2FBXA

Wrn exonuclease, mg complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
HSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Werner syndrome helicase
total genus 63
structure length 195
sequence length 195
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbxA00
1RBSA 3NBPA 4FJ9A 1BGXT 3OYHA 4LSNA 1JKHA 4CF8A 4B3OA 3G10A 3HVTA 4PA1A 4OPJA 3AVLA 1WSFA 4N56A 4DQSA 4FJ8A 1SKRA 3RRGA 4DQQA 1KLNA 4CFAA 3AO5A 4Z0UA 1L3TA 3HO1A 3HL8A 3CYMA 3QEIA 3OS0A 2ETJA 1NJZA 1WSJA 3DLHA 1K6YA 3BDPA 1L3SA 4F3OA 4CGDA 4FJXA 4MQ3A 3OJSA 1CXUA 2A1SA 3SI6A 1IG9A 4CEAA 1KVCA 5KRTA 1UAXA 4C8MA 1KFSA 4FXDA 5C42A 1W0HA 4K8XA 2E6MA 4FLUA 2GBZA 2OZMA 1QQCA 2IS3A 4E7JA 1JLGA 4DFKA 3AVMA 1T05A 3RMCA 3DMJA 1IH7A 1S1UA 3I0SA 4RW4A 3HPHA 1HQUA 4BDPA 3WNGA 2BDPA 3SQ2A 3SUOA 2KZZA 3QLHA 3OYJA 5C25A 3AV9A 4B9VA 2XO7A 3K57A 4CEQA 4CJ4A 1LAWA 1VSDA 3DOKA 1C0UA 3D0PA 3IRXA 1S6QA 4E1MA 4IKFA 1LWEA 3RMAA 3CM6A 1LW0A 3KLGA 4KTWA 4DTNA 3AVNA 4FJJA 2OYQA 4E0DA 4DSJA 4OLBA 2KFZA 2F96A 4CEFA 3DI6A 4DQPA 2HHSA 3VQEA 5CYQA 1QE1A 4CJVA 4LH5A 3MXIA 2F8SA 4C8OA 1EP4A 2B5JA 4CESA 3ZT3A 4DLGA 3VQQA 1FKOA 4IFVA 4CIEA 3DLGA 1TKXA 1TV6A 2E4LA 3NH1A 4NCGA 2P5OA 4DS5A 2DTUA 4F8RA 4JRQA 4OGCA 3AVIA 4CK3A 3K2PA 2I5JA 4FLXA 1DTTA 3KD1E 1TKTA 4DU4A 4KKOA 2B6AA 1S9EA 4DLEA 2GUIA 3PX4A 4F4KA 2YKNA 3KJVA 2VG6A 4FLZA 3QIOA 4N76A 4Y1CA 3OJUA 1C1BA 3L2WA 3RWUA 4DF8A 4O0IA 3RMDA 2QKBA 4CCHA 1JLCA 3U3YA 1EX4A 2VG7A 3KKRA 3S3OA 3V1OA 3VN5A 4E7LA 3JYTA 1SL2A 4PY5A 3HP6A 4DFMA 4Z4GA 2P5GA 5I3UA 4J2AA 4DQIA 4CIFA 3ZSVA 2ZE2A 1RBVA 4CK1A 3NDKA 3AO4A 4FJ5A 4IBNA 4OPKA 1SL1A 3QIPA 3C6UA 1KVAA 2YNGA 1SL0A 2RF2A 2XY7A 3SPYA 1VSFA 2G8WA 3CM5A 1EXQA 2YNFA 4CJUA 3LWMA 2F8TA 1EETA 1ZBUA 3FFIA 2QXFA 1ZBHA 5JS2A 4ZTJA 4JLHA 3VQ4A 4OJRA 3HSTB 2NUBA 1BCMA 4Y1DA 1LV5A 4FJHA 3SQ4A 4AHCA 2BANA 1BHLA 1BIUA 3KLEA 4FLYA 3ZT1A 2XY8A 3SPZA 1TK8A 5J2MA 1IKWA 2DFHA 3TAFA 2PY5A 3L8BA 2Z1GA 4J2DA 4OKEA 4E19A 3NHGA 4RW7A 4CGHA 2OPQA 3O4NA 4N41A 4FK0A 2X6SA 4E89A 1FK9A 1EKEA 4DU1A 2D5RA 2OPSA 1NK6A 4CEEA 3SUQA 3OS1A 1T03A 3ALYA 1D8YA 4B9TA 4F2SA 1RT5A 4B8CA 1GOAA 1BISA 3A2FA 4KI6A 1R0AA 3P83D 4I2QA 4CJSA 5SWMA 2D0BA 3MXJA 3L2VA 1MU2A 4L8RB 3BGRA 4DFJA 4E7KA 3DRSA 1L3UA 1BI4B 1S1WA 3O3HA 3LP0A 2X74A 1HQEA 4QOZB 3KK3A 1U04A 4CJLA 4QAGA 4CJEA 2WONA 3L2QA 2HVHA 4M3XA 4CHNA 4CJ5A 5I42A 1S1TA 1D5AA 1TVRA 1Q9YA 4FJMA 4DTRA 1VSMA 3TAGA 1REVA 1VSJA 4YNQA 3U6FA 4F2RA 5HROA 3NGZA 1ZBIA 3OYIA 1TK0A 4C8NA 3ASMA 1TAQA 1ZBFA 1TKDA 2KQ2A 3MAQA 3CFOA 3MECA 2YHAA 4HUEA 3SUNA 1IO2A 1XHXA 2O4IA 3HP9A 2OPRA 4W5OA 2YNIA 4Z4FA 4W5QA 4WE1A 3ZT2A 4FM0A 4PQUA 3NE6A 3DOLA 3OYDA 1NOYA 2R7YA 4J2EA 4DQRA 3QNOA 3U3GA 3B6OA 4CHZA 3M8RA 4EZ6A 4KTQA 1JLBA 1C1AA 4I9LA 2HHVA 2D0CA 3TABA 5HRPA 3EYZA 4KHSA 3IAYA 3K5LA 3C95A 4C8LA 4M42A 1RDDA 1G15A 1U47A 2XRIA 3SV4A 3O3GA 5J2QA 3NF7A 5CZ2A 4ZHRA 3VQ6A 4CEDA 2A1RA 2QKKA 2HHQA 1TKZA 1NJXA 4IG3A 1HPZA 2Z1HA 3OYFA 3PV8A 3HJFA 3D45A 3ZSYA 4CGFA 3SNNA 2OA8A 1VSLA 2IDOA 1IKXA 3AVCA 1RILA 4CIGA 3QERA 1X9SA 4F3TA 2LSNA 4AHVA 1D9FA 3C94A 3F73A 3G0ZA 2X6NA 2ATQA 2EX3A 3LPUA 1VSEA 1BL3A 2GV9A 1TK5A 4CF1A 3CFPA 4CECA 4OLAA 1WSIA 4KTZA 4ELTA 5EU7A 4FJGA 3VA0A 5HP1A 4CFCA 4FZYA 3P5JA 4FJLA 5DK5A 4NYNA 2JLEA 4OKKA 3NGIA 1NK0A 3VQCA 1ITGA 3RR8A 3TAEA 4W5TA 1KFDA 1VRTA 3OVNA 1BI4A 4H4OA 1J9AA 3L2UA 4KHUA 4CHOA 4DS4A 3OYNA 1X9MA 1KTQA 1B92A 1HMVA 3CFRA 2FBVA 1ASWA 3MEEA 5KTQA 4M3UA 1VSHA 3AO1A 5J2NA 1S6PA 2YKMA 4O44A 1UOCA 4JS5A 1L3VA 1XC9A 1SKWA 3DRRA 4LH4A 4CHYA 4HCCA 4K8ZA 3NFAA 3TI0A 1RNHA 4JS4A 2VWJA 1BQMA 1S5JA 5FRMA 3DLEA 1D9DA 4GMJB 2DFEA 3KTQA 4DTUA 2D0AA 3NF8A 4BDZA 4B08A 1ASVA 4UQGA 3KLFA 3QEVA 3NGYA 1HJRA 1NK9A 4CGIA 4DSEA 3QNNA 5JS1A 4CJFA 1RTHA 1RDBA 3LP2A 1B9FA 3KD5E 1B9DA 4DSIA 4AHSA 1HRHA 3SQ0A 2G8UA 4DSLA 2BE2A 4PWDA 4I7FA 3V81A 1WLJA 4W5NA 3AVFA 3ULDA 4BWMA 4FLWA 4QCLA 1WAJA 2IGIA 4RW9A 2HHXA 2HW3A 3DYAA 2HNDA 3EZ5A 4M3ZA 2FBTA 3AA3A 4LD0A 4CJKA 2G8IA 3LPTA 4CE9A 1DLOA 1LAVA 4CGJA 5CYMA 4KREA 1Z25A 3QO9A 3TWHA 2G8HA 2IOCA 1ZBLA 3OYEA 1NOZA 1FXXA 3V9WA 1CXQA 3MEDA 3V9XA 3PO4A 4DTJA 3KKSA 3V9SA 5J2PA 1TGOA 3UIQA 1RBUA 5SZTA 3SZ2A 4N47A 3OS2A 4DWIA 1HNVA 3WNEA 2PYLA 2DY4A 3KK2A 5HRNA 4FJIA 4M3WA 3LAMA 3RR7A 1WSEA 3LALA 3VQ5A 3ZSXA 3M8QA 1RTDA 2HHUA 3DLRA 4CEBA 4M41A 4Z4CA 3V6DA 3AO3A 3CG7A 2VWKA 4HUGA 3HK2A 1F21A 4E1NA 1NK7A 3P1GA 2RN2A 4B9SA 2PYJA 1RBTA 3T19A 2FC0A 4O5BA 3DRPA 1T7PA 3V4IA 4C8KA 4DFPA 3IG1A 4MFBA 1JLAA 2Z1IA 4HVJA 3L3UA 1CZBA 4M3RA 4DSKA 3OYCA 4CEZA 4KI4A 2KTQA 5HRRA 4KRFA 2FBXA 3CQ8A 3ZSOA 4FZXC 3L2RA 3F9KA 1IKVA 3QEWA 3TARA 1YT3A 3S3NA 4B9MA 1C6VA 4FJKA 4CHQA 2O4GA 1DTQA 3AA4A 4CJ3A 4CJTA 1W9HA 3ISNC 3SJJA 3ZSRA 1JLFA 3HPOA 2OPPA 3JSMA 4DTOA 4Z4IA 1BCOA 4M3TA 1A5XA 3AA2A 1J54A 1WSHA 3AVBA 4I2PA 1U48A 3M8SA 3TAMA 1NKEA 3NH0A 3AVHA 3KLHA 1N6QA 4DG1A 1QSSA 1NK8A 4FK4A 2Y1JA 4GW6A 3K5OA 1RT4A 2B4JA 3O4QA 1YTAA 4IDKA 4BE2A 4KV8A 4AILC 2XY5A 3PX6A 4NCAA 2HHTA 4CFBA 4DF4A 4TSXA 4ELVA 1A5VA 3S3MA 4CK2A 1S1VA 3HPGA 1RTIA 1S1XA 4FJ7A 3PO5A 1QS4A 3C6TA 3T1AA 4J2BA 3V1QA 4HHTA 2Q3SA 3WNFA 3KK1A 4DTXA 4H8KA 4CJWA 1NK4A 3ZSZA 3OYGA 4W5RA 3VQ9A 1J53A 5FDLA 1ASUA 1JL1A 4CHPA 4R5PA 1LW2A 4CJPA 1WAFA 4HUFA 4ICLA 4BDYA 4KHNA 2ZQBA 3SYZA 3PY8A 2ZD1A 3VQDA 1IKYA 4DTSA 4AH9A 3MEGA 3WNHA 3QETA 4AHTA 4CJRA 2HHWA 3DM2A 3I8DA 3QEXA 3OYLA 2IC3A 4KHYA 4FW1A 4IFYA 3VQ8A 4FM2A 1U45A 1JLEA 3VQPA 3NAEA 1SUQA 1U4BA 4ID1A 2Y1IA 1KLMA 1NKCA 1VK0A 1WNSA 2HB5A 1QSYA 1XHZA 4RW8A 2XHBA 3E01A 1NJYA 1JXBA 1N5YA 3AVJA 5CY4A 4XIUA 4ZTFA 2QK9A 4AHRA 2X78A 2ITGA 1RT2A 5K14A 1YVUA 4FJNA 4ID5A 2RPIA 4KO0A 4HTUA 3VA3A 1UA1A 1TAUA 1VRUA 2EHGA 3AVGA 5D3GA 2VG5A 4OVLA 3LWLA 2FBYA 1KSPA 1Y97A 4Z4EA 1CLQA 4FZZA 3ZSWA 5KRSA 1KVBA 3B6PA 1KCFA 4EP4A 5J1EA 3PUFA 4FCYA 5HRSA 3L3VA 2PZSA 4OKJA 4RW6A 4B8AB 3AVKA 4E3SA 3KIOA 4CGGA 3QEPA 4NCBA 3K5NA 4KPYA 1RT7A 3V9ZA 4M45A 1QTMA 1NK5A 3LP3A 3SQ1A 2YV0X 2E6LA 3LZJA 4E7IA 1JLQA 2DFFA 4CF0A 4DU3A 4DTMA 1X1PA 2P51A 3NCIA 2HVIA 1RT1A 4Q0BA 2P1JA 3K59A 4DMNA 5KI6A 3S9HA 4N5SA 3ZCMA 1HNIA 4E7HA 3EY1A 1BIZA 3K58A 4BACA 4GVMA 3I0RA 3TAPA 5T7BA 4FK2A 4CEOA 1RDAA 1CZ9A 4LY7A 3OYMA 1GOBA 1RDCA 1VSKA 2YNHA 4FLTA 2BGGA 3T3FA 5CZ1A 1C0TA 4B9NA 3VQBA 1KRPA 1Q9XA 2KW4A 5C24A 1XWLA 3SCXA 5FRNA 4O0JA 2JGUA 4BE0A 4I9QA 3RTVA 2IAJA 1LWFA 1O1WA 2G8FA 4CFDA 2W42A 1RTJA 3NF9A 5E41A 4FW2A 4RG8A 4NYFA 4YFUA 4KFBA 4B9UA 3RRHA 1HYVA 4BWJA 3SUPA 5DMRA 5HBMA 3LZIA 4AHUA 3SV3A 4KHQA 3THVA 1NJWA 1RT6A 3TAQA 3ZT4A 2WOMA 3AA5X 4BE1A 1ZYQA 3NF6A 2AJQA 1C1CA 3LANA 3OYAA 5KGXA 1XI1A 1UA0A 3NH2A 4Q5VA 3LDSA 4DTPA 5HLFA 3IS9A 3M8PA 3H08A 2G8VA 4FYDA 3ZSQA 3OYBA 1SV5A 3VQ7A 3VQAA 1FKPA 1HYSA 1A5WA 4CF9A 3MXMA 1J5OA 3LAKA 3QINA 3DLBA 4M3YA 4CJQA 5FROA 4FM1A 3V9UA 3PX0A 1WN7A 4KB0A 1WSGA 5KGWA 2Z1JA 1TL3A 3O3FA 1L5UA 4FLVA 1QHTA 4EZ9A 4O4GA 4DSFA 4KAZA 1NKBA 4KB1A 2KZMA 1LWCA 2KFNA 3K5MA 1X9WA 3QESA 4Z4HA 1JXEA 1I39A 1RT3A 3ITHA 3V1RA 1JL2A 4LSLA 4CERA 2XY6A 2HNYA 1BQNA 4CF2A 1HYZA 1Z26A 4KHWA 4IG0A 2G8KA 1I3AA 4EP5A 1U49A 1T8EA 4B9LA 3LP1A 1YTUA 2YHBA 3OYKA 4H4MA 4O55A 1Q8IA 3TR8A 3ZT0A 4FVMA 1RBRA 3OY9A 2HNZA 2RKIA 1UWBA 3HYFA 3HVRA 3TANA 2OZSA 4PUOA 4OGEA 1C0MA 1S9GA 3HXMA 3RMBA 1SKSA 4ELUA 4HCBA 1GOCA 3HM9A 3AVAA 4JRPA 4G1QA 1QSLA 3AO2A 1VSIA 1RCHA 3HT3A 1TL1A 3KLIA 2HMIA 3DLKA
chains in the Genus database with same CATH superfamily
1RBSA 1BGXT 3OYHA 3A5MC 4CF8A 3AVLA 2UYTA 1OVQA 2E1YA 4CFAA 3TU5A 3AO5A 3HO1A 3CYMA 3OS0A 2GELA 3SAHA 3B8AX 3G6EN 3G71N 3DLHA 4F3OA 4CGDA 4MQ3A 2ASPA 4A61A 5E84A 1KVCA 4C8MA 5BRFA 1VHXA 4XEIA 1IV0A 1W0HA 2GBZA 3MWPA 5M1OA 1T6DA 1N32K 1QQCA 2IS3A 4E7JA 3AVMA 1T05A 3RMCA 3QICA 5M1QA 2HBKA 2NRTA 3GG4A 1P90A 3HPHA 2P9UA 2QI2A 3BF3A 3SQ2A 4Z94A 3AV9A 4B9VA 1RGIA 1S72N 3IRXA 1N36K 4E1MA 4IKFA 4ISEA 3CM6A 5AQWA 1LW0A 4FJJA 2OYQA 4CEFA 3O9UA 3C6AA 3VEYA 5F1XA 2HHSA 3MN6A 4CJVA 4LH5A 4C8OA 3FR0A 4DLGA 4IFVA 4DS5A 1Q18A 3UE5A 2E5LK 3AVIA 3OHRA 5ELZA 4JAXA 3EL2A 3P31A 3PX4A 1JCFA 4N76A 3QIOA 3BUZB 3JYTA 4Z4GA 3T1HK 2O8EB 4DQIA 4CIFA 5DM6L 3QDKA 4IBNA 4OPKA 1SL1A 1SL0A 2YNGA 1VQNN 2XY7A 2NLXA 1FW6A 4H0VB 3MDQA 4BC3A 4B1UB 4FO0A 4BRQA 1BCMA 5B8HA 3MWTA 3SQ4A 1BIUA 1GLEG 2XY8A 3SPZA 2DFHA 3TAFA 2PY5A 5AQZA 5GINA 3L8BA 3NHGA 2GWKA 2Q0RA 3O4NA 2P9SA 4FK0A 4H0OA 3MCPA 4JNEA 4WYBA 5AQIA 1FK9A 1EKEA 2D5RA 4ILJA 4JI5K 4CEEA 3UKRB 3SUQA 1D8YA 4F2SA 1RT5A 4JYAK 1XUPO 4KI6A 2YHWA 5EX5A 4CJSA 5LMUK 4JKCA 2ZGZA 1MU2A 1BI4B 4QOZB 2W40A 3CCRN 4M3XA 4CHNA 3O8MA 1TVRA 5AZIB 1REVA 4F2RA 1ZBIA 3OYIA 1TK0A 3ASMA 3CQYA 3MAQA 3CFOA 4W5OA 3WXIA 4WE1A 4FM0A 3DOLA 5LJVA 2R7YA 4DQRA 2J4RA 1C1AA 3DLLL 3WXJA 3C95A 1RDDA 1G15A 3E66A 2HHQA 5IWAK 3DJCA 1RILA 4F3TA 4IEIA 2LSNA 3C94A 4IXCA 2JWLA 2YI1A 2X6NA 1VQ8N 3VF2A 1M90O 3L4QA 4BGAA 2O8DB 1WSIA 4KTZA 1TYQA 3P5JA 5AQGA 3RR8A 4W5TA 2UUCK 1TYQB 4KHUA 1J9AA 4CHOA 3OYNA 2FBVA 4JS5A 1UOCA 3C7NB 1WB9A 4LH4A 4CHYA 1BQMA 4GMJB 2DFEA 3VF6A 1LOTB 4K41A 4DSEA 1OH6A 3LDNA 4B3TK 4IZ9A 4DR6K 3LP2A 1B9FA 2P9KA 3D7EO 3UB5A 4AHSA 3SQ0A 4DSLA 3V81A 1JJ2M 4W5NA 1WAJA 2IGIA 3G25A 2KKZA 2HNDA 3HSCA 3EZ5A 4BRPA 4AM7A 5CYMA 2ZJPL 4L3QA 5TKWA 3CCMN 3H46O 2IOCA 1ZBLA 5FPNA 1NOZA 1FXXA 4A5AA 1BG3A 1J5EK 3MX2A 1NU0A 1RBUA 4R79A 5SZTA 4DWIA 1HNVA 2A3ZA 2PYLA 3PSFA 1WSEA 1YJ9N 4CEBA 1XMQK 2E2QA 5BPNA 2VWKA 3HK2A 4E1NA 1N34K 1NGFA 2VWBA 3T19A 2FC0A 1T7PA 3DRPA 3CXCM 3V4IA 4C8KA 3ZX2A 2W6KA 4KI4A 4FZXC 4YOTA 1IKVA 3QEWA 1C6VA 2O4GA 1DTQA 3EEQA 5JLHA 4CJ3A 4AM6A 3MK6A 4DR2K 1JLFA 4X65K 1J54A 2FSJA 4I2PA 4BRGA 3TAMA 3KLHA 4GW6A 4JK7A 2HHTA 4IDKA 4DCHA 4TSXA 3W0LA 3S3MA 1S1VA 4J2BA 2Q3SA 3KK1A 1DKGD 1GLDG 4CBXA 1NK4A 1C0GA 4CJPA 2ASOA 2ZQBA 3FZLA 5LMNK 3EN9A 4CZJA 3QEXA 1TUYA 4JD2A 3VQ8A 1U45A 4FM2A 3FLCO 1SUQA 4AQYK 2Y1IA 1KLMA 1QSYA 2HBLA 1NGEA 1N5YA 1EWQA 3AVJA 4BRCA 2ITGA 3SK3A 3IDHA 4ID5A 2VGMA 1H1VA 1MDUB 4OVLA 3A5NC 3WEEA 3CQXA 3ZSWA 4FZZA 3ZX0A 4EP4A 4DV5K 1S3XA 3LP3A 2YV0X 2E6LA 4BG8A 3LZJA 4DTMA 1HNWK 2P51A 3O9TA 2HVIA 3DXMB 4WF9L 1QZ5A 3VF4A 2A42A 5KI6A 3ZCMA 1HNIA 1VQMN 4O8UA 1BIZA 3K58A 1NGDA 3S41A 4DUZK 2Q1NA 5T7BA 2O8DA 1GOBA 2YNHA 1GLLO 1XWLA 3OA9A 4WFNL 2W42A 3PIPL 3AY9A 2P9PA 4FW2A 4CZIA 3O1BA 1DT9A 1HYVA 5BRHA 4KHQA 1YI2N 3THVA 4X64K 1RT6A 3TAQA 5ADXH 2VGNA 3AA5X 1ZYQA 3VETA 2AJQA 5AQLA 3KD1E 2NRHA 2G8VA 4FWOA 3LDSA 4DTPA 4JKGA 4KH6A 1NNEA 1M1KO 2CH5A 1HYSA 1A5WA 4CF9A 3QINA 3DLBA 3FZHA 3I55N 4KB0A 1ATSA 1L5UA 4DSFA 1VQPN 4CD3A 2KFNA 3ITHA 3FE1A 4LSLA 2XY6A 2HNYA 2QWPA 5AQQA 1YIJN 1Z26A 3IMXA 1HR0K 4IG0A 3TSPA 1I3AA 4EP5A 1U49A 1HKGA 1YTUA 2YHBA 4H4MA 3P38A 3TR8A 2HNZA 4BQZA 2RHKA 1ESVA 1TL1A 3HPOA 4MDAA 2HMIA 5GIOA 1HPMA 3NBPA 4FJ9A 2WTUA 4B3OA 3G10A 3HVTA 4YORA 4OPJA 1Q81O 1WSFA 5AQVA 4MLEA 4B1ZA 4NXNK 3MCAB 2ETJA 3BDPA 3OJSA 4A59A 2GEMA 1IG9A 4CEAA 2IVNA 4FXDA 2ZJRL 5EY4A 4FLUA 4YOVA 3THXB 4WQ5A 4DFKA 2GX9A 4GV9A 4CZEA 1HQUA 3E9LA 4H5VA 5C25A 4CJ7A 3LM2A 4C1NI 4CJ4A 1LAWA 2HBMA 1S6QA 3CJCA 3KLGA 3RSEB 3QFUA 1KXPA 4DQPA 4H03B 5CYQA 1QE1A 2YCHA 3ZEUA 3MXIA 4MDBA 2B5JA 4CESA 2OTLN 2NRWA 3CETA 4BRIA 1TKXA 1TV6A 2YJFA 3NH1A 2DTUA 1QHAA 4F8RA 1W7AA 2NZTA 4OGCA 2HBJA 2I5JA 5M1FA 5AQXA 4WQ4A 1TKTA 5AFUA 2B6AA 4DV2K 2GUIA 4LF9K 4F4KA 2YHYA 2YKNA 4WFBL 5A2QO 2VG6A 1C1BA 3L2WA 4DF8A 3CJ9A 2QKBA 4CCHA 4B9QA 3U3YA 3S3OA 3V1OA 3VN5A 3WT0A 4FPAA 4B1VA 3CIPA 3ZSVA 3AO4A 2VCPA 3QIPA 3C6UA 3HRGA 4BQLA 5AQTA 1EXQA 2QXFA 5C15A 4ZTJA 4JLHA 3R8EA 4OJRA 1LV5A 4AHCA 4JI3K 1TK8A 2NRZA 1IKWA 1R59O 2NRRA 2JWKA 2Z1GA 3CJAA 3RSEA 4OKEA 2E8AA 3T69A 3CJ7A 4DU1A 2QWLA 1NK6A 1OVYA 2NRXA 3ALYA 4B9TA 1GOAA 3A2FA 3CJBA 1R0AA 1ATRA 3P83D 4I2QA 4JN4A 5SWMA 3TPQA 4OPAA 4LFCK 3O3HA 4LF5K 3LDPA 4IOCL 1HQEA 4CJLA 3AAPA 4ILHA 1S1TA 3ZLJA 1Q9YA 3KVGA 2KQ2A 2YHAA 1IO2A 3D2EA 2OPRA 3L4IA 3NE6A 3I33A 1NOYA 4PHTX 4J2EA 5HRPA 4KHPK 5KPTA 3BZKA 3NF7A 5CZ2A 4LFAK 2GUPA 4CEDA 2A1RA 1VQ6N 2UXBK 1NJXA 3R6MA 3OYFA 3HJFA 3D45A 4BR0A 3SNNA 1VSLA 3AVCA 3QERA 1XNRK 3CPEA 4B3MK 1D9FA 3BZCA 3F73A 3G0ZA 4GKJK 3LPUA 2GV9A 3OW2M 4CF1A 4CECA 3CCVN 4OLAA 4ELTA 3ENOA 4FJGA 4BR9A 4YDUA 3J81O 4FZYA 5DK5A 4NYNA 2DPNA 3NGIA 3CCJN 2ZM6K 4A5BA 1VRTA 3TAEA 4DS4A 1B92A 3AARA 1ASWA 2BH1A 3R3LA 3A8YA 4FOIA 4FPBA 3CD6N 3P39A 3MEEA 1EQYA 4M3UA 3U4LA 2YKMA 4O44A 3H1QA 4IO9L 1XC9A 3WQTA 4HCCA 2VWJA 1S5JA 3DLEA 4CZLA 3KTQA 3NF8A 4BDZA 3PLAA 1ASVA 4UQGA 4CVNE 4BRLA 3NGYA 1HJRA 4CGIA 3J7ZO 4CJFA 1RTHA 1RDBA 3JAMO 2FXUA 3KD5E 3E9OA 5AZJA 1WLJA 2PAVA 4KH5A 3ULDA 4BWMA 2HHXA 2HF3A 4F9OA 3DYAA 1MA9B 4CJKA 4CE9A 3BF1A 3VGKA 4IOXA 4WQ4C 1IG8A 3QO9A 1BU6O 2G8HA 3D6RA 3OYEA 3BP8A 3V9WA 3PO4A 3ATVA 3MEDA 2FF3B 5J2PA 3KKSA 4CZGA 3V9SA 3ENBA 3SZ2A 3H1VX 4N47A 3WNEA 3DXMA 4O5FA 2DY4A 3KK2A 3EO3A 1NGBA 1NGIA 4DHYA 1K9MO 5C10A 3FGUA 2HHUA 1E4FT 3M8QA 3VMFB 3ZX3A 2Q36A 3V6DA 1NK7A 2VQFK 5AQKA 4E1JA 4O5BA 1JLAA 3L3UA 5EVZA 3VTIA 2O8CA 2W6LA 4Y0WA 2NNWA 5C2DA 3KZBA 3ZEUB 3ZSOA 3F9KA 1I94K 1YT3A 3S3NA 4B9MA 1YVNA 3H3OB 3ISNC 3ZSRA 1OKJA 4DR3K 1BCOA 4M3TA 2PBDA 3AA2A 4PKHA 1NKEA 3M8SA 5C0YA 2D4WA 3M3ZA 3NH0A 4BC5A 1VAZA 4DG1A 3J80O 4FK4A 2Y1JA 3K5OA 1RT4A 2B4JA 1YTAA 3EZWA 4AILC 1A5VA 4FJ7A 3C6TA 3V1QA 3CPWM 4HHTA 4LF8K 1SAZA 4DTXA 1U2VB 4H8KA 1NGCA 1JL1A 4CHPA 3AGKA 4HUFA 1WAFA 2A41A 3PY8A 3N4PA 3MEGA 1BA1A 1KAZA 3I8DA 2IC3A 4WCEL 1JLEA 1U4BA 1YF5L 1RDUA 4A57A 3JXUA 1WNSA 4DB3A 4B1XB 4RW8A 2XHBA 4GV3A 1JXBA 4XIUA 5K14A 2I7NA 3OTOK 3MN7A 4DV7K 2RPIA 1BUPA 1VRUA 5D3GA 1NM1A 3AVGA 2VG5A 3LWLA 4Z4EA 1KSPA 1QVGM 3P4IA 3VENA 4FVUA 5HRSA 4RW6A 4XH5A 4MO5A 3C0BA 3SQ1A 5JMVA 3PIOL 1JLQA 2DFFA 4CF0A 5AQPA 1N33K 3NCIA 1RT1A 4Q0BA 4IOAL 2VYPA 1MWKA 4DMNA 1NGJA 3K59A 4BR5A 4JV5K 1CZAN 4JI4K 4GVMA 2W41A 1BA0A 3UKUB 3TAPA 2OTJN 1ATNA 1WUAA 1ZC6A 4FK2A 1RDAA 1CZ9A 3OYMA 1RDCA 4FLTA 3T3FA 3VQBA 3THYA 5AQSA 3GE1A 5FRNA 4JD2B 2G8FA 2ITMA 5M1NA 1VQ4N 2UUBK 3NF9A 4LFBK 4RG8A 3E9PA 4A2BA 4B9UA 3RRHA 4AHUA 3CERA 3ULEA 1NJWA 3THXA 5TKYA 4CD1A 1C1CA 5KGXA 5ADXA 2IVOA 3NH2A 4NLCA 3IS9A 1SV5A 4K0KK 1J5OA 4CJQA 5FROA 1NBWA 4IJAA 1WN7A 1XMOK 5KGWA 2Z1JA 4BVPA 4M63C 4FLVA 1QHTA 4X66K 2KZMA 1LWCA 3K5MA 3THWA 3QESA 3CMAN 1I39A 1RT3A 4CERA 4BY9C 3HI0A 1HYZA 2Q97A 4KHWA 2G8KA 1T8EA 5GAEP 3T7ZA 4B9LA 3OYKA 1BOTO 4PUOA 2RKIA 3TANA 2OZSA 3MN9A 3HXMA 4ELUA 1GOCA 3WEEB 4YOUA 3AVAA 4JRPA 4DV3K 3AO2A 1VSIA 1RCHA 1ZBSA 3HT3A 3KLIA 3DLKA 4LSNA 1BDGA 4PL8A 5F2RA 4IJNA 3M5RA 4IO8A 4DQSA 1GLJO 1SKRA 5I9EB 3RRGA 4Z0UA 3HL8A 1NJZA 1WSJA 1K6YA 4FJXA 4K43A 1CXUA 3SI6A 4LF7K 3HBTA 4FSVA 3O9QA 4JKAA 1KFSA 2QWQA 4JHDA 4K8XA 3SMSA 1JLGA 1ILYA 4OPHA 3FZMA 5GIPA 4LF6K 4IWVA 2YHXA 4RW4A 1V4TA 1G99A 2H3GX 4BDPA 3WNGA 3M6GA 2BDPA 3LDQA 1SQKA 2UU9K 2F9TA 4H5NA 5M1PA 1K8AO 4CEQA 4DKWA 1VSDA 4H0TB 1LWEA 3RMAA 4KTWA 3AVNA 2KFZA 4DSJA 1GLCG 3VQEA 4JKEA 3THWB 3J7AP 2WBNA 3LM9A 4M7XA 5GAGP 5LY3A 1FKOA 3DLGA 2E4LA 5M1KA 3K2PA 3E1YA 1FJGK 3CCLN 1S9EA 4DLEA 3QBWA 3A5LC 3KJVA 4JEPA 3RWUA 3ULEB 1JLCA 1EX4A 2VG7A 1NWKA 4E7LA 5MLCQ 4PY5A 1OH5A 5BPMA 1BO5O 4J2AA 2Q2RA 2ZE2A 4JI6K 3NDKA 4FJ5A 1HUXA 4FWPA 3DXKA 3SPYA 1VSFA 2G8WA 4CJUA 1EETA 1ZBUA 3FFIA 3W3DA 4KH4A 5JS2A 5LJWA 2P9IA 4Y1DA 4FJHA 4JI1K 3JS6A 1K8KA 4CZKA 3KLEA 4DR4K 3ZT1A 3HOSA 2EWSA 1Z6RA 4E19A 3RVCA 4RW7A 4CGHA 4CZHA 2OPQA 1E4GT 3FFKB 3OS1A 1T03A 3MXJA 4DFJA 1EWRA 1NMNA 1L3UA 1S1WA 1WBDA 3LP0A 3VOVA 1U04A 3KK3A 1HJOA 1RDWX 2ZWHA 4QAGA 4CJEA 3L2QA 3EKSA 1K73O 4CJ5A 1D5AA 5CE3A 1VQON 4FJMA 3J7YP 1VSMA 3TAGA 4C23A 3U6FA 4H5WA 5HROA 3NGZA 2HOEA 1IBMK 4BGBA 3LL3A 4C8NA 3ZYYX 1JCGA 4HUEA 1XHXA 3SUNA 3HP9A 4W5QA 3ZT2A 5EXWA 4PQUA 1RFQA 4CHZA 3B6OA 3M8RA 5E26A 2QXLA 4I9LA 2FLOA 2HHVA 2D0CA 3CCUN 3K5LA 4C8LA 4G9ZA 5JLFA 4M42A 3SV4A 3O3GA 4H0XB 1U2VA 4GVEA 4IFEA 3U9DA 1TKZA 3GOIA 4IG3A 1KAXA 2GWJA 2Z1HA 4JK9A 4JHDB 5KPZA 3PV8A 3CC4N 4AF1A 3OBYA 4CW7B 4IDHA 5AJ3K 1KD1O 2IDOA 4CIGA 3N4QA 5AFUH 3ID6A 2EX3A 2O8BA 1BL3A 5JVHL 4CBUA 2QWRA 3CFPA 4NLBA 3QB0A 5EU7A 2P9KB 4BRKA 4CFCA 2WC9A 1QQOA 2JLEA 1NK0A 4CI6A 4DR7K 3LDLA 3OVNA 4H4OA 1BI4A 3L2UA 3CJ1A 1X9MA 3IKMA 4BROA 3CFRA 5KTQA 1VSHA 1S6PA 4DV1K 3UKRA 5BN9A 3DAWA 3DRRA 2P9SB 1Z05A 4BRMA 3IFRA 1RNHA 2E2PA 5FRMA 1D9DA 5KQDA 4DTUA 3KLFA 4CBWA 3QEVA 3NVMA 1NK9A 3QNNA 5JS1A 5FPMA 2HSTA 1B9DA 1HRHA 2G8UA 2BE2A 4ILGB 3SAGA 3AVFA 1KAYA 4RW9A 4JKBA 2HW3A 1DEJA 2FBTA 1LAVA 4CGJA 3GBTA 4KREA 3WUHA 3V9XA 2YJEA 4M3WA 4FJIA 3RR7A 3WXLA 1VQ7N 3ZSXA 3DLRA 2AA4A 3GDQA 4M41A 4Z4CA 4GV6A 4DV6K 3CG7A 4BRDA 3P1GA 4B9SA 3O5BA 1RBTA 3THYB 2CH6A 4DFPA 4MFBA 1CZBA 4M3RA 5BRDA 3OYCA 1GLBG 2I7PA 3C6HA 1QVFM 2E20A 2KTQA 4KRFA 3CQ8A 5AZIA 1HNXK 1HKCA 3KHYA 3TARA 4FJKA 2P9IB 3AA4A 1LCUA 1W9HA 4Z4IA 5JVGL 1J6ZA 4DTOA 2OPPA 3JSMA 1WSHA 3AVHA 3DXKB 1N6QA 5CR4A 1NLVA 4A62A 1X3NA 4BE2A 2XY5A 3PX6A 4KV8A 5AQMA 4CFBA 4ELVA 4CK2A 3HPGA 4FWNA 3T1YK 1RTIA 1S1XA 3LDOA 1QS4A 3PO5A 1QQNA 1XC3A 1HLUA 4CJWA 3VEVA 3ZSZA 3CC2N 4W5RA 4B1YB 5FLXO 1ASUA 4PKGA 2OCEA 4JK8A 3SAFA 2ZD1A 3BY5A 3FZKA 3O1WA 1IKYA 4DTSA 3NVKA 3A0IX 3SJHA 3WNHA 4NO7A 3QETA 4AHTA 3D2EB 1X9JA 5KPRA 3VQPA 4BR2A 4ID1A 3KWIA 2O8EA 1XHZA 3F2KA 3E01A 3F5TA 4A2AA 5F0XA 4AHRA 4H0YB 4RTFD 1YVUA 4KO0A 1OH8A 1UA1A 3VTHA 1IJJA 2QWMA 1IBKK 5KRSA 1KVBA 1KCFA 3AAQA 3PUFA 1IBLK 3L3VA 2PZSA 4OKJA 4B8AB 2QWOA 4E3SA 1ZXOA 3HM8A 4C1NK 3K5NA 4KPYA 1RT7A 4NCBA 1NK5A 1P8ZA 5CHIA 1X1PA 3U8XA 1N8RO 5C2FA 5GADP 2VQEK 1QQMA 4N5SA 1GLAG 3EE8A 4BACA 3VESA 2O8CB 3Q7CA 2BGGA 4FWQA 4FWRA 5CZ1A 2O8BB 2WFBA 1EO1A 5HOOA 1KRPA 1Q9XA 4QS7A 4QS9A 1WOQA 2IAJA 1LWFA 4CFDA 4GKKK 5DM7L 1RTJA 5E41A 3O08A 3R1XA 3HTVA 1T6CA 4YFUA 4DR5K 4GY2B 4BWJA 5HBMA 3LZIA 4I6MB 4K42A 5AR0A 3O4WA 2QA4N 1WBBA 2ZF5O 3LANA 3KK7A 4BREA 1UA0A 5HLFA 3M8PA 3H08A 3ZETB 1Q86O 3VQ7A 4FWLA 3VQAA 5BPLA 4O8KA 1YAGA 4M3YA 3CMEN 1TL3A 2F9WA 3U9ZA 2F4VK 1NKBA 1YJWN 4YHHK 1X9WA 4Z4HA 1JXEA 3V1RA 1JL2A 3Q7BA 2Q31A 1BQNA 3EKUA 4CF2A 2KLAA 4BG9A 5BREA 1S22A 3AGRA 3ZT0A 1Q8IA 4FVMA 1RBRA 3OY9A 1BWFO 4QS8A 4OGEA 3R9PA 4H0PA 1C0MA 3MMVA 3RMBA 1SKSA 3TTCA 1MWMA 3HM9A 4OO1J 4G1QA 1QSLA 1C0FA 4B3RK 3K0SA 1JKHA 3O80A 1K8KB 4PA1A 4N56A 4FJ8A 3MX5A 4DQQA 1KLNA 3QMLA 2O8FB 1L3TA 3QEIA 4EAHD 1L3SA 3CCSN 1SZ2A 1NMDA 2A1SA 2P9NA 5AQNA 4V19S 4CZMA 1JCEA 4YDUC 5KRTA 1UAXA 4PL7A 1Y64A 5C42A 2P9LA 3M1FA 2E6MA 3H6EA 3EE9A 4U7BA 3CCQN 2OZMA 4RWTA 4DR1K 3DMJA 1IH7A 1VQ5N 1S1UA 3I0SA 4NXMK 1W2BM 1W97L 3SUOA 2KZZA 3QLHA 3OYJA 4JI7K 3O6WA 2XO7A 3K57A 3D0PA 3DOKA 1C0UA 4EHTA 4U67L 1NGHA 4YOYA 2RE2A 4DTNA 4OLBA 2F96A 3DI6A 3TSUA 2F8SA 5IT9O 1EP4A 3ZT3A 3VQQA 4CIEA 4LF4K 5BR9A 4FL9A 5AQJA 2WUSA 4NCGA 2P5OA 4PKIA 4FWMA 4JRQA 4CK3A 4FLXA 1DTTA 4DU4A 4KKOA 1TUUA 4JI2K 2AP1A 4FLZA 4JI0K 4Y1CA 3OJUA 4O0IA 3RMDA 3HOTA 3KKRA 1SL2A 3HP6A 4DFMA 1YJNN 2P5GA 5I3UA 2QM1A 3KWGA 1VQKN 2P9PB 2E88A 1RBVA 4CK1A 2UUAK 3D2FA 3CF5L 1KVAA 3SLCA 2RF2A 1GLFO 3CM5A 2YNFA 3LWMA 2F8TA 4DV0K 3QBXA 3ENHA 2F7TA 3F9MA 5GAHP 1ZBHA 4DUYK 3VQ4A 3I8BA 1Q7YO 2NUBA 3HSTB 2D1KA 2BANA 5AQYA 1BHLA 4BC4A 4FLYA 1OH7A 5J2MA 4GNIA 4J2DA 1VQLN 4N41A 2X6SA 4E89A 2NRVA 2OPSA 3ATUA 4KBOA 3WXMB 4B8CA 1BISA 2D0BA 3L2VA 2GTDA 1X3MA 1XQSC 3BGRA 4L8RB 1YHQN 4E7KA 2BTFA 3DRSA 4XH1A 3VERA 2X74A 2HVHA 2WONA 2UXDK 5I42A 3MN5A 2FSKA 4DTRA 4YNQA 1VSJA 3GL1A 2V7ZA 1U6ZA 2V7YA 2V52B 3HZ6A 5FPEA 1TAQA 1ZBFA 1TKDA 2O4IA 3MECA 2P9NB 4BR4A 2YNIA 4Z4FA 4FWSA 3D2FB 3OYDA 3CC7N 3QNOA 5AQUA 1O13A 3U3GA 4EZ6A 4KTQA 1YITN 1JLBA 2CGLA 3TABA 3EYZA 3K9KA 4KHSA 3IAYA 1U47A 2XRIA 2QEXN 2FSNA 5J2QA 4ZHRA 1HKBA 3VQ6A 5AQRA 2QKKA 4K25A 2ASMA 4H5RA 1HPZA 2V51B 1NJIO 4JI8K 3ZSYA 4CGFA 5BN8A 4WQ5C 2OA8A 1IKXA 4X62K 1X9SA 4AHVA 3ID8A 2ATQA 2HMPA 1VSEA 1TK5A 4HTLA 3UKUA 2QW9A 3VA0A 5HP1A 3O9SA 4EIAA 4FJLA 4OKKA 5AQFA 3VQCA 1ITGA 1KFDA 4B1WB 1HX1A 1XNQK 1T3VA 4BVOA 1KTQA 1HMVA 2ZJQL 5FPDA 5EOYA 2IIRA 2QWNA 4J8FA 1NG9A 3AO1A 3ZETA 5J2NA 3O9RA 1L3VA 3CCEN 4RCHA 4JKDA 1SKWA 4K8ZA 2IVPA 3NFAA 3TI0A 3WQUA 4JS4A 4ISFA 2D0AA 5HL7L 4B08A 2D0OA 2KHOA 5AQHA 4DSIA 4CZFA 3CI5A 4PWDA 4I7FA 5KQ8A 3VEWA 4FLWA 2A40A 4QCLA 1YUWA 1SS6A 4JKGB 4BRFA 4M3ZA 1NGAA 3AA3A 4LD0A 2G8IA 3LPTA 2CGJA 1DLOA 3WXKA 1Z25A 3TWHA 4JKFA 3L0QA 1CXQA 4YOWA 4DTJA 1TGOA 3UIQA 3OS2A 5HRNA 3LAMA 3LALA 3VQ5A 1RTDA 4BC2A 2QTDA 2CGKA 3AO3A 4HUGA 1F21A 2RN2A 3C7NA 2PYJA 3VGMA 4DV4K 3DWLA 5LL6Z 3J8AA 3IG1A 2Z1IA 4H5TA 4HVJA 4DSKA 4CEZA 3FZFA 5HRRA 2FBXA 4BRAA 3L2RA 1KC8O 4CHQA 1QZ6A 4CJTA 3SJJA 4OX9K 1A5XA 3AVBA 5AQOA 1U48A 3C65A 3K9JA 2Q0UA 4YY3K 1QSSA 1NK8A 4FOEA 3VPZA 3QFPA 3O4QA 4NCAA 3NMUA 3TTDA 4EHUA 4M7YA 4DF4A 2E2NA 1DGKN 3T1AA 2ZGYA 3WNFA 3VEXA 2OANA 4EFHA 3TSQA 3OYGA 3VQ9A 1J53A 5FDLA 4R5PA 4BDYA 4E0DA 4KHNA 1LW2A 4ICLA 2P9LB 3SYZA 1Q82O 1HNZK 3VQDA 4AH9A 4CJRA 2HHWA 3DM2A 3OYLA 4KHYA 4FW1A 4IFYA 3NAEA 4LC9B 1NGGA 5AZJB 1NKCA 1VK0A 2HB5A 2D0PA 5BR8K 3SBTA 1NJYA 2A6AA 5CY4A 2QK9A 4ZTFA 2E2OA 2X78A 3H3NO 1RT2A 4FJNA 4HTUA 3VA3A 4HWIA 1TAUA 2EHGA 4ISGA 3IUCA 1CLQA 2FBYA 1Y97A 3A5OC 2PFUA 3B6PA 5J1EA 4BRHA 4WFAL 4FCYA 3VEOA 2UXCK 2A5XA 2HF4A 3AVKA 3KIOA 4CGGA 3QEPA 3V9ZA 4M45A 1QTMA 3BEXA 5H1SQ 4E7IA 4BR7A 4DU3A 4UY8O 4MO4A 2P1JA 3S9HA 2E1ZA 4BRNA 4E7HA 3EY1A 3I0RA 4NB4A 3VGLA 1VQ9N 4CEOA 4LY7A 1VSKA 3OBWA 1C0TA 2HHHK 4B9NA 3PSIA 2KW4A 5C24A 3SCXA 2FF6A 4O0JA 2JGUA 3SMPA 4BE0A 4I9QA 3RTVA 1O1WA 4JKHA 1YXQA 1V4SA 4YOXA 4I6MA 4NYFA 4KFBA 4B3SK 3SUPA 5DMRA 3SV3A 3CHWA 3VEZA 5JICA 3ZT4A 2WOMA 4BE1A 3NF6A 3OYAA 1D4XA 4XH4A 1XI1A 4Q5VA 3SBGA 4FYDA 3ZSQA 3OYBA 2YX6A 1T44A 1FKPA 3G4SN 3MXMA 3LAKA 5C12A 3PX0A 1E3MA 4FM1A 4DQ8A 3V9UA 1WSGA 3TTFA 3O3FA 2O8FA 4FWKA 4EZ9A 4O4GA 4KAZA 4KB1A 3L6QA 3H45C 3LP1A 4O55A 3I56N 3HYFA 1UWBA 2BUPA 3HVRA 1S9GA 4IEEA 4HCBA 2P9UB 1KQSM 4MLHA
chains in the Genus database with same CATH topology
1RBSA 3NBPA 4FJ9A 1BGXT 3OYHA 4LSNA 1JKHA 4CF8A 4B3OA 3G10A 3HVTA 4PA1A 4OPJA 3AVLA 1WSFA 4N56A 4DQSA 4FJ8A 1SKRA 3RRGA 4DQQA 1KLNA 4CFAA 3AO5A 4Z0UA 1L3TA 3HO1A 3HL8A 3CYMA 3QEIA 3OS0A 2ETJA 1NJZA 1WSJA 3DLHA 1K6YA 3BDPA 1L3SA 4F3OA 4CGDA 4FJXA 4MQ3A 3OJSA 1CXUA 2A1SA 3SI6A 1IG9A 4CEAA 1KVCA 5KRTA 1UAXA 4C8MA 1KFSA 4FXDA 5C42A 1W0HA 4K8XA 2E6MA 4FLUA 2GBZA 2OZMA 1QQCA 2IS3A 4E7JA 1JLGA 4DFKA 3AVMA 1T05A 3RMCA 3DMJA 1IH7A 1S1UA 3I0SA 4RW4A 3HPHA 1HQUA 4BDPA 3WNGA 2BDPA 3SQ2A 3SUOA 2KZZA 3QLHA 3OYJA 5C25A 3AV9A 4B9VA 2XO7A 3K57A 4CEQA 4CJ4A 1LAWA 1VSDA 3DOKA 1C0UA 3D0PA 3IRXA 1S6QA 4E1MA 4IKFA 1LWEA 3RMAA 3CM6A 1LW0A 3KLGA 4KTWA 4DTNA 3AVNA 4FJJA 2OYQA 4E0DA 4DSJA 4OLBA 2KFZA 2F96A 4CEFA 3DI6A 4DQPA 2HHSA 3VQEA 5CYQA 1QE1A 4CJVA 4LH5A 3MXIA 2F8SA 4C8OA 1EP4A 2B5JA 4CESA 3ZT3A 4DLGA 3VQQA 1FKOA 4IFVA 4CIEA 3DLGA 1TKXA 1TV6A 2E4LA 3NH1A 4NCGA 2P5OA 4DS5A 2DTUA 4F8RA 4JRQA 4OGCA 3AVIA 4CK3A 3K2PA 2I5JA 4FLXA 1DTTA 3KD1E 1TKTA 4DU4A 4KKOA 2B6AA 1S9EA 4DLEA 2GUIA 3PX4A 4F4KA 2YKNA 3KJVA 2VG6A 4FLZA 3QIOA 4N76A 4Y1CA 3OJUA 1C1BA 3L2WA 3RWUA 4DF8A 4O0IA 3RMDA 2QKBA 4CCHA 1JLCA 3U3YA 1EX4A 2VG7A 3KKRA 3S3OA 3V1OA 3VN5A 4E7LA 3JYTA 1SL2A 4PY5A 3HP6A 4DFMA 4Z4GA 2P5GA 5I3UA 4J2AA 4DQIA 4CIFA 3ZSVA 2ZE2A 1RBVA 4CK1A 3NDKA 3AO4A 4FJ5A 4IBNA 4OPKA 1SL1A 3QIPA 3C6UA 1KVAA 2YNGA 1SL0A 2RF2A 2XY7A 3SPYA 1VSFA 2G8WA 3CM5A 1EXQA 2YNFA 4CJUA 3LWMA 2F8TA 1EETA 1ZBUA 3FFIA 2QXFA 1ZBHA 5JS2A 4ZTJA 4JLHA 3VQ4A 4OJRA 3HSTB 2NUBA 1BCMA 4Y1DA 1LV5A 4FJHA 3SQ4A 4AHCA 2BANA 1BHLA 1BIUA 3KLEA 4FLYA 3ZT1A 2XY8A 3SPZA 1TK8A 5J2MA 1IKWA 2DFHA 3TAFA 2PY5A 3L8BA 2Z1GA 4J2DA 4OKEA 4E19A 3NHGA 4RW7A 4CGHA 2OPQA 3O4NA 4N41A 4FK0A 2X6SA 4E89A 1FK9A 1EKEA 4DU1A 2D5RA 2OPSA 1NK6A 4CEEA 3SUQA 3OS1A 1T03A 3ALYA 1D8YA 4B9TA 4F2SA 1RT5A 4B8CA 1GOAA 1BISA 3A2FA 4KI6A 1R0AA 3P83D 4I2QA 4CJSA 5SWMA 2D0BA 3MXJA 3L2VA 1MU2A 4L8RB 3BGRA 4DFJA 4E7KA 3DRSA 1L3UA 1BI4B 1S1WA 3O3HA 3LP0A 2X74A 1HQEA 4QOZB 3KK3A 1U04A 4CJLA 4QAGA 4CJEA 2WONA 3L2QA 2HVHA 4M3XA 4CHNA 4CJ5A 5I42A 1S1TA 1D5AA 1TVRA 1Q9YA 4FJMA 4DTRA 1VSMA 3TAGA 1REVA 1VSJA 4YNQA 3U6FA 4F2RA 5HROA 3NGZA 1ZBIA 3OYIA 1TK0A 4C8NA 3ASMA 1TAQA 1ZBFA 1TKDA 2KQ2A 3MAQA 3CFOA 3MECA 2YHAA 4HUEA 3SUNA 1IO2A 1XHXA 2O4IA 3HP9A 2OPRA 4W5OA 2YNIA 4Z4FA 4W5QA 4WE1A 3ZT2A 4FM0A 4PQUA 3NE6A 3DOLA 3OYDA 1NOYA 2R7YA 4J2EA 4DQRA 3QNOA 3U3GA 3B6OA 4CHZA 3M8RA 4EZ6A 4KTQA 1JLBA 1C1AA 4I9LA 2HHVA 2D0CA 3TABA 5HRPA 3EYZA 4KHSA 3IAYA 3K5LA 3C95A 4C8LA 4M42A 1RDDA 1G15A 1U47A 2XRIA 3SV4A 3O3GA 5J2QA 3NF7A 5CZ2A 4ZHRA 3VQ6A 4CEDA 2A1RA 2QKKA 2HHQA 1TKZA 1NJXA 4IG3A 1HPZA 2Z1HA 3OYFA 3PV8A 3HJFA 3D45A 3ZSYA 4CGFA 3SNNA 2OA8A 1VSLA 2IDOA 1IKXA 3AVCA 1RILA 4CIGA 3QERA 1X9SA 4F3TA 2LSNA 4AHVA 1D9FA 3C94A 3F73A 3G0ZA 2X6NA 2ATQA 2EX3A 3LPUA 1VSEA 1BL3A 2GV9A 1TK5A 4CF1A 3CFPA 4CECA 4OLAA 1WSIA 4KTZA 4ELTA 5EU7A 4FJGA 3VA0A 5HP1A 4CFCA 4FZYA 3P5JA 4FJLA 5DK5A 4NYNA 2JLEA 4OKKA 3NGIA 1NK0A 3VQCA 1ITGA 3RR8A 3TAEA 4W5TA 1KFDA 1VRTA 3OVNA 1BI4A 4H4OA 1J9AA 3L2UA 4KHUA 4CHOA 4DS4A 3OYNA 1X9MA 1KTQA 1B92A 1HMVA 3CFRA 2FBVA 1ASWA 3MEEA 5KTQA 4M3UA 1VSHA 3AO1A 5J2NA 1S6PA 2YKMA 4O44A 1UOCA 4JS5A 1L3VA 1XC9A 1SKWA 3DRRA 4LH4A 4CHYA 4HCCA 4K8ZA 3NFAA 3TI0A 1RNHA 4JS4A 2VWJA 1BQMA 1S5JA 5FRMA 3DLEA 1D9DA 4GMJB 2DFEA 3KTQA 4DTUA 2D0AA 3NF8A 4BDZA 4B08A 1ASVA 4UQGA 3KLFA 3QEVA 3NGYA 1HJRA 1NK9A 4CGIA 4DSEA 3QNNA 5JS1A 4CJFA 1RTHA 1RDBA 3LP2A 1B9FA 3KD5E 1B9DA 4DSIA 4AHSA 1HRHA 3SQ0A 2G8UA 4DSLA 2BE2A 4PWDA 4I7FA 3V81A 1WLJA 4W5NA 3AVFA 3ULDA 4BWMA 4FLWA 4QCLA 1WAJA 2IGIA 4RW9A 2HHXA 2HW3A 3DYAA 2HNDA 3EZ5A 4M3ZA 2FBTA 3AA3A 4LD0A 4CJKA 2G8IA 3LPTA 4CE9A 1DLOA 1LAVA 4CGJA 5CYMA 4KREA 1Z25A 3QO9A 3TWHA 2G8HA 2IOCA 1ZBLA 3OYEA 1NOZA 1FXXA 3V9WA 1CXQA 3MEDA 3V9XA 3PO4A 4DTJA 3KKSA 3V9SA 5J2PA 1TGOA 3UIQA 1RBUA 5SZTA 3SZ2A 4N47A 3OS2A 4DWIA 1HNVA 3WNEA 2PYLA 2DY4A 3KK2A 5HRNA 4FJIA 4M3WA 3LAMA 3RR7A 1WSEA 3LALA 3VQ5A 3ZSXA 3M8QA 1RTDA 2HHUA 3DLRA 4CEBA 4M41A 4Z4CA 3V6DA 3AO3A 3CG7A 2VWKA 4HUGA 3HK2A 1F21A 4E1NA 1NK7A 3P1GA 2RN2A 4B9SA 2PYJA 1RBTA 3T19A 2FC0A 4O5BA 3DRPA 1T7PA 3V4IA 4C8KA 4DFPA 3IG1A 4MFBA 1JLAA 2Z1IA 4HVJA 3L3UA 1CZBA 4M3RA 4DSKA 3OYCA 4CEZA 4KI4A 2KTQA 5HRRA 4KRFA 2FBXA 3CQ8A 3ZSOA 4FZXC 3L2RA 3F9KA 1IKVA 3QEWA 3TARA 1YT3A 3S3NA 4B9MA 1C6VA 4FJKA 4CHQA 2O4GA 1DTQA 3AA4A 4CJ3A 4CJTA 1W9HA 3ISNC 3SJJA 3ZSRA 1JLFA 3HPOA 2OPPA 3JSMA 4DTOA 4Z4IA 1BCOA 4M3TA 1A5XA 3AA2A 1J54A 1WSHA 3AVBA 4I2PA 1U48A 3M8SA 3TAMA 1NKEA 3NH0A 3AVHA 3KLHA 1N6QA 4DG1A 1QSSA 1NK8A 4FK4A 2Y1JA 4GW6A 3K5OA 1RT4A 2B4JA 3O4QA 1YTAA 4IDKA 4BE2A 4KV8A 4AILC 2XY5A 3PX6A 4NCAA 2HHTA 4CFBA 4DF4A 4TSXA 4ELVA 1A5VA 3S3MA 4CK2A 1S1VA 3HPGA 1RTIA 1S1XA 4FJ7A 3PO5A 1QS4A 3C6TA 3T1AA 4J2BA 3V1QA 4HHTA 2Q3SA 3WNFA 3KK1A 4DTXA 4H8KA 4CJWA 1NK4A 3ZSZA 3OYGA 4W5RA 3VQ9A 1J53A 5FDLA 1ASUA 1JL1A 4CHPA 4R5PA 1LW2A 4CJPA 1WAFA 4HUFA 4ICLA 4BDYA 4KHNA 2ZQBA 3SYZA 3PY8A 2ZD1A 3VQDA 1IKYA 4DTSA 4AH9A 3MEGA 3WNHA 3QETA 4AHTA 4CJRA 2HHWA 3DM2A 3I8DA 3QEXA 3OYLA 2IC3A 4KHYA 4FW1A 4IFYA 3VQ8A 4FM2A 1U45A 1JLEA 3VQPA 3NAEA 1SUQA 1U4BA 4ID1A 2Y1IA 1KLMA 1NKCA 1VK0A 1WNSA 2HB5A 1QSYA 1XHZA 4RW8A 2XHBA 3E01A 1NJYA 1JXBA 1N5YA 3AVJA 5CY4A 4XIUA 4ZTFA 2QK9A 4AHRA 2X78A 2ITGA 1RT2A 5K14A 1YVUA 4FJNA 4ID5A 2RPIA 4KO0A 4HTUA 3VA3A 1UA1A 1TAUA 1VRUA 2EHGA 3AVGA 5D3GA 2VG5A 4OVLA 3LWLA 2FBYA 1KSPA 1Y97A 4Z4EA 1CLQA 4FZZA 3ZSWA 5KRSA 1KVBA 3B6PA 1KCFA 4EP4A 5J1EA 3PUFA 4FCYA 5HRSA 3L3VA 2PZSA 4OKJA 4RW6A 4B8AB 3AVKA 4E3SA 3KIOA 4CGGA 3QEPA 4NCBA 3K5NA 4KPYA 1RT7A 3V9ZA 4M45A 1QTMA 1NK5A 3LP3A 3SQ1A 2YV0X 2E6LA 3LZJA 4E7IA 1JLQA 2DFFA 4CF0A 4DU3A 4DTMA 1X1PA 2P51A 3NCIA 2HVIA 1RT1A 4Q0BA 2P1JA 3K59A 4DMNA 5KI6A 3S9HA 4N5SA 3ZCMA 1HNIA 4E7HA 3EY1A 1BIZA 3K58A 4BACA 4GVMA 3I0RA 3TAPA 5T7BA 4FK2A 4CEOA 1RDAA 1CZ9A 4LY7A 3OYMA 1GOBA 1RDCA 1VSKA 2YNHA 4FLTA 2BGGA 3T3FA 5CZ1A 1C0TA 4B9NA 3VQBA 1KRPA 1Q9XA 2KW4A 5C24A 1XWLA 3SCXA 5FRNA 4O0JA 2JGUA 4BE0A 4I9QA 3RTVA 2IAJA 1LWFA 1O1WA 2G8FA 4CFDA 2W42A 1RTJA 3NF9A 5E41A 4FW2A 4RG8A 4NYFA 4YFUA 4KFBA 4B9UA 3RRHA 1HYVA 4BWJA 3SUPA 5DMRA 5HBMA 3LZIA 4AHUA 3SV3A 4KHQA 3THVA 1NJWA 1RT6A 3TAQA 3ZT4A 2WOMA 3AA5X 4BE1A 1ZYQA 3NF6A 2AJQA 1C1CA 3LANA 3OYAA 5KGXA 1XI1A 1UA0A 3NH2A 4Q5VA 3LDSA 4DTPA 5HLFA 3IS9A 3M8PA 3H08A 2G8VA 4FYDA 3ZSQA 3OYBA 1SV5A 3VQ7A 3VQAA 1FKPA 1HYSA 1A5WA 4CF9A 3MXMA 1J5OA 3LAKA 3QINA 3DLBA 4M3YA 4CJQA 5FROA 4FM1A 3V9UA 3PX0A 1WN7A 4KB0A 1WSGA 5KGWA 2Z1JA 1TL3A 3O3FA 1L5UA 4FLVA 1QHTA 4EZ9A 4O4GA 4DSFA 4KAZA 1NKBA 4KB1A 2KZMA 1LWCA 2KFNA 3K5MA 1X9WA 3QESA 4Z4HA 1JXEA 1I39A 1RT3A 3ITHA 3V1RA 1JL2A 4LSLA 4CERA 2XY6A 2HNYA 1BQNA 4CF2A 1HYZA 1Z26A 4KHWA 4IG0A 2G8KA 1I3AA 4EP5A 1U49A 1T8EA 4B9LA 3LP1A 1YTUA 2YHBA 3OYKA 4H4MA 4O55A 1Q8IA 3TR8A 3ZT0A 4FVMA 1RBRA 3OY9A 2HNZA 2RKIA 1UWBA 3HYFA 3HVRA 3TANA 2OZSA 4PUOA 4OGEA 1C0MA 1S9GA 3HXMA 3RMBA 1SKSA 4ELUA 4HCBA 1GOCA 3HM9A 3AVAA 4JRPA 4G1QA 1QSLA 3AO2A 1VSIA 1RCHA 3HT3A 1TL1A 3KLIA 2HMIA 3DLKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RBS A;  3NBP A;  4FJ9 A;  1BGX T;  3OYH A;  4LSN A;  1JKH A;  4CF8 A;  4B3O A;  3G10 A;  3HVT A;  4PA1 A;  4OPJ A;  3AVL A;  1WSF A;  4N56 A;  4DQS A;  4FJ8 A;  1SKR A;  3RRG A;  4DQQ A;  1KLN A;  4CFA A;  3AO5 A;  4Z0U A;  1L3T A;  3HO1 A;  3HL8 A;  3CYM A;  3QEI A;  3OS0 A;  2ETJ A;  1NJZ A;  1WSJ A;  3DLH A;  1K6Y A;  3BDP A;  1L3S A;  4F3O A;  4CGD A;  4FJX A;  4MQ3 A;  3OJS A;  1CXU A;  2A1S A;  3SI6 A;  1IG9 A;  4CEA A;  1KVC A;  5KRT A;  1UAX A;  4C8M A;  1KFS A;  4FXD A;  5C42 A;  1W0H A;  4K8X A;  2E6M A;  4FLU A;  2GBZ A;  2OZM A;  1QQC A;  2IS3 A;  4E7J A;  1JLG A;  4DFK A;  3AVM A;  1T05 A;  3RMC A;  3DMJ A;  1IH7 A;  1S1U A;  3I0S A;  4RW4 A;  3HPH A;  1HQU A;  4BDP A;  3WNG A;  2BDP A;  3SQ2 A;  3SUO A;  2KZZ A;  3QLH A;  3OYJ A;  5C25 A;  3AV9 A;  4B9V A;  2XO7 A;  3K57 A;  4CEQ A;  4CJ4 A;  1LAW A;  1VSD A;  3DOK A;  1C0U A;  3D0P A;  3IRX A;  1S6Q A;  4E1M A;  4IKF A;  1LWE A;  3RMA A;  3CM6 A;  1LW0 A;  3KLG A;  4KTW A;  4DTN A;  3AVN A;  4FJJ A;  2OYQ A;  4E0D A;  4DSJ A;  4OLB A;  2KFZ A;  2F96 A;  4CEF A;  3DI6 A;  4DQP A;  2HHS A;  3VQE A;  5CYQ A;  1QE1 A;  4CJV A;  4LH5 A;  3MXI A;  2F8S A;  4C8O A;  1EP4 A;  2B5J A;  4CES A;  3ZT3 A;  4DLG A;  3VQQ A;  1FKO A;  4IFV A;  4CIE A;  3DLG A;  1TKX A;  1TV6 A;  2E4L A;  3NH1 A;  4NCG A;  2P5O A;  4DS5 A;  2DTU A;  4F8R A;  4JRQ A;  4OGC A;  3AVI A;  4CK3 A;  3K2P A;  2I5J A;  4FLX A;  1DTT A;  3KD1 E;  1TKT A;  4DU4 A;  4KKO A;  2B6A A;  1S9E A;  4DLE A;  2GUI A;  3PX4 A;  4F4K A;  2YKN A;  3KJV A;  2VG6 A;  4FLZ A;  3QIO A;  4N76 A;  4Y1C A;  3OJU A;  1C1B A;  3L2W A;  3RWU A;  4DF8 A;  4O0I A;  3RMD A;  2QKB A;  4CCH A;  1JLC A;  3U3Y A;  1EX4 A;  2VG7 A;  3KKR A;  3S3O A;  3V1O A;  3VN5 A;  4E7L A;  3JYT A;  1SL2 A;  4PY5 A;  3HP6 A;  4DFM A;  4Z4G A;  2P5G A;  5I3U A;  4J2A A;  4DQI A;  4CIF A;  3ZSV A;  2ZE2 A;  1RBV A;  4CK1 A;  3NDK A;  3AO4 A;  4FJ5 A;  4IBN A;  4OPK A;  1SL1 A;  3QIP A;  3C6U A;  1KVA A;  2YNG A;  1SL0 A;  2RF2 A;  2XY7 A;  3SPY A;  1VSF A;  2G8W A;  3CM5 A;  1EXQ A;  2YNF A;  4CJU A;  3LWM A;  2F8T A;  1EET A;  1ZBU A;  3FFI A;  2QXF A;  1ZBH A;  5JS2 A;  4ZTJ A;  4JLH A;  3VQ4 A;  4OJR A;  3HST B;  2NUB A;  1BCM A;  4Y1D A;  1LV5 A;  4FJH A;  3SQ4 A;  4AHC A;  2BAN A;  1BHL A;  1BIU A;  3KLE A;  4FLY A;  3ZT1 A;  2XY8 A;  3SPZ A;  1TK8 A;  5J2M A;  1IKW A;  2DFH A;  3TAF A;  2PY5 A;  3L8B A;  2Z1G A;  4J2D A;  4OKE A;  4E19 A;  3NHG A;  4RW7 A;  4CGH A;  2OPQ A;  3O4N A;  4N41 A;  4FK0 A;  2X6S A;  4E89 A;  1FK9 A;  1EKE A;  4DU1 A;  2D5R A;  2OPS A;  1NK6 A;  4CEE A;  3SUQ A;  3OS1 A;  1T03 A;  3ALY A;  1D8Y A;  4B9T A;  4F2S A;  1RT5 A;  4B8C A;  1GOA A;  1BIS A;  3A2F A;  4KI6 A;  1R0A A;  3P83 D;  4I2Q A;  4CJS A;  5SWM A;  2D0B A;  3MXJ A;  3L2V A;  1MU2 A;  4L8R B;  3BGR A;  4DFJ A;  4E7K A;  3DRS A;  1L3U A;  1BI4 B;  1S1W A;  3O3H A;  3LP0 A;  2X74 A;  1HQE A;  4QOZ B;  3KK3 A;  1U04 A;  4CJL A;  4QAG A;  4CJE A;  2WON A;  3L2Q A;  2HVH A;  4M3X A;  4CHN A;  4CJ5 A;  5I42 A;  1S1T A;  1D5A A;  1TVR A;  1Q9Y A;  4FJM A;  4DTR A;  1VSM A;  3TAG A;  1REV A;  1VSJ A;  4YNQ A;  3U6F A;  4F2R A;  5HRO A;  3NGZ A;  1ZBI A;  3OYI A;  1TK0 A;  4C8N A;  3ASM A;  1TAQ A;  1ZBF A;  1TKD A;  2KQ2 A;  3MAQ A;  3CFO A;  3MEC A;  2YHA A;  4HUE A;  3SUN A;  1IO2 A;  1XHX A;  2O4I A;  3HP9 A;  2OPR A;  4W5O A;  2YNI A;  4Z4F A;  4W5Q A;  4WE1 A;  3ZT2 A;  4FM0 A;  4PQU A;  3NE6 A;  3DOL A;  3OYD A;  1NOY A;  2R7Y A;  4J2E A;  4DQR A;  3QNO A;  3U3G A;  3B6O A;  4CHZ A;  3M8R A;  4EZ6 A;  4KTQ A;  1JLB A;  1C1A A;  4I9L A;  2HHV A;  2D0C A;  3TAB A;  5HRP A;  3EYZ A;  4KHS A;  3IAY A;  3K5L A;  3C95 A;  4C8L A;  4M42 A;  1RDD A;  1G15 A;  1U47 A;  2XRI A;  3SV4 A;  3O3G A;  5J2Q A;  3NF7 A;  5CZ2 A;  4ZHR A;  3VQ6 A;  4CED A;  2A1R A;  2QKK A;  2HHQ A;  1TKZ A;  1NJX A;  4IG3 A;  1HPZ A;  2Z1H A;  3OYF A;  3PV8 A;  3HJF A;  3D45 A;  3ZSY A;  4CGF A;  3SNN A;  2OA8 A;  1VSL A;  2IDO A;  1IKX A;  3AVC A;  1RIL A;  4CIG A;  3QER A;  1X9S A;  4F3T A;  2LSN A;  4AHV A;  1D9F A;  3C94 A;  3F73 A;  3G0Z A;  2X6N A;  2ATQ A;  2EX3 A;  3LPU A;  1VSE A;  1BL3 A;  2GV9 A;  1TK5 A;  4CF1 A;  3CFP A;  4CEC A;  4OLA A;  1WSI A;  4KTZ A;  4ELT A;  5EU7 A;  4FJG A;  3VA0 A;  5HP1 A;  4CFC A;  4FZY A;  3P5J A;  4FJL A;  5DK5 A;  4NYN A;  2JLE A;  4OKK A;  3NGI A;  1NK0 A;  3VQC A;  1ITG A;  3RR8 A;  3TAE A;  4W5T A;  1KFD A;  1VRT A;  3OVN A;  1BI4 A;  4H4O A;  1J9A A;  3L2U A;  4KHU A;  4CHO A;  4DS4 A;  3OYN A;  1X9M A;  1KTQ A;  1B92 A;  1HMV A;  3CFR A;  2FBV A;  1ASW A;  3MEE A;  5KTQ A;  4M3U A;  1VSH A;  3AO1 A;  5J2N A;  1S6P A;  2YKM A;  4O44 A;  1UOC A;  4JS5 A;  1L3V A;  1XC9 A;  1SKW A;  3DRR A;  4LH4 A;  4CHY A;  4HCC A;  4K8Z A;  3NFA A;  3TI0 A;  1RNH A;  4JS4 A;  2VWJ A;  1BQM A;  1S5J A;  5FRM A;  3DLE A;  1D9D A;  4GMJ B;  2DFE A;  3KTQ A;  4DTU A;  2D0A A;  3NF8 A;  4BDZ A;  4B08 A;  1ASV A;  4UQG A;  3KLF A;  3QEV A;  3NGY A;  1HJR A;  1NK9 A;  4CGI A;  4DSE A;  3QNN A;  5JS1 A;  4CJF A;  1RTH A;  1RDB A;  3LP2 A;  1B9F A;  3KD5 E;  1B9D A;  4DSI A;  4AHS A;  1HRH A;  3SQ0 A;  2G8U A;  4DSL A;  2BE2 A;  4PWD A;  4I7F A;  3V81 A;  1WLJ A;  4W5N A;  3AVF A;  3ULD A;  4BWM A;  4FLW A;  4QCL A;  1WAJ A;  2IGI A;  4RW9 A;  2HHX A;  2HW3 A;  3DYA A;  2HND A;  3EZ5 A;  4M3Z A;  2FBT A;  3AA3 A;  4LD0 A;  4CJK A;  2G8I A;  3LPT A;  4CE9 A;  1DLO A;  1LAV A;  4CGJ A;  5CYM A;  4KRE A;  1Z25 A;  3QO9 A;  3TWH A;  2G8H A;  2IOC A;  1ZBL A;  3OYE A;  1NOZ A;  1FXX A;  3V9W A;  1CXQ A;  3MED A;  3V9X A;  3PO4 A;  4DTJ A;  3KKS A;  3V9S A;  5J2P A;  1TGO A;  3UIQ A;  1RBU A;  5SZT A;  3SZ2 A;  4N47 A;  3OS2 A;  4DWI A;  1HNV A;  3WNE A;  2PYL A;  2DY4 A;  3KK2 A;  5HRN A;  4FJI A;  4M3W A;  3LAM A;  3RR7 A;  1WSE A;  3LAL A;  3VQ5 A;  3ZSX A;  3M8Q A;  1RTD A;  2HHU A;  3DLR A;  4CEB A;  4M41 A;  4Z4C A;  3V6D A;  3AO3 A;  3CG7 A;  2VWK A;  4HUG A;  3HK2 A;  1F21 A;  4E1N A;  1NK7 A;  3P1G A;  2RN2 A;  4B9S A;  2PYJ A;  1RBT A;  3T19 A;  2FC0 A;  4O5B A;  3DRP A;  1T7P A;  3V4I A;  4C8K A;  4DFP A;  3IG1 A;  4MFB A;  1JLA A;  2Z1I A;  4HVJ A;  3L3U A;  1CZB A;  4M3R A;  4DSK A;  3OYC A;  4CEZ A;  4KI4 A;  2KTQ A;  5HRR A;  4KRF A;  2FBX A;  3CQ8 A;  3ZSO A;  4FZX C;  3L2R A;  3F9K A;  1IKV A;  3QEW A;  3TAR A;  1YT3 A;  3S3N A;  4B9M A;  1C6V A;  4FJK A;  4CHQ A;  2O4G A;  1DTQ A;  3AA4 A;  4CJ3 A;  4CJT A;  1W9H A;  3ISN C;  3SJJ A;  3ZSR A;  1JLF A;  3HPO A;  2OPP A;  3JSM A;  4DTO A;  4Z4I A;  1BCO A;  4M3T A;  1A5X A;  3AA2 A;  1J54 A;  1WSH A;  3AVB A;  4I2P A;  1U48 A;  3M8S A;  3TAM A;  1NKE A;  3NH0 A;  3AVH A;  3KLH A;  1N6Q A;  4DG1 A;  1QSS A;  1NK8 A;  4FK4 A;  2Y1J A;  4GW6 A;  3K5O A;  1RT4 A;  2B4J A;  3O4Q A;  1YTA A;  4IDK A;  4BE2 A;  4KV8 A;  4AIL C;  2XY5 A;  3PX6 A;  4NCA A;  2HHT A;  4CFB A;  4DF4 A;  4TSX A;  4ELV A;  1A5V A;  3S3M A;  4CK2 A;  1S1V A;  3HPG A;  1RTI A;  1S1X A;  4FJ7 A;  3PO5 A;  1QS4 A;  3C6T A;  3T1A A;  4J2B A;  3V1Q A;  4HHT A;  2Q3S A;  3WNF A;  3KK1 A;  4DTX A;  4H8K A;  4CJW A;  1NK4 A;  3ZSZ A;  3OYG A;  4W5R A;  3VQ9 A;  1J53 A;  5FDL A;  1ASU A;  1JL1 A;  4CHP A;  4R5P A;  1LW2 A;  4CJP A;  1WAF A;  4HUF A;  4ICL A;  4BDY A;  4KHN A;  2ZQB A;  3SYZ A;  3PY8 A;  2ZD1 A;  3VQD A;  1IKY A;  4DTS A;  4AH9 A;  3MEG A;  3WNH A;  3QET A;  4AHT A;  4CJR A;  2HHW A;  3DM2 A;  3I8D A;  3QEX A;  3OYL A;  2IC3 A;  4KHY A;  4FW1 A;  4IFY A;  3VQ8 A;  4FM2 A;  1U45 A;  1JLE A;  3VQP A;  3NAE A;  1SUQ A;  1U4B A;  4ID1 A;  2Y1I A;  1KLM A;  1NKC A;  1VK0 A;  1WNS A;  2HB5 A;  1QSY A;  1XHZ A;  4RW8 A;  2XHB A;  3E01 A;  1NJY A;  1JXB A;  1N5Y A;  3AVJ A;  5CY4 A;  4XIU A;  4ZTF A;  2QK9 A;  4AHR A;  2X78 A;  2ITG A;  1RT2 A;  5K14 A;  1YVU A;  4FJN A;  4ID5 A;  2RPI A;  4KO0 A;  4HTU A;  3VA3 A;  1UA1 A;  1TAU A;  1VRU A;  2EHG A;  3AVG A;  5D3G A;  2VG5 A;  4OVL A;  3LWL A;  2FBY A;  1KSP A;  1Y97 A;  4Z4E A;  1CLQ A;  4FZZ A;  3ZSW A;  5KRS A;  1KVB A;  3B6P A;  1KCF A;  4EP4 A;  5J1E A;  3PUF A;  4FCY A;  5HRS A;  3L3V A;  2PZS A;  4OKJ A;  4RW6 A;  4B8A B;  3AVK A;  4E3S A;  3KIO A;  4CGG A;  3QEP A;  4NCB A;  3K5N A;  4KPY A;  1RT7 A;  3V9Z A;  4M45 A;  1QTM A;  1NK5 A;  3LP3 A;  3SQ1 A;  2YV0 X;  2E6L A;  3LZJ A;  4E7I A;  1JLQ A;  2DFF A;  4CF0 A;  4DU3 A;  4DTM A;  1X1P A;  2P51 A;  3NCI A;  2HVI A;  1RT1 A;  4Q0B A;  2P1J A;  3K59 A;  4DMN A;  5KI6 A;  3S9H A;  4N5S A;  3ZCM A;  1HNI A;  4E7H A;  3EY1 A;  1BIZ A;  3K58 A;  4BAC A;  4GVM A;  3I0R A;  3TAP A;  5T7B A;  4FK2 A;  4CEO A;  1RDA A;  1CZ9 A;  4LY7 A;  3OYM A;  1GOB A;  1RDC A;  1VSK A;  2YNH A;  4FLT A;  2BGG A;  3T3F A;  5CZ1 A;  1C0T A;  4B9N A;  3VQB A;  1KRP A;  1Q9X A;  2KW4 A;  5C24 A;  1XWL A;  3SCX A;  5FRN A;  4O0J A;  2JGU A;  4BE0 A;  4I9Q A;  3RTV A;  2IAJ A;  1LWF A;  1O1W A;  2G8F A;  4CFD A;  2W42 A;  1RTJ A;  3NF9 A;  5E41 A;  4FW2 A;  4RG8 A;  4NYF A;  4YFU A;  4KFB A;  4B9U A;  3RRH A;  1HYV A;  4BWJ A;  3SUP A;  5DMR A;  5HBM A;  3LZI A;  4AHU A;  3SV3 A;  4KHQ A;  3THV A;  1NJW A;  1RT6 A;  3TAQ A;  3ZT4 A;  2WOM A;  3AA5 X;  4BE1 A;  1ZYQ A;  3NF6 A;  2AJQ A;  1C1C A;  3LAN A;  3OYA A;  5KGX A;  1XI1 A;  1UA0 A;  3NH2 A;  4Q5V A;  3LDS A;  4DTP A;  5HLF A;  3IS9 A;  3M8P A;  3H08 A;  2G8V A;  4FYD A;  3ZSQ A;  3OYB A;  1SV5 A;  3VQ7 A;  3VQA A;  1FKP A;  1HYS A;  1A5W A;  4CF9 A;  3MXM A;  1J5O A;  3LAK A;  3QIN A;  3DLB A;  4M3Y A;  4CJQ A;  5FRO A;  4FM1 A;  3V9U A;  3PX0 A;  1WN7 A;  4KB0 A;  1WSG A;  5KGW A;  2Z1J A;  1TL3 A;  3O3F A;  1L5U A;  4FLV A;  1QHT A;  4EZ9 A;  4O4G A;  4DSF A;  4KAZ A;  1NKB A;  4KB1 A;  2KZM A;  1LWC A;  2KFN A;  3K5M A;  1X9W A;  3QES A;  4Z4H A;  1JXE A;  1I39 A;  1RT3 A;  3ITH A;  3V1R A;  1JL2 A;  4LSL A;  4CER A;  2XY6 A;  2HNY A;  1BQN A;  4CF2 A;  1HYZ A;  1Z26 A;  4KHW A;  4IG0 A;  2G8K A;  1I3A A;  4EP5 A;  1U49 A;  1T8E A;  4B9L A;  3LP1 A;  1YTU A;  2YHB A;  3OYK A;  4H4M A;  4O55 A;  1Q8I A;  3TR8 A;  3ZT0 A;  4FVM A;  1RBR A;  3OY9 A;  2HNZ A;  2RKI A;  1UWB A;  3HYF A;  3HVR A;  3TAN A;  2OZS A;  4PUO A;  4OGE A;  1C0M A;  1S9G A;  3HXM A;  3RMB A;  1SKS A;  4ELU A;  4HCB A;  1GOC A;  3HM9 A;  3AVA A;  4JRP A;  4G1Q A;  1QSL A;  3AO2 A;  1VSI A;  1RCH A;  3HT3 A;  1TL1 A;  3KLI A;  2HMI A;  3DLK A; 
#chains in the Genus database with same CATH topology
 1RBS A;  1BGX T;  3OYH A;  3A5M C;  4CF8 A;  3AVL A;  2UYT A;  1OVQ A;  2E1Y A;  4CFA A;  3TU5 A;  3AO5 A;  3HO1 A;  3CYM A;  3OS0 A;  2GEL A;  3SAH A;  3B8A X;  3G6E N;  3G71 N;  3DLH A;  4F3O A;  4CGD A;  4MQ3 A;  2ASP A;  4A61 A;  5E84 A;  1KVC A;  4C8M A;  5BRF A;  1VHX A;  4XEI A;  1IV0 A;  1W0H A;  2GBZ A;  3MWP A;  5M1O A;  1T6D A;  1N32 K;  1QQC A;  2IS3 A;  4E7J A;  3AVM A;  1T05 A;  3RMC A;  3QIC A;  5M1Q A;  2HBK A;  2NRT A;  3GG4 A;  1P90 A;  3HPH A;  2P9U A;  2QI2 A;  3BF3 A;  3SQ2 A;  4Z94 A;  3AV9 A;  4B9V A;  1RGI A;  1S72 N;  3IRX A;  1N36 K;  4E1M A;  4IKF A;  4ISE A;  3CM6 A;  5AQW A;  1LW0 A;  4FJJ A;  2OYQ A;  4CEF A;  3O9U A;  3C6A A;  3VEY A;  5F1X A;  2HHS A;  3MN6 A;  4CJV A;  4LH5 A;  4C8O A;  3FR0 A;  4DLG A;  4IFV A;  4DS5 A;  1Q18 A;  3UE5 A;  2E5L K;  3AVI A;  3OHR A;  5ELZ A;  4JAX A;  3EL2 A;  3P31 A;  3PX4 A;  1JCF A;  4N76 A;  3QIO A;  3BUZ B;  3JYT A;  4Z4G A;  3T1H K;  2O8E B;  4DQI A;  4CIF A;  5DM6 L;  3QDK A;  4IBN A;  4OPK A;  1SL1 A;  1SL0 A;  2YNG A;  1VQN N;  2XY7 A;  2NLX A;  1FW6 A;  4H0V B;  3MDQ A;  4BC3 A;  4B1U B;  4FO0 A;  4BRQ A;  1BCM A;  5B8H A;  3MWT A;  3SQ4 A;  1BIU A;  1GLE G;  2XY8 A;  3SPZ A;  2DFH A;  3TAF A;  2PY5 A;  5AQZ A;  5GIN A;  3L8B A;  3NHG A;  2GWK A;  2Q0R A;  3O4N A;  2P9S A;  4FK0 A;  4H0O A;  3MCP A;  4JNE A;  4WYB A;  5AQI A;  1FK9 A;  1EKE A;  2D5R A;  4ILJ A;  4JI5 K;  4CEE A;  3UKR B;  3SUQ A;  1D8Y A;  4F2S A;  1RT5 A;  4JYA K;  1XUP O;  4KI6 A;  2YHW A;  5EX5 A;  4CJS A;  5LMU K;  4JKC A;  2ZGZ A;  1MU2 A;  1BI4 B;  4QOZ B;  2W40 A;  3CCR N;  4M3X A;  4CHN A;  3O8M A;  1TVR A;  5AZI B;  1REV A;  4F2R A;  1ZBI A;  3OYI A;  1TK0 A;  3ASM A;  3CQY A;  3MAQ A;  3CFO A;  4W5O A;  3WXI A;  4WE1 A;  4FM0 A;  3DOL A;  5LJV A;  2R7Y A;  4DQR A;  2J4R A;  1C1A A;  3DLL L;  3WXJ A;  3C95 A;  1RDD A;  1G15 A;  3E66 A;  2HHQ A;  5IWA K;  3DJC A;  1RIL A;  4F3T A;  4IEI A;  2LSN A;  3C94 A;  4IXC A;  2JWL A;  2YI1 A;  2X6N A;  1VQ8 N;  3VF2 A;  1M90 O;  3L4Q A;  4BGA A;  2O8D B;  1WSI A;  4KTZ A;  1TYQ A;  3P5J A;  5AQG A;  3RR8 A;  4W5T A;  2UUC K;  1TYQ B;  4KHU A;  1J9A A;  4CHO A;  3OYN A;  2FBV A;  4JS5 A;  1UOC A;  3C7N B;  1WB9 A;  4LH4 A;  4CHY A;  1BQM A;  4GMJ B;  2DFE A;  3VF6 A;  1LOT B;  4K41 A;  4DSE A;  1OH6 A;  3LDN A;  4B3T K;  4IZ9 A;  4DR6 K;  3LP2 A;  1B9F A;  2P9K A;  3D7E O;  3UB5 A;  4AHS A;  3SQ0 A;  4DSL A;  3V81 A;  1JJ2 M;  4W5N A;  1WAJ A;  2IGI A;  3G25 A;  2KKZ A;  2HND A;  3HSC A;  3EZ5 A;  4BRP A;  4AM7 A;  5CYM A;  2ZJP L;  4L3Q A;  5TKW A;  3CCM N;  3H46 O;  2IOC A;  1ZBL A;  5FPN A;  1NOZ A;  1FXX A;  4A5A A;  1BG3 A;  1J5E K;  3MX2 A;  1NU0 A;  1RBU A;  4R79 A;  5SZT A;  4DWI A;  1HNV A;  2A3Z A;  2PYL A;  3PSF A;  1WSE A;  1YJ9 N;  4CEB A;  1XMQ K;  2E2Q A;  5BPN A;  2VWK A;  3HK2 A;  4E1N A;  1N34 K;  1NGF A;  2VWB A;  3T19 A;  2FC0 A;  1T7P A;  3DRP A;  3CXC M;  3V4I A;  4C8K A;  3ZX2 A;  2W6K A;  4KI4 A;  4FZX C;  4YOT A;  1IKV A;  3QEW A;  1C6V A;  2O4G A;  1DTQ A;  3EEQ A;  5JLH A;  4CJ3 A;  4AM6 A;  3MK6 A;  4DR2 K;  1JLF A;  4X65 K;  1J54 A;  2FSJ A;  4I2P A;  4BRG A;  3TAM A;  3KLH A;  4GW6 A;  4JK7 A;  2HHT A;  4IDK A;  4DCH A;  4TSX A;  3W0L A;  3S3M A;  1S1V A;  4J2B A;  2Q3S A;  3KK1 A;  1DKG D;  1GLD G;  4CBX A;  1NK4 A;  1C0G A;  4CJP A;  2ASO A;  2ZQB A;  3FZL A;  5LMN K;  3EN9 A;  4CZJ A;  3QEX A;  1TUY A;  4JD2 A;  3VQ8 A;  1U45 A;  4FM2 A;  3FLC O;  1SUQ A;  4AQY K;  2Y1I A;  1KLM A;  1QSY A;  2HBL A;  1NGE A;  1N5Y A;  1EWQ A;  3AVJ A;  4BRC A;  2ITG A;  3SK3 A;  3IDH A;  4ID5 A;  2VGM A;  1H1V A;  1MDU B;  4OVL A;  3A5N C;  3WEE A;  3CQX A;  3ZSW A;  4FZZ A;  3ZX0 A;  4EP4 A;  4DV5 K;  1S3X A;  3LP3 A;  2YV0 X;  2E6L A;  4BG8 A;  3LZJ A;  4DTM A;  1HNW K;  2P51 A;  3O9T A;  2HVI A;  3DXM B;  4WF9 L;  1QZ5 A;  3VF4 A;  2A42 A;  5KI6 A;  3ZCM A;  1HNI A;  1VQM N;  4O8U A;  1BIZ A;  3K58 A;  1NGD A;  3S41 A;  4DUZ K;  2Q1N A;  5T7B A;  2O8D A;  1GOB A;  2YNH A;  1GLL O;  1XWL A;  3OA9 A;  4WFN L;  2W42 A;  3PIP L;  3AY9 A;  2P9P A;  4FW2 A;  4CZI A;  3O1B A;  1DT9 A;  1HYV A;  5BRH A;  4KHQ A;  1YI2 N;  3THV A;  4X64 K;  1RT6 A;  3TAQ A;  5ADX H;  2VGN A;  3AA5 X;  1ZYQ A;  3VET A;  2AJQ A;  5AQL A;  3KD1 E;  2NRH A;  2G8V A;  4FWO A;  3LDS A;  4DTP A;  4JKG A;  4KH6 A;  1NNE A;  1M1K O;  2CH5 A;  1HYS A;  1A5W A;  4CF9 A;  3QIN A;  3DLB A;  3FZH A;  3I55 N;  4KB0 A;  1ATS A;  1L5U A;  4DSF A;  1VQP N;  4CD3 A;  2KFN A;  3ITH A;  3FE1 A;  4LSL A;  2XY6 A;  2HNY A;  2QWP A;  5AQQ A;  1YIJ N;  1Z26 A;  3IMX A;  1HR0 K;  4IG0 A;  3TSP A;  1I3A A;  4EP5 A;  1U49 A;  1HKG A;  1YTU A;  2YHB A;  4H4M A;  3P38 A;  3TR8 A;  2HNZ A;  4BQZ A;  2RHK A;  1ESV A;  1TL1 A;  3HPO A;  4MDA A;  2HMI A;  5GIO A;  1HPM A;  3NBP A;  4FJ9 A;  2WTU A;  4B3O A;  3G10 A;  3HVT A;  4YOR A;  4OPJ A;  1Q81 O;  1WSF A;  5AQV A;  4MLE A;  4B1Z A;  4NXN K;  3MCA B;  2ETJ A;  3BDP A;  3OJS A;  4A59 A;  2GEM A;  1IG9 A;  4CEA A;  2IVN A;  4FXD A;  2ZJR L;  5EY4 A;  4FLU A;  4YOV A;  3THX B;  4WQ5 A;  4DFK A;  2GX9 A;  4GV9 A;  4CZE A;  1HQU A;  3E9L A;  4H5V A;  5C25 A;  4CJ7 A;  3LM2 A;  4C1N I;  4CJ4 A;  1LAW A;  2HBM A;  1S6Q A;  3CJC A;  3KLG A;  3RSE B;  3QFU A;  1KXP A;  4DQP A;  4H03 B;  5CYQ A;  1QE1 A;  2YCH A;  3ZEU A;  3MXI A;  4MDB A;  2B5J A;  4CES A;  2OTL N;  2NRW A;  3CET A;  4BRI A;  1TKX A;  1TV6 A;  2YJF A;  3NH1 A;  2DTU A;  1QHA A;  4F8R A;  1W7A A;  2NZT A;  4OGC A;  2HBJ A;  2I5J A;  5M1F A;  5AQX A;  4WQ4 A;  1TKT A;  5AFU A;  2B6A A;  4DV2 K;  2GUI A;  4LF9 K;  4F4K A;  2YHY A;  2YKN A;  4WFB L;  5A2Q O;  2VG6 A;  1C1B A;  3L2W A;  4DF8 A;  3CJ9 A;  2QKB A;  4CCH A;  4B9Q A;  3U3Y A;  3S3O A;  3V1O A;  3VN5 A;  3WT0 A;  4FPA A;  4B1V A;  3CIP A;  3ZSV A;  3AO4 A;  2VCP A;  3QIP A;  3C6U A;  3HRG A;  4BQL A;  5AQT A;  1EXQ A;  2QXF A;  5C15 A;  4ZTJ A;  4JLH A;  3R8E A;  4OJR A;  1LV5 A;  4AHC A;  4JI3 K;  1TK8 A;  2NRZ A;  1IKW A;  1R59 O;  2NRR A;  2JWK A;  2Z1G A;  3CJA A;  3RSE A;  4OKE A;  2E8A A;  3T69 A;  3CJ7 A;  4DU1 A;  2QWL A;  1NK6 A;  1OVY A;  2NRX A;  3ALY A;  4B9T A;  1GOA A;  3A2F A;  3CJB A;  1R0A A;  1ATR A;  3P83 D;  4I2Q A;  4JN4 A;  5SWM A;  3TPQ A;  4OPA A;  4LFC K;  3O3H A;  4LF5 K;  3LDP A;  4IOC L;  1HQE A;  4CJL A;  3AAP A;  4ILH A;  1S1T A;  3ZLJ A;  1Q9Y A;  3KVG A;  2KQ2 A;  2YHA A;  1IO2 A;  3D2E A;  2OPR A;  3L4I A;  3NE6 A;  3I33 A;  1NOY A;  4PHT X;  4J2E A;  5HRP A;  4KHP K;  5KPT A;  3BZK A;  3NF7 A;  5CZ2 A;  4LFA K;  2GUP A;  4CED A;  2A1R A;  1VQ6 N;  2UXB K;  1NJX A;  3R6M A;  3OYF A;  3HJF A;  3D45 A;  4BR0 A;  3SNN A;  1VSL A;  3AVC A;  3QER A;  1XNR K;  3CPE A;  4B3M K;  1D9F A;  3BZC A;  3F73 A;  3G0Z A;  4GKJ K;  3LPU A;  2GV9 A;  3OW2 M;  4CF1 A;  4CEC A;  3CCV N;  4OLA A;  4ELT A;  3ENO A;  4FJG A;  4BR9 A;  4YDU A;  3J81 O;  4FZY A;  5DK5 A;  4NYN A;  2DPN A;  3NGI A;  3CCJ N;  2ZM6 K;  4A5B A;  1VRT A;  3TAE A;  4DS4 A;  1B92 A;  3AAR A;  1ASW A;  2BH1 A;  3R3L A;  3A8Y A;  4FOI A;  4FPB A;  3CD6 N;  3P39 A;  3MEE A;  1EQY A;  4M3U A;  3U4L A;  2YKM A;  4O44 A;  3H1Q A;  4IO9 L;  1XC9 A;  3WQT A;  4HCC A;  2VWJ A;  1S5J A;  3DLE A;  4CZL A;  3KTQ A;  3NF8 A;  4BDZ A;  3PLA A;  1ASV A;  4UQG A;  4CVN E;  4BRL A;  3NGY A;  1HJR A;  4CGI A;  3J7Z O;  4CJF A;  1RTH A;  1RDB A;  3JAM O;  2FXU A;  3KD5 E;  3E9O A;  5AZJ A;  1WLJ A;  2PAV A;  4KH5 A;  3ULD A;  4BWM A;  2HHX A;  2HF3 A;  4F9O A;  3DYA A;  1MA9 B;  4CJK A;  4CE9 A;  3BF1 A;  3VGK A;  4IOX A;  4WQ4 C;  1IG8 A;  3QO9 A;  1BU6 O;  2G8H A;  3D6R A;  3OYE A;  3BP8 A;  3V9W A;  3PO4 A;  3ATV A;  3MED A;  2FF3 B;  5J2P A;  3KKS A;  4CZG A;  3V9S A;  3ENB A;  3SZ2 A;  3H1V X;  4N47 A;  3WNE A;  3DXM A;  4O5F A;  2DY4 A;  3KK2 A;  3EO3 A;  1NGB A;  1NGI A;  4DHY A;  1K9M O;  5C10 A;  3FGU A;  2HHU A;  1E4F T;  3M8Q A;  3VMF B;  3ZX3 A;  2Q36 A;  3V6D A;  1NK7 A;  2VQF K;  5AQK A;  4E1J A;  4O5B A;  1JLA A;  3L3U A;  5EVZ A;  3VTI A;  2O8C A;  2W6L A;  4Y0W A;  2NNW A;  5C2D A;  3KZB A;  3ZEU B;  3ZSO A;  3F9K A;  1I94 K;  1YT3 A;  3S3N A;  4B9M A;  1YVN A;  3H3O B;  3ISN C;  3ZSR A;  1OKJ A;  4DR3 K;  1BCO A;  4M3T A;  2PBD A;  3AA2 A;  4PKH A;  1NKE A;  3M8S A;  5C0Y A;  2D4W A;  3M3Z A;  3NH0 A;  4BC5 A;  1VAZ A;  4DG1 A;  3J80 O;  4FK4 A;  2Y1J A;  3K5O A;  1RT4 A;  2B4J A;  1YTA A;  3EZW A;  4AIL C;  1A5V A;  4FJ7 A;  3C6T A;  3V1Q A;  3CPW M;  4HHT A;  4LF8 K;  1SAZ A;  4DTX A;  1U2V B;  4H8K A;  1NGC A;  1JL1 A;  4CHP A;  3AGK A;  4HUF A;  1WAF A;  2A41 A;  3PY8 A;  3N4P A;  3MEG A;  1BA1 A;  1KAZ A;  3I8D A;  2IC3 A;  4WCE L;  1JLE A;  1U4B A;  1YF5 L;  1RDU A;  4A57 A;  3JXU A;  1WNS A;  4DB3 A;  4B1X B;  4RW8 A;  2XHB A;  4GV3 A;  1JXB A;  4XIU A;  5K14 A;  2I7N A;  3OTO K;  3MN7 A;  4DV7 K;  2RPI A;  1BUP A;  1VRU A;  5D3G A;  1NM1 A;  3AVG A;  2VG5 A;  3LWL A;  4Z4E A;  1KSP A;  1QVG M;  3P4I A;  3VEN A;  4FVU A;  5HRS A;  4RW6 A;  4XH5 A;  4MO5 A;  3C0B A;  3SQ1 A;  5JMV A;  3PIO L;  1JLQ A;  2DFF A;  4CF0 A;  5AQP A;  1N33 K;  3NCI A;  1RT1 A;  4Q0B A;  4IOA L;  2VYP A;  1MWK A;  4DMN A;  1NGJ A;  3K59 A;  4BR5 A;  4JV5 K;  1CZA N;  4JI4 K;  4GVM A;  2W41 A;  1BA0 A;  3UKU B;  3TAP A;  2OTJ N;  1ATN A;  1WUA A;  1ZC6 A;  4FK2 A;  1RDA A;  1CZ9 A;  3OYM A;  1RDC A;  4FLT A;  3T3F A;  3VQB A;  3THY A;  5AQS A;  3GE1 A;  5FRN A;  4JD2 B;  2G8F A;  2ITM A;  5M1N A;  1VQ4 N;  2UUB K;  3NF9 A;  4LFB K;  4RG8 A;  3E9P A;  4A2B A;  4B9U A;  3RRH A;  4AHU A;  3CER A;  3ULE A;  1NJW A;  3THX A;  5TKY A;  4CD1 A;  1C1C A;  5KGX A;  5ADX A;  2IVO A;  3NH2 A;  4NLC A;  3IS9 A;  1SV5 A;  4K0K K;  1J5O A;  4CJQ A;  5FRO A;  1NBW A;  4IJA A;  1WN7 A;  1XMO K;  5KGW A;  2Z1J A;  4BVP A;  4M63 C;  4FLV A;  1QHT A;  4X66 K;  2KZM A;  1LWC A;  3K5M A;  3THW A;  3QES A;  3CMA N;  1I39 A;  1RT3 A;  4CER A;  4BY9 C;  3HI0 A;  1HYZ A;  2Q97 A;  4KHW A;  2G8K A;  1T8E A;  5GAE P;  3T7Z A;  4B9L A;  3OYK A;  1BOT O;  4PUO A;  2RKI A;  3TAN A;  2OZS A;  3MN9 A;  3HXM A;  4ELU A;  1GOC A;  3WEE B;  4YOU A;  3AVA A;  4JRP A;  4DV3 K;  3AO2 A;  1VSI A;  1RCH A;  1ZBS A;  3HT3 A;  3KLI A;  3DLK A;  4LSN A;  1BDG A;  4PL8 A;  5F2R A;  4IJN A;  3M5R A;  4IO8 A;  4DQS A;  1GLJ O;  1SKR A;  5I9E B;  3RRG A;  4Z0U A;  3HL8 A;  1NJZ A;  1WSJ A;  1K6Y A;  4FJX A;  4K43 A;  1CXU A;  3SI6 A;  4LF7 K;  3HBT A;  4FSV A;  3O9Q A;  4JKA A;  1KFS A;  2QWQ A;  4JHD A;  4K8X A;  3SMS A;  1JLG A;  1ILY A;  4OPH A;  3FZM A;  5GIP A;  4LF6 K;  4IWV A;  2YHX A;  4RW4 A;  1V4T A;  1G99 A;  2H3G X;  4BDP A;  3WNG A;  3M6G A;  2BDP A;  3LDQ A;  1SQK A;  2UU9 K;  2F9T A;  4H5N A;  5M1P A;  1K8A O;  4CEQ A;  4DKW A;  1VSD A;  4H0T B;  1LWE A;  3RMA A;  4KTW A;  3AVN A;  2KFZ A;  4DSJ A;  1GLC G;  3VQE A;  4JKE A;  3THW B;  3J7A P;  2WBN A;  3LM9 A;  4M7X A;  5GAG P;  5LY3 A;  1FKO A;  3DLG A;  2E4L A;  5M1K A;  3K2P A;  3E1Y A;  1FJG K;  3CCL N;  1S9E A;  4DLE A;  3QBW A;  3A5L C;  3KJV A;  4JEP A;  3RWU A;  3ULE B;  1JLC A;  1EX4 A;  2VG7 A;  1NWK A;  4E7L A;  5MLC Q;  4PY5 A;  1OH5 A;  5BPM A;  1BO5 O;  4J2A A;  2Q2R A;  2ZE2 A;  4JI6 K;  3NDK A;  4FJ5 A;  1HUX A;  4FWP A;  3DXK A;  3SPY A;  1VSF A;  2G8W A;  4CJU A;  1EET A;  1ZBU A;  3FFI A;  3W3D A;  4KH4 A;  5JS2 A;  5LJW A;  2P9I A;  4Y1D A;  4FJH A;  4JI1 K;  3JS6 A;  1K8K A;  4CZK A;  3KLE A;  4DR4 K;  3ZT1 A;  3HOS A;  2EWS A;  1Z6R A;  4E19 A;  3RVC A;  4RW7 A;  4CGH A;  4CZH A;  2OPQ A;  1E4G T;  3FFK B;  3OS1 A;  1T03 A;  3MXJ A;  4DFJ A;  1EWR A;  1NMN A;  1L3U A;  1S1W A;  1WBD A;  3LP0 A;  3VOV A;  1U04 A;  3KK3 A;  1HJO A;  1RDW X;  2ZWH A;  4QAG A;  4CJE A;  3L2Q A;  3EKS A;  1K73 O;  4CJ5 A;  1D5A A;  5CE3 A;  1VQO N;  4FJM A;  3J7Y P;  1VSM A;  3TAG A;  4C23 A;  3U6F A;  4H5W A;  5HRO A;  3NGZ A;  2HOE A;  1IBM K;  4BGB A;  3LL3 A;  4C8N A;  3ZYY X;  1JCG A;  4HUE A;  1XHX A;  3SUN A;  3HP9 A;  4W5Q A;  3ZT2 A;  5EXW A;  4PQU A;  1RFQ A;  4CHZ A;  3B6O A;  3M8R A;  5E26 A;  2QXL A;  4I9L A;  2FLO A;  2HHV A;  2D0C A;  3CCU N;  3K5L A;  4C8L A;  4G9Z A;  5JLF A;  4M42 A;  3SV4 A;  3O3G A;  4H0X B;  1U2V A;  4GVE A;  4IFE A;  3U9D A;  1TKZ A;  3GOI A;  4IG3 A;  1KAX A;  2GWJ A;  2Z1H A;  4JK9 A;  4JHD B;  5KPZ A;  3PV8 A;  3CC4 N;  4AF1 A;  3OBY A;  4CW7 B;  4IDH A;  5AJ3 K;  1KD1 O;  2IDO A;  4CIG A;  3N4Q A;  5AFU H;  3ID6 A;  2EX3 A;  2O8B A;  1BL3 A;  5JVH L;  4CBU A;  2QWR A;  3CFP A;  4NLB A;  3QB0 A;  5EU7 A;  2P9K B;  4BRK A;  4CFC A;  2WC9 A;  1QQO A;  2JLE A;  1NK0 A;  4CI6 A;  4DR7 K;  3LDL A;  3OVN A;  4H4O A;  1BI4 A;  3L2U A;  3CJ1 A;  1X9M A;  3IKM A;  4BRO A;  3CFR A;  5KTQ A;  1VSH A;  1S6P A;  4DV1 K;  3UKR A;  5BN9 A;  3DAW A;  3DRR A;  2P9S B;  1Z05 A;  4BRM A;  3IFR A;  1RNH A;  2E2P A;  5FRM A;  1D9D A;  5KQD A;  4DTU A;  3KLF A;  4CBW A;  3QEV A;  3NVM A;  1NK9 A;  3QNN A;  5JS1 A;  5FPM A;  2HST A;  1B9D A;  1HRH A;  2G8U A;  2BE2 A;  4ILG B;  3SAG A;  3AVF A;  1KAY A;  4RW9 A;  4JKB A;  2HW3 A;  1DEJ A;  2FBT A;  1LAV A;  4CGJ A;  3GBT A;  4KRE A;  3WUH A;  3V9X A;  2YJE A;  4M3W A;  4FJI A;  3RR7 A;  3WXL A;  1VQ7 N;  3ZSX A;  3DLR A;  2AA4 A;  3GDQ A;  4M41 A;  4Z4C A;  4GV6 A;  4DV6 K;  3CG7 A;  4BRD A;  3P1G A;  4B9S A;  3O5B A;  1RBT A;  3THY B;  2CH6 A;  4DFP A;  4MFB A;  1CZB A;  4M3R A;  5BRD A;  3OYC A;  1GLB G;  2I7P A;  3C6H A;  1QVF M;  2E20 A;  2KTQ A;  4KRF A;  3CQ8 A;  5AZI A;  1HNX K;  1HKC A;  3KHY A;  3TAR A;  4FJK A;  2P9I B;  3AA4 A;  1LCU A;  1W9H A;  4Z4I A;  5JVG L;  1J6Z A;  4DTO A;  2OPP A;  3JSM A;  1WSH A;  3AVH A;  3DXK B;  1N6Q A;  5CR4 A;  1NLV A;  4A62 A;  1X3N A;  4BE2 A;  2XY5 A;  3PX6 A;  4KV8 A;  5AQM A;  4CFB A;  4ELV A;  4CK2 A;  3HPG A;  4FWN A;  3T1Y K;  1RTI A;  1S1X A;  3LDO A;  1QS4 A;  3PO5 A;  1QQN A;  1XC3 A;  1HLU A;  4CJW A;  3VEV A;  3ZSZ A;  3CC2 N;  4W5R A;  4B1Y B;  5FLX O;  1ASU A;  4PKG A;  2OCE A;  4JK8 A;  3SAF A;  2ZD1 A;  3BY5 A;  3FZK A;  3O1W A;  1IKY A;  4DTS A;  3NVK A;  3A0I X;  3SJH A;  3WNH A;  4NO7 A;  3QET A;  4AHT A;  3D2E B;  1X9J A;  5KPR A;  3VQP A;  4BR2 A;  4ID1 A;  3KWI A;  2O8E A;  1XHZ A;  3F2K A;  3E01 A;  3F5T A;  4A2A A;  5F0X A;  4AHR A;  4H0Y B;  4RTF D;  1YVU A;  4KO0 A;  1OH8 A;  1UA1 A;  3VTH A;  1IJJ A;  2QWM A;  1IBK K;  5KRS A;  1KVB A;  1KCF A;  3AAQ A;  3PUF A;  1IBL K;  3L3V A;  2PZS A;  4OKJ A;  4B8A B;  2QWO A;  4E3S A;  1ZXO A;  3HM8 A;  4C1N K;  3K5N A;  4KPY A;  1RT7 A;  4NCB A;  1NK5 A;  1P8Z A;  5CHI A;  1X1P A;  3U8X A;  1N8R O;  5C2F A;  5GAD P;  2VQE K;  1QQM A;  4N5S A;  1GLA G;  3EE8 A;  4BAC A;  3VES A;  2O8C B;  3Q7C A;  2BGG A;  4FWQ A;  4FWR A;  5CZ1 A;  2O8B B;  2WFB A;  1EO1 A;  5HOO A;  1KRP A;  1Q9X A;  4QS7 A;  4QS9 A;  1WOQ A;  2IAJ A;  1LWF A;  4CFD A;  4GKK K;  5DM7 L;  1RTJ A;  5E41 A;  3O08 A;  3R1X A;  3HTV A;  1T6C A;  4YFU A;  4DR5 K;  4GY2 B;  4BWJ A;  5HBM A;  3LZI A;  4I6M B;  4K42 A;  5AR0 A;  3O4W A;  2QA4 N;  1WBB A;  2ZF5 O;  3LAN A;  3KK7 A;  4BRE A;  1UA0 A;  5HLF A;  3M8P A;  3H08 A;  3ZET B;  1Q86 O;  3VQ7 A;  4FWL A;  3VQA A;  5BPL A;  4O8K A;  1YAG A;  4M3Y A;  3CME N;  1TL3 A;  2F9W A;  3U9Z A;  2F4V K;  1NKB A;  1YJW N;  4YHH K;  1X9W A;  4Z4H A;  1JXE A;  3V1R A;  1JL2 A;  3Q7B A;  2Q31 A;  1BQN A;  3EKU A;  4CF2 A;  2KLA A;  4BG9 A;  5BRE A;  1S22 A;  3AGR A;  3ZT0 A;  1Q8I A;  4FVM A;  1RBR A;  3OY9 A;  1BWF O;  4QS8 A;  4OGE A;  3R9P A;  4H0P A;  1C0M A;  3MMV A;  3RMB A;  1SKS A;  3TTC A;  1MWM A;  3HM9 A;  4OO1 J;  4G1Q A;  1QSL A;  1C0F A;  4B3R K;  3K0S A;  1JKH A;  3O80 A;  1K8K B;  4PA1 A;  4N56 A;  4FJ8 A;  3MX5 A;  4DQQ A;  1KLN A;  3QML A;  2O8F B;  1L3T A;  3QEI A;  4EAH D;  1L3S A;  3CCS N;  1SZ2 A;  1NMD A;  2A1S A;  2P9N A;  5AQN A;  4V19 S;  4CZM A;  1JCE A;  4YDU C;  5KRT A;  1UAX A;  4PL7 A;  1Y64 A;  5C42 A;  2P9L A;  3M1F A;  2E6M A;  3H6E A;  3EE9 A;  4U7B A;  3CCQ N;  2OZM A;  4RWT A;  4DR1 K;  3DMJ A;  1IH7 A;  1VQ5 N;  1S1U A;  3I0S A;  4NXM K;  1W2B M;  1W97 L;  3SUO A;  2KZZ A;  3QLH A;  3OYJ A;  4JI7 K;  3O6W A;  2XO7 A;  3K57 A;  3D0P A;  3DOK A;  1C0U A;  4EHT A;  4U67 L;  1NGH A;  4YOY A;  2RE2 A;  4DTN A;  4OLB A;  2F96 A;  3DI6 A;  3TSU A;  2F8S A;  5IT9 O;  1EP4 A;  3ZT3 A;  3VQQ A;  4CIE A;  4LF4 K;  5BR9 A;  4FL9 A;  5AQJ A;  2WUS A;  4NCG A;  2P5O A;  4PKI A;  4FWM A;  4JRQ A;  4CK3 A;  4FLX A;  1DTT A;  4DU4 A;  4KKO A;  1TUU A;  4JI2 K;  2AP1 A;  4FLZ A;  4JI0 K;  4Y1C A;  3OJU A;  4O0I A;  3RMD A;  3HOT A;  3KKR A;  1SL2 A;  3HP6 A;  4DFM A;  1YJN N;  2P5G A;  5I3U A;  2QM1 A;  3KWG A;  1VQK N;  2P9P B;  2E88 A;  1RBV A;  4CK1 A;  2UUA K;  3D2F A;  3CF5 L;  1KVA A;  3SLC A;  2RF2 A;  1GLF O;  3CM5 A;  2YNF A;  3LWM A;  2F8T A;  4DV0 K;  3QBX A;  3ENH A;  2F7T A;  3F9M A;  5GAH P;  1ZBH A;  4DUY K;  3VQ4 A;  3I8B A;  1Q7Y O;  2NUB A;  3HST B;  2D1K A;  2BAN A;  5AQY A;  1BHL A;  4BC4 A;  4FLY A;  1OH7 A;  5J2M A;  4GNI A;  4J2D A;  1VQL N;  4N41 A;  2X6S A;  4E89 A;  2NRV A;  2OPS A;  3ATU A;  4KBO A;  3WXM B;  4B8C A;  1BIS A;  2D0B A;  3L2V A;  2GTD A;  1X3M A;  1XQS C;  3BGR A;  4L8R B;  1YHQ N;  4E7K A;  2BTF A;  3DRS A;  4XH1 A;  3VER A;  2X74 A;  2HVH A;  2WON A;  2UXD K;  5I42 A;  3MN5 A;  2FSK A;  4DTR A;  4YNQ A;  1VSJ A;  3GL1 A;  2V7Z A;  1U6Z A;  2V7Y A;  2V52 B;  3HZ6 A;  5FPE A;  1TAQ A;  1ZBF A;  1TKD A;  2O4I A;  3MEC A;  2P9N B;  4BR4 A;  2YNI A;  4Z4F A;  4FWS A;  3D2F B;  3OYD A;  3CC7 N;  3QNO A;  5AQU A;  1O13 A;  3U3G A;  4EZ6 A;  4KTQ A;  1YIT N;  1JLB A;  2CGL A;  3TAB A;  3EYZ A;  3K9K A;  4KHS A;  3IAY A;  1U47 A;  2XRI A;  2QEX N;  2FSN A;  5J2Q A;  4ZHR A;  1HKB A;  3VQ6 A;  5AQR A;  2QKK A;  4K25 A;  2ASM A;  4H5R A;  1HPZ A;  2V51 B;  1NJI O;  4JI8 K;  3ZSY A;  4CGF A;  5BN8 A;  4WQ5 C;  2OA8 A;  1IKX A;  4X62 K;  1X9S A;  4AHV A;  3ID8 A;  2ATQ A;  2HMP A;  1VSE A;  1TK5 A;  4HTL A;  3UKU A;  2QW9 A;  3VA0 A;  5HP1 A;  3O9S A;  4EIA A;  4FJL A;  4OKK A;  5AQF A;  3VQC A;  1ITG A;  1KFD A;  4B1W B;  1HX1 A;  1XNQ K;  1T3V A;  4BVO A;  1KTQ A;  1HMV A;  2ZJQ L;  5FPD A;  5EOY A;  2IIR A;  2QWN A;  4J8F A;  1NG9 A;  3AO1 A;  3ZET A;  5J2N A;  3O9R A;  1L3V A;  3CCE N;  4RCH A;  4JKD A;  1SKW A;  4K8Z A;  2IVP A;  3NFA A;  3TI0 A;  3WQU A;  4JS4 A;  4ISF A;  2D0A A;  5HL7 L;  4B08 A;  2D0O A;  2KHO A;  5AQH A;  4DSI A;  4CZF A;  3CI5 A;  4PWD A;  4I7F A;  5KQ8 A;  3VEW A;  4FLW A;  2A40 A;  4QCL A;  1YUW A;  1SS6 A;  4JKG B;  4BRF A;  4M3Z A;  1NGA A;  3AA3 A;  4LD0 A;  2G8I A;  3LPT A;  2CGJ A;  1DLO A;  3WXK A;  1Z25 A;  3TWH A;  4JKF A;  3L0Q A;  1CXQ A;  4YOW A;  4DTJ A;  1TGO A;  3UIQ A;  3OS2 A;  5HRN A;  3LAM A;  3LAL A;  3VQ5 A;  1RTD A;  4BC2 A;  2QTD A;  2CGK A;  3AO3 A;  4HUG A;  1F21 A;  2RN2 A;  3C7N A;  2PYJ A;  3VGM A;  4DV4 K;  3DWL A;  5LL6 Z;  3J8A A;  3IG1 A;  2Z1I A;  4H5T A;  4HVJ A;  4DSK A;  4CEZ A;  3FZF A;  5HRR A;  2FBX A;  4BRA A;  3L2R A;  1KC8 O;  4CHQ A;  1QZ6 A;  4CJT A;  3SJJ A;  4OX9 K;  1A5X A;  3AVB A;  5AQO A;  1U48 A;  3C65 A;  3K9J A;  2Q0U A;  4YY3 K;  1QSS A;  1NK8 A;  4FOE A;  3VPZ A;  3QFP A;  3O4Q A;  4NCA A;  3NMU A;  3TTD A;  4EHU A;  4M7Y A;  4DF4 A;  2E2N A;  1DGK N;  3T1A A;  2ZGY A;  3WNF A;  3VEX A;  2OAN A;  4EFH A;  3TSQ A;  3OYG A;  3VQ9 A;  1J53 A;  5FDL A;  4R5P A;  4BDY A;  4E0D A;  4KHN A;  1LW2 A;  4ICL A;  2P9L B;  3SYZ A;  1Q82 O;  1HNZ K;  3VQD A;  4AH9 A;  4CJR A;  2HHW A;  3DM2 A;  3OYL A;  4KHY A;  4FW1 A;  4IFY A;  3NAE A;  4LC9 B;  1NGG A;  5AZJ B;  1NKC A;  1VK0 A;  2HB5 A;  2D0P A;  5BR8 K;  3SBT A;  1NJY A;  2A6A A;  5CY4 A;  2QK9 A;  4ZTF A;  2E2O A;  2X78 A;  3H3N O;  1RT2 A;  4FJN A;  4HTU A;  3VA3 A;  4HWI A;  1TAU A;  2EHG A;  4ISG A;  3IUC A;  1CLQ A;  2FBY A;  1Y97 A;  3A5O C;  2PFU A;  3B6P A;  5J1E A;  4BRH A;  4WFA L;  4FCY A;  3VEO A;  2UXC K;  2A5X A;  2HF4 A;  3AVK A;  3KIO A;  4CGG A;  3QEP A;  3V9Z A;  4M45 A;  1QTM A;  3BEX A;  5H1S Q;  4E7I A;  4BR7 A;  4DU3 A;  4UY8 O;  4MO4 A;  2P1J A;  3S9H A;  2E1Z A;  4BRN A;  4E7H A;  3EY1 A;  3I0R A;  4NB4 A;  3VGL A;  1VQ9 N;  4CEO A;  4LY7 A;  1VSK A;  3OBW A;  1C0T A;  2HHH K;  4B9N A;  3PSI A;  2KW4 A;  5C24 A;  3SCX A;  2FF6 A;  4O0J A;  2JGU A;  3SMP A;  4BE0 A;  4I9Q A;  3RTV A;  1O1W A;  4JKH A;  1YXQ A;  1V4S A;  4YOX A;  4I6M A;  4NYF A;  4KFB A;  4B3S K;  3SUP A;  5DMR A;  3SV3 A;  3CHW A;  3VEZ A;  5JIC A;  3ZT4 A;  2WOM A;  4BE1 A;  3NF6 A;  3OYA A;  1D4X A;  4XH4 A;  1XI1 A;  4Q5V A;  3SBG A;  4FYD A;  3ZSQ A;  3OYB A;  2YX6 A;  1T44 A;  1FKP A;  3G4S N;  3MXM A;  3LAK A;  5C12 A;  3PX0 A;  1E3M A;  4FM1 A;  4DQ8 A;  3V9U A;  1WSG A;  3TTF A;  3O3F A;  2O8F A;  4FWK A;  4EZ9 A;  4O4G A;  4KAZ A;  4KB1 A;  3L6Q A;  3H45 C;  3LP1 A;  4O55 A;  3I56 N;  3HYF A;  1UWB A;  2BUP A;  3HVR A;  1S9G A;  4IEE A;  4HCB A;  2P9U B;  1KQS M;  4MLH A; 
#chains in the Genus database with same CATH homology
 1RBS A;  3NBP A;  4FJ9 A;  1BGX T;  3OYH A;  4LSN A;  1JKH A;  4CF8 A;  4B3O A;  3G10 A;  3HVT A;  4PA1 A;  4OPJ A;  3AVL A;  1WSF A;  4N56 A;  4DQS A;  4FJ8 A;  1SKR A;  3RRG A;  4DQQ A;  1KLN A;  4CFA A;  3AO5 A;  4Z0U A;  1L3T A;  3HO1 A;  3HL8 A;  3CYM A;  3QEI A;  3OS0 A;  2ETJ A;  1NJZ A;  1WSJ A;  3DLH A;  1K6Y A;  3BDP A;  1L3S A;  4F3O A;  4CGD A;  4FJX A;  4MQ3 A;  3OJS A;  1CXU A;  2A1S A;  3SI6 A;  1IG9 A;  4CEA A;  1KVC A;  5KRT A;  1UAX A;  4C8M A;  1KFS A;  4FXD A;  5C42 A;  1W0H A;  4K8X A;  2E6M A;  4FLU A;  2GBZ A;  2OZM A;  1QQC A;  2IS3 A;  4E7J A;  1JLG A;  4DFK A;  3AVM A;  1T05 A;  3RMC A;  3DMJ A;  1IH7 A;  1S1U A;  3I0S A;  4RW4 A;  3HPH A;  1HQU A;  4BDP A;  3WNG A;  2BDP A;  3SQ2 A;  3SUO A;  2KZZ A;  3QLH A;  3OYJ A;  5C25 A;  3AV9 A;  4B9V A;  2XO7 A;  3K57 A;  4CEQ A;  4CJ4 A;  1LAW A;  1VSD A;  3DOK A;  1C0U A;  3D0P A;  3IRX A;  1S6Q A;  4E1M A;  4IKF A;  1LWE A;  3RMA A;  3CM6 A;  1LW0 A;  3KLG A;  4KTW A;  4DTN A;  3AVN A;  4FJJ A;  2OYQ A;  4E0D A;  4DSJ A;  4OLB A;  2KFZ A;  2F96 A;  4CEF A;  3DI6 A;  4DQP A;  2HHS A;  3VQE A;  5CYQ A;  1QE1 A;  4CJV A;  4LH5 A;  3MXI A;  2F8S A;  4C8O A;  1EP4 A;  2B5J A;  4CES A;  3ZT3 A;  4DLG A;  3VQQ A;  1FKO A;  4IFV A;  4CIE A;  3DLG A;  1TKX A;  1TV6 A;  2E4L A;  3NH1 A;  4NCG A;  2P5O A;  4DS5 A;  2DTU A;  4F8R A;  4JRQ A;  4OGC A;  3AVI A;  4CK3 A;  3K2P A;  2I5J A;  4FLX A;  1DTT A;  3KD1 E;  1TKT A;  4DU4 A;  4KKO A;  2B6A A;  1S9E A;  4DLE A;  2GUI A;  3PX4 A;  4F4K A;  2YKN A;  3KJV A;  2VG6 A;  4FLZ A;  3QIO A;  4N76 A;  4Y1C A;  3OJU A;  1C1B A;  3L2W A;  3RWU A;  4DF8 A;  4O0I A;  3RMD A;  2QKB A;  4CCH A;  1JLC A;  3U3Y A;  1EX4 A;  2VG7 A;  3KKR A;  3S3O A;  3V1O A;  3VN5 A;  4E7L A;  3JYT A;  1SL2 A;  4PY5 A;  3HP6 A;  4DFM A;  4Z4G A;  2P5G A;  5I3U A;  4J2A A;  4DQI A;  4CIF A;  3ZSV A;  2ZE2 A;  1RBV A;  4CK1 A;  3NDK A;  3AO4 A;  4FJ5 A;  4IBN A;  4OPK A;  1SL1 A;  3QIP A;  3C6U A;  1KVA A;  2YNG A;  1SL0 A;  2RF2 A;  2XY7 A;  3SPY A;  1VSF A;  2G8W A;  3CM5 A;  1EXQ A;  2YNF A;  4CJU A;  3LWM A;  2F8T A;  1EET A;  1ZBU A;  3FFI A;  2QXF A;  1ZBH A;  5JS2 A;  4ZTJ A;  4JLH A;  3VQ4 A;  4OJR A;  3HST B;  2NUB A;  1BCM A;  4Y1D A;  1LV5 A;  4FJH A;  3SQ4 A;  4AHC A;  2BAN A;  1BHL A;  1BIU A;  3KLE A;  4FLY A;  3ZT1 A;  2XY8 A;  3SPZ A;  1TK8 A;  5J2M A;  1IKW A;  2DFH A;  3TAF A;  2PY5 A;  3L8B A;  2Z1G A;  4J2D A;  4OKE A;  4E19 A;  3NHG A;  4RW7 A;  4CGH A;  2OPQ A;  3O4N A;  4N41 A;  4FK0 A;  2X6S A;  4E89 A;  1FK9 A;  1EKE A;  4DU1 A;  2D5R A;  2OPS A;  1NK6 A;  4CEE A;  3SUQ A;  3OS1 A;  1T03 A;  3ALY A;  1D8Y A;  4B9T A;  4F2S A;  1RT5 A;  4B8C A;  1GOA A;  1BIS A;  3A2F A;  4KI6 A;  1R0A A;  3P83 D;  4I2Q A;  4CJS A;  5SWM A;  2D0B A;  3MXJ A;  3L2V A;  1MU2 A;  4L8R B;  3BGR A;  4DFJ A;  4E7K A;  3DRS A;  1L3U A;  1BI4 B;  1S1W A;  3O3H A;  3LP0 A;  2X74 A;  1HQE A;  4QOZ B;  3KK3 A;  1U04 A;  4CJL A;  4QAG A;  4CJE A;  2WON A;  3L2Q A;  2HVH A;  4M3X A;  4CHN A;  4CJ5 A;  5I42 A;  1S1T A;  1D5A A;  1TVR A;  1Q9Y A;  4FJM A;  4DTR A;  1VSM A;  3TAG A;  1REV A;  1VSJ A;  4YNQ A;  3U6F A;  4F2R A;  5HRO A;  3NGZ A;  1ZBI A;  3OYI A;  1TK0 A;  4C8N A;  3ASM A;  1TAQ A;  1ZBF A;  1TKD A;  2KQ2 A;  3MAQ A;  3CFO A;  3MEC A;  2YHA A;  4HUE A;  3SUN A;  1IO2 A;  1XHX A;  2O4I A;  3HP9 A;  2OPR A;  4W5O A;  2YNI A;  4Z4F A;  4W5Q A;  4WE1 A;  3ZT2 A;  4FM0 A;  4PQU A;  3NE6 A;  3DOL A;  3OYD A;  1NOY A;  2R7Y A;  4J2E A;  4DQR A;  3QNO A;  3U3G A;  3B6O A;  4CHZ A;  3M8R A;  4EZ6 A;  4KTQ A;  1JLB A;  1C1A A;  4I9L A;  2HHV A;  2D0C A;  3TAB A;  5HRP A;  3EYZ A;  4KHS A;  3IAY A;  3K5L A;  3C95 A;  4C8L A;  4M42 A;  1RDD A;  1G15 A;  1U47 A;  2XRI A;  3SV4 A;  3O3G A;  5J2Q A;  3NF7 A;  5CZ2 A;  4ZHR A;  3VQ6 A;  4CED A;  2A1R A;  2QKK A;  2HHQ A;  1TKZ A;  1NJX A;  4IG3 A;  1HPZ A;  2Z1H A;  3OYF A;  3PV8 A;  3HJF A;  3D45 A;  3ZSY A;  4CGF A;  3SNN A;  2OA8 A;  1VSL A;  2IDO A;  1IKX A;  3AVC A;  1RIL A;  4CIG A;  3QER A;  1X9S A;  4F3T A;  2LSN A;  4AHV A;  1D9F A;  3C94 A;  3F73 A;  3G0Z A;  2X6N A;  2ATQ A;  2EX3 A;  3LPU A;  1VSE A;  1BL3 A;  2GV9 A;  1TK5 A;  4CF1 A;  3CFP A;  4CEC A;  4OLA A;  1WSI A;  4KTZ A;  4ELT A;  5EU7 A;  4FJG A;  3VA0 A;  5HP1 A;  4CFC A;  4FZY A;  3P5J A;  4FJL A;  5DK5 A;  4NYN A;  2JLE A;  4OKK A;  3NGI A;  1NK0 A;  3VQC A;  1ITG A;  3RR8 A;  3TAE A;  4W5T A;  1KFD A;  1VRT A;  3OVN A;  1BI4 A;  4H4O A;  1J9A A;  3L2U A;  4KHU A;  4CHO A;  4DS4 A;  3OYN A;  1X9M A;  1KTQ A;  1B92 A;  1HMV A;  3CFR A;  2FBV A;  1ASW A;  3MEE A;  5KTQ A;  4M3U A;  1VSH A;  3AO1 A;  5J2N A;  1S6P A;  2YKM A;  4O44 A;  1UOC A;  4JS5 A;  1L3V A;  1XC9 A;  1SKW A;  3DRR A;  4LH4 A;  4CHY A;  4HCC A;  4K8Z A;  3NFA A;  3TI0 A;  1RNH A;  4JS4 A;  2VWJ A;  1BQM A;  1S5J A;  5FRM A;  3DLE A;  1D9D A;  4GMJ B;  2DFE A;  3KTQ A;  4DTU A;  2D0A A;  3NF8 A;  4BDZ A;  4B08 A;  1ASV A;  4UQG A;  3KLF A;  3QEV A;  3NGY A;  1HJR A;  1NK9 A;  4CGI A;  4DSE A;  3QNN A;  5JS1 A;  4CJF A;  1RTH A;  1RDB A;  3LP2 A;  1B9F A;  3KD5 E;  1B9D A;  4DSI A;  4AHS A;  1HRH A;  3SQ0 A;  2G8U A;  4DSL A;  2BE2 A;  4PWD A;  4I7F A;  3V81 A;  1WLJ A;  4W5N A;  3AVF A;  3ULD A;  4BWM A;  4FLW A;  4QCL A;  1WAJ A;  2IGI A;  4RW9 A;  2HHX A;  2HW3 A;  3DYA A;  2HND A;  3EZ5 A;  4M3Z A;  2FBT A;  3AA3 A;  4LD0 A;  4CJK A;  2G8I A;  3LPT A;  4CE9 A;  1DLO A;  1LAV A;  4CGJ A;  5CYM A;  4KRE A;  1Z25 A;  3QO9 A;  3TWH A;  2G8H A;  2IOC A;  1ZBL A;  3OYE A;  1NOZ A;  1FXX A;  3V9W A;  1CXQ A;  3MED A;  3V9X A;  3PO4 A;  4DTJ A;  3KKS A;  3V9S A;  5J2P A;  1TGO A;  3UIQ A;  1RBU A;  5SZT A;  3SZ2 A;  4N47 A;  3OS2 A;  4DWI A;  1HNV A;  3WNE A;  2PYL A;  2DY4 A;  3KK2 A;  5HRN A;  4FJI A;  4M3W A;  3LAM A;  3RR7 A;  1WSE A;  3LAL A;  3VQ5 A;  3ZSX A;  3M8Q A;  1RTD A;  2HHU A;  3DLR A;  4CEB A;  4M41 A;  4Z4C A;  3V6D A;  3AO3 A;  3CG7 A;  2VWK A;  4HUG A;  3HK2 A;  1F21 A;  4E1N A;  1NK7 A;  3P1G A;  2RN2 A;  4B9S A;  2PYJ A;  1RBT A;  3T19 A;  2FC0 A;  4O5B A;  3DRP A;  1T7P A;  3V4I A;  4C8K A;  4DFP A;  3IG1 A;  4MFB A;  1JLA A;  2Z1I A;  4HVJ A;  3L3U A;  1CZB A;  4M3R A;  4DSK A;  3OYC A;  4CEZ A;  4KI4 A;  2KTQ A;  5HRR A;  4KRF A;  2FBX A;  3CQ8 A;  3ZSO A;  4FZX C;  3L2R A;  3F9K A;  1IKV A;  3QEW A;  3TAR A;  1YT3 A;  3S3N A;  4B9M A;  1C6V A;  4FJK A;  4CHQ A;  2O4G A;  1DTQ A;  3AA4 A;  4CJ3 A;  4CJT A;  1W9H A;  3ISN C;  3SJJ A;  3ZSR A;  1JLF A;  3HPO A;  2OPP A;  3JSM A;  4DTO A;  4Z4I A;  1BCO A;  4M3T A;  1A5X A;  3AA2 A;  1J54 A;  1WSH A;  3AVB A;  4I2P A;  1U48 A;  3M8S A;  3TAM A;  1NKE A;  3NH0 A;  3AVH A;  3KLH A;  1N6Q A;  4DG1 A;  1QSS A;  1NK8 A;  4FK4 A;  2Y1J A;  4GW6 A;  3K5O A;  1RT4 A;  2B4J A;  3O4Q A;  1YTA A;  4IDK A;  4BE2 A;  4KV8 A;  4AIL C;  2XY5 A;  3PX6 A;  4NCA A;  2HHT A;  4CFB A;  4DF4 A;  4TSX A;  4ELV A;  1A5V A;  3S3M A;  4CK2 A;  1S1V A;  3HPG A;  1RTI A;  1S1X A;  4FJ7 A;  3PO5 A;  1QS4 A;  3C6T A;  3T1A A;  4J2B A;  3V1Q A;  4HHT A;  2Q3S A;  3WNF A;  3KK1 A;  4DTX A;  4H8K A;  4CJW A;  1NK4 A;  3ZSZ A;  3OYG A;  4W5R A;  3VQ9 A;  1J53 A;  5FDL A;  1ASU A;  1JL1 A;  4CHP A;  4R5P A;  1LW2 A;  4CJP A;  1WAF A;  4HUF A;  4ICL A;  4BDY A;  4KHN A;  2ZQB A;  3SYZ A;  3PY8 A;  2ZD1 A;  3VQD A;  1IKY A;  4DTS A;  4AH9 A;  3MEG A;  3WNH A;  3QET A;  4AHT A;  4CJR A;  2HHW A;  3DM2 A;  3I8D A;  3QEX A;  3OYL A;  2IC3 A;  4KHY A;  4FW1 A;  4IFY A;  3VQ8 A;  4FM2 A;  1U45 A;  1JLE A;  3VQP A;  3NAE A;  1SUQ A;  1U4B A;  4ID1 A;  2Y1I A;  1KLM A;  1NKC A;  1VK0 A;  1WNS A;  2HB5 A;  1QSY A;  1XHZ A;  4RW8 A;  2XHB A;  3E01 A;  1NJY A;  1JXB A;  1N5Y A;  3AVJ A;  5CY4 A;  4XIU A;  4ZTF A;  2QK9 A;  4AHR A;  2X78 A;  2ITG A;  1RT2 A;  5K14 A;  1YVU A;  4FJN A;  4ID5 A;  2RPI A;  4KO0 A;  4HTU A;  3VA3 A;  1UA1 A;  1TAU A;  1VRU A;  2EHG A;  3AVG A;  5D3G A;  2VG5 A;  4OVL A;  3LWL A;  2FBY A;  1KSP A;  1Y97 A;  4Z4E A;  1CLQ A;  4FZZ A;  3ZSW A;  5KRS A;  1KVB A;  3B6P A;  1KCF A;  4EP4 A;  5J1E A;  3PUF A;  4FCY A;  5HRS A;  3L3V A;  2PZS A;  4OKJ A;  4RW6 A;  4B8A B;  3AVK A;  4E3S A;  3KIO A;  4CGG A;  3QEP A;  4NCB A;  3K5N A;  4KPY A;  1RT7 A;  3V9Z A;  4M45 A;  1QTM A;  1NK5 A;  3LP3 A;  3SQ1 A;  2YV0 X;  2E6L A;  3LZJ A;  4E7I A;  1JLQ A;  2DFF A;  4CF0 A;  4DU3 A;  4DTM A;  1X1P A;  2P51 A;  3NCI A;  2HVI A;  1RT1 A;  4Q0B A;  2P1J A;  3K59 A;  4DMN A;  5KI6 A;  3S9H A;  4N5S A;  3ZCM A;  1HNI A;  4E7H A;  3EY1 A;  1BIZ A;  3K58 A;  4BAC A;  4GVM A;  3I0R A;  3TAP A;  5T7B A;  4FK2 A;  4CEO A;  1RDA A;  1CZ9 A;  4LY7 A;  3OYM A;  1GOB A;  1RDC A;  1VSK A;  2YNH A;  4FLT A;  2BGG A;  3T3F A;  5CZ1 A;  1C0T A;  4B9N A;  3VQB A;  1KRP A;  1Q9X A;  2KW4 A;  5C24 A;  1XWL A;  3SCX A;  5FRN A;  4O0J A;  2JGU A;  4BE0 A;  4I9Q A;  3RTV A;  2IAJ A;  1LWF A;  1O1W A;  2G8F A;  4CFD A;  2W42 A;  1RTJ A;  3NF9 A;  5E41 A;  4FW2 A;  4RG8 A;  4NYF A;  4YFU A;  4KFB A;  4B9U A;  3RRH A;  1HYV A;  4BWJ A;  3SUP A;  5DMR A;  5HBM A;  3LZI A;  4AHU A;  3SV3 A;  4KHQ A;  3THV A;  1NJW A;  1RT6 A;  3TAQ A;  3ZT4 A;  2WOM A;  3AA5 X;  4BE1 A;  1ZYQ A;  3NF6 A;  2AJQ A;  1C1C A;  3LAN A;  3OYA A;  5KGX A;  1XI1 A;  1UA0 A;  3NH2 A;  4Q5V A;  3LDS A;  4DTP A;  5HLF A;  3IS9 A;  3M8P A;  3H08 A;  2G8V A;  4FYD A;  3ZSQ A;  3OYB A;  1SV5 A;  3VQ7 A;  3VQA A;  1FKP A;  1HYS A;  1A5W A;  4CF9 A;  3MXM A;  1J5O A;  3LAK A;  3QIN A;  3DLB A;  4M3Y A;  4CJQ A;  5FRO A;  4FM1 A;  3V9U A;  3PX0 A;  1WN7 A;  4KB0 A;  1WSG A;  5KGW A;  2Z1J A;  1TL3 A;  3O3F A;  1L5U A;  4FLV A;  1QHT A;  4EZ9 A;  4O4G A;  4DSF A;  4KAZ A;  1NKB A;  4KB1 A;  2KZM A;  1LWC A;  2KFN A;  3K5M A;  1X9W A;  3QES A;  4Z4H A;  1JXE A;  1I39 A;  1RT3 A;  3ITH A;  3V1R A;  1JL2 A;  4LSL A;  4CER A;  2XY6 A;  2HNY A;  1BQN A;  4CF2 A;  1HYZ A;  1Z26 A;  4KHW A;  4IG0 A;  2G8K A;  1I3A A;  4EP5 A;  1U49 A;  1T8E A;  4B9L A;  3LP1 A;  1YTU A;  2YHB A;  3OYK A;  4H4M A;  4O55 A;  1Q8I A;  3TR8 A;  3ZT0 A;  4FVM A;  1RBR A;  3OY9 A;  2HNZ A;  2RKI A;  1UWB A;  3HYF A;  3HVR A;  3TAN A;  2OZS A;  4PUO A;  4OGE A;  1C0M A;  1S9G A;  3HXM A;  3RMB A;  1SKS A;  4ELU A;  4HCB A;  1GOC A;  3HM9 A;  3AVA A;  4JRP A;  4G1Q A;  1QSL A;  3AO2 A;  1VSI A;  1RCH A;  3HT3 A;  1TL1 A;  3KLI A;  2HMI A;  3DLK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...