1S6PA

Crystal structure of human immunodeficiency virus type 1 reverse transcriptase (rt) in complex with janssen-r100943
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
552
structure length
552
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 124
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s6pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s6pA05
3ASMA 4KHNA 4F4KA 5C25B 3ICLA 4K4XA 4CEOA 3H5XA 4HUFA 4Q8EA 4CHYA 4H8KA 2EHGA 3NF8A 4LQ3A 4MQ3A 4I2QB 1B9DA 3ITHB 1LAWA 5I42A 4CJ5A 3DLGB 2G8VA 1VRTA 5KT4A 4IKFA 4QAGA 1S6QA 3KLGA 1SH0A 3OL7A 4Y1DA 4ECXA 3CFPA 4HVJA 1BQMA 4QWBA 1VRUA 5KFRA 3ZT2A 3TAQA 4CJPA 1N5YB 3RBEA 3RMDA 1RTDA 4E0DA 3SYZA 1RDAA 5F9NA 3QNOA 4N47A 2C2EA 4XPEA 1XHXA 2ILYA 5KT7A 1SV5A 5KRSA 4FLTA 2E4LA 4NLUA 4ECTA 3MEGB 4IRCA 4PWDA 3EPIA 3DM2B 2HNZB 4I2PA 5L1JA 4NLGA 4AH9A 4DL7A 2B6AB 1VK0A 3NGZA 4QWAA 5HBMA 3PW5A 4WXWA 1ASUA 4O4GA 4Z4EA 4ED6A 3WNFA 3QGIA 1QSSA 3NH2A 1WSEA 2R2UA 2BQUA 4J9PA 1GOAA 5FRNA 4LH4A 3NAEA 4NLTA 3QERA 1XC9A 4FYDA 4TN2A 4EBEA 3FDSA 3QIPA 1T03A 2HHQA 1D9FA 4Y2AA 1S1UB 2EX3A 5F9LA 2WB4A 4Y1CA 3C6TB 3ISND 3UDLA 4C8NA 1SKSA 4CJQA 4KTZA 3V1QA 2XCPA 1YTAA 4AHSA 3DOKA 4Z4IA 2D7SA 5KT2A 4CHNA 1C1AA 4DWIA 2XWYA 1T05B 1JLFB 3VQPA 1HQEB 4DTXA 1NK5A 4MK9A 3OVNA 5SWMA 3RAQA 1BIZA 3OJUA 1ZBLA 4I2QA 1N56A 3ITHA 4KO0B 1BI4B 4O3OA 4PUOB 4QW9A 3TARA 3LZJA 3DLGA 5CYMB 3JSMB 1EXQA 4M41A 4RNNA 4FLVA 4W5NA 4K4ZA 2HVIA 3TVKA 1XR7A 4ECQA 4ZTJA 2HVHA 3OYDA 1ITGA 3SUNA 5J2MB 3M9NB 2AX0A 2WCXA 5KFTA 4CEQA 3VQEA 4J2DA 4FJIA 1NKBA 1HNIA 3OL9A 4RUAA 4F8RA 4O4RA 1T8EA 3PUFA 1D1UA 4H54A 3CJ0A 1I3AA 2W8KA 4GW6A 4C8OA 2C2DA 2VG7B 4ECRA 1TAUA 3OY9A 2XY6A 1RT1B 1BISA 4MKAA 4DTOA 4NLSA 4YR0A 2Q3SA 1GX6A 2BR0A 3S3OA 4ZVHA 2F8SA 4CJFA 1RT4B 5KFAA 1LV5A 2XGQA 3DI6A 5FDLA 2R8IA 1IKXB 3MEGA 4RU9A 3DM2A 2HNZA 1RAJA 4K8ZA 3HJFA 2B6AA 2R2RA 1NK8A 2WRMA 2UVRA 4IKAA 4MH8A 3SI8A 2HHUA 1S0OA 1GOBA 3HHKA 2P1JA 4ED2A 2HNDB 3BQ0A 4GVMA 2J6TA 5F8NA 5L1KA 3MXMA 3M9MB 1J5OB 2UUTA 2W8LA 4PQUA 4KBIA 4CFAA 4CJUA 2G8KA 3ZT1A 4ZHRB 5J1EA 3GILA 1JLAB 5KFEA 3VQ6A 4NYNA 1S1UA 1FKPB 1EETA 3CO9A 3C6TA 4ZP6A 3KLVA 4LY7A 2D0AA 3MR5A 3T19A 1S0NA 1L3SA 2B43A 1T94A 3KKSA 2D0BA 5HROA 4CGDA 5KT5A 1X9MA 1EP4B 4DL5A 4OL8A 1T05A 1JLFA 3NAIA 3HXMA 5KFSA 5D3GB 4CF1A 1NK0A 3NHGA 3CFOA 4K4YA 1BQNA 2P51A 2OYQA 1W25A 5JXSA 1QE1A 2V4QA 2ZKUA 4KHRA 4DQSA 3IAYA 4KV8B 2AU0A 3MF5A 5J2NA 1RBRA 4KO0A 2B5JA 4PUOA 3M8QB 2DTUA 3JSMA 5F8IA 3RTVA 2WONB 4QWEA 5KFKA 2EC0A 1ZTWA 1IM4A 5KTQA 1RT2B 2R2SA 1SUQB 4LD0A 2VG7A 3QZ7A 4DQIA 3T3FA 1RTJB 1RT1A 2HNYB 1RT7B 3SUOA 1S1VB 4ECWA 3KHGA 3VQSA 3AVFA 3IGNA 3M8PB 3KHLA 1IKXA 2AQ4A 1JXBA 4IRDA 3VQ8A 3HVRA 4BWMA 2G8IA 4BDYA 1TGOA 4QWDA 3AA4A 1T3NA 3KTQA 1GOCA 3K57A 3QGGA 2V0NA 1QTMA 4NRTA 4CEBA 3CG7A 3KK3A 4NYZA 3SI6A 3ZSRA 5L1IA 2HNDA 5EWEA 2FVCA 4B9MA 2XY7A 1J5OA 3HPOA 2OPRA 3ALYA 1KVBA 3G6YA 1JLAA 4DFMA 4CEDA 4DTMA 1FKPA 3RB3A 3V9WA 4KHSA 4DFPA 3LANA 5HLFA 3BREA 5JUMA 3CJ3A 4K8XA 5CYQB 2ZD1A 4RW7B 2OZMA 5KFYA 1RA7A 3OLAA 1EP4A 1ASWA 3BJYA 3G6VA 4YP3A 3BGRB 3KHRA 5D3GA 1NOYA 4KE5A 5DG7A 1REVB 4FK0A 4W5RA 3D45A 3K59A 4KV8A 3KIOA 4OKJA 2D3UA 4Q44A 1U4BA 1TKXB 4DTSA 4HTUA 1BHLA 1T7PA 3KLHB 4LQ9A 4K4SA 2UVWA 3T1AA 4YMEA 3NGIA 5EWGA 4DSFA 4M95A 1RBUA 4JS4A 5SZTA 3N6MA 1A5VA 2OPPB 1JL2A 1SUQA 2E9ZA 1RBTA 3OS2A 1CZBA 2HNYA 1RT7A 3AV9A 3QO9B 3QEVA 3DRRB 4E1MA 4M3ZA 4KRFA 3UQSA 3M8PA 4CJ3A 4RW9B 4CE9A 5J2QA 3RMCA 1IKYB 3CJ4A 4J9OA 4HYKA 3DMJB 3V9UA 3VA3A 2G8UA 3OSNA 2ASDA 1KFDA 2HW3A 3LAMA 3PW2A 1JLBB 4O0IA 3EYZA 1BIUA 1O1WA 1VSDA 3RR7A 3VQCA 5DLGA 4I9LA 4JRPA 4NLVA 2KFNA 4CHZA 3KLIA 3D28A 4ZP9A 4BDZA 2DY4A 3KMSA 4OJRA 2FVRA 5KFMA 5JS2A 1S10A 2YNIB 4QCLA 2PY5A 4CJVA 1TL1B 1C0UA 4RW6B 2Z1HA 1F21A 2IBKA 4KPYA 1QAJA 4G3IA 4FJXA 2YKMB 1SKWA 3OYIA 2XI3A 2X6SA 3OYLA 2IAJB 4OGEA 4LH5A 3L3UA 3DRSB 5CYQA 4CHOA 3O3GA 3QEXA 4RW7A 4WFZA 3OS1A 2X78A 4WE1B 1KVCA 3KKRA 3WNHA 4NLPA 4B3OB 4IDKA 4LSLA 3HL8A 3OSPA 4CEFA 2ATLA 4IR1A 4CECA 3CQ8A 1ZBUA 3BGRA 1DTQB 1QHTA 1REVA 3SZ2A 2IC3B 4TXSA 2HHVA 1LWCB 2W7PA 3VQ5A 4ID5B 1WAJA 2F8TA 5DLFA 4DG1A 1NHUA 4O3QA 3V6JA 4DU3A 3I0SB 2NUBA 3KLHA 5F8LA 4KHMA 4XO0A 5CZ1A 5C42B 3GIMA 4EO6A 1C1BB 2E6LA 3ZT0A 2XY8A 4E1NA 4FM0A 2OPPA 1SL0A 3PW4A 4CK1A 1DLOA 4F4XA 3QIOA 1JL1A 1S6PB 4IRKA 1S1TA 4BDPA 1YT3A 1RDRA 4J9NA 1N6QB 2DPIA 3DRRA 1MU2B 4RW9A 4FZXC 3DMJA 3CFRA 4B8AB 2W9AA 1YTUA 3I5CA 4AHVA 1Z25A 1RBVA 3SFUA 1NJWA 1JLBA 1KLMB 1TK0A 3PV8A 5KFHA 3V9SA 3KD5E 1L5UA 3FFIB 4YFUA 4DL2A 1RILA 4CFBA 4B9UA 4CF9A 2AGOA 4N41A 3SFGA 1JLCB 1JLEB 2YNIA 1S97A 5KFNA 3MFHA 1TL1A 3HO1A 2FC0A 3THVA 4KHQA 4RW6A 4YNQA 2ITGA 3KLFA 3QIDA 2GUIA 4IFYB 1YVFA 3DRSA 2R8KA 3CVKA 3BQ2A 1TP7A 1SKRA 4JV1A 3BDPA 4NLRA 1ASVA 4AILC 3AVNA 4B3OA 1RA6A 3SQ0A 4KHYA 4EP4A 1U47A 4CJ4A 3OYBA 1RNHA 4CGFA 3ZCMA 3PX4A 2FVQA 4ZTFA 4QOZB 4RW4A 4FS1A 1C1CB 2IJFA 2IC3A 4F3OA 3KK2B 1S0MA 1RT3B 1HYSB 3FSIA 4ID5A 3CIZA 5KFVA 3M8RA 3BSCA 4ELVA 4OLBA 4MKBA 4J2AA 5DQGA 4DSKA 3H59A 3TR8A 3I0SA 4FXDA 4ZVGA 5KFGA 3KHHA 1S1XB 1C1BA 1S4FA 2YNHB 4DL4A 2A1RA 3PX6A 1XR6A 3KK1A 3FRZA 4M42A 4J9SA 4R0EA 4ED7A 1WSIA 3HK2A 5HP1B 3SCXA 4DQRA 4B9TA 3AVGA 4WZQA 4MK8A 3F9KA 1RTHA 3GYNA 2KTQA 5K14B 1N6QA 1ZYQA 1RT5A 4DTUA 3OYMA 3O4NA 3V81B 3DDKA 4XPCA 1LW2A 5KG0A 1FK9B 2P5OA 4E89A 4Z4HA 4FJHA 4DF4A 3TAMB 1DTTB 1TKDA 2G8FA 4KTWA 2Y1JA 4JUZA 1IKVB 1WN7A 2QE5A 4WXOA 3FFIA 1JIHA 1KCFA 3OYEA 2GC8A 3H4DA 3NDKA 4DU1A 3LAKA 5C25A 2JEFA 1JLCA 1JLEA 1L3UA 1S5JA 4IH5A 4FBTA 4DL6A 4NRUA 4O3NA 3QINA 2LSNA 3OYCA 2RKIB 4O3RA 1NK6A 3L3VA 4C8LA 3ZSQA 2FLLA 4CGJA 4IFYA 3SQ4A 4KB7A 3LWMA 4GC7A 3K5MA 3SQ2A 3GIJA 2VG5B 4M3WA 3VQ9A 3PR5B 1N5YA 4FJNA 5T14A 4N56A 1C1CA 3NH1A 5DQIA 2P5GA 3KK2A 1ZBFA 4AHTA 1R0AB 1RT3A 1HYSA 4CHQA 3SPZA 1WSJA 1SH2A 3MR6A 4EBCA 2Z1GA 3U3YA 2C22A 2IMWP 3WNEA 3PJWA 2BQ3A 3NKYA 1ZBHA 2YNHA 3QNNA 3NAHA 1FKOB 4X2BA 3K58A 3K5OA 1LW0B 3CM5A 1HNVB 4QWCA 2YHBA 4ZPDA 4RUCA 2AWZA 3VQQA 3LZIA 4EO8A 3EPGA 2F8EX 4FLYA 3NCIA 3G10A 1HRHA 3V81A 3AVMA 4AHUA 2WHOA 4LSNB 1C2PA 2HAIA 4CK2A 3NH0A 4FVMA 4R5PB 1WSGA 1HPZB 3HP9A 1RDCA 4B9SA 1WSHA 1IKVA 4MFBB 5DG8A 4CF2A 2AJQA 3AO1A 1HQEA 4DFJA 4ZMMA 1RYSA 4Q0BB 4K4WA 3AVHA 3I0RB 1SH3A 2X74A 3OL6A 3SJJA 2KZMA 1XWLA 3MEDB 4BE0A 2RKIA 2HHWA 1BI4A 4NLYA 2UVUA 5CYMA 5DK5A 3T5JA 2R8HA 3Q8PB 1FXXA 2YKNB 5J2MA 4C8KA 3BSOA 1UA0A 2HMIB 4KTQA 1X1PA 1KVAA 1IO2A 1D8YA 3H5YA 3UR0A 2VG5A 4J2EA 2RDJA 1N48A 2ASLA 3M9OB 4B9LA 4NCGB 4K50A 4FJ9A 4M3YA 1RCHA 1JLQB 3Q8QB 1R0AA 3EZ5A 1OS5A 2OPSB 1RT4A 3PR4A 4DLGA 3TWHA 3IRXB 4WYWA 3GIKA 4FJJA 3CWJA 4URSA 4CJRA 1KHWA 2A1SA 4OPKA 1QUVA 4AHRA 4CGGA 1NHVA 4CEZA 3G0ZA 5T7BA 2FVSA 4ECYA 1FKOA 2BRLA 2QXFA 4DS5A 2HHXA 4DF8A 1LW0A 3CDUA 1HNVA 4IH7A 5JS1A 1A5XA 4J9QA 3PW7A 3IS9B 3BSAA 1UWBB 3OYAA 2RN2A 4TQRA 4ZHRA 2VA2A 4KHWA 4FZZA 1RDDA 3AA3A 4LSNA 3KOAA 5KFBA 4ED8A 4FM2A 3QEPA 2GIRA 5HRNA 4FCYA 4FJ5A 1HPZA 3O3FA 1TVRB 5KFZA 4MFBA 1IH7A 4IG3B 1CLQA 3GV7B 5KT3A 3NF7A 4NCAA 3LWLA 4DL3A 3IGVA 2W9CB 4FW1A 3H4BA 1RDBA 4YR2A 4DQQA 4TY9A 4DTRA 4Q0BA 3I0RA 2W9BB 1G15A 3MAQA 5I3UB 4OVLA 3VN5A 3UIQA 4ZPBA 3DYAB 1CXUA 1C0MA 4Y34A 3M8QA 1XI1A 3TAPA 4ICLB 5EWFA 2IS3A 3RWUA 2WONA 4CJEA 2YKNA 2WOMB 4EZ6A 2HMIA 4K4UA 1QS4A 3VQDA 5KFFA 2XHBA 1U49A 1W9HA 5KI6A 5KFUA 4WFYA 1Q8IA 1RT2A 2FJXA 4QW8A 3U3GA 4ED1A 2HWIA 1RYRA 3CJ5A 4FK4A 4NCGA 2IGIA 3DLRA 1JKHB 2IOCA 5KGWA 4CJWA 1RTJA 1CSJA 1JLQA 1S1VA 1BCOA 3PO5A 2DFHA 4OGCA 3OHAA 5KGXA 3DRPB 3IRXA 4CIGA 1EKEA 5EU7A 2AX1A 4Q45A 4Q8FA 5HRPA 5KG2A 3UPFA 5C24B 4ECSA 2I5JB 3HVAA 3DLEB 1J54A 4HCCA 4ZP8A 3I8DA 4RG8A 3IS9A 1UWBA 3V4IB 4GC6A 4M45A 4DSJA 3DLBA 1S1WB 2QK9A 3PO4A 2O4IA 4FLWA 5KT6A 2D5RA 3QLHB 3L8BA 4CIFA 3MXJA 2HHTA 3PY8A 3DOLB 4CEEA 3RRHA 3V1OA 4NYFA 3N6NA 2RDIA 2ETJA 4IG3A 3K5LA 3TAGA 2W9CA 3OYFA 4W5OA 5KG3A 1BGXT 3TQ1A 1LAVA 4ECZA 3AO3A 2KFZA 2W9BA 1C0TB 4DSLA 3RB0A 4H4OB 5I3UA 2E9RX 2OA8A 4FJKA 3DYAA 4CJLA 3OLBA 3S3NA 1TKXA 4O55A 4ICLA 3KMQA 4G1QB 4CFCA 1XR5A 2XY5A 2UUWA 2FBTA 4O3PA 2BQRA 2ZE2B 2FLPA 2WOMA 4O44B 1VSMA 4JRQA 1VSHA 3ZT4A 4ECUA 1QSLA 1SV5B 3HYFA 5DGAA 1JXLA 3VQBA 4J2BA 5KG6A 4PWDB 1KFSA 3OYHA 3SV3A 4CEAA 4CGHA 4F2RA 4H4MB 5HBMB 2D3ZA 3ZSYA 3A2FA 1NK9A 3QO9A 2YNFB 3MFIA 2JLEA 1J53A 3DRPA 1IKYA 1CZ9A 2D0CA 2FBVA 1WNSA 2Z1IA 4M3TA 4MIAA 4KKOB 3AO5A 2W42A 4KAZA 2CJQA 3SPYA 4RNFA 1TKZB 4EP5A 5J2PB 5C24A 4W5QA 5KFCA 3DLEA 1KTQA 4ZPCA 3VQ4A 2FBYA 2B4JA 3OL8A 5DG9A 1A5WA 3V4IA 4DLEA 3PX0A 1LWFB 1S1WA 3DOKB 2C28A 3T5KA 2XGPA 4CFDA 3C6UB 2PYJA 5KFWA 1TKTB 4E7HA 3NFAA 4TYBA 2YKMA 1TQLA 3QLHA 1HYZA 2BANB 2IAJA 2X6NA 2GV9A 1C6VA 2KW4A 2HHSA 4U7CA 3CM6A 3CDWA 3DOLA 1NJZA 4R8UB 1TV6B 5KFJA 2WK4A 4BE2A 4WE1A 3BR9A 1HMVB 3MR3A 2F96A 3OS0A 4HKQA 4ED0A 1L3VA 1KSPA 3BSNA 1DTQA 4FZYA 1JXEA 3H5SA 1C0TA 1LWCA 4H4OA 1HNIB 4I9QA 4FK2A 4HCBA 3Q8SB 1N4LA 1U09A 1TL3B 2C2RA 4Y2CA 5CY4A 4DFKA 2JC1A 4G1QA 5KFPA 3O4QA 3M8SA 3HPHA 4NLDA 3T5HA 3PVXA 4B9VA 4DS4A 4Y3CA 3V6DB 2ZE2A 5C42A 1NK7A 4O44A 3QESA 3AO4A 4IFVB 4JV0A 3GV8B 1X9WA 3JYTB 2JEIA 2JC0A 4Z4CA 5HRRA 2ILZA 2CKWA 3DI6B 5FDLB 4KHUA 1S6PA 4KI6A 3LDSA 4IQXA 4I7FB 4F4WA 4H4MA 2BGGA 1UA1A 5EDWA 4FBUA 2YNFA 4ELTA 4YQWA 1HQUB 1MU2A 4IH6A 1BL3A 4O0JA 4EZ9A 3P83D 3SUPA 4KKOA 3LP3A 1ZTTA 3FQLA 1J9AA 3O3HA 4PQUB 1WSFA 2HWHA 4M3UA 1SL1A 1KLMA 4E7IA 1TKZA 1X9SA 1W0HA 5J1EB 3QZ8A 4TY8B 5J2PA 2YNGB 3RR8A 4CJKA 4DTNA 3C95A 1EETB 4XIUA 4UQGA 4ID1A 4DTJA 3H40A 1LWFA 5HROB 3LP0B 3V9ZA 2BRKA 1RT6B 3C6UA 2ATQA 4U6PA 1TKTA 2O4GA 4O5BA 2KZZA 2BANA 4CJTA 2JEGA 1S48A 2AGPA 2IM0A 1BQNB 4R8UA 1TV6A 4RNOA 4FS2A 4E7KA 3RB6A 1QE1B 3LP2B 1HMVA 4FLXA 4MK7A 5J2NB 3CYMA 2B5JB 3T5LA 2V9WA 4E19A 3ZSOA 4NCBA 3RAXA 4KB0A 1NKCA 5F8MA 4F50A 3OYJA 2R8GA 1K6YA 3PZPA 4CCHA 5DGBA 4NLQA 4HUEA 1NJXA 3IG1B 3ULDA 3TAFA 4EYHB 2YHAA 3OJSA 3DLHA 2FLNA 1Q9YA 2IM2A 4WYLA 5KG1A 1TL3A 4NLXA 3NGDA 5KFDA 4Q43A 1S1XA 3V6DA 5KFLA 3ZSVA 4NZ0A 2E6MA 3BQ1A 4IFVA 2XC9A 3NGYA 4URQU 3JYTA 3WNGA 1VSLA 3SNNA 4EEYA 5HRSA 5HP1A 1QQCA 4FJ8A 4AHCA 2PZSA 3VA0A 5DMRA 2XCAA 3V1RA 5L9XA 5EUHA 3HP6A 3ISNC 1S9GB 4I7FA 1S9EB 5K14A 1KRPA 4JS5A 5C5JA 3LALA 3RMBA 1VSIA 4OPJA 5KG4A 4IR9A 1HQUA 1K1SA 3AA2A 3AVIA 3KK3B 1K1QA 5F8JA 2DFEA 1NOZA 4KI4A 1FK9A 3Q8RB 1KHVA 2FJWA 3K5NA 2R2TA 4EYIB 3TAMA 1DTTA 2OPRB 3FQKA 1HJRA 1EX4A 3V9XA 4TY8A 2YNGA 3LPTA 1Q9XA 4CERA 3GV5B 1TK8A 4KREA 2DPJA 2BE2B 3AVCA 2PYLA 4OLAA 5HLFB 3DLKB 1TAQA 4IBNA 3RBDA 2ZD1B 3P5JA 1I39A 3LPUA 4KSEB 4QPXA 3LP0A 3KLEB 1ZETA 1RT6A 2GBZA 1LWEB 3AA5X 3GIIA 1NK4A 3AVLA 1VSKA 1U45A 5KFOA 3H5UA 3L2WA 5F8HA 3S3MA 3LP2A 4M3RA 4DSIA 3HVWA 4FJGA 1XHZA 4TSXA 4FJ7A 4Z4FA 3G6XA 3E51A 3KD1E 3IN5A 3V6KA 4Z0UA 3KNAA 4YR3A 2Y1IA 3L2QA 2GIQA 3N6LA 3IG1A 4OKKA 3TABA 3AVAA 3TANA 4Q5VA 4DEZA 4RNMA 4F4YA 1YVUA 2G8HA 3VQ7A 2QV6A 3P1GA 1Y97A 1UOCA 3GQCA 4M3XA 4ZPAA 4WZMA 2ASJA 4JV2A 3AVBA 1RBSA 3I5AA 3MR2A 2IA6A 5J2QB 3SQ1A 4C8MA 4CGIA 4ZVFA 1S9GA 1GX5A 1S9EA 1MMLA 1RTIB 3EY1A 3E01B 1I6JA 3ZSXA 2O5DA 4PY5A 4JLHA 3NMAA 4CJSA 4BE1A 4E3SA 3SV4A 3KLIB 3RRGA 4R5PA 3QEIA 4ZP7A 2R8JA 3CDEA 5F8GA 1TK5A 3HVTB 4J9RA 4K4TA 2Z1JA 1CXQA 3MEEB 2VG6B 1JX4A 3OHBA 1C0UB 4DSEA 2IM1A 4KAIA 3C94A 3L2VA 2BE2A 3PHEA 2WTFA 3OYNA 3DLKA 1IKWB 1VSJA 4TLRA 1D0EA 4MIBA 2FJVA 4CIEA 3MEDA 5CZ2A 3KLEA 2W7OA 4IDKB 4GMJB 4LSLB 4F4ZA 4FJLA 1LWEA 1D5AA 3AO2A 3I5BA 3QETA 4TQSA 2IM3A 4RW8B 5KFXA 1QSYA 4KFBB 2V4RA 3LP1B 1U04A 3MECB 1UAXA 4J9MA 1HYVA 2RPIA 4FW2A 2QKBA 4M94A 5L1LA 1S49A 4FLUA 4DG1B 3KJVB 4URGA 2YV0X 2R7YA 4ECVA 1VSFA 4RNHA 4FLZA 2XI2A 3K2PA 1S9FA 1B92A 3HT3A 4DQPA 1SL2A 1D9DA 2OPSA 4IOBA 3B6PA 4E7LA 5FROA 3MTKA 1JLGB 4CESA 2XO7A 1VSEA 4KB1A 4CK3A 3D0PA 3SUQA 1DLOB 4BACA 1B9FA 2VWJA 4FM1A 2IJNA 1S1TB 4J9LA 5KFQA 1Z4UA 1U48A 2ZQBA 5KG7A 3MXIA 4DU4A 3RB4A 3OYGA 3NF6A 3B6OA 3NF9A 3NBPB 2OPQB 2BDPA 3HSTB 2FVPA 1WAFA 4ELUA 4B8CA 2RF2B 5KRTA 5KG5A 1BCMA 3TAEA 3EZUA 3QGHA 3H98A 4E7JA 3L2UA 1RTIA 3TI0A 4W5TA 3E01A 3HKWA 4IG0B 4BWJA 1NKEA 5E41A 3G86A 3OYKA 3QEWA 1Z26A 4F2SA 4CF8A 1TVRA 3HVTA 3S9HA 2ALZA 1NNDA 3AVJA 3MEEA 2VG6A 3NL0A 5I42B 3ZT3A 3KLFB 2FBXA 1VRTB 3H2LA 4NLWA 1IKWA 4PA1A 3NE6A 5FRMA 1WNEA 1S6QB 3KLGB 4O3SA 4B08A 3VQAA 1NJYA 1BQMB 2J6SA 1VRUB 2OZSA 5DQHA 4HUGA 4RW8A 4WFXA 1RTDB 4KFBA 4RW4B 1WLJA 3LP1A 1IG9A 3MECA 3ZSZA 3L2RA 4OKEA 3V6HA 4ZVEA 4CF0A 4RZRA 4DTPA 4K4VA 3KJVA 3CJ2A 2AGQA 3H08A 3HM9A 2XRIA 4TYAA 1L3TA 4I2PB 3D5MA 1JKHA 2JEJA 2VWKA 2J6UA 3U6FA 4O4GB 3KK1B 4N5SA 1HARA 4Z4GA 4F3TA 5KFIA 1JLGA 2DFFA 4N76A 2QKKA 1ZBIA 2HB5A 4EBDA 4J9KA 1KLNA 2VA3A 1RTHB 2IDOA 2JGUA 4DMNA 4L8RB 4ED3A 4B9NA 3ZSWA 2D41A 3QYYA 3QIPB 1T03B 1RT5B 2UVVA 4NLOA 2I5JA 2I1RA 4CHPA 3HPGA 3NBPA 3PJXA 2OPQA 1LW2B 2RF2A 4FJMA 3RMAA 4HHTA 3PW0A 2E9TA 3AVKA 2KQ2A 1QAIA 2G8WA 3F73A 2OH2A 4IG0A
chains in the Genus database with same CATH superfamily
2E5LK 2NCKL 5AQSA 3ICLA 4K4XA 4CEOA 4HUFA 4CHYA 3VF2A 2EHGA 1K8KB 5MAOA 1NDKA 4EIAA 3NNCA 1R89A 4O0NA 1EX8A 3CIMA 2Z0GA 4L3KA 1X3NA 1SH0A 3TZWA 4ECXA 4K2XA 3J7ZT 2Q0RA 1WHXA 3TTCA 1LXNA 3VGMA 1UJ6A 3L95X 1N5SA 2QSFA 3TAQA 3RBEA 5ITHA 2BA9A 4E0DA 3Q86A 3QNOA 4N47A 2C2EA 4JI4K 5B09A 2ILYA 4AF1A 3SSRA 2VBXA 3NS6A 4UQTA 3MEGB 4LF2A 1BWEA 1BG3A 4I2PA 5L1JA 2E66A 2DXDA 1H0HB 3PW5A 3ZX0A 3WNFA 4GV3A 3HZGA 4I67A 1UW9A 2WSFC 2DCLA 5E7OB 1WG5A 4NLTA 4FYDA 4TN2A 1D9FA 4Z7YA 1QDUB 1SS6A 4U67Q 3C6TB 1OY6A 2ZDPA 5AXKA 3WQUA 2ZJPQ 2NUUG 3UDLA 5LY3A 1SKSA 4CJQA 4KTZA 4LBHA 1YTYA 3D2WA 4MDAA 1VOMA 3GE9A 4AHSA 2EFQA 5KT2A 3CCMS 3TUPA 1C1AA 1EQMA 1T05B 1HQEB 4DTXA 1NK5A 1HL6A 3OR1A 4U8YA 1VC6A 3QFUA 5E2QA 4USVA 5ETVA 3QGPA 1D3WA 3SMZA 3ITHA 4FWQA 4KO0B 4MDBA 4O3OA 3TARA 2PA8D 1MSWD 3DLGA 3LZJA 4USJC 2M8DB 2B9XA 4W5NA 4RNNA 4FLVA 3O44A 3TVKA 1FWLA 4ECQA 4AL5A 3FUYA 1ITGA 3A5LC 4HTLA 3SUNA 2EK1A 2WCXA 5KFTA 4J2DA 3IR5B 2CJXB 4JV5J 2B7CB 3OL9A 3PIPQ 1JK9B 4O4RA 1T8EA 2E7XA 1VCTA 2W8KA 3K9JA 4QYZJ 1TAUA 4X4SA 3D7SB 4JI2K 1AFJA 2P9LA 1ITPA 3OY9A 2YVSA 4FWSA 4DTOA 3PYEA 2Q3SA 3GFZA 2BR0A 4WQ5A 4ZVHA 5KPRA 3S3OA 2F8SA 1RKJA 3DN9A 5KFAA 4DU8A 2XGQA 5FDLA 2PMHA 1IKXB 4Y6IA 4K8ZA 3NS5A 1V3ZA 2IFXA 2RRAA 1NK8A 1D09B 1YX2A 1NPPA 2HHUA 3UCGA 4H0PA 4OI6A 2DNQA 2CZVC 3BH6B 3BQ0A 4RU2A 5L1KA 2Y8WA 4CFAA 2DNPA 3ZT1A 4ZHRB 5HOOA 5J1EA 4O23A 4JN4A 3D6RA 1S1UA 2JX2A 4BR5A 3CO9A 1RCXB 2HBKA 1RADB 1S0NA 3BM7A 1T94A 1U1LA 3QJJA 3KKSA 1G7CB 4CGDA 1RWPB 1XTZA 1WF1A 1JLFA 3EMTA 3H8YA 1UZDA 3HXMA 3P6YC 3QSIA 4DV3K 3CUNA 5D3GB 3B4DA 3BB5A 1GLJO 3CFOA 2K3IA 2NRHA 5JXSA 1VDHA 4ANDA 4DQSA 2RRNA 3IAYA 4DCJB 3PKYA 1YJWN 2B5JA 4OZ5A 2ZZNA 2DTUA 3JSMA 2WONB 2J8SA 1YAGA 4PWWA 2XO6A 4CZHA 2EC0A 2ROPA 4CZMA 2HVEA 3G25A 2BJ1A 2RVJA 3A4TA 1TUUA 1RT2B 4CO2A 2UUBJ 3MM5B 1V4SA 1NO8A 4LD0A 4ILRA 4K5SA 1IVZA 4GV9A 3H3OB 2G2OA 3GG4A 3T3FA 4KR0B 2HNYB 2O8BB 5SUHA 3IP0A 3AVFA 5JLHA 3QRQA 1YITN 5GAHU 3VF0B 3L4BC 5HVHA 3VQ8A 1WC5A 1Y5NB 2PMZD 3HVRA 4NOHA 2MY7A 5B8HA 3OXFA 3GFHA 2QXLA 3MDFA 2GVDA 4J5OA 1YVNA 4UTGA 3KK3A 3UFCX 3ZSRA 5B08A 5L1IA 2HNDA 1RGIA 5EWEA 1TYQA 3R5DA 3WQPA 3A5OC 2FVCA 3ZZRA 1J5OA 1KVBA 2M88A 4OX9K 4LF9J 2IIHA 1JLAA 2A6AA 3HKZD 4PKIA 1N5VA 4C7QA 2ZF5O 1WF0A 3DLJA 4LF7K 3RB3A 3V9WA 5ETKA 2C3MA 3UO0A 2OMLA 5HLFA 3BREA 2JDJA 1SXLA 5CYQB 2ZD1A 2CPJA 4RW7B 3JQKA 2L48A 5KFYA 4B3SJ 2XMAA 1WTFA 2GNKA 4EHTA 4M5JA 3BJYA 3CMES 4YP3A 3BGRB 5DG7A 1REVB 4WFBQ 4FK0A 5DZ7A 3ZFVA 2D74B 1VHIA 3D54A 1QVGR 4AXIA 4HTUA 1CPZA 3Q8UA 1T7PA 4X62K 3CF5Q 4ED5A 2NUHA 1M5HA 4LQ9A 4J37A 1DQAA 4F0MA 2UVWA 3ADAC 4P71A 4G65A 3AY9A 4DR1F 4ITSA 1M90O 2AJ1A 4X65J 3M8WA 3NCPA 4A61A 1N8RO 2L9DA 3FKBA 2QA4N 2FY8A 5SZTA 1A5VA 2U1AA 4NI2A 4B1VA 2E9ZA 1RBTA 4H5TA 1HNXJ 3CCVS 3AV9A 3QO9B 4AM7A 3G9CA 4KRFA 3RMCA 4IG0A 1HIYA 3CJ4A 1T3VA 3ZZYA 1KQSM 4TKTA 2B3TB 3CDAA 1WG1A 1JLBB 1F0XA 3R6GB 1BIUA 4AQYK 2J7KA 1HLWA 4KHPK 3WQTA 3VQCA 3U8XA 4I9LA 2MQMA 4PABA 1UETA 2DY4A 2EG1A 4NA3A 4K41A 4BROA 1S10A 3BF4A 4QCLA 2EC2A 2YHYA 1QHAA 3Q7BA 4B3TK 4DUYF 1F21A 4I6MA 4KPYA 1QAJA 4FJXA 2X7IA 3C2PA 2X6SA 3OYLA 4KJIA 5HAOA 2FZCB 5H1SQ 3QEXA 2P9GA 1ZM3A 3OS1A 2X78A 2WVEA 4A48A 4WE1B 4ZPWR 1ULRA 3P31A 2DY9A 4WQ4C 4LSLA 2OCEA 1FHTA 1CQNA 3M8ZA 4BRDA 3CQ8A 3N4PA 1J27A 4CZJA 2MHNA 2YY3A 4TXSA 3GJSB 4ID5B 2F8TA 2NSCA 3WUHA 1RAGB 1UEKA 5K8PA 4IZ9A 4O3QA 4MYUA 2NUBA 1HW8A 3OTOF 2YX6A 3GIMA 1C1BB 2B9YA 3ZT0A 1W2BR 4E1NA 1NSKL 1SKUB 4I0WA 5LMUJ 5KOWA 2HQCA 3CJRA 3I31A 3PW4A 3O80A 4CK1A 1DLOA 3TZYA 4M5DA 4RWWA 3IFRA 1UVMA 2D3OR 1YJWS 4XK8C 4CZFA 1RDRA 1RU1A 2DPIA 3DRRA 3TEHB 2RSQA 4IQMA 4RW9A 2EFPA 1QZ6A 2VQFJ 4BC9A 2WAQD 2UZAA 4UY85 1Z25A 4OYIA 4HHUA 5CQGA 1NEEA 1ZZNA 3ENWA 2Z56B 2RUSA 3K5PA 5KFHA 3CB4A 4IJAA 2ZH7A 1RI7A 3FFIB 4PG5A 1RILA 1Y00A 4B3RK 4N41A 2Y9HA 1R8CA 5IT4A 3UN3A 2YJEA 2GEMA 1HI0P 3HO1A 3AGKA 4DR4K 4RW6A 2ITGA 3QIDA 2VOPA 2GUIA 3F5TA 4IFYB 5G0RB 2R8KA 3H20A 3QB0A 3CVKA 2VHGA 4IUFA 2APOA 3AVNA 4B3OA 3SQ0A 1MNEA 3KXDA 2BBEA 1U47A 1RNHA 4CGFA 4H5RA 3SQGA 3TSPA 1C1CB 2EKYA 3TA1A 2V8GA 2YXLA 4YDDB 1SC3B 3K8VA 1EJ7L 1SQFA 2V8VA 3J8AA 5AFUA 4MKBA 3DXMB 4ZOSA 5DQGA 3H59A 3TR8A 2CIMA 4WIIA 4YDUA 1S4FA 1WB9A 3UDVA 4DL4A 4JI5J 3WDOA 2XLIA 5HP1B 5KPZA 3CE8A 2E20A 2OUGA 4BR0A 1N36J 2D3O1 4PXBA 2CPYA 1N6QA 4GVEA 1RT5A 3VGKA 3ULEA 4B1WB 1GLBG 5GAGI 3DDKA 1ZOTA 4H03B 4Q7AA 2DGVA 4TNOA 1FK9B 1OVYA 2D69A 3ENQA 3CJCA 4FJHA 4DF4A 3OTCA 3IFEA 1DTTB 3U02A 2QA4S 2G8FA 5IM0B 4JUZA 1WN7A 4M5LA 3UDEA 1FNMA 2LEBA 3H4DA 4DU1A 2G2YA 2JEFA 5A0YA 1JLCA 3KK7A 4HTJA 4FBTA 4NRUA 4O3NA 5HMYA 2V8PA 3K0JA 2RKIB 2XNQA 4P52A 4OI1A 1WTBA 3L3VA 3ZSQA 2FLLA 2E2PA 1SI9A 2HRUA 3TR5A 4Z7CA 3GJTB 3LWMA 1TELA 3M2UB 4GC7A 2FD2A 1JNZB 1N52B 4E8UA 2R42A 3HD1A 4PEOA 1EQ0A 3VQ9A 1REGX 2W4PA 3GCXP 1RFQA 4FJNA 3U27A 2GHPA 3NH1A 5DQIA 3CJKB 4L72B 4AHTA 1R0AB 5AJ3K 1TL5A 1HYSA 2AYBA 1SH2A 2DNMA 2ACYA 4EBCA 2Z1GA 3U3YA 5K20B 2O8FA 1BDGA 3WNEA 1U6BA 4JI6K 3R6LB 4XH5A 2BQ3A 2F40A 4XTTA 3HBTA 3NKYA 3EE8A 4JYAF 4NMXA 4WU3A 4CM2A 2WB1D 2DNLA 3OTDA 1CC7A 3K58A 4X2BA 3K5OA 1LW0B 5CAAA 4QWCA 2ROGA 1RCOB 2X1FA 2AWZA 5LXRA 2CQGA 1K0VA 4AFFA 1GMWA 2PFUA 3VEWA 3NCIA 1PYOB 3V81A 2WHOA 1C2PA 1NJIO 2BUNA 3D67A 4FVMA 1MROA 3CJAA 1WSGA 3DLLQ 2DNZA 4P7TA 2K06A 3H1QA 1RDCA 1YIJN 1OSCA 3LDLA 1NLKL 5M2PA 4DFJA 4FSVA 2AEMA 3OHRA 3ZX3A 4CLPA 3AVHA 4CLYA 1U0SA 3EEQA 3H3NO 4BE0A 2HHWA 3G82A 4QIEA 4NLYA 5A8KA 5CYMA 2J76E 4QBUA 5ELZA 1FXXA 1ZZFA 4NZ7A 3J7AN 3ID6A 3BEGB 1D8YA 3W5ZA 1MWQA 4FF1A 5AQNA 1N48A 2ASLA 1JXVA 3SCJE 4C11A 4DV2F 2WC9A 3WX4A 3ZXWA 5BPLA 1DBDA 4DX7A 1OS5A 1RT4A 4FJJA 4URSA 3M2VA 4CYUA 4OPKA 4BRAA 3ILIA 1YZ7A 1QUVA 4PR6A 3RRKA 2F3JA 1RP5A 4FYVB 5T7BA 1K47A 4ECYA 2C2OB 4RWXA 1FKOA 2BRLA 4DS5A 2HHXA 1HNVA 5ETOA 4USWA 4DV7F 3P45B 5FJ4A 3IS9B 1B3TA 3A8YA 3M2RA 4X4TA 3E9PA 4ISEA 5AZIB 5KFBA 4ED8A 3DU5A 3UNYA 3CERA 3MMBA 2B51A 1HPZA 3SQOP 1TVRB 5KFZA 1IH7A 2V63A 3KJNB 5KT3A 1CULA 3NF7A 2B4PA 2W9CB 2ZHAA 3H4BA 2PA3A 4OMFG 4WTYA 4UZCA 1IBMJ 4ZVSB 4YHHJ 5I3UB 5ADXA 3VN5A 5ETPA 3OFFA 5AQVA 2VV5A 2DTJA 3IAS9 3DYAB 2GVZB 2QLJB 1CXUA 1C0MA 4NXNF 1GLCG 4UW2A 2YKNA 1XUPO 5GADU 2HMIA 1CS4B 3VQDA 1U49A 2GELA 4WFYA 3PYGA 3X3UA 1R27B 2M7SA 4JK9A 1RYRA 3CJ5A 4NCGA 2MJUA 2IOCA 2DHXA 1EWQA 1CSJA 2NLXA 1JLQA 1M5KC 3HHLD 3ETMA 2V34A 2DFHA 2ZOGA 3OHAA 3FZ2A 4CIGA 3K7RA 3GZ7A 2AD9A 3VOVA 5EU7A 2CZ4A 2JL9A 2FJEB 4Q8FA 1CZAN 1FRKA 1WI8A 4BRPA 3RSEB 5C24B 3C19A 1UP1A 3I8DA 2VC1A 2CQ1A 2OLWA 4AE5A 5GAEU 1HW9A 5BR9A 4DSJA 2P9PB 1Q4RA 5JVGL 4DPUA 1IR2A 4HH0A 2AA4A 3L4QA 3J7YP 1MWMA 3EJMA 3V1OA 4BR4A 1DJ0A 3G6ES 2VD3A 3N6NA 1ATSA 4IG3A 5EOYA 3ENAA 3TAGA 1XEZA 3JXUA 3OYFA 5KG3A 2FUG9 2WVFA 3CCZA 4ECZA 2KFZA 4LF4F 3AO3A 4WJBA 4DSLA 4H4OB 2E9RX 2OA8A 3DGVA 4CJLA 3S3NA 3QT5A 2PI5A 1Q95G 1VHFA 5E5NA 2YHXA 2F9DA 3UCZP 4O3PA 2ZE2B 3OR2B 5E0OA 3S7RA 3NOGA 4O44B 4DR3J 4A8FA 3AA8A 2XEXA 3QMLA 3ZT4A 2F8MA 5HMXA 2DKOB 1GEHA 3ZZPA 4YDUC 4Y2KA 4F0KA 3QT8A 1FO1A 4CGHA 2R3VA 2ZM6K 3QAEA 4BVPA 3MFIA 2BH1A 1IKYA 1RLCL 1ATRA 1R0BG 1BUXA 5CHCB 2VOOA 3MCAB 1F2GA 4A5BA 5KFCA 2DNYA 3DLEA 1FI4A 2HQDA 2E2OA 3K89A 2OD6A 5DS7A 3MCMA 2HZVA 4F3QA 4ZPCA 3VQ4A 1TFWA 5AQPA 2MDAA 4J9VA 2HIYA 4DLEA 2JFKA 4CFDA 1E6YA 5KFWA 1TKTB 1NAQA 4TYBA 2YKMA 1TQLA 4RWTA 2Y3YA 3W1YC 2IAJA 2KW4A 2X6NA 2UUCJ 1XNQK 2RD5C 2HK3A 2VKRA 3OFEA 3IMQJ 1KDNA 1RISA 4HKQA 3W61A 1L3VA 3DXBA 1KSPA 4OI3A 2VFSA 2A3ZA 4Z37A 3N79A 2CQIA 2DCUB 1C0TA 3H5SA 2HLUA 3T6JA 4L76A 1XN9A 1TL3B 4Y2CA 5D4OA 4DFKA 3MDQA 3HPHA 9RUBA 4Y3CA 1N33K 5C42A 2P9LB 2A5XA 5BPMA 3QESA 1T9TA 1W26A 4JV0A 1X9WA 3WXMB 2JEIA 4KGMA 2KN4A 2QLXA 2ILZA 2CKWA 5FDLB 1XIQA 1S6PA 4U95A 3LDSA 4IQXA 4F4WA 4NXMF 2YNFA 4YY3J 4YQWA 1HQUB 4A8MP 2XMKA 3CD0A 3EX7B 1MU2A 4V19J 1BL3A 4O0JA 2G9OA 3M05A 3P83D 3X1LB 2DYAA 2V69A 2ZJRL 2A0FB 3OXGA 4RO0A 2A6OA 3FQLA 1J9AA 1HNWK 3VAKA 3MCNA 1KLMA 1GXLA 1TKZA 4OZJA 5J1EB 2DGQA 5BYRA 2O8DB 4DV4K 2UP1A 3WXLA 2MZQA 1NGDA 5B0EA 1JJ4A 4LFCF 3JTOA 4P2FA 3FCHA 4QYRA 1MA9B 1A9NB 7FD1A 1T9YA 3V9ZA 3J7ZO 4CLFA 5C10A 5D0HA 4M5MA 2GAGC 1FA0A 4JNEA 3W9IA 1OH6A 1J5EF 3O2IA 2AGPA 1O0PA 3M1FA 3TZXA 3A3NB 3RB6A 3HCXA 3QFWA 2HLTA 2B5JB 4DUZJ 2V9WA 4E19A 2E1MC 4YORA 4NCBA 3NNHA 5GMKa 2XZTB 2H54B 4KB0A 1GMUA 4F50A 4A57A 4CLSA 1LOUA 5DGBA 5H1SV 2NXCA 1X0PA 2KVQE 3TAFA 3DLHA 2G2ZA 2V5HG 5KG1A 2E5LF 1BC6A 2G0IA 5M1FA 5KFDA 1NWKA 4Y65A 3BQ1A 1HWKA 4OHXA 4WCEL 3NGYA 1GLAG 1WEYA 1X8DA 3ISZA 1MDUB 1BY9A 3H2UB 2AEFA 2IA0A 3V1RA 5EUHA 3HP6A 4X4RA 1DARA 4L73A 4JI0K 4Y2MA 3IMXA 3I8BA 4GNIA 1Q79A 1X60A 2GVDB 5C5JA 3LALA 1VSIA 4OPJA 1K1SA 4LFBF 2DRDA 3KK3B 2OJ3A 4NX9A 4LF8K 3HSCA 3POTB 3Q2TC 1T6DA 3FQKA 4C23A 4JI4F 2QFIA 4OYOA 3V9XA 3W9HA 4DB3A 2YNGA 1GLDG 2W40A 3GV5B 1HKCA 3ILLA 1Y3KA 2BE2B 3AVCA 1X4EA 3C46A 2PYLA 3CCEN 4OLAA 5HLFB 1ZM2A 4IBNA 2CAJA 2ZD1B 1NH7A 4QPXA 3QMQA 1RT6A 1U0HA 1F5AA 4MKVA 1H7XA 1LWEB 2FJDB 5A8WA 3O8MA 3G8QA 7FDRA 1RAOA 2NNWA 3H5UA 2MKSA 2FYXA 3LM9A 2OFHX 3G8SA 1YI2S 2SXLA 3HT0A 3LP2A 4DSIA 2R7TA 3HVWA 2A2DA 5LMNK 2VJVA 4FJ7A 4Z4FA 1SJFA 5IWAJ 4JKDA 4PL7A 1TL7A 3KD1E 3I82A 3UKUA 3W5XA 4O8UA 2D1KA 3C8YA 2B4VA 2ZKTA 5M1KA 1YJ7A 3AVAA 3TANA 5I3QA 2FGCA 2Q43A 5C2FA 1RWMB 2G8HA 2QV6A 2F9TA 1SQGA 1Y97A 1Y7PA 1S6UA 2ASJA 4JV2A 1PCAA 3TRGA 4WK3A 3SQ1A 1SAZA 1G4CA 3T9ZA 3W63A 2X3DA 1UEVA 3EY1A 3E01B 4LF5J 3IBWA 3ZSXA 1VK3A 1QQMA 2O5DA 2FSKA 5K8OA 4BR9A 2UU9K 3DXSX 2QWOA 3S8SA 3EN9A 2VQEK 4FL9A 4JI2F 2HFVA 4GY2B 5F8GA 1TK5A 4X64K 2Z1JA 1CXQA 4CD1A 3M7VA 3EDRB 2ZGZA 5D0GA 2B0GA 4DPOA 3L2VA 3MPWA 4YN3B 4JK8A 2WTFA 2ZBCA 2QEXN 1IKWB 3VTIA 3BF3A 2CG8A 3H6EA 2FF6A 2FJVA 5GIPA 3BR8A 3MEDA 3FZLA 2E1ZA 1CLFA 3UKRB 4GMJB 4LSLB 4YB6A 5T7LB 1D5AA 4G1PA 4J7CA 4OO1J 2DB1A 5GMEA 4FW2A 3TVYA 9ATCB 3GB0A 4M94A 1S49A 2RHKA 4CLUA 3IC1A 1FE4A 5IS2A 3O1BA 2GTDA 2YV0X 1IBLK 5IV3A 4ECVA 4MAKA 4RNHA 4LFAK 3CJTA 2K2PA 4QIGA 3K2PA 4CDIA 1OY9A 4IOBA 3B6PA 3MTKA 4HI2A 3ZZZA 3MM8A 3EKUA 3MGJA 3GPAA 1KKHA 3EL2A 1OQ3A 4QIWD 1JLGB 5JVGQ 2XO7A 2MKCA 4DV3F 2XSFA 1DLOB 4Y0FA 3W3SA 2DR8A 1G3OA 1Z4UA 2ZQBA 1Z2LA 5ETNA 4DV1J 3MR7A 3VVUA 3NF9A 2VPXB 4ELUA 4F36A 2RF2B 5AFUH 4OYMA 3TAEA 3EZUA 3L09A 1UFWA 1R8BA 4RBTA 2UUAJ 3R7SB 3H98A 3W62A 4FNHA 1RTIA 1V4TA 4PCQA 3HMJG 2EG2A 4XH4A 2NYIA 2DBBA 2HEKA 4Z94A 4B3MK 1Z26A 4F2SA 5HL7Q 4KGVB 3AY0A 3GYGA 3LF0A 2I2YA 1XMQF 1U1MA 3H2LA 4PA1A 5EGYA 1WEXA 3KLGB 1Y10A 1IV0A 1HR0J 1OPIA 3VQAA 4N7TA 1BQMB 3O9QA 2HGLA 2DT9A 2MKKA 3PSFA 3MOJB 1HWJA 3UN5A 1RTDB 4P73A 4KFBA 1FJGJ 1TUGB 4OX9F 4UOFA 4OKEA 4CF0A 2GJFA 4B1XB 1NPRA 1VR6A 4LF7F 2RNEA 3QWPA 1SVDA 1Q18A 1CJVA 2J6UA 3U6FA 3CCLN 4X4OA 2NSBA 3T1YK 5B0GA 4N5SA 4F3TA 1RHKB 2BV3A 2J9CA 1N32J 4N76A 2HB5A 2QL5B 5CZVA 5BR8K 5RUBA 4L8RB 1GXTA 4ED3A 5LJ3Y 3U1LA 2MKYA 1RT5B 2UVVA 2HFSA 2MTLA 1VAZA 2I5JA 3RUBL 3HPGA 3NBPA 3PJXA 3DOMA 4X62F 1E6VB 2GMLA 2CUYA 3FE1A 1TTHB 3VAIA 3I55N 2NZCA 3D1QA 2ZBRA 5BRDA 4BR2A 4C6AA 5LT5A 1F9FA 3L7PA 3UI3A 4F4KA 1W2IA 3H5XA 4Q8EA 2UXDJ 3NF8A 2Q0UA 2R7RA 2EBGA 3MN7A 4I2QB 4WIQA 1B9DA 2EKNA 4LF8J 1KAYA 2QLWA 3ETOA 3AQPA 4CJ5A 5BYQA 1AUSL 1VRTA 5KT4A 4IKFA 1NGGA 5AQOA 3OL7A 1VIXA 4Y1DA 4AQYF 1NNEA 4KHPF 4DPYA 3MI7X 3VEZA 1VRUA 5AQZA 2KT5A 4RCHA 3ZT2A 4CJPA 4WP9A 2V7ZA 2FZKB 3RMDA 1NU0A 1WKJA 2J9EA 2JJ4D 3R5BA 4YEAA 1YRTA 3O5TB 3R9LA 5KT7A 4RKUC 4B3TF 4JI8K 2QEXS 2E4LA 4FLTA 1H2VZ 4NLUA 2BE7D 2F4FA 4DR2J 3ET6B 4PWDA 3DM2B 2HNZB 1N0VC 2O3DA 3OBWA 4DL7A 3NGZA 1VK0A 4DHYA 4HT5A 4O4GA 1CJTA 4Z4EA 4F4AA 2NZ4A 5JMNA 4ED6A 2A3JA 4I6AA 1BA1A 2JLFA 2G1HA 2HK2A 3G96A 3R3TA 2R2UA 2W24A 3R97A 4FF2A 1XC9A 4EBEA 2NRRA 2VONA 4GVBA 2EX3A 4Y1CA 1YDLA 2WBNA 4A8WA 4DX6A 5AQUA 3Q89A 3C0BA 4LBPA 2GQ2A 1M1GA 3PSIA 3PG9A 4CHNA 2F4VK 3IBCB 2W1BA 4DWIA 5L8RC 2IYGA 7AT1B 3VQPA 4CTAB 3ILOA 1RKIA 2IPOB 3D1OA 5ETRA 3OVNA 2QRRA 1K8KA 2EWSA 3RAQA 2PGCA 4NWBA 3HI0A 2FY1A 4PUOB 3G82B 2VQEJ 5DM7Q 1P1LA 4ZIWA 5A8KB 5CYMB 3L0QA 4Q2LA 2HVIA 4X64J 5C2GA 3U7JA 3T1HK 2AX0A 4CEQA 2HVDA 1VQKN 1NKBA 3CPWR 5GAHI 2FC8A 4RUAA 4PXDA 3PUFA 3MOZA 2ZVSA 4B3RF 2C2DA 1I51B 2N4CA 2JVOA 4C11B 3EZWA 1RT1B 1BISA 3BY5A 4MKAA 2RHQB 3FCVA 1GX6A 5A76A 3MM7B 2CPZA 1HBNB 4DR4F 1RT4B 2NRXA 5ADXH 4LMZA 4CYUB 3MEGA 1MMDA 1URNA 1NU4A 3AJDA 4HHHA 2R2RA 2AJ2A 4ZVUB 2MLYA 1FJ7A 2ZC3A 2UVRA 4IKAA 4MH8A 3SI8A 1IBLJ 1S0OA 2P1JA 4ED2A 3EVWA 4NA1A 1KNZA 3AAPA 2N3OA 4EUVA 1SJRA 5F8NA 3MXMA 2G8KA 3P4UB 3BZCA 3TVZA 2PN6A 5IT9Y 5AQIA 3VQ6A 2JWKA 1FFSB 4OHYA 5D77A 3C6TA 5DM6L 4X4QA 4C3MA 5HO4A 1RAHB 3MMBB 3CCLS 3VGLA 5KT5A 4NB4A 5CHIA 3VGTA 1EP4B 3GSIA 4OL8A 1CULB 5BJRA 3SAHA 1T05A 1ICEB 2HRTA 3NAIA 2Z4PA 1M5OC 1NB2A 4MYTA 3TZZA 3EE3A 2OYQA 1W25A 1QE1A 3M30A 4FP9A 2V4QA 4PG7A 3VEOA 2LU1A 2NRZA 4KV8B 5FLXY 5J2NA 4NA2A 4KO0A 3I55S 1GTEA 5F8IA 4GKJK 2NREA 3RTVA 4QWEA 3Q2SC 2VODA 2COLA 1N54B 4DPXA 5KFKA 3L3CA 2VL1A 4G6VB 2ZH9A 3DRYA 3ZTPA 4HI1A 5C0YA 2EFNA 2GO9A 1PG5B 5BRHA 4DQIA 3SUOA 1RT7B 4FKYA 3M8PB 5F1XA 1IKXA 4BG8A 1BUPA 3TOQA 4KGXB 4M8LA 4BWMA 2UXCK 4BDYA 5F3TA 3OBIA 3NWRA 1TGOA 3VGSA 1T6CA 3BZKA 1M90T 4QWDA 4OYBA 3TP2A 1T3NA 4DKWA 1VQNN 3BKTA 3U9DA 1N8RT 3GFYA 3CG7A 3SI6A 3SSQA 2V50A 1YGYA 1WC1A 2HBLA 2UXBK 4B9MA 4X4PA 3ALYA 3R8YA 1SCJB 1PC4A 2L9WA 5AJ3F 1Q82O 2GHWA 2F9JA 5BR8J 2CNOB 4KHSA 4DFPA 4HACA 2GMHA 1U8SA 4JI6F 3OTOK 2HG4A 1WHWA 4KH0B 3Q0AA 3G87A 3OLAA 2G0CA 1GLLO 5C2CA 5D3GA 2AT1B 4KE5A 2IVOA 3J7YU 4M5GA 4PKGA 4F02A 1RHJB 1U8WA 4OKJA 3WXKA 2XYPB 1N34K 2O66A 1X0FA 3KLHB 3Q22A 3UD3P 1ZM4A 4MMOA 1U6FA 2VFVA 1I1GA 3NGIA 3GTYX 5EWGA 1RBUA 4JS4A 3MM5A 2Z57B 2LDYA 3AOBA 3SDEB 3CJ1A 2WFBA 3F2KA 2DXFA 2KU7A 1CZBA 2HNYA 2XS5A 2O8BA 3ATVA 2WBRA 2PC6A 2W4CA 4CJ3A 3D6HB 1IKYB 2MKHA 4HYKA 3DMJB 3HRGA 4F04B 1TMMA 2ASDA 1KFDA 1VQKS 2V9KA 5LM7E 4FYXB 5GMDA 3J7Z5 3I32A 3RR7A 5DLGA 4NLVA 2KFNA 3KLIA 4BDZA 1XMOK 4OJRA 2E1AA 5KFMA 5JS2A 3PJ9A 2CQ4A 2PY5A 3FEYB 1EKRA 1FWPA 1E6YB 2IBKA 2YKMB 3R9PA 4A8QA 3A5NC 3EUNA 2IAJB 1FXDA 3DRSB 5CYQA 5EVZA 4CHOA 3O3GA 1H7WA 4RW7A 4C1NI 2R7QA 4NLPA 2KT3A 5L46A 4IDKA 2H3GX 3HHLB 3HL8A 3OSPA 4CEFA 3PEJA 4KH4A 2VPWB 1Q5VA 1NGEA 5M1QA 3BGRA 2O8CA 1WC0A 1QHTA 1REVA 4YB7A 1KEKA 1Y4ZB 2HURA 2L08A 4CZGA 4JAXA 5DLFA 4OPAA 4DG1A 1PYSB 3I4PA 2QA4G 1KXPA 1HHSA 3V6JA 2HRYA 2HBZB 3IWXA 4XO0A 1NDCA 4V1Ak 1KQGB 3W0LA 5C42B 4EO6A 2ZNYA 1T9UA 4G9ZA 3P5TL 3UR3C 1EO1A 3M5RA 3OT9A 1LWXA 4IDHA 4IOAQ 4I4BA 1WUUA 2DHAA 1AROP 1S6PB 2DY1A 4IO9L 2IVMA 2ZH8A 4DV6K 4BRHA 1OO0B 3OVAA 1B4SA 3MX2A 3RW7A 4OJHA 2CG4A 1MU2B 3CFRA 2W9AA 3I5CA 4USKA 5HSPA 3QT6A 2MGZB 1JLBA 1KLMB 2KT2A 3T7ZA 3DC2A 2PI4A 3TW0A 3KD5E 1L5UA 1YJTA 2XBPA 4YFUA 3IBFB 4CF9A 1VQSA 3GJQB 2XM3A 3T41A 1JLEB 2KHCA 5J1NA 4I69A 3THTA 1S97A 4CWBA 4AXJA 4KHQA 4QS8A 3KLFA 2Q6CA 1VQ7S 1VQNS 5ETSA 3HOTA 2LXUA 3GBTA 1TP7A 4JV1A 3BDPA 2QA1A 4O8KA 4M5IA 1RA6A 1NLVA 3D9BA 5C2DA 3BH7B 1PKUA 2FVQA 3JTPA 4DR1J 4QOZB 4RW4A 3FNNA 4FS1A 2ERRA 2IJFA 4Y0WA 5LL6d 3KK2B 1S0MA 5CH7B 1RT3B 4ID5A 5KFVA 2VWBA 3HI9A 3BSCA 4Y2IA 4YOVA 4ZVGA 1AXQA 5KFGA 4BRCA 3CCWA 1C1BA 4F0HA 1NGHA 3PX6A 3KK1A 3FRZA 3FRYA 1PILA 1B99A 1Q8KA 2P9CA 4DR7K 3PYFA 4CO3A 1RTHA 1RJJA 3GYNA 3N0VA 2KTQA 1IBKK 4CLWA 1G2EA 5KG0A 1R31A 2RQMA 2HQFA 4DUYJ 1TKDA 1FD2A 3WZ0A 1UVIA 3CD7A 2QE5A 2HS0A 3FFIA 2QIFA 2UXCJ 1KCFA 3OYEA 2QO3A 4P6QA 1R6YA 2PBDA 1RBAA 2OEKA 1FJEB 4PZVA 1KQSR 4ZCKA 1L3UA 3UE5A 1S5JA 3D2FA 2ZM6F 3QINA 2LSNA 5AQMA 4DR5K 2LEPA 2HHHK 1NK6A 4O3RA 3CJ7A 1NM1A 4IO8A 1NPKA 1NJIT 5A8WB 4OZ1A 2VC0A 4IFYA 1X4AA 2H1YA 4P75A 2AW0A 5A6PA 2IVPA 1F6TA 4U67L 2FSJA 5D78A 2VG5B 3OTOJ 4M3WA 2LDIA 3OVBA 2ZJPL 3PR5B 5AQQA 3UKUB 1C1CA 3ZNJ1 4DV0K 4R0JA 4QJVA 5HQLA 5H9FJ 4ILHA 1XNRK 1S6OA 3BUZB 1UVKA 2HYIB 2VBYA 3DXMA 4ILGB 1NMNA 2RILA 1XNQF 3CD6S 3SAGA 1OY8A 1YF5L 1VYAA 2DIUA 2JLGA 5AZJB 4I68A 3VQQA 3CC4S 4EO8A 3IRWP 3EPGA 2CADA 1AYEA 5F3ZA 1SQKA 1YHQS 3WT0A 4FLYA 1HRHA 5LXYA 2UV8G 3KYLA 2HAIA 4CK2A 3NEKA 4YS2A 2GMJA 4ZITA 4DN0A 1N33F 2W41A 5LSLA 5IM0A 4B9SA 4MFBB 4YOUA 3LL3A 4OI4A 1VQLN 1WDTA 4CO4A 1RYSA 2QT7A 3I0RB 4F7VA 2X74A 3OL6A 2KZMA 3SJJA 2EK6A 3MEDB 2DGOA 2RKIA 1BI4A 2UVUA 4DV5K 4LUBA 5DK5A 4FYWB 2R8HA 3Q8PB 1WKLA 5J2MA 1HNWF 2GQQA 4M5KA 4KTQA 2HF4A 1KVAA 5HMZA 3O4WA 4DV4F 1IO2A 4LF6K 2H51B 2LQBA 3SIPB 4J2EA 1UL3A 4BREA 2CGLA 4M3YA 1RCHA 3HF5A 3CJKA 4EGLA 2V2QA 1R0AA 3GL1A 3EZ5A 5IQQA 3PR4A 3IRXB 1V3SA 3CWJA 1HFEL 5ETTA 4CGGA 2J9DE 3H1VX 2FF3B 1NB7A 3VVTA 4X4VA 3MPDA 4KRWA 4DF8A 1LW0A 2QWRA 1A5XA 2YWWA 2B8PA 2G1DA 2YH0A 5DO2A 3PW7A 1M1HA 1YJRA 2C2KB 2FPHX 1VMBA 3BSAA 4M63A 3OYAA 2ZDOA 3G4SN 4TQRA 2GCFA 1GAOA 3J80Y 4J9UE 4KHWA 3HLUA 1RDDA 3AA3A 3R7BB 4HR2A 4DDFA 5AQYA 2CWXA 5KPTA 1NGAA 5L38A 2E1YA 4J8FA 4CNYA 2GIRA 5HRNA 1N5QA 3GG1A 3O3FA 2GX8A 1U2VB 3SMPA 4KBOA 1Q1KA 4H5NA 3NGKA 1CLQA 1PJ5A 1HKAA 3MURP 3LWLA 3TUJC 4DL3A 4NPOA 4F25A 1NHKL 4AL6A 3ELHA 4DTRA 4JI0F 1SIWB 3S41A 3MAQA 4EHUA 3ZEUB 3A13A 3I33A 4Y34A 4B1UB 1PYTA 3KG0A 3TAPA 4ICLB 2YI1A 3M6XA 3TA2A 2LXFA 5LL6Z 2R4FA 2OTJN 1QVFM 5E3AA 4CW7B 1QS4A 2ZOFA 1W9HA 5KI6A 5KFUA 3TTFA 2M0GB 2DR9A 1Q8IA 2RAQA 4C2MA 3DNCA 5CD4A 5A6WA 2QWNA 3U3GA 3RVCA 1GNKA 2VIHA 4JYAJ 2PDAA 2F1FA 1RTJA 3O1LA 1TFYA 1P8ZA 2Q1LA 3PO5A 1BCOA 2RHSB 1CJVB 4DX5A 4OGCA 1DKGD 5KGXA 5D0RA 1BOTO 1VI7A 3C16B 6AT1B 2HGMA 3VENA 4USHA 4WFBL 3S1TA 2F8HA 1FDBA 3QSYB 4DOZA 3K0SA 3R5JB 2QTDA 2I5JB 5LMNF 3HVAA 3CF5L 2YWKA 1J54A 4HCCA 1X5SA 3N5BA 4ZP8A 2NXJA 4RG8A 1FRMA 3IS9A 4GC6A 3DLBA 1S1WB 2QK9A 3CD5A 4ZVRB 5U47A 4DUTA 1HBOB 3QLHB 5AZIA 3EZOA 2IDEA 1BD6A 4CIFA 3VMFB 3PY8A 3DOLB 4CEEA 3CPWM 3RRHA 1SC6A 1H2TZ 1NG9A 2RQKA 4BS2A 5F2RA 2ETJA 4A4JA 2Q6BA 2RU9A 2YQ3A 4PPDA 2W9CA 4PRFA 4W5OA 1VQPS 3TQ1A 4CO5A 4IO9Q 5I3UA 4FJKA 3DYAA 1TKXA 2CQ0A 3LH2S 4DV2J 2UU9F 4G1QB 1XR5A 2UUWA 2FBTA 3CCRS 2FLPA 1VQLS 3FK4A 1CS4A 2B7BB 4X64F 2CDQA 1UW4A 3VZIA 4ECUA 3CJBA 3WXJA 2MPUA 2V52B 2GW8A 1F3VA 4J2BA 2YWGA 2ABYA 4JB8B 1YSJA 2MSSA 4PWDB 1KFSA 3B6BA 3SV3A 4CEAA 2Y0BB 3V4MA 4H4MB 4JKCA 4ZJQA 5BN8A 3KZBA 2JLEA 4DV7J 2D0CA 1WNSA 1LKZA 2W42A 3SPYA 2W4DA 1UZHA 1XNRJ 3VV2B 1GLEG 1ZA1B 4FWNA 4FWKA 5C24A 2VPYB 2ZBPA 3BP8A 3U1NA 4I6WA 1IBLF 2B4JA 4LFAF 5DG9A 2M52A 2R7OA 2H9ZA 1LWFB 1EAYC 2C28A 2P9PA 1LFPA 3NFAA 1WUAA 1BE4A 2G13A 2MZRA 4F3MA 3OXLA 4N8OA 2HPUA 1C6VA 5A2QO 4JKBA 2C3YA 4W90B 3ZZTA 2JWNA 4OZLA 2WK4A 3BR9A 4NXNJ 1P27B 3MR3A 3PRVA 4W98A 5AQHA 3F9MA 3OS0A 4WQ4A 1UVLA 4Y00A 3G4SS 3CSKA 5GVQA 1DTQA 1JXEA 5K5MA 3SXLA 1UPPA 4H4OA 1U09A 4LFBK 3QPIA 5CY4A 5KFPA 4B9VA 2ZE2A 3OR2A 4B3MF 1XMBA 4O44A 2KJWA 4DR6K 3AO4A 2XLKA 4IFVB 3VTHA 1CQMA 3CCQN 4Z4CA 3AQOA 4U8VA 2HZCA 2CJ9A 1URRA 2N3LA 4I7FB 3ZLJA 3JQJA 4ELTA 5M2UA 1PBAA 1B7YB 3VZHA 4ENOA 2OTJS 4EZ9A 5H9EJ 1M5SA 3SUPA 2JZ5A 3LP3A 2QJ3A 1LQ9A 2RJZA 2HWHA 4E7IA 3O9TA 4ED4A 3QZ8A 4OZ0A 2V2ZA 2PEBA 5F41A 1VQ6S 4DTNA 1SZ2A 3C95A 4M5NA 4ISGA 4JI3K 4XIUA 2YKOA 2EW9A 5HATA 1CC8A 1MW7A 3VAFA 4C98A 3LM2A 2QFJA 4U9RA 3PXGa 3QQCD 2BRKA 3T1YF 1TKTA 2KZZA 4LF4J 1VQYA 1WHVA 2B4UA 2I9SA 5BR8F 4RNOA 4FS2A 1ILYA 2LMIA 3IAM9 1QE1B 3M30B 4NMLA 2F65A 4A47A 3AHPA 3RGIA 5J2NB 4C4WA 4ZLPA 1K8AT 1LEOA 4ES2A 4FVUA 3VHQA 3RAXA 3F41A 3E8OA 2Q66A 2NPIA 3M6WA 4YOEA 1Z2ZA 3OYJA 1K6YA 2VDIA 4HUEA 1Q81T 1NJXA 3EXCX 3R1LA 5I3PA 4EYHB 1X31C 4Q2MA 2FLNA 4WYLA 4RTFD 1TL3A 3JS9A 3C6HA 3NGDA 3WXIA 4Q43A 3CC7S 5KFLA 1YRUA 1GH8A 4GKKK 3GMGA 2XC9A 3W5YA 1VSLA 4EEYA 2NQPA 4DMZA 5DZ6A 2UYTA 2Y8YA 1S9GB 3KUGA 1S9EB 2W25A 2DD8S 2EFGA 4RJVA 2BTFA 1HQUA 2P2CB 1XJWB 3AA2A 3AVIA 1RBLA 1NOZA 2YKAA 3K5NA 4M63C 4EYIB 2RS8A 1HJRA 1YJNS 2GAHC 2BOAA 2O8DA 5E3QA 3LPTA 4JI8F 2CJAA 1Q9XA 3R8EA 4HACB 2Z58B 3DLKB 3T9NA 1S76D 1ZH5A 3RBDA 3LPUA 4KSEB 4XDCA 1ZETA 1RU2A 1JJCB 4I1TA 3W3DA 4DCOB 1VC5A 2YWHA 4WK1A 1VSKA 3PKMA 2DH7A 5KFOA 3SSSA 4IYQA 3S3MA 2CXEA 1P6TA 4LBIA 3DAWA 4LRAA 1XHZA 4TSXA 3GYXB 2LFVA 1HI8A 2CPFA 4LREA 3E51A 3IN5A 3DLLL 1QQOA 4Z0UA 1ZAWA 2NXEA 2OSRA 3P39A 2OO4A 1H73A 2GIQA 4HDHA 1C0GA 2F4VF 4OKKA 3CXCR 2VH7A 4DEZA 2BW2A 2LCWA 3EO3A 1YVUA 1IJEB 3VQ7A 1IBCB 1HNZK 4NXMJ 3PYDA 1HX1A 3P1GA 3HD2A 4JI1K 1UOCA 1FRLA 4OI2A 3MAAB 4WZMA 3FFKB 3NRBA 4OJ3A 4A8OA 3MR2A 3M4XA 1XMQK 4C8MA 1GK8A 3H90A 3T1HF 4ETXA 1ZS6A 1MMLA 1P9QC 5DJBA 3CCUN 4LFCJ 1I6JA 2QTWA 2ALYB 1RWKB 4JLHA 3A0IX 1QAYA 3KLIB 3QEIA 3POTA 3I56N 3D7EO 3Q8YA 1G99A 3CDEA 3J81j 2BABA 2OEMA 1RACB 4K4TA 2B8QA 2VG6B 4RL1A 1J5EJ 2A42A 4DSEA 2P9UA 3DU6A 2BE2A 1YXQA 1VSJA 4TLRA 1NXIA 2JH3A 4IDKB 4FJLA 1LWEA 2BUPA 1O6XA 2O8CB 4C9DA 1R59O 4OYWA 2V4RA 3QFPA 3HZ6A 3MECB 3BEXA 4K7QA 1UAXA 4WP3A 1UAWA 2LKZA 4J9MA 5THWA 3Q24A 2E5LJ 2CPHA 2XZWA 2RPIA 1JB0C 3D1HA 2ASOA 5L1LA 2CRLA 2V8HA 4DG1B 1FKAF 4FPAA 3A3PB 4URGA 2DNOA 4BRMA 1WJ9A 2R7YA 2WBMA 2J0XA 4N77A 4NYPA 1B92A 4NL5A 4MLHA 4C3LA 4OI0A 3CIPA 2W2QP 2OPSA 2C2ZB 2AEJA 4E7LA 1Q5YA 4CESA 3NXZA 3SUQA 1VQON 3CJQA 5EN1A 4FM1A 4OZ2A 5KFQA 1U48A 4LFBJ 1WI6A 5KG7A 3MXIA 4FXVA 3RB4A 3OYGA 3B6OA 4P72A 3MK6A 2KXFA 2YKQA 2BDPA 2FVPA 4GKJF 2KG1A 4JI4J 1OYEA 5KG5A 4B1YB 1S3XA 1FRHA 4B9QA 4QS9A 1HWUA 3E01A 1GXUA 2KLAA 3HKWA 3E66A 3GOIA 3UD5A 3TX8A 3D0IE 3Q23A 3MN5A 1U1NA 3OYKA 3QEWA 4CF8A 5G4DA 1NNDA 4HHJA 2YQ0A 5M1OA 2NXNA 2RE2A 3A8JA 5I42B 3DCAA 3OV7A 3CQXA 1FESA 1KOOA 1VQ5N 2KRBA 3KLFB 2DR6A 1HWIA 5LJ5Y 1IKWA 3NE6A 2UXCF 2CH5A 1S6QB 1BHNA 2Q79A 5DDQC 4X66K 4B08A 3AJ2A 2BJ8A 1JJ2M 3UKRA 2QWMA 2J6SA 5LJVA 5T7LA 2OELA 4WFXA 3TX0A 3AB4B 2UXBF 4RW4B 1IG9A 5KAKA 4RR5A 1Q16B 2HBYB 2CWKA 3V6HA 1ZPWX 3H46O 3H08A 1WSRA 4TYAA 1JKHA 3I87A 2I6WA 3MWTA 1YK9A 3EM1A 3K2YA 4LC9B 1BWVA 5CABA 3KK1B 3J7AP 2R9LA 4JKEA 1F1BB 2OI2A 1JLGA 4QQBA 1RZMA 1JCGA 4V19S 1R7IA 2PSZA 1LCUA 1FE0A 1RTHB 2D0OA 2JGUA 3ZSWA 4YUDA 4A2BA 3QIPB 3CMAN 1T03B 3DHWC 2MQLA 2N7CA 3AXMA 1BQXA 2YH1A 4A5AA 5HJYA 1U2CA 4JI2J 1N34F 2EPIA 2RF2A 3ZX2A 1R6VA 2W2MP 4FJMA 4HHTA 2G0JA 2LYVA 1AZSA 2IVFB 3B8AX 3F73A 2OH2A 3UVJB 3AXKA 3ASMA 1AA1B 3QICA 2DR7A 4LJMA 2PE8A 3FMWA 1QLNA 4H8KA 1QAXA 2ZEJA 4LQ3A 6FD1A 3D2FB 4IOCQ 1UMJA 4WFNL 1YITS 3HHNB 1LAWA 4FPIA 2PO4A 2G8VA 4CIOA 1KC8O 4LRCA 1B7FA 3KLGA 2CPXA 4OQJA 4YOWA 2OSQA 4HVJA 1H1VA 1NZAA 5A8RB 1BQMA 4OFZA 4QWBA 3NMUA 3I56S 3OW2M 4M5HA 1P1TA 3FSYA 5KFRA 1XMOF 1W7WA 1RTDA 1RDAA 5F9NA 3FCWA 1CG2A 2POKA 4XPEA 1XHXA 5KQDA 1SV5A 2HMPA 5KRSA 1QUPA 4DV3J 2LXIA 4ECTA 1VC0A 4H5WA 4NLGA 4FZVA 2B6AB 1GLFO 1HBMB 5HBMA 1NH8A 4CI0B 3O9SA 5KOXA 1NGIA 4IEEA 3QGIA 1QSSA 1WSEA 2QX0A 2ZH2A 4J9PA 3DKDA 1GOAA 1CJKA 4LH4A 3NAEA 2XMJA 2HHQA 5CA5A 2ITMA 4Y2AA 5F9LA 2WB4A 2H5JB 1E6VA 1U24A 2A2CA 1UVNA 2DRBA 3V1QA 2XCPA 4Z4IA 2D7SA 1XMQJ 2HSTA 1QD1A 1VQOS 1FT8A 1SB6A 5AXMA 5EY4A 3UE2A 1KS2A 4GV6A 2AJ0A 3GWCA 3FZKA 5AR0A 4K0KK 4DV6F 5SWMA 3D4JA 2DNHA 1ZBLA 4OX8A 4I2QA 3CTRA 1BI4B 4M41A 1FRIA 4K4ZA 1UFLA 4OX9J 1RHRB 4ZTJA 2E5IA 1YZ6A 1AB8A 2HVHA 5J2MB 3H25A 5HVGA 2CNLB 1WWHA 3M9NB 1HLUA 4FKXA 4LF7J 4FJIA 3D6TB 4F8RA 3OVSA 5D6GA 3H2VE 4H54A 3CJ0A 1I3AA 4C8OA 1A6LA 2Q1NA 1IJFB 2VG7B 2CZ9A 4ECRA 4JKGB 3AB2B 1ZBSA 3HHEA 4QR2A 3LW5C 4CZCA 4NLSA 5D0EA 2F63A 4CJFA 2HGNA 4D3GA 4LRDA 4PKDB 2DEJA 2R7WA 4RU9A 3ET6A 3DM2A 2HNZA 2RE1A 1H2UX 5TKYA 3KDOA 2QWPA 4OHWA 4FWLA 3B8HA 4ZVOB 2WRMA 4X62J 3MTJA 1GOBA 3PFEA 3OFHA 2V2KA 5CD4H 3NP5A 3D68A 1K9MO 4DBQA 3M9MB 2HF3A 1V5VA 1VBKA 3ULHA 3NLCA 1B0PA 5KFEA 3AA9A 4U96A 4DPTA 4NYNA 1FKPB 4JKAA 2BJDA 3J7YI 1APSA 4I56A 1BA0A 2HBJA 3MR5A 2D0PA 4UY8O 1L3SA 1FDAA 2D0BA 1RHUB 3GR0A 5HROA 4FVCA 2IY5B 2JSXA 3FGVA 4DL5A 4CZLA 1VJWA 1G1XA 4CTAA 1WELA 5KFSA 4AQYJ 4DR7F 1NK0A 2P9SB 3NHGA 3CMAS 4K4YA 1BQNA 4KHPJ 2ZKUA 4BG9A 2B9EA 1IBKF 1GT8A 2AU0A 3RBZA 4OV1A 1Q82T 4PUOA 4X84A 4PAAA 2MKIA 3CULA 3CNQP 2R7SA 1ROFA 4P74A 4B3TJ 2YJFA 4CO0A 5HK4A 3D3CJ 2E7WA 1I5OB 2R2SA 1SUQB 2P6TA 3CC2N 1S7IA 4WYBA 2D9PA 1NGBA 3SLCA 1RTJB 1RT1A 3JQMA 4H0OA 4ZVTB 1U02A 3KHGA 3VQSA 3E2EA 3MM7A 3VESA 4CZEA 4DR5F 5J1PA 1HBNA 2HHHF 3AOAA 1U7LA 3KHLA 1EWRA 2LLZA 1ACMB 2AQ4A 4WPAA 1JXBA 3AD9C 4IRDA 3OD2A 5BN9A 1GQEA 2G8IA 4KH1B 5MLCQ 2KVIA 2CDRB 1GOCA 3QGGA 2V0NA 1NCLA 4NRTA 1ELOA 2J7UA 4NYZA 1CVJA 3PLAA 2ZH5A 4IEIA 2AKWB 2XY7A 3HPOA 2OPRA 4XEIA 2M70A 2CPEA 4DV0F 5JVHQ 3C66A 3TJAA 2RRBA 4DFMA 1XNRF 4DTMA 4DX8H 2IDLA 2QWQA 4ATNA 2DITA 3CJ3A 4K8XA 4KQZA 2OZMA 3QJPA 1RA7A 4QYZK 1VLOA 1WOQA 2RQCA 3BO4A 4DQ8A 1EP4A 1B0VA 1SJQA 4FWRA 1ASWA 2PEHA 5F0UA 3G6VA 3M3ZA 3SBMA 3OTEA 4C0OC 2K3KA 3KHRA 1NOYA 1OSDA 3J7A1 3HX9A 4ZA1A 2MXYA 2DJWA 3D45A 4B3RJ 4KV8A 2ROEA 3KDNA 2IBOA 4Q44A 2EFOA 2MEWA 2KM8C 1TKXB 4M1KA 1T9WA 1BHLA 1NZ8A 2KHDA 8ATCB 2XLJA 1I3OB 4DR4J 3T1AA 5CR4A 2AYGA 2V4JA 2JRSA 2PMWA 4H0VB 4JP8A 4DSFA 4M95A 2DGSA 3RYLA 2CQPA 3N6MA 2OPPB 3CCMN 1JL2A 4TU8A 1RHMB 2RB7A 1R3NA 2A18A 1KVJA 3OS2A 4C97A 1RT7A 2VGMA 4NLBA 4E1MA 3QEVA 1UEUA 3KFWX 3M8PA 5J2QA 4CRJA 3V9UA 4DV5F 4LR9A 1FDDA 3OSNA 4BHQA 2CQCA 2HW3A 3LAMA 3PW2A 3MMCB 3EYZA 3L7OA 2V51B 2ZITA 3MPVA 2BYCA 1U1OA 4LF6F 2ASYA 3M32B 4JRPA 2FHMA 4CHZA 3L4IA 2CVEA 3V2UC 1U1PA 3KMSA 1VLYA 2K7JA 1CJUA 4ZJLA 1JWWA 2YNIB 1RDWX 3H7HB 4CJVA 1TL1B 2Z1HA 3OFGA 4G3IA 3GLJA 2ASMA 3QT7A 1SKWA 4QU6A 4BC5A 3SBGA 4B17A 1HD1A 4BC7A 5GADP 2NYHA 2V94A 3WNHA 3KKRA 2XTJP 2YX7A 3HDSA 4JD2A 2ATLA 4CECA 4R25A 2EVZA 4JI7K 1DTQB 2MSTA 2IC3B 1OWXA 1WBDA 1F3FA 2HHVA 2CFXA 2W7PA 2V68A 3VQ5A 3Q8VA 4RUBA 2GGPA 2IVYA 1LXJA 2VDHA 4DU3A 3I0SB 3KLHA 5F8LA 4S0MA 3H0PA 5HL7L 1YIJS 2P9EA 2E6LA 1Q78A 2XY8A 1RK8A 5C7PA 1WKKA 1N88A 2HBRB 4LF9K 2L3MA 3ATUA 2HFZA 1HI1A 1HD0A 1IR0A 1JL1A 3SDEA 3AARA 4IRKA 1S1TA 4BDPA 4BLGA 2YQ1A 2CNNB 4H0TB 2YX1A 4WFNQ 4FZXC 2MZTA 4B3SK 1KD1T 1Q53A 3DMJA 1FW6A 4B8AB 3PTWA 1YTUA 3IR7B 5AJ3J 3SFUA 5IC4B 1NJWA 2YBVA 4P9SA 4DL2A 4JI6J 1HBUB 3IWLA 3IKMA 1NSQA 5M1NA 5AE2A 2AGOA 2QLBB 2FJBB 3SFGA 3DDNA 3VEVA 4DCHA 3THVA 2FC0A 2Z2LA 3TJ8A 1DFDA 4X65K 1VQ4N 3ZETA 3GDQA 3KNGA 1YVFA 3DRSA 5FPDA 5CYJA 3VERA 3AJ1A 3CXCM 3BQ2A 1IQZA 2PFDA 1SKRA 1H38A 4NLRA 1ASVA 3HHLA 4EP4A 2KFYA 1HNXK 3OYBA 3WEEA 3PX4A 2HHPA 3SBTA 4F3OA 3L6QA 3FSIA 4DN9A 3CIZA 4ELVA 2XYGB 4OYXA 3MM9B 3LDOA 4OLBA 4QIVA 3MAHA 4FXDA 2EFVA 3P4IA 5E3CA 4CJ7A 2YNHB 3NVKA 2A1RA 1ATNA 2BM1A 4RX6A 4M42A 4J9SA 3AAWB 2E88A 2E5JA 3HK2A 3SCXA 4B9TA 1YKWA 3HZEA 4MK8A 1DEJA 3CMEN 3TO8A 1RWVB 4BC3A 2H4WB 4ZK7M 3SCKE 1ZYQA 3OYMA 3O4NA 2XSJB 2W7AA 5DRKA 3E3XA 3I96A 2OIHA 4XPCA 1LW2A 4Z4HA 2MLZA 3C7NB 3THPA 2MGZA 1KR4A 2ZJQQ 4BRLA 2Y1JA 1IKVB 2QGFB 4WXOA 2WTUA 2GC8A 3O08A 3NDKA 3W60A 3LAKA 5C25A 1JLEA 3PFOA 4HEA9 1PBUA 4IH5A 3E9OA 4DL6A 5E33A 2WZ1A 4OPHA 1ZBTA 3OYCA 4C8LA 3CCVN 4H5VA 5LMUK 2AYEA 1DHMA 3SQ2A 2MQ8A 2VPZB 4ILMA 1N5YA 2PD1A 4FNIA 1Y64A 4V19X 5D4LA 5T14A 3QJLA 2VQFK 3KK2A 3IO1A 5HI7A 1RT3A 3SPZA 2MJNA 1WSJA 2E44A 2O01C 4CM0A 3MR6A 4ALZA 2C22A 3FBBA 1T44A 3DJCA 3O3LA 6FDRA 2CYYA 1ZBHA 3NAHA 5DM7L 2MLXA 2YHBA 3A8KA 5D4PA 3LZIA 3R1HA 1JMTA 2F8EX 4LRBA 1AFIA 2KI2A 3G10A 2J8AA 4LSNB 2ZNZA 4EAHD 3FC9A 4Z2XA 2V67A 3IUCA 4ZPVR 1HKBA 2D1CA 4ZCLA 2VYPA 5E84A 1QZ5A 3HP9A 4DR6F 2IIRA 3JS6A 2AJ4A 5B0CA 1K8AO 4CF2A 2AJQA 2P9UB 1DY3A 2Z2ZA 4ZMMA 2YCHA 5IC6B 4M7XA 3R27A 4Q0BB 4K4WA 4EMDA 2MQNA 3HULA 1KQFB 1Q81O 3QFHA 2H48B 3PIOL 4PL8A 4ERDA 1BU6O 2VCPA 4JI5K 1SC1B 3HHDA 2MQOA 4EK2A 4C8KA 2OTLN 2EXUA 1SJ1A 4WTOB 3BSOA 1UA0A 4IFEA 5GINA 1N36K 3NCRA 4EFAC 3UR0A 1Z6RA 2VG5A 2RDJA 4JI3F 1RDUA 4PHTX 4K50A 2RU3A 4FJ9A 3AAQA 4E98A 3Q8QB 2DK2A 2JWLA 2OPSB 1VQ4S 4JI7J 1WEZA 3TWHA 1KHWA 1M5VC 2VICA 5BPNA 1Q86T 4MLEA 1NHVA 4HT7A 3LPEA 3I4HX 2FVSA 4ZCIA 3FZMA 3CDUA 1OIAA 2O8EB 5AZJA 3O9UA 5D15A 1UWBB 3K17A 5KQ8A 2VA2A 3BO3A 4FZZA 2RH3A 2C2MB 3GFXA 1C0FA 3B54A 2ZM6J 4FM2A 1NSAA 4FJ5A 4GKKF 2X3GA 2MKJA 4MFBA 3GV7B 2XWXA 4NCAA 1EB0A 3MUVP 2P9IB 3I0RA 2W9BB 3HTVA 1IUJA 3M8QA 3TJ9A 5CCLA 1XI1A 3T69A 2KM8B 2YKPA 5EWFA 4GMKA 2WOMB 1RWNB 4K4UA 2HBQB 2XHBA 4AUKA 8AT1B 5ETLA 2P6SA 1WC4A 3CQYA 2WVBA 4QW8A 4ED1A 1FERA 2HWIA 1XNQJ 5IOLA 1B70B 2IGIA 3DLRA 1JKHB 3LDPA 4CI6A 1NDPA 4CJWA 1FX4A 2K1RB 1S1VA 2P5VA 1S57A 1WDDA 3DRPB 3IRXA 5HN0A 3ENBA 2OD4A 3PRBA 4ZVPB 2AX1A 4Q45A 3RW6A 5HRPA <