1DTQA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-1 (pett131a94)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-CHAIN
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/transferase
total genus 134
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dtqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dtqA05
4HCBA 4O0JA 4NLTA 3C95A 4EP5A 5C25A 3C6TA 1TV6B 1WAFA 4EZ9A 4N41A 4IG3A 4TY8B 2IAJB 3WNEA 5HRSA 2ETJA 5KFIA 4X2BA 5L9XA 3UDLA 1QQCA 4DU1A 3QO9B 3L2VA 4FJKA 3UQSA 2AGPA 4KSEB 2I5JB 4G1QB 4ED7A 5KFYA 1S1WA 3L2QA 4O3OA 3OL7A 4FJJA 4K4UA 3KHLA 3D0PA 1IKWA 3TABA 3D5MA 1UWBA 4KFBA 2GBZA 4TXSA 1JLAB 4IFVB 4MFBB 3SI8A 5T14A 5KT3A 1VSIA 1SL0A 2CKWA 4RW9B 3AVGA 3MXIA 1N5YA 4DFPA 3KLIB 4PQUB 2HHSA 5HLFB 3PO5A 3HSTB 4ZHRB 3GIIA 1ASVA 4B3OA 5K14A 4FM1A 4DFJA 1JLEA 1S9EA 5CYQA 4MKBA 3AVNA 1JX4A 3M8QB 4LD0A 2QKKA 3VN5A 1REVA 1BI4A 3SUPA 2IM1A 4WFZA 1HQEA 5C24A 1RDAA 4RNNA 3V1RA 5KG4A 2D41A 3ZSOA 4ZVHA 3K57A 4CJWA 1WLJA 2Q3SA 1S9GB 4M41A 1T3NA 4AHUA 2R2UA 2HHXA 3AVJA 2W7PA 4Q45A 4CJEA 1C1BA 3OHAA 1NJXA 1KSPA 4WXOA 2AQ4A 2XHBA 2IJNA 5KFQA 4NLPA 2C28A 3QZ8A 2CJQA 4NLQA 2FJXA 3SYZA 2P5OA 4O3RA 4FLXA 1DTQA 4H4OB 2IS3A 4RZRA 3KKRA 5KFVA 3E01A 4RW7A 3BREA 3V6DA 3ZSWA 2C2EA 4B9VA 1RT3B 4K4ZA 3K58A 3OYJA 3VQCA 1EKEA 3B6PA 4FBUA 3VQBA 1TP7A 4TQRA 4NYFA 1DLOA 1N6QA 1RT6A 2AX0A 5DMRA 4DG1B 4FM2A 1VSFA 4CEOA 4LQ9A 4FJ8A 2ILYA 4E7LA 5L1JA 4KKOA 4CESA 3HXMA 4K4VA 3MFHA 1A5VA 3DI6B 3T5KA 5EDWA 4FJ5A 1RT2B 3PV8A 3QGGA 4KV8A 4CJQA 5KFNA 1S5JA 3RAQA 4HUFA 4FBTA 4DL4A 2D7SA 3LPTA 2DFEA 4NYZA 4HUEA 1FK9B 2R8HA 3KNAA 2GV9A 3DM2B 1D8YA 4OJRA 2EX3A 1FKOA 5CYMB 5I42A 1SH2A 3OY9A 4CJ4A 3OS1A 2JLEA 2RN2A 1B9FA 4WYWA 3DRPA 2KQ2A 1C0TB 4KO0B 5DK5A 4CEDA 2HVIA 5KFXA 1C0MA 1C0UA 2YNIA 3RTVA 1BQNA 4C8MA 1KRPA 4EYHB 4LSLB 1UAXA 2BRLA 3PX6A 3GIJA 4Q8FA 4K8ZA 2Z1GA 3RAXA 4LSNB 4DTOA 3OYLA 4IRDA 1IO2A 4DF8A 4UQGA 5D3GA 3QGHA 4ID5B 1T05B 3PW2A 4RW6A 4CJSA 2HHUA 3OJUA 1HYSA 2W7OA 2G8FA 4F50A 3SCXA 2E4LA 1VSJA 5F8LA 5E41A 1IKVA 5FDLA 3F73A 4HUGA 3SV3A 2F8SA 3LP2A 2V9WA 3HP6A 5KT6A 4ECZA 4FK0A 2AX1A 1J9AA 4KB0A 4TYAA 3NGDA 5KT7A 3VQQA 3SQ0A 2DPIA 5KFZA 3VQEA 5DLFA 1Y97A 4RW8B 3Q8QB 3V9XA 1GOBA 2YHAA 2HB5A 5KFTA 4DQQA 3SJJA 5J1EB 3ZSYA 1RDBA 2FLNA 3MEGA 2R8JA 4DL3A 4NRTA 2BQUA 3VQ4A 4ECTA 1C1AA 2HHVA 1NK0A 4KHSA 4B9TA 2YKMA 3HPHA 3PY8A 4B8CA 5J2QB 4KTWA 3K5MA 3LPUA 3ZT2A 1TK5A 4KTQA 4CJUA 3IG1B 3PHEA 3DMJB 1ZETA 5J2PA 3WNFA 3V4IB 5JUMA 1NKBA 2YNFA 4CGIA 4C8KA 4E89A 3VQDA 1BISA 5J2NB 3HYFA 2G8WA 3RBDA 1TV6A 3OL8A 2IJFA 1JLFB 4TY8A 2IAJA 3S9HA 4FJ7A 1NJZA 3PW5A 3QO9A 4B9UA 4OGCA 4RNMA 4YP3A 4W5QA 3HO1A 4KHMA 2BE2A 2QXFA 2I5JA 4G1QA 3AA4A 1S97A 1W9HA 1WSIA 3QLHB 1HJRA 3OS0A 1TK8A 5DQIA 3KD1E 4TSXA 3TQ1A 4Z0UA 3SI6A 4Y34A 4QWEA 3CFPA 4ZP6A 3S3NA 3KK2B 2GIRA 3OYMA 3RB6A 3VA0A 2XRIA 1RNHA 3ALYA 1JLAA 4IFVA 4MFBA 4JUZA 4M3YA 1JLCA 4CJ5A 2PY5A 3BSCA 3N6MA 2ASLA 3C94A 3L3VA 1BIZA 1OS5A 4DSLA 4U7CA 3WNHA 3KLIA 4BE2A 4PQUA 1QSLA 4O3SA 5HLFA 5I3UB 3SQ4A 4QW9A 4KHQA 3RB3A 3L3UA 4ELTA 3DRRB 2R2TA 2HW3A 5HP1B 1FXXA 1R0AB 4FJGA 3OSNA 2G8UA 3TAGA 5KGWA 3SV4A 3H2LA 2IA6A 1TL3B 4KHYA 1QAJA 3M8QA 4FJHA 4QW8A 1Q9YA 5HRNA 2FBYA 4HCCA 5F8JA 1J54A 1T94A 3I0RA 1F21A 1RT1B 1RTDA 4XPCA 5KFHA 4FS1A 1S9GA 5CZ2A 2ATQA 3Q8SB 4KRFA 4CEZA 1IKYB 4E0DA 1IKXB 4CJPA 4KPYA 4J9SA 3M8PB 3OYCA 3RB4A 2QKBA 4YMEA 3G10A 4QCLA 4URSA 1S4FA 1S1VB 3KK3B 3OS2A 2IM3A 1LWEB 4NLGA 4LH4A 4F4XA 4WZMA 2GUIA 4FJNA 3FFIB 2OPRA 1S9FA 5L1IA 4QPXA 3OYNA 5FRMA 1TVRB 1SL2A 1L3TA 1RBSA 1RT3A 3VA3A 2ALZA 2D0AA 2JC1A 3SUOA 5EUHA 1S6PB 4R0EA 4O3QA 3Q8RB 5KG7A 3OVNA 4KAZA 4C8OA 3PJWA 4GMJB 4NLWA 3AVHA 4DG1A 3BJYA 2BR0A 2DFHA 3EPIA 3ZSVA 3DYAB 5KG5A 3VQPA 3TI0A 4MKAA 4RUAA 1BL3A 4N47A 3HJFA 3BQ2A 4RU9A 2R2RA 3LWMA 3MXMA 1L5UA 1K6YA 3QEPA 1MU2A 4CGFA 4E7HA 2W9AA 4RNFA 3ZSZA 1RT2A 2BGGA 1D9FA 2G8IA 1RTIB 4F3OA 1C1CA 2IBKA 3TAMB 1KTQA 4ED3A 2E6MA 5HBMB 2O5DA 1YT3A 2E9ZA 2YNGB 1FK9A 2VA3A 3KIOA 4ICLB 3H59A 3DM2A 5CYMA 4MIAA 4M3XA 1XI1A 5KFUA 4CJTA 3NGZA 1N4LA 3M9OB 4DS5A 5F8HA 3CJ5A 1C0TA 1HPZB 1RT7B 3DDKA 3HVAA 3MXJA 1S0NA 2VA2A 5KGXA 3NH0A 4CFDA 3O3FA 1S1UB 4NCBA 2G8VA 1UA1A 3RMAA 3EY1A 5C42A 3H5SA 3ASMA 2XCPA 1B9DA 4DMNA 2BQ3A 2VWJA 4NCGB 1TAQA 4LSNA 4JV1A 1NJWA 1LW2B 4ID5A 1T05A 2W9CB 4B8AB 1S1TB 3I8DA 2UVRA 1SKSA 4O4GB 2BQRA 2IM0A 4KHWA 3RRHA 3BSAA 3ZSXA 3MR2A 4O55A 2VG6B 4WXWA 2YHBA 3OL6A 3KLGA 3RRGA 3CWJA 3AVFA 4OKEA 1TKXA 3ISND 2GIQA 4ZP9A 3SZ2A 4FCYA 4FW2A 2KZZA 3G6XA 3MEDB 3CYMA 4GVMA 3LP3A 3HVWA 2KW4A 3VQ7A 2FVQA 3RB0A 4DTMA 4I7FB 2WRMA 4JS5A 4FJLA 5KFMA 3PX4A 4ZPDA 1VRUA 3QETA 3ZCMA 4O5BA 4RW4A 3B6OA 4E7JA 5J1EA 3K5LA 1IM4A 4KHRA 4DL2A 4OGEA 4ECWA 4CJLA 2XI3A 3AO4A 4IBNA 3N6NA 4QWDA 3V6HA 3RMBA 1IG9A 1D5AA 2IC3B 3M9NB 5J2QA 4F3TA 2E6LA 4WE1B 3V6KA 1TL1B 3IG1A 2W8KA 3DMJA 4MK8A 4EO8A 3V4IA 4K4SA 4BE0A 1NK8A 1QSSA 3L2RA 4I2PB 3O3GA 4B9SA 4IH5A 5J2NA 1VSMA 2HNZB 3HKWA 4B9LA 1JLGB 4J9QA 3AVCA 3AVMA 4DFMA 4TN2A 1O1WA 2BRKA 3NL0A 3OL9A 4NYNA 4FS2A 3IGVA 1S10A 4H8KA 1NK7A 4F4KA 2VWKA 4CJFA 2ZKUA 2RKIB 4Z4EA 3QLHA 1RT4A 4ZVGA 2VG7A 3V81B 1ASUA 1NK6A 1B92A 3GIMA 1EP4B 1U09A 4J9OA 4K4YA 4DSJA 3DLEA 3LDSA 3KK2A 5KFAA 2WHOA 3I5CA 3NHGA 3LAMA 1QE1B 3NAHA 1N56A 3SUQA 1X9MA 2PYLA 1WSHA 2KFNA 2ZQBA 1WSJA 3OLAA 1GOCA 1SH3A 3O4NA 3V9SA 4IH6A 4W5NA 1NHUA 3E51A 1L3SA 5KFKA 2V0NA 3NF6A 4J9LA 4ECYA 2B5JB 2C2DA 5DQGA 3HM9A 4XO0A 1S0MA 4E1MA 3DRRA 2XGQA 4CHPA 4WZQA 3IAYA 5HP1A 4FK4A 1TK0A 3FRZA 1BCMA 3V9WA 3NFAA 2Y1JA 2XY7A 2B4JA 3HPOA 1NJYA 4KE5A 5KFPA 3SPZA 4QOZB 4J2AA 1TKZB 4CIGA 4TLRA 4FW1A 4FLZA 2W9BA 5EU7A 2JC0A 4YR0A 3BQ1A 5F9LA 4BWJA 4YFUA 1RT1A 3HHKA 4ECUA 4IR9A 2HNDA 2X74A 1RTJB 4EYIB 1IKXA 4Y1DA 4PWDB 3M8PA 3NGIA 3JYTA 4ZP7A 4CJ3A 4F2SA 1K1QA 1S1XA 2FJWA 4J9PA 4O3NA 4Q5VA 2UUWA 3VQ5A 4DU4A 3QESA 1RAJA 1X9SA 3KK3A 4WFYA 3AO3A 1LWEA 2ZE2B 2IDOA 5KFSA 1TKTB 3FFIA 5EWFA 3BGRB 1T8EA 3AVIA 1U4BA 1BQMB 3G6VA 2RDIA 1KLMB 1KHVA 3TR8A 4Q8EA 4J9NA 3GYNA 2WONB 4ZPCA 3I5AA 5L1KA 3NE6A 3H08A 4I2QB 5F9NA 2X6SA 4N76A 1S6PA 3DOKB 3GV5B 1RCHA 1SV5B 4N56A 5DG8A 2P1JA 1XWLA 3D28A 1JLBB 3DYAA 4DSIA 2OPPA 3NDKA 4DSKA 1RTHB 1EETB 1WSEA 2HHWA 4O4RA 1RDRA 1QTMA 2UUTA 3AO2A 4FLVA 4M94A 3OLBA 2BANA 1RTIA 2IMWP 4Y3CA 4DTNA 1DTTB 3TAMA 1RBRA 4FJMA 3LP1B 4TYBA 4FVMA 4CHZA 3IN5A 4KI6A 5HBMA 4GC7A 2YNGA 2DPJA 3AA5X 2F96A 5F8IA 4ICLA 3IS9B 3KD5E 4YNQA 1SL1A 4RNOA 2B6AB 3L8BA 1N48A 3QIPB 3KLEA 4O44B 3KHRA 5KFWA 2P5GA 3KKSA 5CY4A 3C6UB 2C22A 1HPZA 1RT7A 3RWUA 4IG3B 1ZBIA 4B9NA 1KVBA 3G6YA 4LQ3A 3O4QA 1RT5B 2X78A 1S1UA 4ECRA 1NOZA 3DLGB 2XC9A 4U6PA 4CF1A 4CF9A 4QWAA 4FLTA 4J9RA 3SPYA 4NCGA 1WN7A 1LW2A 2HNYB 3H4BA 2W9CA 1S1TA 2D0CA 3SUNA 4CHNA 1JL2A 4JV0A 4IFYA 5HROA 2HHTA 2KFZA 2RF2B 3GILA 1UWBB 2UVUA 3CM6A 3LALA 2FVSA 2VG6A 1HNIB 4ECQA 1QUVA 4NLXA 4M42A 3VQSA 4ZP8A 3T5LA 1X1PA 3AO5A 4DS4A 1GX5A 3TAEA 1VSDA 3MAQA 4ZPBA 3KK1B 3MEDA 3EZUA 3I0SB 3KOAA 5SWMA 4ED0A 3RMDA 1N5YB 2XY8A 1SKRA 2D0BA 3V1QA 4ED8A 2AU0A 4OLBA 4IG0B 4IKAA 3AA3A 3QNOA 5KG2A 4QWCA 1VSKA 3GV7B 1VSHA 5JS1A 4NLOA 3OYIA 4KB1A 3DRSB 3GQCA 2IC3A 4E7KA 1NNDA 2PYJA 4WE1A 4K4TA 4AHSA 1TL1A 3ZT0A 1ZBHA 4DTXA 3OSPA 4DEZA 4DWIA 1YTUA 3H40A 4CFBA 1D9DA 4JRPA 4RW9A 4I2PA 4F4ZA 4RNHA 4K8XA 3SQ1A 2HNZA 4FJ9A 3KJVB 4IDKB 1G15A 1JLGA 1C1BB 3BSOA 1RDDA 3QIOA 4ZHRA 3PW0A 2W8LA 3ICLA 2AJQA 1BIUA 2YKNB 1GX6A 1NK5A 3M9MB 2FBVA 1DTQB 4F4WA 4AH9A 2UVVA 2RKIA 4CIFA 4RW7B 3VQ9A 1NOYA 3MFIA 4BDYA 1HRHA 3V81A 1I6JA 1ZBLA 1EP4A 3DLRA 2XGPA 2DFFA 3SQ2A 2FBXA 1N6QB 1RT6B 1T7PA 4E7IA 3U3GA 4CIEA 4ELUA 4EP4A 3K59A 4CECA 1S0OA 1QE1A 3KLHB 3AO1A 1HARA 4DL7A 4OKKA 3TAQA 1YVFA 3N6LA 3K5NA 2VG5B 3EPGA 1LWFB 4AHCA 1I39A 3PR5B 4NLDA 3LAKA 2R8IA 3OYDA 4FLUA 4J2DA 4HTUA 4H4OA 4Z4FA 4FM0A 4KV8B 2B5JA 3DLKB 1J5OB 4ECXA 4M45A 1ITGA 3CJ4A 3PJXA 4IRCA 4KHUA 4F2RA 4Y2CA 1TQLA 2Z1JA 4BDZA 3KHGA 1HQUB 5I42B 3KTQA 1NK9A 2WOMB 1RBUA 4OKJA 4WFXA 3KLFB 3V9UA 4FZYA 4DSFA 3H4DA 1C0UB 2YNIB 4RUCA 1S6QB 4MIBA 3A2FA 2XI2A 1Q9XA 2RPIA 3DI6A 2IM2A 1RTJA 1ZYQA 1XHXA 4I9QA 4PWDA 1L3UA 5KT4A 3VQ8A 4DF4A 1RYSA 2E9RX 4KB7A 4RW6B 4RG8A 1HYSB 3OYKA 2A1SA 4ZPAA 1U04A 4CEAA 2ZD1B 2ZE2A 1ASWA 3T5JA 4ED6A 1TKTA 4NLYA 2FVRA 3TAFA 3BGRA 4R5PB 1BQMA 4J9MA 1YTAA 5DGBA 4KO0A 3LP2B 1KLMA 4R8UB 3RR8A 2WONA 3IRXB 4I2QA 5KFRA 4URQU 4IKFA 4EBDA 2OYQA 4LSLA 1SV5A 5KG0A 4ECVA 1FKPB 1JLBA 2WCXA 2FJVA 4EBCA 3KMQA 3QERA 4FJXA 3EYZA 1EETA 4AHVA 1KFDA 4IOBA 1MMLA 5KFFA 4OPJA 4QWBA 4NLSA 1KVAA 2YKMB 3MTKA 1QS4A 4DTRA 3CJ3A 1SH0A 1JKHB 1DTTA 5EWEA 3LP1A 3CDWA 4OLAA 5J2PB 4OVLA 1Z26A 3IS9A 4RW8A 1ZBUA 1Q8IA 1LW0B 3QIPA 3H5YA 4O44A 4CK3A 5JS2A 5F8GA 4GW6A 2NUBA 1EXQA 1VSLA 4M3RA 2F8TA 1KVCA 4ED1A 3C6UA 2XO7A 2QE5A 4BDPA 2YNHB 4F4YA 2WK4A 4AILC 1RT5A 4DL5A 4PA1A 4NCAA 4JLHA 4CHOA 3DLGA 2BE2B 4LH5A 3MR5A 5F8NA 3SFUA 1BHLA 2OH2A 4H4MB 3GV8B 4CJKA 4BACA 4DQIA 3KHHA 3V1OA 2HNYA 1QAIA 2R2SA 4G3IA 4DTJA 3FQKA 1A5XA 2RF2A 3HVTB 1LAWA 2ASJA 3T1AA 2R8GA 5DLGA 4CK2A 3PZPA 4IR1A 1HNIA 4MK7A 4J2BA 3ULDA 4M3UA 2YV0X 3CQ8A 4ZVEA 1RDCA 3ITHB 3MF5A 1JLFA 4CGJA 3KK1A 1JLCB 2FBTA 3I0SA 4URGA 1BCOA 3K5OA 3JSMB 5KTQA 3G0ZA 1LWCB 3ZT3A 4Z4IA 4ED2A 4EBEA 4DQSA 1SUQB 4K4WA 3CIZA 4B08A 4CEEA 1L3VA 4IG0A 2J6SA 3KLVA 1QHTA 4E3SA 4J9KA 5L1LA 3ZSQA 1NKCA 1WNEA 4KI4A 3LP0B 3CJ0A 3DRSA 4KHNA 3NAIA 1RBVA 3NCIA 4EO6A 5J2MB 4CGDA 4ZTFA 1U48A 4CE9A 1WAJA 3NAEA 2RDJA 3I0RB 2Z1HA 1RTDB 4ZMMA 5KG6A 3DOLB 2HVHA 3CO9A 3AVLA 2OPSB 4CEFA 4W5RA 3KJVA 5KFJA 4IDKA 4NRUA 4DTPA 5I3UA 1LV5A 4L8RB 3UIQA 3QGIA 1JLQB 5KI6A 2Y1IA 1XR7A 4DTUA 4F8RA 2B43A 1HNVB 2YKNA 3PW4A 1R0AA 2OA8A 2HMIB 3TANA 2XWYA 3MEEB 2OZMA 2OPRB 5KFBA 2HHQA 1TL3A 4CHQA 3NF7A 3QNNA 4OL8A 4AHTA 3IGNA 2D3UA 2X6NA 3H98A 3EZ5A 2AGOA 1Z25A 3OYEA 4JRQA 1W25A 3OYFA 1SKWA 1JIHA 4CF0A 1IKYA 2FLPA 1U45A 3KLHA 2EC0A 4Y2AA 3CG7A 4Z4GA 4WYLA 3NF9A 2DY4A 2VG5A 3OYBA 4TQSA 3ZT4A 1LWFA 2WTFA 5KT5A 5EWGA 1T03B 3PO4A 3MECB 2HAIA 1JXBA 1S1VA 3CDUA 4DTSA 1MU2B 4CGGA 3DLBA 5KFCA 2D5RA 2R7YA 4MH8A 3WNGA 1WNSA 1C1CB 3DLKA 1TVRA 1J5OA 4Z4HA 3VQAA 1CXUA 5KG1A 4M95A 3FSIA 3VQ6A 1HMVB 1RA6A 3RBEA 1HQUA 1J53A 5C5JA 2G8HA 4KBIA 2XY5A 4GC6A 2ATLA 2WOMA 4B9MA 2KTQA 2OPQB 3ISNC 4IRKA 3KLFA 1KFSA 2V4QA 4Q0BB 1S6QA 1XR5A 5KRTA 3NKYA 4CEBA 3TARA 5C42B 4YR3A 4FK2A 3TAPA 3AV9A 3QEXA 3CFOA 1RYRA 4FZXC 5HRRA 4PUOB 1VK0A 4EEYA 3QEVA 5KFDA 3NBPB 4DL6A 5JXSA 1VRTB 2JEFA 2ZD1A 1WSGA 4CEQA 3KLGB 1QSYA 4NLVA 5C25B 2JEJA 4R5PA 4CF8A 3C6TB 4C8NA 4HVJA 1TKXB 3OHBA 4R8UA 3O3HA 4O3PA 4CJVA 1WSFA 3IRXA 2O4GA 3QIDA 5F8MA 3M8SA 1VRUB 3H5XA 3CVKA 4DLEA 1S1WB 1XR6A 4RW4B 1FKPA 4Z4CA 1U47A 3NH1A 3MR6A 4HYKA 2DTUA 4QAGA 4CFAA 4FYDA 4O4GA 1IKWB 1TAUA 4CJRA 2E9TA 5KFOA 1I3AA 4KFBB 3SNNA 2FLLA 4DLGA 3NGYA 4CF2A 3QZ7A 1RBTA 2C2RA 1X9WA 1C6VA 1K1SA 4YR2A 1JKHA 2PZSA 4ECSA 4Q43A 3F9KA 4ELVA 1CSJA 1IH7A 5T7BA 4I7FA 4CFCA 2UVWA 1LW0A 3QEIA 1XHZA 3ZSRA 1CLQA 4NLUA 4M3WA 2ITGA 3AVAA 2KZMA 1JXLA 1NHVA 3PR4A 4K4XA 3AVKA 3HPGA 4N5SA 5KT2A 1CZ9A 2YNHA 3FDSA 3S3MA 2V4RA 3HT3A 2XCAA 4B3OB 3LZIA 5K14B 2IOCA 3QYYA 4C8LA 3RMCA 3L2UA 1JLEB 4H54A 1EX4A 1S9EB 5CYQB 3UPFA 4PY5A 2F8EX 4DQRA 4JV2A 1KLNA 4H4MA 1REVB 1RT4B 1BI4B 5DQHA 2VG7B 2EHGA 1HQEB 5C24B 5FROA 5HRPA 2G8KA 2A1RA 4CCHA 4J2EA 3NMAA 1A5WA 3DLEB 3HVTA 2FVCA 1VSEA 3MR3A 2QK9A 4CHYA 3CJ2A 3AVBA 4ZTJA 5KFGA 2O4IA 1Z4UA 2XY6A 3ITHA 1HYVA 3CFRA 3I5BA 4KTZA 3JSMA 2HWHA 3LWLA 1LWCA 3Q8PB 3HVRA 3T3FA 3U3YA 1SUQA 3DLHA 2AGQA 3H5UA 1GOAA 4HKQA 2AWZA 5DG9A 4Q44A 3E01B 3V6DB 2LSNA 3FQLA 2P51A 4YQWA 3LP0A 2GC8A 2ILZA 4KAIA 4AHRA 3OJSA 1KHWA 4DU3A 5KRSA 5KG3A 2FVPA 3U6FA 1DLOB 1UA0A 4XPEA 3TVKA 3V9ZA 3PW7A 3BDPA 5J2MA 5CZ1A 4MK9A 1S49A 2IGIA 1HYZA 2I1RA 3QEWA 2R8KA 4FXDA 4OPKA 2W9BB 4IH7A 3ZT1A 1UOCA 4KKOB 1YVUA 3G86A 1NKEA 2BDPA 2HNDB 5DG7A 1D0EA 3DOLA 4NZ0A 3D45A 2OPSA 2D3ZA 4CERA 3OYGA 1C2PA 1CZBA 3JYTB 4W5OA 2HWIA 1ZTWA 1S1XB 1JLQA 4M3ZA 2W42A 1RA7A 1TKDA 1HNVA 4DSEA 2HMIA 3OYAA 4K50A 1FKOB 3MEEA 2JGUA 4FLWA 3M8RA 3BQ0A 3P5JA 1TGOA 1TKZA 3DRPB 4M3TA 5FRNA 1NK4A 4HHTA 3T5HA 1BQNB 1KCFA 1S48A 3LANA 2QV6A 3SFGA 3P1GA 1BGXT 4ZVFA 1U49A 2WB4A 4I9LA 1JXEA 2J6TA 2OPPB 5D3GB 4XIUA 3HK2A 4FJIA 4O0IA 3L2WA 3PUFA 4CK1A 1T03A 3MECA 1D1UA 3QINA 3UR0A 4E19A 4JS4A 4MQ3A 1IKVB 5SZTA 3RR7A 2BANB 5FDLB 1RILA 4NLRA 3BSNA 3THVA 1ZBFA 3TWHA 1W0HA 3PVXA 1HMVA 3S3OA 3DOKA 1LAVA 3KLEB 4Y1CA 3T19A 4ID1A 4LY7A 4KREA 2OPQA 3MEGB 4FZZA 1JL1A 2J6UA 3P83D 4DFKA 2Z1IA 1RTHA 5KFLA 4Q0BA 1XC9A 2FC0A 2JEIA 2ASDA 4E1NA 4TY9A 3V6JA 2JEGA 3CM5A 3PX0A 3AA2A 3KMSA 4EZ6A 3HP9A 4IQXA 4FLYA 3GIKA 3NF8A 3HL8A 4CGHA 4BE1A 3OYHA 3LZJA 4W5TA 3NH2A 3K2PA 1CXQA 4PUOA 5KFEA 1ZTTA 5DGAA 4IFYB 5HROB 3BR9A 2YNFB 4DQPA 3NBPA 2B6AA 1VRTA 2OZSA 3CDEA 4BWMA
chains in the Genus database with same CATH superfamily
4AL5A 5IWAJ 4HCBA 4NLTA 5C25A 3CI5A 1BLUA 1WAFA 4O5FA 1HBUB 1YUWA 2MEWA 3WNEA 1UTAA 4ZVSB 2ZJQL 4X2BA 1UVJA 4FYVB 3QO9B 4QOTA 3OFHA 3UQSA 3GJQB 5BPLA 2AGPA 4KSEB 4LF4J 1S1WA 2W40A 2QO3A 1T9YA 4FJJA 5D0RA 1T9TA 5GADU 1KVKA 1OMSA 4KFBA 4OX9F 3BYRA 4X64F 4B3SK 3MCOA 3UD3P 4MFBB 4W90B 2MZSA 1U6ZA 2CPFA 1VSIA 1SL0A 4AYBD 2CKWA 4FWQA 4RW9B 4CWBA 3VEWA 4U8VA 3MXIA 5M1KA 2HAFA 2E88A 4KJIA 1N5SA 5HLFB 3PO5A 4ZPWR 3RSEA 3EM1A 2D74B 4ZHRB 5EX5A 1BQXA 2DPNA 1SPBP 1ASVA 4B3OA 3I96A 3L9ZA 5KPZA 3WEEB 2C2NA 1IVZA 4JV5F 1JLEA 1Q0NA 4DV7K 3AVNA 3MM9A 5B0EA 2Q1NA 4D3HA 3SUPA 4MIWA 3MM6B 4WCEQ 3NOCA 2Q43A 2QIFA 3ZSOA 1DJ0A 1SC4B 2LXIA 5LM7E 3K57A 2NNWA 4ZK7M 1WLJA 1FEHA 2MY8A 3OTCA 1FFGB 4JI2J 4AHUA 3AVJA 4DKWA 3H3OB 1UJ5A 5IZHA 4P71A 4DR7J 2Z57B 3CD6N 2IJNA 5KFQA 4N8OA 3M1FA 3MURP 4OPAA 3SCKE 1NGJA 1Q79A 2P5OA 2FJXA 3SYZA 2QTDA 4O3RA 1GLAG 1A9NB 4JV5J 3OXGA 4FF4A 4JI0F 4X62K 3J7A1 1FRKA 3E01A 5T7LA 4QYZJ 4HWIA 2BJ8A 4I0WA 4NMLA 1TP7A 2PE8A 3KG0A 1VQNS 1OVQA 3H2UB 1X5PA 1SI9A 4DG1B 5HVGA 1ZAXA 4FWOA 1SJ3P 4LQ9A 3R5BA 3CJAA 3UKUB 3ZTQA 2HRTA 2CA9A 4CESA 1WEZA 3MFHA 4H5VA 4CLKA 5EDWA 4FJ5A 2E5LF 3H0PA 5AQTA 1T02A 1RT2B 3HHLD 4DV1F 4KV8A 4M5LA 5KFNA 1QQOA 3R2DJ 1TUUA 4DL4A 4PAAA 3UKRB 4A2BA 2PMZD 3LPTA 2DFEA 1FK9B 2WBRA 3CJ9A 4DV0F 5AXKA 3LM9A 4OI3A 5L8RC 1FE0A 2GA7A 1XBWA 1NG9A 2GVZA 5AT1B 4EK2A 4DPYA 3OS1A 3J7ZO 2ACMA 2JDJA 1NAQA 2HSEB 2KQ2A 4X66F 1I94F 4OHYA 4CEDA 4U8YA 2YNIA 2JX2A 4FSVA 3QFHA 5B0BA 5L39A 1CJTA 3N4QA 2QGFB 1UAXA 1MWKA 3FGUA 5F41A 4K8ZA 4LFAK 2V4JB 2KXFA 1IO2A 1T05B 4DV1J 4AQYJ 4CJSA 1HYSA 2W7OA 4X4UA 3EGZA 3JAMU 1X0PA 4CNYA 2E4LA 1VSJA 2R7WA 5F8LA 3I9V9 1FX4A 4RU2A 2AP1A 1XERA 1YGYA 4MTPA 4ECZA 4KB0A 3NGDA 3VQQA 3SQ0A 5K5MA 1T3VA 3Q8QB 1HNWF 1J5EK 2O66A 4DR5K 2P9GA 3IUCA 2EG2A 2R8JA 5D8HB 4HTIA 1ZH5A 4MKVA 3BH7B 1NO8A 1C1AA 1NK0A 5M1QA 4F02A 4BC5A 4BG8A 4B9TA 2YKMA 4KTWA 3LPUA 2ABYA 2CGKA 1TK5A 3I6PA 2A6OA 3PHEA 1VHFA 1HNZK 4NXMJ 4QS8A 2VFVA 1EQ0A 4Y2MA 3V4IB 1ZPVA 3SEOA 2CPDA 4M5JA 1BISA 3EL2A 3BB5A 1B0TA 3RBDA 1GEHA 1TZ0A 4TY8A 2IAJA 2EVZA 2G9OA 3S9HA 1K44A 2V2KA 1NJZA 3PW5A 2CNKB 3MMCA 3J7AP 2P9SA 2BE2A 2BYCA 3AA4A 2GAGC 1W9HA 5AQFA 4X4OA 2HWTA 4WF9L 2D69A 4Z0UA 3SI6A 4Y34A 3FZHA 2V2VA 7AT1B 3KK2B 3CMEN 3CD5A 2XMWA 1ZC6A 4IFVA 2QYCA 5GADI 2ASLA 1Y5IB 3L3VA 3LA0A 2IVFB 4DSLA 4U7CA 1VMBA 4BE2A 5AQXA 1VQ5S 4QBUA 2AYEA 4QW9A 5F3ZA 3RB3A 5ADXA 2HW3A 1RGIA 3I4PA 4ZS6A 1TL7A 3UVJA 3J80O 4JKDA 3BZKA 5KGWA 3H2LA 4QIGA 4DR1J 3M8QA 3J7YP 4QW8A 4IDHA 3MZIA 3Q8VA 2DR6A 1RT1B 2KI2A 1U0HB 3U8XA 1HI8A 3CD6S 1S9GA 4J9SA 3C3LA 2ZH2A 1QDUB 3KDNA 3OT9A 4NWBA 5H9FK 3G10A 3W8GA 1M1KT 3L7PA 4PZVA 3SSSA 2UU9J 3SBMA 1MWQA 2FQQB 1S1VB 3KK3B 2PIIA 4LH4A 2PA8D 2X51A 5FRMA 2OTJN 1SL2A 1N36J 1RABB 1HBMA 3RW6A 2V8VA 3SUOA 5FLXU 3ZNJ1 3CCLS 2A41A 1OQ6A 5KG7A 3OVNA 3QRQA 2P9EA 4ZIVA 2LEBA 3DYAB 2IJRA 3TI0A 3CO0P 1HIYA 1X8DA 4U96A 4RUAA 3CDBA 3VOVA 1BL3A 2JWNA 1VGYA 4AFFA 3HJFA 2R2RA 3MXMA 1OIAA 2YX1A 1GTHA 1K6YA 2NRVA 1RKJA 4IJAA 3QEPA 4E7HA 5K8NA 3LDQA 2BGGA 3NVKA 4BC4A 1D9FA 2G8IA 4F3OA 2IBKA 3R1HA 2E6MA 4ED3A 1FWPA 4R25A 2XSJB 5HBMB 3WQUA 4WCEL 2NXJA 1YT3A 3M1VB 3N4WA 2IYGA 2RU9A 4PXBA 2B8PA 5ETTA 2WVBA 3HFKA 5CYMA 2O8DB 1XI1A 3NGZA 3QBXA 1N4LA 1AUDA 4DS5A 5F8HA 4M5IA 2ZOFA 1SQEA 2M2BA 5AJ3F 4I4BA 4OZ0A 3A3PB 2OKQA 2E5JA 1CLFA 4DHVA 4NCBA 3RMAA 2ZOGA 1Y4ZB 4KGXB 3EY1A 1F3VA 3ASMA 2XCPA 1B9DA 3T1HF 3FFKB 2XNQA 4ZDNA 3VENA 4JV1A 1R89A 1NJWA 1LW2B 2EG1A 2IFXA 2LQJA 2CADA 1ZM4A 2IM0A 2NRTA 2G2OA 3JQKA 3ZEUB 2JL9A 3MR2A 4JI6K 3OL6A 3QMQA 4J91A 2UXDJ 4B3TF 3EXYA 3ISND 2GIQA 1BD6A 5AQYA 2VKZG 3P45B 3LP3A 2FVQA 3OVAA 4JS5A 4FJLA 1UJ4A 3QETA 3CCJS 3ZCMA 4O5BA 2ROPA 2P9CA 3B6OA 5J1EA 3M2RB 3VERA 1IM4A 2V50A 3UD4P 1N5TA 2XI3A 4IBNA 2IVNA 1D5AA 5A8KA 2GO9A 5J2QA 5BYSA 1HQ2A 3N4PA 4NYPA 3TR5A 3V6KA 1TL1B 4ES3A 1IXKA 1QJHA 5JVGQ 3TU5A 2XHCA 2AV5A 5AZJB 3O3GA 4B9SA 3Q0AA 4IH5A 5J2NA 1C4CA 3HKWA 2QFJA 3AVMA 2BACA 4DFMA 2HRYA 2XS7A 4OHXA 4WP9A 3VF0B 5F3TA 2KVQE 5IT4A 3CMAS 3OL9A 4FS2A 3BKTA 2ZBIA 2OFGX 2AD9A 3QWPA 1VISA 2VWKA 4DR4K 1K8KB 4CJFA 1N88A 3NP5A 4DV7F 1RT4A 1P27B 5I3QA 4XTTA 3RBZA 2JZ5A 1U09A 3C19A 3AAQA 5E3CA 4B3SJ 3LDSA 4HLBA 2WHOA 2DK2A 3LAMA 5HQMA 1QE1B 2ZHOA 2L9WA 4HEA9 4Z7YA 1UL3A 3OLAA 3O4NA 3V9SA 3K0SA 3D6HB 5D0HA 4IOCQ 2I2YA 1GK8A 2PAVA 3E51A 1U1MA 5KFKA 5CHCB 4LT6A 1N8RO 3DHXA 1S0MA 4E1MA 4X62F 4P52A 4WZQA 2QRRA 4NYOA 3IAYA 3V2UC 1NH7A 4DV7J 2V2ZA 3D6RA 1PJ5A 1BCMA 1UJ6A 1FEEA 2VV5A 3M2UA 3NFAA 5ADZA 2K1RB 5KFPA 2HIQA 4J2AA 4FW1A 4OI6A 2ZZNA 2E20A 5ADXH 2DJWA 4YR0A 4BWJA 2K06A 3CETA 1BMQB 2X74A 4UY8O 4PWDB 3M8PA 3W9HA 5BRFA 1UZDA 3GG0A 3PYDA 1OY6A 3A5OC 4O3NA 3R7NB 3OW2M 4DU4A 3CC4N 2QYGA 2CDRB 1RWOB 1HR0J 3VVUA 2XLIA 2RUSA 3AQPA 1TKTB 5IT9Y 2GHWA 2MGZA 2LU2A 2E2PA 3VEXA 2WONB 4ER8A 3I5AA 1HWJA 2RHQB 5L1KA 3C6AA 1JJ2R 2X6SA 4N76A 2GWKA 5DG8A 3E9PA 1JLBB 1HD0A 2YCHA 1BE4A 3NDKA 1F2GA 1S57A 1EETB 4LFAF 3B4DA 2EK6A 3EX7B 1DHMA 3QICA 1F9HA 3HHLB 5K8MA 1QTMA 2Q31A 3SCIE 3TX0A 2UUTA 1Y5NB 3AO2A 2HZVA 4M94A 3O9TA 2IMWP 1BG3A 1DTTB 3TAMA 1QHAA 4FVMA 4UUWA 3TA0A 4KI6A 4OYPA 4GC7A 5HSPA 2YNGA 3AA5X 2HFUA 2LQ8A 3KD5E 4YNQA 2WSEC 3VAIA 3L8BA 3QIPB 4ETZA 1IBCB 2O8BB 4BRQA 2P5GA 2ERRA 3CJQA 1VC0A 1J5EF 1IQZA 3BO3A 1ULRA 3AA8A 1HPZA 1RT7A 2RVJA 4QZVB 3W2VA 2ADBA 1ZBIA 4BG9A 2P5VA 1KVBA 3G71N 5HVHA 2DGWA 4QR1A 2X78A 1S1UA 4ECRA 1S6UA 1NOZA 2XC9A 4CF9A 1OH8A 5A2QO 3F2KA 2UUCK 1HWLA 3ET6B 1SIWB 2W9CA 2DHGA 1S1TA 4LVOP 1P6TA 1Q18A 5HROA 1HNZF 2KFZA 2RF2B 2VG6A 2FJAB 2XZTB 2JFKA 1QUVA 4M42A 3A0IX 3AO5A 3HCXA 1VSDA 1U2FA 3MAQA 3W65A 4H0OA 3TSQA 3KOAA 4DR5J 4N8NA 3C2PA 2XY8A 5LSRA 4RBUA 2PA3A 3BDEA 4ED8A 5CCMA 4OLBA 4IG0B 3AA3A 4FKXA 1VQYA 4NLOA 1KAZA 1M5SA 1AW0A 2IC3A 3BN7A 3GJTB 4CD3A 2GGPA 2DIUA 2A3JA 2PYJA 1QQNA 2Z2MA 2W41A 4K4TA 2CH6A 4A8FA 3ZT0A 1ZBHA 2JSXA 3H40A 3BBFA 1QZ5A 5BJRA 4JRPA 5CH7B 4I2PA 4CLUA 1S5ZA 2Y0SD 4IDKB 4LFBK 1JLGA 4XH4A 4C9DA 1RDDA 3PW0A 4C2MA 1VBYA 1CS4B 1H98A 4Z7CA 2AJQA 1GX6A 4I6MA 3ZFVA 2Z56B 3M9MB 5I9EB 2KM8B 3W2WA 4EWTA 3HSGA 4GVBB 2RKIA 1RHKB 3C6HA 3WC0A 4RW7B 4PHTX 5KQDA 2O8EA 2V7ZA 4M63A 3GFZA 3TQEA 2MHNA 4C0BA 3CCSN 1G99A 1T7PA 4E7IA 1YBAA 3U3GA 4LFCK 3K59A 1S0OA 3KLHB 1K0VA 3AO1A 2RHKA 4R79A 2VQEK 1RISA 4AHCA 3U9ZA 4YB6A 4YEAA 3D0HE 2WSCC 1NPKA 5LT5A 4Y0FA 5BRHA 4FLUA 2LDYA 4IWVA 1FE4A 4H4OA 4FM0A 2BM1A 3DLKB 4KIAA 1R8CA 4LBIA 3IWNC 4JD2B 3CJ4A 5JVGL 3UFCX 2DGUA 1AB8A 4BDZA 1RCXB 3KHGA 2DB1A 5I42B 1VAZA 2IRXA 3AJDA 1RBUA 5F1XA 1BO5O 4OKJA 4UZCA 4BRDA 3OR2A 1N0UA 5HAOA 4OJHA 1HFEL 3W9JA 4RUCA 5FJ4A 5HQ8A 3A2FA 1NGFA 1M5HA 2CVEA 4DBQA 5DDQC 1XHXA 4I9QA 3CC4S 1L3UA 3VGKA 3TTFA 1HBNA 3FCVA 2QXLA 4USHA 4DF4A 4U7UD 2EFGA 2LEAA 1RHQB 4JI1K 1BC6A 3CJKB 2YQ1A 2ZD1B 1X3MA 3EVOA 2FVRA 2D0PA 3BGRA 4R5PB 3A8JA 4HDHA 3LP2B 2MMYA 3DJCA 2Y1RI 2F7VA 2C2KB 5GAEP 1XNRJ 3RW7A 2NSCA 3DDIA 4IOCL 5E3AA 5KFRA 3D1HA 3SSRA 1SV5A 3TZXA 2KT5A 1Y3KA 3K2YA 3DOMA 2ADCA 2DNQA 1VLOA 2FC9A 3KKFA 3J7YU 3F44A 1HLUA 3KMQA 5JLFA 2KFYA 4CIOA 1U24A 1N32K 4BBYA 1MMLA 5KFFA 4X4NA 4OPJA 4QWBA 4DTRA 1P9YA 3MM7A 1RAOA 4FPRA 3OD2A 1CPZA 5EWEA 4JI6F 2YX7A 1U6BA 5J2PB 1GXUA 3MPDA 4FKYA 5C2DA 5LJ5Y 1Q8IA 1W26A 1VQ4N 2O8CA 3W0LA 3G71S 2P9KA 3VV2B 1VSLA 2F8TA 4EUVA 1JCGA 1WJ9A 2AYBA 1FTRA 1RT5A 2B56A 2YI1A 1VQ9N 4LH5A 4QIEA 5IFMA 3RJMB 4YHHK 3SFUA 1BHLA 3O1BA 3EE9A 4H4MB 4BACA 1XJWB 2BUNA 4V19S 2E7WA 3V1OA 1QUPA 2HNYA 4RBVA 4KBOA 2R2SA 2GQQA 2GUPA 2E2QA 3QFPA 4CI6A 4C0HA 4G9ZA 2Y8WA 2B51A 1WI6A 3ATVA 1LFPA 1OH7A 3OTEA 1NGHA 3PZPA 1V4TA 4IR1A 1HNIA 2PFUA 4ANDA 2H5IB 4AUKA 3KK1A 2RILA 1JLCB 3IDHA 1EHWA 3PFOA 4DUTA 2KKZA 2VF3A 2F9TA 3DLJA 2OI2A 1WD6A 3ZT3A 4DQSA 3VHQA 2MZJA 1O51A 4B08A 4CEEA 2J6SA 3KLVA 1QHTA 4ZCKA 3D2FA 1XN9A 4DR4F 2UUAJ 4EGLA 1NKCA 3LP0B 3ILLA 3R6LB 5E3RA 3BF1A 2D9OA 3KWMA 3NCIA 4H5RA 1IBKJ 1YZ7A 5HJYA 4ZTFA 3DCAA 4DR3J 3NAEA 1Q5VA 2Z1HA 3J81Y 1BU6O 2YXLA 1TYQB 4A8WA 3CC2N 2XMKA 4NX9A 1WUUA 3AVLA 5BN9A 3KJVA 4A62A 5AR0A 2E1RA 1N8RT 1WSVA 3LPEA 3QGIA 1JLQB 5THWA 2Y1IA 3TRGA 2B43A 2YKNA 1R0AA 4F0KA 3HFVA 2OA8A 3B8HA 3TANA 3BGUA 2XWYA 3MEEB 2B9EA 4CHQA 2HBKA 3NF7A 5A0YA 2E7VA 3CCSS 2VQFJ 3H98A 2X6NA 3HSJA 5BR9A 2P9IA 1CG2A 1KS2A 4JRQA 2GAHC 3HFZB 5AQNA 3OYFA 1SKWA 3ULEA 4C6AA 2XMJA 3THWB 1IKYA 1VBXA 1K8AO 1U45A 2EC0A 4UY8T 2CJKA 2GZOA 3HRGA 1CJKA 4ZKAA 3R6GB 5DO2A 3ZT4A 5AQOA 2WTFA 3UE2A 1T03B 1JXBA 3QATA 1HBOB 4BRGA 3W9IA 3CHWA 2MZTA 4ATNA 4MH8A 2GJFA 4LRDA 1E4FT 1CXUA 2KRRA 3MPYA 3UN5A 1VBZA 8RUCA 2ZBCA 3A1YG 3MN9A 4KR0B 3M6XA 5IM0B 1WF1A 4PKGA 2ATLA 4B9MA 4NLBA 2B9YA 3I9ZA 2B7BB 5BPNA 1A7GE 3K89A 4Q0BB 4E2FB 5CXTA 3MUVP 2GJIA 4OI2A 1UVLA 5RUBA 2P9UA 2F40A 1RBAA 4YR3A 4DV5K 3AV9A 4I67A 3QEXA 2NLXA 4CD1A 1RYRA 5HRRA 4PUOB 1VK0A 2F7TA 3VR1A 3MCSA 2V8HA 5KFDA 4DL6A 2MKCA 4K41A 3P39A 4EFHA 3C16A 3KLGB 2FDNA 1QSYA 5C25B 5IT0A 1TKXB 2I6WA 1XNQK 2DRAA 2QLXA 4R8UA 2YH1A 2F63A 4CJVA 1WSFA 3D7EO 2F8HA 2QMWA 5LOQA 4BY9C 2P9LA 1FRIA 2X3DA 1VRUB 1VC5A 2H9ZA 2BW2A 5F0XA 1S1WB 1XR6A 4RW4B 1FKPA 1D9AA 4JI3J 3EXCX 2GV1A 2B4VA 4CFAA 1KKHA 3D7SB 2XMVA 4DN9A 4FYDA 1E3MA 5IT9O 2J0WA 4KFBB 3SDEA 3SNNA 4WQ5A 3TPQA 3QZ7A 2CG8A 4NASA 2C2RA 3PIOQ 2ZM6F 1K1SA 3HI9A 3QT5A 3J7YI 3EGVA 2PZSA 3SSQA 2D4WA 2R7VA 1CSJA 4I7FA 3OFGA 3M6VA 1PCAA 3J80U 3FZKA 4AM6A 2KZMA 1JXLA 3HPGA 3RSEB 3CJSA 3I55N 5KT2A 4A4JA 2YNHA 2EK1A 2V4RA 3HT3A 1WTFA 2XCAA 4B3OB 2DNZA 2MQMA 2IOCA 3QYYA 1JLEB 3ETOA 1EX4A 3FR0A 2UUCJ 3MM9B 4PY5A 3KWIA 1UCNA 4DQRA 3P31A 4DX8H 1H1VA 3R5GA 5HRPA 2G8KA 2RSQA 2A1RA 4B17A 4CQ1A 4CCHA 3BO2A 1IR0A 3NMAA 2B4PA 3MR3A 1L3KA 1RDWX 2QK9A 4ZTJA 3AD8C 3FSYA 5ETQA 3I5BA 3VQTA 4LFBF 3DGPA 3JSMA 4HACA 2C2OB 2KVIA 3MM8A 3Q8PB 1YJNS 1YJUA 3HVRA 1LCUA 1SUQA 3DLHA 2B8QA 2YWEA 1YJTA 4HKQA 4CBUA 2AWZA 2VIHA 3E01B 5T7LB 2VDHA 1UEKA 2KKHA 3CMQA 3A8YA 2EWHA 1OY8A 2GC8A 5AQKA 2EXUA 4KAIA 3OJSA 4AHRA 2FVPA 2SXLA 1XIQA 4XPEA 1R27B 2ZDOA 3MXHP 2H4YB 5J2MA 2B0GA 4MK9A 1LOTB 1S49A 1RGVA 5CHIA 4N7TA 3CC2S 4OPKA 1X5SA 4LFCF 4IH7A 2Z58B 1UOCA 2XO6A 1YVUA 1NKEA 2G2YA 1IBMJ 5GAHP 5B08A 1T95A 1D0EA 3DOLA 1NNEA 3OYGA 3JTPA 1NLVA 3JYTB 3X1LB 4W5OA 3G82B 1XMOK 1S1XB 3SJHA 3JS9A 4GVLA 4QR0A 3OUYA 3CXCR 1KTVA 2GVZB 2V51B 3BP8A 3M8RA 4NPOA 2VHGA 1U6FA 5GIOA 2YKPA 1Q82O 2EWSA 5HOOA 2OD6A 4CW7B 2P2CB 4LFCJ 3C65A 1S48A 2YH0A 2QV6A 5IC4B 3HBTA 1CJTB 1BGXT 3WT0A 3M30A 2R3VA 4N77A 4I9LA 2VQEJ 4CI0B 3HM8A 2Q6BA 3TZZA 4XIUA 3BV8A 4FJIA 3L2WA 4ZIWA 2ZUAA 3QINA 5B0AA 1RBOB 5DRKA 2BANB 3JSBA 1ATRA 2HQ3A 2H51B 4NLRA 3GTYX 5F0UA 3THVA 3JTOA 4MLEA 3TWHA 2KHOA 1CC7A 1U02A 4XAKA 1J27A 5HMYA 1VIOA 4EU0A 2LDIA 1HMVA 1LOUA 5JMNA 3S3OA 1K73O 3OTOJ 4BC2A 3Q23A 1O13A 1ITPA 4LY7A 3VGTA 1ZM3A 1K47A 2J6UA 3P83D 3MN7A 2Z2LA 5KFLA 1XC9A 3ETMA 3BO4A 3EZWA 3MR7A 1AROP 4KH4A 5L46A 5HMXA 1N5QA 4EZ6A 1N32F 2VC0A 1KAXA 2HZAA 3HL8A 1EZZB 1PILA 2MZRA 4QU7A 4WTOB 4JI1J 3K2PA 1CXQA 1Y11A 2DXDA 1ZTTA 3VGUA 5CE3A 5DGAA 3R1XA 4CRJA 2MLYA 2B6AA 2V2QA 2YVSA 2HK3A 4BWMA 3T9NA 2E2OA 3QT7A 4BC9A 2WBNA 3C6TA 4FN5A 4N41A 3M6WA 4OYMA 4ZVPB 4BVPA 1V5IB 4TY8B 2IAJB 3C7NA 1FT8A 1D8ZA 5KFIA 2WVCA 2HS3A 1VS3A 3UDLA 4USUA 4DU1A 4USWA 3MMCB 1FESA 4FJKA 2P9SB 2P9PA 2BJDA 2XMUA 2ASMA 1TL4A 2QLFB 3GE9A 5KFYA 3L2QA 1N32J 4O3OA 2XMTA 4M5HA 3KHLA 3UNGC 1RLCL 4HTJA 5GAGP 3TABA 4NI2A 4MT1A 4L75A 1NMEB 3WX8A 3OA9A 2BABA 4TXSA 2GFFA 5M2UA 3SQGA 1VDHA 1GNKA 3FEZA 4IFVB 3AY0A 1YDLA 1R3NA 3UI3A 2J4RA 3LDNA 4BRHA 2HQCA 1N5YA 3TSUA 3PEJA 1S7IA 1VOMA 3HSTB 4NB4A 1JJ4A 1XQIA 2DRBA 2A42A 2V6AA 1IWAA 1U1NA 2BTFA 3EUNA 5GAEU 4FM1A 2UV8G 4YHHJ 1YWXA 1UVMA 4MJKA 4ZJQA 2PFFB 1JX4A 1EARA 1Q7LB 3GE1A 3M8QB 2OGUA 4A46A 2QKKA 1REVA 1BI4A 4BVOA 4MO4A 3V1RA 3BUZB 4R0JA 1XTZA 2NR0A 1VJWA 3FZFA 1VQ7N 4CJWA 1YZ6A 4A8XA 2K8GA 1S9GB 4ES2A 4K0KK 2QL9B 2CPEA 1FNMA 1C1BA 3OHAA 2AQ4A 4RUHA 1FDBA 1TUWA 3IR6B 4P2FA 3S1TA 3TEGA 3AAPA 4FPAA 2C28A 2ZH7A 4CZEA 1DTQA 2R7RA 1JQGA 2IS3A 4I56A 3PIOL 3V6DA 3M32A 2WVEA 4K4ZA 3K58A 3OYJA 1HBMB 3VQCA 1EKEA 2PFDA 3B6PA 3J7Z5 1X9JA 4TQRA 4X4QA 1DLOA 1N6QA 1RT6A 3W60A 5FPNA 4OJGA 3MDQA 1S59A 1K8AT 1FJGF 1AYEA 3Q24A 4CEOA 3GWCA 2ILYA 4E7LA 4LF2A 1MDUB 2MKHA 4BRIA 4PKHA 3DI6B 5F2RA 1QAXA 1G3OA 3PV8A 3QGGA 1UAWA 3RAQA 4HUFA 1JNRB 5E2QA 2D7SA 4NYZA 4XDDA 1DQ8A 1NSAA 2W4PA 4OJRA 2EX3A 4UT4A 5CYMB 3KDOA 5FPMA 3H7HB 1UW4A 2E1CA 5LMUK 3J81O 5A2QU 1NZ8A 2RRAA 3B8AX 3GLJA 4KO0B 3RU0A 4WIQA 2MKYA 5KFXA 3KJNB 4LF9K 1C0UA 3IA0A 1BHNA 3RTVA 3G96A 3EE8A 1RAGB 4C8MA 2CG4A 3IC1A 1QAYA 1O0PA 4LSLB 3WXJA 2BRLA 3PX6A 3CB4A 4Q8FA 2Z1GA 3RAXA 3MN6A 1VQLN 4DTOA 4DV5F 3OYLA 4IRDA 5AQHA 3MM5A 4UQGA 4OHVA 4B3MK 2HHUA 3QWUA 2BE9B 3VF6A 1HD1A 1IKVA 2BJEA 2K2PA 3F73A 4HUGA 3SCJE 1FA0A 4ZCIA 4I68A 2V9WA 3HP6A 1F1BB 1A6LA 1P8GA 5KT7A 1XNQF 2ZKTA 5KFZA 2DPIA 1Y97A 4M63C 4RW8B 4M5MA 3V9XA 4JEPA 1GOBA 3CCWA 2YHAA 4HHHA 5A6WA 4M1KA 4DQQA 5J1EB 3ZSYA 2FLNA 3MEGA 2BJ7A 1VC6A 3FKBA 4DL3A 4JI4F 2AYMA 3VQ4A 2ALYB 4DV5J 2HHVA 2XLKA 5ETKA 2XYPB 3U7JA 5A8KB 1IBLF 4RKUC 2ZZTA 5AE1A 5J2QB 1RWKB 3OVBA 3C14A 1XUPO 4JK8A 1G7CB 2LYVA 3EZOA 2IBOA 1FERA 4UTGA 2NPFA 1M5OC 4DZ6A 2P8IA 3ADAC 3G87A 3ZETB 1UVKA 3ENQA 1UVNA 4E89A 2DVIA 3SXLA 5J2NB 3NGSA 4OQJA 3B4MA 1XNQJ 1PC5A 2G8WA 2DNRA 1TV6A 2WVDA 3OL8A 1JLFB 1DQAA 3JAMO 2UZAA 2QLBB 1N34F 3MOZA 4RNMA 4YP3A 3PFEA 3BZCA 5IXUA 1KD1O 2I5JA 3NRBA 2FHJD 1S97A 5D4PA 3PSFA 3GSIA 2WSFC 3OS0A 1TK8A 5DQIA 3KD1E 5D4NA 4QWEA 1WC6A 5B09A 3MPWA 3W5YA 2GIRA 3OYMA 2LA6A 3QT6A 4OZLA 3RB6A 1YJWN 2XRIA 1RNHA 1V5VA 3THYA 2NXEA 1NPRA 4M3YA 5KPRA 2H65B 2G0JA 2C3PA 1ROFA 4JOUA 3N6MA 3MUTP 3C94A 2JLGA 1APSA 4LF1A 1OS5A 4J9UE 4FP9A 2KYZA 3KLIA 2MTLA 1GMWA 2WW8A 1FW6A 2GVDA 4KHQA 4I6YA 2ASPA 2APOA 4A61A 1FXXA 1Q81O 4FJGA 1NU4A 2DNKA 3M2UB 2G8UA 3TAGA 3SV4A 1PO6A 1VQ7S 2UUBF 4KHYA 4DMZA 4FJHA 4QIWD 1OPIA 3CIMA 5HRNA 4KGKA 4DV4K 3T9ZA 3EMTA 1GXTA 3I0RA 2ROGA 2HBYB 4XPCA 5GAEI 4FS1A 5CZ2A 3Q8SB 3M8PB 2B9XA 6FD1A 3RB4A 2QKBA 4YMEA 4YY3K 5CCLA 4QCLA 4USKA 1S4FA 1XMOF 2IM3A 4FO0A 4WZMA 4BR0A 2GUIA 1NGGA 2MGZB 1S9FA 2FSNA 5L1IA 3GG1A 3OYNA 1VLYA 3VZIA 2X1BA 2VYPA 2GMJA 4OYZA 4LF8K 1RE1B 3VA3A 2ALZA 4BR9A 2NUUG 1CVJA 3PJWA 4HHUA 4NLWA 3BJYA 2DFHA 3EPIA 3VQPA 3FMWA 3V5RA 3FZBA 3A5LC 2DH8A 4CGFA 3ZX0A 2OD4A 4FYWB 3ZSZA 1TMJA 3HI0A 3TAMB 4M7YA 4HT5A 4PXDA 2O5DA 2YNGB 2CVIA 3ENVA 3H59A 3VGMA 1CEZA 1M0SA 4MIAA 2A5XA 5KFUA 3NNCA 4WFBL 4CJTA 3MAAA 4CO0A 1YIJN 5D4LA 4JKGA 3CJ5A 1C0TA 1HPZB 1RT7B 4G1IA 4MO5A 4NO7A 3DDKA 3W2VB 2A0FB 5KOWA 3HVAA 3JXOA 5KGXA 3ID8A 3NH0A 4ZLJA 1VQLS 3O3FA 1VR6A 3W8PA 1S1UB 2G8VA 2ZWOA 2I38A 5C42A 2IDEA 4B1XB 2BQ3A 3OXLA 4K5RA 1RAIB 2RHSB 4LSNA 4LF4K 2W9CB 1S1TB 3I8DA 4OJ3A 3W66A 4O4GB 2C2MB 1S79A 3ZSXA 4ES1A 5GAHU 2VG6B 4DR2K 2MSTA 2C3UA 3VTIA 1PJ7A 1Q7YO 4ZP9A 3SZ2A 5JJBA 3CYMA 4GVMA 4OYXA 4LIRA 3VQ7A 4DTMA 2WRMA 4KC5A 4CDIA 4JHDA 1DY3A 2FTRA 2J9CA 3AOAA 1PSDA 3K5LA 3QFUA 1J2VA 2H54B 3N6NA 3RMBA 1IG9A 2IC3B 2GGPB 3M9NB 1G6BA 2HZCA 3LDLA 1VQKN 3GCWP 3FZ2A 3DMJA 4MK8A 2N82B 1VQPN 4CLLA 4K4SA 3ZZYA 1NK8A 1QSSA 4I2PB 1YJVA 3P5BP 2YQ3A 1TMMA 4A57A 4ZLLA 4B9LA 1JLGB 2OP5A 3MD3A 3G25A 3LTOA 1W7AA 2XYHB 4JI2K 2KHDA 3NL0A 4NYNA 4DR7K 4B1YB 4I6MB 1S10A 3I31A 4LREA 1NK7A 1CZAN 3W2WB 1K0TA 4FZVA 1T9UA 1UFLA 4BRFA 2RKIB 2VG7A 4BLGA 2CQGA 1UVIA 4K4YA 4J9OA 2A18A 1R7IA 1SQGA 4DSJA 4QYZK 4FWKA 4FWLA 1TUGB 3R7SB 3I5CA 3NHGA 4JNEA 3NAHA 3E3XA 4K0KF 3SUQA 4WU3A 3ENHA 1WSHA 5TKWA 1JXVA 1F6TA 1GLCG 2ZQBA 1F9EB 1GOCA 4C8YA 4W5NA 3MD1A 2FF3B 4PYAA 4L74A 5DQGA 4XO0A 1EX8A 2XGQA 4NZ6A 5HP1A 1TK0A 1NBWA 3FRZA 1XMBA 3LDPA 2WB1D 2Y1JA 3V9WA 2XY7A 2L08A 1KVJA 2B4JA 3HPOA 2Q3PA 2MJNA 1F60B 4CVNE 3ILOA 3SPZA 1TKZB 4CIGA 1V3RA 2W9BA 2W2MP 5SUHA 1C0GA 2XS5A 3BQ1A 3O08A 2V34A 1X4GA 3HHKA 4WK1A 2A40A 1H6KX 2GELA 4EYIB 2IVPA 2DCLA 2R7UA 4CJ3A 2YTCA 1EQMA 4UOHA 4DR6K 2FJWA 2O8FA 3SAFA 3WXLA 1EJ7L 1JMTA 1RAJA 4AQYK 1X9SA 1LWEA 5KFSA 4FWRA 3FFIA 3S7RA 7FD1A 5KOXA 3BGRB 4PL8A 3AVIA 4DUYF 2CQ0A 4FWNA 1TELA 4C98A 3GYNA 4OMFG 5LMUF 3AARA 4ZPCA 5F9NA 1VQSA 3BGLA 3O1WA 5IT9U 1S6PA 3WQPA 3DOKB 2AJ2A 3GV5B 2O01C 4LF9F 2G2ZA 1SV5B 4LR9A 3DOMB 2E66A 4LF7F 1WSEA 2HHWA 3CCVN 1RDRA 2CZVC 3QPIA 3WIUA 2QL7B 3MM7B 1RTIA 5H1SV 2JRSA 1A0OB 4RTFD 1RBRA 2N3OA 3Q7CA 4FJMA 4TYBA 4CHZA 5AQGA 5A8WB 2DPJA 1YIJS 4BR5A 2HFOA 1YXQA 5A6PA 3I56S 1SL1A 3KLEA 2O8CB 3KHRA 5KFWA 2P9KB 2EFOA 3BH6B 3J8AA 2V5HG 5CY4A 3RYLA 4UW2A 1YI2N 1X7VA 1NLKL 3I82A 2C22A 3RWUA 4IG3B 2FJDB 2E5GA 4B9NA 2AZ3A 1W2BM 1U25A 4P2SA 1RT5B 1UMJA 1YBTA 4NMXA 1FKAF 5AZIA 2V94A 2R7QA 3O6QA 4B3MJ 4J9RA 4LMZA 1WG4A 3HOSA 3P49B 2HNYB 3P4UB 4TU7A 4GV9A 1E6VA 2PGCA 4OLPA 2HHTA 2YHXA 3GILA 1UWBB 1S99A 1HNIB 4QU6A 2NYIA 3T5LA 3HULA 3UE5A 3TAEA 3KK1B 1DBDA 1X4DA 3QT8A 2H5JB 1QLNA 4ED0A 3AJ2A 1BWVA 2RQMA 1KD1T 3CEDA 2HLUA 2AU0A 4H03B 1UEVA 3D2FB 4IKAA 2HK2A 3QNOA 5KG2A 3DAWA 2KXNB 4RO0A 4A8SA 5A76A 1VQKS 3NMUA 1VQPS 2V52B 2QLWA 3O3LA 4DR1K 3HT0A 4NOHA 2QWRA 4DWIA 4CFBA 4RW9A 4H5NA 2J9EA 2WUSA 2HEKA 4JKCA 1JJCB 1QVFR 3SBTA 3KJVB 1CJUA 3GU0A 2ZC3A 3KXDA 4ZHRA 2QA1A 3ICLA 3U4LA 2YKNB 2UU9K 2XYGB 1Q81T 4QS7A 2ZBRA 1B0VA 5A0YB 3O9SA 5LMNJ 3IFRA 4LBPA 4BDYA 2P9IB 3V81A 3NVMA 2MJUA 1LKZA 4DQ8A 2Q79A 4DV4F 4E98A 1N36K 2CGLA 2DFFA 1FNXH 1Z2LA 2GHPA 1R8HA 4C11A 3TAQA 1Q16B 2HGMA 2VFUA 4U67Q 1NUEA 4M5GA 2D0OA 4YY3F 1I51B 3PR5B 4NLDA 3GCXP 3LAKA 1D3WA 2R8IA 3ENBA 3OYDA 2ZH1A 3KHYA 4HTUA 3H8YA 4Z4FA 5FLXY 4HL9A 1M1KO 1U8WA 4RWWA 1W97L 3MMAA 3ZZZA 1ITGA 3VAGA 3PJXA 4JK9A 2NRZA 1TFWA 3B78A 3E8OA 4F2RA 3A8KA 3Q83A 3NLCA 4LF8F 4USVA 4DV4J 2Q36A 1F5CA 1T44A 4KY3A 4WFXA 1J6ZA 3V9UA 4BROA 4FZYA 3TUIC 3UKUA 2DNYA 2P9UB 4MDAA 2RPIA 1DEJA 3TA1A 4LR8A 4CBXA 4YY3J 1YHQN 3LW5C 4OV6A 1VI7A 3QNWB 4KB7A 4RW6B 4P2MA 2H48B 2R4FA 4ZLNA 2A1SA 3DN9A 1U04A 4BC3A 4CEAA 3C16B 4IQMA 1NGDA 2NRXA 1BQMA 4R8UB 1KLMA 2CQDA 2UXDK 3GL1A 3PG9A 5IWAF 4I2QA 5LSLA 4DCOB 3NCQA 4Z2XA 2J0XA 4V1Ak 4URQU 3DRYA 1VHXA 5KG0A 3C0BA 2UXCJ 1FKPB 3EGWB 3ENWA 3VAFA 4EBCA 4DV3K 5C0YA 3S8SA 2LA4A 4AHVA 1KFDA 2GTDA 4LF4F 3SDEB 4DI6A 1KVAA 4F67A 3MTKA 4K7QA 2IIHA 1WWHA 4M7XA 3CJ3A 1SH0A 3VAMA 3SAHA 4D3GA 4W92B 3CJRA 1YAGA 4DR2F 4KQZA 3LP1A 3THTA 4GY2B 4OLAA 1Z26A 1Q7YT 3TO8A 3LDOA 2F9JA 3D1QA 3BM7A 3FMBA 1ZBUA 3CJ1A 4OYBA 4AXIA 3H5YA 4CK3A 5F8GA 1T9VA 4G65A 4GW6A 1EXQA 1X60A 4ED1A 1GMWD 1FWLA 4BDPA 4X65J 2YNHB 3G8TA 3O5BA 1U8SA 3AHPA 2WK4A 3SIPB 4LRFA 5L9NA 4PA1A 4FNIA 4JLHA 4EAHD 3DLGA 3H25A 3ELHA 4KGVB 3MR5A 1HPMA 4Y2KA 2LMIA 1SQFA 2I7PA 2FZCB 4DZDA 4PKIA 4DQIA 3RUBL 5GMKa 4OPHA 3KVGA 5D15A 5BREA 4F0MA 4DTJA 4DR2J 1HWUA 1A5XA 2ASJA 3T1AA 3BYPA 3UDVA 2BBEA 4KPCA 2E5HA 4KHPJ 1RDCA 5EHHA 4ZLPA 3I0SA 4URGA 3E1YA 4JI2F 3DGPB 3JSMB 4HACB 2OO4A 4AE5A 3ZZUA 3MM8B 4DR7F 4EBEA 1SUQB 1L3VA 4MYUA 3PSIA 4PKDB 1YRTA 5L38A 5L1LA 3DRSA 3BGOP 1VQ5N 3NAIA 4FF2A 8ATCB 1RBVA 5BYQA 1M5VC 4IO9Q 5J2MB 3TOQA 5E84A 3VGVA 2CPXA 1NJIO 3X3UA 4RCHA 2VH7A 1WAJA 2JLFA 4B3RJ 4DU7A 1MWYA 4ZVRB 1MMNA 4CYUA 4C3KA 1RTDB 2ZDPA 1X4HA 3H1VX 5KG6A 3DOLB 2HVHA 3CO9A 4CEFA 3CW2C 3W3SA 3DXBA 1RCOB 1YJ7A 4JP8A 3MK6A 1YITN 1W2IA 4L8RB 3NG8A 3J81U 3WQTA 4F8RA 2OELA 4F04B 3OUYB 2MQNA 3BEXA 2OPRB 5KFBA 1Y7PA 1P8ZA 1HR0K 4OL8A 5KPTA 5KQ8A 3EZ5A 3LH2S 2AGOA 1KXPA 2V8PA 5AQJA 4A2AA 2MKSA 1W25A 2CGJA 3FBBA 1X4BA 2Y3YA 2VCPA 3M30B 1JIHA 1NDCA 2HHHK 1TUYA 2FLPA 2VFSA 3GFYA 4OZ3A 4Y2AA 4WYLA 1GAOA 3D2EA 1QZ6A 3NF9A 1GLJO 2DY4A 2DH7A 3CCMN 3CCLN 4TQSA 1LWFA 2HIYA 3PO4A 2HAIA 1FXLA 2OFHX 3TW0A 1S1VA 1NDLA 2IVYA 1MU2B 2DNLA 4DR6F 2FHOB 2B7CB 5EX0A 1IV0A 4A8QA 1RK8A 1QVGM 1HNXK 2R7YA 4AQYF 4A48A 1WNSA 5BR8K 1C1CB 2Y1LB 3WIVA 3Q2TC 1J5OA 3WX4A 1JK9B 3VQAA 1FDNA 2U1AA 1AT1B 4CLTA 1HMVB 4CH1A 3L6QA 4NEZA 1J53A 3UN3A 1YG0A 3AD9C 3BEGB 3AQOA 1BWEA 4IRKA 2VD3A 3TWZA 2G4BA 1YHQS 1X31C 4PABA 2PT0A 2IPOB 2CZ9A 4CEBA 1T6CA 5CAAA 3U27A 4FK2A 2F65A 2WZ1A 2BZ2A 4DR6J 5C2GA 4YB5A 3M1VA 3SLCA 2PC6A 3D9BA 3LOUA 2AIRB 3IMQJ 3CCUN 2CDQA 2BJ3A 3DNCA 2HFVA 4NXMF 4CEQA 5C7PA 3LGNA 4NLVA 1HI0P 2R9LA 4CF8A 3C6TB 4C8NA 3OFEA 1WBBA 3O44A 4U67L 3CJBA 3A13A 5FPEA 3IRXA 2ACYA 5F8MA 2P9PB 1FO1A 3M8SA 2FB0A 2I8EA 2X7IA 1UFWA 3P8BB 1U47A 1Q78A 3GSDA 1S0VA 5MLCV 3CCJN 5B0CA 3QMLA 3SAGA 4CJRA 4NI2B 2E9TA 4PXCA 5KFOA 1I3AA 3NGYA 3ZEUA 4JYAK 1ESVA 1X9WA 4NA1A 4LF5J 3SQGB 3SMSA 4ECSA 5I3PA 1U2VB 3LF0A 3IP0A 3F9KA 5BRDA 4ELVA 1UPMB 1H3DA 2M8HA 2Q66A 3PKMA 5ETLA 3QEIA 3ZSRA 4NLUA 1RHMB 2Q2RA 3AVAA 1S3XA 3HZEA 3PR4A 2LEPA 2COLA 1RKIA 1MROB 2WFBA 2MQPA 3K9KA 1SVDA 3S3MA 2F4VJ 5ETVA 1PBUA 3TVZA 5C2CA 3UPFA 4HI2A 2PN6A 3D66A 3CMAN 1REVB 1FDAA 1BI4B 5D6GA 4DR1F 1R6YA 3QSIA 3U02A 3DLEB 3HVTA 2FVCA 5AZJA 3P6YC 2DGSA 2CPHA 2Z2ZA 3MPVA 3CJ2A 4OHWA 2XY6A 3ITHA 4OYIA 4OZ2A 4P7TA 1KQSM 1NB2A 4UOGA 2HWHA 1OH6A 3LWLA 3D4JA 1MWMA 1WHYA 4WQ4C 3T3FA 3LGMA 2UU9F 5DJBA 2AGQA 1F5AA 5H9EK 3V6DB 2LVWA 3VETA 5IS2A 1HWIA 5KG3A 1DLOB 4C3LA 4C7QA 2LU1A 3V9ZA 3PW7A 2PEBA 1N36F 2DD8S 3GJSB 2M52A 1HYZA 2YHWA 3QEWA 2R8KA 3PNIA 4FXDA 1MMDA 1ZAVA 4KH5A 2LQ9A 3ZT1A 2OHDA 2CNNB 3BPSP 3G86A 1YITS 3SCLE 2BDPA 3THPA 3KZBA 2QJ3A 2D9PA 2HNDB 2HVDA 4X4RA 3W1YC 2RB7A 4M5DB 4NZ0A 3D45A 2OPSA 4CERA 2A10A 3Q89A 4BRMA 1YJ9S 2J9DE 3D54A 2E29A 2HWIA 1ZTWA 2CQPA 3A8EA 4CTAA 2W42A 4L73A 2FPHX 1HNVA 2RU3A 3P4IA 3UNYA 3P96A 2JGUA 4FLWA 2QSWA 5LY3A 1MN9A 3P5JA 1HKCA 4PWWA 4MKYA 3VMFB 4CZIA 5FRNA 6AT1B 4HHTA 2J0QD 3DU5A 1KCFA 3FLCO 3SFGA 3CCMS 1XNRK 4ZVFA 2CJBA 1U49A 3R8EA 1R59O 1JXEA 2OPPB 1Z2ZA 2DY1A 5ETSA 3H20A 3MECA 1D1UA 3UR0A 4E19A 5DS7A 3AAWB 4IO9L 3PCOB 2VPYB 1IKVB 2NZTA 5JMVA 1RILA 2DR8A 5B0GA 1XMQK 2QEXN 4HH0A 3OFFA 1YX2A 2UXDF 1LAVA 3TEHB 3C15A 2J7UA 4CM0A 2OPQA 4UZBA 3MEGB 4FZZA 3QAUA 4DFKA 2Z1IA 3Q2SC 4ENOA 5M1NA 3TTDA 2ASDA 4TY9A 3HHLA 2DR5A 3HP9A 3NF8A 4PEOA 1WB9A 1H73A 2AW0A 3C14B 2VC1A 3GOIA 3CCUS 4W5TA 4NA2A 2ZC4A 2AHOB 2BOPA 2RH3A 4IFYB 2OMOA 3I87A 4I6AA 2EFNA 4FOIA 1VRTA 3G9CA 3CDEA 2O8BA 4K2XA 2VL1A 4O0JA 2DO4A 3IBFB 1GLLO 4NA3A 1TV6B 4EZ9A 3SMZA 1QQCA 2QFIA 3UO0A 1BWFO 1NBEB 2XQCA 2I5JB 4QIFA 2QMUB 4DV3J 1CJVA 1VFJA 3MAHA 3OL7A 2AA4A 4K4UA 3CNQP 1IKWA 1RLDA 4OX9K 3R5DA 4RX6A 2UUAK 2WW4A 4F3MA 2CRLA 4L6V3 3VEZA 9ATCB 2MKJA 1M1GA 4X4TA 2QWOA 1IBKK 4B3SF 2Q6CA 5T14A 1ZOTA 2BXJA 5KT3A 4I1TA 4DR3K 3T7ZA 3AVGA 2VOPA 2ZH6A 5EXWA 4DFPA 3KLIB 2HHSA 2Z30B 4UOCA 4BREA 2N3LA 3OXFA 2V8GA 3RG6A 3GFHA 2W01A 4DFJA 1S9EA 4QQBA 2P9NA 4BRNA 3AA9A 4TKTA 2CPYA 4KGZB 1NJIT 4WFZA 1HQEA 5C24A 1RDAA 4RNNA 5KG4A 2VQFK 4ZVHA 3AH6A 2Q3SA 4OLOA 4ED4A 4Q45A 4X4SA 1NJXA 4WXOA 3AB2B 1MLAA 1JNZB 4ERDA 2CJQA 3CTRA 4C48A 4FLXA 4XDCA 3MMJA 3I32A 4RZRA 3KKRA 3GONA 1OWXA 2F3JA 4RW7A 3BREA 3ZSWA 2C2EA 4B9VA 1HR0F 3H46O 5ETMA 2KJVA 3UN2A 2A2CA 1GLBG 4FBUA 3VQBA 1NSQA 4NYFA 2AX0A 5AQLA 2RDDA 1URNA 3FEXB 2HG4A 4CH7A 3JTNA 4FM2A 4MYTA 3R9LA 4H0YB 1S7HA 2KG0A 2KLAA 4YB7A 4FVUA 2JH3A 3DC2A 3ENAA 3HXMA 1A5VA 5D4OA 4FYXB 3R3TA 3PHTA 3T5KA 5H1SQ 2AZ1A 1RBLA 2IRUA 1YK9A 5K20B 5C12A 2K7JA 3W3DA 2NUHA 1S5JA 1RU1A 4U7UK 1HNXF 4JD2A 5BR8F 4HUEA 3HSCA 4V19J 2R42A 2R8HA 3KNAA 1D8YA 5I42A 3GJRB 3R2CJ 2PI4A 3QQCD 2JLEA 2XLJA 3MAAB 3D68A 1B9FA 4WYWA 5IV3A 4JKGB 3DRXA 1C0TB 4OI4A 2HVIA 1C0MA 5IQ6A 1BQNA 2HHHJ 1KRPA 4FNHA 2CUYA 1M5PC 3GIJA 3W63A 1KOOA 3IWLA 4LSNB 4DF8A 2E1PA 4JI3K 1JCEA 3OJUA 2VGNA 2DEJA 3SCXA 2P6TA 1HNXJ 3K5PA 3JB9k 2QEXS 2BJ9A 4FF1A 5BR8J 2KRBA 1KONA 3K9JA 4ZA1A 3QRPA 1IG8A 5FDLA 1BY9A 3SV3A 2F8SA 3LP2A 3NNHA 4WKYA 4I64A 5KT6A 1WF0A 2AX1A 1J9AA 1FI4A 2OJ3A 1F2HA 3VQEA 1R8PA 4JHDB 3VAJA 2HB5A 5KFTA 5LXRA 4CLWA 3RZAA 3SJJA 2KHCA 4DR5F 3OPKA 4F4AA 4NRTA 2Z0GA 4HVZA 1HKBA 1NHKL 1WG1A 3JSYA 1K9MO 2BW7A 2KJWA 3K5MA 2LQBA 4KTQA 4JYAF 4CJUA 3M8YA 3DMJB 1SKUB 2OEKA 1ZETA 5J2PA 5JUMA 1CULA 2FJBB 2YNFA 4CGIA 3R97A 4DV2K 1RAFB 4DUZJ 2ZNZA 3VQDA 2YKOA 3WC2A 3HYFA 1OYEA 4EHTA 4H4KC 2IJFA 4ISGA 1VQMN 2XHWA 4B9UA 4JAXA 4OGCA 4U95A 4W5QA 3HO1A 1V9OA 2BJ1A 5AQPA 2W25A 2YWKA 4G1QA 1SB6A 1WSIA 3BY5A 1X4FA 1HJRA 1AZSA 3K8VA 3POTB 5B0FA 2WTUA 1FCAA 1IJFB 4ZJOA 4IFEA 4JYAJ 4ZP6A 3S3NA 3DGVA 5FPDA 2QTWA 3VA0A 2O3DA 1RWXB 2R7OA 2R7SA 1JLAA 1GLEG 4L3QA 3MDFA 3AJ1A 5F0WA 1SAZA 1JLCA 2GMLA 3NNAA 4Y28C 4BHQA 3EKSA 1B0PA 4L76A 1IBMK 4LUBA 4DCJB 3WNHA 1QSLA 4PQUA 4O3SA 3D3BJ 5I3UB 4NXNJ 2J7WA 4ELTA 1T11A 1U1RA 5HP1B 3WBZA 4USIA 2ZBQA 1RP5A 4DCHA 2IHR1 1E4GT 1B7YB 2CQ2A 1TL3B 1WF2A 1QAJA 1Q9YA 4CM2A 2FBYA 4HCCA 5F8JA 1J54A 3T41A 3KUEA 4RL1A 4ZPVR 2HBRB 2D1KA 2DRDA 3GG4A 2ATQA 3LGHA 4IZ9A 1MA9B 4FPBA 4CEZA 4B1VA 4CJPA 1OYDA 3ZZTA 4Y00A 2DHSA 2O8FB 3QBWA 4DHYA 2U2FA 1LWEB 4BQLA 3JS6A 5H9EJ 4FJNA 3FFIB 2DHXA 1Y9OA 3UDCA 1ZXOA 4QPXA 1TVRB 4BRKA 3PLAA 1L3TA 1U26A 1RBSA 1RT3A 2QT7A 3CE8A 3I8BA 2CJXB 3M6GA 5EUHA 1S6PB 4R0EA 4C1NI 4KAZA 3THWA 3WHIA 3ZSVA 5KG5A 1XNRF 3OTOK 4ZPTR 4NZ7A 4WTYA 4MKAA 3IMXA 3LWMA 1L5UA 4IOAQ 3CCTA 1HBOA 1T0TV 1YLXA 2HS0A 2ZWHA 2NZ4A 2BA9A 1RTIB 3GBTA 2PEHA 4Y65A 5AQUA 2UXBJ 2XULA 1OKJA 2VA3A 2CYYA 3U9DA 3DM2A 3Q7BA 4H5TA 2E8AA 3W5XA 1WDDA 2ZFHA 4OX7A 3HJVA 1WSRA 1WACA 3MXJA 3BN4A 4DX7A 4PG6A 1S0NA 4FWSA 4ILJA 2XZDB 2VA2A 2QC3A 1UA1A 2GS8A 3H5SA 5C2FA 1Y3JA 4DMNA 5DETA 2D3OR 2VWJA 4IJNA 2QL5B 4ID5A 1SKSA 1LNQA 1E6VB 5HK4A 4O8UA 4BRAA 3BKUA 3NCRA 2RD5C 3BSAA 3B6BA 2NRHA 4WXWA 1XMQJ 3KLGA 2PDAA 2RNEA 3CWJA 4C23A 1WOQA 4OKEA 1TKXA 1DGKN 2DIVA 4FCYA 1RHRB 3G6XA 3NOGA 1VQON 3OW2R 3RB0A 5EX3A 5KFMA 4BQZA 3FSXA 2ASYA 1VRUA 1ATNA 4RW4A 4YOTA 4E7JA 3VCDA 5AE2A 5G0RA 4DL2A 2MHEA 4OGEA 1BUXA 4ECWA 5E5NA 3AO4A 1FXRA 2WVFA 4QWDA 3MMVA 2HFSA 2ZH5A 2J5AA 1Q5YA 2UUAF 4J8FA 1MG7A 3IG1A 2FC8A 5I4MA 5LJVA 3IWXA 1AFJA 2ZJPQ 2EBGA 1ZM2A 1IBKF 3L2RA 2HPUA 1VQMS 2P6SA 1KQGB 4ZN3A 4DR3F 1VSMA 5LJWA 1EIYB 3L7UA 3IAS9 1CJUB 1OH5A 4J9QA 3AVCA 2XTJP 2LP4A 1JJHA 4TN2A 2BRKA 1KVIA 2XSFA 1X5TA 3QGPA 3IGVA 4PG8A 2QI2A 4F4KA 3OV7A 5AQZA 5JLHA 3DDNA 3QLHA 1PKUA 4RWTA 4AT1B 4ZVGA 4OX9J 3RRKA 4X64J 3ZX2A 3V81B 1ASUA 1TR0A 3MMBA 1YJNN 3GIMA 4A8KA 4CO4A 4YOYA 3SMPA 5E3PA 4CLYA 2VQFF 1FD2A 4LRAA 1LWXA 2KT3A 4C11B 4OYOA 3CD7A 4HTLA 4U7BA 1OSDA 2MLZA 2F5GA 4X4PA 1B3TA 2KG1A 2PO4A 1L3SA 2MKKA 2V0NA 1PIEA 2CJ9A 2C2DA 4YDXA 3IM9A 4WU2A 4OZNA 3MMAB 3HM9A 3DRRA 1AUSL 1WC4A 3T6JA 3KG1A 4LSZB 3ISZA 4UUXA 1NJYA 4KE5A 2KL8A 3BF4A 1DURA 4QOZB 5EU7A 1F9FA 4CO2A 2JC0A 5F9LA 4YFUA 4ECUA 2F8MA 4IR9A 1FFWB 1GH8A 2AT1B 1LXJA 4I69A 1IKXA 4Y1DA 3L4BC 3FBEA 2L9DA 4XEIA 5J1NA 3JYTA 4TU9A 4F2SA 3G82A 2CJAA 5A2QY 4ILGB 1S1XA 4JI0J 2DKOB 4DPOA 4Q5VA 1V4SA 3QJPA 4WFYA 1FX2A 4U9RA 4MLHA 1P9QC 3ZTSA 5EWFA 5E33A 3N5BA 1T8EA 1RXOB 1BQMB 3G6VA 3SBGA 2RDIA 1KLMB 3TR8A 4P74A 4Q8EA 4AL7A 4J9NA 4XK8C 3JQMA 3NE6A 1BA1A 4I2QB 3M2VB 2AJ1A 2DISA 3DXKA 2HBQB 1VHIA 1XWLA 5MLCQ 2DT9A 3T69A 2E5LJ 4DSKA 5GVQA 3KNGA 5AE3A 1PG5B 3CJCA 1RTHB 4O4RA 1FNOA 1WEXA 1R0BG 4JI3F 1WKKA 5A8RB 3U1NA 4FLVA 4DV0J 3OLBA 2BANA 3ZNUA 1NMNA 3LP1B 4C0OC 3V4MA 2F96A 1WEYA 4X66J 4ICLA 1I94J 3JSRA 1N5VA 3FUYA 1EQYA 3O5TB 3VEOA 1EWQA 3WZ0A 4YDDB 3G6YA 4LQ3A 3FZMA 1IR2A 2VFRA 3O4QA 2J8SA 1RUSA 2YKQA 3DLGB 4CF1A 1K9MT 4DJBA 4FLTA 2JWKA 1IM6A 2ZH9A 4NCGA 3K8WA 3VTHA 1WN7A 1B70B 3Q22A 1GMUA 3H4BA 3SUNA 2DITA 3MTJA 2UUCF 2LKZA 2UVUA 3N9UC 2FVSA 2RRNA 1VQOS 4ECQA 4NLXA 4DV2F 1HNWJ 4ZP8A 1Q8KA 1X1PA 4DS4A 1H72C 1GX5A 5G4DA 2DR7A 3MEDA 3W7BA 5AXMA 3EZUA 3I0SB 5SWMA 4IOAL 1S12A 4ZITA 3TYTA 2ZF5O 3H2VE 1SKRA 2D0BA 1HL6A 3FJ2A 3V1QA 3OHRA 4PXEA 3T1YK 2NCKL 1I3OB 4DOZA 1VCTA 4TU8A 4QWCA 2CQ4A 1VSKA 4ILHA 3NCPA 1VSHA 4YS2A 5JS1A 3OYIA 2CQCA 2FZKB 4KB1A 2E1AA 5E7OB 3DRSB 3GQCA 2AEJA 5CYJA 3NGTA 3ZX3A 1NNDA 3L0QA 2Z2YB 4OZJA 4WE1A 1S22A 2G0CA 1OSCA 2XEXA 3UD5A 4AHSA 2JHEA 2QW9A 4DTXA 4DEZA 3P38A 4DV2J 1ZM9A 4CYUB 2Q97A 1RJJA 2VODA 1RWMB 4RNHA 2ZHBA 1EAYC 4WKRA 1DKGD 4EHUA 2EC2A 4K8XA 3SQ1A 2HNZA 3PIPQ 2HBLA 4FJ9A 2DGOA 1G15A 1GTEA 1IBMF 1O6XA 2J76E 2J7KA 5BXIA 2MXYA 1AXQA 1BIUA 1JJ2M 3MUMP 3FCHA 4TNOA 3W62A 3HHLC 2HBZB 2UVVA 4GO7X 5EVZA 1DRZA 1NOYA 1GXLA 2DGXA 1I6JA 1ZBLA 1EP4A 3DLRA 2FHKA 1H7WA 3O8WA 4WP3A 3SQ2A 4DPWA