1S6PA

Crystal structure of human immunodeficiency virus type 1 reverse transcriptase (rt) in complex with janssen-r100943
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 124
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s6pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s6pA05
1RBRA 4CFBA 3VQPA 2R2TA 3MTKA 3DRSB 4GC6A 3HM9A 4KTQA 2G8IA 4DTPA 2AX0A 1BQMB 1RYRA 3V6DB 2C2RA 4CCHA 3IG1B 4CJRA 2YHAA 2WOMA 2HNZA 3MEDB 4NLXA 4FM2A 2DFEA 4KO0B 4FM0A 3PX4A 3NMAA 5DMRA 1FK9B 3B6PA 3MXIA 5DGAA 4M3XA 3GIJA 4O55A 1RT2A 2V9WA 3QGGA 3OYIA 2HNYB 2P1JA 3MAQA 4Q0BA 3BSCA 1RTIA 1R0AA 2E9RX 4LD0A 2P5GA 5KT4A 1J53A 4ECRA 4FLYA 3FFIA 1A5VA 5KGXA 3H5XA 5J2NB 5CYMA 4RZRA 3DYAA 4DS4A 4H4OA 2AU0A 1JXEA 3GIMA 3V9UA 3KLEB 3UQSA 2AGPA 2XY8A 4PQUA 2JC0A 1BCMA 1NHVA 2QKKA 3BSNA 3TABA 3M8PB 1HQUA 1WLJA 1EXQA 1K1SA 3MR5A 2KQ2A 3CO9A 3TVKA 1LWEA 4E3SA 4F2RA 4CGFA 2RKIA 4NLGA 1SKRA 1JXLA 1SL0A 3GV8B 4CGIA 2AJQA 4O3SA 1JLBB 2D0BA 4WFYA 4ED0A 1VSHA 3RB4A 1LWCB 3QIPB 1TKZB 3BSAA 5T14A 1YVFA 3CJ2A 1VSIA 3HPOA 4Z4GA 3O4NA 4TQRA 4CJEA 3VQBA 4ED1A 4CIGA 3HJFA 2XY5A 3ZSVA 1IH7A 1HJRA 3MR6A 1Q9YA 2Z1HA 5KFEA 1TKXB 4CHQA 5KG0A 4HHTA 2KZMA 4O3NA 5J2PB 1VSLA 3H5SA 4NCGA 3VQAA 4KHQA 2YKNA 3QEIA 5FDLB 4CJSA 2AGQA 3TI0A 3PO4A 3U3GA 2B6AB 3HYFA 1X9WA 2R8GA 3DRPA 3G6VA 2B43A 3G6YA 5K14B 3ZT3A 4CEEA 2E9TA 3MECA 3DOLB 4KAIA 1L3VA 3QERA 4ZMMA 1ZBFA 1QSSA 1CLQA 2DFFA 3S9HA 3MR3A 4KHSA 1HNIB 2XY7A 1DTQB 2QV6A 2VG5B 2XCAA 2WHOA 3VQ5A 1RBUA 5C42A 3KHHA 4KRFA 4FS1A 3BSOA 2R8KA 4HCBA 1REVB 3NGDA 3AVNA 3ALYA 4DQPA 4J9OA 3MEGB 2UVWA 3NAHA 2YV0X 4I2PB 1WNEA 4QCLA 4ZP7A 1UWBA 1S1XB 2IC3A 3AVFA 4MK7A 1TQLA 3TAMA 1LW2B 3V1QA 3UPFA 3QESA 1JLGA 4HUEA 2AWZA 4ZP6A 2DY4A 1HMVA 1RTJB 2QXFA 3KLGA 4IKFA 1JLEB 5CYQA 3NH0A 3ZT0A 4KB7A 4CK2A 4O3PA 1XR6A 3V9ZA 1S1WB 2JEIA 2V0NA 2LSNA 1X9SA 3O3HA 2R2UA 5T7BA 2FLLA 3A2FA 2W9BB 1VSEA 3FRZA 4KB0A 3DOKB 3SUNA 5KFNA 4M3WA 3OYAA 1GOAA 1QUVA 2XCPA 1IKXB 1IKVA 4U6PA 5EWGA 2R7YA 4OLBA 4B08A 4BDYA 3VQ4A 3HVRA 3TARA 1VSKA 5J2QA 5C5JA 5JS2A 3NF6A 2KW4A 4WYLA 4KHYA 1JLFA 4IH5A 3GV5B 5JUMA 2QK9A 1XC9A 5J2MA 1RDRA 1HNVB 4G3IA 3OYFA 4KKOA 5KRSA 3OSNA 1RDDA 4FJ8A 3O3FA 3DLGA 3BREA 3VQSA 3L2UA 3QEVA 5D3GB 5HROA 2OPRB 4NLUA 2X74A 3CDUA 4DTSA 4KHRA 1JX4A 1CZ9A 4FLZA 4OLAA 2RF2B 1TVRA 1ZTTA 1W9HA 4YR2A 4J9PA 4YR0A 1C0UA 1C0TB 3CJ0A 4M94A 1ITGA 5KFUA 4ZHRA 4AHSA 2Q3SA 2OZSA 3PZPA 1NJYA 3M9NB 3QLHB 2X78A 4DF4A 3D0PA 4RU9A 4IKAA 2OPPB 4OGEA 4C8LA 4MQ3A 5HBMA 1D9FA 1RT7B 5DG7A 4FK4A 2HHSA 4GVMA 4Z4FA 1VSDA 4DSIA 2OPSA 3KK3A 2C2DA 4OL8A 2ILZA 3QYYA 4FM1A 1JKHA 4PA1A 4IFYA 3ZT4A 4Z4IA 2EC0A 4K4VA 3ZSYA 4K4ZA 1SUQB 1D1UA 4Q8FA 5KG4A 2ZE2B 4PY5A 2YNFA 2FVCA 3H59A 1LAWA 4DL6A 1UA1A 4B9MA 3WNEA 4RW4B 4WFZA 4KHNA 1HYSB 3PJXA 3PX6A 2IS3A 3KLIA 4PUOA 1C1BA 3Q8PB 4W5TA 4CHPA 3DLKA 1N5YB 2FJVA 4FLUA 1DTTB 4H4MB 2ZD1B 4RNHA 3DLRA 1T7PA 3KK2B 1WSGA 4NLSA 3LP2B 2HMIA 2WTFA 4FLXA 2PZSA 4L8RB 4QOZB 2AX1A 4J9QA 4RW9B 2HHVA 1SH3A 3SQ2A 1JLAB 1RT1A 3AO2A 3LAKA 1EP4A 4ZVFA 4FBTA 1KRPA 4BACA 4DL2A 3NE6A 4DWIA 3QGIA 2HHTA 4WE1A 1EETB 3OYJA 3HT3A 3FQKA 1YVUA 1TAUA 3RB0A 4FJ7A 2OPQA 4X2BA 3LWMA 2HHQA 3DRSA 3UDLA 2VWKA 3K5MA 1J5OB 2WCXA 2J6UA 4TYBA 1S1UB 3MEDA 5KFBA 3KHGA 3VQ9A 1NOYA 3OLAA 3KJVB 3OL7A 2XC9A 1FK9A 3AVBA 2JGUA 4QWCA 4MKBA 2FVSA 1RT3B 3PUFA 2V4QA 4Z0UA 1KLMB 3MEEB 4RW8A 2FBVA 4DU3A 3D5MA 3ITHB 3MXJA 4CHNA 4FJNA 1VRTB 1HRHA 5C24B 3DRRA 4E0DA 2ATLA 2HNYA 1LW0B 4R0EA 3IN5A 3C6UA 3I5CA 3M8QB 4IFVB 2WONB 1RA7A 1WSEA 4CJTA 2HNDA 3BR9A 4KPYA 4EO8A 1B9FA 2YNGA 4NLRA 4O3QA 5J2NA 3MFIA 3QNOA 4IH6A 2FBYA 2D7SA 3PVXA 4B9NA 5C25A 3OYEA 4AHTA 3ZSWA 5KFTA 4Y2CA 2RDJA 3AVAA 1CZBA 4CFAA 4E19A 3HP9A 4MFBA 4ECXA 3OL9A 3JSMA 5F8LA 2ASJA 3V9WA 3M8PA 4XIUA 4NLTA 3L2QA 2BRKA 2W9CA 4AHCA 1WSFA 4CEBA 3KIOA 2D41A 4EP5A 3TAFA 4ZVEA 3IAYA 2D0CA 4BWJA 2UUWA 1MU2B 4AILC 2ILYA 4I9LA 4ZPDA 3RMDA 3H5UA 3HVTB 3GIKA 4MKAA 4B9SA 3QO9B 4BDZA 3LPTA 2JEJA 1LAVA 4RW6A 2KTQA 4OKKA 3SQ1A 2XI3A 3QINA 3LP1A 3LALA 1GX6A 1QHTA 4NYNA 3NF7A 1L3UA 5KG5A 4F4XA 3M9OB 4Q5VA 1ZBLA 4CF9A 3NF9A 1D5AA 5J2PA 2GUIA 3K58A 2IJNA 4J2BA 2XWYA 5FROA 4RW7A 1BQNB 1S6QB 4MIBA 1BI4B 3M9MB 5J1EB 4K4TA 3E01B 3C94A 4WZMA 3CJ3A 2R2SA 5F9LA 1VRUA 5DG9A 3DOLA 4J9SA 2X6NA 3H2LA 3QEPA 1U48A 4EO6A 1EX4A 1I39A 1NK6A 4HKQA 1NKEA 1N6QA 3QEWA 4IBNA 3SQ0A 2YNHB 1TKTB 1RILA 4J9NA 3LAMA 3M8SA 1JLQB 3AO4A 1T3NA 3TAPA 4E7KA 2G8HA 3OVNA 2I1RA 1S1TB 2FVQA 3KLHB 2VA2A 4GMJB 5L1KA 4K8ZA 3AO1A 1TV6A 4EEYA 1S9GB 2YHBA 4ECSA 3OL6A 4FLWA 3H4BA 3T3FA 3V6JA 5HRSA 3I0RB 3G6XA 1WN7A 4H8KA 5EWEA 3C6TB 3SNNA 2IM3A 3EZ5A 2HHUA 5KT5A 3AA2A 3KD1E 1XR5A 3K5OA 1HARA 1N4LA 5CZ1A 1TL3A 1D0EA 3GILA 1YTUA 4WFXA 4M3ZA 1QQCA 2W42A 1Z25A 1RT6B 3DM2A 3DMJA 4EP4A 4FK2A 4LH4A 1FXXA 3GV7B 2FJXA 4DSKA 4CF0A 4KSEB 3RB6A 1GX5A 3IRXA 1RT5A 4ID5A 3DI6B 2DPIA 3VA3A 4O4GB 1XHXA 1RYSA 2AQ4A 4CHOA 2ZKUA 3OJUA 1S5JA 1S4FA 2WK4A 4ZVHA 2HWIA 4WYWA 3SPZA 5HP1B 4M3RA 1ZBUA 5HLFB 2F8SA 3PV8A 4R5PB 4LQ9A 3O4QA 2BQUA 5KFXA 4DQSA 5KT2A 4FZXC 2FJWA 1FKPA 4DG1B 1B92A 4URQU 3NBPA 2ALZA 3PW2A 4IG3B 1LWFB 4ZPCA 3U6FA 3RRGA 4J9MA 2IAJB 1WNSA 4B8CA 3OYLA 2UVUA 4CGDA 2R2RA 3QGHA 1IKYB 4IDKB 3CM6A 4FJHA 1CSJA 2YNIB 2W7OA 4FJGA 2YKMA 1U04A 4DTMA 4DEZA 5F8JA 2HAIA 2EHGA 4DL5A 3CVKA 4DL7A 4DS5A 4NLOA 4IG0A 3RBDA 1NK7A 3SFUA 4Z4CA 4RNNA 3SQ4A 2G8FA 2HVHA 2PYJA 3HKWA 1S0NA 3SYZA 2HHWA 5EDWA 4DTRA 4DFMA 4CIFA 1QTMA 1C0TA 4LSLB 4F4ZA 4KV8A 4NCBA 5L1IA 1HQEA 1VSFA 4DQIA 3JYTB 2XY6A 1FKOB 4O3OA 1T05A 3BJYA 2KFNA 3KKSA 3QIOA 1KLNA 4CHYA 1S1VB 4FJKA 1DLOB 3ULDA 2VG6A 1RT4B 1YTAA 3OHBA 1HPZA 3WNFA 4KHWA 3NHGA 4CK3A 4IOBA 4CJ5A 2DTUA 5F8HA 3LANA 5KT3A 3U3YA 3CFOA 4ECVA 3BGRA 2I5JB 4KTWA 4RNOA 2FVRA 1K1QA 2ZQBA 3VQ6A 1ZETA 2ZE2A 4M41A 2FC0A 3Q8RB 4TN2A 3ZSQA 4BE2A 2D5RA 2FBTA 1RNHA 2OA8A 1HYSA 4ZPAA 1RBVA 2IJFA 2OYQA 5KT6A 3G0ZA 4YMEA 4B3OA 4QWDA 1ZBIA 5KFDA 2DFHA 3KK1A 1RBSA 1MMLA 5HRRA 1WAJA 3AVIA 2VG7A 1S0OA 1ASVA 3OLBA 1DTTA 3P83D 2WOMB 4H4MA 2HNZB 4EZ9A 1TK5A 3KK2A 3DLEA 4KE5A 4J2AA 2G8VA 4K8XA 2IM1A 4GC7A 1Q8IA 1C1CB 4RW9A 3NGYA 2GIRA 4CERA 1JLAA 5KGWA 2X6SA 1WSIA 1U49A 4CGJA 4R8UB 4F4WA 1ASWA 1SKWA 2UUTA 3RRHA 4JV0A 5L1LA 3VQ7A 2FLNA 4Q0BB 2WRMA 1RTIB 1NNDA 2P5OA 4DTJA 3FFIB 4C8NA 4DQRA 5FRNA 5CYMB 4PWDA 3DYAB 5HRNA 4H4OB 1S9EA 3AA4A 2BE2B 3D28A 2JEFA 2O4GA 4RG8A 1L3TA 1S1UA 4AHUA 3LP0A 3O3GA 4FJXA 4ZVGA 5KFFA 3OS0A 1RT3A 3DDKA 4K4SA 3FQLA 4J2DA 4M3TA 3QZ7A 1K6YA 1KLMA 1SKSA 4CJPA 4CEDA 4DL3A 4I7FB 2XGPA 1IO2A 1VRTA 5C24A 4FJJA 3V6HA 5EWFA 4F8RA 3M8QA 3GIIA 4W5OA 3OSPA 1RTDB 2J6TA 4NZ0A 4TXSA 4TY8B 3L2WA 4G1QA 3IGVA 4W5QA 3MXMA 3B6OA 2BQRA 2Z1GA 1NK4A 1BL3A 1U47A 1TL1A 3TR8A 3KNAA 5F9NA 4ZP8A 3T5KA 3L3VA 4IRDA 1VSJA 2IM0A 4E1MA 1BIUA 4HYKA 3CWJA 1KCFA 3K5NA 5SZTA 4DTNA 2FBXA 4DU4A 3KLFA 1L3SA 3P5JA 2BRLA 3KD5E 5EUHA 3IS9A 4CJ3A 3DRPB 5KFQA 4ELTA 3N6MA 5I42A 1EKEA 3SV3A 4F3OA 3MECB 1KVCA 1UA0A 2HB5A 1XI1A 2IMWP 3AV9A 4DSEA 5JXSA 2AGOA 3OJSA 4KFBA 5KG3A 2ITGA 2F8TA 3QO9A 3S3NA 4K50A 4URSA 2BGGA 1RA6A 4LSNA 2BANA 1RAJA 5F8GA 4IRKA 4EBDA 1F21A 4DFJA 3V4IA 1XR7A 4O3RA 3PR5B 2C2EA 2G8WA 2W8KA 3D45A 2RPIA 1QAIA 1BQNA 3VQEA 2IC3B 1BI4A 4CJWA 3TAMB 4CEOA 5SWMA 4ICLB 2IGIA 1WAFA 3HHKA 3FDSA 1JLGB 3I0SA 4DTXA 2E4LA 1ZBHA 4CF2A 2R8HA 3ZSRA 1QSLA 1HMVB 3KLGB 2GC8A 5CYQB 4QPXA 2B5JA 4Z4HA 4NRTA 4QW8A 3HK2A 1S6PB 4CEQA 3N6NA 1NK5A 3QZ8A 5F8MA 2GV9A 4B9UA 3K5LA 3G10A 3BQ1A 5KFLA 1S1TA 2JC1A 4I9QA 4O44B 3L8BA 1BQMA 3V6DA 3IG1A 4DTOA 1IKVB 4KO0A 4FS2A 4K4XA 3SUQA 5DQGA 3I0RA 3RB3A 3HP6A 3RWUA 4IRCA 4F4KA 1QS4A 3EZUA 1KFSA 4B9TA 3AVMA 4CJLA 1A5WA 4IH7A 1JLFB 1RT6A 4RNFA 5E41A 4JRPA 1XHZA 3CFPA 4ZP9A 4DQQA 3HL8A 3QEXA 4KKOB 3WNGA 5I3UB 3KMSA 3AVKA 4FJ9A 3DLGB 3DI6A 1IM4A 1NKCA 5HROB 3KLEA 1WSJA 3I5BA 5CY4A 2CKWA 3VN5A 4FJMA 1T94A 1TVRB 4OJRA 1QSYA 3DLHA 1BCOA 4R5PA 2XHBA 4E7LA 1SV5B 2A1SA 4CGGA 5DK5A 1C0UB 5KFYA 4YQWA 1KVAA 1BISA 2OH2A 2IDOA 4FW1A 4DFPA 4E89A 2FLPA 4RUAA 3KKRA 1LV5A 3V1OA 1IKYA 4BWMA 2JLEA 3GYNA 2YNIA 1BIZA 1C2PA 4DLGA 1JLBA 1QE1B 1C1AA 3PX0A 4ED7A 1TKDA 1LWCA 3QIPA 4Z4EA 2KFZA 1HYVA 2NUBA 1J54A 1TKZA 2B4JA 2OPSB 1X9MA 4QWEA 5KFRA 3PW5A 4F2SA 3S3MA 3KK3B 3NGIA 3TWHA 2RDIA 1U45A 3NAIA 1RTHB 1TKXA 2C22A 3I8DA 5KFPA 4YFUA 1W0HA 4ZTJA 4CJVA 5L9XA 3T1AA 4YP3A 4ZPBA 3BQ2A 2WB4A 4JRQA 5FDLA 2YNFB 4FJLA 4KI6A 2B6AA 3SUOA 4KAZA 5DQIA 4N76A 4I2QB 2IA6A 2HW3A 5K14A 5KG1A 3NF8A 3KLIB 4PUOB 1C1BB 3DLKB 3F9KA 4CJQA 4CJ4A 1S1VA 1HNIA 1RDCA 1DTQA 4ECTA 2VG5A 3SI8A 3LPUA 3AA3A 4Q43A 2HMIB 1NJXA 2R8IA 3HPHA 3NL0A 4CGHA 1RT1B 1EP4B 3NAEA 3T5JA 4FYDA 2ETJA 1REVA 2IM2A 4WE1B 3MEGA 4KHMA 5KFAA 4H54A 4I2PA 1XWLA 3RMBA 1S1XA 3CG7A 4MH8A 4NRUA 1LW2A 3G86A 5DQHA 1S0MA 2Z1JA 4FW2A 3E51A 5KFJA 1S10A 1SL1A 3PW4A 3SCXA 2Z1IA 1RTJA 1JLEA 2E9ZA 3ZSZA 3EPGA 4YNQA 4N56A 4FJIA 1C1CA 1S1WA 4NYZA 1Z4UA 4RW8B 4ECWA 4F50A 1BGXT 4TQSA 2W9BA 4R8UA 3OY9A 3AO5A 3QETA 3RBEA 2QKBA 4U7CA 3DRRB 4YR3A 1BHLA 3DOKA 3C6UB 1IKXA 2IOCA 4HVJA 3VQCA 3SV4A 2HNDB 3HVWA 3OYGA 2YNGB 4NLWA 5F8NA 4EYHB 4TYAA 3LWLA 2XGQA 4KBIA 5C25B 2BE2A 3ICLA 3RAXA 4TLRA 1TP7A 3EYZA 5KFCA 3RTVA 4O0IA 4DF8A 3ASMA 3L2RA 4MFBB 1TAQA 3PW0A 3JSMB 3Q8SB 3MR2A 2DPJA 4C8KA 4CHZA 3EPIA 4MIAA 1NHUA 2IBKA 1HNVA 2PYLA 2W9CB 5KFWA 4OPKA 2W7PA 1IKWB 5D3GA 4NYFA 4NLYA 4I7FA 4N5SA 2OPRA 3CJ4A 2XO7A 3OYBA 3K2PA 2RF2A 4OKJA 4QW9A 1RTDA 1W25A 1O1WA 3EY1A 4TY8A 3KLVA 5DLGA 1JL1A 3CQ8A 2D3ZA 4RW6B 3C95A 1KFDA 3OYMA 4Y1CA 4ELUA 4CEFA 4J9RA 3LP1B 1OS5A 3QLHA 3OS1A 1JLCB 2E6LA 3PW7A 5JS1A 4BDPA 2OPPA 3LZIA 3RR7A 1U4BA 3MF5A 4AHRA 1RT7A 3OYHA 5DLFA 3OYNA 1RBTA 1ASUA 4ED8A 3T5LA 2V4RA 2EX3A 4RW7B 4N47A 1JXBA 3SZ2A 2E6MA 4Q44A 4CFDA 3CM5A 3LDSA 3KTQA 3CDWA 3RR8A 1VRUB 4HCCA 3DLBA 3V81B 1D9DA 1NK9A 4OVLA 4ED6A 3F73A 1N6QB 4CJFA 1SUQA 4TY9A 5KFZA 5EU7A 4FZYA 1S48A 1T03B 1Z26A 3TAQA 2A1RA 4KTZA 3ZT1A 4LQ3A 4RW4A 3PJWA 4HUFA 4J2EA 2G8KA 4W5NA 3HO1A 4CECA 3SFGA 3H08A 1CXQA 3ZSOA 4CIEA 1N5YA 2BDPA 1TV6B 4NLPA 2ASDA 4XO0A 2JEGA 2ZD1A 4ECYA 2KZZA 1ZTWA 3LP2A 4CF1A 4LH5A 4ICLA 3ZCMA 3L2VA 2F8EX 5KT7A 5CZ2A 4FK0A 4M95A 1TL3B 5KG7A 1RT2B 4NLVA 4OKEA 2VA3A 4Y3CA 4C8MA 1UAXA 3ISND 3PY8A 1EETA 3I5AA 4RUCA 4DLEA 3DM2B 4EBCA 1R0AB 1S6PA 3DMJB 4O5BA 1KHVA 1HYZA 2XRIA 3TAGA 4LY7A 4FCYA 3VQ8A 2GIQA 3IRXB 1T8EA 1RT5B 4K4YA 4ID5B 4EBEA 1J5OA 3ZT2A 4M45A 3AVHA 4O44A 5DGBA 4PQUB 2UVRA 4IR1A 5KI6A 1S9FA 4CEAA 3H40A 1S97A 4F4YA 4ED2A 1S49A 3OYKA 3KJVA 4XPEA 1HQUB 4ED3A 4QAGA 1FKPB 4DMNA 2OZMA 4ECQA 4E7IA 1IG9A 3NBPB 3MEEA 3KOAA 3KHLA 1LWEB 3ITHA 2RKIB 3H4DA 4EZ6A 4M42A 4URGA 4FZZA 1LW0A 1J9AA 2YKMB 2W9AA 4GW6A 4IFVA 2WONA 2BQ3A 4AHVA 3SJJA 5I3UA 1QAJA 1G15A 4E7HA 2VWJA 1D8YA 3NGZA 3NKYA 3THVA 4IG0B 3KHRA 3H5YA 1GOBA 3QNNA 3QIDA 4OGCA 4DSLA 3PHEA 5F8IA 4UQGA 2P51A 1SV5A 5HRPA 4NCGB 4KV8B 2YKNB 3S3OA 1HQEB 3GQCA 4MK8A 4DSJA 1NJZA 3K57A 4B9LA 1T05B 2FVPA 1NOZA 3H98A 4CE9A 3SUPA 1MU2A 1ZYQA 1QE1A 2Y1JA 3OS2A 4WZQA 3OHAA 3OYDA 3HVTA 4WXWA 3Q8QB 4Q8EA 5KG6A 2VG6B 5L1JA 2UVVA 1KTQA 1HPZB 3AVJA 5C42B 4NLQA 3HSTB 1NKBA 4NCAA 1KSPA 4ECUA 1YT3A 2C28A 3BGRB 2RN2A 4O4RA 1RTHA 2J6SA 4O0JA 4M3YA 4TSXA 4DTUA 3SI6A 3PR4A 1I6JA 1B9DA 1GOCA 3RAQA 4E7JA 1UWBB 1S6QA 3KMQA 3WNHA 5J1EA 4CF8A 3E01A 1NJWA 4I2QA 4MK9A 1C6VA 4FXDA 4B3OB 3KK1B 4ID1A 1NK0A 2VG7B 3FSIA 1KHWA 3TANA 2CJQA 4FJ5A 3T5HA 2W8LA 4N41A 3RMCA 1Q9XA 4Y1DA 3CIZA 3DLEB 1VSMA 3NCIA 2YNHA 3CFRA 5KFIA 1TKTA 4J9KA 3T19A 4Y2AA 4RNMA 4IR9A 1JLQA 4Y34A 1JL2A 5KFKA 3LP3A 4CJKA 3KLHA 4BE0A 1KVBA 4F3TA 1S9GA 4OPJA 3ISNC 3AVGA 4CEZA 4AH9A 2ASLA 4FLVA 4PWDB 3VA0A 1S9EB 3C6TA 2ATQA 3NFAA 5KFVA 2HWHA 5J2QB 5KFOA 4JS4A 3K59A 3TAEA 3NH2A 1TGOA 1UOCA 1SH2A 4ZTFA 3LP0B 1VK0A 1SH0A 2G8UA 3V9XA 5J2MB 1N56A 3NH1A 2O4IA 5KFHA 2D0AA 4IQXA 4B9VA 4CJUA 4O4GA 3OL8A 4BE1A 2R8JA 1WSHA 1RDBA 1A5XA 3UR0A 5HP1A 3PO5A 5KFMA 3CDEA 5HLFA 3HPGA 2Y1IA 2QE5A 4QWBA 1TK0A 4DG1A 4G1QB 4ZHRB 2HHXA 1U09A 4ELVA 3LZJA 4M3UA 4CK1A 4IG3A 4K4UA 1LWFA 1TL1B 4DFKA 2HVIA 4JV2A 4FBUA 2IAJA 3AVLA 1JIHA 3HVAA 4IDKA 3ZSXA 1N48A 1SL2A 3N6LA 3RMAA 2XI2A 5HBMB 3M8RA 3BDPA 1C0MA 3V1RA 3KLFB 4DU1A 5KFGA 4ECZA 1IKWA 1Y97A 3IS9B 4XPCA 4JS5A 5FRMA 3TQ1A 5I42B 2BR0A 4J9LA 1L5UA 4JV1A 4HUGA 5KFSA 2O5DA 1JKHB 1RCHA 4IFYB 4DL4A 3CYMA 4KFBB 3HXMA 4FLTA 3SPYA 4KREA 3V6KA 4KHUA 4LSLA 4W5RA 3L3UA 2D3UA 4HTUA 3AA5X 1TK8A 4LSNB 2BANB 4NLDA 4WXOA 4E1NA 3JYTA 4KB1A 3VQQA 1FKOA 1JLCA 4DSFA 4C8OA 3P1GA 4CESA 1CXUA 1I3AA 3V4IB 4FVMA 3CJ5A 1DLOA 4JUZA 4Q45A 4JLHA 1RT4A 5KTQA 5KRTA 2F96A 4EYIB 1RDAA 2PY5A 1NK8A 2GBZA 3V81A 2I5JA 3I0SB 4K4WA 3NDKA 4QWAA 5DG8A 1X1PA 3UIQA 3BQ0A 4KI4A 4CFCA 3AVCA 3VQDA 3IGNA 2B5JB 1T03A 4B8AB 5KG2A 3AO3A 3MFHA 3OYCA 2OPQB 3V9SA
chains in the Genus database with same CATH superfamily
2VL1A 4J9VA 3FZKA 4PR6A 3DRSB 4ZLLA 1KOOA 3MUMP 5AQNA 2G8IA 1RYRA 4USHA 2C2RA 4ZLNA 4CCHA 3IG1B 4TU7A 1ITPA 2HNZA 1MNEA 4DX6A 3NMAA 2RVJA 2GHWA 5DMRA 1FK9B 3IR7B 3CEDA 4M3XA 4FWRA 3R9LA 4ZITA 4WQ5A 1RT2A 4A2AA 1RLDA 1JK9B 2QMXA 3QGGA 2HNYB 1VQKS 2P1JA 2HURA 1Y3KA 4CLLA 1RTIA 1SQFA 4NWBA 5KT4A 1GLEG 3FFIA 5KGXA 1U6BA 4HLBA 4RTFD 2FY8A 3KLEB 5A8RA 4IJNA 4ILMA 4OZ5A 1NHVA 2W2PP 2OUGA 2XHWA 3BSNA 2DCUB 1IWAA 3M8PB 4U67Q 4PXBA 3UD4P 4A46A 2XSJA 5JVGQ 4K5SA 2UXCF 4NLBA 1OVYA 3TVKA 4BRAA 2RKIA 1MSWD 1X60A 2LA6A 4HEA9 3J80U 4M5KA 1SS6A 2K3KA 4USWA 4O3SA 4WFYA 1CJKA 3H0PA 2XO6A 4ED0A 1VSHA 2YKOA 3QIPB 5AQWA 4WKRA 4HDGA 3BSAA 5AQXA 4Z4GA 2UUCJ 4CIGA 2ZNYA 4OX6A 4DX7A 4LFBK 3QAEA 4USMA 3TJ9A 2YJEA 5LMUJ 3KZBA 2C3OA 1OPZA 2DGVA 4HHTA 5D4LA 1VSLA 3W2VB 3H5SA 1B0TA 3VQAA 4PEOA 3QEIA 3A8JA 2RD5C 4B1VA 4CJSA 3TI0A 3U3GA 1YG0A 1RABB 2R8GA 3G6VA 2B43A 3G6YA 3O44A 3DOLB 1UEVA 3I8BA 3QERA 5GMDA 2DFFA 4AL5A 4CNYA 3BF1A 2XY7A 1DTQB 3BKUA 1HBOB 2QN6B 4DN0A 1E4FT 4CT8A 4GNIA 4JHDA 1CC7A 1NDCA 1H3DA 4PKHA 4M1KA 5AT1B 3W8PA 2UV8A 3WXIA 4KRFA 2LQ9A 3LGMA 5IS2A 4BY9C 5ETVA 2R8KA 3GP9A 3P45B 1FESA 1KDNA 4DQPA 4K0KK 4J9OA 2CJKA 2YV0X 3HDSA 4ANCA 1UWBA 4JV5J 3AVFA 2IC3A 3TAMA 1VK8A 3EVWA 1JLGA 3FBCA 3QJJA 2HRUA 4PG7A 5TKYA 1M0SA 3SCKE 3H2UB 4ZP6A 2DY4A 4B1XB 3UKRB 2UZAA 3NH0A 3HSJA 1RHRB 4DV1F 5GADI 4DZ6A 2V0NA 1X9SA 2LSNA 3O3HA 2KT2A 1GMWD 4Y00A 3A5MC 4KB0A 2DHGA 1H2UX 2COLA 3SUNA 5KFNA 4M3WA 2CNNB 1IKXB 5EWGA 3Q7CA 1DHMA 3W60A 2NPIA 2W2MP 4UY8T 5DETA 2DEJA 4IYQA 1N32F 4ENOA 4JI2F 3TZWA 5DDQC 1HIYA 2FUG9 4DR7K 2B4OA 3GV5B 5G0RA 2IVMA 5CH7B 1PBAA 2WBRA 5J2MA 2JL9A 4P9SA 2MZQA 3OYFA 1O5JA 1B0VA 1Y10A 3QEVA 1O8BA 3CW2C 2BW7A 3BY5A 3CDUA 4DTSA 3D6RA 2DBBA 4WF9Q 2YH1A 1ZTTA 5FPDA 1W9HA 4YR2A 4U7UK 5GIOA 1SBRA 1IBLK 1MMDA 1TR0A 2E66A 1SB6A 3M9NB 3D67A 4EWTA 3QLHB 3GG1A 2X78A 4DF4A 3D0PA 1RJJA 4RU9A 4OGEA 2W6KA 5DG7A 2HHSA 1SAZA 3GE9A 3EZOA 5EN1A 3FMBA 1N33F 5AQLA 2BJ3A 4A62A 1F60B 3NGKA 2G1HA 3QYYA 4C7QA 4IFYA 4ISGA 1HA1A 4K4VA 3ZSYA 2ZE2B 3TWZA 4NI2A 3H59A 2E1PA 4DL6A 3WNEA 2GWJA 1KVJA 4WFZA 4KHNA 3E9LA 3PX6A 1LQ9A 4QS7A 1C1BA 4DV7F 3M8WA 3WIUA 1U2FA 4CHPA 3N5BA 4FNIA 4LVOP 3DLKA 2E44A 2FJVA 2W2NP 3RUBL 4RNHA 1VYAA 1ATNA 3KK2B 2ZITA 1R6YA 3LP2B 4FLXA 4FF4A 1SXLA 2HHVA 1GXUA 1RT1A 1EP4A 3K5PA 2YCHA 1FF2A 5HK4A 3M4XA 3MCOA 2WC9A 3KUGA 5CR4A 4WE1A 2CWXA 2H65B 3HT3A 1YVUA 1TAUA 1RHKB 2MKSA 2OPQA 4X2BA 4DKWA 2XM3A 1WB9A 4QIVA 2HHQA 3UDLA 2FLOA 2Y9HA 1XNRF 8RUCA 2IIRA 1SIZA 2H1YA 4FWOA 2H5JB 3US5A 1S1UB 2E7WA 1VQPN 3KHGA 1NOYA 3OLAA 1UPMB 2JGUA 2FVSA 3TUJC 2MGZB 3RBZA 2GVDB 4Z0UA 3MEEB 2DY1A 4DU3A 4Y0FA 2GW8A 3RJMB 2OJ3A 5AZJB 1DGKN 2ATLA 1R89A 3A4TA 2EFVA 4R0EA 3IN5A 3I5CA 4U7BA 3FSYA 4CJTA 3N01A 1WSEA 3VF6A 1EAYC 3R27A 3D2FB 4NLRA 5J2NA 4IH6A 2ZM6J 2FBYA 4DV2K 3PVXA 2IJRA 2CQPA 1RACB 3DU6A 1X5PA 1IBMJ 4E19A 2LYVA 3OL9A 5F8LA 1WSVA 1TYQB 1WC6A 1JJ2R 2MY7A 2B4VA 1WSFA 4CEBA 1ZA1B 3ELHA 2D41A 3TAFA 4ZVEA 4FYVB 1LOUA 4AILC 4HT7A 4ZPDA 2G9OA 3PSIA 4C97A 4OZ3A 3H5UA 3FVYA 3VEWA 4ED5A 4MKAA 3VETA 5ETQA 1N34J 3A5NC 2JEJA 1LAVA 4DV5J 2CXEA 3AJDA 3AGRA 4NYNA 3NF7A 2I0XA 2HBZB 4X4PA 1L3UA 3NS7B 4F4XA 2E2NA 1NNEA 4G65A 2E5HA 3T1YJ 1G99A 3AFGA 3I9ZA 2DYAA 3VZHA 2O67A 3SBTA 2KN4A 4J2BA 1F5CA 2ROGA 4MIBA 1BI4B 3E01B 1AB8A 3LW5C 4NXMF 3CJAA 2CZ9A 3H2LA 3QEPA 1ZAXA 2WVDA 4IDHA 1NK6A 2YHXA 1N6QA 5AE3A 1RWMB 4PYAA 2VODA 1S99A 3O6WA 4BRMA 5AFUA 3LAMA 4DI6A 3AO4A 3CC7S 2V7YA 4PXDA 4E7KA 2G8HA 3VGLA 1X8DA 2I1RA 1FFWB 3LH2S 5I9EB 4ES3A 3E1YA 4EEYA 4OZ0A 3HULA 4PL8A 2B7BB 3OL6A 3IWLA 2HSTA 1FRKA 1VQ4S 2HAFA 1I51B 2V8PA 4WP9A 3SNNA 3K5OA 3P39A 2ROEA 5CZ1A 3P38A 1NUEA 1XK8A 4G1IA 1Z25A 1RT6B 1B7FA 2NYIA 6FDRA 4EP4A 4FK2A 2HFVA 3R3TA 4DCHA 4GKKF 4RUBA 4CBXA 1D09B 1IR2A 2UUBF 3PFEA 1RT5A 2D4WA 1SC6A 1I94J 4GV6A 5AQTA 2ZKUA 2NRTA 3OJUA 2XMAA 1CJUB 1S4FA 3GFXA 4LF9F 2QIFA 4DR4F 1MWYA 2BACA 2UUAJ 3G4SN 3PV8A 4R5PB 5E5NA 1OIAA 4NMLA 3O4QA 2ZBQA 4FZXC 2FJWA 4DG1B 4ILJA 1Q1KA 4URQU 2LMIA 2ALZA 3PW2A 2ZBCA 4L6V3 1DBDA 1GMWA 3U6FA 3RRGA 1WNSA 1Y0HA 4X65K 1YJ9S 1Q78A 4FJGA 3T9NA 3FNNA 4DTMA 2IRYA 3OPKA 1HWIA 4DR3K 1S6UA 3PYDA 4LF5K 2HGNA 4LFAJ 4DS5A 4CZCA 3VGMA 3RBDA 3CD6N 4EK2A 3GG0A 4MT1A 2G8FA 1VQMS 2PYJA 2YPZA 5ETRA 4DTRA 1KN6A 3CNQP 1LCUA 4CIFA 2Z2LA 1C0TA 3TEGA 4F4ZA 3O1LA 1ZXOA 2V9KA 3OA9A 2NZCA 2QX0A 3BJYA 2JH3A 1NDLA 2H9ZA 4BRDA 2KFNA 1Z1ZA 3KKSA 3QIOA 5IFMA 1NJIT 2QSFA 1IG8A 3RAMA 2OFGX 5M1FA 1YTAA 3UNGC 4DPTA 2KG0A 1HPZA 3CCSN 2N7YA 4CK3A 1RISA 1K44A 1MG7A 4ECVA 4CH1A 1F2GA 3H1QA 1DAXA 1OQ6A 1K1QA 3QT6A 3VQ6A 2OMOA 3Q8RB 5D0RA 3DKDA 1NMEB 4DDFA 3IFEA 2B9XA 1RBVA 2QI2A 4X4OA 2P2CB 5AFUH 2IRUA 2HWTA 4B3OA 4PWWA 1RBSA 1WOQA 4EMDA 2CPYA 2VG7A 3L7UA 4ZVTB 1ASVA 3OLBA 4X64J 3O08A 3P83D 4H4MA 2OEKA 4EZ9A 3DXKB 4J2AA 2I7PA 1GTEA 1N5QA 2BJDA 2VWBA 4RW9A 2GIRA 4GVBA 4V19S 1WSIA 1YRUA 1HNXF 1ASWA 4C3KA 4YOUA 5L1LA 4WTYA 2FLNA 1N8RO 4IEIA 4Q0BB 2XYGB 2P5OA 2MZSA 4BG8A 4DQRA 5HRNA 3JQJA 4C6AA 1RWOB 3MM5A 3M6VA 3MGJA 4FSVA 1YF5L 4OX9F 3TA0A 1L3TA 3SJHA 2PMWA 2K1RB 4AHUA 2A40A 3LP0A 4LIWA 1FHTA 5KFFA 1ZZFA 2FHMA 2CQ2A 2NXJA 3TA1A 5BR9A 4I7FB 1IO2A 5C24A 3J7A1 1NGDA 1HR0F 3V6HA 2QLFB 3M8QA 3IBCB 3GIIA 4O5FA 2ZJRL 3NVMA 1RTDB 4PABA 2XSFA 2ZBRA 2J6TA 4NZ0A 4TXSA 2MKKA 4AF1A 4J90A 3RGIA 5F9NA 1JCGA 3VGKA 2J7KA 1O13A 2IM0A 3M5RA 2HQIA 3EE8A 4HYKA 2QM1A 2E5JA 4NL5A 5SZTA 2G13A 4CBWA 3M1VA 3IS9A 3DRPB 2YQ1A 3UDEA 2FZGB 2DNQA 3N4WA 3N6MA 4FYWB 4A2BA 3W8GA 3SV3A 1RAHB 3MECB 2HFUA 4ZVPB 5DDRC 1SPBP 4CZGA 3BUZB 4B3SJ 5KG3A 1FEHA 2H3GX 2F8TA 4JYAK 4AE5A 3EKSA 1RA6A 1KC8O 4JI8K 5F8GA 2HG4A 2BV3A 1HD1A 3CCJN 1SI9A 1HUXA 4O3RA 4ITSA 2C2EA 4LFBF 1PC4A 5MLCV 1RSCA 1BQNA 1U8SA 3BBFA 3E8OA 4CJWA 1UKUA 2FY1A 3MCAB 4ICLB 3R9PA 3ZEUA 1NRKA 3GFHA 4ZVOB 3UN2A 1K73T 4OYZA 4QPXA 1HKGA 4FNHA 1S6PB 2NRXA 5J1NA 3MMVA 3HJVA 5F8MA 3BGOP 2J9EA 3WQPA 3AARA 1QUPA 3IG1A 4DTOA 1NGGA 1FJCA 3IC1A 3SUQA 2BTFA 4K0KF 3CCTA 2JWLA 4F4KA 2ZWHA 4B17A 2POKA 2MKJA 1CJTA 1UMJA 4DR6F 4FKXA 2YQ3A 1A5WA 4M5DB 4RNFA 5D8HB 1U1NA 3FSXA 3WNGA 1OMSA 3WXKA 4FJ9A 2ZF5O 4N77A 2A6OA 3AD9C 4L76A 3KLEA 3OQ2A 3J80O 5CY4A 5A6WA 1FVSA 3VN5A 1CPZA 1BCOA 2XHBA 4RPFA 4I1TA 4E7LA 2PMHA 4YQWA 4KBOA 4BROA 1B99A 3DC2A 1KVAA 1BISA 1MWMA 4FW1A 2V2KA 1EX8A 2FLPA 1I5OB 2NRHA 4BWMA 3MM9A 3GYNA 3FZ2A 2YNIA 1FFSB 1BIZA 1Q18A 3IMXA 1C1AA 3PX0A 1TKDA 2X1FA 1V3RA 2KKZA 1HW8A 3QIPA 4Z4EA 2FC8A 4CVNE 1HYVA 2NUBA 5GADU 4JKEA 2DXEA 5HL7Q 2B4JA 5KFRA 1RAEB 2GJIA 5E84A 3S3MA 2MQPA 3OFEA 5FLXY 4YEAA 3KK3B 2GV1A 2BJ7A 3FZBA 2KVQE 2P9UB 2CA9A 4CLUA 4WFBL 4IOAL 4DUZF 3NAIA 1RTHB 1X4AA 4PYDA 2P6TA 1GLJO 1FX4A 3W2VA 3BQ2A 3EZWA 4PHTX 3JTNA 1VBKA 4C1NK 2UXBK 5DDPC 2HW3A 4OHZA 1AFIA 1IBLF 3EWGA 3CCRS 1RQ0A 2L9NA 1FNMA 3F9KA 2HEKA 1RDCA 1DTQA 4ECTA 1LKZA 4W92B 3SI8A 3H42A 1U6FA 5IT4A 3UWTA 3VF0B 2KG1A 3HPHA 3MUTP 2V2VA 3NAEA 3HFVA 3JSYA 1SQKA 2JWKA 1GLFO 5A2QY 2DNKA 4JI6J 1XWLA 4EUVA 2LEPA 2L9WA 4DR5K 2VZ9A 3RMBA 4CIOA 3CULA 2W01A 1B70B 5DQHA 3FZFA 2Z1JA 1XERA 3MM8B 4BR5A 4WBFA 3R1XA 2VBYA 2OI2A 5GAGI 2Z1IA 2ACYA 3UKRA 2E9ZA 1TL4A 3VEVA 2O01C 2KU7A 1JJ2M 4YNQA 3FC9A 3OTBA 1X3NA 4ID8A 2A2CA 4H4KC 3MN9A 5C15A 2P9SA 1BGXT 2FHJA 4OYOA 4RO0A 3DRRB 4YR3A 8ATCB 2Z2MA 3C6UB 4B3TF 4X4UA 1IKXA 2DNRA 3JTOA 2MQLA 4NASA 2YNGB 3KG4A 2DGXA 3LWLA 2O8FB 2XGQA 1VC5A 2ZH8A 1VLOA 2CQCA 1U2VA 2UYTA 1CJVB 5CCLA 4OI6A 2J76E 4MYUA 1W7WA 3PW0A 4F36A 4JI5K 1V3SA 4C8KA 2O8DB 2R7RA 1K8AT 2IBKA 4HT5A 2PYLA 4CTAB 3MK6A 2W9CB 1FXLA 2CQBA 4GV3A 1VQKN 5LJVA 3K8VA 4NLYA 3OT9A 3L4IA 2E2OA 1CC8A 1SQGA 3PHTA 1NB7A 4GKJJ 3FE1A 1HNWJ 3A0IX 4QW9A 2QWQA 1W25A 5DLGA 1YJVA 3CQ8A 2EXUA 2BYCA 4C0BA 3G25A 2RDDA 1BQXA 3PTWA 1KFDA 5DZ6A 4CZKA 2ZJPL 3QLHA 2C3UA 4BDPA 3MF5A 4AHRA 2HSEB 3GCWP 3NCQA 4NA2A 2GVZA 1RBTA 3B6BA 4ED8A 1T02A 4E8UA 2V4RA 2EX3A 3BF4A 3BGLA 4N47A 3CE8A 1T9YA 2Q1LA 1FRJA 3FCHA 3LDSA 4B02A 3CDWA 2OFHX 2NSCA 3CHWA 1NM2A 1D9DA 1NK9A 2KT3A 2Y0SD 4ED6A 2R7TA 1GLAG 2QWPA 3WT0A 2Z2ZA 1XJWB 1Q8BA 1S48A 1T03B 2QFJA 4KH1B 1F9HA 2LDYA 1TZ0A 3ZT1A 2RIJA 3PJWA 4J2EA 1NM1A 4PG5A 3FGUA 4W5NA 1UW4A 3HO1A 3C16B 2YY3A 3H08A 4CIEA 2FSJA 2C2MB 3DXMB 3LP2A 4UY8O 4LH5A 3G6ES 3L2VA 2F8EX 2PN6A 4DBQA 1VIOA 4M95A 4YOXA 2OP5A 4EFAC 2E1AA 2F5GA 2VA3A 4GVLA 4Y3CA 4C8MA 4ILHA 2R7SA 4OO1J 2DB1A 2QA2A 4A57A 2DKOB 4RUCA 4EBCA 1R0AB 4YOYA 2FIUA 1KHVA 1Y5NB 3ISZA 1A9NB 2LQ5A 2PA3A 3DDIA 4U95A 4ZVRB 3L6QA 1FDAA 4O44A 5DGBA 1DRZA 3Q8YA 1X4GA 1S97A 1N36K 2BABA 3K2YA 1HQUB 4ED3A 3C2PA 2MGZA 4ECQA 2FJEB 2GVDA 3SK3A 3MMCB 1IG9A 3MEEA 3KHLA 1LWEB 2QO3A 2RRBA 2DT9A 3H4DA 2VQFF 3CCEN 5AZJA 5BPNA 2CJ9A 4KH0B 3JXUA 3KG0A 3OXLA 5RUBA 2DR7A 1VQYA 3D2FA 5I3UA 1WKLA 1FKAF 1R31A 2VWJA 1D8YA 3F5TA 3NKYA 3EGWB 1BD6A 4QIGA 2O8CA 1A7GE 2DRAA 4U96A 1GOBA 4DSLA 1FNXH 2HBQB 3SCIE 3THYB 4UQGA 4QZVB 1WF2A 2P51A 2HF4A 1SV5A 1R8AA 2VU5A 2ZZNA 5HRPA 1TYQA 2YKNB 4YORA 3IAM9 4UZCA 1HQEB 2GMLA 2ZM6K 5AQFA 3QBCA 4N8OA 3K57A 1VQ9S 3H98A 4CE9A 3SUPA 3J81O 2J9CA 3VVUA 3R6LB 1QE1A 3TSPA 1Z05A 4CZFA 4A8SA 3OYDA 1JMTA 1DT9A 4Q8EA 5KG6A 4X65F 5GAEP 3A3OB 2NR0A 2O8BA 1RAAB 3ZZZA 5BPMA 4LIRA 1P8GA 3HF5A 4LF5F 5D4NA 4M3YA 4O0JA 2BA9A 3NS6A 3SI6A 1I6JA 4YB7A 1SZ2A 2KL8A 3RAQA 4BRHA 4E7JA 5LMNJ 3I9V9 1N34K 1T9TA 4CF8A 3E01A 3W63A 4DV5K 3HHDA 4MK9A 2F8MA 2IYGA 3WEEB 1J5EJ 3T5HA 2OEMA 2YX7A 3KXDA 1VBYA 1Q9XA 2D9OA 2CZ4A 1R8PA 3CIZA 3DLEB 3CFRA 1UL3A 4RNMA 5D0EA 1LXJA 4RBUA 5KFKA 5AJ3K 3LF0A 2VOPA 3ENVA 4GVEA 4ZPWR 4LF7K 3F0NA 2ZFHA 4OHYA 1YDLA 1NSAA 2DGWA 4AH9A 3BN4A 4FLVA 1FEEA 2Y8YA 1S9EB 1CQMA 2AZ3A 2I9SA 3PSFA 4IXCA 2DISA 3NH2A 1TGOA 1SH2A 3ZZYA 1VK0A 2G8UA 5FPEA 3ZZUA 3EKUA 2EKNA 2OTLS 4B9VA 1XNQJ 4BE1A 1WSHA 1A5XA 1CS4A 4YHHK 1CJUA 1H72C 4P2FA 3G96A 3EUNA 4HHJA 4PG6A 1R0BG 3HPGA 4Y2KA 2C2ZB 3W5ZA 2O1PA 2YX6A 4DG1A 4ZHRB 1VHFA 1U09A 4P74A 4F9OA 2R7WA 3VEOA 4KHPK 4CK1A 1TL1B 1VQ7S 2HVIA 2GELA 3RW7A 3AVLA 1JIHA 5H1SV 3LQVA 1I94K 5GAHU 3UW1A 5IXUA 5ETSA 1SL2A 5F0WA 2YX1A 2B9EA 3M8RA 3BDPA 1FJ7A 1VC0A 4A8WA 3V1RA 3KLFB 3W5XA 4KGKA 1IKWA 3SMPA 3EJMA 1SC1B 3W1YC 4XPCA 1QQNA 4HTLA 2XEXA 4ZJLA 2XS5A 2BXJA 2LXIA 4BR7A 4IOCL 3I82A 1S72N 2BX6A 1ICEB 2DR6A 3GG4A 5JLHA 3VEZA 1JKHB 1RCHA 2PO4A 4H5TA 4KFBB 4WCEQ 3SPYA 4KHUA 4BRFA 1UVKA 2D3UA 4HTUA 3MHYA 1KS2A 2D9PA 3AA5X 1TK8A 4EIAA 2BANB 4E1NA 1FJGK 3IP0A 3VQQA 3RSEB 1JLCA 2B4PA 2YJFA 3VOVA 1I3AA 3CQYA 3E9PA 3V4IB 4LF8F 4FVMA 3EE3A 1LOTB 3A3PB 2ALYB 2RQMA 4JLHA 4DX5A 5HO4A 4ILGB 3ZO7A 5KRTA 2Z2YB 1J2VA 3MMAA 3AOCA 4K4WA 3NS5A 5DG8A 1X1PA 3B78A 4KI4A 3UB5A 2D1KA 3VQDA 5KG2A 3MFHA 1G3OA 2YWGA 3V9SA 5GVQA 4CFBA 2ASOA 2F7TA 3U9ZA 1BU6O 2RQ4A 3UVJB 3BKTA 4JI3J 2W7AA 1REGX 4QYZK 4JI8F 4CJRA 1F1BB 1Q79A 4NX9A 4FM2A 2DFEA 4KO0B 4FM0A 4UOHA 4LFCJ 1NDKA 1N54B 3B6PA 4CP5A 1F9FA 4C0OC 4C1NI 3GIJA 2HS4A 2PEHA 5K8MA 2GMJA 2YI1A 2P9LB 2CFXA 1NB2A 2XZWA 4ERDA 3MAQA 2AJFE 4Q0BA 3BSCA 1DKGD 4FLYA 2GGPB 3DGVA 3KWGA 2M52A 2FXUA 3IDHA 4OYWA 1U2CA 3UQSA 2ZHOA 1FRLA 2AGPA 2O8EA 2JC0A 1BCMA 4BRIA 2QKKA 3RZAA 2X3GA 3TABA 3C8YA 2WSCC 2HBLA 2EBEA 1LXNA 3KNGA 1K1SA 3MR5A 1FTRA 1RWPB 5ETMA 4NLGA 4KR0B 3HSCA 3P3DA 2DEIA 4CLYA 3GV8B 3O3LA 5F2RA 4P7TA 1X4HA 4CGIA 4FPRA 3GJSB 2PMZD 5HMWA 1Q0NA 4K43A 4LRBA 3CJ2A 3O4NA 5A2QU 1RWVB 4BRGA 2XY5A 1IH7A 1HJRA 2LQJA 3W2WB 1Q9YA 5KFEA 5KG0A 1X4DA 4UUXA 2KHDA 3QFWA 2AEJA 4JNEA 5D4PA 2AGQA 3Q2TC 2B6AB 3HYFA 3DRPA 1YQHA 5C2DA 1GK8A 4DV0J 3HX9A 2E9TA 3MECA 4AQYK 2V8DA 1Y11A 1JXVA 3ENOA 1OSDA 4A48A 3S9HA 3NRBA 1Z6RA 3MR3A 4KHSA 3ZETB 2QV6A 2XCAA 4AM6A 2CNKB 3M30B 5C42A 4RWTA 4DR1J 3KHHA 1Q5YA 3TTFA 4I6WA 3D1HA 5HMZA 4DQ8A 3HD1A 1YK9A 2ASPA 3ALYA 3MEGB 3NAHA 3TZXA 4HHUA 2QEXN 2MQQA 2LCWA 4Z94A 4MK7A 1TQLA 1ATSA 5DM6L 3UPFA 3VGUA 2QMWA 4BR2A 4I6MB 2R7QA 2F9TA 4X62K 1NPRA 4KQZA 1R43A 2UXBF 3NXZA 1A0OB 4B3MJ 4KB7A 2H54B 1XR6A 2KXHA 4O3PA 2CG8A 1PYOB 1OPIA 2F8HA 3A2FA 3BS9A 4RU2A 3LDQA 1MWKA 1T3VA 2E5LF 1X3MA 3CC2N 1FWLA 1QUVA 1VCTA 4PKIA 3ENHA 2IFXA 1K8KB 2BOPA 4BDYA 1VMBA 3VQ4A 1HL6A 3HVRA 2VPWB 3O8MA 2E20A 5J2QA 4DR5F 4BC3A 3ULHA 3NF6A 2KW4A 3AA8A 4WYLA 4IH5A 1FT8A 1MWZA 3K17A 4M5DA 4FP9A 5JUMA 2QK9A 4Y28C 1G2EA 1HNVB 2C3YA 4IQMA 4ZCKA 4ALZA 4FXWA 3BREA 4NYPA 2FZCB 4J37A 5IM0B 1DQAA 1EARA 2VIHA 3D54A 2QLXA 3AY9A 5MLCQ 4FLZA 4OLAA 2ZVSA 2RHKA 4YR0A 4A61A 1ITGA 4JAXA 4P75A 4ZPTR 3TVZA 1VI7A 3O4WA 2RB7A 4UF4A 5GAGU 3H8YA 5HBMA 2Q6CA 3U02A 3FEYB 4NOHA 1PJ5A 1IBKJ 4JI5F 4OZNA 4R0JA 2FYXA 1I1GA 3KK3A 3CJCA 4OL8A 2P9UA 4FM1A 2F40A 2WVFA 3IRWP 1TTHB 2EC0A 4DV4J 1IXKA 4K4ZA 2E2PA 1K73O 4HDHA 4A8XA 1WDDA 1OQ3A 2FVCA 1IR1A 3QJPA 1UA1A 2IDLA 2QA4G 3N4QA 4RW4B 3VF4A 1HYSB 3UKUB 2Q36A 1SJQA 1Y9OA 4WQ5C 1ZZNA 1FRHA 2IS3A 3WHIA 3NOCA 4W5TA 3AXMA 1UW9A 3ZZ0A 1DTTB 3NGUA 3DLRA 1T7PA 5AE1A 1WSGA 3JSBA 2OANA 1VQPS 1PSDA 4J9QA 3BPDA 3PYFA 3EM1A 2BEFA 3LAKA 3M8ZA 4WKYA 2DCLA 4KGMA 1APSA 4BACA 4DL2A 4DWIA 2OCEA 2HHTA 2Q97A 3N28A 1C0GA 3C19A 3SQGA 3UFCX 2CNLB 2DGUA 3PEJA 4FJ7A 4FPAA 3K5MA 1J5OB 3D0GE 2WCXA 2J6UA 3MM8A 1PG5B 4TYBA 1WWHA 1EO1A 3MEDA 3VQ9A 1ZAVA 3OL7A 3KJVB 4QWCA 4MKBA 1RT3B 1BC6A 1KLMB 1KR4A 3D5MA 2V4JA 1T9XA 4QQBA 3MXJA 1ZPWX 4WPAA 1HRHA 3DRRA 1E6VB 1TL7A 4X66K 1LW0B 3L7PA 4HI2A 3C6UA 4YB6A 3ZTOA 2WONB 2V69A 3BR9A 4KPYA 4EO8A 1B9FA 2YNGA 4O3QA 3MFIA 3MOJB 1C0FA 2O8FA 4FVCA 2PEBA 4CM2A 1CJVA 4Y2CA 3AVAA 4CFAA 1JQGA 3HP9A 4ECXA 4OV6A 3BGFA 2O8DA 5JVHQ 4LMZA 3CDAA 4XIUA 2HVZA 4CTAA 2W9CA 2OSQA 5KAKA 1VHIA 4AHCA 3QFPA 2NZ4A 2W1BA 1N36F 2Z0GA 3KIOA 4EP5A 1SIWB 4CRJA 2UUWA 1MU2B 3DWLA 2ILYA 2V50A 4G9ZA 4I68A 4FL9A 1RKIA 2DXFA 3VESA 2ZWPA 3EICA 3Q0AA 1DQ9A 1HWJA 2KTQA 4IUFA 2XI3A 1GX6A 3NCPA 1M5KC 5KG5A 2CGLA 2ZJQQ 5J2PA 2GUIA 3K58A 3OW2R 1NZ8A 2KI2A 2QT7A 3PFOA 2XWYA 1OH6A 1RAIB 2QLWA 3CPEA 3C94A 4LREA 4WZMA 4RR5A 3CJ3A 4J9SA 3GYXB 1U48A 4EO6A 2UXCJ 1I39A 1YAGA 1UWAA 4MJKA 3J7Z5 1RDUA 5CHCB 3AOBA 1NKEA 3BF3A 1LEOA 4IBNA 1TKTB 3J80Y 1JLQB 2GCFA 3IM8A 1T3NA 3OR1B 3OVNA 1S1TB 3C16A 3VAKA 4M5JA 3SAHA 1S9GB 1Y7PA 3Q22A 3DXMA 3FLCO 1V4SA 2ZOMA 3CJKB 1VQLN 2BW2A 3I0RB 5GADP 3G6XA 3G4SS 5KT5A 3AA2A 1EHWA 1N4LA 3F2KA 2BE9B 1D0EA 2XZTB 4WFXA 3PLAA 2BKPA 2CPHA 2W42A 4DV5F 2G4BA 1K8AO 2QL9B 1T6CA 3C3LA 4JOUA 1FXXA 5CZVA 4CF0A 2DD8S 1V4TA 4DU7A 5AZIB 3DI6B 3PRVA 2DPIA 4O4GB 3VA3A 2CH6A 2QTWA 4J9UE 4CLFA 5D4OA 4WYWA 3SPZA 2V5HG 3CD6S 3CGIA 4M3RA 3PJ9A 5AJ3F 2AEFA 3AB2B 1ZBUA 4TLQA 5DJBA 2FJAB 4LF7F 2ATCB 3U4LA 3M6WA 2Z4PA 3MMCA 2Q6BA 1WEZA 4ATNA 1NLKL 3QGHA 2V6AA 3GSIA 5SUHA 1CSJA 2W7OA 3ADAC 3VQTA 1U04A 2MZ1A 3SSSA 2HAIA 2EHGA 4DL5A 4J8FA 4DL7A 4DN9A 2J0XA 2VPXB 3R1HA 4RNNA 4DV1J 3CCSS 3SQ4A 3THXA 1Q4RA 2N3OA 3I33A 1H74A 3Q7BA 4QBUA 1WC3A 3IA0A 5AQHA 2MEWA 1T9VA 4LSLB 3C15B 2YQ0A 4YHHF 4PAAA 4NA1A 4NCBA 1SJRA 1HQEA 2OKQA 3TA2A 4DV6F 5AQZA 2QMUB 2XY6A 1FKOB 2A3ZA 4TU9A 2PC6A 2C1EB 1M1KT 5LM7E 1KLNA 2QLJB 1N32J 4KHPF 2V8VA 4CHYA 1S1VB 1XQIA 1DLOB 1F0XA 1I94F 3IAS9 3OHBA 3NHGA 2NXCA 4IOBA 4OLOA 2UXDF 2ZGYA 2DTUA 5F8HA 3LUYA 3LANA 4OJGA 5KT3A 3U3YA 2I2YA 2EWSA 4JI4J 4KTWA 3E9OA 1RBLA 3NGRA 5C2FA 4NO7A 1RI7A 5AQPA 4DL0C 4M41A 5JMNA 3ZSQA 2D5RA 4AYBD 2FBTA 3G82A 2OA8A 3JQMA 2YWWA 2IJFA 1EWRA 2G2OA 3C6AA 2OYQA 5KT6A 2AP1A 5C2GA 5IV4A 2DFHA 5HRRA 3HSGA 3WEEA 1WAJA 3K0JA 1KAXA 1FJGF 3D7EO 3DLEA 4KE5A 1RWNB 1HKAA 4GC7A 3DRXA 3MDQA 1Q8IA 3R7SB 3Q86A 4CERA 1JLAA 2X6SA 2BJ8A 1KQSR 4CGJA 1WD6A 2ZH5A 3M1FA 1SKWA 2RILA 3N4PA 3D2EB 4JI0K 2K8GA 4FKYA 4C8NA 5FRNA 5CYMB 4JI7J 1S9EA 2CQHA 2Z56B 2NPFA 4RG8A 2EFNA 2C2OB 3BR8A 2HHHJ 2YWEA 3P4IA 3O3GA 4JI1F 1DZ5A 3GZ7A 2W2OP 4ZVGA 2XULA 4FVUA 4DV7J 3FQLA 3QZ7A 1K6YA 5CQGA 3IUCA 4DL3A 2FPHX 5B0DA 3GFZA 1VRTA 4IZ9A 1K47A 1NH8A 3MPVA 4QPTA 5A8KA 4H0OA 1RGVA 3Q83A 2V94A 3A5OC 2VD3A 2CIMA 5EWFA 4F8RA 4BREA 3J7AN 3AHPA 1TUUA 3VCDA 1FRXA 4W5OA 2MB0B 4F0HA 4W5QA 3B6OA 2BQRA 2Z1GA 4WFBQ 1BL3A 4IOAQ 4EU0A 4EGLA 1TL1A 1XNQK 3KNAA 1FW6A 3T5KA 3SLCA 4ZK7M 3PIOQ 2CQGA 2ZC3A 1BIUA 4J91A 4CLSA 3CWJA 3CCJS 1KCFA 2A6AA 3K5NA 3OR2B 3HM8A 4DTNA 1XNRJ 4OZLA 3H45C 4WFNL 3KLFA 3P5JA 3KD5E 5EUHA 4ELTA 1N0VC 4F3OA 1M90O 1XI1A 4MO4A 1N52B 5JXSA 2KDOA 4KFBA 3QO9A 3H2VE 1HBMB 3JAMY 2BANA 5D78A 3CJRA 2GX8A 4EBDA 1F21A 2HFNA 3V4IA 4FZVA 2G8WA 1UFWA 3D45A 1WG5A 1XMBA 4XH5A 2W41A 4A8OA 3F44A 4OI2A 3PRDA 2C3PA 1QZ6A 2DNGA 2XWXA 2UP1A 4W4MA 4LF2A 3HHKA 4H5RA 3LOUA 5IQ6A 2YBVA 1ZBSA 3FDSA 1UZDA 5GIPA 4DTXA 2AJ0A 4QU7A 4CF2A 2OHDA 1KQFB 1QSLA 3A8KA 4AQYF 4Z4HA 4NRTA 4QW8A 3OXFA 1NGBA 3ZX0A 5H1SQ 4PL7A 2GV9A 7FDRA 1XEZA 3G10A 3UVJA 5HVFA 2V34A 1QLNA 3B4MA 4NXNK 1HPMA 2LU1A 2ZDPA 4YY3F 2RU9A 1PCAA 3QICA 4KO0A 3HP6A 2KVIA 3RWUA 3UE5A 1TFWA 3IR6B 3TRGA 2E7XA 4G6VB 2P9LA 1HD0A 4JI3K 4CD1A 1JLFB 2KFYA 2CDRB 1V3ZA 1VQON 2FHKA 4ZP9A 4NXMJ 3BO4A 4I4BA 3HL8A 2GGPA 4LFCK 4X62F 4KKOB 3CIMA 4A5BA 2M70A 4BRCA 4DPXA 5ETKA 2MHNA 1NKCA 2CYYA 1XMQK 4BR9A 2GHPA 1WSJA 1U1QA 2HFOA 1FWPA 1WOSA 5BR8K 1T94A 1TMJA 2GAHC 3C7NB 3DLHA 3D1OA 4M5IA 4RBTA 4DPWA 4CGGA 4B9QA 1C0UB 3LDOA 3L3CA 1Q82T 1T11A 2V2QA 4MO5A 4BQLA 1M1HA 5A2QO 4BC5A 5HJXA 2FGOA 3KHYA 2PBDA 1LV5A 1IKYA 1C2PA 2F3JA 4DLGA 3L0QA 4FYXB 2KFZA 2GMHA 3ENBA 4WF9L 4F02A 2OPSB 1X9MA 3BZCA 3BBBA 1K0TA 4YOVA 2XMTA 2W6LA 1G7CB 4MTPA 3NGIA 2YKPA 4ZLJA 3TWHA 3W2WA 4GKKJ 1NLVA 1F5AA 1XQSC 4YFUA 5AQKA 4ZTJA 2LEAA 2VFRA 2WB4A 4I0WA 4OX8A 2YNFB 1BXNA 2B6AA 4LF9J 1YZ7A 4KAZA 3FZHA 4DR4J 1UFLA 2IA6A 3KLIB 4PUOB 3CCUN 1YHQN 2F63A 4ZJQA 4CJQA 3ZETA 3TZYA 2FDNA 3M2RB 4FWLA 2XHCA 4CLTA 1IJFB 2HMIB 1YJRA 4HTIA 3P49B 2YHYA 4FDFA 3F41A 5EVZA 1X5SA 1ACMB 3D3BJ 5B09A 3HFZB 2UU9F 3QSYB 4CT9A 3SBMA 3MEGA 4KHMA 5KFAA 3VAGA 3L7OA 1D8ZA 1AA1B 3R97A 3CG7A 1N0UA 1YITN 4MH8A 2QZ8A 3ILOA 5LSLA 4DR1K 5B7WA 1W2BM 1H98A 3WX4A 5E33A 1S0MA 4I6MA 4PZVA 4FW2A 1DURA 2FJDB 5EX3A 1RXOB 1OO0B 4MYTA 1U24A 1FFGB 2ZH1A 5DZ7A 3RW6A 1C1CA 1X4FA 3FZMA 1SQEA 2Y1LB 3OVBA 4RLEA 1QDUB 4ECWA 4F50A 3R5AA 2WBNA 4TQSA 4R8UA 2XB2D 3OY9A 2M8DB 4BGBA 4BLGA 4A8KA 1RTZA 1CEZA 3CJTA 3VQCA 2HNDB 2G0JA 4NLWA 1K8KA 1ZPVA 4KBIA 2XYPB 5C25B 2BE2A 1T3OA 3P4UB 1WHWA 2HBYB 3D6FB 4DF8A 3ASMA 4LF6K 4MFBB 1TAQA 3JSMB 4YDUC 4CHZA 3EPIA 2QSWA 3OW2M 1NHUA 4DV3K 1HNVA 3VHQA 2G0CA 2H51B 2IDEA 3BZKA 2L9DA 3ZXWA 1HBUA 2MZRA 4QJVA 1R8CA 1GXTA 1HNZK 1YXQA 2IVNA 2FSNA 4TY8A 4X66F 3KLVA 3SCJE 1JL1A 1HNXJ 4WFAQ 2D3ZA 3C95A 4Y1CA 3C14B 1E6YB 1OS5A 2OAUA 2E6LA 3PW7A 4DPOA 1ROFA 3LZIA 1U4BA 2E1ZA 2NZTA 2QWRA 1RCOB 3FEZA 3A5LC 2M3DA 2JFKA 5DLFA 5DM7Q 1ASUA 3QWUA 3T5LA 3OHRA 3TTCA 2AHOB 2IY5B 1U2RA 2GQCA 4MIWA 4OX9J 2GAGC 1JJCB 1JXBA 5BRHA 3SZ2A 3UCGA 3N5FA 2ZH4A 4CFDA 3CM5A 3QFUA 1VRUB 2VICA 3DLBA 4F3MA 3F73A 1WG4A 3R6GB 3PKMA 3FZLA 5KFZA 3VWSA 4FZYA 2JJ4D 4KTZA 4CZEA 4LQ3A 4UW2A 4RW4A 1HR0J 1XN9A 1IBKK 1RWUA 3B8HA 3UKUA 2G8KA 4TU8A 1R6VA 3SFGA 3GBTA 2BDPA 4CO1A 2LVWA 4NLPA 2XYHB 4O23A 2JEGA 3B82A 3T1HF 5LJ5Y 5C2CA 3KK7A 3J7YI 1QHAA 5KT7A 1FERA 2N4CA 4XDCA 1TL3B 4Q2LA 1WC0A 1RT2B 3CJ8A 4OFZA 1UAXA 2J7WA 2HFSA 3CCES 3I5AA 3DM2B 3VALA 3DMJB 4O5BA 3RBXA 5E26A 1HYZA 2XRIA 1QM9A 4LY7A 4FCYA 1RU1A 2GIQA 3QSIA 3VGTA 3EGNA 2EBGA 4EBEA 1J5OA 4M45A 1HBNB 1FD8A 3AVHA 2R9LA 2HPUA 3DLJA 2ASYA 5KI6A 1F5BA 3MOZA 3H40A 5GAEU 1S49A 3OYKA 3KJVA 4XPEA 4JBCA 2IVYA 2OZMA 4DMNA 1FKPB 2CPZA 4I56A 4F0MA 2H48B 1UVNA 4OLPA 3NBPB 3KOAA 4K5RA 4LFBJ 1UCNA 2RKIB 2FB0A 3ZTRA 1KVKA 4EZ6A 4URGA 2ADCA 3O9QA 1LW0A 3TX0A 2YKMB 2W9AA 1CJKB 1Q81O 2WONA 2HKEA 1B3TA 4PKDB 5CAAA 2I7NA 4EI2A 5AQQA 1G15A 4IOCQ 4W90B 5KPTA 2MDAA 3THVA 2DR8A 4IG0B 4RJVA 1IR0A 4H4KA 3X1LB 2OIHA 3QNNA 1NBWA 3PHEA 2MTLA 5F8IA 1EWQA 1JNRB 4LF4K 1HHSA 4KV8B 4FOEA 1U6ZA 3S3OA 2IRXA 2X1GA 4CO2A 1NJZA 1S7IA 1T05B 1U1PA 4WYBA 3H25A 2VQEF 2PFFB 1MU2A 1VDHA 4OI0A 1FDBA 3TJAA 4K0KJ 3U1NA 1KD1T 2P9IB 3DAWA 1RWWB 2JVRA 4YUDA 2MXYA 2VG6B 3TU5A 3U9DA 1KTQA 2F4FA 4DR6J 5K8NA 1OSCA 1NPPA 1KQSM 4NCAA 4YB5A 2YH0A 1RFQA 3BGRB 1FXRA 4OYBA 1CULB 5F3TA 1KP6A 3N79A 4QIFA 5L46A 4K2XA 3L95X 1B9DA 1GOCA 2FZKB 1UWBB 2M8HA 3KMQA 3NCRA 1O6XA 1VOMA 4I2QA 3KK1B 4ID1A 2CJQA 4FJ5A 4N41A 4TKTA 2I8EA 3RMCA 4Y1DA 4QR1A 3VAMA 1TKTA 3ZYYX 4J9KA 3T19A 2K2PA 1JLQA 3LP3A 4CZJA 4JP8A 5LL6Z 2VBWA 3KWMA 3H20A 2P5VA 1YI2N 3R3LA 2UXCK 4F3TA 1S9GA 5GAGP 3ISNC 3A8IA 4CEZA 4OJ3A 4PWDB 3VA0A 4DUZJ 3KJNB 3NFAA 3BEGB 2HWHA 3POTB 5I3QA 2DNHA 3EL2A 4OYMA 2DGTA 1SH0A 4Y2IA 3V9XA 4AXJA 5J2MB 2QA4N 1N56A 1XTZA 3AB4B 1IBLJ 3NH1A 2O4IA 5KFHA 2AP6A 2D0AA 4UUWA 3EDQB 3A13A 5AZIA 4O4GA 2FSKA 2WW4A 3JAMU 2FHOB 1TUVA 2NRZA 5CA5A 3CDEA 2B9WA 1S72S 3J81j 2IA0A 1KAZA 3QPIA 3G2XA 1GMUA 2HLTA 5A76A 1MROB 4JI0F 3DOMA 4ELVA 5D0GA 4M3UA 1MN9A 5K20B 3W5YA 2ZC4A 2HZAA 3ET6A 2DH9A 3MMBB 4DUYK 5F1XA 3RMAA 3L9ZA 3GWCA 2B4UA 2ZH6A 1C0MA 4RX6A 3AGKA 1KTVA 2QG9B 4IOXA 3CCZA 2BR0A 4QS8A 4HUGA 2MLYA 4Y0WA 2O5DA 4IFYB 4DL4A 2Q0UA 3VMFB 4LSLA 2B8QA 2JNJA 3C15A 3W9IA 2M7SA 3L3UA 2MQOA 2ITMA 1CQNA 1UVMA 4LSNB 4WXOA 4B3TJ 3M2UA 1FKOA 5JICA 3CD0A 2HBRB 4DOZA 2MSTA 1ZC6A 4NLCA 1GLLO 1LFWA 1DLOA 4Q45A 4A8MP 3Q8VA 5HJYA 5DM6Q 4RUHA 2Y1RI 3JS9A 1V6HA 5B0AA 1S7HA 1RDAA 2PY5A 4PXCA 3RU0A 3V81A 4XDDA 3NDKA 4CLKA 2HLUA 3THWB 1VQ5N 2DR9A 1EJ7L 2R7VA 4B8AB 4ANEA 1H2VZ 2BVZA 3OYCA 1EQMA 2KRBA 2W4PA 2OPQB 2V52B 1NGJA 3VQPA 2R2TA 4GC6A 3R8EA 4JI4K 3GFYA 2AX0A 3V6DB 3S01A 1VFJA 4Y2MA 3PX4A 2CQ3A 2A0FB 1NGHA 4ISFA 1LNQA 5DGAA 3O9UA 2ZH2A 4IO1A 4GMKA 3CSKA 3OYIA 4ES2A 2HMPA 5IV3A 2P5GA 4LD0A 1J53A 2CPJA 2VGMA 1A5VA 4C11B 3H5XA 5J2NB 5CYMA 4RZRA 4DS4A 1JXEA 1WOOA 2EVZA 3EMTA 2CQIA 2XY8A 4H0VB 4PQUA 4WIIA 3R5CA 3TX8A 4J5OA 3R1LA 2DIUA 2KKHA 2UV8G 4NXNF 1YJWN 2KQ2A 4N7TA 3G9CA 3ZNJ1 4JI7K 4F2RA 3E66A 5D77A 1SKRA 1JWWA 4W98A 2BJEA 3I56N 1M1KO 3CJBA 2HHHK 3GLJA 2AJQA 1JLBB 3T41A 1XMOK 3KJQB 4A5AA 5JJBA 1HLWA 1KBRA 4HTJA 1AUDA 2H4WB 3TNVA 3SAGA 1TKZB 4JI3F 5T14A 3HPOA 4DV7K 4CJEA 1G6BA 4ED1A 3HJFA 3ENAA 1U1KA 5M2UA 3ZSVA 1K0VA 4K8RA 4LFCF 5BXIA 2F4VF 4E2FB 3MR6A 4UQTA 3PG9A 2Z1HA 4CHQA 3NNAA 1XMQF 2KZMA 3MWPA 3IMQJ 4NCGA 3OR2A 5FDLB 5BR8F 1TL5A 2G0IA 3BDEA 2CPIA 3MI7X 1X9WA 2QEXS 3GR1A 5K14B 1NMNA 3MN5A 3MM6B 4ZMMA 1NO8A 1QSSA 4GRSA 2VG5B 2VQFJ 1RBUA 1VBZA 5BREA 4M7YA 4FS1A 3BSOA 1ZM4A 4HCBA 5ADXA 2HIYA 2VB6A 1S76D 3ULEB 1BLUA 5HANA 3NGDA 4K41A 5ETNA 4CYUB 3AVNA 2UVWA 2L41A 4I2PB 3KVGA 3CJ7A 1M5OC 1WNEA 4ZP7A 3CC2S 1S1XB 4PCQA 4OMFG 2P9GA 3VEXA 4NZ6A 2FHJD 1RB0A 1LW2B 4PPDA 4WQ4C 1NZAA 2AF6A 3QESA 1LK5A 4DMZA 4HUEA 5J1PA 1F6TA 3MR7A 2DRBA 4LR7A 4A47A 4NEYA 4IKFA 3BO2A 3FK4A 2D69A 4UZBA 2XMUA 3GOIA 4CK2A 1S1WB 4OX7A 2V8HA 3MM7B 2O3DA 3CUNA 2RHSB 3MTJA 2HOEA 2FLLA 2M0GB 3E2EA 2W9BB 1MWQA 4XAKA 2W40A 4X65J 3DOKB 1H6KX 1TFYA 2XBPA 3OYAA 1GOAA 2XCPA 4U6PA 1H73A 4OLBA 4B08A 2EFPA 4CO5A 4OYIA 4LF5J 3TARA 1QD1A 3OTOF 2OGUA 4OIXA 2WVEA 5IOLA 1YTYA 1JLFA 4TNOA 4CI0B 1XC9A 3UD3P 4KKOA 4FJ8A 3H1VX 3L2UA 1QTNB 5D3GB 4BRNA 1N5TA 2OPRB 2X74A 4KHRA 1H0HB 1JX4A 3SXLA 1CZ9A 2WSEC 1MA9B 2DGSA 1WKJA 3CJ1A 3C7NA 4LSZB 1SJ1A 1C0UA 1H2TZ 4LRFA 1C0TB 2Z57B 3ZTPA 4NXMK 4AHSA 2RS8A 4C4WA 2NLWA 3WC0A 3IKMA 2OZSA 3D66A 4P7VA 3PZPA 2Y0BB 1E3MA 2D74B 3CD7A 3FEXB 1CZAN 2XMJA 3BKFA 1X4EA 3AAQA 3U1MA 2BJ9A 4IKAA 1K9MO 5BYQA 4MQ3A 1RT7B 3VVTA 4KIAA 4FK4A 1YIJN 3C46A 5JMVA 3T9ZA 4LF6F 4Z4FA 1VSDA 2GEMA 1BWEA 2HVDA 2OPSA 2APOA 2NUUG 3SDEB 2DPNA 1NBEB 2P9EA 4DV3F 1YX2A 4OQJA 3GMGA 4C48A 2ILZA 2PDAA 2AJ1A 4PA1A 4Z4IA 1OWXA 1D1UA 5KG4A 2H4YB 4M5LA 3Q23A 2DH7A 2YNFA 1FD2A 1BA0A 8AT1B 1HNZF 1L3KA 2P9PA 3KLIA 4PUOA 1VQ6N 3Q8PB 5ADXH 1N5YB 2FF3B 2ZOGA 4FLUA 3K9KA 4H4MB 1S5ZA 3M2RA 1NGIA 3C0BA 4NLSA 2HMIA 5GINA 4RW9B 3D6TB 4JN4A 4RCHA 3JB9k 4LF9K 3SQ2A 5AQRA 2HK3A 3NMUA 4ZVFA 4CO4A 4DR4K 1KRPA 1NU4A 3NE6A 5H9FK 1HX1A 1EETB 2RE2A 3D1QA 2OTJN 2B56A 3RB0A 2P9NA 1M5HA 3D4JA 2HRTA 2Z8QA 2HK2A 3OBIA 3DRSA 3QBXA 1FE4A 1YJ7A 3KWIA 2HRYA 5IWAK 1Q7LB 2FTRA 4XH1A 1HHQA 2XC9A 1FK9A 3THPA 1D9AA 2F9WA 1Q82O 1OJ4A 3PUFA 4F4AA 5BRFA 4DR2J 1JJ4A 4LF8J 3ILLA 3ITHB 4RWWA 4CHNA 4FJNA 3DXBA 5C24B 4E0DA 4HH1A 2R7XA 2HNYA 2IIHA 2EFQA 4HH0A 3BN7A 3MCPA 1X5TA 3NG8A 3M8QB 1VLYA 1RA7A 2LQBA 2HNDA 3NNHA 5E3CA 3QNOA 2HBMA 2D7SA 4B9NA 5C25A 3GJTB 3SEOA 3OYEA 4AHTA 3ZSWA 4PRFA 1CZBA 4PG4A 3P6YC 4P52A 4MFBA 2Q66A 3LGHA 3VAHA 3JSMA 5CXTA 1V5IB 3ZFVA 2DGOA 1VS3A 3V9WA 1P6TA 3M8PA 3L2QA 1CG2A 2BRKA 3M1VB 3J7YU 1F2HA 1U0HB 1WOPA 2QLBB 5M2RA 4JI8J 3LL3A 2D0CA 3O5TB 4BWJA 4AL7A 4I9LA 2ERRA 1U1OA 4CZMA 3GIKA 4DR7F 4BDZA 1GTHA 2X3DA 1M1GA 3C14A 1E6YA 4P73A 3QINA 1EB0A 3LALA 1QHTA 2RAQA 2Z30B 1MDUB 3PKYA 1UEUA 4LT6A 3AQOA 1D5AA 1BMQB 2IJNA 3AQPA 5FROA 1BQNB 3FR0A 1S6QB 1NSPA 5M1PA 4HVZA 5J1EB 4LF4F 2UUCK 1WELA 1ZM2A 2YX4A 1VQLS 5F9LA 1VRUA 3DOLA 3EXYA 2X6NA 5LMUK 1LK7A 1ULRA 3DHXA 3TSQA 2ZUAA 4QR2A 3QEWA 1HBOA 2YNHB 4CJ7A 2XLKA 4RL1A 1YBAA 5BJRA 4OJ1A 4OX9K 4UTGA 4J9NA 2P8IA 3QRQA 2DHAA 3M8SA 2B0GA 1QQMA 3TAPA 5KQ8A 2FVQA 3KLHB 2VA2A 4GMJB 4K8ZA 5U47A 3AO1A 1X0FA 3VTHA 4ECSA 1WBBA 2RRNA 3QQCD 1WI6A 4JKGB 2ZH7A 1IBCB 3UCUP 1WN7A 5EWEA 1X5OA 3C6TB 2IM3A 3EZ5A 3MCNA 1HR0K 2CADA 3VENA 1HARA 1OYEA 2VC0A 2AV5A 1TL3A 1CJTB 3GILA 4M3ZA 2RHQB 1QQCA 1RHQB 1HKBA 3DM2A 3DMJA 2ASMA 4LH4A 4KT0C 1T6DA 3PIPL 2FJXA 4DSKA 4JV5K 4KSEB 6FD1A 1GX5A 5L9NA 1PYTA 1XHXA 1RYSA 1HBNA 5FIIA 4CHOA 1S5JA 2WK4A 4BRPA 2HWIA 1CBKA 2PE8A 4Q7AA 3M6GA 3CCLN 1ZAWA 2D0OA 4E98A 5KFXA 2YXLA 3M32B 1FKPA 1F3FA 2V63A 1WDTA 2VJVA 3NBPA 2ZZMA 4IG3B 2MPUA 5T7LB 1KNZA 2IAJB 4B8CA 5AQYA 3OYLA 2DNZA 5C7PA 3HTVA 3CM6A 3MM9B 2YNIB 3I55N 2YKMA 4WFNQ 3M8YA 1U1RA 2AD9A 3CIPA 2F1FA 2PSZA 4CH7A 4IFEA 5LY3A 4C3LA 1YGYA 4NLOA 4IG0A 2UXBJ 1IN0A 1WSRA 4BHQA 2HVHA 3HKWA 4M5MA 3SYZA 3UDVA 1WI8A 5AXKA 2VONA 1QTMA 2CQ0A 3DU5A 4HACB 4KV8A 2D0PA 3VF2A 2E5LJ 4DQIA 4M5NA 3JYTB 3IXQA 4A8QA 4K59A 1T05A 3I4HX 4DV2F 2CQDA 1NGAA 3ATUA 1YJNN 5AE2A 2P9IA 2MJUA 1Q7YO 4FJKA 3ULDA 2VG6A 4DR5J 4G1PA 4FOIA 3AD7C 1JB0C 4DUYF 3SBGA 4IEEA 3WNFA 4XH4A 4WCEL 3AXKA 4L74A 4CJ5A 1M5PC 2KJVA 3CFOA 3BGRA 3N9UC 2I5JB 4JKFA 3OTCA 1CULA 1WF1A 2HBJA 2FVRA 2KM8C 1NCLA 4P72A 2ZE2A 1RCXB 2A1BA 4CO0A 2PFUA 5AQMA 4TN2A 3O1BA 4BE2A 2KXFA 4FN5A 4DR6K 1KWMA 4XEIA 1HW9A 4ZPAA 4CZLA 3G0ZA 2CAJA 4YMEA 3IM9A 5KFDA 3KK1A 4AM7A 2Q43A 1S0OA 4R79A 2W24A 2IYIA 2A3JA 2WOMB 2KT5A 3M6XA 5M1NA 3W66A 1TK5A 3KK2A 1UP1A 2G8VA 2DGQA 2IM1A 3AJ1A 5ITHA 2XZDB 5A8WB 3G8QA 4A8FA 3Q89A 4LRCA 4OHVA 2P9SB 5GMKa 2YVSA 3BV8A 4F4WA 4KGXB 1YLXA 5G4DA 4ZLPA 3RRHA 4JV0A 1I3OB 4JI5J 3VQ7A 3OTEA 3C66A 2DTJA 2WRMA 2VASA 1NNDA 3O8WA 4PWDA 3DYAB 4H4OB 3EO3A 2RH3A 4M63C 2VPYB 1VQ8N 2NS1B 3D28A 1U2VB 2JEFA 2O4GA 3POTA 2LQ8A 5LSOA 1S1UA 3JAMO 2CVIA 2HYIB 1EKSA 4JI4F 3DDKA 4K4SA 3W0LA 4M3TA 3QGPA 4DUZK 4CW7B 3DLLQ 4CJPA 4CEDA 3ZTQA 3FKBA 2VDIA 4FJJA 1V5VA 4ZS6A 4LR9A 4FXVA 1KD1O 4AL6A 1R8BA 2J0QD 4F0KA 1MROA 1NK4A 3PNIA 1GNKA 4ZP8A 4Y65A 3MMBA 4DUTA 2VF3A 3L3VA 1VC6A 4IRDA 1VSJA 3CO0P 4E1MA 2OSRA 2JVOA 1IM6A 1HHTP 2GVZB 3D0HE 3OVSA 2BRLA 1IV0A 1GQEA 2HZVA 5IC4B 1EKEA 1IBMK 1Z2ZA 1KVCA 2EEYA 4JI7F 3JQKA 2HB5A 2ZHAA 1VQNN 2IMWP 2AGOA 4NZ7A 3DN9A 4WK1A 5HN0A 1KQGB 2HHHF 1XMOF 1QAXA 2BGGA 5EOYA 3NWRA 1NEEA 4LSNA 3HZEA 1RAJA 3CCQN 4DR3F 4IRKA 1OY8A 4BBYA 1MW7A 1XR7A 1B7YB 1ZBTA 2AA4A 1AROP 1OY6A 2RPIA 1QAIA 1WHYA 4JKDA 1UJ5A 1BI4A 4F3QA 4CEOA 2IGIA 1WAFA 9RUBA 2DIVA 4B3TK 1IQZA 4PXEA 1ZBHA 1M90T 3T1YK 3THWA 4M8LA 1HMVB 3KLGB 3FUYA 4RBVA 1N36J 5CYQB 1QVGR 3HK2A 2B51A 4CEQA 3N6NA 1NK5A 1VQOS 4OJHA 3QZ8A 3UN5A 2JHEA 4B9UA 4ZVUB 2DH8A 3QJLA 3ILIA 3BQ1A 2VFSA 2JC1A 4O44B 3V6DA 1D4XA 1OH7A 1IKVB 2AIRB 3D0IE 4CH0S 4FS2A 4H0PA 4M5HA 3AJ2A 2AEMA 3MAHA 3RB3A 2BOAA 5AQOA 2RS2A 3I6PA 2LA4A 3JTPA 1O51A 4OZ2A 5K8PA 3EZUA 4X4SA 1UVJA 1KFSA 4XK8C 1EIYB 4CJLA 4IH7A 2VKZG 1RT6A 1PAEX 5E41A 1XHZA 4U9RA 2E1RA 4DQQA 2LDIA 1WHXA 5IZHA 3QEXA 4C11A 5I3UB 3AVKA 4BR0A 2DR5A 3DLGB 4ED4A 1FVQA 3MN6A 3KKFA 1IM4A 5HROB 3TQEA 2O8CB 5BN8A 4IO9L 2VDHA 3H90A 5L8RC 2CKWA 4FJMA 1PGZA 1TVRB 4OJRA 1QSYA 4CZHA 2WVBA 4R5PA 1SV5B 4H0XB 4ZVSB 5L39A 5KFYA 1NSKL 2NRWA 2GO9A 2B3TB 4D3GA 3J7ZT 2JLFA 4A8YA 3KKRA 3V1OA 4QS9A 5MAOA