1DTQA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-1 (pett131a94)
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
536
structure length
524
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transferase
molecule keywords HIV-1 RT A-CHAIN
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 134
structure length 524
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dtqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dtqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dtqA05
1KHWA 3M8QA 4CHOA 1A5VA 3OYBA 1NK9A 4JRQA 1U45A 3GV8B 4J9OA 2YNIB 2RPIA 1RTHB 1VRUA 4FJGA 2IMWP 1LWFA 4JUZA 1RBUA 4E7LA 1SL0A 4OJRA 1FK9A 1LW0A 3OHAA 3MFIA 4DQIA 1NK5A 3Q8QB 3K57A 1QTMA 4XPEA 4KFBB 2FBXA 4FM2A 3AO4A 5E41A 3GV7B 4HCCA 4ZVGA 4CJTA 3V81B 2FJXA 1J54A 3U6FA 4C8LA 3OL9A 1JXBA 3L2UA 1LWCB 4ECRA 1IKXA 4JV0A 1RDCA 3VQ8A 4PWDA 5F9NA 3EZUA 2HVIA 2IM2A 5KFLA 3MR6A 4KO0B 3LDSA 3ZCMA 4CGIA 3DRRB 3MEEB 3TR8A 2B5JB 1K1QA 1SH0A 2ATQA 3OS0A 4EBDA 1B9DA 3CFPA 2D41A 2BE2A 4RZRA 1X9WA 3CJ4A 2BRLA 4OKKA 4J2BA 4DL6A 1Q9YA 2J6SA 1RT2B 3I5AA 2IC3B 4IKAA 1EKEA 5HRNA 1SUQA 4O0JA 3EZ5A 1S1WB 3I0RA 4O0IA 4MIBA 4Q44A 1W9HA 3KJVB 1C2PA 5L1LA 3JSMB 4B8AB 4F2SA 2R2TA 3CDWA 5KFIA 2HHUA 3KLIB 2ASLA 3FQKA 4NRTA 3IG1B 4URQU 5KT3A 5KFKA 2J6TA 3H5YA 3CIZA 4ED7A 3LP0B 4DL7A 3KLGB 2YV0X 1N5YB 4KHRA 2IBKA 4RUAA 5DMRA 1RT3A 1ZBLA 4J9PA 3CJ2A 4DL5A 4U6PA 1B9FA 4Q0BA 4TXSA 4CJSA 2BR0A 1YT3A 4CJQA 5KFTA 2XI2A 5KT4A 4DSFA 4OL8A 2AX1A 4R0EA 2ZE2A 2YHBA 4CJEA 3V1QA 3OHBA 2O4GA 3SV3A 4KHUA 3VQSA 3ZSWA 4RW7A 2XCPA 1S1UA 5EWEA 4KHWA 4DU3A 4IRCA 4BE1A 1DTTB 3BREA 1Y97A 4N76A 4G1QA 3C6UA 3V4IB 1NNDA 2C2EA 4ED2A 2R8GA 1LV5A 3MECB 3NH2A 4IBNA 1S1TB 1NK4A 3G86A 2HB5A 4ECVA 5HROB 3DLBA 4CEEA 2PYJA 4FK2A 4CEDA 1RBRA 3SPZA 2BRKA 2LSNA 3V6HA 3DLHA 1XR6A 3BJYA 4O5BA 3ZT1A 4CJ5A 3DRPB 1QSYA 3O3FA 3KLEA 3K5MA 3DLRA 4F8RA 3LALA 2I5JA 4YQWA 3ITHB 4RW4B 3DRSB 3RWUA 3KMSA 1XC9A 4C8MA 1TQLA 4KO0A 3V6DA 2FJVA 4M3WA 4DTJA 4AHCA 1JX4A 4ED8A 1RTJA 3GILA 4BDYA 2R2RA 4DQSA 3KK3B 4KKOB 4EYHB 1C1AA 5C42A 3OLAA 2OPQB 2DFEA 3LANA 3E01B 4MQ3A 3IRXA 1HNIA 2W9BB 3HP9A 4K50A 4FJXA 5FRNA 1RTIA 3HL8A 3OYMA 3HT3A 3KK1A 3EPIA 1I39A 2RDJA 4ELUA 4ICLB 5KFHA 3T19A 2GC8A 3TANA 1YTAA 4RNMA 3KKSA 1JKHA 4URSA 1BQNB 4WYWA 4I2PB 3OYHA 2E6LA 4NCBA 3HO1A 3DMJB 1ASUA 3MEDB 4TLRA 4ZPCA 4DTXA 3I5CA 1HPZA 5DK5A 2AGQA 2E4LA 3QNNA 4DTRA 1GX6A 4ECZA 3PW7A 3HPOA 2GIRA 4E1NA 3OYIA 1JLCA 5J2NA 4EP5A 4CJVA 3QIOA 2DY4A 4F4WA 2V4QA 1MU2A 1TKZB 3LPTA 1X1PA 5FRMA 4YMEA 1BQMB 4LY7A 1RT7A 1QHTA 4QWAA 3OYDA 1LW2A 4CCHA 4M3ZA 4GMJB 1DTTA 4X2BA 3SZ2A 4IH7A 2Q3SA 3QYYA 3QEPA 1U49A 2VG5A 4O4GA 2FVSA 1S1TA 2XO7A 1T05B 1IKYB 2WHOA 1NHUA 5KG4A 4M95A 4FK4A 3M8SA 1SL1A 1NOZA 2IGIA 3QGIA 3O3GA 4J9LA 4J2EA 4FXDA 4W5RA 1TL3B 4WZMA 5J2PB 4CJFA 1RDAA 5F8IA 2ETJA 2D0AA 2BQUA 4KHNA 2Z1IA 3FFIA 4EBEA 1TK0A 3DLKB 4IFYA 3NFAA 3H5XA 1QUVA 2HW3A 2R2SA 2E9RX 3H40A 1HQEA 4DU4A 1WSIA 4IDKA 3IN5A 1NJWA 5T14A 2QKBA 2G8UA 3PJWA 3CO9A 1TKXB 3KIOA 3DLEA 4EO6A 4FW1A 3VQ9A 4ED1A 4HCBA 3IGVA 1I6JA 3BSOA 5D3GB 3GIJA 2HAIA 3C6TA 1J5OB 3PJXA 4Y3CA 1T03A 4O3PA 4W5TA 1C1BA 3EY1A 4RW8A 3NH1A 3RAXA 5HBMA 2KFNA 3V1OA 3VQAA 3BSCA 4DLEA 2VA3A 1LWEA 2AQ4A 5C24B 4TN2A 1S9GB 4E7JA 1C1CA 3HVWA 2V4RA 5KG2A 1VK0A 4LD0A 4I2PA 3OL8A 4KI4A 2HHWA 1S1XB 4B9UA 4BDPA 1ZTWA 3T1AA 3GIKA 4E3SA 3PX6A 3OYFA 2C2DA 1SH3A 1EP4B 3PO5A 2RDIA 1KVBA 4CK1A 3HVTB 2HNYB 4HTUA 1ITGA 1NKEA 4NLYA 4Y1DA 2HNZB 3HVAA 3G0ZA 3P83D 2VWKA 2IJFA 3OYGA 4CIEA 3RRHA 4DQPA 1VRTB 1BQMA 1S49A 3DM2A 4F4YA 3MFHA 2IAJB 4TYAA 4CESA 3SV4A 3H2LA 3BSAA 1WSJA 4FJHA 1RT5B 3TQ1A 1T94A 4CF9A 3PX0A 1KLMA 2OPSA 4I2QA 2D3ZA 2ZKUA 1U47A 2G8KA 3OLBA 3G10A 2ILZA 2UVUA 3NCIA 3T5LA 2XY7A 1QQCA 1JXEA 4NYNA 2Y1IA 1QSLA 4Y34A 2YKNB 1A5XA 4ZTFA 3QNOA 4CFCA 4EEYA 3ZT3A 3L8BA 3NBPB 4DL3A 1HYSB 2UUWA 4ZPBA 3CM5A 3WNHA 3ISNC 1C0UA 3V1RA 4PUOB 1KFDA 2HVHA 3LP3A 4IG0A 1WLJA 5KRSA 4DTNA 3VQQA 4Z0UA 3KMQA 2X6SA 3NH0A 3DLKA 3QIPB 1DTQA 1K1SA 4H4OA 3TVKA 4ED0A 4ZP7A 4JS4A 4BDZA 5KFRA 4E1MA 1UWBB 4ZPDA 2BQ3A 5C5JA 1YVUA 3VQ6A 5CYQB 3SQ1A 3PV8A 2X74A 3L2VA 3NGZA 1RBTA 3V6KA 2QXFA 1JLFB 5EU7A 5C25B 2YKMB 3VQEA 4E89A 1JLGA 4C8NA 4AHUA 5FROA 4LQ9A 4O3OA 1N6QA 4FJMA 1GOCA 5KI6A 4QAGA 4URGA 4K8ZA 1CXUA 1GOAA 3HVRA 3RMDA 2YNGB 5K14B 1EETA 1BI4B 2A1RA 1VSHA 3IAYA 3AO2A 2P5GA 3SUPA 3O4QA 5SWMA 1S1XA 4ZVEA 3VN5A 3DI6A 4QWEA 2F8SA 1ZBUA 2R8IA 1WSFA 3BGRA 1S10A 3H59A 1SKWA 1EP4A 3QESA 3OL6A 2KZZA 4L8RB 2HNYA 4XPCA 1D1UA 5KFFA 5KGXA 3PR4A 5KFAA 5CYMA 4TY9A 2PYLA 4ZHRB 4DSJA 3KHRA 3AVMA 1S9EB 3ZSZA 1L3SA 1L3VA 3A2FA 5FDLB 4Y2CA 4M94A 3RB0A 1IKWA 5JUMA 3QETA 2HWIA 4YNQA 3Q8RB 2RKIA 4O44B 5HLFA 4CJPA 2JC1A 4DSEA 4CJUA 1L3UA 1QAIA 5J2QA 3ALYA 4RUCA 2JEJA 5CZ2A 4ZP9A 4B9SA 4C8OA 1HMVB 3CYMA 1HYSA 3OYJA 3TAGA 3RR7A 2XY5A 5J1EB 2XI3A 4H8KA 3HSTB 3ICLA 1RDDA 1Z26A 3H4DA 1QE1A 4FBTA 5KG1A 3RBDA 3GYNA 2NUBA 5KFWA 2ZQBA 1S6PB 4M3XA 4KRFA 4CF1A 4KREA 2RF2A 1JLBB 1ASWA 4CHQA 4KE5A 4NLDA 4JV2A 4F50A 1NJXA 1WNSA 2W42A 4FLZA 4B3OB 4ECQA 4GW6A 4MIAA 5J2MB 4YR0A 3PO4A 3NL0A 1L5UA 1TK5A 4RNOA 2R2UA 4N41A 4WE1A 3V6JA 4DS4A 3C94A 3JYTA 3V9UA 3SYZA 2P5OA 4J9KA 5DQGA 1ZBHA 5KG7A 1TKTA 4R5PB 3TWHA 2ASDA 1D8YA 1S6QB 4K4YA 4KPYA 3KLHA 3FRZA 1RT6A 3H4BA 3H98A 1JLAA 2IM0A 4HYKA 1VSKA 2PY5A 1A5WA 1TAUA 1Z4UA 4DSLA 3CFRA 4B08A 3PVXA 1RTDA 2DTUA 5K14A 3ZSRA 1RYRA 4FLWA 3OYCA 4KAIA 1R0AA 4KSEB 5KFOA 1VSJA 3LAMA 4WFZA 4IKFA 4Z4FA 3OS1A 4LH4A 3CJ3A 4ECWA 1HYZA 2OPPB 3N6MA 5L1KA 4CJ3A 3K59A 3DYAB 3DLGB 2FBYA 3I0SB 3BQ0A 4K4ZA 4NLUA 2P51A 3H08A 3CJ0A 2IJNA 4FLTA 4KHYA 1XWLA 4DFKA 2OZSA 3QIDA 2YNIA 1S9EA 2D3UA 3THVA 1RTHA 3G6YA 4FJJA 4LH5A 2W7PA 1D0EA 4ID1A 3PX4A 1LAVA 1RT4B 4WXOA 4O3NA 1GX5A 2XWYA 2FC0A 2HHQA 4RW9B 4MFBB 2YNHB 4O44A 4FLVA 3QERA 3ZSXA 3LP1B 4NCGB 1KHVA 1REVB 4KFBA 3KOAA 4LSNB 3RMAA 3MR3A 1X9MA 4I7FB 2HNDB 3NGYA 3V81A 3D5MA 3VQBA 2FVPA 2G8WA 2G8VA 2UVVA 3KD5E 4NLWA 3TAMB 1HMVA 1LWCA 4TY8B 1SV5B 1BIZA 3HHKA 2KQ2A 1BCOA 2W8LA 1HNVB 4WFYA 1NOYA 1UAXA 4K4VA 3IS9B 4TQSA 2OYQA 3DRRA 4ZPAA 1EXQA 2AU0A 3MEEA 3LAKA 2B5JA 4HUFA 3UQSA 4TQRA 1U04A 3NF6A 5KT6A 3AVNA 4PA1A 4EO8A 1WSHA 1RT2A 2IC3A 3RB3A 1U4BA 3BR9A 2Z1GA 1TL1B 1VSEA 1S1WA 3BQ1A 4IR1A 4JS5A 3NGDA 1N56A 4HUGA 4O3QA 3RRGA 3NGIA 4NYFA 3KJVA 5EUHA 4EZ6A 3JSMA 3ZSYA 4R5PA 3KLIA 5KT5A 3D0PA 3IG1A 4F2RA 5KFDA 2WOMB 3LP0A 4CJRA 3KLGA 1N5YA 4KV8B 4DTSA 2P1JA 3SQ4A 1XR5A 3AVFA 2XC9A 4DSKA 4E7IA 1KLNA 3AO1A 3SUQA 3TAQA 3RB6A 4Z4GA 4Y2AA 4K4WA 2G8FA 1C0TB 1S5JA 4QOZB 4AHRA 4KHQA 1BHLA 4CEAA 4RU9A 1RNHA 3DYAA 3DLGA 4M3YA 1QAJA 3WNFA 4K4TA 3AV9A 1S48A 5CY4A 3V4IA 4EZ9A 5KFBA 3MECA 1TV6B 2O5DA 2FJWA 4KTQA 4DEZA 3AVKA 1NK8A 3DOLB 3NF9A 5HROA 3NF8A 1JLQB 1KCFA 4RW6B 4Z4EA 4MFBA 3KTQA 3SI8A 4BWMA 2FBTA 1FKPB 4LSNA 2R7YA 3DRPA 4I7FA 5T7BA 4DL4A 3D28A 3CWJA 4ID5B 3TAMA 4KBIA 3ITHA 4RW4A 3DRSA 1ZETA 3QO9B 3SNNA 2G8HA 2XY8A 1O1WA 2R8KA 2JLEA 3QGHA 4CJKA 4MH8A 3OVNA 4YFUA 4Z4CA 1UA1A 4FW2A 5DG7A 3FQLA 4HKQA 1RCHA 4GVMA 2B6AB 1BIUA 1W0HA 3KK3A 4KKOA 3MXIA 2VA2A 3PW2A 4MKBA 2OPQA 1FKOB 1JL1A 3E01A 3WNEA 2ZD1B 2HWHA 1T3NA 2W9BA 5I42B 2Z1JA 3Q8PB 1TL1A 1JXLA 2VG7B 4AHSA 3MXMA 2WRMA 4QPXA 4ICLA 5DGAA 4KHMA 4ED3A 4CEOA 4B8CA 4DWIA 4CFAA 1BQNA 4DTOA 4N47A 2ASJA 4NLRA 2C28A 3DMJA 3CDEA 4Q43A 4MKAA 3MEDA 3DOKB 4CF0A 5KTQA 2KZMA 3SCXA 3AVJA 3C95A 2FVQA 1RT1B 3OYKA 4FM0A 5KT7A 3MEGB 4ECYA 4R8UB 3VA0A 2GIQA 3UDLA 2QE5A 1B92A 1Q8IA 2XGPA 3QGGA 2VWJA 3RMBA 5JS1A 3CJ5A 1TKZA 2WONB 3NAEA 3K5NA 4CF2A 2BANB 4W5NA 2B43A 4LSLB 1RA7A 1S9FA 4O3SA 3ZSOA 2CJQA 4KB1A 3NDKA 1WNEA 1HQUB 3ZT4A 4E7HA 3MR2A 3HP6A 1TVRB 5KFYA 4KB0A 3QZ7A 1JLEB 3Q8SB 1TV6A 2PZSA 3ZT0A 4QWCA 1T05A 4K4XA 4YR3A 1IKYA 3KHLA 2R8JA 4I9QA 3KNAA 1LWFB 5JXSA 1C6VA 3TABA 4TSXA 1FK9B 3VQ5A 1SKSA 5KG6A 1S97A 2BGGA 1FKPA 1TL3A 4CEZA 5J2PA 5DGBA 4Y1CA 4E19A 4ZP8A 4DFJA 3S3NA 1ASVA 3K5OA 4ID5A 4FJLA 2X6NA 3L3VA 1YTUA 3TARA 3CVKA 5KFPA 4Z4IA 3I5BA 2OPRB 4QW9A 4HHTA 4RG8A 1IKXB 3QO9A 2R8HA 4CEBA 3HJFA 3B6OA 4PWDB 2C22A 1F21A 2V0NA 3M8PB 3P5JA 3PW5A 3KK2B 5F8MA 1TGOA 1TKXA 5KRTA 2V9WA 2D7SA 5KFJA 4W5OA 2G8IA 4CHPA 1Z25A 2BE2B 2ALZA 3RMCA 1FKOA 5D3GA 1DLOB 2HHSA 1J5OA 5F8NA 5KFGA 4FJKA 3O3HA 3NE6A 1VSFA 4E7KA 2JEGA 2W8KA 4AILC 1J53A 3B6PA 4IH6A 3OSPA 1CZ9A 5C24A 1S9GA 3I0RB 2ILYA 4FLYA 1KTQA 4DLGA 3VQPA 4ZVHA 3QZ8A 1EX4A 2XGQA 4IFVB 4J9QA 4J9MA 5DQIA 2C2RA 4CERA 3UR0A 2IOCA 4IRDA 1ZBFA 4FM1A 5HP1B 4FJIA 1CLQA 3CQ8A 1RT3B 3HVTA 2WK4A 2BDPA 3TAEA 3KD1E 2FVRA 2HNZA 4R8UA 1NHVA 4Q0BB 4Q5VA 3PUFA 3GIIA 1SL2A 4FZZA 1VRTA 4Z4HA 4RNFA 2GBZA 4H54A 4B9TA 2ZE2B 4K4SA 2IAJA 4B9NA 2IS3A 1HJRA 1CSJA 4UQGA 1K6YA 3CM6A 4RW7B 1S1UB 2DFHA 1RT5A 3AVIA 1IM4A 5L9XA 4XO0A 4G1QB 3C6UB 3AO5A 3HYFA 1NKBA 3OJSA 4IG3B 2KFZA 1BCMA 4QWBA 5KGWA 1RDRA 4FK0A 4H4MB 4JV1A 2YNFB 5DQHA 4J9RA 2YKNA 4J9SA 3BDPA 4NLVA 3T5HA 1VSIA 4EBCA 3EPGA 4DQQA 3NBPA 4MK7A 1JL2A 4XIUA 3T5KA 3NAIA 4N56A 2AGOA 4DTUA 3OL7A 4PUOA 3AVGA 1WSEA 4OGEA 3KLEB 2OPRA 3S9HA 4B9LA 3QIPA 2FLNA 4KI6A 2I5JB 4QWDA 4N5SA 4B9VA 2YHAA 4BE0A 3M8PA 1UWBA 3V6DB 3UIQA 2AWZA 4NLXA 5KG3A 3KK2A 1TK8A 5KFNA 4ECTA 3RAQA 1HYVA 5CYQA 4OPJA 1RTJB 1NK0A 3T5JA 4Q8EA 1FXXA 3KLFB 3K5LA 4G3IA 4ELVA 1DLOA 4J9NA 3ZT2A 4JRPA 2HHTA 3RR8A 5C42B 1JLFA 5C25A 2YKMA 3IRXB 2ITGA 3BSNA 1HNIB 1X9SA 4OPKA 3BQ2A 3H5SA 2D0BA 5F8JA 4FLXA 1RTIB 5KFMA 4IQXA 3AVAA 3KHHA 3PY8A 3KK1B 2YNGA 3LZJA 2JC0A 1RYSA 2IM3A 1BI4A 3MTKA 2AGPA 3RBEA 4IFVA 1L3TA 1VSMA 3FSIA 1MMLA 1JKHB 4FJ7A 4K8XA 1CZBA 3QEXA 5F8LA 5HP1A 3ASMA 2OH2A 1HPZB 4OLBA 1RDBA 4NLOA 2D5RA 1TAQA 3QINA 3V9SA 3F9KA 4KHSA 4CGDA 2OA8A 1JLCB 5J2NB 4ZHRA 3MR5A 3OJUA 4NLTA 1XHZA 4F4KA 1MU2B 4KTZA 1U48A 2EHGA 2FBVA 2J6UA 3MF5A 5FDLA 5F9LA 1RT7B 2JEIA 1LW2B 2D0CA 4DG1B 1OS5A 1WAFA 1NK6A 4CJ4A 5DG8A 3LP2B 5I3UB 4M42A 2VG5B 2W9CB 4IG3A 4O4GB 4O4RA 2Y1JA 4CGGA 4DTPA 1NJYA 1S0NA 2DPJA 1BISA 4H4MA 2YNFA 1ZBIA 3NMAA 2FLPA 3VA3A 3LWMA 2XCAA 1TP7A 3LWLA 5J1EA 2E6MA 2HMIB 1RA6A 3VQ4A 5KFZA 2FVCA 4IR9A 1HRHA 4NLQA 2HHVA 4AHTA 1GOBA 4ECSA 4OKEA 1S6PA 2CKWA 3PHEA 2OZMA 1JLBA 3FFIB 1VSLA 1S0OA 5KFUA 5L1JA 4KAZA 4IFYB 1JIHA 3VQ7A 4B3OA 1HQEB 4DU1A 4CIFA 3SPYA 5J2MA 4FYDA 3MXJA 4IDKB 3F73A 1UOCA 4DMNA 4HVJA 3SFUA 4NCAA 2GUIA 1KVCA 3AA4A 4FVMA 3DLEB 3KLFA 4FJ9A 2F8TA 4E0DA 4AH9A 3L2WA 3PW4A 3C6TB 3QEIA 1S6QA 1T03B 4CHZA 1C1BB 5EWGA 4RW8B 5HBMB 5KT2A 4OKJA 1NKCA 2ATLA 3AVBA 1SH2A 3OYAA 4ECUA 3TAPA 3H5UA 2RN2A 1Q9XA 1LWEB 4ECXA 3CDUA 1C1CB 4DL2A 3AVCA 1BL3A 1XI1A 2FLLA 3GIMA 3AVHA 4M3TA 3M9OB 1N48A 2DPIA 3AO3A 4CK2A 4DFMA 2OPPA 3VQCA 3KLVA 4GC6A 3I0SA 4CGJA 4CHNA 3HM9A 2F8EX 4M3UA 5DLGA 4IOBA 4ZMMA 5KFQA 3QLHB 4KTWA 4F3TA 3SQ2A 1IKVB 3DM2B 2UVWA 2QV6A 4DG1A 1RT4A 3PW0A 4RW9A 2YNHA 3SJJA 2A1SA 3LP2A 5I3UA 5HRPA 5KG0A 3OS2A 3LP1A 3QEVA 4NCGA 4NRUA 1KLMB 2OPSB 1REVA 4I2QB 2W9CA 4CE9A 2O4IA 3M9MB 3NF7A 3V9ZA 3EYZA 4ZP6A 2HNDA 4NLSA 1HARA 3IGNA 2WTFA 4WXWA 4FBUA 4TY8A 1SV5A 3SUOA 4O3RA 1BGXT 1C0MA 5JS2A 3OYEA 5HRRA 4AHVA 1HNVA 3D45A 1VSDA 2HMIA 3AVLA 3HXMA 2XY6A 4MK8A 3IS9A 1C0UB 4OVLA 3SFGA 2X78A 4F3OA 4OLAA 4ELTA 4IG0B 1G15A 4K4UA 1RAJA 1N4LA 1LAWA 1DTQB 3HPHA 4H4OB 1QSSA 1ZTTA 3K2PA 5HRSA 4DFPA 2UVRA 3NHGA 4ED6A 1KRPA 3P1GA 2IDOA 5SZTA 3N6NA 2JGUA 3ISND 4YP3A 4YR2A 3E51A 1S0MA 3L3UA 4NLPA 1XR7A 4WYLA 4CFDA 2QK9A 1T7PA 1JLGB 3LPUA 2BQRA 2WOMA 4IH5A 4DS5A 1QS4A 4ZTJA 2VG6B 1N6QB 2AX0A 2I1RA 4DSIA 4CECA 4FJNA 4KV8A 1YVFA 4F4XA 3M8RA 2E9ZA 3M9NB 3OY9A 1NJZA 4MK9A 1S1VB 4RNNA 2UUTA 3NKYA 3ZSQA 1EETB 3K58A 5KG5A 3AA2A 4DQRA 1C0TA 4O55A 3RB4A 4DF4A 3DI6B 4WFXA 2AJQA 1WSGA 4NYZA 2W9AA 4BACA 2XRIA 3BGRB 3ZSVA 4FS2A 4OGCA 1NK7A 1WN7A 4QW8A 4Q45A 4ZVFA 3DDKA 5F8HA 3G6XA 2B4JA 2IM1A 3V9XA 4PY5A 1WAJA 3L2RA 1RBSA 4PQUB 3QLHA 5DLFA 1UA0A 5CYMB 3M8QB 4J2DA 5F8GA 2KTQA 4CHYA 4CFBA 4DTMA 4LQ3A 1XHXA 3I8DA 5KFVA 4M3RA 1IKVA 4HUEA 1ZYQA 1D9FA 1VRUB 3DOLA 3CFOA 4EP4A 5KFCA 2DFFA 4CJWA 2WB4A 4RNHA 3T3FA 1JLQA 4RW6A 4CEFA 1LW0B 3VQDA 3OSNA 1IKWB 2GV9A 3U3GA 4FS1A 4GC7A 2Z1HA 2RKIB 5HLFB 4M41A 4B9MA 3SQ0A 5KFXA 4M45A 5J2QB 3HK2A 1I3AA 3QEWA 1U09A 2IA6A 3TAFA 1T8EA 5KFSA 1D9DA 2QKKA 1IO2A 4FJ5A 4EYIB 3OYNA 4CIGA 3ULDA 4IRKA 1QE1B 1CXQA 2XHBA 3MAQA 2W7OA 4NZ0A 4W5QA 2B6AA 1KVAA 4KB7A 3UPFA 3FDSA 2RF2B 4Q8FA 3LZIA 1RILA 3L2QA 4FZXC 4CGFA 3U3YA 2ZD1A 4WZQA 4QCLA 4CJLA 1W25A 5I42A 4FCYA 2VG7A 1SUQB 4I9LA 1S4FA 4WE1B 3JYTB 4JLHA 3S3OA 3O4NA 3PR5B 2JEFA 3TI0A 5L1IA 3V9WA 1TKTB 5EDWA 4NLGA 3AA3A 1SKRA 3WNGA 2VG6A 4U7CA 3KLHB 4TYBA 5DG9A 4FZYA 3DOKA 1RT6B 2F96A 1JLAB 3S3MA 4FLUA 4J2AA 1IH7A 4F4ZA 3HKWA 1RTDB 1D5AA 3SI6A 3KHGA 2WCXA 1RT1A 4C8KA 3CG7A 1TKDA 1S1VA 3KKRA 4CK3A 3MEGA 2EX3A 1RBVA 3PZPA 1R0AB 1J9AA 3HPGA 2KW4A 3GV5B 5EWFA 1KSPA 3OYLA 2WONA 3G6VA 4BE2A 2HHXA 2BANA 3RTVA 4LSLA 4CF8A 1IG9A 3SUNA 3NAHA 2EC0A 2E9TA 4FJ8A 3N6LA 5CZ1A 1HQUA 4CGHA 1TVRA 5KFEA 3AA5X 1KFSA 3GQCA 4DF8A 4PQUA 4CEQA 4BWJA 1JLEA
chains in the Genus database with same CATH superfamily
1X8DA 4CHOA 5L46A 3GV8B 2GUPA 1LXJA 4JD2A 4JI5K 3JS6A 4IUFA 4P7VA 1Z2LA 3AT1B 4OJRA 2J8AA 3G82B 1WHXA 1SCJB 2QL9B 3NCPA 2ZH4A 3K57A 2E5IA 5GMEA 1MLAA 1M5OC 4C1NK 3BZCA 3U27A 2FBXA 2MPUA 2L9NA 3F2KA 4HCCA 1JJ4A 2RH3A 3V81B 2FJXA 1Q79A 3VESA 4C8LA 2H3EB 4Z7YA 1YJWS 3OL9A 3C6AA 1JXBA 3OA9A 4HTIA 3M1VA 1V3SA 4H0OA 2VQFJ 1FXDA 4PWDA 5F9NA 4RWXA 3IWNC 1GMUA 4X4NA 4L3NA 3W8GA 3LDSA 3ZCMA 1LQ9A 1YJVA 3VVTA 4OZ5A 5LMNF 1SJRA 3ENWA 5G0RB 4EBDA 2DGUA 2DNKA 2D41A 3MCMA 3I31A 4RZRA 1NDPA 4WP3A 2CADA 4LF4J 3GCWP 4DL6A 2NUUG 3I5AA 4QIGA 3VHQA 2IC3B 2MZJA 2FYXA 2MZSA 1N5TA 5HRNA 2IVYA 4O0JA 2BACA 3ZZRA 2CPHA 4WFBL 3I0RA 1VQON 3UE5A 4Q44A 1W9HA 5L1LA 1JMTA 2Q0RA 2HLUA 4LFAF 5KFIA 2VQFK 3BYPA 2PN6A 2F8HA 2IRUA 1HIYA 5KT3A 3LP0B 2QWRA 3KLGB 2L9WA 2IBKA 1RT3A 2P9EA 4F3MA 1X4FA 1ZBLA 4OZ0A 2R3VA 1BD6A 1B9FA 4RUBA 4TXSA 5FPEA 5CZVA 2LVWA 2JNJA 1YT3A 1K9MO 2NRXA 3LM2A 4B3SJ 2AX1A 2ZE2A 1F5BA 4LBHA 3CDBA 4RWWA 1UMJA 4LF6F 3SV3A 3OR2B 1ACMB 1T02A 4LF4F 2XCPA 4BE1A 3BREA 3P6YC 2M9KA 4N76A 1CBKA 1YI2N 5DM6L 2M4MA 1IBKJ 3ENAA 5FD1A 1WC3A 3UN2A 4IBNA 1RBOB 3C16A 3VQTA 2CNNB 3DLBA 4KBOA 3AB2B 4CEDA 2QYCA 3V6HA 3GP9A 1XR6A 5CD4A 3FUYA 1QSYA 3HI9A 2MGZA 4CTAB 4RW4B 3RGIA 2IYIA 3DRSB 3KMSA 4LRAA 1XC9A 4B3SF 4KO0A 3H7HB 1F2HA 4W90B 1YUWA 1SKUB 1ZA1B 1TELA 3IR7B 2NQPA 4AHCA 4A2AA 4JI1J 4CD1A 4NI2A 3GILA 1IBKK 1DKGD 5A2QU 4YOTA 3CT9A 4F26A 4DQSA 3CCSN 1DBDA 4DV6F 3CD7A 3KK3B 4KKOB 4BG9A 1PJ6A 3QT7A 3C14A 3WXKA 2HFUA 2QN6B 1U1OA 4MDBA 4CZEA 1BUPA 1RTIA 1MMNA 2IRYA 3EPIA 3RJMB 1I39A 2RVJA 3AJ2A 5AFUH 1F2GA 4KGZB 1YTAA 4RNMA 3G2XA 3THWB 1TL7B 1N5QA 5IT4A 3OBYA 3MTJA 1U8WA 4ZPCA 3H25A 3L0QA 4EU0A 4JI1K 1GMVA 5DK5A 2BJDA 4N77A 4IWVA 1CC8A 3QNNA 3HTVA 4X66J 4DTRA 1VBKA 2SXLA 3PW7A 2NRZA 3A3NB 2POKA 1JLCA 2XNQA 5J2NA 3ZZTA 2QMXA 3QIOA 2V4QA 1BQMB 1FFSB 4QWAA 4ILMA 4CCHA 2MKJA 4I64A 4GMJB 2LA4A 4CLZA 2CQPA 1WEYA 3R9LA 4UUWA 3A0IX 4BGBA 2XO7A 4RPFA 2WHOA 3R27A 2ZBRA 4FK4A 1X3MA 3LH2S 3QGIA 3O3GA 4XAKA 3CSKA 2XNRA 1CJKB 2NYIA 3LO3A 4X66K 5ETPA 4DV3K 1UJ4A 4WZMA 5J2PB 2V63A 2ERRA 3RSEA 1KC8T 1LNQA 2ETJA 4BC7A 2BQUA 2N7YA 4WJBA 3Q86A 1HBUB 2B4UA 4N7TA 2Z1IA 1M1GA 1TK0A 4JNEA 3R5DA 3NGSA 3H5XA 1P6TA 3I32A 4CIOA 3CD6S 2E9RX 4DU4A 4IDKA 1FERA 4NZ7A 3LOUA 3DLEA 5H9FJ 5DO2A 4EO6A 4QQBA 1XNQK 4ED1A 1NMDA 3IGVA 3K8VA 2NRRA 1MSWD 1GNKA 2DJWA 1UW9A 2EFVA 3C0BA 7FD1A 1T03A 1YJ9S 3RAXA 3MUMP 3MMCB 1EHWA 3Q7BA 1K0VA 1NZAA 2VA3A 5M2UA 1S9GB 4E7JA 1YRUA 2DH8A 2V4RA 3MCPA 1W26A 4IEEA 5GMKa 5GINA 1VK0A 4I2PA 2QWNA 4M1KA 1H72C 4Y28C 1HX1A 4L73A 3T1AA 3TRGA 1NCLA 2K1RA 1UVKA 3GIKA 2IVPA 1KVIA 3OYFA 1TYQB 4X4SA 1U1MA 1HI1A 5H9FK 1KXPA 2HNYB 1VJWA 4HTUA 4NLYA 4ZITA 2I7PA 5HMWA 4Y1DA 2D0OA 4B1VA 2LQ8A 1ITPA 2FD2A 4ZCKA 3P83D 3CC7S 2VWKA 3FBFA 4OX6A 3CUNA 4CIEA 4F9OA 4YHHJ 1VRTB 1V5IB 1S49A 2PA3A 3MN6A 1PYSB 4C3LA 5CCMA 3H2UB 1NH8A 3H2LA 3BSAA 2BBEA 3ISZA 1Q82O 1WF1A 2ZKUA 3G10A 1VBZA 4LRBA 4U8YA 1JXEA 2W2OP 1QHAA 2Y1IA 4NYNA 3W63A 3OR1B 3BO4A 1QSLA 4WU3A 5B7WA 2XBPA 4ZTFA 2HSEB 1E3MA 4ZPBA 2YX7A 3WNHA 3O9QA 4IOAL 3ISNC 4PUOB 1OPIA 2HVHA 3LP3A 4RLEA 2GX9A 4IG0A 1WLJA 1PIEA 5I9EB 1ZPWX 2M3DA 4YHHK 2XMJA 2X6SA 4M7YA 4ZPVR 3QIPB 3CW2C 1SI9A 2XSFA 2YKPA 3OTOK 1YQHA 3OW2M 4ZPDA 3CQXA 1FX2A 5C5JA 2X1FA 1N0VC 4LF7K 3L7OA 4KY3A 3RW6A 3PV8A 1R8PA 3BPDA 1ATSA 1VQ6S 3L2VA 1UAWA 1RBTA 5ETOA 2N7CA 3O1WA 3V6KA 1XTZA 3MMJA 1JLFB 2EK6A 3VQEA 1JLGA 4MYUA 1HNXK 4K42A 1GOCA 9ATCB 1R27B 2W2PP 1GLDG 1GOAA 2XQCA 1XERA 2YNGB 3BF3A 3HMJG 2BH1A 1BI4B 1QD1A 2P5GA 1S1XA 4HHHA 4QWEA 2N4CA 1ZBUA 2R8IA 1WSFA 3BGRA 2R42A 1SKWA 1EP4A 1AB8A 2YX1A 2AA4A 3G96A 2OEKA 1H0HB 2RU3A 4L8RB 3ZNUA 4IXCA 1RHRB 1SJ1A 1D1UA 3RBZA 1Q8KA 5KGXA 4G1PA 2EI5A 3NY0A 2PYLA 4ZHRB 4DSJA 2ZWOA 3KHRA 3I33A 1IBCB 3ZSZA 1L3SA 3CC4S 3J7YI 3A2FA 3MMVA 1ZBTA 2JFKA 2QA1A 1NUEA 4YNQA 3Q8RB 3LF0A 4CJPA 2JC1A 4JK8A 2H1YA 4ZDNA 1CG2A 2CFXA 3TR5A 4CJUA 4X64J 1BG3A 3D0GE 2IFXA 4WCEQ 3ALYA 4DPYA 4BQLA 1FT8A 4DQ8A 3DU5A 4C8OA 3CF5Q 1HYSA 1HI8A 1SPBP 2HZCA 2XY5A 2XI3A 4H8KA 2V2VA 2HHPA 3ICLA 3ZZZA 3H4DA 1QE1A 4JKEA 4AXIA 4ES1A 3NNCA 1B4SA 3H3OB 5LL6d 3WXMB 2GVZB 3D6HB 2YHXA 3EGNA 4BRFA 4M3XA 4XH1A 4JKFA 4KRFA 2PEBA 4G9ZA 1ASWA 1GQEA 5ETNA 3I6PA 2F40A 4NLDA 2KT3A 3GG4A 5A8WB 3FZKA 3BM7A 5ETVA 4B3OB 6FD1A 4ECQA 4MIAA 3NL0A 3VAJA 5GAGU 1L5UA 1U25A 2XZTB 3V6JA 3JYTA 5KPTA 3V9UA 2GIFA 1OVQA 3VMFB 8RUCA 2HQGA 4LIWA 1Y4ZB 4J9UE 4X64F 3TWHA 4DR6F 1YVNA 1S6QB 3FRZA 3H4BA 1JLAA 1VSKA 2J0WA 4RU2A 1TAUA 1EB0A 5AXKA 3CFRA 4B08A 3PVXA 5A76A 3CO0P 2C3YA 2Y8YA 3H90A 3HBTA 5K14A 3VR1A 3ZSRA 2C3MA 3CCLS 3UDEA 3DRXA 1R0AA 3QDKA 4KSEB 1U0HB 1S72N 2MY7A 2VL1A 4ECWA 1HYZA 3DYAB 3ET6B 4WFBQ 2FBYA 3I0SB 3C6HA 4P75A 1ZAWA 1WI8A 2QLFB 3U02A 1WC6A 2OZSA 5AZJB 1YJRA 4BC9A 2VFSA 1PBUA 5GAEI 4FJJA 2F4VJ 4B3RK 3CPWR 3MDFA 2WBNA 3G82A 1LAVA 2DEIA 4O3NA 3QSYB 4RW9B 1WUUA 2MHNA 4WTOB 1H74A 1KHVA 1REVB 1MWZA 3RMAA 4FYVB 3EN9A 2G2YA 2HNDB 3V81A 1KD1T 2FVPA 4K41A 2B56A 3QRPA 2G8VA 4CT8A 3KD5E 1S57A 1EARA 3TAMB 2OELA 2LXUA 3HHKA 2JFDA 1PYOB 5DM6Q 3MMAB 4BVOA 2MKHA 3HKZD 3MAHA 5RUBA 4OZ2A 3JAMO 1FWLA 2VD3A 3MCOA 2RQ4A 4UOCA 3IS9B 4TQSA 2W2QP 4JP8A 3L3CA 5G0RA 5BR8J 2F4VK 3BYRA 4B9QA 2VPZB 2NREA 4V19X 3NF6A 1UWAA 3OFHA 2HBKA 2GELA 2IC3A 3BY5A 4A59A 3HSJA 1VSEA 2DO0A 4PKIA 3RRGA 4XH5A 3FGVA 3JS9A 3J8AA 3MN5A 2GA7A 2DXDA 1YZ6A 2B7CB 4AQYK 3D0PA 2E2OA 4F2RA 2K7KA 4DR2J 2WOMB 3LP0A 3KLGA 1SQGA 4A8QA 1D9AA 4DTSA 2NXCA 3AVFA 3ZX0A 5BR8K 2XC9A 3D1QA 4DSKA 5I3PA 2EG1A 2HF4A 4W98A 3VEZA 4DV1F 4AHRA 1BHLA 2ZH2A 2UUBJ 3DLGA 4M3YA 3QBXA 1N32J 3OR2A 2QLBB 2CPZA 3A12A 4C97A 1NNEA 4A8YA 4EZ9A 2F4FA 1RU1A 4I68A 1TV6B 1RGVA 4KTQA 2IMOA 2ZH7A 1OPZA 2HRTA 4DR2K 4CH7A 2OO4A 3NF8A 4RW6B 3T9NA 3S8SA 1VQ4N 3W2WB 1FKPB 4LSNA 3Q8VA 2VGMA 2R7YA 4I7FA 4LFCK 2J0SD 4DL4A 4BROA 1I1GA 2GVDB 3CWJA 1CJVB 3LDLA 3G71N 2UUBK 4CTAA 1N32K 4RW4A 3EM1A 3DRSA 1ZETA 2MZTA 4OYZA 2G8HA 1UVLA 1CZAN 4U7UK 3CETA 5AQLA 2E44A 4FW2A 3NRBA 5DG7A 3SCLE 4HKQA 2V4JB 2Y8WA 2FSNA 3KK3A 2AZ1A 4KKOA 3MXIA 2VA2A 5G4DA 1VIOA 3TEGA 1H2TZ 3OV7A 2HHHJ 1JL1A 4OYMA 1F60B 1WD6A 1N34F 4R0JA 4S0MA 2E1AA 3IRWP 2X3GA 3Q8PB 2UV8A 1CC7A 2GJIA 2WRMA 3Q8YA 4MAKA 2AP6A 4GVLA 3ZTSA 1O0PA 4CEOA 5ELZA 4B8CA 3THWA 2GWKA 1TL7A 3NOGA 4GKKJ 2CJKA 4YOYA 3ZZOA 2HF3A 4FWPA 1P9YA 4C0OC 4OPHA 2W40A 4Q43A 4A8FA 3GONA 4HL9A 2KZMA 3SCXA 3AVJA 5C0YA 3OUYB 2FVQA 4FM0A 2KI2A 4ECYA 1DGKN 3VA0A 2OANA 1Q8IA 4KH0B 4O8KA 2XGPA 3QGGA 2HHHK 3RMBA 5SUHA 4J91A 4CF2A 2WB1D 2RAQA 3N9UC 3TSPA 3W5ZA 2MZRA 3ZSOA 3POTB 3QATA 4FPIA 3UN3A 4OYBA 1HQUB 4ENOA 3HSDA 1OJ4A 2XS5A 1LFWA 1XNRF 2PA8D 5CA5A 1R3NA 2G2ZA 1YBTA 4KB0A 4GKKK 4QIWD 2PZSA 1XK8A 3ZT0A 4QWCA 3F0NA 4NMLA 3CDAA 3IBFB 5JXSA 3TABA 4CLLA 4CLWA 4DV2J 2ZH3A 2X1AA 2CWXA 4UW2A 2FF3B 4CEZA 5J2PA 5DGBA 2RRAA 1UEUA 4C1NI 4OPAA 3M32A 2R7TA 1HBUA 3L3VA 1J2VA 1VI7A 3AOBA 2CIMA 4H5TA 4RG8A 2XLIA 3C15A 4MTPA 4CEBA 1VLYA 5FIIA 2LXFA 2HBZB 5GADP 3M8PB 3KK2B 4WQ4A 4MKVA 3SSRA 2D7SA 5KFJA 1E6VB 3GFYA 2G8IA 1WHYA 5BYRA 1Z25A 1M5KC 2BE2B 4JKAA 4DZDA 1BHNA 4IOAQ 4K0KJ 2HHSA 4DV2K 2XZDB 3I9V9 2W7AA 1T6DA 3WUHA 3MMCA 4OZ1A 3R8YA 4FJKA 1RAGB 3O3HA 2H3GX 4FXVA 1MROA 2FGOA 2Y0BB 3B6PA 1CZ9A 1S9GA 2ILYA 2XGQA 2E5HA 3QWUA 3QWPA 2VWBA 5GAHU 3O08A 4JKDA 4J9MA 2KO1A 1KOOA 1TYQA 2Q31A 1NPPA 2OTLN 2I9SA 5KAKA 4FVUA 2WK4A 3W61A 3KD1E 2P9LB 3UI3A 1NZ8A 1N5SA 4R8UA 4DL0C 1NHVA 2WBMA 4Q0BB 4K0KK 4F7VA 3GIIA 1SL2A 3GYXB 4FZZA 4C0HA 1VRTA 1T3OA 1AUSL 4B9TA 1HJRA 4UQGA 2VZ9A 2HYIB 1TUUA 1S1UB 3CJ7A 2GNKA 3AVIA 5L9XA 4NXMJ 3EGZA 1NGCA 4TKTA 1RWXB 3C6UB 3ATVA 4FWOA 2XSJB 3CCMS 1BWEA 4QWBA 1WDTA 1SJFA 1RDRA 4HTLA 3OR1A 2PFUA 4J9RA 3MPYA 4ETXA 2E1MC 1W7WA 3BDPA 2A3JA 2YWKA 4NLVA 3TUJC 1NU0A 3EO3A 3UE2A 3TA0A 1JL2A 2Q66A 3T5KA 4QIFA 4CZGA 2AGOA 4A4JA 1P90A 4ZOSA 4MJKA 4PUOA 1X5TA 4FOIA 1FJCA 2FLOA 1WSEA 4C48A 1D3WA 3KLEB 2OPRA 3S9HA 3CCZA 2UUAJ 5AQPA 3QIPA 2I5JB 5DZ7A 4QWDA 1KR4A 2VDIA 4BE0A 4NXMK 4IZ9A 3GJTB 3V5RA 3AARA 2DR7A 2AWZA 3BO2A 1P8ZA 2KJWA 4OFZA 3LDQA 1NK0A 3MX5A 2FTRA 3VALA 4Q8EA 1U1RA 4RTFD 2V5HG 1DLOA 3FZ2A 4J9NA 4DU8A 4JRPA 4B1UB 1JLFA 1KD1O 4ZA1A 3R5BA 2ITGA 3BSNA 2O3DA 1OH5A 2DR8A 3H5SA 2P9PB 4JHDB 3HM8A 3ULHA 4IQXA 3KHHA 3EVOA 4FYXB 3KK1B 1RWVB 2YNGA 5GVQA 3AB4B 1DEJA 2J76E 4QBUA 1BI4A 2UUAK 3MTKA 3RBEA 1L3TA 2FGCA 4FJ7A 4H0XB 1SBRA 2LA6A 2V2QA 4BQZA 5EN1A 5HP1A 2E2PA 3ASMA 2GCFA 2OH2A 5AQTA 2D5RA 1N36F 2CGLA 5ADXH 1X4HA 3V9SA 5E33A 4KHSA 1DAXA 1MWKA 2OA8A 4ZHRA 3MR5A 4ZVUB 4H03B 4KTZA 2FBVA 1FEEA 3W62A 5F9LA 2DK2A 1LW2B 4J8FA 1NK6A 3OPKA 4ZVOB 2DPNA 4NASA 4I69A 1BY9A 4ZCMA 2W9CB 4IG3A 4O4GB 3AA9A 3QFWA 5B8HA 4GKJJ 3DAWA 4H4MA 2LKZA 3NMAA 2U2FA 1UVNA 3VA3A 3J80O 3ZX2A 2ZOGA 5B0GA 1TP7A 3THTA 1S72S 1NGFA 3EZOA 4OZNA 1RA6A 1GTEA 3HZ6A 5KFZA 1HRHA 4NLQA 3K9JA 2GVZA 4I6WA 5I3QA 1B99A 3PHEA 4WP9A 2OZMA 2YWEA 3FFIB 3RZAA 3V2UC 1VSLA 3KXDA 4U67L 3JAMU 5KFUA 4XH4A 3U9DA 2CJ9A 3KYLA 4PABA 4EK2A 5A8WA 2DKOB 3DLLL 2GO9A 4B3OA 3W7BA 4JI0F 3MXJA 4LBIA 2RNEA 1UOCA 1G4CA 1RHMB 4DMNA 3SFUA 4HVJA 3I96A 2K7JA 2GUIA 3R1XA 2ZFHA 4GKJK 3FZLA 2LU2A 4E0DA 4YS2A 4X4QA 4KH1B 3C6TB 1S6QA 2OEJA 9RUBA 2IVFB 2GO8A 4RW8B 4A8MP 2GAGC 2L48A 3TAPA 2EFPA 2ZWPA 2DHAA 3CDUA 4DL2A 1XI1A 2HFSA 4OX7A 3AVHA 3ZLJA 1WTBA 2DPIA 4DFMA 2A2DA 1GMWA 1U0HA 3DXKB 3D66A 1VISA 3ET6A 3QT8A 3I0SA 3W5XA 2DRBA 4CGJA 5K5MA 2VH7A 4XK8C 1K8AT 3L6QA 2F8EX 4M3UA 3CPWM 4YB1P 3VGKA 1UVJA 5AZJA 4F3TA 1YBAA 2OGUA 1WDDA 1IKVB 1ZC6A 4DG1A 4XTTA 4EHUA 4RW9A 4A8WA 3LP2A 5I3UA 4DV7K 5CHCB 1KLMB 2OPSB 1REVA 4I2QB 3TQEA 1Q8BA 3I56S 3BH6B 5DJBA 2HNDA 2WTFA 2ZVSA 4YOVA 2HPUA 2KYZA 3DN9A 4FBUA 4OYIA 5AZIB 3SUOA 1BGXT 3MPWA 1H2VZ 4H4KA 3OYEA 2RJZA 4QOTA 2JWKA 3AVLA 2LMIA 4CH1A 3IS9A 4OVLA 3G8QA 4ELTA 1HBNB 4K4UA 5C7PA 2O8EB 3F56A 4MYTA 1GXTA 1S76D 1N4LA 1J27A 1LAWA 5K20B 2F9DA 1JJ2M 3AJDA 4X65J 3S01A 2IDOA 5SZTA 1RGIA 3QT6A 3PSFA 1S0MA 4BC4A 1UFWA 4CFDA 1YG0A 2D1CA 2QK9A 3G71S 4DR4J 2WOMA 1N6QB 4ANCA 4WBFA 1FF2A 3TX0A 3HHLC 3CCEN 3TA1A 3N5FA 4OV6A 4A2BA 1GXUA 3MK6A 3VGMA 3OTCA 5J1NA 1R8HA 1NJZA 4CO1A 4RNNA 4DMZA 3K58A 3VEWA 5LY3A 5KG5A 4O55A 4DF4A 2LP4A 4C4WA 4BACA 4X65K 1EAYC 1HNZJ 3VEXA 1WN7A 3CCQS 3DDKA 1RFQA 5MLCV 2IM1A 5BPMA 4Q7AA 4WQ5C 3V9XA 1RWOB 4PY5A 2HURA 3L2RA 1RBSA 4PQUB 3RBXA 5DLFA 4C0BA 5CYMB 2KTQA 2QT7A 3EJMA 1KDNA 1XHXA 4HUEA 4DR4K 4M3RA 4H5NA 4USVA 2ROEA 3CFOA 4CBXA 4JI3J 5KFCA 1YKWA 2CPFA 4RW6A 3FCWA 3VQDA 1IKWB 2JJ4D 5M1PA 3ILOA 2RKIB 4WIIA 4L3KA 3W2WA 4B9MA 3FLCO 2ZNYA 3SQ0A 1NJIT 3OD2A 5J2QB 2CPXA 3HK2A 2GVDA 1CJVA 3LUYA 4BRNA 1QUPA 2IA6A 3GL1A 3T7ZA 3ULEB 1HNZK 3EDRB 2KXFA 3W64A 3QBCA 4ILHA 2HBRB 1HLUA 1ZZFA 3QMQA 2QRRA 1CXQA 1XMOJ 2XHBA 2V4JA 4W5QA 2V7ZA 4I6YA 4WKRA 3UPFA 2RF2B 4JI3K 3SCIE 4L6V3 4CGFA 4IDHA 2Q79A 2OJ3A 1URRA 4A61A 3VAMA 4OHWA 2P6SA 2GX8A 1P9QC 4CI0B 3KUHA 2C3PA 4PG5A 3TI0A 3QICA 3V9WA 1TKTB 4NLGA 4GVEA 3GZ7A 1SKRA 3VGLA 1WG4A 3ONQA 4YUDA 4FZYA 1XMOK 4FLUA 1IH7A 3HT0A 1RTDB 3IWLA 1OIAA 3O5TB 3CG7A 3TSQA 4MLEA 1J9AA 3EXYA 3FJ2A 4JYAJ 1IBMJ 2ROPA 1KSPA 3RTVA 2E9TA 3POTA 2E8AA 1HQUA 1JQGA 2CRLA 4CGHA 2A2CA 1X3NA 3GQCA 4CZMA 3M8QA 3OYBA 1U45A 4JRQA 2ZBQA 4J9OA 1NWKA 2RPIA 2RU9A 4DX7A 1VRUA 5ITHA 4FJGA 3G9CA 1UEVA 3UW1A 4KQZA 3G6EN 4PL8A 4DR5F 1OVYA 4DQIA 4CZLA 2Z58B 4FO0A 3CI5A 2MYFA 3BR8A 4CLSA 4XPEA 1JJCB 3H20A 4FM2A 3AO4A 1IBMK 3GV7B 4ZVGA 4CJTA 3M8WA 2YTCA 3BPSP 4JI2J 2HWTA 3AXKA 1LWCB 4ECRA 1KOHA 2GV1A 4JYAF 3VQ8A 3EZUA 1RACB 2HVIA 3R3TA 2MJUA 2ROGA 2BKOA 1TFWA 3M5RA 2UUCK 1P1TA 3DRRB 4DUZJ 3TR8A 1NGDA 2B5JB 1K1QA 1SH0A 3OS0A 3D1OA 4QJVA 1E6VA 2W4DA 2ZKTA 3CCJS 3CPEA 2VFUA 1M1KT 2BE2A 1LCUA 2BRLA 5D4OA 3GJRB 4J2BA 1Q9YA 5LMUJ 2J6SA 1WC4A 1RAIB 1QLNA 2HFZA 3SDEB 5F41A 1PJ7A 1S1WB 4X62J 4R25A 4O0IA 4JI2K 2QLJB 2XEXA 3FCHA 1IWGA 2UXDF 2LDYA 3CDWA 4PL7A 4EGLA 4NRTA 4DOZA 4LF8J 5AQHA 3LPYA 4BREA 5GAGI 2YV0X 4DUZK 5BRFA 2YH0A 5CZXA 3M3ZA 2N4DA 4J9PA 2P9LA 1XMQF 2QG9B 2YPYA 4FF3A 4Q0BA 2BR0A 4YEAA 3ZO7A 4CZCA 5B0CA 2M2BA 5LMUK 5KFTA 3P45B 2XI2A 5M1NA 4R0EA 1WHWA 2O4GA 3H1VX 3VQSA 1S1UA 4KHWA 4DU3A 1YX2A 4X62K 4IO8A 2HBYB 5FLXY 3C6UA 2XSJA 2C2EA 1RLDA 2X1GA 2MEWA 2PE8A 2FJEB 2E2NA 2BA9A 4IO1A 4LF8K 3H45C 4ECVA 2GQCA 5AXMA 1HNWK 4KJIA 2PYJA 1RBRA 3CCUN 3AQOA 3SPZA 2Y0SD 1YHQN 1NDLA 3OXFA 3BJYA 3ZT1A 4CJ5A 1PKUA 2ZHOA 1K8AO 3J80U 3O3FA 3KLEA 4IJAA 5K8PA 3LALA 5GIOA 2I5JA 3ITHB 1R6YA 5M1KA 4C8MA 4BRMA 3BGLA 2NUHA 1TQLA 3QJJA 4M3WA 4ED8A 4BVPA 4B1ZA 3TPQA 2X51A 4LFBF 2GW8A 1Y7PA 5LXYA 2D9PA 3UR3C 3CXCM 4WTYA 4EYHB 2OPQB 1Y11A 2RIJA 3MN9A 5CYJA 3HP9A 2P9PA 1NBEB 5FRNA 3HL8A 3L7PA 3KK1A 5H9EJ 1RWPB 2MQMA 4ZN1A 4ELUA 3T19A 4CZJA 2MTLA 3DLLQ 2QA4S 1Q7LB 3AXMA 1MWMA 4E2FB 3PRDA 3OYHA 4NCBA 2E6LA 3HO1A 1ZM2A 3HFZB 2AJ2A 1IJFB 1SIZA 4DTXA 2HVDA 2E4LA 5JLHA 1GX6A 2CNKB 4YDDB 1ZS6A 3OYIA 1BO5O 2BJ3A 2F63A 2XMUA 4CJVA 2DY4A 4F4WA 1TKZB 1X1PA 2QLXA 4M8LA 3IAM9 1KBRA 1QHTA 3J81O 3OYDA 1LW2A 3W3DA 1SC3B 1DTTA 2V8DA 5H9EK 3SZ2A 3QYYA 5AQXA 3O1LA 1U49A 4O4GA 4LR8A 4AUKA 1S1TA 1JNZB 4F67A 2CQHA 3PLAA 2GWJA 1S79A 1IKYB 5K8MA 1NHUA 5KG4A 1IXKA 3AH6A 3UVJB 4M95A 1SL1A 2E7XA 2IGIA 4BLGA 3P96A 4J9LA 4J2EA 4JKGB 5AQRA 4C23A 4W5RA 3SMZA 3GCXP 5F8IA 4A57A 4X84A 2D0AA 3Q2TC 3Q89A 1RK8A 4JV5F 4DCHA 2HK3A 3FFIA 2V9KA 1U1KA 3DLKB 4CJ7A 1QUVA 3H40A 5FPMA 2W25A 3A4TA 3I9ZA 3IN5A 5T14A 2QI2A 4QU7A 2QKBA 2YVSA 3KIOA 1SJQA 3GMGA 4HCBA 2J9CA 3OXLA 3GIJA 3PHTA 3CJAA 5M1FA 2YPZA 2HAIA 3C6TA 3W0LA 4RO0A 4O3PA 3R7SB 2DRAA 2ZGZA 4RW8A 1NDKA 3GYGA 2KFNA 4JB8B 4I6MB 3E9PA 3V1OA 4HACA 3MM8B 3BSCA 4KHPF 3DHWC 4WU2A 4WFAQ 5BREA 2DGSA 3M6XA 4BDPA 3DXKA 3AQPA 3PX6A 1WOPA 2CQBA 2C2DA 4DV4F 5ETQA 4QU6A 2O8BB 3MCAB 5KOXA 1NKEA 4X4PA 1ULRA 3SSSA 3NG8A 3HVAA 3LPEA 2WFBA 1WOQA 3VENA 2YI1A 2F9TA 4C6AA 2Q3PA 2Y9HA 2IYGA 2H65B 4TYAA 4AE5A 4UY8O 1GLCG 2ZOFA 3HHNB 1U2RA 4OI4A 4CF9A 3PX0A 3RYLA 1KLMA 2OPSA 4I2QA 2ILZA 1C0GA 4LUBA 3T5LA 2XY7A 1K8KB 1G2EA 2MKKA 2CJYB 5AXNA 5AZIA 1A5XA 3QNOA 4JOUA 4CFCA 4EEYA 3ZT3A 5B08A 3W60A 3CM5A 4JI4K 3FNNA 2KL8A 2R7UA 3V1RA 1Q16B 1HBNA 1YWXA 5KRSA 5BRDA 2UV8G 4H4KC 1TUVA 2APOA 3VAFA 2O8EA 3SLCA 3MM9A 4PKGA 1C4CA 1UFKA 3U1LA 3NCQA 4B17A 5KFRA 1UWBB 2LEBA 3AY0A 3P5TL 1Q81T 5E2QA 3VGUA 1OWXA 2RDDA 2Q36A 1NPKA 2IIHA 4RCHA 3QT5A 2DNHA 1NGIA 1I5OB 2XULA 1P27B 4Y2MA 3CMEN 4AHUA 5FROA 4LQ9A 1N6QA 5LSLA 2XZWA 2HZVA 4K8ZA 4H0PA 3HVRA 1X9JA 2E5JA 4BRQA 3GR1A 5AQZA 1TTHB 2A1RA 4EFAC 2DEJA 3O4QA 3VN5A 5AJ3F 3UD3P 2DHHA 1M1KO 3MMBB 4LREA 3OL6A 2KZZA 3FCVA 4RUHA 3BN4A 2LLZA 3G8SA 1KAYA 1FWKA 4NLCA 1Z2ZA 3I55N 5CYMA 5GAHI 1VJQA 4PWWA 2YBVA 3M30B 3AVMA 4XDDA 4ZIWA 4DV5J 2RRNA 4Y2CA 1Y0HA 2XYGB 3QFUA 2KM8B 3J7AN 3JXUA 1IKWA 3QETA 2RKIA 3LW5C 4DSEA 1TFYA 3PRVA 1QAIA 5J2QA 2JVOA 3D2FB 1VQSA 2VKZG 1VQ5N 3W9JA 4RUCA 5CZ2A 2HFNA 4ZP9A 3ULEA 4NMXA 2OSRA 4ER8A 1HMVB 3VAKA 5T41A 3TAGA 3M05A 4OJGA 5J1EB 3MOZA 4GO5X 1PC5A 3IXQA 5KFWA 1V3RA 3TZYA 4KREA 1OYEA 2RF2A 2KXNB 2HBMA 3TYTA 1NB2A 3ZNJ1 3C65A 4JV2A 4FWKA 3SAGA 4FLZA 3PYGA 4GW6A 4DV5F 4YR0A 3PO4A 2PFDA 2QZ8A 5D15A 1MNEA 4RNOA 2PI4A 3C94A 4J9KA 3CULA 2A42A 3NMUA 2CQ2A 5DQGA 4UY85 5JLFA 3CJKB 4L76A 1TKTA 1AA1B 1S22A 2ASDA 2V34A 4KPYA 1D09B 1N0UA 2IM0A 2PY5A 2M0GB 1A5WA 3D68A 4I1TA 4PKHA 2OD4A 4DDFA 2CZ9A 3EWGA 1Y3JA 1RTDA 2BV3A 3PFEA 1N33K 4FLWA 4ZVRB 4KAIA 2NLWA 1BE4A 3FZMA 2GZOA 2DNGA 3LAMA 3AFGA 4Z4FA 3IFEA 2YWWA 5D4NA 2BKPA 3HFVA 4K5RA 5L1KA 5AQFA 2GAHC 4Q2MA 4ZLPA 4B3MF 3GG0A 3T41A 4C9DA 1RAHB 1Q5YA 4B3TF 3MM7A 2IJNA 3GE1A 1VMBA 2RE1A 1ESVA 2Y1RI 1S9EA 2P5VA 4NXNJ 1OH6A 4P7TA 2H48B 1U2VA 3WT0A 2W7PA 1D0EA 1R8CA 2AW0A 3P49B 4ID1A 3PX4A 4DPUA 3UD5A 1GX5A 1E4GT 3R8EA 4HT7A 4MFBB 2YNHB 1GEHA 4O44A 3QERA 3ZSXA 4NCGB 2BYCA 3KOAA 2DT9A 3D54A 1T9TA 3A5OC 4AD6A 5LL6Z 1UPPA 2E5GA 1GT8A 3D5MA 1X4CA 2UVVA 1RZMA 1GTHA 5IQ6A 1HL6A 4C98A 3VEYA 1KWMA 4TY8B 1LWCA 1BIZA 2BEFA 1BCOA 2MQOA 4K4VA 1KQSM 2M52A 3DRRA 1EXQA 4H5WA 2B5JA 5LJWA 4YORA 1EKRA 4CZHA 2DBBA 4PA1A 2C2OB 4NXNF 4QZVB 1DT9A 3BR9A 3SDEA 1RUSA 2BM1A 1TL1B 1S1WA 3BQ1A 4IR1A 3K0JA 1LEOA 3RU0A 4HUGA 4ISGA 4H0VB 4NYFA 3M8YA 4R5PA 1YITN 4M5DB 2RHSB 3GSIA 2CGJA 2XYHB 4LVNP 2OTJN 1NLKL 4CJRA 2K3KA 2V2ZA 2ZJRL 4KV8B 2EPIA 3CE8A 5U47A 2ZJPL 2OFGX 3N79A 2ZH6A 1KLNA 3RB6A 4Y2AA 2K2PA 2G8FA 1C0TB 2WW4A 1PG5B 2E1CA 3C7NB 5IWAJ 3G87A 4QOZB 1W97L 1AXQA 1RAOA 4KHQA 3KHYA 4CEAA 4RU9A 3BV8A 4DV0F 3L4QA 1S0VA 1VQ9N 1NGEA 3O9SA 1T9YA 1YF5L 1S48A 1HKCA 2PMWA 3J81U 1FJGF 4DEZA 2I7NA 3AVKA 3EGVA 3DOLB 3NF9A 1Q95G 1FRJA 1RDWX 1W7AA 5EXWA 3SI8A 4NZ6A 4BWMA 2FBTA 2E29A 4MIWA 5IWAK 1KQKA 2MQ8A 3ITHA 3QQCD 3QO9B 4ZKAA 1EWQA 1O1WA 3PYEA 2HOEA 5KPRA 4CJKA 3E2EA 3GSDA 3MURP 1UA1A 1VC0A 2VODA 3FQLA 5KOWA 3IMXA 4GVMA 3MPUB 1R31A 2M7SA 2R7RA 1YDLA 4LF5F 1KVKA 5EY4A 4CI6A 4OX9J 2VBYA 2OPQA 1FKOB 2GMHA 3WNEA 4EHTA 4WF9Q 5I42B 3R6MA 4CW7B 1JXLA 3VAHA 2VG7B 4AHSA 5F2RA 4P2MA 4ANDA 4QPXA 3GR0A 3QNWB 4JAXA 1M5HA 1CS4B 4KHMA 3O9TA 2WBRA 4DTOA 4DPXA 3JQJA 2ASJA 4NLRA 1FRHA 4FPRA 4FWLA 3QAUA 1U24A 1WBBA 1M90O 2CPJA 3DOKB 5KTQA 4CF0A 4KR0B 4BC5A 2AYEA 2ZNZA 4CLUA 4DR7F 5IT9Y 1V5VA 2I0XA 5M1QA 4OX9K 3FEYB 2GIQA 3UDLA 2QE5A 1RAFB 1YJNN 1DRZA 5JS1A 2QTDA 1TKZA 4FWRA 2WONB 3NAEA 3K5NA 2UXCF 5BN8A 2CJBA 4CRJA 4LSLB 4KGXB 1S9FA 4O3SA 4KPCA 3KK7A 3ZT4A 3BZQA 1ZPVA 1N5VA 5BJRA 3QZ7A 1JLEB 3BKFA 1VQKN 1FWPA 2VCPA 3KJNB 1IKYA 2NYHA 5CABA 2R8JA 3KNAA 1LWFB 3UVJA 2VIHA 3A5NC 1UPMB 1U0SA 5KG6A 3TNVA 4JKGA 3DDNA 3DKDA 5LXRA 3ZEUB 3D0HE 4Y1CA 4DFJA 3K5OA 3T1YK 4ID5A 2FHKA 2X6NA 3AAWB 2ZM6J 1VQLN 3CVKA 5KFPA 1E4FT 2MKCA 4CP5A 4QW9A 4HHTA 2FZGB 1IKXB 2R8HA 3HJFA 3B6OA 3QPIA 3L9ZA 3ID8A 5E26A 2UXBF 2RE2A 3HHEA 4CLYA 4PRFA 1FDAA 2V9WA 7AT1B 4CWBA 4CHPA 4ZVSB 1U2FA 2XMVA 4FF2A 3VV2B 1VQPN 3KWIA 4U9RA 1T6CA 4I6MA 3CTRA 1VSFA 4E7KA 3MM8A 2JEGA 3SQGB 1J53A 2LCWA 4IH6A 1ZZNA 1VC6A 3FZFA 2ZM6K 4FLYA 1KTQA 5DDRC 4ZVHA 2D9OA 2R9LA 3IBCB 3QZ8A 4YOEA 1FVQA 2C2RA 3VOVA 1ZBFA 4FJIA 1RE1B 2KHOA 4K43A 4M5LA 4PAAA 3TUZC 4BC3A 2E66A 4HVZA 2O8BA 3TAEA 1SJ4P 4CLTA 2FVRA 2B9XA 4KH4A 3HDSA 1S7IA 2UU9K 1KVJA 1KEKA 5A0YA 3J7YP 2BUNA 4EIAA 4DCPB 2IS3A 1K6YA 1FHTA 3CMES 5BN9A 5LMNJ 4RW7B 1IM4A 1RDUA 3LM9A 1WC0A 4BR9A 3WIUA 2GMLA 3W66A 2I2YA 4G1QB 2CQCA 1RWUA 3HYFA 3UN5A 1WSRA 2KG1A 1K8KA 4NB4A 5KGWA 1J5EF 2AYMA 4JV1A 2YNFB 2ZJQL 1VSIA 1HHSA 3EPGA 4Y0WA 3NAIA 4DUTA 2NXUA 3OL7A 2BJ7A 4IOCL 4LFAJ 2FC8A 3AVGA 3EX7B 1Y5IB 4QS7A 1SQEA 3GG1A 4PZVA 4N8OA 4ISFA 3VWSA 2DNNA 5I4MA 5LMNK 4FSVA 2HS0A 4B9VA 1XQIA 2EKYA 3UNGC 4JI6F 1T0TV 1UWBA 4LMZA 4C8ZA 1TK8A 1X5OA 3RAQA 3GWCA 2NRHA 2G0CA 4USHA 4PEOA 1PJ5A 5KPZA 4A48A 3KLFB 3K5LA 4DR3J 4ELVA 4G3IA 4WKYA 3T1HF 4LF6J 4EUVA 1VQ5S 3RR8A 2HHTA 4IYQA 1X5PA 2PGCA 1HKBA 3GPAA 4OPKA 2D0BA 3K7RA 3SIPB 2H5IB 2NSCA 3K0SA 4LFAK 4FLXA 2HQFA 2CQDA 1T3VA 2JC0A 2IM3A 2ZZNA 1FRXA 4GVBB 2AGPA 1U2CA 4IFVA 1F9FA 2YKAA 1JKHB 4K8XA 3JTNA 3FRYA 3MMBA 3QEXA 5F8LA 4A62A 4FPBA 3UDCA 1NGJA 3DXMA 3TUIC 4LJMA 4C2MA 4L74A 3NVKA 3U8XA 4LF6K 2IVNA 4CGDA 4LF4K 1DURA 3ZZUA 3OJUA 2DCLA 4NLTA 3M30A 5GAEP 2JVRA 2BJ8A 1MA9B 1RHUB 2BE7D 4DR3F 1PAEX 1ZM3A 2Z0GA 3KJQB 2JEIA 1WAFA 3H6EA 4CJ4A 4FYWB 1UCNA 4DV6J 3FFKB 4M42A 4JKCA 4DTPA 3R3LA 3SQOP 1VQ7S 2B4VA 5L39A 3RVCA 2JHEA 2XCAA 4P6QA 1SC6A 4Y2KA 5J1EA 3ENQA 5M2PA 1VQ8N 2E6MA 3WEEB 5CD4H 3VQ4A 3BEXA 4C7QA 2FVCA 3M8ZA 3WXIA 5LM7E 1U1QA 4B3SK 2JWLA 2A41A 1WSVA 4UQTA 3D3CJ 1S0OA 2XHCA 3L09A 5HO4A 4KAZA 4IFYB 2GS8A 1MDUB 4DU1A 3KUGA 4DV6K 2WUSA 3SPYA 3KKFA 3M6UA 2V6AA 4FYDA 2PIIA 4DR1F 1B0VA 3F73A 2DNOA 3QSIA 1EO1A 4USIA 3AA4A 4BRCA 4O5FA 1IJJA 5E7OB 3CJKA 1DHMA 2BE9B 4ZN3A 1YRTA 3QEIA 1HUXA 2K3IA 4L72B 5JICA 1KQFB 3DNCA 4CHZA 1C1BB 1IN0A 2OSQA 5EWGA 2ITMA 5KT2A 4OKJA 2E1YA 2ATLA 3OYAA 1SH2A 3VGVA 4WWSA 3LL3A 3H5UA 4JI8J 1Q9XA 1LWEB 2OP5A 4O23A 2OKQA 5H1SV 1S12A 3AO3A 4K25A 1XC3A 1OY6A 3GJSB 1VHXA 2JRSA 3VQCA 4A8KA 3KLVA 2XLKA 3MXHP 1CLFA 1T9UA 4GC6A 4CHNA 2F8MA 2KB2A 3HHLD 2E20A 8AT1B 5DLGA 4IOBA 5KFQA 5D4LA 4KTWA 2VJUA 2ZJRQ 3T6JA 2M5YA 4J5OA 4G1IA 3HOSA 4ZVPB 3NGKA 3ELHA 2VUGA 2YNHA 3WX8A 1QJHA 3QEVA 4NCGA 2XMAA 2O4IA 2R7SA 3NF7A 1VFJA 1S6UA 3WQUA 3V9ZA 4DX8H 1YJUA 3BGFA 3P31A 3BS9A 2HGLA 1WTFA 3IGNA 3A3OB 4JI8F 1QVGM 4JI7F 4TY8A 2CPYA 4YOXA 4AHVA 2CXEA 2HMIA 1VQ9S 2XY6A 3CQYA 1C0UB 5C10A 3NWGA 4F3OA 4OLAA 2XMKA 2E5LF 2W4PA 2ZUGA 2RHQB 2WZ1A 1E6YB 2NRWA 3FEZA 4A47A 2JL9A 1VBYA 4FVCA 2BW7A 1RAJA 5HANA 1DTQB 3HPHA 4H4OB 4FZVA 1ZTTA 4I56A 3R7NB 4DFPA 3NS6A 2UVRA 3NHGA 4H0TB 2D0PA 2RT3A 3N6NA 2OD6A 2NS1B 2QFJA 1U6FA 2R7QA 3TA2A 3CJQA 3JQKA 4M5DA 2O8CA 2HQCA 4NYOA 1QS4A 2VG6B 3N01A 2I1RA 4DSIA 4CECA 4ZCIA 4FJNA 4KV8A 1Y5LB 2W6LA 4UT4A 4F4XA 2JLGA 5C2FA 4MK9A 2ZZTA 1EETB 3MI7X 4DQRA 3AA2A 1C0TA 2AIRB 5HAOA 3RB4A 4UOHA 2ZGYA 3C7NA 3DI6B 3CJTA 4CNYA 3VZHA 5CXTA 2XRIA 1VR6A 3OFEA 3J7ZT 2HG4A 2ZF5O 4Q45A 2PDAA 2QW9A 3RAMA 5L9NA 2VYPA 2N3OA 1WAJA 5HSPA 5AQNA 3IR5B 3QLHA 4FF4A 3MUTP 4CFBA 4DTMA 3PYFA 4LQ3A 1ZYQA 3I8DA 4JD2B 3BUZB 3DOLA 2QYGA 2EFQA 2L3MA 3TJ9A 1HBMA 2WB4A 2CQ3A 1Q18A 3MPVA 2D3O1 1F9EB 4FS1A 3G4SN 2HRYA 1O5JA 3O9UA 4M45A 3CC2N 3N28A 1LOUA 3QAEA 5H1SQ 3QEWA 1U09A 1WEZA 1GLLO 2NZ4A 1D9DA 2QKKA 1HFEL 4FJ5A 3CB4A 3MM6B 1BC6A 4X4VA 3U7JA 1VK8A 4V19J 3CJ8A 3MAQA 1QVFR 3LGNA 3EDQB 1VBXA 3FDSA 1VQKS 3SBGA 4FZXC 3C3LA 4NO7A 4WZQA 1KN6A 4CJLA 1W25A 1TUGB 5A8RB 5I42A 3T9ZA 2FXUA 4FCYA 2VG7A 1FCAA 3US5A 2VJVA 4WE1B 1CS4A 4NYPA 4M5IA 3O4NA 2JEFA 2ZWHA 3A8KA 5C15A 4FDFA 1T95A 3WNGA 3GIRA 5D0GA 4TYBA 5DG9A 3DOKA 1RT6B 3J7YU 3MPDA 4K7QA 4F4ZA 3SI6A 2WCXA 3MEKA 1S1VA 4CK3A 3SEOA 2MSSA 4OHXA 3PZPA 3HPGA 1YJWN 3GV5B 5EWFA 2WONA 2HHXA 4LSLA 4CF8A 3TO8A 1IG9A 5BPNA 3SUNA 3NAHA 8ATCB 5AE2A 2ZH9A 1VQPS 1H73A 1BXNA 3IMQJ 1GLJO 3AA5X 1DY3A 3R9PA 1T44A 1JLEA 2YX4A 2DNRA 1A5VA 2VU5A 1I94F 5D0RA 2YNIB 3NGUA 1RTHB 1X0FA 2IMWP 1LWFA 4E7LA 1RBUA 1HJOA 5HVFA 1SL0A 3M2UB 5E3QA 3CCRN 1CJTB 2GEMA 2RB7A 2V2KA 1LW0A 3MFIA 1HWIA 2VGNA 3Q8QB 2FJBB 1TMMA 4J7CA 5K8OA 4KFBB 2C2ZB 2DHGA 4DR6J 1J54A 3U6FA 4QIVA 1IKXA 5IM0B 1Y64A 1B70B 3MR6A 4KO0B 4YY3F 2EFGA 2DR5A 1PBAA 3MEEB 4USJC 4EWTA 5BPLA 2ATQA 3QMLA 1B9DA 3HSZA 4Z7CA 5FLXO 3EGWB 1X9WA 3E3XA 3C8YA 1RT2B 4IOCQ 2CH5A 1HBOA 1CQMA 1F1BB 1SB6A 3C14B 3PNIA 3Q7CA 1SUQA 1EWRA 5ADZA 2QM1A 4X64K 1M0SA 1YLXA 2OHDA 4F0KA 1TZ0A 4DR6K 3SQGA 3J81j 2BOPA 1RP5A 3HSCA 5HI7A 3KJVB 2GTDA 4FL9A 2ZH5A 3E9OA 4B8AB 4F2SA 5ETTA 1HKGA 2CQ0A 3KLIB 4ISEA 2ASLA 3FQKA 1NDCA 3AODA 3H5YA 4DL7A 3BBBA 3CJBA 2A5XA 1N5YB 4KHRA 1DQ8A 2Z2LA 4RUAA 2V94A 4DL5A 2G0JA 4U6PA 3THYA 5AT1B 3H3NO 5M1OA 4CJQA 5K8NA 4DSFA 4OL8A 2YHBA 2KT5A 3D7EO 2RS8A 3V1QA 3OHBA 3HRGA 2CZVC 3ZSWA 4RW7A 3DOMB 2PC6A 5EWEA 4PQAA 2IVMA 3RW7A 5C2GA 2AMCB 5CCLA 1Y97A 4G1QA 3V4IB 1NNDA 4FKYA 4ED2A 1VQOS 3O2IA 1LV5A 3MECB 2DY9A 3G86A 2HB5A 5HROB 1Q7YT 4CEEA 2BRKA 2LSNA 5KQDA 3MM5B 2X7IA 2VPYB 2YHYA 4O5BA 2KG0A 4MMOA 2BOAA 2EXUA 3K5MA 2QWOA 3DLRA 3AHPA 4YQWA 5EX5A 3RWUA 5A8KB 1BWVA 2DGXA 5E0OA 3DGPB 4ZIVA 4FWNA 2HSTA 2C42A 2FJVA 1S7HA 1LWXA 2QSFA 4DTJA 4BS2A 2FQQB 3CEDA 1YI2S 4BDYA 4DV1J 4WPAA 1K9MT 5FPDA 3LGMA 5BYQA 2P9SB 1C1AA 3OLAA 3PEHA 2DFEA 1U26A 1SQKA 2N82B 2QFIA 4OX8A 4K50A 4K5SA 1VQ8S 5AQVA 2P9KB 2OMOA 1KC8O 1JJ2R 4ICLB 5KFHA 4GVBA 3J80Y 2VOPA 4B1YB 5ETSA 4OIXA 1Q78A 3W65A 3FSYA 1JKHA 3VAGA 4I2PB 4C8YA 1ASUA 2GJFA 4YOWA 2K1RB 2KKZA 2BM0A 5EX3A 3I5CA 1WKKA 4D3HA 2IY5B 5CH7B 1VQMN 2HVEA 4DV1K 2CGKA 4HHJA 2ABYA 2W24A 2GIRA 4E1NA 2FY1A 2NRVA 4DN9A 5E3PA 3CCSS 5C2CA 3O8WA 4CH0S 1O13A 5FRMA 4YMEA 4CBWA 4LY7A 2YHWA 4YOUA 4ED5A 1WG5A 1RWNB 4M3ZA 3C2PA 2C3OA 4OI6A 1X4EA 3AD9C 2Q3SA 3BF1A 3QEPA 3GFZA 4CM2A 2CJAA 1UETA 1N34J 1T05B 2KN4A 1DZ5A 2MZ1A 3M8SA 1YJ9N 4DPOA 2WAQD 4ZPWR 3WEEA 4EFHA 4P2FA 4FXDA 2CQ1A 3RG6A 1JB0C 3PRBA 2MLYA 5HQMA 4Z94A 2Q2RA 4IFYA 4LRCA 4CYUB 1NSKL 2HW3A 1K73T 3OVBA 1R8AA 3TUPA 1A6LA 1SIWB 3P4IA 2JX2A 1NJWA 2G8UA 4QIEA 1N34K 5AQIA 3PJWA 3CO9A 1TKXB 1R43A 4I67A 3VQ9A 3DFEA 3TZXA 3F41A 3CC7N 1I6JA 2G9OA 2F5GA 3BSOA 5D3GB 4E98A 1XNRJ 2HZAA 4W5TA 1C1BA 5BYSA 3EY1A 3NH1A 1PYTA 1HD1A 4LBPA 4MT1A 2EFNA 2PI5A 1LWEA 2AQ4A 4TN2A 2V7YA 3H2VE 5KG2A 2CG4A 2NZCA 3WIVA 4LD0A 3OL8A 1R89A 2HHWA 1S1XB 4B9UA 6AT1B 4GO7X 4E3SA 3SK3A 4GY2B 1SH3A 1EP4B 4LR9A 2RDIA 3TSUA 4CK1A 1SC4B 4BG8A 3S41A 2FZKB 2HNZB 3DXBA 4LF9F 4KC5A 3G0ZA 3DC2A 4USWA 2IJFA 3OYGA 5AQKA 3ETOA 4DQPA 4QPTA 1XNRK 3KG1A 1BQMA 1FNMA 4U96A 3MFHA 2DD8S 2IAJB 3I87A 2CNLB 4B1WB 3LDNA 3SV4A 3KZBA 3D6MB 1RT5B 3TZZA 3TQ1A 2YJEA 3P3DA 3EKSA 2CA9A 2D3ZA 1U47A 3BP8A 2XTJP 2FF6A 5HN0A 1VQ6N 1QQCA 1RB0A 2OMLA 4Y34A 2VPXB 1K0TA 4LR7A 4M5KA 3DU6A 2OFHX 3L8BA 3NBPB 1CJKA 1HYSB 2UUWA 1VAZA 2VQEF 1B0TA 1P1LA 1M5VC 1C0UA 2DTJA 4I0WA 4KRWA 1KFDA 1ZM4A 1U6ZA 3MAAB 1VQNN 2DIUA 1E6YA 2Q97A 4Z0UA 3KMQA 3NH0A 3OT9A 3UCZP 3EL2A 4RWTA 4FKXA 2DISA 1DTQA 4H4OA 1ELOA 4PR6A 3TVKA 4ED0A 4ZP7A 1FD2A 3O44A 4JS4A 1RHKB 4F3QA 4BDZA 3NMRA 2A3ZA 1CJUB 2O67A 5CYQB 4DUYF 2MB0B 3SQ1A 2NXJA 2IPOB 2X74A 1EJ7L 3M2VB 1ZAVA 1ZM9A 5EU7A 5C25B 1AROP 4WK1A 4C8NA 2QL5B 5KI6A 1C4AA 2B9YA 2HEKA 3Q2SC 1CXUA 3RMDA 3QJLA 1Y10A 4UZCA 5K14B 1RCOB 1EETA 1VSHA 4P74A 3IAYA 2CAJA 5SWMA 4ZVEA 3DI6A 2F8SA 2IJRA 3N5BA 1S10A 3I4PA 2O66A 2CQGA 1VS3A 4LSZB 4HDHA 2HNYA 4XPCA 4PXCA 3JB9k 3PR4A 2QTWA 5KFAA 2I6WA 3FC9A 1WI6A 3M2RB 5AQSA 2VBZA 3TP2A 1EQMA 4RL1A 3VTIA 1L3VA 3W1YC 2J9EA 2J7WA 1AUDA 5JUMA 1G99A 5HK4A 1DFDA 2EBGA 3BDEA 4JK7A 3SAHA 4JI5F 3T6BA 5AQWA 4GMKA 1H1VA 3BEGB 1P8GA 1GLAG 2JEJA 1B64A 4F0HA 4B9SA 5AQMA 4ZVTB 1QVFM 4BC2A 3UKUB 1NO8A 3RR7A 2GQ2A 3MM6A 3HSTB 1RDDA 1Z26A 1DQAA 4FBTA 5KG1A 1OY9A 3GYNA 2XMWA 3CCLN 2NUBA 2QC3A 4CF1A 2NZTA 5HJXA 1JLBB 5AQQA 2H9ZA 2B9WA 3PCOB 2XG8A 1R0BG 2W2NP 2KH9A 1NJXA 1WNSA 1N36J 3A8IA 3CCRS 3Q23A 1IR0A 5A8RA 3HZGA 2P2CB 1Q7YO 4H0YB 2Z4PA 1DJ0A 2WW8A 1TK5A 5FLXU 2R2UA 4N41A 4OLOA 5HMXA 4WE1A 1ATRA 4DS4A 2P5OA 4YB5A 3HHLB 3VVUA 1ZBHA 4DZ6A 3RUBL 3GFHA 1R8BA 4F0MA 3HZEA 1D8YA 4K4YA 2O01C 1RT6A 5GAGP 3CXCR 2NXEA 4HYKA 4HR2A 3VPZA 5C12A 4DSLA 1L3KA 2GHWA 2DTUA 3SBMA 2VQFF 2D3OR 4Y2IA 1VC5A 2G2OA 2W41A 2KFYA 1RYRA 2MXYA 3OYCA 3EVMA 3WC0A 4ILRA 4OLPA 3O9RA 1VSJA 1KAXA 1N36K 4IKFA 5L38A 4ERDA 3CJ3A 3SCKE 5IV3A 3N6MA 3ZETB 3K59A 4CJ3A 3KFWX 3DLGB 4UUXA 4Q2LA 4OYXA 2NPIA 2XM3A 3U1MA 1WF0A 3KDNA 4K4ZA 1RKJA 4KHYA 1XWLA 4DFKA 4CZKA 3QIDA 2YNIA 3THVA 1RTHA 3TTDA 1XUPO 4JI0J 1WC1A 3M2UA 2P9UB 1CJTA 3BN7A 4WXOA 2FC0A 3QB0A 3J7A1 4FLVA 2LU1A 2VONA 4JBCA 4KFBA 3MHYA 4LSNB 3MR3A 2EEYA 1WG1A 4I7FB 3NGYA 2V8GA 1U1NA 4UOGA 2D69A 5GIPA 2G8WA 2Q6CA 2W1BA 2WVEA 1SV5B 5IM0A 2KQ2A 4UOFA 4WFYA 1NOYA 5EVZA 3LGHA 4ZPAA 3K2YA 3MEEA 2AU0A 3TVZA 3R7BB 2WVFA 1A9NB 2V69A 3UQSA 4X4TA 4TQRA 1U04A 4JI0K 1RI7A 5KT6A 3JSBA 3AVNA 4EO8A 1IBKF 3FZHA 1RT2A 3RB3A 2X1BA 2HQIA 2JOQA 3A3PB 1U4BA 3R97A 2Z1GA 4J37A 2LQ5A 1F3FA 1X7VA 2RILA 3BGUA 4JS5A 1JCEA 2A10A 3NGDA 1N56A 3NWRA 2CQIA 4O3QA 3NGIA 3EEQA 3KJVA 5EUHA 4EZ6A 3CMAN 5AFUA 3KLIA 2EC2A 5KT5A 3SBTA 4NEZA 1HPMA 5GMDA 1AT1B 2LYVA 1N5YA 1FI4A 1K73O 5AQJA 2P1JA 3BH7B 3SQ4A 1BWFO 3MD3A 4M5GA 2ZBCA 4DV3J 3TAQA 4AFFA 4JI1F 5TKWA 1VK3A 4F02A 4BRPA 1H2UX 3N4WA 1TUYA 3JSRA 3OTDA 1JCFA 3DYAA 3EUNA 3DOMA 1U1PA 3Q8UA 5CY4A 3V4IA 4B1XB 2CDQA 5KFBA 2CYYA 3MECA 4CBUA 4A8OA 3ADAC 3M7VA 1S77D 2FJWA 1XNQJ 3AAQA 5HROA 4ILGB 4BRDA 1KCFA 4Z4EA 1OQ3A 3KTQA 2YQ3A 3RRKA 3K9KA 4M7XA 3MM5A 2MSTA 1VQMS 4P10A 2BUPA 2YWGA 5JVHL 5T7BA 3E8OA 3M32B 5CHIA 1TL4A 2XHWA 2BX6A 2GMJA 4X66F 4DV3F 3JQMA 5IT9O 3TAMA 3SCJE 1F9HA 3PKMA 3MMAA 5A8KA 2VC0A 3DGPA 3SNNA 3C15B 4FP9A 2XY8A 4Z4CA 3CCWA 1QAYA 1X4AA 5MAOA 1RCHA 4F4AA 4KGKA 1W0HA 1RADB 2P9SA 1QDUB 3PW2A 3J81Y 3WX4A 1N52B 2ZD1B 2HWHA 1T3NA 1XNQF 2Z1JA 2H4YB 3DXSX 1VQ4S 2QIFA 2D74B 3MXMA 2R7VA 4YDXA 1UJ6A 2P9KA 1MROB 3L4BC 4PWUA 4ICLA 5AQUA 3ZX3A 5DGAA 4ED3A 1HQ2A 3S7RA 2F1FA 4DWIA 4DN0A 4CFAA 5DDOC 2JZ5A 2DITA 3C66A 3CDEA 4DKWA 4MKAA 4RJVA 4RX6A 4AXJA 1HHTP 1F6TA 2A6OA 1X5SA 3NGRA 3OYKA 4FF1A 1NU4A 5KT7A 3MEGB 4R8UB 3B6BA 4EMDA 2VWJA 3CJ5A 3KWMA