1T05A

Hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords oligonucleotide template
molecule tags Transferase/dna
source organism Human immunodeficiency virus 1
publication title Structures of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
total genus 138
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t05A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t05A05
4FW2A 4JV0A 3SFUA 4NLVA 3LP1A 1S1VA 2FLLA 4WFYA 1XR7A 5CZ1A 2VWKA 4RW4A 3DYAA 4ELVA 3NGZA 3RB4A 3DRPB 4FCYA 4JV1A 2BQRA 3OYJA 1YT3A 3O3FA 4EEYA 1NHVA 2FBVA 1L3SA 2C2RA 4YQWA 4LH5A 5CYMA 1HYSB 2WONA 1BI4A 5KFJA 3M9OB 4CJEA 4LSNA 3ZSOA 1HNIB 3MTKA 3CG7A 3NF9A 4ZMMA 4ZTFA 3MECA 4NYZA 3M8PA 4ED0A 2UVWA 2QKBA 1VK0A 4AHCA 4CHZA 2VWJA 4OKEA 1VSLA 5KFRA 4YNQA 1JLGA 1ITGA 2JEGA 4F2RA 3GILA 4CFAA 5JS2A 3DLGA 3H98A 4EYHB 4AHSA 1U09A 3V1RA 1C1CA 4KKOB 3CDWA 1EP4A 1SL0A 2J6UA 1SUQA 3VQCA 3AO3A 3DRSA 4ICLB 2XY7A 2JC0A 2AGQA 5DG8A 4H4MA 4CGIA 4ID1A 3NH0A 4WFXA 5HBMA 1RA7A 1JLEB 4Y3CA 3TABA 4Y34A 2V4RA 2W9AA 3SUOA 3S3MA 4IOBA 4C8LA 4FJMA 5JS1A 1GX5A 2OYQA 2YNFA 1RCHA 3RAQA 4DQRA 3PJWA 4ECXA 4F3TA 1DLOB 1SH3A 1B9FA 2AU0A 2X6NA 1D9FA 4KHWA 3KLFA 3NFAA 1TK0A 3QINA 4FLVA 4Z4FA 3Q8QB 1C0UB 2XI2A 5KT5A 4OPJA 3TI0A 4ZVHA 2WOMB 3OYLA 4RW9B 2D0CA 3AVGA 3HVAA 4FK4A 1RILA 4M41A 3FDSA 1C0TB 3P83D 2ASDA 1QE1B 1Z26A 1VSMA 4CJUA 2W8KA 3GIJA 4ZHRB 5J2MA 3DOKB 4E7KA 4FS1A 4TSXA 1RBRA 2W7PA 4YFUA 1C1BB 3IS9A 4CEQA 1IG9A 2QV6A 2E6MA 3ZT3A 3OJUA 1Y97A 3QLHB 4FM2A 4MFBA 4I2QA 1RT1A 1SL2A 3K59A 4DQPA 4CGFA 2ALZA 2IM3A 4OLAA 1KVBA 5KFHA 3I8DA 3V9ZA 3SQ0A 1R0AB 5KFDA 3NH2A 3K58A 1RT2B 5J2NA 4GMJB 5K14A 4YR0A 4CFDA 1KLMA 4K8ZA 5KG3A 3HPOA 3AVKA 1I6JA 4NLPA 2ILYA 3CWJA 3RR8A 3H40A 4M42A 4F50A 4OGCA 2JEJA 4O44B 2XRIA 3L2VA 1UA0A 4K4UA 4RNNA 4KO0B 4J2EA 3ICLA 1S10A 2XCAA 4E7LA 4E0DA 3G86A 4K4YA 3U3GA 2W9CB 4TY9A 4KTWA 3QO9A 4Q45A 4N41A 4XPEA 3NF8A 3SQ1A 1RDAA 2WTFA 5KT7A 5C24B 1LW0A 3VQ8A 1SH0A 1Z25A 4E19A 3V81A 1X9SA 3TAFA 2OPPA 4PA1A 3BGRB 4ZP9A 4BE2A 3SJJA 2BRLA 1IKXB 4MIAA 3IGNA 1TKXB 2E9TA 3H08A 5I42A 1ASUA 1RBVA 1SKWA 2XGPA 4CF1A 5KFSA 1S1TA 1U4BA 2DFHA 4RU9A 1FKOA 2OPSA 2HHVA 3WNHA 1C1BA 4KTQA 4U6PA 3OYCA 2IOCA 2RDJA 4CFBA 3OYGA 3OVNA 3KLEA 1WSGA 2E9RX 3D28A 2B4JA 3K5OA 3MAQA 5F9LA 4KO0A 1S9GB 1UAXA 2B5JB 3PVXA 1HPZB 2FVSA 4CF9A 3T5LA 4DG1A 1Q9YA 4IRDA 1XHXA 2E4LA 1L3VA 3O4NA 3CJ0A 3OS0A 1HNIA 4KHMA 3BJYA 2V9WA 1KHWA 1SKSA 1KLMB 4KTZA 5KFNA 1ZBUA 4MK9A 5KTQA 3K5NA 1CZBA 5K14B 3KMSA 4FJKA 4FLXA 3OYIA 4RW8A 1R0AA 4PWDB 1SKRA 1JLFB 3PW4A 3NBPA 1XWLA 3OS1A 1MMLA 1NJYA 4FW1A 3OLBA 1VSHA 5HP1B 1Q8IA 4DTMA 5J1EA 1RTIA 2IM0A 2DFEA 3AVHA 2A1RA 4DL6A 5JUMA 1S1UA 3H5XA 3NCIA 4JS4A 3LP3A 1ZYQA 4DFJA 4Y2AA 4IDKB 5KFVA 1T03B 2XY5A 4CGHA 3KNAA 2O5DA 3KHLA 4J9SA 5KFLA 3HP6A 4OKKA 1QSYA 4ELTA 4NLXA 4Q44A 5KFYA 4OLBA 4O3OA 3EPGA 4AHTA 3DLEB 5L1IA 3TAPA 4RNHA 1WNSA 2B6AB 1O1WA 4TY8B 2JLEA 4DL3A 3AA5X 2GC8A 3G10A 3O3HA 5T7BA 1FKPA 1BCOA 2UUWA 1SV5B 3UR0A 1RT5B 4DWIA 3PO5A 3V9UA 4J9MA 4DLEA 3SI8A 5DG9A 3QNOA 1LAVA 3HP9A 5C42B 4KHSA 1YVUA 3FQKA 4I9QA 1RT4B 4BDPA 4CHPA 4DSFA 1MU2A 2IGIA 4CF8A 1F21A 1K1QA 3ZSRA 4RNFA 3V6DA 3HT3A 3KD5E 3RB6A 4IG3A 4DFPA 3PR5B 3JYTA 4ID5A 2ITGA 1S0MA 4H8KA 3SV3A 1TKZB 1RA6A 1U49A 1LWFA 5FRMA 1BL3A 2WOMA 4QAGA 3E51A 3FRZA 4ECTA 4CJRA 4KKOA 2GUIA 3DOLA 4KREA 2JGUA 2UUTA 3AO1A 4EZ9A 1I39A 3HVTA 3KLIB 1MU2B 3EPIA 1CLQA 2KFNA 2OPSB 3VQPA 3T1AA 1X9WA 5KFOA 4R8UB 4XIUA 4EBEA 1HQUA 3EY1A 4ECVA 2ASJA 4CJTA 1RYRA 1LWEB 5CYMB 1HYSA 3HL8A 1HYVA 3D45A 4QW9A 3KHGA 3KLIA 5F8JA 1NHUA 2VG7B 4TY8A 3KLGA 3OYMA 4E7JA 4KHYA 2VA2A 4DSKA 3T19A 4RW9A 4O5BA 1N56A 2Y1JA 2HW3A 4DTRA 2IC3A 3C6UB 1J5OA 1EX4A 5EDWA 3CJ3A 2O4GA 3HO1A 2D3ZA 2HHSA 3CJ4A 4ED3A 4F2SA 5KFPA 1TQLA 3H5YA 3AA4A 1B92A 1DLOA 4IDKA 4DTNA 1JLQA 4DF4A 3HHKA 4M3UA 1RYSA 3VQ7A 4CGGA 3BDPA 4KHRA 3DM2B 3NHGA 3GQCA 4KBIA 4J9KA 2W8LA 3TQ1A 1A5XA 2FJWA 2IA6A 4HHTA 2IS3A 4CHQA 2I5JB 1NK7A 2OZMA 4WFZA 1ZBHA 5KFFA 2YNHA 4J9LA 2G8WA 3I0SA 2ILZA 3H5UA 1WLJA 3SFGA 3RRHA 3VQ4A 3RMBA 1C0TA 3H4BA 1HPZA 3RMCA 3V6JA 3AVCA 3GIKA 1TK5A 3QZ7A 2D7SA 3OS2A 5HROB 4IRCA 4FBUA 1TAUA 4CK3A 4KB0A 2Z1IA 1RDCA 3PW2A 4IKAA 3MFIA 4JLHA 3NAIA 4JRPA 3DLKB 2ZE2A 5C25B 3MR2A 4DQSA 4KAIA 2WB4A 3OY9A 3TAGA 2D0AA 3PJXA 3QZ8A 4B9MA 3HKWA 3BGRA 5SZTA 1TK8A 4LSNB 5KT4A 2ATLA 2HNZB 1IKXA 3G6YA 4HCCA 2BQUA 3T3FA 4Z0UA 3KHRA 4JUZA 1RT3A 1TP7A 1TL1B 3G6VA 4NLUA 1TV6A 1DTQB 4IH7A 1WSJA 3LP2B 1JLBA 5J2PA 4Q0BA 3L8BA 3N6MA 4NLWA 4M3YA 4M3RA 4DMNA 3ZT4A 3AVFA 4RNOA 1RAJA 3ZSZA 5D3GB 3MEDA 1VSDA 4I2PA 4Z4GA 4KB7A 1LW2A 4LD0A 3V9SA 1NK4A 2E6LA 2FVRA 3QEVA 4NCGA 3KK2B 4Q8FA 4QWEA 2YHBA 3Q8PB 2CKWA 5E41A 2R2TA 2PYJA 2X6SA 5FDLA 4X2BA 4DSJA 3CM6A 3NH1A 1JLAB 4IFYA 2W42A 4O55A 2UVUA 4CJKA 1REVA 5DLFA 2BE2B 2YNHB 3OL9A 4RW7B 3V6DB 2DY4A 3KJVB 3E01B 3IN5A 3SZ2A 1UA1A 1ZTWA 2W9BA 4IFVA 3DM2A 3WNGA 3CQ8A 3HK2A 1D5AA 4FLZA 1QSLA 2KTQA 3UQSA 4YMEA 1RTHA 1U04A 2OPRB 4DS4A 1XR5A 4K4XA 4CERA 5L1KA 2XHBA 4HUGA 2DPIA 3U6FA 4FK0A 5DGAA 4DTJA 1QHTA 4O3NA 1VRTB 1IKVA 3MR6A 1U45A 1TGOA 3AVIA 4J2DA 3PR4A 3GIMA 3RRGA 1QAIA 4FJ8A 4NRTA 3ASMA 3QYYA 4TYAA 1FK9B 3LWLA 5F8MA 3CFRA 2YHAA 4B08A 5KFEA 1TKTA 3ZCMA 2R7YA 2FVQA 2OPQA 3EZ5A 2RDIA 4B9NA 1WNEA 1VSEA 5KRSA 4JS5A 3LAKA 1N5YB 3H5SA 4O0JA 3GV8B 3V6KA 4ZTJA 4B9UA 4O3QA 1RTIB 1DTQA 5KFBA 4IG0B 4ZPDA 4DS5A 2BR0A 4CJPA 4LY7A 2IJNA 4H54A 3NBPB 2AWZA 1NKEA 4DU1A 1WAFA 1GOBA 4H4MB 4W5OA 2QE5A 1RT1B 1JKHA 4I7FA 3QLHA 1TVRA 5KT3A 4CFCA 2HHUA 3H4DA 4IFYB 4N56A 4BWJA 4EP5A 3NMAA 4J9RA 1A5WA 2F96A 1HARA 4AHUA 3QGHA 4NZ0A 3L2WA 1HQEA 5FDLB 5EWFA 1TL3A 3BSOA 3CJ5A 4Z4EA 3PZPA 3PX6A 4FZYA 4EYIB 3KKSA 3IAYA 2G8UA 2R8KA 4FJ7A 1S5JA 5DMRA 3QEIA 2WCXA 3UDLA 4G3IA 4CIEA 4QWDA 2G8VA 2GIQA 1NK5A 2ETJA 1B9DA 3I0RA 4GW6A 5D3GA 4CK2A 1IO2A 3VQ5A 4CEDA 4F4YA 4IFVB 2XWYA 2IM2A 4DTOA 3VQDA 2XCPA 4MIBA 2R2RA 3LWMA 1JIHA 3OYFA 5L9XA 4BE0A 1VSJA 5F9NA 4ECWA 1GOCA 1D1UA 2HHXA 1NOZA 4YP3A 3I0RB 3PUFA 3OHAA 4F4WA 4FLUA 2VG5A 1N5YA 3KHHA 3NAHA 4EO8A 4CCHA 4GC7A 3C95A 3LZIA 3LDSA 4ECYA 3OYBA 3T5KA 3VQAA 1SH2A 3MECB 4O4GB 4ID5B 2WK4A 1QAJA 4LSLB 2FLPA 1U48A 4FZZA 4QWBA 4FS2A 4F3OA 3MXIA 5J2QB 3VN5A 3V6HA 1S6QA 2RN2A 4DSEA 1XHZA 1BI4B 4CJ3A 2VG6A 1N6QA 4FK2A 1IKWA 1EETA 4O3RA 1WAJA 1TL1A 5DQIA 4FJIA 2R2SA 5HRNA 4N5SA 2UVVA 1RTDB 1LWEA 4CEAA 4Q5VA 4HKQA 1NNDA 4PUOA 4PWDA 2GIRA 5HRPA 2QXFA 2OPQB 2RPIA 4CEFA 3QERA 2G8FA 4MH8A 2F8EX 3KD1E 4I9LA 5KGWA 3TARA 3TVKA 4K50A 3OYAA 4F8RA 2FVCA 3MR5A 5KFTA 4U7CA 2IC3B 4R5PA 4ED6A 4ICLA 2NUBA 4CHOA 1ZBFA 1JLAA 4NCGB 2IM1A 3KLHA 3O3GA 4B9TA 4KHQA 4O4GA 4DTSA 1C2PA 3SQ4A 4W5QA 3TWHA 3QESA 3VQSA 4ED7A 5KGXA 4BDZA 1S6PA 1L5UA 2EHGA 5L1LA 3PX4A 2VA3A 4KRFA 2ZQBA 4PQUB 1RNHA 1RTHB 4ECZA 3I5AA 2FBYA 1JLCA 2AJQA 1S48A 4CHNA 1J9AA 2J6SA 3S3NA 1NK9A 4MQ3A 4AHVA 4FJLA 1HRHA 1KLNA 1UWBB 3PX0A 2PYLA 2HHQA 5DK5A 1W9HA 1RT5A 4F4KA 1S4FA 4CEOA 4LSLA 2J6TA 1HNVB 3OL7A 4MKAA 5F8HA 3K5LA 5J2MB 1T05A 3D5MA 4XO0A 3DLBA 4ECRA 3ZSVA 1RDBA 4CIGA 4CK1A 4E7IA 3HPGA 1QSSA 4KFBA 1LWFB 2OA8A 1S1VB 3M9MB 3KLEB 2YKNA 4KV8A 3DOLB 4O3PA 2ZD1B 1DTTA 5L1JA 3KIOA 4TYBA 4ZPAA 2R8HA 3KMQA 4EBCA 3I5CA 3VA0A 3G0ZA 3CDUA 4ZPCA 1EKEA 3NF7A 3DMJA 5I3UA 1T94A 3S9HA 5EU7A 4IG3B 4M3TA 2WONB 1TKXA 4EP4A 4MKBA 1S1TB 3N6LA 3ZSWA 1JLCB 1JLBB 1JL1A 2RKIB 5CY4A 2FJVA 3SV4A 1Q9XA 4TQRA 3SUNA 1BQNB 3HSTB 3DLKA 5C25A 3DLHA 2XC9A 3DYAB 1SV5A 4WE1B 2HNYB 1VRUA 4DLGA 4N47A 4RW8B 2KW4A 3SYZA 3DI6B 4JRQA 4NLYA 1S6PB 2AX1A 3DDKA 5KFZA 3IS9B 4LQ9A 1J53A 3IG1A 1S6QB 3DRSB 4DTXA 2RF2B 5KFIA 3AO4A 3RBDA 1EP4B 4RW6A 2W9CA 2ATQA 2QK9A 5CYQA 4CEZA 4AILC 1LV5A 2ASLA 1T8EA 4J9OA 4CECA 4Y2CA 4MK8A 5F8GA 5KT2A 4QW8A 1HJRA 1TKDA 5DGBA 5KG7A 3ITHB 1TL3B 3BQ0A 3MEGB 2C28A 2DFFA 5J2NB 1IH7A 2YNFB 3QNNA 3LPUA 1NKBA 4HVJA 1SL1A 2OPRA 3UPFA 3V9WA 3AA2A 1KVCA 1YTAA 4WXWA 3AA3A 1RTJB 4ZPBA 2FC0A 4WYLA 3QEWA 3MEEA 4Z4CA 3SQ2A 4B3OB 1JXEA 4E1MA 3L3UA 3MXJA 3DRPA 1NJZA 5C24A 4NLTA 4FM1A 1S9EA 5HBMB 2W7OA 1KTQA 2KFZA 3DMJB 1BISA 3VQ9A 3S3OA 4OPKA 4CJLA 3AVMA 5I3UB 4NYNA 3H59A 1QE1A 3K2PA 3LP0A 3NF6A 5EUHA 3BSCA 4WXOA 1NJXA 3OJSA 5KFGA 4RUAA 3FFIB 3SPYA 4Y1CA 1KSPA 1S97A 3BR9A 4CEBA 3VA3A 4NLRA 3LANA 4FVMA 1L3UA 1BIZA 3QIPA 1G15A 2HNDB 4KI4A 4M3XA 5HP1A 3C94A 3CYMA 2KQ2A 2HNYA 4I7FB 3K57A 1TV6B 3PW5A 3H2LA 3VQBA 4UQGA 1NOYA 1WSFA 4K4VA 4IRKA 1NK6A 1LW0B 3MFHA 2IDOA 3SNNA 2FVPA 2F8SA 3PO4A 4KHNA 2YNIA 3O4QA 3OHBA 4NRUA 1U47A 4AH9A 3OYEA 3OLAA 2Q3SA 3HVTB 3MEGA 3LP1B 3MF5A 3CFPA 4FJGA 3T5HA 5KFKA 1S1XB 3P1GA 1CXUA 3DLGB 4CEEA 2YKMB 1KFSA 1S1WA 1RT7A 2G8KA 3LPTA 1XR6A 4E1NA 4M45A 4E7HA 2YNIB 1FKOB 1T03A 1VSKA 3LP0B 1RT4A 4YR2A 3M8SA 3OYKA 4Z4IA 4CJSA 2BDPA 4W5RA 2EC0A 2YNGB 4B8AB 1WSEA 4C8KA 4O0IA 3LZJA 3V1QA 3WNFA 3NGYA 3QO9B 2ZE2B 3L2UA 1JL2A 1RT6B 4CHYA 4FLYA 4ZP6A 3M9NB 1JLFA 3A2FA 1KFDA 1Z4UA 4C8NA 3TAQA 3HM9A 3RMAA 3ZSYA 5J2QA 3KK3B 3E01A 1C0MA 4KAZA 4J9PA 3DOKA 4QPXA 3C6UA 1A5VA 3ALYA 3KLHB 1S1XA 4AHRA 2R8JA 4IKFA 3HVWA 4BACA 4DU4A 2HB5A 3CM5A 2D41A 4DL7A 4ZP7A 1VRTA 3QIOA 4CJ4A 4FZXC 2AX0A 5KG6A 2Z1JA 4JV2A 5KG1A 1UOCA 4CJVA 3JSMB 3RBEA 4ED8A 4KE5A 4NCBA 2P1JA 4WE1A 2LSNA 1RTDA 4F4XA 1BGXT 4K4SA 2HNZA 3QGGA 3AVAA 3RTVA 4RW7A 1IKWB 1LWCB 1KCFA 2QKKA 4GC6A 4WYWA 4C8MA 1RT7B 4NLSA 5HRRA 2DPJA 3THVA 1IKYA 4Y1DA 2HHWA 3TR8A 4URQU 1C1CB 3ZT1A 1ZBLA 4F4ZA 3BSAA 4CIFA 4CE9A 1SUQB 2O4IA 4ED1A 4M94A 3KK2A 1K6YA 3MXMA 4W5NA 3OYNA 3AVNA 4C8OA 3BQ1A 1T3NA 1TKZA 4CJWA 1ASVA 4DQIA 3NL0A 4DQQA 4IH6A 4K4TA 4B9SA 1HNVA 2AQ4A 1KHVA 1ZBIA 2GBZA 3LP2A 3RAXA 2D3UA 3ISND 4FBTA 1S9EB 5KG2A 3P5JA 4ECQA 2HHTA 3KTQA 4Q43A 2C2DA 1JLEA 2AGOA 5KFUA 3L2RA 2BQ3A 3QIPB 4Z4HA 3HJFA 5F8LA 2BANB 4HUEA 3RWUA 4IBNA 4ZHRA 4OGEA 1RBUA 3GV7B 1YTUA 2PZSA 3FSIA 2FBXA 1WSIA 2D0BA 3QEXA 1N48A 4NYFA 3PW0A 2D5RA 3C6TA 3TAEA 3PHEA 3KLFB 3M8QB 4CGDA 3I0SB 3TAMA 3NDKA 1HQEB 5HLFB 4HYKA 3NGDA 4K4WA 3V4IB 3SCXA 2XI3A 3IRXB 4B8CA 2JEFA 3VQQA 3HPHA 5DQHA 2BRKA 4ZVFA 2WHOA 3KLGB 5FRNA 1VRUB 1CZ9A 3WNEA 1LAWA 4KB1A 4PUOB 5KFAA 1X1PA 1I3AA 4LQ3A 1BQNA 3OYHA 3CO9A 3NGIA 1D0EA 1VSFA 2V4QA 5DQGA 4DTUA 1JX4A 4YR3A 5J1EB 4J9NA 4I2QB 4J2AA 3KJVA 2OH2A 2G8IA 3IRXA 1BQMB 4FLWA 3QETA 2HVIA 3DRRA 3LAMA 3JSMA 3Q8SB 2B43A 3AVJA 2I1RA 3OL6A 3ITHA 2WRMA 4DL2A 4M3WA 4HTUA 3RB3A 4ZVEA 4DF8A 4ECUA 3AV9A 5C5JA 1X9MA 1S1WB 3B6PA 1IM4A 5JXSA 3AVBA 4KSEB 4ZVGA 3JYTB 3D0PA 3CFOA 1JLGB 1HMVB 3FQLA 3KK3A 3MEDB 4N76A 3M8PB 2IAJB 4R0EA 4IH5A 2EX3A 1TVRB 1UWBA 2VG7A 5KFCA 1RBSA 4XPCA 5KG5A 4OKJA 4BWMA 5KFQA 4ELUA 4QWCA 1CSJA 3KK1A 1QQCA 3AO2A 5HRSA 3RR7A 4FJJA 1JXBA 4FJNA 2OPPB 4R8UA 2PY5A 2BGGA 2HNDA 4DFMA 3F9KA 3TANA 2Z1GA 3U3YA 3OYDA 2XY6A 3NKYA 1KRPA 3BSNA 1DTTB 4KFBB 2YKNB 4KV8B 2AGPA 1N4LA 3FFIA 4FJXA 5F8IA 4FM0A 1T05B 4BE1A 4WZQA 2X74A 2KZMA 5SWMA 2GV9A 3SUQA 1IKVB 4DU3A 1BQMA 4E3SA 3EZUA 2HMIB 5KG0A 2HWHA 2CJQA 5C42A 2R8IA 3SUPA 4RUCA 3CJ2A 3NE6A 1ZTTA 1LWCA 3GYNA 3G6XA 3I5BA 3OSNA 3KOAA 4URGA 4K4ZA 4O4RA 3K5MA 3ZT0A 4MFBB 2C2EA 1JXLA 2JEIA 1QUVA 1JLQB 4ECSA 1HMVA 1RDDA 4DSIA 4FJ5A 1XI1A 2XY8A 3B6OA 2FJXA 3SI6A 2BE2A 4HCBA 5HROA 2JC1A 1EXQA 5CZ2A 3DLEA 4FLTA 4CESA 3UIQA 3PV8A 4RG8A 1ZETA 2P51A 3Q8RB 3L2QA 5DG7A 2YKMA 4G1QB 1GX6A 1S0NA 3V1OA 2VG5B 3QEPA 3T5JA 1RT2A 3DLRA 5CYQB 4CJ5A 2IJFA 2RF2A 4ZP8A 2BANA 4DL5A 3ISNC 4URSA 3RMDA 3KKRA 4MK7A 3SPZA 1RT6A 1RBTA 5J2PB 2P5GA 4FJ9A 5I42B 1J54A 5F8NA 4GVMA 4CF0A 3CDEA 2E9ZA 1FXXA 2Y1IA 2FBTA 3N6NA 3L3VA 4K8XA 3MEEB 4KI6A 1BIUA 3IGVA 1S9FA 2VG6B 1N6QB 4ED2A 1S0OA 4CF2A 4W5TA 4TXSA 3LALA 1C1AA 5KFXA 2X78A 4KHUA 3V4IA 3CIZA 2W9BB 2RKIA 1KVAA 1TAQA 3EYZA 1QS4A 4NLQA 2V0NA 1FK9A 2YV0X 1C6VA 3BQ2A 2FLNA 3ZSXA 3NAEA 4DG1B 1J5OB 1OS5A 5EWGA 1REVB 4HUFA 5HLFA 4CJQA 3ZT2A 1C0UA 4KPYA 2R2UA 4TQSA 2B5JA 4EO6A 3RB0A 4DFKA 3CVKA 4I2PB 2P5OA 1RDRA 4RW6B 4IR9A 2XGQA 1LW2B 1ASWA 4NCAA 3DRRB 4OVLA 1QTMA 1IKYB 4TN2A 3AO5A 2G8HA 5DLGA 4Q0BB 3QIDA 4PY5A 1W25A 1VSIA 1HQUB 2HAIA 1NKCA 2HWIA 3GIIA 1YVFA 3GV5B 3V81B 4NLDA 4M3ZA 1NK8A 1BCMA 3VQEA 1RT3B 3AVLA 4EBDA 3ZSQA 2KZZA 4RNMA 3HXMA 4PQUA 1WN7A 2C22A 4IG0A 4O3SA 1GOAA 4CGJA 3QGIA 1NJWA 5EWEA 2ZD1A 4RW4B 4TLRA 3OSPA 1WSHA 4J9QA 4G1QA 4EZ6A 2B6AA 1CXQA 3KLVA 4DEZA 2Z1HA 1T7PA 4WZMA 4RZRA 5KG4A 4O44A 4B9LA 1HYZA 1D9DA 4H4OA 3M8RA 1K1SA 4QCLA 3F73A 4R5PB 5KI6A 2XO7A 4QOZB 1S1UB 4OL8A 4L8RB 2I5JA 3HVRA 1XC9A 1S49A 5FROA 3BREA 2UVRA 1JKHB 2IMWP 5KFWA 4OJRA 1D8YA 3DI6A 4FXDA 3KK1B 3IG1B 5KFMA 1L3TA 1W0HA 1BHLA 5KRTA 2A1SA 2IAJA 4DTPA 4NLOA 4B3OA 4FJHA 3HYFA 5T14A 4CJFA 1NK0A 4LH4A 3ULDA 4BDYA 1EETB 4DL4A 2IBKA 2YNGA 4DSLA 1RTJA 2R8GA 2HVHA 3PY8A 3MR3A 2HMIA 4IR1A 1FKPB 2ZKUA 3C6TB 4NLGA 4Q8EA 3PW7A 1TKTB 2DTUA 4B9VA 3TAMB 4QWAA 4J2BA 4E89A 3OL8A 1S9GA 4IQXA 3V9XA 4FYDA 3M8QA 2OZSA 4M95A 3VQ6A 5KT6A 4H4OB 2F8TA
chains in the Genus database with same CATH superfamily
2L3MA 1BO5O 2MY8A 3SFUA 5HATA 5ETMA 3LH2S 4CO2A 5AJ3J 1VC5A 3LP1A 4UOGA 1HBUA 3FCVA 4WFYA 1XR7A 4RW4A 1VQLS 3DYAA 1XNRJ 2QEXS 3DRPB 2CZVC 3OYJA 3O1LA 4QS9A 3ZO7A 1FJGK 2UUBF 2C2RA 3ZNJ1 3VF2A 2P9LA 2AEFA 4CH0S 3M9OB 5A8RA 4JI6F 4CJEA 1X5TA 2BTFA 1AB8A 1HNIB 3MTKA 2NR0A 2LDYA 4FWNA 3HX9A 1IBLF 2UVWA 5GIPA 3VGLA 2GW8A 5KFRA 4JI4F 4R79A 3ZTQA 5A8WB 3R5GA 4B3MF 2HSEB 1E4GT 3V1RA 3CDWA 1F5BA 2KVIA 2LQBA 2J6UA 2PFUA 3J80O 5ETVA 4ZN1A 2EK1A 4A48A 2R7WA 3OBIA 4ID1A 3MMJA 3NH0A 4WFXA 4GVEA 1VQ5S 5CH7B 3DAWA 3RVCA 1VDHA 2W9AA 3DDIA 3ZC4A 2BM0A 1TZ0A 3DOMB 4UUXA 4M7YA 4IOBA 4FJMA 5AQNA 3VQTA 4MAKA 1CJKA 4P72A 4BRDA 3PJWA 3M8ZA 1SH3A 4X62F 2AU0A 3VAKA 3NFAA 4FLVA 3TP2A 5KT5A 3OTDA 3TI0A 2YPYA 4QQBA 2WOMB 3ENVA 3KDNA 3FDSA 4CJUA 4ZHRB 4M63C 4FS1A 4TSXA 1RBRA 1Q8LA 4E1JA 4CEQA 2EFOA 4F3MA 4YOYA 1CJVB 2CJYB 2EFQA 5EN1A 3J7AN 4I2QA 1M5VC 1SL2A 4BR7A 4KIAA 4USMA 1FDBA 1R8AA 2VGMA 2IM3A 2CRLA 1U6FA 1KVBA 5KFHA 1VHXA 1X5PA 2LQJA 3SXLA 3LDLA 1XMQJ 5KFDA 1Q95G 1Q16B 3SQOP 3EGVA 3BF3A 4CFDA 5KG3A 3ZX0A 1GEHA 3GONA 4ZOSA 2ILYA 4I69A 1ZPWX 3CWJA 4RX6A 3H40A 1Z2LA 2XRIA 4O44B 2YWFA 5D0GA 1QD1A 4USTA 1NH7A 1HNZF 2B4VA 1S10A 2VUGA 4E0DA 3U4LA 3U3GA 5IC4B 2W9CB 4NOHA 4DV2F 2FXUA 1HHSA 1X4EA 2EFVA 3CCVS 3IM8A 4N41A 3GSDA 4PRFA 4XPEA 2ZNYA 3MEKA 3SQ1A 1RDAA 5KT7A 5ETLA 5AXMA 2BE9B 1RQ0A 1X9SA 3W63A 3P49B 4MIAA 2JOQA 1IBLJ 4I56A 3UVJA 1SKWA 5EOYA 1FKOA 1U24A 3W5XA 3CCTA 2VWBA 1SXLA 1QQMA 2OLWA 3OYCA 4UT4A 1K8AO 3OYGA 3UNGC 2E9RX 1Q53A 2HGLA 3K5OA 3W5ZA 2RUSA 3MAQA 3OW2M 2RILA 1TUYA 4OV1A 1HPZB 2E5LK 3C7NB 3HSCA 2QJ3A 1Q9YA 3W2VB 2XS2A 1XHXA 2E4LA 5C2FA 3ISZA 4WKYA 4H0YB 2G2OA 4F67A 5FLXU 3CCQS 4AUKA 5IXUA 1RWWB 5U47A 2HFZA 1VQ4S 1R6YA 1S72S 3D4JA 4PWDB 1SKRA 3OV7A 1P8GA 3GR0A 4FW1A 3MCOA 1TUUA 2IM0A 3O3LA 4FL9A 3HBTA 1XMQF 1OQ6A 4DV1F 3H5XA 3NCIA 3LP3A 4S0MA 4Y2AA 6FD1A 2IVYA 4IDKB 1GTHA 5M2RA 1RXOB 4CLSA 4YEAA 3KHLA 5KFLA 2XEXA 3M8YA 4Q44A 3CCWA 4OLBA 5E3CA 3LOUA 1HNWK 3CJCA 3EPGA 1BWFO 1ZAXA 1VJQA 4IYQA 2B6AB 3H3NO 2JLEA 5AR0A 4FOIA 4DL3A 3MN9A 2GC8A 1S22A 2DH7A 3O3HA 1FKPA 1WHVA 1YGYA 1SV5B 1B0TA 5LJVA 2V2QA 3PO5A 4J9MA 5C2CA 1LFWA 1SQEA 1LAVA 2PIIA 1M90T 4I9QA 1K73T 3MD1A 4BDPA 4CHPA 1VQON 4OJHA 4BGAA 4JI8F 1QVFM 1K1QA 1EWQA 5JLFA 1KC8O 2V34A 1BC6A 3V6DA 2ALYB 1MWZA 3RB6A 2YJEA 2LVWA 4ID5A 2ITGA 4H8KA 3KNGA 1RA6A 3W61A 2DXDA 4ECTA 1HWKA 1XEZA 3DOLA 2UUTA 4EZ9A 3AO1A 1XIQA 1TYQA 1MU2B 1CLQA 1FI4A 5BRDA 5D77A 4H5NA 4IO8A 3KUHA 5F0XA 1VFJA 1N8RO 3QICA 3EY1A 5JMVA 2ASJA 1NGGA 1GLDG 1KC8T 3A8IA 2FZCB 1P1LA 3CC4S 3AD8C 4O0NA 2GVZB 1X9JA 1NHKL 2XS5A 2YX7A 2E88A 3O08A 1HWJA 2JDJA 3C3LA 2H9ZA 4TY8A 3BV8A 4CNZA 3CNQP 4X64F 1SJ1A 2G1DA 4OZ5A 1URRA 4RWXA 3G96A 2VA2A 4DSKA 2Q36A 4RW9A 4A2BA 1VQ6S 2Y1JA 1O5JA 4HDGA 3IAM9 1QHAA 3W62A 3CCLN 1N5SA 2MQOA 1VHFA 2ATCB 2IDLA 3DGVA 2FY8A 2NXEA 5KPTA 4ED3A 3H5YA 2OIHA 2W24A 3CJBA 3B82A 2VQFK 4IWVA 4DR7J 4WWSA 5D4NA 1RYSA 4NLCA 3VQ7A 3M4XA 3NHGA 2CWXA 3TQEA 2KG0A 2HIYA 2CGKA 4J9KA 4JKHA 3D9BA 2VB6A 4QS7A 2HF4A 1NK7A 3HZ6A 1T6DA 1H2VZ 2WFBA 4HH0A 2DITA 2O8DB 3KG1A 2W6KA 2G8WA 2KN4A 1U1QA 4K2XA 3KJFB 4BHQA 2IVNA 2CNOB 1NDCA 3RRHA 2VBYA 2F65A 3VQ4A 3RMBA 4Y28C 4WFNL 4OZNA 1XC3A 3IMQJ 2OANA 2D7SA 3OS2A 4JI1J 3BGLA 4CK3A 3DHXA 4KB0A 2V2KA 4DR5K 5AQWA 3NAIA 5C25B 2ZE2A 3MR2A 3W8GA 1BY9A 4KAIA 2WB4A 3TAGA 3QZ8A 3HKWA 2DIVA 3WEEB 2BKOA 3CPEA 3T3FA 3CQYA 3OA9A 4JUZA 1RT3A 2CFXA 1TL1B 1TV6A 1WSJA 3LP2B 5J2PA 2CJKA 2F4VF 4DMNA 2B9XA 3AVFA 3PM9A 5D3GB 3MEDA 4I2PA 1YKWA 1FHTA 4Z4GA 5M1PA 1FWKA 1RAAB 4LD0A 1NK4A 4C48A 2YI1A 3QEVA 3VF0B 1R8CA 2CKWA 2MZSA 5E41A 3NXZA 5FDLA 4DSJA 1H6KX 1C4AA 3NH1A 5JVGQ 1XJWB 5GMDA 3ETOA 1X3MA 1OY9A 4CJKA 1REVA 4BRFA 2VODA 3CD6S 2R7UA 2NLWA 3OL9A 3A13A 3MK6A 3KJVB 4X4PA 4DU7A 4FO0A 3PG9A 2Q43A 5F1XA 1UA1A 3MI7X 3D2FB 4IFVA 3HK2A 3OR2B 2KTQA 3US5A 2ASOA 1HLUA 1X4AA 2XHBA 1RDWX 3N4QA 2J8AA 2DPIA 3U6FA 3BF1A 5B0DA 5IM0A 4O3NA 4PZVA 4KJIA 3AVIA 3J7Z5 2RT3A 3RZAA 3OBWA 3QFHA 3PR4A 3RRGA 5G0RA 5L9NA 2MHNA 3ASMA 1C0FA 4FF1A 4DV0J 2YHAA 4OPAA 3LQVA 4WU2A 4B9NA 2ZWPA 5KRSA 3H42A 1N5YB 3GV8B 5I3PA 3V6KA 4ZTJA 2W2MP 2Q31A 4B9UA 4JI7J 4RO0A 2GVZA 5DDPC 5JVHL 4H54A 3NBPB 1S99A 2AWZA 1NKEA 3W5YA 4DU1A 1WAFA 5THWA 1GOBA 1HR0K 4RBTA 4W5OA 1JKHA 2GTDA 3O9UA 4WP3A 3RJMB 2HHUA 3M6UA 4N56A 2IVOA 3NMAA 4DCHA 1A5WA 2F96A 4BR5A 4IOCL 4NZ0A 3L2WA 5FDLB 4ED4A 4WQ4C 3CJ5A 5F3ZA 3TSUA 4Z4EA 2LEBA 4ZPVR 2UXCK 4CD1A 3IAYA 2JH3A 2R8KA 1NGHA 4KGKA 5DMRA 1N33K 2D0OA 1T9XA 4BC7A 1E6VA 4A4JA 4CIEA 4QWDA 2GIQA 4WF9Q 3VMFB 3TNVA 4LF8K 1TL5A 1B9DA 3I0RA 5D3GA 1IO2A 1FDDA 1LNQA 3LWMA 3GG1A 1P27B 1ZOTA 4ZJLA 5HJXA 4RUHA 1VSJA 2CJXB 5F9NA 1SJ4P 3PYFA 1NOZA 4YP3A 3I0RB 3PUFA 2MZ1A 4F4WA 3TRGA 2DRDA 2VG5A 1N5YA 3KHHA 3IC1A 2EXUA 4OX9J 4WF9L 4JI3J 2ASPA 2PD1A 4CCHA 4HACB 4FXVA 2ZH7A 1MN9A 2V5HG 3T5KA 3POTB 1SH2A 2R42A 1W97L 2WK4A 1NGEA 1FRKA 3TJAA 2GGPA 4D3HA 4QWBA 2IY5B 4FS2A 4U7UK 2AYMA 4OX6A 2Z58B 4OZ2A 3GG4A 1DBDA 3MOZA 4K5RA 5HMZA 1IKWA 4F0KA 1YJWS 3FMWA 4O3RA 1WAJA 4C23A 3LDOA 6AT1B 5CAAA 5AQQA 2UVVA 2RU3A 2JVOA 3TR5A 2BJDA 1W7AA 1RFQA 1EAYC 2ZJRQ 5K8NA 4HKQA 2E2OA 4PWDA 3FBEA 5HRPA 2G8FA 3KD1E 5DM6L 1F5AA 1JJHA 3TVKA 2FGCA 1VLOA 1IBCB 2FVCA 1QQNA 2RS8A 2VICA 1BA0A 4L3NA 4ICLA 2NUBA 3O3GA 4AQYF 4B9TA 4L3KA 3M7VA 4LF4J 3TWHA 1P8ZA 2UYTA 3VOVA 1E6YB 1NO8A 3KWGA 3TUPA 3G8TA 4ER8A 3PX4A 4AT1B 2GIFA 1VYAA 2FBYA 2PE8A 2AJQA 1S48A 2WTUA 3DC2A 3S3NA 1NK9A 1CQMA 4AHVA 3C6AA 4FP9A 2J9DE 2QSFA 1VIXA 5DK5A 4PHTX 2UU9F 1S4FA 3CC7N 2Y8WA 3TX0A 4CEOA 2I38A 3WZ0A 4HT5A 3OL7A 5J2MB 1F6TA 4XO0A 3ZSVA 4WQ4A 4CIGA 2OA8A 3HOSA 1S1VB 5LSOA 3GE9A 1TMJA 4PCQA 3DOLB 3M1VB 4NXMJ 2R8HA 4RU2A 4EBCA 3I5CA 1XMQK 3VA0A 1UCNA 3AB2B 3CDUA 1X7VA 3CI5A 5FPEA 5EU7A 3UW1A 2QC3A 4EP4A 2V8HA 4YOEA 1JLBB 2FJVA 3SV4A 1Q9XA 1RE1B 2HFNA 2O8EA 3CMAN 3CJKB 2M4MA 2QMXA 1FKAF 3DLHA 5CE3A 2KHOA 2ABYA 1VBKA 1SV5A 1NDKA 2QA4S 4JRQA 1NUEA 3NY0A 4NLYA 2AX1A 2BJ3A 4LQ9A 3IG1A 3OXFA 4EU0A 2ZJQQ 3MM8B 3CCES 5KFIA 4DV3F 4RW6A 4C11B 1KQGB 1LFPA 3GU0A 5A76A 3HHLD 1T8EA 5JMNA 1GLLO 3MAAA 4CECA 2IFXA 1WSRA 3FRYA 5KT2A 3BUZB 3L3CA 3PIPL 1HJRA 2WUSA 2K06A 3BQ0A 3MEGB 2Z4PA 1WKLA 1VQKS 2DFFA 1R6VA 2NRHA 3LPEA 2YNFB 3IKMA 1YUWA 2HQ3A 4HVJA 3JTNA 3V9WA 3MDQA 1VQ8S 1KAXA 4NO7A 3J7AP 1KVCA 4WXWA 1KQKA 1OPZA 3THTA 1RTJB 2HAFA 2A41A 2UXBJ 2B56A 4O8KA 4WYLA 1FNOA 5ETPA 3DXBA 5CCMA 3L3UA 4OLPA 4FM1A 3SMPA 2HFVA 2VCPA 3DMJB 4OPKA 4YDDB 3AVMA 4W98A 3H59A 3H0PA 1UZHA 2AKWB 1MWKA 3GYXB 4RUAA 3SPYA 1OKJA 4CEBA 3VA3A 4OHWA 3SJHA 3P8BB 3A8YA 3SBGA 4N8OA 1L3UA 2JFDA 4K8RA 4USUA 1HKAA 1WC4A 5HP1A 3C94A 4CYUB 2JWLA 3G9CA 2FJEB 2KQ2A 2GS8A 2HNYA 3GG0A 1T6CA 4X4VA 2MKCA 1IR1A 3WQTA 3D6RA 3TEGA 4UQGA 1PYOB 4LJMA 1NOYA 4M5DA 1WSFA 3N79A 2I9SA 2OKQA 3VGSA 2Z2YB 4DR3J 3SNNA 2RDDA 2FVPA 3NG8A 1TL7A 2FSJA 2BH1A 1Y3KA 3OHBA 2CQ0A 1U47A 3NGRA 3M2VB 3MEGA 1OWXA 3KZBA 3H90A 4DV3J 6FDRA 5D6GA 4FPAA 4FVUA 5KFKA 3DLGB 3TVYA 2YKMB 1KFSA 4OJ1A 5JVGL 1RT7A 3FGVA 1XR6A 2ZOMA 2R7VA 4E1NA 1NZAA 3BGOP 4JYAF 3AAQA 3FSYA 1T03A 1ILYA 2MKJA 1RT4A 2V63A 4CZFA 3OYKA 4CJSA 3IP0A 1CC7A 1TMMA 1QVGM 3VTIA 2CWKA 2YNGB 1WOPA 1N34J 3V1QA 7FD1A 4ILLA 1EWRA 2RHQB 1WSVA 1K47A 2ZE2B 4NEYA 3HM8A 3HF5A 3N5BA 3M9NB 3A2FA 3TAQA 4CNYA 2MLYA 3ZSYA 5J2QA 2MEWA 4JKGA 1NRKA 3ZETB 3THXB 4X66F 5D0EA 2MB0B 3E01A 1GXLA 2RMLA 4QPXA 2XMAA 1A5VA 1DKGD 3V5RA 2BA9A 3JSBA 2PT0A 2D3O1 3HDSA 4DL7A 2CPIA 3HSZA 2V67A 1VRTA 3B8AX 3MURP 4JV5F 4FZXC 2MQNA 5KG6A 2Z1JA 1T9WA 2HK2A 4I4BA 4JV2A 5KG1A 1UOCA 4CJVA 1K8KB 2IBOA 2VDIA 3R9LA 4JI8K 2A42A 8RUCA 2F7VA 3K5PA 2D9OA 2X1GA 5FIIA 4F4XA 3KKFA 4KR0B 3TA0A 3QGGA 4LBIA 1MMNA 4NI2B 1LWCB 2QKKA 4GC6A 1B0PA 4XDCA 4NXNK 4NZ7A 5LMNF 1HA1A 1RT7B 1R7IA 1IWAA 2RQCA 4KH0B 4MYTA 5HRRA 2J9DA 2DPJA 3W1YC 2GO9A 1FE4A 1Q78A 2HHWA 3FBFA 3QT6A 4FWQA 2W2NP 4HTIA 3QBXA 2XYPB 2HYIB 1SUQB 3C16B 1X8DA 4CTAA 3AVNA 4C8OA 2OHDA 3VCDA 2U2FA 1WTBA 4A47A 2UUCJ 3VF6A 2HHHJ 2UUBJ 1X3NA 1HNVA 2MQMA 3MPYA 3DRYA 2GBZA 2A40A 3LP2A 2D3UA 1KXPA 2XMKA 1WF1A 4FBTA 4DPTA 5KPZA 4QOTA 4QBUA 1QQOA 3P5JA 1FRLA 3KTQA 1FD2A 1JLEA 3PACA 5ETQA 4KGVB 3FZ2A 4DPUA 3THYA 2NRTA 3IO1A 4HUEA 2QT7A 1DEJA 4IBNA 3Q83A 1KS2A 1SQFA 5IC6B 4USHA 3H7HB 5C12A 4Y2IA 2EFGA 4QR0A 3QEXA 2DCLA 4NYFA 2D5RA 3C6TA 5AE1A 3PHEA 3KYLA 3KLFB 3M8QB 3TAMA 3R8YA 4PXCA 3J81Y 3Q2TC 2M52A 3SCXA 3DNCA 2N4DA 4DR2K 3IRXB 3VQQA 4J9VA 5DQHA 4QIVA 5CQGA 1VRUB 3F5TA 4OHZA 2C3MA 3FNNA 2O8EB 1WF2A 2QA4G 2F40A 4B3SK 2OMOA 4X66J 3SSQA 3WC2A 4I2QB 2DD8S 4ETXA 5ADXA 4J2AA 3KJVA 2OH2A 4E8UA 3QETA 4FLWA 3PXGa 5LMNJ 2I6WA 2LMIA 2I1RA 3OL6A 3G4SN 4M3WA 4DF8A 4OI3A 1M1KO 5C5JA 4HVZA 2VJUA 3BZQA 4MDBA 1S1WB 3B6PA 1IM4A 2F9TA 4A8KA 2J0SD 2N82B 1GLCG 3CFOA 3JXUA 1SQKA 2ZITA 2WBRA 3TO8A 3LGHA 3FQLA 3ETMA 3KXDA 1B7FA 2ZHBA 1FX4A 1A7GE 4IH5A 4GKKF 3ADAC 1UWBA 4WPAA 1QZ6A 5ITHA 3SIPB 3GWCA 5M1NA 3GDQA 2KXNB 3DOMA 2H54B 4DR6K 3EX7B 4OKJA 5KFQA 2AYBA 3G6ES 3KK1A 3VZHA 4FJJA 5AJ3F 2BGGA 2HNDA 2NLXA 2Z1GA 4YHHK 3A5NC 2P9PA 1RBAA 4F9OA 3NKYA 4CH7A 1SJ3P 3MZIA 4JV5K 2AF6A 3QPIA 2AGPA 1N4LA 4JI7K 4FJXA 4FM0A 1T9YA 2E5LJ 2GV1A 4DU3A 2YH0A 2GHWA 5CCLA 3BKTA 5C42A 2R8IA 2X1AA 3VEOA 1G7CB 2XTJP 2WW4A 1IJFB 4I0WA 2X7IA 5AXKA 4CT8A 3BH6B 1YJUA 2O3DA 2H4YB 4FDFA 1TFWA 5BR8F 4DUYJ 1SB6A 2YY3A 4IOXA 4K4ZA 1Q86T 4EMDA 3SAHA 2BX6A 1CJTA 2C2EA 1K8AT 2LEAA 1QUVA 4ECSA 4JI1F 1F9FA 3QT7A 3B6OA 4EIAA 5HROA 3AY9A 2VFSA 1REGX 2FHJD 4Z2XA 3N9UC 1N34K 2P9UA 5LMUJ 3PV8A 1VK3A 1ZETA 4B02A 4OHYA 1VC0A 3L2QA 4G1QB 4JI4K 2VG5B 3QEPA 5CYQB 2HQCA 3Q8VA 4TKTA 4ZVQB 4LFAF 4H0VB 3J81O 4CZEA 2UU9K 2Q1LA 2CG4A 4YUDA 5I42B 4GVMA 5GMKa 1QLNA 2MJUA 1RJJA 4X4UA 3L3VA 2VBZA 3C8YA 2C2OB 3L9ZA 3VHQA 2D0PA 3NCPA 2ZZMA 4A8MP 4ED2A 2BBEA 2A2CA 3TOQA 2X51A 5KFXA 2IVFB 1MNEA 3V4IA 2VD3A 2RKIA 1QS4A 2L9NA 1FK9A 2VPXB 2NPFA 2FLNA 2MMYA 5EWGA 1J5OB 1QAYA 3GCXP 5HLFA 4CJQA 2R2UA 4WK3A 2ZBCA 4NA2A 3VAHA 1IBMK 4UQTA 2CQ1A 5A2QO 3QBWA 4DFKA 1VQ8N 4PWWA 4RW6B 2RS2A 3O6WA 1LW2B 4GV3A 2AV5A 4JI1K 3CXCR 3JQJA 4IXCA 2LA4A 4PY5A 1BUXA 1VSIA 2G1HA 2I7NA 4JOUA 4C6AA 3JAMO 4NLDA 1X5SA 3NS5A 3VQEA 3AVLA 4GKJF 1N0VC 2QA1A 3JS9A 3BH7B 3E9PA 1JCEA 3AQOA 1NJWA 2Q6BA 1R0BG 1M5PC 4TLRA 3VESA 3OSPA 4G1QA 3R5DA 4EZ6A 3P4IA 2VOPA 2Z1HA 3SK3A 1ITPA 5KG4A 4O44A 4B9LA 3PSIA 2BJ7A 1D9DA 2CJBA 2ZH1A 2GHPA 1JJ2M 4DUTA 3QRPA 5EGYA 1S57A 3HVRA 4LT6A 3VEVA 5HVHA 3TEHB 1VS3A 3TTCA 1YWXA 3M6VA 3BY5A 3ENHA 3IBWA 4ZJOA 3IG1B 4DN9A 1U2RA 3QJLA 2IAJA 4JNEA 3ZTPA 4CJFA 1X4FA 4P2SA 3ULDA 4BDYA 1FVSA 3O1BA 1RTJA 3I9ZA 4J9UE 1GH8A 2VPYB 2ZKUA 2NRRA 2ROEA 4NLGA 3UDEA 4BC3A 1TKTB 4I64A 2EC2A 1RBOB 3GCWP 3BGFA 4QR1A 4HEA9 2B4PA 4I68A 4E89A 3V9XA 3MCMA 3M8QA 3TPQA 3B4MA 5IQ6A 3RUBL 4BVPA 3PYEA 1X31C 4C11A 1S1VA 2V8PA 1UPPA 2QXLA 2CUYA 4YB6A 4ELVA 4FSVA 1EO1A 3HHNB 4JV1A 3QGPA 4AL5A 4EEYA 1NHVA 3ID6A 4A8OA 3QB0A 1L3SA 4LH5A 5CYMA 1HYSB 3ID8A 1BI4A 2MLZA 2Q3PA 3PIOL 2P9KA 4LFCK 4ZMMA 1ZH5A 3MECA 4V19S 4NYZA 4LF7K 3M8PA 4LFAK 2QKBA 1VK0A 4CHZA 3FSXA 3EKUA 3HT0A 1ITGA 1MWMA 2JEGA 4P6QA 1IWGA 4KGZB 4F2RA 1FXRA 2MQLA 4IQMA 5C0YA 3H98A 4EYHB 1UVLA 3KUGA 3CMAS 1EP4A 1SUQA 2E1MC 1N34F 3DRSA 4ICLB 3ZZRA 2NZCA 2JC0A 1VQ9N 1NGAA 5DG8A 4H4MA 5HBMA 1RA7A 1SAZA 2V4RA 4IOCQ 4B1ZA 2CQPA 2KM8B 4DR4K 5IT9O 5JS1A 1WKJA 1RHUB 4DV4J 3RAQA 3P6YC 3LM9A 3JSYA 2XLKA 1IBKF 2CQ3A 2VC0A 5L46A 1HWUA 5A2QU 4WTOB 4KHWA 3A3OB 1Q7YT 3QINA 3Q8QB 3VR1A 5HAOA 4AXJA 2DKOB 4RW9B 2D0CA 5AT1B 5AQHA 2M88A 2ASDA 1Z26A 2CGJA 2W8KA 2RHSB 1B7YB 1WI8A 4RLEA 1C1BB 3IS9A 4BRNA 2RAQA 1IG9A 1PJ6A 2E6MA 3K9KA 3OJUA 2CH6A 4MFBA 3RBXA 3CF5Q 5BYQA 3FCHA 5E7OB 4LIWA 5SUHA 3Q8UA 3UO0A 4OLAA 5L38A 2QYGA 4Y2KA 1XQSC 2IYGA 2E2QA 1O0PA 4O23A 4GKKK 4CH1A 1RWOB 1HNZJ 3MM7B 3GBTA 1YIJN 4YR0A 2FZKB 3DLLQ 4JI5K 2XBPA 2JSXA 3I4HX 3FZMA 2MZJA 4NLPA 1N33F 5C15A 4OMFG 3RR8A 1UA0A 2JEJA 2V51B 3L2VA 4K4UA 2KHCA 3VF4A 2UXCF 2PGCA 2IA0A 2QWOA 2CPDA 4PAAA 3OVAA 5H9EK 5EXWA 5HVFA 4PWUA 5FD1A 3R7NB 2OFGX 2DR6A 2CJ9A 3ENQA 3BZCA 3C2PA 3NF8A 1Q82T 4DHYA 1EZZB 3T1HF 3C6HA 1LW0A 1JNZB 4E19A 3TZYA 4PA1A 2J8SA 3BGRB 4ZP9A 1KR4A 1GMWD 4K0KK 3DHWC 2BRLA 2EG2A 1TKXB 3OT9A 1XMOJ 1ASUA 3THWB 4CF1A 2XS7A 3CJTA 5AXNA 2MKHA 1C1BA 2V8VA 4KTQA 2NRVA 4FPIA 4GO7X 4DR2F 1RWXB 4TU8A 1NM2A 3GIRA 4IFEA 3D28A 4KO0A 1S9GB 1CULB 2B5JB 3PVXA 4ANEA 1HWLA 2XMUA 5AQRA 3T9NA 4DG1A 1L3VA 3CJ0A 1HNIA 2XLJA 3BJYA 3CD6N 4OO1J 3OVSA 1NU0A 4IOAQ 1KLMB 1TU0B 4WQ5C 5K14B 4FJKA 1NJIO 4C3MA 4FWPA 1R0AA 2OI2A 3PW4A 4IJAA 1X5OA 1IVZA 1OVQA 1XWLA 3BYPA 1NJYA 3C19A 3OLBA 5HP1B 4DTMA 1EKSA 1R89A 5ETTA 1WC3A 3EEQA 3AVHA 7AT1B 1Y5IB 2RQMA 4V19X 1RTZA 4CQ1A 3OQ2A 5KFVA 3MOJB 1RB0A 3DLJA 3M30B 3SCLE 1U2VB 3FZFA 3DKDA 5AQJA 4NLXA 3GFYA 1EIYB 5L1IA 3TAPA 4JI2K 3N28A 4YY3K 1WNSA 1ZM4A 4RJVA 2CNNB 1YJNN 1XN9A 2B7BB 1OO0B 3NNHA 4DR1F 5T7BA 1IM6A 2BM1A 2UUWA 1T9VA 2ZZTA 1EKRA 2ZBQA 2BOPA 4A2AA 1RT5B 3C66A 4DWIA 3M6XA 5LMNK 3LTOA 5GAHI 3V9UA 2HGMA 3D2FA 2WBMA 1U1OA 2ASMA 2E5HA 1UVJA 4PKHA 3QNOA 3CCRN 3MMCA 5MLCV 1RT4B 1BE4A 5L39A 1A9NB 4JI0J 4DV6F 3FFKB 2DY1A 5F2RA 3TZXA 4CLWA 2F7TA 4YOVA 2NUHA 4ZLJA 1N33J 4CF8A 5F3TA 4RNFA 2DY9A 1SJFA 2DRBA 3KD5E 3A8JA 2QLXA 3PR5B 3SV3A 1PYTA 2J4RA 3HSGA 1LWFA 1BL3A 1W26A 2WOMA 1YSJA 1JNRB 3E51A 5EVZA 4PKGA 5HL7L 4CJRA 4KKOA 4TNOA 4KREA 4DUYK 4Z7CA 4PG6A 2YX1A 5AXLA 1MW7A 3R1HA 1FF2A 3T1HJ 3HVTA 4DV7K 4DXLA 1V5IB 2EEYA 2KFNA 2OO4A 4JI3K 4LF5F 2MQPA 2CQHA 3RW7A 2MQ8A 3ZLJA 4XIUA 3SBMA 4EBEA 1HQUA 3ULEA 3ZX2A 2CQCA 4CJTA 4NXMK 1FRJA 4GY2B 1LWEB 3OXLA 5A6PA 2BJ8A 2HRTA 2NZTA 3IUCA 2VQFF 5LMUF 1ZBSA 2HBMA 1NHUA 3QBCA 2VG7B 3LPYA 2UXDK 4KHYA 3CE8A 3K7RA 4DR7K 3U9ZA 1CZAN 2O8CB 3HHDA 4DTRA 4ITSA 8AT1B 1J5OA 4LR9A 2ZH2A 1S0VA 3HHLA 2E44A 3HO1A 2D3ZA 3QT8A 1JQGA 3CJ4A 4F2SA 2FJBB 1JLQA 1ZAVA 4PPDA 1NGFA 4WYBA 2RVJA 4CGGA 4KHRA 3DM2B 5B0BA 1SQGA 4YOTA 2ZZNA 3E66A 2FJWA 1NSPA 4HHTA 2KLAA 3HHLB 2I5JB 2E7VA 4AM6A 2CQIA 4F4AA 5KFFA 2F63A 1KAZA 2ZHAA 1TFYA 2D9PA 2QTWA 2ZVSA 4UY8O 4P2XA 1PYSB 2E5GA 5C10A 2B7CB 1KTVA 2FHKA 2QTDA 5HQ8A 5HSPA 3D3CJ 1HPZA 3AVCA 2I7PA 3GIKA 4H0TB 1TK5A 3M05A 1FERA 1B3TA 5HMWA 1I94J 1O13A 1YK9A 2Z1IA 4OI2A 1RDCA 3PW2A 1WJ9A 4JRPA 3DLKB 3LA0A 3HZGA 2D0AA 2P9LB 4KH1B 4LF9F 4TU9A 4IEEA 1M5SA 2W4PA 5SZTA 1MROA 2RRNA 4A8SA 2HNZB 3J7YU 3A0IX 4HCCA 3VAJA 3G6VA 2KYZA 3PRDA 4NLUA 3IDHA 1DTQB 1B4SA 3F2KA 4DR1K 4M3YA 4OX9K 3ZTRA 3NEKA 3ZT4A 1RAJA 3ZSZA 3UR3C 2YCHA 4WIQA 1VSDA 1LK7A 4KB7A 2QLBB 4FYWB 1MN7A 1OY8A 2FVRA 3KK2B 4QWEA 2YHYA 3I87A 2YHBA 3Q8PB 2B9WA 2FSKA 3CB4A 2X6SA 4Z37A 4X2BA 3CM6A 1TR0A 1JLAB 1RKIA 2WSEC 2W42A 2DNLA 2UVUA 4DV3K 3W8PA 5DLFA 2UXDF 2VHGA 4DV1J 2GNKA 3V6DB 3ELHA 2FB0A 4AF1A 3I82A 2AYEA 3IN5A 2E2NA 2ERRA 1ZTWA 2W9BA 1MROB 1Z6RA 4FLZA 3UQSA 4YMEA 2VFUA 1RAGB 1XR5A 2PO4A 4CERA 2CPEA 4U7BA 4HUGA 3JQKA 2W41A 4DU8A 3H2UB 1QY7A 5DGAA 4DTJA 4KBOA 1RADB 5BXIA 4AE5A 4CZHA 1U45A 1TGOA 4AYBD 2E5LF 1QAIA 1HI8A 4NRTA 4TYAA 1PG5B 4BC9A 5F8MA 3NGTA 5KFEA 2OPQA 4LFCF 1YJ9S 5TKYA 1WNEA 1UVMA 2V7ZA 1VSEA 5DJBA 2L41A 4JS5A 3LAKA 3CJ9A 2E1ZA 1R0CB 3H5SA 1MDUB 3SCJE 3H45C 1GLJO 3S7RA 2V2VA 3CTRA 2B8QA 1RTIB 4DS5A 3ILLA 4CJPA 2IJNA 3UDCA 1IJJA 2VOOA 3JAMU 4H4MB 2QE5A 1RT1B 2RD5C 4DV7J 3T1HK 1UW9A 1HBOA 4BBYA 2YQ0A 2V8GA 2UXBK 1ZBTA 4BWJA 5HI7A 5A0YA 3QWUA 4AHUA 5IWAK 1E4FT 3QGHA 4ZVRB 3MUTP 2MSTA 2F8MA 5BR8J 3QEIA 2W4DA 2WCXA 2FHMA 1N5VA 5E0OA 4G3IA 2W4CA 1H3DA 3PLAA 4HT7A 3ZNUA 2Q66A 1GXUA 4IFVB 2XWYA 2XMWA 1FEHA 3VQDA 4L75A 3G71S 5MAOA 4BRAA 2PA3A 2VU5A 1X60A 3JAMY 2M2BA 3KG0A 3OFGA 5BPMA 2AJFE 2Y9HA 5AZIA 4OX8A 4KGMA 4YB1P 5AQPA 3AOBA 3CCZA 4GC7A 1SIZA 3AOAA 3LZIA 3T1YK 3LDSA 1ZC6A 1MG7A 4ECYA 3OYBA 4WCEL 3MECB 4ID5B 3KUEA 1YJWN 2CQ4A 2Q0RA 4LSLB 2YXLA 4F3OA 3VN5A 1M90O 1IBKK 5K8MA 5GAEP 3CT9A 3SQGB 3UDVA 5FPMA 2DXFA 4ALZA 5DQIA 4N5SA 5HRNA 3OVBA 5M2UA 5H1SV 4B1VA 1RTDB 3K9JA 4CEAA 2GIRA 3R5JB 1Y5LB 2QXFA 2B3TB 1V3RA 4BREA 2IPOB 4QS8A 1UP1A 3AOCA 4HHHA 4F8RA 3CEDA 4DQ8A 3W7BA 1GNKA 2IC3B 2X1BA 3GTYX 4ED6A 3MWTA 2BJEA 3CIMA 1YTYA 5BJRA 1CEZA 5GMEA 2XYGB 3LGNA 4O4GA 1P9QC 2AA4A 2VFVA 4W5QA 3MMAB 4BDZA 1S6PA 2VH7A 4OYPA 1L5UA 5L1LA 1GLBG 2VA3A 3KG4A 2HMPA 4ECZA 3D3BJ 4JI6K 3Q0AA 1JLCA 2P9KB 4I6YA 4B9QA 4CHNA 4Q2MA 4B3RJ 1NGJA 4MQ3A 1FJGF 5FJ4A 1VHIA 3D0IE 1HRHA 3FGUA 3PX0A 3CHWA 3QFUA 2QL9B 2HHQA 1W9HA 4F4KA 2DRAA 1P6TA 2Z8QA 4I6WA 2P9SA 1PSDA 2FYXA 3L7UA 3WC0A 4NMLA 4FWRA 1RACB 3FZKA 5F8HA 1ZAWA 3TU5A 1HIYA 3I6PA 5D4LA 3TVZA 2MKSA 1TYQB 4CZMA 4QIEA 2MQQA 3CPWM 3CCRS 3PCOB 5CR4A 1DTTA 3KIOA 4ZPAA 4X64K 2DHHA 3R5BA 4MLHA 1NZ8A 3G0ZA 1F1BB 2RRAA 3I55S 1T94A 3S9HA 1WEXA 4M3TA 1TKXA 1HPMA 1N36F 4MKBA 2DR9A 1S1TB 3N6LA 1FRHA 5L8RC 3ZSWA 1JLCB 1JL1A 1RWUA 3HSTB 4LRAA 3FC9A 4ILRA 3TA2A 3DI6B 3SYZA 1JCFA 4DI6A 1VRQC 2KO1A 1IR2A 3DRSB 3M2RA 4M1KA 1ATNA 1FD8A 1UWAA 1WTFA 2V4JB 2HFUA 2ATQA 3IBCB 2KVQE 3Q8YA 2PMZD 2UUAK 2C2KB 2ASLA 4C0OC 3ITHB 1NXIA 2E7WA 2C28A 4ZITA 1IH7A 2O8BB 3WX8A 3VALA 3QNNA 3LPUA 3Q89A 5IM0B 4N7TA 3DJCA 3AA2A 1X4DA 1YTAA 3AA3A 1NMNA 3EGNA 2O8FB 2W1BA 5ETKA 3B78A 4LF4K 1DQAA 3QEWA 3MEEA 3SQ2A 3WXLA 1GMVA 4DOZA 3CDBA 1VQMS 1KTQA 2AJ2A 2KFZA 3HJVA 2IVPA 4DR3K 4NYNA 1QE1A 4DR5F 4CZLA 4FOEA 3M8WA 2JWNA 1ZS6A 1NJXA 4GV9A 3OJSA 4LFBJ 5GADU 2MKIA 3LANA 3BBCA 5AZJB 2ZH8A 2HNDB 1U0HA 3RU0A 4KI4A 3CCQN 3AH6A 3CYMA 2P9NB 4IDHA 2HIQA 1FFGB 3L4BC 1IBMJ 2ZDPA 1N5QA 1MWQA 3Q7BA 4BROA 3PW5A 1IN0A 1UL3A 4WFNQ 1NK6A 3MFHA 1T3VA 1CVJA 3RSEA 2E7XA 2O67A 3WEEA 2ZHOA 3CD0A 3FUYA 4LSZB 2E1PA 4C8YA 1SS6A 4J91A 5HK4A 4UY85 4ILHA 5A2QY 4FJGA 1WI6A 1S1XB 3N5FA 2QLWA 5GAEU 4CZKA 1S1WA 1KD1T 4NE9C 2G8KA 3CXCM 3W64A 1RISA 2PMHA 4ZPWR 3HMJG 1VSKA 3LP0B 4QPTA 5AQLA 1HKBA 3M8SA 2HG4A 2KT2A 4Z4IA 2O01C 4LMZA 5IQQA 2CADA 2HFOA 3D66A 2NREA 3UN3A 3LZJA 5H9FK 3QO9B 1JL2A 4RR5A 3EZOA 4U67L 4CHYA 5B0GA 2UXCJ 4K42A 1U1KA 4FLYA 3FEYB 2VF3A 4ZP6A 1JLFA 1KFDA 1Z4UA 3RMAA 3GOIA 3KK3B 2BACA 1J5EF 1AZSA 3SAGA 1C0MA 1HQ2A 1ATRA 1N5TA 3FZBA 3HTVA 4R25A 5DRKA 4U67Q 4U8VA 3ALYA 1ZZFA 3KLHB 3Q24A 5AQMA 1DGKN 2YHXA 5K5MA 1X0FA 3FEXB 1FXDA 2DNOA 4USVA 4X64J 2HK3A 1VLYA 3MX2A 3BKUA 4NCBA 4WE1A 2MKYA 1Y4ZB 4JV5J 3J7YP 2HNZA 3VERA 2E5JA 1VQPN 3AVAA 4A8XA 3MAHA 3RTVA 5J1NA 1CQNA 1S12A 1T9UA 4CO4A 2GCFA 1KAYA 1FEEA 1KEKA 2BZ2A 1IKYA 1NDLA 3TR8A 2UUCF 3C7NA 1SJQA 3W2VA 1VQOS 2WZ1A 4BGBA 4B3RK 3K2YA 3BSAA 3BDEA 1HKGA 1E6VB 4Y0FA 3TUIC 4CIFA 5C2GA 4CO3A 3UCZP 1FTRA 3DDNA 4M94A 3R2DJ 1K6YA 2BE7D 2AYGA 4X62K 4CJWA 1ASVA 5LL6d 4UW2A 3CJQA 4DQQA 4IH6A 3NS6A 1J6ZA 1GLEG 3X3UA 4K4TA 2F9WA 1KHVA 4G1IA 1ZXOA 2P5VA 4ZCMA 3EDRB 4X4NA 3EVOA 2GWJA 2CPFA 3EZWA 2M8HA 3VENA 1I51B 3MUMP 5KG2A 4C98A 2BABA 2JZ5A 4BVOA 3S8SA 1VISA 3O2IA 4Z4HA 3PJ9A 5ETSA 2YBVA 5F8LA 3IR7B 2BANB 4PG8A 4CYUA 1U6ZA 3Q2SC 5CXTA 4LF7J 3RWUA 4DB3A 1IG8A 3SDEA 1FNXH 1ROFA 3CPWR 3D2EA 2L08A 3DU6A 2PZSA 2DGWA 3AA8A 4OQJA 3NVKA 3TAEA 3PW0A 5AQUA 1R43A 3CSKA 1A6LA 4K4WA 4ZCIA 3V4IB 1UJ5A 2ZJRL 1UETA 4B8CA 2XHWA 1XNRK 4WK1A 5FRNA 1CZ9A 3WNEA 1LAWA 4ZLLA 3CGIA 2XZDB 2CZ9A 1BQNA 4LF6F 3T7ZA 3CO9A 3E8OA 4KRWA 2ZOGA 4LF9K 2VQEF 1JX4A 4YR3A 2CQBA 1BU6O 4JKEA 3MTJA 1RK8A 2JFKA 2E1CA 3LAMA 3NWRA 2B43A 1RLDA 3EGWB 3C14B 3QMQA 4ZKAA 1YITN 3J80U 1FESA 3RB3A 4FYVB 4ZVEA 1Y0HA 2DNZA 2Y0BB 3GR1A 3FEZA 3O8MA 2HOEA 2CNKB 3FBBA 4DCJB 4NMXA 3M2VA 4LF8J 4H5TA 1RCXB 1JLGB 2EFNA 1KVKA 2F3JA 2A3ZA 3MEDB 3IA0A 2EX3A 2COLA 2E2PA 1M1GA 5KFCA 4WCEQ 1NWKA 3WT0A 1Z2ZA 4LRBA 3RR7A 1JXBA 1MSWD 2LXIA 2OPPB 4R8UA 4DFMA 2XNQA 3ENWA 3PEHA 3OYDA 1SCJB 3ZZPA 1C0GA 1OJ4A 2POKA 3IMXA 4K7QA 1D3WA 1RCOB 3C15B 2PI5A 1MLAA 4WZQA 4FYYB 2QN6B 2NPIA 2A5XA 5SWMA 1JK9B 4I6MB 1IKVB 3SUQA 3C46A 2F8HA 2OGUA 2XMJA 2HWHA 3ILOA 2WVDA 4QYRA 1ZTTA 3GYNA 4YHHJ 4ZVOB 1SBRA 3G6XA 2ZH4A 5LM7E 3CJ1A 4URGA 1RAEB 3BM7A 4DR2J 4O4RA 4DBQA 4UOFA 5HL7Q 2I2YA 4MFBB 1CC8A 1JXLA 4A61A 3D6TB 2QGFB 4GVBA 1D4XA 3PNIA 4DSIA 4CZGA 2CYYA 3GFXA 4JYAK 1SJRA 4YB5A 3SI6A 2BE2A 4H0PA 2FLOA 5H9FJ 1EXQA 5CZ2A 3P39A 2RH3A 4KHPK 3AGRA 2P51A 4F36A 5EX5A 2YKMA 4ZCKA 1S0NA 4H5VA 2DXEA 2BKPA 2PMWA 1RT2A 3NWGA 4CJ5A 4B3RF 1XTZA 2R3VA 2RF2A 3FMBA 3JQMA 4DL5A 1WORA 2ZC3A 1FA0A 4MK7A 4JI5J 3SPZA 1RT6A 5J2PB 1UTAA 1J54A 2P9GA 9ATCB 1FXXA 4YY3J 2HGNA 3OXGA 4U7UD 4HL9A 2UUBK 2FC8A 3IGVA 2VG6B 1R59O 4TXSA 3LALA 1Y5NB 4H4KA 4TVAB 2MPUA 3CIZA 2W9BB 1TAQA 1S3XA 3EYZA 4NLQA 2YV0X 1C6VA 2G0JA 1F3VA 3ZSXA 1WEZA 3NAEA 1OS5A 3IAS9 2HHPA 4M5KA 4A62A 4TQSA 3H46O 4RTFD 1JJCB 2A6MA 1HBMB 3PDNA 1WC6A 1BA1A 2CAJA 1VBZA 3CJ7A 3CVKA 2AJ1A 4C1NI 4I2PB 2P5OA 2VBWA 1CS4B 4IR9A 3WXKA 1K9MT 1DURA 1ASWA 3FCWA 3DRRB 1PBUA 1QTMA 4OZ3A 4JKAA 4TN2A 3AO5A 5M1QA 2G8HA 4Q0BB 3QIDA 4FWMA 3VETA 3A3PB 3GIIA 5E84A 1BCMA 1Y00A 3P3DA 3HXMA 3BO3A 1CS4A 2C22A 3LUYA 1WELA 4O3SA 1NEEA 2P9NA 2AHOB 1GOAA 5EWEA 2DGQA 1CXQA 2HHHK 4WZMA 2FPHX 2NXJA 1NLVA 3O9QA 1RUSA 1HYZA 4H4OA 4DPWA 1K1SA 3F73A 4AQYJ 2NYHA 4R5PB 2XO7A 4QOZB 1S1UB 4OL8A 4Q7AA 1RU2A 2KT5A 3BN4A 5FROA 3F41A 2UVRA 5KFWA 4OJRA 3DI6A 2E1AA 2N4CA 3D67A 3L09A 2WAQD 3I31A 1HBNB 3BO2A 1W0HA 3DGPB 5KRTA 4B3OA 3HYFA 1RKJA 4OYIA 4LH4A 2QWLA 1WOQA 2IBKA 4XEIA 3BS9A 2BOAA 4P2MA 2YKAA 5ETNA 3PY8A 3MR3A 3U02A 3TW0A 3O1WA 3VPZA 5JLHA 4Q8EA 3PW7A 3SCKE 2J0XA 2G4BA 4CLFA 1NDPA 1N52B 5M1OA 2Z30B 1S9GA 3VQ6A 4CEDA 4HTLA 1PAUB 4FW2A 1HUXA 3KFWX 4JV0A 3ZEUA 5E2QA 3UFCX 2R7TA 4NLVA 4PL7A 1WOOA 2FLLA 1AZSB 2VWKA 2R7OA 4OHVA 4DCOB 2DJWA 3NGZA 1AYEA 4FCYA 2LECA 3JTPA 3IFEA 1YT3A 2FD2A 4JKDA 3BN7A 5A8KB 1UJ6A 4XH1A 2GVDA 3AXKA 4YQWA 2WONA 2IIHA 5KFJA 4QU7A 4E2FB 4LSNA 4PXBA 3U1NA 3ZSOA 3ULEB 2EBEA 3CG7A 4ZTFA 4GO5X 3QSIA 4ED0A 4AHCA 1FXLA 3GB0A 1U0HB 1VSLA 4F02A 4YNQA 1E6YA 5B0EA 1F5CA 1R3NA 3F56A 4AQYK 4CFAA 1V3SA 4ZJQA 5JS2A 5D4PA 4AHSA 1U09A 1C1CA 4KKOB 1Q81T 2V4JA 4DV2J 2ROGA 1SL0A 3CDAA 1GLAG 3ET6A 5DETA 3GJSB 4MKYA 4P7TA 4WFAL 2XY7A 1NBWA 2P9SB 2MJNA 3P38A 2PA8D 4CGIA 4DR4F 1JLEB 4Y3CA 3TABA 2DHGA 2WVEA 4Y34A 3SUOA 4H4KC 3S3MA 1YBTA 4ANCA 4ZCLA 1I5OB 1D8ZA 3BEGB 3WQPA 3UCUP 1QVGR 2A0FB 2YNFA 4DQRA 3I8BA 2KXHA 3W60A 2GAHC 1AROP 2GWKA 2F9DA 3M1VA 1NSQA 1D9FA 3W3DA 3KLFA 4FYXB 1TK0A 4Z4FA 1VOMA 1C0UB 4XAKA 2HS3A 4ZVHA 3OYLA 1IJEB 1FRIA 3HVAA 4M41A 1QE1B 5ADZA 1VSMA 2AMCB 2ZWOA 3DOKB 4BQLA 1VK8A 2F4VK 4J8FA 1N36J 4PKDB 2W7PA 3DXSX 3E2EA 3CMQA 4CI6A 3M2RB 7FDRA 1Y97A 4FM2A 4B1XB 1FJEB 4BCAA 4USIA 2QX0A 4BG9A 3R9PA 2G9OA 2L48A 3GFHA 3NNCA 2YTCA 2RE1A 4JHDA 1SC3B 3E3XA 3SQ0A 4WIIA 3V9ZA 1NBEB 3NH2A 1XMOK 1TTHB 4GMJB 4BC5A 1EARA 4DPXA 1KLMA 4K8ZA 3HPOA 2LU2A 1I6JA 2YVSA 4DL0C 4XK8C 3J7ZO 4OZ0A 5EX3A 4F50A 4OGCA 2HS4A 3SAFA 4RNNA 2YQ3A 4J2EA 1WHXA 2NXCA 3ICLA 1O51A 4FKYA 2XCAA 3U1LA 4E7LA 2EVZA 3G86A 2ZBPA 4FWLA 2E29A 4TY9A 1PC4A 3N01A 1XUPO 2FY1A 4OYZA 5C24B 3VEYA 3QSYB 5DO2A 2V94A 3VQ8A 4LF4F 1HNXJ 3ENBA 2DR5A 1LK5A 2V68A 4BE2A 1IKXB 1FRMA 2NYIA 1R8BA 2E9TA 2DGOA 5I42A 1RBVA 3CCMN 1U4BA 1KDNA 2DFHA 4RU9A 2OPSA 2HHVA 1LWXA 2HFSA 3V2UC 1EB0A 2HLUA 3HKZD 4LFBF 3EJMA 3IWLA 2IOCA 1FX2A 4CFBA 1GK8A 3ZEUB 2OJ3A 1WSGA 1PC5A 4ZA1A 5F9LA 3CJSA 3PKMA 2FVSA 3D6MB 4L6V3 5B8HA 2KI2A 2R7QA 2DH9A 1QTNB 2KKHA 3O4WA 3GMGA 2CDRB 3EVMA 2G13A 1HHTP 1S4EA 3THXA 4DZDA 1SKSA 1ZM2A 1GQEA 5KFNA 1ZBUA 4KTZA 2BW2A 5KTQA 1CZBA 4FLXA 3A4TA 4N8NA 4RW8A 2XZWA 1S7HA 1JLFB 3VEZA 2H5IB 5EX0A 3OS1A 4J90A 3DXMA 1YG0A 2LQ5A 2NRWA 1VSHA 2BXJA 1Q8IA 2DPNA 4NEZA 9RUBA 1RTIA 3G4SS 3VAFA 2A1RA 4DL6A 1TELA 2MZQA 2EI5A 4LF8F 3UNYA 2ZWHA 2O5DA 5LJ5Y 3HP6A 4OZ1A 1QSYA 5CZXA 5KFYA 2MLXA 4O3OA 2ZBIA 2MDAA 1BQXA 4B17A 4G9ZA 4NL5A 4TY8B 1ZPVA 3AA5X 4ILMA 3G10A 2EPIA 4FWSA 1BCOA 2ZOFA 2EW9A 2YPZA 3UR0A 2FTRA 2K3IA 4M5HA 3SI8A 3VTHA 2VGNA 2YKPA 2LDIA 3QRRA 2ZKTA 4KHSA 1YVUA 4DR1J 4YB7A 5D78A 3O5BA 4BR9A 4JK8A 1MU2A 4BRGA 4WP8A 3ZSRA 1K0VA 4IG3A 1HD0A 4DFPA 2PI4A 2C2ZB 1S0MA 3VV2B 1HNWF 1TKZB 1U49A 2OEKA 3OTBA 2MTLA 1CULA 4PXDA 3MPDA 3BPDA 3JB9k 3EXYA 3FRZA 5IWAJ 3X1LB 2GUIA 2DGUA 2JGUA 1I39A 4DZ6A 3EPIA 4DV4F 2OPSB 3VQPA 3T1AA 3NP5A 3MM6B 5KFOA 4R8UB 1RWMB 2OSQA 4JN4A 1WG1A 1RYRA 2QWPA 1OYEA 5CYMB 1HYSA 4IUFA 3P5BP 5B0CA 1HYVA 3UKUB 3D45A 3KHGA 5F8JA 2E1YA 3HULA 2DO0A 3EE9A 4M63A 2JL9A 3NMRA 3OYMA 1ZA1B 5GADP 4JK7A 3W9IA 1NB2A 3TSQA 1VI7A 1Y64A 3HFZB 2Y8YA 4BRLA 4O5BA 1UFKA 1SIWB 5HANA 1F2GA 2HW3A 1M5OC 4I67A 3VWSA 2IC3A 1OPIA 4Y6IA 5ETOA 5EDWA 4BRCA 3CJ3A 2O4GA 4BRHA 3I4PA 2HHSA 2IRUA 2AIRB 1WWHA 3THPA 5KFPA 1DLOA 4IDKA 4DF4A 3HHKA 1M5KC 3JTOA 1M1HA 3ZZZA 5AQKA 4GKJK 3BDPA 2LKZA 2UV8G 4KPCA 1A5XA 3MN7A 3T6BA 2IS3A 4JB8B 2XSJB 5F41A 4CHQA 2OZMA 5KOXA 4DV2K 4ZK7M 4JI8J 2ILZA 2GA7A 4IO1A 2QWRA 4ZLNA 1WLJA 3SFGA 2XULA 2GMHA 2OTLS 2KFYA 2LCWA 3H4BA 3V6JA 4FWOA 4YOUA 4IRCA 4FBUA 3ILJA 4M5IA 3CCLS 4DQSA 3UD4P 3RBZA 3PIOQ 1L3KA 1H0HB 3OUYA 3PJXA 2LLZA 2CQDA 5H1SQ 3BGRA 4BRPA 3G8QA 1TK8A 1Q18A 4DDFA 5KT4A 1DFDA 1NH8A 2ATLA 5BN9A 1N88A 3KHRA 1Q5YA 1SPBP 2K1RA 3GJRB 1AXQA 4F7VA 1TP7A 5HN0A 2LP4A 1OSDA 4IH7A 4GMKA 1Q7YO 3R5AA 2AP1A 3N6MA 3I9V9 4JI0K 4NLWA 1IR0A 3G6EN 1KWMA 1S79A 4NA3A 1TUWA 5I3QA 4CLTA 1LOUA 2QRRA 1U1LA 3V9SA 1RP5A 2E6LA 3HI9A 5BPLA 3EN9A 4Q8FA 3QAEA 3MM5B 1U2VA 2P9PB 3IBFB 2VQEJ 3MDFA 2IRYA 4IFYA 4O55A 4ISEA 3VGUA 2YNHB 4NI2A 2DNRA 2DY4A 4LREA 2FHJA 3ZTOA 3E01B 3FK4A 2XSJA 3DM2A 3H3OB 3CQ8A 5LMUK 1YITS 1D5AA 1QSLA 2YX6A 2DNYA 2ZBRA 5BR8K 2AEMA 1U04A 1FTCA 3FLCO 1WACA 2MKKA 1LOTB 5L1KA 3T41A 3LO3A 2DR7A 4OPHA 2C2MB 4FK0A 1QHTA 4LR8A 4LF5K 4JI3F 1P9YA 2A18A 1F0XA 3CJ8A 1VRTB 2CDQA 4Y2MA 4BQZA 1JMTA 4BY9C 4FJ8A 3QYYA 3G71N 4NPOA 3T6JA 3CCSN 3OTEA 3CFRA 4IZ9A 2C3UA 1TKTA 3ZCMA 4JI0F 2CVEA 3GJTB 2RDIA 2UZAA 4ZPTR 3U9DA 4MIWA 4O0JA 2C1EB 2CNLB 5KFBA 4IG0B 1OSCA 2DB1A 3WXJA 3VGVA 4LY7A 3UE2A 5B09A 2DVIA 3AJDA 4ZLPA 3HZEA 4I7FA 1YRTA 3QLHA 3Q86A 1TVRA 3PFEA 2OCEA 4IFYB 4L76A 4C8ZA 4J9RA 2P6SA 1HARA 1B64A 2EK6A 2KRBA 4MDAA 4KYZA 1Q86O 2DNMA 3AODA 3MN6A 1TL3A 3BSOA 1NPRA 3L6QA 3PX6A 3ZZOA 1NGCA 4FZYA 4EYIB 3KKSA 3D7SB 3RAMA 1S6OA 1S5JA 1GFWB 3UDLA 4V1Ak 4GRSA 3AJ2A 1NK5A 2ETJA 4GW6A 4DV1K 2V69A 3VQ5A 1YJTA 4RUBA 4F4YA 2Q6CA 4ZVUB 2IM2A 4DTOA 4B1YB 3LGMA 4LIRA 1YAGA 4MIBA 2L9DA 1JIHA 1N32F 3OYFA 4B3TK 3CMEN 4LF6K 4BE0A 2VPZB 2V52B 3DU5A 4OYOA 1KKHA 4DX5A 2JJ4D 1GOCA 5AQOA 2CGLA 4JK9A 1D1UA 1WG4A 2HHXA 5BREA 4P73A 3H25A 3MX5A 3OHAA 2B8PA 4FLUA 5IZHA 1RGVA 3UKRB 3J81j 5AFUH 4UOHA 1WHWA 3C95A 3H6EA 1OYDA 3IR5B 5E33A 3SBTA 2EKYA 1HW8A 1QAJA 5FPNA 3OHRA 1U48A 4FZZA 4JEPA 3DCAA 4OYXA 2DNPA 4OYBA 5LT5A 2J0WA 4AL6A 1BI4B 4CJ3A 1N6QA 5BRFA 1EETA 3GP9A 2YX4A 1TL1A 4FPBA 2R2SA 3ZZUA 3W2WB 2F1FA 2QYCA 2XSFA 3WUHA 3BR8A 3AQPA 2QL7B 1N32K 4Q5VA 1G6BA 3HFVA 2W2QP 4LRDA 4C0BA 3WXIA 4DV4K 3SMSA 3QERA 3TARA 5KGWA 2Z2LA 4DUYF 4O5FA 4IEIA 4EFAC 2HBJA 4CHOA 1OH7A 5DDOC 1G3OA 1ZBFA 4NCGB 3W65A 3KLHA 2DK2A 2A2DA 3CC4N 3BEXA 4KHQA 2G2YA 1C2PA 3C14A 2X3DA 2DNKA 3QESA 3QATA 3QQCD 4ED7A 3M30A 1UZDA 5KGXA 4A59A 1D9AA 1RAHB 1IBLK 2D74B 4ILGB 2UUCK 2MY7A 3PTWA 4KRFA 4PQUB 1RNHA 1CJTB 1HNXK 1X0PA 3DRXA 4NXNF 4W90B 4RL1A 1J9AA 2J6SA 4FJLA 3D1QA 4BLGA 4WJBA 3Q7CA 4C7QA 1Y9OA 1RT5A 4ZIVA 1OQ3A 5H9EJ 3G82A 5G4DA 2WSCC 1T05A 2FIUA 3D5MA 3DLBA 4ECRA 1FJGJ 1YJ7A 1UVKA 3D2EB 2QLJB 4CK1A 4KFBA 4ISGA 4ZN3A 2HEKA 3OTCA 1GMUA 2YKNA 4KV8A 4OI1A 2ZVIA 4YS2A 1M0SA 2ZGZA 4OI6A 4CZJA 1EKEA 3NF7A 1JJ4A 5FPDA 4UZCA 1PO6A 4IG3B 1MMDA 4K43A 1SI9A 5E3AA 3MPVA 3EE8A 2MZRA 2RKIB 4TQRA 1ATSA 3BKFA 3P96A 3DXMB 3DLKA 2XC9A 3DYAB 1YHQS 2HNYB 4DLGA 5AQYA 1N36K 2RJZA 4RW8B 2KW4A 3CIPA 1S6PB 2H4WB 4AL7A 3IS9B 2KT3A 1J53A 2DGXA 1PIEA 4ZVTB 2AJ0A 2HF3A 2DBBA 5KQ8A 3AO4A 3RBDA 2HBKA 1EP4B 4F0HA 3HHLC 1X4BA 2QK9A 1DAXA 1Q4RA 4CEZA 4AILC 4DV5K 4NX9A 1LV5A 3S01A 4J9OA 1FRXA 1PBAA 4Y2CA 5F8GA 3UI3A 4QW8A 4ATNA 2W7AA 3D6HB 4X65K 1TKDA 3L7PA 5KG7A 3W9HA 3DWLA 3OBYA 5CD4A 1BXNA 1X4GA 4JI6J 5J2NB 1UEKA 3FVYA 3MM8A 1Q79A 1GT8A 5KQDA 4LF7F 1H72C 4DCPB 4MYUA 2OPRA 3UPFA 4OJGA 4K0KF 1WBBA 5I4MA 1KD1O 3A3NB 1I94F 4JI2J 2EWSA 3CJKA 4Z4CA 2AZ1A 1JXEA 3PRVA 1HNWJ 2M8DB 3OFEA 3MXJA 3MCSA 3C0BA 3TYTA 5C24A