1JXBA

I53a, a point mutant of the cysteine-free variant of e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
152
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAAVALEALKEHAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Propagation of a single destabilizing mutation throughout the Escherichia coli ribonuclease HI native state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jxbA00
3L2VA 4JLHA 3TAQA 1KLMA 1X9WA 1CXUA 1LWEA 4J2BA 3VQEA 4BACA 4DG1A 5JS1A 1KVBA 1C0MA 5CYMA 4AHVA 1TAQA 5EU7A 3AVKA 3K59A 4CGGA 4QOZB 2XY8A 3DI6A 4ID1A 4OJRA 4FLTA 1U47A 2HHSA 1XC9A 2GV9A 1U04A 1NKCA 3ZSVA 2HVIA 1QQCA 4FLXA 1C0TA 4M45A 4CK3A 4CECA 3DOLA 3RTVA 1C1AA 3AO3A 3NF7A 4OPJA 1C1CA 3TR8A 4B9SA 4NYFA 1TL3A 1LW0A 3VQAA 1S1WA 3VQ8A 4KB0A 1YTAA 2G8KA 1ASVA 3S3OA 2G8FA 3RRHA 1LAWA 3DRSA 1ZBLA 3TI0A 2HHTA 5FRNA 2OPRA 2LSNA 1JL1A 3QIOA 4Y1CA 4BWJA 4W5QA 1VSFA 4DSEA 3LALA 2PYLA 3B6PA 4Z0UA 3NGZA 4AHCA 2O4GA 4JS4A 5J2NA 5J2QA 3L2WA 2OZMA 3O3GA 4CERA 2IC3A 3MXMA 2FBYA 3HXMA 4O0IA 3K5MA 3EZ5A 4GW6A 2E6LA 4ELVA 4CJRA 3QNNA 4CEBA 3G10A 1HYZA 3HPOA 3HK2A 2HHVA 3PX4A 3SZ2A 3ZT0A 3QO9A 3ALYA 3O4QA 1WAJA 1S5JA 1LWFA 4C8NA 3T1AA 4Z4HA 3OYAA 3PX6A 4OGEA 1L5UA 4KAZA 1A5XA 2XY6A 5CYQA 5HP1A 3LZJA 4KHQA 1S6PA 2IAJA 3OYDA 2E6MA 4C8KA 3HSTB 1QSYA 1KFDA 4OGCA 3SCXA 3HYFA 2Q3SA 3V1OA 1FKOA 4OLAA 3ZT2A 1J5OA 4OLBA 1TAUA 5KGXA 3QLHA 3OYJA 3AA3A 3HVRA 5HRPA 3U3GA 3KJVA 4ELUA 3AVGA 3P83D 3VN5A 3HT3A 1UA1A 1RTJA 4OKJA 3QESA 4B9NA 4IKFA 3OYHA 3K57A 3O3HA 4CFBA 1HJRA 2ZE2A 3NH1A 4GMJB 4E3SA 4CFAA 5CY4A 1WNSA 2Z1GA 5JS2A 4QAGA 3KLHA 4FJ9A 3ZCMA 1N6QA 3OVNA 1KRPA 3BDPA 4KB1A 4FJNA 3NGYA 4DTSA 4KREA 5HBMA 1TKTA 1NJXA 5HRSA 4I9LA 1JKHA 4CCHA 2NUBA 2HW3A 5SZTA 3OJSA 2HNYA 1IKYA 3F9KA 3V81A 3U3YA 1NOYA 1KSPA 1SL0A 4O55A 4B9UA 4DSJA 4AH9A 3V9UA 1JLAA 4FM0A 1BQNA 4CESA 1RTIA 1VSJA 1X1PA 3MEDA 4CK2A 1L3UA 4NCAA 4AHSA 4CJPA 3RMDA 4CHQA 3P5JA 3I0SA 2AJQA 1HMVA 1RDCA 4C8MA 4DTOA 4PA1A 3CFPA 3LWLA 4DFKA 4MFBA 4AHRA 4CIEA 3U6FA 4B9TA 4KI6A 3DYAA 1B9DA 1UWBA 3ASMA 3C6UA 4CJVA 2W42A 4E1NA 1RT6A 2G8UA 1CXQA 4ID5A 1TL1A 4CF9A 3LPTA 4E1MA 3VA0A 1ITGA 3ITHA 3AV9A 3LWMA 2BANA 4DS5A 5I3UA 2G8VA 4FZYA 1EP4A 2DFEA 3HVTA 4CGIA 1WAFA 1T8EA 1RT2A 2DY4A 4FLZA 4ICLA 1CZBA 4L8RB 4DU3A 1XHZA 4IG0A 5HRRA 1IKXA 5CZ1A 4CEAA 2B5JA 3P1GA 3O4NA 3V6DA 3EY1A 3TARA 4DTRA 2ETJA 4C8LA 4H8KA 1RT5A 1QE1A 4E7JA 4E89A 2F8TA 2OA8A 3OJUA 4ZTJA 3V9XA 3KK1A 3NF6A 3ZT1A 3PY8A 3DLGA 1C1BA 1SKSA 3ZSWA 1W9HA 3NGIA 1VSMA 3QIPA 3PUFA 4N56A 2RN2A 2VG7A 1VK0A 4F2RA 4CJLA 4YFUA 1GOAA 4CF1A 3ZSQA 4KFBA 3MXJA 4J2EA 3SJJA 2P5OA 2EHGA 3LP1A 3KLGA 3QEVA 3VQ9A 3AVJA 4KV8A 4XIUA 3PX0A 1NK7A 2HMIA 1RBSA 3NFAA 4KO0A 1BQMA 3NH2A 1TK0A 1Z25A 1Q8IA 1A5VA 2OPQA 4BDYA 4DQPA 1J9AA 4B8CA 2G8IA 1F21A 1A5WA 3SUPA 1QHTA 3LPUA 3SUQA 4NYNA 1HNVA 2Z1JA 5I42A 2OZSA 2OPPA 4Z4EA 3F73A 1BIUA 2FBVA 3HM9A 1RDDA 1K6YA 2XRIA 4HUFA 3VQQA 3OYMA 3CFRA 4FLVA 1YTUA 3MEEA 4AHUA 1RBVA 1VSDA 3AA4A 3AVHA 3JSMA 1HPZA 2YNHA 4AHTA 3OYLA 4CEQA 2ZD1A 1JLFA 3DRPA 3MECA 3AVAA 5CZ2A 3QERA 1L3SA 3KD5E 3PO5A 3VQ4A 1FK9A 3C6TA 4FJLA 4F4KA 1ZYQA 1RNHA 4W5RA 3THVA 4CJSA 2WOMA 1NK0A 1RBTA 4BE2A 1REVA 4C8OA 5KI6A 4FJHA 2KW4A 3PV8A 1XHXA 1RT1A 3L2QA 4HHTA 4Y1DA 1NK8A 1SKWA 4O5BA 4GVMA 1S1XA 2WONA 1Q9XA 4UQGA 3JYTA 3V4IA 4FXDA 1CZ9A 3OYBA 1RT3A 3QEIA 3DLRA 4O4GA 1HYSA 4LH4A 3L2RA 4DTJA 4CHOA 3ZSYA 1EKEA 1DLOA 1JLEA 2B4JA 2XO7A 1LW2A 1UAXA 3AVFA 2BE2A 4G1QA 3ULDA 2PZSA 4CHNA 3RR7A 4CJ4A 4CJ3A 2VWKA 3HPHA 3LAKA 4HVJA 4JRPA 1TKDA 1BIZA 3KK2A 2X6NA 3ZT3A 3OYFA 3S3MA 3VQDA 4KTWA 1RBUA 3KLIA 4CJEA 5HRNA 3L8BA 3QETA 3C94A 2XY7A 4DFMA 2G8WA 4IG3A 4EP4A 5FRMA 4CGJA 4PY5A 4FM1A 2XY5A 1VSKA 4RW8A 2VG6A 4DS4A 2YNGA 1BCOA 3DMJA 3HPGA 4CF8A 3TAGA 4CJTA 3VQBA 3TAFA 4NCGA 1RILA 1I3AA 4LY7A 3CYMA 4MQ3A 3OYKA 4E7HA 1QSSA 4K8ZA 4FJMA 4FW2A 1U48A 3KK3A 2IDOA 1DTTA 1XI1A 2D5RA 3ISNC 3V1QA 3NHGA 2YHBA 1S6QA 4I9QA 4B08A 1NJYA 1IH7A 2E4LA 2P1JA 3OY9A 4CIGA 1WSHA 3FFIA 1Q9YA 3K5LA 2GUIA 3TANA 4F3TA 3TWHA 1BGXT 4NCBA 4H4MA 4CHZA 2VWJA 1YT3A 4BDPA 4CF2A 4CK1A 1NOZA 1RT4A 4W5TA 4ZTFA 3V9SA 2A1RA 3LANA 2ATQA 3OS0A 4FCYA 4BWMA 3WNGA 1L3TA 4FJ7A 1ASUA 3CM6A 4I7FA 2D0CA 3ZSXA 5C25A 3K58A 1NK9A 4JRQA 4FK2A 4IFYA 2FC0A 1EXQA 4J2AA 4CF0A 2RF2A 3K5NA 1VSEA 4FLUA 4DSFA 4Z4GA 1U4BA 2RPIA 1D9DA 3HP9A 1BI4A 4CJKA 2XHBA 2G8HA 4CJ5A 2ITGA 3SV3A 4BDZA 4M41A 4CIFA 1KVAA 1UOCA 2HNDA 4DLGA 4FLYA 3OYNA 2I5JA 3S3NA 4CJWA 4EZ9A 2YNFA 2P5GA 4B9VA 3QEPA 1TVRA 1VSLA 4TSXA 3VQCA 4BE1A 2HHQA 3SV4A 4ELTA 4HCCA 3KKSA 3AVCA 3OYGA 3I8DA 4CEFA 1RTHA 1RDBA 3AA2A 4RW7A 1TKZA 5FROA 1EX4A 4M3TA 5E41A 1HYVA 2HNZA 4LSNA 4CGDA 3OYEA 4B9MA 2D0BA 3QINA 4DTNA 4KHWA 2HHWA 3E01A 3NE6A 3RWUA 4FJXA 3ZSRA 2YV0X 1SL2A 4M3RA 1WLJA 1Z26A 1BISA 3IRXA 3VQ6A 1RBRA 5C42A 4CHPA 3SQ2A 5DK5A 4CFCA 4J2DA 4KPYA 1IKVA 4BE0A 3OS2A 3HO1A 2HVHA 4FVMA 4OVLA 4IFVA 5KRSA 4DWIA 4DFJA 1JLBA 4KTQA 2B6AA 3IS9A 4N47A 1ZBFA 1T05A 1KVCA 4YNQA 2Y1IA 2F96A 3HL8A 1N5YA 1BCMA 3V9WA 3SNNA 2QK9A 1NJWA 4B3OA 4FJ8A 3SI6A 1RDAA 4LD0A 4RW6A 3QEXA 4F8RA 4FJKA 2HHXA 4N5SA 3C95A 4KKOA 4CEEA 4DTMA 3SUNA 1S1UA 3MEGA 3AVMA 1FKPA 3NBPA 4EP5A 5KGWA 4Z4CA 2X78A 4M42A 3TAMA 1ASWA 5J2PA 4FJGA 5J2MA 3LZIA 4M3UA 1D5AA 3OYIA 3D45A 3QNOA 3DOKA 5DMRA 3MAQA 1RCHA 3AO5A 3RMAA 2X6SA 4CEOA 1IKWA 4Z4FA 3SUOA 3QEWA 4B8AB 1NKBA 4I2PA 4DMNA 2R7YA 4FZXC 3HJFA 3G0ZA 4E19A 3VQPA 3I0RA 3O3FA 2YNIA 4DQIA 2Z1IA 4IDKA 4M3YA 3NF8A 5K14A 4E7LA 4DQQA 1CLQA 3H08A 2QKBA 5C24A 3ZT4A 1QS4A 3L2UA 1VSHA 4E7IA 5HROA 4DQRA 1SKRA 4M3ZA 1LWCA 4QCLA 4F2SA 1X9MA 1R0AA 1JLQA 3KLEA 4KHUA 2ZQBA 1S1TA 4FJJA 4O0JA 3CQ8A 1NKEA 4E7KA 4PQUA 1GOBA 1VRUA 3LP2A 4FJ5A 1NK6A 4PUOA 3KIOA 3OYCA 4W5NA 3VQ5A 3SQ0A 1QSLA 5J1EA 1HQEA 3OS1A 4Z4IA 1TK8A 3D0PA 3WNFA 1G15A 2YHAA 1B9FA 1JL2A 1L3VA 2KFZA 3M8RA 4CE9A 3LP0A 3ZSOA 4CJUA 3DLHA 5KTQA 4E0DA 1BL3A 1ZBHA 1NK4A 4I2QA 1J54A 1X9SA 1KFSA 3B6OA 2QKKA 3WNHA 4OPKA 3T19A 3KD1E 2EX3A 4PWDA 4FZZA 2GBZA 3CFOA 4DSLA 4FM2A 4Q5VA 1HQUA 1VSIA 2OYQA 3PO4A 4FLWA 2JLEA 1YVUA 1TV6A 3KLFA 2P51A 4CGFA 3AVIA 1C6VA 3V1RA 4RW9A 2FBTA 4HUGA 3TAEA 4CEDA 2BDPA 2IOCA 3AVLA 3SPYA 4CHYA 1XWLA 4DSKA 4KHYA 4ZHRA 4KRFA 3S9HA 3RRGA 1S9GA 3LP3A 4DTXA 1TK5A 1QTMA 2DTUA 3IG1A 4B9LA 4FYDA 1S1VA 3CG7A 4KHNA 1SUQA 3M8QA 4HTUA 4KHSA 3M8SA 4AILC 1SL1A 1GOCA 2VG5A 4DTPA 1TGOA 2D0AA 1LV5A 1U45A 4DU4A 2PY5A 1ZBUA 3SPZA 1EETA 4HCBA 2KZMA 1LAVA 2QXFA 5SWMA 1HNIA 4EZ6A 1RT7A 1KCFA 4DSIA 3NAEA 3NCIA 1NK5A 4CJQA 3L3VA 5FDLA 3RR8A 2FBXA 4R5PA 1BI4B 4OKKA 4DU1A 4CGHA 4HUEA 4CEZA 1KTQA 1WSFA 2YKMA 2KFNA 3LDSA 1JLGA 2KQ2A 4RW4A 2YKNA 1KLNA 4CFDA 3RMBA 3KKRA 3DLKA 2O4IA 4K8XA 4DFPA 4JS5A 3T3FA 3BGRA 3DM2A 4M3WA 1O1WA 4FJIA 1B92A 4DF4A 3KTQA 2KTQA 4DF8A 1FXXA 4DTUA 4RG8A 2IGIA 3AO2A 3DLEA 3AA5X 3NDKA 3AVBA 1ZBIA 4LSLA 3NF9A 3VA3A 4FK4A 3RMCA 4IBNA 3AO1A 3TAPA 4DLEA 3K2PA 4M3XA 1JXBA 2BGGA 3SQ4A 3A2FA 1S9EA 1I39A 5KRTA 1MU2A 1UA0A 4N41A 1D8YA 2KZZA 2HB5A 3AVNA 3V9ZA 4KTZA 3NH0A 3VQ7A 3L3UA 1SV5A 1JLCA 3M8PA 3IAYA 1T03A 3SQ1A 3DRRA 1IO2A 1WSEA 4LH5A 3TABA 1C0UA 1WSIA 1WSJA 2PYJA 1DTQA 5D3GA 1WN7A 3K5OA 3LAMA 2DFHA 2HHUA 4DQSA 4Q0BA 3ZSZA 4FK0A 2A1SA 4O44A 5T7BA 1U49A 3AO4A 2JGUA 1WSGA 1HRHA 3HP6A 1RTDA 1IG9A 3MXIA 1TKXA 1NJZA 3DLBA 4N76A 2F8SA 2Z1HA 4CJFA 2IS3A 3CM5A 4F3OA 2RKIA 2X74A 1BHLA 1W0HA 3WNEA 4W5OA 3UIQA 2Y1JA 5HLFA 1VRTA 4KI4A 1D9FA 1J53A 2DFFA 4OKEA 1JXEA 1Y97A 2OPSA 4WE1A 3EYZA 4FW1A 3SYZA 1T7PA 4H4OA
chains in the Genus database with same CATH superfamily
2OANA 4JLHA 3C0BA 2UXBK 1X9WA 4YDUA 4BACA 4LFCK 5JS1A 2YJFA 1DGKN 4JKCA 1TAQA 2GX9A 3LL3A 1VQLN 1NKCA 1JCGA 1TUYA 1QQCA 2QI2A 4C1NK 4FLXA 1C1AA 1LW0A 3VQAA 3S3OA 1LAWA 3IMXA 2Q36A 2OPRA 2LSNA 3H1QA 3QIOA 3R3LA 4JS4A 4JI0K 4ISFA 4PKGA 3R8EA 4JI5K 3H3OB 3MN5A 1NU0A 4CJRA 3G10A 1HYZA 3OBYA 3HK2A 2GTDA 3ZT0A 3SZ2A 4C8NA 3OYAA 4JKHA 1LWFA 5GAHP 4BRNA 1Q18A 1S6PA 1OH7A 3OYDA 2CGKA 3QICA 1QSYA 4OLAA 1J5OA 4JD2A 3QLHA 2WTUA 2FXUA 1T6DA 4ELUA 4BRPA 1UA1A 1RTJA 4PKHA 3O3HA 2VGMA 4CFBA 4GMJB 3BF3A 2DPNA 4FWOA 4GNIA 4XH5A 4DTSA 4KREA 1TKTA 1NJXA 1JKHA 2HW3A 4ILHA 5SZTA 4BR2A 5BR9A 2P9SA 4AH9A 3HRGA 3O9RA 1JLAA 2GWJA 2HBLA 1L3UA 1VSJA 1NMNA 2P9SB 1QQOA 3BY5A 3RMDA 3I0SA 2AJQA 1H1VA 2ASPA 4C8MA 4DTOA 4FWLA 3U6FA 1B9DA 3ASMA 3VENA 2W42A 4E1NA 2G8UA 3VA0A 3LPTA 1NM1A 3CJ7A 3LWMA 5I3UA 2BANA 3H3NO 5BREA 2W6LA 1T8EA 4ICLA 4DU3A 2KLAA 2E8AA 3CMAN 5HRRA 5CZ1A 4DTRA 1QE1A 1OKJA 3UKUA 3V9XA 3KK1A 3U9ZA 1NMDA 4N56A 3O4WA 2RN2A 1VK0A 1WB9A 4F2RA 4CJLA 2HMPA 5AZJA 4J2EA 2BH1A 2EHGA 3QEVA 1HR0K 3AVJA 2Q0RA 3PX0A 1FJGK 3TSQA 2HMIA 3NH2A 4K41A 3JXUA 1A5VA 4OX9K 5AFUA 3U8XA 1J9AA 1K8AO 3CETA 4B3SK 1QHTA 2NRXA 2Z1JA 4CJ7A 2IVNA 3ULEA 3F73A 1BIUA 2FBVA 2XRIA 3MEEA 3AVHA 2NNWA 3BZCA 3OYLA 4CEQA 2ZD1A 3MECA 3MCPA 3VQ4A 4W5RA 3THVA 4DR4K 3VGMA 1RT1A 4AF1A 1NK8A 4GVMA 2WONA 1Q9XA 4UQGA 3V4IA 1VQ5N 4DUYK 3DLRA 3A5MC 3HSCA 3ZSYA 1EKEA 3J7AP 2XO7A 2UUAK 3ID6A 1LW2A 2PZSA 4OO1J 2BE2A 1XNQK 4BRGA 4CJ3A 2VWKA 4X62K 4HVJA 4JRPA 2XY7A 2GELA 3B8AX 4CBUA 4CGJA 4LF7K 4RW8A 1T44A 3HPGA 1X3MA 3TAFA 4K8ZA 3OYKA 4MQ3A 3D2EB 2D5RA 2YHBA 4FWPA 1DKGD 1IH7A 3FFIA 1Q9YA 1Q86O 5FLXO 1MDUB 2O8BB 1KAZA 3V9SA 4FCYA 3WNGA 3CM6A 3T1YK 1NK9A 4FK2A 5ELZA 4K42A 2NRTA 2ZJQL 4Z4GA 1K9MO 1D9DA 3LM2A 2G8HA 3UE5A 3L6QA 4EFHA 4CIFA 4H5TA 1KVAA 4BDZA 2Q0UA 4DLGA 4FLYA 3OYNA 4CJWA 4JK9A 3SAGA 4TSXA 4ELTA 4HCCA 4CZLA 2QWNA 2F9WA 3AA2A 5AFUH 1HYVA 3FR0A 4CGDA 4CD1A 3OYEA 4B9MA 3QINA 3PSFA 3E01A 5AJ3K 2HBMA 4M3RA 1XUPO 3WXJA 3IRXA 4Y0WA 2E20A 3MCAB 4BVOA 3SQ2A 5DK5A 3NMUA 3CC4N 4OVLA 4IFVA 4DWIA 1VQ7N 2UUCK 4KTQA 3IS9A 3BEXA 1KVCA 4KH5A 1ZBSA 3SI6A 3QEXA 2Q97A 2F9TA 2HHXA 3C95A 2NRVA 1P8ZA 3O8MA 4KKOA 5KGWA 4M42A 5AQOA 3TAMA 5J2PA 3THWA 3RVCA 5J2MA 4BG9A 3OW2M 1CZAN 2P9UA 3OYIA 1IBKK 4K25A 3MAQA 1RCHA 4CEOA 2P9UB 2UUBK 3QEWA 3HJFA 3O3FA 2Z1IA 1OH5A 4GV3A 4M3YA 4H0VB 3H08A 5C24A 3CJ1A 1SKRA 3SBTA 4M3ZA 4QCLA 3VPZA 1BDGA 4LF9K 3EL2A 2ZF5O 4O0JA 4PQUA 1GOBA 1Q7YO 1NK6A 3KIOA 4K0KK 4YDUC 3SQ0A 5J1EA 4WFAL 3OS1A 4WFNL 3G71N 3D0PA 2CH5A 2ASMA 1J5EK 1E4GT 1L3VA 2P9KB 4I2QA 4MLEA 3B6OA 4OPKA 2A40A 2EX3A 3PIOL 4PWDA 4YOWA 3CFOA 3N4QA 4GKKK 3K0SA 2OYQA 3PO4A 2JLEA 1YVUA 3KLFA 2P51A 1YJ9N 3V1RA 2IOCA 3M6GA 4JKFA 1GLEG 2AA4A 2GUPA 4H0TB 3RRGA 3LP3A 4DTXA 2DTUA 5JVGL 2CGLA 3IG1A 1T3VA 4KHSA 1SL1A 4AM6A 1LV5A 4BRAA 4DU4A 1ZBUA 4CZIA 1EETA 4BRQA 1LAVA 1HNIA 1NK5A 1VQ8N 4FL9A 5FDLA 4CZJA 5JICA 4HUEA 3KVGA 3TTCA 1JLGA 2VQEK 4A59A 1T6CA 3DLKA 4LF4K 5EVZA 2O4IA 4JS5A 3T3FA 1O1WA 5HL7L 1FXXA 2KHOA 3AA5X 3NDKA 3E66A 3SMPA 4FWMA 3NF9A 3RMCA 3AO1A 5KRTA 4N41A 3T1HK 2NRRA 2KZZA 5M1QA 4KTZA 4WQ4A 3CF5L 3L3UA 1SV5A 3SV3A 2QM1A 3IAYA 3SQ1A 1WSEA 1C0UA 4QS7A 3CC2N 4DV6K 3HBTA 1DTQA 1WN7A 1NWKA 2V52B 4FK0A 5T7BA 3VOVA 3JAMO 3FZFA 1IG9A 4MDBA 1XMQK 3DLBA 4N76A 1XMOK 1GLAG 4EIAA 2F8SA 2RKIA 2QWMA 1BHLA 3WNEA 3MX2A 1VRTA 3EYZA 2NZTA 3SYZA 3O9SA 3VTHA 4H4OA 2CH6A 4J2BA 3EKSA 1N36K 2RE2A 3O9TA 1XQSC 4X65K 1GLLO 2HHSA 1XC9A 1VQMN 3WT0A 1YVNA 3ZSVA 4DV0K 1S3XA 3R1XA 4PKIA 2HVIA 4JK7A 3NF7A 4OPJA 1YTAA 2G8KA 3RRHA 4NB4A 5FRNA 3CI5A 4Y1CA 4DSEA 3O1WA 3D2FB 2PYLA 3B6PA 4AHCA 2O4GA 3CIPA 1ATRA 2IC3A 2FBYA 4O0IA 4GW6A 4ELVA 3QNNA 4CEBA 1NBWA 3FGUA 3HPOA 3QO9A 3FZLA 4H0YB 4FK4A 3ENOA 4KAZA 4OGEA 5LJWA 1L5UA 3R6MA 4MO5A 5HP1A 4I6MA 1HNWK 1V4TA 2IAJA 3A5OC 4CVNE 2E6MA 4I6MB 3DXMA 3SCXA 2BUPA 3V1OA 5KGXA 3AA3A 3HVRA 3KJVA 1Q82O 3MX5A 1TUUA 4IKFA 3VN5A 3QESA 4OKJA 5ADXA 3K57A 2ZE2A 4KH6A 5JS2A 4QAGA 4FJ9A 3BDPA 4KB1A 5AQTA 4BRHA 4YOVA 4CCHA 2HF3A 3F9KA 1IKYA 3U3YA 5EOYA 3O6WA 3CHWA 3Q7CA 4JI4K 2I7PA 3GG4A 3WEEA 4FM0A 1X1PA 1RTIA 4CK2A 3MEDA 4YORA 3CJAA 4AHSA 3ZYYX 4CHQA 3CCUN 3WEEB 1HMVA 1RDCA 3E9LA 1HKGA 4DFKA 3CFPA 3LM9A 4MFBA 4CJVA 3WXIA 3MWPA 3AV9A 1KC8O 1EP4A 1WAFA 4JHDA 4GV9A 1XHZA 1NGIA 3EO3A 2B5JA 3TARA 3O4NA 5MLCQ 1RT5A 5JMVA 2F8TA 4E89A 2OA8A 1WBBA 5AQLA 3OJUA 5AQFA 3KHYA 4NO7A 2O8CB 4GY2B 4DV2K 4BC2A 3VEXA 4H0XB 4YFUA 1IBLK 3ZEUB 4KFBA 3MXJA 3SJJA 3LP1A 1SS6A 3F2KA 3KLGA 4XIUA 4YOYA 3NFAA 1Q8IA 4ISEA 3GBTA 4DQPA 4A5BA 5AQIA 1F21A 3LPUA 3SUQA 4NYNA 3M1FA 1M1KO 1VQKN 1K6YA 4HUFA 4FLVA 4AHUA 3IKMA 3AA4A 3JSMA 4AHTA 2NRWA 3E9PA 1JLFA 1ATSA 3O80A 3TTDA 3KD5E 2HHHK 4QS9A 4FJLA 4F4KA 3BF1A 4BE2A 4C8OA 4FJHA 5ADXH 3L2QA 3JYTA 4FXDA 4BREA 2E1ZA 3VEWA 1RT3A 4C1NI 3FLCO 3ZLJA 1JLEA 3ULDA 1D4XA 4CBWA 4BGAA 3HPHA 2HHTA 3KK2A 3VQDA 4CJEA 1RBUA 3QETA 4B1ZA 3C94A 2G8WA 4PY5A 1NGGA 5M1NA 2XY5A 1LOTB 4JK8A 4J8FA 3TSPA 4CF8A 3VQBA 3ZX0A 1RILA 4FJMA 3KK3A 1JJ2M 3HI0A 1DTTA 1XI1A 3ISNC 3O1BA 1KD1O 1YF5L 3NHGA 3K9KA 4JD2B 3UKRA 4I9QA 5M1PA 1BGXT 1N8RO 3CCEN 1YT3A 1NOZA 3G4SN 4DUZK 5BPNA 4I7FA 3ZSXA 5C25A 1WBDA 3DLLL 3IFRA 3K5NA 5GINA 1VSEA 1YXQA 5BN9A 5B8HA 4DSFA 1U4BA 2RPIA 3HP9A 2ZM6K 4CJ5A 1WOQA 2VCPA 3QEPA 1TVRA 4O5FA 3VQCA 2HHQA 5DM6L 4YOTA 1Z6RA 4CEFA 1RTHA 1RDBA 3J81O 4ISGA 1TKZA 5FROA 1YITN 5E41A 4DTNA 4BR5A 2HHWA 3ZSRA 1SL2A 4Z94A 2D1KA 2VGNA 5FPMA 1BISA 3EEQA 5KPTA 4J2DA 4KPYA 1IKVA 3OS2A 3UKUB 2HVHA 3CCVN 2E2OA 4DFJA 3EN9A 3AY9A 1HNZK 2B6AA 1SAZA 5F2RA 4DHYA 3ENHA 4WQ5C 1TYQA 5IT9O 3ZETA 1ZBFA 4YNQA 3KK7A 1VAZA 3V9WA 1NJWA 1WUAA 5CR4A 2FF3B 5AQVA 4FJ8A 5AZJB 4FJKA 4KBOA 3OTOK 4DTMA 3SUNA 3MEGA 3P4IA 4BGBA 3CMEN 3DAWA 1VQPN 4Z4CA 4WQ4C 3H45C 3AAPA 4FWKA 1D5AA 5GAGP 3D45A 3DOKA 5DMRA 3HOSA 3AO5A 4DV3K 3ULEB 4RTFD 4B8AB 4PHTX 4E19A 3I0RA 3KZBA 3L0QA 4DQQA 2E5LK 1CLQA 1QS4A 2VWBA 5HROA 1HNXK 4DQRA 4GKJK 4JI3K 4KHPK 2ZQBA 1NKEA 4E7KA 4H5WA 4JKDA 4PUOA 3FZMA 1EO1A 1G15A 4IJNA 1QZ5A 3M8RA 4CE9A 2KFZA 1E3MA 3LP0A 3ZSOA 4CJUA 5KTQA 4E0DA 1HJOA 3W0LA 1NK4A 2QKKA 1J54A 1KFSA 4K43A 3T19A 3ATUA 3KD1E 4FM2A 3QFUA 3J7ZO 4QS8A 4FPAA 1OVQA 4CGFA 3AVIA 3TAEA 3AVLA 3VEVA 1XWLA 5M1FA 1OH8A 4DSKA 4V19S 3I56N 4ZHRA 3S9HA 5BR8K 4L3QA 2EWSA 3MN9A 4KHNA 1NGJA 4HTUA 2OCEA 4IFEA 3M8SA 2VG5A 1TGOA 2PY5A 5AQMA 4JKGA 2E88A 5SWMA 4EZ6A 4DSIA 3NAEA 2A5XA 3O08A 4JKGB 4CJQA 3J80O 4U67L 5DM7L 1KTQA 4BC3A 3U9DA 3HZ6A 2KQ2A 4CFDA 3RMBA 2E2PA 1VQ4N 4K8XA 4DFPA 3BGRA 4BRIA 4M3WA 1B92A 4FWSA 3F5TA 2QWRA 2YJEA 4DTUA 3AO2A 1ZBIA 4LSLA 1MA9B 4LF6K 3K2PA 4PL8A 3AARA 3M5RA 5AQYA 4RWTA 1HUXA 3HOTA 1J6ZA 4LH5A 3C7NA 5AZIA 4M7XA 5D3GA 2DFHA 3ZSZA 4JKEA 2A1SA 3O9UA 1U49A 2OTLN 5C12A 3AO4A 3HP6A 1WSGA 3NVKA 5IWAK 1M90O 3THWB 4CJFA 5HLFA 4BQLA 4DV1K 1J53A 2DFFA 4OKEA 1JXEA 4WE1A 3C65A 3TAQA 4B1UB 1CXUA 1LWEA 4DG1A 1C0MA 5HOOA 4IEEA 5CYMA 3AVKA 3K59A 4CGGA 5AQKA 1MWKA 3CJ9A 2HBJA 2XY8A 4ID1A 4OJRA 1NJIO 4FLTA 1U47A 3P39A 3TU5A 2GV9A 3N4PA 5BRFA 1YAGA 4DCHA 1C0TA 3O9QA 3DOLA 1IJJA 3AO3A 3VEYA 4BR9A 1K8KA 5LMUK 1C1CA 3TR8A 1S1WA 1X3NA 1GLJO 1ASVA 3WUHA 3DRSA 1ZBLA 4RCHA 1C0FA 4CZKA 4YY3K 3LALA 5BN8A 4Z0UA 4H5NA 5J2QA 3O3GA 3FZKA 3MXMA 4OPAA 3K5MA 3EZ5A 5AQQA 4H0OA 1NGDA 2HHVA 3ALYA 3O4QA 1WAJA 1S5JA 4DR1K 4O8KA 3T1AA 3PX6A 1MWMA 3HTVA 4DR3K 1A5XA 4BG8A 2XY6A 3H1VX 5CYQA 4KHQA 2A3ZA 4FO0A 4WF9L 3L4QA 4MDAA 1KFDA 3SK3A 3ZT2A 3U3GA 3P83D 3HT3A 3ID8A 4B9NA 3MN7A 3OYHA 3EE9A 4E3SA 4CFAA 5CY4A 5FPDA 2Z1GA 3KLHA 1KRPA 3M3ZA 3NGYA 2H3GX 3OJSA 1W97L 2HNYA 3V81A 1KSPA 1SL0A 4O55A 4DSJA 4WYBA 2JWKA 2FSKA 5FPEA 4IOXA 3VERA 4CJPA 3P5JA 5C2FA 5BRDA 3LWLA 4AHRA 4CIEA 4KI6A 4B9TA 3DXKA 3DYAA 3C6UA 5C15A 1RT6A 5EX5A 1CXQA 1TL1A 3DXKB 3L4IA 1ESVA 1ITGA 3CCMN 3AGKA 2G8VA 2DFEA 3HVTA 4CGIA 4BR0A 1IBMK 4FSVA 1IKXA 4CEAA 2ETJA 1RGIA 4BY9C 4E7JA 2AP1A 1O13A 4ZTJA 3NF6A 2QWPA 3PY8A 1SKSA 3ZSWA 3NGIA 1VSMA 1OVYA 3QIPA 3PUFA 2ZWHA 5M1OA 2ITMA 1GOAA 3SAFA 2YCHA 4A5AA 2V7ZA 3VQ9A 4KV8A 4H5RA 2D4WA 1RBSA 1TK0A 1Z25A 4B3TK 5GAEP 3H6EA 3AAQA 4B8CA 2G8IA 1A5WA 3SUPA 3EZWA 5EY4A 1ZXOA 1HNVA 5I42A 3CD6N 2OZSA 3IDHA 1RDDA 1YTUA 3MWTA 1NG9A 1VSDA 1HPZA 5CZ2A 1U2VA 3AVAA 1L3SA 3QERA 1Z05A 3C6TA 4FWRA 2FF6A 1ZYQA 1RNHA 1U2VB 4CJSA 2WOMA 1NK0A 5KI6A 2KW4A 3PV8A 5AR0A 4HHTA 3FZHA 4Y1DA 1SKWA 1U6ZA 2A41A 4O4GA 4IEIA 4IO9L 4DTJA 4DQ8A 4EHTA 1R59O 1DLOA 2A42A 1UAXA 3AVFA 4G1QA 3RR7A 1OH6A 1BIZA 3S3MA 2X6NA 3KLIA 5HRNA 1RDUA 4LC9B 4EP4A 4FWQA 2CGJA 4FM1A 3A5LC 1VSKA 2VG6A 3DMJA 1BCOA 5KQ8A 3TAGA 4CJTA 3TSUA 4NCGA 1I3AA 4E7HA 4XEIA 4FW2A 1W2BM 3DXMB 2IDOA 1U48A 2QWLA 3S41A 1S6QA 1NJYA 2E4LA 2P1JA 3OY9A 4CIGA 1YI2N 3K5LA 2GUIA 3TANA 4F3TA 4B1XB 3TWHA 4H4MA 4CHZA 2VWJA 4BDPA 5AQHA 4W5TA 2ATQA 1ASUA 3MK6A 2P9IA 4IXCA 4JRQA 1IV0A 4XH4A 2FC0A 1NLVA 2RF2A 4CF0A 1YJWN 4FLUA 3W3DA 1JCFA 3VEZA 1BI4A 4CW7B 4CJKA 2O8FA 2WUSA 3F9MA 4DV4K 2HNDA 2I5JA 3S3NA 1QHAA 4M7YA 4B9VA 3BZKA 2I7NA 3AVCA 3I8DA 5TKWA 1EX4A 4M3TA 1C0GA 2W40A 3EE8A 1S22A 2HNZA 4JHDB 4LSNA 2D0BA 3RWUA 4FJXA 2YV0X 3CJCA 5E84A 2IVPA 3VQ6A 1RBRA 5C42A 3P31A 5AQRA 3HO1A 3LDQA 3R9PA 1HX1A 4BRMA 4A62A 4N47A 1S72N 1T05A 1IG8A 3O5BA 2F96A 3HL8A 1RDWX 5AQGA 2QK9A 5BPMA 4IDHA 1RDAA 4LD0A 2VYPA 3THXA 4N5SA 2O8EA 2YI1A 5BPLA 3THYA 4FOEA 4JI6K 2O8EB 1S1UA 3AVMA 1FKPA 4O8UA 4EP5A 5F0XA 4KH4A 2X78A 1ASWA 5H1SQ 3J7YP 3LZIA 3QNOA 3H46O 2X6SA 1IKWA 3E1YA 4CI6A 5M1KA 4Z4FA 1VQON 4FZXC 3VETA 3VQPA 3WQUA 4BVPA 2YNIA 4FOIA 4IOAL 3NF8A 4E7LA 2QKBA 3ZT4A 4JI1K 5AQUA 2W41A 3P38A 2P9LA 1VSHA 3ATVA 4E7IA 1LWCA 2P9LB 1X9MA 1R0AA 5JLHA 3KLEA 1S1TA 4FJJA 5AQSA 1VRUA 3LP2A 1HKBA 4NXNK 3VQ5A 1QSLA 1HQEA 3WNFA 2YHAA 2FLOA 1JL2A 2GEMA 4OPHA 3DLHA 4J2AA 4CZHA 4FZZA 4NXMK 2BTFA 4DSLA 4Q5VA 4H0PA 5AQZA 2NRZA 5EXWA 4LFBK 1C6VA 2FBTA 2BDPA 2PFUA 3SPYA 3UKRB 4CHYA 4KHYA 1EQYA 4BRCA 4KRFA 4EAHD 5F1XA 1QTMA 4B9LA 4FYDA 1S1VA 4DB3A 1SUQA 4AILC 4DTPA 1KAXA 3SPZA 2KZMA 2KKZA 2QXFA 1QQMA 1KCFA 3NCIA 3L3VA 3QMLA 3RR8A 2FBXA 4R5PA 3T7ZA 1NGEA 4CEZA 4X64K 1WSFA 2KFNA 4RW4A 4IOCL 3CCJN 1KLNA 3KTQA 4DF4A 4DF8A 3D7EO 4IZ9A 2IGIA 3AVBA 1K73O 1QZ6A 5I9EB 4DLEA 3MMVA 4M3XA 1JXBA 1BUPA 3SQ4A 3LDLA 1S9EA 1MU2A 1UA0A 4DR6K 1Q81O 2QTDA 3SAHA 1GLDG 3VQ7A 3PIPL 3M8PA 3VGLA 1TYQB 2WFBA 3DRRA 3ZETB 2UXCK 4NLCA 3CCLN 1WSJA 3LAMA 3VMFB 2HHUA 2RHKA 4B1YB 4CZGA 2O8DA 4FVUA 1HRHA 2P9PA 1RTDA 2O8DB 1TKXA 1NJZA 2P9PB 1DT9A 2Z1HA 3J8AA 3CM5A 4F3OA 2X74A 4W5OA 3QDKA 2Y1JA 5GADP 2OPSA 3KWIA 4FW1A 1T7PA 3L2VA 1KLMA 3VQEA 3GOIA 1KVBA 4B9QA 1KQSM 4AHVA 5EU7A 4JAXA 4JI2K 3CQYA 4GVEA 3DI6A 4YOUA 1U04A 1ATNA 3G6EN 4M45A 4CK3A 3RTVA 4CECA 3C6HA 4B9SA 4NYFA 1TL3A 3VQ8A 4KB0A 3CERA 3VF6A 4A2BA 2G8FA 1N32K 1BA1A 2HBKA 3TI0A 5LL6Z 1JL1A 2ZGYA 4BWJA 4W5QA 1VSFA 3NGZA 5J2NA 2OZMA 1P90A 4X66K 3L2WA 4CERA 4CBXA 3HXMA 3TPQA 2E6LA 3PX4A 2QWOA 1YUWA 4Z4HA 4JKBA 4QOZB 1TAUA 3D6RA 3UB5A 3SJHA 4BROA 2F7TA 4C23A 3LZJA 2UYTA 4BRKA 4C8KA 3HSTB 2FSJA 3D2EA 4M63C 1N33K 4OGCA 3HYFA 2Q3SA 1FKOA 4BRDA 1GLBG 4BC4A 4OLBA 2PBDA 3OYJA 2E1YA 3TTFA 5HRPA 3AVGA 2YHWA 3OHRA 2GWKA 1HJRA 3NH1A 1V4SA 2YHYA 2O8BA 1WNSA 3LDOA 1BU6O 3LDPA 4ILJA 3ZCMA 1N6QA 3OVNA 5KQDA 4FJNA 5HBMA 5HRSA 4I9LA 2NUBA 5LJVA 1NOYA 4B9UA 4G9ZA 4JEPA 5A2QO 1FW6A 5AQPA 3V9UA 1BQNA 4CESA 4NCAA 1HPMA 5AQJA 3ZX3A 4MLHA 2Q2RA 4PA1A 1UWBA 3I55N 1YIJN 4ID5A 4CF9A 4E1MA 3ITHA 4FWNA 4DS5A 4FZYA 4BRFA 1VQ6N 1XNRK 1W7AA 2ZGZA 1RT2A 2DY4A 4FLZA 1CZBA 3FE1A 1SQKA 4L8RB 4IG0A 3P1GA 3V6DA 3EY1A 4JKAA 5AQXA 4C8LA 3C7NB 4H8KA 1KXPA 5AZIB 3GL1A 3C6AA 5JLFA 4PL7A 4AQYK 3ZT1A 3DLGA 1C1BA 5GIOA 1W9HA 2VQFK 3JS6A 2VG7A 4BQZA 3CPEA 3QB0A 4E1JA 5C0YA 4CF1A 3ZSQA 3LDNA 3QFPA 3NVMA 4JN4A 2P5OA 4A61A 1NK7A 1BWFO 4CZFA 4KO0A 1BQMA 4MO4A 3CQXA 3VF2A 2OPQA 4BDYA 4EHUA 4BR7A 4JI7K 2E2QA 2OPPA 4Z4EA 3HM9A 3VQQA 3OYMA 3CFRA 1ZC6A 4H5VA 1RBVA 2YNHA 4IWVA 4HTLA 3QBWA 1VHXA 3CXCM 3DRPA 1RFQA 1K8KB 5KPZA 1FK9A 3PO5A 3BUZB 4CD3A 3KWGA 1RBTA 1REVA 1VQNN 3CCQN 3SMSA 1XHXA 4O5BA 1S1XA 1BG3A 2NLXA 1CZ9A 3QBXA 3OYBA 4LF8K 3QEIA 1HYSA 4LH4A 3L2RA 4CHOA 3WXLA 4BRLA 2B4JA 5C10A 2J4RA 4CHNA 3VTIA 4CJ4A 3LAKA 4FPBA 1TKDA 3OYFA 3ZT3A 4WCEL 3L8BA 4KTWA 2PAVA 4B3RK 2WBNA 2P9KA 2WC9A 4GV6A 4DFMA 4IG3A 5FRMA 1HLUA 2ZJRL 4CZMA 4DS4A 2YNGA 3VGKA 1Y64A 4LY7A 1NGHA 3CYMA 3G25A 1QSSA 4A57A 3V1QA 4B08A 1DEJA 1EWRA 5C2DA 2F4VK 1WSHA 4DR5K 1BO5O 2JWLA 4NCBA 1GLCG 4CF2A 4CK1A 1RT4A 4ZTFA 2A1RA 3LANA 3OS0A 3OA9A 4BWMA 4FJ7A 1L3TA 2IIRA 3EKUA 2D0CA 3IUCA 3K58A 3I8BA 4IJAA 4ILGB 4IFYA 1EXQA 3E9OA 2YX6A 2XHBA 3VEOA 3DWLA 2ITGA 3HM8A 4M41A 1UOCA 4EZ9A 2YNFA 2P5GA 3I33A 1VSLA 4BE1A 1NGFA 2P9NA 3SV4A 3PLAA 3KKSA 3OYGA 2P9NB 4RW7A 1BOTO 3SLCA 3WQTA 3CPWM 2E2NA 4JI8K 2YHXA 4WQ5A 1QVFM 4DR7K 4KHWA 3NE6A 1WLJA 1Z26A 2HF4A 1NNEA 4CHPA 1YJNN 3A0IX 4UY8O 4CFCA 4YHHK 4BE0A 4FVMA 5KRSA 1JLBA 1KAYA 2Q31A 2Y1IA 3PSIA 1N5YA 1BCMA 3SNNA 5AQNA 2QW9A 3GDQA 4B3OA 4RW6A 4F8RA 4JV5K 4BC5A 3DJCA 5CE3A 4CEEA 5CHIA 3NBPA 5AQWA 1ILYA 4A2AA 4FJGA 1QVGM 4U7BA 4M3UA 5KPRA 2QWQA 5GIPA 4BR4A 3CCRN 3BP8A 3RMAA 2ASOA 2Q1NA 2UU9K 3SUOA 1NKBA 4I2PA 4DMNA 2R7YA 2OTJN 2HOEA 3G0ZA 4XH1A 4DQIA 3ENBA 4IDKA 3RSEA 5K14A 3MN6A 2NRHA 3RSEB 3K9JA 5TKYA 3SBGA 3L2UA 4HWIA 4F2SA 1JLQA 1N34K 4KHUA 3U4LA 3CQ8A 4JNEA 1E4FT 4LF5K 1LCUA 3T69A 4FJ5A 4W5NA 3OYCA 4Z4IA 1TK8A 5FPNA 3FFKB 3D2FA 2FSNA 1B9FA 3VESA 1YHQN 5BRHA 2QXLA 1BL3A 1ZBHA 1X9SA 2QA4N 3WNHA 2W6KA 2D0PA 2GBZA 1NGCA 1HQUA 1VSIA 1EWQA 4FLWA 1TV6A 4RW9A 4HUGA 5LMNK 4CEDA 2D0OA 1XC3A 3ZX2A 2A6AA 1S9GA 1TK5A 1NGAA 5E26A 2ZJPL 3CG7A 3M8QA 4F9OA 1QQNA 1GOCA 4JYAK 2D0AA 1U45A 4HCBA 1G99A 1RT7A 2P9IB 1VQ9N 4B1WB 4DR2K 1HKCA 4YOXA 1BI4B 2V7YA 4OKKA 4DU1A 4CGHA 3WXKA 2YKMA 2O8FB 3VF4A 3LDSA 4B1VA 3CCSN 2YKNA 3Q7BA 3WXMB 4H03B 3KKRA 3DM2A 3A5NC 4FJIA 2KTQA 3OBWA 4AM7A 4RG8A 2UXDK 3DLEA 1SZ2A 1GLFO 3MDQA 4LFAK 3VA3A 4IBNA 2HSTA 3TAPA 2BGGA 3A2FA 1I39A 4IO8A 1D8YA 2HB5A 3AVNA 3V9ZA 3CC7N 3NH0A 3GE1A 4DV7K 2QEXN 5LY3A 4R79A 3A8YA 1JLCA 1JCEA 4WFBL 1T03A 4B3MK 1IO2A 3TABA 3CJBA 3AGRA 1WSIA 1BA0A 2PYJA 4NLBA 3K5OA 1NGBA 5JVHL 4DQSA 4Q0BA 2O8CA 3THXB 4O44A 2IVOA 3THYB 2JGUA 1I94K 3ZEUA 3MXIA 2V51B 2IS3A 4DV5K 1W0HA 1X9JA 3UIQA 4KI4A 1D9FA 1Y97A 4DKWA 4CZEA
chains in the Genus database with same CATH topology
3L2VA 4JLHA 3TAQA 1KLMA 1X9WA 1CXUA 1LWEA 4J2BA 3VQEA 4BACA 4DG1A 5JS1A 1KVBA 1C0MA 5CYMA 4AHVA 1TAQA 5EU7A 3AVKA 3K59A 4CGGA 4QOZB 2XY8A 3DI6A 4ID1A 4OJRA 4FLTA 1U47A 2HHSA 1XC9A 2GV9A 1U04A 1NKCA 3ZSVA 2HVIA 1QQCA 4FLXA 1C0TA 4M45A 4CK3A 4CECA 3DOLA 3RTVA 1C1AA 3AO3A 3NF7A 4OPJA 1C1CA 3TR8A 4B9SA 4NYFA 1TL3A 1LW0A 3VQAA 1S1WA 3VQ8A 4KB0A 1YTAA 2G8KA 1ASVA 3S3OA 2G8FA 3RRHA 1LAWA 3DRSA 1ZBLA 3TI0A 2HHTA 5FRNA 2OPRA 2LSNA 1JL1A 3QIOA 4Y1CA 4BWJA 4W5QA 1VSFA 4DSEA 3LALA 2PYLA 3B6PA 4Z0UA 3NGZA 4AHCA 2O4GA 4JS4A 5J2NA 5J2QA 3L2WA 2OZMA 3O3GA 4CERA 2IC3A 3MXMA 2FBYA 3HXMA 4O0IA 3K5MA 3EZ5A 4GW6A 2E6LA 4ELVA 4CJRA 3QNNA 4CEBA 3G10A 1HYZA 3HPOA 3HK2A 2HHVA 3PX4A 3SZ2A 3ZT0A 3QO9A 3ALYA 3O4QA 1WAJA 1S5JA 1LWFA 4C8NA 3T1AA 4Z4HA 3OYAA 3PX6A 4OGEA 1L5UA 4KAZA 1A5XA 2XY6A 5CYQA 5HP1A 3LZJA 4KHQA 1S6PA 2IAJA 3OYDA 2E6MA 4C8KA 3HSTB 1QSYA 1KFDA 4OGCA 3SCXA 3HYFA 2Q3SA 3V1OA 1FKOA 4OLAA 3ZT2A 1J5OA 4OLBA 1TAUA 5KGXA 3QLHA 3OYJA 3AA3A 3HVRA 5HRPA 3U3GA 3KJVA 4ELUA 3AVGA 3P83D 3VN5A 3HT3A 1UA1A 1RTJA 4OKJA 3QESA 4B9NA 4IKFA 3OYHA 3K57A 3O3HA 4CFBA 1HJRA 2ZE2A 3NH1A 4GMJB 4E3SA 4CFAA 5CY4A 1WNSA 2Z1GA 5JS2A 4QAGA 3KLHA 4FJ9A 3ZCMA 1N6QA 3OVNA 1KRPA 3BDPA 4KB1A 4FJNA 3NGYA 4DTSA 4KREA 5HBMA 1TKTA 1NJXA 5HRSA 4I9LA 1JKHA 4CCHA 2NUBA 2HW3A 5SZTA 3OJSA 2HNYA 1IKYA 3F9KA 3V81A 3U3YA 1NOYA 1KSPA 1SL0A 4O55A 4B9UA 4DSJA 4AH9A 3V9UA 1JLAA 4FM0A 1BQNA 4CESA 1RTIA 1VSJA 1X1PA 3MEDA 4CK2A 1L3UA 4NCAA 4AHSA 4CJPA 3RMDA 4CHQA 3P5JA 3I0SA 2AJQA 1HMVA 1RDCA 4C8MA 4DTOA 4PA1A 3CFPA 3LWLA 4DFKA 4MFBA 4AHRA 4CIEA 3U6FA 4B9TA 4KI6A 3DYAA 1B9DA 1UWBA 3ASMA 3C6UA 4CJVA 2W42A 4E1NA 1RT6A 2G8UA 1CXQA 4ID5A 1TL1A 4CF9A 3LPTA 4E1MA 3VA0A 1ITGA 3ITHA 3AV9A 3LWMA 2BANA 4DS5A 5I3UA 2G8VA 4FZYA 1EP4A 2DFEA 3HVTA 4CGIA 1WAFA 1T8EA 1RT2A 2DY4A 4FLZA 4ICLA 1CZBA 4L8RB 4DU3A 1XHZA 4IG0A 5HRRA 1IKXA 5CZ1A 4CEAA 2B5JA 3P1GA 3O4NA 3V6DA 3EY1A 3TARA 4DTRA 2ETJA 4C8LA 4H8KA 1RT5A 1QE1A 4E7JA 4E89A 2F8TA 2OA8A 3OJUA 4ZTJA 3V9XA 3KK1A 3NF6A 3ZT1A 3PY8A 3DLGA 1C1BA 1SKSA 3ZSWA 1W9HA 3NGIA 1VSMA 3QIPA 3PUFA 4N56A 2RN2A 2VG7A 1VK0A 4F2RA 4CJLA 4YFUA 1GOAA 4CF1A 3ZSQA 4KFBA 3MXJA 4J2EA 3SJJA 2P5OA 2EHGA 3LP1A 3KLGA 3QEVA 3VQ9A 3AVJA 4KV8A 4XIUA 3PX0A 1NK7A 2HMIA 1RBSA 3NFAA 4KO0A 1BQMA 3NH2A 1TK0A 1Z25A 1Q8IA 1A5VA 2OPQA 4BDYA 4DQPA 1J9AA 4B8CA 2G8IA 1F21A 1A5WA 3SUPA 1QHTA 3LPUA 3SUQA 4NYNA 1HNVA 2Z1JA 5I42A 2OZSA 2OPPA 4Z4EA 3F73A 1BIUA 2FBVA 3HM9A 1RDDA 1K6YA 2XRIA 4HUFA 3VQQA 3OYMA 3CFRA 4FLVA 1YTUA 3MEEA 4AHUA 1RBVA 1VSDA 3AA4A 3AVHA 3JSMA 1HPZA 2YNHA 4AHTA 3OYLA 4CEQA 2ZD1A 1JLFA 3DRPA 3MECA 3AVAA 5CZ2A 3QERA 1L3SA 3KD5E 3PO5A 3VQ4A 1FK9A 3C6TA 4FJLA 4F4KA 1ZYQA 1RNHA 4W5RA 3THVA 4CJSA 2WOMA 1NK0A 1RBTA 4BE2A 1REVA 4C8OA 5KI6A 4FJHA 2KW4A 3PV8A 1XHXA 1RT1A 3L2QA 4HHTA 4Y1DA 1NK8A 1SKWA 4O5BA 4GVMA 1S1XA 2WONA 1Q9XA 4UQGA 3JYTA 3V4IA 4FXDA 1CZ9A 3OYBA 1RT3A 3QEIA 3DLRA 4O4GA 1HYSA 4LH4A 3L2RA 4DTJA 4CHOA 3ZSYA 1EKEA 1DLOA 1JLEA 2B4JA 2XO7A 1LW2A 1UAXA 3AVFA 2BE2A 4G1QA 3ULDA 2PZSA 4CHNA 3RR7A 4CJ4A 4CJ3A 2VWKA 3HPHA 3LAKA 4HVJA 4JRPA 1TKDA 1BIZA 3KK2A 2X6NA 3ZT3A 3OYFA 3S3MA 3VQDA 4KTWA 1RBUA 3KLIA 4CJEA 5HRNA 3L8BA 3QETA 3C94A 2XY7A 4DFMA 2G8WA 4IG3A 4EP4A 5FRMA 4CGJA 4PY5A 4FM1A 2XY5A 1VSKA 4RW8A 2VG6A 4DS4A 2YNGA 1BCOA 3DMJA 3HPGA 4CF8A 3TAGA 4CJTA 3VQBA 3TAFA 4NCGA 1RILA 1I3AA 4LY7A 3CYMA 4MQ3A 3OYKA 4E7HA 1QSSA 4K8ZA 4FJMA 4FW2A 1U48A 3KK3A 2IDOA 1DTTA 1XI1A 2D5RA 3ISNC 3V1QA 3NHGA 2YHBA 1S6QA 4I9QA 4B08A 1NJYA 1IH7A 2E4LA 2P1JA 3OY9A 4CIGA 1WSHA 3FFIA 1Q9YA 3K5LA 2GUIA 3TANA 4F3TA 3TWHA 1BGXT 4NCBA 4H4MA 4CHZA 2VWJA 1YT3A 4BDPA 4CF2A 4CK1A 1NOZA 1RT4A 4W5TA 4ZTFA 3V9SA 2A1RA 3LANA 2ATQA 3OS0A 4FCYA 4BWMA 3WNGA 1L3TA 4FJ7A 1ASUA 3CM6A 4I7FA 2D0CA 3ZSXA 5C25A 3K58A 1NK9A 4JRQA 4FK2A 4IFYA 2FC0A 1EXQA 4J2AA 4CF0A 2RF2A 3K5NA 1VSEA 4FLUA 4DSFA 4Z4GA 1U4BA 2RPIA 1D9DA 3HP9A 1BI4A 4CJKA 2XHBA 2G8HA 4CJ5A 2ITGA 3SV3A 4BDZA 4M41A 4CIFA 1KVAA 1UOCA 2HNDA 4DLGA 4FLYA 3OYNA 2I5JA 3S3NA 4CJWA 4EZ9A 2YNFA 2P5GA 4B9VA 3QEPA 1TVRA 1VSLA 4TSXA 3VQCA 4BE1A 2HHQA 3SV4A 4ELTA 4HCCA 3KKSA 3AVCA 3OYGA 3I8DA 4CEFA 1RTHA 1RDBA 3AA2A 4RW7A 1TKZA 5FROA 1EX4A 4M3TA 5E41A 1HYVA 2HNZA 4LSNA 4CGDA 3OYEA 4B9MA 2D0BA 3QINA 4DTNA 4KHWA 2HHWA 3E01A 3NE6A 3RWUA 4FJXA 3ZSRA 2YV0X 1SL2A 4M3RA 1WLJA 1Z26A 1BISA 3IRXA 3VQ6A 1RBRA 5C42A 4CHPA 3SQ2A 5DK5A 4CFCA 4J2DA 4KPYA 1IKVA 4BE0A 3OS2A 3HO1A 2HVHA 4FVMA 4OVLA 4IFVA 5KRSA 4DWIA 4DFJA 1JLBA 4KTQA 2B6AA 3IS9A 4N47A 1ZBFA 1T05A 1KVCA 4YNQA 2Y1IA 2F96A 3HL8A 1N5YA 1BCMA 3V9WA 3SNNA 2QK9A 1NJWA 4B3OA 4FJ8A 3SI6A 1RDAA 4LD0A 4RW6A 3QEXA 4F8RA 4FJKA 2HHXA 4N5SA 3C95A 4KKOA 4CEEA 4DTMA 3SUNA 1S1UA 3MEGA 3AVMA 1FKPA 3NBPA 4EP5A 5KGWA 4Z4CA 2X78A 4M42A 3TAMA 1ASWA 5J2PA 4FJGA 5J2MA 3LZIA 4M3UA 1D5AA 3OYIA 3D45A 3QNOA 3DOKA 5DMRA 3MAQA 1RCHA 3AO5A 3RMAA 2X6SA 4CEOA 1IKWA 4Z4FA 3SUOA 3QEWA 4B8AB 1NKBA 4I2PA 4DMNA 2R7YA 4FZXC 3HJFA 3G0ZA 4E19A 3VQPA 3I0RA 3O3FA 2YNIA 4DQIA 2Z1IA 4IDKA 4M3YA 3NF8A 5K14A 4E7LA 4DQQA 1CLQA 3H08A 2QKBA 5C24A 3ZT4A 1QS4A 3L2UA 1VSHA 4E7IA 5HROA 4DQRA 1SKRA 4M3ZA 1LWCA 4QCLA 4F2SA 1X9MA 1R0AA 1JLQA 3KLEA 4KHUA 2ZQBA 1S1TA 4FJJA 4O0JA 3CQ8A 1NKEA 4E7KA 4PQUA 1GOBA 1VRUA 3LP2A 4FJ5A 1NK6A 4PUOA 3KIOA 3OYCA 4W5NA 3VQ5A 3SQ0A 1QSLA 5J1EA 1HQEA 3OS1A 4Z4IA 1TK8A 3D0PA 3WNFA 1G15A 2YHAA 1B9FA 1JL2A 1L3VA 2KFZA 3M8RA 4CE9A 3LP0A 3ZSOA 4CJUA 3DLHA 5KTQA 4E0DA 1BL3A 1ZBHA 1NK4A 4I2QA 1J54A 1X9SA 1KFSA 3B6OA 2QKKA 3WNHA 4OPKA 3T19A 3KD1E 2EX3A 4PWDA 4FZZA 2GBZA 3CFOA 4DSLA 4FM2A 4Q5VA 1HQUA 1VSIA 2OYQA 3PO4A 4FLWA 2JLEA 1YVUA 1TV6A 3KLFA 2P51A 4CGFA 3AVIA 1C6VA 3V1RA 4RW9A 2FBTA 4HUGA 3TAEA 4CEDA 2BDPA 2IOCA 3AVLA 3SPYA 4CHYA 1XWLA 4DSKA 4KHYA 4ZHRA 4KRFA 3S9HA 3RRGA 1S9GA 3LP3A 4DTXA 1TK5A 1QTMA 2DTUA 3IG1A 4B9LA 4FYDA 1S1VA 3CG7A 4KHNA 1SUQA 3M8QA 4HTUA 4KHSA 3M8SA 4AILC 1SL1A 1GOCA 2VG5A 4DTPA 1TGOA 2D0AA 1LV5A 1U45A 4DU4A 2PY5A 1ZBUA 3SPZA 1EETA 4HCBA 2KZMA 1LAVA 2QXFA 5SWMA 1HNIA 4EZ6A 1RT7A 1KCFA 4DSIA 3NAEA 3NCIA 1NK5A 4CJQA 3L3VA 5FDLA 3RR8A 2FBXA 4R5PA 1BI4B 4OKKA 4DU1A 4CGHA 4HUEA 4CEZA 1KTQA 1WSFA 2YKMA 2KFNA 3LDSA 1JLGA 2KQ2A 4RW4A 2YKNA 1KLNA 4CFDA 3RMBA 3KKRA 3DLKA 2O4IA 4K8XA 4DFPA 4JS5A 3T3FA 3BGRA 3DM2A 4M3WA 1O1WA 4FJIA 1B92A 4DF4A 3KTQA 2KTQA 4DF8A 1FXXA 4DTUA 4RG8A 2IGIA 3AO2A 3DLEA 3AA5X 3NDKA 3AVBA 1ZBIA 4LSLA 3NF9A 3VA3A 4FK4A 3RMCA 4IBNA 3AO1A 3TAPA 4DLEA 3K2PA 4M3XA 1JXBA 2BGGA 3SQ4A 3A2FA 1S9EA 1I39A 5KRTA 1MU2A 1UA0A 4N41A 1D8YA 2KZZA 2HB5A 3AVNA 3V9ZA 4KTZA 3NH0A 3VQ7A 3L3UA 1SV5A 1JLCA 3M8PA 3IAYA 1T03A 3SQ1A 3DRRA 1IO2A 1WSEA 4LH5A 3TABA 1C0UA 1WSIA 1WSJA 2PYJA 1DTQA 5D3GA 1WN7A 3K5OA 3LAMA 2DFHA 2HHUA 4DQSA 4Q0BA 3ZSZA 4FK0A 2A1SA 4O44A 5T7BA 1U49A 3AO4A 2JGUA 1WSGA 1HRHA 3HP6A 1RTDA 1IG9A 3MXIA 1TKXA 1NJZA 3DLBA 4N76A 2F8SA 2Z1HA 4CJFA 2IS3A 3CM5A 4F3OA 2RKIA 2X74A 1BHLA 1W0HA 3WNEA 4W5OA 3UIQA 2Y1JA 5HLFA 1VRTA 4KI4A 1D9FA 1J53A 2DFFA 4OKEA 1JXEA 1Y97A 2OPSA 4WE1A 3EYZA 4FW1A 3SYZA 1T7PA 4H4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2V A;  4JLH A;  3TAQ A;  1KLM A;  1X9W A;  1CXU A;  1LWE A;  4J2B A;  3VQE A;  4BAC A;  4DG1 A;  5JS1 A;  1KVB A;  1C0M A;  5CYM A;  4AHV A;  1TAQ A;  5EU7 A;  3AVK A;  3K59 A;  4CGG A;  4QOZ B;  2XY8 A;  3DI6 A;  4ID1 A;  4OJR A;  4FLT A;  1U47 A;  2HHS A;  1XC9 A;  2GV9 A;  1U04 A;  1NKC A;  3ZSV A;  2HVI A;  1QQC A;  4FLX A;  1C0T A;  4M45 A;  4CK3 A;  4CEC A;  3DOL A;  3RTV A;  1C1A A;  3AO3 A;  3NF7 A;  4OPJ A;  1C1C A;  3TR8 A;  4B9S A;  4NYF A;  1TL3 A;  1LW0 A;  3VQA A;  1S1W A;  3VQ8 A;  4KB0 A;  1YTA A;  2G8K A;  1ASV A;  3S3O A;  2G8F A;  3RRH A;  1LAW A;  3DRS A;  1ZBL A;  3TI0 A;  2HHT A;  5FRN A;  2OPR A;  2LSN A;  1JL1 A;  3QIO A;  4Y1C A;  4BWJ A;  4W5Q A;  1VSF A;  4DSE A;  3LAL A;  2PYL A;  3B6P A;  4Z0U A;  3NGZ A;  4AHC A;  2O4G A;  4JS4 A;  5J2N A;  5J2Q A;  3L2W A;  2OZM A;  3O3G A;  4CER A;  2IC3 A;  3MXM A;  2FBY A;  3HXM A;  4O0I A;  3K5M A;  3EZ5 A;  4GW6 A;  2E6L A;  4ELV A;  4CJR A;  3QNN A;  4CEB A;  3G10 A;  1HYZ A;  3HPO A;  3HK2 A;  2HHV A;  3PX4 A;  3SZ2 A;  3ZT0 A;  3QO9 A;  3ALY A;  3O4Q A;  1WAJ A;  1S5J A;  1LWF A;  4C8N A;  3T1A A;  4Z4H A;  3OYA A;  3PX6 A;  4OGE A;  1L5U A;  4KAZ A;  1A5X A;  2XY6 A;  5CYQ A;  5HP1 A;  3LZJ A;  4KHQ A;  1S6P A;  2IAJ A;  3OYD A;  2E6M A;  4C8K A;  3HST B;  1QSY A;  1KFD A;  4OGC A;  3SCX A;  3HYF A;  2Q3S A;  3V1O A;  1FKO A;  4OLA A;  3ZT2 A;  1J5O A;  4OLB A;  1TAU A;  5KGX A;  3QLH A;  3OYJ A;  3AA3 A;  3HVR A;  5HRP A;  3U3G A;  3KJV A;  4ELU A;  3AVG A;  3P83 D;  3VN5 A;  3HT3 A;  1UA1 A;  1RTJ A;  4OKJ A;  3QES A;  4B9N A;  4IKF A;  3OYH A;  3K57 A;  3O3H A;  4CFB A;  1HJR A;  2ZE2 A;  3NH1 A;  4GMJ B;  4E3S A;  4CFA A;  5CY4 A;  1WNS A;  2Z1G A;  5JS2 A;  4QAG A;  3KLH A;  4FJ9 A;  3ZCM A;  1N6Q A;  3OVN A;  1KRP A;  3BDP A;  4KB1 A;  4FJN A;  3NGY A;  4DTS A;  4KRE A;  5HBM A;  1TKT A;  1NJX A;  5HRS A;  4I9L A;  1JKH A;  4CCH A;  2NUB A;  2HW3 A;  5SZT A;  3OJS A;  2HNY A;  1IKY A;  3F9K A;  3V81 A;  3U3Y A;  1NOY A;  1KSP A;  1SL0 A;  4O55 A;  4B9U A;  4DSJ A;  4AH9 A;  3V9U A;  1JLA A;  4FM0 A;  1BQN A;  4CES A;  1RTI A;  1VSJ A;  1X1P A;  3MED A;  4CK2 A;  1L3U A;  4NCA A;  4AHS A;  4CJP A;  3RMD A;  4CHQ A;  3P5J A;  3I0S A;  2AJQ A;  1HMV A;  1RDC A;  4C8M A;  4DTO A;  4PA1 A;  3CFP A;  3LWL A;  4DFK A;  4MFB A;  4AHR A;  4CIE A;  3U6F A;  4B9T A;  4KI6 A;  3DYA A;  1B9D A;  1UWB A;  3ASM A;  3C6U A;  4CJV A;  2W42 A;  4E1N A;  1RT6 A;  2G8U A;  1CXQ A;  4ID5 A;  1TL1 A;  4CF9 A;  3LPT A;  4E1M A;  3VA0 A;  1ITG A;  3ITH A;  3AV9 A;  3LWM A;  2BAN A;  4DS5 A;  5I3U A;  2G8V A;  4FZY A;  1EP4 A;  2DFE A;  3HVT A;  4CGI A;  1WAF A;  1T8E A;  1RT2 A;  2DY4 A;  4FLZ A;  4ICL A;  1CZB A;  4L8R B;  4DU3 A;  1XHZ A;  4IG0 A;  5HRR A;  1IKX A;  5CZ1 A;  4CEA A;  2B5J A;  3P1G A;  3O4N A;  3V6D A;  3EY1 A;  3TAR A;  4DTR A;  2ETJ A;  4C8L A;  4H8K A;  1RT5 A;  1QE1 A;  4E7J A;  4E89 A;  2F8T A;  2OA8 A;  3OJU A;  4ZTJ A;  3V9X A;  3KK1 A;  3NF6 A;  3ZT1 A;  3PY8 A;  3DLG A;  1C1B A;  1SKS A;  3ZSW A;  1W9H A;  3NGI A;  1VSM A;  3QIP A;  3PUF A;  4N56 A;  2RN2 A;  2VG7 A;  1VK0 A;  4F2R A;  4CJL A;  4YFU A;  1GOA A;  4CF1 A;  3ZSQ A;  4KFB A;  3MXJ A;  4J2E A;  3SJJ A;  2P5O A;  2EHG A;  3LP1 A;  3KLG A;  3QEV A;  3VQ9 A;  3AVJ A;  4KV8 A;  4XIU A;  3PX0 A;  1NK7 A;  2HMI A;  1RBS A;  3NFA A;  4KO0 A;  1BQM A;  3NH2 A;  1TK0 A;  1Z25 A;  1Q8I A;  1A5V A;  2OPQ A;  4BDY A;  4DQP A;  1J9A A;  4B8C A;  2G8I A;  1F21 A;  1A5W A;  3SUP A;  1QHT A;  3LPU A;  3SUQ A;  4NYN A;  1HNV A;  2Z1J A;  5I42 A;  2OZS A;  2OPP A;  4Z4E A;  3F73 A;  1BIU A;  2FBV A;  3HM9 A;  1RDD A;  1K6Y A;  2XRI A;  4HUF A;  3VQQ A;  3OYM A;  3CFR A;  4FLV A;  1YTU A;  3MEE A;  4AHU A;  1RBV A;  1VSD A;  3AA4 A;  3AVH A;  3JSM A;  1HPZ A;  2YNH A;  4AHT A;  3OYL A;  4CEQ A;  2ZD1 A;  1JLF A;  3DRP A;  3MEC A;  3AVA A;  5CZ2 A;  3QER A;  1L3S A;  3KD5 E;  3PO5 A;  3VQ4 A;  1FK9 A;  3C6T A;  4FJL A;  4F4K A;  1ZYQ A;  1RNH A;  4W5R A;  3THV A;  4CJS A;  2WOM A;  1NK0 A;  1RBT A;  4BE2 A;  1REV A;  4C8O A;  5KI6 A;  4FJH A;  2KW4 A;  3PV8 A;  1XHX A;  1RT1 A;  3L2Q A;  4HHT A;  4Y1D A;  1NK8 A;  1SKW A;  4O5B A;  4GVM A;  1S1X A;  2WON A;  1Q9X A;  4UQG A;  3JYT A;  3V4I A;  4FXD A;  1CZ9 A;  3OYB A;  1RT3 A;  3QEI A;  3DLR A;  4O4G A;  1HYS A;  4LH4 A;  3L2R A;  4DTJ A;  4CHO A;  3ZSY A;  1EKE A;  1DLO A;  1JLE A;  2B4J A;  2XO7 A;  1LW2 A;  1UAX A;  3AVF A;  2BE2 A;  4G1Q A;  3ULD A;  2PZS A;  4CHN A;  3RR7 A;  4CJ4 A;  4CJ3 A;  2VWK A;  3HPH A;  3LAK A;  4HVJ A;  4JRP A;  1TKD A;  1BIZ A;  3KK2 A;  2X6N A;  3ZT3 A;  3OYF A;  3S3M A;  3VQD A;  4KTW A;  1RBU A;  3KLI A;  4CJE A;  5HRN A;  3L8B A;  3QET A;  3C94 A;  2XY7 A;  4DFM A;  2G8W A;  4IG3 A;  4EP4 A;  5FRM A;  4CGJ A;  4PY5 A;  4FM1 A;  2XY5 A;  1VSK A;  4RW8 A;  2VG6 A;  4DS4 A;  2YNG A;  1BCO A;  3DMJ A;  3HPG A;  4CF8 A;  3TAG A;  4CJT A;  3VQB A;  3TAF A;  4NCG A;  1RIL A;  1I3A A;  4LY7 A;  3CYM A;  4MQ3 A;  3OYK A;  4E7H A;  1QSS A;  4K8Z A;  4FJM A;  4FW2 A;  1U48 A;  3KK3 A;  2IDO A;  1DTT A;  1XI1 A;  2D5R A;  3ISN C;  3V1Q A;  3NHG A;  2YHB A;  1S6Q A;  4I9Q A;  4B08 A;  1NJY A;  1IH7 A;  2E4L A;  2P1J A;  3OY9 A;  4CIG A;  1WSH A;  3FFI A;  1Q9Y A;  3K5L A;  2GUI A;  3TAN A;  4F3T A;  3TWH A;  1BGX T;  4NCB A;  4H4M A;  4CHZ A;  2VWJ A;  1YT3 A;  4BDP A;  4CF2 A;  4CK1 A;  1NOZ A;  1RT4 A;  4W5T A;  4ZTF A;  3V9S A;  2A1R A;  3LAN A;  2ATQ A;  3OS0 A;  4FCY A;  4BWM A;  3WNG A;  1L3T A;  4FJ7 A;  1ASU A;  3CM6 A;  4I7F A;  2D0C A;  3ZSX A;  5C25 A;  3K58 A;  1NK9 A;  4JRQ A;  4FK2 A;  4IFY A;  2FC0 A;  1EXQ A;  4J2A A;  4CF0 A;  2RF2 A;  3K5N A;  1VSE A;  4FLU A;  4DSF A;  4Z4G A;  1U4B A;  2RPI A;  1D9D A;  3HP9 A;  1BI4 A;  4CJK A;  2XHB A;  2G8H A;  4CJ5 A;  2ITG A;  3SV3 A;  4BDZ A;  4M41 A;  4CIF A;  1KVA A;  1UOC A;  2HND A;  4DLG A;  4FLY A;  3OYN A;  2I5J A;  3S3N A;  4CJW A;  4EZ9 A;  2YNF A;  2P5G A;  4B9V A;  3QEP A;  1TVR A;  1VSL A;  4TSX A;  3VQC A;  4BE1 A;  2HHQ A;  3SV4 A;  4ELT A;  4HCC A;  3KKS A;  3AVC A;  3OYG A;  3I8D A;  4CEF A;  1RTH A;  1RDB A;  3AA2 A;  4RW7 A;  1TKZ A;  5FRO A;  1EX4 A;  4M3T A;  5E41 A;  1HYV A;  2HNZ A;  4LSN A;  4CGD A;  3OYE A;  4B9M A;  2D0B A;  3QIN A;  4DTN A;  4KHW A;  2HHW A;  3E01 A;  3NE6 A;  3RWU A;  4FJX A;  3ZSR A;  2YV0 X;  1SL2 A;  4M3R A;  1WLJ A;  1Z26 A;  1BIS A;  3IRX A;  3VQ6 A;  1RBR A;  5C42 A;  4CHP A;  3SQ2 A;  5DK5 A;  4CFC A;  4J2D A;  4KPY A;  1IKV A;  4BE0 A;  3OS2 A;  3HO1 A;  2HVH A;  4FVM A;  4OVL A;  4IFV A;  5KRS A;  4DWI A;  4DFJ A;  1JLB A;  4KTQ A;  2B6A A;  3IS9 A;  4N47 A;  1ZBF A;  1T05 A;  1KVC A;  4YNQ A;  2Y1I A;  2F96 A;  3HL8 A;  1N5Y A;  1BCM A;  3V9W A;  3SNN A;  2QK9 A;  1NJW A;  4B3O A;  4FJ8 A;  3SI6 A;  1RDA A;  4LD0 A;  4RW6 A;  3QEX A;  4F8R A;  4FJK A;  2HHX A;  4N5S A;  3C95 A;  4KKO A;  4CEE A;  4DTM A;  3SUN A;  1S1U A;  3MEG A;  3AVM A;  1FKP A;  3NBP A;  4EP5 A;  5KGW A;  4Z4C A;  2X78 A;  4M42 A;  3TAM A;  1ASW A;  5J2P A;  4FJG A;  5J2M A;  3LZI A;  4M3U A;  1D5A A;  3OYI A;  3D45 A;  3QNO A;  3DOK A;  5DMR A;  3MAQ A;  1RCH A;  3AO5 A;  3RMA A;  2X6S A;  4CEO A;  1IKW A;  4Z4F A;  3SUO A;  3QEW A;  4B8A B;  1NKB A;  4I2P A;  4DMN A;  2R7Y A;  4FZX C;  3HJF A;  3G0Z A;  4E19 A;  3VQP A;  3I0R A;  3O3F A;  2YNI A;  4DQI A;  2Z1I A;  4IDK A;  4M3Y A;  3NF8 A;  5K14 A;  4E7L A;  4DQQ A;  1CLQ A;  3H08 A;  2QKB A;  5C24 A;  3ZT4 A;  1QS4 A;  3L2U A;  1VSH A;  4E7I A;  5HRO A;  4DQR A;  1SKR A;  4M3Z A;  1LWC A;  4QCL A;  4F2S A;  1X9M A;  1R0A A;  1JLQ A;  3KLE A;  4KHU A;  2ZQB A;  1S1T A;  4FJJ A;  4O0J A;  3CQ8 A;  1NKE A;  4E7K A;  4PQU A;  1GOB A;  1VRU A;  3LP2 A;  4FJ5 A;  1NK6 A;  4PUO A;  3KIO A;  3OYC A;  4W5N A;  3VQ5 A;  3SQ0 A;  1QSL A;  5J1E A;  1HQE A;  3OS1 A;  4Z4I A;  1TK8 A;  3D0P A;  3WNF A;  1G15 A;  2YHA A;  1B9F A;  1JL2 A;  1L3V A;  2KFZ A;  3M8R A;  4CE9 A;  3LP0 A;  3ZSO A;  4CJU A;  3DLH A;  5KTQ A;  4E0D A;  1BL3 A;  1ZBH A;  1NK4 A;  4I2Q A;  1J54 A;  1X9S A;  1KFS A;  3B6O A;  2QKK A;  3WNH A;  4OPK A;  3T19 A;  3KD1 E;  2EX3 A;  4PWD A;  4FZZ A;  2GBZ A;  3CFO A;  4DSL A;  4FM2 A;  4Q5V A;  1HQU A;  1VSI A;  2OYQ A;  3PO4 A;  4FLW A;  2JLE A;  1YVU A;  1TV6 A;  3KLF A;  2P51 A;  4CGF A;  3AVI A;  1C6V A;  3V1R A;  4RW9 A;  2FBT A;  4HUG A;  3TAE A;  4CED A;  2BDP A;  2IOC A;  3AVL A;  3SPY A;  4CHY A;  1XWL A;  4DSK A;  4KHY A;  4ZHR A;  4KRF A;  3S9H A;  3RRG A;  1S9G A;  3LP3 A;  4DTX A;  1TK5 A;  1QTM A;  2DTU A;  3IG1 A;  4B9L A;  4FYD A;  1S1V A;  3CG7 A;  4KHN A;  1SUQ A;  3M8Q A;  4HTU A;  4KHS A;  3M8S A;  4AIL C;  1SL1 A;  1GOC A;  2VG5 A;  4DTP A;  1TGO A;  2D0A A;  1LV5 A;  1U45 A;  4DU4 A;  2PY5 A;  1ZBU A;  3SPZ A;  1EET A;  4HCB A;  2KZM A;  1LAV A;  2QXF A;  5SWM A;  1HNI A;  4EZ6 A;  1RT7 A;  1KCF A;  4DSI A;  3NAE A;  3NCI A;  1NK5 A;  4CJQ A;  3L3V A;  5FDL A;  3RR8 A;  2FBX A;  4R5P A;  1BI4 B;  4OKK A;  4DU1 A;  4CGH A;  4HUE A;  4CEZ A;  1KTQ A;  1WSF A;  2YKM A;  2KFN A;  3LDS A;  1JLG A;  2KQ2 A;  4RW4 A;  2YKN A;  1KLN A;  4CFD A;  3RMB A;  3KKR A;  3DLK A;  2O4I A;  4K8X A;  4DFP A;  4JS5 A;  3T3F A;  3BGR A;  3DM2 A;  4M3W A;  1O1W A;  4FJI A;  1B92 A;  4DF4 A;  3KTQ A;  2KTQ A;  4DF8 A;  1FXX A;  4DTU A;  4RG8 A;  2IGI A;  3AO2 A;  3DLE A;  3AA5 X;  3NDK A;  3AVB A;  1ZBI A;  4LSL A;  3NF9 A;  3VA3 A;  4FK4 A;  3RMC A;  4IBN A;  3AO1 A;  3TAP A;  4DLE A;  3K2P A;  4M3X A;  1JXB A;  2BGG A;  3SQ4 A;  3A2F A;  1S9E A;  1I39 A;  5KRT A;  1MU2 A;  1UA0 A;  4N41 A;  1D8Y A;  2KZZ A;  2HB5 A;  3AVN A;  3V9Z A;  4KTZ A;  3NH0 A;  3VQ7 A;  3L3U A;  1SV5 A;  1JLC A;  3M8P A;  3IAY A;  1T03 A;  3SQ1 A;  3DRR A;  1IO2 A;  1WSE A;  4LH5 A;  3TAB A;  1C0U A;  1WSI A;  1WSJ A;  2PYJ A;  1DTQ A;  5D3G A;  1WN7 A;  3K5O A;  3LAM A;  2DFH A;  2HHU A;  4DQS A;  4Q0B A;  3ZSZ A;  4FK0 A;  2A1S A;  4O44 A;  5T7B A;  1U49 A;  3AO4 A;  2JGU A;  1WSG A;  1HRH A;  3HP6 A;  1RTD A;  1IG9 A;  3MXI A;  1TKX A;  1NJZ A;  3DLB A;  4N76 A;  2F8S A;  2Z1H A;  4CJF A;  2IS3 A;  3CM5 A;  4F3O A;  2RKI A;  2X74 A;  1BHL A;  1W0H A;  3WNE A;  4W5O A;  3UIQ A;  2Y1J A;  5HLF A;  1VRT A;  4KI4 A;  1D9F A;  1J53 A;  2DFF A;  4OKE A;  1JXE A;  1Y97 A;  2OPS A;  4WE1 A;  3EYZ A;  4FW1 A;  3SYZ A;  1T7P A;  4H4O A; 
#chains in the Genus database with same CATH topology
 2OAN A;  4JLH A;  3C0B A;  2UXB K;  1X9W A;  4YDU A;  4BAC A;  4LFC K;  5JS1 A;  2YJF A;  1DGK N;  4JKC A;  1TAQ A;  2GX9 A;  3LL3 A;  1VQL N;  1NKC A;  1JCG A;  1TUY A;  1QQC A;  2QI2 A;  4C1N K;  4FLX A;  1C1A A;  1LW0 A;  3VQA A;  3S3O A;  1LAW A;  3IMX A;  2Q36 A;  2OPR A;  2LSN A;  3H1Q A;  3QIO A;  3R3L A;  4JS4 A;  4JI0 K;  4ISF A;  4PKG A;  3R8E A;  4JI5 K;  3H3O B;  3MN5 A;  1NU0 A;  4CJR A;  3G10 A;  1HYZ A;  3OBY A;  3HK2 A;  2GTD A;  3ZT0 A;  3SZ2 A;  4C8N A;  3OYA A;  4JKH A;  1LWF A;  5GAH P;  4BRN A;  1Q18 A;  1S6P A;  1OH7 A;  3OYD A;  2CGK A;  3QIC A;  1QSY A;  4OLA A;  1J5O A;  4JD2 A;  3QLH A;  2WTU A;  2FXU A;  1T6D A;  4ELU A;  4BRP A;  1UA1 A;  1RTJ A;  4PKH A;  3O3H A;  2VGM A;  4CFB A;  4GMJ B;  3BF3 A;  2DPN A;  4FWO A;  4GNI A;  4XH5 A;  4DTS A;  4KRE A;  1TKT A;  1NJX A;  1JKH A;  2HW3 A;  4ILH A;  5SZT A;  4BR2 A;  5BR9 A;  2P9S A;  4AH9 A;  3HRG A;  3O9R A;  1JLA A;  2GWJ A;  2HBL A;  1L3U A;  1VSJ A;  1NMN A;  2P9S B;  1QQO A;  3BY5 A;  3RMD A;  3I0S A;  2AJQ A;  1H1V A;  2ASP A;  4C8M A;  4DTO A;  4FWL A;  3U6F A;  1B9D A;  3ASM A;  3VEN A;  2W42 A;  4E1N A;  2G8U A;  3VA0 A;  3LPT A;  1NM1 A;  3CJ7 A;  3LWM A;  5I3U A;  2BAN A;  3H3N O;  5BRE A;  2W6L A;  1T8E A;  4ICL A;  4DU3 A;  2KLA A;  2E8A A;  3CMA N;  5HRR A;  5CZ1 A;  4DTR A;  1QE1 A;  1OKJ A;  3UKU A;  3V9X A;  3KK1 A;  3U9Z A;  1NMD A;  4N56 A;  3O4W A;  2RN2 A;  1VK0 A;  1WB9 A;  4F2R A;  4CJL A;  2HMP A;  5AZJ A;  4J2E A;  2BH1 A;  2EHG A;  3QEV A;  1HR0 K;  3AVJ A;  2Q0R A;  3PX0 A;  1FJG K;  3TSQ A;  2HMI A;  3NH2 A;  4K41 A;  3JXU A;  1A5V A;  4OX9 K;  5AFU A;  3U8X A;  1J9A A;  1K8A O;  3CET A;  4B3S K;  1QHT A;  2NRX A;  2Z1J A;  4CJ7 A;  2IVN A;  3ULE A;  3F73 A;  1BIU A;  2FBV A;  2XRI A;  3MEE A;  3AVH A;  2NNW A;  3BZC A;  3OYL A;  4CEQ A;  2ZD1 A;  3MEC A;  3MCP A;  3VQ4 A;  4W5R A;  3THV A;  4DR4 K;  3VGM A;  1RT1 A;  4AF1 A;  1NK8 A;  4GVM A;  2WON A;  1Q9X A;  4UQG A;  3V4I A;  1VQ5 N;  4DUY K;  3DLR A;  3A5M C;  3HSC A;  3ZSY A;  1EKE A;  3J7A P;  2XO7 A;  2UUA K;  3ID6 A;  1LW2 A;  2PZS A;  4OO1 J;  2BE2 A;  1XNQ K;  4BRG A;  4CJ3 A;  2VWK A;  4X62 K;  4HVJ A;  4JRP A;  2XY7 A;  2GEL A;  3B8A X;  4CBU A;  4CGJ A;  4LF7 K;  4RW8 A;  1T44 A;  3HPG A;  1X3M A;  3TAF A;  4K8Z A;  3OYK A;  4MQ3 A;  3D2E B;  2D5R A;  2YHB A;  4FWP A;  1DKG D;  1IH7 A;  3FFI A;  1Q9Y A;  1Q86 O;  5FLX O;  1MDU B;  2O8B B;  1KAZ A;  3V9S A;  4FCY A;  3WNG A;  3CM6 A;  3T1Y K;  1NK9 A;  4FK2 A;  5ELZ A;  4K42 A;  2NRT A;  2ZJQ L;  4Z4G A;  1K9M O;  1D9D A;  3LM2 A;  2G8H A;  3UE5 A;  3L6Q A;  4EFH A;  4CIF A;  4H5T A;  1KVA A;  4BDZ A;  2Q0U A;  4DLG A;  4FLY A;  3OYN A;  4CJW A;  4JK9 A;  3SAG A;  4TSX A;  4ELT A;  4HCC A;  4CZL A;  2QWN A;  2F9W A;  3AA2 A;  5AFU H;  1HYV A;  3FR0 A;  4CGD A;  4CD1 A;  3OYE A;  4B9M A;  3QIN A;  3PSF A;  3E01 A;  5AJ3 K;  2HBM A;  4M3R A;  1XUP O;  3WXJ A;  3IRX A;  4Y0W A;  2E20 A;  3MCA B;  4BVO A;  3SQ2 A;  5DK5 A;  3NMU A;  3CC4 N;  4OVL A;  4IFV A;  4DWI A;  1VQ7 N;  2UUC K;  4KTQ A;  3IS9 A;  3BEX A;  1KVC A;  4KH5 A;  1ZBS A;  3SI6 A;  3QEX A;  2Q97 A;  2F9T A;  2HHX A;  3C95 A;  2NRV A;  1P8Z A;  3O8M A;  4KKO A;  5KGW A;  4M42 A;  5AQO A;  3TAM A;  5J2P A;  3THW A;  3RVC A;  5J2M A;  4BG9 A;  3OW2 M;  1CZA N;  2P9U A;  3OYI A;  1IBK K;  4K25 A;  3MAQ A;  1RCH A;  4CEO A;  2P9U B;  2UUB K;  3QEW A;  3HJF A;  3O3F A;  2Z1I A;  1OH5 A;  4GV3 A;  4M3Y A;  4H0V B;  3H08 A;  5C24 A;  3CJ1 A;  1SKR A;  3SBT A;  4M3Z A;  4QCL A;  3VPZ A;  1BDG A;  4LF9 K;  3EL2 A;  2ZF5 O;  4O0J A;  4PQU A;  1GOB A;  1Q7Y O;  1NK6 A;  3KIO A;  4K0K K;  4YDU C;  3SQ0 A;  5J1E A;  4WFA L;  3OS1 A;  4WFN L;  3G71 N;  3D0P A;  2CH5 A;  2ASM A;  1J5E K;  1E4G T;  1L3V A;  2P9K B;  4I2Q A;  4MLE A;  3B6O A;  4OPK A;  2A40 A;  2EX3 A;  3PIO L;  4PWD A;  4YOW A;  3CFO A;  3N4Q A;  4GKK K;  3K0S A;  2OYQ A;  3PO4 A;  2JLE A;  1YVU A;  3KLF A;  2P51 A;  1YJ9 N;  3V1R A;  2IOC A;  3M6G A;  4JKF A;  1GLE G;  2AA4 A;  2GUP A;  4H0T B;  3RRG A;  3LP3 A;  4DTX A;  2DTU A;  5JVG L;  2CGL A;  3IG1 A;  1T3V A;  4KHS A;  1SL1 A;  4AM6 A;  1LV5 A;  4BRA A;  4DU4 A;  1ZBU A;  4CZI A;  1EET A;  4BRQ A;  1LAV A;  1HNI A;  1NK5 A;  1VQ8 N;  4FL9 A;  5FDL A;  4CZJ A;  5JIC A;  4HUE A;  3KVG A;  3TTC A;  1JLG A;  2VQE K;  4A59 A;  1T6C A;  3DLK A;  4LF4 K;  5EVZ A;  2O4I A;  4JS5 A;  3T3F A;  1O1W A;  5HL7 L;  1FXX A;  2KHO A;  3AA5 X;  3NDK A;  3E66 A;  3SMP A;  4FWM A;  3NF9 A;  3RMC A;  3AO1 A;  5KRT A;  4N41 A;  3T1H K;  2NRR A;  2KZZ A;  5M1Q A;  4KTZ A;  4WQ4 A;  3CF5 L;  3L3U A;  1SV5 A;  3SV3 A;  2QM1 A;  3IAY A;  3SQ1 A;  1WSE A;  1C0U A;  4QS7 A;  3CC2 N;  4DV6 K;  3HBT A;  1DTQ A;  1WN7 A;  1NWK A;  2V52 B;  4FK0 A;  5T7B A;  3VOV A;  3JAM O;  3FZF A;  1IG9 A;  4MDB A;  1XMQ K;  3DLB A;  4N76 A;  1XMO K;  1GLA G;  4EIA A;  2F8S A;  2RKI A;  2QWM A;  1BHL A;  3WNE A;  3MX2 A;  1VRT A;  3EYZ A;  2NZT A;  3SYZ A;  3O9S A;  3VTH A;  4H4O A;  2CH6 A;  4J2B A;  3EKS A;  1N36 K;  2RE2 A;  3O9T A;  1XQS C;  4X65 K;  1GLL O;  2HHS A;  1XC9 A;  1VQM N;  3WT0 A;  1YVN A;  3ZSV A;  4DV0 K;  1S3X A;  3R1X A;  4PKI A;  2HVI A;  4JK7 A;  3NF7 A;  4OPJ A;  1YTA A;  2G8K A;  3RRH A;  4NB4 A;  5FRN A;  3CI5 A;  4Y1C A;  4DSE A;  3O1W A;  3D2F B;  2PYL A;  3B6P A;  4AHC A;  2O4G A;  3CIP A;  1ATR A;  2IC3 A;  2FBY A;  4O0I A;  4GW6 A;  4ELV A;  3QNN A;  4CEB A;  1NBW A;  3FGU A;  3HPO A;  3QO9 A;  3FZL A;  4H0Y B;  4FK4 A;  3ENO A;  4KAZ A;  4OGE A;  5LJW A;  1L5U A;  3R6M A;  4MO5 A;  5HP1 A;  4I6M A;  1HNW K;  1V4T A;  2IAJ A;  3A5O C;  4CVN E;  2E6M A;  4I6M B;  3DXM A;  3SCX A;  2BUP A;  3V1O A;  5KGX A;  3AA3 A;  3HVR A;  3KJV A;  1Q82 O;  3MX5 A;  1TUU A;  4IKF A;  3VN5 A;  3QES A;  4OKJ A;  5ADX A;  3K57 A;  2ZE2 A;  4KH6 A;  5JS2 A;  4QAG A;  4FJ9 A;  3BDP A;  4KB1 A;  5AQT A;  4BRH A;  4YOV A;  4CCH A;  2HF3 A;  3F9K A;  1IKY A;  3U3Y A;  5EOY A;  3O6W A;  3CHW A;  3Q7C A;  4JI4 K;  2I7P A;  3GG4 A;  3WEE A;  4FM0 A;  1X1P A;  1RTI A;  4CK2 A;  3MED A;  4YOR A;  3CJA A;  4AHS A;  3ZYY X;  4CHQ A;  3CCU N;  3WEE B;  1HMV A;  1RDC A;  3E9L A;  1HKG A;  4DFK A;  3CFP A;  3LM9 A;  4MFB A;  4CJV A;  3WXI A;  3MWP A;  3AV9 A;  1KC8 O;  1EP4 A;  1WAF A;  4JHD A;  4GV9 A;  1XHZ A;  1NGI A;  3EO3 A;  2B5J A;  3TAR A;  3O4N A;  5MLC Q;  1RT5 A;  5JMV A;  2F8T A;  4E89 A;  2OA8 A;  1WBB A;  5AQL A;  3OJU A;  5AQF A;  3KHY A;  4NO7 A;  2O8C B;  4GY2 B;  4DV2 K;  4BC2 A;  3VEX A;  4H0X B;  4YFU A;  1IBL K;  3ZEU B;  4KFB A;  3MXJ A;  3SJJ A;  3LP1 A;  1SS6 A;  3F2K A;  3KLG A;  4XIU A;  4YOY A;  3NFA A;  1Q8I A;  4ISE A;  3GBT A;  4DQP A;  4A5B A;  5AQI A;  1F21 A;  3LPU A;  3SUQ A;  4NYN A;  3M1F A;  1M1K O;  1VQK N;  1K6Y A;  4HUF A;  4FLV A;  4AHU A;  3IKM A;  3AA4 A;  3JSM A;  4AHT A;  2NRW A;  3E9P A;  1JLF A;  1ATS A;  3O80 A;  3TTD A;  3KD5 E;  2HHH K;  4QS9 A;  4FJL A;  4F4K A;  3BF1 A;  4BE2 A;  4C8O A;  4FJH A;  5ADX H;  3L2Q A;  3JYT A;  4FXD A;  4BRE A;  2E1Z A;  3VEW A;  1RT3 A;  4C1N I;  3FLC O;  3ZLJ A;  1JLE A;  3ULD A;  1D4X A;  4CBW A;  4BGA A;  3HPH A;  2HHT A;  3KK2 A;  3VQD A;  4CJE A;  1RBU A;  3QET A;  4B1Z A;  3C94 A;  2G8W A;  4PY5 A;  1NGG A;  5M1N A;  2XY5 A;  1LOT B;  4JK8 A;  4J8F A;  3TSP A;  4CF8 A;  3VQB A;  3ZX0 A;  1RIL A;  4FJM A;  3KK3 A;  1JJ2 M;  3HI0 A;  1DTT A;  1XI1 A;  3ISN C;  3O1B A;  1KD1 O;  1YF5 L;  3NHG A;  3K9K A;  4JD2 B;  3UKR A;  4I9Q A;  5M1P A;  1BGX T;  1N8R O;  3CCE N;  1YT3 A;  1NOZ A;  3G4S N;  4DUZ K;  5BPN A;  4I7F A;  3ZSX A;  5C25 A;  1WBD A;  3DLL L;  3IFR A;  3K5N A;  5GIN A;  1VSE A;  1YXQ A;  5BN9 A;  5B8H A;  4DSF A;  1U4B A;  2RPI A;  3HP9 A;  2ZM6 K;  4CJ5 A;  1WOQ A;  2VCP A;  3QEP A;  1TVR A;  4O5F A;  3VQC A;  2HHQ A;  5DM6 L;  4YOT A;  1Z6R A;  4CEF A;  1RTH A;  1RDB A;  3J81 O;  4ISG A;  1TKZ A;  5FRO A;  1YIT N;  5E41 A;  4DTN A;  4BR5 A;  2HHW A;  3ZSR A;  1SL2 A;  4Z94 A;  2D1K A;  2VGN A;  5FPM A;  1BIS A;  3EEQ A;  5KPT A;  4J2D A;  4KPY A;  1IKV A;  3OS2 A;  3UKU B;  2HVH A;  3CCV N;  2E2O A;  4DFJ A;  3EN9 A;  3AY9 A;  1HNZ K;  2B6A A;  1SAZ A;  5F2R A;  4DHY A;  3ENH A;  4WQ5 C;  1TYQ A;  5IT9 O;  3ZET A;  1ZBF A;  4YNQ A;  3KK7 A;  1VAZ A;  3V9W A;  1NJW A;  1WUA A;  5CR4 A;  2FF3 B;  5AQV A;  4FJ8 A;  5AZJ B;  4FJK A;  4KBO A;  3OTO K;  4DTM A;  3SUN A;  3MEG A;  3P4I A;  4BGB A;  3CME N;  3DAW A;  1VQP N;  4Z4C A;  4WQ4 C;  3H45 C;  3AAP A;  4FWK A;  1D5A A;  5GAG P;  3D45 A;  3DOK A;  5DMR A;  3HOS A;  3AO5 A;  4DV3 K;  3ULE B;  4RTF D;  4B8A B;  4PHT X;  4E19 A;  3I0R A;  3KZB A;  3L0Q A;  4DQQ A;  2E5L K;  1CLQ A;  1QS4 A;  2VWB A;  5HRO A;  1HNX K;  4DQR A;  4GKJ K;  4JI3 K;  4KHP K;  2ZQB A;  1NKE A;  4E7K A;  4H5W A;  4JKD A;  4PUO A;  3FZM A;  1EO1 A;  1G15 A;  4IJN A;  1QZ5 A;  3M8R A;  4CE9 A;  2KFZ A;  1E3M A;  3LP0 A;  3ZSO A;  4CJU A;  5KTQ A;  4E0D A;  1HJO A;  3W0L A;  1NK4 A;  2QKK A;  1J54 A;  1KFS A;  4K43 A;  3T19 A;  3ATU A;  3KD1 E;  4FM2 A;  3QFU A;  3J7Z O;  4QS8 A;  4FPA A;  1OVQ A;  4CGF A;  3AVI A;  3TAE A;  3AVL A;  3VEV A;  1XWL A;  5M1F A;  1OH8 A;  4DSK A;  4V19 S;  3I56 N;  4ZHR A;  3S9H A;  5BR8 K;  4L3Q A;  2EWS A;  3MN9 A;  4KHN A;  1NGJ A;  4HTU A;  2OCE A;  4IFE A;  3M8S A;  2VG5 A;  1TGO A;  2PY5 A;  5AQM A;  4JKG A;  2E88 A;  5SWM A;  4EZ6 A;  4DSI A;  3NAE A;  2A5X A;  3O08 A;  4JKG B;  4CJQ A;  3J80 O;  4U67 L;  5DM7 L;  1KTQ A;  4BC3 A;  3U9D A;  3HZ6 A;  2KQ2 A;  4CFD A;  3RMB A;  2E2P A;  1VQ4 N;  4K8X A;  4DFP A;  3BGR A;  4BRI A;  4M3W A;  1B92 A;  4FWS A;  3F5T A;  2QWR A;  2YJE A;  4DTU A;  3AO2 A;  1ZBI A;  4LSL A;  1MA9 B;  4LF6 K;  3K2P A;  4PL8 A;  3AAR A;  3M5R A;  5AQY A;  4RWT A;  1HUX A;  3HOT A;  1J6Z A;  4LH5 A;  3C7N A;  5AZI A;  4M7X A;  5D3G A;  2DFH A;  3ZSZ A;  4JKE A;  2A1S A;  3O9U A;  1U49 A;  2OTL N;  5C12 A;  3AO4 A;  3HP6 A;  1WSG A;  3NVK A;  5IWA K;  1M90 O;  3THW B;  4CJF A;  5HLF A;  4BQL A;  4DV1 K;  1J53 A;  2DFF A;  4OKE A;  1JXE A;  4WE1 A;  3C65 A;  3TAQ A;  4B1U B;  1CXU A;  1LWE A;  4DG1 A;  1C0M A;  5HOO A;  4IEE A;  5CYM A;  3AVK A;  3K59 A;  4CGG A;  5AQK A;  1MWK A;  3CJ9 A;  2HBJ A;  2XY8 A;  4ID1 A;  4OJR A;  1NJI O;  4FLT A;  1U47 A;  3P39 A;  3TU5 A;  2GV9 A;  3N4P A;  5BRF A;  1YAG A;  4DCH A;  1C0T A;  3O9Q A;  3DOL A;  1IJJ A;  3AO3 A;  3VEY A;  4BR9 A;  1K8K A;  5LMU K;  1C1C A;  3TR8 A;  1S1W A;  1X3N A;  1GLJ O;  1ASV A;  3WUH A;  3DRS A;  1ZBL A;  4RCH A;  1C0F A;  4CZK A;  4YY3 K;  3LAL A;  5BN8 A;  4Z0U A;  4H5N A;  5J2Q A;  3O3G A;  3FZK A;  3MXM A;  4OPA A;  3K5M A;  3EZ5 A;  5AQQ A;  4H0O A;  1NGD A;  2HHV A;  3ALY A;  3O4Q A;  1WAJ A;  1S5J A;  4DR1 K;  4O8K A;  3T1A A;  3PX6 A;  1MWM A;  3HTV A;  4DR3 K;  1A5X A;  4BG8 A;  2XY6 A;  3H1V X;  5CYQ A;  4KHQ A;  2A3Z A;  4FO0 A;  4WF9 L;  3L4Q A;  4MDA A;  1KFD A;  3SK3 A;  3ZT2 A;  3U3G A;  3P83 D;  3HT3 A;  3ID8 A;  4B9N A;  3MN7 A;  3OYH A;  3EE9 A;  4E3S A;  4CFA A;  5CY4 A;  5FPD A;  2Z1G A;  3KLH A;  1KRP A;  3M3Z A;  3NGY A;  2H3G X;  3OJS A;  1W97 L;  2HNY A;  3V81 A;  1KSP A;  1SL0 A;  4O55 A;  4DSJ A;  4WYB A;  2JWK A;  2FSK A;  5FPE A;  4IOX A;  3VER A;  4CJP A;  3P5J A;  5C2F A;  5BRD A;  3LWL A;  4AHR A;  4CIE A;  4KI6 A;  4B9T A;  3DXK A;  3DYA A;  3C6U A;  5C15 A;  1RT6 A;  5EX5 A;  1CXQ A;  1TL1 A;  3DXK B;  3L4I A;  1ESV A;  1ITG A;  3CCM N;  3AGK A;  2G8V A;  2DFE A;  3HVT A;  4CGI A;  4BR0 A;  1IBM K;  4FSV A;  1IKX A;  4CEA A;  2ETJ A;  1RGI A;  4BY9 C;  4E7J A;  2AP1 A;  1O13 A;  4ZTJ A;  3NF6 A;  2QWP A;  3PY8 A;  1SKS A;  3ZSW A;  3NGI A;  1VSM A;  1OVY A;  3QIP A;  3PUF A;  2ZWH A;  5M1O A;  2ITM A;  1GOA A;  3SAF A;  2YCH A;  4A5A A;  2V7Z A;  3VQ9 A;  4KV8 A;  4H5R A;  2D4W A;  1RBS A;  1TK0 A;  1Z25 A;  4B3T K;  5GAE P;  3H6E A;  3AAQ A;  4B8C A;  2G8I A;  1A5W A;  3SUP A;  3EZW A;  5EY4 A;  1ZXO A;  1HNV A;  5I42 A;  3CD6 N;  2OZS A;  3IDH A;  1RDD A;  1YTU A;  3MWT A;  1NG9 A;  1VSD A;  1HPZ A;  5CZ2 A;  1U2V A;  3AVA A;  1L3S A;  3QER A;  1Z05 A;  3C6T A;  4FWR A;  2FF6 A;  1ZYQ A;  1RNH A;  1U2V B;  4CJS A;  2WOM A;  1NK0 A;  5KI6 A;  2KW4 A;  3PV8 A;  5AR0 A;  4HHT A;  3FZH A;  4Y1D A;  1SKW A;  1U6Z A;  2A41 A;  4O4G A;  4IEI A;  4IO9 L;  4DTJ A;  4DQ8 A;  4EHT A;  1R59 O;  1DLO A;  2A42 A;  1UAX A;  3AVF A;  4G1Q A;  3RR7 A;  1OH6 A;  1BIZ A;  3S3M A;  2X6N A;  3KLI A;  5HRN A;  1RDU A;  4LC9 B;  4EP4 A;  4FWQ A;  2CGJ A;  4FM1 A;  3A5L C;  1VSK A;  2VG6 A;  3DMJ A;  1BCO A;  5KQ8 A;  3TAG A;  4CJT A;  3TSU A;  4NCG A;  1I3A A;  4E7H A;  4XEI A;  4FW2 A;  1W2B M;  3DXM B;  2IDO A;  1U48 A;  2QWL A;  3S41 A;  1S6Q A;  1NJY A;  2E4L A;  2P1J A;  3OY9 A;  4CIG A;  1YI2 N;  3K5L A;  2GUI A;  3TAN A;  4F3T A;  4B1X B;  3TWH A;  4H4M A;  4CHZ A;  2VWJ A;  4BDP A;  5AQH A;  4W5T A;  2ATQ A;  1ASU A;  3MK6 A;  2P9I A;  4IXC A;  4JRQ A;  1IV0 A;  4XH4 A;  2FC0 A;  1NLV A;  2RF2 A;  4CF0 A;  1YJW N;  4FLU A;  3W3D A;  1JCF A;  3VEZ A;  1BI4 A;  4CW7 B;  4CJK A;  2O8F A;  2WUS A;  3F9M A;  4DV4 K;  2HND A;  2I5J A;  3S3N A;  1QHA A;  4M7Y A;  4B9V A;  3BZK A;  2I7N A;  3AVC A;  3I8D A;  5TKW A;  1EX4 A;  4M3T A;  1C0G A;  2W40 A;  3EE8 A;  1S22 A;  2HNZ A;  4JHD B;  4LSN A;  2D0B A;  3RWU A;  4FJX A;  2YV0 X;  3CJC A;  5E84 A;  2IVP A;  3VQ6 A;  1RBR A;  5C42 A;  3P31 A;  5AQR A;  3HO1 A;  3LDQ A;  3R9P A;  1HX1 A;  4BRM A;  4A62 A;  4N47 A;  1S72 N;  1T05 A;  1IG8 A;  3O5B A;  2F96 A;  3HL8 A;  1RDW X;  5AQG A;  2QK9 A;  5BPM A;  4IDH A;  1RDA A;  4LD0 A;  2VYP A;  3THX A;  4N5S A;  2O8E A;  2YI1 A;  5BPL A;  3THY A;  4FOE A;  4JI6 K;  2O8E B;  1S1U A;  3AVM A;  1FKP A;  4O8U A;  4EP5 A;  5F0X A;  4KH4 A;  2X78 A;  1ASW A;  5H1S Q;  3J7Y P;  3LZI A;  3QNO A;  3H46 O;  2X6S A;  1IKW A;  3E1Y A;  4CI6 A;  5M1K A;  4Z4F A;  1VQO N;  4FZX C;  3VET A;  3VQP A;  3WQU A;  4BVP A;  2YNI A;  4FOI A;  4IOA L;  3NF8 A;  4E7L A;  2QKB A;  3ZT4 A;  4JI1 K;  5AQU A;  2W41 A;  3P38 A;  2P9L A;  1VSH A;  3ATV A;  4E7I A;  1LWC A;  2P9L B;  1X9M A;  1R0A A;  5JLH A;  3KLE A;  1S1T A;  4FJJ A;  5AQS A;  1VRU A;  3LP2 A;  1HKB A;  4NXN K;  3VQ5 A;  1QSL A;  1HQE A;  3WNF A;  2YHA A;  2FLO A;  1JL2 A;  2GEM A;  4OPH A;  3DLH A;  4J2A A;  4CZH A;  4FZZ A;  4NXM K;  2BTF A;  4DSL A;  4Q5V A;  4H0P A;  5AQZ A;  2NRZ A;  5EXW A;  4LFB K;  1C6V A;  2FBT A;  2BDP A;  2PFU A;  3SPY A;  3UKR B;  4CHY A;  4KHY A;  1EQY A;  4BRC A;  4KRF A;  4EAH D;  5F1X A;  1QTM A;  4B9L A;  4FYD A;  1S1V A;  4DB3 A;  1SUQ A;  4AIL C;  4DTP A;  1KAX A;  3SPZ A;  2KZM A;  2KKZ A;  2QXF A;  1QQM A;  1KCF A;  3NCI A;  3L3V A;  3QML A;  3RR8 A;  2FBX A;  4R5P A;  3T7Z A;  1NGE A;  4CEZ A;  4X64 K;  1WSF A;  2KFN A;  4RW4 A;  4IOC L;  3CCJ N;  1KLN A;  3KTQ A;  4DF4 A;  4DF8 A;  3D7E O;  4IZ9 A;  2IGI A;  3AVB A;  1K73 O;  1QZ6 A;  5I9E B;  4DLE A;  3MMV A;  4M3X A;  1JXB A;  1BUP A;  3SQ4 A;  3LDL A;  1S9E A;  1MU2 A;  1UA0 A;  4DR6 K;  1Q81 O;  2QTD A;  3SAH A;  1GLD G;  3VQ7 A;  3PIP L;  3M8P A;  3VGL A;  1TYQ B;  2WFB A;  3DRR A;  3ZET B;  2UXC K;  4NLC A;  3CCL N;  1WSJ A;  3LAM A;  3VMF B;  2HHU A;  2RHK A;  4B1Y B;  4CZG A;  2O8D A;  4FVU A;  1HRH A;  2P9P A;  1RTD A;  2O8D B;  1TKX A;  1NJZ A;  2P9P B;  1DT9 A;  2Z1H A;  3J8A A;  3CM5 A;  4F3O A;  2X74 A;  4W5O A;  3QDK A;  2Y1J A;  5GAD P;  2OPS A;  3KWI A;  4FW1 A;  1T7P A;  3L2V A;  1KLM A;  3VQE A;  3GOI A;  1KVB A;  4B9Q A;  1KQS M;  4AHV A;  5EU7 A;  4JAX A;  4JI2 K;  3CQY A;  4GVE A;  3DI6 A;  4YOU A;  1U04 A;  1ATN A;  3G6E N;  4M45 A;  4CK3 A;  3RTV A;  4CEC A;  3C6H A;  4B9S A;  4NYF A;  1TL3 A;  3VQ8 A;  4KB0 A;  3CER A;  3VF6 A;  4A2B A;  2G8F A;  1N32 K;  1BA1 A;  2HBK A;  3TI0 A;  5LL6 Z;  1JL1 A;  2ZGY A;  4BWJ A;  4W5Q A;  1VSF A;  3NGZ A;  5J2N A;  2OZM A;  1P90 A;  4X66 K;  3L2W A;  4CER A;  4CBX A;  3HXM A;  3TPQ A;  2E6L A;  3PX4 A;  2QWO A;  1YUW A;  4Z4H A;  4JKB A;  4QOZ B;  1TAU A;  3D6R A;  3UB5 A;  3SJH A;  4BRO A;  2F7T A;  4C23 A;  3LZJ A;  2UYT A;  4BRK A;  4C8K A;  3HST B;  2FSJ A;  3D2E A;  4M63 C;  1N33 K;  4OGC A;  3HYF A;  2Q3S A;  1FKO A;  4BRD A;  1GLB G;  4BC4 A;  4OLB A;  2PBD A;  3OYJ A;  2E1Y A;  3TTF A;  5HRP A;  3AVG A;  2YHW A;  3OHR A;  2GWK A;  1HJR A;  3NH1 A;  1V4S A;  2YHY A;  2O8B A;  1WNS A;  3LDO A;  1BU6 O;  3LDP A;  4ILJ A;  3ZCM A;  1N6Q A;  3OVN A;  5KQD A;  4FJN A;  5HBM A;  5HRS A;  4I9L A;  2NUB A;  5LJV A;  1NOY A;  4B9U A;  4G9Z A;  4JEP A;  5A2Q O;  1FW6 A;  5AQP A;  3V9U A;  1BQN A;  4CES A;  4NCA A;  1HPM A;  5AQJ A;  3ZX3 A;  4MLH A;  2Q2R A;  4PA1 A;  1UWB A;  3I55 N;  1YIJ N;  4ID5 A;  4CF9 A;  4E1M A;  3ITH A;  4FWN A;  4DS5 A;  4FZY A;  4BRF A;  1VQ6 N;  1XNR K;  1W7A A;  2ZGZ A;  1RT2 A;  2DY4 A;  4FLZ A;  1CZB A;  3FE1 A;  1SQK A;  4L8R B;  4IG0 A;  3P1G A;  3V6D A;  3EY1 A;  4JKA A;  5AQX A;  4C8L A;  3C7N B;  4H8K A;  1KXP A;  5AZI B;  3GL1 A;  3C6A A;  5JLF A;  4PL7 A;  4AQY K;  3ZT1 A;  3DLG A;  1C1B A;  5GIO A;  1W9H A;  2VQF K;  3JS6 A;  2VG7 A;  4BQZ A;  3CPE A;  3QB0 A;  4E1J A;  5C0Y A;  4CF1 A;  3ZSQ A;  3LDN A;  3QFP A;  3NVM A;  4JN4 A;  2P5O A;  4A61 A;  1NK7 A;  1BWF O;  4CZF A;  4KO0 A;  1BQM A;  4MO4 A;  3CQX A;  3VF2 A;  2OPQ A;  4BDY A;  4EHU A;  4BR7 A;  4JI7 K;  2E2Q A;  2OPP A;  4Z4E A;  3HM9 A;  3VQQ A;  3OYM A;  3CFR A;  1ZC6 A;  4H5V A;  1RBV A;  2YNH A;  4IWV A;  4HTL A;  3QBW A;  1VHX A;  3CXC M;  3DRP A;  1RFQ A;  1K8K B;  5KPZ A;  1FK9 A;  3PO5 A;  3BUZ B;  4CD3 A;  3KWG A;  1RBT A;  1REV A;  1VQN N;  3CCQ N;  3SMS A;  1XHX A;  4O5B A;  1S1X A;  1BG3 A;  2NLX A;  1CZ9 A;  3QBX A;  3OYB A;  4LF8 K;  3QEI A;  1HYS A;  4LH4 A;  3L2R A;  4CHO A;  3WXL A;  4BRL A;  2B4J A;  5C10 A;  2J4R A;  4CHN A;  3VTI A;  4CJ4 A;  3LAK A;  4FPB A;  1TKD A;  3OYF A;  3ZT3 A;  4WCE L;  3L8B A;  4KTW A;  2PAV A;  4B3R K;  2WBN A;  2P9K A;  2WC9 A;  4GV6 A;  4DFM A;  4IG3 A;  5FRM A;  1HLU A;  2ZJR L;  4CZM A;  4DS4 A;  2YNG A;  3VGK A;  1Y64 A;  4LY7 A;  1NGH A;  3CYM A;  3G25 A;  1QSS A;  4A57 A;  3V1Q A;  4B08 A;  1DEJ A;  1EWR A;  5C2D A;  2F4V K;  1WSH A;  4DR5 K;  1BO5 O;  2JWL A;  4NCB A;  1GLC G;  4CF2 A;  4CK1 A;  1RT4 A;  4ZTF A;  2A1R A;  3LAN A;  3OS0 A;  3OA9 A;  4BWM A;  4FJ7 A;  1L3T A;  2IIR A;  3EKU A;  2D0C A;  3IUC A;  3K58 A;  3I8B A;  4IJA A;  4ILG B;  4IFY A;  1EXQ A;  3E9O A;  2YX6 A;  2XHB A;  3VEO A;  3DWL A;  2ITG A;  3HM8 A;  4M41 A;  1UOC A;  4EZ9 A;  2YNF A;  2P5G A;  3I33 A;  1VSL A;  4BE1 A;  1NGF A;  2P9N A;  3SV4 A;  3PLA A;  3KKS A;  3OYG A;  2P9N B;  4RW7 A;  1BOT O;  3SLC A;  3WQT A;  3CPW M;  2E2N A;  4JI8 K;  2YHX A;  4WQ5 A;  1QVF M;  4DR7 K;  4KHW A;  3NE6 A;  1WLJ A;  1Z26 A;  2HF4 A;  1NNE A;  4CHP A;  1YJN N;  3A0I X;  4UY8 O;  4CFC A;  4YHH K;  4BE0 A;  4FVM A;  5KRS A;  1JLB A;  1KAY A;  2Q31 A;  2Y1I A;  3PSI A;  1N5Y A;  1BCM A;  3SNN A;  5AQN A;  2QW9 A;  3GDQ A;  4B3O A;  4RW6 A;  4F8R A;  4JV5 K;  4BC5 A;  3DJC A;  5CE3 A;  4CEE A;  5CHI A;  3NBP A;  5AQW A;  1ILY A;  4A2A A;  4FJG A;  1QVG M;  4U7B A;  4M3U A;  5KPR A;  2QWQ A;  5GIP A;  4BR4 A;  3CCR N;  3BP8 A;  3RMA A;  2ASO A;  2Q1N A;  2UU9 K;  3SUO A;  1NKB A;  4I2P A;  4DMN A;  2R7Y A;  2OTJ N;  2HOE A;  3G0Z A;  4XH1 A;  4DQI A;  3ENB A;  4IDK A;  3RSE A;  5K14 A;  3MN6 A;  2NRH A;  3RSE B;  3K9J A;  5TKY A;  3SBG A;  3L2U A;  4HWI A;  4F2S A;  1JLQ A;  1N34 K;  4KHU A;  3U4L A;  3CQ8 A;  4JNE A;  1E4F T;  4LF5 K;  1LCU A;  3T69 A;  4FJ5 A;  4W5N A;  3OYC A;  4Z4I A;  1TK8 A;  5FPN A;  3FFK B;  3D2F A;  2FSN A;  1B9F A;  3VES A;  1YHQ N;  5BRH A;  2QXL A;  1BL3 A;  1ZBH A;  1X9S A;  2QA4 N;  3WNH A;  2W6K A;  2D0P A;  2GBZ A;  1NGC A;  1HQU A;  1VSI A;  1EWQ A;  4FLW A;  1TV6 A;  4RW9 A;  4HUG A;  5LMN K;  4CED A;  2D0O A;  1XC3 A;  3ZX2 A;  2A6A A;  1S9G A;  1TK5 A;  1NGA A;  5E26 A;  2ZJP L;  3CG7 A;  3M8Q A;  4F9O A;  1QQN A;  1GOC A;  4JYA K;  2D0A A;  1U45 A;  4HCB A;  1G99 A;  1RT7 A;  2P9I B;  1VQ9 N;  4B1W B;  4DR2 K;  1HKC A;  4YOX A;  1BI4 B;  2V7Y A;  4OKK A;  4DU1 A;  4CGH A;  3WXK A;  2YKM A;  2O8F B;  3VF4 A;  3LDS A;  4B1V A;  3CCS N;  2YKN A;  3Q7B A;  3WXM B;  4H03 B;  3KKR A;  3DM2 A;  3A5N C;  4FJI A;  2KTQ A;  3OBW A;  4AM7 A;  4RG8 A;  2UXD K;  3DLE A;  1SZ2 A;  1GLF O;  3MDQ A;  4LFA K;  3VA3 A;  4IBN A;  2HST A;  3TAP A;  2BGG A;  3A2F A;  1I39 A;  4IO8 A;  1D8Y A;  2HB5 A;  3AVN A;  3V9Z A;  3CC7 N;  3NH0 A;  3GE1 A;  4DV7 K;  2QEX N;  5LY3 A;  4R79 A;  3A8Y A;  1JLC A;  1JCE A;  4WFB L;  1T03 A;  4B3M K;  1IO2 A;  3TAB A;  3CJB A;  3AGR A;  1WSI A;  1BA0 A;  2PYJ A;  4NLB A;  3K5O A;  1NGB A;  5JVH L;  4DQS A;  4Q0B A;  2O8C A;  3THX B;  4O44 A;  2IVO A;  3THY B;  2JGU A;  1I94 K;  3ZEU A;  3MXI A;  2V51 B;  2IS3 A;  4DV5 K;  1W0H A;  1X9J A;  3UIQ A;  4KI4 A;  1D9F A;  1Y97 A;  4DKW A;  4CZE A; 
#chains in the Genus database with same CATH homology
 3L2V A;  4JLH A;  3TAQ A;  1KLM A;  1X9W A;  1CXU A;  1LWE A;  4J2B A;  3VQE A;  4BAC A;  4DG1 A;  5JS1 A;  1KVB A;  1C0M A;  5CYM A;  4AHV A;  1TAQ A;  5EU7 A;  3AVK A;  3K59 A;  4CGG A;  4QOZ B;  2XY8 A;  3DI6 A;  4ID1 A;  4OJR A;  4FLT A;  1U47 A;  2HHS A;  1XC9 A;  2GV9 A;  1U04 A;  1NKC A;  3ZSV A;  2HVI A;  1QQC A;  4FLX A;  1C0T A;  4M45 A;  4CK3 A;  4CEC A;  3DOL A;  3RTV A;  1C1A A;  3AO3 A;  3NF7 A;  4OPJ A;  1C1C A;  3TR8 A;  4B9S A;  4NYF A;  1TL3 A;  1LW0 A;  3VQA A;  1S1W A;  3VQ8 A;  4KB0 A;  1YTA A;  2G8K A;  1ASV A;  3S3O A;  2G8F A;  3RRH A;  1LAW A;  3DRS A;  1ZBL A;  3TI0 A;  2HHT A;  5FRN A;  2OPR A;  2LSN A;  1JL1 A;  3QIO A;  4Y1C A;  4BWJ A;  4W5Q A;  1VSF A;  4DSE A;  3LAL A;  2PYL A;  3B6P A;  4Z0U A;  3NGZ A;  4AHC A;  2O4G A;  4JS4 A;  5J2N A;  5J2Q A;  3L2W A;  2OZM A;  3O3G A;  4CER A;  2IC3 A;  3MXM A;  2FBY A;  3HXM A;  4O0I A;  3K5M A;  3EZ5 A;  4GW6 A;  2E6L A;  4ELV A;  4CJR A;  3QNN A;  4CEB A;  3G10 A;  1HYZ A;  3HPO A;  3HK2 A;  2HHV A;  3PX4 A;  3SZ2 A;  3ZT0 A;  3QO9 A;  3ALY A;  3O4Q A;  1WAJ A;  1S5J A;  1LWF A;  4C8N A;  3T1A A;  4Z4H A;  3OYA A;  3PX6 A;  4OGE A;  1L5U A;  4KAZ A;  1A5X A;  2XY6 A;  5CYQ A;  5HP1 A;  3LZJ A;  4KHQ A;  1S6P A;  2IAJ A;  3OYD A;  2E6M A;  4C8K A;  3HST B;  1QSY A;  1KFD A;  4OGC A;  3SCX A;  3HYF A;  2Q3S A;  3V1O A;  1FKO A;  4OLA A;  3ZT2 A;  1J5O A;  4OLB A;  1TAU A;  5KGX A;  3QLH A;  3OYJ A;  3AA3 A;  3HVR A;  5HRP A;  3U3G A;  3KJV A;  4ELU A;  3AVG A;  3P83 D;  3VN5 A;  3HT3 A;  1UA1 A;  1RTJ A;  4OKJ A;  3QES A;  4B9N A;  4IKF A;  3OYH A;  3K57 A;  3O3H A;  4CFB A;  1HJR A;  2ZE2 A;  3NH1 A;  4GMJ B;  4E3S A;  4CFA A;  5CY4 A;  1WNS A;  2Z1G A;  5JS2 A;  4QAG A;  3KLH A;  4FJ9 A;  3ZCM A;  1N6Q A;  3OVN A;  1KRP A;  3BDP A;  4KB1 A;  4FJN A;  3NGY A;  4DTS A;  4KRE A;  5HBM A;  1TKT A;  1NJX A;  5HRS A;  4I9L A;  1JKH A;  4CCH A;  2NUB A;  2HW3 A;  5SZT A;  3OJS A;  2HNY A;  1IKY A;  3F9K A;  3V81 A;  3U3Y A;  1NOY A;  1KSP A;  1SL0 A;  4O55 A;  4B9U A;  4DSJ A;  4AH9 A;  3V9U A;  1JLA A;  4FM0 A;  1BQN A;  4CES A;  1RTI A;  1VSJ A;  1X1P A;  3MED A;  4CK2 A;  1L3U A;  4NCA A;  4AHS A;  4CJP A;  3RMD A;  4CHQ A;  3P5J A;  3I0S A;  2AJQ A;  1HMV A;  1RDC A;  4C8M A;  4DTO A;  4PA1 A;  3CFP A;  3LWL A;  4DFK A;  4MFB A;  4AHR A;  4CIE A;  3U6F A;  4B9T A;  4KI6 A;  3DYA A;  1B9D A;  1UWB A;  3ASM A;  3C6U A;  4CJV A;  2W42 A;  4E1N A;  1RT6 A;  2G8U A;  1CXQ A;  4ID5 A;  1TL1 A;  4CF9 A;  3LPT A;  4E1M A;  3VA0 A;  1ITG A;  3ITH A;  3AV9 A;  3LWM A;  2BAN A;  4DS5 A;  5I3U A;  2G8V A;  4FZY A;  1EP4 A;  2DFE A;  3HVT A;  4CGI A;  1WAF A;  1T8E A;  1RT2 A;  2DY4 A;  4FLZ A;  4ICL A;  1CZB A;  4L8R B;  4DU3 A;  1XHZ A;  4IG0 A;  5HRR A;  1IKX A;  5CZ1 A;  4CEA A;  2B5J A;  3P1G A;  3O4N A;  3V6D A;  3EY1 A;  3TAR A;  4DTR A;  2ETJ A;  4C8L A;  4H8K A;  1RT5 A;  1QE1 A;  4E7J A;  4E89 A;  2F8T A;  2OA8 A;  3OJU A;  4ZTJ A;  3V9X A;  3KK1 A;  3NF6 A;  3ZT1 A;  3PY8 A;  3DLG A;  1C1B A;  1SKS A;  3ZSW A;  1W9H A;  3NGI A;  1VSM A;  3QIP A;  3PUF A;  4N56 A;  2RN2 A;  2VG7 A;  1VK0 A;  4F2R A;  4CJL A;  4YFU A;  1GOA A;  4CF1 A;  3ZSQ A;  4KFB A;  3MXJ A;  4J2E A;  3SJJ A;  2P5O A;  2EHG A;  3LP1 A;  3KLG A;  3QEV A;  3VQ9 A;  3AVJ A;  4KV8 A;  4XIU A;  3PX0 A;  1NK7 A;  2HMI A;  1RBS A;  3NFA A;  4KO0 A;  1BQM A;  3NH2 A;  1TK0 A;  1Z25 A;  1Q8I A;  1A5V A;  2OPQ A;  4BDY A;  4DQP A;  1J9A A;  4B8C A;  2G8I A;  1F21 A;  1A5W A;  3SUP A;  1QHT A;  3LPU A;  3SUQ A;  4NYN A;  1HNV A;  2Z1J A;  5I42 A;  2OZS A;  2OPP A;  4Z4E A;  3F73 A;  1BIU A;  2FBV A;  3HM9 A;  1RDD A;  1K6Y A;  2XRI A;  4HUF A;  3VQQ A;  3OYM A;  3CFR A;  4FLV A;  1YTU A;  3MEE A;  4AHU A;  1RBV A;  1VSD A;  3AA4 A;  3AVH A;  3JSM A;  1HPZ A;  2YNH A;  4AHT A;  3OYL A;  4CEQ A;  2ZD1 A;  1JLF A;  3DRP A;  3MEC A;  3AVA A;  5CZ2 A;  3QER A;  1L3S A;  3KD5 E;  3PO5 A;  3VQ4 A;  1FK9 A;  3C6T A;  4FJL A;  4F4K A;  1ZYQ A;  1RNH A;  4W5R A;  3THV A;  4CJS A;  2WOM A;  1NK0 A;  1RBT A;  4BE2 A;  1REV A;  4C8O A;  5KI6 A;  4FJH A;  2KW4 A;  3PV8 A;  1XHX A;  1RT1 A;  3L2Q A;  4HHT A;  4Y1D A;  1NK8 A;  1SKW A;  4O5B A;  4GVM A;  1S1X A;  2WON A;  1Q9X A;  4UQG A;  3JYT A;  3V4I A;  4FXD A;  1CZ9 A;  3OYB A;  1RT3 A;  3QEI A;  3DLR A;  4O4G A;  1HYS A;  4LH4 A;  3L2R A;  4DTJ A;  4CHO A;  3ZSY A;  1EKE A;  1DLO A;  1JLE A;  2B4J A;  2XO7 A;  1LW2 A;  1UAX A;  3AVF A;  2BE2 A;  4G1Q A;  3ULD A;  2PZS A;  4CHN A;  3RR7 A;  4CJ4 A;  4CJ3 A;  2VWK A;  3HPH A;  3LAK A;  4HVJ A;  4JRP A;  1TKD A;  1BIZ A;  3KK2 A;  2X6N A;  3ZT3 A;  3OYF A;  3S3M A;  3VQD A;  4KTW A;  1RBU A;  3KLI A;  4CJE A;  5HRN A;  3L8B A;  3QET A;  3C94 A;  2XY7 A;  4DFM A;  2G8W A;  4IG3 A;  4EP4 A;  5FRM A;  4CGJ A;  4PY5 A;  4FM1 A;  2XY5 A;  1VSK A;  4RW8 A;  2VG6 A;  4DS4 A;  2YNG A;  1BCO A;  3DMJ A;  3HPG A;  4CF8 A;  3TAG A;  4CJT A;  3VQB A;  3TAF A;  4NCG A;  1RIL A;  1I3A A;  4LY7 A;  3CYM A;  4MQ3 A;  3OYK A;  4E7H A;  1QSS A;  4K8Z A;  4FJM A;  4FW2 A;  1U48 A;  3KK3 A;  2IDO A;  1DTT A;  1XI1 A;  2D5R A;  3ISN C;  3V1Q A;  3NHG A;  2YHB A;  1S6Q A;  4I9Q A;  4B08 A;  1NJY A;  1IH7 A;  2E4L A;  2P1J A;  3OY9 A;  4CIG A;  1WSH A;  3FFI A;  1Q9Y A;  3K5L A;  2GUI A;  3TAN A;  4F3T A;  3TWH A;  1BGX T;  4NCB A;  4H4M A;  4CHZ A;  2VWJ A;  1YT3 A;  4BDP A;  4CF2 A;  4CK1 A;  1NOZ A;  1RT4 A;  4W5T A;  4ZTF A;  3V9S A;  2A1R A;  3LAN A;  2ATQ A;  3OS0 A;  4FCY A;  4BWM A;  3WNG A;  1L3T A;  4FJ7 A;  1ASU A;  3CM6 A;  4I7F A;  2D0C A;  3ZSX A;  5C25 A;  3K58 A;  1NK9 A;  4JRQ A;  4FK2 A;  4IFY A;  2FC0 A;  1EXQ A;  4J2A A;  4CF0 A;  2RF2 A;  3K5N A;  1VSE A;  4FLU A;  4DSF A;  4Z4G A;  1U4B A;  2RPI A;  1D9D A;  3HP9 A;  1BI4 A;  4CJK A;  2XHB A;  2G8H A;  4CJ5 A;  2ITG A;  3SV3 A;  4BDZ A;  4M41 A;  4CIF A;  1KVA A;  1UOC A;  2HND A;  4DLG A;  4FLY A;  3OYN A;  2I5J A;  3S3N A;  4CJW A;  4EZ9 A;  2YNF A;  2P5G A;  4B9V A;  3QEP A;  1TVR A;  1VSL A;  4TSX A;  3VQC A;  4BE1 A;  2HHQ A;  3SV4 A;  4ELT A;  4HCC A;  3KKS A;  3AVC A;  3OYG A;  3I8D A;  4CEF A;  1RTH A;  1RDB A;  3AA2 A;  4RW7 A;  1TKZ A;  5FRO A;  1EX4 A;  4M3T A;  5E41 A;  1HYV A;  2HNZ A;  4LSN A;  4CGD A;  3OYE A;  4B9M A;  2D0B A;  3QIN A;  4DTN A;  4KHW A;  2HHW A;  3E01 A;  3NE6 A;  3RWU A;  4FJX A;  3ZSR A;  2YV0 X;  1SL2 A;  4M3R A;  1WLJ A;  1Z26 A;  1BIS A;  3IRX A;  3VQ6 A;  1RBR A;  5C42 A;  4CHP A;  3SQ2 A;  5DK5 A;  4CFC A;  4J2D A;  4KPY A;  1IKV A;  4BE0 A;  3OS2 A;  3HO1 A;  2HVH A;  4FVM A;  4OVL A;  4IFV A;  5KRS A;  4DWI A;  4DFJ A;  1JLB A;  4KTQ A;  2B6A A;  3IS9 A;  4N47 A;  1ZBF A;  1T05 A;  1KVC A;  4YNQ A;  2Y1I A;  2F96 A;  3HL8 A;  1N5Y A;  1BCM A;  3V9W A;  3SNN A;  2QK9 A;  1NJW A;  4B3O A;  4FJ8 A;  3SI6 A;  1RDA A;  4LD0 A;  4RW6 A;  3QEX A;  4F8R A;  4FJK A;  2HHX A;  4N5S A;  3C95 A;  4KKO A;  4CEE A;  4DTM A;  3SUN A;  1S1U A;  3MEG A;  3AVM A;  1FKP A;  3NBP A;  4EP5 A;  5KGW A;  4Z4C A;  2X78 A;  4M42 A;  3TAM A;  1ASW A;  5J2P A;  4FJG A;  5J2M A;  3LZI A;  4M3U A;  1D5A A;  3OYI A;  3D45 A;  3QNO A;  3DOK A;  5DMR A;  3MAQ A;  1RCH A;  3AO5 A;  3RMA A;  2X6S A;  4CEO A;  1IKW A;  4Z4F A;  3SUO A;  3QEW A;  4B8A B;  1NKB A;  4I2P A;  4DMN A;  2R7Y A;  4FZX C;  3HJF A;  3G0Z A;  4E19 A;  3VQP A;  3I0R A;  3O3F A;  2YNI A;  4DQI A;  2Z1I A;  4IDK A;  4M3Y A;  3NF8 A;  5K14 A;  4E7L A;  4DQQ A;  1CLQ A;  3H08 A;  2QKB A;  5C24 A;  3ZT4 A;  1QS4 A;  3L2U A;  1VSH A;  4E7I A;  5HRO A;  4DQR A;  1SKR A;  4M3Z A;  1LWC A;  4QCL A;  4F2S A;  1X9M A;  1R0A A;  1JLQ A;  3KLE A;  4KHU A;  2ZQB A;  1S1T A;  4FJJ A;  4O0J A;  3CQ8 A;  1NKE A;  4E7K A;  4PQU A;  1GOB A;  1VRU A;  3LP2 A;  4FJ5 A;  1NK6 A;  4PUO A;  3KIO A;  3OYC A;  4W5N A;  3VQ5 A;  3SQ0 A;  1QSL A;  5J1E A;  1HQE A;  3OS1 A;  4Z4I A;  1TK8 A;  3D0P A;  3WNF A;  1G15 A;  2YHA A;  1B9F A;  1JL2 A;  1L3V A;  2KFZ A;  3M8R A;  4CE9 A;  3LP0 A;  3ZSO A;  4CJU A;  3DLH A;  5KTQ A;  4E0D A;  1BL3 A;  1ZBH A;  1NK4 A;  4I2Q A;  1J54 A;  1X9S A;  1KFS A;  3B6O A;  2QKK A;  3WNH A;  4OPK A;  3T19 A;  3KD1 E;  2EX3 A;  4PWD A;  4FZZ A;  2GBZ A;  3CFO A;  4DSL A;  4FM2 A;  4Q5V A;  1HQU A;  1VSI A;  2OYQ A;  3PO4 A;  4FLW A;  2JLE A;  1YVU A;  1TV6 A;  3KLF A;  2P51 A;  4CGF A;  3AVI A;  1C6V A;  3V1R A;  4RW9 A;  2FBT A;  4HUG A;  3TAE A;  4CED A;  2BDP A;  2IOC A;  3AVL A;  3SPY A;  4CHY A;  1XWL A;  4DSK A;  4KHY A;  4ZHR A;  4KRF A;  3S9H A;  3RRG A;  1S9G A;  3LP3 A;  4DTX A;  1TK5 A;  1QTM A;  2DTU A;  3IG1 A;  4B9L A;  4FYD A;  1S1V A;  3CG7 A;  4KHN A;  1SUQ A;  3M8Q A;  4HTU A;  4KHS A;  3M8S A;  4AIL C;  1SL1 A;  1GOC A;  2VG5 A;  4DTP A;  1TGO A;  2D0A A;  1LV5 A;  1U45 A;  4DU4 A;  2PY5 A;  1ZBU A;  3SPZ A;  1EET A;  4HCB A;  2KZM A;  1LAV A;  2QXF A;  5SWM A;  1HNI A;  4EZ6 A;  1RT7 A;  1KCF A;  4DSI A;  3NAE A;  3NCI A;  1NK5 A;  4CJQ A;  3L3V A;  5FDL A;  3RR8 A;  2FBX A;  4R5P A;  1BI4 B;  4OKK A;  4DU1 A;  4CGH A;  4HUE A;  4CEZ A;  1KTQ A;  1WSF A;  2YKM A;  2KFN A;  3LDS A;  1JLG A;  2KQ2 A;  4RW4 A;  2YKN A;  1KLN A;  4CFD A;  3RMB A;  3KKR A;  3DLK A;  2O4I A;  4K8X A;  4DFP A;  4JS5 A;  3T3F A;  3BGR A;  3DM2 A;  4M3W A;  1O1W A;  4FJI A;  1B92 A;  4DF4 A;  3KTQ A;  2KTQ A;  4DF8 A;  1FXX A;  4DTU A;  4RG8 A;  2IGI A;  3AO2 A;  3DLE A;  3AA5 X;  3NDK A;  3AVB A;  1ZBI A;  4LSL A;  3NF9 A;  3VA3 A;  4FK4 A;  3RMC A;  4IBN A;  3AO1 A;  3TAP A;  4DLE A;  3K2P A;  4M3X A;  1JXB A;  2BGG A;  3SQ4 A;  3A2F A;  1S9E A;  1I39 A;  5KRT A;  1MU2 A;  1UA0 A;  4N41 A;  1D8Y A;  2KZZ A;  2HB5 A;  3AVN A;  3V9Z A;  4KTZ A;  3NH0 A;  3VQ7 A;  3L3U A;  1SV5 A;  1JLC A;  3M8P A;  3IAY A;  1T03 A;  3SQ1 A;  3DRR A;  1IO2 A;  1WSE A;  4LH5 A;  3TAB A;  1C0U A;  1WSI A;  1WSJ A;  2PYJ A;  1DTQ A;  5D3G A;  1WN7 A;  3K5O A;  3LAM A;  2DFH A;  2HHU A;  4DQS A;  4Q0B A;  3ZSZ A;  4FK0 A;  2A1S A;  4O44 A;  5T7B A;  1U49 A;  3AO4 A;  2JGU A;  1WSG A;  1HRH A;  3HP6 A;  1RTD A;  1IG9 A;  3MXI A;  1TKX A;  1NJZ A;  3DLB A;  4N76 A;  2F8S A;  2Z1H A;  4CJF A;  2IS3 A;  3CM5 A;  4F3O A;  2RKI A;  2X74 A;  1BHL A;  1W0H A;  3WNE A;  4W5O A;  3UIQ A;  2Y1J A;  5HLF A;  1VRT A;  4KI4 A;  1D9F A;  1J53 A;  2DFF A;  4OKE A;  1JXE A;  1Y97 A;  2OPS A;  4WE1 A;  3EYZ A;  4FW1 A;  3SYZ A;  1T7P A;  4H4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...