJA 3DLRA 5C24A 4RNOA 4TQRA 4H4MA 3I5BA 5KFHA 4E7HA 2IJNA 2G8FA 4M3TA 3UPFA 4CGJA 1VSKA 4NLDA 1SL2A 1S1UB 2F8SA 4YR2A 2R8JA 4DF4A 3F73A 1QAJA 4J9SA 3FFIA 3T19A 3BSCA 3ALYA 3EPIA 2RPIA 2FLNA 3AVGA 2KW4A 1UA0A 3DLKA 1JIHA 3K59A 1C0TB 3M9NB 5KFTA 4Z4IA 2CKWA 2C2DA 1L5UA 1TV6B 4O44B 4KE5A 1UWBA 3DMJB 2VWKA 4Q43A 4K4YA 4MK9A 2V4QA 2RDJA 3KHLA 1LW0A 3BJYA 3NAEA 4R5PA 3FQKA 3D45A 3U3GA 2IM1A 1TQLA 3OYBA 3VQ8A 1DTTA 1T3NA 2F8EX 1K6YA 3FSIA 5KG2A 3I8DA 3SQ1A 4KB1A 5CYMB 1WSHA 1HQUA 2JGUA 3L2UA 3G6XA 4RUCA 2OH2A 1S1TA 2F8TA 2W9CA 4E7KA 2DY4A 3HVWA 2B4JA 2YNGB 4KTZA 4BDPA 3VQCA 1BQNA 2HHTA 4CHYA 1KCFA 4CIFA 5CY4A 4IOBA 4DFMA 4K4WA 3AO3A 4KSEB 5DQIA 2ALZA 2IAJB 3ZSRA 3CM5A 1IKXA 3V4IB 1KVCA 1RTHB 1JL1A 5KT3A 1NK0A 1B92A 5EDWA 1K1SA 4ECUA 2HHWA 3E51A 1ZTWA 1R0AB 3MFIA 4ED6A 1Q9XA 2FJWA 3HYFA 5I42B 1RT2A 4Y34A 2RKIB 3DOLA 2R8GA 4NLGA 4DSEA 2WOMB 4RW9A 1TKZA 4URGA 2WONB 5KFEA 3DLEA 1SKSA 4ZPAA 1S9FA 1VRUB 4WYLA 1RT6A 4CF1A 1D8YA 1LV5A 4ZP8A 3PW7A 3PO5A 1CZ9A 3K5LA 3OVNA 1HPZB 1YVFA 4DFKA 4F2SA 1RT7B 3GIIA 3PW4A 3RRGA 1X9SA 1NKEA 3RMAA 3CM6A 2YKMB 3NL0A 4DEZA 4CHOA 4K4UA 3NE6A 2ILYA 2Y1JA 4W5OA 3CQ8A 3VQSA 3AVLA 2VA3A 1N6QA 4O3SA 5EWEA 4KFBB 2R2UA 3OSNA 3OS1A 1WAFA 3PZPA 5J2NB 4TN2A 2WRMA 4RU9A 3NDKA 3KLIB 2PY5A 2XHBA 1IKYB 1SV5A 1NK7A 1RT3B 5D3GB 3TAFA 3MEEB 4CF0A 4CF8A 4ZTJA 2YNFA 4IQXA 3DRPB 2IC3B 1RTIB 3SUPA 1T7PA 2W9BB 1TAUA 1B9FA 1JXLA 2EC0A 2D5RA 5E41A 4IDKA 5KFRA 3DI6A 4R8UA 4CEEA 3GIKA 1Q8IA 3NFAA 3AVNA 1F21A 3HPGA 2OPRB 4E7JA 4FJHA 4HUFA 3KK1B 5C5JA 2ZE2A 1S5JA 2I5JB 1A5VA 3RWUA 3HKWA 4F3TA 4FJ5A 5KFMA 2IMWP 1GOAA 1BGXT 3AVMA 2E9ZA 1S9GB 4RZRA 3MFHA 4KTQA 3G86A 4RUAA 4MIBA 2HNZB 4E89A 3BGRA 4FW1A 2IDOA 3M8PA 3V6HA 3NCIA 3BREA 1RA7A 5KFDA 1GX6A 5J2MA 3S3OA 5F8GA 4OKEA 1JLGA 1RCHA 1RT4A 1NJXA 4ECRA 1BCMA 2R2SA 2R8IA 3QYYA 3EZUA 3RB6A 4Z4CA 2J6SA 1JX4A 1FKPA 2EHGA 4Q45A 4DL6A 4NYZA 2R7YA 4JV1A 4E1NA 4PA1A 3VQ7A 3HO1A 4J2AA 3AA5X 1S1XB 1KVAA 3LP1B 2FBVA 3LWMA 1J5OA 3LPUA 1IKVB 1U49A 3IRXB 4CEBA 4RW8B 3V1OA 4KV8B 4ED7A 4QWDA 4FM0A 3NGIA 1CXQA 3QZ8A 1BCOA 4FJ7A 3CJ3A 4GW6A 4FZYA 4CGFA 1L3UA 3PR4A 3E01A 1ZTTA 3V9UA 4NLVA 3CJ4A 3QZ7A 4FLWA 3PW0A 4CGDA 5KG6A 5JUMA 2J6UA 1VSDA 4HCCA 3TAQA 4CJEA 4EBDA 3AVBA 2XGQA 4QWEA 1XR7A 4ELTA 1QE1A 5FDLA 1N5YB 4HKQA 3CYMA 1IKWA 1TP7A 3FRZA 3HVTA 4ED3A 3MXIA 3V6JA 3TAMA 2P51A 4CERA 3RAXA 4WZQA 3SFUA 4N76A 4ZMMA 4MIAA 4DTRA 3NKYA 1RAJA 2XGPA 4J2DA 4QPXA 1RDBA 3MEDB 2FBTA 3NBPB 4Q0BA 1FK9B 3JSMA 3V6DB 1JLEB 2HNDA 4AH9A 3DOKA 3DYAA 4KHSA 4C8LA 2GUIA 3CJ2A 4J9KA 2R8HA 3C6TB 3THVA 3QLHA 2BR0A 3LANA 3OS2A 3OL6A 3ZSWA 2X78A 3QEIA 5DMRA 4FVMA 4C8OA 4F4KA 3HM9A 5KFLA 4FJ9A 5T14A 1S9EA 4MFBB 3D5MA 4AHUA 4OGCA 1S6QB 1Y97A 1NK9A 4NLTA 4XPCA 2BDPA 5KFYA 3BQ0A 3KLHA 1EP4A 2AX1A 2GV9A 4C8KA 3I0RB 4WE1B 5HP1A 4AHRA 5JS2A 1RILA 4O3NA 2JEIA 1I6JA 1MU2B 3K5NA 4NYFA 1LW2B 3K57A 3CJ5A 3OYKA 3H40A 3QIOA 1XI1A 3IN5A 3RB3A 4F4WA 4IR1A 4B9MA 3M8QA 3MECB 5DLGA 1BI4A 3QEXA 1RDCA 2X6NA 1GX5A 3ZSQA 4NLPA 3OYAA 3WNEA 4JS5A 3TAGA 2HHUA 3MAQA 1B9DA 1C1BB 4PQUB 3M9OB 2HNYB 2D41A 4DQQA 1S0OA 3KKRA 4B08A 2IGIA 1S48A 2VG7B 4H8KA 4J9LA 4EZ6A 3AO2A 1CSJA 3BDPA 4ED1A 4RW4A 4CIEA 3H2LA 1BIZA 3QIDA 1S0NA 4CHPA 4NLRA 1TK0A 4I2QB 1TKTA 1GOBA 1XWLA 3O4QA 3LP2B 4CHNA 1XR6A 2XWYA 3SQ2A 4LSNB 2WB4A 1Z4UA 3LP3A 1IH7A 1VSHA 2B6AB 4NLWA 5CYQB 4NCBA 1SUQA 3OYMA 4FW2A 2UUWA 5HRNA 4W5TA 4JUZA 3HP6A 5DK5A 2D0BA 5KFCA 1NNDA 4M3UA 5KG3A 3V1QA 1S1UA 4FLXA 1NJWA 3DRSB 2F96A 3C95A 4CF9A 1LWCB 2IM2A 3DLHA 3GYNA 4J9MA 3QESA 1C0TA 1S6PB 3SZ2A 1HQEA 2J6TA 4KB0A 1TV6A 4O44A 3DMJA 2V0NA 1RYSA 1C1CA 3HPHA 1SL1A 3SPYA 2YNIB 4B3OB 2VG5A 2YNHB 4QWAA 3OSPA 4Z4FA 4NLQA 3H98A 3OYCA 4YP3A 4RG8A 5CYMA 3FDSA 3MEGA 3HVAA 4R0EA 3QINA 5DGBA 5KTQA 4K8ZA 1W0HA 1TGOA 2YHBA 3NF6A 3QO9A 3B6PA 3SUQA 1QS4A 2WK4A 3AA2A 1RTJA 2G8KA 3LP0A 2IAJA 5JXSA 1N4LA 3QGGA 5EWGA 4LSLA 4EYIB 3V4IA 3OY9A 2D0CA 2RDIA 4DTPA 3P83D 3N6NA 4RNFA 3IS9B 4Y1DA 5KRSA 3V9ZA 2KZMA 1HNIB 3KLFB 4IKFA 4RW6A 2JEFA 3M8RA 4CJQA 4DS5A 2ATQA 3PW2A 3KK2B 2WOMA 5KG5A 5HLFB 2B43A 1TKXB 2YV0X 4QW8A 1KLNA 2BQ3A 1YT3A 3QIPB 5KG0A 1VRUA 3O3FA 3VQ4A 4NCGB 1REVB 3H59A 4QW9A 4IFVB 3CFRA 4G1QA 4TQSA 2D3UA 3ITHA 3GQCA 4WXOA 2X6SA 2IA6A 5KFPA 4FJLA 4DTOA 2HMIA 5F8NA 1JLFB 3SI6A 4JRQA 4FS1A 4ED8A 1U09A 3KLVA 4IG3A 1IM4A 1RT1A 4DL2A 4FXDA 4OLBA 5KFJA 2Y1IA 4FCYA 3CFPA 1BL3A 4KFBA 4X2BA 5J2NA 1WN7A 2E4LA 1VRTB 3CDWA 3TVKA 1IKYA 4O3OA 3Q8PB 1RT3A 2YKNA 3V81B 2HWHA 3OL8A 2FBYA 5KFIA 2GIRA 2IC3A 1NHUA 4Q8FA 1WAJA 4CE9A 4DL7A 4JV2A 4DU4A 4GC7A 4ZPBA 1KLMA 2Z1GA 4I9QA 3GILA 5KGXA 2IOCA 3TQ1A 4O4GA 4RW7B 1LAWA 1QHTA 4CECA 3UQSA 1S1VA 4QWBA 4LQ3A 4F4YA 4TY8B 2KTQA 2I5JA 4CK3A 3NF9A 3NH1A 3AV9A 4BE2A 2HB5A 4I2PB 4O0JA 4EYHB 3M9MB 4LH4A 5F8LA 3SQ4A 4M41A 1S9GA 3KLEB 4CGGA 3RB4A 3OYEA 3FQLA 3V6KA 4ECZA 1JKHA 4MKBA 1C6VA 3DRRB 5C24B 1O1WA 3LDSA 4HYKA 3UR0A 3EYZA 2V9WA 2ZQBA 4M45A 1VSIA 5L1IA 1ASVA 3OHAA 4JLHA 3P5JA 2UVVA 4ZVEA 4PUOA 3L3VA 3PUFA 4J2EA 4TYBA 4KHMA 3KJVA 4NLOA 3IG1A 4EBCA 2JEGA 4FJNA 1U04A 2OPSA 3FFIB 3VA3A 4MKAA 1VSEA 1D9DA 3O3GA 2HAIA 4FJKA 3T5KA 3OS0A 2IJFA 5F8JA 2KFNA 3DLKB 2FVSA 4DQRA 1QSLA 3F9KA 4KBIA 3WNGA 5I3UA 2JLEA 3LPTA 2A1RA 1ASUA 3KLGB 1WSGA 4OJRA 1EETB 3HL8A 1C0MA 4FK2A 4R5PB 2PZSA 3K5OA 4HTUA 4RW8A 3EPGA 1RBUA 4CEDA 3AO4A 1HMVB 2VA2A 3RBDA 2ZD1B 3WNFA 3C6UA 4ZVHA 1ZBLA 1DTTB 3ZT0A 1WNSA 3QEPA 4XO0A 4U6PA 3CIZA 5KFXA 5J2QB 1X9MA 2XY5A 2XY8A 4E3SA 3PX0A 1HQUB 2OPQA 4EP5A 3DLGA 2KZZA 5KFKA 3KK3B 4W5RA 4LD0A 4E7LA 4FLVA 5L1JA 4QOZB 1S1TB 2W9CB 1CLQA 3DM2A 4NYNA 3Q8SB 4CHZA 1N5YA 1FKOA 3L2WA 1BQNB 5KFQA 3PX6A 3QETA 3VQ6A 1A5XA 4YQWA 4CF2A 4FM1A 2LSNA 3OYGA 4PWDA 4J2BA 2E9TA 4B9TA 2AQ4A 1IKXB 4KHNA 3SFGA 4Z4GA 4H4OA 1UOCA 5KG1A 1RYRA 2GIQA 1ITGA 3K58A 3KTQA 4B9LA 4FBUA 2VWJA 1S1WA 2AJQA 1FK9A 1RT2B 4TXSA 3NGYA 4OPKA 3DOLB 3KNAA 4QAGA 4RW9B 1TKZB 2VG6A 2BRLA 1JLAA 2QXFA 3DLEB 3LAKA 1QTMA 4DTUA 3RMCA 2XI3A 3HJFA 3Q8QB 5J2PA 4YNQA 4WFXA 3ISNC 4G3IA 4CCHA 4LH5A 3SCXA 1D5AA 2BE2B 4O4RA 1T03B 4CEOA 3KOAA 4AHSA 2P5OA 4E7IA 5F8IA 1RTDB 4M3XA 5HBMB 4KB7A 3KHHA 4KAZA 1JLQB 1SH0A 3I0SA 4IH7A 1C1AA 3I0RA 4RNHA 3PVXA 4AHCA 1N6QB 4HUEA 1TK5A 1ZBFA 4ED2A 1MU2A 5KT2A 1SV5B 2HHXA 2FC0A 1L3TA 4BE0A 2V4RA 4I9LA 3RRHA 1U45A 3PO4A 2GBZA 4ICLA 2R2TA 2HVHA 4ZP7A 2G8VA 2FVQA 4IDKB 3MECA 3DI6B 2BANA 4FLZA 3MF5A 1HNVA 2B5JB 3CDEA 4AHTA 4CFDA 4AHVA 3TAPA 5K14A 4ZP6A 2BRKA 5J1EB 4IRDA 1C0UA 3RB0A 3MTKA 4NRTA 2ZE2B 2NUBA 4FLTA 3H5YA 3CVKA 1JLBA 1Q9YA 4ZPCA 4K4XA 2OZMA 4DSJA 4CFCA 4IFYA 4O55A 2PYLA 1BIUA 1KHWA 3TANA 4KKOA 1HYSA 2JC1A 2DPJA 3BGRB 1JLCB 3L3UA 3K5MA 4KREA 3LP2A 1WNEA 1JXEA 5F9NA 5DQGA 1G15A 4OL8A 4DFPA 2C22A 4FZZA 3T5JA 3NF7A 4E0DA 5J2MB 1SKWA 5CYQA 5HRRA 1OS5A 3ZT3A 4YFUA 1RT4B 4CJFA 4J9NA 2HHSA 5C42A 3TARA 4CJRA 4IG0A 4CJ5A 1RT5A 4E19A 3VQDA 1XC9A 4IBNA 1TL1A 2DFEA 3KIOA 1Z26A 1FKPB 1J9AA 4KHUA 4DSFA 4Y2CA 4Q44A 4O3QA 3BQ1A 3OJSA 4EP4A 3AVAA 5KT6A 4DG1A 2JEJA 4ID5A 4CJTA 1J5OB 1KVBA 1RBTA 2AGPA 4NLXA 3U6FA 1S6PA 3L2RA 3PW5A 1S0MA 3C94A 2YHAA 3CO9A 2HVIA 2Z1HA 3PV8A 2XI2A 5KFGA 5F8HA 3E01B 3VA0A 2Z1IA 4ECTA 3RMDA 1WSIA 4N56A 4MK7A 5KT5A 4CJ3A 2G8HA 2YNIA 2XO7A 3IGVA 4O5BA 3BSAA 4DTNA 5HROA 4DFJA 2D0AA 3SI8A 4FJMA 1T05A 5KFUA 4J9PA 3VQPA 3I5CA 3OL9A 1S49A 1QE1B 5FDLB 1IKWB 3OYFA 3OYHA 4YMEA 4FJGA 3QNNA 2HHQA 3UIQA 3TAMB 3OLAA 3V9WA 4W5NA 4TSXA 3VQ5A 2OYQA 1DLOA 3H4DA 3RR8A 3KHRA 2JC0A 2E6MA 3VQEA 4CJKA 3KD5E 2EX3A 4EZ9A 2WTFA 4CEAA 1BQMB 4KAIA 4Q0BB 4ECXA 1KFDA 1TVRA 4DSKA 3TABA 3LAMA 5DQHA 5KFZA 2AX0A 4KO0A 2HNDB 1XR5A 3DOKB 4CEFA 3CJ0A 4K50A 3KLFA 4Z4EA 3DYAB 2FVPA 3HK2A 4WYWA 3V9SA 1Z25A 3LZJA 3ZT4A 2Q3SA 3KK2A 3BR9A 3RTVA 3QLHB 2C2RA 3SYZA 3SUNA 3JYTB 3NH2A 3KMSA 5HRPA 3I5AA 3QIPA 1RNHA 3SJJA 5F8MA 1S9EB 1TL3B 4Y3CA 3AVFA 5FROA 4GMJB 4JS4A 2FVCA 2HWIA 1EP4B 1X9WA 3T1AA 4ED0A 2W8LA 3D0PA 5KFOA 1JLFA 2DFFA 5KFBA 3AO1A 1KHVA 3SV3A 4NLUA 4DF8A 2FJVA 3HPOA 5KRTA 3ZT1A 5CZ2A 2GC8A 1RBSA 3M8QB 3AO5A 1I39A 1BI4B 1W25A 3K2PA 1D9FA 4K4TA 2FLLA 4HVJA 1LWFB 3QERA 2XY6A 1KFSA 1N48A 1RDDA 3T5LA 1DTQB 4K4SA 2QKKA 3VQAA 4NCAA 3U3YA 4EO6A 2OA8A 2OPPB 2YNGA 4DTSA 1U47A 4DTMA 4KHWA 4WXWA 2R8KA 3MR2A 4PY5A 1VSFA 3LZIA 4DTJA 4CK2A 3ZSXA 1RTHA 4RW4B 5C25B 4TY8A 1R0AA 1HYVA 5KT4A 3S3MA 1WSEA 3OYIA 5I42A 3BQ2A 2RKIA 4I2PA 2ATLA 5EUHA 4DSIA 2WONA 3QEWA 3TAEA 2RN2A 1C2PA 2RF2B 3TWHA 1SUQB 4QCLA 3DRRA 3VQ9A 4B9VA 4BWJA 2BGGA 2QE5A 4ZHRB 4W5QA 1J54A 2PYJA 3IAYA 2I1RA 4CGIA 4TY9A 4FS2A 1MMLA 1N56A 3SUOA 1HPZA 4CEZA 1UA1A 1WSFA 4TLRA 3MR6A 4M94A 4F2RA 1RT7A 4F4XA 4B8AB 4KTWA 2BQUA 3CFOA 4XIUA 4ZP9A 1TK8A 5DG8A 1W9HA 4KHQA 3NAIA 2FBXA 2YKMA 3TI0A 4F3OA 3ZSVA 4CJ4A 1NK6A 2XC9A 4BDYA 1HQEB 1RBRA 4CJVA 2FJXA 1LWEB 4XPEA 3OL7A 3KLGA 3GV5B 2UVWA 1EETA 1C1CB 3KLIA 5D3GA 4J9RA 4ECVA 3MEEA 2X74A 3DRPA 2AWZA 1HMVA 1RTIA 2W9BA 2ZD1A 4OVLA 2VG5B 1U4BA 1NOZA 2O4GA 1HYZA 3KKSA 5J2QA 4CJLA 3CG7A 3V1RA 4OLAA 4K4ZA 4J9QA 1KSPA 3MEGB 4I7FB 4GC6A 2OPRA 4HHTA 1QSYA 3KK3A 3MXJA 3QO9B 3KK1A 2UVRA 5SWMA 4ECYA 1NOYA 2XRIA 1RDRA 1NJZA 1RTJB 5SZTA 3LP0B 1D0EA 4LSLB 1L3VA 4Z0UA 4DSLA 3AA3A 3GV8B 1HARA 4URQU 4JRPA 2HNZA 4FJIA 3H5UA 1YTUA 4RW6B 4H4MB 2E6LA 3M8SA 4ECWA 1ZYQA 2ILZA 4CESA 4DQPA 1KTQA 4O0IA 1S4FA 4CK1A 4NZ0A 4BE1A 1ZBIA 4YR3A 3QNOA 3O4NA 4BDZA 3OHBA 3AVIA 2DPIA 4CHQA 4B9NA 4KHYA 4DL4A 4G1QB 4DLGA 2WHOA 2QKBA 4CJUA 3ITHB 1L3SA 2BE2A 1UWBB 1T03A 4KPYA 2HMIB 1QUVA 2XCPA 1RTDA 1S1XA 5HBMA 1LW0B 3CDUA 3LP1A 1JLQA 1IKVA 3BSNA 3IRXA 4H54A 4KV8A 5FRNA 4IG3B 3NF8A 1RT1B 1FXXA 3TR8A 4RNNA 4MK8A 3HHKA 4DQIA 1VSJA 3PJWA 3G6VA 4M3ZA 4KHRA 4Y2AA 4DL3A 3L2VA 2YKNB 4Q8EA 1YTAA 3PHEA 2IM0A 2QV6A 3S9HA 3P1GA 3OYNA 1EX4A 1NHVA 4CGHA 5DLFA 1ASWA 1KLMB 5DG7A 1S97A 4OGEA 2B5JA 1HJRA 1NKCA 3PY8A 4O4GB 4M3RA 3KMQA 4CFBA 5J1EA 1S1VB 5F9LA 1IG9A 4F8RA 1NK5A 4Y1CA 1IO2A 4M3YA 3MEDA 2A1SA 3NBPA 2ASLA 4FK0A 3RR7A 3V6DA 3DLBA 4TYAA 1JLEA 4HUGA 3BSOA 3VN5A 2HHVA 3OLBA 3EY1A 1J53A 2C28A 1JKHB 3WNHA 4QWCA 2UVUA 1RT6B 1JLCA 3LWLA 1U48A 1D1UA 4ZVFA 4KI4A 1ZBUA 3QEVA 3C6TA 3G10A 3AVCA 3H08A 1RA6A 4PUOB 4CJPA 3KJVB 3IG1B 4GVMA 2E9RX 2OPSB 3VQQA 4E1MA 4MFBA 3IGNA 3HVRA 5CZ1A 3ZSYA 1JL2A 1S6QA 3ASMA 1NJYA 3ISND 4DQSA 3SV4A 2FLPA 2AGOA 5I3UB 4WE1A 2DTUA 2W9AA 1WLJA 3PR5B 1LAVA 4JV0A 4ECSA 3MR5A 1CXUA 3V9XA 2KQ2A 3QGHA 1LW2A 2YNFB 1BHLA 3T3FA 4B9SA 4Z4HA 3NH0A 3H5XA 4IRCA 4DWIA 3C6UB 2FVRA 4FJJA 1S10A 3HXMA 3AVHA 2W42A
chains in the Genus database with same CATH superfamily
2FPHX 4CFAA 1FI4A 1AA1B 2YWFA 2D1CA 2F5GA 3IBFB 1S59A 4USWA 1C1BA 4PQUA 2HQDA 1HLUA 4HDGA 2HNYA 2L3MA 4I6WA 4ID1A 4Y2MA 3DM2B 4TNOA 2AMCB 5AXKA 3GR1A 2E29A 4FM2A 3DDKA 2MKSA 4OHYA 5EU7A 2W2NP 3WXJA 4A8FA 1WSJA 4CBUA 3R6GB 3PJXA 5GAHU 3AA4A 4LQ9A 4ZPDA 2V50A 1ATSA 4M7XA 1RAAB 2QEXN 4RJVA 3DRYA 3NGDA 1M1HA 1BQMA 3M8PB 3J8AA 3PYFA 2BVZA 2VJVA 2CJBA 4UQGA 1BA1A 2O5DA 4CLUA 3JTOA 3QQCD 2W7PA 1IR0A 3ILLA 1TUGB 4IR9A 1T94A 3JYTA 2KH9A 4WKRA 3ILJA 2J0SD 3MWBA 4K5SA 3OR1A 2NS1B 4M5DA 3SNNA 2QWOA 1YSJA 4DR6K 3GV7B 3FZHA 3I0SB 5A8RB 4ZN3A 3W9HA 3MR3A 2OCEA 2OTJS 4C3LA 3DLLQ 4MQ3A 1VQPN 1HRHA 5HOOA 2ADBA 4DU3A 3KG0A 3RAQA 5FRMA 1LXNA 4ZS6A 2M9KA 2YNHA 3PCOB 2DRBA 1UFLA 2BANB 4OV6A 3OJUA 2CVEA 1BHNA 4LFCF 4ECQA 4G65A 5D15A 2JDJA 4OPJA 2HVZA 3L2QA 5BXIA 5C0YA 4CW7B 5C2FA 1KRPA 3N6LA 1ZETA 4KJIA 1SC1B 2JSXA 4IFYB 2F4FA 4C8MA 2GQQA 1YBTA 3W61A 4E1JA 5BYSA 4B9UA 1WBBA 3IS9A 1IBKJ 2AGQA 1QAIA 4LF8F 1V3SA 2UV8G 2HSEB 2U2FA 1LOUA 1BISA 2XZTB 2IM3A 4ZCMA 4B9QA 4URSA 3UI3A 2BOPA 3T6BA 3R8YA 1REVA 5C42B 4IFVA 1IG8A 2KXHA 1QSSA 4JV5F 1TL1B 3R5BA 4AYBD 4M63C 2H1YA 3Q8UA 4DR3K 2F65A 2GAHC 4FK4A 4DJBA 1YTYA 2HQCA 2P1JA 1S12A 2VKRA 3EVOA 3ENOA 5L1LA 3LUYA 2OTLS 3UE2A 4HI2A 3MAAA 2VODA 3NS7B 1T8EA 4KGXB 4DV0J 2PAVA 4N7TA 4NLCA 1WF0A 3BBFA 1IN0A 2MQOA 1NK4A 3BB5A 3D28A 3DN9A 2DGVA 2WB1D 3TUPA 3UDLA 3SAGA 1CULA 4L3NA 4FJXA 3HSZA 1PC5A 2NNWA 4ZTFA 2E7WA 2VBZA 4RX6A 3MUMP 3ZSZA 4AILC 4FLYA 4OLPA 2W6LA 1B70B 5D4OA 2W7OA 4KO0B 3C16B 4DR2J 2J4RA 2IBKA 3DLRA 3HT0A 1MDUB 2ZBQA 4H4MA 4KQZA 5KFHA 4E7HA 5K8NA 2YWGA 2VUGA 2ZHBA 4X4VA 2MKIA 3QATA 4DF4A 4GKKK 4YHHK 1AT1B 1X8DA 4J9SA 3FFIA 3EPIA 1MWQA 3DXBA 2FLNA 3L4QA 3AVGA 1UA0A 3K59A 4MLEA 5HJYA 1LFWA 2YJEA 1JNRB 5DM7L 4ZDNA 3RYLA 2G0JA 3C15A 3CHWA 4KE5A 1Y3KA 1UWBA 5B09A 3TVYA 2CAJA 3M6UA 3HHLD 3NMUA 1WUAA 1TQLA 4A8YA 3VQ8A 4JN4A 3CD7A 3ZNJ1 1WF2A 2ASOA 3FBCA 3WEEA 1HNXF 3SQ1A 3M1VA 2XYHB 5CYMB 4QIWD 2NXEA 5KQ8A 2HZAA 4ILRA 5DRKA 2F8TA 2W9CA 3RGIA 4YDDB 3W63A 7FD1A 2B4JA 2QMXA 2YNGB 4I6AA 4CHYA 1KCFA 3AODA 4BRFA 3O1WA 4A8MP 3CM5A 3AGKA 3V4IB 4YY3J 1NK0A 2XMUA 2DHGA 2NSCA 4Y34A 4NLGA 2WVCA 5MLCV 5JVGQ 1T95A 3L95X 4URGA 4X4PA 2QTDA 3FBFA 5KFEA 2UUBK 4ZPAA 3KK7A 1S9FA 2WTUA 4X65J 1GMWD 1PKUA 3O1BA 1V5IB 1VRUB 1YUWA 1D8YA 2HFZA 3R1HA 1A7GE 3AXKA 1LV5A 1K8AT 3BKUA 4JKAA 1SCJB 1ACMB 1WC4A 4CLKA 1S3XA 2BJ7A 1K47A 2XM3A 1U2FA 1NKEA 2A3ZA 2YKMB 4ZJOA 4K4UA 3NE6A 4IOAQ 3O1LA 3CQ8A 2AJ4A 3L09A 3ZTPA 1Q86T 3O9UA 3C6AA 3OS1A 2P6TA 3BF4A 4P6QA 1LWXA 1RADB 4DZDA 1GMWA 1OYDA 1NK7A 4I69A 4CF0A 4CF8A 3QBCA 1DBDA 2IC3B 1CJTB 1A6LA 2ADCA 4C2MA 1T7PA 1TAUA 4HHHA 1VAZA 4BG9A 3J80O 4CWBA 3UD4P 4R8UA 2V51B 4BGBA 3SCIE 4FJHA 2LLZA 3CJSA 2RT3A 7FDRA 5M1PA 1S5JA 1A5VA 3AARA 3RWUA 3FSYA 1B0PA 5SUHA 1WACA 2EK6A 5AJ3J 1BGXT 2QI2A 4U7UD 1WG5A 1RLDA 2HNZB 3LDPA 4JKGA 3NNCA 4M5NA 4DUZK 2DKOB 4KH6A 3J80U 1T9TA 2IDOA 1KVKA 3BREA 2XQCA 2DEIA 4RR5A 5LMUK 1OQ3A 3EWGA 3KUGA 4OKEA 1VQ7N 1JLGA 4LC9B 1RT4A 4AXJA 1U6FA 5L9NA 1NJXA 4IUFA 4ECRA 2XS2A 2DR7A 1NRKA 4QIEA 2Y8WA 3SBTA 2FGOA 1H2UX 3IO1A 4AM7A 2J6SA 4DL6A 5A0YB 3D7SB 2RQKA 4CZCA 3ZLJA 1NZAA 2EFVA 3VF0B 5EX3A 4ED7A 4QWDA 3CJ1A 3RW6A 1V3RA 4FJ7A 3QZ8A 1BCOA 3CJ3A 2Z2MA 4FZYA 2RS8A 4IOAL 3V9UA 2Q2RA 2ZWOA 1VQ8N 3P6YC 5GADU 4NMXA 2XZWA 4NASA 5BR8F 4QU7A 4NEZA 1VSDA 3LH2S 1L3KA 2IRUA 1QE1A 1IKWA 2NXCA 2XB2D 5D4PA 3IUCA 3MXIA 4W90B 3Q8YA 3V6JA 3TAMA 2P51A 4Z94A 3WXLA 4E98A 4B02A 3SFUA 4ZMMA 3BS9A 1RAJA 4DX6A 1YJNN 1QDUB 4QPXA 1F5AA 4FWOA 3JXOA 3CCJN 1Y11A 4Q0BA 3CULA 2OMOA 3V6DB 3BBBA 2HNDA 2YI1A 3H1QA 3MN7A 3DYAA 3MMBA 5C2CA 2WSEC 3R8EA 2FQQB 4BC5A 2HQGA 2ZM6F 1N52B 3THVA 3KJFB 3M2VA 3LANA 2BR0A 3OS2A 3OL6A 3ZSWA 3QEIA 5GAGI 1RQ0A 1I51B 4OYOA 4FVMA 2GWJA 3DNCA 2C2ZB 4FJ9A 4MFBB 4B3SF 2GNKA 1SVDA 1Y97A 2LQJA 1NH8A 5KFYA 3HZGA 3R7SB 1WELA 3KLHA 4C8KA 4LFAF 1Q53A 3PRDA 1QQOA 3ET6A 2ZBPA 5JS2A 4O3NA 2JEIA 1U0SA 3IM9A 1I6JA 5IWAF 4IXCA 3SBGA 4LF6J 3OYKA 3H40A 5I3PA 1U02A 1N0VC 1UZDA 3IN5A 1XI1A 2MQ8A 5CXTA 4WBFA 1N5QA 5AQYA 3MECB 3ULHA 1BI4A 4QIFA 2XYGB 3WXKA 4NLPA 2GJFA 1F3FA 4DR5F 3WNEA 1X4DA 2HHUA 4ILMA 2B4UA 1N5VA 2VFUA 3KKRA 2NLXA 1S48A 2VG7B 5ETOA 2QMUB 4ED4A 5GAHI 1KAYA 4KRWA 3CJ8A 3SCJE 2OELA 2DHAA 2OFHX 4CLYA 1FNXH 2M0GB 2XSFA 5A2QO 4C9DA 2WW8A 1N34J 1D8ZA 4CHPA 1TK0A 5IV3A 4CT8A 1FRJA 5F3ZA 1XWLA 4ANEA 1Q18A 4CHNA 2IMOA 2XWYA 1KQSM 3Q83A 2EK1A 2P6SA 1IH7A 1CJVB 5CYQB 3MMCB 3L6QA 4P10A 1SUQA 3OYMA 2LKZA 5HRNA 2K3KA 5DK5A 2EC2A 5KFCA 4IJAA 3NCRA 3ILOA 2E7XA 3T7ZA 3TUJC 2ZJRQ 5LMNJ 1NJWA 3THYB 3C95A 5A2QU 2QEXS 3CJQA 3PIPQ 1LWCB 3MN9A 4I6MA 3MMAA 1F5CA 1RU1A 4UTGA 1H2VZ 2P8IA 4HDHA 3VGTA 1HQEA 1TV6A 2Z8QA 1X31C 2H4WB 4LSZB 2V0NA 1RYSA 1C1CA 5M2PA 2VFVA 3UB5A 1LOTB 2QG9B 2YNIB 1ZM3A 3ETOA 2HIQA 1YVNA 4QWAA 2VBXA 4PR6A 4NLQA 3AJ1A 3OYCA 4YP3A 4RG8A 4UOCA 1UEVA 2FJAB 4R0EA 3QINA 1N36F 2DO4A 1OPIA 5DGBA 4K8ZA 1TGOA 2DITA 3I96A 4W98A 2JX2A 5GAHP 4F36A 6FDRA 3AAWB 1VQPS 1RHUB 3T41A 3AA2A 1RTJA 5JXSA 1JNZB 5EWGA 3TSQA 3W8GA 4IOCL 2RMLA 1CJUB 3V9ZA 3ILIA 2KZMA 5KRSA 4FOEA 3KLFB 1Y64A 4ZLPA 2I9SA 3ZETA 3UO0A 3T1HF 4CJQA 4DV4F 2HFUA 1BUXA 3TEGA 4IFEA 4ES1A 3C14B 2E2OA 2AP6A 2B7BB 2E1RA 1YT3A 5CQGA 3GCXP 4YEAA 3O3FA 4OJ3A 3H59A 1NCLA 2D0PA 4PXDA 1UJ6A 3CMAS 5KFPA 1RHKB 4DTOA 2OHDA 3UCZP 4FS1A 3PIPL 4DKWA 5GMEA 3KLVA 3EN9A 4DL2A 4H0TB 2KT3A 2ZJPQ 3UNGC 3CFPA 3QRQA 5J2NA 5B0EA 2E4LA 3Q8PB 2HWHA 5HQMA 2FBYA 3THPA 1NHUA 1T9VA 1WAJA 4FKYA 3LF0A 4ZPBA 4DV5J 3P49B 3OQ2A 3MX2A 1KD1O 2CUYA 5G4DA 2YVSA 3CD0A 4O4GA 1KR4A 4L3KA 4RW7B 1KS2A 1O13A 4QWBA 4RWTA 4TY8B 4OHZA 3TX8A 1VCTA 2KTQA 2I5JA 2AZ1A 2HSTA 2VH7A 2CQHA 3NLCA 4WF9Q 2CG8A 3SQ4A 2QA2A 1S9GA 5AZIB 3EZOA 4XTTA 1ICEB 3T1YF 1NG9A 3V6KA 4MKBA 3DRRB 5C24B 1SS6A 3UR0A 3R9LA 4JI3K 1OVQA 2ZQBA 1HBMA 1QTNB 3QFHA 3P5JA 1G6BA 3D6FB 3O9TA 5B0CA 1GXUA 4ZVEA 3Q24A 4V19X 4PWWA 3TYTA 4KHMA 3KJVA 2X1FA 3FBEA 5F3TA 2FF3B 1PSDA 2CG4A 2JVOA 1D9DA 2HAIA 3Q7CA 1TUUA 3AFGA 2KFNA 5F8JA 2ACYA 2HHHJ 1QSLA 3A3PB 2VL1A 5AZJA 1YLXA 4FF2A 3CJAA 3LPTA 4MLHA 1VIOA 4HR2A 4R5PB 2PZSA 4RW8A 1RBUA 3W5ZA 4LF4J 5KPRA 4UUWA 3WNFA 3T6JA 2LDIA 2MQQA 1HNXK 3DXSX 1WNSA 4B3RJ 3H3NO 2PFDA 3CIZA 5J2QB 1X9MA 4MO5A 4NWBA 5CD4H 2XS5A 5JMNA 2OPQA 4EP5A 4W5RA 4LD0A 4DCJB 4FLVA 2XMAA 1S1TB 3Q2TC 1F6TA 1FFGB 4LR9A 3D1QA 1N5YA 4NXMK 1BQNB 1I94J 2WVDA 1IBMF 2R7OA 2Z2YB 1XMOF 4J2BA 5H9EK 2AQ4A 4H4OA 2XMWA 2MKHA 4JI0J 4A8QA 1SIWB 1UOCA 1UVLA 3ENHA 2ZH2A 2VWJA 3E2EA 1S1WA 5MAOA 2AJQA 1FK9A 4OPKA 3EGNA 3NGYA 3DOLB 1RGVA 2CADA 2KYXA 1KQKA 2EW9A 3MXHP 4ANDA 1CZAN 2POKA 3T9NA 4ZVTB 3SK3A 4KC5A 4USIA 1VQ6N 2HQ3A 1E3MA 2HQIA 3L0QA 3CD6N 2FSNA 5BREA 3VTHA 1M0SA 2BE2B 3D66A 4L76A 3CCEN 4PYDA 5HK4A 2P5OA 4E7IA 2WVBA 4M3XA 5HBMB 3MN5A 1JLQB 1KP6A 2BKNA 2K06A 4U9RA 5B0BA 3I0RA 4C8ZA 8RUCA 4B1ZA 3U4LA 5T7LA 1RWPB 4NB4A 1MU2A 2LECA 4DV1F 2ZUGA 1L3TA 6AT1B 2HVHA 3MM8B 2G8VA 5LSRA 2AJFE 3MF5A 3H25A 2B5JB 2BUNA 3ENWA 3CDEA 5D8HB 2DXFA 4LF7K 4AHTA 4CFDA 1QJHA 4WFNQ 3QFPA 3WX4A 3TAPA 5K14A 5J1EB 4WK1A 1VI7A 3NY0A 2APOA 4P2SA 3AOBA 2NRWA 4I4BA 3WXIA 3MTKA 3FZMA 2CWXA 4ZCIA 2FB0A 3EE9A 4DV7F 1MNEA 1Q9YA 4DSJA 7AT1B 2PYLA 5F41A 1KVIA 1KHWA 3TANA 2E2QA 2O66A 3ULEB 3DDIA 1JLCB 4DR1J 4K0KJ 1JXEA 1G2EA 1FRHA 3VEZA 1RBAA 4PG7A 3K7RA 2Q6BA 4BCAA 1F60B 5GAEI 3UKUB 4CJFA 1UVJA 4CJRA 4E19A 4CJ5A 1RT5A 2H3GX 2P9PB 5CYJA 3D4JA 1FKPB 4O3QA 3BQ1A 4X64J 1UFKA 2LMIA 5KT6A 4M5IA 3EVMA 4ID5A 1J5OB 2AV5A 3EX7B 1VIXA 3L2RA 1P8GA 1VS3A 3O9SA 2HS4A 2Z1HA 3PV8A 5KFGA 5F8HA 2DGSA 4I6YA 3H7HB 1R0BG 2DR8A 4N56A 2FLOA 5LL6Z 2DISA 3BSAA 2I2YA 3NGSA 3CIMA 4NXNK 2V6AA 5IS2A 5KQDA 3GP9A 4B3MK 4YMEA 4NYOA 3A12A 3V9WA 5HAOA 2W01A 1DLOA 1IWAA 3RR8A 3KHRA 3EKUA 3TRGA 2EX3A 4CEAA 1VQ8S 1BQMB 4KAIA 2GTDA 2D9OA 2AJ0A 5KFZA 3PKYA 4CI6A 1N33J 5L46A 1ZPVA 3H46O 2ZUAA 3QFWA 3DOKB 3I31A 2J8AA 3AOAA 2KHCA 4J37A 4Z4EA 1HUXA 2ZM6K 3HK2A 4WYWA 2BJ1A 3M6XA 2P2CB 2RHQB 3RTVA 2J9DA 1WOQA 3SYZA 2L9DA 3JYTB 1YJNS 3NH2A 2V34A 3SJJA 1HI0P 3CCJS 1S9EB 4M5DB 5FROA 3K9KA 1VHIA 3A0IX 2P9IA 4GMJB 3R5GA 2Z2ZA 3IAS9 1OSDA 1W2BM 1ATRA 1EP4B 1HR0K 3N4PA 2QLXA 4ISEA 1WD6A 3BPDA 5LL6d 5LJ5Y 5GMKa 1CJKA 5GADP 4DF8A 4NLBA 3MOJB 4HT7A 2GC8A 1RBSA 5CZ2A 1TMJA 3M8QB 2A40A 2PC6A 4H03B 3K2PA 4DN0A 1HNZJ 3L4IA 4F3MA 1KFSA 5ADXH 1N48A 4EIAA 4P74A 2YPYA 3T5LA 4AL6A 4K4SA 1UVNA 5EN1A 1KXPA 2DGWA 3U3YA 1U0HA 4DPXA 2QC3A 1U47A 4DCOB 2JRSA 2QA4G 4KHWA 2J0QD 4L74A 4PQAA 4IO8A 3VAMA 4PY5A 3OBYA 4QR2A 4CK2A 1WF1A 4ZPTR 3WIVA 2UV8A 4RW4B 3CI5A 1R89A 5KT4A 1TL5A 3P3DA 1HLWA 2JZ5A 2J9EA 1X4GA 3AAPA 2ATLA 4BR4A 1IBKF 4KH5A 1EWRA 2EPIA 1PJ7A 2RN2A 1YX2A 2RVJA 3TWHA 4JEPA 4DR7K 2BGGA 2BEFA 3VEXA 4ANCA 1HWUA 3CC4N 2MZJA 1OH6A 2I1RA 4FS2A 1MMLA 2CPHA 1WSFA 4P75A 4DPYA 4F2RA 1RT7A 4F4XA 1MN7A 2HK3A 4B8AB 4DPWA 1WDTA 2F9JA 4ZA1A 3AAQA 4KHQA 3TI0A 4BRGA 2EG1A 1NK6A 4W4MA 5HL7Q 1M5OC 1QUPA 4OFZA 3OL7A 5HMWA 2UVWA 3GE9A 4DX8H 2UUAJ 3BH6B 4NI2B 4CBXA 2ZD1A 4OVLA 2VG5B 3PYDA 4P7VA 4V19J 1HYZA 1RCXB 4NZ7A 4A57A 4CJLA 4DV0F 3CG7A 3V1RA 5B0DA 4OLAA 2DRAA 4K4ZA 1KSPA 5HQLA 1X4FA 2OPRA 2IRYA 3SEOA 4ENOA 1CULB 2WBNA 3KK1A 5SWMA 4ZVRB 5DM6L 1U1QA 2F7VA 2CXEA 4MJKA 4U7UK 1R7IA 1KQSR 2F3JA 1RP5A 1GT8A 5EVZA 4URQU 3KDOA 1KN6A 2VPWB 3T1HK 5DDRC 3QJLA 3H5UA 4H4MB 5E0OA 4DV4K 2E6LA 3M8SA 1NGFA 4DR2F 3QT7A 3O6WA 1KTQA 4O0IA 3H8YA 2NPIA 1MG7A 4DI6A 1LFPA 1U2VA 5AQQA 2YWWA 2HBRB 4IO9L 3M05A 3AVIA 4B9NA 5IT9U 4G1QB 2WHOA 2OFGX 3ITHB 2QLFB 2ABYA 2F4VK 2OANA 2DGUA 1UWBB 4E2FB 3W3DA 2HMIB 2XCPA 4YDXA 1S1XA 3LP1A 1MROA 2HPUA 3BY5A 2J8SA 1GLCG 3P5TL 4H54A 4KV8A 4WKYA 2XNRA 1U7LA 3LGMA 3NF8A 1FXXA 1E6YB 3TR8A 4DQIA 1EQYA 2CPZA 1VSJA 2B0GA 3WEEB 4DV6J 4KHRA 4Y2AA 4DL3A 3L2VA 2CGJA 3O3LA 2ZH3A 1EX4A 3BO3A 3IDHA 2E2PA 2RE2A 2HK2A 4CGHA 2V94A 1OPZA 3KUHA 1Q7YO 4I68A 3PY8A 2H4YB 3JQMA 3HHLB 4OYIA 2K2PA 3KMQA 4CFBA 4F8RA 4C0OC 4Y1CA 1Y9OA 1HL6A 1D9AA 5AFUA 5D78A 3K8WA 3NBPA 4YY3F 3CCLN 2CJKA 3ENVA 3UKRB 3DLBA 4TYAA 4PKDB 1X4EA 1E6VB 2HHVA 4YN3B 1J53A 2P9SB 3QEVA 3NGTA 4PG5A 4X65F 3AVCA 1RA6A 4B3TK 1C4CA 1P6TA 3VQQA 3IGNA 4LVNP 3ZSYA 3ASMA 1NJYA 2LP4A 4J9VA 4DR4K 2O1PA 2FLPA 2DTUA 4WE1A 4RL1A 2W9AA 3PR5B 2YH1A 4Y00A 4XDDA 1CXUA 2B3TB 1FESA 1I3OB 2PFFB 4UOHA 3MN6A 2ZDOA 3CGIA 2FHKA 1IBLJ 1S10A 1BE4A 3D3BJ 1NM2A 2J9DE 4R8UB 1VSLA 2PMZD 4N47A 4Z7YA 4DX7A 1XMBA 1Z1ZA 4MDAA 3EZ5A 3DLGB 2XCAA 3OBWA 3HP9A 2I0XA 2IA0A 5G0RA 5M1KA 4IRKA 1VSMA 2VD3A 1B99A 2B8PA 9RUBA 1FKOB 1NKBA 2HAFA 5AXLA 3PNIA 1ZA1B 3W2WA 3GIMA 1NO8A 3TVZA 4LF9J 4ED5A 5IM0B 4ATNA 3OYDA 4I2QA 1IR2A 3W3SA 3QGPA 4OYMA 4LSNA 1UAXA 4QU6A 4U7CA 4MH8A 1X4BA 2VG6B 3ATVA 2B6AA 1JLAB 4J91A 2KFZA 2HFVA 1X0FA 4KPCA 1JLGB 2R7RA 4CZKA 4DTXA 2ETJA 4X62K 1KD1T 3GLJA 4IQMA 4J9OA 3OYLA 2G8UA 4Y28C 2GUPA 1YVUA 3Q8RB 1YJWN 1FJGJ 3G82A 3A2FA 3N01A 1TUWA 1QZ5A 2AA4A 1K0VA 3THWA 4OLOA 2O8EA 1FE4A 1TKDA 3HRGA 1U1PA 1S72N 5J1NA 5AQOA 4CEQA 2N4DA 4CYUA 5KG7A 4CT9A 3GIJA 2GHPA 4FF3A 4DV1K 4ZIVA 4Q5VA 1VQ6S 1NGJA 4Q2MA 4D3HA 2VCPA 4IH6A 5DGAA 3CD6S 1S79A 5FD1A 4DL5A 3R1XA 3H4BA 2P9KB 3KD1E 1MMDA 2QK9A 3CCES 1OWXA 2PGCA 4PRFA 4C8NA 5KFWA 2C2EA 3PEHA 1NGBA 2VQFJ 2NREA 2BE7D 3BDEA 3L7PA 3OPKA 3M32B 1U1MA 1WWHA 4YR0A 3MXMA 5KI6A 1FRXA 1X7VA 2AHOB 4ZKAA 4BACA 1BD6A 1VRQC 3SBMA 1VHFA 3HD1A 3EE3A 3TR5A 5ETNA 1JLBB 4WK3A 2MZ1A 1XQSC 3MZIA 2HVDA 3KHGA 4AUKA 3OFEA 3U1MA 1PJ5A 1HNIA 1HYSB 5L1KA 1SJ4P 5HMXA 1SH3A 2V7ZA 3QGIA 3AVJA 3DHXA 1TKXA 3G6YA 2NQPA 1VQ4S 3MM5A 4KI6A 4OHXA 4QR1A 2RF2A 3SMZA 4F50A 4O3RA 4FSVA 2DFHA 4QS8A 4QS9A 4NCGA 4ZHRA 2ZKUA 2ASPA 1U26A 4IG0B 2XNQA 1FHTA 4YUDA 2B56A 1AFIA 3BP8A 3KLHB 2MB0B 2NPFA 2R2RA 1FERA 4DMNA 4LBHA 4O8UA 1JCEA 2XS7A 4DG1B 1Y10A 2Y1RI 3ENBA 2G8IA 4OX9J 4CZMA 4LF6F 1YF5L 1TFYA 4I67A 4DLEA 4F4ZA 4AQYK 4WFZA 3GR0A 1QQMA 4HACB 3V81A 4IH5A 3MDFA 3SQ0A 4LT6A 5HROB 2O4IA 4P2MA 5KG4A 3AVKA 2KM8B 2KVQE 2QMWA 2AW0A 3O5TB 1DEJA 3G4SS 4A5AA 4M95A 3AH6A 1VDHA 4OI3A 5DG9A 2HW3A 1RK8A 1N34F 2P9UA 4MTPA 1CZBA 5KFSA 4RO0A 2IY5B 2MQPA 3CWJA 1Q7LB 1XHZA 2O01C 3I8BA 4RNOA 4IOXA 4TQRA 3I5BA 2OO4A 2IJNA 2O3DA 3QPIA 2G8FA 4M3TA 4ILHA 3N4WA 3IA0A 1YJUA 2EXUA 2E8AA 3N79A 4WQ4C 3F73A 4RBUA 3MCAB 3MHYA 3BSCA 3R3LA 5LXRA 4J90A 4P72A 4I6MB 5LMNF 1Y3JA 2VF3A 4Z4IA 1GTEA 2MZRA 2G2YA 2XG8A 1TV6B 1SIZA 3OTEA 1UETA 3D0GE 3BJYA 4P2FA 1FE0A 1NGEA 3U3GA 4ISGA 2IM1A 1NLVA 3OYBA 4BVOA 1HBUA 2DGTA 4K42A 1DTTA 3UW1A 5KG2A 3I8DA 3B54A 2RJZA 1WSHA 1HQUA 3O4WA 2R7QA 4RBTA 4Y2KA 1WI8A 3L2UA 2FUG9 1TZ0A 2V8PA 4YOUA 2DY4A 1G3OA 3RSEA 3G25A 1WOSA 4BDPA 3UDEA 3PSFA 4DX5A 5CY4A 1JJCB 4K4WA 3A8KA 2ALZA 2HYIB 3AB2B 2BYCA 1RTHB 1JL1A 2NLWA 1B92A 4AL7A 2ZH7A 1K1SA 4ECUA 3UWTA 1R0AB 1A9NB 1K73T 2LXFA 2D69A 5I42B 2DHHA 3NWRA 3Q86A 3HSGA 1TKZA 2WONB 2PA3A 3EVWA 4DU7A 1SKSA 2O67A 3HULA 5B0GA 4WYLA 5BYRA 1RT6A 2CZVC 4CF1A 2A10A 1FXLA 2CZ4A 1VC6A 3K9JA 1PILA 1CZ9A 3K5LA 3OXGA 3RW7A 4JI2F 3U02A 5T41A 1GK8A 2IIRA 4NA2A 3PW4A 3RRGA 5LSLA 3BGFA 3NOGA 4X66K 2QWLA 1YDLA 2K8GA 4GY2B 5B0AA 1SC6A 3POTA 5I3QA 5FLXY 5I4MA 4FYXB 1WEXA 5IC4B 3AVLA 1N6QA 2FDNA 3P39A 1CS4A 4O3SA 5AQKA 3OSNA 1WAFA 5J2NB 4TN2A 4YOYA 2FY8A 2DB1A 4BVPA 3KLIB 2DNYA 1SJ1A 4WTOB 3CC4S 3W9IA 3TAFA 3MEEB 4ZTJA 2YNFA 3DRPB 2V9KA 2XLKA 3CUNA 4DOZA 5J1PA 1FVQA 1KONA 4IDKA 4DV0K 1XNQK 3FZFA 5BR8J 4BR5A 1Q8IA 2YX1A 2KLAA 4DV5F 3A5LC 1F21A 3HPGA 2QT7A 2NRVA 4HUFA 5C5JA 4C11B 1NSPA 1RCOB 2I5JB 2EFQA 4FJ5A 4QYRA 1WSVA 3GJTB 1T6CA 3GOIA 1U1RA 1S9GB 2FY1A 1TU0B 2X3GA 3G86A 4RUAA 3VAGA 4MIBA 1HW9A 4E89A 3BGRA 4MKYA 4FW1A 5AQJA 5LSOA 4XAKA 1HBMB 4P2XA 4EMDA 4FL9A 4K5RA 3NCIA 2F9DA 1RA7A 5J2MA 1NJIO 3TPQA 2HF3A 3G8QA 3WXMB 2DH7A 4JD2B 1G1XA 2W41A 1BCMA 4M5KA 2R8IA 3MWTA 4H5VA 4DR3J 4W92B 2Q79A 1OY6A 1NGHA 3EZUA 1JX4A 2XSJB 4BQZA 4YDUC 2R7YA 3KFWX 1RHJB 4JV1A 3BYPA 2HHHF 3HO1A 3VQ7A 2O8BA 2DIVA 3E9OA 1FJCA 1UVIA 3LPUA 1IKVB 3IRXB 4CEBA 4RW8B 3HSDA 1NWKA 2B7CB 4FM0A 3HOTA 2IFXA 2J9CA 1RKIA 3KJNB 1NEEA 4PCQA 4GW6A 1N32K 5BN9A 1L3UA 4CGFA 3PR4A 4LF4F 4NOHA 3EXCX 1NH7A 2HIYA 4WPAA 3MM9B 5JUMA 2GW8A 2A42A 3AVBA 2XGQA 4HTIA 3L7UA 5U47A 1XR7A 4ELTA 1N5YB 4OX7A 1TP7A 2W40A 3T69A 2VC1A 3ZZTA 2YCHA 1HBNA 3J81Y 4WZQA 3O5BA 4A5BA 3EZWA 1I94F 4PABA 3NKYA 3W60A 4J2DA 4UOFA 2HBYB 5C2DA 5BJRA 3D6MB 1RDBA 2QA4N 2ZJQQ 2MEWA 3CB4A 1FK9B 4JI0F 3JSMA 4ZPWR 4JBCA 2H48B 3W66A 1KEKA 4AH9A 3QWUA 4F02A 2E5HA 1DRZA 3TZWA 3O08A 4X65K 2P9LA 2RE1A 2GUIA 2DNRA 4RLEA 4J9KA 1IQZA 2R8HA 2M52A 2DTJA 3C6TB 4YHHJ 2I7PA 2O8FA 3QLHA 4BROA 3IR6B 3SQOP 2EWHA 5DMRA 1S77D 4WP8A 4C8OA 4F4KA 4UQTA 2UU9K 4HHUA 5KFLA 3PYEA 3CCLS 4AHUA 5I9EB 1RUSA 1ITPA 4B1UB 8AT1B 3LDOA 2PI4A 2AX1A 3VR1A 3I0RB 2W4PA 1URNA 2DGQA 1YRTA 5T7LB 5HP1A 2VB6A 4X4RA 1RILA 2PN6A 1OKJA 2VGMA 3DAWA 2O8CA 1MU2B 4C0HA 2D1KA 4NYFA 1LW2B 3K57A 3B6BA 1N88A 2LU2A 3HDSA 3L4BC 4RTFD 3NVMA 2MY8A 3RB3A 4F4WA 4IR1A 3QEXA 4ZPVR 2X6NA 1GX5A 3O9QA 2Y3YA 3CTRA 1S76D 2GV1A 1B9DA 4DQQA 3O80A 4B08A 5AQXA 2C2NA 3P5BP 3DU6A 1N5SA 4H8KA 1HWLA 4CLFA 1ZOTA 4EZ6A 3BDPA 2DR9A 4BR7A 5AJ3K 4CIEA 5ETMA 2EKNA 1BIZA 2IVOA 3BO4A 3CEDA 4NLRA 2M4MA 3THXA 1XR6A 3DGPB 2UUBJ 3LP3A 2R7VA 3F9MA 1HX1A 1VSHA 4UY85 4DR1F 3KKFA 4K0KF 1WHWA 4NCBA 3TOQA 3MD3A 2UUWA 3NOCA 4FW2A 4JUZA 1N5TA 1Q7YT 4CD3A 2B51A 4A62A 2QTWA 5KG3A 1JJHA 4FLXA 2PEHA 3DRSB 2F96A 4CF9A 4DUYK 3CCUN 1B0TA 2FIUA 2VFRA 3GYNA 2EFGA 2L48A 1AW0A 1WOOA 1OQ6A 4X64F 3SSQA 2J6TA 4O44A 1YAGA 3TJ9A 3H2UB 1SL1A 4USUA 5AE1A 3ZYYX 3U1NA 2Q6CA 4B3OB 3CJCA 3KJQB 5E84A 5KPTA 4IYQA 3VEYA 5AQRA 1YJWS 4Z4FA 1CC8A 1VC0A 1R3NA 2AD9A 4JK7A 3M1FA 3N5BA 4BREA 3BZCA 3FDSA 4DPTA 3VCDA 4OHWA 1S72S 2LCWA 3NF6A 2YBVA 1ZM4A 3SUQA 3I4PA 3RZAA 2V7YA 1EAYC 2VKZG 2G8KA 4MYTA 5AXNA 2IAJA 2P9GA 1N4LA 3OY9A 1VYAA 3G96A 4DUZJ 3ZX0A 2D0CA 2RDIA 3OHRA 3P83D 4BRHA 4OJ1A 3N6NA 3A8YA 1FRKA 1N33F 4JI7K 2MZTA 5LMUJ 4DS5A 1B7YB 2ATQA 2BKPA 8ATCB 1V6HA 3DOMA 3FMWA 5HLFB 3IFRA 2CJAA 3ENQA 3SJHA 3WHIA 2QL9B 4L72B 4TLQA 3VQ4A 4A8XA 2P9IB 2CQ2A 4TQSA 2D3UA 2Z4PA 2X6SA 3V4MA 1BQXA 1TYQA 2BTFA 1H1VA 3OW2M 2KG1A 4FP9A 2VOPA 3M2UB 4HH1A 3L9ZA 4ED8A 4ES2A 1Q8LA 1IM4A 3PG9A 1RT1A 1NB7A 4LF6K 4FXDA 4OLBA 2GVZA 2MZSA 1HIYA 1BL3A 1WN7A 3UR3C 1VRTB 3VF4A 3TVKA 3QWPA 2QXLA 1IKYA 2CNLB 4O3OA 1RT3A 3J7AP 4DL7A 2CQDA 1IUJA 4DU4A 1HNZF 1U0HB 1VHXA 4OI6A 3X1LB 4LIRA 4OI1A 3H6EA 3PEJA 4I9QA 3VAFA 3GILA 5AQZA 3TQ1A 1IVZA 2QRRA 3H45C 4CO2A 2DRDA 2O8DB 1S1VA 1XMQK 4F4YA 2YJFA 1ZM2A 3VHQA 4CK3A 1WHYA 4M5LA 1WDDA 4BE2A 1RB0A 3H20A 3EJMA 4TU9A 2HB5A 5F2RA 4O0JA 1D09B 2K3IA 3QSYB 3M9MB 1NHKL 1T3VA 4LH4A 5F8LA 3KLEB 4CGGA 1U2RA 3IKMA 2H5EA 3RB4A 3OYEA 3FQLA 1U8SA 2QWPA 1JKHA 5F0WA 3BN4A 2P9NA 1FRMA 1Z2LA 3K89A 4OYZA 3C7NA 1N0UA 1UW9A 3M8YA 1HI1A 5L1IA 4LFBK 4EUVA 3OHAA 3FZKA 4JLHA 2UVVA 4FXVA 4LF5J 4X84A 4PUOA 3PUFA 2QSFA 4TYBA 2CDQA 4EBCA 3IG1A 1T11A 3ZZYA 2ZDPA 4FJNA 2OPSA 3VA3A 4MKAA 1WTBA 1VSEA 2ZC3A 1NLKL 3D6HB 3DLKB 2GVDB 3VZIA 2RRNA 2XMKA 3WNGA 3HCXA 2UXCK 3X3UA 2VHGA 1SJ3P 1W26A 3CF5Q 2V8VA 4OJRA 3HL8A 2EWSA 3D2FA 1C0MA 3BF1A 4FK2A 2C2OB 2GX8A 4HTUA 3EPGA 1KOHA 2VA2A 3RBDA 2ZD1B 4A4JA 3E9LA 1GAOA 2QA1A 2UUAF 1SB6A 4U6PA 4OJHA 2XY8A 3PX0A 4GV6A 2KZZA 3GFZA 5L1JA 1CLQA 3DM2A 3HMJG 4ZVSB 3L2WA 3BN7A 1LNQA 1CC7A 2CQBA 2NUHA 3QETA 1T9UA 4FM1A 2LSNA 4U67Q 3PFEA 5B08A 1IKXB 3SFGA 3C65A 4MAKA 1X9JA 1ITGA 3KTQA 4B9LA 4FBUA 1RABB 2VV5A 1P1LA 4AL5A 1RT2B 4TXSA 1F1BB 3BZKA 4RW9B 1WORA 1UJ5A 1PAUB 4C3KA 2QXFA 3DLEB 1U2VB 3LAKA 3IMQJ 4OZJA 4NEYA 3DXKA 4L3QA 4H5RA 2DO0A 2VOOA 2QLJB 4H0PA 4G3IA 1N8RO 3FCHA 2G2ZA 4O4RA 4CLLA 3JSYA 2KU7A 3ZTOA 3KOAA 3D3CJ 1K8KA 5F1XA 3TEHB 2GX9A 3IR7B 4XH5A 1MROB 4KAZA 5HI7A 4BC9A 3I0SA 3C3LA 1YJRA 5A8RA 3HX9A 1WC6A 5CCMA 2DVIA 2Z56B 9ATCB 2MHEA 2JWKA 4H0YB 1SV5B 1R6VA 4DV6F 4H5TA 3OFGA 2CPFA 1OYEA 1X4CA 1UFWA 3BF3A 2FVQA 4BR2A 3DI6B 2BANA 3CCZA 4FLZA 3RRKA 3ZEUB 4DV5K 1WOPA 2HGLA 1R27B 1RAEB 4AHVA 2HWTA 1X5TA 2BRKA 2EKYA 4IRDA 2LQ8A 3RB0A 1NGCA 2LQ9A 2ZE2B 1W7AA 1KAXA 4KR0B 2W2QP 3IWNC 5IT9Y 3H5YA 2JWNA 1F0XA 3CVKA 2XULA 3PTWA 3QMQA 4FPRA 3E66A 4K4XA 4IFYA 4O55A 2IVPA 4LREA 3SLCA 1ZM9A 4U67L 2CYYA 2JC1A 1U6BA 3K0JA 2DPJA 2VQEK 1Y7PA 2A6OA 4DZ6A 3LP2A 2RHSB 3E9PA 5ADXA 5F9NA 2QX0A 4OL8A 4U96A 3NF7A 2M2BA 2HGMA 2ZVIA 4A8OA 2UP1A 3L3CA 2JFKA 4OZ1A 4NO7A 5C42A 3TARA 2M88A 3MDQA 3CCSN 1XC9A 3VQDA 1TL1A 3KIOA 1Z26A 4JAXA 3ATUA 1J9AA 4KHUA 5M1FA 3LDQA 1RISA 2HHHK 3OXLA 3QT5A 4CNZA 4P52A 3QNWB 4CJTA 3GFXA 3M6GA 2QJ3A 2DXDA 4GRSA 3C94A 2YHAA 2HVIA 4JP8A 3E01B 3VA0A 4B3RK 2X3DA 3RMDA 1IBLF 1WSIA 2Q36A 5KT5A 4CJ3A 5JICA 4KBOA 4O5BA 3NG8A 3C19A 1UP1A 3SI8A 4FJMA 3VV2B 3CXCM 2C3MA 5HN0A 4J9PA 3VQPA 3OL9A 2BKOA 4OQJA 5FDLB 5DJBA 1VJQA 5A8KB 4FJGA 2BXJA 3CO0P 3ZC4A 3UIQA 4D3GA 5AR0A 1I94K 5D0RA 4TSXA 2OYQA 4CO3A 2E6MA 1RTZA 4B1XB 2GIFA 4QZVB 4ECXA 3G87A 1KFDA 4C1NK 4LF9F 2RIJA 2AIRB 2W1BA 4CZHA 1RWKB 4CD1A 4KO0A 3C16A 4JI3J 1NBEB 2FVPA 3V9SA 3DJCA 1Z25A 4DQ8A 1GNKA 3LZJA 3ZT4A 2Q3SA 3KK2A 3BR9A 2CQ3A 2MGZB 3EL2A 2A1BA 3R97A 3E1YA 3QIPA 3G82B 3TUZC 1RNHA 2QA4S 5F8MA 4Y3CA 2AKWB 3I55N 5DM7Q 1FJGF 2O8EB 1NBWA 2JNJA 4USVA 1DAXA 1X9WA 2CJ9A 2W8LA 4FKXA 5D0GA 5AQUA 1H0HB 5KFOA 1Q8KA 1R8BA 5D77A 1YQHA 2UXBK 1FJEB 3M6WA 3US5A 3MR7A 2V2ZA 1NJIT 1RU2A 1KHVA 3SV3A 4NLUA 3MM7B 2FJVA 5A8WB 5KRTA 4JYAJ 2R9LA 2V8HA 3GL1A 1W25A 3OA9A 2FLLA 4HVJA 2XY6A 4GVEA 2ZFHA 1IJJA 3WX8A 2MXYA 1F9HA 4NXMJ 2DNMA 3R6LB 4NCAA 2VQFF 5E5NA 2WBMA 1RWOB 2HOEA 2OA8A 2YNGA 2GFFA 1YBUA 4CH0S 1JCGA 1HWIA 2GJ2A 5H9EJ 3GFYA 3LZIA 1U2CA 1WKJA 3EICA 1T9WA 3D67A 1WSEA 3LQVA 2E2NA 1Q95G 1X3NA 2CJXB 1ZC6A 3P8BB 2GGPB 4DSIA 1EWQA 2DIUA 2J0WA 3TZXA 1HHQA 1SC4B 2QZ8A 2B8QA 4FDFA 4C3MA 4OJGA 2DGXA 2RF2B 3QAEA 4B9VA 4BWJA 3ZZ0A 2DNNA 4FYWB 4ZHRB 5D4NA 4W5QA 4CGIA 1FDNA 4BC7A 3SUOA 4CEZA 3W0LA 4USHA 3M7VA 2Q0UA 3Q0AA 2BQUA 3FRYA 3CFOA 3HHLC 5DG8A 4X64K 1EJ7L 3CMQA 2YKMA 2NXJA 2ZBCA 1XUPO 4BDYA 2W2PP 5AQHA 5KOWA 2F9TA 4WTYA 1EETA 4O23A 2YKQA 4OX9F 2OUGA 3TUIC 3JS9A 3LTOA 1OJ4A 3S01A 2JLGA 2X74A 2IYIA 3GONA 4DV3J 2CFXA 3D9BA 1CBKA 3VOVA 1U4BA 3TA2A 4ZLNA 4LF7J 3OBIA 2XWXA 3CCUS 4PPDA 3KKSA 4PWUA 4QR0A 5M1NA 3GTYX 4H0XB 3MEGB 4GC6A 2DNGA 3TP2A 3QDKA 4HHTA 3KK3A 3MMVA 3MXJA 3QO9B 1NPKA 2BW7A 1RDRA 1NJZA 3UDCA 3ZTQA 1HFEL 3AJ2A 2NUUG 5SZTA 3LP0B 1CG2A 1D0EA 4LSLB 4JI4K 3AA3A 4JRPA 1V3ZA 1N33K 2HNZA 1WB9A 2B4OA 1YTUA 4RW6B 4DB3A 3A8IA 4HTJA 4TKTA 4Y6IA 4DQPA 3CCWA 3ONQA 3R5CA 2Q97A 4CK1A 3ETMA 4BE1A 2EI5A 4YR3A 4ZN1A 2PO4A 5E3QA 3DXMB 1HA1A 2GAGC 2DPIA 2DNKA 4BRQA 4KHYA 4DL4A 1KBRA 3MPVA 5HO4A 1B0VA 2QKBA 2ZWHA 4CJUA 2AF6A 5A0YA 2RSQA 3W2VB 4U95A 3SMPA 1RTDA 4J8FA 2Y0SD 3CDUA 1YHQN 3P96A 3VGUA 1GH8A 3KWMA 4IG3B 2RRBA 3GBTA 2GZOA 2KB2A 3J7AN 4MK8A 2CPXA 4PXEA 1RHRB 3F41A 1UWAA 4M1KA 4M3ZA 2YX7A 4IJNA 4WCEL 1PGZA 2P5VA 1GMVA 1BXNA 1NDCA 4NXNJ 2YKNB 4Q8EA 4PEOA 4BS2A 3S9HA 1PJ6A 1HNZK 3J7A1 3P1GA 4USMA 3T9ZA 3OYNA 4B3MJ 2BJEA 2K1RB 3LO3A 1AZSA 1PC4A 4HTLA 5DLFA 1YJ7A 3RSEB 1KLMB 2DY1A 1FA0A 2EFNA 3NWGA 2D9PA 4OGEA 2DGOA 1HJRA 2LA4A 1NKCA 4WQ5C 2MQMA 3CC2N 2Z2LA 4M3RA 5H9FK 2G13A 2GMHA 3BKTA 4IO1A 4XH1A 3U27A 1NK5A 4M3YA 1IV0A 3SDEA 2GEMA 1FRIA 2R7UA 2ASLA 1FDAA 2CPYA 2VJUA 3RR7A 3V6DA 3OTOK 4HUGA 3VN5A 4OZ3A 5LXYA 3EY1A 2E5LJ 3MURP 1P8ZA 2A18A 3WNHA 4QWCA 1RT6B 2NZ4A 1U48A 4ZVFA 4CI0B 4CNYA 1ZBUA 1CQMA 3WDOA 3KG1A 3MM6A 4CJPA 4GVMA 4UY8O 5DO2A 2QWNA 4P73A 2E9RX 4F67A 5JJBA 1LQ9A 4MFBA 3JAMY 5CZ1A 1YITN 3OTDA 5ETQA 3OW2R 1VLYA 3ISND 2YHWA 4WIIA 3SV4A 3AA8A 3OVBA 3PDNA 1HR0J 5I3UB 3AHPA 1LAVA 1CS4B 3V9XA 1MWYA 1FWPA 1BUPA 3CDAA 3KHYA 5ETVA 2YNFB 3N9UC 4KH1B 5CR4A 3C6UB 3OVSA 1B4SA 2KVIA 3AVHA 2W42A 2H54B 2DT9A 5AXMA 2XLIA 4PPZA 3Q2SC 1J2VA 3QRRA 4GKJK 1SL0A 1YJ9S 4BQLA 4EO8A 4RUHA 1X5SA 1G99A 3M5RA 2HBZB 4YDUA 3ZSOA 2VG7A 3CE8A 1KQFB 3B82A 4PWDB 4EFHA 1GOCA 3V2UC 4MO4A 4FJ8A 4CBWA 4K8XA 1SJFA 4BWMA 1BO5O 3M30A 4JKHA 3D6TB 2UXDJ 2FJDB 3VF2A 1IJEB 2E1ZA 5CAAA 2IJRA 4CLTA 3TNVA 4WZMA 2QW9A 3HJVA 4DR7J 3KDNA 4NLSA 2OKQA 2CJQA 3NXZA 2DXEA 1FEEA 2AEMA 5J2PB 4HL9A 3OT9A 5LM7E 1M1KO 5GINA 1HKCA 2KN4A 2BA9A 3B78A 4S0MA 4FBTA 4CZEA 3THYA 4CO0A 2Q43A 3R27A 4A8WA 3OUYB 1VK0A 2KM8C 3LALA 2A6MA 4DR3F 3RVCA 2U1AA 1LWCA 5LJ3Y 2O8BB 5AT1B 5IQ6A 4HCBA 5D0HA 4FPBA 2W8KA 1T44A 1WTFA 4FOIA 2FSJA 3UDVA 4CZGA 1S99A 4DV6K 2XY7A 2HGNA 2KRRA 4DL0C 4KRFA 4ICLB 2HBJA 1FVSA 2OZSA 5KOXA 3H5SA 2G8WA 3VGMA 1HNVB 1VQ5S 5HMZA 1QHAA 3CERA 3AXMA 1F2GA 1DTQA 1FKAF 1NDKA 4OI0A 2F63A 4M42A 2HBKA 2ITGA 1C0UB 2XMJA 1TAQA 3RJMB 2OPPA 2CH5A 1RBVA 2UUCJ 3JSMB 1EKEA 4DS4A 4IOCQ 5AQTA 3UE5A 4AE5A 2L9WA 2IS3A 3B6OA 1F3VA 2IRXA 4KKOB 2FHOB 5AQLA 5K9FA 1EZZB 3HT3A 4FYDA 4WFYA 1KNZA 4N41A 1A5WA 2MYFA 3F56A 4BY9C 2FYXA 3C14A 2RAQA 4M3WA 2X1GA 3S3NA 4YHHF 2XZDB 5EWFA 5HANA 1ZBHA 2ZH5A 3L7OA 3AD9C 2F4VJ 3ZCMA 4K4VA 3GJSB 3VENA 2BV3A 3JSBA 5HP1B 3CCRN 5AE3A 4R25A 5EX5A 3HSTB 1SKRA 3GJQB 1PBUA 3NEKA 1GQEA 3FK4A 1Y0HA 2QL7B 1LWEA 4CJ7A 2D3OR 4O3PA 1H72C 1YRXA 5DDQC 3CCSS 1KVJA 4DDFA 1N8RT 2OAUA 2XHCA 4LBPA 5HRSA 3GCWP 4ZVGA 1T05B 4NYPA 4YS2A 3R7NB 4JK9A 1Q4RA 1NSKL 2Z58B 2HFSA 1DFDA 4LFCK 3P38A 2D7SA 4RW7A 4I7FA 1U8WA 1PBAA 5KFFA 4BG8A 4HEA9 1URRA 4LRBA 2BQRA 1UW4A 1FDDA 2DH9A 4CJSA 2ZOMA 3W1YC 2JJ4D 2RUGA 4NLYA 1CPZA 1TVRB 4OYBA 1HKBA 2L08A 5AZIA 3ZT2A 4CO1A 4KY3A 3EKSA 4OKJA 4WWSA 2UUBF 5C24A 4LF8K 2HRYA 3P31A 1HBOA 3CDBA 3UPFA 4B3TJ 1VSKA 4AD6A 4JHDB 2F8SA 4YR2A 3KYLA 4ZLJA 1TL7B 4NPOA 3CJKB 3IR5B 1DZ5A 1FJGK 4K41A 2QM1A 1PG5B 4DR4J 2HG4A 4JI2J 2KW4A 1JIHA 4JV5K 4CP5A 4OZNA 3GG0A 5KFTA 5C12A 3CNQP 2CKWA 3DC2A 2HZVA 1JXVA 1L5UA 4K8RA 2Y9HA 2M8HA 4O44B 3F2KA 2WBRA 4Q43A 2RDJA 1BY9A 3AD8C 3KHLA 1LW0A 1OY9A 2AT1B 1ZBSA 1TMMA 4R5PA 3D45A 3LM2A 2WFBA 2NXUA 1OVYA 2PE8A 1XTZA 1BG3A 1T3NA 5ITHA 2IDLA 3DFEA 3B8HA 2F8EX 3GG1A 4DN9A 1K6YA 3FSIA 3CXCR 1H3DA 2YXLA 3D0IE 3I55S 4X4OA 5L39A 4RUCA 2OH2A 1S1TA 3HBTA 4BC4A 3HVWA 4BR9A 4KTZA 3VQCA 1BQNA 4WFAQ 2HHTA 4CIFA 1WEYA 1SI9A 3FLCO 4DFMA 3W65A 1X0PA 5LJWA 4KSEB 5DQIA 1R0CB 2HURA 2IAJB 2C2MB 1KVCA 4C1NI 5KT3A 4N77A 2P9EA 3CSKA 5EDWA 1P1TA 2HHWA 3E51A 1ZTWA 2ZBRA 1X60A 2Z57B 4GVBB 3MFIA 4ED6A 2F8HA 4DUZF 2RKIB 3DOLA 5JVHL 3DOMB 4PXCA 2DNHA 4J7CA 5JLFA 2XEXA 5LMUF 2W24A 4X62J 1EIYB 4ER8A 4PKHA 3IP0A 3OTBA 4ZP8A 3EEQA 3PO5A 3UN3A 2R7SA 1FT8A 1HPZB 1LXJA 3OD2A 4DFKA 1TYQB 1UPPA 1IWGA 1M5VC 2R3VA 1X9SA 4OIXA 2CPIA 3RBZA 4ZITA 4OYAA 3CM6A 2GWKA 3NL0A 4DEZA 2Y1JA 3R2DJ 4W5OA 3VQSA 2VA3A 5EWEA 2DEJA 1UVMA 2M70A 4OZ2A 3PZPA 4RU9A 3NDKA 2PY5A 2XHBA 3JSRA 2YKAA 1IKYB 1RT3B 5D3GB 2W25A 4IQXA 2KJVA 1RTIB 3SUPA 1Z2ZA 2W9BB 3MM8A 4GO7X 2ZH6A 5E41A 1JXLA 2EC0A 1B9FA 2NSBA 3IC1A 5KFRA 5AQWA 4CEEA 2OSRA 2KI2A 2NR0A 4O5FA 3GIKA 3AVNA 1KTVA 3CQYA 2VASA 3GSDA 4QS7A 3BZQA 3GZ7A 3HI9A 3P45B 1S0VA 3MGJA 5HVFA 2BBEA 4F3TA 3HKWA 4YOTA 2KKHA 1EQMA 2V5HG 5ETLA 3UCGA 5KFMA 3IFEA 2R7XA 2IMWP 4WFAL 1GOAA 1ZZNA 4RZRA 2KHDA 3J7YU 5GIOA 4FN5A 5BPNA 2FHJA 5RUBA 3SAFA 4DPUA 2P9NB 2CQPA 3C7NB 2XYPB 1G7CB 2F40A 3V6HA 2GJIA 3AOCA 1W2IA 3NGKA 1VBXA 3OXFA 1GX6A 5KFDA 3S3OA 5F8GA 3GSIA 4LF5F 1ZPWX 3UKUA 4EHTA 2GQ2A 2R2SA 5DZ6A 3KWIA 2P9PA 3JXUA 2ZHAA 3RB6A 4Z4CA 1FKPA 2EHGA 4Q45A 4NYZA 2X1BA 4E1NA 4JI6J 4MYUA 2AJ2A 2FBVA 3LWMA 1J5OA 2MLZA 3V1OA 3CCTA 3NGIA 4G6VB 4AQYJ 1D4XA 2ZC4A 4BRLA 2E1AA 1PAEX 3HKZD 2NXNA 1FNOA 1ZTTA 1FW6A 4YOEA 3CJ4A 4FLWA 3ZZPA 5FPEA 4YB6A 3PW0A 5K8MA 1UTAA 2J6UA 4HCCA 4CJEA 3F0NA 3HSJA 1K9MO 3WT0A 4JI1J 1NSQA 3HVTA 4ED3A 3LGHA 1YHQS 5CHIA 1AXQA 1GXTA 4N76A 1M5PC 5ETPA 2V4JB 2XGPA 4KH4A 1SXLA 1NU0A 1JMTA 4WJBA 3MEDB 2FBTA 2JL9A 3PRVA 2ZOFA 1YZ7A 5A76A 1JLEB 2AYMA 4E8UA 3DOKA 1HW8A 3BV8A 3Q89A 1RWWB 5M1OA 3DXKB 3VEOA 4WFBL 1HNWJ 4KHSA 4C8LA 4M5HA 3CC2S 4H0VB 2NYHA 3BGUA 1IQTA 3NNHA 2X78A 2BJDA 3D2EB 1PIEA 3H90A 2HLUA 1K8KB 5T14A 1S9EA 1JJ4A 1S6QB 1NK9A 2YKPA 3VAJA 2XO6A 4XPCA 2BDPA 3SQGB 1VQYA 2W7AA 1EP4A 2MTLA 5HMYA 5AFUH 2KJWA 2HHPA 5EHHA 3K5NA 3LM9A 2KL8A 3CJ5A 3JB9k 3QIOA 4UW2A 1U24A 3CCQN 3BM7A 3EDRB 1VQ7S 2P9CA 5FIIA 3M8QA 5DLGA 5GADI 1RDCA 1YITS 1WJ9A 2JHEA 3EGZA 5BR8K 4JS5A 3TAGA 3AGRA 1C1BB 4PQUB 3M9OB 2HNYB 1R8CA 3GJRB 4BRKA 5DZ7A 2DR5A 4J9LA 5A6PA 3AO2A 1MW7A 2E66A 3CMAN 4RW4A 1MA9B 3U7JA 4FPIA 2MKJA 1S0NA 4RWXA 4OYPA 1TKTA 1GOBA 2FD2A 4X4QA 3LP2B 3O4QA 1APSA 3I33A 3SQ2A 1XIQA 1Z4UA 4CLSA 3PM9A 4KGZB 3RG6A 2ZH1A 4NLWA 2HMPA 2ZGZA 2QO3A 2M8DB 3K0SA 2DR6A 3FSXA 4W5TA 3ZZRA 1B7FA 4NA3A 1S1UA 2HRTA 1X4HA 4ALZA 4BRNA 3HFVA 1BWVA 1Q79A 4X66J 3AT1B 4B3SK 1E4GT 3OR1B 2PMHA 2IM2A 1WSRA 3DLHA 4J9MA 2AYEA 3QESA 5AE2A 5IFMA 5LJVA 1C0TA 4LFAK 5M1QA 3UN5A 3SZ2A 1SZ2A 2AYBA 2VICA 2V52B 3DMJA 2H9ZA 3DLLL 5IWAK 1FTRA 1PYOB 2JH3A 3HPHA 1TUVA 4NI2A 1NXIA 1JB0C 5C2GA 3CT9A 4UY8T 2VG5A 1XNQJ 1S4EA 1KDNA 2YNHB 2OEKA 1M5SA 3R7BB 4DR5K 2IBOA 4WP9A 2HBMA 5KTQA 1W0HA 3VTIA 1YG0A 5DM6Q 5CA5A 3IBWA 4M63A 3AJDA 1QS4A 3A5MC 4JI5J 2WK4A 2LFVA 5IT0A 4K25A 3QGGA 1R8AA 3PJ9A 1RZMA 2W6KA 2Q31A 4DTPA 3IS9B 4IKFA 2M5YA 2JEFA 4A48A 1UVKA 1RI7A 4JI3F 3HLUA 3PW2A 3KK2B 1GLJO 2WOMA 2BJ9A 5KG5A 2B43A 1O6XA 2MQLA 2YV0X 4IO9Q 4QW8A 1KLNA 2BQ3A 3NGUA 2BABA 3QIPB 3VVUA 5KG0A 4F25A 2VPXB 1P27B 5GMDA 4IEIA 5BN8A 1REVB 4IFVB 2ASYA 4G1QA 3ITHA 3GQCA 2CZ9A 3MAHA 4WXOA 3LOUA 2HMIA 1RAIB 1NU4A 3IM8A 4JRQA 1HWJA 3SIPB 3HZ6A 5JMVA 1N32J 2UZAA 3EGVA 3HF5A 4Z37A 1E6YA 4NL5A 2Y1IA 4DXLA 4FCYA 4KFBA 5AQVA 4X2BA 3MAAB 4KHPJ 3CDWA 1M1KT 1X3MA 1H38A 2KG0A 4JYAF 2N7CA 1CVJA 5KFIA 2GIRA 4Q8FA 3A13A 2ZZNA 4JV2A 5A6WA 2GMLA 3CCRS 3QICA 5IZHA 2Z1GA 3FZLA 3TJ8A 3JTPA 2PIIA 4NXMF 2BM0A 2KKZA 1N36K 2IOCA 3CMEN 3HHLA 4C4WA 1QHTA 4CECA 1YI2N 3UQSA 4C0BA 1MSWD 4QBUA 5AQGA 3MUTP 2RH3A 2B9WA 1FXDA 3NH1A 4LIWA 2KHOA 3UKRA 1WHVA 2LEPA 4EYHB 4PG8A 3FC9A 1E6VA 3M8WA 2QIFA 2P9SA 2J5AA 1C6VA 3U9ZA 3KG4A 4CZFA 3S41A 1O1WA 3LDSA 2V9WA 5GIPA 1VSIA 1KC8O 1V4SA 1OH7A 2UU9J 3L3VA 4CH1A 3FEYB 4DV2J 3W5YA 2JEGA 4OHVA 3FFIB 2VFTA 5E26A 3O3GA 3C0BA 5ETSA 3T5KA 3KUEA 2IJFA 4J5OA 1ILYA 4DQRA 2E20A 3F9KA 4LMZA 3C15B 2LDYA 1WSGA 1EETB 1YKWA 4V1Ak 2SXL