1S6PA

Crystal structure of human immunodeficiency virus type 1 reverse transcriptase (rt) in complex with janssen-r100943
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 124
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s6pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s6pA05
4DTMA 2IC3A 4QPXA 4RW4B 4BE2A 1S1UB 1S1VA 2AQ4A 4BE0A 3KK2B 4KHRA 4AHCA 5J2NA 2WOMA 2D0CA 1EX4A 5K14B 1HARA 2HMIA 3KLVA 1SKSA 1YTUA 4LSNA 3PX0A 4ZVHA 1WAFA 3THVA 3N6MA 5F8MA 3OY9A 2KZZA 3JSMB 3EZ5A 4FLWA 4J2AA 3NKYA 4ECTA 4DEZA 1U4BA 2X74A 4EP5A 3BJYA 1EETB 2HNYA 4EO6A 5HROA 2G8VA 4CFBA 5J2MB 1FKPB 1S0OA 2IBKA 2JEGA 5HRSA 2XC9A 3SQ2A 5CYQA 1GX6A 4Z4FA 3PW7A 3ZSRA 1TV6B 3TANA 4IR1A 2BQUA 3DRSB 2C2RA 3T1AA 1HRHA 3IGNA 1XI1A 2BRKA 3KLEA 5DQGA 3MXMA 1RBVA 1BQMB 4Z4GA 1WSEA 3M8PB 3G6YA 1JLCB 3VQAA 1Z25A 3CVKA 3RB3A 2D5RA 3B6PA 4FBTA 2QKKA 4HUGA 2FVQA 4AHRA 4ELTA 3K5OA 2V9WA 3VA0A 4FCYA 1QSSA 3VQ5A 2YNHA 2HNZB 4IRCA 3AO3A 3QYYA 1U04A 5KG6A 4MH8A 2HWHA 2G8WA 5KFFA 3IS9B 3UR0A 3ITHA 2V4QA 3VQPA 4CGFA 4F3OA 4K4XA 5KFVA 3LANA 3NF9A 1XWLA 1T03A 5KI6A 2RDIA 1LAVA 2B6AA 2WCXA 5EWFA 4G3IA 4BWMA 4N41A 4MKAA 4CIEA 3V6JA 4LSLA 4R0EA 2R2UA 3H5YA 3AVMA 1ZBUA 1MMLA 4WZMA 4H4MA 2J6UA 4W5NA 5C24B 4Y2CA 1T8EA 1BI4B 2VWKA 4CF9A 3Q8SB 5DLFA 1JXLA 3B6OA 4RW8A 1C0MA 4W5OA 5HBMA 2UVVA 3OYAA 5KFJA 3QEIA 4PWDA 4KB1A 3FFIB 3CIZA 4E89A 1NKCA 3TAEA 1ASUA 2IC3B 3CJ5A 1S1VB 2AGPA 4YMEA 2JC1A 1RT2A 1WAJA 2J6SA 4QW9A 5F8IA 3CFRA 4O44A 2HMIB 2RKIB 3OVNA 1SL0A 2G8UA 4LSNB 2QXFA 2EC0A 1NNDA 5J2PB 2BQ3A 4CGGA 3H5XA 1WLJA 4XO0A 5KG0A 4J9LA 2I5JA 2EHGA 3DRPA 4O0IA 3EYZA 4H8KA 4E7LA 4M41A 5EUHA 4ED0A 2HNYB 4EZ9A 4IDKA 5HROB 1DTQB 3AO1A 4PY5A 2AGOA 2R2TA 4EP4A 1SV5A 3I0RA 2AX1A 4OKKA 1SL2A 3NF7A 4DQPA 4JV2A 3TQ1A 3RTVA 4Q0BA 3LALA 1RTHB 4H4OA 4K8ZA 5CYQB 4CFCA 3OYNA 1NK9A 1JL2A 2VG5A 5DLGA 1X9WA 4KPYA 2P1JA 2F8SA 2HW3A 4RNMA 4FJ5A 1ZBHA 4IFYA 4B9LA 5EDWA 2IJNA 4ZVEA 2VA3A 2KFZA 2R2RA 4KO0A 1BHLA 5KRSA 4ED2A 2D0BA 3O3HA 4NLPA 1N4LA 4CEEA 2YNHB 3QNOA 4FW2A 4AHVA 3OLAA 2W8LA 1NOZA 2HVHA 2PYJA 2BRLA 2Z1IA 4MQ3A 2JLEA 3MAQA 3ITHB 1REVA 5KG7A 3PR4A 1BL3A 3HP9A 4NLQA 1TVRA 3PW5A 3RBDA 1S9EA 3MEEB 1WSHA 3MFIA 1T03B 3OL7A 5KGWA 3LAMA 2JEJA 4J9KA 2B6AB 4CK2A 1TKZA 3MTKA 2ASJA 1KCFA 1I3AA 3RMBA 2VG6B 4E3SA 2ILYA 3PHEA 2YHAA 3NBPA 4LSLB 2C2DA 3RR8A 2WB4A 1S6QA 1UA1A 4H4MB 4B3OA 2W9BA 4FS1A 5KGXA 1YT3A 4CJSA 3DLHA 3Q8RB 3QNNA 1JLEA 4RW7A 4RW8B 5HBMB 3AVJA 4PWDB 2YNFA 4ECRA 4KSEB 3SQ1A 4CFAA 4TYBA 1SUQA 3BSNA 3KNAA 3KTQA 1L3TA 4OL8A 4KTQA 1TL1A 5DQIA 4LQ9A 4DTJA 3TABA 2FJVA 1RT2B 1XR7A 1J9AA 4Z4EA 3CFOA 3KLIA 4O44B 4KB0A 5CYMA 5J1EA 3SFUA 1VRUA 3HHKA 4CECA 1KLMA 3DRRA 3P1GA 4F4YA 1L3VA 2UUTA 4ED8A 2I5JB 2Z1HA 3ZSYA 4KHWA 2AGQA 3BDPA 2IDOA 4DTXA 4IDKB 4BDZA 3HM9A 3HPOA 5DQHA 2FBXA 3OJSA 3BREA 2E6LA 2YKNA 1SV5B 3I0RB 4RU9A 4Q0BB 4TY9A 4NLTA 3LWMA 4H4OB 1VSJA 4W5RA 2BGGA 3KLHA 3V9SA 4WYLA 1LAWA 3RRHA 5I42A 4OPKA 4F4ZA 3P5JA 2F96A 1RCHA 3SUQA 4KV8A 4BDYA 2D3ZA 1RTDA 4CJ3A 4ZPBA 2RDJA 1LW2A 3ASMA 4DL7A 1FXXA 2XY6A 5KFQA 3AVHA 1NK0A 4IFYB 4RUAA 4DU4A 4CF1A 3SJJA 4KO0B 4CJEA 1Y97A 4C8LA 3M9MB 2R8HA 4URQU 1JLAA 2KZMA 4HCBA 4CGDA 4ZP7A 3AO4A 1UWBA 3S9HA 1LWCA 5KFYA 2BDPA 1IKXA 2B43A 1REVB 1Q8IA 1VSFA 4DL5A 3AA3A 2WK4A 1S9EB 4RW4A 2JEFA 4CGJA 1S0MA 4E1NA 4O3SA 2IOCA 4KHYA 1TKZB 5F9NA 4ZMMA 1JKHA 3MECA 2RF2B 4CEFA 3OHBA 3NBPB 1JXEA 1RDCA 4IRDA 4F2RA 1S6QB 4AILC 4HKQA 2QK9A 2W9BB 3O3GA 3CJ4A 4DL6A 4K4VA 3L3UA 4CF0A 4O3PA 1JLEB 2HNDB 3E01A 1KRPA 4KTZA 1EETA 4DFPA 3M9OB 2E9RX 5HP1A 3KK1A 3RMCA 1SUQB 4ECQA 1TL1B 4WXOA 3AVBA 3CJ2A 3DLGA 1RDDA 4LH4A 4RG8A 1B92A 1T7PA 3S3MA 2IS3A 3KLIB 4ZHRB 4ICLA 3DLEA 3OYDA 1NJYA 5CYMB 5J1EB 1ZYQA 1RA7A 3GIKA 3DMJA 1RBSA 3ICLA 4NLRA 2UVRA 4KRFA 1KLMB 3DRRB 4CIGA 4C8NA 1JLCA 1YTAA 4IG0A 2W8KA 4KBIA 3DLBA 1BIUA 4O3QA 4ELVA 5F8JA 1X1PA 4Q45A 3Q8PB 4FM0A 4FBUA 4AHTA 4ED6A 3ULDA 1Z26A 1NK5A 1SH0A 2YKNB 5SWMA 5KG5A 3CM5A 1RBUA 3TAPA 1VSHA 1T94A 4ZPCA 3KLHB 3IS9A 5KFHA 4WFZA 1K1QA 5I42B 1NJXA 2OH2A 3VQDA 4KV8B 3T5JA 1RTDB 2ILZA 1RTIA 5L1JA 4O4RA 1LW2B 4B9UA 2XRIA 1CZBA 2OYQA 3Q8QB 2JEIA 1NJZA 4RW9B 4KHNA 1NK4A 3BSOA 4E0DA 2DFHA 3SNNA 3NAEA 4KI6A 4K4YA 1JLAB 3V6KA 2C28A 3CWJA 5L1IA 3WNFA 3PW4A 5KFPA 5J2QB 2G8HA 1WNEA 4FLYA 1IKXB 3PX4A 5L1KA 3N6LA 3GILA 2UVUA 3CG7A 2ATQA 2Z1GA 4OLAA 4DS5A 4CHNA 1T3NA 3V6DA 2FVCA 5KFAA 3E51A 3KKRA 1U49A 4IG3A 3AO5A 4CHOA 1JKHB 1LWEA 3LP2B 4Q44A 3MECB 2RKIA 4J9SA 3TVKA 4Y2AA 5J2PA 3AV9A 1B9FA 3VQSA 3ZSWA 3DOLA 4M94A 2UUWA 4ZP8A 1ASWA 2DY4A 1C2PA 3UPFA 1S97A 4FK2A 3E01B 2IAJA 3CJ3A 3OYKA 3TI0A 3MXJA 1DTQA 5HP1B 1IM4A 3KK1B 4IFVB 3KHLA 1ZETA 4NLVA 3H4BA 3M8QB 4WYWA 3PZPA 3JYTA 4IKFA 1JIHA 3RB4A 4KHQA 4QWEA 1RTHA 4M45A 3DLGB 4JRPA 4FJGA 1HYVA 4FLVA 1HNVA 3QO9B 2R2SA 1QAJA 3AVIA 4ECXA 4GW6A 4ICLB 3DLEB 4NRUA 3K2PA 1RYRA 2A1SA 1C6VA 3CQ8A 3DLRA 2GIQA 3DMJB 1EKEA 1F21A 5L1LA 3PUFA 4ECYA 1W25A 3OS0A 3F73A 3NHGA 5T14A 1VSKA 4IG0B 4FK4A 5KFKA 3G6XA 3LPTA 3L2UA 3HVTA 3I8DA 2XI2A 2NUBA 3VQQA 4WZQA 4ED3A 3NF6A 3ZT2A 4OKJA 4F8RA 1KFDA 4C8MA 2FVRA 5FRNA 2GC8A 3PJXA 3AVFA 3CFPA 3SI8A 3BSAA 4K4ZA 1HQUB 2R8JA 4DQRA 1S9FA 4U6PA 5KFOA 3QIOA 1XR5A 3MEEA 1RTIB 4MIAA 1QAIA 3IN5A 4DSJA 3OYCA 2FLNA 1LV5A 2C2EA 4ZTJA 3MR2A 4MKBA 2VG6A 1BGXT 3PR5B 2YKMA 2YNGA 3A2FA 4RNHA 3U6FA 3FRZA 4KAZA 2DPJA 4LQ3A 1NK6A 3MR3A 1QTMA 2W7PA 1TKTA 1BISA 1X9SA 1GX5A 4H54A 4KE5A 3OYMA 4C8KA 3NGYA 4JUZA 4O3RA 4OGCA 2O5DA 2ATLA 3OL9A 3VQ4A 1RT7B 4KKOA 3C94A 3T3FA 1KVAA 1TKDA 4DFJA 3QZ7A 4WXWA 3V6DB 2Y1IA 1XC9A 1T05A 3NAIA 3TR8A 4IG3B 1W9HA 4CHPA 4QWCA 1LWEB 3KJVB 4K50A 3MR6A 2W9CA 3U3GA 4DFMA 2XHBA 4Y3CA 1C0UA 3HSTB 1YVFA 2XWYA 1JLBA 2DFEA 5CZ2A 3DOLB 1GOAA 5KFLA 4R8UA 5KFMA 1WSIA 4FJMA 3HT3A 1D0EA 3HPHA 2IAJB 3OYIA 4WFYA 3D28A 5JS2A 3T19A 1L3SA 4NLDA 3RMDA 3HPGA 3H08A 2IMWP 3JYTB 1W0HA 2WHOA 4UQGA 1JLQA 3K5LA 2X6SA 2KQ2A 1HNVB 5KG4A 5KT6A 2QE5A 4CJFA 4M3ZA 1KSPA 1FKOA 4CEBA 4CHZA 4ECUA 2RN2A 1S49A 4DLEA 4IH6A 4NCAA 1QS4A 1QSLA 1HMVA 4KFBA 3AA4A 1ZTTA 2D41A 5KFTA 1LWFA 1A5VA 3AVCA 4CJUA 3OYLA 2P51A 4AHSA 3OSNA 4CJRA 2AU0A 1XHZA 2XGPA 3NCIA 3IAYA 3VQ7A 3HVTB 1JLGB 4EYHB 3I5AA 3HK2A 1NHVA 2KTQA 2IM3A 3N6NA 3NMAA 4IKAA 1L5UA 1D1UA 4YP3A 4W5QA 4DQQA 4I9QA 4TY8A 4XIUA 2ALZA 2G8FA 3NH0A 2PYLA 2A1RA 3RBEA 1BCOA 1R0AB 4PUOA 3RB6A 2VG7B 3OYHA 4TN2A 4J9NA 4F4KA 5KG1A 2ASLA 4I2QB 4O55A 3OYJA 2UVWA 2B4JA 5C25A 3OYBA 4MK7A 1X9MA 1FK9A 3DI6A 2FBVA 4PA1A 2RF2A 2YKMB 4YQWA 2YNGB 2XY7A 1HQEA 1DTTB 3PY8A 2BANA 1VSIA 2B5JA 4M3UA 4IH7A 2J6TA 4R5PA 4CJKA 4X2BA 4EO8A 3GIIA 3M8SA 1TKTB 2HNDA 3KD5E 2F8EX 4Z4IA 1QSYA 1U47A 4KKOB 1JLFB 4F50A 2ZQBA 1TK0A 3AO2A 1RA6A 3PO5A 3ALYA 4DSKA 3H40A 4BDPA 3VA3A 1BCMA 1T05B 1S9GB 3BQ1A 3DOKA 4ZHRA 4ECSA 5DG7A 2R8KA 4E19A 4E7HA 4B9NA 3MR5A 4EEYA 2W9CB 1U45A 3O4NA 1RT1A 3LAKA 4PQUA 1UOCA 1C0UB 3AVKA 4ID5A 1JLBB 4GC6A 1CZ9A 1WSFA 2FBTA 2IM0A 3TWHA 1NJWA 3QEXA 4R8UB 4F2SA 4DS4A 4OKEA 4LD0A 2FJWA 4CJVA 5JS1A 4BE1A 4B9MA 4DMNA 2OZMA 4B08A 4TLRA 4K4TA 1ASVA 4TQSA 1JLQB 3KLFA 4CF2A 3BGRA 1FKOB 3L3VA 5DGBA 4Q8EA 3EY1A 3ZT1A 2OPQA 5KG3A 2QKBA 4CERA 1TK8A 3EPIA 1S5JA 2W7OA 2JGUA 4QOZB 4N76A 1HMVB 4KFBB 2FVSA 5CY4A 1LWFB 3KKSA 4JLHA 3M8RA 3TAGA 3RAXA 2P5OA 4RW9A 3TARA 2PZSA 3L2QA 4BWJA 4DU3A 2E6MA 3CO9A 2GIRA 3ZSQA 1VSLA 1IO2A 3NE6A 2ITGA 3V9XA 4TXSA 3KHGA 4TY8B 5J2QA 4CJPA 5KFGA 4FS2A 3D0PA 3ZSVA 4PUOB 4O4GB 4WFXA 2O4GA 2W42A 1J5OA 3V9ZA 3GIMA 4IR9A 3HVWA 4QWAA 3GIJA 4Q43A 3KOAA 5FROA 3SFGA 4FXDA 3VQ9A 1ZTWA 4M3XA 3ZCMA 4NCGA 1EP4A 3ZT3A 3DM2B 5C25B 3ZT4A 4DF4A 3KMQA 3RR7A 1FK9B 3LP2A 3DI6B 1K1SA 3CDUA 4DF8A 1HQEB 1RAJA 3T5KA 1J53A 1N56A 2BANB 2B5JB 1WNSA 3NF8A 4R5PB 5DK5A 1SKWA 3AVLA 1CLQA 4OGEA 4DG1A 5I3UA 2AJQA 2PY5A 3HJFA 2V0NA 3OYEA 1HPZB 3LWLA 1HYSA 4M3WA 4IFVA 5FRMA 1S0NA 3H5SA 1DLOA 2XCAA 2XCPA 4FZXC 1TK5A 3M8QA 3O4QA 3K5MA 1JXBA 3DOKB 3QO9A 3G6VA 1Z4UA 1RT1B 1I39A 1RILA 4PQUB 1NK7A 3S3NA 4E1MA 4ID5B 1A5WA 2Z1JA 4NYNA 4AH9A 3G10A 4FYDA 1CXQA 3TAMA 1ITGA 4CFDA 3QGGA 3K59A 4N56A 4DTOA 3CYMA 3C6TA 1K6YA 3QLHA 1JX4A 3AVGA 4FK0A 5SZTA 1TAUA 3V81A 4QW8A 3VQEA 1S10A 4J2BA 3V9WA 3KLFB 4IH5A 3BGRB 1VRTA 3NFAA 3RAQA 2IJFA 1HQUA 2OPQB 2OPSA 1N48A 2WTFA 3C95A 3KK3B 2HHUA 4Q5VA 2ZE2A 4NRTA 2VWJA 3IG1A 4CJ5A 2YHBA 2P5GA 4I9LA 4Y1CA 1CXUA 4DSLA 1UA0A 2HWIA 2C22A 3UDLA 4ZP9A 1RT6A 3RMAA 1IKVB 4FJKA 3LZJA 2OPPB 4KAIA 2E9ZA 2FBYA 4M95A 4BACA 4CGIA 3MEDB 3OYFA 3ZSXA 3IGVA 3UIQA 3HYFA 3ISNC 4HVJA 3LP1A 1J5OB 4TYAA 1TGOA 3V1RA 1RT7A 1RT5A 3SPYA 3C6UB 4O3OA 1S48A 3BQ2A 4NCGB 1EP4B 1SL1A 4FLTA 3WNGA 3MF5A 4CEOA 2YNIA 3KJVA 1KLNA 3QERA 3SQ0A 3OSPA 4NLWA 1RT3A 5T7BA 3H59A 3DLKA 4HUEA 2OPRA 3NH1A 3TAFA 1C1AA 4DG1B 3SPZA 5I3UB 1S1TA 3NL0A 2E4LA 4DL3A 4ZVGA 1HYSB 5EWGA 2FC0A 1KVCA 1DLOB 3FQLA 4XPCA 5KFEA 3GV5B 4LY7A 4DTUA 3EPGA 2O4IA 1VSEA 4DSFA 3HXMA 4ZPDA 4DU1A 1NKBA 4FJ9A 4FJNA 3HKWA 4CJQA 3OHAA 3T5LA 3QEVA 2IM1A 3K58A 1C1CA 2YV0X 4HHTA 2XI3A 5KFXA 1KFSA 2DTUA 2HHXA 1RNHA 5KT7A 1WSJA 3KLGB 2IGIA 1TP7A 3QIPA 3VQ8A 3TAMB 5HRRA 4CJ4A 1D8YA 3HVRA 4FJ7A 1VSDA 4Z4CA 3KHHA 4CE9A 1JLGA 2WONA 3K5NA 3C6TB 4FJXA 3QLHB 4G1QA 4NLGA 1KVBA 4JS4A 2F8TA 1RDBA 3QINA 3M9NB 4Z4HA 4CHYA 3AA5X 4FZYA 3V81B 4RUCA 4M42A 4CHQA 4OVLA 1QHTA 1R0AA 1HNIA 1VRTB 1JL1A 2VG7A 3QEWA 3QETA 1OS5A 2OPSB 3HP6A 2AWZA 3K57A 4I2QA 3LPUA 5CZ1A 5KTQA 2ZE2B 3OLBA 3IG1B 3SUOA 4ID1A 2KW4A 3H4DA 1G15A 3IRXA 4MK9A 4ZVFA 4C8OA 2OZSA 1RT6B 1DTTA 1S1XA 4EBEA 1MU2B 1N6QA 4FLXA 4EBCA 1N5YA 5KFRA 4J9OA 3QGIA 4GC7A 4CK3A 3WNHA 4K4WA 3LP1B 3VQ6A 4NLYA 4CJWA 1JLFA 3L2RA 3WNEA 3I5BA 4CESA 1RT5B 1SH3A 3OL6A 1ZBFA 1C1BA 3ISND 3FSIA 2GBZA 4FZZA 4DFKA 1EXQA 2DPIA 3SV4A 3SCXA 5DG9A 4ED1A 1S9GA 2KFNA 3KD1E 2VA2A 4URSA 4J9QA 1U09A 2YNIB 3O3FA 3DYAA 1IG9A 3BQ0A 4TQRA 1RT3B 4MK8A 1TL3A 3V9UA 3P83D 4I2PA 1S6PA 3NH2A 4FJ8A 3DLKB 3NGDA 4J9MA 2OPRB 4OPJA 4IOBA 1S1TB 5J2NB 4OLBA 2WOMB 2R8GA 4O0JA 2GV9A 1XR6A 3SYZA 4NLXA 1I6JA 4CF8A 1NKEA 4DTRA 1KHVA 2ZKUA 2E9TA 5F8NA 4DQSA 5KT4A 5D3GA 2FLPA 1YVUA 4WE1A 2BE2A 1L3UA 4YR3A 1QQCA 4CEAA 4DTPA 1C0TA 4LH5A 3L2WA 1C1CB 2BQRA 2LSNA 1B9DA 3G0ZA 4E7IA 4DTNA 5L9XA 3QEPA 3QIPB 2JC0A 3QZ8A 4JRQA 4RNOA 3CM6A 1U48A 2WONB 2OA8A 1RDRA 3PV8A 3SUNA 4B9SA 4G1QB 4JS5A 1RBRA 5KFZA 2R8IA 3KLEB 3UQSA 4QWDA 5KFBA 3PW0A 3PO4A 4YR0A 1HNIB 4O4GA 5F8HA 3VN5A 4IBNA 4F4XA 3SI6A 4YFUA 4YNQA 4CJLA 4ECZA 1RYSA 4KREA 3AVAA 4Y34A 3HO1A 3I0SA 2CKWA 3U3YA 3CJ0A 4ED7A 4RNNA 4MFBA 3DM2A 4DSEA 4FM2A 1QE1A 4CGHA 3IRXB 2GUIA 1D9FA 1RDAA 4RW6A 3V1QA 1TAQA 3SUPA 3V6HA 1ZBIA 1S1XB 4EYIB 1N6QB 1SH2A 2D0AA 4FM1A 4B8CA 2FLLA 3OJUA 1N5YB 2ZD1A 1WN7A 4KB7A 3VQBA 1S1WA 1D9DA 3QGHA 3EZUA 4K8XA 1IKWA 3PW2A 3QESA 1HPZA 4U7CA 5FDLA 3LZIA 3D5MA 4ECVA 4HUFA 1C1BB 1J54A 3I5CA 3PJWA 4B9TA 4I7FA 1SKRA 4NLUA 4F4WA 3T5HA 4J2DA 4MIBA 4NZ0A 5DMRA 5JXSA 1RT4A 3FDSA 3DYAB 4O5BA 2Y1JA 4N5SA 1CSJA 5KT3A 2I1RA 1O1WA 4QAGA 1TL3B 5KFWA 1KHWA 2HB5A 4I2PB 1S6PB 2R7YA 4J9RA 1QUVA 4W5TA 4EBDA 4CJTA 3HVAA 3H98A 2FJXA 4FJIA 4OJRA 3LDSA 4JV0A 4Y1DA 3MEGA 4DTSA 2HAIA 4ZP6A 4M3YA 5C42A 2X78A 5F8GA 1Q9XA 4IRKA 3D45A 5D3GB 4WE1B 1IKYA 2BE2B 3V4IA 1RTJA 3DRPB 2W9AA 1LW0A 2Q3SA 4KTWA 3FQKA 3LP0A 3KK3A 1HJRA 4DWIA 1C0TB 3QIDA 2RPIA 4KHUA 4O3NA 3ZSZA 1XHXA 4E7KA 2IA6A 2VG5B 2ASDA 5KT5A 1BQNA 4CEDA 2D7SA 2EX3A 3OS1A 1NK8A 3GQCA 3L2VA 3OS2A 1IKVA 5JUMA 2OPPA 3GV7B 2HVIA 3RWUA 5KRTA 1TKXA 5HLFA 3SQ4A 4KHSA 3MEDA 2HHVA 4NLOA 1RBTA 3OYGA 4L8RB 5KFSA 4ZPAA 4F3TA 3I0SB 4Z0UA 4HTUA 3C6UA 4MFBB 3PX6A 3GV8B 5E41A 3RRGA 1NHUA 3LP3A 1QE1B 3OL8A 5F9LA 4RW6B 5HRNA 4ELUA 3ZT0A 3GYNA 4CIFA 5DG8A 1BIZA 5KFNA 4M3TA 2IM2A 1TVRB 3AVNA 1S1UA 2ETJA 2ZD1B 5F8LA 4URGA 4HCCA 4EZ6A 1S1WB 3KK2A 3NGIA 4J2EA 1IKWB 4N47A 5EU7A 1GOCA 2QV6A 2CJQA 3CDWA 5FDLB 5K14A 3NAHA 3AA2A 3ZSOA 2XY5A 4K4SA 5EWEA 3H5UA 4B3OB 4DSIA 4CEQA 4I7FB 4FLZA 3JSMA 2G8KA 5KFUA 3KHRA 4RW7B 4DQIA 1RT4B 3KMSA 2YNFB 3BR9A 5J2MA 2G8IA 5KFCA 1FKPA 5KG2A 4RZRA 4E7JA 1D5AA 3VQCA 4KI4A 3PVXA 4GVMA 4FJJA 4FJLA 1A5XA 2BR0A 3KLGA 1VK0A 4GMJB 1KTQA 2XGQA 4J9PA 4ZTFA 4B9VA 3RB0A 1TV6A 4NCBA 3SZ2A 3DRSA 2D3UA 3NGZA 3MEGB 5HRPA 1Q9YA 3KIOA 5C42B 1VRUB 3MXIA 4DL4A 2V4RA 3TAQA 1BQMA 2XY8A 3MFHA 2HHWA 3M8PA 3CDEA 4FLUA 1ZBLA 4QCLA 4K4UA 1IKYB 2WRMA 3V4IB 5C5JA 1RTJB 4CCHA 4FJHA 1LW0B 4JV1A 5KFIA 3F9KA 3SV3A 2HHQA 5DGAA 2DFFA 3LP0B 2FVPA 2HNZA 2HHSA 2X6NA 5KFDA 4FW1A 4RNFA 1TQLA 3G86A 5KT2A 3S3OA 4IQXA 1HYZA 4XPEA 1S4FA 3NDKA 3HL8A 3H2LA 4B8AB 3BSCA 1BQNB 4ECWA 1IH7A 1MU2A 1VSMA 4AHUA 1UAXA 3L8BA 2HHTA 1GOBA 4Q8FA 1TKXB 5HLFB 2XO7A 1WSGA 4DLGA 4NYFA 4CEZA 4NLSA 4M3RA 4TSXA 4CK1A 3V1OA 1NOYA 4DL2A 4QWBA 4NYZA 5C24A 1BI4A 3DDKA 4YR2A 4KHMA 2AX0A 1UWBB 1LWCB 4FVMA 3FFIA 4HYKA
chains in the Genus database with same CATH superfamily
2IC3A 3O9UA 5GAHP 4BE2A 1S1VA 4C3KA 4BE0A 2WC9A 4KHRA 3VV2B 2GHWA 1FKAF 5J2NA 3ETMA 4C11B 5K14B 1UVIA 2M8DB 4LSNA 5IWAK 5KPZA 1SBRA 5JICA 4USIA 2YJFA 4LVNP 5DM7Q 3J7YP 4EFAC 1U4BA 4CLTA 5TKWA 1CPZA 2DGXA 1SVDA 4EP5A 1EETB 4HTIA 4JI6J 4CFBA 1Q86O 5J2MB 3BBCA 4YEAA 2JEGA 4U67Q 1YUWA 4WTYA 3D0HE 4E98A 3PM9A 1DARA 1WF2A 5AJ3J 5JVHQ 3AOBA 3DHWC 1RDWX 4Z4FA 3PW7A 2RQCA 1TV6B 5AQHA 1NRKA 2BQUA 1HRHA 2QEXN 3IGNA 3VGUA 1N36K 5D8HB 2G13A 3IC1A 2LKZA 1K47A 2PSZA 1LXNA 4CZJA 5BR8K 3MCSA 2QKKA 4ELTA 4AHRA 2B8QA 2V9WA 3VQ5A 2YNHA 1RWMB 2HNZB 4IRCA 3NNHA 3AO3A 1WD6A 2V9KA 3RYLA 3DU6A 3BZQA 2GFFA 5IFMA 1I94F 3CF5Q 2RD5C 3CUNA 4YHHK 2AYBA 2AF6A 1T03A 5B7WA 5KI6A 2H48B 2RDIA 5K8OA 4OYPA 5EWFA 1BO5O 3DRXA 1YX2A 2NRZA 4CIEA 2ZWOA 3T1HK 2P9NA 2V4JB 5C24B 3G82B 1DZ5A 2QL5B 4CF9A 1JXLA 5AQGA 2UVVA 4KB1A 3FKBA 3CIZA 1Z6RA 5BXIA 5MAOA 5LM7E 2IA0A 4QPTA 3TAEA 3BUZB 1RAIB 1IUJA 2JRSA 2DB1A 2JC1A 3W9IA 5CZVA 4IO8A 2HMIB 2HQDA 3GU0A 4OPHA 2N4DA 4BR7A 4C4WA 2EC0A 1NNDA 2BQ3A 3H5XA 1TMMA 2I5JA 2UXDK 3EYZA 4H8KA 4E7LA 2ZHBA 2QN6B 2HNYB 2L9NA 3Q0AA 4EZ9A 3M3ZA 4BR0A 3R8YA 1DTQB 3AO1A 5ETQA 2DNGA 2AGOA 4JI6F 1SL2A 4AQYJ 3M32A 3TQ1A 5LMNK 5CYQB 4QIFA 2NYHA 4RPFA 3OYNA 3I6PA 3FBEA 5DLGA 4JYAJ 5AJ3F 2W2OP 1X9WA 1PJ7A 1WI6A 4ALZA 2CUYA 1T3VA 2J7UA 2IVNA 2CRLA 4S0MA 1PAEX 4IFYA 4B9LA 4DX7A 3QFHA 3R5CA 1YJNN 2YWGA 2YTCA 2R2RA 5B0CA 1CJUA 2L48A 2CQGA 4LT6A 3NS5A 2KT5A 3DNCA 1BHLA 4R0JA 5KRSA 2GMHA 1WEXA 4ED2A 5BRHA 4J90A 2DBBA 1NOZA 3CQXA 2V67A 4ILMA 4MQ3A 2DNOA 4DI6A 3R7BB 2ROPA 3ITHB 3DGPA 4DR1J 2F5GA 3AD7C 3GFHA 2CAJA 1S9EA 2C2MB 1WSHA 3MFIA 4OZ0A 2BJDA 4H0PA 1Z1ZA 3LAMA 2JEJA 2MKIA 2UXBK 4F0MA 4CK2A 1Q16B 4CZFA 1EJ7L 1GT8A 4FPBA 2L41A 2ILYA 2C2DA 1S6QA 2G2ZA 1RLDA 1KVKA 3TPQA 1R27B 1YT3A 3DLHA 5B8HA 8AT1B 3QNNA 3R1HA 4CO2A 3G6ES 5HBMB 4QZVB 4KSEB 3D1HA 3M2UA 4FZVA 3KTQA 1L3TA 3EL2A 1PSDA 4OL8A 4LQ9A 4DTJA 3CB4A 1B70B 2M7SA 4KRWA 3AH6A 4QIGA 1RT2B 1XR7A 4C97A 2JWNA 3IWNC 2NXCA 3TSQA 3HOTA 4BRLA 2P9LA 4LMZA 1YI2N 3PIPQ 1O8BA 1WC1A 4PXCA 3QWPA 2LQ9A 3VR1A 3P1GA 2Z30B 4F4YA 4ATNA 3OXGA 1NPKA 2VBYA 4IDKB 4BRNA 4B3MJ 3HPOA 2FC8A 2EK1A 1OH6A 4Q0BB 5LY3A 3LWMA 3IMXA 4H4OB 4AQYF 1RWNB 1CC7A 1UTAA 4W5RA 2BGGA 4DPWA 5I42A 1X5SA 2LVWA 4OPKA 2AIRB 1RCHA 4KV8A 4JYAF 4ZPBA 4C8YA 2RDJA 1LW2A 1RI7A 3ASMA 4DL7A 2B9EA 2DY9A 4OZ1A 4MLHA 4RUAA 4DCOB 2CPJA 4CJEA 2F3JA 1E6VA 4C8LA 3UN2A 2GAGC 3M9MB 3RSEA 3CCEN 1UVJA 4QIWD 2J5AA 5C2FA 3W62A 4CGDA 4ZP7A 2BDPA 1HHTP 2DEJA 1VSFA 2QFJA 4RX6A 3PJ9A 2WK4A 2BKNA 4DR1F 3TR5A 2WTUA 3EXCX 1WHYA 4RW4A 2V8HA 5CCMA 4K2XA 1PYTA 1OIAA 1RCOB 4O3SA 1CJTA 2IOCA 4KHYA 4ZMMA 2QXLA 3TVYA 2KH9A 1RWVB 3FEYB 3THWB 1UVKA 2RF2B 1ITPA 1RDCA 4F2RA 5M1FA 1FCAA 3CJ4A 4M8LA 4DL6A 4K4VA 2A6MA 4K42A 4GV6A 3ETOA 3UVJB 4KTZA 1ZBSA 3O5BA 4IXCA 3KK1A 3RMCA 1KAZA 2W01A 2Y0BB 3GDQA 3SAFA 3PXGa 4WXOA 1CS4B 3CJ2A 2WW4A 1T7PA 3LDLA 2EG1A 3S3MA 3EVOA 2VIHA 4BCAA 2IS3A 3KLIB 3VAFA 1NJYA 5CYMB 2ZHOA 4P7VA 4RBTA 1ZYQA 2XM3A 3GG4A 2ZEJA 2BJ9A 2A40A 5D4PA 4WWSA 1GLJO 1GLFO 2D3O1 2UUAJ 4IG0A 5FLXY 3DLBA 4O3QA 4ELVA 5F8JA 4Q45A 3O3LA 4DR3J 1ZS6A 4WQ4C 1MA9B 2WSFC 1A7GE 4CI0B 1NK5A 4B3MF 5J1NA 3DFEA 1QY7A 3JAMO 5SWMA 1Y5IB 4A8QA 2W4PA 3TAPA 3IWXA 1PIEA 4ZPCA 2HBRB 1SCJB 3D6RA 2OH2A 2KI2A 2PD1A 1RTDB 4PL8A 2AEMA 3H3NO 1KD1O 3DXKA 3OBIA 4ZLNA 4I6MA 3KYLA 2V5HG 3G87A 1HUXA 2OYQA 4LJMA 3EN9A 4A5BA 1PJ6A 1NK4A 3BSOA 3FFKB 1FF2A 4LUBA 4ZPTR 4KI6A 1R6YA 1JQGA 3H7HB 5J2QB 2G8HA 3ZYYX 3I56S 1IKXB 3PX4A 5L1KA 2UVUA 4BRIA 2ATQA 3ENHA 1X3MA 5DETA 4LF8J 2Z1GA 2VU5A 7FDRA 4DS5A 4DPXA 2FVCA 3KVGA 4FP9A 2W24A 1PBUA 2Y1RI 3CCMS 3N28A 1MMNA 4CHOA 1XEZA 5GAGU 2E5JA 2KJVA 4Q44A 2RKIA 2RT3A 2RS8A 3PSIA 1B9FA 3OFEA 2DO0A 5GADU 2MQQA 1CJVB 4DX6A 1DEJA 2GVDB 3UPFA 4FK2A 4EU0A 3CC2S 3OYKA 2HG4A 5MLCQ 3MXJA 2LA4A 4IFVB 2HRTA 4MO4A 2E2NA 2G0IA 3QFWA 2EBEA 3H4BA 3JYTA 4C8ZA 3M6VA 2CVIA 1A0OB 1RTHA 4JRPA 3DLGB 3WXMB 3OW2R 3QO9B 1QAJA 3CJ8A 3CQ8A 4L3KA 4PG8A 3VHQA 3PUFA 1VC6A 3VERA 3FGUA 5M1NA 1AUDA 2UUAF 2R3VA 4JV5J 3A8KA 2HFVA 5E2QA 4DR3F 3P38A 3ZC4A 3CCUN 2FQQB 3ENOA 2HIYA 4C8MA 2RU9A 5LJVA 5FRNA 3PJXA 3AVFA 4BVPA 3FEXB 3SI8A 5JLFA 3BSAA 1JCGA 4DQRA 3D1OA 2FF6A 4DOZA 3DHXA 1XR5A 3MEEA 1RTIB 5AQOA 3W63A 3CCWA 4DSJA 2FLNA 1CQMA 2C2EA 1G7CB 2VPZB 1UL3A 4FYYB 5ETLA 4KT0C 1VQMS 4EAHD 4KAZA 3HSDA 3EGNA 3BN7A 2EKYA 5LXRA 1YJWS 4NYOA 1BISA 1QAXA 5K9FA 4KE5A 3OYMA 4FKYA 1ACMB 3M1VB 3TU5A 3VQ4A 4IEEA 4KKOA 1TMJA 1P1LA 3T3FA 2LXIA 3SDEA 1KVAA 1TKDA 4I68A 1VQNS 3SCJE 1HNWJ 1HI8A 4WXWA 4L76A 3V6DB 4I0WA 3DJCA 1XTZA 1RABB 1XC9A 3TNVA 4CHPA 4QWCA 2O1PA 4WTOB 2Z2YB 3Q22A 2HVEA 4Y3CA 1C0UA 2QJ3A 4P9SA 3HHNB 2DFEA 1GOAA 4B3SF 1F6TA 5KFMA 4WF9Q 3KHYA 4FJMA 1FD2A 3HT3A 2ZJQL 1D0EA 3OYIA 3B8AX 2RQMA 1L3SA 3T19A 5JS2A 1KR4A 1YLXA 1ZAVA 2Q1LA 4B3TJ 3ULEA 4E2FB 3NOGA 4M5LA 4ZOSA 1YBTA 2IMWP 1NGCA 2WHOA 3K5LA 2M88A 6AT1B 2X6SA 2V8PA 1HNVB 4CJFA 1FKOA 4CEBA 2C3MA 3VGKA 3C65A 4CVNE 3Q83A 4IH6A 1PAUB 1VQ7S 3M6XA 1HMVA 3AA4A 3AOCA 5KFTA 1B7YB 1LWFA 3OYLA 2P51A 1NPPA 3HDSA 4WIQA 2DO4A 3T1HJ 3MM6B 1Q81O 4Q2MA 3NCIA 3IAYA 3MMAB 3VQ7A 3HVTB 1JLGB 4EYHB 3X3UA 1XBWA 3TUJC 1RADB 1NHVA 4NO7A 1U1KA 4JV5F 2Y9HA 4IKAA 5DDQC 4YP3A 2RE1A 2O8DB 2BX6A 5KAKA 4I9QA 4XIUA 2ALZA 1M5OC 2JHEA 2PYLA 4PUOA 3BEXA 1H0HB 2ASLA 2Y1LB 1WWHA 2YY3A 1Y7PA 2VKZG 5IT9Y 1MWQA 4FL9A 2NXNA 3OYJA 2B4JA 5C25A 3OYBA 4ZN3A 3I96A 5AQPA 4Y0WA 3R7NB 2YKMB 2XY7A 2A42A 2WVCA 3M4XA 2C3YA 3O6QA 2GX9A 4EGLA 4BG9A 3AT1B 3M8SA 4FF2A 5GAGP 3KD5E 2MJUA 3U27A 4Z4IA 1NH7A 5LMNJ 2NZTA 3CPWR 3G71S 2FC9A 2ZQBA 4DSKA 3WXJA 1HNWF 4HTLA 4DXLA 4E7HA 3MR5A 2FDNA 2W9CB 3O4NA 4OMFG 1NGJA 2K8GA 4PQUA 4RR5A 4U8VA 1JLBB 4AL6A 2BABA 2MZJA 3NXZA 4DS4A 5IC6B 1R8AA 1VQON 2EW9A 4OKEA 4LD0A 4CJVA 5JS1A 2RQKA 4B9MA 3QNWB 2XZWA 4I56A 2OZMA 2GX8A 2M5YA 2MGZB 4M5DA 4B3TF 3IR5B 1CG2A 4CLFA 1FRJA 4Q8EA 3EY1A 4ED4A 4BBYA 5AFUA 1TK8A 1T9WA 1U2VB 4Z2XA 4ZVRB 3VMFB 3P31A 3VF2A 2Q31A 3KKSA 3CCSS 1GLLO 2CPHA 1SJ3P 1S79A 2IFXA 2R7TA 3T1HF 4C1NI 2PMWA 4BWJA 4DU3A 2E6MA 2GIRA 4DUYJ 2EWHA 3P3DA 1Y0HA 3UKUA 3NMUA 4DB3A 3ZNUA 4FS2A 2AJFE 1GLCG 2OGUA 3V9ZA 4USJC 1K8AO 4IR9A 1Y00A 3BH7B 3SFGA 2QA4S 2QWQA 3R6MA 2DNHA 1W2IA 4NCGA 3ZT3A 4CH7A 5BPNA 3DM2B 3TTFA 5AQZA 4NYPA 3MHYA 3RR7A 4JI2K 1IBKK 3VOVA 3OQ2A 2W25A 3J7AN 1HQEB 2IVPA 1J53A 1WNSA 3C16B 2NPFA 1SKWA 4WFBL 2I6WA 1CLQA 4OGEA 4DV7J 3OUYB 2HSTA 1IJFB 2PY5A 4RJVA 3QQCD 3DGVA 2ROGA 4E8UA 1HYSA 3GONA 1KEKA 5LMNF 2XCPA 1TK5A 2V94A 3M8QA 5D0EA 3PTWA 1SC1B 3EKUA 2CFXA 2E7VA 3CERA 2P9SB 3G6VA 1HI1A 1Z4UA 5AQLA 3HSCA 2UUCK 3VEVA 3VEYA 1RT1B 3UWTA 3S3NA 2BV3A 2Q0UA 4ID5B 4J5OA 3TWZA 3AJ1A 5A6WA 3TAMA 3CD7A 2P9UA 3SSQA 1YKWA 1JCFA 4X66K 3BV8A 3C15A 4N56A 4DTOA 3MCOA 4WFAL 3OXLA 1K6YA 4FK0A 5HL7L 3WUHA 5A0YB 2IY5B 3TA1A 2RDDA 2CJKA 1FE4A 4FDFA 2H65B 1S10A 1XUPO 3KLFB 3BGRB 3CD0A 3NFAA 2ZH4A 2VBXA 2CH5A 3CJCA 4CBWA 1VQ4S 2VWJA 2ASOA 2F8HA 3A13A 3HHLA 5GMEA 1Y3JA 2MKKA 2YHBA 5AQJA 1ZOTA 2VQEJ 4WK1A 4OYIA 3NG8A 2XHWA 4DSLA 2D9OA 3GFXA 1Q0NA 1S0VA 1F2HA 4KAIA 2R7SA 1WJ9A 4DUYF 4BLGA 5E0OA 3ZSXA 3IGVA 1BHNA 3R5AA 3R5GA 2B9WA 2IVYA 3HYFA 3LP1A 4JB8B 3E9OA 1RT7A 2VQFJ 2FZCB 4JKHA 2FGCA 5FLXO 1SJ1A 4PABA 3SPYA 2IRXA 2XWXA 2KRRA 3W2VB 4GO5X 3BQ2A 1EP4B 4FLTA 4LR9A 4LFAK 4FWNA 2P9PA 1KLNA 2J9CA 4BC3A 1CULB 2YQ3A 1YJ9N 3L4QA 1VQSA 5D0HA 5FIIA 3IBFB 5CAAA 3N0VA 1NGBA 6FDRA 4Q2LA 3SPZA 5I3UB 1U1PA 1CVJA 1C0GA 2W2MP 4DL3A 2K7JA 4DV7F 1G4CA 4M5NA 3NGSA 3W2WB 3U1MA 4CT9A 3W1YC 1R31A 3FQLA 4XPCA 3NMRA 2LFVA 4LF9K 4LY7A 4DTUA 3IWLA 3TO8A 2O4IA 1N88A 2G4BA 1VSEA 2FB0A 2MQOA 4DU1A 4FF1A 1NKBA 4FJ9A 3HKWA 5B0DA 3VZIA 3T5LA 4C1NK 3ZTPA 4J91A 3QEVA 4ITSA 4HHTA 1U25A 3BYRA 4XEIA 1IR2A 2DNPA 2HK2A 3VQ8A 1D8YA 3HVRA 4YOUA 1N0UA 3W61A 2CGJA 4L75A 4FJXA 1W2BR 4NLGA 4JS4A 3BO3A 3QPIA 4WQ5A 3M9NB 4CHYA 4P7TA 4TU9A 3V81B 4RUCA 2XLKA 2VASA 3EO3A 4C48A 4CJ7A 1XN9A 4H03B 1QHTA 1R0AA 3NP5A 2CA9A 1Y3KA 3VAGA 4KY3A 1U24A 5AZIB 3QETA 2OPSB 1ZZFA 4FPRA 3VF6A 3K57A 4I2QA 3K2YA 5CZ1A 5KTQA 4FO0A 3JAMU 2NLWA 3SUOA 1M5SA 3KUHA 3W9JA 3H4DA 3PSFA 1G15A 3HHEA 3OR2A 2VQEF 1RWWB 1RT6B 4CM2A 4DV5K 3BO4A 3M1FA 2EG2A 4GC7A 4OYZA 4NLYA 2QL9B 4DR7F 2ZH1A 3WNEA 3KG0A 3OL6A 1NCLA 3FSIA 2OMOA 2VQFF 1P90A 1EXQA 1JWWA 4HI2A 1S9GA 2KFNA 2QA1A 3RW6A 2E1RA 2VA2A 1ELOA 1VJWA 3PRVA 3G96A 4TQRA 2CPYA 1RT3B 4DV1J 1YF5L 3P83D 1OVQA 3DLKB 3NGDA 2OPRB 4IOBA 4LRAA 1S1TB 4PG5A 1XR6A 1I6JA 1NEEA 4A8SA 4CF8A 1NKEA 1KHVA 4DUZJ 2ZKUA 1K8KB 1NLVA 3N9UC 2FJEB 5KT4A 2WW8A 2FLPA 5U47A 4YR3A 4LRFA 3MURP 4BY9C 1HFEL 4HH1A 2E5LK 2FZKB 3A5NC 1XQSC 4Y65A 1AROP 4OYOA 2HBKA 4DTNA 2KL8A 3I33A 2RRNA 1S6OA 4J37A 4CBUA 1Q78A 4HHUA 4RNOA 1U48A 2OA8A 3WT0A 2XZDB 3SUNA 4G1QB 2HPUA 1RBRA 1HWIA 1T0TV 3TP2A 5KFBA 3PO4A 4WIIA 3UO0A 2IYIA 4CZHA 4IBNA 4F4XA 5BPMA 4YNQA 3Q2TC 2PE8A 2CKWA 4DL0C 4DSEA 4FM2A 2KDOA 4WFNL 1QE1A 1B0TA 4CGHA 4M5HA 2E2PA 4QS9A 3AFGA 5KPTA 1RDAA 1S5ZA 1TAQA 3SUPA 1ZBIA 4U96A 2DGUA 5ETMA 2FLLA 1N5YB 3HRGA 1KD1T 3EM1A 3BH6B 2XSJA 4EWTA 1D9DA 1CJKA 4ILLA 3PW2A 1SPBP 3QESA 2P6TA 5FDLA 1QVFM 1ATSA 5C12A 1XMOF 1UVLA 2ADCA 1B99A 2YX4A 2V6AA 3UD5A 1C1BB 2MXYA 2ZWPA 1AUSL 5T7LA 3ELHA 3DC2A 2J7WA 5A8WB 1Y9OA 4M5MA 2Y1JA 2K06A 1FJGJ 2HBLA 5KT3A 1O1WA 4QAGA 3OT9A 2YCHA 1S12A 4DV1F 4J9RA 4H4KA 5L8RC 5IT9O 2ZDPA 4CJTA 2Y8WA 2DVIA 2AD9A 1BUPA 4PQAA 5EX0A 4X4RA 2P9IB 2CPXA 4DTSA 4QS8A 4ZP6A 5C42A 2KXNB 5HMWA 5CD4A 4FNIA 3D3BJ 4DUZF 4IRKA 2E1MC 1G3OA 1KNZA 2AP1A 3DRPB 1LW0A 2DGOA 5DZ7A 3I55S 3K89A 5F3TA 2Q3SA 3FQKA 1U6FA 3KK3A 5B0BA 1C0TB 3QIDA 3S01A 2V52B 1L3KA 1MNEA 4DV3K 5AQKA 1XHXA 1T9VA 2VG5B 3UI3A 2ASDA 1BQNA 2R7OA 2D7SA 2DHSA 3N4QA 4A2AA 1NK8A 5JUMA 4QYZK 4A8OA 5KRTA 3MEDA 4MJKA 1U1QA 2HHVA 2F4VK 4K43A 3H3OB 2GVZB 8RUCA 3QMLA 4L8RB 2NRWA 4P10A 4WP8A 4AM7A 3C6UA 4MFBB 4OI0A 4CLSA 1IQTA 1NHUA 3LP3A 3R5DA 2CQIA 3D9BA 1U2RA 3HOSA 5HRNA 5DG8A 4M3TA 1XNRK 1JJ4A 4NASA 3CJ9A 3QT7A 3NGIA 4J2EA 2E20A 5EU7A 4E1JA 2CJQA 3NAHA 3ZSOA 3P4IA 3SJHA 2Y3YA 1R8PA 1HIYA 4TKTA 1S99A 4B3OB 1VBXA 4CEQA 1WORA 3V4MA 5KFUA 2RHQB 4CT8A 2XS7A 1QDUB 3KMSA 3ZZUA 5JMNA 1FKPA 2JOQA 4P73A 2AHOB 3VQCA 4UOHA 1FJGF 2D9PA 5AQVA 4FJJA 4FJLA 3AQPA 1KTQA 2XGQA 1P9QC 3L09A 3WX8A 4B9VA 3RB0A 1U0HB 2EK6A 3DCAA 3L0QA 3DRSA 3MEGB 1Z2ZA 3KIOA 4XH4A 4LRDA 1BQMA 3BM7A 3AODA 3CDEA 2QX0A 4CCHA 3OBWA 1XNQK 3F9KA 1VAZA 4A2BA 3GWCA 3WDOA 2O8EB 2FVPA 4JI2J 1E3MA 2HHSA 5GADI 3JTNA 4LBPA 2MMYA 4WKYA 3Q24A 4FWSA 3HD1A 2C3OA 5KT2A 1JNZB 2N4CA 1WHVA 3H2LA 1TUYA 3D6MB 2G9OA 4AHUA 2HHTA 3GJTB 3MI7X 1TKXB 4IO9L 1X5TA 1UEVA 4DLGA 1KS2A 2YJEA 4CEZA 1D09B 3MX2A 1TR0A 2W41A 4CK1A 3V1OA 4DL2A 2Q43A 4JN4A 4QWBA 1BI4A 1PYOB 3ZETA 3QICA 5M1PA 3DDKA 4HT7A 2AX0A 3RBZA 4FVMA 1NMDA 4ZIVA 3FFIA 3KWGA 3J81O 2UV8G 2FJAB 2DGVA 2MJNA 4DTMA 4K8RA 2RILA 3D6HB 1Q53A 3KK2B 3I8BA 4AHCA 2YHWA 5BREA 2CQBA 3MCMA 1AYEA 1RBOB 4W92B 1YTUA 2J76E 3KWMA 3AARA 1OKJA 2OI2A 4ZVHA 1WAFA 2KZZA 3JSMB 3W9HA 3EZ5A 4FLWA 3R1XA 4ECTA 3VALA 4DEZA 4JKBA 3PIOQ 4FSVA 3BJYA 3PKMA 5HROA 2G8VA 4LF5K 1S0OA 2N82B 4EI2A 4B1ZA 3GR0A 3WIUA 5HRSA 2XC9A 4JAXA 3MD3A 3SIPB 1GX6A 1RHQB 4QIVA 2R7RA 4B02A 4IR1A 1S22A 1PC5A 1XI1A 1OYDA 5BPLA 4C0HA 1GLAG 1RBVA 2I7PA 1KONA 4DV0K 4Z4GA 4LF6K 3O9TA 3M8PB 2XSFA 1JLCB 1Q5YA 2C1EB 2F9WA 4JKGB 2D5RA 1N32J 4ZVPB 2FVQA 3EE8A 3K5OA 2FHJA 4LFAJ 3SSSA 4FCYA 3I4HX 4JI2F 4USUA 5DJBA 3GE9A 2HWHA 5EX3A 4KJIA 5KFFA 5F0UA 4TLQA 2V4QA 1WACA 3OR1A 4D3GA 4F3OA 5FPDA 5KFVA 2N3OA 3MM8B 3PLAA 2QEXS 4OFZA 2B6AA 1YIJN 4GKJK 4LF9J 4N41A 2XBPA 5ETTA 4ZJOA 4LSLA 2LEAA 3J7AP 4H4MA 2QTDA 3MN7A 4B1XB 5DLFA 3B6OA 2EFVA 4FPAA 3AA9A 1C0MA 1WDTA 4W5OA 2GQQA 3OYAA 5KFJA 4PWDA 1MROA 2RIJA 2ZJQQ 4H0TB 5FLXU 2VPXB 1O51A 2ZOGA 2IC3B 3CJ5A 1S1VB 2ASPA 2AGPA 1OH5A 4YMEA 3AOAA 5GAEU 2J6SA 4QW9A 1NHKL 4BHQA 4DZDA 5F8IA 4JD2A 2MTLA 2NPIA 1NAQA 2AJ1A 2G8UA 4LSNB 4RCHA 2QXFA 5K8MA 5J2PB 4K41A 4LFCK 1T11A 5KG0A 3UDEA 1MWKA 5F2RA 4J9LA 1YRXA 3VETA 4ED0A 4P71A 3SBGA 4IWVA 2QA2A 4PY5A 3VVUA 2R2TA 4EP4A 1P8GA 1KQSM 1SV5A 3NF7A 4JV2A 3JSBA 1HKBA 2PA8D 4ZCLA 4FYWB 3G8SA 3LQVA 3ET6A 2DT9A 1HBOA 1HR0K 4DDFA 2N7CA 2OANA 2EEYA 3P6YC 3X1LB 3OHRA 1HJOA 4KPYA 2P1JA 1IJJA 2HW3A 4FJ5A 1ZBHA 2X1GA 5EDWA 3HX9A 3TSPA 4ZVEA 4USMA 1AZSA 2Z4PA 5B0FA 2D0BA 1N32F 3W66A 4KR0B 4NLPA 1N4LA 2MKYA 4DPOA 2YNHB 4L3NA 1ZAXA 4JI0K 4FW2A 4AHVA 1ROFA 3OLAA 4CW7B 2HVHA 1TUUA 1IWGA 3P49B 1S77D 3MAQA 2P9GA 5IM0A 1D3WA 4PL7A 1ZM3A 3PR4A 1BL3A 1TVRA 4IUFA 4V19X 1T03B 1AA1B 2BW2A 5KGWA 2C2NA 3ILIA 1PKUA 1SJQA 4GV9A 1KQGB 1KCFA 3RMBA 2VG6B 4JI1K 5CA5A 1NJIT 2KRBA 3NBPA 2G2OA 4LF9F 1WUUA 1YJNS 2P9NB 1HNXK 2W9BA 4FOEA 2R9LA 4KH1B 4CZGA 5M1OA 3O5TB 1APSA 5M1QA 4RW7A 4TNOA 4ZCMA 4YDUA 2YNFA 4OYXA 4CFAA 2WUSA 3ZNJ1 1OY6A 4KHPJ 3TABA 2FJVA 2E7WA 4FOIA 3OTDA 3CFOA 2LLZA 2G1DA 3IR6B 3KJQB 2QL7B 3SFUA 3L7UA 4OHWA 3KUEA 3JTOA 2BW7A 4PYDA 5AQWA 3WQPA 1F3VA 1KLMA 4A8FA 3CDBA 1ZXOA 4OV6A 1L3VA 2UUTA 2I5JB 2AGQA 3BDPA 2IDOA 2CQHA 2WB1D 4C9DA 5D4LA 4BDZA 1AW0A 3OJSA 4C0BA 2YKPA 4ISEA 2MKJA 3UW1A 3BREA 2E6LA 3M32B 4RU9A 2QWMA 3C14A 4PEOA 2NRRA 4TY9A 9RUBA 3KLHA 4QYRA 3LPEA 3RRHA 3GYGA 2ZJRL 3U1NA 4F4ZA 2BE9B 2HGLA 3PYFA 1UVNA 5IT0A 1FXXA 4BR4A 2ZOFA 2QG9B 1KOOA 1NK0A 3AVHA 4IFYB 1FVSA 2NSCA 2BACA 3AGRA 5AQMA 1CJUB 1MWMA 5L46A 4DCJB 4BRPA 1SC4B 1R8CA 2HYIB 1OQ3A 3NNAA 3G25A 4G1PA 1GFWB 2BM1A 2YX6A 1JLAA 4HCBA 3QSIA 3AO4A 2G0JA 4WFBQ 2FJBB 1LWCA 1EQMA 2A2DA 3DGPB 3AA3A 3CD6S 1NGAA 3IFRA 2EWSA 1S9EB 3H0PA 4CGJA 4M5GA 3C3LA 1VBZA 5F9NA 4JP8A 1FTCA 1FEHA 1JKHA 4C11A 1QAYA 3MECA 3QAEA 3OHBA 4IRDA 1S6QB 3UE5A 4ZN1A 2QK9A 5GAEP 1I94K 3AJDA 3CCES 3CCQN 4JKEA 3ZX0A 2HNDB 3E01A 1EETA 3AGKA 4O5FA 5ETOA 5B09A 1XJWB 5HP1A 1ZBTA 4WFAQ 2BUPA 3M2UB 2APOA 4ECQA 3UE2A 3FMWA 5HL7Q 3MMJA 3O9SA 1RDDA 4LH4A 4KHPF 3CCVN 3P8BB 2ZH3A 1K44A 2JFDA 4ICLA 3DLEA 1WSRA 3MPWA 3C66A 2NNWA 3GIKA 4ERDA 3DMJA 1RBSA 3E2EA 4NLRA 1Q7YT 3QJPA 5IT9U 3EJMA 3NOCA 3GCWP 1YTAA 2DHXA 1YWXA 1X1PA 3Q8PB 1X4FA 3PACA 3FUYA 5B08A 3CCZA 2FY8A 4ED6A 1SH0A 1ZAWA 2MZRA 1RBUA 1XNRJ 1T94A 4PCQA 4ANCA 2DGWA 5I42B 2A6OA 3UN5A 4ZK7M 4BC2A 3F2KA 3VQDA 2KHCA 1N33K 4KV8B 3EGZA 1LW2B 2HFUA 2XRIA 4JI6K 1G6BA 1CZBA 2JEIA 4RW9B 2GIFA 3UFCX 1T9TA 2MKHA 3LPYA 3A8IA 5AJ3K 3RSEB 3NAEA 3THTA 1W7AA 2C28A 3K9KA 1FDAA 3GZ7A 2DTJA 3DN9A 4AXIA 4ZVSB 4DV6J 3PCOB 3PNIA 2VFTA 4F3MA 2MHEA 4OHVA 3PYGA 3GILA 3CG7A 4P2FA 1RHJB 4CHNA 1T3NA 1X4CA 4DN0A 3TEGA 2J9DE 4RKUC 5KFAA 2X3GA 3E51A 4CQ1A 3KKRA 1U49A 3EVWA 4BC9A 4IG3A 3AO5A 1CJTB 4AF1A 3LP2B 1LWEA 1QJHA 4X84A 4J9SA 4ZS6A 2MSTA 3DOLA 2UUWA 2GA7A 3IKMA 1Q82O 5AQQA 2IAJA 4IQMA 1DTQA 1IM4A 1KTVA 3KK1B 2CQ3A 3KHLA 1X31C 2KO1A 3U9ZA 4NLVA 1ZETA 4MAKA 4IOXA 3PZPA 2NLXA 4IKFA 4KHQA 4DU8A 4ILHA 4FJGA 2CJBA 2R2SA 3OVSA 3AVIA 4ECXA 4GW6A 4MDBA 4L74A 1RYRA 1UFLA 2GIQA 3GPAA 1EKEA 5AQTA 2V69A 1CC8A 3OS0A 2K1RB 4IG0B 4FK4A 4KH0B 5KFKA 2F9TA 1U1NA 3HULA 1QVGR 1UFWA 2DHAA 1C4CA 2W4DA 4U8YA 1NMNA 4WZQA 1OO0B 1U1OA 4DR5K 4BR5A 3SQGB 4OKJA 4FN5A 4FF4A 3JQKA 3BO2A 1KFDA 3CMQA 2GC8A 4ZPWR 2OTLS 1M5HA 4PAAA 4K4ZA 1XNRF 1HQUB 3HCXA 5ADXH 2GQ2A 4MLEA 1S9FA 1WDDA 2PAVA 4ILGB 5KFOA 3LDOA 3ZTOA 3G8TA 1QAIA 3DXKB 3NWGA 4I6MB 4B1WB 2FIUA 3CCJN 2LQ8A 4MT1A 5IQ6A 4MKBA 3PR5B 3U6FA 3GSIA 2DPJA 3M05A 2VYPA 4LQ3A 4ER8A 4AL7A 4YOWA 2GJFA 2NUHA 3Q8VA 4JYAK 2W7PA 1YBAA 3H25A 1VQ6N 3IRWP 3LL3A 3ENVA 3FR0A 3CCUS 4O3RA 4OGCA 4HL9A 4DV6F 1RWUA 2ATLA 2J8SA 1HW8A 2MQPA 3V5RA 2E1YA 4TU7A 1T05A 3NAIA 1W9HA 4YDDB 2F63A 3IR7B 3CMES 3J81U 3KJVB 4YDXA 4K50A 4LF6J 4DFMA 1VC5A 3THXA 2ZC3A 3MPVA 3UD4P 1NSAA 4AXJA 1N52B 4L73A 3JB9k 5CZ2A 3U7JA 2PIIA 5CXTA 2GW8A 1WELA 4DR1K 5KFLA 2KLAA 1E4GT 3TW0A 1WSIA 3R3LA 3TUPA 4HLBA 3HPHA 1HKCA 2NUUG 4AD6A 2M4MA 3RMDA 4DR6F 2AP6A 4C23A 3JYTB 1W0HA 4UQGA 1JLQA 5HK4A 1F9HA 4NEYA 2H5IB 1FDDA 4MO5A 4LRBA 1X7VA 4YB7A 4YB6A 1TL7B 1G2EA 1OJ4A 1S49A 1HD0A 3R2DJ 2XMUA 4CJUA 3OSNA 4A62A 4CJRA 4FWKA 3OTOK 4WFNQ 1PG5B 1HQ2A 1R8BA 1DBDA 1XMQK 2OIHA 2EFPA 4O8KA 3N6NA 2MZSA 3CIMA 3OFFA 3NMAA 3G6EN 3LDPA 1L5UA 2K3KA 1RK8A 2P2CB 2LXUA 4CZLA 2VG7B 3DXMB 2MZQA 4OLOA 2P9KA 1J5EK 3MM9A 2OCEA 2KG1A 4MK7A 4B3MK 3ENQA 1X9MA 4X62J 3SMZA 1FK9A 3DI6A 3H8YA 2FBVA 4PA1A 2RF2A 5D4OA 1NDPA 3UCGA 1QUPA 3HM8A 2BBEA 4YQWA 3HSZA 3PY8A 2CWXA 5C2DA 2J6TA 4R5PA 4CJKA 3MWPA 3BF1A 2JH3A 3HBTA 2ZVIA 1SS6A 2F8EX 2ZFHA 1NGFA 4ES3A 1MWZA 1QSYA 1NGEA 1RWXB 3N5FA 4KKOB 3LGMA 1JLFB 4LIRA 3SDEB 1HR0J 4PKIA 1RA6A 3PO5A 3ALYA 3H40A 1CS4A 5GAHU 2L3MA 1BCMA 3MOJB 1NNEA 4EMDA 1SQFA 4L6V3 4B9NA 2QWLA 4JKFA 3LAKA 4KC5A 1C0UB 2P8IA 1N5SA 1R89A 4LF6F 1UWAA 1VS3A 1CZ9A 4GC6A 3EZOA 1GLEG 2BYCA 3TWHA 1NJWA 1A6LA 4CO3A 2VFSA 2O67A 3J7YU 3GMGA 2FJWA 4NI2A 4JI0J 2C2KB 2KYXA 2LXFA 2VGMA 4B08A 4K4TA 2W6LA 1IBMK 4CF2A 3MCAB 1FKOB 4OYBA 4C6AA 3PRDA 2O8FA 3ZT1A 2QKBA 3ZLJA 1NLKL 3EPIA 2JLFA 4MKVA 1S5JA 1N5TA 1HMVB 3A3NB 4RWTA 3P5TL 4A8WA 2XHCA 1LWFB 4QR2A 4JLHA 4HWIA 3N01A 2HS3A 3GCXP 2XYPB 3UN3A 2NRTA 3ISZA 1VK3A 2XNRA 2V68A 2Q3PA 1VQOS 1ATNA 2A10A 1VSLA 4FVUA 5EOYA 4CWBA 3NE6A 1JB0C 2KHDA 3Q7CA 4CO0A 5J2QA 4GY2B 4PUOB 4WFXA 3THYB 2HBYB 1J5OA 3GIMA 3A0IX 3SSRA 4QWAA 3GIJA 4Q43A 5FROA 2UUAK 1ZTWA 1U1LA 2ACYA 4LRCA 3P96A 4M3XA 5E7OB 2RJZA 3UNGC 4DR3K 2QZ8A 1W97L 5E3RA 5C25B 3KMQA 5IOLA 4BG8A 2V2KA 4H5WA 4X62F 2XMJA 1LK7A 1RAJA 1GLDG 3MUVP 5DRKA 3RW7A 2VICA 2FHJD 1WF0A 4YB5A 2V0NA 4N77A 2RSQA 3OYEA 2MQLA 3LWLA 4IFVA 4PWWA 3QB0A 2O8BA 1S0NA 1X0PA 4DX5A 2XCAA 4FZXC 3OTEA 1KBRA 1GTEA 3O1BA 2QSFA 1HR0F 1EKRA 3IAM9 3QO9A 3MAAA 2OO4A 1RBAA 4F0KA 2QT7A 2J0SD 4PQUB 4I64A 4E1MA 4BVOA 4NYNA 2CPFA 4FWMA 4FYDA 2POKA 1CXQA 4F3QA 2CQ4A 5CCLA 3A3OB 3M2VA 3K59A 3GOIA 3PYDA 3QLHA 2E5HA 3TJ8A 1JX4A 3AVGA 2CG4A 3C6AA 3FC9A 1X4AA 5SZTA 2GNKA 1TAUA 2FHKA 3HJVA 3VQEA 3E9PA 4J2BA 4M63C 4B3SK 4IO9Q 2AYMA 3PHTA 1VRTA 2IJFA 4UTGA 2OD6A 2HQIA 5CZXA 4JNEA 3TA2A 2FF3B 4PKGA 3QJLA 5AE2A 1YAGA 4ES2A 1GTHA 2IMOA 5SUHA 4I9LA 2R42A 2HWIA 4KPCA 4KGZB 1IKVB 4FJKA 2FSNA 4H5RA 4DV4K 4ENOA 4RBVA 5HMYA 1RAFB 1R7IA 4HVJA 3ISNC 3QFUA 3UDCA 2NS1B 3M1VA 1NMEB 4O3OA 4OX6A 3SMSA 3W8GA 4NCGB 4JV5K 3U4LA 4DV2J 2DH8A 4HHHA 4W98A 3C7NA 2HIQA 3J7A1 3SQ0A 3JS6A 4NLWA 2HURA 1FT8A 4A8YA 3GG0A 1YZ6A 2ASMA 4JK8A 4OZ5A 2LEBA 1V5IB 3TEHB 1DQ8A 3MM7A 2HS4A 2X3DA 1HYSB 4BR9A 1FDBA 3NGTA 3GV5B 4A57A 1X0FA 2HEKA 2IDEA 2W2QP 4DSFA 1N33J 1EWQA 3ZEUA 1VHXA 4OX7A 2VDHA 4J9UE 4CLWA 4BRMA 4JEPA 1R0BG 4FJNA 4DHVA 3OHAA 1ZA1B 2HLTA 1N34J 4A8XA 5DM7L 2GGPB 3O2IA 1RNHA 1WSJA 1YJ9S 1HPMA 2E1ZA 1TP7A 1FERA 3QIPA 3TAMB 2P9UB 4BQZA 1BE4A 4Z4CA 3TOQA 3C15B 1HNWK 1JLGA 5TKYA 4JI7J 4YORA 1KVBA 2KXHA 2FJDB 1RDBA 4Z4HA 4FZYA 1WC4A 1FNXH 4M42A 3MM5B 2KB2A 4NEZA 1VQNN 2HS0A 2WSEC 1JNRB 2BVZA 3QEWA 1QTNB 3DAWA 2AWZA 5HVFA 1Q79A 4K5RA 5I3QA 3HHLB 3ZO7A 4PHTX 2CZ4A 2A0FB 3M8ZA 2M8HA 4B3TK 2H9ZA 2HHHF 4MK9A 2CVEA 2OZSA 2MLZA 4I69A 3DU5A 3T7ZA 1GNKA 1ZM2A 3WEEA 3D2WA 2RVJA 1LOTB 3ATVA 2HGNA 3TQEA 3WNHA 5HSPA 2OTJN 3LP1B 4UOFA 4DMZA 3L2RA 1ZBFA 2GBZA 1MMDA 4DFKA 3VVTA 1VOMA 3M6UA 2D3OR 2QLFB 3O3FA 2P9PB 1IG9A 4DV2F 3BQ0A 3OW2M 1RDUA 4MK8A 1TL3A 3NLCA 3V9UA 1S6PA 3PEHA 1U6BA 1MWYA 2WOMB 3B78A 4JOUA 1S57A 1RB0A 2B9YA 4DR5J 5LSLA 1IG8A 4HHJA 1UEUA 3LGNA 1BU6O 2DCUB 2E9TA 3CI5A 4I6AA 4DQSA 1VR6A 3D7SB 1VQPN 4WE1A 2BE2A 2CDRB 1QQCA 1YRUA 1N33F 3M2RB 2EFOA 4A46A 4CEAA 1TFYA 4ZCIA 2BQRA 2LSNA 2QM1A 1N34F 3G0ZA 3L95X 3UDVA 2I0XA 2HGMA 2JC0A 1RBLA 2Z58B 4FWOA 2B51A 2ZZNA 1WG4A 2A18A 5LJWA 3U1LA 3P39A 4CZEA 4P2MA 2KHOA 5KFZA 1FESA 3KLEB 4QWDA 1Q5VA 4JI7F 3PW0A 3FRYA 3MXHP 3V2UC 2VUGA 4P2XA 3L9ZA 4HDGA 4K7QA 5F8HA 3VN5A 1WHXA 3EDRB 4RL1A 4YFUA 3R27A 2XB2D 4ECZA 1RYSA 1P6TA 3AVAA 2LDIA 2UZAA 4ZIWA 3FCHA 2GWJA 3DM2A 3O8MA 3SBMA 1D9FA 2GUIA 3FBBA 3V1QA 2CJYB 1U1RA 3OR2B 3WXKA 2IPOB 4EYIB 1Y4ZB 2ZITA 3OJUA 3N4PA 2ZD1A 4WJBA 4KB7A 5F41A 1S1WA 2OFHX 3QGHA 3EZUA 4K8XA 4LFBK 5LL6d 4LC9B 3D5MA 4ECVA 3W64A 2AMCB 1V4SA 2OHDA 1FXDA 2DNQA 4OYAA 1N5VA 4B9TA 4K25A 4I7FA 1SKRA 2HBJA 4NLUA 4F4WA 3T5HA 4J2DA 2HSEB 4DUYK 2YI1A 1X8DA 4UQTA 2EXUA 4B1YB 3FDSA 4A61A 3ATUA 3CTRA 3GJQB 2HF4A 4WQ4A 5FPMA 1CSJA 3CCSN 3ENBA 3OTOJ 4NA1A 5HQLA 1BXNA 2HB5A 1ICEB 1SAZA 2R7YA 1XMQJ 3KG1A 3OBYA 1VQLN 1R0CB 3HVAA 4F26A 3C0BA 5BN8A 1UCNA 4DR5F 2V7ZA 2ZJRQ 3LA0A 3ZX3A 4X64J 1E6YB 2X78A 5F8GA 3GFZA 4NXNF 3D45A 1XMBA 2VJVA 4B3RJ 1LWXA 1KQFB 1IKYA 4Z7CA 1RTJA 4A5AA 1J5EJ 2DRBA 1Q82T 2GWKA 4PKDB 4IJNA 4KTWA 4DV7K 3A5MC 3ZZZA 4OZ2A 4RBUA 1DT9A 3E3XA 4RLEA 4YOEA 4O3NA 4PG4A 3QRRA 2J4RA 1UJ4A 5KT5A 1T3OA 3L2VA 3RRKA 4BGBA 1O6XA 2F7TA 2Q2RA 1K73O 3RWUA 3U02A 3M30B 1NGDA 4KHSA 2V2ZA 2QWOA 2SXLA 3HSJA 4Z0UA 1TFWA 2B8PA 3CIPA 3GV8B 1QE1B 3OL8A 1H98A 5F9LA 2ZVSA 3C19A 1Y64A 4OX8A 1SB6A 3IM8A 2IM2A 5CD4H 2I9SA 3L7PA 1S1UA 2V7YA 3CCRN 3W3SA 1D9AA 4U9RA 1CJKB 4N47A 1XC3A 4RO0A 1GOCA 2QV6A 3CCLN 3CDWA 5FDLB 1YJRA 2RB7A 5D15A 4QBUA 3M8WA 4LSZB 3IMQJ 2OEKA 4ZA1A 1IBMJ 4K4SA 3W2WA 1X5OA 2VQEK 4DSIA 2B4UA 5B0AA 2B4OA 2G8KA 1VQ4N 2R7WA 4CZMA 4LF4K 2G8IA 5KFCA 4E7JA 2BOAA 4X4VA 3RAMA 5CABA 3J80Y 4DR7K 3OTOF 1A5XA 4GMJB 2ERRA 2VQFK 4RU2A 1XMQF 3F9MA 2HZAA 4NCBA 3SZ2A 1VYAA 3NGZA 4HTJA 1T9XA 1OYEA 3MXIA 5C42B 1VRUB 2YPYA 3PYEA 3A8JA 2V4RA 2FUG9 2XY8A 4X64F 5EVZA 4K4UA 4U95A 5C5JA 4B3RF 1LW0B 2F8MA 5KFIA 4JV1A 4OX9K 1M1GA 1VQ8S 1J5EF 3NVKA 2WZ1A 3L4IA 1RAGB 2BEFA 4I6YA 3GLJA 1MLAA 1Y5NB 1TQLA 2MQMA 4IQXA 4LR7A 1S4FA 1FFWB 3HL8A 4FXVA 2AKWB 2H3EB 1BQNB 3CJBA 7AT1B 1KP6A 3EKSA 3LDNA 1VSMA 2AJ2A 1UAXA 4IFEA 1WSGA 2IYGA 4NYFA 4QOTA 5ETSA 4NLSA 3FBCA 5IS2A 3LTOA 4TSXA 1KAXA 3R9LA 3AQOA 4NYZA 4JI3F 3LDQA 1GEHA 1LXJA 3OD2A 3GG1A 4J8FA 4DPTA 2ROEA 2BH1A 1UWBB 2PEBA 2C3PA 1QLNA 2P9EA 2P5VA 2ITMA 4QPXA 3UKRA 1FXRA 4I67A 2QFIA 2BKOA 4HEA9 1EX4A 1HARA 1T6DA 3KLVA 1SKSA 4B3SJ 3PX0A 1X4BA 1IBMF 2YPZA 4CO5A 5F8MA 5I3PA 5EHHA 1Q18A 3PFEA 3NKYA 1RAEB 1XIQA 4NZ6A 2ZZMA 4UF4A 4EO6A 1FKPB 2HFSA 2W1BA 2IBKA 1XMOK 3HZEA 4IOAL 2DEIA 1NG9A 3SQ2A 2F9JA 1BOTO 4CIOA 5H1SQ 1OH8A 2M70A 3ZSRA 2CQPA 4DV4J 1C0FA 5EY4A 4FWRA 3DRSB 3T1AA 2BRKA 3D2EB 1GMVA 1HI0P 3QDKA 2A3ZA 2UXCF 1BQMB 1Q8KA 1R8HA 3EZWA 4OHZA 2QA4G 3VQAA 4DV1K 1Z25A 1AT1B 3B6PA 4F67A 2E66A 3ILJA 1Q1KA 4XDCA 2PC6A 3VA0A 4JI5J 1LFPA 4YOTA 5DZ6A 3QYYA 2ZGYA 3K17A 5KG6A 4NLCA 2VC1A 1SQEA 4DUZK 1KKHA 2G8WA 1LQ9A 3IS9B 3TTCA 2H1YA 4CGFA 3KG4A 3T1YJ 4K4XA 1XWLA 2DISA 1NDCA 1WOOA 1NSPA 4IZ9A 2CADA 1E4FT 2FD2A 3F0NA 2CJ9A 4BWMA 4MKAA 3V6JA 4OYMA 3JXUA 2NREA 3H5YA 3AVMA 1ZBUA 1GH8A 4W5NA 4Y2CA 1T8EA 1BI4B 4HDHA 2VWKA 4WCEL 2K2PA 3MPUB 4DZ6A 3ZETB 5A8KA 3FCWA 3Q8SB 3FJ2A 4RW8A 3QEIA 4X4QA 2ZDOA 3FFIB 4E89A 1WG1A 4NZ7A 2VFUA 1ASUA 2B3TB 1FEEA 3J7ZT 4A8KA 2JFKA 3RU0A 2IJRA 5G0RB 1U7LA 2IIRA 2X1AA 1EIYB 3ZXWA 2B4VA 5K5MA 2QC3A 4O44A 2EKNA 2PMZD 1YIJS 3OVNA 1SL0A 4RUBA 3QRQA 4R79A 4CGGA 4W90B 2VB6A 2DPNA 1HWKA 1W26A 1NSKL 1W2BM 3DOMB 3DRPA 4O0IA 4BC7A 5HROB 2LECA 5H9EJ 2WVEA 1OQ6A 3K0JA 3I0RA 2AX1A 4OKKA 1UFKA 3HFKA 3RTVA 2ZH9A 4GO7X 1ZPVA 1X3NA 5I9EB 1JL2A 2VG5A 3MWTA 2MEWA 2R7QA 4DV4F 2CDQA 2BUNA 2YX1A 3R1LA 5GAHI 1ULRA 1FJGK 3CC4N 2IJNA 2VA3A 2KFZA 5AXKA 3G2XA 4KO0A 2XMTA 2GVZA 2XO6A 4LBIA 2KM8B 1Q8BA 5HJYA 3ULHA 1IQZA 2KVIA 3O1LA 3F44A 2CH6A 4CEEA 3CC7S 3QNOA 4JI5F 3OXFA 2W8LA 3ZZTA 2BRLA 2Z1IA 3M5RA 2JLEA 1WOSA 3J7YI 3MCNA 5L39A 5D0GA 1REVA 5KG7A 3OR1B 1WEZA 2QLJB 2VL1A 4GKKJ 4NLQA 3PW5A 2X1BA 3T1YF 3OL7A 4ZJQA 1K0TA 4J9KA 2B6AB 2XS5A 1TKZA 3MTKA 1H38A 3PHEA 2VZ9A 4LSLB 1KC8O 2WB4A 3AB4B 1M1KT 4H4MB 1M5KC 4B3OA 3CJTA 1TYQA 4FS1A 3D7EO 4NWBA 4CJSA 4NX9A 5M2RA 3BN4A 3EEQA 1JLEA 4K0KJ 3TX0A 4A48A 4PWDB 1MROB 3SQ1A 1SUQA 3CW2C 3KNAA 2GCFA 4KTQA 1RACB 1TL1A 5DQIA 3OFGA 1WKKA 3ENAA 3GE1A 5C15A 5AE1A 2QWPA 5T41A 4AUKA 1KWMA 1U0SA 4JD2B 2BOPA 5J1EA 3ID6A 4V19S 3OPKA 3GYXB 3AXMA 3NEKA 3DRRA 5FPEA 1N8RT 4KGKA 2CIMA 3H2VE 3TJAA 3F5TA 3HM9A 4DR2F 5DQHA 2FBXA 3J7Z5 2YKNA 1SV5B 4DPYA 2D0PA 3ZTRA 2MY7A 3H46O 4NLTA 3ET6B 1HBOB 2IVMA 5CHCB 2V2QA 3IM9A 4P74A 3P5JA 2Z0GA 4BDYA 4CJ3A 4USVA 2VV5A 4LFBJ 2XY6A 1TZ0A 1YTYA 1YXQA 1WI8A 4HVZA 3H42A 1Y97A 3OVBA 1AZSB 1FRIA 2Z8QA 2D1KA 1RLCL 2F65A 4URQU 2RU3A 3A8EA 2YQ0A 3B6BA 4OHYA 4CI6A 5BRFA 2VD3A 5IZHA 3S9HA 5IM0B 2A41A 1J27A 5H9FK 2B43A 1OWXA 3WC2A 3POTB 2PO4A 5CR4A 3O4WA 4GKKF 2QGFB 3EGVA 1S0MA 3WQUA 1EX8A 2VOOA 4E1NA 4P52A 4PR6A 1ZC6A 3TRGA 3IXQA 1URNA 3NBPB 1JXEA 4AILC 3SLCA 4HKQA 1U02A 2W9BB 3O3GA 4CF0A 3KUGA 1T02A 4DFPA 1KDNA 4K0KF 2CNKB 3VESA 4USKA 2EI5A 3CETA 2VF3A 1FTRA 1VQKN 1Z05A 3NS7B 4ZHRB 2YXLA 1JCEA 2KKZA 5AQXA 1RHUB 1RA7A 2Z2ZA 3ICLA 3VCDA 2UVRA 1MN9A 1KLMB 4CIGA 1JLCA 3CJ7A 4KBIA 1BIUA 1X4EA 1SIWB 4FM0A 2AYGA 2KT3A 4LREA 1VCTA 1SZ2A 4FBUA 3R2CJ 2B0GA 2MQNA 4L3QA 3C14B 1WB9A 4WU3A 1F5AA 4FWLA 5KG5A 1GMWD 4ZVUB 1VSHA 2E88A 3KLHB 4WFZA 3R97A 3MDFA 3VTHA 3CCVS 4KBOA 3PKYA 4USTA 2LA6A 5L1JA 4O4RA 2KVQE 4B9UA 2XS2A 4LFBF 3Q8QB 1R43A 1NJIO 3J80O 4KHNA 1RQ0A 1DAXA 4E0DA 3JSRA 3AA8A 5HMXA 1JLAB 2A1BA 4LF4J 3KFWX 2VOPA 3WNFA 3PW4A 2QMUB 5KFPA 1RISA 4A8MP 1RU2A 4FLYA 4DR7J 3QT6A 2ZZTA 4I6WA 3S7RA 1I3OB 4OLAA 2R7VA 1QZ6A 5HMZA 1N54B 1N32K 2OEMA 4P75A 2YKQA 2DD8S 1JKHB 1OMSA 3MECB 3QAUA 2VGNA 3TVKA 3AV9A 5J2PA 4OX9J 3MMVA 3L6QA 5AXNA 3VTIA 3AAPA 4ZP8A 4KQZA 2DY4A 3MUTP 1C2PA 2ZNZA 3K0SA 1S97A 3TX8A 3E01B 1YVNA 3O08A 3TI0A 1YZ7A 2YWEA 5HP1B 2EFQA 3IBCB 2DGTA 4WYWA 4H5NA 2W2PP 1NUEA 1PBAA 2HMPA 1HBUA 4M45A 1HYVA 4FLVA 2VFVA 1TUWA 2BKPA 1YJ7A 4BC5A 4ICLB 3DLEB 4M5KA 4NRUA 2DHGA 2A1SA 1C6VA 2BE7D 4ED5A 2C42A 5HN0A 1WBDA 3DMJB 5JLHA 1F21A 2ZC4A 1F2GA 5KOXA 3LH2S 1W25A 1PILA 2ZWHA 2AYEA 3G6XA 1SJFA 1H2TZ 3LPTA 3L2UA 2XI2A 2CWKA 2Z2LA 4CO4A 1RTZA 3ZZPA 4ED3A 1C4AA 3NF6A 1DJ0A 2Q97A 4F8RA 1VLOA 2I2YA 4PXDA 2E1PA 1I1GA 3CD5A 3P5BP 4Y2KA 2L08A 4H0VB 3MPDA 2QTWA 2DYAA 1Q8LA 2M0GB 4NB4A 5AXMA 4AL5A 4MIAA 3OYCA 3HSGA 1FNMA 2WVFA 1AFJA 4EHTA 3GR1A 1WKLA 3M7VA 2VG6A 2CNLB 2ZM6K 2YNGA 3A2FA 4RNHA 1FJ7A 3FRZA 4KYZA 2L9WA 2H4WB 3D2FB 2V8GA 1K73T 1TKTA 2DIUA 1XMOJ 1X9SA 5AZJA 4LF4F 1GX5A 4H54A 2F9DA 4C8KA 3NGYA 2HVZA 4JUZA 4C3LA 4B9QA 2PN6A 4DFJA 3HZ6A 2OELA 2DNRA 4HACB 2Z57B 3VAJA 1M5VC 1EKSA 4IG3B 1LFWA 1VQ9N 1RAHB 2J7KA 1LWEB 4OO1J 3U3GA 4BRDA 2DNZA 3CCJS 1Q4RA 4IEIA 4BRQA 3PDNA 2P9CA 1Q7YO 2XWYA 3R5JB 3DOLB 1OPZA 2OAUA 3DDIA 1U8SA 2LEPA 4OX9F 4R8UA 4Y2MA 2LQJA 3HFVA 2RHKA 4O0NA 5KOWA 2IAJB 1UMJA 3K8VA 2C3UA 2UUBJ 1VQ6S 2Z2MA 4OZ3A 3L3CA 4NLDA 1RE1B 4Y28C 3HPGA 2XMWA 2H5EA 1S72S 3TYTA 1HKGA 1JJCB 2QE5A 2VCPA 4CHZA 4CD1A 4RUHA 4N8NA 4PKHA 2RN2A 1PGZA 3OTBA 2B4PA 3DXBA 3K9JA 4KFBA 1ZTTA 1A5VA 3AVCA 4XAKA 4AHSA 1WHWA 2V34A 2AU0A 4A59A 2EBGA 3Q23A 3W65A 3HZGA 3DWLA 4KHPK 1RCXB 1VQ5N 3I5AA 3BF3A 2BMBA 2KG0A 1WOPA 2KTQA 3VGSA 5DDRC 2IM3A 1X5PA 4OHXA 2X1FA 1UZDA 4W5QA 1Y5LB 4DQQA 4TY8A 3NH0A 1BCOA 1QD1A 2IDLA 3OYHA 1F0XA 4J9NA 4F4KA 5KG1A 3MTJA 4H0YB 5G4DA 3TUIC 1RKJA 2XZTB 2UVWA 3PFOA 2OLWA 1DURA 2PFFB 1KQKA 2LP4A 3ZTQA 1DTTB 3O6WA 2BANA 3BKFA 2B5JA 5M2PA 3GIIA 1HKAA 3RG6A 4WYBA 1H7WA 2VPWB 3TTDA 2HNDA 3MUMP 1BUXA 2QMXA 4TU8A 1U47A 4GVBA 2Q79A 4F50A 5BN9A 2KU7A 5JVGL 2LDYA 2IVOA 1T05B 3FSXA 3DOKA 4ZITA 1P8ZA 4EEYA 1EARA 2BXJA 1U8WA 3THXB 1FJEB 1B3TA 1UOCA 2VFRA 1WSFA 5A8RA 2FBTA 4MMOA 4F2SA 2E5GA 1VJQA 2HHPA 3ADAC 2ZJPL 3ID8A 2CGKA 1DFDA 2UUBF 1WOQA 4TLRA 2RHSB 2DNKA 4TQSA 4JI8K 1JLQB 1IM6A 2O8CA 4YY3J 3CD6N 1NXIA 2FZGB 4X4PA 2OPQA 5KG3A 4I4BA 5L9NA 3N5BA 2W7OA 2YQ1A 4QOZB 4N76A 3UCZP 3FZLA 3M8RA 2P5OA 5ADZA 1ZA2B 4RW9A 3UNYA 3HD2A 3CO9A 1MN7A 1V5VA 3CJKA 4IJAA 2ITGA 3V9XA 4TXSA 2HQCA 1VBYA 2D69A 2VKRA 5KFGA 1HLUA 3ZSVA 3JQMA 4O4GB 4UW2A 2O4GA 2DR7A 2WVDA 1YJTA 5E3PA 4FXDA 3SAHA 1ZM9A 2P9KB 1CEZA 3MM9B 3ZCMA 2UU9K 3ZT4A 2RS2A 2OSQA 1IXKA 1FK9B 3LP2A 1FXLA 3DI6B 2AEFA 3Q86A 3CDUA 4DF8A 3AD9C 3T5KA 2U1AA 1N56A 1KVIA 3VEOA 3NF8A 4R5PB 4BRGA 4K5SA 1K9MO 3U9DA 4F36A 2JZ5A 4DG1A 3AXKA 4ZLJA 3HJFA 1X9JA 1HPZB 3D54A 2V51B 2OD4A 5FRMA 2JWLA 3H5SA 1DLOA 1U1MA 4X65J 4RWWA 1R3NA 3T9NA 3O4QA 1RGIA 1JXBA 2QSWA 1BWVA 5A6PA 2QWRA 3G4SN 2ASY