1JXBA

I53a, a point mutant of the cysteine-free variant of e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
152
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAAVALEALKEHAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Propagation of a single destabilizing mutation throughout the Escherichia coli ribonuclease HI native state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 48
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jxbA00
3LP3A 4OKKA 3OY9A 1RCHA 3KD5E 3OYCA 4C8MA 4DQPA 4I9QA 1N5YA 4FM0A 3HM9A 1GOBA 1TL3A 1NKBA 4KRFA 4NYNA 2YKNA 4JS4A 4ICLA 4FZXC 1ZBUA 1NK9A 4E1NA 3SCXA 2F8SA 1RTHA 1HYVA 4IKFA 4G1QA 3KK2A 3M8QA 3KD1E 4KHQA 1U48A 3DRSA 5FDLA 5FROA 4JRQA 1NK7A 4GVMA 4OGEA 2OZSA 1C6VA 4I2QA 3OYGA 3K5OA 3V4IA 3T3FA 2EHGA 3DLRA 3V1QA 3QIPA 1ZBHA 2HHSA 1D9FA 1IKYA 1ZBLA 1HNVA 4CF2A 4DLGA 4NCBA 2A1SA 2HMIA 4CCHA 1WAFA 4CFCA 4JS5A 3TWHA 3G10A 4I7FA 1NJZA 2ZQBA 3LANA 4GMJB 3VQBA 1KVAA 4FJ9A 1UOCA 1Y97A 1RDAA 4IDKA 4DF8A 1K6YA 4FJHA 3PY8A 2DFHA 2PZSA 4E19A 1WSGA 2G8FA 4DWIA 4KHSA 1NKCA 3ZSQA 1Q8IA 3MAQA 1XHZA 2BGGA 2HHUA 1QE1A 2R7YA 2X74A 4KTZA 1L3UA 3OJSA 4DLEA 4FYDA 4FJIA 1A5XA 1FKPA 1VSIA 2KZZA 2G8WA 4F2SA 2JLEA 4M42A 3HO1A 3DMJA 4NYFA 3AO4A 3KLFA 4FZZA 1NK5A 1JLCA 3CFRA 4E7HA 3MECA 2G8HA 4J2AA 4DFMA 3RMBA 4F3TA 4KB1A 4CGDA 4YNQA 3OJUA 3QEIA 1TL1A 3VN5A 1RDDA 1SKRA 1T7PA 4B9MA 4ZTFA 4CGJA 1C1BA 3O4NA 3S3OA 4PUOA 4EP4A 1YTUA 1LWCA 3LP1A 3MEDA 2KFNA 4FCYA 1FK9A 1QHTA 1HMVA 1WNSA 2VWJA 1VSDA 3ZT3A 3AVKA 1S6QA 4CJEA 3TAGA 1HYZA 3B6OA 3AVAA 5I3UA 1N6QA 1VRUA 4DG1A 1KLNA 4B9SA 3ZT2A 1D8YA 1QSLA 4CEAA 4KHYA 4KI6A 5CY4A 2OZMA 3AA2A 3VQEA 4B8CA 3DRRA 3KK1A 3RMCA 1RILA 3SJJA 1GOAA 4OKJA 3VQ5A 3OYIA 3KLEA 2XY7A 1SL0A 4CF1A 1QSYA 2B5JA 4FJ5A 1BI4A 1JXEA 4MQ3A 1S1TA 3T1AA 3NFAA 4DTOA 1IKXA 3MXMA 4J2EA 4DTJA 2QK9A 3C6TA 4M3XA 1B9FA 1C0UA 4QOZB 3O3GA 4Z4FA 3TAEA 3HVRA 2B6AA 3SQ0A 1WSIA 1JXBA 2KQ2A 3AA5X 4J2DA 3MXJA 1DTQA 1IO2A 5CYMA 3L2WA 3K58A 3PO5A 4KHNA 4TSXA 5FRMA 4H4MA 1RDCA 1LW0A 1HNIA 4B08A 4NCAA 3DLEA 1ZYQA 2XY6A 4IG0A 4C8KA 3IG1A 2QXFA 5CZ1A 3H08A 2NUBA 4E7KA 1BIUA 3SI6A 1GOCA 1LAWA 1SL2A 3TR8A 1WSHA 1UA0A 1DLOA 3RR7A 2E6MA 3QNNA 4C8OA 4DTXA 1TAQA 1VSEA 3U6FA 4CFAA 3OYAA 3NH2A 1RT4A 4M3RA 2W42A 4BDZA 1NJXA 4FJXA 1KTQA 5C24A 3O3HA 4CIGA 4BWMA 1JL2A 3ZSXA 3IS9A 2YHBA 3P83D 3NF7A 3VQCA 2JGUA 4W5TA 3QESA 3C95A 2ZE2A 3D0PA 3VA0A 2XY5A 2D0CA 3AVFA 1S1XA 3I0SA 4FZYA 3L2VA 1T03A 1KRPA 3QEPA 1F21A 1W0HA 3L3UA 5KTQA 1BCMA 3SQ2A 3TABA 4J2BA 3HP6A 2RPIA 4E7LA 1X9MA 4LSNA 3QERA 3HP9A 3RR8A 1WSEA 3LWLA 1RT2A 1WSFA 4JLHA 3VA3A 1BI4B 5KRTA 4K8XA 1VSJA 4CGIA 3AVCA 3KKSA 4E0DA 4KFBA 3AVNA 3ZT0A 3OYKA 1VSMA 3PX0A 4N76A 4CGHA 2OA8A 2YNFA 3JSMA 4M3TA 2O4GA 2QKBA 4RW4A 2QKKA 3V6DA 3DLGA 1EETA 1CXQA 4ELVA 1QSSA 4MFBA 4DFPA 2FC0A 4W5NA 4KREA 3B6PA 3AVIA 3PX6A 4DQIA 4DSKA 4F3OA 4E1MA 3PX4A 1U04A 1TVRA 3FFIA 4XIUA 1SKSA 3ULDA 4LY7A 3SV3A 4OVLA 2X6NA 4AHTA 4CJLA 4BE1A 4O44A 4O0IA 4KAZA 1C1AA 4FLXA 4ELUA 3SQ1A 1S9GA 1ZBFA 3LZIA 3TAFA 3HJFA 4E7JA 2DTUA 3OS0A 1TKTA 4B8AB 4F8RA 4AHCA 4DMNA 4DFKA 2OYQA 4DU4A 3ZT1A 4BE0A 3BGRA 4GW6A 1U47A 3NE6A 3RMAA 2WONA 3MXIA 1KCFA 3C6UA 2RF2A 2GV9A 5J2MA 3QETA 3QINA 4CJRA 3KLHA 4M3WA 4EP5A 3U3GA 1NKEA 1IG9A 3V9UA 1T8EA 3KKRA 1KVCA 3HPOA 4Z4CA 4DFJA 1JKHA 3OYDA 4I2PA 2G8UA 4DQQA 3RTVA 1SKWA 4QAGA 2IDOA 1C1CA 3M8PA 2FBTA 4E3SA 1HRHA 3IRXA 1Q9XA 3MEEA 1XI1A 4KV8A 2FBXA 4N5SA 3DI6A 1NOZA 1Z26A 4IG3A 3LP0A 4Y1CA 4C8NA 4CEDA 2Y1IA 3O4QA 5DK5A 3VQ7A 3OYLA 4DU1A 5HLFA 3HK2A 2AJQA 1RT6A 2G8VA 4Z4GA 3P1GA 2DFEA 3AA4A 1ZBIA 2EX3A 3HVTA 2B4JA 3V9ZA 2HW3A 4DTUA 2HHTA 4E7IA 1SL1A 4NCGA 2HHWA 4DTSA 1S5JA 4ID5A 4LD0A 4HUGA 4FJLA 1A5WA 1S9EA 3AO2A 4LH4A 1KSPA 3A2FA 3SPYA 3PO4A 2HNZA 3ASMA 3WNFA 3L2UA 3SZ2A 4Q5VA 4LH5A 3K57A 3VQPA 3DYAA 1EKEA 1BHLA 1ASVA 1EX4A 4CJ3A 4JRPA 3SUNA 1NK4A 1TK0A 4C8LA 3L2RA 3AO1A 4HCCA 4AH9A 4DS4A 3HPGA 4WE1A 2P1JA 3V81A 3ZSZA 4CF0A 4FLWA 4RW9A 3OS2A 4B9VA 1FXXA 4CIFA 1BQMA 4R5PA 4CJUA 4W5RA 3SUOA 3VQDA 4KB0A 2O4IA 3S3NA 4CHQA 3NCIA 3TARA 1A5VA 1J53A 4Z4HA 2BDPA 1C0MA 1JLQA 5C25A 3PUFA 3NGZA 2YNHA 4CGFA 2P5GA 4Y1DA 4M45A 5HRSA 1VRTA 1ASWA 3CM5A 5HP1A 4O55A 1Q9YA 2D0AA 3L2QA 4BDPA 2YKMA 1RT3A 4KI4A 3D45A 4CJVA 4OPKA 5J1EA 3NF8A 4B9NA 3LPTA 4FJJA 1UAXA 4FM1A 1VSHA 4PY5A 3M8RA 1FKOA 2OPRA 3AVLA 3ZSOA 1ITGA 3V9XA 1NK8A 4BE2A 3IAYA 4FXDA 4W5QA 3EZ5A 1JLGA 3SQ4A 2XHBA 3OYBA 4LSLA 4CEZA 4CJ5A 2WOMA 1LV5A 2ATQA 3OS1A 4DTNA 4DSIA 2G8KA 1XWLA 4KO0A 2HVIA 1JLBA 3HPHA 1WN7A 5T7BA 5EU7A 3LWMA 4B9TA 4HCBA 1JL1A 3SUPA 3NF9A 4CK2A 1RBVA 3RRGA 4CERA 1REVA 2IC3A 4CEQA 3QEVA 4FJ7A 5D3GA 1ASUA 3LPUA 4HUFA 1NK0A 4Z4EA 4OLAA 3DRPA 4CEOA 5K14A 4CHNA 2KW4A 1VK0A 3MEGA 1IKVA 4E89A 3NDKA 1S1UA 3AVMA 2YNGA 1KVBA 1SUQA 3SPZA 1NOYA 4K8ZA 1XHXA 3CFPA 3NBPA 5CZ2A 1TK5A 3EY1A 3KJVA 2Z1GA 4DTMA 3ZSWA 1RT7A 5SZTA 3HT3A 4W5OA 4DTRA 1EXQA 3THVA 3DOKA 4Z0UA 4UQGA 3TANA 2HHVA 3C94A 2VG6A 5HRRA 3HYFA 4OLBA 1J5OA 4PWDA 3EYZA 2IS3A 2GUIA 4IFVA 1S1VA 4CF9A 4FJMA 4H4OA 1VSFA 3V1OA 1J54A 2IGIA 4CEFA 1SV5A 4CJFA 3DOLA 3CYMA 4FW2A 4CESA 4FLVA 1VSLA 1RDBA 1UA1A 4FJKA 3LP2A 2RKIA 3JYTA 3I0RA 1JLFA 3DLBA 4FLTA 4DQRA 4M3YA 4AHVA 2Q3SA 3I8DA 3CM6A 3QEXA 1CXUA 2A1RA 1G15A 4ELTA 1QQCA 1CZ9A 2X78A 4CHYA 3AO5A 4FK4A 1TKXA 1RT5A 1TV6A 4KTWA 5E41A 1NJWA 1D5AA 3ZSYA 4F2RA 4Q0BA 5KI6A 1TKDA 3F9KA 5HRPA 4DSEA 2DY4A 1LWFA 3ZSVA 4CHZA 3QO9A 3AV9A 2ETJA 4CJSA 3K5MA 4KTQA 5KGWA 1NK6A 1RT1A 4FJ8A 4KHUA 4CJTA 4ZTJA 1WSJA 5KGXA 3LAMA 2XY8A 3V1RA 1LAVA 4L8RB 4BDYA 4KPYA 4FLYA 1MU2A 2ZD1A 3P5JA 3LALA 3AVGA 5HRNA 1QTMA 1BQNA 3AVHA 3QLHA 3SV4A 4M3UA 4OKEA 1QS4A 4KKOA 3NGYA 3ZCMA 3ISNC 4O4GA 3BDPA 5SWMA 4FK2A 3WNEA 3VQ6A 4CEBA 2PYLA 1CLQA 4HHTA 1HQUA 1O1WA 4RG8A 4DSFA 2LSNA 5KRSA 4EZ9A 3RWUA 1VSKA 1YT3A 4AHSA 3OYMA 5FRNA 4RW6A 1RTJA 2Z1HA 5DMRA 3SNNA 2IOCA 1X9WA 1LWEA 2FBVA 4OJRA 4F4KA 3ITHA 3UIQA 1YVUA 4N47A 3KLIA 3OYEA 1NJYA 3NF6A 3QEWA 1WAJA 5CYQA 2X6SA 3U3YA 3E01A 2KTQA 1HYSA 4RW7A 4H8KA 3HXMA 3NGIA 2I5JA 1KLMA 4M3ZA 3DLHA 4CFBA 4FW1A 1DTTA 4CECA 1D9DA 4FLUA 2HNDA 2OPQA 3VQ9A 4CJKA 2YNIA 4DF4A 5HROA 3AO3A 3G0ZA 1U49A 1B92A 2FBYA 4PQUA 2E6LA 4IBNA 3CQ8A 3K59A 3K5LA 2D0BA 4B9LA 1CZBA 3KK3A 1TKZA 1WLJA 1HPZA 2E4LA 2PY5A 4DSJA 3V9WA 5HBMA 1S6PA 3K2PA 1RBUA 4M41A 3WNHA 3V9SA 4FJNA 4Z4IA 3F73A 2OPPA 3ZT4A 2HNYA 3TAMA 4EZ6A 1KFSA 1RBRA 1XC9A 3K5NA 1W9HA 4O5BA 4RW8A 4HUEA 4PA1A 2XO7A 1X9SA 2VWKA 3T19A 4FJGA 1UWBA 3QNOA 2OPSA 4ID1A 5JS2A 3SYZA 3CFOA 3RRHA 3S9HA 1L3SA 2F96A 1HQEA 4CK1A 3KTQA 2F8TA 3KLGA 3NH0A 4BWJA 3NHGA 3KIOA 1U45A 3DM2A 2Y1JA 1HJRA 4CHOA 2Z1IA 3L8BA 3PV8A 3DLKA 3AA3A 4CEEA 2HVHA 5C42A 2HHXA 3OYNA 4I9LA 4DTPA 3OYFA 1I39A 2BANA 1L3VA 5J2NA 1BIZA 4CHPA 5J2QA 4CFDA 1TGOA 3ZSRA 3NAEA 4FK0A 2G8IA 3TI0A 1BL3A 1JLAA 4B3OA 1S1WA 1TK8A 1R0AA 3TAPA 1T05A 1L3TA 1IKWA 2VG7A 2D5RA 3AVJA 4CJPA 4DSLA 4AHRA 4CE9A 4HVJA 1RTIA 2BE2A 3L3VA 4CJWA 4CIEA 4OPJA 1IH7A 3M8SA 4CGGA 3HL8A 1U4BA 3O3FA 2PYJA 1BISA 1L5UA 1B9DA 3VQAA 3HSTB 1KFDA 2KFZA 1I3AA 4HTUA 2ITGA 1RBSA 4DS5A 3QIOA 4QCLA 3ALYA 2IAJA 1RTDA 4FVMA 3AVBA 4AILC 2VG5A 4N56A 1RNHA 1Z25A 2DFFA 1TAUA 1J9AA 2P5OA 2YV0X 2YHAA 3WNGA 4AHUA 3LDSA 3VQ4A 3LZJA 3CG7A 3TAQA 3NH1A 4CF8A 2KZMA 1X1PA 4YFUA 2Z1JA 2HB5A 4OGCA 3VQ8A 3OVNA 5JS1A 4BACA 1YTAA 1BGXT 4O0JA 3S3MA 2GBZA 4FLZA 5I42A 4KHWA 4B9UA 1BCOA 2P51A 1JLEA 2RN2A 4CJQA 3OYHA 2XRIA 3OYJA 4IFYA 1RBTA 3VQQA 4FM2A 3RMDA 4CJ4A 3LAKA 1EP4A 4ZHRA 1C0TA 4DU3A 2HHQA 4CK3A 5J2PA 3SUQA 1LW2A 4DQSA 4N41A
chains in the Genus database with same CATH superfamily
3OY9A 3TU5A 1RCHA 4FWPA 4JK9A 3OYCA 3IMXA 4BR9A 4DKWA 4KH4A 1J6ZA 2QWLA 2YKNA 4JS4A 1QVGM 4H0VB 5C2DA 1RTHA 5CE3A 3BUZB 4IKFA 3KK2A 1E4GT 3DRSA 4JRQA 4GVMA 4OGEA 2OZSA 4I2QA 4JEPA 3K5OA 3OYGA 2NLXA 3C6HA 3DXKB 3T3FA 3DLRA 3V1QA 1ZBHA 2HHSA 1D9FA 5BRDA 4CF2A 1EQYA 3IKMA 4DLGA 2HMIA 4AM6A 4X62K 4CCHA 5F2RA 3EE9A 4BR7A 3F5TA 3LANA 3VQBA 1KVAA 3IFRA 1RDAA 1K6YA 4FJHA 5AQUA 4E19A 4GNIA 3THWB 1X9JA 2G8FA 2E1ZA 3DXMB 1Q8IA 4YY3K 3MAQA 1QE1A 1L3UA 3L4QA 3H6EA 3GBTA 4FWQA 4FJIA 1A5XA 1FKPA 1VSIA 2G8WA 3HO1A 3DMJA 4G9ZA 4J2AA 2A42A 4H5NA 4F3TA 3JS6A 2QA4N 3A5LC 1TL1A 3OHRA 3VN5A 4PUOA 1YTUA 3B8AX 5M1OA 3LP1A 4FCYA 1FK9A 4IOXA 3BY5A 2VWJA 3CCVN 3TAGA 5M1FA 3AVAA 2UUCK 1CZAN 4KHYA 4CEAA 3CCMN 2OZMA 3VQEA 3SLCA 4BRAA 3VQ5A 4OKJA 3KLEA 4CF1A 3CCSN 1BI4A 3T1AA 4DTOA 5AQXA 1IKXA 1T6DA 4YHHK 4MDAA 5EY4A 4QOZB 2QK9A 4M3XA 1C0UA 4Z4FA 2KHOA 1JXBA 3WT0A 4BGAA 5AJ3K 5BR9A 4KHNA 1Q86O 2EWSA 4H0XB 4JI1K 3THYB 4NCAA 2QEXN 3AARA 2XY6A 4IG0A 4DV6K 3H08A 2E2QA 2YX6A 3DXMA 2QWRA 3U4LA 3TR8A 3P38A 2E6MA 4H5RA 3U6FA 3LM9A 2W42A 5EOYA 1RT4A 4ILJA 1QZ5A 4PKIA 3P83D 2JGUA 3QESA 2ZE2A 3ENBA 2D0CA 3EN9A 1S1XA 5KPTA 1QQOA 3CPEA 2NRVA 4CZIA 5C10A 5GADP 3L2VA 1T03A 1KRPA 3QEPA 4FSVA 4J2BA 1BCMA 1NMNA 2QXLA 2UUAK 4MLEA 1NGHA 3VGKA 3UB5A 4DQ8A 1X9MA 3QERA 4ILGB 5AZIA 1BA1A 3LDLA 4CBXA 4JLHA 5E26A 4K8XA 3PSFA 3KKSA 4E0DA 3ZT0A 4N76A 4AQYK 4HTLA 3MCAB 3BZKA 4M3TA 1ATNA 1KC8O 3DLGA 1EETA 1NU0A 3EO3A 5AQVA 3T7ZA 3DLLL 1YJNN 4XH5A 3PX6A 3BZCA 1OH7A 4IJNA 3SV3A 5IT9O 4OVLA 5AQKA 4BE1A 1N33K 3SQ1A 1MWMA 4NLBA 3LZIA 2CH6A 1GLDG 3OS0A 3CIPA 2ZF5O 4DV1K 3K9JA 2OYQA 2UYTA 3CETA 1NGEA 4JD2A 4FWNA 4EP5A 3V9UA 1XUPO 1KVCA 4Z4CA 1C0GA 4H0YB 4E3SA 3P4IA 1Q9XA 4N5SA 3DI6A 3PIPL 4CEDA 3O4QA 4K0KK 3HK2A 4LF7K 2G8VA 2HF3A 2EX3A 3V9ZA 2HW3A 2UXDK 2A40A 5FPMA 4HUGA 3KZBA 5AZJA 1NWKA 3SPYA 3ASMA 4XEIA 3O5BA 4JN4A 4LF8K 3VQPA 4JRPA 4WQ4A 4BQZA 3SAHA 4DS4A 4JHDA 5C2FA 3MK6A 4W5RA 5AZJB 4GY2B 3SUOA 4PL8A 3S3NA 3NCIA 3TARA 1A5VA 4Z4HA 2ASOA 2YNHA 4M45A 2NRXA 3CM5A 5HP1A 4IWVA 2D0AA 2YKMA 2Q31A 1RT3A 2OANA 3O1WA 4CJVA 2P9IA 3IAYA 3TTCA 3V9XA 3NVKA 1S3XA 2XHBA 1ILYA 4CJ5A 1VQPN 1YITN 3OS1A 3QB0A 1XWLA 4WQ5A 2HVIA 3HPHA 3VTHA 3LWMA 1VAZA 4BRIA 4CK2A 4CERA 2IC3A 4CEQA 4FJ7A 3KWGA 1ASUA 3LPUA 2A41A 3W3DA 4HUFA 1NK0A 4Y0WA 3UKRA 2KW4A 5BPNA 3CCUN 3TSUA 5AQZA 5CZ2A 3E9LA 3PLAA 3ZSWA 5SZTA 4W5OA 4JI2K 3JAMO 2VG6A 1XMOK 4PWDA 3IUCA 4CF9A 4FJMA 4H4OA 3V1OA 1J54A 3TSPA 4FW2A 4FLVA 4FJKA 4B9QA 3LP2A 4ISFA 2WTUA 2HHHK 1WUAA 4M3YA 2Q3SA 3H3OB 3AO5A 1IBMK 5AQFA 4FK4A 4KTWA 5HRPA 3AGKA 2O8DB 1RT1A 1E3MA 2A3ZA 2GWJA 4CJTA 4ZTJA 4O8UA 4BDYA 1MU2A 1T3VA 1NG9A 3QLHA 1Q7YO 5GAGP 4O4GA 1VQON 4FK2A 3J8AA 3EEQA 3FZKA 3RVCA 4HHTA 4RG8A 4A5AA 4EZ9A 1NGAA 3RWUA 3N4QA 1FW6A 3R3LA 5FRNA 3TTFA 4ILHA 1RTJA 3THXB 2P9UA 1GLJO 2IOCA 4F4KA 3ITHA 3CJCA 4YOVA 3QEWA 5CYQA 3U3YA 3O9QA 5AQWA 3J81O 1FJGK 2E20A 3NGIA 2PAVA 3SJHA 4H0OA 4CFBA 1DTTA 2HNDA 2OPQA 1HKGA 3VOVA 4CJKA 4OPHA 2D0PA 4OO1J 1U49A 4PQUA 3K59A 2D0BA 1MDUB 3G25A 4FL9A 5HBMA 1RBUA 2E5LK 3I55N 3FE1A 4A59A 3TAMA 3FZMA 1KFSA 4EZ6A 1MA9B 1RBRA 1XC9A 1W9HA 4HUEA 2XO7A 2CGKA 4FJGA 4X64K 3SYZA 3HSCA 3RRHA 3CFOA 3S9HA 1L3SA 4CK1A 4M7YA 3NHGA 3CJ7A 3MDQA 3UKUB 1JCFA 1N36K 5DM6L 2HVHA 2HHXA 3CC7N 1OVYA 4I9LA 1GLEG 3ZX0A 4CFDA 1LCUA 2BUPA 4NLCA 5BPMA 1BDGA 1JLAA 3CCQN 1NGGA 2HBLA 3ENOA 4CJPA 4DSLA 3MN7A 4CE9A 4KHWA 4CGGA 3SBGA 1L5UA 2ITGA 4DHYA 3ALYA 2IAJA 2PFUA 1IBLK 2VG5A 4DB3A 1RNHA 1Z25A 2DFFA 2YHAA 4AHUA 3VQ4A 2QWOA 4YOWA 3NH1A 1X1PA 3BEXA 3C65A 3VF2A 1GLBG 4BACA 1YTAA 3VEOA 1Z6RA 3ZX3A 4FLZA 3RTVA 1JLEA 3HRGA 3OYHA 3VQQA 3LAKA 1H1VA 4CJ7A 4M7XA 3C7NB 4ZHRA 4BROA 2YHWA 2HHQA 5J2PA 1P8ZA 5GIPA 1Q18A 3SK3A 5JVGL 3G6EN 3KD5E 4C8MA 4I9QA 5AQQA 4DV2K 1NKBA 4KRFA 4NYNA 4WQ4C 2GUPA 4E1NA 3SCXA 2F8SA 3EL2A 3M8QA 5JMVA 4KHQA 1U48A 5FDLA 1NK7A 3D2EA 1IG8A 4XH4A 3K0SA 4LFAK 1IKYA 4IDHA 2A1SA 1QZ6A 3CMEN 4JKAA 4B1UB 1WAFA 3OBWA 3G10A 4GMJB 4K41A 4FVUA 5LMNK 2PZSA 4JKHA 4H5VA 2E88A 4DWIA 2WFBA 4KHSA 1XHZA 2BGGA 4YOXA 2Q1NA 2KZZA 4M42A 2HBKA 4JAXA 3KLFA 4B3MK 1ATRA 1JLCA 2G8HA 2ZWHA 1WBDA 2KLAA 2NRHA 5ELZA 1DKGD 4YNQA 3OJUA 3QEIA 5JLFA 4CGJA 1C1BA 4PL7A 4BRNA 3AY9A 1LWCA 3MEDA 4FWSA 1C0FA 5I3UA 5GINA 4OPAA 1QSLA 4KI6A 5CY4A 3O8MA 3DRRA 3KK1A 3RMCA 1RILA 3ENHA 3SJJA 2XY7A 4H5WA 2W41A 4U67L 1JXEA 1YJWN 4FJ5A 2VGMA 1S1TA 1QQNA 2W6LA 4V19S 3C6TA 3O3GA 3M1FA 3TAEA 3HVRA 5AQTA 2B6AA 1WSIA 2KQ2A 3K9KA 4J2DA 3GE1A 5CYMA 3K58A 4H4MA 1RDCA 4DV4K 1HNIA 3DLEA 2HSTA 3O4WA 1YVNA 5CZ1A 2NUBA 4BG9A 1BIUA 1SL2A 3RR7A 3KHYA 4CFAA 4FJXA 1K9MO 2A5XA 4CIGA 4BWMA 3ZSXA 2DPNA 3C95A 3D0PA 3UKRB 5KPZA 4BREA 1YIJN 1F21A 3L3UA 4AF1A 3A5MC 3TPQA 4F9OA 4LSNA 3WXLA 1RT2A 4BRPA 3AVCA 4KFBA 3OYKA 4MO5A 2YNFA 1VHXA 3LL3A 4GVEA 1T44A 4ELVA 1QSSA 1KAZA 4W5NA 4DQIA 3O6WA 4DSKA 1U04A 4IEEA 3CCEN 4LY7A 3T1YK 4CJLA 5M1QA 3EKUA 4O44A 4KAZA 3NVMA 1C1AA 4FLXA 4ELUA 1S9GA 3TAFA 3HOTA 3THXA 4DU4A 3BGRA 4BVOA 1U47A 1M90O 2WONA 2P9PB 3C6UA 2RF2A 4A62A 5J2MA 3QETA 3KLHA 3EKSA 1NKEA 3KKRA 2O8BA 3OYDA 4PKGA 2G8UA 4DQQA 4WYBA 1C1CA 1HRHA 1IBKK 3AGRA 4KV8A 3VPZA 1KAXA 4KPYA 4Y1CA 3LP0A 2Y1IA 4DU1A 3HI0A 5M1PA 4BRMA 2DFEA 4B1XB 1ZBIA 1HLUA 2HBMA 2B4JA 4DTUA 1SL1A 4NCGA 2HHWA 4BRHA 4DV3K 4FJLA 1S9EA 1KSPA 3PO4A 3L2UA 1P90A 3SZ2A 4Q5VA 3DYAA 4CJ3A 2W40A 3SUNA 1TK0A 5FPNA 3L2RA 4AH9A 3ZEUB 3HPGA 4WE1A 4R79A 3I8BA 1XMQK 4RW9A 3OS2A 2P9NB 4R5PA 4CJUA 3VQDA 2O4IA 4BGBA 2BDPA 1C0MA 5C25A 2GWKA 5E84A 3P31A 4IJAA 5BREA 5ADXH 4BDPA 4OPKA 1T6CA 1WOQA 2IVNA 4FM1A 3M8RA 3O9TA 3AVLA 2E2OA 1XNRK 3BF1A 3WQTA 3SQ4A 4YORA 4CEZA 3KVGA 1XC3A 2ATQA 3R9PA 4DSIA 2F9TA 5I9EB 5BR8K 2G8KA 4IXCA 3SUPA 3NF9A 1RBVA 1REVA 2BTFA 4CHNA 3NDKA 3GG4A 5K14A 1T7PA 1VK0A 3MEGA 4E89A 1KVBA 4BR5A 1SUQA 3WXJA 4DR7K 1XHXA 1TK5A 4GV3A 4DTMA 1E4FT 4NXNK 1M1KO 4H03B 3FZHA 4DR3K 4DTRA 3DOKA 4Z0UA 2O8EA 3H46O 3CCLN 5C0YA 2IGIA 4LF5K 4CEFA 1SV5A 3DOLA 3CYMA 4O5FA 1UA1A 3I0RA 3QMLA 4FLTA 1ZXOA 4BC5A 3I8DA 2A1RA 1CXUA 1OKJA 1G15A 1QQCA 1CZ9A 4CHYA 1TKXA 1VQ8N 1NJWA 4IEIA 3ZSYA 1NM1A 4CZFA 4F2RA 4Q0BA 1TKDA 3ZETA 2DY4A 4CHZA 4KH6A 4KTQA 1NGDA 1NK6A 5HOOA 1Y64A 1ZBSA 3LAMA 3V1RA 1LAVA 4FPAA 4CD3A 3P5JA 3LALA 2FF6A 5JVHL 4KKOA 5SWMA 1NBWA 2PYLA 2P9PA 3L0QA 4DSFA 4BVPA 4LF4K 4AHSA 3SNNA 2WC9A 5DMRA 2Z1HA 3UIQA 4N47A 4U7BA 3OYEA 3F9MA 3NF6A 4RW7A 4H8KA 3HXMA 4FW1A 2ZGZA 1D9DA 4JV5K 4JHDB 4DF4A 1YUWA 4EFHA 3SMPA 2QWNA 2HBJA 2YHXA 3K5LA 1QQMA 2YHYA 2PY5A 4DSJA 4Z4IA 1S6PA 3K2PA 3V9SA 2NRRA 4JI5K 2E2PA 4BRKA 3J7YP 4BRLA 3R1XA 1K8AO 4RW8A 3A0IX 3D2EB 1X9SA 4CZGA 1NJIO 2NNWA 2OPSA 5JS2A 1HQEA 5GIOA 4L3QA 3NH0A 1EO1A 2IVPA 1QVFM 1HX1A 2UU9K 1HJRA 4HWIA 3L8BA 4CEEA 5C42A 3UE5A 3OYNA 4DTPA 3OYFA 5FPEA 1BIZA 5J2QA 4FK0A 3ZSRA 3F2KA 3G71N 1S1WA 3TAPA 1IKWA 5AQPA 4HVJA 1RTIA 3L3VA 4BRGA 4OPJA 1U4BA 3RSEB 3E66A 3S41A 1B9DA 1I3AA 4HTUA 4DS5A 1HNXK 1RTDA 3AVBA 4AILC 3D2FB 4N56A 1TAUA 1GLAG 2YV0X 3WNGA 2P5OA 1HNZK 1KXPA 2NRTA 3LZJA 4GKJK 3O1BA 4CF8A 1WB9A 4CVNE 4FWMA 2Z1JA 2HB5A 3VQ8A 5JS1A 5A2QO 3CJAA 2P9LB 4B9UA 2QWPA 4JKEA 4K25A 3A8YA 1RBTA 4CJ4A 4YOTA 1C0TA 3IDHA 1OH8A 3SUQA 4DQSA 4N41A 3LP3A 2P9LA 4DQPA 1N8RO 3CC4N 5KPRA 4DV5K 1GOBA 1NLVA 1TL3A 3ID6A 4ICLA 1NK9A 3KD1E 3AAQA 3U8XA 5FROA 1C6VA 1BO5O 1NNEA 4DUYK 5AQOA 2ZJRL 2EHGA 4RCHA 5AR0A 1ZBLA 4NCBA 4X65K 3SMSA 2VYPA 4CFCA 4JS5A 3TWHA 1K73O 1U2VA 4JI3K 2ZQBA 3U9DA 1GLFO 4FJ9A 5AQNA 1Y97A 4DF8A 4BR2A 4PKHA 3PY8A 1WSGA 4JKGB 1NKCA 4O8KA 3ZSQA 2O8BB 2R7YA 2X74A 3FFKB 3E9OA 3ZEUA 1U2VB 4F2SA 2JLEA 4CZMA 1NK5A 3ULEB 4E7HA 1X3MA 3MECA 1OH6A 1SZ2A 3RMBA 2ZGYA 4KB1A 3GL1A 4CGDA 1RDDA 1SKRA 4B9MA 3O4NA 3S3OA 4FPBA 3H1VX 2KFNA 4BC3A 2F7TA 5EXWA 1QHTA 2YJEA 1HMVA 1WNSA 1VSDA 3ZT3A 1S6QA 4CJEA 1HYZA 3B6OA 4B9SA 4JNEA 2O8DA 3ZT2A 2OCEA 3MN5A 4JKBA 4C1NI 3LDOA 1GOAA 2QWMA 1SL0A 3CC2N 3MN9A 2BH1A 1QSYA 1RFQA 2QW9A 4JI7K 5GAHP 4J2EA 3NFAA 1NMDA 3VEXA 3ZLJA 4KBOA 1B9FA 1NGIA 4Z94A 3SQ0A 1DTQA 1IO2A 3L2WA 3PO5A 5BN8A 4WFNL 4JI6K 3G4SN 1LW0A 1Q82O 4B08A 1NGCA 2OTLN 4C8KA 2QXFA 3WXIA 3QICA 4CZKA 1GOCA 1LAWA 1WSHA 1UA0A 1DLOA 4C8OA 4DTXA 1ZC6A 4BDZA 3NH2A 4M3RA 1KTQA 5C24A 3O3HA 4B1ZA 1JL2A 2YHBA 3VQCA 3PIOL 3MMVA 3I0SA 3P39A 4FZYA 1GLCG 4FWKA 1W0HA 3TABA 2UUBK 3HP6A 2RPIA 4DV0K 4FWLA 3HP9A 5EVZA 3LWLA 2P9NA 3WQUA 5KRTA 2HF4A 1VSJA 1TYQA 1VSMA 4CGHA 2OA8A 2IIRA 2QKBA 1CXQA 5IWAK 4B3SK 2J4RA 4MFBA 4DFPA 4DUZK 3AVIA 3O9SA 1BOTO 1SKSA 2X6NA 4O0IA 3HJFA 4FWRA 3SAGA 1TKTA 4AHCA 4DMNA 4DFKA 3D6RA 2QWQA 4BE0A 1KAYA 5ADXA 3RMAA 3MXIA 1KCFA 4EIAA 2GV9A 3QINA 4M3WA 3U3GA 4BC4A 4I2PA 1SKWA 2IDOA 3M8PA 2FBTA 3VTIA 5JICA 4QS7A 3IRXA 4CBWA 4CZJA 2FBXA 4IG3A 4BRDA 4C8NA 5HLFA 5DK5A 3THWA 1RT6A 4Z4GA 3AA4A 4ISEA 2VQEK 5AQIA 2O8CB 1RGIA 2FF3B 5EX5A 4ID5A 3QDKA 3ULEA 1A5WA 3AO2A 3L4IA 2H3GX 4GV9A 2GTDA 1EX4A 1BHLA 2VGNA 1NK4A 2GELA 4HCCA 3AO1A 4CBUA 2CH5A 3FR0A 2P1JA 5TKWA 3V81A 3ZSZA 1N32K 4CF0A 1FXXA 4CIFA 1BQMA 2Q0RA 4CHQA 1J53A 1JLQA 3PUFA 1VRTA 1X3NA 3VGMA 5AFUA 3D45A 4KI4A 5J1EA 3NF8A 4B9NA 1UAXA 4BE2A 1K8KB 4W5QA 3HM8A 3HZ6A 3EZ5A 3VEVA 1BWFO 4K43A 4LSLA 2QI2A 4DTNA 1VQ5N 2ASMA 4KO0A 1JLBA 5MLCQ 1WN7A 5T7BA 3CQXA 5EU7A 4B9TA 4HCBA 1JL1A 5TKYA 1ESVA 3CJ9A 3RRGA 4GKKK 1W97L 4Z4EA 3DRPA 1IKVA 1S1UA 3AVMA 2VQFK 1BA0A 2FSJA 3OTOK 1NOYA 1VQMN 4K8ZA 2P9SA 2NZTA 3CFPA 4H5TA 1OH5A 2VWBA 3M3ZA 1G99A 1RT7A 3ATVA 4WFAL 3THVA 5C15A 4UQGA 3TSQA 2UXBK 4JI4K 4BR4A 4OLBA 3EYZA 2GUIA 4IFVA 1VSFA 4AM7A 2GX9A 4CJFA 1NGFA 1VSLA 2FSKA 3JYTA 2RKIA 3AAPA 3DLBA 4DR5K 4DQRA 4AHVA 2FSNA 3QEXA 3CM6A 5LJVA 3J80O 1YAGA 1RT5A 2P9KB 5E41A 5KI6A 2FLOA 5LY3A 3ZSVA 3QO9A 3AV9A 3K5MA 5KGWA 1K8KA 3ATUA 4KHUA 4CZLA 1WSJA 2V7YA 3DAWA 4OX9K 3UKUA 1HJOA 1BQNA 3SV4A 1KQSM 4M3UA 2E2NA 4IFEA 3VETA 3NGYA 3VQ6A 4CEBA 2Q0UA 2PBDA 2O8FA 1O1WA 3CPWM 5KRSA 3DXKA 2GEMA 3A5OC 3VEWA 3O9UA 1VSKA 1YT3A 3OYMA 1X9WA 1LWEA 4OJRA 1YVUA 4H0TB 5BRFA 2V52B 2X6SA 2I5JA 4M3ZA 4CECA 4FLUA 2P9UB 1IV0A 3FGUA 5C12A 5BPLA 2D1KA 3BF3A 3ZETB 2FBYA 4IBNA 3LM2A 3CQ8A 4DR2K 3T1HK 1CZBA 3KK3A 1WLJA 1HPZA 1EWRA 3V9WA 4M41A 3WNHA 3DJCA 1NGJA 2OPPA 2I7PA 2HOEA 2HNYA 2AA4A 4JK7A 3T19A 4A61A 1UWBA 3QNOA 1U6ZA 1ATSA 3BP8A 2F96A 1TUYA 3KK7A 3H3NO 3KIOA 3DM2A 2Y1JA 3PV8A 3DLKA 2BANA 1L3VA 2UXCK 4CHPA 2G8IA 1TGOA 2ZJQL 3TI0A 2CGJA 1DEJA 2NRZA 4A2BA 4GV6A 3N4PA 3WXMB 2Q2RA 1L3TA 2VG7A 2D5RA 3AVJA 4AHRA 3M8SA 2BE2A 4CJWA 4PY5A 4CIEA 4JK8A 1IH7A 2PYJA 1KFDA 1JJ2M 1RBSA 3QIOA 3CJ1A 3W0LA 4BR0A 1TYQB 3LDSA 2W6KA 4LF9K 4WCEL 4YDUC 3VEZA 2KZMA 4OGCA 1BGXT 4O0JA 4JI0K 3S3MA 2ZJPL 4QS8A 5I42A 1BCOA 1IJJA 4MLHA 4CJQA 2P51A 2RN2A 4FM2A 4IFYA 1LOTB 4DV7K 5M1NA 1EP4A 3I33A 3VGLA 3KWIA 4CK3A 4WF9L 3LDPA 1HUXA 4OLAA 1SQKA 4OKKA 4UY8O 3WEEA 1N5YA 4FM0A 3HM9A 3LDQA 2Q36A 4NO7A 4DCHA 4FZXC 4BRQA 1ZBUA 1HYVA 5AQSA 4G1QA 4BY9C 3HBTA 3VESA 3V4IA 1VQ9N 3QIPA 1VQLN 3QFPA 1W2BM 5AQYA 2RE2A 1HNVA 5KQ8A 3CF5L 2QTDA 4BQLA 4I7FA 1NJZA 1RDWX 5AQLA 1UOCA 2I7NA 4IDKA 5BRHA 2DFHA 4YOUA 4B3TK 2HHUA 4KTZA 3CQYA 3OJSA 2O8EB 1HR0K 4DLEA 4FYDA 1D4XA 4YDUA 4MDBA 4NYFA 3AO4A 4FZZA 3CFRA 3VF6A 4CD1A 4DFMA 3L6QA 2YI1A 1YF5L 2P9SB 1YXQA 4NXMK 3C7NA 5KQDA 4ZTFA 2V51B 4EP4A 5H1SQ 1R59O 3AVKA 2HMPA 1N6QA 1VRUA 3ZYYX 3O80A 4DG1A 1KLNA 1D8YA 2JWKA 3ZX2A 5JLHA 3AA2A 2WUSA 4B8CA 4IOAL 5F1XA 1J5EK 3OYIA 2B5JA 3FZFA 3GOIA 1YJ9N 4MQ3A 3MXMA 4JD2B 4MO4A 3VERA 3SAFA 4DTJA 1S22A 3AA5X 4YOYA 3R6MA 3MXJA 4H0PA 4LF6K 2CGLA 1Z05A 4ISGA 4TSXA 5FRMA 3VENA 5FLXO 2NRWA 1ZYQA 2E1YA 2V7ZA 3DWLA 5FPDA 3IG1A 4E7KA 4WFBL 3SI6A 4DR6K 3QBWA 5B8HA 1SAZA 1VQ4N 3QNNA 1TAQA 1VSEA 5CR4A 3OYAA 3CCJN 1NJXA 2E8AA 2ITMA 3CXCM 1HKBA 3IS9A 1OVQA 3NF7A 4W5TA 3OA9A 3VA0A 2XY5A 3AVFA 3SQ2A 5KTQA 3RSEA 4E7LA 3RR8A 1WSEA 2F4VK 3R8EA 3CJBA 2ZM6K 1WSFA 3VA3A 1BI4B 3D7EO 4J8FA 4CGIA 3AVNA 3PX0A 4XH1A 1V4TA 3JSMA 2O4GA 4RW4A 2QKKA 3V6DA 4I6MB 1MWKA 2F9WA 1QHAA 2FC0A 4KREA 3CCRN 3B6PA 1KD1O 4F3OA 4CZEA 4E1MA 4E1JA 3PX4A 1TVRA 3FFIA 4XIUA 5M1KA 3ULDA 4EAHD 4RWTA 4AHTA 4JYAK 5F0XA 1ZBFA 1XQSC 4E7JA 4LC9B 2DTUA 4B8AB 4F8RA 3ZT1A 5AFUH 4GW6A 5DM7L 3M5RA 3NE6A 4CJRA 4JKGA 3MN6A 1BG3A 1IG9A 1T8EA 2YJFA 3HPOA 4DFJA 1JKHA 4WQ5C 1GLLO 4QAGA 3MWPA 1WBBA 3MEEA 1XI1A 4FOIA 2JWLA 1NOZA 1Z26A 3NMUA 4LFBK 3OYLA 3VQ7A 3E9PA 2AJQA 3WUHA 3P1GA 3EE8A 3HVTA 3E1YA 2HHTA 4E7IA 4DTSA 1S5JA 5LJWA 5AQHA 4LD0A 4KH5A 4DR1K 4LH4A 3MX2A 3A2FA 2HNZA 3WNFA 3J7ZO 3FZLA 4LH5A 3K57A 1JCGA 1EKEA 1ASVA 4C8LA 3ID8A 3J7AP 1W7AA 3OBYA 4A2AA 1VQ6N 4IO9L 4FLWA 5AQJA 5AQRA 4B9VA 2VCPA 3TTDA 4KB0A 2P5GA 3JXUA 3NGZA 4CGFA 4Y1DA 5HRSA 1ASWA 3T69A 4O55A 1Q9YA 3L2QA 3H45C 1VQKN 3LPTA 4FJJA 1VSHA 1FKOA 2OPRA 3PSIA 3ZSOA 1ITGA 1NK8A 4BC2A 4FXDA 4JKCA 1JLGA 3C0BA 3OYBA 2WOMA 1YI2N 1LV5A 1HNWK 4CZHA 5GAEP 1SS6A 5AQGA 1V4SA 1JCEA 5D3GA 3QEVA 4CEOA 3MX5A 4FO0A 2YNGA 3SPZA 3CD6N 3CHWA 3I56N 3NBPA 1XNQK 3EY1A 3KJVA 2Z1GA 5BN9A 1BU6O 4BG8A 3HT3A 1TUUA 1EXQA 3TANA 3QBXA 2HHVA 3C94A 3QFUA 5HRRA 3HYFA 1J5OA 2IS3A 1VQNN 1S1VA 1N34K 4DR4K 1BUPA 1O13A 2AP1A 4A57A 4CESA 1RDBA 3GDQA 1JLFA 3CERA 3VF4A 3OW2M 3C6AA 4ELTA 2X78A 3HOSA 3FLCO 1TV6A 1NGBA 1D5AA 5CHIA 4NB4A 3F9KA 4DSEA 1LWFA 2ETJA 4CJSA 4BRFA 4FJ8A 4CW7B 5KGXA 2XY8A 4X66K 4L8RB 2RHKA 4JKDA 4FLYA 2ZD1A 3AVGA 5HRNA 2FXUA 1QTMA 3AVHA 4OKEA 1QS4A 3MWTA 1DT9A 3ISNC 3O08A 3VEYA 3ZCMA 3LDNA 3BDPA 3WNEA 1CLQA 1HQUA 2LSNA 1VQ7N 4IOCL 1RDUA 5LL6Z 4RTFD 4RW6A 3H1QA 2FBVA 4JKFA 3A5NC 2ASPA 5AZIB 3KLIA 1NJYA 1YHQN 2YCHA 1WAJA 3E01A 2KTQA 3WXKA 1HYSA 3CI5A 2Q97A 1KLMA 3DLHA 4A5BA 5LMUK 2KKZA 3VQ9A 2YNIA 5HROA 2A6AA 3AO3A 3G0ZA 1B92A 4FOEA 2E6LA 4B1YB 3SBTA 1HPMA 1S72N 2D0OA 4B9LA 1TKZA 2E4LA 4KHPK 4FJNA 4LFCK 3F73A 2OTJN 2O8CA 3ZT4A 4C23A 4QS9A 3K5NA 4O5BA 4PA1A 4EHTA 2VWKA 4IO8A 4BRCA 4B1WB 4ID1A 3KTQA 4M63C 2F8TA 3KLGA 4BWJA 4CHOA 2Z1IA 2QM1A 4I6MA 3AA3A 2D4WA 1I94K 4CI6A 1I39A 3Q7CA 2IVOA 4B1VA 5J2NA 3THYA 3WEEB 3NAEA 1BL3A 4JI8K 1HKCA 4B3OA 3U9ZA 5AQMA 1TK8A 1Q81O 1R0AA 1DGKN 1T05A 3VMFB 1EWQA 3O9RA 2P9IB 3HL8A 3M6GA 3O3FA 1BISA 3VQAA 3HSTB 2KFZA 4K42A 4QCLA 4FWOA 4FVMA 2O8FB 4PHTX 4IZ9A 1J9AA 3Q7BA 3CG7A 3TAQA 2WBNA 4YFUA 5HL7L 3EZWA 3OVNA 3D2FA 2GBZA 4B3RK 3RMDA 2XRIA 3OYJA 3HTVA 3MCPA 4C1NK 3CMAN 4DU3A 2P9KA 4EHUA 1LW2A 1U45A
chains in the Genus database with same CATH topology
3LP3A 4OKKA 3OY9A 1RCHA 3KD5E 3OYCA 4C8MA 4DQPA 4I9QA 1N5YA 4FM0A 3HM9A 1GOBA 1TL3A 1NKBA 4KRFA 4NYNA 2YKNA 4JS4A 4ICLA 4FZXC 1ZBUA 1NK9A 4E1NA 3SCXA 2F8SA 1RTHA 1HYVA 4IKFA 4G1QA 3KK2A 3M8QA 3KD1E 4KHQA 1U48A 3DRSA 5FDLA 5FROA 4JRQA 1NK7A 4GVMA 4OGEA 2OZSA 1C6VA 4I2QA 3OYGA 3K5OA 3V4IA 3T3FA 2EHGA 3DLRA 3V1QA 3QIPA 1ZBHA 2HHSA 1D9FA 1IKYA 1ZBLA 1HNVA 4CF2A 4DLGA 4NCBA 2A1SA 2HMIA 4CCHA 1WAFA 4CFCA 4JS5A 3TWHA 3G10A 4I7FA 1NJZA 2ZQBA 3LANA 4GMJB 3VQBA 1KVAA 4FJ9A 1UOCA 1Y97A 1RDAA 4IDKA 4DF8A 1K6YA 4FJHA 3PY8A 2DFHA 2PZSA 4E19A 1WSGA 2G8FA 4DWIA 4KHSA 1NKCA 3ZSQA 1Q8IA 3MAQA 1XHZA 2BGGA 2HHUA 1QE1A 2R7YA 2X74A 4KTZA 1L3UA 3OJSA 4DLEA 4FYDA 4FJIA 1A5XA 1FKPA 1VSIA 2KZZA 2G8WA 4F2SA 2JLEA 4M42A 3HO1A 3DMJA 4NYFA 3AO4A 3KLFA 4FZZA 1NK5A 1JLCA 3CFRA 4E7HA 3MECA 2G8HA 4J2AA 4DFMA 3RMBA 4F3TA 4KB1A 4CGDA 4YNQA 3OJUA 3QEIA 1TL1A 3VN5A 1RDDA 1SKRA 1T7PA 4B9MA 4ZTFA 4CGJA 1C1BA 3O4NA 3S3OA 4PUOA 4EP4A 1YTUA 1LWCA 3LP1A 3MEDA 2KFNA 4FCYA 1FK9A 1QHTA 1HMVA 1WNSA 2VWJA 1VSDA 3ZT3A 3AVKA 1S6QA 4CJEA 3TAGA 1HYZA 3B6OA 3AVAA 5I3UA 1N6QA 1VRUA 4DG1A 1KLNA 4B9SA 3ZT2A 1D8YA 1QSLA 4CEAA 4KHYA 4KI6A 5CY4A 2OZMA 3AA2A 3VQEA 4B8CA 3DRRA 3KK1A 3RMCA 1RILA 3SJJA 1GOAA 4OKJA 3VQ5A 3OYIA 3KLEA 2XY7A 1SL0A 4CF1A 1QSYA 2B5JA 4FJ5A 1BI4A 1JXEA 4MQ3A 1S1TA 3T1AA 3NFAA 4DTOA 1IKXA 3MXMA 4J2EA 4DTJA 2QK9A 3C6TA 4M3XA 1B9FA 1C0UA 4QOZB 3O3GA 4Z4FA 3TAEA 3HVRA 2B6AA 3SQ0A 1WSIA 1JXBA 2KQ2A 3AA5X 4J2DA 3MXJA 1DTQA 1IO2A 5CYMA 3L2WA 3K58A 3PO5A 4KHNA 4TSXA 5FRMA 4H4MA 1RDCA 1LW0A 1HNIA 4B08A 4NCAA 3DLEA 1ZYQA 2XY6A 4IG0A 4C8KA 3IG1A 2QXFA 5CZ1A 3H08A 2NUBA 4E7KA 1BIUA 3SI6A 1GOCA 1LAWA 1SL2A 3TR8A 1WSHA 1UA0A 1DLOA 3RR7A 2E6MA 3QNNA 4C8OA 4DTXA 1TAQA 1VSEA 3U6FA 4CFAA 3OYAA 3NH2A 1RT4A 4M3RA 2W42A 4BDZA 1NJXA 4FJXA 1KTQA 5C24A 3O3HA 4CIGA 4BWMA 1JL2A 3ZSXA 3IS9A 2YHBA 3P83D 3NF7A 3VQCA 2JGUA 4W5TA 3QESA 3C95A 2ZE2A 3D0PA 3VA0A 2XY5A 2D0CA 3AVFA 1S1XA 3I0SA 4FZYA 3L2VA 1T03A 1KRPA 3QEPA 1F21A 1W0HA 3L3UA 5KTQA 1BCMA 3SQ2A 3TABA 4J2BA 3HP6A 2RPIA 4E7LA 1X9MA 4LSNA 3QERA 3HP9A 3RR8A 1WSEA 3LWLA 1RT2A 1WSFA 4JLHA 3VA3A 1BI4B 5KRTA 4K8XA 1VSJA 4CGIA 3AVCA 3KKSA 4E0DA 4KFBA 3AVNA 3ZT0A 3OYKA 1VSMA 3PX0A 4N76A 4CGHA 2OA8A 2YNFA 3JSMA 4M3TA 2O4GA 2QKBA 4RW4A 2QKKA 3V6DA 3DLGA 1EETA 1CXQA 4ELVA 1QSSA 4MFBA 4DFPA 2FC0A 4W5NA 4KREA 3B6PA 3AVIA 3PX6A 4DQIA 4DSKA 4F3OA 4E1MA 3PX4A 1U04A 1TVRA 3FFIA 4XIUA 1SKSA 3ULDA 4LY7A 3SV3A 4OVLA 2X6NA 4AHTA 4CJLA 4BE1A 4O44A 4O0IA 4KAZA 1C1AA 4FLXA 4ELUA 3SQ1A 1S9GA 1ZBFA 3LZIA 3TAFA 3HJFA 4E7JA 2DTUA 3OS0A 1TKTA 4B8AB 4F8RA 4AHCA 4DMNA 4DFKA 2OYQA 4DU4A 3ZT1A 4BE0A 3BGRA 4GW6A 1U47A 3NE6A 3RMAA 2WONA 3MXIA 1KCFA 3C6UA 2RF2A 2GV9A 5J2MA 3QETA 3QINA 4CJRA 3KLHA 4M3WA 4EP5A 3U3GA 1NKEA 1IG9A 3V9UA 1T8EA 3KKRA 1KVCA 3HPOA 4Z4CA 4DFJA 1JKHA 3OYDA 4I2PA 2G8UA 4DQQA 3RTVA 1SKWA 4QAGA 2IDOA 1C1CA 3M8PA 2FBTA 4E3SA 1HRHA 3IRXA 1Q9XA 3MEEA 1XI1A 4KV8A 2FBXA 4N5SA 3DI6A 1NOZA 1Z26A 4IG3A 3LP0A 4Y1CA 4C8NA 4CEDA 2Y1IA 3O4QA 5DK5A 3VQ7A 3OYLA 4DU1A 5HLFA 3HK2A 2AJQA 1RT6A 2G8VA 4Z4GA 3P1GA 2DFEA 3AA4A 1ZBIA 2EX3A 3HVTA 2B4JA 3V9ZA 2HW3A 4DTUA 2HHTA 4E7IA 1SL1A 4NCGA 2HHWA 4DTSA 1S5JA 4ID5A 4LD0A 4HUGA 4FJLA 1A5WA 1S9EA 3AO2A 4LH4A 1KSPA 3A2FA 3SPYA 3PO4A 2HNZA 3ASMA 3WNFA 3L2UA 3SZ2A 4Q5VA 4LH5A 3K57A 3VQPA 3DYAA 1EKEA 1BHLA 1ASVA 1EX4A 4CJ3A 4JRPA 3SUNA 1NK4A 1TK0A 4C8LA 3L2RA 3AO1A 4HCCA 4AH9A 4DS4A 3HPGA 4WE1A 2P1JA 3V81A 3ZSZA 4CF0A 4FLWA 4RW9A 3OS2A 4B9VA 1FXXA 4CIFA 1BQMA 4R5PA 4CJUA 4W5RA 3SUOA 3VQDA 4KB0A 2O4IA 3S3NA 4CHQA 3NCIA 3TARA 1A5VA 1J53A 4Z4HA 2BDPA 1C0MA 1JLQA 5C25A 3PUFA 3NGZA 2YNHA 4CGFA 2P5GA 4Y1DA 4M45A 5HRSA 1VRTA 1ASWA 3CM5A 5HP1A 4O55A 1Q9YA 2D0AA 3L2QA 4BDPA 2YKMA 1RT3A 4KI4A 3D45A 4CJVA 4OPKA 5J1EA 3NF8A 4B9NA 3LPTA 4FJJA 1UAXA 4FM1A 1VSHA 4PY5A 3M8RA 1FKOA 2OPRA 3AVLA 3ZSOA 1ITGA 3V9XA 1NK8A 4BE2A 3IAYA 4FXDA 4W5QA 3EZ5A 1JLGA 3SQ4A 2XHBA 3OYBA 4LSLA 4CEZA 4CJ5A 2WOMA 1LV5A 2ATQA 3OS1A 4DTNA 4DSIA 2G8KA 1XWLA 4KO0A 2HVIA 1JLBA 3HPHA 1WN7A 5T7BA 5EU7A 3LWMA 4B9TA 4HCBA 1JL1A 3SUPA 3NF9A 4CK2A 1RBVA 3RRGA 4CERA 1REVA 2IC3A 4CEQA 3QEVA 4FJ7A 5D3GA 1ASUA 3LPUA 4HUFA 1NK0A 4Z4EA 4OLAA 3DRPA 4CEOA 5K14A 4CHNA 2KW4A 1VK0A 3MEGA 1IKVA 4E89A 3NDKA 1S1UA 3AVMA 2YNGA 1KVBA 1SUQA 3SPZA 1NOYA 4K8ZA 1XHXA 3CFPA 3NBPA 5CZ2A 1TK5A 3EY1A 3KJVA 2Z1GA 4DTMA 3ZSWA 1RT7A 5SZTA 3HT3A 4W5OA 4DTRA 1EXQA 3THVA 3DOKA 4Z0UA 4UQGA 3TANA 2HHVA 3C94A 2VG6A 5HRRA 3HYFA 4OLBA 1J5OA 4PWDA 3EYZA 2IS3A 2GUIA 4IFVA 1S1VA 4CF9A 4FJMA 4H4OA 1VSFA 3V1OA 1J54A 2IGIA 4CEFA 1SV5A 4CJFA 3DOLA 3CYMA 4FW2A 4CESA 4FLVA 1VSLA 1RDBA 1UA1A 4FJKA 3LP2A 2RKIA 3JYTA 3I0RA 1JLFA 3DLBA 4FLTA 4DQRA 4M3YA 4AHVA 2Q3SA 3I8DA 3CM6A 3QEXA 1CXUA 2A1RA 1G15A 4ELTA 1QQCA 1CZ9A 2X78A 4CHYA 3AO5A 4FK4A 1TKXA 1RT5A 1TV6A 4KTWA 5E41A 1NJWA 1D5AA 3ZSYA 4F2RA 4Q0BA 5KI6A 1TKDA 3F9KA 5HRPA 4DSEA 2DY4A 1LWFA 3ZSVA 4CHZA 3QO9A 3AV9A 2ETJA 4CJSA 3K5MA 4KTQA 5KGWA 1NK6A 1RT1A 4FJ8A 4KHUA 4CJTA 4ZTJA 1WSJA 5KGXA 3LAMA 2XY8A 3V1RA 1LAVA 4L8RB 4BDYA 4KPYA 4FLYA 1MU2A 2ZD1A 3P5JA 3LALA 3AVGA 5HRNA 1QTMA 1BQNA 3AVHA 3QLHA 3SV4A 4M3UA 4OKEA 1QS4A 4KKOA 3NGYA 3ZCMA 3ISNC 4O4GA 3BDPA 5SWMA 4FK2A 3WNEA 3VQ6A 4CEBA 2PYLA 1CLQA 4HHTA 1HQUA 1O1WA 4RG8A 4DSFA 2LSNA 5KRSA 4EZ9A 3RWUA 1VSKA 1YT3A 4AHSA 3OYMA 5FRNA 4RW6A 1RTJA 2Z1HA 5DMRA 3SNNA 2IOCA 1X9WA 1LWEA 2FBVA 4OJRA 4F4KA 3ITHA 3UIQA 1YVUA 4N47A 3KLIA 3OYEA 1NJYA 3NF6A 3QEWA 1WAJA 5CYQA 2X6SA 3U3YA 3E01A 2KTQA 1HYSA 4RW7A 4H8KA 3HXMA 3NGIA 2I5JA 1KLMA 4M3ZA 3DLHA 4CFBA 4FW1A 1DTTA 4CECA 1D9DA 4FLUA 2HNDA 2OPQA 3VQ9A 4CJKA 2YNIA 4DF4A 5HROA 3AO3A 3G0ZA 1U49A 1B92A 2FBYA 4PQUA 2E6LA 4IBNA 3CQ8A 3K59A 3K5LA 2D0BA 4B9LA 1CZBA 3KK3A 1TKZA 1WLJA 1HPZA 2E4LA 2PY5A 4DSJA 3V9WA 5HBMA 1S6PA 3K2PA 1RBUA 4M41A 3WNHA 3V9SA 4FJNA 4Z4IA 3F73A 2OPPA 3ZT4A 2HNYA 3TAMA 4EZ6A 1KFSA 1RBRA 1XC9A 3K5NA 1W9HA 4O5BA 4RW8A 4HUEA 4PA1A 2XO7A 1X9SA 2VWKA 3T19A 4FJGA 1UWBA 3QNOA 2OPSA 4ID1A 5JS2A 3SYZA 3CFOA 3RRHA 3S9HA 1L3SA 2F96A 1HQEA 4CK1A 3KTQA 2F8TA 3KLGA 3NH0A 4BWJA 3NHGA 3KIOA 1U45A 3DM2A 2Y1JA 1HJRA 4CHOA 2Z1IA 3L8BA 3PV8A 3DLKA 3AA3A 4CEEA 2HVHA 5C42A 2HHXA 3OYNA 4I9LA 4DTPA 3OYFA 1I39A 2BANA 1L3VA 5J2NA 1BIZA 4CHPA 5J2QA 4CFDA 1TGOA 3ZSRA 3NAEA 4FK0A 2G8IA 3TI0A 1BL3A 1JLAA 4B3OA 1S1WA 1TK8A 1R0AA 3TAPA 1T05A 1L3TA 1IKWA 2VG7A 2D5RA 3AVJA 4CJPA 4DSLA 4AHRA 4CE9A 4HVJA 1RTIA 2BE2A 3L3VA 4CJWA 4CIEA 4OPJA 1IH7A 3M8SA 4CGGA 3HL8A 1U4BA 3O3FA 2PYJA 1BISA 1L5UA 1B9DA 3VQAA 3HSTB 1KFDA 2KFZA 1I3AA 4HTUA 2ITGA 1RBSA 4DS5A 3QIOA 4QCLA 3ALYA 2IAJA 1RTDA 4FVMA 3AVBA 4AILC 2VG5A 4N56A 1RNHA 1Z25A 2DFFA 1TAUA 1J9AA 2P5OA 2YV0X 2YHAA 3WNGA 4AHUA 3LDSA 3VQ4A 3LZJA 3CG7A 3TAQA 3NH1A 4CF8A 2KZMA 1X1PA 4YFUA 2Z1JA 2HB5A 4OGCA 3VQ8A 3OVNA 5JS1A 4BACA 1YTAA 1BGXT 4O0JA 3S3MA 2GBZA 4FLZA 5I42A 4KHWA 4B9UA 1BCOA 2P51A 1JLEA 2RN2A 4CJQA 3OYHA 2XRIA 3OYJA 4IFYA 1RBTA 3VQQA 4FM2A 3RMDA 4CJ4A 3LAKA 1EP4A 4ZHRA 1C0TA 4DU3A 2HHQA 4CK3A 5J2PA 3SUQA 1LW2A 4DQSA 4N41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LP3 A;  4OKK A;  3OY9 A;  1RCH A;  3KD5 E;  3OYC A;  4C8M A;  4DQP A;  4I9Q A;  1N5Y A;  4FM0 A;  3HM9 A;  1GOB A;  1TL3 A;  1NKB A;  4KRF A;  4NYN A;  2YKN A;  4JS4 A;  4ICL A;  4FZX C;  1ZBU A;  1NK9 A;  4E1N A;  3SCX A;  2F8S A;  1RTH A;  1HYV A;  4IKF A;  4G1Q A;  3KK2 A;  3M8Q A;  3KD1 E;  4KHQ A;  1U48 A;  3DRS A;  5FDL A;  5FRO A;  4JRQ A;  1NK7 A;  4GVM A;  4OGE A;  2OZS A;  1C6V A;  4I2Q A;  3OYG A;  3K5O A;  3V4I A;  3T3F A;  2EHG A;  3DLR A;  3V1Q A;  3QIP A;  1ZBH A;  2HHS A;  1D9F A;  1IKY A;  1ZBL A;  1HNV A;  4CF2 A;  4DLG A;  4NCB A;  2A1S A;  2HMI A;  4CCH A;  1WAF A;  4CFC A;  4JS5 A;  3TWH A;  3G10 A;  4I7F A;  1NJZ A;  2ZQB A;  3LAN A;  4GMJ B;  3VQB A;  1KVA A;  4FJ9 A;  1UOC A;  1Y97 A;  1RDA A;  4IDK A;  4DF8 A;  1K6Y A;  4FJH A;  3PY8 A;  2DFH A;  2PZS A;  4E19 A;  1WSG A;  2G8F A;  4DWI A;  4KHS A;  1NKC A;  3ZSQ A;  1Q8I A;  3MAQ A;  1XHZ A;  2BGG A;  2HHU A;  1QE1 A;  2R7Y A;  2X74 A;  4KTZ A;  1L3U A;  3OJS A;  4DLE A;  4FYD A;  4FJI A;  1A5X A;  1FKP A;  1VSI A;  2KZZ A;  2G8W A;  4F2S A;  2JLE A;  4M42 A;  3HO1 A;  3DMJ A;  4NYF A;  3AO4 A;  3KLF A;  4FZZ A;  1NK5 A;  1JLC A;  3CFR A;  4E7H A;  3MEC A;  2G8H A;  4J2A A;  4DFM A;  3RMB A;  4F3T A;  4KB1 A;  4CGD A;  4YNQ A;  3OJU A;  3QEI A;  1TL1 A;  3VN5 A;  1RDD A;  1SKR A;  1T7P A;  4B9M A;  4ZTF A;  4CGJ A;  1C1B A;  3O4N A;  3S3O A;  4PUO A;  4EP4 A;  1YTU A;  1LWC A;  3LP1 A;  3MED A;  2KFN A;  4FCY A;  1FK9 A;  1QHT A;  1HMV A;  1WNS A;  2VWJ A;  1VSD A;  3ZT3 A;  3AVK A;  1S6Q A;  4CJE A;  3TAG A;  1HYZ A;  3B6O A;  3AVA A;  5I3U A;  1N6Q A;  1VRU A;  4DG1 A;  1KLN A;  4B9S A;  3ZT2 A;  1D8Y A;  1QSL A;  4CEA A;  4KHY A;  4KI6 A;  5CY4 A;  2OZM A;  3AA2 A;  3VQE A;  4B8C A;  3DRR A;  3KK1 A;  3RMC A;  1RIL A;  3SJJ A;  1GOA A;  4OKJ A;  3VQ5 A;  3OYI A;  3KLE A;  2XY7 A;  1SL0 A;  4CF1 A;  1QSY A;  2B5J A;  4FJ5 A;  1BI4 A;  1JXE A;  4MQ3 A;  1S1T A;  3T1A A;  3NFA A;  4DTO A;  1IKX A;  3MXM A;  4J2E A;  4DTJ A;  2QK9 A;  3C6T A;  4M3X A;  1B9F A;  1C0U A;  4QOZ B;  3O3G A;  4Z4F A;  3TAE A;  3HVR A;  2B6A A;  3SQ0 A;  1WSI A;  1JXB A;  2KQ2 A;  3AA5 X;  4J2D A;  3MXJ A;  1DTQ A;  1IO2 A;  5CYM A;  3L2W A;  3K58 A;  3PO5 A;  4KHN A;  4TSX A;  5FRM A;  4H4M A;  1RDC A;  1LW0 A;  1HNI A;  4B08 A;  4NCA A;  3DLE A;  1ZYQ A;  2XY6 A;  4IG0 A;  4C8K A;  3IG1 A;  2QXF A;  5CZ1 A;  3H08 A;  2NUB A;  4E7K A;  1BIU A;  3SI6 A;  1GOC A;  1LAW A;  1SL2 A;  3TR8 A;  1WSH A;  1UA0 A;  1DLO A;  3RR7 A;  2E6M A;  3QNN A;  4C8O A;  4DTX A;  1TAQ A;  1VSE A;  3U6F A;  4CFA A;  3OYA A;  3NH2 A;  1RT4 A;  4M3R A;  2W42 A;  4BDZ A;  1NJX A;  4FJX A;  1KTQ A;  5C24 A;  3O3H A;  4CIG A;  4BWM A;  1JL2 A;  3ZSX A;  3IS9 A;  2YHB A;  3P83 D;  3NF7 A;  3VQC A;  2JGU A;  4W5T A;  3QES A;  3C95 A;  2ZE2 A;  3D0P A;  3VA0 A;  2XY5 A;  2D0C A;  3AVF A;  1S1X A;  3I0S A;  4FZY A;  3L2V A;  1T03 A;  1KRP A;  3QEP A;  1F21 A;  1W0H A;  3L3U A;  5KTQ A;  1BCM A;  3SQ2 A;  3TAB A;  4J2B A;  3HP6 A;  2RPI A;  4E7L A;  1X9M A;  4LSN A;  3QER A;  3HP9 A;  3RR8 A;  1WSE A;  3LWL A;  1RT2 A;  1WSF A;  4JLH A;  3VA3 A;  1BI4 B;  5KRT A;  4K8X A;  1VSJ A;  4CGI A;  3AVC A;  3KKS A;  4E0D A;  4KFB A;  3AVN A;  3ZT0 A;  3OYK A;  1VSM A;  3PX0 A;  4N76 A;  4CGH A;  2OA8 A;  2YNF A;  3JSM A;  4M3T A;  2O4G A;  2QKB A;  4RW4 A;  2QKK A;  3V6D A;  3DLG A;  1EET A;  1CXQ A;  4ELV A;  1QSS A;  4MFB A;  4DFP A;  2FC0 A;  4W5N A;  4KRE A;  3B6P A;  3AVI A;  3PX6 A;  4DQI A;  4DSK A;  4F3O A;  4E1M A;  3PX4 A;  1U04 A;  1TVR A;  3FFI A;  4XIU A;  1SKS A;  3ULD A;  4LY7 A;  3SV3 A;  4OVL A;  2X6N A;  4AHT A;  4CJL A;  4BE1 A;  4O44 A;  4O0I A;  4KAZ A;  1C1A A;  4FLX A;  4ELU A;  3SQ1 A;  1S9G A;  1ZBF A;  3LZI A;  3TAF A;  3HJF A;  4E7J A;  2DTU A;  3OS0 A;  1TKT A;  4B8A B;  4F8R A;  4AHC A;  4DMN A;  4DFK A;  2OYQ A;  4DU4 A;  3ZT1 A;  4BE0 A;  3BGR A;  4GW6 A;  1U47 A;  3NE6 A;  3RMA A;  2WON A;  3MXI A;  1KCF A;  3C6U A;  2RF2 A;  2GV9 A;  5J2M A;  3QET A;  3QIN A;  4CJR A;  3KLH A;  4M3W A;  4EP5 A;  3U3G A;  1NKE A;  1IG9 A;  3V9U A;  1T8E A;  3KKR A;  1KVC A;  3HPO A;  4Z4C A;  4DFJ A;  1JKH A;  3OYD A;  4I2P A;  2G8U A;  4DQQ A;  3RTV A;  1SKW A;  4QAG A;  2IDO A;  1C1C A;  3M8P A;  2FBT A;  4E3S A;  1HRH A;  3IRX A;  1Q9X A;  3MEE A;  1XI1 A;  4KV8 A;  2FBX A;  4N5S A;  3DI6 A;  1NOZ A;  1Z26 A;  4IG3 A;  3LP0 A;  4Y1C A;  4C8N A;  4CED A;  2Y1I A;  3O4Q A;  5DK5 A;  3VQ7 A;  3OYL A;  4DU1 A;  5HLF A;  3HK2 A;  2AJQ A;  1RT6 A;  2G8V A;  4Z4G A;  3P1G A;  2DFE A;  3AA4 A;  1ZBI A;  2EX3 A;  3HVT A;  2B4J A;  3V9Z A;  2HW3 A;  4DTU A;  2HHT A;  4E7I A;  1SL1 A;  4NCG A;  2HHW A;  4DTS A;  1S5J A;  4ID5 A;  4LD0 A;  4HUG A;  4FJL A;  1A5W A;  1S9E A;  3AO2 A;  4LH4 A;  1KSP A;  3A2F A;  3SPY A;  3PO4 A;  2HNZ A;  3ASM A;  3WNF A;  3L2U A;  3SZ2 A;  4Q5V A;  4LH5 A;  3K57 A;  3VQP A;  3DYA A;  1EKE A;  1BHL A;  1ASV A;  1EX4 A;  4CJ3 A;  4JRP A;  3SUN A;  1NK4 A;  1TK0 A;  4C8L A;  3L2R A;  3AO1 A;  4HCC A;  4AH9 A;  4DS4 A;  3HPG A;  4WE1 A;  2P1J A;  3V81 A;  3ZSZ A;  4CF0 A;  4FLW A;  4RW9 A;  3OS2 A;  4B9V A;  1FXX A;  4CIF A;  1BQM A;  4R5P A;  4CJU A;  4W5R A;  3SUO A;  3VQD A;  4KB0 A;  2O4I A;  3S3N A;  4CHQ A;  3NCI A;  3TAR A;  1A5V A;  1J53 A;  4Z4H A;  2BDP A;  1C0M A;  1JLQ A;  5C25 A;  3PUF A;  3NGZ A;  2YNH A;  4CGF A;  2P5G A;  4Y1D A;  4M45 A;  5HRS A;  1VRT A;  1ASW A;  3CM5 A;  5HP1 A;  4O55 A;  1Q9Y A;  2D0A A;  3L2Q A;  4BDP A;  2YKM A;  1RT3 A;  4KI4 A;  3D45 A;  4CJV A;  4OPK A;  5J1E A;  3NF8 A;  4B9N A;  3LPT A;  4FJJ A;  1UAX A;  4FM1 A;  1VSH A;  4PY5 A;  3M8R A;  1FKO A;  2OPR A;  3AVL A;  3ZSO A;  1ITG A;  3V9X A;  1NK8 A;  4BE2 A;  3IAY A;  4FXD A;  4W5Q A;  3EZ5 A;  1JLG A;  3SQ4 A;  2XHB A;  3OYB A;  4LSL A;  4CEZ A;  4CJ5 A;  2WOM A;  1LV5 A;  2ATQ A;  3OS1 A;  4DTN A;  4DSI A;  2G8K A;  1XWL A;  4KO0 A;  2HVI A;  1JLB A;  3HPH A;  1WN7 A;  5T7B A;  5EU7 A;  3LWM A;  4B9T A;  4HCB A;  1JL1 A;  3SUP A;  3NF9 A;  4CK2 A;  1RBV A;  3RRG A;  4CER A;  1REV A;  2IC3 A;  4CEQ A;  3QEV A;  4FJ7 A;  5D3G A;  1ASU A;  3LPU A;  4HUF A;  1NK0 A;  4Z4E A;  4OLA A;  3DRP A;  4CEO A;  5K14 A;  4CHN A;  2KW4 A;  1VK0 A;  3MEG A;  1IKV A;  4E89 A;  3NDK A;  1S1U A;  3AVM A;  2YNG A;  1KVB A;  1SUQ A;  3SPZ A;  1NOY A;  4K8Z A;  1XHX A;  3CFP A;  3NBP A;  5CZ2 A;  1TK5 A;  3EY1 A;  3KJV A;  2Z1G A;  4DTM A;  3ZSW A;  1RT7 A;  5SZT A;  3HT3 A;  4W5O A;  4DTR A;  1EXQ A;  3THV A;  3DOK A;  4Z0U A;  4UQG A;  3TAN A;  2HHV A;  3C94 A;  2VG6 A;  5HRR A;  3HYF A;  4OLB A;  1J5O A;  4PWD A;  3EYZ A;  2IS3 A;  2GUI A;  4IFV A;  1S1V A;  4CF9 A;  4FJM A;  4H4O A;  1VSF A;  3V1O A;  1J54 A;  2IGI A;  4CEF A;  1SV5 A;  4CJF A;  3DOL A;  3CYM A;  4FW2 A;  4CES A;  4FLV A;  1VSL A;  1RDB A;  1UA1 A;  4FJK A;  3LP2 A;  2RKI A;  3JYT A;  3I0R A;  1JLF A;  3DLB A;  4FLT A;  4DQR A;  4M3Y A;  4AHV A;  2Q3S A;  3I8D A;  3CM6 A;  3QEX A;  1CXU A;  2A1R A;  1G15 A;  4ELT A;  1QQC A;  1CZ9 A;  2X78 A;  4CHY A;  3AO5 A;  4FK4 A;  1TKX A;  1RT5 A;  1TV6 A;  4KTW A;  5E41 A;  1NJW A;  1D5A A;  3ZSY A;  4F2R A;  4Q0B A;  5KI6 A;  1TKD A;  3F9K A;  5HRP A;  4DSE A;  2DY4 A;  1LWF A;  3ZSV A;  4CHZ A;  3QO9 A;  3AV9 A;  2ETJ A;  4CJS A;  3K5M A;  4KTQ A;  5KGW A;  1NK6 A;  1RT1 A;  4FJ8 A;  4KHU A;  4CJT A;  4ZTJ A;  1WSJ A;  5KGX A;  3LAM A;  2XY8 A;  3V1R A;  1LAV A;  4L8R B;  4BDY A;  4KPY A;  4FLY A;  1MU2 A;  2ZD1 A;  3P5J A;  3LAL A;  3AVG A;  5HRN A;  1QTM A;  1BQN A;  3AVH A;  3QLH A;  3SV4 A;  4M3U A;  4OKE A;  1QS4 A;  4KKO A;  3NGY A;  3ZCM A;  3ISN C;  4O4G A;  3BDP A;  5SWM A;  4FK2 A;  3WNE A;  3VQ6 A;  4CEB A;  2PYL A;  1CLQ A;  4HHT A;  1HQU A;  1O1W A;  4RG8 A;  4DSF A;  2LSN A;  5KRS A;  4EZ9 A;  3RWU A;  1VSK A;  1YT3 A;  4AHS A;  3OYM A;  5FRN A;  4RW6 A;  1RTJ A;  2Z1H A;  5DMR A;  3SNN A;  2IOC A;  1X9W A;  1LWE A;  2FBV A;  4OJR A;  4F4K A;  3ITH A;  3UIQ A;  1YVU A;  4N47 A;  3KLI A;  3OYE A;  1NJY A;  3NF6 A;  3QEW A;  1WAJ A;  5CYQ A;  2X6S A;  3U3Y A;  3E01 A;  2KTQ A;  1HYS A;  4RW7 A;  4H8K A;  3HXM A;  3NGI A;  2I5J A;  1KLM A;  4M3Z A;  3DLH A;  4CFB A;  4FW1 A;  1DTT A;  4CEC A;  1D9D A;  4FLU A;  2HND A;  2OPQ A;  3VQ9 A;  4CJK A;  2YNI A;  4DF4 A;  5HRO A;  3AO3 A;  3G0Z A;  1U49 A;  1B92 A;  2FBY A;  4PQU A;  2E6L A;  4IBN A;  3CQ8 A;  3K59 A;  3K5L A;  2D0B A;  4B9L A;  1CZB A;  3KK3 A;  1TKZ A;  1WLJ A;  1HPZ A;  2E4L A;  2PY5 A;  4DSJ A;  3V9W A;  5HBM A;  1S6P A;  3K2P A;  1RBU A;  4M41 A;  3WNH A;  3V9S A;  4FJN A;  4Z4I A;  3F73 A;  2OPP A;  3ZT4 A;  2HNY A;  3TAM A;  4EZ6 A;  1KFS A;  1RBR A;  1XC9 A;  3K5N A;  1W9H A;  4O5B A;  4RW8 A;  4HUE A;  4PA1 A;  2XO7 A;  1X9S A;  2VWK A;  3T19 A;  4FJG A;  1UWB A;  3QNO A;  2OPS A;  4ID1 A;  5JS2 A;  3SYZ A;  3CFO A;  3RRH A;  3S9H A;  1L3S A;  2F96 A;  1HQE A;  4CK1 A;  3KTQ A;  2F8T A;  3KLG A;  3NH0 A;  4BWJ A;  3NHG A;  3KIO A;  1U45 A;  3DM2 A;  2Y1J A;  1HJR A;  4CHO A;  2Z1I A;  3L8B A;  3PV8 A;  3DLK A;  3AA3 A;  4CEE A;  2HVH A;  5C42 A;  2HHX A;  3OYN A;  4I9L A;  4DTP A;  3OYF A;  1I39 A;  2BAN A;  1L3V A;  5J2N A;  1BIZ A;  4CHP A;  5J2Q A;  4CFD A;  1TGO A;  3ZSR A;  3NAE A;  4FK0 A;  2G8I A;  3TI0 A;  1BL3 A;  1JLA A;  4B3O A;  1S1W A;  1TK8 A;  1R0A A;  3TAP A;  1T05 A;  1L3T A;  1IKW A;  2VG7 A;  2D5R A;  3AVJ A;  4CJP A;  4DSL A;  4AHR A;  4CE9 A;  4HVJ A;  1RTI A;  2BE2 A;  3L3V A;  4CJW A;  4CIE A;  4OPJ A;  1IH7 A;  3M8S A;  4CGG A;  3HL8 A;  1U4B A;  3O3F A;  2PYJ A;  1BIS A;  1L5U A;  1B9D A;  3VQA A;  3HST B;  1KFD A;  2KFZ A;  1I3A A;  4HTU A;  2ITG A;  1RBS A;  4DS5 A;  3QIO A;  4QCL A;  3ALY A;  2IAJ A;  1RTD A;  4FVM A;  3AVB A;  4AIL C;  2VG5 A;  4N56 A;  1RNH A;  1Z25 A;  2DFF A;  1TAU A;  1J9A A;  2P5O A;  2YV0 X;  2YHA A;  3WNG A;  4AHU A;  3LDS A;  3VQ4 A;  3LZJ A;  3CG7 A;  3TAQ A;  3NH1 A;  4CF8 A;  2KZM A;  1X1P A;  4YFU A;  2Z1J A;  2HB5 A;  4OGC A;  3VQ8 A;  3OVN A;  5JS1 A;  4BAC A;  1YTA A;  1BGX T;  4O0J A;  3S3M A;  2GBZ A;  4FLZ A;  5I42 A;  4KHW A;  4B9U A;  1BCO A;  2P51 A;  1JLE A;  2RN2 A;  4CJQ A;  3OYH A;  2XRI A;  3OYJ A;  4IFY A;  1RBT A;  3VQQ A;  4FM2 A;  3RMD A;  4CJ4 A;  3LAK A;  1EP4 A;  4ZHR A;  1C0T A;  4DU3 A;  2HHQ A;  4CK3 A;  5J2P A;  3SUQ A;  1LW2 A;  4DQS A;  4N41 A; 
#chains in the Genus database with same CATH topology
 3OY9 A;  3TU5 A;  1RCH A;  4FWP A;  4JK9 A;  3OYC A;  3IMX A;  4BR9 A;  4DKW A;  4KH4 A;  1J6Z A;  2QWL A;  2YKN A;  4JS4 A;  1QVG M;  4H0V B;  5C2D A;  1RTH A;  5CE3 A;  3BUZ B;  4IKF A;  3KK2 A;  1E4G T;  3DRS A;  4JRQ A;  4GVM A;  4OGE A;  2OZS A;  4I2Q A;  4JEP A;  3K5O A;  3OYG A;  2NLX A;  3C6H A;  3DXK B;  3T3F A;  3DLR A;  3V1Q A;  1ZBH A;  2HHS A;  1D9F A;  5BRD A;  4CF2 A;  1EQY A;  3IKM A;  4DLG A;  2HMI A;  4AM6 A;  4X62 K;  4CCH A;  5F2R A;  3EE9 A;  4BR7 A;  3F5T A;  3LAN A;  3VQB A;  1KVA A;  3IFR A;  1RDA A;  1K6Y A;  4FJH A;  5AQU A;  4E19 A;  4GNI A;  3THW B;  1X9J A;  2G8F A;  2E1Z A;  3DXM B;  1Q8I A;  4YY3 K;  3MAQ A;  1QE1 A;  1L3U A;  3L4Q A;  3H6E A;  3GBT A;  4FWQ A;  4FJI A;  1A5X A;  1FKP A;  1VSI A;  2G8W A;  3HO1 A;  3DMJ A;  4G9Z A;  4J2A A;  2A42 A;  4H5N A;  4F3T A;  3JS6 A;  2QA4 N;  3A5L C;  1TL1 A;  3OHR A;  3VN5 A;  4PUO A;  1YTU A;  3B8A X;  5M1O A;  3LP1 A;  4FCY A;  1FK9 A;  4IOX A;  3BY5 A;  2VWJ A;  3CCV N;  3TAG A;  5M1F A;  3AVA A;  2UUC K;  1CZA N;  4KHY A;  4CEA A;  3CCM N;  2OZM A;  3VQE A;  3SLC A;  4BRA A;  3VQ5 A;  4OKJ A;  3KLE A;  4CF1 A;  3CCS N;  1BI4 A;  3T1A A;  4DTO A;  5AQX A;  1IKX A;  1T6D A;  4YHH K;  4MDA A;  5EY4 A;  4QOZ B;  2QK9 A;  4M3X A;  1C0U A;  4Z4F A;  2KHO A;  1JXB A;  3WT0 A;  4BGA A;  5AJ3 K;  5BR9 A;  4KHN A;  1Q86 O;  2EWS A;  4H0X B;  4JI1 K;  3THY B;  4NCA A;  2QEX N;  3AAR A;  2XY6 A;  4IG0 A;  4DV6 K;  3H08 A;  2E2Q A;  2YX6 A;  3DXM A;  2QWR A;  3U4L A;  3TR8 A;  3P38 A;  2E6M A;  4H5R A;  3U6F A;  3LM9 A;  2W42 A;  5EOY A;  1RT4 A;  4ILJ A;  1QZ5 A;  4PKI A;  3P83 D;  2JGU A;  3QES A;  2ZE2 A;  3ENB A;  2D0C A;  3EN9 A;  1S1X A;  5KPT A;  1QQO A;  3CPE A;  2NRV A;  4CZI A;  5C10 A;  5GAD P;  3L2V A;  1T03 A;  1KRP A;  3QEP A;  4FSV A;  4J2B A;  1BCM A;  1NMN A;  2QXL A;  2UUA K;  4MLE A;  1NGH A;  3VGK A;  3UB5 A;  4DQ8 A;  1X9M A;  3QER A;  4ILG B;  5AZI A;  1BA1 A;  3LDL A;  4CBX A;  4JLH A;  5E26 A;  4K8X A;  3PSF A;  3KKS A;  4E0D A;  3ZT0 A;  4N76 A;  4AQY K;  4HTL A;  3MCA B;  3BZK A;  4M3T A;  1ATN A;  1KC8 O;  3DLG A;  1EET A;  1NU0 A;  3EO3 A;  5AQV A;  3T7Z A;  3DLL L;  1YJN N;  4XH5 A;  3PX6 A;  3BZC A;  1OH7 A;  4IJN A;  3SV3 A;  5IT9 O;  4OVL A;  5AQK A;  4BE1 A;  1N33 K;  3SQ1 A;  1MWM A;  4NLB A;  3LZI A;  2CH6 A;  1GLD G;  3OS0 A;  3CIP A;  2ZF5 O;  4DV1 K;  3K9J A;  2OYQ A;  2UYT A;  3CET A;  1NGE A;  4JD2 A;  4FWN A;  4EP5 A;  3V9U A;  1XUP O;  1KVC A;  4Z4C A;  1C0G A;  4H0Y B;  4E3S A;  3P4I A;  1Q9X A;  4N5S A;  3DI6 A;  3PIP L;  4CED A;  3O4Q A;  4K0K K;  3HK2 A;  4LF7 K;  2G8V A;  2HF3 A;  2EX3 A;  3V9Z A;  2HW3 A;  2UXD K;  2A40 A;  5FPM A;  4HUG A;  3KZB A;  5AZJ A;  1NWK A;  3SPY A;  3ASM A;  4XEI A;  3O5B A;  4JN4 A;  4LF8 K;  3VQP A;  4JRP A;  4WQ4 A;  4BQZ A;  3SAH A;  4DS4 A;  4JHD A;  5C2F A;  3MK6 A;  4W5R A;  5AZJ B;  4GY2 B;  3SUO A;  4PL8 A;  3S3N A;  3NCI A;  3TAR A;  1A5V A;  4Z4H A;  2ASO A;  2YNH A;  4M45 A;  2NRX A;  3CM5 A;  5HP1 A;  4IWV A;  2D0A A;  2YKM A;  2Q31 A;  1RT3 A;  2OAN A;  3O1W A;  4CJV A;  2P9I A;  3IAY A;  3TTC A;  3V9X A;  3NVK A;  1S3X A;  2XHB A;  1ILY A;  4CJ5 A;  1VQP N;  1YIT N;  3OS1 A;  3QB0 A;  1XWL A;  4WQ5 A;  2HVI A;  3HPH A;  3VTH A;  3LWM A;  1VAZ A;  4BRI A;  4CK2 A;  4CER A;  2IC3 A;  4CEQ A;  4FJ7 A;  3KWG A;  1ASU A;  3LPU A;  2A41 A;  3W3D A;  4HUF A;  1NK0 A;  4Y0W A;  3UKR A;  2KW4 A;  5BPN A;  3CCU N;  3TSU A;  5AQZ A;  5CZ2 A;  3E9L A;  3PLA A;  3ZSW A;  5SZT A;  4W5O A;  4JI2 K;  3JAM O;  2VG6 A;  1XMO K;  4PWD A;  3IUC A;  4CF9 A;  4FJM A;  4H4O A;  3V1O A;  1J54 A;  3TSP A;  4FW2 A;  4FLV A;  4FJK A;  4B9Q A;  3LP2 A;  4ISF A;  2WTU A;  2HHH K;  1WUA A;  4M3Y A;  2Q3S A;  3H3O B;  3AO5 A;  1IBM K;  5AQF A;  4FK4 A;  4KTW A;  5HRP A;  3AGK A;  2O8D B;  1RT1 A;  1E3M A;  2A3Z A;  2GWJ A;  4CJT A;  4ZTJ A;  4O8U A;  4BDY A;  1MU2 A;  1T3V A;  1NG9 A;  3QLH A;  1Q7Y O;  5GAG P;  4O4G A;  1VQO N;  4FK2 A;  3J8A A;  3EEQ A;  3FZK A;  3RVC A;  4HHT A;  4RG8 A;  4A5A A;  4EZ9 A;  1NGA A;  3RWU A;  3N4Q A;  1FW6 A;  3R3L A;  5FRN A;  3TTF A;  4ILH A;  1RTJ A;  3THX B;  2P9U A;  1GLJ O;  2IOC A;  4F4K A;  3ITH A;  3CJC A;  4YOV A;  3QEW A;  5CYQ A;  3U3Y A;  3O9Q A;  5AQW A;  3J81 O;  1FJG K;  2E20 A;  3NGI A;  2PAV A;  3SJH A;  4H0O A;  4CFB A;  1DTT A;  2HND A;  2OPQ A;  1HKG A;  3VOV A;  4CJK A;  4OPH A;  2D0P A;  4OO1 J;  1U49 A;  4PQU A;  3K59 A;  2D0B A;  1MDU B;  3G25 A;  4FL9 A;  5HBM A;  1RBU A;  2E5L K;  3I55 N;  3FE1 A;  4A59 A;  3TAM A;  3FZM A;  1KFS A;  4EZ6 A;  1MA9 B;  1RBR A;  1XC9 A;  1W9H A;  4HUE A;  2XO7 A;  2CGK A;  4FJG A;  4X64 K;  3SYZ A;  3HSC A;  3RRH A;  3CFO A;  3S9H A;  1L3S A;  4CK1 A;  4M7Y A;  3NHG A;  3CJ7 A;  3MDQ A;  3UKU B;  1JCF A;  1N36 K;  5DM6 L;  2HVH A;  2HHX A;  3CC7 N;  1OVY A;  4I9L A;  1GLE G;  3ZX0 A;  4CFD A;  1LCU A;  2BUP A;  4NLC A;  5BPM A;  1BDG A;  1JLA A;  3CCQ N;  1NGG A;  2HBL A;  3ENO A;  4CJP A;  4DSL A;  3MN7 A;  4CE9 A;  4KHW A;  4CGG A;  3SBG A;  1L5U A;  2ITG A;  4DHY A;  3ALY A;  2IAJ A;  2PFU A;  1IBL K;  2VG5 A;  4DB3 A;  1RNH A;  1Z25 A;  2DFF A;  2YHA A;  4AHU A;  3VQ4 A;  2QWO A;  4YOW A;  3NH1 A;  1X1P A;  3BEX A;  3C65 A;  3VF2 A;  1GLB G;  4BAC A;  1YTA A;  3VEO A;  1Z6R A;  3ZX3 A;  4FLZ A;  3RTV A;  1JLE A;  3HRG A;  3OYH A;  3VQQ A;  3LAK A;  1H1V A;  4CJ7 A;  4M7X A;  3C7N B;  4ZHR A;  4BRO A;  2YHW A;  2HHQ A;  5J2P A;  1P8Z A;  5GIP A;  1Q18 A;  3SK3 A;  5JVG L;  3G6E N;  3KD5 E;  4C8M A;  4I9Q A;  5AQQ A;  4DV2 K;  1NKB A;  4KRF A;  4NYN A;  4WQ4 C;  2GUP A;  4E1N A;  3SCX A;  2F8S A;  3EL2 A;  3M8Q A;  5JMV A;  4KHQ A;  1U48 A;  5FDL A;  1NK7 A;  3D2E A;  1IG8 A;  4XH4 A;  3K0S A;  4LFA K;  1IKY A;  4IDH A;  2A1S A;  1QZ6 A;  3CME N;  4JKA A;  4B1U B;  1WAF A;  3OBW A;  3G10 A;  4GMJ B;  4K41 A;  4FVU A;  5LMN K;  2PZS A;  4JKH A;  4H5V A;  2E88 A;  4DWI A;  2WFB A;  4KHS A;  1XHZ A;  2BGG A;  4YOX A;  2Q1N A;  2KZZ A;  4M42 A;  2HBK A;  4JAX A;  3KLF A;  4B3M K;  1ATR A;  1JLC A;  2G8H A;  2ZWH A;  1WBD A;  2KLA A;  2NRH A;  5ELZ A;  1DKG D;  4YNQ A;  3OJU A;  3QEI A;  5JLF A;  4CGJ A;  1C1B A;  4PL7 A;  4BRN A;  3AY9 A;  1LWC A;  3MED A;  4FWS A;  1C0F A;  5I3U A;  5GIN A;  4OPA A;  1QSL A;  4KI6 A;  5CY4 A;  3O8M A;  3DRR A;  3KK1 A;  3RMC A;  1RIL A;  3ENH A;  3SJJ A;  2XY7 A;  4H5W A;  2W41 A;  4U67 L;  1JXE A;  1YJW N;  4FJ5 A;  2VGM A;  1S1T A;  1QQN A;  2W6L A;  4V19 S;  3C6T A;  3O3G A;  3M1F A;  3TAE A;  3HVR A;  5AQT A;  2B6A A;  1WSI A;  2KQ2 A;  3K9K A;  4J2D A;  3GE1 A;  5CYM A;  3K58 A;  4H4M A;  1RDC A;  4DV4 K;  1HNI A;  3DLE A;  2HST A;  3O4W A;  1YVN A;  5CZ1 A;  2NUB A;  4BG9 A;  1BIU A;  1SL2 A;  3RR7 A;  3KHY A;  4CFA A;  4FJX A;  1K9M O;  2A5X A;  4CIG A;  4BWM A;  3ZSX A;  2DPN A;  3C95 A;  3D0P A;  3UKR B;  5KPZ A;  4BRE A;  1YIJ N;  1F21 A;  3L3U A;  4AF1 A;  3A5M C;  3TPQ A;  4F9O A;  4LSN A;  3WXL A;  1RT2 A;  4BRP A;  3AVC A;  4KFB A;  3OYK A;  4MO5 A;  2YNF A;  1VHX A;  3LL3 A;  4GVE A;  1T44 A;  4ELV A;  1QSS A;  1KAZ A;  4W5N A;  4DQI A;  3O6W A;  4DSK A;  1U04 A;  4IEE A;  3CCE N;  4LY7 A;  3T1Y K;  4CJL A;  5M1Q A;  3EKU A;  4O44 A;  4KAZ A;  3NVM A;  1C1A A;  4FLX A;  4ELU A;  1S9G A;  3TAF A;  3HOT A;  3THX A;  4DU4 A;  3BGR A;  4BVO A;  1U47 A;  1M90 O;  2WON A;  2P9P B;  3C6U A;  2RF2 A;  4A62 A;  5J2M A;  3QET A;  3KLH A;  3EKS A;  1NKE A;  3KKR A;  2O8B A;  3OYD A;  4PKG A;  2G8U A;  4DQQ A;  4WYB A;  1C1C A;  1HRH A;  1IBK K;  3AGR A;  4KV8 A;  3VPZ A;  1KAX A;  4KPY A;  4Y1C A;  3LP0 A;  2Y1I A;  4DU1 A;  3HI0 A;  5M1P A;  4BRM A;  2DFE A;  4B1X B;  1ZBI A;  1HLU A;  2HBM A;  2B4J A;  4DTU A;  1SL1 A;  4NCG A;  2HHW A;  4BRH A;  4DV3 K;  4FJL A;  1S9E A;  1KSP A;  3PO4 A;  3L2U A;  1P90 A;  3SZ2 A;  4Q5V A;  3DYA A;  4CJ3 A;  2W40 A;  3SUN A;  1TK0 A;  5FPN A;  3L2R A;  4AH9 A;  3ZEU B;  3HPG A;  4WE1 A;  4R79 A;  3I8B A;  1XMQ K;  4RW9 A;  3OS2 A;  2P9N B;  4R5P A;  4CJU A;  3VQD A;  2O4I A;  4BGB A;  2BDP A;  1C0M A;  5C25 A;  2GWK A;  5E84 A;  3P31 A;  4IJA A;  5BRE A;  5ADX H;  4BDP A;  4OPK A;  1T6C A;  1WOQ A;  2IVN A;  4FM1 A;  3M8R A;  3O9T A;  3AVL A;  2E2O A;  1XNR K;  3BF1 A;  3WQT A;  3SQ4 A;  4YOR A;  4CEZ A;  3KVG A;  1XC3 A;  2ATQ A;  3R9P A;  4DSI A;  2F9T A;  5I9E B;  5BR8 K;  2G8K A;  4IXC A;  3SUP A;  3NF9 A;  1RBV A;  1REV A;  2BTF A;  4CHN A;  3NDK A;  3GG4 A;  5K14 A;  1T7P A;  1VK0 A;  3MEG A;  4E89 A;  1KVB A;  4BR5 A;  1SUQ A;  3WXJ A;  4DR7 K;  1XHX A;  1TK5 A;  4GV3 A;  4DTM A;  1E4F T;  4NXN K;  1M1K O;  4H03 B;  3FZH A;  4DR3 K;  4DTR A;  3DOK A;  4Z0U A;  2O8E A;  3H46 O;  3CCL N;  5C0Y A;  2IGI A;  4LF5 K;  4CEF A;  1SV5 A;  3DOL A;  3CYM A;  4O5F A;  1UA1 A;  3I0R A;  3QML A;  4FLT A;  1ZXO A;  4BC5 A;  3I8D A;  2A1R A;  1CXU A;  1OKJ A;  1G15 A;  1QQC A;  1CZ9 A;  4CHY A;  1TKX A;  1VQ8 N;  1NJW A;  4IEI A;  3ZSY A;  1NM1 A;  4CZF A;  4F2R A;  4Q0B A;  1TKD A;  3ZET A;  2DY4 A;  4CHZ A;  4KH6 A;  4KTQ A;  1NGD A;  1NK6 A;  5HOO A;  1Y64 A;  1ZBS A;  3LAM A;  3V1R A;  1LAV A;  4FPA A;  4CD3 A;  3P5J A;  3LAL A;  2FF6 A;  5JVH L;  4KKO A;  5SWM A;  1NBW A;  2PYL A;  2P9P A;  3L0Q A;  4DSF A;  4BVP A;  4LF4 K;  4AHS A;  3SNN A;  2WC9 A;  5DMR A;  2Z1H A;  3UIQ A;  4N47 A;  4U7B A;  3OYE A;  3F9M A;  3NF6 A;  4RW7 A;  4H8K A;  3HXM A;  4FW1 A;  2ZGZ A;  1D9D A;  4JV5 K;  4JHD B;  4DF4 A;  1YUW A;  4EFH A;  3SMP A;  2QWN A;  2HBJ A;  2YHX A;  3K5L A;  1QQM A;  2YHY A;  2PY5 A;  4DSJ A;  4Z4I A;  1S6P A;  3K2P A;  3V9S A;  2NRR A;  4JI5 K;  2E2P A;  4BRK A;  3J7Y P;  4BRL A;  3R1X A;  1K8A O;  4RW8 A;  3A0I X;  3D2E B;  1X9S A;  4CZG A;  1NJI O;  2NNW A;  2OPS A;  5JS2 A;  1HQE A;  5GIO A;  4L3Q A;  3NH0 A;  1EO1 A;  2IVP A;  1QVF M;  1HX1 A;  2UU9 K;  1HJR A;  4HWI A;  3L8B A;  4CEE A;  5C42 A;  3UE5 A;  3OYN A;  4DTP A;  3OYF A;  5FPE A;  1BIZ A;  5J2Q A;  4FK0 A;  3ZSR A;  3F2K A;  3G71 N;  1S1W A;  3TAP A;  1IKW A;  5AQP A;  4HVJ A;  1RTI A;  3L3V A;  4BRG A;  4OPJ A;  1U4B A;  3RSE B;  3E66 A;  3S41 A;  1B9D A;  1I3A A;  4HTU A;  4DS5 A;  1HNX K;  1RTD A;  3AVB A;  4AIL C;  3D2F B;  4N56 A;  1TAU A;  1GLA G;  2YV0 X;  3WNG A;  2P5O A;  1HNZ K;  1KXP A;  2NRT A;  3LZJ A;  4GKJ K;  3O1B A;  4CF8 A;  1WB9 A;  4CVN E;  4FWM A;  2Z1J A;  2HB5 A;  3VQ8 A;  5JS1 A;  5A2Q O;  3CJA A;  2P9L B;  4B9U A;  2QWP A;  4JKE A;  4K25 A;  3A8Y A;  1RBT A;  4CJ4 A;  4YOT A;  1C0T A;  3IDH A;  1OH8 A;  3SUQ A;  4DQS A;  4N41 A;  3LP3 A;  2P9L A;  4DQP A;  1N8R O;  3CC4 N;  5KPR A;  4DV5 K;  1GOB A;  1NLV A;  1TL3 A;  3ID6 A;  4ICL A;  1NK9 A;  3KD1 E;  3AAQ A;  3U8X A;  5FRO A;  1C6V A;  1BO5 O;  1NNE A;  4DUY K;  5AQO A;  2ZJR L;  2EHG A;  4RCH A;  5AR0 A;  1ZBL A;  4NCB A;  4X65 K;  3SMS A;  2VYP A;  4CFC A;  4JS5 A;  3TWH A;  1K73 O;  1U2V A;  4JI3 K;  2ZQB A;  3U9D A;  1GLF O;  4FJ9 A;  5AQN A;  1Y97 A;  4DF8 A;  4BR2 A;  4PKH A;  3PY8 A;  1WSG A;  4JKG B;  1NKC A;  4O8K A;  3ZSQ A;  2O8B B;  2R7Y A;  2X74 A;  3FFK B;  3E9O A;  3ZEU A;  1U2V B;  4F2S A;  2JLE A;  4CZM A;  1NK5 A;  3ULE B;  4E7H A;  1X3M A;  3MEC A;  1OH6 A;  1SZ2 A;  3RMB A;  2ZGY A;  4KB1 A;  3GL1 A;  4CGD A;  1RDD A;  1SKR A;  4B9M A;  3O4N A;  3S3O A;  4FPB A;  3H1V X;  2KFN A;  4BC3 A;  2F7T A;  5EXW A;  1QHT A;  2YJE A;  1HMV A;  1WNS A;  1VSD A;  3ZT3 A;  1S6Q A;  4CJE A;  1HYZ A;  3B6O A;  4B9S A;  4JNE A;  2O8D A;  3ZT2 A;  2OCE A;  3MN5 A;  4JKB A;  4C1N I;  3LDO A;  1GOA A;  2QWM A;  1SL0 A;  3CC2 N;  3MN9 A;  2BH1 A;  1QSY A;  1RFQ A;  2QW9 A;  4JI7 K;  5GAH P;  4J2E A;  3NFA A;  1NMD A;  3VEX A;  3ZLJ A;  4KBO A;  1B9F A;  1NGI A;  4Z94 A;  3SQ0 A;  1DTQ A;  1IO2 A;  3L2W A;  3PO5 A;  5BN8 A;  4WFN L;  4JI6 K;  3G4S N;  1LW0 A;  1Q82 O;  4B08 A;  1NGC A;  2OTL N;  4C8K A;  2QXF A;  3WXI A;  3QIC A;  4CZK A;  1GOC A;  1LAW A;  1WSH A;  1UA0 A;  1DLO A;  4C8O A;  4DTX A;  1ZC6 A;  4BDZ A;  3NH2 A;  4M3R A;  1KTQ A;  5C24 A;  3O3H A;  4B1Z A;  1JL2 A;  2YHB A;  3VQC A;  3PIO L;  3MMV A;  3I0S A;  3P39 A;  4FZY A;  1GLC G;  4FWK A;  1W0H A;  3TAB A;  2UUB K;  3HP6 A;  2RPI A;  4DV0 K;  4FWL A;  3HP9 A;  5EVZ A;  3LWL A;  2P9N A;  3WQU A;  5KRT A;  2HF4 A;  1VSJ A;  1TYQ A;  1VSM A;  4CGH A;  2OA8 A;  2IIR A;  2QKB A;  1CXQ A;  5IWA K;  4B3S K;  2J4R A;  4MFB A;  4DFP A;  4DUZ K;  3AVI A;  3O9S A;  1BOT O;  1SKS A;  2X6N A;  4O0I A;  3HJF A;  4FWR A;  3SAG A;  1TKT A;  4AHC A;  4DMN A;  4DFK A;  3D6R A;  2QWQ A;  4BE0 A;  1KAY A;  5ADX A;  3RMA A;  3MXI A;  1KCF A;  4EIA A;  2GV9 A;  3QIN A;  4M3W A;  3U3G A;  4BC4 A;  4I2P A;  1SKW A;  2IDO A;  3M8P A;  2FBT A;  3VTI A;  5JIC A;  4QS7 A;  3IRX A;  4CBW A;  4CZJ A;  2FBX A;  4IG3 A;  4BRD A;  4C8N A;  5HLF A;  5DK5 A;  3THW A;  1RT6 A;  4Z4G A;  3AA4 A;  4ISE A;  2VQE K;  5AQI A;  2O8C B;  1RGI A;  2FF3 B;  5EX5 A;  4ID5 A;  3QDK A;  3ULE A;  1A5W A;  3AO2 A;  3L4I A;  2H3G X;  4GV9 A;  2GTD A;  1EX4 A;  1BHL A;  2VGN A;  1NK4 A;  2GEL A;  4HCC A;  3AO1 A;  4CBU A;  2CH5 A;  3FR0 A;  2P1J A;  5TKW A;  3V81 A;  3ZSZ A;  1N32 K;  4CF0 A;  1FXX A;  4CIF A;  1BQM A;  2Q0R A;  4CHQ A;  1J53 A;  1JLQ A;  3PUF A;  1VRT A;  1X3N A;  3VGM A;  5AFU A;  3D45 A;  4KI4 A;  5J1E A;  3NF8 A;  4B9N A;  1UAX A;  4BE2 A;  1K8K B;  4W5Q A;  3HM8 A;  3HZ6 A;  3EZ5 A;  3VEV A;  1BWF O;  4K43 A;  4LSL A;  2QI2 A;  4DTN A;  1VQ5 N;  2ASM A;  4KO0 A;  1JLB A;  5MLC Q;  1WN7 A;  5T7B A;  3CQX A;  5EU7 A;  4B9T A;  4HCB A;  1JL1 A;  5TKY A;  1ESV A;  3CJ9 A;  3RRG A;  4GKK K;  1W97 L;  4Z4E A;  3DRP A;  1IKV A;  1S1U A;  3AVM A;  2VQF K;  1BA0 A;  2FSJ A;  3OTO K;  1NOY A;  1VQM N;  4K8Z A;  2P9S A;  2NZT A;  3CFP A;  4H5T A;  1OH5 A;  2VWB A;  3M3Z A;  1G99 A;  1RT7 A;  3ATV A;  4WFA L;  3THV A;  5C15 A;  4UQG A;  3TSQ A;  2UXB K;  4JI4 K;  4BR4 A;  4OLB A;  3EYZ A;  2GUI A;  4IFV A;  1VSF A;  4AM7 A;  2GX9 A;  4CJF A;  1NGF A;  1VSL A;  2FSK A;  3JYT A;  2RKI A;  3AAP A;  3DLB A;  4DR5 K;  4DQR A;  4AHV A;  2FSN A;  3QEX A;  3CM6 A;  5LJV A;  3J80 O;  1YAG A;  1RT5 A;  2P9K B;  5E41 A;  5KI6 A;  2FLO A;  5LY3 A;  3ZSV A;  3QO9 A;  3AV9 A;  3K5M A;  5KGW A;  1K8K A;  3ATU A;  4KHU A;  4CZL A;  1WSJ A;  2V7Y A;  3DAW A;  4OX9 K;  3UKU A;  1HJO A;  1BQN A;  3SV4 A;  1KQS M;  4M3U A;  2E2N A;  4IFE A;  3VET A;  3NGY A;  3VQ6 A;  4CEB A;  2Q0U A;  2PBD A;  2O8F A;  1O1W A;  3CPW M;  5KRS A;  3DXK A;  2GEM A;  3A5O C;  3VEW A;  3O9U A;  1VSK A;  1YT3 A;  3OYM A;  1X9W A;  1LWE A;  4OJR A;  1YVU A;  4H0T B;  5BRF A;  2V52 B;  2X6S A;  2I5J A;  4M3Z A;  4CEC A;  4FLU A;  2P9U B;  1IV0 A;  3FGU A;  5C12 A;  5BPL A;  2D1K A;  3BF3 A;  3ZET B;  2FBY A;  4IBN A;  3LM2 A;  3CQ8 A;  4DR2 K;  3T1H K;  1CZB A;  3KK3 A;  1WLJ A;  1HPZ A;  1EWR A;  3V9W A;  4M41 A;  3WNH A;  3DJC A;  1NGJ A;  2OPP A;  2I7P A;  2HOE A;  2HNY A;  2AA4 A;  4JK7 A;  3T19 A;  4A61 A;  1UWB A;  3QNO A;  1U6Z A;  1ATS A;  3BP8 A;  2F96 A;  1TUY A;  3KK7 A;  3H3N O;  3KIO A;  3DM2 A;  2Y1J A;  3PV8 A;  3DLK A;  2BAN A;  1L3V A;  2UXC K;  4CHP A;  2G8I A;  1TGO A;  2ZJQ L;  3TI0 A;  2CGJ A;  1DEJ A;  2NRZ A;  4A2B A;  4GV6 A;  3N4P A;  3WXM B;  2Q2R A;  1L3T A;  2VG7 A;  2D5R A;  3AVJ A;  4AHR A;  3M8S A;  2BE2 A;  4CJW A;  4PY5 A;  4CIE A;  4JK8 A;  1IH7 A;  2PYJ A;  1KFD A;  1JJ2 M;  1RBS A;  3QIO A;  3CJ1 A;  3W0L A;  4BR0 A;  1TYQ B;  3LDS A;  2W6K A;  4LF9 K;  4WCE L;  4YDU C;  3VEZ A;  2KZM A;  4OGC A;  1BGX T;  4O0J A;  4JI0 K;  3S3M A;  2ZJP L;  4QS8 A;  5I42 A;  1BCO A;  1IJJ A;  4MLH A;  4CJQ A;  2P51 A;  2RN2 A;  4FM2 A;  4IFY A;  1LOT B;  4DV7 K;  5M1N A;  1EP4 A;  3I33 A;  3VGL A;  3KWI A;  4CK3 A;  4WF9 L;  3LDP A;  1HUX A;  4OLA A;  1SQK A;  4OKK A;  4UY8 O;  3WEE A;  1N5Y A;  4FM0 A;  3HM9 A;  3LDQ A;  2Q36 A;  4NO7 A;  4DCH A;  4FZX C;  4BRQ A;  1ZBU A;  1HYV A;  5AQS A;  4G1Q A;  4BY9 C;  3HBT A;  3VES A;  3V4I A;  1VQ9 N;  3QIP A;  1VQL N;  3QFP A;  1W2B M;  5AQY A;  2RE2 A;  1HNV A;  5KQ8 A;  3CF5 L;  2QTD A;  4BQL A;  4I7F A;  1NJZ A;  1RDW X;  5AQL A;  1UOC A;  2I7N A;  4IDK A;  5BRH A;  2DFH A;  4YOU A;  4B3T K;  2HHU A;  4KTZ A;  3CQY A;  3OJS A;  2O8E B;  1HR0 K;  4DLE A;  4FYD A;  1D4X A;  4YDU A;  4MDB A;  4NYF A;  3AO4 A;  4FZZ A;  3CFR A;  3VF6 A;  4CD1 A;  4DFM A;  3L6Q A;  2YI1 A;  1YF5 L;  2P9S B;  1YXQ A;  4NXM K;  3C7N A;  5KQD A;  4ZTF A;  2V51 B;  4EP4 A;  5H1S Q;  1R59 O;  3AVK A;  2HMP A;  1N6Q A;  1VRU A;  3ZYY X;  3O80 A;  4DG1 A;  1KLN A;  1D8Y A;  2JWK A;  3ZX2 A;  5JLH A;  3AA2 A;  2WUS A;  4B8C A;  4IOA L;  5F1X A;  1J5E K;  3OYI A;  2B5J A;  3FZF A;  3GOI A;  1YJ9 N;  4MQ3 A;  3MXM A;  4JD2 B;  4MO4 A;  3VER A;  3SAF A;  4DTJ A;  1S22 A;  3AA5 X;  4YOY A;  3R6M A;  3MXJ A;  4H0P A;  4LF6 K;  2CGL A;  1Z05 A;  4ISG A;  4TSX A;  5FRM A;  3VEN A;  5FLX O;  2NRW A;  1ZYQ A;  2E1Y A;  2V7Z A;  3DWL A;  5FPD A;  3IG1 A;  4E7K A;  4WFB L;  3SI6 A;  4DR6 K;  3QBW A;  5B8H A;  1SAZ A;  1VQ4 N;  3QNN A;  1TAQ A;  1VSE A;  5CR4 A;  3OYA A;  3CCJ N;  1NJX A;  2E8A A;  2ITM A;  3CXC M;  1HKB A;  3IS9 A;  1OVQ A;  3NF7 A;  4W5T A;  3OA9 A;  3VA0 A;  2XY5 A;  3AVF A;  3SQ2 A;  5KTQ A;  3RSE A;  4E7L A;  3RR8 A;  1WSE A;  2F4V K;  3R8E A;  3CJB A;  2ZM6 K;  1WSF A;  3VA3 A;  1BI4 B;  3D7E O;  4J8F A;  4CGI A;  3AVN A;  3PX0 A;  4XH1 A;  1V4T A;  3JSM A;  2O4G A;  4RW4 A;  2QKK A;  3V6D A;  4I6M B;  1MWK A;  2F9W A;  1QHA A;  2FC0 A;  4KRE A;  3CCR N;  3B6P A;  1KD1 O;  4F3O A;  4CZE A;  4E1M A;  4E1J A;  3PX4 A;  1TVR A;  3FFI A;  4XIU A;  5M1K A;  3ULD A;  4EAH D;  4RWT A;  4AHT A;  4JYA K;  5F0X A;  1ZBF A;  1XQS C;  4E7J A;  4LC9 B;  2DTU A;  4B8A B;  4F8R A;  3ZT1 A;  5AFU H;  4GW6 A;  5DM7 L;  3M5R A;  3NE6 A;  4CJR A;  4JKG A;  3MN6 A;  1BG3 A;  1IG9 A;  1T8E A;  2YJF A;  3HPO A;  4DFJ A;  1JKH A;  4WQ5 C;  1GLL O;  4QAG A;  3MWP A;  1WBB A;  3MEE A;  1XI1 A;  4FOI A;  2JWL A;  1NOZ A;  1Z26 A;  3NMU A;  4LFB K;  3OYL A;  3VQ7 A;  3E9P A;  2AJQ A;  3WUH A;  3P1G A;  3EE8 A;  3HVT A;  3E1Y A;  2HHT A;  4E7I A;  4DTS A;  1S5J A;  5LJW A;  5AQH A;  4LD0 A;  4KH5 A;  4DR1 K;  4LH4 A;  3MX2 A;  3A2F A;  2HNZ A;  3WNF A;  3J7Z O;  3FZL A;  4LH5 A;  3K57 A;  1JCG A;  1EKE A;  1ASV A;  4C8L A;  3ID8 A;  3J7A P;  1W7A A;  3OBY A;  4A2A A;  1VQ6 N;  4IO9 L;  4FLW A;  5AQJ A;  5AQR A;  4B9V A;  2VCP A;  3TTD A;  4KB0 A;  2P5G A;  3JXU A;  3NGZ A;  4CGF A;  4Y1D A;  5HRS A;  1ASW A;  3T69 A;  4O55 A;  1Q9Y A;  3L2Q A;  3H45 C;  1VQK N;  3LPT A;  4FJJ A;  1VSH A;  1FKO A;  2OPR A;  3PSI A;  3ZSO A;  1ITG A;  1NK8 A;  4BC2 A;  4FXD A;  4JKC A;  1JLG A;  3C0B A;  3OYB A;  2WOM A;  1YI2 N;  1LV5 A;  1HNW K;  4CZH A;  5GAE P;  1SS6 A;  5AQG A;  1V4S A;  1JCE A;  5D3G A;  3QEV A;  4CEO A;  3MX5 A;  4FO0 A;  2YNG A;  3SPZ A;  3CD6 N;  3CHW A;  3I56 N;  3NBP A;  1XNQ K;  3EY1 A;  3KJV A;  2Z1G A;  5BN9 A;  1BU6 O;  4BG8 A;  3HT3 A;  1TUU A;  1EXQ A;  3TAN A;  3QBX A;  2HHV A;  3C94 A;  3QFU A;  5HRR A;  3HYF A;  1J5O A;  2IS3 A;  1VQN N;  1S1V A;  1N34 K;  4DR4 K;  1BUP A;  1O13 A;  2AP1 A;  4A57 A;  4CES A;  1RDB A;  3GDQ A;  1JLF A;  3CER A;  3VF4 A;  3OW2 M;  3C6A A;  4ELT A;  2X78 A;  3HOS A;  3FLC O;  1TV6 A;  1NGB A;  1D5A A;  5CHI A;  4NB4 A;  3F9K A;  4DSE A;  1LWF A;  2ETJ A;  4CJS A;  4BRF A;  4FJ8 A;  4CW7 B;  5KGX A;  2XY8 A;  4X66 K;  4L8R B;  2RHK A;  4JKD A;  4FLY A;  2ZD1 A;  3AVG A;  5HRN A;  2FXU A;  1QTM A;  3AVH A;  4OKE A;  1QS4 A;  3MWT A;  1DT9 A;  3ISN C;  3O08 A;  3VEY A;  3ZCM A;  3LDN A;  3BDP A;  3WNE A;  1CLQ A;  1HQU A;  2LSN A;  1VQ7 N;  4IOC L;  1RDU A;  5LL6 Z;  4RTF D;  4RW6 A;  3H1Q A;  2FBV A;  4JKF A;  3A5N C;  2ASP A;  5AZI B;  3KLI A;  1NJY A;  1YHQ N;  2YCH A;  1WAJ A;  3E01 A;  2KTQ A;  3WXK A;  1HYS A;  3CI5 A;  2Q97 A;  1KLM A;  3DLH A;  4A5B A;  5LMU K;  2KKZ A;  3VQ9 A;  2YNI A;  5HRO A;  2A6A A;  3AO3 A;  3G0Z A;  1B92 A;  4FOE A;  2E6L A;  4B1Y B;  3SBT A;  1HPM A;  1S72 N;  2D0O A;  4B9L A;  1TKZ A;  2E4L A;  4KHP K;  4FJN A;  4LFC K;  3F73 A;  2OTJ N;  2O8C A;  3ZT4 A;  4C23 A;  4QS9 A;  3K5N A;  4O5B A;  4PA1 A;  4EHT A;  2VWK A;  4IO8 A;  4BRC A;  4B1W B;  4ID1 A;  3KTQ A;  4M63 C;  2F8T A;  3KLG A;  4BWJ A;  4CHO A;  2Z1I A;  2QM1 A;  4I6M A;  3AA3 A;  2D4W A;  1I94 K;  4CI6 A;  1I39 A;  3Q7C A;  2IVO A;  4B1V A;  5J2N A;  3THY A;  3WEE B;  3NAE A;  1BL3 A;  4JI8 K;  1HKC A;  4B3O A;  3U9Z A;  5AQM A;  1TK8 A;  1Q81 O;  1R0A A;  1DGK N;  1T05 A;  3VMF B;  1EWQ A;  3O9R A;  2P9I B;  3HL8 A;  3M6G A;  3O3F A;  1BIS A;  3VQA A;  3HST B;  2KFZ A;  4K42 A;  4QCL A;  4FWO A;  4FVM A;  2O8F B;  4PHT X;  4IZ9 A;  1J9A A;  3Q7B A;  3CG7 A;  3TAQ A;  2WBN A;  4YFU A;  5HL7 L;  3EZW A;  3OVN A;  3D2F A;  2GBZ A;  4B3R K;  3RMD A;  2XRI A;  3OYJ A;  3HTV A;  3MCP A;  4C1N K;  3CMA N;  4DU3 A;  2P9K A;  4EHU A;  1LW2 A;  1U45 A; 
#chains in the Genus database with same CATH homology
 3LP3 A;  4OKK A;  3OY9 A;  1RCH A;  3KD5 E;  3OYC A;  4C8M A;  4DQP A;  4I9Q A;  1N5Y A;  4FM0 A;  3HM9 A;  1GOB A;  1TL3 A;  1NKB A;  4KRF A;  4NYN A;  2YKN A;  4JS4 A;  4ICL A;  4FZX C;  1ZBU A;  1NK9 A;  4E1N A;  3SCX A;  2F8S A;  1RTH A;  1HYV A;  4IKF A;  4G1Q A;  3KK2 A;  3M8Q A;  3KD1 E;  4KHQ A;  1U48 A;  3DRS A;  5FDL A;  5FRO A;  4JRQ A;  1NK7 A;  4GVM A;  4OGE A;  2OZS A;  1C6V A;  4I2Q A;  3OYG A;  3K5O A;  3V4I A;  3T3F A;  2EHG A;  3DLR A;  3V1Q A;  3QIP A;  1ZBH A;  2HHS A;  1D9F A;  1IKY A;  1ZBL A;  1HNV A;  4CF2 A;  4DLG A;  4NCB A;  2A1S A;  2HMI A;  4CCH A;  1WAF A;  4CFC A;  4JS5 A;  3TWH A;  3G10 A;  4I7F A;  1NJZ A;  2ZQB A;  3LAN A;  4GMJ B;  3VQB A;  1KVA A;  4FJ9 A;  1UOC A;  1Y97 A;  1RDA A;  4IDK A;  4DF8 A;  1K6Y A;  4FJH A;  3PY8 A;  2DFH A;  2PZS A;  4E19 A;  1WSG A;  2G8F A;  4DWI A;  4KHS A;  1NKC A;  3ZSQ A;  1Q8I A;  3MAQ A;  1XHZ A;  2BGG A;  2HHU A;  1QE1 A;  2R7Y A;  2X74 A;  4KTZ A;  1L3U A;  3OJS A;  4DLE A;  4FYD A;  4FJI A;  1A5X A;  1FKP A;  1VSI A;  2KZZ A;  2G8W A;  4F2S A;  2JLE A;  4M42 A;  3HO1 A;  3DMJ A;  4NYF A;  3AO4 A;  3KLF A;  4FZZ A;  1NK5 A;  1JLC A;  3CFR A;  4E7H A;  3MEC A;  2G8H A;  4J2A A;  4DFM A;  3RMB A;  4F3T A;  4KB1 A;  4CGD A;  4YNQ A;  3OJU A;  3QEI A;  1TL1 A;  3VN5 A;  1RDD A;  1SKR A;  1T7P A;  4B9M A;  4ZTF A;  4CGJ A;  1C1B A;  3O4N A;  3S3O A;  4PUO A;  4EP4 A;  1YTU A;  1LWC A;  3LP1 A;  3MED A;  2KFN A;  4FCY A;  1FK9 A;  1QHT A;  1HMV A;  1WNS A;  2VWJ A;  1VSD A;  3ZT3 A;  3AVK A;  1S6Q A;  4CJE A;  3TAG A;  1HYZ A;  3B6O A;  3AVA A;  5I3U A;  1N6Q A;  1VRU A;  4DG1 A;  1KLN A;  4B9S A;  3ZT2 A;  1D8Y A;  1QSL A;  4CEA A;  4KHY A;  4KI6 A;  5CY4 A;  2OZM A;  3AA2 A;  3VQE A;  4B8C A;  3DRR A;  3KK1 A;  3RMC A;  1RIL A;  3SJJ A;  1GOA A;  4OKJ A;  3VQ5 A;  3OYI A;  3KLE A;  2XY7 A;  1SL0 A;  4CF1 A;  1QSY A;  2B5J A;  4FJ5 A;  1BI4 A;  1JXE A;  4MQ3 A;  1S1T A;  3T1A A;  3NFA A;  4DTO A;  1IKX A;  3MXM A;  4J2E A;  4DTJ A;  2QK9 A;  3C6T A;  4M3X A;  1B9F A;  1C0U A;  4QOZ B;  3O3G A;  4Z4F A;  3TAE A;  3HVR A;  2B6A A;  3SQ0 A;  1WSI A;  1JXB A;  2KQ2 A;  3AA5 X;  4J2D A;  3MXJ A;  1DTQ A;  1IO2 A;  5CYM A;  3L2W A;  3K58 A;  3PO5 A;  4KHN A;  4TSX A;  5FRM A;  4H4M A;  1RDC A;  1LW0 A;  1HNI A;  4B08 A;  4NCA A;  3DLE A;  1ZYQ A;  2XY6 A;  4IG0 A;  4C8K A;  3IG1 A;  2QXF A;  5CZ1 A;  3H08 A;  2NUB A;  4E7K A;  1BIU A;  3SI6 A;  1GOC A;  1LAW A;  1SL2 A;  3TR8 A;  1WSH A;  1UA0 A;  1DLO A;  3RR7 A;  2E6M A;  3QNN A;  4C8O A;  4DTX A;  1TAQ A;  1VSE A;  3U6F A;  4CFA A;  3OYA A;  3NH2 A;  1RT4 A;  4M3R A;  2W42 A;  4BDZ A;  1NJX A;  4FJX A;  1KTQ A;  5C24 A;  3O3H A;  4CIG A;  4BWM A;  1JL2 A;  3ZSX A;  3IS9 A;  2YHB A;  3P83 D;  3NF7 A;  3VQC A;  2JGU A;  4W5T A;  3QES A;  3C95 A;  2ZE2 A;  3D0P A;  3VA0 A;  2XY5 A;  2D0C A;  3AVF A;  1S1X A;  3I0S A;  4FZY A;  3L2V A;  1T03 A;  1KRP A;  3QEP A;  1F21 A;  1W0H A;  3L3U A;  5KTQ A;  1BCM A;  3SQ2 A;  3TAB A;  4J2B A;  3HP6 A;  2RPI A;  4E7L A;  1X9M A;  4LSN A;  3QER A;  3HP9 A;  3RR8 A;  1WSE A;  3LWL A;  1RT2 A;  1WSF A;  4JLH A;  3VA3 A;  1BI4 B;  5KRT A;  4K8X A;  1VSJ A;  4CGI A;  3AVC A;  3KKS A;  4E0D A;  4KFB A;  3AVN A;  3ZT0 A;  3OYK A;  1VSM A;  3PX0 A;  4N76 A;  4CGH A;  2OA8 A;  2YNF A;  3JSM A;  4M3T A;  2O4G A;  2QKB A;  4RW4 A;  2QKK A;  3V6D A;  3DLG A;  1EET A;  1CXQ A;  4ELV A;  1QSS A;  4MFB A;  4DFP A;  2FC0 A;  4W5N A;  4KRE A;  3B6P A;  3AVI A;  3PX6 A;  4DQI A;  4DSK A;  4F3O A;  4E1M A;  3PX4 A;  1U04 A;  1TVR A;  3FFI A;  4XIU A;  1SKS A;  3ULD A;  4LY7 A;  3SV3 A;  4OVL A;  2X6N A;  4AHT A;  4CJL A;  4BE1 A;  4O44 A;  4O0I A;  4KAZ A;  1C1A A;  4FLX A;  4ELU A;  3SQ1 A;  1S9G A;  1ZBF A;  3LZI A;  3TAF A;  3HJF A;  4E7J A;  2DTU A;  3OS0 A;  1TKT A;  4B8A B;  4F8R A;  4AHC A;  4DMN A;  4DFK A;  2OYQ A;  4DU4 A;  3ZT1 A;  4BE0 A;  3BGR A;  4GW6 A;  1U47 A;  3NE6 A;  3RMA A;  2WON A;  3MXI A;  1KCF A;  3C6U A;  2RF2 A;  2GV9 A;  5J2M A;  3QET A;  3QIN A;  4CJR A;  3KLH A;  4M3W A;  4EP5 A;  3U3G A;  1NKE A;  1IG9 A;  3V9U A;  1T8E A;  3KKR A;  1KVC A;  3HPO A;  4Z4C A;  4DFJ A;  1JKH A;  3OYD A;  4I2P A;  2G8U A;  4DQQ A;  3RTV A;  1SKW A;  4QAG A;  2IDO A;  1C1C A;  3M8P A;  2FBT A;  4E3S A;  1HRH A;  3IRX A;  1Q9X A;  3MEE A;  1XI1 A;  4KV8 A;  2FBX A;  4N5S A;  3DI6 A;  1NOZ A;  1Z26 A;  4IG3 A;  3LP0 A;  4Y1C A;  4C8N A;  4CED A;  2Y1I A;  3O4Q A;  5DK5 A;  3VQ7 A;  3OYL A;  4DU1 A;  5HLF A;  3HK2 A;  2AJQ A;  1RT6 A;  2G8V A;  4Z4G A;  3P1G A;  2DFE A;  3AA4 A;  1ZBI A;  2EX3 A;  3HVT A;  2B4J A;  3V9Z A;  2HW3 A;  4DTU A;  2HHT A;  4E7I A;  1SL1 A;  4NCG A;  2HHW A;  4DTS A;  1S5J A;  4ID5 A;  4LD0 A;  4HUG A;  4FJL A;  1A5W A;  1S9E A;  3AO2 A;  4LH4 A;  1KSP A;  3A2F A;  3SPY A;  3PO4 A;  2HNZ A;  3ASM A;  3WNF A;  3L2U A;  3SZ2 A;  4Q5V A;  4LH5 A;  3K57 A;  3VQP A;  3DYA A;  1EKE A;  1BHL A;  1ASV A;  1EX4 A;  4CJ3 A;  4JRP A;  3SUN A;  1NK4 A;  1TK0 A;  4C8L A;  3L2R A;  3AO1 A;  4HCC A;  4AH9 A;  4DS4 A;  3HPG A;  4WE1 A;  2P1J A;  3V81 A;  3ZSZ A;  4CF0 A;  4FLW A;  4RW9 A;  3OS2 A;  4B9V A;  1FXX A;  4CIF A;  1BQM A;  4R5P A;  4CJU A;  4W5R A;  3SUO A;  3VQD A;  4KB0 A;  2O4I A;  3S3N A;  4CHQ A;  3NCI A;  3TAR A;  1A5V A;  1J53 A;  4Z4H A;  2BDP A;  1C0M A;  1JLQ A;  5C25 A;  3PUF A;  3NGZ A;  2YNH A;  4CGF A;  2P5G A;  4Y1D A;  4M45 A;  5HRS A;  1VRT A;  1ASW A;  3CM5 A;  5HP1 A;  4O55 A;  1Q9Y A;  2D0A A;  3L2Q A;  4BDP A;  2YKM A;  1RT3 A;  4KI4 A;  3D45 A;  4CJV A;  4OPK A;  5J1E A;  3NF8 A;  4B9N A;  3LPT A;  4FJJ A;  1UAX A;  4FM1 A;  1VSH A;  4PY5 A;  3M8R A;  1FKO A;  2OPR A;  3AVL A;  3ZSO A;  1ITG A;  3V9X A;  1NK8 A;  4BE2 A;  3IAY A;  4FXD A;  4W5Q A;  3EZ5 A;  1JLG A;  3SQ4 A;  2XHB A;  3OYB A;  4LSL A;  4CEZ A;  4CJ5 A;  2WOM A;  1LV5 A;  2ATQ A;  3OS1 A;  4DTN A;  4DSI A;  2G8K A;  1XWL A;  4KO0 A;  2HVI A;  1JLB A;  3HPH A;  1WN7 A;  5T7B A;  5EU7 A;  3LWM A;  4B9T A;  4HCB A;  1JL1 A;  3SUP A;  3NF9 A;  4CK2 A;  1RBV A;  3RRG A;  4CER A;  1REV A;  2IC3 A;  4CEQ A;  3QEV A;  4FJ7 A;  5D3G A;  1ASU A;  3LPU A;  4HUF A;  1NK0 A;  4Z4E A;  4OLA A;  3DRP A;  4CEO A;  5K14 A;  4CHN A;  2KW4 A;  1VK0 A;  3MEG A;  1IKV A;  4E89 A;  3NDK A;  1S1U A;  3AVM A;  2YNG A;  1KVB A;  1SUQ A;  3SPZ A;  1NOY A;  4K8Z A;  1XHX A;  3CFP A;  3NBP A;  5CZ2 A;  1TK5 A;  3EY1 A;  3KJV A;  2Z1G A;  4DTM A;  3ZSW A;  1RT7 A;  5SZT A;  3HT3 A;  4W5O A;  4DTR A;  1EXQ A;  3THV A;  3DOK A;  4Z0U A;  4UQG A;  3TAN A;  2HHV A;  3C94 A;  2VG6 A;  5HRR A;  3HYF A;  4OLB A;  1J5O A;  4PWD A;  3EYZ A;  2IS3 A;  2GUI A;  4IFV A;  1S1V A;  4CF9 A;  4FJM A;  4H4O A;  1VSF A;  3V1O A;  1J54 A;  2IGI A;  4CEF A;  1SV5 A;  4CJF A;  3DOL A;  3CYM A;  4FW2 A;  4CES A;  4FLV A;  1VSL A;  1RDB A;  1UA1 A;  4FJK A;  3LP2 A;  2RKI A;  3JYT A;  3I0R A;  1JLF A;  3DLB A;  4FLT A;  4DQR A;  4M3Y A;  4AHV A;  2Q3S A;  3I8D A;  3CM6 A;  3QEX A;  1CXU A;  2A1R A;  1G15 A;  4ELT A;  1QQC A;  1CZ9 A;  2X78 A;  4CHY A;  3AO5 A;  4FK4 A;  1TKX A;  1RT5 A;  1TV6 A;  4KTW A;  5E41 A;  1NJW A;  1D5A A;  3ZSY A;  4F2R A;  4Q0B A;  5KI6 A;  1TKD A;  3F9K A;  5HRP A;  4DSE A;  2DY4 A;  1LWF A;  3ZSV A;  4CHZ A;  3QO9 A;  3AV9 A;  2ETJ A;  4CJS A;  3K5M A;  4KTQ A;  5KGW A;  1NK6 A;  1RT1 A;  4FJ8 A;  4KHU A;  4CJT A;  4ZTJ A;  1WSJ A;  5KGX A;  3LAM A;  2XY8 A;  3V1R A;  1LAV A;  4L8R B;  4BDY A;  4KPY A;  4FLY A;  1MU2 A;  2ZD1 A;  3P5J A;  3LAL A;  3AVG A;  5HRN A;  1QTM A;  1BQN A;  3AVH A;  3QLH A;  3SV4 A;  4M3U A;  4OKE A;  1QS4 A;  4KKO A;  3NGY A;  3ZCM A;  3ISN C;  4O4G A;  3BDP A;  5SWM A;  4FK2 A;  3WNE A;  3VQ6 A;  4CEB A;  2PYL A;  1CLQ A;  4HHT A;  1HQU A;  1O1W A;  4RG8 A;  4DSF A;  2LSN A;  5KRS A;  4EZ9 A;  3RWU A;  1VSK A;  1YT3 A;  4AHS A;  3OYM A;  5FRN A;  4RW6 A;  1RTJ A;  2Z1H A;  5DMR A;  3SNN A;  2IOC A;  1X9W A;  1LWE A;  2FBV A;  4OJR A;  4F4K A;  3ITH A;  3UIQ A;  1YVU A;  4N47 A;  3KLI A;  3OYE A;  1NJY A;  3NF6 A;  3QEW A;  1WAJ A;  5CYQ A;  2X6S A;  3U3Y A;  3E01 A;  2KTQ A;  1HYS A;  4RW7 A;  4H8K A;  3HXM A;  3NGI A;  2I5J A;  1KLM A;  4M3Z A;  3DLH A;  4CFB A;  4FW1 A;  1DTT A;  4CEC A;  1D9D A;  4FLU A;  2HND A;  2OPQ A;  3VQ9 A;  4CJK A;  2YNI A;  4DF4 A;  5HRO A;  3AO3 A;  3G0Z A;  1U49 A;  1B92 A;  2FBY A;  4PQU A;  2E6L A;  4IBN A;  3CQ8 A;  3K59 A;  3K5L A;  2D0B A;  4B9L A;  1CZB A;  3KK3 A;  1TKZ A;  1WLJ A;  1HPZ A;  2E4L A;  2PY5 A;  4DSJ A;  3V9W A;  5HBM A;  1S6P A;  3K2P A;  1RBU A;  4M41 A;  3WNH A;  3V9S A;  4FJN A;  4Z4I A;  3F73 A;  2OPP A;  3ZT4 A;  2HNY A;  3TAM A;  4EZ6 A;  1KFS A;  1RBR A;  1XC9 A;  3K5N A;  1W9H A;  4O5B A;  4RW8 A;  4HUE A;  4PA1 A;  2XO7 A;  1X9S A;  2VWK A;  3T19 A;  4FJG A;  1UWB A;  3QNO A;  2OPS A;  4ID1 A;  5JS2 A;  3SYZ A;  3CFO A;  3RRH A;  3S9H A;  1L3S A;  2F96 A;  1HQE A;  4CK1 A;  3KTQ A;  2F8T A;  3KLG A;  3NH0 A;  4BWJ A;  3NHG A;  3KIO A;  1U45 A;  3DM2 A;  2Y1J A;  1HJR A;  4CHO A;  2Z1I A;  3L8B A;  3PV8 A;  3DLK A;  3AA3 A;  4CEE A;  2HVH A;  5C42 A;  2HHX A;  3OYN A;  4I9L A;  4DTP A;  3OYF A;  1I39 A;  2BAN A;  1L3V A;  5J2N A;  1BIZ A;  4CHP A;  5J2Q A;  4CFD A;  1TGO A;  3ZSR A;  3NAE A;  4FK0 A;  2G8I A;  3TI0 A;  1BL3 A;  1JLA A;  4B3O A;  1S1W A;  1TK8 A;  1R0A A;  3TAP A;  1T05 A;  1L3T A;  1IKW A;  2VG7 A;  2D5R A;  3AVJ A;  4CJP A;  4DSL A;  4AHR A;  4CE9 A;  4HVJ A;  1RTI A;  2BE2 A;  3L3V A;  4CJW A;  4CIE A;  4OPJ A;  1IH7 A;  3M8S A;  4CGG A;  3HL8 A;  1U4B A;  3O3F A;  2PYJ A;  1BIS A;  1L5U A;  1B9D A;  3VQA A;  3HST B;  1KFD A;  2KFZ A;  1I3A A;  4HTU A;  2ITG A;  1RBS A;  4DS5 A;  3QIO A;  4QCL A;  3ALY A;  2IAJ A;  1RTD A;  4FVM A;  3AVB A;  4AIL C;  2VG5 A;  4N56 A;  1RNH A;  1Z25 A;  2DFF A;  1TAU A;  1J9A A;  2P5O A;  2YV0 X;  2YHA A;  3WNG A;  4AHU A;  3LDS A;  3VQ4 A;  3LZJ A;  3CG7 A;  3TAQ A;  3NH1 A;  4CF8 A;  2KZM A;  1X1P A;  4YFU A;  2Z1J A;  2HB5 A;  4OGC A;  3VQ8 A;  3OVN A;  5JS1 A;  4BAC A;  1YTA A;  1BGX T;  4O0J A;  3S3M A;  2GBZ A;  4FLZ A;  5I42 A;  4KHW A;  4B9U A;  1BCO A;  2P51 A;  1JLE A;  2RN2 A;  4CJQ A;  3OYH A;  2XRI A;  3OYJ A;  4IFY A;  1RBT A;  3VQQ A;  4FM2 A;  3RMD A;  4CJ4 A;  3LAK A;  1EP4 A;  4ZHR A;  1C0T A;  4DU3 A;  2HHQ A;  4CK3 A;  5J2P A;  3SUQ A;  1LW2 A;  4DQS A;  4N41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...