3ZCMA

Small molecule inhibitors of the ledgf site of hiv integrase identified by fragment screening and structure based design.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zcmA00
1QQCA 1C0UA 3DLEA 3VQ7A 1NKCA 3HK2A 4KTWA 3RMCA 3KIOA 1XHZA 5KI6A 2X78A 5C42A 3DLRA 4IG0A 4AHVA 2NUBA 4KI4A 1N6QA 3MXMA 1D9DA 1VSHA 2HHXA 2BDPA 4C8NA 4CJEA 1TAUA 3TAGA 4KTQA 3AO1A 3MXIA 3OJSA 2OPQA 4Q0BA 4FJ7A 2EHGA 1LWFA 1C6VA 3QINA 4UQGA 4Q5VA 2KZZA 2HHWA 3ZT1A 4FJGA 3OYBA 3AVLA 3K58A 4GW6A 1RTIA 3KLFA 1ASWA 2O4GA 3M8QA 4E19A 1U4BA 1KRPA 1VSEA 2HB5A 3ZT0A 1JLAA 4LY7A 4FM1A 3SUOA 1NKEA 3OYKA 4M3ZA 3VQPA 4F3OA 5HBMA 5J2PA 3B6OA 1QHTA 4DTOA 3H08A 1JXBA 1XHXA 2GUIA 4FW1A 1W0HA 1JL1A 1UA1A 1S1VA 4CJUA 1DLOA 1RDCA 5CZ2A 2D0AA 4W5OA 4HCCA 4CEDA 2HHQA 1EKEA 1QSLA 4BWMA 4FJXA 1WAFA 2DFHA 4FZXC 1VK0A 4ZTFA 2VG7A 1X9SA 3DYAA 3SUNA 4FJ5A 1L5UA 3HP9A 2KTQA 3BDPA 2VWKA 3NH0A 3L2VA 3VQQA 1BCOA 3KLIA 4CK3A 4FLYA 1CXUA 3AVCA 1FK9A 1HQUA 3ZSZA 2Y1IA 3PX0A 1IG9A 5SWMA 4IG3A 4Y1DA 2G8VA 2XRIA 4BE1A 3ZSVA 1EX4A 3L3VA 4FK4A 1RBTA 1QSYA 4Z4EA 1L3TA 3K5OA 1EXQA 3AO2A 3ZSXA 3RRGA 4L8RB 1ZBHA 3OYNA 2DY4A 2RN2A 3G10A 4CEAA 2I5JA 2XHBA 1Q9XA 2R7YA 4DF8A 3NDKA 4ICLA 1RT5A 4TSXA 3T19A 3OYDA 3TR8A 4DTXA 2F8SA 4FYDA 3AVMA 5HRSA 4BDYA 3D45A 3QNOA 3LP1A 3G0ZA 1NK0A 4NCBA 3M8PA 4DTMA 4CERA 1QS4A 4CESA 1TVRA 4JLHA 1HRHA 3P83D 1U49A 4DQPA 4EP5A 3L2RA 2EX3A 2YNGA 3U6FA 4CFDA 2DTUA 3RTVA 3PV8A 4B8AB 1CZ9A 2HMIA 3ZSOA 3JYTA 3MEGA 4DLGA 5HP1A 4DQSA 4CK2A 3TABA 3MEDA 2Z1JA 3OYMA 3VN5A 2XY8A 4B9TA 4DQIA 1CZBA 3WNHA 4KHNA 5HRNA 3QIOA 2Q3SA 4FLZA 3SYZA 1VSFA 1U48A 1IO2A 4AHUA 4EZ9A 1F21A 1JLCA 3TWHA 1D9FA 3I8DA 1KFSA 3LALA 1RTHA 3ALYA 3DRSA 3L3UA 3PX6A 4Z4FA 1WSFA 3RR7A 2KZMA 1QE1A 1HYSA 4DSKA 3RRHA 1VSIA 3SPYA 1LAWA 1NK7A 1FKPA 3KLEA 4FJ9A 4JRQA 4N76A 3QLHA 3KLGA 3QO9A 3P1GA 3ZSWA 2VG6A 1JLEA 1WSEA 4WE1A 4FK2A 5JS2A 4KHYA 5KRSA 3TAQA 1NOZA 3DM2A 1YT3A 5HRRA 1U45A 1TKDA 2XO7A 4RW9A 2RPIA 3PY8A 1LWEA 2OPRA 1FKOA 1L3SA 1TL3A 4C8OA 3OS0A 4E7HA 1WSJA 3I0SA 3NAEA 4FZZA 4B9SA 4FJLA 1QSSA 1X9MA 4CJTA 1VSLA 3S3NA 4I9LA 4CF9A 3F73A 3QETA 3AA4A 4CIGA 1S1UA 3OYCA 1WSHA 3KKSA 4B08A 4DTSA 3LP0A 3NH2A 1S1WA 3UIQA 1IH7A 1TL1A 1RDAA 3AVFA 4NYNA 3SV3A 5I42A 1SL0A 4BDPA 4KAZA 2QK9A 4PY5A 1VRUA 5CYMA 3ZT3A 1A5WA 4RW8A 4DU1A 3QEIA 3RMAA 3DMJA 4CJRA 1C0MA 2IS3A 2JLEA 3EY1A 1SL2A 2OZMA 4CFAA 3OYEA 2HHSA 2D0CA 1RNHA 2ZE2A 4DS5A 4J2BA 3KK2A 4DSJA 4FJHA 1KVCA 5CY4A 1IKVA 3VQAA 4HUEA 1S6PA 4DTJA 4DTUA 5KGXA 4E7LA 2Z1GA 5D3GA 4CGIA 1TKXA 3K57A 4KO0A 4CGJA 3RMBA 4B9VA 3NCIA 1J53A 5KRTA 2VWJA 3OY9A 3QERA 1J54A 2YKNA 4CEBA 4C8MA 3PO4A 3S3MA 3NGIA 3CM5A 2ATQA 3SUQA 4KI6A 3VQ8A 4OPJA 3ISNC 3OVNA 1IKYA 2IGIA 3OYLA 3V4IA 1U47A 3HXMA 1TK8A 4I7FA 2OYQA 4KHWA 3SUPA 4ELVA 5FRMA 2AJQA 3PO5A 4FW2A 4HUFA 4FLTA 3TAMA 4M42A 1KFDA 2KFNA 3B6PA 3SQ0A 3EYZA 4Z4GA 4I2PA 3ZSRA 4HHTA 2G8WA 4DWIA 2X74A 2B5JA 3QEXA 4DG1A 3C95A 4CHYA 3CM6A 1TV6A 1W9HA 3KJVA 5J2QA 1BQNA 4O5BA 3V1QA 3K59A 1S6QA 2E6LA 4LD0A 2IDOA 1NK6A 1ZBLA 4FJMA 4QCLA 1ZBFA 4OKJA 1LAVA 2BGGA 1O1WA 4PWDA 4B8CA 1HPZA 4CEOA 4ZHRA 4JS4A 5FRNA 4KHQA 4OJRA 5E41A 4FVMA 1VSKA 1RTDA 3DLKA 1KLMA 3T1AA 3NE6A 3SJJA 3NF7A 1SKWA 2G8HA 1K6YA 1LW0A 3OYIA 1XI1A 4ELUA 3HPGA 4FJKA 1ITGA 4DU4A 2X6SA 4FCYA 1Q8IA 4CFBA 4CHQA 3HYFA 4FJIA 1S9GA 2HVHA 4W5RA 1ZYQA 2G8FA 4J2AA 3F9KA 3O3GA 4KKOA 3V1OA 1ASUA 1TGOA 4M41A 4CHNA 1WAJA 1IKWA 3VQ6A 3ZSYA 2KQ2A 4M3TA 4GVMA 4OKKA 4GMJB 4OGEA 4NCAA 3O3HA 4B9UA 1A5VA 4K8XA 1BI4B 1RBVA 1SKSA 1JLGA 2IOCA 2P51A 1RT6A 1DTQA 3AVGA 4BE2A 4DTNA 3V9SA 5JS1A 3ZCMA 2RF2A 4DMNA 4E7JA 5KGWA 3KTQA 3CFOA 3DLGA 4JS5A 3FFIA 3LAMA 1NK4A 4DQRA 3HVTA 3K2PA 4CJKA 3SV4A 4E1NA 3KD1E 1RT4A 3K5LA 1WLJA 2WOMA 1RCHA 4OKEA 1SKRA 1RT7A 2QKKA 1NK9A 2F8TA 1CXQA 4NCGA 1TKZA 2IC3A 4FJJA 4B3OA 4CIFA 1C1AA 2Z1HA 1NK5A 4F4KA 4DSIA 2D0BA 3QEVA 1TK5A 4FJ8A 1BIZA 2HW3A 1KVBA 3D0PA 1KLNA 4CF8A 4F2SA 2X6NA 3THVA 4KPYA 4DS4A 1YVUA 5C25A 1LW2A 1VRTA 1BHLA 3VA0A 1RDDA 1VSMA 4O4GA 4O44A 3AV9A 5CZ1A 2BE2A 4CECA 4DLEA 4H8KA 3QEPA 2YNHA 4CF0A 2D5RA 2QXFA 1HJRA 4DTPA 4KHSA 2HHUA 3OJUA 3AO4A 1SL1A 3KKRA 4CJLA 4IFVA 1ZBUA 3NHGA 3TAFA 4Z4CA 4IBNA 2PYLA 1L3UA 4LH5A 1JKHA 4FJNA 3AO5A 3CYMA 4CEQA 1D5AA 4MQ3A 4CGHA 5SZTA 3OS1A 4B9MA 4HTUA 4ELTA 4KV8A 4DU3A 3AO3A 1YTUA 4DFJA 4M3RA 1BL3A 3U3YA 3HM9A 3AA2A 3MEEA 3HPOA 3TAEA 4QAGA 3BGRA 1I39A 1RTJA 4RW6A 1T03A 4E0DA 1HNVA 4IDKA 4HVJA 3LP2A 1VSJA 1BCMA 3CFPA 5J2MA 1S9EA 2VG5A 1IKXA 4ID1A 4EZ6A 4KREA 3PX4A 4KFBA 2KFZA 2GV9A 3LANA 3P5JA 3AVAA 1N5YA 2IAJA 4C8LA 3KK3A 2O4IA 3CQ8A 3AVJA 3TANA 1J5OA 3HL8A 4G1QA 5HRPA 4R5PA 4FLWA 3LPUA 4KB0A 3KK1A 3AVKA 3IAYA 1RT3A 3VQDA 4CGFA 1L3VA 2XY6A 4FK0A 3VA3A 4DTRA 3AA5X 1EETA 2FC0A 3HSTB 3O4NA 1T7PA 1X1PA 3VQCA 2E6MA 2HNZA 5T7BA 3RMDA 4M3WA 4BE0A 3MAQA 4M3XA 3O3FA 1HYZA 4HCBA 4Z4HA 2OPSA 5KTQA 2HVIA 2YV0X 4M3UA 1WSIA 4F3TA 4FXDA 3C6UA 4OGCA 4DSFA 4H4OA 1GOBA 1HNIA 4CJ5A 4CJ4A 2GBZA 1SUQA 3HT3A 4O55A 3V1RA 3QNNA 4E7KA 3S9HA 2G8KA 2PY5A 3NFAA 2OPPA 3DLHA 4FM2A 4CFCA 3V9XA 2FBVA 2P5GA 1UWBA 4RG8A 4RW7A 1C0TA 3VQ5A 3T3FA 1NKBA 3AA3A 1GOCA 1UAXA 3QEWA 2YHBA 3HVRA 1WN7A 2A1SA 2WONA 4CHOA 2G8UA 4YFUA 2DFEA 1DTTA 1Q9YA 1RBRA 4FLVA 5J2NA 3E01A 1ZBIA 1BQMA 2FBXA 4PQUA 3OYJA 1HQEA 5K14A 4J2EA 4AHSA 3SQ2A 2Z1IA 1C1CA 2XY7A 3C94A 1KVAA 4CGGA 2YHAA 3LZIA 2ZD1A 1RBSA 3MXJA 3I0RA 4N47A 4B9LA 1RILA 2KW4A 4Y1CA 3L2WA 2ITGA 3SPZA 1S5JA 4LSNA 3NH1A 4CJVA 1ASVA 1YTAA 2JGUA 3LWMA 4E7IA 4KB1A 4PA1A 4AHTA 4AHCA 3DRRA 1B9DA 4CEEA 1NJWA 3RWUA 4W5NA 4AHRA 1EP4A 2A1RA 5C24A 4M3YA 3NF8A 1B9FA 4IFYA 3WNFA 4B9NA 4IKFA 4K8ZA 4KHUA 4ID5A 4Z0UA 3LPTA 4E89A 4PUOA 4J2DA 3M8SA 3SQ1A 5HROA 5CYQA 4FLXA 3QIPA 3AVNA 4CF1A 4CJ3A 1XC9A 4I9QA 4F8RA 3RR8A 4FLUA 3ZSQA 3SI6A 3VQEA 1XWLA 3JSMA 2YNFA 4XIUA 4M45A 2YKMA 3EZ5A 3TARA 1QTMA 4OLAA 3NGZA 3MECA 3ZT2A 2W42A 3IG1A 4AILC 4F2RA 1I3AA 4DFMA 4N5SA 1NOYA 3M8RA 2BANA 2B6AA 1G15A 4E1MA 1BGXT 1KCFA 4O0IA 2DFFA 1JLFA 5EU7A 2P5OA 4QOZB 4DQQA 1Z26A 2FBTA 3V9UA 3L8BA 4O0JA 1T8EA 4W5TA 3TI0A 4DFPA 1FXXA 4CE9A 1KSPA 1KTQA 3C6TA 5DK5A 4BDZA 1S1TA 1A5XA 1TAQA 3WNEA 4CHPA 4N41A 2HHTA 3AVIA 4CIEA 3SZ2A 3ULDA 4Z4IA 1RT1A 2QKBA 3AVBA 3QESA 1UA0A 1NJYA 4CJQA 3OYHA 4LH4A 2ZQBA 4CJFA 1T05A 5FDLA 1BIUA 2OZSA 3IS9A 3A2FA 3OYAA 4DSLA 1TK0A 3O4QA 4FM0A 1X9WA 2HHVA 1MU2A 4LSLA 1CLQA 3HPHA 3HP6A 4CEZA 1RBUA 1Z25A 4CGDA 3ITHA 2HNYA 4CF2A 1R0AA 2B4JA 3L2QA 1TKTA 2LSNA 3S3OA 1J9AA 3OYFA 4CCHA 1LWCA 2YNIA 4CK1A 4HUGA 4DF4A 1NJZA 4ZTJA 3AVHA 4E3SA 5HLFA 4C8KA 3HJFA 4MFBA 4BWJA 3NF9A 3VQ9A 1HMVA 4H4MA 4DSEA 1LV5A 5J1EA 3ZT4A 1U04A 4OVLA 1VSDA 4OPKA 3KD5E 2F96A 3NGYA 4NYFA 2OA8A 3K5NA 1NJXA 3L2UA 2PYJA 1JLBA 1JXEA 4RW4A 3OS2A 1S1XA 3SQ4A 3NF6A 4AH9A 2RKIA 1RT2A 3DOLA 3LDSA 3CG7A 4EP4A 3SNNA 4FZYA 3V9WA 3V6DA 3ASMA 4YNQA 1JL2A 2ETJA 2PZSA 1BISA 3LP3A 2G8IA 1REVA 1B92A 4N56A 3SCXA 3PUFA 1NK8A 4KRFA 3LAKA 3DLBA 5I3UA 2E4LA 3HO1A 4CJSA 4JRPA 5DMRA 2P1JA 1GOAA 3LWLA 3DI6A 1Y97A 3NBPA 4BACA 3DRPA 3TAPA 1WNSA 3K5MA 3DOKA 2HNDA 3WNGA 4CEFA 4CJPA 3U3GA 2FBYA 4DFKA 1RDBA 3KLHA 3VQ4A 3OYGA 4KTZA 4CHZA 1D8YA 3LZJA 1SV5A 1UOCA 1JLQA 4I2QA 3IRXA 3V9ZA 5FROA 4CJWA 3CFRA 1C1BA 1HYVA 3VQBA 3V81A 2Y1JA 1WSGA 1BI4A 4W5QA 2XY5A 4OLBA
chains in the Genus database with same CATH superfamily
4B3RK 1C0UA 4GV9A 3RMCA 4ILJA 3KIOA 1NGEA 2X78A 4IG0A 3OBWA 2UUBK 3D7EO 1VQ4N 1VSHA 1K8AO 4C8NA 2UU9K 4QS9A 4Q5VA 2KZZA 2HHWA 4FJGA 1HNZK 3KLFA 3M8QA 3UE5A 3ZT0A 4WQ4A 3JXUA 4V19S 4M3ZA 3GG4A 5HBMA 3B6OA 1Q18A 4FW1A 1JXBA 1XHXA 3EE8A 4HWIA 1JL1A 3PIPL 3R1XA 4PL7A 4FJXA 3CPWM 3NVKA 2VG7A 1VQMN 2O8EA 3QB0A 3VGMA 1XQSC 3SUNA 4FJ5A 1HNWK 1L5UA 2NRVA 2KTQA 2OTLN 3ZYYX 3L2VA 2PAVA 1CXUA 3H46O 2Y1IA 1FK9A 1HQUA 2O8FB 1IG9A 5SWMA 2G8VA 2QM1A 3PIOL 4BR4A 1EX4A 1RBTA 1QSYA 4Z4EA 1L3TA 1YXQA 3CHWA 3K5OA 4DHYA 2VWBA 5JVHL 3OYNA 3G10A 4U7BA 3O9TA 4JNEA 3NDKA 4ICLA 1RT5A 2F8SA 3OYDA 5HRSA 5AQWA 3QNOA 3LP1A 4CERA 4CESA 1TVRA 4DQPA 4BRFA 4CFDA 4BRKA 5F2RA 4H0XB 4BRAA 4CK2A 2W41A 2BUPA 5HRNA 3QIOA 4FLZA 1VSFA 4AHUA 2E20A 3L6QA 3LALA 2Q97A 2WBNA 2KZMA 4DSKA 3CMEN 4IEEA 3O9QA 3ZSWA 4PHTX 4KHYA 5CHIA 2QWQA 5E84A 3WXKA 2NRHA 1TKDA 3B8AX 4XH1A 4K25A 4RW9A 2RPIA 5AZJA 4HTLA 2OPRA 1FKOA 2RHKA 2GWJA 4BRHA 1WSJA 3ZX3A 4CJTA 3S3NA 3OYCA 4Z94A 4B08A 4DTSA 2WFBA 1YIJN 4E1JA 3UIQA 1IH7A 4BDPA 3OHRA 1VRUA 2CGJA 1C0MA 4BRMA 4LF4K 2ZE2A 2O8FA 1KVCA 4JD2A 3C7NB 4HUEA 4DV7K 4DTUA 4BC5A 5D3GA 4CGIA 4KO0A 2ATQA 3SUQA 4U67L 2NLXA 2IGIA 1I94K 4GVEA 4I7FA 4DR2K 4ELVA 2AJQA 3VTHA 5FPMA 3SLCA 4M42A 4ISGA 3EYZA 5EVZA 2D0OA 2H3GX 4CHYA 3CM6A 4I6MB 3KJVA 3HJFA 3V1QA 3MMVA 1S6QA 2E6LA 4FJMA 4OKJA 4ZHRA 1WBDA 3DLKA 3NE6A 3SJJA 3MN5A 1K6YA 3OYIA 4FJKA 1X9JA 3HPGA 2ZGYA 1V4TA 4QS7A 2HVHA 3ZX2A 3F9KA 4BR0A 3O3GA 1JCGA 1TGOA 1BG3A 3A0IX 4GVMA 1HUXA 4OKKA 1Z05A 5BN9A 4GMJB 1VQ8N 4NCAA 3CCQN 4K8XA 1SKSA 1DTQA 3AVGA 5JS1A 5E26A 4E7JA 5KGWA 4K0KK 3EE9A 2V51B 3FFIA 3LAMA 2A6AA 1NK4A 1NJIO 4E1NA 1RT4A 3WT0A 4LFAK 3A5OC 1RT7A 1NK9A 3QFUA 1JCFA 1YITN 4FJJA 1YHQN 4JI4K 4X62K 4F4KA 2D0BA 5M1NA 1BO5O 1KVBA 3IFRA 4F2SA 3C7NA 1YVUA 4LF9K 1VRTA 4O4GA 4O44A 4CECA 4DLEA 3I56N 4ISEA 1HJRA 2BH1A 4K43A 1N34K 4JI0K 3IUCA 1ZBUA 3NHGA 1BOTO 1EWRA 4FJNA 4DR7K 1D5AA 4MQ3A 4BG9A 4HTUA 4KV8A 1DKGD 3U3YA 2AA4A 5BPLA 3UB5A 2W6LA 3TAEA 4QAGA 1N36K 1T03A 4RTFD 3LP2A 1VSJA 2VG5A 1IKXA 3BP8A 4KREA 1SZ2A 2GV9A 2W6KA 2PFUA 2CH6A 3AVAA 3CQ8A 1J5OA 1OH7A 4KB0A 4PL8A 3VQDA 4CGFA 4YHHK 3KHYA 3AA5X 4LFCK 4DB3A 2FC0A 1X1PA 3I55N 4JAXA 5AQKA 5KTQA 1VQNN 2HVIA 2YV0X 1WSIA 2QWMA 4H4OA 4X64K 4WFNL 3HT3A 4FYDA 3LDNA 3WQTA 3S9HA 2G8KA 2FLOA 3GOIA 1IJJA 3ID8A 4RW7A 3UKRB 4FO0A 4F9OA 3U4LA 4YFUA 1RBRA 4NO7A 1RGIA 3E01A 4BREA 2JWLA 4AHSA 1J6ZA 3TU5A 4FWOA 3LZIA 2ZD1A 4YOWA 3ZETB 1C0GA 4B9LA 4N47A 1RILA 3L2WA 4Y1CA 3TTDA 1S5JA 1OKJA 3LWMA 1ASVA 4AHTA 4CEEA 3CCEN 4W5NA 3AGRA 4AHRA 5AQGA 5C24A 4M3YA 3NF8A 4BGAA 4BVPA 2GX9A 2GELA 4YDUC 1YVNA 4DUYK 4Z0UA 2YHXA 3LDQA 1V4SA 1NGBA 4JHDB 4I9QA 3LL3A 3SI6A 2CGKA 1NGIA 3FE1A 2ZWHA 3EZ5A 3TARA 5BPNA 1M1KO 2W42A 4DR4K 4JI2K 5BRHA 4NLBA 4CZHA 1BGXT 3THYB 2DFFA 1JLFA 2QWOA 5JLFA 4QOZB 4DQQA 1Z26A 3ENHA 4B1WB 1GLAG 1DGKN 3EO3A 4O8KA 3SAGA 1FXXA 4CE9A 4CD3A 1KSPA 3SAHA 4KHPK 1R59O 1TAQA 3ENOA 3MX5A 3P39A 1UA0A 3CI5A 1ATNA 1T05A 4DSLA 3EKUA 1HLUA 1K73O 1MU2A 4DQ8A 3HPHA 4JKAA 4CEZA 1Z25A 2ASMA 1R0AA 1TKTA 2LSNA 1MWMA 3FZKA 3OYFA 4DF4A 1IV0A 5HLFA 4JI3K 5HOOA 3VQ9A 1HMVA 1NGHA 4DSEA 5J1EA 4OPKA 1VSDA 2F96A 4NYFA 1NJXA 3ATUA 3L2UA 2PYJA 1JLBA 4RW4A 5AQMA 3OS2A 3NMUA 5AQXA 3F9MA 4WCEL 3NF6A 4AH9A 4CZFA 2HBJA 3M3ZA 4EP4A 3AARA 1HKGA 4YNQA 3LP3A 3E1YA 2G8IA 1GLBG 4N56A 4IZ9A 2RE2A 1NK8A 4K41A 2A42A 5I3UA 1KAXA 3HO1A 4CJSA 1Y97A 4BACA 3DRPA 2IVOA 4H0TB 3DOKA 4BRNA 2KLAA 2CH5A 1YUWA 4CZJA 4B1XB 1UOCA 1JLQA 3GE1A 1NGGA 4JHDA 3CFRA 1NMDA 1HYVA 5JVGL 2Y1JA 4C8KA 2XY5A 3ATVA 3DWLA 4BQZA 3DLRA 4IOAL 4H0VB 1TAUA 2BDPA 4CJEA 1TUYA 3AO1A 3MN7A 4Q0BA 3D2FB 4LC9B 3ZT1A 1VQ7N 3OYBA 3AVLA 4GW6A 2O4GA 1KRPA 5F1XA 4LY7A 3OYKA 4EHUA 1VQON 1QHTA 4DTOA 2GUIA 1W0HA 5FLXO 1RDCA 5CZ2A 3CD6N 4CEDA 2HHQA 1EKEA 3FLCO 3QMLA 4LF6K 4FZXC 3E9OA 1VK0A 2D1KA 3DYAA 2FF6A 2VWKA 1JJ2M 1LOTB 3DXKA 1BWFO 4FLYA 4Y1DA 1D4XA 4LFBK 3TTCA 3ZSVA 3L3VA 4GKKK 4JKEA 1EXQA 3AO2A 3RRGA 4L8RB 3IMXA 1ZBHA 1YI2N 2I5JA 4FWPA 1Q9XA 1HX1A 3T19A 2Q31A 3G0ZA 5GAEP 1VHXA 4DTMA 3TSPA 4BR9A 4JLHA 4ILGB 1EWQA 4EP5A 3HM8A 1NM1A 1SAZA 1QQNA 5ELZA 2ZJRL 3DLLL 1QQOA 3PV8A 1BDGA 3EKSA 5HP1A 3MDQA 2NRTA 3M5RA 1E4FT 4JK9A 4DQIA 1CZBA 4KHNA 4NLCA 2Q3SA 1U48A 4EZ9A 1IO2A 4GNIA 1JLCA 3TWHA 1T6DA 3WXJA 5AQJA 4Z4FA 3RR7A 1HYSA 3CQXA 5BPMA 3RRHA 3SPYA 1J5EK 3DXMB 4JRQA 4N76A 3QLHA 1FW6A 1JLEA 1WSEA 4MO5A 4WE1A 4FK2A 3D2FA 5GAGP 3SMPA 3TAQA 3LDOA 1YT3A 3PSFA 1L3SA 1TL3A 3CJAA 4JK8A 4MDAA 2F9WA 3JAMO 3NAEA 4B9SA 4FJLA 1QSSA 1VSLA 5KPTA 4IWVA 4I9LA 4CF9A 4X66K 3D2EB 1WSHA 3CC7N 2O8DB 1S1WA 4PKHA 4PY5A 3ZT3A 4DU1A 1A5WA 3DMJA 4CJRA 1VAZA 2BTFA 4BG8A 3EY1A 3VF6A 3OYEA 3ID6A 4DS5A 1BU6O 3CCSN 1Q86O 1IKVA 3H3NO 4DTJA 3O5BA 4WYBA 3RMBA 3NCIA 2VWJA 3OY9A 1J54A 2YKNA 3NGIA 3CM5A 4KI6A 4OPJA 3CERA 1YJ9N 4H0OA 3V4IA 3HXMA 4BC4A 5GADP 2A40A 3TAMA 1KFDA 4IO9L 3C65A 2KFNA 3L4QA 3SQ0A 4BGBA 2VGNA 2X74A 3QEXA 3C95A 5J2QA 4O5BA 1T6CA 3BY5A 3K59A 4LD0A 2IDOA 1ZBLA 2OANA 2IVNA 4QCLA 1ZBFA 1LAVA 3CIPA 4PWDA 1HPZA 1QZ5A 4OJRA 5E41A 4FVMA 2E2OA 3FZFA 3SJHA 3NF7A 2G8HA 2ITMA 1NGAA 1XI1A 4ELUA 1T3VA 1S72N 1ITGA 1ESVA 3R3LA 2A5XA 3UKUB 4W5RA 3HOTA 4J2AA 3J8AA 4KKOA 3V1OA 1ASUA 3WQUA 4JKHA 3THWB 5FPDA 4FL9A 1BI4B 4H03B 4NB4A 4FPBA 3V9SA 2RF2A 2Q36A 1WOQA 4LF5K 5AQRA 2O8DA 3KD1E 1RCHA 4X65K 1NWKA 2F8TA 1HR0K 2IC3A 4YDUA 3RSEB 2UUCK 3CC2N 2UXBK 3QEVA 3O8MA 2ASPA 3THVA 3CJ1A 5C25A 4RCHA 4J8FA 1RDDA 1VSMA 3KD5E 4J2DA 1KQSM 4BRLA 3QEPA 4H8KA 2YNHA 4CF0A 4DR6K 2QXFA 4KHSA 3OJUA 3AO4A 2GWKA 1NGFA 3K9KA 4IFVA 4BC3A 3FZHA 3O1BA 3AO5A 4KH5A 3OS1A 4CGHA 5SZTA 3MCAB 5FPEA 1Q82O 5KPZA 4DU3A 4DFJA 4M3RA 1BL3A 3AA2A 3CJ7A 3MEEA 4HVJA 3FR0A 3CFPA 5J2MA 2E88A 4EZ6A 5KQDA 3KK3A 2O4IA 3AVJA 3WUHA 1EQYA 3HL8A 5AQPA 3LPUA 3AVKA 3VPZA 3IAYA 1G99A 1Z6RA 2XY6A 2E2QA 3VA3A 2P9SB 3O4NA 4DV3K 5GINA 4M3XA 3O3FA 3L4IA 2IIRA 5B8HA 4Z4HA 2OPSA 4DV2K 3U9DA 4FXDA 3C6UA 2QW9A 3THWA 4DSFA 1GOBA 4CJ5A 1SUQA 3QNNA 3V1RA 4WQ5C 3DLHA 1N32K 3R6MA 3KVGA 3CCJN 1C0TA 3T3FA 1GOCA 3LM9A 2YHBA 2WONA 1SS6A 4FOIA 1DTTA 3CCLN 1KD1O 5J2NA 5EOYA 4PQUA 1ZBIA 5LJVA 1KAZA 1C1CA 1KVAA 1GLJO 3BZKA 1RBSA 5LMUK 3RSEA 3I0RA 1ILYA 2ITGA 3VEOA 2NZTA 1XMQK 2WTUA 4PA1A 3ENBA 3DRRA 1NJWA 1EP4A 1QVGM 2A1RA 3TPQA 2P9UB 5JICA 3G25A 4JKBA 3LPTA 3M8SA 3H6EA 3SQ1A 2HF4A 3QIPA 4BROA 4CF1A 4CJ3A 1XC9A 4XIUA 4PKIA 4M45A 4AF1A 2HF3A 3NGZA 4B1UB 2HBKA 2BANA 2B6AA 3LM2A 1KCFA 5GIPA 5EU7A 2P5OA 2OCEA 1QZ6A 1S3XA 4O0JA 2HSTA 4W5TA 4DFPA 4BDZA 5DK5A 1S1TA 3VENA 4N41A 3ULDA 4RWTA 3AVBA 2P9SA 3EN9A 4CJFA 4B9QA 2QI2A 2OZSA 3IS9A 3A2FA 1TK0A 1K8KB 2HHVA 3J7ZO 1RBUA 4B1YB 4CF2A 2B4JA 3S3OA 1J9AA 3AVHA 4WFAL 3O6WA 3NF9A 4OVLA 4CVNE 2ASOA 2QWPA 5HL7L 3F5TA 3LDSA 2HMPA 5CE3A 4I6MA 4JKGB 3J81O 3V9WA 2ETJA 2PZSA 2FSNA 4G9ZA 1REVA 1B92A 4KRFA 4JRPA 5DMRA 2P1JA 3C6HA 2P9UA 4OX9K 3WNGA 2NRRA 3KLHA 2HOEA 1SV5A 3M1FA 1IG8A 3IRXA 3FZMA 1C1BA 5GIOA 1QQCA 3HK2A 4DV0K 4QS8A 3CCVN 3D6RA 1XHZA 5KI6A 3SAFA 3OBYA 4H5TA 3WXLA 2NUBA 4A59A 4KI4A 2E2NA 5AQQA 4KTQA 2V7YA 3MXIA 4K42A 4FJ7A 1C6VA 3VEZA 3KWGA 1ASWA 1U4BA 1VSEA 2HB5A 4FM1A 3SUOA 1IBLK 4MLHA 3VQPA 4DCHA 5BR8K 4F3OA 1HNXK 3H08A 3VGLA 1S1VA 5BR9A 1DLOA 4BRCA 1M90O 5LMNK 4W5OA 4HCCA 2DFHA 2UXDK 2P9NB 3HP9A 3BDPA 5KPRA 3NH0A 3VQQA 4CW7B 3KLIA 3ZEUB 4CK3A 3AVCA 3PX0A 3VEYA 4YOXA 2XRIA 3ZSXA 2DY4A 4CEAA 4JKGA 3A5MC 4TSXA 3P31A 2VYPA 3TR8A 2ZJPL 2OTJN 3AVMA 4BDYA 3QBWA 4NCBA 1NK0A 3M8PA 1QS4A 3H1VX 1HRHA 3E66A 4IOXA 2EX3A 3AAPA 2YNGA 3U6FA 2DTUA 3CPEA 2QWNA 4A5AA 1CZ9A 2HMIA 4DLGA 5JMVA 4DQSA 3TABA 3C6AA 2XY8A 4BVOA 3CCMN 1U2VB 4GKJK 3O9RA 1F21A 1D9FA 3I8DA 5CR4A 5AQYA 1TYQB 3L3UA 3PX6A 1WSFA 4PKGA 3HBTA 1GLDG 3UKRA 1VSIA 3TSUA 1FKPA 3KLEA 3HRGA 3CCUN 4FJ9A 3KLGA 3OA9A 2VG6A 5MLCQ 2AP1A 3N4PA 5KRSA 3FFKB 3DM2A 5HRRA 4ILHA 1LWEA 3ZETA 4C8OA 2QWRA 4E7HA 3I0SA 3HZ6A 3QETA 4EHTA 3R8EA 1IBMK 3GDQA 3LP0A 3F2KA 5KQ8A 2Q2RA 1TL1A 3AVFA 4KAZA 1SL0A 2KKZA 2P9NA 5A2QO 2YI1A 1O13A 2IS3A 3ZEUA 2F9TA 4CFAA 1ZC6A 4DKWA 3KK2A 3KZBA 4DSJA 4FJHA 4BQLA 1VQ6N 3VQAA 2VGMA 1RDWX 3QFPA 5AQUA 4BRIA 2Z1GA 3K57A 4WF9L 4B1ZA 1GLCG 4CGJA 3THYA 4B9VA 4FWMA 1E4GT 4CEBA 4C8MA 3PO4A 3S3MA 3A8YA 3OYLA 4KHWA 2OYQA 5FRMA 4IOCL 3PO5A 4FW2A 4HUFA 4FLTA 3J7YP 3KWIA 4H0PA 3B6PA 4XH4A 4JKCA 2I7NA 3WEEB 4Z4GA 4OPHA 2B5JA 5M1PA 3FZLA 1W9HA 2YHYA 3CETA 1BQNA 4IO8A 1U2VA 3MX2A 1NK6A 2V7ZA 2BGGA 1O1WA 4B8CA 4DV6K 3H45C 4JS4A 4JI1K 5FRNA 4KHQA 1YAGA 2FF3B 1T44A 1TYQA 3ULEB 4OPAA 3T1AA 1FJGK 1SKWA 4WQ5A 1LW0A 3N4QA 2X6SA 1Q8IA 4CFBA 4CHQA 4C1NK 1S9GA 3J7AP 4M41A 3P4IA 3VQ6A 1NNEA 3S41A 4OGEA 4YOYA 5M1QA 1JLGA 2P51A 2JWKA 1RT6A 1X3MA 3AAQA 3ZCMA 3OTOK 4DR3K 5EY4A 2F4VK 3W3DA 3CFOA 3DLGA 2ZGZA 3FGUA 3HVTA 3K2PA 1YF5L 4CJKA 3SV4A 1BUPA 1WLJA 1HPMA 3EZWA 2QKKA 3QICA 4NCGA 4B3OA 4CIFA 1C1AA 2Z1HA 1NK5A 3PSIA 1TK5A 4JI8K 4NXNK 2D0PA 2X6NA 2W40A 5DM6L 4DS4A 1W97L 1LW2A 1BHLA 2A3ZA 3AV9A 5AR0A 5AQHA 1ATSA 2D5RA 4DTPA 2HHUA 3KKRA 3MCPA 1X3NA 3O80A 4Z4CA 2I7PA 3M6GA 1L3UA 2E1YA 3CYMA 4CEQA 3VF2A 3AO3A 3HM9A 3HPOA 4A57A 3BGRA 5M1KA 2QXLA 1RTJA 4E0DA 2NRXA 3MK6A 3EL2A 2HHHK 1BCMA 2P9LB 1S9EA 5TKWA 4ID1A 3H3OB 4KFBA 5GAHP 1WBBA 3P5JA 1N5YA 4C8LA 5BREA 1HKBA 3TANA 1W7AA 4G1QA 1QQMA 5HRPA 4FLWA 3KK1A 3ULEA 1RT3A 3MN6A 5JLHA 1L3VA 4MDBA 1EETA 1T7PA 5AJ3K 2O8CB 1KAYA 2E6MA 4M3WA 4BE0A 3MAQA 1HYZA 4F3TA 2F7TA 1C0FA 4GY2B 3R9PA 4CJ4A 2GBZA 3VF4A 2PY5A 4FVUA 3NFAA 4CFCA 2FBVA 2P5GA 1UWBA 4H5NA 4RG8A 3VQ5A 1UAXA 3QEWA 4B1VA 3HVRA 1WN7A 3GBTA 4CHOA 1XMOK 2G8UA 5AQFA 1BQMA 3OYJA 3JS6A 3SQ2A 2Z1IA 3C94A 5AZJB 3K0SA 4CGGA 1IBKK 3CCRN 2KW4A 3BZCA 4A61A 3NH1A 4FOEA 4CZMA 3RWUA 2IVPA 3DXMA 3W0LA 3O08A 4IFYA 5M1FA 4IKFA 4AM6A 4KHUA 4ID5A 1YJNN 4E89A 4PUOA 4DV1K 5HROA 2QWLA 5CYQA 4FLXA 4F8RA 5C12A 3RR8A 1XWLA 3JSMA 3MWPA 1QTMA 1XC3A 4OLAA 4JD2B 3ZT2A 4AILC 4F2RA 3G4SN 3D2EA 4N5SA 1OVYA 5BN8A 3M8RA 1SQKA 1N8RO 2P9LA 1N33K 1QHAA 1G15A 4O0IA 2HBLA 3L8BA 1HJOA 1KC8O 1T8EA 3TI0A 1KTQA 3C6TA 4IXCA 1A5XA 4CHPA 3WNEA 2HHTA 2QKBA 4CIEA 4JV5K 1NGDA 4R79A 4CZGA 4CJQA 5BRDA 3OYHA 3ZX0A 5FDLA 1BIUA 2O8CA 3VOVA 3O4QA 4CBUA 4FM0A 1X9WA 4AQYK 3L0QA 1CLQA 3HP6A 2Q1NA 1E3MA 1VQPN 4ZTJA 4E3SA 4MFBA 3AY9A 5I9EB 2UXCK 1LV5A 3ZT4A 1U04A 4XEIA 1H1VA 3NVMA 3NGYA 3K5NA 2O8BB 3SQ4A 2RKIA 1LCUA 1RT2A 3DOLA 3LDPA 3O9SA 3SNNA 4NXMK 2WC9A 2FSKA 3ASMA 1JL2A 4CI6A 3Q7CA 5AQTA 2J4RA 3HTVA 3LAKA 3DLBA 1GLLO 4Y0WA 3CMAN 2E4LA 4IJNA 5IT9O 3LDLA 4IDHA 4BR2A 1DEJA 3DI6A 5F0XA 3TAPA 3P38A 3UKUA 4CZIA 3K5MA 5FPNA 3THXB 1QVFM 3U3GA 2FBYA 4FWRA 4CJ7A 3VQ4A 3OYGA 2VQFK 1D8YA 3LZJA 3VTIA 4CJWA 3VQBA 1WSGA 1BI4A 1KXPA 4ELTA 4L3QA 4W5QA 3DLEA 3VQ7A 1NKCA 4KTWA 1Y64A 4JI6K 4KH4A 5C42A 4AHVA 4CZEA 1VQKN 4BRGA 4DR5K 2HHXA 1N6QA 3MXMA 1D9DA 1P90A 3TAGA 3OJSA 2OPQA 2EHGA 1LWFA 3QINA 4YORA 4UQGA 3C0BA 4AM7A 4YOUA 3K58A 5LY3A 4IJAA 1RTIA 3A5LC 4E19A 1JLAA 1NKEA 4M7XA 4A2AA 5J2PA 3BUZB 1UA1A 4CJUA 1EO1A 2D0AA 4CZKA 3U8XA 1QSLA 4CBWA 4BWMA 1VQ5N 1WAFA 3QBXA 4ZTFA 4MLEA 1X9SA 1BA1A 1BCOA 4M7YA 3ZSZA 5M1OA 4IG3A 4FWLA 2O8BA 3CJBA 3CQYA 4ISFA 4BE1A 3CJ9A 3HOSA 4FK4A 2RN2A 3T1HK 4MO4A 3IKMA 2XHBA 2VQEK 2R7YA 4DF8A 4DTXA 1JCEA 3O1WA 3D45A 4JKFA 5AQSA 3P83D 3SBTA 1U49A 3L2RA 4BRDA 1K9MO 1ZXOA 3RVCA 3RTVA 4B8AB 3ZSOA 1DT9A 4C1NI 3JYTA 3MEGA 1Q81O 2QTDA 1OH6A 3SBGA 3MEDA 2Z1JA 5BRFA 2E8AA 4FWSA 3VN5A 3OYMA 3THXA 4B9TA 3KK7A 3WNHA 4EAHD 3SYZA 2YCHA 1BA0A 4IFEA 3K9JA 2UUAK 1KFSA 1RTHA 3ALYA 3H1QA 3DRSA 3CJCA 1QE1A 1NK7A 1LAWA 4JI7K 3QO9A 3P1GA 2NNWA 4BR7A 5JS2A 1NGJA 1NG9A 1NOZA 1U45A 2XO7A 3PY8A 5ADXA 2P9IB 3OS0A 1W2BM 4FZZA 1X9MA 2FXUA 1Q7YO 4UY8O 3F73A 3AA4A 4CIGA 1S1UA 3KKSA 2Q0RA 3VEWA 3TTFA 3NH2A 4BR5A 5C2DA 2ZM6K 2A41A 3SV3A 1RDAA 4NYNA 4WQ4C 5I42A 5AFUA 2QK9A 5CYMA 4RW8A 4EFHA 3QEIA 3RMAA 2YX6A 4H5WA 2JLEA 1SL2A 2OZMA 2HHSA 2D0CA 1RNHA 4J2BA 1XNRK 2YJEA 4DR1K 5CY4A 2YHWA 1S6PA 5KGXA 4E7LA 1TKXA 5AQZA 4BRQA 5C10A 1J53A 5KRTA 1WB9A 3QERA 3DAWA 4BC2A 2NRZA 3VQ8A 5AQIA 3ISNC 3OVNA 1IKYA 3BF3A 1U47A 3AGKA 1TK8A 3SUPA 3CXCM 4CBXA 3PLAA 1RFQA 2NRWA 4I2PA 3ZSRA 4HHTA 5AZIB 2G8WA 4DWIA 4CD1A 4DG1A 1K8KA 1TV6A 3G6EN 4DV5K 3MWTA 4CEOA 3HI0A 1RTDA 1VSKA 1XUPO 1KLMA 1NU0A 4A2BA 4DU4A 4FCYA 4FJIA 2UYTA 3HYFA 1ZYQA 2G8FA 1NGCA 3EEQA 1GLEG 4YOTA 3T1YK 4CHNA 1WAJA 1IKWA 3ZSYA 2KQ2A 4M3TA 4BRPA 2WUSA 3O3HA 4B9UA 1A5VA 2P9IA 1RBVA 1MDUB 2IOCA 4BE2A 4DTNA 2DPNA 3VMFB 4DMNA 5AQLA 2GUPA 4H0YB 3KTQA 1P8ZA 4A62A 4DQRA 3T7ZA 5AQOA 3K5LA 2WOMA 4OKEA 1SKRA 2EWSA 3VETA 1MWKA 1CXQA 1NMNA 1TKZA 4B3SK 4H5VA 4KBOA 4H5RA 3BEXA 4YY3K 4DSIA 2FSJA 4FJ8A 1BIZA 2HW3A 2P9KB 3VGKA 3D0PA 1KLNA 4CF8A 4KPYA 5AQVA 3VA0A 5CZ1A 3GL1A 2BE2A 5EX5A 4CZLA 1S22A 2ZF5O 1CZAN 1HKCA 1SL1A 4CJLA 3IDHA 3TAFA 1YJWN 4IBNA 2PYLA 3ZLJA 3O9UA 1JKHA 4LH5A 2PBDA 3DXKB 4B9MA 2E2PA 1YTUA 2P9PB 3VERA 1I39A 2HBMA 4RW6A 1HNVA 4IDKA 4JKDA 4O8UA 2ZJQL 5AZIA 1VQLN 4LF7K 1RDUA 1VQ9N 3LANA 4B3TK 5TKYA 2IAJA 3A5NC 4YOVA 3BF1A 2E5LK 3E9LA 1U6ZA 4R5PA 3O4WA 3CF5L 4FK0A 4DTRA 4GV3A 3HSTB 5C15A 4C23A 3VQCA 3HSCA 2HNZA 5T7BA 3RMDA 4HCBA 4M3UA 4OGCA 2KFZA 1HNIA 3PX4A 4O55A 4E7KA 2OPPA 3MN9A 4FM2A 3V9XA 2VCPA 2E1ZA 3VEXA 3Q7BA 1NKBA 3AA3A 5DM7L 2A1SA 5H1SQ 2DFEA 1Q9YA 4FLVA 4JI5K 2FBXA 3T69A 1HQEA 5K14A 4J2EA 2XY7A 2YHAA 3MXJA 5C0YA 3SPZA 2GTDA 4JEPA 4LSNA 2P9KA 3VEVA 1YTAA 2JGUA 4CJVA 4WFBL 4E7IA 4KB1A 4AHCA 3G71N 1B9DA 1B9FA 4B9NA 3WNFA 4K8ZA 4JYAK 1GLFO 3WXMB 3AVNA 1NLVA 4FLUA 3ZSQA 3VQEA 2YNFA 4XH5A 1OH8A 2P9PA 2YKMA 3U9ZA 4A5BA 4DV4K 3MECA 2KHOA 3IG1A 1I3AA 4M63C 4DFMA 1NOYA 4IEIA 4FWQA 4E1MA 1OH5A 3V9UA 2FBTA 4FPAA 5ADXH 1TUUA 2D4WA 5LL6Z 3AVIA 3SZ2A 4Z4IA 1RT1A 2QA4N 3QESA 1NJYA 3J80O 1NBWA 4LH4A 1WUAA 2ZQBA 3OW2M 2YJFA 4OO1J 2GEMA 3OYAA 5LJWA 4LSLA 4LF8K 4CGDA 3E9PA 5AFUH 2O8EB 3ITHA 2HNYA 3L2QA 4CCHA 1LWCA 2YNIA 4CK1A 4HUGA 1NJZA 4FWKA 4BWJA 4BY9C 1ATRA 4H4MA 2CGLA 3SMSA 3TSQA 2OA8A 1OVQA 1JXEA 4DUZK 3DJCA 1MA9B 1S1XA 3WEEA 5IWAK 2V52B 3I33A 4FSVA 3CG7A 5EXWA 2QEXN 4O5FA 4FZYA 3SK3A 3V6DA 4B3MK 1BISA 4JK7A 3CC4N 3SCXA 3PUFA 4FWNA 4JN4A 4KH6A 5C2FA 1GOAA 3LWLA 3NBPA 1WNSA 4GV6A 2HNDA 4CEFA 2Q0UA 4CJPA 4DFKA 1RDBA 4KTZA 5AQNA 4CHZA 1XNQK 3I8BA 3VESA 3QDKA 4I2QA 3V9ZA 5FROA 3WXIA 1ZBSA 3V81A 4EIAA 4JS5A 4OLBA
chains in the Genus database with same CATH topology
1QQCA 1C0UA 3DLEA 3VQ7A 1NKCA 3HK2A 4KTWA 3RMCA 3KIOA 1XHZA 5KI6A 2X78A 5C42A 3DLRA 4IG0A 4AHVA 2NUBA 4KI4A 1N6QA 3MXMA 1D9DA 1VSHA 2HHXA 2BDPA 4C8NA 4CJEA 1TAUA 3TAGA 4KTQA 3AO1A 3MXIA 3OJSA 2OPQA 4Q0BA 4FJ7A 2EHGA 1LWFA 1C6VA 3QINA 4UQGA 4Q5VA 2KZZA 2HHWA 3ZT1A 4FJGA 3OYBA 3AVLA 3K58A 4GW6A 1RTIA 3KLFA 1ASWA 2O4GA 3M8QA 4E19A 1U4BA 1KRPA 1VSEA 2HB5A 3ZT0A 1JLAA 4LY7A 4FM1A 3SUOA 1NKEA 3OYKA 4M3ZA 3VQPA 4F3OA 5HBMA 5J2PA 3B6OA 1QHTA 4DTOA 3H08A 1JXBA 1XHXA 2GUIA 4FW1A 1W0HA 1JL1A 1UA1A 1S1VA 4CJUA 1DLOA 1RDCA 5CZ2A 2D0AA 4W5OA 4HCCA 4CEDA 2HHQA 1EKEA 1QSLA 4BWMA 4FJXA 1WAFA 2DFHA 4FZXC 1VK0A 4ZTFA 2VG7A 1X9SA 3DYAA 3SUNA 4FJ5A 1L5UA 3HP9A 2KTQA 3BDPA 2VWKA 3NH0A 3L2VA 3VQQA 1BCOA 3KLIA 4CK3A 4FLYA 1CXUA 3AVCA 1FK9A 1HQUA 3ZSZA 2Y1IA 3PX0A 1IG9A 5SWMA 4IG3A 4Y1DA 2G8VA 2XRIA 4BE1A 3ZSVA 1EX4A 3L3VA 4FK4A 1RBTA 1QSYA 4Z4EA 1L3TA 3K5OA 1EXQA 3AO2A 3ZSXA 3RRGA 4L8RB 1ZBHA 3OYNA 2DY4A 2RN2A 3G10A 4CEAA 2I5JA 2XHBA 1Q9XA 2R7YA 4DF8A 3NDKA 4ICLA 1RT5A 4TSXA 3T19A 3OYDA 3TR8A 4DTXA 2F8SA 4FYDA 3AVMA 5HRSA 4BDYA 3D45A 3QNOA 3LP1A 3G0ZA 1NK0A 4NCBA 3M8PA 4DTMA 4CERA 1QS4A 4CESA 1TVRA 4JLHA 1HRHA 3P83D 1U49A 4DQPA 4EP5A 3L2RA 2EX3A 2YNGA 3U6FA 4CFDA 2DTUA 3RTVA 3PV8A 4B8AB 1CZ9A 2HMIA 3ZSOA 3JYTA 3MEGA 4DLGA 5HP1A 4DQSA 4CK2A 3TABA 3MEDA 2Z1JA 3OYMA 3VN5A 2XY8A 4B9TA 4DQIA 1CZBA 3WNHA 4KHNA 5HRNA 3QIOA 2Q3SA 4FLZA 3SYZA 1VSFA 1U48A 1IO2A 4AHUA 4EZ9A 1F21A 1JLCA 3TWHA 1D9FA 3I8DA 1KFSA 3LALA 1RTHA 3ALYA 3DRSA 3L3UA 3PX6A 4Z4FA 1WSFA 3RR7A 2KZMA 1QE1A 1HYSA 4DSKA 3RRHA 1VSIA 3SPYA 1LAWA 1NK7A 1FKPA 3KLEA 4FJ9A 4JRQA 4N76A 3QLHA 3KLGA 3QO9A 3P1GA 3ZSWA 2VG6A 1JLEA 1WSEA 4WE1A 4FK2A 5JS2A 4KHYA 5KRSA 3TAQA 1NOZA 3DM2A 1YT3A 5HRRA 1U45A 1TKDA 2XO7A 4RW9A 2RPIA 3PY8A 1LWEA 2OPRA 1FKOA 1L3SA 1TL3A 4C8OA 3OS0A 4E7HA 1WSJA 3I0SA 3NAEA 4FZZA 4B9SA 4FJLA 1QSSA 1X9MA 4CJTA 1VSLA 3S3NA 4I9LA 4CF9A 3F73A 3QETA 3AA4A 4CIGA 1S1UA 3OYCA 1WSHA 3KKSA 4B08A 4DTSA 3LP0A 3NH2A 1S1WA 3UIQA 1IH7A 1TL1A 1RDAA 3AVFA 4NYNA 3SV3A 5I42A 1SL0A 4BDPA 4KAZA 2QK9A 4PY5A 1VRUA 5CYMA 3ZT3A 1A5WA 4RW8A 4DU1A 3QEIA 3RMAA 3DMJA 4CJRA 1C0MA 2IS3A 2JLEA 3EY1A 1SL2A 2OZMA 4CFAA 3OYEA 2HHSA 2D0CA 1RNHA 2ZE2A 4DS5A 4J2BA 3KK2A 4DSJA 4FJHA 1KVCA 5CY4A 1IKVA 3VQAA 4HUEA 1S6PA 4DTJA 4DTUA 5KGXA 4E7LA 2Z1GA 5D3GA 4CGIA 1TKXA 3K57A 4KO0A 4CGJA 3RMBA 4B9VA 3NCIA 1J53A 5KRTA 2VWJA 3OY9A 3QERA 1J54A 2YKNA 4CEBA 4C8MA 3PO4A 3S3MA 3NGIA 3CM5A 2ATQA 3SUQA 4KI6A 3VQ8A 4OPJA 3ISNC 3OVNA 1IKYA 2IGIA 3OYLA 3V4IA 1U47A 3HXMA 1TK8A 4I7FA 2OYQA 4KHWA 3SUPA 4ELVA 5FRMA 2AJQA 3PO5A 4FW2A 4HUFA 4FLTA 3TAMA 4M42A 1KFDA 2KFNA 3B6PA 3SQ0A 3EYZA 4Z4GA 4I2PA 3ZSRA 4HHTA 2G8WA 4DWIA 2X74A 2B5JA 3QEXA 4DG1A 3C95A 4CHYA 3CM6A 1TV6A 1W9HA 3KJVA 5J2QA 1BQNA 4O5BA 3V1QA 3K59A 1S6QA 2E6LA 4LD0A 2IDOA 1NK6A 1ZBLA 4FJMA 4QCLA 1ZBFA 4OKJA 1LAVA 2BGGA 1O1WA 4PWDA 4B8CA 1HPZA 4CEOA 4ZHRA 4JS4A 5FRNA 4KHQA 4OJRA 5E41A 4FVMA 1VSKA 1RTDA 3DLKA 1KLMA 3T1AA 3NE6A 3SJJA 3NF7A 1SKWA 2G8HA 1K6YA 1LW0A 3OYIA 1XI1A 4ELUA 3HPGA 4FJKA 1ITGA 4DU4A 2X6SA 4FCYA 1Q8IA 4CFBA 4CHQA 3HYFA 4FJIA 1S9GA 2HVHA 4W5RA 1ZYQA 2G8FA 4J2AA 3F9KA 3O3GA 4KKOA 3V1OA 1ASUA 1TGOA 4M41A 4CHNA 1WAJA 1IKWA 3VQ6A 3ZSYA 2KQ2A 4M3TA 4GVMA 4OKKA 4GMJB 4OGEA 4NCAA 3O3HA 4B9UA 1A5VA 4K8XA 1BI4B 1RBVA 1SKSA 1JLGA 2IOCA 2P51A 1RT6A 1DTQA 3AVGA 4BE2A 4DTNA 3V9SA 5JS1A 3ZCMA 2RF2A 4DMNA 4E7JA 5KGWA 3KTQA 3CFOA 3DLGA 4JS5A 3FFIA 3LAMA 1NK4A 4DQRA 3HVTA 3K2PA 4CJKA 3SV4A 4E1NA 3KD1E 1RT4A 3K5LA 1WLJA 2WOMA 1RCHA 4OKEA 1SKRA 1RT7A 2QKKA 1NK9A 2F8TA 1CXQA 4NCGA 1TKZA 2IC3A 4FJJA 4B3OA 4CIFA 1C1AA 2Z1HA 1NK5A 4F4KA 4DSIA 2D0BA 3QEVA 1TK5A 4FJ8A 1BIZA 2HW3A 1KVBA 3D0PA 1KLNA 4CF8A 4F2SA 2X6NA 3THVA 4KPYA 4DS4A 1YVUA 5C25A 1LW2A 1VRTA 1BHLA 3VA0A 1RDDA 1VSMA 4O4GA 4O44A 3AV9A 5CZ1A 2BE2A 4CECA 4DLEA 4H8KA 3QEPA 2YNHA 4CF0A 2D5RA 2QXFA 1HJRA 4DTPA 4KHSA 2HHUA 3OJUA 3AO4A 1SL1A 3KKRA 4CJLA 4IFVA 1ZBUA 3NHGA 3TAFA 4Z4CA 4IBNA 2PYLA 1L3UA 4LH5A 1JKHA 4FJNA 3AO5A 3CYMA 4CEQA 1D5AA 4MQ3A 4CGHA 5SZTA 3OS1A 4B9MA 4HTUA 4ELTA 4KV8A 4DU3A 3AO3A 1YTUA 4DFJA 4M3RA 1BL3A 3U3YA 3HM9A 3AA2A 3MEEA 3HPOA 3TAEA 4QAGA 3BGRA 1I39A 1RTJA 4RW6A 1T03A 4E0DA 1HNVA 4IDKA 4HVJA 3LP2A 1VSJA 1BCMA 3CFPA 5J2MA 1S9EA 2VG5A 1IKXA 4ID1A 4EZ6A 4KREA 3PX4A 4KFBA 2KFZA 2GV9A 3LANA 3P5JA 3AVAA 1N5YA 2IAJA 4C8LA 3KK3A 2O4IA 3CQ8A 3AVJA 3TANA 1J5OA 3HL8A 4G1QA 5HRPA 4R5PA 4FLWA 3LPUA 4KB0A 3KK1A 3AVKA 3IAYA 1RT3A 3VQDA 4CGFA 1L3VA 2XY6A 4FK0A 3VA3A 4DTRA 3AA5X 1EETA 2FC0A 3HSTB 3O4NA 1T7PA 1X1PA 3VQCA 2E6MA 2HNZA 5T7BA 3RMDA 4M3WA 4BE0A 3MAQA 4M3XA 3O3FA 1HYZA 4HCBA 4Z4HA 2OPSA 5KTQA 2HVIA 2YV0X 4M3UA 1WSIA 4F3TA 4FXDA 3C6UA 4OGCA 4DSFA 4H4OA 1GOBA 1HNIA 4CJ5A 4CJ4A 2GBZA 1SUQA 3HT3A 4O55A 3V1RA 3QNNA 4E7KA 3S9HA 2G8KA 2PY5A 3NFAA 2OPPA 3DLHA 4FM2A 4CFCA 3V9XA 2FBVA 2P5GA 1UWBA 4RG8A 4RW7A 1C0TA 3VQ5A 3T3FA 1NKBA 3AA3A 1GOCA 1UAXA 3QEWA 2YHBA 3HVRA 1WN7A 2A1SA 2WONA 4CHOA 2G8UA 4YFUA 2DFEA 1DTTA 1Q9YA 1RBRA 4FLVA 5J2NA 3E01A 1ZBIA 1BQMA 2FBXA 4PQUA 3OYJA 1HQEA 5K14A 4J2EA 4AHSA 3SQ2A 2Z1IA 1C1CA 2XY7A 3C94A 1KVAA 4CGGA 2YHAA 3LZIA 2ZD1A 1RBSA 3MXJA 3I0RA 4N47A 4B9LA 1RILA 2KW4A 4Y1CA 3L2WA 2ITGA 3SPZA 1S5JA 4LSNA 3NH1A 4CJVA 1ASVA 1YTAA 2JGUA 3LWMA 4E7IA 4KB1A 4PA1A 4AHTA 4AHCA 3DRRA 1B9DA 4CEEA 1NJWA 3RWUA 4W5NA 4AHRA 1EP4A 2A1RA 5C24A 4M3YA 3NF8A 1B9FA 4IFYA 3WNFA 4B9NA 4IKFA 4K8ZA 4KHUA 4ID5A 4Z0UA 3LPTA 4E89A 4PUOA 4J2DA 3M8SA 3SQ1A 5HROA 5CYQA 4FLXA 3QIPA 3AVNA 4CF1A 4CJ3A 1XC9A 4I9QA 4F8RA 3RR8A 4FLUA 3ZSQA 3SI6A 3VQEA 1XWLA 3JSMA 2YNFA 4XIUA 4M45A 2YKMA 3EZ5A 3TARA 1QTMA 4OLAA 3NGZA 3MECA 3ZT2A 2W42A 3IG1A 4AILC 4F2RA 1I3AA 4DFMA 4N5SA 1NOYA 3M8RA 2BANA 2B6AA 1G15A 4E1MA 1BGXT 1KCFA 4O0IA 2DFFA 1JLFA 5EU7A 2P5OA 4QOZB 4DQQA 1Z26A 2FBTA 3V9UA 3L8BA 4O0JA 1T8EA 4W5TA 3TI0A 4DFPA 1FXXA 4CE9A 1KSPA 1KTQA 3C6TA 5DK5A 4BDZA 1S1TA 1A5XA 1TAQA 3WNEA 4CHPA 4N41A 2HHTA 3AVIA 4CIEA 3SZ2A 3ULDA 4Z4IA 1RT1A 2QKBA 3AVBA 3QESA 1UA0A 1NJYA 4CJQA 3OYHA 4LH4A 2ZQBA 4CJFA 1T05A 5FDLA 1BIUA 2OZSA 3IS9A 3A2FA 3OYAA 4DSLA 1TK0A 3O4QA 4FM0A 1X9WA 2HHVA 1MU2A 4LSLA 1CLQA 3HPHA 3HP6A 4CEZA 1RBUA 1Z25A 4CGDA 3ITHA 2HNYA 4CF2A 1R0AA 2B4JA 3L2QA 1TKTA 2LSNA 3S3OA 1J9AA 3OYFA 4CCHA 1LWCA 2YNIA 4CK1A 4HUGA 4DF4A 1NJZA 4ZTJA 3AVHA 4E3SA 5HLFA 4C8KA 3HJFA 4MFBA 4BWJA 3NF9A 3VQ9A 1HMVA 4H4MA 4DSEA 1LV5A 5J1EA 3ZT4A 1U04A 4OVLA 1VSDA 4OPKA 3KD5E 2F96A 3NGYA 4NYFA 2OA8A 3K5NA 1NJXA 3L2UA 2PYJA 1JLBA 1JXEA 4RW4A 3OS2A 1S1XA 3SQ4A 3NF6A 4AH9A 2RKIA 1RT2A 3DOLA 3LDSA 3CG7A 4EP4A 3SNNA 4FZYA 3V9WA 3V6DA 3ASMA 4YNQA 1JL2A 2ETJA 2PZSA 1BISA 3LP3A 2G8IA 1REVA 1B92A 4N56A 3SCXA 3PUFA 1NK8A 4KRFA 3LAKA 3DLBA 5I3UA 2E4LA 3HO1A 4CJSA 4JRPA 5DMRA 2P1JA 1GOAA 3LWLA 3DI6A 1Y97A 3NBPA 4BACA 3DRPA 3TAPA 1WNSA 3K5MA 3DOKA 2HNDA 3WNGA 4CEFA 4CJPA 3U3GA 2FBYA 4DFKA 1RDBA 3KLHA 3VQ4A 3OYGA 4KTZA 4CHZA 1D8YA 3LZJA 1SV5A 1UOCA 1JLQA 4I2QA 3IRXA 3V9ZA 5FROA 4CJWA 3CFRA 1C1BA 1HYVA 3VQBA 3V81A 2Y1JA 1WSGA 1BI4A 4W5QA 2XY5A 4OLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QQC A;  1C0U A;  3DLE A;  3VQ7 A;  1NKC A;  3HK2 A;  4KTW A;  3RMC A;  3KIO A;  1XHZ A;  5KI6 A;  2X78 A;  5C42 A;  3DLR A;  4IG0 A;  4AHV A;  2NUB A;  4KI4 A;  1N6Q A;  3MXM A;  1D9D A;  1VSH A;  2HHX A;  2BDP A;  4C8N A;  4CJE A;  1TAU A;  3TAG A;  4KTQ A;  3AO1 A;  3MXI A;  3OJS A;  2OPQ A;  4Q0B A;  4FJ7 A;  2EHG A;  1LWF A;  1C6V A;  3QIN A;  4UQG A;  4Q5V A;  2KZZ A;  2HHW A;  3ZT1 A;  4FJG A;  3OYB A;  3AVL A;  3K58 A;  4GW6 A;  1RTI A;  3KLF A;  1ASW A;  2O4G A;  3M8Q A;  4E19 A;  1U4B A;  1KRP A;  1VSE A;  2HB5 A;  3ZT0 A;  1JLA A;  4LY7 A;  4FM1 A;  3SUO A;  1NKE A;  3OYK A;  4M3Z A;  3VQP A;  4F3O A;  5HBM A;  5J2P A;  3B6O A;  1QHT A;  4DTO A;  3H08 A;  1JXB A;  1XHX A;  2GUI A;  4FW1 A;  1W0H A;  1JL1 A;  1UA1 A;  1S1V A;  4CJU A;  1DLO A;  1RDC A;  5CZ2 A;  2D0A A;  4W5O A;  4HCC A;  4CED A;  2HHQ A;  1EKE A;  1QSL A;  4BWM A;  4FJX A;  1WAF A;  2DFH A;  4FZX C;  1VK0 A;  4ZTF A;  2VG7 A;  1X9S A;  3DYA A;  3SUN A;  4FJ5 A;  1L5U A;  3HP9 A;  2KTQ A;  3BDP A;  2VWK A;  3NH0 A;  3L2V A;  3VQQ A;  1BCO A;  3KLI A;  4CK3 A;  4FLY A;  1CXU A;  3AVC A;  1FK9 A;  1HQU A;  3ZSZ A;  2Y1I A;  3PX0 A;  1IG9 A;  5SWM A;  4IG3 A;  4Y1D A;  2G8V A;  2XRI A;  4BE1 A;  3ZSV A;  1EX4 A;  3L3V A;  4FK4 A;  1RBT A;  1QSY A;  4Z4E A;  1L3T A;  3K5O A;  1EXQ A;  3AO2 A;  3ZSX A;  3RRG A;  4L8R B;  1ZBH A;  3OYN A;  2DY4 A;  2RN2 A;  3G10 A;  4CEA A;  2I5J A;  2XHB A;  1Q9X A;  2R7Y A;  4DF8 A;  3NDK A;  4ICL A;  1RT5 A;  4TSX A;  3T19 A;  3OYD A;  3TR8 A;  4DTX A;  2F8S A;  4FYD A;  3AVM A;  5HRS A;  4BDY A;  3D45 A;  3QNO A;  3LP1 A;  3G0Z A;  1NK0 A;  4NCB A;  3M8P A;  4DTM A;  4CER A;  1QS4 A;  4CES A;  1TVR A;  4JLH A;  1HRH A;  3P83 D;  1U49 A;  4DQP A;  4EP5 A;  3L2R A;  2EX3 A;  2YNG A;  3U6F A;  4CFD A;  2DTU A;  3RTV A;  3PV8 A;  4B8A B;  1CZ9 A;  2HMI A;  3ZSO A;  3JYT A;  3MEG A;  4DLG A;  5HP1 A;  4DQS A;  4CK2 A;  3TAB A;  3MED A;  2Z1J A;  3OYM A;  3VN5 A;  2XY8 A;  4B9T A;  4DQI A;  1CZB A;  3WNH A;  4KHN A;  5HRN A;  3QIO A;  2Q3S A;  4FLZ A;  3SYZ A;  1VSF A;  1U48 A;  1IO2 A;  4AHU A;  4EZ9 A;  1F21 A;  1JLC A;  3TWH A;  1D9F A;  3I8D A;  1KFS A;  3LAL A;  1RTH A;  3ALY A;  3DRS A;  3L3U A;  3PX6 A;  4Z4F A;  1WSF A;  3RR7 A;  2KZM A;  1QE1 A;  1HYS A;  4DSK A;  3RRH A;  1VSI A;  3SPY A;  1LAW A;  1NK7 A;  1FKP A;  3KLE A;  4FJ9 A;  4JRQ A;  4N76 A;  3QLH A;  3KLG A;  3QO9 A;  3P1G A;  3ZSW A;  2VG6 A;  1JLE A;  1WSE A;  4WE1 A;  4FK2 A;  5JS2 A;  4KHY A;  5KRS A;  3TAQ A;  1NOZ A;  3DM2 A;  1YT3 A;  5HRR A;  1U45 A;  1TKD A;  2XO7 A;  4RW9 A;  2RPI A;  3PY8 A;  1LWE A;  2OPR A;  1FKO A;  1L3S A;  1TL3 A;  4C8O A;  3OS0 A;  4E7H A;  1WSJ A;  3I0S A;  3NAE A;  4FZZ A;  4B9S A;  4FJL A;  1QSS A;  1X9M A;  4CJT A;  1VSL A;  3S3N A;  4I9L A;  4CF9 A;  3F73 A;  3QET A;  3AA4 A;  4CIG A;  1S1U A;  3OYC A;  1WSH A;  3KKS A;  4B08 A;  4DTS A;  3LP0 A;  3NH2 A;  1S1W A;  3UIQ A;  1IH7 A;  1TL1 A;  1RDA A;  3AVF A;  4NYN A;  3SV3 A;  5I42 A;  1SL0 A;  4BDP A;  4KAZ A;  2QK9 A;  4PY5 A;  1VRU A;  5CYM A;  3ZT3 A;  1A5W A;  4RW8 A;  4DU1 A;  3QEI A;  3RMA A;  3DMJ A;  4CJR A;  1C0M A;  2IS3 A;  2JLE A;  3EY1 A;  1SL2 A;  2OZM A;  4CFA A;  3OYE A;  2HHS A;  2D0C A;  1RNH A;  2ZE2 A;  4DS5 A;  4J2B A;  3KK2 A;  4DSJ A;  4FJH A;  1KVC A;  5CY4 A;  1IKV A;  3VQA A;  4HUE A;  1S6P A;  4DTJ A;  4DTU A;  5KGX A;  4E7L A;  2Z1G A;  5D3G A;  4CGI A;  1TKX A;  3K57 A;  4KO0 A;  4CGJ A;  3RMB A;  4B9V A;  3NCI A;  1J53 A;  5KRT A;  2VWJ A;  3OY9 A;  3QER A;  1J54 A;  2YKN A;  4CEB A;  4C8M A;  3PO4 A;  3S3M A;  3NGI A;  3CM5 A;  2ATQ A;  3SUQ A;  4KI6 A;  3VQ8 A;  4OPJ A;  3ISN C;  3OVN A;  1IKY A;  2IGI A;  3OYL A;  3V4I A;  1U47 A;  3HXM A;  1TK8 A;  4I7F A;  2OYQ A;  4KHW A;  3SUP A;  4ELV A;  5FRM A;  2AJQ A;  3PO5 A;  4FW2 A;  4HUF A;  4FLT A;  3TAM A;  4M42 A;  1KFD A;  2KFN A;  3B6P A;  3SQ0 A;  3EYZ A;  4Z4G A;  4I2P A;  3ZSR A;  4HHT A;  2G8W A;  4DWI A;  2X74 A;  2B5J A;  3QEX A;  4DG1 A;  3C95 A;  4CHY A;  3CM6 A;  1TV6 A;  1W9H A;  3KJV A;  5J2Q A;  1BQN A;  4O5B A;  3V1Q A;  3K59 A;  1S6Q A;  2E6L A;  4LD0 A;  2IDO A;  1NK6 A;  1ZBL A;  4FJM A;  4QCL A;  1ZBF A;  4OKJ A;  1LAV A;  2BGG A;  1O1W A;  4PWD A;  4B8C A;  1HPZ A;  4CEO A;  4ZHR A;  4JS4 A;  5FRN A;  4KHQ A;  4OJR A;  5E41 A;  4FVM A;  1VSK A;  1RTD A;  3DLK A;  1KLM A;  3T1A A;  3NE6 A;  3SJJ A;  3NF7 A;  1SKW A;  2G8H A;  1K6Y A;  1LW0 A;  3OYI A;  1XI1 A;  4ELU A;  3HPG A;  4FJK A;  1ITG A;  4DU4 A;  2X6S A;  4FCY A;  1Q8I A;  4CFB A;  4CHQ A;  3HYF A;  4FJI A;  1S9G A;  2HVH A;  4W5R A;  1ZYQ A;  2G8F A;  4J2A A;  3F9K A;  3O3G A;  4KKO A;  3V1O A;  1ASU A;  1TGO A;  4M41 A;  4CHN A;  1WAJ A;  1IKW A;  3VQ6 A;  3ZSY A;  2KQ2 A;  4M3T A;  4GVM A;  4OKK A;  4GMJ B;  4OGE A;  4NCA A;  3O3H A;  4B9U A;  1A5V A;  4K8X A;  1BI4 B;  1RBV A;  1SKS A;  1JLG A;  2IOC A;  2P51 A;  1RT6 A;  1DTQ A;  3AVG A;  4BE2 A;  4DTN A;  3V9S A;  5JS1 A;  3ZCM A;  2RF2 A;  4DMN A;  4E7J A;  5KGW A;  3KTQ A;  3CFO A;  3DLG A;  4JS5 A;  3FFI A;  3LAM A;  1NK4 A;  4DQR A;  3HVT A;  3K2P A;  4CJK A;  3SV4 A;  4E1N A;  3KD1 E;  1RT4 A;  3K5L A;  1WLJ A;  2WOM A;  1RCH A;  4OKE A;  1SKR A;  1RT7 A;  2QKK A;  1NK9 A;  2F8T A;  1CXQ A;  4NCG A;  1TKZ A;  2IC3 A;  4FJJ A;  4B3O A;  4CIF A;  1C1A A;  2Z1H A;  1NK5 A;  4F4K A;  4DSI A;  2D0B A;  3QEV A;  1TK5 A;  4FJ8 A;  1BIZ A;  2HW3 A;  1KVB A;  3D0P A;  1KLN A;  4CF8 A;  4F2S A;  2X6N A;  3THV A;  4KPY A;  4DS4 A;  1YVU A;  5C25 A;  1LW2 A;  1VRT A;  1BHL A;  3VA0 A;  1RDD A;  1VSM A;  4O4G A;  4O44 A;  3AV9 A;  5CZ1 A;  2BE2 A;  4CEC A;  4DLE A;  4H8K A;  3QEP A;  2YNH A;  4CF0 A;  2D5R A;  2QXF A;  1HJR A;  4DTP A;  4KHS A;  2HHU A;  3OJU A;  3AO4 A;  1SL1 A;  3KKR A;  4CJL A;  4IFV A;  1ZBU A;  3NHG A;  3TAF A;  4Z4C A;  4IBN A;  2PYL A;  1L3U A;  4LH5 A;  1JKH A;  4FJN A;  3AO5 A;  3CYM A;  4CEQ A;  1D5A A;  4MQ3 A;  4CGH A;  5SZT A;  3OS1 A;  4B9M A;  4HTU A;  4ELT A;  4KV8 A;  4DU3 A;  3AO3 A;  1YTU A;  4DFJ A;  4M3R A;  1BL3 A;  3U3Y A;  3HM9 A;  3AA2 A;  3MEE A;  3HPO A;  3TAE A;  4QAG A;  3BGR A;  1I39 A;  1RTJ A;  4RW6 A;  1T03 A;  4E0D A;  1HNV A;  4IDK A;  4HVJ A;  3LP2 A;  1VSJ A;  1BCM A;  3CFP A;  5J2M A;  1S9E A;  2VG5 A;  1IKX A;  4ID1 A;  4EZ6 A;  4KRE A;  3PX4 A;  4KFB A;  2KFZ A;  2GV9 A;  3LAN A;  3P5J A;  3AVA A;  1N5Y A;  2IAJ A;  4C8L A;  3KK3 A;  2O4I A;  3CQ8 A;  3AVJ A;  3TAN A;  1J5O A;  3HL8 A;  4G1Q A;  5HRP A;  4R5P A;  4FLW A;  3LPU A;  4KB0 A;  3KK1 A;  3AVK A;  3IAY A;  1RT3 A;  3VQD A;  4CGF A;  1L3V A;  2XY6 A;  4FK0 A;  3VA3 A;  4DTR A;  3AA5 X;  1EET A;  2FC0 A;  3HST B;  3O4N A;  1T7P A;  1X1P A;  3VQC A;  2E6M A;  2HNZ A;  5T7B A;  3RMD A;  4M3W A;  4BE0 A;  3MAQ A;  4M3X A;  3O3F A;  1HYZ A;  4HCB A;  4Z4H A;  2OPS A;  5KTQ A;  2HVI A;  2YV0 X;  4M3U A;  1WSI A;  4F3T A;  4FXD A;  3C6U A;  4OGC A;  4DSF A;  4H4O A;  1GOB A;  1HNI A;  4CJ5 A;  4CJ4 A;  2GBZ A;  1SUQ A;  3HT3 A;  4O55 A;  3V1R A;  3QNN A;  4E7K A;  3S9H A;  2G8K A;  2PY5 A;  3NFA A;  2OPP A;  3DLH A;  4FM2 A;  4CFC A;  3V9X A;  2FBV A;  2P5G A;  1UWB A;  4RG8 A;  4RW7 A;  1C0T A;  3VQ5 A;  3T3F A;  1NKB A;  3AA3 A;  1GOC A;  1UAX A;  3QEW A;  2YHB A;  3HVR A;  1WN7 A;  2A1S A;  2WON A;  4CHO A;  2G8U A;  4YFU A;  2DFE A;  1DTT A;  1Q9Y A;  1RBR A;  4FLV A;  5J2N A;  3E01 A;  1ZBI A;  1BQM A;  2FBX A;  4PQU A;  3OYJ A;  1HQE A;  5K14 A;  4J2E A;  4AHS A;  3SQ2 A;  2Z1I A;  1C1C A;  2XY7 A;  3C94 A;  1KVA A;  4CGG A;  2YHA A;  3LZI A;  2ZD1 A;  1RBS A;  3MXJ A;  3I0R A;  4N47 A;  4B9L A;  1RIL A;  2KW4 A;  4Y1C A;  3L2W A;  2ITG A;  3SPZ A;  1S5J A;  4LSN A;  3NH1 A;  4CJV A;  1ASV A;  1YTA A;  2JGU A;  3LWM A;  4E7I A;  4KB1 A;  4PA1 A;  4AHT A;  4AHC A;  3DRR A;  1B9D A;  4CEE A;  1NJW A;  3RWU A;  4W5N A;  4AHR A;  1EP4 A;  2A1R A;  5C24 A;  4M3Y A;  3NF8 A;  1B9F A;  4IFY A;  3WNF A;  4B9N A;  4IKF A;  4K8Z A;  4KHU A;  4ID5 A;  4Z0U A;  3LPT A;  4E89 A;  4PUO A;  4J2D A;  3M8S A;  3SQ1 A;  5HRO A;  5CYQ A;  4FLX A;  3QIP A;  3AVN A;  4CF1 A;  4CJ3 A;  1XC9 A;  4I9Q A;  4F8R A;  3RR8 A;  4FLU A;  3ZSQ A;  3SI6 A;  3VQE A;  1XWL A;  3JSM A;  2YNF A;  4XIU A;  4M45 A;  2YKM A;  3EZ5 A;  3TAR A;  1QTM A;  4OLA A;  3NGZ A;  3MEC A;  3ZT2 A;  2W42 A;  3IG1 A;  4AIL C;  4F2R A;  1I3A A;  4DFM A;  4N5S A;  1NOY A;  3M8R A;  2BAN A;  2B6A A;  1G15 A;  4E1M A;  1BGX T;  1KCF A;  4O0I A;  2DFF A;  1JLF A;  5EU7 A;  2P5O A;  4QOZ B;  4DQQ A;  1Z26 A;  2FBT A;  3V9U A;  3L8B A;  4O0J A;  1T8E A;  4W5T A;  3TI0 A;  4DFP A;  1FXX A;  4CE9 A;  1KSP A;  1KTQ A;  3C6T A;  5DK5 A;  4BDZ A;  1S1T A;  1A5X A;  1TAQ A;  3WNE A;  4CHP A;  4N41 A;  2HHT A;  3AVI A;  4CIE A;  3SZ2 A;  3ULD A;  4Z4I A;  1RT1 A;  2QKB A;  3AVB A;  3QES A;  1UA0 A;  1NJY A;  4CJQ A;  3OYH A;  4LH4 A;  2ZQB A;  4CJF A;  1T05 A;  5FDL A;  1BIU A;  2OZS A;  3IS9 A;  3A2F A;  3OYA A;  4DSL A;  1TK0 A;  3O4Q A;  4FM0 A;  1X9W A;  2HHV A;  1MU2 A;  4LSL A;  1CLQ A;  3HPH A;  3HP6 A;  4CEZ A;  1RBU A;  1Z25 A;  4CGD A;  3ITH A;  2HNY A;  4CF2 A;  1R0A A;  2B4J A;  3L2Q A;  1TKT A;  2LSN A;  3S3O A;  1J9A A;  3OYF A;  4CCH A;  1LWC A;  2YNI A;  4CK1 A;  4HUG A;  4DF4 A;  1NJZ A;  4ZTJ A;  3AVH A;  4E3S A;  5HLF A;  4C8K A;  3HJF A;  4MFB A;  4BWJ A;  3NF9 A;  3VQ9 A;  1HMV A;  4H4M A;  4DSE A;  1LV5 A;  5J1E A;  3ZT4 A;  1U04 A;  4OVL A;  1VSD A;  4OPK A;  3KD5 E;  2F96 A;  3NGY A;  4NYF A;  2OA8 A;  3K5N A;  1NJX A;  3L2U A;  2PYJ A;  1JLB A;  1JXE A;  4RW4 A;  3OS2 A;  1S1X A;  3SQ4 A;  3NF6 A;  4AH9 A;  2RKI A;  1RT2 A;  3DOL A;  3LDS A;  3CG7 A;  4EP4 A;  3SNN A;  4FZY A;  3V9W A;  3V6D A;  3ASM A;  4YNQ A;  1JL2 A;  2ETJ A;  2PZS A;  1BIS A;  3LP3 A;  2G8I A;  1REV A;  1B92 A;  4N56 A;  3SCX A;  3PUF A;  1NK8 A;  4KRF A;  3LAK A;  3DLB A;  5I3U A;  2E4L A;  3HO1 A;  4CJS A;  4JRP A;  5DMR A;  2P1J A;  1GOA A;  3LWL A;  3DI6 A;  1Y97 A;  3NBP A;  4BAC A;  3DRP A;  3TAP A;  1WNS A;  3K5M A;  3DOK A;  2HND A;  3WNG A;  4CEF A;  4CJP A;  3U3G A;  2FBY A;  4DFK A;  1RDB A;  3KLH A;  3VQ4 A;  3OYG A;  4KTZ A;  4CHZ A;  1D8Y A;  3LZJ A;  1SV5 A;  1UOC A;  1JLQ A;  4I2Q A;  3IRX A;  3V9Z A;  5FRO A;  4CJW A;  3CFR A;  1C1B A;  1HYV A;  3VQB A;  3V81 A;  2Y1J A;  1WSG A;  1BI4 A;  4W5Q A;  2XY5 A;  4OLB A; 
#chains in the Genus database with same CATH topology
 4B3R K;  1C0U A;  4GV9 A;  3RMC A;  4ILJ A;  3KIO A;  1NGE A;  2X78 A;  4IG0 A;  3OBW A;  2UUB K;  3D7E O;  1VQ4 N;  1VSH A;  1K8A O;  4C8N A;  2UU9 K;  4QS9 A;  4Q5V A;  2KZZ A;  2HHW A;  4FJG A;  1HNZ K;  3KLF A;  3M8Q A;  3UE5 A;  3ZT0 A;  4WQ4 A;  3JXU A;  4V19 S;  4M3Z A;  3GG4 A;  5HBM A;  3B6O A;  1Q18 A;  4FW1 A;  1JXB A;  1XHX A;  3EE8 A;  4HWI A;  1JL1 A;  3PIP L;  3R1X A;  4PL7 A;  4FJX A;  3CPW M;  3NVK A;  2VG7 A;  1VQM N;  2O8E A;  3QB0 A;  3VGM A;  1XQS C;  3SUN A;  4FJ5 A;  1HNW K;  1L5U A;  2NRV A;  2KTQ A;  2OTL N;  3ZYY X;  3L2V A;  2PAV A;  1CXU A;  3H46 O;  2Y1I A;  1FK9 A;  1HQU A;  2O8F B;  1IG9 A;  5SWM A;  2G8V A;  2QM1 A;  3PIO L;  4BR4 A;  1EX4 A;  1RBT A;  1QSY A;  4Z4E A;  1L3T A;  1YXQ A;  3CHW A;  3K5O A;  4DHY A;  2VWB A;  5JVH L;  3OYN A;  3G10 A;  4U7B A;  3O9T A;  4JNE A;  3NDK A;  4ICL A;  1RT5 A;  2F8S A;  3OYD A;  5HRS A;  5AQW A;  3QNO A;  3LP1 A;  4CER A;  4CES A;  1TVR A;  4DQP A;  4BRF A;  4CFD A;  4BRK A;  5F2R A;  4H0X B;  4BRA A;  4CK2 A;  2W41 A;  2BUP A;  5HRN A;  3QIO A;  4FLZ A;  1VSF A;  4AHU A;  2E20 A;  3L6Q A;  3LAL A;  2Q97 A;  2WBN A;  2KZM A;  4DSK A;  3CME N;  4IEE A;  3O9Q A;  3ZSW A;  4PHT X;  4KHY A;  5CHI A;  2QWQ A;  5E84 A;  3WXK A;  2NRH A;  1TKD A;  3B8A X;  4XH1 A;  4K25 A;  4RW9 A;  2RPI A;  5AZJ A;  4HTL A;  2OPR A;  1FKO A;  2RHK A;  2GWJ A;  4BRH A;  1WSJ A;  3ZX3 A;  4CJT A;  3S3N A;  3OYC A;  4Z94 A;  4B08 A;  4DTS A;  2WFB A;  1YIJ N;  4E1J A;  3UIQ A;  1IH7 A;  4BDP A;  3OHR A;  1VRU A;  2CGJ A;  1C0M A;  4BRM A;  4LF4 K;  2ZE2 A;  2O8F A;  1KVC A;  4JD2 A;  3C7N B;  4HUE A;  4DV7 K;  4DTU A;  4BC5 A;  5D3G A;  4CGI A;  4KO0 A;  2ATQ A;  3SUQ A;  4U67 L;  2NLX A;  2IGI A;  1I94 K;  4GVE A;  4I7F A;  4DR2 K;  4ELV A;  2AJQ A;  3VTH A;  5FPM A;  3SLC A;  4M42 A;  4ISG A;  3EYZ A;  5EVZ A;  2D0O A;  2H3G X;  4CHY A;  3CM6 A;  4I6M B;  3KJV A;  3HJF A;  3V1Q A;  3MMV A;  1S6Q A;  2E6L A;  4FJM A;  4OKJ A;  4ZHR A;  1WBD A;  3DLK A;  3NE6 A;  3SJJ A;  3MN5 A;  1K6Y A;  3OYI A;  4FJK A;  1X9J A;  3HPG A;  2ZGY A;  1V4T A;  4QS7 A;  2HVH A;  3ZX2 A;  3F9K A;  4BR0 A;  3O3G A;  1JCG A;  1TGO A;  1BG3 A;  3A0I X;  4GVM A;  1HUX A;  4OKK A;  1Z05 A;  5BN9 A;  4GMJ B;  1VQ8 N;  4NCA A;  3CCQ N;  4K8X A;  1SKS A;  1DTQ A;  3AVG A;  5JS1 A;  5E26 A;  4E7J A;  5KGW A;  4K0K K;  3EE9 A;  2V51 B;  3FFI A;  3LAM A;  2A6A A;  1NK4 A;  1NJI O;  4E1N A;  1RT4 A;  3WT0 A;  4LFA K;  3A5O C;  1RT7 A;  1NK9 A;  3QFU A;  1JCF A;  1YIT N;  4FJJ A;  1YHQ N;  4JI4 K;  4X62 K;  4F4K A;  2D0B A;  5M1N A;  1BO5 O;  1KVB A;  3IFR A;  4F2S A;  3C7N A;  1YVU A;  4LF9 K;  1VRT A;  4O4G A;  4O44 A;  4CEC A;  4DLE A;  3I56 N;  4ISE A;  1HJR A;  2BH1 A;  4K43 A;  1N34 K;  4JI0 K;  3IUC A;  1ZBU A;  3NHG A;  1BOT O;  1EWR A;  4FJN A;  4DR7 K;  1D5A A;  4MQ3 A;  4BG9 A;  4HTU A;  4KV8 A;  1DKG D;  3U3Y A;  2AA4 A;  5BPL A;  3UB5 A;  2W6L A;  3TAE A;  4QAG A;  1N36 K;  1T03 A;  4RTF D;  3LP2 A;  1VSJ A;  2VG5 A;  1IKX A;  3BP8 A;  4KRE A;  1SZ2 A;  2GV9 A;  2W6K A;  2PFU A;  2CH6 A;  3AVA A;  3CQ8 A;  1J5O A;  1OH7 A;  4KB0 A;  4PL8 A;  3VQD A;  4CGF A;  4YHH K;  3KHY A;  3AA5 X;  4LFC K;  4DB3 A;  2FC0 A;  1X1P A;  3I55 N;  4JAX A;  5AQK A;  5KTQ A;  1VQN N;  2HVI A;  2YV0 X;  1WSI A;  2QWM A;  4H4O A;  4X64 K;  4WFN L;  3HT3 A;  4FYD A;  3LDN A;  3WQT A;  3S9H A;  2G8K A;  2FLO A;  3GOI A;  1IJJ A;  3ID8 A;  4RW7 A;  3UKR B;  4FO0 A;  4F9O A;  3U4L A;  4YFU A;  1RBR A;  4NO7 A;  1RGI A;  3E01 A;  4BRE A;  2JWL A;  4AHS A;  1J6Z A;  3TU5 A;  4FWO A;  3LZI A;  2ZD1 A;  4YOW A;  3ZET B;  1C0G A;  4B9L A;  4N47 A;  1RIL A;  3L2W A;  4Y1C A;  3TTD A;  1S5J A;  1OKJ A;  3LWM A;  1ASV A;  4AHT A;  4CEE A;  3CCE N;  4W5N A;  3AGR A;  4AHR A;  5AQG A;  5C24 A;  4M3Y A;  3NF8 A;  4BGA A;  4BVP A;  2GX9 A;  2GEL A;  4YDU C;  1YVN A;  4DUY K;  4Z0U A;  2YHX A;  3LDQ A;  1V4S A;  1NGB A;  4JHD B;  4I9Q A;  3LL3 A;  3SI6 A;  2CGK A;  1NGI A;  3FE1 A;  2ZWH A;  3EZ5 A;  3TAR A;  5BPN A;  1M1K O;  2W42 A;  4DR4 K;  4JI2 K;  5BRH A;  4NLB A;  4CZH A;  1BGX T;  3THY B;  2DFF A;  1JLF A;  2QWO A;  5JLF A;  4QOZ B;  4DQQ A;  1Z26 A;  3ENH A;  4B1W B;  1GLA G;  1DGK N;  3EO3 A;  4O8K A;  3SAG A;  1FXX A;  4CE9 A;  4CD3 A;  1KSP A;  3SAH A;  4KHP K;  1R59 O;  1TAQ A;  3ENO A;  3MX5 A;  3P39 A;  1UA0 A;  3CI5 A;  1ATN A;  1T05 A;  4DSL A;  3EKU A;  1HLU A;  1K73 O;  1MU2 A;  4DQ8 A;  3HPH A;  4JKA A;  4CEZ A;  1Z25 A;  2ASM A;  1R0A A;  1TKT A;  2LSN A;  1MWM A;  3FZK A;  3OYF A;  4DF4 A;  1IV0 A;  5HLF A;  4JI3 K;  5HOO A;  3VQ9 A;  1HMV A;  1NGH A;  4DSE A;  5J1E A;  4OPK A;  1VSD A;  2F96 A;  4NYF A;  1NJX A;  3ATU A;  3L2U A;  2PYJ A;  1JLB A;  4RW4 A;  5AQM A;  3OS2 A;  3NMU A;  5AQX A;  3F9M A;  4WCE L;  3NF6 A;  4AH9 A;  4CZF A;  2HBJ A;  3M3Z A;  4EP4 A;  3AAR A;  1HKG A;  4YNQ A;  3LP3 A;  3E1Y A;  2G8I A;  1GLB G;  4N56 A;  4IZ9 A;  2RE2 A;  1NK8 A;  4K41 A;  2A42 A;  5I3U A;  1KAX A;  3HO1 A;  4CJS A;  1Y97 A;  4BAC A;  3DRP A;  2IVO A;  4H0T B;  3DOK A;  4BRN A;  2KLA A;  2CH5 A;  1YUW A;  4CZJ A;  4B1X B;  1UOC A;  1JLQ A;  3GE1 A;  1NGG A;  4JHD A;  3CFR A;  1NMD A;  1HYV A;  5JVG L;  2Y1J A;  4C8K A;  2XY5 A;  3ATV A;  3DWL A;  4BQZ A;  3DLR A;  4IOA L;  4H0V B;  1TAU A;  2BDP A;  4CJE A;  1TUY A;  3AO1 A;  3MN7 A;  4Q0B A;  3D2F B;  4LC9 B;  3ZT1 A;  1VQ7 N;  3OYB A;  3AVL A;  4GW6 A;  2O4G A;  1KRP A;  5F1X A;  4LY7 A;  3OYK A;  4EHU A;  1VQO N;  1QHT A;  4DTO A;  2GUI A;  1W0H A;  5FLX O;  1RDC A;  5CZ2 A;  3CD6 N;  4CED A;  2HHQ A;  1EKE A;  3FLC O;  3QML A;  4LF6 K;  4FZX C;  3E9O A;  1VK0 A;  2D1K A;  3DYA A;  2FF6 A;  2VWK A;  1JJ2 M;  1LOT B;  3DXK A;  1BWF O;  4FLY A;  4Y1D A;  1D4X A;  4LFB K;  3TTC A;  3ZSV A;  3L3V A;  4GKK K;  4JKE A;  1EXQ A;  3AO2 A;  3RRG A;  4L8R B;  3IMX A;  1ZBH A;  1YI2 N;  2I5J A;  4FWP A;  1Q9X A;  1HX1 A;  3T19 A;  2Q31 A;  3G0Z A;  5GAE P;  1VHX A;  4DTM A;  3TSP A;  4BR9 A;  4JLH A;  4ILG B;  1EWQ A;  4EP5 A;  3HM8 A;  1NM1 A;  1SAZ A;  1QQN A;  5ELZ A;  2ZJR L;  3DLL L;  1QQO A;  3PV8 A;  1BDG A;  3EKS A;  5HP1 A;  3MDQ A;  2NRT A;  3M5R A;  1E4F T;  4JK9 A;  4DQI A;  1CZB A;  4KHN A;  4NLC A;  2Q3S A;  1U48 A;  4EZ9 A;  1IO2 A;  4GNI A;  1JLC A;  3TWH A;  1T6D A;  3WXJ A;  5AQJ A;  4Z4F A;  3RR7 A;  1HYS A;  3CQX A;  5BPM A;  3RRH A;  3SPY A;  1J5E K;  3DXM B;  4JRQ A;  4N76 A;  3QLH A;  1FW6 A;  1JLE A;  1WSE A;  4MO5 A;  4WE1 A;  4FK2 A;  3D2F A;  5GAG P;  3SMP A;  3TAQ A;  3LDO A;  1YT3 A;  3PSF A;  1L3S A;  1TL3 A;  3CJA A;  4JK8 A;  4MDA A;  2F9W A;  3JAM O;  3NAE A;  4B9S A;  4FJL A;  1QSS A;  1VSL A;  5KPT A;  4IWV A;  4I9L A;  4CF9 A;  4X66 K;  3D2E B;  1WSH A;  3CC7 N;  2O8D B;  1S1W A;  4PKH A;  4PY5 A;  3ZT3 A;  4DU1 A;  1A5W A;  3DMJ A;  4CJR A;  1VAZ A;  2BTF A;  4BG8 A;  3EY1 A;  3VF6 A;  3OYE A;  3ID6 A;  4DS5 A;  1BU6 O;  3CCS N;  1Q86 O;  1IKV A;  3H3N O;  4DTJ A;  3O5B A;  4WYB A;  3RMB A;  3NCI A;  2VWJ A;  3OY9 A;  1J54 A;  2YKN A;  3NGI A;  3CM5 A;  4KI6 A;  4OPJ A;  3CER A;  1YJ9 N;  4H0O A;  3V4I A;  3HXM A;  4BC4 A;  5GAD P;  2A40 A;  3TAM A;  1KFD A;  4IO9 L;  3C65 A;  2KFN A;  3L4Q A;  3SQ0 A;  4BGB A;  2VGN A;  2X74 A;  3QEX A;  3C95 A;  5J2Q A;  4O5B A;  1T6C A;  3BY5 A;  3K59 A;  4LD0 A;  2IDO A;  1ZBL A;  2OAN A;  2IVN A;  4QCL A;  1ZBF A;  1LAV A;  3CIP A;  4PWD A;  1HPZ A;  1QZ5 A;  4OJR A;  5E41 A;  4FVM A;  2E2O A;  3FZF A;  3SJH A;  3NF7 A;  2G8H A;  2ITM A;  1NGA A;  1XI1 A;  4ELU A;  1T3V A;  1S72 N;  1ITG A;  1ESV A;  3R3L A;  2A5X A;  3UKU B;  4W5R A;  3HOT A;  4J2A A;  3J8A A;  4KKO A;  3V1O A;  1ASU A;  3WQU A;  4JKH A;  3THW B;  5FPD A;  4FL9 A;  1BI4 B;  4H03 B;  4NB4 A;  4FPB A;  3V9S A;  2RF2 A;  2Q36 A;  1WOQ A;  4LF5 K;  5AQR A;  2O8D A;  3KD1 E;  1RCH A;  4X65 K;  1NWK A;  2F8T A;  1HR0 K;  2IC3 A;  4YDU A;  3RSE B;  2UUC K;  3CC2 N;  2UXB K;  3QEV A;  3O8M A;  2ASP A;  3THV A;  3CJ1 A;  5C25 A;  4RCH A;  4J8F A;  1RDD A;  1VSM A;  3KD5 E;  4J2D A;  1KQS M;  4BRL A;  3QEP A;  4H8K A;  2YNH A;  4CF0 A;  4DR6 K;  2QXF A;  4KHS A;  3OJU A;  3AO4 A;  2GWK A;  1NGF A;  3K9K A;  4IFV A;  4BC3 A;  3FZH A;  3O1B A;  3AO5 A;  4KH5 A;  3OS1 A;  4CGH A;  5SZT A;  3MCA B;  5FPE A;  1Q82 O;  5KPZ A;  4DU3 A;  4DFJ A;  4M3R A;  1BL3 A;  3AA2 A;  3CJ7 A;  3MEE A;  4HVJ A;  3FR0 A;  3CFP A;  5J2M A;  2E88 A;  4EZ6 A;  5KQD A;  3KK3 A;  2O4I A;  3AVJ A;  3WUH A;  1EQY A;  3HL8 A;  5AQP A;  3LPU A;  3AVK A;  3VPZ A;  3IAY A;  1G99 A;  1Z6R A;  2XY6 A;  2E2Q A;  3VA3 A;  2P9S B;  3O4N A;  4DV3 K;  5GIN A;  4M3X A;  3O3F A;  3L4I A;  2IIR A;  5B8H A;  4Z4H A;  2OPS A;  4DV2 K;  3U9D A;  4FXD A;  3C6U A;  2QW9 A;  3THW A;  4DSF A;  1GOB A;  4CJ5 A;  1SUQ A;  3QNN A;  3V1R A;  4WQ5 C;  3DLH A;  1N32 K;  3R6M A;  3KVG A;  3CCJ N;  1C0T A;  3T3F A;  1GOC A;  3LM9 A;  2YHB A;  2WON A;  1SS6 A;  4FOI A;  1DTT A;  3CCL N;  1KD1 O;  5J2N A;  5EOY A;  4PQU A;  1ZBI A;  5LJV A;  1KAZ A;  1C1C A;  1KVA A;  1GLJ O;  3BZK A;  1RBS A;  5LMU K;  3RSE A;  3I0R A;  1ILY A;  2ITG A;  3VEO A;  2NZT A;  1XMQ K;  2WTU A;  4PA1 A;  3ENB A;  3DRR A;  1NJW A;  1EP4 A;  1QVG M;  2A1R A;  3TPQ A;  2P9U B;  5JIC A;  3G25 A;  4JKB A;  3LPT A;  3M8S A;  3H6E A;  3SQ1 A;  2HF4 A;  3QIP A;  4BRO A;  4CF1 A;  4CJ3 A;  1XC9 A;  4XIU A;  4PKI A;  4M45 A;  4AF1 A;  2HF3 A;  3NGZ A;  4B1U B;  2HBK A;  2BAN A;  2B6A A;  3LM2 A;  1KCF A;  5GIP A;  5EU7 A;  2P5O A;  2OCE A;  1QZ6 A;  1S3X A;  4O0J A;  2HST A;  4W5T A;  4DFP A;  4BDZ A;  5DK5 A;  1S1T A;  3VEN A;  4N41 A;  3ULD A;  4RWT A;  3AVB A;  2P9S A;  3EN9 A;  4CJF A;  4B9Q A;  2QI2 A;  2OZS A;  3IS9 A;  3A2F A;  1TK0 A;  1K8K B;  2HHV A;  3J7Z O;  1RBU A;  4B1Y B;  4CF2 A;  2B4J A;  3S3O A;  1J9A A;  3AVH A;  4WFA L;  3O6W A;  3NF9 A;  4OVL A;  4CVN E;  2ASO A;  2QWP A;  5HL7 L;  3F5T A;  3LDS A;  2HMP A;  5CE3 A;  4I6M A;  4JKG B;  3J81 O;  3V9W A;  2ETJ A;  2PZS A;  2FSN A;  4G9Z A;  1REV A;  1B92 A;  4KRF A;  4JRP A;  5DMR A;  2P1J A;  3C6H A;  2P9U A;  4OX9 K;  3WNG A;  2NRR A;  3KLH A;  2HOE A;  1SV5 A;  3M1F A;  1IG8 A;  3IRX A;  3FZM A;  1C1B A;  5GIO A;  1QQC A;  3HK2 A;  4DV0 K;  4QS8 A;  3CCV N;  3D6R A;  1XHZ A;  5KI6 A;  3SAF A;  3OBY A;  4H5T A;  3WXL A;  2NUB A;  4A59 A;  4KI4 A;  2E2N A;  5AQQ A;  4KTQ A;  2V7Y A;  3MXI A;  4K42 A;  4FJ7 A;  1C6V A;  3VEZ A;  3KWG A;  1ASW A;  1U4B A;  1VSE A;  2HB5 A;  4FM1 A;  3SUO A;  1IBL K;  4MLH A;  3VQP A;  4DCH A;  5BR8 K;  4F3O A;  1HNX K;  3H08 A;  3VGL A;  1S1V A;  5BR9 A;  1DLO A;  4BRC A;  1M90 O;  5LMN K;  4W5O A;  4HCC A;  2DFH A;  2UXD K;  2P9N B;  3HP9 A;  3BDP A;  5KPR A;  3NH0 A;  3VQQ A;  4CW7 B;  3KLI A;  3ZEU B;  4CK3 A;  3AVC A;  3PX0 A;  3VEY A;  4YOX A;  2XRI A;  3ZSX A;  2DY4 A;  4CEA A;  4JKG A;  3A5M C;  4TSX A;  3P31 A;  2VYP A;  3TR8 A;  2ZJP L;  2OTJ N;  3AVM A;  4BDY A;  3QBW A;  4NCB A;  1NK0 A;  3M8P A;  1QS4 A;  3H1V X;  1HRH A;  3E66 A;  4IOX A;  2EX3 A;  3AAP A;  2YNG A;  3U6F A;  2DTU A;  3CPE A;  2QWN A;  4A5A A;  1CZ9 A;  2HMI A;  4DLG A;  5JMV A;  4DQS A;  3TAB A;  3C6A A;  2XY8 A;  4BVO A;  3CCM N;  1U2V B;  4GKJ K;  3O9R A;  1F21 A;  1D9F A;  3I8D A;  5CR4 A;  5AQY A;  1TYQ B;  3L3U A;  3PX6 A;  1WSF A;  4PKG A;  3HBT A;  1GLD G;  3UKR A;  1VSI A;  3TSU A;  1FKP A;  3KLE A;  3HRG A;  3CCU N;  4FJ9 A;  3KLG A;  3OA9 A;  2VG6 A;  5MLC Q;  2AP1 A;  3N4P A;  5KRS A;  3FFK B;  3DM2 A;  5HRR A;  4ILH A;  1LWE A;  3ZET A;  4C8O A;  2QWR A;  4E7H A;  3I0S A;  3HZ6 A;  3QET A;  4EHT A;  3R8E A;  1IBM K;  3GDQ A;  3LP0 A;  3F2K A;  5KQ8 A;  2Q2R A;  1TL1 A;  3AVF A;  4KAZ A;  1SL0 A;  2KKZ A;  2P9N A;  5A2Q O;  2YI1 A;  1O13 A;  2IS3 A;  3ZEU A;  2F9T A;  4CFA A;  1ZC6 A;  4DKW A;  3KK2 A;  3KZB A;  4DSJ A;  4FJH A;  4BQL A;  1VQ6 N;  3VQA A;  2VGM A;  1RDW X;  3QFP A;  5AQU A;  4BRI A;  2Z1G A;  3K57 A;  4WF9 L;  4B1Z A;  1GLC G;  4CGJ A;  3THY A;  4B9V A;  4FWM A;  1E4G T;  4CEB A;  4C8M A;  3PO4 A;  3S3M A;  3A8Y A;  3OYL A;  4KHW A;  2OYQ A;  5FRM A;  4IOC L;  3PO5 A;  4FW2 A;  4HUF A;  4FLT A;  3J7Y P;  3KWI A;  4H0P A;  3B6P A;  4XH4 A;  4JKC A;  2I7N A;  3WEE B;  4Z4G A;  4OPH A;  2B5J A;  5M1P A;  3FZL A;  1W9H A;  2YHY A;  3CET A;  1BQN A;  4IO8 A;  1U2V A;  3MX2 A;  1NK6 A;  2V7Z A;  2BGG A;  1O1W A;  4B8C A;  4DV6 K;  3H45 C;  4JS4 A;  4JI1 K;  5FRN A;  4KHQ A;  1YAG A;  2FF3 B;  1T44 A;  1TYQ A;  3ULE B;  4OPA A;  3T1A A;  1FJG K;  1SKW A;  4WQ5 A;  1LW0 A;  3N4Q A;  2X6S A;  1Q8I A;  4CFB A;  4CHQ A;  4C1N K;  1S9G A;  3J7A P;  4M41 A;  3P4I A;  3VQ6 A;  1NNE A;  3S41 A;  4OGE A;  4YOY A;  5M1Q A;  1JLG A;  2P51 A;  2JWK A;  1RT6 A;  1X3M A;  3AAQ A;  3ZCM A;  3OTO K;  4DR3 K;  5EY4 A;  2F4V K;  3W3D A;  3CFO A;  3DLG A;  2ZGZ A;  3FGU A;  3HVT A;  3K2P A;  1YF5 L;  4CJK A;  3SV4 A;  1BUP A;  1WLJ A;  1HPM A;  3EZW A;  2QKK A;  3QIC A;  4NCG A;  4B3O A;  4CIF A;  1C1A A;  2Z1H A;  1NK5 A;  3PSI A;  1TK5 A;  4JI8 K;  4NXN K;  2D0P A;  2X6N A;  2W40 A;  5DM6 L;  4DS4 A;  1W97 L;  1LW2 A;  1BHL A;  2A3Z A;  3AV9 A;  5AR0 A;  5AQH A;  1ATS A;  2D5R A;  4DTP A;  2HHU A;  3KKR A;  3MCP A;  1X3N A;  3O80 A;  4Z4C A;  2I7P A;  3M6G A;  1L3U A;  2E1Y A;  3CYM A;  4CEQ A;  3VF2 A;  3AO3 A;  3HM9 A;  3HPO A;  4A57 A;  3BGR A;  5M1K A;  2QXL A;  1RTJ A;  4E0D A;  2NRX A;  3MK6 A;  3EL2 A;  2HHH K;  1BCM A;  2P9L B;  1S9E A;  5TKW A;  4ID1 A;  3H3O B;  4KFB A;  5GAH P;  1WBB A;  3P5J A;  1N5Y A;  4C8L A;  5BRE A;  1HKB A;  3TAN A;  1W7A A;  4G1Q A;  1QQM A;  5HRP A;  4FLW A;  3KK1 A;  3ULE A;  1RT3 A;  3MN6 A;  5JLH A;  1L3V A;  4MDB A;  1EET A;  1T7P A;  5AJ3 K;  2O8C B;  1KAY A;  2E6M A;  4M3W A;  4BE0 A;  3MAQ A;  1HYZ A;  4F3T A;  2F7T A;  1C0F A;  4GY2 B;  3R9P A;  4CJ4 A;  2GBZ A;  3VF4 A;  2PY5 A;  4FVU A;  3NFA A;  4CFC A;  2FBV A;  2P5G A;  1UWB A;  4H5N A;  4RG8 A;  3VQ5 A;  1UAX A;  3QEW A;  4B1V A;  3HVR A;  1WN7 A;  3GBT A;  4CHO A;  1XMO K;  2G8U A;  5AQF A;  1BQM A;  3OYJ A;  3JS6 A;  3SQ2 A;  2Z1I A;  3C94 A;  5AZJ B;  3K0S A;  4CGG A;  1IBK K;  3CCR N;  2KW4 A;  3BZC A;  4A61 A;  3NH1 A;  4FOE A;  4CZM A;  3RWU A;  2IVP A;  3DXM A;  3W0L A;  3O08 A;  4IFY A;  5M1F A;  4IKF A;  4AM6 A;  4KHU A;  4ID5 A;  1YJN N;  4E89 A;  4PUO A;  4DV1 K;  5HRO A;  2QWL A;  5CYQ A;  4FLX A;  4F8R A;  5C12 A;  3RR8 A;  1XWL A;  3JSM A;  3MWP A;  1QTM A;  1XC3 A;  4OLA A;  4JD2 B;  3ZT2 A;  4AIL C;  4F2R A;  3G4S N;  3D2E A;  4N5S A;  1OVY A;  5BN8 A;  3M8R A;  1SQK A;  1N8R O;  2P9L A;  1N33 K;  1QHA A;  1G15 A;  4O0I A;  2HBL A;  3L8B A;  1HJO A;  1KC8 O;  1T8E A;  3TI0 A;  1KTQ A;  3C6T A;  4IXC A;  1A5X A;  4CHP A;  3WNE A;  2HHT A;  2QKB A;  4CIE A;  4JV5 K;  1NGD A;  4R79 A;  4CZG A;  4CJQ A;  5BRD A;  3OYH A;  3ZX0 A;  5FDL A;  1BIU A;  2O8C A;  3VOV A;  3O4Q A;  4CBU A;  4FM0 A;  1X9W A;  4AQY K;  3L0Q A;  1CLQ A;  3HP6 A;  2Q1N A;  1E3M A;  1VQP N;  4ZTJ A;  4E3S A;  4MFB A;  3AY9 A;  5I9E B;  2UXC K;  1LV5 A;  3ZT4 A;  1U04 A;  4XEI A;  1H1V A;  3NVM A;  3NGY A;  3K5N A;  2O8B B;  3SQ4 A;  2RKI A;  1LCU A;  1RT2 A;  3DOL A;  3LDP A;  3O9S A;  3SNN A;  4NXM K;  2WC9 A;  2FSK A;  3ASM A;  1JL2 A;  4CI6 A;  3Q7C A;  5AQT A;  2J4R A;  3HTV A;  3LAK A;  3DLB A;  1GLL O;  4Y0W A;  3CMA N;  2E4L A;  4IJN A;  5IT9 O;  3LDL A;  4IDH A;  4BR2 A;  1DEJ A;  3DI6 A;  5F0X A;  3TAP A;  3P38 A;  3UKU A;  4CZI A;  3K5M A;  5FPN A;  3THX B;  1QVF M;  3U3G A;  2FBY A;  4FWR A;  4CJ7 A;  3VQ4 A;  3OYG A;  2VQF K;  1D8Y A;  3LZJ A;  3VTI A;  4CJW A;  3VQB A;  1WSG A;  1BI4 A;  1KXP A;  4ELT A;  4L3Q A;  4W5Q A;  3DLE A;  3VQ7 A;  1NKC A;  4KTW A;  1Y64 A;  4JI6 K;  4KH4 A;  5C42 A;  4AHV A;  4CZE A;  1VQK N;  4BRG A;  4DR5 K;  2HHX A;  1N6Q A;  3MXM A;  1D9D A;  1P90 A;  3TAG A;  3OJS A;  2OPQ A;  2EHG A;  1LWF A;  3QIN A;  4YOR A;  4UQG A;  3C0B A;  4AM7 A;  4YOU A;  3K58 A;  5LY3 A;  4IJA A;  1RTI A;  3A5L C;  4E19 A;  1JLA A;  1NKE A;  4M7X A;  4A2A A;  5J2P A;  3BUZ B;  1UA1 A;  4CJU A;  1EO1 A;  2D0A A;  4CZK A;  3U8X A;  1QSL A;  4CBW A;  4BWM A;  1VQ5 N;  1WAF A;  3QBX A;  4ZTF A;  4MLE A;  1X9S A;  1BA1 A;  1BCO A;  4M7Y A;  3ZSZ A;  5M1O A;  4IG3 A;  4FWL A;  2O8B A;  3CJB A;  3CQY A;  4ISF A;  4BE1 A;  3CJ9 A;  3HOS A;  4FK4 A;  2RN2 A;  3T1H K;  4MO4 A;  3IKM A;  2XHB A;  2VQE K;  2R7Y A;  4DF8 A;  4DTX A;  1JCE A;  3O1W A;  3D45 A;  4JKF A;  5AQS A;  3P83 D;  3SBT A;  1U49 A;  3L2R A;  4BRD A;  1K9M O;  1ZXO A;  3RVC A;  3RTV A;  4B8A B;  3ZSO A;  1DT9 A;  4C1N I;  3JYT A;  3MEG A;  1Q81 O;  2QTD A;  1OH6 A;  3SBG A;  3MED A;  2Z1J A;  5BRF A;  2E8A A;  4FWS A;  3VN5 A;  3OYM A;  3THX A;  4B9T A;  3KK7 A;  3WNH A;  4EAH D;  3SYZ A;  2YCH A;  1BA0 A;  4IFE A;  3K9J A;  2UUA K;  1KFS A;  1RTH A;  3ALY A;  3H1Q A;  3DRS A;  3CJC A;  1QE1 A;  1NK7 A;  1LAW A;  4JI7 K;  3QO9 A;  3P1G A;  2NNW A;  4BR7 A;  5JS2 A;  1NGJ A;  1NG9 A;  1NOZ A;  1U45 A;  2XO7 A;  3PY8 A;  5ADX A;  2P9I B;  3OS0 A;  1W2B M;  4FZZ A;  1X9M A;  2FXU A;  1Q7Y O;  4UY8 O;  3F73 A;  3AA4 A;  4CIG A;  1S1U A;  3KKS A;  2Q0R A;  3VEW A;  3TTF A;  3NH2 A;  4BR5 A;  5C2D A;  2ZM6 K;  2A41 A;  3SV3 A;  1RDA A;  4NYN A;  4WQ4 C;  5I42 A;  5AFU A;  2QK9 A;  5CYM A;  4RW8 A;  4EFH A;  3QEI A;  3RMA A;  2YX6 A;  4H5W A;  2JLE A;  1SL2 A;  2OZM A;  2HHS A;  2D0C A;  1RNH A;  4J2B A;  1XNR K;  2YJE A;  4DR1 K;  5CY4 A;  2YHW A;  1S6P A;  5KGX A;  4E7L A;  1TKX A;  5AQZ A;  4BRQ A;  5C10 A;  1J53 A;  5KRT A;  1WB9 A;  3QER A;  3DAW A;  4BC2 A;  2NRZ A;  3VQ8 A;  5AQI A;  3ISN C;  3OVN A;  1IKY A;  3BF3 A;  1U47 A;  3AGK A;  1TK8 A;  3SUP A;  3CXC M;  4CBX A;  3PLA A;  1RFQ A;  2NRW A;  4I2P A;  3ZSR A;  4HHT A;  5AZI B;  2G8W A;  4DWI A;  4CD1 A;  4DG1 A;  1K8K A;  1TV6 A;  3G6E N;  4DV5 K;  3MWT A;  4CEO A;  3HI0 A;  1RTD A;  1VSK A;  1XUP O;  1KLM A;  1NU0 A;  4A2B A;  4DU4 A;  4FCY A;  4FJI A;  2UYT A;  3HYF A;  1ZYQ A;  2G8F A;  1NGC A;  3EEQ A;  1GLE G;  4YOT A;  3T1Y K;  4CHN A;  1WAJ A;  1IKW A;  3ZSY A;  2KQ2 A;  4M3T A;  4BRP A;  2WUS A;  3O3H A;  4B9U A;  1A5V A;  2P9I A;  1RBV A;  1MDU B;  2IOC A;  4BE2 A;  4DTN A;  2DPN A;  3VMF B;  4DMN A;  5AQL A;  2GUP A;  4H0Y B;  3KTQ A;  1P8Z A;  4A62 A;  4DQR A;  3T7Z A;  5AQO A;  3K5L A;  2WOM A;  4OKE A;  1SKR A;  2EWS A;  3VET A;  1MWK A;  1CXQ A;  1NMN A;  1TKZ A;  4B3S K;  4H5V A;  4KBO A;  4H5R A;  3BEX A;  4YY3 K;  4DSI A;  2FSJ A;  4FJ8 A;  1BIZ A;  2HW3 A;  2P9K B;  3VGK A;  3D0P A;  1KLN A;  4CF8 A;  4KPY A;  5AQV A;  3VA0 A;  5CZ1 A;  3GL1 A;  2BE2 A;  5EX5 A;  4CZL A;  1S22 A;  2ZF5 O;  1CZA N;  1HKC A;  1SL1 A;  4CJL A;  3IDH A;  3TAF A;  1YJW N;  4IBN A;  2PYL A;  3ZLJ A;  3O9U A;  1JKH A;  4LH5 A;  2PBD A;  3DXK B;  4B9M A;  2E2P A;  1YTU A;  2P9P B;  3VER A;  1I39 A;  2HBM A;  4RW6 A;  1HNV A;  4IDK A;  4JKD A;  4O8U A;  2ZJQ L;  5AZI A;  1VQL N;  4LF7 K;  1RDU A;  1VQ9 N;  3LAN A;  4B3T K;  5TKY A;  2IAJ A;  3A5N C;  4YOV A;  3BF1 A;  2E5L K;  3E9L A;  1U6Z A;  4R5P A;  3O4W A;  3CF5 L;  4FK0 A;  4DTR A;  4GV3 A;  3HST B;  5C15 A;  4C23 A;  3VQC A;  3HSC A;  2HNZ A;  5T7B A;  3RMD A;  4HCB A;  4M3U A;  4OGC A;  2KFZ A;  1HNI A;  3PX4 A;  4O55 A;  4E7K A;  2OPP A;  3MN9 A;  4FM2 A;  3V9X A;  2VCP A;  2E1Z A;  3VEX A;  3Q7B A;  1NKB A;  3AA3 A;  5DM7 L;  2A1S A;  5H1S Q;  2DFE A;  1Q9Y A;  4FLV A;  4JI5 K;  2FBX A;  3T69 A;  1HQE A;  5K14 A;  4J2E A;  2XY7 A;  2YHA A;  3MXJ A;  5C0Y A;  3SPZ A;  2GTD A;  4JEP A;  4LSN A;  2P9K A;  3VEV A;  1YTA A;  2JGU A;  4CJV A;  4WFB L;  4E7I A;  4KB1 A;  4AHC A;  3G71 N;  1B9D A;  1B9F A;  4B9N A;  3WNF A;  4K8Z A;  4JYA K;  1GLF O;  3WXM B;  3AVN A;  1NLV A;  4FLU A;  3ZSQ A;  3VQE A;  2YNF A;  4XH5 A;  1OH8 A;  2P9P A;  2YKM A;  3U9Z A;  4A5B A;  4DV4 K;  3MEC A;  2KHO A;  3IG1 A;  1I3A A;  4M63 C;  4DFM A;  1NOY A;  4IEI A;  4FWQ A;  4E1M A;  1OH5 A;  3V9U A;  2FBT A;  4FPA A;  5ADX H;  1TUU A;  2D4W A;  5LL6 Z;  3AVI A;  3SZ2 A;  4Z4I A;  1RT1 A;  2QA4 N;  3QES A;  1NJY A;  3J80 O;  1NBW A;  4LH4 A;  1WUA A;  2ZQB A;  3OW2 M;  2YJF A;  4OO1 J;  2GEM A;  3OYA A;  5LJW A;  4LSL A;  4LF8 K;  4CGD A;  3E9P A;  5AFU H;  2O8E B;  3ITH A;  2HNY A;  3L2Q A;  4CCH A;  1LWC A;  2YNI A;  4CK1 A;  4HUG A;  1NJZ A;  4FWK A;  4BWJ A;  4BY9 C;  1ATR A;  4H4M A;  2CGL A;  3SMS A;  3TSQ A;  2OA8 A;  1OVQ A;  1JXE A;  4DUZ K;  3DJC A;  1MA9 B;  1S1X A;  3WEE A;  5IWA K;  2V52 B;  3I33 A;  4FSV A;  3CG7 A;  5EXW A;  2QEX N;  4O5F A;  4FZY A;  3SK3 A;  3V6D A;  4B3M K;  1BIS A;  4JK7 A;  3CC4 N;  3SCX A;  3PUF A;  4FWN A;  4JN4 A;  4KH6 A;  5C2F A;  1GOA A;  3LWL A;  3NBP A;  1WNS A;  4GV6 A;  2HND A;  4CEF A;  2Q0U A;  4CJP A;  4DFK A;  1RDB A;  4KTZ A;  5AQN A;  4CHZ A;  1XNQ K;  3I8B A;  3VES A;  3QDK A;  4I2Q A;  3V9Z A;  5FRO A;  3WXI A;  1ZBS A;  3V81 A;  4EIA A;  4JS5 A;  4OLB A; 
#chains in the Genus database with same CATH homology
 1QQC A;  1C0U A;  3DLE A;  3VQ7 A;  1NKC A;  3HK2 A;  4KTW A;  3RMC A;  3KIO A;  1XHZ A;  5KI6 A;  2X78 A;  5C42 A;  3DLR A;  4IG0 A;  4AHV A;  2NUB A;  4KI4 A;  1N6Q A;  3MXM A;  1D9D A;  1VSH A;  2HHX A;  2BDP A;  4C8N A;  4CJE A;  1TAU A;  3TAG A;  4KTQ A;  3AO1 A;  3MXI A;  3OJS A;  2OPQ A;  4Q0B A;  4FJ7 A;  2EHG A;  1LWF A;  1C6V A;  3QIN A;  4UQG A;  4Q5V A;  2KZZ A;  2HHW A;  3ZT1 A;  4FJG A;  3OYB A;  3AVL A;  3K58 A;  4GW6 A;  1RTI A;  3KLF A;  1ASW A;  2O4G A;  3M8Q A;  4E19 A;  1U4B A;  1KRP A;  1VSE A;  2HB5 A;  3ZT0 A;  1JLA A;  4LY7 A;  4FM1 A;  3SUO A;  1NKE A;  3OYK A;  4M3Z A;  3VQP A;  4F3O A;  5HBM A;  5J2P A;  3B6O A;  1QHT A;  4DTO A;  3H08 A;  1JXB A;  1XHX A;  2GUI A;  4FW1 A;  1W0H A;  1JL1 A;  1UA1 A;  1S1V A;  4CJU A;  1DLO A;  1RDC A;  5CZ2 A;  2D0A A;  4W5O A;  4HCC A;  4CED A;  2HHQ A;  1EKE A;  1QSL A;  4BWM A;  4FJX A;  1WAF A;  2DFH A;  4FZX C;  1VK0 A;  4ZTF A;  2VG7 A;  1X9S A;  3DYA A;  3SUN A;  4FJ5 A;  1L5U A;  3HP9 A;  2KTQ A;  3BDP A;  2VWK A;  3NH0 A;  3L2V A;  3VQQ A;  1BCO A;  3KLI A;  4CK3 A;  4FLY A;  1CXU A;  3AVC A;  1FK9 A;  1HQU A;  3ZSZ A;  2Y1I A;  3PX0 A;  1IG9 A;  5SWM A;  4IG3 A;  4Y1D A;  2G8V A;  2XRI A;  4BE1 A;  3ZSV A;  1EX4 A;  3L3V A;  4FK4 A;  1RBT A;  1QSY A;  4Z4E A;  1L3T A;  3K5O A;  1EXQ A;  3AO2 A;  3ZSX A;  3RRG A;  4L8R B;  1ZBH A;  3OYN A;  2DY4 A;  2RN2 A;  3G10 A;  4CEA A;  2I5J A;  2XHB A;  1Q9X A;  2R7Y A;  4DF8 A;  3NDK A;  4ICL A;  1RT5 A;  4TSX A;  3T19 A;  3OYD A;  3TR8 A;  4DTX A;  2F8S A;  4FYD A;  3AVM A;  5HRS A;  4BDY A;  3D45 A;  3QNO A;  3LP1 A;  3G0Z A;  1NK0 A;  4NCB A;  3M8P A;  4DTM A;  4CER A;  1QS4 A;  4CES A;  1TVR A;  4JLH A;  1HRH A;  3P83 D;  1U49 A;  4DQP A;  4EP5 A;  3L2R A;  2EX3 A;  2YNG A;  3U6F A;  4CFD A;  2DTU A;  3RTV A;  3PV8 A;  4B8A B;  1CZ9 A;  2HMI A;  3ZSO A;  3JYT A;  3MEG A;  4DLG A;  5HP1 A;  4DQS A;  4CK2 A;  3TAB A;  3MED A;  2Z1J A;  3OYM A;  3VN5 A;  2XY8 A;  4B9T A;  4DQI A;  1CZB A;  3WNH A;  4KHN A;  5HRN A;  3QIO A;  2Q3S A;  4FLZ A;  3SYZ A;  1VSF A;  1U48 A;  1IO2 A;  4AHU A;  4EZ9 A;  1F21 A;  1JLC A;  3TWH A;  1D9F A;  3I8D A;  1KFS A;  3LAL A;  1RTH A;  3ALY A;  3DRS A;  3L3U A;  3PX6 A;  4Z4F A;  1WSF A;  3RR7 A;  2KZM A;  1QE1 A;  1HYS A;  4DSK A;  3RRH A;  1VSI A;  3SPY A;  1LAW A;  1NK7 A;  1FKP A;  3KLE A;  4FJ9 A;  4JRQ A;  4N76 A;  3QLH A;  3KLG A;  3QO9 A;  3P1G A;  3ZSW A;  2VG6 A;  1JLE A;  1WSE A;  4WE1 A;  4FK2 A;  5JS2 A;  4KHY A;  5KRS A;  3TAQ A;  1NOZ A;  3DM2 A;  1YT3 A;  5HRR A;  1U45 A;  1TKD A;  2XO7 A;  4RW9 A;  2RPI A;  3PY8 A;  1LWE A;  2OPR A;  1FKO A;  1L3S A;  1TL3 A;  4C8O A;  3OS0 A;  4E7H A;  1WSJ A;  3I0S A;  3NAE A;  4FZZ A;  4B9S A;  4FJL A;  1QSS A;  1X9M A;  4CJT A;  1VSL A;  3S3N A;  4I9L A;  4CF9 A;  3F73 A;  3QET A;  3AA4 A;  4CIG A;  1S1U A;  3OYC A;  1WSH A;  3KKS A;  4B08 A;  4DTS A;  3LP0 A;  3NH2 A;  1S1W A;  3UIQ A;  1IH7 A;  1TL1 A;  1RDA A;  3AVF A;  4NYN A;  3SV3 A;  5I42 A;  1SL0 A;  4BDP A;  4KAZ A;  2QK9 A;  4PY5 A;  1VRU A;  5CYM A;  3ZT3 A;  1A5W A;  4RW8 A;  4DU1 A;  3QEI A;  3RMA A;  3DMJ A;  4CJR A;  1C0M A;  2IS3 A;  2JLE A;  3EY1 A;  1SL2 A;  2OZM A;  4CFA A;  3OYE A;  2HHS A;  2D0C A;  1RNH A;  2ZE2 A;  4DS5 A;  4J2B A;  3KK2 A;  4DSJ A;  4FJH A;  1KVC A;  5CY4 A;  1IKV A;  3VQA A;  4HUE A;  1S6P A;  4DTJ A;  4DTU A;  5KGX A;  4E7L A;  2Z1G A;  5D3G A;  4CGI A;  1TKX A;  3K57 A;  4KO0 A;  4CGJ A;  3RMB A;  4B9V A;  3NCI A;  1J53 A;  5KRT A;  2VWJ A;  3OY9 A;  3QER A;  1J54 A;  2YKN A;  4CEB A;  4C8M A;  3PO4 A;  3S3M A;  3NGI A;  3CM5 A;  2ATQ A;  3SUQ A;  4KI6 A;  3VQ8 A;  4OPJ A;  3ISN C;  3OVN A;  1IKY A;  2IGI A;  3OYL A;  3V4I A;  1U47 A;  3HXM A;  1TK8 A;  4I7F A;  2OYQ A;  4KHW A;  3SUP A;  4ELV A;  5FRM A;  2AJQ A;  3PO5 A;  4FW2 A;  4HUF A;  4FLT A;  3TAM A;  4M42 A;  1KFD A;  2KFN A;  3B6P A;  3SQ0 A;  3EYZ A;  4Z4G A;  4I2P A;  3ZSR A;  4HHT A;  2G8W A;  4DWI A;  2X74 A;  2B5J A;  3QEX A;  4DG1 A;  3C95 A;  4CHY A;  3CM6 A;  1TV6 A;  1W9H A;  3KJV A;  5J2Q A;  1BQN A;  4O5B A;  3V1Q A;  3K59 A;  1S6Q A;  2E6L A;  4LD0 A;  2IDO A;  1NK6 A;  1ZBL A;  4FJM A;  4QCL A;  1ZBF A;  4OKJ A;  1LAV A;  2BGG A;  1O1W A;  4PWD A;  4B8C A;  1HPZ A;  4CEO A;  4ZHR A;  4JS4 A;  5FRN A;  4KHQ A;  4OJR A;  5E41 A;  4FVM A;  1VSK A;  1RTD A;  3DLK A;  1KLM A;  3T1A A;  3NE6 A;  3SJJ A;  3NF7 A;  1SKW A;  2G8H A;  1K6Y A;  1LW0 A;  3OYI A;  1XI1 A;  4ELU A;  3HPG A;  4FJK A;  1ITG A;  4DU4 A;  2X6S A;  4FCY A;  1Q8I A;  4CFB A;  4CHQ A;  3HYF A;  4FJI A;  1S9G A;  2HVH A;  4W5R A;  1ZYQ A;  2G8F A;  4J2A A;  3F9K A;  3O3G A;  4KKO A;  3V1O A;  1ASU A;  1TGO A;  4M41 A;  4CHN A;  1WAJ A;  1IKW A;  3VQ6 A;  3ZSY A;  2KQ2 A;  4M3T A;  4GVM A;  4OKK A;  4GMJ B;  4OGE A;  4NCA A;  3O3H A;  4B9U A;  1A5V A;  4K8X A;  1BI4 B;  1RBV A;  1SKS A;  1JLG A;  2IOC A;  2P51 A;  1RT6 A;  1DTQ A;  3AVG A;  4BE2 A;  4DTN A;  3V9S A;  5JS1 A;  3ZCM A;  2RF2 A;  4DMN A;  4E7J A;  5KGW A;  3KTQ A;  3CFO A;  3DLG A;  4JS5 A;  3FFI A;  3LAM A;  1NK4 A;  4DQR A;  3HVT A;  3K2P A;  4CJK A;  3SV4 A;  4E1N A;  3KD1 E;  1RT4 A;  3K5L A;  1WLJ A;  2WOM A;  1RCH A;  4OKE A;  1SKR A;  1RT7 A;  2QKK A;  1NK9 A;  2F8T A;  1CXQ A;  4NCG A;  1TKZ A;  2IC3 A;  4FJJ A;  4B3O A;  4CIF A;  1C1A A;  2Z1H A;  1NK5 A;  4F4K A;  4DSI A;  2D0B A;  3QEV A;  1TK5 A;  4FJ8 A;  1BIZ A;  2HW3 A;  1KVB A;  3D0P A;  1KLN A;  4CF8 A;  4F2S A;  2X6N A;  3THV A;  4KPY A;  4DS4 A;  1YVU A;  5C25 A;  1LW2 A;  1VRT A;  1BHL A;  3VA0 A;  1RDD A;  1VSM A;  4O4G A;  4O44 A;  3AV9 A;  5CZ1 A;  2BE2 A;  4CEC A;  4DLE A;  4H8K A;  3QEP A;  2YNH A;  4CF0 A;  2D5R A;  2QXF A;  1HJR A;  4DTP A;  4KHS A;  2HHU A;  3OJU A;  3AO4 A;  1SL1 A;  3KKR A;  4CJL A;  4IFV A;  1ZBU A;  3NHG A;  3TAF A;  4Z4C A;  4IBN A;  2PYL A;  1L3U A;  4LH5 A;  1JKH A;  4FJN A;  3AO5 A;  3CYM A;  4CEQ A;  1D5A A;  4MQ3 A;  4CGH A;  5SZT A;  3OS1 A;  4B9M A;  4HTU A;  4ELT A;  4KV8 A;  4DU3 A;  3AO3 A;  1YTU A;  4DFJ A;  4M3R A;  1BL3 A;  3U3Y A;  3HM9 A;  3AA2 A;  3MEE A;  3HPO A;  3TAE A;  4QAG A;  3BGR A;  1I39 A;  1RTJ A;  4RW6 A;  1T03 A;  4E0D A;  1HNV A;  4IDK A;  4HVJ A;  3LP2 A;  1VSJ A;  1BCM A;  3CFP A;  5J2M A;  1S9E A;  2VG5 A;  1IKX A;  4ID1 A;  4EZ6 A;  4KRE A;  3PX4 A;  4KFB A;  2KFZ A;  2GV9 A;  3LAN A;  3P5J A;  3AVA A;  1N5Y A;  2IAJ A;  4C8L A;  3KK3 A;  2O4I A;  3CQ8 A;  3AVJ A;  3TAN A;  1J5O A;  3HL8 A;  4G1Q A;  5HRP A;  4R5P A;  4FLW A;  3LPU A;  4KB0 A;  3KK1 A;  3AVK A;  3IAY A;  1RT3 A;  3VQD A;  4CGF A;  1L3V A;  2XY6 A;  4FK0 A;  3VA3 A;  4DTR A;  3AA5 X;  1EET A;  2FC0 A;  3HST B;  3O4N A;  1T7P A;  1X1P A;  3VQC A;  2E6M A;  2HNZ A;  5T7B A;  3RMD A;  4M3W A;  4BE0 A;  3MAQ A;  4M3X A;  3O3F A;  1HYZ A;  4HCB A;  4Z4H A;  2OPS A;  5KTQ A;  2HVI A;  2YV0 X;  4M3U A;  1WSI A;  4F3T A;  4FXD A;  3C6U A;  4OGC A;  4DSF A;  4H4O A;  1GOB A;  1HNI A;  4CJ5 A;  4CJ4 A;  2GBZ A;  1SUQ A;  3HT3 A;  4O55 A;  3V1R A;  3QNN A;  4E7K A;  3S9H A;  2G8K A;  2PY5 A;  3NFA A;  2OPP A;  3DLH A;  4FM2 A;  4CFC A;  3V9X A;  2FBV A;  2P5G A;  1UWB A;  4RG8 A;  4RW7 A;  1C0T A;  3VQ5 A;  3T3F A;  1NKB A;  3AA3 A;  1GOC A;  1UAX A;  3QEW A;  2YHB A;  3HVR A;  1WN7 A;  2A1S A;  2WON A;  4CHO A;  2G8U A;  4YFU A;  2DFE A;  1DTT A;  1Q9Y A;  1RBR A;  4FLV A;  5J2N A;  3E01 A;  1ZBI A;  1BQM A;  2FBX A;  4PQU A;  3OYJ A;  1HQE A;  5K14 A;  4J2E A;  4AHS A;  3SQ2 A;  2Z1I A;  1C1C A;  2XY7 A;  3C94 A;  1KVA A;  4CGG A;  2YHA A;  3LZI A;  2ZD1 A;  1RBS A;  3MXJ A;  3I0R A;  4N47 A;  4B9L A;  1RIL A;  2KW4 A;  4Y1C A;  3L2W A;  2ITG A;  3SPZ A;  1S5J A;  4LSN A;  3NH1 A;  4CJV A;  1ASV A;  1YTA A;  2JGU A;  3LWM A;  4E7I A;  4KB1 A;  4PA1 A;  4AHT A;  4AHC A;  3DRR A;  1B9D A;  4CEE A;  1NJW A;  3RWU A;  4W5N A;  4AHR A;  1EP4 A;  2A1R A;  5C24 A;  4M3Y A;  3NF8 A;  1B9F A;  4IFY A;  3WNF A;  4B9N A;  4IKF A;  4K8Z A;  4KHU A;  4ID5 A;  4Z0U A;  3LPT A;  4E89 A;  4PUO A;  4J2D A;  3M8S A;  3SQ1 A;  5HRO A;  5CYQ A;  4FLX A;  3QIP A;  3AVN A;  4CF1 A;  4CJ3 A;  1XC9 A;  4I9Q A;  4F8R A;  3RR8 A;  4FLU A;  3ZSQ A;  3SI6 A;  3VQE A;  1XWL A;  3JSM A;  2YNF A;  4XIU A;  4M45 A;  2YKM A;  3EZ5 A;  3TAR A;  1QTM A;  4OLA A;  3NGZ A;  3MEC A;  3ZT2 A;  2W42 A;  3IG1 A;  4AIL C;  4F2R A;  1I3A A;  4DFM A;  4N5S A;  1NOY A;  3M8R A;  2BAN A;  2B6A A;  1G15 A;  4E1M A;  1BGX T;  1KCF A;  4O0I A;  2DFF A;  1JLF A;  5EU7 A;  2P5O A;  4QOZ B;  4DQQ A;  1Z26 A;  2FBT A;  3V9U A;  3L8B A;  4O0J A;  1T8E A;  4W5T A;  3TI0 A;  4DFP A;  1FXX A;  4CE9 A;  1KSP A;  1KTQ A;  3C6T A;  5DK5 A;  4BDZ A;  1S1T A;  1A5X A;  1TAQ A;  3WNE A;  4CHP A;  4N41 A;  2HHT A;  3AVI A;  4CIE A;  3SZ2 A;  3ULD A;  4Z4I A;  1RT1 A;  2QKB A;  3AVB A;  3QES A;  1UA0 A;  1NJY A;  4CJQ A;  3OYH A;  4LH4 A;  2ZQB A;  4CJF A;  1T05 A;  5FDL A;  1BIU A;  2OZS A;  3IS9 A;  3A2F A;  3OYA A;  4DSL A;  1TK0 A;  3O4Q A;  4FM0 A;  1X9W A;  2HHV A;  1MU2 A;  4LSL A;  1CLQ A;  3HPH A;  3HP6 A;  4CEZ A;  1RBU A;  1Z25 A;  4CGD A;  3ITH A;  2HNY A;  4CF2 A;  1R0A A;  2B4J A;  3L2Q A;  1TKT A;  2LSN A;  3S3O A;  1J9A A;  3OYF A;  4CCH A;  1LWC A;  2YNI A;  4CK1 A;  4HUG A;  4DF4 A;  1NJZ A;  4ZTJ A;  3AVH A;  4E3S A;  5HLF A;  4C8K A;  3HJF A;  4MFB A;  4BWJ A;  3NF9 A;  3VQ9 A;  1HMV A;  4H4M A;  4DSE A;  1LV5 A;  5J1E A;  3ZT4 A;  1U04 A;  4OVL A;  1VSD A;  4OPK A;  3KD5 E;  2F96 A;  3NGY A;  4NYF A;  2OA8 A;  3K5N A;  1NJX A;  3L2U A;  2PYJ A;  1JLB A;  1JXE A;  4RW4 A;  3OS2 A;  1S1X A;  3SQ4 A;  3NF6 A;  4AH9 A;  2RKI A;  1RT2 A;  3DOL A;  3LDS A;  3CG7 A;  4EP4 A;  3SNN A;  4FZY A;  3V9W A;  3V6D A;  3ASM A;  4YNQ A;  1JL2 A;  2ETJ A;  2PZS A;  1BIS A;  3LP3 A;  2G8I A;  1REV A;  1B92 A;  4N56 A;  3SCX A;  3PUF A;  1NK8 A;  4KRF A;  3LAK A;  3DLB A;  5I3U A;  2E4L A;  3HO1 A;  4CJS A;  4JRP A;  5DMR A;  2P1J A;  1GOA A;  3LWL A;  3DI6 A;  1Y97 A;  3NBP A;  4BAC A;  3DRP A;  3TAP A;  1WNS A;  3K5M A;  3DOK A;  2HND A;  3WNG A;  4CEF A;  4CJP A;  3U3G A;  2FBY A;  4DFK A;  1RDB A;  3KLH A;  3VQ4 A;  3OYG A;  4KTZ A;  4CHZ A;  1D8Y A;  3LZJ A;  1SV5 A;  1UOC A;  1JLQ A;  4I2Q A;  3IRX A;  3V9Z A;  5FRO A;  4CJW A;  3CFR A;  1C1B A;  1HYV A;  3VQB A;  3V81 A;  2Y1J A;  1WSG A;  1BI4 A;  4W5Q A;  2XY5 A;  4OLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...