2FBXA

Wrn exonuclease, mg complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
HSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 195
sequence length 195
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbxA00
3HP9A 3SNNA 2W42A 4ID1A 5EU7A 5FRNA 3KLGA 1VSMA 1KSPA 2G8WA 1JLFA 4EZ6A 1Q9YA 1ZBHA 4N76A 5KRTA 1EKEA 1XHXA 2IC3A 3G10A 1Z26A 3MAQA 1TGOA 2LSNA 1NK8A 2F8TA 3MEGA 1IKXA 3VQEA 2DY4A 4M3ZA 4BE1A 4F4KA 3LANA 1S9EA 5KGXA 1YTUA 5JS2A 4DFPA 1NK0A 3ITHA 4N5SA 4C8LA 1BIUA 1BCOA 3F73A 1W9HA 4Z4FA 1HPZA 1Z25A 4CERA 2Z1GA 2A1RA 3C94A 1JLCA 4F3TA 3OYMA 1W0HA 1KVCA 3ZT2A 5FROA 4DFMA 2FBVA 4K8XA 4W5RA 3CQ8A 4DU1A 3KJVA 4CEQA 3DLBA 2G8VA 5I3UA 2RKIA 3MXMA 1IO2A 3QLHA 4B9LA 4FJ5A 1HMVA 1BIZA 3JYTA 2WONA 2BDPA 1U47A 3HPGA 4HUFA 1ZBLA 4CFDA 4FK0A 3HXMA 4I2QA 3OYHA 4IG3A 3EZ5A 3V81A 4FLTA 3NCIA 2GV9A 1RNHA 1C1AA 1KVAA 2KZZA 3THVA 2BGGA 1KLNA 1L3SA 2YNGA 4BACA 5HROA 3RRHA 2YHAA 2AJQA 1T03A 4BE0A 4BWMA 4KO0A 4FJXA 4E7KA 1DTTA 1YT3A 4CJ4A 1TL1A 3U3YA 2ZQBA 5KI6A 1D5AA 3V1OA 2YKMA 4HHTA 4CFAA 4CF9A 3RMDA 3SYZA 1MU2A 4NCGA 3TAEA 4Z4HA 3AA2A 2I5JA 3TAQA 3M8QA 4CJWA 3KLHA 2FBYA 2HHQA 3OVNA 1EP4A 1HYZA 1BI4A 4E1NA 1NJWA 1T05A 4B9SA 2HVIA 2G8KA 4B8AB 4E7JA 1FK9A 3VQQA 5C24A 4KKOA 3AVIA 1CLQA 5J2MA 3RR7A 1BQNA 3CM6A 3QEPA 5JS1A 3AVFA 5CYMA 3SUQA 2Y1IA 3VQBA 4CJ5A 4KHUA 4M3UA 3SUPA 1XI1A 1ITGA 1B9FA 3V9WA 3F9KA 3NF8A 4LD0A 1NJZA 4FK2A 4IG0A 3NH2A 2RN2A 5I42A 1ZBFA 1IG9A 3QEXA 4ELTA 3WNEA 3M8PA 3HK2A 4CEDA 3OJUA 3VQDA 1I39A 1LV5A 3AVNA 4IKFA 4DQRA 4C8KA 5J2QA 4FJIA 1B9DA 1N6QA 1TK8A 2B4JA 2GUIA 2DTUA 3ZSRA 1ASWA 3VQ8A 1QSSA 4H4OA 1U49A 4O55A 4AHVA 4Q5VA 4EP4A 3M8SA 2VWJA 3OY9A 1JLGA 4J2AA 3SPZA 4OKJA 4B8CA 1X9MA 4FLWA 1BI4B 4HCBA 4DSEA 5CY4A 4DTJA 1WAJA 4DU3A 3L2UA 4OKEA 3OYEA 2X6NA 3KLEA 2HHWA 1LWEA 1HRHA 1TKZA 3CG7A 3D0PA 2O4GA 5KGWA 2YNFA 2OPRA 4KB1A 2Y1JA 3QEVA 2BE2A 4CGDA 4DFJA 4BDPA 5D3GA 3T19A 4JRPA 2DFEA 2B6AA 3O4NA 4DS5A 4BWJA 3AO3A 3PV8A 1VSKA 4ELUA 4DSIA 4YFUA 4GW6A 2VG7A 1WSGA 3K5OA 3LWLA 1SKRA 3T1AA 4DF4A 3IG1A 4B08A 1U4BA 1NJYA 4KHSA 3VQ5A 3VQAA 4Y1CA 4Z4EA 1SUQA 4G1QA 4CEFA 5HRSA 2X74A 3G0ZA 4FJNA 3LZJA 4FLXA 1UWBA 3CFRA 4DQQA 1JL2A 2D5RA 3RTVA 2XY7A 1L3VA 4O4GA 1Q9XA 1JXEA 3IS9A 3JSMA 1NOYA 4OLAA 1KLMA 4OLBA 4CIGA 3LP0A 5DK5A 3CFOA 3OYKA 4CECA 3V4IA 4FJLA 1YTAA 4FK4A 3M8RA 1C1BA 4B9UA 2JLEA 4RW8A 1B92A 4R5PA 3TI0A 1J54A 2HNDA 4HUGA 2IDOA 4RW4A 1FKPA 3NBPA 4CEOA 1RT6A 2EHGA 1REVA 4CIFA 4JRQA 2QKKA 4OVLA 4ZHRA 1RT1A 4H4MA 4ICLA 1TAUA 4FJ9A 4I9LA 4RW7A 3QIOA 4DS4A 4M45A 2G8FA 3DMJA 3NF9A 3WNHA 3K58A 4QCLA 3AV9A 4KPYA 4EZ9A 3RRGA 3LP2A 4M3TA 4OPJA 4AHSA 3LPTA 3OYCA 4J2EA 4FLZA 1U48A 1UOCA 1IH7A 3V9ZA 4DWIA 1QSLA 1F21A 1RTHA 3OS1A 1CZ9A 4KTZA 3L3UA 1A5VA 3DI6A 3ASMA 3PY8A 1SV5A 4E89A 5KRSA 2PYLA 3QO9A 4J2DA 3ZSXA 1QHTA 3MECA 4B9TA 4KB0A 2G8HA 1LW2A 3ZSYA 3RMBA 3C6TA 5T7BA 3OS0A 4OGCA 3TANA 4B3OA 4DTOA 3VQ4A 1TVRA 2E4LA 4CFBA 3DRRA 1RT5A 3SJJA 2A1SA 4CJVA 1JLQA 1BGXT 3TABA 1TKTA 1VSDA 1RBTA 5HP1A 3V1RA 4CHOA 3SCXA 3OYGA 4FXDA 4B9VA 1U45A 4W5NA 2D0AA 3ZCMA 3L2WA 2HNZA 3QESA 1RT7A 4DMNA 4FJ7A 1TK5A 3OYBA 3E01A 2OZSA 4CHPA 4N41A 5DMRA 2PY5A 3QEIA 4F8RA 1NOZA 4CFCA 3OYAA 2ETJA 4ZTJA 2ITGA 3C6UA 4GMJB 2IAJA 4CEBA 2XHBA 3QEWA 1C0MA 3SI6A 4B9MA 3PX6A 1VRUA 3LALA 3SQ2A 3DYAA 2Z1IA 1A5WA 2YNHA 2G8UA 4FJJA 4FCYA 5SZTA 4CEAA 2X78A 4CGIA 4DTPA 2HHUA 4KTQA 3TAMA 4NYFA 3P1GA 4E1MA 3ZT0A 4DSKA 3SQ1A 3A2FA 1YVUA 2ATQA 4DSLA 3DLHA 3AVAA 4HVJA 1Y97A 1RDCA 2KFNA 1U04A 1NK4A 1RCHA 2IOCA 4N47A 2ZE2A 4OJRA 1XWLA 1TKXA 1S6PA 4LSNA 4CF8A 4JLHA 4CEEA 3MEEA 3OS2A 3L2QA 4DTRA 3SPYA 1X9WA 1N5YA 3KTQA 4DQIA 5K14A 1UA0A 3B6OA 2VG6A 1JLAA 1J53A 4W5OA 1LAWA 1EETA 3HP6A 1NKBA 2PYJA 4AHRA 3HM9A 4O5BA 2IGIA 3QNNA 1S1TA 4FM1A 3HYFA 2FC0A 3B6PA 3LAMA 2HB5A 3OYNA 1VSJA 4CF1A 1X9SA 3DM2A 4H8KA 3OYJA 1SKSA 4CJRA 3KK1A 1ASUA 4QAGA 4PQUA 4CGJA 3BDPA 1GOBA 2P1JA 1KTQA 1RTJA 3V9XA 1EXQA 4KHWA 4F2SA 1TKDA 1LWFA 1EX4A 3NH0A 1KFDA 1RT3A 4Z4IA 4CGGA 5HRNA 3SV4A 3QERA 3AVKA 1HYVA 4HUEA 4DQSA 2QK9A 4FJGA 3OYFA 2KFZA 4KRFA 1RDDA 4CJUA 5E41A 4PY5A 4CF2A 1KCFA 2KQ2A 4Y1DA 4KHQA 1O1WA 3HPOA 1SL0A 4CE9A 3O3GA 4HCCA 3L2RA 3QIPA 3H08A 5KTQA 1C1CA 4CEZA 3NF6A 1GOAA 3AO5A 1VSHA 3TARA 2NUBA 3MXJA 1RT2A 1ASVA 3DLKA 4BE2A 3CM5A 4GVMA 3O4QA 1RTDA 1WAFA 2DFFA 4DTMA 4KTWA 4KV8A 4O44A 1JL1A 2F96A 4TSXA 4JS5A 3V9SA 4DTSA 1D9FA 1BCMA 1WSHA 4DTUA 2VG5A 3QETA 1G15A 4RW6A 3AVGA 3LP1A 4DF8A 2OA8A 4PWDA 4FM2A 3TAGA 1SL2A 3HO1A 4DU4A 2R7YA 2D0CA 1BL3A 4E19A 2HMIA 2XRIA 4CESA 3NGIA 3DLRA 4I9QA 2YNIA 2P51A 1QTMA 3I8DA 4M3WA 2GBZA 4CK2A 5C42A 4F2RA 4FJMA 3AVCA 1BQMA 1RTIA 5FDLA 5HRRA 4IFYA 4OPKA 4M3RA 1S5JA 5HLFA 3KK2A 1C6VA 4Z0UA 3NDKA 4DTNA 2YV0X 3PUFA 4XIUA 4L8RB 1NK6A 4M3XA 2F8SA 3TR8A 1LWCA 3AVLA 3DOLA 1Q8IA 3SUNA 4IDKA 4CGHA 3K2PA 1BISA 4I7FA 4RW9A 1D9DA 3KK3A 3HL8A 3NHGA 3PO5A 3HVTA 1R0AA 1NJXA 5CYQA 2HHXA 1S6QA 4BDYA 1S1WA 3VQCA 4FZYA 3HT3A 3VQPA 1DLOA 3AO1A 4B9NA 1RBUA 3S3OA 1KRPA 3SZ2A 1C0TA 4MFBA 1XHZA 2OYQA 2HVHA 3SQ4A 2OPPA 3C95A 3P83D 4KAZA 1HJRA 3NF7A 3RMCA 1WSFA 3LPUA 2KTQA 2IS3A 3PO4A 4IBNA 1QSYA 1QS4A 3SUOA 4MQ3A 4KHNA 2WOMA 1T7PA 1WN7A 3AVJA 3HPHA 3IRXA 3LAKA 4JS4A 1TAQA 1ZYQA 2HHSA 3IAYA 1RBVA 3LDSA 3DLEA 2P5GA 3AVBA 4OGEA 2OZMA 1WNSA 4KI6A 5CZ2A 2HHVA 3LZIA 4DSFA 4FYDA 3TWHA 1X1PA 2DFHA 3OYIA 4CHNA 4N56A 3T3FA 3MXIA 1VSFA 4CCHA 4K8ZA 1VRTA 4FJ8A 3NFAA 4CJSA 2O4IA 4PUOA 1HNVA 3P5JA 4DLEA 3SQ0A 3ZT1A 3S9HA 4DLGA 4HTUA 3KD1E 4LSLA 2G8IA 1S1VA 4W5QA 3BGRA 4CJLA 5C25A 2HHTA 1J9AA 4FJHA 4CJPA 3KIOA 2QKBA 3ZSOA 5J2NA 1RDBA 3KLFA 3VQ9A 4CJKA 2KW4A 1VSIA 4CJTA 3EYZA 5CZ1A 4CJQA 4NCAA 1RBSA 3QNOA 1D8YA 2FBXA 3AVHA 2YKNA 3LWMA 4CJEA 3K5LA 3NGZA 1LAVA 1GOCA 4C8NA 4RG8A 4M3YA 2RPIA 1UA1A 2FBTA 4C8MA 3K59A 1VK0A 3NGYA 3KKRA 1J5OA 3U3GA 4W5TA 2XO7A 3NE6A 3FFIA 4M41A 2YHBA 2BANA 4O0IA 1RDAA 5SWMA 4FLUA 3I0RA 2VWKA 3KKSA 1HYSA 4IFVA 3ALYA 2QXFA 1HNIA 3AO4A 3QINA 4LH4A 1JLBA 4KFBA 1WSEA 4E3SA 1FKOA 3UIQA 3O3HA 4NYNA 1KVBA 3ZSQA 4CJFA 4YNQA 3RR8A 1HQUA 1S9GA 4AHCA 1ZBIA 4PA1A 1TL3A 3VA0A 3PX0A 1TK0A 3ULDA 3PX4A 3HSTB 4KREA 4AHTA 2XY6A 1T8EA 1QQCA 1CZBA 1UAXA 4AHUA 4J2BA 4FLVA 1C0UA 1VSEA 3O3FA 4ID5A 1QE1A 4LY7A 4UQGA 1LW0A 3K5NA 3WNFA 3DRSA 4KHYA 4DFKA 3AA5X 1IKYA 1RBRA 3OYDA 1HQEA 1NKEA 1NKCA 1S1XA 3LP3A 4DSJA 3AA4A 4OKKA 3CYMA 4F3OA 3SV3A 1WSIA 4ELVA 1RT4A 1TV6A 1WLJA 4E0DA 1IKVA 3ZSZA 1L3UA 3ZT4A 1SKWA 2HW3A 1IKWA 4FVMA 4CK1A 3TAFA 3AO2A 2P5OA 3OYLA 3RWUA 1RILA 5HRPA 2KZMA 2E6MA 3AA3A 1BHLA 3L3VA 4I2PA 2PZSA 4FW1A 3ZSWA 4AILC 3U6FA 1KFSA 3HJFA 3S3NA 2ZD1A 4CIEA 4LH5A 4CGFA 4CK3A 5FRMA 2Q3SA 1CXUA 2EX3A 2X6SA 4FLYA 3L8BA 4O0JA 4DG1A 4CHQA 1I3AA 2Z1HA 4DQPA 3D45A 3RMAA 2B5JA 3DOKA 4QOZB 4Z4CA 4CF0A 3NH1A 2E6LA 4FZXC 4Z4GA 4FM0A 3V6DA 1WSJA 4KI4A 5HBMA 2OPSA 3AVMA 3KLIA 3TAPA 4M42A 3V1QA 1NK5A 4CHZA 4NCBA 1JLEA 3HVRA 2JGUA 1FXXA 3VQ6A 3OJSA 1ZBUA 1SL1A 1DTQA 4DTXA 1L5UA 4FW2A 1L3TA 4E7LA 4ZTFA 2HNYA 4BDZA 3K57A 1JXBA 2D0BA 4E7IA 3ZSVA 3VA3A 3NAEA 1XC9A 2Z1JA 2XY5A 3K5MA 1S1UA 1CXQA 3ISNC 3MEDA 3DLGA 4AH9A 4EP5A 5J1EA 2RF2A 3VN5A 3I0SA 4E7HA 1VSLA 2OPQA 4FZZA 3L2VA 3WNGA 5J2PA 3V9UA 1NK9A 3VQ7A 4Q0BA 4CJ3A 1K6YA 2XY8A 3S3MA 1JKHA 3DRPA 3EY1A 4C8OA 1NK7A 4FJKA 4WE1A 3CFPA 3KD5E 4CHYA 1A5XA 3ZT3A
chains in the Genus database with same CATH superfamily
1HKBA 2EWSA 1NGCA 4ID1A 1QZ5A 1ESVA 1C0GA 5AZIA 1ZBHA 3UE5A 1XHXA 2H3GX 3MAQA 1TGOA 2P9KA 2CH5A 3MEGA 4JKBA 3ZETA 1YTUA 5KGXA 5JS2A 4GKKK 2GWJA 1BIUA 4FWRA 1W9HA 4WQ5A 2A1RA 2Z1GA 3C94A 4RTFD 1BWFO 1T3VA 1KVCA 1W0HA 4DU1A 4B1UB 1YJWN 2CGKA 4H0VB 3QLHA 4JI8K 1HMVA 2BDPA 1U47A 1NGHA 4LF7K 4JK8A 4I2QA 4CZHA 2IVPA 3V81A 3MN5A 3OW2M 1KVAA 3THVA 2NRTA 2BGGA 1L3SA 3VERA 4A2AA 3CPWM 2O8EB 4BE0A 4FJXA 1DTTA 5EXWA 5IT9O 1JJ2M 4LF9K 3V1OA 2YKMA 4LF8K 4BREA 4CF9A 3M8QA 4B9QA 1RDUA 3OVNA 4OX9K 1EP4A 1HYZA 3R9PA 4JKFA 1NJWA 1T05A 2HVIA 4H0OA 3NMUA 3VQQA 2IVOA 3PLAA 4KKOA 3VEVA 1ZC6A 3DWLA 3I33A 3VEZA 4CZLA 4BRDA 2HHHK 1ITGA 3H46O 3V9WA 3F9KA 4LD0A 4FK2A 5I42A 3NH2A 2RN2A 5M1OA 1RGIA 3FGUA 4O5FA 3KZBA 3HK2A 2PAVA 4CEDA 1OH8A 4FSVA 4GV3A 4DV4K 4JD2B 5J2QA 1TK8A 2GUIA 1ASWA 3OHRA 1U49A 2VWJA 1DEJA 3HOTA 2YJFA 1X9MA 2GELA 4HCBA 5CY4A 4BRMA 4BRGA 1VHXA 3E9LA 3DXKB 2AA4A 3HBTA 3D0PA 1X3NA 4BR5A 2YNFA 2JWLA 2Y1JA 2GEMA 2HBMA 3T19A 4H0TB 3E9OA 4JRPA 1KAZA 4DS5A 4ELUA 4DSIA 1VSKA 4YFUA 3K9JA 2AP1A 4WQ4C 4DF4A 3IG1A 4KHSA 1ZXOA 1JCGA 1GLDG 1SZ2A 4CEFA 5IWAK 3C65A 4DQQA 4BC4A 1JL2A 1L3VA 4FWPA 2CH6A 4OLBA 3DXMB 4CIGA 3CFOA 4CECA 3D7EO 2JLEA 4IEEA 1HLUA 1NLVA 4R5PA 4CBXA 3VEOA 4HUGA 4JRQA 4IWVA 1U6ZA 4ZHRA 4RW7A 5BPLA 4KPYA 3N4PA 4H03B 4BY9C 4CZJA 3OYCA 1IH7A 2VWBA 4DWIA 2NNWA 1RTHA 3THYA 3ASMA 3PY8A 2E2NA 3ZSXA 1QHTA 1OVQA 3FZHA 4MLEA 3SJJA 3H1VX 5CR4A 4CJVA 5GAHP 1BGXT 3TABA 5AZIB 1VSDA 3SCXA 3OYGA 2YHYA 3QDKA 4B9VA 2P9KB 2FF6A 1KAXA 3E66A 3L2WA 4FJ7A 4CHPA 5DMRA 2PY5A 2NRWA 3OYAA 2ETJA 2ITGA 2XHBA 2IAJA 3QEWA 4DCHA 3SI6A 3I8BA 1GLJO 1VRUA 2WFBA 3DYAA 2YNHA 5SZTA 3OA9A 3T69A 4YOXA 4H5TA 4J2BA 1HUXA 5AQQA 3A2FA 4DSLA 2GTDA 3AVAA 4OJRA 3CCEN 1TKXA 2CGLA 4LSNA 1X9WA 2VQEK 1NM1A 5EX5A 1J5EK 3WXLA 1N32K 1EETA 3HP6A 1NKBA 2NRZA 4O5BA 2IGIA 4FM1A 2FC0A 3LAMA 2HB5A 3OYNA 2GWKA 1VSJA 2VYPA 3OYJA 5AZJA 1S22A 4FWSA 3LDLA 3GBTA 3TSQA 2P1JA 4DR3K 3ATUA 1E4GT 1EX4A 1KFDA 1P90A 1RT3A 4AM6A 3AVKA 1HYVA 4FJGA 3ZX3A 4DUYK 1KCFA 4Y1DA 4CE9A 3IFRA 3QIPA 3H08A 3VETA 1C1CA 4ILHA 1GOAA 3AO5A 4A62A 3TARA 1RT2A 4BRQA 2Q36A 3CM5A 5C2FA 2F96A 4JS5A 1D9FA 5AQNA 3B8AX 3W0LA 5BRHA 4BGAA 1NGDA 3DLRA 3J7ZO 2P51A 3I8DA 4DV1K 4NLCA 2GBZA 1SAZA 4M3WA 4FJMA 3AVCA 1RTIA 5HRRA 2G8HA 3KK2A 1C6VA 1EWRA 4Z0UA 4PKGA 3NDKA 1QQOA 4DKWA 4L8RB 5DM6L 2YJEA 4IDKA 1BISA 1R0AA 2HSTA 1S1WA 2ZF5O 3VQCA 4DHYA 1RBUA 1HKCA 3SZ2A 1C0TA 2P9UA 2OPPA 1ILYA 2V7YA 3P83D 4KAZA 1HJRA 3NF7A 3RMCA 2O8DA 2KTQA 2IS3A 1QSYA 2P9SB 4JI0K 3SUOA 4KHNA 2WOMA 3HPHA 3AVJA 3PSFA 1DGKN 2ZJRL 2HHVA 1WNSA 3VESA 1NJIO 3WUHA 3ZEUA 4CCHA 4K8ZA 1HYSA 4KBOA 1HNVA 3SQ0A 3L4IA 4FO0A 1QZ6A 4HTUA 1OH7A 2G8IA 3P4IA 4CJLA 1J9AA 4FJHA 3KIOA 4A5BA 5J2NA 3A8YA 4YDUA 4K25A 4CJTA 3EYZA 4IOAL 3VTIA 4CJQA 4IEIA 3AVHA 4CJEA 3P39A 4C8NA 5CE3A 2RPIA 2O8BB 2QM1A 5ADXH 1VK0A 3NGYA 5GIOA 3U3GA 4W5TA 1SQKA 3SBTA 2XO7A 4M41A 2YHBA 2BANA 1RDAA 3AGKA 1IBLK 2NRHA 2W6LA 3ALYA 4CZFA 3TTCA 5TKYA 3O3HA 4BG8A 1HQUA 1OKJA 4DV3K 3A5OC 2D4WA 1C0UA 3O3FA 3GDQA 3WNFA 5M1QA 4DFKA 3AA5X 1IKYA 3VF6A 1S1XA 1EO1A 4JKCA 4JKDA 4DR4K 1WLJA 3ZSZA 2HW3A 1IKWA 2VQFK 1JCEA 1NBWA 3HOSA 2KZMA 3AA3A 1BHLA 3L3VA 2PZSA 3O9QA 2UXBK 2W41A 3K0SA 2E1ZA 3S3NA 5AQTA 3L4QA 1NGIA 5AZJB 3G71N 5E26A 4DG1A 4HWIA 5AQPA 3NH1A 2E6LA 3WXJA 1K9MO 2ZJQL 3W3DA 1GLFO 4FM0A 4Z4GA 1X9JA 5C10A 4CHZA 4NCBA 3HVRA 3D2EA 2YCHA 1ZBUA 3SAFA 1DTQA 1L3TA 4BDZA 1YVNA 2RHKA 1JXBA 4E7IA 1GLBG 3ZSVA 5AQRA 3VA3A 3GL1A 4YY3K 2XY5A 4PKHA 1S1UA 3SAHA 2UU9K 5J1EA 2RF2A 1VSLA 5AQKA 3VQ7A 1K6YA 1WBDA 1JKHA 4C8OA 4K41A 3HP9A 3CCSN 4ISGA 5EU7A 1TUYA 1KSPA 1JLFA 4YORA 3O9UA 1ZBSA 3G10A 4A2BA 4CBWA 2LSNA 4CZKA 3CJ1A 3VQEA 2DY4A 3T1YK 4F4KA 2O8EA 3MDQA 1NK0A 1KAYA 4IOCL 4N5SA 1IJJA 4CZEA 4Z4FA 5EVZA 3CCUN 1HPZA 2GUPA 2D0OA 5FROA 2FBVA 4K8XA 3KJVA 4U7BA 3DLBA 3JYTA 3M3ZA 5F0XA 2WONA 2P9UB 4HUFA 3PSIA 3NVMA 5JICA 2GV9A 4MDAA 2KZZA 4DV0K 2FSNA 4ILJA 4B1YB 3UKUB 4BACA 1V4TA 3RRHA 4M63C 2YHAA 2AJQA 4JI7K 3H3NO 5AQZA 3ENOA 4JD2A 4OO1J 5M1KA 4JI5K 3CJ7A 3TAQA 4BRPA 2FBYA 4WQ5C 4B9SA 5KPRA 3QB0A 1FK9A 3DXKA 3T7ZA 1GLCG 1CLQA 1BQNA 3QEPA 4H0PA 3C7NB 3UB5A 4M3UA 4BRKA 1XI1A 2NLXA 3U9ZA 3NF8A 1NJZA 4IG0A 5GIPA 1IG9A 4ELTA 3WNEA 3CPEA 1VQPN 3M8PA 3LDNA 3OJUA 3VQDA 1I39A 4FJIA 1B9DA 2B4JA 1D4XA 4BR4A 2QWOA 1QSSA 4AHVA 3M8SA 3HM8A 3OY9A 4LFAK 5AQYA 3SPZA 4JKHA 2QWRA 3DXMA 2A40A 3L2UA 2X6NA 1VQ5N 3DJCA 3A5MC 1HRHA 3CG7A 3EEQA 3OBYA 2O4GA 1J6ZA 2OPRA 4KB1A 2BE2A 4DFJA 5AR0A 4BDPA 3CC7N 2B6AA 3O4NA 1VQON 2VG7A 3WEEB 1SKRA 3THXB 1BA0A 1RFQA 1QQMA 4WF9L 4EIAA 4G1QA 2JWKA 5HRSA 3A5LC 4PKIA 3LZJA 4FLXA 4O4GA 3WQUA 1JXEA 3BZCA 4JAXA 3OYKA 1YTAA 4JHDB 1B92A 4CVNE 2HNDA 2ITMA 4CEOA 2P9PB 2EHGA 1REVA 4JYAK 2QKKA 5BN9A 4IOXA 3CC4N 3D2EB 3EZWA 1RT1A 1TAUA 4I9LA 4DUZK 2A42A 4DS4A 4QS8A 4X62K 3K58A 1XQSC 4EZ9A 1H1VA 3RRGA 3CQYA 4M3TA 4OPJA 3IKMA 3U9DA 4BROA 4U67L 1SV5A 1NGGA 3D2FA 2GX9A 3ZYYX 3TANA 1XMQK 1TVRA 2E4LA 4CFBA 3WXIA 4MLHA 3RVCA 1K8KB 3CCVN 5AFUA 4CHOA 3E1YA 4LFBK 4FXDA 4W5NA 3ZCMA 2QEXN 2HNZA 3QESA 1U2VB 1NGEA 3OYBA 3G4SN 3E01A 1XNQK 4I6MB 5AQUA 4ILGB 3C6UA 1YAGA 1C0MA 3BF3A 3PX6A 2Z1IA 2G8UA 5EOYA 2X78A 3R8EA 2YI1A 2HHUA 3LM9A 4NYFA 3P1GA 4DSKA 2ATQA 4B3RK 3DLHA 2UXDK 1RDCA 4CI6A 1NK4A 1RCHA 3CC2N 4N47A 2ZE2A 5LJVA 1S6PA 3SPYA 1ATSA 3MN7A 2VCPA 4CEEA 4DTRA 3EO3A 3B6OA 4ISFA 1Q86O 3KK7A 3CHWA 5AQGA 5GAEP 3QNNA 1NWKA 3HYFA 3O1WA 1HNWK 2Q0RA 4H8KA 2ZWHA 3C6AA 3KK1A 1ASUA 3LDOA 3R1XA 4PQUA 1GOBA 1KTQA 1EXQA 1TKDA 1LWFA 1YIJN 3O8MA 4Z4IA 4CGGA 1Z6RA 2J4RA 5HRNA 3UKRB 5GINA 4DQSA 2QK9A 3CJCA 5JMVA 1RDDA 4KRFA 1XMOK 5E41A 3OBWA 4CF2A 4B1ZA 3HPOA 4CZIA 4HCCA 3O3GA 3NF6A 1VSHA 4BRNA 1ASVA 3DLKA 1HPMA 3L0QA 1RTDA 4DTMA 4KV8A 1JL1A 3HI0A 2P9IB 4DTUA 3AVGA 3LP1A 4DF8A 4IXCA 2D0CA 4E19A 4I9QA 1T6CA 4CK2A 5C42A 4F2RA 3CQXA 2P9SA 4IFYA 5HLFA 1XNRK 4DTNA 1N33K 3CCQN 1YI2N 1NK6A 4M3XA 1EWQA 1LWCA 1Q8IA 3G6EN 3SUNA 4CGHA 2D0PA 4I7FA 5EY4A 3MWTA 3KK3A 1NMDA 3HVTA 5JVHL 4FPBA 2HHXA 3M5RA 4FZYA 3HT3A 3AO1A 1KC8O 2BUPA 3MK6A 2HVHA 2QI2A 1WSFA 3PO4A 1HKGA 1QS4A 4BR2A 4MQ3A 3CCLN 4FWLA 1TAQA 1ZYQA 2O8BA 5C0YA 2P5GA 3H45C 3CERA 4OGEA 5CZ2A 3LZIA 1X1PA 3OYIA 3T3FA 2O4IA 4PUOA 3P5JA 4H5NA 3S9HA 4CJ7A 4LSLA 2FLOA 2QWPA 4W5QA 3RSEA 2HHTA 1NGJA 4CJPA 2QKBA 3ZSOA 1VQ7N 2V52B 1RDBA 1HNZK 2FSKA 2A41A 1BG3A 2KW4A 5CZ1A 3EL2A 4NCAA 2YKNA 5F1XA 3LWMA 1VQNN 3D2FB 4CZGA 2QWLA 1LAVA 1IG8A 4RG8A 1YHQN 4M3YA 4NXNK 2YHWA 1UA1A 2FBTA 3CETA 1M1KO 5H1SQ 3LDPA 3VEWA 3CMEN 4FLUA 3I0RA 2E5LK 3AO4A 4LH4A 3ZLJA 1WSEA 3UIQA 4J8FA 4NXMK 4NYNA 1S9GA 1WBBA 3PX0A 3PX4A 4KREA 4AHTA 2XY6A 3MN6A 1CZBA 4AHUA 2ZM6K 4FLVA 4ID5A 4LY7A 3VMFB 4O8UA 2D1KA 5A2QO 4YDUC 2QW9A 4DSJA 3CYMA 1W7AA 3SV3A 5BREA 1W2BM 1R59O 3QMLA 1TYQB 4BR9A 3ZT4A 2P5OA 5BPNA 1RILA 4PL8A 3HSCA 5AQIA 4FW1A 1BO5O 3U6FA 4JKAA 2ZD1A 4CK3A 4CGFA 2EX3A 2X6SA 3CCRN 3MMVA 5I9EB 4O0JA 4CHQA 2Z1HA 5LY3A 3FE1A 3A0IX 4QOZB 2E20A 4OPHA 4C23A 3V6DA 1WSJA 4IZ9A 3TAPA 3V1QA 3R3LA 2BTFA 3OJSA 1S72N 4DTXA 4E7LA 4ZTFA 3VEYA 1NU0A 2HNYA 4FPAA 3K57A 2D0BA 3THWB 4DV2K 2OCEA 2Z1JA 3K5MA 2WBNA 1CXQA 3ISNC 4AH9A 1ATNA 1VQMN 3I0SA 2OPQA 3ID6A 3L2VA 4CJ3A 3S3MA 1E4FT 4CHYA 1A5XA 3ZT3A 2W42A 3CD6N 3FZFA 3SJHA 5FRNA 3KLGA 1VSMA 3L6QA 2G8WA 4WFBL 4LF5K 4GKJK 4EZ6A 3TSUA 5KRTA 4N76A 1EKEA 4FOEA 1Z26A 4CD3A 1NK8A 5M1NA 1IKXA 3UKUA 4BE1A 3LANA 1S9EA 1Q81O 4DFPA 3ITHA 1BCOA 2P9NA 4PHTX 1Z25A 4IDHA 3A5NC 1JLCA 4F3TA 3OYMA 2NZTA 3WXKA 5I3UA 2RKIA 4FJ5A 4B9LA 4LF4K 3O5BA 3CXCM 3HXMA 3C6HA 1OH6A 3OYHA 4IG3A 1GLAG 3N4QA 3NCIA 2FSJA 4RWTA 1C1AA 1V4SA 2E2OA 1IV0A 3C7NA 3J7YP 4KH6A 4H5RA 2YNGA 4WCEL 5HROA 4DR2K 4BRAA 1T03A 4KO0A 3MCAB 1YT3A 3O08A 1D5AA 3QICA 3RMDA 3MX5A 2V7ZA 5FPDA 3AA2A 4QS7A 2I5JA 3RSEB 3SBGA 4CJWA 1WOQA 5BN8A 5C24A 5J2MA 4JI6K 1NMNA 4BRFA 4BC2A 3AVFA 3BZKA 5CYMA 4A59A 3SUQA 4JK9A 3VQBA 3SUPA 3PIPL 1O13A 1B9FA 4BRHA 3WEEA 3THXA 3QEXA 3CCMN 1T44A 3F2KA 4C8KA 4IJNA 3D6RA 3KHYA 4KHPK 2A3ZA 2E2QA 2DTUA 3ZSRA 3S41A 3BP8A 3C0BA 3SMPA 4AM7A 4Q5VA 4EP4A 1JLGA 3VEXA 4J2AA 4OKJA 1NGFA 4FLWA 1BI4B 2Q1NA 4Z94A 1VQLN 4DTJA 1WAJA 4JHDA 2E88A 4OKEA 3QBXA 1T6DA 1LWEA 2P9PA 3QEVA 3DLLL 2DFEA 3PV8A 4BG9A 4BWJA 3K5OA 1WSGA 4FWNA 1KXPA 3T1AA 1U4BA 1P8ZA 3J7AP 3VQ5A 3VQAA 4Y1CA 4Z4EA 1SUQA 3DAWA 1Q18A 4FWQA 1VQ4N 2X74A 3G0ZA 4E1JA 3CFRA 2D5RA 3RTVA 5AQLA 1Q9XA 2BH1A 3JSMA 1NOYA 4OLAA 3LP0A 5DK5A 3V4IA 4FK4A 4F9OA 3M8RA 2W40A 2Q97A 4RW8A 1OH5A 1QHAA 3TI0A 3AARA 1J54A 2IDOA 1FKPA 3NBPA 3GG4A 1RT6A 3FZLA 1K8KA 4OVLA 4H4MA 4ICLA 3BEXA 3ENBA 4FJ9A 4H0XB 5GAGP 4M45A 3DMJA 3NF9A 3WNHA 1U2VA 3LP2A 3QFPA 4WFAL 4I6MA 3O4WA 3LPTA 3AAQA 3MCPA 4J2EA 3V9ZA 1QSLA 1F21A 2Q31A 1CZ9A 4KTZA 3EN9A 3DI6A 3EKSA 4E89A 1VAZA 2PYLA 4J2DA 5JLFA 1RDWX 4CBUA 4BC5A 4KB0A 1LW2A 3ZSYA 3C6TA 5T7BA 3OS0A 3TTDA 1Z05A 4B3OA 4DTOA 3SMSA 3DRRA 1RT5A 2A1SA 3O6WA 3R6MA 1JLQA 3TSPA 1TKTA 1RBTA 3V1RA 4XH4A 3HRGA 5MLCQ 3J80O 2D0AA 3E9PA 3OTOK 4NO7A 1TK5A 1KD1O 2OZSA 2FXUA 3H6EA 2P9NB 4F8RA 1NOZA 4CFCA 4ZTJA 4GMJB 4B9MA 4CEBA 4GV9A 5BPMA 4FJJA 4CGIA 4DTPA 4KTQA 3TAMA 3VGMA 4E1MA 3UKRA 1Q82O 1Y97A 2KFNA 1U04A 4OPAA 1XWLA 4CF8A 3OS2A 5FPEA 1N5YA 3KTQA 5BRDA 4DQIA 1UA0A 4DR1K 2VG6A 1JLAA 3TTFA 1LAWA 4LC9B 5GADP 2A5XA 4AHRA 4NLBA 3AGRA 3B6PA 3CMAN 4FWKA 4CF1A 1X9SA 3DM2A 2P9IA 3Q7BA 1GLLO 3VPZA 5FPNA 1WUAA 4QAGA 1RTJA 4KHWA 3NH0A 1QQNA 3F9MA 3SV4A 3QERA 1XC3A 4B3TK 4BRIA 2Q2RA 3OYFA 2KKZA 4CJUA 4PY5A 4BRCA 4C1NK 1SL0A 4BVPA 4CEZA 3MXJA 4BE2A 3ZX2A 3KVGA 2DFFA 4KTWA 3V9SA 4TSXA 5HL7L 4DTSA 5FLXO 1Q7YO 1BCMA 1WSHA 3SAGA 1QVFM 1G15A 4RW6A 3O1BA 4FM2A 2KHOA 5C15A 3HO1A 2R7YA 4XH1A 5LMUK 2HMIA 2XRIA 3NGIA 2HF3A 2YNIA 3BUZB 2HBJA 1E3MA 1BQMA 4OPKA 1S5JA 5AQFA 5AQHA 3TR8A 1OVYA 3AVLA 1ATRA 1DKGD 3K2PA 4JNEA 1D9DA 2QA4N 3NHGA 5JVGL 3PO5A 1NJXA 3EE8A 1HR0K 3CF5L 1S6QA 3TU5A 4BDYA 3EE9A 4DR7K 4H0YB 2HOEA 4H5WA 3VQPA 1DLOA 4B9NA 3S3OA 1VQKN 2OYQA 1XUPO 1YJ9N 4YOYA 3GE1A 3LPUA 4IBNA 1NGAA 1HX1A 3CIPA 4MO5A 1T7PA 1WN7A 4JS4A 4YOWA 1RBVA 3LDSA 1MDUB 3DLEA 1YITN 3AVBA 4KI6A 3FFKB 4DSFA 4FYDA 4KH4A 3ULEB 2DFHA 1VSFA 1YUWA 2E1YA 4CJSA 4DLEA 1VQ8N 2OTLN 1S1VA 2NRXA 3BGRA 5C25A 1X3MA 4B1XB 4CZMA 4JKGB 4JKEA 3KLFA 4CJKA 1VSIA 2O8CA 5AFUH 4K42A 4K43A 1D8YA 1HJOA 1BUPA 3K5LA 4M7YA 4LFCK 2I7NA 3VF2A 4B1VA 2I7PA 1TYQA 2E8AA 3FFIA 1N34K 5SWMA 3KKSA 2VWKA 4IFVA 1HNIA 5LJWA 4E3SA 1FKOA 4CJFA 2ASMA 4K0KK 3RR8A 1YJNN 4PA1A 3VA0A 4GY2B 2IIRA 1T8EA 1VSEA 4JN4A 4EFHA 1QE1A 4UQGA 3IUCA 1LW0A 3K5NA 1RBRA 3OYDA 1NKEA 3VGLA 1MWKA 2ZGYA 1N8RO 1SS6A 4F3OA 1RT4A 4E0DA 1IKVA 3KWIA 5M1FA 3VENA 3THWA 4FVMA 4CK1A 4L3QA 3OYLA 5HRPA 4HTLA 1VQ9N 2E6MA 2PFUA 4I2PA 4WFNL 3ZSWA 4B3MK 4FLYA 5KQ8A 1I3AA 2IVNA 3D45A 5KQDA 1C0FA 3WT0A 4FZXC 4KI4A 5C12A 5HBMA 2OPSA 3AVMA 3G25A 1NK5A 2OANA 2UUCK 1JLEA 1FXXA 1SL1A 2O8FB 1L5UA 4YOTA 2NRVA 3NAEA 1XC9A 3MEDA 4Y0WA 3VTHA 4EP5A 1LCUA 5AQMA 3ZX0A 5J2PA 4H5VA 1NK9A 4Q0BA 3CI5A 2XY8A 4R79A 3DRPA 3EY1A 3CFPA 4XH5A 5LL6Z 3SNNA 3LL3A 1Q9YA 5B8HA 1MWMA 4GVEA 2IC3A 5E84A 2F8TA 4A61A 4M3ZA 3NVKA 2RE2A 5C2DA 4C8LA 5AQVA 3F73A 1MA9B 4CERA 1YF5L 3ZT2A 4DFMA 3KWGA 4ISEA 4DR5K 4W5RA 3CQ8A 4CEQA 4BVOA 2V51B 2G8VA 3MXMA 1IO2A 1BIZA 3P31A 4GV6A 3TPQA 3HPGA 1ZBLA 4CFDA 4FK0A 4KH5A 3EZ5A 4FLTA 1RNHA 1WB9A 1KLNA 3ZETB 3CJAA 3MN9A 4BWMA 4E7KA 4CJ4A 1TL1A 3FZKA 3U3YA 4BGBA 2ZQBA 5KI6A 2YX6A 4HHTA 4CFAA 1TUUA 3SYZA 1MU2A 4NCGA 3TAEA 4Z4HA 3KLHA 5KPTA 2HHQA 3FLCO 1BI4A 4E1NA 2G8KA 4B8AB 4E7JA 2O8CB 1S3XA 3AVIA 3AY9A 4WQ4A 3RR7A 3I56N 3CM6A 2UUAK 5CHIA 2Y1IA 4KHUA 4CJ5A 5F2RA 1G99A 3F5TA 2HF4A 1CZAN 5FPMA 4BC3A 1JCFA 1ZBFA 4CW7B 4A5AA 2QTDA 3IDHA 2ZJPL 4IKFA 1LV5A 3AVNA 4DQRA 1VQ6N 3PIOL 1N6QA 4IO8A 3VQ8A 4H4OA 4LF6K 4O55A 2WUSA 2YHXA 4EHTA 4B8CA 4B1WB 4DSEA 4C1NI 4WYBA 4DU3A 3OYEA 3KLEA 2HHWA 1BDGA 1TKZA 3O9SA 5AJ3K 5KGWA 4CGDA 4FWMA 5D3GA 3M6GA 3AO3A 4GW6A 3LWLA 1FW6A 4CD1A 4BR7A 4B08A 3BF1A 1NJYA 4FJNA 1KQSM 1UWBA 4M7XA 2XY7A 2ASOA 2WTUA 3IS9A 1KLMA 4FJLA 1C1BA 4B9UA 4YOUA 4BRLA 4RW4A 3CCJN 4CIFA 3P38A 2VGNA 2FF3B 3QIOA 2G8FA 3FR0A 4QCLA 3AV9A 2F4VK 4O8KA 4AHSA 4JV5K 4FLZA 1U48A 1UOCA 3OS1A 4RCHA 3L3UA 1A5VA 5M1PA 5KRSA 3QO9A 2CGJA 3MECA 4B9TA 3U8XA 3RMBA 4JI1K 4OGCA 2ZGZA 3VQ4A 5AQOA 3H3OB 5HP1A 1U45A 1DT9A 3HZ6A 4G9ZA 1BOTO 1RT7A 4DMNA 4N41A 5ADXA 4UY8O 3QEIA 5TKWA 3THYB 3LALA 4EAHD 3SQ2A 1A5WA 4FCYA 4CEAA 5HOOA 4DV7K 4X66K 3ZT0A 3SQ1A 3GOIA 1YVUA 4BQLA 4HVJA 1HNXK 4YHHK 2IOCA 3BY5A 4JLHA 1K8AO 3MEEA 5FRMA 3L2QA 5K14A 4JI3K 1J53A 4W5OA 2PYJA 4X64K 3HM9A 5AQSA 1S1TA 2DPNA 3I55N 3J8AA 1FJGK 3QBWA 1SKSA 2PBDA 4CJRA 3U4LA 4CGJA 3BDPA 4XEIA 3V9XA 2E2PA 5BR9A 4F2SA 4FOIA 3ENHA 4HUEA 4X65K 4FL9A 2KFZA 5KPZA 2KQ2A 2P9LA 4KHQA 1O1WA 3FZMA 3L2RA 2NRRA 5KTQA 4IFEA 4QS9A 2F9TA 5DM7L 3O9TA 2NUBA 3HTVA 4GVMA 3O4QA 1WAFA 4O44A 5LMNK 2QWNA 2VG5A 3QETA 1LOTB 2OA8A 4PWDA 1NGBA 4IJAA 4JI2K 3TAGA 4DU4A 1SL2A 4YOVA 1BL3A 3O80A 4CESA 3JXUA 1QTMA 4DQ8A 5FDLA 2QWMA 3VGKA 2UXCK 4M3RA 2YV0X 3PUFA 3EKUA 1M90O 4XIUA 2QXLA 2F8SA 4A57A 4EHUA 3ULEA 3DOLA 2OTJN 4RW9A 4GNIA 2Q0UA 1BU6O 3HL8A 5CYQA 3T1HK 2HMPA 4PL7A 4JKGA 1KRPA 1XHZA 4MFBA 3MWPA 1EQYA 3SQ4A 3C95A 2VGMA 4MO4A 3MX2A 4DR6K 3QFUA 3IRXA 3LAKA 3AAPA 5AQXA 3ID8A 4IO9L 2HHSA 2F9WA 3IAYA 1K73O 2OZMA 3TWHA 4CHNA 4N56A 4FJ8A 5BRFA 3MXIA 1VRTA 3NFAA 1GLEG 2ASPA 3ZT1A 4DLGA 3KD1E 2QWQA 2F7TA 3VQ9A 1RBSA 4BQZA 3QNOA 2O8DB 2HBLA 2FBXA 1BA1A 3NGZA 1GOCA 3LDQA 3J81O 3JAMO 4C8MA 3K59A 1J5OA 3KKRA 3NE6A 3VF4A 3ZEUB 3K9KA 4O0IA 4BR0A 4DV5K 2KLAA 2A6AA 2QXFA 4DV6K 3QINA 4MDBA 1IBMK 1JLBA 4KFBA 5JLHA 1NNEA 4YNQA 1KVBA 3ZSQA 4V19S 4AHCA 1ZBIA 1TK0A 1TL3A 5AQJA 3JS6A 2UYTA 3ULDA 3HSTB 1IBKK 1QQCA 4B3SK 1UAXA 3SLCA 3WQTA 5ELZA 4DB3A 1N36K 3DRSA 3M1FA 5AQWA 4KHYA 1Y64A 1HQEA 1NKCA 3LP3A 3AA4A 4OKKA 2O8FA 1WSIA 3IMXA 4ELVA 1TV6A 2W6KA 3LM2A 1L3UA 3VOVA 1NG9A 1SKWA 3TAFA 3AO2A 3RWUA 3WXMB 4JEPA 4AILC 3H1QA 1KFSA 3SK3A 3HJFA 1QVGM 4CIEA 4LH5A 2Q3SA 1CXUA 3L8BA 4JI4K 4JK7A 4DQPA 3RMAA 2B5JA 3DOKA 4Z4CA 5BR8K 4CF0A 3KLIA 4M42A 5JS1A 2JGUA 3Q7CA 3VQ6A 1W97L 4FW2A 3CJBA 4AQYK 1I94K 2P9LB 4NB4A 4FWOA 4AF1A 3ATVA 3DLGA 2UUBK 3CJ9A 4FVUA 3VN5A 4E7HA 2WC9A 4FZZA 3WNGA 3V9UA 3O9RA 1NK7A 4FJKA 4WE1A 1YXQA 3KD5E 2HBKA
chains in the Genus database with same CATH topology
3HP9A 3SNNA 2W42A 4ID1A 5EU7A 5FRNA 3KLGA 1VSMA 1KSPA 2G8WA 1JLFA 4EZ6A 1Q9YA 1ZBHA 4N76A 5KRTA 1EKEA 1XHXA 2IC3A 3G10A 1Z26A 3MAQA 1TGOA 2LSNA 1NK8A 2F8TA 3MEGA 1IKXA 3VQEA 2DY4A 4M3ZA 4BE1A 4F4KA 3LANA 1S9EA 5KGXA 1YTUA 5JS2A 4DFPA 1NK0A 3ITHA 4N5SA 4C8LA 1BIUA 1BCOA 3F73A 1W9HA 4Z4FA 1HPZA 1Z25A 4CERA 2Z1GA 2A1RA 3C94A 1JLCA 4F3TA 3OYMA 1W0HA 1KVCA 3ZT2A 5FROA 4DFMA 2FBVA 4K8XA 4W5RA 3CQ8A 4DU1A 3KJVA 4CEQA 3DLBA 2G8VA 5I3UA 2RKIA 3MXMA 1IO2A 3QLHA 4B9LA 4FJ5A 1HMVA 1BIZA 3JYTA 2WONA 2BDPA 1U47A 3HPGA 4HUFA 1ZBLA 4CFDA 4FK0A 3HXMA 4I2QA 3OYHA 4IG3A 3EZ5A 3V81A 4FLTA 3NCIA 2GV9A 1RNHA 1C1AA 1KVAA 2KZZA 3THVA 2BGGA 1KLNA 1L3SA 2YNGA 4BACA 5HROA 3RRHA 2YHAA 2AJQA 1T03A 4BE0A 4BWMA 4KO0A 4FJXA 4E7KA 1DTTA 1YT3A 4CJ4A 1TL1A 3U3YA 2ZQBA 5KI6A 1D5AA 3V1OA 2YKMA 4HHTA 4CFAA 4CF9A 3RMDA 3SYZA 1MU2A 4NCGA 3TAEA 4Z4HA 3AA2A 2I5JA 3TAQA 3M8QA 4CJWA 3KLHA 2FBYA 2HHQA 3OVNA 1EP4A 1HYZA 1BI4A 4E1NA 1NJWA 1T05A 4B9SA 2HVIA 2G8KA 4B8AB 4E7JA 1FK9A 3VQQA 5C24A 4KKOA 3AVIA 1CLQA 5J2MA 3RR7A 1BQNA 3CM6A 3QEPA 5JS1A 3AVFA 5CYMA 3SUQA 2Y1IA 3VQBA 4CJ5A 4KHUA 4M3UA 3SUPA 1XI1A 1ITGA 1B9FA 3V9WA 3F9KA 3NF8A 4LD0A 1NJZA 4FK2A 4IG0A 3NH2A 2RN2A 5I42A 1ZBFA 1IG9A 3QEXA 4ELTA 3WNEA 3M8PA 3HK2A 4CEDA 3OJUA 3VQDA 1I39A 1LV5A 3AVNA 4IKFA 4DQRA 4C8KA 5J2QA 4FJIA 1B9DA 1N6QA 1TK8A 2B4JA 2GUIA 2DTUA 3ZSRA 1ASWA 3VQ8A 1QSSA 4H4OA 1U49A 4O55A 4AHVA 4Q5VA 4EP4A 3M8SA 2VWJA 3OY9A 1JLGA 4J2AA 3SPZA 4OKJA 4B8CA 1X9MA 4FLWA 1BI4B 4HCBA 4DSEA 5CY4A 4DTJA 1WAJA 4DU3A 3L2UA 4OKEA 3OYEA 2X6NA 3KLEA 2HHWA 1LWEA 1HRHA 1TKZA 3CG7A 3D0PA 2O4GA 5KGWA 2YNFA 2OPRA 4KB1A 2Y1JA 3QEVA 2BE2A 4CGDA 4DFJA 4BDPA 5D3GA 3T19A 4JRPA 2DFEA 2B6AA 3O4NA 4DS5A 4BWJA 3AO3A 3PV8A 1VSKA 4ELUA 4DSIA 4YFUA 4GW6A 2VG7A 1WSGA 3K5OA 3LWLA 1SKRA 3T1AA 4DF4A 3IG1A 4B08A 1U4BA 1NJYA 4KHSA 3VQ5A 3VQAA 4Y1CA 4Z4EA 1SUQA 4G1QA 4CEFA 5HRSA 2X74A 3G0ZA 4FJNA 3LZJA 4FLXA 1UWBA 3CFRA 4DQQA 1JL2A 2D5RA 3RTVA 2XY7A 1L3VA 4O4GA 1Q9XA 1JXEA 3IS9A 3JSMA 1NOYA 4OLAA 1KLMA 4OLBA 4CIGA 3LP0A 5DK5A 3CFOA 3OYKA 4CECA 3V4IA 4FJLA 1YTAA 4FK4A 3M8RA 1C1BA 4B9UA 2JLEA 4RW8A 1B92A 4R5PA 3TI0A 1J54A 2HNDA 4HUGA 2IDOA 4RW4A 1FKPA 3NBPA 4CEOA 1RT6A 2EHGA 1REVA 4CIFA 4JRQA 2QKKA 4OVLA 4ZHRA 1RT1A 4H4MA 4ICLA 1TAUA 4FJ9A 4I9LA 4RW7A 3QIOA 4DS4A 4M45A 2G8FA 3DMJA 3NF9A 3WNHA 3K58A 4QCLA 3AV9A 4KPYA 4EZ9A 3RRGA 3LP2A 4M3TA 4OPJA 4AHSA 3LPTA 3OYCA 4J2EA 4FLZA 1U48A 1UOCA 1IH7A 3V9ZA 4DWIA 1QSLA 1F21A 1RTHA 3OS1A 1CZ9A 4KTZA 3L3UA 1A5VA 3DI6A 3ASMA 3PY8A 1SV5A 4E89A 5KRSA 2PYLA 3QO9A 4J2DA 3ZSXA 1QHTA 3MECA 4B9TA 4KB0A 2G8HA 1LW2A 3ZSYA 3RMBA 3C6TA 5T7BA 3OS0A 4OGCA 3TANA 4B3OA 4DTOA 3VQ4A 1TVRA 2E4LA 4CFBA 3DRRA 1RT5A 3SJJA 2A1SA 4CJVA 1JLQA 1BGXT 3TABA 1TKTA 1VSDA 1RBTA 5HP1A 3V1RA 4CHOA 3SCXA 3OYGA 4FXDA 4B9VA 1U45A 4W5NA 2D0AA 3ZCMA 3L2WA 2HNZA 3QESA 1RT7A 4DMNA 4FJ7A 1TK5A 3OYBA 3E01A 2OZSA 4CHPA 4N41A 5DMRA 2PY5A 3QEIA 4F8RA 1NOZA 4CFCA 3OYAA 2ETJA 4ZTJA 2ITGA 3C6UA 4GMJB 2IAJA 4CEBA 2XHBA 3QEWA 1C0MA 3SI6A 4B9MA 3PX6A 1VRUA 3LALA 3SQ2A 3DYAA 2Z1IA 1A5WA 2YNHA 2G8UA 4FJJA 4FCYA 5SZTA 4CEAA 2X78A 4CGIA 4DTPA 2HHUA 4KTQA 3TAMA 4NYFA 3P1GA 4E1MA 3ZT0A 4DSKA 3SQ1A 3A2FA 1YVUA 2ATQA 4DSLA 3DLHA 3AVAA 4HVJA 1Y97A 1RDCA 2KFNA 1U04A 1NK4A 1RCHA 2IOCA 4N47A 2ZE2A 4OJRA 1XWLA 1TKXA 1S6PA 4LSNA 4CF8A 4JLHA 4CEEA 3MEEA 3OS2A 3L2QA 4DTRA 3SPYA 1X9WA 1N5YA 3KTQA 4DQIA 5K14A 1UA0A 3B6OA 2VG6A 1JLAA 1J53A 4W5OA 1LAWA 1EETA 3HP6A 1NKBA 2PYJA 4AHRA 3HM9A 4O5BA 2IGIA 3QNNA 1S1TA 4FM1A 3HYFA 2FC0A 3B6PA 3LAMA 2HB5A 3OYNA 1VSJA 4CF1A 1X9SA 3DM2A 4H8KA 3OYJA 1SKSA 4CJRA 3KK1A 1ASUA 4QAGA 4PQUA 4CGJA 3BDPA 1GOBA 2P1JA 1KTQA 1RTJA 3V9XA 1EXQA 4KHWA 4F2SA 1TKDA 1LWFA 1EX4A 3NH0A 1KFDA 1RT3A 4Z4IA 4CGGA 5HRNA 3SV4A 3QERA 3AVKA 1HYVA 4HUEA 4DQSA 2QK9A 4FJGA 3OYFA 2KFZA 4KRFA 1RDDA 4CJUA 5E41A 4PY5A 4CF2A 1KCFA 2KQ2A 4Y1DA 4KHQA 1O1WA 3HPOA 1SL0A 4CE9A 3O3GA 4HCCA 3L2RA 3QIPA 3H08A 5KTQA 1C1CA 4CEZA 3NF6A 1GOAA 3AO5A 1VSHA 3TARA 2NUBA 3MXJA 1RT2A 1ASVA 3DLKA 4BE2A 3CM5A 4GVMA 3O4QA 1RTDA 1WAFA 2DFFA 4DTMA 4KTWA 4KV8A 4O44A 1JL1A 2F96A 4TSXA 4JS5A 3V9SA 4DTSA 1D9FA 1BCMA 1WSHA 4DTUA 2VG5A 3QETA 1G15A 4RW6A 3AVGA 3LP1A 4DF8A 2OA8A 4PWDA 4FM2A 3TAGA 1SL2A 3HO1A 4DU4A 2R7YA 2D0CA 1BL3A 4E19A 2HMIA 2XRIA 4CESA 3NGIA 3DLRA 4I9QA 2YNIA 2P51A 1QTMA 3I8DA 4M3WA 2GBZA 4CK2A 5C42A 4F2RA 4FJMA 3AVCA 1BQMA 1RTIA 5FDLA 5HRRA 4IFYA 4OPKA 4M3RA 1S5JA 5HLFA 3KK2A 1C6VA 4Z0UA 3NDKA 4DTNA 2YV0X 3PUFA 4XIUA 4L8RB 1NK6A 4M3XA 2F8SA 3TR8A 1LWCA 3AVLA 3DOLA 1Q8IA 3SUNA 4IDKA 4CGHA 3K2PA 1BISA 4I7FA 4RW9A 1D9DA 3KK3A 3HL8A 3NHGA 3PO5A 3HVTA 1R0AA 1NJXA 5CYQA 2HHXA 1S6QA 4BDYA 1S1WA 3VQCA 4FZYA 3HT3A 3VQPA 1DLOA 3AO1A 4B9NA 1RBUA 3S3OA 1KRPA 3SZ2A 1C0TA 4MFBA 1XHZA 2OYQA 2HVHA 3SQ4A 2OPPA 3C95A 3P83D 4KAZA 1HJRA 3NF7A 3RMCA 1WSFA 3LPUA 2KTQA 2IS3A 3PO4A 4IBNA 1QSYA 1QS4A 3SUOA 4MQ3A 4KHNA 2WOMA 1T7PA 1WN7A 3AVJA 3HPHA 3IRXA 3LAKA 4JS4A 1TAQA 1ZYQA 2HHSA 3IAYA 1RBVA 3LDSA 3DLEA 2P5GA 3AVBA 4OGEA 2OZMA 1WNSA 4KI6A 5CZ2A 2HHVA 3LZIA 4DSFA 4FYDA 3TWHA 1X1PA 2DFHA 3OYIA 4CHNA 4N56A 3T3FA 3MXIA 1VSFA 4CCHA 4K8ZA 1VRTA 4FJ8A 3NFAA 4CJSA 2O4IA 4PUOA 1HNVA 3P5JA 4DLEA 3SQ0A 3ZT1A 3S9HA 4DLGA 4HTUA 3KD1E 4LSLA 2G8IA 1S1VA 4W5QA 3BGRA 4CJLA 5C25A 2HHTA 1J9AA 4FJHA 4CJPA 3KIOA 2QKBA 3ZSOA 5J2NA 1RDBA 3KLFA 3VQ9A 4CJKA 2KW4A 1VSIA 4CJTA 3EYZA 5CZ1A 4CJQA 4NCAA 1RBSA 3QNOA 1D8YA 2FBXA 3AVHA 2YKNA 3LWMA 4CJEA 3K5LA 3NGZA 1LAVA 1GOCA 4C8NA 4RG8A 4M3YA 2RPIA 1UA1A 2FBTA 4C8MA 3K59A 1VK0A 3NGYA 3KKRA 1J5OA 3U3GA 4W5TA 2XO7A 3NE6A 3FFIA 4M41A 2YHBA 2BANA 4O0IA 1RDAA 5SWMA 4FLUA 3I0RA 2VWKA 3KKSA 1HYSA 4IFVA 3ALYA 2QXFA 1HNIA 3AO4A 3QINA 4LH4A 1JLBA 4KFBA 1WSEA 4E3SA 1FKOA 3UIQA 3O3HA 4NYNA 1KVBA 3ZSQA 4CJFA 4YNQA 3RR8A 1HQUA 1S9GA 4AHCA 1ZBIA 4PA1A 1TL3A 3VA0A 3PX0A 1TK0A 3ULDA 3PX4A 3HSTB 4KREA 4AHTA 2XY6A 1T8EA 1QQCA 1CZBA 1UAXA 4AHUA 4J2BA 4FLVA 1C0UA 1VSEA 3O3FA 4ID5A 1QE1A 4LY7A 4UQGA 1LW0A 3K5NA 3WNFA 3DRSA 4KHYA 4DFKA 3AA5X 1IKYA 1RBRA 3OYDA 1HQEA 1NKEA 1NKCA 1S1XA 3LP3A 4DSJA 3AA4A 4OKKA 3CYMA 4F3OA 3SV3A 1WSIA 4ELVA 1RT4A 1TV6A 1WLJA 4E0DA 1IKVA 3ZSZA 1L3UA 3ZT4A 1SKWA 2HW3A 1IKWA 4FVMA 4CK1A 3TAFA 3AO2A 2P5OA 3OYLA 3RWUA 1RILA 5HRPA 2KZMA 2E6MA 3AA3A 1BHLA 3L3VA 4I2PA 2PZSA 4FW1A 3ZSWA 4AILC 3U6FA 1KFSA 3HJFA 3S3NA 2ZD1A 4CIEA 4LH5A 4CGFA 4CK3A 5FRMA 2Q3SA 1CXUA 2EX3A 2X6SA 4FLYA 3L8BA 4O0JA 4DG1A 4CHQA 1I3AA 2Z1HA 4DQPA 3D45A 3RMAA 2B5JA 3DOKA 4QOZB 4Z4CA 4CF0A 3NH1A 2E6LA 4FZXC 4Z4GA 4FM0A 3V6DA 1WSJA 4KI4A 5HBMA 2OPSA 3AVMA 3KLIA 3TAPA 4M42A 3V1QA 1NK5A 4CHZA 4NCBA 1JLEA 3HVRA 2JGUA 1FXXA 3VQ6A 3OJSA 1ZBUA 1SL1A 1DTQA 4DTXA 1L5UA 4FW2A 1L3TA 4E7LA 4ZTFA 2HNYA 4BDZA 3K57A 1JXBA 2D0BA 4E7IA 3ZSVA 3VA3A 3NAEA 1XC9A 2Z1JA 2XY5A 3K5MA 1S1UA 1CXQA 3ISNC 3MEDA 3DLGA 4AH9A 4EP5A 5J1EA 2RF2A 3VN5A 3I0SA 4E7HA 1VSLA 2OPQA 4FZZA 3L2VA 3WNGA 5J2PA 3V9UA 1NK9A 3VQ7A 4Q0BA 4CJ3A 1K6YA 2XY8A 3S3MA 1JKHA 3DRPA 3EY1A 4C8OA 1NK7A 4FJKA 4WE1A 3CFPA 3KD5E 4CHYA 1A5XA 3ZT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HP9 A;  3SNN A;  2W42 A;  4ID1 A;  5EU7 A;  5FRN A;  3KLG A;  1VSM A;  1KSP A;  2G8W A;  1JLF A;  4EZ6 A;  1Q9Y A;  1ZBH A;  4N76 A;  5KRT A;  1EKE A;  1XHX A;  2IC3 A;  3G10 A;  1Z26 A;  3MAQ A;  1TGO A;  2LSN A;  1NK8 A;  2F8T A;  3MEG A;  1IKX A;  3VQE A;  2DY4 A;  4M3Z A;  4BE1 A;  4F4K A;  3LAN A;  1S9E A;  5KGX A;  1YTU A;  5JS2 A;  4DFP A;  1NK0 A;  3ITH A;  4N5S A;  4C8L A;  1BIU A;  1BCO A;  3F73 A;  1W9H A;  4Z4F A;  1HPZ A;  1Z25 A;  4CER A;  2Z1G A;  2A1R A;  3C94 A;  1JLC A;  4F3T A;  3OYM A;  1W0H A;  1KVC A;  3ZT2 A;  5FRO A;  4DFM A;  2FBV A;  4K8X A;  4W5R A;  3CQ8 A;  4DU1 A;  3KJV A;  4CEQ A;  3DLB A;  2G8V A;  5I3U A;  2RKI A;  3MXM A;  1IO2 A;  3QLH A;  4B9L A;  4FJ5 A;  1HMV A;  1BIZ A;  3JYT A;  2WON A;  2BDP A;  1U47 A;  3HPG A;  4HUF A;  1ZBL A;  4CFD A;  4FK0 A;  3HXM A;  4I2Q A;  3OYH A;  4IG3 A;  3EZ5 A;  3V81 A;  4FLT A;  3NCI A;  2GV9 A;  1RNH A;  1C1A A;  1KVA A;  2KZZ A;  3THV A;  2BGG A;  1KLN A;  1L3S A;  2YNG A;  4BAC A;  5HRO A;  3RRH A;  2YHA A;  2AJQ A;  1T03 A;  4BE0 A;  4BWM A;  4KO0 A;  4FJX A;  4E7K A;  1DTT A;  1YT3 A;  4CJ4 A;  1TL1 A;  3U3Y A;  2ZQB A;  5KI6 A;  1D5A A;  3V1O A;  2YKM A;  4HHT A;  4CFA A;  4CF9 A;  3RMD A;  3SYZ A;  1MU2 A;  4NCG A;  3TAE A;  4Z4H A;  3AA2 A;  2I5J A;  3TAQ A;  3M8Q A;  4CJW A;  3KLH A;  2FBY A;  2HHQ A;  3OVN A;  1EP4 A;  1HYZ A;  1BI4 A;  4E1N A;  1NJW A;  1T05 A;  4B9S A;  2HVI A;  2G8K A;  4B8A B;  4E7J A;  1FK9 A;  3VQQ A;  5C24 A;  4KKO A;  3AVI A;  1CLQ A;  5J2M A;  3RR7 A;  1BQN A;  3CM6 A;  3QEP A;  5JS1 A;  3AVF A;  5CYM A;  3SUQ A;  2Y1I A;  3VQB A;  4CJ5 A;  4KHU A;  4M3U A;  3SUP A;  1XI1 A;  1ITG A;  1B9F A;  3V9W A;  3F9K A;  3NF8 A;  4LD0 A;  1NJZ A;  4FK2 A;  4IG0 A;  3NH2 A;  2RN2 A;  5I42 A;  1ZBF A;  1IG9 A;  3QEX A;  4ELT A;  3WNE A;  3M8P A;  3HK2 A;  4CED A;  3OJU A;  3VQD A;  1I39 A;  1LV5 A;  3AVN A;  4IKF A;  4DQR A;  4C8K A;  5J2Q A;  4FJI A;  1B9D A;  1N6Q A;  1TK8 A;  2B4J A;  2GUI A;  2DTU A;  3ZSR A;  1ASW A;  3VQ8 A;  1QSS A;  4H4O A;  1U49 A;  4O55 A;  4AHV A;  4Q5V A;  4EP4 A;  3M8S A;  2VWJ A;  3OY9 A;  1JLG A;  4J2A A;  3SPZ A;  4OKJ A;  4B8C A;  1X9M A;  4FLW A;  1BI4 B;  4HCB A;  4DSE A;  5CY4 A;  4DTJ A;  1WAJ A;  4DU3 A;  3L2U A;  4OKE A;  3OYE A;  2X6N A;  3KLE A;  2HHW A;  1LWE A;  1HRH A;  1TKZ A;  3CG7 A;  3D0P A;  2O4G A;  5KGW A;  2YNF A;  2OPR A;  4KB1 A;  2Y1J A;  3QEV A;  2BE2 A;  4CGD A;  4DFJ A;  4BDP A;  5D3G A;  3T19 A;  4JRP A;  2DFE A;  2B6A A;  3O4N A;  4DS5 A;  4BWJ A;  3AO3 A;  3PV8 A;  1VSK A;  4ELU A;  4DSI A;  4YFU A;  4GW6 A;  2VG7 A;  1WSG A;  3K5O A;  3LWL A;  1SKR A;  3T1A A;  4DF4 A;  3IG1 A;  4B08 A;  1U4B A;  1NJY A;  4KHS A;  3VQ5 A;  3VQA A;  4Y1C A;  4Z4E A;  1SUQ A;  4G1Q A;  4CEF A;  5HRS A;  2X74 A;  3G0Z A;  4FJN A;  3LZJ A;  4FLX A;  1UWB A;  3CFR A;  4DQQ A;  1JL2 A;  2D5R A;  3RTV A;  2XY7 A;  1L3V A;  4O4G A;  1Q9X A;  1JXE A;  3IS9 A;  3JSM A;  1NOY A;  4OLA A;  1KLM A;  4OLB A;  4CIG A;  3LP0 A;  5DK5 A;  3CFO A;  3OYK A;  4CEC A;  3V4I A;  4FJL A;  1YTA A;  4FK4 A;  3M8R A;  1C1B A;  4B9U A;  2JLE A;  4RW8 A;  1B92 A;  4R5P A;  3TI0 A;  1J54 A;  2HND A;  4HUG A;  2IDO A;  4RW4 A;  1FKP A;  3NBP A;  4CEO A;  1RT6 A;  2EHG A;  1REV A;  4CIF A;  4JRQ A;  2QKK A;  4OVL A;  4ZHR A;  1RT1 A;  4H4M A;  4ICL A;  1TAU A;  4FJ9 A;  4I9L A;  4RW7 A;  3QIO A;  4DS4 A;  4M45 A;  2G8F A;  3DMJ A;  3NF9 A;  3WNH A;  3K58 A;  4QCL A;  3AV9 A;  4KPY A;  4EZ9 A;  3RRG A;  3LP2 A;  4M3T A;  4OPJ A;  4AHS A;  3LPT A;  3OYC A;  4J2E A;  4FLZ A;  1U48 A;  1UOC A;  1IH7 A;  3V9Z A;  4DWI A;  1QSL A;  1F21 A;  1RTH A;  3OS1 A;  1CZ9 A;  4KTZ A;  3L3U A;  1A5V A;  3DI6 A;  3ASM A;  3PY8 A;  1SV5 A;  4E89 A;  5KRS A;  2PYL A;  3QO9 A;  4J2D A;  3ZSX A;  1QHT A;  3MEC A;  4B9T A;  4KB0 A;  2G8H A;  1LW2 A;  3ZSY A;  3RMB A;  3C6T A;  5T7B A;  3OS0 A;  4OGC A;  3TAN A;  4B3O A;  4DTO A;  3VQ4 A;  1TVR A;  2E4L A;  4CFB A;  3DRR A;  1RT5 A;  3SJJ A;  2A1S A;  4CJV A;  1JLQ A;  1BGX T;  3TAB A;  1TKT A;  1VSD A;  1RBT A;  5HP1 A;  3V1R A;  4CHO A;  3SCX A;  3OYG A;  4FXD A;  4B9V A;  1U45 A;  4W5N A;  2D0A A;  3ZCM A;  3L2W A;  2HNZ A;  3QES A;  1RT7 A;  4DMN A;  4FJ7 A;  1TK5 A;  3OYB A;  3E01 A;  2OZS A;  4CHP A;  4N41 A;  5DMR A;  2PY5 A;  3QEI A;  4F8R A;  1NOZ A;  4CFC A;  3OYA A;  2ETJ A;  4ZTJ A;  2ITG A;  3C6U A;  4GMJ B;  2IAJ A;  4CEB A;  2XHB A;  3QEW A;  1C0M A;  3SI6 A;  4B9M A;  3PX6 A;  1VRU A;  3LAL A;  3SQ2 A;  3DYA A;  2Z1I A;  1A5W A;  2YNH A;  2G8U A;  4FJJ A;  4FCY A;  5SZT A;  4CEA A;  2X78 A;  4CGI A;  4DTP A;  2HHU A;  4KTQ A;  3TAM A;  4NYF A;  3P1G A;  4E1M A;  3ZT0 A;  4DSK A;  3SQ1 A;  3A2F A;  1YVU A;  2ATQ A;  4DSL A;  3DLH A;  3AVA A;  4HVJ A;  1Y97 A;  1RDC A;  2KFN A;  1U04 A;  1NK4 A;  1RCH A;  2IOC A;  4N47 A;  2ZE2 A;  4OJR A;  1XWL A;  1TKX A;  1S6P A;  4LSN A;  4CF8 A;  4JLH A;  4CEE A;  3MEE A;  3OS2 A;  3L2Q A;  4DTR A;  3SPY A;  1X9W A;  1N5Y A;  3KTQ A;  4DQI A;  5K14 A;  1UA0 A;  3B6O A;  2VG6 A;  1JLA A;  1J53 A;  4W5O A;  1LAW A;  1EET A;  3HP6 A;  1NKB A;  2PYJ A;  4AHR A;  3HM9 A;  4O5B A;  2IGI A;  3QNN A;  1S1T A;  4FM1 A;  3HYF A;  2FC0 A;  3B6P A;  3LAM A;  2HB5 A;  3OYN A;  1VSJ A;  4CF1 A;  1X9S A;  3DM2 A;  4H8K A;  3OYJ A;  1SKS A;  4CJR A;  3KK1 A;  1ASU A;  4QAG A;  4PQU A;  4CGJ A;  3BDP A;  1GOB A;  2P1J A;  1KTQ A;  1RTJ A;  3V9X A;  1EXQ A;  4KHW A;  4F2S A;  1TKD A;  1LWF A;  1EX4 A;  3NH0 A;  1KFD A;  1RT3 A;  4Z4I A;  4CGG A;  5HRN A;  3SV4 A;  3QER A;  3AVK A;  1HYV A;  4HUE A;  4DQS A;  2QK9 A;  4FJG A;  3OYF A;  2KFZ A;  4KRF A;  1RDD A;  4CJU A;  5E41 A;  4PY5 A;  4CF2 A;  1KCF A;  2KQ2 A;  4Y1D A;  4KHQ A;  1O1W A;  3HPO A;  1SL0 A;  4CE9 A;  3O3G A;  4HCC A;  3L2R A;  3QIP A;  3H08 A;  5KTQ A;  1C1C A;  4CEZ A;  3NF6 A;  1GOA A;  3AO5 A;  1VSH A;  3TAR A;  2NUB A;  3MXJ A;  1RT2 A;  1ASV A;  3DLK A;  4BE2 A;  3CM5 A;  4GVM A;  3O4Q A;  1RTD A;  1WAF A;  2DFF A;  4DTM A;  4KTW A;  4KV8 A;  4O44 A;  1JL1 A;  2F96 A;  4TSX A;  4JS5 A;  3V9S A;  4DTS A;  1D9F A;  1BCM A;  1WSH A;  4DTU A;  2VG5 A;  3QET A;  1G15 A;  4RW6 A;  3AVG A;  3LP1 A;  4DF8 A;  2OA8 A;  4PWD A;  4FM2 A;  3TAG A;  1SL2 A;  3HO1 A;  4DU4 A;  2R7Y A;  2D0C A;  1BL3 A;  4E19 A;  2HMI A;  2XRI A;  4CES A;  3NGI A;  3DLR A;  4I9Q A;  2YNI A;  2P51 A;  1QTM A;  3I8D A;  4M3W A;  2GBZ A;  4CK2 A;  5C42 A;  4F2R A;  4FJM A;  3AVC A;  1BQM A;  1RTI A;  5FDL A;  5HRR A;  4IFY A;  4OPK A;  4M3R A;  1S5J A;  5HLF A;  3KK2 A;  1C6V A;  4Z0U A;  3NDK A;  4DTN A;  2YV0 X;  3PUF A;  4XIU A;  4L8R B;  1NK6 A;  4M3X A;  2F8S A;  3TR8 A;  1LWC A;  3AVL A;  3DOL A;  1Q8I A;  3SUN A;  4IDK A;  4CGH A;  3K2P A;  1BIS A;  4I7F A;  4RW9 A;  1D9D A;  3KK3 A;  3HL8 A;  3NHG A;  3PO5 A;  3HVT A;  1R0A A;  1NJX A;  5CYQ A;  2HHX A;  1S6Q A;  4BDY A;  1S1W A;  3VQC A;  4FZY A;  3HT3 A;  3VQP A;  1DLO A;  3AO1 A;  4B9N A;  1RBU A;  3S3O A;  1KRP A;  3SZ2 A;  1C0T A;  4MFB A;  1XHZ A;  2OYQ A;  2HVH A;  3SQ4 A;  2OPP A;  3C95 A;  3P83 D;  4KAZ A;  1HJR A;  3NF7 A;  3RMC A;  1WSF A;  3LPU A;  2KTQ A;  2IS3 A;  3PO4 A;  4IBN A;  1QSY A;  1QS4 A;  3SUO A;  4MQ3 A;  4KHN A;  2WOM A;  1T7P A;  1WN7 A;  3AVJ A;  3HPH A;  3IRX A;  3LAK A;  4JS4 A;  1TAQ A;  1ZYQ A;  2HHS A;  3IAY A;  1RBV A;  3LDS A;  3DLE A;  2P5G A;  3AVB A;  4OGE A;  2OZM A;  1WNS A;  4KI6 A;  5CZ2 A;  2HHV A;  3LZI A;  4DSF A;  4FYD A;  3TWH A;  1X1P A;  2DFH A;  3OYI A;  4CHN A;  4N56 A;  3T3F A;  3MXI A;  1VSF A;  4CCH A;  4K8Z A;  1VRT A;  4FJ8 A;  3NFA A;  4CJS A;  2O4I A;  4PUO A;  1HNV A;  3P5J A;  4DLE A;  3SQ0 A;  3ZT1 A;  3S9H A;  4DLG A;  4HTU A;  3KD1 E;  4LSL A;  2G8I A;  1S1V A;  4W5Q A;  3BGR A;  4CJL A;  5C25 A;  2HHT A;  1J9A A;  4FJH A;  4CJP A;  3KIO A;  2QKB A;  3ZSO A;  5J2N A;  1RDB A;  3KLF A;  3VQ9 A;  4CJK A;  2KW4 A;  1VSI A;  4CJT A;  3EYZ A;  5CZ1 A;  4CJQ A;  4NCA A;  1RBS A;  3QNO A;  1D8Y A;  2FBX A;  3AVH A;  2YKN A;  3LWM A;  4CJE A;  3K5L A;  3NGZ A;  1LAV A;  1GOC A;  4C8N A;  4RG8 A;  4M3Y A;  2RPI A;  1UA1 A;  2FBT A;  4C8M A;  3K59 A;  1VK0 A;  3NGY A;  3KKR A;  1J5O A;  3U3G A;  4W5T A;  2XO7 A;  3NE6 A;  3FFI A;  4M41 A;  2YHB A;  2BAN A;  4O0I A;  1RDA A;  5SWM A;  4FLU A;  3I0R A;  2VWK A;  3KKS A;  1HYS A;  4IFV A;  3ALY A;  2QXF A;  1HNI A;  3AO4 A;  3QIN A;  4LH4 A;  1JLB A;  4KFB A;  1WSE A;  4E3S A;  1FKO A;  3UIQ A;  3O3H A;  4NYN A;  1KVB A;  3ZSQ A;  4CJF A;  4YNQ A;  3RR8 A;  1HQU A;  1S9G A;  4AHC A;  1ZBI A;  4PA1 A;  1TL3 A;  3VA0 A;  3PX0 A;  1TK0 A;  3ULD A;  3PX4 A;  3HST B;  4KRE A;  4AHT A;  2XY6 A;  1T8E A;  1QQC A;  1CZB A;  1UAX A;  4AHU A;  4J2B A;  4FLV A;  1C0U A;  1VSE A;  3O3F A;  4ID5 A;  1QE1 A;  4LY7 A;  4UQG A;  1LW0 A;  3K5N A;  3WNF A;  3DRS A;  4KHY A;  4DFK A;  3AA5 X;  1IKY A;  1RBR A;  3OYD A;  1HQE A;  1NKE A;  1NKC A;  1S1X A;  3LP3 A;  4DSJ A;  3AA4 A;  4OKK A;  3CYM A;  4F3O A;  3SV3 A;  1WSI A;  4ELV A;  1RT4 A;  1TV6 A;  1WLJ A;  4E0D A;  1IKV A;  3ZSZ A;  1L3U A;  3ZT4 A;  1SKW A;  2HW3 A;  1IKW A;  4FVM A;  4CK1 A;  3TAF A;  3AO2 A;  2P5O A;  3OYL A;  3RWU A;  1RIL A;  5HRP A;  2KZM A;  2E6M A;  3AA3 A;  1BHL A;  3L3V A;  4I2P A;  2PZS A;  4FW1 A;  3ZSW A;  4AIL C;  3U6F A;  1KFS A;  3HJF A;  3S3N A;  2ZD1 A;  4CIE A;  4LH5 A;  4CGF A;  4CK3 A;  5FRM A;  2Q3S A;  1CXU A;  2EX3 A;  2X6S A;  4FLY A;  3L8B A;  4O0J A;  4DG1 A;  4CHQ A;  1I3A A;  2Z1H A;  4DQP A;  3D45 A;  3RMA A;  2B5J A;  3DOK A;  4QOZ B;  4Z4C A;  4CF0 A;  3NH1 A;  2E6L A;  4FZX C;  4Z4G A;  4FM0 A;  3V6D A;  1WSJ A;  4KI4 A;  5HBM A;  2OPS A;  3AVM A;  3KLI A;  3TAP A;  4M42 A;  3V1Q A;  1NK5 A;  4CHZ A;  4NCB A;  1JLE A;  3HVR A;  2JGU A;  1FXX A;  3VQ6 A;  3OJS A;  1ZBU A;  1SL1 A;  1DTQ A;  4DTX A;  1L5U A;  4FW2 A;  1L3T A;  4E7L A;  4ZTF A;  2HNY A;  4BDZ A;  3K57 A;  1JXB A;  2D0B A;  4E7I A;  3ZSV A;  3VA3 A;  3NAE A;  1XC9 A;  2Z1J A;  2XY5 A;  3K5M A;  1S1U A;  1CXQ A;  3ISN C;  3MED A;  3DLG A;  4AH9 A;  4EP5 A;  5J1E A;  2RF2 A;  3VN5 A;  3I0S A;  4E7H A;  1VSL A;  2OPQ A;  4FZZ A;  3L2V A;  3WNG A;  5J2P A;  3V9U A;  1NK9 A;  3VQ7 A;  4Q0B A;  4CJ3 A;  1K6Y A;  2XY8 A;  3S3M A;  1JKH A;  3DRP A;  3EY1 A;  4C8O A;  1NK7 A;  4FJK A;  4WE1 A;  3CFP A;  3KD5 E;  4CHY A;  1A5X A;  3ZT3 A; 
#chains in the Genus database with same CATH topology
 1HKB A;  2EWS A;  1NGC A;  4ID1 A;  1QZ5 A;  1ESV A;  1C0G A;  5AZI A;  1ZBH A;  3UE5 A;  1XHX A;  2H3G X;  3MAQ A;  1TGO A;  2P9K A;  2CH5 A;  3MEG A;  4JKB A;  3ZET A;  1YTU A;  5KGX A;  5JS2 A;  4GKK K;  2GWJ A;  1BIU A;  4FWR A;  1W9H A;  4WQ5 A;  2A1R A;  2Z1G A;  3C94 A;  4RTF D;  1BWF O;  1T3V A;  1KVC A;  1W0H A;  4DU1 A;  4B1U B;  1YJW N;  2CGK A;  4H0V B;  3QLH A;  4JI8 K;  1HMV A;  2BDP A;  1U47 A;  1NGH A;  4LF7 K;  4JK8 A;  4I2Q A;  4CZH A;  2IVP A;  3V81 A;  3MN5 A;  3OW2 M;  1KVA A;  3THV A;  2NRT A;  2BGG A;  1L3S A;  3VER A;  4A2A A;  3CPW M;  2O8E B;  4BE0 A;  4FJX A;  1DTT A;  5EXW A;  5IT9 O;  1JJ2 M;  4LF9 K;  3V1O A;  2YKM A;  4LF8 K;  4BRE A;  4CF9 A;  3M8Q A;  4B9Q A;  1RDU A;  3OVN A;  4OX9 K;  1EP4 A;  1HYZ A;  3R9P A;  4JKF A;  1NJW A;  1T05 A;  2HVI A;  4H0O A;  3NMU A;  3VQQ A;  2IVO A;  3PLA A;  4KKO A;  3VEV A;  1ZC6 A;  3DWL A;  3I33 A;  3VEZ A;  4CZL A;  4BRD A;  2HHH K;  1ITG A;  3H46 O;  3V9W A;  3F9K A;  4LD0 A;  4FK2 A;  5I42 A;  3NH2 A;  2RN2 A;  5M1O A;  1RGI A;  3FGU A;  4O5F A;  3KZB A;  3HK2 A;  2PAV A;  4CED A;  1OH8 A;  4FSV A;  4GV3 A;  4DV4 K;  4JD2 B;  5J2Q A;  1TK8 A;  2GUI A;  1ASW A;  3OHR A;  1U49 A;  2VWJ A;  1DEJ A;  3HOT A;  2YJF A;  1X9M A;  2GEL A;  4HCB A;  5CY4 A;  4BRM A;  4BRG A;  1VHX A;  3E9L A;  3DXK B;  2AA4 A;  3HBT A;  3D0P A;  1X3N A;  4BR5 A;  2YNF A;  2JWL A;  2Y1J A;  2GEM A;  2HBM A;  3T19 A;  4H0T B;  3E9O A;  4JRP A;  1KAZ A;  4DS5 A;  4ELU A;  4DSI A;  1VSK A;  4YFU A;  3K9J A;  2AP1 A;  4WQ4 C;  4DF4 A;  3IG1 A;  4KHS A;  1ZXO A;  1JCG A;  1GLD G;  1SZ2 A;  4CEF A;  5IWA K;  3C65 A;  4DQQ A;  4BC4 A;  1JL2 A;  1L3V A;  4FWP A;  2CH6 A;  4OLB A;  3DXM B;  4CIG A;  3CFO A;  4CEC A;  3D7E O;  2JLE A;  4IEE A;  1HLU A;  1NLV A;  4R5P A;  4CBX A;  3VEO A;  4HUG A;  4JRQ A;  4IWV A;  1U6Z A;  4ZHR A;  4RW7 A;  5BPL A;  4KPY A;  3N4P A;  4H03 B;  4BY9 C;  4CZJ A;  3OYC A;  1IH7 A;  2VWB A;  4DWI A;  2NNW A;  1RTH A;  3THY A;  3ASM A;  3PY8 A;  2E2N A;  3ZSX A;  1QHT A;  1OVQ A;  3FZH A;  4MLE A;  3SJJ A;  3H1V X;  5CR4 A;  4CJV A;  5GAH P;  1BGX T;  3TAB A;  5AZI B;  1VSD A;  3SCX A;  3OYG A;  2YHY A;  3QDK A;  4B9V A;  2P9K B;  2FF6 A;  1KAX A;  3E66 A;  3L2W A;  4FJ7 A;  4CHP A;  5DMR A;  2PY5 A;  2NRW A;  3OYA A;  2ETJ A;  2ITG A;  2XHB A;  2IAJ A;  3QEW A;  4DCH A;  3SI6 A;  3I8B A;  1GLJ O;  1VRU A;  2WFB A;  3DYA A;  2YNH A;  5SZT A;  3OA9 A;  3T69 A;  4YOX A;  4H5T A;  4J2B A;  1HUX A;  5AQQ A;  3A2F A;  4DSL A;  2GTD A;  3AVA A;  4OJR A;  3CCE N;  1TKX A;  2CGL A;  4LSN A;  1X9W A;  2VQE K;  1NM1 A;  5EX5 A;  1J5E K;  3WXL A;  1N32 K;  1EET A;  3HP6 A;  1NKB A;  2NRZ A;  4O5B A;  2IGI A;  4FM1 A;  2FC0 A;  3LAM A;  2HB5 A;  3OYN A;  2GWK A;  1VSJ A;  2VYP A;  3OYJ A;  5AZJ A;  1S22 A;  4FWS A;  3LDL A;  3GBT A;  3TSQ A;  2P1J A;  4DR3 K;  3ATU A;  1E4G T;  1EX4 A;  1KFD A;  1P90 A;  1RT3 A;  4AM6 A;  3AVK A;  1HYV A;  4FJG A;  3ZX3 A;  4DUY K;  1KCF A;  4Y1D A;  4CE9 A;  3IFR A;  3QIP A;  3H08 A;  3VET A;  1C1C A;  4ILH A;  1GOA A;  3AO5 A;  4A62 A;  3TAR A;  1RT2 A;  4BRQ A;  2Q36 A;  3CM5 A;  5C2F A;  2F96 A;  4JS5 A;  1D9F A;  5AQN A;  3B8A X;  3W0L A;  5BRH A;  4BGA A;  1NGD A;  3DLR A;  3J7Z O;  2P51 A;  3I8D A;  4DV1 K;  4NLC A;  2GBZ A;  1SAZ A;  4M3W A;  4FJM A;  3AVC A;  1RTI A;  5HRR A;  2G8H A;  3KK2 A;  1C6V A;  1EWR A;  4Z0U A;  4PKG A;  3NDK A;  1QQO A;  4DKW A;  4L8R B;  5DM6 L;  2YJE A;  4IDK A;  1BIS A;  1R0A A;  2HST A;  1S1W A;  2ZF5 O;  3VQC A;  4DHY A;  1RBU A;  1HKC A;  3SZ2 A;  1C0T A;  2P9U A;  2OPP A;  1ILY A;  2V7Y A;  3P83 D;  4KAZ A;  1HJR A;  3NF7 A;  3RMC A;  2O8D A;  2KTQ A;  2IS3 A;  1QSY A;  2P9S B;  4JI0 K;  3SUO A;  4KHN A;  2WOM A;  3HPH A;  3AVJ A;  3PSF A;  1DGK N;  2ZJR L;  2HHV A;  1WNS A;  3VES A;  1NJI O;  3WUH A;  3ZEU A;  4CCH A;  4K8Z A;  1HYS A;  4KBO A;  1HNV A;  3SQ0 A;  3L4I A;  4FO0 A;  1QZ6 A;  4HTU A;  1OH7 A;  2G8I A;  3P4I A;  4CJL A;  1J9A A;  4FJH A;  3KIO A;  4A5B A;  5J2N A;  3A8Y A;  4YDU A;  4K25 A;  4CJT A;  3EYZ A;  4IOA L;  3VTI A;  4CJQ A;  4IEI A;  3AVH A;  4CJE A;  3P39 A;  4C8N A;  5CE3 A;  2RPI A;  2O8B B;  2QM1 A;  5ADX H;  1VK0 A;  3NGY A;  5GIO A;  3U3G A;  4W5T A;  1SQK A;  3SBT A;  2XO7 A;  4M41 A;  2YHB A;  2BAN A;  1RDA A;  3AGK A;  1IBL K;  2NRH A;  2W6L A;  3ALY A;  4CZF A;  3TTC A;  5TKY A;  3O3H A;  4BG8 A;  1HQU A;  1OKJ A;  4DV3 K;  3A5O C;  2D4W A;  1C0U A;  3O3F A;  3GDQ A;  3WNF A;  5M1Q A;  4DFK A;  3AA5 X;  1IKY A;  3VF6 A;  1S1X A;  1EO1 A;  4JKC A;  4JKD A;  4DR4 K;  1WLJ A;  3ZSZ A;  2HW3 A;  1IKW A;  2VQF K;  1JCE A;  1NBW A;  3HOS A;  2KZM A;  3AA3 A;  1BHL A;  3L3V A;  2PZS A;  3O9Q A;  2UXB K;  2W41 A;  3K0S A;  2E1Z A;  3S3N A;  5AQT A;  3L4Q A;  1NGI A;  5AZJ B;  3G71 N;  5E26 A;  4DG1 A;  4HWI A;  5AQP A;  3NH1 A;  2E6L A;  3WXJ A;  1K9M O;  2ZJQ L;  3W3D A;  1GLF O;  4FM0 A;  4Z4G A;  1X9J A;  5C10 A;  4CHZ A;  4NCB A;  3HVR A;  3D2E A;  2YCH A;  1ZBU A;  3SAF A;  1DTQ A;  1L3T A;  4BDZ A;  1YVN A;  2RHK A;  1JXB A;  4E7I A;  1GLB G;  3ZSV A;  5AQR A;  3VA3 A;  3GL1 A;  4YY3 K;  2XY5 A;  4PKH A;  1S1U A;  3SAH A;  2UU9 K;  5J1E A;  2RF2 A;  1VSL A;  5AQK A;  3VQ7 A;  1K6Y A;  1WBD A;  1JKH A;  4C8O A;  4K41 A;  3HP9 A;  3CCS N;  4ISG A;  5EU7 A;  1TUY A;  1KSP A;  1JLF A;  4YOR A;  3O9U A;  1ZBS A;  3G10 A;  4A2B A;  4CBW A;  2LSN A;  4CZK A;  3CJ1 A;  3VQE A;  2DY4 A;  3T1Y K;  4F4K A;  2O8E A;  3MDQ A;  1NK0 A;  1KAY A;  4IOC L;  4N5S A;  1IJJ A;  4CZE A;  4Z4F A;  5EVZ A;  3CCU N;  1HPZ A;  2GUP A;  2D0O A;  5FRO A;  2FBV A;  4K8X A;  3KJV A;  4U7B A;  3DLB A;  3JYT A;  3M3Z A;  5F0X A;  2WON A;  2P9U B;  4HUF A;  3PSI A;  3NVM A;  5JIC A;  2GV9 A;  4MDA A;  2KZZ A;  4DV0 K;  2FSN A;  4ILJ A;  4B1Y B;  3UKU B;  4BAC A;  1V4T A;  3RRH A;  4M63 C;  2YHA A;  2AJQ A;  4JI7 K;  3H3N O;  5AQZ A;  3ENO A;  4JD2 A;  4OO1 J;  5M1K A;  4JI5 K;  3CJ7 A;  3TAQ A;  4BRP A;  2FBY A;  4WQ5 C;  4B9S A;  5KPR A;  3QB0 A;  1FK9 A;  3DXK A;  3T7Z A;  1GLC G;  1CLQ A;  1BQN A;  3QEP A;  4H0P A;  3C7N B;  3UB5 A;  4M3U A;  4BRK A;  1XI1 A;  2NLX A;  3U9Z A;  3NF8 A;  1NJZ A;  4IG0 A;  5GIP A;  1IG9 A;  4ELT A;  3WNE A;  3CPE A;  1VQP N;  3M8P A;  3LDN A;  3OJU A;  3VQD A;  1I39 A;  4FJI A;  1B9D A;  2B4J A;  1D4X A;  4BR4 A;  2QWO A;  1QSS A;  4AHV A;  3M8S A;  3HM8 A;  3OY9 A;  4LFA K;  5AQY A;  3SPZ A;  4JKH A;  2QWR A;  3DXM A;  2A40 A;  3L2U A;  2X6N A;  1VQ5 N;  3DJC A;  3A5M C;  1HRH A;  3CG7 A;  3EEQ A;  3OBY A;  2O4G A;  1J6Z A;  2OPR A;  4KB1 A;  2BE2 A;  4DFJ A;  5AR0 A;  4BDP A;  3CC7 N;  2B6A A;  3O4N A;  1VQO N;  2VG7 A;  3WEE B;  1SKR A;  3THX B;  1BA0 A;  1RFQ A;  1QQM A;  4WF9 L;  4EIA A;  4G1Q A;  2JWK A;  5HRS A;  3A5L C;  4PKI A;  3LZJ A;  4FLX A;  4O4G A;  3WQU A;  1JXE A;  3BZC A;  4JAX A;  3OYK A;  1YTA A;  4JHD B;  1B92 A;  4CVN E;  2HND A;  2ITM A;  4CEO A;  2P9P B;  2EHG A;  1REV A;  4JYA K;  2QKK A;  5BN9 A;  4IOX A;  3CC4 N;  3D2E B;  3EZW A;  1RT1 A;  1TAU A;  4I9L A;  4DUZ K;  2A42 A;  4DS4 A;  4QS8 A;  4X62 K;  3K58 A;  1XQS C;  4EZ9 A;  1H1V A;  3RRG A;  3CQY A;  4M3T A;  4OPJ A;  3IKM A;  3U9D A;  4BRO A;  4U67 L;  1SV5 A;  1NGG A;  3D2F A;  2GX9 A;  3ZYY X;  3TAN A;  1XMQ K;  1TVR A;  2E4L A;  4CFB A;  3WXI A;  4MLH A;  3RVC A;  1K8K B;  3CCV N;  5AFU A;  4CHO A;  3E1Y A;  4LFB K;  4FXD A;  4W5N A;  3ZCM A;  2QEX N;  2HNZ A;  3QES A;  1U2V B;  1NGE A;  3OYB A;  3G4S N;  3E01 A;  1XNQ K;  4I6M B;  5AQU A;  4ILG B;  3C6U A;  1YAG A;  1C0M A;  3BF3 A;  3PX6 A;  2Z1I A;  2G8U A;  5EOY A;  2X78 A;  3R8E A;  2YI1 A;  2HHU A;  3LM9 A;  4NYF A;  3P1G A;  4DSK A;  2ATQ A;  4B3R K;  3DLH A;  2UXD K;  1RDC A;  4CI6 A;  1NK4 A;  1RCH A;  3CC2 N;  4N47 A;  2ZE2 A;  5LJV A;  1S6P A;  3SPY A;  1ATS A;  3MN7 A;  2VCP A;  4CEE A;  4DTR A;  3EO3 A;  3B6O A;  4ISF A;  1Q86 O;  3KK7 A;  3CHW A;  5AQG A;  5GAE P;  3QNN A;  1NWK A;  3HYF A;  3O1W A;  1HNW K;  2Q0R A;  4H8K A;  2ZWH A;  3C6A A;  3KK1 A;  1ASU A;  3LDO A;  3R1X A;  4PQU A;  1GOB A;  1KTQ A;  1EXQ A;  1TKD A;  1LWF A;  1YIJ N;  3O8M A;  4Z4I A;  4CGG A;  1Z6R A;  2J4R A;  5HRN A;  3UKR B;  5GIN A;  4DQS A;  2QK9 A;  3CJC A;  5JMV A;  1RDD A;  4KRF A;  1XMO K;  5E41 A;  3OBW A;  4CF2 A;  4B1Z A;  3HPO A;  4CZI A;  4HCC A;  3O3G A;  3NF6 A;  1VSH A;  4BRN A;  1ASV A;  3DLK A;  1HPM A;  3L0Q A;  1RTD A;  4DTM A;  4KV8 A;  1JL1 A;  3HI0 A;  2P9I B;  4DTU A;  3AVG A;  3LP1 A;  4DF8 A;  4IXC A;  2D0C A;  4E19 A;  4I9Q A;  1T6C A;  4CK2 A;  5C42 A;  4F2R A;  3CQX A;  2P9S A;  4IFY A;  5HLF A;  1XNR K;  4DTN A;  1N33 K;  3CCQ N;  1YI2 N;  1NK6 A;  4M3X A;  1EWQ A;  1LWC A;  1Q8I A;  3G6E N;  3SUN A;  4CGH A;  2D0P A;  4I7F A;  5EY4 A;  3MWT A;  3KK3 A;  1NMD A;  3HVT A;  5JVH L;  4FPB A;  2HHX A;  3M5R A;  4FZY A;  3HT3 A;  3AO1 A;  1KC8 O;  2BUP A;  3MK6 A;  2HVH A;  2QI2 A;  1WSF A;  3PO4 A;  1HKG A;  1QS4 A;  4BR2 A;  4MQ3 A;  3CCL N;  4FWL A;  1TAQ A;  1ZYQ A;  2O8B A;  5C0Y A;  2P5G A;  3H45 C;  3CER A;  4OGE A;  5CZ2 A;  3LZI A;  1X1P A;  3OYI A;  3T3F A;  2O4I A;  4PUO A;  3P5J A;  4H5N A;  3S9H A;  4CJ7 A;  4LSL A;  2FLO A;  2QWP A;  4W5Q A;  3RSE A;  2HHT A;  1NGJ A;  4CJP A;  2QKB A;  3ZSO A;  1VQ7 N;  2V52 B;  1RDB A;  1HNZ K;  2FSK A;  2A41 A;  1BG3 A;  2KW4 A;  5CZ1 A;  3EL2 A;  4NCA A;  2YKN A;  5F1X A;  3LWM A;  1VQN N;  3D2F B;  4CZG A;  2QWL A;  1LAV A;  1IG8 A;  4RG8 A;  1YHQ N;  4M3Y A;  4NXN K;  2YHW A;  1UA1 A;  2FBT A;  3CET A;  1M1K O;  5H1S Q;  3LDP A;  3VEW A;  3CME N;  4FLU A;  3I0R A;  2E5L K;  3AO4 A;  4LH4 A;  3ZLJ A;  1WSE A;  3UIQ A;  4J8F A;  4NXM K;  4NYN A;  1S9G A;  1WBB A;  3PX0 A;  3PX4 A;  4KRE A;  4AHT A;  2XY6 A;  3MN6 A;  1CZB A;  4AHU A;  2ZM6 K;  4FLV A;  4ID5 A;  4LY7 A;  3VMF B;  4O8U A;  2D1K A;  5A2Q O;  4YDU C;  2QW9 A;  4DSJ A;  3CYM A;  1W7A A;  3SV3 A;  5BRE A;  1W2B M;  1R59 O;  3QML A;  1TYQ B;  4BR9 A;  3ZT4 A;  2P5O A;  5BPN A;  1RIL A;  4PL8 A;  3HSC A;  5AQI A;  4FW1 A;  1BO5 O;  3U6F A;  4JKA A;  2ZD1 A;  4CK3 A;  4CGF A;  2EX3 A;  2X6S A;  3CCR N;  3MMV A;  5I9E B;  4O0J A;  4CHQ A;  2Z1H A;  5LY3 A;  3FE1 A;  3A0I X;  4QOZ B;  2E20 A;  4OPH A;  4C23 A;  3V6D A;  1WSJ A;  4IZ9 A;  3TAP A;  3V1Q A;  3R3L A;  2BTF A;  3OJS A;  1S72 N;  4DTX A;  4E7L A;  4ZTF A;  3VEY A;  1NU0 A;  2HNY A;  4FPA A;  3K57 A;  2D0B A;  3THW B;  4DV2 K;  2OCE A;  2Z1J A;  3K5M A;  2WBN A;  1CXQ A;  3ISN C;  4AH9 A;  1ATN A;  1VQM N;  3I0S A;  2OPQ A;  3ID6 A;  3L2V A;  4CJ3 A;  3S3M A;  1E4F T;  4CHY A;  1A5X A;  3ZT3 A;  2W42 A;  3CD6 N;  3FZF A;  3SJH A;  5FRN A;  3KLG A;  1VSM A;  3L6Q A;  2G8W A;  4WFB L;  4LF5 K;  4GKJ K;  4EZ6 A;  3TSU A;  5KRT A;  4N76 A;  1EKE A;  4FOE A;  1Z26 A;  4CD3 A;  1NK8 A;  5M1N A;  1IKX A;  3UKU A;  4BE1 A;  3LAN A;  1S9E A;  1Q81 O;  4DFP A;  3ITH A;  1BCO A;  2P9N A;  4PHT X;  1Z25 A;  4IDH A;  3A5N C;  1JLC A;  4F3T A;  3OYM A;  2NZT A;  3WXK A;  5I3U A;  2RKI A;  4FJ5 A;  4B9L A;  4LF4 K;  3O5B A;  3CXC M;  3HXM A;  3C6H A;  1OH6 A;  3OYH A;  4IG3 A;  1GLA G;  3N4Q A;  3NCI A;  2FSJ A;  4RWT A;  1C1A A;  1V4S A;  2E2O A;  1IV0 A;  3C7N A;  3J7Y P;  4KH6 A;  4H5R A;  2YNG A;  4WCE L;  5HRO A;  4DR2 K;  4BRA A;  1T03 A;  4KO0 A;  3MCA B;  1YT3 A;  3O08 A;  1D5A A;  3QIC A;  3RMD A;  3MX5 A;  2V7Z A;  5FPD A;  3AA2 A;  4QS7 A;  2I5J A;  3RSE B;  3SBG A;  4CJW A;  1WOQ A;  5BN8 A;  5C24 A;  5J2M A;  4JI6 K;  1NMN A;  4BRF A;  4BC2 A;  3AVF A;  3BZK A;  5CYM A;  4A59 A;  3SUQ A;  4JK9 A;  3VQB A;  3SUP A;  3PIP L;  1O13 A;  1B9F A;  4BRH A;  3WEE A;  3THX A;  3QEX A;  3CCM N;  1T44 A;  3F2K A;  4C8K A;  4IJN A;  3D6R A;  3KHY A;  4KHP K;  2A3Z A;  2E2Q A;  2DTU A;  3ZSR A;  3S41 A;  3BP8 A;  3C0B A;  3SMP A;  4AM7 A;  4Q5V A;  4EP4 A;  1JLG A;  3VEX A;  4J2A A;  4OKJ A;  1NGF A;  4FLW A;  1BI4 B;  2Q1N A;  4Z94 A;  1VQL N;  4DTJ A;  1WAJ A;  4JHD A;  2E88 A;  4OKE A;  3QBX A;  1T6D A;  1LWE A;  2P9P A;  3QEV A;  3DLL L;  2DFE A;  3PV8 A;  4BG9 A;  4BWJ A;  3K5O A;  1WSG A;  4FWN A;  1KXP A;  3T1A A;  1U4B A;  1P8Z A;  3J7A P;  3VQ5 A;  3VQA A;  4Y1C A;  4Z4E A;  1SUQ A;  3DAW A;  1Q18 A;  4FWQ A;  1VQ4 N;  2X74 A;  3G0Z A;  4E1J A;  3CFR A;  2D5R A;  3RTV A;  5AQL A;  1Q9X A;  2BH1 A;  3JSM A;  1NOY A;  4OLA A;  3LP0 A;  5DK5 A;  3V4I A;  4FK4 A;  4F9O A;  3M8R A;  2W40 A;  2Q97 A;  4RW8 A;  1OH5 A;  1QHA A;  3TI0 A;  3AAR A;  1J54 A;  2IDO A;  1FKP A;  3NBP A;  3GG4 A;  1RT6 A;  3FZL A;  1K8K A;  4OVL A;  4H4M A;  4ICL A;  3BEX A;  3ENB A;  4FJ9 A;  4H0X B;  5GAG P;  4M45 A;  3DMJ A;  3NF9 A;  3WNH A;  1U2V A;  3LP2 A;  3QFP A;  4WFA L;  4I6M A;  3O4W A;  3LPT A;  3AAQ A;  3MCP A;  4J2E A;  3V9Z A;  1QSL A;  1F21 A;  2Q31 A;  1CZ9 A;  4KTZ A;  3EN9 A;  3DI6 A;  3EKS A;  4E89 A;  1VAZ A;  2PYL A;  4J2D A;  5JLF A;  1RDW X;  4CBU A;  4BC5 A;  4KB0 A;  1LW2 A;  3ZSY A;  3C6T A;  5T7B A;  3OS0 A;  3TTD A;  1Z05 A;  4B3O A;  4DTO A;  3SMS A;  3DRR A;  1RT5 A;  2A1S A;  3O6W A;  3R6M A;  1JLQ A;  3TSP A;  1TKT A;  1RBT A;  3V1R A;  4XH4 A;  3HRG A;  5MLC Q;  3J80 O;  2D0A A;  3E9P A;  3OTO K;  4NO7 A;  1TK5 A;  1KD1 O;  2OZS A;  2FXU A;  3H6E A;  2P9N B;  4F8R A;  1NOZ A;  4CFC A;  4ZTJ A;  4GMJ B;  4B9M A;  4CEB A;  4GV9 A;  5BPM A;  4FJJ A;  4CGI A;  4DTP A;  4KTQ A;  3TAM A;  3VGM A;  4E1M A;  3UKR A;  1Q82 O;  1Y97 A;  2KFN A;  1U04 A;  4OPA A;  1XWL A;  4CF8 A;  3OS2 A;  5FPE A;  1N5Y A;  3KTQ A;  5BRD A;  4DQI A;  1UA0 A;  4DR1 K;  2VG6 A;  1JLA A;  3TTF A;  1LAW A;  4LC9 B;  5GAD P;  2A5X A;  4AHR A;  4NLB A;  3AGR A;  3B6P A;  3CMA N;  4FWK A;  4CF1 A;  1X9S A;  3DM2 A;  2P9I A;  3Q7B A;  1GLL O;  3VPZ A;  5FPN A;  1WUA A;  4QAG A;  1RTJ A;  4KHW A;  3NH0 A;  1QQN A;  3F9M A;  3SV4 A;  3QER A;  1XC3 A;  4B3T K;  4BRI A;  2Q2R A;  3OYF A;  2KKZ A;  4CJU A;  4PY5 A;  4BRC A;  4C1N K;  1SL0 A;  4BVP A;  4CEZ A;  3MXJ A;  4BE2 A;  3ZX2 A;  3KVG A;  2DFF A;  4KTW A;  3V9S A;  4TSX A;  5HL7 L;  4DTS A;  5FLX O;  1Q7Y O;  1BCM A;  1WSH A;  3SAG A;  1QVF M;  1G15 A;  4RW6 A;  3O1B A;  4FM2 A;  2KHO A;  5C15 A;  3HO1 A;  2R7Y A;  4XH1 A;  5LMU K;  2HMI A;  2XRI A;  3NGI A;  2HF3 A;  2YNI A;  3BUZ B;  2HBJ A;  1E3M A;  1BQM A;  4OPK A;  1S5J A;  5AQF A;  5AQH A;  3TR8 A;  1OVY A;  3AVL A;  1ATR A;  1DKG D;  3K2P A;  4JNE A;  1D9D A;  2QA4 N;  3NHG A;  5JVG L;  3PO5 A;  1NJX A;  3EE8 A;  1HR0 K;  3CF5 L;  1S6Q A;  3TU5 A;  4BDY A;  3EE9 A;  4DR7 K;  4H0Y B;  2HOE A;  4H5W A;  3VQP A;  1DLO A;  4B9N A;  3S3O A;  1VQK N;  2OYQ A;  1XUP O;  1YJ9 N;  4YOY A;  3GE1 A;  3LPU A;  4IBN A;  1NGA A;  1HX1 A;  3CIP A;  4MO5 A;  1T7P A;  1WN7 A;  4JS4 A;  4YOW A;  1RBV A;  3LDS A;  1MDU B;  3DLE A;  1YIT N;  3AVB A;  4KI6 A;  3FFK B;  4DSF A;  4FYD A;  4KH4 A;  3ULE B;  2DFH A;  1VSF A;  1YUW A;  2E1Y A;  4CJS A;  4DLE A;  1VQ8 N;  2OTL N;  1S1V A;  2NRX A;  3BGR A;  5C25 A;  1X3M A;  4B1X B;  4CZM A;  4JKG B;  4JKE A;  3KLF A;  4CJK A;  1VSI A;  2O8C A;  5AFU H;  4K42 A;  4K43 A;  1D8Y A;  1HJO A;  1BUP A;  3K5L A;  4M7Y A;  4LFC K;  2I7N A;  3VF2 A;  4B1V A;  2I7P A;  1TYQ A;  2E8A A;  3FFI A;  1N34 K;  5SWM A;  3KKS A;  2VWK A;  4IFV A;  1HNI A;  5LJW A;  4E3S A;  1FKO A;  4CJF A;  2ASM A;  4K0K K;  3RR8 A;  1YJN N;  4PA1 A;  3VA0 A;  4GY2 B;  2IIR A;  1T8E A;  1VSE A;  4JN4 A;  4EFH A;  1QE1 A;  4UQG A;  3IUC A;  1LW0 A;  3K5N A;  1RBR A;  3OYD A;  1NKE A;  3VGL A;  1MWK A;  2ZGY A;  1N8R O;  1SS6 A;  4F3O A;  1RT4 A;  4E0D A;  1IKV A;  3KWI A;  5M1F A;  3VEN A;  3THW A;  4FVM A;  4CK1 A;  4L3Q A;  3OYL A;  5HRP A;  4HTL A;  1VQ9 N;  2E6M A;  2PFU A;  4I2P A;  4WFN L;  3ZSW A;  4B3M K;  4FLY A;  5KQ8 A;  1I3A A;  2IVN A;  3D45 A;  5KQD A;  1C0F A;  3WT0 A;  4FZX C;  4KI4 A;  5C12 A;  5HBM A;  2OPS A;  3AVM A;  3G25 A;  1NK5 A;  2OAN A;  2UUC K;  1JLE A;  1FXX A;  1SL1 A;  2O8F B;  1L5U A;  4YOT A;  2NRV A;  3NAE A;  1XC9 A;  3MED A;  4Y0W A;  3VTH A;  4EP5 A;  1LCU A;  5AQM A;  3ZX0 A;  5J2P A;  4H5V A;  1NK9 A;  4Q0B A;  3CI5 A;  2XY8 A;  4R79 A;  3DRP A;  3EY1 A;  3CFP A;  4XH5 A;  5LL6 Z;  3SNN A;  3LL3 A;  1Q9Y A;  5B8H A;  1MWM A;  4GVE A;  2IC3 A;  5E84 A;  2F8T A;  4A61 A;  4M3Z A;  3NVK A;  2RE2 A;  5C2D A;  4C8L A;  5AQV A;  3F73 A;  1MA9 B;  4CER A;  1YF5 L;  3ZT2 A;  4DFM A;  3KWG A;  4ISE A;  4DR5 K;  4W5R A;  3CQ8 A;  4CEQ A;  4BVO A;  2V51 B;  2G8V A;  3MXM A;  1IO2 A;  1BIZ A;  3P31 A;  4GV6 A;  3TPQ A;  3HPG A;  1ZBL A;  4CFD A;  4FK0 A;  4KH5 A;  3EZ5 A;  4FLT A;  1RNH A;  1WB9 A;  1KLN A;  3ZET B;  3CJA A;  3MN9 A;  4BWM A;  4E7K A;  4CJ4 A;  1TL1 A;  3FZK A;  3U3Y A;  4BGB A;  2ZQB A;  5KI6 A;  2YX6 A;  4HHT A;  4CFA A;  1TUU A;  3SYZ A;  1MU2 A;  4NCG A;  3TAE A;  4Z4H A;  3KLH A;  5KPT A;  2HHQ A;  3FLC O;  1BI4 A;  4E1N A;  2G8K A;  4B8A B;  4E7J A;  2O8C B;  1S3X A;  3AVI A;  3AY9 A;  4WQ4 A;  3RR7 A;  3I56 N;  3CM6 A;  2UUA K;  5CHI A;  2Y1I A;  4KHU A;  4CJ5 A;  5F2R A;  1G99 A;  3F5T A;  2HF4 A;  1CZA N;  5FPM A;  4BC3 A;  1JCF A;  1ZBF A;  4CW7 B;  4A5A A;  2QTD A;  3IDH A;  2ZJP L;  4IKF A;  1LV5 A;  3AVN A;  4DQR A;  1VQ6 N;  3PIO L;  1N6Q A;  4IO8 A;  3VQ8 A;  4H4O A;  4LF6 K;  4O55 A;  2WUS A;  2YHX A;  4EHT A;  4B8C A;  4B1W B;  4DSE A;  4C1N I;  4WYB A;  4DU3 A;  3OYE A;  3KLE A;  2HHW A;  1BDG A;  1TKZ A;  3O9S A;  5AJ3 K;  5KGW A;  4CGD A;  4FWM A;  5D3G A;  3M6G A;  3AO3 A;  4GW6 A;  3LWL A;  1FW6 A;  4CD1 A;  4BR7 A;  4B08 A;  3BF1 A;  1NJY A;  4FJN A;  1KQS M;  1UWB A;  4M7X A;  2XY7 A;  2ASO A;  2WTU A;  3IS9 A;  1KLM A;  4FJL A;  1C1B A;  4B9U A;  4YOU A;  4BRL A;  4RW4 A;  3CCJ N;  4CIF A;  3P38 A;  2VGN A;  2FF3 B;  3QIO A;  2G8F A;  3FR0 A;  4QCL A;  3AV9 A;  2F4V K;  4O8K A;  4AHS A;  4JV5 K;  4FLZ A;  1U48 A;  1UOC A;  3OS1 A;  4RCH A;  3L3U A;  1A5V A;  5M1P A;  5KRS A;  3QO9 A;  2CGJ A;  3MEC A;  4B9T A;  3U8X A;  3RMB A;  4JI1 K;  4OGC A;  2ZGZ A;  3VQ4 A;  5AQO A;  3H3O B;  5HP1 A;  1U45 A;  1DT9 A;  3HZ6 A;  4G9Z A;  1BOT O;  1RT7 A;  4DMN A;  4N41 A;  5ADX A;  4UY8 O;  3QEI A;  5TKW A;  3THY B;  3LAL A;  4EAH D;  3SQ2 A;  1A5W A;  4FCY A;  4CEA A;  5HOO A;  4DV7 K;  4X66 K;  3ZT0 A;  3SQ1 A;  3GOI A;  1YVU A;  4BQL A;  4HVJ A;  1HNX K;  4YHH K;  2IOC A;  3BY5 A;  4JLH A;  1K8A O;  3MEE A;  5FRM A;  3L2Q A;  5K14 A;  4JI3 K;  1J53 A;  4W5O A;  2PYJ A;  4X64 K;  3HM9 A;  5AQS A;  1S1T A;  2DPN A;  3I55 N;  3J8A A;  1FJG K;  3QBW A;  1SKS A;  2PBD A;  4CJR A;  3U4L A;  4CGJ A;  3BDP A;  4XEI A;  3V9X A;  2E2P A;  5BR9 A;  4F2S A;  4FOI A;  3ENH A;  4HUE A;  4X65 K;  4FL9 A;  2KFZ A;  5KPZ A;  2KQ2 A;  2P9L A;  4KHQ A;  1O1W A;  3FZM A;  3L2R A;  2NRR A;  5KTQ A;  4IFE A;  4QS9 A;  2F9T A;  5DM7 L;  3O9T A;  2NUB A;  3HTV A;  4GVM A;  3O4Q A;  1WAF A;  4O44 A;  5LMN K;  2QWN A;  2VG5 A;  3QET A;  1LOT B;  2OA8 A;  4PWD A;  1NGB A;  4IJA A;  4JI2 K;  3TAG A;  4DU4 A;  1SL2 A;  4YOV A;  1BL3 A;  3O80 A;  4CES A;  3JXU A;  1QTM A;  4DQ8 A;  5FDL A;  2QWM A;  3VGK A;  2UXC K;  4M3R A;  2YV0 X;  3PUF A;  3EKU A;  1M90 O;  4XIU A;  2QXL A;  2F8S A;  4A57 A;  4EHU A;  3ULE A;  3DOL A;  2OTJ N;  4RW9 A;  4GNI A;  2Q0U A;  1BU6 O;  3HL8 A;  5CYQ A;  3T1H K;  2HMP A;  4PL7 A;  4JKG A;  1KRP A;  1XHZ A;  4MFB A;  3MWP A;  1EQY A;  3SQ4 A;  3C95 A;  2VGM A;  4MO4 A;  3MX2 A;  4DR6 K;  3QFU A;  3IRX A;  3LAK A;  3AAP A;  5AQX A;  3ID8 A;  4IO9 L;  2HHS A;  2F9W A;  3IAY A;  1K73 O;  2OZM A;  3TWH A;  4CHN A;  4N56 A;  4FJ8 A;  5BRF A;  3MXI A;  1VRT A;  3NFA A;  1GLE G;  2ASP A;  3ZT1 A;  4DLG A;  3KD1 E;  2QWQ A;  2F7T A;  3VQ9 A;  1RBS A;  4BQZ A;  3QNO A;  2O8D B;  2HBL A;  2FBX A;  1BA1 A;  3NGZ A;  1GOC A;  3LDQ A;  3J81 O;  3JAM O;  4C8M A;  3K59 A;  1J5O A;  3KKR A;  3NE6 A;  3VF4 A;  3ZEU B;  3K9K A;  4O0I A;  4BR0 A;  4DV5 K;  2KLA A;  2A6A A;  2QXF A;  4DV6 K;  3QIN A;  4MDB A;  1IBM K;  1JLB A;  4KFB A;  5JLH A;  1NNE A;  4YNQ A;  1KVB A;  3ZSQ A;  4V19 S;  4AHC A;  1ZBI A;  1TK0 A;  1TL3 A;  5AQJ A;  3JS6 A;  2UYT A;  3ULD A;  3HST B;  1IBK K;  1QQC A;  4B3S K;  1UAX A;  3SLC A;  3WQT A;  5ELZ A;  4DB3 A;  1N36 K;  3DRS A;  3M1F A;  5AQW A;  4KHY A;  1Y64 A;  1HQE A;  1NKC A;  3LP3 A;  3AA4 A;  4OKK A;  2O8F A;  1WSI A;  3IMX A;  4ELV A;  1TV6 A;  2W6K A;  3LM2 A;  1L3U A;  3VOV A;  1NG9 A;  1SKW A;  3TAF A;  3AO2 A;  3RWU A;  3WXM B;  4JEP A;  4AIL C;  3H1Q A;  1KFS A;  3SK3 A;  3HJF A;  1QVG M;  4CIE A;  4LH5 A;  2Q3S A;  1CXU A;  3L8B A;  4JI4 K;  4JK7 A;  4DQP A;  3RMA A;  2B5J A;  3DOK A;  4Z4C A;  5BR8 K;  4CF0 A;  3KLI A;  4M42 A;  5JS1 A;  2JGU A;  3Q7C A;  3VQ6 A;  1W97 L;  4FW2 A;  3CJB A;  4AQY K;  1I94 K;  2P9L B;  4NB4 A;  4FWO A;  4AF1 A;  3ATV A;  3DLG A;  2UUB K;  3CJ9 A;  4FVU A;  3VN5 A;  4E7H A;  2WC9 A;  4FZZ A;  3WNG A;  3V9U A;  3O9R A;  1NK7 A;  4FJK A;  4WE1 A;  1YXQ A;  3KD5 E;  2HBK A; 
#chains in the Genus database with same CATH homology
 3HP9 A;  3SNN A;  2W42 A;  4ID1 A;  5EU7 A;  5FRN A;  3KLG A;  1VSM A;  1KSP A;  2G8W A;  1JLF A;  4EZ6 A;  1Q9Y A;  1ZBH A;  4N76 A;  5KRT A;  1EKE A;  1XHX A;  2IC3 A;  3G10 A;  1Z26 A;  3MAQ A;  1TGO A;  2LSN A;  1NK8 A;  2F8T A;  3MEG A;  1IKX A;  3VQE A;  2DY4 A;  4M3Z A;  4BE1 A;  4F4K A;  3LAN A;  1S9E A;  5KGX A;  1YTU A;  5JS2 A;  4DFP A;  1NK0 A;  3ITH A;  4N5S A;  4C8L A;  1BIU A;  1BCO A;  3F73 A;  1W9H A;  4Z4F A;  1HPZ A;  1Z25 A;  4CER A;  2Z1G A;  2A1R A;  3C94 A;  1JLC A;  4F3T A;  3OYM A;  1W0H A;  1KVC A;  3ZT2 A;  5FRO A;  4DFM A;  2FBV A;  4K8X A;  4W5R A;  3CQ8 A;  4DU1 A;  3KJV A;  4CEQ A;  3DLB A;  2G8V A;  5I3U A;  2RKI A;  3MXM A;  1IO2 A;  3QLH A;  4B9L A;  4FJ5 A;  1HMV A;  1BIZ A;  3JYT A;  2WON A;  2BDP A;  1U47 A;  3HPG A;  4HUF A;  1ZBL A;  4CFD A;  4FK0 A;  3HXM A;  4I2Q A;  3OYH A;  4IG3 A;  3EZ5 A;  3V81 A;  4FLT A;  3NCI A;  2GV9 A;  1RNH A;  1C1A A;  1KVA A;  2KZZ A;  3THV A;  2BGG A;  1KLN A;  1L3S A;  2YNG A;  4BAC A;  5HRO A;  3RRH A;  2YHA A;  2AJQ A;  1T03 A;  4BE0 A;  4BWM A;  4KO0 A;  4FJX A;  4E7K A;  1DTT A;  1YT3 A;  4CJ4 A;  1TL1 A;  3U3Y A;  2ZQB A;  5KI6 A;  1D5A A;  3V1O A;  2YKM A;  4HHT A;  4CFA A;  4CF9 A;  3RMD A;  3SYZ A;  1MU2 A;  4NCG A;  3TAE A;  4Z4H A;  3AA2 A;  2I5J A;  3TAQ A;  3M8Q A;  4CJW A;  3KLH A;  2FBY A;  2HHQ A;  3OVN A;  1EP4 A;  1HYZ A;  1BI4 A;  4E1N A;  1NJW A;  1T05 A;  4B9S A;  2HVI A;  2G8K A;  4B8A B;  4E7J A;  1FK9 A;  3VQQ A;  5C24 A;  4KKO A;  3AVI A;  1CLQ A;  5J2M A;  3RR7 A;  1BQN A;  3CM6 A;  3QEP A;  5JS1 A;  3AVF A;  5CYM A;  3SUQ A;  2Y1I A;  3VQB A;  4CJ5 A;  4KHU A;  4M3U A;  3SUP A;  1XI1 A;  1ITG A;  1B9F A;  3V9W A;  3F9K A;  3NF8 A;  4LD0 A;  1NJZ A;  4FK2 A;  4IG0 A;  3NH2 A;  2RN2 A;  5I42 A;  1ZBF A;  1IG9 A;  3QEX A;  4ELT A;  3WNE A;  3M8P A;  3HK2 A;  4CED A;  3OJU A;  3VQD A;  1I39 A;  1LV5 A;  3AVN A;  4IKF A;  4DQR A;  4C8K A;  5J2Q A;  4FJI A;  1B9D A;  1N6Q A;  1TK8 A;  2B4J A;  2GUI A;  2DTU A;  3ZSR A;  1ASW A;  3VQ8 A;  1QSS A;  4H4O A;  1U49 A;  4O55 A;  4AHV A;  4Q5V A;  4EP4 A;  3M8S A;  2VWJ A;  3OY9 A;  1JLG A;  4J2A A;  3SPZ A;  4OKJ A;  4B8C A;  1X9M A;  4FLW A;  1BI4 B;  4HCB A;  4DSE A;  5CY4 A;  4DTJ A;  1WAJ A;  4DU3 A;  3L2U A;  4OKE A;  3OYE A;  2X6N A;  3KLE A;  2HHW A;  1LWE A;  1HRH A;  1TKZ A;  3CG7 A;  3D0P A;  2O4G A;  5KGW A;  2YNF A;  2OPR A;  4KB1 A;  2Y1J A;  3QEV A;  2BE2 A;  4CGD A;  4DFJ A;  4BDP A;  5D3G A;  3T19 A;  4JRP A;  2DFE A;  2B6A A;  3O4N A;  4DS5 A;  4BWJ A;  3AO3 A;  3PV8 A;  1VSK A;  4ELU A;  4DSI A;  4YFU A;  4GW6 A;  2VG7 A;  1WSG A;  3K5O A;  3LWL A;  1SKR A;  3T1A A;  4DF4 A;  3IG1 A;  4B08 A;  1U4B A;  1NJY A;  4KHS A;  3VQ5 A;  3VQA A;  4Y1C A;  4Z4E A;  1SUQ A;  4G1Q A;  4CEF A;  5HRS A;  2X74 A;  3G0Z A;  4FJN A;  3LZJ A;  4FLX A;  1UWB A;  3CFR A;  4DQQ A;  1JL2 A;  2D5R A;  3RTV A;  2XY7 A;  1L3V A;  4O4G A;  1Q9X A;  1JXE A;  3IS9 A;  3JSM A;  1NOY A;  4OLA A;  1KLM A;  4OLB A;  4CIG A;  3LP0 A;  5DK5 A;  3CFO A;  3OYK A;  4CEC A;  3V4I A;  4FJL A;  1YTA A;  4FK4 A;  3M8R A;  1C1B A;  4B9U A;  2JLE A;  4RW8 A;  1B92 A;  4R5P A;  3TI0 A;  1J54 A;  2HND A;  4HUG A;  2IDO A;  4RW4 A;  1FKP A;  3NBP A;  4CEO A;  1RT6 A;  2EHG A;  1REV A;  4CIF A;  4JRQ A;  2QKK A;  4OVL A;  4ZHR A;  1RT1 A;  4H4M A;  4ICL A;  1TAU A;  4FJ9 A;  4I9L A;  4RW7 A;  3QIO A;  4DS4 A;  4M45 A;  2G8F A;  3DMJ A;  3NF9 A;  3WNH A;  3K58 A;  4QCL A;  3AV9 A;  4KPY A;  4EZ9 A;  3RRG A;  3LP2 A;  4M3T A;  4OPJ A;  4AHS A;  3LPT A;  3OYC A;  4J2E A;  4FLZ A;  1U48 A;  1UOC A;  1IH7 A;  3V9Z A;  4DWI A;  1QSL A;  1F21 A;  1RTH A;  3OS1 A;  1CZ9 A;  4KTZ A;  3L3U A;  1A5V A;  3DI6 A;  3ASM A;  3PY8 A;  1SV5 A;  4E89 A;  5KRS A;  2PYL A;  3QO9 A;  4J2D A;  3ZSX A;  1QHT A;  3MEC A;  4B9T A;  4KB0 A;  2G8H A;  1LW2 A;  3ZSY A;  3RMB A;  3C6T A;  5T7B A;  3OS0 A;  4OGC A;  3TAN A;  4B3O A;  4DTO A;  3VQ4 A;  1TVR A;  2E4L A;  4CFB A;  3DRR A;  1RT5 A;  3SJJ A;  2A1S A;  4CJV A;  1JLQ A;  1BGX T;  3TAB A;  1TKT A;  1VSD A;  1RBT A;  5HP1 A;  3V1R A;  4CHO A;  3SCX A;  3OYG A;  4FXD A;  4B9V A;  1U45 A;  4W5N A;  2D0A A;  3ZCM A;  3L2W A;  2HNZ A;  3QES A;  1RT7 A;  4DMN A;  4FJ7 A;  1TK5 A;  3OYB A;  3E01 A;  2OZS A;  4CHP A;  4N41 A;  5DMR A;  2PY5 A;  3QEI A;  4F8R A;  1NOZ A;  4CFC A;  3OYA A;  2ETJ A;  4ZTJ A;  2ITG A;  3C6U A;  4GMJ B;  2IAJ A;  4CEB A;  2XHB A;  3QEW A;  1C0M A;  3SI6 A;  4B9M A;  3PX6 A;  1VRU A;  3LAL A;  3SQ2 A;  3DYA A;  2Z1I A;  1A5W A;  2YNH A;  2G8U A;  4FJJ A;  4FCY A;  5SZT A;  4CEA A;  2X78 A;  4CGI A;  4DTP A;  2HHU A;  4KTQ A;  3TAM A;  4NYF A;  3P1G A;  4E1M A;  3ZT0 A;  4DSK A;  3SQ1 A;  3A2F A;  1YVU A;  2ATQ A;  4DSL A;  3DLH A;  3AVA A;  4HVJ A;  1Y97 A;  1RDC A;  2KFN A;  1U04 A;  1NK4 A;  1RCH A;  2IOC A;  4N47 A;  2ZE2 A;  4OJR A;  1XWL A;  1TKX A;  1S6P A;  4LSN A;  4CF8 A;  4JLH A;  4CEE A;  3MEE A;  3OS2 A;  3L2Q A;  4DTR A;  3SPY A;  1X9W A;  1N5Y A;  3KTQ A;  4DQI A;  5K14 A;  1UA0 A;  3B6O A;  2VG6 A;  1JLA A;  1J53 A;  4W5O A;  1LAW A;  1EET A;  3HP6 A;  1NKB A;  2PYJ A;  4AHR A;  3HM9 A;  4O5B A;  2IGI A;  3QNN A;  1S1T A;  4FM1 A;  3HYF A;  2FC0 A;  3B6P A;  3LAM A;  2HB5 A;  3OYN A;  1VSJ A;  4CF1 A;  1X9S A;  3DM2 A;  4H8K A;  3OYJ A;  1SKS A;  4CJR A;  3KK1 A;  1ASU A;  4QAG A;  4PQU A;  4CGJ A;  3BDP A;  1GOB A;  2P1J A;  1KTQ A;  1RTJ A;  3V9X A;  1EXQ A;  4KHW A;  4F2S A;  1TKD A;  1LWF A;  1EX4 A;  3NH0 A;  1KFD A;  1RT3 A;  4Z4I A;  4CGG A;  5HRN A;  3SV4 A;  3QER A;  3AVK A;  1HYV A;  4HUE A;  4DQS A;  2QK9 A;  4FJG A;  3OYF A;  2KFZ A;  4KRF A;  1RDD A;  4CJU A;  5E41 A;  4PY5 A;  4CF2 A;  1KCF A;  2KQ2 A;  4Y1D A;  4KHQ A;  1O1W A;  3HPO A;  1SL0 A;  4CE9 A;  3O3G A;  4HCC A;  3L2R A;  3QIP A;  3H08 A;  5KTQ A;  1C1C A;  4CEZ A;  3NF6 A;  1GOA A;  3AO5 A;  1VSH A;  3TAR A;  2NUB A;  3MXJ A;  1RT2 A;  1ASV A;  3DLK A;  4BE2 A;  3CM5 A;  4GVM A;  3O4Q A;  1RTD A;  1WAF A;  2DFF A;  4DTM A;  4KTW A;  4KV8 A;  4O44 A;  1JL1 A;  2F96 A;  4TSX A;  4JS5 A;  3V9S A;  4DTS A;  1D9F A;  1BCM A;  1WSH A;  4DTU A;  2VG5 A;  3QET A;  1G15 A;  4RW6 A;  3AVG A;  3LP1 A;  4DF8 A;  2OA8 A;  4PWD A;  4FM2 A;  3TAG A;  1SL2 A;  3HO1 A;  4DU4 A;  2R7Y A;  2D0C A;  1BL3 A;  4E19 A;  2HMI A;  2XRI A;  4CES A;  3NGI A;  3DLR A;  4I9Q A;  2YNI A;  2P51 A;  1QTM A;  3I8D A;  4M3W A;  2GBZ A;  4CK2 A;  5C42 A;  4F2R A;  4FJM A;  3AVC A;  1BQM A;  1RTI A;  5FDL A;  5HRR A;  4IFY A;  4OPK A;  4M3R A;  1S5J A;  5HLF A;  3KK2 A;  1C6V A;  4Z0U A;  3NDK A;  4DTN A;  2YV0 X;  3PUF A;  4XIU A;  4L8R B;  1NK6 A;  4M3X A;  2F8S A;  3TR8 A;  1LWC A;  3AVL A;  3DOL A;  1Q8I A;  3SUN A;  4IDK A;  4CGH A;  3K2P A;  1BIS A;  4I7F A;  4RW9 A;  1D9D A;  3KK3 A;  3HL8 A;  3NHG A;  3PO5 A;  3HVT A;  1R0A A;  1NJX A;  5CYQ A;  2HHX A;  1S6Q A;  4BDY A;  1S1W A;  3VQC A;  4FZY A;  3HT3 A;  3VQP A;  1DLO A;  3AO1 A;  4B9N A;  1RBU A;  3S3O A;  1KRP A;  3SZ2 A;  1C0T A;  4MFB A;  1XHZ A;  2OYQ A;  2HVH A;  3SQ4 A;  2OPP A;  3C95 A;  3P83 D;  4KAZ A;  1HJR A;  3NF7 A;  3RMC A;  1WSF A;  3LPU A;  2KTQ A;  2IS3 A;  3PO4 A;  4IBN A;  1QSY A;  1QS4 A;  3SUO A;  4MQ3 A;  4KHN A;  2WOM A;  1T7P A;  1WN7 A;  3AVJ A;  3HPH A;  3IRX A;  3LAK A;  4JS4 A;  1TAQ A;  1ZYQ A;  2HHS A;  3IAY A;  1RBV A;  3LDS A;  3DLE A;  2P5G A;  3AVB A;  4OGE A;  2OZM A;  1WNS A;  4KI6 A;  5CZ2 A;  2HHV A;  3LZI A;  4DSF A;  4FYD A;  3TWH A;  1X1P A;  2DFH A;  3OYI A;  4CHN A;  4N56 A;  3T3F A;  3MXI A;  1VSF A;  4CCH A;  4K8Z A;  1VRT A;  4FJ8 A;  3NFA A;  4CJS A;  2O4I A;  4PUO A;  1HNV A;  3P5J A;  4DLE A;  3SQ0 A;  3ZT1 A;  3S9H A;  4DLG A;  4HTU A;  3KD1 E;  4LSL A;  2G8I A;  1S1V A;  4W5Q A;  3BGR A;  4CJL A;  5C25 A;  2HHT A;  1J9A A;  4FJH A;  4CJP A;  3KIO A;  2QKB A;  3ZSO A;  5J2N A;  1RDB A;  3KLF A;  3VQ9 A;  4CJK A;  2KW4 A;  1VSI A;  4CJT A;  3EYZ A;  5CZ1 A;  4CJQ A;  4NCA A;  1RBS A;  3QNO A;  1D8Y A;  2FBX A;  3AVH A;  2YKN A;  3LWM A;  4CJE A;  3K5L A;  3NGZ A;  1LAV A;  1GOC A;  4C8N A;  4RG8 A;  4M3Y A;  2RPI A;  1UA1 A;  2FBT A;  4C8M A;  3K59 A;  1VK0 A;  3NGY A;  3KKR A;  1J5O A;  3U3G A;  4W5T A;  2XO7 A;  3NE6 A;  3FFI A;  4M41 A;  2YHB A;  2BAN A;  4O0I A;  1RDA A;  5SWM A;  4FLU A;  3I0R A;  2VWK A;  3KKS A;  1HYS A;  4IFV A;  3ALY A;  2QXF A;  1HNI A;  3AO4 A;  3QIN A;  4LH4 A;  1JLB A;  4KFB A;  1WSE A;  4E3S A;  1FKO A;  3UIQ A;  3O3H A;  4NYN A;  1KVB A;  3ZSQ A;  4CJF A;  4YNQ A;  3RR8 A;  1HQU A;  1S9G A;  4AHC A;  1ZBI A;  4PA1 A;  1TL3 A;  3VA0 A;  3PX0 A;  1TK0 A;  3ULD A;  3PX4 A;  3HST B;  4KRE A;  4AHT A;  2XY6 A;  1T8E A;  1QQC A;  1CZB A;  1UAX A;  4AHU A;  4J2B A;  4FLV A;  1C0U A;  1VSE A;  3O3F A;  4ID5 A;  1QE1 A;  4LY7 A;  4UQG A;  1LW0 A;  3K5N A;  3WNF A;  3DRS A;  4KHY A;  4DFK A;  3AA5 X;  1IKY A;  1RBR A;  3OYD A;  1HQE A;  1NKE A;  1NKC A;  1S1X A;  3LP3 A;  4DSJ A;  3AA4 A;  4OKK A;  3CYM A;  4F3O A;  3SV3 A;  1WSI A;  4ELV A;  1RT4 A;  1TV6 A;  1WLJ A;  4E0D A;  1IKV A;  3ZSZ A;  1L3U A;  3ZT4 A;  1SKW A;  2HW3 A;  1IKW A;  4FVM A;  4CK1 A;  3TAF A;  3AO2 A;  2P5O A;  3OYL A;  3RWU A;  1RIL A;  5HRP A;  2KZM A;  2E6M A;  3AA3 A;  1BHL A;  3L3V A;  4I2P A;  2PZS A;  4FW1 A;  3ZSW A;  4AIL C;  3U6F A;  1KFS A;  3HJF A;  3S3N A;  2ZD1 A;  4CIE A;  4LH5 A;  4CGF A;  4CK3 A;  5FRM A;  2Q3S A;  1CXU A;  2EX3 A;  2X6S A;  4FLY A;  3L8B A;  4O0J A;  4DG1 A;  4CHQ A;  1I3A A;  2Z1H A;  4DQP A;  3D45 A;  3RMA A;  2B5J A;  3DOK A;  4QOZ B;  4Z4C A;  4CF0 A;  3NH1 A;  2E6L A;  4FZX C;  4Z4G A;  4FM0 A;  3V6D A;  1WSJ A;  4KI4 A;  5HBM A;  2OPS A;  3AVM A;  3KLI A;  3TAP A;  4M42 A;  3V1Q A;  1NK5 A;  4CHZ A;  4NCB A;  1JLE A;  3HVR A;  2JGU A;  1FXX A;  3VQ6 A;  3OJS A;  1ZBU A;  1SL1 A;  1DTQ A;  4DTX A;  1L5U A;  4FW2 A;  1L3T A;  4E7L A;  4ZTF A;  2HNY A;  4BDZ A;  3K57 A;  1JXB A;  2D0B A;  4E7I A;  3ZSV A;  3VA3 A;  3NAE A;  1XC9 A;  2Z1J A;  2XY5 A;  3K5M A;  1S1U A;  1CXQ A;  3ISN C;  3MED A;  3DLG A;  4AH9 A;  4EP5 A;  5J1E A;  2RF2 A;  3VN5 A;  3I0S A;  4E7H A;  1VSL A;  2OPQ A;  4FZZ A;  3L2V A;  3WNG A;  5J2P A;  3V9U A;  1NK9 A;  3VQ7 A;  4Q0B A;  4CJ3 A;  1K6Y A;  2XY8 A;  3S3M A;  1JKH A;  3DRP A;  3EY1 A;  4C8O A;  1NK7 A;  4FJK A;  4WE1 A;  3CFP A;  3KD5 E;  4CHY A;  1A5X A;  3ZT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...