3ZCMA

Small molecule inhibitors of the ledgf site of hiv integrase identified by fragment screening and structure based design.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zcmA00
4C8NA 4CFCA 3SQ0A 5EU7A 4KHYA 4OGEA 3RMCA 1U45A 2KZMA 2F96A 3AO1A 1VSHA 4DTPA 1JLGA 4CGIA 3CFRA 3KD1E 3K59A 3SZ2A 3LWLA 3KKRA 3WNFA 2RF2A 4YFUA 3OYJA 3QEXA 4DTOA 2X78A 3OYKA 4CHYA 4BDZA 4B8CA 1RDDA 4FLVA 1BIUA 3NF9A 2ZE2A 4CJLA 4FLTA 1WAJA 4J2BA 4Z4IA 1QSLA 4BWMA 4OKKA 3C6TA 4CF1A 3DLGA 1TGOA 3HPOA 4R5PA 1KLNA 3L2QA 3CYMA 2XY5A 2HMIA 4CE9A 2GBZA 4OPKA 4I7FA 3AVIA 2R7YA 1LW0A 4QAGA 1LWEA 3VN5A 2I5JA 1KVCA 4BDPA 4LSNA 4DSLA 4FJJA 1C0MA 3KLGA 3NGIA 1UAXA 4RW8A 4FJ8A 4CEEA 4ID5A 3OY9A 4CHQA 1WSGA 3DOKA 4DQPA 1WSJA 4CESA 4M3XA 1TKXA 1BCOA 2OA8A 1C0UA 3VQCA 4XIUA 2XHBA 1HRHA 1ITGA 4FCYA 5CY4A 4DU3A 3SV4A 3RR7A 4NCAA 3ZSYA 5FRMA 4LSLA 3KIOA 3NFAA 3ITHA 3KLHA 4N76A 4KHUA 1TKZA 5DMRA 4B9NA 4CEFA 1TL3A 3QO9A 4IFYA 5FROA 1NK5A 1DTTA 1TVRA 2HNDA 1RT4A 3A2FA 4M41A 1VSJA 2HHQA 2YNFA 3HVTA 1BQMA 1IKYA 2GUIA 1NOZA 3ZSVA 3SUNA 4CCHA 2HNZA 3CM5A 4DQRA 4PQUA 4UQGA 4E7KA 1RBRA 3RRHA 4CFBA 2EX3A 2LSNA 2RPIA 4RW4A 1YT3A 1RNHA 4KPYA 4K8XA 4Z4GA 2XY8A 2FBVA 3AVHA 4HUGA 2HHVA 3KTQA 4E7HA 1LWFA 2RKIA 2IOCA 1C1BA 4CJEA 1NJWA 2QK9A 4IFVA 5HRRA 4FLWA 3K5OA 3VQ4A 2QXFA 1JKHA 3LANA 2F8TA 4LH4A 1QE1A 1G15A 1RDAA 1U48A 1L3TA 3RRGA 1D9DA 4CHZA 2FBYA 4OKEA 4HUFA 3QNOA 1GOCA 3TAQA 1L3UA 3O3GA 4K8ZA 1ZBUA 3WNGA 3LPTA 4RW9A 3NDKA 5J2NA 4GVMA 3F9KA 3KK3A 1QS4A 3PO4A 4N41A 4JRPA 1S1VA 4CF0A 4KO0A 3AVJA 3OYMA 2EHGA 1BI4B 1WLJA 3FFIA 1T03A 1T05A 3TAFA 2HHXA 5HRPA 4CK3A 2F8SA 4B9TA 3OJUA 3QEVA 2YKNA 1JLCA 1RT3A 1T7PA 5I42A 4PY5A 4OJRA 4QOZB 1HNVA 2DY4A 4BE2A 4EZ9A 3SQ1A 1S1TA 3OYBA 3ALYA 1S1WA 2OPQA 4ICLA 3HJFA 3U3GA 2HHSA 4KI4A 3CQ8A 4OGCA 3HM9A 4CEQA 3AVNA 3SI6A 4AILC 4NYNA 3THVA 3AA3A 3M8QA 3DM2A 1HJRA 1S9EA 2Z1GA 3H08A 4GMJB 3QIPA 3T19A 3ZT3A 1SUQA 3NH2A 4FJXA 2AJQA 4FLYA 2GV9A 4KKOA 4AHRA 1LAVA 4OLBA 1XWLA 3OYLA 2HB5A 1RT2A 3MECA 3I0RA 4Y1CA 4CEAA 3EZ5A 5KTQA 2NUBA 2PY5A 5J2QA 3EY1A 1IO2A 2VWKA 3AVGA 4JLHA 4FJLA 4W5OA 3HXMA 3NCIA 1SKRA 1X9WA 2FC0A 4W5RA 4DSFA 2JLEA 1L3VA 4CF9A 1ZBFA 2BGGA 2WONA 1D8YA 2G8WA 4C8LA 1WSHA 3ISNC 4CFDA 3I8DA 2W42A 4M3TA 2YV0X 4PUOA 1NOYA 2X6NA 5E41A 4F2RA 4F2SA 1X9SA 2ATQA 4WE1A 3V1RA 3VQ7A 2RN2A 2HHWA 1VSFA 3NF8A 3UIQA 4ELUA 4FM2A 1WSEA 2OPSA 4IKFA 3DRSA 4B3OA 3HP9A 3NF7A 3DMJA 1HQEA 3O4QA 4B9UA 3ULDA 3QINA 4FJGA 3ZT0A 4AH9A 4Q0BA 1A5WA 2G8VA 1FK9A 5SZTA 4Q5VA 4FJIA 5CYMA 3DRPA 3V9XA 4M3RA 4DTMA 4LH5A 2G8HA 3PV8A 3TARA 3VQPA 3T3FA 3LDSA 1NKCA 3M8RA 3VQEA 4ZHRA 4CEOA 1R0AA 2BDPA 3L3UA 4CHNA 3OYGA 4DU1A 3MXJA 1C1AA 2ZQBA 4DS4A 3KLIA 1J9AA 4O5BA 3P1GA 3HPHA 1HYSA 3I0SA 4KTQA 1Y97A 2ETJA 1RBUA 4FM1A 4F3TA 3KD5E 4HTUA 3IAYA 4FJKA 4B08A 3BDPA 4KREA 4OVLA 2D5RA 1YVUA 1IH7A 2Z1HA 1WSIA 4O4GA 5CYQA 4DFKA 4F4KA 1FKOA 5HROA 5J2PA 4KHSA 1BGXT 3SUPA 1NK8A 3NF6A 1S6QA 2HNYA 2OPRA 4FVMA 4O0JA 5C42A 3V6DA 3SQ4A 4DSJA 1J53A 4B8AB 3V1OA 2HVIA 3ZSRA 1MU2A 4QCLA 4C8OA 1CZBA 1RTHA 3QEPA 2IDOA 5J2MA 3V9UA 3V81A 2P1JA 4O55A 4DSIA 4LY7A 3G10A 1J54A 4TSXA 3C95A 4HCCA 3HP6A 1REVA 1RDBA 3VQQA 1JLAA 4IG3A 5FDLA 4CEDA 4W5QA 3KK2A 1NK4A 4ZTJA 3ZSWA 4HCBA 4FJMA 3G0ZA 1KRPA 5FRNA 1HQUA 2DFHA 4AHVA 4CJRA 4Z4HA 4AHUA 4F8RA 3OYHA 4JS4A 3AA2A 3U6FA 4B9VA 5C25A 5KGXA 3QETA 1RT1A 4CJTA 1EP4A 4DTSA 5T7BA 1NJYA 1UOCA 2Z1JA 2Q3SA 3DRRA 3VQBA 5CZ2A 1RT6A 3K5LA 1N5YA 4FK4A 3SV3A 2FBTA 4FXDA 3ZSOA 2DFFA 2VG6A 3MAQA 1KTQA 4Z0UA 3V9SA 1U49A 4CJWA 2DFEA 3PUFA 3VQDA 5K14A 1S5JA 4KFBA 3T1AA 5KRTA 4FYDA 2PZSA 3ZSQA 3AVKA 3KLFA 3L2WA 1HPZA 3PX0A 4RW7A 3RR8A 1EXQA 2X6SA 4RW6A 2G8IA 4Z4FA 3U3YA 2YHBA 4LD0A 3DLHA 1KLMA 4FJNA 1I39A 3ZT4A 3F73A 5HLFA 1RBVA 3HSTB 4FZZA 3QLHA 4E0DA 4CJUA 1N6QA 1HNIA 4GW6A 3ZT1A 2G8UA 1TKTA 3K5MA 1L5UA 4KHNA 2WOMA 5HBMA 4N5SA 1F21A 3NGZA 1EKEA 3LP0A 4CGHA 3VQAA 4KAZA 1B92A 4CGJA 1VRTA 3CFPA 3JSMA 1SL1A 1RTDA 1JLBA 1KFSA 4J2AA 2HHTA 3RMDA 3KKSA 3V1QA 4FJHA 5KI6A 1BL3A 2KZZA 3LP2A 4OKJA 4CEBA 4OLAA 1NK7A 4O0IA 4DF4A 1JLFA 3QESA 3SPZA 4CJQA 1TAQA 1Z26A 1C6VA 2B6AA 4FW1A 1RTJA 1QSYA 3TAPA 3DLKA 3C6UA 3WNEA 3ZSZA 4DFJA 4FZYA 4KHQA 3KJVA 4DU4A 1VSEA 1S1XA 2YHAA 1IG9A 2VG5A 1DTQA 1VSDA 1VSKA 2BANA 3O4NA 4EP4A 3L2UA 1BISA 4NCGA 4DTNA 4DSEA 1RT5A 2ZD1A 4F3OA 1ZYQA 2D0AA 4E1NA 4H8KA 1ASVA 4N47A 3WNHA 3O3HA 4ELTA 3TANA 3DI6A 1XI1A 4CJ3A 4DTJA 4KB1A 3VA0A 3TAGA 1XHZA 1RBSA 3LWMA 4JS5A 3TWHA 3SCXA 4KRFA 3DLBA 3SJJA 3S3MA 2KQ2A 2IGIA 2PYLA 3P83D 3RTVA 2YKMA 4FW2A 3K58A 3AVAA 3NBPA 3QIOA 1VSIA 4CHOA 3OYCA 4DWIA 1ZBLA 2QKKA 3B6OA 4Z4EA 3L8BA 3AO3A 1IKXA 1U04A 4KI6A 3O3FA 3QERA 1CXQA 3SNNA 4CK1A 1EX4A 3OYAA 4DQQA 2XY6A 5D3GA 3OYDA 4CIGA 1SL0A 2HHUA 2KW4A 4FLUA 4FJ5A 1NK0A 2O4IA 3HO1A 1CLQA 3LZJA 3RMAA 4E7LA 1Q9YA 1U4BA 3AO5A 1S6PA 1HYVA 3AVFA 3OS1A 1SV5A 4JRQA 4O44A 4M3UA 4BE0A 1EETA 3MXIA 1TK0A 4W5NA 1BIZA 3TI0A 3M8PA 1KSPA 1TAUA 1O1WA 4E1MA 3OYIA 1QSSA 1D9FA 5I3UA 2XO7A 2YNHA 1X1PA 3IRXA 4KTWA 3BGRA 4CF8A 1JLEA 3SUQA 1VRUA 1LW2A 3IS9A 1D5AA 1RILA 2E4LA 3VQ6A 3ZCMA 4CF2A 5J1EA 4EZ6A 3SUOA 4Z4CA 4DFMA 4M45A 3V9ZA 4J2EA 1S1UA 1K6YA 3SQ2A 4PA1A 1NKEA 1ASWA 4L8RB 3HK2A 1RTIA 3KLEA 2KFNA 3AVLA 3RMBA 4M3ZA 3D0PA 4DQSA 4B9SA 1U47A 4FJ9A 2O4GA 2DTUA 1I3AA 1T8EA 1B9FA 3OYNA 4I2PA 3S9HA 1UWBA 4I9LA 4CJ5A 2FBXA 4KV8A 1YTAA 3CM6A 1VSLA 4MQ3A 4W5TA 1BI4A 1TK8A 4E3SA 3NGYA 3TAEA 1XHXA 3AVMA 4Y1DA 3L2VA 2Y1IA 1JXBA 1ZBHA 3NHGA 5KRSA 4DTRA 4CJ4A 3VQ9A 4C8KA 1IKVA 3OYFA 2A1RA 5JS2A 3OS2A 2HW3A 1SKSA 4N56A 4BE1A 2Z1IA 1RT7A 3AVBA 4MFBA 3LPUA 1BCMA 1W0HA 3LAKA 5C24A 3PX6A 4M3WA 1JL2A 4M42A 1XC9A 3PO5A 1C0TA 2E6LA 3MEDA 3VA3A 4FJ7A 3SYZA 1ASUA 2XRIA 3AA5X 1YTUA 4FK2A 4IBNA 1NJZA 3HPGA 4DG1A 2VWJA 5HP1A 4DTXA 3LZIA 4KB0A 3L2RA 4CFAA 3K57A 4DLGA 1J5OA 3DYAA 1BQNA 4CECA 1A5XA 4CJVA 3K5NA 1FKPA 2PYJA 4DFPA 3JYTA 4FLXA 2P5OA 4E19A 1LWCA 3LP1A 5SWMA 1JXEA 1VK0A 3K2PA 1QQCA 2B5JA 3QEWA 4BDYA 2Y1JA 4AHCA 1KCFA 4PWDA 2OZMA 3MEGA 1LAWA 3EYZA 4G1QA 4ID1A 4CGGA 3VQ5A 3RWUA 4ELVA 1LV5A 3LAMA 1SL2A 3KK1A 4H4MA 1RBTA 4DSKA 4DS5A 2X74A 4FLZA 1TKDA 3ASMA 4H4OA 1NK9A 5DK5A 3HL8A 3OJSA 4E7IA 1IKWA 3VQ8A 1C1CA 4NCBA 5JS1A 4DQIA 4C8MA 1RCHA 1JL1A 4DMNA 2QKBA 3E01A 5CZ1A 4CIEA 5HRSA 2OZSA 4E7JA 1CXUA 4BACA 4J2DA 2KFZA 3SPYA 2OPPA 4KHWA 3OVNA 4E89A 3PY8A 1NJXA 2IC3A 1WNSA 4B9MA 4CGDA 4HUEA 3NE6A 3PX4A 3DLEA 3HVRA 3CFOA 2P51A 3MXMA 3S3OA 1B9DA 1UA1A 4I9QA 3MEEA 1Z25A 2ITGA 3DOLA 1BHLA 3M8SA 1JLQA 3IG1A 4CERA 4I2QA 4CJSA 4CK2A 3CG7A 1UA0A 4B9LA 3OYEA 4FK0A 2D0BA 3V4IA 1GOBA 4CEZA 3S3NA 1NKBA 4CGFA 3QEIA 3AVCA 4DLEA 4IDKA 1VSMA 1CZ9A 2P5GA 4IG0A 3HYFA 4EP5A 1QHTA 3D45A 2G8FA 3V9WA 1HMVA 1WAFA 2XY7A 1A5VA 4CJKA 2G8KA 1WN7A 2JGUA 3HT3A 3P5JA 1DLOA 3NH1A 4CJPA 1FXXA 1KVBA 1Q8IA 3ZSXA 1HYZA 3NAEA 3OS0A 1TV6A 4NYFA 4CJFA 4YNQA 3ZT2A 4FM0A 3AV9A 1ZBIA 1KFDA 3TR8A 2E6MA 3AO4A 1TL1A 4FZXC 2IAJA 3QNNA 1GOAA 4AHTA 4DF8A 4M3YA 2HVHA 2YNIA 1KVAA 4BWJA 3B6PA 4DTUA 1L3SA 3LALA 1Q9XA 4HHTA 2KTQA 3NH0A 5HRNA 1QTMA 4HVJA 1SKWA 2OYQA 1WSFA 2YNGA 3DLRA 4RG8A 4KTZA 3AA4A 4CHPA 2BE2A 1TK5A 3TAMA 4OPJA 2B4JA 1NK6A 3AO2A 2IS3A 5KGWA 4ZTFA 1W9HA 3LP3A 3L3VA 4AHSA 2D0CA 2A1SA 2VG7A 3C94A 4CIFA 3TABA 1X9MA 1S9GA 1RDCA
chains in the Genus database with same CATH superfamily
5M1PA 5EU7A 2A3ZA 4H0PA 4OGEA 1U45A 2O8CB 2F96A 4CGIA 3KD1E 3SZ2A 3LWLA 2RF2A 3OYJA 4DTOA 3U4LA 3OYKA 1U2VA 4B8CA 4B1WB 4FLVA 4FLTA 3N4PA 4LF8K 1TGOA 3DXMA 4OPKA 4I7FA 3AVIA 2R7YA 1N32K 4DSLA 4BR5A 3NGIA 3OY9A 3C65A 3DOKA 4DQPA 1WSJA 1FW6A 1U6ZA 1TKXA 4I6MA 4M3XA 1C0UA 4XIUA 1HRHA 1ITGA 3RR7A 3ZSYA 3ITHA 5DMRA 4PKIA 3QO9A 4IFYA 4BROA 3MN5A 1XMOK 3A2FA 3VTIA 2BH1A 2HHQA 2YNFA 2UXDK 1BQMA 3SUNA 2GUIA 4CCHA 3ZSVA 4M63C 4BGBA 2HNZA 1RBRA 3RRHA 3D2EB 4CFBA 2EX3A 2RPIA 4JHDA 1YT3A 1RNHA 3KTQA 2CH6A 4IFVA 3J7ZO 1GLAG 1NGEA 2BUPA 1KAYA 4OKEA 4K8ZA 3QFPA 1VQ5N 4RW9A 4GVMA 3F9KA 5DM6L 1QS4A 3KK3A 4N41A 3I55N 4WQ5C 1T05A 3KHYA 1VAZA 1M90O 1GLBG 1JCFA 4BRDA 1WOQA 1VQNN 3ALYA 4KH4A 3HJFA 2P9IA 2HHSA 3HTVA 3CCJN 4A61A 4GMJB 3QIPA 4FJXA 1SUQA 4FWPA 4AHRA 2O8EB 3DXKB 3MECA 5KTQA 1YITN 2NUBA 1KXPA 2PY5A 3CCMN 4CBXA 1IBLK 2QWPA 1X9WA 3WEEA 2JLEA 1Q81O 4CF9A 4NB4A 1D8YA 2G8WA 3TSQA 3U9ZA 2YV0X 4JK9A 4PUOA 5E41A 4F2RA 1X9SA 1XNQK 2IVNA 1WBBA 2HHWA 3NF8A 2FSKA 3NVMA 5M1QA 4DV3K 1T3VA 4IKFA 3OA9A 4LF7K 3LDOA 3NF7A 4IJNA 3O4QA 4B9UA 3ULDA 4K43A 4FJGA 4FJIA 1FK9A 3BY5A 3GBTA 3CJ9A 4M3RA 5FPMA 3E66A 2WTUA 3VQPA 3OBYA 3M8RA 3A5NC 4ZHRA 2E20A 3L3UA 4CHNA 1TYQA 3MXJA 2ZQBA 4MDBA 4BR4A 1J9AA 2O8BA 3HPHA 3PLAA 2CGJA 4KTQA 2D1KA 1VQ8N 5EY4A 4FM1A 3IAYA 3TTFA 1X9MA 4B08A 5KQ8A 4OVLA 5EXWA 4A2BA 2D5RA 1KQSM 4B3SK 1IH7A 4O4GA 4FWRA 1RGIA 2V51B 5AQLA 4OPHA 5J2PA 1KC8O 2WUSA 5C42A 4B1XB 3J7YP 4DSJA 2NNWA 3ZSRA 1RTHA 4IEEA 3AGRA 1SAZA 3V81A 1IBMK 4DSIA 2P9SB 4J8FA 4LY7A 4C23A 1HNZK 1W97L 1J54A 1ATRA 3IMXA 2YHXA 2G8KA 3KK2A 4HCBA 4FJMA 3R8EA 3G0ZA 5FRNA 3CJCA 2DFHA 2QM1A 4Z4HA 1XUPO 3CQYA 3OYHA 3U6FA 5I9EB 5C25A 3QETA 4B9VA 1UOCA 2Z1JA 3ID8A 3VQBA 5CZ2A 1NNEA 4FK4A 3ZSOA 2DFFA 3MAQA 1KTQA 3V9SA 3SBTA 4JI2K 2PZSA 3L2WA 1HPZA 2X6SA 5M1NA 4Z4FA 3U3YA 1KLMA 3F73A 4CZLA 4E0DA 2W41A 1L5UA 5HBMA 1Y64A 4N5SA 3LP0A 2HMPA 3VQAA 1B92A 2GX9A 1BU6O 1EWQA 4WYBA 4AF1A 2E2QA 4JI0K 5AQGA 2CGLA 2JWLA 3C0BA 4BY9C 1TAQA 1Z26A 1C6VA 3TAPA 3DLKA 3ZSZA 4FZYA 3M6GA 4MLHA 3ZX0A 3ZEUB 4DTNA 1ZYQA 4FO0A 4IWVA 3WNHA 3A8YA 3DAWA 2P9UB 4DTJA 4KB1A 3VA0A 1K8AO 1RBSA 5AQWA 2UUCK 4KRFA 2HBMA 1NGJA 1T6CA 2IGIA 4O8KA 4DV0K 3THWA 3K58A 3QDKA 3AVAA 3VF2A 4DWIA 3OYCA 2QKKA 1ESVA 1IKXA 1U04A 2HSTA 4JEPA 4BVPA 4DQQA 5D3GA 3OYDA 1SL0A 2KW4A 4DKWA 4DV4K 3HO1A 2NRVA 3LZJA 3RMAA 4KH5A 1S6PA 1XQSC 3SJHA 3MXIA 1TK0A 4W5NA 3IUCA 1QSSA 1D9FA 1ZBSA 1BOTO 1BUPA 1D5AA 3E9PA 1NU0A 2QWRA 3Q7BA 3V9ZA 3CCUN 4J2EA 1S1UA 2KFNA 2E2PA 1E4GT 3UKRB 1T8EA 1B9FA 1UWBA 4CJ5A 5MLCQ 1K8KA 3CM6A 1TK8A 3NGYA 3PSIA 1XHXA 4Y1DA 2Y1IA 5JICA 1V4TA 2Q2RA 3VQ9A 1IKVA 1Q86O 2HW3A 1SKSA 4BRGA 2OTJN 4K0KK 4MFBA 3LPUA 1BCMA 3SAHA 4M3WA 5AQXA 1JL2A 3WXIA 3PO5A 1C0TA 2E6LA 3CXCM 4FJ7A 4BRNA 1ASUA 3EL2A 1NJZA 4DR5K 4DTXA 3K57A 3QBXA 3RVCA 4FLXA 1LWCA 3LP1A 1QQCA 3CIPA 4BDYA 2Y1JA 2GWKA 4BRMA 1KCFA 1N34K 4B1UB 4PWDA 1NJIO 1RBTA 1VQKN 4DSKA 3NMUA 4H4OA 4ISGA 3HL8A 1C1CA 2FSNA 4DMNA 2QKBA 5CZ1A 3VPZA 4FVUA 4E7JA 5E26A 4J2DA 3SPYA 3OVNA 2A42A 2IC3A 1WNSA 2ZF5O 3DLEA 2P51A 3S3OA 3M3ZA 3BP8A 4CERA 3IG1A 1UA0A 4FK0A 3V4IA 1GOBA 1NKBA 5BRFA 4CGFA 3QEIA 5TKYA 3E9OA 3AVCA 3O9UA 5BN8A 4IOAL 4IG0A 3VF4A 1X9JA 2G8FA 5ELZA 4CJKA 3UKUA 4AM6A 1FXXA 3ZSXA 1HYZA 2J4RA 1TV6A 4NYFA 4CJFA 4YNQA 2D4WA 2QI2A 3P38A 4YOWA 4JAXA 1ZBIA 3HI0A 2E6MA 3KWIA 2IAJA 2GELA 4JYAK 4AHTA 4JKGB 2YNIA 1KVAA 4BWJA 3CCRN 3BUZB 1L3SA 3LALA 4IOXA 4HHTA 1N36K 5HRNA 4M7XA 4RG8A 1NGGA 1QVGM 3HM8A 2BE2A 4OPJA 2B4JA 1NK6A 2UXCK 4AHSA 2D0CA 3FZFA 1GLCG 4C8NA 4CFCA 3RMCA 3VGMA 1JLGA 3CFRA 3K59A 3QEXA 5LJWA 1EWRA 4CZGA 4CHYA 4BDZA 1RDDA 3HSCA 1W7AA 1NG9A 3NF9A 5AQTA 4CJLA 5AZIA 1WAJA 4J2BA 3FZMA 3VOVA 2FLOA 2YHYA 3DLGA 3L2QA 4CE9A 1HX1A 2GBZA 3CPEA 5GINA 1LW0A 4QAGA 4FJJA 2W6KA 2I5JA 1KVCA 4BDPA 2PFUA 4Z4IA 4FJ8A 1UAXA 4RW8A 4CEEA 4ID5A 4GY2B 4JD2A 1BCOA 1Z6RA 2XHBA 4FCYA 4DU3A 4G9ZA 2NRZA 4LSLA 3F9MA 3KIOA 4N76A 1NMNA 5FROA 1NK5A 1DTTA 1TVRA 4F9OA 3FGUA 3ZLJA 1GLJO 1IV0A 3O08A 4PQUA 3CM5A 2ZJQL 4Z4GA 4ISFA 2NRTA 2E2NA 1GLFO 1NWKA 4FLWA 4WF9L 3VQ4A 4O8UA 1YAGA 1JKHA 1EQYA 3LANA 3MDQA 4LH4A 1QE1A 1G15A 2F8TA 3GOIA 3EKUA 4CZJA 3QNOA 1GOCA 3TAQA 3O3GA 1ZBUA 3LPTA 5AQKA 4JRPA 1S1VA 2EHGA 4PHTX 3IFRA 1T03A 5ADXA 4PL8A 5IT9O 3CCQN 3BF3A 4CZEA 1T7PA 1LOTB 5I42A 4OJRA 4QOZB 3A5MC 4EZ9A 3SQ1A 4FWOA 1S1WA 3CPWM 2OPQA 3ID6A 3CJBA 3U3GA 4B1ZA 3HM9A 4CEQA 3SI6A 2RE2A 5GIPA 3AA3A 3FR0A 3H08A 4JNEA 3ZT3A 4FLYA 5GIOA 1IG8A 2HHHK 3OYLA 1NGAA 1RT2A 4Y1CA 2P9LA 3HBTA 3EZ5A 1V4SA 5M1FA 4FJLA 3AVGA 2VWKA 2QTDA 4W5OA 2FC0A 3AAPA 5GAEP 2D0PA 2P9NA 1WSHA 2QWNA 1ATSA 1NOYA 2X6NA 1I94K 1HR0K 2ATQA 4WE1A 1VSFA 4KBOA 2OPSA 3MWTA 2AA4A 4BR2A 2F9TA 3DMJA 1HQEA 1M1KO 1J6ZA 3CETA 5CYMA 1OVYA 3DRPA 2H3GX 1YJWN 1JCEA 3V9XA 1Q7YO 3VQEA 2A6AA 2BDPA 3OYGA 4DU1A 4DS4A 4CD1A 4BGAA 2I7PA 3KLIA 1Q18A 4O5BA 2A5XA 5AZJB 3I0SA 2ETJA 2O8DA 3KD5E 3MCPA 4YOVA 3BDPA 2E1YA 5LY3A 2Z1HA 1WSIA 1FKOA 4NO7A 1BGXT 1NK8A 2HNYA 2OPRA 3EN9A 2NRHA 4CBWA 4IJAA 3SQ4A 4EFHA 1BA0A 3BZKA 2HVIA 3QEPA 1QZ6A 5J2MA 2O8FB 3VEXA 5DM7L 3ULEB 3CJAA 1RDBA 3VQQA 4CEDA 5FDLA 1NK4A 2P9KA 3CERA 3WT0A 4NXNK 4CJTA 2WBNA 4DTSA 1NJYA 1NGDA 3D6RA 3DRRA 1ZC6A 3FLCO 3O1BA 4FXDA 4YDUA 2VG6A 4Z0UA 1C0GA 3BZCA 4CJWA 1OVQA 3CC7N 5KRTA 3KLFA 3AVKA 3THYA 3OBWA 4RWTA 4BG9A 4RW6A 1HKCA 2YHBA 2P9PB 4JI3K 3GDQA 1I39A 5HLFA 3HSTB 4CJUA 1HNIA 4GW6A 4NLBA 3ZT1A 4PKHA 4KHNA 4WFNL 3NGZA 1F21A 3TSUA 1VRTA 1SL1A 2FF6A 1HJOA 2Q0UA 4RCHA 5AQIA 3RMDA 3V1QA 4B1VA 2YJEA 3THXB 4OLAA 4DF4A 3QESA 3SPZA 4CJQA 2B6AA 4FW1A 1SS6A 1RTJA 1QSYA 2O8CA 3C6UA 3WNEA 3KJVA 4DU4A 1VSEA 1T44A 1S1XA 1YVNA 3MX2A 1DTQA 4BRLA 2BANA 4DSEA 1RT5A 4BQZA 2V7ZA 2D0AA 4H8KA 2Q97A 3O3HA 3DI6A 4FWQA 4MO5A 4CJ3A 4AM7A 3LWMA 1XNRK 5B8HA 2Q0RA 3DLBA 3S3MA 2PYLA 5KPRA 2WC9A 1ZBLA 3B6OA 3CMAN 1QVFM 3EKSA 5AQRA 3SNNA 3ZYYX 4CIGA 4FLUA 1CLQA 1RDWX 3K0SA 5AFUH 3CF5L 2W6LA 1Q9YA 2VGMA 3AO5A 4JRQA 4JKHA 3O9TA 3N4QA 4BRHA 4A57A 3TI0A 3M8PA 1KSPA 3D2EA 4BRIA 4H03B 1G99A 2YNHA 2QWOA 2QEXN 2QWMA 4CZFA 2VWBA 5AQMA 3VEZA 3WQTA 4E3SA 3ZCMA 4CF2A 3SAGA 4M45A 4OPAA 5FPDA 4FSVA 1NKEA 3JS6A 1U47A 4FJ9A 2HBJA 4I2PA 5FLXO 4GV9A 2HOEA 4GVEA 1YTAA 3A5LC 1KAZA 3K9KA 3AVMA 4Y0WA 5GADP 3NHGA 3TSPA 3O80A 4C8KA 5JS2A 4YDUC 4N56A 3C7NB 1RT7A 3AVBA 1W0HA 3LAKA 5IWAK 4LFCK 3SYZA 1D4XA 2XRIA 1YJNN 3AY9A 1YTUA 2PAVA 1GLLO 1J5EK 1MDUB 4CECA 3K5NA 2PYJA 3KK7A 1C0FA 3JYTA 2O8EA 4E19A 5SWMA 1JXEA 1VK0A 3QFUA 3DXKA 2B5JA 3QEWA 3ATVA 4BG8A 3EYZA 3LAMA 3RSEB 4CZHA 4DS5A 3H46O 4M7YA 4FLZA 1TKDA 2ASMA 3H3NO 4JKFA 4L3QA 2ZM6K 5FPNA 5DK5A 4LF6K 3GL1A 4NCBA 4C8MA 3VETA 4U67L 3E01A 5HRSA 1CXUA 3KWGA 2KFZA 2UUAK 4E89A 3PIPL 1NJXA 3PY8A 4JKBA 4I9QA 3MEEA 2ITGA 1BHLA 1JLQA 4CK2A 4B9LA 2GEMA 3OYEA 4HWIA 2NRXA 4CEZA 4ILHA 1MWMA 4DLEA 3D45A 3V9WA 3HRGA 3FFKB 3HT3A 1DLOA 4FOEA 1NGIA 4LFAK 3OS0A 3PSFA 3LL3A 3ZT2A 4BC5A 4NLCA 5AFUA 3AV9A 4H5WA 3PIOL 1KFDA 3TR8A 3EE9A 1YHQN 5TKWA 5AQOA 2PBDA 4JKEA 4YOTA 5LJVA 4BRFA 3NH0A 3ZETB 1QTMA 2GUPA 2YNGA 3DLRA 2P9SA 3CC2N 4KTZA 1ATNA 4H0OA 5LMUK 2IS3A 4WFBL 1W9HA 3LM2A 2A1SA 1BA1A 3TABA 1S9GA 4AQYK 3SQ0A 1OH5A 4KHYA 2KZMA 1VSHA 1BO5O 3L0QA 3WXKA 4BR7A 3KKRA 3KZBA 4R79A 4C1NI 3HPOA 1KLNA 4R5PA 3CYMA 2XY5A 3VTHA 2CGKA 3JXUA 3NVKA 1HUXA 4LSNA 1C0MA 3KLGA 3J80O 4FWMA 4BREA 4CHQA 4CESA 3VQCA 4EIAA 4NCAA 5CY4A 4UY8O 5FRMA 3I8BA 4KHUA 3KLHA 4CJ7A 1TKZA 4CEFA 1TL3A 5H1SQ 2VYPA 2HNDA 1RT4A 4M41A 2WFBA 2FSJA 3HVTA 1NOZA 4DQRA 4WQ4A 3ENBA 4RW4A 4HUGA 3AVHA 2HHVA 4E7HA 3SBGA 2RKIA 1C1BA 4CJEA 2QK9A 3MN7A 3ZEUA 5HRRA 3H1VX 5AQHA 3VEVA 4LF9K 1U48A 2P9UA 1NM1A 1D9DA 3M1FA 4CHZA 1VQ4N 2HF4A 1HKGA 3PO4A 4CF0A 4KO0A 3CJ1A 3OYMA 1IBKK 4B3TK 1BI4B 1T6DA 2GTDA 4JKCA 3TAFA 2HHXA 5M1OA 4CK3A 4B9TA 4B3RK 2YKNA 1JLCA 1RT3A 5C10A 2DY4A 1HNVA 4BE2A 3WXMB 1S1TA 3OYBA 4ICLA 3IKMA 3O9QA 3HOTA 1K73O 4A2AA 4AILC 3THVA 4DQ8A 3M8QA 3TWHA 1HJRA 4IO8A 3T19A 2AJQA 5AQJA 1QQMA 1LAVA 1VQ9N 4OLBA 5HOOA 5JLFA 2HB5A 3I0RA 4JKDA 3VEOA 5F0XA 1N8RO 5J2QA 4JLHA 2DPNA 2UYTA 1SKRA 3UKRA 1VQLN 1ZBFA 3SMPA 3CCSN 2BGGA 1Z05A 2WONA 4C8LA 3I8DA 4CFDA 4IXCA 4F2SA 4U7BA 3V1RA 4FWLA 2RN2A 3UIQA 1MWKA 4FM2A 1WSEA 4IFEA 3DRSA 3E9LA 3QINA 3ZT0A 4AH9A 4Q0BA 1A5WA 2G8VA 4MLEA 3L6QA 5SZTA 4Q5VA 1NGCA 1WBDA 4LC9B 3PV8A 3LDSA 3MCAB 1NKCA 4FPAA 4BC4A 4CEOA 4CD3A 4X64K 2ZGZA 1C1AA 1WB9A 1XC3A 4B1YB 3P1GA 5EOYA 1HYSA 1Y97A 4F3TA 4HTUA 3WQUA 4DV2K 2QXLA 4FJKA 4KREA 4FWKA 5LMNK 1YVUA 4DFKA 5EX5A 1VQON 5HROA 4BRKA 1NGFA 5E84A 3SUPA 2ASPA 4YORA 4O0JA 4WQ4C 1J53A 4B8AB 3V1OA 2GWJA 4QCLA 4JI1K 4C8OA 2IDOA 3VENA 3TTCA 3CMEN 2KLAA 4O55A 2NRRA 2UU9K 3G10A 2CH5A 1DKGD 2A40A 1REVA 1P8ZA 1JLAA 2Q1NA 4IG3A 3ZSWA 3VEWA 4CJRA 3FZLA 4JI6K 4JS4A 3AA2A 1RT1A 1EP4A 5T7BA 4GNIA 1N5YA 3K5LA 4YOXA 1IJJA 1QHAA 1U2VB 4X65K 3VQDA 5K14A 1S5JA 4KFBA 4FYDA 3ZSQA 3DXMB 3VGKA 4YOYA 1EXQA 3H45C 3DLHA 1YF5L 4QS9A 5KQDA 1RBVA 2G8UA 4JKGA 3SMSA 3K5MA 4MO4A 4DR4K 2WOMA 4IDHA 1EO1A 1EKEA 4I6MB 5AQZA 4CZMA 4KAZA 3CFPA 3JSMA 3T69A 2HHTA 1E4FT 4FJHA 5KI6A 2KZZA 3LP2A 1JLFA 4KHQA 4JHDB 1TUYA 1BWFO 2YHAA 4JI7K 1VSDA 3O4NA 2AP1A 2V52B 2FXUA 1VQ7N 3F2KA 3TANA 1XHZA 3SCXA 4FOIA 5C2FA 1NBWA 2KQ2A 4A62A 3JAMO 3NBPA 1VSIA 1S3XA 4Z4EA 4IOCL 3L8BA 4O5FA 3AO3A 3O3FA 4DV5K 3QERA 4CK1A 1EX4A 3E1YA 3OYAA 2XY6A 3I33A 4E7LA 1U4BA 1HYVA 2ZWHA 3TU5A 4Z94A 1SV5A 4M3UA 4H5NA 2P9IB 1EETA 4BE0A 4CZIA 1BIZA 1TAUA 1O1WA 4E1MA 3EO3A 3OYIA 4JI8K 4BRPA 2XO7A 3IRXA 1X1PA 4KTWA 4CF8A 3D2FA 1LW2A 4EZ6A 2E4LA 3VQ6A 1W2BM 1QQOA 3SUOA 3QB0A 4Z4CA 5JMVA 1K6YA 4PA1A 4L8RB 1ASWA 2ZJRL 3AVLA 1O13A 3FZKA 3MX5A 5GAGP 2O4GA 3WEEB 1I3AA 1H1VA 1ZXOA 3ENHA 4KV8A 3T7ZA 4MQ3A 1JCGA 4W5TA 1NLVA 3TPQA 3L2VA 4FPBA 4JN4A 1ZBHA 5KRSA 4DTRA 2E2OA 4CJ4A 5AQUA 4RTFD 2HBLA 3OS2A 1X3NA 3F5TA 4H0TB 1OH6A 4GKJK 4BE1A 2Z1IA 3PX6A 5C24A 1N33K 5CR4A 4M42A 3MEDA 3M5RA 4FK2A 5BPMA 4DV1K 3HPGA 4XH4A 4DR6K 3LZIA 4KB0A 1J5OA 1TYQB 2HF3A 3DYAA 1QZ5A 1A5XA 4CJVA 2QW9A 5CE3A 1FKPA 3FZHA 3DWLA 4DFPA 2O8BB 5M1KA 1RDUA 2P5OA 1QQNA 1BG3A 4AHCA 4H0XB 3CC4N 2NRWA 3EZWA 4ELVA 5AQQA 2VCPA 2BTFA 3KK1A 5LL6Z 2X74A 5AQPA 4E7IA 1IKWA 2QWQA 5JS1A 4DQIA 1RCHA 1JL1A 1BDGA 2OZSA 4BACA 1FJGK 4DB3A 4KHWA 1DEJA 1HKBA 2IVPA 2KHOA 3NE6A 3PX4A 4CBUA 2OANA 1Z25A 3DOLA 3O1WA 4I2QA 4CJSA 3AARA 3CG7A 2EWSA 3S3NA 4EAHD 5CHIA 5AQVA 4PKGA 3OHRA 2P5GA 5AZJA 3HYFA 4CZKA 1QHTA 4DCHA 2XY7A 1YIJN 1WN7A 4OO1J 2JWKA 3P5JA 3NH1A 1KVBA 3LDQA 3NAEA 2NLXA 5BREA 4FM0A 1NMDA 3MWPA 4EHTA 1TL1A 4DF8A 4M3YA 2I7NA 4DUYK 3B6PA 3W3DA 1Q9XA 2KTQA 4DR1K 2OYQA 1WSFA 3LDLA 4BC2A 1OH8A 2O8FA 4CHPA 3ULEA 3TAMA 4GKKK 4YY3K 5KGWA 3L3VA 3MK6A 3C94A 2VG7A 3CJ7A 1DGKN 4ELTA 4JK7A 3AO1A 4DTPA 3W0LA 3WNFA 4YFUA 4IEIA 2X78A 3H3OB 1BIUA 2YI1A 2ZE2A 1K9MO 1QSLA 4BWMA 4OKKA 3C6TA 4CF1A 2HMIA 4BRQA 4BVOA 4GV6A 2HBKA 3VN5A 4BC3A 1LWEA 2P9PA 3R9PA 4KH6A 3THWB 2VQEK 4OX9K 1WSGA 3EE8A 2OA8A 1YJ9N 3T1HK 3SV4A 2YJFA 5JVHL 3NFAA 4B9NA 3UE5A 3P31A 5AR0A 4WFAL 4BR9A 3THXA 1VSJA 1IKYA 3R3LA 2E88A 3QICA 4UQGA 4E7KA 2RHKA 5GAHP 2LSNA 4KPYA 4K8XA 2XY8A 2FBVA 3B8AX 1LWFA 1NJWA 2IOCA 3A0IX 3VEYA 3K5OA 5AQNA 2QXFA 2F4VK 3O4WA 1RDAA 1L3TA 5A2QO 3RRGA 2FBYA 3U9DA 4HUFA 1L3UA 3WNGA 4EHUA 1GLDG 3NDKA 5J2NA 1K8KB 3AVJA 3CI5A 1WLJA 3AGKA 1YUWA 3FFIA 2NZTA 3CD6N 2FF3B 5HRPA 4ILGB 2F8SA 5AQFA 3OJUA 3QEVA 2ITMA 4PY5A 4QS8A 1ILYA 3ENOA 4K42A 4KI4A 3CQ8A 4OGCA 3AVNA 5AJ3K 4NYNA 3LDNA 3DM2A 1S9EA 2Z1GA 5AQSA 3NH2A 2GV9A 4KKOA 2ZGYA 3MMVA 1HNXK 1XWLA 4CEAA 5C2DA 2E8AA 3EY1A 1IO2A 1E3MA 3CCEN 2F9WA 5KPZA 3HXMA 3NCIA 4W5RA 4DSFA 1S22A 1L3VA 3VMFB 3SAFA 4M3TA 3ISNC 2W42A 3VQ7A 4ELUA 5F2RA 2OTLN 3H1QA 3HP9A 4B3OA 3C7NA 4XEIA 4CW7B 3T1YK 4H0YB 4GV3A 4JI4K 2G8HA 4DTMA 4LH5A 3TARA 3T3FA 3VESA 3L4QA 1R0AA 5BPNA 3C6AA 4DUZK 1Q82O 3KVGA 1RBUA 4A59A 1VQ6N 3UKUB 2V7YA 3MN9A 5C15A 3U8XA 3J81O 3GG4A 3O8MA 1X3MA 5CYQA 3RSEA 4F4KA 3ZX3A 3HOSA 3LDPA 4KHSA 3L4IA 1TUUA 3NF6A 1S6QA 4FVMA 2YCHA 4IZ9A 3V6DA 1MU2A 1CZBA 3V9UA 2UXBK 2P1JA 1YI2N 1S72N 2A41A 4QS7A 3C95A 4TSXA 4HCCA 3HP6A 4FWNA 5BRHA 4W5QA 2IIRA 4ZTJA 4B3MK 1KRPA 5F1XA 1HQUA 4AHVA 3WUHA 1HNWK 4AHUA 4F8RA 4ILJA 5KGXA 3HZ6A 3QBWA 2E5LK 4DR2K 1NGHA 3CQXA 2Q3SA 1RT6A 3SV3A 2FBTA 1U49A 2DFEA 3PUFA 5AZIB 3T1AA 3P39A 3R1XA 5JVGL 3PX0A 4RW7A 4YOUA 3RR8A 1P90A 2G8IA 4LD0A 3GE1A 4FJNA 4DR7K 3ZT4A 4FZZA 1CZAN 3QLHA 1N6QA 3IDHA 1TKTA 4JD2B 4JI5K 4HTLA 4NXMK 4C1NK 4CGHA 2VQFK 1DT9A 3ZETA 4CGJA 1RTDA 3LM9A 3O5BA 4B9QA 4DV7K 1JLBA 1KFSA 4J2AA 3K9JA 3KKSA 1BL3A 4OKJA 4CEBA 4A5BA 1KAXA 1NK7A 4O0IA 4DFJA 2VGNA 5ADXH 4LFBK 1IG9A 2VG5A 1VSKA 3L2UA 4H5VA 4EP4A 1BISA 4NCGA 2ZD1A 4F3OA 3O9RA 3BEXA 4E1NA 1ASVA 4N47A 5BRDA 3BF1A 1XI1A 4DHYA 3S41A 3TAGA 4JS5A 3A5OC 4BRCA 4X66K 3SJJA 2OCEA 1VQPN 3P83D 3UB5A 2Q36A 2YKMA 4FW2A 4YHHK 3RTVA 3QIOA 4CHOA 3OTOK 3MN6A 3H6EA 4KI6A 1CXQA 3CHWA 2Q31A 3DJCA 3CCLN 2HHUA 2O4IA 4FJ5A 3FE1A 1NK0A 3EEQA 3AVFA 3O9SA 3OS1A 4BQLA 4O44A 5AQYA 4CVNE 4H0VB 3WXJA 3WXLA 5JLHA 3CCVN 4XH1A 5I3UA 4BRAA 3BGRA 1JLEA 1XMQK 4BR0A 3SUQA 1VRUA 3IS9A 1RILA 5J1EA 1R59O 2P9LB 2QWLA 4DFMA 3HK2A 4FL9A 3SQ2A 1GLEG 1RTIA 3KLEA 2E1ZA 3RMBA 4M3ZA 4H5RA 5C12A 3D0PA 2ASOA 4DQSA 4B9SA 2YHWA 2DTUA 2ZJPL 1LCUA 3OYNA 5BR9A 4K25A 3S9HA 4I9LA 2FBXA 2P9NB 1VSLA 1BI4A 4XH5A 3QMLA 3TAEA 4X62K 3Q7CA 1JXBA 3ATUA 5FPEA 3OYFA 3ZX2A 2A1RA 3AAQA 1OH7A 1VHXA 3D7EO 1KD1O 2KKZA 1XC9A 1OKJA 3VA3A 5BR8K 4DR3K 3AA5X 2UUBK 4LF4K 5BN9A 4IBNA 4DG1A 2VWJA 5BPLA 3VERA 5HP1A 1SZ2A 3L2RA 4CFAA 4DLGA 4JK8A 1BQNA 1RFQA 2IVOA 3K2PA 5KPTA 2O8DB 3TTDA 4LF5K 2F7TA 4PL7A 3C6HA 3MEGA 2YX6A 1LAWA 2OZMA 4G1QA 4ID1A 3G4SN 4CGGA 3D2FB 4V19S 3VQ5A 3RWUA 1LV5A 4K41A 1YXQA 1SL2A 3R6MA 4H4MA 5EVZA 3O6WA 3ASMA 1NK9A 3OJSA 3VQ8A 3DLLL 2QA4N 4CIEA 3J7AP 4JKAA 3VF6A 2OPPA 4FWSA 4DV6K 1MA9B 4B9MA 4CGDA 4HUEA 3HVRA 3CFOA 3J8AA 3MXMA 3SLCA 1B9DA 2D0OA 3G71N 1UA1A 3M8SA 3VGLA 2P9KB 1JJ2M 2D0BA 4WQ5A 3OW2M 4IDKA 1VSMA 1CZ9A 1SQKA 4EP5A 1HMVA 1WAFA 4MDAA 4CI6A 1A5VA 2JGUA 4H5TA 5C0YA 4CJPA 1Q8IA 4IO9L 1HPMA 3THYB 3P4IA 2W40A 5HL7L 1NGBA 4ISEA 4E1JA 3SK3A 3AO4A 4FZXC 3QNNA 4KHPK 1GOAA 2HVHA 4DTUA 4A5AA 1VQMN 3G6EN 4HVJA 1SKWA 3AA4A 1TK5A 4WCEL 3AO2A 3I56N 3G25A 4ZTFA 3LP3A 4CIFA 1WUAA 1HLUA 4JV5K 1RDCA
chains in the Genus database with same CATH topology
4C8NA 4CFCA 3SQ0A 5EU7A 4KHYA 4OGEA 3RMCA 1U45A 2KZMA 2F96A 3AO1A 1VSHA 4DTPA 1JLGA 4CGIA 3CFRA 3KD1E 3K59A 3SZ2A 3LWLA 3KKRA 3WNFA 2RF2A 4YFUA 3OYJA 3QEXA 4DTOA 2X78A 3OYKA 4CHYA 4BDZA 4B8CA 1RDDA 4FLVA 1BIUA 3NF9A 2ZE2A 4CJLA 4FLTA 1WAJA 4J2BA 4Z4IA 1QSLA 4BWMA 4OKKA 3C6TA 4CF1A 3DLGA 1TGOA 3HPOA 4R5PA 1KLNA 3L2QA 3CYMA 2XY5A 2HMIA 4CE9A 2GBZA 4OPKA 4I7FA 3AVIA 2R7YA 1LW0A 4QAGA 1LWEA 3VN5A 2I5JA 1KVCA 4BDPA 4LSNA 4DSLA 4FJJA 1C0MA 3KLGA 3NGIA 1UAXA 4RW8A 4FJ8A 4CEEA 4ID5A 3OY9A 4CHQA 1WSGA 3DOKA 4DQPA 1WSJA 4CESA 4M3XA 1TKXA 1BCOA 2OA8A 1C0UA 3VQCA 4XIUA 2XHBA 1HRHA 1ITGA 4FCYA 5CY4A 4DU3A 3SV4A 3RR7A 4NCAA 3ZSYA 5FRMA 4LSLA 3KIOA 3NFAA 3ITHA 3KLHA 4N76A 4KHUA 1TKZA 5DMRA 4B9NA 4CEFA 1TL3A 3QO9A 4IFYA 5FROA 1NK5A 1DTTA 1TVRA 2HNDA 1RT4A 3A2FA 4M41A 1VSJA 2HHQA 2YNFA 3HVTA 1BQMA 1IKYA 2GUIA 1NOZA 3ZSVA 3SUNA 4CCHA 2HNZA 3CM5A 4DQRA 4PQUA 4UQGA 4E7KA 1RBRA 3RRHA 4CFBA 2EX3A 2LSNA 2RPIA 4RW4A 1YT3A 1RNHA 4KPYA 4K8XA 4Z4GA 2XY8A 2FBVA 3AVHA 4HUGA 2HHVA 3KTQA 4E7HA 1LWFA 2RKIA 2IOCA 1C1BA 4CJEA 1NJWA 2QK9A 4IFVA 5HRRA 4FLWA 3K5OA 3VQ4A 2QXFA 1JKHA 3LANA 2F8TA 4LH4A 1QE1A 1G15A 1RDAA 1U48A 1L3TA 3RRGA 1D9DA 4CHZA 2FBYA 4OKEA 4HUFA 3QNOA 1GOCA 3TAQA 1L3UA 3O3GA 4K8ZA 1ZBUA 3WNGA 3LPTA 4RW9A 3NDKA 5J2NA 4GVMA 3F9KA 3KK3A 1QS4A 3PO4A 4N41A 4JRPA 1S1VA 4CF0A 4KO0A 3AVJA 3OYMA 2EHGA 1BI4B 1WLJA 3FFIA 1T03A 1T05A 3TAFA 2HHXA 5HRPA 4CK3A 2F8SA 4B9TA 3OJUA 3QEVA 2YKNA 1JLCA 1RT3A 1T7PA 5I42A 4PY5A 4OJRA 4QOZB 1HNVA 2DY4A 4BE2A 4EZ9A 3SQ1A 1S1TA 3OYBA 3ALYA 1S1WA 2OPQA 4ICLA 3HJFA 3U3GA 2HHSA 4KI4A 3CQ8A 4OGCA 3HM9A 4CEQA 3AVNA 3SI6A 4AILC 4NYNA 3THVA 3AA3A 3M8QA 3DM2A 1HJRA 1S9EA 2Z1GA 3H08A 4GMJB 3QIPA 3T19A 3ZT3A 1SUQA 3NH2A 4FJXA 2AJQA 4FLYA 2GV9A 4KKOA 4AHRA 1LAVA 4OLBA 1XWLA 3OYLA 2HB5A 1RT2A 3MECA 3I0RA 4Y1CA 4CEAA 3EZ5A 5KTQA 2NUBA 2PY5A 5J2QA 3EY1A 1IO2A 2VWKA 3AVGA 4JLHA 4FJLA 4W5OA 3HXMA 3NCIA 1SKRA 1X9WA 2FC0A 4W5RA 4DSFA 2JLEA 1L3VA 4CF9A 1ZBFA 2BGGA 2WONA 1D8YA 2G8WA 4C8LA 1WSHA 3ISNC 4CFDA 3I8DA 2W42A 4M3TA 2YV0X 4PUOA 1NOYA 2X6NA 5E41A 4F2RA 4F2SA 1X9SA 2ATQA 4WE1A 3V1RA 3VQ7A 2RN2A 2HHWA 1VSFA 3NF8A 3UIQA 4ELUA 4FM2A 1WSEA 2OPSA 4IKFA 3DRSA 4B3OA 3HP9A 3NF7A 3DMJA 1HQEA 3O4QA 4B9UA 3ULDA 3QINA 4FJGA 3ZT0A 4AH9A 4Q0BA 1A5WA 2G8VA 1FK9A 5SZTA 4Q5VA 4FJIA 5CYMA 3DRPA 3V9XA 4M3RA 4DTMA 4LH5A 2G8HA 3PV8A 3TARA 3VQPA 3T3FA 3LDSA 1NKCA 3M8RA 3VQEA 4ZHRA 4CEOA 1R0AA 2BDPA 3L3UA 4CHNA 3OYGA 4DU1A 3MXJA 1C1AA 2ZQBA 4DS4A 3KLIA 1J9AA 4O5BA 3P1GA 3HPHA 1HYSA 3I0SA 4KTQA 1Y97A 2ETJA 1RBUA 4FM1A 4F3TA 3KD5E 4HTUA 3IAYA 4FJKA 4B08A 3BDPA 4KREA 4OVLA 2D5RA 1YVUA 1IH7A 2Z1HA 1WSIA 4O4GA 5CYQA 4DFKA 4F4KA 1FKOA 5HROA 5J2PA 4KHSA 1BGXT 3SUPA 1NK8A 3NF6A 1S6QA 2HNYA 2OPRA 4FVMA 4O0JA 5C42A 3V6DA 3SQ4A 4DSJA 1J53A 4B8AB 3V1OA 2HVIA 3ZSRA 1MU2A 4QCLA 4C8OA 1CZBA 1RTHA 3QEPA 2IDOA 5J2MA 3V9UA 3V81A 2P1JA 4O55A 4DSIA 4LY7A 3G10A 1J54A 4TSXA 3C95A 4HCCA 3HP6A 1REVA 1RDBA 3VQQA 1JLAA 4IG3A 5FDLA 4CEDA 4W5QA 3KK2A 1NK4A 4ZTJA 3ZSWA 4HCBA 4FJMA 3G0ZA 1KRPA 5FRNA 1HQUA 2DFHA 4AHVA 4CJRA 4Z4HA 4AHUA 4F8RA 3OYHA 4JS4A 3AA2A 3U6FA 4B9VA 5C25A 5KGXA 3QETA 1RT1A 4CJTA 1EP4A 4DTSA 5T7BA 1NJYA 1UOCA 2Z1JA 2Q3SA 3DRRA 3VQBA 5CZ2A 1RT6A 3K5LA 1N5YA 4FK4A 3SV3A 2FBTA 4FXDA 3ZSOA 2DFFA 2VG6A 3MAQA 1KTQA 4Z0UA 3V9SA 1U49A 4CJWA 2DFEA 3PUFA 3VQDA 5K14A 1S5JA 4KFBA 3T1AA 5KRTA 4FYDA 2PZSA 3ZSQA 3AVKA 3KLFA 3L2WA 1HPZA 3PX0A 4RW7A 3RR8A 1EXQA 2X6SA 4RW6A 2G8IA 4Z4FA 3U3YA 2YHBA 4LD0A 3DLHA 1KLMA 4FJNA 1I39A 3ZT4A 3F73A 5HLFA 1RBVA 3HSTB 4FZZA 3QLHA 4E0DA 4CJUA 1N6QA 1HNIA 4GW6A 3ZT1A 2G8UA 1TKTA 3K5MA 1L5UA 4KHNA 2WOMA 5HBMA 4N5SA 1F21A 3NGZA 1EKEA 3LP0A 4CGHA 3VQAA 4KAZA 1B92A 4CGJA 1VRTA 3CFPA 3JSMA 1SL1A 1RTDA 1JLBA 1KFSA 4J2AA 2HHTA 3RMDA 3KKSA 3V1QA 4FJHA 5KI6A 1BL3A 2KZZA 3LP2A 4OKJA 4CEBA 4OLAA 1NK7A 4O0IA 4DF4A 1JLFA 3QESA 3SPZA 4CJQA 1TAQA 1Z26A 1C6VA 2B6AA 4FW1A 1RTJA 1QSYA 3TAPA 3DLKA 3C6UA 3WNEA 3ZSZA 4DFJA 4FZYA 4KHQA 3KJVA 4DU4A 1VSEA 1S1XA 2YHAA 1IG9A 2VG5A 1DTQA 1VSDA 1VSKA 2BANA 3O4NA 4EP4A 3L2UA 1BISA 4NCGA 4DTNA 4DSEA 1RT5A 2ZD1A 4F3OA 1ZYQA 2D0AA 4E1NA 4H8KA 1ASVA 4N47A 3WNHA 3O3HA 4ELTA 3TANA 3DI6A 1XI1A 4CJ3A 4DTJA 4KB1A 3VA0A 3TAGA 1XHZA 1RBSA 3LWMA 4JS5A 3TWHA 3SCXA 4KRFA 3DLBA 3SJJA 3S3MA 2KQ2A 2IGIA 2PYLA 3P83D 3RTVA 2YKMA 4FW2A 3K58A 3AVAA 3NBPA 3QIOA 1VSIA 4CHOA 3OYCA 4DWIA 1ZBLA 2QKKA 3B6OA 4Z4EA 3L8BA 3AO3A 1IKXA 1U04A 4KI6A 3O3FA 3QERA 1CXQA 3SNNA 4CK1A 1EX4A 3OYAA 4DQQA 2XY6A 5D3GA 3OYDA 4CIGA 1SL0A 2HHUA 2KW4A 4FLUA 4FJ5A 1NK0A 2O4IA 3HO1A 1CLQA 3LZJA 3RMAA 4E7LA 1Q9YA 1U4BA 3AO5A 1S6PA 1HYVA 3AVFA 3OS1A 1SV5A 4JRQA 4O44A 4M3UA 4BE0A 1EETA 3MXIA 1TK0A 4W5NA 1BIZA 3TI0A 3M8PA 1KSPA 1TAUA 1O1WA 4E1MA 3OYIA 1QSSA 1D9FA 5I3UA 2XO7A 2YNHA 1X1PA 3IRXA 4KTWA 3BGRA 4CF8A 1JLEA 3SUQA 1VRUA 1LW2A 3IS9A 1D5AA 1RILA 2E4LA 3VQ6A 3ZCMA 4CF2A 5J1EA 4EZ6A 3SUOA 4Z4CA 4DFMA 4M45A 3V9ZA 4J2EA 1S1UA 1K6YA 3SQ2A 4PA1A 1NKEA 1ASWA 4L8RB 3HK2A 1RTIA 3KLEA 2KFNA 3AVLA 3RMBA 4M3ZA 3D0PA 4DQSA 4B9SA 1U47A 4FJ9A 2O4GA 2DTUA 1I3AA 1T8EA 1B9FA 3OYNA 4I2PA 3S9HA 1UWBA 4I9LA 4CJ5A 2FBXA 4KV8A 1YTAA 3CM6A 1VSLA 4MQ3A 4W5TA 1BI4A 1TK8A 4E3SA 3NGYA 3TAEA 1XHXA 3AVMA 4Y1DA 3L2VA 2Y1IA 1JXBA 1ZBHA 3NHGA 5KRSA 4DTRA 4CJ4A 3VQ9A 4C8KA 1IKVA 3OYFA 2A1RA 5JS2A 3OS2A 2HW3A 1SKSA 4N56A 4BE1A 2Z1IA 1RT7A 3AVBA 4MFBA 3LPUA 1BCMA 1W0HA 3LAKA 5C24A 3PX6A 4M3WA 1JL2A 4M42A 1XC9A 3PO5A 1C0TA 2E6LA 3MEDA 3VA3A 4FJ7A 3SYZA 1ASUA 2XRIA 3AA5X 1YTUA 4FK2A 4IBNA 1NJZA 3HPGA 4DG1A 2VWJA 5HP1A 4DTXA 3LZIA 4KB0A 3L2RA 4CFAA 3K57A 4DLGA 1J5OA 3DYAA 1BQNA 4CECA 1A5XA 4CJVA 3K5NA 1FKPA 2PYJA 4DFPA 3JYTA 4FLXA 2P5OA 4E19A 1LWCA 3LP1A 5SWMA 1JXEA 1VK0A 3K2PA 1QQCA 2B5JA 3QEWA 4BDYA 2Y1JA 4AHCA 1KCFA 4PWDA 2OZMA 3MEGA 1LAWA 3EYZA 4G1QA 4ID1A 4CGGA 3VQ5A 3RWUA 4ELVA 1LV5A 3LAMA 1SL2A 3KK1A 4H4MA 1RBTA 4DSKA 4DS5A 2X74A 4FLZA 1TKDA 3ASMA 4H4OA 1NK9A 5DK5A 3HL8A 3OJSA 4E7IA 1IKWA 3VQ8A 1C1CA 4NCBA 5JS1A 4DQIA 4C8MA 1RCHA 1JL1A 4DMNA 2QKBA 3E01A 5CZ1A 4CIEA 5HRSA 2OZSA 4E7JA 1CXUA 4BACA 4J2DA 2KFZA 3SPYA 2OPPA 4KHWA 3OVNA 4E89A 3PY8A 1NJXA 2IC3A 1WNSA 4B9MA 4CGDA 4HUEA 3NE6A 3PX4A 3DLEA 3HVRA 3CFOA 2P51A 3MXMA 3S3OA 1B9DA 1UA1A 4I9QA 3MEEA 1Z25A 2ITGA 3DOLA 1BHLA 3M8SA 1JLQA 3IG1A 4CERA 4I2QA 4CJSA 4CK2A 3CG7A 1UA0A 4B9LA 3OYEA 4FK0A 2D0BA 3V4IA 1GOBA 4CEZA 3S3NA 1NKBA 4CGFA 3QEIA 3AVCA 4DLEA 4IDKA 1VSMA 1CZ9A 2P5GA 4IG0A 3HYFA 4EP5A 1QHTA 3D45A 2G8FA 3V9WA 1HMVA 1WAFA 2XY7A 1A5VA 4CJKA 2G8KA 1WN7A 2JGUA 3HT3A 3P5JA 1DLOA 3NH1A 4CJPA 1FXXA 1KVBA 1Q8IA 3ZSXA 1HYZA 3NAEA 3OS0A 1TV6A 4NYFA 4CJFA 4YNQA 3ZT2A 4FM0A 3AV9A 1ZBIA 1KFDA 3TR8A 2E6MA 3AO4A 1TL1A 4FZXC 2IAJA 3QNNA 1GOAA 4AHTA 4DF8A 4M3YA 2HVHA 2YNIA 1KVAA 4BWJA 3B6PA 4DTUA 1L3SA 3LALA 1Q9XA 4HHTA 2KTQA 3NH0A 5HRNA 1QTMA 4HVJA 1SKWA 2OYQA 1WSFA 2YNGA 3DLRA 4RG8A 4KTZA 3AA4A 4CHPA 2BE2A 1TK5A 3TAMA 4OPJA 2B4JA 1NK6A 3AO2A 2IS3A 5KGWA 4ZTFA 1W9HA 3LP3A 3L3VA 4AHSA 2D0CA 2A1SA 2VG7A 3C94A 4CIFA 3TABA 1X9MA 1S9GA 1RDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8N A;  4CFC A;  3SQ0 A;  5EU7 A;  4KHY A;  4OGE A;  3RMC A;  1U45 A;  2KZM A;  2F96 A;  3AO1 A;  1VSH A;  4DTP A;  1JLG A;  4CGI A;  3CFR A;  3KD1 E;  3K59 A;  3SZ2 A;  3LWL A;  3KKR A;  3WNF A;  2RF2 A;  4YFU A;  3OYJ A;  3QEX A;  4DTO A;  2X78 A;  3OYK A;  4CHY A;  4BDZ A;  4B8C A;  1RDD A;  4FLV A;  1BIU A;  3NF9 A;  2ZE2 A;  4CJL A;  4FLT A;  1WAJ A;  4J2B A;  4Z4I A;  1QSL A;  4BWM A;  4OKK A;  3C6T A;  4CF1 A;  3DLG A;  1TGO A;  3HPO A;  4R5P A;  1KLN A;  3L2Q A;  3CYM A;  2XY5 A;  2HMI A;  4CE9 A;  2GBZ A;  4OPK A;  4I7F A;  3AVI A;  2R7Y A;  1LW0 A;  4QAG A;  1LWE A;  3VN5 A;  2I5J A;  1KVC A;  4BDP A;  4LSN A;  4DSL A;  4FJJ A;  1C0M A;  3KLG A;  3NGI A;  1UAX A;  4RW8 A;  4FJ8 A;  4CEE A;  4ID5 A;  3OY9 A;  4CHQ A;  1WSG A;  3DOK A;  4DQP A;  1WSJ A;  4CES A;  4M3X A;  1TKX A;  1BCO A;  2OA8 A;  1C0U A;  3VQC A;  4XIU A;  2XHB A;  1HRH A;  1ITG A;  4FCY A;  5CY4 A;  4DU3 A;  3SV4 A;  3RR7 A;  4NCA A;  3ZSY A;  5FRM A;  4LSL A;  3KIO A;  3NFA A;  3ITH A;  3KLH A;  4N76 A;  4KHU A;  1TKZ A;  5DMR A;  4B9N A;  4CEF A;  1TL3 A;  3QO9 A;  4IFY A;  5FRO A;  1NK5 A;  1DTT A;  1TVR A;  2HND A;  1RT4 A;  3A2F A;  4M41 A;  1VSJ A;  2HHQ A;  2YNF A;  3HVT A;  1BQM A;  1IKY A;  2GUI A;  1NOZ A;  3ZSV A;  3SUN A;  4CCH A;  2HNZ A;  3CM5 A;  4DQR A;  4PQU A;  4UQG A;  4E7K A;  1RBR A;  3RRH A;  4CFB A;  2EX3 A;  2LSN A;  2RPI A;  4RW4 A;  1YT3 A;  1RNH A;  4KPY A;  4K8X A;  4Z4G A;  2XY8 A;  2FBV A;  3AVH A;  4HUG A;  2HHV A;  3KTQ A;  4E7H A;  1LWF A;  2RKI A;  2IOC A;  1C1B A;  4CJE A;  1NJW A;  2QK9 A;  4IFV A;  5HRR A;  4FLW A;  3K5O A;  3VQ4 A;  2QXF A;  1JKH A;  3LAN A;  2F8T A;  4LH4 A;  1QE1 A;  1G15 A;  1RDA A;  1U48 A;  1L3T A;  3RRG A;  1D9D A;  4CHZ A;  2FBY A;  4OKE A;  4HUF A;  3QNO A;  1GOC A;  3TAQ A;  1L3U A;  3O3G A;  4K8Z A;  1ZBU A;  3WNG A;  3LPT A;  4RW9 A;  3NDK A;  5J2N A;  4GVM A;  3F9K A;  3KK3 A;  1QS4 A;  3PO4 A;  4N41 A;  4JRP A;  1S1V A;  4CF0 A;  4KO0 A;  3AVJ A;  3OYM A;  2EHG A;  1BI4 B;  1WLJ A;  3FFI A;  1T03 A;  1T05 A;  3TAF A;  2HHX A;  5HRP A;  4CK3 A;  2F8S A;  4B9T A;  3OJU A;  3QEV A;  2YKN A;  1JLC A;  1RT3 A;  1T7P A;  5I42 A;  4PY5 A;  4OJR A;  4QOZ B;  1HNV A;  2DY4 A;  4BE2 A;  4EZ9 A;  3SQ1 A;  1S1T A;  3OYB A;  3ALY A;  1S1W A;  2OPQ A;  4ICL A;  3HJF A;  3U3G A;  2HHS A;  4KI4 A;  3CQ8 A;  4OGC A;  3HM9 A;  4CEQ A;  3AVN A;  3SI6 A;  4AIL C;  4NYN A;  3THV A;  3AA3 A;  3M8Q A;  3DM2 A;  1HJR A;  1S9E A;  2Z1G A;  3H08 A;  4GMJ B;  3QIP A;  3T19 A;  3ZT3 A;  1SUQ A;  3NH2 A;  4FJX A;  2AJQ A;  4FLY A;  2GV9 A;  4KKO A;  4AHR A;  1LAV A;  4OLB A;  1XWL A;  3OYL A;  2HB5 A;  1RT2 A;  3MEC A;  3I0R A;  4Y1C A;  4CEA A;  3EZ5 A;  5KTQ A;  2NUB A;  2PY5 A;  5J2Q A;  3EY1 A;  1IO2 A;  2VWK A;  3AVG A;  4JLH A;  4FJL A;  4W5O A;  3HXM A;  3NCI A;  1SKR A;  1X9W A;  2FC0 A;  4W5R A;  4DSF A;  2JLE A;  1L3V A;  4CF9 A;  1ZBF A;  2BGG A;  2WON A;  1D8Y A;  2G8W A;  4C8L A;  1WSH A;  3ISN C;  4CFD A;  3I8D A;  2W42 A;  4M3T A;  2YV0 X;  4PUO A;  1NOY A;  2X6N A;  5E41 A;  4F2R A;  4F2S A;  1X9S A;  2ATQ A;  4WE1 A;  3V1R A;  3VQ7 A;  2RN2 A;  2HHW A;  1VSF A;  3NF8 A;  3UIQ A;  4ELU A;  4FM2 A;  1WSE A;  2OPS A;  4IKF A;  3DRS A;  4B3O A;  3HP9 A;  3NF7 A;  3DMJ A;  1HQE A;  3O4Q A;  4B9U A;  3ULD A;  3QIN A;  4FJG A;  3ZT0 A;  4AH9 A;  4Q0B A;  1A5W A;  2G8V A;  1FK9 A;  5SZT A;  4Q5V A;  4FJI A;  5CYM A;  3DRP A;  3V9X A;  4M3R A;  4DTM A;  4LH5 A;  2G8H A;  3PV8 A;  3TAR A;  3VQP A;  3T3F A;  3LDS A;  1NKC A;  3M8R A;  3VQE A;  4ZHR A;  4CEO A;  1R0A A;  2BDP A;  3L3U A;  4CHN A;  3OYG A;  4DU1 A;  3MXJ A;  1C1A A;  2ZQB A;  4DS4 A;  3KLI A;  1J9A A;  4O5B A;  3P1G A;  3HPH A;  1HYS A;  3I0S A;  4KTQ A;  1Y97 A;  2ETJ A;  1RBU A;  4FM1 A;  4F3T A;  3KD5 E;  4HTU A;  3IAY A;  4FJK A;  4B08 A;  3BDP A;  4KRE A;  4OVL A;  2D5R A;  1YVU A;  1IH7 A;  2Z1H A;  1WSI A;  4O4G A;  5CYQ A;  4DFK A;  4F4K A;  1FKO A;  5HRO A;  5J2P A;  4KHS A;  1BGX T;  3SUP A;  1NK8 A;  3NF6 A;  1S6Q A;  2HNY A;  2OPR A;  4FVM A;  4O0J A;  5C42 A;  3V6D A;  3SQ4 A;  4DSJ A;  1J53 A;  4B8A B;  3V1O A;  2HVI A;  3ZSR A;  1MU2 A;  4QCL A;  4C8O A;  1CZB A;  1RTH A;  3QEP A;  2IDO A;  5J2M A;  3V9U A;  3V81 A;  2P1J A;  4O55 A;  4DSI A;  4LY7 A;  3G10 A;  1J54 A;  4TSX A;  3C95 A;  4HCC A;  3HP6 A;  1REV A;  1RDB A;  3VQQ A;  1JLA A;  4IG3 A;  5FDL A;  4CED A;  4W5Q A;  3KK2 A;  1NK4 A;  4ZTJ A;  3ZSW A;  4HCB A;  4FJM A;  3G0Z A;  1KRP A;  5FRN A;  1HQU A;  2DFH A;  4AHV A;  4CJR A;  4Z4H A;  4AHU A;  4F8R A;  3OYH A;  4JS4 A;  3AA2 A;  3U6F A;  4B9V A;  5C25 A;  5KGX A;  3QET A;  1RT1 A;  4CJT A;  1EP4 A;  4DTS A;  5T7B A;  1NJY A;  1UOC A;  2Z1J A;  2Q3S A;  3DRR A;  3VQB A;  5CZ2 A;  1RT6 A;  3K5L A;  1N5Y A;  4FK4 A;  3SV3 A;  2FBT A;  4FXD A;  3ZSO A;  2DFF A;  2VG6 A;  3MAQ A;  1KTQ A;  4Z0U A;  3V9S A;  1U49 A;  4CJW A;  2DFE A;  3PUF A;  3VQD A;  5K14 A;  1S5J A;  4KFB A;  3T1A A;  5KRT A;  4FYD A;  2PZS A;  3ZSQ A;  3AVK A;  3KLF A;  3L2W A;  1HPZ A;  3PX0 A;  4RW7 A;  3RR8 A;  1EXQ A;  2X6S A;  4RW6 A;  2G8I A;  4Z4F A;  3U3Y A;  2YHB A;  4LD0 A;  3DLH A;  1KLM A;  4FJN A;  1I39 A;  3ZT4 A;  3F73 A;  5HLF A;  1RBV A;  3HST B;  4FZZ A;  3QLH A;  4E0D A;  4CJU A;  1N6Q A;  1HNI A;  4GW6 A;  3ZT1 A;  2G8U A;  1TKT A;  3K5M A;  1L5U A;  4KHN A;  2WOM A;  5HBM A;  4N5S A;  1F21 A;  3NGZ A;  1EKE A;  3LP0 A;  4CGH A;  3VQA A;  4KAZ A;  1B92 A;  4CGJ A;  1VRT A;  3CFP A;  3JSM A;  1SL1 A;  1RTD A;  1JLB A;  1KFS A;  4J2A A;  2HHT A;  3RMD A;  3KKS A;  3V1Q A;  4FJH A;  5KI6 A;  1BL3 A;  2KZZ A;  3LP2 A;  4OKJ A;  4CEB A;  4OLA A;  1NK7 A;  4O0I A;  4DF4 A;  1JLF A;  3QES A;  3SPZ A;  4CJQ A;  1TAQ A;  1Z26 A;  1C6V A;  2B6A A;  4FW1 A;  1RTJ A;  1QSY A;  3TAP A;  3DLK A;  3C6U A;  3WNE A;  3ZSZ A;  4DFJ A;  4FZY A;  4KHQ A;  3KJV A;  4DU4 A;  1VSE A;  1S1X A;  2YHA A;  1IG9 A;  2VG5 A;  1DTQ A;  1VSD A;  1VSK A;  2BAN A;  3O4N A;  4EP4 A;  3L2U A;  1BIS A;  4NCG A;  4DTN A;  4DSE A;  1RT5 A;  2ZD1 A;  4F3O A;  1ZYQ A;  2D0A A;  4E1N A;  4H8K A;  1ASV A;  4N47 A;  3WNH A;  3O3H A;  4ELT A;  3TAN A;  3DI6 A;  1XI1 A;  4CJ3 A;  4DTJ A;  4KB1 A;  3VA0 A;  3TAG A;  1XHZ A;  1RBS A;  3LWM A;  4JS5 A;  3TWH A;  3SCX A;  4KRF A;  3DLB A;  3SJJ A;  3S3M A;  2KQ2 A;  2IGI A;  2PYL A;  3P83 D;  3RTV A;  2YKM A;  4FW2 A;  3K58 A;  3AVA A;  3NBP A;  3QIO A;  1VSI A;  4CHO A;  3OYC A;  4DWI A;  1ZBL A;  2QKK A;  3B6O A;  4Z4E A;  3L8B A;  3AO3 A;  1IKX A;  1U04 A;  4KI6 A;  3O3F A;  3QER A;  1CXQ A;  3SNN A;  4CK1 A;  1EX4 A;  3OYA A;  4DQQ A;  2XY6 A;  5D3G A;  3OYD A;  4CIG A;  1SL0 A;  2HHU A;  2KW4 A;  4FLU A;  4FJ5 A;  1NK0 A;  2O4I A;  3HO1 A;  1CLQ A;  3LZJ A;  3RMA A;  4E7L A;  1Q9Y A;  1U4B A;  3AO5 A;  1S6P A;  1HYV A;  3AVF A;  3OS1 A;  1SV5 A;  4JRQ A;  4O44 A;  4M3U A;  4BE0 A;  1EET A;  3MXI A;  1TK0 A;  4W5N A;  1BIZ A;  3TI0 A;  3M8P A;  1KSP A;  1TAU A;  1O1W A;  4E1M A;  3OYI A;  1QSS A;  1D9F A;  5I3U A;  2XO7 A;  2YNH A;  1X1P A;  3IRX A;  4KTW A;  3BGR A;  4CF8 A;  1JLE A;  3SUQ A;  1VRU A;  1LW2 A;  3IS9 A;  1D5A A;  1RIL A;  2E4L A;  3VQ6 A;  3ZCM A;  4CF2 A;  5J1E A;  4EZ6 A;  3SUO A;  4Z4C A;  4DFM A;  4M45 A;  3V9Z A;  4J2E A;  1S1U A;  1K6Y A;  3SQ2 A;  4PA1 A;  1NKE A;  1ASW A;  4L8R B;  3HK2 A;  1RTI A;  3KLE A;  2KFN A;  3AVL A;  3RMB A;  4M3Z A;  3D0P A;  4DQS A;  4B9S A;  1U47 A;  4FJ9 A;  2O4G A;  2DTU A;  1I3A A;  1T8E A;  1B9F A;  3OYN A;  4I2P A;  3S9H A;  1UWB A;  4I9L A;  4CJ5 A;  2FBX A;  4KV8 A;  1YTA A;  3CM6 A;  1VSL A;  4MQ3 A;  4W5T A;  1BI4 A;  1TK8 A;  4E3S A;  3NGY A;  3TAE A;  1XHX A;  3AVM A;  4Y1D A;  3L2V A;  2Y1I A;  1JXB A;  1ZBH A;  3NHG A;  5KRS A;  4DTR A;  4CJ4 A;  3VQ9 A;  4C8K A;  1IKV A;  3OYF A;  2A1R A;  5JS2 A;  3OS2 A;  2HW3 A;  1SKS A;  4N56 A;  4BE1 A;  2Z1I A;  1RT7 A;  3AVB A;  4MFB A;  3LPU A;  1BCM A;  1W0H A;  3LAK A;  5C24 A;  3PX6 A;  4M3W A;  1JL2 A;  4M42 A;  1XC9 A;  3PO5 A;  1C0T A;  2E6L A;  3MED A;  3VA3 A;  4FJ7 A;  3SYZ A;  1ASU A;  2XRI A;  3AA5 X;  1YTU A;  4FK2 A;  4IBN A;  1NJZ A;  3HPG A;  4DG1 A;  2VWJ A;  5HP1 A;  4DTX A;  3LZI A;  4KB0 A;  3L2R A;  4CFA A;  3K57 A;  4DLG A;  1J5O A;  3DYA A;  1BQN A;  4CEC A;  1A5X A;  4CJV A;  3K5N A;  1FKP A;  2PYJ A;  4DFP A;  3JYT A;  4FLX A;  2P5O A;  4E19 A;  1LWC A;  3LP1 A;  5SWM A;  1JXE A;  1VK0 A;  3K2P A;  1QQC A;  2B5J A;  3QEW A;  4BDY A;  2Y1J A;  4AHC A;  1KCF A;  4PWD A;  2OZM A;  3MEG A;  1LAW A;  3EYZ A;  4G1Q A;  4ID1 A;  4CGG A;  3VQ5 A;  3RWU A;  4ELV A;  1LV5 A;  3LAM A;  1SL2 A;  3KK1 A;  4H4M A;  1RBT A;  4DSK A;  4DS5 A;  2X74 A;  4FLZ A;  1TKD A;  3ASM A;  4H4O A;  1NK9 A;  5DK5 A;  3HL8 A;  3OJS A;  4E7I A;  1IKW A;  3VQ8 A;  1C1C A;  4NCB A;  5JS1 A;  4DQI A;  4C8M A;  1RCH A;  1JL1 A;  4DMN A;  2QKB A;  3E01 A;  5CZ1 A;  4CIE A;  5HRS A;  2OZS A;  4E7J A;  1CXU A;  4BAC A;  4J2D A;  2KFZ A;  3SPY A;  2OPP A;  4KHW A;  3OVN A;  4E89 A;  3PY8 A;  1NJX A;  2IC3 A;  1WNS A;  4B9M A;  4CGD A;  4HUE A;  3NE6 A;  3PX4 A;  3DLE A;  3HVR A;  3CFO A;  2P51 A;  3MXM A;  3S3O A;  1B9D A;  1UA1 A;  4I9Q A;  3MEE A;  1Z25 A;  2ITG A;  3DOL A;  1BHL A;  3M8S A;  1JLQ A;  3IG1 A;  4CER A;  4I2Q A;  4CJS A;  4CK2 A;  3CG7 A;  1UA0 A;  4B9L A;  3OYE A;  4FK0 A;  2D0B A;  3V4I A;  1GOB A;  4CEZ A;  3S3N A;  1NKB A;  4CGF A;  3QEI A;  3AVC A;  4DLE A;  4IDK A;  1VSM A;  1CZ9 A;  2P5G A;  4IG0 A;  3HYF A;  4EP5 A;  1QHT A;  3D45 A;  2G8F A;  3V9W A;  1HMV A;  1WAF A;  2XY7 A;  1A5V A;  4CJK A;  2G8K A;  1WN7 A;  2JGU A;  3HT3 A;  3P5J A;  1DLO A;  3NH1 A;  4CJP A;  1FXX A;  1KVB A;  1Q8I A;  3ZSX A;  1HYZ A;  3NAE A;  3OS0 A;  1TV6 A;  4NYF A;  4CJF A;  4YNQ A;  3ZT2 A;  4FM0 A;  3AV9 A;  1ZBI A;  1KFD A;  3TR8 A;  2E6M A;  3AO4 A;  1TL1 A;  4FZX C;  2IAJ A;  3QNN A;  1GOA A;  4AHT A;  4DF8 A;  4M3Y A;  2HVH A;  2YNI A;  1KVA A;  4BWJ A;  3B6P A;  4DTU A;  1L3S A;  3LAL A;  1Q9X A;  4HHT A;  2KTQ A;  3NH0 A;  5HRN A;  1QTM A;  4HVJ A;  1SKW A;  2OYQ A;  1WSF A;  2YNG A;  3DLR A;  4RG8 A;  4KTZ A;  3AA4 A;  4CHP A;  2BE2 A;  1TK5 A;  3TAM A;  4OPJ A;  2B4J A;  1NK6 A;  3AO2 A;  2IS3 A;  5KGW A;  4ZTF A;  1W9H A;  3LP3 A;  3L3V A;  4AHS A;  2D0C A;  2A1S A;  2VG7 A;  3C94 A;  4CIF A;  3TAB A;  1X9M A;  1S9G A;  1RDC A; 
#chains in the Genus database with same CATH topology
 5M1P A;  5EU7 A;  2A3Z A;  4H0P A;  4OGE A;  1U45 A;  2O8C B;  2F96 A;  4CGI A;  3KD1 E;  3SZ2 A;  3LWL A;  2RF2 A;  3OYJ A;  4DTO A;  3U4L A;  3OYK A;  1U2V A;  4B8C A;  4B1W B;  4FLV A;  4FLT A;  3N4P A;  4LF8 K;  1TGO A;  3DXM A;  4OPK A;  4I7F A;  3AVI A;  2R7Y A;  1N32 K;  4DSL A;  4BR5 A;  3NGI A;  3OY9 A;  3C65 A;  3DOK A;  4DQP A;  1WSJ A;  1FW6 A;  1U6Z A;  1TKX A;  4I6M A;  4M3X A;  1C0U A;  4XIU A;  1HRH A;  1ITG A;  3RR7 A;  3ZSY A;  3ITH A;  5DMR A;  4PKI A;  3QO9 A;  4IFY A;  4BRO A;  3MN5 A;  1XMO K;  3A2F A;  3VTI A;  2BH1 A;  2HHQ A;  2YNF A;  2UXD K;  1BQM A;  3SUN A;  2GUI A;  4CCH A;  3ZSV A;  4M63 C;  4BGB A;  2HNZ A;  1RBR A;  3RRH A;  3D2E B;  4CFB A;  2EX3 A;  2RPI A;  4JHD A;  1YT3 A;  1RNH A;  3KTQ A;  2CH6 A;  4IFV A;  3J7Z O;  1GLA G;  1NGE A;  2BUP A;  1KAY A;  4OKE A;  4K8Z A;  3QFP A;  1VQ5 N;  4RW9 A;  4GVM A;  3F9K A;  5DM6 L;  1QS4 A;  3KK3 A;  4N41 A;  3I55 N;  4WQ5 C;  1T05 A;  3KHY A;  1VAZ A;  1M90 O;  1GLB G;  1JCF A;  4BRD A;  1WOQ A;  1VQN N;  3ALY A;  4KH4 A;  3HJF A;  2P9I A;  2HHS A;  3HTV A;  3CCJ N;  4A61 A;  4GMJ B;  3QIP A;  4FJX A;  1SUQ A;  4FWP A;  4AHR A;  2O8E B;  3DXK B;  3MEC A;  5KTQ A;  1YIT N;  2NUB A;  1KXP A;  2PY5 A;  3CCM N;  4CBX A;  1IBL K;  2QWP A;  1X9W A;  3WEE A;  2JLE A;  1Q81 O;  4CF9 A;  4NB4 A;  1D8Y A;  2G8W A;  3TSQ A;  3U9Z A;  2YV0 X;  4JK9 A;  4PUO A;  5E41 A;  4F2R A;  1X9S A;  1XNQ K;  2IVN A;  1WBB A;  2HHW A;  3NF8 A;  2FSK A;  3NVM A;  5M1Q A;  4DV3 K;  1T3V A;  4IKF A;  3OA9 A;  4LF7 K;  3LDO A;  3NF7 A;  4IJN A;  3O4Q A;  4B9U A;  3ULD A;  4K43 A;  4FJG A;  4FJI A;  1FK9 A;  3BY5 A;  3GBT A;  3CJ9 A;  4M3R A;  5FPM A;  3E66 A;  2WTU A;  3VQP A;  3OBY A;  3M8R A;  3A5N C;  4ZHR A;  2E20 A;  3L3U A;  4CHN A;  1TYQ A;  3MXJ A;  2ZQB A;  4MDB A;  4BR4 A;  1J9A A;  2O8B A;  3HPH A;  3PLA A;  2CGJ A;  4KTQ A;  2D1K A;  1VQ8 N;  5EY4 A;  4FM1 A;  3IAY A;  3TTF A;  1X9M A;  4B08 A;  5KQ8 A;  4OVL A;  5EXW A;  4A2B A;  2D5R A;  1KQS M;  4B3S K;  1IH7 A;  4O4G A;  4FWR A;  1RGI A;  2V51 B;  5AQL A;  4OPH A;  5J2P A;  1KC8 O;  2WUS A;  5C42 A;  4B1X B;  3J7Y P;  4DSJ A;  2NNW A;  3ZSR A;  1RTH A;  4IEE A;  3AGR A;  1SAZ A;  3V81 A;  1IBM K;  4DSI A;  2P9S B;  4J8F A;  4LY7 A;  4C23 A;  1HNZ K;  1W97 L;  1J54 A;  1ATR A;  3IMX A;  2YHX A;  2G8K A;  3KK2 A;  4HCB A;  4FJM A;  3R8E A;  3G0Z A;  5FRN A;  3CJC A;  2DFH A;  2QM1 A;  4Z4H A;  1XUP O;  3CQY A;  3OYH A;  3U6F A;  5I9E B;  5C25 A;  3QET A;  4B9V A;  1UOC A;  2Z1J A;  3ID8 A;  3VQB A;  5CZ2 A;  1NNE A;  4FK4 A;  3ZSO A;  2DFF A;  3MAQ A;  1KTQ A;  3V9S A;  3SBT A;  4JI2 K;  2PZS A;  3L2W A;  1HPZ A;  2X6S A;  5M1N A;  4Z4F A;  3U3Y A;  1KLM A;  3F73 A;  4CZL A;  4E0D A;  2W41 A;  1L5U A;  5HBM A;  1Y64 A;  4N5S A;  3LP0 A;  2HMP A;  3VQA A;  1B92 A;  2GX9 A;  1BU6 O;  1EWQ A;  4WYB A;  4AF1 A;  2E2Q A;  4JI0 K;  5AQG A;  2CGL A;  2JWL A;  3C0B A;  4BY9 C;  1TAQ A;  1Z26 A;  1C6V A;  3TAP A;  3DLK A;  3ZSZ A;  4FZY A;  3M6G A;  4MLH A;  3ZX0 A;  3ZEU B;  4DTN A;  1ZYQ A;  4FO0 A;  4IWV A;  3WNH A;  3A8Y A;  3DAW A;  2P9U B;  4DTJ A;  4KB1 A;  3VA0 A;  1K8A O;  1RBS A;  5AQW A;  2UUC K;  4KRF A;  2HBM A;  1NGJ A;  1T6C A;  2IGI A;  4O8K A;  4DV0 K;  3THW A;  3K58 A;  3QDK A;  3AVA A;  3VF2 A;  4DWI A;  3OYC A;  2QKK A;  1ESV A;  1IKX A;  1U04 A;  2HST A;  4JEP A;  4BVP A;  4DQQ A;  5D3G A;  3OYD A;  1SL0 A;  2KW4 A;  4DKW A;  4DV4 K;  3HO1 A;  2NRV A;  3LZJ A;  3RMA A;  4KH5 A;  1S6P A;  1XQS C;  3SJH A;  3MXI A;  1TK0 A;  4W5N A;  3IUC A;  1QSS A;  1D9F A;  1ZBS A;  1BOT O;  1BUP A;  1D5A A;  3E9P A;  1NU0 A;  2QWR A;  3Q7B A;  3V9Z A;  3CCU N;  4J2E A;  1S1U A;  2KFN A;  2E2P A;  1E4G T;  3UKR B;  1T8E A;  1B9F A;  1UWB A;  4CJ5 A;  5MLC Q;  1K8K A;  3CM6 A;  1TK8 A;  3NGY A;  3PSI A;  1XHX A;  4Y1D A;  2Y1I A;  5JIC A;  1V4T A;  2Q2R A;  3VQ9 A;  1IKV A;  1Q86 O;  2HW3 A;  1SKS A;  4BRG A;  2OTJ N;  4K0K K;  4MFB A;  3LPU A;  1BCM A;  3SAH A;  4M3W A;  5AQX A;  1JL2 A;  3WXI A;  3PO5 A;  1C0T A;  2E6L A;  3CXC M;  4FJ7 A;  4BRN A;  1ASU A;  3EL2 A;  1NJZ A;  4DR5 K;  4DTX A;  3K57 A;  3QBX A;  3RVC A;  4FLX A;  1LWC A;  3LP1 A;  1QQC A;  3CIP A;  4BDY A;  2Y1J A;  2GWK A;  4BRM A;  1KCF A;  1N34 K;  4B1U B;  4PWD A;  1NJI O;  1RBT A;  1VQK N;  4DSK A;  3NMU A;  4H4O A;  4ISG A;  3HL8 A;  1C1C A;  2FSN A;  4DMN A;  2QKB A;  5CZ1 A;  3VPZ A;  4FVU A;  4E7J A;  5E26 A;  4J2D A;  3SPY A;  3OVN A;  2A42 A;  2IC3 A;  1WNS A;  2ZF5 O;  3DLE A;  2P51 A;  3S3O A;  3M3Z A;  3BP8 A;  4CER A;  3IG1 A;  1UA0 A;  4FK0 A;  3V4I A;  1GOB A;  1NKB A;  5BRF A;  4CGF A;  3QEI A;  5TKY A;  3E9O A;  3AVC A;  3O9U A;  5BN8 A;  4IOA L;  4IG0 A;  3VF4 A;  1X9J A;  2G8F A;  5ELZ A;  4CJK A;  3UKU A;  4AM6 A;  1FXX A;  3ZSX A;  1HYZ A;  2J4R A;  1TV6 A;  4NYF A;  4CJF A;  4YNQ A;  2D4W A;  2QI2 A;  3P38 A;  4YOW A;  4JAX A;  1ZBI A;  3HI0 A;  2E6M A;  3KWI A;  2IAJ A;  2GEL A;  4JYA K;  4AHT A;  4JKG B;  2YNI A;  1KVA A;  4BWJ A;  3CCR N;  3BUZ B;  1L3S A;  3LAL A;  4IOX A;  4HHT A;  1N36 K;  5HRN A;  4M7X A;  4RG8 A;  1NGG A;  1QVG M;  3HM8 A;  2BE2 A;  4OPJ A;  2B4J A;  1NK6 A;  2UXC K;  4AHS A;  2D0C A;  3FZF A;  1GLC G;  4C8N A;  4CFC A;  3RMC A;  3VGM A;  1JLG A;  3CFR A;  3K59 A;  3QEX A;  5LJW A;  1EWR A;  4CZG A;  4CHY A;  4BDZ A;  1RDD A;  3HSC A;  1W7A A;  1NG9 A;  3NF9 A;  5AQT A;  4CJL A;  5AZI A;  1WAJ A;  4J2B A;  3FZM A;  3VOV A;  2FLO A;  2YHY A;  3DLG A;  3L2Q A;  4CE9 A;  1HX1 A;  2GBZ A;  3CPE A;  5GIN A;  1LW0 A;  4QAG A;  4FJJ A;  2W6K A;  2I5J A;  1KVC A;  4BDP A;  2PFU A;  4Z4I A;  4FJ8 A;  1UAX A;  4RW8 A;  4CEE A;  4ID5 A;  4GY2 B;  4JD2 A;  1BCO A;  1Z6R A;  2XHB A;  4FCY A;  4DU3 A;  4G9Z A;  2NRZ A;  4LSL A;  3F9M A;  3KIO A;  4N76 A;  1NMN A;  5FRO A;  1NK5 A;  1DTT A;  1TVR A;  4F9O A;  3FGU A;  3ZLJ A;  1GLJ O;  1IV0 A;  3O08 A;  4PQU A;  3CM5 A;  2ZJQ L;  4Z4G A;  4ISF A;  2NRT A;  2E2N A;  1GLF O;  1NWK A;  4FLW A;  4WF9 L;  3VQ4 A;  4O8U A;  1YAG A;  1JKH A;  1EQY A;  3LAN A;  3MDQ A;  4LH4 A;  1QE1 A;  1G15 A;  2F8T A;  3GOI A;  3EKU A;  4CZJ A;  3QNO A;  1GOC A;  3TAQ A;  3O3G A;  1ZBU A;  3LPT A;  5AQK A;  4JRP A;  1S1V A;  2EHG A;  4PHT X;  3IFR A;  1T03 A;  5ADX A;  4PL8 A;  5IT9 O;  3CCQ N;  3BF3 A;  4CZE A;  1T7P A;  1LOT B;  5I42 A;  4OJR A;  4QOZ B;  3A5M C;  4EZ9 A;  3SQ1 A;  4FWO A;  1S1W A;  3CPW M;  2OPQ A;  3ID6 A;  3CJB A;  3U3G A;  4B1Z A;  3HM9 A;  4CEQ A;  3SI6 A;  2RE2 A;  5GIP A;  3AA3 A;  3FR0 A;  3H08 A;  4JNE A;  3ZT3 A;  4FLY A;  5GIO A;  1IG8 A;  2HHH K;  3OYL A;  1NGA A;  1RT2 A;  4Y1C A;  2P9L A;  3HBT A;  3EZ5 A;  1V4S A;  5M1F A;  4FJL A;  3AVG A;  2VWK A;  2QTD A;  4W5O A;  2FC0 A;  3AAP A;  5GAE P;  2D0P A;  2P9N A;  1WSH A;  2QWN A;  1ATS A;  1NOY A;  2X6N A;  1I94 K;  1HR0 K;  2ATQ A;  4WE1 A;  1VSF A;  4KBO A;  2OPS A;  3MWT A;  2AA4 A;  4BR2 A;  2F9T A;  3DMJ A;  1HQE A;  1M1K O;  1J6Z A;  3CET A;  5CYM A;  1OVY A;  3DRP A;  2H3G X;  1YJW N;  1JCE A;  3V9X A;  1Q7Y O;  3VQE A;  2A6A A;  2BDP A;  3OYG A;  4DU1 A;  4DS4 A;  4CD1 A;  4BGA A;  2I7P A;  3KLI A;  1Q18 A;  4O5B A;  2A5X A;  5AZJ B;  3I0S A;  2ETJ A;  2O8D A;  3KD5 E;  3MCP A;  4YOV A;  3BDP A;  2E1Y A;  5LY3 A;  2Z1H A;  1WSI A;  1FKO A;  4NO7 A;  1BGX T;  1NK8 A;  2HNY A;  2OPR A;  3EN9 A;  2NRH A;  4CBW A;  4IJA A;  3SQ4 A;  4EFH A;  1BA0 A;  3BZK A;  2HVI A;  3QEP A;  1QZ6 A;  5J2M A;  2O8F B;  3VEX A;  5DM7 L;  3ULE B;  3CJA A;  1RDB A;  3VQQ A;  4CED A;  5FDL A;  1NK4 A;  2P9K A;  3CER A;  3WT0 A;  4NXN K;  4CJT A;  2WBN A;  4DTS A;  1NJY A;  1NGD A;  3D6R A;  3DRR A;  1ZC6 A;  3FLC O;  3O1B A;  4FXD A;  4YDU A;  2VG6 A;  4Z0U A;  1C0G A;  3BZC A;  4CJW A;  1OVQ A;  3CC7 N;  5KRT A;  3KLF A;  3AVK A;  3THY A;  3OBW A;  4RWT A;  4BG9 A;  4RW6 A;  1HKC A;  2YHB A;  2P9P B;  4JI3 K;  3GDQ A;  1I39 A;  5HLF A;  3HST B;  4CJU A;  1HNI A;  4GW6 A;  4NLB A;  3ZT1 A;  4PKH A;  4KHN A;  4WFN L;  3NGZ A;  1F21 A;  3TSU A;  1VRT A;  1SL1 A;  2FF6 A;  1HJO A;  2Q0U A;  4RCH A;  5AQI A;  3RMD A;  3V1Q A;  4B1V A;  2YJE A;  3THX B;  4OLA A;  4DF4 A;  3QES A;  3SPZ A;  4CJQ A;  2B6A A;  4FW1 A;  1SS6 A;  1RTJ A;  1QSY A;  2O8C A;  3C6U A;  3WNE A;  3KJV A;  4DU4 A;  1VSE A;  1T44 A;  1S1X A;  1YVN A;  3MX2 A;  1DTQ A;  4BRL A;  2BAN A;  4DSE A;  1RT5 A;  4BQZ A;  2V7Z A;  2D0A A;  4H8K A;  2Q97 A;  3O3H A;  3DI6 A;  4FWQ A;  4MO5 A;  4CJ3 A;  4AM7 A;  3LWM A;  1XNR K;  5B8H A;  2Q0R A;  3DLB A;  3S3M A;  2PYL A;  5KPR A;  2WC9 A;  1ZBL A;  3B6O A;  3CMA N;  1QVF M;  3EKS A;  5AQR A;  3SNN A;  3ZYY X;  4CIG A;  4FLU A;  1CLQ A;  1RDW X;  3K0S A;  5AFU H;  3CF5 L;  2W6L A;  1Q9Y A;  2VGM A;  3AO5 A;  4JRQ A;  4JKH A;  3O9T A;  3N4Q A;  4BRH A;  4A57 A;  3TI0 A;  3M8P A;  1KSP A;  3D2E A;  4BRI A;  4H03 B;  1G99 A;  2YNH A;  2QWO A;  2QEX N;  2QWM A;  4CZF A;  2VWB A;  5AQM A;  3VEZ A;  3WQT A;  4E3S A;  3ZCM A;  4CF2 A;  3SAG A;  4M45 A;  4OPA A;  5FPD A;  4FSV A;  1NKE A;  3JS6 A;  1U47 A;  4FJ9 A;  2HBJ A;  4I2P A;  5FLX O;  4GV9 A;  2HOE A;  4GVE A;  1YTA A;  3A5L C;  1KAZ A;  3K9K A;  3AVM A;  4Y0W A;  5GAD P;  3NHG A;  3TSP A;  3O80 A;  4C8K A;  5JS2 A;  4YDU C;  4N56 A;  3C7N B;  1RT7 A;  3AVB A;  1W0H A;  3LAK A;  5IWA K;  4LFC K;  3SYZ A;  1D4X A;  2XRI A;  1YJN N;  3AY9 A;  1YTU A;  2PAV A;  1GLL O;  1J5E K;  1MDU B;  4CEC A;  3K5N A;  2PYJ A;  3KK7 A;  1C0F A;  3JYT A;  2O8E A;  4E19 A;  5SWM A;  1JXE A;  1VK0 A;  3QFU A;  3DXK A;  2B5J A;  3QEW A;  3ATV A;  4BG8 A;  3EYZ A;  3LAM A;  3RSE B;  4CZH A;  4DS5 A;  3H46 O;  4M7Y A;  4FLZ A;  1TKD A;  2ASM A;  3H3N O;  4JKF A;  4L3Q A;  2ZM6 K;  5FPN A;  5DK5 A;  4LF6 K;  3GL1 A;  4NCB A;  4C8M A;  3VET A;  4U67 L;  3E01 A;  5HRS A;  1CXU A;  3KWG A;  2KFZ A;  2UUA K;  4E89 A;  3PIP L;  1NJX A;  3PY8 A;  4JKB A;  4I9Q A;  3MEE A;  2ITG A;  1BHL A;  1JLQ A;  4CK2 A;  4B9L A;  2GEM A;  3OYE A;  4HWI A;  2NRX A;  4CEZ A;  4ILH A;  1MWM A;  4DLE A;  3D45 A;  3V9W A;  3HRG A;  3FFK B;  3HT3 A;  1DLO A;  4FOE A;  1NGI A;  4LFA K;  3OS0 A;  3PSF A;  3LL3 A;  3ZT2 A;  4BC5 A;  4NLC A;  5AFU A;  3AV9 A;  4H5W A;  3PIO L;  1KFD A;  3TR8 A;  3EE9 A;  1YHQ N;  5TKW A;  5AQO A;  2PBD A;  4JKE A;  4YOT A;  5LJV A;  4BRF A;  3NH0 A;  3ZET B;  1QTM A;  2GUP A;  2YNG A;  3DLR A;  2P9S A;  3CC2 N;  4KTZ A;  1ATN A;  4H0O A;  5LMU K;  2IS3 A;  4WFB L;  1W9H A;  3LM2 A;  2A1S A;  1BA1 A;  3TAB A;  1S9G A;  4AQY K;  3SQ0 A;  1OH5 A;  4KHY A;  2KZM A;  1VSH A;  1BO5 O;  3L0Q A;  3WXK A;  4BR7 A;  3KKR A;  3KZB A;  4R79 A;  4C1N I;  3HPO A;  1KLN A;  4R5P A;  3CYM A;  2XY5 A;  3VTH A;  2CGK A;  3JXU A;  3NVK A;  1HUX A;  4LSN A;  1C0M A;  3KLG A;  3J80 O;  4FWM A;  4BRE A;  4CHQ A;  4CES A;  3VQC A;  4EIA A;  4NCA A;  5CY4 A;  4UY8 O;  5FRM A;  3I8B A;  4KHU A;  3KLH A;  4CJ7 A;  1TKZ A;  4CEF A;  1TL3 A;  5H1S Q;  2VYP A;  2HND A;  1RT4 A;  4M41 A;  2WFB A;  2FSJ A;  3HVT A;  1NOZ A;  4DQR A;  4WQ4 A;  3ENB A;  4RW4 A;  4HUG A;  3AVH A;  2HHV A;  4E7H A;  3SBG A;  2RKI A;  1C1B A;  4CJE A;  2QK9 A;  3MN7 A;  3ZEU A;  5HRR A;  3H1V X;  5AQH A;  3VEV A;  4LF9 K;  1U48 A;  2P9U A;  1NM1 A;  1D9D A;  3M1F A;  4CHZ A;  1VQ4 N;  2HF4 A;  1HKG A;  3PO4 A;  4CF0 A;  4KO0 A;  3CJ1 A;  3OYM A;  1IBK K;  4B3T K;  1BI4 B;  1T6D A;  2GTD A;  4JKC A;  3TAF A;  2HHX A;  5M1O A;  4CK3 A;  4B9T A;  4B3R K;  2YKN A;  1JLC A;  1RT3 A;  5C10 A;  2DY4 A;  1HNV A;  4BE2 A;  3WXM B;  1S1T A;  3OYB A;  4ICL A;  3IKM A;  3O9Q A;  3HOT A;  1K73 O;  4A2A A;  4AIL C;  3THV A;  4DQ8 A;  3M8Q A;  3TWH A;  1HJR A;  4IO8 A;  3T19 A;  2AJQ A;  5AQJ A;  1QQM A;  1LAV A;  1VQ9 N;  4OLB A;  5HOO A;  5JLF A;  2HB5 A;  3I0R A;  4JKD A;  3VEO A;  5F0X A;  1N8R O;  5J2Q A;  4JLH A;  2DPN A;  2UYT A;  1SKR A;  3UKR A;  1VQL N;  1ZBF A;  3SMP A;  3CCS N;  2BGG A;  1Z05 A;  2WON A;  4C8L A;  3I8D A;  4CFD A;  4IXC A;  4F2S A;  4U7B A;  3V1R A;  4FWL A;  2RN2 A;  3UIQ A;  1MWK A;  4FM2 A;  1WSE A;  4IFE A;  3DRS A;  3E9L A;  3QIN A;  3ZT0 A;  4AH9 A;  4Q0B A;  1A5W A;  2G8V A;  4MLE A;  3L6Q A;  5SZT A;  4Q5V A;  1NGC A;  1WBD A;  4LC9 B;  3PV8 A;  3LDS A;  3MCA B;  1NKC A;  4FPA A;  4BC4 A;  4CEO A;  4CD3 A;  4X64 K;  2ZGZ A;  1C1A A;  1WB9 A;  1XC3 A;  4B1Y B;  3P1G A;  5EOY A;  1HYS A;  1Y97 A;  4F3T A;  4HTU A;  3WQU A;  4DV2 K;  2QXL A;  4FJK A;  4KRE A;  4FWK A;  5LMN K;  1YVU A;  4DFK A;  5EX5 A;  1VQO N;  5HRO A;  4BRK A;  1NGF A;  5E84 A;  3SUP A;  2ASP A;  4YOR A;  4O0J A;  4WQ4 C;  1J53 A;  4B8A B;  3V1O A;  2GWJ A;  4QCL A;  4JI1 K;  4C8O A;  2IDO A;  3VEN A;  3TTC A;  3CME N;  2KLA A;  4O55 A;  2NRR A;  2UU9 K;  3G10 A;  2CH5 A;  1DKG D;  2A40 A;  1REV A;  1P8Z A;  1JLA A;  2Q1N A;  4IG3 A;  3ZSW A;  3VEW A;  4CJR A;  3FZL A;  4JI6 K;  4JS4 A;  3AA2 A;  1RT1 A;  1EP4 A;  5T7B A;  4GNI A;  1N5Y A;  3K5L A;  4YOX A;  1IJJ A;  1QHA A;  1U2V B;  4X65 K;  3VQD A;  5K14 A;  1S5J A;  4KFB A;  4FYD A;  3ZSQ A;  3DXM B;  3VGK A;  4YOY A;  1EXQ A;  3H45 C;  3DLH A;  1YF5 L;  4QS9 A;  5KQD A;  1RBV A;  2G8U A;  4JKG A;  3SMS A;  3K5M A;  4MO4 A;  4DR4 K;  2WOM A;  4IDH A;  1EO1 A;  1EKE A;  4I6M B;  5AQZ A;  4CZM A;  4KAZ A;  3CFP A;  3JSM A;  3T69 A;  2HHT A;  1E4F T;  4FJH A;  5KI6 A;  2KZZ A;  3LP2 A;  1JLF A;  4KHQ A;  4JHD B;  1TUY A;  1BWF O;  2YHA A;  4JI7 K;  1VSD A;  3O4N A;  2AP1 A;  2V52 B;  2FXU A;  1VQ7 N;  3F2K A;  3TAN A;  1XHZ A;  3SCX A;  4FOI A;  5C2F A;  1NBW A;  2KQ2 A;  4A62 A;  3JAM O;  3NBP A;  1VSI A;  1S3X A;  4Z4E A;  4IOC L;  3L8B A;  4O5F A;  3AO3 A;  3O3F A;  4DV5 K;  3QER A;  4CK1 A;  1EX4 A;  3E1Y A;  3OYA A;  2XY6 A;  3I33 A;  4E7L A;  1U4B A;  1HYV A;  2ZWH A;  3TU5 A;  4Z94 A;  1SV5 A;  4M3U A;  4H5N A;  2P9I B;  1EET A;  4BE0 A;  4CZI A;  1BIZ A;  1TAU A;  1O1W A;  4E1M A;  3EO3 A;  3OYI A;  4JI8 K;  4BRP A;  2XO7 A;  3IRX A;  1X1P A;  4KTW A;  4CF8 A;  3D2F A;  1LW2 A;  4EZ6 A;  2E4L A;  3VQ6 A;  1W2B M;  1QQO A;  3SUO A;  3QB0 A;  4Z4C A;  5JMV A;  1K6Y A;  4PA1 A;  4L8R B;  1ASW A;  2ZJR L;  3AVL A;  1O13 A;  3FZK A;  3MX5 A;  5GAG P;  2O4G A;  3WEE B;  1I3A A;  1H1V A;  1ZXO A;  3ENH A;  4KV8 A;  3T7Z A;  4MQ3 A;  1JCG A;  4W5T A;  1NLV A;  3TPQ A;  3L2V A;  4FPB A;  4JN4 A;  1ZBH A;  5KRS A;  4DTR A;  2E2O A;  4CJ4 A;  5AQU A;  4RTF D;  2HBL A;  3OS2 A;  1X3N A;  3F5T A;  4H0T B;  1OH6 A;  4GKJ K;  4BE1 A;  2Z1I A;  3PX6 A;  5C24 A;  1N33 K;  5CR4 A;  4M42 A;  3MED A;  3M5R A;  4FK2 A;  5BPM A;  4DV1 K;  3HPG A;  4XH4 A;  4DR6 K;  3LZI A;  4KB0 A;  1J5O A;  1TYQ B;  2HF3 A;  3DYA A;  1QZ5 A;  1A5X A;  4CJV A;  2QW9 A;  5CE3 A;  1FKP A;  3FZH A;  3DWL A;  4DFP A;  2O8B B;  5M1K A;  1RDU A;  2P5O A;  1QQN A;  1BG3 A;  4AHC A;  4H0X B;  3CC4 N;  2NRW A;  3EZW A;  4ELV A;  5AQQ A;  2VCP A;  2BTF A;  3KK1 A;  5LL6 Z;  2X74 A;  5AQP A;  4E7I A;  1IKW A;  2QWQ A;  5JS1 A;  4DQI A;  1RCH A;  1JL1 A;  1BDG A;  2OZS A;  4BAC A;  1FJG K;  4DB3 A;  4KHW A;  1DEJ A;  1HKB A;  2IVP A;  2KHO A;  3NE6 A;  3PX4 A;  4CBU A;  2OAN A;  1Z25 A;  3DOL A;  3O1W A;  4I2Q A;  4CJS A;  3AAR A;  3CG7 A;  2EWS A;  3S3N A;  4EAH D;  5CHI A;  5AQV A;  4PKG A;  3OHR A;  2P5G A;  5AZJ A;  3HYF A;  4CZK A;  1QHT A;  4DCH A;  2XY7 A;  1YIJ N;  1WN7 A;  4OO1 J;  2JWK A;  3P5J A;  3NH1 A;  1KVB A;  3LDQ A;  3NAE A;  2NLX A;  5BRE A;  4FM0 A;  1NMD A;  3MWP A;  4EHT A;  1TL1 A;  4DF8 A;  4M3Y A;  2I7N A;  4DUY K;  3B6P A;  3W3D A;  1Q9X A;  2KTQ A;  4DR1 K;  2OYQ A;  1WSF A;  3LDL A;  4BC2 A;  1OH8 A;  2O8F A;  4CHP A;  3ULE A;  3TAM A;  4GKK K;  4YY3 K;  5KGW A;  3L3V A;  3MK6 A;  3C94 A;  2VG7 A;  3CJ7 A;  1DGK N;  4ELT A;  4JK7 A;  3AO1 A;  4DTP A;  3W0L A;  3WNF A;  4YFU A;  4IEI A;  2X78 A;  3H3O B;  1BIU A;  2YI1 A;  2ZE2 A;  1K9M O;  1QSL A;  4BWM A;  4OKK A;  3C6T A;  4CF1 A;  2HMI A;  4BRQ A;  4BVO A;  4GV6 A;  2HBK A;  3VN5 A;  4BC3 A;  1LWE A;  2P9P A;  3R9P A;  4KH6 A;  3THW B;  2VQE K;  4OX9 K;  1WSG A;  3EE8 A;  2OA8 A;  1YJ9 N;  3T1H K;  3SV4 A;  2YJF A;  5JVH L;  3NFA A;  4B9N A;  3UE5 A;  3P31 A;  5AR0 A;  4WFA L;  4BR9 A;  3THX A;  1VSJ A;  1IKY A;  3R3L A;  2E88 A;  3QIC A;  4UQG A;  4E7K A;  2RHK A;  5GAH P;  2LSN A;  4KPY A;  4K8X A;  2XY8 A;  2FBV A;  3B8A X;  1LWF A;  1NJW A;  2IOC A;  3A0I X;  3VEY A;  3K5O A;  5AQN A;  2QXF A;  2F4V K;  3O4W A;  1RDA A;  1L3T A;  5A2Q O;  3RRG A;  2FBY A;  3U9D A;  4HUF A;  1L3U A;  3WNG A;  4EHU A;  1GLD G;  3NDK A;  5J2N A;  1K8K B;  3AVJ A;  3CI5 A;  1WLJ A;  3AGK A;  1YUW A;  3FFI A;  2NZT A;  3CD6 N;  2FF3 B;  5HRP A;  4ILG B;  2F8S A;  5AQF A;  3OJU A;  3QEV A;  2ITM A;  4PY5 A;  4QS8 A;  1ILY A;  3ENO A;  4K42 A;  4KI4 A;  3CQ8 A;  4OGC A;  3AVN A;  5AJ3 K;  4NYN A;  3LDN A;  3DM2 A;  1S9E A;  2Z1G A;  5AQS A;  3NH2 A;  2GV9 A;  4KKO A;  2ZGY A;  3MMV A;  1HNX K;  1XWL A;  4CEA A;  5C2D A;  2E8A A;  3EY1 A;  1IO2 A;  1E3M A;  3CCE N;  2F9W A;  5KPZ A;  3HXM A;  3NCI A;  4W5R A;  4DSF A;  1S22 A;  1L3V A;  3VMF B;  3SAF A;  4M3T A;  3ISN C;  2W42 A;  3VQ7 A;  4ELU A;  5F2R A;  2OTL N;  3H1Q A;  3HP9 A;  4B3O A;  3C7N A;  4XEI A;  4CW7 B;  3T1Y K;  4H0Y B;  4GV3 A;  4JI4 K;  2G8H A;  4DTM A;  4LH5 A;  3TAR A;  3T3F A;  3VES A;  3L4Q A;  1R0A A;  5BPN A;  3C6A A;  4DUZ K;  1Q82 O;  3KVG A;  1RBU A;  4A59 A;  1VQ6 N;  3UKU B;  2V7Y A;  3MN9 A;  5C15 A;  3U8X A;  3J81 O;  3GG4 A;  3O8M A;  1X3M A;  5CYQ A;  3RSE A;  4F4K A;  3ZX3 A;  3HOS A;  3LDP A;  4KHS A;  3L4I A;  1TUU A;  3NF6 A;  1S6Q A;  4FVM A;  2YCH A;  4IZ9 A;  3V6D A;  1MU2 A;  1CZB A;  3V9U A;  2UXB K;  2P1J A;  1YI2 N;  1S72 N;  2A41 A;  4QS7 A;  3C95 A;  4TSX A;  4HCC A;  3HP6 A;  4FWN A;  5BRH A;  4W5Q A;  2IIR A;  4ZTJ A;  4B3M K;  1KRP A;  5F1X A;  1HQU A;  4AHV A;  3WUH A;  1HNW K;  4AHU A;  4F8R A;  4ILJ A;  5KGX A;  3HZ6 A;  3QBW A;  2E5L K;  4DR2 K;  1NGH A;  3CQX A;  2Q3S A;  1RT6 A;  3SV3 A;  2FBT A;  1U49 A;  2DFE A;  3PUF A;  5AZI B;  3T1A A;  3P39 A;  3R1X A;  5JVG L;  3PX0 A;  4RW7 A;  4YOU A;  3RR8 A;  1P90 A;  2G8I A;  4LD0 A;  3GE1 A;  4FJN A;  4DR7 K;  3ZT4 A;  4FZZ A;  1CZA N;  3QLH A;  1N6Q A;  3IDH A;  1TKT A;  4JD2 B;  4JI5 K;  4HTL A;  4NXM K;  4C1N K;  4CGH A;  2VQF K;  1DT9 A;  3ZET A;  4CGJ A;  1RTD A;  3LM9 A;  3O5B A;  4B9Q A;  4DV7 K;  1JLB A;  1KFS A;  4J2A A;  3K9J A;  3KKS A;  1BL3 A;  4OKJ A;  4CEB A;  4A5B A;  1KAX A;  1NK7 A;  4O0I A;  4DFJ A;  2VGN A;  5ADX H;  4LFB K;  1IG9 A;  2VG5 A;  1VSK A;  3L2U A;  4H5V A;  4EP4 A;  1BIS A;  4NCG A;  2ZD1 A;  4F3O A;  3O9R A;  3BEX A;  4E1N A;  1ASV A;  4N47 A;  5BRD A;  3BF1 A;  1XI1 A;  4DHY A;  3S41 A;  3TAG A;  4JS5 A;  3A5O C;  4BRC A;  4X66 K;  3SJJ A;  2OCE A;  1VQP N;  3P83 D;  3UB5 A;  2Q36 A;  2YKM A;  4FW2 A;  4YHH K;  3RTV A;  3QIO A;  4CHO A;  3OTO K;  3MN6 A;  3H6E A;  4KI6 A;  1CXQ A;  3CHW A;  2Q31 A;  3DJC A;  3CCL N;  2HHU A;  2O4I A;  4FJ5 A;  3FE1 A;  1NK0 A;  3EEQ A;  3AVF A;  3O9S A;  3OS1 A;  4BQL A;  4O44 A;  5AQY A;  4CVN E;  4H0V B;  3WXJ A;  3WXL A;  5JLH A;  3CCV N;  4XH1 A;  5I3U A;  4BRA A;  3BGR A;  1JLE A;  1XMQ K;  4BR0 A;  3SUQ A;  1VRU A;  3IS9 A;  1RIL A;  5J1E A;  1R59 O;  2P9L B;  2QWL A;  4DFM A;  3HK2 A;  4FL9 A;  3SQ2 A;  1GLE G;  1RTI A;  3KLE A;  2E1Z A;  3RMB A;  4M3Z A;  4H5R A;  5C12 A;  3D0P A;  2ASO A;  4DQS A;  4B9S A;  2YHW A;  2DTU A;  2ZJP L;  1LCU A;  3OYN A;  5BR9 A;  4K25 A;  3S9H A;  4I9L A;  2FBX A;  2P9N B;  1VSL A;  1BI4 A;  4XH5 A;  3QML A;  3TAE A;  4X62 K;  3Q7C A;  1JXB A;  3ATU A;  5FPE A;  3OYF A;  3ZX2 A;  2A1R A;  3AAQ A;  1OH7 A;  1VHX A;  3D7E O;  1KD1 O;  2KKZ A;  1XC9 A;  1OKJ A;  3VA3 A;  5BR8 K;  4DR3 K;  3AA5 X;  2UUB K;  4LF4 K;  5BN9 A;  4IBN A;  4DG1 A;  2VWJ A;  5BPL A;  3VER A;  5HP1 A;  1SZ2 A;  3L2R A;  4CFA A;  4DLG A;  4JK8 A;  1BQN A;  1RFQ A;  2IVO A;  3K2P A;  5KPT A;  2O8D B;  3TTD A;  4LF5 K;  2F7T A;  4PL7 A;  3C6H A;  3MEG A;  2YX6 A;  1LAW A;  2OZM A;  4G1Q A;  4ID1 A;  3G4S N;  4CGG A;  3D2F B;  4V19 S;  3VQ5 A;  3RWU A;  1LV5 A;  4K41 A;  1YXQ A;  1SL2 A;  3R6M A;  4H4M A;  5EVZ A;  3O6W A;  3ASM A;  1NK9 A;  3OJS A;  3VQ8 A;  3DLL L;  2QA4 N;  4CIE A;  3J7A P;  4JKA A;  3VF6 A;  2OPP A;  4FWS A;  4DV6 K;  1MA9 B;  4B9M A;  4CGD A;  4HUE A;  3HVR A;  3CFO A;  3J8A A;  3MXM A;  3SLC A;  1B9D A;  2D0O A;  3G71 N;  1UA1 A;  3M8S A;  3VGL A;  2P9K B;  1JJ2 M;  2D0B A;  4WQ5 A;  3OW2 M;  4IDK A;  1VSM A;  1CZ9 A;  1SQK A;  4EP5 A;  1HMV A;  1WAF A;  4MDA A;  4CI6 A;  1A5V A;  2JGU A;  4H5T A;  5C0Y A;  4CJP A;  1Q8I A;  4IO9 L;  1HPM A;  3THY B;  3P4I A;  2W40 A;  5HL7 L;  1NGB A;  4ISE A;  4E1J A;  3SK3 A;  3AO4 A;  4FZX C;  3QNN A;  4KHP K;  1GOA A;  2HVH A;  4DTU A;  4A5A A;  1VQM N;  3G6E N;  4HVJ A;  1SKW A;  3AA4 A;  1TK5 A;  4WCE L;  3AO2 A;  3I56 N;  3G25 A;  4ZTF A;  3LP3 A;  4CIF A;  1WUA A;  1HLU A;  4JV5 K;  1RDC A; 
#chains in the Genus database with same CATH homology
 4C8N A;  4CFC A;  3SQ0 A;  5EU7 A;  4KHY A;  4OGE A;  3RMC A;  1U45 A;  2KZM A;  2F96 A;  3AO1 A;  1VSH A;  4DTP A;  1JLG A;  4CGI A;  3CFR A;  3KD1 E;  3K59 A;  3SZ2 A;  3LWL A;  3KKR A;  3WNF A;  2RF2 A;  4YFU A;  3OYJ A;  3QEX A;  4DTO A;  2X78 A;  3OYK A;  4CHY A;  4BDZ A;  4B8C A;  1RDD A;  4FLV A;  1BIU A;  3NF9 A;  2ZE2 A;  4CJL A;  4FLT A;  1WAJ A;  4J2B A;  4Z4I A;  1QSL A;  4BWM A;  4OKK A;  3C6T A;  4CF1 A;  3DLG A;  1TGO A;  3HPO A;  4R5P A;  1KLN A;  3L2Q A;  3CYM A;  2XY5 A;  2HMI A;  4CE9 A;  2GBZ A;  4OPK A;  4I7F A;  3AVI A;  2R7Y A;  1LW0 A;  4QAG A;  1LWE A;  3VN5 A;  2I5J A;  1KVC A;  4BDP A;  4LSN A;  4DSL A;  4FJJ A;  1C0M A;  3KLG A;  3NGI A;  1UAX A;  4RW8 A;  4FJ8 A;  4CEE A;  4ID5 A;  3OY9 A;  4CHQ A;  1WSG A;  3DOK A;  4DQP A;  1WSJ A;  4CES A;  4M3X A;  1TKX A;  1BCO A;  2OA8 A;  1C0U A;  3VQC A;  4XIU A;  2XHB A;  1HRH A;  1ITG A;  4FCY A;  5CY4 A;  4DU3 A;  3SV4 A;  3RR7 A;  4NCA A;  3ZSY A;  5FRM A;  4LSL A;  3KIO A;  3NFA A;  3ITH A;  3KLH A;  4N76 A;  4KHU A;  1TKZ A;  5DMR A;  4B9N A;  4CEF A;  1TL3 A;  3QO9 A;  4IFY A;  5FRO A;  1NK5 A;  1DTT A;  1TVR A;  2HND A;  1RT4 A;  3A2F A;  4M41 A;  1VSJ A;  2HHQ A;  2YNF A;  3HVT A;  1BQM A;  1IKY A;  2GUI A;  1NOZ A;  3ZSV A;  3SUN A;  4CCH A;  2HNZ A;  3CM5 A;  4DQR A;  4PQU A;  4UQG A;  4E7K A;  1RBR A;  3RRH A;  4CFB A;  2EX3 A;  2LSN A;  2RPI A;  4RW4 A;  1YT3 A;  1RNH A;  4KPY A;  4K8X A;  4Z4G A;  2XY8 A;  2FBV A;  3AVH A;  4HUG A;  2HHV A;  3KTQ A;  4E7H A;  1LWF A;  2RKI A;  2IOC A;  1C1B A;  4CJE A;  1NJW A;  2QK9 A;  4IFV A;  5HRR A;  4FLW A;  3K5O A;  3VQ4 A;  2QXF A;  1JKH A;  3LAN A;  2F8T A;  4LH4 A;  1QE1 A;  1G15 A;  1RDA A;  1U48 A;  1L3T A;  3RRG A;  1D9D A;  4CHZ A;  2FBY A;  4OKE A;  4HUF A;  3QNO A;  1GOC A;  3TAQ A;  1L3U A;  3O3G A;  4K8Z A;  1ZBU A;  3WNG A;  3LPT A;  4RW9 A;  3NDK A;  5J2N A;  4GVM A;  3F9K A;  3KK3 A;  1QS4 A;  3PO4 A;  4N41 A;  4JRP A;  1S1V A;  4CF0 A;  4KO0 A;  3AVJ A;  3OYM A;  2EHG A;  1BI4 B;  1WLJ A;  3FFI A;  1T03 A;  1T05 A;  3TAF A;  2HHX A;  5HRP A;  4CK3 A;  2F8S A;  4B9T A;  3OJU A;  3QEV A;  2YKN A;  1JLC A;  1RT3 A;  1T7P A;  5I42 A;  4PY5 A;  4OJR A;  4QOZ B;  1HNV A;  2DY4 A;  4BE2 A;  4EZ9 A;  3SQ1 A;  1S1T A;  3OYB A;  3ALY A;  1S1W A;  2OPQ A;  4ICL A;  3HJF A;  3U3G A;  2HHS A;  4KI4 A;  3CQ8 A;  4OGC A;  3HM9 A;  4CEQ A;  3AVN A;  3SI6 A;  4AIL C;  4NYN A;  3THV A;  3AA3 A;  3M8Q A;  3DM2 A;  1HJR A;  1S9E A;  2Z1G A;  3H08 A;  4GMJ B;  3QIP A;  3T19 A;  3ZT3 A;  1SUQ A;  3NH2 A;  4FJX A;  2AJQ A;  4FLY A;  2GV9 A;  4KKO A;  4AHR A;  1LAV A;  4OLB A;  1XWL A;  3OYL A;  2HB5 A;  1RT2 A;  3MEC A;  3I0R A;  4Y1C A;  4CEA A;  3EZ5 A;  5KTQ A;  2NUB A;  2PY5 A;  5J2Q A;  3EY1 A;  1IO2 A;  2VWK A;  3AVG A;  4JLH A;  4FJL A;  4W5O A;  3HXM A;  3NCI A;  1SKR A;  1X9W A;  2FC0 A;  4W5R A;  4DSF A;  2JLE A;  1L3V A;  4CF9 A;  1ZBF A;  2BGG A;  2WON A;  1D8Y A;  2G8W A;  4C8L A;  1WSH A;  3ISN C;  4CFD A;  3I8D A;  2W42 A;  4M3T A;  2YV0 X;  4PUO A;  1NOY A;  2X6N A;  5E41 A;  4F2R A;  4F2S A;  1X9S A;  2ATQ A;  4WE1 A;  3V1R A;  3VQ7 A;  2RN2 A;  2HHW A;  1VSF A;  3NF8 A;  3UIQ A;  4ELU A;  4FM2 A;  1WSE A;  2OPS A;  4IKF A;  3DRS A;  4B3O A;  3HP9 A;  3NF7 A;  3DMJ A;  1HQE A;  3O4Q A;  4B9U A;  3ULD A;  3QIN A;  4FJG A;  3ZT0 A;  4AH9 A;  4Q0B A;  1A5W A;  2G8V A;  1FK9 A;  5SZT A;  4Q5V A;  4FJI A;  5CYM A;  3DRP A;  3V9X A;  4M3R A;  4DTM A;  4LH5 A;  2G8H A;  3PV8 A;  3TAR A;  3VQP A;  3T3F A;  3LDS A;  1NKC A;  3M8R A;  3VQE A;  4ZHR A;  4CEO A;  1R0A A;  2BDP A;  3L3U A;  4CHN A;  3OYG A;  4DU1 A;  3MXJ A;  1C1A A;  2ZQB A;  4DS4 A;  3KLI A;  1J9A A;  4O5B A;  3P1G A;  3HPH A;  1HYS A;  3I0S A;  4KTQ A;  1Y97 A;  2ETJ A;  1RBU A;  4FM1 A;  4F3T A;  3KD5 E;  4HTU A;  3IAY A;  4FJK A;  4B08 A;  3BDP A;  4KRE A;  4OVL A;  2D5R A;  1YVU A;  1IH7 A;  2Z1H A;  1WSI A;  4O4G A;  5CYQ A;  4DFK A;  4F4K A;  1FKO A;  5HRO A;  5J2P A;  4KHS A;  1BGX T;  3SUP A;  1NK8 A;  3NF6 A;  1S6Q A;  2HNY A;  2OPR A;  4FVM A;  4O0J A;  5C42 A;  3V6D A;  3SQ4 A;  4DSJ A;  1J53 A;  4B8A B;  3V1O A;  2HVI A;  3ZSR A;  1MU2 A;  4QCL A;  4C8O A;  1CZB A;  1RTH A;  3QEP A;  2IDO A;  5J2M A;  3V9U A;  3V81 A;  2P1J A;  4O55 A;  4DSI A;  4LY7 A;  3G10 A;  1J54 A;  4TSX A;  3C95 A;  4HCC A;  3HP6 A;  1REV A;  1RDB A;  3VQQ A;  1JLA A;  4IG3 A;  5FDL A;  4CED A;  4W5Q A;  3KK2 A;  1NK4 A;  4ZTJ A;  3ZSW A;  4HCB A;  4FJM A;  3G0Z A;  1KRP A;  5FRN A;  1HQU A;  2DFH A;  4AHV A;  4CJR A;  4Z4H A;  4AHU A;  4F8R A;  3OYH A;  4JS4 A;  3AA2 A;  3U6F A;  4B9V A;  5C25 A;  5KGX A;  3QET A;  1RT1 A;  4CJT A;  1EP4 A;  4DTS A;  5T7B A;  1NJY A;  1UOC A;  2Z1J A;  2Q3S A;  3DRR A;  3VQB A;  5CZ2 A;  1RT6 A;  3K5L A;  1N5Y A;  4FK4 A;  3SV3 A;  2FBT A;  4FXD A;  3ZSO A;  2DFF A;  2VG6 A;  3MAQ A;  1KTQ A;  4Z0U A;  3V9S A;  1U49 A;  4CJW A;  2DFE A;  3PUF A;  3VQD A;  5K14 A;  1S5J A;  4KFB A;  3T1A A;  5KRT A;  4FYD A;  2PZS A;  3ZSQ A;  3AVK A;  3KLF A;  3L2W A;  1HPZ A;  3PX0 A;  4RW7 A;  3RR8 A;  1EXQ A;  2X6S A;  4RW6 A;  2G8I A;  4Z4F A;  3U3Y A;  2YHB A;  4LD0 A;  3DLH A;  1KLM A;  4FJN A;  1I39 A;  3ZT4 A;  3F73 A;  5HLF A;  1RBV A;  3HST B;  4FZZ A;  3QLH A;  4E0D A;  4CJU A;  1N6Q A;  1HNI A;  4GW6 A;  3ZT1 A;  2G8U A;  1TKT A;  3K5M A;  1L5U A;  4KHN A;  2WOM A;  5HBM A;  4N5S A;  1F21 A;  3NGZ A;  1EKE A;  3LP0 A;  4CGH A;  3VQA A;  4KAZ A;  1B92 A;  4CGJ A;  1VRT A;  3CFP A;  3JSM A;  1SL1 A;  1RTD A;  1JLB A;  1KFS A;  4J2A A;  2HHT A;  3RMD A;  3KKS A;  3V1Q A;  4FJH A;  5KI6 A;  1BL3 A;  2KZZ A;  3LP2 A;  4OKJ A;  4CEB A;  4OLA A;  1NK7 A;  4O0I A;  4DF4 A;  1JLF A;  3QES A;  3SPZ A;  4CJQ A;  1TAQ A;  1Z26 A;  1C6V A;  2B6A A;  4FW1 A;  1RTJ A;  1QSY A;  3TAP A;  3DLK A;  3C6U A;  3WNE A;  3ZSZ A;  4DFJ A;  4FZY A;  4KHQ A;  3KJV A;  4DU4 A;  1VSE A;  1S1X A;  2YHA A;  1IG9 A;  2VG5 A;  1DTQ A;  1VSD A;  1VSK A;  2BAN A;  3O4N A;  4EP4 A;  3L2U A;  1BIS A;  4NCG A;  4DTN A;  4DSE A;  1RT5 A;  2ZD1 A;  4F3O A;  1ZYQ A;  2D0A A;  4E1N A;  4H8K A;  1ASV A;  4N47 A;  3WNH A;  3O3H A;  4ELT A;  3TAN A;  3DI6 A;  1XI1 A;  4CJ3 A;  4DTJ A;  4KB1 A;  3VA0 A;  3TAG A;  1XHZ A;  1RBS A;  3LWM A;  4JS5 A;  3TWH A;  3SCX A;  4KRF A;  3DLB A;  3SJJ A;  3S3M A;  2KQ2 A;  2IGI A;  2PYL A;  3P83 D;  3RTV A;  2YKM A;  4FW2 A;  3K58 A;  3AVA A;  3NBP A;  3QIO A;  1VSI A;  4CHO A;  3OYC A;  4DWI A;  1ZBL A;  2QKK A;  3B6O A;  4Z4E A;  3L8B A;  3AO3 A;  1IKX A;  1U04 A;  4KI6 A;  3O3F A;  3QER A;  1CXQ A;  3SNN A;  4CK1 A;  1EX4 A;  3OYA A;  4DQQ A;  2XY6 A;  5D3G A;  3OYD A;  4CIG A;  1SL0 A;  2HHU A;  2KW4 A;  4FLU A;  4FJ5 A;  1NK0 A;  2O4I A;  3HO1 A;  1CLQ A;  3LZJ A;  3RMA A;  4E7L A;  1Q9Y A;  1U4B A;  3AO5 A;  1S6P A;  1HYV A;  3AVF A;  3OS1 A;  1SV5 A;  4JRQ A;  4O44 A;  4M3U A;  4BE0 A;  1EET A;  3MXI A;  1TK0 A;  4W5N A;  1BIZ A;  3TI0 A;  3M8P A;  1KSP A;  1TAU A;  1O1W A;  4E1M A;  3OYI A;  1QSS A;  1D9F A;  5I3U A;  2XO7 A;  2YNH A;  1X1P A;  3IRX A;  4KTW A;  3BGR A;  4CF8 A;  1JLE A;  3SUQ A;  1VRU A;  1LW2 A;  3IS9 A;  1D5A A;  1RIL A;  2E4L A;  3VQ6 A;  3ZCM A;  4CF2 A;  5J1E A;  4EZ6 A;  3SUO A;  4Z4C A;  4DFM A;  4M45 A;  3V9Z A;  4J2E A;  1S1U A;  1K6Y A;  3SQ2 A;  4PA1 A;  1NKE A;  1ASW A;  4L8R B;  3HK2 A;  1RTI A;  3KLE A;  2KFN A;  3AVL A;  3RMB A;  4M3Z A;  3D0P A;  4DQS A;  4B9S A;  1U47 A;  4FJ9 A;  2O4G A;  2DTU A;  1I3A A;  1T8E A;  1B9F A;  3OYN A;  4I2P A;  3S9H A;  1UWB A;  4I9L A;  4CJ5 A;  2FBX A;  4KV8 A;  1YTA A;  3CM6 A;  1VSL A;  4MQ3 A;  4W5T A;  1BI4 A;  1TK8 A;  4E3S A;  3NGY A;  3TAE A;  1XHX A;  3AVM A;  4Y1D A;  3L2V A;  2Y1I A;  1JXB A;  1ZBH A;  3NHG A;  5KRS A;  4DTR A;  4CJ4 A;  3VQ9 A;  4C8K A;  1IKV A;  3OYF A;  2A1R A;  5JS2 A;  3OS2 A;  2HW3 A;  1SKS A;  4N56 A;  4BE1 A;  2Z1I A;  1RT7 A;  3AVB A;  4MFB A;  3LPU A;  1BCM A;  1W0H A;  3LAK A;  5C24 A;  3PX6 A;  4M3W A;  1JL2 A;  4M42 A;  1XC9 A;  3PO5 A;  1C0T A;  2E6L A;  3MED A;  3VA3 A;  4FJ7 A;  3SYZ A;  1ASU A;  2XRI A;  3AA5 X;  1YTU A;  4FK2 A;  4IBN A;  1NJZ A;  3HPG A;  4DG1 A;  2VWJ A;  5HP1 A;  4DTX A;  3LZI A;  4KB0 A;  3L2R A;  4CFA A;  3K57 A;  4DLG A;  1J5O A;  3DYA A;  1BQN A;  4CEC A;  1A5X A;  4CJV A;  3K5N A;  1FKP A;  2PYJ A;  4DFP A;  3JYT A;  4FLX A;  2P5O A;  4E19 A;  1LWC A;  3LP1 A;  5SWM A;  1JXE A;  1VK0 A;  3K2P A;  1QQC A;  2B5J A;  3QEW A;  4BDY A;  2Y1J A;  4AHC A;  1KCF A;  4PWD A;  2OZM A;  3MEG A;  1LAW A;  3EYZ A;  4G1Q A;  4ID1 A;  4CGG A;  3VQ5 A;  3RWU A;  4ELV A;  1LV5 A;  3LAM A;  1SL2 A;  3KK1 A;  4H4M A;  1RBT A;  4DSK A;  4DS5 A;  2X74 A;  4FLZ A;  1TKD A;  3ASM A;  4H4O A;  1NK9 A;  5DK5 A;  3HL8 A;  3OJS A;  4E7I A;  1IKW A;  3VQ8 A;  1C1C A;  4NCB A;  5JS1 A;  4DQI A;  4C8M A;  1RCH A;  1JL1 A;  4DMN A;  2QKB A;  3E01 A;  5CZ1 A;  4CIE A;  5HRS A;  2OZS A;  4E7J A;  1CXU A;  4BAC A;  4J2D A;  2KFZ A;  3SPY A;  2OPP A;  4KHW A;  3OVN A;  4E89 A;  3PY8 A;  1NJX A;  2IC3 A;  1WNS A;  4B9M A;  4CGD A;  4HUE A;  3NE6 A;  3PX4 A;  3DLE A;  3HVR A;  3CFO A;  2P51 A;  3MXM A;  3S3O A;  1B9D A;  1UA1 A;  4I9Q A;  3MEE A;  1Z25 A;  2ITG A;  3DOL A;  1BHL A;  3M8S A;  1JLQ A;  3IG1 A;  4CER A;  4I2Q A;  4CJS A;  4CK2 A;  3CG7 A;  1UA0 A;  4B9L A;  3OYE A;  4FK0 A;  2D0B A;  3V4I A;  1GOB A;  4CEZ A;  3S3N A;  1NKB A;  4CGF A;  3QEI A;  3AVC A;  4DLE A;  4IDK A;  1VSM A;  1CZ9 A;  2P5G A;  4IG0 A;  3HYF A;  4EP5 A;  1QHT A;  3D45 A;  2G8F A;  3V9W A;  1HMV A;  1WAF A;  2XY7 A;  1A5V A;  4CJK A;  2G8K A;  1WN7 A;  2JGU A;  3HT3 A;  3P5J A;  1DLO A;  3NH1 A;  4CJP A;  1FXX A;  1KVB A;  1Q8I A;  3ZSX A;  1HYZ A;  3NAE A;  3OS0 A;  1TV6 A;  4NYF A;  4CJF A;  4YNQ A;  3ZT2 A;  4FM0 A;  3AV9 A;  1ZBI A;  1KFD A;  3TR8 A;  2E6M A;  3AO4 A;  1TL1 A;  4FZX C;  2IAJ A;  3QNN A;  1GOA A;  4AHT A;  4DF8 A;  4M3Y A;  2HVH A;  2YNI A;  1KVA A;  4BWJ A;  3B6P A;  4DTU A;  1L3S A;  3LAL A;  1Q9X A;  4HHT A;  2KTQ A;  3NH0 A;  5HRN A;  1QTM A;  4HVJ A;  1SKW A;  2OYQ A;  1WSF A;  2YNG A;  3DLR A;  4RG8 A;  4KTZ A;  3AA4 A;  4CHP A;  2BE2 A;  1TK5 A;  3TAM A;  4OPJ A;  2B4J A;  1NK6 A;  3AO2 A;  2IS3 A;  5KGW A;  4ZTF A;  1W9H A;  3LP3 A;  3L3V A;  4AHS A;  2D0C A;  2A1S A;  2VG7 A;  3C94 A;  4CIF A;  3TAB A;  1X9M A;  1S9G A;  1RDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...