1JXBA

I53a, a point mutant of the cysteine-free variant of e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
152
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAAVALEALKEHAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Propagation of a single destabilizing mutation throughout the Escherichia coli ribonuclease HI native state.
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jxbA00
4CJ3A 2X6SA 1TAUA 2XRIA 2QXFA 2HHVA 1S6QA 3M8RA 4F2RA 4ID1A 3V9SA 4CF9A 1FXXA 1JLQA 4GVMA 2XHBA 1NK6A 4FZYA 4CJKA 5HLFA 3QLHA 3S3NA 4E1MA 3SQ2A 4FLTA 4DSJA 3WNGA 3RMCA 3K2PA 3TAFA 3KKRA 4FLWA 2XY8A 4EZ9A 3CM5A 2NUBA 2D5RA 4B9TA 2Y1IA 4FJGA 4B3OA 4DTRA 2WOMA 3SPYA 1HYVA 4N47A 4E1NA 3V9WA 2VWJA 1DLOA 5J2QA 4CJRA 3KLGA 3LALA 2R7YA 4FM2A 1ZYQA 3KTQA 4DQIA 2OPQA 3AVFA 4FLYA 4B8AB 3TARA 4KB0A 3VQPA 4M42A 1TKZA 3SPZA 4B9UA 4E0DA 3CFPA 4FJIA 1XHZA 5HP1A 1QSYA 3KD1E 4F4KA 3D45A 3VA0A 1SL2A 3DM2A 2B4JA 3KJVA 1W0HA 1HJRA 1NJWA 5C25A 3QEXA 3HJFA 3M8QA 3HK2A 1WSFA 1NKCA 3O4QA 3OYBA 1S9EA 4W5QA 4Z0UA 1T03A 4OGEA 3QEVA 2Z1HA 4BDZA 3OYEA 4CHQA 4L8RB 3HP9A 4O0IA 1WSHA 1WN7A 3QERA 4DU1A 4M3UA 1IKWA 2QKBA 4UQGA 2G8VA 4J2BA 1RT1A 2IOCA 4WE1A 4B9VA 3VQDA 3LWMA 4Y1CA 3PX0A 3C6UA 3TAGA 5I3UA 1L3TA 3CYMA 3OYJA 1RILA 1TGOA 3OJUA 1NK4A 3LAMA 1KVAA 3TANA 4ZHRA 1LWCA 4CF2A 4DFJA 3V1QA 2P5GA 3P1GA 3LANA 1B9FA 4CJSA 1S1VA 4CJUA 1J54A 3SNNA 1GOCA 5KGWA 3NH2A 4JLHA 5FRMA 3L2QA 4BE0A 4MFBA 3OY9A 3QESA 1NKEA 2LSNA 4M3RA 5HRPA 4FJJA 4CHZA 3L8BA 4NCAA 3RRHA 4KREA 4KI4A 1YT3A 3OYMA 2YHAA 4I2PA 5KI6A 3NGIA 5DMRA 4KHUA 4CJFA 3RMAA 1Q9XA 1TKXA 2PYLA 3DLRA 2HHUA 4CHNA 3MECA 4DLEA 1TKTA 1ASUA 1WAFA 3LP3A 4PQUA 3QNOA 3OYDA 4NCGA 1JLAA 4FJNA 5FROA 3JYTA 4CJEA 3QIPA 4RW9A 2XY7A 2KFZA 4CK3A 3C94A 3I8DA 3CFRA 2FBYA 2YNHA 1EETA 3LP2A 3OS2A 4FM1A 5I42A 2BDPA 4B8CA 4N41A 5D3GA 2KZMA 3OYFA 1QSLA 1JXEA 3VA3A 4JS4A 1C1AA 4F3TA 2JGUA 3NF8A 4FLUA 2FBVA 1U45A 4CEAA 2YNFA 4DU4A 4DF4A 1KLNA 3DRPA 4AHTA 3TAPA 4ZTJA 1RTDA 1TK8A 1C0TA 4I7FA 5JS2A 4CERA 1IKYA 3SUNA 3KLIA 4DTJA 1NOYA 3OVNA 4IFVA 4CF1A 1YTUA 4CFDA 4HUEA 3AVIA 4DFKA 2QKKA 4KHSA 1RDAA 3NCIA 1MU2A 3K5LA 4N56A 4KAZA 1QQCA 1LAVA 4LSNA 4CFBA 4CCHA 2VG7A 3DYAA 4FK4A 1HRHA 1FKPA 2OZMA 3OJSA 2KZZA 3OYGA 4JS5A 3MXMA 3AO3A 3SV3A 4NCBA 4FVMA 4M3XA 4Z4EA 4R5PA 1SL1A 4CEEA 1VSHA 3JSMA 3OYIA 4KHNA 4DTSA 1Z25A 1C1BA 1IO2A 4GMJB 5HRSA 1JLFA 2G8KA 4CJWA 5CZ1A 1BQNA 1W9HA 3VQQA 3L2RA 3EYZA 1N5YA 2Z1GA 4DQPA 1BIZA 5HBMA 1EX4A 3CG7A 2VG5A 4W5TA 4B9LA 4G1QA 2YKMA 3AVHA 3NF7A 3ULDA 4CGHA 1L3VA 4C8LA 3P5JA 3KLFA 3LPTA 4LY7A 1T7PA 5CYQA 3S3OA 4OKJA 4DLGA 3I0SA 1CZ9A 3OYAA 2BANA 4H8KA 3VQ4A 3NGYA 1KCFA 1EP4A 1G15A 4AHVA 4CECA 1DTQA 2EHGA 4KTZA 1J53A 4E7IA 5SWMA 5HRRA 4HTUA 5J2MA 3AVNA 4MQ3A 4DTPA 2PY5A 4FJHA 3WNFA 1LW2A 4DMNA 2DY4A 1BCOA 4DTXA 1SKRA 2G8HA 4C8MA 2A1SA 2F96A 4OKEA 4FLXA 1T05A 3AVKA 3NBPA 5CZ2A 2E4LA 2W42A 3MAQA 2WONA 2KW4A 3VQEA 2G8FA 3VQCA 3K58A 1NK0A 1GOAA 3LWLA 5CY4A 3O3HA 3ZT3A 4IKFA 1UA1A 4C8KA 1SKSA 1KTQA 3V1RA 2OA8A 3U3YA 3NE6A 3CM6A 3L3UA 3DLBA 4KTQA 2KFNA 2DTUA 4DSFA 4HVJA 3AA5X 4HCBA 2FBXA 4OGCA 3OS1A 1RT2A 4DQQA 3NH0A 3SUPA 1L3UA 4CK1A 3TABA 1XI1A 1U47A 3HVRA 2YHBA 1VSFA 2RF2A 2OPRA 3AA3A 4FW2A 3O3GA 3HM9A 4M45A 4RW7A 3L3VA 3VQ8A 5EU7A 4DTOA 3VQBA 2IS3A 1CXUA 1RBRA 3VN5A 1TKDA 2YNGA 1VSDA 4HHTA 1YVUA 2E6LA 4CIGA 2HHSA 1J9AA 3H08A 3AVLA 4BDPA 1ASVA 2IDOA 3KLHA 5FDLA 3A2FA 4DSIA 3SYZA 4IDKA 2HW3A 1LAWA 4FLZA 2D0BA 3BDPA 1ZBHA 1C6VA 5SZTA 1XHXA 3LPUA 3K5NA 4DS5A 1GOBA 5HROA 3K57A 3RRGA 1DTTA 4J2EA 1BHLA 3C6TA 3NF6A 1D5AA 3OYHA 1T8EA 1BI4A 4KKOA 3DI6A 2F8TA 3ZSXA 4W5NA 3CQ8A 3B6OA 1IH7A 2ITGA 2I5JA 3AVMA 2ZE2A 3NFAA 1R0AA 4N76A 4KI6A 3WNHA 5C42A 3T3FA 4F2SA 1ZBLA 1IKVA 3DOLA 3ASMA 5T7BA 1ASWA 3KK2A 1K6YA 4NYFA 1UWBA 2Q3SA 3EY1A 4EP4A 1TK5A 4M3WA 2KQ2A 4C8OA 4Q0BA 5JS1A 1X9SA 4Z4FA 3HL8A 3HT3A 1U48A 2O4GA 3VQ9A 3SJJA 4AHCA 1I39A 3KKSA 4H4OA 4O4GA 1SUQA 3VQ6A 3D0PA 2G8UA 4KO0A 4O0JA 3OYLA 1REVA 1S1TA 1S1XA 3HVTA 4I2QA 3NGZA 3QEWA 4F8RA 4KV8A 4DFPA 4QCLA 2XY6A 4LSLA 3HP6A 3MEDA 1C1CA 4HUFA 4IG0A 4Z4HA 3DMJA 3CFOA 3AVBA 5J1EA 1ZBFA 4E7KA 2G8WA 4CJVA 4JRQA 3O3FA 1BL3A 4LH4A 3PX6A 4OLBA 4DFMA 4PWDA 3QETA 3E01A 4CEFA 3K59A 1RCHA 2G8IA 4DQRA 1WLJA 3OYCA 3HPHA 4CF0A 2FC0A 3S3MA 5KRSA 4EZ6A 1BI4B 1RBVA 3KD5E 5J2PA 3SQ0A 4KHYA 3VQ5A 3AA2A 3RMDA 2GBZA 3LZJA 3DRRA 1VK0A 4IG3A 2IAJA 3SV4A 4M3TA 1JKHA 1SV5A 1VSLA 3PV8A 1VRTA 2Y1JA 1NKBA 2B5JA 1JXBA 1KSPA 1TV6A 3RR7A 4CEBA 3ZT0A 4CGGA 4CJ5A 1NK8A 4H4MA 4DTMA 1TVRA 1TL1A 1QTMA 2ZD1A 4LD0A 4CGFA 2BE2A 4YFUA 3SI6A 1LW0A 4I9QA 4FZZA 4XIUA 3RMBA 4B08A 3C95A 3K5OA 3PUFA 3PY8A 1Q8IA 4E89A 2YNIA 4KTWA 1X9WA 3S9HA 1VSEA 1HNVA 1RNHA 3IG1A 3IS9A 3EZ5A 2HNDA 1JLEA 3SZ2A 1JLGA 3ZT2A 4BACA 2P5OA 4CFAA 4Z4CA 4FK0A 3DLKA 4BE1A 1X9MA 4RW6A 1JL2A 4RW8A 1RT6A 4LH5A 4W5OA 4DSEA 2IC3A 5CYMA 3TAEA 3HPGA 2HNYA 1U49A 1IG9A 4CGIA 1HQUA 1Q9YA 1D9DA 4FXDA 4OLAA 1RTIA 2OPPA 2EX3A 1I3AA 4DSKA 2F8SA 3ZT1A 3SQ4A 3AV9A 3TI0A 4B9NA 2RPIA 4CGDA 2XO7A 3HYFA 4FZXC 3AO1A 2D0AA 4FJ8A 1BQMA 1EKEA 2VWKA 5K14A 3QIOA 4CJLA 1LV5A 1Z26A 3LP0A 1QSSA 4KFBA 3OYKA 1TAQA 4B9SA 1HMVA 1FKOA 3V9XA 2DFFA 3MEGA 1KVBA 3KK1A 3TAMA 4B9MA 4FJ9A 1S1UA 1IKXA 2PYJA 3DRSA 1X1PA 3VQAA 1VSKA 2E6MA 4CEOA 4OPKA 3THVA 3MXIA 1HPZA 1SL0A 4CESA 3PO4A 2Z1IA 1JL1A 1QHTA 3OYNA 3DLEA 3MEEA 5DK5A 4W5RA 1RT4A 1VSJA 1LWEA 3G10A 1RTHA 1RDCA 4J2AA 2ATQA 1HYZA 1O1WA 2YV0X 4OVLA 3KK3A 4IFYA 3NDKA 4E7LA 1WNSA 4E3SA 4HCCA 4AHSA 1NK5A 4DSLA 4OKKA 1RTJA 3AA4A 3BGRA 3TWHA 4CFCA 4M41A 3F9KA 2QK9A 3NAEA 4KPYA 1KVCA 4DTNA 4PUOA 3DOKA 4CHYA 1A5VA 1LWFA 4DTUA 4CGJA 4O44A 4Q5VA 2OYQA 1HQEA 4M3YA 2DFEA 2HHXA 1C0MA 4CJQA 4DF8A 1RT7A 3NF9A 2X74A 3O4NA 3QEPA 4CJTA 2BGGA 3TAQA 1NJXA 3UIQA 1B92A 3U6FA 3HXMA 4CEQA 1RT3A 3HSTB 3KLEA 4FLVA 1HYSA 3AO4A 3V81A 1D9FA 3L2WA 3V4IA 1J5OA 4FK2A 4GW6A 5KRTA 4CJPA 3RR8A 3DLHA 4FJ5A 3RTVA 3QNNA 3ZSZA 2KTQA 1EXQA 3AVJA 3PX4A 3M8PA 1B9DA 4DU3A 1BCMA 2HHWA 4O5BA 4FW1A 2OPSA 1UOCA 3ZSVA 4E19A 4YNQA 4CIEA 1CLQA 3AVAA 3IAYA 4ELUA 4PY5A 4QOZB 5KGXA 3ZT4A 3V9ZA 4KB1A 3ISNC 3U3GA 4CJ4A 3LZIA 2ETJA 1L5UA 4N5SA 2RKIA 5J2NA 4CIFA 1S1WA 4OJRA 2HVIA 3ALYA 3AO5A 4RW4A 1JLCA 1RBSA 5C24A 3NHGA 2HMIA 1NK9A 1NJYA 1HNIA 1A5XA 2JLEA 3OS0A 4FJKA 1RBTA 3QEIA 2X6NA 4DWIA 2GUIA 2HNZA 1NOZA 5KTQA 1UA0A 4CHOA 3P83D 4TSXA 3ZSRA 4AHRA 4QAGA 3M8SA 1QE1A 4BWJA 4DQSA 5HRNA 3VQ7A 3SQ1A 4FJ7A 1VSIA 1WSJA 1NK7A 1A5WA 1KLMA 4ID5A 4I9LA 2HB5A 1QS4A 4DG1A 4EP5A 3L2UA 1FK9A 1KFDA 3LAKA 2P51A 1RDDA 1NJZA 2DFHA 2O4IA 1WSEA 4NYNA 1U04A 3QO9A 3HO1A 2P1JA 4AH9A 3ZSWA 3ZSQA 5E41A 3NH1A 2D0CA 3MXJA 4ZTFA 2HHQA 3I0RA 2ZQBA 1C0UA 3AO2A 4AILC 4CF8A 1Y97A 2RN2A 3F73A 3WNEA 3ZSYA 3TR8A 4KHQA 4CEZA 1S5JA 1WAJA 3RWUA 4ELVA 1XWLA 1BISA 3V1OA 3ZSOA 4JRPA 4HUGA 3DLGA 4Z4GA 1S6PA 1VRUA 1KRPA 3SUQA 1XC9A 4FJMA 3QINA 4K8XA 4F3OA 2HVHA 1BIUA 3AVGA 4BDYA 1CXQA 1RBUA 3V6DA 2VG6A 4FM0A 4Y1DA 3T19A 1S9GA 4FJXA 1JLBA 3AVCA 1CZBA 3LP1A 3L2VA 4CK2A 4Z4IA 3LDSA 2Z1JA 1TK0A 3V9UA 2FBTA 3KIOA 1F21A 2PZSA 4RG8A 2GV9A 2AJQA 3B6PA 4PA1A 1L3SA 3PO5A 4CHPA 3SCXA 4KHWA 4M3ZA 1SKWA 3T1AA 3SUOA 4ELTA 1D8YA 4CEDA 4K8ZA 4E7JA 3IRXA 1ZBIA 1RT5A 1WSIA 1RDBA 2X78A 4IBNA 2A1RA 1N6QA 4FJLA 4C8NA 2YKNA 1UAXA 1VSMA 3ITHA 4E7HA 1BGXT 2OZSA 4CE9A 4OPJA 2IGIA 4FCYA 5FRNA 1ZBUA 1U4BA 2XY5A 1TL3A 4AHUA 4ICLA 4DS4A 1KFSA 4KRFA 3K5MA 1ITGA 1WSGA 4O55A 4BE2A 4BWMA 4FYDA 2HHTA 3HPOA 1YTAA 3FFIA 3G0ZA 3ZCMA 4J2DA 2B6AA
chains in the Genus database with same CATH superfamily
1YHQN 1S6QA 4ID1A 2ITMA 1EWQA 3V9SA 4JKFA 2NRTA 3A5MC 3A0IX 4MDAA 3AGKA 3S3NA 4DKWA 1BU6O 3FE1A 3TPQA 3SQ2A 4DSJA 3WNGA 4YOYA 3KKRA 2UXCK 2Y1IA 3QFPA 2WOMA 5AQSA 4H5RA 3VF6A 1SZ2A 2R7YA 1ZYQA 4B8AB 4KB0A 3A5NC 3JS6A 4GKKK 3SPZA 4FJIA 1XHZA 4FWSA 3NMUA 4CBXA 1QSYA 4FWPA 3D45A 3OBYA 1Z6RA 2B4JA 5C15A 3W3DA 5C25A 1U2VA 4O8UA 1YJ9N 1VQKN 1S9EA 4Z0UA 4OGEA 1SS6A 1VQ5N 5AZJA 1DEJA 4O0IA 1WSHA 5BRHA 5E84A 4DU1A 2QKBA 3RSEA 1GLEG 3VOVA 3OYJA 1RILA 4IFEA 3TANA 4GVEA 4ZHRA 4DFJA 1S1VA 3ATVA 5AQKA 4IEEA 4A2BA 1JCFA 2LSNA 3N4QA 3I33A 3LDNA 4KI4A 4KREA 3L0QA 3D6RA 3AARA 3NGIA 5DMRA 2O8DB 1Q9XA 2KHOA 3D2EA 1TKTA 1WAFA 4PQUA 3QNOA 4A61A 4NCGA 4FJNA 5FROA 2V7ZA 3BZKA 3QIPA 4CJEA 1MWKA 2A40A 4CZJA 1NGIA 5GAHP 3I8DA 2FBYA 5MLCQ 1EETA 5I42A 4V19S 4B8CA 4CJ7A 3OYFA 4JS4A 4JKBA 4FLUA 1JCEA 2YNFA 3DRPA 4ZTJA 2A42A 4CERA 3H3OB 3JXUA 1NOYA 3OVNA 4CFDA 4HUEA 5C2DA 2QKKA 4KHSA 3M1FA 5AQOA 4CZLA 5TKWA 1NBWA 1IJJA 4WFNL 1LAVA 4BRGA 4CCHA 1J6ZA 2FF3B 3DYAA 1QQMA 2IVNA 3OJSA 3OYGA 4F9OA 4FVMA 2RE2A 3AAQA 4JKDA 1SL1A 4CEEA 3OYIA 2G8KA 3MCPA 4CJWA 4BRQA 3MX5A 4DQPA 3LDOA 4W5TA 2VG5A 4G1QA 1EQYA 4CGHA 4C8LA 3P5JA 3KLFA 4BRFA 3A8YA 3KVGA 5CYQA 3CCRN 4DR7K 2W40A 1CZ9A 3WXJA 3OYAA 3WXMB 1KCFA 3P38A 2EHGA 1J53A 3E66A 3KHYA 3W0LA 5LMNK 4HTUA 4FJHA 4DMNA 1GLLO 2DY4A 4DTXA 1IBKK 2G8HA 4FLXA 4OKEA 4JI3K 1YJNN 5CZ2A 2E4LA 1NK0A 1GOAA 5GADP 4H0TB 4WQ5A 4MLHA 3U3YA 2A5XA 2P9IB 4HVJA 4HCBA 4OGCA 1RT2A 5TKYA 3O3GA 3HM9A 3IFRA 3VQBA 4JI7K 1XMOK 4YY3K 3MDQA 2E6LA 2HHSA 1ASVA 2IDOA 2WUSA 2A41A 4AF1A 4BY9C 2D0BA 4A2AA 1BHLA 5KQ8A 1D5AA 2F8TA 4KKOA 4MDBA 3MN6A 2VWBA 1RGIA 3H1QA 2ITGA 2I5JA 4B1XB 4K43A 4F2SA 5AQPA 1IKVA 1HX1A 3ASMA 1TK5A 3FFKB 4NYFA 4DR3K 2KQ2A 3J81O 1X9SA 5ADXH 3BF1A 1NGGA 4FWLA 1T44A 5DM7L 3VQ9A 4O4GA 3CC4N 1P8ZA 4KO0A 4LF8K 3P39A 4O0JA 2YX6A 3NGZA 5LMUK 2E2NA 4I2QA 4KV8A 4QCLA 4LSLA 2VQFK 4OO1J 3HM8A 4Z4HA 2QXLA 2VGMA 2HHHK 4OLBA 2WTUA 4DFMA 2G8IA 4EZ6A 1BI4B 1RBVA 3H46O 3VQ5A 3AA2A 1NWKA 3GL1A 1E4FT 1VK0A 1WOQA 1VSLA 1V4TA 1VRTA 3FZHA 3THXB 1YUWA 1TV6A 3ULEB 4CGGA 3RR7A 5CR4A 4DTMA 3S41A 4KH5A 2ZGZA 4LD0A 2BE2A 3CCUN 4I9QA 3PUFA 1Q8IA 2YNIA 2FSKA 3IG1A 2HNDA 1JLEA 1JLGA 3ZT2A 3H45C 3MN5A 1RT6A 4LH5A 1JJ2M 3TAEA 3R3LA 1D9DA 4OLAA 1RTIA 3QBXA 4FZXC 1EKEA 2VWKA 3LP0A 4YDUA 4B9SA 3AY9A 1QHAA 3KK1A 4FJ9A 2PYJA 1X1PA 4CEOA 3MXIA 1BUPA 1VQ9N 4CESA 2Z1IA 3MEEA 3VF4A 1BWFO 1RDCA 1O1WA 1NK5A 3TWHA 4CFCA 4M41A 4B3MK 4PUOA 2NRHA 3DOKA 4DTUA 4CGJA 5GIPA 4Q5VA 1GLFO 2OYQA 2E2QA 4BC2A 4CJQA 4DF8A 2GTDA 4H5TA 4CJTA 3CC2N 3U6FA 2CGLA 4BC3A 3L2WA 3V4IA 4CJPA 5KQDA 4GKJK 4DU3A 1BCMA 2HHWA 4O5BA 4FW1A 2OPSA 1UOCA 3ZSVA 4BRLA 3AVAA 3G71N 3IAYA 4QOZB 1VQNN 4H0XB 4IJAA 3U9ZA 4DR2K 2FSJA 2RKIA 3EEQA 4OJRA 3AO5A 1JLCA 1RBSA 5C24A 4BC5A 2P9UB 2HMIA 3THXA 1A5XA 2JLEA 3H3NO 4FJKA 2JWLA 2EWSA 2P9SA 4H5NA 4IO9L 4TSXA 3IMXA 3WXLA 4ILJA 1QE1A 4DQSA 4FJ7A 5HRNA 4GV6A 1FJGK 1NK7A 3O80A 4I9LA 4DG1A 3L2UA 1KFDA 2P51A 2WFBA 1NJZA 2DFHA 4CD3A 4AH9A 3ZSWA 5E41A 4ZTFA 3I0RA 3AO2A 1LCUA 1Y97A 4KHQA 4CEZA 3RWUA 1VRUA 4OPAA 3SUQA 1YAGA 4FJMA 3QINA 2HVHA 3ZX0A 3T19A 1S9GA 1JLBA 3LP1A 3L2VA 2Z1JA 3CJCA 4RWTA 3MN7A 4FVUA 1NGCA 3B6PA 1P90A 4PA1A 4CHPA 3SCXA 4KHWA 4M3ZA 1SKWA 3ZETB 1ZC6A 4ELTA 4CEDA 4EHUA 3VF2A 3WEEB 2OZSA 5AQYA 1U4BA 4AHUA 4ICLA 4DS4A 5F1XA 2H3GX 4O55A 1WSGA 3CJ9A 4M63C 1YTAA 3DXKB 3CC7N 2E5LK 5GIOA 1SAZA 3FZLA 1RFQA 4FZYA 4BRPA 2YJFA 4IXCA 4FPBA 4K25A 5AQZA 1XC3A 3CJ1A 1KD1O 4JD2A 3U4LA 2BH1A 3K2PA 1Q81O 1IG8A 3QDKA 3FZFA 2O8FB 2D5RA 4YHHK 3H1VX 4N47A 4FWRA 4AM6A 2VWJA 3VERA 3KLGA 3ZEUB 4FM2A 3AVFA 4FLYA 4M42A 4ILHA 4B9UA 3CFPA 3VGMA 1G99A 3KD1E 1TYQA 4IZ9A 3VA0A 1SL2A 3CXCM 1NJWA 3OYBA 4W5QA 1T03A 3ZX3A 2CH6A 3FZMA 3QEVA 4IOCL 2ZJRL 3UB5A 4BRDA 4L8RB 3HP9A 3Q7BA 4M3UA 3T1YK 3G4SN 3E9LA 1NLVA 2IOCA 4B9VA 3LWMA 2O8CA 1Z05A 5I3UA 3TAGA 3TTDA 1L3TA 4H0YB 4XH4A 3LAMA 1KVAA 2ASMA 2GELA 2P5GA 3HRGA 3P1GA 3CI5A 3J80O 4CJSA 1GOCA 1WBBA 4JLHA 3L2QA 4BE0A 5CE3A 5JMVA 1NKEA 4FJJA 1HNWK 3THYB 1U2VB 2F9TA 1K9MO 3OYMA 3WEEA 1NMDA 5KI6A 4YOWA 3MX2A 4CJFA 5AZJB 2PYLA 2HBMA 4DR5K 2HHUA 4CHNA 4DLEA 1ASUA 3LP3A 3RSEB 4BRMA 4DV2K 2BUPA 1BA0A 4YOUA 3OYDA 3C6HA 5B8HA 2XY7A 3LP2A 2BDPA 4N41A 2O8EA 1T3VA 2JGUA 3NF8A 3F9MA 4CEAA 3H6EA 1TK8A 1C0TA 4I7FA 4KBOA 3M3ZA 4A59A 1YIJN 1RDAA 4JI6K 2OTLN 3K5LA 4L3QA 4LSNA 4CZFA 4FK4A 3A5OC 2OZMA 3D2EB 5FLXO 1W2BM 4LFCK 2VYPA 3AO3A 4M7XA 3TSQA 4R5PA 3L6QA 3JSMA 5BN9A 4KHNA 1C1BA 4GMJB 1KQSM 1JLFA 3TSPA 1QVFM 2BTFA 1BQNA 2E1ZA 3VQQA 5AFUA 3L2RA 3EYZA 1N5YA 3KWIA 5HBMA 3CG7A 2YKMA 1L3VA 4DV4K 1T7PA 1VQMN 2BANA 3VQ4A 3NGYA 1NGHA 4CECA 4G9ZA 2ZJQL 3AVNA 4MQ3A 5AQJA 4DTPA 2PY5A 3WNFA 4B1ZA 4U67L 2A1SA 2FLOA 2I7PA 3NBPA 2WONA 2KW4A 4CZIA 2G8FA 3VQCA 3LWLA 3ZT3A 4C8KA 3THYA 1KTQA 2OA8A 3CM6A 3IKMA 1DKGD 3JAMO 3AA5X 3EZWA 4ISGA 5M1FA 3OS1A 3SUPA 3CERA 1XI1A 2FXUA 3WXIA 2RF2A 4EFHA 1D4XA 2IS3A 3HOSA 1CXUA 1RBRA 4FWNA 1ZXOA 4HHTA 2E2OA 5LJVA 1J9AA 3KLHA 2HBLA 1QZ6A 4BC4A 5AQLA 4DSIA 1ZBHA 3BUZB 1XHXA 3LPUA 3K5NA 5HROA 1GOBA 3C6TA 1T8EA 1OH7A 3ZSXA 3DXMB 3AAPA 3CQ8A 3B6OA 3VPZA 4NXNK 4N76A 1NNEA 5C42A 1ZBLA 3CETA 1NKCA 3BDPA 4JI5K 4FSVA 1ZBSA 3EY1A 2Q3SA 4C8OA 3VGLA 4AHCA 1Y64A 3OYLA 2P9LA 3DLLL 4F8RA 3TU5A 2CGKA 3MEDA 4IG0A 4BROA 3DMJA 3CFOA 5J1EA 1ZBFA 3IDHA 1BL3A 4LH4A 3PX6A 3QETA 3E01A 3K59A 1WLJA 3HPHA 4CF0A 2O8BB 4DV0K 3S3MA 5J2PA 1FW6A 3RMDA 2GBZA 4JN4A 2B5JA 1JXBA 4WQ4A 3ZT0A 5AZIA 4B1YB 3K9KA 4JI0K 3P31A 4DV7K 3EL2A 3PY8A 2P9NA 4E89A 3EZ5A 3IS9A 1NGEA 3E9OA 3SAGA 4DB3A 4BE1A 2NRWA 3IUCA 2IC3A 5E26A 3HPGA 2HNYA 1U49A 1IG9A 4CGIA 1C0GA 2OPPA 2NZTA 2HF4A 3SQ4A 4B9NA 2RPIA 2XO7A 3HYFA 5AQXA 1EO1A 3LDLA 4CJLA 1VQPN 1Z26A 3HI0A 4JEPA 3OYKA 2DFFA 3MEGA 1X9JA 1RDUA 1S1UA 1IKXA 3DRSA 1SL0A 3THVA 1VSKA 1V4SA 1HPZA 2KLAA 4DV6K 1RT4A 3DXMA 1RTHA 3CJAA 3V6DA 4OVLA 3FZKA 4NXMK 4E3SA 4HCCA 4DR6K 4DSLA 4X66K 3THWA 4YORA 2QK9A 3F9KA 4K42A 1KVCA 4GNIA 5C12A 4O44A 2P9KA 4JV5K 4M3YA 2HHXA 3QEPA 4CZKA 3TAQA 3UIQA 1NGAA 1RT3A 4FWOA 3KLEA 3AO4A 4FK2A 5KRTA 4JKCA 5AQIA 3OHRA 3PX4A 3AVJA 3M8PA 1B9DA 4E19A 4YNQA 2O8BA 4H0VB 2NRRA 1CZAN 4ISFA 3U3GA 4CJ4A 1L5UA 3ID8A 2HVIA 1X3NA 3P4IA 4EHTA 4LF5K 3OA9A 4JI8K 3OS0A 3BEXA 1RBTA 3QEIA 2X6NA 2HNZA 1NOZA 4M7YA 1UA0A 4NB4A 3ZSRA 2HBJA 3E9PA 2UU9K 4BWJA 3L4QA 3VQ7A 3SQ1A 1WSJA 1KLMA 1O13A 4ID5A 1FK9A 4CVNE 4NYNA 1U04A 3GOIA 2ZQBA 1C0UA 3GG4A 1GLJO 4ELVA 1XWLA 4CZMA 2CGJA 3UKRA 2GUPA 4F3OA 3AVGA 1CXQA 1RBUA 2NRXA 3I8BA 4JKEA 3AVCA 3O9UA 3ZX2A 4CK2A 1ATNA 1VQON 2P9SB 3FGUA 4RG8A 2GV9A 2AJQA 1BG3A 1HR0K 3VMFB 3T1AA 4E7JA 3IRXA 1ZBIA 3OTOK 1WSIA 1RDBA 2W41A 2X78A 4YOVA 3ITHA 4E7HA 1BGXT 3O9SA 4MLEA 4XH5A 4CE9A 2QWQA 1NGJA 2KKZA 1ZBUA 5BR8K 3GDQA 1VQ7N 4KRFA 1S72N 2HHTA 3G0ZA 2B6AA 2X6SA 4QS7A 2XRIA 1YITN 1NU0A 3L4IA 2UUAK 4CF9A 1FXXA 1JLQA 4GVMA 1NK6A 2Q36A 4CJKA 5GINA 4DCHA 5HLFA 4E1MA 1NMNA 4A5BA 4FLTA 1Q7YO 3RMCA 1K73O 3TAFA 2XY8A 4FWQA 3CM5A 4B9TA 3NVMA 3HTVA 4H5VA 4FJGA 4B3OA 3V9WA 2ZWHA 3LALA 3KTQA 3QB0A 3UKUB 1XNRK 3TARA 3VEVA 3VQPA 4B3TK 1JCGA 3ATUA 3EE8A 4B3SK 2A6AA 5HP1A 4K0KK 4F4KA 5DM6L 1W0HA 3HK2A 4BR7A 3O4QA 3M6GA 3QFUA 1ATRA 3R9PA 4BDZA 4JD2B 3OYEA 5HOOA 3F5TA 4IOXA 1WN7A 1IKWA 4H0OA 4WE1A 3PX0A 3C6UA 3CYMA 1TGOA 1NK4A 4CF2A 3FR0A 1BA1A 3V1QA 4H0PA 3I56N 3WT0A 1XQSC 3PSIA 2D0PA 4CJUA 3SNNA 3NH2A 5AQMA 5FRMA 3OY9A 1TYQB 4LF4K 4M3RA 5I9EB 2NRZA 4IOAL 4LC9B 1YT3A 2YHAA 1N32K 3VGKA 1TKXA 4B1UB 4BG9A 3DLRA 4KH4A 3QMLA 4JYAK 1JLAA 4CBWA 3VTIA 2NNWA 2O8CB 4KH6A 4RW9A 1KAYA 4CK3A 3OS2A 4A5AA 2KZMA 2ZF5O 1QSLA 1JXEA 3VA3A 1VQ8N 4F3TA 2FBVA 2QI2A 3GE1A 2OTJN 1KLNA 1RTDA 4IO8A 5JS2A 1IKYA 3KLIA 4DTJA 1YTUA 4CF1A 2Q0UA 3AVIA 1MU2A 5EY4A 4N56A 2UUBK 4XH1A 4CFBA 5IT9O 4B1VA 1TUUA 3VETA 3UKUA 1HRHA 1FKPA 4DR1K 5FPNA 2KZZA 1QQNA 1HLUA 2ASPA 3MXMA 4IWVA 4M3XA 4Z4EA 1I94K 4C1NI 1VSHA 1Z25A 5ELZA 4WCEL 5HRSA 4BR5A 2D0OA 1KXPA 2O8EB 5CZ1A 4X62K 1W9HA 3EKUA 4YOXA 2V51B 1TUYA 1BIZA 1EX4A 4B9LA 2V52B 3AVHA 3ULDA 4AM7A 4DQ8A 3LPTA 2PBDA 4LY7A 3S3OA 4OKJA 3SBGA 3A5LC 4H8KA 1DTQA 3DAWA 4KTZA 4E7IA 5SWMA 3C7NB 3R1XA 5AQUA 1E3MA 3EO3A 1T05A 3MAQA 4BRNA 2F7TA 2VQEK 4IKFA 1UA1A 4YOTA 1SQKA 1SKSA 4KTQA 3V1RA 2KFNA 3NE6A 3L3UA 2DTUA 4BRIA 4JHDA 2FBXA 3AGRA 3VEZA 5AJ3K 3DWLA 4DQQA 1L3UA 3CJBA 4CK1A 1U47A 3SBTA 1VSFA 2OPRA 4M45A 2IIRA 1T6CA 3VQ8A 5EU7A 2DPNA 1HJOA 4FPAA 3VN5A 1TKDA 2UYTA 2ZGYA 1VSDA 3T69A 3EN9A 2E1YA 3VESA 4CIGA 3H08A 3AVLA 4BDPA 4PL7A 5FDLA 3A2FA 3QBWA 3SYZA 2HW3A 4WFAL 4OPHA 1C6VA 4FOEA 2P9PA 3D7EO 4FL9A 3OYHA 2RHKA 2FSNA 3DI6A 2QTDA 4W5NA 1IH7A 2ZE2A 1GLCG 3AVMA 1R0AA 1HKCA 3WNHA 5T7BA 2BGGA 1K6YA 1UWBA 4I6MB 2NRVA 3CPWM 5JVGL 4JKHA 1U48A 1Q86O 2JWKA 2O4GA 3SJJA 3CMAN 3KKSA 4H4OA 1SUQA 2A3ZA 1X3MA 1R59O 1S1TA 1S1XA 3HVTA 3QEWA 2WBNA 2Q1NA 4DFPA 3LM2A 2XY6A 3J8AA 3HP6A 1HNXK 1C1CA 3BF3A 4HUFA 2E2PA 3AVBA 5AQWA 4CJVA 4JRQA 3O3FA 1WB9A 3M5RA 4PWDA 1RCHA 4IDHA 2YHYA 2FC0A 5KRSA 4KHYA 3HOTA 3KD5E 3VEYA 3LZJA 3EE9A 2IAJA 3SV4A 1SV5A 3PV8A 1NKBA 1MDUB 3MCAB 1YXQA 2Y1JA 5EOYA 2PFUA 1NK8A 3DJCA 3EKSA 1TVRA 1TL1A 3C7NA 3CF5L 3TTFA 2NLXA 4DUZK 1J5EK 2QWRA 4FZZA 4YFUA 4WQ5C 3U9DA 2AA4A 2Q2RA 3RMBA 2P9LB 1OH8A 3S9HA 1HNVA 1RNHA 5HL7L 3SZ2A 2ZM6K 4FK0A 1K8KB 1JL2A 4RW8A 1EWRA 3KZBA 3BZCA 4JAXA 3WUHA 5CYMA 2HOEA 4BRHA 2Q31A 1HQUA 1Q9YA 1I3AA 4DSKA 2F8SA 2UUCK 4BRCA 5FPMA 5ADXA 3TI0A 1M90O 4ISEA 3AO1A 2D0AA 4FJ8A 1BQMA 1NGBA 5BPMA 2OCEA 5K14A 3QIOA 1LV5A 1QSSA 4JI2K 3VENA 3V9XA 4BVOA 5AZIB 3ZYYX 4CW7B 3O1WA 3LM9A 3TAMA 4BQZA 4MO5A 3O8MA 3ENOA 1JL1A 1QHTA 3DLEA 2P9NB 3G10A 1VSJA 1LWEA 5KPZA 4J2AA 3RMAA 3KK3A 1WNSA 4OKKA 1RTJA 1T6DA 3AA4A 3BGRA 3N4PA 3NAEA 4KPYA 1K8AO 3VEXA 4CHYA 4I6MA 2QWOA 4CBUA 1KC8O 1N33K 2ASOA 1HQEA 3G6EN 1C0MA 1RT7A 3NF9A 5AQHA 3O4NA 5AR0A 4NO7A 3CQXA 2CH5A 2QM1A 4R79A 3HXMA 4CEQA 5GAEP 4JKAA 4ILGB 2W6LA 4FLVA 1D9FA 5LJWA 3CJ7A 1VAZA 1NGFA 3DLHA 4FJ5A 3ENBA 3QNNA 2KTQA 1OKJA 1N8RO 5LL6Z 3O1BA 3RVCA 4CIEA 4PL8A 5F0XA 4PY5A 3SAHA 3WQUA 3LZIA 4FO0A 1E4GT 2ETJA 4N5SA 3THWB 5J2NA 4CIFA 2VGNA 1NK9A 2P9KB 5F2RA 1S3XA 1S22A 4DWIA 2QEXN 4FWMA 5KTQA 4CHOA 3CCLN 4QAGA 4PKHA 1YI2N 3MK6A 1A5WA 3CCSN 1WBDA 2HB5A 1QS4A 4EP5A 3PSFA 1K8KA 1RDDA 2O4IA 3BP8A 3CIPA 3NH1A 2D0CA 2YCHA 2HHQA 5A2QO 3O6WA 4QS8A 1DT9A 4YDUC 4CF8A 2RN2A 3WNEA 3D2FA 1BISA 3V1OA 4JRPA 4HUGA 3DLGA 1KRPA 3MWPA 1N34K 1XC9A 4K8XA 5AQNA 1BIUA 1GLAG 4BDYA 2HF3A 1BOTO 2HSTA 3ZLJA 4FJXA 2QW9A 5AQTA 4Z4IA 3LDSA 3V9UA 2FBTA 1F21A 5BPNA 1HPMA 2E88A 5M1OA 1D8YA 4A57A 4K8ZA 1RT5A 2QWLA 2J4RA 4IBNA 1LOTB 2A1RA 1N6QA 4FJLA 4C8NA 2YKNA 2E8AA 2YJEA 2IGIA 4FCYA 1XNQK 3K5MA 1ITGA 4BE2A 4BWMA 3HPOA 3FFIA 3ZCMA 4J2DA 4CJ3A 1TAUA 2QXFA 3UKRB 2HHVA 3M8RA 4F2RA 3VTHA 4EAHD 3O9QA 1IBMK 5AQFA 2XHBA 3QLHA 3SMPA 3HBTA 4FLWA 4EZ9A 2NUBA 4DTRA 3SPYA 1HYVA 4E1NA 1DLOA 5J2QA 4CJRA 3NVKA 4JI4K 2W6KA 4NLBA 4LF6K 2QWNA 3KWGA 4DQIA 2OPQA 1M1KO 4FOIA 1TKZA 4E0DA 4CI6A 3O4WA 4BRAA 3DM2A 5JLFA 3KJVA 1HJRA 3QEXA 3HJFA 3M8QA 1WSFA 1YVNA 4O5FA 2Z1HA 2O8DA 4CHQA 1NJIO 3QERA 1XMQK 2VCPA 2Q97A 2QWMA 4UQGA 4DV5K 3R8EA 2G8VA 1RT1A 4J2BA 5BR9A 3VQDA 4BR2A 4Y1CA 4O8KA 4BR4A 4U7BA 3OJUA 4EIAA 1C0FA 4DV3K 1LWCA 3F2KA 1YJWN 3LANA 1B9FA 3WQTA 4DR4K 4CZHA 3LDPA 1J54A 4BGBA 3CCMN 5KGWA 4WF9L 4MFBA 3QESA 5M1QA 3CMEN 5HRPA 4CHZA 3L8BA 4NCAA 5AQRA 5AFUH 3RRHA 2HBKA 5CHIA 3SMSA 4OX9K 3SK3A 2WC9A 4JKGB 1VHXA 4I2PA 5FPDA 4KHUA 4WYBA 3MECA 4FWKA 3CPEA 1HKGA 2KFZA 3C94A 3CFRA 4FM1A 2YNHA 5D3GA 4GV9A 1C1AA 3TSUA 5GAGP 1U45A 3T7ZA 4DU4A 4DF4A 1BO5O 1NGDA 3CCVN 4AHTA 3TAPA 4BVPA 1HNZK 3SUNA 4IFVA 2GEMA 3OW2M 5AQGA 2D1KA 5C10A 4DFKA 1DGKN 4XEIA 5JICA 3O08A 3NCIA 1GLDG 4Y0WA 4KAZA 1QQCA 2VG7A 5AQQA 1Q82O 4RCHA 4JS5A 4C23A 5C0YA 3SV3A 4NCBA 5KPTA 4DTSA 1IO2A 4MO4A 5FPEA 4B3RK 1KAZA 3SAFA 4GV3A 2P9IA 3VEWA 2Z1GA 1KAXA 4HWIA 5EXWA 2YI1A 3NF7A 4J8FA 3LL3A 4DLGA 3VEOA 3I0SA 4NLCA 1MWMA 3C65A 1EP4A 1G15A 4AHVA 3J7ZO 3HSCA 5HRRA 5J2MA 5AQVA 1LW2A 1BCOA 1GLBG 4JK9A 3G25A 1SKRA 4C8MA 2F96A 3B8AX 3AVKA 2W42A 3VQEA 3K58A 1OVYA 5CY4A 3O3HA 5BN8A 3UE5A 4WFBL 3DLBA 1IBLK 2UXDK 2HMPA 4DSFA 3HZ6A 4JKGA 5IWAK 3NH0A 3TABA 3HVRA 3WXKA 2YHBA 4FW2A 3AA3A 1WUAA 1OVQA 3L3VA 4RW7A 3J7YP 4DTOA 3CCEN 4JK7A 5EVZA 2YNGA 1YVUA 5KPRA 4IDKA 4IJNA 4B1WB 1LAWA 4FLZA 5SZTA 4DS5A 3K57A 3RRGA 1DTTA 4J2EA 3NF6A 1OH5A 1BI4A 4CD1A 4JI1K 3NFAA 4KI6A 5BRDA 3T3FA 3DOLA 1ASWA 3KK2A 2E20A 4Q0BA 4JHDB 4EP4A 3CCJN 3ULEA 4M3WA 5JS1A 4IEIA 1RDWX 4Z4FA 4LF7K 3HL8A 3HT3A 3ID6A 2GWJA 1QVGM 1I39A 3VQ6A 2G8UA 3D0PA 3O5BA 3LDQA 4BR9A 1REVA 1QQOA 3R6MA 3K0SA 2G8WA 4E7KA 4BRKA 4CEFA 5M1NA 2P9PB 3GBTA 3OYCA 4DQRA 4BG8A 3SQ0A 3I55N 3CQYA 1NM1A 1H1VA 3DRRA 4LF9K 4IG3A 4M3TA 2Q0RA 1JKHA 5JLHA 4QS9A 1KSPA 4CEBA 4CJ5A 4H4MA 1BDGA 1QTMA 2OANA 2ZD1A 4CGFA 4BREA 3SI6A 1LW0A 4XIUA 2F4VK 4B08A 3C95A 3K5OA 1W97L 1X9WA 4KTWA 3CD6N 1VSEA 2QWPA 1OH6A 2PAVA 1ESVA 2I7NA 4BACA 2P5OA 4CFAA 4Z4CA 3DLKA 4PKIA 4RW6A 2QA4N 1X9MA 4W5OA 4DSEA 2IVOA 3PIOL 4BGAA 4FXDA 1ILYA 2EX3A 5C2FA 5JVHL 3ZT1A 3AV9A 4CGDA 4BR0A 1VQ4N 1XUPO 4KFBA 1TAQA 1HMVA 1FKOA 4E1JA 4RTFD 1KVBA 4B9MA 3J7AP 4CZGA 3VQAA 2E6MA 4BQLA 4OPKA 2ZJPL 4C1NK 3KK7A 3PO4A 3OYNA 4W5RA 5DK5A 4PKGA 1MA9B 2ATQA 1HYZA 2YV0X 3MMVA 5BREA 3NDKA 2F9WA 4IFYA 4E7LA 4GY2B 4LFBK 4AHSA 4HTLA 4DUYK 4X64K 3ENHA 4DTNA 2P9UA 1A5VA 1LWFA 4DHYA 4X65K 3T1HK 3OBWA 5LY3A 1Q18A 4AQYK 1VQLN 2DFEA 1U6ZA 4B9QA 3BY5A 1N36K 1IV0A 2X74A 4LFAK 5M1PA 5BPLA 1NJXA 1B92A 3FLCO 4H5WA 3C6AA 3HSTB 3MWTA 1HYSA 3V81A 1J5OA 4GW6A 3CCQN 3RR8A 3E1YA 4PHTX 3RTVA 3ZSZA 1EXQA 3O9TA 1QZ5A 1CLQA 4ELUA 4WQ4C 5KGXA 3ZT4A 3V9ZA 4H03B 4KB1A 3ISNC 5M1KA 1S1WA 3ALYA 4RW4A 2D4WA 1HKBA 3NHGA 2V7YA 2UXBK 1NJYA 1NG9A 1HNIA 2GWKA 2GUIA 3TTCA 3P83D 3CHWA 4AHRA 4A62A 3M8SA 3O9RA 3ZETA 1VSIA 4JNEA 2FF6A 4UY8O 3LAKA 1W7AA 1WSEA 1YF5L 4K41A 3QO9A 3HO1A 2P1JA 3ZSQA 4Z94A 3MXJA 1ATSA 2AP1A 4AILC 2IVPA 3F73A 3ZSYA 3TR8A 1S5JA 1WAJA 3DXKA 4Z4GA 1VQ6N 3ZSOA 1S6PA 3PIPL 4JK8A 3K9JA 2VG6A 4FM0A 4Y1DA 2GX9A 5BRFA 1CZBA 2YHWA 1TK0A 3Q7CA 3KIOA 2PZSA 3MN9A 3U8XA 1L3SA 3PO5A 3SUOA 2O8FA 2YHXA 4CZEA 4KHPK 5H1SQ 1UAXA 1VSMA 3QICA 3C0BA 4OPJA 5EX5A 3ZEUA 5FRNA 3PLAA 4DV1K 2XY5A 1TL3A 1KFSA 3SJHA 1HUXA 3SLCA 4FYDA 3JYTA 3D2FB
chains in the Genus database with same CATH topology
4CJ3A 2X6SA 1TAUA 2XRIA 2QXFA 2HHVA 1S6QA 3M8RA 4F2RA 4ID1A 3V9SA 4CF9A 1FXXA 1JLQA 4GVMA 2XHBA 1NK6A 4FZYA 4CJKA 5HLFA 3QLHA 3S3NA 4E1MA 3SQ2A 4FLTA 4DSJA 3WNGA 3RMCA 3K2PA 3TAFA 3KKRA 4FLWA 2XY8A 4EZ9A 3CM5A 2NUBA 2D5RA 4B9TA 2Y1IA 4FJGA 4B3OA 4DTRA 2WOMA 3SPYA 1HYVA 4N47A 4E1NA 3V9WA 2VWJA 1DLOA 5J2QA 4CJRA 3KLGA 3LALA 2R7YA 4FM2A 1ZYQA 3KTQA 4DQIA 2OPQA 3AVFA 4FLYA 4B8AB 3TARA 4KB0A 3VQPA 4M42A 1TKZA 3SPZA 4B9UA 4E0DA 3CFPA 4FJIA 1XHZA 5HP1A 1QSYA 3KD1E 4F4KA 3D45A 3VA0A 1SL2A 3DM2A 2B4JA 3KJVA 1W0HA 1HJRA 1NJWA 5C25A 3QEXA 3HJFA 3M8QA 3HK2A 1WSFA 1NKCA 3O4QA 3OYBA 1S9EA 4W5QA 4Z0UA 1T03A 4OGEA 3QEVA 2Z1HA 4BDZA 3OYEA 4CHQA 4L8RB 3HP9A 4O0IA 1WSHA 1WN7A 3QERA 4DU1A 4M3UA 1IKWA 2QKBA 4UQGA 2G8VA 4J2BA 1RT1A 2IOCA 4WE1A 4B9VA 3VQDA 3LWMA 4Y1CA 3PX0A 3C6UA 3TAGA 5I3UA 1L3TA 3CYMA 3OYJA 1RILA 1TGOA 3OJUA 1NK4A 3LAMA 1KVAA 3TANA 4ZHRA 1LWCA 4CF2A 4DFJA 3V1QA 2P5GA 3P1GA 3LANA 1B9FA 4CJSA 1S1VA 4CJUA 1J54A 3SNNA 1GOCA 5KGWA 3NH2A 4JLHA 5FRMA 3L2QA 4BE0A 4MFBA 3OY9A 3QESA 1NKEA 2LSNA 4M3RA 5HRPA 4FJJA 4CHZA 3L8BA 4NCAA 3RRHA 4KREA 4KI4A 1YT3A 3OYMA 2YHAA 4I2PA 5KI6A 3NGIA 5DMRA 4KHUA 4CJFA 3RMAA 1Q9XA 1TKXA 2PYLA 3DLRA 2HHUA 4CHNA 3MECA 4DLEA 1TKTA 1ASUA 1WAFA 3LP3A 4PQUA 3QNOA 3OYDA 4NCGA 1JLAA 4FJNA 5FROA 3JYTA 4CJEA 3QIPA 4RW9A 2XY7A 2KFZA 4CK3A 3C94A 3I8DA 3CFRA 2FBYA 2YNHA 1EETA 3LP2A 3OS2A 4FM1A 5I42A 2BDPA 4B8CA 4N41A 5D3GA 2KZMA 3OYFA 1QSLA 1JXEA 3VA3A 4JS4A 1C1AA 4F3TA 2JGUA 3NF8A 4FLUA 2FBVA 1U45A 4CEAA 2YNFA 4DU4A 4DF4A 1KLNA 3DRPA 4AHTA 3TAPA 4ZTJA 1RTDA 1TK8A 1C0TA 4I7FA 5JS2A 4CERA 1IKYA 3SUNA 3KLIA 4DTJA 1NOYA 3OVNA 4IFVA 4CF1A 1YTUA 4CFDA 4HUEA 3AVIA 4DFKA 2QKKA 4KHSA 1RDAA 3NCIA 1MU2A 3K5LA 4N56A 4KAZA 1QQCA 1LAVA 4LSNA 4CFBA 4CCHA 2VG7A 3DYAA 4FK4A 1HRHA 1FKPA 2OZMA 3OJSA 2KZZA 3OYGA 4JS5A 3MXMA 3AO3A 3SV3A 4NCBA 4FVMA 4M3XA 4Z4EA 4R5PA 1SL1A 4CEEA 1VSHA 3JSMA 3OYIA 4KHNA 4DTSA 1Z25A 1C1BA 1IO2A 4GMJB 5HRSA 1JLFA 2G8KA 4CJWA 5CZ1A 1BQNA 1W9HA 3VQQA 3L2RA 3EYZA 1N5YA 2Z1GA 4DQPA 1BIZA 5HBMA 1EX4A 3CG7A 2VG5A 4W5TA 4B9LA 4G1QA 2YKMA 3AVHA 3NF7A 3ULDA 4CGHA 1L3VA 4C8LA 3P5JA 3KLFA 3LPTA 4LY7A 1T7PA 5CYQA 3S3OA 4OKJA 4DLGA 3I0SA 1CZ9A 3OYAA 2BANA 4H8KA 3VQ4A 3NGYA 1KCFA 1EP4A 1G15A 4AHVA 4CECA 1DTQA 2EHGA 4KTZA 1J53A 4E7IA 5SWMA 5HRRA 4HTUA 5J2MA 3AVNA 4MQ3A 4DTPA 2PY5A 4FJHA 3WNFA 1LW2A 4DMNA 2DY4A 1BCOA 4DTXA 1SKRA 2G8HA 4C8MA 2A1SA 2F96A 4OKEA 4FLXA 1T05A 3AVKA 3NBPA 5CZ2A 2E4LA 2W42A 3MAQA 2WONA 2KW4A 3VQEA 2G8FA 3VQCA 3K58A 1NK0A 1GOAA 3LWLA 5CY4A 3O3HA 3ZT3A 4IKFA 1UA1A 4C8KA 1SKSA 1KTQA 3V1RA 2OA8A 3U3YA 3NE6A 3CM6A 3L3UA 3DLBA 4KTQA 2KFNA 2DTUA 4DSFA 4HVJA 3AA5X 4HCBA 2FBXA 4OGCA 3OS1A 1RT2A 4DQQA 3NH0A 3SUPA 1L3UA 4CK1A 3TABA 1XI1A 1U47A 3HVRA 2YHBA 1VSFA 2RF2A 2OPRA 3AA3A 4FW2A 3O3GA 3HM9A 4M45A 4RW7A 3L3VA 3VQ8A 5EU7A 4DTOA 3VQBA 2IS3A 1CXUA 1RBRA 3VN5A 1TKDA 2YNGA 1VSDA 4HHTA 1YVUA 2E6LA 4CIGA 2HHSA 1J9AA 3H08A 3AVLA 4BDPA 1ASVA 2IDOA 3KLHA 5FDLA 3A2FA 4DSIA 3SYZA 4IDKA 2HW3A 1LAWA 4FLZA 2D0BA 3BDPA 1ZBHA 1C6VA 5SZTA 1XHXA 3LPUA 3K5NA 4DS5A 1GOBA 5HROA 3K57A 3RRGA 1DTTA 4J2EA 1BHLA 3C6TA 3NF6A 1D5AA 3OYHA 1T8EA 1BI4A 4KKOA 3DI6A 2F8TA 3ZSXA 4W5NA 3CQ8A 3B6OA 1IH7A 2ITGA 2I5JA 3AVMA 2ZE2A 3NFAA 1R0AA 4N76A 4KI6A 3WNHA 5C42A 3T3FA 4F2SA 1ZBLA 1IKVA 3DOLA 3ASMA 5T7BA 1ASWA 3KK2A 1K6YA 4NYFA 1UWBA 2Q3SA 3EY1A 4EP4A 1TK5A 4M3WA 2KQ2A 4C8OA 4Q0BA 5JS1A 1X9SA 4Z4FA 3HL8A 3HT3A 1U48A 2O4GA 3VQ9A 3SJJA 4AHCA 1I39A 3KKSA 4H4OA 4O4GA 1SUQA 3VQ6A 3D0PA 2G8UA 4KO0A 4O0JA 3OYLA 1REVA 1S1TA 1S1XA 3HVTA 4I2QA 3NGZA 3QEWA 4F8RA 4KV8A 4DFPA 4QCLA 2XY6A 4LSLA 3HP6A 3MEDA 1C1CA 4HUFA 4IG0A 4Z4HA 3DMJA 3CFOA 3AVBA 5J1EA 1ZBFA 4E7KA 2G8WA 4CJVA 4JRQA 3O3FA 1BL3A 4LH4A 3PX6A 4OLBA 4DFMA 4PWDA 3QETA 3E01A 4CEFA 3K59A 1RCHA 2G8IA 4DQRA 1WLJA 3OYCA 3HPHA 4CF0A 2FC0A 3S3MA 5KRSA 4EZ6A 1BI4B 1RBVA 3KD5E 5J2PA 3SQ0A 4KHYA 3VQ5A 3AA2A 3RMDA 2GBZA 3LZJA 3DRRA 1VK0A 4IG3A 2IAJA 3SV4A 4M3TA 1JKHA 1SV5A 1VSLA 3PV8A 1VRTA 2Y1JA 1NKBA 2B5JA 1JXBA 1KSPA 1TV6A 3RR7A 4CEBA 3ZT0A 4CGGA 4CJ5A 1NK8A 4H4MA 4DTMA 1TVRA 1TL1A 1QTMA 2ZD1A 4LD0A 4CGFA 2BE2A 4YFUA 3SI6A 1LW0A 4I9QA 4FZZA 4XIUA 3RMBA 4B08A 3C95A 3K5OA 3PUFA 3PY8A 1Q8IA 4E89A 2YNIA 4KTWA 1X9WA 3S9HA 1VSEA 1HNVA 1RNHA 3IG1A 3IS9A 3EZ5A 2HNDA 1JLEA 3SZ2A 1JLGA 3ZT2A 4BACA 2P5OA 4CFAA 4Z4CA 4FK0A 3DLKA 4BE1A 1X9MA 4RW6A 1JL2A 4RW8A 1RT6A 4LH5A 4W5OA 4DSEA 2IC3A 5CYMA 3TAEA 3HPGA 2HNYA 1U49A 1IG9A 4CGIA 1HQUA 1Q9YA 1D9DA 4FXDA 4OLAA 1RTIA 2OPPA 2EX3A 1I3AA 4DSKA 2F8SA 3ZT1A 3SQ4A 3AV9A 3TI0A 4B9NA 2RPIA 4CGDA 2XO7A 3HYFA 4FZXC 3AO1A 2D0AA 4FJ8A 1BQMA 1EKEA 2VWKA 5K14A 3QIOA 4CJLA 1LV5A 1Z26A 3LP0A 1QSSA 4KFBA 3OYKA 1TAQA 4B9SA 1HMVA 1FKOA 3V9XA 2DFFA 3MEGA 1KVBA 3KK1A 3TAMA 4B9MA 4FJ9A 1S1UA 1IKXA 2PYJA 3DRSA 1X1PA 3VQAA 1VSKA 2E6MA 4CEOA 4OPKA 3THVA 3MXIA 1HPZA 1SL0A 4CESA 3PO4A 2Z1IA 1JL1A 1QHTA 3OYNA 3DLEA 3MEEA 5DK5A 4W5RA 1RT4A 1VSJA 1LWEA 3G10A 1RTHA 1RDCA 4J2AA 2ATQA 1HYZA 1O1WA 2YV0X 4OVLA 3KK3A 4IFYA 3NDKA 4E7LA 1WNSA 4E3SA 4HCCA 4AHSA 1NK5A 4DSLA 4OKKA 1RTJA 3AA4A 3BGRA 3TWHA 4CFCA 4M41A 3F9KA 2QK9A 3NAEA 4KPYA 1KVCA 4DTNA 4PUOA 3DOKA 4CHYA 1A5VA 1LWFA 4DTUA 4CGJA 4O44A 4Q5VA 2OYQA 1HQEA 4M3YA 2DFEA 2HHXA 1C0MA 4CJQA 4DF8A 1RT7A 3NF9A 2X74A 3O4NA 3QEPA 4CJTA 2BGGA 3TAQA 1NJXA 3UIQA 1B92A 3U6FA 3HXMA 4CEQA 1RT3A 3HSTB 3KLEA 4FLVA 1HYSA 3AO4A 3V81A 1D9FA 3L2WA 3V4IA 1J5OA 4FK2A 4GW6A 5KRTA 4CJPA 3RR8A 3DLHA 4FJ5A 3RTVA 3QNNA 3ZSZA 2KTQA 1EXQA 3AVJA 3PX4A 3M8PA 1B9DA 4DU3A 1BCMA 2HHWA 4O5BA 4FW1A 2OPSA 1UOCA 3ZSVA 4E19A 4YNQA 4CIEA 1CLQA 3AVAA 3IAYA 4ELUA 4PY5A 4QOZB 5KGXA 3ZT4A 3V9ZA 4KB1A 3ISNC 3U3GA 4CJ4A 3LZIA 2ETJA 1L5UA 4N5SA 2RKIA 5J2NA 4CIFA 1S1WA 4OJRA 2HVIA 3ALYA 3AO5A 4RW4A 1JLCA 1RBSA 5C24A 3NHGA 2HMIA 1NK9A 1NJYA 1HNIA 1A5XA 2JLEA 3OS0A 4FJKA 1RBTA 3QEIA 2X6NA 4DWIA 2GUIA 2HNZA 1NOZA 5KTQA 1UA0A 4CHOA 3P83D 4TSXA 3ZSRA 4AHRA 4QAGA 3M8SA 1QE1A 4BWJA 4DQSA 5HRNA 3VQ7A 3SQ1A 4FJ7A 1VSIA 1WSJA 1NK7A 1A5WA 1KLMA 4ID5A 4I9LA 2HB5A 1QS4A 4DG1A 4EP5A 3L2UA 1FK9A 1KFDA 3LAKA 2P51A 1RDDA 1NJZA 2DFHA 2O4IA 1WSEA 4NYNA 1U04A 3QO9A 3HO1A 2P1JA 4AH9A 3ZSWA 3ZSQA 5E41A 3NH1A 2D0CA 3MXJA 4ZTFA 2HHQA 3I0RA 2ZQBA 1C0UA 3AO2A 4AILC 4CF8A 1Y97A 2RN2A 3F73A 3WNEA 3ZSYA 3TR8A 4KHQA 4CEZA 1S5JA 1WAJA 3RWUA 4ELVA 1XWLA 1BISA 3V1OA 3ZSOA 4JRPA 4HUGA 3DLGA 4Z4GA 1S6PA 1VRUA 1KRPA 3SUQA 1XC9A 4FJMA 3QINA 4K8XA 4F3OA 2HVHA 1BIUA 3AVGA 4BDYA 1CXQA 1RBUA 3V6DA 2VG6A 4FM0A 4Y1DA 3T19A 1S9GA 4FJXA 1JLBA 3AVCA 1CZBA 3LP1A 3L2VA 4CK2A 4Z4IA 3LDSA 2Z1JA 1TK0A 3V9UA 2FBTA 3KIOA 1F21A 2PZSA 4RG8A 2GV9A 2AJQA 3B6PA 4PA1A 1L3SA 3PO5A 4CHPA 3SCXA 4KHWA 4M3ZA 1SKWA 3T1AA 3SUOA 4ELTA 1D8YA 4CEDA 4K8ZA 4E7JA 3IRXA 1ZBIA 1RT5A 1WSIA 1RDBA 2X78A 4IBNA 2A1RA 1N6QA 4FJLA 4C8NA 2YKNA 1UAXA 1VSMA 3ITHA 4E7HA 1BGXT 2OZSA 4CE9A 4OPJA 2IGIA 4FCYA 5FRNA 1ZBUA 1U4BA 2XY5A 1TL3A 4AHUA 4ICLA 4DS4A 1KFSA 4KRFA 3K5MA 1ITGA 1WSGA 4O55A 4BE2A 4BWMA 4FYDA 2HHTA 3HPOA 1YTAA 3FFIA 3G0ZA 3ZCMA 4J2DA 2B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CJ3 A;  2X6S A;  1TAU A;  2XRI A;  2QXF A;  2HHV A;  1S6Q A;  3M8R A;  4F2R A;  4ID1 A;  3V9S A;  4CF9 A;  1FXX A;  1JLQ A;  4GVM A;  2XHB A;  1NK6 A;  4FZY A;  4CJK A;  5HLF A;  3QLH A;  3S3N A;  4E1M A;  3SQ2 A;  4FLT A;  4DSJ A;  3WNG A;  3RMC A;  3K2P A;  3TAF A;  3KKR A;  4FLW A;  2XY8 A;  4EZ9 A;  3CM5 A;  2NUB A;  2D5R A;  4B9T A;  2Y1I A;  4FJG A;  4B3O A;  4DTR A;  2WOM A;  3SPY A;  1HYV A;  4N47 A;  4E1N A;  3V9W A;  2VWJ A;  1DLO A;  5J2Q A;  4CJR A;  3KLG A;  3LAL A;  2R7Y A;  4FM2 A;  1ZYQ A;  3KTQ A;  4DQI A;  2OPQ A;  3AVF A;  4FLY A;  4B8A B;  3TAR A;  4KB0 A;  3VQP A;  4M42 A;  1TKZ A;  3SPZ A;  4B9U A;  4E0D A;  3CFP A;  4FJI A;  1XHZ A;  5HP1 A;  1QSY A;  3KD1 E;  4F4K A;  3D45 A;  3VA0 A;  1SL2 A;  3DM2 A;  2B4J A;  3KJV A;  1W0H A;  1HJR A;  1NJW A;  5C25 A;  3QEX A;  3HJF A;  3M8Q A;  3HK2 A;  1WSF A;  1NKC A;  3O4Q A;  3OYB A;  1S9E A;  4W5Q A;  4Z0U A;  1T03 A;  4OGE A;  3QEV A;  2Z1H A;  4BDZ A;  3OYE A;  4CHQ A;  4L8R B;  3HP9 A;  4O0I A;  1WSH A;  1WN7 A;  3QER A;  4DU1 A;  4M3U A;  1IKW A;  2QKB A;  4UQG A;  2G8V A;  4J2B A;  1RT1 A;  2IOC A;  4WE1 A;  4B9V A;  3VQD A;  3LWM A;  4Y1C A;  3PX0 A;  3C6U A;  3TAG A;  5I3U A;  1L3T A;  3CYM A;  3OYJ A;  1RIL A;  1TGO A;  3OJU A;  1NK4 A;  3LAM A;  1KVA A;  3TAN A;  4ZHR A;  1LWC A;  4CF2 A;  4DFJ A;  3V1Q A;  2P5G A;  3P1G A;  3LAN A;  1B9F A;  4CJS A;  1S1V A;  4CJU A;  1J54 A;  3SNN A;  1GOC A;  5KGW A;  3NH2 A;  4JLH A;  5FRM A;  3L2Q A;  4BE0 A;  4MFB A;  3OY9 A;  3QES A;  1NKE A;  2LSN A;  4M3R A;  5HRP A;  4FJJ A;  4CHZ A;  3L8B A;  4NCA A;  3RRH A;  4KRE A;  4KI4 A;  1YT3 A;  3OYM A;  2YHA A;  4I2P A;  5KI6 A;  3NGI A;  5DMR A;  4KHU A;  4CJF A;  3RMA A;  1Q9X A;  1TKX A;  2PYL A;  3DLR A;  2HHU A;  4CHN A;  3MEC A;  4DLE A;  1TKT A;  1ASU A;  1WAF A;  3LP3 A;  4PQU A;  3QNO A;  3OYD A;  4NCG A;  1JLA A;  4FJN A;  5FRO A;  3JYT A;  4CJE A;  3QIP A;  4RW9 A;  2XY7 A;  2KFZ A;  4CK3 A;  3C94 A;  3I8D A;  3CFR A;  2FBY A;  2YNH A;  1EET A;  3LP2 A;  3OS2 A;  4FM1 A;  5I42 A;  2BDP A;  4B8C A;  4N41 A;  5D3G A;  2KZM A;  3OYF A;  1QSL A;  1JXE A;  3VA3 A;  4JS4 A;  1C1A A;  4F3T A;  2JGU A;  3NF8 A;  4FLU A;  2FBV A;  1U45 A;  4CEA A;  2YNF A;  4DU4 A;  4DF4 A;  1KLN A;  3DRP A;  4AHT A;  3TAP A;  4ZTJ A;  1RTD A;  1TK8 A;  1C0T A;  4I7F A;  5JS2 A;  4CER A;  1IKY A;  3SUN A;  3KLI A;  4DTJ A;  1NOY A;  3OVN A;  4IFV A;  4CF1 A;  1YTU A;  4CFD A;  4HUE A;  3AVI A;  4DFK A;  2QKK A;  4KHS A;  1RDA A;  3NCI A;  1MU2 A;  3K5L A;  4N56 A;  4KAZ A;  1QQC A;  1LAV A;  4LSN A;  4CFB A;  4CCH A;  2VG7 A;  3DYA A;  4FK4 A;  1HRH A;  1FKP A;  2OZM A;  3OJS A;  2KZZ A;  3OYG A;  4JS5 A;  3MXM A;  3AO3 A;  3SV3 A;  4NCB A;  4FVM A;  4M3X A;  4Z4E A;  4R5P A;  1SL1 A;  4CEE A;  1VSH A;  3JSM A;  3OYI A;  4KHN A;  4DTS A;  1Z25 A;  1C1B A;  1IO2 A;  4GMJ B;  5HRS A;  1JLF A;  2G8K A;  4CJW A;  5CZ1 A;  1BQN A;  1W9H A;  3VQQ A;  3L2R A;  3EYZ A;  1N5Y A;  2Z1G A;  4DQP A;  1BIZ A;  5HBM A;  1EX4 A;  3CG7 A;  2VG5 A;  4W5T A;  4B9L A;  4G1Q A;  2YKM A;  3AVH A;  3NF7 A;  3ULD A;  4CGH A;  1L3V A;  4C8L A;  3P5J A;  3KLF A;  3LPT A;  4LY7 A;  1T7P A;  5CYQ A;  3S3O A;  4OKJ A;  4DLG A;  3I0S A;  1CZ9 A;  3OYA A;  2BAN A;  4H8K A;  3VQ4 A;  3NGY A;  1KCF A;  1EP4 A;  1G15 A;  4AHV A;  4CEC A;  1DTQ A;  2EHG A;  4KTZ A;  1J53 A;  4E7I A;  5SWM A;  5HRR A;  4HTU A;  5J2M A;  3AVN A;  4MQ3 A;  4DTP A;  2PY5 A;  4FJH A;  3WNF A;  1LW2 A;  4DMN A;  2DY4 A;  1BCO A;  4DTX A;  1SKR A;  2G8H A;  4C8M A;  2A1S A;  2F96 A;  4OKE A;  4FLX A;  1T05 A;  3AVK A;  3NBP A;  5CZ2 A;  2E4L A;  2W42 A;  3MAQ A;  2WON A;  2KW4 A;  3VQE A;  2G8F A;  3VQC A;  3K58 A;  1NK0 A;  1GOA A;  3LWL A;  5CY4 A;  3O3H A;  3ZT3 A;  4IKF A;  1UA1 A;  4C8K A;  1SKS A;  1KTQ A;  3V1R A;  2OA8 A;  3U3Y A;  3NE6 A;  3CM6 A;  3L3U A;  3DLB A;  4KTQ A;  2KFN A;  2DTU A;  4DSF A;  4HVJ A;  3AA5 X;  4HCB A;  2FBX A;  4OGC A;  3OS1 A;  1RT2 A;  4DQQ A;  3NH0 A;  3SUP A;  1L3U A;  4CK1 A;  3TAB A;  1XI1 A;  1U47 A;  3HVR A;  2YHB A;  1VSF A;  2RF2 A;  2OPR A;  3AA3 A;  4FW2 A;  3O3G A;  3HM9 A;  4M45 A;  4RW7 A;  3L3V A;  3VQ8 A;  5EU7 A;  4DTO A;  3VQB A;  2IS3 A;  1CXU A;  1RBR A;  3VN5 A;  1TKD A;  2YNG A;  1VSD A;  4HHT A;  1YVU A;  2E6L A;  4CIG A;  2HHS A;  1J9A A;  3H08 A;  3AVL A;  4BDP A;  1ASV A;  2IDO A;  3KLH A;  5FDL A;  3A2F A;  4DSI A;  3SYZ A;  4IDK A;  2HW3 A;  1LAW A;  4FLZ A;  2D0B A;  3BDP A;  1ZBH A;  1C6V A;  5SZT A;  1XHX A;  3LPU A;  3K5N A;  4DS5 A;  1GOB A;  5HRO A;  3K57 A;  3RRG A;  1DTT A;  4J2E A;  1BHL A;  3C6T A;  3NF6 A;  1D5A A;  3OYH A;  1T8E A;  1BI4 A;  4KKO A;  3DI6 A;  2F8T A;  3ZSX A;  4W5N A;  3CQ8 A;  3B6O A;  1IH7 A;  2ITG A;  2I5J A;  3AVM A;  2ZE2 A;  3NFA A;  1R0A A;  4N76 A;  4KI6 A;  3WNH A;  5C42 A;  3T3F A;  4F2S A;  1ZBL A;  1IKV A;  3DOL A;  3ASM A;  5T7B A;  1ASW A;  3KK2 A;  1K6Y A;  4NYF A;  1UWB A;  2Q3S A;  3EY1 A;  4EP4 A;  1TK5 A;  4M3W A;  2KQ2 A;  4C8O A;  4Q0B A;  5JS1 A;  1X9S A;  4Z4F A;  3HL8 A;  3HT3 A;  1U48 A;  2O4G A;  3VQ9 A;  3SJJ A;  4AHC A;  1I39 A;  3KKS A;  4H4O A;  4O4G A;  1SUQ A;  3VQ6 A;  3D0P A;  2G8U A;  4KO0 A;  4O0J A;  3OYL A;  1REV A;  1S1T A;  1S1X A;  3HVT A;  4I2Q A;  3NGZ A;  3QEW A;  4F8R A;  4KV8 A;  4DFP A;  4QCL A;  2XY6 A;  4LSL A;  3HP6 A;  3MED A;  1C1C A;  4HUF A;  4IG0 A;  4Z4H A;  3DMJ A;  3CFO A;  3AVB A;  5J1E A;  1ZBF A;  4E7K A;  2G8W A;  4CJV A;  4JRQ A;  3O3F A;  1BL3 A;  4LH4 A;  3PX6 A;  4OLB A;  4DFM A;  4PWD A;  3QET A;  3E01 A;  4CEF A;  3K59 A;  1RCH A;  2G8I A;  4DQR A;  1WLJ A;  3OYC A;  3HPH A;  4CF0 A;  2FC0 A;  3S3M A;  5KRS A;  4EZ6 A;  1BI4 B;  1RBV A;  3KD5 E;  5J2P A;  3SQ0 A;  4KHY A;  3VQ5 A;  3AA2 A;  3RMD A;  2GBZ A;  3LZJ A;  3DRR A;  1VK0 A;  4IG3 A;  2IAJ A;  3SV4 A;  4M3T A;  1JKH A;  1SV5 A;  1VSL A;  3PV8 A;  1VRT A;  2Y1J A;  1NKB A;  2B5J A;  1JXB A;  1KSP A;  1TV6 A;  3RR7 A;  4CEB A;  3ZT0 A;  4CGG A;  4CJ5 A;  1NK8 A;  4H4M A;  4DTM A;  1TVR A;  1TL1 A;  1QTM A;  2ZD1 A;  4LD0 A;  4CGF A;  2BE2 A;  4YFU A;  3SI6 A;  1LW0 A;  4I9Q A;  4FZZ A;  4XIU A;  3RMB A;  4B08 A;  3C95 A;  3K5O A;  3PUF A;  3PY8 A;  1Q8I A;  4E89 A;  2YNI A;  4KTW A;  1X9W A;  3S9H A;  1VSE A;  1HNV A;  1RNH A;  3IG1 A;  3IS9 A;  3EZ5 A;  2HND A;  1JLE A;  3SZ2 A;  1JLG A;  3ZT2 A;  4BAC A;  2P5O A;  4CFA A;  4Z4C A;  4FK0 A;  3DLK A;  4BE1 A;  1X9M A;  4RW6 A;  1JL2 A;  4RW8 A;  1RT6 A;  4LH5 A;  4W5O A;  4DSE A;  2IC3 A;  5CYM A;  3TAE A;  3HPG A;  2HNY A;  1U49 A;  1IG9 A;  4CGI A;  1HQU A;  1Q9Y A;  1D9D A;  4FXD A;  4OLA A;  1RTI A;  2OPP A;  2EX3 A;  1I3A A;  4DSK A;  2F8S A;  3ZT1 A;  3SQ4 A;  3AV9 A;  3TI0 A;  4B9N A;  2RPI A;  4CGD A;  2XO7 A;  3HYF A;  4FZX C;  3AO1 A;  2D0A A;  4FJ8 A;  1BQM A;  1EKE A;  2VWK A;  5K14 A;  3QIO A;  4CJL A;  1LV5 A;  1Z26 A;  3LP0 A;  1QSS A;  4KFB A;  3OYK A;  1TAQ A;  4B9S A;  1HMV A;  1FKO A;  3V9X A;  2DFF A;  3MEG A;  1KVB A;  3KK1 A;  3TAM A;  4B9M A;  4FJ9 A;  1S1U A;  1IKX A;  2PYJ A;  3DRS A;  1X1P A;  3VQA A;  1VSK A;  2E6M A;  4CEO A;  4OPK A;  3THV A;  3MXI A;  1HPZ A;  1SL0 A;  4CES A;  3PO4 A;  2Z1I A;  1JL1 A;  1QHT A;  3OYN A;  3DLE A;  3MEE A;  5DK5 A;  4W5R A;  1RT4 A;  1VSJ A;  1LWE A;  3G10 A;  1RTH A;  1RDC A;  4J2A A;  2ATQ A;  1HYZ A;  1O1W A;  2YV0 X;  4OVL A;  3KK3 A;  4IFY A;  3NDK A;  4E7L A;  1WNS A;  4E3S A;  4HCC A;  4AHS A;  1NK5 A;  4DSL A;  4OKK A;  1RTJ A;  3AA4 A;  3BGR A;  3TWH A;  4CFC A;  4M41 A;  3F9K A;  2QK9 A;  3NAE A;  4KPY A;  1KVC A;  4DTN A;  4PUO A;  3DOK A;  4CHY A;  1A5V A;  1LWF A;  4DTU A;  4CGJ A;  4O44 A;  4Q5V A;  2OYQ A;  1HQE A;  4M3Y A;  2DFE A;  2HHX A;  1C0M A;  4CJQ A;  4DF8 A;  1RT7 A;  3NF9 A;  2X74 A;  3O4N A;  3QEP A;  4CJT A;  2BGG A;  3TAQ A;  1NJX A;  3UIQ A;  1B92 A;  3U6F A;  3HXM A;  4CEQ A;  1RT3 A;  3HST B;  3KLE A;  4FLV A;  1HYS A;  3AO4 A;  3V81 A;  1D9F A;  3L2W A;  3V4I A;  1J5O A;  4FK2 A;  4GW6 A;  5KRT A;  4CJP A;  3RR8 A;  3DLH A;  4FJ5 A;  3RTV A;  3QNN A;  3ZSZ A;  2KTQ A;  1EXQ A;  3AVJ A;  3PX4 A;  3M8P A;  1B9D A;  4DU3 A;  1BCM A;  2HHW A;  4O5B A;  4FW1 A;  2OPS A;  1UOC A;  3ZSV A;  4E19 A;  4YNQ A;  4CIE A;  1CLQ A;  3AVA A;  3IAY A;  4ELU A;  4PY5 A;  4QOZ B;  5KGX A;  3ZT4 A;  3V9Z A;  4KB1 A;  3ISN C;  3U3G A;  4CJ4 A;  3LZI A;  2ETJ A;  1L5U A;  4N5S A;  2RKI A;  5J2N A;  4CIF A;  1S1W A;  4OJR A;  2HVI A;  3ALY A;  3AO5 A;  4RW4 A;  1JLC A;  1RBS A;  5C24 A;  3NHG A;  2HMI A;  1NK9 A;  1NJY A;  1HNI A;  1A5X A;  2JLE A;  3OS0 A;  4FJK A;  1RBT A;  3QEI A;  2X6N A;  4DWI A;  2GUI A;  2HNZ A;  1NOZ A;  5KTQ A;  1UA0 A;  4CHO A;  3P83 D;  4TSX A;  3ZSR A;  4AHR A;  4QAG A;  3M8S A;  1QE1 A;  4BWJ A;  4DQS A;  5HRN A;  3VQ7 A;  3SQ1 A;  4FJ7 A;  1VSI A;  1WSJ A;  1NK7 A;  1A5W A;  1KLM A;  4ID5 A;  4I9L A;  2HB5 A;  1QS4 A;  4DG1 A;  4EP5 A;  3L2U A;  1FK9 A;  1KFD A;  3LAK A;  2P51 A;  1RDD A;  1NJZ A;  2DFH A;  2O4I A;  1WSE A;  4NYN A;  1U04 A;  3QO9 A;  3HO1 A;  2P1J A;  4AH9 A;  3ZSW A;  3ZSQ A;  5E41 A;  3NH1 A;  2D0C A;  3MXJ A;  4ZTF A;  2HHQ A;  3I0R A;  2ZQB A;  1C0U A;  3AO2 A;  4AIL C;  4CF8 A;  1Y97 A;  2RN2 A;  3F73 A;  3WNE A;  3ZSY A;  3TR8 A;  4KHQ A;  4CEZ A;  1S5J A;  1WAJ A;  3RWU A;  4ELV A;  1XWL A;  1BIS A;  3V1O A;  3ZSO A;  4JRP A;  4HUG A;  3DLG A;  4Z4G A;  1S6P A;  1VRU A;  1KRP A;  3SUQ A;  1XC9 A;  4FJM A;  3QIN A;  4K8X A;  4F3O A;  2HVH A;  1BIU A;  3AVG A;  4BDY A;  1CXQ A;  1RBU A;  3V6D A;  2VG6 A;  4FM0 A;  4Y1D A;  3T19 A;  1S9G A;  4FJX A;  1JLB A;  3AVC A;  1CZB A;  3LP1 A;  3L2V A;  4CK2 A;  4Z4I A;  3LDS A;  2Z1J A;  1TK0 A;  3V9U A;  2FBT A;  3KIO A;  1F21 A;  2PZS A;  4RG8 A;  2GV9 A;  2AJQ A;  3B6P A;  4PA1 A;  1L3S A;  3PO5 A;  4CHP A;  3SCX A;  4KHW A;  4M3Z A;  1SKW A;  3T1A A;  3SUO A;  4ELT A;  1D8Y A;  4CED A;  4K8Z A;  4E7J A;  3IRX A;  1ZBI A;  1RT5 A;  1WSI A;  1RDB A;  2X78 A;  4IBN A;  2A1R A;  1N6Q A;  4FJL A;  4C8N A;  2YKN A;  1UAX A;  1VSM A;  3ITH A;  4E7H A;  1BGX T;  2OZS A;  4CE9 A;  4OPJ A;  2IGI A;  4FCY A;  5FRN A;  1ZBU A;  1U4B A;  2XY5 A;  1TL3 A;  4AHU A;  4ICL A;  4DS4 A;  1KFS A;  4KRF A;  3K5M A;  1ITG A;  1WSG A;  4O55 A;  4BE2 A;  4BWM A;  4FYD A;  2HHT A;  3HPO A;  1YTA A;  3FFI A;  3G0Z A;  3ZCM A;  4J2D A;  2B6A A; 
#chains in the Genus database with same CATH topology
 1YHQ N;  1S6Q A;  4ID1 A;  2ITM A;  1EWQ A;  3V9S A;  4JKF A;  2NRT A;  3A5M C;  3A0I X;  4MDA A;  3AGK A;  3S3N A;  4DKW A;  1BU6 O;  3FE1 A;  3TPQ A;  3SQ2 A;  4DSJ A;  3WNG A;  4YOY A;  3KKR A;  2UXC K;  2Y1I A;  3QFP A;  2WOM A;  5AQS A;  4H5R A;  3VF6 A;  1SZ2 A;  2R7Y A;  1ZYQ A;  4B8A B;  4KB0 A;  3A5N C;  3JS6 A;  4GKK K;  3SPZ A;  4FJI A;  1XHZ A;  4FWS A;  3NMU A;  4CBX A;  1QSY A;  4FWP A;  3D45 A;  3OBY A;  1Z6R A;  2B4J A;  5C15 A;  3W3D A;  5C25 A;  1U2V A;  4O8U A;  1YJ9 N;  1VQK N;  1S9E A;  4Z0U A;  4OGE A;  1SS6 A;  1VQ5 N;  5AZJ A;  1DEJ A;  4O0I A;  1WSH A;  5BRH A;  5E84 A;  4DU1 A;  2QKB A;  3RSE A;  1GLE G;  3VOV A;  3OYJ A;  1RIL A;  4IFE A;  3TAN A;  4GVE A;  4ZHR A;  4DFJ A;  1S1V A;  3ATV A;  5AQK A;  4IEE A;  4A2B A;  1JCF A;  2LSN A;  3N4Q A;  3I33 A;  3LDN A;  4KI4 A;  4KRE A;  3L0Q A;  3D6R A;  3AAR A;  3NGI A;  5DMR A;  2O8D B;  1Q9X A;  2KHO A;  3D2E A;  1TKT A;  1WAF A;  4PQU A;  3QNO A;  4A61 A;  4NCG A;  4FJN A;  5FRO A;  2V7Z A;  3BZK A;  3QIP A;  4CJE A;  1MWK A;  2A40 A;  4CZJ A;  1NGI A;  5GAH P;  3I8D A;  2FBY A;  5MLC Q;  1EET A;  5I42 A;  4V19 S;  4B8C A;  4CJ7 A;  3OYF A;  4JS4 A;  4JKB A;  4FLU A;  1JCE A;  2YNF A;  3DRP A;  4ZTJ A;  2A42 A;  4CER A;  3H3O B;  3JXU A;  1NOY A;  3OVN A;  4CFD A;  4HUE A;  5C2D A;  2QKK A;  4KHS A;  3M1F A;  5AQO A;  4CZL A;  5TKW A;  1NBW A;  1IJJ A;  4WFN L;  1LAV A;  4BRG A;  4CCH A;  1J6Z A;  2FF3 B;  3DYA A;  1QQM A;  2IVN A;  3OJS A;  3OYG A;  4F9O A;  4FVM A;  2RE2 A;  3AAQ A;  4JKD A;  1SL1 A;  4CEE A;  3OYI A;  2G8K A;  3MCP A;  4CJW A;  4BRQ A;  3MX5 A;  4DQP A;  3LDO A;  4W5T A;  2VG5 A;  4G1Q A;  1EQY A;  4CGH A;  4C8L A;  3P5J A;  3KLF A;  4BRF A;  3A8Y A;  3KVG A;  5CYQ A;  3CCR N;  4DR7 K;  2W40 A;  1CZ9 A;  3WXJ A;  3OYA A;  3WXM B;  1KCF A;  3P38 A;  2EHG A;  1J53 A;  3E66 A;  3KHY A;  3W0L A;  5LMN K;  4HTU A;  4FJH A;  4DMN A;  1GLL O;  2DY4 A;  4DTX A;  1IBK K;  2G8H A;  4FLX A;  4OKE A;  4JI3 K;  1YJN N;  5CZ2 A;  2E4L A;  1NK0 A;  1GOA A;  5GAD P;  4H0T B;  4WQ5 A;  4MLH A;  3U3Y A;  2A5X A;  2P9I B;  4HVJ A;  4HCB A;  4OGC A;  1RT2 A;  5TKY A;  3O3G A;  3HM9 A;  3IFR A;  3VQB A;  4JI7 K;  1XMO K;  4YY3 K;  3MDQ A;  2E6L A;  2HHS A;  1ASV A;  2IDO A;  2WUS A;  2A41 A;  4AF1 A;  4BY9 C;  2D0B A;  4A2A A;  1BHL A;  5KQ8 A;  1D5A A;  2F8T A;  4KKO A;  4MDB A;  3MN6 A;  2VWB A;  1RGI A;  3H1Q A;  2ITG A;  2I5J A;  4B1X B;  4K43 A;  4F2S A;  5AQP A;  1IKV A;  1HX1 A;  3ASM A;  1TK5 A;  3FFK B;  4NYF A;  4DR3 K;  2KQ2 A;  3J81 O;  1X9S A;  5ADX H;  3BF1 A;  1NGG A;  4FWL A;  1T44 A;  5DM7 L;  3VQ9 A;  4O4G A;  3CC4 N;  1P8Z A;  4KO0 A;  4LF8 K;  3P39 A;  4O0J A;  2YX6 A;  3NGZ A;  5LMU K;  2E2N A;  4I2Q A;  4KV8 A;  4QCL A;  4LSL A;  2VQF K;  4OO1 J;  3HM8 A;  4Z4H A;  2QXL A;  2VGM A;  2HHH K;  4OLB A;  2WTU A;  4DFM A;  2G8I A;  4EZ6 A;  1BI4 B;  1RBV A;  3H46 O;  3VQ5 A;  3AA2 A;  1NWK A;  3GL1 A;  1E4F T;  1VK0 A;  1WOQ A;  1VSL A;  1V4T A;  1VRT A;  3FZH A;  3THX B;  1YUW A;  1TV6 A;  3ULE B;  4CGG A;  3RR7 A;  5CR4 A;  4DTM A;  3S41 A;  4KH5 A;  2ZGZ A;  4LD0 A;  2BE2 A;  3CCU N;  4I9Q A;  3PUF A;  1Q8I A;  2YNI A;  2FSK A;  3IG1 A;  2HND A;  1JLE A;  1JLG A;  3ZT2 A;  3H45 C;  3MN5 A;  1RT6 A;  4LH5 A;  1JJ2 M;  3TAE A;  3R3L A;  1D9D A;  4OLA A;  1RTI A;  3QBX A;  4FZX C;  1EKE A;  2VWK A;  3LP0 A;  4YDU A;  4B9S A;  3AY9 A;  1QHA A;  3KK1 A;  4FJ9 A;  2PYJ A;  1X1P A;  4CEO A;  3MXI A;  1BUP A;  1VQ9 N;  4CES A;  2Z1I A;  3MEE A;  3VF4 A;  1BWF O;  1RDC A;  1O1W A;  1NK5 A;  3TWH A;  4CFC A;  4M41 A;  4B3M K;  4PUO A;  2NRH A;  3DOK A;  4DTU A;  4CGJ A;  5GIP A;  4Q5V A;  1GLF O;  2OYQ A;  2E2Q A;  4BC2 A;  4CJQ A;  4DF8 A;  2GTD A;  4H5T A;  4CJT A;  3CC2 N;  3U6F A;  2CGL A;  4BC3 A;  3L2W A;  3V4I A;  4CJP A;  5KQD A;  4GKJ K;  4DU3 A;  1BCM A;  2HHW A;  4O5B A;  4FW1 A;  2OPS A;  1UOC A;  3ZSV A;  4BRL A;  3AVA A;  3G71 N;  3IAY A;  4QOZ B;  1VQN N;  4H0X B;  4IJA A;  3U9Z A;  4DR2 K;  2FSJ A;  2RKI A;  3EEQ A;  4OJR A;  3AO5 A;  1JLC A;  1RBS A;  5C24 A;  4BC5 A;  2P9U B;  2HMI A;  3THX A;  1A5X A;  2JLE A;  3H3N O;  4FJK A;  2JWL A;  2EWS A;  2P9S A;  4H5N A;  4IO9 L;  4TSX A;  3IMX A;  3WXL A;  4ILJ A;  1QE1 A;  4DQS A;  4FJ7 A;  5HRN A;  4GV6 A;  1FJG K;  1NK7 A;  3O80 A;  4I9L A;  4DG1 A;  3L2U A;  1KFD A;  2P51 A;  2WFB A;  1NJZ A;  2DFH A;  4CD3 A;  4AH9 A;  3ZSW A;  5E41 A;  4ZTF A;  3I0R A;  3AO2 A;  1LCU A;  1Y97 A;  4KHQ A;  4CEZ A;  3RWU A;  1VRU A;  4OPA A;  3SUQ A;  1YAG A;  4FJM A;  3QIN A;  2HVH A;  3ZX0 A;  3T19 A;  1S9G A;  1JLB A;  3LP1 A;  3L2V A;  2Z1J A;  3CJC A;  4RWT A;  3MN7 A;  4FVU A;  1NGC A;  3B6P A;  1P90 A;  4PA1 A;  4CHP A;  3SCX A;  4KHW A;  4M3Z A;  1SKW A;  3ZET B;  1ZC6 A;  4ELT A;  4CED A;  4EHU A;  3VF2 A;  3WEE B;  2OZS A;  5AQY A;  1U4B A;  4AHU A;  4ICL A;  4DS4 A;  5F1X A;  2H3G X;  4O55 A;  1WSG A;  3CJ9 A;  4M63 C;  1YTA A;  3DXK B;  3CC7 N;  2E5L K;  5GIO A;  1SAZ A;  3FZL A;  1RFQ A;  4FZY A;  4BRP A;  2YJF A;  4IXC A;  4FPB A;  4K25 A;  5AQZ A;  1XC3 A;  3CJ1 A;  1KD1 O;  4JD2 A;  3U4L A;  2BH1 A;  3K2P A;  1Q81 O;  1IG8 A;  3QDK A;  3FZF A;  2O8F B;  2D5R A;  4YHH K;  3H1V X;  4N47 A;  4FWR A;  4AM6 A;  2VWJ A;  3VER A;  3KLG A;  3ZEU B;  4FM2 A;  3AVF A;  4FLY A;  4M42 A;  4ILH A;  4B9U A;  3CFP A;  3VGM A;  1G99 A;  3KD1 E;  1TYQ A;  4IZ9 A;  3VA0 A;  1SL2 A;  3CXC M;  1NJW A;  3OYB A;  4W5Q A;  1T03 A;  3ZX3 A;  2CH6 A;  3FZM A;  3QEV A;  4IOC L;  2ZJR L;  3UB5 A;  4BRD A;  4L8R B;  3HP9 A;  3Q7B A;  4M3U A;  3T1Y K;  3G4S N;  3E9L A;  1NLV A;  2IOC A;  4B9V A;  3LWM A;  2O8C A;  1Z05 A;  5I3U A;  3TAG A;  3TTD A;  1L3T A;  4H0Y B;  4XH4 A;  3LAM A;  1KVA A;  2ASM A;  2GEL A;  2P5G A;  3HRG A;  3P1G A;  3CI5 A;  3J80 O;  4CJS A;  1GOC A;  1WBB A;  4JLH A;  3L2Q A;  4BE0 A;  5CE3 A;  5JMV A;  1NKE A;  4FJJ A;  1HNW K;  3THY B;  1U2V B;  2F9T A;  1K9M O;  3OYM A;  3WEE A;  1NMD A;  5KI6 A;  4YOW A;  3MX2 A;  4CJF A;  5AZJ B;  2PYL A;  2HBM A;  4DR5 K;  2HHU A;  4CHN A;  4DLE A;  1ASU A;  3LP3 A;  3RSE B;  4BRM A;  4DV2 K;  2BUP A;  1BA0 A;  4YOU A;  3OYD A;  3C6H A;  5B8H A;  2XY7 A;  3LP2 A;  2BDP A;  4N41 A;  2O8E A;  1T3V A;  2JGU A;  3NF8 A;  3F9M A;  4CEA A;  3H6E A;  1TK8 A;  1C0T A;  4I7F A;  4KBO A;  3M3Z A;  4A59 A;  1YIJ N;  1RDA A;  4JI6 K;  2OTL N;  3K5L A;  4L3Q A;  4LSN A;  4CZF A;  4FK4 A;  3A5O C;  2OZM A;  3D2E B;  5FLX O;  1W2B M;  4LFC K;  2VYP A;  3AO3 A;  4M7X A;  3TSQ A;  4R5P A;  3L6Q A;  3JSM A;  5BN9 A;  4KHN A;  1C1B A;  4GMJ B;  1KQS M;  1JLF A;  3TSP A;  1QVF M;  2BTF A;  1BQN A;  2E1Z A;  3VQQ A;  5AFU A;  3L2R A;  3EYZ A;  1N5Y A;  3KWI A;  5HBM A;  3CG7 A;  2YKM A;  1L3V A;  4DV4 K;  1T7P A;  1VQM N;  2BAN A;  3VQ4 A;  3NGY A;  1NGH A;  4CEC A;  4G9Z A;  2ZJQ L;  3AVN A;  4MQ3 A;  5AQJ A;  4DTP A;  2PY5 A;  3WNF A;  4B1Z A;  4U67 L;  2A1S A;  2FLO A;  2I7P A;  3NBP A;  2WON A;  2KW4 A;  4CZI A;  2G8F A;  3VQC A;  3LWL A;  3ZT3 A;  4C8K A;  3THY A;  1KTQ A;  2OA8 A;  3CM6 A;  3IKM A;  1DKG D;  3JAM O;  3AA5 X;  3EZW A;  4ISG A;  5M1F A;  3OS1 A;  3SUP A;  3CER A;  1XI1 A;  2FXU A;  3WXI A;  2RF2 A;  4EFH A;  1D4X A;  2IS3 A;  3HOS A;  1CXU A;  1RBR A;  4FWN A;  1ZXO A;  4HHT A;  2E2O A;  5LJV A;  1J9A A;  3KLH A;  2HBL A;  1QZ6 A;  4BC4 A;  5AQL A;  4DSI A;  1ZBH A;  3BUZ B;  1XHX A;  3LPU A;  3K5N A;  5HRO A;  1GOB A;  3C6T A;  1T8E A;  1OH7 A;  3ZSX A;  3DXM B;  3AAP A;  3CQ8 A;  3B6O A;  3VPZ A;  4NXN K;  4N76 A;  1NNE A;  5C42 A;  1ZBL A;  3CET A;  1NKC A;  3BDP A;  4JI5 K;  4FSV A;  1ZBS A;  3EY1 A;  2Q3S A;  4C8O A;  3VGL A;  4AHC A;  1Y64 A;  3OYL A;  2P9L A;  3DLL L;  4F8R A;  3TU5 A;  2CGK A;  3MED A;  4IG0 A;  4BRO A;  3DMJ A;  3CFO A;  5J1E A;  1ZBF A;  3IDH A;  1BL3 A;  4LH4 A;  3PX6 A;  3QET A;  3E01 A;  3K59 A;  1WLJ A;  3HPH A;  4CF0 A;  2O8B B;  4DV0 K;  3S3M A;  5J2P A;  1FW6 A;  3RMD A;  2GBZ A;  4JN4 A;  2B5J A;  1JXB A;  4WQ4 A;  3ZT0 A;  5AZI A;  4B1Y B;  3K9K A;  4JI0 K;  3P31 A;  4DV7 K;  3EL2 A;  3PY8 A;  2P9N A;  4E89 A;  3EZ5 A;  3IS9 A;  1NGE A;  3E9O A;  3SAG A;  4DB3 A;  4BE1 A;  2NRW A;  3IUC A;  2IC3 A;  5E26 A;  3HPG A;  2HNY A;  1U49 A;  1IG9 A;  4CGI A;  1C0G A;  2OPP A;  2NZT A;  2HF4 A;  3SQ4 A;  4B9N A;  2RPI A;  2XO7 A;  3HYF A;  5AQX A;  1EO1 A;  3LDL A;  4CJL A;  1VQP N;  1Z26 A;  3HI0 A;  4JEP A;  3OYK A;  2DFF A;  3MEG A;  1X9J A;  1RDU A;  1S1U A;  1IKX A;  3DRS A;  1SL0 A;  3THV A;  1VSK A;  1V4S A;  1HPZ A;  2KLA A;  4DV6 K;  1RT4 A;  3DXM A;  1RTH A;  3CJA A;  3V6D A;  4OVL A;  3FZK A;  4NXM K;  4E3S A;  4HCC A;  4DR6 K;  4DSL A;  4X66 K;  3THW A;  4YOR A;  2QK9 A;  3F9K A;  4K42 A;  1KVC A;  4GNI A;  5C12 A;  4O44 A;  2P9K A;  4JV5 K;  4M3Y A;  2HHX A;  3QEP A;  4CZK A;  3TAQ A;  3UIQ A;  1NGA A;  1RT3 A;  4FWO A;  3KLE A;  3AO4 A;  4FK2 A;  5KRT A;  4JKC A;  5AQI A;  3OHR A;  3PX4 A;  3AVJ A;  3M8P A;  1B9D A;  4E19 A;  4YNQ A;  2O8B A;  4H0V B;  2NRR A;  1CZA N;  4ISF A;  3U3G A;  4CJ4 A;  1L5U A;  3ID8 A;  2HVI A;  1X3N A;  3P4I A;  4EHT A;  4LF5 K;  3OA9 A;  4JI8 K;  3OS0 A;  3BEX A;  1RBT A;  3QEI A;  2X6N A;  2HNZ A;  1NOZ A;  4M7Y A;  1UA0 A;  4NB4 A;  3ZSR A;  2HBJ A;  3E9P A;  2UU9 K;  4BWJ A;  3L4Q A;  3VQ7 A;  3SQ1 A;  1WSJ A;  1KLM A;  1O13 A;  4ID5 A;  1FK9 A;  4CVN E;  4NYN A;  1U04 A;  3GOI A;  2ZQB A;  1C0U A;  3GG4 A;  1GLJ O;  4ELV A;  1XWL A;  4CZM A;  2CGJ A;  3UKR A;  2GUP A;  4F3O A;  3AVG A;  1CXQ A;  1RBU A;  2NRX A;  3I8B A;  4JKE A;  3AVC A;  3O9U A;  3ZX2 A;  4CK2 A;  1ATN A;  1VQO N;  2P9S B;  3FGU A;  4RG8 A;  2GV9 A;  2AJQ A;  1BG3 A;  1HR0 K;  3VMF B;  3T1A A;  4E7J A;  3IRX A;  1ZBI A;  3OTO K;  1WSI A;  1RDB A;  2W41 A;  2X78 A;  4YOV A;  3ITH A;  4E7H A;  1BGX T;  3O9S A;  4MLE A;  4XH5 A;  4CE9 A;  2QWQ A;  1NGJ A;  2KKZ A;  1ZBU A;  5BR8 K;  3GDQ A;  1VQ7 N;  4KRF A;  1S72 N;  2HHT A;  3G0Z A;  2B6A A;  2X6S A;  4QS7 A;  2XRI A;  1YIT N;  1NU0 A;  3L4I A;  2UUA K;  4CF9 A;  1FXX A;  1JLQ A;  4GVM A;  1NK6 A;  2Q36 A;  4CJK A;  5GIN A;  4DCH A;  5HLF A;  4E1M A;  1NMN A;  4A5B A;  4FLT A;  1Q7Y O;  3RMC A;  1K73 O;  3TAF A;  2XY8 A;  4FWQ A;  3CM5 A;  4B9T A;  3NVM A;  3HTV A;  4H5V A;  4FJG A;  4B3O A;  3V9W A;  2ZWH A;  3LAL A;  3KTQ A;  3QB0 A;  3UKU B;  1XNR K;  3TAR A;  3VEV A;  3VQP A;  4B3T K;  1JCG A;  3ATU A;  3EE8 A;  4B3S K;  2A6A A;  5HP1 A;  4K0K K;  4F4K A;  5DM6 L;  1W0H A;  3HK2 A;  4BR7 A;  3O4Q A;  3M6G A;  3QFU A;  1ATR A;  3R9P A;  4BDZ A;  4JD2 B;  3OYE A;  5HOO A;  3F5T A;  4IOX A;  1WN7 A;  1IKW A;  4H0O A;  4WE1 A;  3PX0 A;  3C6U A;  3CYM A;  1TGO A;  1NK4 A;  4CF2 A;  3FR0 A;  1BA1 A;  3V1Q A;  4H0P A;  3I56 N;  3WT0 A;  1XQS C;  3PSI A;  2D0P A;  4CJU A;  3SNN A;  3NH2 A;  5AQM A;  5FRM A;  3OY9 A;  1TYQ B;  4LF4 K;  4M3R A;  5I9E B;  2NRZ A;  4IOA L;  4LC9 B;  1YT3 A;  2YHA A;  1N32 K;  3VGK A;  1TKX A;  4B1U B;  4BG9 A;  3DLR A;  4KH4 A;  3QML A;  4JYA K;  1JLA A;  4CBW A;  3VTI A;  2NNW A;  2O8C B;  4KH6 A;  4RW9 A;  1KAY A;  4CK3 A;  3OS2 A;  4A5A A;  2KZM A;  2ZF5 O;  1QSL A;  1JXE A;  3VA3 A;  1VQ8 N;  4F3T A;  2FBV A;  2QI2 A;  3GE1 A;  2OTJ N;  1KLN A;  1RTD A;  4IO8 A;  5JS2 A;  1IKY A;  3KLI A;  4DTJ A;  1YTU A;  4CF1 A;  2Q0U A;  3AVI A;  1MU2 A;  5EY4 A;  4N56 A;  2UUB K;  4XH1 A;  4CFB A;  5IT9 O;  4B1V A;  1TUU A;  3VET A;  3UKU A;  1HRH A;  1FKP A;  4DR1 K;  5FPN A;  2KZZ A;  1QQN A;  1HLU A;  2ASP A;  3MXM A;  4IWV A;  4M3X A;  4Z4E A;  1I94 K;  4C1N I;  1VSH A;  1Z25 A;  5ELZ A;  4WCE L;  5HRS A;  4BR5 A;  2D0O A;  1KXP A;  2O8E B;  5CZ1 A;  4X62 K;  1W9H A;  3EKU A;  4YOX A;  2V51 B;  1TUY A;  1BIZ A;  1EX4 A;  4B9L A;  2V52 B;  3AVH A;  3ULD A;  4AM7 A;  4DQ8 A;  3LPT A;  2PBD A;  4LY7 A;  3S3O A;  4OKJ A;  3SBG A;  3A5L C;  4H8K A;  1DTQ A;  3DAW A;  4KTZ A;  4E7I A;  5SWM A;  3C7N B;  3R1X A;  5AQU A;  1E3M A;  3EO3 A;  1T05 A;  3MAQ A;  4BRN A;  2F7T A;  2VQE K;  4IKF A;  1UA1 A;  4YOT A;  1SQK A;  1SKS A;  4KTQ A;  3V1R A;  2KFN A;  3NE6 A;  3L3U A;  2DTU A;  4BRI A;  4JHD A;  2FBX A;  3AGR A;  3VEZ A;  5AJ3 K;  3DWL A;  4DQQ A;  1L3U A;  3CJB A;  4CK1 A;  1U47 A;  3SBT A;  1VSF A;  2OPR A;  4M45 A;  2IIR A;  1T6C A;  3VQ8 A;  5EU7 A;  2DPN A;  1HJO A;  4FPA A;  3VN5 A;  1TKD A;  2UYT A;  2ZGY A;  1VSD A;  3T69 A;  3EN9 A;  2E1Y A;  3VES A;  4CIG A;  3H08 A;  3AVL A;  4BDP A;  4PL7 A;  5FDL A;  3A2F A;  3QBW A;  3SYZ A;  2HW3 A;  4WFA L;  4OPH A;  1C6V A;  4FOE A;  2P9P A;  3D7E O;  4FL9 A;  3OYH A;  2RHK A;  2FSN A;  3DI6 A;  2QTD A;  4W5N A;  1IH7 A;  2ZE2 A;  1GLC G;  3AVM A;  1R0A A;  1HKC A;  3WNH A;  5T7B A;  2BGG A;  1K6Y A;  1UWB A;  4I6M B;  2NRV A;  3CPW M;  5JVG L;  4JKH A;  1U48 A;  1Q86 O;  2JWK A;  2O4G A;  3SJJ A;  3CMA N;  3KKS A;  4H4O A;  1SUQ A;  2A3Z A;  1X3M A;  1R59 O;  1S1T A;  1S1X A;  3HVT A;  3QEW A;  2WBN A;  2Q1N A;  4DFP A;  3LM2 A;  2XY6 A;  3J8A A;  3HP6 A;  1HNX K;  1C1C A;  3BF3 A;  4HUF A;  2E2P A;  3AVB A;  5AQW A;  4CJV A;  4JRQ A;  3O3F A;  1WB9 A;  3M5R A;  4PWD A;  1RCH A;  4IDH A;  2YHY A;  2FC0 A;  5KRS A;  4KHY A;  3HOT A;  3KD5 E;  3VEY A;  3LZJ A;  3EE9 A;  2IAJ A;  3SV4 A;  1SV5 A;  3PV8 A;  1NKB A;  1MDU B;  3MCA B;  1YXQ A;  2Y1J A;  5EOY A;  2PFU A;  1NK8 A;  3DJC A;  3EKS A;  1TVR A;  1TL1 A;  3C7N A;  3CF5 L;  3TTF A;  2NLX A;  4DUZ K;  1J5E K;  2QWR A;  4FZZ A;  4YFU A;  4WQ5 C;  3U9D A;  2AA4 A;  2Q2R A;  3RMB A;  2P9L B;  1OH8 A;  3S9H A;  1HNV A;  1RNH A;  5HL7 L;  3SZ2 A;  2ZM6 K;  4FK0 A;  1K8K B;  1JL2 A;  4RW8 A;  1EWR A;  3KZB A;  3BZC A;  4JAX A;  3WUH A;  5CYM A;  2HOE A;  4BRH A;  2Q31 A;  1HQU A;  1Q9Y A;  1I3A A;  4DSK A;  2F8S A;  2UUC K;  4BRC A;  5FPM A;  5ADX A;  3TI0 A;  1M90 O;  4ISE A;  3AO1 A;  2D0A A;  4FJ8 A;  1BQM A;  1NGB A;  5BPM A;  2OCE A;  5K14 A;  3QIO A;  1LV5 A;  1QSS A;  4JI2 K;  3VEN A;  3V9X A;  4BVO A;  5AZI B;  3ZYY X;  4CW7 B;  3O1W A;  3LM9 A;  3TAM A;  4BQZ A;  4MO5 A;  3O8M A;  3ENO A;  1JL1 A;  1QHT A;  3DLE A;  2P9N B;  3G10 A;  1VSJ A;  1LWE A;  5KPZ A;  4J2A A;  3RMA A;  3KK3 A;  1WNS A;  4OKK A;  1RTJ A;  1T6D A;  3AA4 A;  3BGR A;  3N4P A;  3NAE A;  4KPY A;  1K8A O;  3VEX A;  4CHY A;  4I6M A;  2QWO A;  4CBU A;  1KC8 O;  1N33 K;  2ASO A;  1HQE A;  3G6E N;  1C0M A;  1RT7 A;  3NF9 A;  5AQH A;  3O4N A;  5AR0 A;  4NO7 A;  3CQX A;  2CH5 A;  2QM1 A;  4R79 A;  3HXM A;  4CEQ A;  5GAE P;  4JKA A;  4ILG B;  2W6L A;  4FLV A;  1D9F A;  5LJW A;  3CJ7 A;  1VAZ A;  1NGF A;  3DLH A;  4FJ5 A;  3ENB A;  3QNN A;  2KTQ A;  1OKJ A;  1N8R O;  5LL6 Z;  3O1B A;  3RVC A;  4CIE A;  4PL8 A;  5F0X A;  4PY5 A;  3SAH A;  3WQU A;  3LZI A;  4FO0 A;  1E4G T;  2ETJ A;  4N5S A;  3THW B;  5J2N A;  4CIF A;  2VGN A;  1NK9 A;  2P9K B;  5F2R A;  1S3X A;  1S22 A;  4DWI A;  2QEX N;  4FWM A;  5KTQ A;  4CHO A;  3CCL N;  4QAG A;  4PKH A;  1YI2 N;  3MK6 A;  1A5W A;  3CCS N;  1WBD A;  2HB5 A;  1QS4 A;  4EP5 A;  3PSF A;  1K8K A;  1RDD A;  2O4I A;  3BP8 A;  3CIP A;  3NH1 A;  2D0C A;  2YCH A;  2HHQ A;  5A2Q O;  3O6W A;  4QS8 A;  1DT9 A;  4YDU C;  4CF8 A;  2RN2 A;  3WNE A;  3D2F A;  1BIS A;  3V1O A;  4JRP A;  4HUG A;  3DLG A;  1KRP A;  3MWP A;  1N34 K;  1XC9 A;  4K8X A;  5AQN A;  1BIU A;  1GLA G;  4BDY A;  2HF3 A;  1BOT O;  2HST A;  3ZLJ A;  4FJX A;  2QW9 A;  5AQT A;  4Z4I A;  3LDS A;  3V9U A;  2FBT A;  1F21 A;  5BPN A;  1HPM A;  2E88 A;  5M1O A;  1D8Y A;  4A57 A;  4K8Z A;  1RT5 A;  2QWL A;  2J4R A;  4IBN A;  1LOT B;  2A1R A;  1N6Q A;  4FJL A;  4C8N A;  2YKN A;  2E8A A;  2YJE A;  2IGI A;  4FCY A;  1XNQ K;  3K5M A;  1ITG A;  4BE2 A;  4BWM A;  3HPO A;  3FFI A;  3ZCM A;  4J2D A;  4CJ3 A;  1TAU A;  2QXF A;  3UKR B;  2HHV A;  3M8R A;  4F2R A;  3VTH A;  4EAH D;  3O9Q A;  1IBM K;  5AQF A;  2XHB A;  3QLH A;  3SMP A;  3HBT A;  4FLW A;  4EZ9 A;  2NUB A;  4DTR A;  3SPY A;  1HYV A;  4E1N A;  1DLO A;  5J2Q A;  4CJR A;  3NVK A;  4JI4 K;  2W6K A;  4NLB A;  4LF6 K;  2QWN A;  3KWG A;  4DQI A;  2OPQ A;  1M1K O;  4FOI A;  1TKZ A;  4E0D A;  4CI6 A;  3O4W A;  4BRA A;  3DM2 A;  5JLF A;  3KJV A;  1HJR A;  3QEX A;  3HJF A;  3M8Q A;  1WSF A;  1YVN A;  4O5F A;  2Z1H A;  2O8D A;  4CHQ A;  1NJI O;  3QER A;  1XMQ K;  2VCP A;  2Q97 A;  2QWM A;  4UQG A;  4DV5 K;  3R8E A;  2G8V A;  1RT1 A;  4J2B A;  5BR9 A;  3VQD A;  4BR2 A;  4Y1C A;  4O8K A;  4BR4 A;  4U7B A;  3OJU A;  4EIA A;  1C0F A;  4DV3 K;  1LWC A;  3F2K A;  1YJW N;  3LAN A;  1B9F A;  3WQT A;  4DR4 K;  4CZH A;  3LDP A;  1J54 A;  4BGB A;  3CCM N;  5KGW A;  4WF9 L;  4MFB A;  3QES A;  5M1Q A;  3CME N;  5HRP A;  4CHZ A;  3L8B A;  4NCA A;  5AQR A;  5AFU H;  3RRH A;  2HBK A;  5CHI A;  3SMS A;  4OX9 K;  3SK3 A;  2WC9 A;  4JKG B;  1VHX A;  4I2P A;  5FPD A;  4KHU A;  4WYB A;  3MEC A;  4FWK A;  3CPE A;  1HKG A;  2KFZ A;  3C94 A;  3CFR A;  4FM1 A;  2YNH A;  5D3G A;  4GV9 A;  1C1A A;  3TSU A;  5GAG P;  1U45 A;  3T7Z A;  4DU4 A;  4DF4 A;  1BO5 O;  1NGD A;  3CCV N;  4AHT A;  3TAP A;  4BVP A;  1HNZ K;  3SUN A;  4IFV A;  2GEM A;  3OW2 M;  5AQG A;  2D1K A;  5C10 A;  4DFK A;  1DGK N;  4XEI A;  5JIC A;  3O08 A;  3NCI A;  1GLD G;  4Y0W A;  4KAZ A;  1QQC A;  2VG7 A;  5AQQ A;  1Q82 O;  4RCH A;  4JS5 A;  4C23 A;  5C0Y A;  3SV3 A;  4NCB A;  5KPT A;  4DTS A;  1IO2 A;  4MO4 A;  5FPE A;  4B3R K;  1KAZ A;  3SAF A;  4GV3 A;  2P9I A;  3VEW A;  2Z1G A;  1KAX A;  4HWI A;  5EXW A;  2YI1 A;  3NF7 A;  4J8F A;  3LL3 A;  4DLG A;  3VEO A;  3I0S A;  4NLC A;  1MWM A;  3C65 A;  1EP4 A;  1G15 A;  4AHV A;  3J7Z O;  3HSC A;  5HRR A;  5J2M A;  5AQV A;  1LW2 A;  1BCO A;  1GLB G;  4JK9 A;  3G25 A;  1SKR A;  4C8M A;  2F96 A;  3B8A X;  3AVK A;  2W42 A;  3VQE A;  3K58 A;  1OVY A;  5CY4 A;  3O3H A;  5BN8 A;  3UE5 A;  4WFB L;  3DLB A;  1IBL K;  2UXD K;  2HMP A;  4DSF A;  3HZ6 A;  4JKG A;  5IWA K;  3NH0 A;  3TAB A;  3HVR A;  3WXK A;  2YHB A;  4FW2 A;  3AA3 A;  1WUA A;  1OVQ A;  3L3V A;  4RW7 A;  3J7Y P;  4DTO A;  3CCE N;  4JK7 A;  5EVZ A;  2YNG A;  1YVU A;  5KPR A;  4IDK A;  4IJN A;  4B1W B;  1LAW A;  4FLZ A;  5SZT A;  4DS5 A;  3K57 A;  3RRG A;  1DTT A;  4J2E A;  3NF6 A;  1OH5 A;  1BI4 A;  4CD1 A;  4JI1 K;  3NFA A;  4KI6 A;  5BRD A;  3T3F A;  3DOL A;  1ASW A;  3KK2 A;  2E20 A;  4Q0B A;  4JHD B;  4EP4 A;  3CCJ N;  3ULE A;  4M3W A;  5JS1 A;  4IEI A;  1RDW X;  4Z4F A;  4LF7 K;  3HL8 A;  3HT3 A;  3ID6 A;  2GWJ A;  1QVG M;  1I39 A;  3VQ6 A;  2G8U A;  3D0P A;  3O5B A;  3LDQ A;  4BR9 A;  1REV A;  1QQO A;  3R6M A;  3K0S A;  2G8W A;  4E7K A;  4BRK A;  4CEF A;  5M1N A;  2P9P B;  3GBT A;  3OYC A;  4DQR A;  4BG8 A;  3SQ0 A;  3I55 N;  3CQY A;  1NM1 A;  1H1V A;  3DRR A;  4LF9 K;  4IG3 A;  4M3T A;  2Q0R A;  1JKH A;  5JLH A;  4QS9 A;  1KSP A;  4CEB A;  4CJ5 A;  4H4M A;  1BDG A;  1QTM A;  2OAN A;  2ZD1 A;  4CGF A;  4BRE A;  3SI6 A;  1LW0 A;  4XIU A;  2F4V K;  4B08 A;  3C95 A;  3K5O A;  1W97 L;  1X9W A;  4KTW A;  3CD6 N;  1VSE A;  2QWP A;  1OH6 A;  2PAV A;  1ESV A;  2I7N A;  4BAC A;  2P5O A;  4CFA A;  4Z4C A;  3DLK A;  4PKI A;  4RW6 A;  2QA4 N;  1X9M A;  4W5O A;  4DSE A;  2IVO A;  3PIO L;  4BGA A;  4FXD A;  1ILY A;  2EX3 A;  5C2F A;  5JVH L;  3ZT1 A;  3AV9 A;  4CGD A;  4BR0 A;  1VQ4 N;  1XUP O;  4KFB A;  1TAQ A;  1HMV A;  1FKO A;  4E1J A;  4RTF D;  1KVB A;  4B9M A;  3J7A P;  4CZG A;  3VQA A;  2E6M A;  4BQL A;  4OPK A;  2ZJP L;  4C1N K;  3KK7 A;  3PO4 A;  3OYN A;  4W5R A;  5DK5 A;  4PKG A;  1MA9 B;  2ATQ A;  1HYZ A;  2YV0 X;  3MMV A;  5BRE A;  3NDK A;  2F9W A;  4IFY A;  4E7L A;  4GY2 B;  4LFB K;  4AHS A;  4HTL A;  4DUY K;  4X64 K;  3ENH A;  4DTN A;  2P9U A;  1A5V A;  1LWF A;  4DHY A;  4X65 K;  3T1H K;  3OBW A;  5LY3 A;  1Q18 A;  4AQY K;  1VQL N;  2DFE A;  1U6Z A;  4B9Q A;  3BY5 A;  1N36 K;  1IV0 A;  2X74 A;  4LFA K;  5M1P A;  5BPL A;  1NJX A;  1B92 A;  3FLC O;  4H5W A;  3C6A A;  3HST B;  3MWT A;  1HYS A;  3V81 A;  1J5O A;  4GW6 A;  3CCQ N;  3RR8 A;  3E1Y A;  4PHT X;  3RTV A;  3ZSZ A;  1EXQ A;  3O9T A;  1QZ5 A;  1CLQ A;  4ELU A;  4WQ4 C;  5KGX A;  3ZT4 A;  3V9Z A;  4H03 B;  4KB1 A;  3ISN C;  5M1K A;  1S1W A;  3ALY A;  4RW4 A;  2D4W A;  1HKB A;  3NHG A;  2V7Y A;  2UXB K;  1NJY A;  1NG9 A;  1HNI A;  2GWK A;  2GUI A;  3TTC A;  3P83 D;  3CHW A;  4AHR A;  4A62 A;  3M8S A;  3O9R A;  3ZET A;  1VSI A;  4JNE A;  2FF6 A;  4UY8 O;  3LAK A;  1W7A A;  1WSE A;  1YF5 L;  4K41 A;  3QO9 A;  3HO1 A;  2P1J A;  3ZSQ A;  4Z94 A;  3MXJ A;  1ATS A;  2AP1 A;  4AIL C;  2IVP A;  3F73 A;  3ZSY A;  3TR8 A;  1S5J A;  1WAJ A;  3DXK A;  4Z4G A;  1VQ6 N;  3ZSO A;  1S6P A;  3PIP L;  4JK8 A;  3K9J A;  2VG6 A;  4FM0 A;  4Y1D A;  2GX9 A;  5BRF A;  1CZB A;  2YHW A;  1TK0 A;  3Q7C A;  3KIO A;  2PZS A;  3MN9 A;  3U8X A;  1L3S A;  3PO5 A;  3SUO A;  2O8F A;  2YHX A;  4CZE A;  4KHP K;  5H1S Q;  1UAX A;  1VSM A;  3QIC A;  3C0B A;  4OPJ A;  5EX5 A;  3ZEU A;  5FRN A;  3PLA A;  4DV1 K;  2XY5 A;  1TL3 A;  1KFS A;  3SJH A;  1HUX A;  3SLC A;  4FYD A;  3JYT A;  3D2F B; 
#chains in the Genus database with same CATH homology
 4CJ3 A;  2X6S A;  1TAU A;  2XRI A;  2QXF A;  2HHV A;  1S6Q A;  3M8R A;  4F2R A;  4ID1 A;  3V9S A;  4CF9 A;  1FXX A;  1JLQ A;  4GVM A;  2XHB A;  1NK6 A;  4FZY A;  4CJK A;  5HLF A;  3QLH A;  3S3N A;  4E1M A;  3SQ2 A;  4FLT A;  4DSJ A;  3WNG A;  3RMC A;  3K2P A;  3TAF A;  3KKR A;  4FLW A;  2XY8 A;  4EZ9 A;  3CM5 A;  2NUB A;  2D5R A;  4B9T A;  2Y1I A;  4FJG A;  4B3O A;  4DTR A;  2WOM A;  3SPY A;  1HYV A;  4N47 A;  4E1N A;  3V9W A;  2VWJ A;  1DLO A;  5J2Q A;  4CJR A;  3KLG A;  3LAL A;  2R7Y A;  4FM2 A;  1ZYQ A;  3KTQ A;  4DQI A;  2OPQ A;  3AVF A;  4FLY A;  4B8A B;  3TAR A;  4KB0 A;  3VQP A;  4M42 A;  1TKZ A;  3SPZ A;  4B9U A;  4E0D A;  3CFP A;  4FJI A;  1XHZ A;  5HP1 A;  1QSY A;  3KD1 E;  4F4K A;  3D45 A;  3VA0 A;  1SL2 A;  3DM2 A;  2B4J A;  3KJV A;  1W0H A;  1HJR A;  1NJW A;  5C25 A;  3QEX A;  3HJF A;  3M8Q A;  3HK2 A;  1WSF A;  1NKC A;  3O4Q A;  3OYB A;  1S9E A;  4W5Q A;  4Z0U A;  1T03 A;  4OGE A;  3QEV A;  2Z1H A;  4BDZ A;  3OYE A;  4CHQ A;  4L8R B;  3HP9 A;  4O0I A;  1WSH A;  1WN7 A;  3QER A;  4DU1 A;  4M3U A;  1IKW A;  2QKB A;  4UQG A;  2G8V A;  4J2B A;  1RT1 A;  2IOC A;  4WE1 A;  4B9V A;  3VQD A;  3LWM A;  4Y1C A;  3PX0 A;  3C6U A;  3TAG A;  5I3U A;  1L3T A;  3CYM A;  3OYJ A;  1RIL A;  1TGO A;  3OJU A;  1NK4 A;  3LAM A;  1KVA A;  3TAN A;  4ZHR A;  1LWC A;  4CF2 A;  4DFJ A;  3V1Q A;  2P5G A;  3P1G A;  3LAN A;  1B9F A;  4CJS A;  1S1V A;  4CJU A;  1J54 A;  3SNN A;  1GOC A;  5KGW A;  3NH2 A;  4JLH A;  5FRM A;  3L2Q A;  4BE0 A;  4MFB A;  3OY9 A;  3QES A;  1NKE A;  2LSN A;  4M3R A;  5HRP A;  4FJJ A;  4CHZ A;  3L8B A;  4NCA A;  3RRH A;  4KRE A;  4KI4 A;  1YT3 A;  3OYM A;  2YHA A;  4I2P A;  5KI6 A;  3NGI A;  5DMR A;  4KHU A;  4CJF A;  3RMA A;  1Q9X A;  1TKX A;  2PYL A;  3DLR A;  2HHU A;  4CHN A;  3MEC A;  4DLE A;  1TKT A;  1ASU A;  1WAF A;  3LP3 A;  4PQU A;  3QNO A;  3OYD A;  4NCG A;  1JLA A;  4FJN A;  5FRO A;  3JYT A;  4CJE A;  3QIP A;  4RW9 A;  2XY7 A;  2KFZ A;  4CK3 A;  3C94 A;  3I8D A;  3CFR A;  2FBY A;  2YNH A;  1EET A;  3LP2 A;  3OS2 A;  4FM1 A;  5I42 A;  2BDP A;  4B8C A;  4N41 A;  5D3G A;  2KZM A;  3OYF A;  1QSL A;  1JXE A;  3VA3 A;  4JS4 A;  1C1A A;  4F3T A;  2JGU A;  3NF8 A;  4FLU A;  2FBV A;  1U45 A;  4CEA A;  2YNF A;  4DU4 A;  4DF4 A;  1KLN A;  3DRP A;  4AHT A;  3TAP A;  4ZTJ A;  1RTD A;  1TK8 A;  1C0T A;  4I7F A;  5JS2 A;  4CER A;  1IKY A;  3SUN A;  3KLI A;  4DTJ A;  1NOY A;  3OVN A;  4IFV A;  4CF1 A;  1YTU A;  4CFD A;  4HUE A;  3AVI A;  4DFK A;  2QKK A;  4KHS A;  1RDA A;  3NCI A;  1MU2 A;  3K5L A;  4N56 A;  4KAZ A;  1QQC A;  1LAV A;  4LSN A;  4CFB A;  4CCH A;  2VG7 A;  3DYA A;  4FK4 A;  1HRH A;  1FKP A;  2OZM A;  3OJS A;  2KZZ A;  3OYG A;  4JS5 A;  3MXM A;  3AO3 A;  3SV3 A;  4NCB A;  4FVM A;  4M3X A;  4Z4E A;  4R5P A;  1SL1 A;  4CEE A;  1VSH A;  3JSM A;  3OYI A;  4KHN A;  4DTS A;  1Z25 A;  1C1B A;  1IO2 A;  4GMJ B;  5HRS A;  1JLF A;  2G8K A;  4CJW A;  5CZ1 A;  1BQN A;  1W9H A;  3VQQ A;  3L2R A;  3EYZ A;  1N5Y A;  2Z1G A;  4DQP A;  1BIZ A;  5HBM A;  1EX4 A;  3CG7 A;  2VG5 A;  4W5T A;  4B9L A;  4G1Q A;  2YKM A;  3AVH A;  3NF7 A;  3ULD A;  4CGH A;  1L3V A;  4C8L A;  3P5J A;  3KLF A;  3LPT A;  4LY7 A;  1T7P A;  5CYQ A;  3S3O A;  4OKJ A;  4DLG A;  3I0S A;  1CZ9 A;  3OYA A;  2BAN A;  4H8K A;  3VQ4 A;  3NGY A;  1KCF A;  1EP4 A;  1G15 A;  4AHV A;  4CEC A;  1DTQ A;  2EHG A;  4KTZ A;  1J53 A;  4E7I A;  5SWM A;  5HRR A;  4HTU A;  5J2M A;  3AVN A;  4MQ3 A;  4DTP A;  2PY5 A;  4FJH A;  3WNF A;  1LW2 A;  4DMN A;  2DY4 A;  1BCO A;  4DTX A;  1SKR A;  2G8H A;  4C8M A;  2A1S A;  2F96 A;  4OKE A;  4FLX A;  1T05 A;  3AVK A;  3NBP A;  5CZ2 A;  2E4L A;  2W42 A;  3MAQ A;  2WON A;  2KW4 A;  3VQE A;  2G8F A;  3VQC A;  3K58 A;  1NK0 A;  1GOA A;  3LWL A;  5CY4 A;  3O3H A;  3ZT3 A;  4IKF A;  1UA1 A;  4C8K A;  1SKS A;  1KTQ A;  3V1R A;  2OA8 A;  3U3Y A;  3NE6 A;  3CM6 A;  3L3U A;  3DLB A;  4KTQ A;  2KFN A;  2DTU A;  4DSF A;  4HVJ A;  3AA5 X;  4HCB A;  2FBX A;  4OGC A;  3OS1 A;  1RT2 A;  4DQQ A;  3NH0 A;  3SUP A;  1L3U A;  4CK1 A;  3TAB A;  1XI1 A;  1U47 A;  3HVR A;  2YHB A;  1VSF A;  2RF2 A;  2OPR A;  3AA3 A;  4FW2 A;  3O3G A;  3HM9 A;  4M45 A;  4RW7 A;  3L3V A;  3VQ8 A;  5EU7 A;  4DTO A;  3VQB A;  2IS3 A;  1CXU A;  1RBR A;  3VN5 A;  1TKD A;  2YNG A;  1VSD A;  4HHT A;  1YVU A;  2E6L A;  4CIG A;  2HHS A;  1J9A A;  3H08 A;  3AVL A;  4BDP A;  1ASV A;  2IDO A;  3KLH A;  5FDL A;  3A2F A;  4DSI A;  3SYZ A;  4IDK A;  2HW3 A;  1LAW A;  4FLZ A;  2D0B A;  3BDP A;  1ZBH A;  1C6V A;  5SZT A;  1XHX A;  3LPU A;  3K5N A;  4DS5 A;  1GOB A;  5HRO A;  3K57 A;  3RRG A;  1DTT A;  4J2E A;  1BHL A;  3C6T A;  3NF6 A;  1D5A A;  3OYH A;  1T8E A;  1BI4 A;  4KKO A;  3DI6 A;  2F8T A;  3ZSX A;  4W5N A;  3CQ8 A;  3B6O A;  1IH7 A;  2ITG A;  2I5J A;  3AVM A;  2ZE2 A;  3NFA A;  1R0A A;  4N76 A;  4KI6 A;  3WNH A;  5C42 A;  3T3F A;  4F2S A;  1ZBL A;  1IKV A;  3DOL A;  3ASM A;  5T7B A;  1ASW A;  3KK2 A;  1K6Y A;  4NYF A;  1UWB A;  2Q3S A;  3EY1 A;  4EP4 A;  1TK5 A;  4M3W A;  2KQ2 A;  4C8O A;  4Q0B A;  5JS1 A;  1X9S A;  4Z4F A;  3HL8 A;  3HT3 A;  1U48 A;  2O4G A;  3VQ9 A;  3SJJ A;  4AHC A;  1I39 A;  3KKS A;  4H4O A;  4O4G A;  1SUQ A;  3VQ6 A;  3D0P A;  2G8U A;  4KO0 A;  4O0J A;  3OYL A;  1REV A;  1S1T A;  1S1X A;  3HVT A;  4I2Q A;  3NGZ A;  3QEW A;  4F8R A;  4KV8 A;  4DFP A;  4QCL A;  2XY6 A;  4LSL A;  3HP6 A;  3MED A;  1C1C A;  4HUF A;  4IG0 A;  4Z4H A;  3DMJ A;  3CFO A;  3AVB A;  5J1E A;  1ZBF A;  4E7K A;  2G8W A;  4CJV A;  4JRQ A;  3O3F A;  1BL3 A;  4LH4 A;  3PX6 A;  4OLB A;  4DFM A;  4PWD A;  3QET A;  3E01 A;  4CEF A;  3K59 A;  1RCH A;  2G8I A;  4DQR A;  1WLJ A;  3OYC A;  3HPH A;  4CF0 A;  2FC0 A;  3S3M A;  5KRS A;  4EZ6 A;  1BI4 B;  1RBV A;  3KD5 E;  5J2P A;  3SQ0 A;  4KHY A;  3VQ5 A;  3AA2 A;  3RMD A;  2GBZ A;  3LZJ A;  3DRR A;  1VK0 A;  4IG3 A;  2IAJ A;  3SV4 A;  4M3T A;  1JKH A;  1SV5 A;  1VSL A;  3PV8 A;  1VRT A;  2Y1J A;  1NKB A;  2B5J A;  1JXB A;  1KSP A;  1TV6 A;  3RR7 A;  4CEB A;  3ZT0 A;  4CGG A;  4CJ5 A;  1NK8 A;  4H4M A;  4DTM A;  1TVR A;  1TL1 A;  1QTM A;  2ZD1 A;  4LD0 A;  4CGF A;  2BE2 A;  4YFU A;  3SI6 A;  1LW0 A;  4I9Q A;  4FZZ A;  4XIU A;  3RMB A;  4B08 A;  3C95 A;  3K5O A;  3PUF A;  3PY8 A;  1Q8I A;  4E89 A;  2YNI A;  4KTW A;  1X9W A;  3S9H A;  1VSE A;  1HNV A;  1RNH A;  3IG1 A;  3IS9 A;  3EZ5 A;  2HND A;  1JLE A;  3SZ2 A;  1JLG A;  3ZT2 A;  4BAC A;  2P5O A;  4CFA A;  4Z4C A;  4FK0 A;  3DLK A;  4BE1 A;  1X9M A;  4RW6 A;  1JL2 A;  4RW8 A;  1RT6 A;  4LH5 A;  4W5O A;  4DSE A;  2IC3 A;  5CYM A;  3TAE A;  3HPG A;  2HNY A;  1U49 A;  1IG9 A;  4CGI A;  1HQU A;  1Q9Y A;  1D9D A;  4FXD A;  4OLA A;  1RTI A;  2OPP A;  2EX3 A;  1I3A A;  4DSK A;  2F8S A;  3ZT1 A;  3SQ4 A;  3AV9 A;  3TI0 A;  4B9N A;  2RPI A;  4CGD A;  2XO7 A;  3HYF A;  4FZX C;  3AO1 A;  2D0A A;  4FJ8 A;  1BQM A;  1EKE A;  2VWK A;  5K14 A;  3QIO A;  4CJL A;  1LV5 A;  1Z26 A;  3LP0 A;  1QSS A;  4KFB A;  3OYK A;  1TAQ A;  4B9S A;  1HMV A;  1FKO A;  3V9X A;  2DFF A;  3MEG A;  1KVB A;  3KK1 A;  3TAM A;  4B9M A;  4FJ9 A;  1S1U A;  1IKX A;  2PYJ A;  3DRS A;  1X1P A;  3VQA A;  1VSK A;  2E6M A;  4CEO A;  4OPK A;  3THV A;  3MXI A;  1HPZ A;  1SL0 A;  4CES A;  3PO4 A;  2Z1I A;  1JL1 A;  1QHT A;  3OYN A;  3DLE A;  3MEE A;  5DK5 A;  4W5R A;  1RT4 A;  1VSJ A;  1LWE A;  3G10 A;  1RTH A;  1RDC A;  4J2A A;  2ATQ A;  1HYZ A;  1O1W A;  2YV0 X;  4OVL A;  3KK3 A;  4IFY A;  3NDK A;  4E7L A;  1WNS A;  4E3S A;  4HCC A;  4AHS A;  1NK5 A;  4DSL A;  4OKK A;  1RTJ A;  3AA4 A;  3BGR A;  3TWH A;  4CFC A;  4M41 A;  3F9K A;  2QK9 A;  3NAE A;  4KPY A;  1KVC A;  4DTN A;  4PUO A;  3DOK A;  4CHY A;  1A5V A;  1LWF A;  4DTU A;  4CGJ A;  4O44 A;  4Q5V A;  2OYQ A;  1HQE A;  4M3Y A;  2DFE A;  2HHX A;  1C0M A;  4CJQ A;  4DF8 A;  1RT7 A;  3NF9 A;  2X74 A;  3O4N A;  3QEP A;  4CJT A;  2BGG A;  3TAQ A;  1NJX A;  3UIQ A;  1B92 A;  3U6F A;  3HXM A;  4CEQ A;  1RT3 A;  3HST B;  3KLE A;  4FLV A;  1HYS A;  3AO4 A;  3V81 A;  1D9F A;  3L2W A;  3V4I A;  1J5O A;  4FK2 A;  4GW6 A;  5KRT A;  4CJP A;  3RR8 A;  3DLH A;  4FJ5 A;  3RTV A;  3QNN A;  3ZSZ A;  2KTQ A;  1EXQ A;  3AVJ A;  3PX4 A;  3M8P A;  1B9D A;  4DU3 A;  1BCM A;  2HHW A;  4O5B A;  4FW1 A;  2OPS A;  1UOC A;  3ZSV A;  4E19 A;  4YNQ A;  4CIE A;  1CLQ A;  3AVA A;  3IAY A;  4ELU A;  4PY5 A;  4QOZ B;  5KGX A;  3ZT4 A;  3V9Z A;  4KB1 A;  3ISN C;  3U3G A;  4CJ4 A;  3LZI A;  2ETJ A;  1L5U A;  4N5S A;  2RKI A;  5J2N A;  4CIF A;  1S1W A;  4OJR A;  2HVI A;  3ALY A;  3AO5 A;  4RW4 A;  1JLC A;  1RBS A;  5C24 A;  3NHG A;  2HMI A;  1NK9 A;  1NJY A;  1HNI A;  1A5X A;  2JLE A;  3OS0 A;  4FJK A;  1RBT A;  3QEI A;  2X6N A;  4DWI A;  2GUI A;  2HNZ A;  1NOZ A;  5KTQ A;  1UA0 A;  4CHO A;  3P83 D;  4TSX A;  3ZSR A;  4AHR A;  4QAG A;  3M8S A;  1QE1 A;  4BWJ A;  4DQS A;  5HRN A;  3VQ7 A;  3SQ1 A;  4FJ7 A;  1VSI A;  1WSJ A;  1NK7 A;  1A5W A;  1KLM A;  4ID5 A;  4I9L A;  2HB5 A;  1QS4 A;  4DG1 A;  4EP5 A;  3L2U A;  1FK9 A;  1KFD A;  3LAK A;  2P51 A;  1RDD A;  1NJZ A;  2DFH A;  2O4I A;  1WSE A;  4NYN A;  1U04 A;  3QO9 A;  3HO1 A;  2P1J A;  4AH9 A;  3ZSW A;  3ZSQ A;  5E41 A;  3NH1 A;  2D0C A;  3MXJ A;  4ZTF A;  2HHQ A;  3I0R A;  2ZQB A;  1C0U A;  3AO2 A;  4AIL C;  4CF8 A;  1Y97 A;  2RN2 A;  3F73 A;  3WNE A;  3ZSY A;  3TR8 A;  4KHQ A;  4CEZ A;  1S5J A;  1WAJ A;  3RWU A;  4ELV A;  1XWL A;  1BIS A;  3V1O A;  3ZSO A;  4JRP A;  4HUG A;  3DLG A;  4Z4G A;  1S6P A;  1VRU A;  1KRP A;  3SUQ A;  1XC9 A;  4FJM A;  3QIN A;  4K8X A;  4F3O A;  2HVH A;  1BIU A;  3AVG A;  4BDY A;  1CXQ A;  1RBU A;  3V6D A;  2VG6 A;  4FM0 A;  4Y1D A;  3T19 A;  1S9G A;  4FJX A;  1JLB A;  3AVC A;  1CZB A;  3LP1 A;  3L2V A;  4CK2 A;  4Z4I A;  3LDS A;  2Z1J A;  1TK0 A;  3V9U A;  2FBT A;  3KIO A;  1F21 A;  2PZS A;  4RG8 A;  2GV9 A;  2AJQ A;  3B6P A;  4PA1 A;  1L3S A;  3PO5 A;  4CHP A;  3SCX A;  4KHW A;  4M3Z A;  1SKW A;  3T1A A;  3SUO A;  4ELT A;  1D8Y A;  4CED A;  4K8Z A;  4E7J A;  3IRX A;  1ZBI A;  1RT5 A;  1WSI A;  1RDB A;  2X78 A;  4IBN A;  2A1R A;  1N6Q A;  4FJL A;  4C8N A;  2YKN A;  1UAX A;  1VSM A;  3ITH A;  4E7H A;  1BGX T;  2OZS A;  4CE9 A;  4OPJ A;  2IGI A;  4FCY A;  5FRN A;  1ZBU A;  1U4B A;  2XY5 A;  1TL3 A;  4AHU A;  4ICL A;  4DS4 A;  1KFS A;  4KRF A;  3K5M A;  1ITG A;  1WSG A;  4O55 A;  4BE2 A;  4BWM A;  4FYD A;  2HHT A;  3HPO A;  1YTA A;  3FFI A;  3G0Z A;  3ZCM A;  4J2D A;  2B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...