1S6PA

Crystal structure of human immunodeficiency virus type 1 reverse transcriptase (rt) in complex with janssen-r100943
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
552
structure length
552
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein [Contains: Reverse transcriptase]
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 124
structure length 552
sequence length 552
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s6pA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s6pA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1s6pA05
1JLCB 2YNIA 3SFGA 4KHUA 1S9GB 3AVFA 3BQ0A 2WONA 5C24A 3NAIA 2AGPA 4FW2A 4DQPA 3BSOA 1VSDA 4GC7A 1TAQA 3DRRB 3TAMA 3QIOA 1SUQB 3TVKA 1GX5A 1S5JA 1C0UB 4M41A 1REVB 3M8SA 4DTPA 3HM9A 4WE1A 3Q8SB 1RILA 3L2RA 2B6AB 2OPPA 2EX3A 4ELVA 4O3QA 3PR4A 2AU0A 3DRSB 1JIHA 2XO7A 2FJWA 1RTIB 3O3HA 2BANA 5HRNA 1TKXB 4RZRA 2GBZA 3CDWA 3MTKA 1TVRB 5F8IA 3ZT0A 4TLRA 1UWBB 3HVWA 3SV4A 5KFCA 2J6TA 3UR0A 1BI4A 3HHKA 1U48A 4ZHRB 4DL6A 4FJ8A 2GIQA 3PX0A 4IG0B 2ZKUA 3U3GA 1FK9B 2O5DA 3HPHA 3OL8A 1BQMB 3U3YA 1QS4A 4KAIA 3DM2B 1IKWA 4ELTA 3AA4A 3NDKA 1GOCA 3HK2A 2Z1IA 3KLFB 1HYSB 4IH5A 4ZVFA 5KFYA 3DMJA 1S1TB 4E89A 2RKIB 3KK1A 3CDEA 4Y2AA 2E9ZA 4FLXA 4DTOA 3CQ8A 1RYRA 4DSFA 1KLNA 3I5AA 1VRUA 4C8MA 5FDLA 3V6KA 1R0AB 2ATLA 5HRPA 4NLGA 3RB4A 4FZYA 1MU2B 4EP4A 1N56A 4Q8FA 3DLHA 2IJFA 2W9CB 3ZSVA 2BE2B 4CEBA 4LH5A 1N6QB 2LSNA 1NOZA 1JL2A 3MR6A 4O44B 4FJ9A 5KG7A 2B4JA 5F9NA 1SV5A 3KJVA 1JXEA 4Q45A 3SUNA 3OHAA 1FKPB 3V9SA 1EX4A 3S9HA 4NLUA 1S6PB 4HCCA 3HP9A 4OGEA 3OL9A 4M95A 5CZ1A 3HO1A 3NGZA 2BGGA 4UQGA 5KG4A 3V81B 1QQCA 4AHRA 3H5YA 2OZMA 4JS5A 4FJMA 2IM0A 5T14A 4M3WA 3P1GA 1F21A 2FVRA 4CE9A 4FCYA 1O1WA 2HHWA 2X78A 2B43A 2B5JA 3OSNA 5F8LA 4J9QA 3SI6A 2BRKA 2DPJA 1S0MA 1N48A 4FJIA 1XR6A 2ZD1A 3JSMB 3CFOA 1JLCA 4FVMA 2VG7B 4CFAA 4K4VA 1RT6B 3L2QA 3DYAB 4KB1A 2IOCA 4ZTJA 4IG3A 3RWUA 5KFGA 5FROA 4N47A 5KI6A 3QZ8A 3KOAA 4KV8A 1S1WB 1HYZA 1LW2B 3DOLB 1RDDA 4PQUA 1SUQA 4FBUA 5DLFA 4QCLA 4EO6A 1JXBA 3BGRB 1REVA 2BQ3A 3T5HA 3HVTB 1XWLA 2B6AA 4W5OA 3QINA 4DFJA 3CJ4A 3KD5E 3CIZA 3CJ3A 1QTMA 2W8KA 4QWBA 4AHCA 3VQEA 3OVNA 2E9TA 1TVRA 5KFAA 1UWBA 3K2PA 2V9WA 3M8PA 5KFHA 2P5OA 4ICLB 2G8VA 3NH2A 3BQ2A 5DLGA 2BR0A 3HPGA 3SQ0A 4FLTA 1A5WA 4M94A 1BL3A 4ZHRA 2YHBA 4PUOB 1N4LA 3LPUA 1RNHA 2V4QA 4IG0A 2RF2B 4CJLA 2JLEA 4KB0A 4JRPA 1BQMA 2ILZA 1GOBA 4JLHA 2AGQA 4K4ZA 1S1UA 4EYIB 2FJVA 3DM2A 4QPXA 2IM1A 1XHZA 1JXLA 4JV1A 5KT4A 3KLFA 3H40A 4IKFA 1W9HA 3OYBA 5J2MB 2RKIA 4CK3A 2HHVA 3QNOA 4RW7B 4F4KA 3OYKA 4H8KA 3G10A 1EP4B 4DTSA 3HSTB 2HNDA 4TY8B 1IKVB 4RW4A 3LP0B 1JLEB 1BQNA 3ICLA 3DRPA 3RMBA 3HYFA 2UVWA 4O4GB 2G8FA 4O44A 4CGHA 4DQRA 2VG5B 2UUTA 2XI3A 3VQ8A 1B92A 4IFYB 3NH1A 1FKPA 1C1BB 2EC0A 4PY5A 1S6PA 1SH3A 4XIUA 4B8AB 4RNOA 1SKSA 1CXQA 3MR2A 3RBDA 3OYJA 5SWMA 3V81A 4WFYA 2OPSB 3NAHA 3RB0A 2HW3A 1TKTB 4IFVB 1D1UA 2XCAA 4QWAA 1RBRA 1XR7A 1BIUA 3L3VA 3LAMA 2XCPA 2D5RA 2FLLA 3K5NA 4NYFA 1VRTA 3SUQA 2R8KA 3SYZA 4NCGB 4NCBA 2ZQBA 3JSMA 3IRXA 1C2PA 5C42B 4OKEA 1X9SA 4KHQA 4KTQA 3DYAA 4DL5A 1EXQA 4B9SA 4K8ZA 3RMCA 2D0CA 2WB4A 1LWCA 2RPIA 3L2WA 2IGIA 4GC6A 1U4BA 1NK7A 4KO0A 5D3GB 1ZETA 3DOLA 4I9LA 3SQ4A 3B6OA 5I42B 2D3ZA 3BGRA 3NAEA 2YKNB 2XHBA 4DSKA 5CY4A 2AGOA 2ASJA 1FXXA 1Z26A 4NYZA 4NLSA 1JLQB 4IH7A 3HVTA 2HVIA 4Y1CA 4RW8B 1CZBA 4RG8A 3MEGB 4J2AA 3RAQA 3PX6A 1NKBA 2OPQB 3TQ1A 3AVIA 1RTHB 1BISA 4CGJA 4NZ0A 1ZYQA 2GUIA 4ICLA 3PZPA 3QZ7A 2W42A 1JLBB 3V1QA 5DQHA 4CJRA 5I3UA 4PWDA 1YTAA 2P1JA 2JGUA 1XI1A 4CFCA 4XPCA 4BDPA 2QK9A 3GV8B 4LD0A 4CHQA 4FK4A 1RT5A 1S4FA 4JV0A 3MEDB 3ZSXA 3MF5A 1ITGA 3TR8A 3JYTB 3DOKA 3KLHB 4DSJA 3GILA 4I7FB 5J2MA 4BE0A 4RW7A 1S10A 5KG5A 4KHNA 4O3RA 4DLGA 1RT2A 2HNYB 3ISNC 4E7JA 4CGDA 3VQDA 4DMNA 4HUFA 4IDKA 3PHEA 4EYHB 4I2QB 1S9EB 2F96A 3NGYA 3HVAA 2YNIB 3VQ9A 2R2SA 3LP0A 5HRRA 1TV6A 4HVJA 3VQBA 1NNDA 2WONB 5C24B 5KG6A 3A2FA 4TSXA 4BWMA 1KHWA 3HP6A 4KE5A 3TAMB 3QLHB 3OYLA 1GOAA 3PO4A 4IFYA 3BDPA 1LV5A 2PY5A 3QO9A 3PW4A 4Z4HA 1OS5A 4ECTA 3AO5A 4WE1B 3MXJA 2FC0A 3SQ2A 2OPSA 3CM5A 2OPPB 1NOYA 3V1RA 5J2QA 2WRMA 2Y1JA 3NF8A 3RMAA 4MH8A 2BANB 3D5MA 4DLEA 4CFBA 4J9KA 2X6NA 4CF0A 3O3GA 3SPZA 2IJNA 4CHNA 4DFPA 5KG3A 5C42A 1TL1B 3P5JA 4R8UB 4J2DA 1WAJA 1BI4B 4MFBB 4MKAA 1XR5A 4F50A 1D5AA 3AVNA 4BDZA 3AVHA 1NJZA 3BR9A 4CEDA 4QAGA 1IKYA 3UDLA 3UIQA 5D3GA 4HHTA 1U47A 4CCHA 5I42A 4FZZA 3N6MA 3LDSA 2XWYA 4KTWA 3DMJB 4MIBA 1JLQA 1HMVB 4DS5A 4N56A 3ISND 2YNGB 4CHYA 1Z25A 1KFSA 3WNEA 2OPQA 1RTHA 4K4SA 3VN5A 3TAEA 1VRUB 2P5GA 4NCAA 2X6SA 3NE6A 2AX0A 5KFEA 1ZBUA 4ECZA 4MKBA 1LW0B 4BDYA 4K4WA 3AVCA 5HLFB 1HQEB 1KHVA 3KD1E 1HPZB 2YKMA 5L1JA 3KJVB 3KLIB 4NYNA 1Q9YA 4YNQA 3QEIA 4NLWA 3QIPA 4K4YA 4XO0A 3KLHA 4ECYA 3SFUA 3HT3A 5J2PA 4FS1A 1NK5A 3T5JA 4HCBA 4CGGA 5DQIA 5DK5A 4NLOA 2ILYA 4ZPBA 4ED8A 1K6YA 5EUHA 2G8WA 3RB6A 1KFDA 4J9OA 3TANA 2ZD1B 5KFVA 5C25B 3KHRA 5J2NB 4ED0A 4E7IA 1NKEA 4IG3B 4CF8A 3CM6A 4TY9A 3VQSA 1UA0A 4QWEA 5DGBA 4KV8B 1WSHA 4FK2A 3QLHA 3G86A 3Q8QB 4PQUB 3SJJA 4RU9A 1WNSA 4F8RA 5EWEA 2UUWA 3HVRA 4FM0A 3AVAA 3MFHA 3I5BA 4ZMMA 5T7BA 1C1AA 4C8NA 1UAXA 2VG6A 4FJLA 4Z0UA 3ITHB 4ED3A 4QWDA 1U09A 4FJXA 3ASMA 3OYGA 1TL1A 3M8PB 1HRHA 4R8UA 5CYMB 5KFWA 4MFBA 2ZE2B 1NJXA 3MEEB 4FLYA 4DFKA 3KNAA 5KFQA 3EZUA 4MQ3A 3OHBA 2JEJA 1CSJA 3KMQA 1J9AA 1S1UB 4B9NA 4K8XA 3LPTA 4FLWA 3IN5A 4F4XA 4J2EA 4ZVEA 3HPOA 1RBSA 4CJEA 3DDKA 2Z1GA 3GV7B 1QAJA 2OA8A 1LAWA 1HMVA 3T5LA 3AO3A 2YNGA 4ZPAA 4IRKA 1N5YA 2HNDB 3ZSYA 3OLBA 4KSEB 3UPFA 4RW4B 3N6NA 1RBTA 1RBVA 1BQNB 4KB7A 5L1KA 3DRPB 4CJ4A 5KFMA 3BQ1A 2KFZA 3WNFA 1LW0A 5HLFA 1NHUA 1LWFB 3CDUA 1HQEA 1HPZA 3EPIA 3KLIA 2DFEA 1ZBFA 4F4WA 4KAZA 3PY8A 4FLZA 3OYCA 4RUAA 3BSCA 3OS0A 4EO8A 1WSFA 3CJ5A 4DQSA 4EBDA 4IQXA 3THVA 2ASDA 2GIRA 1VRTB 5DMRA 3QGHA 5C25A 1S49A 3IRXB 2C28A 1HQUB 2AX1A 1RT1A 5J2NA 4W5RA 2HVHA 3AVLA 1TK8A 2Y1IA 1WSJA 1XC9A 3AVBA 1LWCB 1QHTA 3IG1A 4M45A 3OSPA 3CG7A 4KO0B 2BRLA 3LP1B 4ECVA 3OYEA 1YVFA 4K4XA 1HARA 2I1RA 2FVQA 4IR9A 3GIJA 4E7HA 1RDBA 4AHVA 5CZ2A 3K58A 1BGXT 3F73A 3ITHA 2G8UA 4EBEA 4DWIA 4KHYA 1ZBIA 5JS2A 4M42A 2W7PA 4CEOA 4DTMA 5KGWA 2HAIA 4H4MB 5KGXA 4W5TA 4FJHA 5CYMA 2FLNA 4FK0A 5I3UB 4PWDB 2IM2A 3ZSQA 2GC8A 5KTQA 2ZE2A 4DTXA 4CF1A 3MEEA 3IGNA 1U04A 4AHTA 4H4OA 4CHOA 4BWJA 3ZT2A 3D0PA 3KHGA 1EKEA 3L8BA 1RT5B 4Q0BA 3V1OA 3CO9A 4WFZA 4O4RA 2IAJA 3B6PA 3CYMA 4URSA 3DOKB 5KFOA 2IC3A 5KFFA 3ZSOA 3V6DB 4FJJA 1RT2B 3H2LA 4OKKA 3TI0A 3CFRA 4IDKB 3EYZA 3G6YA 4DF4A 3OS1A 2D0BA 4C8KA 3LWLA 1WSIA 2FLPA 2R2TA 4I2PA 4OPJA 1U45A 4OJRA 2XRIA 4Y2CA 1TV6B 1Q9XA 4IRCA 3AO4A 1RT7B 4FM1A 5KFDA 1J53A 1LWFA 4Q8EA 4DSEA 4E7KA 2YNFA 2KZZA 2ATQA 3AO1A 2OPRA 3I0SA 4C8OA 3KKSA 2IM3A 2CKWA 1DLOA 3QO9B 3PJWA 4E19A 3KHHA 1EETB 3SV3A 3ZT3A 3OYDA 3NMAA 4YMEA 1HNVA 2HHSA 4Y34A 4MK8A 4ZP7A 2JC0A 5J2QB 3NF6A 2DFHA 3L2UA 3SNNA 3SPYA 1B9FA 1KCFA 4U6PA 3BREA 1HQUA 4KFBA 1S0OA 2E9RX 1VK0A 4E1NA 5CYQA 4EBCA 4N76A 4JRQA 1KRPA 4NLPA 2JEGA 4F2SA 1C6VA 3PX4A 3LANA 3AA3A 1RDAA 5JXSA 3VA0A 1IKYB 4DL4A 3LP1A 4CEQA 4OLAA 2WHOA 2W9BB 2AWZA 2HHQA 5FRNA 3I0RA 3O3FA 3K57A 3QGIA 3G0ZA 4KPYA 2HHXA 4DFMA 1SH0A 1BHLA 3GV5B 3NGIA 1RCHA 3H98A 3RRGA 2KFNA 1S1VA 4AHSA 3V4IA 2GV9A 4H4MA 4HYKA 3OYMA 1U49A 3DLKA 4F4YA 1DTTB 3FDSA 2DPIA 1DTQB 4OKJA 2QKKA 3OJUA 1KVCA 3T19A 2RN2A 3DLBA 3RR8A 5K14A 4OLBA 1TK5A 2YKMB 1RTDA 4ECRA 1B9DA 4E0DA 3OY9A 4RUCA 1J5OA 1JX4A 1NK9A 3PVXA 3QIPB 4OGCA 3ZSRA 3V9UA 2AJQA 4URQU 4Q43A 2XGPA 1S6QA 5J2PB 4YQWA 1T7PA 3V6DA 4RNNA 3SUOA 1K1QA 2ITGA 4ECSA 5KRTA 3E01A 5KT3A 5SZTA 1T3NA 3TAFA 2BQUA 3FFIA 4RNMA 4DU1A 1QAIA 3CJ0A 3LWMA 4TN2A 3SUPA 2OYQA 1JLFB 4E3SA 1RT7A 3AV9A 4DTRA 4FS2A 2ETJA 4KHRA 3KLEB 2PYLA 4DQIA 3OLAA 4YR2A 4J9LA 1RA7A 4CF2A 1TKDA 3H4BA 4J9PA 4KI4A 4IOBA 3KHLA 4QW8A 3MFIA 3K5OA 4HKQA 5KFTA 1KVBA 1EETA 1RDRA 3DI6B 4U7CA 2A1RA 4DG1A 2C2DA 2VG6B 1GX6A 4J2BA 2P51A 3PV8A 4G3IA 2A1SA 1HJRA 3PW2A 4DL7A 3DLRA 4NLVA 4CIEA 2WK4A 4FJ7A 2PZSA 4O3OA 4KHMA 2ALZA 4DU3A 4NLYA 1C1CA 4O0JA 4PA1A 2R8IA 1RT4B 4NRTA 3RBEA 1SKRA 5J1EB 3G6XA 2C2RA 3KIOA 3MR3A 1TGOA 3V6JA 4WFXA 2IA6A 3RAXA 5EWFA 3QEPA 1IG9A 2G8HA 4KBIA 5F8MA 2ASLA 4MK9A 2W9BA 5KFZA 1KVAA 4LQ3A 2D7SA 1ZTTA 4LSLB 1ASUA 4Y1DA 5L9XA 3F9KA 4DSLA 1TAUA 3OL7A 4FZXC 3NFAA 4DS4A 5F8JA 3GIMA 5KFXA 5KFIA 5HP1B 2NUBA 1L3UA 3PO5A 3NGDA 4HUGA 1N5YB 3PW7A 4NLXA 3DLEA 4TQSA 5JS1A 3UQSA 1DTTA 3EPGA 3VQQA 3V9WA 4W5QA 4BACA 2HHUA 3NHGA 1DTQA 2DFFA 1MMLA 5EDWA 3NL0A 4CERA 4K4UA 3QIDA 4ID5B 4O3PA 3OYNA 1A5VA 4BE1A 4KKOA 3OYFA 4J9MA 2D3UA 4FYDA 3OYAA 5F8GA 4EP5A 4RW6B 1L3TA 2E6LA 2BDPA 1YT3A 4NRUA 4CK1A 1SL0A 3OYIA 3H5SA 2WTFA 2FBXA 4KTZA 2HMIA 3I5CA 4Z4GA 4ZTFA 4Z4FA 4FLVA 3NCIA 4O55A 3DLGB 1RT1B 4FXDA 5DG8A 3CFPA 3CWJA 1D8YA 4WYLA 1JLFA 4F2RA 5KFKA 1C0TA 3IG1B 3QETA 1HNIA 3KLEA 4DL3A 1IKXB 1WN7A 4IBNA 4OVLA 2UVVA 3MXIA 2R2UA 4B3OB 4MK7A 4JUZA 4H54A 1S1XB 4CGIA 4B08A 1ASWA 3DI6A 1ZBLA 4CJTA 4FJKA 1QSLA 4ZPDA 2HB5A 4ELUA 3MXMA 4ED1A 3RTVA 4HUEA 4GW6A 1IO2A 3ULDA 1SL1A 4Q44A 5L1IA 1S9FA 5KG1A 1X9MA 3FQKA 2V4RA 2EHGA 5DG9A 2J6UA 3LZJA 1RT4A 2JC1A 3IAYA 3H08A 1NK8A 5J1EA 1LWEB 4H4OB 4Z4IA 4CGFA 2G8KA 2R7YA 4FLUA 3SCXA 1TKZA 1TP7A 4Q0BB 3TARA 4X2BA 4L8RB 4RW9A 4LSLA 1L5UA 3C95A 4TYBA 2IAJB 3P83D 3NF9A 2O4IA 2FVCA 3KK2A 1TL3B 2IC3B 3GQCA 2D0AA 2W9AA 3LALA 4B8CA 4KREA 1FKOB 3SQ1A 3T5KA 5HP1A 4O3SA 2FBVA 4B9UA 4Y3CA 4CEEA 3IS9A 4CHPA 1KTQA 1SKWA 5KG2A 1QE1B 2IMWP 4I2PB 4KHWA 4FJ5A 3IGVA 3QEVA 5KG0A 4NLRA 1RTJA 3KLGB 2XY6A 4IRDA 4JS4A 3GYNA 1CZ9A 2YNFB 4C8LA 4FJNA 4R5PB 3MECB 4M3ZA 4ID5A 4ECQA 3EZ5A 3OS2A 4CJKA 2OPRB 3I0SB 1RDCA 3M9MB 1NHVA 5FRMA 4B9TA 1VSEA 4B9MA 4WZMA 4Q5VA 1DLOB 5KFJA 4RW6A 2KTQA 4QOZB 5KFBA 2YV0X 3H59A 3CVKA 3KTQA 2FVSA 1BIZA 1WAFA 1HNVB 4CJPA 3KK3B 3KLVA 4ZP9A 1RT3A 1A5XA 1KSPA 4B9VA 4I9QA 1RBUA 1YVUA 3DLGA 2CJQA 3VQ5A 2FBTA 4KFBB 4KI6A 2I5JA 5CYQB 4ECUA 1C0MA 4IR1A 5KFNA 4ECXA 5KFSA 3QNNA 3QGGA 4F3TA 1SH2A 1IKXA 4GVMA 3BSAA 2VA2A 2VA3A 2W7OA 4ED2A 1JLAA 3O4QA 1ZBHA 2R8HA 5F9LA 2WOMA 1L3SA 3I0RB 3RMDA 5KT5A 4R0EA 1X9WA 4B3OA 4GMJB 3TABA 1S9GA 1S1XA 1NK4A 4CJWA 2X74A 5KFRA 4LSNB 3KKRA 3ZT4A 5L1LA 2BQRA 1RAJA 3DRRA 2UVRA 3FSIA 1S1VB 3TAPA 1C0UA 3V4IB 3S3MA 1S48A 3DLKB 1D9FA 4M3RA 4WXWA 2V0NA 4TYAA 3DRSA 2YHAA 1LWEA 3H5XA 1RTIA 2HNZB 4IKAA 4CJUA 1HYVA 2QE5A 1CLQA 4O5BA 1TKXA 2Z1JA 3C6UB 1G15A 5K14B 4TXSA 4E1MA 1JKHB 1T05B 4DTUA 4OL8A 3HKWA 1RTDB 3FQLA 3TAQA 2R2RA 2FBYA 1J5OB 1VSIA 3RRHA 3BJYA 3VQ4A 2PYJA 3ALYA 1JL1A 1WSGA 1VSHA 1TL3A 1T03B 1UOCA 4ZP6A 1YTUA 4KRFA 2HHTA 1FK9A 1FKOA 1KLMB 3TWHA 4DTJA 3PW5A 4B9LA 4DTNA 4J9SA 3E01B 4EZ6A 4CIFA 3FFIB 1HYSA 3PR5B 4CJVA 1QE1A 4F3OA 4CECA 2F8EX 3NKYA 3AVKA 1S1TA 5DQGA 3T1AA 4WXOA 3KLGA 3AA2A 1NK0A 2R8GA 2YNHB 1D0EA 1VSLA 3I8DA 1NJYA 4CJFA 1QUVA 4R5PA 3MECA 4AH9A 1R0AA 4DQQA 2XY5A 1MU2A 4F4ZA 4IH6A 2IBKA 1QSSA 4CJSA 2IDOA 2W9CA 2BE2A 4CEFA 1N6QA 4DG1B 2OH2A 3NH0A 1JLGB 2OZSA 5KT7A 3KK3A 1BCMA 3NBPB 3L3UA 3H5UA 2QV6A 2E6MA 4LH4A 5EU7A 3ZSWA 4YR0A 2RDIA 1VSJA 4URGA 4CK2A 5F8HA 1C1CB 1VSFA 5KFPA 2KQ2A 2R8JA 4G1QB 3T3FA 1W0HA 4EZ9A 5EWGA 2JEIA 4N41A 3K59A 1NKCA 3V9XA 2VG7A 1Q8IA 1RT6A 3C6TB 1NK6A 4FJGA 1T94A 1NJWA 4LSNA 4CJ5A 2JEFA 4LY7A 3M8RA 1K1SA 3QYYA 1VSMA 3PUFA 2DTUA 2XI2A 1S1WA 3QEWA 1LW2A 2C22A 4MIAA 3VQCA 2XY7A 2AQ4A 3DLEB 5HBMB 2Q3SA 3LZIA 4WYWA 4ZVHA 3NF7A 5HROB 4W5NA 4J9NA 2E4LA 2HNZA 4CFDA 4E7LA 3C6UA 4YFUA 4M3XA 4XPEA 1JKHA 1T05A 4RNFA 3LP2B 4DF8A 3M8QB 5HRSA 4ID1A 1ZTWA 4ED6A 1D9DA 4KHSA 4KKOB 3C94A 1TK0A 3ZT1A 2HWIA 4PUOA 2UVUA 5E41A 3WNHA 3QERA 3EY1A 1T03A 2RF2A 3MAQA 1S0NA 1KLMA 2C2EA 1UA1A 1TQLA 2HMIB 3HL8A 1X1PA 5KFUA 3Q8RB 4J9RA 5KRSA 4CJQA 4TQRA 4LQ9A 3GIKA 5KFLA 4CEAA 2VWJA 3CJ2A 4O3NA 1ASVA 1C0TB 2YNHA 4YP3A 3S3NA 1HNIB 2KZMA 1EP4A 3ZSZA 3MR5A 3S3OA 3SI8A 1S6QB 4TY8A 3QESA 4ZP8A 3Q8PB 1IKVA 1T8EA 1JLEA 4Z4CA 4CESA 4QWCA 1BCOA 3L2VA 5C5JA 3D45A 4O4GA 4BE2A 3LP3A 3OYHA 2FVPA 1WNEA 1JLGA 3M9OB 3AO2A 3V9ZA 3AVJA 4M3YA 4AHUA 2VG5A 3VQAA 3K5MA 3NBPA 4ZPCA 2RDJA 1C1BA 2G8IA 3M9NB 3TAGA 4WZQA 1I3AA 3O4NA 4M3TA 4YR3A 3RB3A 1LAVA 3WNGA 2F8TA 3SZ2A 1L3VA 2J6SA 4G1QA 3ZCMA 1TKTA 4IFVA 4ECWA 2VWKA 5F8NA 3PJXA 2DY4A 4NLDA 2F8SA 2QXFA 1SL2A 3VQPA 4NCGA 3VQ7A 2FJXA 1TKZB 3OL6A 3VQ6A 3V6HA 5KT6A 3C6TA 4RW9B 3BSNA 4O0IA 1XHXA 3GIIA 1Y97A 3KK2B 4CF9A 3VA3A 4DEZA 3G6VA 4K4TA 1VSKA 2O4GA 1I39A 4DL2A 1IKWB 3IS9B 1W25A 4FM2A 1WSEA 2YKNA 4CJ3A 4Z4EA 1RA6A 5JUMA 2XY8A 4AILC 5DG7A 5HBMA 4CHZA 1IH7A 1RYSA 2W8LA 4K50A 3AA5X 5HROA 1QSYA 4RW8A 1RTJB 3KK1B 4RNHA 3MEGA 4JV2A 4DU4A 4DSIA 4I2QA 3HXMA 3D28A 4FW1A 1J54A 3LAKA 4CEZA 3LP2A 5FDLB 3M8QA 4QW9A 4HTUA 1CXUA 3N6LA 2WCXA 3OJSA 1Z4UA 1JLBA 2D41A 2QKBA 3E51A 4ZVGA 3K5LA 3RR7A 4NLTA 3FRZA 1SV5B 2Z1HA 3U6FA 1RT3B 4ED7A 3MEDA 4OPKA 4NLQA 3AVMA 1I6JA 3HJFA 3JYTA 2HWHA 4CIGA 4EEYA 3AVGA 4M3UA 3QEXA 3PW0A 4I7FA 5KT2A 2I5JB 1S97A 3H4DA 5DGAA 3KMSA 2HNYA 4FBTA 2XGQA 2IS3A 2B5JB 1WLJA 2KW4A 4N5SA 1JLAB 1IM4A 2XC9A 2WOMB 1S9EA
chains in the Genus database with same CATH superfamily
3BKTA 1GQEA 4KHUA 3AVFA 4USJC 5C24A 3NAIA 3W3DA 3ZNJ1 2LQBA 3B82A 3CC7N 1VSDA 3TVKA 1WOPA 3VZIA 4X4VA 5LSRA 1KVKA 4DTPA 3DRXA 3Q8SB 3VZHA 3L2RA 5ADZA 2OPPA 2EX3A 4O3QA 1JJ2R 3DRSB 1JIHA 2BM0A 2XSJB 3A5NC 2ASYA 4JI0K 2O8BB 2ZDOA 2BANA 2LA4A 4XTTA 3G6ES 2NLXA 3CDWA 3D68A 4K42A 2UP1A 3WX4A 3HVWA 5BR8F 2QFJA 3MN9A 3SV4A 2ZOGA 1TYQA 2L48A 4K43A 5ETKA 2BX6A 3FBCA 4X66F 1BI4A 1WWHA 1FRKA 3PRVA 1GMWA 1T9YA 2LQ9A 3R5JB 4PYDA 4Y2KA 2XZDB 4DL6A 2OSRA 2F4VK 1PG5B 2UZAA 1BQMB 3NGUA 3MK6A 4DR3K 1M5PC 4ILGB 3PEHA 1SS6A 3KLFB 1HYSB 2WVDA 3SMSA 3GPAA 5KFYA 2DNRA 4OJGA 3MAAA 2OIHA 4NZ7A 2KYXA 4B17A 2YX7A 1RYRA 3ISZA 3I5AA 1VRUA 4HI2A 5FDLA 1UMJA 4RU2A 5HRPA 4NLGA 4OHXA 1FDBA 3DLHA 3ZSVA 2BE2B 4LH5A 2LSNA 2YQ0A 3VF0B 1SV5A 3KJVA 4Q45A 4DV5J 3CGIA 2EEYA 3T6JA 3OHAA 1RHUB 3HO1A 3PG9A 3NMRA 4JV5J 3NGZA 4YEAA 4F25A 1OYDA 4ERDA 1DY3A 2E7VA 1N36K 1F21A 2A42A 2Q36A 4FCYA 2B43A 4ZVUB 3LTOA 3SI6A 4FJIA 4LFBK 3MN6A 1XR6A 3LL3A 1ZA2B 3AJDA 1VC6A 1RLCL 2WBMA 3KK7A 5BJRA 3M6UA 4OJ3A 3RJMB 4X4TA 2L41A 4CD3A 1R8BA 5KQDA 4N47A 3VQTA 2QSWA 2N3OA 3QZ8A 4RWWA 1XQSC 3KOAA 1HYZA 1LW2B 3QWPA 4FBUA 1KBRA 4BRIA 2HVZA 4U8VA 2BQ3A 2N3LA 4DV0F 1YHQS 4JI1F 3WDOA 3TEHB 3HVTB 4M5IA 4W5OA 4A8YA 2E5LJ 2DH8A 2XSJA 5AXMA 4DX7A 1QTMA 2W8KA 4AHCA 3VQEA 1RAEB 2GMLA 4X4RA 4DR6J 2AYEA 1U2FA 2DGWA 3M8PA 4ICLB 2G8VA 5DLGA 3HPGA 3SQ0A 4FLTA 2GWJA 4CM2A 4ZCMA 1BL3A 3SAGA 3BB5A 1N4LA 2PDAA 1XMOK 4KB0A 4F0KA 1BQMA 2ILZA 1HNWF 2FJVA 1IR0A 2IM1A 2PBDA 3D1OA 3KLFA 3S1TA 4ZVOB 3OYBA 5GINA 3C0BA 4DR2J 2HHVA 4CK3A 4F4KA 3OYKA 3G10A 3VERA 4F0MA 1YRUA 4ISGA 4ZDNA 4B3SF 3MCOA 4A57A 4DOZA 5HMWA 4CO0A 3LP0B 1JLEB 4WKYA 3ICLA 3DRPA 3SSRA 3RMBA 3WEEA 2UVWA 2B4PA 2UUBK 4X62F 3TX8A 2IYIA 2RDDA 2NRXA 1U2VB 3MAHA 3EJMA 2VG5B 2YVSA 5LJWA 4B3MF 4PY5A 1GXUA 3TRGA 4XIUA 2CVIA 4C97A 4B8AB 1Q8LA 1G3OA 3CC2N 2FHMA 5HATA 1Q79A 4B3TJ 2P9IB 2H3GX 3D1HA 1RBRA 3LAMA 1YJWS 3K5NA 2FLLA 1XBWA 3SYZA 1MLAA 2V8HA 3F56A 5C42B 5HQLA 1F9EB 1BHNA 4K8ZA 4U67L 1S99A 3L2WA 2NUHA 3N4QA 2BMBA 1NDPA 4CLTA 2DRAA 2FTRA 5D4PA 4KH4A 2XHBA 3A1YG 1Z26A 4MDAA 4IH7A 3HVTA 2OEKA 1VQ5S 3T1HJ 3E8OA 5HK4A 3PX6A 2QA2A 3N0VA 3HSJA 1VQPN 1AFJA 4KGMA 3MTJA 3D2WA 2EWSA 1ZYQA 1VQKS 4ICLA 3PZPA 4KRWA 4CJRA 4JB8B 1YTAA 2P1JA 3H90A 4A8SA 2OD4A 1Y00A 4BDPA 3W0LA 1UTAA 5B0FA 3THXB 1RT5A 1S4FA 2AJ2A 2V8GA 4JV0A 4WP3A 3ZSXA 3M2UB 3MF5A 1ITGA 1JNRB 2IVYA 3I9V9 3TR8A 2KT3A 3W62A 5GAHU 3DOKA 3KLHB 2DR6A 1F9FA 3TUPA 1FX4A 2DH7A 1OPZA 2VDIA 4W98A 3VGUA 5K8OA 1GLEG 2F9WA 3CCVN 3VQDA 4DMNA 4OZLA 4P72A 5MLCV 1S9EB 4DV4J 3LUYA 2F96A 2XTJP 2YNIB 2JWLA 3LP0A 5HRRA 3CCRN 3G8SA 2WONB 4M5KA 3HM8A 1N0VC 2XMMA 9ATCB 5KG6A 1ZBTA 1U2VA 1MDUB 1KHWA 3HP6A 3MUTP 1GLBG 3NMUA 3TAMB 3OYLA 4X4OA 1LV5A 2PY5A 2R7RA 1WI6A 1NGBA 4HT7A 1OS5A 3IA0A 3AO5A 3RBZA 4OX8A 1NOYA 5J2QA 2LEAA 2WRMA 2Y1JA 1VQ9S 3R6GB 2C3MA 3TEGA 4MH8A 5B0EA 3RMAA 3CJ9A 1OO0B 3DOMA 1RWPB 3IRWP 4CHNA 3G2XA 4DFPA 2FY8A 5KG3A 3CQXA 5C42A 1WHYA 3GYXB 1WAJA 1FCAA 3UKUB 4MFBB 5GIOA 3TP2A 1D5AA 1TL5A 3AVHA 4CEDA 3UDLA 1RCOB 4OZJA 3CCEN 2R7TA 1HWUA 1Y4ZB 1WEXA 4JN4A 5F0XA 3LDSA 4CO1A 5AQKA 5DDOC 3A5MC 4UUWA 4MIBA 5IWAK 5ETSA 2DXFA 1WC5A 2YH1A 3SBMA 5GMKa 3AOAA 1UAWA 2YNGB 1Z25A 4ALZA 3PKYA 5KPTA 3CJRA 2JHEA 4FL9A 2GO9A 2BE7D 2BA9A 4NYOA 3O9UA 3RVCA 4L3NA 2UV8A 2HHHK 4ECZA 2ZH3A 2JOQA 4OPHA 3HI9A 1LW0B 3AVCA 3OTDA 2FJEB 1FD2A 1HQEB 1VCTA 2YKMA 5L1JA 2FHOB 1HNZJ 4PG7A 1KR4A 4P73A 3THXA 4MTPA 1BUPA 3M2UA 4DKWA 5HMYA 2P5VA 4NLWA 3QIPA 3KLHA 4DQ8A 4FOIA 1WEZA 3HT3A 2MDAA 2VFSA 1ZZFA 5H1SQ 3T5JA 3O5BA 4A8WA 2VCPA 5DQIA 2ILYA 4WQ4A 4ED8A 1VQ7S 3RB6A 4J9OA 5E3RA 4BC7A 1BY9A 4WTOB 3W64A 3KHRA 2H54B 3LDNA 1K44A 4IG3B 4DR5K 3UCZP 4HEA9 2MZSA 2K1RA 3HSGA 3C19A 3MM6B 4QWEA 2OLWA 2AIRB 4PR6A 4LF2A 5IT9U 1WSHA 4JYAK 3Q8QB 5EX0A 1WNSA 2UUWA 3HVRA 2VQFJ 3V4MA 1XMQF 3PYFA 3F5TA 4C8NA 3GE9A 1UAXA 2VG6A 2AYMA 3DCAA 1NGCA 4FJLA 1NMEB 4YHHJ 2E29A 5C10A 4LRDA 1K8AT 1IBCB 4X4PA 2BACA 4RUHA 1RU1A 1GXLA 1X0FA 5A8KB 5AQQA 2E7XA 2GMJA 1Q4RA 3UKUA 4MFBA 4FLYA 2HQFA 3KVGA 3EZUA 4C0OC 2JEJA 4B9NA 4FLWA 2M0GB 4F4XA 4JKGA 5CCLA 3J7AN 3LH2S 3CMAS 2VDHA 2F5GA 3NOCA 3GFHA 3EE8A 2YNGA 4ZPAA 5DDPC 3BO2A 2KJWA 4DPOA 2HNDB 4CVNE 1FFGB 3VALA 2H3EB 2NPIA 4HH1A 2XZTB 1HW8A 4FWPA 2GZOA 1BQNB 2K06A 1RBVA 3CDAA 5KFMA 3ENWA 3MM8A 4DX6A 3WNFA 1LW0A 1U7LA 1NHUA 4A8FA 3UN5A 3CDUA 3HHEA 1HQEA 1AZSB 5ETQA 5AQPA 1VDHA 1NXIA 1FT8A 1NSQA 1J2VA 5KAKA 3MMJA 5ETTA 3GCXP 1Y3JA 3UWTA 1IJEB 3GJSB 2C2KB 1NEEA 3PY8A 4FLZA 4RUAA 5F2RA 3X3UA 2ZM6J 3ENAA 4JBCA 3ZC4A 1X3MA 3A0IX 1U6ZA 2HHPA 2EPIA 4M5GA 1VGYA 5F41A 3MMCA 5AFUA 3IRXB 1VAZA 2DNPA 5AQJA 3K89A 3JAMU 2HVHA 4MDBA 2H5EA 3THWA 3D0HE 1XC9A 1RACB 2MGZA 2D69A 1NGFA 3MM6A 4ZA1A 3PIPL 4DU8A 4OIXA 4ECVA 2CWKA 1YVFA 4K4XA 1X4AA 4HLBA 5ELZA 4WP8A 2DNQA 3GIJA 4E7HA 1OIAA 4MIWA 3H2UB 2A1BA 3NS6A 1OKJA 2P9LB 2RRBA 1VJWA 1ZBIA 5BR8J 2OMLA 4M42A 3D0IE 2W7PA 4DTMA 3H7HB 4M5MA 4X66J 4ED5A 2FXUA 1NGJA 4FJHA 4W4MA 5A8KA 2DXEA 3MHYA 5I3UB 4CO4A 4PWDB 2BJ7A 4DTXA 4LF7F 2DCLA 3HD2A 1RHRB 3TSQA 4ZLPA 5EN1A 1EKEA 3V1OA 1VQ8S 5EXWA 3WXLA 1S77D 3FVYA 3W2VB 1RAOA 2HLUA 4IFEA 5DM6L 2CQ2A 4OHZA 3D6FB 2V8PA 3H2LA 3TI0A 4OKKA 2E5LK 2FLPA 2XLKA 4DR6K 4NLCA 1U1RA 1WD6A 4GV3A 3DGVA 1U45A 4OJRA 2FSJA 4Y2CA 1TV6B 2UXCF 1SC1B 2FDNA 4LR8A 2WAQD 2O67A 3UVJA 2F63A 1AZSA 2KZZA 2RS2A 4G9ZA 1CJKB 4ETXA 2RVJA 2J7WA 1A9NB 3ZT3A 3OYDA 4HVZA 4RR5A 4YMEA 1HNVA 2HHSA 2MKIA 3RZAA 2JC0A 4YB7A 1YUWA 4DR2K 2Q0UA 1FJGF 1MWKA 1X5SA 2ZBCA 3VAFA 3MPWA 3SPYA 1B9FA 4DUZK 5E3CA 5HOOA 4U6PA 2GJ2A 4OZ3A 3VTIA 3BZCA 1YI2S 3A3PB 4E1NA 5CYQA 4EBCA 4WCEL 3DU5A 4N76A 3P45B 2B9WA 4RKUC 1CQNA 2GGPB 3PX4A 4G65A 1C6VA 3AA3A 2WW8A 5JXSA 2VFVA 5AQFA 3EVWA 1M1GA 2WHOA 2AWZA 2HHQA 2XMAA 3O3FA 4JI1J 2I0XA 2QT7A 4AL7A 1WSVA 2RHQB 5B08A 1BHLA 3RSEA 2NLWA 2KKHA 4I6YA 4ZN1A 4B3TK 2KFNA 4XH5A 3UB5A 3OYMA 3VPZA 2RT3A 3DLKA 4F4YA 2ZUGA 3Q2TC 5HAOA 2DPIA 1AFIA 3EVMA 1HNWJ 3R5AA 4TU9A 2OTJN 3RR8A 5K14A 1UVNA 1RTDA 1NWKA 3N9UC 4ECRA 1B9DA 1V3RA 1J5OA 2DYAA 3IBCB 3VGVA 3CHWA 3ZSRA 3V9UA 4OHVA 3MUVP 1FFSB 3NGSA 3OHRA 4UTGA 1SXLA 4RNNA 5JVHL 3MGJA 1I3OB 2DBBA 4J5OA 3TAFA 3FFIA 1LCUA 4DU1A 3R7BB 2CFXA 2I6WA 3M2RA 3WQTA 2BYCA 1EJ7L 3MWPA 3C66A 4C23A 2EXUA 1N34K 3KLEB 2HK2A 1SIZA 2PYLA 2YKPA 3DN9A 4DQIA 2ZH9A 1RA7A 1CJKA 1H6KX 4FNIA 3SEOA 3H4BA 4J9PA 4IOBA 4YOEA 1REGX 2PEBA 3MM9B 4FF3A 3A5OC 4PKGA 2I7PA 2A1SA 4NA2A 1SJQA 3NLCA 4CIEA 2ZUAA 2CPJA 4IUFA 2PZSA 4ZVPB 4WFBL 4O0JA 1Q81O 1RT4B 3M8ZA 2ZH4A 3RBEA 3OV7A 3R1LA 2GGPA 2NRRA 3G6XA 1EARA 3MR3A 3V6JA 4WFXA 3O1LA 4KBIA 5F8MA 4MK9A 5D4OA 1KVAA 2A5XA 2D7SA 2JLFA 3M7VA 1HUXA 4Y1DA 3OXFA 3H46O 3F9KA 4M1KA 4DSLA 1U0SA 3NFAA 2NR0A 5KFIA 5HP1B 1L3UA 1XNQF 3VENA 3PW7A 2V94A 3QNWB 4KR0B 5JS1A 1LOTB 3GP9A 2DK2A 1RP5A 5B7WA 5H9EJ 4CJ7A 4DV3F 3QIDA 4I1TA 1YJ9N 2W25A 4ID5B 4O3PA 4RL1A 3H25A 1J27A 1VIXA 2YPYA 4J9MA 3H8YA 2HBYB 3OYAA 3GJQB 2V6AA 3I55N 1YT3A 1W7WA 3L6QA 4JI6F 3L09A 4OYBA 4B1WB 4CK1A 3G71N 3OYIA 2WTFA 2FBXA 3OFFA 2CRLA 2HMIA 2IVOA 3I5CA 4Z4GA 4ZTFA 4FLVA 3NCIA 4RWXA 3DAWA 1F3FA 4OZNA 4DPUA 5AQLA 4FKYA 3VEYA 5B09A 4WYLA 2GO8A 3EE9A 5KFKA 3U8XA 1QHAA 4E8UA 5FD1A 3KLEA 1IKXB 5A76A 5GAEU 2WVCA 2CNLB 1Q18A 4GO7X 2C3OA 2X7IA 3NWRA 3P3DA 3HOSA 1HI8A 2R2UA 2J7UA 4H54A 4JUZA 1P8ZA 2CJBA 4HHUA 3MM9A 4ZPWR 1S76D 4LREA 2E1MC 3AGKA 2DO0A 4FJKA 4ZPDA 2V34A 2HBQB 4BVOA 3A8KA 4ED1A 2GVDA 2CJXB 2GAHC 3VAIA 2UUCF 3CXCM 1IO2A 3ULDA 1SL1A 3HKZD 5L1IA 1X9MA 3FQKA 2EHGA 1FKAF 1RT4A 3H08A 1NPKA 1PBUA 3ZNUA 1VHXA 3ILOA 1FRJA 4CGFA 2BZ2A 2AEJA 2QTWA 1FTRA 1RTZA 5A8RB 4FLUA 5E3QA 2BBEA 3CC7S 3C95A 1N33F 3HCXA 4TYBA 3P83D 2VQFK 4CZJA 1TL3B 2IC3B 2C2MB 3GQCA 3FZ2A 2D0AA 4B8CA 4KREA 4JI2F 3SQ1A 1D4XA 1IR1A 5FIIA 5HP1A 2E1CA 3DHXA 1B7YB 3DFEA 4CEEA 2Y3YA 1SKWA 3VETA 2ZBIA 1WB9A 4YHHK 5DZ6A 5KG2A 1QE1B 2IMWP 2KU7A 1X0PA 3QEVA 4NXMK 1HD0A 1NH7A 2XY6A 2GHVC 1SQGA 4IRDA 4YY3F 3AAQA 5JLFA 1CZ9A 3HZEA 4ID5A 3NGTA 3M9MB 5IT9Y 3OVBA 1NHVA 4CTAA 2KTQA 3G25A 2YV0X 2HF4A 4KT0C 1WAFA 3N4PA 1CLFA 3KK3B 1QQOA 4IZ9A 3S8SA 2F40A 3KZBA 2WBRA 1RBUA 2H1YA 3WUHA 2HFOA 4ISFA 1RAAB 4KFBB 4KI6A 4C7QA 3VGSA 3FR0A 2NRZA 1EX8A 4IR1A 4TLQA 2Q0RA 3DNCA 2V9KA 2VD3A 4HHHA 3QGGA 2W4PA 4F3TA 2DIUA 1IKXA 2VA2A 2VA3A 4ENOA 5GADU 2FD2A 1TL7A 1ZA1B 2WOMA 3CCSS 1XMQJ 2ZKTA 3I0RB 4FPBA 5KT5A 4R0EA 1X9WA 1IVZA 1Q7YO 1S9GA 4J90A 1NK4A 4KC5A 5E3AA 5HQ8A 5LXYA 3RU0A 2N7YA 3GYGA 2UXBJ 3VEZA 1HIYA 3EICA 2ZM6K 1C0UA 2Q43A 2K3IA 3VEVA 3VV2B 2JFDA 4NLBA 3SCLE 1B0VA 4QS7A 5B0DA 2KB2A 2V0NA 2YHAA 2HNZB 4USWA 3KUGA 2DNZA 1M0SA 4B1UB 2FYXA 2CPYA 4E1MA 3O9QA 3QRRA 3P96A 5C2GA 4NXNF 4R25A 4BC5A 3RRHA 1VSIA 3BJYA 3VQ4A 5LJVA 4BC9A 4Z7CA 1KC8O 3MCSA 1TL3A 2XMJA 1UOCA 4ZP6A 1YTUA 4KRFA 1FK9A 1KLMB 3AA8A 3H3OB 4ZVSB 1N88A 1U1MA 3HSDA 2XYGB 4UY8O 3WXKA 4CIFA 3Q24A 1QE1A 4F3OA 4X66K 3VTHA 1Q1KA 5IV3A 1UL3A 3NS7B 3JAMY 3AA2A 3PFOA 1NK0A 3POTB 1Q82T 5C15A 1D0EA 4NPOA 1WF1A 3IBWA 5L38A 2H65B 2DNYA 2HGMA 3P5BP 1PYTA 4CLWA 2XQCA 2AHOB 5BREA 2VGNA 3IWNC 4DG1B 3FZLA 2YI1A 1RGIA 3KK3A 1BCMA 4RBUA 2KYZA 4L6V3 5BPNA 1U2CA 2R7OA 5E0OA 4LIWA 1VSJA 3A3NB 4FPIA 1RJJA 4WK1A 2CJAA 1W0HA 2ITMA 3HHLB 4N41A 5RUBA 4OI1A 3JS6A 4GKJF 3BKFA 1Q8IA 2ZOMA 1RT6A 1BWVA 4PCQA 4OZ5A 1T94A 5F0UA 1Y10A 3IXQA 1FVQA 1QLNA 1XTZA 2B8QA 1AA1B 4C11B 3QYYA 2DTUA 3D9BA 1TUUA 2C22A 2Z2YB 4USUA 3TJAA 2HIYA 2BM1A 1OH8A 1KQKA 2AQ4A 2Q3SA 4LF7J 4WYWA 3NF7A 1M90T 5AQHA 4W5NA 4J9NA 3SK3A 3E3XA 2HNZA 2MLYA 2KO1A 2YQ1A 3OXGA 4DZ6A 1Z05A 4M3XA 3LP2B 3ENHA 3M8QB 1S4EA 4ID1A 4QYRA 1D9DA 2CYYA 1HWLA 2HWIA 2EW9A 1FRHA 1E6VB 3FNNA 3ZTQA 1KLMA 3AXMA 3QT6A 1S79A 2UXCJ 4A5BA 3JTNA 1XK8A 4LBHA 1IG8A 2KKZA 4J9RA 2CDQA 4YOVA 1CZAN 1VQPS 1YSJA 5LOQA 2R7XA 3POTA 2B0GA 3CJKA 1C0TB 2D74B 2OANA 1HNIB 1EP4A 1G6BA 4FP9A 4EU0A 1HNWK 3ZSZA 1YKWA 3QESA 3J80U 4ZP8A 4HDHA 4TU7A 1BCOA 5C5JA 3D45A 4PXBA 3LP3A 5DS7A 3CB4A 1FJGJ 4WJBA 2FVPA 1UVLA 3DXMB 4M3YA 2QIFA 3VQAA 3QBXA 1O8BA 1RFQA 2RMLA 2RH3A 3DGPA 3M9NB 3ZX0A 2ZEJA 1LAVA 3WNGA 1GH8A 3CCVS 3IM8A 2MKKA 2CG8A 1TKTA 4IFVA 2UUAK 5F8NA 3PSIA 3HHLA 3CCRS 1TKZB 3OL6A 3VQ6A 3QJPA 2A10A 2FLOA 4CW7B 4RW9B 4JI5J 4C98A 1FXLA 1XHXA 2BE9B 1AUSL 3N28A 2JL9A 2EG1A 4C11A 5AXKA 3PYGA 1I39A 2Z8QA 4DL2A 3IS9B 3CCJS 2YKNA 2XY8A 3MWBA 4AILC 1MW7A 1F2HA 3HXMA 3D28A 1YBTA 1X9JA 3U1MA 4CEZA 3LP2A 2QLXA 1XQIA 3M8QA 4QW9A 4HTUA 5T41A 2MQOA 1G2EA 1CJVB 1G1XA 4Y2IA 4FDFA 3M1FA 3CCES 4N8OA 3EGWB 4LF5F 5AQXA 3LM9A 5D6GA 3P5TL 4HH0A 4CLLA 4FXWA 5IM0A 1RT3B 4QYZK 4ED7A 5JMVA 1SJRA 2KXHA 4NLQA 2HWHA 1J5EK 3QEXA 2MZJA 3PW0A 4I7FA 4ZCLA 3R5DA 1BOTO 5T7LB 2DPNA 2V4JA 2M9KA 1WLJA 3W1YC 2ASOA 4N5SA 2A6AA 3S6EA 4ZPTR 5H9EK 5LT5A 3CULA 1PYOB 3SFGA 2O8DB 3BQ0A 4IO9Q 3IUCA 4DQPA 3HHLC 3AAWB 3DRRB 2QLFB 4KH0B 1S5JA 1GX5A 5CHIA 2HZVA 3J7ZO 2ZC4A 1QQNA 3FEXB 3DXKB 4WE1A 2GWKA 5IT9O 4M63C 1VHIA 4K0KF 2W40A 3PR4A 2XMUA 2AU0A 2XO7A 2FJWA 1RTIB 4GY2B 3AD9C 1TKXB 3MTKA 5F8IA 5A6PA 3ZT0A 4ID8A 2IVMA 4JK8A 2J6TA 2GNKA 3GZ7A 3AGRA 4ZHRB 2XLJA 4FJ8A 2XULA 4OYIA 1XNQJ 2ZKUA 1B0TA 3U3GA 2O5DA 3HPHA 4WTYA 2UU9F 3QFPA 3U3YA 1QS4A 5MAOA 4OI2A 3DM2B 1NMNA 4LMZA 3NDKA 3HK2A 2Z1IA 2J0XA 3AARA 1H7XA 3BPSP 3HDSA 2VQEK 4DV3J 3CDEA 4Y2AA 4MMOA 2E9ZA 3L7PA 1ZBSA 4FLXA 2M52A 3R9PA 3PIOQ 4U7UK 2P9CA 1UJ4A 1RWOB 4R0JA 2B4UA 3T69A 1R0AB 2ATLA 1MU2B 1X5TA 1CJVA 4ZVQB 5TKWA 4JI6J 3OUYB 2W9CB 4CEBA 2M4MA 1NOZA 1JL2A 4O44B 5DM7L 2QN6B 2IY5B 1JXEA 2YJFA 3BBFA 3SUNA 3S9HA 1PSDA 3GMGA 5KG4A 1QQCA 2OZMA 3Q23A 2P2CB 4L75A 1VQON 2IM0A 5T14A 5LXRA 1GMVA 3P1GA 5BRDA 2JWNA 2FIUA 5E2QA 2HHWA 2MQNA 4EK2A 1YHQN 2DPJA 1N48A 3DJCA 1KONA 4FVMA 4PL8A 2W2PP 1NPRA 5DRKA 4QOTA 4BRHA 2O8DA 3DYAB 3IC1A 1QQMA 2VC1A 4LBPA 3RWUA 3KJFB 4K2JA 3M4XA 2UUCJ 1RHJB 4RUBA 1DGKN 1S1WB 4MT1A 4PQUA 4DUTA 1OY8A 1UVIA 4OX6A 1S72N 1TU0B 4H03B 2BW7A 2DHAA 3T5HA 4C48A 5B0AA 5ETMA 2GJFA 3C7NA 3L95X 2A6MA 4DFJA 3CJ4A 1RADB 2X1AA 4LFAF 3CIZA 4QWBA 3VMFB 1K73T 2E9TA 5KFAA 1N33J 1HI1A 2C1EB 3AXKA 3OT9A 2V9WA 2WBNA 2P5OA 5CD4A 3J81j 1XMQK 1FEEA 2BOAA 2D1KA 4JI2J 5E33A 2YH0A 1ZPVA 4ZHRA 2Z56B 4W92B 3LPUA 1PKUA 2RF2B 2JLEA 4M5JA 1D8ZA 2QWPA 3ZTRA 1Q7LB 1VBKA 3CJSA 3DM2A 2UXBK 3C46A 1JXLA 4JV1A 4OX7A 4CBXA 3GSIA 1VQ4N 3H40A 2ADCA 3UCUP 3GOIA 2GUPA 1W9HA 3GFXA 5J2MB 2Q2RA 4YY3J 2HF3A 2OTLN 2H9ZA 2UV8G 4RW7B 1F2GA 1WOQA 3O6QA 3LDPA 4DPXA 1T02A 4TY8B 1IKVB 3J81Y 4YB6A 3IFEA 3I87A 3O4WA 3HYFA 4O4GB 3KYLA 4OYXA 1FJEB 2BV3A 4O44A 2DIVA 5LMUF 4Y6IA 2UUTA 3W60A 1S7IA 3VQ8A 3I56N 5AXLA 2CJKA 4M5DB 1BXNA 4CYUB 1CXQA 1WF0A 4P74A 1GMUA 1SQFA 3TQEA 2CNOB 4WFYA 3IO1A 2OPSB 3NAHA 2H4YB 1EHWA 3O44A 2HAFA 3JSRA 2OO4A 2O8EB 2XCPA 2D5RA 1SZ2A 4NYFA 2R8KA 1ULRA 4NCGB 3NNCA 1HNXK 1C2PA 5AJ3F 1RBOB 1KEKA 2ZBRA 4MO5A 3DYAA 4DL5A 4B9SA 1JJ2M 3OA9A 3RMCA 3D6MB 2D0CA 2WB4A 3CETA 3TTCA 3UE5A 2RPIA 5AQTA 2MTLA 1U4BA 1NK7A 1LXNA 4WF9L 2P8IA 3SQ4A 1T44A 3WXMB 3CCLS 3W2WB 1MWQA 2DKOB 4M7YA 3CXCR 4NYZA 1PJ7A 4NLSA 3M8WA 3HI0A 1N5TA 2ZBQA 2HVIA 2CGJA 1ZM3A 4ZS6A 3CPWM 2M70A 3R97A 4H5NA 3RAQA 4O8UA 1NKBA 4JHDB 1MG7A 1BISA 2JJ4D 2GUIA 3S01A 3N5BA 1HWJA 1HWIA 4J91A 1U1LA 1JLBB 3V1QA 1HBUA 1FRLA 3WBZA 2MQLA 4CFCA 4PRFA 4BRDA 1CC7A 2QK9A 1YG0A 3NY0A 1FNMA 3SLCA 3GV8B 5EVZA 4CHQA 4FK4A 1F0XA 1TTHB 1DEJA 1H2VZ 5GMDA 3JYTB 3R5BA 3GILA 1VQYA 3PNIA 1FRIA 5J2MA 1RAGB 4BE0A 4LF7K 3Q0AA 2VUGA 4RW7A 3KG1A 1JCFA 4UZBA 4O3RA 1MA9B 1RT2A 2HNYB 3ISNC 5AQOA 3M30A 4E7JA 1URNA 3KWMA 4IDKA 3D6RA 3IFRA 2LVWA 4EYHB 3EO3A 4I2QB 3MPDA 3AA9A 3BUZB 2M88A 2OTJS 3VQ9A 4HVJA 3E9OA 1UETA 2MLZA 5IC6B 1UWAA 3CJAA 2E88A 4TSXA 2CPDA 4ZIWA 4AL5A 5ETNA 3SSSA 2GVZB 4M5DA 3QO9A 3AJ1A 1KKHA 2ZH2A 1N0UA 4K7QA 2OPSA 5HJYA 4N77A 1QZ6A 4GKJJ 4FYVB 2EBGA 4DLEA 1N5QA 4CFBA 4J7CA 4OYMA 3SPZA 4ILJA 2IJNA 1OY9A 2QWQA 2M5YA 3P5JA 2AF6A 1ZAWA 3FKBA 5AE3A 5AFUH 1I1GA 4NL5A 4F50A 4ZJQA 4Y2MA 4U67Q 1N32F 2DGVA 5CHCB 3BR9A 2F1FA 5M1QA 4QAGA 1IKYA 1FJGK 4O23A 5IV4A 3Q22A 2CJYB 1U47A 3HSZA 3LO3A 4FZZA 1HLUA 3N6MA 3W2WA 1RISA 2RRNA 1FERA 1F5AA 2E5HA 3THYA 2ZJRL 3DMJB 2VU5A 3P4IA 4CZEA 2G1HA 4JHDA 4DXLA 4CO5A 1ZPWX 2Q6CA 3TAEA 2P5GA 1SB6A 1TMMA 2N4DA 2AX0A 2FQQB 1RWMB 1VQ7N 4JKHA 1P27B 2QL7B 1YJRA 4MKBA 2ZH6A 4JI5K 4BDYA 2E2NA 5FLXU 3M5RA 2O66A 1KHVA 2KHOA 4WIQA 3E2EA 4C8ZA 1RI7A 3DWLA 2CQCA 1Q9YA 3D66A 2PA8D 3FMBA 3P8BB 5C2DA 4PG5A 1UPMB 2QLBB 4K4YA 1CULB 1M90O 3SFUA 4JAXA 2CPXA 5J2PA 4MYTA 4FS1A 1NK5A 4K25A 3NCRA 1TUGB 2RSQA 2G8WA 4OI6A 5M2UA 4Z37A 1KFDA 2ZD1B 5KFVA 3K0SA 1E6YB 5J2NB 3DKDA 2EFGA 2VFRA 4E7IA 1YJ9S 3F44A 2V8VA 4H0XB 5E26A 3QBWA 3CM6A 4AQYF 1UA0A 3IMQJ 2IIRA 1UEVA 5DGBA 4KV8B 1BE4A 3G86A 3ENOA 4RU9A 4F8RA 2GVZA 4C0HA 3AVAA 4ZMMA 5AZIB 3Q89A 3S41A 2YWWA 5BN9A 4Z0UA 2MKJA 3JS9A 4PXEA 5HVHA 4FWSA 3O1BA 3PKMA 2NXUA 4UZCA 5GVQA 2R9LA 1VK3A 2O8FB 4JKDA 2HKEA 5GAHI 5CYMB 3R27A 2QC3A 1EQMA 2B9YA 1NJXA 4K59A 2CUYA 4FF4A 1PJ5A 5KFQA 5D0RA 1TUYA 4MQ3A 3OHBA 1CSJA 1S1UB 1UVJA 3IN5A 2O8CA 3HPOA 4ANDA 5K8NA 2J5AA 2E7WA 3T1YF 1VBZA 1PO6A 1VQ6N 1T6DA 4C9DA 2D9OA 2OMOA 3T7ZA 2GHPA 1FDAA 3TOQA 4IRKA 2EBEA 1N5YA 1YJ7A 3ZSYA 3UPFA 3CNQP 1YJTA 4EHTA 2W7AA 3EEQA 5JMNA 3W3SA 4RW4B 1LKZA 4LF5J 3N6NA 3QT8A 5L1KA 2L3MA 2FC8A 1KQFB 2F3JA 1PYSB 1LWFB 1PAUB 1XNQK 2MYFA 2DFEA 2GMHA 3TUJC 4LC9B 3KKFA 5AR0A 5K5MA 2NXEA 1R8PA 1CULA 4CLSA 4OMFG 4GV9A 4F3MA 2SXLA 2IDEA 3R8YA 4DV3K 1OYEA 2RUGA 2ASDA 2GIRA 1VRTB 1FX2A 3Q8VA 2QWOA 3QGHA 4AE5A 4V19S 1RT1A 5J2NA 4W5RA 2MJUA 4OV1A 1F60B 3AVLA 1TK8A 4BRPA 1WSJA 3AVBA 1LWCB 3IG1A 4JI6K 3AD7C 3OSPA 3CG7A 4KO0B 3LP1B 3OYEA 1YRTA 1FWLA 3GU0A 4WYBA 4ES3A 3ENBA 4K0KJ 1DHMA 1HARA 5KQ8A 3RAMA 4AHVA 3J81O 4JI4F 3TZYA 3F73A 4I67A 4L74A 2G8UA 2CIMA 4ES1A 5JS2A 3IP0A 5KGWA 2HAIA 2O8FA 2DY9A 3ZEUB 1X4HA 5CYMA 4XDDA 2FLNA 4CZHA 5AE1A 4I6MA 3E9LA 3Q7BA 2GC8A 5KTQA 2XHCA 2UU9J 4CF1A 2H51B 3IGNA 5BPMA 4H4OA 2ASMA 4L3QA 5C12A 4A5AA 2IJRA 3OR2B 3FMWA 3WIUA 3ZT2A 3D0PA 1IXKA 5IZHA 3CO9A 4LF4K 2HZCA 1PGZA 2CQIA 4BS2A 3TSUA 2E5IA 4NASA 5KFFA 1HLWA 3FRYA 3TA2A 4KGXB 5EOYA 2RHSB 3K7RA 3C16B 2HFUA 4IOXA 1SJ4P 2W2QP 2D0BA 4IYQA 4JI7J 1UEUA 1W97L 2XNRA 1WKKA 1RE1B 2BJ9A 3QT5A 4YUDA 1ZC6A 5A0YB 1IBLF 1SIWB 4I6AA 3UD5A 1J53A 4JI2K 1LWFA 2XS7A 1YI2N 2YBVA 2YNFA 4NZ6A 4H0YB 4GNIA 4NOHA 2AEFA 1BO5O 1YTYA 2OPRA 1WKJA 4C8OA 3H42A 2CKWA 1I94K 1DLOA 3LA0A 1UZHA 2HVEA 4NI2B 3KHHA 3MOJB 3MM5B 2N82B 1KDNA 3NMAA 2FHJD 3GJRB 4WQ5C 4IQMA 1GLJO 4Y34A 4MK8A 3IAS9 3AOBA 3C14B 2PD1A 1D09B 4X64K 2NREA 2P9SA 2JSXA 1XNRJ 2EC2A 2DT9A 1PILA 1VK0A 4LFCJ 1RAHB 5I3QA 3UN3A 4Y0FA 4DR7F 1R6YA 2JEGA 1V5VA 4PPZA 2YJEA 4A8KA 2KHCA 3LP1A 1KOHA 3C3LA 4Q2MA 4FOEA 1HBOB 4EGLA 2PAVA 1X8DA 4KPYA 4DX8H 2G0JA 3I4PA 3QBCA 3GV5B 3VGKA 1X4DA 1TZ0A 3H98A 3R2DJ 1SJ1A 1H2TZ 5CABA 4IOCQ 5F1XA 3VGLA 2DHGA 3V4IA 1YK9A 9RUBA 3TW0A 3D3CJ 4OYZA 4BC3A 3TTDA 3ZEUA 2MHEA 3BO3A 1HKGA 3EGNA 1P90A 1DTQB 3MI7X 2WVFA 1OVQA 1OSDA 2E1AA 2PIIA 2X51A 3OJUA 3JXUA 3SCKE 1KVCA 5K9FA 4NEZA 2BJEA 3DLBA 2WZ1A 4A2AA 3N01A 2IBOA 5IOLA 3PVXA 1R27B 4OGCA 2CNKB 1BC6A 3FCWA 2J0WA 2XGPA 5DM6Q 1T7PA 1QD1A 2YWHA 2MHNA 2I7NA 1DQAA 2RU9A 1K73O 1T9UA 3SUOA 1HBMA 2W41A 5KRTA 3GIRA 5HMZA 5KT3A 5SZTA 1T3NA 2DCUB 1W7AA 1QAIA 2RILA 3CJ0A 3LWMA 2E2OA 4O0NA 2OYQA 5LMUJ 4WFNL 5A0YA 4E3SA 3ZTSA 2P9PB 4DTRA 4KHRA 4JI0F 3U7JA 3LGHA 3P6YC 3OLAA 3M2VA 2QA4G 3KJNB 5GAHP 4U7BA 2P9KA 3FFKB 2ZOFA 1SC4B 4QW8A 3MFIA 3K5OA 4UQTA 1FNOA 4HKQA 4ILRA 4LF1A 3MM5A 2AP6A 5B0GA 2VWBA 4BC2A 4IO9L 2ZITA 5CA5A 3NRBA 2A1RA 1FD8A 1GX6A 4CNZA 4J2BA 2D9PA 1VMBA 2HOEA 2C2OB 2F4VF 4B3RF 2DB1A 2HBRB 1HJRA 4DL7A 3P38A 5AJ3J 3DLRA 4FJ7A 1U6FA 2KN4A 4DR3F 2GW8A 3SIPB 2JVOA 3N4WA 5CXTA 3WC2A 2QA1A 1C1CA 5E84A 1VLOA 4NRTA 2VF3A 4WCEQ 3TUIC 2ROEA 2C2RA 5HJXA 4BRCA 2RQCA 3CSKA 1ZAVA 5EWFA 1BLUA 2DNGA 3MURP 2ASLA 2LYVA 4LT6A 5KFZA 4LQ3A 1ZTTA 4LSLB 3A8EA 1HBOA 1Q0NA 2V8DA 3NNHA 2POKA 3DC2A 1T9WA 3K0JA 2FSKA 4DS4A 3GIMA 1ZH5A 4H4KC 5EGYA 4HUGA 4NLXA 5D0GA 3GSDA 3VQQA 1OH5A 4BACA 3MWTA 1DTQA 2WSFC 2NRHA 1MMLA 5BRFA 4CERA 1FESA 2PC6A 4BQZA 2HQ3A 1RKJA 1PIEA 3D2FA 4DX5A 4KHPK 1GEHA 4BE1A 4PHTX 2IPOB 4BBYA 3QT7A 1P1TA 4QU6A 4ZOSA 2X1GA 5JVHQ 1WC3A 4PKDB 1NAQA 2IDLA 5DG8A 3CFPA 3HOTA 1C0GA 3LDOA 3M1VB 3OPKA 4YDXA 2P9PA 2AV5A 4DBQA 1WN7A 1NHKL 3AB4B 4Z2XA 4A47A 1A0OB 4IBNA 2OI2A 4DU7A 3WZ0A 2OP5A 2Y8YA 4CGIA 3RW6A 1ASWA 1ZBLA 4QS8A 4CRJA 5D0HA 1XMOF 3DXBA 2FJAB 1M5KC 2L9DA 3V5RA 1OH6A 2B9EA 2FC9A 3FUYA 4JI3K 4WFBQ 5KG1A 2P9NB 5H1SV 5DG9A 1N32J 1VQSA 4AYBD 2Z2MA 4A59A 2JC1A 4YDUA 3LF0A 4FWMA 2LDYA 3WXIA 4Z4IA 4OHYA 2OAUA 5EHHA 2G8KA 2K3KA 3G4SN 3C15B 2VOPA 3W5ZA 5J1NA 3NOGA 1ROFA 4Q0BB 3TARA 1WF2A 4L8RB 4LSLA 2IAJB 2O4IA 3E1YA 1KNZA 2NXNA 4BRAA 2DNOA 4FYWB 3GDQA 1WELA 2BJ1A 3VAJA 2UUBF 1WDDA 1YZ6A 2DR9A 2AT1B 3CPWR 2VIHA 2FBVA 4YB1P 4ILMA 3R6MA 2Q3PA 1CG2A 1QVFM 4CHPA 1KTQA 1IBMJ 4NA3A 4I2PB 3IGVA 1NB7A 4NLRA 1RTJA 3KLGB 3FGUA 3M32B 1BWEA 2V2KA 1T3VA 3GYNA 3HFKA 3NCQA 1R8CA 4RWTA 4FJNA 3MECB 4M3ZA 4ECQA 3I0SB 1RDCA 3QICA 1VSEA 1Q86O 2NZ4A 3F41A 2M8DB 3EXYA 4QOZB 3CCSN 1OSCA 3D7SB 4C4WA 3ATUA 2FVSA 4PG4A 2DGSA 2IIHA 4CJPA 4AFFA 3K2YA 1A5XA 2YX6A 4I9QA 2F9DA 4UOGA 2I5JA 3M1VA 3WT0A 2D3OR 5KFSA 5ETPA 2C3YA 1SH2A 4ED2A 4ANEA 1JLAA 3H0PA 2NXJA 3F0NA 4BR0A 1L3SA 3TABA 3I32A 4YDUC 3CD0A 5GIPA 1GFWB 3KKRA 3ZT4A 3ZZ0A 5L1LA 3SCJE 1RAJA 2DISA 2CPZA 3FSIA 1S1VB 3OFGA 1GLDG 1VQOS 1X4CA 3CW2C 5LMNF 1YJNS 4M3RA 2VASA 5HVGA 2PI4A 4WXWA 1X5PA 3MM7B 3CJCA 3VESA 3DRSA 1UFKA 3LDLA 4IKAA 2O8BA 4CJUA 4CLFA 1HYVA 4O5BA 5JICA 2Z1JA 3C6UB 1G15A 4TXSA 4F26A 3SJHA 3T1YJ 3OFEA 2VBWA 2PYJA 4PWWA 1JL1A 2P6SA 3KUEA 3OBIA 4K0KK 1T03B 1S72S 2BOPA 3AD8C 2J8SA 5LSOA 4XH1A 5GAEI 1H1VA 3R5CA 4OI4A 1HA1A 3E01B 3H20A 4EZ6A 4DN0A 4PKHA 3PACA 1EZZB 2YTCA 3FC9A 1HYSA 3VVUA 3C6HA 3FZFA 3CQYA 5DQGA 4WXOA 3KLGA 4CLUA 3M32A 1Z2ZA 1TFYA 4HTIA 1NJYA 3I8DA 2UU9K 4Q2LA 1RDUA 3MECA 3WX8A 1F6TA 4AD6A 4F4ZA 4IH6A 4GKKF 4CJSA 3KG0A 3BGUA 2IDOA 2F9TA 3LQVA 1LXJA 2BE2A 2PN6A 2HFVA 3NH0A 2M2BA 2GV1A 1VQ4S 2OUGA 3NBPB 3TZWA 2JWKA 3H5UA 3L3UA 3BBCA 2E6MA 2OTLS 1SQEA 3CMQA 2NRTA 4CIOA 1NJIT 2HLTA 2KH9A 4CK2A 1VSFA 3D6HB 2KQ2A 4JI7K 4LF8J 2RE1A 5IWAF 2KXFA 2RAQA 3TO8A 1KN6A 1TMJA 4EZ9A 1ZM2A 2D0PA 3N5FA 1NGHA 4PKIA 4MJKA 1FI4A 3K59A 4BREA 3V9XA 3VVTA 2YCHA 3VF6A 1NK6A 4JI4J 4X65K 2GIFA 4CJ5A 1NLVA 3I56S 4LY7A 3M8RA 2JLGA 1K1SA 2XI2A 3QEWA 1LW2A 1PBAA 3QDKA 7AT1B 1A6LA 1VHFA 4CH1A 2PE8A 5AQUA 1LWXA 3DLEB 5HBMB 5KPRA 4CQ1A 1XNRK 4CM0A 5HROB 4KBOA 4C8YA 3WC0A 4AXIA 4LFCK 1ZZNA 3QMLA 3C6UA 2IVPA 4XPEA 5AZJB 1WACA 3R5GA 2DR8A 4DF8A 1T6CA 5HRSA 1RHQB 4ED6A 1UPPA 2QWRA 4KKOB 5DETA 2DVIA 5BYRA 1TK0A 4CZCA 3ZT1A 2IVFB 4MLHA 3QERA 4XH4A 1T03A 1WJ9A 4DR5F 3MAQA 1S0NA 2ZH8A 4P7TA 3UD3P 2Y0BB 3HTVA 4JYAF 5LM7E 1HKBA 2Q97A 3ZXWA 4DCPB 3HL8A 3WQPA 1ZM4A 1O5JA 3Q8RB 1IBLJ 1FFWB 4LQ9A 3L9ZA 1JB0C 2VWJA 3SDEB 4DPYA 4O3NA 4F02A 3S3NA 2FY1A 2OCEA 3R3LA 3MR5A 4GVBB 3SI8A 1S6QB 3HD1A 3NP5A 3Q8PB 2HFNA 4NX9A 1WHWA 2CQGA 2XSFA 1JLEA 4Z4CA 1WBDA 4QWCA 1LK7A 1J6ZA 1AUDA 3OYHA 1WNEA 3AO2A 3V9ZA 3AVJA 3NGRA 3VCDA 4AHUA 4FPRA 2VG5A 3NBPA 2HS3A 3OTOJ 3L7OA 3ULHA 3W7BA 2VC0A 2JRSA 2COLA 3SZ2A 4KGKA 4DR7J 5M1FA 1L3VA 1F5BA 4MAKA 3UCGA 2BTFA 3CCJN 4ECWA 2P9IA 5D4NA 1EIYB 2QMUB 4FKXA 1QUPA 2FJBB 2DY4A 3DDNA 2F8SA 1SL2A 4J8FA 2CZ9A 5KT6A 3AODA 4IWVA 3BSNA 4P10A 1WUUA 3J7A1 4GO5X 1UFLA 3KK2B 1GXTA 4O5FA 3SBTA 1GTEA 5THWA 4K4TA 5U47A 2O4GA 4FM2A 4KGVB 1WSEA 2RQKA 1RA6A 2FZGB 5JUMA 5AJ3K 5HBMA 4CHZA 1GLCG 5HROA 2E5GA 5AQNA 1P1LA 4DU4A 4ZK7M 4FW1A 3LAKA 3R9LA 1CXUA 3N6LA 4DCHA 3FZBA 4ZJOA 1FJCA 2PMWA 1EAYC 2D41A 4YORA 5CD4H 4NLTA 4OZ1A 2GS8A 1H74A 3KDNA 2Q1NA 3CCUN 4WWSA 3UKRB 1I6JA 3HJFA 4EEYA 2WTUA 1IJFB 2OHDA 4RTFD 2BKOA 4JI0J 5DGAA 2CH5A 1ESVA 2QA4N 3FLCO 2B5JB 4CH0S 1S6QA 3EZWA 1S9EA 4I68A 1JLCB 2YNIA 4UY85 2P9GA 2DHSA 2WONA 2F4VJ 2AGPA 3KXDA 4KGZB 4B3RJ 4OYAA 2KL8A 4LF6F 3HLUA 1TAQA 1Q78A 1FRXA 3TAMA 3QIOA 1DKGD 1SUQB 4OLPA 3MDFA 1NDCA 4M41A 4EHUA 4DV1K 4QZVB 1YGYA 3CUNA 1REVB 1R8AA 3UNYA 4I6WA 1LFWA 4ELVA 5GAEP 4YOUA 2HQGA 4RZRA 1HPMA 2GBZA 4YDDB 1TVRB 2KXNB 4J37A 4DR4J 5KFCA 1U6BA 1IQTA 5G0RB 1T9VA 2FHKA 1V5IB 2DO4A 5AXNA 2FHJA 1U1QA 4R79A 3IWXA 1AW0A 3OL8A 1K47A 1NSAA 4YS2A 1YWXA 3AA4A 1GOCA 4C1NK 2GQCA 3FBBA 3P39A 1U1PA 2CH6A 4UOCA 5D8HB 3U02A 1S1TB 1V4TA 4E89A 2RKIB 2HMPA 3M6XA 3SAHA 4KJIA 2VFTA 4DR2F 1KLNA 4DUZF 4C8MA 2KM8B 3RB4A 4OJHA 1N5VA 5AQZA 1UCNA 2EG2A 1N56A 4F7VA 4Q8FA 2CQ4A 2IJFA 2G13A 4KYZA 1N6QB 3HHLD 4FJ9A 1Y0HA 2HBMA 2B4JA 1B4SA 1FHTA 1VQ6S 2P9EA 4QIGA 3ZTPA 3V9SA 1X4EA 4HCCA 1ELOA 2Z0GA 2BGGA 3LPEA 2ZVIA 3V81B 4AHRA 3RG6A 1IBMK 4FJMA 4DV6J 2FVRA 2OEMA 4ZCIA 1SPBP 2B5JA 2FJDB 3OSNA 4J9QA 2BRKA 1S0MA 1R89A 3JSMB 1WEYA 2ROPA 3CFOA 1JLCA 2VG7B 1XMOJ 1NGEA 3ATVA 3GR1A 3GTYX 2IOCA 4ZTJA 2VICA 4IG3A 5KFGA 1RCXB 2NRWA 2HK3A 2F7TA 5SUHA 1SUQA 5DLFA 1JXBA 4K5SA 2J9CA 4DV5K 1REVA 1K0VA 3HX9A 3ZO7A 3O9SA 3UR3C 4JV5K 3CD6S 1BUXA 1FE0A 4IOCL 2MSSA 2B9XA 1WI8A 2DGQA 3OVNA 4JNEA 1TVRA 3R3TA 1RWWB 4UUXA 3K2PA 5KFHA 3NH2A 3BQ2A 2BR0A 2XS2A 5G0RA 2UUBJ 4M94A 2YHBA 4PUOB 1ATNA 2QX0A 4CJLA 1N34F 4JRPA 2AGQA 4K4ZA 4M5NA 4U7UD 3W9IA 2QEXS 2HFSA 1JWWA 2NRVA 1Q5YA 4IKFA 3T41A 3BGFA 2OGUA 5DDQC 2RKIA 1F9HA 2GELA 3QNOA 4DZDA 3A5LC 2QLJB 4CWBA 1FA0A 4H8KA 2VPXB 1WG1A 1X4GA 3HSTB 2HNDA 3F9MA 4KQZA 1BQNA 1DBDA 3T1YK 4BRFA 4DR1F 1GLAG 2VKZG 4OYOA 3Q86A 1V6HA 2E1YA 2DRDA 2B7BB 1X60A 5DM7Q 3I9ZA 1JMTA 5LSLA 1C1BB 2EC0A 1SH3A 3VF2A 4RNOA 2VPYB 3RBDA 1U8WA 3V81A 2R7QA 2QW9A 5I9EB 3L4BC 3RB0A 1KAZA 2HRTA 2HW3A 3CCLN 1D1UA 2XCAA 2HFZA 3HFZB 1YAGA 5AQRA 1XR7A 1WC4A 3ZX2A 4AT1B 2J0SD 3GLJA 3SUQA 2WC9A 3ZZUA 4RJVA 3JSMA 3IRXA 1T9TA 3Q83A 4LUBA 1VBXA 2PFDA 4KHQA 2B56A 1EXQA 3A12A 1DT9A 3L4QA 1RK8A 2CQ0A 5LL6d 1ZETA 3GL1A 4CDIA 5LMNJ 4X4NA 4IJNA 3EE3A 1Y5LB 3R1HA 2D3ZA 4DV0J 1Q16B 4DSKA 2AGOA 1P9QC 1FXXA 4PYAA 1IQZA 5D4LA 2L9NA 2ZHAA 4FF2A 4Y1CA 4RW8B 2RB7A 1NG9A 1YLXA 4RG8A 3MEGB 2P9LA 2Z2ZA 4J2AA 4B1ZA 1VK8A 4LF8K 2GCFA 4V1Ak 1QVGR 3TQ1A 3AVIA 4CGJA 4NZ0A 1MWZA 4IEEA 3VF4A 4K8RA 1FDNA 3J7Z5 3QZ7A 2NS1B 3Q7CA 3I8BA 5DQHA 5I3UA 4RX6A 2VHGA 4PWDA 3TNVA 2JGUA 4IXCA 4XPCA 3TSPA 4BHQA 3NVKA 2A2CA 1ICEB 1NSKL 1NLKL 4YOTA 2KM8C 2CG4A 5EX3A 3MEDB 1RZMA 3GJTB 4USKA 1QVFR 3W2VA 4DSJA 3EGVA 4CO2A 3OTCA 1RWKB 1S10A 1XIQA 4KHNA 4DLGA 4B3SJ 1QZ5A 3T1HK 3PHEA 4GKKJ 4KH1B 1FVSA 2GTDA 3NGYA 3L3CA 2EFNA 1CJUB 1TV6A 4X62J 4CLKA 5C24B 3AHPA 4B3MJ 3A2FA 3MX2A 5K20B 4BWMA 2QWLA 4KE5A 5FPDA 3QLHB 3W66A 1GOAA 3BDPA 1B3TA 4B1YB 2BW2A 3D0GE 3ZZPA 4OLOA 1C4AA 2EFPA 5IWAJ 4Z4HA 2AKWB 3EXCX 2PMZD 2C3PA 4DV7F 4ECTA 3MXJA 3SQ2A 2OPPB 5CH7B 3H1VX 1IBLK 3LGMA 2C42A 2QGFB 2BANB 3D5MA 3CJ7A 4J9KA 2X6NA 3TJ9A 3QAUA 3O3GA 2PMHA 2RUSA 4NB4A 3EX7B 1VQLS 1SQKA 1JJHA 4DV4K 1BI4B 5AQSA 2PO4A 4NXMF 4MKAA 3AVNA 1U2RA 3U27A 4BDZA 4H0OA 1P6TA 3VEWA 1NJZA 4AM7A 2CPIA 3AQOA 4HHTA 4WF9Q 4BROA 2MLXA 1FJ7A 1NJIO 2XWYA 3SMZA 3OTOK 1NUEA 1YZ7A 1E4GT 1RABB 1QDUB 5LJ3Y 1HMVB 2E20A 1G99A 3WHIA 2KRBA 1Q53A 3MAAB 3ISND 4BY9C 1VI7A 1KD1T 3C8YA 3WNEA 4K4SA 1NPPA 3VN5A 1VOMA 1VRUB 4C6AA 5DZ7A 3VR1A 3CD5A 1ZBUA 4MKVA 1FTCA 5JJBA 4USIA 4CP5A 3BP8A 3DDIA 1HPZB 3KJVB 3KLIB 4M7XA 2QSFA 2O3DA 5BR9A 3QEIA 2QM1A 2ZHBA 3U4LA 1O0PA 4OO1J 1WG5A 4ECYA 3GE1A 4WU3A 4HCBA 4CGGA 5DK5A 2LXFA 2XEXA 4OZ0A 1K6YA 4BR4A 2MZ1A 3JTPA 3M3ZA 4FWQA 3D7EO 2ZM6F 5IC4B 3TANA 4L3KA 5C25B 1B64A 3I33A 4ED0A 2NXCA 1CJUA 1G4CA 1WG4A 1WHVA 4TY9A 2E1RA 4FK2A 3QLHA 3SJJA 2M8HA 1HNZK 2F8MA 3PRBA 8AT1B 1Q8KA 4FM0A 2XG8A 3I5BA 2KG1A 5T7BA 4Q7AA 1NM1A 4BR9A 3EWGA 4OI3A 1WDTA 4QWDA 1U09A 2DR7A 1HJOA 4WKRA 3UDVA 1CEZA 3M8PB 1HRHA 4GV6A 2LQJA 1SC6A 4P52A 4AF1A 2ACYA 5FJ4A 4FF1A 2ZE2B 1NRKA 4DFKA 3HSCA 4B3RK 3FSYA 1ATRA 2I2YA 2Q6BA 4YOYA 4B02A 4K8XA 3LPTA 3UDEA 4J2EA 4ZVEA 3J7AP 2R7WA 2EK1A 3QFWA 1RBSA 4CJEA 3GV7B 2ZJRQ 2R3VA 1HMVA 4D3HA 1WUAA 1S12A 1UFWA 1RU2A 1MN9A 2W01A 3OLBA 2HRUA 2Y1RI 2NYHA 4DR4K 1RBTA 4ETZA 4KB7A 3DRPB 3G4SS 4CJ4A 3TZXA 3AY0A 1RDWX 3WEEB 2IFXA 2J76E 4NMLA 2KFZA 1VQNN 1MWYA 3ZLJA 4H5WA 4USMA 1HPZA 2CZ4A 3CC4S 3OVSA 1GK8A 3KLIA 1ZBFA 4NO7A 1TL4A 4OYPA 4HTLA 2R7UA 3UI3A 5ETLA 1H2UX 4F4WA 1X4FA 3O8MA 3FGVA 2U2FA 2F65A 3PXGa 3OYCA 4OFZA 3VOVA 3OS0A 2XWXA 4EO8A 4BRNA 4IQXA 4EBDA 3THVA 5DMRA 5C25A 1S49A 2C28A 4BG8A 1S5ZA 2V52B 3EZOA 5AQVA 4LF6J 2V2QA 1QHTA 4KH5A 3VAKA 4RO0A 2BRLA 2YWKA 2WVEA 1EKRA 3GONA 3KJQB 4UOHA 5CAAA 2I1RA 3D4JA 3K9KA 2FVQA 4IR9A 3NG8A 1UEKA 1LEOA 1RDBA 3K58A 2CAJA 4A4JA 1FXDA 3EDQB 3MD1A 2VYPA 4EFHA 4EBEA 1O6XA 4DWIA 4DV6K 4YOWA 4CEOA 2ZGYA 4H4MB 4W5TA 2IRXA 3AJ2A 2IM2A 3BGLA 2WB1D 3ZSQA 2ZE2A 4AHTA 1YDLA 4IDHA 3PJ9A 5A8RA 2BJ8A 4BWJA 2DD8S 3M6VA 1WHXA 2HQDA 3KHGA 3L8BA 1RT5B 2DH9A 4WFZA 4O4RA 2VFUA 3DOKB 2HWTA 2IC3A 3ZSOA 3THPA 4FJJA 1T0TV 4DUZJ 1N52B 1LQ9A 3EYZA 4DF4A 2RRAA 1K8AO 4ANCA 2R7SA 3J7YI 4XDCA 5BR8K 1WSIA 1W2IA 3HFVA 1DQ8A 3LDQA 2NSCA 2XRIA 1Q9XA 3UW1A 1Q81T 3AO4A 2UUAF 4FM1A 4M5LA 4DSEA 2HQCA 4FVUA 2A40A 3AO1A 2CPEA 1VJQA 2O1PA 5B8HA 4BRKA 3ZZTA 1EETB 3SV3A 4BR5A 1TUWA 1XEZA 2KHDA 2LQ8A 3ILIA 5G4DA 4ZP7A 5J2QB 3NF6A 2DFHA 3L2UA 5ITHA 2B3TB 3DOMB 1FRMA 3VEOA 3D6TB 4KFBA 2FPHX 7FDRA 1S0OA 5HL7Q 5AQGA 4JRQA 1KRPA 4NLPA 5HMXA 2GEMA 4AXJA 3OTBA 1FEHA 1SKUB 4CEQA 2DEJA 2HSEB 3I0RA 1CJTB 3K57A 3BV8A 1IR2A 2HHXA 3FE1A 3I4HX 2RD5C 4DFMA 4NA1A 5DJBA 2BJDA 3NGIA 1RCHA 1GTHA 2AJFE 3NEKA 4AHSA 2GV9A 1I5OB 4H4MA 1OJ4A 1DTTB 3CDBA 1J5EF 6AT1B 1N34J 2RHKA 2GQQA 4OKJA 2QKKA 1BWFO 1N54B 4CLZA 2Q31A 3T19A 1Z6RA 4OLBA 3HHDA 3TU5A 3ZETB 2YKMB 4ZVTB 4RUCA 2MSTA 4FN5A 1KWMA 1NK9A 4M5HA 5LMNK 3QIPB 3UFCX 2YY3A 2AJQA 3NVMA 4DV0K 4JI1K 4URQU 4Q43A 3NXZA 4CO3A 1K1QA 4ECSA 4EFAC 2MY8A 5AT1B 4ZPVR 1IBKF 1S6OA 2GX9A 3CJ1A 2FUG9 4DR1J 3NWGA 4LRBA 4LF9F 4P9SA 4RPFA 3FCHA 3VGTA 4TN2A 5GAGU 3SUPA 1JLFB 3KWGA 3AV9A 3C6AA 2K1RB 4FS2A 1Z1ZA 2ETJA 2G9OA 4QIFA 3ZZZA 2G4BA 4J9LA 4YR2A 3C65A 4CF2A 5ETOA 2BKNA 1D9AA 1TKDA 4P75A 2RJZA 4I56A 5KFTA 5D0EA 1EETA 1RDRA 3E66