3VA0A

Crystal structure of rnase t in complex with a di-nucleotide product (gg) with one mg in the active site
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
207
structure length
207
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/dna
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3va0A00
2FBVA 1S1XA 3MEGA 5CYMA 3S9HA 1LAVA 3DLEA 4F8RA 2KZZA 2XRIA 5I3UA 1VSLA 3DMJA 1KVBA 5CYQA 2G8WA 1TKZA 3ZSOA 3NF8A 3ZT1A 4ICLA 2KW4A 1WSHA 2DTUA 4CERA 4FZZA 3DRSA 1VSDA 4KREA 3ULDA 1UWBA 2RF2A 1TVRA 4B9VA 4KI6A 1REVA 4KHUA 5HRRA 4CGDA 4YFUA 1LV5A 5HBMA 1ZBFA 4MQ3A 3OYBA 1B92A 3EZ5A 4BDZA 3AVMA 3KLEA 4JRPA 3D0PA 2D0AA 2QXFA 4DQRA 4M3ZA 4O5BA 1RBVA 4DSFA 2ATQA 3LDSA 4GW6A 4W5OA 3JSMA 4FJKA 1RTJA 4DTUA 1J9AA 5HP1A 1NKEA 4DU3A 3TWHA 3WNEA 1XHXA 1BL3A 4LSLA 1CXQA 3C6TA 1ZBUA 4FJIA 2G8KA 4CEZA 3KK2A 3S3MA 4W5RA 1EETA 1WSEA 5FROA 4E19A 3V1OA 3OJSA 3QEPA 4K8XA 2HVIA 5J2NA 4C8NA 1EP4A 4FLXA 2QK9A 2HHXA 3ZT3A 4N5SA 1C0UA 1T7PA 1J54A 4IFYA 4M3YA 1YTUA 1TAUA 3SPZA 1JLAA 1HRHA 3T3FA 3V6DA 1IKWA 1B9DA 1JXBA 4HUGA 5FRNA 4Z4GA 3V1RA 4DSKA 4LH5A 1ZBIA 4G1QA 4TSXA 4M45A 4H8KA 2HNZA 3TR8A 1RBUA 4H4MA 4DF4A 3LANA 3F73A 4FLYA 1BI4B 3O4QA 4CFBA 1J5OA 3ITHA 4CGFA 3SJJA 3AO1A 1C0TA 1VSIA 3RMBA 3KLHA 4R5PA 3KK3A 4Z4HA 5KTQA 4KHYA 3QNOA 4AHTA 4ZHRA 3OS2A 3CG7A 4DU1A 4QOZB 2E6LA 2BGGA 3RMCA 3OVNA 3V9XA 4Z4CA 3PO4A 4BDPA 4IDKA 1BIUA 1HPZA 2RN2A 3C95A 4CJUA 2IC3A 3CM6A 2XY7A 3TAQA 1UA0A 3RRGA 4Z4EA 3HK2A 1S1VA 4ELUA 1UAXA 3K58A 3SQ1A 3QEVA 3HL8A 3LWLA 1KVAA 3BGRA 4DLGA 1IKYA 5HRPA 2Y1JA 1GOBA 1QS4A 4B9UA 1EX4A 1LWCA 4BDYA 2DFEA 2IOCA 2PZSA 2LSNA 1HYSA 4FM1A 3SUNA 2B5JA 3A2FA 3DRPA 4BWJA 3ZSQA 1N6QA 1KLMA 4JS5A 3V9ZA 1VSJA 2XY8A 4DLEA 2JLEA 1ZBLA 3M8PA 1RT4A 2B6AA 3LALA 4IG3A 3ZSYA 1XWLA 3MEDA 4IFVA 4E3SA 2D5RA 3NF9A 4CEQA 4CJVA 1BQMA 2YNIA 1IG9A 4O44A 3OYHA 1WN7A 1Q9YA 4ZTJA 4OGEA 4F2RA 4J2EA 1BQNA 1TKXA 1LWEA 3LP1A 1KRPA 3DLKA 3SZ2A 4RW8A 4OKKA 4AH9A 3NH0A 3TAGA 1RT7A 3OYEA 3LWMA 1A5VA 4FLZA 4DFJA 3SYZA 4CEAA 4Q0BA 1T05A 3AVFA 3K57A 1WAFA 2KQ2A 3KKRA 1EXQA 4CGIA 2X78A 5FDLA 2DFFA 2D0CA 5K14A 1FKPA 4BE0A 1QHTA 1QSLA 3L3UA 1TGOA 3TABA 4C8OA 3B6PA 2HW3A 3QEIA 1HYVA 2IDOA 4I9LA 4CEFA 3SQ0A 1WNSA 3SNNA 4DSLA 3AVJA 1ASVA 2YKNA 4HVJA 4CHQA 4M42A 3QETA 4Y1DA 1NJWA 4I9QA 5HRSA 1VRUA 1KCFA 1Q9XA 4E7IA 4FZYA 5KGXA 2OPQA 4DU4A 4BE1A 4CK2A 3M8RA 2EHGA 4KB0A 3V1QA 3L8BA 1TKTA 4CHOA 5J2MA 4FW2A 2HHSA 4EZ9A 3SUOA 3OYNA 1BIZA 3PV8A 2X6NA 4CEEA 1NK7A 3CFRA 1B9FA 1QSYA 1K6YA 3O3HA 4FJHA 1KFDA 1SL1A 4FZXC 1VSMA 3AVGA 3QINA 4H4OA 3VQ9A 3VQCA 2OPSA 3KLIA 3VQAA 4CJQA 3KJVA 4HTUA 1NK4A 2GBZA 3DOLA 4DQPA 3ZSRA 3THVA 1NKBA 1LWFA 1U04A 5CZ2A 4NYNA 1QE1A 3VQQA 4CJRA 3OYGA 4LH4A 3PUFA 4CIEA 3OY9A 4FJXA 3HXMA 1BCOA 3PY8A 2VG5A 1NJYA 5CZ1A 3QEXA 3ASMA 4RW7A 2PYLA 1RTIA 3P5JA 2RPIA 4CEOA 4CF1A 3BDPA 3LP0A 3CFPA 1NOZA 2G8VA 1S1WA 4PY5A 1KTQA 4FXDA 5E41A 4FYDA 4CF2A 4FJ5A 4C8LA 3NH1A 5JS1A 3AO4A 5T7BA 1UA1A 2EX3A 4FLUA 1SKWA 3DM2A 4FJLA 4KRFA 4ZTFA 4KV8A 1VRTA 2IS3A 1TK8A 3AVCA 4B8CA 4M3WA 1JXEA 1IKXA 2HHWA 3AA3A 4CFAA 2WONA 1I3AA 4O55A 4E7KA 4FVMA 4J2AA 3QERA 3LPUA 3T1AA 1VSEA 3RRHA 4FLVA 3V9WA 3O3GA 3K5MA 1U4BA 2VG7A 2GUIA 3JYTA 1X1PA 3EY1A 1F21A 1YVUA 5HRNA 3AVHA 3NGYA 1RBSA 3H08A 4DMNA 4Z4FA 4CJKA 1DTQA 3IG1A 1JL2A 1NK5A 1JLBA 1RDCA 3AVIA 2Z1IA 4IG0A 1ITGA 4HCCA 4RW6A 1JKHA 4J2DA 1MU2A 1RDDA 1NOYA 4FJ9A 4FCYA 2XHBA 1KFSA 1QSSA 3MAQA 3S3OA 4AHUA 4BACA 3HVTA 3VQ4A 4HUEA 1S5JA 3RTVA 4DS4A 2Y1IA 1TKDA 1ZYQA 3ZT4A 4CGGA 2B4JA 3T19A 3ZT2A 3NF6A 4KAZA 4FJ8A 5J2QA 3IS9A 4HUFA 3KD1E 4E89A 4FJMA 4DTJA 3IAYA 3SV4A 1W0HA 3C6UA 2R7YA 3HYFA 4F2SA 4LD0A 4OPJA 4I2PA 1RTDA 2BE2A 2FC0A 5KRSA 3K59A 1LW0A 2NUBA 1TK5A 3AVLA 3MECA 4CF0A 5J2PA 2Z1HA 3MXIA 1TV6A 3OYAA 3VQEA 4FJNA 3QESA 1RDAA 2P1JA 2P51A 3AA5X 1G15A 3CFOA 3OJUA 2BANA 1NK0A 3V81A 2OYQA 4KKOA 3SPYA 4DS5A 5DMRA 4CHPA 3NAEA 3ZSWA 3HPHA 3ZSVA 2F96A 4B9SA 4DFMA 3ZSXA 4DSEA 2FBXA 4EZ6A 4DTSA 3ALYA 4CHNA 4CCHA 1N5YA 2Z1GA 4DQQA 1WAJA 3NF7A 3RMDA 4OJRA 4GMJB 4BE2A 4CFDA 2XO7A 1I39A 4DFPA 1XC9A 4M41A 4OLAA 3L2VA 3MXJA 5DK5A 3AVAA 4FJ7A 4OKJA 4CJWA 4JLHA 4AHVA 4KHNA 1T03A 4OPKA 3LAKA 4YNQA 4CHYA 5KGWA 3VQ6A 3V9UA 1XHZA 2ZD1A 4N47A 1W9HA 3K2PA 3SUQA 3O4NA 3K5LA 1U49A 5SZTA 2X74A 2YHAA 4E1NA 4AILC 1RBRA 3OYCA 1KSPA 4DSJA 3HJFA 3NHGA 3NFAA 4W5TA 1R0AA 1X9MA 1JLFA 2OPRA 4QAGA 5C42A 2P5OA 4CECA 4EP4A 3CQ8A 3SI6A 1ZBHA 3HPOA 4FK2A 4CHZA 3ZT0A 3VN5A 4CJTA 4OKEA 5FRMA 3PX6A 4E7LA 2A1SA 3HSTB 3VQDA 3VQ8A 4CGJA 5CY4A 1NJZA 2ETJA 3CYMA 1GOCA 3FFIA 4CK1A 1RT6A 1S9GA 4I7FA 3VQ7A 1A5WA 2ITGA 4DF8A 4I2QA 3SCXA 1TK0A 2ZQBA 3U3GA 3OS1A 4JS4A 3P83D 2OPPA 3KK1A 1O1WA 1RT2A 1LAWA 3NE6A 1WSIA 4W5QA 1IO2A 4E7HA 4CJ4A 1SUQA 2OA8A 2Z1JA 3OYJA 4CK3A 3KLGA 2YNGA 4WE1A 1JLCA 2FBYA 4CGHA 4KHSA 3I8DA 3E01A 3DLBA 4B9NA 2Q3SA 1JLGA 2VG6A 4N41A 1RCHA 1T8EA 3SV3A 1HMVA 4CJFA 4CIGA 3RR7A 4KHQA 1BI4A 4FK4A 1WSJA 1TL3A 5HLFA 3NBPA 2A1RA 3OYKA 2HB5A 4OVLA 5SWMA 3NGIA 1IH7A 2HMIA 1J53A 1Y97A 2E6MA 3QEWA 5J1EA 1L3UA 4NCAA 3LP3A 3M8QA 4C8KA 1HQEA 2F8SA 1HQUA 3TAEA 2W42A 1RT3A 1HNVA 2PYJA 3K5OA 1GOAA 4KO0A 4DTNA 2F8TA 3U6FA 4F3OA 4DQIA 3I0RA 2I5JA 1RT5A 3TARA 3OYDA 4FM0A 3OYFA 3DOKA 4NYFA 4DFKA 1TL1A 3LZIA 3ZCMA 4Z0UA 4AHCA 1RNHA 3KLFA 2YNHA 3ISNC 4N76A 2VWJA 1D9FA 4JRQA 4FW1A 2HHUA 1U47A 2OZMA 2HNYA 4M3XA 3S3NA 1DTTA 1VSFA 1RBTA 4M3RA 3WNHA 3KD5E 2KZMA 3VQBA 2XY5A 3V9SA 3KKSA 4M3TA 2JGUA 1EKEA 1NK9A 5HROA 4DSIA 4NCBA 2GV9A 1RTHA 2ZE2A 1QTMA 4FLTA 1HJRA 2E4LA 1Z26A 1HNIA 1L3VA 4KTQA 1SV5A 4O4GA 1S1TA 1BISA 3NH2A 4FM2A 1NK6A 5C25A 3TI0A 4DG1A 1NKCA 3AO2A 3DLGA 4PA1A 4ELVA 1D9DA 3D45A 3DYAA 4CF8A 3L2UA 3G0ZA 4PUOA 4AHSA 2KFZA 3QIOA 5C24A 4B8AB 1SKRA 4CFCA 4N56A 3DLHA 3HT3A 2G8FA 4C8MA 2HHVA 2YV0X 2HNDA 3WNGA 3SQ4A 4KPYA 4FK0A 3QO9A 1C1CA 4W5NA 4KB1A 4Y1CA 1JLEA 3K5NA 4KFBA 4LSNA 1KVCA 1RDBA 3L2WA 3EYZA 3RWUA 3AO3A 3HP6A 4PWDA 1CZ9A 1VK0A 2FBTA 3DI6A 4CJEA 3QNNA 3MXMA 3VQ5A 5KRTA 1XI1A 3ZSZA 5EU7A 2BDPA 4DTMA 1KLNA 4AHRA 1ASUA 1S9EA 4Z4IA 4DTOA 4KTZA 3DRRA 3KTQA 3B6OA 3OYIA 4J2BA 3AV9A 1L3TA 1CLQA 4IKFA 2YNFA 2IGIA 3AA2A 1VSHA 4FLWA 3SUPA 2OZSA 4DTXA 3NGZA 2QKKA 1S1UA 2O4GA 3SQ2A 1L5UA 4ELTA 1TAQA 3HM9A 4KI4A 3OS0A 4Q5VA 5I42A 4L8RB 4OLBA 4B9MA 1D8YA 1FK9A 4ID5A 3M8SA 3I0SA 3AVBA 4GVMA 4E0DA 3NCIA 4F4KA 2DFHA 1BCMA 1CZBA 4O0JA 3WNFA 4CF9A 3VA3A 1U48A 4B3OA 3O3FA 2G8UA 5JS2A 3PX0A 2YHBA 4UQGA 2HHTA 1IKVA 3L3VA 4CESA 3HPGA 4CJSA 2D0BA 2WOMA 4K8ZA 1YT3A 1C1AA 4CIFA 4O0IA 4DTRA 1BGXT 1RT1A 1Q8IA 1C1BA 1CXUA 3LZJA 4B08A 4EP5A 2O4IA 5D3GA 2KTQA 4DTPA 3LP2A 1NJXA 2VWKA 1RILA 2X6SA 1SL0A 4E1MA 2XY6A 2G8IA 2QKBA 4BWMA 3G10A 2DY4A 3UIQA 3AA4A 1FKOA 4IBNA 4MFBA 3PO5A 2PY5A 3LPTA 2P5GA 1Z25A 4CJ5A 3RR8A 4FJGA 3IRXA 4HHTA 1JL1A 1SL2A 1S6PA 1WLJA 4XIUA 4B9TA 3AO5A 4E7JA 3V4IA 2G8HA 4CJPA 4B9LA 4DWIA 5KI6A 1FXXA 4FJJA 3TANA 4KHWA 1SKSA 4CEBA 2HVHA 3DLRA 1D5AA 2AJQA 1UOCA 3OYLA 1C6VA 1S6QA 3CM5A 3MEEA 3VQPA 3OYMA 3RMAA 3L2QA 4OGCA 1DLOA 3AVKA 4M3UA 4RW4A 1NK8A 4PQUA 4HCBA 1L3SA 4QCLA 3U3YA 1X9SA 2IAJA 3KIOA 3QLHA 3LAMA 1WSFA 4ID1A 3C94A 4F3TA 3F9KA 3TAMA 3L2RA 3AVNA 4RW9A 4RG8A 4CEDA 3TAFA 1JLQA 3QIPA 1LW2A 4CJLA 1HYZA 4CE9A 1X9WA 3TAPA 1WSGA 4KTWA 4LY7A 1YTAA 1QQCA 1A5XA 1C0MA 2YKMA 3HP9A 4CJ3A 1BHLA 2HHQA 2RKIA 3NDKA 1ASWA 2KFNA 3VA0A 3PX4A 1U45A 3HVRA 1VSKA 4NCGA 4DQSA 3HO1A 3P1GA
chains in the Genus database with same CATH superfamily
2KZZA 4AM6A 3S9HA 1LAVA 2W41A 4PKHA 1S3XA 1KVBA 2G8WA 3ZSOA 1WSHA 4FZZA 3DRSA 4KREA 1KQSM 4KHUA 5HRRA 4CGDA 4AQYK 1LV5A 3PLAA 4JAXA 4ILHA 3ZETB 4ISFA 3KLEA 3RSEB 4DB3A 5BR8K 3D2FA 3C6HA 2QXFA 1NMDA 1RBVA 5TKYA 3LDSA 4GW6A 3JSMA 1VQ5N 4DKWA 2P9KA 4DTUA 4CZFA 3THXA 4DU3A 3WNEA 1BL3A 4LSLA 4KHPK 1ZBUA 4FVUA 2G8KA 2V51B 1EETA 1WSEA 5FROA 4BQZA 2HVIA 3OJSA 4K8XA 5MLCQ 2HHXA 3N4PA 2YHWA 4JI4K 1J54A 4IFYA 1YTUA 1TAUA 1HRHA 1Z05A 3T3FA 1IKWA 1JXBA 4JI2K 2QW9A 4HUGA 2Q0UA 4LH5A 4TSXA 4M45A 4H8KA 3TR8A 3CMEN 2CH5A 3O4QA 5FLXO 1WOQA 1OH5A 3KLHA 5AQKA 4XH5A 3OS2A 2QA4N 1BUPA 1QQOA 2RN2A 3TAQA 4B1UB 4FXDA 3CM6A 5LJVA 3CMAN 4DLGA 5HRPA 3IMXA 4BRGA 3MN7A 3HZ6A 1LWCA 5AQGA 3UB5A 2PZSA 2LSNA 4FM1A 4BWJA 3ZSQA 4MLHA 4JS5A 1VSJA 3V9ZA 1RDUA 1P90A 4YORA 3TU5A 2KHOA 1V4TA 3MEDA 4IFVA 2WTUA 3CPWM 4IOCL 2YNIA 3ATUA 2Q97A 2O8EA 1LWEA 1KRPA 3DLKA 4OKKA 4AH9A 4BRFA 3C65A 1A5VA 4B9QA 3SYZA 3G25A 4CEAA 4Q0BA 1J6ZA 2KQ2A 5H1SQ 5F1XA 1EXQA 4JI8K 1NGHA 5AQJA 1TGOA 3CD6N 2HW3A 4WFNL 3QEIA 4L3QA 4I9LA 3THWB 1ASVA 4HVJA 2P9LB 3NVKA 3QETA 4Y1DA 1NJWA 3R3LA 3TSUA 5EXWA 4FWQA 3QDKA 5GIPA 4DUYK 4CZLA 1ZBSA 2P9SA 3V1QA 2HHSA 4EZ9A 3FZLA 4IXCA 2X6NA 1NK7A 4E1JA 2PBDA 1K6YA 1QSYA 3O3HA 2I7PA 1KFDA 3VQCA 1VSMA 2E20A 4H4OA 3QMLA 2OPSA 3VQAA 3MN9A 4NYNA 1OVQA 1QE1A 3VQQA 4CJRA 4LH4A 1QVGM 3PUFA 4CIEA 3OY9A 3HXMA 1BCOA 3PY8A 4H5WA 3QEXA 2UU9K 4RW7A 3U8XA 1X3NA 1EWQA 2BUPA 5KQDA 3LP0A 1NOZA 2G8VA 4LC9B 4JHDB 1SS6A 5E41A 3A0IX 3B8AX 4CF2A 3J7ZO 5JS1A 1UA1A 4FJLA 3ZX2A 4ZTFA 1VRTA 2IS3A 1TK8A 4M3WA 1IJJA 4H03B 2WONA 4O55A 4J2AA 4PL8A 5AZJA 5HL7L 2VQEK 4IDHA 3K5MA 5AQPA 3JYTA 4GV6A 3AVHA 2P9UA 3P31A 3IG1A 2O8DB 2FSKA 1S72N 3AVIA 2Z1IA 2NRTA 4J2DA 3MAQA 5TKWA 2Q31A 4HUEA 3VQ4A 1S5JA 1TKDA 4MLEA 3ZT4A 4CGGA 3H1QA 1JJ2M 3NF6A 4KAZA 3E9OA 3IS9A 2D1KA 5HOOA 1BO5O 2A5XA 1W0HA 4LD0A 3K59A 1TK5A 3TTFA 3MECA 4EIAA 3OYAA 3QESA 1RDAA 2P1JA 1NWKA 1ATSA 3CFOA 1NK0A 1W97L 4KKOA 3U9DA 3D2FB 3NAEA 3ZSWA 3HPHA 3CQYA 3WXKA 1X3MA 3VGKA 4NLBA 3GL1A 2BTFA 1GLAG 2P9KB 3ALYA 4CHNA 5KPZA 3THXB 3NF7A 2E8AA 3S41A 5DM6L 4BRDA 1NMNA 1Q81O 2XO7A 1I94K 1RFQA 2NRHA 1VQKN 4IO9L 4FWLA 3VERA 3OA9A 3H6EA 3MDQA 3WXLA 4AHVA 4KHNA 3Q7BA 3LAKA 4OPKA 1LOTB 3VQ6A 1XHZA 2ZD1A 4N47A 3K2PA 1Y64A 1U49A 4JKFA 4DSJA 3NFAA 1JLFA 2P5OA 5AQZA 3CHWA 4FK2A 4B1XB 3FZMA 1MWKA 3IUCA 1BDGA 4BR4A 4E7LA 1WB9A 2A1SA 3K9KA 3VQ8A 1S22A 1VQ4N 3LL3A 4FWKA 3CYMA 3FZFA 1S9GA 4I7FA 3VQ7A 2ITGA 3H3OB 4DF8A 1NG9A 2F9TA 3SCXA 2FLOA 3OS1A 4JS4A 3BUZB 3MX5A 1O1WA 1YF5L 4NLCA 3E9PA 1T6CA 1SUQA 4KHSA 2PFUA 1N32K 4B9NA 1JLGA 2VG6A 4N41A 4IWVA 3EE9A 3BF1A 4XH1A 4CJFA 4KHQA 1BI4A 5HLFA 1YXQA 3CQXA 3NGIA 4A59A 2O8EB 3QFUA 4PKIA 4DR4K 2E6MA 3SAGA 2F8SA 1HQUA 2PYJA 4DV4K 3U6FA 4F3OA 1NGAA 1BG3A 1RT5A 1TUYA 3DOKA 3ZCMA 4DV2K 5AQQA 5M1FA 2HNYA 1VSFA 4WF9L 1RBTA 3WNHA 4DR5K 3KKSA 1JCGA 1NK9A 2CGLA 5HROA 4G9ZA 2GV9A 1RTHA 2P9SB 2ZE2A 1L3VA 1HNIA 3CJBA 1S1TA 4DG1A 1NKCA 3LM9A 3DLGA 4ISGA 4ELVA 2KFZA 2F4VK 4A62A 3QIOA 1SKRA 3OBWA 4B3RK 4MDBA 3SQ4A 3HSCA 4DR3K 4W5NA 1JLEA 4JEPA 2IVNA 1K73O 2ZGYA 3EYZA 4DV5K 3AO3A 1VQON 4PWDA 1QQNA 2FBTA 2ZM6K 2QWNA 3VQ5A 3VEOA 3K9JA 5EU7A 4KBOA 4AHRA 3MN6A 4J2BA 2O8FA 2IGIA 2FF6A 1C0FA 4FLWA 3ULEA 4ELTA 3TPQA 5I42A 4L8RB 3TTDA 4BR5A 1FK9A 4OO1J 3AVBA 5AZJB 3NCIA 2DFHA 3WNFA 4UQGA 1XUPO 1IKVA 3L3VA 3HPGA 1YT3A 5BR9A 1BGXT 1CXUA 4EP5A 5D3GA 4DTPA 2VWKA 2X6SA 3ZETA 4E1MA 2G8IA 4IBNA 4OPAA 3LPTA 3I56N 4YOUA 1TUUA 3JXUA 1SL2A 1VQNN 4E7JA 4MO5A 4JI0K 4FJJA 2HVHA 5CHIA 3U4LA 2BH1A 2ZJPL 4FWSA 3VQPA 2YI1A 4OGCA 3VPZA 3AVKA 3ID8A 3HBTA 3U3YA 2IAJA 3LAMA 3J80O 4F3TA 1NU0A 3F9KA 3TAMA 4RG8A 3TAFA 1JLQA 1FJGK 1XC3A 2YKMA 1ATRA 3NDKA 1ASWA 3VA0A 2I7NA 4K0KK 1S1XA 4O8KA 1KAYA 2XRIA 4JV5K 4O5FA 4BRAA 1TKZA 3ZT1A 4CERA 1TVRA 2QWLA 4WQ4C 5IWAK 4MQ3A 3FZKA 3EZ5A 4BDZA 2E2NA 1Q82O 4CZHA 2ATQA 4W5OA 4FJKA 1H1VA 3W3DA 5HP1A 2P9NB 1Q7YO 3LDPA 2HBMA 4BC2A 1KC8O 3V1OA 5BPMA 4B3SK 4C8NA 1EP4A 3ZT3A 3R1XA 2HOEA 1C0UA 4FO0A 4H0VB 3SPZA 1JLAA 4Z4GA 1NGEA 1B9DA 3DWLA 4PKGA 3CJ7A 5E84A 4H4MA 3F73A 1BI4B 4MO4A 3THWA 4CFBA 1J5OA 3ITHA 4CGFA 3SJJA 2E2QA 2YJFA 1HNWK 3RMBA 3KK3A 4Z4HA 1NLVA 3QNOA 4ZHRA 3I8BA 1VQ7N 2BGGA 3V9XA 3C95A 3UKUA 2H3GX 4CJUA 2IC3A 1YAGA 3HK2A 3K58A 3QEVA 1IKYA 4K41A 1QS4A 4B9UA 4BDYA 3BY5A 3HOSA 3SUNA 2RE2A 3DRPA 1C0GA 3SMSA 1KLMA 3HTVA 4IG3A 2HF3A 4GKKK 5AQOA 5JMVA 1IG9A 5FPEA 4FWOA 2YX6A 4OGEA 4ZTJA 5LJWA 1VQ9N 5LY3A 1BQNA 4BG9A 5ELZA 4BQLA 4RW8A 1RT7A 3OYEA 5LMNK 1NGFA 4A5AA 2P9IA 3MX2A 3AARA 5JVGL 2X78A 5FDLA 5K14A 4BRIA 4B1ZA 3VF6A 3TABA 4PL7A 2IDOA 4QS7A 3SQ0A 4DSLA 3FFKB 4YHHK 3IDHA 4CHQA 4WYBA 3VGLA 1VRUA 1KCFA 5AQVA 5AQSA 2UUAK 4BROA 3SLCA 1Z6RA 2O8FB 4BVPA 4FSVA 3VTHA 1TKTA 3ULEB 1DT9A 3KHYA 3OYNA 1BIZA 2ASPA 1T44A 3PV8A 1B9FA 2OTJN 1NGJA 3ID6A 4HTUA 2GUPA 2GBZA 3VETA 3THVA 1NKBA 1LWFA 1U04A 3SBTA 4JNEA 3CJ1A 4DR6K 5CZ1A 2F7TA 3ASMA 1RTIA 2RPIA 4RTFD 3CFPA 1S1WA 4PY5A 1KTQA 4JYAK 3AO4A 4FLUA 2GTDA 4KV8A 5CE3A 4M63C 4LF5K 4B8CA 2HHWA 3J8AA 1IKXA 1G99A 3AA3A 4CFAA 1QQMA 4YOVA 4DCHA 3QERA 4GVEA 2GWKA 1BU6O 1QZ5A 4FWRA 3LPUA 3T1AA 2E5LK 4YOWA 4FLVA 3RRHA 3V9WA 1J5EK 3SJHA 3QBWA 1F21A 5HRNA 3NGYA 1NK5A 1RDCA 4LF7K 4IG0A 1ITGA 1JKHA 5JLHA 3P4IA 4DR2K 3AY9A 4DS4A 2B4JA 4FJ8A 3ZT2A 4BVOA 3T69A 5AQYA 5AJ3K 3IAYA 1HKGA 3C6UA 3HYFA 4F2SA 5C12A 3TTCA 3AVLA 2A3ZA 4JKDA 4JK8A 5EVZA 4YOTA 3VQEA 2GX9A 4FJNA 4LFBK 3P38A 2OYQA 2BANA 4DS5A 4YY3K 5DMRA 5BREA 4DFMA 4DTSA 3RVCA 1NJIO 1N5YA 1YI2N 1V4SA 3KWIA 2HBKA 4OJRA 5AQHA 1Q86O 4DR1K 5AZIA 1I39A 3KWGA 1XC9A 4FJ7A 2ASOA 3D6RA 2YHYA 1T03A 4YNQA 1VHXA 4IEIA 1W9HA 3IKMA 1KSPA 1RBRA 3EZWA 3OYCA 4LF8K 4QAGA 1YJWN 4CECA 4EP4A 3CQ8A 3SI6A 3HPOA 4XH4A 5AQFA 2QWPA 3VN5A 4OKEA 3PX6A 3UKRA 5AQUA 3O1WA 3HSTB 3VQDA 3WT0A 3UKUB 1NJZA 4AM7A 2ZF5O 4JI3K 1IBLK 3CCSN 4IJAA 3U3GA 2OPPA 5GAGP 4BR9A 1LAWA 3NE6A 3EE8A 4E7HA 2Z1JA 2JWKA 4H0XB 1VQLN 2Q3SA 4BRLA 3SV3A 2W40A 5E26A 3OYKA 1XMQK 4JKHA 1J53A 1Y97A 3QEWA 1YUWA 3TAEA 2W42A 3CC7N 4KO0A 5AQLA 2P9IB 3I0RA 2AA4A 1HJOA 3C7NA 3OYDA 4FM0A 4BGBA 2IIRA 1EO1A 3OYFA 1RNHA 4N76A 4JRQA 4FW1A 2WBNA 3S3NA 4YOXA 3KD5E 3V9SA 4FL9A 4NCBA 3C0BA 2E4LA 4JKCA 1EQYA 4C23A 4O4GA 1HNXK 1U2VB 3VEYA 1BISA 3NH2A 4FOIA 3N4QA 4JI1K 1D9DA 2NRWA 4CF8A 3L2UA 4PUOA 3G0ZA 4BR7A 4B8AB 4M7YA 1KD1O 4IEEA 3DLHA 4GNIA 4C8MA 4WCEL 3NMUA 2YV0X 3WNGA 5GINA 2HHVA 2IVOA 1W7AA 4KB1A 4QS8A 2VWBA 1KVCA 5GADP 3L2WA 1GLDG 4K25A 3G4SN 3HP6A 1CZ9A 3MXMA 3QNNA 3ENHA 3J81O 1XI1A 3PSFA 3MCPA 3ATVA 1ASUA 3CC2N 4DTOA 5DM7L 3B6OA 4I6MA 3OYIA 1IBKK 1CLQA 4IKFA 2YNFA 4B1WB 5C2FA 1VSHA 4DQ8A 1L5UA 1TAQA 4KI4A 4Q5VA 4B9MA 1D8YA 2WC9A 4DHYA 2UYTA 4GVMA 3H3NO 4EHUA 3CCLN 2VGNA 4O0JA 3VA3A 2G8UA 3KZBA 2HHTA 4CBXA 4K8ZA 4CIFA 4O0IA 4DTRA 2QWMA 1OH8A 3WQUA 3LP2A 4A2BA 1NJXA 1RILA 4K42A 4FPBA 2DY4A 1WBBA 3PO5A 2P5GA 4CJ5A 3IRXA 4HHTA 3BZCA 1GLEG 2P9NA 1MWMA 1NGGA 4B9LA 5KI6A 4CI6A 4UY8O 4M7XA 3MEEA 3CM5A 3RMAA 3MCAB 4BRCA 1NK8A 4PQUA 4HCBA 1L3SA 3KIOA 3M1FA 1WSFA 4ID1A 3L2RA 4JI5K 3AVNA 4RW9A 2QWOA 4CJLA 1HYZA 4CE9A 1WSGA 4KTWA 2V7YA 1YTAA 3EN9A 1C0MA 5BRFA 4Z94A 3PX4A 3P39A 4NCGA 2Q36A 5AZIB 3HO1A 2FBVA 1ATNA 3DLEA 1CZAN 5LL6Z 3Q7CA 3JAMO 1VSLA 2VCPA 2DTUA 4ICLA 2KW4A 3GE1A 4LF4K 3ULDA 4KI6A 1YHQN 1ZBFA 2OANA 3OYBA 3J7AP 3AVMA 3D0PA 4DQRA 3E1YA 4O5BA 4DSFA 3UKRB 4X62K 1J9AA 4JK7A 3TWHA 1XHXA 3O9TA 3M6GA 3CC4N 4U7BA 4CEZA 3S3MA 4W5RA 1YVNA 4E19A 3QEPA 4BG8A 3ENOA 4FLXA 2QK9A 1O13A 4N5SA 1HPMA 2ZJQL 4M3YA 3V6DA 4BRKA 4G1QA 3THYA 3WEEA 4FLYA 3AO1A 4J8FA 1ZXOA 4HWIA 4AHTA 4QOZB 4B1VA 3CG7A 4DU1A 1N34K 4Z4CA 3PO4A 1BIUA 2XY7A 3RRGA 4Z4EA 4CBUA 2P9PA 3SQ1A 2UUCK 3HL8A 3LWLA 1KVAA 1SAZA 2Y1JA 1GOBA 3C7NB 2QI2A 4IJNA 1HYSA 3LDLA 3WXIA 2B5JA 3A2FA 1N6QA 5GAHP 2XY8A 2V52B 4DV7K 1RT4A 2EWSA 3LALA 3ZSYA 1XWLA 4E3SA 3NF9A 4CEQA 1BQMA 1ILYA 1WN7A 2CH6A 1Q9YA 4F2RA 3G6EN 5BN8A 1TKXA 3LP1A 3DLLL 3A5MC 2NZTA 3NH0A 3LWMA 3CCRN 3FR0A 4BC4A 1NGDA 3SK3A 4FLZA 1N8RO 3K57A 1WAFA 5ADXH 5ADXA 3KKRA 3AGRA 2AP1A 1FKPA 1QSLA 2D0OA 3L3UA 4DUZK 4H0TB 3B6PA 3SNNA 3I55N 5JVHL 3I33A 4BC5A 4I9QA 5HRSA 4E7IA 4FZYA 5KGXA 4DU4A 4I6MB 1OKJA 4WFBL 2DPNA 2CGJA 4CK2A 3QFPA 5GIOA 2EHGA 4KB0A 3L8BA 4CHOA 4FW2A 4JI6K 5AQRA 4B3TK 3O4WA 3QB0A 4NXNK 4CEEA 3E9LA 4FWNA 2FSNA 3CFRA 4FJHA 4FZXC 3VQ9A 3FGUA 3KJVA 3KLIA 4A57A 4DQPA 3CJCA 1GLLO 3DOLA 3ZSRA 1HNZK 2O8BA 2VGMA 3OYGA 4FJXA 4JD2A 2VG5A 4X66K 1NJYA 5M1NA 2YJEA 3P5JA 4CEOA 2ZGZA 3L6QA 4JKBA 1ESVA 4FYDA 4FJ5A 4C8LA 4FWMA 3DM2A 4KRFA 3SAFA 2HSTA 4BREA 1HKBA 4E7KA 4FVMA 4CZGA 4CD1A 4JKGA 1VSEA 2FF3B 3O3GA 2GUIA 3SAHA 3VEXA 1YVUA 3VGMA 1RBSA 3H08A 4DMNA 4CJKA 4GV3A 1JLBA 5BPLA 4HCCA 4ILGB 4CJ7A 3U9ZA 1RDDA 4FJ9A 1RDWX 4FCYA 2XHBA 1KFSA 1QSSA 3S3OA 1QVFM 4BACA 3HVTA 2Y1IA 3RTVA 1ZYQA 2PAVA 2HBLA 5J2QA 3KD1E 4E89A 5JLFA 3CF5L 5C0YA 4KH5A 3SV4A 3EO3A 3A8YA 2R7YA 4CZIA 2BE2A 2QWQA 5KRSA 2HHHK 2NUBA 2W6KA 4CF0A 2Z1HA 3MXIA 3LDOA 1G15A 3V81A 1FW6A 4BRQA 5F2RA 4CHPA 3H1VX 1DEJA 4DSEA 4EZ6A 2GELA 4CCHA 3DXMA 2Z1GA 5BRHA 1WAJA 5AR0A 3RMDA 4H5NA 4CFDA 1U6ZA 3CCEN 3L2VA 3PIPL 3O08A 4CJWA 4JLHA 1K8AO 3WXMB 3M5RA 3SUQA 3O4NA 3K5LA 3THYB 3WEEB 2X74A 4AILC 3NHGA 4W5TA 1R0AA 1VQ8N 2OPRA 5C42A 1ZBHA 4RWTA 3SBGA 3ZT0A 1HKCA 4CJTA 4DV6K 5FRMA 2VYPA 4H0PA 2UXBK 3L4QA 4WQ5A 5CY4A 2OCEA 4IZ9A 1U2VA 1GOCA 3FFIA 4CK1A 1RT6A 2P9PB 1N33K 3CCQN 1A5WA 1TK0A 2ZQBA 2E1ZA 2GWJA 3P83D 3KK1A 5M1PA 3M3ZA 1XNQK 1RT2A 1OVYA 1WSIA 4W5QA 1IO2A 3O8MA 4KH4A 2OA8A 3CIPA 3KLGA 2YNGA 1JLCA 3C6AA 4A5BA 3E01A 2CGKA 3DLBA 4CIGA 4FK4A 1WSJA 3HRGA 4WQ5C 2A1RA 2HB5A 2QM1A 5SWMA 4C1NI 1IBMK 3VEZA 5J1EA 2UXDK 3WXJA 2NRZA 1HQEA 1RT3A 2UUBK 3ENBA 1GOAA 4DTNA 3FZHA 3TARA 2ZWHA 4NYFA 3VEWA 1TL1A 2HF4A 2HMPA 5KQ8A 2YNHA 3ISNC 3JS6A 2VWJA 1D9FA 2HHUA 3CJAA 1U47A 2OZMA 4M3XA 1DTTA 3D2EA 4M3RA 2XY5A 4DSIA 3LDNA 2OTLN 3T1YK 4BC3A 4OX9K 4KTQA 1SV5A 1Q18A 1K8KA 1NK6A 4PA1A 3AAPA 1N36K 3L0QA 4AHSA 5C24A 4N56A 4BGAA 4Y0WA 2G8FA 1VQ6N 2HNDA 4FK0A 2O8BB 4Y1CA 4BY9C 3DXKA 3K5NA 1XQSC 4KFBA 4LSNA 3VENA 4JD2B 4K43A 2NLXA 4DV1K 1R59O 3DI6A 3PSIA 3WQTA 5KRTA 3ZSZA 2BDPA 1KLNA 4BRHA 3KTQA 3SMPA 1L3TA 4DR7K 3AA2A 5FPMA 1KAXA 4CZEA 2A40A 1IV0A 4DTXA 2O4GA 5KPRA 1OH7A 3HM9A 4H0YB 3OS0A 4OLBA 4ID5A 3M8SA 3W0LA 4JKGB 4BRPA 4F4KA 4V19S 1E4GT 1BCMA 4B3OA 4CF9A 3WUHA 1U48A 3A5LC 1BWFO 2YHBA 4CJSA 2D0BA 2WOMA 1BA1A 1MDUB 2O4IA 4NB4A 3G71N 4LFAK 2JWLA 5M1QA 1SL0A 2E88A 4BWMA 3G10A 2D4WA 4MFBA 4H5RA 3DJCA 3HM8A 3RR8A 3VTIA 1S6PA 4XIUA 2QXLA 3AO5A 4JI7K 3T7ZA 4NO7A 3TANA 1SKSA 1D5AA 5M1OA 1JCEA 3AAQA 1C6VA 1DGKN 4YOYA 3OTOK 3OHRA 3OYMA 1NGIA 4QCLA 1X9SA 3QLHA 3C94A 3R9PA 3D7EO 1KAZA 1QZ6A 1M90O 3TAPA 2RHKA 5AQTA 3DXMB 1A5XA 5C15A 3HP9A 2RKIA 3FLCO 3VF2A 1YJ9N 4CZJA 3HVRA 3P1GA 3O6WA 4F8RA 3MEGA 5CYMA 1KXPA 2WFBA 5LMUK 5I3UA 3DMJA 5CYQA 1T3VA 4BRNA 4FPAA 3NF8A 4O8UA 3R6MA 3VF4A 2O8CA 1VSDA 3J7YP 1X9JA 1UWBA 2RF2A 1DKGD 3ZX3A 4B9VA 1REVA 4KH6A 4YFUA 5HBMA 2F9WA 3BP8A 3VESA 2ASMA 1B92A 4A61A 4JRPA 2D0AA 4B1YB 4M3ZA 1RTJA 1ZC6A 3GOIA 1NKEA 2WUSA 3EL2A 2E1YA 1CXQA 3C6TA 4FJIA 2NNWA 3KK2A 3QBXA 5J2NA 1GLCG 3TSQA 2UXCK 1T7PA 3F5TA 5FRNA 3V1RA 4DSKA 1ZBIA 2HNZA 1RBUA 4JK9A 4DF4A 3LANA 3MWTA 1GLJO 1NNEA 1C0TA 1TYQA 1VSIA 3GDQA 2E2OA 4R5PA 2A41A 3O5BA 4CBWA 1BA0A 4XEIA 1HUXA 5KTQA 1HR0K 1SZ2A 4KHYA 2E6LA 2W6LA 3RMCA 3OVNA 3CCMN 4BDPA 1NGCA 4IDKA 1HPZA 1UA0A 3F9MA 2Q1NA 3L4IA 5BPNA 1S1VA 4ELUA 1UAXA 3BGRA 3CPEA 4IOXA 4H5TA 1EX4A 3PIOL 2DFEA 2IOCA 3ZEUA 4U67L 2NRRA 1RGIA 4OPHA 1LCUA 2ITMA 4EFHA 4DLEA 2JLEA 1ZBLA 3M8PA 3HOTA 3D2EB 3ZX0A 2B6AA 3E66A 1VQPN 2D5RA 4CJVA 5C2DA 4O44A 3OYHA 3O9UA 4J2EA 2HBJA 1K8KB 3DAWA 3SZ2A 3TAGA 4DFJA 1T05A 3AVFA 3O80A 1VQMN 3IFRA 4HTLA 3TSPA 3DXKB 5F0XA 2E2PA 4CGIA 1E4FT 3O9QA 4IOAL 2DFFA 2D0CA 3MN5A 4BE0A 1QHTA 4C8OA 1HYVA 4CEFA 3CCUN 1XMOK 1WNSA 4GY2B 3AVJA 2FSJA 2YKNA 4M42A 1Q9XA 2OPQA 5AQXA 4CW7B 4BE1A 4BR2A 3M8RA 3CCJN 5J2MA 5I9EB 3SUOA 1YIJN 3H46O 1HX1A 5EOYA 3K0SA 4RCHA 5AQWA 4JKAA 1SL1A 3GG4A 4ILJA 3AVGA 3QINA 4GKJK 4CJQA 1NK4A 5CZ2A 3R8EA 3UE5A 2QWRA 3ZYYX 2PYLA 4CF1A 5M1KA 5AFUH 3BDPA 5AFUA 2VQFK 3NH1A 1QHAA 4GV9A 5T7BA 2EX3A 1SKWA 5KPTA 2YCHA 3GBTA 3AVCA 1JXEA 1I3AA 2KLAA 1NGBA 4X64K 1U4BA 2VG7A 1X1PA 3EY1A 4LFCK 1YJNN 3BZKA 3KVGA 4FWPA 3OBYA 4Z4FA 4CZMA 1DTQA 1JL2A 4JN4A 1SQKA 4RW6A 4C1NK 1MU2A 1NOYA 2FXUA 1M1KO 4AHUA 3O9RA 3T19A 2KKZA 3NVMA 4HUFA 4FJMA 4DTJA 2O8CB 4OPJA 4I2PA 1RTDA 2FC0A 3VOVA 3ZLJA 1LW0A 3H45C 4PHTX 5J2PA 1TV6A 5AQNA 2P51A 3AA5X 3OJUA 1T6DA 3VMFB 3CETA 4WFAL 3SPYA 3ZSVA 2F96A 4B9SA 3ZSXA 2FBXA 3BEXA 2YHXA 4DQQA 4GMJB 4BE2A 2NRXA 1GLFO 4DFPA 4OLAA 4M41A 3LM2A 3EEQA 3MXJA 3AVAA 5DK5A 4OKJA 4X65K 4JKEA 4CHYA 5KGWA 3V9UA 5A2QO 2P9UB 5SZTA 4E1NA 2YHAA 3CCVN 3HJFA 1X9MA 4AF1A 1TYQB 3RSEA 2D0PA 4EHTA 4CHZA 1WUAA 3O9SA 4IFEA 3FE1A 5FPDA 4CGJA 2ETJA 2Q0RA 3CI5A 2ZJRL 4I2QA 2A42A 4LF6K 3O1BA 3ZEUB 4CJ4A 3OYJA 4CK3A 1VAZA 4WE1A 2FBYA 2A6AA 4CGHA 1K9MO 3I8DA 2V7ZA 1GLBG 4BR0A 3MWPA 1RCHA 1T8EA 4WQ4A 1HMVA 1EWRA 4H0OA 5BRDA 3RR7A 2QEXN 1TL3A 3NBPA 2Q2RA 4OVLA 4NXMK 1IH7A 2HMIA 1L3UA 4NCAA 3LP3A 3M8QA 4C8KA 1E3MA 1HNVA 3K5OA 2F8TA 4DQIA 2I5JA 2IVPA 3KK7A 4DFKA 1JCFA 3LZIA 4AHCA 4Z0UA 3AGKA 2J4RA 3KLFA 1XNRK 1IG8A 2KZMA 3VQBA 4R79A 4M3TA 2JGUA 4FOEA 3A5OC 1EKEA 4B3MK 1QTMA 4FLTA 1HJRA 1Z26A 3BF3A 4FM2A 4IO8A 5C25A 4YDUA 3TI0A 5EY4A 3AO2A 3MK6A 3EKSA 3D45A 3DYAA 1BOTO 4CFCA 3HT3A 4KPYA 1MA9B 3QO9A 1C1CA 1RDBA 1D4XA 3RWUA 3CXCM 3OW2M 4F9OA 1YITN 1VK0A 4CJEA 2P9LA 5C10A 4DTMA 1S9EA 4Z4IA 4KTZA 4YDUC 3DRRA 5GAEP 3AV9A 1NM1A 4BRMA 5IT9O 3SUPA 2OZSA 1NBWA 2QKKA 3NGZA 1S1UA 5AQMA 3SQ2A 4H5VA 5EX5A 1W2BM 3HI0A 5B8HA 4DV0K 4DV3K 3I0SA 4E0DA 3A5NC 3MMVA 2NRVA 1CZBA 3QICA 3O3FA 5JS2A 3PX0A 4CESA 4QS9A 1C1AA 4A2AA 1RT1A 1Q8IA 1C1BA 4EAHD 3LZJA 4B08A 2KTQA 4CD3A 2XY6A 2QKBA 3EKUA 4JHDA 3UIQA 3AA4A 3LDQA 1FKOA 5BN9A 4CVNE 4MDAA 2PY5A 5CR4A 1Z25A 5AQIA 3VEVA 1OH6A 4FJGA 2QTDA 1JL1A 1WLJA 5FPNA 4B9TA 3T1HK 3V4IA 2G8HA 4CJPA 4DWIA 1FXXA 4KHWA 1WBDA 4CEBA 2AJQA 3DLRA 1UOCA 3OYLA 1S6QA 3L2QA 1DLOA 4M3UA 4LF9K 4RW4A 1P8ZA 3F2KA 3CJ9A 4CEDA 2O8DA 3QIPA 1LW2A 2GEMA 4ISEA 4CZKA 1X9WA 4LY7A 1QQCA 4CJ3A 1BHLA 2HHQA 2KFNA 5JICA 1U45A 4DQSA 1VSKA 3CERA 1HLUA
chains in the Genus database with same CATH topology
2FBVA 1S1XA 3MEGA 5CYMA 3S9HA 1LAVA 3DLEA 4F8RA 2KZZA 2XRIA 5I3UA 1VSLA 3DMJA 1KVBA 5CYQA 2G8WA 1TKZA 3ZSOA 3NF8A 3ZT1A 4ICLA 2KW4A 1WSHA 2DTUA 4CERA 4FZZA 3DRSA 1VSDA 4KREA 3ULDA 1UWBA 2RF2A 1TVRA 4B9VA 4KI6A 1REVA 4KHUA 5HRRA 4CGDA 4YFUA 1LV5A 5HBMA 1ZBFA 4MQ3A 3OYBA 1B92A 3EZ5A 4BDZA 3AVMA 3KLEA 4JRPA 3D0PA 2D0AA 2QXFA 4DQRA 4M3ZA 4O5BA 1RBVA 4DSFA 2ATQA 3LDSA 4GW6A 4W5OA 3JSMA 4FJKA 1RTJA 4DTUA 1J9AA 5HP1A 1NKEA 4DU3A 3TWHA 3WNEA 1XHXA 1BL3A 4LSLA 1CXQA 3C6TA 1ZBUA 4FJIA 2G8KA 4CEZA 3KK2A 3S3MA 4W5RA 1EETA 1WSEA 5FROA 4E19A 3V1OA 3OJSA 3QEPA 4K8XA 2HVIA 5J2NA 4C8NA 1EP4A 4FLXA 2QK9A 2HHXA 3ZT3A 4N5SA 1C0UA 1T7PA 1J54A 4IFYA 4M3YA 1YTUA 1TAUA 3SPZA 1JLAA 1HRHA 3T3FA 3V6DA 1IKWA 1B9DA 1JXBA 4HUGA 5FRNA 4Z4GA 3V1RA 4DSKA 4LH5A 1ZBIA 4G1QA 4TSXA 4M45A 4H8KA 2HNZA 3TR8A 1RBUA 4H4MA 4DF4A 3LANA 3F73A 4FLYA 1BI4B 3O4QA 4CFBA 1J5OA 3ITHA 4CGFA 3SJJA 3AO1A 1C0TA 1VSIA 3RMBA 3KLHA 4R5PA 3KK3A 4Z4HA 5KTQA 4KHYA 3QNOA 4AHTA 4ZHRA 3OS2A 3CG7A 4DU1A 4QOZB 2E6LA 2BGGA 3RMCA 3OVNA 3V9XA 4Z4CA 3PO4A 4BDPA 4IDKA 1BIUA 1HPZA 2RN2A 3C95A 4CJUA 2IC3A 3CM6A 2XY7A 3TAQA 1UA0A 3RRGA 4Z4EA 3HK2A 1S1VA 4ELUA 1UAXA 3K58A 3SQ1A 3QEVA 3HL8A 3LWLA 1KVAA 3BGRA 4DLGA 1IKYA 5HRPA 2Y1JA 1GOBA 1QS4A 4B9UA 1EX4A 1LWCA 4BDYA 2DFEA 2IOCA 2PZSA 2LSNA 1HYSA 4FM1A 3SUNA 2B5JA 3A2FA 3DRPA 4BWJA 3ZSQA 1N6QA 1KLMA 4JS5A 3V9ZA 1VSJA 2XY8A 4DLEA 2JLEA 1ZBLA 3M8PA 1RT4A 2B6AA 3LALA 4IG3A 3ZSYA 1XWLA 3MEDA 4IFVA 4E3SA 2D5RA 3NF9A 4CEQA 4CJVA 1BQMA 2YNIA 1IG9A 4O44A 3OYHA 1WN7A 1Q9YA 4ZTJA 4OGEA 4F2RA 4J2EA 1BQNA 1TKXA 1LWEA 3LP1A 1KRPA 3DLKA 3SZ2A 4RW8A 4OKKA 4AH9A 3NH0A 3TAGA 1RT7A 3OYEA 3LWMA 1A5VA 4FLZA 4DFJA 3SYZA 4CEAA 4Q0BA 1T05A 3AVFA 3K57A 1WAFA 2KQ2A 3KKRA 1EXQA 4CGIA 2X78A 5FDLA 2DFFA 2D0CA 5K14A 1FKPA 4BE0A 1QHTA 1QSLA 3L3UA 1TGOA 3TABA 4C8OA 3B6PA 2HW3A 3QEIA 1HYVA 2IDOA 4I9LA 4CEFA 3SQ0A 1WNSA 3SNNA 4DSLA 3AVJA 1ASVA 2YKNA 4HVJA 4CHQA 4M42A 3QETA 4Y1DA 1NJWA 4I9QA 5HRSA 1VRUA 1KCFA 1Q9XA 4E7IA 4FZYA 5KGXA 2OPQA 4DU4A 4BE1A 4CK2A 3M8RA 2EHGA 4KB0A 3V1QA 3L8BA 1TKTA 4CHOA 5J2MA 4FW2A 2HHSA 4EZ9A 3SUOA 3OYNA 1BIZA 3PV8A 2X6NA 4CEEA 1NK7A 3CFRA 1B9FA 1QSYA 1K6YA 3O3HA 4FJHA 1KFDA 1SL1A 4FZXC 1VSMA 3AVGA 3QINA 4H4OA 3VQ9A 3VQCA 2OPSA 3KLIA 3VQAA 4CJQA 3KJVA 4HTUA 1NK4A 2GBZA 3DOLA 4DQPA 3ZSRA 3THVA 1NKBA 1LWFA 1U04A 5CZ2A 4NYNA 1QE1A 3VQQA 4CJRA 3OYGA 4LH4A 3PUFA 4CIEA 3OY9A 4FJXA 3HXMA 1BCOA 3PY8A 2VG5A 1NJYA 5CZ1A 3QEXA 3ASMA 4RW7A 2PYLA 1RTIA 3P5JA 2RPIA 4CEOA 4CF1A 3BDPA 3LP0A 3CFPA 1NOZA 2G8VA 1S1WA 4PY5A 1KTQA 4FXDA 5E41A 4FYDA 4CF2A 4FJ5A 4C8LA 3NH1A 5JS1A 3AO4A 5T7BA 1UA1A 2EX3A 4FLUA 1SKWA 3DM2A 4FJLA 4KRFA 4ZTFA 4KV8A 1VRTA 2IS3A 1TK8A 3AVCA 4B8CA 4M3WA 1JXEA 1IKXA 2HHWA 3AA3A 4CFAA 2WONA 1I3AA 4O55A 4E7KA 4FVMA 4J2AA 3QERA 3LPUA 3T1AA 1VSEA 3RRHA 4FLVA 3V9WA 3O3GA 3K5MA 1U4BA 2VG7A 2GUIA 3JYTA 1X1PA 3EY1A 1F21A 1YVUA 5HRNA 3AVHA 3NGYA 1RBSA 3H08A 4DMNA 4Z4FA 4CJKA 1DTQA 3IG1A 1JL2A 1NK5A 1JLBA 1RDCA 3AVIA 2Z1IA 4IG0A 1ITGA 4HCCA 4RW6A 1JKHA 4J2DA 1MU2A 1RDDA 1NOYA 4FJ9A 4FCYA 2XHBA 1KFSA 1QSSA 3MAQA 3S3OA 4AHUA 4BACA 3HVTA 3VQ4A 4HUEA 1S5JA 3RTVA 4DS4A 2Y1IA 1TKDA 1ZYQA 3ZT4A 4CGGA 2B4JA 3T19A 3ZT2A 3NF6A 4KAZA 4FJ8A 5J2QA 3IS9A 4HUFA 3KD1E 4E89A 4FJMA 4DTJA 3IAYA 3SV4A 1W0HA 3C6UA 2R7YA 3HYFA 4F2SA 4LD0A 4OPJA 4I2PA 1RTDA 2BE2A 2FC0A 5KRSA 3K59A 1LW0A 2NUBA 1TK5A 3AVLA 3MECA 4CF0A 5J2PA 2Z1HA 3MXIA 1TV6A 3OYAA 3VQEA 4FJNA 3QESA 1RDAA 2P1JA 2P51A 3AA5X 1G15A 3CFOA 3OJUA 2BANA 1NK0A 3V81A 2OYQA 4KKOA 3SPYA 4DS5A 5DMRA 4CHPA 3NAEA 3ZSWA 3HPHA 3ZSVA 2F96A 4B9SA 4DFMA 3ZSXA 4DSEA 2FBXA 4EZ6A 4DTSA 3ALYA 4CHNA 4CCHA 1N5YA 2Z1GA 4DQQA 1WAJA 3NF7A 3RMDA 4OJRA 4GMJB 4BE2A 4CFDA 2XO7A 1I39A 4DFPA 1XC9A 4M41A 4OLAA 3L2VA 3MXJA 5DK5A 3AVAA 4FJ7A 4OKJA 4CJWA 4JLHA 4AHVA 4KHNA 1T03A 4OPKA 3LAKA 4YNQA 4CHYA 5KGWA 3VQ6A 3V9UA 1XHZA 2ZD1A 4N47A 1W9HA 3K2PA 3SUQA 3O4NA 3K5LA 1U49A 5SZTA 2X74A 2YHAA 4E1NA 4AILC 1RBRA 3OYCA 1KSPA 4DSJA 3HJFA 3NHGA 3NFAA 4W5TA 1R0AA 1X9MA 1JLFA 2OPRA 4QAGA 5C42A 2P5OA 4CECA 4EP4A 3CQ8A 3SI6A 1ZBHA 3HPOA 4FK2A 4CHZA 3ZT0A 3VN5A 4CJTA 4OKEA 5FRMA 3PX6A 4E7LA 2A1SA 3HSTB 3VQDA 3VQ8A 4CGJA 5CY4A 1NJZA 2ETJA 3CYMA 1GOCA 3FFIA 4CK1A 1RT6A 1S9GA 4I7FA 3VQ7A 1A5WA 2ITGA 4DF8A 4I2QA 3SCXA 1TK0A 2ZQBA 3U3GA 3OS1A 4JS4A 3P83D 2OPPA 3KK1A 1O1WA 1RT2A 1LAWA 3NE6A 1WSIA 4W5QA 1IO2A 4E7HA 4CJ4A 1SUQA 2OA8A 2Z1JA 3OYJA 4CK3A 3KLGA 2YNGA 4WE1A 1JLCA 2FBYA 4CGHA 4KHSA 3I8DA 3E01A 3DLBA 4B9NA 2Q3SA 1JLGA 2VG6A 4N41A 1RCHA 1T8EA 3SV3A 1HMVA 4CJFA 4CIGA 3RR7A 4KHQA 1BI4A 4FK4A 1WSJA 1TL3A 5HLFA 3NBPA 2A1RA 3OYKA 2HB5A 4OVLA 5SWMA 3NGIA 1IH7A 2HMIA 1J53A 1Y97A 2E6MA 3QEWA 5J1EA 1L3UA 4NCAA 3LP3A 3M8QA 4C8KA 1HQEA 2F8SA 1HQUA 3TAEA 2W42A 1RT3A 1HNVA 2PYJA 3K5OA 1GOAA 4KO0A 4DTNA 2F8TA 3U6FA 4F3OA 4DQIA 3I0RA 2I5JA 1RT5A 3TARA 3OYDA 4FM0A 3OYFA 3DOKA 4NYFA 4DFKA 1TL1A 3LZIA 3ZCMA 4Z0UA 4AHCA 1RNHA 3KLFA 2YNHA 3ISNC 4N76A 2VWJA 1D9FA 4JRQA 4FW1A 2HHUA 1U47A 2OZMA 2HNYA 4M3XA 3S3NA 1DTTA 1VSFA 1RBTA 4M3RA 3WNHA 3KD5E 2KZMA 3VQBA 2XY5A 3V9SA 3KKSA 4M3TA 2JGUA 1EKEA 1NK9A 5HROA 4DSIA 4NCBA 2GV9A 1RTHA 2ZE2A 1QTMA 4FLTA 1HJRA 2E4LA 1Z26A 1HNIA 1L3VA 4KTQA 1SV5A 4O4GA 1S1TA 1BISA 3NH2A 4FM2A 1NK6A 5C25A 3TI0A 4DG1A 1NKCA 3AO2A 3DLGA 4PA1A 4ELVA 1D9DA 3D45A 3DYAA 4CF8A 3L2UA 3G0ZA 4PUOA 4AHSA 2KFZA 3QIOA 5C24A 4B8AB 1SKRA 4CFCA 4N56A 3DLHA 3HT3A 2G8FA 4C8MA 2HHVA 2YV0X 2HNDA 3WNGA 3SQ4A 4KPYA 4FK0A 3QO9A 1C1CA 4W5NA 4KB1A 4Y1CA 1JLEA 3K5NA 4KFBA 4LSNA 1KVCA 1RDBA 3L2WA 3EYZA 3RWUA 3AO3A 3HP6A 4PWDA 1CZ9A 1VK0A 2FBTA 3DI6A 4CJEA 3QNNA 3MXMA 3VQ5A 5KRTA 1XI1A 3ZSZA 5EU7A 2BDPA 4DTMA 1KLNA 4AHRA 1ASUA 1S9EA 4Z4IA 4DTOA 4KTZA 3DRRA 3KTQA 3B6OA 3OYIA 4J2BA 3AV9A 1L3TA 1CLQA 4IKFA 2YNFA 2IGIA 3AA2A 1VSHA 4FLWA 3SUPA 2OZSA 4DTXA 3NGZA 2QKKA 1S1UA 2O4GA 3SQ2A 1L5UA 4ELTA 1TAQA 3HM9A 4KI4A 3OS0A 4Q5VA 5I42A 4L8RB 4OLBA 4B9MA 1D8YA 1FK9A 4ID5A 3M8SA 3I0SA 3AVBA 4GVMA 4E0DA 3NCIA 4F4KA 2DFHA 1BCMA 1CZBA 4O0JA 3WNFA 4CF9A 3VA3A 1U48A 4B3OA 3O3FA 2G8UA 5JS2A 3PX0A 2YHBA 4UQGA 2HHTA 1IKVA 3L3VA 4CESA 3HPGA 4CJSA 2D0BA 2WOMA 4K8ZA 1YT3A 1C1AA 4CIFA 4O0IA 4DTRA 1BGXT 1RT1A 1Q8IA 1C1BA 1CXUA 3LZJA 4B08A 4EP5A 2O4IA 5D3GA 2KTQA 4DTPA 3LP2A 1NJXA 2VWKA 1RILA 2X6SA 1SL0A 4E1MA 2XY6A 2G8IA 2QKBA 4BWMA 3G10A 2DY4A 3UIQA 3AA4A 1FKOA 4IBNA 4MFBA 3PO5A 2PY5A 3LPTA 2P5GA 1Z25A 4CJ5A 3RR8A 4FJGA 3IRXA 4HHTA 1JL1A 1SL2A 1S6PA 1WLJA 4XIUA 4B9TA 3AO5A 4E7JA 3V4IA 2G8HA 4CJPA 4B9LA 4DWIA 5KI6A 1FXXA 4FJJA 3TANA 4KHWA 1SKSA 4CEBA 2HVHA 3DLRA 1D5AA 2AJQA 1UOCA 3OYLA 1C6VA 1S6QA 3CM5A 3MEEA 3VQPA 3OYMA 3RMAA 3L2QA 4OGCA 1DLOA 3AVKA 4M3UA 4RW4A 1NK8A 4PQUA 4HCBA 1L3SA 4QCLA 3U3YA 1X9SA 2IAJA 3KIOA 3QLHA 3LAMA 1WSFA 4ID1A 3C94A 4F3TA 3F9KA 3TAMA 3L2RA 3AVNA 4RW9A 4RG8A 4CEDA 3TAFA 1JLQA 3QIPA 1LW2A 4CJLA 1HYZA 4CE9A 1X9WA 3TAPA 1WSGA 4KTWA 4LY7A 1YTAA 1QQCA 1A5XA 1C0MA 2YKMA 3HP9A 4CJ3A 1BHLA 2HHQA 2RKIA 3NDKA 1ASWA 2KFNA 3VA0A 3PX4A 1U45A 3HVRA 1VSKA 4NCGA 4DQSA 3HO1A 3P1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBV A;  1S1X A;  3MEG A;  5CYM A;  3S9H A;  1LAV A;  3DLE A;  4F8R A;  2KZZ A;  2XRI A;  5I3U A;  1VSL A;  3DMJ A;  1KVB A;  5CYQ A;  2G8W A;  1TKZ A;  3ZSO A;  3NF8 A;  3ZT1 A;  4ICL A;  2KW4 A;  1WSH A;  2DTU A;  4CER A;  4FZZ A;  3DRS A;  1VSD A;  4KRE A;  3ULD A;  1UWB A;  2RF2 A;  1TVR A;  4B9V A;  4KI6 A;  1REV A;  4KHU A;  5HRR A;  4CGD A;  4YFU A;  1LV5 A;  5HBM A;  1ZBF A;  4MQ3 A;  3OYB A;  1B92 A;  3EZ5 A;  4BDZ A;  3AVM A;  3KLE A;  4JRP A;  3D0P A;  2D0A A;  2QXF A;  4DQR A;  4M3Z A;  4O5B A;  1RBV A;  4DSF A;  2ATQ A;  3LDS A;  4GW6 A;  4W5O A;  3JSM A;  4FJK A;  1RTJ A;  4DTU A;  1J9A A;  5HP1 A;  1NKE A;  4DU3 A;  3TWH A;  3WNE A;  1XHX A;  1BL3 A;  4LSL A;  1CXQ A;  3C6T A;  1ZBU A;  4FJI A;  2G8K A;  4CEZ A;  3KK2 A;  3S3M A;  4W5R A;  1EET A;  1WSE A;  5FRO A;  4E19 A;  3V1O A;  3OJS A;  3QEP A;  4K8X A;  2HVI A;  5J2N A;  4C8N A;  1EP4 A;  4FLX A;  2QK9 A;  2HHX A;  3ZT3 A;  4N5S A;  1C0U A;  1T7P A;  1J54 A;  4IFY A;  4M3Y A;  1YTU A;  1TAU A;  3SPZ A;  1JLA A;  1HRH A;  3T3F A;  3V6D A;  1IKW A;  1B9D A;  1JXB A;  4HUG A;  5FRN A;  4Z4G A;  3V1R A;  4DSK A;  4LH5 A;  1ZBI A;  4G1Q A;  4TSX A;  4M45 A;  4H8K A;  2HNZ A;  3TR8 A;  1RBU A;  4H4M A;  4DF4 A;  3LAN A;  3F73 A;  4FLY A;  1BI4 B;  3O4Q A;  4CFB A;  1J5O A;  3ITH A;  4CGF A;  3SJJ A;  3AO1 A;  1C0T A;  1VSI A;  3RMB A;  3KLH A;  4R5P A;  3KK3 A;  4Z4H A;  5KTQ A;  4KHY A;  3QNO A;  4AHT A;  4ZHR A;  3OS2 A;  3CG7 A;  4DU1 A;  4QOZ B;  2E6L A;  2BGG A;  3RMC A;  3OVN A;  3V9X A;  4Z4C A;  3PO4 A;  4BDP A;  4IDK A;  1BIU A;  1HPZ A;  2RN2 A;  3C95 A;  4CJU A;  2IC3 A;  3CM6 A;  2XY7 A;  3TAQ A;  1UA0 A;  3RRG A;  4Z4E A;  3HK2 A;  1S1V A;  4ELU A;  1UAX A;  3K58 A;  3SQ1 A;  3QEV A;  3HL8 A;  3LWL A;  1KVA A;  3BGR A;  4DLG A;  1IKY A;  5HRP A;  2Y1J A;  1GOB A;  1QS4 A;  4B9U A;  1EX4 A;  1LWC A;  4BDY A;  2DFE A;  2IOC A;  2PZS A;  2LSN A;  1HYS A;  4FM1 A;  3SUN A;  2B5J A;  3A2F A;  3DRP A;  4BWJ A;  3ZSQ A;  1N6Q A;  1KLM A;  4JS5 A;  3V9Z A;  1VSJ A;  2XY8 A;  4DLE A;  2JLE A;  1ZBL A;  3M8P A;  1RT4 A;  2B6A A;  3LAL A;  4IG3 A;  3ZSY A;  1XWL A;  3MED A;  4IFV A;  4E3S A;  2D5R A;  3NF9 A;  4CEQ A;  4CJV A;  1BQM A;  2YNI A;  1IG9 A;  4O44 A;  3OYH A;  1WN7 A;  1Q9Y A;  4ZTJ A;  4OGE A;  4F2R A;  4J2E A;  1BQN A;  1TKX A;  1LWE A;  3LP1 A;  1KRP A;  3DLK A;  3SZ2 A;  4RW8 A;  4OKK A;  4AH9 A;  3NH0 A;  3TAG A;  1RT7 A;  3OYE A;  3LWM A;  1A5V A;  4FLZ A;  4DFJ A;  3SYZ A;  4CEA A;  4Q0B A;  1T05 A;  3AVF A;  3K57 A;  1WAF A;  2KQ2 A;  3KKR A;  1EXQ A;  4CGI A;  2X78 A;  5FDL A;  2DFF A;  2D0C A;  5K14 A;  1FKP A;  4BE0 A;  1QHT A;  1QSL A;  3L3U A;  1TGO A;  3TAB A;  4C8O A;  3B6P A;  2HW3 A;  3QEI A;  1HYV A;  2IDO A;  4I9L A;  4CEF A;  3SQ0 A;  1WNS A;  3SNN A;  4DSL A;  3AVJ A;  1ASV A;  2YKN A;  4HVJ A;  4CHQ A;  4M42 A;  3QET A;  4Y1D A;  1NJW A;  4I9Q A;  5HRS A;  1VRU A;  1KCF A;  1Q9X A;  4E7I A;  4FZY A;  5KGX A;  2OPQ A;  4DU4 A;  4BE1 A;  4CK2 A;  3M8R A;  2EHG A;  4KB0 A;  3V1Q A;  3L8B A;  1TKT A;  4CHO A;  5J2M A;  4FW2 A;  2HHS A;  4EZ9 A;  3SUO A;  3OYN A;  1BIZ A;  3PV8 A;  2X6N A;  4CEE A;  1NK7 A;  3CFR A;  1B9F A;  1QSY A;  1K6Y A;  3O3H A;  4FJH A;  1KFD A;  1SL1 A;  4FZX C;  1VSM A;  3AVG A;  3QIN A;  4H4O A;  3VQ9 A;  3VQC A;  2OPS A;  3KLI A;  3VQA A;  4CJQ A;  3KJV A;  4HTU A;  1NK4 A;  2GBZ A;  3DOL A;  4DQP A;  3ZSR A;  3THV A;  1NKB A;  1LWF A;  1U04 A;  5CZ2 A;  4NYN A;  1QE1 A;  3VQQ A;  4CJR A;  3OYG A;  4LH4 A;  3PUF A;  4CIE A;  3OY9 A;  4FJX A;  3HXM A;  1BCO A;  3PY8 A;  2VG5 A;  1NJY A;  5CZ1 A;  3QEX A;  3ASM A;  4RW7 A;  2PYL A;  1RTI A;  3P5J A;  2RPI A;  4CEO A;  4CF1 A;  3BDP A;  3LP0 A;  3CFP A;  1NOZ A;  2G8V A;  1S1W A;  4PY5 A;  1KTQ A;  4FXD A;  5E41 A;  4FYD A;  4CF2 A;  4FJ5 A;  4C8L A;  3NH1 A;  5JS1 A;  3AO4 A;  5T7B A;  1UA1 A;  2EX3 A;  4FLU A;  1SKW A;  3DM2 A;  4FJL A;  4KRF A;  4ZTF A;  4KV8 A;  1VRT A;  2IS3 A;  1TK8 A;  3AVC A;  4B8C A;  4M3W A;  1JXE A;  1IKX A;  2HHW A;  3AA3 A;  4CFA A;  2WON A;  1I3A A;  4O55 A;  4E7K A;  4FVM A;  4J2A A;  3QER A;  3LPU A;  3T1A A;  1VSE A;  3RRH A;  4FLV A;  3V9W A;  3O3G A;  3K5M A;  1U4B A;  2VG7 A;  2GUI A;  3JYT A;  1X1P A;  3EY1 A;  1F21 A;  1YVU A;  5HRN A;  3AVH A;  3NGY A;  1RBS A;  3H08 A;  4DMN A;  4Z4F A;  4CJK A;  1DTQ A;  3IG1 A;  1JL2 A;  1NK5 A;  1JLB A;  1RDC A;  3AVI A;  2Z1I A;  4IG0 A;  1ITG A;  4HCC A;  4RW6 A;  1JKH A;  4J2D A;  1MU2 A;  1RDD A;  1NOY A;  4FJ9 A;  4FCY A;  2XHB A;  1KFS A;  1QSS A;  3MAQ A;  3S3O A;  4AHU A;  4BAC A;  3HVT A;  3VQ4 A;  4HUE A;  1S5J A;  3RTV A;  4DS4 A;  2Y1I A;  1TKD A;  1ZYQ A;  3ZT4 A;  4CGG A;  2B4J A;  3T19 A;  3ZT2 A;  3NF6 A;  4KAZ A;  4FJ8 A;  5J2Q A;  3IS9 A;  4HUF A;  3KD1 E;  4E89 A;  4FJM A;  4DTJ A;  3IAY A;  3SV4 A;  1W0H A;  3C6U A;  2R7Y A;  3HYF A;  4F2S A;  4LD0 A;  4OPJ A;  4I2P A;  1RTD A;  2BE2 A;  2FC0 A;  5KRS A;  3K59 A;  1LW0 A;  2NUB A;  1TK5 A;  3AVL A;  3MEC A;  4CF0 A;  5J2P A;  2Z1H A;  3MXI A;  1TV6 A;  3OYA A;  3VQE A;  4FJN A;  3QES A;  1RDA A;  2P1J A;  2P51 A;  3AA5 X;  1G15 A;  3CFO A;  3OJU A;  2BAN A;  1NK0 A;  3V81 A;  2OYQ A;  4KKO A;  3SPY A;  4DS5 A;  5DMR A;  4CHP A;  3NAE A;  3ZSW A;  3HPH A;  3ZSV A;  2F96 A;  4B9S A;  4DFM A;  3ZSX A;  4DSE A;  2FBX A;  4EZ6 A;  4DTS A;  3ALY A;  4CHN A;  4CCH A;  1N5Y A;  2Z1G A;  4DQQ A;  1WAJ A;  3NF7 A;  3RMD A;  4OJR A;  4GMJ B;  4BE2 A;  4CFD A;  2XO7 A;  1I39 A;  4DFP A;  1XC9 A;  4M41 A;  4OLA A;  3L2V A;  3MXJ A;  5DK5 A;  3AVA A;  4FJ7 A;  4OKJ A;  4CJW A;  4JLH A;  4AHV A;  4KHN A;  1T03 A;  4OPK A;  3LAK A;  4YNQ A;  4CHY A;  5KGW A;  3VQ6 A;  3V9U A;  1XHZ A;  2ZD1 A;  4N47 A;  1W9H A;  3K2P A;  3SUQ A;  3O4N A;  3K5L A;  1U49 A;  5SZT A;  2X74 A;  2YHA A;  4E1N A;  4AIL C;  1RBR A;  3OYC A;  1KSP A;  4DSJ A;  3HJF A;  3NHG A;  3NFA A;  4W5T A;  1R0A A;  1X9M A;  1JLF A;  2OPR A;  4QAG A;  5C42 A;  2P5O A;  4CEC A;  4EP4 A;  3CQ8 A;  3SI6 A;  1ZBH A;  3HPO A;  4FK2 A;  4CHZ A;  3ZT0 A;  3VN5 A;  4CJT A;  4OKE A;  5FRM A;  3PX6 A;  4E7L A;  2A1S A;  3HST B;  3VQD A;  3VQ8 A;  4CGJ A;  5CY4 A;  1NJZ A;  2ETJ A;  3CYM A;  1GOC A;  3FFI A;  4CK1 A;  1RT6 A;  1S9G A;  4I7F A;  3VQ7 A;  1A5W A;  2ITG A;  4DF8 A;  4I2Q A;  3SCX A;  1TK0 A;  2ZQB A;  3U3G A;  3OS1 A;  4JS4 A;  3P83 D;  2OPP A;  3KK1 A;  1O1W A;  1RT2 A;  1LAW A;  3NE6 A;  1WSI A;  4W5Q A;  1IO2 A;  4E7H A;  4CJ4 A;  1SUQ A;  2OA8 A;  2Z1J A;  3OYJ A;  4CK3 A;  3KLG A;  2YNG A;  4WE1 A;  1JLC A;  2FBY A;  4CGH A;  4KHS A;  3I8D A;  3E01 A;  3DLB A;  4B9N A;  2Q3S A;  1JLG A;  2VG6 A;  4N41 A;  1RCH A;  1T8E A;  3SV3 A;  1HMV A;  4CJF A;  4CIG A;  3RR7 A;  4KHQ A;  1BI4 A;  4FK4 A;  1WSJ A;  1TL3 A;  5HLF A;  3NBP A;  2A1R A;  3OYK A;  2HB5 A;  4OVL A;  5SWM A;  3NGI A;  1IH7 A;  2HMI A;  1J53 A;  1Y97 A;  2E6M A;  3QEW A;  5J1E A;  1L3U A;  4NCA A;  3LP3 A;  3M8Q A;  4C8K A;  1HQE A;  2F8S A;  1HQU A;  3TAE A;  2W42 A;  1RT3 A;  1HNV A;  2PYJ A;  3K5O A;  1GOA A;  4KO0 A;  4DTN A;  2F8T A;  3U6F A;  4F3O A;  4DQI A;  3I0R A;  2I5J A;  1RT5 A;  3TAR A;  3OYD A;  4FM0 A;  3OYF A;  3DOK A;  4NYF A;  4DFK A;  1TL1 A;  3LZI A;  3ZCM A;  4Z0U A;  4AHC A;  1RNH A;  3KLF A;  2YNH A;  3ISN C;  4N76 A;  2VWJ A;  1D9F A;  4JRQ A;  4FW1 A;  2HHU A;  1U47 A;  2OZM A;  2HNY A;  4M3X A;  3S3N A;  1DTT A;  1VSF A;  1RBT A;  4M3R A;  3WNH A;  3KD5 E;  2KZM A;  3VQB A;  2XY5 A;  3V9S A;  3KKS A;  4M3T A;  2JGU A;  1EKE A;  1NK9 A;  5HRO A;  4DSI A;  4NCB A;  2GV9 A;  1RTH A;  2ZE2 A;  1QTM A;  4FLT A;  1HJR A;  2E4L A;  1Z26 A;  1HNI A;  1L3V A;  4KTQ A;  1SV5 A;  4O4G A;  1S1T A;  1BIS A;  3NH2 A;  4FM2 A;  1NK6 A;  5C25 A;  3TI0 A;  4DG1 A;  1NKC A;  3AO2 A;  3DLG A;  4PA1 A;  4ELV A;  1D9D A;  3D45 A;  3DYA A;  4CF8 A;  3L2U A;  3G0Z A;  4PUO A;  4AHS A;  2KFZ A;  3QIO A;  5C24 A;  4B8A B;  1SKR A;  4CFC A;  4N56 A;  3DLH A;  3HT3 A;  2G8F A;  4C8M A;  2HHV A;  2YV0 X;  2HND A;  3WNG A;  3SQ4 A;  4KPY A;  4FK0 A;  3QO9 A;  1C1C A;  4W5N A;  4KB1 A;  4Y1C A;  1JLE A;  3K5N A;  4KFB A;  4LSN A;  1KVC A;  1RDB A;  3L2W A;  3EYZ A;  3RWU A;  3AO3 A;  3HP6 A;  4PWD A;  1CZ9 A;  1VK0 A;  2FBT A;  3DI6 A;  4CJE A;  3QNN A;  3MXM A;  3VQ5 A;  5KRT A;  1XI1 A;  3ZSZ A;  5EU7 A;  2BDP A;  4DTM A;  1KLN A;  4AHR A;  1ASU A;  1S9E A;  4Z4I A;  4DTO A;  4KTZ A;  3DRR A;  3KTQ A;  3B6O A;  3OYI A;  4J2B A;  3AV9 A;  1L3T A;  1CLQ A;  4IKF A;  2YNF A;  2IGI A;  3AA2 A;  1VSH A;  4FLW A;  3SUP A;  2OZS A;  4DTX A;  3NGZ A;  2QKK A;  1S1U A;  2O4G A;  3SQ2 A;  1L5U A;  4ELT A;  1TAQ A;  3HM9 A;  4KI4 A;  3OS0 A;  4Q5V A;  5I42 A;  4L8R B;  4OLB A;  4B9M A;  1D8Y A;  1FK9 A;  4ID5 A;  3M8S A;  3I0S A;  3AVB A;  4GVM A;  4E0D A;  3NCI A;  4F4K A;  2DFH A;  1BCM A;  1CZB A;  4O0J A;  3WNF A;  4CF9 A;  3VA3 A;  1U48 A;  4B3O A;  3O3F A;  2G8U A;  5JS2 A;  3PX0 A;  2YHB A;  4UQG A;  2HHT A;  1IKV A;  3L3V A;  4CES A;  3HPG A;  4CJS A;  2D0B A;  2WOM A;  4K8Z A;  1YT3 A;  1C1A A;  4CIF A;  4O0I A;  4DTR A;  1BGX T;  1RT1 A;  1Q8I A;  1C1B A;  1CXU A;  3LZJ A;  4B08 A;  4EP5 A;  2O4I A;  5D3G A;  2KTQ A;  4DTP A;  3LP2 A;  1NJX A;  2VWK A;  1RIL A;  2X6S A;  1SL0 A;  4E1M A;  2XY6 A;  2G8I A;  2QKB A;  4BWM A;  3G10 A;  2DY4 A;  3UIQ A;  3AA4 A;  1FKO A;  4IBN A;  4MFB A;  3PO5 A;  2PY5 A;  3LPT A;  2P5G A;  1Z25 A;  4CJ5 A;  3RR8 A;  4FJG A;  3IRX A;  4HHT A;  1JL1 A;  1SL2 A;  1S6P A;  1WLJ A;  4XIU A;  4B9T A;  3AO5 A;  4E7J A;  3V4I A;  2G8H A;  4CJP A;  4B9L A;  4DWI A;  5KI6 A;  1FXX A;  4FJJ A;  3TAN A;  4KHW A;  1SKS A;  4CEB A;  2HVH A;  3DLR A;  1D5A A;  2AJQ A;  1UOC A;  3OYL A;  1C6V A;  1S6Q A;  3CM5 A;  3MEE A;  3VQP A;  3OYM A;  3RMA A;  3L2Q A;  4OGC A;  1DLO A;  3AVK A;  4M3U A;  4RW4 A;  1NK8 A;  4PQU A;  4HCB A;  1L3S A;  4QCL A;  3U3Y A;  1X9S A;  2IAJ A;  3KIO A;  3QLH A;  3LAM A;  1WSF A;  4ID1 A;  3C94 A;  4F3T A;  3F9K A;  3TAM A;  3L2R A;  3AVN A;  4RW9 A;  4RG8 A;  4CED A;  3TAF A;  1JLQ A;  3QIP A;  1LW2 A;  4CJL A;  1HYZ A;  4CE9 A;  1X9W A;  3TAP A;  1WSG A;  4KTW A;  4LY7 A;  1YTA A;  1QQC A;  1A5X A;  1C0M A;  2YKM A;  3HP9 A;  4CJ3 A;  1BHL A;  2HHQ A;  2RKI A;  3NDK A;  1ASW A;  2KFN A;  3VA0 A;  3PX4 A;  1U45 A;  3HVR A;  1VSK A;  4NCG A;  4DQS A;  3HO1 A;  3P1G A; 
#chains in the Genus database with same CATH topology
 2KZZ A;  4AM6 A;  3S9H A;  1LAV A;  2W41 A;  4PKH A;  1S3X A;  1KVB A;  2G8W A;  3ZSO A;  1WSH A;  4FZZ A;  3DRS A;  4KRE A;  1KQS M;  4KHU A;  5HRR A;  4CGD A;  4AQY K;  1LV5 A;  3PLA A;  4JAX A;  4ILH A;  3ZET B;  4ISF A;  3KLE A;  3RSE B;  4DB3 A;  5BR8 K;  3D2F A;  3C6H A;  2QXF A;  1NMD A;  1RBV A;  5TKY A;  3LDS A;  4GW6 A;  3JSM A;  1VQ5 N;  4DKW A;  2P9K A;  4DTU A;  4CZF A;  3THX A;  4DU3 A;  3WNE A;  1BL3 A;  4LSL A;  4KHP K;  1ZBU A;  4FVU A;  2G8K A;  2V51 B;  1EET A;  1WSE A;  5FRO A;  4BQZ A;  2HVI A;  3OJS A;  4K8X A;  5MLC Q;  2HHX A;  3N4P A;  2YHW A;  4JI4 K;  1J54 A;  4IFY A;  1YTU A;  1TAU A;  1HRH A;  1Z05 A;  3T3F A;  1IKW A;  1JXB A;  4JI2 K;  2QW9 A;  4HUG A;  2Q0U A;  4LH5 A;  4TSX A;  4M45 A;  4H8K A;  3TR8 A;  3CME N;  2CH5 A;  3O4Q A;  5FLX O;  1WOQ A;  1OH5 A;  3KLH A;  5AQK A;  4XH5 A;  3OS2 A;  2QA4 N;  1BUP A;  1QQO A;  2RN2 A;  3TAQ A;  4B1U B;  4FXD A;  3CM6 A;  5LJV A;  3CMA N;  4DLG A;  5HRP A;  3IMX A;  4BRG A;  3MN7 A;  3HZ6 A;  1LWC A;  5AQG A;  3UB5 A;  2PZS A;  2LSN A;  4FM1 A;  4BWJ A;  3ZSQ A;  4MLH A;  4JS5 A;  1VSJ A;  3V9Z A;  1RDU A;  1P90 A;  4YOR A;  3TU5 A;  2KHO A;  1V4T A;  3MED A;  4IFV A;  2WTU A;  3CPW M;  4IOC L;  2YNI A;  3ATU A;  2Q97 A;  2O8E A;  1LWE A;  1KRP A;  3DLK A;  4OKK A;  4AH9 A;  4BRF A;  3C65 A;  1A5V A;  4B9Q A;  3SYZ A;  3G25 A;  4CEA A;  4Q0B A;  1J6Z A;  2KQ2 A;  5H1S Q;  5F1X A;  1EXQ A;  4JI8 K;  1NGH A;  5AQJ A;  1TGO A;  3CD6 N;  2HW3 A;  4WFN L;  3QEI A;  4L3Q A;  4I9L A;  3THW B;  1ASV A;  4HVJ A;  2P9L B;  3NVK A;  3QET A;  4Y1D A;  1NJW A;  3R3L A;  3TSU A;  5EXW A;  4FWQ A;  3QDK A;  5GIP A;  4DUY K;  4CZL A;  1ZBS A;  2P9S A;  3V1Q A;  2HHS A;  4EZ9 A;  3FZL A;  4IXC A;  2X6N A;  1NK7 A;  4E1J A;  2PBD A;  1K6Y A;  1QSY A;  3O3H A;  2I7P A;  1KFD A;  3VQC A;  1VSM A;  2E20 A;  4H4O A;  3QML A;  2OPS A;  3VQA A;  3MN9 A;  4NYN A;  1OVQ A;  1QE1 A;  3VQQ A;  4CJR A;  4LH4 A;  1QVG M;  3PUF A;  4CIE A;  3OY9 A;  3HXM A;  1BCO A;  3PY8 A;  4H5W A;  3QEX A;  2UU9 K;  4RW7 A;  3U8X A;  1X3N A;  1EWQ A;  2BUP A;  5KQD A;  3LP0 A;  1NOZ A;  2G8V A;  4LC9 B;  4JHD B;  1SS6 A;  5E41 A;  3A0I X;  3B8A X;  4CF2 A;  3J7Z O;  5JS1 A;  1UA1 A;  4FJL A;  3ZX2 A;  4ZTF A;  1VRT A;  2IS3 A;  1TK8 A;  4M3W A;  1IJJ A;  4H03 B;  2WON A;  4O55 A;  4J2A A;  4PL8 A;  5AZJ A;  5HL7 L;  2VQE K;  4IDH A;  3K5M A;  5AQP A;  3JYT A;  4GV6 A;  3AVH A;  2P9U A;  3P31 A;  3IG1 A;  2O8D B;  2FSK A;  1S72 N;  3AVI A;  2Z1I A;  2NRT A;  4J2D A;  3MAQ A;  5TKW A;  2Q31 A;  4HUE A;  3VQ4 A;  1S5J A;  1TKD A;  4MLE A;  3ZT4 A;  4CGG A;  3H1Q A;  1JJ2 M;  3NF6 A;  4KAZ A;  3E9O A;  3IS9 A;  2D1K A;  5HOO A;  1BO5 O;  2A5X A;  1W0H A;  4LD0 A;  3K59 A;  1TK5 A;  3TTF A;  3MEC A;  4EIA A;  3OYA A;  3QES A;  1RDA A;  2P1J A;  1NWK A;  1ATS A;  3CFO A;  1NK0 A;  1W97 L;  4KKO A;  3U9D A;  3D2F B;  3NAE A;  3ZSW A;  3HPH A;  3CQY A;  3WXK A;  1X3M A;  3VGK A;  4NLB A;  3GL1 A;  2BTF A;  1GLA G;  2P9K B;  3ALY A;  4CHN A;  5KPZ A;  3THX B;  3NF7 A;  2E8A A;  3S41 A;  5DM6 L;  4BRD A;  1NMN A;  1Q81 O;  2XO7 A;  1I94 K;  1RFQ A;  2NRH A;  1VQK N;  4IO9 L;  4FWL A;  3VER A;  3OA9 A;  3H6E A;  3MDQ A;  3WXL A;  4AHV A;  4KHN A;  3Q7B A;  3LAK A;  4OPK A;  1LOT B;  3VQ6 A;  1XHZ A;  2ZD1 A;  4N47 A;  3K2P A;  1Y64 A;  1U49 A;  4JKF A;  4DSJ A;  3NFA A;  1JLF A;  2P5O A;  5AQZ A;  3CHW A;  4FK2 A;  4B1X B;  3FZM A;  1MWK A;  3IUC A;  1BDG A;  4BR4 A;  4E7L A;  1WB9 A;  2A1S A;  3K9K A;  3VQ8 A;  1S22 A;  1VQ4 N;  3LL3 A;  4FWK A;  3CYM A;  3FZF A;  1S9G A;  4I7F A;  3VQ7 A;  2ITG A;  3H3O B;  4DF8 A;  1NG9 A;  2F9T A;  3SCX A;  2FLO A;  3OS1 A;  4JS4 A;  3BUZ B;  3MX5 A;  1O1W A;  1YF5 L;  4NLC A;  3E9P A;  1T6C A;  1SUQ A;  4KHS A;  2PFU A;  1N32 K;  4B9N A;  1JLG A;  2VG6 A;  4N41 A;  4IWV A;  3EE9 A;  3BF1 A;  4XH1 A;  4CJF A;  4KHQ A;  1BI4 A;  5HLF A;  1YXQ A;  3CQX A;  3NGI A;  4A59 A;  2O8E B;  3QFU A;  4PKI A;  4DR4 K;  2E6M A;  3SAG A;  2F8S A;  1HQU A;  2PYJ A;  4DV4 K;  3U6F A;  4F3O A;  1NGA A;  1BG3 A;  1RT5 A;  1TUY A;  3DOK A;  3ZCM A;  4DV2 K;  5AQQ A;  5M1F A;  2HNY A;  1VSF A;  4WF9 L;  1RBT A;  3WNH A;  4DR5 K;  3KKS A;  1JCG A;  1NK9 A;  2CGL A;  5HRO A;  4G9Z A;  2GV9 A;  1RTH A;  2P9S B;  2ZE2 A;  1L3V A;  1HNI A;  3CJB A;  1S1T A;  4DG1 A;  1NKC A;  3LM9 A;  3DLG A;  4ISG A;  4ELV A;  2KFZ A;  2F4V K;  4A62 A;  3QIO A;  1SKR A;  3OBW A;  4B3R K;  4MDB A;  3SQ4 A;  3HSC A;  4DR3 K;  4W5N A;  1JLE A;  4JEP A;  2IVN A;  1K73 O;  2ZGY A;  3EYZ A;  4DV5 K;  3AO3 A;  1VQO N;  4PWD A;  1QQN A;  2FBT A;  2ZM6 K;  2QWN A;  3VQ5 A;  3VEO A;  3K9J A;  5EU7 A;  4KBO A;  4AHR A;  3MN6 A;  4J2B A;  2O8F A;  2IGI A;  2FF6 A;  1C0F A;  4FLW A;  3ULE A;  4ELT A;  3TPQ A;  5I42 A;  4L8R B;  3TTD A;  4BR5 A;  1FK9 A;  4OO1 J;  3AVB A;  5AZJ B;  3NCI A;  2DFH A;  3WNF A;  4UQG A;  1XUP O;  1IKV A;  3L3V A;  3HPG A;  1YT3 A;  5BR9 A;  1BGX T;  1CXU A;  4EP5 A;  5D3G A;  4DTP A;  2VWK A;  2X6S A;  3ZET A;  4E1M A;  2G8I A;  4IBN A;  4OPA A;  3LPT A;  3I56 N;  4YOU A;  1TUU A;  3JXU A;  1SL2 A;  1VQN N;  4E7J A;  4MO5 A;  4JI0 K;  4FJJ A;  2HVH A;  5CHI A;  3U4L A;  2BH1 A;  2ZJP L;  4FWS A;  3VQP A;  2YI1 A;  4OGC A;  3VPZ A;  3AVK A;  3ID8 A;  3HBT A;  3U3Y A;  2IAJ A;  3LAM A;  3J80 O;  4F3T A;  1NU0 A;  3F9K A;  3TAM A;  4RG8 A;  3TAF A;  1JLQ A;  1FJG K;  1XC3 A;  2YKM A;  1ATR A;  3NDK A;  1ASW A;  3VA0 A;  2I7N A;  4K0K K;  1S1X A;  4O8K A;  1KAY A;  2XRI A;  4JV5 K;  4O5F A;  4BRA A;  1TKZ A;  3ZT1 A;  4CER A;  1TVR A;  2QWL A;  4WQ4 C;  5IWA K;  4MQ3 A;  3FZK A;  3EZ5 A;  4BDZ A;  2E2N A;  1Q82 O;  4CZH A;  2ATQ A;  4W5O A;  4FJK A;  1H1V A;  3W3D A;  5HP1 A;  2P9N B;  1Q7Y O;  3LDP A;  2HBM A;  4BC2 A;  1KC8 O;  3V1O A;  5BPM A;  4B3S K;  4C8N A;  1EP4 A;  3ZT3 A;  3R1X A;  2HOE A;  1C0U A;  4FO0 A;  4H0V B;  3SPZ A;  1JLA A;  4Z4G A;  1NGE A;  1B9D A;  3DWL A;  4PKG A;  3CJ7 A;  5E84 A;  4H4M A;  3F73 A;  1BI4 B;  4MO4 A;  3THW A;  4CFB A;  1J5O A;  3ITH A;  4CGF A;  3SJJ A;  2E2Q A;  2YJF A;  1HNW K;  3RMB A;  3KK3 A;  4Z4H A;  1NLV A;  3QNO A;  4ZHR A;  3I8B A;  1VQ7 N;  2BGG A;  3V9X A;  3C95 A;  3UKU A;  2H3G X;  4CJU A;  2IC3 A;  1YAG A;  3HK2 A;  3K58 A;  3QEV A;  1IKY A;  4K41 A;  1QS4 A;  4B9U A;  4BDY A;  3BY5 A;  3HOS A;  3SUN A;  2RE2 A;  3DRP A;  1C0G A;  3SMS A;  1KLM A;  3HTV A;  4IG3 A;  2HF3 A;  4GKK K;  5AQO A;  5JMV A;  1IG9 A;  5FPE A;  4FWO A;  2YX6 A;  4OGE A;  4ZTJ A;  5LJW A;  1VQ9 N;  5LY3 A;  1BQN A;  4BG9 A;  5ELZ A;  4BQL A;  4RW8 A;  1RT7 A;  3OYE A;  5LMN K;  1NGF A;  4A5A A;  2P9I A;  3MX2 A;  3AAR A;  5JVG L;  2X78 A;  5FDL A;  5K14 A;  4BRI A;  4B1Z A;  3VF6 A;  3TAB A;  4PL7 A;  2IDO A;  4QS7 A;  3SQ0 A;  4DSL A;  3FFK B;  4YHH K;  3IDH A;  4CHQ A;  4WYB A;  3VGL A;  1VRU A;  1KCF A;  5AQV A;  5AQS A;  2UUA K;  4BRO A;  3SLC A;  1Z6R A;  2O8F B;  4BVP A;  4FSV A;  3VTH A;  1TKT A;  3ULE B;  1DT9 A;  3KHY A;  3OYN A;  1BIZ A;  2ASP A;  1T44 A;  3PV8 A;  1B9F A;  2OTJ N;  1NGJ A;  3ID6 A;  4HTU A;  2GUP A;  2GBZ A;  3VET A;  3THV A;  1NKB A;  1LWF A;  1U04 A;  3SBT A;  4JNE A;  3CJ1 A;  4DR6 K;  5CZ1 A;  2F7T A;  3ASM A;  1RTI A;  2RPI A;  4RTF D;  3CFP A;  1S1W A;  4PY5 A;  1KTQ A;  4JYA K;  3AO4 A;  4FLU A;  2GTD A;  4KV8 A;  5CE3 A;  4M63 C;  4LF5 K;  4B8C A;  2HHW A;  3J8A A;  1IKX A;  1G99 A;  3AA3 A;  4CFA A;  1QQM A;  4YOV A;  4DCH A;  3QER A;  4GVE A;  2GWK A;  1BU6 O;  1QZ5 A;  4FWR A;  3LPU A;  3T1A A;  2E5L K;  4YOW A;  4FLV A;  3RRH A;  3V9W A;  1J5E K;  3SJH A;  3QBW A;  1F21 A;  5HRN A;  3NGY A;  1NK5 A;  1RDC A;  4LF7 K;  4IG0 A;  1ITG A;  1JKH A;  5JLH A;  3P4I A;  4DR2 K;  3AY9 A;  4DS4 A;  2B4J A;  4FJ8 A;  3ZT2 A;  4BVO A;  3T69 A;  5AQY A;  5AJ3 K;  3IAY A;  1HKG A;  3C6U A;  3HYF A;  4F2S A;  5C12 A;  3TTC A;  3AVL A;  2A3Z A;  4JKD A;  4JK8 A;  5EVZ A;  4YOT A;  3VQE A;  2GX9 A;  4FJN A;  4LFB K;  3P38 A;  2OYQ A;  2BAN A;  4DS5 A;  4YY3 K;  5DMR A;  5BRE A;  4DFM A;  4DTS A;  3RVC A;  1NJI O;  1N5Y A;  1YI2 N;  1V4S A;  3KWI A;  2HBK A;  4OJR A;  5AQH A;  1Q86 O;  4DR1 K;  5AZI A;  1I39 A;  3KWG A;  1XC9 A;  4FJ7 A;  2ASO A;  3D6R A;  2YHY A;  1T03 A;  4YNQ A;  1VHX A;  4IEI A;  1W9H A;  3IKM A;  1KSP A;  1RBR A;  3EZW A;  3OYC A;  4LF8 K;  4QAG A;  1YJW N;  4CEC A;  4EP4 A;  3CQ8 A;  3SI6 A;  3HPO A;  4XH4 A;  5AQF A;  2QWP A;  3VN5 A;  4OKE A;  3PX6 A;  3UKR A;  5AQU A;  3O1W A;  3HST B;  3VQD A;  3WT0 A;  3UKU B;  1NJZ A;  4AM7 A;  2ZF5 O;  4JI3 K;  1IBL K;  3CCS N;  4IJA A;  3U3G A;  2OPP A;  5GAG P;  4BR9 A;  1LAW A;  3NE6 A;  3EE8 A;  4E7H A;  2Z1J A;  2JWK A;  4H0X B;  1VQL N;  2Q3S A;  4BRL A;  3SV3 A;  2W40 A;  5E26 A;  3OYK A;  1XMQ K;  4JKH A;  1J53 A;  1Y97 A;  3QEW A;  1YUW A;  3TAE A;  2W42 A;  3CC7 N;  4KO0 A;  5AQL A;  2P9I B;  3I0R A;  2AA4 A;  1HJO A;  3C7N A;  3OYD A;  4FM0 A;  4BGB A;  2IIR A;  1EO1 A;  3OYF A;  1RNH A;  4N76 A;  4JRQ A;  4FW1 A;  2WBN A;  3S3N A;  4YOX A;  3KD5 E;  3V9S A;  4FL9 A;  4NCB A;  3C0B A;  2E4L A;  4JKC A;  1EQY A;  4C23 A;  4O4G A;  1HNX K;  1U2V B;  3VEY A;  1BIS A;  3NH2 A;  4FOI A;  3N4Q A;  4JI1 K;  1D9D A;  2NRW A;  4CF8 A;  3L2U A;  4PUO A;  3G0Z A;  4BR7 A;  4B8A B;  4M7Y A;  1KD1 O;  4IEE A;  3DLH A;  4GNI A;  4C8M A;  4WCE L;  3NMU A;  2YV0 X;  3WNG A;  5GIN A;  2HHV A;  2IVO A;  1W7A A;  4KB1 A;  4QS8 A;  2VWB A;  1KVC A;  5GAD P;  3L2W A;  1GLD G;  4K25 A;  3G4S N;  3HP6 A;  1CZ9 A;  3MXM A;  3QNN A;  3ENH A;  3J81 O;  1XI1 A;  3PSF A;  3MCP A;  3ATV A;  1ASU A;  3CC2 N;  4DTO A;  5DM7 L;  3B6O A;  4I6M A;  3OYI A;  1IBK K;  1CLQ A;  4IKF A;  2YNF A;  4B1W B;  5C2F A;  1VSH A;  4DQ8 A;  1L5U A;  1TAQ A;  4KI4 A;  4Q5V A;  4B9M A;  1D8Y A;  2WC9 A;  4DHY A;  2UYT A;  4GVM A;  3H3N O;  4EHU A;  3CCL N;  2VGN A;  4O0J A;  3VA3 A;  2G8U A;  3KZB A;  2HHT A;  4CBX A;  4K8Z A;  4CIF A;  4O0I A;  4DTR A;  2QWM A;  1OH8 A;  3WQU A;  3LP2 A;  4A2B A;  1NJX A;  1RIL A;  4K42 A;  4FPB A;  2DY4 A;  1WBB A;  3PO5 A;  2P5G A;  4CJ5 A;  3IRX A;  4HHT A;  3BZC A;  1GLE G;  2P9N A;  1MWM A;  1NGG A;  4B9L A;  5KI6 A;  4CI6 A;  4UY8 O;  4M7X A;  3MEE A;  3CM5 A;  3RMA A;  3MCA B;  4BRC A;  1NK8 A;  4PQU A;  4HCB A;  1L3S A;  3KIO A;  3M1F A;  1WSF A;  4ID1 A;  3L2R A;  4JI5 K;  3AVN A;  4RW9 A;  2QWO A;  4CJL A;  1HYZ A;  4CE9 A;  1WSG A;  4KTW A;  2V7Y A;  1YTA A;  3EN9 A;  1C0M A;  5BRF A;  4Z94 A;  3PX4 A;  3P39 A;  4NCG A;  2Q36 A;  5AZI B;  3HO1 A;  2FBV A;  1ATN A;  3DLE A;  1CZA N;  5LL6 Z;  3Q7C A;  3JAM O;  1VSL A;  2VCP A;  2DTU A;  4ICL A;  2KW4 A;  3GE1 A;  4LF4 K;  3ULD A;  4KI6 A;  1YHQ N;  1ZBF A;  2OAN A;  3OYB A;  3J7A P;  3AVM A;  3D0P A;  4DQR A;  3E1Y A;  4O5B A;  4DSF A;  3UKR B;  4X62 K;  1J9A A;  4JK7 A;  3TWH A;  1XHX A;  3O9T A;  3M6G A;  3CC4 N;  4U7B A;  4CEZ A;  3S3M A;  4W5R A;  1YVN A;  4E19 A;  3QEP A;  4BG8 A;  3ENO A;  4FLX A;  2QK9 A;  1O13 A;  4N5S A;  1HPM A;  2ZJQ L;  4M3Y A;  3V6D A;  4BRK A;  4G1Q A;  3THY A;  3WEE A;  4FLY A;  3AO1 A;  4J8F A;  1ZXO A;  4HWI A;  4AHT A;  4QOZ B;  4B1V A;  3CG7 A;  4DU1 A;  1N34 K;  4Z4C A;  3PO4 A;  1BIU A;  2XY7 A;  3RRG A;  4Z4E A;  4CBU A;  2P9P A;  3SQ1 A;  2UUC K;  3HL8 A;  3LWL A;  1KVA A;  1SAZ A;  2Y1J A;  1GOB A;  3C7N B;  2QI2 A;  4IJN A;  1HYS A;  3LDL A;  3WXI A;  2B5J A;  3A2F A;  1N6Q A;  5GAH P;  2XY8 A;  2V52 B;  4DV7 K;  1RT4 A;  2EWS A;  3LAL A;  3ZSY A;  1XWL A;  4E3S A;  3NF9 A;  4CEQ A;  1BQM A;  1ILY A;  1WN7 A;  2CH6 A;  1Q9Y A;  4F2R A;  3G6E N;  5BN8 A;  1TKX A;  3LP1 A;  3DLL L;  3A5M C;  2NZT A;  3NH0 A;  3LWM A;  3CCR N;  3FR0 A;  4BC4 A;  1NGD A;  3SK3 A;  4FLZ A;  1N8R O;  3K57 A;  1WAF A;  5ADX H;  5ADX A;  3KKR A;  3AGR A;  2AP1 A;  1FKP A;  1QSL A;  2D0O A;  3L3U A;  4DUZ K;  4H0T B;  3B6P A;  3SNN A;  3I55 N;  5JVH L;  3I33 A;  4BC5 A;  4I9Q A;  5HRS A;  4E7I A;  4FZY A;  5KGX A;  4DU4 A;  4I6M B;  1OKJ A;  4WFB L;  2DPN A;  2CGJ A;  4CK2 A;  3QFP A;  5GIO A;  2EHG A;  4KB0 A;  3L8B A;  4CHO A;  4FW2 A;  4JI6 K;  5AQR A;  4B3T K;  3O4W A;  3QB0 A;  4NXN K;  4CEE A;  3E9L A;  4FWN A;  2FSN A;  3CFR A;  4FJH A;  4FZX C;  3VQ9 A;  3FGU A;  3KJV A;  3KLI A;  4A57 A;  4DQP A;  3CJC A;  1GLL O;  3DOL A;  3ZSR A;  1HNZ K;  2O8B A;  2VGM A;  3OYG A;  4FJX A;  4JD2 A;  2VG5 A;  4X66 K;  1NJY A;  5M1N A;  2YJE A;  3P5J A;  4CEO A;  2ZGZ A;  3L6Q A;  4JKB A;  1ESV A;  4FYD A;  4FJ5 A;  4C8L A;  4FWM A;  3DM2 A;  4KRF A;  3SAF A;  2HST A;  4BRE A;  1HKB A;  4E7K A;  4FVM A;  4CZG A;  4CD1 A;  4JKG A;  1VSE A;  2FF3 B;  3O3G A;  2GUI A;  3SAH A;  3VEX A;  1YVU A;  3VGM A;  1RBS A;  3H08 A;  4DMN A;  4CJK A;  4GV3 A;  1JLB A;  5BPL A;  4HCC A;  4ILG B;  4CJ7 A;  3U9Z A;  1RDD A;  4FJ9 A;  1RDW X;  4FCY A;  2XHB A;  1KFS A;  1QSS A;  3S3O A;  1QVF M;  4BAC A;  3HVT A;  2Y1I A;  3RTV A;  1ZYQ A;  2PAV A;  2HBL A;  5J2Q A;  3KD1 E;  4E89 A;  5JLF A;  3CF5 L;  5C0Y A;  4KH5 A;  3SV4 A;  3EO3 A;  3A8Y A;  2R7Y A;  4CZI A;  2BE2 A;  2QWQ A;  5KRS A;  2HHH K;  2NUB A;  2W6K A;  4CF0 A;  2Z1H A;  3MXI A;  3LDO A;  1G15 A;  3V81 A;  1FW6 A;  4BRQ A;  5F2R A;  4CHP A;  3H1V X;  1DEJ A;  4DSE A;  4EZ6 A;  2GEL A;  4CCH A;  3DXM A;  2Z1G A;  5BRH A;  1WAJ A;  5AR0 A;  3RMD A;  4H5N A;  4CFD A;  1U6Z A;  3CCE N;  3L2V A;  3PIP L;  3O08 A;  4CJW A;  4JLH A;  1K8A O;  3WXM B;  3M5R A;  3SUQ A;  3O4N A;  3K5L A;  3THY B;  3WEE B;  2X74 A;  4AIL C;  3NHG A;  4W5T A;  1R0A A;  1VQ8 N;  2OPR A;  5C42 A;  1ZBH A;  4RWT A;  3SBG A;  3ZT0 A;  1HKC A;  4CJT A;  4DV6 K;  5FRM A;  2VYP A;  4H0P A;  2UXB K;  3L4Q A;  4WQ5 A;  5CY4 A;  2OCE A;  4IZ9 A;  1U2V A;  1GOC A;  3FFI A;  4CK1 A;  1RT6 A;  2P9P B;  1N33 K;  3CCQ N;  1A5W A;  1TK0 A;  2ZQB A;  2E1Z A;  2GWJ A;  3P83 D;  3KK1 A;  5M1P A;  3M3Z A;  1XNQ K;  1RT2 A;  1OVY A;  1WSI A;  4W5Q A;  1IO2 A;  3O8M A;  4KH4 A;  2OA8 A;  3CIP A;  3KLG A;  2YNG A;  1JLC A;  3C6A A;  4A5B A;  3E01 A;  2CGK A;  3DLB A;  4CIG A;  4FK4 A;  1WSJ A;  3HRG A;  4WQ5 C;  2A1R A;  2HB5 A;  2QM1 A;  5SWM A;  4C1N I;  1IBM K;  3VEZ A;  5J1E A;  2UXD K;  3WXJ A;  2NRZ A;  1HQE A;  1RT3 A;  2UUB K;  3ENB A;  1GOA A;  4DTN A;  3FZH A;  3TAR A;  2ZWH A;  4NYF A;  3VEW A;  1TL1 A;  2HF4 A;  2HMP A;  5KQ8 A;  2YNH A;  3ISN C;  3JS6 A;  2VWJ A;  1D9F A;  2HHU A;  3CJA A;  1U47 A;  2OZM A;  4M3X A;  1DTT A;  3D2E A;  4M3R A;  2XY5 A;  4DSI A;  3LDN A;  2OTL N;  3T1Y K;  4BC3 A;  4OX9 K;  4KTQ A;  1SV5 A;  1Q18 A;  1K8K A;  1NK6 A;  4PA1 A;  3AAP A;  1N36 K;  3L0Q A;  4AHS A;  5C24 A;  4N56 A;  4BGA A;  4Y0W A;  2G8F A;  1VQ6 N;  2HND A;  4FK0 A;  2O8B B;  4Y1C A;  4BY9 C;  3DXK A;  3K5N A;  1XQS C;  4KFB A;  4LSN A;  3VEN A;  4JD2 B;  4K43 A;  2NLX A;  4DV1 K;  1R59 O;  3DI6 A;  3PSI A;  3WQT A;  5KRT A;  3ZSZ A;  2BDP A;  1KLN A;  4BRH A;  3KTQ A;  3SMP A;  1L3T A;  4DR7 K;  3AA2 A;  5FPM A;  1KAX A;  4CZE A;  2A40 A;  1IV0 A;  4DTX A;  2O4G A;  5KPR A;  1OH7 A;  3HM9 A;  4H0Y B;  3OS0 A;  4OLB A;  4ID5 A;  3M8S A;  3W0L A;  4JKG B;  4BRP A;  4F4K A;  4V19 S;  1E4G T;  1BCM A;  4B3O A;  4CF9 A;  3WUH A;  1U48 A;  3A5L C;  1BWF O;  2YHB A;  4CJS A;  2D0B A;  2WOM A;  1BA1 A;  1MDU B;  2O4I A;  4NB4 A;  3G71 N;  4LFA K;  2JWL A;  5M1Q A;  1SL0 A;  2E88 A;  4BWM A;  3G10 A;  2D4W A;  4MFB A;  4H5R A;  3DJC A;  3HM8 A;  3RR8 A;  3VTI A;  1S6P A;  4XIU A;  2QXL A;  3AO5 A;  4JI7 K;  3T7Z A;  4NO7 A;  3TAN A;  1SKS A;  1D5A A;  5M1O A;  1JCE A;  3AAQ A;  1C6V A;  1DGK N;  4YOY A;  3OTO K;  3OHR A;  3OYM A;  1NGI A;  4QCL A;  1X9S A;  3QLH A;  3C94 A;  3R9P A;  3D7E O;  1KAZ A;  1QZ6 A;  1M90 O;  3TAP A;  2RHK A;  5AQT A;  3DXM B;  1A5X A;  5C15 A;  3HP9 A;  2RKI A;  3FLC O;  3VF2 A;  1YJ9 N;  4CZJ A;  3HVR A;  3P1G A;  3O6W A;  4F8R A;  3MEG A;  5CYM A;  1KXP A;  2WFB A;  5LMU K;  5I3U A;  3DMJ A;  5CYQ A;  1T3V A;  4BRN A;  4FPA A;  3NF8 A;  4O8U A;  3R6M A;  3VF4 A;  2O8C A;  1VSD A;  3J7Y P;  1X9J A;  1UWB A;  2RF2 A;  1DKG D;  3ZX3 A;  4B9V A;  1REV A;  4KH6 A;  4YFU A;  5HBM A;  2F9W A;  3BP8 A;  3VES A;  2ASM A;  1B92 A;  4A61 A;  4JRP A;  2D0A A;  4B1Y B;  4M3Z A;  1RTJ A;  1ZC6 A;  3GOI A;  1NKE A;  2WUS A;  3EL2 A;  2E1Y A;  1CXQ A;  3C6T A;  4FJI A;  2NNW A;  3KK2 A;  3QBX A;  5J2N A;  1GLC G;  3TSQ A;  2UXC K;  1T7P A;  3F5T A;  5FRN A;  3V1R A;  4DSK A;  1ZBI A;  2HNZ A;  1RBU A;  4JK9 A;  4DF4 A;  3LAN A;  3MWT A;  1GLJ O;  1NNE A;  1C0T A;  1TYQ A;  1VSI A;  3GDQ A;  2E2O A;  4R5P A;  2A41 A;  3O5B A;  4CBW A;  1BA0 A;  4XEI A;  1HUX A;  5KTQ A;  1HR0 K;  1SZ2 A;  4KHY A;  2E6L A;  2W6L A;  3RMC A;  3OVN A;  3CCM N;  4BDP A;  1NGC A;  4IDK A;  1HPZ A;  1UA0 A;  3F9M A;  2Q1N A;  3L4I A;  5BPN A;  1S1V A;  4ELU A;  1UAX A;  3BGR A;  3CPE A;  4IOX A;  4H5T A;  1EX4 A;  3PIO L;  2DFE A;  2IOC A;  3ZEU A;  4U67 L;  2NRR A;  1RGI A;  4OPH A;  1LCU A;  2ITM A;  4EFH A;  4DLE A;  2JLE A;  1ZBL A;  3M8P A;  3HOT A;  3D2E B;  3ZX0 A;  2B6A A;  3E66 A;  1VQP N;  2D5R A;  4CJV A;  5C2D A;  4O44 A;  3OYH A;  3O9U A;  4J2E A;  2HBJ A;  1K8K B;  3DAW A;  3SZ2 A;  3TAG A;  4DFJ A;  1T05 A;  3AVF A;  3O80 A;  1VQM N;  3IFR A;  4HTL A;  3TSP A;  3DXK B;  5F0X A;  2E2P A;  4CGI A;  1E4F T;  3O9Q A;  4IOA L;  2DFF A;  2D0C A;  3MN5 A;  4BE0 A;  1QHT A;  4C8O A;  1HYV A;  4CEF A;  3CCU N;  1XMO K;  1WNS A;  4GY2 B;  3AVJ A;  2FSJ A;  2YKN A;  4M42 A;  1Q9X A;  2OPQ A;  5AQX A;  4CW7 B;  4BE1 A;  4BR2 A;  3M8R A;  3CCJ N;  5J2M A;  5I9E B;  3SUO A;  1YIJ N;  3H46 O;  1HX1 A;  5EOY A;  3K0S A;  4RCH A;  5AQW A;  4JKA A;  1SL1 A;  3GG4 A;  4ILJ A;  3AVG A;  3QIN A;  4GKJ K;  4CJQ A;  1NK4 A;  5CZ2 A;  3R8E A;  3UE5 A;  2QWR A;  3ZYY X;  2PYL A;  4CF1 A;  5M1K A;  5AFU H;  3BDP A;  5AFU A;  2VQF K;  3NH1 A;  1QHA A;  4GV9 A;  5T7B A;  2EX3 A;  1SKW A;  5KPT A;  2YCH A;  3GBT A;  3AVC A;  1JXE A;  1I3A A;  2KLA A;  1NGB A;  4X64 K;  1U4B A;  2VG7 A;  1X1P A;  3EY1 A;  4LFC K;  1YJN N;  3BZK A;  3KVG A;  4FWP A;  3OBY A;  4Z4F A;  4CZM A;  1DTQ A;  1JL2 A;  4JN4 A;  1SQK A;  4RW6 A;  4C1N K;  1MU2 A;  1NOY A;  2FXU A;  1M1K O;  4AHU A;  3O9R A;  3T19 A;  2KKZ A;  3NVM A;  4HUF A;  4FJM A;  4DTJ A;  2O8C B;  4OPJ A;  4I2P A;  1RTD A;  2FC0 A;  3VOV A;  3ZLJ A;  1LW0 A;  3H45 C;  4PHT X;  5J2P A;  1TV6 A;  5AQN A;  2P51 A;  3AA5 X;  3OJU A;  1T6D A;  3VMF B;  3CET A;  4WFA L;  3SPY A;  3ZSV A;  2F96 A;  4B9S A;  3ZSX A;  2FBX A;  3BEX A;  2YHX A;  4DQQ A;  4GMJ B;  4BE2 A;  2NRX A;  1GLF O;  4DFP A;  4OLA A;  4M41 A;  3LM2 A;  3EEQ A;  3MXJ A;  3AVA A;  5DK5 A;  4OKJ A;  4X65 K;  4JKE A;  4CHY A;  5KGW A;  3V9U A;  5A2Q O;  2P9U B;  5SZT A;  4E1N A;  2YHA A;  3CCV N;  3HJF A;  1X9M A;  4AF1 A;  1TYQ B;  3RSE A;  2D0P A;  4EHT A;  4CHZ A;  1WUA A;  3O9S A;  4IFE A;  3FE1 A;  5FPD A;  4CGJ A;  2ETJ A;  2Q0R A;  3CI5 A;  2ZJR L;  4I2Q A;  2A42 A;  4LF6 K;  3O1B A;  3ZEU B;  4CJ4 A;  3OYJ A;  4CK3 A;  1VAZ A;  4WE1 A;  2FBY A;  2A6A A;  4CGH A;  1K9M O;  3I8D A;  2V7Z A;  1GLB G;  4BR0 A;  3MWP A;  1RCH A;  1T8E A;  4WQ4 A;  1HMV A;  1EWR A;  4H0O A;  5BRD A;  3RR7 A;  2QEX N;  1TL3 A;  3NBP A;  2Q2R A;  4OVL A;  4NXM K;  1IH7 A;  2HMI A;  1L3U A;  4NCA A;  3LP3 A;  3M8Q A;  4C8K A;  1E3M A;  1HNV A;  3K5O A;  2F8T A;  4DQI A;  2I5J A;  2IVP A;  3KK7 A;  4DFK A;  1JCF A;  3LZI A;  4AHC A;  4Z0U A;  3AGK A;  2J4R A;  3KLF A;  1XNR K;  1IG8 A;  2KZM A;  3VQB A;  4R79 A;  4M3T A;  2JGU A;  4FOE A;  3A5O C;  1EKE A;  4B3M K;  1QTM A;  4FLT A;  1HJR A;  1Z26 A;  3BF3 A;  4FM2 A;  4IO8 A;  5C25 A;  4YDU A;  3TI0 A;  5EY4 A;  3AO2 A;  3MK6 A;  3EKS A;  3D45 A;  3DYA A;  1BOT O;  4CFC A;  3HT3 A;  4KPY A;  1MA9 B;  3QO9 A;  1C1C A;  1RDB A;  1D4X A;  3RWU A;  3CXC M;  3OW2 M;  4F9O A;  1YIT N;  1VK0 A;  4CJE A;  2P9L A;  5C10 A;  4DTM A;  1S9E A;  4Z4I A;  4KTZ A;  4YDU C;  3DRR A;  5GAE P;  3AV9 A;  1NM1 A;  4BRM A;  5IT9 O;  3SUP A;  2OZS A;  1NBW A;  2QKK A;  3NGZ A;  1S1U A;  5AQM A;  3SQ2 A;  4H5V A;  5EX5 A;  1W2B M;  3HI0 A;  5B8H A;  4DV0 K;  4DV3 K;  3I0S A;  4E0D A;  3A5N C;  3MMV A;  2NRV A;  1CZB A;  3QIC A;  3O3F A;  5JS2 A;  3PX0 A;  4CES A;  4QS9 A;  1C1A A;  4A2A A;  1RT1 A;  1Q8I A;  1C1B A;  4EAH D;  3LZJ A;  4B08 A;  2KTQ A;  4CD3 A;  2XY6 A;  2QKB A;  3EKU A;  4JHD A;  3UIQ A;  3AA4 A;  3LDQ A;  1FKO A;  5BN9 A;  4CVN E;  4MDA A;  2PY5 A;  5CR4 A;  1Z25 A;  5AQI A;  3VEV A;  1OH6 A;  4FJG A;  2QTD A;  1JL1 A;  1WLJ A;  5FPN A;  4B9T A;  3T1H K;  3V4I A;  2G8H A;  4CJP A;  4DWI A;  1FXX A;  4KHW A;  1WBD A;  4CEB A;  2AJQ A;  3DLR A;  1UOC A;  3OYL A;  1S6Q A;  3L2Q A;  1DLO A;  4M3U A;  4LF9 K;  4RW4 A;  1P8Z A;  3F2K A;  3CJ9 A;  4CED A;  2O8D A;  3QIP A;  1LW2 A;  2GEM A;  4ISE A;  4CZK A;  1X9W A;  4LY7 A;  1QQC A;  4CJ3 A;  1BHL A;  2HHQ A;  2KFN A;  5JIC A;  1U45 A;  4DQS A;  1VSK A;  3CER A;  1HLU A; 
#chains in the Genus database with same CATH homology
 2FBV A;  1S1X A;  3MEG A;  5CYM A;  3S9H A;  1LAV A;  3DLE A;  4F8R A;  2KZZ A;  2XRI A;  5I3U A;  1VSL A;  3DMJ A;  1KVB A;  5CYQ A;  2G8W A;  1TKZ A;  3ZSO A;  3NF8 A;  3ZT1 A;  4ICL A;  2KW4 A;  1WSH A;  2DTU A;  4CER A;  4FZZ A;  3DRS A;  1VSD A;  4KRE A;  3ULD A;  1UWB A;  2RF2 A;  1TVR A;  4B9V A;  4KI6 A;  1REV A;  4KHU A;  5HRR A;  4CGD A;  4YFU A;  1LV5 A;  5HBM A;  1ZBF A;  4MQ3 A;  3OYB A;  1B92 A;  3EZ5 A;  4BDZ A;  3AVM A;  3KLE A;  4JRP A;  3D0P A;  2D0A A;  2QXF A;  4DQR A;  4M3Z A;  4O5B A;  1RBV A;  4DSF A;  2ATQ A;  3LDS A;  4GW6 A;  4W5O A;  3JSM A;  4FJK A;  1RTJ A;  4DTU A;  1J9A A;  5HP1 A;  1NKE A;  4DU3 A;  3TWH A;  3WNE A;  1XHX A;  1BL3 A;  4LSL A;  1CXQ A;  3C6T A;  1ZBU A;  4FJI A;  2G8K A;  4CEZ A;  3KK2 A;  3S3M A;  4W5R A;  1EET A;  1WSE A;  5FRO A;  4E19 A;  3V1O A;  3OJS A;  3QEP A;  4K8X A;  2HVI A;  5J2N A;  4C8N A;  1EP4 A;  4FLX A;  2QK9 A;  2HHX A;  3ZT3 A;  4N5S A;  1C0U A;  1T7P A;  1J54 A;  4IFY A;  4M3Y A;  1YTU A;  1TAU A;  3SPZ A;  1JLA A;  1HRH A;  3T3F A;  3V6D A;  1IKW A;  1B9D A;  1JXB A;  4HUG A;  5FRN A;  4Z4G A;  3V1R A;  4DSK A;  4LH5 A;  1ZBI A;  4G1Q A;  4TSX A;  4M45 A;  4H8K A;  2HNZ A;  3TR8 A;  1RBU A;  4H4M A;  4DF4 A;  3LAN A;  3F73 A;  4FLY A;  1BI4 B;  3O4Q A;  4CFB A;  1J5O A;  3ITH A;  4CGF A;  3SJJ A;  3AO1 A;  1C0T A;  1VSI A;  3RMB A;  3KLH A;  4R5P A;  3KK3 A;  4Z4H A;  5KTQ A;  4KHY A;  3QNO A;  4AHT A;  4ZHR A;  3OS2 A;  3CG7 A;  4DU1 A;  4QOZ B;  2E6L A;  2BGG A;  3RMC A;  3OVN A;  3V9X A;  4Z4C A;  3PO4 A;  4BDP A;  4IDK A;  1BIU A;  1HPZ A;  2RN2 A;  3C95 A;  4CJU A;  2IC3 A;  3CM6 A;  2XY7 A;  3TAQ A;  1UA0 A;  3RRG A;  4Z4E A;  3HK2 A;  1S1V A;  4ELU A;  1UAX A;  3K58 A;  3SQ1 A;  3QEV A;  3HL8 A;  3LWL A;  1KVA A;  3BGR A;  4DLG A;  1IKY A;  5HRP A;  2Y1J A;  1GOB A;  1QS4 A;  4B9U A;  1EX4 A;  1LWC A;  4BDY A;  2DFE A;  2IOC A;  2PZS A;  2LSN A;  1HYS A;  4FM1 A;  3SUN A;  2B5J A;  3A2F A;  3DRP A;  4BWJ A;  3ZSQ A;  1N6Q A;  1KLM A;  4JS5 A;  3V9Z A;  1VSJ A;  2XY8 A;  4DLE A;  2JLE A;  1ZBL A;  3M8P A;  1RT4 A;  2B6A A;  3LAL A;  4IG3 A;  3ZSY A;  1XWL A;  3MED A;  4IFV A;  4E3S A;  2D5R A;  3NF9 A;  4CEQ A;  4CJV A;  1BQM A;  2YNI A;  1IG9 A;  4O44 A;  3OYH A;  1WN7 A;  1Q9Y A;  4ZTJ A;  4OGE A;  4F2R A;  4J2E A;  1BQN A;  1TKX A;  1LWE A;  3LP1 A;  1KRP A;  3DLK A;  3SZ2 A;  4RW8 A;  4OKK A;  4AH9 A;  3NH0 A;  3TAG A;  1RT7 A;  3OYE A;  3LWM A;  1A5V A;  4FLZ A;  4DFJ A;  3SYZ A;  4CEA A;  4Q0B A;  1T05 A;  3AVF A;  3K57 A;  1WAF A;  2KQ2 A;  3KKR A;  1EXQ A;  4CGI A;  2X78 A;  5FDL A;  2DFF A;  2D0C A;  5K14 A;  1FKP A;  4BE0 A;  1QHT A;  1QSL A;  3L3U A;  1TGO A;  3TAB A;  4C8O A;  3B6P A;  2HW3 A;  3QEI A;  1HYV A;  2IDO A;  4I9L A;  4CEF A;  3SQ0 A;  1WNS A;  3SNN A;  4DSL A;  3AVJ A;  1ASV A;  2YKN A;  4HVJ A;  4CHQ A;  4M42 A;  3QET A;  4Y1D A;  1NJW A;  4I9Q A;  5HRS A;  1VRU A;  1KCF A;  1Q9X A;  4E7I A;  4FZY A;  5KGX A;  2OPQ A;  4DU4 A;  4BE1 A;  4CK2 A;  3M8R A;  2EHG A;  4KB0 A;  3V1Q A;  3L8B A;  1TKT A;  4CHO A;  5J2M A;  4FW2 A;  2HHS A;  4EZ9 A;  3SUO A;  3OYN A;  1BIZ A;  3PV8 A;  2X6N A;  4CEE A;  1NK7 A;  3CFR A;  1B9F A;  1QSY A;  1K6Y A;  3O3H A;  4FJH A;  1KFD A;  1SL1 A;  4FZX C;  1VSM A;  3AVG A;  3QIN A;  4H4O A;  3VQ9 A;  3VQC A;  2OPS A;  3KLI A;  3VQA A;  4CJQ A;  3KJV A;  4HTU A;  1NK4 A;  2GBZ A;  3DOL A;  4DQP A;  3ZSR A;  3THV A;  1NKB A;  1LWF A;  1U04 A;  5CZ2 A;  4NYN A;  1QE1 A;  3VQQ A;  4CJR A;  3OYG A;  4LH4 A;  3PUF A;  4CIE A;  3OY9 A;  4FJX A;  3HXM A;  1BCO A;  3PY8 A;  2VG5 A;  1NJY A;  5CZ1 A;  3QEX A;  3ASM A;  4RW7 A;  2PYL A;  1RTI A;  3P5J A;  2RPI A;  4CEO A;  4CF1 A;  3BDP A;  3LP0 A;  3CFP A;  1NOZ A;  2G8V A;  1S1W A;  4PY5 A;  1KTQ A;  4FXD A;  5E41 A;  4FYD A;  4CF2 A;  4FJ5 A;  4C8L A;  3NH1 A;  5JS1 A;  3AO4 A;  5T7B A;  1UA1 A;  2EX3 A;  4FLU A;  1SKW A;  3DM2 A;  4FJL A;  4KRF A;  4ZTF A;  4KV8 A;  1VRT A;  2IS3 A;  1TK8 A;  3AVC A;  4B8C A;  4M3W A;  1JXE A;  1IKX A;  2HHW A;  3AA3 A;  4CFA A;  2WON A;  1I3A A;  4O55 A;  4E7K A;  4FVM A;  4J2A A;  3QER A;  3LPU A;  3T1A A;  1VSE A;  3RRH A;  4FLV A;  3V9W A;  3O3G A;  3K5M A;  1U4B A;  2VG7 A;  2GUI A;  3JYT A;  1X1P A;  3EY1 A;  1F21 A;  1YVU A;  5HRN A;  3AVH A;  3NGY A;  1RBS A;  3H08 A;  4DMN A;  4Z4F A;  4CJK A;  1DTQ A;  3IG1 A;  1JL2 A;  1NK5 A;  1JLB A;  1RDC A;  3AVI A;  2Z1I A;  4IG0 A;  1ITG A;  4HCC A;  4RW6 A;  1JKH A;  4J2D A;  1MU2 A;  1RDD A;  1NOY A;  4FJ9 A;  4FCY A;  2XHB A;  1KFS A;  1QSS A;  3MAQ A;  3S3O A;  4AHU A;  4BAC A;  3HVT A;  3VQ4 A;  4HUE A;  1S5J A;  3RTV A;  4DS4 A;  2Y1I A;  1TKD A;  1ZYQ A;  3ZT4 A;  4CGG A;  2B4J A;  3T19 A;  3ZT2 A;  3NF6 A;  4KAZ A;  4FJ8 A;  5J2Q A;  3IS9 A;  4HUF A;  3KD1 E;  4E89 A;  4FJM A;  4DTJ A;  3IAY A;  3SV4 A;  1W0H A;  3C6U A;  2R7Y A;  3HYF A;  4F2S A;  4LD0 A;  4OPJ A;  4I2P A;  1RTD A;  2BE2 A;  2FC0 A;  5KRS A;  3K59 A;  1LW0 A;  2NUB A;  1TK5 A;  3AVL A;  3MEC A;  4CF0 A;  5J2P A;  2Z1H A;  3MXI A;  1TV6 A;  3OYA A;  3VQE A;  4FJN A;  3QES A;  1RDA A;  2P1J A;  2P51 A;  3AA5 X;  1G15 A;  3CFO A;  3OJU A;  2BAN A;  1NK0 A;  3V81 A;  2OYQ A;  4KKO A;  3SPY A;  4DS5 A;  5DMR A;  4CHP A;  3NAE A;  3ZSW A;  3HPH A;  3ZSV A;  2F96 A;  4B9S A;  4DFM A;  3ZSX A;  4DSE A;  2FBX A;  4EZ6 A;  4DTS A;  3ALY A;  4CHN A;  4CCH A;  1N5Y A;  2Z1G A;  4DQQ A;  1WAJ A;  3NF7 A;  3RMD A;  4OJR A;  4GMJ B;  4BE2 A;  4CFD A;  2XO7 A;  1I39 A;  4DFP A;  1XC9 A;  4M41 A;  4OLA A;  3L2V A;  3MXJ A;  5DK5 A;  3AVA A;  4FJ7 A;  4OKJ A;  4CJW A;  4JLH A;  4AHV A;  4KHN A;  1T03 A;  4OPK A;  3LAK A;  4YNQ A;  4CHY A;  5KGW A;  3VQ6 A;  3V9U A;  1XHZ A;  2ZD1 A;  4N47 A;  1W9H A;  3K2P A;  3SUQ A;  3O4N A;  3K5L A;  1U49 A;  5SZT A;  2X74 A;  2YHA A;  4E1N A;  4AIL C;  1RBR A;  3OYC A;  1KSP A;  4DSJ A;  3HJF A;  3NHG A;  3NFA A;  4W5T A;  1R0A A;  1X9M A;  1JLF A;  2OPR A;  4QAG A;  5C42 A;  2P5O A;  4CEC A;  4EP4 A;  3CQ8 A;  3SI6 A;  1ZBH A;  3HPO A;  4FK2 A;  4CHZ A;  3ZT0 A;  3VN5 A;  4CJT A;  4OKE A;  5FRM A;  3PX6 A;  4E7L A;  2A1S A;  3HST B;  3VQD A;  3VQ8 A;  4CGJ A;  5CY4 A;  1NJZ A;  2ETJ A;  3CYM A;  1GOC A;  3FFI A;  4CK1 A;  1RT6 A;  1S9G A;  4I7F A;  3VQ7 A;  1A5W A;  2ITG A;  4DF8 A;  4I2Q A;  3SCX A;  1TK0 A;  2ZQB A;  3U3G A;  3OS1 A;  4JS4 A;  3P83 D;  2OPP A;  3KK1 A;  1O1W A;  1RT2 A;  1LAW A;  3NE6 A;  1WSI A;  4W5Q A;  1IO2 A;  4E7H A;  4CJ4 A;  1SUQ A;  2OA8 A;  2Z1J A;  3OYJ A;  4CK3 A;  3KLG A;  2YNG A;  4WE1 A;  1JLC A;  2FBY A;  4CGH A;  4KHS A;  3I8D A;  3E01 A;  3DLB A;  4B9N A;  2Q3S A;  1JLG A;  2VG6 A;  4N41 A;  1RCH A;  1T8E A;  3SV3 A;  1HMV A;  4CJF A;  4CIG A;  3RR7 A;  4KHQ A;  1BI4 A;  4FK4 A;  1WSJ A;  1TL3 A;  5HLF A;  3NBP A;  2A1R A;  3OYK A;  2HB5 A;  4OVL A;  5SWM A;  3NGI A;  1IH7 A;  2HMI A;  1J53 A;  1Y97 A;  2E6M A;  3QEW A;  5J1E A;  1L3U A;  4NCA A;  3LP3 A;  3M8Q A;  4C8K A;  1HQE A;  2F8S A;  1HQU A;  3TAE A;  2W42 A;  1RT3 A;  1HNV A;  2PYJ A;  3K5O A;  1GOA A;  4KO0 A;  4DTN A;  2F8T A;  3U6F A;  4F3O A;  4DQI A;  3I0R A;  2I5J A;  1RT5 A;  3TAR A;  3OYD A;  4FM0 A;  3OYF A;  3DOK A;  4NYF A;  4DFK A;  1TL1 A;  3LZI A;  3ZCM A;  4Z0U A;  4AHC A;  1RNH A;  3KLF A;  2YNH A;  3ISN C;  4N76 A;  2VWJ A;  1D9F A;  4JRQ A;  4FW1 A;  2HHU A;  1U47 A;  2OZM A;  2HNY A;  4M3X A;  3S3N A;  1DTT A;  1VSF A;  1RBT A;  4M3R A;  3WNH A;  3KD5 E;  2KZM A;  3VQB A;  2XY5 A;  3V9S A;  3KKS A;  4M3T A;  2JGU A;  1EKE A;  1NK9 A;  5HRO A;  4DSI A;  4NCB A;  2GV9 A;  1RTH A;  2ZE2 A;  1QTM A;  4FLT A;  1HJR A;  2E4L A;  1Z26 A;  1HNI A;  1L3V A;  4KTQ A;  1SV5 A;  4O4G A;  1S1T A;  1BIS A;  3NH2 A;  4FM2 A;  1NK6 A;  5C25 A;  3TI0 A;  4DG1 A;  1NKC A;  3AO2 A;  3DLG A;  4PA1 A;  4ELV A;  1D9D A;  3D45 A;  3DYA A;  4CF8 A;  3L2U A;  3G0Z A;  4PUO A;  4AHS A;  2KFZ A;  3QIO A;  5C24 A;  4B8A B;  1SKR A;  4CFC A;  4N56 A;  3DLH A;  3HT3 A;  2G8F A;  4C8M A;  2HHV A;  2YV0 X;  2HND A;  3WNG A;  3SQ4 A;  4KPY A;  4FK0 A;  3QO9 A;  1C1C A;  4W5N A;  4KB1 A;  4Y1C A;  1JLE A;  3K5N A;  4KFB A;  4LSN A;  1KVC A;  1RDB A;  3L2W A;  3EYZ A;  3RWU A;  3AO3 A;  3HP6 A;  4PWD A;  1CZ9 A;  1VK0 A;  2FBT A;  3DI6 A;  4CJE A;  3QNN A;  3MXM A;  3VQ5 A;  5KRT A;  1XI1 A;  3ZSZ A;  5EU7 A;  2BDP A;  4DTM A;  1KLN A;  4AHR A;  1ASU A;  1S9E A;  4Z4I A;  4DTO A;  4KTZ A;  3DRR A;  3KTQ A;  3B6O A;  3OYI A;  4J2B A;  3AV9 A;  1L3T A;  1CLQ A;  4IKF A;  2YNF A;  2IGI A;  3AA2 A;  1VSH A;  4FLW A;  3SUP A;  2OZS A;  4DTX A;  3NGZ A;  2QKK A;  1S1U A;  2O4G A;  3SQ2 A;  1L5U A;  4ELT A;  1TAQ A;  3HM9 A;  4KI4 A;  3OS0 A;  4Q5V A;  5I42 A;  4L8R B;  4OLB A;  4B9M A;  1D8Y A;  1FK9 A;  4ID5 A;  3M8S A;  3I0S A;  3AVB A;  4GVM A;  4E0D A;  3NCI A;  4F4K A;  2DFH A;  1BCM A;  1CZB A;  4O0J A;  3WNF A;  4CF9 A;  3VA3 A;  1U48 A;  4B3O A;  3O3F A;  2G8U A;  5JS2 A;  3PX0 A;  2YHB A;  4UQG A;  2HHT A;  1IKV A;  3L3V A;  4CES A;  3HPG A;  4CJS A;  2D0B A;  2WOM A;  4K8Z A;  1YT3 A;  1C1A A;  4CIF A;  4O0I A;  4DTR A;  1BGX T;  1RT1 A;  1Q8I A;  1C1B A;  1CXU A;  3LZJ A;  4B08 A;  4EP5 A;  2O4I A;  5D3G A;  2KTQ A;  4DTP A;  3LP2 A;  1NJX A;  2VWK A;  1RIL A;  2X6S A;  1SL0 A;  4E1M A;  2XY6 A;  2G8I A;  2QKB A;  4BWM A;  3G10 A;  2DY4 A;  3UIQ A;  3AA4 A;  1FKO A;  4IBN A;  4MFB A;  3PO5 A;  2PY5 A;  3LPT A;  2P5G A;  1Z25 A;  4CJ5 A;  3RR8 A;  4FJG A;  3IRX A;  4HHT A;  1JL1 A;  1SL2 A;  1S6P A;  1WLJ A;  4XIU A;  4B9T A;  3AO5 A;  4E7J A;  3V4I A;  2G8H A;  4CJP A;  4B9L A;  4DWI A;  5KI6 A;  1FXX A;  4FJJ A;  3TAN A;  4KHW A;  1SKS A;  4CEB A;  2HVH A;  3DLR A;  1D5A A;  2AJQ A;  1UOC A;  3OYL A;  1C6V A;  1S6Q A;  3CM5 A;  3MEE A;  3VQP A;  3OYM A;  3RMA A;  3L2Q A;  4OGC A;  1DLO A;  3AVK A;  4M3U A;  4RW4 A;  1NK8 A;  4PQU A;  4HCB A;  1L3S A;  4QCL A;  3U3Y A;  1X9S A;  2IAJ A;  3KIO A;  3QLH A;  3LAM A;  1WSF A;  4ID1 A;  3C94 A;  4F3T A;  3F9K A;  3TAM A;  3L2R A;  3AVN A;  4RW9 A;  4RG8 A;  4CED A;  3TAF A;  1JLQ A;  3QIP A;  1LW2 A;  4CJL A;  1HYZ A;  4CE9 A;  1X9W A;  3TAP A;  1WSG A;  4KTW A;  4LY7 A;  1YTA A;  1QQC A;  1A5X A;  1C0M A;  2YKM A;  3HP9 A;  4CJ3 A;  1BHL A;  2HHQ A;  2RKI A;  3NDK A;  1ASW A;  2KFN A;  3VA0 A;  3PX4 A;  1U45 A;  3HVR A;  1VSK A;  4NCG A;  4DQS A;  3HO1 A;  3P1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...