5FDLA

Crystal structure of k103n/y181c mutant hiv-1 reverse transcriptase (rt) in complex with idx899
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
554
structure length
550
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P51 Reverse transcriptase
publication title Discovery of the Aryl-phospho-indole IDX899, a Highly Potent Anti-HIV Non-nucleoside Reverse Transcriptase Inhibitor.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase
total genus 144
structure length 550
sequence length 554
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5fdlA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5fdlA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5fdlA05
3EYZA 3LANA 3BREA 4RW8B 3KLHB 4KO0B 2Q3SA 4CK1A 5KFDA 3VQ6A 5J2QA 4RNMA 5J1EB 2FBVA 4TYAA 4NLWA 3T5KA 5SWMA 4M95A 4DSFA 4ELTA 1RTHA 3KLIB 1HQUB 1EXQA 3I5CA 1JKHA 3HPGA 5D3GB 1QUVA 5DGBA 1REVA 1XR7A 3MEGB 1TKXB 2XY7A 2XCAA 3CVKA 3U3YA 4E7HA 3AO3A 1EP4A 3QO9B 1HNIA 3V6JA 2KFZA 4O44B 2BANA 4NLQA 3BQ0A 4CJSA 3T3FA 4NCBA 5KFVA 4CGFA 3QETA 2IS3A 1BGXT 3H5SA 2ATLA 4E7IA 3NBPB 4DF4A 2HNYA 3NH1A 1HARA 5L1LA 1WSEA 3LP1A 3GV8B 3SPZA 2ASDA 4YNQA 4NYFA 5J2NA 4DG1A 4NLYA 2D3UA 3CJ3A 1ZBIA 3PUFA 3TI0A 4KB7A 1S10A 5KFPA 1K6YA 2KFNA 4Q44A 1LW0A 2OPSB 4I2QB 4KB1A 1NKCA 1C0TB 2R8GA 2ASLA 4QW8A 3KLFB 5T14A 5KT2A 2I1RA 3H5YA 2XGQA 1ZTWA 4URSA 3C6UA 4ZMMA 4CHZA 1U45A 4E1NA 2QKKA 5KG1A 1SH3A 1HMVA 4BACA 2J6TA 4TYBA 4CEZA 3ICLA 4GC6A 1NKEA 3KLGA 3VQ7A 2E9ZA 1JLQB 4ZTJA 2ZQBA 3P83D 4PY5A 5I3UA 5HRNA 4CJFA 4KRFA 4CHQA 4F3OA 3RAXA 4KHUA 1C1CB 3KK3B 3KK2B 1NHUA 4JS4A 1IKWB 3DRPB 3PX0A 4E89A 4BE0A 1LAVA 3GQCA 1S1VA 3THVA 4NYNA 1ZETA 3AA5X 3DM2B 1C0UA 4RW6B 3VQEA 3IG1B 2KZZA 5DLFA 1S1WB 3SUPA 4PWDA 3BR9A 4RW4B 3D5MA 2OPPB 3QZ7A 1A5VA 4FJJA 4X2BA 1NHVA 4LD0A 3RRGA 4AILC 1IO2A 5JS2A 2NUBA 2FVCA 2F8EX 4DTSA 4F4WA 4NLPA 1LWFA 2CKWA 3MTKA 5KFGA 1FKPB 3G0ZA 4NCAA 3KJVA 3JSMB 2IDOA 4FYDA 4DS5A 3JYTA 5KFZA 4CEEA 2WONA 4FS2A 1WLJA 2ZD1A 4ZPBA 4IH6A 3K2PA 1NK5A 1TKTB 1C1AA 4FM2A 4WFYA 1RDAA 4OGCA 1L5UA 3PX6A 5DK5A 5CZ1A 3BSAA 2YHBA 4CGGA 4F4XA 1C1BA 5KFYA 4ECYA 3DOKA 2VA3A 5DLGA 4CHPA 2CJQA 3CJ5A 1EETA 3MR2A 3SPYA 2RF2A 4DL7A 3PJXA 2W8LA 4J9KA 1RA6A 3MR5A 3CG7A 5KFHA 3O3GA 2BE2A 3VQBA 4YQWA 3OL8A 4FK4A 3HK2A 3DYAA 1VRUA 3I8DA 1CZ9A 1S9EA 3RB0A 3SFUA 1SKWA 3KLIA 4CIFA 2Y1JA 1S1UB 4NLXA 5D3GA 3RB6A 4NLDA 3GIJA 2HNZB 1TKXA 2XI2A 4QPXA 3NKYA 3SV3A 3TABA 4Q0BA 4K4XA 4K4UA 4BWJA 3AVIA 1RT5A 2WRMA 4R5PA 3AVAA 4J2EA 5KFIA 4BDZA 3SCXA 4BE1A 1ASUA 2G8VA 3H40A 1JLBA 2WOMA 3MXMA 2DY4A 5HP1A 5KG2A 4FJKA 1X9WA 1BQNB 3CDUA 4FLTA 1VSMA 3RR7A 3I0SA 4CJRA 1BIUA 4DSLA 4HHTA 4G3IA 3GIKA 3ZCMA 1RT4A 1C0TA 3PX4A 1S1TB 3KD5E 2YNHB 3KOAA 1CZBA 4FCYA 2GBZA 3G6YA 4KFBB 1D9DA 4FJ8A 3LZJA 3LP0B 4CJKA 1F21A 4Q45A 3ZSYA 3KHLA 2P1JA 1WSFA 4ZP9A 4K4YA 3EZUA 4IG3B 2AGQA 3VQQA 1B92A 3QLHA 2D0CA 3PW0A 3LPTA 2RKIB 2D5RA 3V81B 4ZP7A 5KFJA 1JLCB 1S6QB 4DSIA 2IM0A 4E3SA 3D0PA 3PZPA 4KREA 2F8SA 3KK2A 2FVPA 4GMJB 3OS1A 1IKWA 4DU4A 3NF6A 1ASVA 1S49A 3OYMA 1NK0A 2R2TA 3E51A 2V4RA 4DTRA 2HAIA 5KT3A 3MFHA 5KFWA 4Z4FA 2FLNA 2BDPA 1WSHA 2ASJA 4DFMA 3AVNA 4EZ9A 5KG0A 1ZBLA 1YTAA 1S48A 1X9SA 5DG7A 1QE1A 4IOBA 1QSSA 2OPQB 4RW4A 1SL0A 4M45A 4CJPA 3MECB 4NCGB 2EHGA 1TL3B 2R2SA 4FZYA 1LW2A 4IKFA 1SH2A 1NJXA 5CY4A 1J5OB 3SQ0A 5C24B 1S9FA 2I5JA 4RZRA 1RYRA 4Z4IA 4K4SA 3MFIA 4B9MA 1QTMA 2G8KA 3LAKA 3JSMA 2DPIA 2D0BA 4TN2A 3Q8PB 3CO9A 5J2QB 2JEGA 4IG0A 3VQ4A 3KNAA 2W8KA 3MF5A 2V0NA 1DTTA 1LAWA 2A1SA 1RTHB 3M8QA 4IFYA 1JKHB 2X6NA 3M9MB 4TY8A 4I9LA 1SUQA 1RTJB 4MKAA 3L2RA 4KV8A 4E19A 1VSIA 4FVMA 4DF8A 3PVXA 1KLNA 4AHUA 3G10A 3N6NA 2A1RA 1VSFA 3FDSA 4URQU 5DMRA 4Z4EA 3VA3A 1EP4B 1HNIB 4C8OA 4HYKA 4CE9A 1L3VA 2BANB 1Y97A 4J9NA 4ECTA 3C6TA 4ED1A 1OS5A 3RMCA 4E7LA 4DWIA 3AVFA 1BCOA 5CYQA 5DGAA 2R7YA 1RT7B 5J2NB 4DG1B 1S9GA 3KIOA 4G1QA 4FXDA 1X9MA 3QZ8A 4KHYA 4O4RA 3OLBA 5T7BA 4DTXA 4IKAA 3AO4A 1KRPA 2PYLA 1LW0B 4DL5A 3ISND 3ZSXA 4IR9A 4YFUA 2UVWA 3DLEA 3C6UB 5F8MA 3KLVA 4MFBA 4TSXA 2WTFA 4W5QA 3IGNA 3IS9A 4B9TA 4E7KA 5C25A 1JLFA 2KW4A 4ZPAA 3KLGB 4CERA 3M8SA 1BQNA 5KFEA 2P5GA 3K5MA 3BGRA 3H2LA 3PW4A 5I3UB 4FJGA 3VQCA 1RTIA 3V6HA 4CFBA 1TK8A 2HHVA 5F9NA 4EZ6A 1SL2A 3L2WA 4ICLA 1JLAA 3ZSOA 1RT3B 1DTQA 2D3ZA 4QWBA 4K50A 3KHRA 3QESA 1S1VB 4J9PA 4HCCA 3T19A 1U4BA 1TV6A 1C0UB 2RN2A 3OYLA 2YKMA 3RBEA 4FM0A 4RNNA 5JUMA 5L1KA 1LWEA 4E1MA 2EX3A 3L3UA 2RKIA 4QOZB 4IRDA 1UWBB 4CEAA 3OYJA 2BQ3A 1S0MA 3CM5A 3H08A 3V1RA 3OVNA 3DRRA 2HHUA 3WNGA 3M8PA 3MEEB 2XCPA 1IKVA 5F9LA 3PO4A 5EWGA 4RU9A 3HPHA 3U3GA 1LWFB 1SKRA 1WN7A 3OYHA 3BSCA 3KJVB 1T05B 3D28A 3NGZA 1DLOA 2ILYA 3ASMA 3OJSA 1K1SA 3QINA 2WONB 3GIIA 1TGOA 3S3OA 1J54A 3E01A 2ZD1B 4CJ5A 4U6PA 2PZSA 3I5BA 3PJWA 2J6UA 3V9ZA 4WFXA 4DSKA 2C2EA 2PYJA 4Z4HA 3BDPA 2QE5A 5KG7A 1XI1A 4LH5A 4B8AB 3OYIA 3GILA 3L2VA 1J5OA 4ZP8A 4NYZA 1C1BB 2AWZA 4ELVA 2AGOA 2RF2B 1N5YA 4JV0A 4FJ7A 3SZ2A 4KBIA 1S5JA 2QKBA 4TQSA 2D0AA 5KT4A 2BE2B 2BRKA 5KG6A 1KCFA 4FJLA 3DYAB 1VRUB 3HPOA 1W0HA 1S9EB 4ZPCA 5HRPA 3FRZA 3V9XA 3PR4A 4K4VA 4K4TA 1HPZA 1RTJA 4W5OA 3NDKA 2QXFA 1ZBUA 3RRHA 4KI6A 4Q0BB 4CFCA 2IA6A 1CSJA 1KHWA 4CGDA 3S3NA 1TK5A 3RB4A 5KFRA 1RT5B 1KTQA 1XHZA 4R5PB 3C94A 3PHEA 1BCMA 4N47A 1VSHA 5KGXA 1JLBB 2WOMB 1NNDA 3NF8A 4I9QA 5J2PA 5HP1B 4DQSA 4NLOA 3TQ1A 1RNHA 5KG3A 1RT7A 2JEFA 4ED6A 4B8CA 1YVFA 2HWHA 3L8BA 3I0SB 4CIGA 4CJLA 4DQQA 1NJZA 3MXJA 3H59A 4CGHA 3DMJA 1RT4B 4CEQA 2QV6A 5F8JA 4MIBA 3MAQA 4LH4A 2P51A 2B5JA 4O5BA 3LPUA 1RCHA 2FJXA 2VG7A 3ULDA 2HHTA 3GV7B 2OYQA 1U48A 1K1QA 3QLHB 4MIAA 5EDWA 3LZIA 4RUCA 4ZP6A 3ZSWA 1ZYQA 2HW3A 1KHVA 2XY5A 4Y2AA 1GX6A 1O1WA 1D1UA 1RT3A 4FLWA 1VRTA 4RW7A 4KTZA 5F8LA 4C8NA 5L9XA 2F8TA 3QGIA 1R0AA 3FSIA 4DL6A 2IJFA 2HVHA 1QAJA 5L1IA 1QE1B 3CIZA 3OYCA 4Y3CA 1JX4A 3OHBA 4ECSA 3DLKA 2RDJA 2V4QA 1S6PB 1JIHA 2B6AA 4M3TA 1RDRA 2Z1JA 1HJRA 4WXWA 2G8HA 1UWBA 1LW2B 3OHAA 3MEEA 3CWJA 3F73A 2VG6A 2Z1HA 2I5JB 2FBYA 2FJVA 2IOCA 4LSNB 3SI6A 1T05A 4FM1A 4DMNA 4F4KA 3HVAA 1ZTTA 2G8IA 4M3WA 3OSPA 4IG0B 4N56A 4KSEB 4MKBA 4FBTA 3HO1A 2AGPA 4ECUA 5C5JA 1DTTB 4CGJA 1WNEA 3M8QB 4XIUA 2BQRA 1WSJA 4IFYB 3NCIA 4FJNA 3HKWA 1S0NA 4N41A 4TY8B 2PY5A 3ZT3A 1TKDA 4Y2CA 1SUQB 4I2PA 4KV8B 4FK2A 1JL2A 4H4MA 3RMDA 3OYNA 3Q8SB 4CGIA 3KKRA 1IKXA 4NLGA 5KRSA 4J9SA 5SZTA 2XHBA 3C6TB 4CJQA 4XPEA 3LWMA 4FW1A 4EP4A 5KFXA 4DLEA 1LV5A 3NAHA 3VQSA 3HXMA 3H4DA 4MH8A 5KFNA 4HTUA 4R8UB 5L1JA 5CYQB 4RNFA 2AU0A 3OL6A 2HHXA 1S9GB 1QQCA 2AJQA 1GOCA 4G1QB 3BQ1A 3I0RA 2ILZA 3CJ0A 2R8HA 1U47A 4Y1CA 4JLHA 3EZ5A 1EX4A 1J53A 2OZMA 3DLEB 4NLRA 3V9UA 4MFBB 4YMEA 3I5AA 2Y1IA 3IS9B 5F8NA 1RDCA 1HNVA 5C25B 1JLFB 3OYEA 1MMLA 3PW5A 1A5WA 3OYDA 1TL1A 3DOLA 4NLUA 4HVJA 3BGRB 4J9LA 5KFFA 4I7FA 1HYZA 1RTIB 4KI4A 4K8XA 4M3XA 5KFQA 1N56A 3V6DA 4KHRA 4EBEA 2D41A 4ED7A 4CFDA 4ICLB 1JLAB 3RR8A 1DTQB 4HUGA 1BISA 4Y34A 1KFSA 1XHXA 1MU2A 1TV6B 1RT1A 4KTWA 2YKMB 3O3FA 3FQKA 4FW2A 1LWEB 4R0EA 2ALZA 1B9FA 1QHTA 4J9QA 1NK8A 3G86A 3DI6B 1I6JA 1A5XA 2HVIA 4CJEA 3DRRB 3TR8A 2HNDA 3M8PB 1RBTA 1IKVB 5EWFA 4B08A 5KG5A 3QEIA 4K8ZA 3ITHA 4DTPA 4ZVEA 1UOCA 3VQ5A 1RT6A 4XPCA 2EC0A 2YKNA 5EUHA 1VSJA 3ZT2A 3K58A 1VSEA 1DLOB 3E01B 2FBTA 4CF1A 1GOAA 2IGIA 4CJUA 2YNGB 3QEPA 1S6PA 1KLMA 4CFAA 3OJUA 4K4ZA 4IH5A 4KB0A 2O5DA 1N48A 1JLEA 3K5NA 2FLLA 3DDKA 1SV5A 3NAIA 1BHLA 3L2QA 1S97A 4FJMA 1LWCA 2Z1IA 1S1XA 5KFBA 4CJ4A 2E6LA 3MEDB 2KTQA 1JLGA 4WXOA 1N5YB 5EU7A 3MR6A 2WB4A 4LSNA 3AVBA 3SJJA 4HCBA 2DFHA 4ZHRA 1QSLA 2WK4A 3SUOA 3AVLA 4TY9A 2AX0A 4ZVGA 4J2DA 3AVGA 4JS5A 4OVLA 4DTUA 4CK3A 3ZT1A 5HLFA 3VQ9A 1HPZB 3GV5B 4OGEA 3S9HA 2ZKUA 4J9MA 4IDKA 2Z1GA 3B6OA 3QEVA 4TLRA 2C2RA 2DTUA 3H98A 3LWLA 3OLAA 1WNSA 1FK9A 5KT7A 2P5OA 4NLSA 1FKOA 4FJHA 5I42A 5J2PB 5KFUA 4QWAA 4GC7A 2IAJA 3NAEA 3OYAA 2JEJA 4R8UA 3TVKA 3LP2B 2QK9A 3NE6A 3KTQA 3WNEA 1NKBA 1W25A 3CDWA 3CJ2A 2W9AA 1N6QA 4CIEA 2IM2A 1WAFA 4F3TA 4CJWA 2RPIA 4DTNA 4N5SA 1JXEA 5K14B 4FLVA 5C42A 4JV2A 3CYMA 1S4FA 4F4ZA 2C28A 3RMAA 3DMJB 4W5RA 3QEXA 4DU3A 2UVRA 2B5JB 5EWEA 4O3SA 3A2FA 3SV4A 4QCLA 1NK9A 1YT3A 2B43A 4H4OA 4ECRA 2VG7B 1TQLA 4PA1A 3RBDA 3KKSA 3Q8QB 2UUTA 1Q9YA 3DLGA 2GIQA 4QW9A 3DRSA 4BDPA 4Y1DA 1VK0A 5KG4A 3OL7A 4OKKA 5F8IA 5J2MA 3HL8A 3SUNA 4NLTA 3QIDA 4WE1A 4ECWA 3V9SA 2XWYA 1VRTB 4M41A 2E9TA 3RAQA 1L3SA 2HHWA 4RW7B 5FRMA 3K5OA 1R0AB 4CJ3A 2X6SA 1UA0A 3HP6A 4O55A 3H5UA 3VQAA 1TAQA 3DLKB 1WSGA 3OS0A 2HHQA 4KPYA 1TVRA 2B6AB 3DI6A 2IC3A 4DLGA 4WZMA 4BE2A 3T1AA 4ID5A 1NK6A 4WFZA 3SQ4A 2VG6B 3LAMA 5KRTA 4O3NA 2W9BA 1GX5A 4DEZA 4F50A 1NOYA 3DLRA 4JRQA 1HQEA 4ZPDA 5KFAA 3V4IA 4YP3A 4J2BA 5CYMA 2WCXA 2XY8A 3LDSA 1UAXA 5HBMA 2BGGA 1CXUA 4TXSA 4FLUA 2YNGA 4L8RB 3C95A 2UUWA 4EYIB 1TKZA 4F2SA 1C6VA 2IMWP 3NH0A 2ATQA 1TAUA 3ZT4A 1FXXA 3M8RA 1T7PA 1L3TA 5KFLA 4I2PB 1KVCA 5KT5A 3LP3A 3G6XA 3VA0A 2DPJA 1C0MA 3NF9A 4H4MB 3MEDA 3FQLA 4NLVA 3K59A 1IKXB 1IM4A 4OL8A 2IBKA 2OPRA 2BQUA 3L3VA 4ECVA 4EEYA 3QGHA 1IKYB 2VG5A 2JC0A 4AHVA 3RB3A 2IM1A 3SUQA 1Z4UA 1BI4A 4LSLA 4UQGA 3CFRA 1T03B 3AV9A 4J9RA 3KMQA 5JXSA 4EO6A 4PQUA 4IFVA 4QWDA 4M3RA 3GIMA 3ZSZA 2FJWA 4EYHB 1VSDA 3QIOA 5KFMA 4KHQA 2HWIA 1CLQA 2X78A 3I0RB 3UR0A 4QWEA 4KHWA 1NJYA 1U04A 4HUEA 3PR5B 4O4GA 3TARA 4DQPA 1RYSA 3LALA 2VWKA 3AVCA 1HNVB 4OKJA 1RBUA 3LP2A 4ED2A 4AHRA 1IG9A 1TL1B 5F8GA 1BL3A 4DQRA 3AO2A 3DOLB 1J9AA 1KVAA 1SH0A 4I7FB 3G6VA 3V6DB 5K14A 5KTQA 2YNIA 1C2PA 4ECQA 2W9CA 3BQ2A 2ZE2A 2R2RA 3U6FA 3NF7A 2KZMA 1NOZA 1RT2A 2UVUA 2E4LA 2VWJA 1MU2B 4OJRA 1U49A 3S3MA 4OKEA 3NGIA 1RT1B 4IQXA 3QNOA 1RTDA 3SNNA 2JGUA 5FDLB 4RW9A 4YR0A 4DQIA 3KK1A 1B9DA 4DU1A 1KVBA 2GV9A 2HNDB 4BDYA 4DTMA 3CQ8A 1HYVA 4ECXA 3ITHB 3ZSRA 4OLBA 2GIRA 4Q8FA 1RT6B 4AHTA 3P1GA 1RAJA 4IRKA 2YKNB 4YR3A 1G15A 3AVJA 2FVRA 4CHOA 5DQHA 4GVMA 4WYWA 3KHGA 1VSLA 3SFGA 3IN5A 3VN5A 1XWLA 4CK2A 1KLMB 4M3UA 3EPGA 3K57A 4K4WA 2C2DA 3PW7A 2FVQA 1VSKA 4M3ZA 2V9WA 1JLEB 4KKOA 1SV5B 1S0OA 4FJ9A 3HSTB 1LWCB 4DSEA 3BSOA 1RDDA 4ID1A 3D45A 1S1XB 1CXQA 4NRUA 4TQRA 4FJIA 2OH2A 4EBDA 3HVTA 4ED3A 2XRIA 1JLGB 3QIPA 1ASWA 3SYZA 1JXLA 3OL9A 4LY7A 3OYKA 1Q9XA 3CFOA 3HVWA 1T8EA 4ZHRB 1HYSA 1SKSA 3VQDA 3PV8A 4CF8A 2OA8A 1NK4A 2GC8A 3HYFA 4RNOA 5KT6A 1TK0A 3Q8RB 5KFSA 5HLFB 4MK9A 5HROA 2HMIA 4O3RA 4GW6A 4CHNA 4CCHA 5DG9A 4W5NA 3FFIB 2O4GA 3SQ2A 4XO0A 4IDKB 1BQMA 1W9HA 3F9KA 2IM3A 3IRXA 1WAJA 3AA3A 4PUOB 3ALYA 3MXIA 2R8JA 1FK9B 1L3UA 1IKYA 3V1OA 1FKOB 4HKQA 4B3OA 3H4BA 5I42B 4J9OA 3QEWA 4EO8A 2OZSA 1T03A 4FBUA 4IBNA 2IAJB 3AA4A 4H8KA 2YNFA 3TAMB 4KTQA 4RW8A 3KLHA 3V6KA 2KQ2A 4KO0A 4NRTA 2IJNA 1N6QB 3EY1A 3TAFA 5J1EA 2HB5A 2ITGA 4JRPA 4DTOA 3KLEB 5C42B 4EBCA 3DLBA 5DQGA 2XGPA 3CM6A 4CEBA 1HQUA 3T5LA 1Z26A 3EPIA 3AVKA 4F8RA 1XR6A 3TAGA 4M3YA 3MEGA 2W7PA 1RBRA 4H4OB 3PY8A 1GOBA 4IH7A 2J6SA 1U09A 3QO9A 4QWCA 4O44A 4AHCA 4NZ0A 3DLGB 4RUAA 2DFEA 3UQSA 3DRSB 2W42A 3NBPA 4IRCA 5J2MB 4E7JA 3QYYA 4WE1B 4CJTA 5HRRA 3OS2A 4DFPA 1XC9A 2BRLA 3TANA 2YHAA 2D7SA 1RBVA 3HP9A 3O4QA 4M94A 3ZSQA 4CF2A 2B4JA 1I39A 4FLXA 3WNFA 3M9NB 1RILA 2OPSA 4B9SA 4I2QA 5FDLA 2YV0X 1TVRB 3KLFA 3PW2A 3T5HA 2IC3B 1T3NA 3PO5A 1NJWA 3AO5A 4CJVA 4ID5B 4CESA 4C8KA 5DQIA 4O0IA 4DS4A 1QAIA 4B9UA 3NFAA 2G8FA 4BWMA 3NGDA 4J2AA 2W9BB 3AVHA 4N76A 4ZTFA 1HQEB 2FLPA 4DTJA 3K5LA 1JLQA 3B6PA 3V4IB 1D8YA 2R2UA 5CYMB 3RWUA 1QSYA 4LQ3A 5HBMB 4O0JA 3TAPA 1ZBHA 2AX1A 5KGWA 1C1CA 3KK3A 3DRPA 4Q43A 4M42A 4O3OA 4YR2A 1TKZB 1JXBA 4MK7A 5KFOA 2ETJA 4C8LA 3AVMA 3DM2A 5E41A 4RW6A 1RBSA 3IG1A 3KD1E 5KI6A 1S1WA 3HM9A 3WNHA 4B9LA 3UIQA 4DL4A 1X1PA 2OPPA 2OPRB 2G8UA 3OYBA 2JLEA 4KHMA 4H54A 4ED8A 2VG5B 2FC0A 4DFKA 5KFCA 1BI4B 2G8WA 3OSNA 4LSLB 4KHNA 5HRSA 5KFTA 1XR5A 4MK8A 1FKPA 3O3HA 4ED0A 4FZZA 4PQUB 4IFVB 2RDIA 1RDBA 4C8MA 1T94A 2JEIA 3N6LA 3FFIA 1TP7A 3TAQA 4FLYA 3HJFA 2AQ4A 4DL3A 4Z4GA 2WHOA 1TKTA 3HHKA 4JV1A 4PUOA 4W5TA 4ECZA 3TWHA 3IGVA 4O4GB 4F2RA 3AA2A 1REVB 3NHGA 4KE5A 3GYNA 2HHSA 3UPFA 2W7OA 4ELUA 2F96A 3CJ4A 3TAMA 4E0DA 2X74A 3BSNA 1BIZA 1D0EA 3M9OB 2LSNA 3KMSA 5JS1A 3CFPA 2UVVA 3KLEA 2HNYB 2YNIB 4CF0A 4FJXA 4FK0A 4FJ5A 3SI8A 2W9CB 3LP1B 4EP5A 3NL0A 1S1UA 2ZE2B 1RT2B 1JL1A 1NK7A 3OYFA 3HVRA 4CEOA 4KHSA 2HNZA 3P5JA 3T5JA 3HT3A 1SL1A 4HUFA 1D5AA 1EKEA 4CF9A 1RTDB 1KFDA 4Z4CA 3L2UA 3N6MA 2R8KA 1I3AA 4JUZA 4AH9A 5CZ2A 4RW9B 1YTUA 3KK1B 1D9FA 5FROA 4Q8EA 4F4YA 2E6MA 4ZVHA 4O3PA 3RTVA 4DL2A 3VQPA 5FRNA 4WZQA 3O4NA 1HMVB 1HRHA 4OPKA 2JC1A 5F8HA 4MQ3A 4B9VA 4O3QA 3QNNA 1KSPA 4IR1A 3V1QA 4Q5VA 3QGGA 3ZSVA 3NMAA 2VA2A 3CDEA 4AHSA 3NGYA 3DLHA 1S1TA 3KHHA 2FVSA 5KFKA 2YNHA 1WSIA 4KKOB 4KAZA 4KFBA 2XO7A 1QS4A 3LP0A 4CEFA 2XY6A 4OPJA 3MR3A 3H5XA 4ZVFA 5DG8A 1ITGA 4IG3A 3TAEA 3UDLA 3SQ1A 4PWDB 4FZXC 2DFFA 4Z0UA 3HVTB 3NH2A 3OY9A 3QIPB 1RA7A 3VQ8A 3V81A 2C22A 1JLCA 1S6QA 2O4IA 2FBXA 4CECA 3ISNC 4CHYA 3BJYA 2GUIA 1HYSB 3RMBA 4CEDA 4DSJA 4B9NA 2E9RX 4FS1A 2R8IA 4RG8A 4QAGA 4RNHA 3AO1A 1N4LA 3JYTB 2BR0A 5HROB 2HMIB 3OYGA 3QERA 3V9WA 2OPQA 4KAIA 1BQMB 4WYLA 1UA1A 3IRXB 2XC9A 3ZT0A 1Z25A 3MECA 4NCGA 1TL3A 4B3OB 5C24A 3IAYA 4URGA 1IH7A 1ZBFA 3DOKB 4U7CA 4FLZA 2XI3A 4LQ9A 1Q8IA 1EETB 4DFJA 4OLAA 2YNFB 1YVUA
chains in the Genus database with same CATH superfamily
3BF4A 3RBZA 2ZZMA 4RW8B 3KLHB 4KO0B 3UDEA 4NLBA 4ZVUB 1M90O 2F63A 4OYPA 4RNMA 3TW0A 1E6YA 1GMVA 3I55S 1BY9A 5AZJA 4TYAA 4DUYK 3T5KA 4M95A 4ZLLA 2E1RA 1HQUB 1JKHA 1FRKA 2AEMA 2LA4A 3O8MA 1RB0A 2P5VA 2CQ1A 2EK6A 5LXYA 1SJ3P 2KM8B 4LF8J 4LF6J 2A6OA 1HNIA 2KFZA 4O44B 4CJSA 4C3KA 1N32J 5KFVA 3HHLA 3GP9A 3MN6A 2ATLA 4DF4A 4E7IA 3FEXB 2OMLA 3K8WA 1WSEA 1IBMK 3LP1A 3FMWA 4P7TA 2ZITA 3SPZA 3KZBA 4NYFA 4NLYA 4EFHA 3S6EA 3PUFA 4U9RA 3OPKA 4B1YB 4KB7A 2OPSB 4X64J 2VB6A 3KLFB 3MI7X 1ZTWA 4OZ3A 1XMOF 2O8DB 3E9PA 4DV1F 1P27B 2QA2A 3CIPA 2AJ0A 4RX6A 2XG8A 4BR2A 1P6TA 2E9ZA 5CE3A 3V5RA 1JLQB 4ZTJA 2ZQBA 1Z1ZA 1R0CB 2MLZA 2CQDA 1PG5B 4ZCIA 4CHQA 2YCHA 2B56A 1C1CB 4JI2F 2BYCA 2KL8A 4BE0A 3GDQA 4ID8A 1NGJA 8RUCA 3AD8C 5AE2A 1RWOB 3W66A 1YJNS 3VF0B 4WFBQ 2RB7A 1ITPA 4C0OC 4PWDA 3BR9A 4UY85 3D5MA 5BYQA 5GAEP 3HZ6A 3Q7CA 2XYHB 1RWUA 1M5SA 1M5PC 4X2BA 1IO2A 2FVCA 2FGOA 3FEYB 4NLPA 2NSBA 4YN3B 1LWFA 2WFBA 1UPMB 2GMHA 1FKPB 4K2XA 4NCAA 3KJVA 3JSMB 3VAJA 2IDOA 5H9FK 4DS5A 1WUAA 3NGTA 4YB7A 2HQIA 2AYBA 1TKTB 1C1AA 5IT9O 1RDAA 1WOOA 1H73A 1RI7A 5DK5A 2CVIA 3JB9k 1R8HA 3CMAS 5LL6Z 3VVUA 4A46A 5LMUJ 4ECYA 3CJ5A 3I4HX 1HNXJ 3HSZA 4NEZA 2A42A 1Q86T 2W8LA 3CG7A 3C6HA 3O3GA 5ETVA 4XTTA 2YPYA 3I87A 2NRZA 2AP1A 3WXKA 2ROGA 1VRUA 2VQEF 3RB0A 3SFUA 4GO7X 5M2RA 2BEFA 4CIFA 1EAYC 3UN5A 4EHTA 4K7QA 2Y1JA 1S1UB 1I5OB 3RB6A 3A8KA 3GIJA 2YX7A 2HNZB 3VEWA 4CLFA 3VMFB 3AGRA 2CH5A 2BM1A 1H0HB 4P6QA 4ERDA 5C12A 2ASOA 2WRMA 3D9BA 3FZKA 5AZIB 2G8VA 5F2RA 1UJ4A 5LJ3Y 3GE1A 3VQTA 1FEHA 3IM8A 2J76E 4FJKA 3Q0AA 4FKXA 1SKUB 5AJ3K 4CJRA 4JI4J 2MZ1A 2Q0RA 1BIUA 4CO2A 4G6VB 1PKUA 2M3DA 4DSLA 3QT7A 4HHTA 3CULA 4G3IA 3GIKA 1HA1A 2G0IA 2IVNA 3ZCMA 4MAKA 1KDNA 3Q89A 1RT4A 3AOAA 4DUZK 4FCYA 3KOAA 1CZBA 4DCHA 2DNQA 2VBYA 4FJ8A 2PN6A 4Y00A 3U27A 4CJKA 4Q45A 1VHXA 4AXJA 3KHLA 2ZBRA 2P1JA 4YOYA 2WVEA 2VBZA 4X4PA 4DR1K 5KPRA 3LPTA 4LF2A 4PG6A 4ZP7A 1S6QB 3GTYX 1RDUA 3B4MA 3KK2A 4OX9F 5CH7B 3OS1A 2HBJA 2QFJA 2V4RA 3H90A 2HAIA 4NX9A 2BE7D 3PHTA 5KFWA 3BDEA 4DFMA 5RUBA 3CCEN 2XSJB 3CJSA 1Q8KA 1QE1A 1LQ9A 1NM1A 2ASPA 3ILOA 3CCSS 5DRKA 1H7WA 4M45A 2NRVA 3MECB 4BC3A 1TL3B 2CNKB 4IKFA 1ATNA 4DPWA 5C2FA 3P39A 2DO4A 5C24B 5KOXA 3UD3P 4RZRA 1RYRA 3O1BA 4Z4IA 2JLGA 4K4SA 1QTMA 4IO9L 2NNWA 5D77A 2DPIA 2ZVSA 4TN2A 3CO9A 3G71S 2PEHA 4CH7A 1WKKA 2JEGA 3QICA 3NS7B 2ZC4A 4CZHA 2WW4A 3L3CA 2IYGA 2VICA 2V0NA 1DAXA 2A1SA 4CD3A 1RTHB 3DXBA 1PILA 3QWPA 4QIEA 2DR6A 1SUQA 3L2RA 3IRWP 4QU7A 5AQOA 1CJTA 3NS5A 4FVMA 4DF8A 4GO5X 3PVXA 4AHUA 5D78A 1NWKA 3FDSA 4Z4EA 3VA3A 2E5IA 4PKDB 1HBMB 3ULEA 5BPLA 3CCJN 1Y97A 4ED1A 1OS5A 2JX2A 1NLKL 1HI0P 3ZYYX 1BCOA 1GTEA 3C14A 4CBWA 3QJPA 1GLCG 3GR0A 2R7YA 2AYMA 1RT7B 5ETMA 3D6HB 4FXDA 2N7CA 4WWSA 2QLJB 4EFAC 2VUGA 3AO4A 4DL5A 2LYVA 1X9JA 2UVWA 3K0SA 4X4NA 5F8MA 2HQCA 4RPFA 4ZKAA 4MFBA 4W5QA 1PGZA 3IS9A 3NLCA 4E7KA 1JLFA 3HHDA 3ZX3A 2KW4A 2KG1A 3EWGA 1U1PA 5KFEA 1RABB 1MWKA 3HX9A 3H2LA 3M1VA 3VQCA 1RTIA 1U2FA 1KAYA 1TK8A 3M8YA 3NVMA 3TSQA 4EZ6A 4CFBA 1QD1A 1SL2A 3L2WA 1QAYA 2QWOA 3R8EA 1WC5A 1VQKN 3KHRA 3AOBA 1UW9A 4CZEA 1B0PA 1U4BA 3H1QA 1TV6A 2RN2A 1OH8A 1CLFA 2YKMA 4JK8A 3RBEA 4P2FA 5JUMA 5DDOC 1LWEA 4Q7AA 3ENVA 4FNHA 3L3UA 3CD6S 3QJJA 1FXLA 4IRDA 3N4WA 4DV0J 2RMLA 3OYJA 3V1RA 3DRRA 3M8PA 3G4SN 4WPAA 4WTOB 3PO4A 4RU9A 3C66A 1UJ5A 4AM6A 1WN7A 4DV6J 2HLUA 3OYHA 3H3OB 5HJXA 5IT9U 3UE5A 3ASMA 3OJSA 4WFBL 3GIIA 4YOTA 1VQ8S 2PZSA 3I5BA 5IV4A 1AA1B 2OCEA 2C42A 2C2EA 1U24A 5KG7A 1XI1A 4LH5A 4B8AB 2ROPA 1J5OA 3R5JB 1FD2A 4KHPJ 4ELVA 2WVDA 4LF5F 2LEAA 4OZLA 3VEOA 4X65J 3NWRA 3MDFA 3LM2A 4OHXA 3HPOA 1S9EB 2LQBA 1Q18A 5HRPA 1WOQA 1FD8A 1HWKA 3FRZA 4K4VA 4WU3A 2MKIA 3CUNA 2UXBF 1RTJA 4W5OA 5LOQA 2J7WA 2MXYA 4KI6A 4FO0A 4KC5A 3ZTQA 7FD1A 1J6ZA 4Q0BB 2IA6A 2HSTA 1TK5A 5GAEI 2ZF5O 3RB4A 2ZWPA 3LPYA 2V7YA 3QSYB 3TA2A 2O1PA 1VQNN 5A8KB 1JLBB 2WOMB 1NNDA 2V9KA 5J2PA 5A8RA 3W5XA 5HQLA 3TQ1A 3QQCD 5KG3A 4EIAA 5HK4A 5BRFA 4ZK7M 3L8BA 2HWHA 1VQ9N 2ACMA 2ZZTA 3FE1A 4M5LA 4CGHA 2CPIA 5CR4A 5HJYA 4CO4A 3T1HF 4LH4A 2B5JA 1R6VA 4JKEA 2RQKA 3LPUA 2ADBA 3ULDA 2DKOB 2RH3A 3VGUA 1U48A 2XS5A 3T6BA 2CJ9A 1K1QA 3BF1A 2X1AA 4LREA 4RKUC 3GL1A 2ZHBA 3ZSWA 3CPWM 3VF2A 1KHVA 4OHYA 4Y2AA 1O1WA 2MSSA 4C8NA 3G2XA 1PAEX 3PLAA 1R0AA 3FSIA 2IJFA 1I94J 5L1IA 1T9XA 1HKCA 3VF4A 2DTJA 3DN9A 4M3TA 2Z1JA 1ZAVA 4EU0A 1HJRA 3EGNA 1LW2B 2NRTA 4JI6F 3T1YK 3MEEA 3K9JA 1XBWA 2B51A 2VG6A 3J7YU 1HHTP 2Z1HA 2I5JB 2RRBA 1IG8A 5ETOA 3C65A 2IOCA 2EBGA 2FZGB 3DHWC 7FDRA 2K7KA 3FBEA 4AFFA 2KHOA 3GSIA 3AODA 3MUMP 2DH7A 4N56A 3TSUA 4KSEB 4P2XA 1U0HB 5DETA 4ECUA 2MB0B 2O8EA 2C3MA 1WNEA 4XIUA 2ROEA 3NCIA 1FFGB 4RBUA 2HGMA 4FJNA 4TY8B 4LMZA 4JBCA 4DOZA 4ED5A 1TUWA 3GPAA 3RMDA 3D1QA 2HYIB 2VONA 4CGIA 2JLFA 5BR8K 4NLGA 5SZTA 1NRKA 3C6TB 3BKTA 4EP4A 1TL5A 4DLEA 3L7OA 3HXMA 3H4DA 1VQ7S 2C1EB 2GJIA 5CYQB 3ONQA 2WUSA 4KH0B 4CZGA 3P5TL 3JSBA 1HLWA 4WQ5A 3BQ1A 4P71A 4RLEA 2QGFB 2KFYA 4BVPA 3MURP 1U1QA 3P45B 5LXRA 1YKWA 1S3XA 4Y1CA 1DEJA 2HHHF 1EX4A 1J53A 4XEIA 3VEZA 1R43A 3V9UA 4J5OA 2CQCA 5GAHU 3KK7A 5LMNJ 1RDCA 3AARA 1C4AA 5C25B 1XNQJ 2NUHA 1MMLA 1JJ2M 4CWBA 3BP8A 4KH6A 3OFFA 4PXCA 3OUYB 5CD4H 2PA8D 5EX5A 2G0CA 2OEKA 4PCQA 1HYZA 4M3XA 3J7AP 2VFUA 4KHRA 3ZNUA 1AXQA 4I6MA 4M63A 2ZZNA 2QSWA 2NUUG 5IQQA 1V3SA 3AB2B 1BISA 1KFSA 2DR7A 4OI1A 1U6BA 1VIXA 1MMDA 1KEKA 4KTWA 2JFKA 3MMCB 1SI9A 2XZDB 3V4MA 1QHTA 2XB2D 3CMEN 1IBLJ 2CA9A 3ZEUA 1FDBA 2ASMA 4CJEA 1HNWJ 1O6XA 1O0PA 5KG5A 3G96A 3MM9A 4XPCA 5DDQC 2YKNA 3G6EN 1VSJA 3K58A 1FX2A 4NL5A 3KJFB 1DLOB 1RWWB 3ZZZA 2ZKTA 2FBTA 1PC4A 2V5HG 1HI8A 1S6UA 2YNGB 3QEPA 2F4FA 4KB0A 2GWJA 5E3PA 1JLEA 1HWIA 3L09A 3NAIA 3L2QA 1LWCA 4DR2F 2Z1IA 4M5HA 4K0KJ 4DR4K 3PYGA 5KFBA 3X1LB 2Q43A 3MEDB 3HZEA 2RT3A 1WG4A 3V2UC 1JLGA 1N5YB 2WB4A 4LSNA 3LUYA 4ZHRA 4KH1B 3UWTA 3CCMN 3MMAA 2GIFA 1N33K 2OMOA 4O0NA 4CT8A 3QATA 3AVLA 4TY9A 3SUOA 3R7SB 5K8NA 2BKOA 2PO4A 2VPWB 3ADAC 3MMBA 2QEXS 4FWSA 1DQAA 2MZSA 3L9ZA 1F0XA 3MCAB 2K7JA 1YJUA 3FMBA 3GV5B 4OGEA 1NDKA 1U2VB 4CM2A 3PSFA 4IDKA 1S99A 1VJQA 5JVHQ 3HJVA 4F9OA 1H7XA 1Z2LA 4JEPA 4LFAJ 4MKYA 1RAGB 3CCLS 4NLSA 1VI7A 2L9NA 1FKOA 3BPSP 2YI1A 3C7NA 2D9PA 4H4KC 5BRDA 5I42A 2CQ4A 1CBKA 1LEOA 5KFUA 2HS3A 4GC7A 2ZUAA 4R8UA 3KTQA 4FPIA 1W25A 3CDWA 4FYWB 3ZZTA 1GH8A 2W9AA 2QJ3A 5AQLA 2OTLN 2RPIA 1N0VC 1K0TA 1JXEA 3UD4P 1M90T 3FZ2A 1S7IA 2C28A 2QC3A 4KGVB 2CQ3A 3IC1A 4DU3A 5EWEA 4QCLA 5DDRC 4H4OA 3LA0A 2W2OP 2BJEA 3RZAA 3FSYA 1DY3A 4CRJA 1Q9YA 2O67A 1AFIA 3W2WA 3EO3A 4Y1DA 1VQLN 4OJHA 5AQTA 4OKKA 3OL7A 5F8IA 3N4QA 5THWA 2CPYA 4ZLPA 4JI8J 3AAPA 4NLTA 4BROA 3THYB 4AT1B 2V7ZA 1U02A 3EZOA 4KR0B 3HFVA 2MHNA 3K5OA 3GFXA 4CJ3A 1SIZA 1UA0A 2DGOA 2D9OA 4O55A 2GGPA 5AE1A 3H5UA 3IXQA 4OYAA 6FD1A 4HLBA 2AP6A 2W6LA 4CM0A 1WSGA 2QRRA 5A8WA 3CCQS 3TO8A 2B6AB 3DI6A 3M32B 2NS1B 4CZLA 3O44A 2RE2A 1GX5A 1NOYA 2K8GA 3V4IA 4YP3A 4J2BA 5CYMA 2LQJA 1FWLA 3C0BA 1W26A 4MYUA 1F6TA 2BH1A 2BGGA 2CQBA 4FLUA 4PPZA 3UW1A 4A8XA 3TZYA 5C0YA 4EYIB 1TKZA 4F2SA 4JKCA 2IMWP 4LFCF 1BA0A 4CZJA 3ZT4A 1FXXA 3ZTPA 3M8RA 5AXMA 3N5FA 4LF7F 3ENOA 4CZCA 3RSEB 5KFLA 1YRTA 3LP3A 4C8ZA 1SJFA 1XNRK 4H4MB 2IJRA 1YJ7A 3MCPA 5AT1B 1YQHA 5A2QU 3K59A 4IEEA 2NQPA 3IKMA 2BQUA 1IKYB 2N4CA 3RB3A 4KPCA 3EVOA 2U2FA 4DU7A 3HLUA 5DZ7A 4UQGA 3CFRA 3KMQA 1YJ9N 2L41A 3S1TA 2YQ1A 2E29A 2FJWA 1VSDA 3QIOA 1RGVA 2HWIA 2OIHA 2CPXA 3I0RB 3UR0A 5HMYA 2V4JA 1UKUA 1XJWB 3SQGA 2PI5A 1S0VA 3R7BB 4DQPA 2EFNA 1VAZA 3SBMA 4FN5A 1IJFB 1RYSA 1R31A 1HNVB 2HF3A 4ANEA 1RBUA 2YWEA 1TR0A 4ED2A 1PYTA 2VD3A 1FKAF 1CJKA 1J9AA 1KVAA 2CPEA 3FKBA 3D2WA 5C7PA 3THTA 3G6VA 5K14A 1WACA 2GHWA 5AFUH 5GADU 4DR6F 4ECQA 5M1QA 5D0HA 4HACB 3BQ2A 2VKZG 2R2RA 4LT6A 2KZMA 1HW8A 3TRGA 2E4LA 3LGHA 4OJRA 2VBWA 3BN4A 2DNGA 4HH1A 4IQXA 5IWAF 3SNNA 5L8RC 1XMOK 1O5JA 1RSCA 1R3NA 1U7LA 2GZOA 2GV9A 4BDYA 3JTPA 1HYVA 4ECXA 3ITHB 2MEWA 4OYWA 3MPYA 4YR3A 2V67A 2Z8QA 2GCFA 4YDXA 1G15A 2FVRA 4CHOA 4YHHJ 3R9PA 3PXGa 1VS3A 4Y0FA 3KHGA 3G8QA 2H1YA 4WJBA 3VN5A 1XWLA 4DV2F 3EPGA 2C2DA 4M5DA 2FVQA 4OYOA 1VSKA 4M3ZA 1SV5B 2M9KA 3HSTB 4DCJB 2HGLA 3W62A 3M1FA 2PD1A 1CXQA 1N32K 4NRUA 3BZCA 4FJIA 1FDAA 2J9DA 5C10A 3QIPA 3CCVS 4A8SA 3AFGA 3SYZA 5GMDA 3BZQA 2ZJQQ 2I38A 2CPJA 3VGLA 4TLQA 3W9JA 1G2EA 1SKSA 3R5GA 2OA8A 1NK4A 3OXLA 4RNOA 4OYMA 3VENA 3GYXB 5KFSA 4JKAA 5K9FA 1APSA 1YITS 2C3UA 4O3RA 4GW6A 3SQ2A 1YJWN 1IWGA 1PJ6A 2QLFB 3PACA 3AA3A 3MXIA 1ZA2B 4PYAA 4OZ2A 2L08A 3V1OA 1ZA1B 4J9OA 1WOSA 1KOOA 3P38A 2OZSA 2F7TA 3D7EO 1T03A 4H8KA 4PL8A 5FJ4A 2F40A 4KIAA 3V6KA 4QU6A 4NRTA 2V8DA 2P8IA 3EY1A 4WU2A 3TAFA 3IBFB 4JRPA 1IJJA 4DTOA 3KLEB 5C42B 2ZFHA 2H48B 4C48A 3CM6A 4CEBA 5D4PA 1FA0A 2DIVA 4PABA 2AYGA 4F8RA 2M8HA 5M1OA 5D8HB 3MEGA 4NYPA 1BD6A 2GA7A 4DV3J 2W7PA 5H1SQ 4DDFA 3PYDA 5AQQA 3QO9A 4QIGA 2H4YB 3NGKA 1VR6A 3OW2M 4AHCA 4DV4F 3DLGB 3DRXA 3LDQA 2QO3A 6FDRA 4IOCQ 2Y1LB 4A48A 3RYLA 2NZTA 1GMWD 1AFJA 4DN0A 1N5QA 1QY7A 5HRRA 2DNOA 4LF4F 1XC9A 3ZTSA 3NEKA 2CG4A 4PKIA 2JH3A 2K3KA 3HP9A 2CGJA 4M94A 3IFEA 5FDLA 2HZVA 3OBIA 2VOOA 3L4IA 3T5HA 2NXJA 1HNXK 2Q1NA 4CLKA 5IM0A 1J5EJ 4ITSA 2LQ5A 2B3TB 2MKKA 4DS4A 4B9UA 1CVJA 4NXNF 3AVHA 3F9MA 4USJC 4ZTFA 2OO4A 1Y0HA 3R27A 1D8YA 3RWUA 4OX9K 2V8GA 5HBMB 5E3RA 1ZBHA 2H4WB 2GVZA 4FF2A 4QS9A 4DZ6A 3DRPA 3TPQA 1JMTA 4QQBA 2ZM6J 3H45C 5D15A 1AW0A 1QZ6A 3D2EA 4FYVB 3M2UB 2HVDA 4GKJK 3BGLA 4A5BA 1BLUA 5E41A 2RHKA 4A62A 5KI6A 3WNHA 3UIQA 4CO5A 5B0CA 2OPPA 3Q8UA 2WVBA 4GV6A 2VFSA 4WP3A 1RHUB 1NZAA 2OPRB 2KHDA 2FC0A 3TTCA 1GEHA 1RISA 3EX7B 1RWMB 3UCUP 5HRSA 2P6TA 4PQUB 4IFVB 3M5RA 2JEIA 3FFIA 1TP7A 1WC6A 4CLSA 3I55N 3HJFA 2EBEA 5AQVA 2OHDA 2AQ4A 4B1ZA 3E8OA 4PUOA 2RS8A 1UEVA 1Y3KA 1XUPO 1YG0A 4F2RA 3AA2A 1REVB 1R8CA 3IUCA 4L73A 1UTAA 4KE5A 4ZCLA 2NRXA 4DJBA 3JS6A 3FJ2A 1WDTA 1F9FA 4E0DA 1LK7A 3BSNA 1RAHB 4A8OA 5K8PA 4Y28C 4NO7A 5C15A 1GLEG 2LSNA 3VOVA 3KMSA 2YNIB 4FK0A 3Q8VA 2R7RA 4EP5A 2ZE2B 1N0UA 3J7AN 1NK7A 2HMPA 3BN7A 3R9LA 4KHSA 2IBOA 2F9WA 1G4CA 1X5PA 3T5JA 1SL1A 1LKZA 1KFDA 5JVGL 4FWPA 3L2UA 4U8VA 3M3ZA 4JUZA 2Q6BA 4JAXA 2R7VA 3J80Y 1YTUA 3KK1B 5FROA 2VJVA 4Q8EA 4P52A 2E6MA 2D1CA 4ZVHA 1WC0A 3RTVA 3DLLL 4JI5F 4PHTX 4OPKA 4DHYA 4ZVTB 4B9VA 1WEZA 3CIMA 1B4SA 3GLJA 2VA2A 1FJEB 3CDEA 4L75A 4JI1J 4DR3F 3DLHA 2C2NA 5FPEA 3THWB 5KFKA 2W1BA 5ADXA 1RU1A 2E7XA 2P9CA 5J1PA 4KFBA 2XO7A 4HI1A 1RWKB 4DUYJ 2N7YA 2V34A 4H0VB 4CEFA 1YJNN 2XQCA 3KWGA 2MQOA 2J9EA 2G1DA 4TNOA 4IG3A 1RHQB 3LGNA 2DFFA 3VQ8A 2C2KB 3V81A 2EPIA 1JLCA 4HHHA 5K20B 2IVPA 4CEDA 2Z56B 3HKZD 5JMVA 3UR3C 1TFYA 2E9RX 4FS1A 3SDEB 1C0GA 4USKA 3TZXA 3ZETA 3AO1A 1A9NB 4MJKA 1N4LA 1Q95G 3QERA 2IYIA 1VC0A 1BQMB 2VC0A 2XC9A 1RTZA 3ZT0A 2W24A 1S22A 4A4JA 3CNQP 3G8TA 2P9SB 3CMAN 4U8YA 2BACA 4DV5F 4LF5K 4YB5A 4NZ6A 5M1NA 2QSFA 4FLZA 4O8UA 4L72B 1X0FA 4RWXA 2GMJA 1YVUA 4FPBA 1N54B 2DT9A 4ILLA 2ZGZA 1IBKF 3VQ6A 2O8CA 2FBVA 1KBRA 2EXUA 3A5MC 1SCJB 3D0GE 4NLWA 3OXGA 2RAQA 5SWMA 2UXBK 4N7TA 3CJRA 5AQJA 4DV0F 1NGAA 3HPGA 3QT8A 1X31C 1QUVA 1TKXB 1RGIA 3UVJA 4MKVA 3M2RB 4E7HA 3AO3A 1EP4A 1H98A 5DDPC 2BANA 4J91A 3OR2A 4NLQA 3Q24A 2ZNZA 3T3FA 1BU6O 1CQNA 4CGFA 2FJBB 3NS6A 2IS3A 2H51B 3NBPB 1SQGA 3D1OA 1HARA 1TL7B 3JSYA 3QFHA 1WKLA 3GV8B 1MWZA 1Q82O 3J7ZO 2XMAA 1GTHA 2FZKB 1Q78A 4DG1A 4UUWA 2IRXA 2VFVA 4KHPF 3THXB 1IM6A 4BR9A 4Q44A 2AJ1A 3P8BB 4M7YA 3T1HK 2YHWA 4OI0A 1KONA 4FKYA 5H9FJ 4IOCL 2Z58B 4QW8A 4IXCA 5T14A 4HHJA 3H5YA 3HSCA 2XGQA 3K8VA 3C6UA 4CHZA 4HWIA 4NZ7A 1TMMA 1HR0F 4GVBA 5KG1A 2YJEA 1JJ4A 1SH3A 2X3GA 4X65K 3E9OA 1HMVA 5A0YB 4BACA 3R2CJ 1CJVA 5T7LA 3KUHA 1NKEA 3KLGA 1EO1A 4O23A 4A2BA 4CJFA 5DS7A 2YVSA 4JK9A 2H9ZA 4NWBA 3RAXA 5IS2A 5GAGU 4CVNE 3VF6A 4NYNA 2HIQA 3IM9A 1ZETA 5EN1A 3AA5X 2P9EA 2KZZA 3CCSN 4JI6K 3D6MB 4NLCA 1GFWB 3M30A 3FEZA 3QZ7A 2N4DA 4LD0A 3RRGA 1IR1A 1BXNA 4AILC 3POTB 2J9CA 2P9PB 4ZVPB 2CKWA 3W8GA 3G0ZA 3G71N 1MG7A 2FB0A 1Y7PA 3MDQA 2JZ5A 4FYDA 2YKQA 3JYTA 1NSKL 3Q23A 4CEEA 3UKRA 3S01A 3GJTB 3ET6B 5AJ3J 3K2PA 1NK5A 3C19A 4FM2A 2W4PA 1CS4B 1NH7A 5C2GA 1Y00A 5CZ1A 4AL5A 3F2KA 4CGGA 1C1BA 2NYIA 2HEKA 4BRLA 4CHPA 3I31A 4DUZJ 3MK6A 4GKKK 2W40A 4A5AA 1EETA 1H2UX 2ZOGA 3LTOA 5I4MA 3MR5A 2V52B 2BE2A 4YQWA 1RCXB 3KDOA 3HK2A 3DYAA 5EX3A 1SJ4P 4DR1J 2ZJRL 2RU9A 2V68A 4RR5A 2EFVA 1HBNA 3WQTA 4NLXA 3DXSX 5HMXA 2R7UA 3R1XA 3NKYA 4C1NI 3SV3A 3C3LA 3K9KA 2HHHK 4K4XA 2DGQA 4CQ1A 1RT5A 4J2EA 2P9NA 1MA9B 4BE1A 1ASUA 3LOUA 4ZPWR 4Z7YA 4DCPB 1GLBG 2O8BB 2KVQE 4NA2A 4YB6A 2DY4A 3CDBA 1X3NA 1NNEA 5KG2A 3HT0A 2WSCC 3CDUA 1KAZA 4BVOA 1VSMA 3I0SA 3P4UB 2M70A 2VU5A 5LY3A 2ZH5A 2B4UA 4ZS6A 2DHAA 1S1TB 2MGZB 2CFXA 2E7WA 3KD5E 2YNHB 4BRMA 3G82B 3NCQA 2PI4A 4H0YB 4ER8A 1KD1O 1NU0A 3LP0B 4N8OA 4YS2A 3CJKB 1F21A 3ZSYA 1M1HA 1WSFA 4ZP9A 3PDNA 3EZUA 3OTDA 2UXCJ 2AGQA 2QTDA 3GFYA 3QLHA 4K5SA 2ZJPQ 2D0CA 3CD6N 2RKIB 4UOFA 2KDOA 2KJWA 4FZVA 5KFJA 4FPRA 3TJAA 4ATNA 4DU4A 3NF6A 2LFVA 3Q83A 3CF5L 1GXUA 4GV9A 4I6AA 1FT8A 2BJ1A 2I7NA 1WSHA 4EZ9A 3AVNA 1TUYA 3O6QA 4B3RK 1WORA 1YTAA 1S48A 1X9SA 5L38A 3G8SA 4IOBA 4CO1A 1VQ8N 1QSSA 2OPQB 2QXLA 2ITMA 4DR2K 3JAMO 2YX6A 4NCGB 2EHGA 3R1HA 2R2SA 2OD4A 2K06A 3ILJA 3GONA 1F5BA 1ICEB 2H5JB 3SQ0A 5TKWA 1UVJA 3MOZA 2HGNA 4DXLA 3MFIA 1NZ8A 3U1NA 3JSMA 2D0BA 5I3PA 2G2OA 3O9RA 3H8YA 3PYEA 3NNCA 4ZIVA 3VQ4A 2LU1A 1E6YB 2PE8A 5AZJB 2IVMA 3GG4A 3M8QA 1JKHB 1X0PA 3M9MB 3KG1A 4I9LA 2QLBB 1DT9A 5DM6L 1KLNA 4HTIA 4ZLJA 3G10A 5CZXA 3N6NA 4NOHA 2A1RA 1JJHA 5DMRA 2QFIA 1HNIB 4C8OA 4KYZA 1R7IA 2FUG9 3QNWB 4J9NA 4ECTA 3B6BA 3VETA 4LRFA 3HHLB 2BM0A 3MEKA 4DWIA 3CETA 1FRXA 4Y0WA 2IDEA 3EKUA 5DGAA 4WP8A 3UDCA 1DARA 3U02A 1S9GA 3AXMA 3NP5A 4X62F 3KIOA 3G87A 5IFMA 1Q8BA 1X9MA 3CJTA 4KHYA 4O4RA 4F04B 3EMTA 4K0KK 4YDUC 3GZ7A 2RU3A 1U6FA 1FI4A 4IUFA 4OZJA 2KKHA 4IR9A 3DLEA 3BYPA 1GLDG 2RJZA 3CCWA 4CDIA 2E5LJ 1F2HA 1RQ0A 2GJFA 3D3BJ 4B9TA 1GT8A 1M0SA 3OQ2A 3DDNA 3ZX2A 4Q2MA 3A3NB 4RBVA 3K5MA 4ZA1A 1ELOA 1RACB 2ACYA 3UB5A 3EZWA 2BOAA 3V6HA 1O8BA 2VZ9A 3ENAA 1MDUB 3L0QA 5LM7E 4TU8A 1K8KA 2KI2A 1RT3B 4QWBA 3QESA 2L3MA 3SSRA 4JI0J 4EAHD 2GELA 2KU7A 5ITHA 3HFKA 2CUYA 3OYLA 1NMDA 1QM9A 2HS4A 3TVZA 2R9LA 2SXLA 1UWBB 4Y65A 2BQ3A 5HVHA 2EVZA 2YBVA 2Q0UA 4BC9A 3L95X 1WG1A 2HFSA 5F9LA 4M5GA 3HPHA 5ETPA 1LWFB 1SKRA 4JV5F 1VBYA 4WIIA 3IBWA 3KJVB 1T05B 4ZJQA 3NGZA 3MWBA 1SPBP 3Q7BA 2AJ2A 3E01A 4LFCK 2A0FB 4DX8H 3PJWA 4LF7K 1LXJA 1UPPA 2DEIA 3O6WA 3I33A 4DSKA 2PYJA 4Z4HA 2QE5A 2VDIA 5GAHI 1NJIO 1UCNA 4JI8F 1NGGA 3A5NC 2DRDA 2L9WA 1NUEA 2LXIA 3MGJA 4JV0A 3RUBL 3SZ2A 4UUXA 4KBIA 1RAEB 4M5NA 2D0AA 5KT4A 1U1KA 1KCFA 3HI0A 1VRUB 4CI6A 1W0HA 2HFNA 4ZPCA 5BRHA 4DX5A 5HN0A 1VQ7N 1MLAA 3PR4A 2ZBIA 4ZPVR 4K4TA 3NDKA 1ZBUA 2R3VA 2HBLA 1W7AA 2XYGB 2GNKA 5LJ5Y 2QX0A 1WD6A 5AQPA 1NB7A 1KTQA 1MN9A 1TFWA 4H4KA 4WF9L 2YPZA 1UMJA 3PHEA 3PRBA 1BCMA 3D4JA 3W5YA 1ZM2A 2LXUA 3JXOA 3LO3A 1RNHA 3OXFA 3AA8A 2M4MA 3T1YJ 1RT7A 4B8CA 1YVFA 3CSKA 2KVIA 4CIGA 4DR6K 1NJZA 1AZSA 3SSQA 3H59A 1N8RO 4BCAA 3BYRA 1QDUB 3DMJA 3ZTOA 1RT4B 3I82A 2QV6A 3O9QA 5F8JA 4MIBA 4ETXA 4M63C 2UV8A 5IWAK 4HL9A 1RCHA 2HHTA 4FL9A 4X4SA 2AEJA 1CG2A 3LDPA 2H54B 1VQ5S 3AH6A 2EFPA 2W2QP 3BB5A 3VERA 2DGWA 1BQXA 4F0KA 1ULRA 2O01C 3QT6A 3CJ9A 2HW3A 2PFDA 1LNQA 2AA4A 5BR8J 5IXUA 1VRTA 1S4EA 5JLHA 5F0WA 4KTZA 1XMQJ 5G0RA 1QAJA 4DV2K 2K2PA 3A1YG 5AQHA 1U1NA 1QE1B 2Q6CA 1BUPA 3OHBA 5K5MA 2ZOFA 2ZJPL 2RDJA 2V4QA 1S6PB 1JIHA 2OGUA 3D67A 2NRWA 2EWSA 3FRYA 2X3DA 1EKSA 2IVYA 4I64A 1T11A 1GAOA 3F73A 1J27A 5C2DA 5A6WA 3MMVA 4KJIA 3AB4B 2FJVA 2KT5A 2P6SA 3SI6A 3W2VB 2UXDF 3W0LA 4CLZA 8AT1B 1ZTTA 2G8IA 3PEJA 5AQYA 2E2OA 1B99A 4M3WA 1HBUA 1HHSA 2FC9A 3H0PA 2UP1A 2QEXN 3NXZA 4Y6IA 1F9HA 1UFKA 4N41A 1VQ4S 4DCOB 3ZT3A 1TKDA 2PY5A 4Y2CA 2DGXA 2UU9F 5LSOA 1SUQB 2WBRA 3VZHA 2D0OA 2H3GX 3ISZA 2ZH6A 1F3VA 3PTWA 1OPZA 3Q8SB 1HBOA 1RK8A 2WB1D 2YHYA 1MROA 1VLYA 3ULEB 1IKXA 2XHBA 2GUPA 3CCLN 1DQ9A 4FW1A 5KFXA 3OFGA 4DPOA 1VQPS 1XIQA 1VRQC 2FC8A 4NA1A 4NE9C 4QOTA 4CO3A 4CLPA 2I9SA 5DJBA 5CCMA 2ZH9A 5L1JA 4RNFA 4WCEQ 1OIAA 3CEDA 3M8ZA 4A8WA 5MLCQ 2LMIA 2ILZA 1VISA 3QMQA 2YTCA 1U47A 5AR0A 3PRDA 3IP0A 1WEYA 3EZ5A 4JLHA 4K5RA 4NLRA 1FNXH 2WW8A 4I56A 4MFBB 4YMEA 4XDCA 3IS9B 5F8NA 2HBKA 2FIUA 2APOA 4DV4K 1JLFB 2FYXA 3QFPA 1A5WA 4DL0C 4WFNL 3SLCA 1DHMA 3DOLA 3CT9A 3CCTA 4DR4J 1GK8A 3M1VB 5KFFA 4IZ9A 1RTIB 4JK7A 4LF4K 2G2ZA 5KFQA 3V6DA 4B1UB 1YBAA 4F26A 1RKIA 2E1MC 4YOVA 2J8AA 2KHCA 1RLCL 1FTRA 4HUGA 4ZITA 1XHXA 1MU2A 1TV6B 4FVUA 1NM2A 1RT1A 3QBWA 2YKMB 2KG0A 4X66F 1FX4A 2XMKA 1G99A 2NRRA 4FW2A 1LWEB 4ETZA 3CCQN 1B9FA 5DM7L 4J9QA 4A2AA 2CYYA 1XQIA 3G86A 4NXNK 3IR6B 3DRRB 1HWUA 3M8PB 3B4DA 1X60A 3W65A 3L7PA 1UOCA 3VQ5A 2MKSA 3VGMA 1RT6A 3IAS9 5FPNA 3ZT2A 3I9ZA 2J0WA 4NMXA 1GOAA 3GJQB 4CJUA 3DXMB 3CJ8A 2E1PA 2O5DA 2FHJD 2ZDOA 3A5LC 1BHLA 4MDBA 3HHLD 1ILYA 2XMTA 1S1XA 1C4CA 3VEXA 3CC2S 1NGHA 3LPEA 3IR7B 3MR6A 3JSRA 3SSSA 3BO3A 2FY1A 3AVBA 2DNPA 2KXFA 3OTCA 6AT1B 2DFHA 1HKBA 2DR9A 1QSLA 3FZBA 5GADI 2WK4A 5LSLA 4WKYA 5CZVA 2IIHA 3AVGA 3ATUA 4JS5A 4OVLA 4DTUA 2PBDA 5HMZA 2CJYB 2RS2A 4CK3A 5CD4A 5HLFA 3C15A 4X4OA 1K8AO 4NMLA 3OBWA 2QWRA 4ZIWA 1Z2ZA 2Y8YA 2Z1GA 3HHEA 3B6OA 3FBCA 3JQMA 4P10A 5KT7A 5D6GA 5J2PB 1MN7A 1NPPA 1T6DA 4QWAA 4F4AA 2IAJA 3NAEA 3OYAA 3TVKA 2QK9A 3NWGA 1NKBA 1CJUA 2R7OA 1N6QA 4CIEA 4B3MF 4F3TA 2A2CA 1OY6A 4N5SA 3BUZB 4LF9F 3TJ9A 4DV7F 4JV2A 3CYMA 1V3ZA 1FWPA 2QM1A 4PXEA 4R0JA 4JKHA 3JTNA 2UVRA 2B5JB 4I6WA 3SV4A 4CBUA 1TUGB 1WC1A 2B43A 4DHVA 4DU8A 3RBDA 4IJNA 4LSZB 2X1BA 3QAUA 2XHCA 2OUGA 3QRPA 3F56A 5CYJA 4JI5K 4ISFA 4F25A 1OSCA 2MKCA 2EEYA 5KG4A 1JXVA 4OZNA 3DNCA 3QIDA 4WE1A 4ECWA 4M41A 1L3SA 4XDDA 4PXDA 4QS7A 3MD3A 3NY0A 1R0AB 1Q82T 1NO8A 3TEGA 2X6SA 2IHR1 3J7ZT 3WT0A 5K8MA 3U4LA 2QL7B 3VQAA 1TAQA 1TTHB 2XM3A 2FPHX 4FXVA 1TVRA 2HFZA 4C11A 3L4QA 5M1PA 3NGUA 2IC3A 2F4VF 1WSVA 4WZMA 3T1AA 2BKNA 4ID5A 3FBFA 4YDDB 4BRDA 1NK6A 4WFZA 3A8IA 2VG6B 3PRVA 4B3SF 3DLRA 4JRQA 1HQEA 3CD7A 3LF0A 1WTFA 4ZPDA 3CCVN 5KFAA 4A8QA 3N4PA 1DGKN 3ZO7A 3BH6B 1UAXA 3FZMA 4ILMA 3WC2A 3VCDA 5ETSA 3ENBA 1RLDA 1GMWA 2YNGA 4L8RB 5GAGP 2NPIA 3SIPB 2HPUA 2O8EB 3WBZA 3NH0A 3I6PA 3GR1A 1NGEA 1YITN 2CJKA 4G65A 4IO9Q 1LK5A 4OMFG 1KVCA 4UT4A 5KT5A 1N5SA 3MEDA 2G1HA 3FQLA 4QIWD 1YIJS 1RJJA 1FRHA 3R5DA 4OX7A 2C2ZB 4DV5K 3X3UA 3U8XA 2P9IA 3L3VA 3QGHA 4AHVA 2VG5A 3BGOP 3ZZYA 3I9V9 1QVGR 1L3KA 3SUQA 4IO8A 3N79A 1X4BA 1XMOJ 1IBKK 4LSLA 1A0OB 1E4FT 2V2VA 5JXSA 4JI1K 2A40A 4QWDA 2H65B 2DXFA 4KHQA 4RL1A 3DXKA 1KN6A 1SB6A 5D4NA 4P73A 1CLQA 2X78A 4KHWA 1ZM9A 2VOPA 4JI2J 1U04A 2XZTB 2XTJP 1RCOB 3J80U 3W9IA 2IRYA 3VAKA 3AGKA 5GIPA 4OKJA 4DX7A 4WCEL 1YI2S 3CCUS 1IG9A 3ELHA 1MW7A 3AO2A 1IBMF 3HTVA 3N0VA 2E66A 1CPZA 4E98A 5EVZA 4B1XB 2IFXA 4I6MB 2W9CA 4PR6A 2HHPA 1RT2A 1YZ7A 2X51A 4IQMA 2B8PA 3S3MA 3MXHP 4K59A 4DR5F 3QNOA 2DR8A 1RTDA 3BO4A 1WF1A 4CZKA 5T41A 1HR0K 3VVTA 5JLFA 3BY5A 3ZEUB 1B9DA 1TMJA 4BQZA 5B0GA 1FRLA 4DTMA 2KN4A 3THYA 2FJAB 3ZSRA 4OLBA 2GIRA 3AAWB 3MM9B 3QWUA 3P1GA 2YKNB 1FRJA 3RGIA 4O5FA 1IWAA 4OV1A 1Q4RA 1VSLA 3FLCO 4IFEA 1T9TA 4K4WA 1JLEB 4KKOA 3M32A 3QBCA 1OY9A 3WIVA 5JICA 1S0OA 4FJ9A 4JN4A 1LWCB 4WKRA 2GX9A 2G4BA 1RDDA 4ID1A 1YBTA 1KD1T 5BPNA 2IA0A 1YX2A 2OH2A 3HVTA 2VDHA 4H5VA 1JLGB 2RQMA 5KPZA 1ZAWA 1JXLA 3A3PB 2EKYA 1JK9B 4ZHRB 1BWVA 3H20A 3HYFA 3U1MA 5G4DA 2F9TA 2W2PP 3T9NA 3CD0A 3MMBB 3BKFA 1Q5YA 4MK9A 4CLYA 2CNNB 4CHNA 5DG9A 3H7HB 3D6TB 5AFUA 4IDKB 3F9KA 3IRXA 2UUAF 1YAGA 3T41A 3IBCB 4B3TF 2R7QA 3WX8A 5D4OA 1IKYA 1FKOB 4HKQA 3C7NB 3MCMA 2F1FA 5I42B 4F36A 2DGUA 1WC4A 3CJCA 2M5YA 4FBUA 1RWXB 3AA4A 2YNFA 2XMUA 4U67L 3OBYA 1R8BA 4L6V3 2KQ2A 4UOCA 3MAAA 3UNYA 3N28A 1H38A 2D0PA 4UZBA 5KOWA 3WQUA 5J1EA 2Y0SD 4LVOP 3RAMA 1SIWB 4IOAQ 5AQMA 2GFFA 3DLBA 4OX9J 4L3KA 2XGPA 1Z26A 3EPIA 2W2NP 2MZJA 4J8FA 3Q2SC 2HLTA 3LDLA 4M3YA 1FVQA 3UFCX 4ES2A 2DGTA 4H4OB 2PEBA 3PY8A 2RQCA 4ALZA 4FWKA 1T3OA 4IH7A 2W41A 4GKJJ 4OX6A 1HKAA 4QWCA 3WXLA 2DFEA 3W2WB 3UQSA 3MM7A 2DITA 1KP6A 1ZPVA 4PYDA 2YJFA 4ISEA 4IRCA 4E7JA 4I68A 4B9QA 4BC4A 2L9DA 3HD1A 4L74A 3TANA 3CC7S 2D7SA 3W9HA 2GGPB 5L39A 3ZSQA 4CF2A 2QLWA 1KAXA 2VHGA 5AXNA 4I2QA 1F60B 5A8WB 2I7PA 2RD5C 4H5RA 1T3NA 3PO5A 2VJUA 1NJWA 3AO5A 4CJVA 4CESA 4C8KA 4O0IA 1Q79A 3NFAA 4BWMA 3NGDA 1VQ6S 4U7UK 2CJXB 5HAOA 2FLPA 4DTJA 3K5LA 3V4IB 1B0VA 5CYMB 1QSYA 3CQXA 4LQ3A 3N01A 4YEAA 1YWXA 3CI5A 3KK3A 3CCRS 3OW2R 4Q43A 3CXCR 2HZCA 1FCAA 4YR2A 1TKZB 2GAGC 1MMNA 4MK7A 3DM2A 5D0GA 4RW6A 1X5TA 3JQKA 3QSIA 8ATCB 3IG1A 1MWYA 1S1WA 4J37A 2IIRA 5GMKa 1WWHA 1WSRA 2AKWB 1RBAA 2CADA 3OYBA 4KHMA 1H6KX 1HWJA 4ED8A 4JI3F 1U1OA 3B82A 1F3FA 1W2BM 2G8WA 1VK8A 1WELA 5IQ6A 3MMJA 4DN9A 2P9KA 2HQDA 3N6LA 3EICA 4OLPA 3OTOF 2ZH4A 2F8HA 4DL3A 4Z4GA 2HKEA 2CDRB 4NI2A 2V4JB 4W5TA 4ECZA 2Q1LA 2MQQA 2UXCK 3IGVA 3SQGB 1YGYA 5B0FA 3EDQB 3GYNA 2GMLA 1NJIT 2HHSA 2VC1A 2W7OA 2E5JA 2F96A 3AQOA 4ZOSA 2X74A 1BIZA 1CJKB 3MM5A 2UUBF 1FERA 4IOXA 5JS1A 2UVVA 3KLEA 2HNYB 1YK9A 5GAGI 4LBPA 3SI8A 4YOUA 4X62K 3SMPA 2XULA 2MZTA 1SJQA 3OYFA 3PSIA 4C1NK 4CEOA 3HT3A 2G9OA 4MLEA 2R8KA 1I3AA 5AQSA 2JVOA 1OH7A 5CZ2A 1ZC6A 4JYAF 3VHQA 2MDAA 3CTRA 1FJGF 2A6MA 3AT1B 4X4TA 4DL2A 2XS2A 5FRNA 2GQCA 5CAAA 5F8HA 1HFEL 3ZFVA 3QNNA 3TTDA 4AQYF 4LF5J 2QA1A 3PFEA 2C2MB 2DCLA 1K9MO 2GW8A 5AQKA 1OJ4A 2B7BB 1RAAB 3AJ2A 3E2EA 4AHSA 1URRA 2FSNA 1RAFB 4ZVSB 2HBZB 1RAOA 5GIOA 3KHHA 2FVSA 4M5DB 1VGYA 1N8RT 3J7Z5 3QJLA 1Y9OA 4QZVB 4OI4A 2UXBJ 4CYUA 2E5GA 2RIJA 1UW4A 3L4BC 5DG8A 2XLIA 1NPRA 3QIPB 2C22A 4CHYA 3SAHA 4JV5K 5ETRA 4FF3A 2DNNA 3E3XA 1VOMA 4BY9C 4F7VA 1KWMA 5D0RA 1JCGA 4AF1A 1VQOS 2JWLA 3HMJG 3V9WA 4LF1A 1FXRA 2E5LK 2DIUA 4USHA 1GQEA 2KT3A 3ENHA 4PWUA 3DU5A 4W92B 3SBTA 3T1HJ 3CPEA 3MM8B 3IAYA 4URGA 1IH7A 4DPUA 3DOKB 4U7CA 2XI3A 4LQ9A 1Q8IA 3MHYA 3CC4S 1UETA 2ABYA 2Q3SA 4CK1A 5KFDA 5J2QA 5DO2A 4OLOA 4JI0K 1AUDA 1BOTO 2E2QA 3GCWP 1ACMB 4DSFA 3KLIB 3ZZUA 5D3GB 2XSFA 4UOHA 3VZIA 1REVA 2DNYA 5DGBA 3MEGB 3CVKA 2WVFA 3HOSA 4XAKA 2VCPA 2EC2A 2VASA 3OTBA 4ZVQB 1YJRA 2CQ0A 2IMOA 3QO9B 3V6JA 1JCEA 2KM8C 3I56S 4JI7F 2XLKA 4NASA 1EWQA 1LFWA 4IOAL 1FW6A 3SMZA 2HBQB 4JI6J 1B7FA 1X8DA 4LIWA 5L1LA 2CGLA 2B4OA 2Y8WA 5J2NA 1ZBIA 4YDUA 2V51B 1LW0A 4KB1A 1C0TB 2ASLA 2IVFB 2I1RA 1N36F 1OH6A 3J7A1 3O2IA 2E8AA 4ZMMA 1U45A 5IM0B 2XS7A 2DCUB 2QKKA 2FSKA 1EQMA 4TYBA 3J81O 4CEZA 1S79A 4GC6A 3HZGA 3VQ7A 1CULA 1RU2A 3PIOQ 1TELA 2Z2YB 3MCSA 5I3UA 3PCOB 3B54A 4LRDA 4BGAA 2HRUA 4EHUA 2GVZB 4GKKJ 3UKUA 4KHUA 1E6VA 2XHWA 1IKWB 3DRPB 4USTA 2CQHA 3THWA 3D2EB 4KH4A 1S1VA 3DAWA 3THVA 5HOOA 4GNIA 2A18A 1C0UA 3C16A 3VQEA 2O66A 3SUPA 3D7SB 1AYEA 2UZAA 4RW4B 3GWCA 4EGLA 3D6FB 2OPPB 2VQFF 4BS2A 2LVWA 1A5VA 4RWTA 3ID8A 1EIYB 2HHHJ 3R2DJ 4A8MP 3CJBA 2NUBA 2D1KA 4DTSA 2UXDK 4MLHA 4F4WA 3OVBA 3SDEA 2EI5A 3MTKA 1O51A 2NXCA 3CHWA 4JKGB 2BJ8A 1U0SA 3DOMA 2WONA 1WLJA 2QYCA 2ZD1A 3RVCA 4IH6A 3IR5B 1S76D 2UU9K 1Y5IB 1NXIA 1L5UA 2MMYA 3HBTA 2XNQA 3KUGA 2MTLA 1U1MA 4CTAA 5H9EK 4UTGA 2YHBA 2LCWA 5CHIA 4F4XA 2RHQB 1ZXOA 5AE3A 2BUNA 2OJ3A 3SPYA 2RF2A 4BRQA 2HBRB 1REGX 3ZTRA 1U6ZA 1QHAA 2QL5B 5KFHA 3VQBA 3OL8A 4BR7A 4FK4A 2L48A 1CZ9A 1XMQK 1PC5A 1GMUA 1SKWA 2DXEA 1DRZA 4CNZA 3BKUA 2AEFA 4LVNP 1OYEA 4NLDA 2KXHA 4RCHA 1TKXA 2C3PA 4QPXA 3TABA 2A10A 1K8AT 3M2RA 2VODA 4K4UA 4NXMF 5CABA 3LQVA 4BWJA 4B3RJ 4R5PA 4BDZA 1DZ5A 3CJAA 3R6MA 2MY7A 3H40A 2JOQA 2PIIA 3MXMA 4CP5A 4DR2J 3OHRA 5HP1A 3VAGA 1YDLA 1CQMA 1X9WA 2YY3A 3WEEA 1BQNB 3TEHB 4FLTA 3DGPA 4TU9A 3RR7A 1GLJO 3SK3A 4A61A 3BO2A 1G1XA 2X1GA 3DC2A 5ETLA 5I3QA 5F3TA 2GBZA 3G6YA 4KFBB 4X66K 3M6UA 1UZHA 2PMWA 3LZJA 5A0YA 1N34F 2BV3A 2K1RA 4IG3B 1XTZA 5FIIA 5BPMA 2D5RA 3A5OC 3V81B 4DSIA 1JLCB 1BHNA 1OYDA 3D0PA 5AQGA 1EJ7L 2F8SA 4OYZA 2ZBQA 3OYMA 4L76A 1NK0A 4WQ4C 2I8EA 3MFHA 4MT1A 2FLNA 4Z4FA 2BDPA 3HD2A 2QWQA 2Y9HA 4J7CA 3ETOA 2DHGA 4OFZA 3ZETB 2CJBA 3MM6A 5DG7A 4JHDA 4ILJA 4HH0A 3D0HE 2QG9B 4H0OA 1XN9A 1SL0A 3SAFA 3RJMB 2DR5A 3TUPA 1NJXA 1YUWA 5CY4A 1U1RA 4H0TB 3ETMA 4B17A 5TKYA 2HS0A 2E1AA 4B9MA 5EY4A 1N33F 2G8KA 3TZZA 4HI2A 2E1ZA 2HRTA 3Q8PB 3SEOA 4IG0A 2O8CB 1I3OB 3KNAA 2MQLA 3O08A 3MF5A 1FNOA 1DTTA 1LAWA 1CS4A 2WBMA 4IFYA 2X6NA 1Q0NA 5B8HA 2VF3A 2J7UA 4KV8A 4E19A 1VSIA 5MLCV 2OELA 3UVJB 1VSFA 2DHSA 1QQOA 4C97A 1EP4B 1RHRB 2YQ3A 1L3VA 2BANB 3OR2B 3RMCA 2ZUGA 4DR7F 4E7LA 5BR9A 2WVCA 3AVFA 5M2UA 1XMBA 1EKRA 1LOUA 4B3MK 4DG1B 4LF9K 3IMQJ 4DV7K 4G1QA 3NCPA 3QZ8A 5KQ8A 1PYSB 3VR1A 1RADB 4DTXA 4IKAA 1KRPA 2MPUA 2PYLA 2YX4A 3ISND 2QMUB 3KWMA 1FRMA 2IDLA 3C6UB 3KLVA 4LFCJ 4FWOA 3IGNA 4GVBB 4LF7J 4OYIA 2LU2A 1CJVB 5T7LB 1B64A 3BPDA 4ZPAA 3KLGB 3M8SA 4CERA 1PJ5A 1VQ5N 4LFBF 2YHXA 3HSJA 3BGRA 2EFQA 4FJGA 2HHVA 2CH6A 4QIFA 2I2YA 4OYBA 4ICLA 2JJ4D 1JLAA 3ZSOA 1DTQA 4K50A 1F1BB 4J9PA 4PKGA 1X4EA 4F0MA 5F3ZA 1KS2A 3WXMB 3CJKA 3CB4A 2OTJS 5KQDA 3PIOL 5L1KA 4E1MA 2F4VK 2NYHA 2EX3A 1QVGM 4CLWA 3M30B 2RKIA 5GVQA 1NDLA 1SJ1A 3W3SA 4X84A 4CEAA 1S0MA 5KAKA 2ZVIA 3H08A 4B3SK 3OVNA 1FE4A 2HHUA 2N3LA 1IKVA 2FXUA 2ZBCA 2MY8A 3JQJA 1FDDA 4IO1A 3OFEA 5EWGA 4P72A 1B3TA 2YH1A 2VFTA 3BSCA 5B0AA 1KVIA 3D28A 1FWKA 3QINA 3L7UA 4IJAA 3UKRB 3N9UC 3QB0A 4CJ5A 4U6PA 2J6UA 4U96A 5BYSA 4JKFA 2HQFA 2UUCF 4QIVA 4JKDA 4HHUA 4LR8A 1XNRF 4WFXA 4DR6J 3JAMY 1WTBA 1URNA 3H46O 1VQ4N 2F9JA 4CO0A 3GILA 2E1YA 1C1BB 4ZN3A 2AWZA 3H42A 4BRAA 2DY1A 2E88A 5CXTA 5IWAJ 4FJ7A 2A6AA 1S5JA 4TQSA 2BE2B 2BRKA 5KG6A 3KYLA 3VAHA 5AQFA 4FJLA 3CO0P 3DYAB 1VQPN 2HFVA 5E3AA 2Z2ZA 1HBNB 2HVZA 4D3HA 1HPZA 4USWA 2QXFA 4PZVA 1FHTA 3O80A 3BM7A 3A13A 3RW7A 1MWQA 1CSJA 1KHWA 4CGDA 4UQTA 2XZWA 5KFRA 1RT5B 2FHJA 2DNMA 3NOGA 3C94A 4DV2J 2P9NB 2CNLB 1T9YA 3T69A 3R97A 3TNVA 3HFZB 2V6AA 4K43A 3NF8A 3WC0A 1FDNA 1Y10A 4P2MA 2BX6A 2W4DA 3D2FA 3FSXA 5JVGQ 3GFHA 1HW9A 3ATVA 5LSRA 2JEFA 4K42A 2POKA 4Y2MA 3I0SB 1EB0A 2BJ3A 2J0QD 4CJLA 4QS8A 4DQQA 1RHMB 1HNZF 3TX0A 1YTYA 4QR0A 4YY3F 3DLLQ 1X4GA 3R5CA 4AXIA 4DR5K 3MAQA 3MX2A 1T9WA 2W6KA 4TKTA 4ZVRB 2VG7A 2OYQA 4QYZK 5E84A 1QUPA 3QLHB 4MIAA 4DV1K 3PJ9A 4RUCA 4CI0B 2A5XA 2OEMA 3NGSA 2JHEA 3IWNC 2VV5A 1D1UA 1RT3A 1O13A 4M5MA 3RBXA 4RW7A 2BW7A 3K2YA 4CZFA 3VGSA 4JI2K 4DL6A 3R7NB 5CQGA 4LF8F 4LF6F 3CIZA 3OYCA 4Y3CA 4DUTA 4ECSA 3DLKA 1PCAA 2RVJA 1N32F 1RDRA 2G8HA 3WZ0A 1UWBA 4HEA9 4YUDA 4A57A 1HWLA 4BR0A 3CWJA 1HLUA 2YH0A 2IPOB 3TQEA 3CC2N 4N77A 4OZ1A 5F0XA 1T05A 4WFAL 2MQNA 4F4KA 4X4QA 4DV4J 3M8WA 3OSPA 5KPTA 4X64F 4BGBA 1FE0A 4CGJA 3M8QB 5E0OA 2BQRA 1WSJA 2DY9A 1T02A 1W97L 4LF4J 4I2PA 2UUAK 5B7WA 3TJ8A 1JL2A 3OYNA 4B3TK 3KKRA 2XMWA 5KRSA 3CCZA 2D3O1 1WB9A 4J9SA 2QTWA 4CJQA 4XPEA 2P9UA 3JS9A 1LV5A 3NAHA 4MH8A 5KFNA 3KG4A 1WHVA 4RUHA 4NXNJ 5AQNA 2VQEK 1PIEA 3OL6A 2HHXA 1S9GB 4I1TA 1QQCA 2AJQA 3SMSA 1GNKA 2Z2LA 1NGFA 1T9VA 5B0BA 5FD1A 3CJ0A 2GJ2A 1NGBA 2OZMA 3DLEB 1M5VC 1K44A 2DNLA 2Q79A 4L3QA 1NGDA 2MSTA 5E26A 4Z94A 2Y1IA 3QRRA 4GY2B 2EFOA 1V3RA 3K17A 3PW5A 5B08A 4K41A 3OYDA 1TL1A 1VBZA 1DKGD 2EG2A 1OWXA 3CXCM 2V8PA 4I7FA 4KI4A 4BRFA 4JD2A 4K8XA 3H3NO 3IDHA 4EBEA 1OSDA 2O8FA 1T95A 3AQPA 5CA5A 4ED7A 3PEHA 1XEZA 1K8KB 4B02A 2M7SA 4Y34A 5LMUF 3B8HA 1HNXF 5M1FA 2R7WA 3O3FA 2DNHA 3HOTA 1RP5A 2CPZA 1UFWA 2I0XA 3OT9A 2A2DA 1I6JA 3VV2B 2HNDA 3A0IX 4LRAA 4TVAB 2YXLA 1RBTA 3QEIA 4K8ZA 3ZZPA 2EW9A 3B8AX 2IVOA 4U95A 2EC0A 5EUHA 3O5BA 4NYOA 3TOQA 4GKJF 3E01B 2LDIA 2X7IA 3VGVA 4H03B 5GINA 3MD1A 3HF5A 1K9MT 3OR1A 1S6PA 1KLMA 3OJUA 4CFAA 4K4ZA 4M5JA 2XO6A 1N48A 1QQNA 1E3MA 4WK3A 3DDKA 2FLLA 1ATRA 3BGFA 4BC2A 3QBXA 3OVSA 1S97A 1XQSC 4FJMA 3RW6A 3KHYA 3MPWA 1SXLA 3NCRA 4FF1A 2KTQA 2E6LA 3FZHA 1YIJN 3EL2A 4K2JA 3QRQA 5EU7A 4JI3K 1JB0C 2R42A 4JI4F 3W2VA 2I6WA 4CBXA 2VFRA 3SJJA 1YVNA 1BUXA 2CIMA 4OPHA 4CNYA 3MPDA 4J2DA 1K47A 4JI5J 2O3DA 2ADCA 3GE9A 1T3VA 3OTOK 2W2MP 3EVWA 2CNOB 3VQ9A 2Z57B 4CH0S 5ETKA 3S9HA 3QEVA 2DTUA 2ZJRQ 3TUIC 4DR3J 1WNSA 1AT1B 4WIQA 1FK9A 5E7OB 3ZX0A 2P5OA 4E1JA 3R3LA 4FJHA 3UE2A 1V5VA 3NOCA 2UUBK 1YI2N 3CCUN 3LP2B 2E20A 3NE6A 1N52B 2RUGA 2JWKA 3WNEA 1ZAXA 4F3MA 3CJ2A 4PRFA 4CJWA 4DTNA 1AZSB 2ZWHA 1IQZA 3O9UA 4F4ZA 3RMAA 3DMJB 4W5RA 5CHCB 2A41A 2KT2A<