3VA0A

Crystal structure of rnase t in complex with a di-nucleotide product (gg) with one mg in the active site
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
207
structure length
207
Chain Sequence
b'TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 65
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3va0A00
1S1VA 4E19A 3SUNA 3K58A 1ASVA 4KB0A 4OLBA 4I9QA 3U6FA 3LDSA 4RW6A 2KZMA 3RR7A 4Z4FA 4J2AA 1QSYA 3ZSYA 2HNYA 4DTNA 4B08A 3LAKA 4RW7A 3KLFA 4C8MA 3CFOA 1KFDA 2XY6A 3HYFA 1S1UA 1L3SA 1DLOA 2BANA 4Z0UA 3VQPA 4M42A 3OS0A 4JLHA 1UA1A 4CJVA 4CFCA 4DSJA 2DFEA 3DM2A 3NF9A 4OVLA 3TAFA 1HRHA 5HRSA 2Z1GA 3T19A 4DQQA 1NOZA 4Z4IA 1D8YA 3PX4A 3TR8A 3LANA 4KAZA 4Y1CA 1JXEA 4NYNA 1ASUA 1X9WA 4B9UA 1RILA 1QHTA 3AA2A 3O3GA 3V4IA 1EETA 3TI0A 3KD5E 1RTIA 3HL8A 3AVHA 3MEDA 1MU2A 3OYAA 4W5TA 4CFBA 2HHVA 2IC3A 3HPGA 2YKNA 3TABA 1X1PA 1ZBUA 4CJRA 1C0UA 3VQCA 4F8RA 4OLAA 1B9FA 4KPYA 4CF1A 4C8KA 1BQMA 3CQ8A 4AHVA 3KK2A 1SKRA 5KGXA 1TV6A 4FJJA 1EXQA 3QNNA 1TKZA 3G0ZA 1XC9A 3O3FA 3U3YA 1S1TA 1RBTA 4DTPA 3QEVA 1C1AA 3M8QA 2I5JA 4LH5A 1O1WA 3KLEA 2G8FA 1J54A 1LAWA 3IAYA 3V9XA 5J2NA 2KW4A 4E7LA 1T8EA 4FM0A 2BGGA 3K57A 4CK1A 5J2QA 2X74A 5JS1A 1YVUA 3OJSA 4C8LA 3OYKA 2Z1JA 3EY1A 3NCIA 1NKCA 4CHPA 5C24A 1TL1A 4FJHA 4K8XA 4DTRA 2EX3A 5HBMA 4DQRA 4MFBA 2PY5A 2GBZA 5CYQA 4FM1A 1QTMA 4PA1A 4CJFA 3NF8A 2QXFA 1QSSA 5KRSA 1R0AA 3V81A 4OPJA 4DSIA 4BDZA 4B9TA 3OYFA 3IS9A 1RBUA 4CF8A 5J1EA 3SCXA 4IFYA 4FW2A 4B8AB 3EZ5A 3VQQA 1LW0A 4RG8A 3QEWA 1D9DA 1QSLA 4M3YA 3ALYA 1VRUA 3ZCMA 3OS1A 1JXBA 4HUEA 1IKXA 1S9EA 3LP1A 4CECA 1QQCA 3SYZA 1Z25A 1JLFA 1RCHA 2ZQBA 3V9UA 1ZBLA 4KHSA 3CYMA 4AILC 1YTUA 3ITHA 4CJPA 1GOBA 2KZZA 1WLJA 3NHGA 1XHZA 3OS2A 4CJTA 3TAEA 1HQEA 3VQ9A 3OYLA 2OA8A 3NGIA 1J53A 2B5JA 4N5SA 2G8VA 2RF2A 4FLXA 2ZE2A 1IKYA 4CERA 4HHTA 1Z26A 1WSGA 4Z4EA 2HHTA 4BE0A 2P5OA 3MXIA 4W5QA 4FJMA 2X6SA 3NF7A 1S5JA 4PUOA 3F73A 4FW1A 4FM2A 1KVBA 3ZSOA 4FCYA 4CIGA 2P51A 1VSMA 3ZT2A 1D9FA 3S3NA 3AVBA 1W0HA 2QK9A 4ICLA 3MAQA 1C0TA 1HMVA 1SL0A 5EU7A 4DFKA 4CF9A 4C8NA 1ZBFA 1KLMA 4QOZB 3LWLA 3NAEA 1B9DA 4CCHA 2X78A 1KCFA 4GW6A 1T03A 2IOCA 3KKSA 4DTMA 3DLBA 3QETA 4DF4A 1RDAA 1LV5A 4TSXA 1Q9XA 3NH1A 4FLVA 1SL1A 3HVTA 4CGGA 3DRSA 2F8SA 5HRPA 2G8WA 3NGZA 4E7HA 5KTQA 2YNFA 4FLYA 1NK5A 1S1WA 1T7PA 4DS4A 2R7YA 1N6QA 2YV0X 1HNIA 3L3UA 3C94A 3ZSXA 1ASWA 5HP1A 1NKBA 4NCAA 2HHQA 1TAUA 1L5UA 1VRTA 3P83D 4NYFA 3VQEA 3S3OA 3ZSRA 3HJFA 4FYDA 3K2PA 4C8OA 2G8HA 1LAVA 4E1NA 4FK2A 4FJNA 3WNGA 4CGDA 3OJUA 3OVNA 4B9MA 3IG1A 3ISNC 5KGWA 2IAJA 4LSNA 4J2BA 1C1BA 4CFAA 2G8UA 4I9LA 3M8SA 3KLGA 4W5NA 1YTAA 2Z1HA 2DY4A 2Q3SA 4LH4A 4I7FA 4DU4A 4RW8A 2DTUA 1VSHA 3LPTA 1RBSA 1FK9A 4AHUA 5DK5A 1NK8A 4F3TA 3LP2A 1I39A 4CJQA 1KRPA 3UIQA 3G10A 2KFZA 1VSFA 2A1SA 3AVCA 3O4NA 3PY8A 3AO4A 4IKFA 4Z4HA 2KTQA 4MQ3A 1L3TA 3DMJA 3AO3A 4B9VA 1TGOA 3HVRA 1NJYA 4BWMA 4E3SA 5D3GA 1SKWA 1IO2A 2IGIA 3H08A 1REVA 4QAGA 4CHOA 2OPSA 3NDKA 4DTSA 3RMBA 4OJRA 2PYLA 1TK8A 4F2RA 2PYJA 2XO7A 3LZJA 2BE2A 4DSEA 3QNOA 3THVA 3SNNA 4PY5A 2HNZA 1BL3A 1LWEA 3LP3A 4Z4CA 1NK9A 1VSKA 4CESA 1HQUA 2OPRA 4QCLA 1DTTA 1NJZA 5C42A 3SUOA 1TK5A 1RT1A 2P1JA 2YHBA 4J2EA 4CEAA 3NH0A 3C6TA 2VG5A 4CF0A 4DLEA 5DMRA 4FJKA 3SQ2A 3MEEA 4I2PA 1RT4A 4KHNA 2KQ2A 3WNFA 3B6OA 5C25A 1RTDA 1WAFA 4O4GA 4CEEA 1BI4A 3BGRA 3EYZA 3AVIA 4KI4A 3KK1A 1BHLA 1C6VA 1LW2A 4CF2A 2HNDA 2HB5A 3KK3A 1U4BA 3SZ2A 1SKSA 1KFSA 3HO1A 2E6LA 4FLZA 4JS5A 1NK7A 1RBVA 4DTJA 3HT3A 3AA4A 3OYJA 4HUGA 4CIFA 4YNQA 2LSNA 5FDLA 3L2QA 3SQ0A 4F4KA 3AV9A 4FJ5A 2VG7A 4M3TA 4Q0BA 1NJWA 1XWLA 5CY4A 3V1OA 4UQGA 3CFRA 3LAMA 4AHRA 4CGHA 4DS5A 4IDKA 3V6DA 3TAGA 3AVLA 3K59A 3TAQA 3VN5A 1ZYQA 4M3WA 2B6AA 1Q9YA 4FJ9A 4AHTA 2FC0A 1RBRA 2XY5A 4OPKA 1RDCA 1U47A 1WAJA 4DFJA 3L8BA 3KJVA 4B9SA 1XI1A 1NJXA 3KTQA 3ZSQA 4Z4GA 1TKTA 2F96A 4HVJA 1S1XA 2XY8A 3LWMA 4CJ5A 4E7IA 1NK0A 1Y97A 2HMIA 1UOCA 4WE1A 3LALA 4FJXA 4KRFA 3QLHA 4LY7A 3NGYA 1KTQA 3M8RA 4FLUA 1JLCA 4DQPA 3DOKA 1SV5A 3VQ7A 4CJWA 4O0JA 4E7JA 1U49A 4M3UA 3L2RA 1CXUA 4PWDA 3KIOA 5HRRA 4CJLA 2QKBA 4RW4A 2Z1IA 4F2SA 4DSKA 3NH2A 3RMCA 2XY7A 4DSFA 2E4LA 1EKEA 1BQNA 4E0DA 3QINA 4CJKA 2A1RA 4L8RB 3MXMA 2F8TA 2HW3A 2OZSA 4KTWA 4DSLA 3AA3A 4DQIA 3PUFA 3HP6A 1SUQA 3L2UA 1QE1A 3SQ1A 4FK0A 5HROA 4FJ7A 1CXQA 4DTOA 3QERA 2ETJA 2DFHA 2XHBA 4GMJB 4OKJA 4H4OA 3HK2A 1SL2A 3I0SA 4CHZA 2FBTA 4EZ9A 3QEXA 4FJGA 3AVMA 4CEFA 4BWJA 3L2VA 4FXDA 4ELTA 4KHWA 1RTJA 4F3OA 2RPIA 3NE6A 4B9LA 2OYQA 1S6PA 3A2FA 3TANA 4ELUA 3V1QA 1BCMA 3ASMA 1JLEA 2G8KA 1WSFA 5SWMA 3O3HA 1XHXA 2FBYA 4E7KA 3OYCA 1UWBA 2YKMA 1BGXT 3K5LA 2B4JA 3AVJA 4Q5VA 1YT3A 1KVAA 5CZ1A 3ULDA 4DWIA 3AVFA 2BDPA 4B3OA 1RDBA 1VSJA 4RW9A 1GOAA 3ZT0A 3AA5X 4CHQA 2W42A 1UA0A 3OYNA 4M3RA 1IG9A 3V9WA 4CE9A 4N76A 4DFPA 3TAPA 1JKHA 3QEPA 2NUBA 3VQDA 3RWUA 3NFAA 1QS4A 4KI6A 4J2DA 4DU1A 2O4GA 1JLGA 5K14A 4KHQA 3ZT1A 1N5YA 1B92A 4YFUA 1NOYA 4FZZA 2FBXA 4CJSA 3HPHA 4CK3A 3TARA 2GUIA 3B6PA 4EP5A 1WSHA 4ZTJA 1J9AA 3RMDA 2OPQA 2GV9A 3AO2A 1X9MA 2HHUA 4ID1A 2VWJA 4FJIA 4NCBA 3SJJA 1LWCA 4ZHRA 4KV8A 3OYMA 4BACA 4KO0A 5HLFA 1JLAA 4W5OA 4LD0A 3VA0A 2QKKA 1JL1A 1WNSA 2RN2A 4CHNA 1JLQA 4OKKA 2YNHA 4ZTFA 1S9GA 4ID5A 3PO4A 5CYMA 3VQ5A 4AHSA 4EZ6A 1KLNA 1KSPA 4IG3A 5E41A 1A5VA 4FLTA 1BIZA 3SQ4A 3L3VA 3OYEA 2AJQA 3VQ4A 4CEBA 1G15A 1TK0A 3RRGA 2FBVA 2YHAA 1TVRA 4E89A 3WNHA 2Y1IA 1VK0A 1IKWA 3C95A 1DTQA 3TAMA 3LPUA 3LZIA 1BIUA 4CEQA 4Y1DA 1FKOA 2OPPA 4N47A 3DYAA 4KTZA 3VQ8A 1ITGA 4FZYA 2IS3A 3NF6A 4O0IA 3DRPA 3CFPA 4JRQA 2HHSA 2KFNA 4DFMA 3E01A 4KHUA 3HSTB 3DOLA 3DLHA 1BI4B 3PV8A 3T1AA 3K5NA 2Y1JA 4CIEA 1JL2A 1C0MA 1RDDA 1RT2A 1HYZA 3KKRA 3F9KA 4OKEA 4DTUA 5I3UA 1WSJA 1TKXA 1W9HA 3KLHA 3JSMA 3HM9A 3DLRA 1CLQA 4B8CA 2JLEA 3PX6A 2RKIA 3SPZA 3PX0A 3V9ZA 4CJ3A 2ATQA 1NKEA 1GOCA 3K5OA 4JS4A 4N41A 3DRRA 4HCBA 4NCGA 3AO5A 3WNEA 5I42A 4CHYA 4H8KA 1NK6A 4BE2A 3RMAA 3SV3A 3U3GA 4BDYA 3OYGA 3TWHA 4O44A 3MXJA 1S6QA 2IDOA 4CGJA 2ZD1A 4AH9A 3AVGA 3HPOA 4CJEA 3RRHA 3S3MA 1K6YA 4XIUA 3BDPA 1WSEA 4DQSA 1HNVA 3QIPA 5FRNA 3VQAA 1CZ9A 2YNGA 4M41A 3ZSWA 5T7BA 4DMNA 4EP4A 4DU3A 3RR8A 2ITGA 4IFVA 4O55A 3S9HA 1NK4A 2D0BA 3HXMA 3IRXA 1U45A 3CM6A 3MEGA 4CEOA 1U04A 2VG6A 2XRIA 3SPYA 4HCCA 2HHXA 4KTQA 3O4QA 1UAXA 3QEIA 3OY9A 5SZTA 1A5XA 2D0CA 3K5MA 4E1MA 1RT6A 5JS2A 4B9NA 4OGCA 3OYBA 1TAQA 1WSIA 3DI6A 1VSDA 1BISA 3QESA 5J2PA 1L3VA 3AVAA 1BCOA 3AO1A 3VQ6A 4R5PA 4KKOA 3V1RA 3CM5A 2P5GA 1T05A 2PZSA 4M3XA 1HYSA 4GVMA 3NBPA 4I2QA 4DF8A 4JRPA 4H4MA 1EX4A 3C6UA 4KB1A 4FJ8A 4CGFA 4O5BA 1KVCA 1IKVA 3HP9A 3LP0A 2YNIA 4OGEA 4CJ4A 3D0PA 3MECA 4PQUA 4FJLA 1RT3A 2WONA 2HVIA 4FK4A 3QIOA 4KREA 2OZMA 2D5RA 4CGIA 2JGUA 4IBNA 1U48A 4ELVA 4M3ZA 3VQBA 4DLGA 5J2MA 2O4IA 5CZ2A 4KFBA 1Q8IA 2G8IA 4M45A 1D5AA 3DLKA 3I0RA 3QO9A 2X6NA 4FVMA 3ZSVA 3JYTA 1TL3A 1L3UA 3KD1E 4HUFA 5KI6A 1A5WA 4N56A 1VSEA 5FRMA 3OYHA 4FZXC 4FLWA 4CEZA 3OYIA 1ZBIA 1F21A 1RTHA 3V9SA 2E6MA 1ZBHA 4BDPA 1J5OA 2D0AA 3D45A 1VSIA 4CFDA 4W5RA 2WOMA 1FKPA 2VWKA 3PO5A 3SUQA 5HRNA 3L2WA 3SUPA 3SI6A 1EP4A 4HTUA 1IH7A 2DFFA 3M8PA 3T3FA 1VSLA 2HVHA 3P5JA 1RT5A 1FXXA 4AHCA 3P1GA 3ZSZA 3VA3A 2EHGA 1HYVA 1HJRA 3I8DA 1LWFA 3OYDA 4CEDA 5FROA 4KHYA 4DG1A 1WN7A 3AVNA 3CG7A 4LSLA 1TKDA 1I3AA 3RTVA 3DLGA 4BE1A 3KLIA 3ZT3A 4CK2A 3FFIA 4G1QA 3DLEA 1JLBA 3SV4A 1RNHA 1C1CA 1RT7A 4IG0A 4K8ZA 1CZBA 3AVKA 3ZT4A 5KRTA 1X9SA 2HHWA 4DTXA 1HPZA 4CJUA
chains in the Genus database with same CATH superfamily
2YHXA 1S1VA 3SUNA 1ASVA 5LJVA 1BA1A 5EY4A 4RW6A 5AQIA 3RR7A 2ITMA 1C0FA 4B08A 3LAKA 2XY6A 3HYFA 3HM8A 4CD3A 1DLOA 2BANA 2NRHA 3VQPA 3B8AX 4M42A 1YAGA 4JLHA 5KQDA 4CJVA 4CFCA 2GWKA 3VTHA 1HRHA 3R9PA 3J7YP 1EWRA 3I33A 4DQQA 1NOZA 3ULEA 3TR8A 2FSNA 4M7YA 3O3GA 3KD5E 3TI0A 1YF5L 5KPTA 1HJOA 2IC3A 3CCRN 4LC9B 3VMFB 4F8RA 1B9FA 4KPYA 4C8KA 3CQ8A 1QZ6A 4K25A 1EXQA 3U3YA 1S1TA 3O80A 3MX2A 2I5JA 5IWAK 4DHYA 3V9XA 1YITN 4YORA 5AFUH 1YVUA 1TYQA 2A6AA 3O9RA 3FZHA 3NCIA 1RDWX 2D0PA 2KKZA 2GBZA 5CYQA 4FM1A 4CJFA 1OH8A 4OPJA 2P9KB 4B9TA 2W41A 2NRRA 1D9DA 3QEWA 4HUEA 2QW9A 1S9EA 3VF2A 3T1HK 1JLFA 3V9UA 3CYMA 4AILC 1YTUA 4CJPA 2KZZA 3OS2A 1HQEA 3VQ9A 2RF2A 4WQ5A 5E84A 1Z26A 1WSGA 4H5WA 1VQPN 4FWOA 5AQLA 3NF7A 1S5JA 2I7PA 3ZSOA 1VSMA 2P51A 3S3NA 1W0HA 2BTFA 2QK9A 3RSEB 3GOIA 4DUYK 1HMVA 1HR0K 2WFBA 1KLMA 3CIPA 5F0XA 1KCFA 4GW6A 1T03A 3D2EB 3VF6A 1ESVA 4DTMA 3DLBA 4JKGA 1RDAA 2QA4N 3NH1A 2A42A 5GAGP 4IEIA 1GLAG 3UKRB 4DS4A 3BP8A 2R7YA 1N6QA 5AQZA 4NCAA 3L3UA 3G4SN 1M90O 2HHQA 2GWJA 3HJFA 4FOIA 1YXQA 4E1NA 4CGDA 4JI5K 1NGAA 3OVNA 3CCSN 3C6AA 3SAGA 1N34K 2G8UA 4WCEL 1WBBA 3PIOL 3KLGA 4W5NA 5LMUK 1YTAA 2DY4A 2Q3SA 1BDGA 4LH4A 4DU4A 1VSHA 3LPTA 4F3TA 1U2VB 4YOWA 1ATRA 1S3XA 1KRPA 3VETA 1NNEA 2AP1A 3R3LA 1TGOA 3D7EO 4E3SA 3FLCO 4DTSA 2PYLA 2E8AA 1TK8A 2O8BA 1NM1A 2PYJA 3MMVA 4H5NA 2XO7A 3LZJA 3G6EN 3EE8A 1Z6RA 3LL3A 3CHWA 2YHYA 4CEAA 3NH0A 3C6TA 4CF0A 4DLEA 3SQ2A 3MEEA 4I2PA 3WNFA 3B6OA 3WUHA 5C25A 1WAFA 1T6CA 2HBKA 4LFCK 4C1NI 2D4WA 3O4WA 3UE5A 3KK1A 1BHLA 1C6VA 3KK3A 5JVGL 2E6LA 4FLZA 3HT3A 4CIFA 4YNQA 5FDLA 1BA0A 3E66A 4JKHA 4DKWA 3CJ7A 4CI6A 4UQGA 4AHRA 3TAQA 4DS5A 3V6DA 3K59A 4M3WA 2B6AA 5KPZA 4OPKA 1C0GA 3OA9A 3KJVA 1NJXA 2F9TA 3KTQA 4HVJA 1S1XA 1VQ5N 3H6EA 5AQQA 3LALA 4KRFA 1NGJA 3QLHA 4CZMA 3NGYA 4KBOA 4CZKA 3DOKA 3DXMA 3VQ7A 1U49A 4CJLA 4RW4A 4PKGA 4BRQA 3D6RA 2WC9A 5JLHA 4CJKA 2F8TA 3MXMA 3R1XA 4KTWA 4DQIA 4YDUA 3HP6A 5FLXO 1SUQA 3L2UA 1HKGA 2E20A 4FJ7A 4DTOA 3QERA 2DFHA 2JWLA 5FPDA 5C15A 4OKJA 4H4OA 2ZGYA 1SL2A 3UB5A 3I0SA 2NRWA 4EZ9A 3CXCM 4FJGA 1OVQA 4F3OA 3NE6A 1S6PA 3TANA 3ASMA 4BRFA 3FZLA 3CF5L 1UWBA 4YDUC 3H45C 3AVJA 4B3OA 2QEXN 1VSJA 2V7YA 1ZC6A 4QS9A 4JN4A 3OYNA 1IG9A 2W6LA 4N76A 4F9OA 2NUBA 2GELA 5GIPA 4DU1A 3ID8A 1JLGA 5K14A 4KHQA 3E9PA 4YFUA 1QVFM 2AA4A 1Y64A 3B6PA 2HF4A 1J9AA 3RMDA 2GV9A 2HHUA 3CERA 4JI7K 3SJJA 4DR5K 3PIPL 1QQOA 4WFBL 4BACA 4DR4K 4KO0A 1JLAA 1TUYA 4LD0A 3VA0A 1JLQA 4HWIA 1MWMA 3VQ5A 4AHSA 4IO9L 3WQUA 1KSPA 4IG3A 5E41A 1A5VA 3OYEA 5LL6Z 4CEBA 2QTDA 1YIJN 2FBVA 1VK0A 1OKJA 3C95A 1DTQA 3TAMA 3LZIA 4JKFA 4CEQA 1YJ9N 4KTZA 1GLLO 1IBKK 4FZYA 2HHSA 2KFNA 4DFMA 3E01A 2UUAK 3CCLN 3DOLA 3DLHA 3T1AA 2P9NB 5AQMA 4ISEA 1RT2A 4JI1K 1LCUA 3DLRA 4ISFA 4B8CA 1K8KA 2RKIA 4YOVA 3PX0A 2ATQA 2YI1A 2O8DB 4GV3A 3BF3A 4N41A 3AO5A 4MLHA 3ZX2A 1XMOK 4JD2B 3OYGA 1IBMK 3CCEN 4CGJA 3BDPA 4CJEA 3RRHA 4XIUA 4JI3K 1GLCG 3C6HA 4M41A 4DMNA 2E2NA 1EQYA 2ITGA 3U8XA 2D0BA 3JS6A 3MEGA 2Q97A 2O8FA 2P9KA 4DV3K 5SZTA 2D0CA 3K5MA 4WQ4A 1TAQA 1VSDA 5J2PA 1L3VA 2P5GA 4H0TB 1V4TA 2F7TA 3V1RA 3A5LC 4KH6A 4JRPA 1EX4A 2NNWA 3THWB 4O5BA 2YNIA 4FJLA 1N8RO 4H0YB 1U48A 2O4IA 5GADP 3VQBA 4DLGA 4KFBA 2G8IA 4WQ4C 2CGKA 4LF7K 4HUFA 1A5WA 4OO1J 4N56A 5EVZA 1VSEA 4FPBA 1F21A 4A59A 1K9MO 1NLVA 3O9TA 5HRNA 3L2WA 3SUPA 1O13A 1EP4A 4HTUA 4DR2K 3T3FA 3O9QA 1VSLA 3P5JA 5EOYA 3KZBA 3P1GA 5H1SQ 5AQGA 2GEMA 3UKRA 3DLGA 3DLEA 2KLAA 3QBXA 4JI0K 1CZBA 1X9SA 4DTXA 4PA1A 1W2BM 3MN6A 1HKCA 4MLEA 3VGKA 4I9QA 1IG8A 3LDSA 4Z4FA 1QSYA 4R79A 3ZSYA 3PLAA 2HNYA 4G9ZA 4RW7A 3KLFA 1KFDA 1S1UA 1U2VA 5CE3A 4DSJA 3DM2A 2P9IB 4BRKA 5HRSA 3T19A 1XC3A 3S41A 4KAZA 4Y1CA 4YOXA 2UXCK 1QHTA 4BR9A 3NVMA 1GLFO 3AVHA 2YKNA 4BROA 3TABA 1X1PA 4CF1A 4KH5A 3KK2A 1SKRA 1TV6A 5BPNA 4BRCA 4FJJA 1XC9A 1C1AA 3KWIA 4PHTX 1QVGM 5AQFA 1O1WA 1LAWA 4IXCA 5AQPA 3DJCA 3K57A 5KPRA 4JYAK 2X74A 2ASPA 1VQ9N 3OJSA 1BO5O 4CZJA 4CHPA 3CMAN 1MDUB 4FJHA 4DTRA 5HBMA 4JKCA 1YUWA 1N36K 3MDQA 3NF8A 2QXFA 1R0AA 2WBNA 1RBUA 5J1EA 4IFYA 4B8AB 4IDHA 3EZ5A 3ZCMA 1JXBA 1IKXA 3U9DA 5EX5A 4NXMK 3SYZA 1RCHA 2ZQBA 1T44A 4MDBA 5GINA 1R59O 3NGIA 2B5JA 4BY9C 4CERA 2PFUA 3CC2N 4BE0A 2P5OA 5GAEP 3P4IA 4FJMA 5LY3A 3FFKB 4FW1A 4FCYA 2RHKA 4LF6K 3CCMN 1D9FA 2V7ZA 1C0TA 2HMPA 3TSQA 3NAEA 1B9DA 3WXIA 3E9LA 3J80O 4TSXA 1Q9XA 2V52B 3HVTA 3WEEB 1WUAA 3H1QA 3O1BA 3NGZA 5KTQA 1NK5A 1T7PA 1X3NA 1TAUA 1VRTA 4EHTA 3S3OA 1TUUA 4QS8A 3ZSRA 1LAVA 3HI0A 2Q2RA 5KGWA 4LSNA 4K43A 1C1BA 4CFAA 4U67L 1FK9A 4AHUA 1NK8A 4JHDB 1I39A 4CJQA 2KFZA 1VSFA 1GLJO 3O4NA 3HOSA 3WXKA 3FGUA 4MQ3A 3DMJA 3CPWM 3WXLA 1NJYA 3K0SA 4BWMA 2QI2A 4OJRA 4F2RA 3DXKB 4DSEA 2BE2A 3QNOA 3SNNA 4PY5A 3CC4N 1NK9A 1VSKA 5AR0A 1HQUA 2NLXA 3P31A 4YOUA 5C42A 1TK5A 2P1JA 2ZM6K 2Q0RA 4FWLA 2VG5A 3FZKA 2Q0UA 2V51B 2HHHK 4X64K 3C65A 1RT4A 4KHNA 2O8EA 2Q1NA 1RTDA 4CEEA 1KQSM 2P9NA 3F9MA 3L4IA 2UUCK 2ZGZA 1BG3A 3MN5A 3HO1A 1SKSA 4BC2A 1NK7A 4DTJA 3SQ0A 3OYJA 3SBTA 3L2QA 4F4KA 4FJ5A 3AV9A 4ILJA 2O8DA 1NJWA 1XWLA 1NMNA 3Q7BA 3CFRA 5JMVA 1KAZA 3LAMA 4IDKA 2QXLA 3AVLA 1ZYQA 4EFHA 1Q9YA 4JD2A 1EWQA 2FC0A 1T3VA 2XY5A 3WT0A 1P8ZA 1WAJA 4B9SA 3ZSQA 4Z4GA 3VGMA 1X3MA 1NK0A 1Y97A 2HMIA 1UOCA 4FJXA 4FO0A 5BR9A 5AQUA 4M3UA 1SV5A 4E7JA 3L2RA 1CXUA 1HKBA 3KIOA 5HRRA 2QKBA 3KHYA 2FF6A 3NH2A 3RMCA 4XH5A 2XY7A 1EO1A 2E4LA 2HW3A 3DWLA 2A1RA 4H5TA 2OZSA 3OTOK 2ZJRL 1QQNA 1VQON 2ETJA 4BR4A 1VQ8N 4YY3K 4BREA 4BWJA 1Q82O 4ISGA 3CJ1A 3A2FA 4MDAA 1YVNA 2G8KA 1WSFA 3EZWA 5SWMA 1XHXA 4EHUA 4Z94A 3O3HA 4E7KA 3AVFA 1RDBA 3ZEUA 4RW9A 3VTIA 3ZT0A 3KK7A 3AARA 5M1OA 4CHQA 3J7AP 2CH5A 1UA0A 4FWSA 3THXA 4M3RA 5AQTA 5A2QO 4DFPA 1HLUA 5AQJA 4LFAK 3TARA 1NJIO 3IDHA 1W7AA 1X9MA 4QS7A 1XQSC 5AFUA 4NCBA 4BC5A 1FJGK 4OKKA 4ZTFA 3PO4A 4DQ8A 3W3DA 1KLNA 3VF4A 3SQ4A 3RRGA 2YHAA 3WNHA 4ILHA 2Y1IA 2P9IA 1KD1O 1NMDA 3LPUA 1XNRK 4Y1DA 2P9PA 3CD6N 4BGAA 1OH7A 5FPMA 3J8AA 2IS3A 3NF6A 1QQMA 4GNIA 2OTLN 1C0MA 2P9UA 1HYZA 2FSJA 3F9KA 4DTUA 5I3UA 1WSJA 1TKXA 3CJAA 2F9WA 3HM9A 1T6DA 1CLQA 2BH1A 4JKDA 1NKEA 4DV5K 1Q18A 4JI4K 4JS4A 1BUPA 3HRGA 4HCBA 4NCGA 3E1YA 3H3NO 5I42A 4CHYA 3EO3A 2YJEA 4AM7A 1OH5A 3SV3A 3U3GA 4BDYA 4WFAL 2P9LB 3S3MA 3AVGA 1NWKA 1WSEA 3UKUA 3TSUA 5FRNA 3VQAA 5GIOA 3AAPA 3ZSWA 4DU3A 4EP4A 3RR8A 1BU6O 4B1WB 3HXMA 3IRXA 1U45A 3CM6A 2VG6A 4JKEA 1ATSA 5TKYA 4E1MA 1RT6A 5JS2A 5AZIB 4OGCA 4B1VA 1WSIA 4DR1K 1NG9A 4BQZA 2RE2A 3AVAA 4R5PA 4FWKA 1HYSA 3EN9A 3NBPA 1N33K 4H4MA 3C6UA 4KB1A 4FJ8A 4OGEA 4CJ4A 1ATNA 5AQNA 5AQRA 2HF3A 4KREA 2OZMA 3MN9A 4KHPK 2NRZA 1Q8IA 3VEOA 3QO9A 3JYTA 3ZSVA 4FVUA 1RGIA 4H0OA 5KI6A 4IO8A 5FRMA 3MWTA 4B1XB 3D2FB 3M1FA 4CEZA 4EIAA 3JAMO 1RTHA 3OYIA 1GLEG 2E6MA 1ZBHA 4CZIA 3D45A 1VSIA 4CFDA 4YOTA 4OPAA 2DFFA 4X65K 2IVOA 4C1NK 1FXXA 3QDKA 4ILGB 3VA3A 3ZSZA 2J4RA 3WEEA 1LWFA 4KHYA 3RVCA 1WB9A 1I3AA 2ZWHA 3RTVA 3ZT3A 5AQSA 1C1CA 4DCHA 1RT7A 2QWOA 4IG0A 4K8ZA 3ZT4A 2HHWA 1HPZA 2ZJPL 4KB0A 3G71N 3U6FA 4Y0WA 2KZMA 4J2AA 1GLBG 4JK7A 4DTNA 4C8MA 5DM6L 4Z0UA 1UA1A 3NF9A 2Z1GA 1CZAN 3K9JA 4Z4IA 3PX4A 3GBTA 3ULEB 3CCUN 1JXEA 3L0QA 4NYNA 5BREA 1X9WA 1RILA 4B9UA 3AA2A 2F4VK 1EETA 5GAHP 1JCFA 3MEDA 4YOYA 1MU2A 2HHVA 3N4PA 4CFBA 4W5TA 3HPGA 2VQEK 4WF9L 4JAXA 4CJRA 3H3OB 1BQMA 3O9UA 5MLCQ 3CMEN 3KVGA 5BPMA 3G0ZA 3O3FA 4DTPA 3QEVA 5BN8A 4LH5A 3IAYA 5J2NA 2KW4A 4E7LA 2KHOA 1T8EA 4FM0A 2BGGA 4B9QA 5CHIA 3VGLA 3R8EA 4E1JA 4K42A 5JS1A 1J5EK 4C8LA 4B1YB 2Z1JA 1NKCA 5F1XA 5C24A 1YJNN 5LJWA 3A5OC 2EX3A 4MFBA 4XH4A 1QTMA 3CCJN 1QSSA 2NRVA 5KRSA 4FWMA 3MCPA 3CETA 3A0IX 3FR0A 4DSIA 3AGKA 2VGMA 3OYFA 3IS9A 2QWMA 4CF8A 3SCXA 1V4SA 1LW0A 3VQQA 3FZFA 5ELZA 2PBDA 4A61A 1VQKN 1QSLA 3OS1A 1VRUA 3EL2A 3LP1A 2HSTA 4DR7K 2BUPA 1Z25A 1IJJA 4KHSA 4LF8K 3ITHA 1WLJA 3NHGA 3CJBA 4FWNA 5I9EB 3MK6A 1J53A 4IFEA 4N5SA 3I56N 3CC7N 4FLXA 4GV6A 3ZLJA 2ZF5O 4HHTA 3HBTA 3TSPA 2HHTA 4W5QA 3EEQA 2X6SA 4CIGA 3RSEA 4B3TK 2HBLA 3K9KA 3MAQA 4DV2K 2WUSA 5EU7A 4QOZB 1ZBFA 4BRAA 2X78A 4CCHA 3D2EA 2IOCA 2HBMA 3DAWA 5C10A 4JKGB 1LV5A 4AQYK 5ADXA 1NGEA 1SL1A 1J6ZA 4CGGA 1OVYA 3P38A 3DRSA 2F8SA 4E7HA 1S1WA 4IJAA 1HNIA 3C94A 1MWKA 1L5UA 4NYFA 3VQEA 2G8HA 1Z05A 3MX5A 4IOCL 4B9MA 2IAJA 1SAZA 4I9LA 3M8SA 5HL7L 1D4XA 5KQ8A 4I7FA 4RW8A 5FPEA 2DTUA 1RBSA 5AQWA 5DK5A 2HOEA 3LP2A 1HPMA 3ZYYX 3G10A 3ID6A 3AVCA 3AO4A 4IKFA 3F5TA 4A2BA 2KTQA 3ATUA 3AO3A 3BY5A 3HVRA 1ZXOA 4NLBA 1LOTB 5D3GA 1IO2A 1REVA 2D1KA 4BRDA 2OPSA 3RMBA 3EKSA 4PL8A 1E4GT 2HNZA 4JNEA 3LP3A 1NU0A 4Z4CA 2OPRA 1ZBSA 4JK9A 3U9ZA 4M7XA 2YHBA 3U4LA 4J2EA 5DMRA 4A5AA 3IFRA 4BVOA 3EYZA 4KI4A 4FPAA 4CF2A 3AAQA 2HNDA 3ZETB 3SZ2A 3SLCA 4JS5A 4DUZK 3AA4A 4HUGA 3VESA 2LSNA 1X9JA 2VG7A 4Q0BA 5CY4A 1ILYA 4CGHA 3HOTA 5FPNA 2YCHA 2UYTA 4HTLA 2OANA 4IWVA 5BN9A 1RDCA 1U47A 2P9LA 4DR6K 3EE9A 2E1ZA 3L8BA 4BRHA 1XI1A 3QFPA 1TKTA 2F96A 1OH6A 3QICA 1S72N 3OHRA 4WE1A 4LY7A 1KTQA 3M8RA 1IBLK 1JLCA 4DQPA 4MO5A 4CJWA 4PWDA 2Z1IA 3GG4A 5AQYA 4DSFA 5AZIA 3BZCA 4NLCA 4DSLA 3AA3A 1KAXA 3PUFA 1QE1A 3SQ1A 2FSKA 4GMJB 2H3GX 2O8CB 3N4QA 4CHZA 3R6MA 1H1VA 2VYPA 3M6GA 1VAZA 4FXDA 4KHWA 1RTJA 3PSFA 3FZMA 2OYQA 4ELUA 1JLEA 3IKMA 2FBYA 1JCEA 4AM6A 3OYCA 2YKMA 4O5FA 5EXWA 3K5LA 2B4JA 3D2FA 4Q5VA 1YT3A 1KVAA 4DWIA 4LFBK 2BDPA 1GOAA 2UU9K 4BG9A 5C2FA 3V9WA 2CGJA 4A57A 4CE9A 3QEPA 4KI6A 3NFAA 3H46O 2ZJQL 3ZT1A 1N5YA 1B92A 4NXNK 3JXUA 2A40A 4CK3A 2GUPA 4BR2A 4EP5A 1WSHA 4ZTJA 3AO2A 4ZHRA 5HLFA 1DGKN 1JL1A 1WNSA 2GTDA 2RN2A 4CHNA 3THYB 1S9GA 4ID5A 4BGBA 3WXJA 1E4FT 5B8HA 1BIZA 3L3VA 4LF4K 3VQ4A 3SK3A 1TK0A 4E89A 1IKWA 1G99A 4IEEA 3ZX0A 2YJFA 3OBWA 3J7ZO 3VQ8A 1ITGA 3CFPA 4JRQA 3CQYA 4BRPA 4KHUA 3HSTB 1BI4B 3PV8A 4B3RK 3K5NA 4CIEA 1JL2A 1RDDA 2DPNA 3KKRA 5BRHA 3WXMB 1KAYA 4BRGA 2JLEA 3ENBA 1K8KB 3PX6A 3BUZB 4H0PA 1HNZK 3CCQN 3O6WA 1GOCA 3K5OA 3DRRA 2W6KA 3M5RA 3WNEA 4GVEA 2ASMA 5AQKA 4CW7B 2NZTA 1S6QA 2IDOA 2ZD1A 4AH9A 4U7BA 1K6YA 1HNVA 3QIPA 1K73O 2VWBA 2D0OA 3ENOA 3S9HA 1NK4A 4CJ7A 1U04A 4FOEA 5AQVA 4HCCA 4KTQA 2O8FB 4DR3K 3O4QA 1UAXA 3QEIA 3OY9A 1RFQA 5LMNK 4B9NA 3OYBA 3QESA 3TTDA 2E2PA 3QB0A 3CPEA 1BCOA 3AO1A 3VQ6A 4BR5A 4I2QA 4DF8A 3THWA 4H0VB 4A5BA 1NGGA 1IV0A 1IKVA 3HP9A 4PQUA 3MECA 1RT3A 2WONA 2QWPA 2HVIA 4FK4A 3QIOA 4IOXA 2D5RA 4CGIA 2JGUA 5DM7L 4ELVA 4GKJK 1D5AA 3DLKA 3I0RA 3KD1E 2X6NA 4CD1A 3G25A 3OYHA 3IMXA 4FZXC 4FLWA 4BDPA 2D0AA 4W5RA 2WOMA 2VWKA 3SUQA 4BG8A 1P90A 3T1YK 3SI6A 3E9OA 1RDUA 4WQ5C 3L6QA 4AHCA 2IVNA 2FF3B 2EHGA 3I8DA 3OYDA 4CEDA 3HSCA 4DG1A 1WN7A 4MO4A 2QWNA 3CG7A 4WYBA 4CBXA 3O08A 5M1QA 3FFIA 4JI6K 1JLBA 1I94K 4DV0K 3AVKA 5KRTA 1KC8O 2PAVA 4CJUA 3QNNA 4OLBA 4E19A 3K58A 3PSIA 3CFOA 2QWQA 1L3SA 4WFNL 2YX6A 3QBWA 3OS0A 1YI2N 4XH1A 1MA9B 1QHAA 3TPQA 4BQLA 2DFEA 3TAFA 4OVLA 3C0BA 5BR8K 3OBYA 1D8YA 3TTCA 3LANA 4GV9A 1ASUA 3C7NB 1K8AO 3I8BA 3V4IA 1RTIA 2E1YA 3HL8A 3OYAA 1VQ6N 1ZBUA 1C0UA 3VQCA 4OLAA 4JV5K 3LM2A 4AHVA 5E26A 4C23A 5KGXA 5M1FA 3SBGA 1TKZA 4BRLA 2UXBK 3Q7CA 1RBTA 3M8QA 1JCGA 2G8FA 3KLEA 1NGFA 1J54A 1N32K 1BWFO 3HTVA 4X66K 4CK1A 5JVHL 5J2QA 4DV4K 5AQXA 1NBWA 3OYKA 4NO7A 3EY1A 3ZETA 1BOTO 4IZ9A 2A5XA 1TL1A 2E88A 4K8XA 1XNQK 4DQRA 4BR0A 2PY5A 3V81A 4BRMA 4B1UB 2IIRA 4BDZA 5CR4A 5AZJB 4K0KK 4OPHA 1NGIA 4FW2A 3L4QA 4FL9A 4RG8A 1FW6A 4M3YA 3ALYA 4BRIA 4A62A 3FE1A 3VEZA 4CECA 1WOQA 1QQCA 2NRXA 3SMSA 2E2QA 3M3ZA 4XEIA 1ZBLA 1VQNN 3LDOA 1GOBA 4L3QA 2NRTA 1XHZA 4CJTA 3TAEA 3OYLA 2P9SB 2OA8A 2G8VA 4H0XB 4I6MB 3OW2M 2ZE2A 3SAFA 1IKYA 1DEJA 5C12A 4Z4EA 1HNXK 3MXIA 3VEYA 4O8UA 4PUOA 3F73A 4FM2A 1GLDG 1KVBA 3O1WA 3ZT2A 3AVBA 4FWPA 4ICLA 3MCAB 1SL0A 4DFKA 4CF9A 4C8NA 2O8CA 4CVNE 3LWLA 2QWLA 3KKSA 4CZGA 3QETA 4DF4A 4FLVA 4JKBA 1Q7YO 3CQXA 2JWKA 5HRPA 2G8WA 2YNFA 4RTFD 4FLYA 1Q86O 2YV0X 5HP1A 3ZSXA 1ASWA 3LDQA 1NKBA 5M1KA 3P83D 4FYDA 2VGNA 3K2PA 4C8OA 4B3MK 4FK2A 4FJNA 3WNGA 4J2BA 3OJUA 3IG1A 3ISNC 4CBUA 3T7ZA 1JJ2M 3SJHA 3SAHA 3MN7A 2Z1HA 2Q31A 3BEXA 1VQ4N 3VENA 2VCPA 4JHDA 2GX9A 4FSVA 3A8YA 3GE1A 3GL1A 3UIQA 2HBJA 2ASOA 2A1SA 3PY8A 4DV6K 4Z4HA 1L3TA 2I7NA 2YHWA 4B9VA 4PKIA 3EKUA 3THYA 1SKWA 2IGIA 3H08A 4CHOA 4QAGA 1SZ2A 3NDKA 3DXKA 5M1PA 3SMPA 4X62K 3THVA 1KXPA 1NGCA 3W0LA 3DLLL 4CZFA 4KH4A 1BL3A 1LWEA 4CESA 5TKWA 4QCLA 1DTTA 1NJZA 3SUOA 4M63C 1W97L 1RT1A 4EAHD 5ADXH 2A3ZA 4FJKA 2KQ2A 5AQOA 2O8EB 1HUXA 4O4GA 1BI4A 3BGRA 1VQ7N 3AVIA 1LW2A 1TYQB 2HB5A 3VPZA 2E2OA 1U4BA 1KFSA 1RBVA 3F2KA 5AQHA 3A5MC 4BR7A 4M3TA 2W40A 4RCHA 3QFUA 2IVPA 5JLFA 3V1OA 4BVPA 3CI5A 3TAGA 3VN5A 1E3MA 4FJ9A 4AHTA 1RBRA 3H1VX 2E5LK 2CGLA 1HX1A 4DFJA 3WQTA 2FLOA 5JICA 2XY8A 3LWMA 1VHXA 4CJ5A 4E7IA 1S22A 3TU5A 4FLUA 4CBWA 4O0JA 4BC4A 4CZEA 3GDQA 4F2SA 4DSKA 1EKEA 1BQNA 4E0DA 3QINA 3LDLA 4L8RB 5BRFA 4IOAL 2CH6A 1DT9A 3AGRA 5HROA 1CXQA 4A2AA 2XHBA 1YJWN 4JI8K 3HK2A 3NVKA 2FBTA 3QEXA 2Q36A 3AVMA 4CEFA 3KWGA 3L2VA 4ELTA 4O8KA 2RPIA 5AJ3K 4B9LA 1QZ5A 3V1QA 1BCMA 3VEWA 5BRDA 1BGXT 1HNWK 5CZ1A 3ULDA 3ATVA 4CZHA 1NGBA 3ZEUB 3AA5X 5F2RA 2W42A 4BC3A 3THXB 3VEXA 3TAPA 1JKHA 3RWUA 3VQDA 3I55N 1QS4A 4J2DA 2O4GA 3BZKA 1NOYA 4B3SK 4FZZA 2FBXA 4CJSA 3HPHA 2GUIA 4DB3A 1XUPO 2OPQA 5M1NA 1DKGD 4ID1A 3HZ6A 2VWJA 2UUBK 4FJIA 1LWCA 1Q81O 4KV8A 3OYMA 4W5OA 2QKKA 3MWPA 4DV1K 2YNHA 3IUCA 2O8BB 5CYMA 4EZ6A 2WTUA 4PL7A 4FLTA 2AJQA 1XMQK 4DV7K 1YHQN 1G15A 1TVRA 4CZLA 3A5NC 1BIUA 5BPLA 4YHHK 1M1KO 1FKOA 2OPPA 2P9PB 3DYAA 4N47A 3O9SA 4GY2B 3ZX3A 4O0IA 3C7NA 3DRPA 4LF5K 4RWTA 4H5RA 2Y1JA 4BRNA 2A41A 2P9UB 4OKEA 3T69A 3O8MA 2VQFK 1W9HA 3KLHA 3JSMA 3CJ9A 3AY9A 1NGHA 4JKAA 3VEVA 3SPZA 3V9ZA 4CJ3A 3O5BA 3P39A 3BF1A 2FXUA 4H03B 1U6ZA 4J8FA 4H8KA 1NK6A 4BE2A 3RMAA 3CJCA 4JI2K 3TWHA 4O44A 3MXJA 5IT9O 2EWSA 3HPOA 4IJNA 4DQSA 3UKUB 3ENHA 1CZ9A 4H5VA 2YNGA 3LDPA 5T7BA 4O55A 4IFVA 4CEOA 2XRIA 3DXMB 3SPYA 4UY8O 2HHXA 2OTJN 5AZJA 1NGDA 1A5XA 3VERA 4FK0A 3DI6A 1BISA 4KKOA 3CM5A 1T05A 2PZSA 4M3XA 2OCEA 4GVMA 5C0YA 4FWQA 4CGFA 1KVCA 3LP0A 3NMUA 3D0PA 2P9SA 4I6MA 5C2DA 4M3ZA 4IBNA 4GKKK 5J2MA 5CZ2A 1VQLN 4M45A 4NB4A 1SQKA 4FVMA 1L3UA 1TL3A 4K41A 3QMLA 4V19S 1ZBIA 4FWRA 3V9SA 1J5OA 3VOVA 1FKPA 1SS6A 3PO5A 4AF1A 2UXDK 1IH7A 4JK8A 3M8PA 1WBDA 3TTFA 2HVHA 1RT5A 4LF9K 3LDNA 5HOOA 4B1ZA 1VQMN 1HYVA 1HJRA 5FROA 2QWRA 3AVNA 3LM9A 4LSLA 1TKDA 4JEPA 4BE1A 3KLIA 4CK2A 4G1QA 3J81O 3SV4A 4OX9K 1RNHA 4PKHA 2QM1A 3CCVN
chains in the Genus database with same CATH topology
1S1VA 4E19A 3SUNA 3K58A 1ASVA 4KB0A 4OLBA 4I9QA 3U6FA 3LDSA 4RW6A 2KZMA 3RR7A 4Z4FA 4J2AA 1QSYA 3ZSYA 2HNYA 4DTNA 4B08A 3LAKA 4RW7A 3KLFA 4C8MA 3CFOA 1KFDA 2XY6A 3HYFA 1S1UA 1L3SA 1DLOA 2BANA 4Z0UA 3VQPA 4M42A 3OS0A 4JLHA 1UA1A 4CJVA 4CFCA 4DSJA 2DFEA 3DM2A 3NF9A 4OVLA 3TAFA 1HRHA 5HRSA 2Z1GA 3T19A 4DQQA 1NOZA 4Z4IA 1D8YA 3PX4A 3TR8A 3LANA 4KAZA 4Y1CA 1JXEA 4NYNA 1ASUA 1X9WA 4B9UA 1RILA 1QHTA 3AA2A 3O3GA 3V4IA 1EETA 3TI0A 3KD5E 1RTIA 3HL8A 3AVHA 3MEDA 1MU2A 3OYAA 4W5TA 4CFBA 2HHVA 2IC3A 3HPGA 2YKNA 3TABA 1X1PA 1ZBUA 4CJRA 1C0UA 3VQCA 4F8RA 4OLAA 1B9FA 4KPYA 4CF1A 4C8KA 1BQMA 3CQ8A 4AHVA 3KK2A 1SKRA 5KGXA 1TV6A 4FJJA 1EXQA 3QNNA 1TKZA 3G0ZA 1XC9A 3O3FA 3U3YA 1S1TA 1RBTA 4DTPA 3QEVA 1C1AA 3M8QA 2I5JA 4LH5A 1O1WA 3KLEA 2G8FA 1J54A 1LAWA 3IAYA 3V9XA 5J2NA 2KW4A 4E7LA 1T8EA 4FM0A 2BGGA 3K57A 4CK1A 5J2QA 2X74A 5JS1A 1YVUA 3OJSA 4C8LA 3OYKA 2Z1JA 3EY1A 3NCIA 1NKCA 4CHPA 5C24A 1TL1A 4FJHA 4K8XA 4DTRA 2EX3A 5HBMA 4DQRA 4MFBA 2PY5A 2GBZA 5CYQA 4FM1A 1QTMA 4PA1A 4CJFA 3NF8A 2QXFA 1QSSA 5KRSA 1R0AA 3V81A 4OPJA 4DSIA 4BDZA 4B9TA 3OYFA 3IS9A 1RBUA 4CF8A 5J1EA 3SCXA 4IFYA 4FW2A 4B8AB 3EZ5A 3VQQA 1LW0A 4RG8A 3QEWA 1D9DA 1QSLA 4M3YA 3ALYA 1VRUA 3ZCMA 3OS1A 1JXBA 4HUEA 1IKXA 1S9EA 3LP1A 4CECA 1QQCA 3SYZA 1Z25A 1JLFA 1RCHA 2ZQBA 3V9UA 1ZBLA 4KHSA 3CYMA 4AILC 1YTUA 3ITHA 4CJPA 1GOBA 2KZZA 1WLJA 3NHGA 1XHZA 3OS2A 4CJTA 3TAEA 1HQEA 3VQ9A 3OYLA 2OA8A 3NGIA 1J53A 2B5JA 4N5SA 2G8VA 2RF2A 4FLXA 2ZE2A 1IKYA 4CERA 4HHTA 1Z26A 1WSGA 4Z4EA 2HHTA 4BE0A 2P5OA 3MXIA 4W5QA 4FJMA 2X6SA 3NF7A 1S5JA 4PUOA 3F73A 4FW1A 4FM2A 1KVBA 3ZSOA 4FCYA 4CIGA 2P51A 1VSMA 3ZT2A 1D9FA 3S3NA 3AVBA 1W0HA 2QK9A 4ICLA 3MAQA 1C0TA 1HMVA 1SL0A 5EU7A 4DFKA 4CF9A 4C8NA 1ZBFA 1KLMA 4QOZB 3LWLA 3NAEA 1B9DA 4CCHA 2X78A 1KCFA 4GW6A 1T03A 2IOCA 3KKSA 4DTMA 3DLBA 3QETA 4DF4A 1RDAA 1LV5A 4TSXA 1Q9XA 3NH1A 4FLVA 1SL1A 3HVTA 4CGGA 3DRSA 2F8SA 5HRPA 2G8WA 3NGZA 4E7HA 5KTQA 2YNFA 4FLYA 1NK5A 1S1WA 1T7PA 4DS4A 2R7YA 1N6QA 2YV0X 1HNIA 3L3UA 3C94A 3ZSXA 1ASWA 5HP1A 1NKBA 4NCAA 2HHQA 1TAUA 1L5UA 1VRTA 3P83D 4NYFA 3VQEA 3S3OA 3ZSRA 3HJFA 4FYDA 3K2PA 4C8OA 2G8HA 1LAVA 4E1NA 4FK2A 4FJNA 3WNGA 4CGDA 3OJUA 3OVNA 4B9MA 3IG1A 3ISNC 5KGWA 2IAJA 4LSNA 4J2BA 1C1BA 4CFAA 2G8UA 4I9LA 3M8SA 3KLGA 4W5NA 1YTAA 2Z1HA 2DY4A 2Q3SA 4LH4A 4I7FA 4DU4A 4RW8A 2DTUA 1VSHA 3LPTA 1RBSA 1FK9A 4AHUA 5DK5A 1NK8A 4F3TA 3LP2A 1I39A 4CJQA 1KRPA 3UIQA 3G10A 2KFZA 1VSFA 2A1SA 3AVCA 3O4NA 3PY8A 3AO4A 4IKFA 4Z4HA 2KTQA 4MQ3A 1L3TA 3DMJA 3AO3A 4B9VA 1TGOA 3HVRA 1NJYA 4BWMA 4E3SA 5D3GA 1SKWA 1IO2A 2IGIA 3H08A 1REVA 4QAGA 4CHOA 2OPSA 3NDKA 4DTSA 3RMBA 4OJRA 2PYLA 1TK8A 4F2RA 2PYJA 2XO7A 3LZJA 2BE2A 4DSEA 3QNOA 3THVA 3SNNA 4PY5A 2HNZA 1BL3A 1LWEA 3LP3A 4Z4CA 1NK9A 1VSKA 4CESA 1HQUA 2OPRA 4QCLA 1DTTA 1NJZA 5C42A 3SUOA 1TK5A 1RT1A 2P1JA 2YHBA 4J2EA 4CEAA 3NH0A 3C6TA 2VG5A 4CF0A 4DLEA 5DMRA 4FJKA 3SQ2A 3MEEA 4I2PA 1RT4A 4KHNA 2KQ2A 3WNFA 3B6OA 5C25A 1RTDA 1WAFA 4O4GA 4CEEA 1BI4A 3BGRA 3EYZA 3AVIA 4KI4A 3KK1A 1BHLA 1C6VA 1LW2A 4CF2A 2HNDA 2HB5A 3KK3A 1U4BA 3SZ2A 1SKSA 1KFSA 3HO1A 2E6LA 4FLZA 4JS5A 1NK7A 1RBVA 4DTJA 3HT3A 3AA4A 3OYJA 4HUGA 4CIFA 4YNQA 2LSNA 5FDLA 3L2QA 3SQ0A 4F4KA 3AV9A 4FJ5A 2VG7A 4M3TA 4Q0BA 1NJWA 1XWLA 5CY4A 3V1OA 4UQGA 3CFRA 3LAMA 4AHRA 4CGHA 4DS5A 4IDKA 3V6DA 3TAGA 3AVLA 3K59A 3TAQA 3VN5A 1ZYQA 4M3WA 2B6AA 1Q9YA 4FJ9A 4AHTA 2FC0A 1RBRA 2XY5A 4OPKA 1RDCA 1U47A 1WAJA 4DFJA 3L8BA 3KJVA 4B9SA 1XI1A 1NJXA 3KTQA 3ZSQA 4Z4GA 1TKTA 2F96A 4HVJA 1S1XA 2XY8A 3LWMA 4CJ5A 4E7IA 1NK0A 1Y97A 2HMIA 1UOCA 4WE1A 3LALA 4FJXA 4KRFA 3QLHA 4LY7A 3NGYA 1KTQA 3M8RA 4FLUA 1JLCA 4DQPA 3DOKA 1SV5A 3VQ7A 4CJWA 4O0JA 4E7JA 1U49A 4M3UA 3L2RA 1CXUA 4PWDA 3KIOA 5HRRA 4CJLA 2QKBA 4RW4A 2Z1IA 4F2SA 4DSKA 3NH2A 3RMCA 2XY7A 4DSFA 2E4LA 1EKEA 1BQNA 4E0DA 3QINA 4CJKA 2A1RA 4L8RB 3MXMA 2F8TA 2HW3A 2OZSA 4KTWA 4DSLA 3AA3A 4DQIA 3PUFA 3HP6A 1SUQA 3L2UA 1QE1A 3SQ1A 4FK0A 5HROA 4FJ7A 1CXQA 4DTOA 3QERA 2ETJA 2DFHA 2XHBA 4GMJB 4OKJA 4H4OA 3HK2A 1SL2A 3I0SA 4CHZA 2FBTA 4EZ9A 3QEXA 4FJGA 3AVMA 4CEFA 4BWJA 3L2VA 4FXDA 4ELTA 4KHWA 1RTJA 4F3OA 2RPIA 3NE6A 4B9LA 2OYQA 1S6PA 3A2FA 3TANA 4ELUA 3V1QA 1BCMA 3ASMA 1JLEA 2G8KA 1WSFA 5SWMA 3O3HA 1XHXA 2FBYA 4E7KA 3OYCA 1UWBA 2YKMA 1BGXT 3K5LA 2B4JA 3AVJA 4Q5VA 1YT3A 1KVAA 5CZ1A 3ULDA 4DWIA 3AVFA 2BDPA 4B3OA 1RDBA 1VSJA 4RW9A 1GOAA 3ZT0A 3AA5X 4CHQA 2W42A 1UA0A 3OYNA 4M3RA 1IG9A 3V9WA 4CE9A 4N76A 4DFPA 3TAPA 1JKHA 3QEPA 2NUBA 3VQDA 3RWUA 3NFAA 1QS4A 4KI6A 4J2DA 4DU1A 2O4GA 1JLGA 5K14A 4KHQA 3ZT1A 1N5YA 1B92A 4YFUA 1NOYA 4FZZA 2FBXA 4CJSA 3HPHA 4CK3A 3TARA 2GUIA 3B6PA 4EP5A 1WSHA 4ZTJA 1J9AA 3RMDA 2OPQA 2GV9A 3AO2A 1X9MA 2HHUA 4ID1A 2VWJA 4FJIA 4NCBA 3SJJA 1LWCA 4ZHRA 4KV8A 3OYMA 4BACA 4KO0A 5HLFA 1JLAA 4W5OA 4LD0A 3VA0A 2QKKA 1JL1A 1WNSA 2RN2A 4CHNA 1JLQA 4OKKA 2YNHA 4ZTFA 1S9GA 4ID5A 3PO4A 5CYMA 3VQ5A 4AHSA 4EZ6A 1KLNA 1KSPA 4IG3A 5E41A 1A5VA 4FLTA 1BIZA 3SQ4A 3L3VA 3OYEA 2AJQA 3VQ4A 4CEBA 1G15A 1TK0A 3RRGA 2FBVA 2YHAA 1TVRA 4E89A 3WNHA 2Y1IA 1VK0A 1IKWA 3C95A 1DTQA 3TAMA 3LPUA 3LZIA 1BIUA 4CEQA 4Y1DA 1FKOA 2OPPA 4N47A 3DYAA 4KTZA 3VQ8A 1ITGA 4FZYA 2IS3A 3NF6A 4O0IA 3DRPA 3CFPA 4JRQA 2HHSA 2KFNA 4DFMA 3E01A 4KHUA 3HSTB 3DOLA 3DLHA 1BI4B 3PV8A 3T1AA 3K5NA 2Y1JA 4CIEA 1JL2A 1C0MA 1RDDA 1RT2A 1HYZA 3KKRA 3F9KA 4OKEA 4DTUA 5I3UA 1WSJA 1TKXA 1W9HA 3KLHA 3JSMA 3HM9A 3DLRA 1CLQA 4B8CA 2JLEA 3PX6A 2RKIA 3SPZA 3PX0A 3V9ZA 4CJ3A 2ATQA 1NKEA 1GOCA 3K5OA 4JS4A 4N41A 3DRRA 4HCBA 4NCGA 3AO5A 3WNEA 5I42A 4CHYA 4H8KA 1NK6A 4BE2A 3RMAA 3SV3A 3U3GA 4BDYA 3OYGA 3TWHA 4O44A 3MXJA 1S6QA 2IDOA 4CGJA 2ZD1A 4AH9A 3AVGA 3HPOA 4CJEA 3RRHA 3S3MA 1K6YA 4XIUA 3BDPA 1WSEA 4DQSA 1HNVA 3QIPA 5FRNA 3VQAA 1CZ9A 2YNGA 4M41A 3ZSWA 5T7BA 4DMNA 4EP4A 4DU3A 3RR8A 2ITGA 4IFVA 4O55A 3S9HA 1NK4A 2D0BA 3HXMA 3IRXA 1U45A 3CM6A 3MEGA 4CEOA 1U04A 2VG6A 2XRIA 3SPYA 4HCCA 2HHXA 4KTQA 3O4QA 1UAXA 3QEIA 3OY9A 5SZTA 1A5XA 2D0CA 3K5MA 4E1MA 1RT6A 5JS2A 4B9NA 4OGCA 3OYBA 1TAQA 1WSIA 3DI6A 1VSDA 1BISA 3QESA 5J2PA 1L3VA 3AVAA 1BCOA 3AO1A 3VQ6A 4R5PA 4KKOA 3V1RA 3CM5A 2P5GA 1T05A 2PZSA 4M3XA 1HYSA 4GVMA 3NBPA 4I2QA 4DF8A 4JRPA 4H4MA 1EX4A 3C6UA 4KB1A 4FJ8A 4CGFA 4O5BA 1KVCA 1IKVA 3HP9A 3LP0A 2YNIA 4OGEA 4CJ4A 3D0PA 3MECA 4PQUA 4FJLA 1RT3A 2WONA 2HVIA 4FK4A 3QIOA 4KREA 2OZMA 2D5RA 4CGIA 2JGUA 4IBNA 1U48A 4ELVA 4M3ZA 3VQBA 4DLGA 5J2MA 2O4IA 5CZ2A 4KFBA 1Q8IA 2G8IA 4M45A 1D5AA 3DLKA 3I0RA 3QO9A 2X6NA 4FVMA 3ZSVA 3JYTA 1TL3A 1L3UA 3KD1E 4HUFA 5KI6A 1A5WA 4N56A 1VSEA 5FRMA 3OYHA 4FZXC 4FLWA 4CEZA 3OYIA 1ZBIA 1F21A 1RTHA 3V9SA 2E6MA 1ZBHA 4BDPA 1J5OA 2D0AA 3D45A 1VSIA 4CFDA 4W5RA 2WOMA 1FKPA 2VWKA 3PO5A 3SUQA 5HRNA 3L2WA 3SUPA 3SI6A 1EP4A 4HTUA 1IH7A 2DFFA 3M8PA 3T3FA 1VSLA 2HVHA 3P5JA 1RT5A 1FXXA 4AHCA 3P1GA 3ZSZA 3VA3A 2EHGA 1HYVA 1HJRA 3I8DA 1LWFA 3OYDA 4CEDA 5FROA 4KHYA 4DG1A 1WN7A 3AVNA 3CG7A 4LSLA 1TKDA 1I3AA 3RTVA 3DLGA 4BE1A 3KLIA 3ZT3A 4CK2A 3FFIA 4G1QA 3DLEA 1JLBA 3SV4A 1RNHA 1C1CA 1RT7A 4IG0A 4K8ZA 1CZBA 3AVKA 3ZT4A 5KRTA 1X9SA 2HHWA 4DTXA 1HPZA 4CJUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S1V A;  4E19 A;  3SUN A;  3K58 A;  1ASV A;  4KB0 A;  4OLB A;  4I9Q A;  3U6F A;  3LDS A;  4RW6 A;  2KZM A;  3RR7 A;  4Z4F A;  4J2A A;  1QSY A;  3ZSY A;  2HNY A;  4DTN A;  4B08 A;  3LAK A;  4RW7 A;  3KLF A;  4C8M A;  3CFO A;  1KFD A;  2XY6 A;  3HYF A;  1S1U A;  1L3S A;  1DLO A;  2BAN A;  4Z0U A;  3VQP A;  4M42 A;  3OS0 A;  4JLH A;  1UA1 A;  4CJV A;  4CFC A;  4DSJ A;  2DFE A;  3DM2 A;  3NF9 A;  4OVL A;  3TAF A;  1HRH A;  5HRS A;  2Z1G A;  3T19 A;  4DQQ A;  1NOZ A;  4Z4I A;  1D8Y A;  3PX4 A;  3TR8 A;  3LAN A;  4KAZ A;  4Y1C A;  1JXE A;  4NYN A;  1ASU A;  1X9W A;  4B9U A;  1RIL A;  1QHT A;  3AA2 A;  3O3G A;  3V4I A;  1EET A;  3TI0 A;  3KD5 E;  1RTI A;  3HL8 A;  3AVH A;  3MED A;  1MU2 A;  3OYA A;  4W5T A;  4CFB A;  2HHV A;  2IC3 A;  3HPG A;  2YKN A;  3TAB A;  1X1P A;  1ZBU A;  4CJR A;  1C0U A;  3VQC A;  4F8R A;  4OLA A;  1B9F A;  4KPY A;  4CF1 A;  4C8K A;  1BQM A;  3CQ8 A;  4AHV A;  3KK2 A;  1SKR A;  5KGX A;  1TV6 A;  4FJJ A;  1EXQ A;  3QNN A;  1TKZ A;  3G0Z A;  1XC9 A;  3O3F A;  3U3Y A;  1S1T A;  1RBT A;  4DTP A;  3QEV A;  1C1A A;  3M8Q A;  2I5J A;  4LH5 A;  1O1W A;  3KLE A;  2G8F A;  1J54 A;  1LAW A;  3IAY A;  3V9X A;  5J2N A;  2KW4 A;  4E7L A;  1T8E A;  4FM0 A;  2BGG A;  3K57 A;  4CK1 A;  5J2Q A;  2X74 A;  5JS1 A;  1YVU A;  3OJS A;  4C8L A;  3OYK A;  2Z1J A;  3EY1 A;  3NCI A;  1NKC A;  4CHP A;  5C24 A;  1TL1 A;  4FJH A;  4K8X A;  4DTR A;  2EX3 A;  5HBM A;  4DQR A;  4MFB A;  2PY5 A;  2GBZ A;  5CYQ A;  4FM1 A;  1QTM A;  4PA1 A;  4CJF A;  3NF8 A;  2QXF A;  1QSS A;  5KRS A;  1R0A A;  3V81 A;  4OPJ A;  4DSI A;  4BDZ A;  4B9T A;  3OYF A;  3IS9 A;  1RBU A;  4CF8 A;  5J1E A;  3SCX A;  4IFY A;  4FW2 A;  4B8A B;  3EZ5 A;  3VQQ A;  1LW0 A;  4RG8 A;  3QEW A;  1D9D A;  1QSL A;  4M3Y A;  3ALY A;  1VRU A;  3ZCM A;  3OS1 A;  1JXB A;  4HUE A;  1IKX A;  1S9E A;  3LP1 A;  4CEC A;  1QQC A;  3SYZ A;  1Z25 A;  1JLF A;  1RCH A;  2ZQB A;  3V9U A;  1ZBL A;  4KHS A;  3CYM A;  4AIL C;  1YTU A;  3ITH A;  4CJP A;  1GOB A;  2KZZ A;  1WLJ A;  3NHG A;  1XHZ A;  3OS2 A;  4CJT A;  3TAE A;  1HQE A;  3VQ9 A;  3OYL A;  2OA8 A;  3NGI A;  1J53 A;  2B5J A;  4N5S A;  2G8V A;  2RF2 A;  4FLX A;  2ZE2 A;  1IKY A;  4CER A;  4HHT A;  1Z26 A;  1WSG A;  4Z4E A;  2HHT A;  4BE0 A;  2P5O A;  3MXI A;  4W5Q A;  4FJM A;  2X6S A;  3NF7 A;  1S5J A;  4PUO A;  3F73 A;  4FW1 A;  4FM2 A;  1KVB A;  3ZSO A;  4FCY A;  4CIG A;  2P51 A;  1VSM A;  3ZT2 A;  1D9F A;  3S3N A;  3AVB A;  1W0H A;  2QK9 A;  4ICL A;  3MAQ A;  1C0T A;  1HMV A;  1SL0 A;  5EU7 A;  4DFK A;  4CF9 A;  4C8N A;  1ZBF A;  1KLM A;  4QOZ B;  3LWL A;  3NAE A;  1B9D A;  4CCH A;  2X78 A;  1KCF A;  4GW6 A;  1T03 A;  2IOC A;  3KKS A;  4DTM A;  3DLB A;  3QET A;  4DF4 A;  1RDA A;  1LV5 A;  4TSX A;  1Q9X A;  3NH1 A;  4FLV A;  1SL1 A;  3HVT A;  4CGG A;  3DRS A;  2F8S A;  5HRP A;  2G8W A;  3NGZ A;  4E7H A;  5KTQ A;  2YNF A;  4FLY A;  1NK5 A;  1S1W A;  1T7P A;  4DS4 A;  2R7Y A;  1N6Q A;  2YV0 X;  1HNI A;  3L3U A;  3C94 A;  3ZSX A;  1ASW A;  5HP1 A;  1NKB A;  4NCA A;  2HHQ A;  1TAU A;  1L5U A;  1VRT A;  3P83 D;  4NYF A;  3VQE A;  3S3O A;  3ZSR A;  3HJF A;  4FYD A;  3K2P A;  4C8O A;  2G8H A;  1LAV A;  4E1N A;  4FK2 A;  4FJN A;  3WNG A;  4CGD A;  3OJU A;  3OVN A;  4B9M A;  3IG1 A;  3ISN C;  5KGW A;  2IAJ A;  4LSN A;  4J2B A;  1C1B A;  4CFA A;  2G8U A;  4I9L A;  3M8S A;  3KLG A;  4W5N A;  1YTA A;  2Z1H A;  2DY4 A;  2Q3S A;  4LH4 A;  4I7F A;  4DU4 A;  4RW8 A;  2DTU A;  1VSH A;  3LPT A;  1RBS A;  1FK9 A;  4AHU A;  5DK5 A;  1NK8 A;  4F3T A;  3LP2 A;  1I39 A;  4CJQ A;  1KRP A;  3UIQ A;  3G10 A;  2KFZ A;  1VSF A;  2A1S A;  3AVC A;  3O4N A;  3PY8 A;  3AO4 A;  4IKF A;  4Z4H A;  2KTQ A;  4MQ3 A;  1L3T A;  3DMJ A;  3AO3 A;  4B9V A;  1TGO A;  3HVR A;  1NJY A;  4BWM A;  4E3S A;  5D3G A;  1SKW A;  1IO2 A;  2IGI A;  3H08 A;  1REV A;  4QAG A;  4CHO A;  2OPS A;  3NDK A;  4DTS A;  3RMB A;  4OJR A;  2PYL A;  1TK8 A;  4F2R A;  2PYJ A;  2XO7 A;  3LZJ A;  2BE2 A;  4DSE A;  3QNO A;  3THV A;  3SNN A;  4PY5 A;  2HNZ A;  1BL3 A;  1LWE A;  3LP3 A;  4Z4C A;  1NK9 A;  1VSK A;  4CES A;  1HQU A;  2OPR A;  4QCL A;  1DTT A;  1NJZ A;  5C42 A;  3SUO A;  1TK5 A;  1RT1 A;  2P1J A;  2YHB A;  4J2E A;  4CEA A;  3NH0 A;  3C6T A;  2VG5 A;  4CF0 A;  4DLE A;  5DMR A;  4FJK A;  3SQ2 A;  3MEE A;  4I2P A;  1RT4 A;  4KHN A;  2KQ2 A;  3WNF A;  3B6O A;  5C25 A;  1RTD A;  1WAF A;  4O4G A;  4CEE A;  1BI4 A;  3BGR A;  3EYZ A;  3AVI A;  4KI4 A;  3KK1 A;  1BHL A;  1C6V A;  1LW2 A;  4CF2 A;  2HND A;  2HB5 A;  3KK3 A;  1U4B A;  3SZ2 A;  1SKS A;  1KFS A;  3HO1 A;  2E6L A;  4FLZ A;  4JS5 A;  1NK7 A;  1RBV A;  4DTJ A;  3HT3 A;  3AA4 A;  3OYJ A;  4HUG A;  4CIF A;  4YNQ A;  2LSN A;  5FDL A;  3L2Q A;  3SQ0 A;  4F4K A;  3AV9 A;  4FJ5 A;  2VG7 A;  4M3T A;  4Q0B A;  1NJW A;  1XWL A;  5CY4 A;  3V1O A;  4UQG A;  3CFR A;  3LAM A;  4AHR A;  4CGH A;  4DS5 A;  4IDK A;  3V6D A;  3TAG A;  3AVL A;  3K59 A;  3TAQ A;  3VN5 A;  1ZYQ A;  4M3W A;  2B6A A;  1Q9Y A;  4FJ9 A;  4AHT A;  2FC0 A;  1RBR A;  2XY5 A;  4OPK A;  1RDC A;  1U47 A;  1WAJ A;  4DFJ A;  3L8B A;  3KJV A;  4B9S A;  1XI1 A;  1NJX A;  3KTQ A;  3ZSQ A;  4Z4G A;  1TKT A;  2F96 A;  4HVJ A;  1S1X A;  2XY8 A;  3LWM A;  4CJ5 A;  4E7I A;  1NK0 A;  1Y97 A;  2HMI A;  1UOC A;  4WE1 A;  3LAL A;  4FJX A;  4KRF A;  3QLH A;  4LY7 A;  3NGY A;  1KTQ A;  3M8R A;  4FLU A;  1JLC A;  4DQP A;  3DOK A;  1SV5 A;  3VQ7 A;  4CJW A;  4O0J A;  4E7J A;  1U49 A;  4M3U A;  3L2R A;  1CXU A;  4PWD A;  3KIO A;  5HRR A;  4CJL A;  2QKB A;  4RW4 A;  2Z1I A;  4F2S A;  4DSK A;  3NH2 A;  3RMC A;  2XY7 A;  4DSF A;  2E4L A;  1EKE A;  1BQN A;  4E0D A;  3QIN A;  4CJK A;  2A1R A;  4L8R B;  3MXM A;  2F8T A;  2HW3 A;  2OZS A;  4KTW A;  4DSL A;  3AA3 A;  4DQI A;  3PUF A;  3HP6 A;  1SUQ A;  3L2U A;  1QE1 A;  3SQ1 A;  4FK0 A;  5HRO A;  4FJ7 A;  1CXQ A;  4DTO A;  3QER A;  2ETJ A;  2DFH A;  2XHB A;  4GMJ B;  4OKJ A;  4H4O A;  3HK2 A;  1SL2 A;  3I0S A;  4CHZ A;  2FBT A;  4EZ9 A;  3QEX A;  4FJG A;  3AVM A;  4CEF A;  4BWJ A;  3L2V A;  4FXD A;  4ELT A;  4KHW A;  1RTJ A;  4F3O A;  2RPI A;  3NE6 A;  4B9L A;  2OYQ A;  1S6P A;  3A2F A;  3TAN A;  4ELU A;  3V1Q A;  1BCM A;  3ASM A;  1JLE A;  2G8K A;  1WSF A;  5SWM A;  3O3H A;  1XHX A;  2FBY A;  4E7K A;  3OYC A;  1UWB A;  2YKM A;  1BGX T;  3K5L A;  2B4J A;  3AVJ A;  4Q5V A;  1YT3 A;  1KVA A;  5CZ1 A;  3ULD A;  4DWI A;  3AVF A;  2BDP A;  4B3O A;  1RDB A;  1VSJ A;  4RW9 A;  1GOA A;  3ZT0 A;  3AA5 X;  4CHQ A;  2W42 A;  1UA0 A;  3OYN A;  4M3R A;  1IG9 A;  3V9W A;  4CE9 A;  4N76 A;  4DFP A;  3TAP A;  1JKH A;  3QEP A;  2NUB A;  3VQD A;  3RWU A;  3NFA A;  1QS4 A;  4KI6 A;  4J2D A;  4DU1 A;  2O4G A;  1JLG A;  5K14 A;  4KHQ A;  3ZT1 A;  1N5Y A;  1B92 A;  4YFU A;  1NOY A;  4FZZ A;  2FBX A;  4CJS A;  3HPH A;  4CK3 A;  3TAR A;  2GUI A;  3B6P A;  4EP5 A;  1WSH A;  4ZTJ A;  1J9A A;  3RMD A;  2OPQ A;  2GV9 A;  3AO2 A;  1X9M A;  2HHU A;  4ID1 A;  2VWJ A;  4FJI A;  4NCB A;  3SJJ A;  1LWC A;  4ZHR A;  4KV8 A;  3OYM A;  4BAC A;  4KO0 A;  5HLF A;  1JLA A;  4W5O A;  4LD0 A;  3VA0 A;  2QKK A;  1JL1 A;  1WNS A;  2RN2 A;  4CHN A;  1JLQ A;  4OKK A;  2YNH A;  4ZTF A;  1S9G A;  4ID5 A;  3PO4 A;  5CYM A;  3VQ5 A;  4AHS A;  4EZ6 A;  1KLN A;  1KSP A;  4IG3 A;  5E41 A;  1A5V A;  4FLT A;  1BIZ A;  3SQ4 A;  3L3V A;  3OYE A;  2AJQ A;  3VQ4 A;  4CEB A;  1G15 A;  1TK0 A;  3RRG A;  2FBV A;  2YHA A;  1TVR A;  4E89 A;  3WNH A;  2Y1I A;  1VK0 A;  1IKW A;  3C95 A;  1DTQ A;  3TAM A;  3LPU A;  3LZI A;  1BIU A;  4CEQ A;  4Y1D A;  1FKO A;  2OPP A;  4N47 A;  3DYA A;  4KTZ A;  3VQ8 A;  1ITG A;  4FZY A;  2IS3 A;  3NF6 A;  4O0I A;  3DRP A;  3CFP A;  4JRQ A;  2HHS A;  2KFN A;  4DFM A;  3E01 A;  4KHU A;  3HST B;  3DOL A;  3DLH A;  1BI4 B;  3PV8 A;  3T1A A;  3K5N A;  2Y1J A;  4CIE A;  1JL2 A;  1C0M A;  1RDD A;  1RT2 A;  1HYZ A;  3KKR A;  3F9K A;  4OKE A;  4DTU A;  5I3U A;  1WSJ A;  1TKX A;  1W9H A;  3KLH A;  3JSM A;  3HM9 A;  3DLR A;  1CLQ A;  4B8C A;  2JLE A;  3PX6 A;  2RKI A;  3SPZ A;  3PX0 A;  3V9Z A;  4CJ3 A;  2ATQ A;  1NKE A;  1GOC A;  3K5O A;  4JS4 A;  4N41 A;  3DRR A;  4HCB A;  4NCG A;  3AO5 A;  3WNE A;  5I42 A;  4CHY A;  4H8K A;  1NK6 A;  4BE2 A;  3RMA A;  3SV3 A;  3U3G A;  4BDY A;  3OYG A;  3TWH A;  4O44 A;  3MXJ A;  1S6Q A;  2IDO A;  4CGJ A;  2ZD1 A;  4AH9 A;  3AVG A;  3HPO A;  4CJE A;  3RRH A;  3S3M A;  1K6Y A;  4XIU A;  3BDP A;  1WSE A;  4DQS A;  1HNV A;  3QIP A;  5FRN A;  3VQA A;  1CZ9 A;  2YNG A;  4M41 A;  3ZSW A;  5T7B A;  4DMN A;  4EP4 A;  4DU3 A;  3RR8 A;  2ITG A;  4IFV A;  4O55 A;  3S9H A;  1NK4 A;  2D0B A;  3HXM A;  3IRX A;  1U45 A;  3CM6 A;  3MEG A;  4CEO A;  1U04 A;  2VG6 A;  2XRI A;  3SPY A;  4HCC A;  2HHX A;  4KTQ A;  3O4Q A;  1UAX A;  3QEI A;  3OY9 A;  5SZT A;  1A5X A;  2D0C A;  3K5M A;  4E1M A;  1RT6 A;  5JS2 A;  4B9N A;  4OGC A;  3OYB A;  1TAQ A;  1WSI A;  3DI6 A;  1VSD A;  1BIS A;  3QES A;  5J2P A;  1L3V A;  3AVA A;  1BCO A;  3AO1 A;  3VQ6 A;  4R5P A;  4KKO A;  3V1R A;  3CM5 A;  2P5G A;  1T05 A;  2PZS A;  4M3X A;  1HYS A;  4GVM A;  3NBP A;  4I2Q A;  4DF8 A;  4JRP A;  4H4M A;  1EX4 A;  3C6U A;  4KB1 A;  4FJ8 A;  4CGF A;  4O5B A;  1KVC A;  1IKV A;  3HP9 A;  3LP0 A;  2YNI A;  4OGE A;  4CJ4 A;  3D0P A;  3MEC A;  4PQU A;  4FJL A;  1RT3 A;  2WON A;  2HVI A;  4FK4 A;  3QIO A;  4KRE A;  2OZM A;  2D5R A;  4CGI A;  2JGU A;  4IBN A;  1U48 A;  4ELV A;  4M3Z A;  3VQB A;  4DLG A;  5J2M A;  2O4I A;  5CZ2 A;  4KFB A;  1Q8I A;  2G8I A;  4M45 A;  1D5A A;  3DLK A;  3I0R A;  3QO9 A;  2X6N A;  4FVM A;  3ZSV A;  3JYT A;  1TL3 A;  1L3U A;  3KD1 E;  4HUF A;  5KI6 A;  1A5W A;  4N56 A;  1VSE A;  5FRM A;  3OYH A;  4FZX C;  4FLW A;  4CEZ A;  3OYI A;  1ZBI A;  1F21 A;  1RTH A;  3V9S A;  2E6M A;  1ZBH A;  4BDP A;  1J5O A;  2D0A A;  3D45 A;  1VSI A;  4CFD A;  4W5R A;  2WOM A;  1FKP A;  2VWK A;  3PO5 A;  3SUQ A;  5HRN A;  3L2W A;  3SUP A;  3SI6 A;  1EP4 A;  4HTU A;  1IH7 A;  2DFF A;  3M8P A;  3T3F A;  1VSL A;  2HVH A;  3P5J A;  1RT5 A;  1FXX A;  4AHC A;  3P1G A;  3ZSZ A;  3VA3 A;  2EHG A;  1HYV A;  1HJR A;  3I8D A;  1LWF A;  3OYD A;  4CED A;  5FRO A;  4KHY A;  4DG1 A;  1WN7 A;  3AVN A;  3CG7 A;  4LSL A;  1TKD A;  1I3A A;  3RTV A;  3DLG A;  4BE1 A;  3KLI A;  3ZT3 A;  4CK2 A;  3FFI A;  4G1Q A;  3DLE A;  1JLB A;  3SV4 A;  1RNH A;  1C1C A;  1RT7 A;  4IG0 A;  4K8Z A;  1CZB A;  3AVK A;  3ZT4 A;  5KRT A;  1X9S A;  2HHW A;  4DTX A;  1HPZ A;  4CJU A; 
#chains in the Genus database with same CATH topology
 2YHX A;  1S1V A;  3SUN A;  1ASV A;  5LJV A;  1BA1 A;  5EY4 A;  4RW6 A;  5AQI A;  3RR7 A;  2ITM A;  1C0F A;  4B08 A;  3LAK A;  2XY6 A;  3HYF A;  3HM8 A;  4CD3 A;  1DLO A;  2BAN A;  2NRH A;  3VQP A;  3B8A X;  4M42 A;  1YAG A;  4JLH A;  5KQD A;  4CJV A;  4CFC A;  2GWK A;  3VTH A;  1HRH A;  3R9P A;  3J7Y P;  1EWR A;  3I33 A;  4DQQ A;  1NOZ A;  3ULE A;  3TR8 A;  2FSN A;  4M7Y A;  3O3G A;  3KD5 E;  3TI0 A;  1YF5 L;  5KPT A;  1HJO A;  2IC3 A;  3CCR N;  4LC9 B;  3VMF B;  4F8R A;  1B9F A;  4KPY A;  4C8K A;  3CQ8 A;  1QZ6 A;  4K25 A;  1EXQ A;  3U3Y A;  1S1T A;  3O80 A;  3MX2 A;  2I5J A;  5IWA K;  4DHY A;  3V9X A;  1YIT N;  4YOR A;  5AFU H;  1YVU A;  1TYQ A;  2A6A A;  3O9R A;  3FZH A;  3NCI A;  1RDW X;  2D0P A;  2KKZ A;  2GBZ A;  5CYQ A;  4FM1 A;  4CJF A;  1OH8 A;  4OPJ A;  2P9K B;  4B9T A;  2W41 A;  2NRR A;  1D9D A;  3QEW A;  4HUE A;  2QW9 A;  1S9E A;  3VF2 A;  3T1H K;  1JLF A;  3V9U A;  3CYM A;  4AIL C;  1YTU A;  4CJP A;  2KZZ A;  3OS2 A;  1HQE A;  3VQ9 A;  2RF2 A;  4WQ5 A;  5E84 A;  1Z26 A;  1WSG A;  4H5W A;  1VQP N;  4FWO A;  5AQL A;  3NF7 A;  1S5J A;  2I7P A;  3ZSO A;  1VSM A;  2P51 A;  3S3N A;  1W0H A;  2BTF A;  2QK9 A;  3RSE B;  3GOI A;  4DUY K;  1HMV A;  1HR0 K;  2WFB A;  1KLM A;  3CIP A;  5F0X A;  1KCF A;  4GW6 A;  1T03 A;  3D2E B;  3VF6 A;  1ESV A;  4DTM A;  3DLB A;  4JKG A;  1RDA A;  2QA4 N;  3NH1 A;  2A42 A;  5GAG P;  4IEI A;  1GLA G;  3UKR B;  4DS4 A;  3BP8 A;  2R7Y A;  1N6Q A;  5AQZ A;  4NCA A;  3L3U A;  3G4S N;  1M90 O;  2HHQ A;  2GWJ A;  3HJF A;  4FOI A;  1YXQ A;  4E1N A;  4CGD A;  4JI5 K;  1NGA A;  3OVN A;  3CCS N;  3C6A A;  3SAG A;  1N34 K;  2G8U A;  4WCE L;  1WBB A;  3PIO L;  3KLG A;  4W5N A;  5LMU K;  1YTA A;  2DY4 A;  2Q3S A;  1BDG A;  4LH4 A;  4DU4 A;  1VSH A;  3LPT A;  4F3T A;  1U2V B;  4YOW A;  1ATR A;  1S3X A;  1KRP A;  3VET A;  1NNE A;  2AP1 A;  3R3L A;  1TGO A;  3D7E O;  4E3S A;  3FLC O;  4DTS A;  2PYL A;  2E8A A;  1TK8 A;  2O8B A;  1NM1 A;  2PYJ A;  3MMV A;  4H5N A;  2XO7 A;  3LZJ A;  3G6E N;  3EE8 A;  1Z6R A;  3LL3 A;  3CHW A;  2YHY A;  4CEA A;  3NH0 A;  3C6T A;  4CF0 A;  4DLE A;  3SQ2 A;  3MEE A;  4I2P A;  3WNF A;  3B6O A;  3WUH A;  5C25 A;  1WAF A;  1T6C A;  2HBK A;  4LFC K;  4C1N I;  2D4W A;  3O4W A;  3UE5 A;  3KK1 A;  1BHL A;  1C6V A;  3KK3 A;  5JVG L;  2E6L A;  4FLZ A;  3HT3 A;  4CIF A;  4YNQ A;  5FDL A;  1BA0 A;  3E66 A;  4JKH A;  4DKW A;  3CJ7 A;  4CI6 A;  4UQG A;  4AHR A;  3TAQ A;  4DS5 A;  3V6D A;  3K59 A;  4M3W A;  2B6A A;  5KPZ A;  4OPK A;  1C0G A;  3OA9 A;  3KJV A;  1NJX A;  2F9T A;  3KTQ A;  4HVJ A;  1S1X A;  1VQ5 N;  3H6E A;  5AQQ A;  3LAL A;  4KRF A;  1NGJ A;  3QLH A;  4CZM A;  3NGY A;  4KBO A;  4CZK A;  3DOK A;  3DXM A;  3VQ7 A;  1U49 A;  4CJL A;  4RW4 A;  4PKG A;  4BRQ A;  3D6R A;  2WC9 A;  5JLH A;  4CJK A;  2F8T A;  3MXM A;  3R1X A;  4KTW A;  4DQI A;  4YDU A;  3HP6 A;  5FLX O;  1SUQ A;  3L2U A;  1HKG A;  2E20 A;  4FJ7 A;  4DTO A;  3QER A;  2DFH A;  2JWL A;  5FPD A;  5C15 A;  4OKJ A;  4H4O A;  2ZGY A;  1SL2 A;  3UB5 A;  3I0S A;  2NRW A;  4EZ9 A;  3CXC M;  4FJG A;  1OVQ A;  4F3O A;  3NE6 A;  1S6P A;  3TAN A;  3ASM A;  4BRF A;  3FZL A;  3CF5 L;  1UWB A;  4YDU C;  3H45 C;  3AVJ A;  4B3O A;  2QEX N;  1VSJ A;  2V7Y A;  1ZC6 A;  4QS9 A;  4JN4 A;  3OYN A;  1IG9 A;  2W6L A;  4N76 A;  4F9O A;  2NUB A;  2GEL A;  5GIP A;  4DU1 A;  3ID8 A;  1JLG A;  5K14 A;  4KHQ A;  3E9P A;  4YFU A;  1QVF M;  2AA4 A;  1Y64 A;  3B6P A;  2HF4 A;  1J9A A;  3RMD A;  2GV9 A;  2HHU A;  3CER A;  4JI7 K;  3SJJ A;  4DR5 K;  3PIP L;  1QQO A;  4WFB L;  4BAC A;  4DR4 K;  4KO0 A;  1JLA A;  1TUY A;  4LD0 A;  3VA0 A;  1JLQ A;  4HWI A;  1MWM A;  3VQ5 A;  4AHS A;  4IO9 L;  3WQU A;  1KSP A;  4IG3 A;  5E41 A;  1A5V A;  3OYE A;  5LL6 Z;  4CEB A;  2QTD A;  1YIJ N;  2FBV A;  1VK0 A;  1OKJ A;  3C95 A;  1DTQ A;  3TAM A;  3LZI A;  4JKF A;  4CEQ A;  1YJ9 N;  4KTZ A;  1GLL O;  1IBK K;  4FZY A;  2HHS A;  2KFN A;  4DFM A;  3E01 A;  2UUA K;  3CCL N;  3DOL A;  3DLH A;  3T1A A;  2P9N B;  5AQM A;  4ISE A;  1RT2 A;  4JI1 K;  1LCU A;  3DLR A;  4ISF A;  4B8C A;  1K8K A;  2RKI A;  4YOV A;  3PX0 A;  2ATQ A;  2YI1 A;  2O8D B;  4GV3 A;  3BF3 A;  4N41 A;  3AO5 A;  4MLH A;  3ZX2 A;  1XMO K;  4JD2 B;  3OYG A;  1IBM K;  3CCE N;  4CGJ A;  3BDP A;  4CJE A;  3RRH A;  4XIU A;  4JI3 K;  1GLC G;  3C6H A;  4M41 A;  4DMN A;  2E2N A;  1EQY A;  2ITG A;  3U8X A;  2D0B A;  3JS6 A;  3MEG A;  2Q97 A;  2O8F A;  2P9K A;  4DV3 K;  5SZT A;  2D0C A;  3K5M A;  4WQ4 A;  1TAQ A;  1VSD A;  5J2P A;  1L3V A;  2P5G A;  4H0T B;  1V4T A;  2F7T A;  3V1R A;  3A5L C;  4KH6 A;  4JRP A;  1EX4 A;  2NNW A;  3THW B;  4O5B A;  2YNI A;  4FJL A;  1N8R O;  4H0Y B;  1U48 A;  2O4I A;  5GAD P;  3VQB A;  4DLG A;  4KFB A;  2G8I A;  4WQ4 C;  2CGK A;  4LF7 K;  4HUF A;  1A5W A;  4OO1 J;  4N56 A;  5EVZ A;  1VSE A;  4FPB A;  1F21 A;  4A59 A;  1K9M O;  1NLV A;  3O9T A;  5HRN A;  3L2W A;  3SUP A;  1O13 A;  1EP4 A;  4HTU A;  4DR2 K;  3T3F A;  3O9Q A;  1VSL A;  3P5J A;  5EOY A;  3KZB A;  3P1G A;  5H1S Q;  5AQG A;  2GEM A;  3UKR A;  3DLG A;  3DLE A;  2KLA A;  3QBX A;  4JI0 K;  1CZB A;  1X9S A;  4DTX A;  4PA1 A;  1W2B M;  3MN6 A;  1HKC A;  4MLE A;  3VGK A;  4I9Q A;  1IG8 A;  3LDS A;  4Z4F A;  1QSY A;  4R79 A;  3ZSY A;  3PLA A;  2HNY A;  4G9Z A;  4RW7 A;  3KLF A;  1KFD A;  1S1U A;  1U2V A;  5CE3 A;  4DSJ A;  3DM2 A;  2P9I B;  4BRK A;  5HRS A;  3T19 A;  1XC3 A;  3S41 A;  4KAZ A;  4Y1C A;  4YOX A;  2UXC K;  1QHT A;  4BR9 A;  3NVM A;  1GLF O;  3AVH A;  2YKN A;  4BRO A;  3TAB A;  1X1P A;  4CF1 A;  4KH5 A;  3KK2 A;  1SKR A;  1TV6 A;  5BPN A;  4BRC A;  4FJJ A;  1XC9 A;  1C1A A;  3KWI A;  4PHT X;  1QVG M;  5AQF A;  1O1W A;  1LAW A;  4IXC A;  5AQP A;  3DJC A;  3K57 A;  5KPR A;  4JYA K;  2X74 A;  2ASP A;  1VQ9 N;  3OJS A;  1BO5 O;  4CZJ A;  4CHP A;  3CMA N;  1MDU B;  4FJH A;  4DTR A;  5HBM A;  4JKC A;  1YUW A;  1N36 K;  3MDQ A;  3NF8 A;  2QXF A;  1R0A A;  2WBN A;  1RBU A;  5J1E A;  4IFY A;  4B8A B;  4IDH A;  3EZ5 A;  3ZCM A;  1JXB A;  1IKX A;  3U9D A;  5EX5 A;  4NXM K;  3SYZ A;  1RCH A;  2ZQB A;  1T44 A;  4MDB A;  5GIN A;  1R59 O;  3NGI A;  2B5J A;  4BY9 C;  4CER A;  2PFU A;  3CC2 N;  4BE0 A;  2P5O A;  5GAE P;  3P4I A;  4FJM A;  5LY3 A;  3FFK B;  4FW1 A;  4FCY A;  2RHK A;  4LF6 K;  3CCM N;  1D9F A;  2V7Z A;  1C0T A;  2HMP A;  3TSQ A;  3NAE A;  1B9D A;  3WXI A;  3E9L A;  3J80 O;  4TSX A;  1Q9X A;  2V52 B;  3HVT A;  3WEE B;  1WUA A;  3H1Q A;  3O1B A;  3NGZ A;  5KTQ A;  1NK5 A;  1T7P A;  1X3N A;  1TAU A;  1VRT A;  4EHT A;  3S3O A;  1TUU A;  4QS8 A;  3ZSR A;  1LAV A;  3HI0 A;  2Q2R A;  5KGW A;  4LSN A;  4K43 A;  1C1B A;  4CFA A;  4U67 L;  1FK9 A;  4AHU A;  1NK8 A;  4JHD B;  1I39 A;  4CJQ A;  2KFZ A;  1VSF A;  1GLJ O;  3O4N A;  3HOS A;  3WXK A;  3FGU A;  4MQ3 A;  3DMJ A;  3CPW M;  3WXL A;  1NJY A;  3K0S A;  4BWM A;  2QI2 A;  4OJR A;  4F2R A;  3DXK B;  4DSE A;  2BE2 A;  3QNO A;  3SNN A;  4PY5 A;  3CC4 N;  1NK9 A;  1VSK A;  5AR0 A;  1HQU A;  2NLX A;  3P31 A;  4YOU A;  5C42 A;  1TK5 A;  2P1J A;  2ZM6 K;  2Q0R A;  4FWL A;  2VG5 A;  3FZK A;  2Q0U A;  2V51 B;  2HHH K;  4X64 K;  3C65 A;  1RT4 A;  4KHN A;  2O8E A;  2Q1N A;  1RTD A;  4CEE A;  1KQS M;  2P9N A;  3F9M A;  3L4I A;  2UUC K;  2ZGZ A;  1BG3 A;  3MN5 A;  3HO1 A;  1SKS A;  4BC2 A;  1NK7 A;  4DTJ A;  3SQ0 A;  3OYJ A;  3SBT A;  3L2Q A;  4F4K A;  4FJ5 A;  3AV9 A;  4ILJ A;  2O8D A;  1NJW A;  1XWL A;  1NMN A;  3Q7B A;  3CFR A;  5JMV A;  1KAZ A;  3LAM A;  4IDK A;  2QXL A;  3AVL A;  1ZYQ A;  4EFH A;  1Q9Y A;  4JD2 A;  1EWQ A;  2FC0 A;  1T3V A;  2XY5 A;  3WT0 A;  1P8Z A;  1WAJ A;  4B9S A;  3ZSQ A;  4Z4G A;  3VGM A;  1X3M A;  1NK0 A;  1Y97 A;  2HMI A;  1UOC A;  4FJX A;  4FO0 A;  5BR9 A;  5AQU A;  4M3U A;  1SV5 A;  4E7J A;  3L2R A;  1CXU A;  1HKB A;  3KIO A;  5HRR A;  2QKB A;  3KHY A;  2FF6 A;  3NH2 A;  3RMC A;  4XH5 A;  2XY7 A;  1EO1 A;  2E4L A;  2HW3 A;  3DWL A;  2A1R A;  4H5T A;  2OZS A;  3OTO K;  2ZJR L;  1QQN A;  1VQO N;  2ETJ A;  4BR4 A;  1VQ8 N;  4YY3 K;  4BRE A;  4BWJ A;  1Q82 O;  4ISG A;  3CJ1 A;  3A2F A;  4MDA A;  1YVN A;  2G8K A;  1WSF A;  3EZW A;  5SWM A;  1XHX A;  4EHU A;  4Z94 A;  3O3H A;  4E7K A;  3AVF A;  1RDB A;  3ZEU A;  4RW9 A;  3VTI A;  3ZT0 A;  3KK7 A;  3AAR A;  5M1O A;  4CHQ A;  3J7A P;  2CH5 A;  1UA0 A;  4FWS A;  3THX A;  4M3R A;  5AQT A;  5A2Q O;  4DFP A;  1HLU A;  5AQJ A;  4LFA K;  3TAR A;  1NJI O;  3IDH A;  1W7A A;  1X9M A;  4QS7 A;  1XQS C;  5AFU A;  4NCB A;  4BC5 A;  1FJG K;  4OKK A;  4ZTF A;  3PO4 A;  4DQ8 A;  3W3D A;  1KLN A;  3VF4 A;  3SQ4 A;  3RRG A;  2YHA A;  3WNH A;  4ILH A;  2Y1I A;  2P9I A;  1KD1 O;  1NMD A;  3LPU A;  1XNR K;  4Y1D A;  2P9P A;  3CD6 N;  4BGA A;  1OH7 A;  5FPM A;  3J8A A;  2IS3 A;  3NF6 A;  1QQM A;  4GNI A;  2OTL N;  1C0M A;  2P9U A;  1HYZ A;  2FSJ A;  3F9K A;  4DTU A;  5I3U A;  1WSJ A;  1TKX A;  3CJA A;  2F9W A;  3HM9 A;  1T6D A;  1CLQ A;  2BH1 A;  4JKD A;  1NKE A;  4DV5 K;  1Q18 A;  4JI4 K;  4JS4 A;  1BUP A;  3HRG A;  4HCB A;  4NCG A;  3E1Y A;  3H3N O;  5I42 A;  4CHY A;  3EO3 A;  2YJE A;  4AM7 A;  1OH5 A;  3SV3 A;  3U3G A;  4BDY A;  4WFA L;  2P9L B;  3S3M A;  3AVG A;  1NWK A;  1WSE A;  3UKU A;  3TSU A;  5FRN A;  3VQA A;  5GIO A;  3AAP A;  3ZSW A;  4DU3 A;  4EP4 A;  3RR8 A;  1BU6 O;  4B1W B;  3HXM A;  3IRX A;  1U45 A;  3CM6 A;  2VG6 A;  4JKE A;  1ATS A;  5TKY A;  4E1M A;  1RT6 A;  5JS2 A;  5AZI B;  4OGC A;  4B1V A;  1WSI A;  4DR1 K;  1NG9 A;  4BQZ A;  2RE2 A;  3AVA A;  4R5P A;  4FWK A;  1HYS A;  3EN9 A;  3NBP A;  1N33 K;  4H4M A;  3C6U A;  4KB1 A;  4FJ8 A;  4OGE A;  4CJ4 A;  1ATN A;  5AQN A;  5AQR A;  2HF3 A;  4KRE A;  2OZM A;  3MN9 A;  4KHP K;  2NRZ A;  1Q8I A;  3VEO A;  3QO9 A;  3JYT A;  3ZSV A;  4FVU A;  1RGI A;  4H0O A;  5KI6 A;  4IO8 A;  5FRM A;  3MWT A;  4B1X B;  3D2F B;  3M1F A;  4CEZ A;  4EIA A;  3JAM O;  1RTH A;  3OYI A;  1GLE G;  2E6M A;  1ZBH A;  4CZI A;  3D45 A;  1VSI A;  4CFD A;  4YOT A;  4OPA A;  2DFF A;  4X65 K;  2IVO A;  4C1N K;  1FXX A;  3QDK A;  4ILG B;  3VA3 A;  3ZSZ A;  2J4R A;  3WEE A;  1LWF A;  4KHY A;  3RVC A;  1WB9 A;  1I3A A;  2ZWH A;  3RTV A;  3ZT3 A;  5AQS A;  1C1C A;  4DCH A;  1RT7 A;  2QWO A;  4IG0 A;  4K8Z A;  3ZT4 A;  2HHW A;  1HPZ A;  2ZJP L;  4KB0 A;  3G71 N;  3U6F A;  4Y0W A;  2KZM A;  4J2A A;  1GLB G;  4JK7 A;  4DTN A;  4C8M A;  5DM6 L;  4Z0U A;  1UA1 A;  3NF9 A;  2Z1G A;  1CZA N;  3K9J A;  4Z4I A;  3PX4 A;  3GBT A;  3ULE B;  3CCU N;  1JXE A;  3L0Q A;  4NYN A;  5BRE A;  1X9W A;  1RIL A;  4B9U A;  3AA2 A;  2F4V K;  1EET A;  5GAH P;  1JCF A;  3MED A;  4YOY A;  1MU2 A;  2HHV A;  3N4P A;  4CFB A;  4W5T A;  3HPG A;  2VQE K;  4WF9 L;  4JAX A;  4CJR A;  3H3O B;  1BQM A;  3O9U A;  5MLC Q;  3CME N;  3KVG A;  5BPM A;  3G0Z A;  3O3F A;  4DTP A;  3QEV A;  5BN8 A;  4LH5 A;  3IAY A;  5J2N A;  2KW4 A;  4E7L A;  2KHO A;  1T8E A;  4FM0 A;  2BGG A;  4B9Q A;  5CHI A;  3VGL A;  3R8E A;  4E1J A;  4K42 A;  5JS1 A;  1J5E K;  4C8L A;  4B1Y B;  2Z1J A;  1NKC A;  5F1X A;  5C24 A;  1YJN N;  5LJW A;  3A5O C;  2EX3 A;  4MFB A;  4XH4 A;  1QTM A;  3CCJ N;  1QSS A;  2NRV A;  5KRS A;  4FWM A;  3MCP A;  3CET A;  3A0I X;  3FR0 A;  4DSI A;  3AGK A;  2VGM A;  3OYF A;  3IS9 A;  2QWM A;  4CF8 A;  3SCX A;  1V4S A;  1LW0 A;  3VQQ A;  3FZF A;  5ELZ A;  2PBD A;  4A61 A;  1VQK N;  1QSL A;  3OS1 A;  1VRU A;  3EL2 A;  3LP1 A;  2HST A;  4DR7 K;  2BUP A;  1Z25 A;  1IJJ A;  4KHS A;  4LF8 K;  3ITH A;  1WLJ A;  3NHG A;  3CJB A;  4FWN A;  5I9E B;  3MK6 A;  1J53 A;  4IFE A;  4N5S A;  3I56 N;  3CC7 N;  4FLX A;  4GV6 A;  3ZLJ A;  2ZF5 O;  4HHT A;  3HBT A;  3TSP A;  2HHT A;  4W5Q A;  3EEQ A;  2X6S A;  4CIG A;  3RSE A;  4B3T K;  2HBL A;  3K9K A;  3MAQ A;  4DV2 K;  2WUS A;  5EU7 A;  4QOZ B;  1ZBF A;  4BRA A;  2X78 A;  4CCH A;  3D2E A;  2IOC A;  2HBM A;  3DAW A;  5C10 A;  4JKG B;  1LV5 A;  4AQY K;  5ADX A;  1NGE A;  1SL1 A;  1J6Z A;  4CGG A;  1OVY A;  3P38 A;  3DRS A;  2F8S A;  4E7H A;  1S1W A;  4IJA A;  1HNI A;  3C94 A;  1MWK A;  1L5U A;  4NYF A;  3VQE A;  2G8H A;  1Z05 A;  3MX5 A;  4IOC L;  4B9M A;  2IAJ A;  1SAZ A;  4I9L A;  3M8S A;  5HL7 L;  1D4X A;  5KQ8 A;  4I7F A;  4RW8 A;  5FPE A;  2DTU A;  1RBS A;  5AQW A;  5DK5 A;  2HOE A;  3LP2 A;  1HPM A;  3ZYY X;  3G10 A;  3ID6 A;  3AVC A;  3AO4 A;  4IKF A;  3F5T A;  4A2B A;  2KTQ A;  3ATU A;  3AO3 A;  3BY5 A;  3HVR A;  1ZXO A;  4NLB A;  1LOT B;  5D3G A;  1IO2 A;  1REV A;  2D1K A;  4BRD A;  2OPS A;  3RMB A;  3EKS A;  4PL8 A;  1E4G T;  2HNZ A;  4JNE A;  3LP3 A;  1NU0 A;  4Z4C A;  2OPR A;  1ZBS A;  4JK9 A;  3U9Z A;  4M7X A;  2YHB A;  3U4L A;  4J2E A;  5DMR A;  4A5A A;  3IFR A;  4BVO A;  3EYZ A;  4KI4 A;  4FPA A;  4CF2 A;  3AAQ A;  2HND A;  3ZET B;  3SZ2 A;  3SLC A;  4JS5 A;  4DUZ K;  3AA4 A;  4HUG A;  3VES A;  2LSN A;  1X9J A;  2VG7 A;  4Q0B A;  5CY4 A;  1ILY A;  4CGH A;  3HOT A;  5FPN A;  2YCH A;  2UYT A;  4HTL A;  2OAN A;  4IWV A;  5BN9 A;  1RDC A;  1U47 A;  2P9L A;  4DR6 K;  3EE9 A;  2E1Z A;  3L8B A;  4BRH A;  1XI1 A;  3QFP A;  1TKT A;  2F96 A;  1OH6 A;  3QIC A;  1S72 N;  3OHR A;  4WE1 A;  4LY7 A;  1KTQ A;  3M8R A;  1IBL K;  1JLC A;  4DQP A;  4MO5 A;  4CJW A;  4PWD A;  2Z1I A;  3GG4 A;  5AQY A;  4DSF A;  5AZI A;  3BZC A;  4NLC A;  4DSL A;  3AA3 A;  1KAX A;  3PUF A;  1QE1 A;  3SQ1 A;  2FSK A;  4GMJ B;  2H3G X;  2O8C B;  3N4Q A;  4CHZ A;  3R6M A;  1H1V A;  2VYP A;  3M6G A;  1VAZ A;  4FXD A;  4KHW A;  1RTJ A;  3PSF A;  3FZM A;  2OYQ A;  4ELU A;  1JLE A;  3IKM A;  2FBY A;  1JCE A;  4AM6 A;  3OYC A;  2YKM A;  4O5F A;  5EXW A;  3K5L A;  2B4J A;  3D2F A;  4Q5V A;  1YT3 A;  1KVA A;  4DWI A;  4LFB K;  2BDP A;  1GOA A;  2UU9 K;  4BG9 A;  5C2F A;  3V9W A;  2CGJ A;  4A57 A;  4CE9 A;  3QEP A;  4KI6 A;  3NFA A;  3H46 O;  2ZJQ L;  3ZT1 A;  1N5Y A;  1B92 A;  4NXN K;  3JXU A;  2A40 A;  4CK3 A;  2GUP A;  4BR2 A;  4EP5 A;  1WSH A;  4ZTJ A;  3AO2 A;  4ZHR A;  5HLF A;  1DGK N;  1JL1 A;  1WNS A;  2GTD A;  2RN2 A;  4CHN A;  3THY B;  1S9G A;  4ID5 A;  4BGB A;  3WXJ A;  1E4F T;  5B8H A;  1BIZ A;  3L3V A;  4LF4 K;  3VQ4 A;  3SK3 A;  1TK0 A;  4E89 A;  1IKW A;  1G99 A;  4IEE A;  3ZX0 A;  2YJF A;  3OBW A;  3J7Z O;  3VQ8 A;  1ITG A;  3CFP A;  4JRQ A;  3CQY A;  4BRP A;  4KHU A;  3HST B;  1BI4 B;  3PV8 A;  4B3R K;  3K5N A;  4CIE A;  1JL2 A;  1RDD A;  2DPN A;  3KKR A;  5BRH A;  3WXM B;  1KAY A;  4BRG A;  2JLE A;  3ENB A;  1K8K B;  3PX6 A;  3BUZ B;  4H0P A;  1HNZ K;  3CCQ N;  3O6W A;  1GOC A;  3K5O A;  3DRR A;  2W6K A;  3M5R A;  3WNE A;  4GVE A;  2ASM A;  5AQK A;  4CW7 B;  2NZT A;  1S6Q A;  2IDO A;  2ZD1 A;  4AH9 A;  4U7B A;  1K6Y A;  1HNV A;  3QIP A;  1K73 O;  2VWB A;  2D0O A;  3ENO A;  3S9H A;  1NK4 A;  4CJ7 A;  1U04 A;  4FOE A;  5AQV A;  4HCC A;  4KTQ A;  2O8F B;  4DR3 K;  3O4Q A;  1UAX A;  3QEI A;  3OY9 A;  1RFQ A;  5LMN K;  4B9N A;  3OYB A;  3QES A;  3TTD A;  2E2P A;  3QB0 A;  3CPE A;  1BCO A;  3AO1 A;  3VQ6 A;  4BR5 A;  4I2Q A;  4DF8 A;  3THW A;  4H0V B;  4A5B A;  1NGG A;  1IV0 A;  1IKV A;  3HP9 A;  4PQU A;  3MEC A;  1RT3 A;  2WON A;  2QWP A;  2HVI A;  4FK4 A;  3QIO A;  4IOX A;  2D5R A;  4CGI A;  2JGU A;  5DM7 L;  4ELV A;  4GKJ K;  1D5A A;  3DLK A;  3I0R A;  3KD1 E;  2X6N A;  4CD1 A;  3G25 A;  3OYH A;  3IMX A;  4FZX C;  4FLW A;  4BDP A;  2D0A A;  4W5R A;  2WOM A;  2VWK A;  3SUQ A;  4BG8 A;  1P90 A;  3T1Y K;  3SI6 A;  3E9O A;  1RDU A;  4WQ5 C;  3L6Q A;  4AHC A;  2IVN A;  2FF3 B;  2EHG A;  3I8D A;  3OYD A;  4CED A;  3HSC A;  4DG1 A;  1WN7 A;  4MO4 A;  2QWN A;  3CG7 A;  4WYB A;  4CBX A;  3O08 A;  5M1Q A;  3FFI A;  4JI6 K;  1JLB A;  1I94 K;  4DV0 K;  3AVK A;  5KRT A;  1KC8 O;  2PAV A;  4CJU A;  3QNN A;  4OLB A;  4E19 A;  3K58 A;  3PSI A;  3CFO A;  2QWQ A;  1L3S A;  4WFN L;  2YX6 A;  3QBW A;  3OS0 A;  1YI2 N;  4XH1 A;  1MA9 B;  1QHA A;  3TPQ A;  4BQL A;  2DFE A;  3TAF A;  4OVL A;  3C0B A;  5BR8 K;  3OBY A;  1D8Y A;  3TTC A;  3LAN A;  4GV9 A;  1ASU A;  3C7N B;  1K8A O;  3I8B A;  3V4I A;  1RTI A;  2E1Y A;  3HL8 A;  3OYA A;  1VQ6 N;  1ZBU A;  1C0U A;  3VQC A;  4OLA A;  4JV5 K;  3LM2 A;  4AHV A;  5E26 A;  4C23 A;  5KGX A;  5M1F A;  3SBG A;  1TKZ A;  4BRL A;  2UXB K;  3Q7C A;  1RBT A;  3M8Q A;  1JCG A;  2G8F A;  3KLE A;  1NGF A;  1J54 A;  1N32 K;  1BWF O;  3HTV A;  4X66 K;  4CK1 A;  5JVH L;  5J2Q A;  4DV4 K;  5AQX A;  1NBW A;  3OYK A;  4NO7 A;  3EY1 A;  3ZET A;  1BOT O;  4IZ9 A;  2A5X A;  1TL1 A;  2E88 A;  4K8X A;  1XNQ K;  4DQR A;  4BR0 A;  2PY5 A;  3V81 A;  4BRM A;  4B1U B;  2IIR A;  4BDZ A;  5CR4 A;  5AZJ B;  4K0K K;  4OPH A;  1NGI A;  4FW2 A;  3L4Q A;  4FL9 A;  4RG8 A;  1FW6 A;  4M3Y A;  3ALY A;  4BRI A;  4A62 A;  3FE1 A;  3VEZ A;  4CEC A;  1WOQ A;  1QQC A;  2NRX A;  3SMS A;  2E2Q A;  3M3Z A;  4XEI A;  1ZBL A;  1VQN N;  3LDO A;  1GOB A;  4L3Q A;  2NRT A;  1XHZ A;  4CJT A;  3TAE A;  3OYL A;  2P9S B;  2OA8 A;  2G8V A;  4H0X B;  4I6M B;  3OW2 M;  2ZE2 A;  3SAF A;  1IKY A;  1DEJ A;  5C12 A;  4Z4E A;  1HNX K;  3MXI A;  3VEY A;  4O8U A;  4PUO A;  3F73 A;  4FM2 A;  1GLD G;  1KVB A;  3O1W A;  3ZT2 A;  3AVB A;  4FWP A;  4ICL A;  3MCA B;  1SL0 A;  4DFK A;  4CF9 A;  4C8N A;  2O8C A;  4CVN E;  3LWL A;  2QWL A;  3KKS A;  4CZG A;  3QET A;  4DF4 A;  4FLV A;  4JKB A;  1Q7Y O;  3CQX A;  2JWK A;  5HRP A;  2G8W A;  2YNF A;  4RTF D;  4FLY A;  1Q86 O;  2YV0 X;  5HP1 A;  3ZSX A;  1ASW A;  3LDQ A;  1NKB A;  5M1K A;  3P83 D;  4FYD A;  2VGN A;  3K2P A;  4C8O A;  4B3M K;  4FK2 A;  4FJN A;  3WNG A;  4J2B A;  3OJU A;  3IG1 A;  3ISN C;  4CBU A;  3T7Z A;  1JJ2 M;  3SJH A;  3SAH A;  3MN7 A;  2Z1H A;  2Q31 A;  3BEX A;  1VQ4 N;  3VEN A;  2VCP A;  4JHD A;  2GX9 A;  4FSV A;  3A8Y A;  3GE1 A;  3GL1 A;  3UIQ A;  2HBJ A;  2ASO A;  2A1S A;  3PY8 A;  4DV6 K;  4Z4H A;  1L3T A;  2I7N A;  2YHW A;  4B9V A;  4PKI A;  3EKU A;  3THY A;  1SKW A;  2IGI A;  3H08 A;  4CHO A;  4QAG A;  1SZ2 A;  3NDK A;  3DXK A;  5M1P A;  3SMP A;  4X62 K;  3THV A;  1KXP A;  1NGC A;  3W0L A;  3DLL L;  4CZF A;  4KH4 A;  1BL3 A;  1LWE A;  4CES A;  5TKW A;  4QCL A;  1DTT A;  1NJZ A;  3SUO A;  4M63 C;  1W97 L;  1RT1 A;  4EAH D;  5ADX H;  2A3Z A;  4FJK A;  2KQ2 A;  5AQO A;  2O8E B;  1HUX A;  4O4G A;  1BI4 A;  3BGR A;  1VQ7 N;  3AVI A;  1LW2 A;  1TYQ B;  2HB5 A;  3VPZ A;  2E2O A;  1U4B A;  1KFS A;  1RBV A;  3F2K A;  5AQH A;  3A5M C;  4BR7 A;  4M3T A;  2W40 A;  4RCH A;  3QFU A;  2IVP A;  5JLF A;  3V1O A;  4BVP A;  3CI5 A;  3TAG A;  3VN5 A;  1E3M A;  4FJ9 A;  4AHT A;  1RBR A;  3H1V X;  2E5L K;  2CGL A;  1HX1 A;  4DFJ A;  3WQT A;  2FLO A;  5JIC A;  2XY8 A;  3LWM A;  1VHX A;  4CJ5 A;  4E7I A;  1S22 A;  3TU5 A;  4FLU A;  4CBW A;  4O0J A;  4BC4 A;  4CZE A;  3GDQ A;  4F2S A;  4DSK A;  1EKE A;  1BQN A;  4E0D A;  3QIN A;  3LDL A;  4L8R B;  5BRF A;  4IOA L;  2CH6 A;  1DT9 A;  3AGR A;  5HRO A;  1CXQ A;  4A2A A;  2XHB A;  1YJW N;  4JI8 K;  3HK2 A;  3NVK A;  2FBT A;  3QEX A;  2Q36 A;  3AVM A;  4CEF A;  3KWG A;  3L2V A;  4ELT A;  4O8K A;  2RPI A;  5AJ3 K;  4B9L A;  1QZ5 A;  3V1Q A;  1BCM A;  3VEW A;  5BRD A;  1BGX T;  1HNW K;  5CZ1 A;  3ULD A;  3ATV A;  4CZH A;  1NGB A;  3ZEU B;  3AA5 X;  5F2R A;  2W42 A;  4BC3 A;  3THX B;  3VEX A;  3TAP A;  1JKH A;  3RWU A;  3VQD A;  3I55 N;  1QS4 A;  4J2D A;  2O4G A;  3BZK A;  1NOY A;  4B3S K;  4FZZ A;  2FBX A;  4CJS A;  3HPH A;  2GUI A;  4DB3 A;  1XUP O;  2OPQ A;  5M1N A;  1DKG D;  4ID1 A;  3HZ6 A;  2VWJ A;  2UUB K;  4FJI A;  1LWC A;  1Q81 O;  4KV8 A;  3OYM A;  4W5O A;  2QKK A;  3MWP A;  4DV1 K;  2YNH A;  3IUC A;  2O8B B;  5CYM A;  4EZ6 A;  2WTU A;  4PL7 A;  4FLT A;  2AJQ A;  1XMQ K;  4DV7 K;  1YHQ N;  1G15 A;  1TVR A;  4CZL A;  3A5N C;  1BIU A;  5BPL A;  4YHH K;  1M1K O;  1FKO A;  2OPP A;  2P9P B;  3DYA A;  4N47 A;  3O9S A;  4GY2 B;  3ZX3 A;  4O0I A;  3C7N A;  3DRP A;  4LF5 K;  4RWT A;  4H5R A;  2Y1J A;  4BRN A;  2A41 A;  2P9U B;  4OKE A;  3T69 A;  3O8M A;  2VQF K;  1W9H A;  3KLH A;  3JSM A;  3CJ9 A;  3AY9 A;  1NGH A;  4JKA A;  3VEV A;  3SPZ A;  3V9Z A;  4CJ3 A;  3O5B A;  3P39 A;  3BF1 A;  2FXU A;  4H03 B;  1U6Z A;  4J8F A;  4H8K A;  1NK6 A;  4BE2 A;  3RMA A;  3CJC A;  4JI2 K;  3TWH A;  4O44 A;  3MXJ A;  5IT9 O;  2EWS A;  3HPO A;  4IJN A;  4DQS A;  3UKU B;  3ENH A;  1CZ9 A;  4H5V A;  2YNG A;  3LDP A;  5T7B A;  4O55 A;  4IFV A;  4CEO A;  2XRI A;  3DXM B;  3SPY A;  4UY8 O;  2HHX A;  2OTJ N;  5AZJ A;  1NGD A;  1A5X A;  3VER A;  4FK0 A;  3DI6 A;  1BIS A;  4KKO A;  3CM5 A;  1T05 A;  2PZS A;  4M3X A;  2OCE A;  4GVM A;  5C0Y A;  4FWQ A;  4CGF A;  1KVC A;  3LP0 A;  3NMU A;  3D0P A;  2P9S A;  4I6M A;  5C2D A;  4M3Z A;  4IBN A;  4GKK K;  5J2M A;  5CZ2 A;  1VQL N;  4M45 A;  4NB4 A;  1SQK A;  4FVM A;  1L3U A;  1TL3 A;  4K41 A;  3QML A;  4V19 S;  1ZBI A;  4FWR A;  3V9S A;  1J5O A;  3VOV A;  1FKP A;  1SS6 A;  3PO5 A;  4AF1 A;  2UXD K;  1IH7 A;  4JK8 A;  3M8P A;  1WBD A;  3TTF A;  2HVH A;  1RT5 A;  4LF9 K;  3LDN A;  5HOO A;  4B1Z A;  1VQM N;  1HYV A;  1HJR A;  5FRO A;  2QWR A;  3AVN A;  3LM9 A;  4LSL A;  1TKD A;  4JEP A;  4BE1 A;  3KLI A;  4CK2 A;  4G1Q A;  3J81 O;  3SV4 A;  4OX9 K;  1RNH A;  4PKH A;  2QM1 A;  3CCV N; 
#chains in the Genus database with same CATH homology
 1S1V A;  4E19 A;  3SUN A;  3K58 A;  1ASV A;  4KB0 A;  4OLB A;  4I9Q A;  3U6F A;  3LDS A;  4RW6 A;  2KZM A;  3RR7 A;  4Z4F A;  4J2A A;  1QSY A;  3ZSY A;  2HNY A;  4DTN A;  4B08 A;  3LAK A;  4RW7 A;  3KLF A;  4C8M A;  3CFO A;  1KFD A;  2XY6 A;  3HYF A;  1S1U A;  1L3S A;  1DLO A;  2BAN A;  4Z0U A;  3VQP A;  4M42 A;  3OS0 A;  4JLH A;  1UA1 A;  4CJV A;  4CFC A;  4DSJ A;  2DFE A;  3DM2 A;  3NF9 A;  4OVL A;  3TAF A;  1HRH A;  5HRS A;  2Z1G A;  3T19 A;  4DQQ A;  1NOZ A;  4Z4I A;  1D8Y A;  3PX4 A;  3TR8 A;  3LAN A;  4KAZ A;  4Y1C A;  1JXE A;  4NYN A;  1ASU A;  1X9W A;  4B9U A;  1RIL A;  1QHT A;  3AA2 A;  3O3G A;  3V4I A;  1EET A;  3TI0 A;  3KD5 E;  1RTI A;  3HL8 A;  3AVH A;  3MED A;  1MU2 A;  3OYA A;  4W5T A;  4CFB A;  2HHV A;  2IC3 A;  3HPG A;  2YKN A;  3TAB A;  1X1P A;  1ZBU A;  4CJR A;  1C0U A;  3VQC A;  4F8R A;  4OLA A;  1B9F A;  4KPY A;  4CF1 A;  4C8K A;  1BQM A;  3CQ8 A;  4AHV A;  3KK2 A;  1SKR A;  5KGX A;  1TV6 A;  4FJJ A;  1EXQ A;  3QNN A;  1TKZ A;  3G0Z A;  1XC9 A;  3O3F A;  3U3Y A;  1S1T A;  1RBT A;  4DTP A;  3QEV A;  1C1A A;  3M8Q A;  2I5J A;  4LH5 A;  1O1W A;  3KLE A;  2G8F A;  1J54 A;  1LAW A;  3IAY A;  3V9X A;  5J2N A;  2KW4 A;  4E7L A;  1T8E A;  4FM0 A;  2BGG A;  3K57 A;  4CK1 A;  5J2Q A;  2X74 A;  5JS1 A;  1YVU A;  3OJS A;  4C8L A;  3OYK A;  2Z1J A;  3EY1 A;  3NCI A;  1NKC A;  4CHP A;  5C24 A;  1TL1 A;  4FJH A;  4K8X A;  4DTR A;  2EX3 A;  5HBM A;  4DQR A;  4MFB A;  2PY5 A;  2GBZ A;  5CYQ A;  4FM1 A;  1QTM A;  4PA1 A;  4CJF A;  3NF8 A;  2QXF A;  1QSS A;  5KRS A;  1R0A A;  3V81 A;  4OPJ A;  4DSI A;  4BDZ A;  4B9T A;  3OYF A;  3IS9 A;  1RBU A;  4CF8 A;  5J1E A;  3SCX A;  4IFY A;  4FW2 A;  4B8A B;  3EZ5 A;  3VQQ A;  1LW0 A;  4RG8 A;  3QEW A;  1D9D A;  1QSL A;  4M3Y A;  3ALY A;  1VRU A;  3ZCM A;  3OS1 A;  1JXB A;  4HUE A;  1IKX A;  1S9E A;  3LP1 A;  4CEC A;  1QQC A;  3SYZ A;  1Z25 A;  1JLF A;  1RCH A;  2ZQB A;  3V9U A;  1ZBL A;  4KHS A;  3CYM A;  4AIL C;  1YTU A;  3ITH A;  4CJP A;  1GOB A;  2KZZ A;  1WLJ A;  3NHG A;  1XHZ A;  3OS2 A;  4CJT A;  3TAE A;  1HQE A;  3VQ9 A;  3OYL A;  2OA8 A;  3NGI A;  1J53 A;  2B5J A;  4N5S A;  2G8V A;  2RF2 A;  4FLX A;  2ZE2 A;  1IKY A;  4CER A;  4HHT A;  1Z26 A;  1WSG A;  4Z4E A;  2HHT A;  4BE0 A;  2P5O A;  3MXI A;  4W5Q A;  4FJM A;  2X6S A;  3NF7 A;  1S5J A;  4PUO A;  3F73 A;  4FW1 A;  4FM2 A;  1KVB A;  3ZSO A;  4FCY A;  4CIG A;  2P51 A;  1VSM A;  3ZT2 A;  1D9F A;  3S3N A;  3AVB A;  1W0H A;  2QK9 A;  4ICL A;  3MAQ A;  1C0T A;  1HMV A;  1SL0 A;  5EU7 A;  4DFK A;  4CF9 A;  4C8N A;  1ZBF A;  1KLM A;  4QOZ B;  3LWL A;  3NAE A;  1B9D A;  4CCH A;  2X78 A;  1KCF A;  4GW6 A;  1T03 A;  2IOC A;  3KKS A;  4DTM A;  3DLB A;  3QET A;  4DF4 A;  1RDA A;  1LV5 A;  4TSX A;  1Q9X A;  3NH1 A;  4FLV A;  1SL1 A;  3HVT A;  4CGG A;  3DRS A;  2F8S A;  5HRP A;  2G8W A;  3NGZ A;  4E7H A;  5KTQ A;  2YNF A;  4FLY A;  1NK5 A;  1S1W A;  1T7P A;  4DS4 A;  2R7Y A;  1N6Q A;  2YV0 X;  1HNI A;  3L3U A;  3C94 A;  3ZSX A;  1ASW A;  5HP1 A;  1NKB A;  4NCA A;  2HHQ A;  1TAU A;  1L5U A;  1VRT A;  3P83 D;  4NYF A;  3VQE A;  3S3O A;  3ZSR A;  3HJF A;  4FYD A;  3K2P A;  4C8O A;  2G8H A;  1LAV A;  4E1N A;  4FK2 A;  4FJN A;  3WNG A;  4CGD A;  3OJU A;  3OVN A;  4B9M A;  3IG1 A;  3ISN C;  5KGW A;  2IAJ A;  4LSN A;  4J2B A;  1C1B A;  4CFA A;  2G8U A;  4I9L A;  3M8S A;  3KLG A;  4W5N A;  1YTA A;  2Z1H A;  2DY4 A;  2Q3S A;  4LH4 A;  4I7F A;  4DU4 A;  4RW8 A;  2DTU A;  1VSH A;  3LPT A;  1RBS A;  1FK9 A;  4AHU A;  5DK5 A;  1NK8 A;  4F3T A;  3LP2 A;  1I39 A;  4CJQ A;  1KRP A;  3UIQ A;  3G10 A;  2KFZ A;  1VSF A;  2A1S A;  3AVC A;  3O4N A;  3PY8 A;  3AO4 A;  4IKF A;  4Z4H A;  2KTQ A;  4MQ3 A;  1L3T A;  3DMJ A;  3AO3 A;  4B9V A;  1TGO A;  3HVR A;  1NJY A;  4BWM A;  4E3S A;  5D3G A;  1SKW A;  1IO2 A;  2IGI A;  3H08 A;  1REV A;  4QAG A;  4CHO A;  2OPS A;  3NDK A;  4DTS A;  3RMB A;  4OJR A;  2PYL A;  1TK8 A;  4F2R A;  2PYJ A;  2XO7 A;  3LZJ A;  2BE2 A;  4DSE A;  3QNO A;  3THV A;  3SNN A;  4PY5 A;  2HNZ A;  1BL3 A;  1LWE A;  3LP3 A;  4Z4C A;  1NK9 A;  1VSK A;  4CES A;  1HQU A;  2OPR A;  4QCL A;  1DTT A;  1NJZ A;  5C42 A;  3SUO A;  1TK5 A;  1RT1 A;  2P1J A;  2YHB A;  4J2E A;  4CEA A;  3NH0 A;  3C6T A;  2VG5 A;  4CF0 A;  4DLE A;  5DMR A;  4FJK A;  3SQ2 A;  3MEE A;  4I2P A;  1RT4 A;  4KHN A;  2KQ2 A;  3WNF A;  3B6O A;  5C25 A;  1RTD A;  1WAF A;  4O4G A;  4CEE A;  1BI4 A;  3BGR A;  3EYZ A;  3AVI A;  4KI4 A;  3KK1 A;  1BHL A;  1C6V A;  1LW2 A;  4CF2 A;  2HND A;  2HB5 A;  3KK3 A;  1U4B A;  3SZ2 A;  1SKS A;  1KFS A;  3HO1 A;  2E6L A;  4FLZ A;  4JS5 A;  1NK7 A;  1RBV A;  4DTJ A;  3HT3 A;  3AA4 A;  3OYJ A;  4HUG A;  4CIF A;  4YNQ A;  2LSN A;  5FDL A;  3L2Q A;  3SQ0 A;  4F4K A;  3AV9 A;  4FJ5 A;  2VG7 A;  4M3T A;  4Q0B A;  1NJW A;  1XWL A;  5CY4 A;  3V1O A;  4UQG A;  3CFR A;  3LAM A;  4AHR A;  4CGH A;  4DS5 A;  4IDK A;  3V6D A;  3TAG A;  3AVL A;  3K59 A;  3TAQ A;  3VN5 A;  1ZYQ A;  4M3W A;  2B6A A;  1Q9Y A;  4FJ9 A;  4AHT A;  2FC0 A;  1RBR A;  2XY5 A;  4OPK A;  1RDC A;  1U47 A;  1WAJ A;  4DFJ A;  3L8B A;  3KJV A;  4B9S A;  1XI1 A;  1NJX A;  3KTQ A;  3ZSQ A;  4Z4G A;  1TKT A;  2F96 A;  4HVJ A;  1S1X A;  2XY8 A;  3LWM A;  4CJ5 A;  4E7I A;  1NK0 A;  1Y97 A;  2HMI A;  1UOC A;  4WE1 A;  3LAL A;  4FJX A;  4KRF A;  3QLH A;  4LY7 A;  3NGY A;  1KTQ A;  3M8R A;  4FLU A;  1JLC A;  4DQP A;  3DOK A;  1SV5 A;  3VQ7 A;  4CJW A;  4O0J A;  4E7J A;  1U49 A;  4M3U A;  3L2R A;  1CXU A;  4PWD A;  3KIO A;  5HRR A;  4CJL A;  2QKB A;  4RW4 A;  2Z1I A;  4F2S A;  4DSK A;  3NH2 A;  3RMC A;  2XY7 A;  4DSF A;  2E4L A;  1EKE A;  1BQN A;  4E0D A;  3QIN A;  4CJK A;  2A1R A;  4L8R B;  3MXM A;  2F8T A;  2HW3 A;  2OZS A;  4KTW A;  4DSL A;  3AA3 A;  4DQI A;  3PUF A;  3HP6 A;  1SUQ A;  3L2U A;  1QE1 A;  3SQ1 A;  4FK0 A;  5HRO A;  4FJ7 A;  1CXQ A;  4DTO A;  3QER A;  2ETJ A;  2DFH A;  2XHB A;  4GMJ B;  4OKJ A;  4H4O A;  3HK2 A;  1SL2 A;  3I0S A;  4CHZ A;  2FBT A;  4EZ9 A;  3QEX A;  4FJG A;  3AVM A;  4CEF A;  4BWJ A;  3L2V A;  4FXD A;  4ELT A;  4KHW A;  1RTJ A;  4F3O A;  2RPI A;  3NE6 A;  4B9L A;  2OYQ A;  1S6P A;  3A2F A;  3TAN A;  4ELU A;  3V1Q A;  1BCM A;  3ASM A;  1JLE A;  2G8K A;  1WSF A;  5SWM A;  3O3H A;  1XHX A;  2FBY A;  4E7K A;  3OYC A;  1UWB A;  2YKM A;  1BGX T;  3K5L A;  2B4J A;  3AVJ A;  4Q5V A;  1YT3 A;  1KVA A;  5CZ1 A;  3ULD A;  4DWI A;  3AVF A;  2BDP A;  4B3O A;  1RDB A;  1VSJ A;  4RW9 A;  1GOA A;  3ZT0 A;  3AA5 X;  4CHQ A;  2W42 A;  1UA0 A;  3OYN A;  4M3R A;  1IG9 A;  3V9W A;  4CE9 A;  4N76 A;  4DFP A;  3TAP A;  1JKH A;  3QEP A;  2NUB A;  3VQD A;  3RWU A;  3NFA A;  1QS4 A;  4KI6 A;  4J2D A;  4DU1 A;  2O4G A;  1JLG A;  5K14 A;  4KHQ A;  3ZT1 A;  1N5Y A;  1B92 A;  4YFU A;  1NOY A;  4FZZ A;  2FBX A;  4CJS A;  3HPH A;  4CK3 A;  3TAR A;  2GUI A;  3B6P A;  4EP5 A;  1WSH A;  4ZTJ A;  1J9A A;  3RMD A;  2OPQ A;  2GV9 A;  3AO2 A;  1X9M A;  2HHU A;  4ID1 A;  2VWJ A;  4FJI A;  4NCB A;  3SJJ A;  1LWC A;  4ZHR A;  4KV8 A;  3OYM A;  4BAC A;  4KO0 A;  5HLF A;  1JLA A;  4W5O A;  4LD0 A;  3VA0 A;  2QKK A;  1JL1 A;  1WNS A;  2RN2 A;  4CHN A;  1JLQ A;  4OKK A;  2YNH A;  4ZTF A;  1S9G A;  4ID5 A;  3PO4 A;  5CYM A;  3VQ5 A;  4AHS A;  4EZ6 A;  1KLN A;  1KSP A;  4IG3 A;  5E41 A;  1A5V A;  4FLT A;  1BIZ A;  3SQ4 A;  3L3V A;  3OYE A;  2AJQ A;  3VQ4 A;  4CEB A;  1G15 A;  1TK0 A;  3RRG A;  2FBV A;  2YHA A;  1TVR A;  4E89 A;  3WNH A;  2Y1I A;  1VK0 A;  1IKW A;  3C95 A;  1DTQ A;  3TAM A;  3LPU A;  3LZI A;  1BIU A;  4CEQ A;  4Y1D A;  1FKO A;  2OPP A;  4N47 A;  3DYA A;  4KTZ A;  3VQ8 A;  1ITG A;  4FZY A;  2IS3 A;  3NF6 A;  4O0I A;  3DRP A;  3CFP A;  4JRQ A;  2HHS A;  2KFN A;  4DFM A;  3E01 A;  4KHU A;  3HST B;  3DOL A;  3DLH A;  1BI4 B;  3PV8 A;  3T1A A;  3K5N A;  2Y1J A;  4CIE A;  1JL2 A;  1C0M A;  1RDD A;  1RT2 A;  1HYZ A;  3KKR A;  3F9K A;  4OKE A;  4DTU A;  5I3U A;  1WSJ A;  1TKX A;  1W9H A;  3KLH A;  3JSM A;  3HM9 A;  3DLR A;  1CLQ A;  4B8C A;  2JLE A;  3PX6 A;  2RKI A;  3SPZ A;  3PX0 A;  3V9Z A;  4CJ3 A;  2ATQ A;  1NKE A;  1GOC A;  3K5O A;  4JS4 A;  4N41 A;  3DRR A;  4HCB A;  4NCG A;  3AO5 A;  3WNE A;  5I42 A;  4CHY A;  4H8K A;  1NK6 A;  4BE2 A;  3RMA A;  3SV3 A;  3U3G A;  4BDY A;  3OYG A;  3TWH A;  4O44 A;  3MXJ A;  1S6Q A;  2IDO A;  4CGJ A;  2ZD1 A;  4AH9 A;  3AVG A;  3HPO A;  4CJE A;  3RRH A;  3S3M A;  1K6Y A;  4XIU A;  3BDP A;  1WSE A;  4DQS A;  1HNV A;  3QIP A;  5FRN A;  3VQA A;  1CZ9 A;  2YNG A;  4M41 A;  3ZSW A;  5T7B A;  4DMN A;  4EP4 A;  4DU3 A;  3RR8 A;  2ITG A;  4IFV A;  4O55 A;  3S9H A;  1NK4 A;  2D0B A;  3HXM A;  3IRX A;  1U45 A;  3CM6 A;  3MEG A;  4CEO A;  1U04 A;  2VG6 A;  2XRI A;  3SPY A;  4HCC A;  2HHX A;  4KTQ A;  3O4Q A;  1UAX A;  3QEI A;  3OY9 A;  5SZT A;  1A5X A;  2D0C A;  3K5M A;  4E1M A;  1RT6 A;  5JS2 A;  4B9N A;  4OGC A;  3OYB A;  1TAQ A;  1WSI A;  3DI6 A;  1VSD A;  1BIS A;  3QES A;  5J2P A;  1L3V A;  3AVA A;  1BCO A;  3AO1 A;  3VQ6 A;  4R5P A;  4KKO A;  3V1R A;  3CM5 A;  2P5G A;  1T05 A;  2PZS A;  4M3X A;  1HYS A;  4GVM A;  3NBP A;  4I2Q A;  4DF8 A;  4JRP A;  4H4M A;  1EX4 A;  3C6U A;  4KB1 A;  4FJ8 A;  4CGF A;  4O5B A;  1KVC A;  1IKV A;  3HP9 A;  3LP0 A;  2YNI A;  4OGE A;  4CJ4 A;  3D0P A;  3MEC A;  4PQU A;  4FJL A;  1RT3 A;  2WON A;  2HVI A;  4FK4 A;  3QIO A;  4KRE A;  2OZM A;  2D5R A;  4CGI A;  2JGU A;  4IBN A;  1U48 A;  4ELV A;  4M3Z A;  3VQB A;  4DLG A;  5J2M A;  2O4I A;  5CZ2 A;  4KFB A;  1Q8I A;  2G8I A;  4M45 A;  1D5A A;  3DLK A;  3I0R A;  3QO9 A;  2X6N A;  4FVM A;  3ZSV A;  3JYT A;  1TL3 A;  1L3U A;  3KD1 E;  4HUF A;  5KI6 A;  1A5W A;  4N56 A;  1VSE A;  5FRM A;  3OYH A;  4FZX C;  4FLW A;  4CEZ A;  3OYI A;  1ZBI A;  1F21 A;  1RTH A;  3V9S A;  2E6M A;  1ZBH A;  4BDP A;  1J5O A;  2D0A A;  3D45 A;  1VSI A;  4CFD A;  4W5R A;  2WOM A;  1FKP A;  2VWK A;  3PO5 A;  3SUQ A;  5HRN A;  3L2W A;  3SUP A;  3SI6 A;  1EP4 A;  4HTU A;  1IH7 A;  2DFF A;  3M8P A;  3T3F A;  1VSL A;  2HVH A;  3P5J A;  1RT5 A;  1FXX A;  4AHC A;  3P1G A;  3ZSZ A;  3VA3 A;  2EHG A;  1HYV A;  1HJR A;  3I8D A;  1LWF A;  3OYD A;  4CED A;  5FRO A;  4KHY A;  4DG1 A;  1WN7 A;  3AVN A;  3CG7 A;  4LSL A;  1TKD A;  1I3A A;  3RTV A;  3DLG A;  4BE1 A;  3KLI A;  3ZT3 A;  4CK2 A;  3FFI A;  4G1Q A;  3DLE A;  1JLB A;  3SV4 A;  1RNH A;  1C1C A;  1RT7 A;  4IG0 A;  4K8Z A;  1CZB A;  3AVK A;  3ZT4 A;  5KRT A;  1X9S A;  2HHW A;  4DTX A;  1HPZ A;  4CJU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...