2FBXA

Wrn exonuclease, mg complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
195
structure length
195
Chain Sequence
b'HSVFEDDLPFLEFTGSIVYSYDASDCSFLSEDISMSLSDGDVVGFDMEWPPLYNRGKLGKVALIQLCVSESKCYLFHVSSMSVFPQGLKMLLENKAVKKAGVGIEGDQWKLLRDFDIKLKNFVELTDVANKKLKCTETWSLNSLVKHLLGKQLLKDKSIRCSNWSKFPLTEDQKLYAATDAYAGFIIYRNLEILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Werner syndrome helicase
publication title WRN exonuclease structure and molecular mechanism imply an editing role in DNA end processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 63
structure length 195
sequence length 195
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2fbxA00
1D9FA 3PO4A 3O4QA 3IAYA 1GOBA 3L3UA 4EZ9A 4CK1A 4F4KA 4FJ5A 1IKWA 1XHZA 1T03A 4B9MA 4OKEA 3O3FA 1ITGA 1BCOA 1W0HA 1KCFA 3E01A 3P1GA 4OLBA 4FJXA 3KK2A 1JLFA 2F8TA 3V81A 3LDSA 1GOCA 4TSXA 4OKJA 1HNVA 4Y1DA 1ASVA 2HNZA 3IRXA 3EY1A 2X74A 4IDKA 1VSLA 4KFBA 4MFBA 4MQ3A 2JLEA 3WNFA 4CEDA 3HP9A 4CJ4A 4Z4HA 4DTJA 2XY6A 3QEPA 4OGCA 1SKSA 2OZSA 4KHNA 2YHBA 4OGEA 2Q3SA 3LAMA 4ZTFA 4CGHA 1X1PA 2G8WA 5HP1A 2VG5A 1S9EA 1TKZA 3KKRA 4ID5A 2A1RA 1ZBLA 1RDAA 4C8NA 1ZBUA 3K2PA 5EU7A 4W5NA 3TARA 2HHWA 3KLHA 1ZBHA 3NF7A 3TAPA 3OYIA 1CXQA 5I42A 4BDYA 1JLAA 4EP5A 4RW8A 3OYDA 3VQEA 3RMDA 1BL3A 4M3WA 4FLWA 1RT1A 1RTIA 5FRNA 2EX3A 3KD5E 1NKCA 4I2QA 3JYTA 3TAQA 1S1WA 1BQMA 4FCYA 1Q9XA 5D3GA 3V9SA 1VSJA 3CYMA 2X6SA 4OLAA 2ZQBA 4AHTA 4CEBA 1A5WA 3OS0A 2BDPA 4BE0A 1S5JA 3L2UA 3SUPA 1VSFA 4DWIA 3DI6A 4ICLA 1RCHA 1CZBA 2QXFA 3OYHA 1KVAA 1IKYA 1B9FA 3I0RA 3O3HA 4Q0BA 2P51A 4DQSA 2KFZA 4F2SA 4M3XA 3AVKA 3SPYA 4W5QA 1RBUA 3ZSRA 1HYSA 1NKEA 3PUFA 3OVNA 2ETJA 4CHOA 1BQNA 4W5RA 2PYJA 4BACA 4CGGA 4HTUA 2HHUA 1LAWA 3LP0A 4Z4FA 3KLIA 1KFSA 4HUEA 2VG7A 3SZ2A 3RRHA 4I7FA 5J2PA 1BCMA 3KK3A 3KIOA 5HRNA 4OPKA 4I2PA 4DTSA 3DMJA 4FJJA 4IBNA 1RDDA 1QQCA 1WNSA 2FBVA 3RMAA 2HVIA 2VWKA 1JKHA 4FLVA 1A5XA 4W5TA 2HHQA 1I3AA 3DLRA 1NJYA 2OPRA 4ID1A 3ISNC 1C1BA 3ZCMA 1L3VA 5C42A 5J2QA 3LPTA 4GMJB 4E3SA 2Z1JA 4B8AB 5HROA 4FJGA 3F73A 3AVGA 2HB5A 3F9KA 4DTMA 3ZSOA 3S3NA 4CFCA 4O55A 2KQ2A 4B9UA 2ZE2A 3AVFA 1L3SA 4DMNA 1SV5A 4CJSA 1KTQA 3DRPA 4CFBA 4K8ZA 3P83D 1TVRA 3D0PA 3OYCA 5JS1A 4AHSA 4HVJA 4CHPA 4UQGA 4F3OA 4KTQA 3L2WA 3QEVA 4IFYA 4CHYA 1LWFA 3V9UA 1VSMA 4Y1CA 4AHVA 4BDZA 4DSLA 2P5OA 4O44A 3OYMA 4DQIA 4F8RA 4DFMA 3ZSQA 4M3YA 4E7JA 4N41A 3NGZA 3NAEA 3KD1E 1LW2A 4XIUA 4PWDA 4DSFA 4CE9A 3C95A 4DTXA 1J53A 3T1AA 3HPOA 3K58A 1S9GA 1NOYA 4R5PA 1TL3A 3NH2A 3C6TA 1SKRA 4FK2A 1N5YA 3K59A 3OYGA 3H08A 2Z1GA 2B4JA 1TL1A 3DLGA 1QHTA 3KLEA 3TAGA 4YNQA 2RF2A 1JXEA 3B6OA 4G1QA 3RR7A 4BE2A 4RW4A 1IKXA 2DFHA 1RT6A 4NCGA 4DLGA 4N76A 5C24A 3QNNA 4KRFA 4ELVA 4FLXA 3SV4A 4O5BA 3T19A 3VQPA 1EX4A 3OYEA 2D5RA 1RT4A 2HNYA 3HJFA 4B08A 1S1UA 4EP4A 1J9AA 2FBYA 3ZSYA 1L5UA 3QETA 3DRSA 4I9QA 1D8YA 4CEZA 4QCLA 4FLYA 4M45A 4DF8A 1W9HA 3ULDA 3T3FA 1Z26A 3DYAA 1C0MA 2I5JA 3O3GA 3L2VA 3ZT4A 2VWJA 1L3TA 5C25A 3KLGA 4FZYA 1J5OA 3IG1A 1XI1A 3AVAA 3A2FA 3V1OA 3DOLA 1QE1A 4KHSA 4B9TA 3AVHA 3ZSWA 3NDKA 1JL1A 2XY8A 3AVIA 5KTQA 4KKOA 3NH1A 4CEFA 3U3YA 1NK6A 2G8VA 3WNHA 4CIFA 4PUOA 4FM2A 4OKKA 1HYZA 4NYFA 1U47A 2HHXA 3TANA 3NGYA 4DTOA 5CYMA 4CK3A 3VQ9A 4Z4CA 3AA5X 1FKPA 4Z0UA 2ZD1A 3ZSZA 4NCAA 1XC9A 4FJ8A 1RTHA 1U49A 1J54A 2KZMA 2FC0A 3SQ0A 4B9SA 4DSJA 3MXJA 4HUFA 4FVMA 1SL2A 5SZTA 4CF9A 1JLEA 4HUGA 1T8EA 3PO5A 4FJNA 3B6PA 4CJQA 3AVCA 2G8FA 3WNEA 1VSEA 2DFFA 4KI4A 2DY4A 1TKTA 1NK5A 3VQAA 1RDCA 2E4LA 3D45A 4M3RA 4E1MA 2Z1IA 3VQCA 4CF0A 4ZTJA 1NK4A 3QNOA 1WAJA 1WSEA 4CF8A 4DU1A 1BI4A 1S1XA 3KK1A 4CHNA 4J2BA 3HPGA 1KLNA 1KLMA 4LY7A 4DQQA 3V1RA 2XRIA 1FK9A 3MEGA 3NF8A 3VQDA 2FBXA 2P1JA 4LD0A 4AHUA 3HK2A 4ELUA 2BANA 4E7HA 2KZZA 2YHAA 3QEIA 4FW1A 1WSHA 3THVA 4IG3A 4CGJA 3ITHA 4DSEA 5KGWA 3CQ8A 2Y1IA 4WE1A 1RNHA 4CEQA 1B9DA 1TKXA 3KKSA 4N56A 4E7IA 4CFDA 3ZT2A 1ZYQA 1NKBA 2IOCA 2D0AA 2YV0X 1RDBA 4CFAA 3DOKA 1RT7A 4Z4IA 4DTUA 1HRHA 4KHWA 1YTUA 3HPHA 1RILA 4LH5A 4CF2A 3V9WA 1Q9YA 4DTRA 1RT5A 3LP3A 1U4BA 4M42A 3MECA 1RTJA 3SQ4A 2G8IA 1O1WA 4CIEA 4JRQA 4KHQA 3ALYA 1NJXA 4CHZA 1R0AA 1IO2A 3AO5A 3LZJA 4C8OA 1RBSA 3CFOA 1UWBA 2B5JA 2YNIA 3EZ5A 1T7PA 4CEAA 1BHLA 3HVTA 4NYNA 3KJVA 3G10A 1X9SA 3QO9A 1D5AA 1IH7A 1EP4A 3LWLA 4CJUA 1BI4B 3HL8A 5KRTA 1VSDA 1DTTA 3ZT0A 3ZSVA 3CFPA 1G15A 5J2NA 2HHVA 1XWLA 3CM6A 3SYZA 1X9MA 3BGRA 4B9VA 1VSKA 3NCIA 4GW6A 4E0DA 2HHSA 4DLEA 2A1SA 3QIPA 4OVLA 1CZ9A 2O4GA 1EKEA 2GUIA 4E19A 3QESA 3VQ4A 4FK4A 3SI6A 4DFPA 1HQEA 1REVA 3AO3A 4CEOA 3AVMA 4CGDA 4FJMA 4FM1A 2D0CA 2GBZA 2OA8A 4L8RB 3DLEA 1C1AA 4KHUA 4F3TA 3AO2A 1WLJA 1K6YA 1U48A 1UA0A 4FJLA 2ITGA 3PX0A 1S6QA 4F2RA 3G0ZA 1WSFA 1YTAA 3OYLA 3LWMA 3CM5A 1WSJA 1LW0A 3TAMA 1FKOA 4CJWA 3AO4A 3KLFA 5I3UA 2XY5A 4M3TA 3OYNA 2G8KA 3MXIA 1HMVA 3LANA 4DTNA 1TKDA 4KHYA 5FRMA 4CK2A 3QERA 4BE1A 1WSGA 5HBMA 4O4GA 4CECA 4DSIA 4GVMA 2QKBA 3MXMA 1U45A 4BWMA 3EYZA 1KSPA 4HCCA 2OPQA 3RMBA 1JLGA 5SWMA 4J2EA 1NOZA 3LALA 1HQUA 1S6PA 3SPZA 1C0UA 4CJ3A 3O4NA 1DTQA 1MU2A 1RT3A 2E6LA 1L3UA 4KB1A 2HW3A 3CG7A 2DFEA 3K5NA 2ATQA 3RMCA 4FZXC 4B9NA 3K5OA 3AO1A 1KVCA 2PY5A 3HO1A 4B8CA 1TK5A 2BGGA 4PY5A 4LSLA 3K5MA 4E1NA 3DRRA 4KTZA 1NK0A 1C6VA 4C8LA 2O4IA 3FFIA 1VRTA 1UA1A 1UAXA 1RBVA 1TV6A 4DU4A 1JLCA 4CJKA 4O0IA 5J2MA 3PX6A 2IAJA 5HRRA 2HMIA 1HPZA 5CZ1A 4KREA 4CGFA 4KI6A 5DMRA 3MEDA 3V9ZA 3V4IA 1JL2A 3LP2A 4JRPA 1S1TA 3TI0A 1RT2A 2PYLA 3SNNA 1SUQA 4BWJA 3V9XA 4LH4A 3LPUA 1QTMA 4CHQA 3BDPA 3TR8A 2HNDA 3TAFA 2WONA 4Z4EA 4W5OA 3TWHA 1SKWA 1NK7A 4KB0A 2DTUA 3HSTB 3NF6A 3AA3A 3P5JA 4M41A 2XO7A 3LZIA 2QK9A 1VSIA 2RKIA 3L2QA 1NK8A 1QSSA 2F96A 4C8KA 4I9LA 2FBTA 4AHCA 3TABA 5CY4A 1JXBA 4E7LA 1QS4A 4C8MA 2R7YA 4OJRA 4FM0A 2E6MA 2YNFA 5T7BA 3HM9A 5FDLA 1NK9A 5K14A 4JS5A 1IKVA 2Z1HA 4H4MA 4DTPA 3RR8A 3ZT3A 4H8KA 3AVJA 3ASMA 2RPIA 2OYQA 4JS4A 4BDPA 4AILC 1VK0A 3OJUA 5HRSA 3HP6A 4FLZA 1TK8A 1ZBIA 2KFNA 2VG6A 2G8UA 2QKKA 3MEEA 5E41A 2X78A 4DQPA 4B9LA 3SJJA 4FXDA 2YNHA 1VRUA 1NJWA 3PV8A 4AH9A 3RTVA 3ZT1A 3LAKA 2OZMA 3DLKA 4CJEA 4CIGA 2P5GA 3AV9A 4O0JA 4CJVA 3NHGA 3VQ8A 3SUNA 4CESA 3OYFA 1TAQA 2F8SA 4HHTA 1LWEA 4N5SA 1YVUA 1HYVA 5J1EA 1JLBA 1BISA 3AA2A 2OPSA 1HNIA 4CJLA 4J2AA 2YKNA 3SUQA 4M3UA 2IGIA 4CJFA 3ZSXA 3M8QA 1WN7A 3VQ5A 4K8XA 3HT3A 1JLQA 3C94A 3OYJA 3K57A 4E7KA 4M3ZA 1Y97A 3VN5A 1N6QA 3SQ1A 1SL0A 1SL1A 4FW2A 4B3OA 4CGIA 3OS1A 4HCBA 2PZSA 3PY8A 4DQRA 5KRSA 3NE6A 4CJTA 4DU3A 4CJ5A 1X9WA 1ASWA 1UOCA 1RBTA 2KW4A 1LWCA 4DG1A 3DLHA 3L8BA 2EHGA 1C0TA 1BIUA 3OYBA 4LSNA 3VQ6A 4DFJA 3OYKA 4Z4GA 3S3MA 4QOZB 1F21A 4CJRA 3QEWA 3L3VA 4N47A 3QIOA 4ZHRA 2G8HA 4FJ7A 1EETA 4AHRA 4CJPA 4CCHA 2KTQA 3M8SA 4CF1A 4RW7A 4DSKA 2D0BA 3I0SA 4CEEA 4DS5A 4PQUA 3RRGA 3V1QA 3VA0A 2BE2A 2YNGA 4KV8A 2NUBA 3U3GA 1YT3A 4RW6A 1WAFA 1U04A 5JS2A 1RTDA 4FYDA 1QSLA 1KRPA 2HHTA 3M8PA 5HRPA 3SV3A 3S3OA 1QSYA 4FZZA 4CERA 5CZ2A 3QINA 1VSHA 3VA3A 2B6AA 1GOAA 3AVLA 3HYFA 1ZBFA 4DFKA 3U6FA 3SQ2A 1LV5A 5DK5A 1D9DA 3K5LA 4YFUA 3NGIA 3I8DA 2X6NA 3VQQA 2W42A 3NFAA 4DS4A 4IG0A 1NJZA 3QLHA 1EXQA 1KFDA 2OPPA 2YKMA 2XHBA 4FJ9A 3AVNA 4FK0A 1I39A 4DF4A 4PA1A 4ELTA 4FLTA 5CYQA 1DLOA 3NH0A 3CFRA 3L2RA 4EZ6A 4E89A 3QEXA 3UIQA 3RWUA 4KO0A 2RN2A 1FXXA 1A5VA 4RW9A 3S9HA 1TAUA 2XY7A 3SCXA 3NF9A 1BGXT 3WNGA 2IDOA 5KGXA 1IG9A 1B92A 3KTQA 4FJKA 4FLUA 4J2DA 1Z25A 1BIZA 3PX4A 3C6UA 3HVRA 3AVBA 1TK0A 4H4OA 4OPJA 4Q5VA 1ASUA 1RBRA 3OS2A 2Y1JA 3TAEA 4KAZA 3V6DA 1Q8IA 3VQ7A 3NBPA 3JSMA 3IS9A 4JLHA 4KPYA 4IFVA 3SUOA 2IC3A 3M8RA 1C1CA 4KTWA 4RG8A 5KI6A 3OJSA 4FJHA 4FJIA 4IKFA 3DM2A 1CXUA 2JGUA 3OY9A 5FROA 1LAVA 2LSNA 3HXMA 2WOMA 3AA4A 2AJQA 5HLFA 2HVHA 3DLBA 1HJRA 1XHXA 2GV9A 2IS3A 1KVBA 3LP1A 3VQBA 3MAQA 1CLQA 1T05A 3OYAA 1S1VA 4NCBA 1TGOA 4QAGA 1WSIA
chains in the Genus database with same CATH superfamily
4C1NI 2OTLN 3O4QA 3IAYA 1GOBA 1XNQK 2WBNA 3O3FA 4DR3K 1W0HA 3P1GA 1JLFA 4CEDA 1VSLA 4IZ9A 1IG9A 4OGCA 3A0IX 2YHWA 4CZGA 5TKYA 4BRKA 2UXBK 4BRHA 1HUXA 5HP1A 1S9EA 5BPNA 2A1RA 4C8NA 3WQUA 3VGLA 4AM7A 3CCVN 1ZBHA 3EO3A 3OYIA 4EP5A 4RW8A 3OYDA 1NM1A 3BF3A 3KD5E 4WQ5A 5BRHA 2O8DA 2HBJA 4FCYA 1Q9XA 4IJNA 4CEBA 4WQ4A 1S5JA 4BE0A 4B3TK 2FF3B 1RCHA 3OYHA 1B9FA 3OA9A 4F2SA 2W6KA 3VEWA 1RBUA 5AQKA 1HYSA 1T44A 3OVNA 4W5RA 1N8RO 4CGGA 3L6QA 2HHUA 3LP0A 4Z4FA 3H1VX 5J2PA 3O9UA 3KK3A 3KIOA 5HRNA 1VQ7N 3DMJA 3ATUA 3RMAA 4FLVA 4JYAK 1Q18A 1A5XA 1NJYA 1C1BA 5AFUH 1K8KA 3LPTA 2ASPA 5GADP 3F73A 2HB5A 1HKGA 3F9KA 3T1HK 4B9UA 2ZE2A 1BG3A 3AVFA 4YDUC 1BA0A 5EXWA 4DMNA 1SV5A 4MO5A 3VEZA 3OYCA 4F3OA 5GAEP 4CHYA 3ENHA 4MO4A 2DPNA 1VSMA 4DSLA 2P5OA 4O44A 3OYMA 3LDOA 4M3YA 1NGCA 3NGZA 3G71N 1LW2A 4DSFA 2Q0UA 1J53A 5M1NA 2P9LA 4Z94A 2NRRA 1IBMK 2Z1GA 2B4JA 3TAGA 1QHTA 2RF2A 4JEPA 5JVGL 4BE2A 4NCGA 1GLDG 3QNNA 3AAQA 1G99A 3VQPA 2GUPA 2D5RA 3CJ1A 4EP4A 4IO9L 2V52B 4FLYA 4YOTA 4DF8A 4XH5A 4DCHA 1C0MA 1L3TA 3CCJN 3CCLN 3SAHA 1XI1A 4K42A 1Q81O 4KHSA 4CZKA 4CZIA 3C7NA 4KKOA 4CEFA 3RSEA 4PUOA 4FM2A 1YJNN 3NGYA 3KWGA 4DHYA 4CK3A 1FKPA 4FJ8A 3ZSZA 4NCAA 4JI7K 2E2OA 4DSJA 2BH1A 5LJVA 1KC8O 2QEXN 3MXJA 3CCUN 4HUFA 4FVMA 5SZTA 1JLEA 4FO0A 1BOTO 4CJQA 1VSEA 4KI4A 2FXUA 3LL3A 5AQUA 4BRPA 5M1FA 1NK5A 1RDCA 3LDNA 4E1MA 4BG9A 2O8CB 2Z1IA 3VQCA 4ZTJA 5AQRA 1X3NA 1WAJA 4X66K 3THXA 1S1XA 4JKHA 2XRIA 2D1KA 2F4VK 3VQDA 1HNZK 2NRTA 4FWSA 3QEIA 1WSHA 4IG3A 5KGWA 1GLFO 3CQ8A 1Q82O 4K8ZA 2PBDA 1TKXA 4M7YA 4N56A 4LFAK 1QZ6A 3ZETA 3CETA 4KHWA 1YTUA 1SAZA 3HPHA 3V9WA 1Q9YA 1RT5A 1ATNA 1CZAN 1RTJA 4CIEA 4JRQA 4KHQA 4QS9A 3OHRA 1VQ8N 3BY5A 3F9MA 1RBSA 1TYQA 1T7PA 1BHLA 1D5AA 3LWLA 4JKFA 1BI4B 3HL8A 3ZT0A 3GL1A 3CFPA 1XWLA 3CJCA 2GEMA 1X9MA 3E1YA 4GW6A 3NCIA 4E0DA 3QIPA 3LDQA 3G4SN 1EKEA 1P90A 3KK7A 4FK4A 4DFPA 1HQEA 3FE1A 4GKKK 3AO3A 4KHUA 4FJMA 2D0CA 5AQGA 2OA8A 3DLEA 3O08A 4F3TA 4AF1A 3T1YK 1NU0A 4FJLA 3A5OC 3G0ZA 3LWMA 3CM5A 4BR2A 1WSJA 5I3UA 3KLFA 5LJWA 2G8KA 4DR4K 1C0FA 3AY9A 4CK2A 1HLUA 1WSGA 4JK8A 4CECA 4DSIA 3CJ7A 1E4FT 4BWMA 3OW2M 1NGEA 4NXNK 4HCCA 2OPQA 4JI2K 4J2EA 3SPZA 3O4NA 1MU2A 4C23A 4FWNA 4KB1A 2P9KA 3CG7A 2DFEA 2WC9A 2PY5A 5F1XA 4H0OA 4PY5A 4E1NA 3TTCA 1UA1A 3HOSA 3M5RA 2UUCK 3CC2N 1TV6A 1E4GT 4O0IA 3PX6A 1HPZA 3O9TA 3H6EA 4KI6A 1ATRA 2QTDA 3MEDA 3V9ZA 3V4IA 1J6ZA 3GOIA 3SNNA 1SUQA 1C0GA 4JKEA 1JCEA 2A42A 3LPUA 2JWLA 1YJWN 1QTMA 3VGKA 1N36K 2WONA 4W5OA 3C65A 3K0SA 1SKWA 2DTUA 4C1NK 3HSTB 3J8AA 3PSIA 3MMVA 1VSIA 2RKIA 3HRGA 3VETA 4OJRA 4GKJK 3L4QA 3WEEA 1NK9A 1IKVA 2Z1HA 4DTPA 3RR8A 3CJAA 4H8KA 2GTDA 3AVJA 1OVQA 3ASMA 4BVOA 4BDPA 3JS6A 2KFNA 1D4XA 5HRSA 3HP6A 3ULEA 3C7NB 3QBXA 2X78A 4B9LA 3SJJA 2YNHA 4EHUA 3PV8A 3ZT1A 1U6ZA 3LAKA 3DLKA 2A41A 4CIGA 1ZC6A 4O0JA 4BR4A 4YDUA 1HKCA 1BISA 2UYTA 1W2BM 3R9PA 2JWKA 1KAZA 3JXUA 1WN7A 3VQ5A 1GLLO 3K57A 2ZJPL 4M3ZA 3SQ1A 1SL0A 4FW2A 4DQRA 1ASWA 2KW4A 3DLHA 4A2AA 4EAHD 3R1XA 3OYBA 3VQ6A 2NRVA 3ZEUA 4I6MB 1EETA 3FZFA 4CJPA 2P9UB 4CF1A 1JJ2M 2W40A 2D0BA 4DS5A 1OH6A 2VWBA 3WUHA 4YOVA 3RRGA 2YNGA 4LFCK 2NUBA 3U3GA 1U04A 5JS2A 4FYDA 1K8AO 3GG4A 5HRPA 3SV3A 1V4TA 2BTFA 4DFKA 3U6FA 4BC4A 1OVYA 3I8DA 3A5MC 1S22A 3QLHA 1EXQA 4FK0A 3H1QA 4EZ6A 4PL8A 1DLOA 3L2RA 4GVEA 4WYBA 1TAUA 3S9HA 1YXQA 3SCXA 2YCHA 3WT0A 4FLUA 1U2VA 1LCUA 3C6UA 3HVRA 1BUPA 3H45C 4KAZA 2Y1JA 3V6DA 3NBPA 4CVNE 1NMDA 4JKAA 3UE5A 5AQZA 1WOQA 5GIOA 4IFVA 4FWMA 4KTWA 4M7XA 4RG8A 3D6RA 4FJHA 2I7NA 3DM2A 1CXUA 2UXDK 5FROA 1LAVA 2LSNA 5HLFA 2HVHA 3DLBA 1HJRA 5B8HA 2IIRA 1CLQA 4OPHA 1S1VA 3OYAA 4JNEA 1WSIA 3VEVA 3SMSA 4EZ9A 4BRQA 1IKWA 1XHZA 3J7ZO 1T03A 2OTJN 4NLBA 4Y0WA 1BCOA 1KCFA 4G9ZA 3K9KA 3R3LA 3KK2A 3LDSA 1NWKA 3G25A 1VQ9N 4JK9A 3O1WA 3WNFA 2JLEA 2XY6A 3HP9A 1SKSA 2OZSA 1XQSC 5AQPA 4ZTFA 4DR7K 2G8WA 2IVPA 1ZBLA 1RDAA 3K2PA 4H5TA 2HHWA 3HBTA 5I42A 5BN9A 2HHHK 5FRNA 1RT1A 1NKCA 4I2QA 1WUAA 3FZMA 1S1WA 4JK7A 4H5WA 3CYMA 3BP8A 3WXJA 4OLAA 3L2UA 4O8KA 2VQFK 3SUPA 4DWIA 2ZGZA 1CZBA 1QQOA 3WEEB 1IKYA 3O3HA 1WBBA 4DQSA 1VQMN 4CZFA 4W5QA 4DV7K 1VQ4N 4GNIA 2ETJA 2PYJA 4BACA 4HTUA 4BR7A 4XH4A 3KLIA 1KFSA 3SZ2A 1BCMA 4OPKA 4I2PA 4FJJA 2V51B 1VAZA 1QQCA 3O9RA 4IBNA 1JKHA 4W5TA 2HHQA 2OPRA 3ISNC 2O8FB 3ZCMA 4R79A 1ZBSA 5KQDA 1QZ5A 2Z1JA 2UUBK 3F2KA 4DTMA 5BRDA 4FL9A 2KQ2A 4DV4K 1ATSA 1L3SA 2HBMA 3DRPA 3E9OA 1NJIO 4YHHK 4UQGA 3L2WA 3QEVA 3T7ZA 4Y1CA 4IOXA 4AHVA 4DQIA 3ZSQA 4B1UB 4E7JA 4N41A 3NAEA 3KD1E 4PWDA 3WXMB 3NVMA 3T1AA 4B1XB 1NOYA 1S9GA 2O8EB 3CQYA 4CD3A 3P4IA 5GAGP 4CD1A 3H08A 1HNWK 2YX6A 3KLEA 3RR7A 4G1QA 1FW6A 1T3VA 1IKXA 4N76A 2P9NB 4CZMA 4FLXA 4ELVA 2NRXA 3T19A 3DJCA 3OYEA 3BZCA 4B08A 5AQIA 2FBYA 5C2DA 3QETA 3DRSA 1D8YA 4QCLA 4M45A 3MN7A 3ULDA 2O8CA 1Z26A 1YAGA 2VWJA 4GV6A 2BUPA 4ISFA 4JKCA 2E1ZA 1J5OA 5HOOA 3AVAA 3SK3A 3V1OA 4B9TA 3AVIA 3NH1A 4H0XB 3OBWA 1NK6A 3AGRA 5MLCQ 4OKKA 1HYZA 4CW7B 1U2VB 3O80A 2HHXA 4H5RA 3EZWA 1J5EK 3CCRN 4Z4CA 3FGUA 4H5NA 2FC0A 3SQ0A 4B9SA 2YHXA 3DXMB 1IG8A 4CF9A 4FJNA 2VQEK 3WNEA 2DY4A 1OH5A 3VQAA 1KXPA 4JD2B 4M3RA 2FSKA 5M1OA 4DU1A 1BI4A 4CHNA 3HPGA 1KLNA 1KLMA 1MDUB 2WTUA 2UU9K 2P1JA 4AHUA 4ELUA 2Q97A 3KVGA 4FW1A 3THVA 4WFBL 4JI5K 4CEQA 1RNHA 5AQJA 1ZYQA 1HPMA 3ZT2A 1NKBA 2IOCA 5GAHP 4DTUA 1HRHA 1RILA 4LH5A 4DTRA 3LP3A 4LF9K 1R0AA 3WXKA 4NO7A 2B5JA 5AZIB 1VHXA 3KJVA 3G10A 3QO9A 4CJUA 5KRTA 3MCPA 1DTTA 5J2NA 3CM6A 1VSKA 4DLEA 2A1SA 3CXCM 2ASMA 2O4GA 4JI1K 3SI6A 1H1VA 3O5BA 1S3XA 3MX2A 1REVA 3AVMA 2GBZA 5F2RA 4YY3K 1UA0A 3VOVA 3PX0A 4IJAA 1S6QA 2Q1NA 1WSFA 3SAGA 3KWIA 1NNEA 2XY5A 4PL7A 3MWTA 1TKDA 4DTNA 3CIPA 5FRMA 4OPAA 5HBMA 4NLCA 2Q31A 4GVMA 2QKBA 3MXMA 4E1JA 2HMPA 3EYZA 1MWMA 3LALA 1S6PA 4WFAL 1C0UA 4CJ3A 3J81O 2E6LA 4BGAA 4KH6A 2FSNA 1SZ2A 4DR1K 1TK5A 4HTLA 4LSLA 1Z05A 3MCAB 2W41A 1VRTA 1UAXA 4MLHA 4DU4A 4CJKA 5J2MA 2IAJA 4WCEL 1Q86O 1GLEG 1JL2A 2FLOA 4JKGB 1VQLN 3THYB 1RT2A 3VF4A 2I7PA 3V9XA 4LH4A 1YHQN 2HNDA 3TAFA 3TWHA 1QQMA 3P5JA 3LZIA 5FLXO 1VQ5N 2F96A 4I9LA 3AAPA 3RVCA 5CY4A 4JI8K 3IUCA 4F9OA 4E7LA 2ZJQL 2R7YA 2QWOA 3HM9A 4IOCL 4H4MA 3ZT3A 3DXKB 2RPIA 1I94K 3UKRB 2OYQA 4DV2K 3E66A 4A62A 1TK8A 2QKKA 2YHYA 4AH9A 3RTVA 3CCQN 4I6MA 4RWTA 1IJJA 1BDGA 2P5GA 2P9UA 3OYFA 1TAQA 2IVOA 1LWEA 4N5SA 1YVUA 5J1EA 1JLBA 2ITMA 4BROA 5F0XA 4M3UA 2GWKA 3M8QA 1NGJA 4A57A 4E7KA 1ZXOA 3H3OB 4K41A 4CGIA 4B3OA 3OS1A 4HCBA 3PY8A 3NE6A 4CJTA 4DG1A 1RBTA 1LWCA 3UB5A 5DM7L 2EHGA 1C0TA 1NG9A 4CBWA 4H0PA 4QOZB 3I33A 4JI6K 5BR8K 4ZHRA 3CCMN 4JAXA 4CCHA 2KTQA 3TU5A 3W0LA 4U7BA 3AGKA 3R6MA 2E2PA 3DAWA 3V1QA 2BE2A 3IMXA 4KV8A 3LM2A 1HX1A 1DEJA 1RTDA 5JVHL 1QSLA 3M8PA 3S3OA 4FZZA 2OANA 5CZ2A 1W97L 5AQYA 3CD6N 1ZBFA 2HBLA 3HTVA 3VQQA 1VQPN 4IG0A 3MN9A 3TSUA 4YORA 5BR9A 3VESA 3AVNA 4RTFD 4PA1A 4ELTA 4KO0A 3MDQA 1RFQA 5AQNA 4BRIA 2IDOA 4DR5K 1BIZA 4Q5VA 3TAEA 3FLCO 1Q8IA 3VQ7A 4JLHA 4CI6A 3SUOA 2IC3A 1C1CA 2QXLA 3OJSA 4IKFA 4FWRA 3OY9A 2WOMA 2AJQA 1JCFA 1HKBA 3LP1A 4BG8A 2P9SB 3CERA 1T05A 4BRMA 1D9FA 3L3UA 4CK1A 4FJ5A 3JAMO 1EWRA 4OKEA 5IWAK 3CJBA 5H1SQ 3C0BA 3E01A 2F8TA 4OLBA 1GOCA 3Q7BA 1ASVA 3IRXA 3EY1A 5IT9O 2X74A 4CJ4A 4Z4HA 4MQ3A 3D2FB 4KHNA 2YHBA 1NBWA 3CI5A 2HF3A 4OGEA 3SLCA 2Q3SA 5BRFA 4CGHA 2D0OA 1TKZA 3KKRA 4ID5A 2RHKA 1KD1O 1ZBUA 3WQTA 3TARA 3KLHA 4JI0K 3E9LA 3NF7A 4FWLA 2ASOA 4BDYA 3RMDA 3VQEA 1BL3A 2O8FA 2EX3A 4BY9C 1ESVA 3JYTA 3TAQA 1BQMA 3UKUB 5D3GA 2X6SA 5JMVA 2ZQBA 4IEEA 4CZLA 2BDPA 3OS0A 2ZM6K 2CH5A 4LF7K 3U8XA 4ICLA 4FPAA 1XUPO 3I0RA 4Q0BA 1VQON 4M3XA 2GX9A 2CGLA 3WXIA 3SPYA 3ZSRA 3QMLA 4A5AA 1NKEA 3HI0A 4B9QA 4B3RK 3QBWA 3M3ZA 5I9EB 5E84A 4BR9A 3ZLJA 1VQKN 3N4PA 3MX5A 2FBVA 1WNSA 4LC9B 4DUYK 2HVIA 2O8EA 1I3AA 3U4LA 3SBTA 1L3VA 3MN5A 5C42A 4GMJB 1TUYA 2QWMA 4B8AB 5HROA 3TSPA 2P9NA 3AVGA 4FSVA 3ZSOA 4CFCA 4O55A 3C6AA 3E9PA 1KTQA 4CFBA 3P83D 5JS1A 3D0PA 4CHPA 4ILGB 3W3DA 4KTQA 4F8RA 3ENBA 4B3SK 3O1BA 4JHDA 2HF4A 4CE9A 4DTXA 2OCEA 3K58A 4FK2A 4M3WA 3NH2A 1SKRA 4BC5A 1K73O 1JCGA 2QWQA 2QWNA 1TL1A 3ZX0A 1JXEA 3B6OA 4CBXA 5AQFA 2DFHA 1RT6A 5C24A 3SV4A 3DXMA 1EX4A 1RT4A 2HNYA 1J9AA 3ZSYA 4I9QA 4CEZA 4JD2A 3G6EN 4KH4A 4DR2K 3T3FA 5EOYA 3L2VA 3ZT4A 4FZYA 1SQKA 3IG1A 1N32K 1DGKN 3ZSWA 1JL1A 2XY8A 5KTQA 2E1YA 2G8VA 4CIFA 3CCEN 4K0KK 4PHTX 4JN4A 3I8BA 4NYFA 1U47A 2NRWA 5CYMA 2A3ZA 4DTOA 2NRZA 5E26A 2ZD1A 3HSCA 1HNXK 1U49A 1J54A 3L4IA 5AQHA 1OH8A 1M90O 4WFNL 4PKIA 4PKHA 1T8EA 3B6PA 3CPWM 2G8FA 1TKTA 5AZIA 2P9PB 4DV6K 3D45A 1YIJN 4CF0A 3QNOA 4CF8A 3O4WA 3KK1A 4J2BA 1XC3A 4DV5K 4LY7A 3V1RA 3IDHA 3MEGA 4LD0A 2YI1A 4LF4K 2A5XA 4E7HA 4YOYA 2F9WA 3CC7N 3L0QA 4CGJA 3H46O 1NGFA 4K25A 4E7IA 4B3MK 2D0AA 3O9QA 4CFAA 3DOKA 4Z4IA 4XH1A 4O8UA 4K43A 1U4BA 3QICA 4M42A 5LMNK 3MECA 3SQ4A 3U9DA 1O1WA 5EY4A 3ALYA 3AO5A 3LZJA 4C8OA 2O8BB 3CFOA 1UWBA 2P9IB 4B1WB 4EFHA 4CEAA 3HVTA 3EL2A 2J4RA 4FOIA 5AQWA 4A2BA 2F9TA 4UY8O 5TKWA 3ZSVA 2HHVA 1DT9A 5HL7L 3SYZA 3BGRA 4IDHA 4O5FA 2HHSA 5C12A 3QDKA 2GUIA 3QESA 4BQLA 5A2QO 4FM1A 1C1AA 4KHPK 3AO2A 5BN8A 4F2RA 1YTAA 3OYLA 3TAMA 1LW0A 4CJWA 1FKOA 3AO4A 3P31A 1HMVA 5AZJB 1BU6O 3LANA 3WXLA 4BR5A 1NGIA 1P8ZA 1WB9A 4KHYA 1YUWA 4BE1A 3EE9A 4O4GA 4JKGA 3THYA 2A6AA 2E8AA 3ID6A 5SWMA 1NOZA 5AQQA 1HQUA 3TTFA 1N34K 1DTQA 2HW3A 2ZWHA 2ATQA 3K5NA 3RMCA 4FZXC 3SBGA 3K5OA 3AO1A 3K9JA 5EVZA 3K5MA 3DRRA 4X62K 4CZHA 1C6VA 4XEIA 4C8LA 3NMUA 4BC2A 3FFIA 2VGNA 1RBVA 3DXKA 1JLCA 5GINA 3UKRA 4JHDB 3D2EB 4FPBA 5CZ1A 5AQTA 4CGFA 4H0YB 5DMRA 2UUAK 4KBOA 1S1TA 3NVKA 2KLAA 3P38A 1QQNA 3TSQA 3M6GA 4Z4EA 4GV3A 2E2QA 2GELA 1NK7A 4KB0A 2QWRA 3AA3A 5LMUK 1NK8A 4C8KA 4AHCA 2D4WA 5C15A 4A59A 2FF6A 3I56N 2NRHA 2E5LK 3BZKA 2E6MA 2YNFA 5T7BA 1Z6RA 5K14A 1V4SA 4YOWA 4NXMK 2QWLA 1VK0A 3OJUA 4AILC 4FLZA 4X65K 3MEEA 2HSTA 3GE1A 1NJWA 4JV5K 3CF5L 1Y64A 2H3GX 2YJEA 2F8SA 1MA9B 3TTDA 1HYVA 5FPDA 3QB0A 4J2AA 2OPSA 1HNIA 4CJLA 1NLVA 4BRDA 3SUQA 3VEXA 3EEQA 4CJFA 3ZSXA 3OYJA 4BC3A 4L3QA 3DWLA 1DKGD 3ZYYX 1Y97A 5FPMA 4YOUA 4BGBA 1SL1A 2PZSA 1VQNN 4DU3A 4CJ5A 5DM6L 3L8BA 1T6DA 4DFJA 3OYKA 4Z4GA 3S3MA 1T6CA 4CJRA 4QS8A 3QEWA 4N47A 2VGMA 3PIPL 2G8HA 3R8EA 4FJ7A 4AHRA 3M8SA 4RW7A 5JICA 3FZHA 3CJ9A 3I0SA 3OBYA 4PQUA 5ADXH 1YT3A 1WAFA 1KRPA 2HHTA 4BREA 3QINA 5AQMA 1GOAA 3AVLA 3HYFA 3SQ2A 1LV5A 5DK5A 1D9DA 3NGIA 1XMOK 3SMPA 3I55N 1NJZA 2P9SA 3M1FA 1KFDA 2OPPA 2ZF5O 2XHBA 4FJ9A 1I39A 5AQVA 4FLTA 3QFUA 3UIQA 2RN2A 4IWVA 1A5VA 2W6LA 4CZJA 1BGXT 3WNGA 5AQLA 4AM6A 1B92A 2PFUA 3A5NC 4J2DA 1Z25A 5AR0A 3AVBA 4CZEA 1TK0A 4OPJA 1YVNA 3F5TA 1ASUA 1RBRA 3D2FA 3FZKA 4PKGA 1YF5L 5AQSA 3IS9A 3SAFA 4KPYA 4MDBA 4DV1K 3M8RA 4JI3K 4FJIA 3HXMA 1MWKA 4FWPA 1NGGA 3AA4A 3CPEA 5EX5A 3LDPA 2AA4A 1XHXA 3T69A 3MAQA 1NGDA 2GWJA 4QS7A 4NCBA 4OO1J 1TGOA 4QAGA 3JSMA 3PO4A 4F4KA 4IO8A 4B9MA 3UKUA 5AQXA 1ITGA 2CGJA 3CCSN 1IV0A 2CH6A 4FJXA 3V81A 4BRAA 1VQ6N 4TSXA 4OKJA 4BRNA 1HNVA 4Y1DA 3THWB 2HNZA 4IDKA 4KFBA 4MFBA 3VPZA 4DTJA 3QEPA 1BWFO 2NNWA 1NMNA 3LAMA 1M1KO 3VTIA 2Q2RA 1X1PA 2VG5A 5KQ8A 5EU7A 4W5NA 2WFBA 3ZX3A 4U67L 3TAPA 2QA4N 4H0VB 1CXQA 4J8FA 1JLAA 3B8AX 1BO5O 4FLWA 1RTIA 2QWPA 3ID8A 1EQYA 4ISGA 3V9SA 1VSJA 1GLAG 3PSFA 3U9ZA 4AHTA 1A5WA 2NZTA 4YOXA 1VSFA 5AJ3K 3DI6A 2QXFA 1KVAA 2P51A 2KFZA 3AVKA 3EKSA 5GIPA 3PUFA 1EO1A 4CHOA 1BQNA 4H5VA 5BREA 5FPEA 1LAWA 2Q36A 4HUEA 2VG7A 3RRHA 4I7FA 4CJ7A 4DTSA 1Q7YO 1RDDA 1IBLK 3VF2A 2VWKA 2D0PA 3DLRA 4KH5A 3O8MA 4ID1A 4GY2B 4LF6K 3VEYA 4MDAA 5J2QA 2O8DB 4E3SA 1X3MA 4FJGA 4B1VA 5JLHA 3S3NA 4BRCA 4DUZK 5CHIA 4CJSA 1SS6A 1TVRA 4AHSA 4HVJA 4FWOA 4DKWA 4IFYA 1LWFA 3V9UA 3CQXA 1XMQK 4BDZA 3GBTA 1YITN 3LM9A 4XIUA 5ADXA 3C95A 5AFUA 3HPOA 4B9NA 4R5PA 1TL3A 3C6TA 4A5BA 1N5YA 3K59A 3OYGA 3A5LC 3DLGA 1QVFM 4YNQA 1K8KB 3KHYA 4RW4A 5C10A 4DLGA 1NGAA 4KRFA 1NGBA 2FSJA 4O5BA 3KZBA 3HJFA 2E2NA 1S1UA 1L5UA 4EHTA 2KKZA 2P9PA 1W9HA 3HZ6A 4FWQA 3DYAA 2I5JA 3O3GA 5C25A 3KLGA 3A2FA 3VERA 3DOLA 5M1KA 1QE1A 1QVGM 3MN6A 3AVHA 4DQ8A 3NDKA 1HR0K 3U3YA 3WNHA 2P9LB 3TANA 3N4QA 2UXCK 3FR0A 2HBKA 2PAVA 3VQ9A 3AA5X 4Z0UA 4RCHA 1XC9A 1RTHA 2KZMA 2F7TA 1ILYA 2ZJRL 4CBUA 4FVUA 1SL2A 4HUGA 3PO5A 2CGKA 1N33K 3EE8A 3AVCA 3ZX2A 2DFFA 4BQZA 2O8BA 2P9IA 5M1PA 2E4LA 3VTHA 3BF1A 1NK4A 1IBKK 1WSEA 3A8YA 4M63C 1FJGK 3FZLA 4DQQA 1FK9A 4DV0K 3NF8A 2FBXA 3RSEB 3HK2A 2BANA 3J80O 3VEOA 2KZZA 2EWSA 2YHAA 4LFBK 1OKJA 5CE3A 4MLEA 3ITHA 4DV3K 3EKUA 4DSEA 2Y1IA 3PLAA 4WE1A 1B9DA 3KKSA 3QFPA 2QI2A 4CFDA 4NB4A 3CMAN 2YV0X 1RDBA 1RT7A 4CF2A 2G8IA 1R59O 1NJXA 3SJHA 4CHZA 1IO2A 5AZJA 3DLLL 2YNIA 3EZ5A 4NYNA 4DB3A 1X9SA 1IH7A 1EP4A 3THXB 1VSDA 5BPMA 1G15A 4B9VA 1LOTB 4OVLA 1CZ9A 4E19A 3VQ4A 2E88A 4LF8K 1QHAA 2V7ZA 4CEOA 4CGDA 4WQ5C 4L8RB 3ZETB 1WLJA 1K6YA 3FFKB 1U48A 5LY3A 2ITGA 3ATVA 3J7YP 4WQ4C 4V19S 1GLBG 3VMFB 2A40A 4M3TA 1O13A 3OYNA 3MXIA 3MK6A 3D2EA 3QERA 5KPRA 1RGIA 1TYQB 5AQOA 1XNRK 2IVNA 1U45A 1BA1A 1GLJO 3IFRA 1KSPA 3RMBA 3H3NO 1GLCG 1KAXA 1JLGA 3TPQA 3BUZB 2YJFA 4OX9K 3ENOA 4WF9L 2WUSA 4AQYK 3C6HA 1RT3A 1L3UA 4H0TB 3PIOL 1KVCA 3HO1A 4B8CA 2BGGA 4BR0A 4KTZA 4BRLA 4FOEA 1NK0A 2O4IA 3LDLA 4ILHA 4B1ZA 5HRRA 2HMIA 4KREA 3LP2A 4JRPA 1OH7A 3TI0A 2PYLA 4BWJA 4IOAL 4GV9A 4CHQA 3BDPA 5ELZA 3TR8A 3CMEN 4ILJA 3O6WA 5C2FA 3NF6A 4M41A 2XO7A 2P9KB 2QK9A 3IKMA 3L2QA 1QSSA 3VGMA 1WBDA 2FBTA 3TABA 1JXBA 1QS4A 4C8MA 3VENA 4FM0A 2E20A 1TUUA 5FDLA 5LL6Z 2KHOA 4JS5A 4B1YB 4JS4A 1ZBIA 4EIAA 2VG6A 2G8UA 5CR4A 5E41A 4DQPA 4FXDA 1VRUA 3Q7CA 3HM8A 5BPLA 2OZMA 4CJEA 3HOTA 3AV9A 4CJVA 3NHGA 3VQ8A 3SUNA 4CESA 2QW9A 4HHTA 3AA2A 1E3MA 5KPZA 2YKNA 2IGIA 4K8XA 1YI2N 5JLFA 1JLQA 2AP1A 3C94A 3HT3A 4H03B 4DR6K 2VYPA 3VN5A 1N6QA 1S72N 1RDUA 4IFEA 5M1QA 3AARA 5KRSA 4BRFA 3D7EO 1X9WA 1X9JA 1UOCA 3CC4N 3ULEB 1BIUA 4LSNA 1F21A 3L3VA 3QIOA 4ISEA 4DSKA 4CEEA 5KPTA 1NGHA 1HJOA 3VA0A 4IEIA 3S41A 4RW6A 4HWIA 2RE2A 3VF6A 1QSYA 4CERA 2HOEA 1KQSM 4X64K 1VSHA 2QM1A 2B6AA 3VA3A 3K5LA 4YFUA 4BVPA 2X6NA 2W42A 1KAYA 3EN9A 3NFAA 4DS4A 2NLXA 3BEXA 2YKMA 1K9MO 3OTOK 4DF4A 5CYQA 3NH0A 3CFRA 3RWUA 3CHWA 4E89A 3QEXA 4BRGA 3MWPA 1FXXA 4RW9A 3ZEUB 4LF5K 2XY7A 3NF9A 3P39A 2ZGYA 5KGXA 3J7AP 3KTQA 4FJKA 4JI4K 5C0YA 4A61A 4JKDA 3THWA 3PX4A 4H4OA 3OS2A 1EWQA 4FWKA 1RDWX 4IXCA 1YJ9N 5KI6A 2Q0RA 2JGUA 5FPNA 2VCPA 4JKBA 1W7AA 2GV9A 2IS3A 3O9SA 3VQBA 1KVBA 3GDQA 2V7YA 4DFMA
chains in the Genus database with same CATH topology
1D9FA 3PO4A 3O4QA 3IAYA 1GOBA 3L3UA 4EZ9A 4CK1A 4F4KA 4FJ5A 1IKWA 1XHZA 1T03A 4B9MA 4OKEA 3O3FA 1ITGA 1BCOA 1W0HA 1KCFA 3E01A 3P1GA 4OLBA 4FJXA 3KK2A 1JLFA 2F8TA 3V81A 3LDSA 1GOCA 4TSXA 4OKJA 1HNVA 4Y1DA 1ASVA 2HNZA 3IRXA 3EY1A 2X74A 4IDKA 1VSLA 4KFBA 4MFBA 4MQ3A 2JLEA 3WNFA 4CEDA 3HP9A 4CJ4A 4Z4HA 4DTJA 2XY6A 3QEPA 4OGCA 1SKSA 2OZSA 4KHNA 2YHBA 4OGEA 2Q3SA 3LAMA 4ZTFA 4CGHA 1X1PA 2G8WA 5HP1A 2VG5A 1S9EA 1TKZA 3KKRA 4ID5A 2A1RA 1ZBLA 1RDAA 4C8NA 1ZBUA 3K2PA 5EU7A 4W5NA 3TARA 2HHWA 3KLHA 1ZBHA 3NF7A 3TAPA 3OYIA 1CXQA 5I42A 4BDYA 1JLAA 4EP5A 4RW8A 3OYDA 3VQEA 3RMDA 1BL3A 4M3WA 4FLWA 1RT1A 1RTIA 5FRNA 2EX3A 3KD5E 1NKCA 4I2QA 3JYTA 3TAQA 1S1WA 1BQMA 4FCYA 1Q9XA 5D3GA 3V9SA 1VSJA 3CYMA 2X6SA 4OLAA 2ZQBA 4AHTA 4CEBA 1A5WA 3OS0A 2BDPA 4BE0A 1S5JA 3L2UA 3SUPA 1VSFA 4DWIA 3DI6A 4ICLA 1RCHA 1CZBA 2QXFA 3OYHA 1KVAA 1IKYA 1B9FA 3I0RA 3O3HA 4Q0BA 2P51A 4DQSA 2KFZA 4F2SA 4M3XA 3AVKA 3SPYA 4W5QA 1RBUA 3ZSRA 1HYSA 1NKEA 3PUFA 3OVNA 2ETJA 4CHOA 1BQNA 4W5RA 2PYJA 4BACA 4CGGA 4HTUA 2HHUA 1LAWA 3LP0A 4Z4FA 3KLIA 1KFSA 4HUEA 2VG7A 3SZ2A 3RRHA 4I7FA 5J2PA 1BCMA 3KK3A 3KIOA 5HRNA 4OPKA 4I2PA 4DTSA 3DMJA 4FJJA 4IBNA 1RDDA 1QQCA 1WNSA 2FBVA 3RMAA 2HVIA 2VWKA 1JKHA 4FLVA 1A5XA 4W5TA 2HHQA 1I3AA 3DLRA 1NJYA 2OPRA 4ID1A 3ISNC 1C1BA 3ZCMA 1L3VA 5C42A 5J2QA 3LPTA 4GMJB 4E3SA 2Z1JA 4B8AB 5HROA 4FJGA 3F73A 3AVGA 2HB5A 3F9KA 4DTMA 3ZSOA 3S3NA 4CFCA 4O55A 2KQ2A 4B9UA 2ZE2A 3AVFA 1L3SA 4DMNA 1SV5A 4CJSA 1KTQA 3DRPA 4CFBA 4K8ZA 3P83D 1TVRA 3D0PA 3OYCA 5JS1A 4AHSA 4HVJA 4CHPA 4UQGA 4F3OA 4KTQA 3L2WA 3QEVA 4IFYA 4CHYA 1LWFA 3V9UA 1VSMA 4Y1CA 4AHVA 4BDZA 4DSLA 2P5OA 4O44A 3OYMA 4DQIA 4F8RA 4DFMA 3ZSQA 4M3YA 4E7JA 4N41A 3NGZA 3NAEA 3KD1E 1LW2A 4XIUA 4PWDA 4DSFA 4CE9A 3C95A 4DTXA 1J53A 3T1AA 3HPOA 3K58A 1S9GA 1NOYA 4R5PA 1TL3A 3NH2A 3C6TA 1SKRA 4FK2A 1N5YA 3K59A 3OYGA 3H08A 2Z1GA 2B4JA 1TL1A 3DLGA 1QHTA 3KLEA 3TAGA 4YNQA 2RF2A 1JXEA 3B6OA 4G1QA 3RR7A 4BE2A 4RW4A 1IKXA 2DFHA 1RT6A 4NCGA 4DLGA 4N76A 5C24A 3QNNA 4KRFA 4ELVA 4FLXA 3SV4A 4O5BA 3T19A 3VQPA 1EX4A 3OYEA 2D5RA 1RT4A 2HNYA 3HJFA 4B08A 1S1UA 4EP4A 1J9AA 2FBYA 3ZSYA 1L5UA 3QETA 3DRSA 4I9QA 1D8YA 4CEZA 4QCLA 4FLYA 4M45A 4DF8A 1W9HA 3ULDA 3T3FA 1Z26A 3DYAA 1C0MA 2I5JA 3O3GA 3L2VA 3ZT4A 2VWJA 1L3TA 5C25A 3KLGA 4FZYA 1J5OA 3IG1A 1XI1A 3AVAA 3A2FA 3V1OA 3DOLA 1QE1A 4KHSA 4B9TA 3AVHA 3ZSWA 3NDKA 1JL1A 2XY8A 3AVIA 5KTQA 4KKOA 3NH1A 4CEFA 3U3YA 1NK6A 2G8VA 3WNHA 4CIFA 4PUOA 4FM2A 4OKKA 1HYZA 4NYFA 1U47A 2HHXA 3TANA 3NGYA 4DTOA 5CYMA 4CK3A 3VQ9A 4Z4CA 3AA5X 1FKPA 4Z0UA 2ZD1A 3ZSZA 4NCAA 1XC9A 4FJ8A 1RTHA 1U49A 1J54A 2KZMA 2FC0A 3SQ0A 4B9SA 4DSJA 3MXJA 4HUFA 4FVMA 1SL2A 5SZTA 4CF9A 1JLEA 4HUGA 1T8EA 3PO5A 4FJNA 3B6PA 4CJQA 3AVCA 2G8FA 3WNEA 1VSEA 2DFFA 4KI4A 2DY4A 1TKTA 1NK5A 3VQAA 1RDCA 2E4LA 3D45A 4M3RA 4E1MA 2Z1IA 3VQCA 4CF0A 4ZTJA 1NK4A 3QNOA 1WAJA 1WSEA 4CF8A 4DU1A 1BI4A 1S1XA 3KK1A 4CHNA 4J2BA 3HPGA 1KLNA 1KLMA 4LY7A 4DQQA 3V1RA 2XRIA 1FK9A 3MEGA 3NF8A 3VQDA 2FBXA 2P1JA 4LD0A 4AHUA 3HK2A 4ELUA 2BANA 4E7HA 2KZZA 2YHAA 3QEIA 4FW1A 1WSHA 3THVA 4IG3A 4CGJA 3ITHA 4DSEA 5KGWA 3CQ8A 2Y1IA 4WE1A 1RNHA 4CEQA 1B9DA 1TKXA 3KKSA 4N56A 4E7IA 4CFDA 3ZT2A 1ZYQA 1NKBA 2IOCA 2D0AA 2YV0X 1RDBA 4CFAA 3DOKA 1RT7A 4Z4IA 4DTUA 1HRHA 4KHWA 1YTUA 3HPHA 1RILA 4LH5A 4CF2A 3V9WA 1Q9YA 4DTRA 1RT5A 3LP3A 1U4BA 4M42A 3MECA 1RTJA 3SQ4A 2G8IA 1O1WA 4CIEA 4JRQA 4KHQA 3ALYA 1NJXA 4CHZA 1R0AA 1IO2A 3AO5A 3LZJA 4C8OA 1RBSA 3CFOA 1UWBA 2B5JA 2YNIA 3EZ5A 1T7PA 4CEAA 1BHLA 3HVTA 4NYNA 3KJVA 3G10A 1X9SA 3QO9A 1D5AA 1IH7A 1EP4A 3LWLA 4CJUA 1BI4B 3HL8A 5KRTA 1VSDA 1DTTA 3ZT0A 3ZSVA 3CFPA 1G15A 5J2NA 2HHVA 1XWLA 3CM6A 3SYZA 1X9MA 3BGRA 4B9VA 1VSKA 3NCIA 4GW6A 4E0DA 2HHSA 4DLEA 2A1SA 3QIPA 4OVLA 1CZ9A 2O4GA 1EKEA 2GUIA 4E19A 3QESA 3VQ4A 4FK4A 3SI6A 4DFPA 1HQEA 1REVA 3AO3A 4CEOA 3AVMA 4CGDA 4FJMA 4FM1A 2D0CA 2GBZA 2OA8A 4L8RB 3DLEA 1C1AA 4KHUA 4F3TA 3AO2A 1WLJA 1K6YA 1U48A 1UA0A 4FJLA 2ITGA 3PX0A 1S6QA 4F2RA 3G0ZA 1WSFA 1YTAA 3OYLA 3LWMA 3CM5A 1WSJA 1LW0A 3TAMA 1FKOA 4CJWA 3AO4A 3KLFA 5I3UA 2XY5A 4M3TA 3OYNA 2G8KA 3MXIA 1HMVA 3LANA 4DTNA 1TKDA 4KHYA 5FRMA 4CK2A 3QERA 4BE1A 1WSGA 5HBMA 4O4GA 4CECA 4DSIA 4GVMA 2QKBA 3MXMA 1U45A 4BWMA 3EYZA 1KSPA 4HCCA 2OPQA 3RMBA 1JLGA 5SWMA 4J2EA 1NOZA 3LALA 1HQUA 1S6PA 3SPZA 1C0UA 4CJ3A 3O4NA 1DTQA 1MU2A 1RT3A 2E6LA 1L3UA 4KB1A 2HW3A 3CG7A 2DFEA 3K5NA 2ATQA 3RMCA 4FZXC 4B9NA 3K5OA 3AO1A 1KVCA 2PY5A 3HO1A 4B8CA 1TK5A 2BGGA 4PY5A 4LSLA 3K5MA 4E1NA 3DRRA 4KTZA 1NK0A 1C6VA 4C8LA 2O4IA 3FFIA 1VRTA 1UA1A 1UAXA 1RBVA 1TV6A 4DU4A 1JLCA 4CJKA 4O0IA 5J2MA 3PX6A 2IAJA 5HRRA 2HMIA 1HPZA 5CZ1A 4KREA 4CGFA 4KI6A 5DMRA 3MEDA 3V9ZA 3V4IA 1JL2A 3LP2A 4JRPA 1S1TA 3TI0A 1RT2A 2PYLA 3SNNA 1SUQA 4BWJA 3V9XA 4LH4A 3LPUA 1QTMA 4CHQA 3BDPA 3TR8A 2HNDA 3TAFA 2WONA 4Z4EA 4W5OA 3TWHA 1SKWA 1NK7A 4KB0A 2DTUA 3HSTB 3NF6A 3AA3A 3P5JA 4M41A 2XO7A 3LZIA 2QK9A 1VSIA 2RKIA 3L2QA 1NK8A 1QSSA 2F96A 4C8KA 4I9LA 2FBTA 4AHCA 3TABA 5CY4A 1JXBA 4E7LA 1QS4A 4C8MA 2R7YA 4OJRA 4FM0A 2E6MA 2YNFA 5T7BA 3HM9A 5FDLA 1NK9A 5K14A 4JS5A 1IKVA 2Z1HA 4H4MA 4DTPA 3RR8A 3ZT3A 4H8KA 3AVJA 3ASMA 2RPIA 2OYQA 4JS4A 4BDPA 4AILC 1VK0A 3OJUA 5HRSA 3HP6A 4FLZA 1TK8A 1ZBIA 2KFNA 2VG6A 2G8UA 2QKKA 3MEEA 5E41A 2X78A 4DQPA 4B9LA 3SJJA 4FXDA 2YNHA 1VRUA 1NJWA 3PV8A 4AH9A 3RTVA 3ZT1A 3LAKA 2OZMA 3DLKA 4CJEA 4CIGA 2P5GA 3AV9A 4O0JA 4CJVA 3NHGA 3VQ8A 3SUNA 4CESA 3OYFA 1TAQA 2F8SA 4HHTA 1LWEA 4N5SA 1YVUA 1HYVA 5J1EA 1JLBA 1BISA 3AA2A 2OPSA 1HNIA 4CJLA 4J2AA 2YKNA 3SUQA 4M3UA 2IGIA 4CJFA 3ZSXA 3M8QA 1WN7A 3VQ5A 4K8XA 3HT3A 1JLQA 3C94A 3OYJA 3K57A 4E7KA 4M3ZA 1Y97A 3VN5A 1N6QA 3SQ1A 1SL0A 1SL1A 4FW2A 4B3OA 4CGIA 3OS1A 4HCBA 2PZSA 3PY8A 4DQRA 5KRSA 3NE6A 4CJTA 4DU3A 4CJ5A 1X9WA 1ASWA 1UOCA 1RBTA 2KW4A 1LWCA 4DG1A 3DLHA 3L8BA 2EHGA 1C0TA 1BIUA 3OYBA 4LSNA 3VQ6A 4DFJA 3OYKA 4Z4GA 3S3MA 4QOZB 1F21A 4CJRA 3QEWA 3L3VA 4N47A 3QIOA 4ZHRA 2G8HA 4FJ7A 1EETA 4AHRA 4CJPA 4CCHA 2KTQA 3M8SA 4CF1A 4RW7A 4DSKA 2D0BA 3I0SA 4CEEA 4DS5A 4PQUA 3RRGA 3V1QA 3VA0A 2BE2A 2YNGA 4KV8A 2NUBA 3U3GA 1YT3A 4RW6A 1WAFA 1U04A 5JS2A 1RTDA 4FYDA 1QSLA 1KRPA 2HHTA 3M8PA 5HRPA 3SV3A 3S3OA 1QSYA 4FZZA 4CERA 5CZ2A 3QINA 1VSHA 3VA3A 2B6AA 1GOAA 3AVLA 3HYFA 1ZBFA 4DFKA 3U6FA 3SQ2A 1LV5A 5DK5A 1D9DA 3K5LA 4YFUA 3NGIA 3I8DA 2X6NA 3VQQA 2W42A 3NFAA 4DS4A 4IG0A 1NJZA 3QLHA 1EXQA 1KFDA 2OPPA 2YKMA 2XHBA 4FJ9A 3AVNA 4FK0A 1I39A 4DF4A 4PA1A 4ELTA 4FLTA 5CYQA 1DLOA 3NH0A 3CFRA 3L2RA 4EZ6A 4E89A 3QEXA 3UIQA 3RWUA 4KO0A 2RN2A 1FXXA 1A5VA 4RW9A 3S9HA 1TAUA 2XY7A 3SCXA 3NF9A 1BGXT 3WNGA 2IDOA 5KGXA 1IG9A 1B92A 3KTQA 4FJKA 4FLUA 4J2DA 1Z25A 1BIZA 3PX4A 3C6UA 3HVRA 3AVBA 1TK0A 4H4OA 4OPJA 4Q5VA 1ASUA 1RBRA 3OS2A 2Y1JA 3TAEA 4KAZA 3V6DA 1Q8IA 3VQ7A 3NBPA 3JSMA 3IS9A 4JLHA 4KPYA 4IFVA 3SUOA 2IC3A 3M8RA 1C1CA 4KTWA 4RG8A 5KI6A 3OJSA 4FJHA 4FJIA 4IKFA 3DM2A 1CXUA 2JGUA 3OY9A 5FROA 1LAVA 2LSNA 3HXMA 2WOMA 3AA4A 2AJQA 5HLFA 2HVHA 3DLBA 1HJRA 1XHXA 2GV9A 2IS3A 1KVBA 3LP1A 3VQBA 3MAQA 1CLQA 1T05A 3OYAA 1S1VA 4NCBA 1TGOA 4QAGA 1WSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D9F A;  3PO4 A;  3O4Q A;  3IAY A;  1GOB A;  3L3U A;  4EZ9 A;  4CK1 A;  4F4K A;  4FJ5 A;  1IKW A;  1XHZ A;  1T03 A;  4B9M A;  4OKE A;  3O3F A;  1ITG A;  1BCO A;  1W0H A;  1KCF A;  3E01 A;  3P1G A;  4OLB A;  4FJX A;  3KK2 A;  1JLF A;  2F8T A;  3V81 A;  3LDS A;  1GOC A;  4TSX A;  4OKJ A;  1HNV A;  4Y1D A;  1ASV A;  2HNZ A;  3IRX A;  3EY1 A;  2X74 A;  4IDK A;  1VSL A;  4KFB A;  4MFB A;  4MQ3 A;  2JLE A;  3WNF A;  4CED A;  3HP9 A;  4CJ4 A;  4Z4H A;  4DTJ A;  2XY6 A;  3QEP A;  4OGC A;  1SKS A;  2OZS A;  4KHN A;  2YHB A;  4OGE A;  2Q3S A;  3LAM A;  4ZTF A;  4CGH A;  1X1P A;  2G8W A;  5HP1 A;  2VG5 A;  1S9E A;  1TKZ A;  3KKR A;  4ID5 A;  2A1R A;  1ZBL A;  1RDA A;  4C8N A;  1ZBU A;  3K2P A;  5EU7 A;  4W5N A;  3TAR A;  2HHW A;  3KLH A;  1ZBH A;  3NF7 A;  3TAP A;  3OYI A;  1CXQ A;  5I42 A;  4BDY A;  1JLA A;  4EP5 A;  4RW8 A;  3OYD A;  3VQE A;  3RMD A;  1BL3 A;  4M3W A;  4FLW A;  1RT1 A;  1RTI A;  5FRN A;  2EX3 A;  3KD5 E;  1NKC A;  4I2Q A;  3JYT A;  3TAQ A;  1S1W A;  1BQM A;  4FCY A;  1Q9X A;  5D3G A;  3V9S A;  1VSJ A;  3CYM A;  2X6S A;  4OLA A;  2ZQB A;  4AHT A;  4CEB A;  1A5W A;  3OS0 A;  2BDP A;  4BE0 A;  1S5J A;  3L2U A;  3SUP A;  1VSF A;  4DWI A;  3DI6 A;  4ICL A;  1RCH A;  1CZB A;  2QXF A;  3OYH A;  1KVA A;  1IKY A;  1B9F A;  3I0R A;  3O3H A;  4Q0B A;  2P51 A;  4DQS A;  2KFZ A;  4F2S A;  4M3X A;  3AVK A;  3SPY A;  4W5Q A;  1RBU A;  3ZSR A;  1HYS A;  1NKE A;  3PUF A;  3OVN A;  2ETJ A;  4CHO A;  1BQN A;  4W5R A;  2PYJ A;  4BAC A;  4CGG A;  4HTU A;  2HHU A;  1LAW A;  3LP0 A;  4Z4F A;  3KLI A;  1KFS A;  4HUE A;  2VG7 A;  3SZ2 A;  3RRH A;  4I7F A;  5J2P A;  1BCM A;  3KK3 A;  3KIO A;  5HRN A;  4OPK A;  4I2P A;  4DTS A;  3DMJ A;  4FJJ A;  4IBN A;  1RDD A;  1QQC A;  1WNS A;  2FBV A;  3RMA A;  2HVI A;  2VWK A;  1JKH A;  4FLV A;  1A5X A;  4W5T A;  2HHQ A;  1I3A A;  3DLR A;  1NJY A;  2OPR A;  4ID1 A;  3ISN C;  1C1B A;  3ZCM A;  1L3V A;  5C42 A;  5J2Q A;  3LPT A;  4GMJ B;  4E3S A;  2Z1J A;  4B8A B;  5HRO A;  4FJG A;  3F73 A;  3AVG A;  2HB5 A;  3F9K A;  4DTM A;  3ZSO A;  3S3N A;  4CFC A;  4O55 A;  2KQ2 A;  4B9U A;  2ZE2 A;  3AVF A;  1L3S A;  4DMN A;  1SV5 A;  4CJS A;  1KTQ A;  3DRP A;  4CFB A;  4K8Z A;  3P83 D;  1TVR A;  3D0P A;  3OYC A;  5JS1 A;  4AHS A;  4HVJ A;  4CHP A;  4UQG A;  4F3O A;  4KTQ A;  3L2W A;  3QEV A;  4IFY A;  4CHY A;  1LWF A;  3V9U A;  1VSM A;  4Y1C A;  4AHV A;  4BDZ A;  4DSL A;  2P5O A;  4O44 A;  3OYM A;  4DQI A;  4F8R A;  4DFM A;  3ZSQ A;  4M3Y A;  4E7J A;  4N41 A;  3NGZ A;  3NAE A;  3KD1 E;  1LW2 A;  4XIU A;  4PWD A;  4DSF A;  4CE9 A;  3C95 A;  4DTX A;  1J53 A;  3T1A A;  3HPO A;  3K58 A;  1S9G A;  1NOY A;  4R5P A;  1TL3 A;  3NH2 A;  3C6T A;  1SKR A;  4FK2 A;  1N5Y A;  3K59 A;  3OYG A;  3H08 A;  2Z1G A;  2B4J A;  1TL1 A;  3DLG A;  1QHT A;  3KLE A;  3TAG A;  4YNQ A;  2RF2 A;  1JXE A;  3B6O A;  4G1Q A;  3RR7 A;  4BE2 A;  4RW4 A;  1IKX A;  2DFH A;  1RT6 A;  4NCG A;  4DLG A;  4N76 A;  5C24 A;  3QNN A;  4KRF A;  4ELV A;  4FLX A;  3SV4 A;  4O5B A;  3T19 A;  3VQP A;  1EX4 A;  3OYE A;  2D5R A;  1RT4 A;  2HNY A;  3HJF A;  4B08 A;  1S1U A;  4EP4 A;  1J9A A;  2FBY A;  3ZSY A;  1L5U A;  3QET A;  3DRS A;  4I9Q A;  1D8Y A;  4CEZ A;  4QCL A;  4FLY A;  4M45 A;  4DF8 A;  1W9H A;  3ULD A;  3T3F A;  1Z26 A;  3DYA A;  1C0M A;  2I5J A;  3O3G A;  3L2V A;  3ZT4 A;  2VWJ A;  1L3T A;  5C25 A;  3KLG A;  4FZY A;  1J5O A;  3IG1 A;  1XI1 A;  3AVA A;  3A2F A;  3V1O A;  3DOL A;  1QE1 A;  4KHS A;  4B9T A;  3AVH A;  3ZSW A;  3NDK A;  1JL1 A;  2XY8 A;  3AVI A;  5KTQ A;  4KKO A;  3NH1 A;  4CEF A;  3U3Y A;  1NK6 A;  2G8V A;  3WNH A;  4CIF A;  4PUO A;  4FM2 A;  4OKK A;  1HYZ A;  4NYF A;  1U47 A;  2HHX A;  3TAN A;  3NGY A;  4DTO A;  5CYM A;  4CK3 A;  3VQ9 A;  4Z4C A;  3AA5 X;  1FKP A;  4Z0U A;  2ZD1 A;  3ZSZ A;  4NCA A;  1XC9 A;  4FJ8 A;  1RTH A;  1U49 A;  1J54 A;  2KZM A;  2FC0 A;  3SQ0 A;  4B9S A;  4DSJ A;  3MXJ A;  4HUF A;  4FVM A;  1SL2 A;  5SZT A;  4CF9 A;  1JLE A;  4HUG A;  1T8E A;  3PO5 A;  4FJN A;  3B6P A;  4CJQ A;  3AVC A;  2G8F A;  3WNE A;  1VSE A;  2DFF A;  4KI4 A;  2DY4 A;  1TKT A;  1NK5 A;  3VQA A;  1RDC A;  2E4L A;  3D45 A;  4M3R A;  4E1M A;  2Z1I A;  3VQC A;  4CF0 A;  4ZTJ A;  1NK4 A;  3QNO A;  1WAJ A;  1WSE A;  4CF8 A;  4DU1 A;  1BI4 A;  1S1X A;  3KK1 A;  4CHN A;  4J2B A;  3HPG A;  1KLN A;  1KLM A;  4LY7 A;  4DQQ A;  3V1R A;  2XRI A;  1FK9 A;  3MEG A;  3NF8 A;  3VQD A;  2FBX A;  2P1J A;  4LD0 A;  4AHU A;  3HK2 A;  4ELU A;  2BAN A;  4E7H A;  2KZZ A;  2YHA A;  3QEI A;  4FW1 A;  1WSH A;  3THV A;  4IG3 A;  4CGJ A;  3ITH A;  4DSE A;  5KGW A;  3CQ8 A;  2Y1I A;  4WE1 A;  1RNH A;  4CEQ A;  1B9D A;  1TKX A;  3KKS A;  4N56 A;  4E7I A;  4CFD A;  3ZT2 A;  1ZYQ A;  1NKB A;  2IOC A;  2D0A A;  2YV0 X;  1RDB A;  4CFA A;  3DOK A;  1RT7 A;  4Z4I A;  4DTU A;  1HRH A;  4KHW A;  1YTU A;  3HPH A;  1RIL A;  4LH5 A;  4CF2 A;  3V9W A;  1Q9Y A;  4DTR A;  1RT5 A;  3LP3 A;  1U4B A;  4M42 A;  3MEC A;  1RTJ A;  3SQ4 A;  2G8I A;  1O1W A;  4CIE A;  4JRQ A;  4KHQ A;  3ALY A;  1NJX A;  4CHZ A;  1R0A A;  1IO2 A;  3AO5 A;  3LZJ A;  4C8O A;  1RBS A;  3CFO A;  1UWB A;  2B5J A;  2YNI A;  3EZ5 A;  1T7P A;  4CEA A;  1BHL A;  3HVT A;  4NYN A;  3KJV A;  3G10 A;  1X9S A;  3QO9 A;  1D5A A;  1IH7 A;  1EP4 A;  3LWL A;  4CJU A;  1BI4 B;  3HL8 A;  5KRT A;  1VSD A;  1DTT A;  3ZT0 A;  3ZSV A;  3CFP A;  1G15 A;  5J2N A;  2HHV A;  1XWL A;  3CM6 A;  3SYZ A;  1X9M A;  3BGR A;  4B9V A;  1VSK A;  3NCI A;  4GW6 A;  4E0D A;  2HHS A;  4DLE A;  2A1S A;  3QIP A;  4OVL A;  1CZ9 A;  2O4G A;  1EKE A;  2GUI A;  4E19 A;  3QES A;  3VQ4 A;  4FK4 A;  3SI6 A;  4DFP A;  1HQE A;  1REV A;  3AO3 A;  4CEO A;  3AVM A;  4CGD A;  4FJM A;  4FM1 A;  2D0C A;  2GBZ A;  2OA8 A;  4L8R B;  3DLE A;  1C1A A;  4KHU A;  4F3T A;  3AO2 A;  1WLJ A;  1K6Y A;  1U48 A;  1UA0 A;  4FJL A;  2ITG A;  3PX0 A;  1S6Q A;  4F2R A;  3G0Z A;  1WSF A;  1YTA A;  3OYL A;  3LWM A;  3CM5 A;  1WSJ A;  1LW0 A;  3TAM A;  1FKO A;  4CJW A;  3AO4 A;  3KLF A;  5I3U A;  2XY5 A;  4M3T A;  3OYN A;  2G8K A;  3MXI A;  1HMV A;  3LAN A;  4DTN A;  1TKD A;  4KHY A;  5FRM A;  4CK2 A;  3QER A;  4BE1 A;  1WSG A;  5HBM A;  4O4G A;  4CEC A;  4DSI A;  4GVM A;  2QKB A;  3MXM A;  1U45 A;  4BWM A;  3EYZ A;  1KSP A;  4HCC A;  2OPQ A;  3RMB A;  1JLG A;  5SWM A;  4J2E A;  1NOZ A;  3LAL A;  1HQU A;  1S6P A;  3SPZ A;  1C0U A;  4CJ3 A;  3O4N A;  1DTQ A;  1MU2 A;  1RT3 A;  2E6L A;  1L3U A;  4KB1 A;  2HW3 A;  3CG7 A;  2DFE A;  3K5N A;  2ATQ A;  3RMC A;  4FZX C;  4B9N A;  3K5O A;  3AO1 A;  1KVC A;  2PY5 A;  3HO1 A;  4B8C A;  1TK5 A;  2BGG A;  4PY5 A;  4LSL A;  3K5M A;  4E1N A;  3DRR A;  4KTZ A;  1NK0 A;  1C6V A;  4C8L A;  2O4I A;  3FFI A;  1VRT A;  1UA1 A;  1UAX A;  1RBV A;  1TV6 A;  4DU4 A;  1JLC A;  4CJK A;  4O0I A;  5J2M A;  3PX6 A;  2IAJ A;  5HRR A;  2HMI A;  1HPZ A;  5CZ1 A;  4KRE A;  4CGF A;  4KI6 A;  5DMR A;  3MED A;  3V9Z A;  3V4I A;  1JL2 A;  3LP2 A;  4JRP A;  1S1T A;  3TI0 A;  1RT2 A;  2PYL A;  3SNN A;  1SUQ A;  4BWJ A;  3V9X A;  4LH4 A;  3LPU A;  1QTM A;  4CHQ A;  3BDP A;  3TR8 A;  2HND A;  3TAF A;  2WON A;  4Z4E A;  4W5O A;  3TWH A;  1SKW A;  1NK7 A;  4KB0 A;  2DTU A;  3HST B;  3NF6 A;  3AA3 A;  3P5J A;  4M41 A;  2XO7 A;  3LZI A;  2QK9 A;  1VSI A;  2RKI A;  3L2Q A;  1NK8 A;  1QSS A;  2F96 A;  4C8K A;  4I9L A;  2FBT A;  4AHC A;  3TAB A;  5CY4 A;  1JXB A;  4E7L A;  1QS4 A;  4C8M A;  2R7Y A;  4OJR A;  4FM0 A;  2E6M A;  2YNF A;  5T7B A;  3HM9 A;  5FDL A;  1NK9 A;  5K14 A;  4JS5 A;  1IKV A;  2Z1H A;  4H4M A;  4DTP A;  3RR8 A;  3ZT3 A;  4H8K A;  3AVJ A;  3ASM A;  2RPI A;  2OYQ A;  4JS4 A;  4BDP A;  4AIL C;  1VK0 A;  3OJU A;  5HRS A;  3HP6 A;  4FLZ A;  1TK8 A;  1ZBI A;  2KFN A;  2VG6 A;  2G8U A;  2QKK A;  3MEE A;  5E41 A;  2X78 A;  4DQP A;  4B9L A;  3SJJ A;  4FXD A;  2YNH A;  1VRU A;  1NJW A;  3PV8 A;  4AH9 A;  3RTV A;  3ZT1 A;  3LAK A;  2OZM A;  3DLK A;  4CJE A;  4CIG A;  2P5G A;  3AV9 A;  4O0J A;  4CJV A;  3NHG A;  3VQ8 A;  3SUN A;  4CES A;  3OYF A;  1TAQ A;  2F8S A;  4HHT A;  1LWE A;  4N5S A;  1YVU A;  1HYV A;  5J1E A;  1JLB A;  1BIS A;  3AA2 A;  2OPS A;  1HNI A;  4CJL A;  4J2A A;  2YKN A;  3SUQ A;  4M3U A;  2IGI A;  4CJF A;  3ZSX A;  3M8Q A;  1WN7 A;  3VQ5 A;  4K8X A;  3HT3 A;  1JLQ A;  3C94 A;  3OYJ A;  3K57 A;  4E7K A;  4M3Z A;  1Y97 A;  3VN5 A;  1N6Q A;  3SQ1 A;  1SL0 A;  1SL1 A;  4FW2 A;  4B3O A;  4CGI A;  3OS1 A;  4HCB A;  2PZS A;  3PY8 A;  4DQR A;  5KRS A;  3NE6 A;  4CJT A;  4DU3 A;  4CJ5 A;  1X9W A;  1ASW A;  1UOC A;  1RBT A;  2KW4 A;  1LWC A;  4DG1 A;  3DLH A;  3L8B A;  2EHG A;  1C0T A;  1BIU A;  3OYB A;  4LSN A;  3VQ6 A;  4DFJ A;  3OYK A;  4Z4G A;  3S3M A;  4QOZ B;  1F21 A;  4CJR A;  3QEW A;  3L3V A;  4N47 A;  3QIO A;  4ZHR A;  2G8H A;  4FJ7 A;  1EET A;  4AHR A;  4CJP A;  4CCH A;  2KTQ A;  3M8S A;  4CF1 A;  4RW7 A;  4DSK A;  2D0B A;  3I0S A;  4CEE A;  4DS5 A;  4PQU A;  3RRG A;  3V1Q A;  3VA0 A;  2BE2 A;  2YNG A;  4KV8 A;  2NUB A;  3U3G A;  1YT3 A;  4RW6 A;  1WAF A;  1U04 A;  5JS2 A;  1RTD A;  4FYD A;  1QSL A;  1KRP A;  2HHT A;  3M8P A;  5HRP A;  3SV3 A;  3S3O A;  1QSY A;  4FZZ A;  4CER A;  5CZ2 A;  3QIN A;  1VSH A;  3VA3 A;  2B6A A;  1GOA A;  3AVL A;  3HYF A;  1ZBF A;  4DFK A;  3U6F A;  3SQ2 A;  1LV5 A;  5DK5 A;  1D9D A;  3K5L A;  4YFU A;  3NGI A;  3I8D A;  2X6N A;  3VQQ A;  2W42 A;  3NFA A;  4DS4 A;  4IG0 A;  1NJZ A;  3QLH A;  1EXQ A;  1KFD A;  2OPP A;  2YKM A;  2XHB A;  4FJ9 A;  3AVN A;  4FK0 A;  1I39 A;  4DF4 A;  4PA1 A;  4ELT A;  4FLT A;  5CYQ A;  1DLO A;  3NH0 A;  3CFR A;  3L2R A;  4EZ6 A;  4E89 A;  3QEX A;  3UIQ A;  3RWU A;  4KO0 A;  2RN2 A;  1FXX A;  1A5V A;  4RW9 A;  3S9H A;  1TAU A;  2XY7 A;  3SCX A;  3NF9 A;  1BGX T;  3WNG A;  2IDO A;  5KGX A;  1IG9 A;  1B92 A;  3KTQ A;  4FJK A;  4FLU A;  4J2D A;  1Z25 A;  1BIZ A;  3PX4 A;  3C6U A;  3HVR A;  3AVB A;  1TK0 A;  4H4O A;  4OPJ A;  4Q5V A;  1ASU A;  1RBR A;  3OS2 A;  2Y1J A;  3TAE A;  4KAZ A;  3V6D A;  1Q8I A;  3VQ7 A;  3NBP A;  3JSM A;  3IS9 A;  4JLH A;  4KPY A;  4IFV A;  3SUO A;  2IC3 A;  3M8R A;  1C1C A;  4KTW A;  4RG8 A;  5KI6 A;  3OJS A;  4FJH A;  4FJI A;  4IKF A;  3DM2 A;  1CXU A;  2JGU A;  3OY9 A;  5FRO A;  1LAV A;  2LSN A;  3HXM A;  2WOM A;  3AA4 A;  2AJQ A;  5HLF A;  2HVH A;  3DLB A;  1HJR A;  1XHX A;  2GV9 A;  2IS3 A;  1KVB A;  3LP1 A;  3VQB A;  3MAQ A;  1CLQ A;  1T05 A;  3OYA A;  1S1V A;  4NCB A;  1TGO A;  4QAG A;  1WSI A; 
#chains in the Genus database with same CATH topology
 4C1N I;  2OTL N;  3O4Q A;  3IAY A;  1GOB A;  1XNQ K;  2WBN A;  3O3F A;  4DR3 K;  1W0H A;  3P1G A;  1JLF A;  4CED A;  1VSL A;  4IZ9 A;  1IG9 A;  4OGC A;  3A0I X;  2YHW A;  4CZG A;  5TKY A;  4BRK A;  2UXB K;  4BRH A;  1HUX A;  5HP1 A;  1S9E A;  5BPN A;  2A1R A;  4C8N A;  3WQU A;  3VGL A;  4AM7 A;  3CCV N;  1ZBH A;  3EO3 A;  3OYI A;  4EP5 A;  4RW8 A;  3OYD A;  1NM1 A;  3BF3 A;  3KD5 E;  4WQ5 A;  5BRH A;  2O8D A;  2HBJ A;  4FCY A;  1Q9X A;  4IJN A;  4CEB A;  4WQ4 A;  1S5J A;  4BE0 A;  4B3T K;  2FF3 B;  1RCH A;  3OYH A;  1B9F A;  3OA9 A;  4F2S A;  2W6K A;  3VEW A;  1RBU A;  5AQK A;  1HYS A;  1T44 A;  3OVN A;  4W5R A;  1N8R O;  4CGG A;  3L6Q A;  2HHU A;  3LP0 A;  4Z4F A;  3H1V X;  5J2P A;  3O9U A;  3KK3 A;  3KIO A;  5HRN A;  1VQ7 N;  3DMJ A;  3ATU A;  3RMA A;  4FLV A;  4JYA K;  1Q18 A;  1A5X A;  1NJY A;  1C1B A;  5AFU H;  1K8K A;  3LPT A;  2ASP A;  5GAD P;  3F73 A;  2HB5 A;  1HKG A;  3F9K A;  3T1H K;  4B9U A;  2ZE2 A;  1BG3 A;  3AVF A;  4YDU C;  1BA0 A;  5EXW A;  4DMN A;  1SV5 A;  4MO5 A;  3VEZ A;  3OYC A;  4F3O A;  5GAE P;  4CHY A;  3ENH A;  4MO4 A;  2DPN A;  1VSM A;  4DSL A;  2P5O A;  4O44 A;  3OYM A;  3LDO A;  4M3Y A;  1NGC A;  3NGZ A;  3G71 N;  1LW2 A;  4DSF A;  2Q0U A;  1J53 A;  5M1N A;  2P9L A;  4Z94 A;  2NRR A;  1IBM K;  2Z1G A;  2B4J A;  3TAG A;  1QHT A;  2RF2 A;  4JEP A;  5JVG L;  4BE2 A;  4NCG A;  1GLD G;  3QNN A;  3AAQ A;  1G99 A;  3VQP A;  2GUP A;  2D5R A;  3CJ1 A;  4EP4 A;  4IO9 L;  2V52 B;  4FLY A;  4YOT A;  4DF8 A;  4XH5 A;  4DCH A;  1C0M A;  1L3T A;  3CCJ N;  3CCL N;  3SAH A;  1XI1 A;  4K42 A;  1Q81 O;  4KHS A;  4CZK A;  4CZI A;  3C7N A;  4KKO A;  4CEF A;  3RSE A;  4PUO A;  4FM2 A;  1YJN N;  3NGY A;  3KWG A;  4DHY A;  4CK3 A;  1FKP A;  4FJ8 A;  3ZSZ A;  4NCA A;  4JI7 K;  2E2O A;  4DSJ A;  2BH1 A;  5LJV A;  1KC8 O;  2QEX N;  3MXJ A;  3CCU N;  4HUF A;  4FVM A;  5SZT A;  1JLE A;  4FO0 A;  1BOT O;  4CJQ A;  1VSE A;  4KI4 A;  2FXU A;  3LL3 A;  5AQU A;  4BRP A;  5M1F A;  1NK5 A;  1RDC A;  3LDN A;  4E1M A;  4BG9 A;  2O8C B;  2Z1I A;  3VQC A;  4ZTJ A;  5AQR A;  1X3N A;  1WAJ A;  4X66 K;  3THX A;  1S1X A;  4JKH A;  2XRI A;  2D1K A;  2F4V K;  3VQD A;  1HNZ K;  2NRT A;  4FWS A;  3QEI A;  1WSH A;  4IG3 A;  5KGW A;  1GLF O;  3CQ8 A;  1Q82 O;  4K8Z A;  2PBD A;  1TKX A;  4M7Y A;  4N56 A;  4LFA K;  1QZ6 A;  3ZET A;  3CET A;  4KHW A;  1YTU A;  1SAZ A;  3HPH A;  3V9W A;  1Q9Y A;  1RT5 A;  1ATN A;  1CZA N;  1RTJ A;  4CIE A;  4JRQ A;  4KHQ A;  4QS9 A;  3OHR A;  1VQ8 N;  3BY5 A;  3F9M A;  1RBS A;  1TYQ A;  1T7P A;  1BHL A;  1D5A A;  3LWL A;  4JKF A;  1BI4 B;  3HL8 A;  3ZT0 A;  3GL1 A;  3CFP A;  1XWL A;  3CJC A;  2GEM A;  1X9M A;  3E1Y A;  4GW6 A;  3NCI A;  4E0D A;  3QIP A;  3LDQ A;  3G4S N;  1EKE A;  1P90 A;  3KK7 A;  4FK4 A;  4DFP A;  1HQE A;  3FE1 A;  4GKK K;  3AO3 A;  4KHU A;  4FJM A;  2D0C A;  5AQG A;  2OA8 A;  3DLE A;  3O08 A;  4F3T A;  4AF1 A;  3T1Y K;  1NU0 A;  4FJL A;  3A5O C;  3G0Z A;  3LWM A;  3CM5 A;  4BR2 A;  1WSJ A;  5I3U A;  3KLF A;  5LJW A;  2G8K A;  4DR4 K;  1C0F A;  3AY9 A;  4CK2 A;  1HLU A;  1WSG A;  4JK8 A;  4CEC A;  4DSI A;  3CJ7 A;  1E4F T;  4BWM A;  3OW2 M;  1NGE A;  4NXN K;  4HCC A;  2OPQ A;  4JI2 K;  4J2E A;  3SPZ A;  3O4N A;  1MU2 A;  4C23 A;  4FWN A;  4KB1 A;  2P9K A;  3CG7 A;  2DFE A;  2WC9 A;  2PY5 A;  5F1X A;  4H0O A;  4PY5 A;  4E1N A;  3TTC A;  1UA1 A;  3HOS A;  3M5R A;  2UUC K;  3CC2 N;  1TV6 A;  1E4G T;  4O0I A;  3PX6 A;  1HPZ A;  3O9T A;  3H6E A;  4KI6 A;  1ATR A;  2QTD A;  3MED A;  3V9Z A;  3V4I A;  1J6Z A;  3GOI A;  3SNN A;  1SUQ A;  1C0G A;  4JKE A;  1JCE A;  2A42 A;  3LPU A;  2JWL A;  1YJW N;  1QTM A;  3VGK A;  1N36 K;  2WON A;  4W5O A;  3C65 A;  3K0S A;  1SKW A;  2DTU A;  4C1N K;  3HST B;  3J8A A;  3PSI A;  3MMV A;  1VSI A;  2RKI A;  3HRG A;  3VET A;  4OJR A;  4GKJ K;  3L4Q A;  3WEE A;  1NK9 A;  1IKV A;  2Z1H A;  4DTP A;  3RR8 A;  3CJA A;  4H8K A;  2GTD A;  3AVJ A;  1OVQ A;  3ASM A;  4BVO A;  4BDP A;  3JS6 A;  2KFN A;  1D4X A;  5HRS A;  3HP6 A;  3ULE A;  3C7N B;  3QBX A;  2X78 A;  4B9L A;  3SJJ A;  2YNH A;  4EHU A;  3PV8 A;  3ZT1 A;  1U6Z A;  3LAK A;  3DLK A;  2A41 A;  4CIG A;  1ZC6 A;  4O0J A;  4BR4 A;  4YDU A;  1HKC A;  1BIS A;  2UYT A;  1W2B M;  3R9P A;  2JWK A;  1KAZ A;  3JXU A;  1WN7 A;  3VQ5 A;  1GLL O;  3K57 A;  2ZJP L;  4M3Z A;  3SQ1 A;  1SL0 A;  4FW2 A;  4DQR A;  1ASW A;  2KW4 A;  3DLH A;  4A2A A;  4EAH D;  3R1X A;  3OYB A;  3VQ6 A;  2NRV A;  3ZEU A;  4I6M B;  1EET A;  3FZF A;  4CJP A;  2P9U B;  4CF1 A;  1JJ2 M;  2W40 A;  2D0B A;  4DS5 A;  1OH6 A;  2VWB A;  3WUH A;  4YOV A;  3RRG A;  2YNG A;  4LFC K;  2NUB A;  3U3G A;  1U04 A;  5JS2 A;  4FYD A;  1K8A O;  3GG4 A;  5HRP A;  3SV3 A;  1V4T A;  2BTF A;  4DFK A;  3U6F A;  4BC4 A;  1OVY A;  3I8D A;  3A5M C;  1S22 A;  3QLH A;  1EXQ A;  4FK0 A;  3H1Q A;  4EZ6 A;  4PL8 A;  1DLO A;  3L2R A;  4GVE A;  4WYB A;  1TAU A;  3S9H A;  1YXQ A;  3SCX A;  2YCH A;  3WT0 A;  4FLU A;  1U2V A;  1LCU A;  3C6U A;  3HVR A;  1BUP A;  3H45 C;  4KAZ A;  2Y1J A;  3V6D A;  3NBP A;  4CVN E;  1NMD A;  4JKA A;  3UE5 A;  5AQZ A;  1WOQ A;  5GIO A;  4IFV A;  4FWM A;  4KTW A;  4M7X A;  4RG8 A;  3D6R A;  4FJH A;  2I7N A;  3DM2 A;  1CXU A;  2UXD K;  5FRO A;  1LAV A;  2LSN A;  5HLF A;  2HVH A;  3DLB A;  1HJR A;  5B8H A;  2IIR A;  1CLQ A;  4OPH A;  1S1V A;  3OYA A;  4JNE A;  1WSI A;  3VEV A;  3SMS A;  4EZ9 A;  4BRQ A;  1IKW A;  1XHZ A;  3J7Z O;  1T03 A;  2OTJ N;  4NLB A;  4Y0W A;  1BCO A;  1KCF A;  4G9Z A;  3K9K A;  3R3L A;  3KK2 A;  3LDS A;  1NWK A;  3G25 A;  1VQ9 N;  4JK9 A;  3O1W A;  3WNF A;  2JLE A;  2XY6 A;  3HP9 A;  1SKS A;  2OZS A;  1XQS C;  5AQP A;  4ZTF A;  4DR7 K;  2G8W A;  2IVP A;  1ZBL A;  1RDA A;  3K2P A;  4H5T A;  2HHW A;  3HBT A;  5I42 A;  5BN9 A;  2HHH K;  5FRN A;  1RT1 A;  1NKC A;  4I2Q A;  1WUA A;  3FZM A;  1S1W A;  4JK7 A;  4H5W A;  3CYM A;  3BP8 A;  3WXJ A;  4OLA A;  3L2U A;  4O8K A;  2VQF K;  3SUP A;  4DWI A;  2ZGZ A;  1CZB A;  1QQO A;  3WEE B;  1IKY A;  3O3H A;  1WBB A;  4DQS A;  1VQM N;  4CZF A;  4W5Q A;  4DV7 K;  1VQ4 N;  4GNI A;  2ETJ A;  2PYJ A;  4BAC A;  4HTU A;  4BR7 A;  4XH4 A;  3KLI A;  1KFS A;  3SZ2 A;  1BCM A;  4OPK A;  4I2P A;  4FJJ A;  2V51 B;  1VAZ A;  1QQC A;  3O9R A;  4IBN A;  1JKH A;  4W5T A;  2HHQ A;  2OPR A;  3ISN C;  2O8F B;  3ZCM A;  4R79 A;  1ZBS A;  5KQD A;  1QZ5 A;  2Z1J A;  2UUB K;  3F2K A;  4DTM A;  5BRD A;  4FL9 A;  2KQ2 A;  4DV4 K;  1ATS A;  1L3S A;  2HBM A;  3DRP A;  3E9O A;  1NJI O;  4YHH K;  4UQG A;  3L2W A;  3QEV A;  3T7Z A;  4Y1C A;  4IOX A;  4AHV A;  4DQI A;  3ZSQ A;  4B1U B;  4E7J A;  4N41 A;  3NAE A;  3KD1 E;  4PWD A;  3WXM B;  3NVM A;  3T1A A;  4B1X B;  1NOY A;  1S9G A;  2O8E B;  3CQY A;  4CD3 A;  3P4I A;  5GAG P;  4CD1 A;  3H08 A;  1HNW K;  2YX6 A;  3KLE A;  3RR7 A;  4G1Q A;  1FW6 A;  1T3V A;  1IKX A;  4N76 A;  2P9N B;  4CZM A;  4FLX A;  4ELV A;  2NRX A;  3T19 A;  3DJC A;  3OYE A;  3BZC A;  4B08 A;  5AQI A;  2FBY A;  5C2D A;  3QET A;  3DRS A;  1D8Y A;  4QCL A;  4M45 A;  3MN7 A;  3ULD A;  2O8C A;  1Z26 A;  1YAG A;  2VWJ A;  4GV6 A;  2BUP A;  4ISF A;  4JKC A;  2E1Z A;  1J5O A;  5HOO A;  3AVA A;  3SK3 A;  3V1O A;  4B9T A;  3AVI A;  3NH1 A;  4H0X B;  3OBW A;  1NK6 A;  3AGR A;  5MLC Q;  4OKK A;  1HYZ A;  4CW7 B;  1U2V B;  3O80 A;  2HHX A;  4H5R A;  3EZW A;  1J5E K;  3CCR N;  4Z4C A;  3FGU A;  4H5N A;  2FC0 A;  3SQ0 A;  4B9S A;  2YHX A;  3DXM B;  1IG8 A;  4CF9 A;  4FJN A;  2VQE K;  3WNE A;  2DY4 A;  1OH5 A;  3VQA A;  1KXP A;  4JD2 B;  4M3R A;  2FSK A;  5M1O A;  4DU1 A;  1BI4 A;  4CHN A;  3HPG A;  1KLN A;  1KLM A;  1MDU B;  2WTU A;  2UU9 K;  2P1J A;  4AHU A;  4ELU A;  2Q97 A;  3KVG A;  4FW1 A;  3THV A;  4WFB L;  4JI5 K;  4CEQ A;  1RNH A;  5AQJ A;  1ZYQ A;  1HPM A;  3ZT2 A;  1NKB A;  2IOC A;  5GAH P;  4DTU A;  1HRH A;  1RIL A;  4LH5 A;  4DTR A;  3LP3 A;  4LF9 K;  1R0A A;  3WXK A;  4NO7 A;  2B5J A;  5AZI B;  1VHX A;  3KJV A;  3G10 A;  3QO9 A;  4CJU A;  5KRT A;  3MCP A;  1DTT A;  5J2N A;  3CM6 A;  1VSK A;  4DLE A;  2A1S A;  3CXC M;  2ASM A;  2O4G A;  4JI1 K;  3SI6 A;  1H1V A;  3O5B A;  1S3X A;  3MX2 A;  1REV A;  3AVM A;  2GBZ A;  5F2R A;  4YY3 K;  1UA0 A;  3VOV A;  3PX0 A;  4IJA A;  1S6Q A;  2Q1N A;  1WSF A;  3SAG A;  3KWI A;  1NNE A;  2XY5 A;  4PL7 A;  3MWT A;  1TKD A;  4DTN A;  3CIP A;  5FRM A;  4OPA A;  5HBM A;  4NLC A;  2Q31 A;  4GVM A;  2QKB A;  3MXM A;  4E1J A;  2HMP A;  3EYZ A;  1MWM A;  3LAL A;  1S6P A;  4WFA L;  1C0U A;  4CJ3 A;  3J81 O;  2E6L A;  4BGA A;  4KH6 A;  2FSN A;  1SZ2 A;  4DR1 K;  1TK5 A;  4HTL A;  4LSL A;  1Z05 A;  3MCA B;  2W41 A;  1VRT A;  1UAX A;  4MLH A;  4DU4 A;  4CJK A;  5J2M A;  2IAJ A;  4WCE L;  1Q86 O;  1GLE G;  1JL2 A;  2FLO A;  4JKG B;  1VQL N;  3THY B;  1RT2 A;  3VF4 A;  2I7P A;  3V9X A;  4LH4 A;  1YHQ N;  2HND A;  3TAF A;  3TWH A;  1QQM A;  3P5J A;  3LZI A;  5FLX O;  1VQ5 N;  2F96 A;  4I9L A;  3AAP A;  3RVC A;  5CY4 A;  4JI8 K;  3IUC A;  4F9O A;  4E7L A;  2ZJQ L;  2R7Y A;  2QWO A;  3HM9 A;  4IOC L;  4H4M A;  3ZT3 A;  3DXK B;  2RPI A;  1I94 K;  3UKR B;  2OYQ A;  4DV2 K;  3E66 A;  4A62 A;  1TK8 A;  2QKK A;  2YHY A;  4AH9 A;  3RTV A;  3CCQ N;  4I6M A;  4RWT A;  1IJJ A;  1BDG A;  2P5G A;  2P9U A;  3OYF A;  1TAQ A;  2IVO A;  1LWE A;  4N5S A;  1YVU A;  5J1E A;  1JLB A;  2ITM A;  4BRO A;  5F0X A;  4M3U A;  2GWK A;  3M8Q A;  1NGJ A;  4A57 A;  4E7K A;  1ZXO A;  3H3O B;  4K41 A;  4CGI A;  4B3O A;  3OS1 A;  4HCB A;  3PY8 A;  3NE6 A;  4CJT A;  4DG1 A;  1RBT A;  1LWC A;  3UB5 A;  5DM7 L;  2EHG A;  1C0T A;  1NG9 A;  4CBW A;  4H0P A;  4QOZ B;  3I33 A;  4JI6 K;  5BR8 K;  4ZHR A;  3CCM N;  4JAX A;  4CCH A;  2KTQ A;  3TU5 A;  3W0L A;  4U7B A;  3AGK A;  3R6M A;  2E2P A;  3DAW A;  3V1Q A;  2BE2 A;  3IMX A;  4KV8 A;  3LM2 A;  1HX1 A;  1DEJ A;  1RTD A;  5JVH L;  1QSL A;  3M8P A;  3S3O A;  4FZZ A;  2OAN A;  5CZ2 A;  1W97 L;  5AQY A;  3CD6 N;  1ZBF A;  2HBL A;  3HTV A;  3VQQ A;  1VQP N;  4IG0 A;  3MN9 A;  3TSU A;  4YOR A;  5BR9 A;  3VES A;  3AVN A;  4RTF D;  4PA1 A;  4ELT A;  4KO0 A;  3MDQ A;  1RFQ A;  5AQN A;  4BRI A;  2IDO A;  4DR5 K;  1BIZ A;  4Q5V A;  3TAE A;  3FLC O;  1Q8I A;  3VQ7 A;  4JLH A;  4CI6 A;  3SUO A;  2IC3 A;  1C1C A;  2QXL A;  3OJS A;  4IKF A;  4FWR A;  3OY9 A;  2WOM A;  2AJQ A;  1JCF A;  1HKB A;  3LP1 A;  4BG8 A;  2P9S B;  3CER A;  1T05 A;  4BRM A;  1D9F A;  3L3U A;  4CK1 A;  4FJ5 A;  3JAM O;  1EWR A;  4OKE A;  5IWA K;  3CJB A;  5H1S Q;  3C0B A;  3E01 A;  2F8T A;  4OLB A;  1GOC A;  3Q7B A;  1ASV A;  3IRX A;  3EY1 A;  5IT9 O;  2X74 A;  4CJ4 A;  4Z4H A;  4MQ3 A;  3D2F B;  4KHN A;  2YHB A;  1NBW A;  3CI5 A;  2HF3 A;  4OGE A;  3SLC A;  2Q3S A;  5BRF A;  4CGH A;  2D0O A;  1TKZ A;  3KKR A;  4ID5 A;  2RHK A;  1KD1 O;  1ZBU A;  3WQT A;  3TAR A;  3KLH A;  4JI0 K;  3E9L A;  3NF7 A;  4FWL A;  2ASO A;  4BDY A;  3RMD A;  3VQE A;  1BL3 A;  2O8F A;  2EX3 A;  4BY9 C;  1ESV A;  3JYT A;  3TAQ A;  1BQM A;  3UKU B;  5D3G A;  2X6S A;  5JMV A;  2ZQB A;  4IEE A;  4CZL A;  2BDP A;  3OS0 A;  2ZM6 K;  2CH5 A;  4LF7 K;  3U8X A;  4ICL A;  4FPA A;  1XUP O;  3I0R A;  4Q0B A;  1VQO N;  4M3X A;  2GX9 A;  2CGL A;  3WXI A;  3SPY A;  3ZSR A;  3QML A;  4A5A A;  1NKE A;  3HI0 A;  4B9Q A;  4B3R K;  3QBW A;  3M3Z A;  5I9E B;  5E84 A;  4BR9 A;  3ZLJ A;  1VQK N;  3N4P A;  3MX5 A;  2FBV A;  1WNS A;  4LC9 B;  4DUY K;  2HVI A;  2O8E A;  1I3A A;  3U4L A;  3SBT A;  1L3V A;  3MN5 A;  5C42 A;  4GMJ B;  1TUY A;  2QWM A;  4B8A B;  5HRO A;  3TSP A;  2P9N A;  3AVG A;  4FSV A;  3ZSO A;  4CFC A;  4O55 A;  3C6A A;  3E9P A;  1KTQ A;  4CFB A;  3P83 D;  5JS1 A;  3D0P A;  4CHP A;  4ILG B;  3W3D A;  4KTQ A;  4F8R A;  3ENB A;  4B3S K;  3O1B A;  4JHD A;  2HF4 A;  4CE9 A;  4DTX A;  2OCE A;  3K58 A;  4FK2 A;  4M3W A;  3NH2 A;  1SKR A;  4BC5 A;  1K73 O;  1JCG A;  2QWQ A;  2QWN A;  1TL1 A;  3ZX0 A;  1JXE A;  3B6O A;  4CBX A;  5AQF A;  2DFH A;  1RT6 A;  5C24 A;  3SV4 A;  3DXM A;  1EX4 A;  1RT4 A;  2HNY A;  1J9A A;  3ZSY A;  4I9Q A;  4CEZ A;  4JD2 A;  3G6E N;  4KH4 A;  4DR2 K;  3T3F A;  5EOY A;  3L2V A;  3ZT4 A;  4FZY A;  1SQK A;  3IG1 A;  1N32 K;  1DGK N;  3ZSW A;  1JL1 A;  2XY8 A;  5KTQ A;  2E1Y A;  2G8V A;  4CIF A;  3CCE N;  4K0K K;  4PHT X;  4JN4 A;  3I8B A;  4NYF A;  1U47 A;  2NRW A;  5CYM A;  2A3Z A;  4DTO A;  2NRZ A;  5E26 A;  2ZD1 A;  3HSC A;  1HNX K;  1U49 A;  1J54 A;  3L4I A;  5AQH A;  1OH8 A;  1M90 O;  4WFN L;  4PKI A;  4PKH A;  1T8E A;  3B6P A;  3CPW M;  2G8F A;  1TKT A;  5AZI A;  2P9P B;  4DV6 K;  3D45 A;  1YIJ N;  4CF0 A;  3QNO A;  4CF8 A;  3O4W A;  3KK1 A;  4J2B A;  1XC3 A;  4DV5 K;  4LY7 A;  3V1R A;  3IDH A;  3MEG A;  4LD0 A;  2YI1 A;  4LF4 K;  2A5X A;  4E7H A;  4YOY A;  2F9W A;  3CC7 N;  3L0Q A;  4CGJ A;  3H46 O;  1NGF A;  4K25 A;  4E7I A;  4B3M K;  2D0A A;  3O9Q A;  4CFA A;  3DOK A;  4Z4I A;  4XH1 A;  4O8U A;  4K43 A;  1U4B A;  3QIC A;  4M42 A;  5LMN K;  3MEC A;  3SQ4 A;  3U9D A;  1O1W A;  5EY4 A;  3ALY A;  3AO5 A;  3LZJ A;  4C8O A;  2O8B B;  3CFO A;  1UWB A;  2P9I B;  4B1W B;  4EFH A;  4CEA A;  3HVT A;  3EL2 A;  2J4R A;  4FOI A;  5AQW A;  4A2B A;  2F9T A;  4UY8 O;  5TKW A;  3ZSV A;  2HHV A;  1DT9 A;  5HL7 L;  3SYZ A;  3BGR A;  4IDH A;  4O5F A;  2HHS A;  5C12 A;  3QDK A;  2GUI A;  3QES A;  4BQL A;  5A2Q O;  4FM1 A;  1C1A A;  4KHP K;  3AO2 A;  5BN8 A;  4F2R A;  1YTA A;  3OYL A;  3TAM A;  1LW0 A;  4CJW A;  1FKO A;  3AO4 A;  3P31 A;  1HMV A;  5AZJ B;  1BU6 O;  3LAN A;  3WXL A;  4BR5 A;  1NGI A;  1P8Z A;  1WB9 A;  4KHY A;  1YUW A;  4BE1 A;  3EE9 A;  4O4G A;  4JKG A;  3THY A;  2A6A A;  2E8A A;  3ID6 A;  5SWM A;  1NOZ A;  5AQQ A;  1HQU A;  3TTF A;  1N34 K;  1DTQ A;  2HW3 A;  2ZWH A;  2ATQ A;  3K5N A;  3RMC A;  4FZX C;  3SBG A;  3K5O A;  3AO1 A;  3K9J A;  5EVZ A;  3K5M A;  3DRR A;  4X62 K;  4CZH A;  1C6V A;  4XEI A;  4C8L A;  3NMU A;  4BC2 A;  3FFI A;  2VGN A;  1RBV A;  3DXK A;  1JLC A;  5GIN A;  3UKR A;  4JHD B;  3D2E B;  4FPB A;  5CZ1 A;  5AQT A;  4CGF A;  4H0Y B;  5DMR A;  2UUA K;  4KBO A;  1S1T A;  3NVK A;  2KLA A;  3P38 A;  1QQN A;  3TSQ A;  3M6G A;  4Z4E A;  4GV3 A;  2E2Q A;  2GEL A;  1NK7 A;  4KB0 A;  2QWR A;  3AA3 A;  5LMU K;  1NK8 A;  4C8K A;  4AHC A;  2D4W A;  5C15 A;  4A59 A;  2FF6 A;  3I56 N;  2NRH A;  2E5L K;  3BZK A;  2E6M A;  2YNF A;  5T7B A;  1Z6R A;  5K14 A;  1V4S A;  4YOW A;  4NXM K;  2QWL A;  1VK0 A;  3OJU A;  4AIL C;  4FLZ A;  4X65 K;  3MEE A;  2HST A;  3GE1 A;  1NJW A;  4JV5 K;  3CF5 L;  1Y64 A;  2H3G X;  2YJE A;  2F8S A;  1MA9 B;  3TTD A;  1HYV A;  5FPD A;  3QB0 A;  4J2A A;  2OPS A;  1HNI A;  4CJL A;  1NLV A;  4BRD A;  3SUQ A;  3VEX A;  3EEQ A;  4CJF A;  3ZSX A;  3OYJ A;  4BC3 A;  4L3Q A;  3DWL A;  1DKG D;  3ZYY X;  1Y97 A;  5FPM A;  4YOU A;  4BGB A;  1SL1 A;  2PZS A;  1VQN N;  4DU3 A;  4CJ5 A;  5DM6 L;  3L8B A;  1T6D A;  4DFJ A;  3OYK A;  4Z4G A;  3S3M A;  1T6C A;  4CJR A;  4QS8 A;  3QEW A;  4N47 A;  2VGM A;  3PIP L;  2G8H A;  3R8E A;  4FJ7 A;  4AHR A;  3M8S A;  4RW7 A;  5JIC A;  3FZH A;  3CJ9 A;  3I0S A;  3OBY A;  4PQU A;  5ADX H;  1YT3 A;  1WAF A;  1KRP A;  2HHT A;  4BRE A;  3QIN A;  5AQM A;  1GOA A;  3AVL A;  3HYF A;  3SQ2 A;  1LV5 A;  5DK5 A;  1D9D A;  3NGI A;  1XMO K;  3SMP A;  3I55 N;  1NJZ A;  2P9S A;  3M1F A;  1KFD A;  2OPP A;  2ZF5 O;  2XHB A;  4FJ9 A;  1I39 A;  5AQV A;  4FLT A;  3QFU A;  3UIQ A;  2RN2 A;  4IWV A;  1A5V A;  2W6L A;  4CZJ A;  1BGX T;  3WNG A;  5AQL A;  4AM6 A;  1B92 A;  2PFU A;  3A5N C;  4J2D A;  1Z25 A;  5AR0 A;  3AVB A;  4CZE A;  1TK0 A;  4OPJ A;  1YVN A;  3F5T A;  1ASU A;  1RBR A;  3D2F A;  3FZK A;  4PKG A;  1YF5 L;  5AQS A;  3IS9 A;  3SAF A;  4KPY A;  4MDB A;  4DV1 K;  3M8R A;  4JI3 K;  4FJI A;  3HXM A;  1MWK A;  4FWP A;  1NGG A;  3AA4 A;  3CPE A;  5EX5 A;  3LDP A;  2AA4 A;  1XHX A;  3T69 A;  3MAQ A;  1NGD A;  2GWJ A;  4QS7 A;  4NCB A;  4OO1 J;  1TGO A;  4QAG A;  3JSM A;  3PO4 A;  4F4K A;  4IO8 A;  4B9M A;  3UKU A;  5AQX A;  1ITG A;  2CGJ A;  3CCS N;  1IV0 A;  2CH6 A;  4FJX A;  3V81 A;  4BRA A;  1VQ6 N;  4TSX A;  4OKJ A;  4BRN A;  1HNV A;  4Y1D A;  3THW B;  2HNZ A;  4IDK A;  4KFB A;  4MFB A;  3VPZ A;  4DTJ A;  3QEP A;  1BWF O;  2NNW A;  1NMN A;  3LAM A;  1M1K O;  3VTI A;  2Q2R A;  1X1P A;  2VG5 A;  5KQ8 A;  5EU7 A;  4W5N A;  2WFB A;  3ZX3 A;  4U67 L;  3TAP A;  2QA4 N;  4H0V B;  1CXQ A;  4J8F A;  1JLA A;  3B8A X;  1BO5 O;  4FLW A;  1RTI A;  2QWP A;  3ID8 A;  1EQY A;  4ISG A;  3V9S A;  1VSJ A;  1GLA G;  3PSF A;  3U9Z A;  4AHT A;  1A5W A;  2NZT A;  4YOX A;  1VSF A;  5AJ3 K;  3DI6 A;  2QXF A;  1KVA A;  2P51 A;  2KFZ A;  3AVK A;  3EKS A;  5GIP A;  3PUF A;  1EO1 A;  4CHO A;  1BQN A;  4H5V A;  5BRE A;  5FPE A;  1LAW A;  2Q36 A;  4HUE A;  2VG7 A;  3RRH A;  4I7F A;  4CJ7 A;  4DTS A;  1Q7Y O;  1RDD A;  1IBL K;  3VF2 A;  2VWK A;  2D0P A;  3DLR A;  4KH5 A;  3O8M A;  4ID1 A;  4GY2 B;  4LF6 K;  3VEY A;  4MDA A;  5J2Q A;  2O8D B;  4E3S A;  1X3M A;  4FJG A;  4B1V A;  5JLH A;  3S3N A;  4BRC A;  4DUZ K;  5CHI A;  4CJS A;  1SS6 A;  1TVR A;  4AHS A;  4HVJ A;  4FWO A;  4DKW A;  4IFY A;  1LWF A;  3V9U A;  3CQX A;  1XMQ K;  4BDZ A;  3GBT A;  1YIT N;  3LM9 A;  4XIU A;  5ADX A;  3C95 A;  5AFU A;  3HPO A;  4B9N A;  4R5P A;  1TL3 A;  3C6T A;  4A5B A;  1N5Y A;  3K59 A;  3OYG A;  3A5L C;  3DLG A;  1QVF M;  4YNQ A;  1K8K B;  3KHY A;  4RW4 A;  5C10 A;  4DLG A;  1NGA A;  4KRF A;  1NGB A;  2FSJ A;  4O5B A;  3KZB A;  3HJF A;  2E2N A;  1S1U A;  1L5U A;  4EHT A;  2KKZ A;  2P9P A;  1W9H A;  3HZ6 A;  4FWQ A;  3DYA A;  2I5J A;  3O3G A;  5C25 A;  3KLG A;  3A2F A;  3VER A;  3DOL A;  5M1K A;  1QE1 A;  1QVG M;  3MN6 A;  3AVH A;  4DQ8 A;  3NDK A;  1HR0 K;  3U3Y A;  3WNH A;  2P9L B;  3TAN A;  3N4Q A;  2UXC K;  3FR0 A;  2HBK A;  2PAV A;  3VQ9 A;  3AA5 X;  4Z0U A;  4RCH A;  1XC9 A;  1RTH A;  2KZM A;  2F7T A;  1ILY A;  2ZJR L;  4CBU A;  4FVU A;  1SL2 A;  4HUG A;  3PO5 A;  2CGK A;  1N33 K;  3EE8 A;  3AVC A;  3ZX2 A;  2DFF A;  4BQZ A;  2O8B A;  2P9I A;  5M1P A;  2E4L A;  3VTH A;  3BF1 A;  1NK4 A;  1IBK K;  1WSE A;  3A8Y A;  4M63 C;  1FJG K;  3FZL A;  4DQQ A;  1FK9 A;  4DV0 K;  3NF8 A;  2FBX A;  3RSE B;  3HK2 A;  2BAN A;  3J80 O;  3VEO A;  2KZZ A;  2EWS A;  2YHA A;  4LFB K;  1OKJ A;  5CE3 A;  4MLE A;  3ITH A;  4DV3 K;  3EKU A;  4DSE A;  2Y1I A;  3PLA A;  4WE1 A;  1B9D A;  3KKS A;  3QFP A;  2QI2 A;  4CFD A;  4NB4 A;  3CMA N;  2YV0 X;  1RDB A;  1RT7 A;  4CF2 A;  2G8I A;  1R59 O;  1NJX A;  3SJH A;  4CHZ A;  1IO2 A;  5AZJ A;  3DLL L;  2YNI A;  3EZ5 A;  4NYN A;  4DB3 A;  1X9S A;  1IH7 A;  1EP4 A;  3THX B;  1VSD A;  5BPM A;  1G15 A;  4B9V A;  1LOT B;  4OVL A;  1CZ9 A;  4E19 A;  3VQ4 A;  2E88 A;  4LF8 K;  1QHA A;  2V7Z A;  4CEO A;  4CGD A;  4WQ5 C;  4L8R B;  3ZET B;  1WLJ A;  1K6Y A;  3FFK B;  1U48 A;  5LY3 A;  2ITG A;  3ATV A;  3J7Y P;  4WQ4 C;  4V19 S;  1GLB G;  3VMF B;  2A40 A;  4M3T A;  1O13 A;  3OYN A;  3MXI A;  3MK6 A;  3D2E A;  3QER A;  5KPR A;  1RGI A;  1TYQ B;  5AQO A;  1XNR K;  2IVN A;  1U45 A;  1BA1 A;  1GLJ O;  3IFR A;  1KSP A;  3RMB A;  3H3N O;  1GLC G;  1KAX A;  1JLG A;  3TPQ A;  3BUZ B;  2YJF A;  4OX9 K;  3ENO A;  4WF9 L;  2WUS A;  4AQY K;  3C6H A;  1RT3 A;  1L3U A;  4H0T B;  3PIO L;  1KVC A;  3HO1 A;  4B8C A;  2BGG A;  4BR0 A;  4KTZ A;  4BRL A;  4FOE A;  1NK0 A;  2O4I A;  3LDL A;  4ILH A;  4B1Z A;  5HRR A;  2HMI A;  4KRE A;  3LP2 A;  4JRP A;  1OH7 A;  3TI0 A;  2PYL A;  4BWJ A;  4IOA L;  4GV9 A;  4CHQ A;  3BDP A;  5ELZ A;  3TR8 A;  3CME N;  4ILJ A;  3O6W A;  5C2F A;  3NF6 A;  4M41 A;  2XO7 A;  2P9K B;  2QK9 A;  3IKM A;  3L2Q A;  1QSS A;  3VGM A;  1WBD A;  2FBT A;  3TAB A;  1JXB A;  1QS4 A;  4C8M A;  3VEN A;  4FM0 A;  2E20 A;  1TUU A;  5FDL A;  5LL6 Z;  2KHO A;  4JS5 A;  4B1Y B;  4JS4 A;  1ZBI A;  4EIA A;  2VG6 A;  2G8U A;  5CR4 A;  5E41 A;  4DQP A;  4FXD A;  1VRU A;  3Q7C A;  3HM8 A;  5BPL A;  2OZM A;  4CJE A;  3HOT A;  3AV9 A;  4CJV A;  3NHG A;  3VQ8 A;  3SUN A;  4CES A;  2QW9 A;  4HHT A;  3AA2 A;  1E3M A;  5KPZ A;  2YKN A;  2IGI A;  4K8X A;  1YI2 N;  5JLF A;  1JLQ A;  2AP1 A;  3C94 A;  3HT3 A;  4H03 B;  4DR6 K;  2VYP A;  3VN5 A;  1N6Q A;  1S72 N;  1RDU A;  4IFE A;  5M1Q A;  3AAR A;  5KRS A;  4BRF A;  3D7E O;  1X9W A;  1X9J A;  1UOC A;  3CC4 N;  3ULE B;  1BIU A;  4LSN A;  1F21 A;  3L3V A;  3QIO A;  4ISE A;  4DSK A;  4CEE A;  5KPT A;  1NGH A;  1HJO A;  3VA0 A;  4IEI A;  3S41 A;  4RW6 A;  4HWI A;  2RE2 A;  3VF6 A;  1QSY A;  4CER A;  2HOE A;  1KQS M;  4X64 K;  1VSH A;  2QM1 A;  2B6A A;  3VA3 A;  3K5L A;  4YFU A;  4BVP A;  2X6N A;  2W42 A;  1KAY A;  3EN9 A;  3NFA A;  4DS4 A;  2NLX A;  3BEX A;  2YKM A;  1K9M O;  3OTO K;  4DF4 A;  5CYQ A;  3NH0 A;  3CFR A;  3RWU A;  3CHW A;  4E89 A;  3QEX A;  4BRG A;  3MWP A;  1FXX A;  4RW9 A;  3ZEU B;  4LF5 K;  2XY7 A;  3NF9 A;  3P39 A;  2ZGY A;  5KGX A;  3J7A P;  3KTQ A;  4FJK A;  4JI4 K;  5C0Y A;  4A61 A;  4JKD A;  3THW A;  3PX4 A;  4H4O A;  3OS2 A;  1EWQ A;  4FWK A;  1RDW X;  4IXC A;  1YJ9 N;  5KI6 A;  2Q0R A;  2JGU A;  5FPN A;  2VCP A;  4JKB A;  1W7A A;  2GV9 A;  2IS3 A;  3O9S A;  3VQB A;  1KVB A;  3GDQ A;  2V7Y A;  4DFM A; 
#chains in the Genus database with same CATH homology
 1D9F A;  3PO4 A;  3O4Q A;  3IAY A;  1GOB A;  3L3U A;  4EZ9 A;  4CK1 A;  4F4K A;  4FJ5 A;  1IKW A;  1XHZ A;  1T03 A;  4B9M A;  4OKE A;  3O3F A;  1ITG A;  1BCO A;  1W0H A;  1KCF A;  3E01 A;  3P1G A;  4OLB A;  4FJX A;  3KK2 A;  1JLF A;  2F8T A;  3V81 A;  3LDS A;  1GOC A;  4TSX A;  4OKJ A;  1HNV A;  4Y1D A;  1ASV A;  2HNZ A;  3IRX A;  3EY1 A;  2X74 A;  4IDK A;  1VSL A;  4KFB A;  4MFB A;  4MQ3 A;  2JLE A;  3WNF A;  4CED A;  3HP9 A;  4CJ4 A;  4Z4H A;  4DTJ A;  2XY6 A;  3QEP A;  4OGC A;  1SKS A;  2OZS A;  4KHN A;  2YHB A;  4OGE A;  2Q3S A;  3LAM A;  4ZTF A;  4CGH A;  1X1P A;  2G8W A;  5HP1 A;  2VG5 A;  1S9E A;  1TKZ A;  3KKR A;  4ID5 A;  2A1R A;  1ZBL A;  1RDA A;  4C8N A;  1ZBU A;  3K2P A;  5EU7 A;  4W5N A;  3TAR A;  2HHW A;  3KLH A;  1ZBH A;  3NF7 A;  3TAP A;  3OYI A;  1CXQ A;  5I42 A;  4BDY A;  1JLA A;  4EP5 A;  4RW8 A;  3OYD A;  3VQE A;  3RMD A;  1BL3 A;  4M3W A;  4FLW A;  1RT1 A;  1RTI A;  5FRN A;  2EX3 A;  3KD5 E;  1NKC A;  4I2Q A;  3JYT A;  3TAQ A;  1S1W A;  1BQM A;  4FCY A;  1Q9X A;  5D3G A;  3V9S A;  1VSJ A;  3CYM A;  2X6S A;  4OLA A;  2ZQB A;  4AHT A;  4CEB A;  1A5W A;  3OS0 A;  2BDP A;  4BE0 A;  1S5J A;  3L2U A;  3SUP A;  1VSF A;  4DWI A;  3DI6 A;  4ICL A;  1RCH A;  1CZB A;  2QXF A;  3OYH A;  1KVA A;  1IKY A;  1B9F A;  3I0R A;  3O3H A;  4Q0B A;  2P51 A;  4DQS A;  2KFZ A;  4F2S A;  4M3X A;  3AVK A;  3SPY A;  4W5Q A;  1RBU A;  3ZSR A;  1HYS A;  1NKE A;  3PUF A;  3OVN A;  2ETJ A;  4CHO A;  1BQN A;  4W5R A;  2PYJ A;  4BAC A;  4CGG A;  4HTU A;  2HHU A;  1LAW A;  3LP0 A;  4Z4F A;  3KLI A;  1KFS A;  4HUE A;  2VG7 A;  3SZ2 A;  3RRH A;  4I7F A;  5J2P A;  1BCM A;  3KK3 A;  3KIO A;  5HRN A;  4OPK A;  4I2P A;  4DTS A;  3DMJ A;  4FJJ A;  4IBN A;  1RDD A;  1QQC A;  1WNS A;  2FBV A;  3RMA A;  2HVI A;  2VWK A;  1JKH A;  4FLV A;  1A5X A;  4W5T A;  2HHQ A;  1I3A A;  3DLR A;  1NJY A;  2OPR A;  4ID1 A;  3ISN C;  1C1B A;  3ZCM A;  1L3V A;  5C42 A;  5J2Q A;  3LPT A;  4GMJ B;  4E3S A;  2Z1J A;  4B8A B;  5HRO A;  4FJG A;  3F73 A;  3AVG A;  2HB5 A;  3F9K A;  4DTM A;  3ZSO A;  3S3N A;  4CFC A;  4O55 A;  2KQ2 A;  4B9U A;  2ZE2 A;  3AVF A;  1L3S A;  4DMN A;  1SV5 A;  4CJS A;  1KTQ A;  3DRP A;  4CFB A;  4K8Z A;  3P83 D;  1TVR A;  3D0P A;  3OYC A;  5JS1 A;  4AHS A;  4HVJ A;  4CHP A;  4UQG A;  4F3O A;  4KTQ A;  3L2W A;  3QEV A;  4IFY A;  4CHY A;  1LWF A;  3V9U A;  1VSM A;  4Y1C A;  4AHV A;  4BDZ A;  4DSL A;  2P5O A;  4O44 A;  3OYM A;  4DQI A;  4F8R A;  4DFM A;  3ZSQ A;  4M3Y A;  4E7J A;  4N41 A;  3NGZ A;  3NAE A;  3KD1 E;  1LW2 A;  4XIU A;  4PWD A;  4DSF A;  4CE9 A;  3C95 A;  4DTX A;  1J53 A;  3T1A A;  3HPO A;  3K58 A;  1S9G A;  1NOY A;  4R5P A;  1TL3 A;  3NH2 A;  3C6T A;  1SKR A;  4FK2 A;  1N5Y A;  3K59 A;  3OYG A;  3H08 A;  2Z1G A;  2B4J A;  1TL1 A;  3DLG A;  1QHT A;  3KLE A;  3TAG A;  4YNQ A;  2RF2 A;  1JXE A;  3B6O A;  4G1Q A;  3RR7 A;  4BE2 A;  4RW4 A;  1IKX A;  2DFH A;  1RT6 A;  4NCG A;  4DLG A;  4N76 A;  5C24 A;  3QNN A;  4KRF A;  4ELV A;  4FLX A;  3SV4 A;  4O5B A;  3T19 A;  3VQP A;  1EX4 A;  3OYE A;  2D5R A;  1RT4 A;  2HNY A;  3HJF A;  4B08 A;  1S1U A;  4EP4 A;  1J9A A;  2FBY A;  3ZSY A;  1L5U A;  3QET A;  3DRS A;  4I9Q A;  1D8Y A;  4CEZ A;  4QCL A;  4FLY A;  4M45 A;  4DF8 A;  1W9H A;  3ULD A;  3T3F A;  1Z26 A;  3DYA A;  1C0M A;  2I5J A;  3O3G A;  3L2V A;  3ZT4 A;  2VWJ A;  1L3T A;  5C25 A;  3KLG A;  4FZY A;  1J5O A;  3IG1 A;  1XI1 A;  3AVA A;  3A2F A;  3V1O A;  3DOL A;  1QE1 A;  4KHS A;  4B9T A;  3AVH A;  3ZSW A;  3NDK A;  1JL1 A;  2XY8 A;  3AVI A;  5KTQ A;  4KKO A;  3NH1 A;  4CEF A;  3U3Y A;  1NK6 A;  2G8V A;  3WNH A;  4CIF A;  4PUO A;  4FM2 A;  4OKK A;  1HYZ A;  4NYF A;  1U47 A;  2HHX A;  3TAN A;  3NGY A;  4DTO A;  5CYM A;  4CK3 A;  3VQ9 A;  4Z4C A;  3AA5 X;  1FKP A;  4Z0U A;  2ZD1 A;  3ZSZ A;  4NCA A;  1XC9 A;  4FJ8 A;  1RTH A;  1U49 A;  1J54 A;  2KZM A;  2FC0 A;  3SQ0 A;  4B9S A;  4DSJ A;  3MXJ A;  4HUF A;  4FVM A;  1SL2 A;  5SZT A;  4CF9 A;  1JLE A;  4HUG A;  1T8E A;  3PO5 A;  4FJN A;  3B6P A;  4CJQ A;  3AVC A;  2G8F A;  3WNE A;  1VSE A;  2DFF A;  4KI4 A;  2DY4 A;  1TKT A;  1NK5 A;  3VQA A;  1RDC A;  2E4L A;  3D45 A;  4M3R A;  4E1M A;  2Z1I A;  3VQC A;  4CF0 A;  4ZTJ A;  1NK4 A;  3QNO A;  1WAJ A;  1WSE A;  4CF8 A;  4DU1 A;  1BI4 A;  1S1X A;  3KK1 A;  4CHN A;  4J2B A;  3HPG A;  1KLN A;  1KLM A;  4LY7 A;  4DQQ A;  3V1R A;  2XRI A;  1FK9 A;  3MEG A;  3NF8 A;  3VQD A;  2FBX A;  2P1J A;  4LD0 A;  4AHU A;  3HK2 A;  4ELU A;  2BAN A;  4E7H A;  2KZZ A;  2YHA A;  3QEI A;  4FW1 A;  1WSH A;  3THV A;  4IG3 A;  4CGJ A;  3ITH A;  4DSE A;  5KGW A;  3CQ8 A;  2Y1I A;  4WE1 A;  1RNH A;  4CEQ A;  1B9D A;  1TKX A;  3KKS A;  4N56 A;  4E7I A;  4CFD A;  3ZT2 A;  1ZYQ A;  1NKB A;  2IOC A;  2D0A A;  2YV0 X;  1RDB A;  4CFA A;  3DOK A;  1RT7 A;  4Z4I A;  4DTU A;  1HRH A;  4KHW A;  1YTU A;  3HPH A;  1RIL A;  4LH5 A;  4CF2 A;  3V9W A;  1Q9Y A;  4DTR A;  1RT5 A;  3LP3 A;  1U4B A;  4M42 A;  3MEC A;  1RTJ A;  3SQ4 A;  2G8I A;  1O1W A;  4CIE A;  4JRQ A;  4KHQ A;  3ALY A;  1NJX A;  4CHZ A;  1R0A A;  1IO2 A;  3AO5 A;  3LZJ A;  4C8O A;  1RBS A;  3CFO A;  1UWB A;  2B5J A;  2YNI A;  3EZ5 A;  1T7P A;  4CEA A;  1BHL A;  3HVT A;  4NYN A;  3KJV A;  3G10 A;  1X9S A;  3QO9 A;  1D5A A;  1IH7 A;  1EP4 A;  3LWL A;  4CJU A;  1BI4 B;  3HL8 A;  5KRT A;  1VSD A;  1DTT A;  3ZT0 A;  3ZSV A;  3CFP A;  1G15 A;  5J2N A;  2HHV A;  1XWL A;  3CM6 A;  3SYZ A;  1X9M A;  3BGR A;  4B9V A;  1VSK A;  3NCI A;  4GW6 A;  4E0D A;  2HHS A;  4DLE A;  2A1S A;  3QIP A;  4OVL A;  1CZ9 A;  2O4G A;  1EKE A;  2GUI A;  4E19 A;  3QES A;  3VQ4 A;  4FK4 A;  3SI6 A;  4DFP A;  1HQE A;  1REV A;  3AO3 A;  4CEO A;  3AVM A;  4CGD A;  4FJM A;  4FM1 A;  2D0C A;  2GBZ A;  2OA8 A;  4L8R B;  3DLE A;  1C1A A;  4KHU A;  4F3T A;  3AO2 A;  1WLJ A;  1K6Y A;  1U48 A;  1UA0 A;  4FJL A;  2ITG A;  3PX0 A;  1S6Q A;  4F2R A;  3G0Z A;  1WSF A;  1YTA A;  3OYL A;  3LWM A;  3CM5 A;  1WSJ A;  1LW0 A;  3TAM A;  1FKO A;  4CJW A;  3AO4 A;  3KLF A;  5I3U A;  2XY5 A;  4M3T A;  3OYN A;  2G8K A;  3MXI A;  1HMV A;  3LAN A;  4DTN A;  1TKD A;  4KHY A;  5FRM A;  4CK2 A;  3QER A;  4BE1 A;  1WSG A;  5HBM A;  4O4G A;  4CEC A;  4DSI A;  4GVM A;  2QKB A;  3MXM A;  1U45 A;  4BWM A;  3EYZ A;  1KSP A;  4HCC A;  2OPQ A;  3RMB A;  1JLG A;  5SWM A;  4J2E A;  1NOZ A;  3LAL A;  1HQU A;  1S6P A;  3SPZ A;  1C0U A;  4CJ3 A;  3O4N A;  1DTQ A;  1MU2 A;  1RT3 A;  2E6L A;  1L3U A;  4KB1 A;  2HW3 A;  3CG7 A;  2DFE A;  3K5N A;  2ATQ A;  3RMC A;  4FZX C;  4B9N A;  3K5O A;  3AO1 A;  1KVC A;  2PY5 A;  3HO1 A;  4B8C A;  1TK5 A;  2BGG A;  4PY5 A;  4LSL A;  3K5M A;  4E1N A;  3DRR A;  4KTZ A;  1NK0 A;  1C6V A;  4C8L A;  2O4I A;  3FFI A;  1VRT A;  1UA1 A;  1UAX A;  1RBV A;  1TV6 A;  4DU4 A;  1JLC A;  4CJK A;  4O0I A;  5J2M A;  3PX6 A;  2IAJ A;  5HRR A;  2HMI A;  1HPZ A;  5CZ1 A;  4KRE A;  4CGF A;  4KI6 A;  5DMR A;  3MED A;  3V9Z A;  3V4I A;  1JL2 A;  3LP2 A;  4JRP A;  1S1T A;  3TI0 A;  1RT2 A;  2PYL A;  3SNN A;  1SUQ A;  4BWJ A;  3V9X A;  4LH4 A;  3LPU A;  1QTM A;  4CHQ A;  3BDP A;  3TR8 A;  2HND A;  3TAF A;  2WON A;  4Z4E A;  4W5O A;  3TWH A;  1SKW A;  1NK7 A;  4KB0 A;  2DTU A;  3HST B;  3NF6 A;  3AA3 A;  3P5J A;  4M41 A;  2XO7 A;  3LZI A;  2QK9 A;  1VSI A;  2RKI A;  3L2Q A;  1NK8 A;  1QSS A;  2F96 A;  4C8K A;  4I9L A;  2FBT A;  4AHC A;  3TAB A;  5CY4 A;  1JXB A;  4E7L A;  1QS4 A;  4C8M A;  2R7Y A;  4OJR A;  4FM0 A;  2E6M A;  2YNF A;  5T7B A;  3HM9 A;  5FDL A;  1NK9 A;  5K14 A;  4JS5 A;  1IKV A;  2Z1H A;  4H4M A;  4DTP A;  3RR8 A;  3ZT3 A;  4H8K A;  3AVJ A;  3ASM A;  2RPI A;  2OYQ A;  4JS4 A;  4BDP A;  4AIL C;  1VK0 A;  3OJU A;  5HRS A;  3HP6 A;  4FLZ A;  1TK8 A;  1ZBI A;  2KFN A;  2VG6 A;  2G8U A;  2QKK A;  3MEE A;  5E41 A;  2X78 A;  4DQP A;  4B9L A;  3SJJ A;  4FXD A;  2YNH A;  1VRU A;  1NJW A;  3PV8 A;  4AH9 A;  3RTV A;  3ZT1 A;  3LAK A;  2OZM A;  3DLK A;  4CJE A;  4CIG A;  2P5G A;  3AV9 A;  4O0J A;  4CJV A;  3NHG A;  3VQ8 A;  3SUN A;  4CES A;  3OYF A;  1TAQ A;  2F8S A;  4HHT A;  1LWE A;  4N5S A;  1YVU A;  1HYV A;  5J1E A;  1JLB A;  1BIS A;  3AA2 A;  2OPS A;  1HNI A;  4CJL A;  4J2A A;  2YKN A;  3SUQ A;  4M3U A;  2IGI A;  4CJF A;  3ZSX A;  3M8Q A;  1WN7 A;  3VQ5 A;  4K8X A;  3HT3 A;  1JLQ A;  3C94 A;  3OYJ A;  3K57 A;  4E7K A;  4M3Z A;  1Y97 A;  3VN5 A;  1N6Q A;  3SQ1 A;  1SL0 A;  1SL1 A;  4FW2 A;  4B3O A;  4CGI A;  3OS1 A;  4HCB A;  2PZS A;  3PY8 A;  4DQR A;  5KRS A;  3NE6 A;  4CJT A;  4DU3 A;  4CJ5 A;  1X9W A;  1ASW A;  1UOC A;  1RBT A;  2KW4 A;  1LWC A;  4DG1 A;  3DLH A;  3L8B A;  2EHG A;  1C0T A;  1BIU A;  3OYB A;  4LSN A;  3VQ6 A;  4DFJ A;  3OYK A;  4Z4G A;  3S3M A;  4QOZ B;  1F21 A;  4CJR A;  3QEW A;  3L3V A;  4N47 A;  3QIO A;  4ZHR A;  2G8H A;  4FJ7 A;  1EET A;  4AHR A;  4CJP A;  4CCH A;  2KTQ A;  3M8S A;  4CF1 A;  4RW7 A;  4DSK A;  2D0B A;  3I0S A;  4CEE A;  4DS5 A;  4PQU A;  3RRG A;  3V1Q A;  3VA0 A;  2BE2 A;  2YNG A;  4KV8 A;  2NUB A;  3U3G A;  1YT3 A;  4RW6 A;  1WAF A;  1U04 A;  5JS2 A;  1RTD A;  4FYD A;  1QSL A;  1KRP A;  2HHT A;  3M8P A;  5HRP A;  3SV3 A;  3S3O A;  1QSY A;  4FZZ A;  4CER A;  5CZ2 A;  3QIN A;  1VSH A;  3VA3 A;  2B6A A;  1GOA A;  3AVL A;  3HYF A;  1ZBF A;  4DFK A;  3U6F A;  3SQ2 A;  1LV5 A;  5DK5 A;  1D9D A;  3K5L A;  4YFU A;  3NGI A;  3I8D A;  2X6N A;  3VQQ A;  2W42 A;  3NFA A;  4DS4 A;  4IG0 A;  1NJZ A;  3QLH A;  1EXQ A;  1KFD A;  2OPP A;  2YKM A;  2XHB A;  4FJ9 A;  3AVN A;  4FK0 A;  1I39 A;  4DF4 A;  4PA1 A;  4ELT A;  4FLT A;  5CYQ A;  1DLO A;  3NH0 A;  3CFR A;  3L2R A;  4EZ6 A;  4E89 A;  3QEX A;  3UIQ A;  3RWU A;  4KO0 A;  2RN2 A;  1FXX A;  1A5V A;  4RW9 A;  3S9H A;  1TAU A;  2XY7 A;  3SCX A;  3NF9 A;  1BGX T;  3WNG A;  2IDO A;  5KGX A;  1IG9 A;  1B92 A;  3KTQ A;  4FJK A;  4FLU A;  4J2D A;  1Z25 A;  1BIZ A;  3PX4 A;  3C6U A;  3HVR A;  3AVB A;  1TK0 A;  4H4O A;  4OPJ A;  4Q5V A;  1ASU A;  1RBR A;  3OS2 A;  2Y1J A;  3TAE A;  4KAZ A;  3V6D A;  1Q8I A;  3VQ7 A;  3NBP A;  3JSM A;  3IS9 A;  4JLH A;  4KPY A;  4IFV A;  3SUO A;  2IC3 A;  3M8R A;  1C1C A;  4KTW A;  4RG8 A;  5KI6 A;  3OJS A;  4FJH A;  4FJI A;  4IKF A;  3DM2 A;  1CXU A;  2JGU A;  3OY9 A;  5FRO A;  1LAV A;  2LSN A;  3HXM A;  2WOM A;  3AA4 A;  2AJQ A;  5HLF A;  2HVH A;  3DLB A;  1HJR A;  1XHX A;  2GV9 A;  2IS3 A;  1KVB A;  3LP1 A;  3VQB A;  3MAQ A;  1CLQ A;  1T05 A;  3OYA A;  1S1V A;  4NCB A;  1TGO A;  4QAG A;  1WSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...