1DTQA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-1 (pett131a94)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/transferase
molecule keywords HIV-1 RT A-CHAIN
total genus 134
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dtqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dtqA05
4YQWA 4URGA 1HNVA 4NLOA 4J9PA 2RDIA 2NUBA 4IRDA 4K4UA 2E9TA 4DTUA 4O5BA 2R2TA 1S6QA 1BI4A 2OPQA 4CE9A 1Q9YA 4KAZA 4B9MA 1CLQA 4IBNA 3G0ZA 4ED8A 3OL6A 3KTQA 1DTQA 3QLHA 2B43A 1LWCB 1MMLA 4OLAA 3TAEA 5F8IA 3EPGA 4NLDA 1T94A 4CFBA 1J5OA 3MR6A 1S48A 4CK1A 2Z1IA 4DSKA 4CHPA 1GX6A 3S3OA 1D9DA 1YTUA 1NKBA 4DSEA 3V9ZA 2YNHA 5F9LA 4K4WA 3I5AA 2HHSA 3OL7A 5KFMA 5EUHA 3H5SA 3KHLA 2XI3A 4PWDB 2ZQBA 4ID5B 3H5UA 1SV5B 3DRPB 3VN5A 5FRMA 1VSEA 1C0TA 5HRSA 4C8MA 3AA4A 3PV8A 3AVJA 2OPRB 4RZRA 3VQAA 1XHXA 4FVMA 5CZ2A 1T7PA 1X9WA 2Q3SA 4F4KA 1FXXA 4TY8B 4QWBA 3CWJA 1L5UA 5J2NB 4KHYA 3DI6B 1REVA 3C94A 4NCBA 5D3GA 1QUVA 1RNHA 4EBCA 4F3OA 4I2QB 4FCYA 4DFKA 4I2PA 4FZYA 4Z4CA 4WFYA 2AGPA 1TAQA 3M8QA 4KB0A 1HNIB 2FJVA 3WNGA 4MK7A 4Q43A 4GMJB 4XO0A 4FLZA 2B6AA 2J6TA 3BSNA 2HNZA 4DL7A 3PZPA 4OVLA 3IS9A 4NLPA 1WLJA 4ED3A 3TANA 5KG0A 1A5VA 1SH0A 3OYIA 1S0NA 4K50A 4NYNA 5KG1A 2I1RA 4RUAA 4Y1DA 4QAGA 1BISA 4WZQA 4DG1B 4FJIA 3O3GA 3NGDA 4FLXA 1SH3A 3MEEA 3NFAA 4ED6A 3L2QA 1S1TB 1XHZA 4IH7A 3GIKA 4CGHA 3V9UA 2R2SA 4TN2A 2AU0A 3AV9A 1BGXT 5JXSA 1D8YA 3DRSB 3ALYA 1J53A 3A2FA 4OKKA 5C42A 4DF8A 4J9NA 4DQQA 3DLEB 4CGDA 1BQNB 3KLGB 2YNGA 3OYNA 3SFUA 4KBIA 4IFYA 5E41A 1QE1A 2XGQA 1S1VB 1VRUA 2YNHB 2OA8A 1S5JA 3ZSXA 3DI6A 2FBVA 4RW6A 1TL3B 1S1XA 2AX1A 4TY8A 1RTJA 2J6SA 3CJ0A 1N48A 4FLUA 1RT7B 4Z4GA 1RBVA 4DLEA 3DLGA 2JC0A 4KB1A 4RW9A 1RDRA 3QYYA 4CF1A 4DQIA 4CJFA 4KKOA 2ASDA 5FROA 4FW1A 1LW0B 2IM3A 5C24A 3QIOA 2PYJA 3NHGA 3PJXA 1LAVA 5EWFA 2DFHA 4K4ZA 4FBTA 4J9LA 3ZSYA 3ZT2A 3GILA 3QO9B 3HJFA 4ECRA 4Q8EA 1DTTA 3KHRA 1UOCA 4DFPA 4ED2A 3NF6A 3D45A 3GQCA 4ED0A 1HJRA 4URQU 2G8UA 1L3SA 1EKEA 4NZ0A 1VSLA 3D28A 3I5BA 1EX4A 3K5OA 1ASUA 5FDLA 1S10A 2ZD1B 4ICLA 4R5PA 3NAIA 4FJ7A 4IR9A 2G8WA 3KHHA 2KZMA 1LWEA 3L3UA 4IH6A 1SV5A 4ELTA 1S1XB 3O3FA 1TKTB 2OPSA 1NJWA 3DOLB 3OYKA 3DOKB 3ISNC 1YT3A 4JS5A 2IGIA 1IM4A 1RT5B 4KSEB 1RBTA 3H2LA 1F21A 3MAQA 3H08A 5CY4A 1XR6A 5KRSA 5DMRA 1C1BA 4MQ3A 3V81A 2VWKA 1TV6A 3MR3A 4AHRA 1JLCB 3VQSA 2HNDB 4RNNA 3AA5X 3LP1B 2XHBA 3MFIA 4ED7A 4J2DA 3V9XA 1JXLA 4CEFA 2KW4A 1MU2B 4PQUB 4J9RA 1QSLA 4NLGA 3ZSWA 3G86A 1KTQA 1VSMA 1N6QA 2VG7A 1GOBA 4DU1A 3LDSA 4NYZA 4FLWA 5DGBA 2CJQA 3H98A 1RA6A 2VG6A 4W5RA 3NAEA 3RB6A 3OYCA 5F8NA 4KHRA 3DLGB 3DLHA 2VWJA 3I0RB 4CIFA 2P5OA 5KT4A 1RT3B 3ZSVA 3SCXA 1RT2A 2R7YA 4QW9A 4YMEA 5CZ1A 4FBUA 1BL3A 2HHQA 1LWCA 1BQMA 4QWDA 1XI1A 3QEXA 4CF9A 2KQ2A 1S9EB 2XC9A 4M95A 2W9CA 5HRPA 3MXMA 3OLBA 1S6PA 4KV8B 4ELVA 3NH0A 4EP5A 4CHZA 2X74A 4EYIB 3Q8SB 3V81B 4AILC 4Q8FA 5D3GB 3DRRA 1S49A 4BDZA 5C42B 1HQUB 4WE1A 2ETJA 1NK8A 3JYTA 4KB7A 2BRKA 2HNYB 4ECQA 1JLFB 3OHAA 2C2RA 2JLEA 4JRQA 3M8QB 3NAHA 1LWEB 1JLBA 2O4IA 2V0NA 3H5XA 4DSLA 3ULDA 3HPHA 4ZVEA 2BANA 4DL6A 3AVAA 4M3YA 3T5KA 5KTQA 4W5QA 2IA6A 3HVWA 5J2MA 1HPZA 1RDAA 3IGNA 4K8XA 2KFZA 2RN2A 1RTHB 2PZSA 4R8UA 4DS4A 4QW8A 1HQEB 4H4MA 3E01B 2EC0A 2W42A 1RT2B 3SPYA 1WAJA 4FJ5A 3PR5B 4I7FA 3HVTB 2D41A 4RW4B 4NLRA 3G6YA 4IG3B 1Q8IA 5KGWA 1BI4B 3V1QA 4CJVA 3MEDA 3PHEA 3NMAA 2FJWA 3DM2A 2VG7B 4OPJA 4N41A 2XO7A 5J2QB 3ZSQA 2HHXA 4MH8A 2G8FA 3CFRA 1WSGA 4CFCA 4DQRA 4KI4A 1S1WB 4Y2AA 2DY4A 3AO1A 3VQ6A 3TAPA 4R8UB 1C6VA 2QE5A 1I3AA 4H4MB 1DTQB 3VQDA 3QEWA 5KFSA 3AO3A 2HHVA 3QLHB 4J2EA 4YR3A 4OKEA 3UR0A 4DL4A 3PUFA 1IKYA 4CEAA 4DTJA 3QZ7A 1B9DA 2GV9A 4FK4A 4F50A 2OZSA 3FDSA 3NKYA 4ZVHA 5L1KA 1GOAA 4K4SA 3E51A 4BDYA 1TL1B 4LQ3A 3HYFA 1WN7A 4CESA 4K4YA 4CGIA 4F2SA 4IFVB 3K5LA 1RTHA 2OZMA 2WCXA 4CJEA 2Y1IA 3MTKA 4KFBA 1T3NA 4M3UA 3TAQA 4BE2A 3KJVB 1HNIA 3OL9A 1GOCA 2A1SA 4DTOA 4NLTA 2BANB 1S0MA 3KLEB 4DQSA 1ZBLA 5JS2A 1VSIA 4AHSA 5DGAA 3DLRA 4HCCA 2F8SA 4KTZA 4MFBB 4FJ9A 2HVHA 1QAIA 3Q8QB 1OS5A 3TR8A 4J9MA 3BQ0A 2JEFA 4DWIA 2KFNA 1JL1A 2BDPA 5KFGA 4CJ3A 2DPIA 5F8JA 4OJRA 1S1WA 3GV5B 4CF2A 3BGRB 3EZUA 3NF8A 4EYHB 3T5LA 3HO1A 3ZSOA 3TARA 1IO2A 4F3TA 4E0DA 1SUQB 4R0EA 1VSKA 4K8ZA 2WK4A 1IKYB 3QZ8A 5FRNA 4B9TA 2W9AA 1C0UA 3CM5A 2HHUA 2R8GA 4CIEA 1I6JA 2HW3A 2WOMA 3C6TA 3H5YA 2UVWA 2A1RA 3LP1A 3N6LA 3OJSA 3LAMA 4W5NA 4KE5A 1LW2A 3QGHA 3GV7B 4EBDA 2HNDA 4X2BA 3NF9A 5HRRA 3KLGA 3TAGA 3RAXA 4H4OB 3AVNA 2FVQA 5DLGA 4ZP6A 2D3UA 4CGJA 3V6DA 2XI2A 1NHVA 2GIRA 3DLKA 4FS1A 2BE2A 4Q0BB 4NLWA 5KG6A 4GC7A 1WSHA 5K14A 5C5JA 4B9NA 4MK9A 3HT3A 4MIAA 2E9ZA 5HRNA 3P5JA 3NGYA 1U09A 4LH4A 3IG1B 3HXMA 3QINA 4FM1A 1TK8A 4HUEA 4Z4EA 3CVKA 1XR5A 1QHTA 1VSFA 3NGZA 1UWBA 2W8LA 4EBEA 2B4JA 3HL8A 4GVMA 4PUOA 2RDJA 4FK2A 5KFDA 4FJXA 4WYWA 3VQQA 1TAUA 4XPEA 3CJ5A 4QWEA 4K4TA 3K5MA 4IRCA 1RCHA 1EP4A 2R8JA 3OYGA 3HKWA 5CYQA 1GX5A 1X9SA 4RW7B 1KRPA 3AVGA 3BSCA 3NGIA 5KFRA 4K4XA 4O44B 4K4VA 3I0SB 3ICLA 4DL3A 4E7IA 4ECTA 3JSMB 2UVRA 3LZJA 1IKVB 3B6PA 3F73A 4KO0A 4FZZA 3K2PA 1JLGA 1K6YA 1RTDB 3EZ5A 4Y34A 3KIOA 3LP3A 4QPXA 3V6KA 2YNIB 4G1QB 1DLOB 4JV0A 3FQKA 3GIIA 1NJYA 2BR0A 1TV6B 4IG0B 4ZMMA 3K59A 1KFSA 4EZ6A 2YNIA 5KT6A 4TQSA 2AWZA 3V9SA 3TVKA 3T3FA 4AHVA 3CM6A 4CEDA 3SYZA 4PY5A 4J2AA 2WONB 3OSPA 4WYLA 1RYSA 2JEJA 3KK1A 2YKNB 4DU4A 1D1UA 1JLAB 1IKXB 4HKQA 3DLBA 1T05B 1C1CA 3V4IB 3HVRA 1ZBIA 4ECZA 3NH2A 3KD5E 3EYZA 4IR1A 3O4QA 3SFGA 3AA2A 3TAMB 3HSTB 1TKDA 4IQXA 2V4RA 5HBMA 4DU3A 3TQ1A 3NL0A 3GV8B 3KLVA 1K1SA 1HARA 2GBZA 5KT7A 1FK9B 3U6FA 3OJUA 1HMVA 5KFVA 4KHQA 1ASVA 4CJPA 3JYTB 1HQUA 4WE1B 3NBPB 1TKZB 3KMQA 1T8EA 2KZZA 3IRXB 1LWFA 1R0AB 3KLEA 3ZT3A 1QSSA 2EX3A 1S1UB 5C24B 3G6VA 3TWHA 3SQ0A 1XWLA 1JKHB 1TKXA 4C8OA 2W8KA 5J2PA 4E1NA 3VA0A 1VK0A 2P5GA 4F4YA 5J2PB 1G15A 1FKOB 4DF4A 4M3TA 4CEBA 3IGVA 3P1GA 1KFDA 4CGGA 1J9AA 1N5YA 3KK3B 4CERA 4NLSA 2OPRA 2W9CB 4W5TA 4IRKA 3DRPA 2X6SA 1C2PA 3KLHA 4CCHA 3NBPA 2XRIA 4Q5VA 5F8MA 2OH2A 4IDKB 4GC6A 4O0IA 5L1LA 3OYMA 1VRUB 2Y1JA 3M8SA 2XY6A 3CJ2A 4H8KA 4ZPDA 1TK0A 4LSLB 2C2DA 3OYAA 4RW4A 1MU2A 3LPUA 2DPJA 4I7FB 5C25B 4U6PA 3HHKA 4TXSA 3QIPA 3VQPA 4KTQA 4Z4FA 4ZTFA 3I8DA 5F8GA 1YTAA 1QQCA 1HQEA 2FVRA 2X6NA 2WOMB 3V9WA 3QIPB 1JLAA 5KI6A 4IKFA 1HYSB 5DLFA 4O3NA 4AH9A 4Y3CA 4E89A 4F2RA 4DTSA 4O3PA 3G6XA 1KHWA 3CIZA 1A5XA 1NNDA 3KLFA 1YVFA 3MEEB 1BCOA 3RMAA 4WXOA 4DL5A 2WB4A 4C8LA 5KFTA 3T1AA 5KG2A 5HP1A 3N6MA 1IG9A 4OL8A 4DFMA 1QTMA 3HP6A 4NLYA 4NLVA 4B8AB 5I3UB 4WFZA 2JGUA 4KRFA 3UIQA 3SUNA 4YP3A 1FKOA 1NJXA 5I3UA 1JX4A 3KK2A 1KCFA 4LSNA 4FS2A 4CHQA 4RNFA 2JEGA 1KLNA 4FZXC 3UQSA 4FJKA 2X78A 3L2UA 3CFOA 3L3VA 1KVAA 3DMJB 4J9KA 1RBSA 4CEOA 1ZTTA 2HWIA 4N56A 4ZHRA 5EDWA 4MIBA 3DMJA 3OHBA 4O55A 4DEZA 1BHLA 1WSFA 3PO4A 3OL8A 1S9EA 4GW6A 4KFBB 3F9KA 1JLFA 1X9MA 4NLUA 4ZP7A 4WFXA 2IC3A 1I39A 2YHAA 4FLTA 1JLQA 2HVIA 1QS4A 1TL1A 3C95A 1VRTB 3OLAA 2G8KA 1D9FA 5KG4A 4G3IA 2YHBA 2FBYA 5KFPA 3KLFB 3LP2B 2BQ3A 4F8RA 4O0JA 4WXWA 5KGXA 4J9SA 2ILYA 2VA2A 3U3GA 4JS4A 1IH7A 3PW5A 4O4RA 5KT3A 2BGGA 3ZT4A 4XPCA 3RBEA 2HAIA 4RG8A 1L3UA 3RRHA 5C25A 3NF7A 1RDBA 2JEIA 3I0RA 1Z25A 3ITHA 3I5CA 4N47A 2V9WA 4M45A 1RT4B 1WSEA 1S6QB 4O3QA 4C8KA 5KFNA 2CKWA 5EWEA 2W7OA 4DSIA 4TSXA 2QKBA 1HNVB 1WNEA 3DOLA 4CFAA 5KFWA 4H4OA 3HVTA 4RW8B 3H4BA 3IN5A 1VRTA 3LWMA 2BRLA 5JS1A 4CIGA 1FK9A 2ZD1A 4CJWA 3GIJA 4E7JA 4UQGA 3LPTA 2FVCA 5J1EA 2IM2A 4DG1A 4CJUA 1HPZB 3SV4A 1HRHA 1S9GB 2RKIA 4BWMA 4C8NA 3OS0A 4LY7A 5DQIA 4OGEA 3IRXA 3H59A 4FJLA 4LH5A 1C1CB 4CJ4A 2VG5B 1CSJA 3BJYA 4ELUA 4DTXA 4H54A 2IBKA 3WNEA 3V1OA 4B3OB 3OS1A 4M3ZA 4M94A 2AGOA 1SL0A 4DTNA 1B9FA 3IS9B 4HYKA 3WNFA 2D7SA 4M42A 5HROA 4JV1A 2W7PA 5DQGA 2IJFA 2IJNA 2W9BB 4F4XA 4ZVFA 4IKAA 1W0HA 2FVPA 3ITHB 3TAMA 4TYAA 3AVLA 3CFPA 1ZBUA 3AVIA 5KG3A 1RTIA 1TQLA 3CQ8A 4RNHA 3NCIA 3VQ4A 1SKWA 3PW7A 4J9QA 5F8HA 3PW2A 4KTWA 3ZSRA 4BDPA 3V6DB 3L2VA 2G8VA 3HP9A 2IM0A 4LQ9A 4IFYB 4BE0A 1RT3A 1C1AA 1SUQA 3RRGA 3OYFA 2R2RA 3MR5A 1Q9XA 2EHGA 1EP4B 4B9SA 1K1QA 1RILA 2VG6B 2QV6A 1ITGA 3G10A 1T05A 3MECA 1UA1A 4KO0B 4URSA 1XR7A 1A5WA 3AVKA 5KFAA 1RTDA 4KPYA 2HMIA 4HTUA 4DFJA 1S0OA 4ECYA 3L2RA 4OKJA 4E1MA 4FJJA 4B3OA 1S1TA 1T03A 2HMIB 2YNFA 3PW4A 3GYNA 1HYSA 2DFEA 3VQCA 1J5OB 4N76A 4ZHRB 3VA3A 1RDDA 1U48A 4FXDA 1W25A 2FBTA 4W5OA 3SI8A 3KJVA 5KFJA 2W9BA 5DK5A 1DLOA 3OY9A 2O5DA 4J9OA 3RB3A 3V1RA 5HROB 2WTFA 3BREA 5J1EB 3AO2A 4CEEA 1J54A 1JXBA 4B08A 5T7BA 1CZBA 1JLGB 3SV3A 3SI6A 3OYDA 3SQ2A 4FLVA 1CZ9A 1WAFA 3EY1A 1BIUA 3HVAA 3PR4A 1UAXA 3ISND 4IG3A 2FBXA 5KG7A 5KFHA 1O1WA 1NK4A 4CFDA 2GIQA 1B92A 2VG5A 4E7HA 4YR0A 2G8IA 3HK2A 1SL2A 1TVRA 3AVHA 3RB0A 4ECXA 4RW9B 4LSNB 2D0AA 3V6JA 3AO4A 1S1UA 2AX0A 5CYMB 3MXIA 3QO9A 1DTTB 3CJ3A 1NOZA 1T03B 3FQLA 3AVFA 3KKRA 4DTMA 1QSYA 4LSLA 4FLYA 2HHWA 1C0UB 3B6OA 5J2QA 3SNNA 1RAJA 3BSOA 4CK3A 2Z1GA 2QK9A 3VQ8A 1Z26A 1QAJA 4EO6A 1YVUA 1RT4A 4M3WA 3C6UA 2HB5A 5T14A 1LAWA 4L8RB 3S9HA 4CHYA 2OYQA 4NLQA 4CECA 1LW2B 1ZBHA 2IAJA 4FJGA 2RF2B 5JUMA 4OGCA 3CDUA 1N5YB 1WSIA 1N6QB 3T5HA 3QNNA 3MFHA 5SWMA 2IC3B 4B9LA 2AJQA 1RYRA 1L3TA 3OYBA 3L2WA 5KFCA 1WSJA 2BE2B 4Q0BA 2OPQB 4CJSA 3HPOA 5L1JA 3BQ1A 3QGGA 3DM2B 4O44A 1NK9A 4Y1CA 1WNSA 3PX6A 1KVBA 3LALA 3ZT0A 1L3VA 4EZ9A 1KVCA 1BQNA 1KLMB 4ZP9A 2I5JB 4KHMA 2YNGB 1C1BB 4HUFA 5F8LA 1ASWA 4E7KA 3AO5A 3DRSA 2PYLA 3KLIA 3QNOA 2D3ZA 3SUQA 2R2UA 5EWGA 3CYMA 4CJLA 1RDCA 4FJNA 4CJRA 4KHNA 3RWUA 1ZTWA 3OYEA 1VSDA 3SQ4A 3MXJA 5KFKA 4CF0A 4I9QA 3M8RA 1U47A 4HVJA 4RNOA 5DG9A 4RW7A 3OVNA 4ZPCA 4CHNA 2F96A 2YKNA 4O3RA 4B9UA 5FDLB 3RMBA 2C2EA 2RKIB 2R8IA 2E9RX 4O4GA 1RT1B 4KHWA 4IFVA 1HMVB 5KT5A 4M3XA 4MKAA 4XIUA 4PA1A 3KOAA 3ZCMA 4CEZA 4JV2A 4IOBA 3D5MA 4FJHA 2R8HA 1C0TB 1SKSA 1ZBFA 2ZE2B 4DS5A 5KFQA 4OPKA 1C0MA 3KD1E 3CDEA 5HP1B 2JC1A 3DLKB 4ECUA 1JIHA 5KFBA 2F8EX 4KV8A 4B9VA 2ILZA 2GUIA 3QESA 4I9LA 4RUCA 3RB4A 2J6UA 2IMWP 2FC0A 4DQPA 3DYAA 4HUGA 5J2NA 1EXQA 2E4LA 4ED1A 2YNFB 4M3RA 1S9GA 5KFFA 3RMCA 2P1JA 2XGPA 3KK2B 4IH5A 3PW0A 1RTIB 4O3SA 4FM2A 2RF2A 1CXUA 1CXQA 3KKSA 1JLCA 1U49A 1U04A 5K14B 2IAJB 4NCGB 3LWLA 3NH1A 4NRTA 4E19A 3U3YA 2AGQA 1EETA 4YR2A 3M9MB 1SL1A 2G8HA 1ZYQA 4QCLA 5DG7A 3MEDB 3UDLA 3FSIA 4PQUA 2QXFA 3PX4A 3OS2A 4ZPBA 2E6LA 4ZVGA 2UVVA 4CJKA 4QOZB 4RU9A 3E01A 2OPPA 2DTUA 4ECWA 2VA3A 5KT2A 3QERA 1NK5A 2QKKA 4DMNA 1RT1A 5KFOA 1IKWA 3FFIB 4NRUA 3AVMA 1UA0A 5KFYA 5I42A 1D0EA 3V6HA 3QEPA 3Q8PB 4BE1A 3RAQA 1R0AA 3S3NA 2IDOA 3TAFA 4Q45A 3KLHB 3GIMA 3DLEA 3CJ4A 5HLFA 4RNMA 2PY5A 3BR9A 1BCMA 5CYMA 4J2BA 1S9FA 1VSJA 2HNYA 4KHSA 3IAYA 2WHOA 3NE6A 3SQ1A 4OLBA 3MEGA 2C28A 4EO8A 3PY8A 2IOCA 4AHTA 5SZTA 1N56A 2FLLA 3QEVA 4NLXA 3DDKA 4WZMA 3ZT1A 3T19A 4ZPAA 1Z4UA 3LANA 4Q44A 3VQ5A 2XY5A 3PJWA 1JL2A 4DSFA 1S6PB 3KK1B 3LP0A 1IKXA 4QWAA 4RW6B 4TYBA 3QIDA 4DTPA 3LAKA 4JLHA 4DL2A 1BQMB 3VQ9A 1S1VA 4CF8A 3I0SA 4TY9A 1NKCA 4Z0UA 2OPPB 1LW0A 1TK5A 3LP2A 3L8BA 1HYVA 5HBMB 1S4FA 3CDWA 1JXEA 2B5JA 4LD0A 4F4ZA 4N5SA 4ID5A 4TQRA 2B5JB 2BQUA 4HHTA 2LSNA 5KFIA 3HM9A 1NK7A 3K58A 4CJ5A 1BIZA 3RR7A 1NHUA 4ECSA 2XWYA 4BWJA 5DG8A 1LV5A 3V4IA 2C22A 4FK0A 4Y2CA 3SPZA 1EETB 1IKVA 5DQHA 1TGOA 3VQEA 2AQ4A 4MFBA 3HPGA 2D0BA 3BQ2A 4KI6A 1RA7A 3MECB 2HWHA 2WRMA 1TP7A 4KREA 4CJTA 1FKPB 3UPFA 3M8PA 5CYQB 2XY8A 1RT6B 4CHOA 3O3HA 4Z4HA 1U45A 4F4WA 3MEGB 1N4LA 4PWDA 4JUZA 3OSNA 3QETA 1D5AA 1NOYA 3BDPA 5J2MB 2YKMB 4NCAA 1X1PA 2KTQA 3H4DA 1JLBB 1RBUA 3RTVA 4IDKA 4B8CA 3H40A 3LZIA 1UWBB 3NDKA 4DTRA 1TKTA 2OPSB 2D5RA 3LP0B 3RMDA 1Y97A 5F9NA 4R5PB 1NJZA 4EEYA 3EPIA 3KK3A 1NKEA 2ZKUA 2IS3A 4NYFA 2DFFA 4O4GB 2ASLA 2UVUA 4JRPA 4DLGA 3P83D 4E7LA 3KHGA 3K57A 1JKHA 1TKXB 3MR2A 1TVRB 2Z1JA 4CJQA 3DOKA 2O4GA 4PUOB 2HNZB 2B6AB 1TKZA 4MKBA 4M41A 1NK0A 4KHUA 1JLEB 4RW8A 3T5JA 3OYHA 5KRTA 2ALZA 4ICLB 5KG5A 3TI0A 3TABA 1NK6A 2ATQA 3RR8A 4ZP8A 4I2QA 2ATLA 2YKMA 5KFEA 3IG1A 4KKOB 3ZSZA 4FW2A 1IKWB 3FFIA 3BSAA 1ZETA 1FKPA 2P51A 4NCGA 1RT6A 4BACA 4MK8A 3M8PB 1S97A 4U7CA 1HYZA 3AVCA 1RT7A 1KSPA 3PVXA 4TLRA 1RBRA 2HHTA 4O3OA 3VQ7A 3K5NA 5KFLA 2IM1A 3QEIA 3DYAB 2WONA 3C6UB 3MF5A 2BQRA 3M9OB 5L9XA 4CEQA 3QGIA 3CG7A 1VSHA 2V4QA 2ASJA 2Z1HA 4YFUA 4HCBA 3AA3A 4CGFA 3AVBA 4CK2A 1QE1B 3SZ2A 4FJ8A 3FRZA 4EP4A 4ECVA 3OYJA 1SKRA 2ZE2A 4IG0A 4G1QA 5KFXA 3SUOA 4DSJA 3BGRA 2FLPA 3THVA 4AHCA 2R8KA 3VQBA 1JLQB 1RT5A 1RTJB 3C6TB 4FJMA 1TL3A 3O4NA 3WNHA 4QWCA 3S3MA 1JLEA 2FLNA 3SJJA 3JSMA 3KMSA 2UUWA 4AHUA 3ASMA 5KFZA 4YNQA 4FYDA 3D0PA 4I2PB 1W9HA 1LWFB 1U4BA 5I42B 3M9NB 4FM0A 2FVSA 3CO9A 4ZTJA 3Q8RB 4E3SA 1KHVA 2RPIA 1REVB 5EU7A 2GC8A 2FJXA 2D0CA 5L1IA 2XCPA 2XY7A 2YV0X 4Z4IA 3PO5A 3KLIB 1SH2A 2XCAA 5KFUA 2F8TA 4ID1A 2UUTA 3N6NA 3OYLA 2E6MA 3KNAA 4KAIA 3DRRB 2ITGA 5HLFB 3RBDA 2I5JA 1XC9A 3SUPA 3PX0A 1KLMA
chains in the Genus database with same CATH superfamily
4YQWA 4GVBB 4URGA 4P74A 4IRDA 4P7TA 4OZJA 1EO1A 1WF1A 4IWVA 3N5BA 4KAZA 1Q9YA 2KLAA 4ED8A 1YGYA 2MQLA 3EXYA 3KJQB 3GR1A 3KDNA 2DJWA 1S48A 3ZTPA 1HA1A 2V50A 1D9DA 1KNZA 4DUTA 1GEHA 5A8WB 1VQ9S 4JKBA 3MAHA 4HHHA 2YNHA 2VJVA 5F9LA 2YHXA 2Q6CA 5KAKA 2HGMA 4LF4K 4C0OC 5IC6B 1OQ6A 5KFMA 2NZTA 1NMEB 2GAHC 3H5UA 3KNGA 3CXCM 3POTB 4A57A 3VF2A 1BMQB 3W62A 2OPRB 4DV7K 3VQAA 4B3TF 1XHXA 1WOSA 1X9WA 1VBYA 1FXXA 4TY8B 2P6TA 2F9JA 2QLBB 3CWJA 2CJKA 3HSJA 3C94A 5EXWA 1M0SA 4K8RA 5AE3A 4NI2B 2CAJA 1RNHA 4NZ7A 2XS7A 4ZA1A 4DX7A 2V69A 5CCMA 4K2JA 4Z4CA 2N4CA 2NR0A 3M8QA 2QWLA 2GCFA 2ZVIA 4ZVPB 2IVNA 4KB0A 4LF6K 4DPYA 4XO0A 1AXQA 2YWHA 4FLZA 2PIIA 3BGUA 2B6AA 4Z37A 3T1HK 2BE9B 2HNZA 3BBBA 3MM8A 4USTA 5LJVA 4NLPA 1WLJA 1X31C 3ZNUA 4H03B 1SH0A 1S0NA 4NYNA 4QU6A 2I1RA 4QAGA 4FJIA 2ZC3A 1O5JA 1S57A 3FKBA 2OEKA 3KWIA 1WDTA 2BJ9A 3N9UC 2DEJA 1S1TB 5HQ8A 1MWYA 2Q43A 2HIYA 2O8EB 2CPDA 4HT7A 2EW9A 2QT7A 4QIWD 3AV9A 1IR0A 5JXSA 2DR6A 1D8YA 1NGEA 4UUWA 1WD6A 4J9NA 2MSTA 4HH0A 1TFWA 2HHHK 2V9KA 1LFWA 2CG8A 2PO4A 2M4MA 3LH2S 3W8GA 3HSCA 5E41A 5I9EB 4OI2A 3A5OC 1EHWA 2UZAA 3W66A 1S1VB 2XGQA 3MPYA 2YNHB 3FZFA 2MKKA 3G6EN 3ZSXA 3DI6A 3MX5A 2Q1LA 1BWVA 1EZZB 1WKJA 3N4PA 4FPRA 3FEZA 2NLXA 3F56A 2ZH1A 2AYBA 3C16B 2AEFA 1RT7B 2QA2A 2KKHA 3C7NB 2ZH7A 1SXLA 2UXCF 2MY8A 2ZH3A 3DLGA 3LDLA 1KWMA 3AJ1A 1WORA 4NXNK 3Q24A 4CJFA 4KKOA 1HBOB 4CLZA 2DB1A 4CLFA 5EWFA 3TA2A 4AXJA 1UVNA 4J9LA 3ZT2A 2UUBK 1K8AO 5HJXA 3R7NB 2LECA 1UOCA 4FWNA 3IRWP 2YKPA 3NF6A 3GQCA 4QR1A 4ED0A 2DIUA 3UE2A 1W2IA 4LF5J 5H1SV 1EKEA 3D28A 2G0CA 1ASUA 1ZC6A 3W2VB 3NS5A 3C2PA 5AE2A 4R5PA 3NAIA 4JKEA 1WACA 3CXCR 4IR9A 2G8WA 3KHHA 2KZMA 4LRFA 3OXFA 4BRAA 3QAUA 3TUJC 2HS3A 3GYGA 1WI6A 3LO3A 2AYGA 4JS5A 3EKUA 3H2LA 2ZWPA 1F21A 1QTNB 4X4PA 1XR6A 5KRSA 1R43A 2NS1B 4AQYF 3C3LA 2VWKA 2M9KA 4OZ2A 1VQ6N 1JLCB 4KC5A 1WTFA 3AA5X 4ED7A 4LF6J 4J2DA 3TUZC 3HSGA 2GJ2A 4J9RA 4NLGA 1OQ3A 3G86A 4F0HA 3HZGA 1RBLA 4RX6A 5J1PA 4JV5J 2GUPA 2XYPB 2CJQA 3H98A 2D69A 4DPXA 2O8BB 2QWRA 4WFBQ 4KHRA 3A12A 1UW9A 3I0RB 1VGYA 4CIFA 3IC1A 2V63A 2WSCC 2R7RA 3SCXA 2VJUA 2X1BA 2R7YA 2PDAA 1BD6A 3MD1A 1WB9A 1HI8A 2HK2A 1BL3A 1LWCA 1GMVA 4CF9A 2O8EA 3R3TA 2LEBA 3MWPA 4IO1A 4BS2A 2W9CA 3MMAA 5EX5A 3MXMA 5IZHA 1S6PA 2MSSA 3FZBA 1T9UA 5AJ3F 5JLHA 4EFAC 1PYOB 2O8CA 2HZAA 4DR3F 4CHZA 1SQKA 3U8XA 3V81B 1FTRA 4WF9Q 5MLCQ 3DRRA 4IOCL 2GWKA 1NK8A 4K25A 3JYTA 3BF3A 3NVKA 3WEEA 1IXKA 4KB7A 3M2UB 1SJ4P 1Q82O 1JLFB 2RH3A 9RUBA 1HFEL 3M8QB 4LREA 2ZBPA 1GLEG 3MMVA 1WOQA 4JV5K 5KTQA 4W5QA 2IA6A 3GPAA 1S3XA 3I55N 4LF2A 2IDLA 3FBFA 2QMUB 2RN2A 2PZSA 2KVIA 2POKA 3P8BB 1EWQA 1GLJO 4FJ5A 1RWXB 3WXMB 2D41A 4LMZA 5B08A 1HD0A 5KGWA 2RUSA 4QPTA 5BR8J 2XSJB 1G1XA 1NGAA 4USKA 3U1LA 3CJ8A 3CCQN 3MEDA 3NMAA 2AP6A 4ED5A 1IBLF 5H9EK 2EBEA 4DR6J 1XQSC 1VYAA 5BR9A 2HQCA 4BR5A 2Q97A 3CFRA 3DJCA 4L76A 4NX9A 1U8WA 5D78A 4X66F 4KJIA 3VQ6A 2K7KA 3TAPA 4R8UB 3ZTQA 1SQEA 2QRRA 5E33A 1CJKB 3FGVA 1S76D 4UY8O 2HHVA 3QLHB 5D4LA 2YWFA 2XMUA 4OKEA 3HHLA 3UR0A 3L9ZA 1IKYA 2HHHF 4OJ3A 3W5XA 2DR8A 2PC6A 3NKYA 4ZVHA 1YTYA 5L1KA 3E51A 4LQ3A 1NM2A 4GKKJ 1WN7A 3QAEA 4F2SA 4A8WA 2GVDB 2WCXA 4CJEA 4BLGA 3O6QA 1YAGA 1Q7YT 4BRGA 4KFBA 1ATNA 5IT0A 3TAQA 2EG1A 1HNIA 2L3MA 1UKUA 1PYTA 1ZOTA 3CPEA 2P9PA 1GMWD 5BN8A 4ZLPA 2HVDA 5JS2A 1VSIA 4C23A 2DGXA 2DXFA 4NI2A 5DGAA 4L74A 4AHSA 2HVHA 4NZ6A 3FCVA 5E7OB 1VQ7N 1A9NB 1X4GA 3UD5A 2BDPA 2PMZD 2ZNYA 3SIPB 5KFGA 4RTFD 4F67A 4HDGA 2VBXA 4J91A 5F8JA 3U02A 1S1WA 4EYHB 3TARA 4X64J 2VOPA 3O08A 1SUQB 3Q8UA 2JZ5A 4LSZB 3OD2A 4NB4A 1FEHA 1IKYB 4H4KA 3CCUN 2MHEA 5FRNA 4KIAA 2FF6A 2AJ4A 2W9AA 1JJ2R 3CM5A 3ZZRA 4CIEA 2HW3A 2WOMA 2UVWA 2PFUA 4CZCA 3NOGA 3N6LA 1FI4A 3EVOA 2DNPA 2M5YA 4PYDA 2LA4A 3MN7A 2JH3A 3EX7B 5A2QU 4NLCA 4RKUC 3RVCA 3AVNA 2K7JA 1FXRA 3QSIA 5DLGA 3CIPA 1Y5LB 2H48B 2KXFA 4CO3A 4AFFA 3TSQA 5GMDA 2BUPA 1GLDG 2XHWA 4Q0BB 2ZZNA 1IQTA 3M32A 4K42A 5MAOA 4X4TA 4GC7A 3P38A 4PL7A 4KGMA 5HMYA 2MZQA 5FPMA 4W90B 1TUGB 4B9NA 1SZ2A 1YBUA 3FZ2A 3RGIA 5D0GA 1NGCA 4KYZA 8RUCA 2E9ZA 2NZ4A 1PG5B 2GMJA 4P7VA 4BQLA 3NGYA 1DJ0A 1U09A 3HXMA 4YHHF 3FSYA 4YHHK 4Q7AA 2GX9A 2E8AA 3W3SA 2J76E 3AXKA 1HBNA 3D1HA 4MYTA 2B4JA 4GVMA 4PUOA 1VAZA 1VQLS 2FZGB 5IM0A 2QWNA 4K4TA 4PPDA 3KUHA 4AL6A 3OYGA 2O01C 3T6BA 1ILYA 3DLLL 3J7YP 3M6WA 1X9SA 4JI6F 2LCWA 3OPKA 1VQPN 2WTUA 5KFRA 4K4XA 4IOCQ 4K4VA 3AOBA 3JSMB 1RHJB 4NYPA 2V5HG 1DQ9A 3SLCA 2EC2A 3DLLQ 4CO1A 3K2PA 2LQ9A 3LP3A 1LK5A 3R3LA 1N5TA 3ZETB 3ATVA 1DLOB 1M90T 3QQCD 1D8ZA 5D77A 5CD4A 1T6DA 2YNIA 5KT6A 4JI0K 4LIRA 3W64A 1XNQK 4KHPK 3TVKA 3T3FA 3UKRA 2KHOA 1SIZA 4GVEA 4PY5A 3ZXWA 3OSPA 2ADBA 2NSBA 1K9MT 2JEJA 2GHVC 2YKNB 4DU4A 1JLAB 1IKXB 1LK7A 1T05B 1T6CA 4ECZA 2P6SA 4DV1K 3CJTA 4DR2J 3TAMB 2HQDA 1TKDA 1HNXF 4IQXA 4DR4K 3G71N 5HBMA 1F9EB 3K0JA 4JI1J 3MCAB 5B0CA 2CQ4A 1FK9B 3L3CA 3OJUA 4CJPA 2P9SB 1U2VA 1XNRK 4JI2F 1TKZB 4YORA 1GXUA 1RHKB 4ZPVR 3L4BC 3KLEA 5D4NA 3EGNA 1Y7PA 5C24B 3G6VA 1VIOA 4ETZA 3TWHA 1TKXA 3B4MA 4JB8B 4C8OA 5J2PA 4E1NA 4OMFG 1U0HA 3TSPA 1GXLA 1D9AA 1GTEA 1VHFA 1FKOB 1YJVA 4FWPA 1X3NA 2WSEC 4NLSA 2H3GX 4AL5A 1UEKA 4W5TA 3KLHA 4CCHA 4BQZA 2N4DA 5F8MA 4C48A 3ULEB 2QMXA 3VAJA 3AY9A 1GNKA 2MGZA 4I69A 2XSFA 4P71A 1W97L 2XY6A 4JI1K 2CPIA 5BYSA 2QA4S 2VQFK 2C2DA 4C11A 4RW4A 1MU2A 2QFJA 2OFHX 3TOQA 3QIPA 1YWXA 1WC4A 1YTAA 4NO7A 1QQCA 1HQEA 2FVRA 1HYSB 1N34K 4USJC 2VIHA 4O3NA 2LVWA 3THTA 2E5IA 2A41A 4F2RA 3FMWA 4DTSA 4O3PA 1FRHA 2HKEA 4P75A 3G6XA 1KHWA 3CIZA 1FDNA 2F1FA 1A5XA 4KH5A 3GFHA 1MG7A 1PGZA 3WXJA 1YBAA 2WB4A 2BVZA 2MKIA 2V8DA 5CZVA 2ERRA 1IG9A 5T7LA 3LTOA 2P9KB 4K2XA 5LJ5Y 4B8AB 4WFZA 3F5TA 3UIQA 2ZH6A 2P9GA 1FKOA 4NASA 3KK2A 5E5NA 4LSNA 4CHQA 5LSLA 4FZXC 2I8EA 4FJKA 3CFOA 1U0SA 4J9KA 3VMFB 1RBSA 1ZTTA 2LYVA 4PQAA 3CCRS 3UCZP 4WFAL 3GR0A 3PO4A 4CZGA 1T9VA 1CVJA 3IM9A 4M5DA 1E6VB 4X4SA 1AFIA 1DRZA 1Y00A 4NLUA 5JICA 5BPNA 3Q8VA 3VENA 3CCSN 4DR3J 1QS4A 1VRTB 4C0HA 1KC8T 4U8YA 4ES2A 5KG4A 1FDBA 4G3IA 1T9WA 3OTDA 3T41A 4LRCA 2P9LA 1X4FA 4DV2F 1Q4RA 1Q1KA 4ALZA 4O0JA 2GNKA 2PFDA 1Z1ZA 2ILYA 2VA2A 4ZVQB 2A1BA 2OANA 3ZZ0A 3RRKA 4JS4A 4FYVB 3QBXA 1IH7A 5D0RA 3PW5A 5KT3A 2BGGA 1YIJS 4XPCA 1L3UA 1RDBA 1X4HA 2AJ1A 3EGWB 1KTVA 3I0RA 3M6GA 2CDQA 3I5CA 2QM1A 3OTOK 3MDQA 1RT4B 3HSDA 1S6QB 3CI5A 2M70A 5IWAK 3NCRA 3R6LB 1GLLO 2NXEA 1IBMJ 2AHOB 1WNEA 2JRSA 1JCFA 2DNRA 3H4BA 3IN5A 2VBZA 3G9CA 3LWMA 2VCPA 1SJQA 3QT5A 1HKAA 4ZN1A 4JK9A 1SBRA 4CD3A 3CC7S 5AQZA 1EB0A 4CJUA 2HQFA 5B8HA 4IYQA 4CLTA 3WQTA 3THYB 3OV7A 2QEXN 4J5OA 1SPBP 1RI7A 3R97A 5DQIA 2P5VA 3H59A 3MUMP 4LH5A 4TU8A 1P8ZA 4DR2F 1CSJA 2NRWA 1SJRA 4B3OB 2AGOA 2OSRA 2CNOB 1NPPA 2GMLA 3WNFA 4FNIA 5HROA 4UOFA 4B3SK 1WG1A 3HKZD 5DQGA 3MM6B 2W9BB 4ZVFA 1HD1A 1N0UA 3OW2R 4JI2J 4DPTA 2DGQA 5GAEU 3CFPA 3LDQA 5DDQC 5LMUK 4LVNP 3CDAA 2QO3A 1RTIA 1TL7B 1X4DA 1HNXK 2L9NA 4EFHA 3CCEN 3PW7A 3PW2A 2EBGA 5D0HA 1P6TA 4KTWA 2BKNA 3L2VA 5HN0A 2A3JA 2LDIA 4BE0A 5LMUJ 1RT3A 3KG4A 5K5MA 2YY3A 4MKVA 1EAYC 2EHGA 1HR0K 1CULB 1EP4B 4B9SA 2A6MA 1K1QA 4CD1A 4E98A 3M2RA 1UVKA 1W7AA 1U1PA 2O8DA 4KPYA 4DFJA 3IR5B 3GFXA 4YDUC 4P2SA 2KRRA 5GIOA 3UWTA 4OKJA 4FJJA 2V7YA 2HMIB 3JB9k 3DAWA 3ENBA 1XERA 1J5OB 5E84A 2E29A 4N76A 1TYQB 2IVPA 4ZHRB 1KDNA 5BRFA 3WQUA 2HFVA 3VF6A 1W25A 2HPUA 2ZBIA 5KFJA 3A5MC 2N7CA 2UXDJ 2O5DA 4FL9A 3V1RA 1RBOB 5HQLA 2MKYA 3AO2A 1UAWA 4KH0B 4GO7X 5GAHI 1OSDA 1WC0A 3SQ2A 1WAFA 3ENOA 3EY1A 1BIUA 3PR4A 3TQEA 1UAXA 1XUPO 1O1WA 1NK4A 1R0BG 4E7HA 2LXIA 2DGSA 3WBZA 3P4IA 5AQTA 3HK2A 3AVHA 2Y9HA 1JCGA 1M1KT 1QVGR 4ECXA 2LMIA 3GIRA 1UW4A 4RW9B 3ENQA 4LSNB 2FJBB 3Q86A 2AX0A 3L7PA 1AW0A 3CHWA 3AVFA 4DTMA 1QSYA 5K20B 1C0UB 4YHHJ 2B4OA 2Z8QA 1O8BA 3W61A 4B3TK 4DU7A 3J7YI 1HIYA 4YEAA 4CK3A 2Z1GA 2QK9A 3VAGA 1RT4A 3C6UA 4DUZK 1F3VA 3CJAA 1LAWA 4DR5J 4JKGA 4L8RB 3QICA 1ZBHA 3OR1B 3IAS9 4OGCA 3MURP 4BG9A 4KHPF 1N5YB 2APOA 1TL4A 4A5BA 3T5HA 5SWMA 3H0PA 4ZCLA 2AJQA 3DC2A 1VBZA 1RYRA 1L3TA 2VF3A 1KVJA 4KQZA 3DM2B 5ITHA 4TNOA 1RISA 1NK9A 3SSRA 4FYWB 1WNSA 2FXUA 1IV0A 1L3VA 1RBAA 2YNGB 4FYXB 4UTGA 3IWXA 1M1GA 1VISA 4Z2XA 3NXZA 1UFKA 4E7KA 2VFSA 1TUVA 2Y1LB 3MCSA 4FPIA 2D3ZA 3SUQA 3ZX3A 5HMWA 1UTAA 5EWGA 1IJEB 1SKUB 2VFRA 4KHNA 3LOUA 3RWUA 3MXJA 5RUBA 1G99A 3NMUA 4NA2A 2R3VA 1R8PA 2WW4A 4OV1A 4BRKA 2RKIB 1REGX 4FWMA 4KHWA 1T11A 3SK3A 3AD8C 3SAFA 1H2VZ 1UP1A 3E9PA 4XIUA 5CQGA 3KOAA 3OFHA 4JV2A 4GY2B 5L46A 1N32J 5A8KB 1C0TB 5CHCB 2W24A 1ZBFA 4OPKA 5HP1B 3DLKB 3FVYA 4WF9L 1JIHA 1VCTA 2F8EX 3D1OA 3EWGA 1MLAA 4XAKA 2MQ8A 2XWXA 4J90A 1EXQA 1Q18A 4HUGA 3DRYA 4ED1A 1H38A 4OI4A 2XB2D 3L0QA 3ZYYX 1U1RA 1CXQA 3LDOA 2D74B 5K14B 2FUG9 4PWUA 2LQJA 3CPWR 4U67L 4AYBD 5LM7E 4YR2A 2CNNB 3M9MB 2G8HA 1ZYQA 3R27A 3OFEA 4QR2A 3DDIA 2VH7A 3UDLA 4JBCA 5IT9Y 4JI0J 5A8WA 4LR7A 1VQON 1UJ5A 2UVVA 4CM2A 3EE3A 4RU9A 1ZAXA 4JI7K 2RJZA 2W6KA 3QERA 1NK5A 1Y3JA 3TSUA 3WUHA 1NSQA 1RT1A 3FFIB 3AVMA 3QMQA 3JQKA 3V6HA 1RP5A 2VWBA 2AD9A 2DNQA 2JJ4D 4BE1A 4DZ6A 1QD1A 4DB3A 1DURA 4Q45A 4DKWA 3TA1A 3BR9A 4J2BA 5CYMA 4DCHA 2ZHOA 2HNYA 4KHSA 1C4AA 2CPZA 1S4EA 3QNWB 3SQ1A 3MM7B 4ILHA 1PKUA 2RU3A 2RRNA 3QEVA 2KB2A 2DD8S 2GAGC 1U2RA 4ZPAA 3MCPA 3VQ5A 4DJBA 2WB1D 1PCAA 3GG0A 4DV4F 4LF8J 2KT3A 3J7AP 2DGOA 3NGUA 4DTPA 3LAKA 1K8KB 1NH7A 3EUNA 4K0KF 4JLHA 1BQMB 2W41A 3VQ9A 2I6WA 4CF8A 4CVNE 2W2MP 2DCUB 2UU9F 3L8BA 5AQSA 4JV5F 3HM8A 1HYVA 4F9OA 2JFKA 4F4ZA 2ZJRQ 1WUUA 3ZETA 1PBAA 4KRWA 1PAUB 3M6UA 1WDDA 4OHXA 5DQHA 2FQQB 3VQEA 4KGXB 5HVHA 1XMOJ 1K73T 4KI6A 5DDRC 3CMAN 2JLGA 3P4UB 2WRMA 1FE0A 1R8HA 2YXLA 3LQVA 3NRBA 2HLTA 3OR1A 1FE4A 2ZNZA 3FEYB 2FD2A 5IXUA 1XK8A 3MEGB 1N4LA 4JUZA 5E3RA 2YKMB 4NCAA 3MOJB 2G2ZA 3S1TA 4M7XA 1YRTA 3SBTA 1C4CA 4CLUA 3H4DA 4USUA 3RZAA 3RTVA 4LF7K 4B8CA 3LZIA 1UWBB 2LEAA 4DTRA 5ADZA 4JI4K 4YOYA 2W4PA 5GAHP 4AT1B 1QVFM 4CT9A 1Q86O 2FGOA 2E44A 5C2DA 3KK3A 1PJ7A 3HDSA 4JKFA 1UEUA 3EZOA 1B3TA 1PILA 3DGVA 3KHGA 4UY85 3K57A 5DS7A 1TKXB 4CJQA 4BROA 3BEXA 1SJFA 5CD4H 1SC1B 4P10A 3C8YA 3D0IE 2NREA 3M2VA 3W9HA 4CI6A 3M32B 4KHUA 5TKWA 2HYIB 4RW8A 4NE9C 4A2BA 2UV8A 3OYHA 4OZLA 2G0IA 1HI0P 2QGFB 2EFOA 4K7QA 3CO0P 3ZSZA 2RUGA 3FFIA 1GLFO 1U2CA 4Q2LA 2P51A 1U1LA 4C6AA 1T9XA 2C3OA 3C16A 1RB0A 4LJMA 1RT7A 1KSPA 1RKJA 4TU9A 4TLRA 1B0VA 4OQJA 1RBRA 2KT2A 2HHTA 4O3OA 2B4UA 1MROB 2IM1A 3QEIA 3MF5A 3M9OB 3CG7A 1VSHA 2V4QA 2Z1HA 4QS9A 1HBOA 3EMTA 1OPIA 1UFWA 2PT0A 4FJ8A 3P5BP 4ECVA 4HTJA 2ZE2A 4IG0A 5M1PA 4CH0S 3CCES 2PA3A 4DSJA 3SUOA 4GKKF 1CJUB 3THVA 4HI1A 2IYIA 5M1KA 4CLSA 5KQ8A 5AQOA 3C6TB 2WZ1A 3BKFA 4QWCA 1J5EK 2UV8G 1JLEA 2FLNA 1R3NA 5DRKA 2AF6A 4V19X 5KFZA 2KDOA 4DR1F 4FYDA 1D3WA 5KOWA 1U1MA 3OUYB 3D0PA 4I2PB 5CR4A 2QLWA 3CJKB 5HAOA 3R6GB 4OLPA 2E5LK 3Q8RB 2E5HA 3NS6A 1KHVA 3MZIA 3R6MA 3PO5A 2ZM6F 5KFUA 1CJVB 1T3VA 3NMRA 2BJ1A 4OJ1A 3DRRB 1R8AA 1XN9A 2MTLA 3PX0A 1FJEB 4WQ4C 1HNVA 2MJNA 1FRJA 1QJHA 3L7UA 3CJCA 3OA9A 1BLUA 4CE9A 4B9MA 1NNEA 2OTJS 4WBFA 3G0ZA 2YWKA 2CZVC 3QLHA 2B43A 4USMA 3D6HB 1MMLA 1QUPA 4MDAA 5F8IA 2QYCA 4FF4A 3JQMA 4A5AA 1T94A 1WC6A 2ROEA 1CJUA 1AB8A 3MEKA 4QYZJ 3G82B 3A13A 2VB6A 1RFQA 1EKSA 1YTUA 1X8DA 3VEWA 2UXBK 3VR1A 3R1LA 4V19J 2VOOA 1SIWB 5ETRA 4DR4F 3H5SA 5SUHA 2XI3A 3WIUA 2OMOA 3W1YC 4ZJLA 1WJ9A 3DRPB 3VN5A 2Q2RA 3AA4A 5IV4A 2CQ1A 2FHJD 5CZ2A 1T7PA 2OTJN 1TMMA 2Q3SA 3CDBA 3AB2B 5J2NB 1OMSA 3DI6B 4NCBA 1CZAN 5F0XA 1VLYA 2KXHA 2MMYA 4XDCA 4B1ZA 4EBCA 3BO4A 1HBMA 2HK3A 4KH1B 3NCPA 4OZ1A 5A8RB 4FZYA 4DV7F 4M63C 4BC9A 1TAQA 4WFYA 3I8BA 3DHWC 4Q43A 5AQFA 4X66K 4LBIA 3PKYA 8AT1B 2J9CA 4DL7A 3PZPA 1RQ0A 3V5RA 4WJBA 3CULA 3NVMA 2JSXA 1BISA 1IBMK 4WZQA 2ZJQL 1UETA 4CLPA 5BR8F 2GO8A 4OYPA 3NGDA 2BM0A 1XMQJ 4FLXA 1NBWA 1AA1B 4DR6F 1N36F 3FEXB 3Q7CA 2MDAA 5K8PA 3NFAA 3O4WA 4M5NA 1ATSA 3I56S 4IH7A 3OW2M 3JAMU 4KGVB 3IMQJ 2R2SA 4A8XA 5C2CA 3HD2A 4C3LA 3FUYA 4NPOA 4LR8A 1VI7A 3AODA 3WC2A 1FWPA 4OKKA 5C42A 1DARA 1S22A 4CGDA 2M7SA 1ZM9A 3SFUA 1R8BA 4KBIA 1T3OA 1KKHA 1U25A 1SC3B 2GJFA 4FVCA 1HNZF 2B51A 5B7WA 2VDIA 2OD6A 3J8AA 1R8CA 2FBVA 3MMBA 3BZQA 1TL3B 2H4WB 4TY8A 3CJ0A 2NUHA 1N48A 2G0JA 2OIHA 1X9JA 1E4GT 3L09A 4Z4GA 1RBVA 1WG4A 4DLEA 4GMKA 4LF7F 4FWOA 3OTOJ 4EU0A 1VQ8S 2JC0A 2M3DA 1WWHA 4KB1A 4RW9A 3R1HA 4GKJJ 4DQIA 4Y00A 4CZJA 3ZZOA 4L3KA 2G1HA 2IM3A 4DR6K 3DOMA 5C24A 4QYZK 4NOHA 5EVZA 3NHGA 3S8SA 1M5OC 5AXLA 4K4ZA 2QWPA 2YHWA 3SAGA 2AYMA 2Z2YB 3TJAA 3ZSYA 3TUIC 4M63A 4CZKA 1DFDA 3GILA 4WKRA 4KH4A 3HJFA 1DTTA 3IR7B 2C2OB 3L95X 3KHRA 1Q79A 3GG1A 2RNEA 2DHSA 2G8UA 2BV3A 3I5BA 1Q78A 2ZJPQ 1H7WA 2F7TA 4ZVRB 1AFJA 4ICLA 1SC6A 9ATCB 4IO9Q 1LWEA 3E2EA 3L3UA 1NDLA 4JI8F 4ANCA 4ELTA 1S1XB 3IWNC 1TKTB 1NJWA 3QFUA 4PG8A 1BO5O 1EARA 3FCWA 5AZIB 2OLWA 1RBTA 4OHYA 2UXCK 3WEEB 4OYXA 5CY4A 4KT0C 5DMRA 1WHYA 4MQ3A 3V81A 3H90A 3MR3A 1FTCA 2XMVA 5ETLA 1HBUA 5J1NA 3IBWA 1EQMA 3R5GA 1GH8A 3I32A 3HI0A 4CEFA 4QQBA 1MU2B 2F40A 1BHNA 2E20A 3ENWA 1HX1A 3LDSA 4CO5A 1K8AT 2UUCK 1QLNA 1RA6A 2NYHA 2HFNA 4WFNQ 3OYCA 1MWZA 4MDBA 3DLGB 4QS7A 1N32K 5KT4A 1WG5A 4OYZA 5BRHA 4QW9A 5CZ1A 1WSRA 4ZPTR 3EM1A 1BQMA 2UXBJ 1QM9A 1XI1A 3QEXA 4BRQA 2KQ2A 2XC9A 4IO9L 1TR0A 5D4OA 4M95A 2X3DA 3DXMA 5HRPA 2GGPB 2R4FA 4KV8B 3AA9A 3IAM9 3W2WA 2QA4G 3Q8SB 1X4EA 2OAUA 4WU2A 4JAXA 4BDZA 4WE1A 2ETJA 5FIIA 4IJNA 4WQ4A 2BRKA 2HNYB 4ECQA 2CVEA 2CWXA 3U1MA 3GONA 4DV7J 4B3TJ 3OHAA 2VDHA 1P27B 3UDEA 2C2RA 2E88A 1KOHA 5HQMA 1LWEB 1IG8A 1JLBA 3ZZZA 2V0NA 3BPDA 4DSLA 3HPHA 4ZVEA 2BANA 4M3YA 5F2RA 6AT1B 3T5KA 5EX3A 3UDVA 4HL9A 2BZ2A 2IRUA 3R5JB 1HPZA 3IGNA 1HLWA 3PEHA 3PACA 3CJRA 4GNIA 2KFZA 1RTHB 1MN9A 4DS4A 1U1OA 1HQEB 1B7FA 4H4MA 2ZITA 1RLCL 2EC0A 2VODA 3L6QA 5ELZA 1RT2B 1YZ7A 3SPYA 3H3NO 2ZOMA 3PR5B 1H0HB 3H7HB 3SMSA 1MSWD 1M5SA 1ZA2B 3RAMA 4NLRA 3G6YA 1Q8IA 4JI7F 5MLCV 3EGVA 1UMJA 1R7IA 2M2BA 3A1YG 1T02A 4X4RA 3PHEA 1X4AA 4NXMF 4JEPA 5BJRA 3D66A 3JAMY 4N41A 5E0OA 3S41A 5AJ3J 3OQ2A 3B6BA 1FRIA 1S1WB 2DY4A 3CCJS 1GMUA 2WUSA 3V4MA 1C6VA 2QE5A 2D9OA 4L75A 1I3AA 3VQDA 5KFSA 2FSKA 3FBBA 4YR3A 1NU4A 3T9ZA 4DL4A 4KGZB 2RILA 3PUFA 4DCOB 4LUBA 1IBCB 4FK4A 3N79A 2HFUA 3H20A 3FDSA 2HLUA 2XHCA 1GOAA 3VGMA 4K4SA 1TL1B 3W0LA 2CVIA 2ACYA 1YJNS 5DM7L 1NGDA 4CESA 1S59A 3K5LA 1RTHA 1PAEX 4C97A 4DXLA 5AE1A 4WFAQ 3BYPA 4I6YA 1Y3KA 3MTKA 3HRGA 1NGJA 2DXDA 4BE2A 3FLCO 1Q16B 2ZKTA 3KJVB 4DTOA 3THWB 4JKCA 1DEJA 1S0MA 8ATCB 2LU1A 4DQSA 1WKLA 3MMJA 3CCVS 1T95A 4HCCA 2HBLA 2P9SA 4MFBB 4N8NA 2HS4A 3M5RA 1OS5A 2OKQA 3CCMS 4CIOA 2JEFA 4DWIA 2KFNA 1YJTA 3K9JA 1F5AA 3UCUP 5DDOC 2V4JA 3DXKB 5CH7B 2DEIA 4CF2A 1BUXA 4C11B 2YWEA 1VHIA 2FZKB 2YVSA 2ZOGA 3CJKA 2CJXB 2CQDA 1VSKA 3ZX0A 2BKPA 1NJIO 3W9JA 1OSCA 1ACMB 4B9TA 1C0UA 2R8GA 3C6TA 1X4CA 3S7RA 1I1GA 3J81Y 3LP1A 2GZOA 3VGTA 4W5NA 1LW2A 3QGHA 2XYHB 4EBDA 4X2BA 5HRRA 2UP1A 4JKGB 1U26A 3RAXA 4ZS6A 4H4OB 3EDQB 1VDHA 1TMJA 4DV2K 3LDNA 4ZP6A 4TLQA 4CGJA 4OJHA 3B78A 2ZUGA 2GIRA 3DU6A 4FS1A 3UR3C 2ZH9A 1UVJA 5AFUH 4WP3A 2CGKA 3O1WA 4FWLA 4OO1J 2Z2MA 1DT9A 3D2FA 3PJ9A 2UXBF 2RQ4A 2DNMA 4OI6A 1X0FA 3RBXA 4LRBA 3GU0A 1TK8A 2HZCA 1WC5A 4DI6A 2PGCA 3LPEA 4JKDA 3CVKA 4PZVA 1XR5A 4ZVOB 2W8LA 4EBEA 4PG6A 3OHRA 3HL8A 2MZJA 1ZM4A 2RHSB 5B0AA 5AQYA 2HZVA 4DV3F 3CJ5A 4QWEA 2WVFA 1RGVA 4JI1F 2YH0A 1EP4A 1BWEA 5CYQA 3CD7A 5GADU 3NGIA 2KYZA 4NWBA 1ELOA 4O44B 3I0SB 2J9DA 3ICLA 4DL3A 4E7IA 4C1NK 5K8OA 1MROA 1M90O 2FHJA 1IKVB 3B6PA 3PRBA 2FJEB 3W7BA 4CZHA 5HVFA 4G1IA 3KIOA 4X65F 3R5CA 3V6KA 3GBTA 2CJ9A 4GO5X 3GIIA 3FQKA 2E1CA 1TV6B 4IG0B 2SXLA 4EZ6A 2FTRA 4B9QA 3RSEA 2Q0RA 2CQBA 2O3DA 1UVMA 4IJAA 4AHVA 3SYZA 4J2AA 2WFBA 2WONB 2Q3PA 3TR5A 2Z4PA 3MAAB 1HW8A 4WYLA 1RYSA 4M1KA 1D1UA 1BC6A 4HKQA 3DLBA 3V4IB 3NH2A 3I6PA 4IR1A 1U1NA 3SFGA 1FJGK 4EAHD 3GFYA 3BZCA 3M1VB 1HWIA 1K1SA 5KT7A 3FZKA 1UZHA 5KFVA 4KHQA 3OTOF 3JYTB 4OHVA 2AJ0A 4U7BA 4WE1B 3PTWA 3KMQA 3IRXB 1NU0A 3OVAA 2EK1A 2WC9A 3SBMA 2D1KA 4I1TA 1WEZA 2O1PA 3NGSA 5A2QO 1S1UB 4P9SA 3M7VA 3HHLC 3ISZA 5I3PA 2Y8YA 2QLFB 4CZIA 3C46A 5J2PB 1RK8A 2OGUA 4HLBA 4H5VA 1TL5A 4CGGA 3EKSA 1N5YA 3HHDA 2CA9A 3VV2B 1SQGA 2W9CB 4C1NI 2E1YA 4IRKA 3QFWA 2BJDA 4FP9A 3NBPA 4YB7A 2XRIA 1B7YB 2OH2A 2BXJA 4N8OA 1ZPVA 5A8RA 4A62A 3J80Y 4JI4J 1NGHA 1Q7LB 2W2QP 2VGMA 3MGJA 2IVFB 1RJJA 4PG7A 3VHQA 2BJ7A 4TXSA 2RS2A 2NRZA 4Z4FA 2WOMB 3QIPB 1JLAA 4IKFA 3TVYA 2FDNA 1CS4A 1W2BR 4AH9A 5CE3A 4HT5A 4Y3CA 3NGKA 5AQKA 1S79A 4ZJOA 1RKIA 4RPFA 1NNDA 3KLFA 1YVFA 3CCUS 2P9LB 5C2GA 3M2RB 1FRMA 2V8GA 5KFTA 5GMEA 4JOUA 3N6MA 4JP8A 4DFMA 5BPLA 3IXQA 2B0GA 2H1YA 1F3FA 1VQ7S 4KRFA 1RWKB 4DR7K 4OIXA 3SUNA 1KCFA 1OH5A 1KLNA 1Q7YO 4M5MA 4OZ5A 3L2UA 3SSQA 2GVZA 3L3VA 1KVAA 3OUYA 1E6YB 5L39A 1FX4A 2HWIA 2VQFF 4ZHRA 3M30B 5EDWA 4J8FA 1DY3A 2VC0A 2KHDA 1JJCB 1O51A 4O55A 3UKUA 3OL8A 1FDAA 2EPIA 3F9KA 3OBYA 2RU9A 1JLFA 2AA4A 4ZP7A 3D3BJ 4B1WB 2YHAA 1TL1A 4B3MK 1VLOA 5BRDA 4ZPWR 3OLAA 1S77D 1V4SA 3FC9A 2H3EB 3SSSA 1VQ4S 3A8JA 2BQ3A 4CM0A 4WXWA 2DR7A 3UFCX 2YQ1A 3SQGB 4ILLA 4AXIA 4FKYA 5LJWA 3H1QA 2E1MC 4LFAJ 4OX6A 3J81U 1LKZA 3GLJA 4RG8A 4DV0K 3NF7A 1Z25A 3MHYA 2V9WA 3ZO7A 4YUDA 2H9ZA 2ROGA 4FWSA 4C8KA 3FK4A 2ZDPA 3K8VA 3CCJN 3DOLA 4CFAA 4FWKA 4H4OA 3HVTA 3N4WA 4RW8B 3K5PA 1KXPA 1VRTA 2H5EA 3QBWA 4DPWA 2BRLA 2UU9K 5KPTA 4CIGA 2ZD1A 4CJWA 3GIJA 3LL3A 4XH5A 2QFIA 3VAKA 1GLAG 3MM5A 4UQGA 4IXCA 5IFMA 3M1FA 5J1EA 2KVQE 1G7CB 1S9GB 4OPHA 2RKIA 1BG3A 4C8NA 3PLAA 5ETQA 5AXNA 4U8VA 5G0RB 4FJLA 1OWXA 1R89A 5LXRA 2VG5B 3BJYA 1F5BA 4DV2J 1ZA1B 3WNEA 3OS1A 3NG8A 4M94A 1NEEA 4DTNA 3PIPL 4IOAQ 2G2OA 2LU2A 3KG0A 3WHIA 2C3UA 2XO6A 2FVPA 3TAMA 4TYAA 2ZOFA 3CJSA 3AVLA 2WBRA 3EICA 1YBTA 4K5SA 5KG3A 2PMHA 4KGKA 4G9ZA 2CG4A 4DHYA 1SKWA 3AXMA 2IFXA 1FFGB 4RBTA 3NGRA 4DX8H 3QFPA 4IFYB 2KYXA 1C1AA 1SUQA 1JJHA 2R2RA 1FJGJ 3MR5A 1OPZA 4EHUA 4OYIA 1Q81O 2BA9A 1ITGA 5M1NA 1Y64A 2MB0B 3IM8A 3LPYA 2V2VA 3M8WA 3AVKA 3WXIA 2GIFA 1S0OA 3L2RA 1JXVA 5IT9O 1ZS6A 2FY8A 3GYNA 1HYSA 1VQPS 2MY7A 3O8MA 1GXTA 2WAQD 1U48A 4PRFA 3KYLA 1RDDA 2R7SA 3MM9B 2FBTA 3CC4S 4W5OA 1RU2A 5IV3A 3KJVA 4FXWA 2J7WA 3OY9A 3NWGA 2E1ZA 2DHAA 3RB3A 2ZJRL 2WTFA 5J1EB 2ZDOA 5IWAF 4K5RA 4B08A 5T7BA 1CZBA 4DR2K 1JLGB 3SI6A 5A2QY 3N28A 5HMZA 7FD1A 4ZOSA 3MOZA 2RT3A 4CW7B 3ISND 2AV5A 3X1LB 5KG7A 4CFDA 1B92A 2VG5A 4H0XB 2BOPA 1OIAA 1RHMB 1SL2A 1TVRA 3LM2A 1VQ8N 3RB0A 3IA0A 2D0AA 2ZEJA 4B17A 1I94J 3DWLA 4ER8A 3AO4A 1S1UA 5CYMB 3MXIA 1H72C 2BM1A 4I6AA 2Y0SD 3QO9A 3OTBA 2IVMA 2NZCA 3KDOA 3FQLA 3ZZPA 3TO8A 4LSLA 4ZDNA 4FLYA 3EZWA 2HHWA 2BMBA 5J2QA 3B6OA 3SNNA 5BR8K 2LP4A 2JWLA 1OO0B 2ZJPL 1QVGM 3C65A 5M2PA 3OXLA 2W7AA 4FSVA 2O8FB 4CHYA 4CECA 1LW2B 2D4WA 5E3QA 2RF2B 4ES3A 2BJEA 5JUMA 5M2RA 2HVEA 2P9UA 1N6QB 5THWA 1NB7A 3QNNA 1UPMB 4B9LA 4CO2A 4C3MA 4E2FB 3H1VX 2BE2B 4WK1A 2H5IB 1VHXA 2MQOA 2VFUA 2VD3A 3BY5A 4IEIA 1PSDA 1PO6A 3IFEA 1BQNA 4WPAA 1FRLA 1RAEB 5LXYA 4QU7A 4B1XB 2AZ1A 2PA8D 2X3GA 3GJRB 1ASWA 2FHKA 1OH7A 3AOCA 4V19S 4DDFA 3LDPA 4PAAA 2PYLA 3BF4A 3QNOA 3TJ9A 4RUHA 4O8KA 1RDCA 4CJRA 3I33A 4BY9C 1ZTWA 3OYEA 3SQ4A 3OFGA 1UL3A 2HF4A 1FHTA 3K7RA 1U47A 3UDCA 4L3NA 3KHYA 4X84A 4I6MA 4HVJA 3ILOA 3ZTSA 5DG9A 3OVNA 2IPOB 2YKNA 5F1XA 2R8IA 2E9RX 4O4GA 1RT1B 4NXMK 3A3OB 3VTIA 2J4RA 5KT5A 4MKAA 4DBQA 4W92B 4S0MA 3ZCMA 1EKRA 2O67A 2QWOA 4FJHA 4UOHA 2R8HA 4CNYA 3O9RA 1H2TZ 4DS5A 2QEXS 3QRRA 1C0MA 3CDEA 3GCXP 2JC1A 4ECUA 1TUWA 3SMZA 4KV8A 4Y2IA 4B9VA 1UFLA 4Y0FA 2ILZA 2GUIA 3Q23A 4I9LA 4RUCA 2IMWP 2ZBRA 4DQPA 2QZ8A 2EG2A 2YNFB 3SCIE 4EWTA 4M3RA 3BB5A 4OX7A 5KFFA 3RMCA 3MK6A 2P1JA 2XGPA 3KK2B 5FLXY 3K8WA 4DUZJ 1CXUA 5C7PA 1N5SA 1WHVA 3J7Z5 1KD1O 3LWLA 3RSEB 2OI2A 3NH1A 4NRTA 3P39A 3U3YA 1ATRA 4K41A 1IBKF 4DPOA 4QCLA 4JI3F 1NDCA 5M1FA 5E3PA 4C9DA 1FJGF 3OS2A 5GAGI 1IBLJ 3D7SB 4WFBL 2EKNA 4BRMA 4K59A 3CJ1A 2HWTA 2OPPA 3ET6A 2JLFA 2PD1A 4ECWA 3UNYA 4JI8K 4ZLNA 2QKKA 1IKWA 4ZN3A 4IOXA 4QS8A 2YX6A 4RWTA 4M5IA 2F9TA 1JMTA 1N32F 3G25A 5KFYA 5I42A 3QEPA 2P9PB 2VPYB 4JI5F 5EOYA 2IDOA 3O1BA 1RAAB 1TU0B 4RU2A 4CLWA 3TAFA 2DO0A 1HJOA 2VQEF 4A47A 5AR0A 1MMNA 4RNMA 3R7BB 2GWJA 2MKHA 4FOEA 5HVGA 1WELA 1ZAWA 1S9FA 3O3LA 3CTRA 3SCJE 3E66A 1X5SA 4OLBA 2B4VA 4LT6A 2DNNA 5ETTA 4EO8A 4BC5A 2MQMA 4YDDB 1N33K 1RSCA 2VONA 2XLIA 3C7NA 2C3YA 4OFZA 3LANA 4AQYK 2DGVA 4CLLA 4DSFA 4FF3A 5EY4A 3KK1B 3LP0A 3Q83A 3O9TA 1XNQF 2KO1A 3MMBB 4OI0A 3QIDA 3R1XA 4JK8A 3BP8A 3BBCA 4DL2A 4DV5J 3UKRB 1YDLA 3I0SA 1XMBA 2CQHA 2CQIA 3N0VA 1JXEA 3D0HE 2B5JA 1NSKL 5AT1B 3UI3A 1RZMA 2NRHA 4N5SA 2B9YA 2BQUA 2ASMA 1U1QA 1NK7A 2XWYA 2GJIA 5HI7A 4WCEL 5DG8A 1LV5A 2W25A 2Z58B 3PXGa 1VQ4N 2JDJA 1TGOA 3VEXA 1OH6A 4MFBA 3HPGA 2D0BA 3G82A 1VFJA 3HHLD 2O8DB 1NGBA 1VBKA 2DYAA 1HUXA 3KWMA 3EN9A 4ZCIA 3EE8A 3UPFA 4RL1A 4I0WA 5CYQB 1RT6B 3VGSA 3AGRA 4CHOA 3O3HA 3QRPA 4DR1K 3JSBA 3OSNA 3C14B 3OBWA 1D5AA 1YJRA 1X1PA 3B8AX 4Y2MA 4BG8A 3QT6A 1RBUA 4F3QA 4IDKA 5D8HB 1HBNB 2DNHA 1N0VC 1TKTA 1YRXA 2D5RA 3LP0B 2ASYA 4Z7CA 1X5TA 2E2PA 3RMDA 4R5PB 4F04B 1NJZA 4EEYA 3AAWB 4EHTA 4PXEA 1HBMB 1NKEA 1V3ZA 2IS3A 3CCLS 2XMWA 3THYA 2DFFA 4BCAA 2UVUA 4ZVUB 3PEJA 3P83D 4E7LA 4A46A 3OVBA 3D6TB 1JJ2M 3AQOA 1NO8A 3DOKA 2O4GA 5K9FA 1TYQA 2B6AB 1TKZA 4MO5A 3VEOA 2Z2LA 4BC4A 1NK0A 2I7NA 2CWKA 3VAHA 4CJ7A 1LXJA 3K89A 3T5JA 5KRTA 4ICLB 3TABA 2ATQA 1QY7A 2L08A 2YKMA 2J8SA 3IG1A 5GAGU 1G2EA 1NWKA 4DX5A 4H5NA 1IKWB 3BSAA 3GYXB 2NYIA 3AARA 1ZETA 3CD6N 2B7CB 3WXLA 1RT6A 2JWNA 3M8PB 3RBZA 1HYZA 2V4JB 3TJ8A 2J9EA 4ISEA 3CNQP 3F44A 1TFYA 4M5KA 2O66A 3VQ7A 3C6UB 3G8SA 4CEQA 3QGIA 4MLHA 4X4OA 5ADXH 3AVBA 3WQPA 4CK2A 4FXVA 3FRZA 3EVWA 1SKRA 2RRBA 3ILLA 2HBYB 4WP9A 1N33J 3O9SA 3TYTA 4G1QA 5KFXA 3BGRA 2FLPA 4AHCA 2EI5A 4DOZA 4FJMA 4M5DB 1FFWB 7FDRA 4J9UE 3O4NA 4B3MF 2KHCA 2R7WA 4DMZA 2WW8A 5D4PA 3DNCA 3CCMN 4ES1A 1Y10A 3K0SA 2R7TA 3FGUA 5HSPA 3P31A 2RSQA 3DRXA 2IRXA 2F65A 2AKWB 2W2NP 1LWFB 1U4BA 3CD0A 4FM0A 4BRLA 1NAQA 2HBKA 3TTDA 2ZVSA 2XCPA 3O5TB 2YV0X 2XCAA 2MYFA 3TTCA 5AZIA 3MM8B 4RUBA 3OYLA 1G4CA 3KNAA 1B0TA 1WC1A 2P9CA 5F0WA 5HLFB 2CNLB 3RBDA 2I5JA 2HGLA 2OMLA 1XC9A 1D09B 4NLOA 4J9PA 2ZGZA 3ADAC 2NUBA 2RIJA 2YX7A 7AT1B 4K4UA 2E9TA 4O5BA 4LF6F 4M5HA 2NXUA 4C98A 1SAZA 1S6QA 2MJUA 5FD1A 4DUYJ 1BI4A 4XH4A 1RWVB 1VIXA 2OJ3A 5F3ZA 3OL6A 3KTQA 1DTQA 2IVYA 3EPGA 4NLDA 3H45C 3WX4A 1J5OA 3CEDA 4CK1A 1UZDA 4TVAB 2Z1IA 4DSKA 4CHPA 2XS2A 5ETMA 3ZLJA 1Z2ZA 1IUJA 4K4WA 3EEQA 4EMDA 2Q36A 3OL7A 1NMNA 5EUHA 3KHLA 2GO9A 3TEHB 2VL1A 2ZQBA 4ID5B 1KONA 1X5PA 5FRMA 1KOOA 1C0TA 1KQSM 1FERA 3VGKA 2KKZA 4BRIA 4FVMA 2K3KA 5B09A 3O9UA 4FWRA 1FVQA 1TTHB 2QSWA 1L5UA 1RXOB 2KI2A 1V3RA 3MXHP 4UT4A 4LFCF 3FJ2A 2ABYA 1CLFA 3NEKA 1HPMA 1URRA 1APSA 4F3OA 4DFKA 4QR0A 3RW7A 1FA0A 1HL6A 4L72B 2DH8A 5AQGA 3I4PA 5IS2A 3N4QA 3WNGA 4MK7A 4GMJB 5AQHA 4RBVA 2N7YA 2AEJA 3ZEUB 3M2UA 4OVLA 3DOMB 1WOPA 4JI5K 4ZKAA 4ED3A 3CMAS 4UF4A 2AP1A 2ZUAA 5L9NA 5DZ7A 4DG1B 5JVHQ 3PFEA 3O3GA 1H98A 3WXKA 3M6XA 2KU7A 1OVQA 3L2QA 3R8YA 3EJMA 3GSDA 2HS0A 2CZ4A 3GIKA 2GS8A 1WBDA 3V9UA 2PI5A 5KQDA 3O6WA 1BGXT 3TPQA 3DRSB 3US5A 4HHJA 3ALYA 4EGLA 2A10A 3U4LA 4DQQA 3QATA 4LFCK 4X64K 2J5AA 3OYNA 3J7YU 1N5VA 1FDDA 1VOMA 4IFYA 1OYDA 2EVZA 1QE1A 2XZWA 4PR6A 1VRUA 5IT4A 1F2GA 1WF2A 2OA8A 1GQEA 2ADCA 1S5JA 1NPKA 5FPNA 4WIQA 3CMEN 4OPAA 4BR2A 4RW6A 4USVA 1S1XA 2E7VA 2RD5C 3M2VB 4BGAA 1ZXOA 4FLUA 4ZK7M 2A40A 1Q8LA 2R7VA 1IR2A 1UEVA 1I94K 5IWAJ 4ILGB 1Q8BA 4CF1A 2ASDA 5FROA 5LMNK 4FDFA 1LW0B 2PFFB 3GL1A 3QIOA 2PYJA 3PJXA 4A59A 1J27A 3TZYA 3FZLA 1XMQF 2OTLN 5JLFA 4ECRA 4I4BA 4Q8EA 3ELHA 2BUNA 1HJRA 3PDNA 4F7VA 2VBWA 4I68A 3HHLB 4NZ0A 4YOVA 3O9QA 3C6AA 5FDLA 2CZ9A 4B3RF 1SVDA 2JVRA 5CXTA 4HDHA 1IBLK 3P5TL 4LC9B 1YK9A 1MN7A 4BREA 2X1FA 5LSOA 4MO4A 4IH6A 3CF5L 2XG8A 3O3FA 2C1EB 2CQ0A 2LLZA 3DOKB 1F0XA 3ISNC 3VEVA 1RT5B 3ILJA 2NRVA 2QYGA 1HW9A 3MAQA 3H8YA 2QTDA 2VQEJ 4MT1A 2RB7A 2DNGA 2HEKA 1TV6A 2PSZA 3F9MA 4G1PA 2B3TB 4HACB 2EKYA 1XIQA 4DCJB 3VQSA 5DETA 1KBRA 4RNNA 3LP1B 2XHBA 5M1OA 2RQMA 5HMXA 1JXLA 1KAYA 4PQUB 3NCQA 4DV3K 1BQXA 4RR5A 1N6QA 4DU1A 2BJ3A 3I31A 4NYZA 1TL7A 4FLWA 5DGBA 3HBTA 4W5RA 2E1AA 4YB1P 4B1YB 3RB6A 4GV3A 2D1CA 1K47A 3DLHA 2YJFA 1GFWB 2VWJA 2P5OA 3QT8A 2C2KB 3KUGA 1RT3B 2ZHBA 2XULA 3ZSVA 2I7PA 4YMEA 2OHDA 4FBUA 1OYEA 5EGYA 1XC3A 1I5OB 2XBPA 4FO0A 4Y2KA 3AA8A 3RG6A 2KG1A 1VC6A 5M1QA 3Q2SC 4ELVA 4FWQA 1BXNA 4EP5A 2GGPA 1LOTB 2JX2A 3W5YA 2X74A 4HHUA 1VJQA 1HNWJ 4AILC 5D3GB 1S49A 1U1KA 5C42B 2DY1A 3AD9C 3QGPA 4ZLJA 3QJLA 3PRVA 2XMTA 4B3SJ 4OX9J 2XZTB 1H2UX 1RWNB 4JRQA 2DGTA 4WP8A 3WX8A 3TZWA 4DL6A 1SJ3P 4QIFA 3CCVN 3K9KA 1Y9OA 4K43A 1RDAA 2J0SD 2G1DA 1U02A 3UW1A 5HATA 2IIHA 3PHTA 3D54A 2GVDA 3W5ZA 2A2CA 3E01B 5DM6L 1WAJA 1LNQA 2ZWHA 4I7FA 2CGJA 3HVTB 4RW4B 5A0YB 4YB6A 5IOLA 3P45B 4CJVA 2VU5A 2OUGA 2FJWA 3ZNJ1 3C0BA 2Q79A 2XO7A 3ZSQA 2HHXA 4H0OA 4MH8A 2OFGX 2G8FA 3AH6A 4CFCA 4DQRA 2BKOA 2KT5A 1H1VA 4Y2AA 3KWGA 4H5RA 1YX2A 5AZJA 2CPEA 4A8KA 4H4MB 1DTQB 5F3TA 3QEWA 3AO3A 4J2EA 1U0HB 1Z05A 3HULA 4FKXA 5HO4A 4CEAA 3QZ7A 3ENVA 2BJ8A 3G8QA 1VRQC 4BC2A 2XLJA 2C3MA 1VQNS 3I9V9 3HYFA 4K4YA 4CGIA 1NLKL 3IWLA 2DNZA 4IFVB 2OZMA 2D3OR 3GWCA 1J5EJ 2Y1IA 5IQQA 3OL9A 2A1SA 4NLTA 3KLEB 1BU6O 2QIFA 1IVZA 2K3IA 2Q1NA 2H4YB 3DLRA 3R5DA 4FJ9A 4NXMJ 1Q86T 2VUGA 3Q8QB 2QMWA 3WIVA 1SQFA 1WHWA 2C2NA 3T1YF 4CI0B 4TU7A 4O0NA 1Z6RA 4KBOA 1FD2A 2NNWA 2RAQA 3QJPA 3L4IA 2DHHA 3EZUA 3DXBA 3W63A 2RQCA 3NF8A 4PKGA 3T5LA 3HO1A 4HWIA 3MTJA 1RABB 4DR7J 1IO2A 4F3TA 4A8MP 4E0DA 4R0EA 1JK9B 2LQ5A 1PJ6A 3AHPA 4B3RK 1HR0F 2V34A 2MQQA 2E2NA 2D0OA 3U9DA 2HHUA 1WOOA 1I6JA 5EN1A 2DNLA 3H5YA 2DO4A 4ZVTB 3R9LA 3GJSB 2A1RA 3SAHA 5DM7Q 3LAMA 1H3DA 2CUYA 1KEKA 1IJJA 2Z56B 1GLBG 3KLGA 3TAGA 4WKYA 3CIMA 3DDNA 3O5BA 2CPFA 2FVQA 2Y1RI 2OD4A 1NSAA 3FSXA 5CZXA 2Y3YA 3T69A 3DLKA 2BE2A 2V52B 2E66A 5E3CA 2DPNA 3HD1A 3PNIA 4BRCA 5C5JA 1H73A 1S0VA 2XMJA 4MK9A 1GTHA 2DITA 1JQGA 4CZEA 2GX8A 3HT3A 4MIAA 2H65B 5HRNA 3U1NA 3P5JA 4HR2A 1OY6A 3QINA 2ACMA 3VF4A 4BR7A 2MZRA 1EJ7L 4Z4EA 4IOAL 3UD3P 3I56N 2YWWA 1QHTA 1VSFA 2MKSA 2VBYA 3FRYA 5B0GA 2RDJA 4DV0F 5KFDA 4FJXA 4X4VA 1TAUA 3JXUA 3MN5A 5GIPA 4JKAA 3C14A 5F0UA 1OVYA 4PXCA 2VZ9A 4LIWA 1ZPWX 2R8JA 1VQNN 3HKWA 1GX5A 3BV8A 3PIOL 1G6BA 1ZZNA 5LSRA 3MMCA 5LMNF 4RW7B 1KRPA 3BSCA 1PJ5A 4ZJQA 1CC7A 1S6UA 1RDUA 2IRYA 4ECTA 1IQZA 3MPWA 3LZJA 2C42A 3F73A 4KO0A 1VQ6S 4FZZA 1YJ9N 1RTDB 4F0KA 3EZ5A 4FNHA 4QPXA 4JV0A 2BX6A 3K59A 4F25A 2MXYA 1FCAA 4N7TA 1HWUA 2HQGA 3V9SA 3BM7A 1HNZJ 3CM6A 4CEDA 1YF5L 4DV6J 2E1PA 4LFAK 2LQ8A 1OH8A 4ILMA 1C1CA 1JNZB 4LRDA 1ZBIA 3KD5E 3MN9A 4GKKK 3EYZA 1HBUB 3O4QA 4D3GA 4FYYB 4H0YB 3HSTB 4DV3J 3CUNA 4BVPA 2V4RA 3TQ1A 3GV8B 1SJ1A 3KLVA 2J0WA 3UD4P 1HARA 3W60A 2YPYA 4KH6A 2ZJQQ 3QWUA 1HMVA 1MDUB 1ASVA 3B4DA 1KQGB 4P6QA 3NBPB 1U7LA 1T8EA 2KZZA 3HJVA 1V5IB 3ZT3A 1QSSA 3JSRA 2EX3A 2NXJA 1M5VC 4CLYA 3SQ0A 1XWLA 1JKHB 2W8KA 1RAHB 4KPCA 4F02A 3VA0A 1FT8A 2P5GA 4A8YA 3A8YA 5AQVA 1KFDA 1VK3A 3KK3B 3QJJA 3DXMB 2X6SA 3DRPA 1RUSA 3D68A 5L8RC 4LF5F 1C2PA 4CWBA 1YJWN 3CJ9A 2QG9B 2QX0A 3VZHA 3EE9A 4JYAJ 4GC6A 4JD2B 5L1LA 3OYMA 1VRUB 4ERDA 2E2OA 3HX9A 4FOIA 3CJ2A 3HFZB 2HBZB 4H8KA 2CJBA 1JCEA 4ZPDA 1TK0A 4LSLB 2DPJA 3JTPA 3BR8A 2QLJB 4U6PA 3HHKA 5HL7L 4KTQA 4ZTFA 3I8DA 3CW2C 3T9NA 3CCQS 3V9WA 4IFEA 3QB0A 3DKDA 5DLFA 4R79A 4AQYJ 4H0VB 4E89A 4PABA 1VQ5N 1N52B 3SQGA 4WXOA 4DZDA 4DL5A 2V67A 2E7WA 2GA7A 2D3O1 2DXEA 4JI3J 2L41A 4OL8A 1KN6A 4NLYA 4NLVA 2RHQB 4XH1A 3C15A 5I3UB 2DGUA 3VEYA 5A6PA 1LCUA 1RADB 3DGPB 1NJXA 4FS2A 3BGLA 2ZHAA 2JEGA 2AZ3A 1VK8A 3UQSA 4NA1A 4ZCKA 1HKBA 2X78A 3W2WB 2HURA 1V5VA 3DMJB 3TNVA 3SDEB 4FPAA 4CEOA 4A61A 3M8YA 4MIBA 3WT0A 4DEZA 1WSFA 2AIRB 4M5LA 2RHKA 1S9EA 2GW8A 1U6FA 3S01A 4KFBB 4GW6A 3SJHA 4FF2A 3HOSA 1X9MA 4WFXA 2IC3A 3LGMA 1F60B 1EWRA 5AQQA 3C95A 3J81O 1YJNN 1E3MA 1D9FA 2FBYA 5KFPA 3HI9A 2QW9A 2MLXA 5BYQA 5KGXA 4O5FA 4J9SA 3M3ZA 5AQNA 1KQKA 4O4RA 4YY3K 2UXCJ 3CMQA 3MCNA 3O1LA 1MW7A 4WK3A 1XNRF 4WFNL 3RRHA 2YKOA 3MMCB 1BUPA 3CD6S 2JEIA 2QA4N 3ITHA 1CC8A 3AQPA 4M45A 4ISGA 4YDXA 2O8BA 2DRDA 1WSEA 5C0YA 1FEEA 4O3QA 3CQXA 3PYFA 2WBMA 1TUUA 5EWEA 2CKWA 2W7OA 2HF3A 3BO2A 4F4AA 2Z2ZA 3SMPA 1F6TA 4YOUA 1VQMS