3VA0A

Crystal structure of rnase t in complex with a di-nucleotide product (gg) with one mg in the active site
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
207
structure length
207
Chain Sequence
TGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLSAAEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease T
publication title How an exonuclease decides where to stop in trimming of nucleic acids: crystal structures of RNase T-product complexes
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/dna
total genus 65
structure length 207
sequence length 207
chains with identical sequence B
ec nomenclature ec 3.1.13.-:
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00929 RNase_T Exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3va0A00
1EETA 1MU2A 4IFYA 3LANA 4F3OA 4CJKA 2G8WA 3LP2A 1FXXA 3KLHA 3WNGA 3TAFA 4EZ6A 4CJ3A 2DFHA 1ZBUA 4E89A 3RMDA 3C95A 1HMVA 1VSEA 2R7YA 4DTUA 4KHNA 4OGCA 3T1AA 4CERA 4DTNA 3ZT4A 4FYDA 3LP3A 3DLHA 1BQNA 2LSNA 1NJXA 1IKXA 1ASVA 1W0HA 4BDZA 3TANA 3AA2A 4FJKA 4F2SA 1Q8IA 4JS5A 3ASMA 1VSMA 2F96A 1NJZA 2KW4A 4FXDA 1YT3A 1JL1A 1Z25A 3HPHA 4F2RA 2XY8A 2ZE2A 4B9TA 1XHXA 1VSLA 1LAWA 1T03A 3NF6A 3KLFA 2YNGA 1UA1A 2NUBA 2IS3A 3DLEA 3AVHA 4HUGA 1Q9XA 3WNFA 3LPUA 4FLZA 3VA3A 3IRXA 4JRPA 4I2PA 1YTUA 3IS9A 4M3UA 3NGYA 4ID1A 5FRNA 1CLQA 1WNSA 1WSFA 4UQGA 1U45A 1C6VA 3ZT0A 5E41A 5JS2A 2DTUA 3AVIA 2O4GA 4KHSA 3AVGA 3SNNA 1IO2A 2IC3A 4IFVA 5FRMA 4KRFA 1RBRA 4DTOA 2YNHA 3HVTA 4HUEA 2G8HA 1NOYA 2ITGA 4CESA 1BI4B 3CM5A 4BDYA 1JL2A 1J53A 3LP0A 4KTQA 1KTQA 1SL0A 2HNZA 1TKZA 2D5RA 4NCAA 4F3TA 4OGEA 3HXMA 2ATQA 2G8FA 3AVLA 3MEDA 4I2QA 5EU7A 3LZJA 3HJFA 1N5YA 4KKOA 1XC9A 1J5OA 1BQMA 3ITHA 2P51A 2XRIA 5C42A 4BE0A 3AVNA 3MAQA 3I0RA 1S1UA 1ZBIA 4LH5A 3OYMA 3KK2A 2QKBA 3NH2A 1TGOA 4O4GA 3NGIA 4AHUA 4M3RA 1ITGA 3AO1A 4CF1A 4CEDA 3P1GA 2W42A 3THVA 1RTJA 3S3MA 3L3UA 3OYBA 1QSYA 3SV3A 4AHCA 2YV0X 3HT3A 4J2EA 4BACA 2B4JA 3TR8A 5J2QA 1I39A 1TKTA 3QERA 3TAGA 4WE1A 4E7LA 1DLOA 3OS2A 1KLMA 3V9ZA 4KTWA 4DFJA 3RR8A 1BCMA 4FW1A 3V1RA 1UAXA 1BIUA 3G0ZA 3ZCMA 3V9WA 3LPTA 4E7HA 3S3NA 4FJNA 3NFAA 4KHQA 4Z4IA 5SZTA 5T7BA 4Z4FA 4DTPA 4C8MA 4W5OA 3TWHA 4NCBA 1U47A 2JLEA 2PYLA 2P1JA 1N6QA 3HSTB 4CGIA 4Y1DA 1WN7A 4YFUA 1RT1A 2G8VA 4CEEA 3L3VA 4N56A 3LWMA 1HNVA 5HROA 3RMAA 1NK0A 5KGWA 3V9XA 4XIUA 3LDSA 3BGRA 3DMJA 3SV4A 4OKKA 3TARA 2HW3A 2ZQBA 1NK7A 1EXQA 1S9EA 2B6AA 4CJPA 4E1MA 2BGGA 3ZSWA 1VRUA 4CK2A 3VQEA 3ZT2A 1TKXA 1KSPA 3V81A 4ELTA 3F73A 4L8RB 4FK4A 4FLVA 4JLHA 4YNQA 2X74A 2BE2A 1LW2A 1QSLA 3WNEA 4CE9A 4B9SA 3QEVA 3SYZA 4FJMA 2RKIA 4DTRA 3KLEA 3QLHA 4DTMA 4BWMA 2Z1HA 2D0BA 3FFIA 2E6MA 1KVBA 1GOBA 4RW7A 4DTSA 4AHVA 3SUNA 1RDBA 2B5JA 3K58A 3SCXA 1VK0A 2DY4A 3KD1E 3HO1A 3AVMA 5CZ2A 3OYEA 1RTDA 4W5QA 1TAUA 5I42A 3VQBA 1NKEA 3O3HA 1D9DA 3KLIA 1JKHA 3H08A 4FJ7A 4E3SA 4E0DA 1YVUA 3HL8A 3KKRA 3O4NA 4B3OA 1NK8A 1S1XA 3T19A 2OPPA 4J2BA 2Z1IA 4CFBA 3NGZA 2QXFA 3TAMA 1GOAA 3SUQA 3DRPA 3K57A 1WLJA 1QE1A 4DSFA 4ZTJA 4KI4A 4PQUA 2A1SA 3VQQA 4OPKA 1BGXT 3MECA 3ALYA 2YHAA 2IAJA 1RTIA 3AO2A 3QO9A 4CJFA 1NKBA 2HB5A 2BANA 1JLCA 2GUIA 3D45A 1KRPA 4EZ9A 1C1BA 4BE1A 1CZ9A 2FBXA 1RDDA 2ZD1A 3KLGA 3HPOA 3AO5A 4FK0A 1VSHA 4C8NA 4CGHA 4CEAA 5DK5A 4HVJA 4FZZA 2VWKA 2HNYA 3MEEA 4FCYA 3ISNC 1X9SA 4G1QA 3CFOA 4DQPA 1WSJA 3RMCA 3OYDA 3VQ7A 4CEBA 3QEWA 3AVBA 5JS1A 3HYFA 1R0AA 3PO4A 4N41A 2IGIA 4DFPA 1Y97A 3ZSZA 2FBTA 3B6OA 3AO4A 5CY4A 1WSEA 1G15A 4NCGA 3QEIA 3AVCA 4H4MA 1RT6A 3AV9A 4IG3A 1QTMA 5C24A 2VWJA 1IKYA 4E7IA 1VRTA 4DTJA 2PZSA 2XHBA 4KREA 3ZT1A 1CZBA 3V6DA 3SPZA 2PY5A 3PX6A 4CFCA 3QNNA 4CHYA 4H8KA 3DLGA 3TAPA 3AA3A 4IKFA 2HNDA 3TI0A 2P5OA 3VQ9A 3I8DA 4CJTA 3SQ2A 1KVCA 1S5JA 4JS4A 4FM1A 1WAJA 4M3TA 4FM0A 5HRSA 3V1OA 3PX0A 1CXQA 4DQSA 1Z26A 4M3YA 4CGFA 1HRHA 3QESA 1LWCA 2JGUA 3VQ5A 1L3VA 3V4IA 1ZYQA 1WSHA 1B92A 4CFAA 3O3FA 4J2AA 2O4IA 2HHQA 1JLAA 4FJHA 1C1AA 1EKEA 1SL2A 3NDKA 1A5VA 4B9LA 3EY1A 2HMIA 5J2PA 1FKPA 4HCCA 3C6UA 2HHSA 4DTXA 4BDPA 1RBTA 3K5LA 3QEPA 2EX3A 4DQRA 3C94A 4QAGA 3O4QA 1X9MA 3OYHA 3L2WA 2KQ2A 4DF4A 1U4BA 2G8UA 1A5XA 2X78A 4M3WA 2A1RA 1KLNA 2KZMA 4IG0A 2QK9A 3ZT3A 3QNOA 1C1CA 3QIOA 4BE2A 4HCBA 3K2PA 3DLRA 2RN2A 3M8PA 2RPIA 5CYQA 4O44A 1TVRA 4O55A 5HRPA 3NAEA 4CGJA 3KK1A 4KV8A 1KVAA 4I7FA 4KO0A 4FJXA 2HHXA 4CJ5A 3OYLA 1NK9A 2FBYA 2D0CA 3LWLA 4QCLA 4AH9A 3TABA 5J2NA 2ETJA 1QQCA 2IDOA 4JRQA 1VSIA 3HP6A 2VG5A 1HYZA 2FC0A 3VQAA 4DF8A 1T05A 2XY7A 4E7KA 4DQIA 3HP9A 1BHLA 1LV5A 1KFSA 4OVLA 5K14A 4ELVA 1D9FA 1YTAA 3DYAA 1KFDA 3V1QA 4CGGA 1B9FA 1BIZA 4KPYA 3ZSQA 4CIEA 1SL1A 1VSDA 3G10A 3VQDA 4CECA 1WSIA 3PO5A 2HHTA 2YKNA 1IH7A 4CJSA 4CF2A 4DLGA 2VG7A 1DTQA 2RF2A 4RG8A 1B9DA 1QS4A 5KGXA 3NCIA 4LY7A 4R5PA 4C8KA 1RDCA 1RNHA 4Z0UA 3ZSVA 3L2VA 3IAYA 2KFNA 4HHTA 3AVFA 3S9HA 2DFFA 4DS4A 3QEXA 2DFEA 1BL3A 3U3GA 3PY8A 3VQPA 3DOKA 5CYMA 3OYIA 3S3OA 4Z4CA 1IKWA 1F21A 3K5MA 4FW2A 3DRSA 4FJJA 5C25A 1RBVA 3E01A 3NH0A 3CQ8A 2E6LA 3CYMA 1TL3A 4OPJA 5HP1A 2Y1JA 3ULDA 1C0UA 2XY6A 1SUQA 3DM2A 4RW8A 2G8KA 4E7JA 1J54A 1L3UA 1WAFA 4IBNA 1BI4A 2GBZA 2HVHA 3U3YA 3KJVA 1S6QA 4F4KA 3RMBA 4CHZA 3MEGA 3P83D 4I9QA 1JLGA 1IG9A 1TK0A 1S1WA 3VN5A 3KTQA 3VA0A 1K6YA 1QHTA 3L2UA 3D0PA 3KKSA 3SQ4A 1BCOA 3AVAA 2OPQA 4W5TA 2VG6A 5FDLA 1RILA 4OJRA 3HK2A 4Z4EA 5KRTA 3AVKA 3O3GA 4B9NA 3M8SA 1VSKA 4CHQA 3SQ1A 2KTQA 1TKDA 4KAZA 5HRRA 4DSKA 4DS5A 1SV5A 1J9AA 1LAVA 1RT4A 4CF8A 1RBSA 4CGDA 4DSLA 3AA4A 3K5NA 1D5AA 3NH1A 3C6TA 4B8CA 4ID5A 4FLTA 3PX4A 3SI6A 1O1WA 3V9SA 4CK1A 1EP4A 3I0SA 3RWUA 3QETA 1RDAA 2WOMA 2Z1JA 1RCHA 2D0AA 4KHWA 3WNHA 4LSLA 4AHRA 1NK6A 1HNIA 3P5JA 3OS1A 2FBVA 4CIFA 1NK5A 4W5NA 5J1EA 1HYVA 3VQCA 2YHBA 4CJRA 4DU1A 3OYFA 2HHUA 1XHZA 4CK3A 4CEZA 4OKEA 1SKSA 4CF0A 3SJJA 1QSSA 4FLXA 1UOCA 3SUPA 4Q0BA 3NF7A 4CJQA 4NYNA 3K59A 3LZIA 1U49A 2WONA 1RT2A 3DI6A 3IG1A 1HPZA 4NYFA 4DLEA 2QKKA 4KI6A 3TAQA 4DSIA 4N47A 4DSJA 1UA0A 4BWJA 1SKRA 4QOZB 3RR7A 1T7PA 3LP1A 3HVRA 1C0MA 1VSFA 4M41A 3ZSYA 2XO7A 4O0IA 2KZZA 1ZBLA 2KFZA 3SPYA 5I3UA 4N76A 3OJSA 2EHGA 1FK9A 1RBUA 2YNFA 4CIGA 4Z4GA 3VQ4A 3ZSXA 1GOCA 3PUFA 3LALA 1HJRA 4KTZA 4CJLA 4CJ4A 5HLFA 2OZMA 4E1NA 2HHWA 4FZXC 4LH4A 4CJUA 4CCHA 1L5UA 1TK8A 4M3ZA 1FKOA 2I5JA 4CJEA 1XWLA 3VQ8A 5D3GA 3U6FA 4KFBA 2HVIA 1WSGA 4OKJA 4B8AB 3MXIA 4DG1A 5KI6A 4AHTA 3JYTA 1NK4A 3RRHA 4O5BA 4EP4A 4RW4A 4LSNA 5FROA 3OYAA 3NHGA 2XY5A 3SQ0A 4DWIA 4E19A 4CEQA 3RRGA 4O0JA 1D8YA 1S1TA 2E4LA 2OPRA 1JLEA 1XI1A 2X6SA 1ZBFA 1TK5A 3F9KA 3ZSOA 2BDPA 1RT5A 1HQEA 4ZHRA 3OVNA 1DTTA 1S9GA 2YKMA 4CHNA 3OYNA 1LWEA 3KK3A 4GMJB 5DMRA 4KB0A 4J2DA 4M42A 1UWBA 1EX4A 3K5OA 3M8QA 4C8OA 1U48A 1LWFA 4GVMA 4HTUA 4B9MA 4CJWA 1NKCA 3DOLA 4FJ5A 1TV6A 1A5WA 3NF9A 4FK2A 4CEOA 3SUOA 1ASUA 1JXBA 4ICLA 3OJUA 4B9UA 4FZYA 3AO3A 2G8IA 4GW6A 3V9UA 3QINA 4C8LA 1C0TA 3KIOA 4I9LA 1ZBHA 3AA5X 3OYGA 1JLQA 4FJGA 3CG7A 1REVA 1HYSA 4KHYA 3L8BA 3CFRA 5J2MA 2Q3SA 3OYKA 4M45A 1JLBA 3VQ6A 4CJVA 3OYCA 4RW9A 3HM9A 1NJWA 4B08A 1L3TA 2P5GA 3KD5E 4B9VA 4FJIA 1Q9YA 1U04A 3CFPA 1W9HA 3NBPA 4MFBA 4Y1CA 5HBMA 2Y1IA 2OA8A 2OZSA 4AILC 4DU4A 4DMNA 1L3SA 1ASWA 4TSXA 4DU3A 4DFMA 1LW0A 4W5RA 4Q5VA 1T8EA 3SZ2A 4N5SA 3DRRA 3MXMA 3EZ5A 4EP5A 2PYJA 4OLAA 3MXJA 3BDPA 1I3AA 1S6PA 3CM6A 4IDKA 1TAQA 2OPSA 3M8RA 4HUFA 3ZSRA 4PA1A 2HHVA 1JLFA 3L2QA 3HPGA 3L2RA 4FJ9A 4ZTFA 4FM2A 1BISA 3EYZA 4CHOA 3OY9A 4LD0A 1RTHA 2YNIA 4PWDA 1RT7A 4RW6A 1JXEA 2GV9A 3UIQA 4MQ3A 3PV8A 1IKVA 4FLUA 4F8RA 2F8TA 1X1PA 3NF8A 3NE6A 3DLBA 4CEFA 5KRSA 3JSMA 3DLKA 3A2FA 4H4OA 5SWMA 1NJYA 2X6NA 4Z4HA 3T3FA 4FJ8A 4M3XA 3OS0A 2AJQA 5KTQA 4AHSA 3LAKA 1KCFA 1CXUA 3OYJA 4FLYA 3AVJA 2OYQA 4KHUA 3RTVA 4K8ZA 4PY5A 5CZ1A 1HQUA 1VSJA 3LAMA 4FJLA 4DFKA 4CFDA 1NOZA 2Z1GA 1S1VA 3TAEA 4CF9A 2F8SA 4OLBA 4KB1A 4PUOA 1TL1A 4DSEA 3QIPA 4FLWA 5HRNA 1X9WA 4DQQA 4ELUA 2IOCA 1RT3A 3B6PA 4K8XA 4FVMA 4CHPA 1SKWA
chains in the Genus database with same CATH superfamily
2VQEK 1EETA 1MU2A 4IFYA 4F3OA 3LP2A 4UY8O 1ESVA 3O5BA 2DFHA 1ZBUA 2ITMA 4E89A 3C95A 1VSEA 3CMAN 1E4FT 4QS8A 2VWBA 3D7EO 2GWKA 2LSNA 3E9LA 1NJXA 1IKXA 1HKGA 4K41A 5AQNA 3TTCA 5LJVA 4JI6K 4FJKA 4I6MA 4JS5A 3ASMA 1VSMA 5AQLA 1BWFO 2KW4A 4FXDA 4F2RA 2ZE2A 3CC7N 1XHXA 1T44A 1LAWA 2QXLA 1T03A 1IBLK 3NF6A 3KLFA 3PLAA 1BUPA 3IRXA 3OW2M 4ID1A 1KXPA 1WNSA 5JS2A 1EQYA 2JWLA 1RBRA 2YNHA 3HVTA 4C1NI 3CM5A 3QBXA 3LP0A 4WF9L 4KTQA 4YOYA 2HNZA 4F3TA 4KH6A 2ATQA 1NGHA 2G8FA 3AVLA 4BREA 3ZX3A 4RWTA 1HKBA 3C7NB 3ULEB 4BE0A 1ZBIA 4LH5A 3OYMA 1TGOA 4JD2B 3NGIA 3R6MA 4M3RA 2W42A 4ISFA 4CEDA 1K73O 4A2AA 2RHKA 3BF3A 3HT3A 3CXCM 2RE2A 3TR8A 4U7BA 1JCEA 4LF8K 5I9EB 4WE1A 5AQOA 3GBTA 1OH5A 4KTWA 4FW1A 2NZTA 3V1RA 5FPDA 3ZCMA 3O9RA 3LPTA 3S3NA 4KHQA 1QQMA 3WT0A 4Z4FA 3TWHA 4DV1K 1U47A 1N6QA 3HSTB 4CGIA 4YORA 2YI1A 3WQTA 2IVNA 1IV0A 3RMAA 5KGWA 4IEEA 4DUYK 3V9XA 3SV4A 4I6MB 4H0XB 4CI6A 2NNWA 4GNIA 1EXQA 1S9EA 4CW7B 4E1MA 2BGGA 4M7YA 3ZSWA 3VTHA 4CK2A 1TKXA 3F73A 4FLVA 4YNQA 3QEVA 3SYZA 4FJMA 2RKIA 4DTRA 3ID6A 4RW7A 3BEXA 4AHVA 3BY5A 4DTSA 1RDBA 3GL1A 5GAEP 3K58A 4YOXA 4FWRA 5M1NA 5CZ2A 1RTDA 4GY2B 1TAUA 3VERA 4H03B 1D9DA 4FJ7A 4BY9C 1YUWA 1S1XA 2OPPA 1E4GT 4J2BA 5F1XA 4CFBA 1JCFA 4O8UA 4NXNK 3K57A 1WLJA 4KI4A 2A1SA 5AQTA 3VQQA 2HB5A 1KRPA 2GUIA 1C1BA 4BE1A 2ZD1A 4FK0A 3KLGA 3CCQN 1VSHA 4C8NA 4CEAA 3ENOA 3ISNC 3H3NO 1WSJA 1QZ6A 3AVBA 3CC2N 5BREA 2IGIA 1Y97A 5ADXH 1Z6RA 1BA0A 2FBTA 2PBDA 4FL9A 4X65K 4H4MA 2J4RA 4JK9A 3AV9A 4IG3A 3O6WA 5C24A 4DTJA 2PZSA 3V6DA 2PY5A 3PX6A 4H0VB 5CHIA 4CHYA 2HNDA 5BRFA 1S5JA 1WAJA 5KPZA 2HF4A 3ZEUB 5HRSA 3HOTA 1DT9A 4BRQA 2QWQA 3I8BA 1YJNN 5AQKA 3ZETA 4CGFA 3SAHA 1WSHA 1B92A 2ZF5O 4J2AA 2HHQA 1ZBSA 1XNRK 1SL2A 3TPQA 2HMIA 4GKJK 5J2PA 2HHSA 3K5LA 4IJAA 1N33K 4QAGA 3O4QA 1X9MA 2G8UA 1J6ZA 4DF4A 2X78A 4H0OA 2QK9A 4BRMA 3QNOA 3QIOA 4XH1A 2F4VK 3QFPA 5CYQA 4O44A 5JVHL 4CGJA 3KK1A 4KV8A 4I7FA 3OYLA 1NGJA 3U9DA 5KPRA 1QQCA 2IDOA 4PL8A 1VSIA 3J80O 2VG5A 1T05A 4E7KA 4FOIA 4ELVA 1D9FA 4GV9A 2NRZA 3DYAA 3V1QA 1KFDA 4WQ5C 4B1UB 3G10A 3VQDA 2HHTA 4CJSA 2GWJA 4LF9K 4DR6K 4Z0UA 1I94K 3IAYA 1CZAN 1YAGA 3AVFA 2DFFA 3WXJA 2DFEA 2P9LB 5HOOA 1YXQA 1ZXOA 3DOKA 4GVEA 4B3MK 3K5MA 4FWSA 4FW2A 5M1KA 3DRSA 1NGEA 1NG9A 3CYMA 3U8XA 3ULDA 3ZETB 4RW8A 4E7JA 3CJAA 1WAFA 5LJWA 3KJVA 2GEMA 3MEGA 4MDBA 3KWIA 5FPNA 1IG9A 2F7TA 4U67L 3L2UA 1NGBA 5AFUH 5FDLA 3GOIA 1RILA 4WQ4C 2WTUA 5KRTA 2YJFA 3MDQA 4B9NA 3R9PA 4CHQA 3G71N 1TYQA 1SV5A 1RT4A 1RBSA 3HI0A 4DV6K 3C6TA 4FLTA 4ID5A 1S22A 4BQZA 2ASPA 2WOMA 4KHWA 1RCHA 3WNHA 4H5RA 4AHRA 4AM6A 2FBVA 4W5NA 3VQCA 4CJRA 2DPNA 4OKEA 1SKSA 1UOCA 4FPAA 4B1YB 1BDGA 3E66A 4NYFA 4DSIA 4N47A 4DSJA 4CZEA 1SKRA 5DM7L 4QOZB 4JKGA 3ZSYA 4ILJA 5E26A 5DM6L 1ZBLA 1P8ZA 1FK9A 1RBUA 1D4XA 4Z4GA 3VQ4A 3ZSXA 2OZMA 2HHWA 5CR4A 4LH4A 3A5MC 1L5UA 1TK8A 4M3ZA 3LM9A 1XWLA 3VQ8A 2HVIA 4AHTA 1NK4A 4IEIA 4LSNA 3SQ0A 1IBKK 5EXWA 4CZMA 3RRGA 2O8FA 4BRPA 1YJWN 1S1TA 4DR4K 2P9KB 3ZSOA 2BDPA 1RT5A 2IVPA 1HQEA 1DTTA 4CHNA 4M42A 4GMJB 1UWBA 4C8OA 1U48A 4FJ5A 1TV6A 1A5WA 3EKSA 3CJCA 2A6AA 1VHXA 4YDUA 2ZJRL 4LFAK 4K43A 1TYQB 3OYGA 2V7ZA 5J2MA 3IMXA 4EIAA 4C1NK 4M45A 3OYCA 3ATUA 4B1ZA 3KD5E 5LMUK 2F9TA 1GLJO 4B9VA 1U04A 3CFPA 3NBPA 5HBMA 3SMSA 2Y1IA 2CGJA 5BPMA 4M63C 3NMUA 3H45C 2P9IB 1ASWA 5M1PA 4DFMA 1T8EA 2PYJA 3NVMA 1I3AA 3CM6A 3M8RA 4HUFA 3C6AA 3L2QA 1DKGD 3HPGA 3E9OA 3AAQA 1NMNA 4JKGB 5AQSA 3EYZA 4IOCL 3M6GA 4XH4A 2KKZA 1RT7A 3GE1A 1JXEA 3KHYA 2HBLA 2Q2RA 4FWMA 4EFHA 2X6NA 4Z4HA 4A2BA 3VGKA 3OS0A 3OYJA 4FLYA 3LDNA 1Y64A 4K8ZA 4KHUA 4PHTX 2O8FB 3P4IA 4M7XA 1R59O 1VQ6N 2Q0RA 3FZHA 3QIPA 1X9WA 4DQQA 1YI2N 3CC4N 2G8WA 3O1WA 3TAFA 3KLHA 4EZ6A 4CJ3A 3RMDA 2R7YA 4DTUA 3AAPA 3HZ6A 3T1AA 4CERA 3LP3A 3CCMN 3BF1A 1BQNA 4BDZA 2D4WA 4B1VA 1HNWK 3R1XA 3TSPA 4F2SA 3O9TA 4KBOA 2NRRA 1YT3A 1Z25A 2UXBK 1VSLA 4BGBA 2YNGA 1UA1A 4HUGA 2IS3A 1NM1A 3CJBA 4JRPA 4MO4A 3FZLA 3NGYA 4JN4A 5FRNA 5AQXA 4JHDA 3ZT0A 3AVIA 2O4GA 1IO2A 2P9SB 2VQFK 5FRMA 2I7PA 4A5AA 4DTOA 4KRFA 1ILYA 2W6LA 5GAGP 2Q97A 4HUEA 4HWIA 2ITGA 1BI4B 4BDYA 4BC3A 1JL2A 5AR0A 4WFBL 1LCUA 4OGEA 4KH5A 3J81O 3LZJA 4AF1A 3ENBA 3ITHA 2XRIA 3QDKA 4RTFD 5C42A 3AVNA 3SBGA 3KK2A 2QKBA 3NH2A 4AHUA 2HBJA 3LDPA 1RTJA 1VQPN 4AHCA 2YV0X 2B4JA 5J2QA 1TKTA 4CZJA 3EE8A 4E7LA 1DLOA 4JAXA 3VEZA 2FF6A 3WXMB 3G0ZA 2H3GX 3V9WA 3JXUA 4E7HA 1KAXA 3NFAA 4DTPA 4C8MA 2PYLA 2V7YA 4Y1DA 4R79A 3LDSA 3DMJA 4OKKA 4KHPK 2HW3A 2FXUA 5AFUA 4JKCA 1VRUA 3ZT2A 2CH6A 2KHOA 4A57A 4JI8K 4FK4A 3CF5L 2X74A 3WNEA 3KLEA 2PAVA 2QW9A 3QLHA 4JHDB 2D0BA 5JICA 2E6MA 4B3RK 1GOBA 3IDHA 4B1XB 3SUNA 1HUXA 3SCXA 3KD1E 3AVMA 2NRVA 3OYEA 4AM7A 4FVUA 3VQBA 1NKEA 3O3HA 3L6QA 1JKHA 3H08A 1HPMA 3KKRA 5M1FA 1NK8A 1HLUA 4IFEA 5JMVA 3CQYA 4BRNA 2JWKA 3SUQA 2GX9A 4H0TB 4DSFA 3FGUA 3F2KA 2V51B 2YHAA 2IAJA 1RTIA 2GELA 3HBTA 2O8DA 5HL7L 5AQMA 1CZ9A 2FBXA 3HPOA 4EHTA 4CGHA 5DK5A 1NLVA 3MEEA 2UUCK 4G1QA 1Q81O 5JS1A 4DFPA 3KZBA 3B6OA 5CY4A 1WSEA 1BG3A 1G15A 3QEIA 5A2QO 2VYPA 2KFZA 3OBYA 2VWJA 4KREA 4E7IA 2XHBA 4WFNL 1CZBA 3D2EA 3ZYYX 3QNNA 4H8KA 3DLGA 3TAPA 1HR0K 1V4SA 3VQ9A 3SQ2A 5AQJA 3VENA 5AQFA 4JS4A 4FM1A 1Q86O 4FM0A 3O8MA 3UB5A 4DQSA 1Z26A 3O3FA 2AA4A 1C1AA 1EKEA 2W41A 2FSJA 4B9LA 2UUBK 3WQUA 4J8FA 3B8AX 2KLAA 1T6CA 4YHHK 1RBTA 2EX3A 1LOTB 1A5XA 2KZMA 1KLNA 1T6DA 3ZT3A 3SMPA 4HCBA 3K2PA 2RN2A 3NVKA 3A5LC 3P31A 1TVRA 3NAEA 4CZLA 3BZCA 4QS9A 4KO0A 4BRDA 3THYA 3L4QA 4DV2K 2ASOA 2O8DB 1NGGA 3HP6A 1HNZK 1NU0A 1BHLA 2E8AA 4YOWA 1LV5A 1HNXK 1KFSA 5K14A 3O80A 1YTAA 4CGGA 1B9FA 3C65A 1N36K 1SL1A 1VSDA 2D0OA 2QWMA 2ZM6K 3QFUA 1B9DA 4B9QA 1Q82O 4LY7A 4R5PA 1RDCA 1KD1O 3LL3A 3THWA 3ZSVA 3F5TA 1BO5O 4IJNA 3D2EB 1NWKA 2ZJPL 5CYMA 3OYIA 1QQNA 3ZX0A 1IKWA 3CERA 4FJJA 5C25A 4ISEA 3O9SA 1TL3A 5HP1A 3CQXA 2Y1JA 1C0UA 4XH5A 2E1ZA 5AQZA 5JVGL 1SAZA 2HVHA 4F4KA 3VGLA 1ATNA 4CHZA 4I9QA 3VEYA 3S41A 3VN5A 4CD3A 1KC8O 3EZWA 1QHTA 3KKSA 1BCOA 3AVAA 2OPQA 2VG6A 5AZJA 4JK8A 4A62A 4OJRA 4Z4EA 1NGFA 5KPTA 3AVKA 1YVNA 3SQ1A 2KTQA 4KAZA 3CCVN 1NGDA 3MX5A 3I55N 4B8CA 3SI6A 3CD6N 1O1WA 3V9SA 3I0SA 4B3SK 3QETA 4H5NA 2ZGZA 1NK6A 1HNIA 4CIFA 3FZKA 2YHBA 3OYFA 3SBTA 4CK3A 1XC3A 4CF0A 1HKCA 1QSSA 4FLXA 3SUPA 4Q0BA 3HRGA 1RT2A 3AGRA 3P38A 4FWPA 4DLEA 3H1QA 3J8AA 4CZGA 3RR7A 3LP1A 2YHXA 3SPYA 3VF4A 1Q7YO 4EHUA 3OJSA 1MWKA 4DV4K 4FZYA 1GOCA 4CJUA 4AQYK 1MA9B 4CJEA 4KFBA 3MXIA 5KI6A 3RRHA 3NHGA 1XMQK 2XY5A 3VMFB 4E19A 4CEQA 4O0JA 1ZBFA 1TK5A 4JKDA 3FZMA 4ISGA 1LWEA 4KB0A 3K5OA 4BVOA 3QICA 4GVMA 1YITN 5AZJB 3DOLA 1G99A 2A40A 3J7AP 3NF9A 3OJUA 2G8IA 3QINA 1ZBHA 2IVOA 4A5BA 4FJGA 1REVA 3CCEN 1GLAG 4KHYA 3L8BA 2E2NA 3CFRA 1JLBA 3O9UA 4FJIA 1XUPO 2UUAK 3CCLN 4Y1CA 4BRLA 4AILC 4DU4A 2Q1NA 1L3SA 2HSTA 4W5RA 3T7ZA 1GLEG 5C12A 4EP5A 2O8EA 3MXJA 4IDKA 1K8KA 5AQYA 2HHVA 3ZSRA 4LF7K 1JLFA 3CHWA 3EE9A 4WQ5A 3L2RA 3RSEA 4CHOA 3OY9A 4F9OA 4GKKK 1RTHA 1XMOK 4PWDA 2A3ZA 2GV9A 3UIQA 4MQ3A 4FLUA 1X1PA 4NB4A 5KRSA 3O1BA 4DR3K 3A2FA 4K42A 1GLBG 1NJYA 5BN9A 4AHSA 1CXUA 2OYQA 1DGKN 5EOYA 4BRHA 5CZ1A 3DXKA 1VSJA 4FWQA 4DFKA 2Z1GA 4FPBA 3TAEA 2F8SA 1K8AO 4OLBA 4DV3K 4CZFA 1VQ4N 3T1HK 4K8XA 4FVMA 1SKWA 2E2PA 4JKHA 3R3LA 3VGMA 4CJKA 3WNGA 2P9NA 1HMVA 3U4LA 1V4TA 4KHNA 4NLCA 4WQ4A 4OGCA 4DTNA 3ZT4A 1HJOA 4CZIA 5BN8A 1ASVA 2FLOA 4DUZK 3AA2A 4YY3K 1Q8IA 4L3QA 2F96A 1P90A 3ID8A 4JI5K 1JL1A 2VGNA 3AVHA 3IFRA 3LPUA 3WNFA 2O8EB 3D2FA 4I2PA 1YTUA 4M3UA 1K8KB 1CLQA 4UQGA 1WSFA 3MCPA 1U45A 1C6VA 4BROA 3MMVA 5F2RA 4DV7K 4MLHA 2IC3A 3RSEB 2Q31A 1N8RO 5BRHA 5AQPA 1NOYA 2NRWA 5AQGA 4NCAA 3CMEN 3HXMA 2HMPA 3FFKB 3MEDA 4DV5K 1N5YA 4KKOA 1XC9A 4BRFA 4CBWA 3DXKB 5TKYA 4O4GA 4E1JA 4LF6K 3AO1A 3THVA 4YDUC 3S3MA 3L3UA 1QSYA 3MK6A 3SV3A 3TAGA 4DR1K 3V9ZA 3AGKA 4DFJA 3E9PA 1YJ9N 2P9NB 1UAXA 1QQOA 3JS6A 4W5OA 2ASMA 2JLEA 2P1JA 1Q18A 1WN7A 1RT1A 1S72N 2G8VA 3L3VA 4N56A 3KK7A 1HNVA 3LWMA 5HROA 4K0KK 4XIUA 3BGRA 1VQNN 1OVYA 4O8KA 2B6AA 3J7ZO 4MDAA 3VQEA 4ELTA 3V81A 4L8RB 1QVFM 5KQ8A 1LW2A 4CE9A 3OTOK 4BWMA 2Z1HA 2W6KA 2QWLA 5C0YA 2B5JA 4DV0K 2YX6A 2BTFA 5ADXA 5GIPA 5LMNK 2DY4A 1W97L 3HO1A 3MWPA 3QB0A 5I42A 2E5LK 5GIOA 2NRXA 1VQLN 5EVZA 4E3SA 4B3OA 3HL8A 5C2DA 4BRGA 1XQSC 2Z1IA 2QXFA 1VQ8N 3TAMA 1VQKN 1NGAA 3DRPA 1K9MO 4ZTJA 3CPEA 4BG9A 4OPKA 3ALYA 3AO2A 3QO9A 3H46O 4CJFA 2O8CA 1EO1A 4EZ9A 1QZ5A 4BRKA 4O5FA 1RDDA 4LF4K 3QBWA 4FZZA 3A8YA 2HNYA 1X9SA 3H3OB 3ATVA 2CH5A 3CFOA 3VF2A 4DKWA 3RMCA 2ZJQL 3M5RA 1VQ5N 3VQ7A 3H1VX 3QEWA 3HYFA 4JNEA 4JI2K 2A5XA 3U9ZA 4NCGA 2QWPA 1RT6A 3R8EA 1QTMA 1IKYA 1VRTA 5TKWA 3ZT1A 2V52B 1T3VA 4CFCA 4YOUA 4CJTA 3EO3A 4IO8A 3V1OA 2QA4N 1ZC6A 4JKEA 3UKUA 4WCEL 1HRHA 3VQ5A 1ZYQA 4CFAA 4FWOA 2W40A 4JKFA 1JLAA 1NBWA 3UE5A 1KQSM 3NDKA 3C6UA 2P9UA 3P39A 3QEPA 4BVPA 4DQRA 1U4BA 2KQ2A 1WBDA 1OH8A 2A1RA 3OBWA 4BE2A 3M8PA 1VQON 4BRIA 4O55A 4NXMK 1KVAA 3SJHA 2HHXA 2I7NA 4CJ5A 4QCLA 3LWLA 3TABA 5J2NA 4JRQA 3VQAA 4DF8A 2XY7A 4OVLA 1NJIO 1VAZA 1BIZA 1RDWX 4KPYA 4FWLA 4CECA 2WFBA 4CF2A 3RVCA 3TTDA 3MCAB 1DTQA 1HX1A 1RGIA 1ATSA 3NCIA 1VQMN 4C8KA 3LDOA 1RNHA 1WB9A 5FPEA 3PIPL 2KFNA 4MO5A 4BR5A 1FJGK 3S9HA 3QEXA 3U3GA 3PY8A 3VQPA 3S3OA 4Z4CA 1NGCA 4JI4K 1W2BM 2E6LA 4OPJA 1SUQA 1YIJN 1GLDG 3UKUB 2G8KA 2HHHK 2FSKA 2CGKA 2GBZA 4BC2A 3QMLA 1JLGA 4BRCA 1S1WA 3KTQA 1TUUA 1BOTO 3D0PA 3SQ4A 3C7NA 1X3MA 4OX9K 3TU5A 2E1YA 2UYTA 1IJJA 3O3GA 3C0BA 1VSKA 1TKDA 3D6RA 4CGDA 4CF8A 1D5AA 5CE3A 1EP4A 2Z1JA 4LSLA 3P5JA 5J1EA 4DU1A 1XHZA 4CEZA 2HBKA 4IWVA 3KVGA 3NF7A 4CJQA 3LZIA 3CCJN 2WONA 3IG1A 3DI6A 2QKKA 1HPZA 4DR5K 2UU9K 4KI6A 2NRHA 4ILHA 3TAQA 1OH7A 4BWJA 2HOEA 1T7PA 1W7AA 3VEWA 4M41A 4BQLA 5JLFA 4O0IA 3CCRN 5EY4A 5I3UA 1VQ7N 2EHGA 4CIGA 3PUFA 4CJLA 4BR2A 5ELZA 4CCHA 4BG8A 5D3GA 1FKOA 2I5JA 1M90O 3U6FA 1WSGA 4OKJA 3IUCA 4DG1A 3JYTA 4O5BA 4RW4A 5FROA 4DWIA 1BU6O 1D8YA 2E4LA 2YHYA 2X6SA 3T69A 3F9KA 3PIOL 4JKBA 4ZHRA 5BR9A 2YKMA 4X66K 3KK3A 1X3NA 1EX4A 4G9ZA 1LWFA 4HTUA 2HBMA 4JI7K 1SQKA 1ASUA 4BR0A 4OPAA 3EKUA 4C8LA 1C0TA 3KIOA 4I9LA 1JLQA 3DXMA 3I56N 2IIRA 5GINA 4H5WA 1WUAA 4FOEA 2Q3SA 2VCPA 3VQ6A 4CJVA 1X9JA 3HM9A 1NJWA 1L3TA 3CPWM 1Q9YA 3VETA 2QM1A 2OZSA 1LW0A 3SZ2A 4N5SA 3DRRA 4DB3A 1S6PA 4WFAL 4K25A 4HTLA 4YOVA 2OTJN 5BRDA 4ZTFA 1BISA 1C0GA 1JCGA 3DAWA 3LDQA 1S3XA 4LD0A 2YNIA 1KAZA 4RW6A 4X62K 3ZEUA 1N34K 3AARA 3PV8A 2F8TA 5C10A 3NF8A 4CEFA 3WXLA 4FJ8A 4M3XA 4FWNA 1GLFO 3L0QA 5KTQA 3LAKA 4PL7A 1KCFA 4KH4A 3AVJA 4YOTA 3RTVA 4NLBA 1HQUA 2UXDK 1S1VA 5BPLA 4JI0K 1TL1A 4LC9B 4FLWA 1RT3A 3C6HA 3EL2A 3THYB 3LANA 4DR2K 1FXXA 3WXKA 1WBBA 2O8BA 3H6EA 1XNQK 3A5OC 3N4PA 3DXMB 3VTIA 2Q0UA 4FYDA 5BPNA 3DLHA 3GG4A 1W0HA 4IO9L 3TANA 3FLCO 3GDQA 4CVNE 1NJZA 3HPHA 2XY8A 4B9TA 1YF5L 4JEPA 3SLCA 3THWB 3WEEA 1Q9XA 3EN9A 2NUBA 3DLEA 3CJ9A 4FLZA 3VA3A 4FSVA 4CZKA 3IS9A 3G6EN 4CZHA 5E41A 2DTUA 4KHSA 2P9LA 3AVGA 3SNNA 4IFVA 2GTDA 4DHYA 2G8HA 1NNEA 3PSIA 5AQWA 4CESA 4OO1J 4JYAK 1J53A 1KTQA 1SL0A 1TKZA 2D5RA 3SAGA 4GV3A 4LFCK 5EU7A 4I2QA 5FPMA 4PKIA 3VEOA 5MLCQ 3HJFA 4H0PA 1J5OA 1BQMA 2P51A 3MAQA 3I0RA 1S1UA 4C23A 3MN9A 1ITGA 4CF1A 3P1GA 3OYBA 2YCHA 4J2EA 3DJCA 4BACA 3QERA 1M1KO 1I39A 3TTFA 2BH1A 3OS2A 1KLMA 3RR8A 1BCMA 2O8BB 1BIUA 2E88A 4FJNA 3T1YK 4Z4IA 4JK7A 2WBNA 3VOVA 5SZTA 5T7BA 4NCBA 2QWNA 3CJ1A 1IBMK 4YFUA 4CEEA 4IZ9A 5F0XA 1VQ9N 1NK0A 4H5VA 3TARA 2OTLN 4IDHA 3PSFA 2ZQBA 1NK7A 4CJPA 1EWRA 1YHQN 3WEEB 1KSPA 4BR9A 4JLHA 2BE2A 1QSLA 4B9SA 3BUZB 4LF5K 4DTMA 3FFIA 1H1VA 1KVBA 2WUSA 4GV6A 3HSCA 4DQ8A 1VK0A 3O9QA 1RFQA 1C0FA 4W5QA 3FE1A 3MN5A 3KLIA 2GUPA 4E0DA 1YVUA 3O4NA 1OKJA 5AZIA 3T19A 2P9KA 3NGZA 3WUHA 1GOAA 3F9MA 5AJ3K 1QE1A 3CI5A 4PQUA 3O08A 1BGXT 3MECA 3MN6A 4B1WB 1SZ2A 1NKBA 2BANA 1JLCA 1MDUB 3D45A 2QEXN 2A42A 3AO5A 3K9JA 4HVJA 2VWKA 4FCYA 2ZGYA 4X64K 4DQPA 3CJ7A 3VPZA 3OYDA 4CEBA 1N32K 1R0AA 3PO4A 5EX5A 4N41A 3ZSZA 5IT9O 3AO4A 3AVCA 3WXIA 1BA1A 2P9IA 1JJ2M 2Q36A 5B8HA 4IOXA 4NO7A 3SPZA 3AA3A 4IKFA 3TI0A 2P5OA 3I8DA 3BZKA 2YHWA 5GADP 1KVCA 4M3TA 4PKGA 2OCEA 3PX0A 1QHAA 4XEIA 1CXQA 2CGLA 3ENHA 4Y0WA 4M3YA 3QESA 1LWCA 2JGUA 4CBUA 1L3VA 3V4IA 2O4IA 3FR0A 4FJHA 1NMDA 3J7YP 4IOAL 1A5VA 3HTVA 3EY1A 1FKPA 4IXCA 4HCCA 2QWOA 3W0LA 1OVQA 4DTXA 4BDPA 4ILGB 4BR4A 3C94A 1U2VA 4V19S 3OYHA 3L2WA 5GAHP 5AZIB 4M3WA 4IG0A 3I33A 1C1CA 3TSQA 3DLRA 1IG8A 2RPIA 3A5NC 5BR8K 5HRPA 4B3TK 1GLCG 2F9WA 4FJXA 1NK9A 2FBYA 2D0CA 4AH9A 3LDLA 2ETJA 3JAMO 1NGIA 1HYZA 2FC0A 1Z05A 4DQIA 1O13A 3HP9A 4JI3K 5AQIA 4BRAA 3ZSQA 4CIEA 3OHRA 1OH6A 3PO5A 1WSIA 3HOSA 2YKNA 1IH7A 3CIPA 4DLGA 2VG7A 2RF2A 4RG8A 1QS4A 5KGXA 1ATRA 3D2FB 1EWQA 3L2VA 5AQQA 4HHTA 1FW6A 3UKRA 4DS4A 3VEVA 1BL3A 2E2QA 3AY9A 3THXA 1F21A 1WOQA 3M1FA 3BP8A 1RBVA 3E01A 3NH0A 3CQ8A 2P9SA 2FSNA 2XY6A 3DM2A 4JV5K 1J54A 1L3UA 4Z94A 5JLHA 3E1YA 3IKMA 4IBNA 1BI4A 3U3YA 2PFUA 4QS7A 1S6QA 3RMBA 4BR7A 3P83D 4DCHA 3MX2A 5AQVA 1TK0A 3G4SN 3VA0A 1K6YA 3G25A 4W5TA 2UXCK 4PKHA 2D1KA 4RCHA 1U2VB 3HK2A 2HF3A 2OANA 3A0IX 3M8SA 4CBXA 2FF3B 3O4WA 4JKAA 5HRRA 4DSKA 4DS5A 5AQUA 1J9AA 1LAVA 2YJEA 3AA4A 3K5NA 1KAYA 4DSLA 3NH1A 3OA9A 3PX4A 2E2OA 4CK1A 3DWLA 3RWUA 1RDAA 2D0AA 3OS1A 1NK5A 1HYVA 5FLXO 4H5TA 2HHUA 3SJJA 4OPHA 4JI1K 2BUPA 4BC4A 3K59A 4NYNA 1U49A 3Q7CA 2D0PA 2P9PA 3MWTA 3HM8A 3VESA 1UA0A 2EWSA 5LY3A 3M3ZA 3HVRA 1C0MA 1VSFA 5M1QA 2XO7A 2KZZA 4N76A 2WC9A 2YNFA 3UKRB 3CETA 5HLFA 4A61A 4KTZA 3LALA 1HJRA 4CJ4A 3THXB 4E1NA 4FZXC 3SAFA 2QWRA 4B8AB 4EP4A 3OYAA 5C15A 5AQRA 2A41A 3L4IA 2NRTA 1MWMA 1JLEA 2OPRA 1XI1A 2VGMA 3DLLL 1TUYA 5C2FA 3OYNA 3OVNA 3ZLJA 1S9GA 3Q7BA 1SS6A 4J2DA 5DMRA 3M8QA 3VEXA 5KQDA 4LFBK 4B9MA 4CJWA 1NKCA 2O8CB 4CJ7A 3CCUN 5E84A 3N4QA 2ZWHA 4CEOA 3SUOA 1JXBA 4ICLA 4B9UA 4FK2A 3AO3A 4GW6A 3V9UA 3AA5X 3K9KA 2QI2A 3CG7A 1HYSA 2QTDA 3OYKA 2P5GA 4RW9A 1J5EK 1E3MA 4B08A 5IWAK 3SK3A 5LL6Z 1W9HA 4MFBA 2OA8A 4DMNA 4TSXA 3EEQA 4DU3A 4Q5VA 3CCSN 3MXMA 4WYBA 3EZ5A 1DEJA 4OLAA 3BDPA 1TAQA 2P9PB 2OPSA 4BGAA 4PA1A 3ZX2A 4A59A 3TSUA 4FJ9A 4FM2A 1QVGM 3FZFA 4MLEA 5AQHA 4CD1A 1U6ZA 2E20A 1GLLO 4H0YB 4FWKA 4DR7K 5H1SQ 2NLXA 1IKVA 4F8RA 3LM2A 2AP1A 3NE6A 3DLBA 3JSMA 3DLKA 4H4OA 5SWMA 3T3FA 2AJQA 2P9UB 3ULEA 3KWGA 3W3DA 3K0SA 4PY5A 3LAMA 4FJLA 4CFDA 4JD2A 1NOZA 4FO0A 4CF9A 4BC5A 4KB1A 3MN7A 4PUOA 1RDUA 3VF6A 4DSEA 4EAHD 5HRNA 4ELUA 2IOCA 3B6PA 5M1OA 4CHPA
chains in the Genus database with same CATH topology
1EETA 1MU2A 4IFYA 3LANA 4F3OA 4CJKA 2G8WA 3LP2A 1FXXA 3KLHA 3WNGA 3TAFA 4EZ6A 4CJ3A 2DFHA 1ZBUA 4E89A 3RMDA 3C95A 1HMVA 1VSEA 2R7YA 4DTUA 4KHNA 4OGCA 3T1AA 4CERA 4DTNA 3ZT4A 4FYDA 3LP3A 3DLHA 1BQNA 2LSNA 1NJXA 1IKXA 1ASVA 1W0HA 4BDZA 3TANA 3AA2A 4FJKA 4F2SA 1Q8IA 4JS5A 3ASMA 1VSMA 2F96A 1NJZA 2KW4A 4FXDA 1YT3A 1JL1A 1Z25A 3HPHA 4F2RA 2XY8A 2ZE2A 4B9TA 1XHXA 1VSLA 1LAWA 1T03A 3NF6A 3KLFA 2YNGA 1UA1A 2NUBA 2IS3A 3DLEA 3AVHA 4HUGA 1Q9XA 3WNFA 3LPUA 4FLZA 3VA3A 3IRXA 4JRPA 4I2PA 1YTUA 3IS9A 4M3UA 3NGYA 4ID1A 5FRNA 1CLQA 1WNSA 1WSFA 4UQGA 1U45A 1C6VA 3ZT0A 5E41A 5JS2A 2DTUA 3AVIA 2O4GA 4KHSA 3AVGA 3SNNA 1IO2A 2IC3A 4IFVA 5FRMA 4KRFA 1RBRA 4DTOA 2YNHA 3HVTA 4HUEA 2G8HA 1NOYA 2ITGA 4CESA 1BI4B 3CM5A 4BDYA 1JL2A 1J53A 3LP0A 4KTQA 1KTQA 1SL0A 2HNZA 1TKZA 2D5RA 4NCAA 4F3TA 4OGEA 3HXMA 2ATQA 2G8FA 3AVLA 3MEDA 4I2QA 5EU7A 3LZJA 3HJFA 1N5YA 4KKOA 1XC9A 1J5OA 1BQMA 3ITHA 2P51A 2XRIA 5C42A 4BE0A 3AVNA 3MAQA 3I0RA 1S1UA 1ZBIA 4LH5A 3OYMA 3KK2A 2QKBA 3NH2A 1TGOA 4O4GA 3NGIA 4AHUA 4M3RA 1ITGA 3AO1A 4CF1A 4CEDA 3P1GA 2W42A 3THVA 1RTJA 3S3MA 3L3UA 3OYBA 1QSYA 3SV3A 4AHCA 2YV0X 3HT3A 4J2EA 4BACA 2B4JA 3TR8A 5J2QA 1I39A 1TKTA 3QERA 3TAGA 4WE1A 4E7LA 1DLOA 3OS2A 1KLMA 3V9ZA 4KTWA 4DFJA 3RR8A 1BCMA 4FW1A 3V1RA 1UAXA 1BIUA 3G0ZA 3ZCMA 3V9WA 3LPTA 4E7HA 3S3NA 4FJNA 3NFAA 4KHQA 4Z4IA 5SZTA 5T7BA 4Z4FA 4DTPA 4C8MA 4W5OA 3TWHA 4NCBA 1U47A 2JLEA 2PYLA 2P1JA 1N6QA 3HSTB 4CGIA 4Y1DA 1WN7A 4YFUA 1RT1A 2G8VA 4CEEA 3L3VA 4N56A 3LWMA 1HNVA 5HROA 3RMAA 1NK0A 5KGWA 3V9XA 4XIUA 3LDSA 3BGRA 3DMJA 3SV4A 4OKKA 3TARA 2HW3A 2ZQBA 1NK7A 1EXQA 1S9EA 2B6AA 4CJPA 4E1MA 2BGGA 3ZSWA 1VRUA 4CK2A 3VQEA 3ZT2A 1TKXA 1KSPA 3V81A 4ELTA 3F73A 4L8RB 4FK4A 4FLVA 4JLHA 4YNQA 2X74A 2BE2A 1LW2A 1QSLA 3WNEA 4CE9A 4B9SA 3QEVA 3SYZA 4FJMA 2RKIA 4DTRA 3KLEA 3QLHA 4DTMA 4BWMA 2Z1HA 2D0BA 3FFIA 2E6MA 1KVBA 1GOBA 4RW7A 4DTSA 4AHVA 3SUNA 1RDBA 2B5JA 3K58A 3SCXA 1VK0A 2DY4A 3KD1E 3HO1A 3AVMA 5CZ2A 3OYEA 1RTDA 4W5QA 1TAUA 5I42A 3VQBA 1NKEA 3O3HA 1D9DA 3KLIA 1JKHA 3H08A 4FJ7A 4E3SA 4E0DA 1YVUA 3HL8A 3KKRA 3O4NA 4B3OA 1NK8A 1S1XA 3T19A 2OPPA 4J2BA 2Z1IA 4CFBA 3NGZA 2QXFA 3TAMA 1GOAA 3SUQA 3DRPA 3K57A 1WLJA 1QE1A 4DSFA 4ZTJA 4KI4A 4PQUA 2A1SA 3VQQA 4OPKA 1BGXT 3MECA 3ALYA 2YHAA 2IAJA 1RTIA 3AO2A 3QO9A 4CJFA 1NKBA 2HB5A 2BANA 1JLCA 2GUIA 3D45A 1KRPA 4EZ9A 1C1BA 4BE1A 1CZ9A 2FBXA 1RDDA 2ZD1A 3KLGA 3HPOA 3AO5A 4FK0A 1VSHA 4C8NA 4CGHA 4CEAA 5DK5A 4HVJA 4FZZA 2VWKA 2HNYA 3MEEA 4FCYA 3ISNC 1X9SA 4G1QA 3CFOA 4DQPA 1WSJA 3RMCA 3OYDA 3VQ7A 4CEBA 3QEWA 3AVBA 5JS1A 3HYFA 1R0AA 3PO4A 4N41A 2IGIA 4DFPA 1Y97A 3ZSZA 2FBTA 3B6OA 3AO4A 5CY4A 1WSEA 1G15A 4NCGA 3QEIA 3AVCA 4H4MA 1RT6A 3AV9A 4IG3A 1QTMA 5C24A 2VWJA 1IKYA 4E7IA 1VRTA 4DTJA 2PZSA 2XHBA 4KREA 3ZT1A 1CZBA 3V6DA 3SPZA 2PY5A 3PX6A 4CFCA 3QNNA 4CHYA 4H8KA 3DLGA 3TAPA 3AA3A 4IKFA 2HNDA 3TI0A 2P5OA 3VQ9A 3I8DA 4CJTA 3SQ2A 1KVCA 1S5JA 4JS4A 4FM1A 1WAJA 4M3TA 4FM0A 5HRSA 3V1OA 3PX0A 1CXQA 4DQSA 1Z26A 4M3YA 4CGFA 1HRHA 3QESA 1LWCA 2JGUA 3VQ5A 1L3VA 3V4IA 1ZYQA 1WSHA 1B92A 4CFAA 3O3FA 4J2AA 2O4IA 2HHQA 1JLAA 4FJHA 1C1AA 1EKEA 1SL2A 3NDKA 1A5VA 4B9LA 3EY1A 2HMIA 5J2PA 1FKPA 4HCCA 3C6UA 2HHSA 4DTXA 4BDPA 1RBTA 3K5LA 3QEPA 2EX3A 4DQRA 3C94A 4QAGA 3O4QA 1X9MA 3OYHA 3L2WA 2KQ2A 4DF4A 1U4BA 2G8UA 1A5XA 2X78A 4M3WA 2A1RA 1KLNA 2KZMA 4IG0A 2QK9A 3ZT3A 3QNOA 1C1CA 3QIOA 4BE2A 4HCBA 3K2PA 3DLRA 2RN2A 3M8PA 2RPIA 5CYQA 4O44A 1TVRA 4O55A 5HRPA 3NAEA 4CGJA 3KK1A 4KV8A 1KVAA 4I7FA 4KO0A 4FJXA 2HHXA 4CJ5A 3OYLA 1NK9A 2FBYA 2D0CA 3LWLA 4QCLA 4AH9A 3TABA 5J2NA 2ETJA 1QQCA 2IDOA 4JRQA 1VSIA 3HP6A 2VG5A 1HYZA 2FC0A 3VQAA 4DF8A 1T05A 2XY7A 4E7KA 4DQIA 3HP9A 1BHLA 1LV5A 1KFSA 4OVLA 5K14A 4ELVA 1D9FA 1YTAA 3DYAA 1KFDA 3V1QA 4CGGA 1B9FA 1BIZA 4KPYA 3ZSQA 4CIEA 1SL1A 1VSDA 3G10A 3VQDA 4CECA 1WSIA 3PO5A 2HHTA 2YKNA 1IH7A 4CJSA 4CF2A 4DLGA 2VG7A 1DTQA 2RF2A 4RG8A 1B9DA 1QS4A 5KGXA 3NCIA 4LY7A 4R5PA 4C8KA 1RDCA 1RNHA 4Z0UA 3ZSVA 3L2VA 3IAYA 2KFNA 4HHTA 3AVFA 3S9HA 2DFFA 4DS4A 3QEXA 2DFEA 1BL3A 3U3GA 3PY8A 3VQPA 3DOKA 5CYMA 3OYIA 3S3OA 4Z4CA 1IKWA 1F21A 3K5MA 4FW2A 3DRSA 4FJJA 5C25A 1RBVA 3E01A 3NH0A 3CQ8A 2E6LA 3CYMA 1TL3A 4OPJA 5HP1A 2Y1JA 3ULDA 1C0UA 2XY6A 1SUQA 3DM2A 4RW8A 2G8KA 4E7JA 1J54A 1L3UA 1WAFA 4IBNA 1BI4A 2GBZA 2HVHA 3U3YA 3KJVA 1S6QA 4F4KA 3RMBA 4CHZA 3MEGA 3P83D 4I9QA 1JLGA 1IG9A 1TK0A 1S1WA 3VN5A 3KTQA 3VA0A 1K6YA 1QHTA 3L2UA 3D0PA 3KKSA 3SQ4A 1BCOA 3AVAA 2OPQA 4W5TA 2VG6A 5FDLA 1RILA 4OJRA 3HK2A 4Z4EA 5KRTA 3AVKA 3O3GA 4B9NA 3M8SA 1VSKA 4CHQA 3SQ1A 2KTQA 1TKDA 4KAZA 5HRRA 4DSKA 4DS5A 1SV5A 1J9AA 1LAVA 1RT4A 4CF8A 1RBSA 4CGDA 4DSLA 3AA4A 3K5NA 1D5AA 3NH1A 3C6TA 4B8CA 4ID5A 4FLTA 3PX4A 3SI6A 1O1WA 3V9SA 4CK1A 1EP4A 3I0SA 3RWUA 3QETA 1RDAA 2WOMA 2Z1JA 1RCHA 2D0AA 4KHWA 3WNHA 4LSLA 4AHRA 1NK6A 1HNIA 3P5JA 3OS1A 2FBVA 4CIFA 1NK5A 4W5NA 5J1EA 1HYVA 3VQCA 2YHBA 4CJRA 4DU1A 3OYFA 2HHUA 1XHZA 4CK3A 4CEZA 4OKEA 1SKSA 4CF0A 3SJJA 1QSSA 4FLXA 1UOCA 3SUPA 4Q0BA 3NF7A 4CJQA 4NYNA 3K59A 3LZIA 1U49A 2WONA 1RT2A 3DI6A 3IG1A 1HPZA 4NYFA 4DLEA 2QKKA 4KI6A 3TAQA 4DSIA 4N47A 4DSJA 1UA0A 4BWJA 1SKRA 4QOZB 3RR7A 1T7PA 3LP1A 3HVRA 1C0MA 1VSFA 4M41A 3ZSYA 2XO7A 4O0IA 2KZZA 1ZBLA 2KFZA 3SPYA 5I3UA 4N76A 3OJSA 2EHGA 1FK9A 1RBUA 2YNFA 4CIGA 4Z4GA 3VQ4A 3ZSXA 1GOCA 3PUFA 3LALA 1HJRA 4KTZA 4CJLA 4CJ4A 5HLFA 2OZMA 4E1NA 2HHWA 4FZXC 4LH4A 4CJUA 4CCHA 1L5UA 1TK8A 4M3ZA 1FKOA 2I5JA 4CJEA 1XWLA 3VQ8A 5D3GA 3U6FA 4KFBA 2HVIA 1WSGA 4OKJA 4B8AB 3MXIA 4DG1A 5KI6A 4AHTA 3JYTA 1NK4A 3RRHA 4O5BA 4EP4A 4RW4A 4LSNA 5FROA 3OYAA 3NHGA 2XY5A 3SQ0A 4DWIA 4E19A 4CEQA 3RRGA 4O0JA 1D8YA 1S1TA 2E4LA 2OPRA 1JLEA 1XI1A 2X6SA 1ZBFA 1TK5A 3F9KA 3ZSOA 2BDPA 1RT5A 1HQEA 4ZHRA 3OVNA 1DTTA 1S9GA 2YKMA 4CHNA 3OYNA 1LWEA 3KK3A 4GMJB 5DMRA 4KB0A 4J2DA 4M42A 1UWBA 1EX4A 3K5OA 3M8QA 4C8OA 1U48A 1LWFA 4GVMA 4HTUA 4B9MA 4CJWA 1NKCA 3DOLA 4FJ5A 1TV6A 1A5WA 3NF9A 4FK2A 4CEOA 3SUOA 1ASUA 1JXBA 4ICLA 3OJUA 4B9UA 4FZYA 3AO3A 2G8IA 4GW6A 3V9UA 3QINA 4C8LA 1C0TA 3KIOA 4I9LA 1ZBHA 3AA5X 3OYGA 1JLQA 4FJGA 3CG7A 1REVA 1HYSA 4KHYA 3L8BA 3CFRA 5J2MA 2Q3SA 3OYKA 4M45A 1JLBA 3VQ6A 4CJVA 3OYCA 4RW9A 3HM9A 1NJWA 4B08A 1L3TA 2P5GA 3KD5E 4B9VA 4FJIA 1Q9YA 1U04A 3CFPA 1W9HA 3NBPA 4MFBA 4Y1CA 5HBMA 2Y1IA 2OA8A 2OZSA 4AILC 4DU4A 4DMNA 1L3SA 1ASWA 4TSXA 4DU3A 4DFMA 1LW0A 4W5RA 4Q5VA 1T8EA 3SZ2A 4N5SA 3DRRA 3MXMA 3EZ5A 4EP5A 2PYJA 4OLAA 3MXJA 3BDPA 1I3AA 1S6PA 3CM6A 4IDKA 1TAQA 2OPSA 3M8RA 4HUFA 3ZSRA 4PA1A 2HHVA 1JLFA 3L2QA 3HPGA 3L2RA 4FJ9A 4ZTFA 4FM2A 1BISA 3EYZA 4CHOA 3OY9A 4LD0A 1RTHA 2YNIA 4PWDA 1RT7A 4RW6A 1JXEA 2GV9A 3UIQA 4MQ3A 3PV8A 1IKVA 4FLUA 4F8RA 2F8TA 1X1PA 3NF8A 3NE6A 3DLBA 4CEFA 5KRSA 3JSMA 3DLKA 3A2FA 4H4OA 5SWMA 1NJYA 2X6NA 4Z4HA 3T3FA 4FJ8A 4M3XA 3OS0A 2AJQA 5KTQA 4AHSA 3LAKA 1KCFA 1CXUA 3OYJA 4FLYA 3AVJA 2OYQA 4KHUA 3RTVA 4K8ZA 4PY5A 5CZ1A 1HQUA 1VSJA 3LAMA 4FJLA 4DFKA 4CFDA 1NOZA 2Z1GA 1S1VA 3TAEA 4CF9A 2F8SA 4OLBA 4KB1A 4PUOA 1TL1A 4DSEA 3QIPA 4FLWA 5HRNA 1X9WA 4DQQA 4ELUA 2IOCA 1RT3A 3B6PA 4K8XA 4FVMA 4CHPA 1SKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EET A;  1MU2 A;  4IFY A;  3LAN A;  4F3O A;  4CJK A;  2G8W A;  3LP2 A;  1FXX A;  3KLH A;  3WNG A;  3TAF A;  4EZ6 A;  4CJ3 A;  2DFH A;  1ZBU A;  4E89 A;  3RMD A;  3C95 A;  1HMV A;  1VSE A;  2R7Y A;  4DTU A;  4KHN A;  4OGC A;  3T1A A;  4CER A;  4DTN A;  3ZT4 A;  4FYD A;  3LP3 A;  3DLH A;  1BQN A;  2LSN A;  1NJX A;  1IKX A;  1ASV A;  1W0H A;  4BDZ A;  3TAN A;  3AA2 A;  4FJK A;  4F2S A;  1Q8I A;  4JS5 A;  3ASM A;  1VSM A;  2F96 A;  1NJZ A;  2KW4 A;  4FXD A;  1YT3 A;  1JL1 A;  1Z25 A;  3HPH A;  4F2R A;  2XY8 A;  2ZE2 A;  4B9T A;  1XHX A;  1VSL A;  1LAW A;  1T03 A;  3NF6 A;  3KLF A;  2YNG A;  1UA1 A;  2NUB A;  2IS3 A;  3DLE A;  3AVH A;  4HUG A;  1Q9X A;  3WNF A;  3LPU A;  4FLZ A;  3VA3 A;  3IRX A;  4JRP A;  4I2P A;  1YTU A;  3IS9 A;  4M3U A;  3NGY A;  4ID1 A;  5FRN A;  1CLQ A;  1WNS A;  1WSF A;  4UQG A;  1U45 A;  1C6V A;  3ZT0 A;  5E41 A;  5JS2 A;  2DTU A;  3AVI A;  2O4G A;  4KHS A;  3AVG A;  3SNN A;  1IO2 A;  2IC3 A;  4IFV A;  5FRM A;  4KRF A;  1RBR A;  4DTO A;  2YNH A;  3HVT A;  4HUE A;  2G8H A;  1NOY A;  2ITG A;  4CES A;  1BI4 B;  3CM5 A;  4BDY A;  1JL2 A;  1J53 A;  3LP0 A;  4KTQ A;  1KTQ A;  1SL0 A;  2HNZ A;  1TKZ A;  2D5R A;  4NCA A;  4F3T A;  4OGE A;  3HXM A;  2ATQ A;  2G8F A;  3AVL A;  3MED A;  4I2Q A;  5EU7 A;  3LZJ A;  3HJF A;  1N5Y A;  4KKO A;  1XC9 A;  1J5O A;  1BQM A;  3ITH A;  2P51 A;  2XRI A;  5C42 A;  4BE0 A;  3AVN A;  3MAQ A;  3I0R A;  1S1U A;  1ZBI A;  4LH5 A;  3OYM A;  3KK2 A;  2QKB A;  3NH2 A;  1TGO A;  4O4G A;  3NGI A;  4AHU A;  4M3R A;  1ITG A;  3AO1 A;  4CF1 A;  4CED A;  3P1G A;  2W42 A;  3THV A;  1RTJ A;  3S3M A;  3L3U A;  3OYB A;  1QSY A;  3SV3 A;  4AHC A;  2YV0 X;  3HT3 A;  4J2E A;  4BAC A;  2B4J A;  3TR8 A;  5J2Q A;  1I39 A;  1TKT A;  3QER A;  3TAG A;  4WE1 A;  4E7L A;  1DLO A;  3OS2 A;  1KLM A;  3V9Z A;  4KTW A;  4DFJ A;  3RR8 A;  1BCM A;  4FW1 A;  3V1R A;  1UAX A;  1BIU A;  3G0Z A;  3ZCM A;  3V9W A;  3LPT A;  4E7H A;  3S3N A;  4FJN A;  3NFA A;  4KHQ A;  4Z4I A;  5SZT A;  5T7B A;  4Z4F A;  4DTP A;  4C8M A;  4W5O A;  3TWH A;  4NCB A;  1U47 A;  2JLE A;  2PYL A;  2P1J A;  1N6Q A;  3HST B;  4CGI A;  4Y1D A;  1WN7 A;  4YFU A;  1RT1 A;  2G8V A;  4CEE A;  3L3V A;  4N56 A;  3LWM A;  1HNV A;  5HRO A;  3RMA A;  1NK0 A;  5KGW A;  3V9X A;  4XIU A;  3LDS A;  3BGR A;  3DMJ A;  3SV4 A;  4OKK A;  3TAR A;  2HW3 A;  2ZQB A;  1NK7 A;  1EXQ A;  1S9E A;  2B6A A;  4CJP A;  4E1M A;  2BGG A;  3ZSW A;  1VRU A;  4CK2 A;  3VQE A;  3ZT2 A;  1TKX A;  1KSP A;  3V81 A;  4ELT A;  3F73 A;  4L8R B;  4FK4 A;  4FLV A;  4JLH A;  4YNQ A;  2X74 A;  2BE2 A;  1LW2 A;  1QSL A;  3WNE A;  4CE9 A;  4B9S A;  3QEV A;  3SYZ A;  4FJM A;  2RKI A;  4DTR A;  3KLE A;  3QLH A;  4DTM A;  4BWM A;  2Z1H A;  2D0B A;  3FFI A;  2E6M A;  1KVB A;  1GOB A;  4RW7 A;  4DTS A;  4AHV A;  3SUN A;  1RDB A;  2B5J A;  3K58 A;  3SCX A;  1VK0 A;  2DY4 A;  3KD1 E;  3HO1 A;  3AVM A;  5CZ2 A;  3OYE A;  1RTD A;  4W5Q A;  1TAU A;  5I42 A;  3VQB A;  1NKE A;  3O3H A;  1D9D A;  3KLI A;  1JKH A;  3H08 A;  4FJ7 A;  4E3S A;  4E0D A;  1YVU A;  3HL8 A;  3KKR A;  3O4N A;  4B3O A;  1NK8 A;  1S1X A;  3T19 A;  2OPP A;  4J2B A;  2Z1I A;  4CFB A;  3NGZ A;  2QXF A;  3TAM A;  1GOA A;  3SUQ A;  3DRP A;  3K57 A;  1WLJ A;  1QE1 A;  4DSF A;  4ZTJ A;  4KI4 A;  4PQU A;  2A1S A;  3VQQ A;  4OPK A;  1BGX T;  3MEC A;  3ALY A;  2YHA A;  2IAJ A;  1RTI A;  3AO2 A;  3QO9 A;  4CJF A;  1NKB A;  2HB5 A;  2BAN A;  1JLC A;  2GUI A;  3D45 A;  1KRP A;  4EZ9 A;  1C1B A;  4BE1 A;  1CZ9 A;  2FBX A;  1RDD A;  2ZD1 A;  3KLG A;  3HPO A;  3AO5 A;  4FK0 A;  1VSH A;  4C8N A;  4CGH A;  4CEA A;  5DK5 A;  4HVJ A;  4FZZ A;  2VWK A;  2HNY A;  3MEE A;  4FCY A;  3ISN C;  1X9S A;  4G1Q A;  3CFO A;  4DQP A;  1WSJ A;  3RMC A;  3OYD A;  3VQ7 A;  4CEB A;  3QEW A;  3AVB A;  5JS1 A;  3HYF A;  1R0A A;  3PO4 A;  4N41 A;  2IGI A;  4DFP A;  1Y97 A;  3ZSZ A;  2FBT A;  3B6O A;  3AO4 A;  5CY4 A;  1WSE A;  1G15 A;  4NCG A;  3QEI A;  3AVC A;  4H4M A;  1RT6 A;  3AV9 A;  4IG3 A;  1QTM A;  5C24 A;  2VWJ A;  1IKY A;  4E7I A;  1VRT A;  4DTJ A;  2PZS A;  2XHB A;  4KRE A;  3ZT1 A;  1CZB A;  3V6D A;  3SPZ A;  2PY5 A;  3PX6 A;  4CFC A;  3QNN A;  4CHY A;  4H8K A;  3DLG A;  3TAP A;  3AA3 A;  4IKF A;  2HND A;  3TI0 A;  2P5O A;  3VQ9 A;  3I8D A;  4CJT A;  3SQ2 A;  1KVC A;  1S5J A;  4JS4 A;  4FM1 A;  1WAJ A;  4M3T A;  4FM0 A;  5HRS A;  3V1O A;  3PX0 A;  1CXQ A;  4DQS A;  1Z26 A;  4M3Y A;  4CGF A;  1HRH A;  3QES A;  1LWC A;  2JGU A;  3VQ5 A;  1L3V A;  3V4I A;  1ZYQ A;  1WSH A;  1B92 A;  4CFA A;  3O3F A;  4J2A A;  2O4I A;  2HHQ A;  1JLA A;  4FJH A;  1C1A A;  1EKE A;  1SL2 A;  3NDK A;  1A5V A;  4B9L A;  3EY1 A;  2HMI A;  5J2P A;  1FKP A;  4HCC A;  3C6U A;  2HHS A;  4DTX A;  4BDP A;  1RBT A;  3K5L A;  3QEP A;  2EX3 A;  4DQR A;  3C94 A;  4QAG A;  3O4Q A;  1X9M A;  3OYH A;  3L2W A;  2KQ2 A;  4DF4 A;  1U4B A;  2G8U A;  1A5X A;  2X78 A;  4M3W A;  2A1R A;  1KLN A;  2KZM A;  4IG0 A;  2QK9 A;  3ZT3 A;  3QNO A;  1C1C A;  3QIO A;  4BE2 A;  4HCB A;  3K2P A;  3DLR A;  2RN2 A;  3M8P A;  2RPI A;  5CYQ A;  4O44 A;  1TVR A;  4O55 A;  5HRP A;  3NAE A;  4CGJ A;  3KK1 A;  4KV8 A;  1KVA A;  4I7F A;  4KO0 A;  4FJX A;  2HHX A;  4CJ5 A;  3OYL A;  1NK9 A;  2FBY A;  2D0C A;  3LWL A;  4QCL A;  4AH9 A;  3TAB A;  5J2N A;  2ETJ A;  1QQC A;  2IDO A;  4JRQ A;  1VSI A;  3HP6 A;  2VG5 A;  1HYZ A;  2FC0 A;  3VQA A;  4DF8 A;  1T05 A;  2XY7 A;  4E7K A;  4DQI A;  3HP9 A;  1BHL A;  1LV5 A;  1KFS A;  4OVL A;  5K14 A;  4ELV A;  1D9F A;  1YTA A;  3DYA A;  1KFD A;  3V1Q A;  4CGG A;  1B9F A;  1BIZ A;  4KPY A;  3ZSQ A;  4CIE A;  1SL1 A;  1VSD A;  3G10 A;  3VQD A;  4CEC A;  1WSI A;  3PO5 A;  2HHT A;  2YKN A;  1IH7 A;  4CJS A;  4CF2 A;  4DLG A;  2VG7 A;  1DTQ A;  2RF2 A;  4RG8 A;  1B9D A;  1QS4 A;  5KGX A;  3NCI A;  4LY7 A;  4R5P A;  4C8K A;  1RDC A;  1RNH A;  4Z0U A;  3ZSV A;  3L2V A;  3IAY A;  2KFN A;  4HHT A;  3AVF A;  3S9H A;  2DFF A;  4DS4 A;  3QEX A;  2DFE A;  1BL3 A;  3U3G A;  3PY8 A;  3VQP A;  3DOK A;  5CYM A;  3OYI A;  3S3O A;  4Z4C A;  1IKW A;  1F21 A;  3K5M A;  4FW2 A;  3DRS A;  4FJJ A;  5C25 A;  1RBV A;  3E01 A;  3NH0 A;  3CQ8 A;  2E6L A;  3CYM A;  1TL3 A;  4OPJ A;  5HP1 A;  2Y1J A;  3ULD A;  1C0U A;  2XY6 A;  1SUQ A;  3DM2 A;  4RW8 A;  2G8K A;  4E7J A;  1J54 A;  1L3U A;  1WAF A;  4IBN A;  1BI4 A;  2GBZ A;  2HVH A;  3U3Y A;  3KJV A;  1S6Q A;  4F4K A;  3RMB A;  4CHZ A;  3MEG A;  3P83 D;  4I9Q A;  1JLG A;  1IG9 A;  1TK0 A;  1S1W A;  3VN5 A;  3KTQ A;  3VA0 A;  1K6Y A;  1QHT A;  3L2U A;  3D0P A;  3KKS A;  3SQ4 A;  1BCO A;  3AVA A;  2OPQ A;  4W5T A;  2VG6 A;  5FDL A;  1RIL A;  4OJR A;  3HK2 A;  4Z4E A;  5KRT A;  3AVK A;  3O3G A;  4B9N A;  3M8S A;  1VSK A;  4CHQ A;  3SQ1 A;  2KTQ A;  1TKD A;  4KAZ A;  5HRR A;  4DSK A;  4DS5 A;  1SV5 A;  1J9A A;  1LAV A;  1RT4 A;  4CF8 A;  1RBS A;  4CGD A;  4DSL A;  3AA4 A;  3K5N A;  1D5A A;  3NH1 A;  3C6T A;  4B8C A;  4ID5 A;  4FLT A;  3PX4 A;  3SI6 A;  1O1W A;  3V9S A;  4CK1 A;  1EP4 A;  3I0S A;  3RWU A;  3QET A;  1RDA A;  2WOM A;  2Z1J A;  1RCH A;  2D0A A;  4KHW A;  3WNH A;  4LSL A;  4AHR A;  1NK6 A;  1HNI A;  3P5J A;  3OS1 A;  2FBV A;  4CIF A;  1NK5 A;  4W5N A;  5J1E A;  1HYV A;  3VQC A;  2YHB A;  4CJR A;  4DU1 A;  3OYF A;  2HHU A;  1XHZ A;  4CK3 A;  4CEZ A;  4OKE A;  1SKS A;  4CF0 A;  3SJJ A;  1QSS A;  4FLX A;  1UOC A;  3SUP A;  4Q0B A;  3NF7 A;  4CJQ A;  4NYN A;  3K59 A;  3LZI A;  1U49 A;  2WON A;  1RT2 A;  3DI6 A;  3IG1 A;  1HPZ A;  4NYF A;  4DLE A;  2QKK A;  4KI6 A;  3TAQ A;  4DSI A;  4N47 A;  4DSJ A;  1UA0 A;  4BWJ A;  1SKR A;  4QOZ B;  3RR7 A;  1T7P A;  3LP1 A;  3HVR A;  1C0M A;  1VSF A;  4M41 A;  3ZSY A;  2XO7 A;  4O0I A;  2KZZ A;  1ZBL A;  2KFZ A;  3SPY A;  5I3U A;  4N76 A;  3OJS A;  2EHG A;  1FK9 A;  1RBU A;  2YNF A;  4CIG A;  4Z4G A;  3VQ4 A;  3ZSX A;  1GOC A;  3PUF A;  3LAL A;  1HJR A;  4KTZ A;  4CJL A;  4CJ4 A;  5HLF A;  2OZM A;  4E1N A;  2HHW A;  4FZX C;  4LH4 A;  4CJU A;  4CCH A;  1L5U A;  1TK8 A;  4M3Z A;  1FKO A;  2I5J A;  4CJE A;  1XWL A;  3VQ8 A;  5D3G A;  3U6F A;  4KFB A;  2HVI A;  1WSG A;  4OKJ A;  4B8A B;  3MXI A;  4DG1 A;  5KI6 A;  4AHT A;  3JYT A;  1NK4 A;  3RRH A;  4O5B A;  4EP4 A;  4RW4 A;  4LSN A;  5FRO A;  3OYA A;  3NHG A;  2XY5 A;  3SQ0 A;  4DWI A;  4E19 A;  4CEQ A;  3RRG A;  4O0J A;  1D8Y A;  1S1T A;  2E4L A;  2OPR A;  1JLE A;  1XI1 A;  2X6S A;  1ZBF A;  1TK5 A;  3F9K A;  3ZSO A;  2BDP A;  1RT5 A;  1HQE A;  4ZHR A;  3OVN A;  1DTT A;  1S9G A;  2YKM A;  4CHN A;  3OYN A;  1LWE A;  3KK3 A;  4GMJ B;  5DMR A;  4KB0 A;  4J2D A;  4M42 A;  1UWB A;  1EX4 A;  3K5O A;  3M8Q A;  4C8O A;  1U48 A;  1LWF A;  4GVM A;  4HTU A;  4B9M A;  4CJW A;  1NKC A;  3DOL A;  4FJ5 A;  1TV6 A;  1A5W A;  3NF9 A;  4FK2 A;  4CEO A;  3SUO A;  1ASU A;  1JXB A;  4ICL A;  3OJU A;  4B9U A;  4FZY A;  3AO3 A;  2G8I A;  4GW6 A;  3V9U A;  3QIN A;  4C8L A;  1C0T A;  3KIO A;  4I9L A;  1ZBH A;  3AA5 X;  3OYG A;  1JLQ A;  4FJG A;  3CG7 A;  1REV A;  1HYS A;  4KHY A;  3L8B A;  3CFR A;  5J2M A;  2Q3S A;  3OYK A;  4M45 A;  1JLB A;  3VQ6 A;  4CJV A;  3OYC A;  4RW9 A;  3HM9 A;  1NJW A;  4B08 A;  1L3T A;  2P5G A;  3KD5 E;  4B9V A;  4FJI A;  1Q9Y A;  1U04 A;  3CFP A;  1W9H A;  3NBP A;  4MFB A;  4Y1C A;  5HBM A;  2Y1I A;  2OA8 A;  2OZS A;  4AIL C;  4DU4 A;  4DMN A;  1L3S A;  1ASW A;  4TSX A;  4DU3 A;  4DFM A;  1LW0 A;  4W5R A;  4Q5V A;  1T8E A;  3SZ2 A;  4N5S A;  3DRR A;  3MXM A;  3EZ5 A;  4EP5 A;  2PYJ A;  4OLA A;  3MXJ A;  3BDP A;  1I3A A;  1S6P A;  3CM6 A;  4IDK A;  1TAQ A;  2OPS A;  3M8R A;  4HUF A;  3ZSR A;  4PA1 A;  2HHV A;  1JLF A;  3L2Q A;  3HPG A;  3L2R A;  4FJ9 A;  4ZTF A;  4FM2 A;  1BIS A;  3EYZ A;  4CHO A;  3OY9 A;  4LD0 A;  1RTH A;  2YNI A;  4PWD A;  1RT7 A;  4RW6 A;  1JXE A;  2GV9 A;  3UIQ A;  4MQ3 A;  3PV8 A;  1IKV A;  4FLU A;  4F8R A;  2F8T A;  1X1P A;  3NF8 A;  3NE6 A;  3DLB A;  4CEF A;  5KRS A;  3JSM A;  3DLK A;  3A2F A;  4H4O A;  5SWM A;  1NJY A;  2X6N A;  4Z4H A;  3T3F A;  4FJ8 A;  4M3X A;  3OS0 A;  2AJQ A;  5KTQ A;  4AHS A;  3LAK A;  1KCF A;  1CXU A;  3OYJ A;  4FLY A;  3AVJ A;  2OYQ A;  4KHU A;  3RTV A;  4K8Z A;  4PY5 A;  5CZ1 A;  1HQU A;  1VSJ A;  3LAM A;  4FJL A;  4DFK A;  4CFD A;  1NOZ A;  2Z1G A;  1S1V A;  3TAE A;  4CF9 A;  2F8S A;  4OLB A;  4KB1 A;  4PUO A;  1TL1 A;  4DSE A;  3QIP A;  4FLW A;  5HRN A;  1X9W A;  4DQQ A;  4ELU A;  2IOC A;  1RT3 A;  3B6P A;  4K8X A;  4FVM A;  4CHP A;  1SKW A; 
#chains in the Genus database with same CATH topology
 2VQE K;  1EET A;  1MU2 A;  4IFY A;  4F3O A;  3LP2 A;  4UY8 O;  1ESV A;  3O5B A;  2DFH A;  1ZBU A;  2ITM A;  4E89 A;  3C95 A;  1VSE A;  3CMA N;  1E4F T;  4QS8 A;  2VWB A;  3D7E O;  2GWK A;  2LSN A;  3E9L A;  1NJX A;  1IKX A;  1HKG A;  4K41 A;  5AQN A;  3TTC A;  5LJV A;  4JI6 K;  4FJK A;  4I6M A;  4JS5 A;  3ASM A;  1VSM A;  5AQL A;  1BWF O;  2KW4 A;  4FXD A;  4F2R A;  2ZE2 A;  3CC7 N;  1XHX A;  1T44 A;  1LAW A;  2QXL A;  1T03 A;  1IBL K;  3NF6 A;  3KLF A;  3PLA A;  1BUP A;  3IRX A;  3OW2 M;  4ID1 A;  1KXP A;  1WNS A;  5JS2 A;  1EQY A;  2JWL A;  1RBR A;  2YNH A;  3HVT A;  4C1N I;  3CM5 A;  3QBX A;  3LP0 A;  4WF9 L;  4KTQ A;  4YOY A;  2HNZ A;  4F3T A;  4KH6 A;  2ATQ A;  1NGH A;  2G8F A;  3AVL A;  4BRE A;  3ZX3 A;  4RWT A;  1HKB A;  3C7N B;  3ULE B;  4BE0 A;  1ZBI A;  4LH5 A;  3OYM A;  1TGO A;  4JD2 B;  3NGI A;  3R6M A;  4M3R A;  2W42 A;  4ISF A;  4CED A;  1K73 O;  4A2A A;  2RHK A;  3BF3 A;  3HT3 A;  3CXC M;  2RE2 A;  3TR8 A;  4U7B A;  1JCE A;  4LF8 K;  5I9E B;  4WE1 A;  5AQO A;  3GBT A;  1OH5 A;  4KTW A;  4FW1 A;  2NZT A;  3V1R A;  5FPD A;  3ZCM A;  3O9R A;  3LPT A;  3S3N A;  4KHQ A;  1QQM A;  3WT0 A;  4Z4F A;  3TWH A;  4DV1 K;  1U47 A;  1N6Q A;  3HST B;  4CGI A;  4YOR A;  2YI1 A;  3WQT A;  2IVN A;  1IV0 A;  3RMA A;  5KGW A;  4IEE A;  4DUY K;  3V9X A;  3SV4 A;  4I6M B;  4H0X B;  4CI6 A;  2NNW A;  4GNI A;  1EXQ A;  1S9E A;  4CW7 B;  4E1M A;  2BGG A;  4M7Y A;  3ZSW A;  3VTH A;  4CK2 A;  1TKX A;  3F73 A;  4FLV A;  4YNQ A;  3QEV A;  3SYZ A;  4FJM A;  2RKI A;  4DTR A;  3ID6 A;  4RW7 A;  3BEX A;  4AHV A;  3BY5 A;  4DTS A;  1RDB A;  3GL1 A;  5GAE P;  3K58 A;  4YOX A;  4FWR A;  5M1N A;  5CZ2 A;  1RTD A;  4GY2 B;  1TAU A;  3VER A;  4H03 B;  1D9D A;  4FJ7 A;  4BY9 C;  1YUW A;  1S1X A;  2OPP A;  1E4G T;  4J2B A;  5F1X A;  4CFB A;  1JCF A;  4O8U A;  4NXN K;  3K57 A;  1WLJ A;  4KI4 A;  2A1S A;  5AQT A;  3VQQ A;  2HB5 A;  1KRP A;  2GUI A;  1C1B A;  4BE1 A;  2ZD1 A;  4FK0 A;  3KLG A;  3CCQ N;  1VSH A;  4C8N A;  4CEA A;  3ENO A;  3ISN C;  3H3N O;  1WSJ A;  1QZ6 A;  3AVB A;  3CC2 N;  5BRE A;  2IGI A;  1Y97 A;  5ADX H;  1Z6R A;  1BA0 A;  2FBT A;  2PBD A;  4FL9 A;  4X65 K;  4H4M A;  2J4R A;  4JK9 A;  3AV9 A;  4IG3 A;  3O6W A;  5C24 A;  4DTJ A;  2PZS A;  3V6D A;  2PY5 A;  3PX6 A;  4H0V B;  5CHI A;  4CHY A;  2HND A;  5BRF A;  1S5J A;  1WAJ A;  5KPZ A;  2HF4 A;  3ZEU B;  5HRS A;  3HOT A;  1DT9 A;  4BRQ A;  2QWQ A;  3I8B A;  1YJN N;  5AQK A;  3ZET A;  4CGF A;  3SAH A;  1WSH A;  1B92 A;  2ZF5 O;  4J2A A;  2HHQ A;  1ZBS A;  1XNR K;  1SL2 A;  3TPQ A;  2HMI A;  4GKJ K;  5J2P A;  2HHS A;  3K5L A;  4IJA A;  1N33 K;  4QAG A;  3O4Q A;  1X9M A;  2G8U A;  1J6Z A;  4DF4 A;  2X78 A;  4H0O A;  2QK9 A;  4BRM A;  3QNO A;  3QIO A;  4XH1 A;  2F4V K;  3QFP A;  5CYQ A;  4O44 A;  5JVH L;  4CGJ A;  3KK1 A;  4KV8 A;  4I7F A;  3OYL A;  1NGJ A;  3U9D A;  5KPR A;  1QQC A;  2IDO A;  4PL8 A;  1VSI A;  3J80 O;  2VG5 A;  1T05 A;  4E7K A;  4FOI A;  4ELV A;  1D9F A;  4GV9 A;  2NRZ A;  3DYA A;  3V1Q A;  1KFD A;  4WQ5 C;  4B1U B;  3G10 A;  3VQD A;  2HHT A;  4CJS A;  2GWJ A;  4LF9 K;  4DR6 K;  4Z0U A;  1I94 K;  3IAY A;  1CZA N;  1YAG A;  3AVF A;  2DFF A;  3WXJ A;  2DFE A;  2P9L B;  5HOO A;  1YXQ A;  1ZXO A;  3DOK A;  4GVE A;  4B3M K;  3K5M A;  4FWS A;  4FW2 A;  5M1K A;  3DRS A;  1NGE A;  1NG9 A;  3CYM A;  3U8X A;  3ULD A;  3ZET B;  4RW8 A;  4E7J A;  3CJA A;  1WAF A;  5LJW A;  3KJV A;  2GEM A;  3MEG A;  4MDB A;  3KWI A;  5FPN A;  1IG9 A;  2F7T A;  4U67 L;  3L2U A;  1NGB A;  5AFU H;  5FDL A;  3GOI A;  1RIL A;  4WQ4 C;  2WTU A;  5KRT A;  2YJF A;  3MDQ A;  4B9N A;  3R9P A;  4CHQ A;  3G71 N;  1TYQ A;  1SV5 A;  1RT4 A;  1RBS A;  3HI0 A;  4DV6 K;  3C6T A;  4FLT A;  4ID5 A;  1S22 A;  4BQZ A;  2ASP A;  2WOM A;  4KHW A;  1RCH A;  3WNH A;  4H5R A;  4AHR A;  4AM6 A;  2FBV A;  4W5N A;  3VQC A;  4CJR A;  2DPN A;  4OKE A;  1SKS A;  1UOC A;  4FPA A;  4B1Y B;  1BDG A;  3E66 A;  4NYF A;  4DSI A;  4N47 A;  4DSJ A;  4CZE A;  1SKR A;  5DM7 L;  4QOZ B;  4JKG A;  3ZSY A;  4ILJ A;  5E26 A;  5DM6 L;  1ZBL A;  1P8Z A;  1FK9 A;  1RBU A;  1D4X A;  4Z4G A;  3VQ4 A;  3ZSX A;  2OZM A;  2HHW A;  5CR4 A;  4LH4 A;  3A5M C;  1L5U A;  1TK8 A;  4M3Z A;  3LM9 A;  1XWL A;  3VQ8 A;  2HVI A;  4AHT A;  1NK4 A;  4IEI A;  4LSN A;  3SQ0 A;  1IBK K;  5EXW A;  4CZM A;  3RRG A;  2O8F A;  4BRP A;  1YJW N;  1S1T A;  4DR4 K;  2P9K B;  3ZSO A;  2BDP A;  1RT5 A;  2IVP A;  1HQE A;  1DTT A;  4CHN A;  4M42 A;  4GMJ B;  1UWB A;  4C8O A;  1U48 A;  4FJ5 A;  1TV6 A;  1A5W A;  3EKS A;  3CJC A;  2A6A A;  1VHX A;  4YDU A;  2ZJR L;  4LFA K;  4K43 A;  1TYQ B;  3OYG A;  2V7Z A;  5J2M A;  3IMX A;  4EIA A;  4C1N K;  4M45 A;  3OYC A;  3ATU A;  4B1Z A;  3KD5 E;  5LMU K;  2F9T A;  1GLJ O;  4B9V A;  1U04 A;  3CFP A;  3NBP A;  5HBM A;  3SMS A;  2Y1I A;  2CGJ A;  5BPM A;  4M63 C;  3NMU A;  3H45 C;  2P9I B;  1ASW A;  5M1P A;  4DFM A;  1T8E A;  2PYJ A;  3NVM A;  1I3A A;  3CM6 A;  3M8R A;  4HUF A;  3C6A A;  3L2Q A;  1DKG D;  3HPG A;  3E9O A;  3AAQ A;  1NMN A;  4JKG B;  5AQS A;  3EYZ A;  4IOC L;  3M6G A;  4XH4 A;  2KKZ A;  1RT7 A;  3GE1 A;  1JXE A;  3KHY A;  2HBL A;  2Q2R A;  4FWM A;  4EFH A;  2X6N A;  4Z4H A;  4A2B A;  3VGK A;  3OS0 A;  3OYJ A;  4FLY A;  3LDN A;  1Y64 A;  4K8Z A;  4KHU A;  4PHT X;  2O8F B;  3P4I A;  4M7X A;  1R59 O;  1VQ6 N;  2Q0R A;  3FZH A;  3QIP A;  1X9W A;  4DQQ A;  1YI2 N;  3CC4 N;  2G8W A;  3O1W A;  3TAF A;  3KLH A;  4EZ6 A;  4CJ3 A;  3RMD A;  2R7Y A;  4DTU A;  3AAP A;  3HZ6 A;  3T1A A;  4CER A;  3LP3 A;  3CCM N;  3BF1 A;  1BQN A;  4BDZ A;  2D4W A;  4B1V A;  1HNW K;  3R1X A;  3TSP A;  4F2S A;  3O9T A;  4KBO A;  2NRR A;  1YT3 A;  1Z25 A;  2UXB K;  1VSL A;  4BGB A;  2YNG A;  1UA1 A;  4HUG A;  2IS3 A;  1NM1 A;  3CJB A;  4JRP A;  4MO4 A;  3FZL A;  3NGY A;  4JN4 A;  5FRN A;  5AQX A;  4JHD A;  3ZT0 A;  3AVI A;  2O4G A;  1IO2 A;  2P9S B;  2VQF K;  5FRM A;  2I7P A;  4A5A A;  4DTO A;  4KRF A;  1ILY A;  2W6L A;  5GAG P;  2Q97 A;  4HUE A;  4HWI A;  2ITG A;  1BI4 B;  4BDY A;  4BC3 A;  1JL2 A;  5AR0 A;  4WFB L;  1LCU A;  4OGE A;  4KH5 A;  3J81 O;  3LZJ A;  4AF1 A;  3ENB A;  3ITH A;  2XRI A;  3QDK A;  4RTF D;  5C42 A;  3AVN A;  3SBG A;  3KK2 A;  2QKB A;  3NH2 A;  4AHU A;  2HBJ A;  3LDP A;  1RTJ A;  1VQP N;  4AHC A;  2YV0 X;  2B4J A;  5J2Q A;  1TKT A;  4CZJ A;  3EE8 A;  4E7L A;  1DLO A;  4JAX A;  3VEZ A;  2FF6 A;  3WXM B;  3G0Z A;  2H3G X;  3V9W A;  3JXU A;  4E7H A;  1KAX A;  3NFA A;  4DTP A;  4C8M A;  2PYL A;  2V7Y A;  4Y1D A;  4R79 A;  3LDS A;  3DMJ A;  4OKK A;  4KHP K;  2HW3 A;  2FXU A;  5AFU A;  4JKC A;  1VRU A;  3ZT2 A;  2CH6 A;  2KHO A;  4A57 A;  4JI8 K;  4FK4 A;  3CF5 L;  2X74 A;  3WNE A;  3KLE A;  2PAV A;  2QW9 A;  3QLH A;  4JHD B;  2D0B A;  5JIC A;  2E6M A;  4B3R K;  1GOB A;  3IDH A;  4B1X B;  3SUN A;  1HUX A;  3SCX A;  3KD1 E;  3AVM A;  2NRV A;  3OYE A;  4AM7 A;  4FVU A;  3VQB A;  1NKE A;  3O3H A;  3L6Q A;  1JKH A;  3H08 A;  1HPM A;  3KKR A;  5M1F A;  1NK8 A;  1HLU A;  4IFE A;  5JMV A;  3CQY A;  4BRN A;  2JWK A;  3SUQ A;  2GX9 A;  4H0T B;  4DSF A;  3FGU A;  3F2K A;  2V51 B;  2YHA A;  2IAJ A;  1RTI A;  2GEL A;  3HBT A;  2O8D A;  5HL7 L;  5AQM A;  1CZ9 A;  2FBX A;  3HPO A;  4EHT A;  4CGH A;  5DK5 A;  1NLV A;  3MEE A;  2UUC K;  4G1Q A;  1Q81 O;  5JS1 A;  4DFP A;  3KZB A;  3B6O A;  5CY4 A;  1WSE A;  1BG3 A;  1G15 A;  3QEI A;  5A2Q O;  2VYP A;  2KFZ A;  3OBY A;  2VWJ A;  4KRE A;  4E7I A;  2XHB A;  4WFN L;  1CZB A;  3D2E A;  3ZYY X;  3QNN A;  4H8K A;  3DLG A;  3TAP A;  1HR0 K;  1V4S A;  3VQ9 A;  3SQ2 A;  5AQJ A;  3VEN A;  5AQF A;  4JS4 A;  4FM1 A;  1Q86 O;  4FM0 A;  3O8M A;  3UB5 A;  4DQS A;  1Z26 A;  3O3F A;  2AA4 A;  1C1A A;  1EKE A;  2W41 A;  2FSJ A;  4B9L A;  2UUB K;  3WQU A;  4J8F A;  3B8A X;  2KLA A;  1T6C A;  4YHH K;  1RBT A;  2EX3 A;  1LOT B;  1A5X A;  2KZM A;  1KLN A;  1T6D A;  3ZT3 A;  3SMP A;  4HCB A;  3K2P A;  2RN2 A;  3NVK A;  3A5L C;  3P31 A;  1TVR A;  3NAE A;  4CZL A;  3BZC A;  4QS9 A;  4KO0 A;  4BRD A;  3THY A;  3L4Q A;  4DV2 K;  2ASO A;  2O8D B;  1NGG A;  3HP6 A;  1HNZ K;  1NU0 A;  1BHL A;  2E8A A;  4YOW A;  1LV5 A;  1HNX K;  1KFS A;  5K14 A;  3O80 A;  1YTA A;  4CGG A;  1B9F A;  3C65 A;  1N36 K;  1SL1 A;  1VSD A;  2D0O A;  2QWM A;  2ZM6 K;  3QFU A;  1B9D A;  4B9Q A;  1Q82 O;  4LY7 A;  4R5P A;  1RDC A;  1KD1 O;  3LL3 A;  3THW A;  3ZSV A;  3F5T A;  1BO5 O;  4IJN A;  3D2E B;  1NWK A;  2ZJP L;  5CYM A;  3OYI A;  1QQN A;  3ZX0 A;  1IKW A;  3CER A;  4FJJ A;  5C25 A;  4ISE A;  3O9S A;  1TL3 A;  5HP1 A;  3CQX A;  2Y1J A;  1C0U A;  4XH5 A;  2E1Z A;  5AQZ A;  5JVG L;  1SAZ A;  2HVH A;  4F4K A;  3VGL A;  1ATN A;  4CHZ A;  4I9Q A;  3VEY A;  3S41 A;  3VN5 A;  4CD3 A;  1KC8 O;  3EZW A;  1QHT A;  3KKS A;  1BCO A;  3AVA A;  2OPQ A;  2VG6 A;  5AZJ A;  4JK8 A;  4A62 A;  4OJR A;  4Z4E A;  1NGF A;  5KPT A;  3AVK A;  1YVN A;  3SQ1 A;  2KTQ A;  4KAZ A;  3CCV N;  1NGD A;  3MX5 A;  3I55 N;  4B8C A;  3SI6 A;  3CD6 N;  1O1W A;  3V9S A;  3I0S A;  4B3S K;  3QET A;  4H5N A;  2ZGZ A;  1NK6 A;  1HNI A;  4CIF A;  3FZK A;  2YHB A;  3OYF A;  3SBT A;  4CK3 A;  1XC3 A;  4CF0 A;  1HKC A;  1QSS A;  4FLX A;  3SUP A;  4Q0B A;  3HRG A;  1RT2 A;  3AGR A;  3P38 A;  4FWP A;  4DLE A;  3H1Q A;  3J8A A;  4CZG A;  3RR7 A;  3LP1 A;  2YHX A;  3SPY A;  3VF4 A;  1Q7Y O;  4EHU A;  3OJS A;  1MWK A;  4DV4 K;  4FZY A;  1GOC A;  4CJU A;  4AQY K;  1MA9 B;  4CJE A;  4KFB A;  3MXI A;  5KI6 A;  3RRH A;  3NHG A;  1XMQ K;  2XY5 A;  3VMF B;  4E19 A;  4CEQ A;  4O0J A;  1ZBF A;  1TK5 A;  4JKD A;  3FZM A;  4ISG A;  1LWE A;  4KB0 A;  3K5O A;  4BVO A;  3QIC A;  4GVM A;  1YIT N;  5AZJ B;  3DOL A;  1G99 A;  2A40 A;  3J7A P;  3NF9 A;  3OJU A;  2G8I A;  3QIN A;  1ZBH A;  2IVO A;  4A5B A;  4FJG A;  1REV A;  3CCE N;  1GLA G;  4KHY A;  3L8B A;  2E2N A;  3CFR A;  1JLB A;  3O9U A;  4FJI A;  1XUP O;  2UUA K;  3CCL N;  4Y1C A;  4BRL A;  4AIL C;  4DU4 A;  2Q1N A;  1L3S A;  2HST A;  4W5R A;  3T7Z A;  1GLE G;  5C12 A;  4EP5 A;  2O8E A;  3MXJ A;  4IDK A;  1K8K A;  5AQY A;  2HHV A;  3ZSR A;  4LF7 K;  1JLF A;  3CHW A;  3EE9 A;  4WQ5 A;  3L2R A;  3RSE A;  4CHO A;  3OY9 A;  4F9O A;  4GKK K;  1RTH A;  1XMO K;  4PWD A;  2A3Z A;  2GV9 A;  3UIQ A;  4MQ3 A;  4FLU A;  1X1P A;  4NB4 A;  5KRS A;  3O1B A;  4DR3 K;  3A2F A;  4K42 A;  1GLB G;  1NJY A;  5BN9 A;  4AHS A;  1CXU A;  2OYQ A;  1DGK N;  5EOY A;  4BRH A;  5CZ1 A;  3DXK A;  1VSJ A;  4FWQ A;  4DFK A;  2Z1G A;  4FPB A;  3TAE A;  2F8S A;  1K8A O;  4OLB A;  4DV3 K;  4CZF A;  1VQ4 N;  3T1H K;  4K8X A;  4FVM A;  1SKW A;  2E2P A;  4JKH A;  3R3L A;  3VGM A;  4CJK A;  3WNG A;  2P9N A;  1HMV A;  3U4L A;  1V4T A;  4KHN A;  4NLC A;  4WQ4 A;  4OGC A;  4DTN A;  3ZT4 A;  1HJO A;  4CZI A;  5BN8 A;  1ASV A;  2FLO A;  4DUZ K;  3AA2 A;  4YY3 K;  1Q8I A;  4L3Q A;  2F96 A;  1P90 A;  3ID8 A;  4JI5 K;  1JL1 A;  2VGN A;  3AVH A;  3IFR A;  3LPU A;  3WNF A;  2O8E B;  3D2F A;  4I2P A;  1YTU A;  4M3U A;  1K8K B;  1CLQ A;  4UQG A;  1WSF A;  3MCP A;  1U45 A;  1C6V A;  4BRO A;  3MMV A;  5F2R A;  4DV7 K;  4MLH A;  2IC3 A;  3RSE B;  2Q31 A;  1N8R O;  5BRH A;  5AQP A;  1NOY A;  2NRW A;  5AQG A;  4NCA A;  3CME N;  3HXM A;  2HMP A;  3FFK B;  3MED A;  4DV5 K;  1N5Y A;  4KKO A;  1XC9 A;  4BRF A;  4CBW A;  3DXK B;  5TKY A;  4O4G A;  4E1J A;  4LF6 K;  3AO1 A;  3THV A;  4YDU C;  3S3M A;  3L3U A;  1QSY A;  3MK6 A;  3SV3 A;  3TAG A;  4DR1 K;  3V9Z A;  3AGK A;  4DFJ A;  3E9P A;  1YJ9 N;  2P9N B;  1UAX A;  1QQO A;  3JS6 A;  4W5O A;  2ASM A;  2JLE A;  2P1J A;  1Q18 A;  1WN7 A;  1RT1 A;  1S72 N;  2G8V A;  3L3V A;  4N56 A;  3KK7 A;  1HNV A;  3LWM A;  5HRO A;  4K0K K;  4XIU A;  3BGR A;  1VQN N;  1OVY A;  4O8K A;  2B6A A;  3J7Z O;  4MDA A;  3VQE A;  4ELT A;  3V81 A;  4L8R B;  1QVF M;  5KQ8 A;  1LW2 A;  4CE9 A;  3OTO K;  4BWM A;  2Z1H A;  2W6K A;  2QWL A;  5C0Y A;  2B5J A;  4DV0 K;  2YX6 A;  2BTF A;  5ADX A;  5GIP A;  5LMN K;  2DY4 A;  1W97 L;  3HO1 A;  3MWP A;  3QB0 A;  5I42 A;  2E5L K;  5GIO A;  2NRX A;  1VQL N;  5EVZ A;  4E3S A;  4B3O A;  3HL8 A;  5C2D A;  4BRG A;  1XQS C;  2Z1I A;  2QXF A;  1VQ8 N;  3TAM A;  1VQK N;  1NGA A;  3DRP A;  1K9M O;  4ZTJ A;  3CPE A;  4BG9 A;  4OPK A;  3ALY A;  3AO2 A;  3QO9 A;  3H46 O;  4CJF A;  2O8C A;  1EO1 A;  4EZ9 A;  1QZ5 A;  4BRK A;  4O5F A;  1RDD A;  4LF4 K;  3QBW A;  4FZZ A;  3A8Y A;  2HNY A;  1X9S A;  3H3O B;  3ATV A;  2CH5 A;  3CFO A;  3VF2 A;  4DKW A;  3RMC A;  2ZJQ L;  3M5R A;  1VQ5 N;  3VQ7 A;  3H1V X;  3QEW A;  3HYF A;  4JNE A;  4JI2 K;  2A5X A;  3U9Z A;  4NCG A;  2QWP A;  1RT6 A;  3R8E A;  1QTM A;  1IKY A;  1VRT A;  5TKW A;  3ZT1 A;  2V52 B;  1T3V A;  4CFC A;  4YOU A;  4CJT A;  3EO3 A;  4IO8 A;  3V1O A;  2QA4 N;  1ZC6 A;  4JKE A;  3UKU A;  4WCE L;  1HRH A;  3VQ5 A;  1ZYQ A;  4CFA A;  4FWO A;  2W40 A;  4JKF A;  1JLA A;  1NBW A;  3UE5 A;  1KQS M;  3NDK A;  3C6U A;  2P9U A;  3P39 A;  3QEP A;  4BVP A;  4DQR A;  1U4B A;  2KQ2 A;  1WBD A;  1OH8 A;  2A1R A;  3OBW A;  4BE2 A;  3M8P A;  1VQO N;  4BRI A;  4O55 A;  4NXM K;  1KVA A;  3SJH A;  2HHX A;  2I7N A;  4CJ5 A;  4QCL A;  3LWL A;  3TAB A;  5J2N A;  4JRQ A;  3VQA A;  4DF8 A;  2XY7 A;  4OVL A;  1NJI O;  1VAZ A;  1BIZ A;  1RDW X;  4KPY A;  4FWL A;  4CEC A;  2WFB A;  4CF2 A;  3RVC A;  3TTD A;  3MCA B;  1DTQ A;  1HX1 A;  1RGI A;  1ATS A;  3NCI A;  1VQM N;  4C8K A;  3LDO A;  1RNH A;  1WB9 A;  5FPE A;  3PIP L;  2KFN A;  4MO5 A;  4BR5 A;  1FJG K;  3S9H A;  3QEX A;  3U3G A;  3PY8 A;  3VQP A;  3S3O A;  4Z4C A;  1NGC A;  4JI4 K;  1W2B M;  2E6L A;  4OPJ A;  1SUQ A;  1YIJ N;  1GLD G;  3UKU B;  2G8K A;  2HHH K;  2FSK A;  2CGK A;  2GBZ A;  4BC2 A;  3QML A;  1JLG A;  4BRC A;  1S1W A;  3KTQ A;  1TUU A;  1BOT O;  3D0P A;  3SQ4 A;  3C7N A;  1X3M A;  4OX9 K;  3TU5 A;  2E1Y A;  2UYT A;  1IJJ A;  3O3G A;  3C0B A;  1VSK A;  1TKD A;  3D6R A;  4CGD A;  4CF8 A;  1D5A A;  5CE3 A;  1EP4 A;  2Z1J A;  4LSL A;  3P5J A;  5J1E A;  4DU1 A;  1XHZ A;  4CEZ A;  2HBK A;  4IWV A;  3KVG A;  3NF7 A;  4CJQ A;  3LZI A;  3CCJ N;  2WON A;  3IG1 A;  3DI6 A;  2QKK A;  1HPZ A;  4DR5 K;  2UU9 K;  4KI6 A;  2NRH A;  4ILH A;  3TAQ A;  1OH7 A;  4BWJ A;  2HOE A;  1T7P A;  1W7A A;  3VEW A;  4M41 A;  4BQL A;  5JLF A;  4O0I A;  3CCR N;  5EY4 A;  5I3U A;  1VQ7 N;  2EHG A;  4CIG A;  3PUF A;  4CJL A;  4BR2 A;  5ELZ A;  4CCH A;  4BG8 A;  5D3G A;  1FKO A;  2I5J A;  1M90 O;  3U6F A;  1WSG A;  4OKJ A;  3IUC A;  4DG1 A;  3JYT A;  4O5B A;  4RW4 A;  5FRO A;  4DWI A;  1BU6 O;  1D8Y A;  2E4L A;  2YHY A;  2X6S A;  3T69 A;  3F9K A;  3PIO L;  4JKB A;  4ZHR A;  5BR9 A;  2YKM A;  4X66 K;  3KK3 A;  1X3N A;  1EX4 A;  4G9Z A;  1LWF A;  4HTU A;  2HBM A;  4JI7 K;  1SQK A;  1ASU A;  4BR0 A;  4OPA A;  3EKU A;  4C8L A;  1C0T A;  3KIO A;  4I9L A;  1JLQ A;  3DXM A;  3I56 N;  2IIR A;  5GIN A;  4H5W A;  1WUA A;  4FOE A;  2Q3S A;  2VCP A;  3VQ6 A;  4CJV A;  1X9J A;  3HM9 A;  1NJW A;  1L3T A;  3CPW M;  1Q9Y A;  3VET A;  2QM1 A;  2OZS A;  1LW0 A;  3SZ2 A;  4N5S A;  3DRR A;  4DB3 A;  1S6P A;  4WFA L;  4K25 A;  4HTL A;  4YOV A;  2OTJ N;  5BRD A;  4ZTF A;  1BIS A;  1C0G A;  1JCG A;  3DAW A;  3LDQ A;  1S3X A;  4LD0 A;  2YNI A;  1KAZ A;  4RW6 A;  4X62 K;  3ZEU A;  1N34 K;  3AAR A;  3PV8 A;  2F8T A;  5C10 A;  3NF8 A;  4CEF A;  3WXL A;  4FJ8 A;  4M3X A;  4FWN A;  1GLF O;  3L0Q A;  5KTQ A;  3LAK A;  4PL7 A;  1KCF A;  4KH4 A;  3AVJ A;  4YOT A;  3RTV A;  4NLB A;  1HQU A;  2UXD K;  1S1V A;  5BPL A;  4JI0 K;  1TL1 A;  4LC9 B;  4FLW A;  1RT3 A;  3C6H A;  3EL2 A;  3THY B;  3LAN A;  4DR2 K;  1FXX A;  3WXK A;  1WBB A;  2O8B A;  3H6E A;  1XNQ K;  3A5O C;  3N4P A;  3DXM B;  3VTI A;  2Q0U A;  4FYD A;  5BPN A;  3DLH A;  3GG4 A;  1W0H A;  4IO9 L;  3TAN A;  3FLC O;  3GDQ A;  4CVN E;  1NJZ A;  3HPH A;  2XY8 A;  4B9T A;  1YF5 L;  4JEP A;  3SLC A;  3THW B;  3WEE A;  1Q9X A;  3EN9 A;  2NUB A;  3DLE A;  3CJ9 A;  4FLZ A;  3VA3 A;  4FSV A;  4CZK A;  3IS9 A;  3G6E N;  4CZH A;  5E41 A;  2DTU A;  4KHS A;  2P9L A;  3AVG A;  3SNN A;  4IFV A;  2GTD A;  4DHY A;  2G8H A;  1NNE A;  3PSI A;  5AQW A;  4CES A;  4OO1 J;  4JYA K;  1J53 A;  1KTQ A;  1SL0 A;  1TKZ A;  2D5R A;  3SAG A;  4GV3 A;  4LFC K;  5EU7 A;  4I2Q A;  5FPM A;  4PKI A;  3VEO A;  5MLC Q;  3HJF A;  4H0P A;  1J5O A;  1BQM A;  2P51 A;  3MAQ A;  3I0R A;  1S1U A;  4C23 A;  3MN9 A;  1ITG A;  4CF1 A;  3P1G A;  3OYB A;  2YCH A;  4J2E A;  3DJC A;  4BAC A;  3QER A;  1M1K O;  1I39 A;  3TTF A;  2BH1 A;  3OS2 A;  1KLM A;  3RR8 A;  1BCM A;  2O8B B;  1BIU A;  2E88 A;  4FJN A;  3T1Y K;  4Z4I A;  4JK7 A;  2WBN A;  3VOV A;  5SZT A;  5T7B A;  4NCB A;  2QWN A;  3CJ1 A;  1IBM K;  4YFU A;  4CEE A;  4IZ9 A;  5F0X A;  1VQ9 N;  1NK0 A;  4H5V A;  3TAR A;  2OTL N;  4IDH A;  3PSF A;  2ZQB A;  1NK7 A;  4CJP A;  1EWR A;  1YHQ N;  3WEE B;  1KSP A;  4BR9 A;  4JLH A;  2BE2 A;  1QSL A;  4B9S A;  3BUZ B;  4LF5 K;  4DTM A;  3FFI A;  1H1V A;  1KVB A;  2WUS A;  4GV6 A;  3HSC A;  4DQ8 A;  1VK0 A;  3O9Q A;  1RFQ A;  1C0F A;  4W5Q A;  3FE1 A;  3MN5 A;  3KLI A;  2GUP A;  4E0D A;  1YVU A;  3O4N A;  1OKJ A;  5AZI A;  3T19 A;  2P9K A;  3NGZ A;  3WUH A;  1GOA A;  3F9M A;  5AJ3 K;  1QE1 A;  3CI5 A;  4PQU A;  3O08 A;  1BGX T;  3MEC A;  3MN6 A;  4B1W B;  1SZ2 A;  1NKB A;  2BAN A;  1JLC A;  1MDU B;  3D45 A;  2QEX N;  2A42 A;  3AO5 A;  3K9J A;  4HVJ A;  2VWK A;  4FCY A;  2ZGY A;  4X64 K;  4DQP A;  3CJ7 A;  3VPZ A;  3OYD A;  4CEB A;  1N32 K;  1R0A A;  3PO4 A;  5EX5 A;  4N41 A;  3ZSZ A;  5IT9 O;  3AO4 A;  3AVC A;  3WXI A;  1BA1 A;  2P9I A;  1JJ2 M;  2Q36 A;  5B8H A;  4IOX A;  4NO7 A;  3SPZ A;  3AA3 A;  4IKF A;  3TI0 A;  2P5O A;  3I8D A;  3BZK A;  2YHW A;  5GAD P;  1KVC A;  4M3T A;  4PKG A;  2OCE A;  3PX0 A;  1QHA A;  4XEI A;  1CXQ A;  2CGL A;  3ENH A;  4Y0W A;  4M3Y A;  3QES A;  1LWC A;  2JGU A;  4CBU A;  1L3V A;  3V4I A;  2O4I A;  3FR0 A;  4FJH A;  1NMD A;  3J7Y P;  4IOA L;  1A5V A;  3HTV A;  3EY1 A;  1FKP A;  4IXC A;  4HCC A;  2QWO A;  3W0L A;  1OVQ A;  4DTX A;  4BDP A;  4ILG B;  4BR4 A;  3C94 A;  1U2V A;  4V19 S;  3OYH A;  3L2W A;  5GAH P;  5AZI B;  4M3W A;  4IG0 A;  3I33 A;  1C1C A;  3TSQ A;  3DLR A;  1IG8 A;  2RPI A;  3A5N C;  5BR8 K;  5HRP A;  4B3T K;  1GLC G;  2F9W A;  4FJX A;  1NK9 A;  2FBY A;  2D0C A;  4AH9 A;  3LDL A;  2ETJ A;  3JAM O;  1NGI A;  1HYZ A;  2FC0 A;  1Z05 A;  4DQI A;  1O13 A;  3HP9 A;  4JI3 K;  5AQI A;  4BRA A;  3ZSQ A;  4CIE A;  3OHR A;  1OH6 A;  3PO5 A;  1WSI A;  3HOS A;  2YKN A;  1IH7 A;  3CIP A;  4DLG A;  2VG7 A;  2RF2 A;  4RG8 A;  1QS4 A;  5KGX A;  1ATR A;  3D2F B;  1EWQ A;  3L2V A;  5AQQ A;  4HHT A;  1FW6 A;  3UKR A;  4DS4 A;  3VEV A;  1BL3 A;  2E2Q A;  3AY9 A;  3THX A;  1F21 A;  1WOQ A;  3M1F A;  3BP8 A;  1RBV A;  3E01 A;  3NH0 A;  3CQ8 A;  2P9S A;  2FSN A;  2XY6 A;  3DM2 A;  4JV5 K;  1J54 A;  1L3U A;  4Z94 A;  5JLH A;  3E1Y A;  3IKM A;  4IBN A;  1BI4 A;  3U3Y A;  2PFU A;  4QS7 A;  1S6Q A;  3RMB A;  4BR7 A;  3P83 D;  4DCH A;  3MX2 A;  5AQV A;  1TK0 A;  3G4S N;  3VA0 A;  1K6Y A;  3G25 A;  4W5T A;  2UXC K;  4PKH A;  2D1K A;  4RCH A;  1U2V B;  3HK2 A;  2HF3 A;  2OAN A;  3A0I X;  3M8S A;  4CBX A;  2FF3 B;  3O4W A;  4JKA A;  5HRR A;  4DSK A;  4DS5 A;  5AQU A;  1J9A A;  1LAV A;  2YJE A;  3AA4 A;  3K5N A;  1KAY A;  4DSL A;  3NH1 A;  3OA9 A;  3PX4 A;  2E2O A;  4CK1 A;  3DWL A;  3RWU A;  1RDA A;  2D0A A;  3OS1 A;  1NK5 A;  1HYV A;  5FLX O;  4H5T A;  2HHU A;  3SJJ A;  4OPH A;  4JI1 K;  2BUP A;  4BC4 A;  3K59 A;  4NYN A;  1U49 A;  3Q7C A;  2D0P A;  2P9P A;  3MWT A;  3HM8 A;  3VES A;  1UA0 A;  2EWS A;  5LY3 A;  3M3Z A;  3HVR A;  1C0M A;  1VSF A;  5M1Q A;  2XO7 A;  2KZZ A;  4N76 A;  2WC9 A;  2YNF A;  3UKR B;  3CET A;  5HLF A;  4A61 A;  4KTZ A;  3LAL A;  1HJR A;  4CJ4 A;  3THX B;  4E1N A;  4FZX C;  3SAF A;  2QWR A;  4B8A B;  4EP4 A;  3OYA A;  5C15 A;  5AQR A;  2A41 A;  3L4I A;  2NRT A;  1MWM A;  1JLE A;  2OPR A;  1XI1 A;  2VGM A;  3DLL L;  1TUY A;  5C2F A;  3OYN A;  3OVN A;  3ZLJ A;  1S9G A;  3Q7B A;  1SS6 A;  4J2D A;  5DMR A;  3M8Q A;  3VEX A;  5KQD A;  4LFB K;  4B9M A;  4CJW A;  1NKC A;  2O8C B;  4CJ7 A;  3CCU N;  5E84 A;  3N4Q A;  2ZWH A;  4CEO A;  3SUO A;  1JXB A;  4ICL A;  4B9U A;  4FK2 A;  3AO3 A;  4GW6 A;  3V9U A;  3AA5 X;  3K9K A;  2QI2 A;  3CG7 A;  1HYS A;  2QTD A;  3OYK A;  2P5G A;  4RW9 A;  1J5E K;  1E3M A;  4B08 A;  5IWA K;  3SK3 A;  5LL6 Z;  1W9H A;  4MFB A;  2OA8 A;  4DMN A;  4TSX A;  3EEQ A;  4DU3 A;  4Q5V A;  3CCS N;  3MXM A;  4WYB A;  3EZ5 A;  1DEJ A;  4OLA A;  3BDP A;  1TAQ A;  2P9P B;  2OPS A;  4BGA A;  4PA1 A;  3ZX2 A;  4A59 A;  3TSU A;  4FJ9 A;  4FM2 A;  1QVG M;  3FZF A;  4MLE A;  5AQH A;  4CD1 A;  1U6Z A;  2E20 A;  1GLL O;  4H0Y B;  4FWK A;  4DR7 K;  5H1S Q;  2NLX A;  1IKV A;  4F8R A;  3LM2 A;  2AP1 A;  3NE6 A;  3DLB A;  3JSM A;  3DLK A;  4H4O A;  5SWM A;  3T3F A;  2AJQ A;  2P9U B;  3ULE A;  3KWG A;  3W3D A;  3K0S A;  4PY5 A;  3LAM A;  4FJL A;  4CFD A;  4JD2 A;  1NOZ A;  4FO0 A;  4CF9 A;  4BC5 A;  4KB1 A;  3MN7 A;  4PUO A;  1RDU A;  3VF6 A;  4DSE A;  4EAH D;  5HRN A;  4ELU A;  2IOC A;  3B6P A;  5M1O A;  4CHP A; 
#chains in the Genus database with same CATH homology
 1EET A;  1MU2 A;  4IFY A;  3LAN A;  4F3O A;  4CJK A;  2G8W A;  3LP2 A;  1FXX A;  3KLH A;  3WNG A;  3TAF A;  4EZ6 A;  4CJ3 A;  2DFH A;  1ZBU A;  4E89 A;  3RMD A;  3C95 A;  1HMV A;  1VSE A;  2R7Y A;  4DTU A;  4KHN A;  4OGC A;  3T1A A;  4CER A;  4DTN A;  3ZT4 A;  4FYD A;  3LP3 A;  3DLH A;  1BQN A;  2LSN A;  1NJX A;  1IKX A;  1ASV A;  1W0H A;  4BDZ A;  3TAN A;  3AA2 A;  4FJK A;  4F2S A;  1Q8I A;  4JS5 A;  3ASM A;  1VSM A;  2F96 A;  1NJZ A;  2KW4 A;  4FXD A;  1YT3 A;  1JL1 A;  1Z25 A;  3HPH A;  4F2R A;  2XY8 A;  2ZE2 A;  4B9T A;  1XHX A;  1VSL A;  1LAW A;  1T03 A;  3NF6 A;  3KLF A;  2YNG A;  1UA1 A;  2NUB A;  2IS3 A;  3DLE A;  3AVH A;  4HUG A;  1Q9X A;  3WNF A;  3LPU A;  4FLZ A;  3VA3 A;  3IRX A;  4JRP A;  4I2P A;  1YTU A;  3IS9 A;  4M3U A;  3NGY A;  4ID1 A;  5FRN A;  1CLQ A;  1WNS A;  1WSF A;  4UQG A;  1U45 A;  1C6V A;  3ZT0 A;  5E41 A;  5JS2 A;  2DTU A;  3AVI A;  2O4G A;  4KHS A;  3AVG A;  3SNN A;  1IO2 A;  2IC3 A;  4IFV A;  5FRM A;  4KRF A;  1RBR A;  4DTO A;  2YNH A;  3HVT A;  4HUE A;  2G8H A;  1NOY A;  2ITG A;  4CES A;  1BI4 B;  3CM5 A;  4BDY A;  1JL2 A;  1J53 A;  3LP0 A;  4KTQ A;  1KTQ A;  1SL0 A;  2HNZ A;  1TKZ A;  2D5R A;  4NCA A;  4F3T A;  4OGE A;  3HXM A;  2ATQ A;  2G8F A;  3AVL A;  3MED A;  4I2Q A;  5EU7 A;  3LZJ A;  3HJF A;  1N5Y A;  4KKO A;  1XC9 A;  1J5O A;  1BQM A;  3ITH A;  2P51 A;  2XRI A;  5C42 A;  4BE0 A;  3AVN A;  3MAQ A;  3I0R A;  1S1U A;  1ZBI A;  4LH5 A;  3OYM A;  3KK2 A;  2QKB A;  3NH2 A;  1TGO A;  4O4G A;  3NGI A;  4AHU A;  4M3R A;  1ITG A;  3AO1 A;  4CF1 A;  4CED A;  3P1G A;  2W42 A;  3THV A;  1RTJ A;  3S3M A;  3L3U A;  3OYB A;  1QSY A;  3SV3 A;  4AHC A;  2YV0 X;  3HT3 A;  4J2E A;  4BAC A;  2B4J A;  3TR8 A;  5J2Q A;  1I39 A;  1TKT A;  3QER A;  3TAG A;  4WE1 A;  4E7L A;  1DLO A;  3OS2 A;  1KLM A;  3V9Z A;  4KTW A;  4DFJ A;  3RR8 A;  1BCM A;  4FW1 A;  3V1R A;  1UAX A;  1BIU A;  3G0Z A;  3ZCM A;  3V9W A;  3LPT A;  4E7H A;  3S3N A;  4FJN A;  3NFA A;  4KHQ A;  4Z4I A;  5SZT A;  5T7B A;  4Z4F A;  4DTP A;  4C8M A;  4W5O A;  3TWH A;  4NCB A;  1U47 A;  2JLE A;  2PYL A;  2P1J A;  1N6Q A;  3HST B;  4CGI A;  4Y1D A;  1WN7 A;  4YFU A;  1RT1 A;  2G8V A;  4CEE A;  3L3V A;  4N56 A;  3LWM A;  1HNV A;  5HRO A;  3RMA A;  1NK0 A;  5KGW A;  3V9X A;  4XIU A;  3LDS A;  3BGR A;  3DMJ A;  3SV4 A;  4OKK A;  3TAR A;  2HW3 A;  2ZQB A;  1NK7 A;  1EXQ A;  1S9E A;  2B6A A;  4CJP A;  4E1M A;  2BGG A;  3ZSW A;  1VRU A;  4CK2 A;  3VQE A;  3ZT2 A;  1TKX A;  1KSP A;  3V81 A;  4ELT A;  3F73 A;  4L8R B;  4FK4 A;  4FLV A;  4JLH A;  4YNQ A;  2X74 A;  2BE2 A;  1LW2 A;  1QSL A;  3WNE A;  4CE9 A;  4B9S A;  3QEV A;  3SYZ A;  4FJM A;  2RKI A;  4DTR A;  3KLE A;  3QLH A;  4DTM A;  4BWM A;  2Z1H A;  2D0B A;  3FFI A;  2E6M A;  1KVB A;  1GOB A;  4RW7 A;  4DTS A;  4AHV A;  3SUN A;  1RDB A;  2B5J A;  3K58 A;  3SCX A;  1VK0 A;  2DY4 A;  3KD1 E;  3HO1 A;  3AVM A;  5CZ2 A;  3OYE A;  1RTD A;  4W5Q A;  1TAU A;  5I42 A;  3VQB A;  1NKE A;  3O3H A;  1D9D A;  3KLI A;  1JKH A;  3H08 A;  4FJ7 A;  4E3S A;  4E0D A;  1YVU A;  3HL8 A;  3KKR A;  3O4N A;  4B3O A;  1NK8 A;  1S1X A;  3T19 A;  2OPP A;  4J2B A;  2Z1I A;  4CFB A;  3NGZ A;  2QXF A;  3TAM A;  1GOA A;  3SUQ A;  3DRP A;  3K57 A;  1WLJ A;  1QE1 A;  4DSF A;  4ZTJ A;  4KI4 A;  4PQU A;  2A1S A;  3VQQ A;  4OPK A;  1BGX T;  3MEC A;  3ALY A;  2YHA A;  2IAJ A;  1RTI A;  3AO2 A;  3QO9 A;  4CJF A;  1NKB A;  2HB5 A;  2BAN A;  1JLC A;  2GUI A;  3D45 A;  1KRP A;  4EZ9 A;  1C1B A;  4BE1 A;  1CZ9 A;  2FBX A;  1RDD A;  2ZD1 A;  3KLG A;  3HPO A;  3AO5 A;  4FK0 A;  1VSH A;  4C8N A;  4CGH A;  4CEA A;  5DK5 A;  4HVJ A;  4FZZ A;  2VWK A;  2HNY A;  3MEE A;  4FCY A;  3ISN C;  1X9S A;  4G1Q A;  3CFO A;  4DQP A;  1WSJ A;  3RMC A;  3OYD A;  3VQ7 A;  4CEB A;  3QEW A;  3AVB A;  5JS1 A;  3HYF A;  1R0A A;  3PO4 A;  4N41 A;  2IGI A;  4DFP A;  1Y97 A;  3ZSZ A;  2FBT A;  3B6O A;  3AO4 A;  5CY4 A;  1WSE A;  1G15 A;  4NCG A;  3QEI A;  3AVC A;  4H4M A;  1RT6 A;  3AV9 A;  4IG3 A;  1QTM A;  5C24 A;  2VWJ A;  1IKY A;  4E7I A;  1VRT A;  4DTJ A;  2PZS A;  2XHB A;  4KRE A;  3ZT1 A;  1CZB A;  3V6D A;  3SPZ A;  2PY5 A;  3PX6 A;  4CFC A;  3QNN A;  4CHY A;  4H8K A;  3DLG A;  3TAP A;  3AA3 A;  4IKF A;  2HND A;  3TI0 A;  2P5O A;  3VQ9 A;  3I8D A;  4CJT A;  3SQ2 A;  1KVC A;  1S5J A;  4JS4 A;  4FM1 A;  1WAJ A;  4M3T A;  4FM0 A;  5HRS A;  3V1O A;  3PX0 A;  1CXQ A;  4DQS A;  1Z26 A;  4M3Y A;  4CGF A;  1HRH A;  3QES A;  1LWC A;  2JGU A;  3VQ5 A;  1L3V A;  3V4I A;  1ZYQ A;  1WSH A;  1B92 A;  4CFA A;  3O3F A;  4J2A A;  2O4I A;  2HHQ A;  1JLA A;  4FJH A;  1C1A A;  1EKE A;  1SL2 A;  3NDK A;  1A5V A;  4B9L A;  3EY1 A;  2HMI A;  5J2P A;  1FKP A;  4HCC A;  3C6U A;  2HHS A;  4DTX A;  4BDP A;  1RBT A;  3K5L A;  3QEP A;  2EX3 A;  4DQR A;  3C94 A;  4QAG A;  3O4Q A;  1X9M A;  3OYH A;  3L2W A;  2KQ2 A;  4DF4 A;  1U4B A;  2G8U A;  1A5X A;  2X78 A;  4M3W A;  2A1R A;  1KLN A;  2KZM A;  4IG0 A;  2QK9 A;  3ZT3 A;  3QNO A;  1C1C A;  3QIO A;  4BE2 A;  4HCB A;  3K2P A;  3DLR A;  2RN2 A;  3M8P A;  2RPI A;  5CYQ A;  4O44 A;  1TVR A;  4O55 A;  5HRP A;  3NAE A;  4CGJ A;  3KK1 A;  4KV8 A;  1KVA A;  4I7F A;  4KO0 A;  4FJX A;  2HHX A;  4CJ5 A;  3OYL A;  1NK9 A;  2FBY A;  2D0C A;  3LWL A;  4QCL A;  4AH9 A;  3TAB A;  5J2N A;  2ETJ A;  1QQC A;  2IDO A;  4JRQ A;  1VSI A;  3HP6 A;  2VG5 A;  1HYZ A;  2FC0 A;  3VQA A;  4DF8 A;  1T05 A;  2XY7 A;  4E7K A;  4DQI A;  3HP9 A;  1BHL A;  1LV5 A;  1KFS A;  4OVL A;  5K14 A;  4ELV A;  1D9F A;  1YTA A;  3DYA A;  1KFD A;  3V1Q A;  4CGG A;  1B9F A;  1BIZ A;  4KPY A;  3ZSQ A;  4CIE A;  1SL1 A;  1VSD A;  3G10 A;  3VQD A;  4CEC A;  1WSI A;  3PO5 A;  2HHT A;  2YKN A;  1IH7 A;  4CJS A;  4CF2 A;  4DLG A;  2VG7 A;  1DTQ A;  2RF2 A;  4RG8 A;  1B9D A;  1QS4 A;  5KGX A;  3NCI A;  4LY7 A;  4R5P A;  4C8K A;  1RDC A;  1RNH A;  4Z0U A;  3ZSV A;  3L2V A;  3IAY A;  2KFN A;  4HHT A;  3AVF A;  3S9H A;  2DFF A;  4DS4 A;  3QEX A;  2DFE A;  1BL3 A;  3U3G A;  3PY8 A;  3VQP A;  3DOK A;  5CYM A;  3OYI A;  3S3O A;  4Z4C A;  1IKW A;  1F21 A;  3K5M A;  4FW2 A;  3DRS A;  4FJJ A;  5C25 A;  1RBV A;  3E01 A;  3NH0 A;  3CQ8 A;  2E6L A;  3CYM A;  1TL3 A;  4OPJ A;  5HP1 A;  2Y1J A;  3ULD A;  1C0U A;  2XY6 A;  1SUQ A;  3DM2 A;  4RW8 A;  2G8K A;  4E7J A;  1J54 A;  1L3U A;  1WAF A;  4IBN A;  1BI4 A;  2GBZ A;  2HVH A;  3U3Y A;  3KJV A;  1S6Q A;  4F4K A;  3RMB A;  4CHZ A;  3MEG A;  3P83 D;  4I9Q A;  1JLG A;  1IG9 A;  1TK0 A;  1S1W A;  3VN5 A;  3KTQ A;  3VA0 A;  1K6Y A;  1QHT A;  3L2U A;  3D0P A;  3KKS A;  3SQ4 A;  1BCO A;  3AVA A;  2OPQ A;  4W5T A;  2VG6 A;  5FDL A;  1RIL A;  4OJR A;  3HK2 A;  4Z4E A;  5KRT A;  3AVK A;  3O3G A;  4B9N A;  3M8S A;  1VSK A;  4CHQ A;  3SQ1 A;  2KTQ A;  1TKD A;  4KAZ A;  5HRR A;  4DSK A;  4DS5 A;  1SV5 A;  1J9A A;  1LAV A;  1RT4 A;  4CF8 A;  1RBS A;  4CGD A;  4DSL A;  3AA4 A;  3K5N A;  1D5A A;  3NH1 A;  3C6T A;  4B8C A;  4ID5 A;  4FLT A;  3PX4 A;  3SI6 A;  1O1W A;  3V9S A;  4CK1 A;  1EP4 A;  3I0S A;  3RWU A;  3QET A;  1RDA A;  2WOM A;  2Z1J A;  1RCH A;  2D0A A;  4KHW A;  3WNH A;  4LSL A;  4AHR A;  1NK6 A;  1HNI A;  3P5J A;  3OS1 A;  2FBV A;  4CIF A;  1NK5 A;  4W5N A;  5J1E A;  1HYV A;  3VQC A;  2YHB A;  4CJR A;  4DU1 A;  3OYF A;  2HHU A;  1XHZ A;  4CK3 A;  4CEZ A;  4OKE A;  1SKS A;  4CF0 A;  3SJJ A;  1QSS A;  4FLX A;  1UOC A;  3SUP A;  4Q0B A;  3NF7 A;  4CJQ A;  4NYN A;  3K59 A;  3LZI A;  1U49 A;  2WON A;  1RT2 A;  3DI6 A;  3IG1 A;  1HPZ A;  4NYF A;  4DLE A;  2QKK A;  4KI6 A;  3TAQ A;  4DSI A;  4N47 A;  4DSJ A;  1UA0 A;  4BWJ A;  1SKR A;  4QOZ B;  3RR7 A;  1T7P A;  3LP1 A;  3HVR A;  1C0M A;  1VSF A;  4M41 A;  3ZSY A;  2XO7 A;  4O0I A;  2KZZ A;  1ZBL A;  2KFZ A;  3SPY A;  5I3U A;  4N76 A;  3OJS A;  2EHG A;  1FK9 A;  1RBU A;  2YNF A;  4CIG A;  4Z4G A;  3VQ4 A;  3ZSX A;  1GOC A;  3PUF A;  3LAL A;  1HJR A;  4KTZ A;  4CJL A;  4CJ4 A;  5HLF A;  2OZM A;  4E1N A;  2HHW A;  4FZX C;  4LH4 A;  4CJU A;  4CCH A;  1L5U A;  1TK8 A;  4M3Z A;  1FKO A;  2I5J A;  4CJE A;  1XWL A;  3VQ8 A;  5D3G A;  3U6F A;  4KFB A;  2HVI A;  1WSG A;  4OKJ A;  4B8A B;  3MXI A;  4DG1 A;  5KI6 A;  4AHT A;  3JYT A;  1NK4 A;  3RRH A;  4O5B A;  4EP4 A;  4RW4 A;  4LSN A;  5FRO A;  3OYA A;  3NHG A;  2XY5 A;  3SQ0 A;  4DWI A;  4E19 A;  4CEQ A;  3RRG A;  4O0J A;  1D8Y A;  1S1T A;  2E4L A;  2OPR A;  1JLE A;  1XI1 A;  2X6S A;  1ZBF A;  1TK5 A;  3F9K A;  3ZSO A;  2BDP A;  1RT5 A;  1HQE A;  4ZHR A;  3OVN A;  1DTT A;  1S9G A;  2YKM A;  4CHN A;  3OYN A;  1LWE A;  3KK3 A;  4GMJ B;  5DMR A;  4KB0 A;  4J2D A;  4M42 A;  1UWB A;  1EX4 A;  3K5O A;  3M8Q A;  4C8O A;  1U48 A;  1LWF A;  4GVM A;  4HTU A;  4B9M A;  4CJW A;  1NKC A;  3DOL A;  4FJ5 A;  1TV6 A;  1A5W A;  3NF9 A;  4FK2 A;  4CEO A;  3SUO A;  1ASU A;  1JXB A;  4ICL A;  3OJU A;  4B9U A;  4FZY A;  3AO3 A;  2G8I A;  4GW6 A;  3V9U A;  3QIN A;  4C8L A;  1C0T A;  3KIO A;  4I9L A;  1ZBH A;  3AA5 X;  3OYG A;  1JLQ A;  4FJG A;  3CG7 A;  1REV A;  1HYS A;  4KHY A;  3L8B A;  3CFR A;  5J2M A;  2Q3S A;  3OYK A;  4M45 A;  1JLB A;  3VQ6 A;  4CJV A;  3OYC A;  4RW9 A;  3HM9 A;  1NJW A;  4B08 A;  1L3T A;  2P5G A;  3KD5 E;  4B9V A;  4FJI A;  1Q9Y A;  1U04 A;  3CFP A;  1W9H A;  3NBP A;  4MFB A;  4Y1C A;  5HBM A;  2Y1I A;  2OA8 A;  2OZS A;  4AIL C;  4DU4 A;  4DMN A;  1L3S A;  1ASW A;  4TSX A;  4DU3 A;  4DFM A;  1LW0 A;  4W5R A;  4Q5V A;  1T8E A;  3SZ2 A;  4N5S A;  3DRR A;  3MXM A;  3EZ5 A;  4EP5 A;  2PYJ A;  4OLA A;  3MXJ A;  3BDP A;  1I3A A;  1S6P A;  3CM6 A;  4IDK A;  1TAQ A;  2OPS A;  3M8R A;  4HUF A;  3ZSR A;  4PA1 A;  2HHV A;  1JLF A;  3L2Q A;  3HPG A;  3L2R A;  4FJ9 A;  4ZTF A;  4FM2 A;  1BIS A;  3EYZ A;  4CHO A;  3OY9 A;  4LD0 A;  1RTH A;  2YNI A;  4PWD A;  1RT7 A;  4RW6 A;  1JXE A;  2GV9 A;  3UIQ A;  4MQ3 A;  3PV8 A;  1IKV A;  4FLU A;  4F8R A;  2F8T A;  1X1P A;  3NF8 A;  3NE6 A;  3DLB A;  4CEF A;  5KRS A;  3JSM A;  3DLK A;  3A2F A;  4H4O A;  5SWM A;  1NJY A;  2X6N A;  4Z4H A;  3T3F A;  4FJ8 A;  4M3X A;  3OS0 A;  2AJQ A;  5KTQ A;  4AHS A;  3LAK A;  1KCF A;  1CXU A;  3OYJ A;  4FLY A;  3AVJ A;  2OYQ A;  4KHU A;  3RTV A;  4K8Z A;  4PY5 A;  5CZ1 A;  1HQU A;  1VSJ A;  3LAM A;  4FJL A;  4DFK A;  4CFD A;  1NOZ A;  2Z1G A;  1S1V A;  3TAE A;  4CF9 A;  2F8S A;  4OLB A;  4KB1 A;  4PUO A;  1TL1 A;  4DSE A;  3QIP A;  4FLW A;  5HRN A;  1X9W A;  4DQQ A;  4ELU A;  2IOC A;  1RT3 A;  3B6P A;  4K8X A;  4FVM A;  4CHP A;  1SKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...