1Q18A

Crystal structure of e.coli glucokinase (glk)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
320
structure length
320
Chain Sequence
TKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQTLGHIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glucokinase
publication title Crystal structures of Escherichia coli ATP-dependent glucokinase and its complex with glucose.
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.7.1.2: Glucokinase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02685 Glucokinase Glucokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1q18A01
3.40.367.20 Alpha Beta 3-Layer(aba) Sandwich Hexokinase; domain 1 Hexokinase; domain 1 1q18A02
4JHDA 1X9JA 1XUPO 2E20A 1TUYA 4H5RA 2E2OA 4DHYA 4BG8A 2E2QA 4EFHA 1BA1A 3GE1A 5AQWA 3WXLA 1X3NA 4FWMA 2QM1A 2A5XA 3DXMA 4FWOA 1OKJA 4RWTA 3GG4A 3O1BA 5KQ8A 5FPDA 5AQRA 2AP1A 1U2VB 1SQKA 4BRDA 4BRCA 4BRHA 3MN7A 1EQYA 3GL1A 4B1VA 3ULEB 2P9SB 4M7YA 1D4XA 3HZ6A 3O08A 3A5OC 3MN9A 3LM9A 4IXCA 3MCPA 3VF6A 3CJAA 2VCPA 3TU5A 3UKRB 3O6WA 3KZBA 1XC3A 2P9PA 3KHYA 2CGKA 3QFPA 4DQ8A 2FLOA 3LDPA 4BC4A 4JAXA 4H0YB 5BREA 2FSNA 3U4LA 3CQYA 2Q0RA 1QQOA 3A5MC 4B9QA 1GLAG 4FSVA 4KBOA 2CGLA 3D2FB 3FZKA 4M7XA 1U2VA 2GWKA 5CE3A 3EKUA 1IJJA 4K43A 5JICA 5BRHA 2E1YA 3WEEB 5F2RA 5EXWA 2F9TA 4BRPA 4BQZA 4FOIA 2YI1A 5AQPA 5KQDA 4A62A 2KHOA 1RDWX 4H0VB 3UKRA 3SMSA 2FSKA 4E1JA 3HM8A 3VOVA 4BVOA 1GLLO 3L6QA 4XH1A 1DEJA 3GBTA 5EX5A 3FLCO 1BU6O 4BRIA 3O1WA 2D1KA 5AQFA 2P9KA 1Y64A 2GWJA 2PAVA 2ITMA 4BRAA 1XQSC 5ADXA 3EKSA 4EIAA 5EVZA 4A2BA 3CERA 3D2FA 1ATSA 1GLEG 4IWVA 4CZGA 2CH6A 4O5FA 3WXKA 4I6MB 3MMVA 2E88A 3IFRA 4FL9A 5KPRA 3VGLA 3ZX2A 3VEWA 3R8EA 3LDQA 2W41A 5AQQA 3QMLA 1Z6RA 3EZWA 1GLDG 2EWSA 5AR0A 1TYQA 2YJFA 4FWNA 2FF6A 3FR0A 5ADXH 1X3MA 2D0PA 4MO5A 1MWKA 3W0LA 1GLCG 3ZETA 2E2NA 1NMDA 3MDQA 1NLVA 2HF3A 3FGUA 5AQVA 5JLHA 3SLCA 3VEXA 4BRQA 1BUPA 4CD1A 3VENA 2YHYA 3ZX0A 4IO8A 3AAPA 3VETA 4K41A 5FPEA 1E4GT 4BGBA 2QWMA 2ASMA 3FZFA 2A6AA 1MDUB 3MN6A 3L4IA 2ZF5O 2IVNA 5AQYA 5BN9A 4I6MA 5AQJA 4EAHD 1ESVA 5E26A 1G99A 3HTVA 3VF2A 3IDHA 1NWKA 2QXLA 3WUHA 3O4WA 4BROA 3O80A 1BDGA 3D2EA 3MN5A 4NB4A 4QS9A 4FO0A 4BRLA 1TUUA 3DJCA 3FE1A 1QZ5A 4H5VA 2V51B 4F9OA 1HX1A 2QW9A 5AQUA 1HPMA 2VWBA 3D7EO 3S41A 1BO5O 3VEZA 2V52B 5KPZA 3CJCA 3WQTA 4EHTA 1MWMA 4PKIA 4A2AA 4FWSA 3C0BA 1HKGA 4QS7A 2GTDA 3CI5A 4JN4A 4CJ7A 3M1FA 4PL8A 2YHWA 1C0GA 3C7NA 4IJAA 3IMXA 4H5WA 3CJBA 4M63C 1NM1A 1JCEA 3H3OB 2GEMA 3WT0A 1HUXA 4J8FA 5F0XA 2P9KB 3I8BA 5JMVA 3EL2A 4HTLA 3BEXA 2IVOA 1BWFO 1NGEA 4FWKA 4Z94A 1LCUA 1HKCA 4GNIA 5AQHA 4CD3A 3MK6A 4YDUA 3GDQA 4H0OA 2QWQA 2ZWHA 1YXQA 3FFKB 3QBXA 5AZIA 4MLEA 4GY2B 4YDUC 4BR4A 3H6EA 3CETA 4XEIA 3SJHA 4CZMA 1ZC6A 1HLUA 2D0OA 1T44A 3EO3A 2ASPA 2CGJA 5AFUA 2GUPA 4QS8A 1R59O 1TYQB 1BOTO 1E4FT 2DPNA 3AAQA 5I9EB 1V4SA 3ZETB 3VERA 4FPAA 3U9DA 3BF1A 1NGCA 4DCHA 1Q18A 4XH5A 4H5TA 3CIPA 3EN9A 1YVNA 2HF4A 4BREA 4JD2A 5F1XA 4FWPA 4B1XB 4DB3A 3G25A 3ZEUB 3QICA 3VEYA 2UYTA 5B8HA 2YJEA 3WXJA 5JLFA 3TPQA 5AFUH 3CJ7A 3QBWA 1ATNA 2W40A 1GLFO 1SAZA 3DWLA 3HSCA 1S22A 3CQXA 3LL3A 4MLHA 3HI0A 3LDLA 3D2EB 4WQ4A 4BQLA 3FZMA 4H0XB 5BPMA 3UE5A 5BRDA 5AQOA 1NGJA 5AQTA 4BG9A 1Z05A 1LOTB 1IG8A 4B1WB 5BPNA 1P8ZA 4BC5A 4FWLA 2Q1NA 4CZIA 3OHRA 3SK3A 3M3ZA 4PKHA 3WXIA 1U6ZA 3AY9A 4BR2A 2CH5A 2P9NB 4BR7A 2PBDA 3CJ1A 1KXPA 4FPBA 3VESA 4PKGA 1BG3A 2A40A 2P9LA 2V7ZA 3FZHA 4FWRA 3UKUA 3VGMA 1SZ2A 2P9UB 1K8KA 4ISEA 1H1VA 2YHXA 3C7NB 2QWPA 4JNEA 4WQ5A 2P9IB 2Q2RA 3ZEUA 2ZGZA 4K25A 3AARA 3UB5A 4AM7A 3IUCA 3KVGA 1YAGA 3I33A 1V4TA 4BRMA 4CBWA 1NGHA 1QZ6A 2QWLA 3BP8A 5LY3A 1YUWA 3P4IA 5AZIB 3RSEA 5AQIA 4BGAA 2H3GX 1KAZA 2Q36A 1BA0A 1ZBSA 1QQMA 3JXUA 2FF3B 3W3DA 3H3NO 1T6CA 3GOIA 2P9NA 3A0IX 4WYBA 3LDNA 4CI6A 4EHUA 4BRFA 5LJVA 4FWQA 2FSJA 4O8KA 4CZEA 1NBWA 2P9UA 1KAYA 3F9MA 4NO7A 3ZX3A 3H46O 4BR9A 2P9IA 4CZKA 2IVPA 4CZLA 4ISGA 4H03B 4JD2B 3VEVA 2A41A 1QQNA 1GLBG 1HJOA 4AM6A 2ZGYA 5FPMA 3VF4A 2NZTA 1DKGD 1T6DA 4H5NA 1NGIA 1ATRA 2J4RA 2GELA 3CJ9A 4ISFA 4RCHA 3WQUA 5AQMA 1DGKN 5BPLA 1RFQA 2FXUA 1ZXOA 1QHAA 4BRGA 4XH4A 3M6GA 4B1ZA 2NLXA 1MA9B 2Q31A 5AZJB 2ASOA 2Q97A 4C23A 3ENOA 4H0TB 5EOYA 3HBTA 1S3XA 3L0QA 5AQNA 3B8AX 1JCGA 4CBXA 2E1ZA 4BC2A 4CZJA 3ATVA 3U8XA 5TKYA 1J6ZA 3A5LC 4MO4A 3VGKA 5AQXA 2P9LB 3QB0A 3R6MA 2QWRA 3UKUB 3ULEA 2P9SA 4Y0WA 2I7NA 4BRKA 1K8KB 2F9WA 1NGGA 5E84A 3QDKA 3J8AA 3A5NC 2I7PA 4K42A 4IJNA 4CZHA 1CZAN 3SMPA 5FPNA 2YCHA 3R9PA 1NGDA 4FOEA 4HWIA 3DAWA 2HMPA 2E8AA 4B1UB 5ELZA 3LDOA 3DXKB 1HKBA 3A8YA 3ATUA 3LM2A 4BR0A 5AQKA 4LC9B 1KAXA 5AQZA 1C0FA 2OANA 2HOEA 5AZJA 2QWNA 5AQSA 5BN8A 3O5BA 4PL7A 1WUAA 3RSEB 3VPZA 3ENHA 3H1VX 4IZ9A 4JHDB 3JS6A 5LJWA 4BVPA 3FZLA 2WUSA 4WQ4C 4BRNA 5EY4A 3H45C 2QWOA 5KPTA 1JCFA 3U9ZA 1NGBA 3DXMB 4RTFD 1GLJO 4CBUA 3WEEA 2BTFA 3QFUA 3VEOA 4CZFA 2BUPA 4BC3A 2A3ZA 4A61A 4BR5A 4L3QA 3ID8A 1NGFA 5BR9A 4H0PA 3H1QA 2E2PA 3BF3A 1NGAA 3CHWA 2D4WA 2VYPA 5AQLA 5AQGA 2A42A 4WQ5C 2IIRA 5BRFA 3DXKA 2NRHA 1RGIA 2V7YA 4B1YB 3BUZB 2Q0UA 1WOQA 3O8MA 2P9PB 2AA4A
chains in the Genus database with same CATH superfamily
3K5OA 4JHDA 2HHWA 2ZJQL 5LMNK 4H5RA 1S5JA 2E2QA 2P5GA 1RBVA 3LALA 3WXLA 3WNEA 1X3NA 4Y1DA 2QM1A 4FWOA 1OKJA 4CFCA 1IBLK 4ID5A 3VQDA 5KGWA 3V4IA 3VQ8A 1KC8O 2NUBA 5FPDA 5AQRA 1X9MA 4ZHRA 4BRDA 1YJWN 4FJIA 4BRCA 3AO3A 1NJXA 3GL1A 3MXMA 3KKRA 4DUZK 4FLWA 1HMVA 5C2DA 4IXCA 3HPOA 3OTOK 1JLQA 3AVIA 2VCPA 3OYHA 4KO0A 4BC4A 3ZCMA 5BREA 5HRNA 1WBDA 4FLXA 2FSNA 1M90O 4BE1A 3U4LA 1JLGA 1QQOA 2Q0RA 3SBTA 4B9QA 4W5TA 3V9SA 3T69A 1RNHA 3OY9A 3D2FB 4GV3A 2A1RA 3AA3A 3DYAA 4DU3A 2GWKA 1YJ9N 5JICA 2ATQA 2E1YA 3OS2A 3M8RA 2QEXN 3KTQA 1X9WA 4OPKA 3KWGA 4DTOA 1D9DA 1EP4A 1VQ4N 3SUNA 2Z1GA 3S3OA 3PY8A 3V9WA 2YV0X 3CFOA 3VOVA 4H4OA 1HQUA 3QERA 1KTQA 2WOMA 3NGZA 3MAQA 3TAQA 1VQKN 5KGXA 2XHBA 4BRAA 3E9OA 4CJUA 5EVZA 4F3OA 4A2BA 1NG9A 4FCYA 1XHXA 4CZGA 1LV5A 2CH6A 4FLUA 3PV8A 3V9XA 1KLMA 4CJRA 4FL9A 1W7AA 2O8BA 3ZX2A 4IG0A 5C12A 3R8EA 3S3MA 4DLGA 3HOSA 4AF1A 2YKMA 3HPHA 1Z6RA 1BIZA 1N5YA 3FR0A 1TL1A 3BZCA 5ADXH 1NMDA 1NLVA 2HF3A 3FGUA 5JLHA 4B9NA 4BRQA 2QKBA 4K8XA 2UXBK 5HRRA 3AGRA 3M8QA 3ZSWA 1NJZA 1QTMA 4IO8A 4FJNA 2QI2A 1E4GT 4BGBA 4JK9A 3FZFA 1JJ2M 1IKVA 2A6AA 4NXNK 3MN6A 4LF8K 4YOXA 3NBPA 2FBVA 4B3MK 4X66K 3K5MA 1UWBA 3HOTA 3WUHA 4JI1K 4BROA 3E1YA 3OS1A 2ZJPL 3D2EA 4NB4A 5DK5A 4QS9A 4CHZA 3J80O 1U4BA 4A59A 4M3XA 1BI4B 5DM6L 1QZ5A 1CXUA 4H5VA 4FJ7A 2E6LA 3AV9A 2FC0A 3F73A 5KPZA 3CJCA 1YIJN 3K9JA 1LAVA 1SUQA 3OYBA 3LWLA 4PKIA 4A2AA 3C0BA 1HKGA 4AHCA 3PUFA 3CI5A 1LWEA 4DTPA 3M1FA 1TGOA 2BANA 1C0GA 1YF5L 3PX6A 3ZSZA 3SUPA 1YITN 2Z1IA 4J8FA 5F0XA 3BY5A 1T7PA 3K2PA 5JMVA 4CJSA 1VQ7N 3I56N 2IOCA 4F8RA 4FWKA 3QNNA 1OVQA 4UQGA 4DUYK 3GDQA 4H0OA 4M45A 3FFKB 4G9ZA 5AZIA 4BR4A 3MXJA 4DFJA 2OPPA 2HHXA 3SAFA 1JLFA 2D0CA 1T3VA 2ASPA 4PA1A 4BDZA 3EE9A 1TYQB 2RE2A 4EP5A 4JI0K 3UIQA 3HVTA 1V4SA 4FPAA 4C8NA 4DTUA 3SUOA 1C1CA 4K8ZA 1NGCA 1WN7A 3OYIA 3I8DA 2OZSA 4E19A 5FROA 3TARA 4KI4A 4A5BA 4H5TA 3Q7CA 4JD2A 4DSLA 1JXBA 3QICA 1RT2A 2UYTA 2XY6A 1KFSA 1EETA 5HL7L 3CJ7A 5GAEP 4FM2A 2W40A 3LPTA 4E1MA 1TVRA 1SAZA 3E01A 5C24A 4C8OA 3LP3A 3E66A 3DWLA 1NJWA 3HSCA 3HI0A 1ZBLA 2D0AA 1RT1A 3F9KA 4CK3A 4H0XB 3C6UA 5AQOA 1LOTB 1IG8A 1N32K 1RTIA 2Q1NA 4AH9A 1T03A 3M3ZA 3T1HK 1NJIO 1VQ5N 4BR2A 3VQBA 4BR7A 3OYNA 2NRWA 4JLHA 3V9ZA 3TI0A 3TAPA 3VGMA 1K8KA 1Z26A 3QLHA 2HHTA 4WQ5A 4I2PA 3PO4A 4FXDA 3O9UA 4AM7A 3MWPA 4B9VA 1JLEA 3G10A 1TAUA 4FK0A 4JI8K 4CBWA 3NVKA 1YVUA 4YNQA 4JKDA 1QZ6A 1WSJA 3KKSA 2QWLA 4DFKA 5LY3A 1QHTA 1K9MO 3P4IA 2UUAK 4E7JA 5AQIA 4JRPA 1B9DA 2QKKA 4V19S 1IKWA 3OS0A 1BA0A 1QQMA 2FF3B 2EX3A 4JKEA 1T6CA 1WSFA 3RMDA 2P9NA 1RDDA 4WYBA 3LDNA 4EHUA 1M1KO 3IG1A 5LJVA 4FLZA 4A57A 1CXQA 3OJSA 4O8KA 4CZEA 4YHHK 1QS4A 1NBWA 3IS9A 2JGUA 3SQ4A 3QEXA 3H46O 4JV5K 4BR9A 2P9IA 4GKKK 2IVPA 4JKAA 3SV3A 4B3OA 4ISGA 4H03B 3AO4A 3THXB 4DV3K 1K8AO 4CGIA 3NF9A 3VF4A 3QEVA 2RF2A 4I2QA 4H5NA 1Y97A 1QVFM 2J4RA 3CJ9A 4ISFA 2VG7A 4OLBA 1DGKN 3SBGA 4JKGB 4B1ZA 2NLXA 1T05A 2OPQA 2KW4A 2Q97A 3T1AA 1SKRA 4C23A 2WTUA 4H0TB 1NK5A 3PSIA 3RVCA 4GVMA 1VSLA 3AVLA 5J2QA 1JCGA 2E1ZA 4CZJA 3V1RA 3R1XA 3A5LC 4RW6A 5AQXA 1C0TA 4CECA 3ZT0A 4CESA 4IOCL 4BE2A 2I7NA 4JEPA 2JLEA 3QDKA 4J2AA 3OYDA 3MX2A 3R9PA 3VQ6A 3B6PA 2HMPA 3AA4A 1J5OA 3DXKB 4YORA 3V9UA 4AQYK 1ASWA 4JI2K 4LC9B 3C6TA 5AZJA 2QWNA 5AQSA 3SYZA 4AHRA 3RSEB 4IZ9A 3JS6A 2WUSA 4WQ4C 4PWDA 4CEQA 3U9ZA 2DFFA 3L8BA 3DXMB 3JSMA 2BTFA 3VEOA 3ASMA 4BC3A 3KLGA 2ZD1A 4JYAK 4M3RA 3VTIA 3CCSN 4QAGA 3SI6A 1HRHA 1ZBFA 3O3FA 1Q9XA 2V7YA 4N41A 3BUZB 3THVA 4I9QA 1X1PA 2Q0UA 3HVRA 2P9PB 2AA4A 4EZ9A 1ZBIA 4AHSA 4O5BA 4Z4EA 3ZT1A 4DHYA 4BG8A 5HRPA 5AQWA 4CJKA 2A5XA 4W5QA 3GG4A 5KI6A 2G8KA 3TAFA 1SQKA 3ZSVA 4BRHA 1REVA 3CM5A 3THWB 4MDBA 3HM9A 1EQYA 3DLGA 4O0JA 4LFAK 3HZ6A 2O8EB 3O08A 3MN9A 3LM9A 3VF6A 2G8VA 1QE1A 3CJAA 4HVJA 1MU2A 3TAMA 3TU5A 3UKRB 3AVMA 3D45A 4DTNA 3QFPA 4ID1A 1BGXT 4B8AB 4JAXA 4YOWA 1LAWA 1NKBA 4KHWA 2HSTA 4IOXA 3DLEA 3CQYA 1U47A 3J7YP 3VQAA 4CIGA 3A5MC 4KH6A 3L3UA 1A5WA 5I42A 1GLAG 4FSVA 1A5VA 2UXDK 5HRSA 4KH5A 1U2VA 1IJJA 3N4QA 4JKFA 2OPSA 3WEEB 3WXMB 1BI4A 1WBBA 1KSPA 2YI1A 4GVEA 5AQPA 1HJRA 3KLEA 3MECA 3TSQA 1VQ6N 4MQ3A 2HB5A 4A62A 1RT7A 4B9MA 4HHTA 1C1AA 3SMSA 3CCEN 4W5OA 4BVOA 3OBWA 1GLLO 1DEJA 3OYMA 3FLCO 3HXMA 1RILA 1NKCA 2D1KA 5AQFA 3PIOL 1K6YA 3PX4A 1LW2A 2ITMA 1SL0A 4RW8A 3EKSA 5HLFA 2VGMA 3MCAB 1GLEG 4KHPK 4K0KK 4E7HA 3I55N 4O5FA 1BIUA 4I6MB 3DLLL 1NNEA 3VGLA 3LDQA 3BGRA 4F4KA 1S9GA 3T3FA 4CJTA 1WSGA 2EWSA 3IAYA 1TYQA 1S1VA 2FF6A 1HQEA 1GOAA 4KHNA 1MWKA 1GLCG 1RBUA 2ZQBA 3RMCA 4JI6K 5AQVA 3CMEN 4KB1A 3SLCA 4E7KA 3DRSA 1G15A 4E0DA 1BUPA 3TSPA 4JRQA 1RT6A 4YOYA 3AAPA 4Q5VA 5FPEA 2RHKA 3O9QA 2QWMA 2OCEA 2ASMA 1Q82O 5CY4A 4CEZA 2G8HA 4OO1J 1NOYA 1KVAA 3E9LA 3AA2A 5AQYA 2AJQA 1G99A 3KLIA 5JS1A 1YT3A 4JK7A 3KD5E 1B9FA 1RDAA 1VQ8N 4BRLA 1TUUA 1BHLA 4YOVA 4BE0A 2V51B 3KK2A 2QW9A 3WNFA 3OYFA 3AVFA 3D7EO 1BO5O 3AVAA 1JLAA 1FK9A 1HNVA 2EHGA 4FWSA 2DTUA 4QS7A 2HNZA 4CJ7A 3HRGA 4DR2K 1J5EK 4PL8A 4U67L 1L3UA 3BDPA 1VSDA 4H5WA 4DV0K 2HHUA 4ELTA 1NM1A 1JCEA 2KKZA 4OGEA 3WT0A 5D3GA 3I8BA 4ELUA 3BEXA 4O0IA 1BWFO 1NGEA 4Z94A 3SQ1A 1NK8A 1LCUA 4CF2A 1NJYA 4YDUA 5CZ2A 2ZWHA 3QBXA 1YXQA 4F2SA 2F8SA 4MLEA 3THYA 4YDUC 3CETA 3P83D 4CZMA 1ZC6A 4M3YA 4KREA 4M3TA 4OKKA 1T44A 3V81A 3CCRN 3QESA 2CGJA 5AFUA 2Y1JA 1VQPN 2YHAA 4RW9A 5I9EB 5M1PA 3VERA 1VSJA 3CC7N 3BF1A 2O8DB 1S6PA 3P1GA 3SAHA 5K14A 4PUOA 3CC2N 3M8PA 5M1NA 4LSNA 4FWPA 4DB3A 5EU7A 5HROA 4DTXA 5B8HA 1NK7A 5JLFA 3TPQA 1WAJA 3QBWA 1RBSA 1ATNA 4IFEA 3CM6A 4FJMA 1GLFO 3AO2A 2UXCK 3K5NA 3T1YK 1S22A 4JKGA 2HHVA 2E5LK 5BPMA 1RCHA 3UE5A 4B8CA 5BRDA 1NGJA 5JVHL 1E3MA 5AQTA 5BPNA 3QO9A 5E41A 2UUBK 4CZIA 4LF4K 4DWIA 1U6ZA 3AY9A 2O8FB 3O4QA 4LF6K 4FM1A 2V7ZA 4FWRA 4JI3K 1IO2A 1UAXA 2P9UB 3PSFA 2HHSA 2YHXA 3C7NB 2ZM6K 3PO5A 4DV7K 2KZMA 3NCIA 2Q2RA 4DR6K 3ZEUA 2ZGZA 4R5PA 1W2BM 4K25A 4FVMA 1N8RO 2GUIA 1V4TA 2WBNA 3K59A 3QEIA 3ZSOA 1NGHA 2QK9A 3CXCM 2G8WA 3OYAA 3RSEA 3C65A 3VA3A 4DR7K 5J2NA 3SQ0A 1KAZA 3TANA 3JXUA 1W9HA 4YOUA 1L3SA 3GOIA 2HHQA 3A0IX 3ALYA 4CGGA 4CGFA 4BRFA 4KTWA 3OYLA 2X6NA 2B6AA 3DOKA 2FSJA 2B5JA 4PHTX 2LSNA 2X6SA 3F9MA 1TKZA 3ZX3A 4OVLA 3EZ5A 4BDPA 5CZ1A 1VSMA 3HPGA 4CFDA 4CHQA 4ZTJA 4GKJK 1VSHA 4ZTFA 1VSFA 3VEVA 4HUEA 4AM6A 3TR8A 1CZ9A 3DRRA 5GIPA 5BR8K 5GINA 1NGIA 1ATRA 3WQUA 5BPLA 1RFQA 4DV2K 1QHAA 2FBTA 4BRGA 4C1NK 1MA9B 2Q31A 4CCHA 1L3VA 3V1OA 2F7TA 3HBTA 3L0QA 3CCVN 2WONA 5AQNA 4H8KA 4RW4A 4CJ5A 3M8SA 2HBJA 2YNIA 3U8XA 3THWA 4LF7K 2P9LB 2HHHK 3UKUB 2GV9A 3K0SA 5E84A 1NGGA 2O8EA 3L2WA 4TSXA 2I7PA 4DQRA 4CZHA 1CZAN 3VA0A 3CYMA 5FPNA 4BWJA 4DSFA 1RT5A 4FJKA 1NGDA 3DAWA 2IGIA 2E8AA 3QINA 4B1UB 1KFDA 1W97L 3ATUA 3LM2A 3DM2A 5M1OA 4BY9C 1SKSA 1TKDA 5C2FA 2YNGA 1HNZK 1C0FA 4B08A 1TK8A 1KQSM 4M42A 5TKWA 5BN8A 4PL7A 1KD1O 3CD6N 2XY5A 3H1VX 4JHDB 4BVPA 1WNSA 4FJ8A 4JKBA 4BRNA 1JCFA 4Y1CA 1GLJO 3WEEA 4A61A 4HUGA 3K57A 3QIOA 1OVYA 2HVHA 3L2VA 4CK2A 4WFBL 4FJHA 4CGDA 4OX9K 5AQLA 5AQGA 2A42A 4WQ5C 4DSIA 4B1YB 1RTHA 4NLBA 1D9FA 3HL8A 2HBMA 1VQ9N 1BQMA 5SZTA 1X9JA 4DQIA 1TUYA 3OA9A 4DV4K 1OH8A 1WSEA 1BQNA 1BA1A 3HP9A 1TKTA 3IKMA 5MLCQ 4FWMA 4DTSA 1S1XA 4DTJA 4CJPA 4Z4HA 4CEAA 3H08A 4RWTA 1ILYA 5KRTA 5KQ8A 3VQQA 4AHVA 2OTJN 4FZYA 1RBTA 2P9SB 4M7YA 1WSIA 3A5OC 2E4LA 3MCPA 3NE6A 3DI6A 3O6WA 1CZBA 3AVBA 4DR3K 1XC3A 3KHYA 2CGKA 4X62K 4FK4A 3JAMO 2NRZA 5HP1A 4KTZA 1SKWA 1QSLA 5I3UA 1IKXA 3VQ9A 4KHQA 3OYGA 2CGLA 4RW7A 3FZKA 3OYKA 3S9HA 4M7XA 3EE8A 2ITGA 3EKUA 3AVGA 5C10A 3QETA 2GX9A 3DRPA 4CF0A 2O8BB 4W5NA 3M5RA 3CMAN 5LL6Z 4ILJA 4BQZA 4FVUA 1S6QA 1XMOK 1YHQN 4WFNL 1XI1A 3LDSA 1YTUA 1XNRK 1L5UA 4DG1A 1RDWX 3J81O 1UA1A 4WFAL 4HCBA 3HM8A 4JI4K 3L6QA 4I7FA 3ZSYA 3J7AP 3GBTA 4YY3K 4ILHA 4BRIA 2VGNA 4WE1A 4C8LA 2D0BA 3SQ2A 4DSJA 4IEIA 1Y64A 2GWJA 5ADXA 4LF9K 4FJJA 3J7ZO 5CR4A 3CERA 3D2FA 1ATSA 4IWVA 4W5RA 4CHOA 3LPUA 5FRNA 2Q3SA 1LWFA 3MMVA 5KPRA 3VEWA 2R7YA 3RRHA 1XHZA 2NRXA 4F3TA 3A2FA 4KTQA 3NMUA 2W41A 5AQQA 3QMLA 3K9KA 1GLDG 1YTAA 3ENBA 2YJFA 1OH7A 4DV1K 4DMNA 1FXXA 3F2KA 2QXFA 1X3MA 2D0PA 4MO5A 3RR7A 3U6FA 3O9RA 2E2NA 2HNDA 4RG8A 3MDQA 4M3ZA 1SV5A 4C8MA 2P5OA 4OPJA 1RT4A 2O8DA 3KK7A 1XNQK 4LD0A 4G1QA 4OKJA 2YHYA 4CJLA 3VETA 4Z4FA 3MEDA 2IDOA 3CQ8A 5DM7L 3QIPA 3OVNA 3VQPA 4LH5A 2HMIA 4DFPA 2RPIA 5AQJA 2F8TA 1D5AA 1ESVA 3IDHA 1NWKA 3O4WA 3MN5A 1O1WA 3TSUA 4FO0A 2KQ2A 5AJ3K 3DJCA 3TABA 2QA4N 3FE1A 1DT9A 4MDAA 4F9OA 4DR4K 1HX1A 5AQUA 4LF5K 4OLAA 2VWBA 3LP1A 4CF1A 4EHTA 4FLVA 3P5JA 1MWMA 2O8FA 3G0ZA 5M1QA 2VG5A 1I39A 2GTDA 4JN4A 2G8IA 2HVIA 4OGCA 2YHWA 2GBZA 3C7NA 3IMXA 3LP2A 4IJAA 3O3HA 2PYLA 3H3OB 2X74A 2UU9K 2P9KB 3NF8A 2BGGA 4DU1A 2IVOA 4C1NI 1HKCA 4GNIA 4CD3A 4KFBA 3MK6A 4AILC 4Z4GA 3CC4N 2I5JA 1R0AA 3MXIA 2F96A 4IDHA 1HLUA 2D0OA 4KB0A 3EO3A 1DLOA 5M1KA 4KAZA 1BCOA 4QS8A 1R59O 1BOTO 3LZJA 1E4FT 5CYMA 3RRGA 2DPNA 3P31A 5H1SQ 4KHYA 3ZETB 1J53A 3U9DA 2OA8A 4FK2A 4KI6A 3RWUA 4BDYA 4CEFA 1Q18A 4KH4A 4XH5A 1IG9A 2X78A 3CIPA 4HCCA 1UOCA 4BREA 3ID6A 5F1XA 2DFEA 4CGJA 4HTUA 3VEYA 3I0SA 2YJEA 1IBKK 3V6DA 3NHGA 1RT3A 2P1JA 1P90A 4MLHA 3LDLA 3CPEA 4BQLA 2XY8A 3SUQA 4BG9A 1EKEA 1Z05A 4B1WB 4DF4A 3ZSRA 1Q8IA 3WXIA 2Z1JA 2BDPA 2P9NB 2PBDA 3IRXA 3CJ1A 1KXPA 4FPBA 2A40A 2P9LA 3NH2A 1EWQA 3UKUA 1SZ2A 4ISEA 3C6AA 2QWPA 3K5LA 2P9IB 1HNXK 1UA0A 4DTMA 3UB5A 3OYJA 4IEEA 1YAGA 3I33A 3ZT3A 2QTDA 4DQQA 4B3SK 3AA5X 3BP8A 4DLEA 4O8UA 1S9EA 1SL2A 4FJ9A 4Z4CA 2ZJRL 4BGAA 2H3GX 1TK0A 4DTRA 1ZBSA 1B92A 2WC9A 3H3NO 4CIEA 4PQUA 3OBYA 4FLYA 1TL3A 5C42A 5J1EA 3T7ZA 3ULDA 4E1NA 3VQCA 1J54A 5FDLA 4PY5A 1KAYA 5JS2A 4NO7A 2YHBA 3VTHA 2NRTA 2G8FA 2IS3A 1GOCA 4CJFA 3KWIA 4CZKA 1HNWK 1C1BA 3D6RA 4U7BA 4FLTA 3NH0A 4IDKA 5JVGL 2A41A 4JI7K 4FW2A 3DLKA 3SCXA 1XMQK 1T6DA 3S3NA 1KRPA 3O9TA 3MWTA 2FXUA 2XRIA 1VQNN 1NK4A 1YI2N 5T7BA 4XIUA 3E9PA 3CCUN 4XH4A 1D8YA 3CCQN 2OPRA 4CF8A 5AZJB 3MEEA 3EYZA 2ASOA 4UY8O 3TTDA 5EOYA 1U48A 1EX4A 1S3XA 3L4QA 3EEQA 1T8EA 1WLJA 3B8AX 4DQSA 3ZT2A 3C95A 3V1QA 3VGKA 1J6ZA 4MO4A 3QB0A 2P9SA 4Y0WA 4N76A 1RTJA 1L3TA 4FM0A 3THXA 2PZSA 3A5NC 4K42A 4H4MA 4JS5A 4IO9L 4M3WA 4LH4A 4JKCA 2XY7A 5KTQA 1VQMN 2YCHA 5C0YA 3VN5A 1FKPA 5ELZA 4KHUA 4BR0A 3A8YA 4NYNA 4Z0UA 3TAGA 2OANA 4N56A 4DKWA 4FJ5A 4NYFA 3ENHA 3AVKA 4DV6K 4HUFA 3FZLA 5EY4A 3H45C 2QWOA 1FKOA 2ETJA 1O13A 1JLBA 2JWLA 2JWKA 4CJ4A 1NGBA 4NLCA 4ICLA 4CVNE 1VAZA 3WNGA 1ZBHA 4RTFD 3AVJA 3QFUA 4CZFA 2A3ZA 1FW6A 1C0UA 4JS4A 4NCBA 1NGFA 5BR9A 3O9SA 3BF3A 4L8RB 3CHWA 3U3GA 4FJGA 3ZYYX 5FRMA 1DTTA 2BH1A 5M1FA 4J2DA 1Q7YO 2FBXA 2IIRA 3DXKA 2W6LA 2RKIA 2O8CB 4CEEA 3LAKA 5DMRA 3NDKA 1I94K 1DTQA 1LW0A 2NRRA 4CK1A 3O8MA 3W3DA 1N36K 4IOAL 2F4VK 1XUPO 3ZSXA 1Z25A 2E20A 4CHYA 1I3AA 2E2OA 3SPYA 2B4JA 1F21A 4EFHA 3GE1A 1Q9YA 4CW7B 2YKNA 3DXMA 3CCLN 2Z1HA 3LAMA 4N5SA 1WSHA 3O1BA 4CJQA 2AP1A 4EZ6A 1U2VB 2BE2A 3DLRA 3VQ7A 4CFAA 1KCFA 1IKYA 5HBMA 3MEGA 3MN7A 4B1VA 3ULEB 1D4XA 2IAJA 4OJRA 3LZIA 2IC3A 3KZBA 2P9PA 2ZE2A 4DQ8A 2FLOA 3LDPA 1W0HA 2P51A 1JLCA 3SAGA 4H0YB 2VG6A 3G71N 4GW6A 3PIPL 3R3LA 1QQCA 1ZBUA 1LWCA 1ITGA 2A1SA 4IFVA 4IKFA 4J2EA 4GV6A 4KBOA 1JL2A 3O4NA 3LP0A 2HBKA 4Q0BA 3MX5A 5CE3A 4K43A 5BRHA 2KTQA 4CJEA 5F2RA 5EXWA 2F9TA 1VRTA 4BRPA 3ZLJA 4FOIA 4FW1A 1WB9A 5KQDA 3P39A 2YNFA 2KHOA 1EWRA 4H0VB 2VWJA 3UKRA 1IH7A 2VQEK 2FSKA 4E1JA 4JKHA 4XH1A 5EX5A 1JKHA 1BU6O 4CE9A 3O1WA 1RTDA 3NGYA 4C8KA 2YNHA 4AHTA 2P9KA 3NH1A 2PAVA 1XQSC 2HW3A 4WF9L 3JYTA 1ASUA 4EIAA 5KRSA 1S1TA 4BWMA 3WXKA 1SS6A 2E88A 2HBLA 3IFRA 3G6EN 2UUCK 5CHIA 3NF6A 2KFZA 4IBNA 4CGHA 3EZWA 1VRUA 5AR0A 4FWNA 2D5RA 4KV8A 3N4PA 2PFUA 3CPWM 1FJGK 1NU0A 3W0LA 3ZETA 1YJNN 3VEXA 4E89A 3KK3A 4CF9A 1RDBA 2E6MA 1X9SA 4CD1A 3F5TA 3VENA 3SZ2A 3ZX0A 4M3UA 4K41A 1S1WA 2O4GA 1C0MA 1MDUB 2O4IA 4X64K 1HYZA 1GOBA 3L4IA 2ZF5O 4CEBA 5J2PA 2IVNA 5BN9A 4I6MA 1U04A 4EAHD 5E26A 3OYCA 1N6QA 3HTVA 3VF2A 3SNNA 4B3RK 3RR8A 3SJJA 2QXLA 1WAFA 3OYEA 1IBMK 3O80A 1BDGA 1NK0A 1JL1A 3CFRA 4YFUA 3THYB 2KLAA 3Q7BA 3ITHA 3C94A 3KD1E 3S41A 1HPMA 3DLHA 3QEWA 3I0RA 3VEZA 2V52B 5C15A 1VSKA 3WQTA 4AHUA 4A5AA 1QSYA 4DFMA 3C6HA 4DSEA 4JK8A 3CJBA 4M63C 5FLXO 2GEMA 4QOZB 1HUXA 1TK5A 4NCGA 4JI5K 4CHNA 1SL1A 3EL2A 2HNYA 4KRFA 4B9SA 3LWMA 4HTLA 5GAGP 3BZKA 3LANA 4X65K 1NK6A 5CYQA 5AQHA 4CFBA 1TAQA 2W42A 4Z4IA 1RDUA 1U49A 3OW2M 1TKXA 2QWQA 4FYDA 4GY2B 3H6EA 1C6VA 4XEIA 4OPHA 3O3GA 3SJHA 3T19A 4R79A 4IG3A 4E3SA 3RMAA 2GUPA 3KIOA 3VQEA 1VSIA 4CJ3A 3AAQA 3KLHA 3DLBA 1BL3A 3ISNC 4LY7A 4CEDA 4DCHA 3VQ5A 3DMJA 2OYQA 3EN9A 4F2RA 1YVNA 2HF4A 3KJVA 2NRVA 1K73O 3ZT4A 4B1XB 5GADP 4DS4A 3G25A 3ZEUB 1XWLA 3WXJA 4WCEL 3FFIA 5AFUH 4CEOA 5IT9O 4M41A 4FZZA 4NXMK 4QCLA 1J9AA 1A5XA 3CQXA 3LL3A 3D2EB 4WQ4A 4LFBK 3TWHA 3FZMA 3D0PA 5LMUK 1RBRA 1P8ZA 4BC5A 2DFHA 4FWLA 1VK0A 3OHRA 3SK3A 3L3VA 4PKHA 2OZMA 4IFYA 2CH5A 3HT3A 4CJWA 3VESA 3L2RA 4PKGA 1BCMA 1BG3A 3FZHA 2Y1IA 1RDCA 3TAEA 3SPZA 1HYVA 4DQPA 3CCJN 1H1VA 1S1UA 1XC9A 4DS5A 1ZYQA 4JNEA 3ZSQA 1HNIA 2DY4A 1IV0A 3AARA 2G8UA 2FBYA 4J2BA 3AVHA 3IUCA 3KVGA 3NGIA 3CCMN 3NVMA 3K58A 1N34K 4BRMA 4LSLA 3AVNA 1NKEA 2YX6A 3QEPA 4B9UA 1BISA 3L2QA 4BACA 4CERA 3HJFA 1S72N 5C25A 1KVBA 1YUWA 5AZIB 3P38A 4ILGB 2Q36A 4O55A 4KKOA 3CG7A 4I9LA 4O44A 4CI6A 5J2MA 4LFCK 1QVGM 4FWQA 4DR1K 4DF8A 4NCAA 2P9UA 1U45A 3HO1A 3AO5A 3AO1A 3KLFA 1OH5A 2NNWA 3HSTB 2PYJA 4CIFA 4CZLA 4YOTA 1EO1A 1VQON 4JD2B 1KVCA 4KHSA 1QQNA 1GLBG 1HJOA 1TV6A 2ZGYA 5FPMA 1VQLN 2O8CA 4B9LA 1EXQA 2NZTA 3KK1A 1DKGD 3B6OA 4CHPA 5IWAK 2GELA 3AVCA 4B3TK 4RCHA 2PY5A 5AQMA 4MFBA 1HPZA 5HOOA 5A2QO 1ZXOA 3VQ4A 2KZZA 3M6GA 5SWMA 4OKEA 1VSEA 2KFNA 2OTLN 4DU4A 3ENOA 3QNOA 4GV9A 4DSKA 3OJUA 3AGKA 4CBXA 4BC2A 3HK2A 3ATVA 4EP4A 4FJLA 5TKYA 3G4SN 4O4GA 3NF7A 3R6MA 2QWRA 1HR0K 3ULEA 4BRKA 1K8KB 2F9WA 3J8AA 5GIOA 2VQFK 4IJNA 1VHXA 3SMPA 3PX0A 3RTVA 4DR5K 4FOEA 3TTFA 4HWIA 2WFBA 4FJXA 3EY1A 3LDOA 1NK9A 1HKBA 1N33K 3NFAA 3RMBA 3WNHA 4DV5K 5AQKA 3NAEA 3HYFA 1KAXA 3L2UA 5AQZA 2HOEA 3CFPA 3O5BA 1Q86O 1WUAA 3VPZA 5LJWA 4E7LA 1CLQA 3TTCA 4KPYA 3PLAA 3SV4A 5KPTA 1QSSA 4GMJB 1JXEA 4CBUA 2BUPA 4BR5A 2VWKA 2XO7A 4L3QA 3ID8A 1KLNA 4E7IA 3DOLA 4H0PA 1HYSA 3H1QA 3VMFB 2E2PA 4FZXC 1NGAA 1NMNA 2D4WA 2VYPA 3HP6A 4N47A 4ELVA 1NOZA 5GAHP 5BRFA 2NRHA 2RN2A 1RGIA 1OH6A 3U3YA 3CF5L 4OPAA 2W6KA 1ASVA 1WOQA 4B9TA 1Q81O 4CJVA
chains in the Genus database with same CATH topology
4JHDA 4IOAL 1X9JA 1XUPO 2ZJQL 2E20A 1TUYA 3OA9A 4H5RA 2E2OA 4DHYA 4BG8A 2E2QA 4EFHA 1BA1A 3GE1A 5AQWA 3IKMA 3WXLA 1X3NA 4FWMA 5MLCQ 2QM1A 2A5XA 3DXMA 4FWOA 1OKJA 3CCLN 4RWTA 3GG4A 3O1BA 1ILYA 5KQ8A 1KC8O 5FPDA 5AQRA 2AP1A 1U2VB 1SQKA 4BRDA 1YJWN 4BRCA 2OTJN 4BRHA 4MDBA 3MN7A 1EQYA 3GL1A 4B1VA 3ULEB 2P9SB 2QA4N 4M7YA 1D4XA 3HZ6A 3O08A 3A5OC 5C2DA 3MN9A 3LM9A 4IXCA 3MCPA 3VF6A 3CJAA 2VCPA 3TU5A 3UKRB 3O6WA 3KZBA 1XC3A 2P9PA 3KHYA 2CGKA 3QFPA 4DQ8A 2FLOA 3LDPA 4BC4A 3SAGA 4JAXA 4YOWA 2NRZA 4H0YB 2HSTA 4IOXA 5BREA 3G71N 2FSNA 1M90O 3PIPL 3R3LA 3U4LA 3CQYA 2Q0RA 1QQOA 3SBTA 3A5MC 4B9QA 4KH6A 3T69A 1GLAG 4FSVA 4KBOA 4GV6A 2CGLA 3D2FB 3FZKA 4GV3A 4M7XA 3EE8A 2HBKA 4KH5A 1U2VA 2GWKA 3MX5A 5CE3A 1YJ9N 3EKUA 1IJJA 3N4QA 4K43A 4JKFA 5BRHA 5C10A 5JICA 2E1YA 3WEEB 3WXMB 2GX9A 2QEXN 5F2RA 3M5RA 5EXWA 2F9TA 3CMAN 4BRPA 4FVUA 4ILJA 4BQZA 3KWGA 4FOIA 2YI1A 4GVEA 5AQPA 1YHQN 1VQ4N 4WFNL 3TSQA 1VQ6N 5KQDA 3P39A 4A62A 2KHOA 1RDWX 4H0VB 3UKRA 4WFAL 3SMSA 2FSKA 4E1JA 3CCEN 3HM8A 3VOVA 3OBWA 4BVOA 1GLLO 3L6QA 4JKHA 4XH1A 1DEJA 3GBTA 5EX5A 3FLCO 1BU6O 4ILHA 3O1WA 4BRIA 2D1KA 1VQKN 5AQFA 3PIOL 2VGNA 2P9KA 4IEIA 1Y64A 2GWJA 2PAVA 2ITMA 4BRAA 1XQSC 5ADXA 3E9OA 3EKSA 4WF9L 4EIAA 2VGMA 5EVZA 3MCAB 5CR4A 3J7ZO 4A2BA 3CERA 3D2FA 1ATSA 1GLEG 4IWVA 4CZGA 3I55N 2CH6A 4O5FA 3WXKA 4I6MB 3MMVA 1SS6A 2HBLA 2E88A 3IFRA 4FL9A 5KPRA 3G6EN 3VGLA 3DLLL 5CHIA 3ZX2A 3VEWA 2NRXA 5C12A 3R8EA 3LDQA 3NMUA 3HOSA 4AF1A 2W41A 5AQQA 3QMLA 1Z6RA 3K9KA 3EZWA 1GLDG 3ENBA 2EWSA 5AR0A 1TYQA 2YJFA 4FWNA 2FF6A 3FR0A 3F2KA 3N4PA 2PFUA 3CPWM 5ADXH 1X3MA 2D0PA 4MO5A 1MWKA 3W0LA 1GLCG 3O9RA 3ZETA 2E2NA 1YJNN 1NMDA 3MDQA 1NLVA 2HF3A 3FGUA 5AQVA 5JLHA 3CMEN 3SLCA 3VEXA 4BRQA 1BUPA 3KK7A 4CD1A 3AGRA 3TSPA 3F5TA 3VENA 2YHYA 3ZX0A 4IO8A 3AAPA 3VETA 4YOYA 4K41A 5FPEA 2QI2A 2RHKA 3O9QA 1E4GT 4BGBA 2QWMA 5DM7L 2ASMA 4JK9A 1Q82O 3FZFA 1JJ2M 2A6AA 1MDUB 4OO1J 3MN6A 3L4IA 2ZF5O 4YOXA 3E9LA 2IVNA 5AQYA 5BN9A 4I6MA 5AQJA 4EAHD 1ESVA 5E26A 1G99A 3HTVA 3VF2A 3IDHA 3HOTA 1NWKA 4JK7A 2QXLA 3WUHA 3O4WA 4BROA 3E1YA 3O80A 2ZJPL 1BDGA 3D2EA 3MN5A 4NB4A 4QS9A 3TSUA 4FO0A 4A59A 1VQ8N 4BRLA 1TUUA 3DJCA 2KLAA 3FE1A 5DM6L 1QZ5A 3Q7BA 4H5VA 1DT9A 4MDAA 2V51B 4F9OA 4YOVA 1HX1A 2QW9A 5AQUA 1HPMA 2VWBA 3D7EO 3S41A 1BO5O 3VEZA 2V52B 5C15A 5KPZA 3CJCA 3WQTA 4EHTA 3K9JA 1YIJN 1MWMA 4PKIA 4A2AA 5M1QA 4FWSA 3C0BA 1HKGA 4QS7A 2GTDA 3CI5A 4JN4A 4CJ7A 4A5AA 3M1FA 3HRGA 4PL8A 2YHWA 1C0GA 4U67L 1YF5L 3C6HA 3C7NA 4IJAA 3IMXA 4H5WA 3CJBA 4JK8A 4M63C 1NM1A 1JCEA 3H3OB 1YITN 2GEMA 2KKZA 3WT0A 1HUXA 4J8FA 5F0XA 2P9KB 3I8BA 5JMVA 3EL2A 1VQ7N 3I56N 4HTLA 5GAGP 3BEXA 2IVOA 1BWFO 1NGEA 4FWKA 4C1NI 4Z94A 1LCUA 1HKCA 4GNIA 5AQHA 4CD3A 3MK6A 4YDUA 3CC4N 1RDUA 3GDQA 4H0OA 3OW2M 2QWQA 2ZWHA 1YXQA 3FFKB 3QBXA 4G9ZA 5AZIA 4MLEA 4GY2B 4YDUC 4BR4A 3H6EA 3CETA 4XEIA 4OPHA 3SJHA 4IDHA 4CZMA 1ZC6A 4R79A 1HLUA 2D0OA 1T44A 3EO3A 3SAFA 3CCRN 1T3VA 2ASPA 2CGJA 5M1KA 5AFUA 2GUPA 4QS8A 1R59O 1VQPN 3EE9A 1TYQB 2RE2A 1BOTO 1E4FT 2DPNA 3AAQA 5I9EB 3P31A 5H1SQ 1V4SA 3ZETB 5M1PA 4FPAA 3VERA 3U9DA 3CC7N 3BF1A 1NGCA 3SAHA 4DCHA 3CC2N 1Q18A 4KH4A 4XH5A 4A5BA 4H5TA 5M1NA 3Q7CA 3CIPA 3EN9A 1YVNA 2HF4A 4BREA 2NRVA 4JD2A 3ID6A 1K73O 5F1XA 4FWPA 4B1XB 4DB3A 5GADP 3G25A 3ZEUB 3QICA 3VEYA 2UYTA 5B8HA 2YJEA 3WXJA 4WCEL 5JLFA 5HL7L 3TPQA 5AFUH 3CJ7A 5GAEP 3QBWA 1ATNA 2W40A 4IFEA 1GLFO 1SAZA 3E66A 3DWLA 1P90A 3HSCA 1S22A 3CQXA 3LL3A 4JKGA 3HI0A 3LDLA 3D2EB 4MLHA 4WQ4A 3CPEA 4BQLA 3FZMA 4H0XB 5BPMA 3UE5A 5BRDA 5AQOA 5JVHL 1NGJA 5AQTA 4BG9A 1Z05A 1LOTB 1IG8A 4B1WB 5BPNA 1P8ZA 4BC5A 4FWLA 2Q1NA 4CZIA 3OHRA 3SK3A 3M3ZA 4PKHA 1NJIO 1VQ5N 3WXIA 1U6ZA 3AY9A 4BR2A 2CH5A 2P9NB 4BR7A 2PBDA 2NRWA 3CJ1A 1KXPA 4FPBA 3VESA 4PKGA 1BG3A 2A40A 2P9LA 2V7ZA 3FZHA 4FWRA 3UKUA 3VGMA 1SZ2A 2P9UB 1K8KA 4ISEA 3CCJN 1H1VA 2YHXA 3C6AA 3C7NB 2QWPA 4JNEA 4WQ5A 2P9IB 2Q2RA 3O9UA 3ZEUA 2ZGZA 1W2BM 4K25A 3AARA 3UB5A 4AM7A 3MWPA 4IEEA 3IUCA 3KVGA 1YAGA 3CCMN 1N8RO 3I33A 3NVMA 1V4TA 4BRMA 2QTDA 2WBNA 4CBWA 3NVKA 4JKDA 1NGHA 2YX6A 1QZ6A 3CXCM 2QWLA 3BP8A 5LY3A 1S72N 1K9MO 1YUWA 3P4IA 5AZIB 3RSEA 4O8UA 3C65A 3P38A 4ILGB 5AQIA 2ZJRL 4BGAA 2H3GX 1KAZA 2Q36A 1BA0A 1ZBSA 1QQMA 3JXUA 4YOUA 2FF3B 2WC9A 3W3DA 3H3NO 4JKEA 1T6CA 3GOIA 2P9NA 3A0IX 3OBYA 3LDNA 4WYBA 4CI6A 4EHUA 1M1KO 3T7ZA 4BRFA 5LJVA 1QVGM 4FWQA 4A57A 2FSJA 4O8KA 4CZEA 4PHTX 1NBWA 2P9UA 1KAYA 3F9MA 4NO7A 3ZX3A 3VTHA 2NRTA 3H46O 4BR9A 2P9IA 2NNWA 3KWIA 4CZKA 2IVPA 4JKAA 4CZLA 4ISGA 3D6RA 4H03B 4YOTA 4U7BA 1EO1A 1VQON 4JD2B 3VEVA 1K8AO 5JVGL 2A41A 1QQNA 1GLBG 1HJOA 4AM6A 2ZGYA 5FPMA 1VQLN 3VF4A 2NZTA 1DKGD 5GIPA 1T6DA 4H5NA 5GINA 1QVFM 1NGIA 1ATRA 2J4RA 2GELA 3CJ9A 4ISFA 4RCHA 3WQUA 3O9TA 5AQMA 1DGKN 3MWTA 5HOOA 5BPLA 1RFQA 2FXUA 1ZXOA 1VQNN 1QHAA 1YI2N 3CCUN 3E9PA 3SBGA 4BRGA 4XH4A 3M6GA 3CCQN 4JKGB 4B1ZA 2NLXA 1MA9B 2Q31A 5AZJB 4C1NK 2ASOA 2OTLN 2Q97A 4UY8O 4C23A 3ENOA 2F7TA 4H0TB 3TTDA 5EOYA 3HBTA 1S3XA 3L0QA 3CCVN 3L4QA 4GV9A 5AQNA 3RVCA 3AGKA 3B8AX 1JCGA 2HBJA 4CBXA 2E1ZA 4BC2A 4CZJA 3ATVA 3R1XA 3U8XA 5TKYA 1J6ZA 3A5LC 4MO4A 3VGKA 3G4SN 5AQXA 2P9LB 3QB0A 3R6MA 2QWRA 3UKUB 3ULEA 4IOCL 2P9SA 4Y0WA 2I7NA 4BRKA 1K8KB 2F9WA 1NGGA 4JEPA 3QDKA 5E84A 3J8AA 5GIOA 3A5NC 2I7PA 4K42A 4IJNA 4CZHA 1CZAN 4IO9L 4JKCA 3SMPA 5FPNA 1VQMN 2YCHA 3MX2A 3R9PA 5C0YA 1NGDA 4FOEA 4HWIA 3TTFA 3DAWA 2HMPA 2E8AA 2WFBA 4B1UB 5ELZA 3LDOA 1W97L 1HKBA 3A8YA 3ATUA 3DXKB 3LM2A 4YORA 5M1OA 4BR0A 4BY9C 5C2FA 5AQKA 4LC9B 1KAXA 5AQZA 1C0FA 2OANA 2HOEA 5AZJA 2QWNA 5AQSA 5TKWA 5BN8A 3O5BA 4PL7A 1KQSM 4DKWA 1Q86O 1WUAA 1KD1O 3CD6N 3RSEB 3VPZA 3ENHA 3H1VX 4IZ9A 4JHDB 3JS6A 5LJWA 4BVPA 3FZLA 2WUSA 4JKBA 4WQ4C 4BRNA 3TTCA 5EY4A 3H45C 3PLAA 2QWOA 2JWLA 1JCFA 1O13A 5KPTA 2JWKA 3U9ZA 1NGBA 4NLCA 3DXMB 1VAZA 4RTFD 1GLJO 4CBUA 3WEEA 2BTFA 3QFUA 3VEOA 4CZFA 2BUPA 4BC3A 2A3ZA 4A61A 4BR5A 4L3QA 3ID8A 3VTIA 1OVYA 1NGFA 5BR9A 4H0PA 3H1QA 3VMFB 3O9SA 2E2PA 3CCSN 3BF3A 1NGAA 3CHWA 4WFBL 3ZYYX 2D4WA 2VYPA 2BH1A 5AQLA 5M1FA 5AQGA 2A42A 4WQ5C 1Q7YO 5GAHP 2IIRA 5BRFA 3DXKA 2NRHA 1RGIA 2V7YA 4B1YB 3BUZB 4NLBA 3CF5L 4OPAA 2Q0UA 2NRRA 1WOQA 3O8MA 2P9PB 1Q81O 2HBMA 1VQ9N 2AA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHD A;  1X9J A;  1XUP O;  2E20 A;  1TUY A;  4H5R A;  2E2O A;  4DHY A;  4BG8 A;  2E2Q A;  4EFH A;  1BA1 A;  3GE1 A;  5AQW A;  3WXL A;  1X3N A;  4FWM A;  2QM1 A;  2A5X A;  3DXM A;  4FWO A;  1OKJ A;  4RWT A;  3GG4 A;  3O1B A;  5KQ8 A;  5FPD A;  5AQR A;  2AP1 A;  1U2V B;  1SQK A;  4BRD A;  4BRC A;  4BRH A;  3MN7 A;  1EQY A;  3GL1 A;  4B1V A;  3ULE B;  2P9S B;  4M7Y A;  1D4X A;  3HZ6 A;  3O08 A;  3A5O C;  3MN9 A;  3LM9 A;  4IXC A;  3MCP A;  3VF6 A;  3CJA A;  2VCP A;  3TU5 A;  3UKR B;  3O6W A;  3KZB A;  1XC3 A;  2P9P A;  3KHY A;  2CGK A;  3QFP A;  4DQ8 A;  2FLO A;  3LDP A;  4BC4 A;  4JAX A;  4H0Y B;  5BRE A;  2FSN A;  3U4L A;  3CQY A;  2Q0R A;  1QQO A;  3A5M C;  4B9Q A;  1GLA G;  4FSV A;  4KBO A;  2CGL A;  3D2F B;  3FZK A;  4M7X A;  1U2V A;  2GWK A;  5CE3 A;  3EKU A;  1IJJ A;  4K43 A;  5JIC A;  5BRH A;  2E1Y A;  3WEE B;  5F2R A;  5EXW A;  2F9T A;  4BRP A;  4BQZ A;  4FOI A;  2YI1 A;  5AQP A;  5KQD A;  4A62 A;  2KHO A;  1RDW X;  4H0V B;  3UKR A;  3SMS A;  2FSK A;  4E1J A;  3HM8 A;  3VOV A;  4BVO A;  1GLL O;  3L6Q A;  4XH1 A;  1DEJ A;  3GBT A;  5EX5 A;  3FLC O;  1BU6 O;  4BRI A;  3O1W A;  2D1K A;  5AQF A;  2P9K A;  1Y64 A;  2GWJ A;  2PAV A;  2ITM A;  4BRA A;  1XQS C;  5ADX A;  3EKS A;  4EIA A;  5EVZ A;  4A2B A;  3CER A;  3D2F A;  1ATS A;  1GLE G;  4IWV A;  4CZG A;  2CH6 A;  4O5F A;  3WXK A;  4I6M B;  3MMV A;  2E88 A;  3IFR A;  4FL9 A;  5KPR A;  3VGL A;  3ZX2 A;  3VEW A;  3R8E A;  3LDQ A;  2W41 A;  5AQQ A;  3QML A;  1Z6R A;  3EZW A;  1GLD G;  2EWS A;  5AR0 A;  1TYQ A;  2YJF A;  4FWN A;  2FF6 A;  3FR0 A;  5ADX H;  1X3M A;  2D0P A;  4MO5 A;  1MWK A;  3W0L A;  1GLC G;  3ZET A;  2E2N A;  1NMD A;  3MDQ A;  1NLV A;  2HF3 A;  3FGU A;  5AQV A;  5JLH A;  3SLC A;  3VEX A;  4BRQ A;  1BUP A;  4CD1 A;  3VEN A;  2YHY A;  3ZX0 A;  4IO8 A;  3AAP A;  3VET A;  4K41 A;  5FPE A;  1E4G T;  4BGB A;  2QWM A;  2ASM A;  3FZF A;  2A6A A;  1MDU B;  3MN6 A;  3L4I A;  2ZF5 O;  2IVN A;  5AQY A;  5BN9 A;  4I6M A;  5AQJ A;  4EAH D;  1ESV A;  5E26 A;  1G99 A;  3HTV A;  3VF2 A;  3IDH A;  1NWK A;  2QXL A;  3WUH A;  3O4W A;  4BRO A;  3O80 A;  1BDG A;  3D2E A;  3MN5 A;  4NB4 A;  4QS9 A;  4FO0 A;  4BRL A;  1TUU A;  3DJC A;  3FE1 A;  1QZ5 A;  4H5V A;  2V51 B;  4F9O A;  1HX1 A;  2QW9 A;  5AQU A;  1HPM A;  2VWB A;  3D7E O;  3S41 A;  1BO5 O;  3VEZ A;  2V52 B;  5KPZ A;  3CJC A;  3WQT A;  4EHT A;  1MWM A;  4PKI A;  4A2A A;  4FWS A;  3C0B A;  1HKG A;  4QS7 A;  2GTD A;  3CI5 A;  4JN4 A;  4CJ7 A;  3M1F A;  4PL8 A;  2YHW A;  1C0G A;  3C7N A;  4IJA A;  3IMX A;  4H5W A;  3CJB A;  4M63 C;  1NM1 A;  1JCE A;  3H3O B;  2GEM A;  3WT0 A;  1HUX A;  4J8F A;  5F0X A;  2P9K B;  3I8B A;  5JMV A;  3EL2 A;  4HTL A;  3BEX A;  2IVO A;  1BWF O;  1NGE A;  4FWK A;  4Z94 A;  1LCU A;  1HKC A;  4GNI A;  5AQH A;  4CD3 A;  3MK6 A;  4YDU A;  3GDQ A;  4H0O A;  2QWQ A;  2ZWH A;  1YXQ A;  3FFK B;  3QBX A;  5AZI A;  4MLE A;  4GY2 B;  4YDU C;  4BR4 A;  3H6E A;  3CET A;  4XEI A;  3SJH A;  4CZM A;  1ZC6 A;  1HLU A;  2D0O A;  1T44 A;  3EO3 A;  2ASP A;  2CGJ A;  5AFU A;  2GUP A;  4QS8 A;  1R59 O;  1TYQ B;  1BOT O;  1E4F T;  2DPN A;  3AAQ A;  5I9E B;  1V4S A;  3ZET B;  3VER A;  4FPA A;  3U9D A;  3BF1 A;  1NGC A;  4DCH A;  1Q18 A;  4XH5 A;  4H5T A;  3CIP A;  3EN9 A;  1YVN A;  2HF4 A;  4BRE A;  4JD2 A;  5F1X A;  4FWP A;  4B1X B;  4DB3 A;  3G25 A;  3ZEU B;  3QIC A;  3VEY A;  2UYT A;  5B8H A;  2YJE A;  3WXJ A;  5JLF A;  3TPQ A;  5AFU H;  3CJ7 A;  3QBW A;  1ATN A;  2W40 A;  1GLF O;  1SAZ A;  3DWL A;  3HSC A;  1S22 A;  3CQX A;  3LL3 A;  4MLH A;  3HI0 A;  3LDL A;  3D2E B;  4WQ4 A;  4BQL A;  3FZM A;  4H0X B;  5BPM A;  3UE5 A;  5BRD A;  5AQO A;  1NGJ A;  5AQT A;  4BG9 A;  1Z05 A;  1LOT B;  1IG8 A;  4B1W B;  5BPN A;  1P8Z A;  4BC5 A;  4FWL A;  2Q1N A;  4CZI A;  3OHR A;  3SK3 A;  3M3Z A;  4PKH A;  3WXI A;  1U6Z A;  3AY9 A;  4BR2 A;  2CH5 A;  2P9N B;  4BR7 A;  2PBD A;  3CJ1 A;  1KXP A;  4FPB A;  3VES A;  4PKG A;  1BG3 A;  2A40 A;  2P9L A;  2V7Z A;  3FZH A;  4FWR A;  3UKU A;  3VGM A;  1SZ2 A;  2P9U B;  1K8K A;  4ISE A;  1H1V A;  2YHX A;  3C7N B;  2QWP A;  4JNE A;  4WQ5 A;  2P9I B;  2Q2R A;  3ZEU A;  2ZGZ A;  4K25 A;  3AAR A;  3UB5 A;  4AM7 A;  3IUC A;  3KVG A;  1YAG A;  3I33 A;  1V4T A;  4BRM A;  4CBW A;  1NGH A;  1QZ6 A;  2QWL A;  3BP8 A;  5LY3 A;  1YUW A;  3P4I A;  5AZI B;  3RSE A;  5AQI A;  4BGA A;  2H3G X;  1KAZ A;  2Q36 A;  1BA0 A;  1ZBS A;  1QQM A;  3JXU A;  2FF3 B;  3W3D A;  3H3N O;  1T6C A;  3GOI A;  2P9N A;  3A0I X;  4WYB A;  3LDN A;  4CI6 A;  4EHU A;  4BRF A;  5LJV A;  4FWQ A;  2FSJ A;  4O8K A;  4CZE A;  1NBW A;  2P9U A;  1KAY A;  3F9M A;  4NO7 A;  3ZX3 A;  3H46 O;  4BR9 A;  2P9I A;  4CZK A;  2IVP A;  4CZL A;  4ISG A;  4H03 B;  4JD2 B;  3VEV A;  2A41 A;  1QQN A;  1GLB G;  1HJO A;  4AM6 A;  2ZGY A;  5FPM A;  3VF4 A;  2NZT A;  1DKG D;  1T6D A;  4H5N A;  1NGI A;  1ATR A;  2J4R A;  2GEL A;  3CJ9 A;  4ISF A;  4RCH A;  3WQU A;  5AQM A;  1DGK N;  5BPL A;  1RFQ A;  2FXU A;  1ZXO A;  1QHA A;  4BRG A;  4XH4 A;  3M6G A;  4B1Z A;  2NLX A;  1MA9 B;  2Q31 A;  5AZJ B;  2ASO A;  2Q97 A;  4C23 A;  3ENO A;  4H0T B;  5EOY A;  3HBT A;  1S3X A;  3L0Q A;  5AQN A;  3B8A X;  1JCG A;  4CBX A;  2E1Z A;  4BC2 A;  4CZJ A;  3ATV A;  3U8X A;  5TKY A;  1J6Z A;  3A5L C;  4MO4 A;  3VGK A;  5AQX A;  2P9L B;  3QB0 A;  3R6M A;  2QWR A;  3UKU B;  3ULE A;  2P9S A;  4Y0W A;  2I7N A;  4BRK A;  1K8K B;  2F9W A;  1NGG A;  5E84 A;  3QDK A;  3J8A A;  3A5N C;  2I7P A;  4K42 A;  4IJN A;  4CZH A;  1CZA N;  3SMP A;  5FPN A;  2YCH A;  3R9P A;  1NGD A;  4FOE A;  4HWI A;  3DAW A;  2HMP A;  2E8A A;  4B1U B;  5ELZ A;  3LDO A;  3DXK B;  1HKB A;  3A8Y A;  3ATU A;  3LM2 A;  4BR0 A;  5AQK A;  4LC9 B;  1KAX A;  5AQZ A;  1C0F A;  2OAN A;  2HOE A;  5AZJ A;  2QWN A;  5AQS A;  5BN8 A;  3O5B A;  4PL7 A;  1WUA A;  3RSE B;  3VPZ A;  3ENH A;  3H1V X;  4IZ9 A;  4JHD B;  3JS6 A;  5LJW A;  4BVP A;  3FZL A;  2WUS A;  4WQ4 C;  4BRN A;  5EY4 A;  3H45 C;  2QWO A;  5KPT A;  1JCF A;  3U9Z A;  1NGB A;  3DXM B;  4RTF D;  1GLJ O;  4CBU A;  3WEE A;  2BTF A;  3QFU A;  3VEO A;  4CZF A;  2BUP A;  4BC3 A;  2A3Z A;  4A61 A;  4BR5 A;  4L3Q A;  3ID8 A;  1NGF A;  5BR9 A;  4H0P A;  3H1Q A;  2E2P A;  3BF3 A;  1NGA A;  3CHW A;  2D4W A;  2VYP A;  5AQL A;  5AQG A;  2A42 A;  4WQ5 C;  2IIR A;  5BRF A;  3DXK A;  2NRH A;  1RGI A;  2V7Y A;  4B1Y B;  3BUZ B;  2Q0U A;  1WOQ A;  3O8M A;  2P9P B;  2AA4 A; 
#chains in the Genus database with same CATH topology
 3K5O A;  4JHD A;  2HHW A;  2ZJQ L;  5LMN K;  4H5R A;  1S5J A;  2E2Q A;  2P5G A;  1RBV A;  3LAL A;  3WXL A;  3WNE A;  1X3N A;  4Y1D A;  2QM1 A;  4FWO A;  1OKJ A;  4CFC A;  1IBL K;  4ID5 A;  3VQD A;  5KGW A;  3V4I A;  3VQ8 A;  1KC8 O;  2NUB A;  5FPD A;  5AQR A;  1X9M A;  4ZHR A;  4BRD A;  1YJW N;  4FJI A;  4BRC A;  3AO3 A;  1NJX A;  3GL1 A;  3MXM A;  3KKR A;  4DUZ K;  4FLW A;  1HMV A;  5C2D A;  4IXC A;  3HPO A;  3OTO K;  1JLQ A;  3AVI A;  2VCP A;  3OYH A;  4KO0 A;  4BC4 A;  3ZCM A;  5BRE A;  5HRN A;  1WBD A;  4FLX A;  2FSN A;  1M90 O;  4BE1 A;  3U4L A;  1JLG A;  1QQO A;  2Q0R A;  3SBT A;  4B9Q A;  4W5T A;  3V9S A;  3T69 A;  1RNH A;  3OY9 A;  3D2F B;  4GV3 A;  2A1R A;  3AA3 A;  3DYA A;  4DU3 A;  2GWK A;  1YJ9 N;  5JIC A;  2ATQ A;  2E1Y A;  3OS2 A;  3M8R A;  2QEX N;  3KTQ A;  1X9W A;  4OPK A;  3KWG A;  4DTO A;  1D9D A;  1EP4 A;  1VQ4 N;  3SUN A;  2Z1G A;  3S3O A;  3PY8 A;  3V9W A;  2YV0 X;  3CFO A;  3VOV A;  4H4O A;  1HQU A;  3QER A;  1KTQ A;  2WOM A;  3NGZ A;  3MAQ A;  3TAQ A;  1VQK N;  5KGX A;  2XHB A;  4BRA A;  3E9O A;  4CJU A;  5EVZ A;  4F3O A;  4A2B A;  1NG9 A;  4FCY A;  1XHX A;  4CZG A;  1LV5 A;  2CH6 A;  4FLU A;  3PV8 A;  3V9X A;  1KLM A;  4CJR A;  4FL9 A;  1W7A A;  2O8B A;  3ZX2 A;  4IG0 A;  5C12 A;  3R8E A;  3S3M A;  4DLG A;  3HOS A;  4AF1 A;  2YKM A;  3HPH A;  1Z6R A;  1BIZ A;  1N5Y A;  3FR0 A;  1TL1 A;  3BZC A;  5ADX H;  1NMD A;  1NLV A;  2HF3 A;  3FGU A;  5JLH A;  4B9N A;  4BRQ A;  2QKB A;  4K8X A;  2UXB K;  5HRR A;  3AGR A;  3M8Q A;  3ZSW A;  1NJZ A;  1QTM A;  4IO8 A;  4FJN A;  2QI2 A;  1E4G T;  4BGB A;  4JK9 A;  3FZF A;  1JJ2 M;  1IKV A;  2A6A A;  4NXN K;  3MN6 A;  4LF8 K;  4YOX A;  3NBP A;  2FBV A;  4B3M K;  4X66 K;  3K5M A;  1UWB A;  3HOT A;  3WUH A;  4JI1 K;  4BRO A;  3E1Y A;  3OS1 A;  2ZJP L;  3D2E A;  4NB4 A;  5DK5 A;  4QS9 A;  4CHZ A;  3J80 O;  1U4B A;  4A59 A;  4M3X A;  1BI4 B;  5DM6 L;  1QZ5 A;  1CXU A;  4H5V A;  4FJ7 A;  2E6L A;  3AV9 A;  2FC0 A;  3F73 A;  5KPZ A;  3CJC A;  1YIJ N;  3K9J A;  1LAV A;  1SUQ A;  3OYB A;  3LWL A;  4PKI A;  4A2A A;  3C0B A;  1HKG A;  4AHC A;  3PUF A;  3CI5 A;  1LWE A;  4DTP A;  3M1F A;  1TGO A;  2BAN A;  1C0G A;  1YF5 L;  3PX6 A;  3ZSZ A;  3SUP A;  1YIT N;  2Z1I A;  4J8F A;  5F0X A;  3BY5 A;  1T7P A;  3K2P A;  5JMV A;  4CJS A;  1VQ7 N;  3I56 N;  2IOC A;  4F8R A;  4FWK A;  3QNN A;  1OVQ A;  4UQG A;  4DUY K;  3GDQ A;  4H0O A;  4M45 A;  3FFK B;  4G9Z A;  5AZI A;  4BR4 A;  3MXJ A;  4DFJ A;  2OPP A;  2HHX A;  3SAF A;  1JLF A;  2D0C A;  1T3V A;  2ASP A;  4PA1 A;  4BDZ A;  3EE9 A;  1TYQ B;  2RE2 A;  4EP5 A;  4JI0 K;  3UIQ A;  3HVT A;  1V4S A;  4FPA A;  4C8N A;  4DTU A;  3SUO A;  1C1C A;  4K8Z A;  1NGC A;  1WN7 A;  3OYI A;  3I8D A;  2OZS A;  4E19 A;  5FRO A;  3TAR A;  4KI4 A;  4A5B A;  4H5T A;  3Q7C A;  4JD2 A;  4DSL A;  1JXB A;  3QIC A;  1RT2 A;  2UYT A;  2XY6 A;  1KFS A;  1EET A;  5HL7 L;  3CJ7 A;  5GAE P;  4FM2 A;  2W40 A;  3LPT A;  4E1M A;  1TVR A;  1SAZ A;  3E01 A;  5C24 A;  4C8O A;  3LP3 A;  3E66 A;  3DWL A;  1NJW A;  3HSC A;  3HI0 A;  1ZBL A;  2D0A A;  1RT1 A;  3F9K A;  4CK3 A;  4H0X B;  3C6U A;  5AQO A;  1LOT B;  1IG8 A;  1N32 K;  1RTI A;  2Q1N A;  4AH9 A;  1T03 A;  3M3Z A;  3T1H K;  1NJI O;  1VQ5 N;  4BR2 A;  3VQB A;  4BR7 A;  3OYN A;  2NRW A;  4JLH A;  3V9Z A;  3TI0 A;  3TAP A;  3VGM A;  1K8K A;  1Z26 A;  3QLH A;  2HHT A;  4WQ5 A;  4I2P A;  3PO4 A;  4FXD A;  3O9U A;  4AM7 A;  3MWP A;  4B9V A;  1JLE A;  3G10 A;  1TAU A;  4FK0 A;  4JI8 K;  4CBW A;  3NVK A;  1YVU A;  4YNQ A;  4JKD A;  1QZ6 A;  1WSJ A;  3KKS A;  2QWL A;  4DFK A;  5LY3 A;  1QHT A;  1K9M O;  3P4I A;  2UUA K;  4E7J A;  5AQI A;  4JRP A;  1B9D A;  2QKK A;  4V19 S;  1IKW A;  3OS0 A;  1BA0 A;  1QQM A;  2FF3 B;  2EX3 A;  4JKE A;  1T6C A;  1WSF A;  3RMD A;  2P9N A;  1RDD A;  4WYB A;  3LDN A;  4EHU A;  1M1K O;  3IG1 A;  5LJV A;  4FLZ A;  4A57 A;  1CXQ A;  3OJS A;  4O8K A;  4CZE A;  4YHH K;  1QS4 A;  1NBW A;  3IS9 A;  2JGU A;  3SQ4 A;  3QEX A;  3H46 O;  4JV5 K;  4BR9 A;  2P9I A;  4GKK K;  2IVP A;  4JKA A;  3SV3 A;  4B3O A;  4ISG A;  4H03 B;  3AO4 A;  3THX B;  4DV3 K;  1K8A O;  4CGI A;  3NF9 A;  3VF4 A;  3QEV A;  2RF2 A;  4I2Q A;  4H5N A;  1Y97 A;  1QVF M;  2J4R A;  3CJ9 A;  4ISF A;  2VG7 A;  4OLB A;  1DGK N;  3SBG A;  4JKG B;  4B1Z A;  2NLX A;  1T05 A;  2OPQ A;  2KW4 A;  2Q97 A;  3T1A A;  1SKR A;  4C23 A;  2WTU A;  4H0T B;  1NK5 A;  3PSI A;  3RVC A;  4GVM A;  1VSL A;  3AVL A;  5J2Q A;  1JCG A;  2E1Z A;  4CZJ A;  3V1R A;  3R1X A;  3A5L C;  4RW6 A;  5AQX A;  1C0T A;  4CEC A;  3ZT0 A;  4CES A;  4IOC L;  4BE2 A;  2I7N A;  4JEP A;  2JLE A;  3QDK A;  4J2A A;  3OYD A;  3MX2 A;  3R9P A;  3VQ6 A;  3B6P A;  2HMP A;  3AA4 A;  1J5O A;  3DXK B;  4YOR A;  3V9U A;  4AQY K;  1ASW A;  4JI2 K;  4LC9 B;  3C6T A;  5AZJ A;  2QWN A;  5AQS A;  3SYZ A;  4AHR A;  3RSE B;  4IZ9 A;  3JS6 A;  2WUS A;  4WQ4 C;  4PWD A;  4CEQ A;  3U9Z A;  2DFF A;  3L8B A;  3DXM B;  3JSM A;  2BTF A;  3VEO A;  3ASM A;  4BC3 A;  3KLG A;  2ZD1 A;  4JYA K;  4M3R A;  3VTI A;  3CCS N;  4QAG A;  3SI6 A;  1HRH A;  1ZBF A;  3O3F A;  1Q9X A;  2V7Y A;  4N41 A;  3BUZ B;  3THV A;  4I9Q A;  1X1P A;  2Q0U A;  3HVR A;  2P9P B;  2AA4 A;  4EZ9 A;  1ZBI A;  4AHS A;  4O5B A;  4Z4E A;  3ZT1 A;  4DHY A;  4BG8 A;  5HRP A;  5AQW A;  4CJK A;  2A5X A;  4W5Q A;  3GG4 A;  5KI6 A;  2G8K A;  3TAF A;  1SQK A;  3ZSV A;  4BRH A;  1REV A;  3CM5 A;  3THW B;  4MDB A;  3HM9 A;  1EQY A;  3DLG A;  4O0J A;  4LFA K;  3HZ6 A;  2O8E B;  3O08 A;  3MN9 A;  3LM9 A;  3VF6 A;  2G8V A;  1QE1 A;  3CJA A;  4HVJ A;  1MU2 A;  3TAM A;  3TU5 A;  3UKR B;  3AVM A;  3D45 A;  4DTN A;  3QFP A;  4ID1 A;  1BGX T;  4B8A B;  4JAX A;  4YOW A;  1LAW A;  1NKB A;  4KHW A;  2HST A;  4IOX A;  3DLE A;  3CQY A;  1U47 A;  3J7Y P;  3VQA A;  4CIG A;  3A5M C;  4KH6 A;  3L3U A;  1A5W A;  5I42 A;  1GLA G;  4FSV A;  1A5V A;  2UXD K;  5HRS A;  4KH5 A;  1U2V A;  1IJJ A;  3N4Q A;  4JKF A;  2OPS A;  3WEE B;  3WXM B;  1BI4 A;  1WBB A;  1KSP A;  2YI1 A;  4GVE A;  5AQP A;  1HJR A;  3KLE A;  3MEC A;  3TSQ A;  1VQ6 N;  4MQ3 A;  2HB5 A;  4A62 A;  1RT7 A;  4B9M A;  4HHT A;  1C1A A;  3SMS A;  3CCE N;  4W5O A;  4BVO A;  3OBW A;  1GLL O;  1DEJ A;  3OYM A;  3FLC O;  3HXM A;  1RIL A;  1NKC A;  2D1K A;  5AQF A;  3PIO L;  1K6Y A;  3PX4 A;  1LW2 A;  2ITM A;  1SL0 A;  4RW8 A;  3EKS A;  5HLF A;  2VGM A;  3MCA B;  1GLE G;  4KHP K;  4K0K K;  4E7H A;  3I55 N;  4O5F A;  1BIU A;  4I6M B;  3DLL L;  1NNE A;  3VGL A;  3LDQ A;  3BGR A;  4F4K A;  1S9G A;  3T3F A;  4CJT A;  1WSG A;  2EWS A;  3IAY A;  1TYQ A;  1S1V A;  2FF6 A;  1HQE A;  1GOA A;  4KHN A;  1MWK A;  1GLC G;  1RBU A;  2ZQB A;  3RMC A;  4JI6 K;  5AQV A;  3CME N;  4KB1 A;  3SLC A;  4E7K A;  3DRS A;  1G15 A;  4E0D A;  1BUP A;  3TSP A;  4JRQ A;  1RT6 A;  4YOY A;  3AAP A;  4Q5V A;  5FPE A;  2RHK A;  3O9Q A;  2QWM A;  2OCE A;  2ASM A;  1Q82 O;  5CY4 A;  4CEZ A;  2G8H A;  4OO1 J;  1NOY A;  1KVA A;  3E9L A;  3AA2 A;  5AQY A;  2AJQ A;  1G99 A;  3KLI A;  5JS1 A;  1YT3 A;  4JK7 A;  3KD5 E;  1B9F A;  1RDA A;  1VQ8 N;  4BRL A;  1TUU A;  1BHL A;  4YOV A;  4BE0 A;  2V51 B;  3KK2 A;  2QW9 A;  3WNF A;  3OYF A;  3AVF A;  3D7E O;  1BO5 O;  3AVA A;  1JLA A;  1FK9 A;  1HNV A;  2EHG A;  4FWS A;  2DTU A;  4QS7 A;  2HNZ A;  4CJ7 A;  3HRG A;  4DR2 K;  1J5E K;  4PL8 A;  4U67 L;  1L3U A;  3BDP A;  1VSD A;  4H5W A;  4DV0 K;  2HHU A;  4ELT A;  1NM1 A;  1JCE A;  2KKZ A;  4OGE A;  3WT0 A;  5D3G A;  3I8B A;  4ELU A;  3BEX A;  4O0I A;  1BWF O;  1NGE A;  4Z94 A;  3SQ1 A;  1NK8 A;  1LCU A;  4CF2 A;  1NJY A;  4YDU A;  5CZ2 A;  2ZWH A;  3QBX A;  1YXQ A;  4F2S A;  2F8S A;  4MLE A;  3THY A;  4YDU C;  3CET A;  3P83 D;  4CZM A;  1ZC6 A;  4M3Y A;  4KRE A;  4M3T A;  4OKK A;  1T44 A;  3V81 A;  3CCR N;  3QES A;  2CGJ A;  5AFU A;  2Y1J A;  1VQP N;  2YHA A;  4RW9 A;  5I9E B;  5M1P A;  3VER A;  1VSJ A;  3CC7 N;  3BF1 A;  2O8D B;  1S6P A;  3P1G A;  3SAH A;  5K14 A;  4PUO A;  3CC2 N;  3M8P A;  5M1N A;  4LSN A;  4FWP A;  4DB3 A;  5EU7 A;  5HRO A;  4DTX A;  5B8H A;  1NK7 A;  5JLF A;  3TPQ A;  1WAJ A;  3QBW A;  1RBS A;  1ATN A;  4IFE A;  3CM6 A;  4FJM A;  1GLF O;  3AO2 A;  2UXC K;  3K5N A;  3T1Y K;  1S22 A;  4JKG A;  2HHV A;  2E5L K;  5BPM A;  1RCH A;  3UE5 A;  4B8C A;  5BRD A;  1NGJ A;  5JVH L;  1E3M A;  5AQT A;  5BPN A;  3QO9 A;  5E41 A;  2UUB K;  4CZI A;  4LF4 K;  4DWI A;  1U6Z A;  3AY9 A;  2O8F B;  3O4Q A;  4LF6 K;  4FM1 A;  2V7Z A;  4FWR A;  4JI3 K;  1IO2 A;  1UAX A;  2P9U B;  3PSF A;  2HHS A;  2YHX A;  3C7N B;  2ZM6 K;  3PO5 A;  4DV7 K;  2KZM A;  3NCI A;  2Q2R A;  4DR6 K;  3ZEU A;  2ZGZ A;  4R5P A;  1W2B M;  4K25 A;  4FVM A;  1N8R O;  2GUI A;  1V4T A;  2WBN A;  3K59 A;  3QEI A;  3ZSO A;  1NGH A;  2QK9 A;  3CXC M;  2G8W A;  3OYA A;  3RSE A;  3C65 A;  3VA3 A;  4DR7 K;  5J2N A;  3SQ0 A;  1KAZ A;  3TAN A;  3JXU A;  1W9H A;  4YOU A;  1L3S A;  3GOI A;  2HHQ A;  3A0I X;  3ALY A;  4CGG A;  4CGF A;  4BRF A;  4KTW A;  3OYL A;  2X6N A;  2B6A A;  3DOK A;  2FSJ A;  2B5J A;  4PHT X;  2LSN A;  2X6S A;  3F9M A;  1TKZ A;  3ZX3 A;  4OVL A;  3EZ5 A;  4BDP A;  5CZ1 A;  1VSM A;  3HPG A;  4CFD A;  4CHQ A;  4ZTJ A;  4GKJ K;  1VSH A;  4ZTF A;  1VSF A;  3VEV A;  4HUE A;  4AM6 A;  3TR8 A;  1CZ9 A;  3DRR A;  5GIP A;  5BR8 K;  5GIN A;  1NGI A;  1ATR A;  3WQU A;  5BPL A;  1RFQ A;  4DV2 K;  1QHA A;  2FBT A;  4BRG A;  4C1N K;  1MA9 B;  2Q31 A;  4CCH A;  1L3V A;  3V1O A;  2F7T A;  3HBT A;  3L0Q A;  3CCV N;  2WON A;  5AQN A;  4H8K A;  4RW4 A;  4CJ5 A;  3M8S A;  2HBJ A;  2YNI A;  3U8X A;  3THW A;  4LF7 K;  2P9L B;  2HHH K;  3UKU B;  2GV9 A;  3K0S A;  5E84 A;  1NGG A;  2O8E A;  3L2W A;  4TSX A;  2I7P A;  4DQR A;  4CZH A;  1CZA N;  3VA0 A;  3CYM A;  5FPN A;  4BWJ A;  4DSF A;  1RT5 A;  4FJK A;  1NGD A;  3DAW A;  2IGI A;  2E8A A;  3QIN A;  4B1U B;  1KFD A;  1W97 L;  3ATU A;  3LM2 A;  3DM2 A;  5M1O A;  4BY9 C;  1SKS A;  1TKD A;  5C2F A;  2YNG A;  1HNZ K;  1C0F A;  4B08 A;  1TK8 A;  1KQS M;  4M42 A;  5TKW A;  5BN8 A;  4PL7 A;  1KD1 O;  3CD6 N;  2XY5 A;  3H1V X;  4JHD B;  4BVP A;  1WNS A;  4FJ8 A;  4JKB A;  4BRN A;  1JCF A;  4Y1C A;  1GLJ O;  3WEE A;  4A61 A;  4HUG A;  3K57 A;  3QIO A;  1OVY A;  2HVH A;  3L2V A;  4CK2 A;  4WFB L;  4FJH A;  4CGD A;  4OX9 K;  5AQL A;  5AQG A;  2A42 A;  4WQ5 C;  4DSI A;  4B1Y B;  1RTH A;  4NLB A;  1D9F A;  3HL8 A;  2HBM A;  1VQ9 N;  1BQM A;  5SZT A;  1X9J A;  4DQI A;  1TUY A;  3OA9 A;  4DV4 K;  1OH8 A;  1WSE A;  1BQN A;  1BA1 A;  3HP9 A;  1TKT A;  3IKM A;  5MLC Q;  4FWM A;  4DTS A;  1S1X A;  4DTJ A;  4CJP A;  4Z4H A;  4CEA A;  3H08 A;  4RWT A;  1ILY A;  5KRT A;  5KQ8 A;  3VQQ A;  4AHV A;  2OTJ N;  4FZY A;  1RBT A;  2P9S B;  4M7Y A;  1WSI A;  3A5O C;  2E4L A;  3MCP A;  3NE6 A;  3DI6 A;  3O6W A;  1CZB A;  3AVB A;  4DR3 K;  1XC3 A;  3KHY A;  2CGK A;  4X62 K;  4FK4 A;  3JAM O;  2NRZ A;  5HP1 A;  4KTZ A;  1SKW A;  1QSL A;  5I3U A;  1IKX A;  3VQ9 A;  4KHQ A;  3OYG A;  2CGL A;  4RW7 A;  3FZK A;  3OYK A;  3S9H A;  4M7X A;  3EE8 A;  2ITG A;  3EKU A;  3AVG A;  5C10 A;  3QET A;  2GX9 A;  3DRP A;  4CF0 A;  2O8B B;  4W5N A;  3M5R A;  3CMA N;  5LL6 Z;  4ILJ A;  4BQZ A;  4FVU A;  1S6Q A;  1XMO K;  1YHQ N;  4WFN L;  1XI1 A;  3LDS A;  1YTU A;  1XNR K;  1L5U A;  4DG1 A;  1RDW X;  3J81 O;  1UA1 A;  4WFA L;  4HCB A;  3HM8 A;  4JI4 K;  3L6Q A;  4I7F A;  3ZSY A;  3J7A P;  3GBT A;  4YY3 K;  4ILH A;  4BRI A;  2VGN A;  4WE1 A;  4C8L A;  2D0B A;  3SQ2 A;  4DSJ A;  4IEI A;  1Y64 A;  2GWJ A;  5ADX A;  4LF9 K;  4FJJ A;  3J7Z O;  5CR4 A;  3CER A;  3D2F A;  1ATS A;  4IWV A;  4W5R A;  4CHO A;  3LPU A;  5FRN A;  2Q3S A;  1LWF A;  3MMV A;  5KPR A;  3VEW A;  2R7Y A;  3RRH A;  1XHZ A;  2NRX A;  4F3T A;  3A2F A;  4KTQ A;  3NMU A;  2W41 A;  5AQQ A;  3QML A;  3K9K A;  1GLD G;  1YTA A;  3ENB A;  2YJF A;  1OH7 A;  4DV1 K;  4DMN A;  1FXX A;  3F2K A;  2QXF A;  1X3M A;  2D0P A;  4MO5 A;  3RR7 A;  3U6F A;  3O9R A;  2E2N A;  2HND A;  4RG8 A;  3MDQ A;  4M3Z A;  1SV5 A;  4C8M A;  2P5O A;  4OPJ A;  1RT4 A;  2O8D A;  3KK7 A;  1XNQ K;  4LD0 A;  4G1Q A;  4OKJ A;  2YHY A;  4CJL A;  3VET A;  4Z4F A;  3MED A;  2IDO A;  3CQ8 A;  5DM7 L;  3QIP A;  3OVN A;  3VQP A;  4LH5 A;  2HMI A;  4DFP A;  2RPI A;  5AQJ A;  2F8T A;  1D5A A;  1ESV A;  3IDH A;  1NWK A;  3O4W A;  3MN5 A;  1O1W A;  3TSU A;  4FO0 A;  2KQ2 A;  5AJ3 K;  3DJC A;  3TAB A;  2QA4 N;  3FE1 A;  1DT9 A;  4MDA A;  4F9O A;  4DR4 K;  1HX1 A;  5AQU A;  4LF5 K;  4OLA A;  2VWB A;  3LP1 A;  4CF1 A;  4EHT A;  4FLV A;  3P5J A;  1MWM A;  2O8F A;  3G0Z A;  5M1Q A;  2VG5 A;  1I39 A;  2GTD A;  4JN4 A;  2G8I A;  2HVI A;  4OGC A;  2YHW A;  2GBZ A;  3C7N A;  3IMX A;  3LP2 A;  4IJA A;  3O3H A;  2PYL A;  3H3O B;  2X74 A;  2UU9 K;  2P9K B;  3NF8 A;  2BGG A;  4DU1 A;  2IVO A;  4C1N I;  1HKC A;  4GNI A;  4CD3 A;  4KFB A;  3MK6 A;  4AIL C;  4Z4G A;  3CC4 N;  2I5J A;  1R0A A;  3MXI A;  2F96 A;  4IDH A;  1HLU A;  2D0O A;  4KB0 A;  3EO3 A;  1DLO A;  5M1K A;  4KAZ A;  1BCO A;  4QS8 A;  1R59 O;  1BOT O;  3LZJ A;  1E4F T;  5CYM A;  3RRG A;  2DPN A;  3P31 A;  5H1S Q;  4KHY A;  3ZET B;  1J53 A;  3U9D A;  2OA8 A;  4FK2 A;  4KI6 A;  3RWU A;  4BDY A;  4CEF A;  1Q18 A;  4KH4 A;  4XH5 A;  1IG9 A;  2X78 A;  3CIP A;  4HCC A;  1UOC A;  4BRE A;  3ID6 A;  5F1X A;  2DFE A;  4CGJ A;  4HTU A;  3VEY A;  3I0S A;  2YJE A;  1IBK K;  3V6D A;  3NHG A;  1RT3 A;  2P1J A;  1P90 A;  4MLH A;  3LDL A;  3CPE A;  4BQL A;  2XY8 A;  3SUQ A;  4BG9 A;  1EKE A;  1Z05 A;  4B1W B;  4DF4 A;  3ZSR A;  1Q8I A;  3WXI A;  2Z1J A;  2BDP A;  2P9N B;  2PBD A;  3IRX A;  3CJ1 A;  1KXP A;  4FPB A;  2A40 A;  2P9L A;  3NH2 A;  1EWQ A;  3UKU A;  1SZ2 A;  4ISE A;  3C6A A;  2QWP A;  3K5L A;  2P9I B;  1HNX K;  1UA0 A;  4DTM A;  3UB5 A;  3OYJ A;  4IEE A;  1YAG A;  3I33 A;  3ZT3 A;  2QTD A;  4DQQ A;  4B3S K;  3AA5 X;  3BP8 A;  4DLE A;  4O8U A;  1S9E A;  1SL2 A;  4FJ9 A;  4Z4C A;  2ZJR L;  4BGA A;  2H3G X;  1TK0 A;  4DTR A;  1ZBS A;  1B92 A;  2WC9 A;  3H3N O;  4CIE A;  4PQU A;  3OBY A;  4FLY A;  1TL3 A;  5C42 A;  5J1E A;  3T7Z A;  3ULD A;  4E1N A;  3VQC A;  1J54 A;  5FDL A;  4PY5 A;  1KAY A;  5JS2 A;  4NO7 A;  2YHB A;  3VTH A;  2NRT A;  2G8F A;  2IS3 A;  1GOC A;  4CJF A;  3KWI A;  4CZK A;  1HNW K;  1C1B A;  3D6R A;  4U7B A;  4FLT A;  3NH0 A;  4IDK A;  5JVG L;  2A41 A;  4JI7 K;  4FW2 A;  3DLK A;  3SCX A;  1XMQ K;  1T6D A;  3S3N A;  1KRP A;  3O9T A;  3MWT A;  2FXU A;  2XRI A;  1VQN N;  1NK4 A;  1YI2 N;  5T7B A;  4XIU A;  3E9P A;  3CCU N;  4XH4 A;  1D8Y A;  3CCQ N;  2OPR A;  4CF8 A;  5AZJ B;  3MEE A;  3EYZ A;  2ASO A;  4UY8 O;  3TTD A;  5EOY A;  1U48 A;  1EX4 A;  1S3X A;  3L4Q A;  3EEQ A;  1T8E A;  1WLJ A;  3B8A X;  4DQS A;  3ZT2 A;  3C95 A;  3V1Q A;  3VGK A;  1J6Z A;  4MO4 A;  3QB0 A;  2P9S A;  4Y0W A;  4N76 A;  1RTJ A;  1L3T A;  4FM0 A;  3THX A;  2PZS A;  3A5N C;  4K42 A;  4H4M A;  4JS5 A;  4IO9 L;  4M3W A;  4LH4 A;  4JKC A;  2XY7 A;  5KTQ A;  1VQM N;  2YCH A;  5C0Y A;  3VN5 A;  1FKP A;  5ELZ A;  4KHU A;  4BR0 A;  3A8Y A;  4NYN A;  4Z0U A;  3TAG A;  2OAN A;  4N56 A;  4DKW A;  4FJ5 A;  4NYF A;  3ENH A;  3AVK A;  4DV6 K;  4HUF A;  3FZL A;  5EY4 A;  3H45 C;  2QWO A;  1FKO A;  2ETJ A;  1O13 A;  1JLB A;  2JWL A;  2JWK A;  4CJ4 A;  1NGB A;  4NLC A;  4ICL A;  4CVN E;  1VAZ A;  3WNG A;  1ZBH A;  4RTF D;  3AVJ A;  3QFU A;  4CZF A;  2A3Z A;  1FW6 A;  1C0U A;  4JS4 A;  4NCB A;  1NGF A;  5BR9 A;  3O9S A;  3BF3 A;  4L8R B;  3CHW A;  3U3G A;  4FJG A;  3ZYY X;  5FRM A;  1DTT A;  2BH1 A;  5M1F A;  4J2D A;  1Q7Y O;  2FBX A;  2IIR A;  3DXK A;  2W6L A;  2RKI A;  2O8C B;  4CEE A;  3LAK A;  5DMR A;  3NDK A;  1I94 K;  1DTQ A;  1LW0 A;  2NRR A;  4CK1 A;  3O8M A;  3W3D A;  1N36 K;  4IOA L;  2F4V K;  1XUP O;  3ZSX A;  1Z25 A;  2E20 A;  4CHY A;  1I3A A;  2E2O A;  3SPY A;  2B4J A;  1F21 A;  4EFH A;  3GE1 A;  1Q9Y A;  4CW7 B;  2YKN A;  3DXM A;  3CCL N;  2Z1H A;  3LAM A;  4N5S A;  1WSH A;  3O1B A;  4CJQ A;  2AP1 A;  4EZ6 A;  1U2V B;  2BE2 A;  3DLR A;  3VQ7 A;  4CFA A;  1KCF A;  1IKY A;  5HBM A;  3MEG A;  3MN7 A;  4B1V A;  3ULE B;  1D4X A;  2IAJ A;  4OJR A;  3LZI A;  2IC3 A;  3KZB A;  2P9P A;  2ZE2 A;  4DQ8 A;  2FLO A;  3LDP A;  1W0H A;  2P51 A;  1JLC A;  3SAG A;  4H0Y B;  2VG6 A;  3G71 N;  4GW6 A;  3PIP L;  3R3L A;  1QQC A;  1ZBU A;  1LWC A;  1ITG A;  2A1S A;  4IFV A;  4IKF A;  4J2E A;  4GV6 A;  4KBO A;  1JL2 A;  3O4N A;  3LP0 A;  2HBK A;  4Q0B A;  3MX5 A;  5CE3 A;  4K43 A;  5BRH A;  2KTQ A;  4CJE A;  5F2R A;  5EXW A;  2F9T A;  1VRT A;  4BRP A;  3ZLJ A;  4FOI A;  4FW1 A;  1WB9 A;  5KQD A;  3P39 A;  2YNF A;  2KHO A;  1EWR A;  4H0V B;  2VWJ A;  3UKR A;  1IH7 A;  2VQE K;  2FSK A;  4E1J A;  4JKH A;  4XH1 A;  5EX5 A;  1JKH A;  1BU6 O;  4CE9 A;  3O1W A;  1RTD A;  3NGY A;  4C8K A;  2YNH A;  4AHT A;  2P9K A;  3NH1 A;  2PAV A;  1XQS C;  2HW3 A;  4WF9 L;  3JYT A;  1ASU A;  4EIA A;  5KRS A;  1S1T A;  4BWM A;  3WXK A;  1SS6 A;  2E88 A;  2HBL A;  3IFR A;  3G6E N;  2UUC K;  5CHI A;  3NF6 A;  2KFZ A;  4IBN A;  4CGH A;  3EZW A;  1VRU A;  5AR0 A;  4FWN A;  2D5R A;  4KV8 A;  3N4P A;  2PFU A;  3CPW M;  1FJG K;  1NU0 A;  3W0L A;  3ZET A;  1YJN N;  3VEX A;  4E89 A;  3KK3 A;  4CF9 A;  1RDB A;  2E6M A;  1X9S A;  4CD1 A;  3F5T A;  3VEN A;  3SZ2 A;  3ZX0 A;  4M3U A;  4K41 A;  1S1W A;  2O4G A;  1C0M A;  1MDU B;  2O4I A;  4X64 K;  1HYZ A;  1GOB A;  3L4I A;  2ZF5 O;  4CEB A;  5J2P A;  2IVN A;  5BN9 A;  4I6M A;  1U04 A;  4EAH D;  5E26 A;  3OYC A;  1N6Q A;  3HTV A;  3VF2 A;  3SNN A;  4B3R K;  3RR8 A;  3SJJ A;  2QXL A;  1WAF A;  3OYE A;  1IBM K;  3O80 A;  1BDG A;  1NK0 A;  1JL1 A;  3CFR A;  4YFU A;  3THY B;  2KLA A;  3Q7B A;  3ITH A;  3C94 A;  3KD1 E;  3S41 A;  1HPM A;  3DLH A;  3QEW A;  3I0R A;  3VEZ A;  2V52 B;  5C15 A;  1VSK A;  3WQT A;  4AHU A;  4A5A A;  1QSY A;  4DFM A;  3C6H A;  4DSE A;  4JK8 A;  3CJB A;  4M63 C;  5FLX O;  2GEM A;  4QOZ B;  1HUX A;  1TK5 A;  4NCG A;  4JI5 K;  4CHN A;  1SL1 A;  3EL2 A;  2HNY A;  4KRF A;  4B9S A;  3LWM A;  4HTL A;  5GAG P;  3BZK A;  3LAN A;  4X65 K;  1NK6 A;  5CYQ A;  5AQH A;  4CFB A;  1TAQ A;  2W42 A;  4Z4I A;  1RDU A;  1U49 A;  3OW2 M;  1TKX A;  2QWQ A;  4FYD A;  4GY2 B;  3H6E A;  1C6V A;  4XEI A;  4OPH A;  3O3G A;  3SJH A;  3T19 A;  4R79 A;  4IG3 A;  4E3S A;  3RMA A;  2GUP A;  3KIO A;  3VQE A;  1VSI A;  4CJ3 A;  3AAQ A;  3KLH A;  3DLB A;  1BL3 A;  3ISN C;  4LY7 A;  4CED A;  4DCH A;  3VQ5 A;  3DMJ A;  2OYQ A;  3EN9 A;  4F2R A;  1YVN A;  2HF4 A;  3KJV A;  2NRV A;  1K73 O;  3ZT4 A;  4B1X B;  5GAD P;  4DS4 A;  3G25 A;  3ZEU B;  1XWL A;  3WXJ A;  4WCE L;  3FFI A;  5AFU H;  4CEO A;  5IT9 O;  4M41 A;  4FZZ A;  4NXM K;  4QCL A;  1J9A A;  1A5X A;  3CQX A;  3LL3 A;  3D2E B;  4WQ4 A;  4LFB K;  3TWH A;  3FZM A;  3D0P A;  5LMU K;  1RBR A;  1P8Z A;  4BC5 A;  2DFH A;  4FWL A;  1VK0 A;  3OHR A;  3SK3 A;  3L3V A;  4PKH A;  2OZM A;  4IFY A;  2CH5 A;  3HT3 A;  4CJW A;  3VES A;  3L2R A;  4PKG A;  1BCM A;  1BG3 A;  3FZH A;  2Y1I A;  1RDC A;  3TAE A;  3SPZ A;  1HYV A;  4DQP A;  3CCJ N;  1H1V A;  1S1U A;  1XC9 A;  4DS5 A;  1ZYQ A;  4JNE A;  3ZSQ A;  1HNI A;  2DY4 A;  1IV0 A;  3AAR A;  2G8U A;  2FBY A;  4J2B A;  3AVH A;  3IUC A;  3KVG A;  3NGI A;  3CCM N;  3NVM A;  3K58 A;  1N34 K;  4BRM A;  4LSL A;  3AVN A;  1NKE A;  2YX6 A;  3QEP A;  4B9U A;  1BIS A;  3L2Q A;  4BAC A;  4CER A;  3HJF A;  1S72 N;  5C25 A;  1KVB A;  1YUW A;  5AZI B;  3P38 A;  4ILG B;  2Q36 A;  4O55 A;  4KKO A;  3CG7 A;  4I9L A;  4O44 A;  4CI6 A;  5J2M A;  4LFC K;  1QVG M;  4FWQ A;  4DR1 K;  4DF8 A;  4NCA A;  2P9U A;  1U45 A;  3HO1 A;  3AO5 A;  3AO1 A;  3KLF A;  1OH5 A;  2NNW A;  3HST B;  2PYJ A;  4CIF A;  4CZL A;  4YOT A;  1EO1 A;  1VQO N;  4JD2 B;  1KVC A;  4KHS A;  1QQN A;  1GLB G;  1HJO A;  1TV6 A;  2ZGY A;  5FPM A;  1VQL N;  2O8C A;  4B9L A;  1EXQ A;  2NZT A;  3KK1 A;  1DKG D;  3B6O A;  4CHP A;  5IWA K;  2GEL A;  3AVC A;  4B3T K;  4RCH A;  2PY5 A;  5AQM A;  4MFB A;  1HPZ A;  5HOO A;  5A2Q O;  1ZXO A;  3VQ4 A;  2KZZ A;  3M6G A;  5SWM A;  4OKE A;  1VSE A;  2KFN A;  2OTL N;  4DU4 A;  3ENO A;  3QNO A;  4GV9 A;  4DSK A;  3OJU A;  3AGK A;  4CBX A;  4BC2 A;  3HK2 A;  3ATV A;  4EP4 A;  4FJL A;  5TKY A;  3G4S N;  4O4G A;  3NF7 A;  3R6M A;  2QWR A;  1HR0 K;  3ULE A;  4BRK A;  1K8K B;  2F9W A;  3J8A A;  5GIO A;  2VQF K;  4IJN A;  1VHX A;  3SMP A;  3PX0 A;  3RTV A;  4DR5 K;  4FOE A;  3TTF A;  4HWI A;  2WFB A;  4FJX A;  3EY1 A;  3LDO A;  1NK9 A;  1HKB A;  1N33 K;  3NFA A;  3RMB A;  3WNH A;  4DV5 K;  5AQK A;  3NAE A;  3HYF A;  1KAX A;  3L2U A;  5AQZ A;  2HOE A;  3CFP A;  3O5B A;  1Q86 O;  1WUA A;  3VPZ A;  5LJW A;  4E7L A;  1CLQ A;  3TTC A;  4KPY A;  3PLA A;  3SV4 A;  5KPT A;  1QSS A;  4GMJ B;  1JXE A;  4CBU A;  2BUP A;  4BR5 A;  2VWK A;  2XO7 A;  4L3Q A;  3ID8 A;  1KLN A;  4E7I A;  3DOL A;  4H0P A;  1HYS A;  3H1Q A;  3VMF B;  2E2P A;  4FZX C;  1NGA A;  1NMN A;  2D4W A;  2VYP A;  3HP6 A;  4N47 A;  4ELV A;  1NOZ A;  5GAH P;  5BRF A;  2NRH A;  2RN2 A;  1RGI A;  1OH6 A;  3U3Y A;  3CF5 L;  4OPA A;  2W6K A;  1ASV A;  1WOQ A;  4B9T A;  1Q81 O;  4CJV A; 
#chains in the Genus database with same CATH homology
 4JHD A;  4IOA L;  1X9J A;  1XUP O;  2ZJQ L;  2E20 A;  1TUY A;  3OA9 A;  4H5R A;  2E2O A;  4DHY A;  4BG8 A;  2E2Q A;  4EFH A;  1BA1 A;  3GE1 A;  5AQW A;  3IKM A;  3WXL A;  1X3N A;  4FWM A;  5MLC Q;  2QM1 A;  2A5X A;  3DXM A;  4FWO A;  1OKJ A;  3CCL N;  4RWT A;  3GG4 A;  3O1B A;  1ILY A;  5KQ8 A;  1KC8 O;  5FPD A;  5AQR A;  2AP1 A;  1U2V B;  1SQK A;  4BRD A;  1YJW N;  4BRC A;  2OTJ N;  4BRH A;  4MDB A;  3MN7 A;  1EQY A;  3GL1 A;  4B1V A;  3ULE B;  2P9S B;  2QA4 N;  4M7Y A;  1D4X A;  3HZ6 A;  3O08 A;  3A5O C;  5C2D A;  3MN9 A;  3LM9 A;  4IXC A;  3MCP A;  3VF6 A;  3CJA A;  2VCP A;  3TU5 A;  3UKR B;  3O6W A;  3KZB A;  1XC3 A;  2P9P A;  3KHY A;  2CGK A;  3QFP A;  4DQ8 A;  2FLO A;  3LDP A;  4BC4 A;  3SAG A;  4JAX A;  4YOW A;  2NRZ A;  4H0Y B;  2HST A;  4IOX A;  5BRE A;  3G71 N;  2FSN A;  1M90 O;  3PIP L;  3R3L A;  3U4L A;  3CQY A;  2Q0R A;  1QQO A;  3SBT A;  3A5M C;  4B9Q A;  4KH6 A;  3T69 A;  1GLA G;  4FSV A;  4KBO A;  4GV6 A;  2CGL A;  3D2F B;  3FZK A;  4GV3 A;  4M7X A;  3EE8 A;  2HBK A;  4KH5 A;  1U2V A;  2GWK A;  3MX5 A;  5CE3 A;  1YJ9 N;  3EKU A;  1IJJ A;  3N4Q A;  4K43 A;  4JKF A;  5BRH A;  5C10 A;  5JIC A;  2E1Y A;  3WEE B;  3WXM B;  2GX9 A;  2QEX N;  5F2R A;  3M5R A;  5EXW A;  2F9T A;  3CMA N;  4BRP A;  4FVU A;  4ILJ A;  4BQZ A;  3KWG A;  4FOI A;  2YI1 A;  4GVE A;  5AQP A;  1YHQ N;  1VQ4 N;  4WFN L;  3TSQ A;  1VQ6 N;  5KQD A;  3P39 A;  4A62 A;  2KHO A;  1RDW X;  4H0V B;  3UKR A;  4WFA L;  3SMS A;  2FSK A;  4E1J A;  3CCE N;  3HM8 A;  3VOV A;  3OBW A;  4BVO A;  1GLL O;  3L6Q A;  4JKH A;  4XH1 A;  1DEJ A;  3GBT A;  5EX5 A;  3FLC O;  1BU6 O;  4ILH A;  3O1W A;  4BRI A;  2D1K A;  1VQK N;  5AQF A;  3PIO L;  2VGN A;  2P9K A;  4IEI A;  1Y64 A;  2GWJ A;  2PAV A;  2ITM A;  4BRA A;  1XQS C;  5ADX A;  3E9O A;  3EKS A;  4WF9 L;  4EIA A;  2VGM A;  5EVZ A;  3MCA B;  5CR4 A;  3J7Z O;  4A2B A;  3CER A;  3D2F A;  1ATS A;  1GLE G;  4IWV A;  4CZG A;  3I55 N;  2CH6 A;  4O5F A;  3WXK A;  4I6M B;  3MMV A;  1SS6 A;  2HBL A;  2E88 A;  3IFR A;  4FL9 A;  5KPR A;  3G6E N;  3VGL A;  3DLL L;  5CHI A;  3ZX2 A;  3VEW A;  2NRX A;  5C12 A;  3R8E A;  3LDQ A;  3NMU A;  3HOS A;  4AF1 A;  2W41 A;  5AQQ A;  3QML A;  1Z6R A;  3K9K A;  3EZW A;  1GLD G;  3ENB A;  2EWS A;  5AR0 A;  1TYQ A;  2YJF A;  4FWN A;  2FF6 A;  3FR0 A;  3F2K A;  3N4P A;  2PFU A;  3CPW M;  5ADX H;  1X3M A;  2D0P A;  4MO5 A;  1MWK A;  3W0L A;  1GLC G;  3O9R A;  3ZET A;  2E2N A;  1YJN N;  1NMD A;  3MDQ A;  1NLV A;  2HF3 A;  3FGU A;  5AQV A;  5JLH A;  3CME N;  3SLC A;  3VEX A;  4BRQ A;  1BUP A;  3KK7 A;  4CD1 A;  3AGR A;  3TSP A;  3F5T A;  3VEN A;  2YHY A;  3ZX0 A;  4IO8 A;  3AAP A;  3VET A;  4YOY A;  4K41 A;  5FPE A;  2QI2 A;  2RHK A;  3O9Q A;  1E4G T;  4BGB A;  2QWM A;  5DM7 L;  2ASM A;  4JK9 A;  1Q82 O;  3FZF A;  1JJ2 M;  2A6A A;  1MDU B;  4OO1 J;  3MN6 A;  3L4I A;  2ZF5 O;  4YOX A;  3E9L A;  2IVN A;  5AQY A;  5BN9 A;  4I6M A;  5AQJ A;  4EAH D;  1ESV A;  5E26 A;  1G99 A;  3HTV A;  3VF2 A;  3IDH A;  3HOT A;  1NWK A;  4JK7 A;  2QXL A;  3WUH A;  3O4W A;  4BRO A;  3E1Y A;  3O80 A;  2ZJP L;  1BDG A;  3D2E A;  3MN5 A;  4NB4 A;  4QS9 A;  3TSU A;  4FO0 A;  4A59 A;  1VQ8 N;  4BRL A;  1TUU A;  3DJC A;  2KLA A;  3FE1 A;  5DM6 L;  1QZ5 A;  3Q7B A;  4H5V A;  1DT9 A;  4MDA A;  2V51 B;  4F9O A;  4YOV A;  1HX1 A;  2QW9 A;  5AQU A;  1HPM A;  2VWB A;  3D7E O;  3S41 A;  1BO5 O;  3VEZ A;  2V52 B;  5C15 A;  5KPZ A;  3CJC A;  3WQT A;  4EHT A;  3K9J A;  1YIJ N;  1MWM A;  4PKI A;  4A2A A;  5M1Q A;  4FWS A;  3C0B A;  1HKG A;  4QS7 A;  2GTD A;  3CI5 A;  4JN4 A;  4CJ7 A;  4A5A A;  3M1F A;  3HRG A;  4PL8 A;  2YHW A;  1C0G A;  4U67 L;  1YF5 L;  3C6H A;  3C7N A;  4IJA A;  3IMX A;  4H5W A;  3CJB A;  4JK8 A;  4M63 C;  1NM1 A;  1JCE A;  3H3O B;  1YIT N;  2GEM A;  2KKZ A;  3WT0 A;  1HUX A;  4J8F A;  5F0X A;  2P9K B;  3I8B A;  5JMV A;  3EL2 A;  1VQ7 N;  3I56 N;  4HTL A;  5GAG P;  3BEX A;  2IVO A;  1BWF O;  1NGE A;  4FWK A;  4C1N I;  4Z94 A;  1LCU A;  1HKC A;  4GNI A;  5AQH A;  4CD3 A;  3MK6 A;  4YDU A;  3CC4 N;  1RDU A;  3GDQ A;  4H0O A;  3OW2 M;  2QWQ A;  2ZWH A;  1YXQ A;  3FFK B;  3QBX A;  4G9Z A;  5AZI A;  4MLE A;  4GY2 B;  4YDU C;  4BR4 A;  3H6E A;  3CET A;  4XEI A;  4OPH A;  3SJH A;  4IDH A;  4CZM A;  1ZC6 A;  4R79 A;  1HLU A;  2D0O A;  1T44 A;  3EO3 A;  3SAF A;  3CCR N;  1T3V A;  2ASP A;  2CGJ A;  5M1K A;  5AFU A;  2GUP A;  4QS8 A;  1R59 O;  1VQP N;  3EE9 A;  1TYQ B;  2RE2 A;  1BOT O;  1E4F T;  2DPN A;  3AAQ A;  5I9E B;  3P31 A;  5H1S Q;  1V4S A;  3ZET B;  5M1P A;  4FPA A;  3VER A;  3U9D A;  3CC7 N;  3BF1 A;  1NGC A;  3SAH A;  4DCH A;  3CC2 N;  1Q18 A;  4KH4 A;  4XH5 A;  4A5B A;  4H5T A;  5M1N A;  3Q7C A;  3CIP A;  3EN9 A;  1YVN A;  2HF4 A;  4BRE A;  2NRV A;  4JD2 A;  3ID6 A;  1K73 O;  5F1X A;  4FWP A;  4B1X B;  4DB3 A;  5GAD P;  3G25 A;  3ZEU B;  3QIC A;  3VEY A;  2UYT A;  5B8H A;  2YJE A;  3WXJ A;  4WCE L;  5JLF A;  5HL7 L;  3TPQ A;  5AFU H;  3CJ7 A;  5GAE P;  3QBW A;  1ATN A;  2W40 A;  4IFE A;  1GLF O;  1SAZ A;  3E66 A;  3DWL A;  1P90 A;  3HSC A;  1S22 A;  3CQX A;  3LL3 A;  4JKG A;  3HI0 A;  3LDL A;  3D2E B;  4MLH A;  4WQ4 A;  3CPE A;  4BQL A;  3FZM A;  4H0X B;  5BPM A;  3UE5 A;  5BRD A;  5AQO A;  5JVH L;  1NGJ A;  5AQT A;  4BG9 A;  1Z05 A;  1LOT B;  1IG8 A;  4B1W B;  5BPN A;  1P8Z A;  4BC5 A;  4FWL A;  2Q1N A;  4CZI A;  3OHR A;  3SK3 A;  3M3Z A;  4PKH A;  1NJI O;  1VQ5 N;  3WXI A;  1U6Z A;  3AY9 A;  4BR2 A;  2CH5 A;  2P9N B;  4BR7 A;  2PBD A;  2NRW A;  3CJ1 A;  1KXP A;  4FPB A;  3VES A;  4PKG A;  1BG3 A;  2A40 A;  2P9L A;  2V7Z A;  3FZH A;  4FWR A;  3UKU A;  3VGM A;  1SZ2 A;  2P9U B;  1K8K A;  4ISE A;  3CCJ N;  1H1V A;  2YHX A;  3C6A A;  3C7N B;  2QWP A;  4JNE A;  4WQ5 A;  2P9I B;  2Q2R A;  3O9U A;  3ZEU A;  2ZGZ A;  1W2B M;  4K25 A;  3AAR A;  3UB5 A;  4AM7 A;  3MWP A;  4IEE A;  3IUC A;  3KVG A;  1YAG A;  3CCM N;  1N8R O;  3I33 A;  3NVM A;  1V4T A;  4BRM A;  2QTD A;  2WBN A;  4CBW A;  3NVK A;  4JKD A;  1NGH A;  2YX6 A;  1QZ6 A;  3CXC M;  2QWL A;  3BP8 A;  5LY3 A;  1S72 N;  1K9M O;  1YUW A;  3P4I A;  5AZI B;  3RSE A;  4O8U A;  3C65 A;  3P38 A;  4ILG B;  5AQI A;  2ZJR L;  4BGA A;  2H3G X;  1KAZ A;  2Q36 A;  1BA0 A;  1ZBS A;  1QQM A;  3JXU A;  4YOU A;  2FF3 B;  2WC9 A;  3W3D A;  3H3N O;  4JKE A;  1T6C A;  3GOI A;  2P9N A;  3A0I X;  3OBY A;  3LDN A;  4WYB A;  4CI6 A;  4EHU A;  1M1K O;  3T7Z A;  4BRF A;  5LJV A;  1QVG M;  4FWQ A;  4A57 A;  2FSJ A;  4O8K A;  4CZE A;  4PHT X;  1NBW A;  2P9U A;  1KAY A;  3F9M A;  4NO7 A;  3ZX3 A;  3VTH A;  2NRT A;  3H46 O;  4BR9 A;  2P9I A;  2NNW A;  3KWI A;  4CZK A;  2IVP A;  4JKA A;  4CZL A;  4ISG A;  3D6R A;  4H03 B;  4YOT A;  4U7B A;  1EO1 A;  1VQO N;  4JD2 B;  3VEV A;  1K8A O;  5JVG L;  2A41 A;  1QQN A;  1GLB G;  1HJO A;  4AM6 A;  2ZGY A;  5FPM A;  1VQL N;  3VF4 A;  2NZT A;  1DKG D;  5GIP A;  1T6D A;  4H5N A;  5GIN A;  1QVF M;  1NGI A;  1ATR A;  2J4R A;  2GEL A;  3CJ9 A;  4ISF A;  4RCH A;  3WQU A;  3O9T A;  5AQM A;  1DGK N;  3MWT A;  5HOO A;  5BPL A;  1RFQ A;  2FXU A;  1ZXO A;  1VQN N;  1QHA A;  1YI2 N;  3CCU N;  3E9P A;  3SBG A;  4BRG A;  4XH4 A;  3M6G A;  3CCQ N;  4JKG B;  4B1Z A;  2NLX A;  1MA9 B;  2Q31 A;  5AZJ B;  4C1N K;  2ASO A;  2OTL N;  2Q97 A;  4UY8 O;  4C23 A;  3ENO A;  2F7T A;  4H0T B;  3TTD A;  5EOY A;  3HBT A;  1S3X A;  3L0Q A;  3CCV N;  3L4Q A;  4GV9 A;  5AQN A;  3RVC A;  3AGK A;  3B8A X;  1JCG A;  2HBJ A;  4CBX A;  2E1Z A;  4BC2 A;  4CZJ A;  3ATV A;  3R1X A;  3U8X A;  5TKY A;  1J6Z A;  3A5L C;  4MO4 A;  3VGK A;  3G4S N;  5AQX A;  2P9L B;  3QB0 A;  3R6M A;  2QWR A;  3UKU B;  3ULE A;  4IOC L;  2P9S A;  4Y0W A;  2I7N A;  4BRK A;  1K8K B;  2F9W A;  1NGG A;  4JEP A;  3QDK A;  5E84 A;  3J8A A;  5GIO A;  3A5N C;  2I7P A;  4K42 A;  4IJN A;  4CZH A;  1CZA N;  4IO9 L;  4JKC A;  3SMP A;  5FPN A;  1VQM N;  2YCH A;  3MX2 A;  3R9P A;  5C0Y A;  1NGD A;  4FOE A;  4HWI A;  3TTF A;  3DAW A;  2HMP A;  2E8A A;  2WFB A;  4B1U B;  5ELZ A;  3LDO A;  1W97 L;  1HKB A;  3A8Y A;  3ATU A;  3DXK B;  3LM2 A;  4YOR A;  5M1O A;  4BR0 A;  4BY9 C;  5C2F A;  5AQK A;  4LC9 B;  1KAX A;  5AQZ A;  1C0F A;  2OAN A;  2HOE A;  5AZJ A;  2QWN A;  5AQS A;  5TKW A;  5BN8 A;  3O5B A;  4PL7 A;  1KQS M;  4DKW A;  1Q86 O;  1WUA A;  1KD1 O;  3CD6 N;  3RSE B;  3VPZ A;  3ENH A;  3H1V X;  4IZ9 A;  4JHD B;  3JS6 A;  5LJW A;  4BVP A;  3FZL A;  2WUS A;  4JKB A;  4WQ4 C;  4BRN A;  3TTC A;  5EY4 A;  3H45 C;  3PLA A;  2QWO A;  2JWL A;  1JCF A;  1O13 A;  5KPT A;  2JWK A;  3U9Z A;  1NGB A;  4NLC A;  3DXM B;  1VAZ A;  4RTF D;  1GLJ O;  4CBU A;  3WEE A;  2BTF A;  3QFU A;  3VEO A;  4CZF A;  2BUP A;  4BC3 A;  2A3Z A;  4A61 A;  4BR5 A;  4L3Q A;  3ID8 A;  3VTI A;  1OVY A;  1NGF A;  5BR9 A;  4H0P A;  3H1Q A;  3VMF B;  3O9S A;  2E2P A;  3CCS N;  3BF3 A;  1NGA A;  3CHW A;  4WFB L;  3ZYY X;  2D4W A;  2VYP A;  2BH1 A;  5AQL A;  5M1F A;  5AQG A;  2A42 A;  4WQ5 C;  1Q7Y O;  5GAH P;  2IIR A;  5BRF A;  3DXK A;  2NRH A;  1RGI A;  2V7Y A;  4B1Y B;  3BUZ B;  4NLB A;  3CF5 L;  4OPA A;  2Q0U A;  2NRR A;  1WOQ A;  3O8M A;  2P9P B;  1Q81 O;  2HBM A;  1VQ9 N;  2AA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...