2FBXA

Wrn exonuclease, mg complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
HSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Werner syndrome helicase
total genus 63
structure length 195
sequence length 195
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbxA00
4KKOA 3C94A 4OKJA 1XHXA 1VSJA 3ZSWA 4CIFA 3F73A 3MXJA 4NCAA 4B3OA 3WNFA 1RILA 3C95A 1RBSA 3EYZA 2VG5A 4W5OA 3RTVA 2E6LA 4E7JA 3K5MA 5J1EA 3PX6A 1NOZA 4ID1A 4CJQA 3L2UA 2VG7A 3ISNC 3B6OA 4CJWA 3CFPA 2G8UA 3PO5A 1YTAA 3UIQA 3P1GA 4CEAA 3T3FA 3L2QA 1S9EA 4OVLA 1HPZA 3HSTB 4IDKA 2G8IA 1TK8A 3KJVA 2PY5A 1YT3A 1NK8A 3OS1A 4KRFA 2P1JA 3LANA 4FJKA 4KHNA 4W5RA 5DK5A 1JLGA 4DSEA 2QKKA 4KB1A 5KRSA 2G8KA 1GOCA 2OPSA 2DTUA 1Z26A 1JKHA 3CG7A 4F4KA 1JLAA 4DTOA 4CJFA 4RW8A 3AVNA 1IO2A 3KLGA 1D8YA 3SQ1A 3SNNA 4KI6A 4LSLA 3VQBA 3LZIA 1G15A 4HHTA 4DTRA 3KD5E 1KFDA 2YKMA 3RMDA 1QSSA 3SUNA 3KTQA 4CF8A 2X6NA 4N41A 4F8RA 4Y1DA 3L2WA 2OYQA 4DLEA 3KKSA 4OLBA 4GVMA 4CJLA 5HBMA 3TAQA 1WSEA 4B9NA 1NJZA 1NKCA 4CJSA 1BCOA 1J54A 1RT7A 1DTTA 3O3FA 4E7LA 1Q9YA 4ELUA 4JS4A 4CJ4A 4KREA 1NK5A 4DQSA 4FW1A 3IG1A 4ZHRA 4BWJA 2P5OA 4CF0A 4FXDA 2JGUA 3DMJA 1RBUA 2VWKA 3AVJA 1QSYA 3AA3A 4FM0A 1QSLA 4PQUA 5JS1A 3DYAA 4M41A 2D0CA 3MEGA 4DU1A 1NJYA 4C8KA 1JXBA 1YVUA 3OYBA 4FLYA 3IAYA 1CXUA 1TAQA 3V4IA 1ASUA 3OY9A 1VSEA 4DG1A 3NGZA 1TK0A 3QERA 1CZBA 3L2VA 2G8VA 2KFNA 3DRRA 4B9SA 4B9TA 4IG0A 2OZMA 1NKBA 4JLHA 1U04A 3DOKA 3V1OA 4Z0UA 1ASVA 4FLZA 3OJUA 3LPTA 4FCYA 3D45A 4HTUA 3NDKA 4DTPA 1KLNA 4ELTA 3NFAA 3LDSA 2A1SA 2D0AA 3ALYA 1CZ9A 3AVMA 5HLFA 3V1QA 1B92A 4L8RB 4HVJA 1KFSA 4E19A 3VQ8A 4FLXA 3SZ2A 1RTIA 3FFIA 4FK2A 4ELVA 1HYSA 3LP3A 4PWDA 1VSLA 4KI4A 3K5NA 1X1PA 3EZ5A 1IKXA 3THVA 4KFBA 1SL2A 4JRPA 3ZT4A 5E41A 4CJPA 3SCXA 3DLHA 1XWLA 4I2PA 4M3YA 4EZ9A 3T1AA 2F8TA 3VA3A 5T7BA 3VQDA 1S1XA 4DTNA 2P5GA 4F2SA 2XY5A 1JLQA 4DS5A 1KVAA 3ZCMA 4IBNA 4CEEA 3HM9A 3RWUA 4EZ6A 2HHVA 1EKEA 4QCLA 2PYLA 3DRSA 1BIZA 5CY4A 3L8BA 1L5UA 1LW0A 4FJHA 2G8FA 1BQMA 1RT6A 1WAFA 2Q3SA 3QEPA 3HYFA 4AH9A 3DI6A 1IH7A 5J2MA 4MQ3A 5K14A 3M8RA 1S6PA 4R5PA 1WSIA 3G0ZA 1ASWA 1VRUA 2ATQA 2HVIA 4BE0A 2RKIA 2X78A 4CE9A 3OYJA 3SJJA 1T03A 4M3TA 1LWCA 3QETA 4FLUA 2Y1JA 3LP1A 4M3UA 1YTUA 3LZJA 3OYMA 3SV4A 1S1TA 3C6TA 2HHQA 2AJQA 4BWMA 4RW4A 2DFHA 1HRHA 3K5OA 3MEDA 1NJWA 3SUQA 1C0UA 1WAJA 1RTHA 1TV6A 3BGRA 3JYTA 1U45A 3LP0A 2PYJA 4NCGA 1D9FA 3ZT0A 4FJJA 1XHZA 1S1UA 3AVHA 1LAVA 3ZSXA 4FJNA 2YHAA 2RN2A 4FLWA 3TWHA 3CM5A 4E3SA 4CIEA 4JRQA 1JLCA 3AA4A 5JS2A 3HPHA 1BI4A 3ZSZA 5C25A 5KTQA 3OYKA 2QK9A 4CHZA 3OS2A 3K58A 4IKFA 2B4JA 1D5AA 1IKWA 1K6YA 4Z4FA 3DLGA 3OYIA 2VWJA 3V81A 3VA0A 1A5XA 1U48A 4KHYA 3VQ9A 4OPJA 3OYLA 3HO1A 4M3ZA 4Z4HA 4CGDA 2QKBA 3JSMA 1TL3A 4KAZA 3AVGA 2BGGA 3I0SA 4HUFA 1RNHA 4DTJA 4K8ZA 4JS5A 1J53A 4O5BA 1RDBA 1S1VA 1B9DA 4IG3A 3QINA 2EHGA 3NH0A 1EETA 1I3AA 4BDYA 2BDPA 4CGHA 4DMNA 4Q5VA 4DQQA 2HHSA 4DF4A 1TL1A 3QIPA 4C8MA 3CFOA 3LALA 4DQIA 3K57A 4CJ3A 4FJGA 1ZBHA 1S1WA 3C6UA 4KV8A 4QOZB 4FJ7A 5CZ1A 1UAXA 3TI0A 3VQ5A 4WE1A 3QEIA 1BI4B 4IFVA 4CF9A 1XC9A 1RT3A 3U3YA 2B5JA 4PUOA 4DTSA 4KTZA 1QQCA 5I42A 1SKRA 2HNYA 1TKXA 2Y1IA 4B9LA 3OYNA 4DWIA 3V9ZA 3QIOA 1RT2A 3V9XA 3RMBA 3AA5X 4CFDA 1VSHA 4XIUA 1RBVA 2B6AA 2NUBA 1T7PA 3AVIA 4CHQA 3LAKA 4KHWA 3KK3A 1RBTA 1J9AA 2XY6A 4K8XA 2KTQA 1IG9A 1HNIA 3AVBA 2RF2A 4OKKA 3HP6A 1RTDA 2IC3A 4J2AA 2HVHA 1WSHA 4CHOA 4BE1A 3OYAA 4YFUA 3HP9A 3NGIA 3PV8A 3G10A 3VQAA 1D9DA 4W5TA 1S6QA 1CLQA 2YV0X 3NF9A 2BE2A 3CQ8A 3U6FA 5HP1A 1L3VA 2XO7A 4E1NA 3PO4A 4J2EA 1BHLA 2GUIA 3B6PA 3LPUA 4HUEA 1SKSA 3SI6A 4I2QA 5C42A 4Z4IA 1QE1A 4DSJA 4CF2A 2HMIA 2O4GA 1C0TA 2WONA 3RR7A 4KTQA 3VQPA 4ZTFA 4DQPA 3DOLA 4LSNA 4ID5A 2HHXA 5FROA 1SUQA 1WN7A 3QO9A 4GW6A 1RT4A 4LD0A 3QNOA 4B9UA 2HHTA 2Z1IA 4HCCA 4DU4A 4UQGA 3TABA 3NAEA 3DLBA 2X74A 1R0AA 1C0MA 1N5YA 2YHBA 3KKRA 3SV3A 1MU2A 3LAMA 2RPIA 4ZTJA 1RT5A 4FM2A 4DTXA 3HXMA 1A5VA 4OGCA 2IAJA 4CEQA 4FVMA 4ICLA 5KGXA 1DLOA 5EU7A 1NK9A 2VG6A 1UWBA 2FBYA 5FRMA 4FW2A 1DTQA 5SWMA 4FJ5A 1TVRA 3QLHA 2YNGA 1U4BA 3K59A 3BDPA 1S9GA 2XRIA 3VQ7A 4DFKA 3QNNA 4FZYA 4DTMA 4CFBA 3CYMA 4CEBA 3D0PA 4PA1A 4B08A 4AILC 3OJSA 3QEXA 3AVKA 3PX4A 1NK0A 1HQEA 4FJXA 3NE6A 1LAWA 5DMRA 2DY4A 1HYVA 1W0HA 2YKNA 3AVAA 4LY7A 2FC0A 3V1RA 4PY5A 4DSKA 1FK9A 1KCFA 1LWFA 3AO1A 2Z1HA 2ITGA 3P5JA 4CFAA 3S3NA 1I39A 3O3GA 3AVLA 1HQUA 4FJ9A 4G1QA 1TKZA 1W9HA 3ULDA 3U3GA 1BIUA 1RTJA 3HL8A 1C1AA 3S3MA 1ZBFA 1EXQA 1GOAA 4CK3A 1Q9XA 2KZMA 2DFEA 3DRPA 3TAFA 2BANA 1BGXT 4YNQA 4CERA 2YNIA 1RT1A 2LSNA 4LH4A 4TSXA 4DFPA 3SQ4A 1L3UA 2R7YA 3AO2A 4NCBA 1JLFA 1LWEA 4F2RA 4O55A 5HRPA 3P83D 3NCIA 3OYGA 3O4NA 2EX3A 2HB5A 3PUFA 4GMJB 1X9MA 4M3WA 3MECA 4HUGA 4E1MA 1FKPA 3ZT1A 4AHSA 1RDDA 5CYQA 3I8DA 4BDPA 1XI1A 4B8CA 4M3RA 3V9UA 2KFZA 3QEVA 5HRNA 2G8HA 1VSMA 4E7KA 4DFMA 3K5LA 1FKOA 3TANA 4E89A 4N56A 2IS3A 4CF1A 4CGIA 3AV9A 3CFRA 4N47A 3CM6A 4C8LA 2D5RA 4CESA 3ASMA 3RRGA 4BE2A 3VQ6A 4AHVA 3TAPA 4DFJA 3WNHA 1REVA 4F3TA 4KTWA 5HRSA 4B8AB 1X9SA 3ITHA 3F9KA 3NF8A 1F21A 1KVBA 1VSKA 1T8EA 1X9WA 4O44A 3AA2A 2G8WA 3OYEA 3S9HA 3I0RA 4CEDA 4HCBA 4CGGA 1ZYQA 3HJFA 3WNGA 5FDLA 4EP4A 2I5JA 3OYHA 1RBRA 2O4IA 2YNHA 1NJXA 4CEOA 1RDCA 2KW4A 1SV5A 2YNFA 4BDZA 3V9WA 4I9LA 3ZSYA 2FBXA 4DLGA 4J2BA 3IRXA 4OPKA 1BCMA 1QHTA 1VSFA 1S5JA 4CHYA 4DTUA 1NK4A 4FZXC 3SQ2A 3HVRA 3AO4A 3KIOA 1U49A 3O4QA 3TAMA 4CJTA 4Y1CA 1C1CA 3LWMA 3OVNA 4O0IA 4E0DA 1TKTA 1VRTA 2OZSA 4M42A 3HPOA 4CGFA 2DFFA 3RR8A 1UA1A 3NH2A 4DSLA 4J2DA 4CEFA 4FK0A 1SKWA 1KVCA 1ITGA 1QS4A 3DLEA 3L3UA 2IDOA 5J2PA 5C24A 4KHSA 3QEWA 1IKVA 1TK5A 1HYZA 3VQEA 3M8PA 3SPZA 1EX4A 4FM1A 1RDAA 2WOMA 2ZE2A 4KHUA 5CYMA 4DQRA 3E01A 3KLIA 3SUOA 1KSPA 1L3SA 1KRPA 2OPPA 2FBVA 2XY8A 3ZSVA 1JL2A 3ZT2A 3KK1A 2W42A 5J2NA 3TAGA 4AHCA 1N6QA 4N76A 3NF6A 2HHUA 1HJRA 3NGYA 1B9FA 3RMAA 3M8QA 4CJKA 4E7IA 1NKEA 3M8SA 4Z4EA 4M45A 1EP4A 1HNVA 1GOBA 3KLFA 1QTMA 3ZSRA 1VK0A 4FYDA 2HHWA 1SL0A 3OYDA 3V6DA 3ZSOA 4DU3A 3HK2A 3LP2A 5HROA 2D0BA 5CZ2A 4BACA 4AHRA 1NK7A 2Z1JA 1JL1A 2P51A 4CK2A 3SQ0A 2GV9A 2A1RA 1NK6A 1U47A 4Z4GA 1TAUA 3SUPA 2FBTA 4F3OA 4CIGA 4W5NA 3AO3A 1Z25A 5HRRA 1CXQA 4H4OA 1C1BA 2KZZA 5I3UA 4OGEA 3LWLA 4C8OA 3DLRA 1Q8IA 4FLTA 4RG8A 1WSFA 4CJUA 2IGIA 3AO5A 4CHNA 3TARA 1BQNA 3L3VA 4C8NA 1O1WA 3A2FA 1C6VA 4CGJA 3L2RA 1SL1A 4FZZA 3DM2A 4FK4A 3PX0A 4CJRA 2ZD1A 2OPRA 1BISA 2OPQA 3WNEA 3KLHA 4O0JA 1HMVA 3ZSQA 4E7HA 1WSGA 5KI6A 1L3TA 1JLBA 1KTQA 1VSIA 3MAQA 1JXEA 2HNDA 2F96A 4OLAA 1T05A 1TKDA 3HVTA 3OYFA 2XHBA 4EP5A 3NBPA 2HNZA 4NYFA 4Z4CA 3OYCA 4CCHA 1LW2A 2ZQBA 4M3XA 4MFBA 4OKEA 3KK2A 4B9MA 4O4GA 4CJVA 4H4MA 3AVFA 1UA0A 3NH1A 2IOCA 3H08A 4CFCA 4CHPA 4Q0BA 1BL3A 3DLKA 4CK1A 3HT3A 3SYZA 1UOCA 1WSJA 4DSFA 5KGWA 5SZTA 4I7FA 4AHTA 4CJ5A 4FJ8A 5KRTA 4B9VA 4KB0A 4FJIA 5D3GA 4KO0A 3VQ4A 3S3OA 4RW7A 2KQ2A 3NHGA 3VQCA 1VSDA 5FRNA 1WNSA 4FJMA 1IKYA 4AHUA 3RRHA 3SPYA 2OA8A 4KHQA 2HW3A 4RW9A 4OJRA 3ZT3A 1RCHA 4CEZA 2ETJA 3MEEA 4DS4A 3KD1E 1FXXA 2E6MA 3VQQA 4N5SA 1J5OA 1ZBUA 1WLJA 2QXFA 2PZSA 4QAGA 3OS0A 1TGOA 2XY7A 3MXIA 4W5QA 3RMCA 1LV5A 3PY8A 4NYNA 1ZBLA 1NOYA 2F8SA 3IS9A 1A5WA 3NF7A 2GBZA 3KLEA 4DSIA 1KLMA 3AVCA 2X6SA 3QESA 3V9SA 3EY1A 4DF8A 1Y97A 4H8KA 4RW6A 2JLEA 3K2PA 4IFYA 3TAEA 3MXMA 4I9QA 5J2QA 2E4LA 3O3HA 4LH5A 3TR8A 3T19A 4CECA 1ZBIA 4CJEA 3HPGA 4FLVA 4FJLA 3VN5A 4KPYA 1JLEA 2Z1GA
chains in the Genus database with same CATH superfamily
3C94A 5M1PA 2VG5A 1C0GA 1NOZA 4CJWA 3ISNC 1NMNA 3PO5A 3P1GA 4BC2A 5BRFA 4DUZK 2G8IA 1Q7YO 3F9MA 1VQPN 4FWKA 4W5RA 1E3MA 2E1YA 5M1QA 1GOCA 2OPSA 2DTUA 4CJFA 4RW8A 1R59O 3O6WA 1G15A 3M1FA 3RMDA 1QSSA 4Y1DA 3L2WA 4DR5K 1YJNN 1NJZA 1NKCA 1Q9YA 1RT7A 3O3FA 3HTVA 4DQSA 4ZHRA 4BWJA 4FXDA 4NXNK 1N32K 4B3TK 2VWKA 1G99A 3AVJA 1S3XA 2D4WA 3AA3A 3I33A 4BRAA 4YDUC 4FM0A 1QSLA 3CJ1A 2D0CA 5JS1A 4C8KA 3L0QA 3OYBA 3NVMA 3IAYA 5AQXA 2WFBA 4DG1A 3NGZA 1CZBA 3L2VA 3UB5A 4B9TA 3MN5A 1NKBA 3VESA 3OJUA 1NU0A 2Q97A 4ELTA 4FWQA 2A1SA 3AVMA 5HLFA 4FLXA 3SZ2A 5AFUH 3VF2A 4KI4A 1BG3A 3K5NA 5AQMA 5HOOA 1DT9A 4IZ9A 1SL2A 2HOEA 3SCXA 4M3YA 3D2EA 2E88A 1T44A 3A0IX 3FGUA 2P5GA 1JLQA 4DS5A 4IBNA 2PYLA 1BIZA 5CY4A 3L8BA 4FJHA 2G8FA 1WAFA 2Q3SA 5ADXA 3HYFA 3QEPA 5CR4A 5J2MA 5K14A 5TKYA 1S6PA 1WSIA 3GOIA 1VRUA 4CD1A 1VHXA 4IFEA 3OYJA 1T03A 2IVOA 1LWCA 3MCAB 3LP1A 1YTUA 3LZJA 2P9LB 1S1TA 2HHQA 2E2QA 3THYB 4FWPA 1RTHA 2V7ZA 3TTCA 4GV6A 4NCGA 1D9FA 4A5BA 1XHZA 3MN7A 1S1UA 3H6EA 3ZSXA 4FJNA 5AQOA 2RN2A 3FR0A 3BUZB 3CM5A 3QICA 4CIEA 4JRQA 3EZWA 5JS2A 4IOXA 5KTQA 3OS2A 4CZJA 4IKFA 1K6YA 4Z4FA 1A5XA 4KHYA 3LDLA 3HO1A 2A6AA 4Z4HA 4CGDA 3JSMA 1J53A 4O5BA 1KQSM 2HMPA 4IG3A 2EHGA 4BDYA 2VYPA 1IBKK 3EN9A 4DMNA 2AP1A 1TL1A 3QIPA 3CFOA 3D7EO 3K57A 3C6UA 4QOZB 3MWPA 3QEIA 4IFVA 4CF9A 1FJGK 5BR9A 1TKXA 4DWIA 2D0OA 3RMBA 4CFDA 2XY6A 1RBTA 4K8XA 4OKKA 4BR0A 3HP6A 5AQTA 4J2AA 1WSHA 4BG8A 4CHOA 2W6KA 5IWAK 4YFUA 1WBBA 3NGIA 3PV8A 1WB9A 3NVKA 4H5VA 2P9LA 3CCSN 4W5TA 2EWSA 1CLQA 2DPNA 3U6FA 1ATNA 3PO4A 2GUIA 3SI6A 4DHYA 1U2VB 4GY2B 3RR7A 4JKBA 4DQPA 2W40A 4ID5A 3IDHA 4G9ZA 4UQGA 3EE9A 3NAEA 4M63C 3SV3A 1MU2A 4FPAA 4ZTJA 1ESVA 1RT5A 4DTXA 4X62K 4GV3A 3D2EB 4OGCA 1NK9A 1DLOA 1VQMN 2HSTA 2UUBK 5SWMA 1DTQA 2BTFA 4FWSA 4BRLA 2P9PB 2KLAA 1U4BA 3VQ7A 4JYAK 4CFBA 2ZGZA 1NK0A 5C2DA 3QEXA 3AVKA 4KH4A 3LDPA 3AVAA 2FC0A 3KK7A 4PY5A 3C6HA 3AGRA 3C65A 3AO1A 2Z1HA 3G6EN 3S3NA 1TKZA 4C1NI 3U3GA 1BIUA 1EXQA 1Q9XA 3TAFA 1BGXT 4YNQA 4K43A 1XQSC 4LH4A 2R7YA 3VEOA 2GUPA 3VOVA 4IJAA 4HUGA 1FKPA 4B8CA 3OW2M 4M3RA 3V9UA 3QBXA 3K5LA 3TANA 4E89A 4N56A 2IS3A 4AM7A 4N47A 2D5RA 3RRGA 3D6RA 5AQVA 1ILYA 4KTWA 3O9TA 5HRSA 3ITHA 3F9KA 3NF8A 1F21A 2YX6A 1T8EA 1X9WA 3L4QA 4O44A 4PKIA 4F9OA 5FDLA 1DKGD 1RBRA 1VQ5N 4XH5A 2O4IA 1NJXA 4CEOA 1RDCA 2KW4A 4LF4K 4GVEA 4Y0WA 5EY4A 4I9LA 4J2BA 3C6AA 1BCMA 1QHTA 1GLFO 4B1WB 4DTUA 4FZXC 3TAMA 2HHHK 3C7NB 4Y1CA 5FPNA 1TKTA 1VRTA 2DFFA 3NH2A 1XMOK 4J2DA 2HBJA 1QS4A 1HYZA 1TUUA 2A42A 3CQXA 2F9WA 3M8PA 1EX4A 4DV3K 2Q1NA 4BRNA 3R8EA 4EIAA 1KSPA 3CPWM 3TAGA 2W42A 2HHUA 3PIPL 3RMAA 4E7IA 2O8DB 3LL3A 2HHWA 3OYDA 3ZSOA 4DU3A 3VTHA 2D0BA 5CZ2A 4PHTX 3ZX0A 1JL1A 4CK2A 2GV9A 1U47A 1GLJO 5JLHA 4F3OA 4CIGA 1Z25A 3BZCA 4IEIA 1K8KA 3CPEA 5I3UA 2V52B 1NLVA 4IOAL 3I55N 1WSFA 3O4WA 4CGJA 3A2FA 4FZZA 4JKCA 4OPHA 4BRPA 4EHTA 4CJRA 2OPRA 2PAVA 2QI2A 3R9PA 2UXDK 1OKJA 2GWKA 5DM6L 3CCJN 4B1UB 4OO1J 1RDUA 3BP8A 3OYFA 4EP5A 2QWQA 3NBPA 4Z4CA 2A41A 3CCQN 3ZYYX 4OKEA 4B9MA 3ATUA 4B3RK 3ENHA 3HSCA 4BVPA 1EQYA 3NH1A 3H08A 3DLKA 3VEWA 5KGWA 4AHTA 4CJ5A 5KRTA 4FJIA 4K25A 4JI4K 4KO0A 3ZEUB 3T7ZA 4AHUA 1IBMK 4KHQA 2HW3A 4H0OA 1IJJA 4WQ4A 4BRKA 3VQQA 1WLJA 4QAGA 4H0XB 2XY7A 1LV5A 1KAYA 5HL7L 3Q7CA 4NYNA 5AQSA 3KLEA 2GBZA 1KLMA 3Q7BA 2X6SA 3QESA 1HNZK 4B1VA 3M3ZA 3TAEA 1NGJA 4FOEA 5C0YA 3VEZA 1TYQA 2W6LA 3P38A 2YJEA 4B3OA 4CIFA 1VSJA 4NCAA 2A3ZA 4OPAA 3WNFA 1RILA 3E9LA 4W5OA 3RTVA 3B8AX 2VG7A 3CFPA 4CEAA 3T3FA 4C23A 1S9EA 4FWOA 3THWA 1TK8A 2Q36A 3KJVA 1NK8A 3LANA 5JLFA 1NJIO 5BRDA 1OH5A 3EE8A 5KRSA 1JKHA 4F4KA 3AVNA 4LSLA 3VQBA 4FL9A 4HHTA 1KAZA 2YKMA 4CZEA 3KTQA 3SUNA 2X6NA 3C7NA 3KKSA 4JI5K 4CJLA 3CCUN 3VTIA 1BCOA 1DTTA 2QWLA 4KREA 4FW1A 2JGUA 3DMJA 1RBUA 4CZKA 3VEYA 4MLEA 5M1FA 4KBOA 3DYAA 1YVUA 4FLYA 3ID6A 2QWRA 1TK0A 2G8VA 2QXLA 1LOTB 3CMAN 3L6QA 4B9SA 1NGGA 4CBXA 4UY8O 4IG0A 2OZMA 1U04A 4ILJA 1ASVA 2NRZA 4JK9A 4FLZA 4FCYA 4DTPA 1KLNA 4JI6K 3J7ZO 3QFPA 1U6ZA 3ALYA 4BR7A 2WBNA 3QBWA 3A5LC 4L8RB 1KFSA 4FK2A 1HYSA 1VSLA 1XUPO 3EZ5A 4KFBA 3ZT4A 4CJPA 3H3OB 4H5RA 4EZ9A 5AZJA 5BR8K 4DV2K 4H5WA 5AQGA 3VQDA 1S1XA 3TSQA 2XY5A 3ZCMA 4CEEA 1EKEA 4CZMA 3DRSA 5AQHA 1LW0A 1T3VA 1BQMA 2E2NA 3CCVN 4AH9A 1IH7A 3M8RA 2F4VK 2JWLA 2PBDA 4R5PA 2ZJRL 3G0ZA 4JKFA 2QEXN 2HVIA 4RCHA 4BE0A 4CE9A 3SJJA 4H0PA 4FLUA 3S41A 1GLLO 3O80A 1YITN 3C6TA 2AJQA 4RW4A 1Q81O 1BUPA 3K5OA 1NJWA 3BGRA 1BA0A 1MWMA 3LP0A 3TSUA 2PYJA 2Q2RA 3AVHA 1LAVA 1BU6O 2ASPA 3TWHA 5AZIA 5JVHL 4DR3K 3ZSZA 1BI4A 2QM1A 5C25A 3K58A 1IKWA 3W3DA 3G4SN 4IO8A 5AZIB 3VQ9A 4BGBA 5GAHP 3OYLA 4M3ZA 2QKBA 4KAZA 3J7AP 3I0SA 5B8HA 3J80O 2FLOA 1RDBA 3QINA 4BC3A 1BA1A 4B3MK 1VQ9N 4A2BA 2ASOA 4DQQA 4DF4A 4DQIA 4CJ3A 4NLBA 1HKBA 1QQNA 5CZ1A 4BREA 3OA9A 5F0XA 3J81O 4BR4A 1BI4B 3WXKA 4DTSA 2GEMA 3K9KA 4KTZA 3THXA 2HNYA 4KHPK 5ELZA 1M1KO 1W2BM 3PSFA 3AA5X 3AAPA 1CZAN 4XIUA 2NUBA 3CJCA 3AVIA 4KHWA 2HVHA 4BE1A 1X3NA 3G10A 3VQAA 1YUWA 2YHYA 4E1NA 3CETA 2A40A 3TTDA 5C42A 4Z4IA 1QE1A 3H1QA 2P9IA 4B9QA 3GE1A 5C10A 3D2FA 5LJWA 2HMIA 1IV0A 3VQPA 2HHXA 4LSNA 3HI0A 5FROA 1SUQA 1WN7A 3QO9A 4V19S 2HHTA 5M1NA 4BRMA 4HCCA 3WT0A 4DR1K 3TABA 3CC2N 2X74A 1R0AA 1N5YA 2YHBA 3KKRA 3LAMA 5AZJB 1SS6A 4FM2A 3HXMA 1W97L 5KGXA 5EU7A 1TVRA 3THYA 3O08A 3CYMA 4B08A 3NE6A 5DMRA 2ZWHA 1VQ7N 3V1RA 1QQMA 3O9RA 1OH6A 1ATSA 4CFAA 5H1SQ 4IEEA 5GAEP 3VEXA 4DV4K 3O1BA 2CH6A 4FSVA 5AQYA 1ZBFA 1QSYA 4CJ7A 3WEEB 1NGAA 3SQ4A 1L3UA 4NCBA 3RSEA 4F2RA 4O55A 5HRPA 3CCEN 5TKWA 5LL6Z 1P90A 3F2KA 3NCIA 4QS8A 3O4NA 2EX3A 3PUFA 1O13A 5M1OA 4GMJB 3UKUA 4M3WA 3MECA 4AHSA 5CYQA 4ILGB 4A62A 4IXCA 2KFZA 5IT9O 5HRNA 3LDOA 1FKOA 3AV9A 3CFRA 4M7YA 3CJ9A 4C8LA 4BE2A 3WNHA 1XC3A 3CQYA 4O8KA 3UKRB 3AA2A 4YDUA 2G8WA 3OYEA 1HPMA 3S9HA 3I0RA 4CEDA 1WUAA 2O8CB 4H5TA 1ZBSA 3E66A 4BDZA 3V9WA 1XMQK 1VSFA 3N4PA 2D1KA 3SQ2A 1U49A 3ZEUA 1Q86O 3O4QA 1WOQA 2RHKA 2AA4A 3OVNA 4O0IA 4BQLA 3HPOA 5JVGL 5FPMA 4FK0A 4CEFA 3DLEA 3L3UA 4KHSA 3N4QA 5FPEA 1IKVA 3VQEA 4WQ4C 3EL2A 3VF6A 4FM1A 1NGIA 1RDAA 2A5XA 4KHUA 5CYMA 1BOTO 3SUOA 4A59A 2XY8A 3KK1A 1JL2A 3NF6A 3ID8A 3C0BA 1P8ZA 4Z4EA 3AGKA 3M8SA 4CD3A 1EP4A 4LC9B 1HNVA 5KPZA 1QTMA 1VK0A 1QVFM 3R3LA 1SL0A 3V6DA 3LM2A 2CGLA 2ZGYA 3CXCM 1NK7A 2Z1JA 3CF5L 1J5EK 4IOCL 3SQ0A 1TAUA 1RDWX 4OGEA 5MLCQ 4C8OA 1Q8IA 4FLTA 3TARA 4CZGA 1HR0K 1C6VA 5GADP 3L2RA 3DXMB 2ZD1A 1BISA 3WNEA 3KLHA 3DXKA 1HMVA 3ZLJA 3CHWA 2FXUA 3SJHA 1KTQA 4YOWA 1JCGA 1JXEA 2ITMA 4Z94A 2F96A 4DQ8A 1Z05A 2FSKA 2HNZA 4NYFA 3OYCA 4CCHA 1LW2A 4JI3K 4DV0K 3KK2A 4CJVA 4BQZA 1UA0A 3AVFA 4DCHA 4CW7B 2IOCA 1KD1O 4FPBA 3HT3A 3ZX3A 3SYZA 1WSJA 2P9UA 1VQ8N 5SZTA 1RFQA 3H45C 3MCPA 4B9VA 4AQYK 4KB0A 4GKJK 3NHGA 1VSDA 4YOXA 1EO1A 1IKYA 3JAMO 3RRHA 3UKUB 4E1JA 1H1VA 4WQ5C 4OJRA 3VENA 4U67L 4CEZA 3MEEA 4DS4A 1J5OA 2VCPA 2PZSA 3MXIA 1KAXA 1TGOA 3RSEB 5GINA 4W5QA 3RMCA 1NOYA 1ZBLA 3LDNA 1A5WA 3O1WA 3GDQA 4WYBA 5GAGP 4K0KK 2VQFK 3AVCA 3EY1A 1Y97A 3E9OA 3IKMA 4BC4A 2JLEA 4IFYA 3VGMA 3MXMA 3VPZA 4I9QA 2E4LA 4JNEA 4JI7K 3O3HA 3TR8A 3T19A 1QHAA 4CECA 1ZBIA 3HPGA 3VN5A 2Z1GA 4KKOA 3A5MC 4OKJA 4XH4A 3MXJA 3GL1A 3EYZA 1RBSA 1VQ4N 3K5MA 3L2UA 3BY5A 2IVNA 2G8UA 3UIQA 3L2QA 2O8EB 1HPZA 3HSTB 3SBGA 2PY5A 1YT3A 3OS1A 4KRFA 2P1JA 4M7XA 4FJKA 2YHWA 3VEVA 3VGKA 4KHNA 4DSEA 2QKKA 1V4TA 4KB1A 1Z26A 3SAGA 1GLBG 1JLAA 4BRHA 3KLGA 1D8YA 4KI6A 3SNNA 4ISGA 2E2PA 4DTRA 2OANA 4JKEA 2W41A 1KFDA 1T6CA 4PKHA 4BR2A 4CF8A 4N41A 4F8RA 1KC8O 3DJCA 4OLBA 2O8FB 5HBMA 2E1ZA 2Q0UA 4JI1K 2P9IB 4CJSA 1J54A 4E7LA 4JS4A 4CBWA 4CJ4A 1NK5A 3LDQA 2P5OA 3SAHA 3QDKA 1VAZA 3MEGA 1NJYA 1JXBA 1CXUA 3V4IA 4MDAA 4MO4A 2KFNA 4JK8A 3U4LA 4JLHA 2E20A 3V1OA 3LPTA 4YHHK 3CD6N 3M5RA 3THXB 3NFAA 3LDSA 3EO3A 1J6ZA 1ATRA 2WUSA 3SMSA 4HVJA 4E19A 1N36K 1RTIA 3VF4A 5FPDA 4H0TB 4BG9A 3KZBA 5BN9A 1X1PA 1IKXA 2P9NB 2RE2A 1V4SA 4I2PA 5C2FA 4O5FA 5M1KA 1YVNA 2F8TA 5T7BA 1HKCA 4F2SA 4DTNA 3FFKB 3CCLN 4C1NK 3RWUA 3HM9A 2HHVA 1BO5O 3CIPA 1RT6A 1I94K 3DI6A 1U2VA 2P9KA 1ASWA 1OH8A 2ATQA 2RKIA 3LM9A 2Y1JA 4M3UA 5AQZA 3SV4A 3VETA 2DFHA 4A61A 4GV9A 3MMVA 3IUCA 4K41A 1C0UA 1TV6A 2V7YA 3AAQA 5E26A 1U45A 5LJVA 2QWPA 3ZT0A 3OHRA 4FJJA 1QZ5A 4YOTA 2YHAA 2J4RA 1T6DA 4E3SA 1Z6RA 1JLCA 2NLXA 3AA4A 3HPHA 3OYKA 1W7AA 4CHZA 4B1ZA 1K8AO 4JKDA 2QK9A 1D5AA 3DLGA 4O8UA 2VWJA 3V81A 3VA0A 4OPJA 1TL3A 2BGGA 3AVGA 1RNHA 4CZIA 2NRXA 3HBTA 3HOTA 1S1VA 3NH0A 1I3AA 2PFUA 3ZETA 4MDBA 4CGHA 4Q5VA 2HHSA 4C8MA 1QZ6A 4FJGA 3O9QA 4LF9K 1S1WA 2ZF5O 4LF7K 1VQON 4FJ7A 1UAXA 3TI0A 2P9SA 4WE1A 1XC9A 3FZLA 3U3YA 2B5JA 4PUOA 5I42A 1SKRA 4H5NA 2Y1IA 4B9LA 3OYNA 3V9ZA 3V9XA 1VSHA 1T7PA 1RBVA 2B6AA 2ZM6K 3VGLA 1J9AA 1X3MA 3VMFB 2KTQA 2RF2A 2IC3A 3PLAA 2FF6A 1GLCG 2YCHA 1D9DA 1S6QA 4CZLA 3NF9A 5EXWA 3H3NO 4AF1A 5HP1A 1L3VA 1HUXA 1BHLA 4J2EA 3LPUA 4HUEA 5AQIA 2P9KB 3SAFA 4J8FA 1GLAG 2E5LK 3SLCA 4KTQA 3BF3A 3DOLA 5GIPA 4GW6A 4PL8A 4LD0A 2YI1A 2Z1IA 1YI2N 4DU4A 4JI2K 3R6MA 1C0MA 1ZC6A 3K9JA 3CCRN 5A2QO 2RPIA 3EEQA 2ASMA 1A5VA 4CEQA 4FVMA 4ICLA 2VG6A 1UWBA 2FBYA 5FRMA 3GG4A 4LFBK 4FW2A 4FJ5A 2YNGA 3THWB 3K59A 3BDPA 4LFAK 4CBUA 2XRIA 4DFKA 3QNNA 4FZYA 4CEBA 4PA1A 4L3QA 3OJSA 1HQEA 1LAWA 1HYVA 4CZHA 4DSKA 1FK9A 1LWFA 3P5JA 4H0VB 4BRGA 3ATVA 4EFHA 3O3GA 5JMVA 1TYQB 3AVLA 4FJ9A 2O8BA 5AQRA 5FLXO 3ULDA 3W0LA 3HL8A 1C1AA 1GOAA 3HRGA 3EKSA 3G71N 4FWMA 2ZJPL 4CK3A 2DFEA 2YNIA 1RT1A 4TSXA 4DFPA 4BY9C 3AO2A 1JLFA 1EWQA 5AQFA 3P83D 1OH7A 3OYGA 3CJBA 4HWIA 1RDDA 3I8DA 2O8FA 4IWVA 1XI1A 5CE3A 4FO0A 1E4GT 3QEVA 2G8HA 1VSMA 4E7KA 3BF1A 4CESA 4BRCA 3VQ6A 4DFJA 4U7BA 4YY3K 4F3TA 2VGNA 4BC5A 4B8AB 2VGMA 1QVGM 5AQQA 4HCBA 2QA4N 3MK6A 3HJFA 1M90O 2NNWA 4EP4A 3FZKA 3WUHA 2I5JA 3OYHA 3QMLA 4WF9L 1SV5A 2FBXA 4OPKA 2FF3B 4RTFD 3ZX2A 2I7PA 4CHYA 4FWLA 1NK4A 2F9TA 3AO4A 3LWMA 1K73O 1K8KB 4LF8K 2OZSA 4M42A 4QS7A 4DSLA 1UA1A 1YJ9N 1SKWA 1N33K 1KVCA 2IDOA 5C24A 4JI0K 3QEWA 1S72N 1TK5A 3RVCA 5LMNK 2Q0RA 2UU9K 5BPNA 2WOMA 5KPRA 4DUYK 3E01A 1KRPA 3ZSVA 3ZT2A 4X65K 4YOUA 3U9DA 4BR9A 4NB4A 4WFNL 4CJKA 3P31A 1QQOA 4HTLA 3KLFA 3ZSRA 3A8YA 1YJWN 4FYDA 4AM6A 3CMEN 5HROA 4BACA 4KH5A 3VERA 2IVPA 2P51A 1NK6A 2FBTA 3ENOA 3U9ZA 1IBLK 5HRRA 1C1BA 4A57A 2KZZA 3MX5A 3LWLA 3DLRA 4JI8K 4CJUA 2IGIA 4CHNA 3BZKA 1OVQA 1GLDG 3DXKB 3L3VA 1O1WA 4C8NA 1SL1A 2D0PA 2FSNA 3PX0A 2OPQA 3ZSQA 4H0YB 1L3TA 3QFUA 1XNRK 3MAQA 3DWLA 1T05A 2BUPA 1TKDA 3HVTA 4DV1K 5E84A 4MFBA 1IG8A 5KPTA 4CFCA 3KHYA 1BL3A 4CK1A 3FZMA 1DEJA 4I7FA 4BRQA 4FVUA 4FJ8A 5D3GA 3WXJA 4RW7A 2KQ2A 1NGBA 3VQCA 5BPLA 5FRNA 4PL7A 4IDHA 4JEPA 5CHIA 2YHXA 2OA8A 4YORA 4BRDA 3CJAA 5AFUA 1FXXA 3OS0A 4BVOA 3ULEA 3PY8A 1JCFA 2F8SA 5AQUA 3WXIA 4DR7K 4A2AA 4ISFA 3V9SA 1NMDA 4DF8A 4RW6A 3K2PA 2QWOA 2OTJN 4DV7K 5J2QA 4LH5A 3O8MA 4CJEA 3NMUA 4KPYA 3P4IA 2GELA 1XHXA 3ZSWA 3F73A 3C95A 2O8DA 4MLHA 4E7JA 2E6LA 3FLCO 3PX6A 5J1EA 4LF5K 4ID1A 4CJQA 5BN8A 5F1XA 3B6OA 1YTAA 3T1YK 4A5AA 3MN9A 4OVLA 4IDKA 2FSJA 5C15A 3L4IA 2GWJA 3HM8A 3AARA 5DK5A 1JLGA 4DR6K 3FZHA 2G8KA 3CG7A 3WEEA 1NNEA 4DTOA 4JKGB 4JKHA 1IO2A 4OX9K 4DR4K 3SQ1A 1VQKN 1MWKA 3LZIA 3KD5E 5AJ3K 4NXMK 4BR5A 1Q82O 2OYQA 3AY9A 4DLEA 4GNIA 4GVMA 3TAQA 3O5BA 1NGCA 1WSEA 3HOSA 2QTDA 4B9NA 4DV6K 3TTFA 4ELUA 3IG1A 4MO5A 4CF0A 4PQUA 4M41A 4DU1A 3T69A 1KXPA 1TAQA 1HLUA 1ASUA 3OY9A 1VSEA 3QERA 3CI5A 4IJNA 3DRRA 3TSPA 3DOKA 2WTUA 4Z0UA 5AQJA 3KWIA 4FWRA 3D45A 4HTUA 3NDKA 2D0AA 4I6MA 1CZ9A 4NO7A 3V1QA 1B92A 3VQ8A 2V51B 4WQ5A 3FFIA 3D2FB 4ELVA 3LP3A 4PWDA 4RWTA 3KVGA 3ZETB 3THVA 4JRPA 5E41A 2KKZA 3WXMB 3DLHA 1XWLA 4CVNE 3T1AA 3DAWA 2CGKA 3VA3A 4LF6K 3IMXA 1MDUB 2KHOA 5BRHA 1KVAA 4EZ6A 2O8BB 4QCLA 4DR2K 3J8AA 1L5UA 5AR0A 2H3GX 1K9MO 4MQ3A 4GKKK 1NBWA 2UXBK 2X78A 1SAZA 4M3TA 1XNQK 3QETA 5BPMA 1JCEA 1LCUA 3OYMA 3T1HK 4BWMA 1HRHA 2P9PA 2HF4A 3MEDA 4BGAA 4ISEA 3SUQA 1WAJA 3JYTA 3MX2A 3A5NC 4JHDB 4IO9L 3MDQA 1YAGA 1N34K 2NRVA 4FLWA 3CC7N 3KWGA 3M6GA 1D4XA 4B3SK 5BREA 2B4JA 3OYIA 3A5OC 2CH5A 1U48A 3H1VX 4DV5K 4DTJA 4HUFA 4K8ZA 4FWNA 4JS5A 2NRRA 4JHDA 2P9NA 1B9DA 1EETA 3O9UA 2BDPA 1HKGA 4NLCA 3CERA 4X66K 1NWKA 3LALA 1ZBHA 4EAHD 4KV8A 3VQ5A 5AQPA 1RT3A 1QQCA 4JKAA 1MA9B 1NGHA 1RT2A 3QIOA 4CHQA 3BEXA 3LAKA 4QS9A 3KK3A 1IG9A 1HNIA 3AVBA 1RTDA 2P9SB 3OYAA 3I8BA 3HP9A 1S22A 3ENBA 2QWMA 2YV0X 2BE2A 5DM7L 3CQ8A 2YJFA 4BRFA 2XO7A 3B6PA 1SKSA 1BWFO 3JXUA 4I2QA 4ILHA 4DSJA 4CF2A 4YOVA 2O4GA 1C0TA 2WONA 2NZTA 4ZTFA 3U8XA 2BH1A 2NRWA 4YOYA 3QNOA 1RT4A 2Q31A 4B9UA 4CZFA 4I6MB 3DLBA 1NGFA 1SZ2A 1NM1A 3SBTA 4WFBL 3EKUA 5LY3A 2IAJA 3DLLL 3OBYA 4KH6A 2UXCK 4BROA 4BRIA 1HNWK 1VQLN 3QLHA 1JJ2M 2E8AA 4DKWA 1S9GA 4FOIA 4DTMA 4WFAL 3D0PA 2QWNA 3PX4A 4AILC 4FJXA 4H03B 2DY4A 4LFCK 1VQ6N 3TPQA 1W0HA 2YKNA 4LY7A 4CI6A 2HBMA 5I9EB 1KCFA 2ITGA 1NGDA 3O9SA 4R79A 1I39A 3H46O 1NG9A 1HQUA 4G1QA 1W9HA 4JAXA 1RTJA 3S3MA 2JWKA 5KQ8A 3DRPA 2BANA 4CERA 2LSNA 3UE5A 5AQKA 1LWEA 1YXQA 4B1XB 2HB5A 4XEIA 1X9MA 5C12A 4E1MA 3ZT1A 3CCMN 4BDPA 1X9JA 5ADXH 4DFMA 3IFRA 5EVZA 4DB3A 4CF1A 4CGIA 3CM6A 4JKGA 1HJOA 3ASMA 4AHVA 2VQEK 3TAPA 1REVA 3G25A 3OTOK 1X9SA 3MN6A 1KVBA 1VSKA 1YF5L 3SK3A 3I56N 1Q18A 2UUCK 4CGGA 1ZYQA 1EWRA 3WNGA 1BDGA 2YNHA 3F5TA 3FE1A 4X64K 2YNFA 4JD2B 3ZSYA 4DLGA 3IRXA 1Y64A 3JS6A 1S5JA 4JK7A 3HVRA 1ZXOA 3KIOA 1SQKA 4CJTA 1C1CA 3J7YP 2UUAK 3WQUA 2CGJA 5KQDA 4E0DA 4CGFA 2OCEA 1TUYA 3RR8A 1VQNN 1RGIA 1HX1A 1ITGA 5J2PA 2QW9A 3ULEB 3SPZA 3P39A 2ZE2A 3QB0A 3OBWA 5LMUK 4DQRA 3KLIA 1OVYA 1L3SA 2OPPA 2FBVA 2KZMA 5J2NA 2O8EA 1N6QA 1N8RO 4AHCA 4N76A 1HJRA 3NGYA 4EHUA 1B9FA 1E4FT 3M8QA 1NKEA 4M45A 1GOBA 2HBKA 2E2OA 1YHQN 3HK2A 3LP2A 3TU5A 2I7NA 2NRTA 4AHRA 1NGEA 2GX9A 1C0FA 2A1RA 3WXLA 4Z4GA 3SUPA 1WBDA 4W5NA 3AO3A 3MWTA 1CXQA 2WC9A 4H4OA 3E1YA 2HBLA 2OTLN 3PIOL 4RG8A 5GIOA 3AO5A 5EX5A 1BQNA 4JV5K 3PSIA 3DM2A 4JD2A 3FZFA 4FK4A 1YIJN 3GBTA 2IIRA 4O0JA 2ZJQL 4E7HA 1WSGA 5AQNA 5KI6A 5JICA 4JN4A 1JLBA 1VSIA 4K42A 2HNDA 2O8CA 4OLAA 2GTDA 2UYTA 2XHBA 2P9UB 4M3XA 2ZQBA 3UKRA 4O4GA 4H4MA 4CHPA 4Q0BA 1UOCA 4DSFA 5AQLA 3CC4N 2HF3A 1HNXK 1GLEG 3VQ4A 3S3OA 4XH1A 4WCEL 1WNSA 4FJMA 3E9PA 3SPYA 3K0SA 3DXMA 3HZ6A 4RW9A 3ZT3A 1FW6A 1RCHA 2ETJA 3KD1E 3SMPA 2NRHA 2E6MA 4N5SA 1ZBUA 2QXFA 1DGKN 4B1YB 3IS9A 2VWBA 3R1XA 3NF7A 5F2RA 4DSIA 3CJ7A 4H8KA 5EOYA 4PKGA 3WQTA 4FJLA 4FLVA 1JLEA 2F7TA 5AQWA
chains in the Genus database with same CATH topology
4KKOA 3C94A 4OKJA 1XHXA 1VSJA 3ZSWA 4CIFA 3F73A 3MXJA 4NCAA 4B3OA 3WNFA 1RILA 3C95A 1RBSA 3EYZA 2VG5A 4W5OA 3RTVA 2E6LA 4E7JA 3K5MA 5J1EA 3PX6A 1NOZA 4ID1A 4CJQA 3L2UA 2VG7A 3ISNC 3B6OA 4CJWA 3CFPA 2G8UA 3PO5A 1YTAA 3UIQA 3P1GA 4CEAA 3T3FA 3L2QA 1S9EA 4OVLA 1HPZA 3HSTB 4IDKA 2G8IA 1TK8A 3KJVA 2PY5A 1YT3A 1NK8A 3OS1A 4KRFA 2P1JA 3LANA 4FJKA 4KHNA 4W5RA 5DK5A 1JLGA 4DSEA 2QKKA 4KB1A 5KRSA 2G8KA 1GOCA 2OPSA 2DTUA 1Z26A 1JKHA 3CG7A 4F4KA 1JLAA 4DTOA 4CJFA 4RW8A 3AVNA 1IO2A 3KLGA 1D8YA 3SQ1A 3SNNA 4KI6A 4LSLA 3VQBA 3LZIA 1G15A 4HHTA 4DTRA 3KD5E 1KFDA 2YKMA 3RMDA 1QSSA 3SUNA 3KTQA 4CF8A 2X6NA 4N41A 4F8RA 4Y1DA 3L2WA 2OYQA 4DLEA 3KKSA 4OLBA 4GVMA 4CJLA 5HBMA 3TAQA 1WSEA 4B9NA 1NJZA 1NKCA 4CJSA 1BCOA 1J54A 1RT7A 1DTTA 3O3FA 4E7LA 1Q9YA 4ELUA 4JS4A 4CJ4A 4KREA 1NK5A 4DQSA 4FW1A 3IG1A 4ZHRA 4BWJA 2P5OA 4CF0A 4FXDA 2JGUA 3DMJA 1RBUA 2VWKA 3AVJA 1QSYA 3AA3A 4FM0A 1QSLA 4PQUA 5JS1A 3DYAA 4M41A 2D0CA 3MEGA 4DU1A 1NJYA 4C8KA 1JXBA 1YVUA 3OYBA 4FLYA 3IAYA 1CXUA 1TAQA 3V4IA 1ASUA 3OY9A 1VSEA 4DG1A 3NGZA 1TK0A 3QERA 1CZBA 3L2VA 2G8VA 2KFNA 3DRRA 4B9SA 4B9TA 4IG0A 2OZMA 1NKBA 4JLHA 1U04A 3DOKA 3V1OA 4Z0UA 1ASVA 4FLZA 3OJUA 3LPTA 4FCYA 3D45A 4HTUA 3NDKA 4DTPA 1KLNA 4ELTA 3NFAA 3LDSA 2A1SA 2D0AA 3ALYA 1CZ9A 3AVMA 5HLFA 3V1QA 1B92A 4L8RB 4HVJA 1KFSA 4E19A 3VQ8A 4FLXA 3SZ2A 1RTIA 3FFIA 4FK2A 4ELVA 1HYSA 3LP3A 4PWDA 1VSLA 4KI4A 3K5NA 1X1PA 3EZ5A 1IKXA 3THVA 4KFBA 1SL2A 4JRPA 3ZT4A 5E41A 4CJPA 3SCXA 3DLHA 1XWLA 4I2PA 4M3YA 4EZ9A 3T1AA 2F8TA 3VA3A 5T7BA 3VQDA 1S1XA 4DTNA 2P5GA 4F2SA 2XY5A 1JLQA 4DS5A 1KVAA 3ZCMA 4IBNA 4CEEA 3HM9A 3RWUA 4EZ6A 2HHVA 1EKEA 4QCLA 2PYLA 3DRSA 1BIZA 5CY4A 3L8BA 1L5UA 1LW0A 4FJHA 2G8FA 1BQMA 1RT6A 1WAFA 2Q3SA 3QEPA 3HYFA 4AH9A 3DI6A 1IH7A 5J2MA 4MQ3A 5K14A 3M8RA 1S6PA 4R5PA 1WSIA 3G0ZA 1ASWA 1VRUA 2ATQA 2HVIA 4BE0A 2RKIA 2X78A 4CE9A 3OYJA 3SJJA 1T03A 4M3TA 1LWCA 3QETA 4FLUA 2Y1JA 3LP1A 4M3UA 1YTUA 3LZJA 3OYMA 3SV4A 1S1TA 3C6TA 2HHQA 2AJQA 4BWMA 4RW4A 2DFHA 1HRHA 3K5OA 3MEDA 1NJWA 3SUQA 1C0UA 1WAJA 1RTHA 1TV6A 3BGRA 3JYTA 1U45A 3LP0A 2PYJA 4NCGA 1D9FA 3ZT0A 4FJJA 1XHZA 1S1UA 3AVHA 1LAVA 3ZSXA 4FJNA 2YHAA 2RN2A 4FLWA 3TWHA 3CM5A 4E3SA 4CIEA 4JRQA 1JLCA 3AA4A 5JS2A 3HPHA 1BI4A 3ZSZA 5C25A 5KTQA 3OYKA 2QK9A 4CHZA 3OS2A 3K58A 4IKFA 2B4JA 1D5AA 1IKWA 1K6YA 4Z4FA 3DLGA 3OYIA 2VWJA 3V81A 3VA0A 1A5XA 1U48A 4KHYA 3VQ9A 4OPJA 3OYLA 3HO1A 4M3ZA 4Z4HA 4CGDA 2QKBA 3JSMA 1TL3A 4KAZA 3AVGA 2BGGA 3I0SA 4HUFA 1RNHA 4DTJA 4K8ZA 4JS5A 1J53A 4O5BA 1RDBA 1S1VA 1B9DA 4IG3A 3QINA 2EHGA 3NH0A 1EETA 1I3AA 4BDYA 2BDPA 4CGHA 4DMNA 4Q5VA 4DQQA 2HHSA 4DF4A 1TL1A 3QIPA 4C8MA 3CFOA 3LALA 4DQIA 3K57A 4CJ3A 4FJGA 1ZBHA 1S1WA 3C6UA 4KV8A 4QOZB 4FJ7A 5CZ1A 1UAXA 3TI0A 3VQ5A 4WE1A 3QEIA 1BI4B 4IFVA 4CF9A 1XC9A 1RT3A 3U3YA 2B5JA 4PUOA 4DTSA 4KTZA 1QQCA 5I42A 1SKRA 2HNYA 1TKXA 2Y1IA 4B9LA 3OYNA 4DWIA 3V9ZA 3QIOA 1RT2A 3V9XA 3RMBA 3AA5X 4CFDA 1VSHA 4XIUA 1RBVA 2B6AA 2NUBA 1T7PA 3AVIA 4CHQA 3LAKA 4KHWA 3KK3A 1RBTA 1J9AA 2XY6A 4K8XA 2KTQA 1IG9A 1HNIA 3AVBA 2RF2A 4OKKA 3HP6A 1RTDA 2IC3A 4J2AA 2HVHA 1WSHA 4CHOA 4BE1A 3OYAA 4YFUA 3HP9A 3NGIA 3PV8A 3G10A 3VQAA 1D9DA 4W5TA 1S6QA 1CLQA 2YV0X 3NF9A 2BE2A 3CQ8A 3U6FA 5HP1A 1L3VA 2XO7A 4E1NA 3PO4A 4J2EA 1BHLA 2GUIA 3B6PA 3LPUA 4HUEA 1SKSA 3SI6A 4I2QA 5C42A 4Z4IA 1QE1A 4DSJA 4CF2A 2HMIA 2O4GA 1C0TA 2WONA 3RR7A 4KTQA 3VQPA 4ZTFA 4DQPA 3DOLA 4LSNA 4ID5A 2HHXA 5FROA 1SUQA 1WN7A 3QO9A 4GW6A 1RT4A 4LD0A 3QNOA 4B9UA 2HHTA 2Z1IA 4HCCA 4DU4A 4UQGA 3TABA 3NAEA 3DLBA 2X74A 1R0AA 1C0MA 1N5YA 2YHBA 3KKRA 3SV3A 1MU2A 3LAMA 2RPIA 4ZTJA 1RT5A 4FM2A 4DTXA 3HXMA 1A5VA 4OGCA 2IAJA 4CEQA 4FVMA 4ICLA 5KGXA 1DLOA 5EU7A 1NK9A 2VG6A 1UWBA 2FBYA 5FRMA 4FW2A 1DTQA 5SWMA 4FJ5A 1TVRA 3QLHA 2YNGA 1U4BA 3K59A 3BDPA 1S9GA 2XRIA 3VQ7A 4DFKA 3QNNA 4FZYA 4DTMA 4CFBA 3CYMA 4CEBA 3D0PA 4PA1A 4B08A 4AILC 3OJSA 3QEXA 3AVKA 3PX4A 1NK0A 1HQEA 4FJXA 3NE6A 1LAWA 5DMRA 2DY4A 1HYVA 1W0HA 2YKNA 3AVAA 4LY7A 2FC0A 3V1RA 4PY5A 4DSKA 1FK9A 1KCFA 1LWFA 3AO1A 2Z1HA 2ITGA 3P5JA 4CFAA 3S3NA 1I39A 3O3GA 3AVLA 1HQUA 4FJ9A 4G1QA 1TKZA 1W9HA 3ULDA 3U3GA 1BIUA 1RTJA 3HL8A 1C1AA 3S3MA 1ZBFA 1EXQA 1GOAA 4CK3A 1Q9XA 2KZMA 2DFEA 3DRPA 3TAFA 2BANA 1BGXT 4YNQA 4CERA 2YNIA 1RT1A 2LSNA 4LH4A 4TSXA 4DFPA 3SQ4A 1L3UA 2R7YA 3AO2A 4NCBA 1JLFA 1LWEA 4F2RA 4O55A 5HRPA 3P83D 3NCIA 3OYGA 3O4NA 2EX3A 2HB5A 3PUFA 4GMJB 1X9MA 4M3WA 3MECA 4HUGA 4E1MA 1FKPA 3ZT1A 4AHSA 1RDDA 5CYQA 3I8DA 4BDPA 1XI1A 4B8CA 4M3RA 3V9UA 2KFZA 3QEVA 5HRNA 2G8HA 1VSMA 4E7KA 4DFMA 3K5LA 1FKOA 3TANA 4E89A 4N56A 2IS3A 4CF1A 4CGIA 3AV9A 3CFRA 4N47A 3CM6A 4C8LA 2D5RA 4CESA 3ASMA 3RRGA 4BE2A 3VQ6A 4AHVA 3TAPA 4DFJA 3WNHA 1REVA 4F3TA 4KTWA 5HRSA 4B8AB 1X9SA 3ITHA 3F9KA 3NF8A 1F21A 1KVBA 1VSKA 1T8EA 1X9WA 4O44A 3AA2A 2G8WA 3OYEA 3S9HA 3I0RA 4CEDA 4HCBA 4CGGA 1ZYQA 3HJFA 3WNGA 5FDLA 4EP4A 2I5JA 3OYHA 1RBRA 2O4IA 2YNHA 1NJXA 4CEOA 1RDCA 2KW4A 1SV5A 2YNFA 4BDZA 3V9WA 4I9LA 3ZSYA 2FBXA 4DLGA 4J2BA 3IRXA 4OPKA 1BCMA 1QHTA 1VSFA 1S5JA 4CHYA 4DTUA 1NK4A 4FZXC 3SQ2A 3HVRA 3AO4A 3KIOA 1U49A 3O4QA 3TAMA 4CJTA 4Y1CA 1C1CA 3LWMA 3OVNA 4O0IA 4E0DA 1TKTA 1VRTA 2OZSA 4M42A 3HPOA 4CGFA 2DFFA 3RR8A 1UA1A 3NH2A 4DSLA 4J2DA 4CEFA 4FK0A 1SKWA 1KVCA 1ITGA 1QS4A 3DLEA 3L3UA 2IDOA 5J2PA 5C24A 4KHSA 3QEWA 1IKVA 1TK5A 1HYZA 3VQEA 3M8PA 3SPZA 1EX4A 4FM1A 1RDAA 2WOMA 2ZE2A 4KHUA 5CYMA 4DQRA 3E01A 3KLIA 3SUOA 1KSPA 1L3SA 1KRPA 2OPPA 2FBVA 2XY8A 3ZSVA 1JL2A 3ZT2A 3KK1A 2W42A 5J2NA 3TAGA 4AHCA 1N6QA 4N76A 3NF6A 2HHUA 1HJRA 3NGYA 1B9FA 3RMAA 3M8QA 4CJKA 4E7IA 1NKEA 3M8SA 4Z4EA 4M45A 1EP4A 1HNVA 1GOBA 3KLFA 1QTMA 3ZSRA 1VK0A 4FYDA 2HHWA 1SL0A 3OYDA 3V6DA 3ZSOA 4DU3A 3HK2A 3LP2A 5HROA 2D0BA 5CZ2A 4BACA 4AHRA 1NK7A 2Z1JA 1JL1A 2P51A 4CK2A 3SQ0A 2GV9A 2A1RA 1NK6A 1U47A 4Z4GA 1TAUA 3SUPA 2FBTA 4F3OA 4CIGA 4W5NA 3AO3A 1Z25A 5HRRA 1CXQA 4H4OA 1C1BA 2KZZA 5I3UA 4OGEA 3LWLA 4C8OA 3DLRA 1Q8IA 4FLTA 4RG8A 1WSFA 4CJUA 2IGIA 3AO5A 4CHNA 3TARA 1BQNA 3L3VA 4C8NA 1O1WA 3A2FA 1C6VA 4CGJA 3L2RA 1SL1A 4FZZA 3DM2A 4FK4A 3PX0A 4CJRA 2ZD1A 2OPRA 1BISA 2OPQA 3WNEA 3KLHA 4O0JA 1HMVA 3ZSQA 4E7HA 1WSGA 5KI6A 1L3TA 1JLBA 1KTQA 1VSIA 3MAQA 1JXEA 2HNDA 2F96A 4OLAA 1T05A 1TKDA 3HVTA 3OYFA 2XHBA 4EP5A 3NBPA 2HNZA 4NYFA 4Z4CA 3OYCA 4CCHA 1LW2A 2ZQBA 4M3XA 4MFBA 4OKEA 3KK2A 4B9MA 4O4GA 4CJVA 4H4MA 3AVFA 1UA0A 3NH1A 2IOCA 3H08A 4CFCA 4CHPA 4Q0BA 1BL3A 3DLKA 4CK1A 3HT3A 3SYZA 1UOCA 1WSJA 4DSFA 5KGWA 5SZTA 4I7FA 4AHTA 4CJ5A 4FJ8A 5KRTA 4B9VA 4KB0A 4FJIA 5D3GA 4KO0A 3VQ4A 3S3OA 4RW7A 2KQ2A 3NHGA 3VQCA 1VSDA 5FRNA 1WNSA 4FJMA 1IKYA 4AHUA 3RRHA 3SPYA 2OA8A 4KHQA 2HW3A 4RW9A 4OJRA 3ZT3A 1RCHA 4CEZA 2ETJA 3MEEA 4DS4A 3KD1E 1FXXA 2E6MA 3VQQA 4N5SA 1J5OA 1ZBUA 1WLJA 2QXFA 2PZSA 4QAGA 3OS0A 1TGOA 2XY7A 3MXIA 4W5QA 3RMCA 1LV5A 3PY8A 4NYNA 1ZBLA 1NOYA 2F8SA 3IS9A 1A5WA 3NF7A 2GBZA 3KLEA 4DSIA 1KLMA 3AVCA 2X6SA 3QESA 3V9SA 3EY1A 4DF8A 1Y97A 4H8KA 4RW6A 2JLEA 3K2PA 4IFYA 3TAEA 3MXMA 4I9QA 5J2QA 2E4LA 3O3HA 4LH5A 3TR8A 3T19A 4CECA 1ZBIA 4CJEA 3HPGA 4FLVA 4FJLA 3VN5A 4KPYA 1JLEA 2Z1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KKO A;  3C94 A;  4OKJ A;  1XHX A;  1VSJ A;  3ZSW A;  4CIF A;  3F73 A;  3MXJ A;  4NCA A;  4B3O A;  3WNF A;  1RIL A;  3C95 A;  1RBS A;  3EYZ A;  2VG5 A;  4W5O A;  3RTV A;  2E6L A;  4E7J A;  3K5M A;  5J1E A;  3PX6 A;  1NOZ A;  4ID1 A;  4CJQ A;  3L2U A;  2VG7 A;  3ISN C;  3B6O A;  4CJW A;  3CFP A;  2G8U A;  3PO5 A;  1YTA A;  3UIQ A;  3P1G A;  4CEA A;  3T3F A;  3L2Q A;  1S9E A;  4OVL A;  1HPZ A;  3HST B;  4IDK A;  2G8I A;  1TK8 A;  3KJV A;  2PY5 A;  1YT3 A;  1NK8 A;  3OS1 A;  4KRF A;  2P1J A;  3LAN A;  4FJK A;  4KHN A;  4W5R A;  5DK5 A;  1JLG A;  4DSE A;  2QKK A;  4KB1 A;  5KRS A;  2G8K A;  1GOC A;  2OPS A;  2DTU A;  1Z26 A;  1JKH A;  3CG7 A;  4F4K A;  1JLA A;  4DTO A;  4CJF A;  4RW8 A;  3AVN A;  1IO2 A;  3KLG A;  1D8Y A;  3SQ1 A;  3SNN A;  4KI6 A;  4LSL A;  3VQB A;  3LZI A;  1G15 A;  4HHT A;  4DTR A;  3KD5 E;  1KFD A;  2YKM A;  3RMD A;  1QSS A;  3SUN A;  3KTQ A;  4CF8 A;  2X6N A;  4N41 A;  4F8R A;  4Y1D A;  3L2W A;  2OYQ A;  4DLE A;  3KKS A;  4OLB A;  4GVM A;  4CJL A;  5HBM A;  3TAQ A;  1WSE A;  4B9N A;  1NJZ A;  1NKC A;  4CJS A;  1BCO A;  1J54 A;  1RT7 A;  1DTT A;  3O3F A;  4E7L A;  1Q9Y A;  4ELU A;  4JS4 A;  4CJ4 A;  4KRE A;  1NK5 A;  4DQS A;  4FW1 A;  3IG1 A;  4ZHR A;  4BWJ A;  2P5O A;  4CF0 A;  4FXD A;  2JGU A;  3DMJ A;  1RBU A;  2VWK A;  3AVJ A;  1QSY A;  3AA3 A;  4FM0 A;  1QSL A;  4PQU A;  5JS1 A;  3DYA A;  4M41 A;  2D0C A;  3MEG A;  4DU1 A;  1NJY A;  4C8K A;  1JXB A;  1YVU A;  3OYB A;  4FLY A;  3IAY A;  1CXU A;  1TAQ A;  3V4I A;  1ASU A;  3OY9 A;  1VSE A;  4DG1 A;  3NGZ A;  1TK0 A;  3QER A;  1CZB A;  3L2V A;  2G8V A;  2KFN A;  3DRR A;  4B9S A;  4B9T A;  4IG0 A;  2OZM A;  1NKB A;  4JLH A;  1U04 A;  3DOK A;  3V1O A;  4Z0U A;  1ASV A;  4FLZ A;  3OJU A;  3LPT A;  4FCY A;  3D45 A;  4HTU A;  3NDK A;  4DTP A;  1KLN A;  4ELT A;  3NFA A;  3LDS A;  2A1S A;  2D0A A;  3ALY A;  1CZ9 A;  3AVM A;  5HLF A;  3V1Q A;  1B92 A;  4L8R B;  4HVJ A;  1KFS A;  4E19 A;  3VQ8 A;  4FLX A;  3SZ2 A;  1RTI A;  3FFI A;  4FK2 A;  4ELV A;  1HYS A;  3LP3 A;  4PWD A;  1VSL A;  4KI4 A;  3K5N A;  1X1P A;  3EZ5 A;  1IKX A;  3THV A;  4KFB A;  1SL2 A;  4JRP A;  3ZT4 A;  5E41 A;  4CJP A;  3SCX A;  3DLH A;  1XWL A;  4I2P A;  4M3Y A;  4EZ9 A;  3T1A A;  2F8T A;  3VA3 A;  5T7B A;  3VQD A;  1S1X A;  4DTN A;  2P5G A;  4F2S A;  2XY5 A;  1JLQ A;  4DS5 A;  1KVA A;  3ZCM A;  4IBN A;  4CEE A;  3HM9 A;  3RWU A;  4EZ6 A;  2HHV A;  1EKE A;  4QCL A;  2PYL A;  3DRS A;  1BIZ A;  5CY4 A;  3L8B A;  1L5U A;  1LW0 A;  4FJH A;  2G8F A;  1BQM A;  1RT6 A;  1WAF A;  2Q3S A;  3QEP A;  3HYF A;  4AH9 A;  3DI6 A;  1IH7 A;  5J2M A;  4MQ3 A;  5K14 A;  3M8R A;  1S6P A;  4R5P A;  1WSI A;  3G0Z A;  1ASW A;  1VRU A;  2ATQ A;  2HVI A;  4BE0 A;  2RKI A;  2X78 A;  4CE9 A;  3OYJ A;  3SJJ A;  1T03 A;  4M3T A;  1LWC A;  3QET A;  4FLU A;  2Y1J A;  3LP1 A;  4M3U A;  1YTU A;  3LZJ A;  3OYM A;  3SV4 A;  1S1T A;  3C6T A;  2HHQ A;  2AJQ A;  4BWM A;  4RW4 A;  2DFH A;  1HRH A;  3K5O A;  3MED A;  1NJW A;  3SUQ A;  1C0U A;  1WAJ A;  1RTH A;  1TV6 A;  3BGR A;  3JYT A;  1U45 A;  3LP0 A;  2PYJ A;  4NCG A;  1D9F A;  3ZT0 A;  4FJJ A;  1XHZ A;  1S1U A;  3AVH A;  1LAV A;  3ZSX A;  4FJN A;  2YHA A;  2RN2 A;  4FLW A;  3TWH A;  3CM5 A;  4E3S A;  4CIE A;  4JRQ A;  1JLC A;  3AA4 A;  5JS2 A;  3HPH A;  1BI4 A;  3ZSZ A;  5C25 A;  5KTQ A;  3OYK A;  2QK9 A;  4CHZ A;  3OS2 A;  3K58 A;  4IKF A;  2B4J A;  1D5A A;  1IKW A;  1K6Y A;  4Z4F A;  3DLG A;  3OYI A;  2VWJ A;  3V81 A;  3VA0 A;  1A5X A;  1U48 A;  4KHY A;  3VQ9 A;  4OPJ A;  3OYL A;  3HO1 A;  4M3Z A;  4Z4H A;  4CGD A;  2QKB A;  3JSM A;  1TL3 A;  4KAZ A;  3AVG A;  2BGG A;  3I0S A;  4HUF A;  1RNH A;  4DTJ A;  4K8Z A;  4JS5 A;  1J53 A;  4O5B A;  1RDB A;  1S1V A;  1B9D A;  4IG3 A;  3QIN A;  2EHG A;  3NH0 A;  1EET A;  1I3A A;  4BDY A;  2BDP A;  4CGH A;  4DMN A;  4Q5V A;  4DQQ A;  2HHS A;  4DF4 A;  1TL1 A;  3QIP A;  4C8M A;  3CFO A;  3LAL A;  4DQI A;  3K57 A;  4CJ3 A;  4FJG A;  1ZBH A;  1S1W A;  3C6U A;  4KV8 A;  4QOZ B;  4FJ7 A;  5CZ1 A;  1UAX A;  3TI0 A;  3VQ5 A;  4WE1 A;  3QEI A;  1BI4 B;  4IFV A;  4CF9 A;  1XC9 A;  1RT3 A;  3U3Y A;  2B5J A;  4PUO A;  4DTS A;  4KTZ A;  1QQC A;  5I42 A;  1SKR A;  2HNY A;  1TKX A;  2Y1I A;  4B9L A;  3OYN A;  4DWI A;  3V9Z A;  3QIO A;  1RT2 A;  3V9X A;  3RMB A;  3AA5 X;  4CFD A;  1VSH A;  4XIU A;  1RBV A;  2B6A A;  2NUB A;  1T7P A;  3AVI A;  4CHQ A;  3LAK A;  4KHW A;  3KK3 A;  1RBT A;  1J9A A;  2XY6 A;  4K8X A;  2KTQ A;  1IG9 A;  1HNI A;  3AVB A;  2RF2 A;  4OKK A;  3HP6 A;  1RTD A;  2IC3 A;  4J2A A;  2HVH A;  1WSH A;  4CHO A;  4BE1 A;  3OYA A;  4YFU A;  3HP9 A;  3NGI A;  3PV8 A;  3G10 A;  3VQA A;  1D9D A;  4W5T A;  1S6Q A;  1CLQ A;  2YV0 X;  3NF9 A;  2BE2 A;  3CQ8 A;  3U6F A;  5HP1 A;  1L3V A;  2XO7 A;  4E1N A;  3PO4 A;  4J2E A;  1BHL A;  2GUI A;  3B6P A;  3LPU A;  4HUE A;  1SKS A;  3SI6 A;  4I2Q A;  5C42 A;  4Z4I A;  1QE1 A;  4DSJ A;  4CF2 A;  2HMI A;  2O4G A;  1C0T A;  2WON A;  3RR7 A;  4KTQ A;  3VQP A;  4ZTF A;  4DQP A;  3DOL A;  4LSN A;  4ID5 A;  2HHX A;  5FRO A;  1SUQ A;  1WN7 A;  3QO9 A;  4GW6 A;  1RT4 A;  4LD0 A;  3QNO A;  4B9U A;  2HHT A;  2Z1I A;  4HCC A;  4DU4 A;  4UQG A;  3TAB A;  3NAE A;  3DLB A;  2X74 A;  1R0A A;  1C0M A;  1N5Y A;  2YHB A;  3KKR A;  3SV3 A;  1MU2 A;  3LAM A;  2RPI A;  4ZTJ A;  1RT5 A;  4FM2 A;  4DTX A;  3HXM A;  1A5V A;  4OGC A;  2IAJ A;  4CEQ A;  4FVM A;  4ICL A;  5KGX A;  1DLO A;  5EU7 A;  1NK9 A;  2VG6 A;  1UWB A;  2FBY A;  5FRM A;  4FW2 A;  1DTQ A;  5SWM A;  4FJ5 A;  1TVR A;  3QLH A;  2YNG A;  1U4B A;  3K59 A;  3BDP A;  1S9G A;  2XRI A;  3VQ7 A;  4DFK A;  3QNN A;  4FZY A;  4DTM A;  4CFB A;  3CYM A;  4CEB A;  3D0P A;  4PA1 A;  4B08 A;  4AIL C;  3OJS A;  3QEX A;  3AVK A;  3PX4 A;  1NK0 A;  1HQE A;  4FJX A;  3NE6 A;  1LAW A;  5DMR A;  2DY4 A;  1HYV A;  1W0H A;  2YKN A;  3AVA A;  4LY7 A;  2FC0 A;  3V1R A;  4PY5 A;  4DSK A;  1FK9 A;  1KCF A;  1LWF A;  3AO1 A;  2Z1H A;  2ITG A;  3P5J A;  4CFA A;  3S3N A;  1I39 A;  3O3G A;  3AVL A;  1HQU A;  4FJ9 A;  4G1Q A;  1TKZ A;  1W9H A;  3ULD A;  3U3G A;  1BIU A;  1RTJ A;  3HL8 A;  1C1A A;  3S3M A;  1ZBF A;  1EXQ A;  1GOA A;  4CK3 A;  1Q9X A;  2KZM A;  2DFE A;  3DRP A;  3TAF A;  2BAN A;  1BGX T;  4YNQ A;  4CER A;  2YNI A;  1RT1 A;  2LSN A;  4LH4 A;  4TSX A;  4DFP A;  3SQ4 A;  1L3U A;  2R7Y A;  3AO2 A;  4NCB A;  1JLF A;  1LWE A;  4F2R A;  4O55 A;  5HRP A;  3P83 D;  3NCI A;  3OYG A;  3O4N A;  2EX3 A;  2HB5 A;  3PUF A;  4GMJ B;  1X9M A;  4M3W A;  3MEC A;  4HUG A;  4E1M A;  1FKP A;  3ZT1 A;  4AHS A;  1RDD A;  5CYQ A;  3I8D A;  4BDP A;  1XI1 A;  4B8C A;  4M3R A;  3V9U A;  2KFZ A;  3QEV A;  5HRN A;  2G8H A;  1VSM A;  4E7K A;  4DFM A;  3K5L A;  1FKO A;  3TAN A;  4E89 A;  4N56 A;  2IS3 A;  4CF1 A;  4CGI A;  3AV9 A;  3CFR A;  4N47 A;  3CM6 A;  4C8L A;  2D5R A;  4CES A;  3ASM A;  3RRG A;  4BE2 A;  3VQ6 A;  4AHV A;  3TAP A;  4DFJ A;  3WNH A;  1REV A;  4F3T A;  4KTW A;  5HRS A;  4B8A B;  1X9S A;  3ITH A;  3F9K A;  3NF8 A;  1F21 A;  1KVB A;  1VSK A;  1T8E A;  1X9W A;  4O44 A;  3AA2 A;  2G8W A;  3OYE A;  3S9H A;  3I0R A;  4CED A;  4HCB A;  4CGG A;  1ZYQ A;  3HJF A;  3WNG A;  5FDL A;  4EP4 A;  2I5J A;  3OYH A;  1RBR A;  2O4I A;  2YNH A;  1NJX A;  4CEO A;  1RDC A;  2KW4 A;  1SV5 A;  2YNF A;  4BDZ A;  3V9W A;  4I9L A;  3ZSY A;  2FBX A;  4DLG A;  4J2B A;  3IRX A;  4OPK A;  1BCM A;  1QHT A;  1VSF A;  1S5J A;  4CHY A;  4DTU A;  1NK4 A;  4FZX C;  3SQ2 A;  3HVR A;  3AO4 A;  3KIO A;  1U49 A;  3O4Q A;  3TAM A;  4CJT A;  4Y1C A;  1C1C A;  3LWM A;  3OVN A;  4O0I A;  4E0D A;  1TKT A;  1VRT A;  2OZS A;  4M42 A;  3HPO A;  4CGF A;  2DFF A;  3RR8 A;  1UA1 A;  3NH2 A;  4DSL A;  4J2D A;  4CEF A;  4FK0 A;  1SKW A;  1KVC A;  1ITG A;  1QS4 A;  3DLE A;  3L3U A;  2IDO A;  5J2P A;  5C24 A;  4KHS A;  3QEW A;  1IKV A;  1TK5 A;  1HYZ A;  3VQE A;  3M8P A;  3SPZ A;  1EX4 A;  4FM1 A;  1RDA A;  2WOM A;  2ZE2 A;  4KHU A;  5CYM A;  4DQR A;  3E01 A;  3KLI A;  3SUO A;  1KSP A;  1L3S A;  1KRP A;  2OPP A;  2FBV A;  2XY8 A;  3ZSV A;  1JL2 A;  3ZT2 A;  3KK1 A;  2W42 A;  5J2N A;  3TAG A;  4AHC A;  1N6Q A;  4N76 A;  3NF6 A;  2HHU A;  1HJR A;  3NGY A;  1B9F A;  3RMA A;  3M8Q A;  4CJK A;  4E7I A;  1NKE A;  3M8S A;  4Z4E A;  4M45 A;  1EP4 A;  1HNV A;  1GOB A;  3KLF A;  1QTM A;  3ZSR A;  1VK0 A;  4FYD A;  2HHW A;  1SL0 A;  3OYD A;  3V6D A;  3ZSO A;  4DU3 A;  3HK2 A;  3LP2 A;  5HRO A;  2D0B A;  5CZ2 A;  4BAC A;  4AHR A;  1NK7 A;  2Z1J A;  1JL1 A;  2P51 A;  4CK2 A;  3SQ0 A;  2GV9 A;  2A1R A;  1NK6 A;  1U47 A;  4Z4G A;  1TAU A;  3SUP A;  2FBT A;  4F3O A;  4CIG A;  4W5N A;  3AO3 A;  1Z25 A;  5HRR A;  1CXQ A;  4H4O A;  1C1B A;  2KZZ A;  5I3U A;  4OGE A;  3LWL A;  4C8O A;  3DLR A;  1Q8I A;  4FLT A;  4RG8 A;  1WSF A;  4CJU A;  2IGI A;  3AO5 A;  4CHN A;  3TAR A;  1BQN A;  3L3V A;  4C8N A;  1O1W A;  3A2F A;  1C6V A;  4CGJ A;  3L2R A;  1SL1 A;  4FZZ A;  3DM2 A;  4FK4 A;  3PX0 A;  4CJR A;  2ZD1 A;  2OPR A;  1BIS A;  2OPQ A;  3WNE A;  3KLH A;  4O0J A;  1HMV A;  3ZSQ A;  4E7H A;  1WSG A;  5KI6 A;  1L3T A;  1JLB A;  1KTQ A;  1VSI A;  3MAQ A;  1JXE A;  2HND A;  2F96 A;  4OLA A;  1T05 A;  1TKD A;  3HVT A;  3OYF A;  2XHB A;  4EP5 A;  3NBP A;  2HNZ A;  4NYF A;  4Z4C A;  3OYC A;  4CCH A;  1LW2 A;  2ZQB A;  4M3X A;  4MFB A;  4OKE A;  3KK2 A;  4B9M A;  4O4G A;  4CJV A;  4H4M A;  3AVF A;  1UA0 A;  3NH1 A;  2IOC A;  3H08 A;  4CFC A;  4CHP A;  4Q0B A;  1BL3 A;  3DLK A;  4CK1 A;  3HT3 A;  3SYZ A;  1UOC A;  1WSJ A;  4DSF A;  5KGW A;  5SZT A;  4I7F A;  4AHT A;  4CJ5 A;  4FJ8 A;  5KRT A;  4B9V A;  4KB0 A;  4FJI A;  5D3G A;  4KO0 A;  3VQ4 A;  3S3O A;  4RW7 A;  2KQ2 A;  3NHG A;  3VQC A;  1VSD A;  5FRN A;  1WNS A;  4FJM A;  1IKY A;  4AHU A;  3RRH A;  3SPY A;  2OA8 A;  4KHQ A;  2HW3 A;  4RW9 A;  4OJR A;  3ZT3 A;  1RCH A;  4CEZ A;  2ETJ A;  3MEE A;  4DS4 A;  3KD1 E;  1FXX A;  2E6M A;  3VQQ A;  4N5S A;  1J5O A;  1ZBU A;  1WLJ A;  2QXF A;  2PZS A;  4QAG A;  3OS0 A;  1TGO A;  2XY7 A;  3MXI A;  4W5Q A;  3RMC A;  1LV5 A;  3PY8 A;  4NYN A;  1ZBL A;  1NOY A;  2F8S A;  3IS9 A;  1A5W A;  3NF7 A;  2GBZ A;  3KLE A;  4DSI A;  1KLM A;  3AVC A;  2X6S A;  3QES A;  3V9S A;  3EY1 A;  4DF8 A;  1Y97 A;  4H8K A;  4RW6 A;  2JLE A;  3K2P A;  4IFY A;  3TAE A;  3MXM A;  4I9Q A;  5J2Q A;  2E4L A;  3O3H A;  4LH5 A;  3TR8 A;  3T19 A;  4CEC A;  1ZBI A;  4CJE A;  3HPG A;  4FLV A;  4FJL A;  3VN5 A;  4KPY A;  1JLE A;  2Z1G A; 
#chains in the Genus database with same CATH topology
 3C94 A;  5M1P A;  2VG5 A;  1C0G A;  1NOZ A;  4CJW A;  3ISN C;  1NMN A;  3PO5 A;  3P1G A;  4BC2 A;  5BRF A;  4DUZ K;  2G8I A;  1Q7Y O;  3F9M A;  1VQP N;  4FWK A;  4W5R A;  1E3M A;  2E1Y A;  5M1Q A;  1GOC A;  2OPS A;  2DTU A;  4CJF A;  4RW8 A;  1R59 O;  3O6W A;  1G15 A;  3M1F A;  3RMD A;  1QSS A;  4Y1D A;  3L2W A;  4DR5 K;  1YJN N;  1NJZ A;  1NKC A;  1Q9Y A;  1RT7 A;  3O3F A;  3HTV A;  4DQS A;  4ZHR A;  4BWJ A;  4FXD A;  4NXN K;  1N32 K;  4B3T K;  2VWK A;  1G99 A;  3AVJ A;  1S3X A;  2D4W A;  3AA3 A;  3I33 A;  4BRA A;  4YDU C;  4FM0 A;  1QSL A;  3CJ1 A;  2D0C A;  5JS1 A;  4C8K A;  3L0Q A;  3OYB A;  3NVM A;  3IAY A;  5AQX A;  2WFB A;  4DG1 A;  3NGZ A;  1CZB A;  3L2V A;  3UB5 A;  4B9T A;  3MN5 A;  1NKB A;  3VES A;  3OJU A;  1NU0 A;  2Q97 A;  4ELT A;  4FWQ A;  2A1S A;  3AVM A;  5HLF A;  4FLX A;  3SZ2 A;  5AFU H;  3VF2 A;  4KI4 A;  1BG3 A;  3K5N A;  5AQM A;  5HOO A;  1DT9 A;  4IZ9 A;  1SL2 A;  2HOE A;  3SCX A;  4M3Y A;  3D2E A;  2E88 A;  1T44 A;  3A0I X;  3FGU A;  2P5G A;  1JLQ A;  4DS5 A;  4IBN A;  2PYL A;  1BIZ A;  5CY4 A;  3L8B A;  4FJH A;  2G8F A;  1WAF A;  2Q3S A;  5ADX A;  3HYF A;  3QEP A;  5CR4 A;  5J2M A;  5K14 A;  5TKY A;  1S6P A;  1WSI A;  3GOI A;  1VRU A;  4CD1 A;  1VHX A;  4IFE A;  3OYJ A;  1T03 A;  2IVO A;  1LWC A;  3MCA B;  3LP1 A;  1YTU A;  3LZJ A;  2P9L B;  1S1T A;  2HHQ A;  2E2Q A;  3THY B;  4FWP A;  1RTH A;  2V7Z A;  3TTC A;  4GV6 A;  4NCG A;  1D9F A;  4A5B A;  1XHZ A;  3MN7 A;  1S1U A;  3H6E A;  3ZSX A;  4FJN A;  5AQO A;  2RN2 A;  3FR0 A;  3BUZ B;  3CM5 A;  3QIC A;  4CIE A;  4JRQ A;  3EZW A;  5JS2 A;  4IOX A;  5KTQ A;  3OS2 A;  4CZJ A;  4IKF A;  1K6Y A;  4Z4F A;  1A5X A;  4KHY A;  3LDL A;  3HO1 A;  2A6A A;  4Z4H A;  4CGD A;  3JSM A;  1J53 A;  4O5B A;  1KQS M;  2HMP A;  4IG3 A;  2EHG A;  4BDY A;  2VYP A;  1IBK K;  3EN9 A;  4DMN A;  2AP1 A;  1TL1 A;  3QIP A;  3CFO A;  3D7E O;  3K57 A;  3C6U A;  4QOZ B;  3MWP A;  3QEI A;  4IFV A;  4CF9 A;  1FJG K;  5BR9 A;  1TKX A;  4DWI A;  2D0O A;  3RMB A;  4CFD A;  2XY6 A;  1RBT A;  4K8X A;  4OKK A;  4BR0 A;  3HP6 A;  5AQT A;  4J2A A;  1WSH A;  4BG8 A;  4CHO A;  2W6K A;  5IWA K;  4YFU A;  1WBB A;  3NGI A;  3PV8 A;  1WB9 A;  3NVK A;  4H5V A;  2P9L A;  3CCS N;  4W5T A;  2EWS A;  1CLQ A;  2DPN A;  3U6F A;  1ATN A;  3PO4 A;  2GUI A;  3SI6 A;  4DHY A;  1U2V B;  4GY2 B;  3RR7 A;  4JKB A;  4DQP A;  2W40 A;  4ID5 A;  3IDH A;  4G9Z A;  4UQG A;  3EE9 A;  3NAE A;  4M63 C;  3SV3 A;  1MU2 A;  4FPA A;  4ZTJ A;  1ESV A;  1RT5 A;  4DTX A;  4X62 K;  4GV3 A;  3D2E B;  4OGC A;  1NK9 A;  1DLO A;  1VQM N;  2HST A;  2UUB K;  5SWM A;  1DTQ A;  2BTF A;  4FWS A;  4BRL A;  2P9P B;  2KLA A;  1U4B A;  3VQ7 A;  4JYA K;  4CFB A;  2ZGZ A;  1NK0 A;  5C2D A;  3QEX A;  3AVK A;  4KH4 A;  3LDP A;  3AVA A;  2FC0 A;  3KK7 A;  4PY5 A;  3C6H A;  3AGR A;  3C65 A;  3AO1 A;  2Z1H A;  3G6E N;  3S3N A;  1TKZ A;  4C1N I;  3U3G A;  1BIU A;  1EXQ A;  1Q9X A;  3TAF A;  1BGX T;  4YNQ A;  4K43 A;  1XQS C;  4LH4 A;  2R7Y A;  3VEO A;  2GUP A;  3VOV A;  4IJA A;  4HUG A;  1FKP A;  4B8C A;  3OW2 M;  4M3R A;  3V9U A;  3QBX A;  3K5L A;  3TAN A;  4E89 A;  4N56 A;  2IS3 A;  4AM7 A;  4N47 A;  2D5R A;  3RRG A;  3D6R A;  5AQV A;  1ILY A;  4KTW A;  3O9T A;  5HRS A;  3ITH A;  3F9K A;  3NF8 A;  1F21 A;  2YX6 A;  1T8E A;  1X9W A;  3L4Q A;  4O44 A;  4PKI A;  4F9O A;  5FDL A;  1DKG D;  1RBR A;  1VQ5 N;  4XH5 A;  2O4I A;  1NJX A;  4CEO A;  1RDC A;  2KW4 A;  4LF4 K;  4GVE A;  4Y0W A;  5EY4 A;  4I9L A;  4J2B A;  3C6A A;  1BCM A;  1QHT A;  1GLF O;  4B1W B;  4DTU A;  4FZX C;  3TAM A;  2HHH K;  3C7N B;  4Y1C A;  5FPN A;  1TKT A;  1VRT A;  2DFF A;  3NH2 A;  1XMO K;  4J2D A;  2HBJ A;  1QS4 A;  1HYZ A;  1TUU A;  2A42 A;  3CQX A;  2F9W A;  3M8P A;  1EX4 A;  4DV3 K;  2Q1N A;  4BRN A;  3R8E A;  4EIA A;  1KSP A;  3CPW M;  3TAG A;  2W42 A;  2HHU A;  3PIP L;  3RMA A;  4E7I A;  2O8D B;  3LL3 A;  2HHW A;  3OYD A;  3ZSO A;  4DU3 A;  3VTH A;  2D0B A;  5CZ2 A;  4PHT X;  3ZX0 A;  1JL1 A;  4CK2 A;  2GV9 A;  1U47 A;  1GLJ O;  5JLH A;  4F3O A;  4CIG A;  1Z25 A;  3BZC A;  4IEI A;  1K8K A;  3CPE A;  5I3U A;  2V52 B;  1NLV A;  4IOA L;  3I55 N;  1WSF A;  3O4W A;  4CGJ A;  3A2F A;  4FZZ A;  4JKC A;  4OPH A;  4BRP A;  4EHT A;  4CJR A;  2OPR A;  2PAV A;  2QI2 A;  3R9P A;  2UXD K;  1OKJ A;  2GWK A;  5DM6 L;  3CCJ N;  4B1U B;  4OO1 J;  1RDU A;  3BP8 A;  3OYF A;  4EP5 A;  2QWQ A;  3NBP A;  4Z4C A;  2A41 A;  3CCQ N;  3ZYY X;  4OKE A;  4B9M A;  3ATU A;  4B3R K;  3ENH A;  3HSC A;  4BVP A;  1EQY A;  3NH1 A;  3H08 A;  3DLK A;  3VEW A;  5KGW A;  4AHT A;  4CJ5 A;  5KRT A;  4FJI A;  4K25 A;  4JI4 K;  4KO0 A;  3ZEU B;  3T7Z A;  4AHU A;  1IBM K;  4KHQ A;  2HW3 A;  4H0O A;  1IJJ A;  4WQ4 A;  4BRK A;  3VQQ A;  1WLJ A;  4QAG A;  4H0X B;  2XY7 A;  1LV5 A;  1KAY A;  5HL7 L;  3Q7C A;  4NYN A;  5AQS A;  3KLE A;  2GBZ A;  1KLM A;  3Q7B A;  2X6S A;  3QES A;  1HNZ K;  4B1V A;  3M3Z A;  3TAE A;  1NGJ A;  4FOE A;  5C0Y A;  3VEZ A;  1TYQ A;  2W6L A;  3P38 A;  2YJE A;  4B3O A;  4CIF A;  1VSJ A;  4NCA A;  2A3Z A;  4OPA A;  3WNF A;  1RIL A;  3E9L A;  4W5O A;  3RTV A;  3B8A X;  2VG7 A;  3CFP A;  4CEA A;  3T3F A;  4C23 A;  1S9E A;  4FWO A;  3THW A;  1TK8 A;  2Q36 A;  3KJV A;  1NK8 A;  3LAN A;  5JLF A;  1NJI O;  5BRD A;  1OH5 A;  3EE8 A;  5KRS A;  1JKH A;  4F4K A;  3AVN A;  4LSL A;  3VQB A;  4FL9 A;  4HHT A;  1KAZ A;  2YKM A;  4CZE A;  3KTQ A;  3SUN A;  2X6N A;  3C7N A;  3KKS A;  4JI5 K;  4CJL A;  3CCU N;  3VTI A;  1BCO A;  1DTT A;  2QWL A;  4KRE A;  4FW1 A;  2JGU A;  3DMJ A;  1RBU A;  4CZK A;  3VEY A;  4MLE A;  5M1F A;  4KBO A;  3DYA A;  1YVU A;  4FLY A;  3ID6 A;  2QWR A;  1TK0 A;  2G8V A;  2QXL A;  1LOT B;  3CMA N;  3L6Q A;  4B9S A;  1NGG A;  4CBX A;  4UY8 O;  4IG0 A;  2OZM A;  1U04 A;  4ILJ A;  1ASV A;  2NRZ A;  4JK9 A;  4FLZ A;  4FCY A;  4DTP A;  1KLN A;  4JI6 K;  3J7Z O;  3QFP A;  1U6Z A;  3ALY A;  4BR7 A;  2WBN A;  3QBW A;  3A5L C;  4L8R B;  1KFS A;  4FK2 A;  1HYS A;  1VSL A;  1XUP O;  3EZ5 A;  4KFB A;  3ZT4 A;  4CJP A;  3H3O B;  4H5R A;  4EZ9 A;  5AZJ A;  5BR8 K;  4DV2 K;  4H5W A;  5AQG A;  3VQD A;  1S1X A;  3TSQ A;  2XY5 A;  3ZCM A;  4CEE A;  1EKE A;  4CZM A;  3DRS A;  5AQH A;  1LW0 A;  1T3V A;  1BQM A;  2E2N A;  3CCV N;  4AH9 A;  1IH7 A;  3M8R A;  2F4V K;  2JWL A;  2PBD A;  4R5P A;  2ZJR L;  3G0Z A;  4JKF A;  2QEX N;  2HVI A;  4RCH A;  4BE0 A;  4CE9 A;  3SJJ A;  4H0P A;  4FLU A;  3S41 A;  1GLL O;  3O80 A;  1YIT N;  3C6T A;  2AJQ A;  4RW4 A;  1Q81 O;  1BUP A;  3K5O A;  1NJW A;  3BGR A;  1BA0 A;  1MWM A;  3LP0 A;  3TSU A;  2PYJ A;  2Q2R A;  3AVH A;  1LAV A;  1BU6 O;  2ASP A;  3TWH A;  5AZI A;  5JVH L;  4DR3 K;  3ZSZ A;  1BI4 A;  2QM1 A;  5C25 A;  3K58 A;  1IKW A;  3W3D A;  3G4S N;  4IO8 A;  5AZI B;  3VQ9 A;  4BGB A;  5GAH P;  3OYL A;  4M3Z A;  2QKB A;  4KAZ A;  3J7A P;  3I0S A;  5B8H A;  3J80 O;  2FLO A;  1RDB A;  3QIN A;  4BC3 A;  1BA1 A;  4B3M K;  1VQ9 N;  4A2B A;  2ASO A;  4DQQ A;  4DF4 A;  4DQI A;  4CJ3 A;  4NLB A;  1HKB A;  1QQN A;  5CZ1 A;  4BRE A;  3OA9 A;  5F0X A;  3J81 O;  4BR4 A;  1BI4 B;  3WXK A;  4DTS A;  2GEM A;  3K9K A;  4KTZ A;  3THX A;  2HNY A;  4KHP K;  5ELZ A;  1M1K O;  1W2B M;  3PSF A;  3AA5 X;  3AAP A;  1CZA N;  4XIU A;  2NUB A;  3CJC A;  3AVI A;  4KHW A;  2HVH A;  4BE1 A;  1X3N A;  3G10 A;  3VQA A;  1YUW A;  2YHY A;  4E1N A;  3CET A;  2A40 A;  3TTD A;  5C42 A;  4Z4I A;  1QE1 A;  3H1Q A;  2P9I A;  4B9Q A;  3GE1 A;  5C10 A;  3D2F A;  5LJW A;  2HMI A;  1IV0 A;  3VQP A;  2HHX A;  4LSN A;  3HI0 A;  5FRO A;  1SUQ A;  1WN7 A;  3QO9 A;  4V19 S;  2HHT A;  5M1N A;  4BRM A;  4HCC A;  3WT0 A;  4DR1 K;  3TAB A;  3CC2 N;  2X74 A;  1R0A A;  1N5Y A;  2YHB A;  3KKR A;  3LAM A;  5AZJ B;  1SS6 A;  4FM2 A;  3HXM A;  1W97 L;  5KGX A;  5EU7 A;  1TVR A;  3THY A;  3O08 A;  3CYM A;  4B08 A;  3NE6 A;  5DMR A;  2ZWH A;  1VQ7 N;  3V1R A;  1QQM A;  3O9R A;  1OH6 A;  1ATS A;  4CFA A;  5H1S Q;  4IEE A;  5GAE P;  3VEX A;  4DV4 K;  3O1B A;  2CH6 A;  4FSV A;  5AQY A;  1ZBF A;  1QSY A;  4CJ7 A;  3WEE B;  1NGA A;  3SQ4 A;  1L3U A;  4NCB A;  3RSE A;  4F2R A;  4O55 A;  5HRP A;  3CCE N;  5TKW A;  5LL6 Z;  1P90 A;  3F2K A;  3NCI A;  4QS8 A;  3O4N A;  2EX3 A;  3PUF A;  1O13 A;  5M1O A;  4GMJ B;  3UKU A;  4M3W A;  3MEC A;  4AHS A;  5CYQ A;  4ILG B;  4A62 A;  4IXC A;  2KFZ A;  5IT9 O;  5HRN A;  3LDO A;  1FKO A;  3AV9 A;  3CFR A;  4M7Y A;  3CJ9 A;  4C8L A;  4BE2 A;  3WNH A;  1XC3 A;  3CQY A;  4O8K A;  3UKR B;  3AA2 A;  4YDU A;  2G8W A;  3OYE A;  1HPM A;  3S9H A;  3I0R A;  4CED A;  1WUA A;  2O8C B;  4H5T A;  1ZBS A;  3E66 A;  4BDZ A;  3V9W A;  1XMQ K;  1VSF A;  3N4P A;  2D1K A;  3SQ2 A;  1U49 A;  3ZEU A;  1Q86 O;  3O4Q A;  1WOQ A;  2RHK A;  2AA4 A;  3OVN A;  4O0I A;  4BQL A;  3HPO A;  5JVG L;  5FPM A;  4FK0 A;  4CEF A;  3DLE A;  3L3U A;  4KHS A;  3N4Q A;  5FPE A;  1IKV A;  3VQE A;  4WQ4 C;  3EL2 A;  3VF6 A;  4FM1 A;  1NGI A;  1RDA A;  2A5X A;  4KHU A;  5CYM A;  1BOT O;  3SUO A;  4A59 A;  2XY8 A;  3KK1 A;  1JL2 A;  3NF6 A;  3ID8 A;  3C0B A;  1P8Z A;  4Z4E A;  3AGK A;  3M8S A;  4CD3 A;  1EP4 A;  4LC9 B;  1HNV A;  5KPZ A;  1QTM A;  1VK0 A;  1QVF M;  3R3L A;  1SL0 A;  3V6D A;  3LM2 A;  2CGL A;  2ZGY A;  3CXC M;  1NK7 A;  2Z1J A;  3CF5 L;  1J5E K;  4IOC L;  3SQ0 A;  1TAU A;  1RDW X;  4OGE A;  5MLC Q;  4C8O A;  1Q8I A;  4FLT A;  3TAR A;  4CZG A;  1HR0 K;  1C6V A;  5GAD P;  3L2R A;  3DXM B;  2ZD1 A;  1BIS A;  3WNE A;  3KLH A;  3DXK A;  1HMV A;  3ZLJ A;  3CHW A;  2FXU A;  3SJH A;  1KTQ A;  4YOW A;  1JCG A;  1JXE A;  2ITM A;  4Z94 A;  2F96 A;  4DQ8 A;  1Z05 A;  2FSK A;  2HNZ A;  4NYF A;  3OYC A;  4CCH A;  1LW2 A;  4JI3 K;  4DV0 K;  3KK2 A;  4CJV A;  4BQZ A;  1UA0 A;  3AVF A;  4DCH A;  4CW7 B;  2IOC A;  1KD1 O;  4FPB A;  3HT3 A;  3ZX3 A;  3SYZ A;  1WSJ A;  2P9U A;  1VQ8 N;  5SZT A;  1RFQ A;  3H45 C;  3MCP A;  4B9V A;  4AQY K;  4KB0 A;  4GKJ K;  3NHG A;  1VSD A;  4YOX A;  1EO1 A;  1IKY A;  3JAM O;  3RRH A;  3UKU B;  4E1J A;  1H1V A;  4WQ5 C;  4OJR A;  3VEN A;  4U67 L;  4CEZ A;  3MEE A;  4DS4 A;  1J5O A;  2VCP A;  2PZS A;  3MXI A;  1KAX A;  1TGO A;  3RSE B;  5GIN A;  4W5Q A;  3RMC A;  1NOY A;  1ZBL A;  3LDN A;  1A5W A;  3O1W A;  3GDQ A;  4WYB A;  5GAG P;  4K0K K;  2VQF K;  3AVC A;  3EY1 A;  1Y97 A;  3E9O A;  3IKM A;  4BC4 A;  2JLE A;  4IFY A;  3VGM A;  3MXM A;  3VPZ A;  4I9Q A;  2E4L A;  4JNE A;  4JI7 K;  3O3H A;  3TR8 A;  3T19 A;  1QHA A;  4CEC A;  1ZBI A;  3HPG A;  3VN5 A;  2Z1G A;  4KKO A;  3A5M C;  4OKJ A;  4XH4 A;  3MXJ A;  3GL1 A;  3EYZ A;  1RBS A;  1VQ4 N;  3K5M A;  3L2U A;  3BY5 A;  2IVN A;  2G8U A;  3UIQ A;  3L2Q A;  2O8E B;  1HPZ A;  3HST B;  3SBG A;  2PY5 A;  1YT3 A;  3OS1 A;  4KRF A;  2P1J A;  4M7X A;  4FJK A;  2YHW A;  3VEV A;  3VGK A;  4KHN A;  4DSE A;  2QKK A;  1V4T A;  4KB1 A;  1Z26 A;  3SAG A;  1GLB G;  1JLA A;  4BRH A;  3KLG A;  1D8Y A;  4KI6 A;  3SNN A;  4ISG A;  2E2P A;  4DTR A;  2OAN A;  4JKE A;  2W41 A;  1KFD A;  1T6C A;  4PKH A;  4BR2 A;  4CF8 A;  4N41 A;  4F8R A;  1KC8 O;  3DJC A;  4OLB A;  2O8F B;  5HBM A;  2E1Z A;  2Q0U A;  4JI1 K;  2P9I B;  4CJS A;  1J54 A;  4E7L A;  4JS4 A;  4CBW A;  4CJ4 A;  1NK5 A;  3LDQ A;  2P5O A;  3SAH A;  3QDK A;  1VAZ A;  3MEG A;  1NJY A;  1JXB A;  1CXU A;  3V4I A;  4MDA A;  4MO4 A;  2KFN A;  4JK8 A;  3U4L A;  4JLH A;  2E20 A;  3V1O A;  3LPT A;  4YHH K;  3CD6 N;  3M5R A;  3THX B;  3NFA A;  3LDS A;  3EO3 A;  1J6Z A;  1ATR A;  2WUS A;  3SMS A;  4HVJ A;  4E19 A;  1N36 K;  1RTI A;  3VF4 A;  5FPD A;  4H0T B;  4BG9 A;  3KZB A;  5BN9 A;  1X1P A;  1IKX A;  2P9N B;  2RE2 A;  1V4S A;  4I2P A;  5C2F A;  4O5F A;  5M1K A;  1YVN A;  2F8T A;  5T7B A;  1HKC A;  4F2S A;  4DTN A;  3FFK B;  3CCL N;  4C1N K;  3RWU A;  3HM9 A;  2HHV A;  1BO5 O;  3CIP A;  1RT6 A;  1I94 K;  3DI6 A;  1U2V A;  2P9K A;  1ASW A;  1OH8 A;  2ATQ A;  2RKI A;  3LM9 A;  2Y1J A;  4M3U A;  5AQZ A;  3SV4 A;  3VET A;  2DFH A;  4A61 A;  4GV9 A;  3MMV A;  3IUC A;  4K41 A;  1C0U A;  1TV6 A;  2V7Y A;  3AAQ A;  5E26 A;  1U45 A;  5LJV A;  2QWP A;  3ZT0 A;  3OHR A;  4FJJ A;  1QZ5 A;  4YOT A;  2YHA A;  2J4R A;  1T6D A;  4E3S A;  1Z6R A;  1JLC A;  2NLX A;  3AA4 A;  3HPH A;  3OYK A;  1W7A A;  4CHZ A;  4B1Z A;  1K8A O;  4JKD A;  2QK9 A;  1D5A A;  3DLG A;  4O8U A;  2VWJ A;  3V81 A;  3VA0 A;  4OPJ A;  1TL3 A;  2BGG A;  3AVG A;  1RNH A;  4CZI A;  2NRX A;  3HBT A;  3HOT A;  1S1V A;  3NH0 A;  1I3A A;  2PFU A;  3ZET A;  4MDB A;  4CGH A;  4Q5V A;  2HHS A;  4C8M A;  1QZ6 A;  4FJG A;  3O9Q A;  4LF9 K;  1S1W A;  2ZF5 O;  4LF7 K;  1VQO N;  4FJ7 A;  1UAX A;  3TI0 A;  2P9S A;  4WE1 A;  1XC9 A;  3FZL A;  3U3Y A;  2B5J A;  4PUO A;  5I42 A;  1SKR A;  4H5N A;  2Y1I A;  4B9L A;  3OYN A;  3V9Z A;  3V9X A;  1VSH A;  1T7P A;  1RBV A;  2B6A A;  2ZM6 K;  3VGL A;  1J9A A;  1X3M A;  3VMF B;  2KTQ A;  2RF2 A;  2IC3 A;  3PLA A;  2FF6 A;  1GLC G;  2YCH A;  1D9D A;  1S6Q A;  4CZL A;  3NF9 A;  5EXW A;  3H3N O;  4AF1 A;  5HP1 A;  1L3V A;  1HUX A;  1BHL A;  4J2E A;  3LPU A;  4HUE A;  5AQI A;  2P9K B;  3SAF A;  4J8F A;  1GLA G;  2E5L K;  3SLC A;  4KTQ A;  3BF3 A;  3DOL A;  5GIP A;  4GW6 A;  4PL8 A;  4LD0 A;  2YI1 A;  2Z1I A;  1YI2 N;  4DU4 A;  4JI2 K;  3R6M A;  1C0M A;  1ZC6 A;  3K9J A;  3CCR N;  5A2Q O;  2RPI A;  3EEQ A;  2ASM A;  1A5V A;  4CEQ A;  4FVM A;  4ICL A;  2VG6 A;  1UWB A;  2FBY A;  5FRM A;  3GG4 A;  4LFB K;  4FW2 A;  4FJ5 A;  2YNG A;  3THW B;  3K59 A;  3BDP A;  4LFA K;  4CBU A;  2XRI A;  4DFK A;  3QNN A;  4FZY A;  4CEB A;  4PA1 A;  4L3Q A;  3OJS A;  1HQE A;  1LAW A;  1HYV A;  4CZH A;  4DSK A;  1FK9 A;  1LWF A;  3P5J A;  4H0V B;  4BRG A;  3ATV A;  4EFH A;  3O3G A;  5JMV A;  1TYQ B;  3AVL A;  4FJ9 A;  2O8B A;  5AQR A;  5FLX O;  3ULD A;  3W0L A;  3HL8 A;  1C1A A;  1GOA A;  3HRG A;  3EKS A;  3G71 N;  4FWM A;  2ZJP L;  4CK3 A;  2DFE A;  2YNI A;  1RT1 A;  4TSX A;  4DFP A;  4BY9 C;  3AO2 A;  1JLF A;  1EWQ A;  5AQF A;  3P83 D;  1OH7 A;  3OYG A;  3CJB A;  4HWI A;  1RDD A;  3I8D A;  2O8F A;  4IWV A;  1XI1 A;  5CE3 A;  4FO0 A;  1E4G T;  3QEV A;  2G8H A;  1VSM A;  4E7K A;  3BF1 A;  4CES A;  4BRC A;  3VQ6 A;  4DFJ A;  4U7B A;  4YY3 K;  4F3T A;  2VGN A;  4BC5 A;  4B8A B;  2VGM A;  1QVG M;  5AQQ A;  4HCB A;  2QA4 N;  3MK6 A;  3HJF A;  1M90 O;  2NNW A;  4EP4 A;  3FZK A;  3WUH A;  2I5J A;  3OYH A;  3QML A;  4WF9 L;  1SV5 A;  2FBX A;  4OPK A;  2FF3 B;  4RTF D;  3ZX2 A;  2I7P A;  4CHY A;  4FWL A;  1NK4 A;  2F9T A;  3AO4 A;  3LWM A;  1K73 O;  1K8K B;  4LF8 K;  2OZS A;  4M42 A;  4QS7 A;  4DSL A;  1UA1 A;  1YJ9 N;  1SKW A;  1N33 K;  1KVC A;  2IDO A;  5C24 A;  4JI0 K;  3QEW A;  1S72 N;  1TK5 A;  3RVC A;  5LMN K;  2Q0R A;  2UU9 K;  5BPN A;  2WOM A;  5KPR A;  4DUY K;  3E01 A;  1KRP A;  3ZSV A;  3ZT2 A;  4X65 K;  4YOU A;  3U9D A;  4BR9 A;  4NB4 A;  4WFN L;  4CJK A;  3P31 A;  1QQO A;  4HTL A;  3KLF A;  3ZSR A;  3A8Y A;  1YJW N;  4FYD A;  4AM6 A;  3CME N;  5HRO A;  4BAC A;  4KH5 A;  3VER A;  2IVP A;  2P51 A;  1NK6 A;  2FBT A;  3ENO A;  3U9Z A;  1IBL K;  5HRR A;  1C1B A;  4A57 A;  2KZZ A;  3MX5 A;  3LWL A;  3DLR A;  4JI8 K;  4CJU A;  2IGI A;  4CHN A;  3BZK A;  1OVQ A;  1GLD G;  3DXK B;  3L3V A;  1O1W A;  4C8N A;  1SL1 A;  2D0P A;  2FSN A;  3PX0 A;  2OPQ A;  3ZSQ A;  4H0Y B;  1L3T A;  3QFU A;  1XNR K;  3MAQ A;  3DWL A;  1T05 A;  2BUP A;  1TKD A;  3HVT A;  4DV1 K;  5E84 A;  4MFB A;  1IG8 A;  5KPT A;  4CFC A;  3KHY A;  1BL3 A;  4CK1 A;  3FZM A;  1DEJ A;  4I7F A;  4BRQ A;  4FVU A;  4FJ8 A;  5D3G A;  3WXJ A;  4RW7 A;  2KQ2 A;  1NGB A;  3VQC A;  5BPL A;  5FRN A;  4PL7 A;  4IDH A;  4JEP A;  5CHI A;  2YHX A;  2OA8 A;  4YOR A;  4BRD A;  3CJA A;  5AFU A;  1FXX A;  3OS0 A;  4BVO A;  3ULE A;  3PY8 A;  1JCF A;  2F8S A;  5AQU A;  3WXI A;  4DR7 K;  4A2A A;  4ISF A;  3V9S A;  1NMD A;  4DF8 A;  4RW6 A;  3K2P A;  2QWO A;  2OTJ N;  4DV7 K;  5J2Q A;  4LH5 A;  3O8M A;  4CJE A;  3NMU A;  4KPY A;  3P4I A;  2GEL A;  1XHX A;  3ZSW A;  3F73 A;  3C95 A;  2O8D A;  4MLH A;  4E7J A;  2E6L A;  3FLC O;  3PX6 A;  5J1E A;  4LF5 K;  4ID1 A;  4CJQ A;  5BN8 A;  5F1X A;  3B6O A;  1YTA A;  3T1Y K;  4A5A A;  3MN9 A;  4OVL A;  4IDK A;  2FSJ A;  5C15 A;  3L4I A;  2GWJ A;  3HM8 A;  3AAR A;  5DK5 A;  1JLG A;  4DR6 K;  3FZH A;  2G8K A;  3CG7 A;  3WEE A;  1NNE A;  4DTO A;  4JKG B;  4JKH A;  1IO2 A;  4OX9 K;  4DR4 K;  3SQ1 A;  1VQK N;  1MWK A;  3LZI A;  3KD5 E;  5AJ3 K;  4NXM K;  4BR5 A;  1Q82 O;  2OYQ A;  3AY9 A;  4DLE A;  4GNI A;  4GVM A;  3TAQ A;  3O5B A;  1NGC A;  1WSE A;  3HOS A;  2QTD A;  4B9N A;  4DV6 K;  3TTF A;  4ELU A;  3IG1 A;  4MO5 A;  4CF0 A;  4PQU A;  4M41 A;  4DU1 A;  3T69 A;  1KXP A;  1TAQ A;  1HLU A;  1ASU A;  3OY9 A;  1VSE A;  3QER A;  3CI5 A;  4IJN A;  3DRR A;  3TSP A;  3DOK A;  2WTU A;  4Z0U A;  5AQJ A;  3KWI A;  4FWR A;  3D45 A;  4HTU A;  3NDK A;  2D0A A;  4I6M A;  1CZ9 A;  4NO7 A;  3V1Q A;  1B92 A;  3VQ8 A;  2V51 B;  4WQ5 A;  3FFI A;  3D2F B;  4ELV A;  3LP3 A;  4PWD A;  4RWT A;  3KVG A;  3ZET B;  3THV A;  4JRP A;  5E41 A;  2KKZ A;  3WXM B;  3DLH A;  1XWL A;  4CVN E;  3T1A A;  3DAW A;  2CGK A;  3VA3 A;  4LF6 K;  3IMX A;  1MDU B;  2KHO A;  5BRH A;  1KVA A;  4EZ6 A;  2O8B B;  4QCL A;  4DR2 K;  3J8A A;  1L5U A;  5AR0 A;  2H3G X;  1K9M O;  4MQ3 A;  4GKK K;  1NBW A;  2UXB K;  2X78 A;  1SAZ A;  4M3T A;  1XNQ K;  3QET A;  5BPM A;  1JCE A;  1LCU A;  3OYM A;  3T1H K;  4BWM A;  1HRH A;  2P9P A;  2HF4 A;  3MED A;  4BGA A;  4ISE A;  3SUQ A;  1WAJ A;  3JYT A;  3MX2 A;  3A5N C;  4JHD B;  4IO9 L;  3MDQ A;  1YAG A;  1N34 K;  2NRV A;  4FLW A;  3CC7 N;  3KWG A;  3M6G A;  1D4X A;  4B3S K;  5BRE A;  2B4J A;  3OYI A;  3A5O C;  2CH5 A;  1U48 A;  3H1V X;  4DV5 K;  4DTJ A;  4HUF A;  4K8Z A;  4FWN A;  4JS5 A;  2NRR A;  4JHD A;  2P9N A;  1B9D A;  1EET A;  3O9U A;  2BDP A;  1HKG A;  4NLC A;  3CER A;  4X66 K;  1NWK A;  3LAL A;  1ZBH A;  4EAH D;  4KV8 A;  3VQ5 A;  5AQP A;  1RT3 A;  1QQC A;  4JKA A;  1MA9 B;  1NGH A;  1RT2 A;  3QIO A;  4CHQ A;  3BEX A;  3LAK A;  4QS9 A;  3KK3 A;  1IG9 A;  1HNI A;  3AVB A;  1RTD A;  2P9S B;  3OYA A;  3I8B A;  3HP9 A;  1S22 A;  3ENB A;  2QWM A;  2YV0 X;  2BE2 A;  5DM7 L;  3CQ8 A;  2YJF A;  4BRF A;  2XO7 A;  3B6P A;  1SKS A;  1BWF O;  3JXU A;  4I2Q A;  4ILH A;  4DSJ A;  4CF2 A;  4YOV A;  2O4G A;  1C0T A;  2WON A;  2NZT A;  4ZTF A;  3U8X A;  2BH1 A;  2NRW A;  4YOY A;  3QNO A;  1RT4 A;  2Q31 A;  4B9U A;  4CZF A;  4I6M B;  3DLB A;  1NGF A;  1SZ2 A;  1NM1 A;  3SBT A;  4WFB L;  3EKU A;  5LY3 A;  2IAJ A;  3DLL L;  3OBY A;  4KH6 A;  2UXC K;  4BRO A;  4BRI A;  1HNW K;  1VQL N;  3QLH A;  1JJ2 M;  2E8A A;  4DKW A;  1S9G A;  4FOI A;  4DTM A;  4WFA L;  3D0P A;  2QWN A;  3PX4 A;  4AIL C;  4FJX A;  4H03 B;  2DY4 A;  4LFC K;  1VQ6 N;  3TPQ A;  1W0H A;  2YKN A;  4LY7 A;  4CI6 A;  2HBM A;  5I9E B;  1KCF A;  2ITG A;  1NGD A;  3O9S A;  4R79 A;  1I39 A;  3H46 O;  1NG9 A;  1HQU A;  4G1Q A;  1W9H A;  4JAX A;  1RTJ A;  3S3M A;  2JWK A;  5KQ8 A;  3DRP A;  2BAN A;  4CER A;  2LSN A;  3UE5 A;  5AQK A;  1LWE A;  1YXQ A;  4B1X B;  2HB5 A;  4XEI A;  1X9M A;  5C12 A;  4E1M A;  3ZT1 A;  3CCM N;  4BDP A;  1X9J A;  5ADX H;  4DFM A;  3IFR A;  5EVZ A;  4DB3 A;  4CF1 A;  4CGI A;  3CM6 A;  4JKG A;  1HJO A;  3ASM A;  4AHV A;  2VQE K;  3TAP A;  1REV A;  3G25 A;  3OTO K;  1X9S A;  3MN6 A;  1KVB A;  1VSK A;  1YF5 L;  3SK3 A;  3I56 N;  1Q18 A;  2UUC K;  4CGG A;  1ZYQ A;  1EWR A;  3WNG A;  1BDG A;  2YNH A;  3F5T A;  3FE1 A;  4X64 K;  2YNF A;  4JD2 B;  3ZSY A;  4DLG A;  3IRX A;  1Y64 A;  3JS6 A;  1S5J A;  4JK7 A;  3HVR A;  1ZXO A;  3KIO A;  1SQK A;  4CJT A;  1C1C A;  3J7Y P;  2UUA K;  3WQU A;  2CGJ A;  5KQD A;  4E0D A;  4CGF A;  2OCE A;  1TUY A;  3RR8 A;  1VQN N;  1RGI A;  1HX1 A;  1ITG A;  5J2P A;  2QW9 A;  3ULE B;  3SPZ A;  3P39 A;  2ZE2 A;  3QB0 A;  3OBW A;  5LMU K;  4DQR A;  3KLI A;  1OVY A;  1L3S A;  2OPP A;  2FBV A;  2KZM A;  5J2N A;  2O8E A;  1N6Q A;  1N8R O;  4AHC A;  4N76 A;  1HJR A;  3NGY A;  4EHU A;  1B9F A;  1E4F T;  3M8Q A;  1NKE A;  4M45 A;  1GOB A;  2HBK A;  2E2O A;  1YHQ N;  3HK2 A;  3LP2 A;  3TU5 A;  2I7N A;  2NRT A;  4AHR A;  1NGE A;  2GX9 A;  1C0F A;  2A1R A;  3WXL A;  4Z4G A;  3SUP A;  1WBD A;  4W5N A;  3AO3 A;  3MWT A;  1CXQ A;  2WC9 A;  4H4O A;  3E1Y A;  2HBL A;  2OTL N;  3PIO L;  4RG8 A;  5GIO A;  3AO5 A;  5EX5 A;  1BQN A;  4JV5 K;  3PSI A;  3DM2 A;  4JD2 A;  3FZF A;  4FK4 A;  1YIJ N;  3GBT A;  2IIR A;  4O0J A;  2ZJQ L;  4E7H A;  1WSG A;  5AQN A;  5KI6 A;  5JIC A;  4JN4 A;  1JLB A;  1VSI A;  4K42 A;  2HND A;  2O8C A;  4OLA A;  2GTD A;  2UYT A;  2XHB A;  2P9U B;  4M3X A;  2ZQB A;  3UKR A;  4O4G A;  4H4M A;  4CHP A;  4Q0B A;  1UOC A;  4DSF A;  5AQL A;  3CC4 N;  2HF3 A;  1HNX K;  1GLE G;  3VQ4 A;  3S3O A;  4XH1 A;  4WCE L;  1WNS A;  4FJM A;  3E9P A;  3SPY A;  3K0S A;  3DXM A;  3HZ6 A;  4RW9 A;  3ZT3 A;  1FW6 A;  1RCH A;  2ETJ A;  3KD1 E;  3SMP A;  2NRH A;  2E6M A;  4N5S A;  1ZBU A;  2QXF A;  1DGK N;  4B1Y B;  3IS9 A;  2VWB A;  3R1X A;  3NF7 A;  5F2R A;  4DSI A;  3CJ7 A;  4H8K A;  5EOY A;  4PKG A;  3WQT A;  4FJL A;  4FLV A;  1JLE A;  2F7T A;  5AQW A; 
#chains in the Genus database with same CATH homology
 4KKO A;  3C94 A;  4OKJ A;  1XHX A;  1VSJ A;  3ZSW A;  4CIF A;  3F73 A;  3MXJ A;  4NCA A;  4B3O A;  3WNF A;  1RIL A;  3C95 A;  1RBS A;  3EYZ A;  2VG5 A;  4W5O A;  3RTV A;  2E6L A;  4E7J A;  3K5M A;  5J1E A;  3PX6 A;  1NOZ A;  4ID1 A;  4CJQ A;  3L2U A;  2VG7 A;  3ISN C;  3B6O A;  4CJW A;  3CFP A;  2G8U A;  3PO5 A;  1YTA A;  3UIQ A;  3P1G A;  4CEA A;  3T3F A;  3L2Q A;  1S9E A;  4OVL A;  1HPZ A;  3HST B;  4IDK A;  2G8I A;  1TK8 A;  3KJV A;  2PY5 A;  1YT3 A;  1NK8 A;  3OS1 A;  4KRF A;  2P1J A;  3LAN A;  4FJK A;  4KHN A;  4W5R A;  5DK5 A;  1JLG A;  4DSE A;  2QKK A;  4KB1 A;  5KRS A;  2G8K A;  1GOC A;  2OPS A;  2DTU A;  1Z26 A;  1JKH A;  3CG7 A;  4F4K A;  1JLA A;  4DTO A;  4CJF A;  4RW8 A;  3AVN A;  1IO2 A;  3KLG A;  1D8Y A;  3SQ1 A;  3SNN A;  4KI6 A;  4LSL A;  3VQB A;  3LZI A;  1G15 A;  4HHT A;  4DTR A;  3KD5 E;  1KFD A;  2YKM A;  3RMD A;  1QSS A;  3SUN A;  3KTQ A;  4CF8 A;  2X6N A;  4N41 A;  4F8R A;  4Y1D A;  3L2W A;  2OYQ A;  4DLE A;  3KKS A;  4OLB A;  4GVM A;  4CJL A;  5HBM A;  3TAQ A;  1WSE A;  4B9N A;  1NJZ A;  1NKC A;  4CJS A;  1BCO A;  1J54 A;  1RT7 A;  1DTT A;  3O3F A;  4E7L A;  1Q9Y A;  4ELU A;  4JS4 A;  4CJ4 A;  4KRE A;  1NK5 A;  4DQS A;  4FW1 A;  3IG1 A;  4ZHR A;  4BWJ A;  2P5O A;  4CF0 A;  4FXD A;  2JGU A;  3DMJ A;  1RBU A;  2VWK A;  3AVJ A;  1QSY A;  3AA3 A;  4FM0 A;  1QSL A;  4PQU A;  5JS1 A;  3DYA A;  4M41 A;  2D0C A;  3MEG A;  4DU1 A;  1NJY A;  4C8K A;  1JXB A;  1YVU A;  3OYB A;  4FLY A;  3IAY A;  1CXU A;  1TAQ A;  3V4I A;  1ASU A;  3OY9 A;  1VSE A;  4DG1 A;  3NGZ A;  1TK0 A;  3QER A;  1CZB A;  3L2V A;  2G8V A;  2KFN A;  3DRR A;  4B9S A;  4B9T A;  4IG0 A;  2OZM A;  1NKB A;  4JLH A;  1U04 A;  3DOK A;  3V1O A;  4Z0U A;  1ASV A;  4FLZ A;  3OJU A;  3LPT A;  4FCY A;  3D45 A;  4HTU A;  3NDK A;  4DTP A;  1KLN A;  4ELT A;  3NFA A;  3LDS A;  2A1S A;  2D0A A;  3ALY A;  1CZ9 A;  3AVM A;  5HLF A;  3V1Q A;  1B92 A;  4L8R B;  4HVJ A;  1KFS A;  4E19 A;  3VQ8 A;  4FLX A;  3SZ2 A;  1RTI A;  3FFI A;  4FK2 A;  4ELV A;  1HYS A;  3LP3 A;  4PWD A;  1VSL A;  4KI4 A;  3K5N A;  1X1P A;  3EZ5 A;  1IKX A;  3THV A;  4KFB A;  1SL2 A;  4JRP A;  3ZT4 A;  5E41 A;  4CJP A;  3SCX A;  3DLH A;  1XWL A;  4I2P A;  4M3Y A;  4EZ9 A;  3T1A A;  2F8T A;  3VA3 A;  5T7B A;  3VQD A;  1S1X A;  4DTN A;  2P5G A;  4F2S A;  2XY5 A;  1JLQ A;  4DS5 A;  1KVA A;  3ZCM A;  4IBN A;  4CEE A;  3HM9 A;  3RWU A;  4EZ6 A;  2HHV A;  1EKE A;  4QCL A;  2PYL A;  3DRS A;  1BIZ A;  5CY4 A;  3L8B A;  1L5U A;  1LW0 A;  4FJH A;  2G8F A;  1BQM A;  1RT6 A;  1WAF A;  2Q3S A;  3QEP A;  3HYF A;  4AH9 A;  3DI6 A;  1IH7 A;  5J2M A;  4MQ3 A;  5K14 A;  3M8R A;  1S6P A;  4R5P A;  1WSI A;  3G0Z A;  1ASW A;  1VRU A;  2ATQ A;  2HVI A;  4BE0 A;  2RKI A;  2X78 A;  4CE9 A;  3OYJ A;  3SJJ A;  1T03 A;  4M3T A;  1LWC A;  3QET A;  4FLU A;  2Y1J A;  3LP1 A;  4M3U A;  1YTU A;  3LZJ A;  3OYM A;  3SV4 A;  1S1T A;  3C6T A;  2HHQ A;  2AJQ A;  4BWM A;  4RW4 A;  2DFH A;  1HRH A;  3K5O A;  3MED A;  1NJW A;  3SUQ A;  1C0U A;  1WAJ A;  1RTH A;  1TV6 A;  3BGR A;  3JYT A;  1U45 A;  3LP0 A;  2PYJ A;  4NCG A;  1D9F A;  3ZT0 A;  4FJJ A;  1XHZ A;  1S1U A;  3AVH A;  1LAV A;  3ZSX A;  4FJN A;  2YHA A;  2RN2 A;  4FLW A;  3TWH A;  3CM5 A;  4E3S A;  4CIE A;  4JRQ A;  1JLC A;  3AA4 A;  5JS2 A;  3HPH A;  1BI4 A;  3ZSZ A;  5C25 A;  5KTQ A;  3OYK A;  2QK9 A;  4CHZ A;  3OS2 A;  3K58 A;  4IKF A;  2B4J A;  1D5A A;  1IKW A;  1K6Y A;  4Z4F A;  3DLG A;  3OYI A;  2VWJ A;  3V81 A;  3VA0 A;  1A5X A;  1U48 A;  4KHY A;  3VQ9 A;  4OPJ A;  3OYL A;  3HO1 A;  4M3Z A;  4Z4H A;  4CGD A;  2QKB A;  3JSM A;  1TL3 A;  4KAZ A;  3AVG A;  2BGG A;  3I0S A;  4HUF A;  1RNH A;  4DTJ A;  4K8Z A;  4JS5 A;  1J53 A;  4O5B A;  1RDB A;  1S1V A;  1B9D A;  4IG3 A;  3QIN A;  2EHG A;  3NH0 A;  1EET A;  1I3A A;  4BDY A;  2BDP A;  4CGH A;  4DMN A;  4Q5V A;  4DQQ A;  2HHS A;  4DF4 A;  1TL1 A;  3QIP A;  4C8M A;  3CFO A;  3LAL A;  4DQI A;  3K57 A;  4CJ3 A;  4FJG A;  1ZBH A;  1S1W A;  3C6U A;  4KV8 A;  4QOZ B;  4FJ7 A;  5CZ1 A;  1UAX A;  3TI0 A;  3VQ5 A;  4WE1 A;  3QEI A;  1BI4 B;  4IFV A;  4CF9 A;  1XC9 A;  1RT3 A;  3U3Y A;  2B5J A;  4PUO A;  4DTS A;  4KTZ A;  1QQC A;  5I42 A;  1SKR A;  2HNY A;  1TKX A;  2Y1I A;  4B9L A;  3OYN A;  4DWI A;  3V9Z A;  3QIO A;  1RT2 A;  3V9X A;  3RMB A;  3AA5 X;  4CFD A;  1VSH A;  4XIU A;  1RBV A;  2B6A A;  2NUB A;  1T7P A;  3AVI A;  4CHQ A;  3LAK A;  4KHW A;  3KK3 A;  1RBT A;  1J9A A;  2XY6 A;  4K8X A;  2KTQ A;  1IG9 A;  1HNI A;  3AVB A;  2RF2 A;  4OKK A;  3HP6 A;  1RTD A;  2IC3 A;  4J2A A;  2HVH A;  1WSH A;  4CHO A;  4BE1 A;  3OYA A;  4YFU A;  3HP9 A;  3NGI A;  3PV8 A;  3G10 A;  3VQA A;  1D9D A;  4W5T A;  1S6Q A;  1CLQ A;  2YV0 X;  3NF9 A;  2BE2 A;  3CQ8 A;  3U6F A;  5HP1 A;  1L3V A;  2XO7 A;  4E1N A;  3PO4 A;  4J2E A;  1BHL A;  2GUI A;  3B6P A;  3LPU A;  4HUE A;  1SKS A;  3SI6 A;  4I2Q A;  5C42 A;  4Z4I A;  1QE1 A;  4DSJ A;  4CF2 A;  2HMI A;  2O4G A;  1C0T A;  2WON A;  3RR7 A;  4KTQ A;  3VQP A;  4ZTF A;  4DQP A;  3DOL A;  4LSN A;  4ID5 A;  2HHX A;  5FRO A;  1SUQ A;  1WN7 A;  3QO9 A;  4GW6 A;  1RT4 A;  4LD0 A;  3QNO A;  4B9U A;  2HHT A;  2Z1I A;  4HCC A;  4DU4 A;  4UQG A;  3TAB A;  3NAE A;  3DLB A;  2X74 A;  1R0A A;  1C0M A;  1N5Y A;  2YHB A;  3KKR A;  3SV3 A;  1MU2 A;  3LAM A;  2RPI A;  4ZTJ A;  1RT5 A;  4FM2 A;  4DTX A;  3HXM A;  1A5V A;  4OGC A;  2IAJ A;  4CEQ A;  4FVM A;  4ICL A;  5KGX A;  1DLO A;  5EU7 A;  1NK9 A;  2VG6 A;  1UWB A;  2FBY A;  5FRM A;  4FW2 A;  1DTQ A;  5SWM A;  4FJ5 A;  1TVR A;  3QLH A;  2YNG A;  1U4B A;  3K59 A;  3BDP A;  1S9G A;  2XRI A;  3VQ7 A;  4DFK A;  3QNN A;  4FZY A;  4DTM A;  4CFB A;  3CYM A;  4CEB A;  3D0P A;  4PA1 A;  4B08 A;  4AIL C;  3OJS A;  3QEX A;  3AVK A;  3PX4 A;  1NK0 A;  1HQE A;  4FJX A;  3NE6 A;  1LAW A;  5DMR A;  2DY4 A;  1HYV A;  1W0H A;  2YKN A;  3AVA A;  4LY7 A;  2FC0 A;  3V1R A;  4PY5 A;  4DSK A;  1FK9 A;  1KCF A;  1LWF A;  3AO1 A;  2Z1H A;  2ITG A;  3P5J A;  4CFA A;  3S3N A;  1I39 A;  3O3G A;  3AVL A;  1HQU A;  4FJ9 A;  4G1Q A;  1TKZ A;  1W9H A;  3ULD A;  3U3G A;  1BIU A;  1RTJ A;  3HL8 A;  1C1A A;  3S3M A;  1ZBF A;  1EXQ A;  1GOA A;  4CK3 A;  1Q9X A;  2KZM A;  2DFE A;  3DRP A;  3TAF A;  2BAN A;  1BGX T;  4YNQ A;  4CER A;  2YNI A;  1RT1 A;  2LSN A;  4LH4 A;  4TSX A;  4DFP A;  3SQ4 A;  1L3U A;  2R7Y A;  3AO2 A;  4NCB A;  1JLF A;  1LWE A;  4F2R A;  4O55 A;  5HRP A;  3P83 D;  3NCI A;  3OYG A;  3O4N A;  2EX3 A;  2HB5 A;  3PUF A;  4GMJ B;  1X9M A;  4M3W A;  3MEC A;  4HUG A;  4E1M A;  1FKP A;  3ZT1 A;  4AHS A;  1RDD A;  5CYQ A;  3I8D A;  4BDP A;  1XI1 A;  4B8C A;  4M3R A;  3V9U A;  2KFZ A;  3QEV A;  5HRN A;  2G8H A;  1VSM A;  4E7K A;  4DFM A;  3K5L A;  1FKO A;  3TAN A;  4E89 A;  4N56 A;  2IS3 A;  4CF1 A;  4CGI A;  3AV9 A;  3CFR A;  4N47 A;  3CM6 A;  4C8L A;  2D5R A;  4CES A;  3ASM A;  3RRG A;  4BE2 A;  3VQ6 A;  4AHV A;  3TAP A;  4DFJ A;  3WNH A;  1REV A;  4F3T A;  4KTW A;  5HRS A;  4B8A B;  1X9S A;  3ITH A;  3F9K A;  3NF8 A;  1F21 A;  1KVB A;  1VSK A;  1T8E A;  1X9W A;  4O44 A;  3AA2 A;  2G8W A;  3OYE A;  3S9H A;  3I0R A;  4CED A;  4HCB A;  4CGG A;  1ZYQ A;  3HJF A;  3WNG A;  5FDL A;  4EP4 A;  2I5J A;  3OYH A;  1RBR A;  2O4I A;  2YNH A;  1NJX A;  4CEO A;  1RDC A;  2KW4 A;  1SV5 A;  2YNF A;  4BDZ A;  3V9W A;  4I9L A;  3ZSY A;  2FBX A;  4DLG A;  4J2B A;  3IRX A;  4OPK A;  1BCM A;  1QHT A;  1VSF A;  1S5J A;  4CHY A;  4DTU A;  1NK4 A;  4FZX C;  3SQ2 A;  3HVR A;  3AO4 A;  3KIO A;  1U49 A;  3O4Q A;  3TAM A;  4CJT A;  4Y1C A;  1C1C A;  3LWM A;  3OVN A;  4O0I A;  4E0D A;  1TKT A;  1VRT A;  2OZS A;  4M42 A;  3HPO A;  4CGF A;  2DFF A;  3RR8 A;  1UA1 A;  3NH2 A;  4DSL A;  4J2D A;  4CEF A;  4FK0 A;  1SKW A;  1KVC A;  1ITG A;  1QS4 A;  3DLE A;  3L3U A;  2IDO A;  5J2P A;  5C24 A;  4KHS A;  3QEW A;  1IKV A;  1TK5 A;  1HYZ A;  3VQE A;  3M8P A;  3SPZ A;  1EX4 A;  4FM1 A;  1RDA A;  2WOM A;  2ZE2 A;  4KHU A;  5CYM A;  4DQR A;  3E01 A;  3KLI A;  3SUO A;  1KSP A;  1L3S A;  1KRP A;  2OPP A;  2FBV A;  2XY8 A;  3ZSV A;  1JL2 A;  3ZT2 A;  3KK1 A;  2W42 A;  5J2N A;  3TAG A;  4AHC A;  1N6Q A;  4N76 A;  3NF6 A;  2HHU A;  1HJR A;  3NGY A;  1B9F A;  3RMA A;  3M8Q A;  4CJK A;  4E7I A;  1NKE A;  3M8S A;  4Z4E A;  4M45 A;  1EP4 A;  1HNV A;  1GOB A;  3KLF A;  1QTM A;  3ZSR A;  1VK0 A;  4FYD A;  2HHW A;  1SL0 A;  3OYD A;  3V6D A;  3ZSO A;  4DU3 A;  3HK2 A;  3LP2 A;  5HRO A;  2D0B A;  5CZ2 A;  4BAC A;  4AHR A;  1NK7 A;  2Z1J A;  1JL1 A;  2P51 A;  4CK2 A;  3SQ0 A;  2GV9 A;  2A1R A;  1NK6 A;  1U47 A;  4Z4G A;  1TAU A;  3SUP A;  2FBT A;  4F3O A;  4CIG A;  4W5N A;  3AO3 A;  1Z25 A;  5HRR A;  1CXQ A;  4H4O A;  1C1B A;  2KZZ A;  5I3U A;  4OGE A;  3LWL A;  4C8O A;  3DLR A;  1Q8I A;  4FLT A;  4RG8 A;  1WSF A;  4CJU A;  2IGI A;  3AO5 A;  4CHN A;  3TAR A;  1BQN A;  3L3V A;  4C8N A;  1O1W A;  3A2F A;  1C6V A;  4CGJ A;  3L2R A;  1SL1 A;  4FZZ A;  3DM2 A;  4FK4 A;  3PX0 A;  4CJR A;  2ZD1 A;  2OPR A;  1BIS A;  2OPQ A;  3WNE A;  3KLH A;  4O0J A;  1HMV A;  3ZSQ A;  4E7H A;  1WSG A;  5KI6 A;  1L3T A;  1JLB A;  1KTQ A;  1VSI A;  3MAQ A;  1JXE A;  2HND A;  2F96 A;  4OLA A;  1T05 A;  1TKD A;  3HVT A;  3OYF A;  2XHB A;  4EP5 A;  3NBP A;  2HNZ A;  4NYF A;  4Z4C A;  3OYC A;  4CCH A;  1LW2 A;  2ZQB A;  4M3X A;  4MFB A;  4OKE A;  3KK2 A;  4B9M A;  4O4G A;  4CJV A;  4H4M A;  3AVF A;  1UA0 A;  3NH1 A;  2IOC A;  3H08 A;  4CFC A;  4CHP A;  4Q0B A;  1BL3 A;  3DLK A;  4CK1 A;  3HT3 A;  3SYZ A;  1UOC A;  1WSJ A;  4DSF A;  5KGW A;  5SZT A;  4I7F A;  4AHT A;  4CJ5 A;  4FJ8 A;  5KRT A;  4B9V A;  4KB0 A;  4FJI A;  5D3G A;  4KO0 A;  3VQ4 A;  3S3O A;  4RW7 A;  2KQ2 A;  3NHG A;  3VQC A;  1VSD A;  5FRN A;  1WNS A;  4FJM A;  1IKY A;  4AHU A;  3RRH A;  3SPY A;  2OA8 A;  4KHQ A;  2HW3 A;  4RW9 A;  4OJR A;  3ZT3 A;  1RCH A;  4CEZ A;  2ETJ A;  3MEE A;  4DS4 A;  3KD1 E;  1FXX A;  2E6M A;  3VQQ A;  4N5S A;  1J5O A;  1ZBU A;  1WLJ A;  2QXF A;  2PZS A;  4QAG A;  3OS0 A;  1TGO A;  2XY7 A;  3MXI A;  4W5Q A;  3RMC A;  1LV5 A;  3PY8 A;  4NYN A;  1ZBL A;  1NOY A;  2F8S A;  3IS9 A;  1A5W A;  3NF7 A;  2GBZ A;  3KLE A;  4DSI A;  1KLM A;  3AVC A;  2X6S A;  3QES A;  3V9S A;  3EY1 A;  4DF8 A;  1Y97 A;  4H8K A;  4RW6 A;  2JLE A;  3K2P A;  4IFY A;  3TAE A;  3MXM A;  4I9Q A;  5J2Q A;  2E4L A;  3O3H A;  4LH5 A;  3TR8 A;  3T19 A;  4CEC A;  1ZBI A;  4CJE A;  3HPG A;  4FLV A;  4FJL A;  3VN5 A;  4KPY A;  1JLE A;  2Z1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...