5FDLA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with idx899
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
550
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of the Aryl-phospho-indole IDX899, a Highly Potent Anti-HIV Non-nucleoside Reverse Transcriptase Inhibitor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase
molecule keywords P51 Reverse transcriptase
total genus 144
structure length 550
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5fdlA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5fdlA05
5HRNA 3RBEA 4J9RA 3OYGA 1Z4UA 1OS5A 2ZKUA 4Y2AA 3KLEB 1VRTB 1JL1A 4IQXA 4OKEA 5KT3A 4J2AA 5KTQA 1SH2A 1HYSB 4K4XA 1T94A 3FSIA 1HQEA 4MFBB 3M8PA 4QAGA 5C42A 2YNGA 4W5TA 3L2QA 2YNGB 2B43A 3KOAA 3CG7A 2AWZA 4FJLA 4RUCA 5FDLB 2WHOA 3DRSB 1RDAA 5HRRA 2HWIA 2AQ4A 3BQ2A 3V81B 1ZBLA 2C2DA 1CXUA 5FRNA 4FJXA 2KZZA 3V4IB 4EEYA 4HVJA 5HLFA 1QUVA 3MR2A 1TGOA 4KTWA 2B4JA 4EO8A 3G10A 2HNYA 4ED7A 1KFSA 1HQUB 4B8CA 1IKVB 1XI1A 3I0RB 2HMIA 4HYKA 1RDRA 1XHXA 3VQDA 5KT4A 1IKXA 1S1VA 4JUZA 4DL7A 3CDWA 1HNVA 4LQ3A 1HNVB 4WYLA 5F9NA 1U45A 2WB4A 4DLEA 1IKWB 2RKIB 1JLBB 5CZ1A 4DU4A 4O44B 2KW4A 3OSNA 5DQGA 5KFZA 3VA0A 4NYZA 4ID5B 3MXIA 2XY8A 1RT1B 1JLAA 3NGIA 1ZYQA 3VQ9A 4ZP6A 4CGIA 4RU9A 4J2EA 1S48A 2ZD1A 3BQ0A 4FYDA 4LY7A 3NL0A 1T03B 4CHYA 3KK2A 3KK2B 4RW7A 4K4WA 4RW7B 1KVAA 4CFBA 1EETA 1BIUA 4CK1A 2R2TA 1C6VA 3NFAA 3UDLA 2IMWP 4I2PB 3P5JA 3EZUA 2J6UA 2R7YA 1VSLA 3AVAA 1TKXA 1G15A 2X6NA 3VQQA 4F4WA 1XR5A 2EHGA 5I42B 4BE2A 2YNHA 4ECUA 3OL6A 4F3OA 3HVTB 4DF4A 4KHMA 4CEBA 1RTHB 1S10A 1JLCA 4FJGA 4WZMA 1QQCA 1RTDA 4Z4FA 2R8KA 1RTJA 3Q8PB 5CY4A 3DM2A 5CZ2A 3BSOA 3GV5B 3D0PA 2ZE2B 1C2PA 3CFPA 3KK3B 4IFVB 3VQBA 4IH6A 3CM5A 4PA1A 3K59A 1KHWA 3ZT1A 2BQ3A 3V1OA 4Q5VA 3KHLA 4M3RA 3V1RA 3LAMA 4ZP9A 3SQ2A 3LP3A 1VK0A 3VQEA 1WSHA 1QTMA 5CYQB 1S6QB 4LD0A 4F4ZA 1D8YA 3I0SB 3RMDA 1KFDA 4KHRA 4CEOA 4ICLB 3V9UA 3OYBA 5HROB 4CECA 3EYZA 2P5GA 4YP3A 4WYWA 2FBTA 3TAGA 1RT2A 4I2QA 3NAHA 4E7KA 4WZQA 4NCAA 4FJ9A 1DLOA 4B8AB 4TY8B 1LWCB 1UWBB 4O3PA 4X2BA 3SI8A 4N5SA 3I5BA 4I7FB 4G3IA 3NF7A 1S1UA 1N6QB 5KT7A 3EPIA 3IRXA 2LSNA 2UUTA 1LWFB 4QWAA 2VG7A 2JC1A 4DEZA 4J9KA 4ELTA 4HHTA 3HM9A 2XI2A 4M3YA 4FZXC 4E7IA 4PWDA 4CFCA 3MEDB 3T5LA 2UVWA 3AVFA 1RT3A 1FKOB 3AA4A 4LSLB 2FJXA 4J9PA 4KHSA 3V81A 3ZSYA 1RT2B 5EUHA 2XY5A 2BANB 3G6XA 1S5JA 2FBYA 1XHZA 5F8JA 4Y1CA 1IG9A 1WSGA 3MEEA 3VQ4A 1REVB 1UOCA 3LWLA 3H5YA 4PQUA 5F8IA 1JX4A 4CGFA 3PW2A 3MTKA 2W8KA 4MK7A 4YNQA 1N48A 3OYJA 4C8KA 3LWMA 4XO0A 3VN5A 3V9XA 1U09A 1U04A 4JLHA 4ZPBA 3AA3A 2VWJA 3KLEA 4IRCA 3UQSA 4RW6B 2VG7B 3AVIA 3KLHB 2C28A 1WSFA 4MFBA 4B9LA 4H4OB 3C6TB 1NKCA 3DRSA 4TQRA 3MFHA 2W7PA 4FBTA 2FVPA 4UQGA 1LWEA 3IS9B 4N76A 1SL2A 4FLZA 5KFHA 1GOBA 4KRFA 2E9ZA 5KFSA 4KV8A 3PHEA 2IA6A 1A5WA 4MK9A 3MR6A 5KFUA 4E1NA 4RNHA 4E3SA 4CE9A 4PQUB 4KBIA 3PZPA 5KT2A 5F9LA 4NZ0A 2R2RA 4FZZA 1S1WA 5J2NA 4O3QA 3OY9A 3DOKB 5KFEA 1WAFA 5K14A 3VQPA 4ECSA 2VWKA 3DLBA 1NJZA 4F2SA 4DMNA 4TXSA 3ICLA 5J2PA 2KZMA 3BGRA 3E01A 4DTXA 3ALYA 1RCHA 4KB7A 2PZSA 1EX4A 2ITGA 1LWEB 3RWUA 3DRRB 5KG6A 3BR9A 3P83D 1B9DA 2HW3A 2OPQB 4EYIB 1RT7A 3KJVA 3HVRA 3HP9A 3G6VA 4MKBA 3THVA 4NCGA 1IM4A 4DTOA 4DSEA 2AGQA 1R0AB 2B6AA 3OLAA 4NLXA 4OPJA 4YMEA 3I0RA 3KHHA 4OGCA 1QSLA 1S9EA 1C1BA 4FS1A 4URSA 3QGIA 2YNIB 4QPXA 1JKHA 1U47A 5KFIA 4CESA 3DI6B 4NLQA 1BQMB 4JV0A 4IR1A 3QNNA 5E41A 4IKFA 3OYAA 1BISA 3OL8A 4FLWA 4FVMA 3GIKA 4KHNA 3C95A 1WNSA 3AVGA 3ASMA 3Q8QB 4DL2A 1S9FA 3ZSVA 3ITHA 3ITHB 3T1AA 2VG5B 2AGOA 3IG1B 2GC8A 1D1UA 3PJWA 2XCAA 2XWYA 4DTSA 4J9QA 5KFWA 4IRDA 2ETJA 3PR5B 2E9TA 2HAIA 1RBVA 5L1KA 2HWHA 2AU0A 1JXBA 3EZ5A 3DOLB 3OYCA 1JXLA 2HHVA 3ZT0A 3AVMA 1UAXA 4BDZA 4YR0A 1Y97A 5DQHA 4O3OA 5L1IA 4O0JA 5SZTA 2JEJA 2AJQA 2YHAA 3RMCA 4HCBA 4IG3B 3RR8A 2B6AB 3PW0A 3RMBA 4CEEA 3RRGA 4ZP8A 3TWHA 5L9XA 2HHWA 4Q45A 5HP1A 3O3GA 3UIQA 4NRUA 3OS1A 3M8QB 1IKXB 3H98A 4KFBB 4E19A 3PX0A 4EYHB 4Z0UA 1S9GB 1NK7A 4TY8A 3FFIA 3OYDA 5DGBA 1SUQA 3QLHB 2I1RA 3AVKA 5F8LA 1S6PA 4ZMMA 2OPPA 1TV6A 2DPIA 1BI4B 5HBMB 3DLRA 1HYSA 2HHTA 1YVFA 1XR7A 3NE6A 5KFRA 3G6YA 3KD1E 3VA3A 2Y1IA 3E51A 4M45A 3OL7A 4Z4IA 2P51A 4OGEA 4B9SA 1X9SA 3TVKA 2XY7A 4CJEA 4BACA 4CJWA 5KG1A 3L3VA 3KIOA 1RDCA 3SZ2A 4NLWA 2JC0A 1ZTWA 1KHVA 1IKYB 1S1TB 4KHUA 2HHXA 4B9TA 3M9NB 1EXQA 4I2QB 1TL3A 3NGYA 3NAEA 2OPRA 1RTHA 3PX4A 1SKWA 2IM3A 1JLCB 4FJHA 4IFYA 5J1EA 3O3FA 4EP5A 3OS2A 3OYFA 4K50A 4BE1A 3G0ZA 3RRHA 3DLKB 1TKZA 4AHRA 4R0EA 3GIMA 4EP4A 4CGDA 1S1WB 4CF8A 4BWJA 2YNFA 1RNHA 4BE0A 3MEGB 3A2FA 2V4RA 1KLMB 1T8EA 5JS1A 1KVBA 1JL2A 3WNEA 1D9FA 5I3UA 1K1QA 2WCXA 4Z4CA 3OJSA 3S3MA 3JYTB 1N5YB 4ZPAA 4Z4EA 1JLFA 1UA0A 4CEAA 1JIHA 1ZBHA 1QS4A 3DMJA 4ICLA 2Z1HA 4FM0A 1RT3B 4RG8A 4H4MB 4IH5A 1T03A 2RN2A 2HNZA 5D3GA 4MIBA 4B9MA 3N6MA 1DTQA 3KKRA 4DFMA 1VSDA 1KSPA 2XC9A 1WSJA 3KLFA 1YVUA 3V9WA 3V6DB 3V6DA 4CFAA 1S1XB 3RB0A 2FVSA 2E6MA 4YQWA 4Y1DA 1ZBIA 2G8IA 2V9WA 5KFPA 2GIRA 3ZSOA 5EU7A 4W5OA 2X6SA 4FJKA 3K5MA 3MEGA 1QSSA 1JLBA 3VQ6A 2RDIA 4NLSA 3OVNA 4QW9A 3LAKA 3KLGA 3CFRA 5C42B 1KCFA 4JRQA 3DRPB 1X1PA 3CVKA 4HKQA 3IG1A 5T14A 4F50A 3FQKA 3C94A 5KFGA 5FDLA 3KKSA 1NOZA 1TK8A 2HVIA 5SWMA 2F8SA 2F96A 5KG3A 3OHBA 4WXOA 2XHBA 2JLEA 1KRPA 4ECVA 1YTAA 1U48A 1F21A 4U6PA 1RT5A 3WNGA 2HNYB 4WFYA 3ZSQA 2WOMA 3SPYA 4K8XA 3JSMB 3KK1A 2HMIB 4YR3A 2G8KA 4GC7A 1HMVB 4W5QA 2G8VA 1HMVA 3CJ5A 2RDJA 4E7HA 2W9BB 4MKAA 5KG4A 4F4XA 3QO9A 1CZ9A 1U49A 4K4UA 4ECXA 1TKTA 1C0UB 2VA3A 1S0MA 5L1JA 4ZTFA 2JEIA 1RTDB 2FVQA 4J9NA 3PX6A 4CJUA 3EPGA 3T3FA 3K58A 2QXFA 2ZE2A 5KFQA 3CJ2A 1BI4A 1HARA 2DY4A 2IM1A 4FLXA 3N6NA 3DRPA 3EY1A 1HJRA 3OS0A 2D0AA 4DFJA 3L2WA 4K4VA 2ZD1B 1S0NA 3I0SA 3LP2A 1L3UA 4FW2A 1S9EB 1NJWA 4B3OB 1MMLA 4KB0A 4FK0A 4J9SA 5KFLA 4J9LA 4ECQA 5DG7A 1C0TB 2IAJB 2E6LA 3DI6A 4F3TA 1DTTA 4QWCA 2FBVA 4M42A 2R8IA 1K6YA 1HYVA 2YNHB 4GW6A 4U7CA 4NLOA 5JXSA 4NLPA 2DPJA 1HYZA 4KHQA 1JLGB 1NJXA 3NF6A 3T19A 3HXMA 4J2BA 4I7FA 1N6QA 4M3XA 4RNMA 2OZSA 3HYFA 2FVCA 3CJ4A 1J5OA 4I9LA 4CJ5A 5C24A 2D0CA 5FROA 4WFZA 5JUMA 3PUFA 5EDWA 4F2RA 4ECRA 3DLGA 2YV0X 1TL1B 4C8MA 4E89A 1GOAA 1KTQA 5CYQA 1EETB 2RPIA 4E0DA 3OSPA 1S97A 3CDEA 2IJNA 4DTUA 4O4GA 3GILA 2BE2A 1HRHA 1YTUA 3QIOA 1L3VA 2QKKA 3MECB 4RW4B 5HP1B 3D5MA 3GIJA 1C1BB 2KQ2A 4FJIA 4NLDA 4CEFA 3AVNA 2BRLA 3VQ7A 3BSAA 1VSHA 3D28A 4ED2A 4Y34A 3MR5A 2NUBA 4DTMA 5J2MB 3H40A 3TAPA 1VRUB 3CJ0A 1DTTB 4CF1A 5JS2A 3NGDA 4F4YA 2OPRB 4H8KA 3TI0A 4DS4A 4Z4GA 4ZP7A 5KFMA 4URQU 1S49A 4Q0BA 4DSLA 4CF2A 1TV6B 4MIAA 4ZVHA 4M3WA 4DTPA 4KI6A 3U6FA 1VRTA 5J2QA 4C8NA 3K57A 2YKMA 2KFNA 1TK0A 2VA2A 3KNAA 1J53A 2OPSB 3BGRB 3E01B 3ZSZA 4KO0A 3TAQA 1RTIA 3V9ZA 2CJQA 1VSFA 3SUQA 5C25B 4CK3A 1SH0A 4CERA 4CHNA 4CJFA 4CIEA 1LW0B 4O4GB 1ZTTA 2C22A 5F8HA 1TP7A 3LZIA 3C6UB 1NK5A 3BREA 1T05A 4WE1A 5KFJA 5KFKA 1BGXT 2F8EX 4B9NA 3QEIA 3DLKA 2GUIA 1RT4A 3OYMA 4DQPA 4CCHA 3KK1B 3MFIA 2A1RA 3QERA 2BDPA 2RF2B 2A1SA 2W9BA 3DYAA 2FJVA 1CZBA 3BJYA 1IO2A 4H54A 5DK5A 4FJ7A 4FJ5A 3KLIA 2B5JB 1RBUA 3V1QA 4ZHRB 2OA8A 4FM1A 3B6PA 2W8LA 1MU2B 1I39A 4IG0A 4O44A 4K4YA 4FM2A 3MAQA 4OVLA 4O3SA 5EWGA 2IC3A 3QIPB 3KLVA 5DG8A 4LSNB 3K5OA 3IAYA 1IKYA 4R5PB 3MEEB 3D45A 3F9KA 3V6KA 4KTQA 4DSFA 1RDBA 4ELVA 4FXDA 3NH0A 4ZPDA 4ED6A 3H59A 4HUFA 1TKDA 1CXQA 1S1VB 1RT6B 5F8NA 4XPCA 4EBCA 2XCPA 4JS4A 4CJSA 4QOZB 4HUGA 1NKBA 3HKWA 3PJXA 2WRMA 4W5RA 3NBPB 4YR2A 1VSIA 3V9SA 2G8WA 1WN7A 3KLIB 3JYTA 4O5BA 3QEPA 1RDDA 3TAFA 2IBKA 2GV9A 2HNDA 3HPGA 4ZPCA 4ZVFA 2VG5A 4FJNA 2P5OA 2XO7A 1TL1A 3KMSA 2ATQA 2FJWA 4RNFA 1N56A 3SUPA 3ZT4A 5HLFB 3FQLA 1RBSA 4GC6A 4NLUA 1TAQA 3S3NA 3SFGA 3VQCA 3BDPA 4NLTA 4K4ZA 4KFBA 1L3TA 5I42A 1JLEB 4FW1A 4CEDA 3IGNA 4ZTJA 3O3HA 4BWMA 2W9CB 4FJMA 1JLQA 2C2RA 1J9AA 4KAIA 1RA7A 3NF8A 3GQCA 2BRKA 3DM2B 1LAWA 4NYFA 1C0UA 4Q0BB 4KHYA 2ASJA 1HPZB 1UWBA 3DLEA 4R8UB 4NLRA 4IFVA 4CJKA 1LW2B 4FS2A 2AX0A 4F8RA 3SI6A 3VQ5A 2BQRA 3LP0B 3LP0A 4K4TA 4KPYA 1K1SA 3LZJA 4KAZA 5I3UB 3TANA 3DOLA 5KFNA 1BCMA 1XWLA 2ZQBA 3B6OA 4DU3A 4NLGA 5EWEA 2R2UA 5KGWA 3SUOA 1JLEA 4OKKA 3L2RA 1REVA 2R8GA 1ASUA 1LAVA 4O55A 4FBUA 4EZ6A 4ED8A 2OH2A 2XGPA 4TYBA 3IGVA 4B9UA 2HHQA 5J1EB 2IM0A 1JLGA 4ECTA 2HHUA 1LV5A 1S1XA 3DLEB 4R8UA 1SUQB 3DDKA 1YT3A 3RR7A 4DSIA 3DYAB 3CO9A 3KTQA 4ZVEA 3KK3A 5KRSA 4DFKA 2G8HA 3BQ1A 3TR8A 5DGAA 1QAIA 3PO5A 2VG6A 5KG0A 3K5NA 3LP1B 1ZETA 1TK5A 1C0MA 3I5CA 4DL3A 1GX6A 2BE2B 4Q43A 2F8TA 4NYNA 2IAJA 3QIPA 2IC3B 3ZSWA 4AILC 2JEFA 2HHSA 3S9HA 4DTNA 3PO4A 3C6UA 4IOBA 4QWBA 4KE5A 3AO2A 4PUOB 5KFFA 1DLOB 3HJFA 1ASVA 4JV2A 3QYYA 4XIUA 3PW4A 2RF2A 4TQSA 3OL9A 1LWCA 5J2QB 3RB6A 2D0BA 3HVAA 3FRZA 1A5VA 4KI4A 3LDSA 4CJLA 1RYSA 1S1UB 1RBTA 3CWJA 1W0HA 5FRMA 5J2NB 3HL8A 2EX3A 1NHUA 3MXJA 1WNEA 2HB5A 3NH1A 2RKIA 3LPTA 4PWDB 4BDYA 3H4BA 2HVHA 3C6TA 4N41A 2HNDB 4DL5A 3ZT3A 5C25A 1L5UA 3NKYA 3MECA 4RW4A 3BSNA 1D5AA 1R0AA 3SQ4A 2BR0A 1IH7A 3OYKA 3ISNC 4PUOA 3LP2B 5HRPA 4PY5A 4G1QA 2IJFA 3L3UA 5T7BA 3P1GA 2D5RA 5KFBA 4DSKA 4KV8B 1NK8A 3SNNA 1L3SA 4I2PA 4L8RB 2XI3A 5F8MA 4ECZA 2XRIA 1JKHB 3NF9A 2XGQA 1TKXB 2FVRA 2WTFA 4O4RA 2IS3A 4E7JA 4HTUA 2YNFB 2W42A 2FLLA 4OKJA 2KTQA 2G8FA 3O4QA 1S0OA 4J9MA 3S3OA 3QGHA 3H08A 1FKPB 2DFFA 1NOYA 1FKPA 4Y3CA 4ZHRA 2XY6A 4DQIA 3HPHA 5DG9A 2ATLA 3TAEA 3NBPA 3H5UA 2PY5A 4I9QA 4RW6A 3KD5E 4H4OA 2DFEA 3GYNA 4M3TA 1SKSA 4NLVA 4B08A 3IS9A 2D41A 4FZYA 3CQ8A 4FLYA 1RT7B 3KJVB 2FBXA 1NK0A 2OPQA 3Q8SB 3ZCMA 5KRTA 1JXEA 3QEXA 2W7OA 3ZSXA 3BSCA 4NCGB 4RUAA 4E1MA 5KG2A 3TABA 2BGGA 2Z1GA 1DTQB 4F4KA 4R5PA 1T05B 4M41A 3OJUA 3HHKA 5KFTA 4JRPA 5C5JA 1IKVA 2W9AA 2KFZA 3VQAA 2D3ZA 4AHSA 4QWEA 3RB4A 1J54A 1Q9XA 4IBNA 1BQMA 3QEWA 3M8SA 2UVRA 4DG1B 2Z1IA 3SPZA 3DOKA 1TKTB 5KFAA 4LH4A 5K14B 3VQSA 1EP4B 4TN2A 4CEQA 2AX1A 4ID5A 2DFHA 3TARA 1HNIB 2IM2A 3DRRA 1MU2A 2OPPB 4IG0B 4KTZA 1BIZA 1T7PA 1RT1A 2J6TA 3SV4A 1ASWA 5KFVA 2ASLA 3RAXA 4LH5A 5KGXA 1SL0A 1S6QA 4QW8A 3LP1A 1FK9A 1FK9B 1WAJA 3AVLA 4Y2CA 4CHPA 3QIDA 5DQIA 5KFCA 3AO3A 4IDKB 3ISND 2ILYA 2AGPA 3CIZA 1W25A 4C8OA 4CJRA 5J2MA 2WONA 2GIQA 2E4LA 4M3UA 4FLUA 1WSIA 1S4FA 4DQSA 3HK2A 3QO9B 3FFIB 4RW9B 1QAJA 4FJJA 1D9DA 5L1LA 1Z25A 2X74A 4DL6A 1TKZB 4CF0A 1KLMA 4HUEA 3CFOA 3V6HA 2YKMB 1SH3A 5HBMA 4MK8A 4WFXA 4CHZA 4DSJA 1JLAB 2EC0A 3HT3A 2VG6B 3AO5A 1TVRA 3PW7A 3OHAA 4J2DA 3G86A 3LANA 2UUWA 4IR9A 2UVVA 2R8JA 3NMAA 4H4MA 4CJ4A 4IDKA 4AHCA 4CGHA 2IOCA 3AO1A 2DTUA 2FLNA 3HSTB 3NHGA 2BANA 3WNFA 4QCLA 2X78A 4JV1A 1U4BA 3RBDA 1VRUA 2YKNA 2JEGA 1QHTA 4DTRA 2YKNB 3H4DA 3O4NA 4CK2A 1JLQB 4AHVA 3AVHA 1Q9YA 1TAUA 4WE1B 3AVJA 3KMQA 2JGUA 1FXXA 1I3AA 1S6PB 1LWFA 3PY8A 2FC0A 3T5JA 1KVCA 3TAMA 1O1WA 3NH2A 4MQ3A 3IN5A 3MR3A 2B5JA 4XPEA 1QE1B 1QE1A 3F73A 3QZ7A 3AVCA 1Q8IA 3OYLA 1TVRB 1IKWA 5J2PB 3DLGB 3LPUA 4ZVGA 1HQEB 4RZRA 3M8PB 3QNOA 3MXMA 4FLTA 4W5NA 3SQ1A 5KI6A 4E7LA 3SCXA 3V4IA 5DLFA 2CKWA 3OYNA 3SYZA 2IDOA 1BQNA 4GVMA 4ED0A 5DLGA 2WK4A 4KKOA 3KLFB 3NAIA 1X9WA 1C1AA 4DWIA 3AVBA 1RT6A 4FJ8A 1ZBFA 3T5HA 2C2EA 2YHBA 2QE5A 3M9MB 3M9OB 4O0IA 1TQLA 4DL4A 3I8DA 5DMRA 4DG1A 1SKRA 4M3ZA 2V0NA 4DU1A 1N5YA 4M95A 2D3UA 4CGGA 3CYMA 4JS5A 4AH9A 2I5JA 3PVXA 4DQQA 3DMJB 2ILZA 3L2UA 3DLHA 4ELUA 2E9RX 4CFDA 3VQ8A 3M8RA 4IKAA 4TSXA 3NCIA 4DS5A 2GBZA 1SV5B 4KSEB 1NKEA 1C1CA 2R8HA 3SFUA 1NNDA 3KHGA 4G1QB 1VSEA 5D3GB 4GMJB 3KHRA 4IG3A 4CJ3A 4B3OA 5CYMB 3RAQA 3GV8B 4KREA 3OLBA 1D0EA 3GV7B 1C0TA 4J9OA 4OLBA 4CHQA 4CIFA 4OPKA 4EO6A 1T3NA 3QGGA 1VSMA 4ID1A 4RW8A 3SJJA 3PR4A 3T5KA 4CHOA 3NGZA 2W9CA 5KT6A 3V6JA 4DTJA 4WXWA 1BL3A 3Q8RB 3KLGB 1J5OB 3QINA 2R2SA 1GOCA 1VSKA 4DLGA 4URGA 1HPZA 4ECYA 1Z26A 5F8GA 3FDSA 3U3GA 1QSYA 4O3NA 2I5JB 4CJQA 3PV8A 3OYEA 2Y1JA 4LSNA 4Q8FA 1ZBUA 2OZMA 4TY9A 3K5LA 4Q8EA 4ECWA 4FLVA 3MEDA 1A5XA 4CJPA 1C1CB 1WSEA 4FK2A 1HQUA 3LALA 4YFUA 2V4QA 5CYMA 3H5SA 3UR0A 2PYJA 4RNOA 1RT5B 2QKBA 1RBRA 1X9MA 1RYRA 2IGIA 3JSMA 3L8BA 3CM6A 4RW8B 1NJYA 2O4IA 2ALZA 1NHVA 5KFYA 4CJTA 3ULDA 1W9HA 3CJ3A 1RTJB 1VSJA 2UVUA 1CLQA 1BCOA 3QLHA 1HNIA 3RB3A 5KG5A 3GIIA 4IRKA 4NRTA 4MH8A 1LW2A 3QESA 2PYLA 3IRXB 3AV9A 4KHWA 4RNNA 1RILA 3ZT2A 5HRSA 3RMAA 2OPSA 3QEVA 4CGJA 3WNHA 1RTIB 3AO4A 4DFPA 3H5XA 4DF8A 2QV6A 3U3YA 4AHUA 3HP6A 4KB1A 4Q44A 1XR6A 1ITGA 4HCCA 2WONB 3PW5A 5EWFA 4K8ZA 4CF9A 3M8QA 2BQUA 4LSLA 2YNIA 2HNZB 3N6LA 4NCBA 2QK9A 3HVTA 1S9GA 1BQNB 2Z1JA 1XC9A 1TL3B 2G8UA 2Q3SA 4KKOB 5KG7A 3RTVA 1B9FA 3OYIA 3SV3A 1RT4B 1EP4A 1GX5A 3TAMB 2O4GA 2OYQA 3NDKA 4EZ9A 3HPOA 1NK4A 1NK9A 4B9VA 5C24B 4ED1A 3QZ8A 4EBDA 1BHLA 2O5DA 3K2PA 4M94A 4OJRA 4Z4HA 1SL1A 4CIGA 4C8LA 4KO0B 1CSJA 3SUNA 1JLFB 3KLHA 2D7SA 5KFDA 3I5AA 1RA6A 4CEZA 4CJVA 3ZSRA 3AA2A 2FLPA 4FCYA 4AHTA 4EBEA 3L2VA 1NK6A 1N4LA 4OL8A 4TLRA 5HROA 1FKOA 3HVWA 4N47A 3QETA 1RAJA 4BDPA 1LW0A 1SV5A 1S1TA 4IH7A 3TQ1A 3UPFA 4ED3A 3OYHA 4FK4A 1UA1A 5KT5A 4O3RA 4IFYB 4OLAA 2J6SA 4K4SA 4QWDA 3HO1A 4N56A 3MF5A 2P1JA 1I6JA 4TYAA 2WOMB 1WLJA 4RW9A 4NLYA 5KFXA 3SQ0A 2ASDA 4LQ9A 1KLNA 1B92A 3H2LA 3CDUA 4DQRA 3AA5X 5KFOA 1EKEA
chains in the Genus database with same CATH superfamily
4PG7A 3OYGA 1NBWA 2E5LJ 4JI3J 1JL1A 2JFKA 4ILRA 1VQ4S 1HYSB 3CJKB 3FEZA 1T94A 1GAOA 2GHPA 5C42A 2YNGA 3L2QA 2YNGB 3KOAA 1BD6A 3DRSB 3S41A 1SJFA 1G4CA 4DR7J 2WFBA 3T1YJ 2HWIA 3V81B 4DR6F 5AQFA 3IXQA 5FRNA 2FZGB 4I0WA 3QFPA 3MR2A 2QN6B 1TGOA 3MK6A 2QLBB 4PHTX 1KFSA 3POTB 3W64A 1R31A 2HMIA 4IO9L 4BCAA 1RDRA 1XHXA 3VQDA 1WELA 4CLSA 2G0JA 3AODA 5A2QO 2HOEA 1DT9A 1NJIO 3O1BA 1SC4B 4DL7A 2P9IA 2V69A 2RUSA 2WB4A 3E3XA 1IKWB 4OMFG 4KH5A 4DU4A 3DXKB 3VA0A 4FYVB 4CZKA 5GAEI 1RT1B 2Z2YB 3R3LA 3M6GA 3NCRA 4ZP6A 4J2EA 2ZD1A 1I94J 3M6VA 2VBXA 2F9WA 3NL0A 4LF5F 3TYTA 3J7AP 4RW7A 3CCTA 4RW7B 1KVAA 4I68A 1BIUA 4CK1A 3NFAA 3UDLA 4I2PB 3R1LA 5DDQC 2VQFK 1O5JA 3H25A 2X6NA 1W2BM 1XR5A 2YNHA 1U8WA 3CXCR 2QIFA 1S79A 3OL6A 1XMOK 3HVTB 1UVKA 4NMLA 4X4UA 2QXLA 1S10A 3OTOF 4FJGA 3MM5A 1NSAA 3Q8PB 5CY4A 3DM2A 2W2OP 5AJ3F 3GV5B 5AR0A 1MWQA 4YUDA 3E8OA 1C2PA 4P74A 2F65A 4DR1J 3VQBA 3CM5A 4PA1A 4FWKA 2FD2A 3AOAA 3DFEA 2BQ3A 1U25A 3T1HJ 2YKPA 1S76D 1Q78A 2E66A 2FJEB 1VK0A 5CYQB 3RRKA 5ETPA 1S6QB 3EX7B 3I0SB 1RWNB 3OYBA 1RI7A 4DR2K 4U9RA 4UF4A 4N8NA 4CP5A 3HI9A 4M1KA 3L4QA 3Q7CA 4J90A 3PDNA 1ZBSA 3TAGA 4CLFA 4I2QA 3MTJA 4CM0A 4NCAA 2LLZA 3H2VE 3HSJA 4FJ9A 1DLOA 2P9NB 1VJWA 3MX2A 4B8AB 4U7UD 3KUEA 4CTAB 4HLBA 4BG8A 3FJ2A 3EGWB 2DHXA 2F4FA 2C2KB 3L3CA 2EFQA 3VEZA 3B54A 4JI7J 1TUGB 3FZHA 1O8BA 3G8QA 5ETMA 1TL7B 4M5NA 4X4VA 3VEVA 3HM9A 2XI2A 4GVLA 2VGNA 4M3YA 4FZXC 4E7IA 1LK5A 2ZH2A 4PWDA 1R6VA 2PN6A 4DV5J 2KT3A 4P72A 3T5LA 2W40A 4FVCA 4C8ZA 3AVFA 5CR4A 4FO0A 1RT3A 3QSIA 2FIUA 4FL9A 3C15B 3AA4A 4LSLB 5EX5A 4J9PA 4KHSA 3V81A 1GLDG 3ZSYA 5GMDA 3GPAA 4RTFD 4I67A 3QAEA 4A2BA 2CGJA 5BR8J 2A2CA 4AL6A 4Y1CA 3ETMA 1M5KC 3HDSA 1WSGA 1SC1B 3VQ4A 3WXJA 4ZITA 4AL7A 4H0YB 3POTA 3PLAA 3A8YA 4MK7A 1FW6A 1U09A 2EG1A 4JLHA 3KLEA 4BROA 4YOEA 1HI1A 2M3DA 4RW6B 4X66J 1VC6A 2D4WA 1OPIA 3C6TB 3AH6A 2ASMA 3D6MB 4YY3K 2DH7A 4FBTA 2FVPA 4UQGA 2JHEA 1V9OA 2BM1A 4ILJA 3Q8UA 1WC6A 3S01A 2YWFA 2GUPA 1YGYA 2YX7A 1GOBA 2YQ1A 1PJ6A 1RWXB 2F4VF 3VR1A 3R6LB 1K8KB 1A5WA 2XMAA 3DDIA 3TUJC 3VGLA 4YY3F 3M32A 4PQUB 2VBYA 2LA6A 4HL9A 2V50A 4CLTA 3EGVA 5BPMA 1MWKA 3TU5A 4DV5K 1WHWA 2VWKA 3Q89A 4TXSA 1D09B 1F5BA 3ICLA 1N33K 3PM9A 3A8EA 3GE1A 2J0WA 4DTXA 3ALYA 1Q79A 2KT5A 3UR3C 3IFEA 3SJHA 2OPQB 5M1KA 1RAAB 1TYQA 5DDOC 3HVRA 4PL8A 3G6VA 2DCUB 4JI5J 2CIMA 1H6KX 2QTWA 1IM4A 4DTOA 2EKYA 3ATVA 3J7ZO 3HRGA 2B6AA 1LXNA 4P73A 3HLUA 2DNQA 2MZTA 1DFDA 4WK3A 3ZTRA 3I87A 1FXDA 4BRFA 4QPXA 2QLXA 1BQMB 3W1YC 1N32J 5DM6L 4ZCLA 2ZOGA 5BN9A 2AYMA 5E41A 4IKFA 1BISA 4PKGA 3OL8A 4WFNL 2Y8WA 5K8MA 3C95A 1WNSA 2G0IA 4H5TA 3AVGA 1S9FA 3ZSVA 3ITHA 3ITHB 3T1AA 2H54B 2H4YB 3C14B 3I9ZA 1D1UA 3GWCA 3PJWA 3VTIA 4DTSA 4J9QA 3S6EA 2CPDA 5IZHA 1KDNA 2HK2A 1B3TA 1KNZA 3ZT0A 2EVZA 1NLVA 1ZM2A 1B4SA 1U6FA 4BDZA 4WFAQ 1FJCA 2ZZTA 2M5YA 5L1IA 4KRWA 1RADB 3RR8A 4ITSA 4CEEA 3MD1A 1K47A 3J7AN 3OVSA 2ASOA 3TWHA 5L9XA 2HHWA 3MPYA 2DRAA 5HP1A 3F0NA 3UIQA 5DETA 3OHRA 4KY3A 4E19A 3PX0A 3ZZZA 3T1YF 1NK7A 1HD0A 3FFIA 4DCPB 5E3QA 5BYSA 3MHYA 1UJ5A 3WBZA 4HT7A 2OPPA 4UW2A 2A41A 2HHTA 1OSCA 3IUCA 2XMTA 2VPXB 2BJ1A 4QIVA 2QWPA 2AEJA 3SCLE 4BRIA 3E51A 3GJTB 1Q81O 3OFFA 2MEWA 5AZJB 2IIHA 3P3DA 1P9YA 5KG1A 3L3VA 3FVYA 2RQCA 1Y3JA 2ZKTA 1F0XA 2YKOA 3GZ7A 1X60A 5KQDA 1KHVA 1IKYB 4KHUA 4FN5A 3LOUA 2HHXA 1S4EA 1EXQA 4I2QB 4B17A 1RTHA 2IM3A 2WBRA 5AQRA 3O3FA 3NY0A 4EP5A 4X65J 4OLOA 3G0ZA 5LMNJ 3TSQA 2P6TA 4DCHA 2HWTA 4CF8A 2QL9B 1KKHA 4OHZA 2Z2LA 4BE0A 2ROGA 2LU2A 2PI4A 4H4KA 1KVBA 2AEFA 3WNEA 7AT1B 1WTFA 1D9FA 5D0GA 1NGAA 2OD6A 2WCXA 1TFWA 1N5YB 3KVGA 5D15A 2OP5A 3CI5A 3JAMO 4ZPWR 4RL1A 4I6AA 4H0PA 1HHSA 2O8CA 1R0CB 4FM0A 1RT3B 4H4MB 2RN2A 2HNZA 3JTOA 4OO1J 2RRNA 4MLHA 1VSDA 6FDRA 1KSPA 1YVUA 3V9WA 3WIUA 2MLYA 3PYFA 5GADU 4PXEA 3FZMA 2ZGYA 1XNQJ 2DBBA 4FF3A 3PIOL 2G8IA 5GMKa 5KFPA 2V9WA 1GMUA 1OIAA 4M5KA 3K5MA 2VZ9A 5HJXA 3MDQA 3R7NB 3MEGA 1QSSA 1FX4A 1JLBA 3L7PA 4NLBA 5F0WA 3UD5A 5FPDA 4F0MA 1RDUA 3LAKA 3UFCX 1KCFA 4JRQA 3DRPB 3CVKA 4I6MA 1CQNA 4WFBQ 2B4OA 3WC0A 3C94A 4QIFA 3CIMA 1NOZA 1TK8A 5JLFA 2N82B 2F8SA 2F96A 4CT9A 2XHBA 3MMCB 1KRPA 4U6PA 2MSTA 2HNYB 2KHDA 1HR0F 3K2YA 2IFXA 3ZSQA 2WOMA 3VF0B 3JSMB 2VH7A 3TSPA 1AB8A 4W5QA 7FDRA 3BN7A 1IBLK 4E7HA 2O8DB 5BXIA 3TJ8A 2NRRA 3J80O 2ITMA 3MPWA 4ZPTR 4LFAJ 4K4UA 3A5NC 2DO0A 1S0MA 3OW2M 4YHHJ 4NYPA 2W4DA 2JEIA 1RTDB 3K58A 2QXFA 2VFSA 1UVJA 1TUUA 2GVDB 1M5SA 2CQPA 2UU9J 2ZUGA 2OCEA 3L2WA 1XMQF 2A18A 3LP2A 2UXBK 4FW2A 2UXCK 3KXDA 1F1BB 2CA9A 5M1OA 4B3OB 4LF6K 4PXBA 2CG8A 3ENOA 1T3OA 4J9LA 4ECQA 4F67A 2E6LA 2LVWA 4M42A 2R8IA 1JJCB 3MR7A 4H03B 4F02A 5AZIB 4NLOA 1FVQA 1E6VA 1HPMA 4J7CA 3PIPQ 1HYZA 1N5VA 1JLGB 3QMQA 5IV3A 2BJ7A 4J2BA 5ETLA 4M3XA 5BR8F 3ET6A 3OR2A 2OZSA 2AKWB 4A8WA 2FVCA 2JZ5A 5E3CA 1J5OA 4I9LA 1NBEB 1PAEX 3SXLA 2FHKA 2H51B 2X3GA 3FK4A 2X1FA 2CZVC 4WFZA 5JUMA 2CNKB 3PYGA 2WVEA 3DLGA 4C8MA 2JOQA 1GOAA 2B7BB 2ZDPA 4E0DA 5CA5A 3P39A 2CZ4A 4BY9C 4DTUA 4IXCA 3GILA 4AM7A 3OXFA 4RW4B 2WVCA 3K9KA 1QAXA 1C1BB 3SCIE 4BGAA 1U8SA 2NZTA 3AY9A 2KB2A 4DTMA 3H40A 1FFSB 4F4YA 3BBFA 4KJIA 2NUHA 4URQU 4USWA 1B0VA 1VC0A 4X66K 1TV6B 3WQUA 5LSRA 4OFZA 4M3WA 3GSIA 4KI6A 3U6FA 1VRTA 2W4CA 4IZ9A 2K06A 3BR8A 4C8NA 2YKMA 4YY3J 2WW8A 1SC6A 1VOMA 1J53A 1B0PA 3BGRB 1TL5A 4ZS6A 4M5GA 1N32F 1TZ0A 1VSFA 4B1YB 3RU0A 5C25B 3MMAA 1OH6A 2UV8G 4CERA 2V4JA 4CHNA 1YLXA 4CJFA 4CIEA 5M1NA 4USKA 3TO8A 2F5GA 5K20B 4CZGA 4QYZJ 4HACA 2ZC3A 1T05A 4K41A 5KFJA 4WQ5A 2DY9A 3QEIA 1FJ7A 1YJNS 3DLKA 4FWMA 2ZWOA 2V8HA 1RT4A 2GUIA 3MM9B 3MN5A 3GJRB 2A1RA 2ASYA 3MMVA 4K2XA 4FVUA 3THYA 3BJYA 1IO2A 3EWGA 1TMJA 3VCDA 3V1QA 4WFBL 2W8LA 2P9KA 3NOGA 1KONA 4IG0A 2J5AA 4BQZA 4JK7A 3HULA 2BW2A 1VQYA 4O3SA 5EWGA 3CJ1A 2JFDA 4YEAA 3TA0A 3K5OA 1K0VA 3D45A 1VI7A 1T02A 4DV6J 4L72B 1U2CA 4Y2KA 2HHHJ 1NO8A 3R7BB 1BY9A 1RHKB 4ZPDA 4ED6A 2BV3A 1M5OC 3H59A 1Z2ZA 3J7ZT 4XPCA 1E6VB 5A2QY 2XCPA 3G71S 1GLAG 3ZETA 3J81j 3WXMB 1DQAA 2HQGA 1HBUA 4QOZB 3FBCA 4FF1A 1P8GA 1RLDA 3NBPB 5I3PA 4YR2A 1VSIA 4FNHA 3HKZD 3KLIB 2CPXA 4DR4K 2I0XA 2GV9A 2ZZNA 2GHVC 4ZPCA 3JS6A 4DQ8A 4ZVFA 1W2IA 1R59O 1DJ0A 2DISA 2E1CA 3D7EO 1NSQA 3MCSA 1BOTO 5ETSA 4HHJA 5ETKA 1VQ8N 2KYXA 2Q31A 4RNFA 4NASA 4JI2F 2W25A 1NM1A 3FQLA 5A8KB 4BVPA 4EMDA 1UFKA 3S3NA 2FJDB 4OYAA 1XIQA 2B8PA 4FW1A 1VQOS 2XSJA 2GMHA 5LJVA 4ZTJA 3O3HA 2W9CB 4FJMA 1JLQA 2G2YA 3R2CJ 3KK7A 1UCNA 3D1QA 4NYFA 4CO1A 3UWTA 1Y5NB 1U2VA 4IFVA 3CCEN 3HHDA 2RU3A 3VQ5A 2BQRA 2VHGA 1HX1A 2HGNA 1H74A 1Q16B 4RKUC 3IP0A 2A40A 4TU7A 2DJWA 5KFNA 2ZQBA 2W2NP 4JI5K 3ETOA 2DNYA 4RR5A 4KGVB 3B6OA 4CZLA 4NLGA 4WP9A 3SUOA 1JLEA 4LF8K 2Q79A 4OKKA 4EHUA 4DR4F 2PA3A 4O55A 5M2PA 5J1EB 3GG4A 1JLGA 4F26A 2HHUA 1S1XA 3DLEB 3AHPA 2YY3A 2KVQE 4BRMA 4LF9F 4DSIA 3CO9A 2FY8A 3O8WA 1P1TA 2AP6A 2VPWB 3VV2B 5BRFA 4I6YA 1V3ZA 1VQLS 1QAIA 4DN9A 3LGMA 2VG6A 2V7ZA 2UUCF 1ZETA 1UAWA 1HW8A 4BRAA 1YIJS 4A5AA 3D1HA 2A10A 5IXUA 3BGOP 4BRPA 2FSKA 1FEEA 3FZBA 4WU3A 1OO0B 2DK2A 3IBWA 3R5DA 2HHSA 3PO4A 4IOBA 1JCFA 3AO2A 4JYAJ 5KFFA 4HH0A 1ACMB 3D4JA 4DV1J 3D6FB 3NNAA 3EDRB 4H4KC 3PW4A 2RF2A 1QM9A 3NEKA 1FVSA 5J2QB 3RB6A 2D0BA 2UXDJ 2HZVA 2Y8YA 4NYOA 1IN0A 1RBTA 2DRBA 5FRMA 5B09A 4M8LA 5M2RA 3VPZA 4OJGA 2E5LF 1TFYA 2VODA 2N3LA 1QZ6A 3CXCM 1DQ9A 3H4BA 2HFSA 5FLXY 2ZF5O 1ZAXA 1GLJO 4YDUA 3NGUA 5C25A 1T6DA 2CAJA 4YHHF 3MECA 5DDRC 1LKZA 4CO3A 5HL7Q 3SQ4A 1IH7A 3OYKA 4PUOA 5HRPA 3AA8A 4YOWA 3L3UA 3OR1B 3P1GA 4KV8B 2Y9HA 1L3SA 4WPAA 2XRIA 3JXUA 2QMXA 1XMQJ 1TKXB 4LBIA 1XN9A 2G2ZA 2NYHA 4F25A 2VBWA 4OLPA 4E7JA 2EK6A 2YNFB 1OMSA 4OKJA 2KTQA 3O4QA 3G9CA 4FZVA 3S3OA 2DFFA 4ZOSA 2XY6A 5DG9A 7FD1A 2PY5A 2NRXA 3VF4A 4RW6A 4H4OA 4EAHD 1SKSA 2EFOA 3QFWA 1BG3A 1N32K 1RT7B 3KJVB 5JVGL 4DV3F 2R7VA 3QB0A 3SAGA 5GIPA 3QEXA 2G0CA 2G2OA 3BSCA 1H7XA 4NCGB 4RUAA 3QBXA 4E1MA 5AE2A 3MPVA 2CQDA 1Z05A 1DTQB 2V52B 4M41A 1OH5A 2HIQA 1IKVA 4JK8A 3THWB 1G7CB 2KG1A 1Q9XA 3CT9A 2RRAA 1OY8A 4LUBA 4DG1B 2Z30B 4DUYF 1OY6A 2QO3A 3HHNB 5C2FA 4C11B 4C11A 2BJEA 4PPDA 2DFHA 4V19S 4CQ1A 4WU2A 1A7GE 3TARA 2IM2A 3DRRA 2OPPB 1HUXA 4KTZA 1OYEA 5KFVA 2ASLA 2RILA 4LH5A 3M7VA 1SL0A 4DUYK 4M5MA 4OJ3A 1FK9A 1FK9B 4QS9A 4A2AA 5DM6Q 3AO3A 2AZ3A 5IFMA 2ILYA 3MWPA 3ZXWA 1MMNA 2WONA 2RB7A 4X4RA 4IO1A 1S4FA 4AUKA 3PYEA 3RG6A 2UUBK 1FD2A 2V2QA 4FPIA 2N4CA 5ETTA 5L1LA 1IBKJ 5B0GA 2NCKL 4HUEA 3CFOA 3V6HA 2XM3A 3VAKA 1F9FA 1SH3A 3ZZ0A 3VEOA 3B4MA 5ITHA 1YJUA 5A0YA 2F8MA 4JI7F 5GAEP 2DXFA 2KRBA 2K7KA 3TNVA 5JMNA 2B51A 1X4GA 3BB5A 2UU9K 2FJAB 1FF2A 2QLFB 4IQMA 3VGMA 5RUBA 4IDKA 1E4FT 5B0FA 4NZ7A 4DV4K 2LXIA 3L09A 3AO1A 3HSDA 4NOHA 3HSTB 3H46O 2FHJA 2XMKA 2BANA 3CF5L 4QCLA 4YOYA 4OI6A 3RBDA 4M5JA 3OFEA 3TZZA 1QHTA 3U8XA 1QLNA 2F4VJ 4UY8O 2DT9A 4CK2A 4AHVA 1UKUA 3B8HA 3GJQB 4NWBA 2DNRA 3T5JA 1BMQB 2FGOA 2G1DA 1VHXA 4MQ3A 3IN5A 1VQMN 3HHEA 1GH8A 4C98A 3NNHA 1QE1B 2P8IA 1QE1A 3F73A 1Q8IA 4LF4J 3OYLA 1TVRB 3P6YC 1XBWA 4F0KA 3QATA 2JH3A 3M8PB 3A8JA 2NUUG 4FLTA 4W5NA 5DJBA 3SMPA 3OYNA 5AQSA 3SYZA 3QBWA 1GLLO 2CQCA 2YBVA 1X9JA 1YBUA 1KVKA 3VGTA 4CYUB 1UP1A 4KKOA 3NAIA 1C1AA 2ATCB 1W97L 1Y10A 4CBUA 2RUGA 1N52B 3GJSB 2C2EA 2OTLS 3KWGA 3KYLA 4O0IA 1U1QA 4ETZA 4YOTA 4DG1A 4BRQA 4E1JA 5HOOA 1U2FA 1JB0C 3A3OB 4M3ZA 1X4EA 2V0NA 4A8XA 3RVCA 3E9OA 4M95A 4CGGA 1TTHB 3CYMA 4JS5A 1SQFA 4AH9A 4OJHA 3L4IA 1NGBA 2B3TB 4NE9C 3DMJB 1HKCA 3GDQA 2V51B 3L2UA 2E9RX 3R6GB 5KPZA 4DS5A 2OTLN 1NKEA 3I6PA 1VHFA 2JSXA 3Q24A 4WCEQ 3CQXA 3SFUA 4JI5F 4HHHA 3TJAA 1FRIA 1VSEA 4FSVA 1U2RA 1IQTA 4B3OA 4HWIA 1N8RT 2E88A 1BWEA 2CQ0A 3GV7B 4J9OA 4CIFA 1NWKA 4K2JA 1UW9A 3QGGA 3ENBA 3FEYB 4ID1A 2P9CA 4X84A 4MMOA 4FNIA 4B1ZA 4LFBK 5D6GA 3QDKA 3KLGB 4O0NA 3J7YI 1I51B 2R2SA 1GOCA 4JV5J 3QINA 2VFVA 3BZQA 2YX6A 4URGA 1HPZA 5AXLA 2V67A 3W2WA 2A3ZA 2XTJP 2QLJB 4B1WB 4Y00A 3THXA 4O3NA 2I5JB 4CJQA 3VENA 5CCMA 2NREA 4PG8A 4RJVA 2MZJA 2Y1JA 3MM7B 3MEDA 1C1CB 2MZQA 3J8AA 4UOFA 1HQUA 1I94K 4YFUA 5CYMA 2Q0UA 2PYJA 1B99A 1RAOA 4H5RA 2UUCJ 3P5TL 2QL7B 1B64A 3CSKA 3JSMA 2E1RA 2EBGA 4JBCA 1YF5L 1NJYA 2Q1LA 4W4MA 3RYLA 4FOEA 4DKWA 2MKYA 3CJ7A 3BDEA 1CLQA 2RH3A 3OXGA 1KP6A 2DNLA 2DXDA 1AW0A 2E1YA 1HNIA 3GIIA 4IRKA 5GAGI 4NRTA 2X7IA 3DGVA 1JXVA 1N34K 2PIIA 3AV9A 4IOCQ 4RNNA 1K44A 2A6AA 4X4QA 2P9LB 1MWMA 2HS3A 2VU5A 1BWFO 1NZ8A 1Y9OA 3R3TA 5GADI 4HDHA 4LC9B 4J9VA 2J9DE 3HP6A 2P9PA 4KB1A 1XR6A 5EWFA 5JVHL 4LF9J 2E29A 2YNIA 3CE8A 4DPYA 3BKFA 1DGKN 2QK9A 2P9EA 1XC9A 2Z1JA 1UPPA 4PAAA 3HJVA 4KKOB 3EMTA 3RTVA 1VQ4N 2ZVIA 2ZHBA 3JQJA 1P8ZA 2IA0A 2LQ5A 3SV3A 1RT4B 4JI4J 1GX5A 3NVMA 4EZ9A 4HHUA 4ED1A 3THYB 3QZ8A 1BHLA 5LSOA 1Q82T 4BR9A 4Z4HA 3W3SA 3FCWA 1SL1A 3D68A 2ABYA 1RHJB 4UOCA 4BQLA 4C8LA 5U47A 2LDYA 2UUCK 3SUNA 3X1LB 4A47A 3I5AA 3PFOA 1RA6A 4DV1F 4CEZA 3U4LA 2NSBA 4NX9A 3G4SS 3ZSRA 3AA2A 5E26A 4FCYA 4OL8A 1FKOA 1WOQA 2I7PA 1PSDA 3QETA 1RHMB 4ED3A 1RAGB 5F0XA 4XTTA 3TTDA 3SCKE 3L7OA 1Q86O 5HSPA 1Z1ZA 1S5ZA 4OLAA 3HO1A 1HKBA 2RHQB 2E1MC 2KU7A 1U0SA 3MF5A 4N56A 1G1XA 2P1JA 1GXTA 1WLJA 4RW9A 2GJIA 1VQ9N 4KGZB 1KLNA 1B92A 4OYIA 3H2LA 1EKEA 1OY9A 3RBEA 1KAYA 3IR6B 4J9RA 1OS5A 2ZKUA 3ENQA 1VRTB 3PCOB 1SH2A 5DZ7A 1Q86T 2HF4A 3D1OA 4EFHA 3FSIA 1HQEA 1SQEA 1VBXA 4MFBB 1XK8A 3BEGB 2FJBB 4USHA 4K0KF 4FJLA 4ZVOB 4RUCA 3FRYA 2WHOA 3MN6A 2QWNA 3FCHA 1FJGF 4M7XA 2U2FA 3BQ2A 1CXUA 2MDAA 4X66F 1S99A 1XQIA 2B4JA 2XYHB 4H0XB 2HFOA 4RCHA 2DB1A 4JI0F 1HQUB 4B8CA 4FXWA 1YJWS 3I0RB 1V3SA 4HYKA 5B7WA 2GAGC 3QWPA 3DLLL 1MROB 5KT4A 3CETA 1X5TA 2MPUA 1UEKA 1ZM9A 4DX7A 2CNNB 4P2MA 1HNVA 2NRZA 1HNVB 5F3ZA 1X0FA 3L7UA 4DLEA 2RKIB 2VIHA 4FWOA 2O8FA 1AUDA 2WBMA 5E7OB 5KFZA 4NYZA 3HD2A 2V63A 2XY8A 3MZIA 4RU9A 2VASA 3BQ0A 5CAAA 4PQAA 4LY7A 1T03B 2ZDOA 4K4WA 4L3NA 1OQ6A 1D4XA 3GB0A 4CFBA 1EETA 4DUYJ 3OBWA 4V1Ak 5FD1A 1EQYA 2OANA 2IMWP 4OX6A 3P5JA 3EZUA 2J6UA 1VSLA 3JQKA 2DHGA 2PDAA 1XMBA 1G15A 4F4WA 1F2GA 3RAMA 1LCUA 4DF4A 4JI0J 4DCOB 4CLLA 1PBUA 2DH8A 4AYBD 1RXOB 1NDKA 2CPYA 1QQCA 1RTDA 4DV6K 1M5PC 1RTJA 1O0PA 5CZ2A 4EK2A 3OTBA 1NH8A 3D0PA 2W01A 5LMUF 3CFPA 4IH6A 1ZXOA 1KHWA 4K59A 5JVHQ 3V1OA 2H48B 3O1WA 3LF0A 3X3UA 5ETNA 3BM7A 4JD2A 2RJZA 3EE9A 3SQ2A 3LP3A 3VQEA 1WSHA 1UVLA 3GCWP 2QI2A 4LD0A 4F4ZA 1FFWB 1U1LA 2EWSA 3MM7A 4KHRA 5FLXU 3ZZYA 3T41A 1SJQA 3V9UA 4DR5F 2F4VK 5A6PA 4CECA 2J8SA 3L0QA 1ZA1B 2JLGA 3CJCA 1W26A 3W9IA 3NAHA 4WZQA 3SSQA 5BRHA 2DHAA 4DUTA 4ISGA 2HQCA 1FERA 3OR2B 2J9EA 5M1PA 1S22A 2F40A 2Z0GA 1UPMB 3I5BA 1WC0A 4L3KA 3EPIA 4JV5K 2LSNA 1LWFB 3OVBA 3C16A 2JC1A 4J9KA 2EK1A 3W7BA 3O6QA 3SSSA 5EVZA 2DKOB 4P9SA 2CQ3A 2FJXA 4MTPA 1L3KA 1WWHA 3GOIA 2XY5A 3G6XA 3B78A 3U27A 1R43A 3TPQA 3BN4A 1GLBG 1IG9A 3VGUA 3MEEA 4LF4F 3LWLA 2CYYA 3H5YA 4PQUA 2FZCB 1JX4A 4CGFA 3MPDA 4JI1F 4JHDB 2V5HG 3MTKA 2W8KA 1YBTA 5J1PA 4BGBA 4LRAA 1FESA 2SXLA 3O9QA 3CC7N 1U04A 4LF8J 5GMEA 3AA3A 2HURA 5B0DA 2Z57B 2VG7B 5F0UA 2KYZA 5LXYA 3KLHB 3Q0AA 4BC3A 3DN9A 3CCVN 2CDRB 3UE5A 4H4OB 1TYQB 3DRSA 4TQRA 4H5NA 5F41A 1AT1B 1SL2A 3MOJB 2O67A 5KFHA 4JV5F 1VAZA 3PEHA 3UCZP 1WEZA 4MK9A 5KFUA 4A61A 1X31C 1XNQK 4CE9A 1RGVA 5EX0A 5JICA 3IR5B 2RD5C 4NA1A 4KBIA 3PZPA 3HZ6A 4NZ0A 2R2RA 4FZZA 4OQJA 2M0GB 3OY9A 1KAZA 5GADP 4UY8T 3VTHA 2BOAA 4ECSA 3DLBA 1NJZA 4JYAK 2NRHA 5E5NA 2XLKA 5J2PA 3E01A 2Q3PA 5BPLA 2PMHA 1RCHA 3LGHA 4KB7A 3AAWB 4ZN3A 2GCFA 2E2PA 3WUHA 3RWUA 3DRRB 5G0RB 2DR9A 2HW3A 1B9DA 2MZRA 2W4PA 4JI4F 5E3PA 3HP9A 2AP1A 3N9UC 2VC0A 4MAKA 3I56S 4NLXA 3CJ8A 3KFWX 4YMEA 4F36A 1J6ZA 2E5JA 2CG4A 2HSTA 4ZDNA 3NGSA 2DNNA 1VQLN 3FUYA 1C0GA 3FGUA 2XYGB 4CESA 4GO5X 3D66A 1H2UX 4JV0A 2J9DA 2F9JA 4EWTA 3OYAA 1NGJA 2MJNA 4FVMA 2JJ4D 2UV8A 2HBZB 4OIXA 3ASMA 2VCPA 4ILHA 3VQTA 1WG5A 1QVGR 3ILIA 5DS7A 2AGOA 4C3LA 4Y6IA 3BO2A 1UZDA 2XCAA 2FF3B 2XWYA 1NDPA 2UZAA 4IRDA 2ETJA 5L1KA 2HWHA 2AU0A 1GLCG 2J8AA 3EZ5A 2HVDA 3CMQA 2QA4S 3DOLB 3OV7A 2HHVA 2W2MP 4ZVQB 3DAWA 4N8OA 4C1NK 3P5BP 5K5MA 2PA8D 2H1YA 5DQHA 5AZJA 4JKEA 5SZTA 4IG3B 1M1HA 3RMBA 3RRGA 2FHMA 4ZP8A 3FGVA 3HMJG 4D3GA 3I82A 3TEHB 3H98A 1MNEA 4EYHB 4Y0WA 4LFCJ 2Q0RA 2OSQA 4JOUA 1R8PA 4B3SK 3OYDA 4C2MA 2DIUA 5C2DA 3QLHB 4NI2B 2CADA 3MI7X 2DHHA 2RAQA 2DPIA 3DNCA 3UDVA 1SZ2A 4X4NA 5K8NA 1HYSA 2GO8A 3NE6A 2DGSA 3KD1E 2L08A 4KGKA 2YX4A 4M45A 3ZEUA 4Z4IA 5B8HA 3AXMA 3D67A 2ZGZA 2XY7A 2E1PA 3MAAA 3KIOA 1Y7PA 4LF5J 3ULEA 4NLWA 2ZH3A 2ZH1A 1TL3A 3NGYA 3PX4A 1SKWA 4F9OA 1ZZFA 4X4SA 3R8YA 4IFYA 1RABB 5LJWA 3HSCA 4X4OA 4JI8F 5BR8K 2QYGA 3T6BA 3N0VA 2KRRA 1N5TA 4BWJA 4C1NI 3MEGB 4R0JA 3ZZPA 3BGFA 4OYZA 1VS3A 5T41A 1JL2A 4OYPA 2CQ4A 4IUFA 3JYTB 2C3OA 1VGYA 1JLFA 1NB7A 3CCSN 4QQBA 1LNQA 5F3TA 1CVJA 1JIHA 5AQUA 3T1HF 1ESVA 2ZOFA 1QS4A 4AM6A 3DMJA 3PRDA 4P52A 4A46A 3THPA 2UXDK 4UY85 4RG8A 2OHDA 4KQZA 3CCZA 5D3GA 4E2FB 4B9MA 3N6MA 2QG9B 1WSJA 3KLFA 4RWTA 2B0GA 1B0TA 3RB0A 4P2XA 3CW2C 2KHOA 1FJGJ 3CC4S 2GIRA 4W5OA 5EU7A 2X6SA 3C46A 2RDIA 3UKRA 2NPFA 4NLSA 2YPZA 3OVNA 3KLGA 5AQOA 5C42B 1X1PA 4I6WA 2BW7A 1VYAA 4HKQA 3BV8A 5GVQA 1EARA 1N36J 2FSJA 1EWQA 1TU0B 3FQKA 4PYAA 5KFGA 1GFWB 2HVIA 2E7WA 1KD1T 3ISZA 5E2QA 3OHBA 4DV3J 3P96A 1H38A 1U48A 3Q23A 3R5JB 4IOXA 4WFYA 3MN9A 2UP1A 1F5AA 4BC9A 3SPYA 3KK1A 1IR2A 2HMIB 3R9LA 4ZJOA 2FLOA 3EE8A 2W9BB 3GSDA 1HNZJ 4MKAA 2HQ3A 5KG4A 3CCLN 1IJEB 1WF0A 3QO9A 4DR5J 2AYGA 3UB5A 1CC7A 5LMUK 2P9IB 1C0UB 1ZPWX 3HFVA 4S0MA 1FD8A 1EAYC 3N79A 3VALA 2ZJPL 3T3FA 2R7UA 1IBKF 3GFHA 4DHYA 2ZE2A 1X4CA 1HARA 3Q8YA 2IM1A 4HTLA 4J8FA 4FF2A 3EY1A 1DRZA 1IBLJ 1HJRA 2OMOA 2HBLA 4LRCA 4DFJA 2GJ2A 2ZD1B 8RUCA 3B6BA 1PC5A 1L3UA 5D4LA 1S9EB 3GFXA 2AA4A 1HI0P 3C15A 2RHKA 4FK0A 3MXHP 1FEHA 2IAJB 3DI6A 2KT2A 4K43A 1NGFA 2O8DA 2YNHB 4U7CA 1WJ9A 4IYQA 1WHYA 2OFGX 3D9BA 2EXUA 5B0AA 3T19A 3HXMA 1WKJA 4I7FA 1N6QA 4K7QA 4CW7B 2W2QP 2PEHA 1WUUA 1HNZF 3IWXA 4GV3A 3KHYA 1IJFB 2AYEA 5TKYA 4C8YA 4I4BA 4CH1A 3G82B 4BRCA 4JKGB 1AZSA 5IQQA 5CYQA 3NRBA 3K17A 1S77D 2HSEB 1S97A 4CBWA 3CC7S 1DARA 4DV7K 1HRHA 4DL0C 1L3VA 2HBJA 2LDIA 2X1BA 2V8VA 4RUBA 3GIJA 3DDNA 2KQ2A 3W60A 3BEXA 1QUPA 5HN0A 3BSAA 1VSHA 4Y34A 2M7SA 1WG1A 2NUBA 5J2MB 3TAPA 4CF1A 1DTTB 4H8KA 3T69A 2KO1A 4TVAB 2NYIA 3MMJA 1FKAF 2IVNA 4DSLA 1YRXA 5SUHA 4CF2A 3OBIA 1JNZB 1UL3A 3H6EA 1F60B 3O9UA 3MM8A 4LREA 3FMWA 3ID8A 3TSUA 2VA2A 3KNAA 2LEPA 3PNIA 3AAPA 4NEYA 3I33A 2DEJA 3CERA 3V9ZA 3O2IA 3PFEA 2CJQA 4JI1J 3ZEUB 4CK3A 3CCQS 3FE1A 2G1HA 1VQNS 1LW0B 4BR7A 2L9NA 4CBXA 2MB0B 5F8HA 2E1ZA 3AJDA 1FDNA 4FPRA 1UEUA 4UOGA 3H2UB 4BBYA 2CPEA 3NMUA 1EO1A 2F8EX 3I8BA 1R3NA 2B4VA 2MLXA 3CHWA 4H0VB 3KK1B 4OHXA 3QERA 4J5OA 4M5LA 5IM0B 2HBRB 2W9BA 4CLKA 2FJVA 1AFJA 4LF9K 1CZBA 2KXHA 4MO5A 2H4WB 3KWMA 3DXSX 4RU2A 4FJ5A 3KLIA 4ZHRB 2GTDA 4FM1A 1OVYA 4YORA 4QU6A 1VHIA 2AW0A 1I39A 4I6MB 2W2PP 4ALZA 3PHTA 2I7NA 1BQXA 1IBMJ 2HS4A 2BE9B 2W6LA 3CGIA 5F1XA 3QIPB 5AQXA 2HS0A 3KLVA 1T9VA 4LSNB 2XZWA 2QM1A 5A8KA 1IKYA 2XULA 3CCSS 2ZFHA 2HQDA 4DSFA 1F9HA 4FKYA 1TKDA 3F56A 3G87A 1S1VB 1RFQA 4EBCA 8ATCB 4WK1A 1DY3A 5ETRA 5FPEA 4NB4A 1S72N 2UUBF 4JS4A 2ZJPQ 2HZCA 3MCPA 3PJXA 3I9V9 5LMNF 4W5RA 4BR0A 3V9SA 2G8WA 2EG2A 2GW8A 3FLCO 3TAFA 2QWMA 2PE8A 3HPGA 2ZH8A 2HFUA 3UO0A 4C0HA 4JI8J 4ISEA 4FJNA 1NU0A 3VAFA 2XO7A 1WI6A 9ATCB 1CLFA 4WWSA 2LEAA 3ZT4A 1X4BA 3JS9A 1T0TV 2DY1A 1C4AA 1RBSA 4NLUA 1CJUA 5AQTA 4CJ7A 2ZUAA 3ZYYX 3VQCA 5C15A 3MWTA 3PIPL 4KFBA 4P10A 1SKUB 3GE9A 3M8ZA 3QGPA 4MKYA 2JX2A 2VPZB 2C2RA 1RA7A 3W2VB 3NF8A 1YJVA 3GQCA 1C0UA 4KHYA 1HPZB 4KT0C 3FCVA 4R8UB 4JEPA 4CJKA 3CJSA 1HNXJ 1RCOB 4DXLA 1JCGA 2LKZA 2M8DB 1A0OB 4K4TA 4KPYA 1WBDA 3M2VB 4KAZA 3TANA 1PYSB 1SB6A 1KS2A 1MW7A 4JI6J 3R7SB 4C4WA 2Q66A 1VQ7S 5KGWA 1VQSA 4QIGA 2JRSA 3EZOA 1EQMA 3PTWA 1BUXA 4EZ6A 4ZIVA 2OH2A 2XGPA 2DEIA 3HX9A 3A8IA 2D74B 2HHQA 3UNGC 4AF1A 4P2SA 1YT3A 1JMTA 5F2RA 2H5IB 1X3NA 1Q82O 2Z8QA 1YK9A 2R7WA 1YHQN 2RDDA 4DFKA 3ILOA 4RWXA 3SMSA 4DV0J 2G8HA 3BQ1A 5DGAA 3PO5A 5KG0A 3EXCX 3LP1B 1TK5A 3MOZA 4WYBA 3DXMA 3HOSA 1C0MA 1T9UA 3IMXA 3LDPA 3CO0P 4PWWA 2UU9F 4JI3K 3OUYB 2IRXA 4DL3A 4DB3A 4DV0K 1WEYA 2E2QA 3PG9A 4Q43A 3L6QA 2MZ1A 3QIPA 4AILC 2JEFA 3S9HA 3QJJA 2Q6CA 4QWBA 4DV4J 4CH0S 1HNXK 3NS6A 4PG4A 2APOA 3NLCA 4DR7K 3QYYA 4XIUA 4TQSA 3OL9A 3MUTP 1A5VA 4KI4A 3TR5A 4CJLA 2MQ8A 1RYSA 3CWJA 1W0HA 3CD6S 3MM8B 2EX3A 3LPEA 4OV1A 1NHUA 2CJAA 2MKIA 3MXJA 1WNEA 2HB5A 3L9ZA 3NH1A 5L38A 4A8QA 1JK9B 1RTZA 3ATUA 4CI6A 3CJQA 2WVFA 4ZPVR 4CLUA 4K0KJ 5G0RA 4RW4A 3BSNA 3TUPA 2BR0A 3LP2B 4PY5A 4K8RA 4UUWA 4G1QA 3C7NA 2VC1A 3AOCA 5FPNA 4DSKA 1QQMA 3SNNA 4I2PA 4OPHA 4OZ1A 3P8BB 2KM8B 3NF9A 3THTA 2XGQA 2X1AA 5KOWA 1HBNB 3V5RA 4O4RA 2XZTB 2IS3A 2VB6A 3CD0A 3K7RA 3MD3A 3QGHA 5THWA 3H08A 4Y3CA 2R7TA 4BR2A 3GP9A 3S8SA 3TAEA 3NBPA 2NR0A 3KD5E 3GYNA 4M3TA 4DV2K 4B08A 1TMMA 4RWWA 4GKKK 4FLYA 3EGZA 2OPQA 3AAQA 2NRVA 5KRTA 4WBFA 3DOMA 4JK9A 3F9MA 4AXJA 5KG2A 2G9OA 1VRQC 1GMVA 2BGGA 3NWGA 4GKJJ 1S7HA 1Z2LA 1T6CA 1T05B 5E3AA 1CBKA 2MTLA 5KFTA 4JRPA 1WC4A 1GTHA 3MM9A 2E5GA 4DU7A 2ZVSA 4BHQA 2P2CB 1IBLF 2DR8A 4A57A 3UVJB 2Z1IA 3SPZA 4LRBA 3IWLA 2D3OR 3PJ9A 1EP4B 4TN2A 2H5EA 1SJRA 4EI2A 1LFPA 5E3RA 1Z6RA 3BF3A 4HR2A 2YHWA 5K8PA 4IG0B 1CS4A 1SVDA 3GONA 1FDAA 2PC6A 1RT1A 2C42A 3K8WA 2CPHA 2VQFJ 1ASWA 3RAXA 5KGXA 5GAGP 3IDHA 5I9EB 5CYJA 3LP1A 2NSCA 3HM8A 3C6AA 3A4TA 3EZWA 1U6ZA 3AVLA 4EU0A 3QIDA 4DMZA 2H5JB 3PKMA 2ZH4A 2QWQA 2AGPA 3CIZA 2MKKA 2VQEK 4GKJF 1NGCA 3CNQP 1GXLA 4OYMA 1WSIA 3HK2A 1UETA 4LFAK 3FFIB 3P49B 1R8CA 4CVNE 5KPRA 1D9DA 3DGPB 5EOYA 3EN9A 1NDCA 4MK8A 4WFXA 1FHTA 1K0TA 1R8BA 1JLAB 2NLXA 4JNEA 2VG6B 3GIRA 2C3MA 3ENHA 4J2DA 3N28A 4KBOA 3LH2S 4UZBA 1JJ2M 4LF6J 4CJ4A 3CULA 3MX5A 2VFTA 5A8RA 5A8RB 3WNFA 2FTRA 3FFKB 4JI2J 2C2NA 2YQ0A 2Q43A 1YKWA 3H4DA 1IBMF 3DCAA 3WDOA 2RQ4A 4USIA 1JLQB 1UFWA 2HFNA 4C0BA 4WE1B 1XTZA 4USTA 3KMQA 5H9FJ 1FXXA 1I3AA 3PY8A 1LWFA 3TOQA 4CZFA 3AFGA 1O1WA 1N34F 3CJTA 2B5JA 4LF8F 3QZ7A 2I9SA 1VQ5N 4CZHA 4OYOA 1IUJA 3KDOA 3PSIA 2WUSA 1XJWB 4HT5A 2EFPA 1ATNA 2FC8A 2BJDA 2AJ0A 4RZRA 3J81O 3Q2SC 3W5YA 2KFYA 3M4XA 5D78A 2D1CA 3DOMB 4BR4A 4YDXA 2IDOA 1YX2A 2GIFA 4LF6F 1F3FA 4ED0A 3KZBA 2WK4A 1YXQA 5LL6Z 4DWIA 2MLZA 2Q2RA 1RT6A 3P4UB 3TVZA 1ZBFA 5LSLA 5IWAF 2QE5A 2IDLA 3M9MB 3M9OB 3M1VA 4DL4A 1CC8A 2VD3A 3A1YG 4GNIA 2D3UA 1HI8A 1NMDA 2I5JA 2E5IA 4B1XB 2AEMA 1LQ9A 3DLHA 3VQ8A 2EKNA 3HFZB 3NCIA 5FIIA 1SV5B 3EXYA 4KSEB 2A0FB 1C1CA 4KGMA 4A48A 1NNDA 3KHGA 1KOHA 2WBNA 4M63A 4G1QB 1U0HB 5D3GB 2Y1LB 3KHRA 2WTUA 3OTDA 2LU1A 2P9SB 1D0EA 3CJRA 3DRYA 1M1GA 4RW8A 2CRLA 3SJJA 2PSZA 4CHOA 1PIEA 2E44A 2DRDA 3V6JA 3SBGA 2UXDF 4DTJA 3Q8RB 4PKIA 3MMBA 2P5VA 3LQVA 4IO9Q 1VSKA 5LT5A 2J0XA 5HMXA 2K1RB 1NNEA 3TTFA 2IPOB 3U3GA 4HDGA 1QSYA 4Z37A 3PV8A 3J7Z5 1FJGK 3OYEA 1FRKA 3VETA 2OJ3A 2YH1A 2F1FA 2YX1A 3CD5A 4ECWA 1S59A 1A5XA 1WSEA 4FK2A 1S57A 4I56A 4DV0F 2V4QA 3I96A 3H5SA 3UR0A 1RUSA 1UVMA 2RMLA 1RBRA 1X9MA 1NPPA 3TP2A 1RYRA 2IGIA 2QRRA 1SJ1A 3CM6A 4QR1A 1Y64A 2ALZA 4PL7A 5KFYA 4IDHA 1W9HA 4JI6F 4ILLA 3PSFA 1VSJA 2KXFA 1V5VA 3RB3A 3H20A 1ITPA 4PWUA 2O1PA 5AE3A 2PYLA 4K42A 3CF5Q 1H0HB 4DN0A 2E8AA 4ES3A 3WNHA 1PJ7A 3W65A 4DFPA 3H5XA 2OUGA 1RWPB 3U3YA 1XNRJ 1YBAA 2OTJS 4K8ZA 2R4FA 1R0BG 2BQUA 4LSLA 2HNZB 2Y1RI 1P90A 3TZYA 4NCBA 1EWRA 3IR7B 2G8UA 2OELA 4ZLNA 5KG7A 4G65A 4WJBA 3ADAC 4RO0A 1ZM3A 2XMVA 4PG6A 2OYQA 5H1SQ 3HPOA 1NK9A 2WSFC 4B9VA 1IM6A 3TUIC 4G1PA 4U95A 3NS7B 4EBDA 3K2PA 1RWVB 4M94A 5C12A 4B3MJ 3ZNUA 4BLGA 4KO0B 3QBCA 3CQYA 3AT1B 2PI5A 2D7SA 5KFDA 3H8YA 3D3CJ 4DV2F 4AQYK 3MUMP 1KQSR 2EW9A 3DHWC 5BYRA 4JI6K 5HROA 3HVWA 1SV5A 5B08A 1NCLA 1LFWA 2XS5A 3OYHA 3C3LA 2JNJA 4IFYB 4KYZA 4QWDA 1I6JA 1YJ7A 2WOMB 1SJ3P 4LQ9A 1VQ7N 3BO3A 1FXRA 3W9JA 1DKGD 3IAM9 3IBCB 5HRNA 4MYUA 2MKHA 4H0TB 3M8YA 4Y2AA 2XMMA 2IIRA 4IQXA 2I6WA 5KT3A 4J2AA 5KTQA 2IY5B 4WIIA 2F8HA 3WZ0A 4K4XA 1UJ4A 3BO4A 2C3PA 2AYBA 2E5LK 2GJFA 2ZWPA 4QAGA 4DPWA 1NM2A 2B43A 3CG7A 1MA9B 1YG0A 2VPYB 5FDLB 1Y4ZB 2GVDA 2VWBA 4W98A 4MDAA 3KUGA 2GGPB 1ZBLA 2C2DA 2RVJA 2KZZA 4EEYA 4HVJA 4O8KA 4DR3K 4MLEA 2WC9A 4KTWA 4OJ1A 4ZLLA 3G10A 1WG4A 2NXEA 4FXVA 3R6MA 4ED7A 3QJLA 2VQFF 4F0HA 1XI1A 2BKPA 3W5XA 1P27B 2CPJA 2RRBA 5AQJA 2CJBA 1DHMA 1MLAA 1IKXA 2AT1B 3PRBA 1GT8A 2QZ8A 3M6XA 1OVQA 2GV1A 2B9WA 4CWBA 3ZETB 5DM7Q 3M6WA 5D8HB 4WYLA 5F9NA 1U45A 1WC5A 1TELA 1JLBB 5CZ1A 3ZZTA 3CEDA 2KW4A 3OSNA 4ZVRB 2AHOB 3SDEA 4ID5B 1IVZA 3MXIA 4FWLA 2BKOA 4U96A 3LM9A 3NGIA 3HBTA 3VGSA 1NXIA 3U1LA 1S48A 4A8FA 2DHSA 4NXNK 4CHYA 5ADXA 3KNGA 1ULRA 3RBXA 2Z2ZA 4CI0B 5LMNK 3NOCA 2R7YA 1Y00A 2PO4A 1X0PA 4XEIA 2MQMA 1ROFA 3VEXA 4OV6A 4C23A 2EHGA 4LVOP 5I42B 4BE2A 4KH6A 2B56A 5GAHI 4KHMA 1RWWB 4B3SF 3MAHA 4F04B 4B3RK 1JLCA 2K8GA 4WZMA 2QT7A 2PMWA 4Z4FA 2R8KA 4D3HA 1NH7A 2ZE2B 3G6ES 3KK3B 4IFVB 4DUZF 3K59A 3NCQA 1CZAN 4NLCA 4M3RA 4CNZA 2QFIA 3LAMA 4B3RF 2HK3A 4ZP9A 4FPAA 2XS7A 3T1HK 3ULHA 2O8BA 1N34J 1D8YA 4B3TK 4FWQA 2VKRA 1KFDA 4C48A 1FNXH 4ICLB 2QMUB 4OI0A 2C2OB 5HROB 1ZM4A 3R5GA 2P5GA 2PFDA 3A8KA 3I4HX 4WYWA 1S6UA 2HRTA 5CE3A 2FBTA 2GVZB 1RT2A 4A8SA 1BUPA 2W1BA 1HJOA 3PIOQ 4CO0A 4TY8B 1LWCB 3VZIA 3HHLD 2F3JA 3TA2A 1UWBB 2C3YA 4X2BA 3KJFB 4X64J 2EI5A 1NGEA 3F41A 1S1UA 4G3IA 3NF7A 3ZZOA 5IT9Y 2VGMA 3IRXA 3ET6B 2UUTA 2CQ1A 4B3SJ 4QWAA 2VG7A 4DEZA 1RCXB 3O9SA 5L39A 4ELTA 3TQEA 1AROP 4LFCF 1Q8LA 1QVFM 2C1EB 3CC2N 3GTYX 4CLWA 4CFCA 3V2UC 3AY0A 3MEDB 4GVEA 2UVWA 4HTJA 5L8RC 1FKOB 1IJJA 4ENOA 3WIVA 3HSZA 3VF2A 2BANB 1PC4A 2OGUA 2FBYA 1XHZA 4O5FA 1WACA 2O8EA 4I69A 3QJPA 3MCMA 1IR0A 3CMEN 3H7HB 2UXBF 4AD6A 1E3MA 5ETQA 1N48A 4C8KA 3LWMA 4XO0A 1X5SA 3K9JA 1H2VZ 4PPZA 3UQSA 1VK8A 3AVIA 3AJ1A 4TU8A 3SAFA 4X64F 1IBKK 4MFBA 2NPIA 4ED5A 4USMA 1RHQB 4DZ6A 2JWNA 1YJRA 4MO4A 4KH4A 1NKCA 2A3JA 2HFVA 1X5OA 3DLLQ 1LWEA 2P9PB 4CZCA 4N76A 3A5MC 1WOSA 5IWAJ 4W92B 2KDOA 5KFSA 2BTFA 3CCJN 2Y3YA 3PHEA 2IA6A 3LM2A 3MMCA 4YN3B 3O5BA 1YJWN 4E3SA 2ASPA 3OT9A 1WHXA 1HHQA 1QQOA 3H45C 3UDEA 2NQPA 5F9LA 5BREA 4O3QA 2QYCA 3DOKB 1XNRF 3GCXP 5KFEA 1WAFA 3CCWA 5CXTA 3T9NA 2ZOMA 2XYPB 4P7VA 1RAEB 2IVPA 1F3VA 1EX4A 2ITGA 4JKCA 2ADCA 4LR9A 1HNXF 3BR9A 3P83D 4DV3K 2Y0SD 4CLYA 1RT7A 3KJVA 2CQHA 3M2UA 4MKBA 4B02A 1RP5A 3THVA 3CD6N 5DZ6A 2AGQA 4WQ4C 5AQKA 4OPJA 4B3MF 1HFEL 4OGCA 3M8WA 1QSLA 1YI2N 2JVOA 2YNIB 4GY2B 2HLUA 4BRNA 1U47A 5KFIA 1ZS6A 2GVZA 2KKZA 2GAHC 5CHIA 1BDGA 1FNOA 3ZTSA 4FKXA 4Z94A 3QNNA 1NZAA 2QA1A 4FLWA 2KXNB 2HAFA 2ZITA 3QRRA 2BA9A 2HBQB 3C66A 2FHOB 3T6JA 3DWLA 4DL2A 2W24A 4FDFA 3TZWA 1KR4A 3AOBA 3UD4P 1H98A 5G4DA 2BJ3A 3SDEB 3W2WB 3FR0A 2HAIA 3GG0A 4CRJA 4ANCA 1JXBA 4KR0B 3ZO7A 3OYCA 2JL9A 3AVMA 4TLQA 5IT9O 4JAXA 1NSKL 4O0JA 4WQ4A 2AJQA 3F5TA 3RMCA 1A9NB 4NA2A 4HCBA 3W63A 3PW0A 3RW6A 3BF1A 1SAZA 4Q45A 2B4PA 3O3GA 4NRUA 3WXLA 3OS1A 5ADZA 2QEXS 3WHIA 3TTCA 1QZ5A 3CPEA 5AT1B 1S9GB 1WEXA 1HL6A 4WKYA 4CZJA 3G6EN 3BH6B 5CHCB 3T9ZA 1SUQA 3AVKA 5F8LA 1IBCB 1TV6A 3QPIA 3I4PA 5HBMB 2LEBA 5AFUH 3DLRA 2WAQD 3G8TA 3LGNA 1XR7A 2M2BA 2P9LA 2CQGA 3E9PA 5EHHA 2Y1IA 4JKDA 4H5VA 2D1KA 3OL7A 4A8KA 3ELHA 3MM6A 2P51A 4B9SA 1X9SA 3CTRA 1PKUA 1WF1A 1VBZA 4BRKA 4CJEA 4BACA 3C8YA 4CJWA 3GFYA 4J91A 3D0HE 2V9KA 3VWSA 5LXRA 3SZ2A 1RDCA 4K5RA 3HT0A 2NS1B 2JC0A 3OXLA 3H90A 4YDUC 2J7UA 1JJ4A 4KHPF 3ID6A 4X65K 1R8AA 4B9TA 3M9NB 2FYXA 2OPRA 1H7WA 3QT5A 4FJHA 2DNGA 5J1EA 3OS2A 3H1VX 5GAHU 2XLIA 1BC6A 3OYFA 4DV2J 4BE1A 5K8OA 3RRHA 3DLKB 2CNLB 4AHRA 4R0EA 4YHHK 3DU5A 4U8YA 2GA7A 4PRFA 4CGDA 2F7VA 2YNFA 4LF5K 1RNHA 4DPTA 3R5BA 2LCWA 3A2FA 2V4RA 4EUVA 1WOOA 1T8EA 2R7XA 1XMOJ 2CQBA 3CPWM 5I3UA 3IRWP 4Z4CA 3OJSA 4Z4EA 4ZPAA 4UT4A 1UA0A 3MUVP 3GL1A 2CQ2A 4CEAA 1M1KT 1YRUA 2OSRA 1YJ9N 1MWZA 1HA1A 5M1QA 2JWKA 2Z1HA 4K5SA 3MCNA 2KG0A 2XSFA 1H2TZ 1T03A 1KWMA 4G6VB 2CJ9A 4LRFA 1RLCL 2XLJA 1FWLA 2YWWA 4XH5A 1DTQA 4DFMA 3KKRA 2DR7A 2XC9A 3CMES 1U0HA 3EKUA 3ZTPA 3V6DB 2ACYA 3V6DA 2R7SA 4CFAA 1SS6A 5EGYA 2LECA 2P9SA 2FVSA 2E6MA 5T7LA 4LFBF 3A3PB 5B0BA 3RZAA 3P45B 5CQGA 3GMGA 4CH7A 5M1FA 2LXFA 1RGIA 2YWEA 3CCLS 2QSFA 2ZBIA 3D3BJ 2KJWA 4LFCK 3HI0A 2ZJQQ 5T14A 1OWXA 4F50A 1J2VA 4NXNF 2O66A 2RT3A 3JXOA 3NNCA 3J7A1 2M70A 2MZSA 5SWMA 2KL8A 1NSPA 5KG3A 2OEJA 2ZM6K 4WXOA 2JLEA 1RAHB 1F21A 1HR0K 3RW7A 1EKRA 3WNGA 1V4SA 3UI3A 1T44A 2IVOA 3BPDA 4K8XA 2CH5A 4WQ5C 2G8KA 1HMVB 2G8VA 1HMVA 2RDJA 1RKIA 1U1PA 1U1RA 5HAOA 1PYTA 3A13A 3A12A 1NAQA 2MGZB 3FZFA 2OLWA 1HNWF 3FC9A 2XSJB 4ECXA 1TKTA 2VA3A 3OBYA 5L1JA 4ZTFA 4YOXA 2FVQA 4J9NA 2YKAA 4CJUA 3SSRA 2B9XA 3CJ2A 2DY4A 4OX8A 2N7CA 4FLXA 4UOHA 5A0YB 1X3MA 2UUBJ 3C65A 2ZBCA 4PEOA 3CCES 1S0NA 2MKJA 5AJ3K 4JP8A 1WOPA 1N0UA 3I0SA 1F5CA 3BBCA 1K8AO 3ZNJ1 3MWBA 2VONA 1MMLA 4QS8A 4J9SA 3L95X 2LXUA 3KG0A 3IMQJ 2XMUA 1C0TB 4F3TA 4A62A 1DTTA 2GWKA 3N4QA 4QWCA 2FBVA 3CJ9A 2GMJA 4L73A 1HYVA 2ZNYA 1W7AA 3CJAA 1WDTA 2Z56B 4MIWA 1NEEA 1N5SA 3BGLA 4NLPA 5JXSA 2DPJA 4KHQA 1NJXA 3VAMA 4ERDA 4ZCIA 1CQMA 3DXBA 3SBTA 1IXKA 3R97A 3UE2A 5CABA 1VC5A 3ONQA 3HYFA 1UVIA 3MMBB 3CMAS 1ZPVA 2D0CA 3IAS9 5FROA 5KPTA 3PUFA 4L6V3 4JKBA 2CWXA 1EJ7L 1GK8A 4ECRA 1TL1B 4E89A 1KTQA 4XAKA 1X4AA 1VQPN 3OSPA 2IJNA 2ZBQA 2D69A 1RWMB 2BE2A 4HI1A 1YTUA 3QIOA 2IVFB 2QKKA 5HP1B 4B3MK 4FJIA 4NLDA 2E2NA 2V6AA 3KJQB 3GFZA 3AVNA 2BRLA 2VOOA 3VQ7A 4OHYA 3D28A 2KI2A 3O8MA 4J37A 5HANA 1VRUB 3CJ0A 4P75A 1K9MO 4AQYJ 4DS4A 4Z4GA 3Q83A 2YHXA 1WKKA 2XBPA 1S49A 1SQGA 5FJ4A 4O23A 4MIAA 5AQYA 3I55N 3Q86A 5J2QA 1ZZNA 2KJVA 2KFNA 1TK0A 3J81U 2OPSB 3GU0A 1REGX 3E01B 1VLYA 1KN6A 1RTIA 3R2DJ 2RSQA 2MY7A 1CPZA 2MY8A 4ZN1A 1NGHA 1F2HA 1VCTA 2NRWA 4O4GB 2C22A 2IJRA 4IOAL 2YTCA 1TP7A 1VDHA 3LZIA 2VOPA 1K8KA 3C6UB 3O9RA 3BREA 3EVMA 3ENAA 4WE1A 1BGXT 3T7ZA 2VV5A 4DQPA 2DR6A 4CCHA 4LT6A 3MFIA 5ADXH 2BDPA 4GV9A 1V6HA 3DYAA 4CO5A 4QPTA 2EPIA 5HMYA 2UUAJ 4DV4F 4FJ7A 5AFUA 1QAYA 1RBUA 2J76E 2RS2A 2OA8A 2KKHA 3U9DA 4ETXA 2FHJD 1Q0NA 1MU2B 1NGIA 4K4YA 2CGKA 4IJNA 4U67Q 4Z2XA 1FI4A 3CDAA 1UJ6A 1LEOA 4LSZB 1FRLA 5AE1A 4OVLA 1IR1A 2IC3A 4OPAA 4DR6K 2MQPA 5DG8A 3LL3A 4P71A 3IAYA 1YSJA 3F9KA 4ISFA 3E66A 3V6KA 1RDBA 2YJFA 4FXDA 3NH0A 4TKTA 1KXPA 4HUFA 1CXQA 4RBVA 1B7FA 3BYPA 5A2QU 4FWSA 4LF7K 3OQ2A 3B82A 3HKWA 2A6OA 1P1LA 4RBTA 3C14A 1Y3KA 3JYTA 2XG8A 3Q22A 1RDDA