5FDLA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with idx899
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
550
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords P51 Reverse transcriptase
publication title Discovery of the Aryl-phospho-indole IDX899, a Highly Potent Anti-HIV Non-nucleoside Reverse Transcriptase Inhibitor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 144
structure length 550
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5fdlA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5fdlA05
2BQ3A 1FXXA 3OHBA 4W5QA 4J9MA 2O4IA 3L2QA 4Z4HA 3NE6A 1ZBHA 3KJVA 3MEEB 2C22A 1NK7A 5D3GB 4CJRA 4HUEA 3THVA 3BJYA 1JX4A 3F9KA 2XI2A 3QEXA 3N6LA 2FBTA 1RT3A 4Z4EA 3V6KA 1RT1B 2YNFB 2JC0A 3G86A 1SL0A 2PY5A 4JRQA 3HVTB 4GW6A 1HNVB 4I7FA 2X78A 3H98A 4MFBA 4O3NA 1KVCA 4O3QA 4NYZA 3DM2A 3OYKA 1JLQB 4IG3A 1YVFA 2AU0A 5KFZA 2ATLA 2HHXA 1REVB 2B5JB 3TAMA 3LPTA 2KTQA 2P51A 4LH5A 5KT5A 1ZBLA 2ILZA 4CJPA 4IRCA 4CECA 5KFLA 4MK8A 5DG8A 4CHNA 2FBVA 4GC7A 1W9HA 3MECB 5F9LA 5J2MB 2BGGA 1W25A 3OYAA 3FFIB 5KFIA 4FM2A 3FSIA 3VQ5A 3JSMA 1S6QA 1RT7A 4KB7A 2P5OA 3DLKA 3K58A 2ILYA 4LQ3A 1TKXB 4R5PA 3CIZA 4DTMA 1TL3A 3L2UA 4FK0A 1SV5A 3C94A 1NJWA 3WNFA 3E51A 4C8NA 1CZ9A 4ED3A 4KHMA 4Q45A 4NLWA 1KFDA 4Z0UA 3KLHA 4FJ7A 1HQEB 5J2QB 1T3NA 2YNHA 3EPIA 5FDLB 3MR2A 1GOAA 4Q0BA 2ALZA 5I42A 3MR3A 4KSEB 3HPGA 3LWMA 3TAGA 3V6JA 1WAJA 5KFVA 4M94A 2R2SA 3OL7A 5F8LA 1S0MA 4CJUA 3K5NA 3H5UA 1KHWA 1GX5A 2I5JB 3SUPA 3ZT0A 5L9XA 3EZ5A 1HQUA 5CYQA 4OL8A 1ITGA 2HMIB 2VA3A 2XCAA 1XC9A 1JKHB 2W42A 1S6PA 5HROA 2HNDB 4DSFA 1HQEA 2DY4A 4CESA 3DLGA 4B08A 4IRKA 3OL9A 3TAEA 4DSKA 4N76A 3KLFA 3I0SA 4QWEA 4EYHB 2YV0X 4CFCA 3CWJA 1FKOB 4ZP7A 5C24A 3A2FA 4TLRA 5KFDA 4E1NA 1S5JA 5J2PB 4AHVA 4WXOA 4NLSA 3V1RA 1QSSA 1JLBA 3LP1A 3T5KA 3WNEA 3QO9B 2VG5A 1X1PA 4AHUA 2RPIA 1VSIA 1W0HA 1NHUA 2GIQA 3IAYA 1QTMA 3SI8A 3MXIA 3NH1A 1S1XB 3H40A 1BQMA 4WXWA 3CVKA 1SKSA 4ZHRB 3D0PA 4Y2CA 3GIJA 4ECVA 4RW8A 4OGCA 4DTPA 3ISNC 4M3XA 2FLNA 3LZIA 4FCYA 4HHTA 3H5SA 4QCLA 4RW9A 2AGPA 4BE2A 1C1BA 2XCPA 3RMCA 2ZQBA 3GIMA 3H4DA 3AV9A 5KG2A 2B4JA 4PWDA 4F2RA 4DG1A 4GMJB 1C0TB 3ZT2A 2J6TA 4FW1A 4DL2A 2IBKA 2FVRA 1TV6B 1NOYA 3QZ7A 4IR1A 4XPCA 1JLGA 2KZZA 4Z4IA 2IM2A 4ECSA 4MKAA 5F8HA 1A5XA 4F4YA 2FC0A 4O4GB 3BR9A 3HVWA 3SYZA 1QSYA 4BDPA 1S1WA 4FJJA 3QYYA 4CJFA 2OZMA 1O1WA 2XY6A 4WE1B 3OYLA 3AVNA 4AHCA 3PHEA 4CGHA 3Q8RB 2XGPA 3SFGA 1RDRA 1KLNA 5J1EA 1L3VA 2HNYB 1CZBA 4KB0A 4K4SA 2O4GA 3ZSVA 4O3OA 3KHLA 1QAIA 2YNIA 4FZYA 1TKZB 2P5GA 1XI1A 1S9EB 4DSJA 2HVIA 3SQ4A 4PUOB 2LSNA 3K59A 5KFCA 5HP1B 3ISND 2WONA 1EX4A 2D0CA 5I3UA 4WFYA 4J2EA 4MH8A 1JIHA 2FVSA 2E9ZA 3DOKA 5C42B 4CHQA 1KLMA 4QWCA 4FJNA 4O3RA 3TABA 4FK4A 4KHYA 3V1QA 1C1CB 4ELUA 4DQIA 2W7PA 4MIAA 3EPGA 4CJ3A 2BQRA 4DQPA 4MK9A 5K14A 2KZMA 1IO2A 1BI4B 3CFRA 3MEDA 4HKQA 5F8GA 3SUQA 4IQXA 3ZSRA 5CY4A 3EY1A 4RW7B 2IJNA 1QHTA 1LWFA 3KD1E 4TXSA 2VWJA 3N6MA 3LAMA 2UUTA 5KRTA 5HRRA 2I1RA 2QV6A 3QGHA 4K4ZA 1IKXB 4QWBA 4DTOA 4Q8FA 1LWCB 2IGIA 1LW0B 1S1UA 4HCCA 3JYTA 2D0AA 2ASJA 4FLVA 2G8KA 4CEDA 1VRUA 4WYWA 2R8KA 3SFUA 4DS5A 2YHAA 4L8RB 1S1VB 4IH5A 3TAQA 4DSIA 3M9MB 1WLJA 3KKRA 4K4UA 4RNOA 3L8BA 3RMDA 1IKWB 2ZD1B 2XRIA 1DTTA 4LD0A 1C0MA 4E3SA 1TKTB 3NBPB 1HYSA 3AA5X 3BSOA 5DMRA 4DFJA 2E6MA 5HRNA 4CJLA 4HCBA 3KK3B 3SUNA 4H54A 1FK9A 1WN7A 1RT6B 4FXDA 4M3ZA 1ZYQA 3T1AA 3CJ4A 4C8LA 3HL8A 1S9GA 4TY8A 1EP4A 1EETB 1RBTA 2OPRA 1Q8IA 3V6HA 3PY8A 3O3GA 3IS9B 3CYMA 3QGGA 2X6NA 1N5YB 2AWZA 2DFFA 3ZT4A 4EO8A 5JS1A 4KHRA 3QLHB 4FVMA 3QINA 1QE1B 4NYNA 3VQ8A 3SUOA 4FZXC 5CYMA 5E41A 4EZ6A 3KK3A 1S9FA 4QW8A 4Q44A 3U3GA 2WRMA 1RTHA 2BR0A 4F2SA 2E9RX 3I0RA 3VN5A 1IKVB 1U04A 2PZSA 1NK9A 2FVCA 4I2QB 2XHBA 2HHWA 5C25A 1U47A 1UOCA 1C1AA 3RR7A 2G8HA 4IFYA 4G1QA 3NHGA 4DL4A 3CQ8A 1NJZA 4DF4A 3Q8SB 3HSTB 4B9LA 5KT2A 3LP2B 3KLGB 3MF5A 3I8DA 4IKFA 4IG0B 1R0AB 3S3MA 3DRSB 3BQ1A 1K6YA 2AQ4A 4DSEA 4J9LA 2YKMB 1Y97A 3OJSA 4ED6A 1TK8A 2D41A 4Y1DA 4CGFA 3E01A 3DLEB 4YR3A 4WZMA 3VQQA 4KO0B 2JEFA 3VQDA 4LQ9A 4NYFA 4R8UB 3KNAA 3N6NA 4DMNA 2G8UA 1UWBB 3C6TA 2ZE2A 3PV8A 2DPJA 4TQSA 2FVPA 2BE2A 3M8QB 1OS5A 1NK6A 1XR5A 1I3AA 3CJ2A 1N4LA 2YKNB 4IFVB 3OHAA 3I5AA 3H08A 4M41A 4H4OB 4R0EA 2JLEA 4AILC 2HW3A 2D5RA 3OYBA 3V4IA 1BISA 3O4QA 4KHSA 2YHBA 3ITHA 2DFEA 5KFBA 3C6UA 1CXQA 3IRXA 2HHTA 4IBNA 2C28A 1QS4A 4CERA 5KFEA 2RKIB 2ZKUA 4RW4A 2OPPB 1JLCA 1EKEA 2FJWA 3GV8B 2R8GA 4Y1CA 3S3OA 2RDIA 1T03B 1KRPA 2AGOA 4EZ9A 4J9RA 3OSNA 2G8WA 2A1SA 4CGJA 5L1IA 2Z1GA 3ZSZA 4N41A 2B6AA 5HBMB 4QAGA 3G6YA 1U45A 2F8SA 4E7KA 2YNGA 4N56A 5DGBA 1D8YA 2W9BA 1RTDB 3RBDA 4DWIA 4HUFA 1TK5A 4ZTFA 4LSNA 1HNIA 3GYNA 1LAWA 5KG4A 4XPEA 1JLFB 4ZPDA 1IG9A 4NLTA 3F73A 4BDZA 2G8FA 2W9AA 1KTQA 3NGYA 4UQGA 1A5VA 3CM5A 1FKPB 4CFAA 2VG7A 2Q3SA 3V9WA 1NK8A 4DFMA 2V4RA 1RTJA 4NLQA 1BCOA 1VSMA 3MFIA 3IGVA 3OYCA 3SZ2A 4Z4CA 4DFPA 4ZMMA 3K2PA 3OYEA 4IDKB 4ID5B 3V81B 4QW9A 4ELVA 1Z4UA 3NGZA 4NLDA 2XWYA 4NLXA 1NOZA 3MEEA 5D3GA 4RNMA 3IN5A 4JV0A 4KI4A 3HM9A 2QKKA 1IKYB 1ASVA 3L2WA 3P5JA 1S10A 1Q9YA 1ZBIA 4CJTA 3NH2A 4DQQA 2PYLA 3SNNA 1RT1A 3OL6A 2YNFA 5KFJA 4DU1A 5F8JA 3IG1B 3TANA 3HVTA 1VRTB 3KK1B 1HNVA 3ZSXA 3ULDA 4FBUA 1RT2B 1JXBA 3AO3A 4J9NA 4CGIA 4CF2A 4OPKA 2ETJA 1VSJA 3PVXA 1JLQA 4E7LA 4CEBA 2W9CB 4I9LA 3DI6B 4BWJA 2UVWA 3NF7A 3NFAA 1REVA 2B5JA 4C8MA 4BE0A 3AVKA 2V9WA 4TN2A 1NNDA 4ECRA 5KG3A 4B9TA 5DG9A 3RTVA 4IH7A 3WNHA 2HNZB 2D0BA 2ATQA 1SUQB 3HVRA 4QOZB 3MECA 3P1GA 5J2MA 2JEIA 3AA3A 4GC6A 4FJ8A 3FFIA 1Q9XA 3MFHA 1LW2B 4ICLB 4JUZA 3O3FA 1T05B 1IM4A 1YT3A 5KFTA 3AVLA 1TKXA 4NLYA 3DDKA 2R2RA 1RBSA 1J9AA 1TAUA 4J9SA 1RDBA 3UIQA 4CHPA 1NJYA 3L3VA 4IKAA 3KKSA 1RDCA 3HHKA 4TSXA 4HTUA 5J2QA 3V1OA 3HP6A 5FDLA 1J54A 1WSGA 5HLFB 3PR4A 5L1JA 1TK0A 2IC3B 2VWKA 5DK5A 1ZBFA 3B6PA 1WNEA 3D5MA 1X9WA 3MR6A 3RR8A 2V4QA 1WSHA 3C95A 4NLVA 4NZ0A 2W8KA 4U6PA 4NLRA 2FJXA 3KK2B 2GC8A 1JLAB 4WFXA 4ZP6A 3PW5A 2I5JA 3H59A 4Z4FA 3AVAA 3SQ0A 1TL1B 2HMIA 4YQWA 1JKHA 4F4ZA 1RT4B 4N5SA 3ZT3A 2HNDA 3BREA 4Y34A 3UR0A 3NH0A 2NUBA 4JS4A 4RNNA 4K8XA 3MR5A 3LP3A 1RDAA 3K5OA 5KT6A 2ITGA 5EU7A 4NRUA 1FKOA 1D0EA 1JXLA 1I39A 5J2PA 3KLEB 4KAZA 4E7HA 3NL0A 4KPYA 5KFMA 2BQUA 3DRPB 4OKKA 3QO9A 3PUFA 3CG7A 3PJXA 4GVMA 5HRSA 3QZ8A 1SH0A 3AA2A 5FRNA 1G15A 3S3NA 2FLLA 3RWUA 3G10A 3VQEA 4CJQA 3DLBA 4EYIB 1SH2A 4M3RA 1S1XA 1VK0A 4I2PB 4J9KA 4KHWA 5KG6A 4CIFA 3O4NA 4B9UA 1YVUA 4ZHRA 2XY8A 3M8PB 4EP5A 1HYVA 3PW0A 4PA1A 4J2AA 2HAIA 4DSLA 3TI0A 4CF1A 4WYLA 3KHHA 3CDEA 1RBVA 2UUWA 4IOBA 4ECYA 5KFYA 3RRHA 3DMJB 3GQCA 2KQ2A 1C0TA 3DOLB 1RT5B 2FBXA 1TV6A 1LAVA 5T7BA 3EYZA 4B3OB 3SPYA 2E4LA 3RMBA 4F3OA 5J2NB 4O4GA 3EZUA 3ASMA 4M45A 4CJKA 3QEWA 2FBYA 2IMWP 4ECTA 4FJMA 3LP0B 4KV8B 1SL1A 4NCAA 3ZSQA 4WE1A 5F8MA 1DLOB 4ECQA 1XR6A 4M3WA 1C0UB 4F3TA 3AO5A 3KLIB 3PZPA 1T7PA 4O44B 2HNYA 1KVAA 2CKWA 1ASWA 2RF2B 2BRLA 3LZJA 3VA0A 1TAQA 1S0NA 1TVRB 1TKZA 4ID1A 3RRGA 4ECXA 1S9EA 4CFBA 1GOCA 2OPSB 5KRSA 4J2BA 3V9XA 2XY7A 1HPZB 4BACA 4YNQA 4PUOA 3CFOA 4ZPAA 4O3PA 5HP1A 4YFUA 2HHQA 3KTQA 5FRMA 5HRPA 4FJ5A 1S0OA 2OPQB 2Z1HA 4Y3CA 4ZVFA 3K5LA 5C42A 2OYQA 4CF0A 4FM1A 3QESA 4CGGA 1C2PA 3UQSA 1BL3A 4PQUB 1C1CA 1N6QB 4BDYA 4B9NA 1KVBA 1ZETA 2PYJA 4QPXA 2WCXA 3QIDA 5SZTA 4KRFA 4JRPA 4FLUA 1NKEA 1BI4A 4MQ3A 4KREA 4CK2A 3OS2A 3HO1A 3NF9A 4RW7A 1GOBA 4ECZA 4ED1A 1VSDA 4FW2A 1J5OB 4O0JA 3SV3A 4CEQA 3KHGA 1T8EA 2EC0A 1L3TA 1B92A 2A1RA 1IKXA 4XIUA 3BGRB 3MAQA 3CDWA 1LWCA 2KFNA 3NGDA 5KFOA 1LW0A 3HT3A 3V9UA 3H5YA 4J9QA 2HVHA 3SI6A 1B9FA 4WFZA 4DL7A 4DL3A 3ZCMA 2JEJA 4ZPCA 4CE9A 4B8AB 3OVNA 5DG7A 1S1VA 4CHOA 3BQ0A 1D9FA 4FM0A 3AVIA 1TGOA 1IKWA 2ZD1A 5JXSA 4F8RA 3HVAA 3PW2A 4CIGA 3T5JA 3TQ1A 1GX6A 3AVGA 1TKTA 3NBPA 4E1MA 3CFPA 4KHNA 2BRKA 2XY5A 4FJXA 2BDPA 2B43A 4ZVEA 4M95A 5C5JA 1RT6A 2Z1IA 4U7CA 2XO7A 4FJHA 3T19A 4KFBB 1CXUA 1RTIB 3V9SA 3GV7B 1EETA 3VQBA 1DTQB 2IJFA 3B6OA 4KHQA 3IS9A 3TAPA 3RBEA 4CGDA 3OSPA 1N5YA 3RB0A 4TYAA 4B8CA 4ED8A 1BQNB 4OGEA 3QLHA 1QE1A 3QIPB 4TQRA 1S48A 3LALA 4RW6B 4BWMA 2IM0A 4FLZA 3MEGB 4C8OA 2WOMB 2V0NA 4NRTA 5KG7A 1LWEB 3NGIA 1IKVA 3T5HA 2G8VA 2W8LA 2W7OA 1VSKA 4NCGB 2ASDA 2E9TA 1NK4A 1WSFA 4I2QA 3OYJA 1WAFA 3OLBA 3H5XA 4TYBA 4YR2A 4FBTA 4DS4A 4CJEA 3BSAA 2D7SA 1RCHA 4FS2A 3OYNA 3HJFA 3DRRB 4H4MB 3LP2A 3KLGA 1S1TB 1BIUA 2VG6B 4IG0A 1R0AA 3IGNA 2Y1IA 3KMQA 3DRSA 1NKBA 1HMVB 4FLYA 4KKOB 4LSLB 3V6DB 3NAIA 2YKMA 4YP3A 3QGIA 2IAJB 2BANB 4F50A 3DLEA 4O55A 1TQLA 3UDLA 3QNOA 4KO0A 4FJIA 5KFAA 2FJVA 4R8UA 4KTWA 3KJVB 5DQGA 3NMAA 1UWBA 3G6XA 4JV2A 4HYKA 4CEOA 2IA6A 3M8QA 4W5NA 4HVJA 3GV5B 1RNHA 3H4BA 2D3UA 2YKNA 2O5DA 4IFVA 1RT3B 4H4OA 3GILA 5KFHA 1BCMA 4I7FB 3VQAA 4URGA 4FS1A 4MFBB 4LH4A 3DM2B 3RB6A 3HPOA 1HYZA 2RKIA 3CJ3A 4IG3B 3OS1A 3RAQA 4CJWA 3DLHA 2OPPA 3TAMB 3WNGA 3PX0A 3KHRA 2DPIA 2WB4A 2HHUA 1VSFA 4M3YA 1TP7A 1T03A 5EUHA 1RILA 4FK2A 3HP9A 5KTQA 3G0ZA 4OVLA 4FJLA 2XC9A 3U6FA 3LAKA 2Z1JA 5HBMA 4W5RA 4NLPA 4KAIA 3SPZA 5KG0A 4AHSA 3M9OB 4YR0A 1BGXT 5DQHA 2WK4A 4CF8A 1RTDA 1NK5A 3JSMB 3O3HA 1S6QB 1RT7B 2UVVA 1S97A 4DL6A 1JLFA 3DLKB 2Y1JA 5L1LA 4R5PB 1KCFA 4X2BA 1TL3B 1L5UA 1SV5B 3NAHA 3VQSA 2UVRA 5EWFA 2FVQA 3MXMA 2QE5A 1FKPA 5DGAA 4ZPBA 3OYIA 3OLAA 3L3UA 4RU9A 3FQKA 1RAJA 3KLHB 4DLEA 4PY5A 2C2EA 4NLGA 2YNHB 3QEVA 3BSCA 4Q0BB 5EDWA 4CEZA 5I42B 4AHRA 1K1SA 4IDKA 4ID5A 3V81A 1JXEA 3D28A 3FRZA 4AH9A 2QK9A 1VSLA 3HXMA 3HYFA 1XHZA 2HHVA 2X74A 4EO6A 4OJRA 1IKYA 4CJSA 4DU4A 3BDPA 2GV9A 3RB3A 2IM3A 1UAXA 3NF6A 1HQUB 4ED7A 5CYQB 1XR7A 3OYDA 3IG1A 1VRTA 3KK1A 1RT2A 3PW4A 1S6PB 5HROB 3KOAA 3DLGB 5F8NA 4CF9A 4WZQA 1KFSA 4FJ9A 4KHUA 4TY9A 2W9CA 3DI6A 4ED0A 3KLFB 3I0SB 3L2RA 4DTNA 4KB1A 4J9OA 2R7YA 1BIZA 5C24B 2IOCA 4KBIA 4CJVA 5KT4A 1RA7A 3RMAA 1VSHA 2QKBA 3T3FA 4IR9A 4DTRA 3P83D 1JLBB 3LP1B 2HNZA 4Q43A 5DLGA 1SUQA 4HUGA 2VG5B 2ASLA 2VA2A 1QQCA 5DQIA 5JS2A 4EBDA 1KHVA 4URSA 4K50A 1TKDA 1LW2A 4FZZA 4ICLA 1BQMB 3VQCA 1T05A 1N56A 3QERA 4RW8B 1U4BA 1WSEA 4MIBA 4CHYA 1I6JA 3KD5E 4RZRA 1C6VA 1SKRA 4RW9B 1ASUA 4ZP8A 3OJUA 3PX4A 5KFUA 1C1BB 4DTXA 2JEGA 4PWDB 2AJQA 1S4FA 1KSPA 1VSEA 1MU2B 4DG1B 4EP4A 4Z4GA 1D5AA 5HLFA 4JS5A 2G8IA 2IC3A 3RB4A 1L3UA 1K1QA 3CDUA 3OL8A 3S9HA 1JLGB 1D9DA 3PJWA 4Q8EA 5KFXA 1S1WB 3SJJA 4FLWA 4IH6A 2OA8A 3KK2A 4DQSA 1JLAA 4C8KA 5EWEA 4XO0A 4URQU 3ZSYA 3OYGA 4F4WA 2KW4A 5KGWA 1TL1A 4B9MA 4M3TA 3NDKA 5KI6A 2AGQA 1RT4A 3CM6A 3VQ4A 3QIOA 4I9QA 5L1KA 5J1EB 4F4XA 2XGQA 1WSIA 4B9VA 1MU2A 4KI6A 4DLGA 4O5BA 2J6UA 3HKWA 2YNIB 4RNHA 4CCHA 1RA6A 1U09A 3KLEA 2X6SA 1XHXA 1U49A 5KG5A 2R8IA 5KFKA 1SH3A 4EBEA 2IDOA 2R8HA 1L3SA 4O0IA 2AX0A 3DRPA 1NK0A 3OS0A 2WONB 3AO2A 3V9ZA 5I3UB 1D1UA 4E0DA 4ZVHA 3PO4A 2OZSA 3DOKB 1KLMB 5KG1A 4I2PA 4LY7A 3AVFA 2AX1A 4KTQA 3M8PA 3G6VA 4E7IA 5EWGA 4KE5A 5K14B 3GIKA 4FYDA 3MEDB 1EXQA 3GIIA 1JL2A 2HWIA 3I5CA 4QWDA 1Z26A 5CZ2A 3DMJA 1UA0A 4W5OA 3U3YA 2IM1A 1JLEB 1RDDA 3DOLA 1RT5A 4RNFA 1LWFB 4FLXA 5KFRA 4B3OA 4CEEA 4K4YA 4CJ4A 1J53A 3QEPA 5J2NA 3Q8QB 2C2RA 4NLUA 3BQ2A 2RN2A 4ZP9A 2C2DA 3LP0A 4KV8A 3ALYA 1UA1A 1S1UB 3BSNA 4E7JA 2IS3A 1NKCA 4BE1A 4M3UA 4ED2A 2JGUA 3HPHA 3JYTB 1DLOA 3AVCA 4RG8A 1C0UA 2R2TA 2R2UA 3VQ9A 4CJ5A 3KLIA 1VRUB 4O44A 1YTAA 4DTUA 4ECUA 3VQ7A 4G3IA 2DFHA 2RF2A 4CHZA 4OPJA 4J2DA 3QNNA 1X9SA 1JLEA 1DTTB 1SL2A 1IH7A 3K5MA 1TVRA 5JUMA 1N48A 4M42A 4NLOA 1RYSA 3VA3A 1HYSB 4EEYA 2EHGA 5KFWA 4W5TA 3ICLA 2OPSA 4DEZA 1HPZA 3QEIA 4DU3A 1JL1A 4E89A 3NKYA 3VQ6A 1QAJA 1FK9B 3CO9A 2OPQA 4DL5A 1ZBUA 3SV4A 3I5BA 1S9GB 5F8IA 4TY8B 1EP4B 1ZTWA 1NJXA 3AA4A 2OPRB 3AVHA 4PQUA 1N6QA 2FLPA 4CFDA 4DQRA 3LANA 2F8EX 5KFQA 3SQ2A 3AO4A 4K4TA 3MXJA 5SWMA 5CYMB 1RBRA 1RBUA 4CK1A 1QSLA 3VQPA 4JV1A 3FQLA 2WTFA 3OY9A 1RTHB 4QWAA 1LV5A 3I0RB 1YTUA 1J5OA 5F9NA 5KT3A 3M8SA 4FJKA 4KTZA 1HARA 4CEAA 4OLAA 3NCIA 3BGRA 5C25B 3TVKA 4OKJA 3LWLA 4IFYB 4G1QB 2WHOA 2CJQA 3L2VA 2HWHA 2XI3A 4B9SA 4F4KA 4OLBA 4ECWA 4Q5VA 3PR5B 4K4XA 3AO1A 3DYAB 1U48A 1RYRA 4AHTA 4JLHA 3FDSA 5KFGA 5FROA 3E01B 2DTUA 4RUCA 4MK7A 1WNSA 4N47A 3CJ5A 4FJGA 4H8KA 3C6TB 1QUVA 2ZE2B 3KLVA 2HB5A 4DTJA 2BE2B 3NF8A 4K4WA 5KT7A 3Q8PB 3T5LA 2QXFA 1MMLA 4K4VA 3TWHA 1A5WA 1X9MA 1SKWA 4KFBA 3HK2A 5DLFA 4ZVGA 3DYAA 3ZT1A 2E6LA 1RTIA 3OYMA 5KFPA 2F96A 3V4IB 4CK3A 3TARA 3LPUA 3ITHB 4O3SA 3C6UB 3IRXB 1CLQA 3UPFA 1DTQA 1S49A 2HHSA 1HRHA 2R8JA 2UVUA 3SCXA 3QETA 4O4RA 5T14A 4OKEA 3OYHA 4FLTA 1XWLA 4RW4B 1JLCB 2GUIA 3OYFA 4IRDA 1BQNA 4CEFA 3QIPA 3AVBA 3ZSWA 4DF8A 4YMEA 4J9PA 3H2LA 5CZ1A 5KFSA 3MTKA 1B9DA 3LDSA 3AVJA 4Y2AA 2JC1A 3SQ1A 4RW6A 3PO5A 3M9NB 3MEGA 3PW7A 2WOMA 4NCBA 1NHVA 1LWEA 1Z25A 2EX3A 4ZTJA 2RDJA 2B6AB 1HJRA 4NCGA 2D3ZA 2KFZA 3PX6A 3AVMA 3ZSOA 2J6SA 3KMSA 2YNGB 4EBCA 3RAXA 1T94A 2W9BB 4LSNB 1CSJA 5KFFA 3TR8A 1HNIB 2GBZA 3M8RA 4RUAA 2P1JA 4DTSA 1WSJA 1ZTTA 3KIOA 4E19A 2OH2A 4MKBA 4CIEA 3DRRA 4H4MA 2F8TA 1S1TA 2VG6A 1BHLA 2GIRA 3TAFA 3K57A 3CJ0A 1HMVA 2VG7B 5KFNA 1F21A 4KKOA 3DLRA 3D45A 4LSLA 3V6DA 5KGXA 1RTJB 3NAEA 2IAJA 2BANA 4K8ZA 4ELTA 4DFKA
chains in the Genus database with same CATH superfamily
3OXGA 3CCVN 2KO1A 4RTFD 3NE6A 2YVSA 1U1QA 1Q81T 1NK7A 2VC0A 4P2XA 3BJYA 3THVA 5BJRA 4P73A 1VQMS 1Q4RA 1N5SA 5GAHU 3C3LA 4ZVOB 2FBTA 4BQZA 1RT3A 4Z4EA 4OYAA 1SL0A 3BEGB 3T6BA 4JB8B 4JI7J 1NDLA 1KVCA 1VQLN 4DBQA 4JK7A 2GMLA 1HNXJ 4P9SA 2V67A 4OYXA 3TTCA 3G87A 2DVIA 1REVB 1TUUA 2IDLA 5CZXA 2P51A 3W1YC 3GSDA 1SAZA 2E5LF 4CJPA 3R5DA 4CECA 5BR8F 5F0UA 2P9KB 5KFLA 5DG8A 3BGFA 2ITMA 1RXOB 4GC7A 1W9HA 4CLYA 1WF1A 5J2MB 2BGGA 3M8YA 3FSIA 2EWHA 4X4VA 2YHXA 3R7BB 1PYOB 5GAEI 4X64K 3K58A 2I2YA 2OUGA 3R3LA 4C6AA 1KQSM 1TL3A 5HVGA 4FK0A 1X0FA 3PM9A 1NJWA 3KK7A 4DR1F 1WDTA 4C8NA 1S6UA 4KHMA 3IR7B 1ZA1B 4CI6A 3KLHA 2I38A 3EPIA 1GOAA 2GNKA 2ALZA 3IR6B 5HVHA 2FC9A 3KG1A 4BRDA 4O0NA 4LBIA 3P49B 1RWVB 1NGFA 1PCAA 2F4VJ 4NPOA 3C0BA 4NYPA 5F8LA 3EGWB 3W64A 3K5NA 3H5UA 2NXEA 3HD1A 4I64A 2N7YA 3JTPA 2FZCB 2EK6A 3J81O 2CGLA 2XCAA 1XC9A 2MHEA 2VV5A 2UXDF 4OLOA 2XWXA 1HQEA 1WF2A 4CESA 4B08A 1FFWB 4DV5K 3OL9A 3TAEA 1BU6O 2P9PA 3KLFA 2K7JA 4EYHB 4DB3A 1HWKA 4TLRA 1H1VA 3BBBA 1IJJA 3SDEA 3ENBA 4JV5K 5BPMA 3BGOP 2P9UA 1QSSA 3LP1A 2KU7A 1IN0A 4ZCMA 5F0XA 4FZVA 3WC2A 1VSIA 2HFVA 1FF2A 2PFDA 1HBMB 2XEXA 1JXVA 2GIQA 5ETSA 3LO3A 3SI8A 3U9ZA 2E5HA 1S1XB 3M8WA 4WXWA 3QWPA 4ZHRB 1HWJA 2UUCF 3N4WA 3WEEB 1ZAXA 3ISNC 3Q0AA 1U6BA 2FLNA 4HHTA 4QCLA 4F9OA 4RW9A 1C1BA 3VAFA 4LFAK 5KG2A 2V68A 4J5OA 2J8SA 4OZ1A 4DG1A 3ATVA 5E84A 4ZCKA 2FVRA 1TV6B 1BWVA 3QZ7A 1FX4A 1N32F 3H8YA 2IM2A 3IM8A 4MKAA 1A5XA 5BR9A 1VK3A 1WC5A 2MPUA 4GMKA 3QYYA 4A8OA 1JJ2R 2AYGA 3PRVA 1BWFO 4OYZA 3BGUA 2W41A 4AHCA 1P90A 3PEHA 4B3SF 4CGHA 3W7BA 5JVGL 3B78A 1RDRA 3EL2A 5J1EA 5AXNA 1U24A 4K4SA 4B3MF 4L75A 3C16A 3CC4S 4O3OA 1QAIA 4FZYA 2ZH6A 2VPWB 2P5GA 2MSTA 4OHXA 3DU5A 1IQZA 4ED5A 4PXBA 2XMAA 3LTOA 3K59A 3O8WA 2GX8A 5HP1B 4FF4A 3G71N 2WONA 5DO2A 3OUYA 1JQGA 2ZH2A 4HHHA 2ZH7A 2FVSA 4CHQA 4B3TK 1KLMA 1P1TA 3O6WA 1IBMK 5IV3A 2RS2A 3MMAB 3TJAA 3ZETB 1VQ9N 4ELUA 1WI6A 2QO3A 2CQ3A 4LF4K 4MIAA 1Q53A 2LXFA 2BQRA 5K14A 1IO2A 3L3CA 1BI4B 5AXLA 3SUQA 2DNNA 4NB4A 3ZSRA 1RAFB 5CY4A 3KWMA 2XYPB 5AQVA 4NLBA 3KD1E 3N6MA 3W9JA 3I31A 3UCGA 5KRTA 3ZTQA 3EZOA 4H0PA 1VI7A 4UOFA 3H7HB 4QWBA 4FXVA 3I96A 1LWCB 2DXFA 4Q8FA 1NSKL 3HHLC 1RB0A 2W6LA 2ZH3A 2H3EB 2ZH1A 5AZIA 3UNGC 4DR3K 1NGDA 2Y0BB 4IH5A 3M9MB 4M7YA 3CCMS 1HLUA 3KKRA 4K43A 4K4UA 4RNOA 2KDOA 3L8BA 1YLXA 4U7UK 2ATCB 5D6GA 1PYTA 3OHRA 4CJLA 4HCBA 3VGVA 3EO3A 3CF5Q 5TKWA 5DS7A 4LF9J 4YOWA 3QRRA 1GNKA 4M5HA 3ZO7A 4FXDA 5LOQA 2EC2A 3TVZA 1TL5A 2KVQE 2HRUA 1IBKJ 3HL8A 3O9TA 5C10A 3R7SB 2Z8QA 1YJ7A 1RCOB 3A8IA 1XMQK 4TY8A 1AFJA 4F26A 2CPEA 1UEKA 1Q8IA 1R7IA 4X4NA 2X6NA 5T7LB 4EO8A 5JS1A 4A8MP 2QLJB 1QE1B 1YJRA 5CYMA 3KK3A 1ATNA 4JD2B 4BGAA 2WRMA 1RTHA 2YKAA 1RHJB 3I0RA 4QJVA 4BC5A 2HF3A 4KH1B 2PZSA 1HW8A 1CEZA 2RHQB 2HWTA 2UXBJ 1T9VA 2VKZG 2Y1LB 4OYPA 4IFYA 3M2RA 3CE8A 4B9LA 1AROP 5MAOA 3KLGB 4IG0B 2EFOA 3RZAA 5BN9A 3S3MA 3BQ1A 3A8KA 4FPBA 1YJ9S 4J9LA 1Y97A 2DO0A 4ED6A 4FKXA 4PWUA 5AE2A 4Y1DA 2WC9A 3E9OA 3E01A 3DLEB 5L9NA 1FJGK 3MEKA 2MB0B 5SUHA 3OFEA 4I68A 3NVMA 2G8UA 2GGPA 4V19S 2ZE2A 1L3KA 3PV8A 2KXFA 5BRFA 2CJAA 2DB1A 4TQSA 3PLAA 5A0YB 1SXLA 1NK6A 1RUSA 1XR5A 1T6CA 3MCOA 1SC6A 1N4LA 5CQGA 4IFVB 4H4OB 1VIOA 4AILC 5H9EJ 4UY85 4DL0C 2CZVC 5GAGI 3G4SS 1ZM2A 2HHTA 4RKUC 3UD5A 3W2VB 1QS4A 1ZA2B 4DCPB 4JKEA 4ZITA 1IR0A 4RW4A 2IVMA 2LDIA 3Q24A 3P96A 1YDLA 2VFVA 3L0QA 2HQ3A 2V52B 2G8WA 2A1SA 4CGJA 4M5GA 5J1PA 4DR6J 3G6EN 2B6AA 5HBMB 3Q8UA 4QAGA 1M5SA 3NGTA 2F8SA 4E7KA 2YNGA 4N56A 1UP1A 3ZZOA 4JBCA 3KYLA 1RTDB 2XMTA 3RBDA 4LF6F 4ZTFA 4YN3B 3QRPA 1ICEB 3M32B 1IG9A 2KHOA 3H90A 3HF5A 2HF4A 2XO6A 4B3RJ 3NGYA 5H9FJ 4ZIVA 1NK8A 2D74B 3POTA 1FRKA 1X3MA 2HG4A 2FPHX 4LVNP 1S72S 3MFIA 3OTOK 4Z4CA 4ZMMA 4CWBA 3K2PA 4BR9A 3E9PA 3OYEA 3V81B 2W7AA 2CXEA 3NGZA 3MEEA 1N52B 4NZ6A 4AXIA 3LDQA 2D3OR 4DV1J 2P9NB 3O5BA 3L2WA 5FPMA 3PEJA 3NH2A 4OPHA 5IQQA 2A40A 5F8JA 1VRTB 1HNVA 3GL1A 4J9NA 3BKFA 1MSWD 4C1NI 2P9SB 3ETMA 2OFHX 2E88A 4NXMK 2W9CB 2NSCA 4TVAB 4BWJA 4BRFA 3MAAA 4GVLA 3DNCA 4LFCF 3AVKA 1NNDA 4ECRA 4BRGA 1KTVA 1A9NB 2J0SD 2E7WA 1RHRB 3EGVA 4B9TA 1YBAA 4JN4A 2ASPA 4QOZB 3MECA 4BG9A 1VQ5S 2JEIA 3AA3A 3FFIA 3W0LA 4OV6A 4IJAA 4HACA 2QWQA 1AW0A 4RBUA 4DV2F 3GR0A 1T05B 1IM4A 1TKXA 3LDNA 2R2RA 3CPEA 1TAUA 5FLXO 2KJVA 2CQPA 3BZQA 5EXWA 3I82A 1WHYA 3K7RA 2CQ1A 4AM7A 1IBLK 1NGBA 1RDCA 3HHKA 3AAPA 5D0RA 2ROPA 4HTUA 2HK2A 4DR4F 2H1YA 4ID8A 3M6WA 5FDLA 2DD8S 5EHHA 3PR4A 2NRVA 5L1JA 1N33F 2IC3B 5DK5A 2IFXA 1WNEA 3ID8A 3MR6A 3RR8A 3QWUA 1JCFA 4KQZA 4NZ0A 2LKZA 2ERRA 5C15A 2GC8A 1JLAB 2AZ3A 3CD6S 1PJ5A 2I5JA 4Z4FA 1HBOA 3SQ0A 3BN7A 5CR4A 3O1BA 2HMIA 3HX9A 1S7IA 2Q36A 1H2VZ 2YKPA 3K89A 2IIRA 4DV3K 3UKRA 2GWJA 1T9WA 4K8XA 3R3TA 1V3ZA 4Q2LA 1KOOA 1WWHA 3N9UC 3AD8C 2J9EA 3RBZA 1FKOA 3CD7A 2QWRA 2MZTA 1TR0A 1JXLA 1I39A 1SC4B 2E2PA 3KLEB 1N34J 3U4LA 3HHLB 2HIYA 5HL7Q 2A0FB 3NL0A 3VF4A 1RDUA 1UAWA 5C2FA 2G9OA 2CZ4A 3HFZB 3PJXA 4GVMA 1S57A 1U1PA 3RWUA 3OR1B 1X4AA 3VQEA 4CJQA 3DLBA 4EYIB 4AYBD 1VK0A 4J9KA 5KG6A 1BLUA 4X65F 2JFDA 4EP5A 1HYVA 3PW0A 1H7XA 3RRKA 1VQKS 1N8RO 3TI0A 5GIPA 3HSCA 1B64A 3A1YG 2B3TB 2Z4PA 1LFWA 2BX6A 4LF2A 2I7PA 2QA1A 1H73A 2CUYA 1C0TA 2CQDA 1UJ6A 3CD0A 3OVAA 2EFQA 3DJCA 2VUGA 3DC2A 1KXPA 2E8AA 4B9QA 1NBWA 5HSPA 3EZUA 5ADXH 4ZJOA 3LP0B 4MO4A 4OQJA 5A6PA 4PRFA 1E6VA 2UU9J 4WE1A 5F8MA 3VERA 4FWSA 6FD1A 3LGMA 3X1LB 3T6JA 3PZPA 1HBNB 2HBQB 2GQ2A 4JI2J 3MM7A 3T1YK 1YHQN 3O4WA 3MUVP 2Q31A 3VA0A 2FJDB 2VJUA 5A2QO 2FQQB 1TVRB 3PYGA 2VQEF 4JI0F 2PAVA 4ID1A 4JYAJ 2RDDA 3QT5A 5KRSA 3WUHA 2XY7A 3V9XA 1HPZB 4PUOA 2YX6A 1BD6A 1AUSL 4HTJA 2OGUA 4WTYA 3SSQA 4U7UD 4DR2K 1S0OA 2RIJA 4B1YB 1HNWJ 5C42A 3GG4A 4FM1A 2DK2A 4H03B 1QQOA 2ZBIA 4CGGA 3QBWA 1C2PA 1CQMA 1N0VC 4PQUB 1C1CA 1N6QB 4BDYA 2HOEA 4NLCA 2PYJA 2B7CB 2FUG9 3RBXA 5SZTA 4KRFA 2LU1A 4JRPA 4FLUA 1NPPA 1B4SA 4MQ3A 2OKQA 2JLFA 4XH1A 3M7VA 3W2WB 3FBBA 3P5BP 1VQON 1AB8A 2W4CA 4J90A 1VSDA 4FW2A 2PMWA 2MKSA 3NCQA 3FE1A 4BRNA 3SV3A 3CMES 3WX8A 1X4CA 1L3TA 1T8EA 2JVOA 3MMCA 5RUBA 2A1RA 5C0YA 3BGRB 3NGDA 3TX8A 2ZM6K 2W2QP 3SJHA 3EVMA 1X4HA 4RCHA 3H5YA 3UNYA 1B9FA 1YKWA 5ETQA 1Y0HA 3NP5A 4DL3A 3ZCMA 2LQJA 4BHQA 3WQUA 2JEJA 2DHAA 1FX2A 3OVNA 4WFNL 3EX7B 1S1VA 4DR5F 1OQ6A 3BQ0A 4FM0A 2YTCA 2MQNA 5JXSA 4F8RA 3T5JA 1GX6A 4MLHA 3AVGA 1TKTA 2HS4A 4E1MA 1N8RT 3PYDA 3CFPA 1WEYA 1NGCA 2MGZA 3I4PA 3NMUA 4WCEL 2RE1A 3VF6A 4ZVEA 4IDHA 3ILOA 1OPZA 2QSFA 1ZPVA 1YIJS 3MCNA 3EWGA 4HT5A 1RTIB 5CE3A 2FSJA 1LXNA 4JI3J 1EETA 4WQ4C 4QYRA 2IJFA 2MSSA 4KHQA 3R6LB 4JNEA 3TAPA 2DYAA 1VQYA 1NSQA 3OSPA 2EW9A 4B8CA 4U8VA 3GIRA 4OGEA 3VAGA 1G7CB 2OAUA 2V8HA 5FPDA 3LALA 3BP8A 4HTLA 1X5TA 4C8OA 4CQ1A 4KRWA 3GJRB 2VBYA 1LWEB 1IKVA 2H54B 4ITSA 2W8LA 2X1BA 2DY1A 2GMHA 1XNRF 2NUUG 1NK4A 4CNZA 2KXHA 1WC6A 3D7EO 3HMJG 4ISGA 4PL8A 2GELA 2GMJA 4FYYB 4TYBA 3MN7A 4FBTA 4DS4A 3SCIE 1BOTO 3MM5A 3F56A 2GTDA 1BO5O 3H2VE 5C7PA 5DZ6A 4USMA 1BIUA 2GIFA 1UFLA 4RR5A 2Y1IA 3DRSA 5L39A 3NAIA 2DH9A 3GFXA 4RUBA 4YP3A 1MROA 2IAJB 3LGHA 2Q2RA 2ZBRA 2Z58B 3BO4A 4F0HA 4FJIA 1VQNS 2CQ2A 3N5FA 2L9WA 3H46O 2XSJB 3NMAA 4XH4A 2LFVA 4JV2A 2GEMA 4I6MA 4CO4A 4FWPA 3M8QA 1OWXA 1GLCG 1NEEA 2M52A 3H4BA 4IOCL 4DCJB 1BQXA 2PGCA 3GILA 4J9VA 5KFHA 2OTLS 1J5EK 4I7FB 2A2DA 2XS2A 3FZHA 2P9IB 4URGA 4MFBB 4LH4A 2AYBA 3VETA 4OYMA 2RKIA 4F4AA 4FPRA 2HFZA 3WNGA 3FEXB 3HZEA 2DPIA 1W7AA 1TP7A 2QA2A 1P1LA 4GO7X 3FZKA 1GXTA 2BJ9A 4OYIA 8ATCB 3UKUB 3U6FA 3LAKA 4W5RA 4NLPA 3A3PB 1FKAF 2ACMA 1BGXT 4CF8A 1NK5A 1FFGB 3IRWP 3O3HA 3PJ9A 2HSTA 1RT7B 4AL7A 5KPTA 1S97A 3DLKB 3DXKB 2VBZA 5BYSA 5F0WA 2UVRA 2E2QA 2QE5A 3OLAA 4RU9A 4DLEA 4OX9F 1CLFA 3SK3A 4ZVSB 2NRRA 1V3SA 3D2WA 3FCWA 1B7YB 1KS2A 1SKUB 4ID5A 2WVCA 2G4BA 1JNRB 2Z2ZA 1JXEA 3D28A 8AT1B 3TR5A 5DDOC 4YUDA 1PO6A 2X74A 4CJSA 2KM8C 5LMUJ 1QD1A 3UFCX 2F9JA 4KIAA 4DUZJ 3AA8A 1UAXA 5CYQB 1NPRA 3OYDA 3MMJA 3BM7A 1H2TZ 3BS9A 2N3LA 3A8JA 3HHNB 4WZQA 4CF9A 2O67A 2CQIA 2J9DE 4X84A 3DI6A 3W61A 1GXLA 4KB1A 4J9OA 4MO5A 5EX5A 2FHOB 2HHPA 4KBIA 3FBCA 4CJVA 5LSLA 3IBWA 1VSHA 2AF6A 1NM1A 1IUJA 1VQ6N 1MLAA 1U1MA 1OY8A 4DTRA 3CCTA 2HNZA 3PSIA 1U2CA 2ASLA 2VA2A 4H5NA 3DOMA 1QQCA 1VQPS 2Z0GA 4XAKA 1KHVA 1KP6A 2FZGB 4K50A 3N4PA 2WSFC 4HVZA 5HI7A 1XNQK 3CERA 4GVEA 1WUUA 4DPTA 5CD4H 1DGKN 2FJBB 1I6JA 1FI4A 1P8GA 3NG8A 4AL5A 4Y65A 1SKRA 1S4EA 4ZJLA 5BPLA 3DDNA 2NRXA 4PAAA 3GONA 4PWDB 1VDHA 4ER8A 2G1HA 1HUXA 1U2VB 2E66A 1RAOA 1UFKA 3JS9A 3RB4A 3TA2A 1LK7A 4DV6K 3CDAA 4HDHA 1AUDA 5I3QA 2YWHA 1JLGB 4XK8C 1K47A 1D9DA 1U6FA 2B9XA 5KFXA 3SJJA 4IH6A 4DUYK 1VJWA 2NLXA 4FOIA 5B0AA 4CI0B 3OYGA 2Q3PA 2J0WA 2O8BB 1SB6A 1R59O 4B9MA 2FHMA 3J80Y 4C7QA 2AGQA 3CM6A 4CO1A 2WVDA 2BE9B 2XZDB 4DX5A 3C2PA 3OQ2A 4USUA 4H5WA 2GVZB 4MTPA 2YNIB 4JKFA 4G1PA 4LFBF 3A0IX 5A8KA 3DRXA 4NA2A 2V9KA 4DX7A 5KG5A 3CCQS 3ADAC 5KFKA 1SH3A 4EBEA 5GMEA 1T44A 2IDOA 4I6YA 3DRPA 4NA1A 2NPIA 4BQLA 5D4OA 3R5CA 2K1RB 2A6OA 5M1KA 4CYUA 4CBWA 4A59A 2Q0UA 1R8PA 4A8XA 4FWMA 2AJ2A 4ZVHA 1T9XA 4ZIWA 1Y64A 1YJWN 2AX1A 3EVOA 1VK8A 4NXNF 2RUSA 1S59A 2WVEA 4RX6A 1YI2S 1JJ2M 3CCSN 2OANA 3JS6A 1JL2A 5K8OA 2DTJA 1U1OA 2MZSA 4OI1A 5CZ2A 1UMJA 1YG0A 2OO4A 1WACA 2IM1A 1JLEB 1VS3A 3ZZYA 3GFHA 1LWFB 3GDQA 4B3OA 1VJQA 2XMJA 1U02A 5J2NA 3Q8QB 1V6HA 3BQ2A 2RN2A 1F2HA 4ZP9A 2C2DA 3ALYA 1XQIA 1S1UB 2NS1B 4E7JA 5E2QA 1NKCA 3JYTB 3CCLS 5BR8J 1C0UA 3VQ9A 3KLIA 4NI2B 2BKNA 3S7RA 3U1MA 4DTUA 3AD7C 3VQ7A 2DFHA 4OI2A 4JI7F 3QNNA 1N88A 5HQLA 1IM6A 2M70A 4U96A 5JUMA 3OT9A 1CS4A 1HLWA 2VB6A 1RYSA 3QT8A 1GH8A 2GQQA 1MNEA 2AT1B 3PCOB 2CAJA 4USHA 1JL1A 4E89A 1PIEA 3VQ6A 4WFBL 2BOAA 2RVJA 4PXCA 4UZCA 2I6WA 3VGMA 4CZIA 1TUVA 1SVDA 1X31C 1NGIA 1M1KO 3OV7A 4BC9A 2LEPA 4BCAA 2OPRB 3AVHA 3FBFA 3OBWA 3KJQB 5BRHA 3QQCD 2VFTA 3TUPA 2AA4A 3LANA 2F8EX 4LF7K 3ZTPA 4CK1A 4PG6A 5E3PA 1OKJA 5B0CA 1J5OA 2UXDJ 1YVNA 5D4LA 5F9NA 2V4JA 3S41A 3PRBA 2JJ4D 5AQMA 3TVKA 1YTYA 4G1QB 2WHOA 3D2FB 2CJQA 3UD4P 1OH8A 2OMOA 2F4VF 2XI3A 1FE4A 4DCOB 3TSUA 4K4XA 3PFOA 3QGPA 1RYRA 5C12A 3FCHA 1CPZA 2Q79A 3DAWA 2NRTA 4JLHA 2DEJA 2WW4A 3DGVA 3CCRN 2XS5A 4CZGA 4KGXB 4OIXA 2W2OP 3CMAS 4MK7A 1WNSA 2I8EA 4CO0A 4DTJA 2BE2B 5AQOA 4F0KA 5KT7A 2ROEA 2FF6A 1X9MA 1SKWA 4OI0A 4MJKA 1HR0F 2HQDA 1CJVB 1NXIA 2KRBA 4PXEA 1C4CA 4ES1A 3QETA 2WW8A 1S77D 2FJAB 3OYHA 3VESA 3I6PA 3R7NB 2ADBA 4CEFA 3ZSWA 3M6VA 4IO1A 2GJIA 3MM6A 4QR1A 5GMKa 2KM8B 4Y2AA 3SQ1A 1WUAA 4YB5A 4GVBA 2HFNA 2WOMA 3JQMA 1RWMB 3CJAA 1NHVA 1Z25A 5HANA 2X51A 2AZ1A 2RDJA 1R8CA 1HJRA 4NCGA 1BC6A 2KFZA 3UWTA 3ZSOA 1Y5LB 1AXQA 3CCVS 1T3OA 4DPXA 1T9YA 4LSNB 1CSJA 1HNIB 1DKGD 1V4SA 4RUAA 1WSJA 1IR1A 4CZFA 2OH2A 3J7A1 4H4MA 4FSVA 4CIOA 1S1TA 2DNGA 1X5OA 1HMVA 1H2UX 4KKOA 3DLRA 3D45A 3V6DA 5C2CA 5KGXA 3SEOA 3NAEA 4KH0B 4CLWA 3ONQA 3M6XA 4K8ZA 2CQHA 4ELTA 3ULHA 4DFKA 2FHKA 2BQ3A 3L2QA 4OHYA 4C0OC 4I6WA 4Z4HA 1FEHA 3H2UB 2A1BA 3KJVA 3QPIA 1ZBHA 3LQVA 3IAS9 3F9KA 3GMGA 2G2OA 2G1DA 3P6YC 2GQCA 1FO1A 2HURA 3FJ2A 2YNFB 3BF1A 2XYGB 5IWAK 3HVTB 2VD3A 3M30B 3H98A 3WXJA 2HHHJ 6FDRA 1WKKA 1K0TA 4O3QA 3DM2A 4FVCA 3TEHB 2MXYA 4IG3A 1YVFA 3WXIA 2XMUA 3THPA 3TAMA 2KTQA 4G9ZA 4AT1B 3FNNA 2RHSB 1CULB 4EU0A 1ZBLA 2ILZA 3QATA 1HI1A 3EXCX 4UOGA 3U02A 4CHNA 2FBVA 2CPHA 3HHDA 5L46A 1W25A 3OYAA 2A3ZA 3VQ5A 3W63A 2B4VA 4DV0K 1S6QA 2V2VA 3SIPB 2NYHA 4JI5K 2P5OA 3S8SA 4LQ3A 3TRGA 1KR4A 4R5PA 3N5BA 5HQMA 2RILA 3L2UA 3HI9A 2YI1A 3EDQB 3C65A 4F7VA 2QMXA 4Q45A 2CPJA 1H6KX 3R5GA 1HQEB 5J2QB 3OXLA 5GADU 1HNXK 4OZ5A 1QY7A 3MR3A 1EJ7L 4IQMA 4KSEB 4EMDA 3HPGA 2MQMA 3MWTA 3V6JA 1CZAN 3SDEB 4DI6A 2R2SA 3B8HA 3OL7A 1DBDA 3V5RA 3IFRA 4LF9F 4HHJA 3SAGA 3CI5A 4LF5K 1RAIB 3SUPA 2W4DA 1HQUA 1EO1A 4OL8A 2VA3A 3CJKB 1JKHB 2L3MA 2O8DA 2ZGZA 4IO9Q 1S6PA 4LBPA 2HNDB 2DY4A 1IBKF 3DLGA 1NJIT 4EHTA 4DSKA 4WF9L 4N76A 2PMZD 3I0SA 2W25A 3LPYA 3CWJA 1FVSA 5C24A 1RAAB 5KFDA 3U1NA 1E6YA 3V1RA 4JI1F 3PRDA 1KVKA 1JLBA 2GZOA 3WNEA 4I1TA 2VG5A 2ZJQL 2RPIA 4CTAB 4M63A 1R8HA 3QAEA 2CDQA 4LF8K 5LT5A 3IAYA 5IM0B 3MXIA 1BQMA 4IFEA 4JI4K 2UXBF 2OTJN 4GO5X 5A8RB 2IMOA 3GIJA 4ECVA 3O9RA 3C46A 4IEIA 3LDPA 3DXMB 3VF0B 1RBOB 3OTBA 2FHJD 4FCYA 2V8DA 3H5SA 2X7IA 3BR8A 2LQ5A 1X60A 3MD3A 4ZVTB 4PCQA 1UTAA 3BKTA 1J5EF 1OSDA 4USTA 2D4WA 4K8RA 2UV8G 2GS8A 3MZIA 7FDRA 3ZZUA 4ECSA 3BR9A 3HVWA 3RYLA 1QSYA 3W5ZA 1SZ2A 3GSIA 2LLZA 3OYLA 1RU2A 3PHEA 4X4PA 3KWIA 1VCTA 3G71S 3CJRA 2XLKA 1JB0C 1UVNA 1EKRA 3J7YP 5F1XA 2CG8A 2BABA 3GE9A 1SBRA 1P6TA 2KJWA 2F7TA 2RH3A 1UZHA 4GKJF 4LF6J 2CVIA 3KHLA 2DJWA 1VQ9S 2NRWA 3K0JA 1XI1A 2ASOA 2QGFB 1S9EB 2HVIA 3SQ4A 3EE8A 4Z7CA 4K2XA 3ISND 4DPWA 2KLAA 4HH0A 2ZWHA 2D0CA 1RAEB 5I3UA 4Y2MA 4JKGB 4DR6F 2YKOA 2O8EB 4QWCA 4FJNA 2K7KA 3OW2M 2ADCA 1UVJA 4KHYA 3HOSA 4WQ5A 1YZ6A 4DQIA 2W7PA 5B0GA 1FNMA 2XNRA 5K8MA 2KZMA 3CFRA 4B3RF 3MEDA 4IQXA 5AJ3J 3ENVA 2ZJPL 4MKYA 3EY1A 1LKZA 5ETVA 4RW7B 1HFEL 1QHTA 4YHHJ 2JLGA 3AD9C 2VOPA 1FRHA 2VASA 3KDNA 2UUTA 2I1RA 2QV6A 1IKXB 3O80A 3F0NA 2XHCA 4LFCJ 2CJBA 2ASMA 3L4BC 1OY6A 4DV1F 1FA0A 5G4DA 3S6EA 2MY8A 3FZLA 2UUAF 2R8KA 4DZDA 1VHIA 3TAQA 3CCZA 3O9SA 3THWA 3RMDA 2XRIA 1DTTA 4LD0A 4M5MA 3NBPB 1HYSA 3AA5X 3BSOA 4FWQA 5DMRA 4BRKA 1I94K 2P2CB 4LR7A 3FZBA 3MM9B 4FPAA 3KK3B 2J7UA 4CLZA 4YOTA 4S0MA 4H54A 1RT6B 2J9DA 2HBLA 4M3ZA 4DU8A 3LW5C 3T1AA 2QWLA 3CJ4A 3C19A 2ZWOA 1MWZA 2P9LA 1VHXA 1LK5A 1UCNA 1EP4A 3TZXA 2BJ1A 4LUBA 1RBTA 3DHWC 1N33J 3V6HA 3O3GA 1BY9A 2ZBQA 5B0DA 2RD5C 1N5YB 1Y5NB 2AWZA 3QLHB 3G82A 4BRHA 3HHLD 4FZXC 1WSRA 3OR2A 4EZ6A 1S9FA 4Q44A 3U3GA 2BR0A 3OFHA 3OPKA 2E9RX 1X4DA 2CJYB 4B1WB 1EB0A 3FRYA 1U04A 3QJJA 3ZZPA 2XTJP 5C25A 3TZYA 4ES2A 1UOCA 1JCEA 2G8HA 1QUPA 1QDUB 3UDCA 5DDQC 4BROA 1OYDA 4DF4A 3HSTB 2JH3A 2HZVA 5CH7B 4C48A 1R0AB 2P8IA 5DZ7A 3TYTA 3G9CA 2NPFA 3IBFB 1K6YA 1DURA 1X4EA 1QAXA 2VQFJ 2E1ZA 2QMWA 2JOQA 2D41A 4YR3A 3MMBA 3VQQA 4KO0B 4NYFA 1CJTB 1R6VA 3N6NA 2MTLA 4DMNA 2AIRB 1FFSB 1UWBB 1SQGA 2N7CA 2VFRA 3NEKA 4ETXA 1I3AA 2B8PA 1W2IA 1YK9A 2CPZA 3OHAA 3H08A 3E66A 4R0EA 3MWPA 2JLEA 1RK8A 1UVKA 3CEDA 1OO0B 3G6ES 2QWNA 3V4IA 2COLA 4KHSA 2K2PA 4KHPK 4J7CA 3ITHA 5KFBA 1HQ2A 3IRXA 3CO0P 4IBNA 2FGCA 3BY5A 3EM1A 3SCKE 2GJ2A 2AEMA 3D54A 5G0RB 1Z2LA 3KG4A 4K5SA 1VGYA 2FJWA 3GYXB 4KT0C 1EKEA 1NWKA 1MA9B 2UP1A 3NXZA 3CXCM 5ITHA 3DXBA 4LRBA 3C66A 1SIZA 4H0YB 2R7UA 1T03B 4EIAA 2V34A 2AGOA 2HFSA 5LJVA 2J9CA 4N41A 1U45A 1D8YA 2W9BA 2YWEA 4DWIA 4OHWA 1Y4ZB 4MYTA 1TL7B 5K20B 4X64J 1LAWA 3LGNA 4KH5A 4O23A 2VQEJ 4JI0J 3NS5A 4BDZA 2W9AA 1KTQA 2AYEA 2OLWA 2FF3B 3D1OA 1HPMA 3VEOA 3FSXA 4M5IA 1FDAA 2VG7A 3V9WA 3D6FB 4DFMA 1Z05A 3ZNJ1 3I56N 1RTJA 3NNAA 3IGVA 1FTRA 3SZ2A 3A8YA 3KJNB 1FHTA 2F9WA 4DFPA 3LA0A 1PSDA 1RHKB 4ENOA 4NLDA 2XWYA 4NLXA 1NOZA 2ZBPA 4AM6A 5B0FA 1QAYA 3QDKA 3NMRA 1IKYB 4OZ0A 2R7TA 4L3KA 3AAWB 5A8WB 2DR5A 3P5JA 4CJTA 1Y3JA 4DQQA 1HI8A 1Q7YO 3SNNA 5LJWA 1S5ZA 3CCEN 3KK1B 1RT2B 1JXBA 1ITPA 4B1UB 4DN0A 1VSJA 1X5SA 1XIQA 4E7LA 5HMYA 3J7AN 1RP5A 3PFEA 1REVA 2V6AA 4ZPWR 1FRJA 1VQ4N 4TN2A 5H9FK 2J7WA 4JV5J 1AZSB 3GFYA 1SJQA 4EHUA 1JJ4A 2P9KA 3VV2B 1IWGA 3PHTA 3MX5A 3SBGA 3HVRA 5J2MA 1ATRA 4GC6A 4AQYK 4FJ8A 4ALZA 5A76A 3WT0A 3O6QA 4DR5J 4K0KF 4P6QA 1Q86T 3O3FA 4Z37A 2VIHA 5KFTA 4NLYA 2CQBA 1RBSA 2CH5A 1J9AA 4DQ8A 2V69A 2CH6A 2FD2A 2AP6A 4HHUA 5D0HA 4IKAA 2J0XA 1H98A 4DV4K 4LFAJ 1X7VA 3VQTA 3HP6A 1J54A 1SJ4P 1WSGA 5HLFB 1T0TV 3VMFB 3KFWX 2GW8A 3B6PA 1URNA 4USKA 5BREA 2HLUA 2NR0A 3C95A 2V51B 1JCGA 2QLXA 1HL6A 1KD1O 1WBBA 1TL1B 1ATSA 5LXYA 1RT4B 4N5SA 5M1QA 3ZT3A 1UZDA 2E5IA 3BREA 4Y34A 3NH0A 4ATNA 2KI2A 1Y7PA 1RDAA 4BY9C 4UW2A 3K5OA 4QIEA 2ITGA 4NRUA 4JI3F 2VODA 3UB5A 3EVWA 3P4IA 2PN6A 4K59A 4EK2A 3J7ZO 1U25A 2HEKA 4E7HA 4KPYA 5KFMA 3THXB 2WVFA 3CG7A 1RWKB 1ZZFA 5HRSA 2YWKA 3THYB 1HBMA 1WSVA 4DR7K 2FLLA 1SH2A 4B3TJ 4XTTA 1S1XA 1RWWB 4KHWA 2HQGA 4G65A 3O4NA 4ZHRA 3M8PB 2CGKA 3WEEA 2EBEA 3BPDA 4J2AA 1R0CB 4PABA 2HAIA 4DSLA 1Q95G 3JAMY 1F2GA 4CF1A 4WYLA 3KHHA 3CDEA 2UUWA 5FJ4A 1PAEX 5GVQA 3RRHA 5JICA 1GT8A 2APOA 3GQCA 3DOLB 1RT5B 1YHQS 1TV6A 2EFVA 3EYZA 5T7BA 3SPYA 4QIVA 2KHCA 4F25A 1VBKA 4OHVA 4IOAQ 2YQ3A 4YB7A 1IWAA 2HKEA 1N34K 3WXMB 3MPWA 1R6YA 5GAEU 3ZSQA 5LSRA 1KNZA 1HKCA 1XR6A 4M3WA 3WBZA 3DGPB 4DR3J 2EVZA 2QL5B 1ZM4A 4LRCA 4NEZA 4O44B 2VC1A 4W92B 1KVAA 2CKWA 2RF2B 2BRLA 3FKBA 1TAQA 1S0NA 1GOCA 1E3MA 4YNQA 2KRRA 3GOIA 3PG9A 3CFOA 2RS8A 4ZPAA 3K9KA 5HP1A 2HHQA 3VVUA 3AGKA 5HRPA 2AEJA 2OPQB 1RLCL 5DM7Q 2Z1HA 2ZC4A 1REGX 4Y3CA 4OX9J 3I55N 4H5RA 4ZVFA 4QYZK 1XMQJ 4JKDA 1JWWA 3B4MA 5M1PA 3MMAA 3ZETA 2UU9K 3AODA 4QPXA 2BYCA 3FGUA 2HS3A 3MN6A 1KD1T 1BI4A 4JI2K 4KREA 3L4QA 5AQWA 4A2BA 2CNLB 4U67L 4YY3F 4ED1A 2O8FB 1QVGR 5M2PA 1EQYA 4JYAK 3J7ZT 3MAQA 1LWCA 2Z56B 3EGNA 2A2CA 3PIPQ 3RVCA 3UVJB 4WFZA 5LMUF 4X4OA 5EOYA 2QIFA 3TSQA 1HNWK 2FY8A 1W2BM 4ZPCA 2M5YA 1JMTA 3ZX3A 4LF8F 3UI3A 1WHVA 1HD0A 4CHOA 3AHPA 3J81U 1FJGJ 2PFFB 3PW2A 2JVRA 2C2KB 1HW9A 3TEGA 1FW6A 4UOCA 3P8BB 1HX1A 4KHNA 2D0OA 2HBZB 3OBIA 3HSGA 4OI3A 1MWYA 3OTDA 2XY5A 4FJXA 4C0HA 2MKIA 1DAXA 2B43A 4A8QA 3QRQA 4PG4A 4BR5A 4M95A 2MZRA 3A5OC 4WFAQ 1SC1B 5HATA 2XS7A 3UDVA 4U95A 3FZFA 1N36K 3O3LA 4DXLA 4I56A 3FGVA 3K8WA 5DM6L 3RBEA 4CGDA 1WOSA 1VR6A 3D67A 5T7LA 2DNMA 2XYHB 1XMOK 3L7PA 4W98A 1QE1A 3QIPB 1FDBA 4AE5A 3W60A 2M4MA 2RQKA 4I6AA 4JD2A 3MEGB 5M2UA 1RE1B 5GINA 4A8WA 2Y3YA 3T5HA 4NMLA 4RJVA 1U1KA 4C97A 2X1GA 2VZ9A 2BJ7A 4CJEA 3VGLA 3BSAA 2FC8A 5JJBA 4GV6A 3V4MA 3C6HA 3OYNA 1B0VA 2FSKA 3DRRB 4LFBJ 3KLGA 4IG0A 3IGNA 4LSLB 1HNZF 4NEYA 4DU7A 2JDJA 3QGIA 4CLLA 2GHVC 1VBZA 1UJ4A 2QYCA 4F50A 3LF0A 3DLEA 4O55A 3UDLA 4X4UA 2DR9A 3PIOL 4KTWA 5E5NA 2DRBA 5DQGA 2OSQA 3G6XA 1RGVA 4NXNJ 2A3JA 5A0YA 3GV5B 3EMTA 2D3UA 3M6GA 4IFVA 4XDCA 4H4OA 3G4SN 2JWLA 5AQIA 1V4TA 1FNOA 1VFJA 4BC2A 1IVZA 1YJNN 3HPOA 1WHXA 1HYZA 3W2VA 1YQHA 4NL5A 2ZUGA 4NXMJ 4U7BA 3DLHA 1FTCA 2FJEB 3BO3A 2FHJA 2HHUA 5LL6Z 4M3YA 2ABYA 3J8AA 2GWKA 5KTQA 5AQRA 1WD6A 4FJLA 5IXUA 2XC9A 5HBMA 4KAIA 3SPZA 1ZAVA 5KG0A 4AHSA 2W24A 2WK4A 1RTDA 3JSMB 2UVVA 3D9BA 4DL6A 1RACB 3W9HA 1SQFA 3M32A 1H3DA 1LWXA 3O1WA 1HI0P 1SV5B 2FVQA 2DGOA 1NUEA 5C2GA 3M1FA 1F6TA 3OYIA 5AXKA 5K8PA 3R6MA 3L3UA 1IBLJ 1RAJA 4PY5A 2LECA 3J7YI 2C2EA 2YNHB 2WBMA 3QEVA 4OLPA 4Q0BB 3N4QA 5I42B 3V81A 4KC5A 3VAMA 2BTFA 1CVJA 3FRZA 4CLPA 3B4DA 2ZZTA 4PKHA 1IJFB 2Z30B 3VEZA 3ZTSA 1B7FA 2HHVA 4OJRA 3ISZA 2P9NA 4H0VB 2Z2MA 1R3NA 3M2UB 2IM3A 3W8GA 3A5LC 3NF6A 1WTBA 1Y00A 4ED7A 4WKRA 1XR7A 3Q22A 1VRTA 4MKVA 4FWLA 2UXCK 4DV3J 3P5TL 3NGUA 3PW4A 5HROB 1OH6A 2P9SA 5F8NA 4HI1A 1GLLO 3QNWB 2E7VA 3EICA 2W9CA 1H74A 2ZNZA 1PBUA 2R7YA 1BIZA 4USWA 5KT4A 1ROFA 5CABA 1Q8LA 2QKBA 3MPVA 1R89A 2PO4A 3P83D 2PA8D 4IYQA 1R43A 5B0EA 1BA1A 5DLGA 4C3KA 2L9NA 4HUGA 2R7RA 3O2IA 2GHWA 5DQIA 4LIRA 2NZTA 2LEBA 5JS2A 3D3BJ 3CJCA 3US5A 3T1HF 3O08A 2AJ1A 3JSYA 1QVFR 4DV7K 1T05A 5GAGU 1HJOA 1N56A 1NRKA 4P75A 3QERA 1F9EB 1I3OB 4RW8B 5HN0A 4DUZK 2QTWA 1WSEA 1S0VA 1LEOA 1O0PA 3KD5E 1ASUA 4ZP8A 1P9YA 2C2MB 3PX4A 2WSCC 1QLNA 2JEGA 4EP4A 1D5AA 4JS5A 1WTFA 2G8IA 2IC3A 1HR0J 2AJFE 2IVYA 3GG0A 4AL6A 3PJWA 4Q8EA 4KR0B 2HIQA 1S1WB 2RE2A 4PYAA 4C8KA 1JLAA 3EKUA 5EWEA 2OIHA 3H25A 3K17A 4F4WA 1M5HA 4BS2A 5KGWA 4X66K 3FK4A 5KI6A 3VQ4A 5L1KA 3T1YJ 3CJQA 1WSIA 1UEVA 4H4KC 3FEZA 1MWQA 2ZJRQ 4OMFG 5LMNK 1YJWS 3LH2S 2ZH4A 3ILJA 4M8LA 1Q78A 3HKWA 3BUZB 2KT3A 4LREA 1RA6A 1U09A 3KLEA 2YJEA 2XZTB 1TMJA 3HHLA 2X6SA 5M1NA 1VMBA 1KAZA 2R8IA 3CB4A 2AX0A 2NXCA 2QM1A 3SBMA 3QFHA 2CZ9A 5ETLA 4DR2J 3DHXA 2NREA 3ENQA 4GRSA 4FO0A 2M2BA 4D3HA 2Q43A 3OR1A 3P45B 4E0DA 3DOKB 3BYRA 4E98A 3AVFA 3SQGB 2HBYB 1VQKN 1OMSA 4HLBA 4PPZA 4E7IA 2MKCA 5KAKA 1RWUA 1HKAA 2N82B 2ZKTA 5EWGA 2DPNA 1I51B 4EGLA 5F41A 2DGWA 3I5CA 4QWDA 1Z26A 4CT9A 4W5OA 1CJUB 1RDDA 1X9JA 1RKIA 1R31A 4FF1A 4FN5A 4CZJA 2BE7D 3C15B 5IT9Y 5M1OA 1XQSC 1J53A 2LYVA 3HI0A 2C2RA 4E1JA 3A3OB 5AZJB 3DU6A 3LP0A 4DCHA 3TNVA 3CT9A 3TZWA 3EE9A 4M3UA 4ED2A 3HTVA 3HPHA 1BA0A 5E33A 5IC4B 2R2UA 4CRJA 1RDWX 3CCJN 4OZNA 1IR2A 1HBNA 1VRUB 5HQ8A 4I67A 4OZ3A 4G3IA 4J9UE 4OPJA 3DLLQ 1X9SA 2HHHF 1LOUA 3C7NB 1TVRA 3ZLJA 4ISEA 4ZPVR 5KFWA 1HPZA 3GBTA 4DU3A 4Z7YA 1HHTP 3NKYA 4JI8F 4UUXA 1FK9B 4C3MA 1U7LA 4USVA 1KVIA 3EE3A 3T41A 3SV4A 1ZH5A 2QG9B 3KUHA 5JVHQ 1S9GB 3HSJA 4IO8A 4KH6A 1ZTWA 2PSZA 2QYGA 1KAXA 2KKZA 4P2MA 2D0PA 3R6GB 4PQUA 1N6QA 1MN9A 2VPYB 2E5LK 1VHFA 3HZGA 5TKYA 4QIFA 4CFDA 5BR8K 3SQ2A 4X4SA 1D4XA 3S01A 1IG8A 3ENWA 4K4TA 3MXJA 1RBRA 4JV1A 2XZWA 4ZLLA 3M6UA 1OQ3A 4QPTA 3HULA 1OIAA 3W2WA 2HGLA 3CQYA 3R9LA 1NCLA 1LV5A 1YTUA 2EKNA 3CCRS 4F3MA 4WQ5C 1C4AA 4R0JA 2D9OA 3M8SA 4FJKA 1HARA 4OLAA 2LQ8A 3BGRA 3MOZA 1NB2A 1GLEG 3I4HX 1M5VC 3LWLA 4DR1K 1WKLA 3L2VA 5CZVA 3PR5B 3AO1A 4JI1J 1NZAA 3Q7BA 4YORA 4AHTA 1NH7A 3SMSA 5AR0A 4KGVB 1VBYA 3IXQA 3FDSA 5FROA 1RADB 2MHNA 1Y10A 2UZAA 4TNOA 3DDIA 1NG9A 4H8KA 3C6TB 3Q2TC 2P9EA 3Q8PB 3T5LA 4CH7A 4DKWA 1MMLA 2QXFA 1M90O 3FZMA 1A5WA 3UN2A 4KJIA 3L95X 2UXDK 3ZEUB 3DYAA 1RTIA 3PNIA 3W5XA 1NDPA 1T02A 1J5EJ 3CPWM 3LPUA 5IT9O 3C6UB 3MM8B 3A13A 2LA4A 1R27B 2Z57B 3Q23A 2R8JA 3SCXA 4O4RA 4PG5A 4NYOA 5T14A 4OKEA 1O8BA 4ANEA 4A5AA 2C2OB 1JLCB 2GUIA 4P72A 2FDNA 4J9PA 4WYBA 3MTKA 1B9DA 2NLWA 5FLXY 3M9NB 3PW7A 4NCBA 3AAQA 3ID6A 4RBVA 3ZZZA 2VYPA 1LWEA 4HDGA 2PFUA 2D3ZA 2G0CA 1V5VA 3AVMA 3RAXA 5BXIA 4CVNE 5KFFA 2UUCK 2GBZA 3D0GE 4GKJJ 4DTSA 2WZ1A 1ZTTA 1FRMA 2A41A 4C1NK 4MKBA 2BMBA 2F8TA 3TAFA 3FLCO 1BXNA 1F21A 4NX9A 3CQXA 2BJ3A 2MQ8A 5CHCB 2IAJA 2LVWA 4KYZA 1U0HB 1N32K 3HFVA 3OHBA 2O4IA 2L48A 2ZFHA 3GB0A 3CC7N 1U2FA 2XSJA 4M5KA 2C22A 5D3GB 4GKKF 4X62F 4CJRA 5GAHP 2HVDA 2OEKA 4HUEA 4OHZA 1JX4A 3FMBA 3HBTA 2XI2A 3QEXA 4B3SK 4B1XB 2E1AA 2OELA 3V6KA 1RT1B 3G86A 1H0HB 4JRQA 2EFNA 3VZHA 3CJ8A 4GW6A 1ZM9A 4I7FA 4K5RA 2VWBA 4B3MK 2P9IA 4MFBA 4O3NA 3ULEB 3AOCA 4NYZA 2D69A 2QWPA 1JLQB 2NUHA 2G0JA 3SMZA 4ZOSA 2OI2A 2AU0A 3ATUA 4JEPA 5KFZA 2B5JB 3LPTA 1NMNA 3UR3C 3CC2N 4LH5A 3R1LA 2RAQA 4IRCA 2XMVA 2CNOB 4CM2A 4WK1A 3UKUA 5AJ3F 2ZH8A 2UUAJ 5KFIA 4FM2A 3ZC4A 4JK8A 4YHHF 5D0EA 4PZVA 2YH0A 1RT7A 2WTUA 2YWWA 4QBUA 1XNQJ 2QEXN 4KB7A 3DLKA 3DXKA 2ILYA 2Q1LA 3CIZA 4DTMA 2YWFA 2RRNA 1M90T 3WNFA 4TKTA 1ILYA 1FE0A 4NLWA 1KFDA 4Z0UA 4FJ7A 1NGEA 4GY2B 4A47A 3O1LA 9ATCB 3MPUB 2WFBA 3H1VX 2MY7A 2XSFA 4DV6J 4QR0A 3TAGA 1WAJA 5KFVA 4M94A 4P7TA 5A2QY 1S0MA 3MDFA 4CLUA 4DUYJ 4CJUA 2DGQA 4IUFA 1KHWA 2RQ4A 2JHEA 1QHAA 1GX5A 4C9DA 3G96A 1NH8A 2BOPA 2YCHA 3OTCA 5CYQA 2P5VA 3D1QA 1ITGA 1APSA 5L8RC 1PG5B 2W42A 2QA4S 3D2EB 2FZKB 4UT4A 3PKYA 1PC5A 2XB2D 4CFCA 4CH1A 2OTJS 1PJ7A 3A2FA 3F41A 1ULRA 5J2PB 4NLSA 1YJVA 3TJ8A 2IVFB 1MDUB 1O5JA 3QO9B 4OPAA 1GTHA 4AHUA 4A62A 2UUBF 2IA0A 3GP9A 1SCJB 4BG8A 1QTMA 3I33A 2NNWA 3NH1A 3MDQA 3TO8A 3H40A 1WORA 1SKSA 4IZ9A 3D0PA 1F60B 2DH8A 3HM8A 1Q0NA 5E7OB 3IWLA 1HBUB 3C14B 1J27A 4OGCA 3GCXP 4OYBA 3UCUP 4CZMA 2AGPA 2POKA 2QX0A 2XCPA 1QTNB 2ZQBA 5AQUA 3AV9A 4PWDA 2DHSA 4MAKA 2IYGA 3ETOA 3VCDA 2KG1A 2VQFF 1U2VA 3AY9A 2VBWA 3DFEA 2J6TA 4FW1A 2C3OA 2IBKA 1VQ7N 5CHIA 1NOYA 4IR1A 2LU2A 1JLGA 1RABB 2ZZNA 3JB9k 5F8HA 2E2OA 3MMVA 4F4YA 3CSKA 4O4GB 4M5DB 3SYZA 2FC0A 5KPZA 4BDPA 4H0OA 5CCLA 2VL1A 5HAOA 5JVGQ 2EFGA 2ZOFA 3KWGA 2M9KA 3AVNA 2O8BA 1WEXA 5IZHA 2E29A 4C11B 2XGPA 3MGJA 2BW7A 3QBCA 2HNYB 1CZBA 3B82A 1KWMA 4KB0A 2IJRA 4OZJA 2GVZA 3ZSVA 3VALA 2YNIA 3P4UB 1TKZB 2GUPA 2FGOA 4DSJA 2LP4A 3OW2R 2O3DA 4H5VA 1Z1ZA 2LA6A 2E44A 5KFCA 4QU6A 3MXHP 2J76E 2K1RA 1EX4A 1XTZA 3DCAA 2HVEA 4WFYA 1NGJA 4QS9A 4J2EA 1JIHA 2E9ZA 4FK4A 1KC8O 3KHYA 3U7JA 1WC4A 1Q18A 3RSEB 3V1QA 3Q2SC 4X64F 1FJCA 3DRYA 3KG0A 4CJ3A 4DQPA 4LF7J 2O66A 3BBCA 2GA7A 4OI4A 2BVZA 3OA9A 1KQFB 2CDRB 2IJNA 1XERA 2ZHBA 2JZ5A 1WI8A 1LWFA 2VWJA 3LAMA 4LF6K 1WG1A 3UCZP 3CULA 4IJNA 1BUPA 5HRRA 4LT6A 1GLFO 1ZBSA 5B0BA 3SXLA 3VOVA 4K4ZA 3P31A 4P2FA 1RBLA 4WQ4A 1J6ZA 4FL9A 1SQEA 2IGIA 3NWGA 3F2KA 1LW0B 1S1UA 2JNJA 2O01C 2GVDB 4HCCA 1NSAA 3GJQB 3JYTA 3P38A 2D0AA 2ASJA 4FLVA 2BW2A 3PYEA 4CEDA 3AH6A 2YWGA 4NI2A 4WYWA 3SQOP 2QWMA 3HDSA 3SFUA 5CCMA 2CNNB 2YHAA 4DSIA 1K8AO 4CZCA 2HPUA 2H65B 1IKWB 2DGXA 2ZD1B 1V3RA 2XLJA 4DV5F 4K0KJ 1C0MA 5HJXA 4DFJA 2E6MA 2ZWPA 2DR7A 5HRNA 1RHUB 3BEXA 3SUNA 4JV5F 1ZYQA 5IQ6A 3CF5L 1Q82O 4C8LA 4ZVPB 1QVGM 4HT7A 2VICA 4W90B 2B8QA 2OPRA 1D9AA 1YRTA 2B7BB 3TP2A 4LFCK 3IS9B 3WHIA 3CYMA 4BC3A 5I4MA 7AT1B 1TYQB 1Q8BA 2DFFA 1ZPWX 5HMWA 4KHRA 1FD8A 4NYNA 3VQ8A 2OCEA 5E41A 4X66F 4F2SA 4Z94A 4LFAF 2MQOA 1NK9A 4DV2K 5LMNF 4I2QB 2VOOA 3BZKA 4U9RA 1O6XA 2XHBA 1C1AA 2VH7A 4G1QA 3D2FA 8RUCA 3QT7A 3D0IE 2IPOB 4LVOP 3Q8SB 1PBAA 1UVMA 2XM3A 3LP2B 4IKFA 2ZITA 1UKUA 1NO8A 3FUYA 4DR4K 3LM9A 4DSEA 2YKMB 3OJSA 1TK8A 1N33K 3CMAN 1KC8T 1HKGA 4BVOA 2QA4G 4LQ9A 4R8UB 3TA0A 2IBOA 4LSZB 3TW0A 1YRUA 2HFUA 3BN4A 2BE2A 1GLDG 3BO2A 4PYDA 4BRQA 3WQTA 2YH1A 4RO0A 4QQBA 2YKNB 3WQPA 3I5AA 4M41A 2AKWB 3CXCR 4KGKA 1UPMB 2D5RA 3OYBA 3IKMA 1BISA 3QBXA 2YHBA 2V63A 1CJVA 1CXQA 2EG2A 3R2CJ 4B3TF 1QQMA 2DNZA 2ZKUA 1IBMF 5T41A 2ASYA 2IIHA 2OPPB 2H5EA 1NU4A 4KPCA 5DJBA 4ZVUB 3NNHA 3QMLA 4LF4F 3S3OA 2E1PA 1ZM3A 3TUZC 4EFAC 3GCWP 3C8YA 3UD3P 4EZ9A 4J9RA 2ZH5A 3KUGA 3I56S 3HT0A 4K2JA 5L1IA 2E1RA 1K8AT 4LMZA 1WF0A 2HFOA 4Y0WA 4X65K 2Q97A 4DV0J 4LSNA 1HNIA 4JI5J 4XPEA 1JLFB 2M0GB 4NLTA 3LL3A 3OFGA 5A6WA 4MDAA 3HHEA 1Q82T 2O1PA 1A5VA 3CM5A 1K73O 1FKPB 4CFAA 2Q3SA 2QL9B 4B1ZA 4OYOA 5C2DA 4Y00A 2V4RA 2V7ZA 3CCES 1BCOA 4DR3F 1Q16B 3CCUN 2G13A 2YQ1A 2XMMA 4R25A 2Y9HA 4IDKB 2X3GA 4QW9A 3H0PA 3C6AA 4ELVA 1Z4UA 3GU0A 4KBOA 2MZJA 4Y0FA 4L76A 4PXDA 4B1VA 2G2YA 4MMOA 4ZK7M 3J7AP 4UQTA 1VQ4S 1UETA 1Y9OA 4KI4A 2QKKA 2HVZA 3IWXA 1VQ8S 2ZVSA 1S10A 4LJMA 4LF5J 1RISA 3EUNA 2XQCA 2YNFA 5KFJA 3IG1B 3TANA 3HVTA 3ZSXA 2YHYA 3ULDA 4YY3J 1TTHB 3M30A 3AO3A 2A18A 4CGIA 1T95A 3IUCA 4OPKA 2ETJA 3EKSA 3H42A 2VQEK 4JI0K 2JWNA 1XMQF 2MKKA 2GAGC 5ETOA 3NF7A 3NFAA 4BRCA 2R7VA 4KGMA 3VWSA 4C8MA 2V9WA 4O8KA 2HYIB 5GIOA 2ZHAA 1CULA 5AQYA 5DG9A 4IH7A 3WNHA 2EPIA 3ZFVA 2D0BA 2MDAA 3NGKA 1SUQB 1N5TA 3P1GA 4PG8A 3QFUA 3J80U 4LF8J 3MFHA 5ADZA 4JK9A 3THTA 1LW2B 4ICLB 4JUZA 4JI4J 2QT7A 1WEZA 1BDGA 5BPNA 4FF3A 3AVLA 1CG2A 1TMMA 2XHWA 3DDKA 3B6BA 2B51A 4J9SA 1F9HA 4ANCA 4QOTA 3UIQA 3IA0A 1NJYA 3L3VA 2ZOMA 4TSXA 5E26A 5J2QA 4L74A 2IRUA 3WXKA 1TK0A 1ZBFA 4LC9B 2BJ8A 1X9WA 1FJGF 4QS8A 2V4QA 4JHDB 2DR8A 1FXDA 2MKYA 4ZLPA 3JSRA 4NLVA 2W8KA 5KPRA 3KK2B 3H3NO 3K9JA 4ZP6A 2C3YA 2CPFA 2RSQA 2KYXA 3VTIA 3CJKA 1JKHA 4F4ZA 2E2NA 4DR5K 4HEA9 2HNDA 3ILLA 3UR0A 4ETZA 2NUBA 4JS4A 2F8HA 3LP3A 1QVFM 2VFSA 1Q5VA 5KT6A 2MJUA 1ZZNA 1TUYA 3CJBA 1D0EA 1OSCA 3NNCA 1RKJA 4P10A 1K73T 2E5GA 2CWKA 1Q7LB 2BQUA 2HRYA 4A5BA 1WC3A 4C23A 3PUFA 4OX6A 3A5NC 2EKYA 4OO1J 5HL7L 3AB4B 3QZ8A 3MCPA 4CTAA 3AA2A 1HNZJ 4JI6K 1G15A 3S3NA 2KVIA 4A8YA 5IM0A 1MMNA 4HTIA 2F4FA 4I2PB 1IXKA 1YBUA 1S79A 4B9UA 1YVUA 2XY8A 4PKIA 1S7HA 5A8RA 5E3CA 3DXMA 2CFXA 3IO1A 5AE3A 1RBVA 2JRSA 4IOBA 2OEJA 4ECYA 2QWOA 3D3CJ 4L3QA 3NS6A 5KFYA 4OZ2A 3HOTA 1Y11A 1XNRK 3DMJB 4WIQA 2FBXA 4N7TA 1B3TA 5BRDA 1LAVA 3OTOF 2DIVA 2BJDA 1R8AA 1T6DA 3VGKA 1V9OA 3ASMA 4M45A 3QEWA 3WIVA 1NPKA 2IMWP 4ECTA 4KV8B 1SL1A 4EI2A 1P8ZA 3UE2A 2KG0A 1DLOB 1CJKB 5JLHA 4F3TA 3FZ2A 3VVTA 3AO5A 2V8GA 2QJ3A 1T7PA 3I55S 4DHYA 2CPDA 3M2VB 3MPDA 4DHVA 1ASWA 2C1EB 1AYEA 1GK8A 4CZKA 1RZMA 4NXMF 4JOUA 1S9EA 5ETKA 1I94J 2OPSB 4FWRA 3G2XA 3CHWA 1K0VA 2CJKA 4O3PA 4CJ7A 4YFUA 2G0IA 3VHQA 4FJ5A 1IJEB 2YX4A 5AQXA 4JKGA 4P74A 3K5LA 2O8EA 3MD1A 1EAYC 1R8BA 3D66A 3QESA 4I69A 3UQSA 2E1MC 5JMNA 2R3VA 1RHMB 1VQSA 1ZXOA 2E20A 1BL3A 4H0XB 3M5RA 4FDFA 3UE5A 1ZETA 2NYIA 1X5PA 3GR1A 3ET6B 3J7Z5 4CK2A 3OS2A 3HO1A 1IBLF 3NF9A 2GV1A 4CO3A 4RW7A 4FWNA 1K8KB 2C42A 1W2BR 2EC0A 2DGVA 1B92A 1IKXA 4XIUA 3FBEA 3DWLA 3CDWA 3Q7CA 4NOHA 5KFOA 5GAHI 5DRKA 4TU8A 3OBYA 3V9UA 5AQFA 4F02A 4J9QA 3SI6A 5LSOA 1RGIA 4WFNQ 4OX9K 1D3WA 1I1GA 2F65A 4CE9A 4DV3F 3MN9A 1TGOA 4FYVB 2K8GA 3T1HJ 4CIGA 2DHXA 3NBPA 3VEWA 4WCEQ 3MCAB 3O5TB 2BRKA 3T9ZA 3MM9A 5AQTA 2XLIA 1H38A 3IDHA 2ZH9A 4CNYA 3EGZA 4FF2A 3BH7B 1WHWA 2DIUA 2Q6CA 4DUTA 1RT6A 2Z1IA 4U7CA 2XO7A 4FJHA 4A8KA 2R7QA 4KFBB 1QM9A 4WWSA 3X3