1Q18A

Crystal structure of e.coli glucokinase (glk)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
320
structure length
320
Chain Sequence
TKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQTLGHIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucokinase
publication title Crystal structures of Escherichia coli ATP-dependent glucokinase and its complex with glucose.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 92
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.7.1.2: Glucokinase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02685 Glucokinase Glucokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1q18A01
3.40.367.20 Alpha Beta 3-Layer(aba) Sandwich Hexokinase; domain 1 Hexokinase; domain 1 1q18A02
1BUPA 3M3ZA 3KVGA 1MA9B 2GWKA 3O6WA 2YJEA 4NO7A 1Q18A 1NLVA 2VCPA 2V52B 4DCHA 2E8AA 1JCEA 3WEEB 3LDNA 1TUYA 3R9PA 3I8BA 3U8XA 3UE5A 1Y64A 2OANA 1NMDA 4O5FA 2PAVA 2QWLA 3BUZB 4BRHA 1ATSA 2V7YA 1QZ6A 1U6ZA 3O80A 3VF4A 3WXLA 4F9OA 4IO8A 5TKYA 3HM8A 4MO5A 4CI6A 5LJVA 4EFHA 4MLEA 5JICA 1BA1A 4PL8A 4EHTA 2FSNA 2I7NA 4YDUA 5JMVA 5AZIA 1E4FT 4IJNA 3VEOA 3SLCA 3M6GA 1BWFO 2HF4A 2QWQA 3JS6A 1OKJA 4BRIA 2GELA 3H3NO 4KBOA 3ATUA 5AFUA 3VEVA 4BC2A 4BGBA 3AAPA 3VEWA 5KPRA 3SK3A 5AQQA 2DPNA 2CGKA 3VETA 3UKUB 1TYQA 3FZMA 3UB5A 3WXJA 2P9UA 4CZLA 4H0PA 2W40A 4XH5A 2QM1A 3ENHA 4JHDA 5AQFA 2ZGYA 3IUCA 1BO5O 3D2FA 2P9PA 3D7EO 1ATRA 3H1QA 3VERA 1CZAN 1NGDA 3WXKA 5AQLA 1GLDG 3W0LA 4EAHD 4H03B 4EHUA 2NLXA 5LY3A 1XC3A 1YUWA 4E1JA 3QDKA 2ASOA 1C0FA 3EO3A 4ISGA 5BPMA 3L0QA 3DJCA 2CGLA 3ZEUB 4XH1A 4NB4A 2P9LA 4RTFD 3VENA 2P9IA 5E84A 4XEIA 3VGMA 3DAWA 5F0XA 4LC9B 1NGFA 4B1YB 3A8YA 4PKGA 2P9SB 4IWVA 4FWLA 4BRQA 1NBWA 2A5XA 4WQ5C 1NGIA 2GWJA 5AQSA 2P9NB 5FPEA 1YAGA 4H5VA 4CD3A 2NRHA 2WUSA 4Y0WA 2FSKA 5EVZA 3VEXA 3FE1A 2E2PA 3DXMA 4ISEA 5I9EB 2Q2RA 4BG9A 4FWQA 2QWRA 4FSVA 3P4IA 2E2OA 5AQNA 3EZWA 3TU5A 4A2BA 1TYQB 1MWMA 1U2VB 4JHDB 5AQIA 3VEYA 3FGUA 1D4XA 1ZXOA 2VYPA 1GLLO 4K41A 1QHAA 4BR0A 1GLJO 1NGCA 4FWKA 3A5NC 4I6MA 3TPQA 2P9PB 4C23A 4K25A 3ZETA 3ENOA 2YCHA 3FZLA 3KHYA 4CZGA 1T44A 2CH6A 1HJOA 1S3XA 1TUUA 3CI5A 3ZX0A 3ULEA 4BGAA 3A0IX 5ADXA 2IIRA 5KPZA 5F2RA 4GNIA 4PKHA 4CZFA 3ZX3A 2QW9A 4BRAA 4H0VB 2ZGZA 2A6AA 3J8AA 2P9LB 2E20A 3CJAA 4JD2A 3QICA 5F1XA 1YXQA 4DQ8A 3CETA 2FXUA 4QS7A 2FSJA 4K43A 3F9MA 5AQPA 2W41A 5AR0A 4MO4A 1JCFA 4O8KA 3CIPA 3MDQA 4BR9A 4AM6A 2QWPA 3CJBA 3R6MA 2E1YA 2FLOA 3IFRA 4RCHA 1NGGA 1T6CA 3GL1A 4FWNA 3CJ7A 4FOEA 3MCPA 4JN4A 4EIAA 2QXLA 5KPTA 3CERA 1NGEA 2E2QA 1S22A 2V51B 3GG4A 5EOYA 4RWTA 2KHOA 1ESVA 4DB3A 4H0TB 3A5LC 1R59O 4K42A 4H0OA 3SJHA 3VF2A 2NZTA 4BRMA 3FLCO 5AQJA 4BQLA 2GUPA 3H45C 4BRDA 3ZETB 1DGKN 1J6ZA 3LM2A 1G99A 2FF3B 3RSEA 4FL9A 5FPNA 3KZBA 3EKSA 4WYBA 4CZEA 2E88A 3ATVA 3OHRA 1HX1A 3CJCA 2PBDA 2A3ZA 2QWMA 3IDHA 4H0YB 5AFUH 4BRKA 1DKGD 2P9KA 1SAZA 4CZKA 4JD2B 4H5RA 4CZHA 3U9DA 3UKRA 3FZKA 3C0BA 3EL2A 3H3OB 1SQKA 2A40A 4IJAA 5AZJA 1NM1A 5JLHA 3WUHA 2CH5A 3LDOA 3C7NA 1GLBG 1NGHA 2Q36A 3O5BA 1GLFO 5BRHA 1RGIA 5FPMA 5EXWA 5KQDA 3U9ZA 3U4LA 3I33A 4B1UB 1BOTO 1QQMA 5B8HA 3O1BA 3H6EA 2F9WA 3HI0A 3CJ9A 3BF1A 5AZIB 2ZWHA 2ZF5O 3AARA 3WXIA 3VF6A 1LCUA 1NGJA 2YHYA 3QFPA 4FPAA 4B1ZA 5AQRA 4Z94A 3LL3A 2QWNA 3QB0A 4BRCA 3A5MC 3W3DA 5BREA 2D0PA 3WT0A 4BRLA 4CZJA 5AQZA 3MK6A 1MWKA 1YVNA 2GEMA 5BR9A 5EX5A 3GE1A 4CBUA 3VESA 3O1WA 1NGBA 1HPMA 3LM9A 2P9UB 4JAXA 3DWLA 4YDUC 3BP8A 3GBTA 1V4TA 4CD1A 1X3MA 5AQMA 4A2AA 3D2FB 1K8KA 1RDWX 5AQTA 2ASMA 4BROA 4PKIA 5AQYA 4BR4A 3HBTA 1H1VA 4CBXA 5E26A 4B1VA 3VPZA 2BTFA 3HZ6A 1HLUA 1ATNA 1IG8A 4J8FA 4IZ9A 5ELZA 4B1XB 4BR7A 3MN7A 5AZJB 2AP1A 4BVOA 5BRDA 4M63C 1GLEG 4FO0A 2I7PA 3L4IA 3MN6A 1BDGA 1HKGA 2Q97A 4FPBA 2P9IB 4BRGA 1LOTB 4L3QA 2YI1A 3VEZA 1NWKA 2IVNA 3UKUA 3WQUA 4B1WB 4BRNA 3QFUA 3M1FA 3DXKA 4CZIA 2A41A 1GLCG 4CZMA 1KXPA 2VWBA 3A5OC 3BEXA 5AQWA 4BR5A 5ADXH 4FOIA 4XH4A 3VOVA 4H5TA 1IJJA 4BR2A 2D1KA 2YHWA 2E2NA 4BRFA 4FWMA 4WQ5A 5EY4A 4DHYA 2A42A 3AY9A 3MMVA 1V4SA 3DXMB 1QZ5A 3R8EA 5JLFA 3CQXA 2ASPA 1Z6RA 2QWOA 1BU6O 3VGKA 3ZEUA 1XUPO 3GDQA 4QS9A 3D2EA 4BQZA 1QQNA 1GLAG 2IVPA 2CGJA 5BPNA 2BUPA 2P9SA 2HMPA 1RFQA 5BRFA 4I6MB 1K8KB 4M7YA 4QS8A 4H5NA 3WQTA 4MLHA 1X3NA 2HOEA 1X9JA 2D0OA 1QQOA 3FZHA 1HUXA 2P9NA 3EN9A 1WUAA 3ULEB 3LDPA 3MN5A 4GY2B 3BF3A 4WQ4C 4AM7A 2YHXA 1HKBA 2H3GX 3L6QA 4BVPA 2AA4A 1T6DA 4BC5A 4CJ7A 1Z05A 4CBWA 3QBWA 3SMPA 4BRPA 5AQVA 5KQ8A 4BREA 2Q31A 5AQKA 2E1ZA 1U2VA 3DXKB 5AQUA 2Q1NA 1WOQA 5AQGA 5AQXA 2UYTA 4HWIA 1BG3A 2YJFA 4FWSA 5FPDA 2F9TA 5LJWA 3HSCA 3O8MA 3CJ1A 2Q0UA 4FWRA 1ZBSA 5BN8A 2FF6A 4M7XA 2J4RA 5AQHA 1HKCA 1P8ZA 3FFKB 1NGAA 4H5WA 4BC4A 3QMLA 3WEEA 4BC3A 1XQSC 1MDUB 3SMSA 2HF3A 1C0GA 3FZFA 3D2EB 3S41A 2EWSA 5BPLA 2D4WA 3MN9A 3VGLA 1KAXA 3QBXA 1KAZA 3CQYA 4FWOA 4HTLA 3HTVA 3G25A 3H1VX 4ISFA 3EKUA 3O08A 2Q0RA 2V7ZA 2IVOA 5CE3A 3AAQA 1JCGA 4A62A 5AQOA 3LDQA 3RSEB 1SZ2A 3IMXA 4BG8A 3FR0A 4PL7A 4A61A 3JXUA 4JNEA 2GTDA 4WQ4A 2P9KB 1ZC6A 1E4GT 3LDLA 4FWPA 3UKRB 3ZX2A 5BN9A 1DEJA 2ITMA 3C7NB 1KAYA 1BA0A 3CHWA 3O4WA 1EQYA 3GOIA 3B8AX 4H0XB 3ID8A 4IXCA 3H46O 4B9QA
chains in the Genus database with same CATH superfamily
3LZJA 1X9SA 1B9FA 2NNWA 3O6WA 4Q5VA 1NLVA 1BCMA 2VCPA 3THYA 2G8WA 1L3UA 2O4IA 4DFPA 3OS2A 3LDNA 2F7TA 3I8BA 1S1UA 3QEVA 1NK4A 4E0DA 1C0TA 1Y64A 4KFBA 4CF8A 5M1NA 1QQCA 2PAVA 1ATSA 1QZ6A 4PY5A 4FJHA 1SL2A 3KK2A 1VQ5N 3P1GA 4CHNA 5JICA 1NOYA 5JMVA 2HBLA 2G8UA 4FLTA 3NE6A 2VQEK 1KFDA 3HPGA 1Y97A 4BE2A 2HBMA 1S6QA 1TK5A 4IOCL 3RTVA 4M3UA 2F8SA 2GELA 2P5OA 4BGBA 1BIUA 3U6FA 4IG3A 3HT3A 3M8RA 5KPRA 4B3OA 2DPNA 5GAEP 3SPZA 3K5MA 2P9UA 3NHGA 2IS3A 1IBKK 2W40A 4JHDA 2G8VA 4F2SA 1E3MA 4DFMA 3PX4A 4JYAK 1BO5O 2YV0X 3THYB 3EZ5A 3WXKA 5AQLA 1IG9A 3W0LA 4ELUA 4M3XA 2NLXA 3K0SA 2HHVA 4DMNA 5GIPA 4FLXA 1UOCA 4RW8A 2O8DA 2ASOA 3C6AA 3DRPA 1C0FA 3EO3A 4KB1A 3L0QA 3DLKA 3LAKA 1SUQA 4GVEA 2P9IA 4DV4K 1REVA 5KRTA 2P9SB 4IWVA 2HBKA 3J80O 4GV6A 4DV7K 3PX0A 3CF5L 1VQ9N 2D0AA 4DQSA 2P9NB 3KLIA 5FPEA 1YAGA 1WLJA 1KSPA 1F21A 3ZSRA 4CD3A 4DSKA 4FLZA 1ITGA 4DF8A 4FSVA 3AA3A 2E2OA 4RW7A 1DTTA 5AQNA 3THWB 4CJWA 3D45A 3ULDA 4DQQA 1MWMA 2YX6A 4JHDB 4CERA 4W5OA 1ZXOA 1GLLO 1QHAA 3A5NC 3TAEA 4I6MA 4DTMA 4C23A 1NK8A 2E6MA 3MXMA 2YCHA 2VGNA 3KHYA 3OYHA 4DTJA 1HJOA 1TUUA 2RKIA 4HCBA 2O8DB 1HNVA 3HPHA 2HB5A 4CZFA 5JS2A 3K9KA 3ZX3A 1VSFA 3SUPA 1WNSA 2ZGZA 3TAPA 1YJ9N 2FBVA 2RF2A 3RMCA 4X64K 5J2MA 3ZT2A 3CCMN 5F1XA 1XI1A 1ZBUA 4M3RA 4QS7A 4EZ9A 1TL1A 4DUZK 3F9MA 3HYFA 1N5YA 4DTXA 3AO3A 2B6AA 4MO4A 3PLAA 2KFZA 3ASMA 4V19S 3P5JA 1U47A 4LF6K 3TTFA 3MCAB 3SQ1A 1BQMA 4W5RA 3QESA 4FOEA 4CHYA 3LANA 4EIAA 2QXLA 1GOAA 4LFAK 2W6KA 1D9DA 4C8OA 1MU2A 4DTRA 1NK6A 5EOYA 3GG4A 1WB9A 1WAJA 4H4OA 1X9MA 4GKJK 4CGFA 4JI3K 4NYFA 2QA4N 4DB3A 3E66A 3A5LC 3NCIA 2YKNA 2DTUA 2QI2A 3FLCO 2HVIA 5HRRA 1GOCA 3CPWM 2GUPA 3PX6A 5HROA 1IBMK 4IEEA 3RWUA 3TSQA 3F5TA 3OHRA 1B92A 2HHSA 2A3ZA 2QWMA 5AFUH 3I8DA 4B3SK 1N8RO 1K73O 3LALA 3IAYA 1SQKA 2A40A 4X66K 5AZJA 1J53A 3OA9A 4G1QA 5JLHA 3O4QA 3UIQA 1CLQA 3R3LA 2RE2A 1RGIA 5FPMA 5HRSA 2PY5A 3U4LA 1BOTO 1QQMA 5B8HA 1KFSA 2OA8A 5AZIB 1X9WA 2GBZA 3VF6A 1VRUA 1RTJA 3TTDA 4LH5A 1RDBA 1J54A 4BRCA 3W3DA 5BREA 3S3MA 4DR2K 1VQ4N 1A5XA 3HVRA 4EP4A 1MWKA 5FRMA 5EX5A 3VESA 1Q9YA 3C6HA 1FJGK 4CD1A 1J5EK 2KZZA 3CCRN 4HHTA 2HVHA 4BE0A 4MFBA 3KIOA 3AGKA 5AQTA 4DSIA 2ASMA 4BROA 3HPOA 5AQYA 4F3TA 3HZ6A 4FLUA 1HLUA 1ATNA 4B1XB 3AVAA 5AZJB 4BVOA 3M8QA 3AO5A 3ZSXA 4M63C 1RDDA 2NRZA 1ASVA 1BDGA 2Q97A 3HRGA 3J7ZO 1SV5A 4L3QA 2YI1A 4IDKA 1FKPA 4MDAA 4F8RA 2IVNA 3THVA 4J2EA 4AHRA 4BRNA 3M1FA 4LSNA 4CZIA 2W6LA 4DTNA 3QETA 2QXFA 2DY4A 4H5TA 4ID1A 2D1KA 2YHWA 4BRFA 3L8BA 1S1XA 4WFAL 1NOZA 3R8EA 4DR3K 4CJUA 1SKWA 3NBPA 1Z6RA 3J7YP 4FYDA 4O44A 1JLBA 4OKJA 4WF9L 4QS9A 5CYMA 2NUBA 1JLFA 1ZYQA 3SAGA 2A1RA 2IVPA 1S1WA 3C6UA 5BRFA 2F4VK 1I3AA 1UWBA 2XY6A 3OYBA 4GV9A 3N4PA 1QQOA 2KQ2A 3EN9A 1HYVA 1EWRA 4AM7A 5C2DA 3JAMO 4DG1A 2AA4A 1X1PA 2R7YA 3F9KA 4CBWA 1XMQK 2Q31A 5SWMA 3JYTA 4JI7K 1U2VA 1OH6A 2BDPA 4I9QA 5AQUA 1WOQA 3EE9A 4PUOA 1NJXA 4FJ7A 2BANA 3MXIA 1RT1A 3CFPA 1HYSA 1WN7A 2F9TA 5FLXO 2O8EB 3NGIA 4U67L 4RG8A 4M7XA 1RILA 4BWMA 4DR5K 1HKCA 2Z1GA 2FBYA 4M3ZA 3QMLA 3WEEA 4CF0A 4UY8O 4CHPA 2OYQA 3TABA 3FZFA 1CXQA 2EWSA 2QKKA 1VQPN 5BPLA 2KLAA 4I7FA 3MN9A 3VGLA 3QBXA 1KAZA 3CQYA 4CHQA 4KH4A 3VQ9A 3ZSVA 4H4MA 4CVNE 4N41A 2Q0RA 1TKTA 2V7ZA 5CE3A 1JCGA 5IWAK 2I5JA 2KW4A 1N6QA 4PL7A 1IKXA 3ZT3A 3JXUA 5J2NA 1LW0A 2VGMA 4WQ4A 2P9KB 4CJLA 3UKRB 3ZX2A 2OPRA 1R0AA 5C15A 1HNZK 3D0PA 3WNEA 3B8AX 4IXCA 4DU4A 3LAMA 1RT6A 2QKBA 4B9QA 2JWKA 5BRHA 4CJKA 3M3ZA 4R79A 2UXBK 4B9UA 3MWPA 2RHKA 4NCGA 1P90A 2HHUA 4CEEA 3WEEB 4B9SA 4MDBA 4KB0A 1TUYA 3R9PA 1U49A 3U8XA 3QEIA 4FCYA 1HNWK 1L3TA 3EY1A 3BUZB 4BRHA 3VF4A 1WBBA 1XMOK 3WXLA 5TKYA 3P83D 3O9QA 3MX2A 5LJVA 5DM6L 1T3VA 4EFHA 3SCXA 4MLEA 1RTIA 1BA1A 2OPPA 3DRRA 2I7NA 1FXXA 4RW9A 4CJPA 1E4FT 1HQUA 2EX3A 4PA1A 1YJNN 4IKFA 1YTUA 2HHHK 4X65K 4DQRA 2YNHA 1KRPA 3TANA 1NNEA 3JS6A 1S9EA 3H3NO 3LP2A 3BGRA 5AFUA 3AAPA 3TWHA 3SK3A 2E6LA 3DLEA 1VQ8N 3HJFA 1WAFA 2CGKA 3RRHA 4N76A 3UKUB 4JS4A 3WXJA 3UB5A 3DLLL 4XH5A 5LMNK 3ENHA 3U3YA 1TAUA 3D2FA 3H1QA 5A2QO 1CZAN 1GLDG 1W7AA 4H03B 1RTDA 5LY3A 4E1JA 3QDKA 4YOVA 5BPMA 4C8MA 3BDPA 2CGLA 3HO1A 4OGEA 3T19A 4Z4FA 1Z25A 5I3UA 4XH1A 4CFDA 4M42A 1QSSA 3VENA 1Q8IA 5E84A 1NMNA 3DAWA 1VQON 4DR1K 4IG0A 4PKGA 3ALYA 4KHNA 3VQPA 3O9TA 2ZJRL 1WSHA 1BHLA 3LPTA 4BRQA 1NBWA 1IKWA 4DSJA 3KTQA 4DR7K 5I42A 3NF6A 3G0ZA 4B9VA 3M8PA 3CCSN 4AILC 1RDCA 1WSGA 1SKSA 3PO4A 2BE2A 3DXMA 2KTQA 4DKWA 1JLGA 1YVUA 2ZJQL 2Q2RA 4BG9A 2QWRA 2G8KA 4IBNA 1TL3A 4FK2A 4A2BA 3MEEA 3OJUA 4IFYA 3K58A 1L3VA 1IBLK 1IKYA 3VEYA 2VYPA 3EYZA 3QEWA 4AHCA 1NGCA 1N36K 3CMEN 2NRXA 1LAVA 4DQPA 2D0BA 4K25A 3ENOA 3FZLA 4NXMK 4CZGA 3SNNA 3KWGA 1K6YA 1JXBA 3ZX0A 3MWTA 3VQ7A 4FM0A 1QVFM 5KPZA 3VQ6A 4GNIA 4B8AB 4TSXA 4PKHA 3Q7BA 4E7LA 1A5VA 3SZ2A 3O9UA 3THXA 3AA4A 4H0VB 3KLFA 2A6AA 3KD5E 2FBTA 3LWLA 2RPIA 4EZ6A 3L2QA 2FSJA 1YIJN 4K43A 5AR0A 2W41A 4I2QA 1J5OA 1JCFA 4O8KA 3CIPA 2X6SA 1GOBA 3VQQA 1YT3A 2HNDA 4BR9A 3NH1A 3DLRA 4FZXC 4AM6A 3CJBA 3IFRA 5LL6Z 4OX9K 1U4BA 4RCHA 1IV0A 1NK9A 1KVAA 3LP0A 4JN4A 2FC0A 3NVKA 1C0MA 5KPTA 3DOLA 1QVGM 4DFKA 3H08A 3R1XA 4FK4A 1S1VA 3Q7CA 1KVBA 4JI8K 1ESVA 3SJJA 4H0TB 5H1SQ 4NXNK 1R59O 3IRXA 1LW2A 3SJHA 4KKOA 4DR6K 1WBDA 1YJWN 4OPKA 5AQJA 3TAQA 1NJZA 1KVCA 3H45C 4BRDA 1DGKN 4ILGB 4FJJA 1YITN 3RSEA 4FL9A 1Q7YO 3KZBA 1OVYA 3EKSA 3HM9A 5M1PA 3FFIA 4H5RA 2YNFA 3EL2A 4DQIA 3AGRA 4F4KA 1NM1A 3VMFB 4YOTA 3WUHA 3LDOA 4OPJA 5HLFA 1XNQK 3C7NA 1GLBG 3B6OA 2DFEA 1NGHA 4Z4CA 1GLFO 1T7PA 1VSLA 3O1BA 3SYZA 2XY5A 3I0SA 2UUCK 1S6PA 1TK0A 3CJ9A 3BF1A 3NF8A 4DTOA 1N32K 4CHZA 4OKEA 1LCUA 2YHYA 4CGIA 1G15A 5C42A 4N47A 3RR7A 4FPAA 4B1ZA 5AQRA 4CJ4A 4NYNA 3NVMA 4KTZA 4O5BA 1ZBLA 4JKFA 4CJ3A 3MK6A 2GEMA 4LF5K 1T03A 5BR9A 3AVBA 3CCJN 3QIPA 3O1WA 1NGBA 3LM9A 2P9UB 4JAXA 3DWLA 4B9NA 5J2QA 5AQMA 4A5AA 4A2AA 1Q82O 3QIOA 4CK1A 1K8KA 3HXMA 2E5LK 4Z0UA 3SUOA 5DK5A 4CBXA 3TI0A 1N34K 2HW3A 4U7BA 4GVMA 4J8FA 4K8XA 4F3OA 3MN7A 3CCVN 4FJLA 2O4GA 4KV8A 3DMJA 5TKWA 5BRDA 4FJKA 3BZCA 2JLEA 2I7PA 3MN6A 1C6VA 4BRGA 2P9IB 1JLAA 1YF5L 1LOTB 1Q81O 5DMRA 1NKBA 3L2VA 2DFFA 4B1WB 3NH2A 1U04A 2ETJA 3I56N 4JI5K 3BEXA 2VWBA 3A5OC 3QLHA 4BR5A 5ADXH 3VOVA 3L2RA 5D3GA 1IJJA 1W97L 2ZE2A 4J2DA 5DM7L 4WQ5A 4J2AA 3MMVA 1V4SA 4DTSA 2NRWA 3OYMA 2UU9K 2QWOA 1BU6O 3ZEUA 2FBXA 3A2FA 3K5LA 3GDQA 4N5SA 3CXCM 2WTUA 2CGJA 2BUPA 4OO1J 2HMPA 2OPSA 3AVNA 4I6MB 4NCBA 1K8KB 4CEOA 1NK7A 4E1NA 4QS8A 1VQ7N 5HL7L 3WQTA 1X3NA 2HOEA 5GIOA 4DV0K 3HVTA 3OYFA 3AO1A 3DLBA 3LDPA 3BF3A 1HKBA 1U45A 1KD1O 4BVPA 4CEAA 3K5NA 4IEIA 4BC5A 4CJ7A 4B9LA 1Z05A 3SMPA 4DSEA 2OCEA 5AQVA 5KQ8A 4FZZA 1YTAA 3PUFA 5AQKA 1BCOA 4O0IA 2E1ZA 3CM6A 1HRHA 4IFEA 2GX9A 1NJIO 5E41A 2GV9A 4HWIA 1RNHA 1BG3A 2YJFA 1I39A 3LPUA 2ATQA 2HNZA 3CJ1A 5BN8A 4CF2A 1CZBA 1OH5A 3CCEN 4IO9L 5AQHA 1RT7A 1DTQA 4BC4A 3SV4A 3HP9A 1XQSC 1MDUB 4I2PA 2UXDK 4KH6A 4E89A 5C24A 3MXJA 3PIPL 3KK3A 4BACA 2VG5A 1QTMA 1KAXA 1OH8A 3HTVA 2WOMA 3H1VX 3K59A 1EP4A 1EX4A 4A62A 5HP1A 2QTDA 1RT5A 5AQOA 4LFBK 5M1OA 1RT4A 1LWEA 1SZ2A 4LSLA 3TSPA 3FR0A 1JJ2M 3VQEA 3NAEA 2ZJPL 1VRTA 1ZC6A 2HNYA 3TR8A 5C10A 4CEZA 3NFAA 1KAYA 3ITHA 3ZSWA 4DV3K 4FM1A 3V1QA 1M90O 4MQ3A 3O4WA 1EQYA 4H0XB 3ZLJA 4JKDA 3H46O 4CJSA 1BUPA 1MA9B 1QSYA 1ASWA 2GWKA 2YJEA 4NO7A 4OKKA 4DCHA 1JCEA 5IT9O 1WSFA 2O8CA 3AO4A 1O13A 2Y1IA 3UE5A 4JV5K 1NMDA 1VQ6N 3AA5X 3O3HA 3O80A 4F9OA 1U6ZA 3OYAA 3NGZA 5C0YA 1FKOA 3OYJA 2E4LA 3QEXA 4MO5A 4CI6A 3KK1A 1QSLA 4NCAA 3SPYA 4JRQA 4O4GA 3AVKA 4FZYA 4EHTA 2FSNA 2X74A 1JLQA 4KTWA 3QO9A 3O3FA 5GAHP 2WONA 3L4QA 2HF4A 1KLMA 3CC4N 1OH7A 1O1WA 4O0JA 3DM2A 4E3SA 4IOAL 3ATUA 3NGYA 3ENBA 3NF7A 3VEWA 4LD0A 3OYDA 3G4SN 3RMDA 4DR4K 3VETA 2Q3SA 4CZLA 3DI6A 1XNRK 4PWDA 4E1MA 2QM1A 1VSEA 1W2BM 2ZGYA 1VQNN 2P9PA 4ID5A 4CIEA 1ZBIA 1NGDA 4EHUA 2O8CB 4JKBA 4AQYK 1XC3A 3CCQN 4M45A 1CZ9A 3MECA 4JKCA 4CJ5A 4BE1A 2B4JA 2VG7A 3PV8A 2WFBA 1DT9A 3QINA 1EXQA 4XEIA 3VGMA 3PY8A 4LC9B 2YHAA 2DFHA 3A8YA 3O4NA 4FWLA 4CK2A 3K2PA 4KAZA 1NKEA 3ZT1A 2A5XA 3F2KA 4WQ5C 1NGIA 1L5UA 4HVJA 1BIZA 1VSKA 4W5QA 1FW6A 2WUSA 5KGXA 4ZTFA 4LF4K 4CECA 2ZM6K 4FM2A 3SI6A 2VQFK 2E2PA 5I9EB 3PO5A 3ZYYX 3P4IA 3WNFA 3TU5A 1UA1A 3AVFA 4HUEA 4DLGA 3CG7A 5J1EA 3L2WA 1U2VB 2ITGA 5AQIA 1D4XA 2IOCA 4FW1A 4JI2K 3AVGA 4K41A 4FWKA 1M1KO 2P9PB 1T8EA 4C8NA 2EHGA 1KC8O 4GKKK 1XHZA 1T44A 4BGAA 3CI5A 3ULEA 4DV5K 3A0IX 5ADXA 2IIRA 3MEDA 3AVJA 4JK9A 3T3FA 3V9WA 2E20A 3CJAA 4JD2A 4DWIA 3QICA 2HHQA 1EKEA 3VQCA 2FXUA 1SS6A 3NDKA 5AQPA 5KGWA 3EEQA 4Q0BA 2O8FA 4FW2A 3CC2N 1EETA 4CE9A 5M1QA 1LWFA 3MDQA 2QK9A 1JL1A 4CEDA 2O8BA 1VSHA 2FLOA 4E7JA 3RMBA 1NGGA 1T6CA 4FWNA 1Q86O 3CJ7A 1KTQA 4CIGA 3RR8A 3CERA 1JKHA 1NGEA 1HNXK 2NRTA 2V51B 4YFUA 3OVNA 4KO0A 1YHQN 4HCCA 3HP6A 1EO1A 3P39A 3VF2A 2HHWA 1FK9A 4CEQA 2JGUA 2HHTA 3T7ZA 1G99A 2FF3B 3DLGA 4JKGA 5FPNA 3CMAN 1C0UA 1RBRA 4WYBA 2E88A 1BGXT 3CJCA 2PBDA 1KCFA 3IDHA 4H0YB 4BRKA 1DKGD 1SAZA 4JLHA 3WXMB 4CZKA 4JD2B 4K0KK 4CZHA 3U9DA 3V9UA 3C0BA 4IJAA 2G8FA 2CH5A 4CGGA 2O8FB 2Q36A 3C65A 3O5BA 4B9TA 5EXWA 5KQDA 3U9ZA 3I33A 4DU1A 3H6EA 2F9WA 3HI0A 4ILHA 3V6DA 1YI2N 2ZWHA 1HJRA 2ZF5O 3AARA 3WXIA 3D6RA 3QFPA 4KTQA 3ZSYA 4QCLA 1C1CA 4R5PA 1UAXA 4CGDA 4Z94A 1ILYA 2XO7A 3LL3A 2QWNA 5GINA 3A5MC 3SUQA 4FVUA 4QOZB 3WT0A 3LZIA 3KLGA 1LWCA 4CCHA 5AQZA 1YVNA 2GUIA 4CJQA 4HTUA 3GE1A 4FLYA 3OYKA 1HPMA 2D5RA 3ZT0A 3BP8A 1RBTA 2F8TA 4JKGB 2X78A 3TAMA 3D2FB 1RDUA 3SV3A 3J7AP 3S9HA 2P51A 1RDWX 1VHXA 1C1AA 4PKIA 1RT2A 1H1VA 4KHPK 4BDZA 4KREA 5E26A 4XIUA 3VPZA 2BTFA 4BR7A 1IG8A 5ELZA 2HBJA 2IC3A 2AP1A 5SZTA 2X6NA 5C25A 2XY7A 4KI4A 4N56A 2NRVA 4FPBA 4CESA 4BY9C 1NWKA 4CF9A 1RT3A 2VG6A 5HBMA 2XHBA 3DXKA 1GLCG 4JKHA 4CZMA 4LFCK 5AQWA 1S9GA 3SUNA 5LMUK 4FOIA 4XH4A 4JI6K 5M1FA 3MX5A 4OPHA 5C2FA 4BR2A 5K14A 1TVRA 3WNHA 4DHYA 3CQ8A 3J81O 2A42A 3QNOA 3C6TA 4ILJA 3DXMB 1QZ5A 1TV6A 5KTQA 2UUAK 3CQXA 4CJRA 2ASPA 3AO2A 4FLWA 1BI4A 1HPZA 3VGKA 4KHYA 1VK0A 1XUPO 3KD1E 3VQ4A 2YHBA 3D2EA 4IOXA 1QQNA 4CFCA 3E9PA 3ZSZA 2P9SA 5CY4A 4J2BA 3BZKA 1RFQA 4M7YA 4PQUA 4H5NA 4MLHA 4DF4A 2D0OA 2P9NA 4Z4GA 5BR8K 3AVCA 1VSDA 1WUAA 5KI6A 4FXDA 4WQ4C 3TTCA 3ZSOA 3L6QA 3THXB 1B9DA 3DYAA 3OBYA 4KH5A 4FJ9A 4FJ8A 3JSMA 3L3VA 1VAZA 4C8LA 3QBWA 4OGCA 4BRPA 1RCHA 3SBGA 3THWA 3T1HK 4BREA 1S1TA 3T1YK 3DXKB 3VQBA 2Q1NA 5AQXA 3V4IA 2UYTA 4ZHRA 5FPDA 1NJWA 3HSCA 3O8MA 1NK5A 2Q0UA 1ZBSA 2FF6A 4AHUA 2J4RA 3SAHA 3N4QA 2HMIA 4ELVA 1P8ZA 3FFKB 1NGAA 4H5WA 3I55N 1BI4B 4JK8A 3SMSA 1VQMN 4DSLA 4KHQA 4F2RA 2Z1IA 1C0GA 3CCUN 4ZTJA 3D2EB 4M41A 1C1BA 2PYLA 5CZ1A 4KHWA 4CIFA 2OTJN 3IG1A 4HTLA 3M8SA 1QE1A 2RN2A 3O08A 2IVOA 3AAQA 4B3TK 5FROA 3ZSQA 4E7HA 3RSEB 1RDAA 4BG8A 4JKAA 1NKCA 3AV9A 2GTDA 3AVMA 4WE1A 1VQLN 4GW6A 3LDLA 5CZ2A 3VTHA 5BN9A 1DEJA 2QEXN 4M3WA 4DTPA 4RW6A 5M1KA 3P38A 3C7NB 2W42A 5J2PA 1D9FA 4OLAA 4DV1K 1BA0A 4FJNA 2KFNA 3CHWA 3OS0A 1VSMA 3NF9A 1TAQA 4ELTA 4YNQA 4ICLA 4O8UA 4WFBL 5HRNA 3RMAA 4FJGA 3KVGA 3OYIA 2PYJA 1Q18A 2V52B 3V1RA 3PSFA 2E8AA 5T7BA 2OANA 3VTIA 4Z4HA 4O5FA 1RBVA 2QWLA 2V7YA 1D5AA 4IO8A 3S3OA 1TK8A 3HM8A 4AHSA 3C94A 3QEPA 4IFVA 4YHHK 5EU7A 4PL8A 3CPEA 3VQ8A 2D0CA 4YDUA 5CR4A 4Z4EA 5AZIA 4A5BA 4IJNA 4JI4K 3VEOA 2OPQA 2PFUA 4CEBA 3SLCA 4CW7B 3M6GA 4KPYA 1BWFO 4YORA 2QWQA 1QS4A 4K8ZA 2G8HA 4H8KA 4CJTA 2UXCK 1D8YA 1OKJA 4BRIA 3G71N 4JS5A 4KBOA 3VEVA 4BC2A 3K5OA 4LF9K 5AQQA 4KHSA 2BH1A 3V9XA 2BGGA 1JLCA 2WBNA 3SAFA 1TYQA 3FZMA 4H0PA 3ISNC 3OJSA 5AQFA 1KQSM 4KHUA 4FVMA 1VSJA 4YOUA 3IUCA 3D7EO 1ATRA 3VERA 4EAHD 3KJVA 1YUWA 4CJEA 3PSIA 3SQ2A 4HUGA 4KRFA 4ISGA 3DJCA 1BQNA 4DV6K 3ZEUB 4JI0K 3IS9A 4NB4A 2P9LA 4RTFD 2WC9A 3HSTB 4CGHA 2PZSA 2HSTA 5F0XA 1NGFA 4B1YB 3CM5A 4M3TA 4G9ZA 1NU0A 3VQAA 3ID6A 4FJ5A 2XRIA 1NG9A 2GWJA 3LP1A 5AQSA 5FDLA 3T1AA 3OY9A 4H5VA 2NRHA 4Y0WA 2FSKA 5EVZA 3KLEA 1IKVA 3VEXA 3O3GA 3V9ZA 3FE1A 4A57A 4ISEA 4IDHA 4DUYK 5KRSA 4FWQA 2UUBK 3EZWA 3TARA 4AHVA 4RW4A 4C1NK 1TYQB 3C95A 4GMJB 3FGUA 3OBWA 4BR0A 1GLJO 5C12A 3TPQA 4L8RB 3AVIA 1HR0K 3ZETA 4DV2K 4AH9A 2NRRA 2CH6A 1S3XA 5JS1A 5F2RA 1SL0A 1JXEA 3CFOA 4EP5A 2A1SA 3P31A 4WFNL 1UA0A 4JRPA 2YNGA 1XC9A 4NLBA 2QW9A 4BRAA 4YOWA 2Z1HA 3J8AA 2P9LB 3VQ5A 1HNIA 4AHTA 1YXQA 4FJMA 4DQ8A 3S3NA 3CETA 4DSFA 3O9RA 2OZMA 2P1JA 3KKRA 2JWLA 2ZD1A 1RBUA 1TKZA 4CK3A 4BDYA 1LAWA 3TAFA 2O8EA 3T69A 4BDPA 2QWPA 3KK7A 3R6MA 2E1YA 3HOSA 4PHTX 4X62K 2VWJA 3GL1A 1L3SA 4DTUA 1HYZA 3MCPA 3AVLA 2B5JA 4Y1DA 2E2QA 1S22A 3OS1A 3DLHA 4RWTA 5CHIA 2KHOA 2AJQA 3G6EN 4LH4A 4NLCA 3VN5A 4LF7K 4K42A 4LF8K 4H0OA 3MAQA 4OJRA 2NZTA 4BRMA 3OYGA 4BQLA 4C1NI 3SQ4A 3ZETB 4YOYA 1T05A 3LM2A 1J6ZA 1N33K 3V81A 4B8CA 3WNGA 3CCLN 2KKZA 4JK7A 4CZEA 1IH7A 3ATVA 5HOOA 1HX1A 2P9KA 3CYMA 3UKRA 2IGIA 3FZKA 3H3OB 4FJIA 3HL8A 2OTLN 4CJFA 4GV3A 1EWQA 3M5RA 1BISA 1DLOA 3VA3A 4B1UB 1Z26A 4QAGA 3K57A 1KLNA 1S72N 4JI1K 3EE8A 3VQDA 1NGJA 1TGOA 1SKRA 3G10A 1OVQA 1HQEA 3LDSA 1ASUA 4HUFA 3QB0A 5JVHL 2Y1JA 3B6PA 2D0PA 3F73A 4BRLA 2LSNA 4CZJA 3LWMA 3E01A 3OW2M 4CBUA 4YY3K 4E7IA 3I0RA 4YDUC 3V1OA 3GBTA 1V4TA 3U3GA 1X3MA 3ZT4A 3NH0A 4YOXA 1S5JA 5CYQA 3TAGA 3ZCMA 4BR4A 3HBTA 4DFJA 4B1VA 1ZBHA 2G8IA 2XY8A 4IZ9A 4B9MA 3OTOK 1GLEG 4FO0A 3BY5A 3L4IA 1HKGA 3VEZA 3L3UA 4OVLA 3UKUA 3WQUA 4OPAA 3QFUA 4FJXA 1TKXA 2A41A 1KXPA 3SQ0A 4Y1CA 4FK0A 2E2NA 1A5WA 4FWMA 5EY4A 3OYLA 1JLEA 1JL2A 4C8KA 1NK0A 2OZSA 3AY9A 3OYNA 5JLFA 4W5NA 2Z1JA 4BQZA 5GADP 1J9AA 1GLAG 4I9LA 5BPNA 1I94K 1U48A 2P5GA 3PIOL 1BL3A 4E7KA 4AF1A 4DLEA 1TKDA 1LV5A 1X9JA 3FZHA 1HUXA 3ULEB 4DS5A 4B3RK 3MN5A 4GY2B 4OLBA 4JKEA 2YHXA 2H3GX 4B08A 4B3MK 3OYEA 1K8AO 1RBSA 3LP3A 3V9SA 4M3YA 1T6DA 4E19A 4CGJA 1WSIA 2IDOA 1W9HA 2HHXA 1XWLA 2IAJA 3O9SA 3SBTA 1CXUA 5AQGA 1NJYA 4FWSA 2O8BB 4DU3A 5LJWA 1Q9XA 4FWRA 4O55A 3AVHA 3VA0A 3E9OA 3K9JA 3RRGA 1W0HA 4BWJA 2VWKA 5MLCQ 5FRNA 3CFRA 3E9LA 3DRSA 3DOKA 4UQGA 3E1YA 4BC3A 2HF3A 2KZMA 3KKSA 3S41A 4CFBA 3IKMA 4WCEL 5AJ3K 5JVGL 3OYCA 2YNIA 5HRPA 4FLVA 3HK2A 3NMUA 2D4WA 3MEGA 4FWOA 1XHXA 3G25A 1RTHA 2F96A 4ISFA 4LY7A 4CFAA 3EKUA 4W5TA 3KWIA 1ZBFA 3LDQA 1SL1A 5GAGP 2YKMA 3IMXA 1WSEA 1HMVA 3QERA 4A61A 1QHTA 1K9MO 4JNEA 3RVCA 4DS4A 1WSJA 1E4GT 1IO2A 3CC7N 4CF1A 4FWPA 4CEFA 2ZQBA 4CHOA 4KI6A 2ITMA 4CJVA 4Z4IA 3QNNA 1VQKN 3CD6N 3L2UA 3GOIA 4A59A 3ID8A 3AA2A 1VSIA 3HOTA 3TSUA 3KLHA 4JEPA
chains in the Genus database with same CATH topology
1BUPA 3M3ZA 3KVGA 4R79A 1MA9B 3MWPA 2NNWA 2GWKA 3O6WA 2RHKA 2YJEA 4NO7A 1Q18A 1P90A 1NLVA 2VCPA 2V52B 4DCHA 2E8AA 1JCEA 3WEEB 3LDNA 4MDBA 2F7TA 1TUYA 3R9PA 3I8BA 3U8XA 1O13A 3UE5A 1Y64A 2OANA 1NMDA 3VTIA 1VQ6N 4O5FA 5M1NA 2PAVA 2QWLA 3BUZB 4BRHA 1ATSA 2V7YA 1QZ6A 1U6ZA 3O80A 3VF4A 3WXLA 4F9OA 4IO8A 5TKYA 5C0YA 1VQ5N 3HM8A 3O9QA 3MX2A 4MO5A 4CI6A 5LJVA 5DM6L 1T3VA 4EFHA 4MLEA 5JICA 1BA1A 4PL8A 3CPEA 4EHTA 2FSNA 2I7NA 4YDUA 5CR4A 5JMVA 2HBLA 5AZIA 4A5BA 1E4FT 4IJNA 3VEOA 2PFUA 1YJNN 3SLCA 2HBMA 5GAHP 3M6GA 1BWFO 4YORA 3L4QA 2HF4A 2QWQA 3CC4N 4IOCL 3JS6A 1OKJA 4IOAL 4BRIA 3G71N 2GELA 3H3NO 4KBOA 3ATUA 5AFUA 3VEVA 4BC2A 4BGBA 3ENBA 3AAPA 3VEWA 5KPRA 3G4SN 3SK3A 5AQQA 1VQ8N 2BH1A 2DPNA 2CGKA 3VETA 5GAEP 3UKUB 2WBNA 3SAFA 1TYQA 3FZMA 3UB5A 3WXJA 2P9UA 4CZLA 4H0PA 2W40A 4XH5A 2QM1A 3DLLL 3ENHA 4JHDA 1W2BM 5AQFA 2ZGYA 1KQSM 1VQNN 4YOUA 3IUCA 1BO5O 3D2FA 2P9PA 3D7EO 1ATRA 3H1QA 3VERA 1CZAN 1NGDA 3WXKA 5AQLA 1GLDG 3W0LA 4EAHD 4H03B 4EHUA 2NLXA 4JKBA 5LY3A 1XC3A 1YUWA 4E1JA 3QDKA 5GIPA 3CCQN 2ASOA 3C6AA 4JKCA 1C0FA 3EO3A 4ISGA 5BPMA 4YOVA 3L0QA 3DJCA 2CGLA 3ZEUB 4XH1A 2WFBA 4NB4A 2P9LA 4GVEA 4RTFD 3VENA 1DT9A 2P9IA 2WC9A 4XEIA 5E84A 3DAWA 3VGMA 1VQON 2HSTA 5F0XA 4LC9B 1NGFA 4B1YB 3A8YA 4PKGA 2P9SB 4IWVA 4G9ZA 2HBKA 4FWLA 3O9TA 2ZJRL 4GV6A 3ID6A 3CF5L 1VQ9N 4BRQA 1NBWA 2A5XA 3F2KA 4WQ5C 1NGIA 2GWJA 5AQSA 2P9NB 5FPEA 1YAGA 4H5VA 4CD3A 2NRHA 2WUSA 4Y0WA 2FSKA 5EVZA 3CCSN 3VEXA 3FE1A 2E2PA 3DXMA 4A57A 4ISEA 4DKWA 4IDHA 5I9EB 2ZJQL 2Q2RA 3ZYYX 4BG9A 4FWQA 2QWRA 4FSVA 3P4IA 2E2OA 5AQNA 3EZWA 3TU5A 4A2BA 1TYQB 4C1NK 1MWMA 2YX6A 1U2VB 4JHDB 5AQIA 3VEYA 3FGUA 1D4XA 1ZXOA 2VYPA 1GLLO 3OBWA 1QHAA 4K41A 4BR0A 1GLJO 5C12A 1NGCA 4FWKA 3A5NC 1M1KO 4I6MA 3TPQA 2P9PB 3CMEN 2NRXA 4C23A 1KC8O 4K25A 3ZETA 3ENOA 2YCHA 2VGNA 3FZLA 3KHYA 2NRRA 4CZGA 3KWGA 1T44A 2CH6A 1HJOA 1S3XA 1TUUA 3CI5A 3MWTA 3ULEA 3ZX0A 4BGAA 3A0IX 1QVFM 5ADXA 2IIRA 5KPZA 5F2RA 4GNIA 4PKHA 4WFNL 3P31A 4CZFA 3Q7BA 3K9KA 4JK9A 3O9UA 4NLBA 2QW9A 3ZX3A 4BRAA 4H0VB 4YOWA 2ZGZA 2A6AA 3J8AA 2P9LB 1YJ9N 2E20A 3CJAA 4JD2A 3CCMN 3QICA 5F1XA 1YXQA 4DQ8A 3CETA 2FXUA 3O9RA 4QS7A 2FSJA 1SS6A 1YIJN 4K43A 3F9MA 5AQPA 2W41A 5AR0A 2JWLA 3CC2N 4MO4A 1JCFA 4O8KA 3CIPA 3PLAA 5M1QA 3MDQA 4BR9A 3T69A 4AM6A 2QWPA 3CJBA 3KK7A 2E1YA 3R6MA 2FLOA 3IFRA 3HOSA 3TTFA 4PHTX 3MCAB 4RCHA 1NGGA 1T6CA 3GL1A 4FWNA 1Q86O 3CJ7A 4FOEA 3MCPA 4JN4A 4EIAA 2QXLA 3NVKA 5KPTA 3CERA 1NGEA 1QVGM 2NRTA 3R1XA 3Q7CA 2E2QA 1S22A 2V51B 3GG4A 5EOYA 4RWTA 5CHIA 2KHOA 1ESVA 2QA4N 3G6EN 4DB3A 3E66A 4H0TB 3A5LC 5H1SQ 4NLCA 1R59O 4K42A 1YHQN 1EO1A 4H0OA 3SJHA 3P39A 2NZTA 3VF2A 4BRMA 2QI2A 3FLCO 1YJWN 5AQJA 4BQLA 3CPWM 4C1NI 2GUPA 3H45C 4BRDA 3ZETB 4YOYA 1DGKN 1J6ZA 3LM2A 4ILGB 1G99A 2FF3B 3T7ZA 1YITN 4JKGA 3RSEA 4FL9A 5FPNA 3CMAN 1Q7YO 3KZBA 1OVYA 4IEEA 3CCLN 2KKZA 3TSQA 3EKSA 3F5TA 4JK7A 4WYBA 4CZEA 5M1PA 2E88A 3ATVA 3OHRA 5HOOA 1HX1A 3CJCA 2PBDA 2A3ZA 2QWMA 3IDHA 4H0YB 5AFUH 4BRKA 1DKGD 2P9KA 1SAZA 3WXMB 4CZKA 4JD2B 4H5RA 4CZHA 1K73O 1N8RO 3U9DA 3UKRA 3FZKA 3C0BA 3EL2A 3H3OB 1SQKA 2A40A 4IJAA 3AGRA 5AZJA 1NM1A 3OA9A 4YOTA 2CH5A 3LDOA 3VMFB 3WUHA 5JLHA 2OTLN 3C7NA 1GLBG 4GV3A 1NGHA 3R3LA 2RE2A 2Q36A 3C65A 1GLFO 3M5RA 3O5BA 5BRHA 1RGIA 5FPMA 5EXWA 5KQDA 3U9ZA 3U4LA 3I33A 4B1UB 1BOTO 1QQMA 5B8HA 3O1BA 3H6EA 2F9WA 3HI0A 4ILHA 3CJ9A 3BF1A 5AZIB 1YI2N 1S72N 2ZWHA 2ZF5O 3AARA 3WXIA 3D6RA 3EE8A 3VF6A 1LCUA 1NGJA 2YHYA 3QFPA 3TTDA 4FPAA 4B1ZA 5AQRA 4Z94A 1ILYA 3LL3A 2QWNA 3QB0A 5GINA 5JVHL 4BRCA 3A5MC 3W3DA 3NVMA 5BREA 4FVUA 4JKFA 1VQ4N 2D0PA 3WT0A 4BRLA 4CZJA 5AQZA 3MK6A 1MWKA 1YVNA 2GEMA 5BR9A 5EX5A 3GE1A 3OW2M 4CBUA 3VESA 3CCJN 3O1WA 1NGBA 1HPMA 3LM9A 2P9UB 3C6HA 4JAXA 3DWLA 4YDUC 3BP8A 3GBTA 1V4TA 4CD1A 1X3MA 4JKGB 5AQMA 4A5AA 4YOXA 4A2AA 1Q82O 3CCRN 3D2FB 1RDUA 1K8KA 1RDWX 3AGKA 5AQTA 2ASMA 4BROA 4PKIA 5AQYA 4BR4A 3HBTA 1H1VA 4CBXA 5E26A 4B1VA 4U7BA 3VPZA 2BTFA 3HZ6A 1HLUA 1ATNA 1IG8A 4J8FA 4IZ9A 5ELZA 2HBJA 4B1XB 4BR7A 3MN7A 3CCVN 5AZJB 2AP1A 5TKWA 4BVOA 5BRDA 4M63C 1GLEG 4FO0A 2I7PA 2NRZA 3L4IA 3MN6A 1BDGA 1HKGA 2Q97A 2NRVA 2P9IB 1YF5L 3HRGA 4FPBA 1LOTB 4BRGA 4L3QA 3J7ZO 1Q81O 2YI1A 4BY9C 4MDAA 1NWKA 3VEZA 2IVNA 3UKUA 3WQUA 4B1WB 4OPAA 4BRNA 3QFUA 3M1FA 3DXKA 4CZIA 3I56N 2A41A 1GLCG 4JKHA 4CZMA 1KXPA 2VWBA 3A5OC 3BEXA 5AQWA 4BR5A 5ADXH 4FOIA 4XH4A 3VOVA 4H5TA 5M1FA 1IJJA 1W97L 3MX5A 4OPHA 4BR2A 5C2FA 2D1KA 2YHWA 2E2NA 4BRFA 5DM7L 4FWMA 4WQ5A 5EY4A 4DHYA 2A42A 4WFAL 3AY9A 3MMVA 1V4SA 3DXMB 1QZ5A 4ILJA 3R8EA 5JLFA 2NRWA 3CQXA 2ASPA 1Z6RA 2QWOA 1BU6O 3VGKA 3ZEUA 1XUPO 4WF9L 3GDQA 4IOXA 3D2EA 4QS9A 4BQZA 1QQNA 1GLAG 5GADP 3E9PA 3SAGA 2IVPA 3CXCM 2CGJA 5BPNA 2BUPA 2P9SA 4OO1J 2HMPA 1RFQA 5BRFA 4I6MB 1K8KB 4M7YA 3PIOL 4QS8A 4H5NA 1VQ7N 5HL7L 3WQTA 4MLHA 4GV9A 1X3NA 2HOEA 4AF1A 5GIOA 3N4PA 1X9JA 2D0OA 1QQOA 3FZHA 1HUXA 2P9NA 3EN9A 1WUAA 3ULEB 3LDPA 3MN5A 4GY2B 4JKEA 3BF3A 4WQ4C 4AM7A 2YHXA 1HKBA 2H3GX 3L6QA 3TTCA 5C2DA 1KD1O 4BVPA 1K8AO 4KH5A 3OBYA 2AA4A 1T6DA 4IEIA 4BC5A 4CJ7A 1VAZA 1Z05A 4CBWA 3QBWA 3SMPA 4BRPA 3SBGA 5AQVA 5KQ8A 4BREA 2Q31A 5AQKA 2E1ZA 1U2VA 3O9SA 3SBTA 3DXKB 5AQUA 4IFEA 2GX9A 1WOQA 2Q1NA 3EE9A 5AQGA 5AQXA 1NJIO 2UYTA 4HWIA 1BG3A 2YJFA 4FWSA 5FPDA 2F9TA 5LJWA 3HSCA 3O8MA 3CJ1A 2Q0UA 4FWRA 1ZBSA 4U67L 5BN8A 2FF6A 3CCEN 4IO9L 4M7XA 3E9OA 2J4RA 3K9JA 5AQHA 1HKCA 3SAHA 3N4QA 5MLCQ 1P8ZA 3FFKB 1NGAA 4H5WA 4BC4A 3E9LA 3I55N 3QMLA 3E1YA 3WEEA 4BC3A 4JK8A 4UY8O 1XQSC 1MDUB 3SMSA 1VQMN 2HF3A 1C0GA 3CCUN 4KH6A 3FZFA 3D2EB 3S41A 3IKMA 4WCEL 2EWSA 5JVGL 3PIPL 5BPLA 1VQPN 3NMUA 2D4WA 2KLAA 3MN9A 3VGLA 1KAXA 3QBXA 1KAZA 2OTJN 3CQYA 4FWOA 4HTLA 3HTVA 3G25A 4KH4A 3H1VX 4ISFA 3EKUA 3O08A 3KWIA 2Q0RA 2V7ZA 2IVOA 5CE3A 3AAQA 1JCGA 4A62A 2QTDA 5AQOA 3LDQA 5M1OA 3RSEB 5GAGP 1SZ2A 3IMXA 4BG8A 3TSPA 3FR0A 4JKAA 4PL7A 1JJ2M 4A61A 1K9MO 3JXUA 4JNEA 2ZJPL 2GTDA 3RVCA 2VGMA 1VQLN 4WQ4A 2P9KB 1ZC6A 1E4GT 3LDLA 3CC7N 4FWPA 3VTHA 3UKRB 3ZX2A 5BN9A 5C10A 1DEJA 2QEXN 2ITMA 5M1KA 3P38A 3C7NB 1KAYA 5C15A 1BA0A 1VQKN 3CHWA 1M90O 3CD6N 3O4WA 1EQYA 3GOIA 4A59A 3B8AX 4H0XB 3ID8A 4JKDA 4IXCA 3HOTA 3H46O 4O8UA 4WFBL 3TSUA 4B9QA 2JWKA 4JEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUP A;  3M3Z A;  3KVG A;  1MA9 B;  2GWK A;  3O6W A;  2YJE A;  4NO7 A;  1Q18 A;  1NLV A;  2VCP A;  2V52 B;  4DCH A;  2E8A A;  1JCE A;  3WEE B;  3LDN A;  1TUY A;  3R9P A;  3I8B A;  3U8X A;  3UE5 A;  1Y64 A;  2OAN A;  1NMD A;  4O5F A;  2PAV A;  2QWL A;  3BUZ B;  4BRH A;  1ATS A;  2V7Y A;  1QZ6 A;  1U6Z A;  3O80 A;  3VF4 A;  3WXL A;  4F9O A;  4IO8 A;  5TKY A;  3HM8 A;  4MO5 A;  4CI6 A;  5LJV A;  4EFH A;  4MLE A;  5JIC A;  1BA1 A;  4PL8 A;  4EHT A;  2FSN A;  2I7N A;  4YDU A;  5JMV A;  5AZI A;  1E4F T;  4IJN A;  3VEO A;  3SLC A;  3M6G A;  1BWF O;  2HF4 A;  2QWQ A;  3JS6 A;  1OKJ A;  4BRI A;  2GEL A;  3H3N O;  4KBO A;  3ATU A;  5AFU A;  3VEV A;  4BC2 A;  4BGB A;  3AAP A;  3VEW A;  5KPR A;  3SK3 A;  5AQQ A;  2DPN A;  2CGK A;  3VET A;  3UKU B;  1TYQ A;  3FZM A;  3UB5 A;  3WXJ A;  2P9U A;  4CZL A;  4H0P A;  2W40 A;  4XH5 A;  2QM1 A;  3ENH A;  4JHD A;  5AQF A;  2ZGY A;  3IUC A;  1BO5 O;  3D2F A;  2P9P A;  3D7E O;  1ATR A;  3H1Q A;  3VER A;  1CZA N;  1NGD A;  3WXK A;  5AQL A;  1GLD G;  3W0L A;  4EAH D;  4H03 B;  4EHU A;  2NLX A;  5LY3 A;  1XC3 A;  1YUW A;  4E1J A;  3QDK A;  2ASO A;  1C0F A;  3EO3 A;  4ISG A;  5BPM A;  3L0Q A;  3DJC A;  2CGL A;  3ZEU B;  4XH1 A;  4NB4 A;  2P9L A;  4RTF D;  3VEN A;  2P9I A;  5E84 A;  4XEI A;  3VGM A;  3DAW A;  5F0X A;  4LC9 B;  1NGF A;  4B1Y B;  3A8Y A;  4PKG A;  2P9S B;  4IWV A;  4FWL A;  4BRQ A;  1NBW A;  2A5X A;  4WQ5 C;  1NGI A;  2GWJ A;  5AQS A;  2P9N B;  5FPE A;  1YAG A;  4H5V A;  4CD3 A;  2NRH A;  2WUS A;  4Y0W A;  2FSK A;  5EVZ A;  3VEX A;  3FE1 A;  2E2P A;  3DXM A;  4ISE A;  5I9E B;  2Q2R A;  4BG9 A;  4FWQ A;  2QWR A;  4FSV A;  3P4I A;  2E2O A;  5AQN A;  3EZW A;  3TU5 A;  4A2B A;  1TYQ B;  1MWM A;  1U2V B;  4JHD B;  5AQI A;  3VEY A;  3FGU A;  1D4X A;  1ZXO A;  2VYP A;  1GLL O;  4K41 A;  1QHA A;  4BR0 A;  1GLJ O;  1NGC A;  4FWK A;  3A5N C;  4I6M A;  3TPQ A;  2P9P B;  4C23 A;  4K25 A;  3ZET A;  3ENO A;  2YCH A;  3FZL A;  3KHY A;  4CZG A;  1T44 A;  2CH6 A;  1HJO A;  1S3X A;  1TUU A;  3CI5 A;  3ZX0 A;  3ULE A;  4BGA A;  3A0I X;  5ADX A;  2IIR A;  5KPZ A;  5F2R A;  4GNI A;  4PKH A;  4CZF A;  3ZX3 A;  2QW9 A;  4BRA A;  4H0V B;  2ZGZ A;  2A6A A;  3J8A A;  2P9L B;  2E20 A;  3CJA A;  4JD2 A;  3QIC A;  5F1X A;  1YXQ A;  4DQ8 A;  3CET A;  2FXU A;  4QS7 A;  2FSJ A;  4K43 A;  3F9M A;  5AQP A;  2W41 A;  5AR0 A;  4MO4 A;  1JCF A;  4O8K A;  3CIP A;  3MDQ A;  4BR9 A;  4AM6 A;  2QWP A;  3CJB A;  3R6M A;  2E1Y A;  2FLO A;  3IFR A;  4RCH A;  1NGG A;  1T6C A;  3GL1 A;  4FWN A;  3CJ7 A;  4FOE A;  3MCP A;  4JN4 A;  4EIA A;  2QXL A;  5KPT A;  3CER A;  1NGE A;  2E2Q A;  1S22 A;  2V51 B;  3GG4 A;  5EOY A;  4RWT A;  2KHO A;  1ESV A;  4DB3 A;  4H0T B;  3A5L C;  1R59 O;  4K42 A;  4H0O A;  3SJH A;  3VF2 A;  2NZT A;  4BRM A;  3FLC O;  5AQJ A;  4BQL A;  2GUP A;  3H45 C;  4BRD A;  3ZET B;  1DGK N;  1J6Z A;  3LM2 A;  1G99 A;  2FF3 B;  3RSE A;  4FL9 A;  5FPN A;  3KZB A;  3EKS A;  4WYB A;  4CZE A;  2E88 A;  3ATV A;  3OHR A;  1HX1 A;  3CJC A;  2PBD A;  2A3Z A;  2QWM A;  3IDH A;  4H0Y B;  5AFU H;  4BRK A;  1DKG D;  2P9K A;  1SAZ A;  4CZK A;  4JD2 B;  4H5R A;  4CZH A;  3U9D A;  3UKR A;  3FZK A;  3C0B A;  3EL2 A;  3H3O B;  1SQK A;  2A40 A;  4IJA A;  5AZJ A;  1NM1 A;  5JLH A;  3WUH A;  2CH5 A;  3LDO A;  3C7N A;  1GLB G;  1NGH A;  2Q36 A;  3O5B A;  1GLF O;  5BRH A;  1RGI A;  5FPM A;  5EXW A;  5KQD A;  3U9Z A;  3U4L A;  3I33 A;  4B1U B;  1BOT O;  1QQM A;  5B8H A;  3O1B A;  3H6E A;  2F9W A;  3HI0 A;  3CJ9 A;  3BF1 A;  5AZI B;  2ZWH A;  2ZF5 O;  3AAR A;  3WXI A;  3VF6 A;  1LCU A;  1NGJ A;  2YHY A;  3QFP A;  4FPA A;  4B1Z A;  5AQR A;  4Z94 A;  3LL3 A;  2QWN A;  3QB0 A;  4BRC A;  3A5M C;  3W3D A;  5BRE A;  2D0P A;  3WT0 A;  4BRL A;  4CZJ A;  5AQZ A;  3MK6 A;  1MWK A;  1YVN A;  2GEM A;  5BR9 A;  5EX5 A;  3GE1 A;  4CBU A;  3VES A;  3O1W A;  1NGB A;  1HPM A;  3LM9 A;  2P9U B;  4JAX A;  3DWL A;  4YDU C;  3BP8 A;  3GBT A;  1V4T A;  4CD1 A;  1X3M A;  5AQM A;  4A2A A;  3D2F B;  1K8K A;  1RDW X;  5AQT A;  2ASM A;  4BRO A;  4PKI A;  5AQY A;  4BR4 A;  3HBT A;  1H1V A;  4CBX A;  5E26 A;  4B1V A;  3VPZ A;  2BTF A;  3HZ6 A;  1HLU A;  1ATN A;  1IG8 A;  4J8F A;  4IZ9 A;  5ELZ A;  4B1X B;  4BR7 A;  3MN7 A;  5AZJ B;  2AP1 A;  4BVO A;  5BRD A;  4M63 C;  1GLE G;  4FO0 A;  2I7P A;  3L4I A;  3MN6 A;  1BDG A;  1HKG A;  2Q97 A;  4FPB A;  2P9I B;  4BRG A;  1LOT B;  4L3Q A;  2YI1 A;  3VEZ A;  1NWK A;  2IVN A;  3UKU A;  3WQU A;  4B1W B;  4BRN A;  3QFU A;  3M1F A;  3DXK A;  4CZI A;  2A41 A;  1GLC G;  4CZM A;  1KXP A;  2VWB A;  3A5O C;  3BEX A;  5AQW A;  4BR5 A;  5ADX H;  4FOI A;  4XH4 A;  3VOV A;  4H5T A;  1IJJ A;  4BR2 A;  2D1K A;  2YHW A;  2E2N A;  4BRF A;  4FWM A;  4WQ5 A;  5EY4 A;  4DHY A;  2A42 A;  3AY9 A;  3MMV A;  1V4S A;  3DXM B;  1QZ5 A;  3R8E A;  5JLF A;  3CQX A;  2ASP A;  1Z6R A;  2QWO A;  1BU6 O;  3VGK A;  3ZEU A;  1XUP O;  3GDQ A;  4QS9 A;  3D2E A;  4BQZ A;  1QQN A;  1GLA G;  2IVP A;  2CGJ A;  5BPN A;  2BUP A;  2P9S A;  2HMP A;  1RFQ A;  5BRF A;  4I6M B;  1K8K B;  4M7Y A;  4QS8 A;  4H5N A;  3WQT A;  4MLH A;  1X3N A;  2HOE A;  1X9J A;  2D0O A;  1QQO A;  3FZH A;  1HUX A;  2P9N A;  3EN9 A;  1WUA A;  3ULE B;  3LDP A;  3MN5 A;  4GY2 B;  3BF3 A;  4WQ4 C;  4AM7 A;  2YHX A;  1HKB A;  2H3G X;  3L6Q A;  4BVP A;  2AA4 A;  1T6D A;  4BC5 A;  4CJ7 A;  1Z05 A;  4CBW A;  3QBW A;  3SMP A;  4BRP A;  5AQV A;  5KQ8 A;  4BRE A;  2Q31 A;  5AQK A;  2E1Z A;  1U2V A;  3DXK B;  5AQU A;  2Q1N A;  1WOQ A;  5AQG A;  5AQX A;  2UYT A;  4HWI A;  1BG3 A;  2YJF A;  4FWS A;  5FPD A;  2F9T A;  5LJW A;  3HSC A;  3O8M A;  3CJ1 A;  2Q0U A;  4FWR A;  1ZBS A;  5BN8 A;  2FF6 A;  4M7X A;  2J4R A;  5AQH A;  1HKC A;  1P8Z A;  3FFK B;  1NGA A;  4H5W A;  4BC4 A;  3QML A;  3WEE A;  4BC3 A;  1XQS C;  1MDU B;  3SMS A;  2HF3 A;  1C0G A;  3FZF A;  3D2E B;  3S41 A;  2EWS A;  5BPL A;  2D4W A;  3MN9 A;  3VGL A;  1KAX A;  3QBX A;  1KAZ A;  3CQY A;  4FWO A;  4HTL A;  3HTV A;  3G25 A;  3H1V X;  4ISF A;  3EKU A;  3O08 A;  2Q0R A;  2V7Z A;  2IVO A;  5CE3 A;  3AAQ A;  1JCG A;  4A62 A;  5AQO A;  3LDQ A;  3RSE B;  1SZ2 A;  3IMX A;  4BG8 A;  3FR0 A;  4PL7 A;  4A61 A;  3JXU A;  4JNE A;  2GTD A;  4WQ4 A;  2P9K B;  1ZC6 A;  1E4G T;  3LDL A;  4FWP A;  3UKR B;  3ZX2 A;  5BN9 A;  1DEJ A;  2ITM A;  3C7N B;  1KAY A;  1BA0 A;  3CHW A;  3O4W A;  1EQY A;  3GOI A;  3B8A X;  4H0X B;  3ID8 A;  4IXC A;  3H46 O;  4B9Q A; 
#chains in the Genus database with same CATH topology
 3LZJ A;  1X9S A;  1B9F A;  2NNW A;  3O6W A;  4Q5V A;  1NLV A;  1BCM A;  2VCP A;  3THY A;  2G8W A;  1L3U A;  2O4I A;  4DFP A;  3OS2 A;  3LDN A;  2F7T A;  3I8B A;  1S1U A;  3QEV A;  1NK4 A;  4E0D A;  1C0T A;  1Y64 A;  4KFB A;  4CF8 A;  5M1N A;  1QQC A;  2PAV A;  1ATS A;  1QZ6 A;  4PY5 A;  4FJH A;  1SL2 A;  3KK2 A;  1VQ5 N;  3P1G A;  4CHN A;  5JIC A;  1NOY A;  5JMV A;  2HBL A;  2G8U A;  4FLT A;  3NE6 A;  2VQE K;  1KFD A;  3HPG A;  1Y97 A;  4BE2 A;  2HBM A;  1S6Q A;  1TK5 A;  4IOC L;  3RTV A;  4M3U A;  2F8S A;  2GEL A;  2P5O A;  4BGB A;  1BIU A;  3U6F A;  4IG3 A;  3HT3 A;  3M8R A;  5KPR A;  4B3O A;  2DPN A;  5GAE P;  3SPZ A;  3K5M A;  2P9U A;  3NHG A;  2IS3 A;  1IBK K;  2W40 A;  4JHD A;  2G8V A;  4F2S A;  1E3M A;  4DFM A;  3PX4 A;  4JYA K;  1BO5 O;  2YV0 X;  3THY B;  3EZ5 A;  3WXK A;  5AQL A;  1IG9 A;  3W0L A;  4ELU A;  4M3X A;  2NLX A;  3K0S A;  2HHV A;  4DMN A;  5GIP A;  4FLX A;  1UOC A;  4RW8 A;  2O8D A;  2ASO A;  3C6A A;  3DRP A;  1C0F A;  3EO3 A;  4KB1 A;  3L0Q A;  3DLK A;  3LAK A;  1SUQ A;  4GVE A;  2P9I A;  4DV4 K;  1REV A;  5KRT A;  2P9S B;  4IWV A;  2HBK A;  3J80 O;  4GV6 A;  4DV7 K;  3PX0 A;  3CF5 L;  1VQ9 N;  2D0A A;  4DQS A;  2P9N B;  3KLI A;  5FPE A;  1YAG A;  1WLJ A;  1KSP A;  1F21 A;  3ZSR A;  4CD3 A;  4DSK A;  4FLZ A;  1ITG A;  4DF8 A;  4FSV A;  3AA3 A;  2E2O A;  4RW7 A;  1DTT A;  5AQN A;  3THW B;  4CJW A;  3D45 A;  3ULD A;  4DQQ A;  1MWM A;  2YX6 A;  4JHD B;  4CER A;  4W5O A;  1ZXO A;  1GLL O;  1QHA A;  3A5N C;  3TAE A;  4I6M A;  4DTM A;  4C23 A;  1NK8 A;  2E6M A;  3MXM A;  2YCH A;  2VGN A;  3KHY A;  3OYH A;  4DTJ A;  1HJO A;  1TUU A;  2RKI A;  4HCB A;  2O8D B;  1HNV A;  3HPH A;  2HB5 A;  4CZF A;  5JS2 A;  3K9K A;  3ZX3 A;  1VSF A;  3SUP A;  1WNS A;  2ZGZ A;  3TAP A;  1YJ9 N;  2FBV A;  2RF2 A;  3RMC A;  4X64 K;  5J2M A;  3ZT2 A;  3CCM N;  5F1X A;  1XI1 A;  1ZBU A;  4M3R A;  4QS7 A;  4EZ9 A;  1TL1 A;  4DUZ K;  3F9M A;  3HYF A;  1N5Y A;  4DTX A;  3AO3 A;  2B6A A;  4MO4 A;  3PLA A;  2KFZ A;  3ASM A;  4V19 S;  3P5J A;  1U47 A;  4LF6 K;  3TTF A;  3MCA B;  3SQ1 A;  1BQM A;  4W5R A;  3QES A;  4FOE A;  4CHY A;  3LAN A;  4EIA A;  2QXL A;  1GOA A;  4LFA K;  2W6K A;  1D9D A;  4C8O A;  1MU2 A;  4DTR A;  1NK6 A;  5EOY A;  3GG4 A;  1WB9 A;  1WAJ A;  4H4O A;  1X9M A;  4GKJ K;  4CGF A;  4JI3 K;  4NYF A;  2QA4 N;  4DB3 A;  3E66 A;  3A5L C;  3NCI A;  2YKN A;  2DTU A;  2QI2 A;  3FLC O;  2HVI A;  5HRR A;  1GOC A;  3CPW M;  2GUP A;  3PX6 A;  5HRO A;  1IBM K;  4IEE A;  3RWU A;  3TSQ A;  3F5T A;  3OHR A;  1B92 A;  2HHS A;  2A3Z A;  2QWM A;  5AFU H;  3I8D A;  4B3S K;  1N8R O;  1K73 O;  3LAL A;  3IAY A;  1SQK A;  2A40 A;  4X66 K;  5AZJ A;  1J53 A;  3OA9 A;  4G1Q A;  5JLH A;  3O4Q A;  3UIQ A;  1CLQ A;  3R3L A;  2RE2 A;  1RGI A;  5FPM A;  5HRS A;  2PY5 A;  3U4L A;  1BOT O;  1QQM A;  5B8H A;  1KFS A;  2OA8 A;  5AZI B;  1X9W A;  2GBZ A;  3VF6 A;  1VRU A;  1RTJ A;  3TTD A;  4LH5 A;  1RDB A;  1J54 A;  4BRC A;  3W3D A;  5BRE A;  3S3M A;  4DR2 K;  1VQ4 N;  1A5X A;  3HVR A;  4EP4 A;  1MWK A;  5FRM A;  5EX5 A;  3VES A;  1Q9Y A;  3C6H A;  1FJG K;  4CD1 A;  1J5E K;  2KZZ A;  3CCR N;  4HHT A;  2HVH A;  4BE0 A;  4MFB A;  3KIO A;  3AGK A;  5AQT A;  4DSI A;  2ASM A;  4BRO A;  3HPO A;  5AQY A;  4F3T A;  3HZ6 A;  4FLU A;  1HLU A;  1ATN A;  4B1X B;  3AVA A;  5AZJ B;  4BVO A;  3M8Q A;  3AO5 A;  3ZSX A;  4M63 C;  1RDD A;  2NRZ A;  1ASV A;  1BDG A;  2Q97 A;  3HRG A;  3J7Z O;  1SV5 A;  4L3Q A;  2YI1 A;  4IDK A;  1FKP A;  4MDA A;  4F8R A;  2IVN A;  3THV A;  4J2E A;  4AHR A;  4BRN A;  3M1F A;  4LSN A;  4CZI A;  2W6L A;  4DTN A;  3QET A;  2QXF A;  2DY4 A;  4H5T A;  4ID1 A;  2D1K A;  2YHW A;  4BRF A;  3L8B A;  1S1X A;  4WFA L;  1NOZ A;  3R8E A;  4DR3 K;  4CJU A;  1SKW A;  3NBP A;  1Z6R A;  3J7Y P;  4FYD A;  4O44 A;  1JLB A;  4OKJ A;  4WF9 L;  4QS9 A;  5CYM A;  2NUB A;  1JLF A;  1ZYQ A;  3SAG A;  2A1R A;  2IVP A;  1S1W A;  3C6U A;  5BRF A;  2F4V K;  1I3A A;  1UWB A;  2XY6 A;  3OYB A;  4GV9 A;  3N4P A;  1QQO A;  2KQ2 A;  3EN9 A;  1HYV A;  1EWR A;  4AM7 A;  5C2D A;  3JAM O;  4DG1 A;  2AA4 A;  1X1P A;  2R7Y A;  3F9K A;  4CBW A;  1XMQ K;  2Q31 A;  5SWM A;  3JYT A;  4JI7 K;  1U2V A;  1OH6 A;  2BDP A;  4I9Q A;  5AQU A;  1WOQ A;  3EE9 A;  4PUO A;  1NJX A;  4FJ7 A;  2BAN A;  3MXI A;  1RT1 A;  3CFP A;  1HYS A;  1WN7 A;  2F9T A;  5FLX O;  2O8E B;  3NGI A;  4U67 L;  4RG8 A;  4M7X A;  1RIL A;  4BWM A;  4DR5 K;  1HKC A;  2Z1G A;  2FBY A;  4M3Z A;  3QML A;  3WEE A;  4CF0 A;  4UY8 O;  4CHP A;  2OYQ A;  3TAB A;  3FZF A;  1CXQ A;  2EWS A;  2QKK A;  1VQP N;  5BPL A;  2KLA A;  4I7F A;  3MN9 A;  3VGL A;  3QBX A;  1KAZ A;  3CQY A;  4CHQ A;  4KH4 A;  3VQ9 A;  3ZSV A;  4H4M A;  4CVN E;  4N41 A;  2Q0R A;  1TKT A;  2V7Z A;  5CE3 A;  1JCG A;  5IWA K;  2I5J A;  2KW4 A;  1N6Q A;  4PL7 A;  1IKX A;  3ZT3 A;  3JXU A;  5J2N A;  1LW0 A;  2VGM A;  4WQ4 A;  2P9K B;  4CJL A;  3UKR B;  3ZX2 A;  2OPR A;  1R0A A;  5C15 A;  1HNZ K;  3D0P A;  3WNE A;  3B8A X;  4IXC A;  4DU4 A;  3LAM A;  1RT6 A;  2QKB A;  4B9Q A;  2JWK A;  5BRH A;  4CJK A;  3M3Z A;  4R79 A;  2UXB K;  4B9U A;  3MWP A;  2RHK A;  4NCG A;  1P90 A;  2HHU A;  4CEE A;  3WEE B;  4B9S A;  4MDB A;  4KB0 A;  1TUY A;  3R9P A;  1U49 A;  3U8X A;  3QEI A;  4FCY A;  1HNW K;  1L3T A;  3EY1 A;  3BUZ B;  4BRH A;  3VF4 A;  1WBB A;  1XMO K;  3WXL A;  5TKY A;  3P83 D;  3O9Q A;  3MX2 A;  5LJV A;  5DM6 L;  1T3V A;  4EFH A;  3SCX A;  4MLE A;  1RTI A;  1BA1 A;  2OPP A;  3DRR A;  2I7N A;  1FXX A;  4RW9 A;  4CJP A;  1E4F T;  1HQU A;  2EX3 A;  4PA1 A;  1YJN N;  4IKF A;  1YTU A;  2HHH K;  4X65 K;  4DQR A;  2YNH A;  1KRP A;  3TAN A;  1NNE A;  3JS6 A;  1S9E A;  3H3N O;  3LP2 A;  3BGR A;  5AFU A;  3AAP A;  3TWH A;  3SK3 A;  2E6L A;  3DLE A;  1VQ8 N;  3HJF A;  1WAF A;  2CGK A;  3RRH A;  4N76 A;  3UKU B;  4JS4 A;  3WXJ A;  3UB5 A;  3DLL L;  4XH5 A;  5LMN K;  3ENH A;  3U3Y A;  1TAU A;  3D2F A;  3H1Q A;  5A2Q O;  1CZA N;  1GLD G;  1W7A A;  4H03 B;  1RTD A;  5LY3 A;  4E1J A;  3QDK A;  4YOV A;  5BPM A;  4C8M A;  3BDP A;  2CGL A;  3HO1 A;  4OGE A;  3T19 A;  4Z4F A;  1Z25 A;  5I3U A;  4XH1 A;  4CFD A;  4M42 A;  1QSS A;  3VEN A;  1Q8I A;  5E84 A;  1NMN A;  3DAW A;  1VQO N;  4DR1 K;  4IG0 A;  4PKG A;  3ALY A;  4KHN A;  3VQP A;  3O9T A;  2ZJR L;  1WSH A;  1BHL A;  3LPT A;  4BRQ A;  1NBW A;  1IKW A;  4DSJ A;  3KTQ A;  4DR7 K;  5I42 A;  3NF6 A;  3G0Z A;  4B9V A;  3M8P A;  3CCS N;  4AIL C;  1RDC A;  1WSG A;  1SKS A;  3PO4 A;  2BE2 A;  3DXM A;  2KTQ A;  4DKW A;  1JLG A;  1YVU A;  2ZJQ L;  2Q2R A;  4BG9 A;  2QWR A;  2G8K A;  4IBN A;  1TL3 A;  4FK2 A;  4A2B A;  3MEE A;  3OJU A;  4IFY A;  3K58 A;  1L3V A;  1IBL K;  1IKY A;  3VEY A;  2VYP A;  3EYZ A;  3QEW A;  4AHC A;  1NGC A;  1N36 K;  3CME N;  2NRX A;  1LAV A;  4DQP A;  2D0B A;  4K25 A;  3ENO A;  3FZL A;  4NXM K;  4CZG A;  3SNN A;  3KWG A;  1K6Y A;  1JXB A;  3ZX0 A;  3MWT A;  3VQ7 A;  4FM0 A;  1QVF M;  5KPZ A;  3VQ6 A;  4GNI A;  4B8A B;  4TSX A;  4PKH A;  3Q7B A;  4E7L A;  1A5V A;  3SZ2 A;  3O9U A;  3THX A;  3AA4 A;  4H0V B;  3KLF A;  2A6A A;  3KD5 E;  2FBT A;  3LWL A;  2RPI A;  4EZ6 A;  3L2Q A;  2FSJ A;  1YIJ N;  4K43 A;  5AR0 A;  2W41 A;  4I2Q A;  1J5O A;  1JCF A;  4O8K A;  3CIP A;  2X6S A;  1GOB A;  3VQQ A;  1YT3 A;  2HND A;  4BR9 A;  3NH1 A;  3DLR A;  4FZX C;  4AM6 A;  3CJB A;  3IFR A;  5LL6 Z;  4OX9 K;  1U4B A;  4RCH A;  1IV0 A;  1NK9 A;  1KVA A;  3LP0 A;  4JN4 A;  2FC0 A;  3NVK A;  1C0M A;  5KPT A;  3DOL A;  1QVG M;  4DFK A;  3H08 A;  3R1X A;  4FK4 A;  1S1V A;  3Q7C A;  1KVB A;  4JI8 K;  1ESV A;  3SJJ A;  4H0T B;  5H1S Q;  4NXN K;  1R59 O;  3IRX A;  1LW2 A;  3SJH A;  4KKO A;  4DR6 K;  1WBD A;  1YJW N;  4OPK A;  5AQJ A;  3TAQ A;  1NJZ A;  1KVC A;  3H45 C;  4BRD A;  1DGK N;  4ILG B;  4FJJ A;  1YIT N;  3RSE A;  4FL9 A;  1Q7Y O;  3KZB A;  1OVY A;  3EKS A;  3HM9 A;  5M1P A;  3FFI A;  4H5R A;  2YNF A;  3EL2 A;  4DQI A;  3AGR A;  4F4K A;  1NM1 A;  3VMF B;  4YOT A;  3WUH A;  3LDO A;  4OPJ A;  5HLF A;  1XNQ K;  3C7N A;  1GLB G;  3B6O A;  2DFE A;  1NGH A;  4Z4C A;  1GLF O;  1T7P A;  1VSL A;  3O1B A;  3SYZ A;  2XY5 A;  3I0S A;  2UUC K;  1S6P A;  1TK0 A;  3CJ9 A;  3BF1 A;  3NF8 A;  4DTO A;  1N32 K;  4CHZ A;  4OKE A;  1LCU A;  2YHY A;  4CGI A;  1G15 A;  5C42 A;  4N47 A;  3RR7 A;  4FPA A;  4B1Z A;  5AQR A;  4CJ4 A;  4NYN A;  3NVM A;  4KTZ A;  4O5B A;  1ZBL A;  4JKF A;  4CJ3 A;  3MK6 A;  2GEM A;  4LF5 K;  1T03 A;  5BR9 A;  3AVB A;  3CCJ N;  3QIP A;  3O1W A;  1NGB A;  3LM9 A;  2P9U B;  4JAX A;  3DWL A;  4B9N A;  5J2Q A;  5AQM A;  4A5A A;  4A2A A;  1Q82 O;  3QIO A;  4CK1 A;  1K8K A;  3HXM A;  2E5L K;  4Z0U A;  3SUO A;  5DK5 A;  4CBX A;  3TI0 A;  1N34 K;  2HW3 A;  4U7B A;  4GVM A;  4J8F A;  4K8X A;  4F3O A;  3MN7 A;  3CCV N;  4FJL A;  2O4G A;  4KV8 A;  3DMJ A;  5TKW A;  5BRD A;  4FJK A;  3BZC A;  2JLE A;  2I7P A;  3MN6 A;  1C6V A;  4BRG A;  2P9I B;  1JLA A;  1YF5 L;  1LOT B;  1Q81 O;  5DMR A;  1NKB A;  3L2V A;  2DFF A;  4B1W B;  3NH2 A;  1U04 A;  2ETJ A;  3I56 N;  4JI5 K;  3BEX A;  2VWB A;  3A5O C;  3QLH A;  4BR5 A;  5ADX H;  3VOV A;  3L2R A;  5D3G A;  1IJJ A;  1W97 L;  2ZE2 A;  4J2D A;  5DM7 L;  4WQ5 A;  4J2A A;  3MMV A;  1V4S A;  4DTS A;  2NRW A;  3OYM A;  2UU9 K;  2QWO A;  1BU6 O;  3ZEU A;  2FBX A;  3A2F A;  3K5L A;  3GDQ A;  4N5S A;  3CXC M;  2WTU A;  2CGJ A;  2BUP A;  4OO1 J;  2HMP A;  2OPS A;  3AVN A;  4I6M B;  4NCB A;  1K8K B;  4CEO A;  1NK7 A;  4E1N A;  4QS8 A;  1VQ7 N;  5HL7 L;  3WQT A;  1X3N A;  2HOE A;  5GIO A;  4DV0 K;  3HVT A;  3OYF A;  3AO1 A;  3DLB A;  3LDP A;  3BF3 A;  1HKB A;  1U45 A;  1KD1 O;  4BVP A;  4CEA A;  3K5N A;  4IEI A;  4BC5 A;  4CJ7 A;  4B9L A;  1Z05 A;  3SMP A;  4DSE A;  2OCE A;  5AQV A;  5KQ8 A;  4FZZ A;  1YTA A;  3PUF A;  5AQK A;  1BCO A;  4O0I A;  2E1Z A;  3CM6 A;  1HRH A;  4IFE A;  2GX9 A;  1NJI O;  5E41 A;  2GV9 A;  4HWI A;  1RNH A;  1BG3 A;  2YJF A;  1I39 A;  3LPU A;  2ATQ A;  2HNZ A;  3CJ1 A;  5BN8 A;  4CF2 A;  1CZB A;  1OH5 A;  3CCE N;  4IO9 L;  5AQH A;  1RT7 A;  1DTQ A;  4BC4 A;  3SV4 A;  3HP9 A;  1XQS C;  1MDU B;  4I2P A;  2UXD K;  4KH6 A;  4E89 A;  5C24 A;  3MXJ A;  3PIP L;  3KK3 A;  4BAC A;  2VG5 A;  1QTM A;  1KAX A;  1OH8 A;  3HTV A;  2WOM A;  3H1V X;  3K59 A;  1EP4 A;  1EX4 A;  4A62 A;  5HP1 A;  2QTD A;  1RT5 A;  5AQO A;  4LFB K;  5M1O A;  1RT4 A;  1LWE A;  1SZ2 A;  4LSL A;  3TSP A;  3FR0 A;  1JJ2 M;  3VQE A;  3NAE A;  2ZJP L;  1VRT A;  1ZC6 A;  2HNY A;  3TR8 A;  5C10 A;  4CEZ A;  3NFA A;  1KAY A;  3ITH A;  3ZSW A;  4DV3 K;  4FM1 A;  3V1Q A;  1M90 O;  4MQ3 A;  3O4W A;  1EQY A;  4H0X B;  3ZLJ A;  4JKD A;  3H46 O;  4CJS A;  1BUP A;  1MA9 B;  1QSY A;  1ASW A;  2GWK A;  2YJE A;  4NO7 A;  4OKK A;  4DCH A;  1JCE A;  5IT9 O;  1WSF A;  2O8C A;  3AO4 A;  1O13 A;  2Y1I A;  3UE5 A;  4JV5 K;  1NMD A;  1VQ6 N;  3AA5 X;  3O3H A;  3O80 A;  4F9O A;  1U6Z A;  3OYA A;  3NGZ A;  5C0Y A;  1FKO A;  3OYJ A;  2E4L A;  3QEX A;  4MO5 A;  4CI6 A;  3KK1 A;  1QSL A;  4NCA A;  3SPY A;  4JRQ A;  4O4G A;  3AVK A;  4FZY A;  4EHT A;  2FSN A;  2X74 A;  1JLQ A;  4KTW A;  3QO9 A;  3O3F A;  5GAH P;  2WON A;  3L4Q A;  2HF4 A;  1KLM A;  3CC4 N;  1OH7 A;  1O1W A;  4O0J A;  3DM2 A;  4E3S A;  4IOA L;  3ATU A;  3NGY A;  3ENB A;  3NF7 A;  3VEW A;  4LD0 A;  3OYD A;  3G4S N;  3RMD A;  4DR4 K;  3VET A;  2Q3S A;  4CZL A;  3DI6 A;  1XNR K;  4PWD A;  4E1M A;  2QM1 A;  1VSE A;  1W2B M;  2ZGY A;  1VQN N;  2P9P A;  4ID5 A;  4CIE A;  1ZBI A;  1NGD A;  4EHU A;  2O8C B;  4JKB A;  4AQY K;  1XC3 A;  3CCQ N;  4M45 A;  1CZ9 A;  3MEC A;  4JKC A;  4CJ5 A;  4BE1 A;  2B4J A;  2VG7 A;  3PV8 A;  2WFB A;  1DT9 A;  3QIN A;  1EXQ A;  4XEI A;  3VGM A;  3PY8 A;  4LC9 B;  2YHA A;  2DFH A;  3A8Y A;  3O4N A;  4FWL A;  4CK2 A;  3K2P A;  4KAZ A;  1NKE A;  3ZT1 A;  2A5X A;  3F2K A;  4WQ5 C;  1NGI A;  1L5U A;  4HVJ A;  1BIZ A;  1VSK A;  4W5Q A;  1FW6 A;  2WUS A;  5KGX A;  4ZTF A;  4LF4 K;  4CEC A;  2ZM6 K;  4FM2 A;  3SI6 A;  2VQF K;  2E2P A;  5I9E B;  3PO5 A;  3ZYY X;  3P4I A;  3WNF A;  3TU5 A;  1UA1 A;  3AVF A;  4HUE A;  4DLG A;  3CG7 A;  5J1E A;  3L2W A;  1U2V B;  2ITG A;  5AQI A;  1D4X A;  2IOC A;  4FW1 A;  4JI2 K;  3AVG A;  4K41 A;  4FWK A;  1M1K O;  2P9P B;  1T8E A;  4C8N A;  2EHG A;  1KC8 O;  4GKK K;  1XHZ A;  1T44 A;  4BGA A;  3CI5 A;  3ULE A;  4DV5 K;  3A0I X;  5ADX A;  2IIR A;  3MED A;  3AVJ A;  4JK9 A;  3T3F A;  3V9W A;  2E20 A;  3CJA A;  4JD2 A;  4DWI A;  3QIC A;  2HHQ A;  1EKE A;  3VQC A;  2FXU A;  1SS6 A;  3NDK A;  5AQP A;  5KGW A;  3EEQ A;  4Q0B A;  2O8F A;  4FW2 A;  3CC2 N;  1EET A;  4CE9 A;  5M1Q A;  1LWF A;  3MDQ A;  2QK9 A;  1JL1 A;  4CED A;  2O8B A;  1VSH A;  2FLO A;  4E7J A;  3RMB A;  1NGG A;  1T6C A;  4FWN A;  1Q86 O;  3CJ7 A;  1KTQ A;  4CIG A;  3RR8 A;  3CER A;  1JKH A;  1NGE A;  1HNX K;  2NRT A;  2V51 B;  4YFU A;  3OVN A;  4KO0 A;  1YHQ N;  4HCC A;  3HP6 A;  1EO1 A;  3P39 A;  3VF2 A;  2HHW A;  1FK9 A;  4CEQ A;  2JGU A;  2HHT A;  3T7Z A;  1G99 A;  2FF3 B;  3DLG A;  4JKG A;  5FPN A;  3CMA N;  1C0U A;  1RBR A;  4WYB A;  2E88 A;  1BGX T;  3CJC A;  2PBD A;  1KCF A;  3IDH A;  4H0Y B;  4BRK A;  1DKG D;  1SAZ A;  4JLH A;  3WXM B;  4CZK A;  4JD2 B;  4K0K K;  4CZH A;  3U9D A;  3V9U A;  3C0B A;  4IJA A;  2G8F A;  2CH5 A;  4CGG A;  2O8F B;  2Q36 A;  3C65 A;  3O5B A;  4B9T A;  5EXW A;  5KQD A;  3U9Z A;  3I33 A;  4DU1 A;  3H6E A;  2F9W A;  3HI0 A;  4ILH A;  3V6D A;  1YI2 N;  2ZWH A;  1HJR A;  2ZF5 O;  3AAR A;  3WXI A;  3D6R A;  3QFP A;  4KTQ A;  3ZSY A;  4QCL A;  1C1C A;  4R5P A;  1UAX A;  4CGD A;  4Z94 A;  1ILY A;  2XO7 A;  3LL3 A;  2QWN A;  5GIN A;  3A5M C;  3SUQ A;  4FVU A;  4QOZ B;  3WT0 A;  3LZI A;  3KLG A;  1LWC A;  4CCH A;  5AQZ A;  1YVN A;  2GUI A;  4CJQ A;  4HTU A;  3GE1 A;  4FLY A;  3OYK A;  1HPM A;  2D5R A;  3ZT0 A;  3BP8 A;  1RBT A;  2F8T A;  4JKG B;  2X78 A;  3TAM A;  3D2F B;  1RDU A;  3SV3 A;  3J7A P;  3S9H A;  2P51 A;  1RDW X;  1VHX A;  1C1A A;  4PKI A;  1RT2 A;  1H1V A;  4KHP K;  4BDZ A;  4KRE A;  5E26 A;  4XIU A;  3VPZ A;  2BTF A;  4BR7 A;  1IG8 A;  5ELZ A;  2HBJ A;  2IC3 A;  2AP1 A;  5SZT A;  2X6N A;  5C25 A;  2XY7 A;  4KI4 A;  4N56 A;  2NRV A;  4FPB A;  4CES A;  4BY9 C;  1NWK A;  4CF9 A;  1RT3 A;  2VG6 A;  5HBM A;  2XHB A;  3DXK A;  1GLC G;  4JKH A;  4CZM A;  4LFC K;  5AQW A;  1S9G A;  3SUN A;  5LMU K;  4FOI A;  4XH4 A;  4JI6 K;  5M1F A;  3MX5 A;  4OPH A;  5C2F A;  4BR2 A;  5K14 A;  1TVR A;  3WNH A;  4DHY A;  3CQ8 A;  3J81 O;  2A42 A;  3QNO A;  3C6T A;  4ILJ A;  3DXM B;  1QZ5 A;  1TV6 A;  5KTQ A;  2UUA K;  3CQX A;  4CJR A;  2ASP A;  3AO2 A;  4FLW A;  1BI4 A;  1HPZ A;  3VGK A;  4KHY A;  1VK0 A;  1XUP O;  3KD1 E;  3VQ4 A;  2YHB A;  3D2E A;  4IOX A;  1QQN A;  4CFC A;  3E9P A;  3ZSZ A;  2P9S A;  5CY4 A;  4J2B A;  3BZK A;  1RFQ A;  4M7Y A;  4PQU A;  4H5N A;  4MLH A;  4DF4 A;  2D0O A;  2P9N A;  4Z4G A;  5BR8 K;  3AVC A;  1VSD A;  1WUA A;  5KI6 A;  4FXD A;  4WQ4 C;  3TTC A;  3ZSO A;  3L6Q A;  3THX B;  1B9D A;  3DYA A;  3OBY A;  4KH5 A;  4FJ9 A;  4FJ8 A;  3JSM A;  3L3V A;  1VAZ A;  4C8L A;  3QBW A;  4OGC A;  4BRP A;  1RCH A;  3SBG A;  3THW A;  3T1H K;  4BRE A;  1S1T A;  3T1Y K;  3DXK B;  3VQB A;  2Q1N A;  5AQX A;  3V4I A;  2UYT A;  4ZHR A;  5FPD A;  1NJW A;  3HSC A;  3O8M A;  1NK5 A;  2Q0U A;  1ZBS A;  2FF6 A;  4AHU A;  2J4R A;  3SAH A;  3N4Q A;  2HMI A;  4ELV A;  1P8Z A;  3FFK B;  1NGA A;  4H5W A;  3I55 N;  1BI4 B;  4JK8 A;  3SMS A;  1VQM N;  4DSL A;  4KHQ A;  4F2R A;  2Z1I A;  1C0G A;  3CCU N;  4ZTJ A;  3D2E B;  4M41 A;  1C1B A;  2PYL A;  5CZ1 A;  4KHW A;  4CIF A;  2OTJ N;  3IG1 A;  4HTL A;  3M8S A;  1QE1 A;  2RN2 A;  3O08 A;  2IVO A;  3AAQ A;  4B3T K;  5FRO A;  3ZSQ A;  4E7H A;  3RSE B;  1RDA A;  4BG8 A;  4JKA A;  1NKC A;  3AV9 A;  2GTD A;  3AVM A;  4WE1 A;  1VQL N;  4GW6 A;  3LDL A;  5CZ2 A;  3VTH A;  5BN9 A;  1DEJ A;  2QEX N;  4M3W A;  4DTP A;  4RW6 A;  5M1K A;  3P38 A;  3C7N B;  2W42 A;  5J2P A;  1D9F A;  4OLA A;  4DV1 K;  1BA0 A;  4FJN A;  2KFN A;  3CHW A;  3OS0 A;  1VSM A;  3NF9 A;  1TAQ A;  4ELT A;  4YNQ A;  4ICL A;  4O8U A;  4WFB L;  5HRN A;  3RMA A;  4FJG A;  3KVG A;  3OYI A;  2PYJ A;  1Q18 A;  2V52 B;  3V1R A;  3PSF A;  2E8A A;  5T7B A;  2OAN A;  3VTI A;  4Z4H A;  4O5F A;  1RBV A;  2QWL A;  2V7Y A;  1D5A A;  4IO8 A;  3S3O A;  1TK8 A;  3HM8 A;  4AHS A;  3C94 A;  3QEP A;  4IFV A;  4YHH K;  5EU7 A;  4PL8 A;  3CPE A;  3VQ8 A;  2D0C A;  4YDU A;  5CR4 A;  4Z4E A;  5AZI A;  4A5B A;  4IJN A;  4JI4 K;  3VEO A;  2OPQ A;  2PFU A;  4CEB A;  3SLC A;  4CW7 B;  3M6G A;  4KPY A;  1BWF O;  4YOR A;  2QWQ A;  1QS4 A;  4K8Z A;  2G8H A;  4H8K A;  4CJT A;  2UXC K;  1D8Y A;  1OKJ A;  4BRI A;  3G71 N;  4JS5 A;  4KBO A;  3VEV A;  4BC2 A;  3K5O A;  4LF9 K;  5AQQ A;  4KHS A;  2BH1 A;  3V9X A;  2BGG A;  1JLC A;  2WBN A;  3SAF A;  1TYQ A;  3FZM A;  4H0P A;  3ISN C;  3OJS A;  5AQF A;  1KQS M;  4KHU A;  4FVM A;  1VSJ A;  4YOU A;  3IUC A;  3D7E O;  1ATR A;  3VER A;  4EAH D;  3KJV A;  1YUW A;  4CJE A;  3PSI A;  3SQ2 A;  4HUG A;  4KRF A;  4ISG A;  3DJC A;  1BQN A;  4DV6 K;  3ZEU B;  4JI0 K;  3IS9 A;  4NB4 A;  2P9L A;  4RTF D;  2WC9 A;  3HST B;  4CGH A;  2PZS A;  2HST A;  5F0X A;  1NGF A;  4B1Y B;  3CM5 A;  4M3T A;  4G9Z A;  1NU0 A;  3VQA A;  3ID6 A;  4FJ5 A;  2XRI A;  1NG9 A;  2GWJ A;  3LP1 A;  5AQS A;  5FDL A;  3T1A A;  3OY9 A;  4H5V A;  2NRH A;  4Y0W A;  2FSK A;  5EVZ A;  3KLE A;  1IKV A;  3VEX A;  3O3G A;  3V9Z A;  3FE1 A;  4A57 A;  4ISE A;  4IDH A;  4DUY K;  5KRS A;  4FWQ A;  2UUB K;  3EZW A;  3TAR A;  4AHV A;  4RW4 A;  4C1N K;  1TYQ B;  3C95 A;  4GMJ B;  3FGU A;  3OBW A;  4BR0 A;  1GLJ O;  5C12 A;  3TPQ A;  4L8R B;  3AVI A;  1HR0 K;  3ZET A;  4DV2 K;  4AH9 A;  2NRR A;  2CH6 A;  1S3X A;  5JS1 A;  5F2R A;  1SL0 A;  1JXE A;  3CFO A;  4EP5 A;  2A1S A;  3P31 A;  4WFN L;  1UA0 A;  4JRP A;  2YNG A;  1XC9 A;  4NLB A;  2QW9 A;  4BRA A;  4YOW A;  2Z1H A;  3J8A A;  2P9L B;  3VQ5 A;  1HNI A;  4AHT A;  1YXQ A;  4FJM A;  4DQ8 A;  3S3N A;  3CET A;  4DSF A;  3O9R A;  2OZM A;  2P1J A;  3KKR A;  2JWL A;  2ZD1 A;  1RBU A;  1TKZ A;  4CK3 A;  4BDY A;  1LAW A;  3TAF A;  2O8E A;  3T69 A;  4BDP A;  2QWP A;  3KK7 A;  3R6M A;  2E1Y A;  3HOS A;  4PHT X;  4X62 K;  2VWJ A;  3GL1 A;  1L3S A;  4DTU A;  1HYZ A;  3MCP A;  3AVL A;  2B5J A;  4Y1D A;  2E2Q A;  1S22 A;  3OS1 A;  3DLH A;  4RWT A;  5CHI A;  2KHO A;  2AJQ A;  3G6E N;  4LH4 A;  4NLC A;  3VN5 A;  4LF7 K;  4K42 A;  4LF8 K;  4H0O A;  3MAQ A;  4OJR A;  2NZT A;  4BRM A;  3OYG A;  4BQL A;  4C1N I;  3SQ4 A;  3ZET B;  4YOY A;  1T05 A;  3LM2 A;  1J6Z A;  1N33 K;  3V81 A;  4B8C A;  3WNG A;  3CCL N;  2KKZ A;  4JK7 A;  4CZE A;  1IH7 A;  3ATV A;  5HOO A;  1HX1 A;  2P9K A;  3CYM A;  3UKR A;  2IGI A;  3FZK A;  3H3O B;  4FJI A;  3HL8 A;  2OTL N;  4CJF A;  4GV3 A;  1EWQ A;  3M5R A;  1BIS A;  1DLO A;  3VA3 A;  4B1U B;  1Z26 A;  4QAG A;  3K57 A;  1KLN A;  1S72 N;  4JI1 K;  3EE8 A;  3VQD A;  1NGJ A;  1TGO A;  1SKR A;  3G10 A;  1OVQ A;  1HQE A;  3LDS A;  1ASU A;  4HUF A;  3QB0 A;  5JVH L;  2Y1J A;  3B6P A;  2D0P A;  3F73 A;  4BRL A;  2LSN A;  4CZJ A;  3LWM A;  3E01 A;  3OW2 M;  4CBU A;  4YY3 K;  4E7I A;  3I0R A;  4YDU C;  3V1O A;  3GBT A;  1V4T A;  3U3G A;  1X3M A;  3ZT4 A;  3NH0 A;  4YOX A;  1S5J A;  5CYQ A;  3TAG A;  3ZCM A;  4BR4 A;  3HBT A;  4DFJ A;  4B1V A;  1ZBH A;  2G8I A;  2XY8 A;  4IZ9 A;  4B9M A;  3OTO K;  1GLE G;  4FO0 A;  3BY5 A;  3L4I A;  1HKG A;  3VEZ A;  3L3U A;  4OVL A;  3UKU A;  3WQU A;  4OPA A;  3QFU A;  4FJX A;  1TKX A;  2A41 A;  1KXP A;  3SQ0 A;  4Y1C A;  4FK0 A;  2E2N A;  1A5W A;  4FWM A;  5EY4 A;  3OYL A;  1JLE A;  1JL2 A;  4C8K A;  1NK0 A;  2OZS A;  3AY9 A;  3OYN A;  5JLF A;  4W5N A;  2Z1J A;  4BQZ A;  5GAD P;  1J9A A;  1GLA G;  4I9L A;  5BPN A;  1I94 K;  1U48 A;  2P5G A;  3PIO L;  1BL3 A;  4E7K A;  4AF1 A;  4DLE A;  1TKD A;  1LV5 A;  1X9J A;  3FZH A;  1HUX A;  3ULE B;  4DS5 A;  4B3R K;  3MN5 A;  4GY2 B;  4OLB A;  4JKE A;  2YHX A;  2H3G X;  4B08 A;  4B3M K;  3OYE A;  1K8A O;  1RBS A;  3LP3 A;  3V9S A;  4M3Y A;  1T6D A;  4E19 A;  4CGJ A;  1WSI A;  2IDO A;  1W9H A;  2HHX A;  1XWL A;  2IAJ A;  3O9S A;  3SBT A;  1CXU A;  5AQG A;  1NJY A;  4FWS A;  2O8B B;  4DU3 A;  5LJW A;  1Q9X A;  4FWR A;  4O55 A;  3AVH A;  3VA0 A;  3E9O A;  3K9J A;  3RRG A;  1W0H A;  4BWJ A;  2VWK A;  5MLC Q;  5FRN A;  3CFR A;  3E9L A;  3DRS A;  3DOK A;  4UQG A;  3E1Y A;  4BC3 A;  2HF3 A;  2KZM A;  3KKS A;  3S41 A;  4CFB A;  3IKM A;  4WCE L;  5AJ3 K;  5JVG L;  3OYC A;  2YNI A;  5HRP A;  4FLV A;  3HK2 A;  3NMU A;  2D4W A;  3MEG A;  4FWO A;  1XHX A;  3G25 A;  1RTH A;  2F96 A;  4ISF A;  4LY7 A;  4CFA A;  3EKU A;  4W5T A;  3KWI A;  1ZBF A;  3LDQ A;  1SL1 A;  5GAG P;  2YKM A;  3IMX A;  1WSE A;  1HMV A;  3QER A;  4A61 A;  1QHT A;  1K9M O;  4JNE A;  3RVC A;  4DS4 A;  1WSJ A;  1E4G T;  1IO2 A;  3CC7 N;  4CF1 A;  4FWP A;  4CEF A;  2ZQB A;  4CHO A;  4KI6 A;  2ITM A;  4CJV A;  4Z4I A;  3QNN A;  1VQK N;  3CD6 N;  3L2U A;  3GOI A;  4A59 A;  3ID8 A;  3AA2 A;  1VSI A;  3HOT A;  3TSU A;  3KLH A;  4JEP A; 
#chains in the Genus database with same CATH homology
 1BUP A;  3M3Z A;  3KVG A;  4R79 A;  1MA9 B;  3MWP A;  2NNW A;  2GWK A;  3O6W A;  2RHK A;  2YJE A;  4NO7 A;  1Q18 A;  1P90 A;  1NLV A;  2VCP A;  2V52 B;  4DCH A;  2E8A A;  1JCE A;  3WEE B;  3LDN A;  4MDB A;  2F7T A;  1TUY A;  3R9P A;  3I8B A;  3U8X A;  1O13 A;  3UE5 A;  1Y64 A;  2OAN A;  1NMD A;  3VTI A;  1VQ6 N;  4O5F A;  5M1N A;  2PAV A;  2QWL A;  3BUZ B;  4BRH A;  1ATS A;  2V7Y A;  1QZ6 A;  1U6Z A;  3O80 A;  3VF4 A;  3WXL A;  4F9O A;  4IO8 A;  5TKY A;  5C0Y A;  1VQ5 N;  3HM8 A;  3O9Q A;  3MX2 A;  4MO5 A;  4CI6 A;  5LJV A;  5DM6 L;  1T3V A;  4EFH A;  4MLE A;  5JIC A;  1BA1 A;  4PL8 A;  3CPE A;  4EHT A;  2FSN A;  2I7N A;  4YDU A;  5CR4 A;  5JMV A;  2HBL A;  5AZI A;  4A5B A;  1E4F T;  4IJN A;  3VEO A;  2PFU A;  1YJN N;  3SLC A;  2HBM A;  5GAH P;  3M6G A;  1BWF O;  4YOR A;  3L4Q A;  2HF4 A;  2QWQ A;  3CC4 N;  4IOC L;  3JS6 A;  1OKJ A;  4IOA L;  4BRI A;  3G71 N;  2GEL A;  3H3N O;  4KBO A;  3ATU A;  5AFU A;  3VEV A;  4BC2 A;  4BGB A;  3ENB A;  3AAP A;  3VEW A;  5KPR A;  3G4S N;  3SK3 A;  5AQQ A;  1VQ8 N;  2BH1 A;  2DPN A;  2CGK A;  3VET A;  5GAE P;  3UKU B;  2WBN A;  3SAF A;  1TYQ A;  3FZM A;  3UB5 A;  3WXJ A;  2P9U A;  4CZL A;  4H0P A;  2W40 A;  4XH5 A;  2QM1 A;  3DLL L;  3ENH A;  4JHD A;  1W2B M;  5AQF A;  2ZGY A;  1KQS M;  1VQN N;  4YOU A;  3IUC A;  1BO5 O;  3D2F A;  2P9P A;  3D7E O;  1ATR A;  3H1Q A;  3VER A;  1CZA N;  1NGD A;  3WXK A;  5AQL A;  1GLD G;  3W0L A;  4EAH D;  4H03 B;  4EHU A;  2NLX A;  4JKB A;  5LY3 A;  1XC3 A;  1YUW A;  4E1J A;  3QDK A;  5GIP A;  3CCQ N;  2ASO A;  3C6A A;  4JKC A;  1C0F A;  3EO3 A;  4ISG A;  5BPM A;  4YOV A;  3L0Q A;  3DJC A;  2CGL A;  3ZEU B;  4XH1 A;  2WFB A;  4NB4 A;  2P9L A;  4GVE A;  4RTF D;  3VEN A;  1DT9 A;  2P9I A;  2WC9 A;  4XEI A;  5E84 A;  3DAW A;  3VGM A;  1VQO N;  2HST A;  5F0X A;  4LC9 B;  1NGF A;  4B1Y B;  3A8Y A;  4PKG A;  2P9S B;  4IWV A;  4G9Z A;  2HBK A;  4FWL A;  3O9T A;  2ZJR L;  4GV6 A;  3ID6 A;  3CF5 L;  1VQ9 N;  4BRQ A;  1NBW A;  2A5X A;  3F2K A;  4WQ5 C;  1NGI A;  2GWJ A;  5AQS A;  2P9N B;  5FPE A;  1YAG A;  4H5V A;  4CD3 A;  2NRH A;  2WUS A;  4Y0W A;  2FSK A;  5EVZ A;  3CCS N;  3VEX A;  3FE1 A;  2E2P A;  3DXM A;  4A57 A;  4ISE A;  4DKW A;  4IDH A;  5I9E B;  2ZJQ L;  2Q2R A;  3ZYY X;  4BG9 A;  4FWQ A;  2QWR A;  4FSV A;  3P4I A;  2E2O A;  5AQN A;  3EZW A;  3TU5 A;  4A2B A;  1TYQ B;  4C1N K;  1MWM A;  2YX6 A;  1U2V B;  4JHD B;  5AQI A;  3VEY A;  3FGU A;  1D4X A;  1ZXO A;  2VYP A;  1GLL O;  3OBW A;  1QHA A;  4K41 A;  4BR0 A;  1GLJ O;  5C12 A;  1NGC A;  4FWK A;  3A5N C;  1M1K O;  4I6M A;  3TPQ A;  2P9P B;  3CME N;  2NRX A;  4C23 A;  1KC8 O;  4K25 A;  3ZET A;  3ENO A;  2YCH A;  2VGN A;  3FZL A;  3KHY A;  2NRR A;  4CZG A;  3KWG A;  1T44 A;  2CH6 A;  1HJO A;  1S3X A;  1TUU A;  3CI5 A;  3MWT A;  3ULE A;  3ZX0 A;  4BGA A;  3A0I X;  1QVF M;  5ADX A;  2IIR A;  5KPZ A;  5F2R A;  4GNI A;  4PKH A;  4WFN L;  3P31 A;  4CZF A;  3Q7B A;  3K9K A;  4JK9 A;  3O9U A;  4NLB A;  2QW9 A;  3ZX3 A;  4BRA A;  4H0V B;  4YOW A;  2ZGZ A;  2A6A A;  3J8A A;  2P9L B;  1YJ9 N;  2E20 A;  3CJA A;  4JD2 A;  3CCM N;  3QIC A;  5F1X A;  1YXQ A;  4DQ8 A;  3CET A;  2FXU A;  3O9R A;  4QS7 A;  2FSJ A;  1SS6 A;  1YIJ N;  4K43 A;  3F9M A;  5AQP A;  2W41 A;  5AR0 A;  2JWL A;  3CC2 N;  4MO4 A;  1JCF A;  4O8K A;  3CIP A;  3PLA A;  5M1Q A;  3MDQ A;  4BR9 A;  3T69 A;  4AM6 A;  2QWP A;  3CJB A;  3KK7 A;  2E1Y A;  3R6M A;  2FLO A;  3IFR A;  3HOS A;  3TTF A;  4PHT X;  3MCA B;  4RCH A;  1NGG A;  1T6C A;  3GL1 A;  4FWN A;  1Q86 O;  3CJ7 A;  4FOE A;  3MCP A;  4JN4 A;  4EIA A;  2QXL A;  3NVK A;  5KPT A;  3CER A;  1NGE A;  1QVG M;  2NRT A;  3R1X A;  3Q7C A;  2E2Q A;  1S22 A;  2V51 B;  3GG4 A;  5EOY A;  4RWT A;  5CHI A;  2KHO A;  1ESV A;  2QA4 N;  3G6E N;  4DB3 A;  3E66 A;  4H0T B;  3A5L C;  5H1S Q;  4NLC A;  1R59 O;  4K42 A;  1YHQ N;  1EO1 A;  4H0O A;  3SJH A;  3P39 A;  2NZT A;  3VF2 A;  4BRM A;  2QI2 A;  3FLC O;  1YJW N;  5AQJ A;  4BQL A;  3CPW M;  4C1N I;  2GUP A;  3H45 C;  4BRD A;  3ZET B;  4YOY A;  1DGK N;  1J6Z A;  3LM2 A;  4ILG B;  1G99 A;  2FF3 B;  3T7Z A;  1YIT N;  4JKG A;  3RSE A;  4FL9 A;  5FPN A;  3CMA N;  1Q7Y O;  3KZB A;  1OVY A;  4IEE A;  3CCL N;  2KKZ A;  3TSQ A;  3EKS A;  3F5T A;  4JK7 A;  4WYB A;  4CZE A;  5M1P A;  2E88 A;  3ATV A;  3OHR A;  5HOO A;  1HX1 A;  3CJC A;  2PBD A;  2A3Z A;  2QWM A;  3IDH A;  4H0Y B;  5AFU H;  4BRK A;  1DKG D;  2P9K A;  1SAZ A;  3WXM B;  4CZK A;  4JD2 B;  4H5R A;  4CZH A;  1K73 O;  1N8R O;  3U9D A;  3UKR A;  3FZK A;  3C0B A;  3EL2 A;  3H3O B;  1SQK A;  2A40 A;  4IJA A;  3AGR A;  5AZJ A;  1NM1 A;  3OA9 A;  4YOT A;  2CH5 A;  3LDO A;  3VMF B;  3WUH A;  5JLH A;  2OTL N;  3C7N A;  1GLB G;  4GV3 A;  1NGH A;  3R3L A;  2RE2 A;  2Q36 A;  3C65 A;  1GLF O;  3M5R A;  3O5B A;  5BRH A;  1RGI A;  5FPM A;  5EXW A;  5KQD A;  3U9Z A;  3U4L A;  3I33 A;  4B1U B;  1BOT O;  1QQM A;  5B8H A;  3O1B A;  3H6E A;  2F9W A;  3HI0 A;  4ILH A;  3CJ9 A;  3BF1 A;  5AZI B;  1YI2 N;  1S72 N;  2ZWH A;  2ZF5 O;  3AAR A;  3WXI A;  3D6R A;  3EE8 A;  3VF6 A;  1LCU A;  1NGJ A;  2YHY A;  3QFP A;  3TTD A;  4FPA A;  4B1Z A;  5AQR A;  4Z94 A;  1ILY A;  3LL3 A;  2QWN A;  3QB0 A;  5GIN A;  5JVH L;  4BRC A;  3A5M C;  3W3D A;  3NVM A;  5BRE A;  4FVU A;  4JKF A;  1VQ4 N;  2D0P A;  3WT0 A;  4BRL A;  4CZJ A;  5AQZ A;  3MK6 A;  1MWK A;  1YVN A;  2GEM A;  5BR9 A;  5EX5 A;  3GE1 A;  3OW2 M;  4CBU A;  3VES A;  3CCJ N;  3O1W A;  1NGB A;  1HPM A;  3LM9 A;  2P9U B;  3C6H A;  4JAX A;  3DWL A;  4YDU C;  3BP8 A;  3GBT A;  1V4T A;  4CD1 A;  1X3M A;  4JKG B;  5AQM A;  4A5A A;  4YOX A;  4A2A A;  1Q82 O;  3CCR N;  3D2F B;  1RDU A;  1K8K A;  1RDW X;  3AGK A;  5AQT A;  2ASM A;  4BRO A;  4PKI A;  5AQY A;  4BR4 A;  3HBT A;  1H1V A;  4CBX A;  5E26 A;  4B1V A;  4U7B A;  3VPZ A;  2BTF A;  3HZ6 A;  1HLU A;  1ATN A;  1IG8 A;  4J8F A;  4IZ9 A;  5ELZ A;  2HBJ A;  4B1X B;  4BR7 A;  3MN7 A;  3CCV N;  5AZJ B;  2AP1 A;  5TKW A;  4BVO A;  5BRD A;  4M63 C;  1GLE G;  4FO0 A;  2I7P A;  2NRZ A;  3L4I A;  3MN6 A;  1BDG A;  1HKG A;  2Q97 A;  2NRV A;  2P9I B;  1YF5 L;  3HRG A;  4FPB A;  1LOT B;  4BRG A;  4L3Q A;  3J7Z O;  1Q81 O;  2YI1 A;  4BY9 C;  4MDA A;  1NWK A;  3VEZ A;  2IVN A;  3UKU A;  3WQU A;  4B1W B;  4OPA A;  4BRN A;  3QFU A;  3M1F A;  3DXK A;  4CZI A;  3I56 N;  2A41 A;  1GLC G;  4JKH A;  4CZM A;  1KXP A;  2VWB A;  3A5O C;  3BEX A;  5AQW A;  4BR5 A;  5ADX H;  4FOI A;  4XH4 A;  3VOV A;  4H5T A;  5M1F A;  1IJJ A;  1W97 L;  3MX5 A;  4OPH A;  4BR2 A;  5C2F A;  2D1K A;  2YHW A;  2E2N A;  4BRF A;  5DM7 L;  4FWM A;  4WQ5 A;  5EY4 A;  4DHY A;  2A42 A;  4WFA L;  3AY9 A;  3MMV A;  1V4S A;  3DXM B;  1QZ5 A;  4ILJ A;  3R8E A;  5JLF A;  2NRW A;  3CQX A;  2ASP A;  1Z6R A;  2QWO A;  1BU6 O;  3VGK A;  3ZEU A;  1XUP O;  4WF9 L;  3GDQ A;  4IOX A;  3D2E A;  4QS9 A;  4BQZ A;  1QQN A;  1GLA G;  5GAD P;  3E9P A;  3SAG A;  2IVP A;  3CXC M;  2CGJ A;  5BPN A;  2BUP A;  2P9S A;  4OO1 J;  2HMP A;  1RFQ A;  5BRF A;  4I6M B;  1K8K B;  4M7Y A;  3PIO L;  4QS8 A;  4H5N A;  1VQ7 N;  5HL7 L;  3WQT A;  4MLH A;  4GV9 A;  1X3N A;  2HOE A;  4AF1 A;  5GIO A;  3N4P A;  1X9J A;  2D0O A;  1QQO A;  3FZH A;  1HUX A;  2P9N A;  3EN9 A;  1WUA A;  3ULE B;  3LDP A;  3MN5 A;  4GY2 B;  4JKE A;  3BF3 A;  4WQ4 C;  4AM7 A;  2YHX A;  1HKB A;  2H3G X;  3L6Q A;  3TTC A;  5C2D A;  1KD1 O;  4BVP A;  1K8A O;  4KH5 A;  3OBY A;  2AA4 A;  1T6D A;  4IEI A;  4BC5 A;  4CJ7 A;  1VAZ A;  1Z05 A;  4CBW A;  3QBW A;  3SMP A;  4BRP A;  3SBG A;  5AQV A;  5KQ8 A;  4BRE A;  2Q31 A;  5AQK A;  2E1Z A;  1U2V A;  3O9S A;  3SBT A;  3DXK B;  5AQU A;  4IFE A;  2GX9 A;  1WOQ A;  2Q1N A;  3EE9 A;  5AQG A;  5AQX A;  1NJI O;  2UYT A;  4HWI A;  1BG3 A;  2YJF A;  4FWS A;  5FPD A;  2F9T A;  5LJW A;  3HSC A;  3O8M A;  3CJ1 A;  2Q0U A;  4FWR A;  1ZBS A;  4U67 L;  5BN8 A;  2FF6 A;  3CCE N;  4IO9 L;  4M7X A;  3E9O A;  2J4R A;  3K9J A;  5AQH A;  1HKC A;  3SAH A;  3N4Q A;  5MLC Q;  1P8Z A;  3FFK B;  1NGA A;  4H5W A;  4BC4 A;  3E9L A;  3I55 N;  3QML A;  3E1Y A;  3WEE A;  4BC3 A;  4JK8 A;  4UY8 O;  1XQS C;  1MDU B;  3SMS A;  1VQM N;  2HF3 A;  1C0G A;  3CCU N;  4KH6 A;  3FZF A;  3D2E B;  3S41 A;  3IKM A;  4WCE L;  2EWS A;  5JVG L;  3PIP L;  5BPL A;  1VQP N;  3NMU A;  2D4W A;  2KLA A;  3MN9 A;  3VGL A;  1KAX A;  3QBX A;  1KAZ A;  2OTJ N;  3CQY A;  4FWO A;  4HTL A;  3HTV A;  3G25 A;  4KH4 A;  3H1V X;  4ISF A;  3EKU A;  3O08 A;  3KWI A;  2Q0R A;  2V7Z A;  2IVO A;  5CE3 A;  3AAQ A;  1JCG A;  4A62 A;  2QTD A;  5AQO A;  3LDQ A;  5M1O A;  3RSE B;  5GAG P;  1SZ2 A;  3IMX A;  4BG8 A;  3TSP A;  3FR0 A;  4JKA A;  4PL7 A;  1JJ2 M;  4A61 A;  1K9M O;  3JXU A;  4JNE A;  2ZJP L;  2GTD A;  3RVC A;  2VGM A;  1VQL N;  4WQ4 A;  2P9K B;  1ZC6 A;  1E4G T;  3LDL A;  3CC7 N;  4FWP A;  3VTH A;  3UKR B;  3ZX2 A;  5BN9 A;  5C10 A;  1DEJ A;  2QEX N;  2ITM A;  5M1K A;  3P38 A;  3C7N B;  1KAY A;  5C15 A;  1BA0 A;  1VQK N;  3CHW A;  1M90 O;  3CD6 N;  3O4W A;  1EQY A;  3GOI A;  4A59 A;  3B8A X;  4H0X B;  3ID8 A;  4JKD A;  4IXC A;  3HOT A;  3H46 O;  4O8U A;  4WFB L;  3TSU A;  4B9Q A;  2JWK A;  4JEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...