1DTQA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-1 (pett131a94)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-CHAIN
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/transferase
total genus 134
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dtqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dtqA05
3DRSA 4LSNB 4NYNA 4DFPA 1GX5A 2HNYB 2W9BA 3KLEB 3O3GA 5I42B 2RDIA 3AVCA 2G8HA 3K58A 4OPKA 2RDJA 4WZMA 1JLCA 4CEAA 4KAIA 2RN2A 3QLHB 4PWDB 4HTUA 4J2AA 4KTWA 4QAGA 3QERA 3ZSVA 3MEEB 4NCGB 4NRUA 1SKRA 1S1WA 3AO3A 3E01A 2WONA 4ZPAA 4K4UA 1SL2A 1KRPA 2W8KA 1G15A 3HVAA 3DDKA 1U4BA 2G8WA 3EZ5A 3H08A 3OYMA 1D8YA 1SKWA 4KPYA 1S0OA 1EKEA 1ZBLA 5KG1A 4FYDA 1TL1B 1RA7A 1WSJA 2YKMB 1RT1B 3G10A 4IG3A 1IG9A 3LPUA 3SUPA 4B3OB 1J9AA 1BQMB 2X74A 3IGVA 4OLAA 3M8PB 4KB0A 3MXJA 1Z25A 3CM5A 3IGNA 3ZSQA 4KHUA 3D45A 3PJXA 4N56A 1RT2A 5KFPA 3KHLA 1CZBA 5CYQB 1RTDB 3EPGA 2JEIA 1HQUA 4M3UA 3ASMA 4HUFA 3DYAA 2IBKA 5J1EA 3LP2B 1IKXA 3AA3A 5E41A 1KLNA 3V9XA 3QNOA 4Q0BA 3TARA 4ECSA 2OPPB 2Z1GA 1W0HA 3JSMA 2FBYA 1UA0A 4TYBA 4DTNA 4W5NA 1B92A 1C1AA 1R0AB 3KHRA 2W9CA 4CCHA 4CF1A 1B9DA 1NHUA 1CXUA 2DFFA 4E7KA 3TANA 4F3OA 5FDLB 4CJ5A 4M3XA 2AU0A 2OZMA 4O55A 3KD1E 4DSFA 2ZE2B 5J2NB 1L3TA 1KVCA 4K4WA 3V9ZA 1SL1A 3KHGA 1FKOA 5JS1A 3SV4A 3DM2A 3KKRA 4CJTA 4CK3A 5HROB 1C0UB 5KFIA 2CKWA 1U47A 4NZ0A 2YV0X 2G8FA 4E7JA 3MECB 3V9UA 5KRTA 4C8OA 4DU3A 3EZUA 1QHTA 5KFEA 5HP1A 2HNZB 4GC7A 2YHAA 4FJIA 5F9NA 5EDWA 3CJ5A 3KIOA 5EU7A 4MIBA 2IC3A 3HPOA 1NJWA 1DTTB 4RU9A 4KTQA 3HPHA 4URQU 1NK6A 4J9PA 4R8UB 1Y97A 4RW9A 3TAMB 4AHSA 3NBPB 1TKTB 3L3VA 4CEQA 4MFBA 3PJWA 4FM1A 3C6UB 4CJSA 3L2UA 3RB4A 3NHGA 4EBDA 2KFNA 3DLBA 4KB7A 4YR2A 2AJQA 4RW7B 4QW9A 2AGPA 1FK9B 3Q8PB 3QESA 2QK9A 4FS2A 3HXMA 1KSPA 3PV8A 4JS4A 4NCAA 1F21A 3IRXA 4RUAA 3SUQA 1NOZA 3KTQA 2R8IA 1XI1A 4QWCA 1SL0A 4FJNA 4QW8A 4NLPA 4QPXA 3OY9A 5KGXA 2YNGB 3ZSRA 3OYDA 3MF5A 3H5SA 1MU2B 2OA8A 5DLGA 1DTQA 1HRHA 3FFIA 4IRDA 1Z26A 3N6NA 4FLVA 3BQ0A 3SZ2A 4TQRA 2W7PA 5C25A 1TP7A 4CEOA 2IJFA 2XY8A 4FVMA 3LALA 2KFZA 1YTAA 4DFKA 4F4ZA 2WTFA 4ID1A 2XY5A 3NDKA 4NLWA 1C1BB 3KKSA 5JUMA 4CGDA 4DF4A 4M41A 4KFBB 3RTVA 3FQLA 4I7FB 4ECQA 3U3GA 1S0NA 3GV7B 4DLGA 1IKVA 1RDDA 1SUQA 3CFOA 4CHNA 3VQ5A 1REVA 4RNOA 4CF8A 4QWBA 4TXSA 1W25A 2IM3A 5KG3A 2UVRA 1IKYA 4JUZA 1I39A 1CLQA 5D3GA 4EZ9A 2E9TA 4H4MB 1X9SA 5HRSA 4TLRA 4I2PA 4WFYA 3KK1A 2UUTA 3DLKB 3HM9A 3V4IB 1S6QA 5F9LA 4RW4A 4ED1A 4DLEA 3SQ2A 1SV5B 3JYTA 1U09A 2WOMA 2UVWA 4ECZA 3VQ7A 5SZTA 4TY8A 4FJ5A 1K6YA 2ASJA 5EUHA 1JLEA 2BQ3A 5L1IA 1J5OB 1RYSA 3OJSA 4QWAA 2D5RA 4GMJB 2YNFB 1HNIB 1RT7A 3OLAA 3AO4A 1VSKA 3VQCA 1D9FA 2QKKA 2RKIA 4ECYA 2KTQA 3GIKA 3IS9B 4F2SA 2DPJA 4ZP6A 3F9KA 2X78A 4ELVA 3PW5A 3NCIA 4OVLA 2AGQA 1S1VB 4NLXA 1TGOA 1HNVA 3M8RA 4CIFA 5DQGA 3GYNA 4CIEA 1BQNA 1TKZB 3OYAA 1JXBA 4WFZA 5KFQA 4DSKA 3OVNA 3V9WA 1NJYA 2DPIA 3LWLA 4I2QB 4ED0A 3RMDA 1T03B 4DL6A 4OLBA 3QGIA 3RB6A 1ASWA 1C0TA 4DU4A 1RCHA 2FVSA 2OYQA 3HK2A 2YKNA 2YNIA 2R8GA 1T94A 3TAFA 5DGAA 2JEGA 1D1UA 2R2SA 3RMBA 3AVKA 1VSEA 2P5OA 1RT3A 1RTHA 4CK2A 2DY4A 4Q8FA 4CJFA 1WAJA 3KJVA 2HNDB 3HHKA 1WAFA 1GOCA 2E6MA 2BANB 3B6PA 1X1PA 2BQRA 4MKAA 2QE5A 4OPJA 1VRUA 4FJMA 2VG6A 1S0MA 4FLTA 4J2EA 1QAJA 4B9VA 4CEDA 2AWZA 1T7PA 3SI8A 3NFAA 1CSJA 1U48A 1D0EA 1JLBA 3DRPA 3DLEA 4KV8A 3CFRA 3V6JA 3AV9A 5K14B 4FZXC 2D3ZA 1S6PB 3LP0A 5HLFB 4DMNA 3BSCA 3V1RA 4ID5A 3PX4A 4G1QA 2YNHA 3UQSA 3PR5B 3H4BA 2HB5A 3LAKA 4E1MA 4JRQA 4ED8A 3SCXA 4KBIA 3C6TB 3DMJA 4TQSA 3K57A 3NMAA 4NLYA 3KLHA 1XHZA 3KLFB 3OL8A 4CHZA 2BDPA 4O4GA 1XWLA 4M3ZA 2V0NA 4H4OB 5J2PA 4HCCA 4JV1A 2QKBA 3CDWA 3AVGA 1HJRA 3NH1A 3CDUA 4QCLA 1GOAA 3VQ6A 5FROA 1FKPA 4GVMA 3NH0A 2PYJA 4J2DA 3KMSA 2ZD1B 4O5BA 3PHEA 1ZBUA 3PY8A 2W42A 1X9MA 1S9GB 4OKJA 5DK5A 1EP4A 1LW2B 1C1CA 4Y1CA 1WSIA 1JLFA 2D7SA 4J9LA 1JLAA 1S9EA 5KFNA 4CESA 1HPZA 2W7OA 1T3NA 3QEIA 3CG7A 4RW8A 1TV6A 3LAMA 4YMEA 4E1NA 4DSLA 3T1AA 1YVFA 3OYIA 2AQ4A 2HHXA 3LDSA 3E51A 4Y34A 1S9FA 2HHWA 1YVUA 4LSNA 4CF9A 4DS5A 3V6KA 4LSLB 2DFHA 2HNYA 3KLEA 5KFLA 5I42A 3I8DA 3ZCMA 1BIZA 4MIAA 3CYMA 2D0AA 3K5NA 2D3UA 3NAEA 5F8GA 3HKWA 1VSIA 4FM2A 3RAQA 3QLHA 3LWMA 4PWDA 1N48A 4C8MA 4ZVHA 5KFJA 4J2BA 2BE2B 4JRPA 3WNEA 3MEEA 2ASDA 4NCGA 3SFGA 5DQHA 1BIUA 4AHTA 4WE1B 2BRKA 1ZYQA 4CJWA 4HUGA 3RRGA 3QETA 2Z1IA 4DTMA 1HMVB 5KFZA 3MR3A 4JV2A 1HARA 1J54A 4LQ9A 2O4IA 2AGOA 1TL1A 4M94A 2YKMA 4IR9A 1RT1A 3MEDB 4FJKA 1EX4A 2LSNA 3P83D 4CJ4A 4B3OA 1TKXB 3Q8RB 4HKQA 4J9KA 1BQMA 4DTXA 3HP6A 2UUWA 5KG6A 3V6DB 5KFTA 4XIUA 1KCFA 4B9TA 5F8HA 3M8PA 3ITHB 3SI6A 4CHPA 3KLVA 4MQ3A 1OS5A 3HSTB 3M9MB 1S4FA 2G8KA 1QAIA 2EX3A 1BI4B 2Z1JA 5CYQA 1RTDA 1N5YB 4FLXA 1QE1B 3BJYA 2P51A 4JLHA 1JX4A 2XWYA 3EPIA 3H98A 3G0ZA 3AVHA 3LP2A 2JEFA 3A2FA 4YR0A 1JL1A 4E7IA 5KFOA 5KFSA 3DRRB 2OPPA 4RG8A 2WHOA 4UQGA 2FJWA 4KO0B 3OYNA 1RTJB 1Z4UA 3L2WA 4IFYB 4K4ZA 4IR1A 2NUBA 3DOKB 3NL0A 4WYLA 4QWEA 5EWEA 3DLHA 1R0AA 2C2DA 2J6TA 1KFSA 2CJQA 3V6HA 3KK2B 5FDLA 3N6MA 4BWJA 4ZHRB 4O0JA 4WXWA 4KHSA 4IH7A 2ZE2A 5J2NA 2A1SA 4HVJA 3LZIA 1NJXA 3IN5A 5JXSA 3DOLB 3RAXA 5HROA 1RILA 1C0UA 3BQ1A 4O3QA 3AA2A 3MECA 2I5JB 3EYZA 3I5AA 1UA1A 3IG1B 2IS3A 4U7CA 2HNZA 5J2MB 2HMIB 3SNNA 3BREA 1NK7A 2V9WA 2HVHA 4URGA 4R5PB 1DTTA 3CJ4A 4DWIA 3BSAA 1GX6A 4R8UA 2XRIA 5KRSA 1L5UA 4X2BA 3TAMA 1D9DA 3UPFA 3NBPA 1TKTA 4DQRA 3OL6A 2HW3A 2RF2B 4EBEA 2Z1HA 2HWIA 4B8CA 3AO2A 3C6UA 4O0IA 3PVXA 1YTUA 3PR4A 3RB0A 3LP1B 1YT3A 1ASVA 4I9LA 3MAQA 4ED7A 5DGBA 4RW7A 1FK9A 1TKDA 5F8LA 4H54A 3RMCA 2WCXA 3C94A 4CEBA 1LWFB 4DEZA 3ZT1A 4Q43A 4YFUA 2Y1IA 1IH7A 4DL2A 4FJ9A 3OS0A 5F8IA 1WLJA 2YNGA 4B9UA 1U49A 4F4WA 1MU2A 5F8NA 4CEZA 3LPTA 2ATLA 2F8TA 4CGHA 4O44B 4ZP9A 4ED6A 5C5JA 3G6YA 4TN2A 2V4RA 5KFHA 1ASUA 4F4KA 1FXXA 2ETJA 3OYCA 2R2UA 2QXFA 4IDKB 1C1BA 1EETB 1C2PA 4EP5A 1QS4A 3PW2A 4KFBA 5F8JA 1TVRB 3LZJA 1LWEB 4W5QA 3PX6A 4KI4A 1A5VA 4I7FA 1KVBA 4OJRA 4CF2A 3DLGB 4XO0A 5L1JA 3AA5X 4CJRA 4ECTA 1LW0B 3QEVA 2FC0A 1T05B 1RBSA 1TK8A 3FQKA 1QUVA 2FLNA 4WFXA 4H4MA 4FJXA 4OL8A 2PY5A 2J6UA 2A1RA 3BDPA 3T5KA 3GV5B 3DLKA 1U04A 3V4IA 3PO5A 2JC1A 4DFJA 1LV5A 1SV5A 4L8RB 4DG1B 2G8IA 3I0SB 5T14A 2XI3A 4OKKA 1IO2A 1RT4B 4MK9A 4FZYA 5L1KA 5I3UB 1J5OA 3QIDA 4ZTFA 2YNFA 1VK0A 1HNIA 4K4VA 2GIRA 5DG9A 3KOAA 4ZVGA 2IAJB 2C2EA 2X6SA 3MXMA 2OPSB 3OYFA 4Y1DA 3IS9A 5HRRA 3OLBA 5HBMB 1RT6B 3WNFA 4CF0A 4M3TA 4RNMA 4AH9A 3LANA 3QIPB 2G8UA 4RNHA 1S1VA 1VSFA 4Z4EA 1HYSB 2JLEA 4J9SA 1S1TB 1JLGB 1RTIB 2D0CA 1TKZA 5HRPA 4CFCA 3KD5E 1RAJA 3QIOA 3GIMA 1LWCB 4KREA 1QQCA 1KLMB 3H5YA 4RUCA 4FLWA 3OJUA 5KFVA 3NKYA 4TYAA 3ULDA 4I2QA 4IKAA 4DSIA 3I0RB 3KLGB 1T03A 2B43A 3ZT0A 3L2RA 1K1QA 3QEPA 3K2PA 4NCBA 3BQ2A 3FRZA 1O1WA 1JL2A 3RR8A 4U6PA 2D41A 2D0BA 1IKWB 2ILYA 2O4GA 3V1QA 3NGIA 3TAEA 1I3AA 3HYFA 2B4JA 5J2QB 4FJ7A 4DQQA 5KT5A 2C2RA 3RBEA 1DLOB 1JLQB 3BSNA 4RNNA 4BDYA 4Q5VA 2HNDA 4JV0A 3S3MA 2OPRB 4ZPCA 4AHCA 2OPQB 2BANA 3M8QB 3QO9B 4O3SA 3ZSXA 4F4XA 2Y1JA 2HHSA 2JC0A 3SQ1A 5CY4A 4GC6A 3QGHA 1NKBA 4IRCA 3AVMA 4I9QA 4Q44A 3WNGA 4GW6A 4MK8A 4URSA 1RA6A 5K14A 4EYIB 1S6PA 3U3YA 5HLFA 3OHAA 3C95A 2VWKA 3IAYA 2QV6A 3TI0A 4FK0A 1S1XB 3FDSA 1S1UB 1A5XA 2WRMA 2FJXA 5T7BA 1SH0A 4MKBA 1N6QB 4CEEA 2W9AA 1I6JA 4J9NA 3ZT4A 2R8JA 3WNHA 3C6TA 4HYKA 2XHBA 4KB1A 4EP4A 4CEFA 3OYBA 2HHTA 3VQSA 1NK4A 3V1OA 4W5TA 4IFVB 3KLFA 4FW1A 3HVTB 5DLFA 4BE0A 4H4OA 3K5MA 4E0DA 1J53A 4CHQA 4DTUA 4RW6B 3P1GA 1ZETA 3QZ8A 4PQUB 1D5AA 4CECA 1MMLA 2BGGA 1S49A 2B5JB 1JIHA 4EZ6A 2ZD1A 3T3FA 1RDCA 1Q9YA 3OSPA 4RNFA 1S9GA 4J9MA 4CIGA 1LW2A 5KG0A 1TL3B 2KW4A 2XO7A 4FBUA 4DL5A 3L3UA 2XGPA 4JS5A 3HVRA 4BDZA 5KTQA 3BR9A 3KK3B 1VRTB 3OYGA 1S5JA 4K8XA 3V81B 3AA4A 4BACA 2JGUA 5DG8A 3CDEA 1SH3A 4ICLB 4Z0UA 3D28A 3PW0A 4ZP7A 5KFWA 3G86A 4J9OA 4W5RA 3MXIA 1N56A 4LSLA 2F8EX 2WB4A 3H5XA 1RDRA 2R8HA 2GV9A 5KT3A 1RT5B 3SYZA 5C42B 5C24B 4O3RA 4DU1A 3TAQA 4W5OA 2E6LA 3K5LA 4KKOB 3OS1A 4B8AB 2IJNA 2BE2A 1HQEB 3M9NB 1RBUA 4K4TA 3BGRB 3SFUA 4K4XA 3KLIB 3OL9A 4J9QA 2GUIA 4N76A 2B6AB 4WE1A 1NK8A 3O4QA 4DQIA 4XPCA 2IM0A 3RR7A 2O5DA 3NF9A 4ZP8A 4MH8A 4IRKA 1UWBB 1HMVA 3O3HA 1NNDA 4FCYA 4DSJA 4IG0B 3PZPA 3DI6B 4KTZA 2VA3A 5FRMA 4M3RA 4E7HA 3SUOA 5SWMA 3VQ8A 3MEDA 2HHUA 3AVAA 1C1CB 4ZPDA 2XI2A 3PO4A 3QYYA 4HUEA 1TKXA 2E9ZA 4CHOA 1WNSA 4E89A 3V6DA 1RDBA 4NLOA 3T19A 4KE5A 4M45A 3SJJA 3NAIA 3RBDA 3ITHA 4NYZA 2FJVA 4OGCA 3GV8B 1HYVA 2DTUA 5KI6A 1C6VA 5CZ1A 1BI4A 2ZQBA 5KFKA 1NOYA 2VG5B 2KQ2A 2VG7B 1N5YA 4LQ3A 1QE1A 3RMAA 3MEGB 3D5MA 1RNHA 2WK4A 4WYWA 4PUOB 2P1JA 1X9WA 2C22A 3THVA 5EWFA 3NE6A 1U45A 3OSNA 2J6SA 1TK0A 3SQ0A 1WSGA 3TAGA 4WXOA 3DRRA 3SQ4A 1JKHB 3AO1A 5CYMB 2ZKUA 3OYHA 4FZZA 4KO0A 3PW7A 1RTJA 1CXQA 4YNQA 4G3IA 2XCAA 3H5UA 5HRNA 4IFYA 4IH6A 3DOKA 4F4YA 4C8NA 3DRSB 4Z4HA 1WSHA 4FLUA 2W9BB 3KK2A 3QNNA 4ZHRA 4NLSA 3SPYA 1JLCB 4CGFA 3B6OA 3QGGA 4YP3A 4CJEA 4J9RA 4O4RA 3OYJA 4CJKA 3AVJA 3CJ3A 4K50A 3NGZA 4DS4A 4B9LA 5DQIA 3OS2A 3VQ4A 3DOLA 1ZTWA 2E9RX 1NK9A 3SUNA 1K1SA 5KFUA 1S1WB 1ZBIA 3PW4A 3E01B 4FBTA 3VA3A 2WONB 1BCOA 2I5JA 1TK5A 4FK4A 1KTQA 4DTSA 3IG1A 3KMQA 3EY1A 5J2MA 2HMIA 4BDPA 3SV3A 5FRNA 1XR7A 1SKSA 2XC9A 3GQCA 4R5PA 1RBTA 3VA0A 4F8RA 1Q9XA 3CIZA 3ISNC 4IG3B 2FLPA 3ZSYA 1LAVA 2RF2A 4KHYA 5KT7A 3H40A 1B9FA 3K5OA 4FLYA 3T5HA 4FK2A 1T8EA 1BISA 3LP1A 2ALZA 3AVFA 3ZT3A 1C0MA 1NK5A 4E3SA 2KZMA 4Y2CA 3HT3A 3OYEA 4KHRA 3F73A 4O3OA 1RT2B 4RZRA 2IMWP 3CO9A 2G8VA 2DFEA 1LWFA 3H2LA 4AHVA 4EBCA 1HQUB 2FVRA 4ECUA 1BL3A 3DYAB 4OKEA 3U6FA 4EEYA 4NLTA 2W8LA 5F8MA 4KI6A 5J1EB 3CJ0A 1IKXB 1L3VA 1UOCA 2KZZA 3MR6A 3GIIA 5DG7A 4B08A 4Q0BB 1RYRA 4KAZA 4O44A 3MFIA 3UIQA 2GC8A 2EHGA 3H59A 4DL3A 3AVIA 3JSMB 4B9NA 3TR8A 4DSEA 4CFAA 4FJ8A 1L3UA 2P5GA 4C8LA 1KHVA 2FVPA 1A5WA 1BGXT 4QOZB 3UDLA 1RBVA 3L8BA 3G6VA 3HO1A 2W9CB 4IDKA 1EETA 1JXLA 4F2RA 4ZTJA 1TVRA 1LWEA 3UR0A 1NKCA 1HYZA 4ZPBA 3DLGA 3T5JA 3VN5A 2F8SA 1RBRA 1WSFA 3TWHA 1FKOB 1LW0A 1VSMA 3TQ1A 3DM2B 1T05A 3MR5A 5KT4A 3S3OA 4CFDA 5KFAA 5DMRA 4F3TA 1S48A 3VQPA 4N47A 2BR0A 3VQ9A 1N4LA 4FLZA 5HP1B 1GOBA 4AHUA 4DL7A 4NLDA 4E7LA 4DG1A 3I0SA 4CJVA 4DTRA 2IC3B 3CJ2A 4O3NA 3NGDA 3NF7A 1NK0A 4C8KA 3QINA 4CHYA 5L9XA 4EO6A 1RT4A 3PX0A 3TABA 4ECXA 1TAQA 4RW9B 5I3UA 4CJLA 2IA6A 4BWMA 4MFBB 3AVNA 2IAJA 2FVCA 2XCPA 3OYLA 4KHNA 4DQSA 2OPSA 5L1LA 5KG4A 3QEWA 4CJQA 5HBMA 1RT6A 4M3WA 4AHRA 1Q8IA 5KFMA 3HPGA 3L2VA 3QIPA 3CM6A 1HYSA 4ED2A 2FBXA 4XPEA 4NLUA 4FW2A 2F96A 1S1TA 1JLGA 2OH2A 3ZT2A 1RTIA 1WNEA 3IRXB 4CFBA 2PYLA 3CQ8A 4K8ZA 3OHBA 4ED3A 4ELTA 4ZMMA 3AVLA 2ASLA 1LWCA 3OL7A 2Q3SA 3QEXA 1KLMA 3NAHA 3GILA 2IM2A 4O3PA 3RWUA 2EC0A 4ZVFA 1VSHA 2FVQA 1DTQB 3I0RA 3KLGA 3FFIB 2HHQA 3RRHA 2BQUA 3QZ7A 4LH4A 4M42A 1KFDA 1XR6A 3TVKA 5C25B 2ATQA 1ZBHA 4BE2A 1XC9A 2OZSA 1IKWA 4K4SA 2AX0A 4CJPA 4NYFA 5J2QA 4LD0A 2I1RA 1TAUA 3I5CA 3N6LA 1QSSA 4FJGA 1S97A 1DLOA 1ZTTA 1JLQA 4N5SA 2PZSA 2YHBA 3LP3A 1IKVB 3ZSOA 1SUQB 1ZBFA 2GBZA 3T5LA 1REVB 2OPRA 3KHHA 2OPQA 1TQLA 4PY5A 4ECRA 3M8QA 3KNAA 3QO9A 1IKYB 4DFMA 4DTOA 5D3GB 4BE1A 4LH5A 4NLGA 4NRTA 4I2PB 4HCBA 3KK1B 3L2QA 1WSEA 3HJFA 4DTJA 3S3NA 4KHQA 5KFXA 4CE9A 1S6QB 2UVUA 2FBTA 4RW4B 2IGIA 2XY6A 3JYTB 4E19A 2WOMB 3NGYA 5KG7A 4TY8B 4Z4GA 1JLEB 1S1XA 1S1UA 4EYHB 1N6QA 1KHWA 4Z4FA 4TY9A 4Y3CA 1RT7B 1BCMA 1CZ9A 4IFVA 2R8KA 2UVVA 2RKIB 3MTKA 4NLRA 5KFYA 3HVTA 1ITGA 4FXDA 2ITGA 2IM1A 5KG2A 3M8SA 1EXQA 1VSLA 4ZVEA 2R2TA 1HNVB 4RW6A 4CERA 4YQWA 1QTMA 4PQUA 3HL8A 3Q8QB 2HAIA 1BQNB 3VQEA 4K4YA 4WZQA 5KFBA 3SPZA 2B5JA 3Q8SB 3ZSZA 3VQQA 4Z4CA 1SH2A 4B9SA 4AILC 4Y2AA 4CK1A 4FS1A 3CFPA 2IOCA 1TL3A 3AVBA 4DQPA 3ICLA 4EO8A 1C0TB 3ISND 4DF8A 2IDOA 4PA1A 5KFGA 2YKNB 1W9HA 2YNIB 3KK3A 3NF8A 1VRTA 4R0EA 3NF6A 1JXEA 2XGQA 3V81A 2VWJA 3DLRA 3AO5A 4N41A 3NH2A 1RT3B 1RTHB 2R2RA 3VQDA 1LAWA 5CZ2A 4YR3A 3G6XA 1NHVA 4ICLA 2RPIA 3KJVB 3ALYA 2FLLA 4OGEA 3O3FA 2HHVA 1UAXA 1NJZA 4DL4A 3VQBA 3BSOA 1S10A 1BHLA 1RT5A 1VRUB 5C42A 1VSJA 2VG6B 1XHXA 5C24A 3OYKA 1XR5A 4KKOA 5KGWA 4IKFA 4IQXA 3FSIA 1JLBB 1HQEA 3DRPB 3BGRA 3DLEB 4FM0A 3KLIA 4KV8B 4Q45A 4CJ3A 3D0PA 2B6AA 3LP0B 4F50A 4ID5B 2XY7A 3S9HA 4FJHA 3P5JA 4G1QB 2YNHB 3CWJA 3PUFA 4HHTA 3K59A 2GIQA 5KG5A 4CGIA 1QSLA 1UWBA 4KHMA 3DMJB 3HP9A 3GIJA 3O4NA 4M95A 4IG0A 3DI6A 3KLHB 4IBNA 5EWGA 4O4GB 4IH5A 2ILZA 3ZSWA 4NLQA 4H8KA 2HWHA 4B9MA 1KVAA 5J2PB 3V9SA 4KRFA 4KSEB 3TAPA 2VA2A 1FKPB 1QSYA 4M3YA 3MFHA 5KT2A 2HVIA 4CJUA 4CGJA 5KT6A 1NKEA 3RB3A 2VG5A 2VG7A 3MEGA 3MR2A 4ELUA 4PUOA 2C28A 1EP4B 3CVKA 4TSXA 2R7YA 2FBVA 5JS2A 5KFCA 2X6NA 1JLFB 4ECVA 2JEJA 1JLAB 1S9EB 4MK7A 3M9OB 4IOBA 4CGGA 1L3SA 3VQAA 1HPZB 4FJLA 1VSDA 4QWDA 1JKHA 3H4DA 4RW8B 4DTPA 1TV6B 5CYMA 4ECWA 5KFFA 4NLVA 2BRLA 2V4QA 5KFRA 5KFDA 3I5BA 1WN7A 4Z4IA 2E4LA 1RDAA 1IM4A 4Q8EA 4KHWA 3HVWA 4LY7A 4FJJA 2AX1A
chains in the Genus database with same CATH superfamily
3DRSA 1GXUA 4NEYA 2V4JA 4NB4A 1GLFO 3VPZA 5I42B 3FBBA 3AVCA 3TVYA 5IOLA 3M6XA 4CEAA 4KAIA 1D4XA 1PYSB 4LRFA 3QLHB 2MQNA 4L74A 4LSZB 3OTOJ 3T69A 2KN4A 4FWQA 1I94F 3U1MA 1SJ4P 3MEEB 1GMUA 4NRUA 3CCVS 3BBFA 2XS5A 1G15A 5DM7Q 2LA6A 2HZAA 2VZ9A 1D8YA 3CD6S 1HKGA 1SKWA 4KPYA 3GJTB 1S0OA 1ZBLA 1B3TA 1WSJA 2YKMB 2Z56B 1XMQF 1RT1B 3G10A 2OMLA 1HD0A 4M5DA 5AE1A 3CD5A 4B3TF 3IGVA 3VAHA 2OTJN 1WKJA 3W8GA 3M8PB 1WHYA 1Z25A 4CVNE 4CNZA 3ZSQA 4KHUA 4CO4A 4ETZA 1DRZA 3J8AA 1KQFB 2FQQB 1RISA 1H72C 4DV0J 4BRDA 1CZBA 2JEIA 2I6WA 3MOJB 3EMTA 4HUFA 4FP9A 3K9KA 4DR5J 3WX4A 4FXWA 1O6XA 4LBPA 4OYMA 4NXNK 1IKXA 2HMPA 4UOCA 1KLNA 2NRXA 3VERA 2YKPA 1YJNN 5B0CA 1ZH5A 3MPUB 4B3SF 4NLBA 3N79A 2LQ5A 3C16A 2GAHC 1SPBP 2IRYA 1BU6O 4PKDB 2XSFA 1R0AB 4LVNP 4CCHA 5HMWA 3WT0A 2EFNA 2VFUA 1CXUA 3WBZA 3TANA 4CJ5A 3O1BA 1X31C 5C2DA 4O55A 1L3TA 2ZH3A 5ADXA 5M2UA 2W2QP 3QT6A 1KOOA 4NZ7A 3M6UA 1B4SA 1Y3JA 4C8YA 1C0UB 2B9WA 3HHLD 1FDBA 1N0VC 4Y65A 5BXIA 5KRTA 3UDVA 4MAKA 5K9FA 4DU3A 2H54B 3CCMN 1QHTA 3LTOA 4ED5A 1QAYA 4FJIA 4S0MA 5EDWA 3VAJA 1GMVA 3OR1B 3KIOA 4U67L 1PJ6A 3D7SB 1H74A 2A18A 4JKGA 4J9PA 1RWOB 4R8UB 1NZAA 4RW9A 4OHYA 3B78A 3NBPB 1TKTB 4PXEA 2O8BA 3PJWA 3EE8A 2E29A 4FM1A 4CZIA 3ZNUA 1FNMA 4CT9A 1RB0A 2O8FA 1R6VA 1VFJA 3CCQN 3OTEA 3RJMB 5A8KA 2ROEA 4YHHJ 1KAZA 3KVGA 2W2PP 4YR2A 3EL2A 2UV8A 2E7WA 4RWWA 3KUHA 3MM5B 2QSWA 1CS4A 1KSPA 4LF7F 4RJVA 3SUQA 2CJBA 2HK3A 4P9SA 5K20B 1WG1A 1FRHA 3GR0A 4OI0A 3KZBA 4QPXA 3OY9A 2ZH4A 4NXNF 2W4CA 1DTQA 2PC6A 2V69A 3CTRA 2QA4G 4FLVA 2NRTA 3BQ0A 4D3HA 3GIRA 4A5AA 1N0UA 4CM2A 2WAQD 3I4PA 2IJFA 4CEOA 2XY8A 3B4DA 3IBCB 2IY5B 3PNIA 1ZXOA 2KFZA 4I64A 4F4ZA 4TU7A 1N5TA 4ID1A 3NDKA 4DV3K 4KGVB 4P72A 4DF4A 4LFBJ 4M41A 2HF4A 4PG8A 4I7FB 3U3GA 3SCJE 4ILLA 3OBWA 1IKVA 2OLWA 3VQ5A 3EJMA 3IM9A 4PYAA 4CF8A 1VBKA 1F6TA 4TXSA 1W25A 4JAXA 1YJ9S 3C46A 2E9TA 4DZDA 1WKLA 1X9SA 4I2PA 4WFYA 4L3KA 2VV5A 2HWTA 3HM9A 2D1KA 1S6QA 4JI0J 1QAXA 4ED1A 3ATVA 2M5YA 1U09A 1NWKA 4ECZA 1K8KA 1B70B 2ASJA 3FKBA 4C8ZA 1YLXA 4FPIA 5F3ZA 1M5HA 5J1NA 1RYSA 4F04B 2ZHOA 3M30B 1NZ8A 2AD9A 3VQCA 2QKKA 2RKIA 4ECYA 3JS6A 2LKZA 4F2SA 1PC4A 5FPDA 4ZP6A 3G82B 3VF2A 1XTZA 1KKHA 3PW5A 3NCIA 2OKQA 3CXCR 3C7NB 3KDOA 3U1LA 3SK3A 1HNVA 5HQ8A 3WXMB 4CIFA 4P2XA 1NJIO 2DR9A 3GYNA 4AM6A 1BQNA 1JXBA 2MQ8A 2Y1RI 3I96A 5ETOA 1RXOB 2EG1A 3G25A 3ET6A 3OVNA 1HKAA 3OFGA 4H5RA 1U1RA 5GAEP 1VHFA 3AB4B 1Y5IB 2QMWA 2FD2A 4DL6A 2DEJA 5DRKA 4Z2XA 4K7QA 4OLBA 2JZ5A 4L75A 2R7SA 1ASWA 3NCQA 1CJUA 4BQZA 1Q8BA 2A2DA 2OEMA 2UU9K 2YKNA 2YNIA 3PLAA 2R8GA 2EBGA 3AQPA 1D1UA 4MLHA 1VSEA 1A0OB 2P5OA 1RT3A 2QWOA 1WB9A 2HNDB 2PIIA 2UUBF 4FNIA 1IJJA 5JVHL 2A5XA 1WJ9A 3CCLS 3W9IA 4FJMA 2KXNB 1RHQB 4AUKA 2CPXA 2YPZA 4QS9A 2X7IA 1T7PA 1CSJA 5K8PA 1U48A 4DR6J 3DLEA 4KV8A 1WOQA 3A5LC 4BRNA 3AV9A 3NVKA 2GHVC 5K14B 4ZVRB 2KG1A 3V1RA 1BWFO 3MCOA 1NGHA 3W5XA 4JI5J 5FLXU 2HB5A 1QY7A 4E1MA 4ED8A 3SCXA 2G0JA 3DMJA 4TQSA 2XYHB 1FDAA 3NMAA 4OZ5A 1CG2A 4NLYA 2H48B 1WC4A 1APSA 4O4GA 1HNXF 3LDNA 1XWLA 2PBDA 4IDHA 4ZJLA 2YH1A 5J2PA 3ENBA 3ETOA 3AVGA 4LRCA 2DO0A 1HJRA 3PSFA 1W2IA 4H4KA 3R6LB 1RAEB 5B08A 3VQ6A 3AODA 3NH0A 1AFJA 3KMSA 2XMWA 2ZD1B 4YY3K 1N36K 1ZBUA 4UUWA 1Y10A 2A10A 3C66A 2W42A 4OKJA 5DK5A 2MSSA 1TFYA 5GAHI 2BKNA 2V8PA 1YUWA 4O23A 1JLFA 2IDLA 3WQUA 4WP9A 4LF6J 3JXUA 1HPZA 1T3NA 2ZZNA 1TV6A 4E1NA 3UKUA 3J7YP 1EX8A 3FZFA 3T1AA 1YJUA 4FZVA 3GWCA 2NUUG 4AD6A 2FZCB 2Q1NA 3TZZA 4LSLB 2AP1A 2DFHA 3NRBA 3D0HE 1WORA 1JJ2M 2D3UA 3HKWA 1VSIA 1FRKA 1WF1A 1U1MA 1IWAA 4G6VB 2KL8A 4I4BA 1HWIA 3SFGA 3J80U 5BYSA 3VEVA 4MTPA 2BRKA 1ZYQA 3D6RA 1Q81T 4LF2A 4ZN3A 2Z1IA 2KT5A 1HMVB 3EM1A 5KFZA 4JV2A 3MEDB 1EX4A 2LSNA 4CJ4A 3AD7C 4B3OA 2OTLS 1TKXB 2Z2YB 3U1NA 1BQMA 2UXDJ 4DTXA 1NDCA 3QATA 2J7UA 3TVZA 5IV3A 5KFTA 3WDOA 2UXBK 4B9TA 5F8HA 3ITHB 3MWTA 2WW8A 5GAHU 1RTDA 4AL7A 1N36F 1QE1B 3BJYA 1RCOB 1JX4A 2KH9A 2XWYA 2C3OA 1FCAA 3OW2R 3LP2A 2P9SB 1HKBA 3A2FA 3M7VA 4USWA 5CD4A 2A6AA 3C15A 5KFSA 4KJIA 2OPPA 2V7ZA 4RG8A 3VEWA 4P10A 4BBYA 4YOYA 2BJ1A 4M7XA 1N5SA 1NSAA 2FJDB 3UO0A 4KO0B 1CC7A 4WCEQ 1LFPA 4LFAJ 3L2WA 1A6LA 4EFAC 2GZOA 4QWEA 2ZNYA 4B3RJ 2DR7A 5HO4A 2J6TA 3W2WA 2CJQA 2BA9A 4YB7A 3MDQA 4O0JA 1QVFR 3CXCM 2ZE2A 2PGCA 5J1PA 3RAXA 3PSIA 3BQ1A 3U02A 1RWUA 4QYRA 4V1Ak 1VQNS 3MECA 1UA1A 3EWGA 2HNZA 2HMIB 3SNNA 3PYDA 3BREA 2EFPA 2P9PA 3NEKA 2VQEF 5AZJA 3EGVA 3CJ4A 1GX6A 4A4JA 3QGPA 3M05A 1D9DA 5DDRC 1RWNB 1EWRA 2CJAA 2Z1HA 1X5SA 2HWIA 4C3MA 2GQ2A 3VGUA 1VC6A 2KB2A 2APOA 3QMQA 2RRBA 1YTUA 2A0FB 5JLFA 2UXBF 1ASVA 2KYXA 2ZM6J 3MAQA 1NMDA 3VQTA 1FK9A 1TKDA 1S57A 5IXUA 4M5JA 2DCLA 1T11A 4K2JA 2OJ3A 4Q43A 4IO1A 4JYAJ 3CJBA 2Y1IA 1IH7A 1H38A 4DL2A 4FJ9A 3OS0A 1VBYA 2YNGA 1XNRF 2O1PA 1U49A 4IXCA 2O8EB 2OMOA 4F4WA 2XMVA 3ENVA 1R6YA 2YQ3A 3LPTA 1EHWA 1B99A 1VLYA 1KVKA 4ITSA 3G6YA 1LNQA 5ITHA 1DBDA 2FY1A 1RLDA 1DZ5A 2R2UA 2QXFA 1C1BA 1EETB 1QS4A 4DDFA 4CNYA 3FBEA 4KFBA 1VQ4S 1TVRB 3LZJA 3LF0A 1N88A 1KVBA 4RO0A 1D8ZA 4X64F 4FYYB 4CJRA 3ZEUA 3EE3A 3NOCA 4ERDA 4ECTA 4QIGA 2X1GA 3DJCA 1LW0B 5D0GA 3TA1A 1Y4ZB 5A0YB 2AV5A 2EG2A 5KPZA 3FQKA 1ZPWX 2XEXA 4WFXA 4FJXA 4OL8A 2DGTA 3GV5B 3DLKA 2KFYA 1Q8LA 2NUHA 3V4IA 1U04A 1U0HA 4DFJA 3NMRA 2V34A 3BV8A 4DG1B 5KPRA 2OCEA 5CR4A 3OTBA 5L1KA 1J5OA 3QIDA 2YNFA 1HQ2A 4BC3A 5AT1B 5DG9A 3DWLA 4X65F 3CJAA 2JFKA 2DR5A 2C2EA 3MXMA 1NGIA 4USVA 2VDHA 1TELA 1OH7A 1RT6B 2CJKA 2MPUA 4CF0A 3LANA 3BKUA 2A41A 2JLEA 2F9JA 3HZEA 3K8VA 5DM6Q 1YIJN 2E88A 1IR2A 1F9FA 3ID8A 2C2ZB 4CZEA 4CFCA 2CUYA 1VQ6N 3GIMA 1CZAN 2Q6CA 5CYJA 2VDIA 1KLMB 3L09A 1PCAA 3KWIA 4AL5A 3NKYA 4I2QA 3MZIA 3ZT0A 5FIIA 2LVWA 3TZXA 2R7UA 3ILLA 3BQ2A 1XNQF 1JL2A 2WVBA 2UUAK 1T9TA 2O4GA 1I3AA 1S79A 2B4JA 5J2QB 2CQ4A 2F4FA 2UUCF 4DQQA 6FD1A 3Q8YA 3L7UA 4BDYA 3UVJB 4BG9A 4CLUA 1UCNA 4X62F 3S3MA 3QT7A 3QO9B 4O3SA 4KGZB 4BR7A 4F4XA 2HHSA 2P5VA 1K47A 2L9NA 3BO4A 4YS2A 2M7SA 1U24A 4EYIB 1S6PA 3P5TL 3MMBA 5GADI 2K2PA 3OW2M 3ILOA 4A8SA 4FK0A 1S1XB 4BLGA 2AJ2A 3LH2S 2DHSA 2GVZA 3MEKA 4RR5A 4U7BA 2XHBA 4EP4A 4CEFA 3VQSA 1NK4A 3V1OA 2J7KA 3CC2S 2FHOB 2LDYA 2ZWHA 2GHPA 3HVTB 5DLFA 1RHUB 1Q7YO 4BE0A 3O08A 2FUG9 3CCVN 3R3LA 3PYGA 3TNVA 1FNXH 2Q2RA 3CJ8A 4CHQA 1WOOA 3P1GA 1QVFM 2LDIA 5A6PA 1N33J 1D5AA 3I32A 5AQFA 1SC4B 3R2CJ 2B5JB 1ESVA 3CERA 1RDCA 4LF9F 2MKHA 1GFWB 4R79A 5A8RB 1UEVA 4KH6A 1VS3A 1RKJA 2VOOA 1LQ9A 2XQCA 3BYPA 4LMZA 2OP5A 4DL5A 3MK6A 4BDZA 3RBZA 2XG8A 4K8XA 3BR8A 3V81B 4LIRA 5DG8A 3CDEA 1SH3A 3OV7A 4ICLB 3ENAA 4N8OA 1EKRA 5KFWA 1OMSA 1HWUA 5LSLA 1OPIA 2F8EX 3KG4A 3H5XA 2C3UA 4QYZJ 1QD1A 3SYZA 5C42B 3WIUA 5B8HA 3M2VA 5C24B 4N8NA 1Q78A 3TAQA 1Y00A 3BH7B 4ZCMA 5LXYA 3M9NB 4G1IA 3SFUA 3KLIB 4BY9C 3OL9A 2QGFB 3OTOK 3OUYA 1UL3A 1X4GA 2HZVA 1CLFA 5CXTA 2CQ3A 2FZKB 3O4QA 1EKSA 3PFEA 3IBFB 3RR7A 3MGJA 2O5DA 3NF9A 4OZ3A 1UVLA 3NWGA 1DGKN 4EHTA 1UEKA 3HKZD 2CPFA 3SUOA 3UN5A 1Z05A 3T1HJ 4ZVPB 2M88A 2MHEA 3WQPA 2XI2A 3EXCX 3J81O 4HUEA 4CHOA 2IHR1 4YOXA 3MCMA 1DJ0A 1WNSA 3V6DA 1AA1B 1ZZNA 3T19A 4M45A 2K3IA 3A3OB 4HVZA 2ROPA 2FJVA 3JQMA 4OGCA 3GV8B 1FA0A 5CZ1A 1T9UA 1BI4A 1WF0A 1GTHA 2VG5B 1MW7A 4JV5F 1BA0A 2HFOA 5JJBA 4PUOB 3EGZA 3WIVA 3V5RA 2F65A 3CI5A 2NCKL 3SQ0A 1FFGB 3D1QA 4UT4A 3L0QA 1OSDA 3SQ4A 2D0PA 5CYMB 2BJ8A 2K06A 1V6HA 3R6MA 2XCAA 4TU8A 3FZ2A 3H5UA 5HRNA 3CIMA 3DOKA 4F4YA 4JD2A 3EKUA 2Z57B 4C8NA 3CO0P 3DRSB 1P1TA 2V4JB 4Z4HA 1YVNA 4FLUA 3TSQA 4WQ4A 2G2YA 3QRRA 4CBUA 4WPAA 4Z94A 1FESA 4CJEA 1U8WA 4J9RA 4QU7A 1R8BA 3VF6A 3AVJA 3CJ3A 1HNZJ 1EIYB 3VQ4A 2E9RX 5ADZA 1I5OB 2HGNA 3SUNA 1K1SA 2B9EA 3NXZA 3H6EA 3MR7A 3HI0A 4U67Q 3PW4A 2N7YA 3OTOF 4IEEA 3HFZB 1TK5A 2PI4A 4KQZA 3KJNB 4JEPA 3IG1A 3UNGC 2OD4A 3BGUA 3EY1A 5J2MA 4BDPA 2XC9A 4A48A 3CB4A 3KKFA 4F8RA 3VA0A 1KDNA 2YKQA 4NA2A 2HS3A 2VF3A 1LAVA 5KT7A 4M5DB 3H40A 4FLYA 3E66A 1K9MO 2ASOA 2BV3A 1MN7A 4QIWD 1TMJA 5M1FA 4DV5J 2FGOA 3F73A 4JI4J 4KC5A 4DR4K 2VPWB 2WW4A 3J7ZO 1V3RA 4K59A 4YHHK 2FB0A 1LWFA 4CBWA 3AB2B 4AHVA 1DY3A 1YXQA 2FVRA 4ECUA 4F36A 1IWGA 1BL3A 1MA9B 4OKEA 1YRUA 1R31A 4EEYA 5MLCV 3CJ0A 4DV0F 1IKXB 1S4EA 1Q16B 2VJVA 3GIIA 1XC3A 4RBVA 4DR5F 2VC0A 1RYRA 2GC8A 1IJEB 2MZJA 4DL3A 5K8MA 3PJ9A 2CPEA 4X4UA 4DSEA 3C16B 4PXDA 4FN5A 4JI2J 1BGXT 4QOZB 1RBVA 3G6VA 1SC1B 1JXLA 4ZDNA 4I6YA 1NKCA 3OXLA 1YJWS 2Y3YA 3W62A 1U25A 3T5JA 2VFTA 2NYHA 4XAKA 1E6YA 3Q22A 3FMWA 1T05A 2NYIA 1UEUA 1AUSL 4FVUA 1NMNA 3ULEA 2YWGA 2BKOA 5FLXY 2JLFA 2CZ4A 5GAGU 3K0JA 3EE9A 1VQKN 2LEPA 1EQ0A 2JDJA 1GOBA 4DL7A 4M63A 2WTUA 1J2VA 4A8OA 4DTRA 1NK0A 4A8FA 1KBRA 3QINA 4JKGB 4C0OC 5L9XA 1VQYA 1RT4A 4FYXB 2G13A 3DRYA 4RW9B 3O5TB 5I3UA 2NRZA 2O8BB 4DV7F 3AVNA 1RAFB 2VKRA 2IAJA 3HMJG 5HVFA 1LWXA 4KHNA 2O8FB 2OPSA 5L1LA 2CQCA 2VASA 5A8KB 1NEEA 5HBMA 1CULA 1NAQA 1ZM9A 4C7QA 1C4AA 3HPGA 4AQYJ 3QIPA 3U7JA 1HYSA 1CS4B 2B8QA 4FW2A 2E20A 1NXIA 4YHHF 1VISA 2PYLA 3GFYA 3OHBA 4GY2B 3AVLA 1LWCA 3OL7A 3EO3A 2HF3A 3QB0A 3RWUA 2EC0A 1DTQB 3I0RA 4GKJJ 3BF3A 4MO4A 4YOVA 1KFDA 2CNNB 2ATQA 2MLZA 1ZBHA 1I1GA 2E1PA 2QI2A 2XMTA 2OZSA 1IKWA 4K4SA 5JVHQ 1WC6A 3G8TA 1FXLA 2I7PA 1F3FA 1DLOA 1XQIA 1IKVB 2XHCA 3P4IA 3TUJC 2KU7A 4LFBF 1Q53A 4FSVA 1IN0A 2OPQA 3KHHA 4PY5A 3M8QA 2KJWA 1MWYA 5CA5A 3J80Y 2R7TA 3NCRA 4BE1A 1P9YA 3MM9A 3KK7A 1QDUB 4X84A 4I2PB 1ROFA 4KY3A 2NRHA 4YN3B 1SS6A 1WSEA 1NB7A 1S6QB 3IMXA 5H1SQ 1UVKA 3CCRN 4C98A 1HLUA 1K8KB 4M5MA 2LQ8A 4H0XB 1S1UA 2IFXA 4JI0F 2KVQE 2AYBA 1N6QA 1XMOJ 4PEOA 1KHWA 2HVDA 4DV2K 2VWBA 4TY9A 2H65B 4JI5K 2B4UA 4LF4J 4BVPA 3FCHA 2YHYA 1WG5A 2RKIB 3MTKA 1HNWJ 1ITGA 3BO3A 3D6TB 4DBQA 2IM1A 4EI2A 2V67A 1WD6A 3M8SA 4ZVEA 1UVNA 2FC9A 3W61A 1HNVB 5AQIA 4RW6A 4YQWA 1QTMA 2QZ8A 3HL8A 3Q8QB 4V19X 1BQNB 4TKTA 4I68A 4TLQA 3SPZA 1H7XA 5LSOA 3FBCA 3CCUS 4HTJA 1FVQA 2H1YA 3ET6B 2IPOB 3VEXA 4FS1A 3CFPA 1WC5A 5H9FJ 4ED4A 3HCXA 1IVZA 2H3GX 1CJUB 3AGRA 4DQ8A 1HR0K 5KFGA 2YKNB 1W9HA 2YNIB 3KK3A 2MQMA 1VR6A 4X4OA 1J5EK 3UCZP 3CD0A 3MN5A 3LUYA 4N41A 3DLRA 5D77A 3AO5A 3CCWA 3NH2A 1RT3B 1HHSA 2GNKA 2R2RA 3VQDA 4LF6K 1RAHB 1LAWA 5CZ2A 4YR3A 1FRIA 2HQIA 2RPIA 1YG0A 4LRAA 2FLLA 1UMJA 4DN9A 4CD1A 3O3FA 2HHVA 1UAXA 4FF1A 3UKRA 2JLGA 1Q79A 3VQBA 3RZAA 1S10A 1BHLA 2HLTA 1RT5A 4AXJA 1VSJA 1XHXA 2MYFA 4H0TB 3DXMA 1XR5A 5KGWA 4WP8A 4IQXA 3FSIA 1H98A 1HQEA 3DFEA 2DRBA 4LF5J 3DLEB 4KV8B 3GR1A 3O9UA 4PHTX 1WC0A 5AR0A 1YBUA 3S9HA 4FJHA 4DR6F 4M5HA 3TZYA 1A7GE 2OAUA 1VOMA 2UP1A 4MKYA 1UWBA 4KH4A 3DMJB 5HSPA 3UN2A 3CJ1A 3HP9A 4OZ0A 4M95A 2GVDA 1R59O 4O4GB 4IH5A 2G1HA 1YQHA 4NLQA 2B9YA 2HWHA 5J2PB 4U7UK 1R0BG 1NM1A 3V9SA 5HQMA 3FZMA 4KRFA 5JICA 2E5LJ 1HWLA 5E3PA 1HI8A 2AJ4A 1IV0A 5KT2A 4CJUA 4ZLLA 1HW9A 2W6LA 5F41A 2E1YA 3PDNA 3R9PA 1HBUA 3RB3A 4H03B 2DNMA 1VHXA 3MEGA 4ELUA 3MUVP 3A3NB 2IVOA 4TSXA 1I94J 2QN6B 1N32K 1JLFB 4ECVA 2J76E 2RSQA 3SAFA 1H0HB 4MK7A 3P4UB 4IOBA 1HPZB 2QT7A 2QWRA 4FOEA 1JKHA 1FRXA 3H4DA 1TV6B 4ECWA 4OZJA 3UKUB 2RU3A 2BRLA 4I0WA 5KFRA 2GMLA 2PFUA 5C7PA 4LF6F 2BE9B 2F9WA 3OXFA 1HD1A 4ZPTR 4DFPA 3MCPA 2W9BA 3O3GA 1NUEA 2X1AA 4OPKA 2RDJA 1HBMA 1WSVA 1X0PA 4B3RK 3FZKA 2R7XA 4NE9C 3VCDA 3ZNJ1 4BREA 3OVSA 2M8DB 3D7EO 2Z58B 2BM0A 4ZVQB 1BWEA 4CLLA 1SKRA 1S1WA 3AO3A 2Q79A 2WONA 4ZPAA 1KRPA 2U1AA 2W8KA 3H20A 2YWKA 3DDKA 2G8WA 3ZX2A 3H08A 3P5BP 2PDAA 4CZLA 2ZDOA 5F2RA 3DLJA 1EKEA 3JSRA 2HQ3A 1C4CA 5I9EB 1IG9A 3LPUA 3O6WA 4B3OB 4B3SJ 1GXLA 1BQMB 4C4WA 1U1PA 2J9CA 1QQNA 2DRAA 1GLBG 4OLAA 4KB0A 3T1YJ 4HLBA 3CM5A 3IGNA 1YSJA 2UXDF 3GFXA 1NJIT 2DBBA 1S3XA 1U2FA 4PL7A 3DLLL 1RTDB 2QA4S 1HQUA 4M3UA 1FRJA 2DO4A 1OSCA 2CFXA 4ES1A 1SQGA 2DXFA 1SIZA 2XNQA 3AA3A 3LP2B 1ZA2B 1H7WA 4JYAK 3GU0A 2CJXB 1NU4A 3QNOA 3AOCA 2LQJA 3C15B 2R7RA 1KD1O 3MMAA 2OPPB 2CPZA 2IA0A 5A2QU 3NVMA 1IXKA 3B4MA 2FBYA 4TYBA 3CC7N 1B7YB 1B92A 1OJ4A 2OHDA 3W2WB 3N5FA 3KDNA 2P9EA 4F3OA 3PYFA 2PD1A 4LFAF 2DIUA 1Y11A 2HFSA 1YHQS 1NGGA 2OZMA 4BR2A 2ZE2B 1O51A 1KVCA 3OBYA 2P8IA 4UF4A 3V9ZA 3H7HB 3SV4A 3KKRA 5SUHA 4B1UB 4CLWA 2DNHA 3O9QA 2LXFA 5KFIA 2CKWA 2BH1A 1WWHA 3VZIA 2G8FA 2DK2A 3T41A 3MECB 4C8OA 3EZUA 5KFEA 5HP1A 2HNZB 4GC7A 3I56S 2YHAA 2BABA 3I4HX 2A6OA 2P9PB 4I6WA 1FO1A 2ZH6A 5EU7A 5AZJB 2W25A 2M2BA 4WKYA 3HPHA 3DHXA 1VQLS 4QQBA 2FC8A 4AHSA 3L3VA 2Y8WA 4DV6K 1MWKA 4CZJA 3L2UA 3P49B 2KFNA 2FPHX 2D3O1 3LDLA 1WELA 2ZH2A 1R27B 1L3KA 3DKDA 3CJKA 5E3AA 1LOUA 2I38A 2RD5C 4QW9A 3QESA 1FK9B 3UDEA 4FS2A 5IQQA 3HXMA 3PV8A 2F8MA 2JH3A 4ZLPA 2ZM6F 1XI1A 2QJ3A 5M1KA 4PPZA 3P38A 2YNGB 3MF5A 2KM8B 1IBMJ 4PZVA 3WC2A 4JYAF 1HRHA 1ZS6A 1Z26A 3N6NA 1SB6A 1WEYA 4JBCA 3Q23A 1TP7A 2AF6A 4U96A 4FVMA 2LU2A 4HHUA 2H51B 2AHOB 2WTFA 3G71S 2RHQB 1M90T 3FEYB 5GADP 1R0CB 4E2FB 1C1BB 2CQHA 5JUMA 4XEIA 4KFBB 3K2YA 3VTHA 3D2FA 4B1VA 3FQLA 5IS2A 1RHMB 1S0NA 3GV7B 4K43A 1HKCA 1RDDA 2CNKB 3ZEUB 2YJFA 2XZWA 3VV2B 1WTFA 5BN8A 3AAQA 2QTWA 4LJMA 2R7OA 2PFFB 4L3QA 2C3PA 4PAAA 2MZRA 1M1KT 3JS9A 4ALZA 1VK8A 3DLKB 3V4IB 1U0HB 3MDFA 1VIXA 2GJIA 4JI1K 1FDNA 1BOTO 3JYTA 3M8WA 4NXMK 4FJ5A 4ZCLA 3CULA 5EUHA 1JLEA 3QFPA 5B0AA 3TJAA 1J5OB 1OIAA 3OJSA 5L46A 3ELHA 1O13A 2YNFB 3OLAA 4DZ6A 3R1LA 2KTQA 5IC6B 4NLCA 1ZAXA 3NS7B 4A5BA 1AZSA 1NLKL 5AXMA 5AJ3K 1VQ5S 3SMZA 3PRVA 3EXYA 3X3UA 4OPHA 1TGOA 2KM8C 1T44A 3FZHA 4FDFA 2FF6A 3Q0AA 4OLOA 5KFQA 3F9MA 1N33K 2V2ZA 2YKOA 3V9WA 2C2KB 4RWXA 4I2QB 5HMXA 5H9EK 4DCHA 3RB6A 2MZSA 3VAGA 2GTDA 3R7BB 1C0TA 3WHIA 2HHPA 3PACA 5D4OA 3TAFA 3RMBA 2R2SA 2J0SD 3D3BJ 1GLEG 5HANA 4UY8T 3TEGA 2JNJA 4ISFA 1NGCA 1NG9A 1WAJA 3VZHA 3Q24A 1UFKA 2HSEB 2JVRA 3HHKA 1VYAA 1W97L 1WAFA 1FE0A 2E6MA 4IOAL 3UD5A 3B6PA 4O8UA 2CIMA 5D4NA 2IVNA 4MKAA 2QE5A 1VRUA 4JNEA 4J2EA 4J90A 2A3ZA 3KHYA 2EFVA 1URRA 2QSFA 2QG9B 4QYZK 3SI8A 2MSTA 4BQLA 3BH6B 3CFRA 3V6JA 2DHHA 3BBCA 1DAXA 3FGUA 1S6PB 4CZFA 3X1LB 3MMBB 1Y0HA 1SJ3P 1V3SA 2KHCA 4OYIA 2AT1B 2XBPA 1FWKA 2HRUA 3DXKA 3MCSA 2GVZB 4JRQA 4DUYK 3EDQB 1RBAA 3EVMA 2XMKA 1F5CA 1Z2LA 4NMXA 4C3LA 1XHZA 3OL8A 3ZTPA 1WUUA 4IO8A 4M3ZA 3PIOL 3C6HA 2L48A 1NGFA 2P9IA 2YVSA 4DX6A 1EAYC 3SDEA 2EW9A 1GAOA 3T1HK 2GWKA 2HK2A 3OFHA 1RHRB 3N0VA 1FKPA 2FYXA 3OD2A 3PHEA 3TUIC 1N33F 2E2NA 1H3DA 3AARA 2KXFA 4L6V3 1X9MA 1C1CA 2QL9B 4ISGA 2YX4A 4Y1CA 1S12A 4WF9L 1Y9OA 1OVQA 1NB2A 2ZH5A 3FZBA 1BO5O 3HLUA 3S7RA 3AT1B 4G9ZA 1U6ZA 2D4WA 2DHAA 4RWTA 3CG7A 1KQKA 4RW8A 3LAMA 2JFDA 1TUYA 2BJEA 1YVFA 4P7TA 3TUZC 3E51A 1Q86O 2HHWA 1VJWA 1YVUA 4DS5A 1FHTA 3ENQA 1BIZA 4MIAA 3CYMA 2D0AA 5BPNA 3M2VB 3NAEA 4ILRA 2NQPA 3LWMA 1FT8A 4C8MA 2M9KA 2D74B 4QR2A 3MPDA 1OH6A 2E2PA 4JRPA 1DFDA 2R3VA 4NCGA 4H0PA 5DQHA 2RMLA 3OUYB 1HNZK 1K0VA 4AHTA 3K89A 2F9TA 4MYTA 4OHXA 4HUGA 3ZETA 2W4DA 5BR8J 1HA1A 4E1JA 4YOWA 3MR3A 1HARA 1LCUA 3SMSA 3M6WA 4LQ9A 4C9DA 2A1BA 2NNWA 3OXGA 1TL1A 1KNZA 4M94A 2YCHA 1UTAA 3CNQP 3AHPA 4J9KA 1RJJA 2UUWA 5KG6A 3V6DB 1M5PC 1GLJO 2I8EA 1KCFA 2RQKA 3IM8A 2L41A 3SI6A 2EFQA 2MLXA 4MQ3A 1T02A 3M9MB 2WSFC 4LUBA 1QVGR 1QAIA 2DNQA 2EX3A 1BI4B 4I6MA 1NDPA 3CCSS 2YTCA 2P51A 1Z1ZA 4DV5K 3LM2A 4JI4K 4UW2A 4LR7A 3R5GA 4ILMA 3CMAN 3G6ES 3AVHA 2JEFA 2B7BB 3K17A 1S6OA 1TR0A 4RUBA 4E7IA 3HFVA 4UY85 5JVGL 5ETNA 3MM8A 1RWWB 4I1TA 3OYNA 2WZ1A 2AYEA 2FHJD 2QC3A 4WQ5A 3DOKB 2BX6A 4JD2B 2VQEJ 4QU6A 3AY0A 5EWEA 2C2DA 3C0BA 1KFSA 2P2CB 4BWJA 4JI2K 4WXWA 1QTNB 1O8BA 2CPYA 1O0PA 4CI6A 1B0VA 1NJXA 5JXSA 4RCHA 1XIQA 4XK8C 3W9JA 1IM6A 5HROA 2CQ0A 1RILA 1XBWA 1HNZF 3NGTA 5BRFA 3IG1B 2IS3A 4U7CA 3C14A 5J2MB 3LM9A 3C19A 5LY3A 5TKYA 1NK7A 1PC5A 5AXNA 2HVZA 2HVHA 3W8PA 2XYGB 4URGA 1DTTA 1R8AA 2XO6A 4DWIA 1X3NA 4HH0A 2HFVA 2XRIA 3TAMA 4AF1A 3OL6A 4CZCA 4B8CA 3AO2A 3R5JB 4O0IA 1Q7YT 1WUAA 3PVXA 2RHKA 2QLJB 4HACA 1V3ZA 2LCWA 3BYRA 5DGBA 4DKWA 4RW7A 5F8LA 2QRRA 4JI3J 2WCXA 2Y1LB 3C94A 4RU2A 1N34K 5HL7Q 1LWFB 4DEZA 3ZT1A 3I82A 3DGVA 2Q6BA 3AGKA 2YI1A 2J9DE 1LK7A 2RH3A 3PRDA 2VQFK 1WLJA 1FJCA 2BUNA 1MU2A 4CTAA 5FPNA 1SJ1A 3NGRA 1IBLF 4TN2A 3H1VX 5KFHA 2E1CA 2ZZMA 3R7SB 4F0HA 2ETJA 3E9LA 2NXJA 2O67A 1X0FA 2H5EA 4AL6A 3IFEA 3PW2A 2DR6A 4W5QA 4KI4A 1A5VA 4OJRA 4DR1J 4JI2F 1F5AA 1E6YB 1LOTB 1WACA 2EWHA 1T05B 2K1RA 1RBSA 1FD2A 2HFZA 3ULEB 2M3DA 1DKGD 2P9NA 3POTA 2PY5A 2J6UA 2IDEA 2A1RA 4FKYA 3D0GE 2DNOA 2BYCA 1F5BA 2JC1A 4DV4J 3HHLA 3WC0A 4L8RB 4BRPA 2MKJA 5T14A 1X5OA 2QEXN 2RJZA 3P96A 4EWTA 4LRDA 3VALA 5DO2A 4H5VA 2DNNA 1RT4B 3QPIA 4MK9A 3MMCA 5I3UB 4OYWA 3I55S 1HNIA 4K4VA 1VK0A 2IBOA 2IAJB 2OPSB 3IS9A 5IT9O 1ITPA 1KR4A 1YI2N 4LF4K 3OLBA 5HBMB 1CULB 1R8PA 3VETA 4M3TA 3QIPB 2G8UA 1S1VA 5JMNA 3BO2A 1N8RT 1HYSB 2DY1A 2O01C 1ZM2A 2PMWA 2DYAA 3BUZB 2ATCB 4USHA 4C23A 1PYTA 2COLA 3VAFA 3IWXA 2QW9A 4AQYF 3V2UC 2ZJRL 2O8DA 4F3QA 3QIOA 3GCXP 1ZC6A 1LWCB 4KREA 1GTEA 3H5YA 4K0KK 3I0RB 3QEPA 3L2RA 3K2PA 5ETVA 3KG1A 3JTOA 5C0YA 3RR8A 5H9FK 3GB0A 5I3PA 1IKWB 2ILYA 4GKJF 3SBGA 3BPDA 3HYFA 3A1YG 3L9ZA 3VGMA 4YDUA 3JQKA 1IR0A 2C2RA 4X4PA 1DLOB 4A59A 5IWAJ 4Q5VA 2PT0A 4OHZA 4JV0A 2D69A 2OPQB 3MXHP 3M8QB 2HGMA 4GV6A 4ILGB 3MM9B 2KDOA 1NKBA 5C12A 5ETKA 4I9QA 2Y0SD 4MO5A 4P7VA 5HMZA 3S01A 5ETPA 4MIWA 4ZLJA 5HVGA 5HLFA 2DNPA 3U3YA 1Q18A 3C95A 2VWKA 4LF5K 4FWKA 1G7CB 1S1UB 3BKFA 5T7BA 4CEEA 1N6QB 4FVCA 1Q95G 4FWRA 5EX5A 3ZT4A 4OPAA 3WNHA 3C6TA 1NDLA 4KB1A 3OYBA 2HHTA 3R9LA 1OPZA 4W5TA 4J7CA 2V8VA 2C1EB 3DN9A 1XMOF 3P45B 4H4OA 3IAM9 4UUXA 4LF4F 3CETA 4ZIVA 2W2MP 3M32A 1J53A 1HNWF 4RW6B 3QZ8A 3LPYA 1HIYA 5F0UA 2BGGA 1S49A 1XEZA 1JIHA 3R97A 3J7ZT 2E5LK 2QLWA 4U9RA 3N28A 2CQ2A 2MQOA 2DKOB 2NLWA 3VVTA 5A2QY 2Q3PA 4BGAA 1S9GA 3AAPA 1FEEA 2JJ4D 2XO7A 3L3UA 3R8EA 3RG6A 4GRSA 2EVZA 3KK3B 2ZWOA 3G8QA 2H4YB 4BROA 1CJTA 4IEIA 1I94K 3OYGA 1S5JA 3AA4A 3TTCA 2YX7A 1KXPA 2ADCA 2HURA 3MPVA 4ZP7A 1KC8O 3GG0A 4W5RA 3MXIA 1VQON 1D9AA 1N56A 3UKRB 2VICA 1VQMS 2GV9A 1RT5B 5LJVA 1H2TZ 5LM7E 3DXMB 1WEZA 3OS1A 4GMKA 4B8AB 1XMQK 2IJNA 4A2BA 1ZM3A 1HQEB 4OHVA 4OI1A 4CO2A 3M8YA 1G6BA 5D78A 2R42A 2RAQA 2QFJA 2CDQA 3A8YA 4BGBA 2ASYA 4K8RA 4B3TK 4LC9B 2M0GB 4WE1A 1F9HA 2YWFA 3H3NO 5BPLA 3RUBL 3W2VA 4DQIA 2CRLA 4JV5J 4V19J 4BC5A 5MAOA 4MH8A 1UWBB 2LXIA 3R7NB 1VQ9S 1NGAA 5BREA 4OZ2A 3O3HA 3M6GA 4WU3A 4DSJA 2GVDB 1OVYA 2GQCA 4NO7A 5FRMA 4PKGA 4LBHA 5F0XA 1BG3A 1U2VA 4OJGA 4ZPDA 3TTFA 3QYYA 2VUGA 4C0BA 1IJFB 2JWLA 3DLLQ 4OI6A 3SJJA 4NYZA 4B3SK 2YPYA 1UETA 4PYDA 5KI6A 3AA8A 4HR2A 4HTIA 3QJLA 1HBUB 3P8BB 1VQLN 4LQ3A 3CMEN 5EY4A 3MEGB 3D5MA 1RNHA 1ZA1B 4WYWA 2KYZA 3THVA 4NZ6A 3WXLA 2DCUB 5I3QA 1OQ3A 4JK9A 5B09A 2OELA 4LBIA 1U0SA 3DRRA 1JKHB 4ZCKA 4OYZA 1H1VA 3SCIE 1Q82T 4YNQA 4G3IA 3CCJS 4IFYA 4DR7J 2YWWA 1WSHA 2W9BB 3KK2A 4F9OA 5IV4A 1RE1B 3QNNA 1HBMB 3THYA 3SPYA 3QGGA 2PMZD 3OYJA 1VBZA 4CJKA 4HI1A 1FEHA 4IO9L 1RBOB 2MJUA 4DS4A 4CIOA 4B9LA 3OS2A 5LOQA 3T6BA 3F5TA 1NK9A 5KFUA 4IOCL 1S1WB 5HQLA 1JCFA 2WONB 2I5JA 2CZ9A 2KJVA 2QA1A 4FK4A 5C2GA 4PRFA 4DTSA 4KIAA 5D0HA 4U7UD 1VQ8S 4DPWA 5FRNA 3SAHA 1NPKA 2BJ7A 3HSCA 1RBTA 4M1KA 4LF7K 2VL1A 4XH1A 3CCES 3ISNC 4UOFA 3H2VE 2QX0A 1CVJA 2FLPA 3ZSYA 3K5OA 4EMDA 4GVLA 4ZVUB 1BISA 1YITS 3ETMA 2ALZA 1D09B 3TZWA 1BE4A 3ZT3A 5AXLA 1Q8KA 2E1AA 3KFWX 1T3VA 2E1ZA 2DFEA 2W01A 3T1YF 5G4DA 1HQUB 1S77D 4NLTA 2OEJA 2FDNA 1PIEA 5F8MA 4OHWA 4KI6A 4GVBA 1TL4A 2ZBCA 3CUNA 4DL0C 3AJ2A 3W5YA 5LL6Z 1U2RA 5DG7A 3H1QA 3MMAB 1VQ5N 1ZBSA 5BRHA 1VQ7N 4O44A 3UIQA 2J7WA 2CQPA 2BKPA 4D3GA 1BUPA 4PG7A 4ZS6A 4JKFA 4FJ8A 1L3UA 4PWWA 1KHVA 4CZGA 3SCLE 1A5WA 3L8BA 3QBXA 2ITMA 3SCKE 1HX1A 4IDKA 1SQFA 2P9CA 2FY8A 3KXDA 2PFDA 2NSBA 4RX6A 3DLGA 2AEJA 3Q89A 4N7TA 4DV7J 2NZ4A 4UOGA 1WSFA 3TWHA 1X4DA 1DQ8A 3MR5A 5KT4A 1FJ7A 2P9KA 2R7WA 3BN7A 4USMA 5KFAA 4CH1A 4F3TA 5HK4A 4DPXA 2FXUA 2FJAB 3R27A 1JJ2R 5HP1B 2PN6A 3EICA 1UWAA 2NXUA 3I0SA 3ZYYX 1S72N 1JJCB 4NYPA 4WU2A 3HM8A 3CJ7A 4CJLA 2ADBA 4BWMA 2IA6A 4X66J 2FVCA 3OYLA 4DQSA 1JWWA 4PKHA 2UV8G 2OTJS 2VONA 2YY3A 2VFRA 2ZJPL 4OQJA 4CJQA 4M3WA 4U95A 4A8KA 2OD6A 2V2QA 5EN1A 2MY7A 3W64A 1Q81O 3CJKB 4JHDA 2QIFA 4WK3A 4XPEA 1S1TA 1RTIA 1WNEA 4K8ZA 3R8YA 4CZKA 4ZMMA 5BYRA 1OH5A 1MWMA 2IM2A 4ZVFA 1VSHA 2UUBK 2FVQA 2NR0A 1YJNS 3NS6A 4FL9A 2E7VA 2BQUA 3QZ7A 4LH4A 3CJSA 2W2NP 1PYOB 1SZ2A 4JB8B 4F26A 3TVKA 1IBMF 1JNZB 4BE2A 4OMFG 1XC9A 2P6TA 2VBZA 4IOAQ 4NYFA 1TZ0A 4DCPB 1RAGB 3VVUA 3D2EA 3N6LA 1S97A 3D2FB 3FK4A 1KP6A 1ILYA 2DXEA 2ZUGA 1ZBFA 2GBZA 1JJ4A 2OPRA 2XMAA 4JK8A 4DPUA 4DFMA 4WKRA 4DV3J 3TX0A 4LH5A 2DT9A 4NRTA 1HNXK 1Z2ZA 1JCEA 1AW0A 4OZ1A 3CCMS 1X4AA 2VIHA 2XY6A 3JYTB 3NGYA 3CJ9A 3HX9A 1JLEB 3PIOQ 2DISA 3CDAA 4Z4FA 5HMYA 4DU8A 1WOPA 4IFVA 3D4JA 1CZ9A 2KRRA 1SVDA 1AZSB 3MOZA 5KG2A 1HJOA 2QA2A 1VSLA 2MKSA 2R2TA 2G1DA 4NPOA 3MHYA 2ACMA 4PQUA 2E8AA 2HAIA 2LU1A 5THWA 3TU5A 4K4YA 4WZQA 3SSSA 5KFBA 3Q8SB 4WF9Q 1BA1A 2K7KA 4Z4CA 2HGLA 3WQTA 4B9SA 3QFHA 4Y2AA 3MUTP 5DDQC 2HIYA 2GWJA 7FD1A 3DNCA 4PG4A 4BC7A 3O4WA 4DQPA 3CT9A 1C0TB 3ISND 4DF8A 2IDOA 1KD1T 2VCPA 1LK5A 1VRTA 3NF6A 4KH1B 2XGQA 4ATNA 2VWJA 2RU9A 3VHQA 2CVIA 3A12A 4DOZA 3G6XA 2DNRA 4R25A 4ZKAA 3CCSN 4DL4A 5IT9U 2V94A 3BSOA 2HLUA 1VRUB 3OYKA 3UI3A 1RK8A 3B82A 3IO1A 3T7ZA 3IUCA 4USUA 5K8OA 4GV9A 3BGRA 3F0NA 2DRDA 1VQPN 1T3OA 1T9YA 5G0RA 2B6AA 2N4CA 1QQMA 3P5JA 3LO3A 1RWVB 1KEKA 3CWJA 3PUFA 3DXKB 1QSLA 4A8XA 4KHMA 4U8YA 1FXDA 4RKUC 4OYPA 3DI6A 1T9XA 2P6SA 4IBNA 4OJ3A 4I56A 2ZITA 4Y28C 4NMLA 3ZSWA 2P9IB 2BUPA 3SDEB 1KVAA 5AFUH 1V5IB 5D6GA 4BC9A 2N82B 3CHWA 4PG5A 1QZ6A 1M5OC 4KSEB 3TEHB 5BPMA 1FKPB 2KT3A 3FC9A 1QSYA 3MFHA 1RADB 1T9VA 1PBAA 4HHHA 4CGJA 3BGFA 3CW2C 5KT6A 1NKEA 5JVGQ 2E5JA 4FOIA 2R7YA 3UE5A 2CYYA 5JS2A 3OPKA 2X6NA 3D1OA 1GXTA 1OYEA 1UVMA 4YY3J 3DXBA 3VQAA 2YQ0A 3EGWB 1NGBA 2DGXA 4RW8B 1YWXA 3HD2A 3I5BA 2DTJA 2E4LA 1IM4A 4Q8EA 3HVWA 2YXLA 2ZOGA 2MTLA 1S0VA 4NYNA 1JQGA 1GX5A 2EBEA 3PEHA 2RDIA 5MLCQ 3K58A 2VQEK 3A5NC 1JLCA 3DU6A 2RN2A 2ERRA 2MGZA 2FF3B 3H0PA 2ZGYA 2YX1A 2XHWA 4KTWA 1WG4A 4JKEA 1TUUA 4NCGB 5EGYA 3F2KA 2VGNA 5E2QA 3E01A 5AZIA 2HBMA 5CHIA 5GAEU 3ZETB 2ZOMA 2HHHJ 1KS2A 4H0OA 4ZLNA 3NS5A 3OYMA 3DOMA 5T7LA 3HT0A 1OWXA 3W1YC 3RAMA 4OX9F 5KG1A 4FYDA 1TL1B 2MB0B 1RA7A 4BRIA 5BR8F 4WFNL 5IM0A 4IG3A 3SUPA 3EUNA 1XNRK 1J9AA 2X74A 1FVSA 3EKSA 3J7YI 1EB0A 1Y3KA 2AEFA 3PJXA 5DZ7A 3D67A 1RT2A 4I6MB 5KFPA 3SIPB 4LT6A 3KHLA 3JTPA 4HWIA 5FJ4A 2V8GA 3M1VA 3ASMA 3DYAA 2WFBA 2CWKA 2IBKA 2DH8A 3W66A 4X64K 3LQVA 5E41A 3MAAA 3V9XA 2VU5A 4QIFA 5ETSA 4ER8A 1Q1KA 3CIPA 4Q0BA 3TARA 4ECSA 4ID8A 2V8DA 2DNLA 3MM8B 5BR9A 2Z1GA 1W0HA 3JSMA 4HI2A 4OV6A 3UD4P 4XDCA 4DTNA 2KKHA 1S76D 2W9CA 3KHRA 5LXRA 3R3TA 4FXVA 1B9DA 1NHUA 2Q31A 1YGYA 4E7KA 3H45C 1MN9A 1NRKA 5D0RA 3KD1E 4DSFA 2A3JA 4OX6A 3W3SA 2OANA 3HHEA 3DM2A 1I3OB 4P75A 4CJTA 4CK3A 5BYQA 1TUVA 4NWBA 4AM7A 5HROB 2XLJA 4X65K 2RRAA 3RBXA 4E7JA 1BUXA 4JKBA 2H4WB 3C14B 4QOTA 3U8XA 2GMHA 4BHQA 5JMVA 4MIBA 2MDAA 3ZFVA 1DTTB 4RU9A 4KTQA 3DC2A 1NK6A 4DV4K 1OO0B 3TAMB 1K8AO 4ANDA 3GP9A 1U1KA 3J7YU 2RUGA 4FWMA 2Z4PA 4CJSA 3CJTA 3RB4A 3NHGA 2XSJA 4HACB 2ZBPA 4B1WB 3D66A 2ZJRQ 1XNQK 4KB7A 4Y2IA 2AJQA 5IFMA 3PIPL 4RW7B 2AGPA 3Q8PB 2FZGB 2IYGA 4CT8A 3ZZPA 1F21A 4RUAA 2UUCK 2J5AA 2HZCA 3KTQA 1NOZA 2O3DA 4QWCA 4FJNA 2NPIA 4JI3F 1FJEB 4X62K 3OYDA 5L39A 3H5SA 1MU2B 2QWLA 4CTAB 3M2UA 4P2SA 3EN9A 5D8HB 3VOVA 4TQRA 5C25A 3LALA 4DFKA 2EXUA 3M4XA 1WBDA 3KKSA 4CGDA 1NBWA 1Q86T 5GIPA 3RTVA 3HBTA 4M7YA 4ECQA 2FLOA 1NGJA 1FFWB 4DLGA 2O8CA 4EK2A 4IFEA 1X5TA 3CFOA 1HBOA 4CHNA 3IC1A 4X4TA 1IKYA 2K1RB 4JUZA 3BBBA 1I39A 4DR1F 5D3GA 2BJ3A 6FDRA 2P9NB 2G9OA 5M1PA 5HRSA 3POTB 3GBTA 2KHOA 2DJWA 3SMPA 1MSWD 3C65A 3HHLB 3SQ2A 3I8BA 1E3MA 4K5SA 2UVWA 2FTRA 5SZTA 4TY8A 4A8WA 1K6YA 4DV4F 3VMFB 1BHNA 3MMCB 3VGVA 4WJBA 5ELZA 4QWAA 3I31A 4GMJB 4LF9K 1HNIB 1SQEA 2HBYB 4K41A 3AO4A 1VSKA 1D9FA 2GV1A 5ETMA 1BMQB 3GPAA 3TR5A 4GVEA 3IS9B 1S99A 5M1NA 1RFQA 4ELVA 2WBNA 3CMQA 3R5BA 2B0GA 4OVLA 3ZZTA 4HHJA 2VFVA 1S1VB 4M5KA 3OTDA 3WEEA 3GFHA 3M8RA 3PYEA 5DQGA 3K0SA 1KONA 4CIEA 3R2DJ 3OYAA 2LEBA 2O8DB 1WI8A 4WFZA 3ZTOA 4DSKA 2CQ1A 2DNYA 1NJYA 3AFGA 2DPIA 3LWLA 1V4SA 3CC4N 1U1NA 1BQXA 3EX7B 4OI4A 2ZOFA 3QGIA 1RWMB 1EWQA 3AAWB 3MURP 3JTNA 4DU4A 3CCZA 2FVSA 2OYQA 3HK2A 1HL6A 5DGAA 4C3KA 4CK2A 1UJ4A 2GIFA 1RABB 4C11A 3KJVA 1Q7LB 1VC0A 4OYXA 2UUAJ 1GOCA 1X1PA 3LDOA 1W7AA 1CBKA 5IWAF 3RW6A 4ENOA 1S0MA 1QAJA 3SQOP 4B9VA 4CEDA 2ZH1A 1YJVA 4CO1A 1T6DA 4QS8A 3OR2A 1D0EA 3DRPA 1SJQA 3TSUA 4A57A 3LDPA 3A13A 2GA7A 3MCAB 3DDIA 1UVIA 2VPXB 4DMNA 5HLFB 3M3ZA 4CBXA 1DURA 2YNHA 3PR5B 3H4BA 2MMYA 3CGIA 3LAKA 1ATNA 3CD6N 4Y2KA 1FX4A 3C6TB 4KBIA 3TWZA 2YJEA 4P2FA 2QMUB 3PEJA 3FMBA 4JV5K 2XWXA 3MMVA 4CHZA 3P6YC 3UW1A 2J8AA 1UW4A 3CJRA 3UN3A 1XJWB 4UZCA 4H4OB 3SQGA 3I87A 4J5OA 4DCOB 5CQGA 1M5VC 1IQTA 3M32B 3HOSA 4JV1A 3I9ZA 1GLCG 3CDWA 4LF1A 1FTRA 3NH1A 3CDUA 4QCLA 3TQEA 1YIJS 4YDDB 3VGSA 1GOAA 3T6JA 1TYQA 4GVMA 3LGNA 1NSPA 3D6FB 2PYJA 1NBEB 1VQ6S 2JL9A 3D68A 4J8FA 3PY8A 4ZPWR 4USJC 1S9GB 1EP4A 1EARA 1FNOA 1WSIA 4WFAL 3UWTA 4J9LA 3H90A 1JLAA 1S9EA 5KFNA 2F9DA 2ZF5O 1CJTB 3IRWP 3G87A 2GEMA 4IZ9A 4YMEA 3UFCX 1WBBA 2GCFA 1TUWA 3LGMA 4DSLA 1NCLA 3OYIA 3MPYA 4GKKJ 2HHXA 1VRQC 4Y34A 1VJQA 3DRXA 2ZEJA 4IO9Q 2UXCJ 4JN4A 5F1XA 5HATA 3GE1A 4ZJQA 4LSNA 3UCUP 3V6KA 1OY8A 2A42A 2HNYA 3KLEA 5KFLA 2PEBA 1Z6RA 3ZCMA 5CH7B 4DR7K 3K5NA 1HBNA 5F8GA 1GLLO 4IOCQ 3RAQA 4PWDA 1N48A 5A8WA 2MKIA 4ZVHA 3QAEA 5KFJA 5F0WA 2ZH9A 2DNZA 3WNEA 2ASDA 3M2RA 1QJHA 2X3DA 2DD8S 4WE1B 2XMUA 5AQHA 2JX2A 3W2VB 3QETA 2CQIA 4DTMA 2KVIA 4LR8A 1YF5L 3BP8A 1J54A 4HH1A 1KQSR 2O4IA 1JXVA 3GYGA 3SBTA 1U2VB 2BM1A 4FJKA 3P83D 3J7AN 4DV0K 4V19S 5LMUJ 4XIUA 2HSTA 4DR5K 1ICEB 4CHPA 3LW5C 4KR0B 2JSXA 1IBKJ 3VESA 2DIVA 1S4FA 3VAMA 2G8KA 2ZC3A 2Z1JA 3W60A 1PG5B 5CYQA 4JLHA 2E5GA 2B7CB 3HSGA 5LT5A 3KWMA 2CPDA 1KAXA 1FRLA 3UNYA 1JL1A 2IIHA 5KFOA 3DRRB 1HPMA 4F0KA 4ZVTB 2EFOA 2CADA 2P9LA 4UQGA 4PXCA 2FJWA 3JQJA 1H6KX 2C2OB 5C10A 4IFYB 4KH0B 3NL0A 4WYLA 2W6KA 2E5IA 3KK2B 5FDLA 3N6MA 3THYB 5GAGI 1S5ZA 1RZMA 4KHSA 4DR7F 4CI0B 4IH7A 4H5NA 5J2NA 1AROP 2A1SA 4RLEA 4A8YA 3LZIA 2I0XA 3AXMA 1YJ9N 4X4RA 4CO3A 4DV7K 2RB7A 4WTYA 1G2EA 4O3QA 1NGDA 2WVDA 2LYVA 3KYLA 2I5JB 4JKAA 4JOUA 3I5AA 5LJWA 4ILJA 2LQ9A 5AFUA 2FHKA 3FSYA 1PBUA 4NL5A 3DXSX 1EZZB 3U9DA 3FCWA 4NI2A 3TOQA 2ZJPQ 1WHWA 4OYAA 5KRSA 3L7OA 4DQRA 2HW3A 4EBEA 4DV1J 2HG4A 1IBLJ 1RDUA 3C6UA 4E8UA 3CPEA 1K73T 3G8SA 4FNHA 4H0YB 5M2RA 4I9LA 4X66K 4XH4A 2Q97A 3ZZYA 2XYPB 1RLCL 4K2XA 3D2WA 3QMLA 2G0CA 5FD1A 1FKAF 2H5JB 4R0JA 2EK1A 4BVOA 4GVBB 1U1OA 2NRRA 2DR8A 4KBOA 4LFBK 4DR4J 1WF2A 3WUHA 1N52B 1SJFA 4CEZA 4KPCA 3KG0A 2ATLA 3VEYA 4O44B 4ZP9A 4I69A 2QLXA 4IOXA 5AQLA 2JVOA 3M6VA 2CNLB 1ASUA 3HJVA 4F4KA 1FXXA 4FO0A 3A8JA 4CLTA 2R4FA 5IT9Y 3OYCA 2NSCA 2HFUA 4IDKB 3O8WA 3CF5L 4EP5A 3MWPA 4W90B 1KC8T 3PX6A 3MX2A 4EUVA 4M5GA 4M5LA 3DLGB 4XO0A 1S7IA 4ZA1A 2HBQB 3AA5X 3Q83A 4JI0K 3CCLN 1KOHA 3MTJA 2CA9A 5IT4A 2E2OA 4PR6A 2AEMA 1G99A 2P9KB 3R5CA 2FLNA 4H4MA 3AJ1A 3T5KA 1KVJA 3NGKA 3CE8A 1VIOA 3FNNA 3PO5A 1LV5A 1RUSA 1SV5A 3BM7A 3I0SB 3FCVA 3FVYA 3OA9A 5T41A 2XI3A 2E7XA 2VB6A 1OQ6A 2D9OA 2OI2A 2XMJA 4O0NA 5CHCB 1ZZFA 1GNKA 2ZJQL 3KOAA 4ZVGA 1LXNA 3OYFA 5HRRA 2VC1A 2Y0BB 4BC2A 3TJ9A 3S41A 2ZWPA 1AXQA 4X66F 4RNHA 2BBEA 4JHDB 1VSFA 4Z4EA 2K7JA 2WVCA 4QBUA 5AQSA 2OIHA 1S1TB 1RTIB 2D0CA 4B1YB 4BRCA 1TKZA 2BEFA 1DT9A 5HRPA 2B4VA 3KD5E 1RAJA 2JWKA 3IMQJ 1WDTA 2RS2A 1QQCA 2AYGA 4FLWA 5KFVA 5RUBA 1MLAA 4GO7X 4IKAA 3L6QA 1T03A 2JHEA 3HI9A 4NCBA 2QWNA 2C2NA 2SXLA 4I67A 3VWSA 1O1WA 2OSQA 3HFKA 4PXBA 1FFSB 2QYGA 2D41A 2D0BA 2GFFA 3TAEA 3HDSA 5HAOA 3W0LA 1KQSM 5KAKA 1RQ0A 3MN9A 4FJ7A 2M70A 5KT5A 3HTVA 3RBEA 2PI5A 3D2EB 3BSNA 3A5OC 4DR6K 5HI7A 3G96A 4CZHA 2OPRB 5B7WA 4AHCA 2BANA 3RW7A 3IWNC 2AJ0A 4GNIA 4C2MA 3ZSXA 2C3MA 5GAHP 2JC0A 3SQ1A 5CY4A 2C2MB 1MMNA 4GC6A 2F1FA 4MYUA 4QJVA 1BLUA 3GFZA 4IRCA 3AVMA 2MXYA 1VQKS 4Q44A 4DV3F 3QRQA 3WNGA 4GW6A 4URSA 1RA6A 1U1QA 4BRLA 3W5ZA 3I6PA 3QAUA 2BXJA 3THXA 3FRYA 3BPSP 5E7OB 2VHGA 4E98A 1A5XA 2WRMA 3H25A 2FJXA 4K42A 1MNEA 2W9AA 1I6JA 2HS0A 4J9NA 1OKJA 2R8JA 1TTHB 4HYKA 4MT1A 3PCOB 4IFVB 3KLFA 3D3CJ 3Q2TC 3H3OB 4X4VA 3K5MA 1E6VA 2OTLN 4E0DA 5K8NA 2G4BA 4CP5A 2VBXA 3IAS9 4DV2J 4DTUA 2H3EB 1ZETA 4PQUB 4CECA 1WTBA 1MMLA 2DY9A 2Y9HA 4Z37A 3T3FA