1JXBA

I53a, a point mutant of the cysteine-free variant of e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
152
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAAVALEALKEHAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Propagation of a single destabilizing mutation throughout the Escherichia coli ribonuclease HI native state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jxbA00
2FC0A 4CJVA 3G0ZA 4RW4A 4RW9A 2XY8A 4MFBA 3BGRA 1Q9XA 1UA1A 1U4BA 1RTJA 5HRRA 4DSJA 5KI6A 3L2RA 3OYKA 1LWEA 4JRQA 4BDPA 1TAQA 4I7FA 5J1EA 2F96A 2E6MA 3ITHA 3D0PA 4E89A 3V6DA 3SCXA 1LWCA 2PZSA 4OKKA 4OGEA 3SUOA 1RT4A 3L3UA 3C6UA 5C24A 4CCHA 3RWUA 4LSNA 1GOCA 3DMJA 4MQ3A 4Z4FA 4DTSA 2G8FA 1NK4A 2QK9A 4ID1A 4FM0A 2OZMA 3AVGA 3ZCMA 4B9MA 1FKOA 3OJSA 1QSYA 3HL8A 4Z0UA 4CJ4A 4DSFA 4FLTA 4DFPA 3OYJA 4FZYA 1X9MA 2E4LA 4CFDA 3KLGA 1I39A 2HNZA 1VRTA 4HTUA 3SI6A 1NK9A 1LW0A 2HHQA 1BI4B 2VG7A 1XWLA 4E3SA 3OYLA 2HHVA 4FJKA 4KHWA 5CZ2A 4CFBA 1O1WA 3NF6A 2RN2A 4OKJA 4CECA 3V9ZA 3S3MA 1XI1A 4B9TA 1RTHA 4Y1CA 1NKEA 3AA4A 1CXQA 3ZSOA 1NK6A 1ZYQA 2G8VA 4CGGA 4N56A 1WSFA 3OYMA 1LAVA 2P5OA 3JYTA 3KK3A 1VSDA 4CEDA 3ZSZA 5KGXA 2PY5A 3V4IA 2IGIA 3TABA 4E7KA 2YNGA 1CLQA 1ZBFA 3LP3A 1NJXA 4FJJA 4J2BA 3HM9A 2RPIA 4DTPA 1J5OA 3PX0A 3HJFA 3SJJA 2HW3A 3NH0A 3CM5A 1IKWA 1JKHA 4CGJA 2QKBA 3DYAA 2BGGA 3NBPA 1SL1A 3LZIA 4E7JA 1QSLA 4C8NA 1C0TA 3NGZA 3TAFA 4PWDA 4OVLA 3ZSYA 4N47A 1NK0A 5HROA 4DTMA 3ISNC 3QEXA 2OYQA 1NJYA 4KB1A 4CGIA 1BGXT 5FRMA 1JLQA 4DU4A 3O3GA 4Z4HA 3RR7A 3IRXA 1Z25A 1WSIA 3SPYA 4RG8A 5T7BA 4M3RA 4F8RA 2KTQA 2KFNA 4LSLA 3V9XA 3U3YA 3HPGA 1KLMA 1RBRA 1Y97A 1S1TA 3MXMA 3A2FA 2ATQA 3AVJA 1B92A 5I3UA 1LV5A 4CF9A 1YT3A 4W5QA 4B08A 4AHSA 2FBYA 4CJLA 4DTOA 4DWIA 1B9FA 2BANA 1C1CA 1S1UA 4EZ6A 4E19A 5FRNA 4C8LA 4CK2A 4AHUA 1S1WA 3QLHA 5K14A 3CYMA 3OS2A 3VQ5A 2HHWA 1RBVA 2NUBA 4FJMA 1J54A 3HPHA 4H4MA 1VSLA 4CJFA 3LWMA 3SQ0A 4PUOA 4CESA 4FLXA 1FK9A 3AVCA 1JXEA 4W5OA 3V9SA 3K5LA 3PX4A 1ZBLA 1BHLA 1C1AA 1QQCA 2HHXA 4IBNA 2BE2A 4Q0BA 3QEWA 3U3GA 4I9LA 1N5YA 2DFEA 1EP4A 4FJ8A 4ZTFA 3KIOA 4DLGA 1ASUA 1W0HA 4CGHA 3L2VA 2F8TA 4OPKA 2XY6A 3MECA 2GUIA 3RR8A 1TKTA 2JGUA 4ID5A 4CFCA 4XIUA 3O3FA 4IKFA 3C6TA 4FYDA 3VQ9A 4BACA 4AHCA 3I8DA 5CYMA 2HMIA 4HUEA 3K5MA 4IDKA 3IAYA 4CJQA 3RTVA 3RMCA 4DSIA 2IOCA 1T03A 4FJGA 4B9SA 4CHNA 2FBXA 2Z1GA 4KI6A 2XO7A 3VQPA 2WOMA 4KFBA 4CHQA 1KVBA 3AVNA 4KTWA 3DOKA 3T19A 4PA1A 4UQGA 1TK5A 1D8YA 1TGOA 4FLYA 1I3AA 4M41A 4FK0A 3SUNA 5CYQA 1QHTA 1T8EA 5HRSA 4KB0A 4J2EA 4FK4A 3TANA 5J2MA 1JL2A 1S1XA 1C0MA 3K57A 5KTQA 1HMVA 2IAJA 3QEVA 1SKWA 4EP5A 1EX4A 2BDPA 2YKMA 4EP4A 1TKXA 3K2PA 4AHVA 1JLEA 4ICLA 1KRPA 1HQUA 4LH5A 4CEAA 1X9WA 3NH1A 3NF7A 4DTXA 5C42A 4DQQA 3QESA 3L2UA 1HYSA 1LAWA 3P5JA 2XRIA 4DF4A 4J2DA 1TV6A 3RMDA 3TI0A 1U49A 1A5XA 2GBZA 2Z1HA 3AA3A 3HSTB 1KCFA 4B8AB 3NFAA 3KKRA 1BQMA 3T1AA 4NCGA 4BE1A 2D0CA 2YNFA 3V81A 3S9HA 4CEZA 3RRHA 2LSNA 4O5BA 4WE1A 3VQCA 3ZSRA 1VSIA 3JSMA 4B9NA 2FBVA 4LH4A 4DQIA 4CEFA 3QEPA 4CGDA 1NOZA 1S9GA 2IDOA 1ZBUA 2VWKA 1IKXA 2OA8A 3EYZA 4Y1DA 4CEQA 2QXFA 3ZT3A 3PO5A 3OYAA 3LP1A 3AVIA 4H8KA 1FXXA 3SNNA 3KJVA 4DTJA 3DLBA 5HBMA 4CK1A 4CF0A 3O3HA 3TAPA 1NKCA 2Z1JA 3TR8A 1IO2A 4CE9A 4DFJA 3DLEA 1BIUA 4FJ9A 4R5PA 3IS9A 4IG3A 3TAEA 4B3OA 2R7YA 4DSKA 1F21A 1XHXA 5FROA 1TAUA 3L2QA 4DS5A 3KLEA 3LDSA 1J9AA 4OLAA 4CHPA 4DFMA 3SV3A 5HP1A 5J2QA 3AO3A 3ZSQA 3M8QA 4F3TA 1HRHA 4FXDA 2RF2A 3WNHA 3VQ8A 3MXIA 1NOYA 2O4IA 3CFRA 4FVMA 2YHAA 3DLGA 3VQQA 4KHSA 4CJ5A 4DFKA 3AO4A 2OPPA 2B5JA 4OGCA 4TSXA 5CY4A 3QNNA 1X9SA 1T7PA 3KK1A 1R0AA 4AH9A 2ETJA 4K8XA 1TKDA 1WAFA 4AHRA 4FJHA 3KD1E 1S6QA 3V1RA 4CJPA 1RDBA 1X1PA 1SV5A 1Q8IA 3QIOA 5CZ1A 3LZJA 2B6AA 4KPYA 4KHQA 3NF9A 1S6PA 1TKZA 1UA0A 1TL3A 3OYFA 3PX6A 4N76A 3AVBA 2G8WA 3LWLA 4JS4A 4K8ZA 2DFFA 3DLHA 3NF8A 4B9UA 3KLFA 4OJRA 4L8RB 1YTAA 3UIQA 3QNOA 1D9FA 1DTTA 4B8CA 1K6YA 2P5GA 3DM2A 4CFAA 2E6LA 1RCHA 3HYFA 4QAGA 5KGWA 4E7HA 4FM1A 4AILC 4E0DA 1RTIA 2OZSA 3C94A 3T3FA 3DRPA 2PYLA 4CIFA 3ULDA 4C8KA 4BWMA 4KHNA 1TL1A 4HUFA 4I2QA 1IH7A 3MEEA 3OS0A 4M42A 4J2AA 2RKIA 3AVKA 3CQ8A 1SKSA 1BQNA 3C95A 3AO1A 1T05A 3K58A 1SL0A 3HK2A 1YVUA 1RT7A 3I0RA 4HVJA 4OKEA 1QTMA 2HHTA 3AO5A 4DU3A 3I0SA 1DTQA 3PV8A 1IG9A 3LALA 4FLZA 1JLFA 2KZZA 3OY9A 1WNSA 2P51A 3BDPA 3B6PA 3OYCA 3LAKA 2X78A 4O0JA 4CIGA 3TARA 3TAQA 4FLUA 4H4OA 4O4GA 4CIEA 1NK5A 3NCIA 3K59A 1KSPA 4FJNA 4KREA 3NAEA 1D9DA 1L3SA 4CEEA 3K5NA 1KVAA 1NK8A 3V9WA 4KI4A 1GOBA 2X74A 3M8PA 4LD0A 5KRTA 3AVMA 3EZ5A 1RT2A 4BWJA 1ASWA 1NJZA 4CJUA 3RRGA 4DSLA 3WNFA 3DLRA 3F9KA 2GV9A 1KLNA 4KHYA 2EHGA 3CG7A 3QINA 3H08A 4EZ9A 1BI4A 2QKKA 4Q5VA 2G8UA 5DK5A 3AVLA 4CHYA 4QOZB 2HB5A 4ZHRA 3OYGA 1LW2A 4KTZA 4CK3A 4IFYA 3OYBA 4FJ5A 3QEIA 3LP2A 4DTRA 4N5SA 3HVRA 3NE6A 4C8OA 5HRNA 4KTQA 3PUFA 3LPUA 4RW7A 4CF8A 4DQSA 1XHZA 1RILA 2D0BA 4ELVA 1VSFA 1U04A 4IFVA 3HO1A 1ZBIA 4FJXA 4O55A 2XY5A 4Z4EA 1B9DA 1BCOA 3NGIA 4DSEA 4OLBA 3KD5E 4M3WA 1RDCA 1RT6A 4CEOA 4DF8A 1C6VA 1HPZA 3IG1A 1VSMA 1RT1A 3LP0A 1C0UA 3V9UA 4B9VA 4NCBA 3NHGA 2KFZA 3SQ4A 1U45A 1JLBA 2ZQBA 1WSGA 3OYNA 3L2WA 4E7LA 4W5TA 1A5VA 3DI6A 4F2RA 3ALYA 3L8BA 3ZSVA 4CERA 2Y1IA 2ZE2A 4Z4IA 2PYJA 2F8SA 3VQ4A 1DLOA 4FW2A 1KTQA 4DQPA 4FJIA 3DOLA 4YFUA 1VSHA 4CHOA 4PY5A 4HHTA 1KVCA 3LPTA 3VQDA 3PY8A 1J53A 4CGFA 3SUPA 2Z1IA 4FJLA 2DY4A 1SUQA 3CM6A 3VQBA 3SZ2A 3AVFA 2O4GA 3DLKA 1ITGA 2EX3A 2Q3SA 3HVTA 1CZBA 4JS5A 3P83D 2AJQA 2W42A 3SV4A 1VRUA 1S1VA 3WNGA 4CHZA 3M8RA 3OYIA 3CFPA 1WLJA 4RW6A 3QERA 4DTNA 1UOCA 1TK8A 4M3ZA 1RT5A 1QS4A 2ITGA 3HP6A 4E7IA 3MEGA 2VG5A 4N41A 4M3UA 1WSEA 4Z4GA 1HNIA 3ZT2A 2G8IA 4FK2A 4F4KA 3S3NA 5HRPA 4ELUA 2OPSA 3OS1A 1C1BA 1GOAA 3LANA 3HXMA 1D5AA 1W9HA 3NH2A 1UAXA 3THVA 1RDDA 5SZTA 1JLGA 2B4JA 4FW1A 1JLCA 4FLVA 4BE0A 2A1SA 2VG6A 4BE2A 2HVIA 4FLWA 4CJTA 4BDZA 1L3TA 1RTDA 5J2PA 3E01A 1NJWA 2KZMA 3VQ6A 3S3OA 3SYZA 2KW4A 4I2PA 1S5JA 4LY7A 3OYEA 3SQ1A 4I9QA 4M3XA 3CFOA 2HVHA 1KFDA 5FDLA 4W5RA 3ZT0A 4DMNA 1U47A 1MU2A 3VQ7A 1NK7A 4FZZA 3O4NA 5DMRA 3OJUA 3ZT1A 1RBTA 1RBSA 1SL2A 2X6NA 2YNIA 1VK0A 4E1NA 1WSJA 1TVRA 1S9EA 3AVAA 4O44A 3VA0A 2A1RA 4KAZA 1LWFA 3SPZA 3OYHA 4E1MA 5JS2A 3RMBA 3VQEA 5SWMA 2YV0X 2HHUA 2HHSA 1WSHA 3SUQA 1A5WA 2HNDA 3VN5A 3K5OA 4KV8A 1RBUA 3TAMA 3WNEA 4FZXC 2HNYA 1BL3A 4CEBA 3NDKA 4YNQA 5EU7A 3ASMA 1NKBA 1L3VA 4HCBA 4ZTJA 4KRFA 1WAJA 1BCMA 2IS3A 4ELTA 1U48A 4KO0A 4DTUA 1IKVA 1RNHA 1HJRA 3V1OA 1Z26A 4GMJB 3NGYA 3MEDA 2Y1JA 1BIZA 1N6QA 1EKEA 4G1QA 4JRPA 1QE1A 3PO4A 3KKSA 2D0AA 4AHTA 1EETA 3KK2A 3OVNA 3AA5X 4CJWA 1VSEA 2DFHA 1BISA 1ZBHA 4C8MA 3D45A 1HYZA 2ZD1A 1CXUA 3V1QA 1JL1A 2OPQA 3L3VA 2YNHA 5E41A 4DU1A 3LAMA 3RMAA 1UWBA 4GW6A 1FKPA 1QSSA 4HCCA 2IC3A 4QCLA 4NYFA 4Z4CA 3KLHA 2X6SA 1ASVA 4BDYA 3AV9A 3P1GA 3HPOA 3MAQA 1KFSA 4KHUA 1VSJA 4CJ3A 3QIPA 2G8HA 1HNVA 1RT3A 3KLIA 5I42A 2XHBA 2P1JA 3U6FA 1TK0A 1SKRA 4FJ7A 3EY1A 2I5JA 2FBTA 1EXQA 3O4QA 4RW8A 3TAGA 1CZ9A 4GVMA 4M3TA 1JXBA 2D5RA 3DRRA 3G10A 4FM2A 4KKOA 3ZSXA 1HQEA 4CJSA 3MXJA 4HUGA 4O0IA 4OPJA 4CF2A 4CJKA 4FCYA 4CJRA 2KQ2A 3KTQA 4DLEA 4M3YA 4W5NA 2YKNA 2XY7A 1VSKA 3DRSA 2JLEA 2WONA 4B9LA 1RDAA 3F73A 3ZSWA 1XC9A 4NYNA 5KRSA 4NCAA 4M45A 4DG1A 3TWHA 1WN7A 5D3GA 1HYVA 3QO9A 3VQAA 4F3OA 2G8KA 2OPRA 3SQ2A 3FFIA 1IKYA 1REVA 3AA2A 2VWJA 5JS1A 3ZT4A 3HT3A 5J2NA 3AVHA 3B6OA 4CJEA 3OYDA 4DS4A 4IG0A 1G15A 4JLHA 3HP9A 1L5UA 4PQUA 2DTUA 1YTUA 3VA3A 3AO2A 2YHBA 4CF1A 1JLAA 3QETA 4F2SA 5HLFA 1L3UA 3M8SA 1Q9YA 5C25A 4DQRA
chains in the Genus database with same CATH superfamily
4CJVA 3G0ZA 4RW4A 4RW9A 2QI2A 2IVOA 2UU9K 4I6MB 5HRRA 3L2RA 2YJEA 1W2BM 1LWEA 4BRAA 1TAQA 5J1EA 1UA1A 3ITHA 3KVGA 4BR0A 3SUOA 1OH6A 5C24A 1GOCA 4MQ3A 3VTIA 2G8FA 3BY5A 1NK4A 4WFAL 3AVGA 2P9LA 3T69A 5C0YA 2HNZA 4OPHA 1NK9A 4XEIA 1XWLA 4E3SA 4FJKA 5CZ2A 1XI1A 4B3OA 5JICA 4JD2A 1BA0A 3AA4A 1ZYQA 4N56A 3CJ9A 4CEDA 3T1YK 5M1OA 1J5EK 2YNGA 3HM9A 4DTPA 1GLJO 1MA9B 3HJFA 2HW3A 5AZJB 3CM5A 3DYAA 3DXMB 3TAFA 4B1YB 2E1ZA 1JCFA 1NK0A 3HBTA 1NLVA 2A42A 3GBTA 4BRGA 3ID8A 1HR0K 3O80A 3FZHA 3ZETB 4KB1A 3HRGA 4CGIA 3TU5A 5FRMA 4WFBL 3CETA 3O4WA 4RG8A 5T7BA 1Q81O 4F8RA 2KFNA 2KTQA 3J7ZO 4LSLA 4BG9A 1KLMA 3JXUA 3MXMA 3WQUA 4B08A 4CZIA 4DWIA 4MDBA 2BANA 1C1CA 1S1UA 4E19A 3CCJN 1VQ7N 1RBVA 4FJMA 1J54A 3LWMA 4PUOA 3O8MA 4LFCK 1JXEA 1BHLA 2HHXA 1QQCA 3J81O 3K0SA 2OTLN 4Q0BA 1S72N 3O6WA 1FW6A 5GIPA 1ASUA 3CJCA 1ILYA 3L2VA 4OPKA 2W6LA 1NWKA 4FYDA 4H5RA 4IKFA 3C6TA 5CYMA 3K5MA 3RTVA 4B3SK 1HKCA 1BU6O 3R9PA 2QEXN 3I33A 4JKBA 3HOSA 3HI0A 2WOMA 4PA1A 3NMUA 1TK5A 2CGKA 3SUNA 1EO1A 3MN6A 4J2EA 4FSVA 3CC7N 1S1XA 4XH4A 5AQIA 1HMVA 3QEVA 1EX4A 3BF1A 3K2PA 4AHVA 2P9SA 1HQUA 5TKYA 3NH1A 3NF7A 1VQKN 3QMLA 5BR8K 2JWLA 3L2UA 1YUWA 4J2DA 1VQMN 1BDGA 3TI0A 1U49A 3AA3A 1KCFA 3NFAA 3KKRA 4BE1A 3S9HA 4NCGA 3V81A 5AJ3K 3RRHA 4DV6K 4X66K 4CZHA 4IOCL 3P4IA 4LH4A 4CEFA 3QEPA 4H0VB 3VEZA 5JVHL 3ZYYX 3U9ZA 4Y1DA 4CEQA 3H45C 4WCEL 1P8ZA 2QXFA 3ZT3A 1NMNA 3UKUA 5AQXA 4DV0K 3LP1A 1Z05A 3AVIA 3DLBA 2UUAK 5HBMA 3O3HA 1NKCA 4DFJA 2HBMA 4FJ9A 1N32K 3IS9A 4ISEA 4DSKA 4QS9A 3L2QA 1Q86O 5FPEA 3M1FA 1KAYA 3SV3A 3EN9A 4Z94A 2VWBA 5M1FA 3C6HA 3FFKB 4B9QA 2O4IA 2HOEA 2FSKA 3L4QA 4KHSA 1EWRA 1E4GT 4WYBA 5CY4A 5EX5A 2B5JA 1X9SA 4BRKA 2NRHA 4AHRA 3QIOA 1VHXA 3OYFA 3MN5A 4K8ZA 2G8WA 4L8RB 3CJAA 4B9UA 3KLFA 2WTUA 3QNOA 1D9FA 3O9SA 2P5GA 3DM2A 2E6LA 4E0DA 4FM1A 3R1XA 3CI5A 3VEOA 3ULDA 4DV4K 3P39A 5AQYA 1IH7A 4M42A 2RKIA 2QXLA 3C95A 1SL0A 3SJHA 1YVUA 1XNQK 1YJWN 2P9PA 3UKUB 3I0SA 3E9OA 4FLZA 3OY9A 4B1ZA 1WNSA 2Q0UA 5CR4A 2X78A 4DUZK 2Q0RA 4KREA 3K59A 4FJNA 3NAEA 1D9DA 2D0OA 4ILHA 5KRTA 4DR3K 1ASWA 4KHYA 5M1QA 1GLAG 1XNRK 4PL7A 4Q5VA 1JCGA 3VEWA 4CK3A 4IFYA 3UB5A 4FJ5A 3HVRA 4B3RK 4KTQA 3PUFA 1E4FT 4JI1K 4CD1A 2FF3B 1NJIO 4IFVA 1X3MA 1ZBIA 4FJXA 1YJNN 1JCEA 1B9DA 5E26A 2ZWHA 4M3WA 3SBGA 3SAHA 4DF8A 3IG1A 1HPZA 1VSMA 3SQ4A 4KHPK 2ZQBA 1WSGA 2FF6A 4W5TA 3P31A 3L8BA 3ENBA 4MLEA 5LMNK 2F8SA 4DQPA 1QZ6A 3J7YP 3AAPA 1VQNN 1KVCA 3WQTA 4BR5A 1J53A 3ATUA 3VENA 2Z1IA 3E66A 1MWMA 5C10A 1ITGA 2EX3A 2Q3SA 3HVTA 1CZBA 3MWTA 3P83D 1N34K 4OX9K 3M8RA 1IJJA 3QERA 3M6GA 2A6AA 4M3ZA 2UYTA 4E7IA 4N41A 4M3UA 2G8IA 4ELUA 3NVMA 1GOAA 5EY4A 1XMQK 3EE9A 3ULEB 2B4JA 1T6CA 3O08A 3CQYA 1KXPA 2A1SA 2HVIA 3DWLA 2KZMA 2DPNA 1VAZA 4FL9A 4FWQA 2V7ZA 4LY7A 3OYEA 2HVHA 5M1KA 3THWA 1U47A 3FGUA 1HKGA 1RBSA 3U9DA 5JLFA 1VK0A 3CJBA 1TVRA 1S9EA 4O44A 5BRDA 4KAZA 1LWFA 5BPNA 3OYHA 1T6DA 4J8FA 3MN7A 3VQEA 2YV0X 2HHUA 4C1NK 3K5OA 4KV8A 3WNEA 4CI6A 4KBOA 4KRFA 1NKBA 3MK6A 3LDLA 2IS3A 1GLCG 4KO0A 4NO7A 4DTUA 1RNHA 1HJRA 3V1OA 1Z26A 4GMJB 3LDNA 1BIZA 4JHDA 1EKEA 5KQDA 1EETA 4ISGA 3RVCA 3OVNA 4NLCA 3KK2A 2JWKA 2O8EB 2GWJA 2DFHA 1HYZA 2ZD1A 1CXUA 2BUPA 5AQSA 3SMPA 3VETA 3L3VA 4MO4A 4QCLA 4K0KK 1UWBA 4CW7B 2IC3A 4B1VA 4FOEA 4JK7A 1TYQB 4KH6A 3ZX0A 3QIPA 3KLIA 2XHBA 3A5OC 1SKRA 2I5JA 2FBTA 3O4QA 3DAWA 4RW8A 1CZ9A 3E9PA 4K41A 1JXBA 4MLHA 4CJSA 4HUGA 3KTQA 4YOYA 4DLEA 3THWB 1OH8A 4B9LA 1RDAA 3C65A 4NYNA 1XC9A 5KPRA 4DG1A 1QZ5A 2PBDA 3H1VX 2F7TA 5JS1A 3ZT4A 4CJEA 3OYDA 4IG0A 2IVNA 1L5UA 1YTUA 3AO2A 2YHBA 3G71N 5DM6L 2FC0A 3BGRA 5AQOA 1SQKA 3D7EO 1U4BA 5KI6A 4JHDB 3SAGA 2IIRA 4BDPA 3D0PA 2OZMA 3V6DA 4XH1A 4OGEA 3L3UA 3C6UA 1HNWK 1HKBA 4LSNA 4FWRA 2QK9A 4BRLA 3ZCMA 1QSYA 4W5NA 4CJ4A 4DSFA 3OYJA 2E4LA 4CFDA 4JK8A 2E2PA 3SI6A 4H0TB 2HHQA 3N4PA 2V52B 1BI4B 2ZF5O 1GLLO 4KHWA 4CFBA 1O1WA 2RN2A 4YOWA 3HZ6A 1RTHA 4Y1CA 1HNXK 2ASPA 2GX9A 2J4RA 3OYMA 1LAVA 2P5OA 2GELA 2FSJA 5KGXA 2PY5A 5BN8A 4BQZA 4E7KA 2O8CA 3LP3A 1J5OA 3PX0A 4JV5K 2QKBA 4CGJA 1SL1A 1QSLA 4OVLA 4N47A 1OH7A 3ISNC 4K43A 4LF7K 1JLQA 4DU4A 1T3VA 4Z4HA 3AY9A 3RR7A 3IRXA 2EWSA 1Z25A 3DLLL 1WSIA 3SPYA 4M3RA 3U3YA 3HPGA 1RBRA 5I9EB 3VOVA 2QA4N 4EZ6A 4FO0A 4BC2A 5BPMA 5K14A 3CYMA 3OS2A 3VQ5A 1U2VA 3HPHA 2D1KA 3C7NA 1U6ZA 3PX4A 3V9SA 1LCUA 1ZBLA 3K5LA 1C1AA 3U3GA 4I9LA 2GUPA 1N5YA 3KIOA 4B1UB 3FE1A 4CGHA 5EOYA 2WBNA 4ID5A 4AHCA 2ASMA 4HUEA 4IDKA 3IAYA 4DR1K 3RMCA 4CZJA 4B9SA 3U8XA 4KI6A 2O8CB 4MO5A 2HF3A 4CHQA 4KTWA 3DOKA 3BDPA 5AQNA 1TGOA 4FLYA 3WXKA 4FK0A 4CZMA 2RE2A 5CYQA 1QHTA 4KB0A 5J2MA 1C0MA 1SKWA 4EP5A 4EP4A 2NZTA 3DXKA 3SMSA 4BROA 1JLEA 2O8BA 4LH5A 4IFEA 2YX6A 3QESA 1HYSA 5CHIA 1TV6A 3CCEN 3VGMA 3C0BA 1RGIA 4B8AB 2NRTA 5GAHP 2D0CA 2YNFA 2LSNA 3VQCA 1DT9A 3SK3A 4U67L 4FPAA 1IBMK 4CGDA 4A5BA 2OA8A 3EYZA 4BVPA 3C7NB 3MWPA 3OYAA 1VQON 4CK1A 3TAPA 3TR8A 4CE9A 3BZCA 5F0XA 4A59A 2R7YA 3CJ7A 4PKGA 1F21A 4RCHA 3AGKA 4FVUA 3LDSA 4GNIA 1J9AA 5C2FA 3A5LC 5ADXA 5J2QA 3H3NO 3ZSQA 1HRHA 4FXDA 2RF2A 1C0GA 3VQ8A 2KHOA 3A5MC 3MXIA 1NOYA 4GV9A 4FVMA 5AFUH 3VQQA 5GINA 4TSXA 1KD1O 5AQHA 3KK1A 2O8DA 2P9NA 1WAFA 3V1RA 3DXKB 3LL3A 4CJPA 5CZ1A 1Q8IA 2B6AA 4BRFA 3NF9A 2Q31A 3AVBA 3LWLA 4JI7K 3F2KA 4OJRA 4JKDA 2P9IA 4B8CA 4BR7A 4BC3A 4QAGA 5KGWA 2FXUA 4AILC 2OZSA 3CCRN 3DRPA 4CIFA 4KHNA 1T05A 3I8BA 5AQZA 2YHYA 1QVFM 3VESA 1ATRA 3PV8A 2P9LB 1IG9A 2A41A 2KZZA 2P51A 3MMVA 3R8EA 4O0JA 4CIGA 3TARA 4LFAK 3TAQA 4FLUA 4H4OA 4HWIA 4O4GA 4JD2B 1KVAA 3A5NC 4KI4A 2X74A 4LD0A 1C0FA 4YOVA 1RT2A 3LDOA 1LOTB 3BP8A 1ATSA 4CJUA 4DSLA 5AQGA 3GOIA 2EHGA 3ENHA 3ZX3A 4EZ9A 2QKKA 2VYPA 5BR9A 5DK5A 3AVLA 4CHYA 4QOZB 3CD6N 3OBYA 5AZIA 3LP2A 4DTRA 3QEIA 4N5SA 4GV6A 3NE6A 4C8OA 2P9NB 5HRNA 4RW7A 1XHZA 1WBDA 3SLCA 1HX1A 2D0BA 3N4QA 1VSFA 1U04A 2ZGZA 2BTFA 4O55A 2XY5A 4Z4EA 3KD5E 1RT1A 3A0IX 1C0UA 5H1SQ 3V9UA 2QWOA 5FPNA 2KFZA 1JLBA 4YOXA 4Z4IA 4CERA 5GIOA 2WC9A 3WT0A 2PYJA 4IO8A 4B1WB 4A2AA 1DLOA 4FJIA 1ESVA 3H6EA 4PKHA 4FOIA 4U7BA 1SUQA 3CM6A 3SZ2A 3DLKA 1W7AA 1I94K 2W42A 1VRUA 1S1VA 4CHZA 1WLJA 5MLCQ 1UOCA 5BPLA 3MEGA 1WSEA 1HNIA 3CPEA 3S3NA 4F4KA 4JI3K 3OS1A 4FWNA 2E2OA 1W9HA 3GDQA 1UAXA 5BN9A 4DKWA 5C2DA 3F5TA 4ISFA 4BE2A 4FLWA 4BDZA 1L3TA 3VMFB 5J2PA 3E01A 5AZIB 4A5AA 3S3OA 2Q36A 1S5JA 2P9SB 4H5TA 3HOTA 3CFOA 4C23A 4W5RA 1NGIA 4DMNA 4JI0K 3VQ7A 1NK7A 1OVYA 3THYA 1GLDG 4O5FA 3ZT1A 1SL2A 4BC5A 4EAHD 1S3XA 2PAVA 1WSJA 3VA0A 4IEEA 4BG8A 3O1BA 3SPZA 5JS2A 1CZAN 2GTDA 2FSNA 2HNDA 3VN5A 4FWOA 3TAMA 5JMVA 4O8UA 2NNWA 1BL3A 4M63C 3QB0A 4YNQA 5AQTA 2NRRA 4ZTJA 1WAJA 3EZWA 4O8KA 3CC4N 4EHUA 3NGYA 3MEDA 4JRPA 1QE1A 4LF4K 3AA5X 1VSEA 4H5VA 1ZBHA 2H3GX 3V1QA 1JL1A 2OPQA 3RMAA 2P9UA 3QBXA 3KLHA 2X6SA 3J8AA 3CF5L 1ASVA 4BDYA 3AV9A 3BZKA 4BRMA 3P1GA 3HPOA 4V19S 2G8HA 3G4SN 1RT3A 1NM1A 3CPWM 1K8KA 3U6FA 3EY1A 3CIPA 4LF9K 3G10A 3ZSXA 1HQEA 4BVOA 4OPJA 4CF2A 4FCYA 4CJRA 1V4TA 1VSKA 3Q7BA 2JLEA 2WONA 1VQLN 3SBTA 3THYB 4BRCA 4NCAA 3Q7CA 4M45A 1MWKA 3VQAA 4F3OA 3T7ZA 2G8KA 3FFIA 2YCHA 5J2NA 4DS4A 2E2QA 4IOXA 4JLHA 3ZEUA 3HP9A 1Z6RA 1JJ2M 2DTUA 2D4WA 3IDHA 4B3TK 3VA3A 4F2SA 4FJ7A 1L3UA 5C25A 2P9PB 1IBKK 2CH5A 2XY8A 1S22A 1Q9XA 2QWPA 4H5NA 4PHTX 1RTJA 4DSJA 4DUYK 1DKGD 5F2RA 4E89A 2PZSA 4GKKK 3IUCA 3RWUA 4JYAK 4DV3K 3DMJA 2NRZA 4DTSA 3M3ZA 4ID1A 4DFPA 3KLGA 1VRTA 4HTUA 1BA1A 3AAQA 1DEJA 1K8KB 2VG7A 3V9ZA 4CECA 3ATVA 1NKEA 3EO3A 4YOTA 1CXQA 3ZSOA 5FPDA 1NK6A 2OANA 3KWGA 3MCAB 1WSFA 4A61A 4BR9A 3KK3A 4MDAA 3MCPA 3ZSZA 4NLBA 2QWLA 2IGIA 5LL6Z 3V4IA 3U4LA 3VGLA 3THXA 1ZBFA 4J2BA 3AGRA 4IJNA 2RPIA 1IKWA 3L0QA 1YHQN 3NBPA 1TUYA 3MDQA 4C8NA 3NGZA 4PWDA 3ZSYA 5HROA 5HOOA 3FZFA 3AARA 2OYQA 2QWQA 1BG3A 3R6MA 1Y97A 1S1TA 3UE5A 2I7NA 3A2FA 2ATQA 3AVJA 1B92A 2NRWA 5A2QO 1LV5A 2UXCK 4AHSA 1XQSC 2FBYA 5AQMA 4CJLA 1B9FA 4CZKA 2HBKA 5FRNA 4AHUA 1S1WA 3MX2A 1SAZA 1YITN 2CH6A 2P9KA 2QW9A 4WFNL 4CJFA 4FLXA 1FK9A 3AVCA 4W5OA 2HHTA 3WUHA 5C12A 3QEWA 1ZXOA 3KZBA 5AQRA 2W41A 2F8TA 3D2FA 2XY6A 3MECA 2GUIA 1TKTA 2F9WA 2JGUA 4XIUA 4BACA 3I8DA 1YAGA 2UXDK 4CJQA 2IOCA 1WOQA 2NRVA 1EWQA 3THXB 4KFBA 1KVBA 3AVNA 3T19A 1D8YA 4UQGA 1I3AA 1GLEG 4FK4A 3TANA 4CZEA 5KTQA 2IAJA 2BDPA 1TKXA 4ICLA 4CEAA 5BRHA 2HSTA 4DQQA 4R79A 3QBWA 1LAWA 2XRIA 3RMDA 1A5XA 1NMDA 1M90O 1BQMA 5AQUA 1X9JA 1M1KO 2W40A 4WE1A 4FWSA 2IDOA 1ZBUA 2VWKA 1IKXA 2P9KB 5BREA 1T44A 4GVEA 3LDPA 1FXXA 3SNNA 4DTJA 1IO2A 4JI4K 3DLEA 3IFRA 1BIUA 3J7AP 1RDWX 4ILJA 4R5PA 1NGDA 3TAEA 3D2FB 3UKRA 4FWKA 4IEIA 1XHXA 5FROA 1TAUA 5ELZA 2QM1A 3HSCA 3KLEA 4KH5A 4BR2A 5F1XA 4DFMA 4JN4A 3D2EA 3M8QA 4F3TA 3WNHA 4H0PA 3OHRA 3QDKA 4DV5K 1K73O 2YHAA 4CJ5A 4DFKA 2OPPA 4OGCA 1T7PA 4CZGA 3BF3A 2O8FA 1R0AA 4AH9A 4K8XA 4FJHA 3KD1E 1S6QA 1RDBA 3LZJA 1S6PA 3HTVA 1UA0A 1P90A 3PX6A 4N76A 1NU0A 2DFFA 3DLHA 3NF8A 4IOAL 3UIQA 2W6KA 3L4IA 5KPZA 1K6YA 4QS7A 4CFAA 4EHTA 4E7HA 4DQRA 4IZ9A 4NB4A 3T3FA 2E5LK 1HLUA 4C8KA 2F4VK 2HBJA 2WFBA 3KWIA 4RWTA 5EVZA 3MEEA 3CQ8A 3AVKA 4QS8A 1YJ9N 1BQNA 3CHWA 1HPMA 4YDUC 1NBWA 3HK2A 4JKHA 4LC9B 1RT7A 3AO5A 4DU3A 3LALA 1JLFA 3TTDA 1HJOA 2VQFK 3B6PA 3OYCA 3LAKA 4CIEA 1NK5A 4DV2K 4FPBA 1L3SA 4CEEA 3K5NA 1GOBA 3EKUA 5ADXH 1NJZA 3D2EB 3O5BA 4NXMK 3WNFA 3DLRA 3F9KA 2GV9A 1KLNA 3CERA 4IJAA 3EKSA 3TTCA 3WXMB 2HB5A 4ZHRA 3OYGA 2UUBK 3OYBA 4AM6A 4CF8A 4DQSA 1RILA 4ELVA 4JK9A 1NGCA 1NGHA 1BCOA 3NGIA 4DSEA 4OLBA 3S41A 1RDCA 1RT6A 5AZJA 4H0YB 4A2BA 3LP0A 4JKEA 4B9VA 3QFPA 5AQPA 1ZC6A 3DXMA 1U45A 4DR6K 3OYNA 4E7LA 1A5VA 3DI6A 4JKGA 4F2RA 2V51B 3ALYA 3ZSVA 4CZFA 2E20A 2ZE2A 4FWMA 1NGGA 1U2VB 3VQ4A 2KKZA 4FW2A 3DOLA 1WBBA 4YFUA 1VSHA 4CHOA 4PY5A 4HHTA 4JEPA 4YHHK 2NLXA 5GAEP 3VQDA 3PY8A 1K9MO 4CGFA 2PFUA 2E8AA 3VF6A 2ZJPL 2DY4A 3F9MA 4BY9C 1GLBG 5TKWA 1RDUA 2O4GA 2NRXA 2AJQA 3ENOA 4CZLA 3SV4A 3WNGA 1YVNA 4RW6A 1NGJA 4DTNA 1RT5A 4PKIA 1QVGM 3HP6A 2VG5A 1R59O 1VQPN 5HRPA 2OPSA 1C1BA 3THVA 1RDDA 5SZTA 1JLGA 2VGMA 5FLXO 4FLVA 4Y0WA 4BE0A 1BUPA 1BOTO 5LMUK 1NJWA 3VQ6A 3SYZA 2KW4A 4I2PA 2ZJQL 4BC4A 2O8BB 4H5WA 5FDLA 4LF6K 4FZZA 3O4NA 3OJUA 2X6NA 5E84A 1VQ9N 3AVAA 3GE1A 5SWMA 3M5RA 4H0XB 2HHSA 1WSHA 3SUQA 4JKGB 1A5WA 3H3OB 3TPQA 2HNYA 3IMXA 3O9TA 3MX5A 3ASMA 4BREA 4ELTA 3FZKA 3CMEN 5EXWA 2Y1JA 3WXJA 5AQVA 2D0AA 2ZJRL 2YHXA 4X62K 2IVPA 1VQ5N 1BISA 3MN9A 3O1WA 2YNHA 5E41A 4DU1A 4GW6A 5AQWA 4DR7K 4Z4CA 4CBXA 4LFBK 3W0LA 3MAQA 2YJFA 1VSJA 3I56N 3H46O 1HUXA 4L3QA 2VGNA 3J80O 5KQ8A 1EXQA 3TAGA 2O8DB 1QQMA 3DRRA 4FM2A 3MXJA 4O0IA 5LY3A 4CBWA 2XY7A 3DRSA 1D4XA 4FWLA 3ZSWA 3JAMO 1NGAA 2QTDA 4H03B 3VF4A 4JI2K 3TWHA 3VERA 2P9IB 4F9OA 1HYVA 3QO9A 5LJVA 3L6QA 5D3GA 3K9JA 2OPRA 5AFUA 3SQ2A 1IKYA 1REVA 3WXIA 3AVHA 3B6OA 4AF1A 1IV0A 4JI6K 4PL8A 1G15A 4PQUA 2Q97A 4RTFD 4FZYA 4CF1A 4AM7A 3QETA 3RSEA 2HHVA 4YDUA 3M8SA 3KK7A 1Q9YA 1YI2N 3CCQN 3OA9A 4MFBA 1VQ4N 1J6ZA 2A3ZA 1NGEA 1HNZK 2WUSA 3OYKA 4JRQA 4I7FA 2F96A 2E6MA 3SCXA 1LWCA 4OKKA 3CQXA 1RT4A 4WQ5C 5AQKA 4CCHA 4BRQA 4Z4FA 4FM0A 4B9MA 1FKOA 3OJSA 2FLOA 3HL8A 4Z0UA 4FLTA 1X9MA 1I39A 4BRIA 5HL7L 1LW0A 4BGAA 4EFHA 4CBUA 3OYLA 3S3MA 3NF6A 2A40A 4OKJA 4B9TA 1KQSM 4GV3A 2G8VA 4CGGA 4G9ZA 1DGKN 3JYTA 1VSDA 4LF5K 3TABA 4DHYA 2BH1A 3FLCO 5LJWA 1CLQA 4B3MK 3C6AA 1NJXA 4DCHA 4FJJA 4JKFA 3BEXA 3SJJA 3IKMA 3NH0A 4LF8K 3LM9A 1JKHA 3OTOK 2BGGA 3KHYA 1VQ8N 3LZIA 4E7JA 1C0TA 3NVKA 1V4SA 4GKJK 4DTMA 3RSEB 1EQYA 3QEXA 1NJYA 1BGXT 3O3GA 5AQQA 3SAFA 2UXBK 3CC2N 4DV1K 3V9XA 5GAGP 3P38A 5I3UA 4CF9A 1YT3A 4W5QA 4DTOA 3W3DA 4M3XA 5M1NA 4C8LA 4CK2A 2ASOA 1FJGK 3QLHA 5AR0A 2HHWA 2NUBA 3QICA 4H4MA 3SQ0A 3VEYA 1VSLA 4IDHA 1X3NA 2OCEA 4CESA 4BR4A 2OTJN 2YHWA 2BE2A 4IBNA 2DFEA 1N33K 1EP4A 4FJ8A 2HBLA 4DR5K 4ZTFA 1SS6A 4DLGA 2A5XA 1W0HA 1N8RO 5AQLA 3RR8A 1H1VA 4M7XA 4CFCA 3O3FA 4X64K 3VQ9A 2HMIA 1TUUA 4CJ7A 3OBWA 4DSIA 1OKJA 3O9QA 1T03A 4FJGA 4CHNA 2FBXA 2Z1GA 2XO7A 3VQPA 5GADP 4HTLA 3R3LA 3O9RA 4M41A 3ULEA 1T8EA 5HRSA 1N36K 1K8AO 3EEQA 1JL2A 2E1YA 3CXCM 3K57A 2HMPA 3LDQA 2F9TA 2YKMA 1KRPA 1YXQA 1X9WA 4OO1J 4DTXA 5FPMA 5C42A 5IWAK 2UUCK 3P5JA 4DF4A 3VF2A 2GBZA 2Z1HA 3HSTB 4BRPA 3T1AA 1NG9A 4H0OA 1XUPO 4CEZA 4O5BA 3JSMA 3TSQA 3ZSRA 1VSIA 1OH5A 4B9NA 2FBVA 4DQIA 3WXLA 4WQ4C 1NOZA 1S9GA 3FZMA 2D0PA 4K42A 2ZGYA 3HM8A 2QWRA 2Q2RA 2P9UB 1Y64A 3I55N 1G99A 3PO5A 4H8KA 3QFUA 3KJVA 1QQNA 4CF0A 2Z1JA 1YF5L 4IWVA 3DJCA 4BGBA 4EIAA 3T1HK 4XH5A 4IG3A 1NGBA 2O8EA 4AQYK 4JI5K 4DS5A 4M7YA 3TSUA 4OLAA 4CHPA 5HP1A 3AO3A 1RFQA 1TYQA 3VEVA 3CFRA 1WB9A 3DLGA 1SZ2A 3AO4A 3QNNA 4E1JA 2AA4A 2ETJA 3ZX2A 3ZEUB 1TKDA 4BRDA 1X1PA 4KPYA 1SV5A 2GWKA 3JS6A 4KHQA 2VCPA 1XC3A 1TKZA 1TL3A 4KH4A 4JS4A 2HHHK 3PSFA 4IO9L 1YTAA 1DTTA 2V7YA 1RCHA 3HYFA 3E9LA 4BRHA 1RTIA 3C94A 2ZM6K 3VEXA 3CCMN 2PYLA 4BWMA 1TL1A 4HUFA 4I2QA 4WQ5A 3OS0A 4J2AA 3BUZB 1SKSA 3AO1A 3K58A 4CD3A 1E3MA 3I0RA 4HVJA 4OKEA 1QTMA 1IBLK 1DTQA 3WEEA 4FWPA 3O9UA 1KSPA 3NCIA 4NXNK 2YI1A 4A57A 3V9WA 5AQJA 3M8PA 3EZ5A 3AVMA 4BWJA 3B8AX 2HF4A 3RRGA 3PSIA 3CG7A 3QINA 3CJ1A 4IXCA 3H08A 1BI4A 1GLFO 2G8UA 3PLAA 1LW2A 4KTZA 2QWMA 4JKAA 1Q82O 3LPUA 3ID6A 4WF9L 5AQFA 4CVNE 3HO1A 1WUAA 3FZLA 4YOUA 4OPAA 4CEOA 1C6VA 1NGFA 3H1QA 4NCBA 3NHGA 4JKCA 2E88A 3EE8A 3L2WA 2Y1IA 3GG4A 4JNEA 4DR2K 1KTQA 1BWFO 2GEMA 3WEEB 3LPTA 2CGJA 3VGKA 5JLHA 1QHAA 3LM2A 2Q1NA 4GY2B 3SUPA 4FJLA 2QWNA 3VQBA 3E1YA 3AVFA 1W97L 4JS5A 4DB3A 3OW2M 1KAZA 3OYIA 2RHKA 2KLAA 3CFPA 1TK8A 1QS4A 2ITGA 1MDUB 4Z4GA 3ZT2A 4FK2A 4BRNA 3LANA 3HXMA 1D5AA 3NH2A 3EL2A 4FW1A 1Q18A 1JLCA 2VG6A 4CJTA 1RTDA 5M1PA 4C1NI 4DQ8A 1ATNA 4DV7K 5BRFA 3SQ1A 4I9QA 2ITMA 1KFDA 1NNEA 3ZT0A 1MU2A 3CMAN 5DMRA 4YY3K 1RBTA 2YNIA 1O13A 1KC8O 4E1NA 2A1RA 3PIPL 3TSPA 3VPZA 4E1MA 3K9KA 5JVGL 3RMBA 4A62A 3G25A 4WQ4A 1RBUA 3A8YA 4FZXC 3D6RA 2I7PA 4CEBA 3NDKA 5EU7A 1L3VA 4HCBA 3G6EN 4X65K 1BCMA 3GL1A 4JAXA 1U48A 4I6MA 3CCLN 3VTHA 1IKVA 3CCVN 1N6QA 1ZBSA 4G1QA 3PO4A 3KKSA 4AHTA 4ILGB 3UKRB 1XMOK 4CJWA 1YIJN 4C8MA 3D45A 3CCSN 5CE3A 1QSSA 3LAMA 1FKPA 1IG8A 4HCCA 4NYFA 1KAXA 5IT9O 1BO5O 2E2NA 1KFSA 4KHUA 5KPTA 4CJ3A 4UY8O 4DR4K 1HNVA 1OVQA 1VQ6N 5I42A 2P1JA 1TK0A 4BQLA 4GVMA 4B1XB 2O8FB 4M3TA 3TTFA 2D5RA 4KKOA 1NK8A 1QQOA 4CJKA 3FR0A 2KQ2A 4YORA 4M3YA 2YKNA 3PIOL 3F73A 5KRSA 3ZLJA 1WN7A 1Q7YO 2CGLA 2VQEK 3AA2A 2VWJA 3HT3A 5B8HA 3CCUN 5DM7L 4K25A 5C15A 1JLAA 4JI8K 5HLFA 3ZETA 2AP1A
chains in the Genus database with same CATH topology
2FC0A 4CJVA 3G0ZA 4RW4A 4RW9A 2XY8A 4MFBA 3BGRA 1Q9XA 1UA1A 1U4BA 1RTJA 5HRRA 4DSJA 5KI6A 3L2RA 3OYKA 1LWEA 4JRQA 4BDPA 1TAQA 4I7FA 5J1EA 2F96A 2E6MA 3ITHA 3D0PA 4E89A 3V6DA 3SCXA 1LWCA 2PZSA 4OKKA 4OGEA 3SUOA 1RT4A 3L3UA 3C6UA 5C24A 4CCHA 3RWUA 4LSNA 1GOCA 3DMJA 4MQ3A 4Z4FA 4DTSA 2G8FA 1NK4A 2QK9A 4ID1A 4FM0A 2OZMA 3AVGA 3ZCMA 4B9MA 1FKOA 3OJSA 1QSYA 3HL8A 4Z0UA 4CJ4A 4DSFA 4FLTA 4DFPA 3OYJA 4FZYA 1X9MA 2E4LA 4CFDA 3KLGA 1I39A 2HNZA 1VRTA 4HTUA 3SI6A 1NK9A 1LW0A 2HHQA 1BI4B 2VG7A 1XWLA 4E3SA 3OYLA 2HHVA 4FJKA 4KHWA 5CZ2A 4CFBA 1O1WA 3NF6A 2RN2A 4OKJA 4CECA 3V9ZA 3S3MA 1XI1A 4B9TA 1RTHA 4Y1CA 1NKEA 3AA4A 1CXQA 3ZSOA 1NK6A 1ZYQA 2G8VA 4CGGA 4N56A 1WSFA 3OYMA 1LAVA 2P5OA 3JYTA 3KK3A 1VSDA 4CEDA 3ZSZA 5KGXA 2PY5A 3V4IA 2IGIA 3TABA 4E7KA 2YNGA 1CLQA 1ZBFA 3LP3A 1NJXA 4FJJA 4J2BA 3HM9A 2RPIA 4DTPA 1J5OA 3PX0A 3HJFA 3SJJA 2HW3A 3NH0A 3CM5A 1IKWA 1JKHA 4CGJA 2QKBA 3DYAA 2BGGA 3NBPA 1SL1A 3LZIA 4E7JA 1QSLA 4C8NA 1C0TA 3NGZA 3TAFA 4PWDA 4OVLA 3ZSYA 4N47A 1NK0A 5HROA 4DTMA 3ISNC 3QEXA 2OYQA 1NJYA 4KB1A 4CGIA 1BGXT 5FRMA 1JLQA 4DU4A 3O3GA 4Z4HA 3RR7A 3IRXA 1Z25A 1WSIA 3SPYA 4RG8A 5T7BA 4M3RA 4F8RA 2KTQA 2KFNA 4LSLA 3V9XA 3U3YA 3HPGA 1KLMA 1RBRA 1Y97A 1S1TA 3MXMA 3A2FA 2ATQA 3AVJA 1B92A 5I3UA 1LV5A 4CF9A 1YT3A 4W5QA 4B08A 4AHSA 2FBYA 4CJLA 4DTOA 4DWIA 1B9FA 2BANA 1C1CA 1S1UA 4EZ6A 4E19A 5FRNA 4C8LA 4CK2A 4AHUA 1S1WA 3QLHA 5K14A 3CYMA 3OS2A 3VQ5A 2HHWA 1RBVA 2NUBA 4FJMA 1J54A 3HPHA 4H4MA 1VSLA 4CJFA 3LWMA 3SQ0A 4PUOA 4CESA 4FLXA 1FK9A 3AVCA 1JXEA 4W5OA 3V9SA 3K5LA 3PX4A 1ZBLA 1BHLA 1C1AA 1QQCA 2HHXA 4IBNA 2BE2A 4Q0BA 3QEWA 3U3GA 4I9LA 1N5YA 2DFEA 1EP4A 4FJ8A 4ZTFA 3KIOA 4DLGA 1ASUA 1W0HA 4CGHA 3L2VA 2F8TA 4OPKA 2XY6A 3MECA 2GUIA 3RR8A 1TKTA 2JGUA 4ID5A 4CFCA 4XIUA 3O3FA 4IKFA 3C6TA 4FYDA 3VQ9A 4BACA 4AHCA 3I8DA 5CYMA 2HMIA 4HUEA 3K5MA 4IDKA 3IAYA 4CJQA 3RTVA 3RMCA 4DSIA 2IOCA 1T03A 4FJGA 4B9SA 4CHNA 2FBXA 2Z1GA 4KI6A 2XO7A 3VQPA 2WOMA 4KFBA 4CHQA 1KVBA 3AVNA 4KTWA 3DOKA 3T19A 4PA1A 4UQGA 1TK5A 1D8YA 1TGOA 4FLYA 1I3AA 4M41A 4FK0A 3SUNA 5CYQA 1QHTA 1T8EA 5HRSA 4KB0A 4J2EA 4FK4A 3TANA 5J2MA 1JL2A 1S1XA 1C0MA 3K57A 5KTQA 1HMVA 2IAJA 3QEVA 1SKWA 4EP5A 1EX4A 2BDPA 2YKMA 4EP4A 1TKXA 3K2PA 4AHVA 1JLEA 4ICLA 1KRPA 1HQUA 4LH5A 4CEAA 1X9WA 3NH1A 3NF7A 4DTXA 5C42A 4DQQA 3QESA 3L2UA 1HYSA 1LAWA 3P5JA 2XRIA 4DF4A 4J2DA 1TV6A 3RMDA 3TI0A 1U49A 1A5XA 2GBZA 2Z1HA 3AA3A 3HSTB 1KCFA 4B8AB 3NFAA 3KKRA 1BQMA 3T1AA 4NCGA 4BE1A 2D0CA 2YNFA 3V81A 3S9HA 4CEZA 3RRHA 2LSNA 4O5BA 4WE1A 3VQCA 3ZSRA 1VSIA 3JSMA 4B9NA 2FBVA 4LH4A 4DQIA 4CEFA 3QEPA 4CGDA 1NOZA 1S9GA 2IDOA 1ZBUA 2VWKA 1IKXA 2OA8A 3EYZA 4Y1DA 4CEQA 2QXFA 3ZT3A 3PO5A 3OYAA 3LP1A 3AVIA 4H8KA 1FXXA 3SNNA 3KJVA 4DTJA 3DLBA 5HBMA 4CK1A 4CF0A 3O3HA 3TAPA 1NKCA 2Z1JA 3TR8A 1IO2A 4CE9A 4DFJA 3DLEA 1BIUA 4FJ9A 4R5PA 3IS9A 4IG3A 3TAEA 4B3OA 2R7YA 4DSKA 1F21A 1XHXA 5FROA 1TAUA 3L2QA 4DS5A 3KLEA 3LDSA 1J9AA 4OLAA 4CHPA 4DFMA 3SV3A 5HP1A 5J2QA 3AO3A 3ZSQA 3M8QA 4F3TA 1HRHA 4FXDA 2RF2A 3WNHA 3VQ8A 3MXIA 1NOYA 2O4IA 3CFRA 4FVMA 2YHAA 3DLGA 3VQQA 4KHSA 4CJ5A 4DFKA 3AO4A 2OPPA 2B5JA 4OGCA 4TSXA 5CY4A 3QNNA 1X9SA 1T7PA 3KK1A 1R0AA 4AH9A 2ETJA 4K8XA 1TKDA 1WAFA 4AHRA 4FJHA 3KD1E 1S6QA 3V1RA 4CJPA 1RDBA 1X1PA 1SV5A 1Q8IA 3QIOA 5CZ1A 3LZJA 2B6AA 4KPYA 4KHQA 3NF9A 1S6PA 1TKZA 1UA0A 1TL3A 3OYFA 3PX6A 4N76A 3AVBA 2G8WA 3LWLA 4JS4A 4K8ZA 2DFFA 3DLHA 3NF8A 4B9UA 3KLFA 4OJRA 4L8RB 1YTAA 3UIQA 3QNOA 1D9FA 1DTTA 4B8CA 1K6YA 2P5GA 3DM2A 4CFAA 2E6LA 1RCHA 3HYFA 4QAGA 5KGWA 4E7HA 4FM1A 4AILC 4E0DA 1RTIA 2OZSA 3C94A 3T3FA 3DRPA 2PYLA 4CIFA 3ULDA 4C8KA 4BWMA 4KHNA 1TL1A 4HUFA 4I2QA 1IH7A 3MEEA 3OS0A 4M42A 4J2AA 2RKIA 3AVKA 3CQ8A 1SKSA 1BQNA 3C95A 3AO1A 1T05A 3K58A 1SL0A 3HK2A 1YVUA 1RT7A 3I0RA 4HVJA 4OKEA 1QTMA 2HHTA 3AO5A 4DU3A 3I0SA 1DTQA 3PV8A 1IG9A 3LALA 4FLZA 1JLFA 2KZZA 3OY9A 1WNSA 2P51A 3BDPA 3B6PA 3OYCA 3LAKA 2X78A 4O0JA 4CIGA 3TARA 3TAQA 4FLUA 4H4OA 4O4GA 4CIEA 1NK5A 3NCIA 3K59A 1KSPA 4FJNA 4KREA 3NAEA 1D9DA 1L3SA 4CEEA 3K5NA 1KVAA 1NK8A 3V9WA 4KI4A 1GOBA 2X74A 3M8PA 4LD0A 5KRTA 3AVMA 3EZ5A 1RT2A 4BWJA 1ASWA 1NJZA 4CJUA 3RRGA 4DSLA 3WNFA 3DLRA 3F9KA 2GV9A 1KLNA 4KHYA 2EHGA 3CG7A 3QINA 3H08A 4EZ9A 1BI4A 2QKKA 4Q5VA 2G8UA 5DK5A 3AVLA 4CHYA 4QOZB 2HB5A 4ZHRA 3OYGA 1LW2A 4KTZA 4CK3A 4IFYA 3OYBA 4FJ5A 3QEIA 3LP2A 4DTRA 4N5SA 3HVRA 3NE6A 4C8OA 5HRNA 4KTQA 3PUFA 3LPUA 4RW7A 4CF8A 4DQSA 1XHZA 1RILA 2D0BA 4ELVA 1VSFA 1U04A 4IFVA 3HO1A 1ZBIA 4FJXA 4O55A 2XY5A 4Z4EA 1B9DA 1BCOA 3NGIA 4DSEA 4OLBA 3KD5E 4M3WA 1RDCA 1RT6A 4CEOA 4DF8A 1C6VA 1HPZA 3IG1A 1VSMA 1RT1A 3LP0A 1C0UA 3V9UA 4B9VA 4NCBA 3NHGA 2KFZA 3SQ4A 1U45A 1JLBA 2ZQBA 1WSGA 3OYNA 3L2WA 4E7LA 4W5TA 1A5VA 3DI6A 4F2RA 3ALYA 3L8BA 3ZSVA 4CERA 2Y1IA 2ZE2A 4Z4IA 2PYJA 2F8SA 3VQ4A 1DLOA 4FW2A 1KTQA 4DQPA 4FJIA 3DOLA 4YFUA 1VSHA 4CHOA 4PY5A 4HHTA 1KVCA 3LPTA 3VQDA 3PY8A 1J53A 4CGFA 3SUPA 2Z1IA 4FJLA 2DY4A 1SUQA 3CM6A 3VQBA 3SZ2A 3AVFA 2O4GA 3DLKA 1ITGA 2EX3A 2Q3SA 3HVTA 1CZBA 4JS5A 3P83D 2AJQA 2W42A 3SV4A 1VRUA 1S1VA 3WNGA 4CHZA 3M8RA 3OYIA 3CFPA 1WLJA 4RW6A 3QERA 4DTNA 1UOCA 1TK8A 4M3ZA 1RT5A 1QS4A 2ITGA 3HP6A 4E7IA 3MEGA 2VG5A 4N41A 4M3UA 1WSEA 4Z4GA 1HNIA 3ZT2A 2G8IA 4FK2A 4F4KA 3S3NA 5HRPA 4ELUA 2OPSA 3OS1A 1C1BA 1GOAA 3LANA 3HXMA 1D5AA 1W9HA 3NH2A 1UAXA 3THVA 1RDDA 5SZTA 1JLGA 2B4JA 4FW1A 1JLCA 4FLVA 4BE0A 2A1SA 2VG6A 4BE2A 2HVIA 4FLWA 4CJTA 4BDZA 1L3TA 1RTDA 5J2PA 3E01A 1NJWA 2KZMA 3VQ6A 3S3OA 3SYZA 2KW4A 4I2PA 1S5JA 4LY7A 3OYEA 3SQ1A 4I9QA 4M3XA 3CFOA 2HVHA 1KFDA 5FDLA 4W5RA 3ZT0A 4DMNA 1U47A 1MU2A 3VQ7A 1NK7A 4FZZA 3O4NA 5DMRA 3OJUA 3ZT1A 1RBTA 1RBSA 1SL2A 2X6NA 2YNIA 1VK0A 4E1NA 1WSJA 1TVRA 1S9EA 3AVAA 4O44A 3VA0A 2A1RA 4KAZA 1LWFA 3SPZA 3OYHA 4E1MA 5JS2A 3RMBA 3VQEA 5SWMA 2YV0X 2HHUA 2HHSA 1WSHA 3SUQA 1A5WA 2HNDA 3VN5A 3K5OA 4KV8A 1RBUA 3TAMA 3WNEA 4FZXC 2HNYA 1BL3A 4CEBA 3NDKA 4YNQA 5EU7A 3ASMA 1NKBA 1L3VA 4HCBA 4ZTJA 4KRFA 1WAJA 1BCMA 2IS3A 4ELTA 1U48A 4KO0A 4DTUA 1IKVA 1RNHA 1HJRA 3V1OA 1Z26A 4GMJB 3NGYA 3MEDA 2Y1JA 1BIZA 1N6QA 1EKEA 4G1QA 4JRPA 1QE1A 3PO4A 3KKSA 2D0AA 4AHTA 1EETA 3KK2A 3OVNA 3AA5X 4CJWA 1VSEA 2DFHA 1BISA 1ZBHA 4C8MA 3D45A 1HYZA 2ZD1A 1CXUA 3V1QA 1JL1A 2OPQA 3L3VA 2YNHA 5E41A 4DU1A 3LAMA 3RMAA 1UWBA 4GW6A 1FKPA 1QSSA 4HCCA 2IC3A 4QCLA 4NYFA 4Z4CA 3KLHA 2X6SA 1ASVA 4BDYA 3AV9A 3P1GA 3HPOA 3MAQA 1KFSA 4KHUA 1VSJA 4CJ3A 3QIPA 2G8HA 1HNVA 1RT3A 3KLIA 5I42A 2XHBA 2P1JA 3U6FA 1TK0A 1SKRA 4FJ7A 3EY1A 2I5JA 2FBTA 1EXQA 3O4QA 4RW8A 3TAGA 1CZ9A 4GVMA 4M3TA 1JXBA 2D5RA 3DRRA 3G10A 4FM2A 4KKOA 3ZSXA 1HQEA 4CJSA 3MXJA 4HUGA 4O0IA 4OPJA 4CF2A 4CJKA 4FCYA 4CJRA 2KQ2A 3KTQA 4DLEA 4M3YA 4W5NA 2YKNA 2XY7A 1VSKA 3DRSA 2JLEA 2WONA 4B9LA 1RDAA 3F73A 3ZSWA 1XC9A 4NYNA 5KRSA 4NCAA 4M45A 4DG1A 3TWHA 1WN7A 5D3GA 1HYVA 3QO9A 3VQAA 4F3OA 2G8KA 2OPRA 3SQ2A 3FFIA 1IKYA 1REVA 3AA2A 2VWJA 5JS1A 3ZT4A 3HT3A 5J2NA 3AVHA 3B6OA 4CJEA 3OYDA 4DS4A 4IG0A 1G15A 4JLHA 3HP9A 1L5UA 4PQUA 2DTUA 1YTUA 3VA3A 3AO2A 2YHBA 4CF1A 1JLAA 3QETA 4F2SA 5HLFA 1L3UA 3M8SA 1Q9YA 5C25A 4DQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FC0 A;  4CJV A;  3G0Z A;  4RW4 A;  4RW9 A;  2XY8 A;  4MFB A;  3BGR A;  1Q9X A;  1UA1 A;  1U4B A;  1RTJ A;  5HRR A;  4DSJ A;  5KI6 A;  3L2R A;  3OYK A;  1LWE A;  4JRQ A;  4BDP A;  1TAQ A;  4I7F A;  5J1E A;  2F96 A;  2E6M A;  3ITH A;  3D0P A;  4E89 A;  3V6D A;  3SCX A;  1LWC A;  2PZS A;  4OKK A;  4OGE A;  3SUO A;  1RT4 A;  3L3U A;  3C6U A;  5C24 A;  4CCH A;  3RWU A;  4LSN A;  1GOC A;  3DMJ A;  4MQ3 A;  4Z4F A;  4DTS A;  2G8F A;  1NK4 A;  2QK9 A;  4ID1 A;  4FM0 A;  2OZM A;  3AVG A;  3ZCM A;  4B9M A;  1FKO A;  3OJS A;  1QSY A;  3HL8 A;  4Z0U A;  4CJ4 A;  4DSF A;  4FLT A;  4DFP A;  3OYJ A;  4FZY A;  1X9M A;  2E4L A;  4CFD A;  3KLG A;  1I39 A;  2HNZ A;  1VRT A;  4HTU A;  3SI6 A;  1NK9 A;  1LW0 A;  2HHQ A;  1BI4 B;  2VG7 A;  1XWL A;  4E3S A;  3OYL A;  2HHV A;  4FJK A;  4KHW A;  5CZ2 A;  4CFB A;  1O1W A;  3NF6 A;  2RN2 A;  4OKJ A;  4CEC A;  3V9Z A;  3S3M A;  1XI1 A;  4B9T A;  1RTH A;  4Y1C A;  1NKE A;  3AA4 A;  1CXQ A;  3ZSO A;  1NK6 A;  1ZYQ A;  2G8V A;  4CGG A;  4N56 A;  1WSF A;  3OYM A;  1LAV A;  2P5O A;  3JYT A;  3KK3 A;  1VSD A;  4CED A;  3ZSZ A;  5KGX A;  2PY5 A;  3V4I A;  2IGI A;  3TAB A;  4E7K A;  2YNG A;  1CLQ A;  1ZBF A;  3LP3 A;  1NJX A;  4FJJ A;  4J2B A;  3HM9 A;  2RPI A;  4DTP A;  1J5O A;  3PX0 A;  3HJF A;  3SJJ A;  2HW3 A;  3NH0 A;  3CM5 A;  1IKW A;  1JKH A;  4CGJ A;  2QKB A;  3DYA A;  2BGG A;  3NBP A;  1SL1 A;  3LZI A;  4E7J A;  1QSL A;  4C8N A;  1C0T A;  3NGZ A;  3TAF A;  4PWD A;  4OVL A;  3ZSY A;  4N47 A;  1NK0 A;  5HRO A;  4DTM A;  3ISN C;  3QEX A;  2OYQ A;  1NJY A;  4KB1 A;  4CGI A;  1BGX T;  5FRM A;  1JLQ A;  4DU4 A;  3O3G A;  4Z4H A;  3RR7 A;  3IRX A;  1Z25 A;  1WSI A;  3SPY A;  4RG8 A;  5T7B A;  4M3R A;  4F8R A;  2KTQ A;  2KFN A;  4LSL A;  3V9X A;  3U3Y A;  3HPG A;  1KLM A;  1RBR A;  1Y97 A;  1S1T A;  3MXM A;  3A2F A;  2ATQ A;  3AVJ A;  1B92 A;  5I3U A;  1LV5 A;  4CF9 A;  1YT3 A;  4W5Q A;  4B08 A;  4AHS A;  2FBY A;  4CJL A;  4DTO A;  4DWI A;  1B9F A;  2BAN A;  1C1C A;  1S1U A;  4EZ6 A;  4E19 A;  5FRN A;  4C8L A;  4CK2 A;  4AHU A;  1S1W A;  3QLH A;  5K14 A;  3CYM A;  3OS2 A;  3VQ5 A;  2HHW A;  1RBV A;  2NUB A;  4FJM A;  1J54 A;  3HPH A;  4H4M A;  1VSL A;  4CJF A;  3LWM A;  3SQ0 A;  4PUO A;  4CES A;  4FLX A;  1FK9 A;  3AVC A;  1JXE A;  4W5O A;  3V9S A;  3K5L A;  3PX4 A;  1ZBL A;  1BHL A;  1C1A A;  1QQC A;  2HHX A;  4IBN A;  2BE2 A;  4Q0B A;  3QEW A;  3U3G A;  4I9L A;  1N5Y A;  2DFE A;  1EP4 A;  4FJ8 A;  4ZTF A;  3KIO A;  4DLG A;  1ASU A;  1W0H A;  4CGH A;  3L2V A;  2F8T A;  4OPK A;  2XY6 A;  3MEC A;  2GUI A;  3RR8 A;  1TKT A;  2JGU A;  4ID5 A;  4CFC A;  4XIU A;  3O3F A;  4IKF A;  3C6T A;  4FYD A;  3VQ9 A;  4BAC A;  4AHC A;  3I8D A;  5CYM A;  2HMI A;  4HUE A;  3K5M A;  4IDK A;  3IAY A;  4CJQ A;  3RTV A;  3RMC A;  4DSI A;  2IOC A;  1T03 A;  4FJG A;  4B9S A;  4CHN A;  2FBX A;  2Z1G A;  4KI6 A;  2XO7 A;  3VQP A;  2WOM A;  4KFB A;  4CHQ A;  1KVB A;  3AVN A;  4KTW A;  3DOK A;  3T19 A;  4PA1 A;  4UQG A;  1TK5 A;  1D8Y A;  1TGO A;  4FLY A;  1I3A A;  4M41 A;  4FK0 A;  3SUN A;  5CYQ A;  1QHT A;  1T8E A;  5HRS A;  4KB0 A;  4J2E A;  4FK4 A;  3TAN A;  5J2M A;  1JL2 A;  1S1X A;  1C0M A;  3K57 A;  5KTQ A;  1HMV A;  2IAJ A;  3QEV A;  1SKW A;  4EP5 A;  1EX4 A;  2BDP A;  2YKM A;  4EP4 A;  1TKX A;  3K2P A;  4AHV A;  1JLE A;  4ICL A;  1KRP A;  1HQU A;  4LH5 A;  4CEA A;  1X9W A;  3NH1 A;  3NF7 A;  4DTX A;  5C42 A;  4DQQ A;  3QES A;  3L2U A;  1HYS A;  1LAW A;  3P5J A;  2XRI A;  4DF4 A;  4J2D A;  1TV6 A;  3RMD A;  3TI0 A;  1U49 A;  1A5X A;  2GBZ A;  2Z1H A;  3AA3 A;  3HST B;  1KCF A;  4B8A B;  3NFA A;  3KKR A;  1BQM A;  3T1A A;  4NCG A;  4BE1 A;  2D0C A;  2YNF A;  3V81 A;  3S9H A;  4CEZ A;  3RRH A;  2LSN A;  4O5B A;  4WE1 A;  3VQC A;  3ZSR A;  1VSI A;  3JSM A;  4B9N A;  2FBV A;  4LH4 A;  4DQI A;  4CEF A;  3QEP A;  4CGD A;  1NOZ A;  1S9G A;  2IDO A;  1ZBU A;  2VWK A;  1IKX A;  2OA8 A;  3EYZ A;  4Y1D A;  4CEQ A;  2QXF A;  3ZT3 A;  3PO5 A;  3OYA A;  3LP1 A;  3AVI A;  4H8K A;  1FXX A;  3SNN A;  3KJV A;  4DTJ A;  3DLB A;  5HBM A;  4CK1 A;  4CF0 A;  3O3H A;  3TAP A;  1NKC A;  2Z1J A;  3TR8 A;  1IO2 A;  4CE9 A;  4DFJ A;  3DLE A;  1BIU A;  4FJ9 A;  4R5P A;  3IS9 A;  4IG3 A;  3TAE A;  4B3O A;  2R7Y A;  4DSK A;  1F21 A;  1XHX A;  5FRO A;  1TAU A;  3L2Q A;  4DS5 A;  3KLE A;  3LDS A;  1J9A A;  4OLA A;  4CHP A;  4DFM A;  3SV3 A;  5HP1 A;  5J2Q A;  3AO3 A;  3ZSQ A;  3M8Q A;  4F3T A;  1HRH A;  4FXD A;  2RF2 A;  3WNH A;  3VQ8 A;  3MXI A;  1NOY A;  2O4I A;  3CFR A;  4FVM A;  2YHA A;  3DLG A;  3VQQ A;  4KHS A;  4CJ5 A;  4DFK A;  3AO4 A;  2OPP A;  2B5J A;  4OGC A;  4TSX A;  5CY4 A;  3QNN A;  1X9S A;  1T7P A;  3KK1 A;  1R0A A;  4AH9 A;  2ETJ A;  4K8X A;  1TKD A;  1WAF A;  4AHR A;  4FJH A;  3KD1 E;  1S6Q A;  3V1R A;  4CJP A;  1RDB A;  1X1P A;  1SV5 A;  1Q8I A;  3QIO A;  5CZ1 A;  3LZJ A;  2B6A A;  4KPY A;  4KHQ A;  3NF9 A;  1S6P A;  1TKZ A;  1UA0 A;  1TL3 A;  3OYF A;  3PX6 A;  4N76 A;  3AVB A;  2G8W A;  3LWL A;  4JS4 A;  4K8Z A;  2DFF A;  3DLH A;  3NF8 A;  4B9U A;  3KLF A;  4OJR A;  4L8R B;  1YTA A;  3UIQ A;  3QNO A;  1D9F A;  1DTT A;  4B8C A;  1K6Y A;  2P5G A;  3DM2 A;  4CFA A;  2E6L A;  1RCH A;  3HYF A;  4QAG A;  5KGW A;  4E7H A;  4FM1 A;  4AIL C;  4E0D A;  1RTI A;  2OZS A;  3C94 A;  3T3F A;  3DRP A;  2PYL A;  4CIF A;  3ULD A;  4C8K A;  4BWM A;  4KHN A;  1TL1 A;  4HUF A;  4I2Q A;  1IH7 A;  3MEE A;  3OS0 A;  4M42 A;  4J2A A;  2RKI A;  3AVK A;  3CQ8 A;  1SKS A;  1BQN A;  3C95 A;  3AO1 A;  1T05 A;  3K58 A;  1SL0 A;  3HK2 A;  1YVU A;  1RT7 A;  3I0R A;  4HVJ A;  4OKE A;  1QTM A;  2HHT A;  3AO5 A;  4DU3 A;  3I0S A;  1DTQ A;  3PV8 A;  1IG9 A;  3LAL A;  4FLZ A;  1JLF A;  2KZZ A;  3OY9 A;  1WNS A;  2P51 A;  3BDP A;  3B6P A;  3OYC A;  3LAK A;  2X78 A;  4O0J A;  4CIG A;  3TAR A;  3TAQ A;  4FLU A;  4H4O A;  4O4G A;  4CIE A;  1NK5 A;  3NCI A;  3K59 A;  1KSP A;  4FJN A;  4KRE A;  3NAE A;  1D9D A;  1L3S A;  4CEE A;  3K5N A;  1KVA A;  1NK8 A;  3V9W A;  4KI4 A;  1GOB A;  2X74 A;  3M8P A;  4LD0 A;  5KRT A;  3AVM A;  3EZ5 A;  1RT2 A;  4BWJ A;  1ASW A;  1NJZ A;  4CJU A;  3RRG A;  4DSL A;  3WNF A;  3DLR A;  3F9K A;  2GV9 A;  1KLN A;  4KHY A;  2EHG A;  3CG7 A;  3QIN A;  3H08 A;  4EZ9 A;  1BI4 A;  2QKK A;  4Q5V A;  2G8U A;  5DK5 A;  3AVL A;  4CHY A;  4QOZ B;  2HB5 A;  4ZHR A;  3OYG A;  1LW2 A;  4KTZ A;  4CK3 A;  4IFY A;  3OYB A;  4FJ5 A;  3QEI A;  3LP2 A;  4DTR A;  4N5S A;  3HVR A;  3NE6 A;  4C8O A;  5HRN A;  4KTQ A;  3PUF A;  3LPU A;  4RW7 A;  4CF8 A;  4DQS A;  1XHZ A;  1RIL A;  2D0B A;  4ELV A;  1VSF A;  1U04 A;  4IFV A;  3HO1 A;  1ZBI A;  4FJX A;  4O55 A;  2XY5 A;  4Z4E A;  1B9D A;  1BCO A;  3NGI A;  4DSE A;  4OLB A;  3KD5 E;  4M3W A;  1RDC A;  1RT6 A;  4CEO A;  4DF8 A;  1C6V A;  1HPZ A;  3IG1 A;  1VSM A;  1RT1 A;  3LP0 A;  1C0U A;  3V9U A;  4B9V A;  4NCB A;  3NHG A;  2KFZ A;  3SQ4 A;  1U45 A;  1JLB A;  2ZQB A;  1WSG A;  3OYN A;  3L2W A;  4E7L A;  4W5T A;  1A5V A;  3DI6 A;  4F2R A;  3ALY A;  3L8B A;  3ZSV A;  4CER A;  2Y1I A;  2ZE2 A;  4Z4I A;  2PYJ A;  2F8S A;  3VQ4 A;  1DLO A;  4FW2 A;  1KTQ A;  4DQP A;  4FJI A;  3DOL A;  4YFU A;  1VSH A;  4CHO A;  4PY5 A;  4HHT A;  1KVC A;  3LPT A;  3VQD A;  3PY8 A;  1J53 A;  4CGF A;  3SUP A;  2Z1I A;  4FJL A;  2DY4 A;  1SUQ A;  3CM6 A;  3VQB A;  3SZ2 A;  3AVF A;  2O4G A;  3DLK A;  1ITG A;  2EX3 A;  2Q3S A;  3HVT A;  1CZB A;  4JS5 A;  3P83 D;  2AJQ A;  2W42 A;  3SV4 A;  1VRU A;  1S1V A;  3WNG A;  4CHZ A;  3M8R A;  3OYI A;  3CFP A;  1WLJ A;  4RW6 A;  3QER A;  4DTN A;  1UOC A;  1TK8 A;  4M3Z A;  1RT5 A;  1QS4 A;  2ITG A;  3HP6 A;  4E7I A;  3MEG A;  2VG5 A;  4N41 A;  4M3U A;  1WSE A;  4Z4G A;  1HNI A;  3ZT2 A;  2G8I A;  4FK2 A;  4F4K A;  3S3N A;  5HRP A;  4ELU A;  2OPS A;  3OS1 A;  1C1B A;  1GOA A;  3LAN A;  3HXM A;  1D5A A;  1W9H A;  3NH2 A;  1UAX A;  3THV A;  1RDD A;  5SZT A;  1JLG A;  2B4J A;  4FW1 A;  1JLC A;  4FLV A;  4BE0 A;  2A1S A;  2VG6 A;  4BE2 A;  2HVI A;  4FLW A;  4CJT A;  4BDZ A;  1L3T A;  1RTD A;  5J2P A;  3E01 A;  1NJW A;  2KZM A;  3VQ6 A;  3S3O A;  3SYZ A;  2KW4 A;  4I2P A;  1S5J A;  4LY7 A;  3OYE A;  3SQ1 A;  4I9Q A;  4M3X A;  3CFO A;  2HVH A;  1KFD A;  5FDL A;  4W5R A;  3ZT0 A;  4DMN A;  1U47 A;  1MU2 A;  3VQ7 A;  1NK7 A;  4FZZ A;  3O4N A;  5DMR A;  3OJU A;  3ZT1 A;  1RBT A;  1RBS A;  1SL2 A;  2X6N A;  2YNI A;  1VK0 A;  4E1N A;  1WSJ A;  1TVR A;  1S9E A;  3AVA A;  4O44 A;  3VA0 A;  2A1R A;  4KAZ A;  1LWF A;  3SPZ A;  3OYH A;  4E1M A;  5JS2 A;  3RMB A;  3VQE A;  5SWM A;  2YV0 X;  2HHU A;  2HHS A;  1WSH A;  3SUQ A;  1A5W A;  2HND A;  3VN5 A;  3K5O A;  4KV8 A;  1RBU A;  3TAM A;  3WNE A;  4FZX C;  2HNY A;  1BL3 A;  4CEB A;  3NDK A;  4YNQ A;  5EU7 A;  3ASM A;  1NKB A;  1L3V A;  4HCB A;  4ZTJ A;  4KRF A;  1WAJ A;  1BCM A;  2IS3 A;  4ELT A;  1U48 A;  4KO0 A;  4DTU A;  1IKV A;  1RNH A;  1HJR A;  3V1O A;  1Z26 A;  4GMJ B;  3NGY A;  3MED A;  2Y1J A;  1BIZ A;  1N6Q A;  1EKE A;  4G1Q A;  4JRP A;  1QE1 A;  3PO4 A;  3KKS A;  2D0A A;  4AHT A;  1EET A;  3KK2 A;  3OVN A;  3AA5 X;  4CJW A;  1VSE A;  2DFH A;  1BIS A;  1ZBH A;  4C8M A;  3D45 A;  1HYZ A;  2ZD1 A;  1CXU A;  3V1Q A;  1JL1 A;  2OPQ A;  3L3V A;  2YNH A;  5E41 A;  4DU1 A;  3LAM A;  3RMA A;  1UWB A;  4GW6 A;  1FKP A;  1QSS A;  4HCC A;  2IC3 A;  4QCL A;  4NYF A;  4Z4C A;  3KLH A;  2X6S A;  1ASV A;  4BDY A;  3AV9 A;  3P1G A;  3HPO A;  3MAQ A;  1KFS A;  4KHU A;  1VSJ A;  4CJ3 A;  3QIP A;  2G8H A;  1HNV A;  1RT3 A;  3KLI A;  5I42 A;  2XHB A;  2P1J A;  3U6F A;  1TK0 A;  1SKR A;  4FJ7 A;  3EY1 A;  2I5J A;  2FBT A;  1EXQ A;  3O4Q A;  4RW8 A;  3TAG A;  1CZ9 A;  4GVM A;  4M3T A;  1JXB A;  2D5R A;  3DRR A;  3G10 A;  4FM2 A;  4KKO A;  3ZSX A;  1HQE A;  4CJS A;  3MXJ A;  4HUG A;  4O0I A;  4OPJ A;  4CF2 A;  4CJK A;  4FCY A;  4CJR A;  2KQ2 A;  3KTQ A;  4DLE A;  4M3Y A;  4W5N A;  2YKN A;  2XY7 A;  1VSK A;  3DRS A;  2JLE A;  2WON A;  4B9L A;  1RDA A;  3F73 A;  3ZSW A;  1XC9 A;  4NYN A;  5KRS A;  4NCA A;  4M45 A;  4DG1 A;  3TWH A;  1WN7 A;  5D3G A;  1HYV A;  3QO9 A;  3VQA A;  4F3O A;  2G8K A;  2OPR A;  3SQ2 A;  3FFI A;  1IKY A;  1REV A;  3AA2 A;  2VWJ A;  5JS1 A;  3ZT4 A;  3HT3 A;  5J2N A;  3AVH A;  3B6O A;  4CJE A;  3OYD A;  4DS4 A;  4IG0 A;  1G15 A;  4JLH A;  3HP9 A;  1L5U A;  4PQU A;  2DTU A;  1YTU A;  3VA3 A;  3AO2 A;  2YHB A;  4CF1 A;  1JLA A;  3QET A;  4F2S A;  5HLF A;  1L3U A;  3M8S A;  1Q9Y A;  5C25 A;  4DQR A; 
#chains in the Genus database with same CATH topology
 4CJV A;  3G0Z A;  4RW4 A;  4RW9 A;  2QI2 A;  2IVO A;  2UU9 K;  4I6M B;  5HRR A;  3L2R A;  2YJE A;  1W2B M;  1LWE A;  4BRA A;  1TAQ A;  5J1E A;  1UA1 A;  3ITH A;  3KVG A;  4BR0 A;  3SUO A;  1OH6 A;  5C24 A;  1GOC A;  4MQ3 A;  3VTI A;  2G8F A;  3BY5 A;  1NK4 A;  4WFA L;  3AVG A;  2P9L A;  3T69 A;  5C0Y A;  2HNZ A;  4OPH A;  1NK9 A;  4XEI A;  1XWL A;  4E3S A;  4FJK A;  5CZ2 A;  1XI1 A;  4B3O A;  5JIC A;  4JD2 A;  1BA0 A;  3AA4 A;  1ZYQ A;  4N56 A;  3CJ9 A;  4CED A;  3T1Y K;  5M1O A;  1J5E K;  2YNG A;  3HM9 A;  4DTP A;  1GLJ O;  1MA9 B;  3HJF A;  2HW3 A;  5AZJ B;  3CM5 A;  3DYA A;  3DXM B;  3TAF A;  4B1Y B;  2E1Z A;  1JCF A;  1NK0 A;  3HBT A;  1NLV A;  2A42 A;  3GBT A;  4BRG A;  3ID8 A;  1HR0 K;  3O80 A;  3FZH A;  3ZET B;  4KB1 A;  3HRG A;  4CGI A;  3TU5 A;  5FRM A;  4WFB L;  3CET A;  3O4W A;  4RG8 A;  5T7B A;  1Q81 O;  4F8R A;  2KFN A;  2KTQ A;  3J7Z O;  4LSL A;  4BG9 A;  1KLM A;  3JXU A;  3MXM A;  3WQU A;  4B08 A;  4CZI A;  4DWI A;  4MDB A;  2BAN A;  1C1C A;  1S1U A;  4E19 A;  3CCJ N;  1VQ7 N;  1RBV A;  4FJM A;  1J54 A;  3LWM A;  4PUO A;  3O8M A;  4LFC K;  1JXE A;  1BHL A;  2HHX A;  1QQC A;  3J81 O;  3K0S A;  2OTL N;  4Q0B A;  1S72 N;  3O6W A;  1FW6 A;  5GIP A;  1ASU A;  3CJC A;  1ILY A;  3L2V A;  4OPK A;  2W6L A;  1NWK A;  4FYD A;  4H5R A;  4IKF A;  3C6T A;  5CYM A;  3K5M A;  3RTV A;  4B3S K;  1HKC A;  1BU6 O;  3R9P A;  2QEX N;  3I33 A;  4JKB A;  3HOS A;  3HI0 A;  2WOM A;  4PA1 A;  3NMU A;  1TK5 A;  2CGK A;  3SUN A;  1EO1 A;  3MN6 A;  4J2E A;  4FSV A;  3CC7 N;  1S1X A;  4XH4 A;  5AQI A;  1HMV A;  3QEV A;  1EX4 A;  3BF1 A;  3K2P A;  4AHV A;  2P9S A;  1HQU A;  5TKY A;  3NH1 A;  3NF7 A;  1VQK N;  3QML A;  5BR8 K;  2JWL A;  3L2U A;  1YUW A;  4J2D A;  1VQM N;  1BDG A;  3TI0 A;  1U49 A;  3AA3 A;  1KCF A;  3NFA A;  3KKR A;  4BE1 A;  3S9H A;  4NCG A;  3V81 A;  5AJ3 K;  3RRH A;  4DV6 K;  4X66 K;  4CZH A;  4IOC L;  3P4I A;  4LH4 A;  4CEF A;  3QEP A;  4H0V B;  3VEZ A;  5JVH L;  3ZYY X;  3U9Z A;  4Y1D A;  4CEQ A;  3H45 C;  4WCE L;  1P8Z A;  2QXF A;  3ZT3 A;  1NMN A;  3UKU A;  5AQX A;  4DV0 K;  3LP1 A;  1Z05 A;  3AVI A;  3DLB A;  2UUA K;  5HBM A;  3O3H A;  1NKC A;  4DFJ A;  2HBM A;  4FJ9 A;  1N32 K;  3IS9 A;  4ISE A;  4DSK A;  4QS9 A;  3L2Q A;  1Q86 O;  5FPE A;  3M1F A;  1KAY A;  3SV3 A;  3EN9 A;  4Z94 A;  2VWB A;  5M1F A;  3C6H A;  3FFK B;  4B9Q A;  2O4I A;  2HOE A;  2FSK A;  3L4Q A;  4KHS A;  1EWR A;  1E4G T;  4WYB A;  5CY4 A;  5EX5 A;  2B5J A;  1X9S A;  4BRK A;  2NRH A;  4AHR A;  3QIO A;  1VHX A;  3OYF A;  3MN5 A;  4K8Z A;  2G8W A;  4L8R B;  3CJA A;  4B9U A;  3KLF A;  2WTU A;  3QNO A;  1D9F A;  3O9S A;  2P5G A;  3DM2 A;  2E6L A;  4E0D A;  4FM1 A;  3R1X A;  3CI5 A;  3VEO A;  3ULD A;  4DV4 K;  3P39 A;  5AQY A;  1IH7 A;  4M42 A;  2RKI A;  2QXL A;  3C95 A;  1SL0 A;  3SJH A;  1YVU A;  1XNQ K;  1YJW N;  2P9P A;  3UKU B;  3I0S A;  3E9O A;  4FLZ A;  3OY9 A;  4B1Z A;  1WNS A;  2Q0U A;  5CR4 A;  2X78 A;  4DUZ K;  2Q0R A;  4KRE A;  3K59 A;  4FJN A;  3NAE A;  1D9D A;  2D0O A;  4ILH A;  5KRT A;  4DR3 K;  1ASW A;  4KHY A;  5M1Q A;  1GLA G;  1XNR K;  4PL7 A;  4Q5V A;  1JCG A;  3VEW A;  4CK3 A;  4IFY A;  3UB5 A;  4FJ5 A;  3HVR A;  4B3R K;  4KTQ A;  3PUF A;  1E4F T;  4JI1 K;  4CD1 A;  2FF3 B;  1NJI O;  4IFV A;  1X3M A;  1ZBI A;  4FJX A;  1YJN N;  1JCE A;  1B9D A;  5E26 A;  2ZWH A;  4M3W A;  3SBG A;  3SAH A;  4DF8 A;  3IG1 A;  1HPZ A;  1VSM A;  3SQ4 A;  4KHP K;  2ZQB A;  1WSG A;  2FF6 A;  4W5T A;  3P31 A;  3L8B A;  3ENB A;  4MLE A;  5LMN K;  2F8S A;  4DQP A;  1QZ6 A;  3J7Y P;  3AAP A;  1VQN N;  1KVC A;  3WQT A;  4BR5 A;  1J53 A;  3ATU A;  3VEN A;  2Z1I A;  3E66 A;  1MWM A;  5C10 A;  1ITG A;  2EX3 A;  2Q3S A;  3HVT A;  1CZB A;  3MWT A;  3P83 D;  1N34 K;  4OX9 K;  3M8R A;  1IJJ A;  3QER A;  3M6G A;  2A6A A;  4M3Z A;  2UYT A;  4E7I A;  4N41 A;  4M3U A;  2G8I A;  4ELU A;  3NVM A;  1GOA A;  5EY4 A;  1XMQ K;  3EE9 A;  3ULE B;  2B4J A;  1T6C A;  3O08 A;  3CQY A;  1KXP A;  2A1S A;  2HVI A;  3DWL A;  2KZM A;  2DPN A;  1VAZ A;  4FL9 A;  4FWQ A;  2V7Z A;  4LY7 A;  3OYE A;  2HVH A;  5M1K A;  3THW A;  1U47 A;  3FGU A;  1HKG A;  1RBS A;  3U9D A;  5JLF A;  1VK0 A;  3CJB A;  1TVR A;  1S9E A;  4O44 A;  5BRD A;  4KAZ A;  1LWF A;  5BPN A;  3OYH A;  1T6D A;  4J8F A;  3MN7 A;  3VQE A;  2YV0 X;  2HHU A;  4C1N K;  3K5O A;  4KV8 A;  3WNE A;  4CI6 A;  4KBO A;  4KRF A;  1NKB A;  3MK6 A;  3LDL A;  2IS3 A;  1GLC G;  4KO0 A;  4NO7 A;  4DTU A;  1RNH A;  1HJR A;  3V1O A;  1Z26 A;  4GMJ B;  3LDN A;  1BIZ A;  4JHD A;  1EKE A;  5KQD A;  1EET A;  4ISG A;  3RVC A;  3OVN A;  4NLC A;  3KK2 A;  2JWK A;  2O8E B;  2GWJ A;  2DFH A;  1HYZ A;  2ZD1 A;  1CXU A;  2BUP A;  5AQS A;  3SMP A;  3VET A;  3L3V A;  4MO4 A;  4QCL A;  4K0K K;  1UWB A;  4CW7 B;  2IC3 A;  4B1V A;  4FOE A;  4JK7 A;  1TYQ B;  4KH6 A;  3ZX0 A;  3QIP A;  3KLI A;  2XHB A;  3A5O C;  1SKR A;  2I5J A;  2FBT A;  3O4Q A;  3DAW A;  4RW8 A;  1CZ9 A;  3E9P A;  4K41 A;  1JXB A;  4MLH A;  4CJS A;  4HUG A;  3KTQ A;  4YOY A;  4DLE A;  3THW B;  1OH8 A;  4B9L A;  1RDA A;  3C65 A;  4NYN A;  1XC9 A;  5KPR A;  4DG1 A;  1QZ5 A;  2PBD A;  3H1V X;  2F7T A;  5JS1 A;  3ZT4 A;  4CJE A;  3OYD A;  4IG0 A;  2IVN A;  1L5U A;  1YTU A;  3AO2 A;  2YHB A;  3G71 N;  5DM6 L;  2FC0 A;  3BGR A;  5AQO A;  1SQK A;  3D7E O;  1U4B A;  5KI6 A;  4JHD B;  3SAG A;  2IIR A;  4BDP A;  3D0P A;  2OZM A;  3V6D A;  4XH1 A;  4OGE A;  3L3U A;  3C6U A;  1HNW K;  1HKB A;  4LSN A;  4FWR A;  2QK9 A;  4BRL A;  3ZCM A;  1QSY A;  4W5N A;  4CJ4 A;  4DSF A;  3OYJ A;  2E4L A;  4CFD A;  4JK8 A;  2E2P A;  3SI6 A;  4H0T B;  2HHQ A;  3N4P A;  2V52 B;  1BI4 B;  2ZF5 O;  1GLL O;  4KHW A;  4CFB A;  1O1W A;  2RN2 A;  4YOW A;  3HZ6 A;  1RTH A;  4Y1C A;  1HNX K;  2ASP A;  2GX9 A;  2J4R A;  3OYM A;  1LAV A;  2P5O A;  2GEL A;  2FSJ A;  5KGX A;  2PY5 A;  5BN8 A;  4BQZ A;  4E7K A;  2O8C A;  3LP3 A;  1J5O A;  3PX0 A;  4JV5 K;  2QKB A;  4CGJ A;  1SL1 A;  1QSL A;  4OVL A;  4N47 A;  1OH7 A;  3ISN C;  4K43 A;  4LF7 K;  1JLQ A;  4DU4 A;  1T3V A;  4Z4H A;  3AY9 A;  3RR7 A;  3IRX A;  2EWS A;  1Z25 A;  3DLL L;  1WSI A;  3SPY A;  4M3R A;  3U3Y A;  3HPG A;  1RBR A;  5I9E B;  3VOV A;  2QA4 N;  4EZ6 A;  4FO0 A;  4BC2 A;  5BPM A;  5K14 A;  3CYM A;  3OS2 A;  3VQ5 A;  1U2V A;  3HPH A;  2D1K A;  3C7N A;  1U6Z A;  3PX4 A;  3V9S A;  1LCU A;  1ZBL A;  3K5L A;  1C1A A;  3U3G A;  4I9L A;  2GUP A;  1N5Y A;  3KIO A;  4B1U B;  3FE1 A;  4CGH A;  5EOY A;  2WBN A;  4ID5 A;  4AHC A;  2ASM A;  4HUE A;  4IDK A;  3IAY A;  4DR1 K;  3RMC A;  4CZJ A;  4B9S A;  3U8X A;  4KI6 A;  2O8C B;  4MO5 A;  2HF3 A;  4CHQ A;  4KTW A;  3DOK A;  3BDP A;  5AQN A;  1TGO A;  4FLY A;  3WXK A;  4FK0 A;  4CZM A;  2RE2 A;  5CYQ A;  1QHT A;  4KB0 A;  5J2M A;  1C0M A;  1SKW A;  4EP5 A;  4EP4 A;  2NZT A;  3DXK A;  3SMS A;  4BRO A;  1JLE A;  2O8B A;  4LH5 A;  4IFE A;  2YX6 A;  3QES A;  1HYS A;  5CHI A;  1TV6 A;  3CCE N;  3VGM A;  3C0B A;  1RGI A;  4B8A B;  2NRT A;  5GAH P;  2D0C A;  2YNF A;  2LSN A;  3VQC A;  1DT9 A;  3SK3 A;  4U67 L;  4FPA A;  1IBM K;  4CGD A;  4A5B A;  2OA8 A;  3EYZ A;  4BVP A;  3C7N B;  3MWP A;  3OYA A;  1VQO N;  4CK1 A;  3TAP A;  3TR8 A;  4CE9 A;  3BZC A;  5F0X A;  4A59 A;  2R7Y A;  3CJ7 A;  4PKG A;  1F21 A;  4RCH A;  3AGK A;  4FVU A;  3LDS A;  4GNI A;  1J9A A;  5C2F A;  3A5L C;  5ADX A;  5J2Q A;  3H3N O;  3ZSQ A;  1HRH A;  4FXD A;  2RF2 A;  1C0G A;  3VQ8 A;  2KHO A;  3A5M C;  3MXI A;  1NOY A;  4GV9 A;  4FVM A;  5AFU H;  3VQQ A;  5GIN A;  4TSX A;  1KD1 O;  5AQH A;  3KK1 A;  2O8D A;  2P9N A;  1WAF A;  3V1R A;  3DXK B;  3LL3 A;  4CJP A;  5CZ1 A;  1Q8I A;  2B6A A;  4BRF A;  3NF9 A;  2Q31 A;  3AVB A;  3LWL A;  4JI7 K;  3F2K A;  4OJR A;  4JKD A;  2P9I A;  4B8C A;  4BR7 A;  4BC3 A;  4QAG A;  5KGW A;  2FXU A;  4AIL C;  2OZS A;  3CCR N;  3DRP A;  4CIF A;  4KHN A;  1T05 A;  3I8B A;  5AQZ A;  2YHY A;  1QVF M;  3VES A;  1ATR A;  3PV8 A;  2P9L B;  1IG9 A;  2A41 A;  2KZZ A;  2P51 A;  3MMV A;  3R8E A;  4O0J A;  4CIG A;  3TAR A;  4LFA K;  3TAQ A;  4FLU A;  4H4O A;  4HWI A;  4O4G A;  4JD2 B;  1KVA A;  3A5N C;  4KI4 A;  2X74 A;  4LD0 A;  1C0F A;  4YOV A;  1RT2 A;  3LDO A;  1LOT B;  3BP8 A;  1ATS A;  4CJU A;  4DSL A;  5AQG A;  3GOI A;  2EHG A;  3ENH A;  3ZX3 A;  4EZ9 A;  2QKK A;  2VYP A;  5BR9 A;  5DK5 A;  3AVL A;  4CHY A;  4QOZ B;  3CD6 N;  3OBY A;  5AZI A;  3LP2 A;  4DTR A;  3QEI A;  4N5S A;  4GV6 A;  3NE6 A;  4C8O A;  2P9N B;  5HRN A;  4RW7 A;  1XHZ A;  1WBD A;  3SLC A;  1HX1 A;  2D0B A;  3N4Q A;  1VSF A;  1U04 A;  2ZGZ A;  2BTF A;  4O55 A;  2XY5 A;  4Z4E A;  3KD5 E;  1RT1 A;  3A0I X;  1C0U A;  5H1S Q;  3V9U A;  2QWO A;  5FPN A;  2KFZ A;  1JLB A;  4YOX A;  4Z4I A;  4CER A;  5GIO A;  2WC9 A;  3WT0 A;  2PYJ A;  4IO8 A;  4B1W B;  4A2A A;  1DLO A;  4FJI A;  1ESV A;  3H6E A;  4PKH A;  4FOI A;  4U7B A;  1SUQ A;  3CM6 A;  3SZ2 A;  3DLK A;  1W7A A;  1I94 K;  2W42 A;  1VRU A;  1S1V A;  4CHZ A;  1WLJ A;  5MLC Q;  1UOC A;  5BPL A;  3MEG A;  1WSE A;  1HNI A;  3CPE A;  3S3N A;  4F4K A;  4JI3 K;  3OS1 A;  4FWN A;  2E2O A;  1W9H A;  3GDQ A;  1UAX A;  5BN9 A;  4DKW A;  5C2D A;  3F5T A;  4ISF A;  4BE2 A;  4FLW A;  4BDZ A;  1L3T A;  3VMF B;  5J2P A;  3E01 A;  5AZI B;  4A5A A;  3S3O A;  2Q36 A;  1S5J A;  2P9S B;  4H5T A;  3HOT A;  3CFO A;  4C23 A;  4W5R A;  1NGI A;  4DMN A;  4JI0 K;  3VQ7 A;  1NK7 A;  1OVY A;  3THY A;  1GLD G;  4O5F A;  3ZT1 A;  1SL2 A;  4BC5 A;  4EAH D;  1S3X A;  2PAV A;  1WSJ A;  3VA0 A;  4IEE A;  4BG8 A;  3O1B A;  3SPZ A;  5JS2 A;  1CZA N;  2GTD A;  2FSN A;  2HND A;  3VN5 A;  4FWO A;  3TAM A;  5JMV A;  4O8U A;  2NNW A;  1BL3 A;  4M63 C;  3QB0 A;  4YNQ A;  5AQT A;  2NRR A;  4ZTJ A;  1WAJ A;  3EZW A;  4O8K A;  3CC4 N;  4EHU A;  3NGY A;  3MED A;  4JRP A;  1QE1 A;  4LF4 K;  3AA5 X;  1VSE A;  4H5V A;  1ZBH A;  2H3G X;  3V1Q A;  1JL1 A;  2OPQ A;  3RMA A;  2P9U A;  3QBX A;  3KLH A;  2X6S A;  3J8A A;  3CF5 L;  1ASV A;  4BDY A;  3AV9 A;  3BZK A;  4BRM A;  3P1G A;  3HPO A;  4V19 S;  2G8H A;  3G4S N;  1RT3 A;  1NM1 A;  3CPW M;  1K8K A;  3U6F A;  3EY1 A;  3CIP A;  4LF9 K;  3G10 A;  3ZSX A;  1HQE A;  4BVO A;  4OPJ A;  4CF2 A;  4FCY A;  4CJR A;  1V4T A;  1VSK A;  3Q7B A;  2JLE A;  2WON A;  1VQL N;  3SBT A;  3THY B;  4BRC A;  4NCA A;  3Q7C A;  4M45 A;  1MWK A;  3VQA A;  4F3O A;  3T7Z A;  2G8K A;  3FFI A;  2YCH A;  5J2N A;  4DS4 A;  2E2Q A;  4IOX A;  4JLH A;  3ZEU A;  3HP9 A;  1Z6R A;  1JJ2 M;  2DTU A;  2D4W A;  3IDH A;  4B3T K;  3VA3 A;  4F2S A;  4FJ7 A;  1L3U A;  5C25 A;  2P9P B;  1IBK K;  2CH5 A;  2XY8 A;  1S22 A;  1Q9X A;  2QWP A;  4H5N A;  4PHT X;  1RTJ A;  4DSJ A;  4DUY K;  1DKG D;  5F2R A;  4E89 A;  2PZS A;  4GKK K;  3IUC A;  3RWU A;  4JYA K;  4DV3 K;  3DMJ A;  2NRZ A;  4DTS A;  3M3Z A;  4ID1 A;  4DFP A;  3KLG A;  1VRT A;  4HTU A;  1BA1 A;  3AAQ A;  1DEJ A;  1K8K B;  2VG7 A;  3V9Z A;  4CEC A;  3ATV A;  1NKE A;  3EO3 A;  4YOT A;  1CXQ A;  3ZSO A;  5FPD A;  1NK6 A;  2OAN A;  3KWG A;  3MCA B;  1WSF A;  4A61 A;  4BR9 A;  3KK3 A;  4MDA A;  3MCP A;  3ZSZ A;  4NLB A;  2QWL A;  2IGI A;  5LL6 Z;  3V4I A;  3U4L A;  3VGL A;  3THX A;  1ZBF A;  4J2B A;  3AGR A;  4IJN A;  2RPI A;  1IKW A;  3L0Q A;  1YHQ N;  3NBP A;  1TUY A;  3MDQ A;  4C8N A;  3NGZ A;  4PWD A;  3ZSY A;  5HRO A;  5HOO A;  3FZF A;  3AAR A;  2OYQ A;  2QWQ A;  1BG3 A;  3R6M A;  1Y97 A;  1S1T A;  3UE5 A;  2I7N A;  3A2F A;  2ATQ A;  3AVJ A;  1B92 A;  2NRW A;  5A2Q O;  1LV5 A;  2UXC K;  4AHS A;  1XQS C;  2FBY A;  5AQM A;  4CJL A;  1B9F A;  4CZK A;  2HBK A;  5FRN A;  4AHU A;  1S1W A;  3MX2 A;  1SAZ A;  1YIT N;  2CH6 A;  2P9K A;  2QW9 A;  4WFN L;  4CJF A;  4FLX A;  1FK9 A;  3AVC A;  4W5O A;  2HHT A;  3WUH A;  5C12 A;  3QEW A;  1ZXO A;  3KZB A;  5AQR A;  2W41 A;  2F8T A;  3D2F A;  2XY6 A;  3MEC A;  2GUI A;  1TKT A;  2F9W A;  2JGU A;  4XIU A;  4BAC A;  3I8D A;  1YAG A;  2UXD K;  4CJQ A;  2IOC A;  1WOQ A;  2NRV A;  1EWQ A;  3THX B;  4KFB A;  1KVB A;  3AVN A;  3T19 A;  1D8Y A;  4UQG A;  1I3A A;  1GLE G;  4FK4 A;  3TAN A;  4CZE A;  5KTQ A;  2IAJ A;  2BDP A;  1TKX A;  4ICL A;  4CEA A;  5BRH A;  2HST A;  4DQQ A;  4R79 A;  3QBW A;  1LAW A;  2XRI A;  3RMD A;  1A5X A;  1NMD A;  1M90 O;  1BQM A;  5AQU A;  1X9J A;  1M1K O;  2W40 A;  4WE1 A;  4FWS A;  2IDO A;  1ZBU A;  2VWK A;  1IKX A;  2P9K B;  5BRE A;  1T44 A;  4GVE A;  3LDP A;  1FXX A;  3SNN A;  4DTJ A;  1IO2 A;  4JI4 K;  3DLE A;  3IFR A;  1BIU A;  3J7A P;  1RDW X;  4ILJ A;  4R5P A;  1NGD A;  3TAE A;  3D2F B;  3UKR A;  4FWK A;  4IEI A;  1XHX A;  5FRO A;  1TAU A;  5ELZ A;  2QM1 A;  3HSC A;  3KLE A;  4KH5 A;  4BR2 A;  5F1X A;  4DFM A;  4JN4 A;  3D2E A;  3M8Q A;  4F3T A;  3WNH A;  4H0P A;  3OHR A;  3QDK A;  4DV5 K;  1K73 O;  2YHA A;  4CJ5 A;  4DFK A;  2OPP A;  4OGC A;  1T7P A;  4CZG A;  3BF3 A;  2O8F A;  1R0A A;  4AH9 A;  4K8X A;  4FJH A;  3KD1 E;  1S6Q A;  1RDB A;  3LZJ A;  1S6P A;  3HTV A;  1UA0 A;  1P90 A;  3PX6 A;  4N76 A;  1NU0 A;  2DFF A;  3DLH A;  3NF8 A;  4IOA L;  3UIQ A;  2W6K A;  3L4I A;  5KPZ A;  1K6Y A;  4QS7 A;  4CFA A;  4EHT A;  4E7H A;  4DQR A;  4IZ9 A;  4NB4 A;  3T3F A;  2E5L K;  1HLU A;  4C8K A;  2F4V K;  2HBJ A;  2WFB A;  3KWI A;  4RWT A;  5EVZ A;  3MEE A;  3CQ8 A;  3AVK A;  4QS8 A;  1YJ9 N;  1BQN A;  3CHW A;  1HPM A;  4YDU C;  1NBW A;  3HK2 A;  4JKH A;  4LC9 B;  1RT7 A;  3AO5 A;  4DU3 A;  3LAL A;  1JLF A;  3TTD A;  1HJO A;  2VQF K;  3B6P A;  3OYC A;  3LAK A;  4CIE A;  1NK5 A;  4DV2 K;  4FPB A;  1L3S A;  4CEE A;  3K5N A;  1GOB A;  3EKU A;  5ADX H;  1NJZ A;  3D2E B;  3O5B A;  4NXM K;  3WNF A;  3DLR A;  3F9K A;  2GV9 A;  1KLN A;  3CER A;  4IJA A;  3EKS A;  3TTC A;  3WXM B;  2HB5 A;  4ZHR A;  3OYG A;  2UUB K;  3OYB A;  4AM6 A;  4CF8 A;  4DQS A;  1RIL A;  4ELV A;  4JK9 A;  1NGC A;  1NGH A;  1BCO A;  3NGI A;  4DSE A;  4OLB A;  3S41 A;  1RDC A;  1RT6 A;  5AZJ A;  4H0Y B;  4A2B A;  3LP0 A;  4JKE A;  4B9V A;  3QFP A;  5AQP A;  1ZC6 A;  3DXM A;  1U45 A;  4DR6 K;  3OYN A;  4E7L A;  1A5V A;  3DI6 A;  4JKG A;  4F2R A;  2V51 B;  3ALY A;  3ZSV A;  4CZF A;  2E20 A;  2ZE2 A;  4FWM A;  1NGG A;  1U2V B;  3VQ4 A;  2KKZ A;  4FW2 A;  3DOL A;  1WBB A;  4YFU A;  1VSH A;  4CHO A;  4PY5 A;  4HHT A;  4JEP A;  4YHH K;  2NLX A;  5GAE P;  3VQD A;  3PY8 A;  1K9M O;  4CGF A;  2PFU A;  2E8A A;  3VF6 A;  2ZJP L;  2DY4 A;  3F9M A;  4BY9 C;  1GLB G;  5TKW A;  1RDU A;  2O4G A;  2NRX A;  2AJQ A;  3ENO A;  4CZL A;  3SV4 A;  3WNG A;  1YVN A;  4RW6 A;  1NGJ A;  4DTN A;  1RT5 A;  4PKI A;  1QVG M;  3HP6 A;  2VG5 A;  1R59 O;  1VQP N;  5HRP A;  2OPS A;  1C1B A;  3THV A;  1RDD A;  5SZT A;  1JLG A;  2VGM A;  5FLX O;  4FLV A;  4Y0W A;  4BE0 A;  1BUP A;  1BOT O;  5LMU K;  1NJW A;  3VQ6 A;  3SYZ A;  2KW4 A;  4I2P A;  2ZJQ L;  4BC4 A;  2O8B B;  4H5W A;  5FDL A;  4LF6 K;  4FZZ A;  3O4N A;  3OJU A;  2X6N A;  5E84 A;  1VQ9 N;  3AVA A;  3GE1 A;  5SWM A;  3M5R A;  4H0X B;  2HHS A;  1WSH A;  3SUQ A;  4JKG B;  1A5W A;  3H3O B;  3TPQ A;  2HNY A;  3IMX A;  3O9T A;  3MX5 A;  3ASM A;  4BRE A;  4ELT A;  3FZK A;  3CME N;  5EXW A;  2Y1J A;  3WXJ A;  5AQV A;  2D0A A;  2ZJR L;  2YHX A;  4X62 K;  2IVP A;  1VQ5 N;  1BIS A;  3MN9 A;  3O1W A;  2YNH A;  5E41 A;  4DU1 A;  4GW6 A;  5AQW A;  4DR7 K;  4Z4C A;  4CBX A;  4LFB K;  3W0L A;  3MAQ A;  2YJF A;  1VSJ A;  3I56 N;  3H46 O;  1HUX A;  4L3Q A;  2VGN A;  3J80 O;  5KQ8 A;  1EXQ A;  3TAG A;  2O8D B;  1QQM A;  3DRR A;  4FM2 A;  3MXJ A;  4O0I A;  5LY3 A;  4CBW A;  2XY7 A;  3DRS A;  1D4X A;  4FWL A;  3ZSW A;  3JAM O;  1NGA A;  2QTD A;  4H03 B;  3VF4 A;  4JI2 K;  3TWH A;  3VER A;  2P9I B;  4F9O A;  1HYV A;  3QO9 A;  5LJV A;  3L6Q A;  5D3G A;  3K9J A;  2OPR A;  5AFU A;  3SQ2 A;  1IKY A;  1REV A;  3WXI A;  3AVH A;  3B6O A;  4AF1 A;  1IV0 A;  4JI6 K;  4PL8 A;  1G15 A;  4PQU A;  2Q97 A;  4RTF D;  4FZY A;  4CF1 A;  4AM7 A;  3QET A;  3RSE A;  2HHV A;  4YDU A;  3M8S A;  3KK7 A;  1Q9Y A;  1YI2 N;  3CCQ N;  3OA9 A;  4MFB A;  1VQ4 N;  1J6Z A;  2A3Z A;  1NGE A;  1HNZ K;  2WUS A;  3OYK A;  4JRQ A;  4I7F A;  2F96 A;  2E6M A;  3SCX A;  1LWC A;  4OKK A;  3CQX A;  1RT4 A;  4WQ5 C;  5AQK A;  4CCH A;  4BRQ A;  4Z4F A;  4FM0 A;  4B9M A;  1FKO A;  3OJS A;  2FLO A;  3HL8 A;  4Z0U A;  4FLT A;  1X9M A;  1I39 A;  4BRI A;  5HL7 L;  1LW0 A;  4BGA A;  4EFH A;  4CBU A;  3OYL A;  3S3M A;  3NF6 A;  2A40 A;  4OKJ A;  4B9T A;  1KQS M;  4GV3 A;  2G8V A;  4CGG A;  4G9Z A;  1DGK N;  3JYT A;  1VSD A;  4LF5 K;  3TAB A;  4DHY A;  2BH1 A;  3FLC O;  5LJW A;  1CLQ A;  4B3M K;  3C6A A;  1NJX A;  4DCH A;  4FJJ A;  4JKF A;  3BEX A;  3SJJ A;  3IKM A;  3NH0 A;  4LF8 K;  3LM9 A;  1JKH A;  3OTO K;  2BGG A;  3KHY A;  1VQ8 N;  3LZI A;  4E7J A;  1C0T A;  3NVK A;  1V4S A;  4GKJ K;  4DTM A;  3RSE B;  1EQY A;  3QEX A;  1NJY A;  1BGX T;  3O3G A;  5AQQ A;  3SAF A;  2UXB K;  3CC2 N;  4DV1 K;  3V9X A;  5GAG P;  3P38 A;  5I3U A;  4CF9 A;  1YT3 A;  4W5Q A;  4DTO A;  3W3D A;  4M3X A;  5M1N A;  4C8L A;  4CK2 A;  2ASO A;  1FJG K;  3QLH A;  5AR0 A;  2HHW A;  2NUB A;  3QIC A;  4H4M A;  3SQ0 A;  3VEY A;  1VSL A;  4IDH A;  1X3N A;  2OCE A;  4CES A;  4BR4 A;  2OTJ N;  2YHW A;  2BE2 A;  4IBN A;  2DFE A;  1N33 K;  1EP4 A;  4FJ8 A;  2HBL A;  4DR5 K;  4ZTF A;  1SS6 A;  4DLG A;  2A5X A;  1W0H A;  1N8R O;  5AQL A;  3RR8 A;  1H1V A;  4M7X A;  4CFC A;  3O3F A;  4X64 K;  3VQ9 A;  2HMI A;  1TUU A;  4CJ7 A;  3OBW A;  4DSI A;  1OKJ A;  3O9Q A;  1T03 A;  4FJG A;  4CHN A;  2FBX A;  2Z1G A;  2XO7 A;  3VQP A;  5GAD P;  4HTL A;  3R3L A;  3O9R A;  4M41 A;  3ULE A;  1T8E A;  5HRS A;  1N36 K;  1K8A O;  3EEQ A;  1JL2 A;  2E1Y A;  3CXC M;  3K57 A;  2HMP A;  3LDQ A;  2F9T A;  2YKM A;  1KRP A;  1YXQ A;  1X9W A;  4OO1 J;  4DTX A;  5FPM A;  5C42 A;  5IWA K;  2UUC K;  3P5J A;  4DF4 A;  3VF2 A;  2GBZ A;  2Z1H A;  3HST B;  4BRP A;  3T1A A;  1NG9 A;  4H0O A;  1XUP O;  4CEZ A;  4O5B A;  3JSM A;  3TSQ A;  3ZSR A;  1VSI A;  1OH5 A;  4B9N A;  2FBV A;  4DQI A;  3WXL A;  4WQ4 C;  1NOZ A;  1S9G A;  3FZM A;  2D0P A;  4K42 A;  2ZGY A;  3HM8 A;  2QWR A;  2Q2R A;  2P9U B;  1Y64 A;  3I55 N;  1G99 A;  3PO5 A;  4H8K A;  3QFU A;  3KJV A;  1QQN A;  4CF0 A;  2Z1J A;  1YF5 L;  4IWV A;  3DJC A;  4BGB A;  4EIA A;  3T1H K;  4XH5 A;  4IG3 A;  1NGB A;  2O8E A;  4AQY K;  4JI5 K;  4DS5 A;  4M7Y A;  3TSU A;  4OLA A;  4CHP A;  5HP1 A;  3AO3 A;  1RFQ A;  1TYQ A;  3VEV A;  3CFR A;  1WB9 A;  3DLG A;  1SZ2 A;  3AO4 A;  3QNN A;  4E1J A;  2AA4 A;  2ETJ A;  3ZX2 A;  3ZEU B;  1TKD A;  4BRD A;  1X1P A;  4KPY A;  1SV5 A;  2GWK A;  3JS6 A;  4KHQ A;  2VCP A;  1XC3 A;  1TKZ A;  1TL3 A;  4KH4 A;  4JS4 A;  2HHH K;  3PSF A;  4IO9 L;  1YTA A;  1DTT A;  2V7Y A;  1RCH A;  3HYF A;  3E9L A;  4BRH A;  1RTI A;  3C94 A;  2ZM6 K;  3VEX A;  3CCM N;  2PYL A;  4BWM A;  1TL1 A;  4HUF A;  4I2Q A;  4WQ5 A;  3OS0 A;  4J2A A;  3BUZ B;  1SKS A;  3AO1 A;  3K58 A;  4CD3 A;  1E3M A;  3I0R A;  4HVJ A;  4OKE A;  1QTM A;  1IBL K;  1DTQ A;  3WEE A;  4FWP A;  3O9U A;  1KSP A;  3NCI A;  4NXN K;  2YI1 A;  4A57 A;  3V9W A;  5AQJ A;  3M8P A;  3EZ5 A;  3AVM A;  4BWJ A;  3B8A X;  2HF4 A;  3RRG A;  3PSI A;  3CG7 A;  3QIN A;  3CJ1 A;  4IXC A;  3H08 A;  1BI4 A;  1GLF O;  2G8U A;  3PLA A;  1LW2 A;  4KTZ A;  2QWM A;  4JKA A;  1Q82 O;  3LPU A;  3ID6 A;  4WF9 L;  5AQF A;  4CVN E;  3HO1 A;  1WUA A;  3FZL A;  4YOU A;  4OPA A;  4CEO A;  1C6V A;  1NGF A;  3H1Q A;  4NCB A;  3NHG A;  4JKC A;  2E88 A;  3EE8 A;  3L2W A;  2Y1I A;  3GG4 A;  4JNE A;  4DR2 K;  1KTQ A;  1BWF O;  2GEM A;  3WEE B;  3LPT A;  2CGJ A;  3VGK A;  5JLH A;  1QHA A;  3LM2 A;  2Q1N A;  4GY2 B;  3SUP A;  4FJL A;  2QWN A;  3VQB A;  3E1Y A;  3AVF A;  1W97 L;  4JS5 A;  4DB3 A;  3OW2 M;  1KAZ A;  3OYI A;  2RHK A;  2KLA A;  3CFP A;  1TK8 A;  1QS4 A;  2ITG A;  1MDU B;  4Z4G A;  3ZT2 A;  4FK2 A;  4BRN A;  3LAN A;  3HXM A;  1D5A A;  3NH2 A;  3EL2 A;  4FW1 A;  1Q18 A;  1JLC A;  2VG6 A;  4CJT A;  1RTD A;  5M1P A;  4C1N I;  4DQ8 A;  1ATN A;  4DV7 K;  5BRF A;  3SQ1 A;  4I9Q A;  2ITM A;  1KFD A;  1NNE A;  3ZT0 A;  1MU2 A;  3CMA N;  5DMR A;  4YY3 K;  1RBT A;  2YNI A;  1O13 A;  1KC8 O;  4E1N A;  2A1R A;  3PIP L;  3TSP A;  3VPZ A;  4E1M A;  3K9K A;  5JVG L;  3RMB A;  4A62 A;  3G25 A;  4WQ4 A;  1RBU A;  3A8Y A;  4FZX C;  3D6R A;  2I7P A;  4CEB A;  3NDK A;  5EU7 A;  1L3V A;  4HCB A;  3G6E N;  4X65 K;  1BCM A;  3GL1 A;  4JAX A;  1U48 A;  4I6M A;  3CCL N;  3VTH A;  1IKV A;  3CCV N;  1N6Q A;  1ZBS A;  4G1Q A;  3PO4 A;  3KKS A;  4AHT A;  4ILG B;  3UKR B;  1XMO K;  4CJW A;  1YIJ N;  4C8M A;  3D45 A;  3CCS N;  5CE3 A;  1QSS A;  3LAM A;  1FKP A;  1IG8 A;  4HCC A;  4NYF A;  1KAX A;  5IT9 O;  1BO5 O;  2E2N A;  1KFS A;  4KHU A;  5KPT A;  4CJ3 A;  4UY8 O;  4DR4 K;  1HNV A;  1OVQ A;  1VQ6 N;  5I42 A;  2P1J A;  1TK0 A;  4BQL A;  4GVM A;  4B1X B;  2O8F B;  4M3T A;  3TTF A;  2D5R A;  4KKO A;  1NK8 A;  1QQO A;  4CJK A;  3FR0 A;  2KQ2 A;  4YOR A;  4M3Y A;  2YKN A;  3PIO L;  3F73 A;  5KRS A;  3ZLJ A;  1WN7 A;  1Q7Y O;  2CGL A;  2VQE K;  3AA2 A;  2VWJ A;  3HT3 A;  5B8H A;  3CCU N;  5DM7 L;  4K25 A;  5C15 A;  1JLA A;  4JI8 K;  5HLF A;  3ZET A;  2AP1 A; 
#chains in the Genus database with same CATH homology
 2FC0 A;  4CJV A;  3G0Z A;  4RW4 A;  4RW9 A;  2XY8 A;  4MFB A;  3BGR A;  1Q9X A;  1UA1 A;  1U4B A;  1RTJ A;  5HRR A;  4DSJ A;  5KI6 A;  3L2R A;  3OYK A;  1LWE A;  4JRQ A;  4BDP A;  1TAQ A;  4I7F A;  5J1E A;  2F96 A;  2E6M A;  3ITH A;  3D0P A;  4E89 A;  3V6D A;  3SCX A;  1LWC A;  2PZS A;  4OKK A;  4OGE A;  3SUO A;  1RT4 A;  3L3U A;  3C6U A;  5C24 A;  4CCH A;  3RWU A;  4LSN A;  1GOC A;  3DMJ A;  4MQ3 A;  4Z4F A;  4DTS A;  2G8F A;  1NK4 A;  2QK9 A;  4ID1 A;  4FM0 A;  2OZM A;  3AVG A;  3ZCM A;  4B9M A;  1FKO A;  3OJS A;  1QSY A;  3HL8 A;  4Z0U A;  4CJ4 A;  4DSF A;  4FLT A;  4DFP A;  3OYJ A;  4FZY A;  1X9M A;  2E4L A;  4CFD A;  3KLG A;  1I39 A;  2HNZ A;  1VRT A;  4HTU A;  3SI6 A;  1NK9 A;  1LW0 A;  2HHQ A;  1BI4 B;  2VG7 A;  1XWL A;  4E3S A;  3OYL A;  2HHV A;  4FJK A;  4KHW A;  5CZ2 A;  4CFB A;  1O1W A;  3NF6 A;  2RN2 A;  4OKJ A;  4CEC A;  3V9Z A;  3S3M A;  1XI1 A;  4B9T A;  1RTH A;  4Y1C A;  1NKE A;  3AA4 A;  1CXQ A;  3ZSO A;  1NK6 A;  1ZYQ A;  2G8V A;  4CGG A;  4N56 A;  1WSF A;  3OYM A;  1LAV A;  2P5O A;  3JYT A;  3KK3 A;  1VSD A;  4CED A;  3ZSZ A;  5KGX A;  2PY5 A;  3V4I A;  2IGI A;  3TAB A;  4E7K A;  2YNG A;  1CLQ A;  1ZBF A;  3LP3 A;  1NJX A;  4FJJ A;  4J2B A;  3HM9 A;  2RPI A;  4DTP A;  1J5O A;  3PX0 A;  3HJF A;  3SJJ A;  2HW3 A;  3NH0 A;  3CM5 A;  1IKW A;  1JKH A;  4CGJ A;  2QKB A;  3DYA A;  2BGG A;  3NBP A;  1SL1 A;  3LZI A;  4E7J A;  1QSL A;  4C8N A;  1C0T A;  3NGZ A;  3TAF A;  4PWD A;  4OVL A;  3ZSY A;  4N47 A;  1NK0 A;  5HRO A;  4DTM A;  3ISN C;  3QEX A;  2OYQ A;  1NJY A;  4KB1 A;  4CGI A;  1BGX T;  5FRM A;  1JLQ A;  4DU4 A;  3O3G A;  4Z4H A;  3RR7 A;  3IRX A;  1Z25 A;  1WSI A;  3SPY A;  4RG8 A;  5T7B A;  4M3R A;  4F8R A;  2KTQ A;  2KFN A;  4LSL A;  3V9X A;  3U3Y A;  3HPG A;  1KLM A;  1RBR A;  1Y97 A;  1S1T A;  3MXM A;  3A2F A;  2ATQ A;  3AVJ A;  1B92 A;  5I3U A;  1LV5 A;  4CF9 A;  1YT3 A;  4W5Q A;  4B08 A;  4AHS A;  2FBY A;  4CJL A;  4DTO A;  4DWI A;  1B9F A;  2BAN A;  1C1C A;  1S1U A;  4EZ6 A;  4E19 A;  5FRN A;  4C8L A;  4CK2 A;  4AHU A;  1S1W A;  3QLH A;  5K14 A;  3CYM A;  3OS2 A;  3VQ5 A;  2HHW A;  1RBV A;  2NUB A;  4FJM A;  1J54 A;  3HPH A;  4H4M A;  1VSL A;  4CJF A;  3LWM A;  3SQ0 A;  4PUO A;  4CES A;  4FLX A;  1FK9 A;  3AVC A;  1JXE A;  4W5O A;  3V9S A;  3K5L A;  3PX4 A;  1ZBL A;  1BHL A;  1C1A A;  1QQC A;  2HHX A;  4IBN A;  2BE2 A;  4Q0B A;  3QEW A;  3U3G A;  4I9L A;  1N5Y A;  2DFE A;  1EP4 A;  4FJ8 A;  4ZTF A;  3KIO A;  4DLG A;  1ASU A;  1W0H A;  4CGH A;  3L2V A;  2F8T A;  4OPK A;  2XY6 A;  3MEC A;  2GUI A;  3RR8 A;  1TKT A;  2JGU A;  4ID5 A;  4CFC A;  4XIU A;  3O3F A;  4IKF A;  3C6T A;  4FYD A;  3VQ9 A;  4BAC A;  4AHC A;  3I8D A;  5CYM A;  2HMI A;  4HUE A;  3K5M A;  4IDK A;  3IAY A;  4CJQ A;  3RTV A;  3RMC A;  4DSI A;  2IOC A;  1T03 A;  4FJG A;  4B9S A;  4CHN A;  2FBX A;  2Z1G A;  4KI6 A;  2XO7 A;  3VQP A;  2WOM A;  4KFB A;  4CHQ A;  1KVB A;  3AVN A;  4KTW A;  3DOK A;  3T19 A;  4PA1 A;  4UQG A;  1TK5 A;  1D8Y A;  1TGO A;  4FLY A;  1I3A A;  4M41 A;  4FK0 A;  3SUN A;  5CYQ A;  1QHT A;  1T8E A;  5HRS A;  4KB0 A;  4J2E A;  4FK4 A;  3TAN A;  5J2M A;  1JL2 A;  1S1X A;  1C0M A;  3K57 A;  5KTQ A;  1HMV A;  2IAJ A;  3QEV A;  1SKW A;  4EP5 A;  1EX4 A;  2BDP A;  2YKM A;  4EP4 A;  1TKX A;  3K2P A;  4AHV A;  1JLE A;  4ICL A;  1KRP A;  1HQU A;  4LH5 A;  4CEA A;  1X9W A;  3NH1 A;  3NF7 A;  4DTX A;  5C42 A;  4DQQ A;  3QES A;  3L2U A;  1HYS A;  1LAW A;  3P5J A;  2XRI A;  4DF4 A;  4J2D A;  1TV6 A;  3RMD A;  3TI0 A;  1U49 A;  1A5X A;  2GBZ A;  2Z1H A;  3AA3 A;  3HST B;  1KCF A;  4B8A B;  3NFA A;  3KKR A;  1BQM A;  3T1A A;  4NCG A;  4BE1 A;  2D0C A;  2YNF A;  3V81 A;  3S9H A;  4CEZ A;  3RRH A;  2LSN A;  4O5B A;  4WE1 A;  3VQC A;  3ZSR A;  1VSI A;  3JSM A;  4B9N A;  2FBV A;  4LH4 A;  4DQI A;  4CEF A;  3QEP A;  4CGD A;  1NOZ A;  1S9G A;  2IDO A;  1ZBU A;  2VWK A;  1IKX A;  2OA8 A;  3EYZ A;  4Y1D A;  4CEQ A;  2QXF A;  3ZT3 A;  3PO5 A;  3OYA A;  3LP1 A;  3AVI A;  4H8K A;  1FXX A;  3SNN A;  3KJV A;  4DTJ A;  3DLB A;  5HBM A;  4CK1 A;  4CF0 A;  3O3H A;  3TAP A;  1NKC A;  2Z1J A;  3TR8 A;  1IO2 A;  4CE9 A;  4DFJ A;  3DLE A;  1BIU A;  4FJ9 A;  4R5P A;  3IS9 A;  4IG3 A;  3TAE A;  4B3O A;  2R7Y A;  4DSK A;  1F21 A;  1XHX A;  5FRO A;  1TAU A;  3L2Q A;  4DS5 A;  3KLE A;  3LDS A;  1J9A A;  4OLA A;  4CHP A;  4DFM A;  3SV3 A;  5HP1 A;  5J2Q A;  3AO3 A;  3ZSQ A;  3M8Q A;  4F3T A;  1HRH A;  4FXD A;  2RF2 A;  3WNH A;  3VQ8 A;  3MXI A;  1NOY A;  2O4I A;  3CFR A;  4FVM A;  2YHA A;  3DLG A;  3VQQ A;  4KHS A;  4CJ5 A;  4DFK A;  3AO4 A;  2OPP A;  2B5J A;  4OGC A;  4TSX A;  5CY4 A;  3QNN A;  1X9S A;  1T7P A;  3KK1 A;  1R0A A;  4AH9 A;  2ETJ A;  4K8X A;  1TKD A;  1WAF A;  4AHR A;  4FJH A;  3KD1 E;  1S6Q A;  3V1R A;  4CJP A;  1RDB A;  1X1P A;  1SV5 A;  1Q8I A;  3QIO A;  5CZ1 A;  3LZJ A;  2B6A A;  4KPY A;  4KHQ A;  3NF9 A;  1S6P A;  1TKZ A;  1UA0 A;  1TL3 A;  3OYF A;  3PX6 A;  4N76 A;  3AVB A;  2G8W A;  3LWL A;  4JS4 A;  4K8Z A;  2DFF A;  3DLH A;  3NF8 A;  4B9U A;  3KLF A;  4OJR A;  4L8R B;  1YTA A;  3UIQ A;  3QNO A;  1D9F A;  1DTT A;  4B8C A;  1K6Y A;  2P5G A;  3DM2 A;  4CFA A;  2E6L A;  1RCH A;  3HYF A;  4QAG A;  5KGW A;  4E7H A;  4FM1 A;  4AIL C;  4E0D A;  1RTI A;  2OZS A;  3C94 A;  3T3F A;  3DRP A;  2PYL A;  4CIF A;  3ULD A;  4C8K A;  4BWM A;  4KHN A;  1TL1 A;  4HUF A;  4I2Q A;  1IH7 A;  3MEE A;  3OS0 A;  4M42 A;  4J2A A;  2RKI A;  3AVK A;  3CQ8 A;  1SKS A;  1BQN A;  3C95 A;  3AO1 A;  1T05 A;  3K58 A;  1SL0 A;  3HK2 A;  1YVU A;  1RT7 A;  3I0R A;  4HVJ A;  4OKE A;  1QTM A;  2HHT A;  3AO5 A;  4DU3 A;  3I0S A;  1DTQ A;  3PV8 A;  1IG9 A;  3LAL A;  4FLZ A;  1JLF A;  2KZZ A;  3OY9 A;  1WNS A;  2P51 A;  3BDP A;  3B6P A;  3OYC A;  3LAK A;  2X78 A;  4O0J A;  4CIG A;  3TAR A;  3TAQ A;  4FLU A;  4H4O A;  4O4G A;  4CIE A;  1NK5 A;  3NCI A;  3K59 A;  1KSP A;  4FJN A;  4KRE A;  3NAE A;  1D9D A;  1L3S A;  4CEE A;  3K5N A;  1KVA A;  1NK8 A;  3V9W A;  4KI4 A;  1GOB A;  2X74 A;  3M8P A;  4LD0 A;  5KRT A;  3AVM A;  3EZ5 A;  1RT2 A;  4BWJ A;  1ASW A;  1NJZ A;  4CJU A;  3RRG A;  4DSL A;  3WNF A;  3DLR A;  3F9K A;  2GV9 A;  1KLN A;  4KHY A;  2EHG A;  3CG7 A;  3QIN A;  3H08 A;  4EZ9 A;  1BI4 A;  2QKK A;  4Q5V A;  2G8U A;  5DK5 A;  3AVL A;  4CHY A;  4QOZ B;  2HB5 A;  4ZHR A;  3OYG A;  1LW2 A;  4KTZ A;  4CK3 A;  4IFY A;  3OYB A;  4FJ5 A;  3QEI A;  3LP2 A;  4DTR A;  4N5S A;  3HVR A;  3NE6 A;  4C8O A;  5HRN A;  4KTQ A;  3PUF A;  3LPU A;  4RW7 A;  4CF8 A;  4DQS A;  1XHZ A;  1RIL A;  2D0B A;  4ELV A;  1VSF A;  1U04 A;  4IFV A;  3HO1 A;  1ZBI A;  4FJX A;  4O55 A;  2XY5 A;  4Z4E A;  1B9D A;  1BCO A;  3NGI A;  4DSE A;  4OLB A;  3KD5 E;  4M3W A;  1RDC A;  1RT6 A;  4CEO A;  4DF8 A;  1C6V A;  1HPZ A;  3IG1 A;  1VSM A;  1RT1 A;  3LP0 A;  1C0U A;  3V9U A;  4B9V A;  4NCB A;  3NHG A;  2KFZ A;  3SQ4 A;  1U45 A;  1JLB A;  2ZQB A;  1WSG A;  3OYN A;  3L2W A;  4E7L A;  4W5T A;  1A5V A;  3DI6 A;  4F2R A;  3ALY A;  3L8B A;  3ZSV A;  4CER A;  2Y1I A;  2ZE2 A;  4Z4I A;  2PYJ A;  2F8S A;  3VQ4 A;  1DLO A;  4FW2 A;  1KTQ A;  4DQP A;  4FJI A;  3DOL A;  4YFU A;  1VSH A;  4CHO A;  4PY5 A;  4HHT A;  1KVC A;  3LPT A;  3VQD A;  3PY8 A;  1J53 A;  4CGF A;  3SUP A;  2Z1I A;  4FJL A;  2DY4 A;  1SUQ A;  3CM6 A;  3VQB A;  3SZ2 A;  3AVF A;  2O4G A;  3DLK A;  1ITG A;  2EX3 A;  2Q3S A;  3HVT A;  1CZB A;  4JS5 A;  3P83 D;  2AJQ A;  2W42 A;  3SV4 A;  1VRU A;  1S1V A;  3WNG A;  4CHZ A;  3M8R A;  3OYI A;  3CFP A;  1WLJ A;  4RW6 A;  3QER A;  4DTN A;  1UOC A;  1TK8 A;  4M3Z A;  1RT5 A;  1QS4 A;  2ITG A;  3HP6 A;  4E7I A;  3MEG A;  2VG5 A;  4N41 A;  4M3U A;  1WSE A;  4Z4G A;  1HNI A;  3ZT2 A;  2G8I A;  4FK2 A;  4F4K A;  3S3N A;  5HRP A;  4ELU A;  2OPS A;  3OS1 A;  1C1B A;  1GOA A;  3LAN A;  3HXM A;  1D5A A;  1W9H A;  3NH2 A;  1UAX A;  3THV A;  1RDD A;  5SZT A;  1JLG A;  2B4J A;  4FW1 A;  1JLC A;  4FLV A;  4BE0 A;  2A1S A;  2VG6 A;  4BE2 A;  2HVI A;  4FLW A;  4CJT A;  4BDZ A;  1L3T A;  1RTD A;  5J2P A;  3E01 A;  1NJW A;  2KZM A;  3VQ6 A;  3S3O A;  3SYZ A;  2KW4 A;  4I2P A;  1S5J A;  4LY7 A;  3OYE A;  3SQ1 A;  4I9Q A;  4M3X A;  3CFO A;  2HVH A;  1KFD A;  5FDL A;  4W5R A;  3ZT0 A;  4DMN A;  1U47 A;  1MU2 A;  3VQ7 A;  1NK7 A;  4FZZ A;  3O4N A;  5DMR A;  3OJU A;  3ZT1 A;  1RBT A;  1RBS A;  1SL2 A;  2X6N A;  2YNI A;  1VK0 A;  4E1N A;  1WSJ A;  1TVR A;  1S9E A;  3AVA A;  4O44 A;  3VA0 A;  2A1R A;  4KAZ A;  1LWF A;  3SPZ A;  3OYH A;  4E1M A;  5JS2 A;  3RMB A;  3VQE A;  5SWM A;  2YV0 X;  2HHU A;  2HHS A;  1WSH A;  3SUQ A;  1A5W A;  2HND A;  3VN5 A;  3K5O A;  4KV8 A;  1RBU A;  3TAM A;  3WNE A;  4FZX C;  2HNY A;  1BL3 A;  4CEB A;  3NDK A;  4YNQ A;  5EU7 A;  3ASM A;  1NKB A;  1L3V A;  4HCB A;  4ZTJ A;  4KRF A;  1WAJ A;  1BCM A;  2IS3 A;  4ELT A;  1U48 A;  4KO0 A;  4DTU A;  1IKV A;  1RNH A;  1HJR A;  3V1O A;  1Z26 A;  4GMJ B;  3NGY A;  3MED A;  2Y1J A;  1BIZ A;  1N6Q A;  1EKE A;  4G1Q A;  4JRP A;  1QE1 A;  3PO4 A;  3KKS A;  2D0A A;  4AHT A;  1EET A;  3KK2 A;  3OVN A;  3AA5 X;  4CJW A;  1VSE A;  2DFH A;  1BIS A;  1ZBH A;  4C8M A;  3D45 A;  1HYZ A;  2ZD1 A;  1CXU A;  3V1Q A;  1JL1 A;  2OPQ A;  3L3V A;  2YNH A;  5E41 A;  4DU1 A;  3LAM A;  3RMA A;  1UWB A;  4GW6 A;  1FKP A;  1QSS A;  4HCC A;  2IC3 A;  4QCL A;  4NYF A;  4Z4C A;  3KLH A;  2X6S A;  1ASV A;  4BDY A;  3AV9 A;  3P1G A;  3HPO A;  3MAQ A;  1KFS A;  4KHU A;  1VSJ A;  4CJ3 A;  3QIP A;  2G8H A;  1HNV A;  1RT3 A;  3KLI A;  5I42 A;  2XHB A;  2P1J A;  3U6F A;  1TK0 A;  1SKR A;  4FJ7 A;  3EY1 A;  2I5J A;  2FBT A;  1EXQ A;  3O4Q A;  4RW8 A;  3TAG A;  1CZ9 A;  4GVM A;  4M3T A;  1JXB A;  2D5R A;  3DRR A;  3G10 A;  4FM2 A;  4KKO A;  3ZSX A;  1HQE A;  4CJS A;  3MXJ A;  4HUG A;  4O0I A;  4OPJ A;  4CF2 A;  4CJK A;  4FCY A;  4CJR A;  2KQ2 A;  3KTQ A;  4DLE A;  4M3Y A;  4W5N A;  2YKN A;  2XY7 A;  1VSK A;  3DRS A;  2JLE A;  2WON A;  4B9L A;  1RDA A;  3F73 A;  3ZSW A;  1XC9 A;  4NYN A;  5KRS A;  4NCA A;  4M45 A;  4DG1 A;  3TWH A;  1WN7 A;  5D3G A;  1HYV A;  3QO9 A;  3VQA A;  4F3O A;  2G8K A;  2OPR A;  3SQ2 A;  3FFI A;  1IKY A;  1REV A;  3AA2 A;  2VWJ A;  5JS1 A;  3ZT4 A;  3HT3 A;  5J2N A;  3AVH A;  3B6O A;  4CJE A;  3OYD A;  4DS4 A;  4IG0 A;  1G15 A;  4JLH A;  3HP9 A;  1L5U A;  4PQU A;  2DTU A;  1YTU A;  3VA3 A;  3AO2 A;  2YHB A;  4CF1 A;  1JLA A;  3QET A;  4F2S A;  5HLF A;  1L3U A;  3M8S A;  1Q9Y A;  5C25 A;  4DQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...