5FDLA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with idx899
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
550
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P51 Reverse transcriptase
publication title Discovery of the Aryl-phospho-indole IDX899, a Highly Potent Anti-HIV Non-nucleoside Reverse Transcriptase Inhibitor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase
total genus 144
structure length 550
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5fdlA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5fdlA05
3BJYA 3KK3B 2WK4A 3JSMB 1RTIB 2KZMA 4FW2A 5EWFA 4TYBA 1JLEB 3MEGB 4ZPBA 2HW3A 4NYFA 4MKBA 4TY8B 2YHAA 3HVAA 4I2PB 1S9EA 3AA2A 1RAJA 3T3FA 3AO1A 3N6LA 3OYIA 1T3NA 5HRRA 4DQQA 3LWMA 1UWBB 2W9BA 4B9SA 2DFEA 3DLBA 2OZMA 2HVIA 5FDLA 5KFSA 3NCIA 1SL1A 2ILYA 2BE2B 4CF1A 3NH2A 3LZJA 3N6MA 5KFXA 1QQCA 4NZ0A 4PY5A 3PW4A 4IRCA 3OS0A 4M3TA 4CGGA 4DU1A 2HNYB 5KFZA 1ITGA 1CZ9A 4OLBA 2Z1GA 2HWIA 3S9HA 1N5YB 4QAGA 4URGA 3MXJA 4DTOA 1RNHA 4FLWA 4QW8A 3BSNA 3T19A 4O5BA 4E7KA 3DLEA 1JLAB 1RT4A 2PY5A 5EWGA 2Z1IA 1ASVA 1N6QB 3GV7B 4RW7A 1YVFA 1RT1B 4FLZA 1JIHA 4C8OA 4M45A 3NGIA 3DLKB 3GIJA 1UA0A 3BSOA 4FW1A 1C1BA 1TVRB 4FJHA 2PZSA 3FRZA 1RT2B 4CJEA 4ECRA 3LWLA 3DRPB 3OSPA 2QXFA 3V4IA 4CEOA 1HYSB 3FQKA 1HYVA 3AO2A 3I5AA 4JLHA 3L2RA 3RWUA 4IDKB 4NLDA 4K4ZA 4M3UA 3QNOA 4WFZA 3IRXA 3FDSA 1RDCA 4MKAA 3LANA 4K4SA 1HNVB 1NJYA 1T05A 3CJ4A 5HP1A 3NAHA 4YMEA 1NK7A 4N76A 1K1SA 3V6HA 3CM6A 3BQ1A 3SJJA 5EU7A 1QAJA 4HYKA 2FBYA 3DLHA 4CERA 2OPSB 3FFIA 4MK7A 3NBPB 4LSLB 1CLQA 1S5JA 1HQUA 4AH9A 5KFPA 3IN5A 4Q45A 1SUQA 5D3GA 3SV4A 2D3UA 4MFBB 4ECVA 1HNIA 4G1QA 4LH5A 4I7FA 3ZCMA 3P1GA 3LPTA 1BQMB 4ECSA 4M95A 2XY7A 4DF8A 2UVWA 1NK6A 2O5DA 4CK1A 2Z1JA 1KRPA 1S1WA 3S3MA 4K4WA 1NK9A 5KT5A 4O44A 2ATQA 1TKTB 5KFLA 2JEJA 5J2MA 4NYNA 3NAIA 2VG7A 5C24B 3TANA 4N56A 1NNDA 4Q0BB 3V9ZA 4IH6A 5KFVA 3HVTA 5C25B 2R8GA 2FBXA 3D5MA 3RAXA 3CM5A 2XWYA 3V1RA 1I39A 2ZE2B 3C6TA 3ALYA 1NK8A 1KCFA 3RR7A 1S9GB 4Z4EA 2YNHA 3DMJA 2X6NA 2HNDB 4DG1A 5I42A 2IC3A 3LP1A 3S3OA 4ELVA 2C22A 1TL1B 1CXUA 5DGAA 1NK4A 3H5SA 1WSFA 1HRHA 3HO1A 4WZMA 1FK9B 1RDDA 3QEXA 1MMLA 4K50A 4J2BA 4FJXA 4CFBA 2B6AA 1VRUA 4CGHA 3DI6A 2QE5A 3LP2B 4K4VA 2CKWA 4IBNA 1VSMA 5KT7A 1N56A 4GC7A 1OS5A 3L8BA 4DS5A 1D9DA 2HWHA 1EP4B 4B9UA 1ASWA 4CK2A 4BE2A 4FK4A 5KFBA 1JKHA 1BIUA 4KFBA 5K14A 3KK2A 2E9TA 4J9KA 1REVA 4KHUA 3P5JA 3KLGA 5F8HA 1WSIA 4GW6A 4JV1A 1S9FA 4J9LA 5KFRA 1QS4A 1TKXA 3DRRB 1U09A 3OYKA 4DSLA 3KLFB 4CECA 2X78A 4ECTA 1RYSA 5C42A 2UVRA 4B9VA 1JLFA 4WE1B 4ECYA 1W0HA 4CFDA 3M8QB 3OYLA 1S48A 2QK9A 4YP3A 4CHZA 4CK3A 3K5LA 4FS1A 3B6OA 3KLEB 1U04A 2KFNA 1HQEB 2F96A 5EWEA 3LP0B 2KFZA 3NGZA 3RTVA 2G8KA 3S3NA 3DOKA 1S1VA 3PW0A 3O3FA 4ECZA 3CWJA 1A5VA 4Q8EA 4B08A 2F8SA 4MH8A 4BWJA 3QINA 3M8SA 1GX6A 4CEDA 4DTUA 4DQPA 4I9QA 4LY7A 2R2TA 4E19A 4O0IA 4B9MA 5J2QB 1J5OB 1YT3A 3ZT3A 4DL5A 5KRSA 1SV5B 3A2FA 4L8RB 2HHUA 4CEZA 3EZUA 1TV6B 3MEDA 4CF8A 3OS1A 3BSCA 1LWFB 2P5OA 3KMSA 1C1CA 2XY8A 4DTSA 1VSEA 5L1IA 3U3YA 4B8AB 4BE0A 1BCMA 2P51A 4DFMA 4WFXA 3QIPA 3H5YA 2IJFA 1VSIA 2KTQA 4EBEA 3AV9A 3AA3A 3QEPA 1LW2A 3VQ9A 3KD1E 2HMIB 3QZ7A 2C2RA 1S6QA 3HPOA 2IAJA 2ZD1A 4W5TA 1IKVA 3GIMA 3PX6A 4NRTA 4F4ZA 4R8UA 2EX3A 1NK0A 4IQXA 4CJSA 4ED3A 2HHSA 1IKYB 2V9WA 4H4MB 1ZBHA 4NLUA 3BGRB 3DM2A 2IJNA 2RF2B 2IOCA 1U48A 2UVUA 5KFTA 2FLNA 3TAGA 4Z4CA 3TAMB 1T7PA 1DTQB 4IH7A 4JV0A 4O3RA 5J1EA 3M9MB 3ZSRA 2W7OA 5DG9A 4ICLB 3AO4A 3DOLA 3NE6A 4F3OA 3OL7A 5KFEA 1C2PA 1U45A 3C95A 1BI4A 2GIRA 2VA2A 3I0RB 3V9XA 5HBMA 3NHGA 1YTUA 1C0TB 1HYZA 3D28A 3H4BA 2F8TA 4FVMA 3L2VA 4EYHB 2E9ZA 3ZSQA 5J2PB 5DG7A 2B5JB 4NLQA 3WNFA 3NGYA 4IG0B 1NK5A 4OPJA 4DQIA 5HRSA 2YNIB 5KT2A 4JRPA 3V81A 4IFYB 5HLFA 1ASUA 4EBDA 4OGCA 3ZSOA 2VG5A 3GQCA 3M8PB 2IM2A 4RNMA 3I8DA 3WNGA 5CYQA 4DTRA 3MEEB 2BRLA 3C94A 2ALZA 4DL7A 3PX0A 2GIQA 1DTTB 1ZYQA 1S1XB 3MF5A 2GUIA 3T5JA 1R0AB 2AX0A 3C6UA 3KOAA 3SYZA 4JUZA 1QE1A 3VQDA 1LWEB 4I2QB 1O1WA 3JYTB 1RT7A 2E4LA 4ELTA 5HROA 5F8NA 2XI2A 5DGBA 1C0UA 4KV8B 2YKMB 5F9NA 4CFCA 4B3OA 3OY9A 3PY8A 4KHRA 1ZBUA 1KLMB 2OPPB 5DQHA 3RMAA 3V6DB 2G8WA 3OYAA 5KFIA 1RA6A 4FJKA 1ZTWA 2XGQA 3AVNA 4CHPA 1QTMA 1FKOA 4MIAA 1ZBIA 4EP5A 4LSNA 4KKOB 1BQNA 1S97A 2FVCA 4AHVA 3IGNA 3OL9A 2YNGB 3KK3A 3JSMA 1RTIA 1NJXA 3Q8QB 2DFFA 4RW6A 5DQIA 4QWDA 5KG6A 3SQ2A 2UVVA 3THVA 1JLEA 4TY8A 2XRIA 4BDZA 1NHVA 2YNFB 2P5GA 2QKKA 3KK1B 2IM3A 3HPHA 3GV5B 1HMVB 1UWBA 4CJ3A 4YNQA 2RPIA 2BE2A 3OLBA 1HPZB 4OGEA 2JC1A 3PO5A 1RBRA 2I5JB 4CEEA 3CG7A 1U49A 2G8VA 2HNYA 3FSIA 2WTFA 4CF0A 4NLPA 4FJIA 1QSSA 4E0DA 1EXQA 3MAQA 1VSKA 3QEVA 4LH4A 3AO3A 2WRMA 1T03B 4CJTA 4KHYA 3G86A 4FYDA 3F9KA 4RW4B 1JLAA 1KVAA 1CSJA 3NL0A 2G8HA 4TQRA 3QO9A 5KFDA 4FBUA 3NFAA 1RT1A 4ID5B 2AQ4A 4RZRA 4U6PA 3L3VA 5C5JA 3DLKA 1TAQA 3EPGA 4N47A 4IR1A 4FJNA 5CZ2A 1RT2A 1CZBA 3QLHB 4EP4A 4DEZA 1ZETA 3VQ4A 4DL6A 1Q8IA 2IS3A 1HYSA 3FQLA 2B4JA 4KHSA 3BR9A 3BSAA 4C8KA 2RN2A 1FKPB 3IG1B 2AGPA 3NH0A 4DQSA 4GVMA 1X1PA 1HNVA 5I3UB 3QIDA 2BGGA 3L2QA 1BIZA 1LW0A 3OHBA 4MK8A 1RBSA 4BDPA 1S9EB 2OPSA 1RCHA 4LSLA 4Y34A 3PX4A 4FCYA 3CJ5A 3LPUA 3KKSA 4CJ4A 3DRSA 4PUOA 3KHLA 4MFBA 3CJ2A 1C1AA 5KT6A 4DFPA 4CJUA 5KFNA 4M3XA 3RR8A 2RKIA 3CJ0A 4O3NA 3O4QA 4FJ9A 3CDEA 4EO8A 4FLXA 3PJXA 4RNHA 4ID1A 3QYYA 4IFVA 1MU2B 4GC6A 4E1MA 3MECA 3NAEA 2ZQBA 1TKTA 3Q8RB 2V4QA 2ASDA 2IBKA 4DFKA 4HUGA 3DLEB 1B9FA 4CJPA 4KHQA 2XO7A 3M9OB 5C25A 4R5PB 1D1UA 5DK5A 3L2WA 3RMBA 4J2AA 3VQCA 3OYHA 1F21A 4AHTA 1S0NA 3AVFA 1C1BB 2HNDA 4O3SA 2JEGA 4NCGB 2EHGA 3HHKA 3MXIA 2E9RX 3KJVA 4DL4A 4FS2A 2I1RA 1FK9A 3OYNA 3OYBA 3AVGA 1XR7A 5L1LA 1JXBA 4OKEA 4FJ5A 3IRXB 2AX1A 3O4NA 1BCOA 4E7IA 4IG3A 3LP2A 1JLGB 4IKFA 1RTDA 2ITGA 1T05B 5HP1B 2XGPA 3VQ8A 2W7PA 1K1QA 4Z4IA 3KKRA 1SH0A 2P1JA 1WLJA 3G6YA 4TSXA 1S1UB 1TQLA 1TAUA 1KHWA 3SZ2A 3FFIB 1RTHB 5EDWA 4Z4HA 4Y2AA 3SQ1A 2YKNB 1HQUB 2XY6A 3I5BA 3SFUA 3OL6A 4I9LA 1SUQB 1BL3A 5D3GB 2JEFA 5DG8A 1T8EA 1RT5B 4HUEA 1IKXA 4FLYA 4G1QB 4JS4A 2W9CA 4NYZA 4RNNA 4OKKA 4KE5A 4WE1A 3TR8A 4FM0A 2VG6A 3ZSVA 4KTQA 3EPIA 3QETA 4FK2A 4NRUA 3DDKA 3M8QA 3V6KA 4ZPCA 1S1WB 5JUMA 1J53A 3QESA 3BDPA 4O44B 5KGWA 3KLEA 4KTZA 1HQEA 4Q44A 4H8KA 3E01B 3LP0A 2DPIA 5KRTA 1TKDA 4FJGA 2F8EX 3CDUA 2OPQB 4DLEA 4ZP7A 1QUVA 2C2DA 5DLGA 3UPFA 4C8LA 1X9WA 3K5NA 2VWJA 4HTUA 4Y2CA 4AHSA 4K8ZA 3OYCA 3WNHA 4E1NA 3QEIA 1RDRA 1JXEA 3OYEA 3C6TB 2FVSA 3VQ6A 2XHBA 4LQ3A 1TKZA 2YNHB 3DMJB 4BACA 3ZT1A 2ILZA 1HARA 3VQEA 1DLOA 4DG1B 1J5OA 2BRKA 1RILA 2IC3B 3LP1B 3ZT0A 1SV5A 4NLTA 4CJKA 4J2EA 2BANA 4KO0B 1TV6A 2A1RA 5KFWA 1QSLA 2WOMB 2OYQA 1LWFA 2B6AB 1VRUB 4KB1A 3DI6B 4RW9B 4DTXA 4TN2A 4W5QA 1NJWA 4HCBA 5KFAA 4PWDB 2KZZA 4FLUA 1KFSA 1S1TB 2OH2A 3VQPA 5KFCA 2IDOA 3EY1A 3RB3A 1NOZA 4KHMA 1EKEA 4EZ6A 4B9TA 1JKHB 4KFBB 1RT3A 4F4XA 4MQ3A 4GMJB 4M3RA 4E89A 4Q8FA 3V9WA 5K14B 1NHUA 3MFHA 4OL8A 3ULDA 1TK5A 1REVB 3KLGB 2R8HA 2RF2A 2DFHA 1TKXB 3TAMA 3K5OA 4DSIA 4NLYA 2UUWA 3LALA 4ICLA 3DLGA 2V0NA 3I5CA 3K57A 4K4TA 4QPXA 3NGDA 3G10A 1RT6A 4ED6A 4OPKA 3SQ0A 4KRFA 4ECUA 1B9DA 1C0TA 5KG3A 2BQUA 3HM9A 5L1JA 1QHTA 4DTMA 1GOBA 4F8RA 2FVRA 2ATLA 4H4OA 2GC8A 1L5UA 2XC9A 4LQ9A 1S1VB 4MK9A 2QV6A 1LAVA 2BQRA 2B5JA 1ZTTA 4E3SA 3TQ1A 3PW2A 2R2SA 2YNIA 1IO2A 4IFYA 3BQ0A 3VQQA 4O3QA 3RBEA 5J2NB 4IRDA 3WNEA 4KB0A 3HVWA 4K4YA 3SNNA 1WN7A 4URSA 1BGXT 2HHTA 1DTTA 4OJRA 1S1XA 2VWKA 4XO0A 3E51A 5T7BA 2HAIA 3ASMA 3BQ2A 1VK0A 2DTUA 3OSNA 3MEDB 1GX5A 1R0AA 3T5KA 1HJRA 1LWCA 4DL3A 2X74A 5KG7A 3NF6A 1TL3B 2WONB 3O3GA 3OYDA 3QZ8A 3OYMA 3KIOA 4TYAA 1G15A 4ZPDA 4M3YA 3DLRA 1UA1A 3IS9B 3KLIA 2G8IA 4F4WA 5KG2A 1JLBA 2E6LA 4CF2A 2J6SA 4I2QA 2ZD1B 1IH7A 4KAZA 1IKVB 2VA3A 2FLPA 3SQ4A 4EBCA 4CCHA 4O4GB 4FXDA 2YV0X 2YKMA 3SPZA 3DM2B 4J9SA 2X6SA 2JEIA 4DL2A 1UAXA 3AVJA 4U7CA 1GOAA 4NLVA 1N48A 5KFJA 1C6VA 5KTQA 4KAIA 3HJFA 1KLMA 1W25A 1KHVA 1SL0A 1XWLA 4FLVA 1NKCA 2RDIA 4J9MA 1WAFA 4O3PA 4W5OA 5E41A 3CFPA 3KMQA 4F4KA 4M3ZA 1RTJB 2GBZA 3CO9A 2D3ZA 4CEFA 2PYLA 5HBMB 4ED1A 4OKJA 3ZT4A 1U4BA 2W42A 1JLQB 4KKOA 1FXXA 4F4YA 5KFUA 2FVPA 1VRTB 4IR9A 2ASLA 2OA8A 2JGUA 4CJFA 4CF9A 4DTNA 2OZSA 1S6PA 2W8LA 4ZVEA 1D8YA 2BQ3A 2WHOA 5F9LA 1EETA 5SZTA 4DS4A 1D0EA 3ISND 3V81B 4CHYA 1HMVA 5HLFB 5DQGA 4EO6A 4CHNA 1KSPA 1JLCA 3CDWA 3PW7A 5FRMA 5HRNA 2IM1A 4RW8A 4W5NA 4ECXA 3HSTB 4R0EA 2I5JA 4CFAA 5SWMA 1QAIA 3K59A 4IKAA 2C2EA 4AILC 2HNZB 5KG0A 4ELUA 3H4DA 1XC9A 3HT3A 3IGVA 2ASJA 4KHNA 4ZTFA 3HKWA 2C28A 2R8KA 2D41A 1VSDA 3C6UB 4G3IA 4CEQA 1XR6A 2R8JA 3IAYA 1VSHA 3HPGA 2O4IA 4UQGA 3AVLA 4K4UA 4AHCA 3NF8A 1LAWA 5KT4A 1L3UA 1QE1B 3CIZA 2FC0A 3MEGA 1T03A 3KHHA 1QSYA 3CFRA 4I2PA 2AU0A 3K2PA 4RW4A 4NCBA 4EZ9A 1RT7B 4CIFA 2XCPA 3KLHB 5DMRA 4CEBA 1C0UB 5CYMB 4J9OA 3RB0A 3HK2A 1RBUA 1IKWB 3KHGA 4HVJA 4EEYA 1S0MA 1VSJA 4ED2A 4BDYA 5KT3A 4B3OB 1S4FA 3HL8A 3OJSA 4Y3CA 3U6FA 3PZPA 4PQUB 4FZZA 1WSEA 4WXOA 4ZMMA 3KNAA 2JLEA 4Y1CA 1N5YA 4DLGA 1TP7A 2AGQA 3PJWA 2FJXA 4CESA 4ZPAA 5KG4A 1FKPA 3ICLA 1X9SA 4HHTA 4BWMA 1WAJA 4LSNB 2YHBA 3PO4A 1C0MA 5I3UA 3GV8B 3U3GA 4FJLA 4QCLA 1N6QA 1RYRA 4RW6B 2J6TA 4QOZB 5L1KA 4Z0UA 3AA5X 2EC0A 3OJUA 4CJRA 3QNNA 3I0SB 1T94A 1XR5A 3RMCA 5KG5A 4KHWA 3UIQA 1TVRA 4CHOA 4RU9A 3DYAB 1ZBFA 3DRPA 1Q9YA 3SCXA 1SL2A 1XI1A 1NKEA 1WSGA 4TY9A 2XI3A 3HXMA 1NOYA 3GIKA 4ZHRB 3CVKA 5JS1A 3ITHB 4IDKA 3PHEA 4J9NA 3K58A 2OPRB 2Q3SA 3VA3A 1MU2A 3VQ5A 3ZT2A 3PR4A 4NLRA 4B8CA 3OHAA 4CJLA 1L3VA 4Y1DA 4AHRA 4B9LA 2R8IA 2FVQA 3NBPA 2JC0A 4NLXA 2W9BB 3OYGA 3ZSZA 2Z1HA 4R5PA 3QO9B 5FDLB 1JX4A 2XCAA 1RA7A 3EZ5A 4ED0A 3OVNA 1BQMA 2D0AA 4JRQA 3PW5A 4NCGA 3P83D 1EX4A 3CQ8A 4DSFA 3UQSA 3MR6A 3RB6A 3D0PA 4FBTA 4ZVHA 4CIEA 4CEAA 2D7SA 2FLLA 3TWHA 3H08A 4FK0A 3QIOA 5C24A 4KPYA 4KREA 3ZSXA 3MXMA 4Q0BA 3N6NA 1RT4B 5KFKA 1JLGA 5F8GA 1SH3A 4DFJA 4E7JA 4RW7B 2FJVA 1WSHA 3H59A 4TLRA 1VSLA 1RDAA 5HRPA 1LW0B 3HYFA 2R2RA 2J6UA 1S1UA 2ZE2A 4IRKA 3VQ7A 4FZXC 1S9GA 1KTQA 1RTHA 3Q8PB 3RMDA 5KFGA 2YKNA 3M8RA 3OYJA 3H5UA 4M3WA 4XPCA 1NKBA 3SV3A 1TL1A 5F8LA 3V4IB 5F8MA 3DRSB 4PUOB 1RBTA 4RNOA 1RT5A 2D0CA 2BR0A 2IM0A 1Z25A 1RBVA 2RKIB 3LDSA 4CJ5A 2G8UA 4IFVB 2HHQA 3EYZA 1EP4A 3MECB 4OVLA 1BHLA 3E01A 3RRGA 2OPQA 2A1SA 3UDLA 1I6JA 5L9XA 4J9QA 4RNFA 4CIGA 1KFDA 2HHWA 4JV2A 4WZQA 3DRRA 4DU3A 3KLFA 3SFGA 3LAKA 1HNIB 1WSJA 4I7FB 4F2SA 1K6YA 3RB4A 3NH1A 2CJQA 2KW4A 3OLAA 4DSEA 4FJMA 4TXSA 1JL2A 3LZIA 4HCCA 2BDPA 4HKQA 5DLFA 3PR5B 2V4RA 4YQWA 4QWAA 3KJVB 4KO0A 1Q9XA 3O3HA 3V6JA 3VQAA 5KFYA 2WOMA 3NDKA 3T5LA 5J2MB 4YR3A 2VG7B 5KGXA 3H5XA 3HVRA 4IG3B 4LD0A 4FZYA 4RW9A 3V1QA 2IMWP 1XHXA 1RTDB 3HVTB 4PWDA 1S1TA 4CJWA 4DTPA 1WNEA 1Y97A 1SKSA 3M9NB 4J9RA 3PUFA 2GV9A 4M41A 2AGOA 3TAFA 1S0OA 1VSFA 2WB4A 5I42B 5J2QA 4KB7A 3TAQA 4DQRA 3SUQA 4TQSA 4CGDA 5JXSA 2R7YA 3MFIA 3KD5E 1IKXB 3AVCA 4FJ7A 4ECQA 3RBDA 1YVUA 3SUOA 1CXQA 4NLOA 2HB5A 2W9CB 1LV5A 4AHUA 4XIUA 1RDBA 1D9FA 2VG6B 4O0JA 3QEWA 2FBVA 1ZBLA 4FM1A 1UOCA 2HMIA 1A5XA 2PYJA 3H98A 1B92A 4OLAA 4PA1A 3AVHA 4BE1A 4ZVFA 3SUNA 4QWBA 4NLWA 5KFFA 1IKYA 3KK2B 4DSJA 3Q8SB 3KHRA 4H4MA 3BGRA 3NMAA 4CJQA 2KQ2A 2FBTA 3QERA 3L3UA 3GIIA 1DTQA 4WYLA 3D45A 3QGHA 4ECWA 5C42B 4M94A 3NKYA 5T14A 2B43A 3K5MA 4DWIA 4CGIA 1JLFB 5J2NA 1TKZB 4Z4FA 4O3OA 1DLOB 1BISA 3ISNC 3I0RA 2D5RA 2DY4A 3SPYA 2BANB 4YR2A 1YTAA 3TI0A 5KFHA 4IOBA 1W9HA 2Y1IA 3V9UA 5EUHA 4CE9A 4DTJA 2XY5A 4EYIB 1L3SA 4X2BA 3B6PA 1U47A 1TL3A 3DOKB 2WONA 3H40A 5FRNA 1IG9A 5J2PA 2O4GA 4DF4A 5KG1A 3IS9A 3UR0A 1TK0A 4IG0A 4F50A 4ED8A 3NF7A 5FROA 4JS5A 4ZTJA 4KTWA 3PV8A 3LP3A 3M8PA 3QGIA 4RG8A 4O4GA 1RT3B 3KTQA 2HVHA 1L3TA 4J9PA 3SI8A 3MEEA 2HHXA 4NCAA 4WFYA 1KLNA 4ZP9A 1J9AA 4URQU 2LSNA 4N41A 3DLGB 1C1CB 1IM4A 3MTKA 1J54A 3QGGA 4FJJA 4ZVGA 1RT6B 3SI6A 4Q5VA 2RDJA 3HP9A 4C8MA 1RTJA 3QIPB 5F8IA 1LW2B 1S6QB 2DPJA 1LWEA 2IAJB 4ZP6A 4FLTA 1JLQA 3L2UA 3JYTA 4KSEB 2WCXA 1Z26A 1VRTA 4R8UB 3LAMA 4H4OB 1KVCA 1TK8A 1Z4UA 3AVKA 4KV8A 1KVBA 3ZSWA 4WXWA 3RRHA 4CJVA 4B9NA 2W8KA 1I3AA 4W5RA 4NLGA 1D5AA 5CY4A 5J1EB 1S49A 4J2DA 5CZ1A 2OPPA 4RUAA 3V6DA 3DOLB 3GILA 4Q43A 2NUBA 3NF9A 1BI4B 1N4LA 2W9AA 2HNZA 4YFUA 3CJ3A 3GYNA 4E7LA 4ZP8A 3KLVA 3MR3A 4E7HA 1LWCB 5KI6A 2YNGA 4XPEA 3VQSA 3G6XA 4C8NA 3PVXA 3KLIB 1SH2A 1JLBB 3BREA 4CHQA 4QW9A 2YNFA 4KI4A 3H2LA 3CFOA 3KK1A 3HP6A 4WYWA 4HUFA 2VG5B 4QWEA 2R2UA 3KLHA 4FJ8A 4N5SA 5CYQB 3F73A 4RUCA 4K4XA 2D0BA 5CYMA 3TAPA 5KFOA 4MIBA 1HPZA 1IKWA 4H54A 3MR5A 2Y1JA 3TABA 4CGJA 4PQUA 2AWZA 3CYMA 3V9SA 3AVMA 1S10A 1GOCA 1JXLA 3ZSYA 2FJWA 4M42A 4F3TA 1NJZA 3OYFA 1XHZA 4O4RA 4QWCA 2IA6A 2G8FA 3VN5A 4F2RA 2E6MA 3TVKA 5HROB 3AVIA 2ETJA 4KBIA 1X9MA 3G6VA 3AVAA 5KFMA 4ID5A 3RAQA 3OS2A 4CGFA 3SUPA 1S6PB 3MR2A 3V1OA 4K8XA 4ED7A 3I0SA 3VA0A 1EETB 4YR0A 2QKBA 5JS2A 2HHVA 3OL8A 3DYAA 3QLHA 4NLSA 3AO5A 1JLCB 4DMNA 4IH5A 3AVBA 4KI6A 3VQBA 4Z4GA 2ZKUA 4RW8B 3TAEA 1WNSA 3AA4A 2IGIA 5F8JA 3T1AA 1SKWA 4FM2A 4ZHRA 3ITHA 3IG1A 5KFQA 2AJQA 3TARA 1SKRA 2UUTA 4DU4A 3T5HA 1JL1A 1FKOB 4DSKA 1BQNB 2OPRA 1A5WA 4O55A 1TGOA 3G0ZA
chains in the Genus database with same CATH superfamily
1K9MO 4I4BA 3F5TA 1KC8T 1VQSA 3HVAA 4I2PB 1T95A 4I6YA 2C2NA 1RU2A 4AUKA 3LO3A 5B0EA 3ILOA 4DZDA 1UWBB 2DFEA 1YX2A 3KJNB 3M30A 2R7TA 1IWGA 2KM8B 3DDNA 3NH2A 5KFXA 4ED4A 4NZ0A 2FHKA 2Z2YB 4PY5A 4X4RA 3OS0A 4M3TA 2CPIA 2V50A 4DBQA 4JI4J 4PG5A 4OLBA 3AJ2A 1SJFA 3RUBL 4DPOA 4DV0K 4X62F 2UU9J 1LK7A 3MXJA 3GG1A 3G25A 4DV2J 1RNHA 3H2VE 3BN4A 2IHR1 4QW8A 3BSNA 1RAAB 5EX3A 3QFHA 1O51A 3ILLA 2AYGA 3J81Y 1RGIA 3TJ8A 1N8RT 4PL8A 1FRLA 4XDDA 4UQTA 5F3ZA 1YVFA 1K44A 4RBUA 3THWB 4U67L 2GIFA 3BF4A 2FJEB 4P72A 3GIJA 2ZNYA 4JB8B 2L08A 2V34A 3BSOA 4ZVRB 3GWCA 3K9JA 1C1BA 2KT5A 4FJHA 2MQLA 2F40A 4P73A 4LFAJ 1AUDA 3MDFA 2QXFA 5AQKA 1UVNA 3NS7B 4JYAF 3ENAA 4UY8O 3I5AA 4K0KJ 4IDKB 1VGYA 5JJBA 5AXMA 1A0OB 3QNOA 4WFZA 3VV2B 3LANA 3FZBA 1BWEA 3QBWA 1NJYA 3N0VA 4FOEA 3CJ4A 4UT4A 1K1SA 3BQ1A 3SJJA 1VBYA 2DNYA 1AZSB 4BROA 2HG4A 3CCJS 4HYKA 2FBYA 3DLHA 4CERA 3FFIA 4MK7A 5CHIA 1K8AT 1CLQA 4N7TA 3RRKA 3CC4N 5D3GA 3SV4A 4L75A 3A8IA 4JI4F 4MFBB 5DO2A 2HZCA 4ECVA 3GBTA 5KOWA 4I7FA 1OPZA 2UU9F 4DV2F 4OZ1A 4DF8A 1NK6A 3VHQA 4CK1A 1VK3A 4ES2A 1KRPA 2RJZA 4FF4A 2Q2RA 2ACYA 1I3OB 1RFQA 2BV3A 2CQIA 3VVUA 2X3DA 2W01A 3TUPA 2JEJA 5CABA 3KDNA 3D7SB 4FDFA 1FKAF 1UJ6A 3DGPB 1NNDA 2F8MA 4HH0A 5C25B 1N5QA 1FNOA 3CM5A 3THYB 3ZZTA 4LFAF 3DNCA 5BR9A 1DQ9A 5AFUA 2M0GB 3TSQA 2V68A 5F41A 3HI9A 3OTBA 2X6NA 4K0KF 3N5BA 1JJHA 2EFGA 1TL1B 5ETNA 1NK4A 1E6YA 3H5SA 2QFIA 3BPDA 1RCXB 4IQMA 4CM0A 4WZMA 4FNHA 3QEXA 2YQ3A 3NGUA 4GVEA 4W92B 1CLFA 2MHEA 1ZH5A 3GFZA 4K50A 4FJXA 5F0UA 1FVSA 3LP2B 4K4VA 2HS4A 4IBNA 1Z2LA 3VGVA 4DS5A 3L8BA 2XHWA 2ZH3A 1ASWA 4X4OA 5K8OA 1JKHA 3K0SA 1FRMA 1GEHA 3MM7A 2E9TA 1QJHA 1ROFA 1M5OC 2B9WA 4BR2A 4GW6A 4OI3A 1M90O 4J9LA 1TKXA 3I33A 4DSLA 3KLFB 3DXSX 1RAFB 3RAMA 4CECA 3U27A 3CJ9A 1RYSA 2UVRA 3CERA 1UFLA 3L09A 1JLFA 4WE1B 2B7BB 4MO4A 4H5WA 2ZZMA 2GCFA 3PRBA 4CFDA 2X1FA 1MW7A 3M8QB 3OYLA 1S48A 4UOFA 4LR8A 1RTZA 1CS4B 2DO4A 2K3KA 1NM1A 3E1YA 3K5LA 4CK3A 3KG0A 3KLEB 2KFNA 2F96A 4YOTA 4BR0A 2G8KA 3S3NA 2QA1A 1HNZK 3DOKA 1S1VA 1GTEA 2N3OA 3A3PB 3MUMP 4CO0A 4CEDA 4XAKA 3OTDA 2FSJA 4BRLA 3VCDA 1WBDA 3PIOQ 2GMJA 3M8WA 2H54B 1VQMS 1GMWA 3SDEB 2PN6A 2HHUA 3A2FA 2HWTA 2YWFA 4JNEA 3IBFB 3WIUA 1FXLA 1TV6B 1BUXA 4X64K 2DO0A 3SCJE 1TUUA 2IIRA 4YS2A 5TKYA 1VSEA 1RADB 4B8AB 1FA0A 4WFXA 4AL6A 2KTQA 3BZCA 4G65A 3VQ9A 2HMIB 2C2RA 3HD2A 4Z7YA 5EY4A 2IAJA 3UB5A 2QI2A 4ZOSA 3PX6A 4F4ZA 4DCPB 2Y8WA 4CJSA 4ED3A 4L72B 2HHSA 2DHSA 2VPWB 1ZBHA 3QRPA 3B78A 1LK5A 3FR0A 3SMPA 1XMOK 1KOOA 2IOCA 4KBOA 1VJQA 1CJUB 5I9EB 5KFTA 1FFSB 2ZNZA 3M9MB 2W7OA 3ZTQA 2X1BA 2G9OA 3DOLA 3DOMB 5KFEA 3GDQA 4HDHA 3C95A 3FFKB 2VA2A 3I0RB 2ZKTA 1F3VA 2XULA 2M2BA 1HYZA 3D28A 2NPIA 4UOHA 2DTJA 4FVMA 4LREA 3MN7A 1EX8A 4B1ZA 2MXYA 2LA4A 3QT8A 1WHXA 3WNFA 6FDRA 1NK5A 4Z2XA 5HRSA 3CQYA 4JRPA 4Y65A 3V81A 4IFYB 5HLFA 3M8PB 1S77D 2DH8A 4KQZA 4QIFA 1Y00A 3MEEB 2XZWA 2ALZA 3VGTA 2GIQA 3KJFB 5AQLA 3EDQB 2H65B 1W2IA 1X4HA 2AX0A 5E3RA 2PDAA 4YOXA 3C6UA 3I4PA 2XHCA 3T6JA 3KOAA 2POKA 4ZVOB 4UUXA 2RILA 1QE1A 4DN0A 2DD8S 3F0NA 2WVBA 4DV0J 2VH7A 1X3MA 2F4FA 1O1WA 2BABA 3M32B 2GTDA 4FSVA 4UY85 1KAZA 2PFFB 3P49B 5F8NA 2ZJQQ 3O1WA 2HK2A 1LQ9A 3OW2R 2J8AA 3L3CA 1A6LA 1NHKL 2UXBK 3PYEA 2WAQD 2CVIA 2NUHA 4FKYA 2R4FA 2WW8A 3J7AP 3V6DB 2G8WA 3M2VA 2Y8YA 3PHTA 4J9VA 1DKGD 1Q81T 1RA6A 3MM5A 2DNHA 1YQHA 1QTMA 1FKOA 1BQNA 2FVCA 1UVKA 2YNGB 1NU4A 2G2YA 3Q8QB 2FY1A 5M1QA 4RW6A 4QWDA 5KG6A 1VLOA 3THVA 5C2FA 4NMLA 4ER8A 3A5MC 4BDZA 1WSRA 3EEQA 3DLLL 2BJDA 4CT8A 1HMVB 4CJ3A 3MCMA 5GAEI 1RXOB 3OLBA 3A8KA 2COLA 2JC1A 4BRQA 3U9ZA 1WHWA 4AF1A 2EW9A 3J80O 3FBCA 3O4WA 4KGXB 4CI6A 1DY3A 2E8AA 4KH0B 3U1MA 4DV0F 1HL6A 4JV5J 3DHWC 2WRMA 5JICA 1JMTA 1Q0NA 1HW9A 4CZKA 2XM3A 3MMAA 3F9MA 4KHYA 4FYDA 1XNRK 3F9KA 3BBFA 1JLAA 4QU6A 4WKYA 4X84A 4TQRA 3L6QA 3MAAB 4FBUA 2J5AA 1RT1A 3TOQA 2MY8A 3J81O 5A8RB 5C5JA 3DLKA 1TAQA 4LF6K 2K1RB 3G9CA 2MZJA 3K17A 2DBBA 4WTOB 4IR1A 3CCQN 3UNYA 4EP4A 4DEZA 2X51A 2CWXA 2IS3A 1HYSA 1WG1A 3CNQP 2KYXA 2B4JA 1NGHA 4KHSA 3FRYA 4CH0S 2RN2A 2JWKA 3IG1B 4O8UA 5CZXA 2F65A 5BYRA 5IZHA 1HNVA 3J7YP 3QIDA 5HJXA 2BGGA 2VONA 1JJCB 3L2QA 1BIZA 4L73A 1LW0A 2DY9A 3ENHA 3BO4A 3AAPA 3P31A 4LSLA 2FGCA 4LMZA 3QJLA 2AT1B 1FFGB 3CJ5A 4GVLA 3M30B 3KKSA 3CT9A 3DRSA 4PUOA 1FTCA 3R6LB 3U1LA 4CJUA 2NRVA 1IR1A 4K41A 4JV5F 2CNOB 3VEXA 3PLAA 3CJ0A 3QFPA 1HNWK 2QIFA 5ETOA 4EO8A 4FLXA 3PJXA 3CJ1A 4KJIA 4CYUA 3I9V9 1MU2B 1ZA2B 5D4LA 4BC9A 1TKTA 3GYXB 2VUGA 1Q4RA 2B4OA 4QR0A 4MTPA 3TVYA 3E9LA 4DFKA 1B9FA 3L4QA 2XO7A 3WXIA 3TTDA 4R5PB 4J8FA 3C6HA 2G4BA 1HNZJ 1QAXA 3A1YG 3G6EN 3KUGA 3VQCA 3OYHA 1S0NA 1C1BB 1NSPA 1UZDA 2VGMA 4M63C 2HNDA 5SUHA 2LEAA 2CAJA 3K8VA 2E7XA 1FK9A 3NP5A 2JNJA 1FESA 4WPAA 3LL3A 1XR7A 4MDBA 1JXBA 3O4NA 1WELA 5HQLA 1MWYA 1QQOA 4X64J 2ITGA 5IQ6A 2W7PA 3KKRA 1SH0A 5AQJA 1S1UB 1TQLA 3R5GA 3FFIB 4PKGA 1FXDA 3S8SA 3A0IX 4AL7A 3PRVA 4QIGA 1K9MT 3JXUA 3OL6A 4I9LA 1AT1B 2F1FA 3W9HA 4V19J 5D3GB 1HIYA 1XIQA 4USHA 1RT5B 1YUWA 1IKXA 4F02A 3U4LA 3IM8A 5D0GA 1VQ9S 1F9HA 1VBKA 3FGVA 3MHYA 2HBKA 4FK2A 4FOIA 4CO1A 2V9KA 3TA1A 3V6KA 4IOAQ 3QMQA 2ADCA 9RUBA 5ELZA 3W5ZA 5KGWA 3G2XA 1GLCG 4KTZA 1TKDA 2OPQB 4A8XA 1HNZF 2CQ0A 2ZHBA 4C8LA 4AL5A 3EZOA 3CD6N 3ZZ0A 2GMLA 4LF9J 3OYCA 1SAZA 1RDRA 1WHYA 1OO0B 4WF9Q 2XHBA 1XQIA 1EQYA 1TKZA 2O66A 3EL2A 1K0TA 5IM0A 1XERA 2F9WA 1RBLA 1HARA 1FJGK 3ZT0A 2MY7A 1SV5A 4NLTA 4CJKA 3NS5A 2A6OA 2WVFA 1E6YB 1H74A 3MN9A 2A1RA 4X64F 5KFWA 3HSZA 4O0NA 3UD3P 2NXEA 5RUBA 3OW2M 4FYXB 2G1DA 4W5QA 1NJWA 5KFAA 1X4AA 4NMXA 4UY8T 2KI2A 5AE2A 3D2WA 2VICA 3QATA 4B1YB 5KFCA 2P9NA 1OKJA 2VBZA 4TVAB 1JKHB 2MLYA 2NS1B 4F4XA 2YWKA 4MQ3A 4GMJB 4E89A 3TA2A 3MFHA 3MM7B 2QWNA 5DZ6A 4KT0C 1YG0A 2Q0RA 1TK5A 1YXQA 1XMOF 2DRBA 3LM9A 1VQYA 5H1SQ 2RF2A 1QZ6A 1TKXB 3K5OA 4DSIA 4NLYA 3FCWA 2H48B 2YPZA 2B3TB 2XEXA 1YKWA 3HZGA 4QPXA 3G10A 2UXBJ 3SQ0A 4OPKA 2P9SB 4FYWB 5A8KA 2JOQA 5KOXA 4ECUA 1XEZA 1C0TA 2E5JA 3VAGA 3HM9A 1QHTA 4DTMA 4F8RA 1GOBA 2FVRA 3QMLA 4M5NA 2BW7A 2V63A 4LF9F 3GJTB 1KD1O 1S1VB 2QV6A 4R25A 2F9TA 1N5SA 2EG2A 4C2MA 1ZTTA 1SXLA 4RBTA 4E3SA 3PW2A 1FDBA 2R2SA 2YNIA 3W5XA 5CD4A 2HHPA 5GAHU 4O3QA 1UEKA 5H1SV 2H3EB 3HVWA 4K4YA 2ADBA 1WN7A 5G0RB 3LDOA 4ILGB 1DTTA 2FZKB 4OJRA 3KDOA 1KQFB 3D2FB 3ASMA 3AD7C 5L9NA 2WFBA 1OPIA 3OSNA 4WQ5C 1R0AA 1HJRA 1LWCA 4DL3A 4DV5K 2X74A 3NF6A 4OPHA 3OYDA 3OYMA 1G15A 5GAGP 1NDPA 4F4WA 3JB9k 1R0CB 3H20A 4KAZA 2J9DE 4EBCA 2RHKA 2HYIB 2YKMA 1XNRJ 2JZ5A 4YDDB 1QQNA 2X6SA 5CZVA 3ENOA 2ASMA 2WBRA 1GOAA 2UXBF 5ETPA 2ZJPL 5KFJA 2VBXA 1PJ5A 2HBJA 1KLMA 1KHVA 1TFWA 4LF6J 4FLVA 1NKCA 3SIPB 4BS2A 4WCEQ 1VYAA 4O3PA 3CFPA 2OIHA 4F4KA 1VR6A 7FDRA 3FZFA 2ZH7A 2QA4N 4DHVA 3PSFA 4OKJA 1U4BA 3ZT4A 1S5ZA 3R9LA 4KKOA 3FLCO 2UUBK 3VEOA 3HOTA 1VRTB 1F1BB 3RGIA 2JGUA 3Q2TC 1K8KA 4CF9A 3IXQA 4ZVEA 3R9PA 2FZGB 3GU0A 4DS4A 3MX5A 2G0CA 4X65J 3V81B 4CHYA 5HLFB 5DQGA 4OJ1A 2MKCA 2M7SA 3PW7A 3MOJB 1NGEA 2I2YA 5HRNA 4RW8A 2RQ4A 4CLFA 3HSTB 4R0EA 2I5JA 1G7CB 4CFAA 1H7XA 1IBKK 2K8GA 4NEYA 4YUDA 2HNZB 2H3GX 3OR2B 2HLUA 3H4DA 2VASA 4DL0C 3CD0A 3HT3A 1UKUA 2ZVSA 5L46A 2ZBPA 2R8KA 3C6UB 3CCJN 1FWKA 3IAYA 3HPGA 3DXMB 2O4IA 4AHCA 2OEJA 1HNWJ 3G71S 2W6KA 1VQKS 1M5SA 2HBMA 1QE1B 2FC0A 2KM8C 3EUNA 1F5AA 2AU0A 3K2PA 1XNRF 2BTFA 2XBPA 4TKTA 4LF8K 4YOUA 2CDRB 2CPYA 3CCEN 2IA0A 5DMRA 3HK2A 1HI8A 1RBUA 4IWVA 1M1HA 3DRXA 5CAAA 3C16A 4LF6F 1VS3A 4BDYA 4ED2A 5KT3A 1S4FA 4S0MA 3GE1A 2MZQA 3NOGA 4WXOA 4ZMMA 3KNAA 3RBXA 2JLEA 2DR5A 4Y1CA 4DLGA 3M2VB 1TP7A 3GJSB 3CHWA 4R79A 2XS2A 4CESA 1RAOA 4ZPAA 5KG4A 5ETMA 3PRDA 2O8FB 4D3GA 1F60B 2OCEA 3HLUA 3GV8B 3I87A 4QCLA 3ILIA 1VC6A 3CCZA 2LA6A 4RW6B 4XH4A 3L7PA 4F36A 2EC0A 2NQPA 3QNNA 3I0SB 1T94A 4UTGA 1V5VA 3M6UA 4KHWA 4QS8A 3EVMA 4Q2MA 3D68A 3E66A 2AIRB 1ZBFA 2OMLA 3K89A 1DJ0A 1Q9YA 2UV8A 4WFBQ 3SCXA 2DIVA 4NA1A 3FVYA 1VQ5S 5JS1A 3FK4A 1S79A 2QG9B 1HNWF 2BMBA 5E26A 2NRTA 4BR4A 3LDLA 1WC5A 4C3MA 3ZT2A 3PR4A 2DPNA 4A61A 2HAFA 4CD1A 4B8CA 3OHAA 4CJLA 2PC6A 2FVQA 3NBPA 2YPYA 4ITSA 4PXCA 5D0HA 4NLXA 1VQNS 1R89A 4DZ6A 3Q7BA 2DNZA 2JFKA 1VQOS 2V2QA 3EZ5A 4HTLA 4ED0A 4ISEA 1BQMA 5HK4A 2C3PA 1MWMA 1MN9A 1RDWX 2I6WA 4NCGA 4DSFA 3CQ8A 4A8QA 3R1XA 3M6GA 3UQSA 3RB6A 1KONA 3NWGA 2N7CA 2DKOB 1S4EA 1FJGJ 4AE5A 4KPYA 2DHHA 3N6NA 4CBUA 2HLTA 4LFBJ 1SH3A 3R7NB 3I8BA 4RW7B 4D3HA 2DNOA 3H59A 5JMVA 2VHGA 4LIWA 4OYAA 1LW0B 2R2RA 2J9CA 2ZE2A 1VQMN 4JEPA 4FZXC 2KN4A 1KTQA 1RTHA 1HBMA 1VK8A 3M8RA 1RJJA 3NCQA 3DRSB 4PUOB 5BN9A 4RNOA 3VMFB 1U24A 2D0CA 5C10A 4E1JA 2X7IA 1EQMA 2BKOA 1NLVA 3SBTA 4DCOB 1OVQA 4CYUB 4AD6A 1PKUA 1EARA 3LF0A 4OVLA 4USMA 4P74A 2SXLA 4K2JA 2V94A 4Y2KA 3VQTA 1UMJA 1TMMA 2W40A 1T3VA 4C0OC 1RU1A 3SQGA 4DU3A 3IUCA 1NGGA 3TNVA 1K6YA 1NZAA 4CTAB 5BR8K 1HBUA 4HCCA 2BDPA 3V4MA 1FJGF 3PR5B 2V4RA 1VQPS 4CZIA 1SQFA 1YJRA 3QBXA 4QU7A 3O3HA 3VQAA 2MKJA 5KFYA 4LFBF 4K42A 3ZZRA 2A6MA 3T5LA 4YR3A 3C3LA 2VG7B 5KGXA 4FPAA 2J7UA 4LD0A 4RW9A 2E66A 4OYWA 2M52A 2XMKA 3HVTB 4PWDA 2BE7D 5ETRA 4DV5J 1N32J 1S1TA 2NXCA 1JK9B 4DR3K 1WNEA 4HHJA 5GINA 3CD5A 1IWAA 3RW7A 5AQSA 2AV5A 3ZEUA 5M1PA 3TAFA 2X3GA 1PG5B 2WB4A 5IT4A 3SSQA 5J2QA 2M4MA 4KB7A 1U2CA 3C65A 2Y1RI 3EE8A 3MFIA 3KD5E 1IKXB 2LXUA 3AVCA 3MM8A 3OUYA 4FJ7A 1H6KX 4XIUA 2HQGA 2QT7A 3CSKA 2FBVA 2BUNA 4CH1A 1FEHA 3H98A 1KVKA 3MWBA 1NGJA 4N8OA 4BE1A 5CQGA 1P1LA 1V3SA 1RHQB 4I68A 3SUNA 2YBVA 3H46O 3CC2N 3P96A 3DXKA 2UV8G 3KK2B 3Q8SB 3KHRA 4H4MA 3M1VA 3NMAA 2CNNB 2UUBJ 3MX2A 3L3UA 1CC8A 4YORA 1GFWB 2O8BA 3WX4A 4WYLA 1R0BG 3UNGC 2HGLA 5C42B 1ZM3A 3O3LA 3SK3A 2B43A 2XMJA 5J2NA 1TKZB 4Z4FA 1HKGA 4U7BA 2PE8A 4CBXA 1LXNA 2JWLA 2C42A 2D5RA 4CLUA 4ISGA 2ZOFA 2YWEA 5KFHA 5ADZA 4MMOA 4IOBA 1W9HA 5FPEA 4DV5F 3MCOA 3QNWB 2HS0A 2XY5A 4EYIB 4X2BA 3HSJA 1IBKJ 3UI3A 3P4UB 1X0PA 1U2FA 1FDNA 3UR0A 1IUJA 4BRCA 4ED8A 4ZJQA 4OJGA 5FROA 3AGKA 3CIPA 4QS9A 3KNGA 4HI2A 4TU8A 2YWHA 3AB2B 4HACA 2FB0A 3SI8A 2XLIA 4WFYA 4LF8J 3WDOA 4M7XA 4WFNL 4LBPA 2IY5B 5F1XA 1J9AA 4DR1K 4CZHA 2CFXA 4PKDB 3JAMY 4J9UE 4KPCA 4BRAA 4ZVGA 3D1OA 4TLQA 2RDJA 1NUEA 3JAMU 1RTJA 3QIPB 5F8IA 1NJIO 4KRWA 1Y11A 2DPJA 4IFEA 1Z1ZA 2L9DA 2HK3A 4B1UB 2UUBF 2JRSA 2WCXA 4HDGA 3LPYA 3FE1A 3LAMA 2ZVIA 4OQJA 3AVKA 2U1AA 4KV8A 4ES3A 2CDQA 4ZKAA 1G99A 3BUZB 2QFJA 2A3ZA 3RRHA 2V8VA 4B9NA 1I3AA 5CY4A 4H5VA 1S49A 4FXVA 4C0BA 5CZ1A 2OPPA 3CJKA 4RUAA 3BP8A 4DV3K 1TL5A 3GILA 3ZETA 4HT5A 2K06A 3I56S 2ZWOA 3NF9A 1BI4B 4X4PA 1IBKF 2W9AA 3C15B 4ZCMA 1HNXK 4E7LA 4E7HA 1LWCB 3G8SA 5M1FA 4CNZA 2IDLA 1V4TA 3B54A 4C3LA 3W2VA 3W5YA 2HVZA 1NH7A 1SH2A 4A62A 2YNFA 2R7QA 4QW9A 4B3SK 4ZVPB 1CQNA 4LF8F 1S76D 3HP6A 4WYWA 4AXJA 5EXWA 4FPRA 2DIUA 2VG5B 5BRHA 3M6XA 4AXIA 3F73A 4EWTA 5CYMA 3TAPA 3CPWR 1JCEA 1TL4A 4H54A 1H72C 3QWPA 5BRFA 3MM9B 1S10A 4G9ZA 1JXLA 1NMEB 3AAQA 3OYFA 1XHZA 1F3FA 4O4RA 2W25A 1B99A 4QWCA 4RJVA 2QWLA 3TWZA 3T7ZA 2B8QA 2GQCA 2V8HA 3TVKA 2G0IA 4ILJA 2ETJA 5HL7Q 2MQNA 5KFMA 4ID5A 5CH7B 4H5NA 2NPFA 1NGIA 3V1OA 3GCXP 1BY9A 1IR2A 1UW9A 2MB0B 2ZGYA 3OR1A 2QKBA 2QLFB 2DXDA 1U1NA 1M5KC 1KD1T 4NLSA 4DMNA 2F3JA 4IO9Q 2Q3PA 3R3LA 4RW8B 3HHLB 4DV1K 3AB4B 1SKWA 4FM2A 3W60A 5KFQA 2AJQA 2AJFE 2UUTA 4DR7J 3VETA 4O55A 2YH1A 4FN5A 1Q8BA 1RTIB 5EWFA 2DGUA 1VBXA 4TYBA 1Y5IB 1JLEB 1S0VA 4NYFA 4PHTX 4TY8B 1S9EA 2DVIA 1RAJA 3T3FA 2DR8A 3AA2A 3OYIA 1T3NA 3TPQA 4DQQA 2J4RA 3ZXWA 4JI5K 2OGUA 4B9SA 1N54B 2OZMA 4QQBA 1VMBA 1SL1A 3Q89A 1VQ9N 2HFUA 2HRUA 4OJ3A 1U6BA 4BLGA 3LZJA 3CIMA 3MURP 1ITGA 2P2CB 3FKBA 1ZA1B 4URGA 2CZVC 2Q36A 4FLWA 5BR8J 3M7VA 4ATNA 5GAEP 1RAEB 5EWGA 2V4JA 2OP5A 3M1FA 3GV7B 1NM2A 4C8OA 1FNMA 3R7BB 4M45A 3QT6A 2KFYA 2ZZTA 3LGNA 4NA3A 2QWPA 1UA0A 4AM6A 2RE1A 4DR3J 2PZSA 2CQHA 1RT2B 1HHTP 4ECRA 4USKA 3V4IA 4DR7F 3FQKA 2ZUAA 4JLHA 3V5RA 1RDCA 1NG9A 4MKAA 5AXLA 2E1PA 4K4SA 4H5TA 1PGZA 2YHYA 5AQIA 1T05A 5E7OB 3NAHA 4Q2LA 4YMEA 3V6HA 4F25A 2OMOA 1YJ7A 1YWXA 3TSPA 3IMQJ 2RU3A 3BM7A 2XZDB 3CCMS 1GLJO 1FXRA 3NBPB 2CQCA 4CO4A 2O8DB 1S5JA 1WC4A 3IN5A 3UE5A 1NGCA 1SUQA 1D8ZA 4B17A 2FSKA 3SSRA 1TUWA 3P1GA 2UUAK 3LPTA 4CLSA 2GGPA 1BQMB 2XY7A 4O8KA 3CO0P 5BR8F 1ZZFA 2O5DA 3LQVA 4GVBA 1HQ2A 1S1WA 5IV4A 3PIOL 2XSJA 4K4WA 1X4CA 3BYPA 1NK9A 2LECA 5KT5A 3OT9A 4O44A 5D4PA 2ATQA 2BM1A 5J2MA 2NRXA 4NYNA 1RISA 4M63A 1HBOA 4AFFA 3V9ZA 2L48A 3FGUA 2R8GA 2FBXA 3D5MA 3RAXA 4PYAA 4DR3F 1WI6A 5DS7A 5ETQA 4CNYA 3LDQA 4LRAA 1CJTA 5GAHI 5DM7L 2ZE2B 1T9WA 2NRHA 3ALYA 3BYRA 3CULA 1UVMA 1HBMB 3MMJA 2HGMA 2YNHA 4KGKA 4KY3A 2DGXA 3LP1A 1U6ZA 4L76A 1CXUA 2NYIA 1BA0A 3QPIA 4C6AA 1MA9B 1V3RA 1E6VA 4ETZA 1HRHA 2EWSA 1UAWA 2MJNA 2UZAA 3W7BA 1MMLA 1MROA 2LQ5A 5EHHA 3CCVS 3NMRA 1VRUA 2DISA 3HZEA 1NU0A 3TZWA 3UCZP 2CKWA 1CJKA 1QY7A 1UJ4A 1RDUA 1VSMA 2ZHAA 4JI2K 4LRCA 2XMVA 4QYRA 4CK2A 1BIUA 4IXCA 2AKWB 5K14A 3PFEA 3NVKA 4USWA 1REVA 4KHUA 2WSEC 3EICA 3P5JA 4JV1A 3KWGA 2AEJA 2AA4A 3GG0A 1AUSL 2VZ9A 3FZ2A 1RAHB 4B9VA 1QUPA 4ECYA 4FWSA 1HBUB 1W0HA 2PSZA 1RZMA 2E1MC 4MYTA 1D09B 2ZH9A 3EGVA 2HEKA 1R8CA 4YP3A 4CHZA 4FS1A 3B6OA 2DEJA 1YBAA 3LP0B 3CPWM 3RTVA 5AZIA 4DB3A 1FX4A 1HNXJ 3TX8A 1A5VA 1SIWB 4B08A 4LRFA 4OYZA 3O9UA 4WFAL 1U2VB 1T9VA 2BJEA 3ZEUB 1KNZA 4LY7A 4O0IA 4E19A 4QOTA 2GAGC 5J2QB 1YT3A 2QEXN 3CJTA 2ZJQL 2ITMA 5IT9Y 2N3LA 3FCVA 3MM8B 4CF8A 4WIQA 2VC0A 3BSCA 3HKZD 2P5OA 1VQKN 1C1CA 1B7FA 4DTSA 5L1IA 5AQNA 3U3YA 5IT9U 5C2DA 4BE0A 2W2MP 3BZKA 3H5YA 2IBOA 3AA3A 1LW2A 4PQAA 1S6QA 4ZLNA 4NOHA 4Y6IA 1KVIA 2ZD1A 3DU6A 4W5TA 3GIMA 1ZAVA 2EX3A 1NK0A 1N5TA 2V9WA 4H4MB 1NDCA 4LRDA 2IJNA 1U48A 1Q8LA 4Z4CA 3TAMB 1T7PA 3H8YA 4IH7A 2VIHA 5J1EA 2RRNA 4OLPA 4ICLB 3AXMA 1RWWB 4F3OA 3OL7A 2VFSA 2QX0A 5K8NA 5IQQA 4B3MK 2GIRA 5JMNA 3NCPA 5HBMA 3NHGA 1HNXF 1YTUA 5HANA 1PCAA 4DJBA 4DV1J 3Q24A 3ENBA 3L2VA 1WSVA 4EYHB 4M5HA 2ZEJA 3NVMA 1FJCA 1X5TA 4E8UA 1VQ8N 3NGYA 3GJRB 2Q6CA 4OPJA 4WQ5A 1IBLK 2V2KA 5THWA 1Y10A 1Y0HA 1VQ5N 2QM1A 4HACB 3JS9A 5F0WA 1GLBG 4ISFA 4DL7A 3PX0A 2EK1A 4JI5J 4WYBA 3R5DA 4L3NA 1GAOA 4RUBA 5JVHQ 4WBFA 2UUCK 2LMIA 1VQ6N 3MWTA 4BREA 3PCOB 1SS6A 4BQZA 4K8RA 1HLWA 3SYZA 1VQNN 1S12A 1HBNA 3G82B 3JQMA 2E4LA 1VQON 5HROA 2VFVA 5LL6Z 5AFUH 4G1PA 1NGFA 5DGBA 1C0UA 4KV8B 1VHIA 3H7HB 2IVMA 5F9NA 3C14B 4H0YB 1RB0A 4CT9A 2JHEA 2XS5A 2MKYA 2FYXA 3PY8A 3A12A 1SB6A 3HRGA 5DQHA 2OPPB 3CJKB 3MD1A 4XH1A 4BRHA 2DHGA 4DV1F 3E2EA 3C0BA 4DR2K 1H2TZ 2O01C 3P4IA 1JXVA 4MIAA 1ZBIA 3CCUN 1WKJA 3EVWA 2MLZA 2EG1A 2CGJA 1LOUA 1RACB 4K5SA 1NJXA 3IP0A 4B3RK 2ZC4A 4KH1B 3THXA 1YIJS 1SC1B 2XRIA 2YNFB 2P5GA 2QKKA 4JI5F 1UWBA 5GADI 3N4WA 4H0XB 2RPIA 2QA4G 3U8XA 4MKYA 4OGEA 2OTLS 3PO5A 3TJAA 3MEKA 1S57A 2EFOA 1ZBTA 2BJ1A 4YOWA 2E20A 2E2NA 4JKDA 4E0DA 2UUAJ 1EXQA 5AR0A 3MAQA 3OTEA 3EJMA 1VSKA 1Q16B 1FD8A 3AO3A 2XLKA 4JD2A 1T03B 1H2UX 3I4HX 2EVZA 3MN5A 2A18A 3NL0A 2G8HA 4M5MA 3MMBA 1NJIT 1SKUB 4ID5B 2MDAA 5AQTA 2CG8A 2YX4A 4RZRA 1U26A 4U6PA 2CPEA 2NR0A 2LEPA 2Y0BB 5AQMA 3EPGA 3KXDA 3OR1B 1VQPN 4FJNA 1X5PA 2QWMA 2FSNA 2M3DA 2XMWA 4RO0A 4A2BA 5B09A 3VQ4A 1YI2N 4DL6A 3VAIA 4YDUC 3AHPA 1OY6A 1LFWA 3FQLA 1ZPVA 5B7WA 1FKPB 4YEAA 4DQSA 4FF3A 2DY1A 4CH7A 3HHLD 1X1PA 1DRZA 5BRDA 4LSZB 1FE0A 2KYZA 2QMXA 1NZ8A 4IOAL 4BDPA 1S9EB 4JI2J 3J81j 3U9DA 4Y34A 2PA3A 2Q0UA 4RBVA 2XO6A 4CLYA 3PX4A 4GV3A 4A8OA 3WXMB 4FCYA 2IRXA 4JBCA 3LPUA 1Q86O 3KHLA 4MFBA 1RWPB 2UUAF 4C8YA 3WT0A 2DH9A 5AE3A 1LNQA 2QWQA 3H3NO 2WB1D 1SJRA 3O4QA 4FJ9A 3CDEA 4WF9L 4RNHA 3CCLN 4IFVA 1IV0A 2Z57B 1URNA 3MECA 3Q8RB 2V4QA 2ASDA 2IBKA 3DGPA 4L3KA 3BKFA 1YAGA 2V4JB 3BY5A 1OMSA 5C25A 5K8MA 1E4FT 1S7HA 3KG1A 5AQPA 4J2AA 2KHOA 3BF3A 1F21A 4AHTA 3AVFA 2CG4A 5HMZA 4CWBA 3I55S 4O3SA 2JEGA 2KRRA 3CF5Q 5EGYA 1C0GA 2PFUA 2E9RX 3LGMA 2HSTA 4YOEA 3HTVA 3RSEB 3OYBA 1RHRB 3FEZA 4OKEA 2EKNA 4IG3A 1UW4A 4JAXA 3LP2A 1JLGB 3LGHA 1MN7A 1T05B 4LJMA 2XGPA 3O1BA 4JI2F 1DGKN 5L39A 2P1JA 1NEEA 1WLJA 4TSXA 1TAUA 4HT7A 3KUEA 4L74A 4FO0A 3WQUA 4CBWA 5EDWA 3MTJA 2HFSA 1IJFB 1UL3A 3W62A 2XY6A 3SFUA 5B0FA 1SUQB 5F0XA 4OHXA 5DG8A 3RJMB 4BVOA 4NYZA 4RNNA 4KE5A 4WE1A 2EC2A 2IFXA 4NRUA 3M8QA 1SJ3P 4IZ9A 1YJ9S 1S1WB 5JUMA 2XWXA 3Q8YA 4O44B 3KLEA 3IR5B 3E01B 3P3DA 4B3MJ 4ZIWA 3LA0A 4OHVA 3H42A 1HBOB 4Y0WA 1BDGA 2B4UA 2VWJA 1JNZB 4HTUA 4IJNA 2WZ1A 1CJTB 4PXEA 2RQCA 3HSGA 2YX7A 2JLGA 1ZXOA 1JCFA 2AJ1A 2H4WB 4LQ3A 1IBLJ 2YNHB 3OBIA 3VVTA 4BACA 3ZT1A 1RILA 2BRKA 3LP1B 3SDEA 4KO0B 1E6VB 1TV6A 1QSLA 4I6WA 2WVCA 1MROB 1UFKA 4P7VA 1VRUB 3VERA 4KB1A 3B82A 3CE8A 1XMBA 3CJ7A 3KKFA 1CJKB 2KZZA 4FLUA 4WCEL 4P10A 3EE3A 1U0SA 4KHMA 2HBZB 4EZ6A 2R7RA 4A5BA 4ERDA 2QC3A 2OD4A 4F0HA 4W90B 4Q8FA 5B0AA 5K14B 1X4DA 4Z37A 1REVB 2ZBCA 2KLAA 1CJUA 2K2PA 1NMNA 2UUWA 3LALA 3I5CA 1R31A 3K57A 3GPAA 2MZSA 1RT6A 1F5CA 4B3MF 3R5AA 1B9DA 3UD4P 1WUAA 1P27B 1OYDA 4DR2J 2ATLA 5FIIA 3K5PA 2NLXA 2LEBA 4LQ9A 2I7NA 2BQRA 5IWAK 2BJ3A 2GHWA 1P6TA 3TQ1A 1IBLF 2B9XA 3VZIA 3MR7A 3OVBA 4JN4A 4IFYA 2JVOA 4K59A 3W66A 3C6AA 1U8SA 2M8DB 3WNEA 3ULEA 4RWTA 3M6VA 4URSA 3TYTA 3G87A 2VWKA 3CCWA 5HOOA 4XO0A 1RLDA 2GAHC 1RWKB 1W2BR 1VK0A 2DTUA 1FRXA 3NGSA 2UUCF 2LU1A 4FVCA 4JKCA 3OBYA 5KG7A 1RQ0A 3QZ8A 3KIOA 4TYAA 1TYQA 2ABYA 3DLRA 1UA1A 3IS9B 5A2QY 1MSWD 1D4XA 4CF2A 3O8WA 4IOXA 3BH7B 2LVWA 3SSSA 4LRBA 2ZD1B 1IH7A 3M32A 3R2DJ 5A2QU 4O4GB 5MLCQ 4ZS6A 1RGVA 5M1OA 1RBAA 2FGOA 2VFRA 4A4JA 4J9SA 2UXDK 4DL2A 2OTJS 1HD1A 1ACMB 5LJWA 4NLVA 1N48A 2OSRA 5KTQA 4KAIA 1SIZA 1SL0A 2Y3YA 4LF5J 3OFGA 3NNAA 2R7OA 1WAFA 4W5OA 3K2YA 4DR2F 1Y5NB 3QBCA 4FKXA 5HQ8A 4WFBL 5HBMB 2YKAA 4ED1A 3MZIA 2W42A 4YHHK 1F9FA 1JLQB 3E8OA 4A57A 7AT1B 2PT0A 4IR9A 2ASLA 2OA8A 1KS2A 4TNOA 5L8RC 3MMCB 2FY8A 1S6PA 1VI7A 1WKLA 3GR0A 3HHLC 2XNRA 5C15A 5SZTA 1D0EA 1HMVA 1KSPA 3BPSP 4DPTA 3UE2A 1M1GA 1APSA 4ECXA 4H0VB 2GWJA 4OZ5A 4OYPA 3WBZA 4AILC 3QFWA 4ELUA 3VAHA 1WOQA 4JK7A 2ASJA 3A8EA 4KHNA 3HKWA 1YJWS 4P52A 3MPDA 4G3IA 3FEXB 4QZVB 1Y5LB 1SZ2A 3CCMN 4K4UA 2BVZA 4WQ4A 1CJVB 1Z05A 5KT4A 3FC9A 3GIRA 3CIZA 3CC7N 5IOLA 3CFRA 1HBNB 2LCWA 3WUHA 1PSDA 4EZ9A 1U1LA 2XCPA 4IOCL 3KLHB 4C3KA 1C0UB 1FRJA 3QSIA 3W61A 3M4XA 3TJ9A 3D66A 4EIAA 2I9SA 4EEYA 1S0MA 1VSJA 4CP5A 4Y3CA 1XMQK 4A47A 1ZOTA 3BBBA 3G4SN 2O8EA 3PJWA 1N34K 3O2IA 3ICLA 5I3PA 5T41A 4JKFA 4DR4K 4HHTA 4BWMA 3EMTA 2YHBA 1EKSA 3CDBA 3U3GA 3T1YK 4RX6A 1UTAA 2J6TA 1HWLA 4QOZB 2LYVA 2IJRA 3AA5X 3THXB 3IRWP 4OHWA 1XR5A 1W7AA 2C2MB 3UIQA 1TVRA 4CHOA 2J0SD 2RAQA 1U6FA 4RU9A 3ID8A 3MM6B 4PWWA 3R27A 5AE1A 5AQGA 1YLXA 1SL2A 1WSGA 4TY9A 5HJYA 3CCVN 3FUYA 4ZHRB 2G2OA 3ITHB 4DMZA 3FJ2A 3SAHA 4FWRA 2FJAB 3K58A 2OPRB 2DNLA 2Q3SA 2F8HA 4Y0FA 3MD3A 3AARA 1MU2A 2FTRA 2MQQA 5FPMA 4NLRA 5E2QA 4JD2B 1L3VA 3FCHA 4AHRA 2P9CA 3D3BJ 5CD4H 2EWHA 2QXLA 2MTLA 3OFFA 5M2RA 2O3DA 2W9BB 3ZSZA 3MMBB 2Z1HA 4R5PA 2HGNA 1RHMB 5FDLB 3UN2A 1JX4A 2XCAA 2B51A 3L4IA 2MKHA 3OVNA 2A2DA 1BQXA 3H1VX 4JRQA 4ZDNA 1QM9A 1M1KO 5FPDA 5T7LA 5MAOA 4ZVHA 4CEAA 2D7SA 2FLLA 3TWHA 4PYDA 4WIIA 4YB6A 3GCWP 5HQMA 5C24A 3IBCB 5H9FK 5LJ5Y 3D3CJ 1MMDA 2RUSA 3MXMA 4Q0BA 1KAYA 1RT4B 4XH5A 2H51B 1TUVA 4PG8A 2W6LA 2FJVA 1VSLA 1RDAA 1S1UA 2W2NP 4BG9A 1CULA 4PPDA 3BV8A 5GMEA 1AA1B 3OYJA 3H5UA 2B8PA 4M3WA 3VF0B 3UFCX 5F8LA 3M6WA 4JKEA 1RT5A 1CG2A 2CZ9A 1NCLA 2H9ZA 4F67A 2YQ0A 2IM0A 5AQQA 1SC4B 1REGX 3AOCA 3TTFA 2YH0A 2G8UA 4IFVB 3EYZA 1EP4A 1AYEA 1HI0P 3MECB 1XN9A 3PJ9A 1BHLA 2AP1A 1I1GA 3RRGA 3W63A 2FHMA 3D9BA 2OPQA 1R8BA 4KC5A 2N4CA 2A1SA 4FWKA 3UDLA 2CQPA 1TELA 1I6JA 2PO4A 4J9QA 1WD6A 1LFPA 4CIGA 5DZ7A 1GMUA 4JV2A 3OTOK 3DRRA 2FF3B 2W1BA 2APOA 3SFGA 2GZOA 4P75A 3LAKA 1HNIB 5IWAJ 3GG4A 4BGAA 4F2SA 3AD8C 3CETA 3OLAA 3VGMA 3RYLA 1WACA 5B0BA 4LVNP 4OLOA 4B02A 4CDIA 2AYBA 1NDKA 3IBWA 3CJAA 1PYOB 2HVDA 3H5XA 4IG3B 4FZYA 4FF2A 2MKKA 2IMWP 1IQZA 1WTFA 3HHEA 3PEJA 2DNGA 4DTPA 1FT8A 4ANCA 3U1NA 4JI8J 1WHVA 4J9RA 1S22A 1UEUA 1J6ZA 1Q5VA 3MAHA 2AGOA 1Q7YO 1RWXB 1XJWB 1S0OA 1VSFA 4DV7K 5I42B 3SUQA 4CGDA 5JXSA 5KQ8A 2R7YA 3NY0A 4ED5A 4ZJOA 2EPIA 1IBMK 2L9NA 2RB7A 1FRHA 1FF2A 1YVUA 2RU9A 4UZCA 4NLOA 3LW5C 1RDBA 1ZAWA 1D9FA 4O0JA 3DHXA 1Q86T 2P9SA 1HHQA 4KR0B 4BC2A 1ZBLA 2QL5B 1VDHA 3VGLA 4FM1A 5GAHP 1UOCA 2M70A 2HIYA 3F44A 4C7QA 3AVHA 5E3QA 2KKHA 4NWBA 2KH9A 2Y0SD 2IRUA 4QWBA 1TR0A 1TMJA 1FE4A 5IC4B 3H90A 4E98A 4M5KA 1AROP 3F56A 4YHHJ 5IWAF 3CXCR 2KQ2A 3UDVA 1GLEG 3D45A 2ZH1A 1WKKA 1YGYA 4DX6A 4ECWA 2M9KA 3NKYA 5T14A 4DWIA 4JKBA 2OFHX 2ASPA 3GTYX 5G0RA 3QAUA 1BISA 4A48A 2DY4A 3SPYA 2BXJA 1D9AA 3G96A 5FLXO 4YR2A 3D2FA 1RHJB 3TR5A 1YTAA 2Q66A 3J7AN 1SJQA 2Y1IA 3V9UA 3AH6A 5EUHA 1PIEA 5KPRA 4DTJA 5LSRA 1U47A 4KHPK 2D1KA 2GWKA 4E2FB 3EDRB 2NYHA 3H40A 1HKAA 5J2PA 1GK8A 2NLWA 4ZITA 1WC3A 4JI8F 5GVQA 4DF4A 2R7XA 5E84A 2GELA 5KG1A 3T1HK 4FYVB 2HVEA 3P45B 4U7UK 4ZTJA 2B0GA 3BKTA 3GFYA 3QGIA 2JVRA 3EGWB 5B08A 3KTQA 2OTLN 3MGJA 1DEJA 2HHXA 1OVYA 4NCAA 1DBDA 2UXDF 2Y1LB 5DJBA 4DQ8A 1KLNA 2N82B 5HL7L 2AF6A 4W4MA 3HFKA 5M2UA 2YJEA 3Q8UA 2LSNA 4N41A 1RWOB 1M5PC 2ZBQA 4UOCA 3MTKA 4Z7CA 4FJJA 1RT6B 2EBGA 2W2OP 3KK7A 3D7EO 3S6EA 3NEKA 4YHHF 4ZP6A 1C4AA 1GMVA 4FLTA 1SQGA 2AEMA 4KSEB 1T9YA 1VRTA 4R8UB 4V1Ak 1RK8A 3KYLA 4DR4J 4QR2A 1KVBA 4CLWA 1PAUB 3ZTPA 4X4UA 4CJVA 1NRKA 4DDFA 3X3UA 4LF2A 1D5AA 3VAJA 2CQBA 2BJ9A 4DV6K 3ULEB 1EO1A 3CGIA 4I6AA 1BWFO 1G3OA 5AZJA 2NUBA 1DZ5A 1N4LA 1H3DA 4GNIA 2ZDOA 2HNZA 1FEEA 3OR2A 4ZP8A 5ETKA 2NSBA 4P2FA 2VDHA 3DXMA 3G6XA 2DJWA 1TYQB 4C8NA 4QIVA 3GMGA 4C98A 3BREA 2R7WA 4CHQA 3SMSA 1H1VA 2EXUA 4HUFA 2CPFA 4DPUA 3IC1A 4AYBD 3DLJA 1NGBA 5CYQB 4K4XA 1HD0A 1HPZA 1EB0A 3VOVA 1YVNA 1FDDA 4BC4A 3CYMA 4CLZA 3V9SA 1XMQF 2GEMA 3US5A 3Q7CA 1NJZA 1N34F 4ZN3A 2GX8A 1PAEX 4JI6K 2NRRA 5B0CA 2MGZA 4DR4F 2G8FA 2O8FA 4F2RA 4HTIA 2NRZA 2GQ2A 2VBWA 1T11A 3T1YF 1XNQK 4PKHA 3G6VA 3R7SB 1PBAA 3GL1A 1S6PB 2GNKA 3I55N 4QIWD 1OH8A 3I0SA 3FSYA 4YR0A 2LLZA 4QYZK 5D4NA 5C0YA 3EKUA 2RUGA 1IN0A 1R7IA 3CEDA 3TAEA 3R1LA 1YJNN 4CIOA 1WNSA 3TARA 1B4SA 4DU4A 1BHNA 5ETLA 4UF4A 2E1CA 2J7WA 4DSKA 2R7UA 3CMQA 3G0ZA 3CJQA 3BJYA 3KK3B 2WK4A 3JSMB 4FW2A 5D8HB 2CJKA 2L9WA 1OQ6A 3CMES 5BXIA 3AO1A 3N6LA 2Z2MA 3UKRB 2CJYB 2GHPA 3OQ2A 4USTA 1I94K 4DXLA 4RTFD 3QJPA 4BQLA 3UN5A 3DLBA 5KFSA 2OELA 1ITPA 3NCIA 2DEIA 2ILYA 2BE2B 3N6MA 1ZS6A 1QQCA 4AM7A 3LH2S 2L41A 4CGGA 4DU1A 3OTOJ 2HNYB 1YJ9N 1C4CA 3VWSA 3IWNC 4F3QA 1CZAN 3RG6A 2HWIA 2Z1GA 5HSPA 3TP2A 4QAGA 2O8EB 3FBFA 1SPBP 1YF5L 2VYPA 1WF2A 3HOSA 3EO3A 2R42A 4B9QA 5GADP 4G6VB 4O5BA 4E7KA 3JTPA 2Z1IA 4YDUA 3IAS9 1ASVA 3OFHA 4RW7A 3EGZA 4V19X 1JIHA 2DHXA 4OX8A 3VALA 3CCSN 3ZX2A 1GXLA 4FW1A 3PYDA 4L3QA 1TVRB 3VPZA 3FRZA 2IPOB 3LWLA 4QIEA 2FJDB 4J90A 2VOOA 3AO2A 4DV7J 4LC9B 2PGCA 3L2RA 1MG7A 3SJHA 5C12A 4M3UA 2PMHA 4RLEA 3FDSA 1F2GA 1IBMJ 5CHCB 3QICA 2JX2A 3UCUP 4ZK7M 2B4VA 6FD1A 1BOTO 4PL7A 4N76A 2UXCK 4A8WA 3D2EB 1H2VZ 1MLAA 5EOYA 2OPSB 1S3XA 1TFYA 3UDCA 2CNLB 4PG4A 3OTOF 1VBZA 1VISA 3OXLA 2D3UA 3S7RA 4OX9K 4A5AA 4NEZA 4A59A 4ECSA 2DB1A 4CTAA 2R3VA 3ET6B 3WEEA 2P9GA 5T7LB 3NXZA 3F2KA 5KFLA 3NAIA 2VG7A 5C24B 3TANA 2J0XA 3BGUA 4Q0BB 4X4SA 4IH6A 5KFVA 3HVTA 4JHDA 2DR7A 2RHQB 4KHPJ 3CPEA 1WOOA 2IVOA 1NK8A 1CULB 3T1HJ 1KCFA 3RR7A 3CUNA 1Y7PA 2W4CA 3A3OB 3TZXA 4ZN1A 4DV7F 1WTBA 1EKRA 2IC3A 4ELVA 3S3OA 2C22A 4A8MP 3QT7A 3CCQS 1IBMF 1KBRA 3PIPQ 2DCUB 1U2RA 3HHDA 4XTTA 1RDDA 1XMOJ 1BWVA 1B0TA 4J2BA 2AD9A 4CFBA 4CGHA 2RT3A 5AQYA 4F4AA 4CD3A 1OS5A 8ATCB 2JLFA 1SC6A 5HMWA 1D9DA 4R0JA 2HWHA 1EP4B 4B9UA 3ZZUA 4BE2A 4FK4A 5KFBA 4KFBA 1MMNA 2CH6A 2OTJN 1A9NB 3KK2A 2KHCA 1RKJA 4CJ7A 5F8HA 1WSIA 3Q2SC 5KFRA 1QS4A 3DRRB 3OYKA 2K7JA 4C11A 4ECTA 1R27B 1GLDG 5C42A 4I67A 2CH5A 2ZWHA 1N52B 4YY3K 2GS8A 1I5OB 2NCKL 1VHFA 3KWMA 4DV6J 2QK9A 4OI4A 1U04A 1HQEB 2KFZA 3BF1A 2A6AA 1QD1A 3P39A 3NGZA 4KHPF 1M1KT 1B7YB 4Y00A 3ZX3A 2K3IA 3OVAA 5JVHL 2H1YA 4NX9A 3PW0A 3O3FA 5HVGA 3CWJA 3T1HF 2BEFA 4CM2A 1GLLO 4BC3A 2F8SA 5ETVA 3HD1A 3CMAN 2BX6A 2W4DA 3QINA 2CNKB 1HX1A 2A2CA 3OVSA 1GX6A 4K5RA 4DTUA 1IM6A 1KTVA 3G6ES 1ZPWX 4A8SA 2R2TA 4OIXA 1RWVB 1GXTA 1RE1B 3DRYA 1J5OB 1N36K 5KRSA 4RL1A 5M2PA 3N79A 4L8RB 1YJWN 4CEZA 4OYBA 2NXUA 1LWFB 3KMSA 1WWHA 1GLAG 4U9RA 2XY8A 4C4WA 2WUSA 1VC0A 1BCMA 2P51A 4PKIA 1ZM9A 3QIPA 2DRDA 3MCPA 3QZ7A 8RUCA 2HS3A 1IKVA 5ITHA 1OSCA 4JI6J 4NRTA 4IO8A 4FWLA 2PMZD 4IQXA 2CGLA 4GMKA 4M5GA 3I6PA 4NLUA 3JSYA 1DARA 2BACA 1T3OA 3O6WA 2RHSB 2FLNA 2UVUA 1XNQJ 3TAGA 1Q79A 3ZZOA 3PG9A 4JV0A 3ZSRA 5JLHA 5DG9A 3CD7A 4WU3A 2DNPA 4DV6F 3NE6A 4OJHA 4QYZJ 5CA5A 2ZUGA 2RS2A 1BI4A 1IQTA 3V9XA 4N8NA 2ZBRA 3C15A 3KHYA 2BZ2A 4OHYA 2MKIA 2E9ZA 2XNQA 2P9UA 3JTNA 5J2PB 5DG7A 1G1XA 2B5JB 4NLQA 3D1HA 3LM2A 2FC9A 1ASUA 4EBDA 2VG5A 2IM2A 5BPNA 3I8DA 4DTRA 2BRLA 2BE9B 2W24A 5LSOA 1I94J 1S1XB 2GUIA 3RBZA 2HBQB 3ADAC 4DR6K 3T5JA 3MM9A 1ELOA 3ATUA 4JK8A 1YSJA 1M90T 4JI6F 2DH7A 2Z2ZA 3VQDA 4I2QB 1RT7A 4ELTA 3NNCA 1X4GA 1XNQF 5HVHA 3U02A 2YX6A 2XI2A 2JWNA 1QDUB 1MDUB 1KQSR 1DFDA 1S7IA 3N9UC 4YB5A 4B3OA 3OY9A 1V6HA 1ZBUA 3EXCX 3NGKA 4MDAA 4AT1B 2DCLA 3OYAA 3HHLA 5KFIA 5AZJB 3UKUA 2V6AA 4CHPA 3AFGA 1KXPA 4LSNA 1S97A 4DUZK 3W1YC 3IGNA 3OL9A 1RTIA 2DFFA 2E44A 3SQ2A 1JLEA 2EI5A 4CQ1A 3TUJC 4TY8A 1NHVA 1X3NA 3OD2A 2UXCJ 3HPHA 5IS2A 1Q82O 1I94F 2J9EA 5A76A 3GV5B 2BJ8A 3KWIA 3PYFA 2KDOA 1F0XA 3GONA 3EXYA 1HPZB 1NPKA 3O5BA 4BC7A 2WBMA 4MAKA 5AQZA 3CG7A 4HTJA 1U49A 4DV4K 2G8VA 5ADXA 3M8YA 3FSIA 2WTFA 4OX9J 1HHSA 4CF0A 2YX1A 4BRNA 3OFEA 2ZBIA 4LH4A 2E5IA 2HF4A 3PSIA 3ZFVA 3CF5L 1NSKL 2MGZB 2A1BA 4CJTA 1TL7A 4M5DA 2VOPA 4RW4B 3A3NB 2DNMA 2JSXA 1CSJA 2D3O1 3O9RA 3J80Y 2QSWA 3H3OB 2LDIA 1OIAA 2AQ4A 3DJCA 4Y2IA 5CCLA 2AZ3A 2DNQA 1UPPA 2ALYB 2WBNA 3FMBA 2H4YB 3DCAA 3J80U 1HWKA 3DDIA 3BR8A 2B4PA 1RT2A 1CZBA 2E5GA 3ATVA 1ZETA 4ALZA 4CZEA 3QRQA 1UWAA 3BR9A 3GR1A 3BSAA 4C8KA 2LQ8A 3AOBA 2AGPA 4BRDA 3CCRS 1YTYA 3DWLA 6AT1B 5KAKA 4EMDA 2QA4S 5I3UB 3BDEA 2UXCF 3UN3A 1P9QC 4CZCA 3J81U 3OHBA 4CZLA 5IFMA 2YKQA 1BE4A 1RBSA 4WP9A 4OZNA 2O8DA 2KO1A 5FD1A 1Q78A 3WC0A 4GV6A 1UPMB 1U7LA 2YTCA 2RQKA 3JXOA 4OX9F 1LOTB 4LF7K 5KT6A 4DFPA 4M3XA 4RCHA 5AQHA 1X60A 2KJVA 2Z30B 2E2PA 1Y64A 1KQGB 5ETTA 4ID1A 3QYYA 4PXBA 4YY3J 3V2UC 1AXQA 4GC6A 2YWWA 4E1MA 3NAEA 2ZQBA 2KJWA 3BS9A 1YBUA 4FWQA 1H98A 1LWXA 2O1PA 4J5OA 2QYGA 3R5JB 2W4PA 3L2WA 3RMBA 3JSRA 1R43A 1VAZA 4LBIA 3CCES 1PJ6A 2GW8A 5A6PA 4JV5K 3NCRA 4YOVA 3ZZPA 1KR4A 5GADU 2EHGA 2QLBB 3ILJA 3MXIA 2PEBA 4DL4A 3GFHA 2CQ2A 1N36J 3OHRA 5L1LA 5BN8A 5EN1A 4FJ5A 2AX1A 1BCOA 4E7IA 1RTDA 1U1KA 3VQ8A 1K1QA 5AQVA 3Q23A 3CB4A 5AQUA 1KHWA 3SZ2A 1WEXA 4Z4HA 1NB7A 2YWGA 3CI5A 2MLXA 2YKNB 3HX9A 1BL3A 3VF4A 3M2UB 1B70B 5D78A 4EI2A 1IJEB 5IT0A 1T8EA 4HUEA 1O6XA 4FLYA 4JS4A 3VEWA 5AQOA 5AQXA 2FUG9 4YY3F 3M8ZA 4C97A 4CZJA 1BLUA 3TR8A 2VG6A 4KTQA 4X4TA 4JK9A 1FX2A 3VAFA 3WEEB 2OD6A 3KFWX 4ZPCA 1T6CA 1S72S 3AGRA 3L9ZA 5DM6Q 3BDPA 1GLFO 1SVDA 4Q44A 4Y28C 3LP0A 5HMXA 2DPIA 5KRTA 4FJGA 2F8EX 4IEEA 3CDUA 4DLEA 3Q8VA 4ZP7A 1QUVA 2C2DA 2QN6B 2CJ9A 2EBEA 3UPFA 4JHDB 3K5NA 2DITA 4ILRA 4PABA 1VLYA 2E5HA 3QEIA 3F41A 3SEOA 4E1NA 1JXEA 1U1OA 3E3XA 3VQ6A 2PMWA 1U2VA 5K9FA 1FRIA 1QAYA 1WC1A 2ILZA 1N36F 3VQEA 1DLOA 3W8PA 2IC3B 2BANA 2C3OA 2Q97A 1Q5YA 2WOMB 4C9DA 4FPBA 2GVDA 3AAWB 1KQSM 3A5NC 2CIMA 1X5OA 4DR6J 4DTXA 1RUSA 4USJC 5B8HA 1KFSA 3IR7B 3JQJA 2IDOA 1NOZA 1EKEA 4CO5A 3EVOA 4B9TA 3POTA 4KFBB 4M3RA 3V9WA 2BH1A 4OL8A 3P5BP 4FP9A 5EVZA 5LT5A 3FZHA 3TAMA 3HFVA 4C11B 4P6QA 5DDPC 4ICLA 3DLGA 2RH3A 3MI7X 2KHDA 3R2CJ 3TO8A 3A4TA 2HSEB 1SC3B 3JQKA 2RSQA 5L38A 3IO1A 3OA9A 5DM7Q 3VF2A 1O0PA 1V9OA 2P9IA 1HI1A 5L1JA 5LJVA 1EWRA 2AHOB 5HVFA 4NLCA 4XDCA 4H4OA 4IJAA 5D15A 4DR5K 1LKZA 4KH4A 3PTWA 2F9JA 1LAVA 4PAAA 4DUZJ 2IRYA 3PFOA 1IO2A 2I38A 4OI0A 2CJBA 3BQ0A 3RBEA 4FWOA 4ZLJA 2JJ4D 4C1NK 2HHTA 5HAOA 5B0DA 4ZPTR 1R8AA 2ZM6K 4DR6F 4I69A 2HBYB 3VAKA 4JI7K 2KL8A 4B1XB 3CMEN 1B0PA 3TUIC 4K25A 2IDEA 1W7WA 2HQFA 4LF9K 1WOPA 1TL3B 2WONB 4DV4J 2ROPA 2DYAA 5KG2A 1JLBA 3IWLA 3G82A 2J6SA 2GJ2A 2NSCA 1IKVB 1J5EK 2FLPA 3SQ4A 4CCHA 2VL1A 4FXDA 3IFRA 3SPZA 4OZLA 3HULA 3C14A 4U7CA 2KXFA 5DRKA 2RVJA 1N33K 3HJVA 2RE2A 1C6VA 5LJ3Y 4ENOA 3HJFA 1W25A 5E41A 4M3ZA 4WK3A 4FWMA 5CR4A 2GBZA 1R8PA 3CO9A 2D3ZA 3P5TL 2CPJA 4WFAQ 4KH5