3ZCMA

Small molecule inhibitors of the ledgf site of hiv integrase identified by fragment screening and structure based design.
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV INTEGRASE
publication title Small Molecule Inhibitors of the Ledgf Site of Human Immunodeficiency Virus Integrase Identified by Fragment Screening and Structure Based Design.
pubmed doi rcsb
source organism Human immunodeficiency virus
molecule tags Transferase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.-:
pdb deposition date 2012-11-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3zcmA00
3KLHA 4FM1A 3ALYA 3O3GA 3VQCA 3S9HA 2GV9A 4OVLA 1JLCA 4Z0UA 3VQEA 4N5SA 3RMCA 2DTUA 4W5OA 4FCYA 4IKFA 3LP1A 1L3SA 3HSTB 4CFCA 4BWJA 1LV5A 1BGXT 1VSEA 2DFEA 3ZSVA 1TK0A 2KFNA 2HHTA 4E7JA 3QNNA 1MU2A 5SZTA 4DTNA 2B5JA 4KB1A 3MEDA 2AJQA 3KKSA 3TABA 1Q9YA 1CZBA 4KHQA 1VSFA 1VSMA 3MEEA 4N41A 4LSNA 4H4OA 3PY8A 4KTQA 3AVMA 3L3VA 3AO1A 2GBZA 3OYKA 4KHYA 3SPYA 4CCHA 4FXDA 1WSFA 4GMJB 3KLEA 2RN2A 4CJKA 5HRNA 1RCHA 3SPZA 5C24A 4CF1A 4CK3A 1KRPA 4W5NA 4CEDA 2DFFA 1RBRA 1NOZA 4CF8A 4FK4A 2F8SA 1JLBA 3SUQA 4Z4IA 3QEVA 1RT5A 2P1JA 3M8SA 4CJRA 4EP5A 5KTQA 4CJQA 2VG7A 5HRSA 3LAMA 4HTUA 3HYFA 3L2UA 4BDZA 4PWDA 4NYFA 3VN5A 3NGZA 4I9QA 3HP9A 4RW8A 3AO4A 1U45A 1XHXA 4CE9A 1D5AA 1JLEA 3AO2A 2OPRA 3HPOA 2W42A 1A5VA 3C6UA 2XO7A 2P5OA 1SL2A 3U3YA 2WONA 4CJ4A 1IKVA 4B9MA 1BI4B 3AVIA 4F3OA 1RDBA 1KSPA 3VQ4A 2KQ2A 4RW4A 2YNFA 4CEQA 4N56A 3QEWA 3QERA 3G0ZA 1BHLA 4KHNA 2BANA 1RT4A 1RDAA 1UWBA 2NUBA 3TAEA 2O4GA 1X9MA 5HLFA 4I7FA 3RRGA 1X9SA 4O0IA 4CK1A 1JL2A 4FJLA 3G10A 4B08A 1XHZA 1RBTA 1WAJA 4RW6A 4BACA 1KFDA 4C8LA 2X6SA 1FXXA 4W5RA 4N47A 3L3UA 1J9AA 3PUFA 4FJKA 3S3MA 2QKBA 2XY8A 2ZD1A 1RT6A 4LH4A 2G8WA 4FJGA 1WAFA 2YNIA 4FJ9A 1GOCA 3AVGA 1ZBIA 3JYTA 4OLBA 1IKYA 2PY5A 1FK9A 3KD1E 1Q8IA 2ITGA 4TSXA 1R0AA 4CEBA 4M3YA 1VRUA 1RTJA 4DLEA 5D3GA 2G8VA 1TAUA 3VQ5A 4DTXA 1S9EA 2X78A 1HYZA 4NYNA 2I5JA 3V1QA 4J2DA 3HK2A 5KI6A 3HO1A 3DYAA 4CF0A 4O55A 3AVNA 4M42A 2IC3A 4LY7A 4M41A 4AH9A 3AA5X 4EZ9A 4Z4HA 1BIUA 4H8KA 3HT3A 1B92A 4CHYA 4PY5A 2RPIA 3IG1A 3VQDA 1A5WA 4DTMA 3AVHA 3SV3A 2G8UA 1QSLA 1N6QA 4CGIA 4JLHA 3WNHA 4M45A 4OPJA 4BE2A 1VRTA 4I2PA 1NJWA 4FLTA 2PYJA 1VSLA 4FZYA 1CLQA 4KTWA 1QTMA 3AVJA 4IG3A 4CIEA 1BQMA 1DLOA 1EX4A 3ZSZA 1B9FA 4CHNA 1SKRA 2PZSA 4ID5A 4CGGA 4J2BA 4E1NA 1TKTA 4YNQA 2HHXA 1RBVA 1RT7A 3QESA 2B6AA 4M3ZA 5J2QA 1QQCA 4K8XA 3I0RA 1D8YA 4E7LA 1BL3A 3V9ZA 4W5TA 3B6OA 3KD5E 4KI6A 2YHAA 4CHOA 4DU1A 4AHTA 4NCGA 4FLVA 1S6PA 1QS4A 3L8BA 3OJUA 4KHSA 2FBVA 1A5XA 1ASUA 3AVBA 3HPHA 4B9NA 4C8KA 3CFOA 4UQGA 4QAGA 3NBPA 1NK9A 4CERA 4MQ3A 2G8HA 3DLHA 4BE0A 4B9UA 5HBMA 1ASVA 3OYGA 3NFAA 3AVFA 1NJYA 3MXMA 4DSIA 1GOAA 4CESA 1RDCA 1WN7A 3P83D 4QOZB 2HHUA 3QO9A 4BWMA 3QEXA 3O4NA 2YNHA 4H4MA 4CF2A 3VA3A 3RR7A 1RNHA 2EHGA 2QXFA 2YKNA 3VQ8A 4N76A 1C1CA 1QE1A 3V1OA 3OJSA 3OS1A 1DTTA 1WNSA 3K5LA 2LSNA 4AHSA 3PO4A 3VQ9A 1UA0A 1Q9XA 5CYQA 1U47A 1VSHA 1QHTA 4O44A 3KTQA 4HUEA 5KRTA 1TAQA 4Y1CA 4JRPA 4DQQA 4YFUA 5HP1A 3T1AA 2ATQA 1YTAA 3D0PA 3ZSOA 1JXEA 3C94A 1XI1A 3L2QA 3KKRA 3O4QA 1SL1A 2HMIA 1ZBFA 4Y1DA 2VG6A 1VSKA 3BDPA 3RTVA 3S3OA 4FJ5A 3OYFA 4L8RB 1W0HA 1REVA 4FJ7A 4RW9A 3LP0A 2HHVA 3KIOA 4CJPA 4ZTFA 3NF8A 1L5UA 3PX0A 3LPTA 3C6TA 2ETJA 4KREA 1LAWA 3HP6A 3CM6A 2BDPA 3NF9A 1WSGA 1YVUA 3CFPA 2OPSA 3KLIA 4FJHA 5SWMA 4FJ8A 3ISNC 4DQSA 2B4JA 1U4BA 4BDYA 5I42A 3P1GA 1T03A 4BE1A 4F4KA 3OYMA 3SJJA 3WNGA 1EKEA 3LP2A 1U48A 3VQ7A 2P51A 2OPQA 2PYLA 3VQBA 4CEFA 4Q5VA 4OLAA 4XIUA 3KK1A 3DM2A 2A1SA 3HL8A 3SQ2A 1RTIA 4DWIA 5EU7A 1JXBA 1VSJA 5FRMA 1HQUA 1SKSA 4DTSA 1YTUA 1CXQA 3AA4A 1N5YA 4CEOA 1TGOA 4HUGA 3TAFA 2BGGA 1JLGA 4PA1A 3WNEA 1SV5A 3AO3A 4C8MA 4CJUA 1RT2A 3SYZA 1NJXA 3ZT2A 4DTPA 3SQ0A 1BCOA 3V81A 1KVCA 4FZXC 4F8RA 5CYMA 4FM0A 1SUQA 4GVMA 2G8KA 2BE2A 2RKIA 1EXQA 4OPKA 4M3UA 4F2RA 4RG8A 2HHWA 1XWLA 1TK5A 4DS4A 3OYEA 3EY1A 4CJTA 2IGIA 2Z1IA 5E41A 2RF2A 2OZMA 3PX4A 1TL3A 4E7KA 4B9TA 3T19A 2A1RA 1T05A 1KFSA 3OS0A 1CZ9A 4E19A 1KTQA 3DLRA 4WE1A 3EYZA 3PX6A 4FJJA 2HVHA 4DTOA 1BCMA 3OYCA 3LPUA 5C42A 3MECA 5HRPA 3V4IA 3AVKA 4FLXA 1NK0A 1SKWA 2HHQA 1NJZA 3QETA 4FLUA 3OYDA 3BGRA 3T3FA 3C95A 4DSEA 4B8CA 4F2SA 1T7PA 3VQ6A 2D0BA 4CJSA 4ELVA 4J2AA 4MFBA 3CFRA 1ZBUA 4M3TA 5HRRA 1HJRA 1S1VA 4OJRA 4E1MA 4KTZA 3QINA 4M3RA 4AHRA 3SUNA 1LWFA 1BQNA 4DF8A 3AVAA 4DSJA 4CHZA 4ZTJA 4FVMA 5DK5A 3ULDA 1S9GA 5FROA 4CJFA 3QNOA 3TWHA 2IOCA 1TL1A 5DMRA 1HQEA 4CJLA 4HUFA 1BISA 4CFBA 1D9FA 4ID1A 1JKHA 4FW1A 5J2PA 4NCAA 3AVLA 5CZ1A 1S1XA 4LD0A 1JLQA 1S1UA 1RTDA 3IAYA 2D5RA 1HYSA 1S1WA 1HMVA 4C8NA 1T8EA 4Z4CA 4JRQA 2GUIA 1S6QA 1TKXA 2YNGA 1NK8A 2IDOA 1KLMA 1WSHA 1ZYQA 3VQPA 1C6VA 2FBXA 2G8IA 4B9SA 4AHUA 2HVIA 2Z1HA 4CHPA 3U6FA 2HNYA 4OGCA 1NK7A 1IG9A 4CIGA 2KFZA 2XY6A 4Q0BA 3KLFA 3PV8A 1HRHA 1LAVA 3E01A 3OYHA 2OPPA 2HB5A 3HVTA 3V9XA 2HNDA 3KLGA 1WSEA 3K57A 2FBTA 1WSJA 3HM9A 4IFVA 3NDKA 2Z1JA 3VQAA 1S1TA 1WSIA 4LSLA 1RT1A 3O3HA 3AA3A 4CGHA 4DSLA 3LWMA 2JLEA 3K59A 4DFMA 4DFPA 1NKEA 4C8OA 1KVAA 3ZSRA 3VA0A 4CFDA 1NKBA 2XRIA 4DQIA 3MXIA 4R5PA 1EP4A 3LZJA 3IRXA 5CZ2A 2YHBA 2ZQBA 1NKCA 1B9DA 1RDDA 2HNZA 3L2RA 1TKDA 1KLNA 1TVRA 1IO2A 3ZSYA 4FLWA 1J5OA 3HJFA 1HNIA 2YKMA 5K14A 3V6DA 3DRRA 3SZ2A 1RILA 4CIFA 4Z4FA 4FJMA 3OVNA 3QEIA 1TK8A 3K5OA 3I8DA 4KPYA 2QK9A 2HHSA 3QIOA 4KHWA 1XC9A 4CJVA 2Y1JA 1QSYA 3TANA 4CECA 1W9HA 4KB0A 4FW2A 4IG0A 4OKJA 2F96A 1K6YA 2VG5A 4CGDA 4Z4EA 4Z4GA 3L2VA 3M8PA 3V1RA 3I0SA 4CJEA 1VSIA 4O4GA 1RTHA 3CM5A 3WNFA 3OYLA 4NCBA 1UA1A 1NK5A 1LWCA 3V9SA 4DQPA 4CF9A 3TAGA 4ZHRA 1JL1A 1X9WA 3MXJA 3HVRA 2XY7A 4B8AB 4DTJA 1EETA 2HW3A 3TAPA 2OYQA 4HCCA 4CJ3A 4PUOA 3O3FA 3KK3A 4I9LA 1FKOA 1O1WA 4DF4A 1ASWA 1YT3A 3DOLA 1C0UA 1TKZA 1U04A 5J1EA 3RMAA 4E3SA 5HROA 4HHTA 5CY4A 2Q3SA 4GW6A 5J2MA 3LAKA 3TAMA 1L3VA 3AO5A 2E4LA 2F8TA 1QSSA 2IS3A 4CK2A 2FC0A 1RBSA 4KV8A 4FZZA 2E6MA 4DU4A 1GOBA 1CXUA 2D0CA 3AV9A 1G15A 4FM2A 3NF7A 3ZT3A 4F3TA 1FKPA 3IS9A 1I39A 4KRFA 3LANA 3CG7A 4I2QA 4JS4A 4CHQA 4AILC 2JGUA 2KZZA 3HPGA 3NCIA 1X1PA 4CFAA 1C1AA 4IBNA 4DTRA 3TR8A 4O0JA 4E0DA 3LZIA 1UOCA 1LW0A 4CEZA 3ZSXA 2OZSA 4DS5A 3DMJA 1JLFA 3A2FA 3DLBA 5JS2A 1KVBA 4PQUA 2FBYA 3AVCA 4CEEA 4M3WA 4DSFA 1VSDA 1C0TA 2KW4A 3OYAA 3AA2A 1I3AA 1LW2A 1F21A 3DI6A 1DTQA 4IDKA 4E7IA 4DSKA 1BIZA 2D0AA 4AHVA 1NK4A 1IH7A 3NAEA 5KGXA 3NH0A 1HYVA 3H08A 2XHBA 3SUOA 2G8FA 4KHUA 4ELTA 1C0MA 1RT3A 3DLEA 2KTQA 5C25A 3OYNA 1JLAA 1KCFA 1LWEA 4LH5A 5FDLA 1ZBHA 4B3OA 3S3NA 2OA8A 3SQ4A 3NF6A 4OKEA 3ZSWA 2ZE2A 3KJVA 2WOMA 1SL0A 4ELUA 3NHGA 5KGWA 3LDSA 3SUPA 3QLHA 3DOKA 3SI6A 4IFYA 3OS2A 2KZMA 3THVA 1L3UA 4B9VA 4DQRA 1WLJA 3DLGA 1L3TA 3ZT1A 3ZT4A 3NE6A 2R7YA 4FK0A 3RWUA 1ITGA 3TAQA 3LP3A 4OGEA 4KKOA 3NH2A 1IKWA 1J53A 4CGJA 4M3XA 4B9LA 3M8QA 4ICLA 3U3GA 4CEAA 3RMDA 3QEPA 3PO5A 1HNVA 4G1QA 1Z25A 3ZT0A 3ZSQA 5J2NA 4CJ5A 3RMBA 2YV0X 2EX3A 4FK2A 1VK0A 3UIQA 4AHCA 4DU3A 4DFKA 4DMNA 2VWKA 3P5JA 4KO0A 2DFHA 3TARA 4FJNA 3HXMA 3TI0A 4FLZA 4FYDA 3OYIA 4JS5A 3CYMA 2X6NA 1J54A 4FLYA 3F9KA 3NH1A 3K2PA 3NGYA 3DRPA 4HVJA 2P5GA 3ASMA 3SQ1A 4DTUA 4FJIA 2O4IA 4OKKA 4KAZA 4DLGA 3DRSA 3KK2A 3JSMA 4CGFA 3MAQA 3RRHA 3SNNA 1NOYA 1BI4A 5FRNA 2X74A 3NGIA 3SV4A 2XY5A 5JS1A 4E7HA 1TV6A 2E6LA 3SCXA 3OYJA 1D9DA 4W5QA 4DG1A 4QCLA 3V9WA 4KFBA 3DLKA 4RW7A 3EZ5A 4EZ6A 4O5BA 3ZCMA 5I3UA 2VWJA 3FFIA 4CJWA 3MEGA 3VQQA 2Z1GA 3QIPA 5KRSA 1NK6A 3K58A 3LWLA 3ITHA 4K8ZA 3F73A 1Y97A 3K5NA 1RBUA 1HPZA 1Z26A 1UAXA 3B6PA 1S5JA 3M8RA 3L2WA 1ZBLA 3LALA 2QKKA 2DY4A 2Y1IA 3K5MA 5T7BA 4BDPA 4J2EA 4EP4A 3OYBA 4KI4A 1U49A 1C1BA 3RR8A 3CQ8A 3D45A 1IKXA 4DFJA 3V9UA 2IAJA 4E89A 3OY9A 4FJXA 4HCBA
chains in the Genus database with same CATH superfamily
3KLHA 3ALYA 1HKBA 2GV9A 1JLCA 3VQEA 4BRPA 4B1XB 5JLFA 1GLDG 1L3SA 3ENHA 4WF9L 4O5FA 2NLXA 3E9LA 2HHTA 4GKKK 3KVGA 4DTNA 1Q86O 2HBLA 4FWQA 1Q9YA 5GAHP 1H1VA 2GBZA 5KPRA 3ZX3A 3SBTA 3SPYA 1KAXA 4GMJB 3KLEA 3U4LA 4CJKA 3IDHA 1MDUB 4CK3A 4W5NA 4EHTA 4IEIA 1ATNA 4LC9B 1JLBA 3MK6A 4Z4IA 3M8SA 3CCJN 5KTQA 4CJQA 1YHQN 5HRSA 1QHAA 4PWDA 4I9QA 2XO7A 4CJ4A 4YOVA 4PHTX 5AQTA 1KSPA 4RW4A 2FLOA 5MLCQ 3G0ZA 2BANA 1RT4A 1RDAA 4A5AA 2PAVA 4A61A 1RBTA 3HTVA 1KFDA 4C8LA 2OTJN 1J9AA 3QBWA 2G8WA 3JXUA 4DV1K 3THWB 1ZBIA 4OLBA 4HTLA 4WFNL 1FK9A 2PY5A 3KD1E 1VRUA 5D3GA 5M1FA 1TAUA 3VQ5A 5KI6A 4H0PA 3GOIA 3DYAA 4CF0A 2GUPA 5AQOA 2IC3A 4AH9A 3AA5X 4Z4HA 4H8KA 3BF1A 1M1KO 4PY5A 2RPIA 3IG1A 3CCSN 3G25A 1BA0A 3AVHA 5LMNK 1GLJO 3WNHA 4JI2K 4FWRA 1VSLA 3VEVA 3GG4A 3MN5A 4KTWA 4JKEA 1SKRA 5AZIB 3JAMO 4YNQA 2HHXA 5J2QA 2NRHA 4DKWA 3B6OA 1YJNN 1K73O 4H5VA 3L8BA 1DT9A 3I8BA 3MCAB 4X65K 4QAGA 2GWKA 4MQ3A 2G8HA 5KQ8A 5AQYA 2HOEA 3TTDA 2ZM6K 1GOAA 1WN7A 4BVPA 4XEIA 3QO9A 1JCGA 4JK9A 4O8KA 2EHGA 2QXFA 4M7YA 3PO4A 5CR4A 4O44A 3KTQA 4HUEA 5KRTA 4JRPA 4YFUA 5HP1A 4BRGA 5JLHA 1YTAA 3HM8A 4H0VB 4MO5A 1P90A 2JWLA 3KKRA 1SL1A 3S3OA 2E2OA 4JK7A 4CJPA 5C10A 4ZTFA 3WEEA 4R79A 2BTFA 4DR4K 3SAHA 4LF9K 1LAWA 4GNIA 4CZJA 1SAZA 1WSGA 3CFPA 3ULEA 1ESVA 4GKJK 2B4JA 1U4BA 5I42A 3P1GA 2P9PA 4BE1A 1T03A 2A42A 3CCVN 1EKEA 1U48A 2P9KB 2P51A 1WOQA 4CEFA 3CCMN 4Q5VA 3U8XA 2ZF5O 2A1SA 4GY2B 2AA4A 5FRMA 3AA4A 1N5YA 3VGMA 2BGGA 1JLGA 3KZBA 3WNEA 2W6LA 2E20A 1NJXA 4BRFA 3V81A 4FZXC 3R1XA 1NGJA 2ZJQL 1SUQA 4FM0A 3CJ1A 4BR5A 2E2QA 1X9JA 5LL6Z 3OYEA 4FO0A 2IGIA 3D7EO 3CF5L 3PX4A 4E7KA 4PL8A 1KC8O 1VQ8N 2E88A 4FJJA 1BCMA 3DXKB 3LPUA 3M5RA 1NJIO 3V4IA 3AVKA 5LY3A 1NJZA 4FLUA 3CJ9A 3T3FA 3NVMA 5BR9A 4FOEA 4J8FA 4BRNA 4CJSA 2GWJA 4MFBA 4DR3K 4OJRA 4DV5K 4CHZA 4EIAA 4FVMA 5GADP 2O8EB 5FROA 5DMRA 1D9FA 5M1OA 3RSEB 3O9TA 4NCAA 4JKHA 3EO3A 2D5RA 4U67L 1NMDA 1HMVA 4C8NA 1HYSA 3GE1A 4JRQA 1S6QA 2YNGA 2IDOA 1WSHA 3O80A 1ZYQA 2FBXA 4XH1A 4B9SA 4AHUA 2HVIA 5ELZA 3KLFA 1N36K 2HB5A 3VENA 1WSEA 1WSJA 3NDKA 1S1TA 3BZKA 1RT1A 4DFPA 3ZETB 1NKBA 3T7ZA 2E5LK 1NGAA 3MXIA 3O1BA 3LZJA 2GTDA 2YHBA 5C2DA 1MA9B 1TVRA 1J5OA 1HNIA 1NNEA 3SZ2A 1RILA 4CIFA 4LF4K 1TK8A 3EL2A 4JHDB 4KHWA 3D2FA 4YOYA 1QSYA 1W9HA 1XUPO 2F96A 4Z4EA 2WC9A 3I0SA 3CM5A 3MCPA 3U9DA 3CPWM 3TAGA 2XY7A 2ZGYA 2HW3A 5GAEP 4HCCA 4PUOA 3O3FA 5EVZA 5EXWA 4X62K 1ASWA 2GEMA 3MDQA 5CY4A 1IV0A 1E4FT 2UUCK 5J2MA 3VESA 1DEJA 3O9RA 3TAMA 1L3VA 1N8RO 1VQMN 4DU4A 4B3SK 2E2PA 1I39A 4IO8A 5AQIA 2VCPA 4KH6A 1X1PA 4A59A 2I7NA 1LW0A 3ZSXA 4DS5A 2HSTA 1TUUA 3DLBA 1KVBA 4B1WB 5F0XA 2FBYA 3AVCA 2KW4A 2IVOA 4H03B 1LW2A 3DI6A 4OPAA 5BPNA 4IDKA 4E7IA 1BIZA 2D0AA 3EE9A 3VF4A 4AHVA 5KGXA 3A5LC 3H08A 2G8FA 3LDNA 4ELTA 2J4RA 3H45C 5FDLA 3SQ4A 4DV2K 1HNZK 4I6MA 4JKFA 2ZE2A 3KJVA 4GV9A 1Z6RA 1SL0A 4ELUA 3QLHA 4BRIA 1W97L 4IFYA 3SLCA 3THVA 3DLGA 3H1VX 3LM2A 3ZT1A 3NE6A 2PFUA 3M8QA 3RMDA 5CE3A 3ZYYX 1T44A 1Z25A 3ZT0A 3IMXA 3ULEB 4DR5K 4DUYK 1VK0A 5AFUH 3UIQA 4AHCA 4DMNA 2VWKA 2P9PB 3P5JA 4KO0A 3K0SA 3HXMA 4FVUA 3OYIA 3S41A 3DXMB 3O9QA 4JS5A 4FLYA 3F9KA 3NGYA 4HVJA 3VGLA 3ASMA 4FJIA 3VEXA 3DRSA 3RRHA 3VTIA 3CJCA 2FXUA 5FRNA 2X74A 2XY5A 4BY9C 4E7HA 1TV6A 2E6LA 3SCXA 4W5QA 4DG1A 1OVYA 4KFBA 3J81O 3DLKA 3CERA 3EZ5A 2KLAA 4O5BA 3ZCMA 4JKBA 1QVGM 3VQQA 5TKYA 4JKAA 4K8ZA 3ITHA 5BN9A 1HPZA 1UAXA 2QWNA 2DY4A 2W41A 3R8EA 5IWAK 1U49A 3RR8A 3D45A 3THWA 4FJXA 5AQUA 4HCBA 3O3GA 3O1WA 3RMCA 2DTUA 4N5SA 3DAWA 3FZHA 3HZ6A 1LV5A 1Q7YO 4E7JA 4C1NK 5SZTA 3OTOK 1IJJA 1OH6A 4KB1A 3CXCM 2AJQA 3TABA 4KHQA 1VSMA 4B3RK 3PY8A 3E66A 4KHYA 4RTFD 1WSFA 3Q7BA 1DGKN 4Y0WA 1RCHA 2BUPA 1HR0K 5C24A 4CEDA 4DV3K 2DFFA 1RBRA 4DR7K 3QDKA 5BR8K 2P1JA 4EP5A 2YHYA 3HI0A 3CMEN 4HTUA 2FSJA 4NYFA 4M7XA 1XHXA 4BRMA 3AO2A 1E4GT 2W42A 4NB4A 4G9ZA 2WONA 3F9MA 2QWOA 1HUXA 1BI4B 5AQSA 4F3OA 4JEPA 1RDBA 4H0OA 2KQ2A 1C0GA 4BG8A 3QERA 5BREA 3CC4N 3TAEA 1N32K 1X9MA 4CD3A 4O0IA 1VQLN 2F9WA 4B08A 1ZXOA 4N47A 5CHIA 4BGBA 4FJKA 4MDBA 4CZMA 2WFBA 4FJGA 1WAFA 3D2FB 2YNIA 1W7AA 1GOCA 2VGNA 3JYTA 1IKYA 4TSXA 3FR0A 1R0AA 3TTCA 1VAZA 1S9EA 1HYZA 4JI8K 3FE1A 2P9IA 5FPMA 3FFKB 1BIUA 4CBUA 4DTMA 4EHUA 5LMUK 2G8UA 3WQTA 1NGCA 2CGLA 3W3DA 1QTMA 2PZSA 1ATRA 1DLOA 1EX4A 2W40A 3I33A 1BO5O 2F4VK 2P9KA 3UKUA 1TKTA 1RT7A 2B6AA 4K8XA 1QQCA 3I0RA 4FWNA 3V9ZA 3KD5E 1BUPA 1QS4A 4NXNK 2ZGZA 1ASUA 1NBWA 4DV4K 1NK9A 4CERA 4BE0A 3CCLN 4B9UA 4YOWA 2HBKA 3DLLL 5AQVA 5ADXH 3VERA 3P83D 2NRTA 3QB0A 3O4NA 2P9SB 1YAGA 4H4MA 1V4SA 4CF2A 3RR7A 1FJGK 2YKNA 3VQ8A 3J7ZO 1QE1A 3V1OA 3OJSA 1DTTA 1T3VA 2LSNA 3VQ9A 1UA0A 1Q9XA 1R59O 5CYQA 4B3MK 1VSHA 1QHTA 3DXKA 2CGKA 4I6MB 2GELA 4ISFA 4BRAA 4YOTA 4WQ5A 2ATQA 5I9EB 1VHXA 3ZSOA 4IJNA 2NRXA 3P38A 3L2QA 4Y1DA 3G4SN 3BDPA 3RTVA 2HF4A 2O8EA 1W0HA 5A2QO 4JI0K 2HHVA 4A2AA 3LPTA 3RSEA 4IOAL 3VPZA 3CM6A 1VQNN 1IBKK 1TUYA 5AFUA 1W2BM 4FJHA 3IKMA 3QFPA 4B1YB 3ISNC 4CVNE 4DQSA 2E1YA 4F4KA 3OYMA 3SJJA 5GAGP 3LP2A 1RGIA 2ASPA 4H5RA 2OPQA 4BVOA 3TU5A 2P9UA 3KK1A 3SQ2A 3HL8A 1RTIA 2NRRA 4JV5K 4B1ZA 3D6RA 4BR0A 2NRWA 4CZLA 1YTUA 4FWSA 1Z05A 2V52B 3OHRA 4HUGA 1FW6A 4O8UA 1SV5A 4JKDA 3ZETA 4CJUA 3VMFB 3SQ0A 4UY8O 5F1XA 5CYMA 2RKIA 4F2RA 3EKSA 4DR2K 3E9OA 3J7YP 4RG8A 2YX6A 1TK5A 3NMUA 5E41A 5AQGA 4CBXA 3CC7N 4B9TA 2VWBA 3P31A 4JHDA 4OX9K 1KFSA 4FSVA 1CZ9A 4DHYA 2FSKA 1BOTO 3EYZA 4DTOA 3LDQA 3O6WA 3OYCA 5HRPA 1NK0A 3VEYA 4BQZA 3OYDA 3BGRA 2HBJA 4AM6A 2YJEA 2QM1A 1T7PA 3VQ6A 4ELVA 4LF5K 4M3TA 2QWMA 4E1MA 3QINA 4M3RA 1LWFA 4DF8A 3VEZA 4ZTJA 5DK5A 3QNOA 3O5BA 4DR1K 2IOCA 1TL1A 4CJLA 1BISA 4ID1A 4BC3A 3EKUA 2YCHA 5CZ1A 1S1XA 4LD0A 1RTDA 4JI5K 4NLCA 2GUIA 1NM1A 5KPTA 3U6FA 2HNYA 5C2FA 1NK7A 1IG9A 4CIGA 2BH1A 1YI2N 4B3TK 3KWGA 2OPPA 3V9XA 3HVTA 3LL3A 3UKRB 4DSLA 4CI6A 3FZMA 1K8KA 4PKIA 3A5MC 4DQIA 3ZSRA 3VA0A 3QFUA 3K9KA 3QBXA 5AQWA 4YDUC 1KQSM 1B9DA 1TKDA 1QVFM 2YKMA 4Z4FA 3QIOA 1XC9A 4IDHA 4U7BA 3A0IX 3TANA 3VF6A 3F2KA 4OKJA 3L2VA 3M8PA 3V1RA 2P9IB 4O4GA 3WNFA 4DUZK 1LWCA 3V9SA 2O8BB 4BG9A 3MXJA 3SBGA 2HBMA 3EEQA 4DQ8A 2FSNA 1U6ZA 4JYAK 2ASMA 1P8ZA 1TKZA 5BRFA 1U04A 5HROA 4B1UB 3DXMA 3UKUB 2Q3SA 2WTUA 4DV0K 1HKGA 3L6QA 1T6DA 1QSSA 3MX5A 3AAQA 4NO7A 2RHKA 1CXUA 2IVPA 1WUAA 4JI7K 3NF7A 1FKPA 3LANA 3CG7A 4I2QA 4JS4A 4CHQA 4KH4A 4NLBA 4FOIA 3PIOL 1C1AA 3LZIA 1IBLK 2QWPA 4DV7K 3KK7A 3DMJA 1U2VB 2HF3A 4PQUA 5ADXA 3N4PA 4DSFA 3C0BA 3ZLJA 1MWMA 1F21A 1DTQA 2Q1NA 4DSKA 4YHHK 3KWIA 1NK4A 1IH7A 4WQ4C 3NAEA 3NH0A 1T6CA 4KHUA 2KTQA 1C0MA 1YUWA 3DLEA 5C25A 1LWEA 4IWVA 3AY9A 1ZBHA 4BRCA 3S3NA 3NF6A 1NU0A 3CCRN 3SI6A 3OS2A 1Y64A 3SMPA 3GL1A 4KKOA 4WFBL 3NH2A 5E84A 4CGJA 4H0YB 3ZEUB 3PO5A 1HNVA 1KXPA 3ZSQA 1OVQA 1YJWN 4CJ5A 2YV0X 4K25A 5JVGL 4FJNA 2DFHA 2YJFA 5F2RA 1YF5L 1EQYA 3SAFA 3DJCA 2D1KA 4DTUA 2P9UB 4OKKA 3P4IA 4KAZA 3JSMA 1VQ5N 2V7ZA 3PIPL 1BI4A 4FWMA 2A3ZA 1ILYA 2ZJRL 3OYJA 4QCLA 4C23A 4RWTA 1I94K 4CJWA 2Z1GA 2HMPA 1NK6A 3K58A 5AQRA 1GLLO 3L2WA 3LALA 4BROA 5BRHA 3WXMB 4EP4A 3GDQA 3LM9A 3O9SA 4KI4A 4WQ4A 4DFJA 1IKXA 3V9UA 2HHUA 3EE8A 1JJ2M 4MLHA 3VQCA 4OVLA 4W5OA 4FCYA 3LP1A 4CFCA 4BWJA 1V4TA 2P9LA 1VSEA 2KFNA 2FF3B 2QWRA 3QNNA 1NGGA 3KKSA 3TSQA 3WXKA 1VSFA 3MEEA 4N41A 4H4OA 1EWRA 4KTQA 1YITN 3L3VA 4DB3A 3OYKA 1Q81O 4JAXA 3SAGA 5HRNA 3SPZA 1NOZA 4CF8A 4FK4A 2UU9K 1JCFA 4H0TB 3P39A 3CC2N 3DWLA 2VG7A 3MN6A 3HYFA 4BDZA 1OH7A 3VN5A 3NGZA 4RW8A 5AQZA 3AO4A 1U45A 4CE9A 1XMQK 1SL2A 4E1JA 3U3YA 4KHPK 1IKVA 1EWQA 3AVIA 2Q31A 5C15A 4N56A 3QEWA 1NGBA 1BHLA 1K8KB 4IOXA 4KHNA 2P9SA 4H5NA 1UWBA 3L0QA 3C65A 4I7FA 5LJWA 5AZJA 5KQDA 4ISEA 1X9SA 3BF3A 1JL2A 3O9UA 4QS7A 3G10A 4FJLA 1WAJA 2V51B 4RW6A 1FXXA 4W5RA 2QKBA 4L3QA 1LOTB 1RT6A 2WUSA 2ZD1A 3BP8A 4LH4A 4FJ9A 3AVGA 3TPQA 1Q8IA 4JD2A 4M3YA 3BEXA 4LFCK 3SK3A 1RTJA 4DLEA 2G8VA 2W6KA 4DTXA 2X78A 4NYNA 4WFAL 4J2DA 3HK2A 2VQEK 1BA1A 4O55A 4LY7A 4M41A 4EAHD 3HT3A 1B92A 3CJBA 1A5WA 1XNQK 1GLBG 4JLHA 4OPJA 4MDAA 4BE2A 1VRTA 4I2PA 1WBDA 4FLTA 2QWLA 4QS8A 2AP1A 4IG3A 4CIEA 3ZSZA 1S72N 1ZC6A 4PL7A 4CGGA 1D8YA 3E9PA 4MLEA 4CHOA 4DU1A 4FWPA 4NCGA 4AHTA 4KHSA 3AVBA 1A5XA 4C8KA 4Z94A 3HPHA 4B9NA 1VQ4N 3FLCO 3EZWA 1XC3A 1TYQA 5HBMA 4BRDA 2VQFK 5EOYA 1S3XA 1NJYA 3MXMA 3THYB 4CESA 1LCUA 3CHWA 4BWMA 3QEXA 2YNHA 4AQYK 1RNHA 4FWOA 5B8HA 1XNRK 1C1CA 3CD6N 3OS1A 1WNSA 3K5LA 4AHSA 2OANA 4IO9L 2QXLA 1BG3A 4A5BA 3HBTA 4CZKA 1VQPN 2CH6A 3N4QA 2Q36A 1ZBFA 5TKWA 2VG6A 4FJ5A 3MN9A 3JS6A 4L8RB 4RW9A 2E1ZA 3NF8A 3TTFA 1L5UA 3UB5A 3C6TA 3HP6A 2BDPA 3Q7CA 4H0XB 1IG8A 5SWMA 4FJ8A 3AAPA 3FZFA 4BDYA 3IFRA 4CZGA 2FF6A 2PYLA 4CW7B 4X66K 2KHOA 4DCHA 1HNXK 4GV3A 1OKJA 4CZHA 5EU7A 3MMVA 1VSJA 1N34K 1HQUA 3O08A 4DTSA 1YVNA 3UKRA 3SYZA 1M90O 2O8FB 1RDWX 4GVMA 2G8KA 4M3UA 4OPKA 5AQHA 1QZ5A 2HHWA 4DS4A 3EY1A 4CJTA 2OZMA 2RF2A 3WXJA 1T05A 4A62A 3VGKA 3OS0A 3CIPA 4E19A 1KTQA 3DLRA 5FPNA 1OH8A 2OCEA 4WE1A 1EO1A 5C42A 3MECA 2H3GX 2HHQA 2P9LB 2ITMA 3C95A 4DSEA 1RDUA 4B8CA 4F2SA 1YJ9N 2O8BA 5AQKA 2D0BA 2A6AA 5M1NA 3CCQN 4J2AA 3CFRA 1ZBUA 1HJRA 4AHRA 3SUNA 4DSJA 1S9GA 4CJFA 3HOTA 4HUFA 1CZAN 4BR2A 3AARA 4CFBA 1K9MO 1JKHA 4IZ9A 1Q82O 1NG9A 3IAYA 1S1UA 2UXDK 4M63C 4YY3K 1E3MA 1S1WA 4CBWA 1K8AO 3QICA 1NK8A 1KLMA 5FPDA 3VQPA 3RVCA 3C7NA 5AQQA 2Z1HA 4CHPA 4OGCA 2DPNA 3PV8A 1LAVA 3E01A 1IBMK 3OYHA 4BR9A 1N33K 4KH5A 1U2VA 3VEOA 3G6EN 2VGMA 4IFVA 2Z1JA 3VQAA 4LSLA 4LF6K 3O3HA 3AA3A 4IEEA 5AZJB 3VF2A 4CGHA 3LWMA 2JLEA 4DFMA 1J5EK 4C8OA 1XQSC 5AQMA 4R5PA 1EP4A 3VOVA 5CZ2A 3G71N 1YIJN 1RDDA 2HNZA 3L2RA 1KLNA 3ZSYA 4FLWA 1KAYA 5K14A 3DRRA 2D4WA 2WBNA 3QEIA 4FJMA 3K5OA 5C12A 4HWIA 4JD2B 3I8DA 2Y1JA 5HL7L 3WT0A 2VG5A 3FGUA 4BRHA 3CI5A 4CJEA 1VSIA 1BU6O 3BZCA 3OYLA 4NCBA 1UA1A 3E1YA 2JWKA 5AR0A 3OA9A 3QMLA 3ZEUA 4CF9A 4ZHRA 5BN8A 3HVRA 4MO4A 4B8AB 4IOCL 1EETA 4BR7A 3TAPA 2OYQA 2ASOA 4CJ3A 3I56N 3KK3A 4I9LA 1FKOA 2A5XA 4DF4A 1YT3A 3RMAA 1C0UA 4XH4A 3W0LA 5J1EA 4HHTA 2F8TA 2YHXA 4CK2A 2FC0A 4KV8A 4JKGA 1GOBA 2D0CA 1VQ7N 4FM2A 5EY4A 3IS9A 4KRFA 3TSUA 2KZZA 3HPGA 4OO1J 4LFBK 5E26A 2QI2A 4CFAA 3D2EA 1TYQB 4IBNA 4DTRA 1O13A 1UOCA 2OZSA 1D4XA 1X3MA 4BRKA 3ATUA 2D0OA 5JS2A 3H1QA 1G99A 3L4IA 4CEEA 5AQFA 2VYPA 1VSDA 1C0TA 2EWSA 3C6HA 3AA2A 3H6EA 1I3AA 3CPEA 3SUOA 1RT3A 4B3OA 4BC5A 4JNEA 4OKEA 5M1QA 3ZSWA 2WOMA 3NHGA 3C6AA 3LDSA 1NGHA 2Q0UA 2KZMA 1L3UA 4DQRA 1WLJA 1L3TA 2R7YA 4V19S 5GIOA 1ATSA 3TAQA 3LP3A 4PKHA 2P9NA 1IKWA 1J53A 4FWKA 4B9LA 4CEAA 3WXIA 4G1QA 3PLAA 4ILJA 3RMBA 4FK2A 2EX3A 4BREA 4DU3A 4DFKA 1XMOK 1VQ6N 3CYMA 2X6NA 1J54A 2I7PA 3T69A 4DLGA 3KK2A 3MAQA 5BRDA 1NOYA 2QTDA 1D9DA 3V9WA 5DM6L 4RW7A 4FPAA 4EZ6A 5I3UA 2VWJA 3FFIA 3LDLA 3FZKA 1RBUA 1Z26A 1S5JA 2YI1A 4FL9A 3THXB 4BDPA 4J2EA 1BDGA 3SJHA 3CQ8A 3OY9A 3R9PA 4DV6K 4FM1A 3S9HA 4Z0UA 5AQXA 2PBDA 4IKFA 3J7AP 3HSTB 1WB9A 3KHYA 5JICA 1BGXT 2DFEA 3ZSVA 1TK0A 1MU2A 2B5JA 3MEDA 2OTLN 5C0YA 1CZBA 3ZX2A 5BPMA 5JMVA 4LSNA 3AVMA 3AO1A 1HLUA 4EFHA 4CCHA 4FXDA 1WBBA 2RN2A 1NMNA 4CF1A 1KRPA 3SMSA 2F8SA 3SUQA 5KPZA 3QEVA 1RT5A 2UXBK 4K42A 4CJRA 3ZX0A 5JVHL 3C7NB 3LAMA 1SS6A 3L2UA 3CQXA 2A40A 3ATVA 3HP9A 1D5AA 1JLEA 2F7TA 2OPRA 3HPOA 2P5OA 1A5VA 3C6UA 2IVNA 2NRVA 4QS9A 1VQKN 4B9MA 3O8MA 1X3NA 1RFQA 3VQ4A 3THYA 2YNFA 4CEQA 3MWTA 4IXCA 2NUBA 4JN4A 2O4GA 4LFAK 5HLFA 4YDUA 3RRGA 3H46O 4CK1A 1XHZA 5GIPA 4BACA 2X6SA 2F9TA 3L3UA 4C1NI 3PUFA 4JI1K 3S3MA 2XY8A 4YORA 2O8DB 2ITGA 4CEBA 3O4WA 4YOUA 3LDOA 4WYBA 5GINA 2I5JA 3V1QA 2GX9A 3HO1A 3GBTA 4M42A 3AVNA 3CCUN 4EZ9A 4CHYA 3ENOA 2UYTA 3VQDA 3WUHA 3SV3A 1QSLA 1N6QA 4CGIA 4JK8A 2E2NA 4M45A 1NJWA 2PYJA 4FZYA 1CLQA 3AVJA 1BQMA 3EN9A 4CHNA 1B9FA 4ID5A 4J2BA 4H5TA 4E1NA 3CJ7A 1RBVA 1KAZA 4JKGB 3QESA 4M3ZA 3F5TA 4E7LA 1BL3A 4W5TA 4KI6A 4IFEA 2YHAA 2QWQA 4FLVA 1S6PA 3OJUA 3J80O 1VQ9N 1QQMA 2FBVA 5EX5A 3BUZB 3D2EB 3CFOA 4UQGA 3NBPA 3I55N 3DLHA 2NRZA 1ASVA 3HRGA 3OYGA 2O8FA 3NFAA 3AVFA 4DSIA 1NGIA 1RDCA 3VEWA 1C0FA 4F9OA 1GLAG 2O8CA 3VA3A 4N76A 5M1PA 2CH5A 3IUCA 3T1HK 1U47A 4IJAA 4CZEA 5FLXO 1TAQA 4Y1CA 1JCEA 4DQQA 4A2BA 2Q2RA 3T1AA 3D0PA 1JXEA 3C94A 1XI1A 4BRQA 1KD1O 3O4QA 2HMIA 2P9NB 1VSKA 5AJ3K 3OYFA 4LF7K 1REVA 4FJ7A 3LP0A 3AGRA 3KIOA 4GVEA 3PX0A 2ETJA 1NGEA 4KREA 3NF9A 1YVUA 1S22A 2OPSA 3KLIA 3T1YK 2HHHK 2Q0RA 1HPMA 3WNGA 3CMAN 4CJ7A 3OW2M 3VQ7A 3VQBA 4OLAA 4XIUA 3DM2A 3PSFA 4KBOA 4DWIA 1Q18A 5M1KA 1JXBA 1SKSA 3M3ZA 1CXQA 4PKGA 1GLFO 1TGOA 4CEOA 3TAFA 4PA1A 1HNWK 3AO3A 4C8MA 1RT2A 3ZT2A 4DTPA 1BCOA 1KVCA 4F8RA 3VTHA 3A5OC 2BE2A 1EXQA 4BRLA 5HOOA 2UXCK 4JI4K 5BPLA 1HJOA 2RE2A 3B8AX 1XWLA 3H3OB 4X64K 2Z1IA 2ZWHA 1TL3A 2A41A 3T19A 2A1RA 4XH5A 4BQLA 3UE5A 4LF8K 1OH5A 2YHWA 3WQUA 3PX6A 2HVHA 4CZFA 4AF1A 3M1FA 4FLXA 1SKWA 3QETA 4A57A 5DM7L 3L4QA 2NZTA 5HRRA 3MWPA 1S1VA 4KTZA 1BQNA 3CQYA 3AVAA 4YOXA 3ULDA 3TWHA 1HQEA 3WEEB 4FW1A 5J2PA 3CCEN 3H3NO 3AVLA 4FWLA 4RCHA 2CGJA 1JLQA 2KKZA 1MWKA 1T8EA 1GLCG 4Z4CA 1TKXA 1C6VA 2G8IA 3PSIA 2KFZA 2XY6A 4Q0BA 1HRHA 2IIRA 2HNDA 3KLGA 3K57A 1ZBSA 2FBTA 3HM9A 1WSIA 4BGAA 1NLVA 3K59A 1NKEA 4QOZB 2QA4N 1KVAA 3HOSA 4CFDA 2XRIA 4BC4A 4K0KK 2D0PA 3IRXA 3TSPA 2ZQBA 1NWKA 1NKCA 4JI3K 4JKCA 5AQLA 1IO2A 3HJFA 3V6DA 5AQJA 2QK9A 3OVNA 2HHSA 3M6GA 4KPYA 3OBYA 4CJVA 2E8AA 4CECA 3CJAA 4KB0A 4FW2A 4IG0A 4BC2A 3BY5A 4CD1A 1K6YA 3K9JA 4CGDA 3A5NC 4Z4GA 1RTHA 3NVKA 1NK5A 4DQPA 1VQON 4AM7A 1JL1A 1X9WA 5LJVA 4DTJA 3R6MA 2V7YA 2ZJPL 1O1WA 3DOLA 3U9ZA 5AQNA 4E3SA 4GW6A 2NNWA 3LAKA 3VETA 2E4LA 3AO5A 4ILGB 2Q97A 1QQNA 5AZIA 2IS3A 1RBSA 3ID6A 4FZZA 2E6MA 1QQOA 3AV9A 1J6ZA 1G15A 4ISGA 3R3LA 4NXMK 3ZT3A 4F3TA 4AILC 2JGUA 3NCIA 3A8YA 2UUBK 1NGFA 3TR8A 3WXLA 4O0JA 4E0DA 4CEZA 4OPHA 1SZ2A 1JLFA 1NGDA 1QZ6A 3A2FA 3MN7A 5H1SQ 4DR6K 4B1VA 4M3WA 2O8CB 3OYAA 3THXA 3HSCA 3LDPA 1HYVA 2XHBA 2UUAK 3OYNA 1JLAA 1KCFA 4LH5A 4GV6A 2OA8A 4B9QA 5KGWA 3SUPA 3DOKA 4JI6K 3FZLA 4WQ5C 4BR4A 5IT9O 4B9VA 5AQPA 3ZT4A 4FK0A 3J8AA 3RWUA 1ITGA 4OGEA 2QW9A 1BWFO 1YXQA 3ID8A 4M3XA 4ICLA 3QEPA 3U3GA 5J2NA 1HKCA 3TARA 1GLEG 5FPEA 3TI0A 4FLZA 4FYDA 3NH1A 3K2PA 2P5GA 3DRPA 3SQ1A 2O4IA 3OBWA 4WCEL 4CGFA 1SQKA 3SNNA 3SV4A 3NGIA 5JS1A 3ENBA 4K41A 3MEGA 3QIPA 3AGKA 5KRSA 4K43A 3LWLA 4ILHA 3F73A 1Y97A 3K5NA 4H5WA 4FPBA 3M8RA 3B6PA 1ZBLA 2QKKA 2Y1IA 3CETA 3K5MA 5T7BA 2QEXN 2O8DA 4CZIA 3OYBA 3MX2A 1DKGD 1C1BA 2IAJA 4E89A 1HX1A
chains in the Genus database with same CATH topology
3KLHA 4FM1A 3ALYA 3O3GA 3VQCA 3S9HA 2GV9A 4OVLA 1JLCA 4Z0UA 3VQEA 4N5SA 3RMCA 2DTUA 4W5OA 4FCYA 4IKFA 3LP1A 1L3SA 3HSTB 4CFCA 4BWJA 1LV5A 1BGXT 1VSEA 2DFEA 3ZSVA 1TK0A 2KFNA 2HHTA 4E7JA 3QNNA 1MU2A 5SZTA 4DTNA 2B5JA 4KB1A 3MEDA 2AJQA 3KKSA 3TABA 1Q9YA 1CZBA 4KHQA 1VSFA 1VSMA 3MEEA 4N41A 4LSNA 4H4OA 3PY8A 4KTQA 3AVMA 3L3VA 3AO1A 2GBZA 3OYKA 4KHYA 3SPYA 4CCHA 4FXDA 1WSFA 4GMJB 3KLEA 2RN2A 4CJKA 5HRNA 1RCHA 3SPZA 5C24A 4CF1A 4CK3A 1KRPA 4W5NA 4CEDA 2DFFA 1RBRA 1NOZA 4CF8A 4FK4A 2F8SA 1JLBA 3SUQA 4Z4IA 3QEVA 1RT5A 2P1JA 3M8SA 4CJRA 4EP5A 5KTQA 4CJQA 2VG7A 5HRSA 3LAMA 4HTUA 3HYFA 3L2UA 4BDZA 4PWDA 4NYFA 3VN5A 3NGZA 4I9QA 3HP9A 4RW8A 3AO4A 1U45A 1XHXA 4CE9A 1D5AA 1JLEA 3AO2A 2OPRA 3HPOA 2W42A 1A5VA 3C6UA 2XO7A 2P5OA 1SL2A 3U3YA 2WONA 4CJ4A 1IKVA 4B9MA 1BI4B 3AVIA 4F3OA 1RDBA 1KSPA 3VQ4A 2KQ2A 4RW4A 2YNFA 4CEQA 4N56A 3QEWA 3QERA 3G0ZA 1BHLA 4KHNA 2BANA 1RT4A 1RDAA 1UWBA 2NUBA 3TAEA 2O4GA 1X9MA 5HLFA 4I7FA 3RRGA 1X9SA 4O0IA 4CK1A 1JL2A 4FJLA 3G10A 4B08A 1XHZA 1RBTA 1WAJA 4RW6A 4BACA 1KFDA 4C8LA 2X6SA 1FXXA 4W5RA 4N47A 3L3UA 1J9AA 3PUFA 4FJKA 3S3MA 2QKBA 2XY8A 2ZD1A 1RT6A 4LH4A 2G8WA 4FJGA 1WAFA 2YNIA 4FJ9A 1GOCA 3AVGA 1ZBIA 3JYTA 4OLBA 1IKYA 2PY5A 1FK9A 3KD1E 1Q8IA 2ITGA 4TSXA 1R0AA 4CEBA 4M3YA 1VRUA 1RTJA 4DLEA 5D3GA 2G8VA 1TAUA 3VQ5A 4DTXA 1S9EA 2X78A 1HYZA 4NYNA 2I5JA 3V1QA 4J2DA 3HK2A 5KI6A 3HO1A 3DYAA 4CF0A 4O55A 3AVNA 4M42A 2IC3A 4LY7A 4M41A 4AH9A 3AA5X 4EZ9A 4Z4HA 1BIUA 4H8KA 3HT3A 1B92A 4CHYA 4PY5A 2RPIA 3IG1A 3VQDA 1A5WA 4DTMA 3AVHA 3SV3A 2G8UA 1QSLA 1N6QA 4CGIA 4JLHA 3WNHA 4M45A 4OPJA 4BE2A 1VRTA 4I2PA 1NJWA 4FLTA 2PYJA 1VSLA 4FZYA 1CLQA 4KTWA 1QTMA 3AVJA 4IG3A 4CIEA 1BQMA 1DLOA 1EX4A 3ZSZA 1B9FA 4CHNA 1SKRA 2PZSA 4ID5A 4CGGA 4J2BA 4E1NA 1TKTA 4YNQA 2HHXA 1RBVA 1RT7A 3QESA 2B6AA 4M3ZA 5J2QA 1QQCA 4K8XA 3I0RA 1D8YA 4E7LA 1BL3A 3V9ZA 4W5TA 3B6OA 3KD5E 4KI6A 2YHAA 4CHOA 4DU1A 4AHTA 4NCGA 4FLVA 1S6PA 1QS4A 3L8BA 3OJUA 4KHSA 2FBVA 1A5XA 1ASUA 3AVBA 3HPHA 4B9NA 4C8KA 3CFOA 4UQGA 4QAGA 3NBPA 1NK9A 4CERA 4MQ3A 2G8HA 3DLHA 4BE0A 4B9UA 5HBMA 1ASVA 3OYGA 3NFAA 3AVFA 1NJYA 3MXMA 4DSIA 1GOAA 4CESA 1RDCA 1WN7A 3P83D 4QOZB 2HHUA 3QO9A 4BWMA 3QEXA 3O4NA 2YNHA 4H4MA 4CF2A 3VA3A 3RR7A 1RNHA 2EHGA 2QXFA 2YKNA 3VQ8A 4N76A 1C1CA 1QE1A 3V1OA 3OJSA 3OS1A 1DTTA 1WNSA 3K5LA 2LSNA 4AHSA 3PO4A 3VQ9A 1UA0A 1Q9XA 5CYQA 1U47A 1VSHA 1QHTA 4O44A 3KTQA 4HUEA 5KRTA 1TAQA 4Y1CA 4JRPA 4DQQA 4YFUA 5HP1A 3T1AA 2ATQA 1YTAA 3D0PA 3ZSOA 1JXEA 3C94A 1XI1A 3L2QA 3KKRA 3O4QA 1SL1A 2HMIA 1ZBFA 4Y1DA 2VG6A 1VSKA 3BDPA 3RTVA 3S3OA 4FJ5A 3OYFA 4L8RB 1W0HA 1REVA 4FJ7A 4RW9A 3LP0A 2HHVA 3KIOA 4CJPA 4ZTFA 3NF8A 1L5UA 3PX0A 3LPTA 3C6TA 2ETJA 4KREA 1LAWA 3HP6A 3CM6A 2BDPA 3NF9A 1WSGA 1YVUA 3CFPA 2OPSA 3KLIA 4FJHA 5SWMA 4FJ8A 3ISNC 4DQSA 2B4JA 1U4BA 4BDYA 5I42A 3P1GA 1T03A 4BE1A 4F4KA 3OYMA 3SJJA 3WNGA 1EKEA 3LP2A 1U48A 3VQ7A 2P51A 2OPQA 2PYLA 3VQBA 4CEFA 4Q5VA 4OLAA 4XIUA 3KK1A 3DM2A 2A1SA 3HL8A 3SQ2A 1RTIA 4DWIA 5EU7A 1JXBA 1VSJA 5FRMA 1HQUA 1SKSA 4DTSA 1YTUA 1CXQA 3AA4A 1N5YA 4CEOA 1TGOA 4HUGA 3TAFA 2BGGA 1JLGA 4PA1A 3WNEA 1SV5A 3AO3A 4C8MA 4CJUA 1RT2A 3SYZA 1NJXA 3ZT2A 4DTPA 3SQ0A 1BCOA 3V81A 1KVCA 4FZXC 4F8RA 5CYMA 4FM0A 1SUQA 4GVMA 2G8KA 2BE2A 2RKIA 1EXQA 4OPKA 4M3UA 4F2RA 4RG8A 2HHWA 1XWLA 1TK5A 4DS4A 3OYEA 3EY1A 4CJTA 2IGIA 2Z1IA 5E41A 2RF2A 2OZMA 3PX4A 1TL3A 4E7KA 4B9TA 3T19A 2A1RA 1T05A 1KFSA 3OS0A 1CZ9A 4E19A 1KTQA 3DLRA 4WE1A 3EYZA 3PX6A 4FJJA 2HVHA 4DTOA 1BCMA 3OYCA 3LPUA 5C42A 3MECA 5HRPA 3V4IA 3AVKA 4FLXA 1NK0A 1SKWA 2HHQA 1NJZA 3QETA 4FLUA 3OYDA 3BGRA 3T3FA 3C95A 4DSEA 4B8CA 4F2SA 1T7PA 3VQ6A 2D0BA 4CJSA 4ELVA 4J2AA 4MFBA 3CFRA 1ZBUA 4M3TA 5HRRA 1HJRA 1S1VA 4OJRA 4E1MA 4KTZA 3QINA 4M3RA 4AHRA 3SUNA 1LWFA 1BQNA 4DF8A 3AVAA 4DSJA 4CHZA 4ZTJA 4FVMA 5DK5A 3ULDA 1S9GA 5FROA 4CJFA 3QNOA 3TWHA 2IOCA 1TL1A 5DMRA 1HQEA 4CJLA 4HUFA 1BISA 4CFBA 1D9FA 4ID1A 1JKHA 4FW1A 5J2PA 4NCAA 3AVLA 5CZ1A 1S1XA 4LD0A 1JLQA 1S1UA 1RTDA 3IAYA 2D5RA 1HYSA 1S1WA 1HMVA 4C8NA 1T8EA 4Z4CA 4JRQA 2GUIA 1S6QA 1TKXA 2YNGA 1NK8A 2IDOA 1KLMA 1WSHA 1ZYQA 3VQPA 1C6VA 2FBXA 2G8IA 4B9SA 4AHUA 2HVIA 2Z1HA 4CHPA 3U6FA 2HNYA 4OGCA 1NK7A 1IG9A 4CIGA 2KFZA 2XY6A 4Q0BA 3KLFA 3PV8A 1HRHA 1LAVA 3E01A 3OYHA 2OPPA 2HB5A 3HVTA 3V9XA 2HNDA 3KLGA 1WSEA 3K57A 2FBTA 1WSJA 3HM9A 4IFVA 3NDKA 2Z1JA 3VQAA 1S1TA 1WSIA 4LSLA 1RT1A 3O3HA 3AA3A 4CGHA 4DSLA 3LWMA 2JLEA 3K59A 4DFMA 4DFPA 1NKEA 4C8OA 1KVAA 3ZSRA 3VA0A 4CFDA 1NKBA 2XRIA 4DQIA 3MXIA 4R5PA 1EP4A 3LZJA 3IRXA 5CZ2A 2YHBA 2ZQBA 1NKCA 1B9DA 1RDDA 2HNZA 3L2RA 1TKDA 1KLNA 1TVRA 1IO2A 3ZSYA 4FLWA 1J5OA 3HJFA 1HNIA 2YKMA 5K14A 3V6DA 3DRRA 3SZ2A 1RILA 4CIFA 4Z4FA 4FJMA 3OVNA 3QEIA 1TK8A 3K5OA 3I8DA 4KPYA 2QK9A 2HHSA 3QIOA 4KHWA 1XC9A 4CJVA 2Y1JA 1QSYA 3TANA 4CECA 1W9HA 4KB0A 4FW2A 4IG0A 4OKJA 2F96A 1K6YA 2VG5A 4CGDA 4Z4EA 4Z4GA 3L2VA 3M8PA 3V1RA 3I0SA 4CJEA 1VSIA 4O4GA 1RTHA 3CM5A 3WNFA 3OYLA 4NCBA 1UA1A 1NK5A 1LWCA 3V9SA 4DQPA 4CF9A 3TAGA 4ZHRA 1JL1A 1X9WA 3MXJA 3HVRA 2XY7A 4B8AB 4DTJA 1EETA 2HW3A 3TAPA 2OYQA 4HCCA 4CJ3A 4PUOA 3O3FA 3KK3A 4I9LA 1FKOA 1O1WA 4DF4A 1ASWA 1YT3A 3DOLA 1C0UA 1TKZA 1U04A 5J1EA 3RMAA 4E3SA 5HROA 4HHTA 5CY4A 2Q3SA 4GW6A 5J2MA 3LAKA 3TAMA 1L3VA 3AO5A 2E4LA 2F8TA 1QSSA 2IS3A 4CK2A 2FC0A 1RBSA 4KV8A 4FZZA 2E6MA 4DU4A 1GOBA 1CXUA 2D0CA 3AV9A 1G15A 4FM2A 3NF7A 3ZT3A 4F3TA 1FKPA 3IS9A 1I39A 4KRFA 3LANA 3CG7A 4I2QA 4JS4A 4CHQA 4AILC 2JGUA 2KZZA 3HPGA 3NCIA 1X1PA 4CFAA 1C1AA 4IBNA 4DTRA 3TR8A 4O0JA 4E0DA 3LZIA 1UOCA 1LW0A 4CEZA 3ZSXA 2OZSA 4DS5A 3DMJA 1JLFA 3A2FA 3DLBA 5JS2A 1KVBA 4PQUA 2FBYA 3AVCA 4CEEA 4M3WA 4DSFA 1VSDA 1C0TA 2KW4A 3OYAA 3AA2A 1I3AA 1LW2A 1F21A 3DI6A 1DTQA 4IDKA 4E7IA 4DSKA 1BIZA 2D0AA 4AHVA 1NK4A 1IH7A 3NAEA 5KGXA 3NH0A 1HYVA 3H08A 2XHBA 3SUOA 2G8FA 4KHUA 4ELTA 1C0MA 1RT3A 3DLEA 2KTQA 5C25A 3OYNA 1JLAA 1KCFA 1LWEA 4LH5A 5FDLA 1ZBHA 4B3OA 3S3NA 2OA8A 3SQ4A 3NF6A 4OKEA 3ZSWA 2ZE2A 3KJVA 2WOMA 1SL0A 4ELUA 3NHGA 5KGWA 3LDSA 3SUPA 3QLHA 3DOKA 3SI6A 4IFYA 3OS2A 2KZMA 3THVA 1L3UA 4B9VA 4DQRA 1WLJA 3DLGA 1L3TA 3ZT1A 3ZT4A 3NE6A 2R7YA 4FK0A 3RWUA 1ITGA 3TAQA 3LP3A 4OGEA 4KKOA 3NH2A 1IKWA 1J53A 4CGJA 4M3XA 4B9LA 3M8QA 4ICLA 3U3GA 4CEAA 3RMDA 3QEPA 3PO5A 1HNVA 4G1QA 1Z25A 3ZT0A 3ZSQA 5J2NA 4CJ5A 3RMBA 2YV0X 2EX3A 4FK2A 1VK0A 3UIQA 4AHCA 4DU3A 4DFKA 4DMNA 2VWKA 3P5JA 4KO0A 2DFHA 3TARA 4FJNA 3HXMA 3TI0A 4FLZA 4FYDA 3OYIA 4JS5A 3CYMA 2X6NA 1J54A 4FLYA 3F9KA 3NH1A 3K2PA 3NGYA 3DRPA 4HVJA 2P5GA 3ASMA 3SQ1A 4DTUA 4FJIA 2O4IA 4OKKA 4KAZA 4DLGA 3DRSA 3KK2A 3JSMA 4CGFA 3MAQA 3RRHA 3SNNA 1NOYA 1BI4A 5FRNA 2X74A 3NGIA 3SV4A 2XY5A 5JS1A 4E7HA 1TV6A 2E6LA 3SCXA 3OYJA 1D9DA 4W5QA 4DG1A 4QCLA 3V9WA 4KFBA 3DLKA 4RW7A 3EZ5A 4EZ6A 4O5BA 3ZCMA 5I3UA 2VWJA 3FFIA 4CJWA 3MEGA 3VQQA 2Z1GA 3QIPA 5KRSA 1NK6A 3K58A 3LWLA 3ITHA 4K8ZA 3F73A 1Y97A 3K5NA 1RBUA 1HPZA 1Z26A 1UAXA 3B6PA 1S5JA 3M8RA 3L2WA 1ZBLA 3LALA 2QKKA 2DY4A 2Y1IA 3K5MA 5T7BA 4BDPA 4J2EA 4EP4A 3OYBA 4KI4A 1U49A 1C1BA 3RR8A 3CQ8A 3D45A 1IKXA 4DFJA 3V9UA 2IAJA 4E89A 3OY9A 4FJXA 4HCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLH A;  4FM1 A;  3ALY A;  3O3G A;  3VQC A;  3S9H A;  2GV9 A;  4OVL A;  1JLC A;  4Z0U A;  3VQE A;  4N5S A;  3RMC A;  2DTU A;  4W5O A;  4FCY A;  4IKF A;  3LP1 A;  1L3S A;  3HST B;  4CFC A;  4BWJ A;  1LV5 A;  1BGX T;  1VSE A;  2DFE A;  3ZSV A;  1TK0 A;  2KFN A;  2HHT A;  4E7J A;  3QNN A;  1MU2 A;  5SZT A;  4DTN A;  2B5J A;  4KB1 A;  3MED A;  2AJQ A;  3KKS A;  3TAB A;  1Q9Y A;  1CZB A;  4KHQ A;  1VSF A;  1VSM A;  3MEE A;  4N41 A;  4LSN A;  4H4O A;  3PY8 A;  4KTQ A;  3AVM A;  3L3V A;  3AO1 A;  2GBZ A;  3OYK A;  4KHY A;  3SPY A;  4CCH A;  4FXD A;  1WSF A;  4GMJ B;  3KLE A;  2RN2 A;  4CJK A;  5HRN A;  1RCH A;  3SPZ A;  5C24 A;  4CF1 A;  4CK3 A;  1KRP A;  4W5N A;  4CED A;  2DFF A;  1RBR A;  1NOZ A;  4CF8 A;  4FK4 A;  2F8S A;  1JLB A;  3SUQ A;  4Z4I A;  3QEV A;  1RT5 A;  2P1J A;  3M8S A;  4CJR A;  4EP5 A;  5KTQ A;  4CJQ A;  2VG7 A;  5HRS A;  3LAM A;  4HTU A;  3HYF A;  3L2U A;  4BDZ A;  4PWD A;  4NYF A;  3VN5 A;  3NGZ A;  4I9Q A;  3HP9 A;  4RW8 A;  3AO4 A;  1U45 A;  1XHX A;  4CE9 A;  1D5A A;  1JLE A;  3AO2 A;  2OPR A;  3HPO A;  2W42 A;  1A5V A;  3C6U A;  2XO7 A;  2P5O A;  1SL2 A;  3U3Y A;  2WON A;  4CJ4 A;  1IKV A;  4B9M A;  1BI4 B;  3AVI A;  4F3O A;  1RDB A;  1KSP A;  3VQ4 A;  2KQ2 A;  4RW4 A;  2YNF A;  4CEQ A;  4N56 A;  3QEW A;  3QER A;  3G0Z A;  1BHL A;  4KHN A;  2BAN A;  1RT4 A;  1RDA A;  1UWB A;  2NUB A;  3TAE A;  2O4G A;  1X9M A;  5HLF A;  4I7F A;  3RRG A;  1X9S A;  4O0I A;  4CK1 A;  1JL2 A;  4FJL A;  3G10 A;  4B08 A;  1XHZ A;  1RBT A;  1WAJ A;  4RW6 A;  4BAC A;  1KFD A;  4C8L A;  2X6S A;  1FXX A;  4W5R A;  4N47 A;  3L3U A;  1J9A A;  3PUF A;  4FJK A;  3S3M A;  2QKB A;  2XY8 A;  2ZD1 A;  1RT6 A;  4LH4 A;  2G8W A;  4FJG A;  1WAF A;  2YNI A;  4FJ9 A;  1GOC A;  3AVG A;  1ZBI A;  3JYT A;  4OLB A;  1IKY A;  2PY5 A;  1FK9 A;  3KD1 E;  1Q8I A;  2ITG A;  4TSX A;  1R0A A;  4CEB A;  4M3Y A;  1VRU A;  1RTJ A;  4DLE A;  5D3G A;  2G8V A;  1TAU A;  3VQ5 A;  4DTX A;  1S9E A;  2X78 A;  1HYZ A;  4NYN A;  2I5J A;  3V1Q A;  4J2D A;  3HK2 A;  5KI6 A;  3HO1 A;  3DYA A;  4CF0 A;  4O55 A;  3AVN A;  4M42 A;  2IC3 A;  4LY7 A;  4M41 A;  4AH9 A;  3AA5 X;  4EZ9 A;  4Z4H A;  1BIU A;  4H8K A;  3HT3 A;  1B92 A;  4CHY A;  4PY5 A;  2RPI A;  3IG1 A;  3VQD A;  1A5W A;  4DTM A;  3AVH A;  3SV3 A;  2G8U A;  1QSL A;  1N6Q A;  4CGI A;  4JLH A;  3WNH A;  4M45 A;  4OPJ A;  4BE2 A;  1VRT A;  4I2P A;  1NJW A;  4FLT A;  2PYJ A;  1VSL A;  4FZY A;  1CLQ A;  4KTW A;  1QTM A;  3AVJ A;  4IG3 A;  4CIE A;  1BQM A;  1DLO A;  1EX4 A;  3ZSZ A;  1B9F A;  4CHN A;  1SKR A;  2PZS A;  4ID5 A;  4CGG A;  4J2B A;  4E1N A;  1TKT A;  4YNQ A;  2HHX A;  1RBV A;  1RT7 A;  3QES A;  2B6A A;  4M3Z A;  5J2Q A;  1QQC A;  4K8X A;  3I0R A;  1D8Y A;  4E7L A;  1BL3 A;  3V9Z A;  4W5T A;  3B6O A;  3KD5 E;  4KI6 A;  2YHA A;  4CHO A;  4DU1 A;  4AHT A;  4NCG A;  4FLV A;  1S6P A;  1QS4 A;  3L8B A;  3OJU A;  4KHS A;  2FBV A;  1A5X A;  1ASU A;  3AVB A;  3HPH A;  4B9N A;  4C8K A;  3CFO A;  4UQG A;  4QAG A;  3NBP A;  1NK9 A;  4CER A;  4MQ3 A;  2G8H A;  3DLH A;  4BE0 A;  4B9U A;  5HBM A;  1ASV A;  3OYG A;  3NFA A;  3AVF A;  1NJY A;  3MXM A;  4DSI A;  1GOA A;  4CES A;  1RDC A;  1WN7 A;  3P83 D;  4QOZ B;  2HHU A;  3QO9 A;  4BWM A;  3QEX A;  3O4N A;  2YNH A;  4H4M A;  4CF2 A;  3VA3 A;  3RR7 A;  1RNH A;  2EHG A;  2QXF A;  2YKN A;  3VQ8 A;  4N76 A;  1C1C A;  1QE1 A;  3V1O A;  3OJS A;  3OS1 A;  1DTT A;  1WNS A;  3K5L A;  2LSN A;  4AHS A;  3PO4 A;  3VQ9 A;  1UA0 A;  1Q9X A;  5CYQ A;  1U47 A;  1VSH A;  1QHT A;  4O44 A;  3KTQ A;  4HUE A;  5KRT A;  1TAQ A;  4Y1C A;  4JRP A;  4DQQ A;  4YFU A;  5HP1 A;  3T1A A;  2ATQ A;  1YTA A;  3D0P A;  3ZSO A;  1JXE A;  3C94 A;  1XI1 A;  3L2Q A;  3KKR A;  3O4Q A;  1SL1 A;  2HMI A;  1ZBF A;  4Y1D A;  2VG6 A;  1VSK A;  3BDP A;  3RTV A;  3S3O A;  4FJ5 A;  3OYF A;  4L8R B;  1W0H A;  1REV A;  4FJ7 A;  4RW9 A;  3LP0 A;  2HHV A;  3KIO A;  4CJP A;  4ZTF A;  3NF8 A;  1L5U A;  3PX0 A;  3LPT A;  3C6T A;  2ETJ A;  4KRE A;  1LAW A;  3HP6 A;  3CM6 A;  2BDP A;  3NF9 A;  1WSG A;  1YVU A;  3CFP A;  2OPS A;  3KLI A;  4FJH A;  5SWM A;  4FJ8 A;  3ISN C;  4DQS A;  2B4J A;  1U4B A;  4BDY A;  5I42 A;  3P1G A;  1T03 A;  4BE1 A;  4F4K A;  3OYM A;  3SJJ A;  3WNG A;  1EKE A;  3LP2 A;  1U48 A;  3VQ7 A;  2P51 A;  2OPQ A;  2PYL A;  3VQB A;  4CEF A;  4Q5V A;  4OLA A;  4XIU A;  3KK1 A;  3DM2 A;  2A1S A;  3HL8 A;  3SQ2 A;  1RTI A;  4DWI A;  5EU7 A;  1JXB A;  1VSJ A;  5FRM A;  1HQU A;  1SKS A;  4DTS A;  1YTU A;  1CXQ A;  3AA4 A;  1N5Y A;  4CEO A;  1TGO A;  4HUG A;  3TAF A;  2BGG A;  1JLG A;  4PA1 A;  3WNE A;  1SV5 A;  3AO3 A;  4C8M A;  4CJU A;  1RT2 A;  3SYZ A;  1NJX A;  3ZT2 A;  4DTP A;  3SQ0 A;  1BCO A;  3V81 A;  1KVC A;  4FZX C;  4F8R A;  5CYM A;  4FM0 A;  1SUQ A;  4GVM A;  2G8K A;  2BE2 A;  2RKI A;  1EXQ A;  4OPK A;  4M3U A;  4F2R A;  4RG8 A;  2HHW A;  1XWL A;  1TK5 A;  4DS4 A;  3OYE A;  3EY1 A;  4CJT A;  2IGI A;  2Z1I A;  5E41 A;  2RF2 A;  2OZM A;  3PX4 A;  1TL3 A;  4E7K A;  4B9T A;  3T19 A;  2A1R A;  1T05 A;  1KFS A;  3OS0 A;  1CZ9 A;  4E19 A;  1KTQ A;  3DLR A;  4WE1 A;  3EYZ A;  3PX6 A;  4FJJ A;  2HVH A;  4DTO A;  1BCM A;  3OYC A;  3LPU A;  5C42 A;  3MEC A;  5HRP A;  3V4I A;  3AVK A;  4FLX A;  1NK0 A;  1SKW A;  2HHQ A;  1NJZ A;  3QET A;  4FLU A;  3OYD A;  3BGR A;  3T3F A;  3C95 A;  4DSE A;  4B8C A;  4F2S A;  1T7P A;  3VQ6 A;  2D0B A;  4CJS A;  4ELV A;  4J2A A;  4MFB A;  3CFR A;  1ZBU A;  4M3T A;  5HRR A;  1HJR A;  1S1V A;  4OJR A;  4E1M A;  4KTZ A;  3QIN A;  4M3R A;  4AHR A;  3SUN A;  1LWF A;  1BQN A;  4DF8 A;  3AVA A;  4DSJ A;  4CHZ A;  4ZTJ A;  4FVM A;  5DK5 A;  3ULD A;  1S9G A;  5FRO A;  4CJF A;  3QNO A;  3TWH A;  2IOC A;  1TL1 A;  5DMR A;  1HQE A;  4CJL A;  4HUF A;  1BIS A;  4CFB A;  1D9F A;  4ID1 A;  1JKH A;  4FW1 A;  5J2P A;  4NCA A;  3AVL A;  5CZ1 A;  1S1X A;  4LD0 A;  1JLQ A;  1S1U A;  1RTD A;  3IAY A;  2D5R A;  1HYS A;  1S1W A;  1HMV A;  4C8N A;  1T8E A;  4Z4C A;  4JRQ A;  2GUI A;  1S6Q A;  1TKX A;  2YNG A;  1NK8 A;  2IDO A;  1KLM A;  1WSH A;  1ZYQ A;  3VQP A;  1C6V A;  2FBX A;  2G8I A;  4B9S A;  4AHU A;  2HVI A;  2Z1H A;  4CHP A;  3U6F A;  2HNY A;  4OGC A;  1NK7 A;  1IG9 A;  4CIG A;  2KFZ A;  2XY6 A;  4Q0B A;  3KLF A;  3PV8 A;  1HRH A;  1LAV A;  3E01 A;  3OYH A;  2OPP A;  2HB5 A;  3HVT A;  3V9X A;  2HND A;  3KLG A;  1WSE A;  3K57 A;  2FBT A;  1WSJ A;  3HM9 A;  4IFV A;  3NDK A;  2Z1J A;  3VQA A;  1S1T A;  1WSI A;  4LSL A;  1RT1 A;  3O3H A;  3AA3 A;  4CGH A;  4DSL A;  3LWM A;  2JLE A;  3K59 A;  4DFM A;  4DFP A;  1NKE A;  4C8O A;  1KVA A;  3ZSR A;  3VA0 A;  4CFD A;  1NKB A;  2XRI A;  4DQI A;  3MXI A;  4R5P A;  1EP4 A;  3LZJ A;  3IRX A;  5CZ2 A;  2YHB A;  2ZQB A;  1NKC A;  1B9D A;  1RDD A;  2HNZ A;  3L2R A;  1TKD A;  1KLN A;  1TVR A;  1IO2 A;  3ZSY A;  4FLW A;  1J5O A;  3HJF A;  1HNI A;  2YKM A;  5K14 A;  3V6D A;  3DRR A;  3SZ2 A;  1RIL A;  4CIF A;  4Z4F A;  4FJM A;  3OVN A;  3QEI A;  1TK8 A;  3K5O A;  3I8D A;  4KPY A;  2QK9 A;  2HHS A;  3QIO A;  4KHW A;  1XC9 A;  4CJV A;  2Y1J A;  1QSY A;  3TAN A;  4CEC A;  1W9H A;  4KB0 A;  4FW2 A;  4IG0 A;  4OKJ A;  2F96 A;  1K6Y A;  2VG5 A;  4CGD A;  4Z4E A;  4Z4G A;  3L2V A;  3M8P A;  3V1R A;  3I0S A;  4CJE A;  1VSI A;  4O4G A;  1RTH A;  3CM5 A;  3WNF A;  3OYL A;  4NCB A;  1UA1 A;  1NK5 A;  1LWC A;  3V9S A;  4DQP A;  4CF9 A;  3TAG A;  4ZHR A;  1JL1 A;  1X9W A;  3MXJ A;  3HVR A;  2XY7 A;  4B8A B;  4DTJ A;  1EET A;  2HW3 A;  3TAP A;  2OYQ A;  4HCC A;  4CJ3 A;  4PUO A;  3O3F A;  3KK3 A;  4I9L A;  1FKO A;  1O1W A;  4DF4 A;  1ASW A;  1YT3 A;  3DOL A;  1C0U A;  1TKZ A;  1U04 A;  5J1E A;  3RMA A;  4E3S A;  5HRO A;  4HHT A;  5CY4 A;  2Q3S A;  4GW6 A;  5J2M A;  3LAK A;  3TAM A;  1L3V A;  3AO5 A;  2E4L A;  2F8T A;  1QSS A;  2IS3 A;  4CK2 A;  2FC0 A;  1RBS A;  4KV8 A;  4FZZ A;  2E6M A;  4DU4 A;  1GOB A;  1CXU A;  2D0C A;  3AV9 A;  1G15 A;  4FM2 A;  3NF7 A;  3ZT3 A;  4F3T A;  1FKP A;  3IS9 A;  1I39 A;  4KRF A;  3LAN A;  3CG7 A;  4I2Q A;  4JS4 A;  4CHQ A;  4AIL C;  2JGU A;  2KZZ A;  3HPG A;  3NCI A;  1X1P A;  4CFA A;  1C1A A;  4IBN A;  4DTR A;  3TR8 A;  4O0J A;  4E0D A;  3LZI A;  1UOC A;  1LW0 A;  4CEZ A;  3ZSX A;  2OZS A;  4DS5 A;  3DMJ A;  1JLF A;  3A2F A;  3DLB A;  5JS2 A;  1KVB A;  4PQU A;  2FBY A;  3AVC A;  4CEE A;  4M3W A;  4DSF A;  1VSD A;  1C0T A;  2KW4 A;  3OYA A;  3AA2 A;  1I3A A;  1LW2 A;  1F21 A;  3DI6 A;  1DTQ A;  4IDK A;  4E7I A;  4DSK A;  1BIZ A;  2D0A A;  4AHV A;  1NK4 A;  1IH7 A;  3NAE A;  5KGX A;  3NH0 A;  1HYV A;  3H08 A;  2XHB A;  3SUO A;  2G8F A;  4KHU A;  4ELT A;  1C0M A;  1RT3 A;  3DLE A;  2KTQ A;  5C25 A;  3OYN A;  1JLA A;  1KCF A;  1LWE A;  4LH5 A;  5FDL A;  1ZBH A;  4B3O A;  3S3N A;  2OA8 A;  3SQ4 A;  3NF6 A;  4OKE A;  3ZSW A;  2ZE2 A;  3KJV A;  2WOM A;  1SL0 A;  4ELU A;  3NHG A;  5KGW A;  3LDS A;  3SUP A;  3QLH A;  3DOK A;  3SI6 A;  4IFY A;  3OS2 A;  2KZM A;  3THV A;  1L3U A;  4B9V A;  4DQR A;  1WLJ A;  3DLG A;  1L3T A;  3ZT1 A;  3ZT4 A;  3NE6 A;  2R7Y A;  4FK0 A;  3RWU A;  1ITG A;  3TAQ A;  3LP3 A;  4OGE A;  4KKO A;  3NH2 A;  1IKW A;  1J53 A;  4CGJ A;  4M3X A;  4B9L A;  3M8Q A;  4ICL A;  3U3G A;  4CEA A;  3RMD A;  3QEP A;  3PO5 A;  1HNV A;  4G1Q A;  1Z25 A;  3ZT0 A;  3ZSQ A;  5J2N A;  4CJ5 A;  3RMB A;  2YV0 X;  2EX3 A;  4FK2 A;  1VK0 A;  3UIQ A;  4AHC A;  4DU3 A;  4DFK A;  4DMN A;  2VWK A;  3P5J A;  4KO0 A;  2DFH A;  3TAR A;  4FJN A;  3HXM A;  3TI0 A;  4FLZ A;  4FYD A;  3OYI A;  4JS5 A;  3CYM A;  2X6N A;  1J54 A;  4FLY A;  3F9K A;  3NH1 A;  3K2P A;  3NGY A;  3DRP A;  4HVJ A;  2P5G A;  3ASM A;  3SQ1 A;  4DTU A;  4FJI A;  2O4I A;  4OKK A;  4KAZ A;  4DLG A;  3DRS A;  3KK2 A;  3JSM A;  4CGF A;  3MAQ A;  3RRH A;  3SNN A;  1NOY A;  1BI4 A;  5FRN A;  2X74 A;  3NGI A;  3SV4 A;  2XY5 A;  5JS1 A;  4E7H A;  1TV6 A;  2E6L A;  3SCX A;  3OYJ A;  1D9D A;  4W5Q A;  4DG1 A;  4QCL A;  3V9W A;  4KFB A;  3DLK A;  4RW7 A;  3EZ5 A;  4EZ6 A;  4O5B A;  3ZCM A;  5I3U A;  2VWJ A;  3FFI A;  4CJW A;  3MEG A;  3VQQ A;  2Z1G A;  3QIP A;  5KRS A;  1NK6 A;  3K58 A;  3LWL A;  3ITH A;  4K8Z A;  3F73 A;  1Y97 A;  3K5N A;  1RBU A;  1HPZ A;  1Z26 A;  1UAX A;  3B6P A;  1S5J A;  3M8R A;  3L2W A;  1ZBL A;  3LAL A;  2QKK A;  2DY4 A;  2Y1I A;  3K5M A;  5T7B A;  4BDP A;  4J2E A;  4EP4 A;  3OYB A;  4KI4 A;  1U49 A;  1C1B A;  3RR8 A;  3CQ8 A;  3D45 A;  1IKX A;  4DFJ A;  3V9U A;  2IAJ A;  4E89 A;  3OY9 A;  4FJX A;  4HCB A; 
#chains in the Genus database with same CATH topology
 3KLH A;  3ALY A;  1HKB A;  2GV9 A;  1JLC A;  3VQE A;  4BRP A;  4B1X B;  5JLF A;  1GLD G;  1L3S A;  3ENH A;  4WF9 L;  4O5F A;  2NLX A;  3E9L A;  2HHT A;  4GKK K;  3KVG A;  4DTN A;  1Q86 O;  2HBL A;  4FWQ A;  1Q9Y A;  5GAH P;  1H1V A;  2GBZ A;  5KPR A;  3ZX3 A;  3SBT A;  3SPY A;  1KAX A;  4GMJ B;  3KLE A;  3U4L A;  4CJK A;  3IDH A;  1MDU B;  4CK3 A;  4W5N A;  4EHT A;  4IEI A;  1ATN A;  4LC9 B;  1JLB A;  3MK6 A;  4Z4I A;  3M8S A;  3CCJ N;  5KTQ A;  4CJQ A;  1YHQ N;  5HRS A;  1QHA A;  4PWD A;  4I9Q A;  2XO7 A;  4CJ4 A;  4YOV A;  4PHT X;  5AQT A;  1KSP A;  4RW4 A;  2FLO A;  5MLC Q;  3G0Z A;  2BAN A;  1RT4 A;  1RDA A;  4A5A A;  2PAV A;  4A61 A;  1RBT A;  3HTV A;  1KFD A;  4C8L A;  2OTJ N;  1J9A A;  3QBW A;  2G8W A;  3JXU A;  4DV1 K;  3THW B;  1ZBI A;  4OLB A;  4HTL A;  4WFN L;  1FK9 A;  2PY5 A;  3KD1 E;  1VRU A;  5D3G A;  5M1F A;  1TAU A;  3VQ5 A;  5KI6 A;  4H0P A;  3GOI A;  3DYA A;  4CF0 A;  2GUP A;  5AQO A;  2IC3 A;  4AH9 A;  3AA5 X;  4Z4H A;  4H8K A;  3BF1 A;  1M1K O;  4PY5 A;  2RPI A;  3IG1 A;  3CCS N;  3G25 A;  1BA0 A;  3AVH A;  5LMN K;  1GLJ O;  3WNH A;  4JI2 K;  4FWR A;  1VSL A;  3VEV A;  3GG4 A;  3MN5 A;  4KTW A;  4JKE A;  1SKR A;  5AZI B;  3JAM O;  4YNQ A;  2HHX A;  5J2Q A;  2NRH A;  4DKW A;  3B6O A;  1YJN N;  1K73 O;  4H5V A;  3L8B A;  1DT9 A;  3I8B A;  3MCA B;  4X65 K;  4QAG A;  2GWK A;  4MQ3 A;  2G8H A;  5KQ8 A;  5AQY A;  2HOE A;  3TTD A;  2ZM6 K;  1GOA A;  1WN7 A;  4BVP A;  4XEI A;  3QO9 A;  1JCG A;  4JK9 A;  4O8K A;  2EHG A;  2QXF A;  4M7Y A;  3PO4 A;  5CR4 A;  4O44 A;  3KTQ A;  4HUE A;  5KRT A;  4JRP A;  4YFU A;  5HP1 A;  4BRG A;  5JLH A;  1YTA A;  3HM8 A;  4H0V B;  4MO5 A;  1P90 A;  2JWL A;  3KKR A;  1SL1 A;  3S3O A;  2E2O A;  4JK7 A;  4CJP A;  5C10 A;  4ZTF A;  3WEE A;  4R79 A;  2BTF A;  4DR4 K;  3SAH A;  4LF9 K;  1LAW A;  4GNI A;  4CZJ A;  1SAZ A;  1WSG A;  3CFP A;  3ULE A;  1ESV A;  4GKJ K;  2B4J A;  1U4B A;  5I42 A;  3P1G A;  2P9P A;  4BE1 A;  1T03 A;  2A42 A;  3CCV N;  1EKE A;  1U48 A;  2P9K B;  2P51 A;  1WOQ A;  4CEF A;  3CCM N;  4Q5V A;  3U8X A;  2ZF5 O;  2A1S A;  4GY2 B;  2AA4 A;  5FRM A;  3AA4 A;  1N5Y A;  3VGM A;  2BGG A;  1JLG A;  3KZB A;  3WNE A;  2W6L A;  2E20 A;  1NJX A;  4BRF A;  3V81 A;  4FZX C;  3R1X A;  1NGJ A;  2ZJQ L;  1SUQ A;  4FM0 A;  3CJ1 A;  4BR5 A;  2E2Q A;  1X9J A;  5LL6 Z;  3OYE A;  4FO0 A;  2IGI A;  3D7E O;  3CF5 L;  3PX4 A;  4E7K A;  4PL8 A;  1KC8 O;  1VQ8 N;  2E88 A;  4FJJ A;  1BCM A;  3DXK B;  3LPU A;  3M5R A;  1NJI O;  3V4I A;  3AVK A;  5LY3 A;  1NJZ A;  4FLU A;  3CJ9 A;  3T3F A;  3NVM A;  5BR9 A;  4FOE A;  4J8F A;  4BRN A;  4CJS A;  2GWJ A;  4MFB A;  4DR3 K;  4OJR A;  4DV5 K;  4CHZ A;  4EIA A;  4FVM A;  5GAD P;  2O8E B;  5FRO A;  5DMR A;  1D9F A;  5M1O A;  3RSE B;  3O9T A;  4NCA A;  4JKH A;  3EO3 A;  2D5R A;  4U67 L;  1NMD A;  1HMV A;  4C8N A;  1HYS A;  3GE1 A;  4JRQ A;  1S6Q A;  2YNG A;  2IDO A;  1WSH A;  3O80 A;  1ZYQ A;  2FBX A;  4XH1 A;  4B9S A;  4AHU A;  2HVI A;  5ELZ A;  3KLF A;  1N36 K;  2HB5 A;  3VEN A;  1WSE A;  1WSJ A;  3NDK A;  1S1T A;  3BZK A;  1RT1 A;  4DFP A;  3ZET B;  1NKB A;  3T7Z A;  2E5L K;  1NGA A;  3MXI A;  3O1B A;  3LZJ A;  2GTD A;  2YHB A;  5C2D A;  1MA9 B;  1TVR A;  1J5O A;  1HNI A;  1NNE A;  3SZ2 A;  1RIL A;  4CIF A;  4LF4 K;  1TK8 A;  3EL2 A;  4JHD B;  4KHW A;  3D2F A;  4YOY A;  1QSY A;  1W9H A;  1XUP O;  2F96 A;  4Z4E A;  2WC9 A;  3I0S A;  3CM5 A;  3MCP A;  3U9D A;  3CPW M;  3TAG A;  2XY7 A;  2ZGY A;  2HW3 A;  5GAE P;  4HCC A;  4PUO A;  3O3F A;  5EVZ A;  5EXW A;  4X62 K;  1ASW A;  2GEM A;  3MDQ A;  5CY4 A;  1IV0 A;  1E4F T;  2UUC K;  5J2M A;  3VES A;  1DEJ A;  3O9R A;  3TAM A;  1L3V A;  1N8R O;  1VQM N;  4DU4 A;  4B3S K;  2E2P A;  1I39 A;  4IO8 A;  5AQI A;  2VCP A;  4KH6 A;  1X1P A;  4A59 A;  2I7N A;  1LW0 A;  3ZSX A;  4DS5 A;  2HST A;  1TUU A;  3DLB A;  1KVB A;  4B1W B;  5F0X A;  2FBY A;  3AVC A;  2KW4 A;  2IVO A;  4H03 B;  1LW2 A;  3DI6 A;  4OPA A;  5BPN A;  4IDK A;  4E7I A;  1BIZ A;  2D0A A;  3EE9 A;  3VF4 A;  4AHV A;  5KGX A;  3A5L C;  3H08 A;  2G8F A;  3LDN A;  4ELT A;  2J4R A;  3H45 C;  5FDL A;  3SQ4 A;  4DV2 K;  1HNZ K;  4I6M A;  4JKF A;  2ZE2 A;  3KJV A;  4GV9 A;  1Z6R A;  1SL0 A;  4ELU A;  3QLH A;  4BRI A;  1W97 L;  4IFY A;  3SLC A;  3THV A;  3DLG A;  3H1V X;  3LM2 A;  3ZT1 A;  3NE6 A;  2PFU A;  3M8Q A;  3RMD A;  5CE3 A;  3ZYY X;  1T44 A;  1Z25 A;  3ZT0 A;  3IMX A;  3ULE B;  4DR5 K;  4DUY K;  1VK0 A;  5AFU H;  3UIQ A;  4AHC A;  4DMN A;  2VWK A;  2P9P B;  3P5J A;  4KO0 A;  3K0S A;  3HXM A;  4FVU A;  3OYI A;  3S41 A;  3DXM B;  3O9Q A;  4JS5 A;  4FLY A;  3F9K A;  3NGY A;  4HVJ A;  3VGL A;  3ASM A;  4FJI A;  3VEX A;  3DRS A;  3RRH A;  3VTI A;  3CJC A;  2FXU A;  5FRN A;  2X74 A;  2XY5 A;  4BY9 C;  4E7H A;  1TV6 A;  2E6L A;  3SCX A;  4W5Q A;  4DG1 A;  1OVY A;  4KFB A;  3J81 O;  3DLK A;  3CER A;  3EZ5 A;  2KLA A;  4O5B A;  3ZCM A;  4JKB A;  1QVG M;  3VQQ A;  5TKY A;  4JKA A;  4K8Z A;  3ITH A;  5BN9 A;  1HPZ A;  1UAX A;  2QWN A;  2DY4 A;  2W41 A;  3R8E A;  5IWA K;  1U49 A;  3RR8 A;  3D45 A;  3THW A;  4FJX A;  5AQU A;  4HCB A;  3O3G A;  3O1W A;  3RMC A;  2DTU A;  4N5S A;  3DAW A;  3FZH A;  3HZ6 A;  1LV5 A;  1Q7Y O;  4E7J A;  4C1N K;  5SZT A;  3OTO K;  1IJJ A;  1OH6 A;  4KB1 A;  3CXC M;  2AJQ A;  3TAB A;  4KHQ A;  1VSM A;  4B3R K;  3PY8 A;  3E66 A;  4KHY A;  4RTF D;  1WSF A;  3Q7B A;  1DGK N;  4Y0W A;  1RCH A;  2BUP A;  1HR0 K;  5C24 A;  4CED A;  4DV3 K;  2DFF A;  1RBR A;  4DR7 K;  3QDK A;  5BR8 K;  2P1J A;  4EP5 A;  2YHY A;  3HI0 A;  3CME N;  4HTU A;  2FSJ A;  4NYF A;  4M7X A;  1XHX A;  4BRM A;  3AO2 A;  1E4G T;  2W42 A;  4NB4 A;  4G9Z A;  2WON A;  3F9M A;  2QWO A;  1HUX A;  1BI4 B;  5AQS A;  4F3O A;  4JEP A;  1RDB A;  4H0O A;  2KQ2 A;  1C0G A;  4BG8 A;  3QER A;  5BRE A;  3CC4 N;  3TAE A;  1N32 K;  1X9M A;  4CD3 A;  4O0I A;  1VQL N;  2F9W A;  4B08 A;  1ZXO A;  4N47 A;  5CHI A;  4BGB A;  4FJK A;  4MDB A;  4CZM A;  2WFB A;  4FJG A;  1WAF A;  3D2F B;  2YNI A;  1W7A A;  1GOC A;  2VGN A;  3JYT A;  1IKY A;  4TSX A;  3FR0 A;  1R0A A;  3TTC A;  1VAZ A;  1S9E A;  1HYZ A;  4JI8 K;  3FE1 A;  2P9I A;  5FPM A;  3FFK B;  1BIU A;  4CBU A;  4DTM A;  4EHU A;  5LMU K;  2G8U A;  3WQT A;  1NGC A;  2CGL A;  3W3D A;  1QTM A;  2PZS A;  1ATR A;  1DLO A;  1EX4 A;  2W40 A;  3I33 A;  1BO5 O;  2F4V K;  2P9K A;  3UKU A;  1TKT A;  1RT7 A;  2B6A A;  4K8X A;  1QQC A;  3I0R A;  4FWN A;  3V9Z A;  3KD5 E;  1BUP A;  1QS4 A;  4NXN K;  2ZGZ A;  1ASU A;  1NBW A;  4DV4 K;  1NK9 A;  4CER A;  4BE0 A;  3CCL N;  4B9U A;  4YOW A;  2HBK A;  3DLL L;  5AQV A;  5ADX H;  3VER A;  3P83 D;  2NRT A;  3QB0 A;  3O4N A;  2P9S B;  1YAG A;  4H4M A;  1V4S A;  4CF2 A;  3RR7 A;  1FJG K;  2YKN A;  3VQ8 A;  3J7Z O;  1QE1 A;  3V1O A;  3OJS A;  1DTT A;  1T3V A;  2LSN A;  3VQ9 A;  1UA0 A;  1Q9X A;  1R59 O;  5CYQ A;  4B3M K;  1VSH A;  1QHT A;  3DXK A;  2CGK A;  4I6M B;  2GEL A;  4ISF A;  4BRA A;  4YOT A;  4WQ5 A;  2ATQ A;  5I9E B;  1VHX A;  3ZSO A;  4IJN A;  2NRX A;  3P38 A;  3L2Q A;  4Y1D A;  3G4S N;  3BDP A;  3RTV A;  2HF4 A;  2O8E A;  1W0H A;  5A2Q O;  4JI0 K;  2HHV A;  4A2A A;  3LPT A;  3RSE A;  4IOA L;  3VPZ A;  3CM6 A;  1VQN N;  1IBK K;  1TUY A;  5AFU A;  1W2B M;  4FJH A;  3IKM A;  3QFP A;  4B1Y B;  3ISN C;  4CVN E;  4DQS A;  2E1Y A;  4F4K A;  3OYM A;  3SJJ A;  5GAG P;  3LP2 A;  1RGI A;  2ASP A;  4H5R A;  2OPQ A;  4BVO A;  3TU5 A;  2P9U A;  3KK1 A;  3SQ2 A;  3HL8 A;  1RTI A;  2NRR A;  4JV5 K;  4B1Z A;  3D6R A;  4BR0 A;  2NRW A;  4CZL A;  1YTU A;  4FWS A;  1Z05 A;  2V52 B;  3OHR A;  4HUG A;  1FW6 A;  4O8U A;  1SV5 A;  4JKD A;  3ZET A;  4CJU A;  3VMF B;  3SQ0 A;  4UY8 O;  5F1X A;  5CYM A;  2RKI A;  4F2R A;  3EKS A;  4DR2 K;  3E9O A;  3J7Y P;  4RG8 A;  2YX6 A;  1TK5 A;  3NMU A;  5E41 A;  5AQG A;  4CBX A;  3CC7 N;  4B9T A;  2VWB A;  3P31 A;  4JHD A;  4OX9 K;  1KFS A;  4FSV A;  1CZ9 A;  4DHY A;  2FSK A;  1BOT O;  3EYZ A;  4DTO A;  3LDQ A;  3O6W A;  3OYC A;  5HRP A;  1NK0 A;  3VEY A;  4BQZ A;  3OYD A;  3BGR A;  2HBJ A;  4AM6 A;  2YJE A;  2QM1 A;  1T7P A;  3VQ6 A;  4ELV A;  4LF5 K;  4M3T A;  2QWM A;  4E1M A;  3QIN A;  4M3R A;  1LWF A;  4DF8 A;  3VEZ A;  4ZTJ A;  5DK5 A;  3QNO A;  3O5B A;  4DR1 K;  2IOC A;  1TL1 A;  4CJL A;  1BIS A;  4ID1 A;  4BC3 A;  3EKU A;  2YCH A;  5CZ1 A;  1S1X A;  4LD0 A;  1RTD A;  4JI5 K;  4NLC A;  2GUI A;  1NM1 A;  5KPT A;  3U6F A;  2HNY A;  5C2F A;  1NK7 A;  1IG9 A;  4CIG A;  2BH1 A;  1YI2 N;  4B3T K;  3KWG A;  2OPP A;  3V9X A;  3HVT A;  3LL3 A;  3UKR B;  4DSL A;  4CI6 A;  3FZM A;  1K8K A;  4PKI A;  3A5M C;  4DQI A;  3ZSR A;  3VA0 A;  3QFU A;  3K9K A;  3QBX A;  5AQW A;  4YDU C;  1KQS M;  1B9D A;  1TKD A;  1QVF M;  2YKM A;  4Z4F A;  3QIO A;  1XC9 A;  4IDH A;  4U7B A;  3A0I X;  3TAN A;  3VF6 A;  3F2K A;  4OKJ A;  3L2V A;  3M8P A;  3V1R A;  2P9I B;  4O4G A;  3WNF A;  4DUZ K;  1LWC A;  3V9S A;  2O8B B;  4BG9 A;  3MXJ A;  3SBG A;  2HBM A;  3EEQ A;  4DQ8 A;  2FSN A;  1U6Z A;  4JYA K;  2ASM A;  1P8Z A;  1TKZ A;  5BRF A;  1U04 A;  5HRO A;  4B1U B;  3DXM A;  3UKU B;  2Q3S A;  2WTU A;  4DV0 K;  1HKG A;  3L6Q A;  1T6D A;  1QSS A;  3MX5 A;  3AAQ A;  4NO7 A;  2RHK A;  1CXU A;  2IVP A;  1WUA A;  4JI7 K;  3NF7 A;  1FKP A;  3LAN A;  3CG7 A;  4I2Q A;  4JS4 A;  4CHQ A;  4KH4 A;  4NLB A;  4FOI A;  3PIO L;  1C1A A;  3LZI A;  1IBL K;  2QWP A;  4DV7 K;  3KK7 A;  3DMJ A;  1U2V B;  2HF3 A;  4PQU A;  5ADX A;  3N4P A;  4DSF A;  3C0B A;  3ZLJ A;  1MWM A;  1F21 A;  1DTQ A;  2Q1N A;  4DSK A;  4YHH K;  3KWI A;  1NK4 A;  1IH7 A;  4WQ4 C;  3NAE A;  3NH0 A;  1T6C A;  4KHU A;  2KTQ A;  1C0M A;  1YUW A;  3DLE A;  5C25 A;  1LWE A;  4IWV A;  3AY9 A;  1ZBH A;  4BRC A;  3S3N A;  3NF6 A;  1NU0 A;  3CCR N;  3SI6 A;  3OS2 A;  1Y64 A;  3SMP A;  3GL1 A;  4KKO A;  4WFB L;  3NH2 A;  5E84 A;  4CGJ A;  4H0Y B;  3ZEU B;  3PO5 A;  1HNV A;  1KXP A;  3ZSQ A;  1OVQ A;  1YJW N;  4CJ5 A;  2YV0 X;  4K25 A;  5JVG L;  4FJN A;  2DFH A;  2YJF A;  5F2R A;  1YF5 L;  1EQY A;  3SAF A;  3DJC A;  2D1K A;  4DTU A;  2P9U B;  4OKK A;  3P4I A;  4KAZ A;  3JSM A;  1VQ5 N;  2V7Z A;  3PIP L;  1BI4 A;  4FWM A;  2A3Z A;  1ILY A;  2ZJR L;  3OYJ A;  4QCL A;  4C23 A;  4RWT A;  1I94 K;  4CJW A;  2Z1G A;  2HMP A;  1NK6 A;  3K58 A;  5AQR A;  1GLL O;  3L2W A;  3LAL A;  4BRO A;  5BRH A;  3WXM B;  4EP4 A;  3GDQ A;  3LM9 A;  3O9S A;  4KI4 A;  4WQ4 A;  4DFJ A;  1IKX A;  3V9U A;  2HHU A;  3EE8 A;  1JJ2 M;  4MLH A;  3VQC A;  4OVL A;  4W5O A;  4FCY A;  3LP1 A;  4CFC A;  4BWJ A;  1V4T A;  2P9L A;  1VSE A;  2KFN A;  2FF3 B;  2QWR A;  3QNN A;  1NGG A;  3KKS A;  3TSQ A;  3WXK A;  1VSF A;  3MEE A;  4N41 A;  4H4O A;  1EWR A;  4KTQ A;  1YIT N;  3L3V A;  4DB3 A;  3OYK A;  1Q81 O;  4JAX A;  3SAG A;  5HRN A;  3SPZ A;  1NOZ A;  4CF8 A;  4FK4 A;  2UU9 K;  1JCF A;  4H0T B;  3P39 A;  3CC2 N;  3DWL A;  2VG7 A;  3MN6 A;  3HYF A;  4BDZ A;  1OH7 A;  3VN5 A;  3NGZ A;  4RW8 A;  5AQZ A;  3AO4 A;  1U45 A;  4CE9 A;  1XMQ K;  1SL2 A;  4E1J A;  3U3Y A;  4KHP K;  1IKV A;  1EWQ A;  3AVI A;  2Q31 A;  5C15 A;  4N56 A;  3QEW A;  1NGB A;  1BHL A;  1K8K B;  4IOX A;  4KHN A;  2P9S A;  4H5N A;  1UWB A;  3L0Q A;  3C65 A;  4I7F A;  5LJW A;  5AZJ A;  5KQD A;  4ISE A;  1X9S A;  3BF3 A;  1JL2 A;  3O9U A;  4QS7 A;  3G10 A;  4FJL A;  1WAJ A;  2V51 B;  4RW6 A;  1FXX A;  4W5R A;  2QKB A;  4L3Q A;  1LOT B;  1RT6 A;  2WUS A;  2ZD1 A;  3BP8 A;  4LH4 A;  4FJ9 A;  3AVG A;  3TPQ A;  1Q8I A;  4JD2 A;  4M3Y A;  3BEX A;  4LFC K;  3SK3 A;  1RTJ A;  4DLE A;  2G8V A;  2W6K A;  4DTX A;  2X78 A;  4NYN A;  4WFA L;  4J2D A;  3HK2 A;  2VQE K;  1BA1 A;  4O55 A;  4LY7 A;  4M41 A;  4EAH D;  3HT3 A;  1B92 A;  3CJB A;  1A5W A;  1XNQ K;  1GLB G;  4JLH A;  4OPJ A;  4MDA A;  4BE2 A;  1VRT A;  4I2P A;  1WBD A;  4FLT A;  2QWL A;  4QS8 A;  2AP1 A;  4IG3 A;  4CIE A;  3ZSZ A;  1S72 N;  1ZC6 A;  4PL7 A;  4CGG A;  1D8Y A;  3E9P A;  4MLE A;  4CHO A;  4DU1 A;  4FWP A;  4NCG A;  4AHT A;  4KHS A;  3AVB A;  1A5X A;  4C8K A;  4Z94 A;  3HPH A;  4B9N A;  1VQ4 N;  3FLC O;  3EZW A;  1XC3 A;  1TYQ A;  5HBM A;  4BRD A;  2VQF K;  5EOY A;  1S3X A;  1NJY A;  3MXM A;  3THY B;  4CES A;  1LCU A;  3CHW A;  4BWM A;  3QEX A;  2YNH A;  4AQY K;  1RNH A;  4FWO A;  5B8H A;  1XNR K;  1C1C A;  3CD6 N;  3OS1 A;  1WNS A;  3K5L A;  4AHS A;  2OAN A;  4IO9 L;  2QXL A;  1BG3 A;  4A5B A;  3HBT A;  4CZK A;  1VQP N;  2CH6 A;  3N4Q A;  2Q36 A;  1ZBF A;  5TKW A;  2VG6 A;  4FJ5 A;  3MN9 A;  3JS6 A;  4L8R B;  4RW9 A;  2E1Z A;  3NF8 A;  3TTF A;  1L5U A;  3UB5 A;  3C6T A;  3HP6 A;  2BDP A;  3Q7C A;  4H0X B;  1IG8 A;  5SWM A;  4FJ8 A;  3AAP A;  3FZF A;  4BDY A;  3IFR A;  4CZG A;  2FF6 A;  2PYL A;  4CW7 B;  4X66 K;  2KHO A;  4DCH A;  1HNX K;  4GV3 A;  1OKJ A;  4CZH A;  5EU7 A;  3MMV A;  1VSJ A;  1N34 K;  1HQU A;  3O08 A;  4DTS A;  1YVN A;  3UKR A;  3SYZ A;  1M90 O;  2O8F B;  1RDW X;  4GVM A;  2G8K A;  4M3U A;  4OPK A;  5AQH A;  1QZ5 A;  2HHW A;  4DS4 A;  3EY1 A;  4CJT A;  2OZM A;  2RF2 A;  3WXJ A;  1T05 A;  4A62 A;  3VGK A;  3OS0 A;  3CIP A;  4E19 A;  1KTQ A;  3DLR A;  5FPN A;  1OH8 A;  2OCE A;  4WE1 A;  1EO1 A;  5C42 A;  3MEC A;  2H3G X;  2HHQ A;  2P9L B;  2ITM A;  3C95 A;  4DSE A;  1RDU A;  4B8C A;  4F2S A;  1YJ9 N;  2O8B A;  5AQK A;  2D0B A;  2A6A A;  5M1N A;  3CCQ N;  4J2A A;  3CFR A;  1ZBU A;  1HJR A;  4AHR A;  3SUN A;  4DSJ A;  1S9G A;  4CJF A;  3HOT A;  4HUF A;  1CZA N;  4BR2 A;  3AAR A;  4CFB A;  1K9M O;  1JKH A;  4IZ9 A;  1Q82 O;  1NG9 A;  3IAY A;  1S1U A;  2UXD K;  4M63 C;  4YY3 K;  1E3M A;  1S1W A;  4CBW A;  1K8A O;  3QIC A;  1NK8 A;  1KLM A;  5FPD A;  3VQP A;  3RVC A;  3C7N A;  5AQQ A;  2Z1H A;  4CHP A;  4OGC A;  2DPN A;  3PV8 A;  1LAV A;  3E01 A;  1IBM K;  3OYH A;  4BR9 A;  1N33 K;  4KH5 A;  1U2V A;  3VEO A;  3G6E N;  2VGM A;  4IFV A;  2Z1J A;  3VQA A;  4LSL A;  4LF6 K;  3O3H A;  3AA3 A;  4IEE A;  5AZJ B;  3VF2 A;  4CGH A;  3LWM A;  2JLE A;  4DFM A;  1J5E K;  4C8O A;  1XQS C;  5AQM A;  4R5P A;  1EP4 A;  3VOV A;  5CZ2 A;  3G71 N;  1YIJ N;  1RDD A;  2HNZ A;  3L2R A;  1KLN A;  3ZSY A;  4FLW A;  1KAY A;  5K14 A;  3DRR A;  2D4W A;  2WBN A;  3QEI A;  4FJM A;  3K5O A;  5C12 A;  4HWI A;  4JD2 B;  3I8D A;  2Y1J A;  5HL7 L;  3WT0 A;  2VG5 A;  3FGU A;  4BRH A;  3CI5 A;  4CJE A;  1VSI A;  1BU6 O;  3BZC A;  3OYL A;  4NCB A;  1UA1 A;  3E1Y A;  2JWK A;  5AR0 A;  3OA9 A;  3QML A;  3ZEU A;  4CF9 A;  4ZHR A;  5BN8 A;  3HVR A;  4MO4 A;  4B8A B;  4IOC L;  1EET A;  4BR7 A;  3TAP A;  2OYQ A;  2ASO A;  4CJ3 A;  3I56 N;  3KK3 A;  4I9L A;  1FKO A;  2A5X A;  4DF4 A;  1YT3 A;  3RMA A;  1C0U A;  4XH4 A;  3W0L A;  5J1E A;  4HHT A;  2F8T A;  2YHX A;  4CK2 A;  2FC0 A;  4KV8 A;  4JKG A;  1GOB A;  2D0C A;  1VQ7 N;  4FM2 A;  5EY4 A;  3IS9 A;  4KRF A;  3TSU A;  2KZZ A;  3HPG A;  4OO1 J;  4LFB K;  5E26 A;  2QI2 A;  4CFA A;  3D2E A;  1TYQ B;  4IBN A;  4DTR A;  1O13 A;  1UOC A;  2OZS A;  1D4X A;  1X3M A;  4BRK A;  3ATU A;  2D0O A;  5JS2 A;  3H1Q A;  1G99 A;  3L4I A;  4CEE A;  5AQF A;  2VYP A;  1VSD A;  1C0T A;  2EWS A;  3C6H A;  3AA2 A;  3H6E A;  1I3A A;  3CPE A;  3SUO A;  1RT3 A;  4B3O A;  4BC5 A;  4JNE A;  4OKE A;  5M1Q A;  3ZSW A;  2WOM A;  3NHG A;  3C6A A;  3LDS A;  1NGH A;  2Q0U A;  2KZM A;  1L3U A;  4DQR A;  1WLJ A;  1L3T A;  2R7Y A;  4V19 S;  5GIO A;  1ATS A;  3TAQ A;  3LP3 A;  4PKH A;  2P9N A;  1IKW A;  1J53 A;  4FWK A;  4B9L A;  4CEA A;  3WXI A;  4G1Q A;  3PLA A;  4ILJ A;  3RMB A;  4FK2 A;  2EX3 A;  4BRE A;  4DU3 A;  4DFK A;  1XMO K;  1VQ6 N;  3CYM A;  2X6N A;  1J54 A;  2I7P A;  3T69 A;  4DLG A;  3KK2 A;  3MAQ A;  5BRD A;  1NOY A;  2QTD A;  1D9D A;  3V9W A;  5DM6 L;  4RW7 A;  4FPA A;  4EZ6 A;  5I3U A;  2VWJ A;  3FFI A;  3LDL A;  3FZK A;  1RBU A;  1Z26 A;  1S5J A;  2YI1 A;  4FL9 A;  3THX B;  4BDP A;  4J2E A;  1BDG A;  3SJH A;  3CQ8 A;  3OY9 A;  3R9P A;  4DV6 K;  4FM1 A;  3S9H A;  4Z0U A;  5AQX A;  2PBD A;  4IKF A;  3J7A P;  3HST B;  1WB9 A;  3KHY A;  5JIC A;  1BGX T;  2DFE A;  3ZSV A;  1TK0 A;  1MU2 A;  2B5J A;  3MED A;  2OTL N;  5C0Y A;  1CZB A;  3ZX2 A;  5BPM A;  5JMV A;  4LSN A;  3AVM A;  3AO1 A;  1HLU A;  4EFH A;  4CCH A;  4FXD A;  1WBB A;  2RN2 A;  1NMN A;  4CF1 A;  1KRP A;  3SMS A;  2F8S A;  3SUQ A;  5KPZ A;  3QEV A;  1RT5 A;  2UXB K;  4K42 A;  4CJR A;  3ZX0 A;  5JVH L;  3C7N B;  3LAM A;  1SS6 A;  3L2U A;  3CQX A;  2A40 A;  3ATV A;  3HP9 A;  1D5A A;  1JLE A;  2F7T A;  2OPR A;  3HPO A;  2P5O A;  1A5V A;  3C6U A;  2IVN A;  2NRV A;  4QS9 A;  1VQK N;  4B9M A;  3O8M A;  1X3N A;  1RFQ A;  3VQ4 A;  3THY A;  2YNF A;  4CEQ A;  3MWT A;  4IXC A;  2NUB A;  4JN4 A;  2O4G A;  4LFA K;  5HLF A;  4YDU A;  3RRG A;  3H46 O;  4CK1 A;  1XHZ A;  5GIP A;  4BAC A;  2X6S A;  2F9T A;  3L3U A;  4C1N I;  3PUF A;  4JI1 K;  3S3M A;  2XY8 A;  4YOR A;  2O8D B;  2ITG A;  4CEB A;  3O4W A;  4YOU A;  3LDO A;  4WYB A;  5GIN A;  2I5J A;  3V1Q A;  2GX9 A;  3HO1 A;  3GBT A;  4M42 A;  3AVN A;  3CCU N;  4EZ9 A;  4CHY A;  3ENO A;  2UYT A;  3VQD A;  3WUH A;  3SV3 A;  1QSL A;  1N6Q A;  4CGI A;  4JK8 A;  2E2N A;  4M45 A;  1NJW A;  2PYJ A;  4FZY A;  1CLQ A;  3AVJ A;  1BQM A;  3EN9 A;  4CHN A;  1B9F A;  4ID5 A;  4J2B A;  4H5T A;  4E1N A;  3CJ7 A;  1RBV A;  1KAZ A;  4JKG B;  3QES A;  4M3Z A;  3F5T A;  4E7L A;  1BL3 A;  4W5T A;  4KI6 A;  4IFE A;  2YHA A;  2QWQ A;  4FLV A;  1S6P A;  3OJU A;  3J80 O;  1VQ9 N;  1QQM A;  2FBV A;  5EX5 A;  3BUZ B;  3D2E B;  3CFO A;  4UQG A;  3NBP A;  3I55 N;  3DLH A;  2NRZ A;  1ASV A;  3HRG A;  3OYG A;  2O8F A;  3NFA A;  3AVF A;  4DSI A;  1NGI A;  1RDC A;  3VEW A;  1C0F A;  4F9O A;  1GLA G;  2O8C A;  3VA3 A;  4N76 A;  5M1P A;  2CH5 A;  3IUC A;  3T1H K;  1U47 A;  4IJA A;  4CZE A;  5FLX O;  1TAQ A;  4Y1C A;  1JCE A;  4DQQ A;  4A2B A;  2Q2R A;  3T1A A;  3D0P A;  1JXE A;  3C94 A;  1XI1 A;  4BRQ A;  1KD1 O;  3O4Q A;  2HMI A;  2P9N B;  1VSK A;  5AJ3 K;  3OYF A;  4LF7 K;  1REV A;  4FJ7 A;  3LP0 A;  3AGR A;  3KIO A;  4GVE A;  3PX0 A;  2ETJ A;  1NGE A;  4KRE A;  3NF9 A;  1YVU A;  1S22 A;  2OPS A;  3KLI A;  3T1Y K;  2HHH K;  2Q0R A;  1HPM A;  3WNG A;  3CMA N;  4CJ7 A;  3OW2 M;  3VQ7 A;  3VQB A;  4OLA A;  4XIU A;  3DM2 A;  3PSF A;  4KBO A;  4DWI A;  1Q18 A;  5M1K A;  1JXB A;  1SKS A;  3M3Z A;  1CXQ A;  4PKG A;  1GLF O;  1TGO A;  4CEO A;  3TAF A;  4PA1 A;  1HNW K;  3AO3 A;  4C8M A;  1RT2 A;  3ZT2 A;  4DTP A;  1BCO A;  1KVC A;  4F8R A;  3VTH A;  3A5O C;  2BE2 A;  1EXQ A;  4BRL A;  5HOO A;  2UXC K;  4JI4 K;  5BPL A;  1HJO A;  2RE2 A;  3B8A X;  1XWL A;  3H3O B;  4X64 K;  2Z1I A;  2ZWH A;  1TL3 A;  2A41 A;  3T19 A;  2A1R A;  4XH5 A;  4BQL A;  3UE5 A;  4LF8 K;  1OH5 A;  2YHW A;  3WQU A;  3PX6 A;  2HVH A;  4CZF A;  4AF1 A;  3M1F A;  4FLX A;  1SKW A;  3QET A;  4A57 A;  5DM7 L;  3L4Q A;  2NZT A;  5HRR A;  3MWP A;  1S1V A;  4KTZ A;  1BQN A;  3CQY A;  3AVA A;  4YOX A;  3ULD A;  3TWH A;  1HQE A;  3WEE B;  4FW1 A;  5J2P A;  3CCE N;  3H3N O;  3AVL A;  4FWL A;  4RCH A;  2CGJ A;  1JLQ A;  2KKZ A;  1MWK A;  1T8E A;  1GLC G;  4Z4C A;  1TKX A;  1C6V A;  2G8I A;  3PSI A;  2KFZ A;  2XY6 A;  4Q0B A;  1HRH A;  2IIR A;  2HND A;  3KLG A;  3K57 A;  1ZBS A;  2FBT A;  3HM9 A;  1WSI A;  4BGA A;  1NLV A;  3K59 A;  1NKE A;  4QOZ B;  2QA4 N;  1KVA A;  3HOS A;  4CFD A;  2XRI A;  4BC4 A;  4K0K K;  2D0P A;  3IRX A;  3TSP A;  2ZQB A;  1NWK A;  1NKC A;  4JI3 K;  4JKC A;  5AQL A;  1IO2 A;  3HJF A;  3V6D A;  5AQJ A;  2QK9 A;  3OVN A;  2HHS A;  3M6G A;  4KPY A;  3OBY A;  4CJV A;  2E8A A;  4CEC A;  3CJA A;  4KB0 A;  4FW2 A;  4IG0 A;  4BC2 A;  3BY5 A;  4CD1 A;  1K6Y A;  3K9J A;  4CGD A;  3A5N C;  4Z4G A;  1RTH A;  3NVK A;  1NK5 A;  4DQP A;  1VQO N;  4AM7 A;  1JL1 A;  1X9W A;  5LJV A;  4DTJ A;  3R6M A;  2V7Y A;  2ZJP L;  1O1W A;  3DOL A;  3U9Z A;  5AQN A;  4E3S A;  4GW6 A;  2NNW A;  3LAK A;  3VET A;  2E4L A;  3AO5 A;  4ILG B;  2Q97 A;  1QQN A;  5AZI A;  2IS3 A;  1RBS A;  3ID6 A;  4FZZ A;  2E6M A;  1QQO A;  3AV9 A;  1J6Z A;  1G15 A;  4ISG A;  3R3L A;  4NXM K;  3ZT3 A;  4F3T A;  4AIL C;  2JGU A;  3NCI A;  3A8Y A;  2UUB K;  1NGF A;  3TR8 A;  3WXL A;  4O0J A;  4E0D A;  4CEZ A;  4OPH A;  1SZ2 A;  1JLF A;  1NGD A;  1QZ6 A;  3A2F A;  3MN7 A;  5H1S Q;  4DR6 K;  4B1V A;  4M3W A;  2O8C B;  3OYA A;  3THX A;  3HSC A;  3LDP A;  1HYV A;  2XHB A;  2UUA K;  3OYN A;  1JLA A;  1KCF A;  4LH5 A;  4GV6 A;  2OA8 A;  4B9Q A;  5KGW A;  3SUP A;  3DOK A;  4JI6 K;  3FZL A;  4WQ5 C;  4BR4 A;  5IT9 O;  4B9V A;  5AQP A;  3ZT4 A;  4FK0 A;  3J8A A;  3RWU A;  1ITG A;  4OGE A;  2QW9 A;  1BWF O;  1YXQ A;  3ID8 A;  4M3X A;  4ICL A;  3QEP A;  3U3G A;  5J2N A;  1HKC A;  3TAR A;  1GLE G;  5FPE A;  3TI0 A;  4FLZ A;  4FYD A;  3NH1 A;  3K2P A;  2P5G A;  3DRP A;  3SQ1 A;  2O4I A;  3OBW A;  4WCE L;  4CGF A;  1SQK A;  3SNN A;  3SV4 A;  3NGI A;  5JS1 A;  3ENB A;  4K41 A;  3MEG A;  3QIP A;  3AGK A;  5KRS A;  4K43 A;  3LWL A;  4ILH A;  3F73 A;  1Y97 A;  3K5N A;  4H5W A;  4FPB A;  3M8R A;  3B6P A;  1ZBL A;  2QKK A;  2Y1I A;  3CET A;  3K5M A;  5T7B A;  2QEX N;  2O8D A;  4CZI A;  3OYB A;  3MX2 A;  1DKG D;  1C1B A;  2IAJ A;  4E89 A;  1HX1 A; 
#chains in the Genus database with same CATH homology
 3KLH A;  4FM1 A;  3ALY A;  3O3G A;  3VQC A;  3S9H A;  2GV9 A;  4OVL A;  1JLC A;  4Z0U A;  3VQE A;  4N5S A;  3RMC A;  2DTU A;  4W5O A;  4FCY A;  4IKF A;  3LP1 A;  1L3S A;  3HST B;  4CFC A;  4BWJ A;  1LV5 A;  1BGX T;  1VSE A;  2DFE A;  3ZSV A;  1TK0 A;  2KFN A;  2HHT A;  4E7J A;  3QNN A;  1MU2 A;  5SZT A;  4DTN A;  2B5J A;  4KB1 A;  3MED A;  2AJQ A;  3KKS A;  3TAB A;  1Q9Y A;  1CZB A;  4KHQ A;  1VSF A;  1VSM A;  3MEE A;  4N41 A;  4LSN A;  4H4O A;  3PY8 A;  4KTQ A;  3AVM A;  3L3V A;  3AO1 A;  2GBZ A;  3OYK A;  4KHY A;  3SPY A;  4CCH A;  4FXD A;  1WSF A;  4GMJ B;  3KLE A;  2RN2 A;  4CJK A;  5HRN A;  1RCH A;  3SPZ A;  5C24 A;  4CF1 A;  4CK3 A;  1KRP A;  4W5N A;  4CED A;  2DFF A;  1RBR A;  1NOZ A;  4CF8 A;  4FK4 A;  2F8S A;  1JLB A;  3SUQ A;  4Z4I A;  3QEV A;  1RT5 A;  2P1J A;  3M8S A;  4CJR A;  4EP5 A;  5KTQ A;  4CJQ A;  2VG7 A;  5HRS A;  3LAM A;  4HTU A;  3HYF A;  3L2U A;  4BDZ A;  4PWD A;  4NYF A;  3VN5 A;  3NGZ A;  4I9Q A;  3HP9 A;  4RW8 A;  3AO4 A;  1U45 A;  1XHX A;  4CE9 A;  1D5A A;  1JLE A;  3AO2 A;  2OPR A;  3HPO A;  2W42 A;  1A5V A;  3C6U A;  2XO7 A;  2P5O A;  1SL2 A;  3U3Y A;  2WON A;  4CJ4 A;  1IKV A;  4B9M A;  1BI4 B;  3AVI A;  4F3O A;  1RDB A;  1KSP A;  3VQ4 A;  2KQ2 A;  4RW4 A;  2YNF A;  4CEQ A;  4N56 A;  3QEW A;  3QER A;  3G0Z A;  1BHL A;  4KHN A;  2BAN A;  1RT4 A;  1RDA A;  1UWB A;  2NUB A;  3TAE A;  2O4G A;  1X9M A;  5HLF A;  4I7F A;  3RRG A;  1X9S A;  4O0I A;  4CK1 A;  1JL2 A;  4FJL A;  3G10 A;  4B08 A;  1XHZ A;  1RBT A;  1WAJ A;  4RW6 A;  4BAC A;  1KFD A;  4C8L A;  2X6S A;  1FXX A;  4W5R A;  4N47 A;  3L3U A;  1J9A A;  3PUF A;  4FJK A;  3S3M A;  2QKB A;  2XY8 A;  2ZD1 A;  1RT6 A;  4LH4 A;  2G8W A;  4FJG A;  1WAF A;  2YNI A;  4FJ9 A;  1GOC A;  3AVG A;  1ZBI A;  3JYT A;  4OLB A;  1IKY A;  2PY5 A;  1FK9 A;  3KD1 E;  1Q8I A;  2ITG A;  4TSX A;  1R0A A;  4CEB A;  4M3Y A;  1VRU A;  1RTJ A;  4DLE A;  5D3G A;  2G8V A;  1TAU A;  3VQ5 A;  4DTX A;  1S9E A;  2X78 A;  1HYZ A;  4NYN A;  2I5J A;  3V1Q A;  4J2D A;  3HK2 A;  5KI6 A;  3HO1 A;  3DYA A;  4CF0 A;  4O55 A;  3AVN A;  4M42 A;  2IC3 A;  4LY7 A;  4M41 A;  4AH9 A;  3AA5 X;  4EZ9 A;  4Z4H A;  1BIU A;  4H8K A;  3HT3 A;  1B92 A;  4CHY A;  4PY5 A;  2RPI A;  3IG1 A;  3VQD A;  1A5W A;  4DTM A;  3AVH A;  3SV3 A;  2G8U A;  1QSL A;  1N6Q A;  4CGI A;  4JLH A;  3WNH A;  4M45 A;  4OPJ A;  4BE2 A;  1VRT A;  4I2P A;  1NJW A;  4FLT A;  2PYJ A;  1VSL A;  4FZY A;  1CLQ A;  4KTW A;  1QTM A;  3AVJ A;  4IG3 A;  4CIE A;  1BQM A;  1DLO A;  1EX4 A;  3ZSZ A;  1B9F A;  4CHN A;  1SKR A;  2PZS A;  4ID5 A;  4CGG A;  4J2B A;  4E1N A;  1TKT A;  4YNQ A;  2HHX A;  1RBV A;  1RT7 A;  3QES A;  2B6A A;  4M3Z A;  5J2Q A;  1QQC A;  4K8X A;  3I0R A;  1D8Y A;  4E7L A;  1BL3 A;  3V9Z A;  4W5T A;  3B6O A;  3KD5 E;  4KI6 A;  2YHA A;  4CHO A;  4DU1 A;  4AHT A;  4NCG A;  4FLV A;  1S6P A;  1QS4 A;  3L8B A;  3OJU A;  4KHS A;  2FBV A;  1A5X A;  1ASU A;  3AVB A;  3HPH A;  4B9N A;  4C8K A;  3CFO A;  4UQG A;  4QAG A;  3NBP A;  1NK9 A;  4CER A;  4MQ3 A;  2G8H A;  3DLH A;  4BE0 A;  4B9U A;  5HBM A;  1ASV A;  3OYG A;  3NFA A;  3AVF A;  1NJY A;  3MXM A;  4DSI A;  1GOA A;  4CES A;  1RDC A;  1WN7 A;  3P83 D;  4QOZ B;  2HHU A;  3QO9 A;  4BWM A;  3QEX A;  3O4N A;  2YNH A;  4H4M A;  4CF2 A;  3VA3 A;  3RR7 A;  1RNH A;  2EHG A;  2QXF A;  2YKN A;  3VQ8 A;  4N76 A;  1C1C A;  1QE1 A;  3V1O A;  3OJS A;  3OS1 A;  1DTT A;  1WNS A;  3K5L A;  2LSN A;  4AHS A;  3PO4 A;  3VQ9 A;  1UA0 A;  1Q9X A;  5CYQ A;  1U47 A;  1VSH A;  1QHT A;  4O44 A;  3KTQ A;  4HUE A;  5KRT A;  1TAQ A;  4Y1C A;  4JRP A;  4DQQ A;  4YFU A;  5HP1 A;  3T1A A;  2ATQ A;  1YTA A;  3D0P A;  3ZSO A;  1JXE A;  3C94 A;  1XI1 A;  3L2Q A;  3KKR A;  3O4Q A;  1SL1 A;  2HMI A;  1ZBF A;  4Y1D A;  2VG6 A;  1VSK A;  3BDP A;  3RTV A;  3S3O A;  4FJ5 A;  3OYF A;  4L8R B;  1W0H A;  1REV A;  4FJ7 A;  4RW9 A;  3LP0 A;  2HHV A;  3KIO A;  4CJP A;  4ZTF A;  3NF8 A;  1L5U A;  3PX0 A;  3LPT A;  3C6T A;  2ETJ A;  4KRE A;  1LAW A;  3HP6 A;  3CM6 A;  2BDP A;  3NF9 A;  1WSG A;  1YVU A;  3CFP A;  2OPS A;  3KLI A;  4FJH A;  5SWM A;  4FJ8 A;  3ISN C;  4DQS A;  2B4J A;  1U4B A;  4BDY A;  5I42 A;  3P1G A;  1T03 A;  4BE1 A;  4F4K A;  3OYM A;  3SJJ A;  3WNG A;  1EKE A;  3LP2 A;  1U48 A;  3VQ7 A;  2P51 A;  2OPQ A;  2PYL A;  3VQB A;  4CEF A;  4Q5V A;  4OLA A;  4XIU A;  3KK1 A;  3DM2 A;  2A1S A;  3HL8 A;  3SQ2 A;  1RTI A;  4DWI A;  5EU7 A;  1JXB A;  1VSJ A;  5FRM A;  1HQU A;  1SKS A;  4DTS A;  1YTU A;  1CXQ A;  3AA4 A;  1N5Y A;  4CEO A;  1TGO A;  4HUG A;  3TAF A;  2BGG A;  1JLG A;  4PA1 A;  3WNE A;  1SV5 A;  3AO3 A;  4C8M A;  4CJU A;  1RT2 A;  3SYZ A;  1NJX A;  3ZT2 A;  4DTP A;  3SQ0 A;  1BCO A;  3V81 A;  1KVC A;  4FZX C;  4F8R A;  5CYM A;  4FM0 A;  1SUQ A;  4GVM A;  2G8K A;  2BE2 A;  2RKI A;  1EXQ A;  4OPK A;  4M3U A;  4F2R A;  4RG8 A;  2HHW A;  1XWL A;  1TK5 A;  4DS4 A;  3OYE A;  3EY1 A;  4CJT A;  2IGI A;  2Z1I A;  5E41 A;  2RF2 A;  2OZM A;  3PX4 A;  1TL3 A;  4E7K A;  4B9T A;  3T19 A;  2A1R A;  1T05 A;  1KFS A;  3OS0 A;  1CZ9 A;  4E19 A;  1KTQ A;  3DLR A;  4WE1 A;  3EYZ A;  3PX6 A;  4FJJ A;  2HVH A;  4DTO A;  1BCM A;  3OYC A;  3LPU A;  5C42 A;  3MEC A;  5HRP A;  3V4I A;  3AVK A;  4FLX A;  1NK0 A;  1SKW A;  2HHQ A;  1NJZ A;  3QET A;  4FLU A;  3OYD A;  3BGR A;  3T3F A;  3C95 A;  4DSE A;  4B8C A;  4F2S A;  1T7P A;  3VQ6 A;  2D0B A;  4CJS A;  4ELV A;  4J2A A;  4MFB A;  3CFR A;  1ZBU A;  4M3T A;  5HRR A;  1HJR A;  1S1V A;  4OJR A;  4E1M A;  4KTZ A;  3QIN A;  4M3R A;  4AHR A;  3SUN A;  1LWF A;  1BQN A;  4DF8 A;  3AVA A;  4DSJ A;  4CHZ A;  4ZTJ A;  4FVM A;  5DK5 A;  3ULD A;  1S9G A;  5FRO A;  4CJF A;  3QNO A;  3TWH A;  2IOC A;  1TL1 A;  5DMR A;  1HQE A;  4CJL A;  4HUF A;  1BIS A;  4CFB A;  1D9F A;  4ID1 A;  1JKH A;  4FW1 A;  5J2P A;  4NCA A;  3AVL A;  5CZ1 A;  1S1X A;  4LD0 A;  1JLQ A;  1S1U A;  1RTD A;  3IAY A;  2D5R A;  1HYS A;  1S1W A;  1HMV A;  4C8N A;  1T8E A;  4Z4C A;  4JRQ A;  2GUI A;  1S6Q A;  1TKX A;  2YNG A;  1NK8 A;  2IDO A;  1KLM A;  1WSH A;  1ZYQ A;  3VQP A;  1C6V A;  2FBX A;  2G8I A;  4B9S A;  4AHU A;  2HVI A;  2Z1H A;  4CHP A;  3U6F A;  2HNY A;  4OGC A;  1NK7 A;  1IG9 A;  4CIG A;  2KFZ A;  2XY6 A;  4Q0B A;  3KLF A;  3PV8 A;  1HRH A;  1LAV A;  3E01 A;  3OYH A;  2OPP A;  2HB5 A;  3HVT A;  3V9X A;  2HND A;  3KLG A;  1WSE A;  3K57 A;  2FBT A;  1WSJ A;  3HM9 A;  4IFV A;  3NDK A;  2Z1J A;  3VQA A;  1S1T A;  1WSI A;  4LSL A;  1RT1 A;  3O3H A;  3AA3 A;  4CGH A;  4DSL A;  3LWM A;  2JLE A;  3K59 A;  4DFM A;  4DFP A;  1NKE A;  4C8O A;  1KVA A;  3ZSR A;  3VA0 A;  4CFD A;  1NKB A;  2XRI A;  4DQI A;  3MXI A;  4R5P A;  1EP4 A;  3LZJ A;  3IRX A;  5CZ2 A;  2YHB A;  2ZQB A;  1NKC A;  1B9D A;  1RDD A;  2HNZ A;  3L2R A;  1TKD A;  1KLN A;  1TVR A;  1IO2 A;  3ZSY A;  4FLW A;  1J5O A;  3HJF A;  1HNI A;  2YKM A;  5K14 A;  3V6D A;  3DRR A;  3SZ2 A;  1RIL A;  4CIF A;  4Z4F A;  4FJM A;  3OVN A;  3QEI A;  1TK8 A;  3K5O A;  3I8D A;  4KPY A;  2QK9 A;  2HHS A;  3QIO A;  4KHW A;  1XC9 A;  4CJV A;  2Y1J A;  1QSY A;  3TAN A;  4CEC A;  1W9H A;  4KB0 A;  4FW2 A;  4IG0 A;  4OKJ A;  2F96 A;  1K6Y A;  2VG5 A;  4CGD A;  4Z4E A;  4Z4G A;  3L2V A;  3M8P A;  3V1R A;  3I0S A;  4CJE A;  1VSI A;  4O4G A;  1RTH A;  3CM5 A;  3WNF A;  3OYL A;  4NCB A;  1UA1 A;  1NK5 A;  1LWC A;  3V9S A;  4DQP A;  4CF9 A;  3TAG A;  4ZHR A;  1JL1 A;  1X9W A;  3MXJ A;  3HVR A;  2XY7 A;  4B8A B;  4DTJ A;  1EET A;  2HW3 A;  3TAP A;  2OYQ A;  4HCC A;  4CJ3 A;  4PUO A;  3O3F A;  3KK3 A;  4I9L A;  1FKO A;  1O1W A;  4DF4 A;  1ASW A;  1YT3 A;  3DOL A;  1C0U A;  1TKZ A;  1U04 A;  5J1E A;  3RMA A;  4E3S A;  5HRO A;  4HHT A;  5CY4 A;  2Q3S A;  4GW6 A;  5J2M A;  3LAK A;  3TAM A;  1L3V A;  3AO5 A;  2E4L A;  2F8T A;  1QSS A;  2IS3 A;  4CK2 A;  2FC0 A;  1RBS A;  4KV8 A;  4FZZ A;  2E6M A;  4DU4 A;  1GOB A;  1CXU A;  2D0C A;  3AV9 A;  1G15 A;  4FM2 A;  3NF7 A;  3ZT3 A;  4F3T A;  1FKP A;  3IS9 A;  1I39 A;  4KRF A;  3LAN A;  3CG7 A;  4I2Q A;  4JS4 A;  4CHQ A;  4AIL C;  2JGU A;  2KZZ A;  3HPG A;  3NCI A;  1X1P A;  4CFA A;  1C1A A;  4IBN A;  4DTR A;  3TR8 A;  4O0J A;  4E0D A;  3LZI A;  1UOC A;  1LW0 A;  4CEZ A;  3ZSX A;  2OZS A;  4DS5 A;  3DMJ A;  1JLF A;  3A2F A;  3DLB A;  5JS2 A;  1KVB A;  4PQU A;  2FBY A;  3AVC A;  4CEE A;  4M3W A;  4DSF A;  1VSD A;  1C0T A;  2KW4 A;  3OYA A;  3AA2 A;  1I3A A;  1LW2 A;  1F21 A;  3DI6 A;  1DTQ A;  4IDK A;  4E7I A;  4DSK A;  1BIZ A;  2D0A A;  4AHV A;  1NK4 A;  1IH7 A;  3NAE A;  5KGX A;  3NH0 A;  1HYV A;  3H08 A;  2XHB A;  3SUO A;  2G8F A;  4KHU A;  4ELT A;  1C0M A;  1RT3 A;  3DLE A;  2KTQ A;  5C25 A;  3OYN A;  1JLA A;  1KCF A;  1LWE A;  4LH5 A;  5FDL A;  1ZBH A;  4B3O A;  3S3N A;  2OA8 A;  3SQ4 A;  3NF6 A;  4OKE A;  3ZSW A;  2ZE2 A;  3KJV A;  2WOM A;  1SL0 A;  4ELU A;  3NHG A;  5KGW A;  3LDS A;  3SUP A;  3QLH A;  3DOK A;  3SI6 A;  4IFY A;  3OS2 A;  2KZM A;  3THV A;  1L3U A;  4B9V A;  4DQR A;  1WLJ A;  3DLG A;  1L3T A;  3ZT1 A;  3ZT4 A;  3NE6 A;  2R7Y A;  4FK0 A;  3RWU A;  1ITG A;  3TAQ A;  3LP3 A;  4OGE A;  4KKO A;  3NH2 A;  1IKW A;  1J53 A;  4CGJ A;  4M3X A;  4B9L A;  3M8Q A;  4ICL A;  3U3G A;  4CEA A;  3RMD A;  3QEP A;  3PO5 A;  1HNV A;  4G1Q A;  1Z25 A;  3ZT0 A;  3ZSQ A;  5J2N A;  4CJ5 A;  3RMB A;  2YV0 X;  2EX3 A;  4FK2 A;  1VK0 A;  3UIQ A;  4AHC A;  4DU3 A;  4DFK A;  4DMN A;  2VWK A;  3P5J A;  4KO0 A;  2DFH A;  3TAR A;  4FJN A;  3HXM A;  3TI0 A;  4FLZ A;  4FYD A;  3OYI A;  4JS5 A;  3CYM A;  2X6N A;  1J54 A;  4FLY A;  3F9K A;  3NH1 A;  3K2P A;  3NGY A;  3DRP A;  4HVJ A;  2P5G A;  3ASM A;  3SQ1 A;  4DTU A;  4FJI A;  2O4I A;  4OKK A;  4KAZ A;  4DLG A;  3DRS A;  3KK2 A;  3JSM A;  4CGF A;  3MAQ A;  3RRH A;  3SNN A;  1NOY A;  1BI4 A;  5FRN A;  2X74 A;  3NGI A;  3SV4 A;  2XY5 A;  5JS1 A;  4E7H A;  1TV6 A;  2E6L A;  3SCX A;  3OYJ A;  1D9D A;  4W5Q A;  4DG1 A;  4QCL A;  3V9W A;  4KFB A;  3DLK A;  4RW7 A;  3EZ5 A;  4EZ6 A;  4O5B A;  3ZCM A;  5I3U A;  2VWJ A;  3FFI A;  4CJW A;  3MEG A;  3VQQ A;  2Z1G A;  3QIP A;  5KRS A;  1NK6 A;  3K58 A;  3LWL A;  3ITH A;  4K8Z A;  3F73 A;  1Y97 A;  3K5N A;  1RBU A;  1HPZ A;  1Z26 A;  1UAX A;  3B6P A;  1S5J A;  3M8R A;  3L2W A;  1ZBL A;  3LAL A;  2QKK A;  2DY4 A;  2Y1I A;  3K5M A;  5T7B A;  4BDP A;  4J2E A;  4EP4 A;  3OYB A;  4KI4 A;  1U49 A;  1C1B A;  3RR8 A;  3CQ8 A;  3D45 A;  1IKX A;  4DFJ A;  3V9U A;  2IAJ A;  4E89 A;  3OY9 A;  4FJX A;  4HCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...