1JXBA

I53a, a point mutant of the cysteine-free variant of e. coli rnase hi
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
152
Chain Sequence
KQVEIFTDGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAAVALEALKEHAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Propagation of a single destabilizing mutation throughout the Escherichia coli ribonuclease HI native state.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 48
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jxbA00
2WONA 1JLCA 4FJ5A 4DWIA 2GV9A 3DYAA 3MEGA 4KI6A 1SL0A 2HHQA 4KTZA 4CIEA 4E1NA 2DY4A 4KHWA 3LZJA 4ZTJA 4M3TA 5HROA 1WSHA 2FBXA 4IFVA 1RBSA 3AVLA 3NBPA 3TARA 5J1EA 4QOZB 1RT6A 2XY6A 4E3SA 1SKWA 1RT3A 4E89A 2Z1GA 5K14A 3V1RA 3DLRA 3V9WA 3S3MA 4FJ9A 2PYLA 2LSNA 2P5OA 4FJGA 3ZT4A 3TAMA 1T7PA 4CESA 3OYBA 3ZSZA 4M3UA 1Z26A 3I0SA 3L3UA 3F73A 3IS9A 4OPJA 1X9WA 4FK2A 4CGGA 1NK6A 3OVNA 3SUOA 1SL1A 4RG8A 3QLHA 1FKOA 1BI4A 5CZ2A 3U6FA 1KVAA 1JLEA 4OLAA 3F9KA 4CJTA 1NJXA 4O4GA 1EETA 1KFDA 2D0BA 1B92A 3NF6A 4CHPA 1UOCA 4OJRA 4B8CA 3DI6A 1SKRA 2XHBA 1RTIA 2KQ2A 3KLEA 3L3VA 1WAJA 3NH1A 4DFMA 4KB0A 4W5TA 3RMAA 5D3GA 2KW4A 3NF8A 3PO5A 1HQEA 3HJFA 3NH0A 4B9SA 3M8RA 5CYMA 3ASMA 3K5LA 4B9LA 5HP1A 4BE0A 4RW6A 4DTUA 1A5XA 3AA2A 4BDYA 4DTOA 2E6MA 2IGIA 4DQIA 1EXQA 4OKKA 1ASWA 1BHLA 2DTUA 1C6VA 4DTXA 1T03A 2YHAA 1VSEA 3DOLA 4FJ7A 1W9HA 1KLMA 1C1AA 4FJNA 3LAMA 4W5OA 3C95A 1RDDA 3P5JA 4C8MA 1S1TA 3VQ7A 5HRRA 2XO7A 3K59A 3K5MA 4CHQA 3L2RA 3KIOA 1FK9A 4Q5VA 1K6YA 1ZBFA 3O4NA 3K5NA 4W5NA 1NOZA 1EX4A 4CJ3A 4HHTA 2X6SA 3L2WA 4KPYA 1L3UA 4DQSA 3OS0A 2I5JA 3VQ8A 1C1BA 3LWMA 2HVHA 2FC0A 2OZSA 4HUFA 4AHVA 1KVCA 3TAGA 1QTMA 4FM2A 4OVLA 1IKXA 4CGFA 4DQRA 3SZ2A 1FXXA 4DTPA 3LP1A 4FXDA 1RBRA 1SV5A 3NAEA 5T7BA 3O3HA 1TKTA 4YFUA 4IDKA 4FLXA 4CF8A 1HYSA 3VQPA 1ASUA 3IRXA 4KTQA 1D8YA 4FJKA 2F8TA 4CK1A 3DLBA 1IKVA 3OYKA 2R7YA 4CEZA 4CJWA 4E19A 4JRPA 4AHSA 1VSJA 4ELTA 1GOBA 3QO9A 4FJJA 4FW2A 4PA1A 2G8FA 1D5AA 4CGDA 4BWMA 3MAQA 3B6OA 2HVIA 2P5GA 1F21A 2B5JA 2XRIA 1U04A 1R0AA 3AVHA 2HHUA 4CJKA 1QSSA 1J9AA 3AA5X 3AO4A 4ICLA 3HXMA 1WAFA 2O4IA 4WE1A 3HSTB 4F2SA 2G8HA 4Y1CA 1LWFA 1RBTA 3SQ4A 4DMNA 3SCXA 2FBVA 3AO5A 1EKEA 1YTAA 4CEAA 3ZSWA 3LP0A 4F4KA 2ZQBA 5CZ1A 4XIUA 2PZSA 3P83D 3SPZA 3OYLA 2YKMA 4IFYA 1ZBIA 2HHSA 1NKBA 4UQGA 3K5OA 1BL3A 1NK8A 4FLVA 4JLHA 1LWCA 4BDZA 4FLYA 1VK0A 3NF7A 2RF2A 3K2PA 3VQ5A 4W5RA 4KHNA 4Z4EA 1S5JA 4H4OA 5KGWA 3RTVA 2Z1JA 4CJPA 3RMBA 3V9SA 4GMJB 4FM1A 1MU2A 3TAQA 1T8EA 1RT2A 1IKYA 2VG6A 3DRRA 4ZHRA 5HRPA 5CY4A 3NHGA 4LH5A 2HNYA 1TKDA 1KSPA 4LY7A 4PWDA 2AJQA 1RTJA 4OGEA 2KZZA 1XC9A 4ZTFA 4QAGA 2D5RA 2HNZA 1RT7A 1HNVA 2IC3A 1TL1A 2QKBA 4Z4GA 1RTDA 3HP6A 3DOKA 4IKFA 1S1XA 2KFZA 3HYFA 4OGCA 3AO3A 3QNOA 3OS2A 3ZT0A 5J2MA 3OJSA 2IS3A 5CYQA 1TVRA 1JLFA 2OPRA 4IG3A 3QESA 4I7FA 4CERA 1GOCA 3WNHA 4CHOA 3AO1A 3JSMA 2ETJA 4J2BA 1WSJA 1VSHA 5FRNA 3DRSA 2F8SA 4CJLA 4CECA 1NK9A 3NF9A 3HO1A 1NK0A 3NGYA 4DS5A 1NJZA 1UAXA 1ZBUA 5J2PA 3RRGA 1RCHA 4CF0A 3V1OA 3VQQA 3KK3A 3WNFA 4N47A 4KHSA 2G8WA 3ZSRA 4N5SA 4CEQA 1Y97A 4DFJA 1LAVA 2ITGA 4CFAA 4IG0A 3L2VA 1JKHA 3DLHA 4Z4CA 5C24A 3O4QA 5FDLA 5HBMA 1D9FA 3PO4A 4FJXA 4FJ8A 3QEWA 3HL8A 4LD0A 3HVTA 1XI1A 3V4IA 4FZYA 2YV0X 4RW4A 1XHZA 1J5OA 4KFBA 3VQ4A 3LPUA 1TK0A 4K8XA 1TKZA 3EYZA 3QETA 2OA8A 4HCCA 1ZBLA 1YTUA 5DK5A 4NYFA 4O0IA 3TAEA 4CHZA 2QKKA 5DMRA 3ISNC 3OYNA 3SUQA 1U47A 4RW8A 4DTRA 2YHBA 3RR8A 1VSIA 2HHXA 1TV6A 2OPSA 3SQ2A 3SNNA 4CJ4A 1S1UA 3QNNA 4CK3A 3QEXA 4FJLA 3P1GA 1JLBA 1CZBA 4FZZA 1WNSA 4R5PA 3HT3A 1BIZA 3SPYA 1NOYA 1VRUA 1ASVA 2RPIA 3ZCMA 4CGJA 3ZSVA 3KJVA 1NK7A 1IG9A 1HRHA 4B3OA 3T19A 3HPOA 4DU3A 2EX3A 1B9DA 1I39A 4FJIA 2DFFA 2IAJA 3H08A 1KCFA 4FLTA 2HHVA 4CK2A 4HTUA 3OYJA 4CCHA 3OY9A 1HYZA 3PX0A 1RBVA 2FBTA 2YNGA 3DRPA 3HP9A 5HRNA 1VSDA 1CLQA 4OKEA 1RDAA 2IOCA 4PY5A 3JYTA 2GBZA 3AA4A 3TABA 3QIOA 3MXJA 4FYDA 4BE2A 3B6PA 1X9SA 1LWEA 1RDCA 1ITGA 3VQEA 3S9HA 2HMIA 3C6UA 1LV5A 4EZ6A 3O3GA 5HLFA 1DTTA 3HM9A 4CJEA 4DLEA 2HHWA 1JXBA 4JRQA 3RR7A 4B8AB 4KKOA 5KRSA 2G8KA 4FW1A 1BCMA 1B9FA 4CF9A 3D45A 3CQ8A 1L5UA 3ZT1A 4HCBA 3L2UA 3PUFA 3NH2A 3TAPA 3IG1A 1VSMA 4H4MA 2OPQA 4W5QA 4BWJA 3VQ6A 3HPGA 2ZE2A 1HYVA 1DLOA 3AVAA 4I9LA 3VQAA 3AVIA 1KFSA 4KTWA 4Z4IA 1A5VA 3LPTA 2DFEA 4HVJA 3S3NA 3KKSA 3RMDA 5KTQA 4B08A 4CFCA 2BGGA 3SQ1A 2HB5A 2FBYA 4DQQA 2XY8A 2ZD1A 1WN7A 3C6TA 3DMJA 4DF8A 4I9QA 1S9GA 1NK4A 4B9UA 3M8SA 3OYIA 3AA3A 1X9MA 4C8LA 3FFIA 2G8VA 2OPPA 4CJFA 3KLIA 3UIQA 3TANA 5EU7A 2XY5A 1SKSA 1KRPA 3TR8A 2D0AA 1CZ9A 2KFNA 1YT3A 3ZSOA 3L8BA 4O5BA 2HNDA 4Z0UA 3MXIA 4DLGA 1RBUA 2P51A 4E7KA 3LALA 3KKRA 1TAUA 2VWJA 2RN2A 1N6QA 1JLQA 3TI0A 3AVCA 5KI6A 2JLEA 1BIUA 4CE9A 4O0JA 5SWMA 3LDSA 3OYMA 4DU1A 1WLJA 1KLNA 2E4LA 3RMCA 1NK5A 2OYQA 4F2RA 3VA3A 1A5WA 1VRTA 2Y1IA 1QSLA 2QK9A 4DTJA 3AVKA 4BE1A 3EY1A 1KTQA 3VQ9A 1CXUA 3OYFA 4Y1DA 1Q9XA 4OLBA 3NFAA 3MEDA 4FK4A 1BI4B 3WNGA 1SL2A 4QCLA 1IKWA 1BISA 3AVJA 4MQ3A 3ULDA 4BACA 3LAKA 1Q8IA 3M8PA 4CJSA 4CF2A 3PX6A 2P1JA 4O55A 4FCYA 3V9XA 5KGXA 1BGXT 1JLAA 1LAWA 3ALYA 4AHRA 3AV9A 4DSEA 2YNFA 1L3VA 3QERA 4CF1A 4DU4A 1YVUA 5J2NA 1S9EA 4M45A 1L3TA 4FJMA 4HUGA 5J2QA 1BCOA 4LSLA 3VA0A 4KB1A 3V1QA 4NCAA 4KI4A 4E0DA 1JXEA 2Z1IA 1JL1A 3DLGA 4O44A 2Y1JA 1UWBA 4FVMA 2YNHA 1U4BA 4GW6A 4MFBA 1DTQA 3DLEA 4CIFA 4DSIA 4NCBA 4DFKA 1D9DA 1L3SA 4M3YA 2W42A 1EP4A 4DTMA 3QEIA 5E41A 4YNQA 3SV3A 3PY8A 4ELVA 2E6LA 3K57A 2PYJA 4AH9A 4NCGA 1QHTA 3CG7A 1FKPA 5HRSA 3CFOA 3OS1A 4DS4A 4E7IA 1WSGA 4M3XA 4JS5A 3VN5A 3AVMA 3LP2A 4KV8A 3QINA 2WOMA 3QIPA 4CEFA 3AO2A 3OYEA 3ITHA 1HMVA 4ID1A 4M3RA 1IO2A 3SYZA 1C0UA 1TAQA 1I3AA 3V9ZA 1O1WA 3OYCA 3I0RA 1U45A 1U49A 1S1VA 3NCIA 3SI6A 3VQBA 3S3OA 1BQMA 1QQCA 1REVA 3AVGA 1C0MA 1HQUA 3NDKA 2BANA 1VSLA 4CEDA 3K58A 3LWLA 3NE6A 1ZBHA 4CIGA 3AVNA 1G15A 3SUNA 4FJHA 3V6DA 1QE1A 2IDOA 1HJRA 3OYGA 3M8QA 4M41A 5JS2A 2YKNA 4DF4A 2X6NA 1BQNA 2OZMA 4K8ZA 2KZMA 4KO0A 3SJJA 3A2FA 1UA0A 1TKXA 3QEPA 2KTQA 3CFRA 3BDPA 4FM0A 1RILA 1J54A 2VG7A 4DFPA 4N41A 4ELUA 4G1QA 3EZ5A 4CHYA 4DTNA 3HVRA 3SV4A 4E7JA 3D0PA 4EZ9A 3KK2A 4BDPA 3OYHA 4J2DA 3T1AA 1RT1A 3LP3A 1GOAA 4CEEA 5SZTA 4CGHA 3O3FA 2RKIA 1U48A 1C0TA 2NUBA 3TWHA 3THVA 4F3TA 3AVBA 4B9MA 1T05A 1LW0A 1TGOA 3SUPA 1ZYQA 1Q9YA 1QS4A 3RRHA 3T3FA 3WNEA 3VQCA 4AHCA 2Z1HA 1S6PA 3LANA 4CEOA 1S1WA 1IH7A 1UA1A 2ATQA 5JS1A 3CFPA 4JS4A 3V81A 4KHUA 2A1SA 1HNIA 3VQDA 2VWKA 2G8IA 3U3YA 5I3UA 4LSNA 3KLHA 4KAZA 3ZSYA 4E1MA 3G0ZA 4CHNA 2PY5A 3HK2A 4DSJA 1J53A 1RT4A 4KHYA 2D0CA 4N76A 1TK8A 1RT5A 1X1PA 1NKEA 3SQ0A 4HUEA 3OYAA 1NJWA 4Z4HA 2XY7A 3G10A 4Q0BA 1NKCA 4FLZA 4CJVA 3OJUA 4DSKA 1JL2A 2DFHA 4OKJA 1W0HA 1N5YA 4M42A 4LH4A 4KREA 1WSIA 2VG5A 4B9NA 4J2EA 3KK1A 4AHUA 4CJ5A 3DM2A 4CJRA 3LZIA 3V9UA 3ZT3A 1CXQA 4C8NA 2GUIA 5FROA 2Q3SA 3AVFA 4CFBA 1TK5A 4FK0A 4J2AA 2O4GA 4CFDA 3KD5E 1KVBA 3KD1E 4DSFA 1XHXA 2X74A 5I42A 3IAYA 3MECA 1RNHA 4AHTA 5C42A 3RWUA 1JLGA 1Z25A 1S6QA 4NYNA 1VSKA 3KLGA 4E7LA 4EP4A 4DSLA 3C94A 3DLKA 5KRTA 3CM6A 3PX4A 3U3GA 1QSYA 4RW9A 1NJYA 4PQUA 3NGZA 2A1RA 4I2PA 3ZSXA 4EP5A 4Z4FA 4GVMA 1LW2A 2F96A 3HPHA 2B6AA 3OYDA 2G8UA 1VSFA 3CM5A 2X78A 1WSFA 4CEBA 4CGIA 5FRMA 4FLWA 3ZSQA 3PV8A 4PUOA 3I8DA 3MEEA 2YNIA 4FLUA 3NGIA 4KRFA 2JGUA 1WSEA 4L8RB 4M3ZA 3KLFA 4FZXC 4C8OA 4I2QA 2HW3A 1SUQA 1TL3A 3KTQA 4C8KA 4DG1A 1HPZA 4AILC 4N56A 2BDPA 2HHTA 2QXFA 4RW7A 4TSXA 3ZT2A 2EHGA 3CYMA 4CJQA 4M3WA 4B9TA 3MXMA 5C25A 1C1CA 4KHQA 3TAFA 3BGRA 1XWLA 1RTHA 3E01A 2B4JA 4CJUA 3QEVA 4DQPA 4IBNA 3L2QA 4H8KA 4DTSA 1RDBA 4OPKA 4B9VA 4ID5A 2BE2A 4F3OA 4F8RA 4E7HA
chains in the Genus database with same CATH superfamily
2P9KB 1SL0A 5LL6Z 2WC9A 3H3NO 5J1EA 1SZ2A 5K14A 4LF8K 3ZT4A 1HKBA 5BR9A 4BRNA 4CESA 4MDBA 3F73A 3O4WA 1X9WA 1XUPO 5EY4A 5A2QO 3SUOA 4RG8A 1CZAN 3U6FA 1KVAA 1FJGK 3F9KA 4EFHA 2D0BA 3DI6A 2ZM6K 3WXMB 2FXUA 4H03B 3KLEA 1WAJA 3NH1A 4KB0A 1VQ5N 4NLCA 3PO5A 3EE9A 1DEJA 3HJFA 3VEOA 4FWRA 3ASMA 5GIOA 4B9LA 4WF9L 5C15A 5JVHL 4BE0A 4U7BA 1A5XA 2QI2A 1K73O 2O8FB 4DV0K 3UKUB 3UKRB 2ZJQL 3LAMA 4BRQA 3C95A 1RDDA 3K59A 3QETA 2HF4A 1QVFM 3AAQA 3OW2M 3THYB 5BPLA 3L2WA 4DQSA 2YHYA 1IBMK 2FC0A 3H46O 4IJNA 3DXMB 3CMEN 3P39A 3GOIA 4AM6A 4DTPA 3NAEA 4YFUA 4CF8A 1KAZA 2VCPA 3IRXA 1D8YA 3DLBA 1ZC6A 4BGAA 3OYKA 4JK8A 4CEZA 2JWKA 1E4GT 3QO9A 4JI4K 3QBXA 4FJJA 1ZBSA 2D0OA 5LMUK 2XRIA 2HHUA 3AVHA 1QSSA 2OCEA 1J9AA 3HXMA 4BRCA 3FLCO 3TTFA 4BRFA 4F2SA 1LWFA 3MN9A 2CH6A 2ZQBA 3LDPA 2PZSA 3P83D 3ZETB 2YKMA 1ZBIA 1HNZK 1NKBA 4FLYA 1LWCA 3K2PA 3VQ5A 4BQLA 4H4OA 3RMBA 4CJPA 3DRRA 4ZHRA 5HRPA 4JI2K 3G4SN 2Q2RA 5FLXO 1RTJA 2KZZA 5AFUA 1XC9A 4ZTFA 4QAGA 4IFEA 2O8BA 3HP6A 1S1XA 2NZTA 4OGCA 3AO3A 2CGKA 4BR9A 1JLFA 4IG3A 2O8CB 5AQQA 4CERA 4CHOA 3AO1A 1WSJA 5FRNA 3HO1A 3CPWM 3NF9A 1JCEA 3MN6A 3VQQA 4A2AA 1TYQA 1K8KA 4N5SA 1Y97A 3O4QA 4QS8A 1D9FA 4FJ8A 4PHTX 2W6LA 4KFBA 3VQ4A 1TKZA 3EYZA 3RSEA 4FO0A 1ZBLA 1YTUA 5DK5A 3IFRA 2OPSA 3CIPA 4M7XA 3MCAB 4AF1A 4CJ4A 4CK3A 3P1GA 1CZBA 4R5PA 2RPIA 3ZCMA 3WXKA 1HRHA 3HPOA 2EX3A 4HTLA 4BQZA 4FLTA 3OYJA 1HYZA 2NRWA 3SMSA 5BN9A 4BRDA 1BOTO 1QQMA 2IOCA 5F1XA 1GLAG 1KXPA 3CXCM 2V7YA 2P9UB 1X9SA 1LWEA 3C6UA 4FWPA 4JD2A 1MWMA 2HHWA 3RR7A 2HMPA 2ZJPL 1JCFA 1B9FA 3VGMA 1NMDA 1HR0K 4K43A 4HCBA 3NH2A 3TAPA 1M1KO 1VSMA 2OPQA 3AVAA 4I9LA 2E1YA 4HVJA 3R1XA 4B08A 1VQ8N 3A8YA 4DF8A 4FWQA 3GL1A 3CJ1A 3LL3A 1BU6O 2G8VA 1GLFO 4BG8A 3AAPA 3TR8A 1CZ9A 2KFNA 4JI5K 3L8BA 4FZXC 3AVCA 5SWMA 4E1JA 2J4RA 3OYMA 2OYQA 3M1FA 2O8DA 3RMCA 4BRLA 2QK9A 5AQJA 3AVKA 4BR4A 3EY1A 4B9QA 1HJOA 3VMFB 1VQLN 4Y1DA 2A40A 3MWTA 3NFAA 4F9OA 3CJBA 3M3ZA 3ULDA 3M8PA 4CF2A 3PX6A 1U2VA 4BRPA 2P1JA 2KKZA 4O55A 1LAWA 2I7PA 3ALYA 4AHRA 4DR5K 3IUCA 2NRHA 3QERA 4B1YB 5J2NA 4FJMA 1BCOA 4QS9A 3DLGA 4NO7A 5BRHA 1U4BA 4GW6A 1DTQA 3DLEA 3H1VX 1L3SA 4M3YA 3QEIA 3K57A 3CG7A 1FKPA 3CFOA 4E7IA 4RWTA 1WSGA 4M3XA 4JS5A 5I9EB 4K41A 3AVMA 3VPZA 4FVUA 2WOMA 3UE5A 3OYEA 4DV7K 3V9ZA 1T6DA 2O8EB 4DV4K 3NCIA 3SMPA 1BQMA 1OVQA 1REVA 1C0MA 1HQUA 3AVGA 4KH5A 3TTDA 3K58A 2UXCK 1N33K 2CGLA 3AVNA 1BO5O 3SUNA 4FJHA 3OYGA 1HJRA 2OZMA 3M8QA 4K8ZA 2YKNA 5EOYA 3SJJA 3K9JA 4FL9A 1NGFA 3P31A 4ELUA 4BC3A 4BRMA 4JV5K 1Y64A 4EZ9A 1RDUA 3FZLA 3TU5A 1GOAA 4IWVA 3CJ7A 2P9NA 4F3TA 3AVBA 4B9MA 1LW0A 5M1OA 1QS4A 2A42A 1BDGA 4CEOA 4CBWA 1IH7A 2ASOA 4JK9A 4OO1J 3QFPA 3U3YA 5KPTA 3D6RA 2V7ZA 4DSJA 3S41A 4DV6K 3HM8A 5AQWA 4Z4HA 1HLUA 4Q0BA 4IEEA 2DFHA 5FPEA 3QICA 4GKKK 4KREA 4B9NA 4J2EA 3C6HA 3ATUA 3C6AA 4C8NA 2GUIA 5FROA 2Q3SA 2UU9K 3KD5E 4CFDA 1YVNA 3MECA 1RNHA 1R59O 4AHTA 2GWJA 4FSVA 4CZHA 5C42A 1K9MO 1Z25A 1S6QA 2GX9A 2QWLA 4E7LA 5KRTA 3I8BA 3U3GA 1NJYA 3T69A 4PQUA 4LF9K 3FE1A 5C2FA 4Z4FA 3OYDA 5KPZA 2G8UA 2B6AA 3CC2N 4H0VB 1VSFA 3WXLA 2X78A 3JAMO 2YJEA 2UYTA 3ZLJA 3O9TA 4JKDA 3LDNA 4FLWA 3MEEA 4KRFA 2JGUA 3FFKB 1OH7A 4L8RB 4C8OA 3KTQA 2O8EA 4AILC 4LC9B 2HHTA 2VWBA 2QXFA 4CJQA 4M3WA 1W2BM 2E8AA 1Z05A 3MXMA 5HL7L 3WXIA 3BGRA 1RTHA 4Z94A 3QEVA 4BRHA 1ZXOA 2NLXA 4B9VA 2P9LA 3THXB 5C0YA 1OH6A 3DYAA 3MEGA 4MDAA 2P9IB 4KI6A 2DY4A 4DV2K 5HROA 5AQHA 1RBSA 4IO9L 3NBPA 4XH4A 1RT6A 1BUPA 4E3SA 1SKWA 4DV1K 2Z1GA 4FJ9A 4IDHA 1VQPN 4DR6K 3DAWA 2P5OA 4FJGA 3TAMA 1T7PA 3ZSZA 1NGBA 3LM9A 5AQXA 4FK2A 1NK6A 4B1ZA 4CBUA 5CZ2A 4FWOA 2QA4N 4H5WA 4CJTA 3KVGA 3JS6A 3NF6A 3CERA 5AQVA 3AGRA 2AP1A 1SKRA 3L3VA 4W5TA 2KW4A 1NMNA 1XMQK 1HQEA 1YAGA 3NH0A 5CYMA 3LM2A 4C1NK 2IGIA 2F7TA 4OKKA 1ASWA 4JK7A 1W9HA 4JKEA 5AZIB 3SAHA 4FJNA 1QVGM 5E26A 3O1WA 4CZFA 3VGLA 2P9SA 3KIOA 1FK9A 4BRGA 1ZBFA 1K6YA 4Q5VA 3I55N 3L2RA 1G99A 3J8AA 5JMVA 3C65A 3HRGA 4BR0A 4KPYA 1C1BA 4B3RK 4DUYK 1NGHA 4HUFA 4DUZK 4WQ5A 3CJ9A 1WOQA 4FM2A 1IKXA 4CGFA 4DQRA 3SZ2A 1FXXA 4FXDA 5AQRA 1YJWN 3O3HA 2CH5A 2GEMA 4IDKA 4FLXA 5HOOA 4FJKA 1X3NA 4YOTA 5AJ3K 1M90O 1VQ7N 3VOVA 5AQNA 4E19A 2QWPA 5TKWA 4PA1A 2G8FA 3B6OA 2B5JA 1R0AA 4CJKA 3AA5X 2ZWHA 5CE3A 4U67L 3J81O 2E1ZA 5LMNK 4JI8K 3SQ4A 1RBTA 2FBVA 1EKEA 3A5NC 4CEAA 3ZSWA 4XIUA 3SPZA 3OYLA 3H1QA 3GDQA 4UQGA 1BL3A 3BF1A 4JLHA 4BDZA 3CD6N 1VK0A 3CF5L 2ASMA 3CC4N 1S5JA 4I9QA 3RTVA 2I7NA 3AGKA 3HSCA 4EHTA 1MU2A 4FWLA 3TAQA 1RT2A 1IKYA 5BR8K 3W3DA 2IIRA 2KLAA 4LY7A 3ENOA 3U9DA 4OGEA 3ATVA 2FF6A 1TL1A 1VHXA 1RTDA 3DOKA 4IKFA 4JI6K 3QNOA 2Q31A 3E66A 3OS2A 3O6WA 1TVRA 4MLEA 3JSMA 1W7AA 3P4IA 1N34K 1VSHA 2F8SA 3DRSA 4CVNE 4IJAA 2D1KA 1T44A 4DS5A 1ZBUA 3RRGA 3WNFA 4I6MA 4KHSA 2G8WA 4CEQA 1LAVA 2ITGA 3DLHA 4FJXA 5FDLA 5HBMA 4JI0K 3QEWA 2QM1A 5LY3A 3L6QA 3T1HK 2YV0X 4RW4A 4JYAK 1XHZA 1J5OA 1KD1O 1TK0A 4K8XA 2OA8A 3VF2A 2QTDA 4NYFA 2FSKA 4O0IA 3TAEA 2QKKA 2FSNA 3AY9A 2GWKA 3ZETA 1U47A 4RW8A 2YHBA 3RR8A 3QEXA 4EHUA 1JLBA 4FZZA 2IVNA 3QDKA 4A2BA 4CGJA 4XH5A 3KJVA 2HHHK 4B3OA 4DU3A 1I39A 4ISGA 5BPMA 4HTUA 4CCHA 3OY9A 3O9QA 1IBKK 1VSDA 4CW7B 1CLQA 1RDAA 3G25A 2GBZA 3THWB 3AA4A 3KWIA 3FGUA 3LDQA 4FYDA 1RDCA 1ITGA 1GLDG 4EZ6A 4GV6A 5HLFA 1DTTA 5JLFA 3BF3A 1NLVA 4YORA 1JJ2M 2HSTA 3R8EA 4BRAA 1HNXK 1ILYA 4CF9A 3D45A 3JXUA 1L5UA 1NNEA 4C23A 4BC4A 3FR0A 5ELZA 3VQ6A 3AVIA 3O9SA 3CJAA 3LPTA 2DFEA 3RMDA 4CFCA 1BWFO 3U9ZA 1VQKN 3C6TA 3DMJA 1KAXA 2ASPA 3AA3A 4CZKA 4BROA 3FFIA 2A5XA 3TANA 1SKSA 3OTOK 4YDUC 1YT3A 3ZSOA 5LJWA 3J7YP 4NXMK 1WUAA 2P51A 2D4WA 3ENHA 5AQGA 4BC5A 5LJVA 3TI0A 1BIUA 4O0JA 1KLNA 2E4LA 5BREA 1NK5A 3E9PA 3VA3A 1QSLA 3A5MC 2A41A 4DTJA 1RFQA 1BA0A 2JWLA 4JHDA 1Q9XA 4OLBA 3MEDA 4QCLA 3CMAN 1BISA 1Q8IA 3KHYA 4CJ7A 2OTLN 2QWMA 1BGXT 1BA1A 3QBWA 1GLCG 3CC7N 2FLOA 2QWNA 1L3VA 1YVUA 3CPEA 3M6GA 3RSEB 2UUBK 2HBLA 1OKJA 4B3SK 1JXEA 2WFBA 1C0GA 2H3GX 3EKUA 4CIFA 4DFKA 2W42A 1EP4A 4H5TA 4YNQA 3EO3A 3PY8A 4ELVA 2E6LA 4AH9A 3PSFA 4YOYA 1T6CA 1H1VA 4PKIA 4CZIA 5C12A 4CEFA 3T1YK 3TABA 1IO2A 2YHWA 1I3AA 1U45A 1KAYA 4CI6A 1QQCA 1VSLA 4X65K 3LWLA 4O8KA 1EWQA 4K0KK 3V6DA 2IDOA 5JS2A 1TUYA 2KZMA 4H0XB 2X6NA 1BQNA 5AQFA 5AQYA 4KO0A 1KQSM 3THWA 3A2FA 4WCEL 1TKXA 5DM6L 3QEPA 4GNIA 3BDPA 3VEVA 4B1VA 1J54A 2WTUA 4N41A 4G1QA 3EZ5A 4CHYA 4DTNA 3SV4A 2UUAK 3D0PA 2AA4A 3KK2A 3ID6A 3OYHA 1ATRA 5AZJA 3T1AA 1RT1A 5SZTA 3D7EO 3O3FA 4CGHA 1N32K 2NUBA 3TWHA 1GLJO 4WQ4C 1RDWX 1Q9YA 1TGOA 3CCJN 4NXNK 3RRHA 4IEIA 2YCHA 1UA1A 2ITMA 3CFPA 4JS4A 1ATSA 3CCSN 1IG8A 5I3UA 2E2NA 4PL8A 2NRRA 4KAZA 3FZMA 3ZSYA 2PY5A 2D0CA 4N76A 1VQ6N 1DKGD 1OH5A 1NJWA 4DSKA 1JL2A 4I6MB 1W0HA 5AQUA 4M42A 4KH4A 2E2PA 1WSIA 2VG5A 3V9UA 3L0QA 1CXQA 4MO5A 5KPRA 1TK5A 4O5FA 3QB0A 3DXMA 4J2AA 2W6KA 2X74A 2ZF5O 1LOTB 4JI1K 3CCVN 4DV3K 3RWUA 1JLGA 3A5LC 4FPAA 4LF6K 3GBTA 5FPNA 2EWSA 1QSYA 4RW9A 3CCQN 4EP5A 5M1KA 3HPHA 3UKUA 3U8XA 3VEXA 1WSFA 2E2OA 5FRMA 3I56N 3I8DA 4FLUA 2YNIA 4XEIA 1WSEA 3SJHA 4OPHA 3KLFA 3O9UA 2HW3A 1QQOA 5GINA 4N56A 2VGMA 4TSXA 3ZT2A 2EHGA 3EZWA 3K9KA 4DR1K 4KHQA 3TAFA 4DQPA 4IBNA 2BH1A 5IT9O 4H8KA 1EQYA 4JHDB 4DTSA 1Q82O 2BE2A 4E7HA 3THVA 4H0OA 4DWIA 2GV9A 1SQKA 4CIEA 5AQMA 1NBWA 4DB3A 4ZTJA 1DGKN 2FBXA 4IFVA 2UUCK 3AVLA 4LF7K 3TARA 4QOZB 3VESA 3N4QA 1RT3A 4E89A 3V1RA 3S3MA 4MO4A 2PYLA 2LSNA 3L3UA 5AQOA 5MLCQ 1XNRK 4OPJA 3BEXA 3HI0A 3WEEA 3OVNA 5AFUH 3QLHA 1FKOA 1BI4A 3ZX2A 5CR4A 4O4GA 4CHPA 4V19S 1B92A 1UOCA 4B8CA 1RTIA 4DFMA 5KQ8A 3J7AP 3VEZA 3NF8A 4GV3A 2QWRA 3M8RA 4WQ5C 5C2DA 3C7NB 3K5LA 4JAXA 2UXBK 4DV5K 3D2EA 4DTUA 5AZIA 3EN9A 3VENA 4FWMA 4BDYA 2E6MA 4DQIA 5CHIA 2D0PA 2DTUA 1T03A 1VSEA 4FJ7A 1KLMA 1C1AA 1WB9A 4W5OA 3A5OC 3VQ7A 4CHQA 4NLBA 4W5NA 3O4NA 4H0TB 5GAEP 2IVOA 4IXCA 1NOZA 1EX4A 5BN8A 2X6SA 3VQ8A 2KHOA 2HVHA 3SBTA 3AARA 1HNWK 3LP1A 1S72N 2GELA 1RBRA 1HYSA 1YXQA 4KTQA 2F8TA 4A61A 3TPQA 4CK1A 1OH8A 1IKVA 4WQ4A 4AHSA 4FW2A 1D5AA 4NB4A 1S22A 4BWMA 3ZEUA 4CGDA 5GADP 3MAQA 2HVIA 1F21A 2O4IA 4WE1A 4BY9C 3HSTB 4WFBL 4Y1CA 4DMNA 1IV0A 4F4KA 3MX2A 4H5VA 4IFYA 3G71N 1N36K 3K5OA 3Q7CA 4H5RA 4FLVA 3CJCA 4WYBA 3NF7A 2RF2A 4Z4EA 5KGWA 4A59A 2Z1JA 3V9SA 4GMJB 1T8EA 4H5NA 2CGJA 5CY4A 1TKDA 2QW9A 2HNZA 3MMVA 2IC3A 1HNVA 4EIAA 1YITN 4Z4GA 2QKBA 2KFZA 3CCRN 4Y0WA 5AQIA 3ZT0A 5J2MA 2IS3A 5CYQA 2OPRA 4BR5A 3PIOL 3EL2A 1GOCA 2ETJA 4ILHA 4J2BA 2RHKA 1QHAA 2OTJN 4CJLA 4CECA 1NK9A 4OX9K 3NGYA 3MK6A 4JKAA 1NJZA 5J2PA 1RCHA 4CZLA 3IKMA 3VERA 3KK3A 4N47A 1YJ9N 3ZSRA 4DFJA 3CQYA 3VETA 4IG0A 3PO4A 4Z4CA 5C24A 1NGGA 3D2FB 3H45C 3OHRA 1NGJA 3MCPA 4FZYA 4FWKA 3LPUA 1Q86O 1V4TA 1J6ZA 4CHZA 5DMRA 3MDQA 3P38A 3ISNC 3R3LA 3SUQA 4DTRA 5JLHA 1VSIA 1TV6A 4AQYK 3SQ2A 3SNNA 4YHHK 1S1UA 3VF6A 3CCMN 3HT3A 1NOYA 1ASVA 5GAGP 3LDOA 2P9NB 2HF3A 3ZSVA 1NK7A 3T19A 1B9DA 4FJIA 4GKJK 2IAJA 1KCFA 4CZJA 4IO8A 4LF4K 4KH6A 3PX0A 2P9SB 2FBTA 3DRPA 3HP9A 5HRNA 3QIOA 3MXJA 2UXDK 2E88A 2E2QA 4FOIA 3F2KA 3VQEA 5EVZA 3C0BA 5M1QA 3EE8A 4BR7A 1K8AO 4B8AB 3TSUA 2G8KA 3IMXA 4CD1A 3CQ8A 1QZ6A 3ZT1A 3PSIA 3L2UA 3E9LA 3PUFA 4JI7K 4H4MA 4BWJA 2QEXN 3HPGA 2ZE2A 5BRDA 1DLOA 1KFSA 4LF5K 4Z4IA 1A5VA 2NRZA 3O80A 5KTQA 2BGGA 2HB5A 2FBYA 4DQQA 4BRKA 2XY8A 1WN7A 5DM7L 2VQEK 1S9GA 1P90A 2DPNA 3M8SA 3OYIA 1X9MA 4L3QA 2VYPA 3I33A 1RGIA 3KLIA 4BVOA 5EU7A 2NRXA 1KRPA 2D0AA 3SLCA 4O5BA 4Z0UA 3L4QA 1RBUA 4E7KA 3O9RA 3KKRA 2GUPA 5E84A 1GLEG 2JLEA 5KI6A 4CE9A 4DU1A 3LDSA 1WLJA 1Q81O 2P9IA 3IDHA 4BE1A 1EWRA 3VQ9A 1GLLO 2P9LB 3THXA 3OYFA 2HBKA 1SL2A 1IKWA 3AVJA 4MQ3A 4BACA 5KQDA 3LAKA 3DWLA 3SAFA 4FCYA 3V9XA 5KGXA 1JLAA 1SS6A 4DSEA 2YNFA 4CF1A 3QFUA 4K42A 4M45A 1L3TA 1W97L 3E1YA 4KB1A 4NCAA 2Y1JA 1JL1A 4O44A 1UWBA 2YNHA 4MFBA 4NCBA 4DTMA 1FW6A 1HPMA 1N8RO 4DR3K 4NCGA 3KK7A 5HRSA 3BUZB 4DS4A 4KHPK 4JKGA 3LP2A 4B1UB 3QINA 4ID1A 1HMVA 1TAQA 4JKBA 1O1WA 3OYCA 1S1VA 3SI6A 3VQBA 3DXKB 3J80O 1NJXA 3NDKA 4CEDA 1HX1A 3NE6A 4X64K 1XI1A 2P9UA 2G8HA 3KD1E 3ZYYX 1XMOK 1UA0A 2KTQA 3B8AX 3CFRA 1RILA 2VG7A 4DFPA 4E7JA 3HOTA 2PBDA 3NVKA 2Q97A 1QQNA 4CEEA 2RKIA 1U48A 1C0TA 4A57A 3SUPA 3W0LA 1ZYQA 3T3FA 3WNEA 3VQCA 4AHCA 2Z1HA 5JICA 2ATQA 3V81A 4BGBA 1HNIA 3VQDA 1SAZA 2G8IA 1NWKA 3G0ZA 5EX5A 4WFAL 1J53A 4KHYA 3MN7A 2WBNA 2QXLA 4ILGB 3ZX0A 2BTFA 1TK8A 3CCUN 3SQ0A 3E9OA 4HUEA 3OYAA 4CBXA 3G10A 2XY7A 1NKCA 3RVCA 2E20A 2P9PA 3BY5A 3CETA 3OJUA 1X9JA 4OKJA 1K8KB 4FLZA 2IVPA 1N5YA 4LH4A 1HKGA 4B3TK 3KK1A 4AHUA 3LZIA 3DM2A 4CJRA 3ZT3A 3HTVA 4FWNA 4CFBA 3T7ZA 4FK0A 3ID8A 4CD3A 1XHXA 2O8CA 4ISEA 3IAYA 1KC8O 1VSKA 3KLGA 2QWQA 4BG9A 4DSLA 3DLKA 3GG4A 3R9PA 3NGZA 4DCHA 2O8BB 4I2PA 5GIPA 1JCGA 4GVMA 1LW2A 3VF4A 4GY2B 4CEBA 4CGIA 2GTDA 2HBJA 2RE2A 2YHXA 3U4LA 3ZSQA 1MDUB 3K0SA 4M3ZA 3O1BA 4I2QA 4JNEA 1SUQA 1TL3A 3L4IA 4C8KA 4DG1A 4IOXA 3HZ6A 3CYMA 1U2VB 4RTFD 3M5RA 3VEYA 4B9TA 4JKGB 1C1CA 4FPBA 1XWLA 3E01A 1D4XA 4CJUA 1WBDA 5AQSA 4OPKA 4F8RA 4KHUA 2Q0RA 2WONA 3ENBA 1JLCA 4FJ5A 4O8UA 2HHQA 4KTZA 4E1NA 2O8DB 5AR0A 5IWAK 3LZJA 4KHWA 5AQKA 4DKWA 4M3TA 1WSHA 1O13A 4JKFA 2XY6A 4FOEA 1EO1A 3V9WA 3DLRA 5EXWA 2F9TA 1ESVA 3OYBA 4M3UA 1Z26A 3I0SA 3IS9A 3H3OB 4CGGA 2YX6A 5AQTA 1SL1A 5BRFA 3PLAA 3BZCA 5F0XA 1JLEA 4OLAA 3KZBA 3H6EA 2ZGZA 1EETA 1KFDA 4G9ZA 4OJRA 5M1PA 2XHBA 2KQ2A 3THYA 2Q1NA 3RMAA 5D3GA 4B9SA 5HP1A 4RW6A 3AA2A 2O8FA 4DTOA 2W40A 1EXQA 3HOSA 1BHLA 1C6VA 4DTXA 2YHAA 3DOLA 4JD2B 1NM1A 2Q0UA 3WQUA 3CI5A 2OANA 1Q7YO 3MN5A 4C8MA 3P5JA 2XO7A 1S1TA 3S3OA 5HRRA 3K5MA 5AQLA 2PFUA 1Z6RA 3K5NA 4CJ3A 3MWPA 4HHTA 3OA9A 1L3UA 3OS0A 2I5JA 3GE1A 3LWMA 2OZSA 4AHVA 1KVCA 3TAGA 1YUWA 1QTMA 4OVLA 4LFBK 4YOXA 1SV5A 5T7BA 1TKTA 4PKGA 4YOVA 3VEWA 4BR2A 3VQPA 1ASUA 1YF5L 2P9PB 4WFNL 2R7YA 4CJWA 3A0IX 3VGKA 4JRPA 1VQMN 1NGDA 1VSJA 1VQ4N 1GOBA 3OBWA 4ELTA 1VQNN 1YJNN 3SBGA 2QWOA 1TYQB 1WBBA 3F9MA 2P5GA 3WT0A 3LDLA 1U04A 5B8HA 5AQZA 3AO4A 3F5TA 4ICLA 1WAFA 2NRTA 2NRVA 3SCXA 3AO5A 1YTAA 1IJJA 2Q36A 5CZ1A 3LP0A 2HHSA 4KBOA 1NK8A 4KHNA 4W5RA 5FPDA 1HUXA 1NG9A 4FM1A 3CHWA 3D2FA 2VG6A 2VGNA 3NHGA 3DLLL 4LH5A 2HNYA 1KSPA 4PWDA 4BREA 2AJQA 2D5RA 1RT7A 2ZGYA 3PIPL 4A62A 3HYFA 3DXKA 4DR7K 3OJSA 1BG3A 3EEQA 3QESA 4I7FA 3WNHA 1HKCA 4H0PA 5JVGL 1NK0A 3WQTA 3MX5A 1UAXA 1I94K 4C1NI 4CF0A 3V1OA 4DR4K 4B3MK 4CFAA 4J2DA 3L2VA 1JKHA 2V51B 3HL8A 4LD0A 1X3MA 3HVTA 5M1NA 3V4IA 1NGCA 4HCCA 2HBMA 3OYNA 2HHXA 1XQSC 1XNQK 3UB5A 4XH1A 3QNNA 4FJLA 1WNSA 1BIZA 2E5LK 4FWSA 3SPYA 1VRUA 2A3ZA 1IG9A 4DR2K 3ZEUB 2DFFA 3H08A 2HHVA 4K25A 4CK2A 1T3VA 4OPAA 1RBVA 2YNGA 4QS7A 3Q7BA 4OKEA 3KWGA 4PY5A 4IOAL 3JYTA 3NVMA 4ILJA 1VQON 4LFCK 4DHYA 4GV9A 4BRIA 4BE2A 3UKRA 3B6PA 1Q18A 3FZHA 3S9HA 4X62K 3TSQA 2HMIA 1LV5A 3O3GA 3ULEB 3G6EN 3HM9A 4CJEA 4DLEA 4YOUA 1JXBA 4JRQA 1YIJN 2A6AA 4KKOA 5BPNA 5H1SQ 1OVYA 4RCHA 1E4FT 5KRSA 1NGAA 3EKSA 4FW1A 1BCMA 3TTCA 3CCEN 3IG1A 4W5QA 1HYVA 3VQAA 4PKHA 4KTWA 1J5EK 3S3NA 3KKSA 4ISFA 3SQ1A 3CCLN 2ZD1A 1QZ5A 1S3XA 1NK4A 4B9UA 5F2RA 4JKCA 4C8LA 4X66K 3UIQA 2OPPA 4CJFA 2XY5A 3O8MA 3D2EB 1P8ZA 2YI1A 3MXIA 2HNDA 1TAUA 3LALA 2VWJA 2RN2A 1N6QA 1JLQA 3J7ZO 2P9KA 4F2RA 1A5WA 1U6ZA 1VRTA 3FZFA 5ADXH 2Y1IA 1KTQA 1YI2N 1CXUA 4FK4A 1BI4B 3WNGA 2F4VK 1DT9A 3WEEB 4CJSA 4LFAK 1NU0A 3WXJA 3AV9A 4A5AA 4UY8O 5M1FA 1ATNA 4DU4A 1S9EA 4HUGA 5J2QA 4LSLA 4EAHD 3VA0A 3V1QA 4KI4A 4E0DA 2Z1IA 3NMUA 1V4SA 4J8FA 3HBTA 3BP8A 4FVMA 4B1WB 4YDUA 4DSIA 1D9DA 3QMLA 5E41A 3SV3A 2PYJA 1QHTA 3DJCA 3ZX3A 3OS1A 1YHQN 4HWIA 3VN5A 4KV8A 4IOCL 3QIPA 3AO2A 4IZ9A 3ITHA 1NGEA 4B1XB 4M3RA 5GAHP 3SYZA 1C0UA 3PX4A 1U49A 1NJIO 3I0RA 3FZKA 4DLGA 2BANA 1ZBHA 3ULEA 4CIGA 1G15A 3O08A 1QE1A 5AQPA 4M41A 3VTIA 4DF4A 2BUPA 4FM0A 3HVRA 4BVPA 1LCUA 4JEPA 5FPMA 4BDPA 4JI3K 3LP3A 4JKHA 1VAZA 1T05A 1MWKA 1C0FA 1S6PA 4PL7A 3LANA 1S1WA 4JN4A 2YJFA 5JS1A 2A1SA 3VTHA 2W41A 2VWKA 4LSNA 3KLHA 2F9WA 4E1MA 4CHNA 3HK2A 3OBYA 1RT4A 1E3MA 1RT5A 1X1PA 1NKEA 4YY3K 1XC3A 3SAGA 4CJVA 3R6MA 1GLBG 4MLHA 4CJ5A 4M7YA 5ADXA 1VQ9N 3AVFA 5TKYA 3WUHA 2O4GA 2HOEA 1KVBA 4DSFA 5I42A 2ZJRL 5AZJB 4GVEA 4NYNA 4R79A 4YOWA 4A5BA 4EP4A 3C94A 3CM6A 4CZGA 3TSPA 4CZMA 2A1RA 2NNWA 3ZSXA 3BZKA 5C10A 2F96A 3O5BA 4M63C 3CM5A 4BC2A 1IBLK 4AM7A 3N4PA 3PV8A 4PUOA 2VQFK 2V52B 3NGIA 2FSJA 1HPZA 2PAVA 2BDPA 1MA9B 3C7NA 1TUUA 4RW7A 1NGIA 4H0YB 5C25A 2WUSA 3CQXA 2B4JA 4DQ8A 3L2QA 2FF3B 4CZEA 1RDBA 4F3OA 4ID5A 3SK3A
chains in the Genus database with same CATH topology
2WONA 1JLCA 4FJ5A 4DWIA 2GV9A 3DYAA 3MEGA 4KI6A 1SL0A 2HHQA 4KTZA 4CIEA 4E1NA 2DY4A 4KHWA 3LZJA 4ZTJA 4M3TA 5HROA 1WSHA 2FBXA 4IFVA 1RBSA 3AVLA 3NBPA 3TARA 5J1EA 4QOZB 1RT6A 2XY6A 4E3SA 1SKWA 1RT3A 4E89A 2Z1GA 5K14A 3V1RA 3DLRA 3V9WA 3S3MA 4FJ9A 2PYLA 2LSNA 2P5OA 4FJGA 3ZT4A 3TAMA 1T7PA 4CESA 3OYBA 3ZSZA 4M3UA 1Z26A 3I0SA 3L3UA 3F73A 3IS9A 4OPJA 1X9WA 4FK2A 4CGGA 1NK6A 3OVNA 3SUOA 1SL1A 4RG8A 3QLHA 1FKOA 1BI4A 5CZ2A 3U6FA 1KVAA 1JLEA 4OLAA 3F9KA 4CJTA 1NJXA 4O4GA 1EETA 1KFDA 2D0BA 1B92A 3NF6A 4CHPA 1UOCA 4OJRA 4B8CA 3DI6A 1SKRA 2XHBA 1RTIA 2KQ2A 3KLEA 3L3VA 1WAJA 3NH1A 4DFMA 4KB0A 4W5TA 3RMAA 5D3GA 2KW4A 3NF8A 3PO5A 1HQEA 3HJFA 3NH0A 4B9SA 3M8RA 5CYMA 3ASMA 3K5LA 4B9LA 5HP1A 4BE0A 4RW6A 4DTUA 1A5XA 3AA2A 4BDYA 4DTOA 2E6MA 2IGIA 4DQIA 1EXQA 4OKKA 1ASWA 1BHLA 2DTUA 1C6VA 4DTXA 1T03A 2YHAA 1VSEA 3DOLA 4FJ7A 1W9HA 1KLMA 1C1AA 4FJNA 3LAMA 4W5OA 3C95A 1RDDA 3P5JA 4C8MA 1S1TA 3VQ7A 5HRRA 2XO7A 3K59A 3K5MA 4CHQA 3L2RA 3KIOA 1FK9A 4Q5VA 1K6YA 1ZBFA 3O4NA 3K5NA 4W5NA 1NOZA 1EX4A 4CJ3A 4HHTA 2X6SA 3L2WA 4KPYA 1L3UA 4DQSA 3OS0A 2I5JA 3VQ8A 1C1BA 3LWMA 2HVHA 2FC0A 2OZSA 4HUFA 4AHVA 1KVCA 3TAGA 1QTMA 4FM2A 4OVLA 1IKXA 4CGFA 4DQRA 3SZ2A 1FXXA 4DTPA 3LP1A 4FXDA 1RBRA 1SV5A 3NAEA 5T7BA 3O3HA 1TKTA 4YFUA 4IDKA 4FLXA 4CF8A 1HYSA 3VQPA 1ASUA 3IRXA 4KTQA 1D8YA 4FJKA 2F8TA 4CK1A 3DLBA 1IKVA 3OYKA 2R7YA 4CEZA 4CJWA 4E19A 4JRPA 4AHSA 1VSJA 4ELTA 1GOBA 3QO9A 4FJJA 4FW2A 4PA1A 2G8FA 1D5AA 4CGDA 4BWMA 3MAQA 3B6OA 2HVIA 2P5GA 1F21A 2B5JA 2XRIA 1U04A 1R0AA 3AVHA 2HHUA 4CJKA 1QSSA 1J9AA 3AA5X 3AO4A 4ICLA 3HXMA 1WAFA 2O4IA 4WE1A 3HSTB 4F2SA 2G8HA 4Y1CA 1LWFA 1RBTA 3SQ4A 4DMNA 3SCXA 2FBVA 3AO5A 1EKEA 1YTAA 4CEAA 3ZSWA 3LP0A 4F4KA 2ZQBA 5CZ1A 4XIUA 2PZSA 3P83D 3SPZA 3OYLA 2YKMA 4IFYA 1ZBIA 2HHSA 1NKBA 4UQGA 3K5OA 1BL3A 1NK8A 4FLVA 4JLHA 1LWCA 4BDZA 4FLYA 1VK0A 3NF7A 2RF2A 3K2PA 3VQ5A 4W5RA 4KHNA 4Z4EA 1S5JA 4H4OA 5KGWA 3RTVA 2Z1JA 4CJPA 3RMBA 3V9SA 4GMJB 4FM1A 1MU2A 3TAQA 1T8EA 1RT2A 1IKYA 2VG6A 3DRRA 4ZHRA 5HRPA 5CY4A 3NHGA 4LH5A 2HNYA 1TKDA 1KSPA 4LY7A 4PWDA 2AJQA 1RTJA 4OGEA 2KZZA 1XC9A 4ZTFA 4QAGA 2D5RA 2HNZA 1RT7A 1HNVA 2IC3A 1TL1A 2QKBA 4Z4GA 1RTDA 3HP6A 3DOKA 4IKFA 1S1XA 2KFZA 3HYFA 4OGCA 3AO3A 3QNOA 3OS2A 3ZT0A 5J2MA 3OJSA 2IS3A 5CYQA 1TVRA 1JLFA 2OPRA 4IG3A 3QESA 4I7FA 4CERA 1GOCA 3WNHA 4CHOA 3AO1A 3JSMA 2ETJA 4J2BA 1WSJA 1VSHA 5FRNA 3DRSA 2F8SA 4CJLA 4CECA 1NK9A 3NF9A 3HO1A 1NK0A 3NGYA 4DS5A 1NJZA 1UAXA 1ZBUA 5J2PA 3RRGA 1RCHA 4CF0A 3V1OA 3VQQA 3KK3A 3WNFA 4N47A 4KHSA 2G8WA 3ZSRA 4N5SA 4CEQA 1Y97A 4DFJA 1LAVA 2ITGA 4CFAA 4IG0A 3L2VA 1JKHA 3DLHA 4Z4CA 5C24A 3O4QA 5FDLA 5HBMA 1D9FA 3PO4A 4FJXA 4FJ8A 3QEWA 3HL8A 4LD0A 3HVTA 1XI1A 3V4IA 4FZYA 2YV0X 4RW4A 1XHZA 1J5OA 4KFBA 3VQ4A 3LPUA 1TK0A 4K8XA 1TKZA 3EYZA 3QETA 2OA8A 4HCCA 1ZBLA 1YTUA 5DK5A 4NYFA 4O0IA 3TAEA 4CHZA 2QKKA 5DMRA 3ISNC 3OYNA 3SUQA 1U47A 4RW8A 4DTRA 2YHBA 3RR8A 1VSIA 2HHXA 1TV6A 2OPSA 3SQ2A 3SNNA 4CJ4A 1S1UA 3QNNA 4CK3A 3QEXA 4FJLA 3P1GA 1JLBA 1CZBA 4FZZA 1WNSA 4R5PA 3HT3A 1BIZA 3SPYA 1NOYA 1VRUA 1ASVA 2RPIA 3ZCMA 4CGJA 3ZSVA 3KJVA 1NK7A 1IG9A 1HRHA 4B3OA 3T19A 3HPOA 4DU3A 2EX3A 1B9DA 1I39A 4FJIA 2DFFA 2IAJA 3H08A 1KCFA 4FLTA 2HHVA 4CK2A 4HTUA 3OYJA 4CCHA 3OY9A 1HYZA 3PX0A 1RBVA 2FBTA 2YNGA 3DRPA 3HP9A 5HRNA 1VSDA 1CLQA 4OKEA 1RDAA 2IOCA 4PY5A 3JYTA 2GBZA 3AA4A 3TABA 3QIOA 3MXJA 4FYDA 4BE2A 3B6PA 1X9SA 1LWEA 1RDCA 1ITGA 3VQEA 3S9HA 2HMIA 3C6UA 1LV5A 4EZ6A 3O3GA 5HLFA 1DTTA 3HM9A 4CJEA 4DLEA 2HHWA 1JXBA 4JRQA 3RR7A 4B8AB 4KKOA 5KRSA 2G8KA 4FW1A 1BCMA 1B9FA 4CF9A 3D45A 3CQ8A 1L5UA 3ZT1A 4HCBA 3L2UA 3PUFA 3NH2A 3TAPA 3IG1A 1VSMA 4H4MA 2OPQA 4W5QA 4BWJA 3VQ6A 3HPGA 2ZE2A 1HYVA 1DLOA 3AVAA 4I9LA 3VQAA 3AVIA 1KFSA 4KTWA 4Z4IA 1A5VA 3LPTA 2DFEA 4HVJA 3S3NA 3KKSA 3RMDA 5KTQA 4B08A 4CFCA 2BGGA 3SQ1A 2HB5A 2FBYA 4DQQA 2XY8A 2ZD1A 1WN7A 3C6TA 3DMJA 4DF8A 4I9QA 1S9GA 1NK4A 4B9UA 3M8SA 3OYIA 3AA3A 1X9MA 4C8LA 3FFIA 2G8VA 2OPPA 4CJFA 3KLIA 3UIQA 3TANA 5EU7A 2XY5A 1SKSA 1KRPA 3TR8A 2D0AA 1CZ9A 2KFNA 1YT3A 3ZSOA 3L8BA 4O5BA 2HNDA 4Z0UA 3MXIA 4DLGA 1RBUA 2P51A 4E7KA 3LALA 3KKRA 1TAUA 2VWJA 2RN2A 1N6QA 1JLQA 3TI0A 3AVCA 5KI6A 2JLEA 1BIUA 4CE9A 4O0JA 5SWMA 3LDSA 3OYMA 4DU1A 1WLJA 1KLNA 2E4LA 3RMCA 1NK5A 2OYQA 4F2RA 3VA3A 1A5WA 1VRTA 2Y1IA 1QSLA 2QK9A 4DTJA 3AVKA 4BE1A 3EY1A 1KTQA 3VQ9A 1CXUA 3OYFA 4Y1DA 1Q9XA 4OLBA 3NFAA 3MEDA 4FK4A 1BI4B 3WNGA 1SL2A 4QCLA 1IKWA 1BISA 3AVJA 4MQ3A 3ULDA 4BACA 3LAKA 1Q8IA 3M8PA 4CJSA 4CF2A 3PX6A 2P1JA 4O55A 4FCYA 3V9XA 5KGXA 1BGXT 1JLAA 1LAWA 3ALYA 4AHRA 3AV9A 4DSEA 2YNFA 1L3VA 3QERA 4CF1A 4DU4A 1YVUA 5J2NA 1S9EA 4M45A 1L3TA 4FJMA 4HUGA 5J2QA 1BCOA 4LSLA 3VA0A 4KB1A 3V1QA 4NCAA 4KI4A 4E0DA 1JXEA 2Z1IA 1JL1A 3DLGA 4O44A 2Y1JA 1UWBA 4FVMA 2YNHA 1U4BA 4GW6A 4MFBA 1DTQA 3DLEA 4CIFA 4DSIA 4NCBA 4DFKA 1D9DA 1L3SA 4M3YA 2W42A 1EP4A 4DTMA 3QEIA 5E41A 4YNQA 3SV3A 3PY8A 4ELVA 2E6LA 3K57A 2PYJA 4AH9A 4NCGA 1QHTA 3CG7A 1FKPA 5HRSA 3CFOA 3OS1A 4DS4A 4E7IA 1WSGA 4M3XA 4JS5A 3VN5A 3AVMA 3LP2A 4KV8A 3QINA 2WOMA 3QIPA 4CEFA 3AO2A 3OYEA 3ITHA 1HMVA 4ID1A 4M3RA 1IO2A 3SYZA 1C0UA 1TAQA 1I3AA 3V9ZA 1O1WA 3OYCA 3I0RA 1U45A 1U49A 1S1VA 3NCIA 3SI6A 3VQBA 3S3OA 1BQMA 1QQCA 1REVA 3AVGA 1C0MA 1HQUA 3NDKA 2BANA 1VSLA 4CEDA 3K58A 3LWLA 3NE6A 1ZBHA 4CIGA 3AVNA 1G15A 3SUNA 4FJHA 3V6DA 1QE1A 2IDOA 1HJRA 3OYGA 3M8QA 4M41A 5JS2A 2YKNA 4DF4A 2X6NA 1BQNA 2OZMA 4K8ZA 2KZMA 4KO0A 3SJJA 3A2FA 1UA0A 1TKXA 3QEPA 2KTQA 3CFRA 3BDPA 4FM0A 1RILA 1J54A 2VG7A 4DFPA 4N41A 4ELUA 4G1QA 3EZ5A 4CHYA 4DTNA 3HVRA 3SV4A 4E7JA 3D0PA 4EZ9A 3KK2A 4BDPA 3OYHA 4J2DA 3T1AA 1RT1A 3LP3A 1GOAA 4CEEA 5SZTA 4CGHA 3O3FA 2RKIA 1U48A 1C0TA 2NUBA 3TWHA 3THVA 4F3TA 3AVBA 4B9MA 1T05A 1LW0A 1TGOA 3SUPA 1ZYQA 1Q9YA 1QS4A 3RRHA 3T3FA 3WNEA 3VQCA 4AHCA 2Z1HA 1S6PA 3LANA 4CEOA 1S1WA 1IH7A 1UA1A 2ATQA 5JS1A 3CFPA 4JS4A 3V81A 4KHUA 2A1SA 1HNIA 3VQDA 2VWKA 2G8IA 3U3YA 5I3UA 4LSNA 3KLHA 4KAZA 3ZSYA 4E1MA 3G0ZA 4CHNA 2PY5A 3HK2A 4DSJA 1J53A 1RT4A 4KHYA 2D0CA 4N76A 1TK8A 1RT5A 1X1PA 1NKEA 3SQ0A 4HUEA 3OYAA 1NJWA 4Z4HA 2XY7A 3G10A 4Q0BA 1NKCA 4FLZA 4CJVA 3OJUA 4DSKA 1JL2A 2DFHA 4OKJA 1W0HA 1N5YA 4M42A 4LH4A 4KREA 1WSIA 2VG5A 4B9NA 4J2EA 3KK1A 4AHUA 4CJ5A 3DM2A 4CJRA 3LZIA 3V9UA 3ZT3A 1CXQA 4C8NA 2GUIA 5FROA 2Q3SA 3AVFA 4CFBA 1TK5A 4FK0A 4J2AA 2O4GA 4CFDA 3KD5E 1KVBA 3KD1E 4DSFA 1XHXA 2X74A 5I42A 3IAYA 3MECA 1RNHA 4AHTA 5C42A 3RWUA 1JLGA 1Z25A 1S6QA 4NYNA 1VSKA 3KLGA 4E7LA 4EP4A 4DSLA 3C94A 3DLKA 5KRTA 3CM6A 3PX4A 3U3GA 1QSYA 4RW9A 1NJYA 4PQUA 3NGZA 2A1RA 4I2PA 3ZSXA 4EP5A 4Z4FA 4GVMA 1LW2A 2F96A 3HPHA 2B6AA 3OYDA 2G8UA 1VSFA 3CM5A 2X78A 1WSFA 4CEBA 4CGIA 5FRMA 4FLWA 3ZSQA 3PV8A 4PUOA 3I8DA 3MEEA 2YNIA 4FLUA 3NGIA 4KRFA 2JGUA 1WSEA 4L8RB 4M3ZA 3KLFA 4FZXC 4C8OA 4I2QA 2HW3A 1SUQA 1TL3A 3KTQA 4C8KA 4DG1A 1HPZA 4AILC 4N56A 2BDPA 2HHTA 2QXFA 4RW7A 4TSXA 3ZT2A 2EHGA 3CYMA 4CJQA 4M3WA 4B9TA 3MXMA 5C25A 1C1CA 4KHQA 3TAFA 3BGRA 1XWLA 1RTHA 3E01A 2B4JA 4CJUA 3QEVA 4DQPA 4IBNA 3L2QA 4H8KA 4DTSA 1RDBA 4OPKA 4B9VA 4ID5A 2BE2A 4F3OA 4F8RA 4E7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WON A;  1JLC A;  4FJ5 A;  4DWI A;  2GV9 A;  3DYA A;  3MEG A;  4KI6 A;  1SL0 A;  2HHQ A;  4KTZ A;  4CIE A;  4E1N A;  2DY4 A;  4KHW A;  3LZJ A;  4ZTJ A;  4M3T A;  5HRO A;  1WSH A;  2FBX A;  4IFV A;  1RBS A;  3AVL A;  3NBP A;  3TAR A;  5J1E A;  4QOZ B;  1RT6 A;  2XY6 A;  4E3S A;  1SKW A;  1RT3 A;  4E89 A;  2Z1G A;  5K14 A;  3V1R A;  3DLR A;  3V9W A;  3S3M A;  4FJ9 A;  2PYL A;  2LSN A;  2P5O A;  4FJG A;  3ZT4 A;  3TAM A;  1T7P A;  4CES A;  3OYB A;  3ZSZ A;  4M3U A;  1Z26 A;  3I0S A;  3L3U A;  3F73 A;  3IS9 A;  4OPJ A;  1X9W A;  4FK2 A;  4CGG A;  1NK6 A;  3OVN A;  3SUO A;  1SL1 A;  4RG8 A;  3QLH A;  1FKO A;  1BI4 A;  5CZ2 A;  3U6F A;  1KVA A;  1JLE A;  4OLA A;  3F9K A;  4CJT A;  1NJX A;  4O4G A;  1EET A;  1KFD A;  2D0B A;  1B92 A;  3NF6 A;  4CHP A;  1UOC A;  4OJR A;  4B8C A;  3DI6 A;  1SKR A;  2XHB A;  1RTI A;  2KQ2 A;  3KLE A;  3L3V A;  1WAJ A;  3NH1 A;  4DFM A;  4KB0 A;  4W5T A;  3RMA A;  5D3G A;  2KW4 A;  3NF8 A;  3PO5 A;  1HQE A;  3HJF A;  3NH0 A;  4B9S A;  3M8R A;  5CYM A;  3ASM A;  3K5L A;  4B9L A;  5HP1 A;  4BE0 A;  4RW6 A;  4DTU A;  1A5X A;  3AA2 A;  4BDY A;  4DTO A;  2E6M A;  2IGI A;  4DQI A;  1EXQ A;  4OKK A;  1ASW A;  1BHL A;  2DTU A;  1C6V A;  4DTX A;  1T03 A;  2YHA A;  1VSE A;  3DOL A;  4FJ7 A;  1W9H A;  1KLM A;  1C1A A;  4FJN A;  3LAM A;  4W5O A;  3C95 A;  1RDD A;  3P5J A;  4C8M A;  1S1T A;  3VQ7 A;  5HRR A;  2XO7 A;  3K59 A;  3K5M A;  4CHQ A;  3L2R A;  3KIO A;  1FK9 A;  4Q5V A;  1K6Y A;  1ZBF A;  3O4N A;  3K5N A;  4W5N A;  1NOZ A;  1EX4 A;  4CJ3 A;  4HHT A;  2X6S A;  3L2W A;  4KPY A;  1L3U A;  4DQS A;  3OS0 A;  2I5J A;  3VQ8 A;  1C1B A;  3LWM A;  2HVH A;  2FC0 A;  2OZS A;  4HUF A;  4AHV A;  1KVC A;  3TAG A;  1QTM A;  4FM2 A;  4OVL A;  1IKX A;  4CGF A;  4DQR A;  3SZ2 A;  1FXX A;  4DTP A;  3LP1 A;  4FXD A;  1RBR A;  1SV5 A;  3NAE A;  5T7B A;  3O3H A;  1TKT A;  4YFU A;  4IDK A;  4FLX A;  4CF8 A;  1HYS A;  3VQP A;  1ASU A;  3IRX A;  4KTQ A;  1D8Y A;  4FJK A;  2F8T A;  4CK1 A;  3DLB A;  1IKV A;  3OYK A;  2R7Y A;  4CEZ A;  4CJW A;  4E19 A;  4JRP A;  4AHS A;  1VSJ A;  4ELT A;  1GOB A;  3QO9 A;  4FJJ A;  4FW2 A;  4PA1 A;  2G8F A;  1D5A A;  4CGD A;  4BWM A;  3MAQ A;  3B6O A;  2HVI A;  2P5G A;  1F21 A;  2B5J A;  2XRI A;  1U04 A;  1R0A A;  3AVH A;  2HHU A;  4CJK A;  1QSS A;  1J9A A;  3AA5 X;  3AO4 A;  4ICL A;  3HXM A;  1WAF A;  2O4I A;  4WE1 A;  3HST B;  4F2S A;  2G8H A;  4Y1C A;  1LWF A;  1RBT A;  3SQ4 A;  4DMN A;  3SCX A;  2FBV A;  3AO5 A;  1EKE A;  1YTA A;  4CEA A;  3ZSW A;  3LP0 A;  4F4K A;  2ZQB A;  5CZ1 A;  4XIU A;  2PZS A;  3P83 D;  3SPZ A;  3OYL A;  2YKM A;  4IFY A;  1ZBI A;  2HHS A;  1NKB A;  4UQG A;  3K5O A;  1BL3 A;  1NK8 A;  4FLV A;  4JLH A;  1LWC A;  4BDZ A;  4FLY A;  1VK0 A;  3NF7 A;  2RF2 A;  3K2P A;  3VQ5 A;  4W5R A;  4KHN A;  4Z4E A;  1S5J A;  4H4O A;  5KGW A;  3RTV A;  2Z1J A;  4CJP A;  3RMB A;  3V9S A;  4GMJ B;  4FM1 A;  1MU2 A;  3TAQ A;  1T8E A;  1RT2 A;  1IKY A;  2VG6 A;  3DRR A;  4ZHR A;  5HRP A;  5CY4 A;  3NHG A;  4LH5 A;  2HNY A;  1TKD A;  1KSP A;  4LY7 A;  4PWD A;  2AJQ A;  1RTJ A;  4OGE A;  2KZZ A;  1XC9 A;  4ZTF A;  4QAG A;  2D5R A;  2HNZ A;  1RT7 A;  1HNV A;  2IC3 A;  1TL1 A;  2QKB A;  4Z4G A;  1RTD A;  3HP6 A;  3DOK A;  4IKF A;  1S1X A;  2KFZ A;  3HYF A;  4OGC A;  3AO3 A;  3QNO A;  3OS2 A;  3ZT0 A;  5J2M A;  3OJS A;  2IS3 A;  5CYQ A;  1TVR A;  1JLF A;  2OPR A;  4IG3 A;  3QES A;  4I7F A;  4CER A;  1GOC A;  3WNH A;  4CHO A;  3AO1 A;  3JSM A;  2ETJ A;  4J2B A;  1WSJ A;  1VSH A;  5FRN A;  3DRS A;  2F8S A;  4CJL A;  4CEC A;  1NK9 A;  3NF9 A;  3HO1 A;  1NK0 A;  3NGY A;  4DS5 A;  1NJZ A;  1UAX A;  1ZBU A;  5J2P A;  3RRG A;  1RCH A;  4CF0 A;  3V1O A;  3VQQ A;  3KK3 A;  3WNF A;  4N47 A;  4KHS A;  2G8W A;  3ZSR A;  4N5S A;  4CEQ A;  1Y97 A;  4DFJ A;  1LAV A;  2ITG A;  4CFA A;  4IG0 A;  3L2V A;  1JKH A;  3DLH A;  4Z4C A;  5C24 A;  3O4Q A;  5FDL A;  5HBM A;  1D9F A;  3PO4 A;  4FJX A;  4FJ8 A;  3QEW A;  3HL8 A;  4LD0 A;  3HVT A;  1XI1 A;  3V4I A;  4FZY A;  2YV0 X;  4RW4 A;  1XHZ A;  1J5O A;  4KFB A;  3VQ4 A;  3LPU A;  1TK0 A;  4K8X A;  1TKZ A;  3EYZ A;  3QET A;  2OA8 A;  4HCC A;  1ZBL A;  1YTU A;  5DK5 A;  4NYF A;  4O0I A;  3TAE A;  4CHZ A;  2QKK A;  5DMR A;  3ISN C;  3OYN A;  3SUQ A;  1U47 A;  4RW8 A;  4DTR A;  2YHB A;  3RR8 A;  1VSI A;  2HHX A;  1TV6 A;  2OPS A;  3SQ2 A;  3SNN A;  4CJ4 A;  1S1U A;  3QNN A;  4CK3 A;  3QEX A;  4FJL A;  3P1G A;  1JLB A;  1CZB A;  4FZZ A;  1WNS A;  4R5P A;  3HT3 A;  1BIZ A;  3SPY A;  1NOY A;  1VRU A;  1ASV A;  2RPI A;  3ZCM A;  4CGJ A;  3ZSV A;  3KJV A;  1NK7 A;  1IG9 A;  1HRH A;  4B3O A;  3T19 A;  3HPO A;  4DU3 A;  2EX3 A;  1B9D A;  1I39 A;  4FJI A;  2DFF A;  2IAJ A;  3H08 A;  1KCF A;  4FLT A;  2HHV A;  4CK2 A;  4HTU A;  3OYJ A;  4CCH A;  3OY9 A;  1HYZ A;  3PX0 A;  1RBV A;  2FBT A;  2YNG A;  3DRP A;  3HP9 A;  5HRN A;  1VSD A;  1CLQ A;  4OKE A;  1RDA A;  2IOC A;  4PY5 A;  3JYT A;  2GBZ A;  3AA4 A;  3TAB A;  3QIO A;  3MXJ A;  4FYD A;  4BE2 A;  3B6P A;  1X9S A;  1LWE A;  1RDC A;  1ITG A;  3VQE A;  3S9H A;  2HMI A;  3C6U A;  1LV5 A;  4EZ6 A;  3O3G A;  5HLF A;  1DTT A;  3HM9 A;  4CJE A;  4DLE A;  2HHW A;  1JXB A;  4JRQ A;  3RR7 A;  4B8A B;  4KKO A;  5KRS A;  2G8K A;  4FW1 A;  1BCM A;  1B9F A;  4CF9 A;  3D45 A;  3CQ8 A;  1L5U A;  3ZT1 A;  4HCB A;  3L2U A;  3PUF A;  3NH2 A;  3TAP A;  3IG1 A;  1VSM A;  4H4M A;  2OPQ A;  4W5Q A;  4BWJ A;  3VQ6 A;  3HPG A;  2ZE2 A;  1HYV A;  1DLO A;  3AVA A;  4I9L A;  3VQA A;  3AVI A;  1KFS A;  4KTW A;  4Z4I A;  1A5V A;  3LPT A;  2DFE A;  4HVJ A;  3S3N A;  3KKS A;  3RMD A;  5KTQ A;  4B08 A;  4CFC A;  2BGG A;  3SQ1 A;  2HB5 A;  2FBY A;  4DQQ A;  2XY8 A;  2ZD1 A;  1WN7 A;  3C6T A;  3DMJ A;  4DF8 A;  4I9Q A;  1S9G A;  1NK4 A;  4B9U A;  3M8S A;  3OYI A;  3AA3 A;  1X9M A;  4C8L A;  3FFI A;  2G8V A;  2OPP A;  4CJF A;  3KLI A;  3UIQ A;  3TAN A;  5EU7 A;  2XY5 A;  1SKS A;  1KRP A;  3TR8 A;  2D0A A;  1CZ9 A;  2KFN A;  1YT3 A;  3ZSO A;  3L8B A;  4O5B A;  2HND A;  4Z0U A;  3MXI A;  4DLG A;  1RBU A;  2P51 A;  4E7K A;  3LAL A;  3KKR A;  1TAU A;  2VWJ A;  2RN2 A;  1N6Q A;  1JLQ A;  3TI0 A;  3AVC A;  5KI6 A;  2JLE A;  1BIU A;  4CE9 A;  4O0J A;  5SWM A;  3LDS A;  3OYM A;  4DU1 A;  1WLJ A;  1KLN A;  2E4L A;  3RMC A;  1NK5 A;  2OYQ A;  4F2R A;  3VA3 A;  1A5W A;  1VRT A;  2Y1I A;  1QSL A;  2QK9 A;  4DTJ A;  3AVK A;  4BE1 A;  3EY1 A;  1KTQ A;  3VQ9 A;  1CXU A;  3OYF A;  4Y1D A;  1Q9X A;  4OLB A;  3NFA A;  3MED A;  4FK4 A;  1BI4 B;  3WNG A;  1SL2 A;  4QCL A;  1IKW A;  1BIS A;  3AVJ A;  4MQ3 A;  3ULD A;  4BAC A;  3LAK A;  1Q8I A;  3M8P A;  4CJS A;  4CF2 A;  3PX6 A;  2P1J A;  4O55 A;  4FCY A;  3V9X A;  5KGX A;  1BGX T;  1JLA A;  1LAW A;  3ALY A;  4AHR A;  3AV9 A;  4DSE A;  2YNF A;  1L3V A;  3QER A;  4CF1 A;  4DU4 A;  1YVU A;  5J2N A;  1S9E A;  4M45 A;  1L3T A;  4FJM A;  4HUG A;  5J2Q A;  1BCO A;  4LSL A;  3VA0 A;  4KB1 A;  3V1Q A;  4NCA A;  4KI4 A;  4E0D A;  1JXE A;  2Z1I A;  1JL1 A;  3DLG A;  4O44 A;  2Y1J A;  1UWB A;  4FVM A;  2YNH A;  1U4B A;  4GW6 A;  4MFB A;  1DTQ A;  3DLE A;  4CIF A;  4DSI A;  4NCB A;  4DFK A;  1D9D A;  1L3S A;  4M3Y A;  2W42 A;  1EP4 A;  4DTM A;  3QEI A;  5E41 A;  4YNQ A;  3SV3 A;  3PY8 A;  4ELV A;  2E6L A;  3K57 A;  2PYJ A;  4AH9 A;  4NCG A;  1QHT A;  3CG7 A;  1FKP A;  5HRS A;  3CFO A;  3OS1 A;  4DS4 A;  4E7I A;  1WSG A;  4M3X A;  4JS5 A;  3VN5 A;  3AVM A;  3LP2 A;  4KV8 A;  3QIN A;  2WOM A;  3QIP A;  4CEF A;  3AO2 A;  3OYE A;  3ITH A;  1HMV A;  4ID1 A;  4M3R A;  1IO2 A;  3SYZ A;  1C0U A;  1TAQ A;  1I3A A;  3V9Z A;  1O1W A;  3OYC A;  3I0R A;  1U45 A;  1U49 A;  1S1V A;  3NCI A;  3SI6 A;  3VQB A;  3S3O A;  1BQM A;  1QQC A;  1REV A;  3AVG A;  1C0M A;  1HQU A;  3NDK A;  2BAN A;  1VSL A;  4CED A;  3K58 A;  3LWL A;  3NE6 A;  1ZBH A;  4CIG A;  3AVN A;  1G15 A;  3SUN A;  4FJH A;  3V6D A;  1QE1 A;  2IDO A;  1HJR A;  3OYG A;  3M8Q A;  4M41 A;  5JS2 A;  2YKN A;  4DF4 A;  2X6N A;  1BQN A;  2OZM A;  4K8Z A;  2KZM A;  4KO0 A;  3SJJ A;  3A2F A;  1UA0 A;  1TKX A;  3QEP A;  2KTQ A;  3CFR A;  3BDP A;  4FM0 A;  1RIL A;  1J54 A;  2VG7 A;  4DFP A;  4N41 A;  4ELU A;  4G1Q A;  3EZ5 A;  4CHY A;  4DTN A;  3HVR A;  3SV4 A;  4E7J A;  3D0P A;  4EZ9 A;  3KK2 A;  4BDP A;  3OYH A;  4J2D A;  3T1A A;  1RT1 A;  3LP3 A;  1GOA A;  4CEE A;  5SZT A;  4CGH A;  3O3F A;  2RKI A;  1U48 A;  1C0T A;  2NUB A;  3TWH A;  3THV A;  4F3T A;  3AVB A;  4B9M A;  1T05 A;  1LW0 A;  1TGO A;  3SUP A;  1ZYQ A;  1Q9Y A;  1QS4 A;  3RRH A;  3T3F A;  3WNE A;  3VQC A;  4AHC A;  2Z1H A;  1S6P A;  3LAN A;  4CEO A;  1S1W A;  1IH7 A;  1UA1 A;  2ATQ A;  5JS1 A;  3CFP A;  4JS4 A;  3V81 A;  4KHU A;  2A1S A;  1HNI A;  3VQD A;  2VWK A;  2G8I A;  3U3Y A;  5I3U A;  4LSN A;  3KLH A;  4KAZ A;  3ZSY A;  4E1M A;  3G0Z A;  4CHN A;  2PY5 A;  3HK2 A;  4DSJ A;  1J53 A;  1RT4 A;  4KHY A;  2D0C A;  4N76 A;  1TK8 A;  1RT5 A;  1X1P A;  1NKE A;  3SQ0 A;  4HUE A;  3OYA A;  1NJW A;  4Z4H A;  2XY7 A;  3G10 A;  4Q0B A;  1NKC A;  4FLZ A;  4CJV A;  3OJU A;  4DSK A;  1JL2 A;  2DFH A;  4OKJ A;  1W0H A;  1N5Y A;  4M42 A;  4LH4 A;  4KRE A;  1WSI A;  2VG5 A;  4B9N A;  4J2E A;  3KK1 A;  4AHU A;  4CJ5 A;  3DM2 A;  4CJR A;  3LZI A;  3V9U A;  3ZT3 A;  1CXQ A;  4C8N A;  2GUI A;  5FRO A;  2Q3S A;  3AVF A;  4CFB A;  1TK5 A;  4FK0 A;  4J2A A;  2O4G A;  4CFD A;  3KD5 E;  1KVB A;  3KD1 E;  4DSF A;  1XHX A;  2X74 A;  5I42 A;  3IAY A;  3MEC A;  1RNH A;  4AHT A;  5C42 A;  3RWU A;  1JLG A;  1Z25 A;  1S6Q A;  4NYN A;  1VSK A;  3KLG A;  4E7L A;  4EP4 A;  4DSL A;  3C94 A;  3DLK A;  5KRT A;  3CM6 A;  3PX4 A;  3U3G A;  1QSY A;  4RW9 A;  1NJY A;  4PQU A;  3NGZ A;  2A1R A;  4I2P A;  3ZSX A;  4EP5 A;  4Z4F A;  4GVM A;  1LW2 A;  2F96 A;  3HPH A;  2B6A A;  3OYD A;  2G8U A;  1VSF A;  3CM5 A;  2X78 A;  1WSF A;  4CEB A;  4CGI A;  5FRM A;  4FLW A;  3ZSQ A;  3PV8 A;  4PUO A;  3I8D A;  3MEE A;  2YNI A;  4FLU A;  3NGI A;  4KRF A;  2JGU A;  1WSE A;  4L8R B;  4M3Z A;  3KLF A;  4FZX C;  4C8O A;  4I2Q A;  2HW3 A;  1SUQ A;  1TL3 A;  3KTQ A;  4C8K A;  4DG1 A;  1HPZ A;  4AIL C;  4N56 A;  2BDP A;  2HHT A;  2QXF A;  4RW7 A;  4TSX A;  3ZT2 A;  2EHG A;  3CYM A;  4CJQ A;  4M3W A;  4B9T A;  3MXM A;  5C25 A;  1C1C A;  4KHQ A;  3TAF A;  3BGR A;  1XWL A;  1RTH A;  3E01 A;  2B4J A;  4CJU A;  3QEV A;  4DQP A;  4IBN A;  3L2Q A;  4H8K A;  4DTS A;  1RDB A;  4OPK A;  4B9V A;  4ID5 A;  2BE2 A;  4F3O A;  4F8R A;  4E7H A; 
#chains in the Genus database with same CATH topology
 2P9K B;  1SL0 A;  5LL6 Z;  2WC9 A;  3H3N O;  5J1E A;  1SZ2 A;  5K14 A;  4LF8 K;  3ZT4 A;  1HKB A;  5BR9 A;  4BRN A;  4CES A;  4MDB A;  3F73 A;  3O4W A;  1X9W A;  1XUP O;  5EY4 A;  5A2Q O;  3SUO A;  4RG8 A;  1CZA N;  3U6F A;  1KVA A;  1FJG K;  3F9K A;  4EFH A;  2D0B A;  3DI6 A;  2ZM6 K;  3WXM B;  2FXU A;  4H03 B;  3KLE A;  1WAJ A;  3NH1 A;  4KB0 A;  1VQ5 N;  4NLC A;  3PO5 A;  3EE9 A;  1DEJ A;  3HJF A;  3VEO A;  4FWR A;  3ASM A;  5GIO A;  4B9L A;  4WF9 L;  5C15 A;  5JVH L;  4BE0 A;  4U7B A;  1A5X A;  2QI2 A;  1K73 O;  2O8F B;  4DV0 K;  3UKU B;  3UKR B;  2ZJQ L;  3LAM A;  4BRQ A;  3C95 A;  1RDD A;  3K59 A;  3QET A;  2HF4 A;  1QVF M;  3AAQ A;  3OW2 M;  3THY B;  5BPL A;  3L2W A;  4DQS A;  2YHY A;  1IBM K;  2FC0 A;  3H46 O;  4IJN A;  3DXM B;  3CME N;  3P39 A;  3GOI A;  4AM6 A;  4DTP A;  3NAE A;  4YFU A;  4CF8 A;  1KAZ A;  2VCP A;  3IRX A;  1D8Y A;  3DLB A;  1ZC6 A;  4BGA A;  3OYK A;  4JK8 A;  4CEZ A;  2JWK A;  1E4G T;  3QO9 A;  4JI4 K;  3QBX A;  4FJJ A;  1ZBS A;  2D0O A;  5LMU K;  2XRI A;  2HHU A;  3AVH A;  1QSS A;  2OCE A;  1J9A A;  3HXM A;  4BRC A;  3FLC O;  3TTF A;  4BRF A;  4F2S A;  1LWF A;  3MN9 A;  2CH6 A;  2ZQB A;  3LDP A;  2PZS A;  3P83 D;  3ZET B;  2YKM A;  1ZBI A;  1HNZ K;  1NKB A;  4FLY A;  1LWC A;  3K2P A;  3VQ5 A;  4BQL A;  4H4O A;  3RMB A;  4CJP A;  3DRR A;  4ZHR A;  5HRP A;  4JI2 K;  3G4S N;  2Q2R A;  5FLX O;  1RTJ A;  2KZZ A;  5AFU A;  1XC9 A;  4ZTF A;  4QAG A;  4IFE A;  2O8B A;  3HP6 A;  1S1X A;  2NZT A;  4OGC A;  3AO3 A;  2CGK A;  4BR9 A;  1JLF A;  4IG3 A;  2O8C B;  5AQQ A;  4CER A;  4CHO A;  3AO1 A;  1WSJ A;  5FRN A;  3HO1 A;  3CPW M;  3NF9 A;  1JCE A;  3MN6 A;  3VQQ A;  4A2A A;  1TYQ A;  1K8K A;  4N5S A;  1Y97 A;  3O4Q A;  4QS8 A;  1D9F A;  4FJ8 A;  4PHT X;  2W6L A;  4KFB A;  3VQ4 A;  1TKZ A;  3EYZ A;  3RSE A;  4FO0 A;  1ZBL A;  1YTU A;  5DK5 A;  3IFR A;  2OPS A;  3CIP A;  4M7X A;  3MCA B;  4AF1 A;  4CJ4 A;  4CK3 A;  3P1G A;  1CZB A;  4R5P A;  2RPI A;  3ZCM A;  3WXK A;  1HRH A;  3HPO A;  2EX3 A;  4HTL A;  4BQZ A;  4FLT A;  3OYJ A;  1HYZ A;  2NRW A;  3SMS A;  5BN9 A;  4BRD A;  1BOT O;  1QQM A;  2IOC A;  5F1X A;  1GLA G;  1KXP A;  3CXC M;  2V7Y A;  2P9U B;  1X9S A;  1LWE A;  3C6U A;  4FWP A;  4JD2 A;  1MWM A;  2HHW A;  3RR7 A;  2HMP A;  2ZJP L;  1JCF A;  1B9F A;  3VGM A;  1NMD A;  1HR0 K;  4K43 A;  4HCB A;  3NH2 A;  3TAP A;  1M1K O;  1VSM A;  2OPQ A;  3AVA A;  4I9L A;  2E1Y A;  4HVJ A;  3R1X A;  4B08 A;  1VQ8 N;  3A8Y A;  4DF8 A;  4FWQ A;  3GL1 A;  3CJ1 A;  3LL3 A;  1BU6 O;  2G8V A;  1GLF O;  4BG8 A;  3AAP A;  3TR8 A;  1CZ9 A;  2KFN A;  4JI5 K;  3L8B A;  4FZX C;  3AVC A;  5SWM A;  4E1J A;  2J4R A;  3OYM A;  2OYQ A;  3M1F A;  2O8D A;  3RMC A;  4BRL A;  2QK9 A;  5AQJ A;  3AVK A;  4BR4 A;  3EY1 A;  4B9Q A;  1HJO A;  3VMF B;  1VQL N;  4Y1D A;  2A40 A;  3MWT A;  3NFA A;  4F9O A;  3CJB A;  3M3Z A;  3ULD A;  3M8P A;  4CF2 A;  3PX6 A;  1U2V A;  4BRP A;  2P1J A;  2KKZ A;  4O55 A;  1LAW A;  2I7P A;  3ALY A;  4AHR A;  4DR5 K;  3IUC A;  2NRH A;  3QER A;  4B1Y B;  5J2N A;  4FJM A;  1BCO A;  4QS9 A;  3DLG A;  4NO7 A;  5BRH A;  1U4B A;  4GW6 A;  1DTQ A;  3DLE A;  3H1V X;  1L3S A;  4M3Y A;  3QEI A;  3K57 A;  3CG7 A;  1FKP A;  3CFO A;  4E7I A;  4RWT A;  1WSG A;  4M3X A;  4JS5 A;  5I9E B;  4K41 A;  3AVM A;  3VPZ A;  4FVU A;  2WOM A;  3UE5 A;  3OYE A;  4DV7 K;  3V9Z A;  1T6D A;  2O8E B;  4DV4 K;  3NCI A;  3SMP A;  1BQM A;  1OVQ A;  1REV A;  1C0M A;  1HQU A;  3AVG A;  4KH5 A;  3TTD A;  3K58 A;  2UXC K;  1N33 K;  2CGL A;  3AVN A;  1BO5 O;  3SUN A;  4FJH A;  3OYG A;  1HJR A;  2OZM A;  3M8Q A;  4K8Z A;  2YKN A;  5EOY A;  3SJJ A;  3K9J A;  4FL9 A;  1NGF A;  3P31 A;  4ELU A;  4BC3 A;  4BRM A;  4JV5 K;  1Y64 A;  4EZ9 A;  1RDU A;  3FZL A;  3TU5 A;  1GOA A;  4IWV A;  3CJ7 A;  2P9N A;  4F3T A;  3AVB A;  4B9M A;  1LW0 A;  5M1O A;  1QS4 A;  2A42 A;  1BDG A;  4CEO A;  4CBW A;  1IH7 A;  2ASO A;  4JK9 A;  4OO1 J;  3QFP A;  3U3Y A;  5KPT A;  3D6R A;  2V7Z A;  4DSJ A;  3S41 A;  4DV6 K;  3HM8 A;  5AQW A;  4Z4H A;  1HLU A;  4Q0B A;  4IEE A;  2DFH A;  5FPE A;  3QIC A;  4GKK K;  4KRE A;  4B9N A;  4J2E A;  3C6H A;  3ATU A;  3C6A A;  4C8N A;  2GUI A;  5FRO A;  2Q3S A;  2UU9 K;  3KD5 E;  4CFD A;  1YVN A;  3MEC A;  1RNH A;  1R59 O;  4AHT A;  2GWJ A;  4FSV A;  4CZH A;  5C42 A;  1K9M O;  1Z25 A;  1S6Q A;  2GX9 A;  2QWL A;  4E7L A;  5KRT A;  3I8B A;  3U3G A;  1NJY A;  3T69 A;  4PQU A;  4LF9 K;  3FE1 A;  5C2F A;  4Z4F A;  3OYD A;  5KPZ A;  2G8U A;  2B6A A;  3CC2 N;  4H0V B;  1VSF A;  3WXL A;  2X78 A;  3JAM O;  2YJE A;  2UYT A;  3ZLJ A;  3O9T A;  4JKD A;  3LDN A;  4FLW A;  3MEE A;  4KRF A;  2JGU A;  3FFK B;  1OH7 A;  4L8R B;  4C8O A;  3KTQ A;  2O8E A;  4AIL C;  4LC9 B;  2HHT A;  2VWB A;  2QXF A;  4CJQ A;  4M3W A;  1W2B M;  2E8A A;  1Z05 A;  3MXM A;  5HL7 L;  3WXI A;  3BGR A;  1RTH A;  4Z94 A;  3QEV A;  4BRH A;  1ZXO A;  2NLX A;  4B9V A;  2P9L A;  3THX B;  5C0Y A;  1OH6 A;  3DYA A;  3MEG A;  4MDA A;  2P9I B;  4KI6 A;  2DY4 A;  4DV2 K;  5HRO A;  5AQH A;  1RBS A;  4IO9 L;  3NBP A;  4XH4 A;  1RT6 A;  1BUP A;  4E3S A;  1SKW A;  4DV1 K;  2Z1G A;  4FJ9 A;  4IDH A;  1VQP N;  4DR6 K;  3DAW A;  2P5O A;  4FJG A;  3TAM A;  1T7P A;  3ZSZ A;  1NGB A;  3LM9 A;  5AQX A;  4FK2 A;  1NK6 A;  4B1Z A;  4CBU A;  5CZ2 A;  4FWO A;  2QA4 N;  4H5W A;  4CJT A;  3KVG A;  3JS6 A;  3NF6 A;  3CER A;  5AQV A;  3AGR A;  2AP1 A;  1SKR A;  3L3V A;  4W5T A;  2KW4 A;  1NMN A;  1XMQ K;  1HQE A;  1YAG A;  3NH0 A;  5CYM A;  3LM2 A;  4C1N K;  2IGI A;  2F7T A;  4OKK A;  1ASW A;  4JK7 A;  1W9H A;  4JKE A;  5AZI B;  3SAH A;  4FJN A;  1QVG M;  5E26 A;  3O1W A;  4CZF A;  3VGL A;  2P9S A;  3KIO A;  1FK9 A;  4BRG A;  1ZBF A;  1K6Y A;  4Q5V A;  3I55 N;  3L2R A;  1G99 A;  3J8A A;  5JMV A;  3C65 A;  3HRG A;  4BR0 A;  4KPY A;  1C1B A;  4B3R K;  4DUY K;  1NGH A;  4HUF A;  4DUZ K;  4WQ5 A;  3CJ9 A;  1WOQ A;  4FM2 A;  1IKX A;  4CGF A;  4DQR A;  3SZ2 A;  1FXX A;  4FXD A;  5AQR A;  1YJW N;  3O3H A;  2CH5 A;  2GEM A;  4IDK A;  4FLX A;  5HOO A;  4FJK A;  1X3N A;  4YOT A;  5AJ3 K;  1M90 O;  1VQ7 N;  3VOV A;  5AQN A;  4E19 A;  2QWP A;  5TKW A;  4PA1 A;  2G8F A;  3B6O A;  2B5J A;  1R0A A;  4CJK A;  3AA5 X;  2ZWH A;  5CE3 A;  4U67 L;  3J81 O;  2E1Z A;  5LMN K;  4JI8 K;  3SQ4 A;  1RBT A;  2FBV A;  1EKE A;  3A5N C;  4CEA A;  3ZSW A;  4XIU A;  3SPZ A;  3OYL A;  3H1Q A;  3GDQ A;  4UQG A;  1BL3 A;  3BF1 A;  4JLH A;  4BDZ A;  3CD6 N;  1VK0 A;  3CF5 L;  2ASM A;  3CC4 N;  1S5J A;  4I9Q A;  3RTV A;  2I7N A;  3AGK A;  3HSC A;  4EHT A;  1MU2 A;  4FWL A;  3TAQ A;  1RT2 A;  1IKY A;  5BR8 K;  3W3D A;  2IIR A;  2KLA A;  4LY7 A;  3ENO A;  3U9D A;  4OGE A;  3ATV A;  2FF6 A;  1TL1 A;  1VHX A;  1RTD A;  3DOK A;  4IKF A;  4JI6 K;  3QNO A;  2Q31 A;  3E66 A;  3OS2 A;  3O6W A;  1TVR A;  4MLE A;  3JSM A;  1W7A A;  3P4I A;  1N34 K;  1VSH A;  2F8S A;  3DRS A;  4CVN E;  4IJA A;  2D1K A;  1T44 A;  4DS5 A;  1ZBU A;  3RRG A;  3WNF A;  4I6M A;  4KHS A;  2G8W A;  4CEQ A;  1LAV A;  2ITG A;  3DLH A;  4FJX A;  5FDL A;  5HBM A;  4JI0 K;  3QEW A;  2QM1 A;  5LY3 A;  3L6Q A;  3T1H K;  2YV0 X;  4RW4 A;  4JYA K;  1XHZ A;  1J5O A;  1KD1 O;  1TK0 A;  4K8X A;  2OA8 A;  3VF2 A;  2QTD A;  4NYF A;  2FSK A;  4O0I A;  3TAE A;  2QKK A;  2FSN A;  3AY9 A;  2GWK A;  3ZET A;  1U47 A;  4RW8 A;  2YHB A;  3RR8 A;  3QEX A;  4EHU A;  1JLB A;  4FZZ A;  2IVN A;  3QDK A;  4A2B A;  4CGJ A;  4XH5 A;  3KJV A;  2HHH K;  4B3O A;  4DU3 A;  1I39 A;  4ISG A;  5BPM A;  4HTU A;  4CCH A;  3OY9 A;  3O9Q A;  1IBK K;  1VSD A;  4CW7 B;  1CLQ A;  1RDA A;  3G25 A;  2GBZ A;  3THW B;  3AA4 A;  3KWI A;  3FGU A;  3LDQ A;  4FYD A;  1RDC A;  1ITG A;  1GLD G;  4EZ6 A;  4GV6 A;  5HLF A;  1DTT A;  5JLF A;  3BF3 A;  1NLV A;  4YOR A;  1JJ2 M;  2HST A;  3R8E A;  4BRA A;  1HNX K;  1ILY A;  4CF9 A;  3D45 A;  3JXU A;  1L5U A;  1NNE A;  4C23 A;  4BC4 A;  3FR0 A;  5ELZ A;  3VQ6 A;  3AVI A;  3O9S A;  3CJA A;  3LPT A;  2DFE A;  3RMD A;  4CFC A;  1BWF O;  3U9Z A;  1VQK N;  3C6T A;  3DMJ A;  1KAX A;  2ASP A;  3AA3 A;  4CZK A;  4BRO A;  3FFI A;  2A5X A;  3TAN A;  1SKS A;  3OTO K;  4YDU C;  1YT3 A;  3ZSO A;  5LJW A;  3J7Y P;  4NXM K;  1WUA A;  2P51 A;  2D4W A;  3ENH A;  5AQG A;  4BC5 A;  5LJV A;  3TI0 A;  1BIU A;  4O0J A;  1KLN A;  2E4L A;  5BRE A;  1NK5 A;  3E9P A;  3VA3 A;  1QSL A;  3A5M C;  2A41 A;  4DTJ A;  1RFQ A;  1BA0 A;  2JWL A;  4JHD A;  1Q9X A;  4OLB A;  3MED A;  4QCL A;  3CMA N;  1BIS A;  1Q8I A;  3KHY A;  4CJ7 A;  2OTL N;  2QWM A;  1BGX T;  1BA1 A;  3QBW A;  1GLC G;  3CC7 N;  2FLO A;  2QWN A;  1L3V A;  1YVU A;  3CPE A;  3M6G A;  3RSE B;  2UUB K;  2HBL A;  1OKJ A;  4B3S K;  1JXE A;  2WFB A;  1C0G A;  2H3G X;  3EKU A;  4CIF A;  4DFK A;  2W42 A;  1EP4 A;  4H5T A;  4YNQ A;  3EO3 A;  3PY8 A;  4ELV A;  2E6L A;  4AH9 A;  3PSF A;  4YOY A;  1T6C A;  1H1V A;  4PKI A;  4CZI A;  5C12 A;  4CEF A;  3T1Y K;  3TAB A;  1IO2 A;  2YHW A;  1I3A A;  1U45 A;  1KAY A;  4CI6 A;  1QQC A;  1VSL A;  4X65 K;  3LWL A;  4O8K A;  1EWQ A;  4K0K K;  3V6D A;  2IDO A;  5JS2 A;  1TUY A;  2KZM A;  4H0X B;  2X6N A;  1BQN A;  5AQF A;  5AQY A;  4KO0 A;  1KQS M;  3THW A;  3A2F A;  4WCE L;  1TKX A;  5DM6 L;  3QEP A;  4GNI A;  3BDP A;  3VEV A;  4B1V A;  1J54 A;  2WTU A;  4N41 A;  4G1Q A;  3EZ5 A;  4CHY A;  4DTN A;  3SV4 A;  2UUA K;  3D0P A;  2AA4 A;  3KK2 A;  3ID6 A;  3OYH A;  1ATR A;  5AZJ A;  3T1A A;  1RT1 A;  5SZT A;  3D7E O;  3O3F A;  4CGH A;  1N32 K;  2NUB A;  3TWH A;  1GLJ O;  4WQ4 C;  1RDW X;  1Q9Y A;  1TGO A;  3CCJ N;  4NXN K;  3RRH A;  4IEI A;  2YCH A;  1UA1 A;  2ITM A;  3CFP A;  4JS4 A;  1ATS A;  3CCS N;  1IG8 A;  5I3U A;  2E2N A;  4PL8 A;  2NRR A;  4KAZ A;  3FZM A;  3ZSY A;  2PY5 A;  2D0C A;  4N76 A;  1VQ6 N;  1DKG D;  1OH5 A;  1NJW A;  4DSK A;  1JL2 A;  4I6M B;  1W0H A;  5AQU A;  4M42 A;  4KH4 A;  2E2P A;  1WSI A;  2VG5 A;  3V9U A;  3L0Q A;  1CXQ A;  4MO5 A;  5KPR A;  1TK5 A;  4O5F A;  3QB0 A;  3DXM A;  4J2A A;  2W6K A;  2X74 A;  2ZF5 O;  1LOT B;  4JI1 K;  3CCV N;  4DV3 K;  3RWU A;  1JLG A;  3A5L C;  4FPA A;  4LF6 K;  3GBT A;  5FPN A;  2EWS A;  1QSY A;  4RW9 A;  3CCQ N;  4EP5 A;  5M1K A;  3HPH A;  3UKU A;  3U8X A;  3VEX A;  1WSF A;  2E2O A;  5FRM A;  3I56 N;  3I8D A;  4FLU A;  2YNI A;  4XEI A;  1WSE A;  3SJH A;  4OPH A;  3KLF A;  3O9U A;  2HW3 A;  1QQO A;  5GIN A;  4N56 A;  2VGM A;  4TSX A;  3ZT2 A;  2EHG A;  3EZW A;  3K9K A;  4DR1 K;  4KHQ A;  3TAF A;  4DQP A;  4IBN A;  2BH1 A;  5IT9 O;  4H8K A;  1EQY A;  4JHD B;  4DTS A;  1Q82 O;  2BE2 A;  4E7H A;  3THV A;  4H0O A;  4DWI A;  2GV9 A;  1SQK A;  4CIE A;  5AQM A;  1NBW A;  4DB3 A;  4ZTJ A;  1DGK N;  2FBX A;  4IFV A;  2UUC K;  3AVL A;  4LF7 K;  3TAR A;  4QOZ B;  3VES A;  3N4Q A;  1RT3 A;  4E89 A;  3V1R A;  3S3M A;  4MO4 A;  2PYL A;  2LSN A;  3L3U A;  5AQO A;  5MLC Q;  1XNR K;  4OPJ A;  3BEX A;  3HI0 A;  3WEE A;  3OVN A;  5AFU H;  3QLH A;  1FKO A;  1BI4 A;  3ZX2 A;  5CR4 A;  4O4G A;  4CHP A;  4V19 S;  1B92 A;  1UOC A;  4B8C A;  1RTI A;  4DFM A;  5KQ8 A;  3J7A P;  3VEZ A;  3NF8 A;  4GV3 A;  2QWR A;  3M8R A;  4WQ5 C;  5C2D A;  3C7N B;  3K5L A;  4JAX A;  2UXB K;  4DV5 K;  3D2E A;  4DTU A;  5AZI A;  3EN9 A;  3VEN A;  4FWM A;  4BDY A;  2E6M A;  4DQI A;  5CHI A;  2D0P A;  2DTU A;  1T03 A;  1VSE A;  4FJ7 A;  1KLM A;  1C1A A;  1WB9 A;  4W5O A;  3A5O C;  3VQ7 A;  4CHQ A;  4NLB A;  4W5N A;  3O4N A;  4H0T B;  5GAE P;  2IVO A;  4IXC A;  1NOZ A;  1EX4 A;  5BN8 A;  2X6S A;  3VQ8 A;  2KHO A;  2HVH A;  3SBT A;  3AAR A;  1HNW K;  3LP1 A;  1S72 N;  2GEL A;  1RBR A;  1HYS A;  1YXQ A;  4KTQ A;  2F8T A;  4A61 A;  3TPQ A;  4CK1 A;  1OH8 A;  1IKV A;  4WQ4 A;  4AHS A;  4FW2 A;  1D5A A;  4NB4 A;  1S22 A;  4BWM A;  3ZEU A;  4CGD A;  5GAD P;  3MAQ A;  2HVI A;  1F21 A;  2O4I A;  4WE1 A;  4BY9 C;  3HST B;  4WFB L;  4Y1C A;  4DMN A;  1IV0 A;  4F4K A;  3MX2 A;  4H5V A;  4IFY A;  3G71 N;  1N36 K;  3K5O A;  3Q7C A;  4H5R A;  4FLV A;  3CJC A;  4WYB A;  3NF7 A;  2RF2 A;  4Z4E A;  5KGW A;  4A59 A;  2Z1J A;  3V9S A;  4GMJ B;  1T8E A;  4H5N A;  2CGJ A;  5CY4 A;  1TKD A;  2QW9 A;  2HNZ A;  3MMV A;  2IC3 A;  1HNV A;  4EIA A;  1YIT N;  4Z4G A;  2QKB A;  2KFZ A;  3CCR N;  4Y0W A;  5AQI A;  3ZT0 A;  5J2M A;  2IS3 A;  5CYQ A;  2OPR A;  4BR5 A;  3PIO L;  3EL2 A;  1GOC A;  2ETJ A;  4ILH A;  4J2B A;  2RHK A;  1QHA A;  2OTJ N;  4CJL A;  4CEC A;  1NK9 A;  4OX9 K;  3NGY A;  3MK6 A;  4JKA A;  1NJZ A;  5J2P A;  1RCH A;  4CZL A;  3IKM A;  3VER A;  3KK3 A;  4N47 A;  1YJ9 N;  3ZSR A;  4DFJ A;  3CQY A;  3VET A;  4IG0 A;  3PO4 A;  4Z4C A;  5C24 A;  1NGG A;  3D2F B;  3H45 C;  3OHR A;  1NGJ A;  3MCP A;  4FZY A;  4FWK A;  3LPU A;  1Q86 O;  1V4T A;  1J6Z A;  4CHZ A;  5DMR A;  3MDQ A;  3P38 A;  3ISN C;  3R3L A;  3SUQ A;  4DTR A;  5JLH A;  1VSI A;  1TV6 A;  4AQY K;  3SQ2 A;  3SNN A;  4YHH K;  1S1U A;  3VF6 A;  3CCM N;  3HT3 A;  1NOY A;  1ASV A;  5GAG P;  3LDO A;  2P9N B;  2HF3 A;  3ZSV A;  1NK7 A;  3T19 A;  1B9D A;  4FJI A;  4GKJ K;  2IAJ A;  1KCF A;  4CZJ A;  4IO8 A;  4LF4 K;  4KH6 A;  3PX0 A;  2P9S B;  2FBT A;  3DRP A;  3HP9 A;  5HRN A;  3QIO A;  3MXJ A;  2UXD K;  2E88 A;  2E2Q A;  4FOI A;  3F2K A;  3VQE A;  5EVZ A;  3C0B A;  5M1Q A;  3EE8 A;  4BR7 A;  1K8A O;  4B8A B;  3TSU A;  2G8K A;  3IMX A;  4CD1 A;  3CQ8 A;  1QZ6 A;  3ZT1 A;  3PSI A;  3L2U A;  3E9L A;  3PUF A;  4JI7 K;  4H4M A;  4BWJ A;  2QEX N;  3HPG A;  2ZE2 A;  5BRD A;  1DLO A;  1KFS A;  4LF5 K;  4Z4I A;  1A5V A;  2NRZ A;  3O80 A;  5KTQ A;  2BGG A;  2HB5 A;  2FBY A;  4DQQ A;  4BRK A;  2XY8 A;  1WN7 A;  5DM7 L;  2VQE K;  1S9G A;  1P90 A;  2DPN A;  3M8S A;  3OYI A;  1X9M A;  4L3Q A;  2VYP A;  3I33 A;  1RGI A;  3KLI A;  4BVO A;  5EU7 A;  2NRX A;  1KRP A;  2D0A A;  3SLC A;  4O5B A;  4Z0U A;  3L4Q A;  1RBU A;  4E7K A;  3O9R A;  3KKR A;  2GUP A;  5E84 A;  1GLE G;  2JLE A;  5KI6 A;  4CE9 A;  4DU1 A;  3LDS A;  1WLJ A;  1Q81 O;  2P9I A;  3IDH A;  4BE1 A;  1EWR A;  3VQ9 A;  1GLL O;  2P9L B;  3THX A;  3OYF A;  2HBK A;  1SL2 A;  1IKW A;  3AVJ A;  4MQ3 A;  4BAC A;  5KQD A;  3LAK A;  3DWL A;  3SAF A;  4FCY A;  3V9X A;  5KGX A;  1JLA A;  1SS6 A;  4DSE A;  2YNF A;  4CF1 A;  3QFU A;  4K42 A;  4M45 A;  1L3T A;  1W97 L;  3E1Y A;  4KB1 A;  4NCA A;  2Y1J A;  1JL1 A;  4O44 A;  1UWB A;  2YNH A;  4MFB A;  4NCB A;  4DTM A;  1FW6 A;  1HPM A;  1N8R O;  4DR3 K;  4NCG A;  3KK7 A;  5HRS A;  3BUZ B;  4DS4 A;  4KHP K;  4JKG A;  3LP2 A;  4B1U B;  3QIN A;  4ID1 A;  1HMV A;  1TAQ A;  4JKB A;  1O1W A;  3OYC A;  1S1V A;  3SI6 A;  3VQB A;  3DXK B;  3J80 O;  1NJX A;  3NDK A;  4CED A;  1HX1 A;  3NE6 A;  4X64 K;  1XI1 A;  2P9U A;  2G8H A;  3KD1 E;  3ZYY X;  1XMO K;  1UA0 A;  2KTQ A;  3B8A X;  3CFR A;  1RIL A;  2VG7 A;  4DFP A;  4E7J A;  3HOT A;  2PBD A;  3NVK A;  2Q97 A;  1QQN A;  4CEE A;  2RKI A;  1U48 A;  1C0T A;  4A57 A;  3SUP A;  3W0L A;  1ZYQ A;  3T3F A;  3WNE A;  3VQC A;  4AHC A;  2Z1H A;  5JIC A;  2ATQ A;  3V81 A;  4BGB A;  1HNI A;  3VQD A;  1SAZ A;  2G8I A;  1NWK A;  3G0Z A;  5EX5 A;  4WFA L;  1J53 A;  4KHY A;  3MN7 A;  2WBN A;  2QXL A;  4ILG B;  3ZX0 A;  2BTF A;  1TK8 A;  3CCU N;  3SQ0 A;  3E9O A;  4HUE A;  3OYA A;  4CBX A;  3G10 A;  2XY7 A;  1NKC A;  3RVC A;  2E20 A;  2P9P A;  3BY5 A;  3CET A;  3OJU A;  1X9J A;  4OKJ A;  1K8K B;  4FLZ A;  2IVP A;  1N5Y A;  4LH4 A;  1HKG A;  4B3T K;  3KK1 A;  4AHU A;  3LZI A;  3DM2 A;  4CJR A;  3ZT3 A;  3HTV A;  4FWN A;  4CFB A;  3T7Z A;  4FK0 A;  3ID8 A;  4CD3 A;  1XHX A;  2O8C A;  4ISE A;  3IAY A;  1KC8 O;  1VSK A;  3KLG A;  2QWQ A;  4BG9 A;  4DSL A;  3DLK A;  3GG4 A;  3R9P A;  3NGZ A;  4DCH A;  2O8B B;  4I2P A;  5GIP A;  1JCG A;  4GVM A;  1LW2 A;  3VF4 A;  4GY2 B;  4CEB A;  4CGI A;  2GTD A;  2HBJ A;  2RE2 A;  2YHX A;  3U4L A;  3ZSQ A;  1MDU B;  3K0S A;  4M3Z A;  3O1B A;  4I2Q A;  4JNE A;  1SUQ A;  1TL3 A;  3L4I A;  4C8K A;  4DG1 A;  4IOX A;  3HZ6 A;  3CYM A;  1U2V B;  4RTF D;  3M5R A;  3VEY A;  4B9T A;  4JKG B;  1C1C A;  4FPB A;  1XWL A;  3E01 A;  1D4X A;  4CJU A;  1WBD A;  5AQS A;  4OPK A;  4F8R A;  4KHU A;  2Q0R A;  2WON A;  3ENB A;  1JLC A;  4FJ5 A;  4O8U A;  2HHQ A;  4KTZ A;  4E1N A;  2O8D B;  5AR0 A;  5IWA K;  3LZJ A;  4KHW A;  5AQK A;  4DKW A;  4M3T A;  1WSH A;  1O13 A;  4JKF A;  2XY6 A;  4FOE A;  1EO1 A;  3V9W A;  3DLR A;  5EXW A;  2F9T A;  1ESV A;  3OYB A;  4M3U A;  1Z26 A;  3I0S A;  3IS9 A;  3H3O B;  4CGG A;  2YX6 A;  5AQT A;  1SL1 A;  5BRF A;  3PLA A;  3BZC A;  5F0X A;  1JLE A;  4OLA A;  3KZB A;  3H6E A;  2ZGZ A;  1EET A;  1KFD A;  4G9Z A;  4OJR A;  5M1P A;  2XHB A;  2KQ2 A;  3THY A;  2Q1N A;  3RMA A;  5D3G A;  4B9S A;  5HP1 A;  4RW6 A;  3AA2 A;  2O8F A;  4DTO A;  2W40 A;  1EXQ A;  3HOS A;  1BHL A;  1C6V A;  4DTX A;  2YHA A;  3DOL A;  4JD2 B;  1NM1 A;  2Q0U A;  3WQU A;  3CI5 A;  2OAN A;  1Q7Y O;  3MN5 A;  4C8M A;  3P5J A;  2XO7 A;  1S1T A;  3S3O A;  5HRR A;  3K5M A;  5AQL A;  2PFU A;  1Z6R A;  3K5N A;  4CJ3 A;  3MWP A;  4HHT A;  3OA9 A;  1L3U A;  3OS0 A;  2I5J A;  3GE1 A;  3LWM A;  2OZS A;  4AHV A;  1KVC A;  3TAG A;  1YUW A;  1QTM A;  4OVL A;  4LFB K;  4YOX A;  1SV5 A;  5T7B A;  1TKT A;  4PKG A;  4YOV A;  3VEW A;  4BR2 A;  3VQP A;  1ASU A;  1YF5 L;  2P9P B;  4WFN L;  2R7Y A;  4CJW A;  3A0I X;  3VGK A;  4JRP A;  1VQM N;  1NGD A;  1VSJ A;  1VQ4 N;  1GOB A;  3OBW A;  4ELT A;  1VQN N;  1YJN N;  3SBG A;  2QWO A;  1TYQ B;  1WBB A;  3F9M A;  2P5G A;  3WT0 A;  3LDL A;  1U04 A;  5B8H A;  5AQZ A;  3AO4 A;  3F5T A;  4ICL A;  1WAF A;  2NRT A;  2NRV A;  3SCX A;  3AO5 A;  1YTA A;  1IJJ A;  2Q36 A;  5CZ1 A;  3LP0 A;  2HHS A;  4KBO A;  1NK8 A;  4KHN A;  4W5R A;  5FPD A;  1HUX A;  1NG9 A;  4FM1 A;  3CHW A;  3D2F A;  2VG6 A;  2VGN A;  3NHG A;  3DLL L;  4LH5 A;  2HNY A;  1KSP A;  4PWD A;  4BRE A;  2AJQ A;  2D5R A;  1RT7 A;  2ZGY A;  3PIP L;  4A62 A;  3HYF A;  3DXK A;  4DR7 K;  3OJS A;  1BG3 A;  3EEQ A;  3QES A;  4I7F A;  3WNH A;  1HKC A;  4H0P A;  5JVG L;  1NK0 A;  3WQT A;  3MX5 A;  1UAX A;  1I94 K;  4C1N I;  4CF0 A;  3V1O A;  4DR4 K;  4B3M K;  4CFA A;  4J2D A;  3L2V A;  1JKH A;  2V51 B;  3HL8 A;  4LD0 A;  1X3M A;  3HVT A;  5M1N A;  3V4I A;  1NGC A;  4HCC A;  2HBM A;  3OYN A;  2HHX A;  1XQS C;  1XNQ K;  3UB5 A;  4XH1 A;  3QNN A;  4FJL A;  1WNS A;  1BIZ A;  2E5L K;  4FWS A;  3SPY A;  1VRU A;  2A3Z A;  1IG9 A;  4DR2 K;  3ZEU B;  2DFF A;  3H08 A;  2HHV A;  4K25 A;  4CK2 A;  1T3V A;  4OPA A;  1RBV A;  2YNG A;  4QS7 A;  3Q7B A;  4OKE A;  3KWG A;  4PY5 A;  4IOA L;  3JYT A;  3NVM A;  4ILJ A;  1VQO N;  4LFC K;  4DHY A;  4GV9 A;  4BRI A;  4BE2 A;  3UKR A;  3B6P A;  1Q18 A;  3FZH A;  3S9H A;  4X62 K;  3TSQ A;  2HMI A;  1LV5 A;  3O3G A;  3ULE B;  3G6E N;  3HM9 A;  4CJE A;  4DLE A;  4YOU A;  1JXB A;  4JRQ A;  1YIJ N;  2A6A A;  4KKO A;  5BPN A;  5H1S Q;  1OVY A;  4RCH A;  1E4F T;  5KRS A;  1NGA A;  3EKS A;  4FW1 A;  1BCM A;  3TTC A;  3CCE N;  3IG1 A;  4W5Q A;  1HYV A;  3VQA A;  4PKH A;  4KTW A;  1J5E K;  3S3N A;  3KKS A;  4ISF A;  3SQ1 A;  3CCL N;  2ZD1 A;  1QZ5 A;  1S3X A;  1NK4 A;  4B9U A;  5F2R A;  4JKC A;  4C8L A;  4X66 K;  3UIQ A;  2OPP A;  4CJF A;  2XY5 A;  3O8M A;  3D2E B;  1P8Z A;  2YI1 A;  3MXI A;  2HND A;  1TAU A;  3LAL A;  2VWJ A;  2RN2 A;  1N6Q A;  1JLQ A;  3J7Z O;  2P9K A;  4F2R A;  1A5W A;  1U6Z A;  1VRT A;  3FZF A;  5ADX H;  2Y1I A;  1KTQ A;  1YI2 N;  1CXU A;  4FK4 A;  1BI4 B;  3WNG A;  2F4V K;  1DT9 A;  3WEE B;  4CJS A;  4LFA K;  1NU0 A;  3WXJ A;  3AV9 A;  4A5A A;  4UY8 O;  5M1F A;  1ATN A;  4DU4 A;  1S9E A;  4HUG A;  5J2Q A;  4LSL A;  4EAH D;  3VA0 A;  3V1Q A;  4KI4 A;  4E0D A;  2Z1I A;  3NMU A;  1V4S A;  4J8F A;  3HBT A;  3BP8 A;  4FVM A;  4B1W B;  4YDU A;  4DSI A;  1D9D A;  3QML A;  5E41 A;  3SV3 A;  2PYJ A;  1QHT A;  3DJC A;  3ZX3 A;  3OS1 A;  1YHQ N;  4HWI A;  3VN5 A;  4KV8 A;  4IOC L;  3QIP A;  3AO2 A;  4IZ9 A;  3ITH A;  1NGE A;  4B1X B;  4M3R A;  5GAH P;  3SYZ A;  1C0U A;  3PX4 A;  1U49 A;  1NJI O;  3I0R A;  3FZK A;  4DLG A;  2BAN A;  1ZBH A;  3ULE A;  4CIG A;  1G15 A;  3O08 A;  1QE1 A;  5AQP A;  4M41 A;  3VTI A;  4DF4 A;  2BUP A;  4FM0 A;  3HVR A;  4BVP A;  1LCU A;  4JEP A;  5FPM A;  4BDP A;  4JI3 K;  3LP3 A;  4JKH A;  1VAZ A;  1T05 A;  1MWK A;  1C0F A;  1S6P A;  4PL7 A;  3LAN A;  1S1W A;  4JN4 A;  2YJF A;  5JS1 A;  2A1S A;  3VTH A;  2W41 A;  2VWK A;  4LSN A;  3KLH A;  2F9W A;  4E1M A;  4CHN A;  3HK2 A;  3OBY A;  1RT4 A;  1E3M A;  1RT5 A;  1X1P A;  1NKE A;  4YY3 K;  1XC3 A;  3SAG A;  4CJV A;  3R6M A;  1GLB G;  4MLH A;  4CJ5 A;  4M7Y A;  5ADX A;  1VQ9 N;  3AVF A;  5TKY A;  3WUH A;  2O4G A;  2HOE A;  1KVB A;  4DSF A;  5I42 A;  2ZJR L;  5AZJ B;  4GVE A;  4NYN A;  4R79 A;  4YOW A;  4A5B A;  4EP4 A;  3C94 A;  3CM6 A;  4CZG A;  3TSP A;  4CZM A;  2A1R A;  2NNW A;  3ZSX A;  3BZK A;  5C10 A;  2F96 A;  3O5B A;  4M63 C;  3CM5 A;  4BC2 A;  1IBL K;  4AM7 A;  3N4P A;  3PV8 A;  4PUO A;  2VQF K;  2V52 B;  3NGI A;  2FSJ A;  1HPZ A;  2PAV A;  2BDP A;  1MA9 B;  3C7N A;  1TUU A;  4RW7 A;  1NGI A;  4H0Y B;  5C25 A;  2WUS A;  3CQX A;  2B4J A;  4DQ8 A;  3L2Q A;  2FF3 B;  4CZE A;  1RDB A;  4F3O A;  4ID5 A;  3SK3 A; 
#chains in the Genus database with same CATH homology
 2WON A;  1JLC A;  4FJ5 A;  4DWI A;  2GV9 A;  3DYA A;  3MEG A;  4KI6 A;  1SL0 A;  2HHQ A;  4KTZ A;  4CIE A;  4E1N A;  2DY4 A;  4KHW A;  3LZJ A;  4ZTJ A;  4M3T A;  5HRO A;  1WSH A;  2FBX A;  4IFV A;  1RBS A;  3AVL A;  3NBP A;  3TAR A;  5J1E A;  4QOZ B;  1RT6 A;  2XY6 A;  4E3S A;  1SKW A;  1RT3 A;  4E89 A;  2Z1G A;  5K14 A;  3V1R A;  3DLR A;  3V9W A;  3S3M A;  4FJ9 A;  2PYL A;  2LSN A;  2P5O A;  4FJG A;  3ZT4 A;  3TAM A;  1T7P A;  4CES A;  3OYB A;  3ZSZ A;  4M3U A;  1Z26 A;  3I0S A;  3L3U A;  3F73 A;  3IS9 A;  4OPJ A;  1X9W A;  4FK2 A;  4CGG A;  1NK6 A;  3OVN A;  3SUO A;  1SL1 A;  4RG8 A;  3QLH A;  1FKO A;  1BI4 A;  5CZ2 A;  3U6F A;  1KVA A;  1JLE A;  4OLA A;  3F9K A;  4CJT A;  1NJX A;  4O4G A;  1EET A;  1KFD A;  2D0B A;  1B92 A;  3NF6 A;  4CHP A;  1UOC A;  4OJR A;  4B8C A;  3DI6 A;  1SKR A;  2XHB A;  1RTI A;  2KQ2 A;  3KLE A;  3L3V A;  1WAJ A;  3NH1 A;  4DFM A;  4KB0 A;  4W5T A;  3RMA A;  5D3G A;  2KW4 A;  3NF8 A;  3PO5 A;  1HQE A;  3HJF A;  3NH0 A;  4B9S A;  3M8R A;  5CYM A;  3ASM A;  3K5L A;  4B9L A;  5HP1 A;  4BE0 A;  4RW6 A;  4DTU A;  1A5X A;  3AA2 A;  4BDY A;  4DTO A;  2E6M A;  2IGI A;  4DQI A;  1EXQ A;  4OKK A;  1ASW A;  1BHL A;  2DTU A;  1C6V A;  4DTX A;  1T03 A;  2YHA A;  1VSE A;  3DOL A;  4FJ7 A;  1W9H A;  1KLM A;  1C1A A;  4FJN A;  3LAM A;  4W5O A;  3C95 A;  1RDD A;  3P5J A;  4C8M A;  1S1T A;  3VQ7 A;  5HRR A;  2XO7 A;  3K59 A;  3K5M A;  4CHQ A;  3L2R A;  3KIO A;  1FK9 A;  4Q5V A;  1K6Y A;  1ZBF A;  3O4N A;  3K5N A;  4W5N A;  1NOZ A;  1EX4 A;  4CJ3 A;  4HHT A;  2X6S A;  3L2W A;  4KPY A;  1L3U A;  4DQS A;  3OS0 A;  2I5J A;  3VQ8 A;  1C1B A;  3LWM A;  2HVH A;  2FC0 A;  2OZS A;  4HUF A;  4AHV A;  1KVC A;  3TAG A;  1QTM A;  4FM2 A;  4OVL A;  1IKX A;  4CGF A;  4DQR A;  3SZ2 A;  1FXX A;  4DTP A;  3LP1 A;  4FXD A;  1RBR A;  1SV5 A;  3NAE A;  5T7B A;  3O3H A;  1TKT A;  4YFU A;  4IDK A;  4FLX A;  4CF8 A;  1HYS A;  3VQP A;  1ASU A;  3IRX A;  4KTQ A;  1D8Y A;  4FJK A;  2F8T A;  4CK1 A;  3DLB A;  1IKV A;  3OYK A;  2R7Y A;  4CEZ A;  4CJW A;  4E19 A;  4JRP A;  4AHS A;  1VSJ A;  4ELT A;  1GOB A;  3QO9 A;  4FJJ A;  4FW2 A;  4PA1 A;  2G8F A;  1D5A A;  4CGD A;  4BWM A;  3MAQ A;  3B6O A;  2HVI A;  2P5G A;  1F21 A;  2B5J A;  2XRI A;  1U04 A;  1R0A A;  3AVH A;  2HHU A;  4CJK A;  1QSS A;  1J9A A;  3AA5 X;  3AO4 A;  4ICL A;  3HXM A;  1WAF A;  2O4I A;  4WE1 A;  3HST B;  4F2S A;  2G8H A;  4Y1C A;  1LWF A;  1RBT A;  3SQ4 A;  4DMN A;  3SCX A;  2FBV A;  3AO5 A;  1EKE A;  1YTA A;  4CEA A;  3ZSW A;  3LP0 A;  4F4K A;  2ZQB A;  5CZ1 A;  4XIU A;  2PZS A;  3P83 D;  3SPZ A;  3OYL A;  2YKM A;  4IFY A;  1ZBI A;  2HHS A;  1NKB A;  4UQG A;  3K5O A;  1BL3 A;  1NK8 A;  4FLV A;  4JLH A;  1LWC A;  4BDZ A;  4FLY A;  1VK0 A;  3NF7 A;  2RF2 A;  3K2P A;  3VQ5 A;  4W5R A;  4KHN A;  4Z4E A;  1S5J A;  4H4O A;  5KGW A;  3RTV A;  2Z1J A;  4CJP A;  3RMB A;  3V9S A;  4GMJ B;  4FM1 A;  1MU2 A;  3TAQ A;  1T8E A;  1RT2 A;  1IKY A;  2VG6 A;  3DRR A;  4ZHR A;  5HRP A;  5CY4 A;  3NHG A;  4LH5 A;  2HNY A;  1TKD A;  1KSP A;  4LY7 A;  4PWD A;  2AJQ A;  1RTJ A;  4OGE A;  2KZZ A;  1XC9 A;  4ZTF A;  4QAG A;  2D5R A;  2HNZ A;  1RT7 A;  1HNV A;  2IC3 A;  1TL1 A;  2QKB A;  4Z4G A;  1RTD A;  3HP6 A;  3DOK A;  4IKF A;  1S1X A;  2KFZ A;  3HYF A;  4OGC A;  3AO3 A;  3QNO A;  3OS2 A;  3ZT0 A;  5J2M A;  3OJS A;  2IS3 A;  5CYQ A;  1TVR A;  1JLF A;  2OPR A;  4IG3 A;  3QES A;  4I7F A;  4CER A;  1GOC A;  3WNH A;  4CHO A;  3AO1 A;  3JSM A;  2ETJ A;  4J2B A;  1WSJ A;  1VSH A;  5FRN A;  3DRS A;  2F8S A;  4CJL A;  4CEC A;  1NK9 A;  3NF9 A;  3HO1 A;  1NK0 A;  3NGY A;  4DS5 A;  1NJZ A;  1UAX A;  1ZBU A;  5J2P A;  3RRG A;  1RCH A;  4CF0 A;  3V1O A;  3VQQ A;  3KK3 A;  3WNF A;  4N47 A;  4KHS A;  2G8W A;  3ZSR A;  4N5S A;  4CEQ A;  1Y97 A;  4DFJ A;  1LAV A;  2ITG A;  4CFA A;  4IG0 A;  3L2V A;  1JKH A;  3DLH A;  4Z4C A;  5C24 A;  3O4Q A;  5FDL A;  5HBM A;  1D9F A;  3PO4 A;  4FJX A;  4FJ8 A;  3QEW A;  3HL8 A;  4LD0 A;  3HVT A;  1XI1 A;  3V4I A;  4FZY A;  2YV0 X;  4RW4 A;  1XHZ A;  1J5O A;  4KFB A;  3VQ4 A;  3LPU A;  1TK0 A;  4K8X A;  1TKZ A;  3EYZ A;  3QET A;  2OA8 A;  4HCC A;  1ZBL A;  1YTU A;  5DK5 A;  4NYF A;  4O0I A;  3TAE A;  4CHZ A;  2QKK A;  5DMR A;  3ISN C;  3OYN A;  3SUQ A;  1U47 A;  4RW8 A;  4DTR A;  2YHB A;  3RR8 A;  1VSI A;  2HHX A;  1TV6 A;  2OPS A;  3SQ2 A;  3SNN A;  4CJ4 A;  1S1U A;  3QNN A;  4CK3 A;  3QEX A;  4FJL A;  3P1G A;  1JLB A;  1CZB A;  4FZZ A;  1WNS A;  4R5P A;  3HT3 A;  1BIZ A;  3SPY A;  1NOY A;  1VRU A;  1ASV A;  2RPI A;  3ZCM A;  4CGJ A;  3ZSV A;  3KJV A;  1NK7 A;  1IG9 A;  1HRH A;  4B3O A;  3T19 A;  3HPO A;  4DU3 A;  2EX3 A;  1B9D A;  1I39 A;  4FJI A;  2DFF A;  2IAJ A;  3H08 A;  1KCF A;  4FLT A;  2HHV A;  4CK2 A;  4HTU A;  3OYJ A;  4CCH A;  3OY9 A;  1HYZ A;  3PX0 A;  1RBV A;  2FBT A;  2YNG A;  3DRP A;  3HP9 A;  5HRN A;  1VSD A;  1CLQ A;  4OKE A;  1RDA A;  2IOC A;  4PY5 A;  3JYT A;  2GBZ A;  3AA4 A;  3TAB A;  3QIO A;  3MXJ A;  4FYD A;  4BE2 A;  3B6P A;  1X9S A;  1LWE A;  1RDC A;  1ITG A;  3VQE A;  3S9H A;  2HMI A;  3C6U A;  1LV5 A;  4EZ6 A;  3O3G A;  5HLF A;  1DTT A;  3HM9 A;  4CJE A;  4DLE A;  2HHW A;  1JXB A;  4JRQ A;  3RR7 A;  4B8A B;  4KKO A;  5KRS A;  2G8K A;  4FW1 A;  1BCM A;  1B9F A;  4CF9 A;  3D45 A;  3CQ8 A;  1L5U A;  3ZT1 A;  4HCB A;  3L2U A;  3PUF A;  3NH2 A;  3TAP A;  3IG1 A;  1VSM A;  4H4M A;  2OPQ A;  4W5Q A;  4BWJ A;  3VQ6 A;  3HPG A;  2ZE2 A;  1HYV A;  1DLO A;  3AVA A;  4I9L A;  3VQA A;  3AVI A;  1KFS A;  4KTW A;  4Z4I A;  1A5V A;  3LPT A;  2DFE A;  4HVJ A;  3S3N A;  3KKS A;  3RMD A;  5KTQ A;  4B08 A;  4CFC A;  2BGG A;  3SQ1 A;  2HB5 A;  2FBY A;  4DQQ A;  2XY8 A;  2ZD1 A;  1WN7 A;  3C6T A;  3DMJ A;  4DF8 A;  4I9Q A;  1S9G A;  1NK4 A;  4B9U A;  3M8S A;  3OYI A;  3AA3 A;  1X9M A;  4C8L A;  3FFI A;  2G8V A;  2OPP A;  4CJF A;  3KLI A;  3UIQ A;  3TAN A;  5EU7 A;  2XY5 A;  1SKS A;  1KRP A;  3TR8 A;  2D0A A;  1CZ9 A;  2KFN A;  1YT3 A;  3ZSO A;  3L8B A;  4O5B A;  2HND A;  4Z0U A;  3MXI A;  4DLG A;  1RBU A;  2P51 A;  4E7K A;  3LAL A;  3KKR A;  1TAU A;  2VWJ A;  2RN2 A;  1N6Q A;  1JLQ A;  3TI0 A;  3AVC A;  5KI6 A;  2JLE A;  1BIU A;  4CE9 A;  4O0J A;  5SWM A;  3LDS A;  3OYM A;  4DU1 A;  1WLJ A;  1KLN A;  2E4L A;  3RMC A;  1NK5 A;  2OYQ A;  4F2R A;  3VA3 A;  1A5W A;  1VRT A;  2Y1I A;  1QSL A;  2QK9 A;  4DTJ A;  3AVK A;  4BE1 A;  3EY1 A;  1KTQ A;  3VQ9 A;  1CXU A;  3OYF A;  4Y1D A;  1Q9X A;  4OLB A;  3NFA A;  3MED A;  4FK4 A;  1BI4 B;  3WNG A;  1SL2 A;  4QCL A;  1IKW A;  1BIS A;  3AVJ A;  4MQ3 A;  3ULD A;  4BAC A;  3LAK A;  1Q8I A;  3M8P A;  4CJS A;  4CF2 A;  3PX6 A;  2P1J A;  4O55 A;  4FCY A;  3V9X A;  5KGX A;  1BGX T;  1JLA A;  1LAW A;  3ALY A;  4AHR A;  3AV9 A;  4DSE A;  2YNF A;  1L3V A;  3QER A;  4CF1 A;  4DU4 A;  1YVU A;  5J2N A;  1S9E A;  4M45 A;  1L3T A;  4FJM A;  4HUG A;  5J2Q A;  1BCO A;  4LSL A;  3VA0 A;  4KB1 A;  3V1Q A;  4NCA A;  4KI4 A;  4E0D A;  1JXE A;  2Z1I A;  1JL1 A;  3DLG A;  4O44 A;  2Y1J A;  1UWB A;  4FVM A;  2YNH A;  1U4B A;  4GW6 A;  4MFB A;  1DTQ A;  3DLE A;  4CIF A;  4DSI A;  4NCB A;  4DFK A;  1D9D A;  1L3S A;  4M3Y A;  2W42 A;  1EP4 A;  4DTM A;  3QEI A;  5E41 A;  4YNQ A;  3SV3 A;  3PY8 A;  4ELV A;  2E6L A;  3K57 A;  2PYJ A;  4AH9 A;  4NCG A;  1QHT A;  3CG7 A;  1FKP A;  5HRS A;  3CFO A;  3OS1 A;  4DS4 A;  4E7I A;  1WSG A;  4M3X A;  4JS5 A;  3VN5 A;  3AVM A;  3LP2 A;  4KV8 A;  3QIN A;  2WOM A;  3QIP A;  4CEF A;  3AO2 A;  3OYE A;  3ITH A;  1HMV A;  4ID1 A;  4M3R A;  1IO2 A;  3SYZ A;  1C0U A;  1TAQ A;  1I3A A;  3V9Z A;  1O1W A;  3OYC A;  3I0R A;  1U45 A;  1U49 A;  1S1V A;  3NCI A;  3SI6 A;  3VQB A;  3S3O A;  1BQM A;  1QQC A;  1REV A;  3AVG A;  1C0M A;  1HQU A;  3NDK A;  2BAN A;  1VSL A;  4CED A;  3K58 A;  3LWL A;  3NE6 A;  1ZBH A;  4CIG A;  3AVN A;  1G15 A;  3SUN A;  4FJH A;  3V6D A;  1QE1 A;  2IDO A;  1HJR A;  3OYG A;  3M8Q A;  4M41 A;  5JS2 A;  2YKN A;  4DF4 A;  2X6N A;  1BQN A;  2OZM A;  4K8Z A;  2KZM A;  4KO0 A;  3SJJ A;  3A2F A;  1UA0 A;  1TKX A;  3QEP A;  2KTQ A;  3CFR A;  3BDP A;  4FM0 A;  1RIL A;  1J54 A;  2VG7 A;  4DFP A;  4N41 A;  4ELU A;  4G1Q A;  3EZ5 A;  4CHY A;  4DTN A;  3HVR A;  3SV4 A;  4E7J A;  3D0P A;  4EZ9 A;  3KK2 A;  4BDP A;  3OYH A;  4J2D A;  3T1A A;  1RT1 A;  3LP3 A;  1GOA A;  4CEE A;  5SZT A;  4CGH A;  3O3F A;  2RKI A;  1U48 A;  1C0T A;  2NUB A;  3TWH A;  3THV A;  4F3T A;  3AVB A;  4B9M A;  1T05 A;  1LW0 A;  1TGO A;  3SUP A;  1ZYQ A;  1Q9Y A;  1QS4 A;  3RRH A;  3T3F A;  3WNE A;  3VQC A;  4AHC A;  2Z1H A;  1S6P A;  3LAN A;  4CEO A;  1S1W A;  1IH7 A;  1UA1 A;  2ATQ A;  5JS1 A;  3CFP A;  4JS4 A;  3V81 A;  4KHU A;  2A1S A;  1HNI A;  3VQD A;  2VWK A;  2G8I A;  3U3Y A;  5I3U A;  4LSN A;  3KLH A;  4KAZ A;  3ZSY A;  4E1M A;  3G0Z A;  4CHN A;  2PY5 A;  3HK2 A;  4DSJ A;  1J53 A;  1RT4 A;  4KHY A;  2D0C A;  4N76 A;  1TK8 A;  1RT5 A;  1X1P A;  1NKE A;  3SQ0 A;  4HUE A;  3OYA A;  1NJW A;  4Z4H A;  2XY7 A;  3G10 A;  4Q0B A;  1NKC A;  4FLZ A;  4CJV A;  3OJU A;  4DSK A;  1JL2 A;  2DFH A;  4OKJ A;  1W0H A;  1N5Y A;  4M42 A;  4LH4 A;  4KRE A;  1WSI A;  2VG5 A;  4B9N A;  4J2E A;  3KK1 A;  4AHU A;  4CJ5 A;  3DM2 A;  4CJR A;  3LZI A;  3V9U A;  3ZT3 A;  1CXQ A;  4C8N A;  2GUI A;  5FRO A;  2Q3S A;  3AVF A;  4CFB A;  1TK5 A;  4FK0 A;  4J2A A;  2O4G A;  4CFD A;  3KD5 E;  1KVB A;  3KD1 E;  4DSF A;  1XHX A;  2X74 A;  5I42 A;  3IAY A;  3MEC A;  1RNH A;  4AHT A;  5C42 A;  3RWU A;  1JLG A;  1Z25 A;  1S6Q A;  4NYN A;  1VSK A;  3KLG A;  4E7L A;  4EP4 A;  4DSL A;  3C94 A;  3DLK A;  5KRT A;  3CM6 A;  3PX4 A;  3U3G A;  1QSY A;  4RW9 A;  1NJY A;  4PQU A;  3NGZ A;  2A1R A;  4I2P A;  3ZSX A;  4EP5 A;  4Z4F A;  4GVM A;  1LW2 A;  2F96 A;  3HPH A;  2B6A A;  3OYD A;  2G8U A;  1VSF A;  3CM5 A;  2X78 A;  1WSF A;  4CEB A;  4CGI A;  5FRM A;  4FLW A;  3ZSQ A;  3PV8 A;  4PUO A;  3I8D A;  3MEE A;  2YNI A;  4FLU A;  3NGI A;  4KRF A;  2JGU A;  1WSE A;  4L8R B;  4M3Z A;  3KLF A;  4FZX C;  4C8O A;  4I2Q A;  2HW3 A;  1SUQ A;  1TL3 A;  3KTQ A;  4C8K A;  4DG1 A;  1HPZ A;  4AIL C;  4N56 A;  2BDP A;  2HHT A;  2QXF A;  4RW7 A;  4TSX A;  3ZT2 A;  2EHG A;  3CYM A;  4CJQ A;  4M3W A;  4B9T A;  3MXM A;  5C25 A;  1C1C A;  4KHQ A;  3TAF A;  3BGR A;  1XWL A;  1RTH A;  3E01 A;  2B4J A;  4CJU A;  3QEV A;  4DQP A;  4IBN A;  3L2Q A;  4H8K A;  4DTS A;  1RDB A;  4OPK A;  4B9V A;  4ID5 A;  2BE2 A;  4F3O A;  4F8R A;  4E7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...