1S6PA

Crystal structure of human immunodeficiency virus type 1 reverse transcriptase (rt) in complex with janssen-r100943
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
total genus 124
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s6pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s6pA05
3DRRA 1HQEA 1RAJA 4I2PB 3KLGB 3DOKA 4NYZA 2ASDA 1VRTB 3GV8B 3HL8A 4Q8FA 4K4TA 3KNAA 2G8KA 3OYIA 4B8AB 4R5PA 3SI6A 1W9HA 1HARA 2VG7B 3S3NA 1SKSA 2FBTA 1LW0B 4O4RA 4LQ9A 1SV5B 4F3OA 2F8SA 3NE6A 3QEWA 1HNVB 2VWJA 1NNDA 5EWGA 3DI6A 4DU3A 1VRUB 1BGXT 3BGRA 4KI6A 4RW7A 3NF9A 3KJVA 4M3TA 3M8PB 5D3GB 3MXJA 4KSEB 4CGHA 3M9NB 2R8JA 2ILZA 4J2AA 3NBPA 5L1IA 3RRGA 5HROB 3MFHA 3C6TA 4HUEA 4DFPA 3ISNC 5KFOA 3ITHB 4ZVFA 4ECXA 3KKSA 1WSFA 1RTIB 4KTWA 1D5AA 3CG7A 1L3SA 2W8LA 1X9WA 1L5UA 5C25B 4FJIA 1R0AA 4EZ6A 3SJJA 3DYAA 4B3OA 2XI3A 2YKNB 1WNEA 4IH6A 1VSKA 3NF7A 3WNEA 4I2QA 1RTJA 3G86A 3OLAA 1DTQA 3ZSWA 2IBKA 2GV9A 4FM1A 4K4WA 4Y34A 3U3GA 3OSPA 4FJLA 4CFDA 2AU0A 2AGQA 1X1PA 3ZSZA 1CXUA 4DL7A 4KI4A 2FBXA 3VQ9A 4ZHRB 1RT4B 4FLZA 3KLFA 4E1NA 1UWBA 2R8HA 2GIQA 3RRHA 1J53A 3ZSXA 3V81B 3QIOA 2X6SA 1U45A 3CFPA 1TQLA 3CJ3A 4ED0A 2E9ZA 1LWEA 1TKXA 1UA1A 4LSLA 3DLEB 4MK9A 3DMJB 4EBCA 4TYAA 4Q8EA 1IKVB 3MECB 3C6TB 3SYZA 4CGDA 4M42A 1WSGA 1HQUA 4KHWA 3TARA 4ZVEA 1S1UB 3QZ7A 5FDLA 4ECVA 2JEIA 3RB6A 2FLNA 2HHVA 3LANA 3H98A 3UDLA 3K5LA 3DOLB 2HHUA 3KLIA 4Q0BB 1DTTA 2IM1A 3V81A 5EWEA 4FJKA 1R0AB 4TSXA 1B9FA 5K14A 3AO1A 5C42B 1S9FA 3CFOA 2YNGA 3SUOA 4DSJA 5DQHA 4RW4A 5KFVA 1JL2A 2C22A 1XC9A 1NOYA 3L2WA 3PR4A 4ELTA 4DSFA 2JEJA 3E01A 4TY8B 1RTDB 1L3VA 4G3IA 1TP7A 3HPOA 1RT3B 4IG0B 3QEIA 2IM2A 1DLOA 1D1UA 4RUCA 1WSIA 4CEQA 4KREA 1QAIA 3NHGA 3FQKA 4B3OB 2RKIB 4DL4A 4JV2A 3PW4A 1VSJA 4FYDA 3GQCA 3PX6A 3DLGA 1BI4B 3QEVA 1S1XA 4PY5A 2IAJB 3RAQA 3PW0A 3KIOA 5I3UB 2FLLA 4TN2A 3V6DA 4H54A 5L1LA 4NLOA 4O3OA 3HPGA 5C24B 1S0NA 4MIAA 5KFMA 3P83D 4DTJA 4ZPDA 3M8QA 1MU2B 3L2RA 1RTHA 2WONA 2OYQA 1T8EA 1JIHA 4WFYA 3OL8A 4M3ZA 4H4OB 3QGGA 1U04A 3LP1B 4KRFA 3RMBA 2G8IA 4F8RA 1C1CA 4IRCA 3QGIA 1RYSA 2KQ2A 4OJRA 1S5JA 4B8CA 4CEZA 3EYZA 4CGJA 2YNFB 2D7SA 1NKEA 4U6PA 1S1UA 4EP5A 2FJVA 3FFIA 4WYWA 4CEOA 3CYMA 1JLBA 1RTDA 5T14A 3N6LA 3OSNA 4CHOA 4EO8A 3SFGA 5F8GA 2HNDB 4JV0A 1QUVA 4RNHA 1RT1A 5HBMB 1UAXA 1SV5A 4NCGA 3AO2A 4ZP8A 4FM2A 1NK5A 4Y2CA 4HCBA 5CYQB 3SCXA 3I8DA 3RMCA 5KFCA 4O0IA 2IM0A 4YQWA 3HP6A 1JLCA 1RDRA 2FVQA 2AWZA 3LWLA 3AVFA 3U3YA 4LQ3A 1VSMA 3QETA 3CJ4A 4YFUA 3AV9A 2BQUA 2YKMB 1W0HA 4E89A 1S4FA 2XY6A 2OPSA 2EC0A 2VA2A 4J9SA 4Y3CA 4O3SA 3MEEB 1XR6A 3MEDA 2IS3A 2X74A 5KI6A 3I0RA 3PJWA 2Z1JA 4I9LA 3KD5E 2DY4A 4MKBA 3RWUA 1S1XB 5T7BA 3DM2B 5F9LA 4O3QA 4E7LA 2IGIA 3H40A 4FJJA 3KK3B 4K4XA 1JLQB 3O3GA 2D3UA 2HB5A 3V6DB 2R8KA 1KTQA 4DQIA 4I2QB 3OL6A 4EBDA 1RDAA 5C24A 3P5JA 1BIZA 3HVAA 4URSA 4YMEA 4CGFA 4Z4IA 1UA0A 1REVB 5J2MB 5KGWA 4O44B 3L8BA 3IGNA 1K6YA 4FJ9A 4J9LA 2AJQA 4J2BA 4F2RA 1HPZB 3KLHA 1TK0A 4FXDA 4PQUB 4IDKB 2OPPA 4Q43A 3MXMA 4CHYA 3G6VA 5FRMA 1I6JA 2ZE2A 3OYCA 3AVCA 2W9AA 2HWHA 4FLVA 3OVNA 4CJRA 1S0OA 1N5YA 4QAGA 4CEAA 2XO7A 4EYHB 2B6AA 3OJUA 4K4YA 4TQSA 4J9NA 4I7FA 1YVUA 5KT3A 2C28A 4NLTA 5J2QB 2XRIA 3TI0A 4AHVA 2HNDA 1Z4UA 3GIKA 5L9XA 4LH4A 1HQUB 3TAPA 4FJHA 2XY7A 5FROA 2LSNA 4FLUA 1VSHA 5KFTA 2FBYA 2BR0A 2QKKA 4LH5A 2D5RA 5KFKA 4DQPA 4E19A 3HK2A 1T03A 4BE0A 3NGZA 2ATQA 4BDYA 3RB4A 2OA8A 1IKXB 3VQDA 4AHSA 4YR2A 1A5VA 1N5YB 4EO6A 3NFAA 5JXSA 3DLBA 4ZVGA 3HKWA 2PYJA 3FQLA 4DTPA 1KCFA 2UUWA 3JYTA 2ZKUA 5DQGA 1JXLA 4OPJA 5JS1A 4XPEA 1WAJA 4J9MA 5I42A 4KHNA 1CSJA 4IDKA 3KKRA 1T03B 4OLBA 2P5GA 4OL8A 5KFSA 4KKOB 4BE2A 4IQXA 2HW3A 3HXMA 1ZTTA 4RW4B 3N6NA 3K5MA 4FM0A 2IMWP 1U47A 4O44A 3GIJA 4NLYA 3OL7A 4CJ3A 2W9BA 3NBPB 4CFCA 4KHUA 2KFNA 4TY8A 1JLAB 2ASJA 2KZMA 3NMAA 3ZT2A 2FVCA 4WE1A 4KB0A 1Q8IA 2CKWA 2O5DA 1XWLA 3RB3A 3UQSA 5HRRA 3DLKB 4DFKA 1J5OA 3C94A 3DRPA 3DRSA 1RCHA 4GW6A 3G6YA 3OYGA 3CM6A 5J1EA 2NUBA 3AA4A 4FW1A 3QNOA 4KKOA 2QK9A 4FJ5A 4BWJA 3TAQA 5DG9A 3HPHA 2WK4A 3BR9A 4GC7A 5CY4A 1C1BA 3TAMB 4PA1A 5KFPA 4URGA 3GIIA 1S97A 1QSLA 3SQ1A 2WOMA 2BGGA 4OGEA 4F3TA 3LPUA 3P1GA 3RAXA 3HSTB 3OYNA 4DMNA 2FJWA 1D8YA 4H4OA 5CYQA 4WZMA 4DL6A 3OS2A 4FJ8A 3KLEA 1IKXA 1JL1A 4F4YA 2YNFA 4FJGA 4LSLB 4YR3A 1HMVA 2R2UA 1LV5A 1K1QA 2GBZA 1IKVA 3MECA 4K4VA 3V9XA 1WAFA 2BANB 1U09A 4F2SA 2UVVA 1BIUA 4K4UA 5KFFA 3NGYA 5KFUA 1NK7A 3FFIB 1EETA 1F21A 3VQAA 4C8NA 1TL1A 3BQ1A 2GUIA 1HYSB 5E41A 4ED2A 4QWAA 3SQ0A 2CJQA 5HRSA 4KV8A 4O3RA 1LWEB 1TKXB 2X6NA 2YNHA 2QV6A 1SL1A 1BQMA 3M9OB 1BISA 4O0JA 4QWCA 2D0CA 4ID5B 3DLEA 5KFAA 5JUMA 1FKOA 2IJNA 3H5XA 3E51A 1YT3A 4KO0B 4CJFA 1ASWA 3PHEA 1HNIB 4EP4A 4C8LA 4MK7A 4LY7A 3PV8A 3ASMA 3FDSA 1S1VB 4R0EA 4K4ZA 2XHBA 3VQEA 2WCXA 1S6PA 4KBIA 1VRUA 3AVBA 3WNGA 1B9DA 1QQCA 3S3OA 3K58A 1IKWB 3C6UA 3HT3A 4CIGA 1GOBA 1BQMB 3M8RA 2OZSA 1RT2A 3ITHA 4EEYA 4KB7A 1NK8A 1RT5B 1TK5A 3SUPA 4FLXA 4QOZB 4DG1B 1HNVA 4CJVA 3EPGA 3G0ZA 4IR9A 3H4BA 1EX4A 1S6PB 1S1WB 2R7YA 2Y1JA 3KJVB 1RNHA 4JS5A 1RT6A 3H08A 3NCIA 2F96A 4GVMA 4KAIA 2JEGA 4R8UB 4U7CA 5DLFA 4LSNB 1CLQA 1RBSA 3KMQA 1XHZA 1S1TA 4CJSA 3OY9A 1WSHA 3LP2B 4ELVA 1RBVA 2O4GA 3T5HA 2Y1IA 3Q8RB 5KG5A 3SPYA 4QW8A 1JLBB 3VQ6A 3CFRA 1XI1A 1RBUA 4FLTA 2HAIA 4J2DA 1J9AA 3QEXA 4NCGB 3BJYA 4J9OA 4RNOA 4CCHA 2PYLA 4OKJA 3C6UB 3O4NA 3GV7B 4CHPA 1I39A 5KFQA 3NGDA 5DG8A 2PZSA 5KFRA 4ED1A 5EUHA 3OYMA 4RUAA 3GILA 2FVRA 1S1VA 1S10A 2BQRA 1JLAA 1RT4A 3T1AA 4KTQA 2AQ4A 1KFDA 2FBVA 3OYLA 4M45A 2VG6A 1JKHA 1SUQB 4NLSA 1KFSA 3LAMA 3PO5A 4QCLA 4Q5VA 4E7HA 1FXXA 3I0SA 3I0RB 1VSFA 3CWJA 4KHRA 4IFYA 5J1EB 4MIBA 4E7JA 5KRTA 2VG5B 1XR7A 4ID1A 4KHYA 3IN5A 3AVNA 5F8MA 3ZSRA 2XY5A 1C2PA 4BWMA 4J2EA 5J2PA 2IC3A 4OLAA 4B9TA 4CESA 4WE1B 4DSIA 2HNYB 3DM2A 3DOLA 3HVWA 1RT6B 4W5OA 1D9DA 4FS2A 3MXIA 1S6QA 3FSIA 4CJEA 4CJ5A 4CK2A 1OS5A 3M8SA 3V1RA 4ZPAA 3CVKA 4HHTA 3D28A 4DSLA 4JRPA 1A5WA 4NYNA 2FVPA 1WLJA 3EZ5A 3ZSVA 4RNNA 1G15A 1ZBUA 2QXFA 3V9SA 4DQRA 2E6MA 5HRNA 5HROA 3LP3A 2WOMB 2BRKA 4FCYA 4NLPA 1LW0A 1W25A 5KFYA 4ELUA 4O5BA 1RT7A 1RT3A 3M9MB 3IG1B 3HO1A 3MEGA 3H5UA 4DQQA 3M8QB 3NF6A 1BHLA 1O1WA 2XY8A 4DTXA 4C8KA 3QLHB 3TANA 3QIDA 3BSCA 3H5YA 4F4ZA 4FK2A 4NLVA 2AX1A 3ZSOA 1S9EB 2ZD1A 4KFBB 2AGPA 4M3XA 2F8EX 4ED8A 1TKZB 1BCOA 1C0MA 2BANA 5DQIA 2HHWA 4RNFA 4IOBA 2E4LA 4K50A 1HMVB 2EX3A 1DTQB 2R8IA 1EP4B 4N5SA 2JEFA 3HJFA 4FJXA 1JXBA 4KAZA 3JSMA 3IRXB 4ED7A 2WONB 3NL0A 4C8MA 4CJUA 4AHUA 4DQSA 2IC3B 5KG0A 1GX6A 4J9RA 4ZP9A 2WHOA 4CFAA 3KLFB 3H5SA 4Y1CA 3VN5A 3V4IA 4FZXC 2KW4A 1A5XA 1S6QB 1NOZA 5KFBA 4ZPBA 1N6QA 1ASUA 4RW9B 4XO0A 3TR8A 3F73A 4G1QA 4EYIB 2D3ZA 2P5OA 5KFXA 4CE9A 1RILA 4E7KA 4UQGA 1TVRB 3VQ7A 4Z4GA 1RA7A 3H59A 1JLFA 4DTNA 3PY8A 4ZMMA 3GV5B 4AH9A 3CJ0A 1S49A 4BDPA 1RDDA 4FK0A 2QKBA 1IKWA 5KFIA 3OLBA 2BRLA 2J6SA 1RYRA 3QYYA 1IG9A 3QLHA 4QWDA 4N47A 3ZT0A 2HHSA 4JRQA 2IDOA 5SZTA 2Z1GA 3QERA 2G8UA 3SUNA 3VQ5A 4W5QA 3QEPA 4NLDA 2YHBA 2W9BB 3NGIA 4CEFA 5K14B 3BQ2A 4F50A 4ECYA 5KT2A 1RDBA 1TKZA 1L3UA 3ISND 4O3PA 4Z4HA 4N56A 1REVA 1GOAA 1C0TA 5F9NA 3I5BA 2W8KA 3IGVA 4RZRA 2VA3A 4X2BA 1XR5A 1EKEA 1EP4A 3AA2A 2BE2B 4IH5A 2E6LA 3CJ2A 3THVA 4OVLA 1HJRA 3L2QA 3DRPB 4TLRA 2XCAA 4DLEA 3QNNA 4ZTJA 1HPZA 1SH2A 3DDKA 2P51A 2UUTA 3PJXA 3AVHA 1NJZA 3L3VA 5DG7A 3VA0A 4FBUA 4AHTA 3AO5A 3LZJA 1WNSA 2JGUA 3MR3A 4IKAA 3O3FA 1SH0A 3CJ5A 2OH2A 3VQCA 4CJPA 3NAEA 5HP1B 5KRSA 1KVBA 3SV3A 2G8WA 3MF5A 4Y2AA 4RU9A 4L8RB 3QIPB 4NYFA 1TL1B 4QW9A 1RA6A 3KLHB 3RMDA 4EZ9A 3LP0B 3V4IB 3UR0A 3OS1A 3KOAA 4Z0UA 1TL3B 4PUOB 2C2EA 4DFMA 5KG1A 1LAWA 4NLXA 3L2UA 1ZTWA 1JXEA 4HUGA 4CJWA 2GC8A 4E0DA 2B5JB 5F8NA 3QGHA 4TYBA 3QO9A 5D3GA 4J9QA 5EU7A 3Q8PB 5KFEA 4TY9A 2XC9A 1TV6A 1RTHB 2FJXA 4IFVB 3Q8QB 4CF1A 5EWFA 4QPXA 3TQ1A 2VG6B 4RW7B 1VSLA 4CGGA 3I0SB 3M8PA 3N6MA 4ID5A 3OHAA 2DFFA 3SZ2A 4CJ4A 5C25A 4IFYB 2BQ3A 5KFWA 4KO0A 2F8TA 3CIZA 2E9TA 4KPYA 1TK8A 3PW7A 1BQNA 1ZYQA 3AVKA 5F8LA 2DPJA 4GC6A 2RDJA 3I5CA 5CZ2A 3HHKA 4IH7A 2OPRB 2A1RA 3QIPA 1GX5A 3NAIA 2I1RA 2RF2B 2IA6A 3AO3A 3T3FA 1JLGA 3TVKA 3T19A 1NKBA 2HHTA 5FRNA 1KLNA 4WFZA 1FK9A 1TL3A 4HCCA 5DK5A 2J6TA 4OGCA 4CHZA 1S9EA 2ZD1B 4KFBA 1RT5A 3BSAA 5KG6A 1C1AA 4M3WA 2JC0A 3AVIA 2J6UA 2UVWA 3IS9B 2G8VA 3IG1A 2ZQBA 3SUQA 2ILYA 1QSYA 3PUFA 1NK6A 3NH2A 4JLHA 4NLUA 1QE1A 1TKDA 3CDUA 4CF0A 4FJMA 1S1WA 1FKPA 4HUFA 2DTUA 1C6VA 4PQUA 4DTSA 1EXQA 2OPPB 4NCAA 1KVCA 1JLEB 3CDWA 3HVTB 4MFBA 2R2TA 3F9KA 4FW2A 1SH3A 2UVRA 4RW8B 3KHGA 4J9KA 4O4GA 1KHVA 3TAMA 2BDPA 1TV6B 2YV0X 2WB4A 5HRPA 3K57A 1VK0A 1T05B 2B43A 3ZSQA 3PR5B 2C2DA 1D0EA 1LW2B 5KGXA 3V9ZA 1TAQA 1RBRA 2G8HA 1B92A 2WRMA 1RDCA 1L3TA 4DS4A 4B9NA 5DGAA 3LAKA 1SL0A 4TXSA 4G1QB 1QHTA 2GIRA 2W9CB 4M3YA 3PX4A 5KFGA 4ZP6A 2D0BA 3BSOA 4NLRA 4O4GB 5L1KA 3OYFA 3L2VA 4FJ7A 2HWIA 1KLMB 1S48A 3IS9A 1TAUA 3K59A 1RTIA 4KV8B 4BE1A 3VQ4A 3VQPA 1CZ9A 1IKYA 1LWCB 1N4LA 1FK9B 4B9LA 4IG3A 4PWDB 3TAEA 2FVSA 4CHQA 4O55A 4ICLA 2OPQA 1KHWA 3LALA 1JX4A 4ZPCA 4FK4A 1T94A 5JS2A 3LPTA 4MFBB 4FZYA 2BE2A 2X78A 5KG2A 2AGOA 4FS1A 4B9SA 5HP1A 5J2PB 1VSEA 1KRPA 3MTKA 4M94A 4FZZA 2HNZB 4DFJA 4IRKA 1YTUA 3UIQA 4CJKA 3MEGB 1UWBB 1LWCA 3RR7A 4ZTFA 2HVIA 5SWMA 4IG3B 3RB0A 2D0AA 3NAHA 3AVAA 3KK2A 1C1CB 1TGOA 4RW8A 4DTMA 3DRSB 1LWFB 1RTJB 2W9CA 3V6JA 4CIEA 3B6OA 5DMRA 5KFJA 4ZHRA 4YNQA 4HTUA 1NHUA 4CIFA 1RT1B 5HBMA 3QESA 5CYMB 3AVLA 3ZSYA 5KFZA 1KLMA 3O3HA 1MMLA 2I5JA 1S9GB 5KG3A 3SI8A 1C0UB 2XCPA 4IRDA 4KHMA 4W5NA 3S3MA 2V4RA 3AO4A 1NHVA 2ATLA 4NRTA 3MFIA 4CJTA 1N6QB 4Z4CA 1JLQA 3GYNA 4RW9A 4EBEA 3K2PA 3O4QA 2YKMA 1NJWA 3SPZA 1NK0A 3IAYA 4Y1DA 3VQ8A 3JSMB 3G6XA 3U6FA 4Z4FA 3IRXA 1Z25A 4NCBA 3MEEA 2D41A 4GMJB 4YP3A 2KFZA 3DRRB 1DTTB 4CJQA 2ASLA 1VRTA 3MR2A 4N41A 4HVJA 3KK3A 4I2PA 1ZBLA 3SV4A 4AHRA 3QZ8A 4MQ3A 3WNFA 4QWBA 3OHBA 4H8KA 4Q44A 1Q9YA 2ZE2B 5C42A 3DLGB 1ZETA 4F4WA 2O4IA 3EY1A 4R5PB 3D5MA 4CEEA 4W5TA 3NH1A 3OYDA 3OYEA 2AX0A 2OPRA 3WNHA 4CEDA 2HNZA 3AA5X 2HMIB 3FRZA 4ECTA 3UPFA 5KTQA 4CJLA 3V6HA 1QTMA 3K5NA 4M95A 3DI6B 1WN7A 2WTFA 4OPKA 4NLQA 3OS0A 3CDEA 3RBEA 2ETJA 2YHAA 1TKTB 3PW2A 1IH7A 3NH0A 2Q3SA 4I7FB 2IAJA 3HVTA 2JC1A 2VG5A 2E9RX 4CK3A 4MK8A 1C0TB 4WZQA 4BACA 4CFBA 3I5AA 4W5RA 1MU2A 3OYBA 5DLGA 4DL5A 3LDSA 4AILC 1IO2A 5KT6A 1VSIA 4IR1A 2W7PA 4ED6A 4M3RA 2YKNA 1ITGA 4JS4A 3V1OA 3LP0A 4NLGA 1ASVA 3LP1A 4CEBA 3PO4A 4WFXA 3LZIA 1RT2B 4AHCA 2HVHA 4O3NA 1WSEA 2W7OA 2C2RA 1Z26A 4CERA 3Q8SB 4M3UA 4ED3A 4XIUA 4FVMA 2OZMA 1T05A 3L3UA 1SKWA 3ZT1A 4DTOA 4F4XA 3NF8A 2B4JA 2RDIA 4TQRA 4Q45A 3PZPA 4DF8A 3QINA 2XWYA 2B5JA 5L1JA 4DL2A 4IBNA 3MEDB 4CF2A 5KFNA 3KLIB 4Q0BA 1U48A 5KT7A 4MKAA 4R8UA 3MR5A 2PY5A 3KLEB 4HKQA 4LSNA 4WXWA 1TKTA 3KLGA 2YNIA 4K4SA 4ZVHA 4RW6A 2W42A 2V4QA 2G8FA 3C95A 2R2SA 3KHLA 4YR0A 4DG1A 5F8IA 2RN2A 4ECRA 3V6KA 3E01B 4IG0A 3V9WA 4ECZA 4PWDA 1HYSA 3MR6A 3ALYA 5KG4A 4HYKA 1ZBHA 4ECQA 1IKYB 4N76A 4KHQA 4WXOA 4URQU 2YNGB 2IJFA 1X9MA 1HYZA 3DOKB 2IOCA 3SFUA 4ICLB 4CK1A 4F4KA 2EHGA 1ZBIA 3HYFA 4ECWA 5KT4A 2IM3A 3TAFA 2YNIB 1HYVA 1CZBA 1BI4A 2XGQA 3KHHA 1T3NA 1DLOB 3LP2A 4K8XA 3H2LA 3K5OA 5KFDA 4OKKA 3OYHA 2DPIA 4DS5A 3PW5A 4XPCA 3RR8A 2RF2A 4DU4A 3H4DA 1Y97A 2ALZA 2VWKA 3AVJA 3DLRA 2Z1IA 3KK2B 3ZT3A 3DYAB 5DGBA 1C0UA 2A1SA 4H4MB 4DEZA 3VQQA 1QAJA 2V9WA 3OJSA 3NKYA 1I3AA 2HHQA 3HVRA 3OYAA 5I3UA 1J54A 4RG8A 2HHXA 5KG7A 2B6AB 1N56A 3T5JA 1FKOB 2R2RA 1EETB 4B08A 1SKRA 1WSJA 1X9SA 4M41A 4CGIA 2R8GA 1S9GA 3PVXA 3KLVA 1HNIA 3VQSA 2XGPA 2DFHA 3TWHA 2KZZA 3D45A 4E1MA 5CZ1A 1FKPB 3KD1E 4PUOA 1LW2A 5I42B 3ZCMA 1SL2A 3ZT4A 4B9UA 4H4MA 3SQ4A 4FBTA 3AVMA 3DMJA 4RW6B 1IM4A 1JLCB 3CM5A 3KK1B 3EPIA 3V1QA 4RNMA 3QO9B 2Z1HA 1NKCA 3DLHA 3ICLA 2ITGA 3A2FA 5HLFA 1YTAA 4JUZA 1KSPA 3KTQA 3S9HA 3EZUA 4OKEA 3AA3A 4DU1A 3BSNA 4B9VA 3T5LA 3KHRA 2OPSB 4B9MA 2HNYA 4LD0A 4KTZA 4CF9A 4K8ZA 1QS4A 4E3SA 5FDLB 2UVUA 1NJXA 1GOCA 5KFLA 1J5OB 3ULDA 1UOCA 1XHXA 1HQEB 3SQ2A 3CQ8A 4FLWA 4NLWA 3TABA 3HP9A 1N48A 1K1SA 2OPQB 5KT5A 4I9QA 3KK1A 1RT7B 3OYJA 1BQNB 2HMIA 1U4BA 5J2MA 3CO9A 1C1BB 3KMSA 4IFVA 4ZP7A 5HLFB 4KHSA 2QE5A 2VG7A 4DSKA 1S1TB 4DLGA 1KVAA 3AVGA 4ECUA 3DLKA 4NZ0A 3SNNA 4CHNA 3T5KA 1CXQA 3BQ0A 3RMAA 3RBDA 1NK4A 3B6PA 1QSSA 4DWIA 2RPIA 3OYKA 4E7IA 1JLGB 4KB1A 1LAVA 3D0PA 1BL3A 3BREA 2P1JA 4JV1A 3TAGA 3VQBA 1BCMA 1TVRA 4CF8A 1U49A 5J2NA 3RTVA 1JLFB 1Q9XA 5J2QA 2FC0A 4MH8A 3PX0A 4ECSA 5KFHA 3HM9A 1YVFA 1VSDA 5C5JA 5F8HA 4DSEA 2DFEA 3VA3A 1QE1B 1NJYA 2V0NA 4CECA 4C8OA 3MAQA 3BGRB 2RKIA 2XI2A 4DL3A 5CYMA 1LWFA 1HRHA 2YNHB 2FLPA 3NDKA 1JLEA 4DF4A 4FLYA 4DTUA 3OL9A 5F8JA 1ZBFA 1S0MA 4IKFA 4WYLA 4BDZA 4KE5A 4NRUA 3GIMA 4DTRA 5EDWA 3BDPA 1D9FA 5J2NB 4QWEA 2KTQA 2JLEA 1JKHB 1SUQA 4Z4EA 3LWMA 1NK9A 3JYTB 2I5JB 3G10A 4J9PA 1RBTA 3V9UA 1T7PA 4FJNA
chains in the Genus database with same CATH superfamily
5C2GA 2QL5B 5HATA 3DOKA 4NYZA 1N32K 2CPJA 3OYIA 4RUHA 4R5PA 3CCLS 4M5LA 1UFKA 1HARA 1WSVA 4FSVA 3S3NA 2B8QA 5K8PA 4LQ9A 1FJGK 1SV5B 4KQZA 3NE6A 3ZTQA 3QEWA 5I4MA 2VWJA 1NNDA 5LT5A 1CPZA 4X66J 5HMXA 4AM6A 2Z4PA 1VRUB 3DCAA 3AXKA 2CFXA 4M3TA 3GYGA 3MXJA 4KSEB 4YDDB 4CGHA 2A1BA 2FPHX 2G2OA 2ILZA 1U8WA 4I6MA 3NBPA 1S59A 3C6TA 1DJ0A 3M05A 2OELA 1NGAA 5KFOA 2RS8A 4ECXA 1T9WA 3G4SN 4HDHA 3WQUA 4JOUA 2DPNA 2MLZA 4Q2LA 1C0GA 2P5VA 3IWLA 1D5AA 5AQJA 1X9WA 2LU2A 2QFIA 3EGNA 4CZIA 4EZ6A 4QZVB 3SJJA 1N32J 3DYAA 5FJ4A 3ZZYA 2CQBA 3IKMA 4UY8T 3NWRA 2DKOB 4KGMA 3QAEA 4CBWA 1IBMK 4P9SA 2J7UA 2DGVA 3ZSWA 2Z58B 2IBKA 2GV9A 4K4WA 1TUVA 3D6RA 1T9TA 1B0VA 3OSPA 5GAGP 3UVJB 2AGQA 1X1PA 4RTFD 3ONQA 3CMAN 3Q8VA 4KI4A 2KKZA 2ZUAA 2DR8A 1UWBA 5E0OA 2GIQA 2YCHA 3ET6B 5C7PA 4J9VA 3CFPA 4ED0A 4XH1A 2M52A 2YHYA 2E9ZA 4BHQA 2VC1A 3T1HK 5IT0A 1U25A 2RHKA 4EBCA 4WU3A 1ZAXA 1IKVB 3MECB 4PXBA 1GLCG 1IVZA 4DXLA 2QWRA 1URNA 2H51B 2FXUA 3LM2A 2V2KA 1MDUB 1Y3JA 1U0SA 4DV7J 3F56A 2MKJA 4CZCA 3RB6A 3CF5Q 2HHVA 3LANA 2YKQA 2HHUA 4JKFA 2DR7A 4Q0BB 3J7AN 2IM1A 2DR9A 4FJKA 4HH0A 2DD8S 5MLCQ 2DNYA 5C42B 2YNGA 3N9UC 3WUHA 5DQHA 4Y2KA 1PIEA 3J7ZT 2C22A 1XC9A 2A10A 1CC8A 3L2WA 1Z05A 3O80A 4ELTA 3IFEA 3ZZ0A 2JEJA 2GNKA 3I87A 1JB0C 1L3VA 3HFZB 3VGLA 3FR0A 3HPOA 3I55S 3QEIA 2IM2A 1B7YB 2P8IA 1MG7A 2RKIB 4DL4A 3PW4A 5KQ8A 5F1XA 5M2RA 2AYEA 1X0PA 3NG8A 2FLLA 3BV8A 3PRDA 2BA9A 1KAZA 4NLOA 4A59A 3THWB 2DNHA 2E66A 1I5OB 4DTJA 4ZPDA 1MU2B 3L2RA 2H5IB 3KNGA 1RTHA 2OYQA 4OX9J 4BG9A 1JIHA 1ZH5A 4GKKK 4BC2A 4M3ZA 3QGGA 2QXLA 1CBKA 3CJCA 3CNQP 3H6EA 4CZMA 1X4FA 3PRVA 2KM8C 3A5OC 2ZEJA 1RYSA 4WKYA 1HNZJ 4KH4A 3EYZA 4CGJA 1VQSA 4FF4A 4U6PA 2MPUA 1S1UA 4EP5A 2FJVA 4DV5F 4PG5A 1FJEB 3CYMA 4B02A 3AAPA 5T14A 3OSNA 5LJVA 4CHOA 4TU7A 2N3OA 2RHQB 3I6PA 4F0MA 2VKRA 3DAWA 3I8DA 4O0IA 2IM0A 4RPFA 4DV6F 2FVQA 5HAOA 2W40A 1EHWA 1VAZA 4JI1F 4LQ3A 1VSMA 2ADBA 1VLYA 3KUHA 1GLAG 4LF4F 1K9MT 1IBKK 4OJ1A 5DM6L 4OLOA 1S4FA 1KAYA 2YVSA 2ZJRL 4LF8J 2MGZB 5IV3A 1BUPA 1XR6A 2X74A 5KI6A 2MHNA 2B3TB 4FYWB 4C1NK 4IWVA 2EWHA 2Z1JA 4I9LA 2DY4A 4MKBA 3RWUA 2N4DA 3HSJA 4FJJA 2KJWA 2R8KA 5EX5A 2KT3A 3OL6A 2UUBK 3MURP 2QFJA 2A3JA 5J2MB 1U1LA 2HGMA 1NLVA 4BRPA 1F3VA 3HHLD 3BH6B 1N5TA 3D4JA 4J9LA 2AJQA 2HRYA 2G9OA 1HPZB 3KLHA 1TK0A 2Q2RA 1YRXA 4PQUB 3VAKA 4CLZA 4IDKB 3SQOP 1FCAA 4L3KA 1BWEA 2DRBA 2KG1A 3G6VA 1WBBA 3VGSA 5DO2A 3SXLA 2QEXN 2EBGA 1HKCA 1S77D 2XO7A 2ZH6A 4EYHB 2B6AA 5CCMA 1B99A 4L3NA 1T11A 2LQJA 4M5NA 4IJNA 1ZM2A 1UZDA 2OSRA 3GIKA 1YI2S 2UYTA 4FJHA 2DNLA 3WXLA 1LFWA 3CXCM 5E3RA 4JEPA 1P9QC 1ZPWX 1VC5A 3Q0AA 3VTIA 3HK2A 3EJMA 3ZTRA 1RAIB 4AF1A 5THWA 1A5VA 1N5YB 3GPAA 4PPZA 4UOCA 4JK8A 1VQLS 3HZEA 2QWMA 1BC6A 1TR0A 3GJSB 1U2VB 1PJ6A 2B51A 3P96A 1KCFA 2N4CA 3P49B 3Q23A 4OPJA 5JS1A 2R7OA 1G7CB 2APOA 5D0EA 2V8DA 4KHNA 3NS7B 1FVSA 2DVIA 1TMMA 2DHXA 3WIVA 2Y8YA 2HW3A 4CLSA 1PYTA 4ILHA 4OI0A 4RW4B 2QL9B 1T0TV 3U1MA 4FM0A 1U47A 1YIJS 1SJRA 3HHEA 1GNKA 3GIJA 1MA9B 3C14A 2EG2A 2IHR1 4JV5K 1JLAB 2QN6B 4JI3F 4B1XB 2NZ4A 3NMAA 1RDUA 2FVCA 2ZNYA 2CKWA 1IUJA 4AT1B 3LL3A 1EQYA 5B0GA 4KR0B 1N32F 4B1ZA 1NSAA 1Q16B 4C98A 3MN6A 2RS2A 4I56A 1J5OA 1U2RA 2HG4A 1B64A 3PG9A 2B4OA 3CM6A 3OA9A 4J5OA 3AA4A 4FW1A 2YWHA 4BWJA 2RRNA 4OHWA 2HS0A 4KJIA 4X4PA 1UEUA 3TAMB 1VC0A 1OQ6A 1NRKA 3O9TA 2DT9A 3SQ1A 1K73T 4C1NI 4RO0A 3LPUA 2ASPA 1GXLA 3HSTB 3OYNA 2DNRA 5CYQA 4WZMA 3TVZA 4OYOA 4PXDA 4EUVA 3MM6A 3W2WA 2VFTA 5A8KA 2XQCA 4CM2A 1Y64A 5HVGA 2R2UA 3BN4A 2GBZA 2O66A 1IKVA 3MECA 5AXMA 2LQ8A 2BANB 1U09A 2HQFA 3IMQJ 2GCFA 1NK7A 1RK8A 2OD4A 4PKIA 4NL5A 1KP6A 1VQMS 3BQ1A 2VOPA 4ED2A 4QWAA 3SQ0A 4X4QA 5HRSA 4KV8A 1NDPA 2KU7A 4F0KA 2RDDA 5AQUA 2X3GA 1RAOA 4YB6A 1WOQA 4XK8C 4Y0FA 4ID5B 3DLEA 2MLYA 1AUSL 3P31A 1M5VC 4TNOA 1FKOA 3X1LB 1YT3A 4FF2A 4ETXA 1GMUA 3HOTA 2E5JA 1H72C 3PHEA 4ZLNA 4C8LA 1KXPA 1FXDA 3N4QA 3PV8A 4EMDA 3AAWB 1LEOA 4FPIA 4OYIA 4DJBA 3AVBA 2FSKA 3OD2A 3D7EO 3FSYA 1X4BA 1J5EF 2KYZA 2J8AA 4CIGA 1BQMB 2CQPA 4CLKA 5BN8A 1YJNN 3HSZA 4KB7A 3W5XA 1NGGA 3RUBL 4YHHF 4P7TA 3DRXA 5U47A 2E2OA 4CJVA 1CJKA 2MDAA 1N36J 3H4BA 2VICA 2EBEA 2M0GB 2GA7A 3FUYA 3WQTA 1RT6A 4BRAA 3NCIA 2ZH5A 2F96A 5GAHU 2QTDA 4UY85 3OUYB 4U7CA 4DHYA 1CLQA 1RBSA 3RAMA 2DK2A 1T95A 2XM3A 2UV8A 1S1TA 3C19A 4IOCQ 3C65A 3OY9A 2Q36A 3I9V9 2R7QA 4GV6A 1K0VA 1BQXA 2O4GA 3EO3A 3Q8RB 3MXHP 4QW8A 1JLBB 4ZOSA 1E4FT 5LJ5Y 2HAIA 2ZWHA 4F3QA 4DR2K 1OPZA 3N01A 4ITSA 3ET6A 4OKJA 3O4NA 1TUUA 5DG8A 4HI2A 4L6V3 1E3MA 5EUHA 2MKSA 3OYMA 4OJHA 5KQDA 2FVRA 2JVOA 4F02A 1KQGB 3VR1A 2DNQA 2UUCK 2VQEJ 2OLWA 4QR2A 1RT4A 3T1AA 2NLWA 1G2EA 1KFDA 1F9FA 2FBVA 2MGZA 1SUQB 1KFSA 3PO5A 3OBWA 1QZ6A 3I0RB 1VSFA 1YUWA 1BLUA 5BREA 4IFYA 4GRSA 5LJWA 3HTVA 2PAVA 3FJ2A 3HM8A 2D69A 4ISEA 3UKUA 1XR7A 5C2DA 4KHYA 4ID8A 3VV2B 4A8FA 1G6BA 1BOTO 2XY5A 5LMNJ 4BWMA 4ZK7M 4OLAA 3ISZA 3AB2B 3K0SA 3V2UC 3ZC4A 4I1TA 3KFWX 4DSIA 3HVWA 3VQTA 3QT8A 4G6VB 3BGOP 4FS2A 3MXIA 2MYFA 3FE1A 2BM0A 2O8EA 4EK2A 4DSLA 1V3ZA 4WU2A 4JRPA 1O51A 3D1OA 3TX0A 4GV9A 2FVPA 3EZ5A 1NUEA 2KM8B 1G15A 2QXFA 5HMYA 1UP1A 4DQRA 2XMKA 3HMJG 3LP3A 4E2FB 2W6KA 2BRKA 4Y0WA 4FCYA 3HFKA 1W25A 2FGOA 4O5BA 1RT3A 3HO1A 3IG1B 3R6LB 4OYXA 3MM8A 2V7ZA 1ZZNA 3NF6A 4PR6A 2XY8A 3DHWC 4C8KA 2DHGA 2CQGA 3TANA 2QZ8A 5RUBA 2IPOB 2MSSA 5B0BA 3D0IE 3HKZD 1S9EB 2ZD1A 3MM9B 2AGPA 2U1AA 2F8EX 2UU9F 1YXQA 4JKEA 2KHDA 4RNFA 1PSDA 4B17A 4CLWA 2MQQA 2Y8WA 2LCWA 1DTQB 2KKHA 2JEFA 1HR0F 2PFUA 2C3UA 1FRKA 5ADXH 5F3TA 3M7VA 2P9UB 2I2YA 2WONB 1MN7A 4AHUA 2NRTA 5KG0A 4R25A 1SAZA 2NR0A 5BR8K 2AP1A 4FWQA 4Y1CA 2VGMA 2W4CA 2KW4A 1A5XA 1S6QB 1NOZA 4ILJA 1NU0A 4PKHA 2GTDA 1KC8T 2P9LA 3B54A 2BUNA 5CQGA 2CPZA 5KFXA 3K8VA 1BU6O 1RILA 4E7KA 4BRQA 3VQ7A 4LIRA 2OSQA 2VGNA 3WX8A 2QO3A 3GFYA 1RDDA 5AE3A 3R2DJ 5KFIA 3OLBA 3HSDA 3QYYA 1IG9A 4LF6J 2OIHA 4CVNE 3FEYB 4LRFA 4N47A 4CO0A 4QWDA 2HHSA 4ZVTB 5SZTA 4DV0K 4HHHA 5A0YA 4NXNK 3MUMP 5K14B 3ENWA 4ECYA 3NCRA 3M1VB 4FOIA 4IOAL 1REVA 4OFZA 3I5BA 1XR5A 2MKCA 1EP4A 5IM0B 2PO4A 3T1YJ 3LDNA 2HGLA 3KWGA 4BC7A 3THVA 1VISA 1FKAF 2K3IA 1IJEB 3L2QA 3SBTA 1X7VA 2DH8A 2D3OR 3CE8A 1HPZA 3DHXA 3MHYA 4ZCMA 4UZCA 3LA0A 1ATSA 2HIQA 2KB2A 3AVHA 1NJZA 3MM6B 4UY8O 3L3VA 3VA0A 4FBUA 4H0PA 3MR3A 4IKAA 4X4TA 3N0VA 2OH2A 3VQCA 4RU9A 4Y2AA 4A8KA 4NYFA 2CA9A 3FZLA 1SPBP 3OTOK 3LF0A 3V4IB 3KOAA 1TL3B 4PUOB 2G0CA 2C2EA 3MD1A 3L2UA 2FGCA 2VBYA 3O1BA 3FLCO 2ZH8A 4NA3A 5LY3A 2KN4A 3RRKA 2G2YA 4YOVA 3M2RB 3O44A 1FTRA 2XG8A 2JH3A 4TY9A 1Y5LB 2NRWA 2XC9A 1OH7A 4KYZA 1RTHB 3KYLA 2E2NA 1X4EA 1EZZB 1CQNA 3DWLA 2VG6B 1L3KA 3P4IA 1FT8A 3I0SB 1W2IA 4ID5A 2DFFA 1DBDA 4I6MB 5KFWA 1ATRA 2GQ2A 2DO0A 4KGXB 4MKVA 4KPYA 1DY3A 2PD1A 3IAM9 2W6LA 1X8DA 1HWIA 4IOXA 4C11A 3CUNA 1OJ4A 2QA4N 4IO9L 2VPZB 4OYZA 2RDJA 2ZJPQ 1DKGD 4IH7A 3A8JA 1CJTB 3CCUS 3DXBA 1MMDA 1M5OC 2OPRB 4FKYA 5T41A 2DO4A 3NCPA 3QIPA 2IA6A 2RF2B 3VEWA 1GXTA 3ZZRA 1RISA 1JLGA 3CMAS 3QRPA 3CJ7A 4ZVPB 3IBCB 2YWWA 4HCCA 5DK5A 2K3KA 3HHDA 4OMFG 1HQ2A 2J6TA 3EGWB 1K44A 3BSAA 5KG6A 4OZ5A 2JC0A 1U6ZA 4LF7F 4NOHA 5HQLA 2KT5A 2UVWA 1RHQB 2Q43A 2NLXA 3SUQA 2OTJS 5AXNA 4NLUA 4QU7A 4HTLA 1Y10A 2R7TA 1S1WA 3G82A 1FX4A 3TP2A 4DTSA 2YKOA 2W2OP 2O8DB 2YHXA 5K8NA 3HVTB 3BM7A 1WI6A 1KHVA 2DITA 2BDPA 1S79A 2C2OB 2WB4A 3PIPQ 3AODA 1Q8LA 3VVUA 1VK0A 2QLFB 3ZSQA 2C2DA 4DUYF 5KGXA 1PYOB 4ZCIA 2ZZNA 3R1XA 2D9OA 1B92A 4GVEA 1L3TA 1UCNA 1CC7A 2J9EA 2LQBA 3CCLN 4LF5J 1QHTA 4C3KA 4FL9A 2W9CB 1ICEB 2I9SA 3PX4A 4M3YA 2Q0RA 1RAAB 2P9SA 3A3OB 4C7QA 2PI5A 5L1KA 3KVGA 2FTRA 3E2EA 4BR7A 3L2VA 1KLMB 1S48A 3K59A 3VQ4A 3EX7B 1IQZA 1FK9B 4QS9A 3G6EN 4OZNA 4B9LA 4PWDB 1SB6A 3TAEA 2FVSA 4CHQA 4OI4A 1KHWA 1JX4A 2GHPA 2BBEA 2BE2A 2CVEA 2WAQD 3OXLA 1WHYA 5HP1A 5J2PB 2UUBF 1LNQA 1KRPA 2DNOA 1RLCL 4M94A 3D54A 4H03B 1YTUA 2VBZA 4DV6J 4BY9C 1LWCA 3RR7A 4ZTFA 1CJKB 5SWMA 1IWGA 4JHDB 3I82A 3NAHA 1G3OA 3KK2A 1TGOA 2O67A 4L3QA 1LWFB 2LU1A 4FYVB 4AQYF 5FIIA 3CJAA 2A5XA 3B6OA 3HI9A 5KFJA 4FVUA 2WW4A 3PTWA 4LF8F 4I4BA 2RRAA 4ZKAA 3BBBA 2CQ0A 2QMUB 1CJUB 3MN9A 2HVZA 3ZSYA 3O3HA 2L9WA 4CZKA 4W92B 3MWTA 4HT7A 2GMJA 2O1PA 2OGUA 1C0UB 2FIUA 5CHCB 3BPDA 2XCPA 3W9IA 4OYPA 1TYQB 4KHMA 2V4RA 2GAGC 3UD5A 5H9EJ 2JL9A 3GSIA 4CNZA 3QT5A 4F3MA 3MFIA 2CPXA 5A6WA 3O4QA 1N5VA 3SCLE 1NJWA 3QFPA 4BRHA 3VQ8A 4QJVA 3AD8C 3IRXA 1GT8A 2JLGA 2QSWA 4DV6K 2KFZA 1FFSB 3UO0A 4DV3F 4HVJA 4OHYA 1H98A 4PG4A 4P74A 2H1YA 2AP6A 3MM5A 4DPTA 3QZ8A 4MQ3A 5A8KB 4HWIA 4USVA 5C42A 3DLGB 1ZETA 1QDUB 1VJWA 3K89A 1X3NA 1D09B 2RQ4A 3NNAA 2YHWA 3W3SA 1RBOB 2WBMA 1UPPA 4ECTA 3UPFA 2RILA 4K43A 2DXDA 3K5NA 3DI6B 1YX2A 1H7WA 5BYRA 1KONA 3CDEA 5BYQA 2HQIA 3RBEA 3M1VA 4LF4J 3W2VB 1DRZA 4IDHA 4QS7A 3NWGA 1Q7YT 5F2RA 2D1CA 1FD2A 2JC1A 4LMZA 4C2MA 4MK8A 3J80Y 2VFUA 5IS2A 3SSRA 1VOMA 4P71A 2ZFHA 3I5AA 1HBOA 5ADXA 2EKYA 1MU2A 2ZBIA 3MCNA 1VSIA 5KT6A 3GR0A 2DR6A 4JS4A 2R7UA 1FVQA 3V1OA 1DARA 4NLGA 1F2HA 3UE5A 2A18A 3PO4A 3MCOA 1UWAA 4JKCA 2HVHA 2JHEA 1WSEA 2W7OA 1RLDA 2V7YA 3ENQA 1Y5NB 4ED3A 1NGFA 3L3UA 2YKPA 3CCQN 2RQKA 3RW6A 2HBKA 3ZZUA 2NXEA 2YJEA 1TL5A 3SBMA 1U1MA 2MZRA 1E6VA 4DF8A 5BXIA 5L1JA 1U8SA 3MEDB 5DETA 4JI6J 1UW4A 5G0RA 2PY5A 4LFBJ 2HFZA 1HNWJ 4WXWA 1TKTA 4LRCA 3DU5A 3M5RA 3GDQA 1RBAA 3C95A 3KHLA 2RN2A 4KBOA 1IBLJ 3V6KA 3VALA 3V9WA 4ECZA 4PAAA 1HYSA 2DEIA 4L75A 4HYKA 3GONA 3QQCD 1ZBHA 1IKYB 4LT6A 4N76A 4BC4A 4USMA 1X9MA 2E1CA 1HYZA 4JI5K 1S7IA 4QYRA 3EMTA 1PC4A 1ZBIA 4ECWA 5JICA 3EZOA 1MSWD 2ZHBA 2YNIB 3D0GE 3CO0P 1CJTA 3KHHA 4U7BA 1J27A 3TZYA 1T3NA 2IMOA 2AA4A 1V4TA 4K8XA 4HTIA 3E66A 4IOCL 4OKKA 3QJJA 2Q1NA 4DS5A 3IO1A 4CRJA 1CG2A 1FRLA 4XPCA 2A6OA 3DLRA 2Z1IA 3DYAB 4H4MB 3ZNJ1 1LWXA 3I8BA 4RKUC 5I3UA 2HHXA 3E9PA 1QJHA 2B6AB 4GNIA 1N56A 3T1HF 2VCPA 3U9ZA 3NMRA 3RZAA 3UNYA 1YF5L 1IR2A 3KLVA 1HNIA 1S57A 2NZCA 2BKNA 2O8EB 3J80U 1FJCA 1NAQA 3ZZZA 1LFPA 4XTTA 1JCEA 4V19J 2UXCK 3ZCMA 2DXEA 2IDLA 3W65A 1GEHA 5DDQC 1TFYA 3KK1B 2CQ3A 1I51B 4X66K 4JN4A 4N77A 3CQYA 2QYGA 4MYUA 3VVTA 3G71S 3L7UA 4E3SA 5FDLB 1WC0A 1NJXA 1GOCA 5KFLA 2GJFA 2GMHA 3TWZA 4Y2MA 3C3LA 1X4AA 3J8AA 2CGLA 1HQEB 5BPMA 2V8GA 4X65F 3GJRB 3GE9A 2M8HA 3TABA 3OR2A 2OPQB 3GFHA 4M5DA 5KT5A 3J81O 1U4BA 4NXMK 3FK4A 4X62K 1AB8A 5F0XA 4FZVA 1C1BB 3KMSA 4QU6A 4ZP7A 2V4JA 4KHSA 2QE5A 4PKDB 3ZTOA 3AVGA 3HBTA 2LXFA 2W1BA 4ECUA 3SNNA 4CHNA 2KXHA 4LIWA 3RMAA 2HZCA 1NK4A 3TZXA 1N36K 1RE1B 1YGYA 3OYKA 1JLGB 4DV1F 3D0PA 1BL3A 2P1JA 4JV1A 1QUPA 1BCMA 5J2NA 3PYFA 3KG1A 1RI7A 2FSNA 4WJBA 2B9YA 3PNIA 4ECSA 1YVFA 4DV5K 3VA3A 1QE1B 4TLQA 3Q7CA 2IFXA 4C8OA 4ZN1A 3BGRB 2HBJA 1T44A 3A8YA 1MW7A 5CYMA 4ZVQB 2XO6A 1LWFA 1HRHA 4BRKA 2YNHB 2QLXA 1YAGA 4B3SJ 3TW0A 3SSQA 3G82B 3NDKA 2AJFE 1JLEA 2FHMA 1VQNS 3CC2S 1XMBA 4KRWA 3MWPA 4EFAC 1S0MA 4IKFA 4X4OA 3MDFA 5D4LA 2GJIA 5FLXO 5M1PA 3CCSS 2P9IB 3CCEN 2ZH3A 5CABA 1KVIA 2JLEA 4I6YA 2DGWA 1SUQA 2F8HA 1MWYA 3JYTB 1SJ3P 2HIYA 1RBTA 4OZ1A 4JI8J 3BEXA 3V9UA 2HSTA 4CT8A 4FJNA 3L7OA 5AZJB 2IVPA 4ZCKA 3DRRA 1RAJA 4IO8A 3ZZPA 2GGPB 3MAAB 1VRTB 4BR5A 4K4TA 3UKUB 2XMAA 2E1AA 2G8KA 1TUWA 3JXUA 4YOUA 1XK8A 5IFMA 3SI6A 2VG7B 1SKSA 3F9MA 2FBTA 1EX8A 2PT0A 1GFWB 2IYIA 4QQBA 2F8SA 1AUDA 5EWGA 3DI6A 4WTOB 2B4UA 1BGXT 1RHKB 2MKYA 3ZO7A 5AQQA 2RIJA 4OJGA 3M9NB 3N4PA 4DUZJ 5L1IA 2VQEF 1HR0J 2ABYA 3UDVA 1LXNA 1TTHB 1WSFA 3FZBA 1RTIB 4KTWA 3QSIA 4RWTA 5DJBA 1L5UA 5ETLA 1HJOA 2CJKA 4FJIA 1R0AA 3CCVN 2GS8A 3J7ZO 2B9XA 4B3OA 4OYWA 2XI3A 2YKNB 3MZIA 1VDHA 1VSKA 3MCAB 4OZ2A 3GG4A 2ZC3A 1DTQA 1OY6A 4FM1A 3NS6A 1WG5A 5EVZA 4UOHA 3AD9C 3U8XA 4CFDA 4LRBA 1SVDA 4YOXA 2ZDOA 5EN1A 1YJNS 2DGSA 1NGDA 2C3PA 1VQ6N 1SC4B 3FMWA 2SXLA 4I68A 3BGFA 2GWKA 3E9OA 2R8HA 2VUGA 3ZSXA 2RAQA 4JI2F 1TQLA 3CJ3A 2NXNA 1HNWF 4YY3J 1RDWX 1IBKJ 1PJ5A 2HF4A 1UA1A 4MK9A 4Q8EA 4ZS6A 2F4VK 1WSGA 3KZBA 5D8HB 1ZS6A 3CCQS 1IBLF 1BA0A 1U1KA 1DGKN 4ECVA 2JEIA 1YJUA 4CZGA 1V3RA 1N54B 2L08A 3RJMB 2QWNA 3R7NB 3OT9A 4FYYB 4TSXA 5K14A 2FD2A 5AZIA 3AO1A 1WACA 1S9FA 5E5NA 2GVDA 5IC6B 4RW4A 5KFVA 1D9AA 4KHPK 1HNZK 1VQMN 1NOYA 2C3OA 2YI1A 4LFCK 4V19X 1RAGB 1NO8A 1YRTA 2IVYA 3MCPA 2G0JA 4IG0B 3OXFA 3UDEA 1DLOA 3HHNB 1S76D 1WWHA 3FQKA 4H0YB 4DV2F 1XUPO 1YITN 4YY3K 5AQOA 3DGPB 4FYDA 3QEVA 2O8CA 4PY5A 3PFEA 3M2UB 3MUTP 4DUTA 3PW0A 5I3UB 1NDLA 1F6TA 3R1LA 4H54A 2K7JA 2FJBB 5L1LA 1KD1T 2BTFA 1U1PA 4G1IA 1Y11A 3S01A 4MIAA 1YBUA 2KFYA 4B3TF 2DGOA 2XHWA 3M6VA 3R3TA 4ETZA 5DM6Q 5B7WA 3MN7A 4FXWA 4DV1K 3HT0A 1PKUA 3OL8A 4IQMA 1Q82O 4JI7F 3LP1B 2DRDA 3SK3A 3R97A 3K5PA 1C1CA 1RWUA 4IRCA 4MT1A 3VEXA 1S5JA 4ATNA 4O0NA 2YNFB 2D7SA 1YJRA 2P9CA 2ZVIA 2M70A 1RTDA 3FVYA 3ID6A 2J76E 2HNDB 3CCMS 4JV0A 3GG0A 4RNHA 4DU7A 1RT1A 5HBMB 3NRBA 1SV5A 2RQCA 4NCGA 3AO2A 1NK5A 1VQKN 1WC4A 4A47A 3H25A 3WT0A 1FRIA 2MEWA 1M90O 4OIXA 3SCXA 3RMCA 1BMQB 4MYTA 1XEZA 2VONA 2A6MA 1U6FA 2E7XA 3NY0A 3QETA 4IFEA 3CJTA 1TUGB 2BQUA 1VHFA 2YKMB 3C16A 1W0HA 5ETOA 3JS6A 4JI4J 3P45B 2OPSA 5JJBA 5JMVA 4O3SA 3MEEB 4A5AA 2IS3A 3DXMA 4LC9B 3MM7A 1HHSA 3BYRA 3KD5E 2CQCA 1S1XB 2XULA 2D3UA 1SIZA 3V6DB 3O8WA 1YI2N 2V94A 1NBEB 5C24A 3AOBA 3P5JA 4Z4IA 4URSA 2NCKL 5HN0A 1F2GA 2VH7A 4CLYA 1REVB 4O44B 3IGNA 5AQVA 1K6YA 1OSDA 4FJ9A 4OX6A 3CHWA 4X4UA 4IO1A 3T7ZA 4CHYA 5GADP 1I6JA 3ZTPA 2E20A 4FLVA 3SMPA 1S0OA 4CEAA 2MZTA 2H4YB 1KQKA 4A2AA 4K4YA 4TQSA 4J9NA 3GYXB 5L39A 4I7FA 1YVUA 1F5CA 5KT3A 2F65A 2H48B 4NLTA 4ANDA 4AQYK 3VMFB 3TI0A 3N4WA 2CPEA 1Z4UA 2Z56B 1UL3A 5ETTA 1VBZA 1UVKA 3GCXP 2KVIA 2LSNA 1FDNA 3F44A 2V2VA 4FLUA 2BJ7A 5KFTA 1KQSR 2BR0A 1IR1A 2D5RA 3IR6B 4LF9J 1NDKA 4DQPA 3Q8UA 4E19A 4QPTA 4PWWA 1T03A 1IBCB 4BDYA 3RB4A 1FRHA 2H5JB 2OA8A 4GKJK 2ZNZA 5BYSA 1IKXB 3EGVA 3VQDA 1QVFR 1NMNA 2MJNA 1K47A 2HBLA 3CJ9A 3SMZA 2DRAA 3HKWA 4KY3A 9ATCB 1RAEB 2G0IA 2KHCA 2AV5A 4AUKA 3R3LA 2NSCA 5DQGA 1U02A 1VGYA 4CZEA 5A2QY 4G1PA 3WX4A 1JJ2R 1UTAA 4H0OA 5KFSA 4KKOB 4CP5A 3M30B 3O4WA 1ZTTA 1GMWA 1M1HA 3EDQB 2W9BA 3NBPB 4TY8A 2ZOGA 1MWKA 2KZMA 4U67Q 2LYVA 1LOUA 1Q8IA 1DFDA 4LF9K 3RB3A 3IWXA 3DRPA 3HZ6A 1RCHA 1OH8A 3OR1A 1O6XA 3JTPA 5J1EA 1CLFA 5AFUA 3QNOA 3CCUN 1VR6A 3QMLA 5DG9A 5AQYA 4CJ7A 2WK4A 4ZLPA 2PGCA 5B8HA 3D2FA 2IIHA 1HWUA 4PA1A 3GIIA 3AXMA 1YWXA 1JNRB 4M63C 2J5AA 3MM8B 2HFSA 4EHTA 2DR5A 1TU0B 4F3TA 5M2PA 5A8WB 3RAXA 1QHAA 4YEAA 2JRSA 3PYGA 2VOOA 1S6OA 2QTWA 2IVOA 3QBXA 2FJWA 1D8YA 4K41A 4H4OA 3ZLJA 4FJ8A 3IAS9 5ETVA 4F4YA 2ZF5O 3N5BA 2VHGA 4PKGA 1QVGM 2ZBPA 1ZBSA 4BCAA 1F9HA 3TUIC 3RW7A 4BVPA 1X4GA 2XZWA 1F21A 3OTBA 2F7TA 1Q7LB 3CC7S 3JAMO 2IVFB 4JI7K 3FEXB 5L38A 5HANA 1SL1A 2OKQA 3HX9A 1Q81O 1BISA 2OMLA 2G13A 1UVLA 3CJKA 1V3SA 5AZJA 1F1BB 5KFAA 2B9EA 4KO0B 4CDIA 3KWMA 1WC3A 3D68A 2MXYA 3S7RA 1HNIB 3T9NA 1S1VB 4R0EA 4JI5F 2R42A 3TUZC 3VQEA 2XHBA 4KBIA 3G2XA 1B9DA 3O3LA 3S3OA 2BYCA 3K58A 1RBLA 1HIYA 3M8RA 1DHMA 5EX3A 3NOGA 1RWKB 1Q81T 4DPYA 2WB1D 2ZJQL 2J4RA 1OYDA 2DGTA 5GAGU 2XLKA 2HFOA 1WC5A 5GADU 1D3WA 4QOZB 4ILLA 4DG1B 4NZ6A 3UI3A 4JKGA 1GTEA 1BY9A 1RTZA 1N5QA 3VGTA 2Y1JA 1RNHA 4JS5A 3OTOF 1N33K 3F41A 3K8WA 4GVMA 4JNEA 4MO4A 1YJVA 4BRIA 2OTLS 5B09A 3LGMA 2CXEA 4UTGA 2A3ZA 1M1KO 4PEOA 3LP2B 1T3VA 2V6AA 3HJVA 4Z37A 3T5HA 2IRYA 5C2CA 5KG5A 2Y1IA 3EZWA 3SPYA 2W7AA 3I32A 5FD1A 2BW7A 2ZJPL 4FLTA 2CNNB 1Y00A 1U0HB 4J2DA 3QEXA 4J9UE 3BJYA 4J9OA 4CCHA 3CXCR 3C6UB 2FLOA 2ZZMA 5KFQA 3NGDA 1I39A 4CHPA 3A5NC 2Y3YA 3EVOA 2UXCF 5AQNA 3MMBA 3PRBA 3BO2A 3HHLA 1Y3KA 5HSPA 5IT4A 4JI4F 2ZM6K 4JYAK 1JLAA 4FPAA 4RWWA 1VHXA 4RBVA 4FWOA 2VG6A 1FRXA 2YWFA 1PAUB 3DRYA 3H3OB 2RRBA 5GMKa 1S5ZA 1XMOJ 2DGXA 4UW2A 1ZAVA 4A46A 2ZC4A 4E7HA 2CGJA 1FXXA 3TTCA 4GKJF 1VCTA 2YX1A 1OO0B 2AEJA 4KH6A 2R3VA 3CWJA 2LA4A 1ZA1B 4DR5F 3I4PA 5AQGA 1HFEL 2HVDA 3VENA 2UUAF 4JKAA 5E3PA 5F8MA 3CCJN 3VOVA 4B9TA 4X62F 4NXMF 3MCMA 4GMKA 2HNYB 1WOOA 3U02A 3FBFA 4CJEA 4CJ5A 2FHKA 5A6PA 4OZLA 1S3XA 4I64A 1FRMA 2NUUG 4I6WA 4ZPAA 4D3HA 3D28A 1A0OB 3D7SB 2WC9A 2VFRA 2NYHA 1A5WA 1NNEA 3HZGA 2LMIA 1WLJA 3ZSVA 2MY8A 3V9SA 2J0XA 2CPYA 4ISFA 1NJIO 2KHOA 3L9ZA 1UMJA 1RT7A 4CYUB 3I4HX 1VYAA 2XLJA 3MEGA 3H5UA 3ENHA 3M8QB 2V50A 1Q5VA 4AE5A 2W41A 1O1WA 2GV1A 1GK8A 3QLHB 5D0RA 2ZZTA 4JB8B 4E1JA 5BPLA 2PA8D 2XBPA 4DV3K 2R7WA 1VRQC 5CHIA 2KLAA 1XMQK 4M3XA 1C0MA 2MZ1A 1BCOA 2BANA 2HHWA 3JB9k 2E4LA 2QWLA 4K50A 1HMVB 2PEHA 2EX3A 2FJEB 1OY9A 1FFGB 2P6SA 4EWTA 4A5BA 1JXBA 4J90A 3T1YK 4KAZA 1BHNA 3QRRA 3W0LA 3X3UA 1VQKS 3MX5A 2DNPA 3BO4A 4CJUA 4DQSA 2IC3B 2AJ2A 1GX6A 1MROB 2CQ4A 3KLFB 3H5SA 3AB4B 3DGVA 3VN5A 5TKWA 2W25A 4MAKA 2MJUA 4LJMA 3IDHA 2GUPA 2I8EA 4ZPBA 4CLTA 2CDRB 5CR4A 3F73A 1GLBG 2D3ZA 2P5OA 3FRYA 4CE9A 5LMUK 4UQGA 2A42A 4XH5A 4IYQA 4NWBA 3H59A 2EW9A 3PY8A 4ZMMA 3GV5B 2BJ8A 1U26A 3GB0A 2ALYB 3CJ0A 4FWRA 1S49A 3MPWA 2UXDJ 2K7KA 1A9NB 1DURA 4FK0A 3KHYA 3NVMA 2LA6A 3SLCA 3TRGA 1TL4A 4AL7A 2EI5A 2D4WA 3K2YA 2PI4A 4JRQA 2F3JA 4W5QA 1HPMA 4NLDA 2YHBA 2W9BB 4CEFA 4NX9A 3DOMA 1TKZA 4O3PA 4N56A 1C0TA 4F4AA 2W8KA 3IGVA 4RZRA 3VF4A 4WK3A 1HLWA 1Z2ZA 3R5JB 4IH5A 2E6LA 3CJ2A 2VU5A 3DU6A 1W7AA 3U4LA 3DRPB 4TLRA 2OTJN 4L73A 4DV5J 4Z94A 1Q8BA 4ZTJA 3D6HB 4MMOA 5C15A 1SH2A 5AFUH 3MTJA 4NB4A 2HWTA 3PJXA 5AQPA 3AO5A 5LMUJ 4OHZA 1WNSA 3O3FA 1SH0A 5MLCV 3NAEA 5KRSA 5A8WA 4DCJB 1HBMA 2G8WA 2EVZA 4CLLA 1NZ8A 3L09A 5H9EK 3KLHB 3GOIA 2XZTB 4B3MF 3OS1A 4H0VB 4DFMA 4Z0UA 1LAWA 4NLXA 1AFJA 4CI6A 2O8CB 3NGRA 3CJ8A 4BRCA 4C4WA 4TYBA 2RUSA 2V34A 3CI5A 5BRDA 4J9QA 4WQ4A 4U96A 2XS2A 4BR2A 5KOXA 3W9JA 2F8MA 4DR4F 1UVNA 3U1LA 5CA5A 5LSLA 1TV6A 3MEKA 5E3CA 4IFVB 1Q53A 3O1WA 4JP8A 1CVJA 4QPXA 1VQ6S 3FZMA 3TQ1A 2LQ9A 4CGGA 2QT7A 3N6MA 3SZ2A 2KI2A 2VPWB 4CJ4A 4IFYB 4LVNP 2BQ3A 4KO0A 1SC3B 4DPXA 1Q78A 1TK8A 2AEMA 3IP0A 1BQNA 2Z8QA 4MKYA 2CQ2A 1UZHA 5BPNA 3AVKA 3OR2B 1IQTA 3CJBA 3THWA 1VS3A 5F8LA 3AJDA 4Y00A 1MLAA 4IXCA 2DPJA 2QMXA 1R3NA 4GC6A 1HNZF 3I5CA 3MGJA 3R6MA 3TSPA 3HHKA 2KO1A 1S4EA 4DR6K 3J7YP 3TJAA 2A1RA 1BA1A 2V52B 4FDFA 2MKKA 2VQEK 2KDOA 1NKBA 2HHTA 5ETSA 2ZOMA 3MR7A 4WFZA 4QS8A 4TVAB 2OD6A 3J80O 4OGCA 4C8ZA 2XYPB 1S9EA 2ZD1B 1C0FA 1C1AA 1B4SA 5ETRA 2J6UA 3QT7A 2HPUA 3OUYA 2OJ3A 3IS9B 3KWIA 1OMSA 2ZQBA 1QSYA 3PUFA 3C0BA 3NH2A 1YKWA 4JLHA 2C3MA 3QT6A 1QE1A 2GHWA 2FZCB 2RE1A 1V5IB 1NH8A 4HUFA 3J7YI 1EXQA 4FF3A 5CCLA 1JLEB 2EXUA 4JKHA 3CDWA 1YJTA 1C4AA 4MFBA 5K8MA 3HLUA 2UVRA 4RW8B 1U1NA 3KHGA 1CZAN 4O4GA 3TAMA 4H5RA 1T05B 3PR5B 1HNWK 4WFNL 2CQHA 2N82B 1RBRA 3OW2M 1RQ0A 1HHTP 4B9NA 3AJ1A 3CCTA 2CJYB 4ZJOA 4BR4A 4TXSA 2B4PA 1N0VC 2DJWA 2PMHA 4ZP6A 4LBPA 2GQCA 2OUGA 3BKFA 1YLXA 2UUAJ 2IIRA 4GVBB 4FJ7A 3TX8A 4NLBA 5IM0A 3M6WA 3NXZA 2HOEA 4KV8B 1R7IA 3F2KA 2BACA 1IKYA 1N4LA 4IG3A 3SAFA 3FGVA 4NEZA 2HQCA 4IOAQ 4O55A 5HQ8A 3LALA 2HZVA 1T94A 1SQGA 3Q2SC 3JSRA 4FZYA 3OBIA 3R7BB 5KG2A 5LL6d 3KUGA 4FS1A 4DV2K 3MTKA 4FZZA 5ETPA 2HNZB 2VC0A 4UUXA 2OFHX 3UIQA 1KOOA 5FPEA 4M5GA 3ULHA 5M1KA 1NPPA 4Q2MA 3SCIE 3RB0A 4JK9A 3NNHA 1C1CB 4DTMA 3DRSB 3J7A1 2UUAK 4AD6A 3K7RA 2V67A 4P2XA 3IBWA 4YNQA 4WQ4C 1NHUA 2GFFA 1RT1B 5HBMA 3JSYA 2COLA 4AXJA 4PG7A 1ULRA 5KFZA 5ELZA 2BKOA 2I5JA 1S9GB 4YOTA 3KG4A 4G9ZA 3SI8A 2NUHA 3WZ0A 4YDXA 4W5NA 4OX8A 4DBQA 4X4VA 3AO4A 1NHVA 5B0AA 4Z4CA 1JLQA 1RCOB 3IM8A 5SUHA 4EBEA 3C16B 2YKMA 2XWXA 3JSMB 3G6XA 2E2QA 4Z4FA 2QRRA 2BJDA 2L9DA 2V9KA 3MEEA 1TZ0A 3TA2A 3UKRA 1P90A 1DTTB 3EKUA 1RJJA 3MR2A 1ZBLA 3SV4A 3WNFA 4B1VA 1FEEA 3OHBA 1N36F 4K2JA 1FE4A 4F4WA 1FNXH 2LKZA 4GVLA 4C0HA 5A0YB 2OPRA 1K8KB 4CEDA 3CW2C 2HMIB 3FRZA 3C7NA 1HW8A 2VB6A 5KTQA 1CJVA 3FFKB 4M95A 2LP4A 3F0NA 4HACA 1NBWA 3OS0A 2ETJA 3PW2A 1IH7A 2ZWPA 2QL7B 2YJFA 3LO3A 4ZCLA 5HJYA 4I7FB 3AQOA 4NE9C 3HVTA 3I55N 4ED4A 1TUYA 3I9ZA 2MTLA 4BACA 1JMTA 2P9KA 1TL7A 3K9KA 1PAEX 5A8RB 4B3MJ 3VEVA 3PM9A 3UNGC 5DLGA 3LDSA 2XMUA 4P2SA 4M3RA 4BRLA 1ITGA 3RVCA 1TMJA 1ASVA 2D74B 3LP1A 4CEBA 2WVDA 3LZIA 4EU0A 1Z26A 3CTRA 3MMVA 3Q8SB 2E1YA 3TSUA 2GHVC 2YWKA 5D4OA 1SKWA 3CCZA 3ZT1A 4U8YA 3PEHA 4DTOA 4DQ8A 2YH1A 2RDIA 3M2RA 1BXNA 3PZPA 1HBOB 1PBUA 2ZHOA 3QINA 1FJGF 4DL2A 4JYAF 2E7WA 3TA1A 1N8RT 2GVZA 4Q0BA 1VIXA 2F1FA 5KT7A 4BRMA 3MR5A 2DNGA 3CT9A 3EWGA 3KLEB 1VFJA 3GU0A 2M88A 4FF1A 3KLGA 3ZX2A 1VJQA 1NB7A 3JAMY 2HGNA 1CS4A 2AJ1A 1ZC6A 4RW6A 4NI2B 4FWMA 2W42A 2DXFA 2ITMA 2ASOA 4J91A 4AM7A 4WFAL 4ECRA 2HZAA 3E01B 1X4DA 2V63A 4PWDA 3ALYA 5KG4A 4KHQA 4WXOA 2LLZA 3VGKA 1FXLA 1ZA2B 1U2FA 5DRKA 4ANEA 2DH9A 2EHGA 2VQFJ 3HYFA 5KT4A 3O8MA 2IM3A 4BREA 3TAFA 1HYVA 2OI2A 4LF5K 2ZITA 3IFRA 2E1MC 1B7FA 3K5OA 3W3DA 4IZ9A 3US5A 1T9VA 4CQ1A 3PW5A 2VF3A 2YQ0A 1N52B 2VWKA 2VJVA 3KK2B 6FD1A 3ZT3A 2RQMA 5DGBA 3M32A 3ZEUB 1C0UA 1RWXB 4DEZA 1K8AT 1QAJA 2BABA 1I3AA 5D78A 4H0XB 1HW9A 3HVRA 4WQ5C 3UDCA 4F25A 3T5JA 2AYBA 2ZGZA 3HHLC 3CDAA 4A61A 2R2RA 4IJAA 1SKRA 1XQIA 1WSJA 3C6AA 2YKAA 2NYIA 3R5CA 2MB0B 3U9DA 3SCJE 1Z1ZA 1QQNA 2ZOFA 2XGPA 2BE7D 3KKFA 2KZZA 1TYQA 5LMNF 1FKPB 1F9EB 1YDLA 2FZKB 4OX9F 3R9LA 5I42B 4Q7AA 2OEJA 2QA2A 4H4MA 4CLUA 3SQ4A 4WIQA 3AVMA 4WCEQ 2E1RA 2MQPA 5BR8F 1JLCB 3SCKE 3EPIA 4JI6F 3R27A 3WXKA 3ICLA 2RNEA 2G4BA 4JUZA 3FZ2A 2ZDPA 3S9HA 3LDLA 1M5HA 1ZAWA 5JVGL 1NCLA 4B9MA 4LBHA 4KTZA 3J7YU 5ETKA 3VF0B 4A8QA 1QS4A 1FERA 1VQON 4L76A 4P10A 1VQLN 1R43A 5AZIB 3D3CJ 1UOCA 1XHXA 3G87A 1FDAA 1IWAA 4FLWA 4GVBA 2QW9A 1ZM4A 2Z2LA 1K1SA 2QM1A 2A2DA 3KK1A 1BQNB 3L0QA 3H8YA 2LXUA 2WSEC 5J2MA 3CO9A 4OI2A 5CD4A 4X4RA 1TELA 4TU8A 5AQLA 4K5SA 3BF1A 3VEYA 3DLKA 4MTPA 2BJ1A 2PC6A 1CXQA 4OPAA 3CJSA 3CD5A 3B6PA 2L41A 5FLXY 3HRGA 4E7IA 3THYA 2XSFA 2N3LA 2MLXA 4FKXA 5EGYA 3H46O 4ZVOB 4K0KK 3M2UA 2HYIB 5DDRC 2KG0A 2QEXS 3I33A 4P75A 3OHRA 2M3DA 3VQBA 4ED5A 3ZTSA 1XIQA 2MHEA 3PX0A 5DS7A 3G6ES 4EIAA 5GINA 2NXJA 2ADCA 1FWPA 5C5JA 4ZN3A 4CECA 3MAQA 1UJ4A 1URRA 3QATA 3NEKA 4ZVUB 4DL3A 5AXKA 3VESA 1WUUA 1X3MA 2G1DA 4PPDA 3UD4P 3P8BB 4DUZK 2O8BB 3QJPA 3EUNA 1HR0K 5AQKA 4IEIA 4CT9A 4DR2J 1ZBFA 4ZITA 2YQ1A 1S12A 3ELHA 4Z7YA 5J2NB 1E6YB 1QY7A 3PJ9A 3EM1A 3OFGA 5C10A 2B7BB 4CTAA 3G10A 4JI3K 3T1YF 1YHQN 4ES3A 4JAXA 4QYZJ 1T7PA 4FNHA 2EFPA 3DDNA 2X1AA 2ASDA 4JI4K 5KPTA 3TUPA 4Q8FA 1Y5IB 3KNAA 4LF8K 4B8AB 1KBRA 4LR8A 2CWKA 4U9RA 3OTDA 4CO1A 4HDGA 2JX2A 3MPDA 1M5KC 2LXIA 4V19S 4LFAF 1K8KA 2OTLN 4O4RA 2CIMA 1HNVB 2JSXA 4DU3A 4N7TA 3NF9A 3KJVA 2EKNA 3M8PB 3OW2R 1CEZA 3P6YC 3AARA 4J2AA 2FC8A 5DZ7A 3H7HB 4DFPA 4DV0F 3KKSA 2E7VA 2DY1A 4DV2J 3AHPA 4JKDA 3D6FB 2HHHJ 1TL7B 4GY2B 4JI3J 4U8VA 2W8LA 4ENOA 2B56A 1R89A 3JAMU 4MLEA 1RU2A 1M5SA 2DTJA 3JXOA 4RUBA 1T6DA 1QD1A 1B0TA 2C1EB 4B3TJ 3NF7A 4ZJLA 3WNEA 4I2QA 1RTJA 3G86A 2OANA 1HI8A 2E1ZA 1AA1B 2GWJA 4FJLA 2UXDF 4B3RJ 3CCRS 2AU0A 3M2VB 1T6CA 3FZFA 4HT5A 1EKRA 2R9LA 4DL7A 3MN5A 4FLZA 1FJGJ 3KLFA 4E1NA 4X4NA 5EOYA 3W8GA 4CBUA 4DPWA 3RRHA 2B8PA 1HWKA 3EN9A 1Q86O 3V81B 1U45A 4CD1A 2BJ3A 1LWEA 1TKXA 5EHHA 1FRJA 3DLEB 4DR3F 3DMJB 2C2NA 3DLJA 3C6TB 3SYZA 4CGDA 4M42A 2GAHC 5KPZA 1FW6A 1HQUA 3Q2TC 4EGLA 4P2FA 4ZVEA 3CJRA 1S1UB 3CMEN 3QZ7A 5H9FJ 5FDLA 3LQVA 3D1QA 2FLNA 3N28A 4UUWA 2ZH1A 1PCAA 4OX9K 2Y1LB 3UDLA 3K5LA 3DOLB 1IR0A 3KLIA 3FC9A 1DTTA 2FY8A 5EWEA 1B9FA 3RG6A 2HK3A 5E7OB 2DGQA 2KRBA 1NPRA 1JJHA 3PR4A 3KK7A 1Y4ZB 4DSFA 3E01A 2GEMA 1GLFO 4TY8B 5GAEI 4G3IA 2IYGA 2GO8A 1UKUA 4H5VA 1JJ4A 1U7LA 1WSIA 4CEQA 1DEJA 2DB1A 1QAIA 2JJ4D 3POTA 1NSKL 4DUYJ 5C2FA 1VSJA 3PFOA 3DLGA 3R5DA 2IAJB 3NP5A 3KIOA 2J0WA 3ENBA 4WQ5A 2HURA 1SCJB 3JTNA 1S0NA 1M1GA 4F67A 3VPZA 4QBUA 3M8QA 3M32B 2CADA 1ZOTA 2P9KB 2V5HG 2J7KA 2W2MP 1RZMA 1T3OA 1U1OA 4ILMA 3G4SS 2CJAA 4H4OB 3W2VA 3MPVA 2GX8A 2PEBA 3RMBA 3P5TL 4F8RA 3SQGB 2XNRA 2LECA 2HS4A 4ZPTR 4CEZA 3WXIA 1NKEA 4WFBL 1GXUA 4CEOA 2NS1B 4WYWA 3VAFA 1IBMJ 3N6LA 1W7WA 2X3DA 5F8GA 3C6HA 4KPCA 1UAXA 1GQEA 2LDYA 4ZP8A 2P9NA 4FM2A 1Q8KA 4Y2CA 2GGPA 4HCBA 4WF9L 1Q79A 4LRAA 5ETNA 3HP6A 1JLCA 3LWLA 3AVFA 3U3YA 1Q95G 3QICA 3U27A 3GR1A 3MPUB 2CRLA 1HHQA 3GFZA 1Q86T 3C2PA 4OZJA 2DHSA 2E8AA 3CJ4A 1HUXA 4YFUA 4AQYJ 3TSQA 1WOSA 1FXRA 1Q5YA 3CSKA 2O8FB 2XY6A 1WJ9A 2C2MB 4J9SA 1N8RO 3HD1A 3W5ZA 3BZKA 3MEDA 3PJWA 4WF9Q 5T7BA 2FJDB 4O23A 1ZZFA 4O3QA 5F9LA 2IGIA 1VK8A 3H40A 3KK3B 1JLQB 1H3DA 3CMQA 5HL7Q 2ZJQQ 3NMUA 3GE1A 2JZ5A 1MWZA 2HB5A 1B0PA 5AQFA 4DQIA 1RWVB 1RDAA 1RWWB 3HVAA 1UA0A 1FE0A 1SS6A 2M5YA 2QWPA 7FD1A 2RSQA 4XDDA 3TTFA 4J2BA 4F2RA 2PN6A 4FXDA 2D1KA 1J6ZA 4CZLA 2PMZD 5FRMA 3MMJA 3AVCA 3FCHA 2HWHA 3S41A 5DDOC 3OVNA 4CJRA 3OJUA 3IR7B 2MZSA 3OPKA 3BO3A 1NGIA 2C28A 5J2QB 1NEEA 4W90B 2RT3A 2XRIA 1VLOA 2NQPA 1NGEA 3I56N 4AHVA 5L9XA 2CJXB 4PHTX 3TAPA 2XY7A 2P9IA 1XN9A 5FROA 1VSHA 2FBYA 4M8LA 2QKKA 2Q3PA 1JNZB 2E1PA 2ERRA 1F3FA 2ZH9A 4F04B 1M0SA 3LGNA 8AT1B 3WC2A 4GKKJ 1AZSB 4AHSA 4DR7J 1KD1O 2I0XA 4ZVGA 3BGUA 3QRQA 1MN9A 3FQLA 2PYJA 1SXLA 2VZ9A 5IT9Y 1VMBA 3T6BA 4JI0F 4MDAA 2ZKUA 1R0CB 3B6BA 4J9MA 1FO1A 4M7YA 3VAGA 4IDKA 4P72A 3KKRA 1T03B 4OLBA 3QMQA 4OL8A 4BE2A 4IQXA 1FA0A 1YJWS 4BQLA 1NG9A 3N6NA 2P9PB 3K5MA 3C66A 5E2QA 4ER8A 4CJ3A 4ZPVR 5DZ6A 4CFCA 3GP9A 2RU9A 4BGAA 3ZT2A 1BO5O 5AJ3J 1DQ8A 4NZ7A 1XWLA 1WC1A 4DR6J 3C46A 3EXYA 3S1TA 1APSA 4D3GA 3DLKB 3JSBA 2UXBF 4QOTA 1T9XA 3DRSA 3D6TB 3FGUA 4GW6A 3G6YA 4DDFA 2NRHA 2NUBA 2E29A 1F0XA 4KKOA 1HI1A 2QK9A 4FJ5A 3BR9A 5L8RC 2A40A 1SQKA 1C1BA 3TEHB 5KFPA 4URGA 3ID8A 2WOMA 1UVMA 2BGGA 1LQ9A 3P1GA 2ZJRQ 2FB0A 4BVOA 4DMNA 3OS2A 3DXSX 7FDRA 2YNFA 3UN5A 4YR3A 1VQ7N 1G99A 1HMVA 2CNOB 3BF3A 1KQFB 1K1QA 1Y7PA 2XMVA 3MMCB 3SAHA 4F2SA 1BIUA 4K4UA 2PBDA 5KFFA 5KFUA 2H3GX 3FFIB 5IQ6A 1EETA 3DXKB 3VQAA 3FSXA 1TL1A 2GMLA 1HYSB 4DCPB 1REGX 5E41A 2Y9HA 3IA0A 2E5HA 4DN0A 4O3RA 1LWEB 1TKXB 2EPIA 4USUA 2YNHA 2WVFA 1U6BA 2QV6A 5AQIA 5AQXA 4KT0C 5IT9O 2YX7A 4O0JA 8ATCB 2M9KA 2D0CA 4WIIA 3C15A 5JUMA 2UXDK 4DCOB 4LRDA 4CJFA 3EE9A 4H4KC 2IA0A 4NXNF 5AQZA 3LPEA 4A8XA 4USKA 1SJQA 4EP4A 4MK7A 4Y65A 1S72N 1LCUA 2MY7A 4UQTA 2VASA 1S6PA 3TU5A 3THTA 1VQ4N 3WNGA 4DV7K 1X5PA 1IKWB 3HT3A 3CCVS 3ENAA 1GOBA 5GIOA 4PG6A 3IWNC 3CJKB 4OZ3A 3O2IA 4MJKA 2NRVA 3ITHA 4EEYA 4B3SF 2P9EA 2FF3B 1NK8A 3W62A 1RT5B 2JOQA 2WSCC 4NMLA 3SUPA 3VF6A 2QIFA 3EPGA 5F41A 1FNMA 4IR9A 5JLHA 3AA9A 2B9WA 4CW7B 1XMOK 4DB3A 1S1WB 3H42A 2KRRA 2R7YA 2KH9A 3U7JA 1YIJN 4KAIA 4BR9A 4G65A 2JEGA 4R8UB 1U1QA 3O9SA 1RGVA 2AJ4A 5DLFA 4LSNB 2RE2A 4B3RK 1XHZA 3IUCA 1TFWA 1WSHA 4ELVA 3CJQA 1ZM3A 4N8OA 2F9TA 1EWQA 3AH6A 2P9NB 2HAFA 3OFFA 1XI1A 1RBUA 2I7NA 2P6TA 1WEYA 4DN9A 1J9AA 4NCGB 4M1KA 3HSGA 4JI1J 4RNOA 3GV7B 1NM2A 3E1YA 4QIVA 3Q7BA 3GILA 1EKSA 4U95A 1YTYA 1S10A 2YH0A 3CCSN 2BJEA 4KTQA 1DT9A 2Y1RI 2YY3A 3WIUA 3J81Y 4NLSA 5LM7E 4IEEA 2F9JA 1K73O 3QFWA 4CZHA 1UW9A 2JWLA 3MM7B 2AF6A 2VKZG 2BM1A 2N7YA 3H1VX 4KHRA 5J1EB 3PDNA 2E5GA 3RSEA 1V5VA 4MIBA 4WK1A 2VG5B 2YQ3A 4ID1A 2JFKA 3IN5A 2YWGA 4J2EA 5J2PA 1NMDA 1ZBTA 4WE1B 1RT6B 4W5OA 1D9DA 2J0QD 1S6QA 1OS5A 4LF2A 4CH1A 4M5KA 5E84A 5FLXU 1VQ8S 4NYNA 3QNWB 4RNNA 1NU4A 1ZBUA 5GAEU 3QB0A 2E6MA 4KGVB 5HRNA 2HS3A 4JV5F 5HROA 4JI2J 2MQ8A 3R5BA 4NLPA 4USIA 3TOQA 5KFYA 1CULA 1R0BG 4DQQA 4YB7A 2W4DA 2CPFA 1IG8A 1BHLA 4DTXA 1QAXA 1VQPS 5B0FA 3BSCA 5M2UA 3H5YA 3L4QA 4F4ZA 2AX1A 3ZSOA 1QQMA 3MI7X 4NYPA 4KFBB 3WEEB 1GAOA 2FYXA 3R5GA 2Q66A 1AT1B 4IOBA 4HEA9 4Y6IA 2R8IA 1EP4B 2QSFA 3HJFA 4FJXA 4KGZB 4KH0B 3NNCA 2ROEA 4CYUA 3IRXB 4ED7A 2ZWOA 1NHKL 3FKBA 3NL0A 2JWNA 3EDRB 2QI2A 2KVQE 2VODA 3V4IA 5CYJA 3DKDA 4FZXC 2AKWB 2RUGA 5EY4A 3R7SB 4DX7A 1ASUA 4C9DA 4G1QA 5F3ZA 2QLJB 4HHUA 4QIEA 3NGUA 3THXA 3B4DA 3P38A 1WF1A 1U2VA 4BBYA 2CAJA 1X5SA 4Z4GA 4UT4A 1RA7A 1JLFA 4AH9A 5ETMA 1VBKA 2CG4A 4WPAA 1U2CA 3H1QA 2BRLA 2J6SA 5LOQA 1RYRA 1UEKA 2L48A 3RBXA 4DV3J 1K0TA 3B8AX 2IDOA 3MD3A 2Z1GA 2G8UA 5AE2A 3QEPA 4M5JA 3NGIA 4L74A 4DPOA 5KT2A 1RDBA 5T7LB 5HMZA 4XH4A 3ISND 2XYGB 2JFDA 2QYCA 3TA0A 5CH7B 3Q24A 4X2BA 5D0GA 4C11B 1I94F 4WFNQ 3DLLQ 4BRDA 4J37A 3DXMB 5K9FA 2XCAA 1H2TZ 3QNNA 3CD6N 5D15A 3AA8A 3EL2A 1R8CA 5LXRA 1UPMB 4AHTA 1R6VA 3LZJA 2JGUA 3CJ5A 2VBWA 2F9DA 1KVBA 4P2MA 2RMLA 4WTYA 1RSCA 2X7IA 3QIPB 2H65B 1TL1B 1RA6A 1WBDA 1X5TA 2HFNA 3SDEA 4EZ9A 3OFHA 3RMDA 3LP0B 2BXJA 2HKEA 1W97L 3UR0A 2POKA 5GAHI 2Z0GA 2CPHA 1ZTWA 1JXEA 2AT1B 4HUGA 4CJWA 2GC8A 4E0DA 3ETOA 2B5JB 5F8NA 3QGHA 3HHLB 4DV0J 3QO9A 5D3GA 3A8IA 3AY0A