1T05A

Hiv-1 reverse transcriptase crosslinked to template-primer with tenofovir-diphosphate bound as the incoming nucleotide substrate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
554
structure length
554
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDICKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords oligonucleotide template
publication title Structures of HIV-1 RT-DNA complexes before and after incorporation of the anti-AIDS drug tenofovir
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/dna
total genus 138
structure length 554
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1t05A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1t05A02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1t05A05
4J9KA 4CGGA 5KG6A 3DLEA 2AQ4A 1CLQA 1EETA 4B9TA 3CG7A 3OL9A 2XY8A 1L3VA 4FJNA 1G15A 3K59A 4CHZA 4ID5A 2CKWA 2X6NA 3QZ8A 2WK4A 3RMAA 2F96A 4CHYA 3CM6A 3KLGB 4KSEB 5HBMA 2F8SA 2GBZA 1CZBA 1VSJA 4KTQA 1S49A 3AVLA 4DU1A 1NK6A 2UUTA 5DK5A 5J2QA 3C6UB 3DOKA 3TAEA 5DG7A 4J9MA 3VN5A 1N6QB 4DL3A 4I7FB 1FK9A 3MF5A 2WB4A 1I6JA 3C6TB 3EY1A 4JLHA 3OYNA 3Q8SB 1B9DA 1S1VB 4J9NA 4CE9A 4I2QB 2B5JB 1CSJA 4FS1A 3HPOA 4F4WA 3IG1B 1LWCB 2F8TA 1K6YA 5K14A 1UA0A 4MK8A 1S97A 4CF1A 1RT2B 1JLBB 1K1SA 4ZP7A 2B6AA 4LY7A 3SPYA 1SKRA 3NDKA 1JIHA 4PUOA 1TKXB 3DM2A 2QXFA 4CJTA 4O3SA 4RW4B 3LP0A 4CGDA 3QNOA 3OY9A 4EEYA 5L1KA 4ECUA 1RT5A 1QUVA 4CJVA 4Z4EA 1RDRA 2D0AA 1RBSA 5KG5A 4IOBA 2R2SA 3ZT3A 1JKHA 2HNZB 1JLQA 3KK3A 2O4IA 4O5BA 3QYYA 3BREA 2FBYA 4B8AB 4CJEA 2YKNB 2DTUA 2B4JA 2A1SA 4QAGA 4HYKA 4N76A 1GOAA 4DG1A 1J53A 4FYDA 4YFUA 5CZ1A 4YP3A 1JL2A 3O3GA 2GIRA 2IC3A 4YMEA 4GC7A 1Y97A 1KCFA 2W9AA 1UA1A 2YNHA 3I5CA 5J1EB 2FVCA 3LP2B 3AVCA 3VQ6A 2HHVA 3H4BA 1HJRA 5DGAA 3G6XA 1VRTA 1KHWA 4CCHA 3OJSA 1HNVB 3MEDB 4DF8A 4LSNB 3DOLA 3AA2A 2ILZA 4Y3CA 2AGPA 3LP3A 3RBDA 1TKZA 1R0AB 4QWBA 2IJNA 2R8KA 1HQEB 2E6LA 4DS4A 3MR6A 5D3GA 5KG4A 1RT6A 4K4SA 3PW5A 2RDJA 1NOYA 1SKSA 1Q9YA 4WYLA 2XRIA 3THVA 3M8SA 2D41A 1L5UA 2O4GA 4RZRA 2RPIA 3RRHA 4DWIA 3DDKA 4KFBB 3HHKA 3NGDA 3OJUA 3NH2A 4KAZA 4Y1DA 3TAFA 2HHQA 3QGGA 3HVRA 4Y1CA 2YNGA 5EUHA 2D3UA 1LWEB 4CHNA 4CGFA 4M3RA 3DI6B 3BSAA 4CJ5A 4I2PB 4OKKA 4DS5A 4R5PA 4DSIA 2ALZA 4M3TA 1KLMA 3FSIA 4CEOA 4WXWA 5KFYA 1C0UA 3GILA 1JXEA 1KVAA 2Y1IA 2RKIA 1ITGA 4FW2A 2ATQA 5F8IA 4F2RA 1BIUA 3ZT1A 4BWJA 4DTPA 4CGIA 5L9XA 3QETA 2QKBA 2WCXA 4J9QA 5DQIA 3K2PA 1XR6A 1N6QA 4DSLA 4Z0UA 2QK9A 1D5AA 3L8BA 3HVTA 3E01A 4Q45A 4NLDA 4RG8A 2OPQA 1RBVA 3HJFA 3ISND 1RTJB 3MFHA 2BRLA 2VG6B 3OYHA 3TAPA 3LP1A 4K4YA 4FK0A 2GC8A 3G6YA 3CM5A 4IH5A 2FJWA 4X2BA 4CEFA 4FLVA 4RW8B 4ED8A 1EP4A 4MFBA 4XPEA 5KG1A 5HRNA 4H8KA 1VSHA 1JLEB 1KRPA 1SH0A 1REVB 4OJRA 1SUQA 4LH5A 1C6VA 2VWJA 3PO4A 3CFRA 3O3HA 5CYQB 3CDUA 3DLRA 4O4GA 1QAJA 1JLGB 5KFDA 5KFKA 4CF9A 4YNQA 4DTJA 4AHVA 3TANA 3H59A 1GOCA 4J2EA 3RB4A 3NBPA 4KKOA 5F8JA 3V1OA 3DYAA 2OPRB 4JV0A 2G8IA 4DTRA 5HRPA 4ELVA 4CHQA 1RTDB 3RTVA 3MECA 4IFYB 2HNZA 3OYIA 2PYJA 2ZD1B 2XI3A 4UQGA 3SUQA 2Z1JA 2D7SA 2YV0X 4ECSA 3LPTA 4IH7A 3SUOA 1QS4A 5C25B 2RF2B 3H5UA 3EPGA 3M9MB 3MXJA 3KLVA 2E9ZA 1HRHA 4BE0A 3KHGA 3DLEB 3I0SA 4ELTA 1EETB 3CJ0A 2BRKA 3H98A 4ID5B 5DG8A 2VA3A 4EYHB 1TAUA 4FXDA 4F4KA 3OS1A 4DFKA 1RAJA 3NH0A 4ZP8A 4KHYA 1U47A 5KFBA 3NCIA 5KRSA 4FJLA 4QWEA 5HBMB 4KHUA 5HROA 1LAVA 5C24A 4G3IA 3KMSA 3TAGA 3MEGA 3BQ2A 1N56A 1KVBA 1O1WA 5HLFB 5KFEA 5J2QB 3DOKB 5L1IA 3PHEA 3NGYA 1ZTTA 3NF7A 2HNDA 3GYNA 1CZ9A 4QWAA 3AVAA 1TAQA 1EKEA 3L3UA 5T14A 4OPJA 2R8HA 3U3GA 4CEQA 4GW6A 4NCGA 4KB7A 4ED0A 4EP5A 1QE1A 2BANA 3C95A 1YT3A 3IRXA 3UPFA 1TKTA 4PQUA 3I5BA 4E7IA 4KHSA 3QNNA 3G86A 4DEZA 4CEDA 5EDWA 3KKSA 3PUFA 5K14B 3AVJA 1Z26A 3KK2A 1ZBFA 2C22A 4FM2A 2B6AB 2IGIA 3I5AA 1WSHA 5KFCA 2R2TA 4FLWA 2FLPA 4PUOB 4ZHRA 3NAHA 3DM2B 3LP0B 4I9LA 4CFBA 2XY6A 4CERA 1JXBA 1TL1A 4XPCA 4CJPA 1RT5B 4Z4GA 4DQPA 3HYFA 4DTSA 3H5XA 1NKCA 3PX0A 4CJ3A 1S0MA 4DQIA 4M3WA 1JKHB 1JLQB 3KK3B 2IA6A 3G0ZA 3NFAA 4DSKA 2VG7A 1SL2A 2R2UA 2G8VA 4HUFA 2G8FA 3VA0A 4WYWA 1NHVA 4BDPA 5KFFA 3D45A 3HM9A 4KI6A 4NLXA 4K8XA 4FLTA 4O3QA 4DG1B 3H08A 3IGNA 3AVMA 1LAWA 4CECA 3VQQA 3AV9A 2XCPA 4O3RA 4ECVA 1BQMA 1QHTA 3QINA 4CGHA 2IC3B 5KT5A 2G8HA 2P1JA 4DL7A 2DPIA 3ZSVA 2XO7A 4DL6A 4ZTFA 4B9UA 1WAFA 3C94A 4ELUA 4KPYA 2YNHB 3UQSA 3DRSA 1U04A 4TYAA 3GIKA 4NLQA 1S1XA 4PWDA 3HP6A 1Q8IA 4YQWA 2C28A 2R8GA 4OPKA 3AVKA 4RW8A 2P5OA 3OYDA 4YR0A 3GV8B 3F9KA 1RT3B 4KE5A 2LSNA 2JLEA 1VRTB 3NAEA 4CEBA 3DOLB 3WNGA 5CYQA 1TKZB 3DMJA 3QIDA 2WTFA 2HW3A 4IKAA 2EC0A 4IBNA 3T5HA 4DLEA 4C8KA 4FJ8A 4O0IA 3LZJA 5D3GB 1WN7A 1QTMA 3SJJA 1RT6B 1BISA 1HPZA 1WSGA 4FS2A 4O55A 3UIQA 3HPHA 3F73A 4ZTJA 5C5JA 3B6PA 4TY8A 1HMVA 2EHGA 2KW4A 5DLGA 3OL6A 3NMAA 5EWGA 1N4LA 3HPGA 1IKXA 4ECXA 4F4ZA 1S1TA 3TR8A 2YNGB 3QIPA 4AHUA 1RDAA 1A5WA 4FJMA 1RTHA 3KIOA 4FJ7A 4LSLA 3OLBA 4R5PB 4DFMA 3RMCA 5DG9A 3MR2A 1XR7A 4JRQA 2OPSA 3BQ1A 1KLMB 5CYMA 3IAYA 4M3YA 5KFHA 4U7CA 3DLBA 3N6LA 3LPUA 1TP7A 1C0UB 4EP4A 1S9FA 2XI2A 2J6SA 4RU9A 3HP9A 4MH8A 1ZBIA 5DGBA 4FJXA 2HWHA 2RKIB 3PJWA 4NLYA 1YTUA 1QQCA 5CZ2A 3OYEA 4DFPA 3AVHA 1DTQB 3OYGA 4RNMA 4OKEA 2G8WA 3OSPA 4Q5VA 3Q8PB 2YKMA 5CY4A 4JS4A 5HLFA 2FVSA 1XI1A 3K57A 3MAQA 4DFJA 4Y2CA 3HVTB 3SUNA 3E01B 1FKOA 2Z1HA 2OPQB 5DLFA 3BR9A 3LP1B 2J6UA 4RW9A 4NZ0A 4M3XA 1QSSA 2V4QA 4F4YA 3SQ4A 1EP4B 4MFBB 4Q8EA 4W5OA 1TK8A 2IAJA 1HNIA 5J2NA 5HP1A 4KREA 2HB5A 1FKPA 1SUQB 4J9SA 3PX4A 3VQCA 1FXXA 3TAMA 1NK9A 2JEJA 2QE5A 3MTKA 4NLRA 4F2SA 4O4GB 1SH3A 3L2QA 4E3SA 3KKRA 2I5JA 5KTQA 3SQ1A 3OYFA 5KT4A 3NBPB 4KKOB 3S3NA 3DYAB 3V9UA 4IRCA 3RR8A 2HHTA 4AHRA 3OYKA 3ZT2A 3SPZA 4FJJA 4J9RA 3MECB 4N5SA 4FJ5A 2HAIA 4IRKA 1WNEA 5KFUA 2AGOA 4FJKA 3QEXA 3OS0A 3VA3A 4DTOA 4RNHA 4I9QA 3MEEA 1WSJA 1MMLA 4OL8A 3KOAA 3SV3A 4TY9A 4ZPCA 3CYMA 4FJ9A 1ZTWA 4CK3A 5F8GA 2Q3SA 2X78A 2O5DA 4C8OA 3I0SB 2WOMB 4CJ4A 4FVMA 3VQEA 2AGQA 1RYRA 2F8EX 3K5MA 3GV5B 2OZMA 4ECWA 4CFAA 3ZSXA 2XGPA 4RNFA 2HMIA 2XCAA 2BGGA 1RA6A 3QEPA 4F50A 1RDBA 4FLYA 1VSKA 4MIAA 3ASMA 1TV6A 4YR2A 1YVUA 3FFIA 1RILA 5HROB 1HYSA 1S0OA 1RT3A 5C24B 2ETJA 3MEGB 2HVHA 1NK0A 1UAXA 2HNDB 1X9SA 3K5LA 1J54A 3OLAA 4CEZA 4CHPA 4HTUA 3QERA 1L3SA 4CJSA 4NCAA 4AHCA 4NCGB 3V9ZA 1QSLA 1QE1B 2HNYA 1ZBHA 2BANB 4DQQA 3CDWA 4CGJA 3IRXB 3V9WA 3RRGA 1TKTB 4PQUB 4FBTA 2JEIA 3VQ7A 4HVJA 5KFSA 4U6PA 3AO3A 1WLJA 1L3UA 1ZETA 2ZQBA 2KZMA 2PZSA 5FROA 1JL1A 1U45A 3CFOA 3S3OA 1KSPA 4IKFA 3KK2B 2CJQA 3KK1A 1W9HA 1X9MA 4ZHRB 3CJ2A 4E1NA 4ED2A 4Z4IA 2G8KA 2UVVA 3H5SA 5KFPA 3WNFA 4KRFA 3UR0A 1RT4A 4Z4CA 3KLIA 4Y34A 1TL1B 4F3OA 4BACA 1LW0A 4KTZA 1CXUA 3LALA 3BSCA 3K5NA 1A5VA 3QEVA 2P5GA 3RR7A 3V6HA 4NLWA 3BQ0A 3KJVA 3V1RA 3MXMA 2GIQA 4HUEA 2ASJA 3O4QA 4BE2A 2VG7B 1U09A 2JEFA 3P83D 4TQRA 1RYSA 4FZXC 5KFZA 1XWLA 5E41A 1DTQA 3MR3A 4G1QA 4CJRA 4CJWA 4TYBA 3G6VA 4O3NA 3IS9A 2A1RA 5L1JA 4KBIA 2V0NA 3K5OA 2W9CA 4DF4A 4WZQA 4WXOA 4RNNA 1BQMB 3M9NB 1RT7A 2OPPA 3CQ8A 4B9LA 4Q43A 4KHQA 4OLBA 4QW9A 3PW4A 4IR9A 4ECZA 1BCOA 3DRSB 4ED3A 3OHBA 3PW7A 1JLAA 1S1XB 4PWDB 4MKAA 3OL8A 1N5YA 1VSIA 3VQ9A 3CDEA 3NGIA 4AILC 1ASWA 2AJQA 4HCBA 4GMJB 3L3VA 1SL0A 3ZSYA 1RBTA 1L3TA 3DMJB 1OS5A 4R8UA 3HK2A 5KT7A 3SI6A 4R0EA 4KO0A 3V81B 1HYVA 2JGUA 3A2FA 1HPZB 1NOZA 3CJ4A 4B9MA 3NE6A 5KFWA 3DLGA 3BSNA 4TY8B 5L1LA 1HMVB 3Q8RB 1BCMA 3PY8A 4FBUA 3NF6A 2RN2A 3QIOA 3CO9A 3V1QA 1IKXB 2AU0A 1S1TB 5SZTA 2HHWA 4E19A 3QIPB 3PZPA 1ZBLA 5JS1A 2BQRA 1RTHB 3DRPA 4LSLB 2OH2A 1IM4A 3OYCA 2WOMA 3DLKA 1I39A 5FDLA 2GV9A 3WNEA 3ZSZA 3CIZA 4KHMA 1LWFA 2AX0A 2OPSB 4CEEA 3HKWA 5CYMB 4FLUA 4CK1A 1C1BA 3TVKA 3ICLA 4W5TA 4Y2AA 3MFIA 4AHSA 3IGVA 3LDSA 3SCXA 4H4MA 3ALYA 5KG7A 3OYAA 4JS5A 3V6DA 4K4TA 3Q8QB 1S6QB 3SZ2A 4IQXA 2YNIA 3I0RA 5KT3A 3DRRA 2YKMB 3NF8A 4C8NA 4DTXA 1X1PA 2E9RX 1ZBUA 2HHUA 1VRUA 1J9AA 2BQ3A 5F8LA 1T05A 3SFUA 4TN2A 5EWFA 2YHAA 1C1CA 3LWMA 2W9BA 4B9VA 3OYBA 3M9OB 1FKOB 3KLEA 2Z1IA 1DTTA 4EYIB 2JC1A 1RCHA 4FK2A 4DSFA 4RW9B 1KTQA 4RW7A 3HL8A 1HQUA 2JC0A 4FW1A 1VSMA 3KLHA 3HVWA 4W5RA 4KAIA 2IAJB 1HNIB 5J2NB 5HP1B 4CIGA 4FM1A 4TLRA 1FKPB 3TQ1A 1BI4A 3TAMB 4IR1A 2X6SA 1K1QA 3CVKA 4ED7A 1DLOA 5EU7A 2I5JB 4QWCA 1MU2A 3QEWA 5KFTA 1S5JA 4MK7A 2XC9A 4URQU 4NLGA 3SI8A 2Y1JA 1BIZA 1S9GA 2VG5A 4LQ3A 2FJVA 2V9WA 3H4DA 1D9DA 3OYLA 2DFHA 3MEEB 3NH1A 1WSEA 3CJ3A 3TAQA 1S1WA 4MKBA 4QCLA 1LW2A 4QWDA 2FJXA 4ZP9A 4E7LA 1RTIA 3FDSA 5KT2A 2IM1A 2W7PA 2E6MA 4GVMA 3EPIA 4ZPAA 1NKEA 4CJKA 4TQSA 1IKVA 1RT1A 4IG0A 4M41A 3T5KA 3KHRA 4NLSA 2C2RA 2I1RA 2HMIB 1XHXA 2YNFA 4AHTA 1NK8A 1WSFA 3VQBA 1TK5A 3CJ5A 4E7HA 4DU3A 4URGA 1W0HA 5C42A 1TV6B 4RUCA 3VQ5A 3FFIB 3PVXA 3M8PA 1TKDA 1HYSB 4ECYA 3RBEA 4AH9A 1JX4A 2DY4A 3V6KA 4CFCA 4DQRA 1ASUA 1D8YA 3RAXA 1T03A 3OVNA 4DLGA 4BE1A 3QO9A 5KRTA 4PA1A 3V9SA 1TVRA 3JYTA 3ITHA 2FLNA 2OZSA 4JUZA 1HYZA 2HNYB 3V81A 3EYZA 2HHXA 4K8ZA 1Q9XA 2PYLA 1UWBA 4K50A 3VQ8A 1JLCA 3AA4A 3RWUA 5J2PA 2UUWA 5J2MA 2X74A 4YR3A 4BDYA 2XY5A 3KK1B 2BE2A 4ECQA 3SFGA 3PR5B 3M8RA 1VSEA 5KG0A 4HHTA 1YTAA 3NF9A 1IKYA 3AVIA 5I3UA 4O44A 4OVLA 5F8HA 1RT4B 3KLIB 1BQNA 4JRPA 1C2PA 1LW0B 2GUIA 4ECRA 3HT3A 1UOCA 3U6FA 3BGRA 3QGHA 5KFVA 1ZYQA 2FVPA 3H2LA 3K58A 3KJVB 3GIIA 2UVWA 3L2VA 1SV5A 3PX6A 1EX4A 4J2DA 1S6QA 4RW6A 2WONA 4CHOA 1S10A 4CIEA 3SQ0A 4Q0BA 4G1QB 3LWLA 1D1UA 4ZPDA 3RMDA 3IS9B 1RBRA 2W9CB 3LZIA 4KB0A 1KVCA 3HVAA 1RT7B 2OPPB 4QPXA 2IM0A 5KFOA 3BDPA 1LV5A 4IFVA 2VWKA 4N41A 2B43A 3H40A 4XO0A 5F8NA 3PO5A 3QLHA 4LQ9A 3LAKA 2XHBA 1JLAB 3T5JA 2KFZA 2KZZA 4B8CA 4CESA 3IN5A 1N5YB 1D9FA 3ZSOA 5KFAA 3L2WA 1T7PA 3AO4A 4W5QA 5JS2A 2XGQA 2AX1A 5DQGA 1RDDA 4NYFA 4DQSA 1I3AA 4CFDA 5DMRA 1S1UA 4IDKA 4EZ9A 4N56A 4QW8A 4DTUA 1TL3A 4FCYA 4R8UB 2HVIA 2IM2A 4KV8A 4KO0B 4FJHA 2FBVA 3KHLA 4ZVEA 4ZVFA 2FLLA 1U48A 1KLNA 1KFDA 2FVRA 3E51A 4M3ZA 5KI6A 1S9EA 3MXIA 1NJWA 4N47A 5DQHA 3VQDA 3DLGB 4E1MA 1BL3A 4LH4A 3HXMA 4CF2A 3SQ2A 3PV8A 1NJZA 1XC9A 4OKJA 4M42A 4EZ6A 3KD5E 5KFJA 1KHVA 3T19A 2R2RA 4DSJA 1NK4A 3V9XA 2R8IA 2UVRA 4ED1A 3DRPB 4J2AA 3DLKB 3TARA 5FDLB 2IJFA 1TQLA 1LWFB 3QZ7A 5F9NA 4CF0A 4CIFA 5I42A 1C1BB 4E89A 4B3OA 4IG3A 4NLOA 4H4MB 4C8MA 3V6DB 4ID1A 1XHZA 3AO5A 3VQ4A 3OL7A 1VSDA 4WE1A 1WNSA 2DFFA 2YNIB 3I0RB 3NKYA 1J5OA 3ZT4A 4DL2A 3DRRB 4M45A 3V4IA 4CJUA 1VSFA 4KHNA 3ISNC 3RAQA 1VRUB 3AVBA 1HARA 1T05B 1QSYA 1XR5A 1C1CB 2W9BB 1TK0A 4URSA 4H4OA 1S6PA 4EBDA 3KLEB 4B08A 5KFMA 1DTTB 2IBKA 3HO1A 3DLHA 2UVUA 2FBTA 4DTNA 4RW7B 2IMWP 2ZKUA 1HQUB 3AVGA 3BSOA 3KLFA 2XWYA 3KLHB 1NHUA 1IKWA 2ZE2A 1JLFA 2E4LA 3L2RA 2BDPA 1BI4B 4JV1A 3NGZA 2ATLA 3O4NA 4QOZB 4NYZA 1DLOB 2J6TA 2W7OA 3JSMA 1IG9A 1MU2B 5HRRA 1C0TA 4ICLA 1Z25A 4E7JA 3H5YA 4KB1A 1BHLA 4W5NA 1YVFA 4TXSA 1S9GB 2VG5B 4EBCA 1WAJA 2P51A 2QKKA 2C2DA 2OYQA 2W8KA 3FRZA 4F4XA 3AVNA 3SUPA 4NLUA 4NLTA 4HKQA 4KI4A 1SL1A 2DFEA 4K4VA 2R7YA 4KHRA 1S1WB 4FZYA 1LW2B 4FK4A 4BDZA 5T7BA 1RTIB 5HRSA 1EXQA 3RB3A 3AVFA 3D5MA 2IOCA 3KD1E 4DL4A 4F3TA 1C0MA 2V4RA 2HWIA 1IKVB 3CWJA 4C8LA 1RT1B 4IG0B 3KLGA 3UDLA 3GIMA 1NKBA 1GX5A 2YNFB 4BWMA 1VSLA 4M3UA 3C6UA 5C42B 3CFPA 3O3FA 3N6NA 4I7FA 3S9HA 3M8PB 3C6TA 3S3MA 3P5JA 4LD0A 1W25A 5KFGA 5KGXA 4CF8A 3V6JA 4EO6A 4XIUA 4ZPBA 3T1AA 1S1VA 1T03B 4I2QA 2B5JA 3QO9B 3IG1A 1SKWA 1LWCA 1TVRB 3JYTB 5KGWA 3ITHB 1GX6A 3U3YA 1GOBA 1U49A 3VQAA 4FZZA 4GC6A 3G10A 1RT2A 1JLBA 4J9OA 1UWBB 4M95A 5KFXA 4ZMMA 4OLAA 3ZSWA 1JLCB 3PJXA 4KTWA 4WFXA 4B9NA 3GQCA 5J2PB 1TKXA 5J2MB 3EZ5A 4RW4A 4Q8FA 4FLZA 4CJLA 3D0PA 3M8QB 4O3PA 4K4XA 4PY5A 4ZVHA 2BE2B 2ILYA 1NK5A 4Q44A 3PW2A 1D0EA 3SYZA 3B6OA 1IKYB 5I3UB 3LAMA 4O44B 2EX3A 1BQNB 5KT6A 4MIBA 3QEIA 4J9PA 3T3FA 3NL0A 1A5XA 3NAIA 3OYJA 2QV6A 3RB0A 3BGRB 1RBUA 1IO2A 2YKNA 4TSXA 2E9TA 3NHGA 1SV5B 3ZT0A 1CXQA 3ULDA 3AO2A 4NYNA 2ITGA 1TGOA 4RW6B 5KG2A 2WONB 3MR5A 4DSEA 4WFZA 2W8LA 3OYMA 4Q0BB 5JXSA 3D28A 3SNNA 2C2EA 1SH2A 1T8EA 4E7KA 3KTQA 4JV2A 4M94A 4ZVGA 4CK2A 5J1EA 3HSTB 3LP2A 3T5LA 5JUMA 4O4RA 3KHHA 4DL5A 4ZP6A 4IFVB 3VQPA 4MK9A 3QLHB 1NJYA 1HNVA 3MEDA 1T3NA 4LSNA 4OGEA 3QESA 5FRMA 4Z4FA 1NK7A 1FK9B 1R0AA 1B92A 2D0CA 4F8RA 2VA2A 4CEAA 1HQEA 3AA3A 1C1AA 2G8UA 4L8RB 2OA8A 4MQ3A 2BR0A 3TWHA 2D5RA 4IH6A 2JEGA 4RUAA 4K4WA 4FM0A 4NLVA 1S1UB 4IDKB 1NJXA 4Z4HA 1BGXT 1TL3B 4KV8B 4IRDA 3N6MA 1S0NA 4KFBA 4J9LA 1S9EB 2KFNA 4O0JA 1KFSA 3VQSA 4ECTA 3QGIA 1S48A 5F9LA 4WZMA 4K4ZA 3AA5X 2YHBA 1RA7A 1LWEA 4DTMA 3L2UA 3DI6A 1QAIA 1RDCA 4FJGA 4I2PA 2NUBA 3PR4A 2DPJA 1WSIA 1N48A 4OGCA 3OS2A 3KNAA 2WHOA 4RNOA 1VK0A 3I8DA 2W42A 3GIJA 4ED6A 4CJQA 1RNHA 5I42B 4FLXA 5KFLA 5KFNA 4HUGA 4B3OB 4IG3B 2AWZA 1T94A 3TI0A 4NRTA 3RB6A 3OHAA 2ASLA 1S4FA 5KFRA 4WE1B 1U4BA 1J5OB 1NNDA 4HCCA 3V4IB 4DU4A 4E0DA 5FRNA 1RTJA 2Z1GA 2VG6A 2IS3A 1X9WA 4EO8A 2PY5A 4NCBA 3ZSRA 4DMNA 4K4UA 4H4OB 2FC0A 3WNHA 1S6PB 2IDOA 4B9SA 3AO1A 1JLEA 2RDIA 4H54A 1IH7A 1REVA 3FQLA 4CJFA 2ASDA 1ASVA 5F8MA 1JXLA 3FQKA 4J2BA 2D0BA 5KFQA 2BQUA 3LANA 3GV7B 1JLGA 3KLFB 5KFIA 3M8QA 3P1GA 1IKWB 2WRMA 2ZE2B 1JLFB 4NRUA 5KG3A 3TABA 3PW0A 3EZUA 3ZCMA 5SWMA 2OPRA 2D3ZA 4FJIA 2IM3A 1F21A 2HHSA 2KTQA 2KQ2A 2FVQA 1RTDA 2FBXA 3JSMB 4KHWA 4NLPA 1C0TB 4IFYA 2R8JA 4ICLB 3OSNA 5EWEA 2ZD1A 3RMBA 4EBEA 4O3OA 3ZSQA 3SV4A 1Z4UA 1B9FA 2XY7A 3BJYA 3KMQA 4WFYA 5C25A 2RF2A
chains in the Genus database with same CATH superfamily
1P6TA 2VWBA 2UXCF 4YY3J 4ZN3A 3DLEA 1GLLO 5B8HA 1HD0A 1CLQA 3OW2R 2VFRA 2KO1A 1ATNA 5M2RA 3NGSA 2D0OA 4ID5A 5AQFA 2Z2ZA 1RAHB 4P7TA 3OHRA 2WK4A 4I4BA 4WF9Q 4JYAF 3CM6A 1VS3A 2Y8WA 4OHVA 2RUSA 2F8SA 1F5AA 1CZBA 1VSJA 4KTQA 4LVOP 4LT6A 3AVLA 4ANDA 4NXMJ 2ZWHA 2WVCA 5J2QA 2ZGZA 1M1KO 4I69A 3VN5A 4DL3A 2WB4A 1I6JA 4H5VA 3EY1A 1X4EA 3TA1A 2RIJA 2RILA 5AQYA 2P9UB 1S1VB 4ZCIA 4CE9A 2GNKA 2HFNA 3MAAA 1HLUA 1D3WA 1CSJA 4FS1A 3IG1B 1LWCB 2GHPA 3GCWP 3MEKA 4RLEA 4MK8A 2SXLA 3MURP 1JCFA 1VQNS 1HWLA 2KT3A 1EB0A 5D0GA 2QA2A 2RRBA 1WBDA 4DV6K 1BA1A 2FHMA 4RW4B 1VQKS 4CGDA 2XS7A 2ABYA 4WFNL 1C4CA 3OY9A 4AXJA 1YJ9S 2MJNA 5FD1A 2OUGA 1V3ZA 1PC5A 4DR6F 1M5VC 1RDRA 2D0AA 4FYYB 1QY7A 4IOBA 1M1KT 1JKHA 1X4DA 4M5GA 3FEXB 4LF7J 3PYEA 3HT0A 1YF5L 4B8AB 2MQOA 4DPUA 4CJEA 3MI7X 1HR0F 2YKNB 2B4JA 1F9EB 4N76A 1NPPA 2FD2A 2VZ9A 2H5EA 1X5OA 1YBTA 2QWLA 1YJ7A 2GIRA 1RWOB 4RBUA 4CO3A 4ENOA 4YMEA 1F5BA 1Y97A 3MZIA 1KCFA 3QT7A 4AQYJ 4FYVB 3AVCA 3W64A 1P90A 3G6XA 3NNCA 1VRTA 3K9JA 4TU9A 2WSEC 3OJSA 1WOSA 3MEDB 4DF8A 3DOLA 5AQLA 5F3ZA 4CLTA 3FVYA 4QIFA 1X8DA 4LF8J 4DS4A 1A9NB 3MR6A 4ITSA 5AQHA 2GW8A 4OI6A 5AQKA 2QFIA 2OMLA 3QATA 4C11A 1L5UA 1AYEA 2V52B 4B02A 2P6TA 4RZRA 2RPIA 4X66K 3NH2A 3QAUA 4WP3A 4Y1DA 4Y1CA 4KGKA 5FLXY 3MUTP 2RE1A 4CHNA 2VIHA 4DV4K 3BSAA 3CMQA 4IJAA 4HT7A 4CJ5A 4USVA 4I2PB 4WU3A 5ADZA 3BGUA 1KQSR 2PD1A 4YOVA 3L9ZA 1VC6A 1KLMA 4WXWA 4NOHA 4FXVA 2ZH3A 4J7CA 2C1EB 2V2QA 3GILA 1FXDA 3DAWA 2P9SA 2RKIA 2QZ8A 1ITGA 3HCXA 1VQMN 3CQXA 4DTPA 3HRGA 2ZZNA 2DJWA 2GJIA 5L9XA 3QETA 2QKBA 3U1LA 1V4SA 5DQIA 2RE2A 1N34F 3ENAA 1YZ7A 3N0VA 3QB0A 2Q1NA 1DAXA 3E01A 4A8OA 2PO4A 4Q45A 3IM9A 1QAXA 4KH5A 1I94K 4ES2A 5IXUA 3DXMA 3ISND 1RTJB 2YKPA 2BRLA 3SK3A 3G6YA 3A12A 3CM5A 1R0BG 4ED8A 1EP4A 4MFBA 4CO5A 4A59A 2WZ1A 1VSHA 1JLEB 2CJ9A 1KRPA 1REVB 4DV1J 4OJRA 2UU9F 3ZC4A 4OI1A 3CFRA 3O3HA 3KVGA 5CYQB 3CDUA 1JLGB 3X1LB 2HZVA 1BO5O 2NXEA 1OH8A 3KG1A 3GCXP 3TYTA 4KKOA 3LGMA 5IV4A 2ZEJA 2G8IA 4ELVA 4CO0A 4KJIA 5AFUH 1QAYA 3RTVA 4IFYB 4ED5A 3VTHA 2HNZA 3ZETB 3CJ8A 2A41A 4NPOA 1XUPO 4JKEA 3SUQA 4GV9A 2YV0X 3SUOA 4JKDA 3THXA 3RU0A 3H5UA 2E1ZA 3LTOA 3KLVA 2Y8YA 2E9ZA 1HRHA 3C3LA 3KHGA 3I0SA 1Z1ZA 2VPYB 4WP8A 1EETB 4LFAJ 5D6GA 1Y5IB 1BA0A 4UTGA 2ZWOA 2B51A 4FXDA 3VR1A 2OGUA 2WBRA 1YDLA 4O23A 1ZAWA 1TL4A 5KFBA 4KHUA 3LDQA 1BUPA 5LJWA 3FFKB 1N33J 2VBYA 5LXRA 5HLFB 1O1WA 5KFEA 2X1AA 5L1IA 2GHWA 1ZTTA 2HNDA 4A8QA 5DJBA 4PQAA 2KG0A 1DBDA 1PO6A 3QBCA 4LF6J 5T14A 1EKEA 3L3UA 2VV5A 4OPJA 1IBMK 4GW6A 4NCGA 2X51A 4LF9J 4DR3J 1FD2A 2ZC3A 1TKTA 3POTB 4JKFA 4E7IA 1CS4B 4ZPTR 5L38A 1SVDA 4IWVA 3KKSA 3PUFA 4JI3J 5A2QO 1Z26A 1K9MO 4FM2A 2C22A 2J9DE 4CO2A 2B6AB 3LQVA 3AOBA 4FXWA 3I5AA 4ZLPA 5RUBA 2LU2A 1NLKL 2OEKA 3PCOB 2FLPA 2KJVA 3DM2B 2CPZA 2Q2RA 2CIMA 3U4LA 2Q31A 1U0HA 4XPCA 1DEJA 1RT5B 5M2PA 3HYFA 4WTOB 3H5XA 5ETQA 3KG0A 5CXTA 4CJ3A 4DQIA 3G0ZA 2Q1LA 3CCSN 2ROPA 4K5RA 4FWLA 1SS6A 2YQ0A 4HUFA 4WYWA 4OZNA 3IUCA 3HOTA 3D45A 4DV5F 2MEWA 4I64A 2IFXA 3AVMA 3GBTA 2LEBA 2XCPA 4X4UA 1HNZJ 1K9MT 3QINA 4OI4A 5E84A 4CGHA 5KT5A 2G8HA 1A0OB 3LDNA 1Y00A 1M5KC 2XO7A 2XWXA 1NLVA 4B9UA 3CCVN 3C94A 2QLWA 5F0UA 3UQSA 4UUXA 3HP6A 5CD4H 1NPRA 3NS7B 1R8PA 3AVKA 2O8BB 3MWTA 4ZVOB 4DV3F 3GV8B 1WF0A 4CIOA 3F9KA 1RT3B 1VOMA 2JLEA 2LSNA 3ENWA 3NAEA 3CJKA 3W0LA 3THWB 4OHXA 3QWPA 4Y2MA 2CNKB 5K8OA 3QJJA 1S12A 1KEKA 3QIDA 3B78A 3SBTA 3IC1A 4C8KA 3C16A 1FT8A 3DOMA 1BWVA 1QTMA 2HQDA 4P52A 4FS2A 1FFWB 2HHHK 3UIQA 3LGNA 5C5JA 4TY8A 5DLGA 1GAOA 4PXCA 3G25A 2YX4A 1S1TA 2E5LF 3TR8A 2YNGB 1PG5B 1EWQA 4LSLA 2MQQA 4OJHA 1S59A 2VBZA 1DJ0A 2VASA 4DFMA 4DV7K 5FJ4A 5DG9A 4U7BA 3T41A 3HSDA 3LH2S 5K8NA 4LFCJ 4M3YA 3U1MA 3DLBA 1C0UB 2R7WA 4OZJA 3JB9k 5ETMA 3BZCA 4GVEA 4MH8A 1JCGA 4MKVA 3R5DA 3SDEB 3VAFA 2PSZA 3BGFA 3AVHA 3HJVA 5I4MA 4CBUA 3OYGA 3BO2A 4OKEA 3OSPA 4Q5VA 3Q8PB 2YKMA 4YHHF 3O9UA 3HFVA 2C3YA 2RJZA 3CMAS 3OXFA 5E3AA 3SUNA 3MM8A 2NR0A 2GQ2A 1FKOA 2DITA 4A48A 2R3VA 1GNKA 3M6VA 2DNQA 4YB5A 2DNGA 2OEMA 4QIGA 4NZ0A 2ZHOA 4USMA 1QSSA 4YDDB 4F4YA 1DZ5A 5BRHA 3BEGB 3J7Z5 2IAJA 3GSIA 2B7BB 3R1XA 5GAHP 3AGRA 2BH1A 3HHLA 2JEJA 1V4TA 2DGUA 4UQTA 3R7SB 3TSUA 4F7VA 5KTQA 4C8ZA 3KWMA 3P4UB 4CLFA 5KT4A 3GR0A 3PACA 3V9UA 4IRCA 3RR8A 4BG8A 1IVZA 4N5SA 3MECB 3HHDA 4J9RA 2BMBA 2BA9A 3CPWM 1WNEA 5KFUA 5JVGQ 4FJKA 3QEXA 2LQBA 3P5TL 4DTOA 4RNHA 4XDCA 5CQGA 1RHUB 2J9CA 3EVMA 5B0AA 5J1PA 3SV3A 2LQ9A 1HWJA 2Q3SA 3WC2A 4UW2A 3C15A 1QVGM 4FKXA 1MN7A 4JYAK 1G4CA 3NMRA 1ZM4A 1NRKA 2D9OA 1N5VA 4CJ4A 4JKHA 3A5MC 5E5NA 4LRFA 5DO2A 2IVMA 2OZMA 4E2FB 2XGPA 2HMIA 4FWRA 2XCAA 2XMAA 4BC2A 4ETZA 2QA4N 4H0OA 1CJKA 3AT1B 3LA0A 2WFBA 3ASMA 2LP4A 1TV6A 2RHSB 3AD9C 3H20A 3H7HB 1HNWJ 5BR9A 4JI7J 3T6BA 2GVDA 2RAQA 3G6EN 1NK0A 2VBWA 3JQJA 2RHQB 5K8PA 4YY3K 5AXNA 4CTAA 3U02A 1HHSA 3QERA 3M1FA 4AHCA 1QSLA 3V9ZA 4RX6A 2F8MA 2XNQA 3VZHA 2HNYA 1YJWN 2BANB 4DQQA 3D3CJ 1P1TA 3IRXB 3V9WA 3RVCA 4PQUB 1O5JA 4JNEA 3FMWA 3VQ7A 1I1GA 3AO3A 1L3UA 3WQUA 2NRVA 3FJ2A 1EJ7L 3ET6A 4P2XA 1U45A 4ER8A 1JL1A 5FROA 4IKFA 2XULA 3KK2B 3KK1A 2XO6A 3G8SA 4WK3A 1X9MA 3DGPB 2W6LA 1SZ2A 4JK8A 4OHZA 4ZHRB 3CJ2A 5C2FA 3W2VB 3JTNA 1YXQA 4AT1B 1RT4A 1Y11A 1FVQA 3FUYA 2V5HG 4W90B 4KTZA 2DD8S 3QFPA 3QEVA 4N8OA 1TZ0A 5T7LA 4NLWA 4B1UB 2XMTA 4DX6A 2ASJA 4AL6A 1ELOA 3O4QA 4B1XB 5CHCB 2LFVA 4KIAA 4BG9A 4HHUA 3J7YP 1NMDA 4ZITA 3MDQA 3CCRS 3CNQP 5AQVA 3QT8A 2CZ4A 4WZQA 4B3SJ 2W4PA 4FF4A 2Z2LA 3M9NB 2OPPA 3CPEA 3CQ8A 5H1SV 2KXFA 4B9LA 3GDQA 4KHQA 5F41A 3T1HF 3Q7BA 5CCMA 2MGZA 3DRSB 1BCOA 4BR5A 3PW7A 1KN6A 1VQYA 4PWDB 4LF7K 1UTAA 1K0VA 4NWBA 1WG1A 1ASWA 3FBEA 2HQFA 4HCBA 4GMJB 5IZHA 4A8MP 5KT7A 4BGAA 4KO0A 3SSSA 3GTYX 4AQYK 4DR7F 3CJ4A 4B9MA 3QGPA 1VR6A 4ZCMA 3NE6A 3FR0A 1EWRA 1GLJO 3IXQA 3PY8A 4X64J 2VICA 2GVZA 2O1PA 2QXLA 3RSEA 3SXLA 1NU4A 4KT0C 2CZVC 5MLCV 5JS1A 1WBBA 3UR3C 2BQRA 1RTHB 3PSFA 3DRPA 2JFDA 3L09A 2OH2A 2G1DA 3UD3P 4JI1J 3OYCA 1IJJA 3M2VB 3GZ7A 1LWFA 2JJ4D 2OPSB 2OD4A 3OFEA 3HKWA 3UE5A 2KXNB 4YOWA 3TVKA 3ICLA 3MFIA 4AHSA 3T1YJ 3FBCA 3SEOA 2J0SD 1RAFB 2EFGA 1AW0A 3Q8QB 3SZ2A 1FF2A 1IBKJ 3H6EA 6FD1A 2UZAA 3F41A 4WCEQ 1B0PA 3IBFB 3DRRA 1GT8A 1ZOTA 3NF8A 3ULHA 1RAIB 5ADXA 4QR0A 1J9AA 2A3ZA 2HURA 3SFUA 3V2UC 5HSPA 4CZHA 2ZBIA 1B3TA 3BN7A 3LWMA 1VBZA 3M9OB 4JI4J 4LF5K 4FKYA 1U2VA 1RISA 4QR1A 2Z1IA 1DTTA 2UU9K 2JC1A 2BJ1A 4RW9B 1KTQA 4C1NK 1DKGD 1O51A 2XYHB 4RW7A 1OYDA 3Q8YA 4HTJA 3VAKA 2KT2A 1VSMA 2RQMA 3D0HE 4U67Q 5J2NB 5HP1B 4CIGA 4FM1A 4NEYA 4F4AA 4FVCA 1BI4A 2XG8A 3BN4A 2GWKA 2X6SA 3J8AA 1Q0NA 2DXDA 5HQLA 5GADP 3THTA 5A6PA 5HANA 1KQFB 3QEWA 5KFTA 1XNRF 4Y2KA 3C6HA 2HBLA 3JTPA 1VISA 5JJBA 4JP8A 2Y1JA 4CRJA 2MB0B 1IV0A 3Q89A 4LQ3A 2X3DA 3CCZA 3LGHA 1ZM9A 3JAMO 1W2BR 3E9PA 3NH1A 3GU0A 3CJ3A 1SIWB 3L3CA 3GFHA 2LKZA 1S1WA 5B0GA 1LW2A 1RTIA 3DNCA 2IM1A 4WFAQ 3H8YA 1UZDA 5D4PA 2YWKA 2ZF5O 2P9NA 1YX2A 1T9VA 5F0WA 3TP2A 3KHRA 4NLSA 2I1RA 1VQ6N 1YTYA 5D78A 2DR5A 3M2UB 2NRRA 4KHPK 4EU0A 5C42A 3ZFVA 4KH1B 3IA0A 3PVXA 2B56A 5HO4A 2BEFA 1HFEL 4ECYA 3RBEA 3Q24A 3V5RA 4MDAA 4DQRA 3R1LA 1D8YA 1D8ZA 4A57A 5CAAA 3QO9A 3V9SA 1TVRA 3JYTA 4PKIA 2OZSA 3M05A 1FX4A 2NSCA 1VQSA 4Y65A 4CZCA 1GXLA 3MN7A 2GJFA 2CNOB 5IFMA 4EFAC 2HHXA 4IFEA 3Q22A 2PYLA 4K50A 5JMNA 4BC4A 3QMLA 2UUWA 3VEOA 2AEFA 3M6UA 4C2MA 3DGVA 3EZWA 4WP9A 2NZCA 2V9KA 3NEKA 1N33K 3E2EA 5KG0A 2MLXA 1WC0A 2W4CA 5I3UA 4O44A 5F8HA 3BR8A 3FZHA 5D0RA 3MUVP 3NCRA 4BRHA 2Z30B 2GUIA 1JCEA 3A8EA 3HT3A 4ECRA 4DV5K 4CLZA 4AE5A 4ZA1A 3KJVB 2UVWA 3PX6A 3NWGA 4BRCA 1RWKB 3O4WA 2WONA 1S10A 4CIEA 2PFFB 2D0PA 1LWXA 1XNQJ 1D1UA 4ZPDA 4P2FA 3GJQB 3UCGA 4KB0A 2BUPA 2A40A 1GLFO 5DZ6A 1D9AA 1S0VA 3HVAA 1RT7B 4QPXA 5KFOA 4HWIA 3JSYA 3BDPA 2B43A 4OHYA 1VQPN 1XERA 4LQ9A 2XHBA 2I0XA 4MJKA 1JLAB 2KZZA 2KFZA 2P9IA 4B8CA 5AQGA 3G8TA 4CESA 1N5YB 4B3TJ 4JHDB 3NG8A 5KFAA 2FY8A 2AX1A 4ZLNA 1I3AA 4CFDA 1KQKA 1FESA 3TZXA 4N56A 4FCYA 1OPIA 2NUUG 5B0BA 3J80O 4KGMA 2V8VA 3CCMS 4KV8A 4C48A 2FBVA 4ZVEA 1R59O 4MKYA 4M3ZA 1S9EA 3MXIA 1U0SA 2XSJA 4N47A 3VQDA 3DLGB 1BL3A 4CF2A 1Q79A 3PV8A 4RTFD 3VEYA 1Y0HA 4EZ6A 2UUCJ 1U1OA 2R2RA 1NK4A 1O8BA 1SC3B 3PRBA 1VAZA 2BJ7A 1B7YB 4H5WA 2V34A 1NG9A 4J2AA 5FDLB 3M8YA 2NNWA 3VESA 2GV1A 4FZVA 4KPCA 5M1KA 3KDNA 3NS6A 4CF0A 3VEVA 4YB1P 5JVHL 4GO7X 4LBIA 1OPZA 5D77A 1T3VA 4B3OA 4IG3A 4H4MB 2DGTA 5BYQA 2W2NP 1VSDA 4WE1A 3UCUP 3G2XA 2DFFA 4N7TA 1J5OA 1FDNA 3ISNC 2Q0RA 1VRUB 3AVBA 3NNHA 3FBBA 3I56N 1C1CB 2W9BB 1TK0A 5IM0B 4LFCK 1U2FA 4EBDA 2QMUB 1HBMA 2NQPA 5D4OA 3QT6A 2DRBA 1OVYA 3EXYA 1HWKA 2ZH5A 2UVUA 3Q86A 2P2CB 3A4TA 4AYBD 4BRPA 2BM1A 3BSOA 3KLFA 2XWYA 2VONA 3KLHB 1R31A 3QAEA 1JLFA 4I6WA 3KYLA 1KAXA 3WT0A 1UEKA 4JI0J 3QSIA 2ATLA 3O4NA 4NYZA 1DLOB 2RQ4A 4I68A 1DQAA 4JI6J 1W97L 3CQYA 4P72A 4JKGB 3MD1A 1C0TA 2HFVA 1F2GA 1Z25A 3H5YA 4KB1A 2MQPA 1RUSA 1NNEA 5C10A 2VG5B 2BYCA 1AFJA 4BRIA 2QKKA 4USHA 1RADB 3UE2A 3SUPA 4NLUA 2AYBA 4K4VA 2MQ8A 2OKQA 4KHRA 3TZZA 4FZYA 3D1QA 4FK4A 2APOA 4BDZA 4NXNF 5IWAJ 3A3NB 4TLQA 4F3TA 2V4RA 4M5KA 3EZOA 2QN6B 5CYJA 2NRZA 4Z7YA 1S72N 2C2OB 2YNFB 1LOTB 1SC1B 4M3UA 2DEJA 4XH4A 5ETKA 3A13A 4NLBA 2KVQE 3CO0P 2BJ8A 2CQGA 3CI5A 1W25A 5KFGA 5KGXA 4BRLA 2MXYA 3TJAA 1N36J 2P9UA 3T1AA 1S1VA 2DB1A 4WIIA 4PG4A 2NS1B 3IG1A 5GVQA 1LWCA 1SKWA 3U3YA 3ONQA 1Q8LA 2KU7A 1TUWA 4GC6A 4YDXA 3C65A 1RWPB 2YCHA 4J9OA 2DR8A 4ILMA 1VJQA 1RK8A 3C14B 5DM6L 1JLCB 2LMIA 4CO4A 4MIWA 1GLCG 4RW4A 1HNWK 4Q8FA 2QYGA 1QHAA 3M8QB 4LFBF 1FNOA 4ZVHA 5JMVA 1FRKA 2G2OA 3KJQB 3Q8VA 2VQFF 1NGGA 3IM8A 2E20A 4Q44A 5IQQA 4KGVB 1SB6A 1UZHA 1IKYB 2EX3A 2QJ3A 2ADCA 1HX1A 5GAGP 1BQNB 4HHJA 1G7CB 4MIBA 5KT6A 2PFDA 5ADXH 4OJ3A 4J9PA 4CBWA 3NAIA 1HWUA 2QV6A 2DGWA 3DXSX 2YKNA 4JI8J 3KKFA 3NHGA 3ZT0A 1CXQA 3B54A 4BQZA 2V50A 2ITGA 1TGOA 1TR0A 1XIQA 4IEEA 5GMDA 1ILYA 3R97A 3VEWA 5AJ3F 3BBFA 1SH2A 1T8EA 3CMES 4ZVGA 4CK2A 4OYPA 3T5LA 3ZZRA 5BR8J 1PYOB 4DL5A 4IFVB 1CPZA 5IQ6A 4MK9A 3QLHB 4X62J 1FJGJ 3ILOA 2DHGA 3MEDA 1T3NA 2IMOA 2VPWB 4QJVA 1RE1B 4LFAF 2ZM6J 1J27A 1B92A 2PMWA 2W2QP 1C1AA 3OPKA 4MQ3A 3TWHA 2GMJA 2JEGA 4CW7B 4NLVA 1E6YB 4Z4HA 1BGXT 3FCHA 2KT5A 1RBAA 5D0EA 3PEHA 1EHWA 4I6MB 3ZTSA 4B3RJ 2QLFB 4PZVA 3SBGA 1HW8A 5F3TA 3CCUS 3EDQB 4IOXA 1XMQF 5F9LA 4WZMA 1I3OB 2YHBA 3QJPA 4ZS6A 3ZNJ1 2E7XA 4DTMA 3SBMA 3OA9A 1RDCA 4LF9F 4I2PA 2FDNA 3M8ZA 4DR3F 3VETA 4IOAQ 4A8SA 2QWRA 5KAKA 4AM7A 3OBYA 3A5OC 3PIPL 2BACA 2QWQA 3KNAA 2WHOA 4MYTA 3KK7A 4JI3F 2YXLA 4P10A 4RNOA 1VBXA 3I8DA 2W42A 2H5IB 1FVSA 3KFWX 5T41A 1UJ6A 4FLXA 1IJFB 2CQBA 5KFNA 4HUGA 4NI2B 1X60A 1YSJA 3OHAA 1MSWD 5ETVA 1RBOB 4WF9L 3UKUB 4ISGA 1NNDA 4U8VA 4S0MA 4HCCA 3DKDA 4DR1K 1RTJA 4K2JA 1X9WA 3RW7A 2ZC4A 4NA3A 3CB4A 2H65B 4B9SA 1JLEA 3T1YK 1REVA 1IH7A 1HI8A 3CJSA 2P9KB 3FQKA 1NO8A 3NVKA 3CETA 2ZJPQ 1Q7LB 1IBKK 1HNZF 1JLGA 3I87A 1JQGA 2RUGA 2KRBA 2ZE2B 3H0PA 1MMDA 3TABA 3K2YA 2MYFA 2CADA 3WUHA 3MM5B 4FJIA 2IM3A 4AL5A 4P71A 2HHSA 1YRUA 2ZH6A 2FBXA 4GKJF 3VCDA 4IFYA 3FEZA 3ZETA 1Q86O 1SCJB 2Q79A 1F6TA 4EBEA 1S77D 3SV4A 2E5HA 1Z4UA 1B9FA 3BV8A 4WFYA 5AZJB 2JFKA 4J9KA 5KPTA 1U8SA 1RCXB 5CZVA 2MSSA 1VCTA 1EETA 2XY8A 2HS3A 1L3VA 1FWKA 1NEEA 5DETA 5U47A 1NBWA 3IKMA 3K59A 1U1PA 2X6NA 3ENOA 3DHWC 1XN9A 1RHJB 1QZ5A 4OYWA 5M1QA 3H90A 1RHQB 2CPEA 2AD9A 1VIOA 3KLGB 2F96A 4M7XA 2YTCA 4KSEB 3CCLN 4CZEA 2WAQD 1E4GT 1NWKA 4DU1A 5DG7A 4J9MA 1Q86T 1FK9A 3MF5A 3C6TB 2AEMA 2DGXA 4GKKJ 3OVBA 1FJEB 3GJRB 2UXBJ 4J9NA 2B5JB 3POTA 1VDHA 2Q66A 3HPOA 1CS4A 1T6DA 1HHTP 3QWUA 2F8TA 3IFRA 1K6YA 3VALA 1S97A 4AD6A 1K1SA 4ZP7A 2B6AA 2PT0A 3SPYA 1JIHA 2BVZA 3S7RA 2MZJA 2CJBA 4LSZB 1RQ0A 1TKXB 3DM2A 2QXFA 3F5TA 4FPIA 4CJTA 3QNOA 3WX8A 2HGLA 4NZ6A 5L1KA 3B82A 2C3OA 4ECUA 3PG9A 1RT5A 3P6YC 4UF4A 3FZBA 1LCUA 2R2SA 2HNZB 4DKWA 3O1LA 2E1RA 3WIUA 2I9SA 4RBTA 5TKYA 1PJ5A 1WF2A 2DTUA 3U9ZA 2ZH8A 2A1SA 3OXLA 4HYKA 2AF6A 5LL6d 1BD6A 1GOAA 2UUBJ 1XMOJ 4FYDA 1RAAB 4YP3A 1ICEB 1VGYA 3UWTA 3O3GA 5C0YA 1YI2S 3VGTA 3BM7A 3M30B 4GC7A 3D0IE 4RO0A 3CSKA 1UA1A 3VOVA 5J1EB 2A10A 3B4DA 5E3PA 3PXGa 3W8PA 3BKUA 3ZZ0A 4K42A 4B1YB 1XC3A 4X65J 3THWA 4LSNB 3AA2A 2B9WA 2AGPA 5GINA 4X4NA 1SJ1A 4RKUC 3KUEA 1HQEB 3AB2B 4JI2K 1SBRA 3CUNA 4OZ2A 1NOYA 1Q9YA 1RDUA 1NSQA 3M8SA 4DV0J 2D41A 3JS6A 4PCQA 1BWFO 3DDKA 3HHKA 3NS5A 3SCLE 4BS2A 3JTOA 3DC2A 2XYPB 3A3OB 3MXHP 4B3TK 2YNGA 4EFHA 4CGFA 3DI6B 4CP5A 1ACMB 2ALZA 4M3TA 3AB4B 3FSIA 3UD4P 1RWMB 2UXDK 5KFYA 1C0UA 2R42A 3SDEA 1QLNA 3W8GA 5FPEA 4F2RA 2A18A 3ZT1A 1V6HA 3G82B 4FO0A 4CGIA 4OPHA 4J9QA 1KD1O 5D4NA 3K2PA 3ENVA 2KDOA 4Z0UA 1X4CA 1D5AA 3ZX0A 3SIPB 4EGLA 2K7JA 2DO4A 3JQMA 1RBVA 3VF4A 1X3MA 1SXLA 3RG6A 1NGEA 1JWWA 2FJWA 4CEFA 1X31C 2LQ8A 3EJMA 3EO3A 5KG1A 5HRNA 4YOUA 1H74A 2V4JB 5FPNA 5AXKA 5BJRA 3AQPA 2Q36A 4LH5A 1C6VA 2O66A 3C0BA 3DLRA 4B3SF 1F0XA 3EGNA 4FF1A 1FNMA 1KOOA 1FWPA 2BE7D 4GNIA 2W4DA 4J2EA 2MSTA 2OPRB 3HZEA 4DTRA 3IMXA 5HRPA 1KD1T 3VAIA 4F3MA 3CJ9A 3MECA 2FJBB 1AA1B 2EBEA 2PYJA 4DU8A 3THYB 3ULEB 4L3KA 3W61A 3O9RA 2ZD1B 1ZC6A 4ECSA 4IH7A 3TEHB 3P4IA 3CCJS 2V8GA 3UO0A 1RLDA 2LECA 2ZDOA 3D1HA 1ULRA 3CJ0A 4FL9A 5AQMA 3JAMY 1T02A 2PA3A 3HSJA 3TUPA 1VBYA 2E7WA 1JJ4A 1PYTA 2E1AA 1KVKA 2VA3A 4EYHB 1VQNN 2ZKTA 1RAJA 3NH0A 2QC3A 4IO9Q 2MQLA 1VQKN 2BABA 5HBMB 4ZN1A 4IZ9A 1LAVA 3G96A 1YJ9N 3UVJB 2ZOMA 4ZCKA 4G3IA 3KMSA 5A2QU 2QL7B 5A76A 2ZH1A 1N56A 1KVBA 3DOKB 4JI1F 3NGYA 3GYNA 2OTLS 1CZ9A 2F4VK 4DR2J 3UB5A 3I4HX 2QX0A 3AVAA 1IXKA 1VK8A 4ED0A 1NHKL 3DLLQ 2J4RA 1N0VC 2BANA 2NCKL 3C95A 1YT3A 3IRXA 3NXZA 3UPFA 1LK5A 4PQUA 2RMLA 5IWAK 3OQ2A 2EWHA 1Z05A 3QNNA 3G86A 4DEZA 2XB2D 5EDWA 5EHHA 3IBCB 2UUAJ 4JK7A 2IRXA 3KK2A 2Z57B 2IGIA 1GFWB 3DGPA 5KFCA 1APSA 4IYQA 3D6MB 4PUOB 4ZHRA 3W2VA 5E26A 4WQ4A 4C3MA 4ZOSA 1VJWA 2Z2MA 2BX6A 2FPHX 4JI4F 2XY6A 4CERA 1JXBA 3DLJA 1N36K 4CJPA 4DQPA 2FHKA 3CXCR 4OX9F 5C15A 1WHWA 1VK3A 4BRGA 4M3WA 1JLQB 3KK3B 1JJ2R 4MLEA 3NFAA 3AD8C 2HIYA 3K8WA 1Q78A 3VA0A 3F56A 3RRKA 4BDPA 1ESVA 3AA8A 2LLZA 2HFOA 4C3KA 4K8XA 4PAAA 1WC3A 4DG1B 2M8HA 4QQBA 1LAWA 2BV3A 1N8RO 1R8BA 1J5EK 4O3RA 2F7VA 4M7YA 1QHTA 4J9UE 3CDBA 1VRQC 2CGLA 2DPIA 2IRUA 1WAFA 4ELUA 3O9QA 3DRSA 1U04A 1CJKB 4NLQA 4BR4A 4PWDA 5IT4A 2C28A 1QDUB 4RW8A 2P5OA 4TKTA 1MW7A 4P74A 4CM0A 3L7UA 4J91A 4LR9A 1HKCA 3Q0AA 1FE0A 3IAM9 1V5VA 4BR2A 3W60A 3WNGA 1TKZB 3BGOP 2WTFA 4IBNA 2YBVA 2KFYA 4O0IA 3CW2C 3WBZA 3LZJA 4DR5J 2NRWA 4CBXA 2M88A 2MY8A 1WSGA 4O55A 5ETTA 2RNEA 3O2IA 4OZ1A 1O13A 3F73A 3HPHA 4ZTJA 4ZJLA 3ET6B 1N8RT 2AKWB 2OI2A 5LMUJ 2WUSA 3J80Y 3NMAA 4X62K 5EWGA 3HPGA 1DQ9A 1FJGK 2O3DA 3IWLA 4BC3A 4F4ZA 1RHMB 1BU6O 1RWXB 1Q81T 2AJ0A 2G2YA 1A5WA 2ZM6K 1RTHA 4FJ7A 3W63A 1R6YA 3OXGA 2QGFB 5AE1A 3M2VA 4JRQA 5JVGL 2CJAA 2OPSA 2P5VA 1EQ0A 4XH5A 2QL9B 3MCAB 5D4LA 5KFHA 5T7LB 2J76E 3N6LA 2ZUAA 1TP7A 4MT1A 1BMQB 2CRLA 4U95A 3HP9A 2XTJP 5DGBA 4NLYA 1AFIA 5CZ2A 2IYIA 2PA8D 2LXUA 4QU6A 4NYOA 5CY4A 1HI0P 4JS4A 1VIXA 4BRKA 5HMXA 3ZZOA 2V2ZA 1TYQA 1NGHA 3MK6A 2D1CA 2KXHA 2ROEA 2V63A 3HVTB 1NCLA 2QSWA 2H5JB 4RCHA 3R2DJ 2OPQB 4FWOA 3BZKA 5DLFA 3BR9A 1FW6A 3LP1B 2EC2A 3L4QA 1NGAA 3KG4A 4RW9A 2G1HA 3IR6B 3SQGB 1MMNA 3SQ4A 2Y1RI 1F9FA 5J2NA 5HP1A 4DV4J 4KREA 3O6QA 3DDNA 4JKAA 2HB5A 1SUQB 2ASPA 2PDAA 3PX4A 3O08A 1FXXA 3VQCA 4USTA 2YWWA 3MTKA 1KC8O 3VEXA 4O4GB 4GKJK 2BW2A 3L2QA 3KKRA 4E3SA 3SQ1A 3D4JA 1TTHB 3S3NA 3DYAB 3FMBA 3M8WA 1VHFA 3TA0A 3WQTA 2EFNA 3ZT2A 2VFSA 4FJJA 2J9DA 4HTIA 3MMAB 1FI4A 1YJRA 1NGFA 1QM9A 2JHEA 4USKA 3KOAA 1K73O 4CLYA 4TY9A 1NM1A 5A8KB 4ZIVA 2A0FB 2X78A 2FHJD 3ZNUA 1BXNA 1PSDA 3D2WA 3S6EA 3VQEA 1WHVA 2VQEJ 2F8EX 1RYRA 3EGWB 3OD2A 5IT9O 4CVNE 3HHEA 4OZLA 1T95A 1KC8T 2XZTB 4F50A 3CC4S 2V8DA 4KRWA 4EHTA 3M2UA 4DUZF 1Q8KA 1VBKA 3OTOK 4YR2A 2BBEA 2CQIA 4H0XB 1VHXA 2L9DA 1PBAA 2DNOA 2QIFA 1QVFM 3MEGB 3N5BA 1SQEA 5KOWA 5AQIA 2W01A 5M1FA 5A8RB 1X9SA 1UEUA 1NGBA 1J54A 3OLAA 5BREA 3W2WB 5E33A 4NCAA 2HHPA 1RGIA 1QE1B 1S4EA 1GK8A 3CDWA 4WYBA 4HI1A 1K73T 4K0KF 1SC6A 1NH7A 4FBTA 2JEIA 5KFSA 3UN3A 1H98A 1WLJA 2HAFA 1ZETA 1IQTA 2ZQBA 2K3IA 2ASYA 2KZMA 4F0HA 2PZSA 1KSPA 2E1CA 2R9LA 4J90A 3MPWA 1W9HA 3J81O 4BHQA 3CJ1A 4Z4IA 2HBRB 4I6YA 3ZO7A 2C2NA 2O67A 1YAGA 3UR0A 5HVFA 1IBLJ 1WEZA 2GJ2A 4Y34A 3VVTA 5B0CA 2M70A 3ETOA 2OFHX 4BACA 5EGYA 2UXBK 1CXUA 2H48B 5G0RB 3AHPA 4P2SA 2GMLA 1HNXK 3RR7A 3KJVA 4CLWA 4EHUA 2GTDA 2QEXN 4JD2B 1U09A 2JEFA 4ZPWR 1RYSA 1UVLA 1NJIT 2ADBA 2JVOA 5KFZA 5F2RA 4JI0F 2DISA 5E41A 1IBMJ 4BRMA 3KJNB 1DTQA 5GAEI 5AQQA 3MR3A 3OTDA 3GG4A 1VHIA 2WC9A 4JI6F 3B6BA 2F3JA 5L1JA 3K5OA 1YIJS 2E7VA 1BQMB 4CLKA 3CJBA 1RT7A 2G2ZA 3W9JA 1VLOA 1UWAA 2DYAA 3B8HA 4ECZA 2EFOA 2XHWA 4ED3A 3OHBA 1JLAA 4WCEL 3AXKA 1EZZB 1N5YA 4JHDA 5LMNF 1UVMA 3EE9A 1HHQA 5ELZA 2B9YA 4F26A 3NGIA 3L4BC 3N28A 2UUBK 3P45B 1HKGA 1L3TA 1RBTA 5LJ3Y 4A8YA 3WHIA 3HK2A 4R0EA 1UW9A 4DUYJ 2XS5A 3HKZD 3HF5A 1O6XA 2RQKA 1K47A 2JGUA 1F1BB 3K17A 4U67L 3DLGA 3CIPA 5A8WB 2OJ3A 1HMVB 2W25A 3Q8RB 2L48A 2W1BA 4FBUA 1PCAA 3QIOA 3CO9A 3V1QA 1FEHA 2IVNA 3CMAN 4X65K 4E19A 2VGNA 3QIPB 3PZPA 1PGZA 4RWXA 1H0HB 1R7IA 3TR5A 1I39A 4CZIA 5FDLA 2WVEA 4KHMA 2AX0A 3VV2B 4RBVA 5CYMB 1PJ6A 3GOIA 4CK1A 4YB6A 4DV0K 4W5TA 4Y2AA 4XH1A 3IGVA 3SCXA 1IR1A 4H4MA 4PXBA 3ALYA 3MPDA 3SMZA 2MLZA 2G0CA 2O8FB 2DKOB 3NP5A 4IQXA 2XMKA 3GP9A 5ETPA 5AFUA 2UV8G 3SAFA 1R8AA 2ZJRQ 1WHYA 3R1HA 1X1PA 2EPIA 1BC6A 1VRUA 4B3MF 2YX6A 2HHHJ 2XQCA 3JS9A 4ZVSB 1C1CA 2YHAA 2W9BA 4O0NA 5IM0A 4OFZA 4EUVA 3CC7S 4FSVA 2VJVA 3DFEA 1MWKA 5AQNA 4JI8F 3JXOA 3TQEA 1RCHA 2RH3A 4C0BA 2JVRA 2M52A 2RDDA 2LQ5A 2BW7A 4PKHA 1Z2LA 3KLHA 3ZYYX 4KAIA 2ZNZA 2PBDA 1GH8A 3TTDA 2B4VA 3GYGA 3K8VA 4TLRA 2HK2A 3JAMU 2XNRA 1K1QA 4KGXB 4ED7A 1I5OB 3ATVA 1DLOA 2EK1A 5D0HA 5EU7A 3FBFA 1FHTA 2BOAA 2H51B 4JKGA 4MO5A 1U1LA 3NGTA 1WC6A 1S5JA 4MK7A 2DNRA 4NLGA 4TU7A 2E2QA 3D1OA 3SI8A 2V2KA 2VG5A 2VGMA 4KGZB 4NZ7A 2FJVA 4L73A 1YJWS 5HK4A 2JWLA 4M5DB 3OYLA 3ID6A 4YOEA 3MEEB 4A47A 3KNGA 5GIPA 2QTWA 3I55S 4JBCA 1F9HA 3AQOA 1DFDA 4QWDA 2KYZA 2OAUA 4IDHA 2N82B 4E7LA 1U1NA 1KNZA 4B3RF 3FDSA 1N32F 5KT2A 2JOQA 2E6MA 4GVMA 1S99A 4EMDA 3EPIA 4ZPAA 2O8CB 2RS8A 4C9DA 4TQSA 2J8SA 2QLJB 1SQFA 4M41A 4O5FA 5D8HB 4H5TA 2CJKA 2YNFA 4AHTA 1ZA1B 1ZM2A 1NK8A 1WSFA 2JDJA 2B4OA 2P6SA 3VQ5A 3FFIB 1TKDA 1HYSB 1T0TV 4AH9A 1JX4A 4JI5F 1ASUA 1EIYB 4DLGA 4BE1A 4CLSA 4PA1A 2HQ3A 2FLNA 2UXCJ 3SJHA 1HYZA 3V81A 2VD3A 3UFCX 3EYZA 2HF4A 3MHYA 2W6KA 4W98A 1Q9XA 2F63A 3C14A 4JV5F 1JLCA 3AA4A 1S6OA 2X74A 3CCRN 1WKJA 5EX5A 5BPNA 2Y0SD 3O8MA 4JYAJ 3NY0A 3RBXA 1W2IA 3SFGA 3PR5B 2CGJA 1BUXA 1VSEA 2EK6A 1YTAA 3D3BJ 4NE9C 4DR2K 3CD6S 1H3DA 1IKYA 1VQOS 1VQ8S 3J7ZO 2VPXB 1BQNA 3D0GE 1PKUA 1R0CB 4JRPA 2ZZMA 2OSRA 1UOCA 1WI8A 5KFVA 3H2LA 2UUAK 3OW2M 1N52B 5C2DA 1P27B 1EX4A 2XLKA 1K8KB 5AQSA 3CCWA 2H9ZA 1S6QA 2IBOA 2KHOA 1IUJA 5I9EB 5IOLA 3SQ0A 4G1QB 2OEJA 2HBJA 2YI1A 2DIVA 5DDQC 3IDHA 3LZIA 5CE3A 4DR4F 4PKGA 4ATNA 1KAYA 3OTEA 1RHRB 4PG7A 4IFVA 2VJUA 3J80U 2NYHA 3H40A 3PO5A 5F8NA 3QLHA 8RUCA 3G71S 2N7YA 3SAGA 3J7ZT 1CBKA 2CPHA 1J6ZA 4W5QA 4AFFA 2XGQA 3AFGA 2YJEA 2MMYA 1HR0J 1E6YA 4DPTA 4KQZA 1X4HA 4QW8A 4QYZJ 4DTUA 3HM8A 5HVHA 4I6MA 2FLLA 2GAHC 1KFDA 2FVRA 3E51A 1S5ZA 1Q53A 1NJWA 1WORA 5DQHA 3OUYB 4B1WB 5E7OB 3WXLA 4E1MA 4LH4A 4N77A 1W7WA 4A4JA 2OLWA 2YWHA 2UP1A 2DO0A 2GMHA 1XC9A 4OKJA 2NPFA 4X4PA 3KUGA 4GKKF 3NGUA 3T19A 1U1MA 2AZ3A 3BP8A 4YUDA 4KBOA 3V9XA 3MDFA 1RHKB 3TARA 1TQLA 4DR5K 2I6WA 4A8KA 2PAVA 3QZ7A 1FEEA 1C1BB 5M1NA 4E89A 4NI2A 5LMUK 4NLOA 1FNXH 2XHCA 2LA6A 3VHQA 3VQ4A 2MKJA 4FWNA 1JXVA 3OL7A 1YQHA 3LF0A 2YQ3A 1WNSA 3UKUA 4FVUA 4NMXA 1H2UX 4M45A 4CJUA 4DHYA 3J7A1 2K2PA 4CT8A 2E2NA 1YJNS 2YJFA 1QSYA 5AQZA 4URSA 2PI5A 2ZDPA 3W65A 3MM6B 3KLEB 2CQDA 4ERDA 3N4PA 1KXPA 2P9KA 1XMOF 2FBTA 3JXUA 2IMWP 1WOPA 1H6KX 3AJ2A 2DBBA 1HQUB 4OI0A 1HWIA 3TUZC 4KY3A 1CJUB 4U8YA 1NHUA 4GVLA 2L9NA 2ZE2A 4L75A 3GE1A 2GX8A 4U96A 1ZXOA 3BH6B 3MM5A 1HBOB 4M5NA 3F44A 3PM9A 2J6TA 2VH7A 3UDCA 1MU2B 2WVFA 2ACYA 2QA1A 2NRHA 4FWSA 1EO1A 4K8RA 3MUMP 1YVFA 1S9GB 4EBCA 2DHSA 2P51A 4BROA 4FWMA 5AZJA 2OYQA 4IO1A 5AQJA 1KQSM 5MAOA 3AVNA 3L95X 1SL1A 1VYAA 2MZSA 2DFEA 4HDHA 1T11A 4LF5J 1FTCA 2VFTA 2ZZTA 1HD1A 2UU9J 5T7BA 4DUZK 4RWWA 5HRSA 4CNYA 3AVFA 3D5MA 2IOCA 3U8XA 4DL4A 2QG9B 1NGJA 3CWJA 4C8LA 2V51B 3KLGA 4ILLA 2GAGC 4ZLLA 1NKBA 1M90O 1GX5A 3MPVA 1VSLA 2V94A 1Y3JA 3U7JA 4PL8A 5IT0A 4WQ5C 1U25A 2LVWA 2VKZG 3O3FA 3N6NA 3D6TB 3C6TA 1RAGB 3P5JA 5ETSA 4LD0A 4K0KK 5ETLA 1SJQA 2F9JA 2HBKA 4ZPBA 2IVFB 2ZBPA 1T03B 3QRPA 2B5JA 1RBLA 2DR6A 3ITHB 4USJC 3BBBA 2WSCC 4QU7A 2VQEK 1WOQA 4UZBA 3R7NB 4LF4F 3NGKA 8AT1B 3MCNA 3MX2A 2RT3A 3R5GA 1UWBB 4M95A 3A8JA 2E1YA 3PJXA 4KTWA 3ENBA 4B9NA 1KR4A 3R6LB 1TKXA 1HA1A 5J2MB 3EZ5A 2XM3A 2CH6A 3P38A 4CJLA 4LMZA 4PY5A 4CDIA 4WKRA 3PTWA 2OD6A 4YOXA 4DV2F 1KOHA 1SQGA 1M90T 3LAMA 3RBZA 4M5JA 2YPYA 3ZZUA 1B64A 4IUFA 4KHPJ 7FD1A 3RB0A 2CG8A 2YPZA 4IOAL 1SV5B 3AO2A 4RW6B 3R5AA 3MR5A 2LEPA 5M1OA 3OYMA 4Q0BB 3M30A 5JXSA 1RCOB 4DXLA 3SNNA 3GLJA 2OTJS 1NH8A 3PIOQ 4PR6A 4E7KA 2HKEA 1IBLK 5J1EA 1FWLA 2G13A 3UCZP 1YG0A 2MHNA 3G4SS 1VQ5S 3UNYA 3E9LA 3NOGA 5AXMA 4QS7A 4BC7A 1K0TA 3GB0A 4LSNA 2X3GA 4XDDA 4OGEA 1OJ4A 3P31A 2E2OA 1FK9B 5HMZA 2FF6A 4DCHA 3QT5A 4F8RA 3I8BA 3LL3A 4CEAA 1HQEA 2RS2A 4IH6A 4K4WA 4DV5J 1NJXA 1TL3B 1NU0A 1OQ3A 4FWPA 3HHLD 2ZJPL 2Q43A 4IRDA 2Q0UA 3VQSA 3TNVA 2L41A 2QWOA 3QGIA 2NZTA 3TO8A 2XLJA 3NNAA 2U2FA 2QSFA 5B09A 1YJUA 3PRDA 3OBWA 3DI6A 1QAIA 4C8YA 1NM2A 4DCOB 1YZ6A 3PR4A 4DV3J 3HX9A 2DPJA 2EFPA 2VU5A 2I7PA 4OGCA 4CZJA 5ETNA 4N8NA 4DUYK 5LOQA 1VK0A 1FA0A 1AUDA 3KUHA 3L4IA 5KOXA 4ED6A 2H4YB 1HBUA 3G82A 5I42B 4CZLA 2HVDA 5L9NA 2JH3A 2AWZA 2MLYA 1XQSC 3RB6A 2YWGA 2ASLA 4LIWA 1S4FA 5ETRA 3M5RA 2U1AA 2ZGYA 4C23A 3TVYA 3VAMA 5FRNA 1QJHA 5EOYA 2Z1GA 2E5LJ 2PY5A 2QT7A 2BJ9A 4DMNA 1FDDA 4OYOA 4H4OB 2ATCB 4FOEA 2V4JA 5AR0A 2Y0BB 3V4MA 3AO1A 4H54A 3FQLA 4BLGA 2MJUA 5F8MA 1FRMA 2OELA 3CULA 2DPNA 4J2BA 4GO5X 2Z2YB 5KFQA 4LIRA 4F25A 3GV7B 3NOCA 5KFIA 2NXJA 4ANEA 4KYZA 3VF0B 3FZMA 3S1TA 2KB2A 4ID8A 5KG3A 3PW0A 3WX4A 2CG4A 3ZCMA 2OPRA 2D3ZA 3UW1A 5LY3A 5C7PA 2KTQA 1MWMA 4DV6F 2KQ2A 2FVQA 4WIQA 4YHHJ 3JSMB 4NLPA 3THYA 2R8JA 3ULEA 2Q97A 4ICLB 2ZD1A 1N5TA 2XZWA 1CJTB 3PHTA 3ZSQA 4EAHD 1ZM3A 3BJYA 3KMQA 2GQCA 3ILIA 2PN6A 2V68A 2EKYA 4CGGA 4DCJB 5KG6A 2E1PA 1WELA 2AQ4A 3M7VA 4B9TA 3CG7A 3GFZA 1A6LA 3OL9A 4PG8A 2CQ4A 4FJNA 1G15A 2J0XA 4OIXA 2B9EA 1T9WA 3RJMB 2YKQA 4CHYA 4WQ5A 5HBMA 2XBPA 3MN6A 4DQ8A 3UVJA 3EDRB 2PEBA 1BOTO 1NK6A 2UUTA 3C6UB 3DOKA 1T6CA 3WZ0A 2WW4A 1F3FA 4JLHA 3W3DA 1B9DA 4I2QB 2ASMA 2MDAA 2QMXA 5ITHA 2FGOA 4CF1A 1RT2B 1D4XA 2PGCA 1JLBB 4LY7A 1MG7A 1SKRA 3NDKA 1YKWA 3VVUA 2RU9A 4PUOA 4DI6A 4O3SA 2ROGA 5LT5A 4CQ1A 4U7UD 2MKCA 3UNGC 3N4QA 4EEYA 1UPMB 4FWKA 4F0MA 4X66F 2P9PB 2QFJA 1Y5NB 2F1FA 3SMSA 3NCPA 4CJVA 4Z4EA 2N4DA 1RBSA 1ZZFA 5CA5A 3MGJA 2UXCK 3ZT3A 1JLQA 3KK3A 4OX6A 3QYYA 3BREA 1CC7A 1HPMA 3B8AX 2A3JA 5HN0A 4DG1A 5BRFA 1VQ4S 2F7TA 5K9FA 5AE2A 4PXDA 3TRGA 3P96A 4PEOA 4YFUA 5E2QA 4X4OA 1PYSB 3DN9A 3M32B 3O44A 1UMJA 2NPIA 5E3RA 1NGCA 3HDSA 2Y1LB 4HACB 2E5JA 3HLUA 3CJCA 2EG2A 1ZS6A 4QZVB 1MNEA 4C97A 2W9AA 3CCUN 2D74B 3MMCB 1IJEB 2ZUGA 3LP2B 3AH6A 4LBHA 4ZVUB 1MN9A 1XEZA 2COLA 3H4BA 2HHVA 1HJRA 2GFFA 3ADAC 4C7QA 4PRFA 1I94F 2HF3A 2V6AA 1XQIA 1HNVB 2ZH9A 1D09B 3QRQA 2ILZA 3M3ZA 4Y3CA 3RBDA 1TKZA 4BC9A 1R0AB 4QWBA 2F65A 4CI6A 4IJNA 2X1BA 5SUHA 1TFYA 5H9EJ 5KG4A 2O8DB 3VQTA 4WYLA 2POKA 2XRIA 1UFLA 4J8FA 1T3OA 2MZTA 1G2EA 1Q1KA 1X5SA 3MCMA 2VUGA 3MD3A 1YITS 2AJFE 4DR6K 1H1VA 3G87A 4KAZA 4BQLA 4LBPA 3HVRA 3T1HJ 2D3UA 2YX7A 1LWEB 3OVSA 2QTDA 1WB9A 4OKKA 2IVPA 2HMPA 3NRBA 4DSIA 3IR5B 4FYXB 3MN5A 1HR0K 4FF2A 1RTZA 4QYZK 4CEOA 1W7AA 4J5OA 2H4WB 2XZDB 2R7VA 2GO8A 2Y1IA 4DZ6A 4FW2A 3C46A 2BJEA 4XTTA 4DR7J 1KKHA 2JX2A 2HVZA 2FYXA 1XR6A 1N6QA 2JWNA 4DSLA 2ZBRA 4ZVRB 4CWBA 1OH5A 2QK9A 3HVTA 4IO9L 1QTNB 1WKKA 1CEZA 4RG8A 2OPQA 3SSRA 3MFHA 2VG6B 1TMJA 3LP1A 4B17A 1C0GA 4FK0A 2GC8A 4IH5A 4OMFG 3G8QA 4X2BA 2DY9A 2V67A 3SQGA 1DGKN 4RW8B 3N79A 1V3RA 1IBMF 4XPEA 3PRVA 4F9OA 2JNJA 5M1PA 4ZIWA 3OTCA 1SUQA 1UFWA 3DLLL 3PO4A 2VWJA 2R7SA 4O4GA 1QAJA 5KFDA 5KFKA 4CF9A 2A1BA 3QNWB 4YNQA 3HZ6A 1YBUA 3TANA 3H59A 1GOCA 3W66A 2E5GA 3BYRA 5F8JA 3V1OA 3DYAA 3OTBA 2CQ1A 4JV0A 4CHQA 1RTDB 3MMAA 4Q7AA 2XI3A 2FHJA 3LPTA 2KH9A 1QS4A 5C25B 2HK3A 4CI0B 5A8KA 4DR1J 3MXJA 1WTFA 4BE0A 2ZH7A 4ELTA 4BREA 1SAZA 4K43A 3GONA 3H98A 2CQ3A 5DG8A 2R4FA 4F4KA 3KDOA 3OS1A 4RUBA 1WSRA 1N34K 2DHHA 2F9WA 1C4AA 3NCIA 4FJLA 5KRSA 1EQMA 4QWEA 3D54A 2E44A 3UD5A 3M6XA 1XNRJ 1TUVA 1BY9A 2DNLA 3MEGA 3PHEA 1TYQB 5A8RA 5KQDA 2HBYB 1VQLS 3EVWA 3X3UA 2HQIA 3W2WA 2R8HA 3U3GA 4ZVTB 4CEQA 4EP5A 1FKAF 1YBAA 2CXEA 1QE1A 3D2FB 1UJ4A 1HBNB 3DCAA 4Y28C 1N0UA 1UPPA 1RSCA 2ZNYA 4CEDA 3IR7B 5GAHI 2CZ9A 5K14B 1RACB 3AVJA 2HBMA 4QS9A 1ZBFA 2RB7A 4OQJA 4DV2K 2BJ3A 2R2TA 4FLWA 5C2GA 3NAHA 4OYMA 5CH7B 2DNYA 1DQ8A 3LP0B 2PMHA 1U1KA 4EWTA 4I9LA 4CFBA 2PIIA 3J7AP 3IAS9 3BBCA 4Z4GA 5G0RA 1NKCA 2KL8A 4DTSA 4QIEA 3PX0A 1IWAA 3I96A 1FXLA 1W2BM 1CZAN 1S0MA 1KBRA 2IA6A 2PE8A 4DSKA 4JD2A 1IR2A 2R2UA 4DZDA 4DV7F 4CT9A 2O01C 4NLXA 4FLTA 4O3QA 4NO7A 4CECA 3VQQA 4WPAA 1X0PA 1X4FA 4F3QA 3ZZZA 4CZGA 1BQMA 3ZTOA 2IC3B 5AE3A 3DDIA 3F0NA 3ZSVA 4DL6A 3I33A 5BN9A 4ZTFA 2RRNA 4LRCA 2YNHB 1MROA 3BEXA 5DS7A 4TYAA 4CYUB 3GIKA 2DNMA 4G6VB 1SIZA 4USUA 4OPKA 2LYVA 2GX9A 4AUKA 3OYDA 3BGLA 4KE5A 2YKOA 3HSCA 4KH6A 4BGBA 4ES3A 1OO0B 2LDYA 3ZX3A 4QS8A 5IC6B 4IKAA 3WXMB 1NZAA 4DLEA 1FRJA 4FJ8A 2F5GA 2HWTA 4M5HA 5D3GB 1WN7A 3PFOA 3SJJA 1RT6B 4BR0A 2E8AA 3GIRA 2JSXA 3W62A 4NX9A 5A8WA 2AJ4A 2WSFC 2MKKA 1HMVA 5E0OA 2KW4A 1FFSB 1RZMA 1OMSA 4IQMA 1J2VA 4DCPB 5DRKA 3QBWA 2XEXA 1NMEB 2EW9A 3THPA 2EXUA 2M2BA 2CPYA 2P9CA 3R8YA 4NL5A 3QIPA 3CT9A 4AHUA 1RDAA 2ERRA 4FJMA 2YQ1A 3KIOA 5GAEU 4R5PB 3RMCA 2EFQA 3MR2A 1GLBG 3PKYA 5CYMA 3AJ1A 4U7CA 1YUWA 3IMQJ 3LPUA 1AZSB 4EP4A 2J6SA 2XI2A 4DPWA 3J7YI 1JK9B 4FPRA 2HWHA 3PJWA 2O8FA 3OT9A 3BKFA 1QQCA 4DFPA 3R8EA 1DTQB 4JI2J 4RNMA 5CR4A 4KH0B 3TW0A 3R3LA 4CLUA 2WVBA 1SJ4P 3WXKA 1NAQA 3PFEA 2FVSA 2I38A 3K0SA 1XI1A 4CZMA 3K57A 4DFJA 4DV3K 4Y2CA 4UOGA 1PBUA 3LDPA 4X84A 1VQ9S 2OO4A 2J6UA 3DXKB 4YY3F 3CCJN 2DGQA 4H0PA 2CQCA 3C7NB 4H0VB 1Q8BA 1LEOA 1DRZA 1NK9A 2QE5A 4NLRA 1KVIA 1X5TA 4F2SA 3SMPA 4C0HA 1SH3A 2UXDJ 3EMTA 2C42A 3NBPB 2E5LK 4NXMF 1ROFA 2HHTA 4OYZA 3BY5A 2HAIA 3GFXA 5IT9U 4M5DA 4MDBA 4ISEA 2OTLN 1GXTA 3MEEA 1WSJA 1MMLA 4OL8A 2A42A 3CYMA 4ZPCA 4MMOA 1ZTWA 4QYRA 4C8OA 2V7ZA 1SKUB 2HZCA 4ZJOA 2H3EB 4FVMA 2AGQA 2O8CA 1KWMA 4ECWA 3ZSXA 3W1YC 4YHHK 3MM9B 3L7OA 1NSPA 2BGGA 4DPXA 1RA6A 1LXJA 1RDBA 1FO1A 5GMEA 3W5YA 2CFXA 3CTRA 3W5XA 1FCAA 2DH8A 1RDWX 2XLIA 2QLBB 3FFIA 1SC4B 2Q6BA 5HROB 1HYSA 5C24B 3R6MA 4FPBA 2ETJA 4OZ5A 2HVHA 3AOAA 1UAXA 2FY1A 3J81U 2PC6A 1S22A 3M4XA 3ZZTA 2QYCA 4LF7F 4CEZA 4CHPA 1L3SA 4CJSA 2CPIA 1ZBHA 3TPQA 3C8YA 4CGJA 1Y10A 2E29A 4U6PA 1PAEX 4IOCQ 3IBWA 3FGVA 3VMFB 4NXNJ 3H3NO 3TSPA 3DWLA 3CFOA 5TKWA 1LKZA 5GADI 4GMKA 4OO1J 4HDGA 3SAHA 3GJTB 2YHXA 1FRLA 4AQYF 4X4SA 2G8KA 5ETOA 1GLEG 5AQXA 1XBWA 3H5SA 5KFPA 1R43A 2ZJQQ 3ZX2A 2DNNA 3A0IX 4KRFA 1HL6A 2ASOA 4Z4CA 4Z37A 3TTFA 1TL1B 2AP1A 1YJVA 2EKNA 3LALA 3CHWA 3BSCA 3K5NA 1ZH5A 2V7YA 2P5GA 2IJRA 3BQ0A 3MXMA 2GIQA 2CJXB 1RI7A 4BE2A 1K8KA 2VG7B 4LF8F 4TQRA 2F4VJ 2P9GA 3KJFB 3MOJB 2D3OR 1XWLA 3A1YG 3MMJA 3PSIA 3CD5A 1RP5A 4G1QA 2AW0A 3G6VA 1R3NA 2A1RA 1RJJA 1WUAA 2V0NA 2MKYA 4DF4A 3LM9A 2CDQA 4LFBJ 5A6WA 3A8YA 4OX8A 4WTYA 2ZWPA 4Q43A 1OWXA 2VQFJ 4OLBA 2CGKA 4QIVA 4FP9A 1S1XB 3OL8A 4DHVA 3CC2S 2ZJRL 3MMBB 3BO3A 4DN9A 3S41A 1VSIA 2P9EA 3TJ9A 3CDEA 2AT1B 4LF5F 3SLCA 3PKMA 2QO3A 1SL0A 1GLAG 2YHWA 3DMJB 2HG4A 5EN1A 2HQCA 1NPKA 4NYPA 6FDRA 3SI6A 1SPBP 3V81B 2HBQB 4A8WA 3HHLC 4F04B 4Z7CA 1HYVA 4OHWA 4OJGA 2Y3YA 3A2FA 1X0FA 1HPZB 2VC0A 2W2PP 1R6VA 4ZKAA 3OUYA 5AJ3J 1U02A 3BSNA 1IWGA 4LC9B 5BXIA 1VQ7S 1BCMA 4CZFA 3NF6A 4CD1A 1J5EJ 5A2QY 1IKXB 1IBCB 2EBGA 2HGNA 3MTJA 1TMMA 1P9YA 2OP5A 2FSKA 1IM4A 2WOMA 2AJ1A 5H9EK 1NGIA 3CIZA 4DV1F 2CVIA 4FLUA 3AAPA 1C1BA