1Q18A

Crystal structure of e.coli glucokinase (glk)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
320
structure length
320
Chain Sequence
TKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGCIAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFGGAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAEIGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVIMGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIVHDNPGLLGSGAHLRQTLGHIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucokinase
publication title Crystal structures of Escherichia coli ATP-dependent glucokinase and its complex with glucose.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 92
structure length 320
sequence length 320
chains with identical sequence B
ec nomenclature ec 2.7.1.2: Glucokinase.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02685 Glucokinase Glucokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1q18A01
3.40.367.20 Alpha Beta 3-Layer(aba) Sandwich Hexokinase; domain 1 Hexokinase; domain 1 1q18A02
2D4WA 2QWLA 1HLUA 1NGAA 4B1ZA 1JCEA 3CHWA 4IO8A 3IMXA 3D7EO 4O5FA 3VEYA 3FLCO 3H3NO 4H5NA 4CZEA 3G25A 3KHYA 3CJ1A 3J8AA 3CERA 3O6WA 5FPMA 1V4TA 3UKRB 2A5XA 1NLVA 1T6CA 3AY9A 3SMSA 3VF4A 2E2OA 3EKUA 3BF1A 3WXLA 4B1XB 2HF3A 4FWLA 3HI0A 3HTVA 3EN9A 3FFKB 1MWMA 1OKJA 2YHXA 3VGMA 2E2PA 4K42A 4PKHA 5AQTA 4XH5A 1QQOA 2J4RA 5F2RA 2QWPA 2BUPA 4BRGA 4JAXA 2V7YA 4BR9A 4LC9B 1BA1A 3U4LA 5AQZA 2P9LA 1BG3A 2ZGYA 3GG4A 3WQUA 3ZX3A 4C23A 2D0OA 4A62A 1S3XA 2CGKA 3HBTA 3GBTA 1QQNA 1P8ZA 4XEIA 4H5VA 5E26A 4CZMA 1BWFO 3BEXA 3QMLA 5AQGA 3H1VX 1Q18A 3MN9A 4PL7A 3LDLA 1BDGA 3VF2A 1NGGA 3O80A 4I6MA 4IJAA 1IG8A 5AQQA 1NGHA 5AQUA 3UB5A 3VOVA 5AQKA 2FSNA 1ATRA 1HKCA 3EO3A 4BRQA 4JD2A 4QS7A 1RGIA 3VENA 2VYPA 4EIAA 3A0IX 3BF3A 2P9UA 3TPQA 5EY4A 1GLDG 4CZGA 4WQ5A 4FWRA 1GLEG 4L3QA 5JMVA 2QWOA 3QB0A 4EHTA 1ZXOA 3U9DA 1G99A 4Y0WA 4BR0A 3AARA 4BVPA 1YUWA 3RSEB 2P9NB 2D0PA 1XC3A 2P9IB 4XH1A 3ZETA 4CI6A 2AA4A 3KVGA 5BPLA 3HM8A 3LM9A 1EQYA 3QBXA 3A5NC 5AZIB 5AQJA 3VGKA 4FWQA 5KQDA 4BRDA 3EZWA 2IVNA 3S41A 1U2VA 4WQ4A 3H1QA 1RFQA 1XUPO 3EL2A 2KHOA 1DGKN 2IIRA 4GY2B 2GUPA 2F9WA 2PAVA 2Q0UA 1ATSA 1NGIA 2I7PA 2YI1A 5FPDA 3JS6A 4H0VB 3AAPA 2EWSA 1ATNA 1MWKA 3U8XA 5AQRA 1KAZA 5EX5A 1NGCA 2FXUA 4XH4A 3ENOA 3CETA 4BRKA 4EHUA 4H0OA 3L4IA 2OANA 3R8EA 3D2EA 3VESA 1NMDA 4B1WB 1IJJA 4BQLA 1WUAA 3R6MA 4RTFD 5AR0A 3FZMA 3W0LA 4JHDA 3F9MA 3MDQA 4HWIA 3VERA 2GEMA 2YCHA 3DXKB 2FLOA 3JXUA 4FWNA 5AFUA 2QWNA 1NBWA 2Q36A 2E2QA 4JNEA 3ZX2A 4B1YB 4CZFA 3VF6A 4CZIA 5AFUH 3W3DA 1J6ZA 3UKUA 2P9LB 3ULEB 1NGDA 2FSKA 5TKYA 2Q97A 4DCHA 4PKIA 4F9OA 2A41A 2HOEA 3WEEA 3O1BA 5FPEA 5AQMA 2A6AA 2ITMA 3AAQA 4H5RA 4FWOA 4BR4A 3ID8A 2IVPA 4M7XA 2FF6A 5LY3A 1BO5O 4WQ5C 5JICA 1QZ5A 4YDUC 3ATVA 1JCFA 5BN8A 4BREA 3CJCA 4MLEA 4BC2A 2E1YA 3WQTA 5ELZA 1GLFO 4BRHA 1NGFA 3FGUA 4CJ7A 1NGEA 1Z05A 4H0XB 2ZWHA 2GELA 3B8AX 3M6GA 2E8AA 1ZC6A 2NLXA 3FZLA 2P9UB 3D2FA 4H5TA 2P9SB 3VPZA 2CH6A 4H0YB 1JCGA 1V4SA 3GDQA 2GWJA 3BUZB 1NM1A 3LL3A 4CZKA 1MDUB 3LDPA 3CQYA 4K41A 1LOTB 2FF3B 2Q31A 2Q2RA 4BVOA 4H0TB 3LM2A 1NWKA 1TYQA 3EKSA 4B9QA 4PKGA 2HF4A 5AQOA 1DEJA 3I33A 2W41A 5EXWA 3DAWA 2W40A 4BRCA 1HKGA 5BRHA 4H0PA 4NB4A 3MN6A 1KAXA 5BRDA 3QFUA 3GOIA 4QS8A 3HSCA 5AZJB 1GLLO 2P9KB 2WUSA 4BRMA 2V52B 5KPTA 1KXPA 1QQMA 2FSJA 3ENHA 4FL9A 5FPNA 3DXMA 3A5OC 2F9TA 2QW9A 4E1JA 5BR9A 1Z6RA 1ESVA 1X3MA 3FR0A 3R9PA 1CZAN 2V51B 3O08A 3ZEUA 3VEOA 1E4FT 3O4WA 3P4IA 3H45C 1NGBA 3GL1A 1GLCG 2E1ZA 3M3ZA 4MO4A 1K8KA 1KAYA 3CJ9A 3DWLA 1BU6O 5AQWA 3VEXA 3LDOA 3CJAA 4ISGA 5AQXA 4CBWA 3C7NB 3O5BA 4BG8A 4ISEA 4ISFA 3C0BA 2PBDA 3A5MC 1BA0A 1RDWX 2YHWA 1ZBSA 3GE1A 3QFPA 1X9JA 3VEVA 1T44A 4EAHD 2E88A 1GLBG 3CJBA 4DQ8A 4JHDB 3ATUA 4IWVA 2QXLA 4DB3A 3FZHA 3MN5A 3VEWA 5ADXA 2CGLA 5AQSA 1BOTO 3L0QA 2A3ZA 3A5LC 4IZ9A 1S22A 1YXQA 4FWSA 5ADXH 4CBXA 1HX1A 3UKUB 2QWQA 4RWTA 3SJHA 1BUPA 1E4GT 5KPZA 3H46O 4CBUA 3U9ZA 2CGJA 3WEEB 4FPAA 4A2BA 3WXJA 5F1XA 4CZLA 1GLAG 2YJFA 3H3OB 1X3NA 2ASOA 2V7ZA 5AQHA 4EFHA 1HKBA 3O1WA 2GWKA 4J8FA 4BRPA 4CZHA 3LDNA 2Q1NA 4FWKA 3VETA 4JN4A 4FWMA 5JLHA 4BR7A 4CD3A 1T6DA 1LCUA 2P9PA 1SQKA 2A42A 3D2FB 2AP1A 1DKGD 3ZX0A 5I9EB 3VGLA 4I6MB 3QICA 2BTFA 4BRAA 3DXKA 4BG9A 3UE5A 2H3GX 2E20A 4Z94A 1R59O 3WT0A 4FOIA 4JD2B 3UKRA 4IXCA 4BRLA 1NGJA 2YHYA 2E2NA 1HJOA 5AQLA 5AQPA 1U6ZA 1TYQB 5BRFA 3CI5A 3ULEA 1SAZA 3KZBA 3CJ7A 3L6QA 3QDKA 5AQFA 4K43A 4BROA 3BP8A 4B1UB 2CH5A 3MN7A 4BQZA 3HZ6A 2DPNA 4WQ4C 3M1FA 5EOYA 3VEZA 4BGAA 2I7NA 4BR2A 4FPBA 3MMVA 4BGBA 5BPNA 3DXMB 4AM7A 2Q0RA 4O8KA 3ZETB 4A61A 2GTDA 1C0GA 5BPMA 2ASMA 5EVZA 3ZEUB 4B1VA 4CD1A 5LJVA 3O8MA 4FSVA 4CZJA 1Y64A 2QM1A 3MK6A 1K8KB 2QWRA 2IVOA 4KBOA 4GNIA 3A8YA 3FZKA 1U2VB 2ZF5O 1TUUA 4WYBA 4M63C 4BRFA 5BREA 2A40A 5AQVA 5AQYA 2P9SA 1HPMA 3IFRA 4BC5A 3FZFA 5LJWA 4MLHA 1HUXA 4YDUA 4A2AA 2HMPA 4BRNA 4M7YA 2NZTA 4DHYA 5AQIA 1TUYA 3H6EA 5JLFA 4H03B 3DJCA 1WOQA 4HTLA 3WUHA 4AM6A 3I8BA 3SK3A 4IJNA 1QZ6A 4BRIA 3IDHA 1YVNA 4FOEA 5AQNA 1H1VA 1YAGA 4QS9A 3WXIA 5BN9A 5KQ8A 2VCPA 3D2EB 4K25A 4NO7A 5E84A 3QBWA 3MCPA 3CIPA 5KPRA 2YJEA 4MO5A 5F0XA 2QWMA 3CQXA 1SZ2A 2ZGZA 5AZJA 2P9KA 3SLCA 2NRHA 1C0FA 2D1KA 3TU5A 3FE1A 1D4XA 1XQSC 3RSEA 2P9NA 2UYTA 2P9IA 4RCHA 1QHAA 5B8HA 5CE3A 2VWBA 4FWPA 3LDQA 4H5WA 1GLJO 5AZIA 3WXKA 4BR5A 1MA9B 4FO0A 4BC4A 2ASPA 4PL8A 3SMPA 3C7NA 3IUCA 4BC3A 2P9PB 3OHRA
chains in the Genus database with same CATH superfamily
3DOLA 3CFOA 1BIZA 1WSHA 1JCEA 2UUAK 3IMXA 4B3MK 3D7EO 3VEYA 1S9GA 4H5NA 1OVYA 1LWFA 4C1NI 4HUFA 4DQRA 3O6WA 1XI1A 1V4TA 2RN2A 3RMCA 2A5XA 4O5BA 4LF9K 1C1CA 3AY9A 1XMQK 2E6MA 3ITHA 4DR7K 2E2OA 1S6PA 3HOSA 2HF3A 1YVUA 4Z4EA 2OCEA 4B3TK 4K42A 4PKHA 4LD0A 5GIOA 4AHUA 3NF8A 3L2VA 4LC9B 5GINA 5AQZA 2P9LA 1BG3A 4H8KA 4Z4CA 1BI4B 2FBXA 4CK1A 3F2KA 1S3XA 4JKCA 4DS5A 2NRRA 4CZMA 4KH4A 1WBDA 1UAXA 3CCRN 4YOWA 1WAFA 4DQPA 1Q18A 1J9AA 3MN9A 4JI6K 1KD1O 1QE1A 3RTVA 1KVAA 1ZBIA 4DTSA 3UB5A 2UXCK 3B6OA 3VOVA 2QA4N 1T7PA 3LZJA 1FW6A 3DLHA 4I9QA 4BRQA 1LW0A 1N33K 1YT3A 2D5RA 4I2QA 3VENA 2XY5A 4KHQA 3A0IX 1N8RO 5HP1A 1GLDG 3KTQA 4WQ5A 1YIJN 4J2DA 3C6UA 4NCGA 4FK0A 4Z4IA 4PHTX 4IEEA 3J7AP 3QB0A 3TTDA 4EHTA 1ZXOA 2GUIA 5JVHL 4B08A 3AVIA 3AARA 3R3LA 4KH6A 3RSEB 2P9NB 2D0PA 4XH1A 4CHYA 3KVGA 1A5VA 3HM8A 3LM9A 3TARA 3PO5A 4JI5K 2RE2A 4KREA 3MEEA 4NYNA 3A5NC 3DLGA 5AQJA 4AHCA 3D0PA 4BRDA 2IVNA 1M90O 3CMAN 4CHOA 4WQ4A 2JLEA 4GY2B 1FKOA 4DSIA 2OPRA 2Q0UA 2O8CB 4N41A 2ZQBA 4JI7K 1Z25A 1NK7A 2IGIA 4C8KA 1X1PA 3DRSA 4J2AA 4HUEA 2E6LA 5M1PA 3CETA 2PZSA 1XHXA 3ZSVA 4M3YA 4FJNA 4FLVA 4B1WB 1J5EK 1Q9XA 3M8PA 3KKRA 3CM6A 4FVUA 4G9ZA 3VERA 2E2QA 1DT9A 3SQ4A 3VF6A 1SKSA 3ZT0A 5H1SQ 3W3DA 3TABA 2KLAA 3J7ZO 3I56N 3ULEB 1KC8O 4FJKA 5DMRA 1HJRA 5TKYA 3CMEN 1BCOA 3F9KA 4ILHA 4PKIA 3TTCA 5FPEA 4DTPA 4JI8K 2HBLA 3QEWA 3MWTA 4BR4A 4LH4A 3EY1A 3PV8A 3HRGA 4FZXC 3DYAA 2G8FA 5JICA 3DMJA 2DFHA 3PIPL 5FDLA 4DQQA 1W7AA 4LH5A 4CECA 2VQFK 1NGFA 4H0XB 3TSPA 2VG5A 2X74A 4KKOA 2NLXA 4X65K 3K58A 2DFEA 4CF1A 4OO1J 3K5OA 3VPZA 1NK0A 1JLGA 3QEXA 3RMAA 1V4SA 3CG7A 3HP6A 3SPYA 2GWJA 1S1WA 3RR7A 3SQ1A 4U7BA 3LDPA 3CQYA 3KK3A 3OBWA 2PYLA 2F96A 4BVOA 3CF5L 2O4GA 1HYVA 1WN7A 4O4GA 1K9MO 4R79A 3O9QA 4F2RA 3K59A 1KVBA 4LSLA 1TK5A 4BRMA 3LANA 1RT1A 3AO5A 2F9TA 1L5UA 1N32K 3O9UA 4ZTFA 1X3MA 3V81A 3QERA 1D9DA 3O08A 4A5BA 1E4FT 2E1ZA 4MO4A 1K8KA 3ASMA 4O0IA 3CJ9A 3DWLA 3CJAA 4DWIA 5AQXA 4B9LA 3PIOL 4BG8A 4ISEA 4CVNE 2HHTA 3OJSA 3CXCM 3OS1A 1FXXA 2BDPA 1RTDA 1C0TA 1IKXA 3WNFA 3SZ2A 4M3WA 1X9JA 3SNNA 3E1YA 4EAHD 2E88A 1SKRA 4JHDB 4IWVA 1HNVA 3JSMA 1NK8A 3MN5A 3VEWA 3AVAA 2CGLA 3L0QA 4IZ9A 1L3VA 1S72N 3TSQA 1J54A 4HTUA 4CBXA 3UKUB 4CEBA 2QWQA 1NK4A 4RWTA 3THYA 1VQON 5KPZA 3AV9A 4JI4K 3OS0A 3AVFA 1VSIA 1WNSA 4Z4HA 5CHIA 3THVA 5KGXA 4CZLA 2YJFA 3H3OB 1YTUA 1DTTA 1T8EA 4EFHA 3IS9A 1HKBA 2GWKA 2QTDA 3VQQA 5D3GA 5HBMA 4KPYA 3SAGA 4FWMA 4YOXA 4BR7A 3TAPA 1NG9A 2O8FB 4CF8A 1SQKA 5TKWA 4OJRA 2A42A 3QESA 1VQ7N 1W0HA 3Q7CA 4I6MB 4HCCA 1C0UA 3KWIA 5EU7A 2VG6A 4BG9A 4OGEA 3WNGA 1R59O 1RT5A 4JD2B 3UKRA 1GOCA 2E2NA 3AO4A 4CFAA 3BGRA 1U6ZA 4CHPA 3CI5A 4K8XA 3Q7BA 3ULEA 3SBGA 5CZ1A 3HVRA 4RW6A 2OPQA 3BP8A 4B1UB 5JS1A 4BQZA 3HZ6A 2DPNA 3OYNA 4ILJA 2P5OA 2O8EA 1OVQA 4DV7K 3NF7A 4FPBA 4BGBA 3C6AA 1Q81O 2GTDA 1C0GA 5BPMA 5EVZA 4B1VA 1S1UA 3OJUA 4CZJA 1XNRK 1QSLA 4KV8A 4N76A 3MWPA 1WSGA 3C65A 5HOOA 4WYBA 2YNIA 4BRFA 2A40A 4CJLA 1HR0K 1TAQA 1VSLA 1XWLA 3NH1A 4WF9L 3NE6A 3LZIA 3TAFA 3FZFA 3DLEA 1NK9A 3QINA 4YDUA 1HUXA 3A2FA 3I55N 2ZE2A 4A57A 2G8HA 2Z1HA 4M7YA 1S5JA 4HTLA 3QEVA 3I8BA 3SK3A 4IJNA 1QZ6A 1H1VA 4QS9A 4FJHA 5GAGP 5E84A 4CK3A 4JS5A 2LSNA 5KPRA 3K5MA 3G10A 4IEIA 3CQXA 2ZGZA 4Z4FA 4DF8A 4IKFA 2D1KA 4DV1K 4C1NK 1QVFM 5DM6L 5KRSA 1XQSC 1TVRA 2P9IA 1QHAA 5C15A 3KK1A 2OZMA 1TGOA 4IG0A 4IFVA 4H5WA 3BY5A 4BR5A 3OTOK 4FO0A 3V9ZA 3ZSZA 1I39A 2ZM6K 4E89A 4LFCK 1N5YA 4KI6A 4GV3A 3SQ2A 5GAEP 1N36K 4ID1A 1B9DA 3M5RA 1K8AO 1HLUA 1NGAA 4I7FA 1S1TA 4DU1A 4CJQA 3CCUN 4E0DA 4NYFA 4CIEA 1TL1A 3FLCO 2UU9K 4WFNL 3KK7A 3G25A 3KHYA 3CJ1A 3O9TA 2HBMA 3NVKA 5KI6A 4WFBL 2HHUA 5KRTA 3KLGA 3CCVN 3T19A 3E01A 3PX6A 3EKUA 3BF1A 4CF2A 3LWMA 1LWCA 5JVGL 3HI0A 2B4JA 3HTVA 4FLZA 1NJZA 3V9WA 3RR8A 4FJ9A 2KZZA 1OKJA 2YHXA 1VRTA 4GMJB 2E2PA 3VGMA 5C10A 3NHGA 4KB1A 1JXBA 5AQTA 3AVHA 5M1QA 4CJUA 2RF2A 5F2RA 4KFBA 3IRXA 1VQ6N 4RW8A 5CZ2A 4J2EA 5M1NA 2XHBA 4MFBA 4C23A 2D0OA 2CGKA 3GBTA 1QQNA 1P8ZA 3PY8A 1ASUA 3BEXA 1W9HA 3OYHA 4PL7A 1BDGA 1EKEA 1NGGA 3O80A 2NRXA 4CEQA 3KKSA 2NNWA 4I6MA 3VN5A 1IG8A 5AQQA 3DRRA 5AQKA 1VSMA 1UOCA 3K9JA 3HO1A 4DTNA 5KTQA 4LFBK 4JD2A 4EIAA 3HSTB 2P9UA 4FJ5A 3LALA 3TPQA 3C95A 4FWRA 4L3QA 1IBLK 4PWDA 3DRPA 4B3RK 4DR2K 3AVNA 5JMVA 1NKEA 4MDBA 4F8RA 3ZLJA 1XHZA 5GAHP 3U9DA 2YNHA 4DTRA 4BR0A 4BVPA 3N4PA 5C2DA 4CI6A 3L2UA 3L2RA 4KHUA 3EE8A 5AZIB 4FWQA 3EZWA 2Y1IA 4G1QA 3K5LA 3S41A 3DI6A 3PUFA 3K5NA 5J1EA 2QEXN 3EL2A 1XMOK 1VSHA 3HVTA 3E66A 2F9WA 4YY3K 4W5OA 1RILA 3RVCA 4DF4A 1EXQA 3O9RA 4ELVA 2YI1A 5FPDA 4LF6K 1MWKA 3CFPA 3ZYYX 4E1NA 1BHLA 1NGCA 4XH4A 5A2QO 4CEFA 5IWAK 2XO7A 1SL2A 4DKWA 3HL8A 4DU3A 4GV9A 3L4IA 4FK4A 4BQLA 1IJJA 2X6SA 2A1SA 1IG9A 4RTFD 3FZMA 4OPHA 1RTIA 3MDQA 3DXKB 2HHWA 3JXUA 4JRQA 3SPZA 4CZFA 5LL6Z 1UA0A 3K57A 3TTFA 4CZIA 2D0CA 1J6ZA 4FJGA 4DQIA 3V1QA 3AA5X 4FCYA 1KLMA 3VQ8A 4DCHA 3T69A 3WEEA 5AQMA 3TWHA 2ITMA 4JV5K 3VQ7A 3QLHA 4LSNA 4E7KA 2IVPA 5LY3A 3AGRA 4WQ5C 3L3UA 5BN8A 1JCFA 3SI6A 3E9OA 4BREA 4MLEA 5C42A 2YV0X 1Q86O 1NOYA 3I8DA 2E1YA 3WQTA 5ELZA 1GLFO 3MAQA 4DV4K 4CJ7A 1NGEA 3G71N 1GOAA 3RRGA 1HYZA 2E8AA 3CFRA 2PY5A 3D2FA 1X9SA 2P9SB 3MECA 3ID6A 2CH6A 1C1BA 2WTUA 3TI0A 3LL3A 4CEDA 1MDUB 3KK2A 4KTQA 3HYFA 2F8TA 4B9NA 2FF3B 2Q31A 4DSKA 3HXMA 1TYQA 2HF4A 5AQOA 1DEJA 3DAWA 2W40A 3ZT3A 4BRCA 1HQUA 1HKGA 4DSJA 2OTJN 1TV6A 1C0MA 5BRHA 4H0PA 5HRRA 3MN6A 4YORA 1S1VA 4QS8A 1GLLO 4N47A 4DUYK 1TL3A 2V52B 3T1AA 5KPTA 3NAEA 4E1JA 5BR9A 2ETJA 2QW9A 1KVCA 3FR0A 1RT3A 4DFMA 1RNHA 2V51B 3VEOA 3CD6N 3P4IA 3H45C 1NGBA 4M3XA 4FM1A 2F4VK 3O3FA 1FJGK 4ISGA 4XIUA 1UWBA 1RDBA 2HSTA 2PBDA 3A5MC 2VWJA 3U3GA 4JKHA 3TANA 4EP4A 2YNFA 3SBTA 1ZBSA 4JK9A 2D0BA 4DV2K 3ATUA 4DLGA 1HNXK 4CEOA 4CJ4A 4CK2A 2QXLA 4DB3A 5J2MA 2BANA 3IG1A 2G8IA 1HMVA 2A3ZA 3N4QA 3CCMN 1YXQA 4FWSA 3OYFA 1IKVA 3SJHA 1E4GT 4QCLA 4BACA 3H46O 2B6AA 4E7HA 3HPGA 4MQ3A 1IO2A 3WXJA 4YOYA 2QI2A 2YHAA 5K14A 4YHHK 3QETA 2V7ZA 4O8UA 4M3RA 4B9UA 1Q82O 4CZHA 3VA0A 2Q1NA 3DLBA 3OYGA 4B3SK 3VTHA 3TSUA 4CD3A 2P9PA 3NGYA 3ENBA 4JI0K 1N34K 3PSFA 1NKBA 3NFAA 2DY4A 2D0AA 1EP4A 2AP1A 3ZX0A 3OYKA 1SS6A 3S3NA 2O8DB 4RG8A 3QICA 2BTFA 4BRAA 1ZBHA 3AVMA 3DXKA 4YNQA 2H3GX 2E20A 1CXQA 3OYLA 3AO1A 3NH0A 1IKYA 1NGJA 4R5PA 5CYQA 1Z26A 1HJOA 1SV5A 5BRFA 4RW7A 4IFEA 1IV0A 3L6QA 2CH5A 3SV4A 3MN7A 3DLLL 4FLYA 3AVGA 3O4QA 3P83D 3M1FA 2HNZA 3T1YK 3OA9A 4BR2A 4FJ8A 4DLEA 3DXMB 3RMBA 2Q0RA 4O8KA 4AILC 3R1XA 3ZETB 3HJFA 4CESA 1YJ9N 3VQ4A 1BI4A 2HHXA 3ZEUB 5LJVA 4K8ZA 3O8MA 4N5SA 4FSVA 4M3TA 5CYMA 4GNIA 1QS4A 3V9SA 4YOUA 4CFBA 1U2VB 4M63C 4IOXA 3MXJA 5AQVA 5AQYA 2P9SA 1HPMA 1WSIA 2HW3A 3MCAB 3THXB 2UUBK 1T05A 4A2AA 3OVNA 4IG3A 4BRNA 4DHYA 1Q8IA 3DJCA 3WNEA 3WUHA 2GV9A 1WB9A 3S3OA 4BRIA 4CJSA 1YVNA 2DFFA 4I2PA 5LMNK 3CC7N 5FRNA 3HP9A 5BN9A 5KQ8A 1NK5A 4DUZK 4CIGA 3CCQN 1VQKN 3CCEN 2AJQA 3QBWA 1RCHA 4MO5A 5F0XA 4HHTA 1SZ2A 1EO1A 4L8RB 1VQNN 3TU5A 1OH7A 2ZJRL 1K73O 2WC9A 1L3UA 3RSEA 2P9NA 2UYTA 5B8HA 4CERA 5CE3A 4EP5A 4YOVA 4H4MA 2RPIA 1GLJO 4NLBA 4BC4A 2ASPA 3CYMA 1BCMA 3DM2A 3SMPA 4PUOA 1BISA 2D4WA 3CPEA 2QWLA 3VQDA 5M1OA 3CHWA 3SAHA 1LV5A 2O8CA 4B8CA 2OA8A 4O5FA 4DSFA 5GIPA 3CQ8A 1CZBA 1YF5L 1RBTA 3J8AA 3CERA 1S6QA 1RTHA 1JLQA 4BWJA 2KFNA 2OPPA 3L2WA 2HBKA 4FJ7A 1RBRA 3JYTA 1RDCA 1T6CA 3SMSA 1QQCA 3I0SA 4FWLA 1OH8A 3FFKB 5C12A 1MWMA 3QIOA 4CGGA 3CPWM 3ZCMA 1KLNA 3PLAA 4CE9A 1X9MA 2QWPA 4BRGA 4JAXA 1ASWA 4BR9A 4CGIA 3KLHA 1BA1A 3PO4A 3GG4A 3EZ5A 3ZX3A 4EZ6A 1WSFA 4O0JA 3P1GA 2W6KA 2F7TA 3HBTA 3NF6A 4CCHA 2B5JA 5E26A 4BY9C 1BWFO 1C1AA 3LDLA 4GKKK 2ATQA 4DR6K 4GV6A 2O8DA 4FYDA 1NGHA 4A5AA 1T3VA 1ATRA 3AA3A 3OBYA 3VQEA 1HKCA 3ZSQA 3UIQA 4OKJA 3TR8A 5I42A 4JEPA 5I3UA 3BF3A 3OW2M 4CHQA 3SUNA 1ZBLA 2YNGA 4LF5K 1GOBA 2IAJA 2R7YA 4CJEA 3LPUA 4OVLA 2O8BB 3J7YP 4C8NA 4KTZA 2Z1IA 5BR8K 1HNWK 2QWOA 1JLEA 3EE9A 3E9LA 4OGCA 4NXNK 1A5XA 4GVMA 4X62K 1VK0A 5FLXO 1XC3A 3ZETA 3BZCA 5J2QA 4KI4A 3SUOA 5BPLA 4B8AB 1EQYA 3V9XA 4KO0A 3VQ5A 5HRNA 1QHTA 4W5QA 2VG7A 3AGKA 2IS3A 2Y1JA 1N6QA 1W2BM 4E3SA 4O44A 1U2VA 1RTJA 1XUPO 4FW1A 2KHOA 3S9HA 2IIRA 4CJKA 4LF4K 1RT2A 3NH2A 3NF9A 1CLQA 2GUPA 2DTUA 3THXA 4BE1A 2PAVA 2HMIA 1ATSA 3OS2A 3LPTA 1OH5A 4V19S 4PQUA 2KTQA 2I7PA 3JS6A 4H0VB 3AAPA 1L3TA 5KGWA 3M8RA 4ELUA 5AQRA 3P31A 1KAZA 1ZYQA 2HHQA 2FXUA 3ENOA 2WONA 2Z1JA 4BRKA 4EZ9A 4AF1A 3TAQA 3R8EA 3VESA 4IBNA 2G8KA 3NMUA 1NMDA 2Q3SA 1WUAA 3R6MA 5AR0A 4JHDA 1FK9A 1Q7YO 3I0RA 2GEMA 4DSEA 2YCHA 2FLOA 5AFUA 1CXUA 2QWNA 1NBWA 2Q36A 4B1YB 3ZX2A 1VQPN 4ZHRA 4DS4A 1TAUA 3UKUA 2P9LB 1NGDA 3CC4N 1YJNN 1BL3A 4YOTA 2A41A 2HOEA 1NOZA 3O1BA 3PSIA 2A6AA 3VTIA 3AAQA 3V9UA 4H5RA 3AO3A 3ID8A 4Z4GA 2FF6A 4IO9L 4JK8A 1QZ5A 3LP2A 4Q0BA 4OKKA 3K0SA 4H4OA 3HPOA 2O8FA 3SJJA 2GELA 2I5JA 3H08A 3B8AX 2A1RA 2YX6A 2QKKA 1ZC6A 3FZLA 4F2SA 3LP1A 1NJWA 3P39A 4MDAA 4M3UA 1TKDA 4O55A 1JCGA 4FLTA 3KLIA 3GDQA 3NCIA 4LY7A 4WCEL 1OH6A 4W5NA 4CZKA 4JK7A 4JKGB 2PFUA 1LOTB 3AVJA 4CIFA 2Q2RA 1RDUA 3LM2A 1NWKA 3EKSA 3F73A 2GX9A 1YITN 1X9WA 3GOIA 3K9KA 1VSEA 1XNQK 3MX2A 2BGGA 4JKBA 1QQMA 3ENHA 2NRWA 4FL9A 5FPNA 5HLFA 3A5OC 1BIUA 1ESVA 4Z0UA 3R9PA 5C24A 3T7ZA 1JL2A 2HNYA 3GL1A 1GLCG 3M3ZA 2KFZA 3OYJA 1JL1A 1VQMN 4OPKA 1XC9A 3U3YA 1U04A 4ISFA 1IKWA 1BA0A 4K0KK 4KH5A 1RDWX 2IOCA 2YHWA 4YFUA 3GE1A 3QFPA 1QSYA 4FZZA 1T44A 2YKMA 2O8BA 3CJBA 4DQ8A 5M1KA 5ADXA 5AQSA 1BOTO 1D9FA 4PY5A 4CGHA 3LAMA 3LAKA 5J2PA 2KW4A 4CF9A 4DMNA 2F8SA 2EHGA 4CBUA 3U9ZA 4CEEA 2CGJA 4E19A 4BWMA 4FPAA 1U45A 5F1XA 4M41A 2KZMA 1X3NA 5AQHA 4N56A 2OPSA 2ITGA 3LDNA 2HBJA 1O1WA 1T6DA 4LF8K 2P51A 3KWGA 4ID5A 3QIPA 1I94K 3CCSN 1Y97A 3T3FA 5I9EB 2OZSA 4OLAA 1TK8A 3VGLA 1VSJA 2ZD1A 3TAMA 5CR4A 3S3MA 4FZYA 4IFYA 4ICLA 4FJJA 2HNDA 3WT0A 4FOIA 1NKCA 4JS4A 4LFAK 3O4NA 2NUBA 5FRMA 5AQLA 5AQPA 1SAZA 3KZBA 1JLCA 3CJ7A 1KFDA 1EETA 5AQFA 4BROA 3VQCA 4WQ4C 1IH7A 5EOYA 2QKBA 4BGAA 2I7NA 4NCAA 1IBKK 3LP0A 4BDZA 5SWMA 4FJLA 5AJ3K 1LWEA 1VHXA 1U48A 1J53A 2VGMA 3MK6A 1K8KB 4FLWA 2QWRA 4DTJA 2IVOA 4KBOA 3OYEA 1SKWA 3FZKA 1QTMA 4OKEA 1DLOA 1TUUA 3PX0A 2FC0A 3P5JA 3VQAA 1VQ5N 3SUQA 4BC5A 1D8YA 1S1XA 3MX5A 2XRIA 4KAZA 4FLXA 4AHVA 5LMUK 2VWKA 2RHKA 2NZTA 1REVA 5AQIA 4JI2K 3V1RA 4FW2A 5JS2A 4JKGA 1YHQN 4JYAK 1M1KO 3LP3A 3SCXA 2OYQA 4JLHA 4CGDA 3PX4A 2BE2A 5AQNA 1KTQA 3KJVA 3D2EB 4K25A 4NO7A 1JJ2M 4FJIA 1JLAA 3K2PA 1HQEA 3CIPA 2YJEA 1JXEA 3THYB 2QWMA 1NNEA 4IOCL 4DTUA 4OPAA 1C0FA 1KQSM 3ZSXA 3FE1A 3VQ9A 4RCHA 3P38A 4DFKA 2PYJA 4UY8O 2HB5A 2VWBA 3LDQA 5AZIA 2X78A 1MA9B 1DTQA 3M8SA 1VQLN 1R0AA 4DTOA 1Q9YA 1YTAA 4GVEA 3ZT2A 3OHRA 3ZSRA 4DR4K 5C0YA 3EEQA 3LWLA 4B1ZA 2G8VA 4IO8A 4DV0K 1CZ9A 4DTXA 4E7JA 2P5GA 3OYMA 3H3NO 4CZEA 4DQSA 2JWKA 5FPMA 2XY8A 4CFCA 1UA1A 3UKRB 3U6FA 4CEZA 1NLVA 4X66K 3QEIA 3VF4A 4JI1K 3WXLA 3AVBA 4B1XB 3EN9A 4DG1A 4DR3K 3O3GA 2O8EB 1HRHA 4XH5A 1QQOA 1ZBUA 2J4RA 3DLKA 2BUPA 3VQPA 3KD5E 2V7YA 3SAFA 3ZSWA 3U4LA 4FLUA 4E7LA 2ZGYA 1RT7A 4OLBA 4OPJA 3WQUA 3B6PA 2WBNA 4A62A 4XEIA 4H5VA 3QMLA 4Y1CA 5AQGA 3H1VX 2HVIA 3VF2A 4DU4A 1U47A 3M8QA 2W42A 1YI2N 1RDAA 3JAMO 4BE0A 4IJAA 5AQUA 3QNNA 4QOZB 2FSNA 1ILYA 1B92A 2OTLN 3EO3A 3NDKA 4U67L 3HM9A 4QS7A 1RGIA 3NVMA 2VYPA 4ZTJA 1VQ8N 4JI3K 1TKZA 3L2QA 5EY4A 4ILGB 4CZGA 4F4KA 1HYSA 3VMFB 1EWQA 2BH1A 5C25A 1GLEG 3F5TA 4CJTA 4CGJA 1WLJA 3IAYA 1NK6A 2RKIA 1G99A 4Y0WA 4FM0A 1YUWA 3MXIA 2P9IB 5FROA 3RRHA 1HNIA 2AA4A 4DR5K 2HHSA 3ZT1A 5E41A 2UXBK 5HL7L 3QBXA 1W97L 4AHSA 3VGKA 2XY7A 4IDKA 5KQDA 1WSJA 2QK9A 3THWB 3ISNC 3KIOA 3H1QA 1RFQA 3OYDA 1DGKN 1RDDA 3C6TA 3OYAA 4JKFA 4BE2A 3ALYA 1KRPA 4B9VA 3ZSYA 4AHTA 3T1HK 1NGIA 4KHPK 3DOKA 4CHZA 2EWSA 1KCFA 1ATNA 4I9LA 3U8XA 2WOMA 5EX5A 4Q5VA 4B9MA 4NXMK 2JGUA 4EHUA 3MEDA 4H0OA 4W5RA 1JLBA 2FBTA 2OANA 3AA2A 3D2EA 3SYZA 3AA4A 3W0LA 3F9MA 1EWRA 3WXMB 4HWIA 3HK2A 4B3OA 4CJWA 4DV3K 4RW9A 4FWNA 3L8BA 4IDHA 4JNEA 1SL1A 4E7IA 3CM5A 5AFUH 3AVCA 1HNZK 2FSKA 2Q97A 3ZSOA 1I3AA 3V6DA 4F9OA 3IKMA 4UQGA 3AVKA 4FXDA 4FWOA 4PA1A 1BGXT 4M7XA 1FKPA 1BO5O 3HT3A 4YDUC 3ATVA 4DV5K 3CJCA 4BC2A 4M45A 3G4SN 4KHNA 5DK5A 4BRHA 3FGUA 1LAVA 4FK2A 1Z05A 4KRFA 2ZWHA 3VQBA 4M42A 3M6GA 3RMDA 1ASVA 4CEAA 4KB0A 2O4IA 2P9UB 4H5TA 4Y1DA 3V4IA 4H0YB 4ELTA 2VQEK 4AQYK 4B9TA 3BUZB 1NM1A 1VRUA 2HHHK 1VQ4N 2Z1GA 3C6HA 4K41A 3G0ZA 2HHVA 4HCBA 1TKTA 4H0TB 1RBSA 5HRSA 4B9QA 4PKGA 4W5TA 3ULDA 2WFBA 4CJPA 3I33A 2W41A 5EXWA 1C6VA 4JKDA 4KHWA 4FJMA 4F3TA 4NB4A 1KAXA 5BRDA 3QFUA 3HSCA 5AZJB 2P9KB 4C8OA 2WUSA 1VQ9N 4C8LA 1KXPA 2FSJA 1JKHA 4RW4A 5JLHA 3DXMA 1Z6RA 4DFPA 2YKNA 1CZAN 3ZEUA 3O4WA 1KAYA 1E3MA 1BU6O 5CY4A 1SUQA 1VAZA 5AQWA 2IC3A 3LDOA 3VEXA 3BZKA 2UUCK 4CBWA 3C7NB 3HOTA 3O5BA 1KSPA 1S9EA 4CJRA 3C0BA 3MEGA 2ZJQL 4CGFA 4WFAL 3VA3A 3KLEA 1SL0A 4X64K 2P1JA 3NGIA 1ITGA 3VEVA 5SZTA 5HRPA 1J5OA 4KHYA 3NGZA 1GLBG 2FBVA 4DR1K 4CJ3A 3FZHA 4GKJK 3A5LC 5GADP 1S22A 3CC2N 1NJIO 2JWLA 5ADXH 1HX1A 3V1OA 2NRTA 1BUPA 4BDPA 4JKAA 5DM7L 3O3HA 1RT6A 3E9PA 5MLCQ 3THWA 5J2NA 3SQ0A 3WEEB 4A2BA 3OY9A 1GLAG 2ASOA 1T03A 1WAJA 3AO2A 3O1WA 4J8FA 4BRPA 3SUPA 1U4BA 4FWKA 3VETA 1IBMK 4JN4A 4CJ5A 1LCUA 2NRVA 4HUGA 3OYIA 2YHBA 1LAWA 2NRZA 3D2FB 1B9FA 3DLRA 1YJWN 1VSKA 1DKGD 1TK0A 4F3OA 2E5LK 3HPHA 1RT4A 2XY6A 3QNOA 3BDPA 3O9SA 1NMNA 4TSXA 3ZT4A 4NLCA 1BQMA 1VSDA 3UE5A 2HVHA 3L3VA 4HVJA 4DSLA 4Z94A 1K6YA 4FJXA 3FFIA 4IXCA 4BRLA 1JLFA 2YHYA 3KLFA 1QSSA 3VQ6A 4QAGA 4LF7K 1TYQB 4AH9A 1QVGM 4C8MA 4IOAL 4E1MA 3L4QA 2GBZA 3D6RA 3QDKA 4WE1A 4K43A 4CFDA 4NCBA 4FVMA 2QXFA 1WSEA 1F21A 3VEZA 1HPZA 1RBUA 4CW7B 1O13A 4JKEA 3MMVA 4FM2A 3SV3A 5BPNA 3RWUA 5C2FA 4AM7A 3WNHA 4A61A 2G8WA 5M1FA 3NBPA 2ASMA 1WBBA 4CD1A 2VGNA 1G15A 1Y64A 3D45A 2QM1A 4A59A 4KTWA 3TAEA 3A8YA 3OYBA 4JRPA 1L3SA 2ZF5O 3AVLA 3TAGA 5BREA 1BQNA 3IFRA 3QEPA 5LJWA 1A5WA 4MLHA 2HMPA 4GW6A 2FBYA 2G8UA 1TUYA 1P90A 3H6EA 5JLFA 4H03B 1WOQA 2UXDK 4AM6A 1NJXA 2EX3A 2IDOA 3IDHA 3CCLN 5T7BA 4DV6K 5HROA 1D5AA 2E4LA 1U49A 4FOEA 3MXMA 1YAGA 3WXIA 4DFJA 4CF0A 1TKXA 3LDSA 2VCPA 3MCPA 4OX9K 1RBVA 5IT9O 5AZJA 4AHRA 2P9KA 3SLCA 3KD1E 4B9SA 2NRHA 4J2BA 4CJVA 2KKZA 3EYZA 4CJFA 1D4XA 3OYCA 4DTMA 1KFSA 3CCJN 4FWPA 2KQ2A 3C94A 4BDYA 4M3ZA 1ZBFA 2W6LA 3WXKA 2X6NA 1NU0A 3QO9A 4CHNA 1NJYA 2ZJPL 3G6EN 1VSFA 1LW2A 1EX4A 1MU2A 4PL8A 3C7NA 3IUCA 3J80O 4BC3A 3J81O 2P9PB 4KHSA
chains in the Genus database with same CATH topology
2D4WA 3CPEA 2QWLA 5C0YA 3M5RA 5M1OA 1K8AO 1HLUA 1NGAA 4B1ZA 1JCEA 3CHWA 3SAHA 4IO8A 3IMXA 3CCUN 3D7EO 4O5FA 3VEYA 3FLCO 5GIPA 4WFNL 3H3NO 4H5NA 4CZEA 1OVYA 3KK7A 3G25A 3KHYA 4C1NI 3CJ1A 1YF5L 2JWKA 3J8AA 3CERA 3O9TA 2HBMA 3O6WA 3NVKA 5FPMA 1V4TA 3UKRB 4WFBL 2HBKA 2A5XA 1NLVA 1T6CA 3AY9A 3CCVN 3SMSA 3VF4A 2E2OA 3EKUA 3BF1A 3WXLA 3HOSA 4B1XB 2HF3A 4FWLA 5JVGL 3HI0A 3HTVA 3EN9A 3FFKB 5C12A 1MWMA 1OKJA 2YHXA 3VGMA 2E2PA 5C10A 3CPWM 4K42A 4PKHA 5AQTA 4XH5A 5M1QA 3PLAA 1QQOA 2J4RA 5GIOA 5F2RA 2QWPA 2BUPA 4BRGA 4JAXA 2V7YA 3SAFA 4BR9A 4LC9B 1BA1A 3U4LA 5GINA 5AQZA 1VQ6N 2P9LA 1BG3A 2ZGYA 5M1NA 3GG4A 3WQUA 3ZX3A 4C23A 3F2KA 2D0OA 2WBNA 4A62A 1S3XA 2CGKA 2F7TA 2NRRA 3GBTA 3HBTA 1QQNA 1P8ZA 4JKCA 4XEIA 4H5VA 4KH4A 5E26A 4CZMA 4BY9C 3CCRN 1BWFO 3BEXA 3QMLA 5AQGA 4YOWA 3H1VX 1Q18A 3MN9A 1KD1O 4PL7A 3LDLA 1BDGA 3VF2A 1NGGA 3O80A 2NRXA 1YI2N 2NNWA 4GV6A 4I6MA 4IJAA 1IG8A 5AQQA 1NGHA 5AQUA 3UB5A 4A5AA 3VOVA 5AQKA 2QA4N 2FSNA 1T3VA 1ATRA 1ILYA 3K9JA 3OBYA 1HKCA 3EO3A 2OTLN 4BRQA 4U67L 4JEPA 4JD2A 4QS7A 1RGIA 3VENA 3NVMA 2VYPA 4EIAA 1VQ8N 3A0IX 3BF3A 2P9UA 1N8RO 3OW2M 3TPQA 5EY4A 1GLDG 4ILGB 4CZGA 4WQ5A 1YIJN 3VMFB 4FWRA 2BH1A 1GLEG 3F5TA 4L3QA 4PHTX 4IEEA 5JMVA 4MDBA 2QWOA 3QB0A 3TTDA 4EHTA 3EE9A 1ZXOA 3E9LA 5GAHP 3U9DA 5JVHL 1G99A 4Y0WA 4BR0A 3AARA 3R3LA 4BVPA 4KH6A 1YUWA 3N4PA 3RSEB 5C2DA 2P9NB 2D0PA 1XC3A 2P9IB 4XH1A 3ZETA 4CI6A 2AA4A 3KVGA 5BPLA 3HM8A 3LM9A 1EQYA 2RE2A 5HL7L 3QBXA 1W97L 3A5NC 3EE8A 5AQJA 5AZIB 3VGKA 4FWQA 5KQDA 4BRDA 3EZWA 2IVNA 3AGKA 1M90O 1W2BM 3CMAN 3S41A 1U2VA 4WQ4A 3H1QA 2QEXN 1RFQA 1XUPO 3EL2A 2KHOA 1DGKN 2IIRA 4GY2B 4JKFA 2GUPA 3E66A 2F9WA 2PAVA 2Q0UA 3RVCA 1ATSA 3O9RA 1NGIA 2I7PA 2YI1A 5FPDA 3JS6A 4H0VB 3AAPA 2EWSA 1ATNA 1MWKA 3U8XA 5AQRA 3P31A 1KAZA 3ZYYX 5EX5A 1NGCA 2FXUA 4XH4A 5M1PA 3ENOA 3CETA 4BRKA 4EHUA 4H0OA 4DKWA 4GV9A 3L4IA 4AF1A 2OANA 3R8EA 3D2EA 3VESA 3NMUA 1NMDA 4B1WB 1IJJA 4BQLA 1WUAA 3R6MA 4RTFD 5AR0A 3FZMA 3W0LA 4JHDA 3F9MA 4OPHA 3MDQA 3WXMB 1Q7YO 4FVUA 4HWIA 3VERA 4G9ZA 2GEMA 2YCHA 3DXKB 2FLOA 3JXUA 4FWNA 5AFUA 2QWNA 1NBWA 2Q36A 2E2QA 1DT9A 4IDHA 4JNEA 3ZX2A 4B1YB 3VF6A 4CZFA 1VQPN 3TTFA 4CZIA 5H1SQ 5AFUH 3W3DA 1J6ZA 2KLAA 3J7ZO 3I56N 3UKUA 2P9LB 3ULEB 1KC8O 1NGDA 2FSKA 5TKYA 2Q97A 3CC4N 4DCHA 3CMEN 4PKIA 3IKMA 4ILHA 4F9OA 4YOTA 1YJNN 2A41A 2HOEA 3T69A 3TTCA 3O1BA 3WEEA 5FPEA 5AQMA 2A6AA 2ITMA 3VTIA 3AAQA 2HBLA 4H5RA 4FWOA 3MWTA 4BR4A 3ID8A 2IVPA 4M7XA 2FF6A 3HRGA 5LY3A 4IO9L 1BO5O 3AGRA 4WQ5C 4JK8A 5JICA 1QZ5A 4YDUC 3ATVA 1JCFA 5BN8A 3E9OA 4BREA 3PIPL 3CJCA 4MLEA 4BC2A 3G4SN 1Q86O 2E1YA 3WQTA 5ELZA 1GLFO 4BRHA 1NGFA 3FGUA 4CJ7A 1NGEA 1Z05A 4H0XB 3TSPA 3G71N 2ZWHA 2GELA 3B8AX 2YX6A 2E8AA 1ZC6A 2NLXA 3FZLA 3M6GA 2P9UB 3D2FA 4H5TA 3P39A 2P9SB 4MDAA 4OO1J 3VPZA 3ID6A 2CH6A 4H0YB 1JCGA 1V4SA 3GDQA 2GWJA 3BUZB 1NM1A 3LL3A 4WCEL 4U7BA 1VQ4N 4CZKA 1MDUB 3LDPA 4JK7A 3C6HA 4JKGB 2PFUA 3CQYA 1LOTB 4K41A 2FF3B 2Q31A 2Q2RA 3OBWA 1RDUA 4BVOA 4H0TB 3CF5L 3LM2A 1NWKA 1TYQA 3EKSA 4B9QA 4PKGA 2HF4A 5AQOA 1DEJA 2WFBA 2GX9A 3I33A 2W41A 5EXWA 3DAWA 2W40A 4BRCA 1K9MO 2OTJN 1HKGA 4JKDA 4R79A 5BRHA 3O9QA 4H0PA 4NB4A 3MN6A 1KAXA 5BRDA 4YORA 1YITN 3QFUA 3GOIA 4QS8A 3HSCA 3K9KA 1GLLO 2P9KB 5AZJB 2WUSA 4BRMA 2V52B 3MX2A 5KPTA 4JKBA 1VQ9N 1KXPA 1QQMA 2FSJA 2NRWA 3ENHA 4FL9A 3DXMA 3A5OC 2F9TA 2QW9A 5FPNA 4E1JA 5BR9A 3O9UA 1Z6RA 1ESVA 1X3MA 3FR0A 3R9PA 3T7ZA 1CZAN 2V51B 3O08A 3ZEUA 3VEOA 4A5BA 1E4FT 3O4WA 3P4IA 3H45C 1NGBA 3GL1A 3CD6N 1GLCG 2E1ZA 3M3ZA 4MO4A 1K8KA 1KAYA 3CJ9A 3DWLA 1VQMN 1BU6O 1VAZA 5AQWA 3VEXA 3LDOA 3CJAA 4ISGA 5AQXA 4CBWA 3C7NB 3PIOL 3HOTA 3O5BA 4BG8A 4ISEA 2HSTA 4ISFA 3C0BA 2PBDA 3A5MC 2ZJQL 1BA0A 3CXCM 4KH5A 1RDWX 4JKHA 4WFAL 2YHWA 3SBTA 1ZBSA 3GE1A 3QFPA 4JK9A 1X9JA 3VEVA 1T44A 3E1YA 4EAHD 2E88A 1GLBG 3CJBA 4DQ8A 5M1KA 4JHDB 3ATUA 4IWVA 2QXLA 4DB3A 3FZHA 3MN5A 3VEWA 5ADXA 2CGLA 5AQSA 1BOTO 3L0QA 2A3ZA 3A5LC 3N4QA 4IZ9A 5GADP 1S22A 3CCMN 3CC2N 1S72N 1NJIO 3TSQA 1YXQA 2JWLA 4FWSA 5ADXH 4CBXA 1HX1A 3UKUB 2QWQA 2NRTA 4RWTA 3SJHA 1BUPA 1E4GT 1VQON 4JKAA 5DM7L 5KPZA 3E9PA 3H46O 3U9ZA 4CBUA 2CGJA 5MLCQ 3WEEB 4FPAA 5CHIA 4A2BA 3WXJA 5F1XA 4CZLA 1GLAG 4YOYA 2YJFA 3H3OB 2QI2A 1X3NA 2ASOA 2V7ZA 5AQHA 4EFHA 4O8UA 1HKBA 3O1WA 2GWKA 4J8FA 1Q82O 4BRPA 2QTDA 4CZHA 3LDNA 2Q1NA 2HBJA 4FWKA 3VTHA 3VETA 3SAGA 4JN4A 4FWMA 5JLHA 4YOXA 4BR7A 3TSUA 4CD3A 1T6DA 1LCUA 2NRVA 2P9PA 1SQKA 3ENBA 3KWGA 5TKWA 2A42A 3CCSN 2NRZA 3D2FB 1YJWN 2AP1A 1DKGD 1VQ7N 3ZX0A 5I9EB 3Q7CA 1SS6A 3VGLA 4I6MB 3QICA 5CR4A 3KWIA 3O9SA 2BTFA 4BRAA 3DXKA 4BG9A 4NLCA 3UE5A 2H3GX 2E20A 4Z94A 1R59O 3WT0A 4FOIA 4JD2B 3UKRA 4IXCA 4BRLA 1NGJA 2YHYA 2E2NA 1HJOA 5AQLA 5AQPA 1U6ZA 1TYQB 5BRFA 3CI5A 3Q7BA 1QVGM 3ULEA 1SAZA 4IOAL 3SBGA 3KZBA 4IFEA 3CJ7A 3L4QA 3L6QA 3D6RA 3QDKA 5AQFA 4K43A 4BROA 3BP8A 4B1UB 2CH5A 3MN7A 4BQZA 3HZ6A 2DPNA 3DLLL 4ILJA 4WQ4C 3M1FA 5EOYA 3VEZA 4BGAA 2I7NA 1O13A 3OA9A 4FPBA 3MMVA 4JKEA 4BR2A 4BGBA 5BPNA 3DXMB 5C2FA 4AM7A 3C6AA 2Q0RA 4O8KA 3R1XA 3ZETB 4A61A 1Q81O 1YJ9N 2GTDA 1C0GA 5BPMA 5M1FA 2ASMA 5EVZA 3ZEUB 4B1VA 4CD1A 2VGNA 5LJVA 3O8MA 4FSVA 4CZJA 2VGMA 1Y64A 2QM1A 3MK6A 1K8KB 4A59A 2QWRA 2IVOA 4KBOA 4GNIA 3MWPA 3A8YA 4YOUA 3C65A 3FZKA 1U2VB 5HOOA 2ZF5O 1TUUA 4WYBA 4M63C 4IOXA 4BRFA 2A40A 5BREA 5AQVA 5AQYA 2P9SA 1HPMA 4WF9L 1VQ5N 3IFRA 4BC5A 3FZFA 3MCAB 5LJWA 4MLHA 1HUXA 3MX5A 4YDUA 4A2AA 3I55N 2HMPA 4BRNA 4A57A 2RHKA 4M7YA 2NZTA 4DHYA 5AQIA 1TUYA 1P90A 3H6EA 4JKGA 1YHQN 5JLFA 4H03B 3DJCA 1WOQA 4HTLA 3WUHA 4AM6A 1M1KO 3I8BA 3SK3A 4IJNA 1QZ6A 4BRIA 3IDHA 3CCLN 1YVNA 4FOEA 5AQNA 1H1VA 1YAGA 4QS9A 3WXIA 3CC7N 5BN9A 5KQ8A 5GAGP 1VQKN 3CCQN 2VCPA 3D2EB 4K25A 4NO7A 5E84A 1JJ2M 3CCEN 3QBWA 3MCPA 3CIPA 5KPRA 2YJEA 4MO5A 4IEIA 2QWMA 5F0XA 3CQXA 1SZ2A 2ZGZA 5AZJA 4IOCL 2P9KA 3SLCA 1EO1A 4OPAA 2NRHA 1C0FA 2D1KA 3TU5A 1VQNN 1KQSM 4C1NK 2ZJRL 2WC9A 1K73O 2KKZA 1QVFM 5DM6L 3FE1A 1D4XA 1XQSC 3RSEA 2P9NA 2UYTA 2P9IA 4RCHA 1QHAA 5B8HA 3P38A 5C15A 5CE3A 4YOVA 4UY8O 3CCJN 2VWBA 4FWPA 3LDQA 4H5WA 1GLJO 4NLBA 5AZIA 3WXKA 1MA9B 4FO0A 4BR5A 4BC4A 1VQLN 2ZJPL 2ASPA 3G6EN 4PL8A 3SMPA 4GV3A 4GVEA 3C7NA 3IUCA 4BC3A 2P9PB 5GAEP 3OHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D4W A;  2QWL A;  1HLU A;  1NGA A;  4B1Z A;  1JCE A;  3CHW A;  4IO8 A;  3IMX A;  3D7E O;  4O5F A;  3VEY A;  3FLC O;  3H3N O;  4H5N A;  4CZE A;  3G25 A;  3KHY A;  3CJ1 A;  3J8A A;  3CER A;  3O6W A;  5FPM A;  1V4T A;  3UKR B;  2A5X A;  1NLV A;  1T6C A;  3AY9 A;  3SMS A;  3VF4 A;  2E2O A;  3EKU A;  3BF1 A;  3WXL A;  4B1X B;  2HF3 A;  4FWL A;  3HI0 A;  3HTV A;  3EN9 A;  3FFK B;  1MWM A;  1OKJ A;  2YHX A;  3VGM A;  2E2P A;  4K42 A;  4PKH A;  5AQT A;  4XH5 A;  1QQO A;  2J4R A;  5F2R A;  2QWP A;  2BUP A;  4BRG A;  4JAX A;  2V7Y A;  4BR9 A;  4LC9 B;  1BA1 A;  3U4L A;  5AQZ A;  2P9L A;  1BG3 A;  2ZGY A;  3GG4 A;  3WQU A;  3ZX3 A;  4C23 A;  2D0O A;  4A62 A;  1S3X A;  2CGK A;  3HBT A;  3GBT A;  1QQN A;  1P8Z A;  4XEI A;  4H5V A;  5E26 A;  4CZM A;  1BWF O;  3BEX A;  3QML A;  5AQG A;  3H1V X;  1Q18 A;  3MN9 A;  4PL7 A;  3LDL A;  1BDG A;  3VF2 A;  1NGG A;  3O80 A;  4I6M A;  4IJA A;  1IG8 A;  5AQQ A;  1NGH A;  5AQU A;  3UB5 A;  3VOV A;  5AQK A;  2FSN A;  1ATR A;  1HKC A;  3EO3 A;  4BRQ A;  4JD2 A;  4QS7 A;  1RGI A;  3VEN A;  2VYP A;  4EIA A;  3A0I X;  3BF3 A;  2P9U A;  3TPQ A;  5EY4 A;  1GLD G;  4CZG A;  4WQ5 A;  4FWR A;  1GLE G;  4L3Q A;  5JMV A;  2QWO A;  3QB0 A;  4EHT A;  1ZXO A;  3U9D A;  1G99 A;  4Y0W A;  4BR0 A;  3AAR A;  4BVP A;  1YUW A;  3RSE B;  2P9N B;  2D0P A;  1XC3 A;  2P9I B;  4XH1 A;  3ZET A;  4CI6 A;  2AA4 A;  3KVG A;  5BPL A;  3HM8 A;  3LM9 A;  1EQY A;  3QBX A;  3A5N C;  5AZI B;  5AQJ A;  3VGK A;  4FWQ A;  5KQD A;  4BRD A;  3EZW A;  2IVN A;  3S41 A;  1U2V A;  4WQ4 A;  3H1Q A;  1RFQ A;  1XUP O;  3EL2 A;  2KHO A;  1DGK N;  2IIR A;  4GY2 B;  2GUP A;  2F9W A;  2PAV A;  2Q0U A;  1ATS A;  1NGI A;  2I7P A;  2YI1 A;  5FPD A;  3JS6 A;  4H0V B;  3AAP A;  2EWS A;  1ATN A;  1MWK A;  3U8X A;  5AQR A;  1KAZ A;  5EX5 A;  1NGC A;  2FXU A;  4XH4 A;  3ENO A;  3CET A;  4BRK A;  4EHU A;  4H0O A;  3L4I A;  2OAN A;  3R8E A;  3D2E A;  3VES A;  1NMD A;  4B1W B;  1IJJ A;  4BQL A;  1WUA A;  3R6M A;  4RTF D;  5AR0 A;  3FZM A;  3W0L A;  4JHD A;  3F9M A;  3MDQ A;  4HWI A;  3VER A;  2GEM A;  2YCH A;  3DXK B;  2FLO A;  3JXU A;  4FWN A;  5AFU A;  2QWN A;  1NBW A;  2Q36 A;  2E2Q A;  4JNE A;  3ZX2 A;  4B1Y B;  4CZF A;  3VF6 A;  4CZI A;  5AFU H;  3W3D A;  1J6Z A;  3UKU A;  2P9L B;  3ULE B;  1NGD A;  2FSK A;  5TKY A;  2Q97 A;  4DCH A;  4PKI A;  4F9O A;  2A41 A;  2HOE A;  3WEE A;  3O1B A;  5FPE A;  5AQM A;  2A6A A;  2ITM A;  3AAQ A;  4H5R A;  4FWO A;  4BR4 A;  3ID8 A;  2IVP A;  4M7X A;  2FF6 A;  5LY3 A;  1BO5 O;  4WQ5 C;  5JIC A;  1QZ5 A;  4YDU C;  3ATV A;  1JCF A;  5BN8 A;  4BRE A;  3CJC A;  4MLE A;  4BC2 A;  2E1Y A;  3WQT A;  5ELZ A;  1GLF O;  4BRH A;  1NGF A;  3FGU A;  4CJ7 A;  1NGE A;  1Z05 A;  4H0X B;  2ZWH A;  2GEL A;  3B8A X;  3M6G A;  2E8A A;  1ZC6 A;  2NLX A;  3FZL A;  2P9U B;  3D2F A;  4H5T A;  2P9S B;  3VPZ A;  2CH6 A;  4H0Y B;  1JCG A;  1V4S A;  3GDQ A;  2GWJ A;  3BUZ B;  1NM1 A;  3LL3 A;  4CZK A;  1MDU B;  3LDP A;  3CQY A;  4K41 A;  1LOT B;  2FF3 B;  2Q31 A;  2Q2R A;  4BVO A;  4H0T B;  3LM2 A;  1NWK A;  1TYQ A;  3EKS A;  4B9Q A;  4PKG A;  2HF4 A;  5AQO A;  1DEJ A;  3I33 A;  2W41 A;  5EXW A;  3DAW A;  2W40 A;  4BRC A;  1HKG A;  5BRH A;  4H0P A;  4NB4 A;  3MN6 A;  1KAX A;  5BRD A;  3QFU A;  3GOI A;  4QS8 A;  3HSC A;  5AZJ B;  1GLL O;  2P9K B;  2WUS A;  4BRM A;  2V52 B;  5KPT A;  1KXP A;  1QQM A;  2FSJ A;  3ENH A;  4FL9 A;  5FPN A;  3DXM A;  3A5O C;  2F9T A;  2QW9 A;  4E1J A;  5BR9 A;  1Z6R A;  1ESV A;  1X3M A;  3FR0 A;  3R9P A;  1CZA N;  2V51 B;  3O08 A;  3ZEU A;  3VEO A;  1E4F T;  3O4W A;  3P4I A;  3H45 C;  1NGB A;  3GL1 A;  1GLC G;  2E1Z A;  3M3Z A;  4MO4 A;  1K8K A;  1KAY A;  3CJ9 A;  3DWL A;  1BU6 O;  5AQW A;  3VEX A;  3LDO A;  3CJA A;  4ISG A;  5AQX A;  4CBW A;  3C7N B;  3O5B A;  4BG8 A;  4ISE A;  4ISF A;  3C0B A;  2PBD A;  3A5M C;  1BA0 A;  1RDW X;  2YHW A;  1ZBS A;  3GE1 A;  3QFP A;  1X9J A;  3VEV A;  1T44 A;  4EAH D;  2E88 A;  1GLB G;  3CJB A;  4DQ8 A;  4JHD B;  3ATU A;  4IWV A;  2QXL A;  4DB3 A;  3FZH A;  3MN5 A;  3VEW A;  5ADX A;  2CGL A;  5AQS A;  1BOT O;  3L0Q A;  2A3Z A;  3A5L C;  4IZ9 A;  1S22 A;  1YXQ A;  4FWS A;  5ADX H;  4CBX A;  1HX1 A;  3UKU B;  2QWQ A;  4RWT A;  3SJH A;  1BUP A;  1E4G T;  5KPZ A;  3H46 O;  4CBU A;  3U9Z A;  2CGJ A;  3WEE B;  4FPA A;  4A2B A;  3WXJ A;  5F1X A;  4CZL A;  1GLA G;  2YJF A;  3H3O B;  1X3N A;  2ASO A;  2V7Z A;  5AQH A;  4EFH A;  1HKB A;  3O1W A;  2GWK A;  4J8F A;  4BRP A;  4CZH A;  3LDN A;  2Q1N A;  4FWK A;  3VET A;  4JN4 A;  4FWM A;  5JLH A;  4BR7 A;  4CD3 A;  1T6D A;  1LCU A;  2P9P A;  1SQK A;  2A42 A;  3D2F B;  2AP1 A;  1DKG D;  3ZX0 A;  5I9E B;  3VGL A;  4I6M B;  3QIC A;  2BTF A;  4BRA A;  3DXK A;  4BG9 A;  3UE5 A;  2H3G X;  2E20 A;  4Z94 A;  1R59 O;  3WT0 A;  4FOI A;  4JD2 B;  3UKR A;  4IXC A;  4BRL A;  1NGJ A;  2YHY A;  2E2N A;  1HJO A;  5AQL A;  5AQP A;  1U6Z A;  1TYQ B;  5BRF A;  3CI5 A;  3ULE A;  1SAZ A;  3KZB A;  3CJ7 A;  3L6Q A;  3QDK A;  5AQF A;  4K43 A;  4BRO A;  3BP8 A;  4B1U B;  2CH5 A;  3MN7 A;  4BQZ A;  3HZ6 A;  2DPN A;  4WQ4 C;  3M1F A;  5EOY A;  3VEZ A;  4BGA A;  2I7N A;  4BR2 A;  4FPB A;  3MMV A;  4BGB A;  5BPN A;  3DXM B;  4AM7 A;  2Q0R A;  4O8K A;  3ZET B;  4A61 A;  2GTD A;  1C0G A;  5BPM A;  2ASM A;  5EVZ A;  3ZEU B;  4B1V A;  4CD1 A;  5LJV A;  3O8M A;  4FSV A;  4CZJ A;  1Y64 A;  2QM1 A;  3MK6 A;  1K8K B;  2QWR A;  2IVO A;  4KBO A;  4GNI A;  3A8Y A;  3FZK A;  1U2V B;  2ZF5 O;  1TUU A;  4WYB A;  4M63 C;  4BRF A;  5BRE A;  2A40 A;  5AQV A;  5AQY A;  2P9S A;  1HPM A;  3IFR A;  4BC5 A;  3FZF A;  5LJW A;  4MLH A;  1HUX A;  4YDU A;  4A2A A;  2HMP A;  4BRN A;  4M7Y A;  2NZT A;  4DHY A;  5AQI A;  1TUY A;  3H6E A;  5JLF A;  4H03 B;  3DJC A;  1WOQ A;  4HTL A;  3WUH A;  4AM6 A;  3I8B A;  3SK3 A;  4IJN A;  1QZ6 A;  4BRI A;  3IDH A;  1YVN A;  4FOE A;  5AQN A;  1H1V A;  1YAG A;  4QS9 A;  3WXI A;  5BN9 A;  5KQ8 A;  2VCP A;  3D2E B;  4K25 A;  4NO7 A;  5E84 A;  3QBW A;  3MCP A;  3CIP A;  5KPR A;  2YJE A;  4MO5 A;  5F0X A;  2QWM A;  3CQX A;  1SZ2 A;  2ZGZ A;  5AZJ A;  2P9K A;  3SLC A;  2NRH A;  1C0F A;  2D1K A;  3TU5 A;  3FE1 A;  1D4X A;  1XQS C;  3RSE A;  2P9N A;  2UYT A;  2P9I A;  4RCH A;  1QHA A;  5B8H A;  5CE3 A;  2VWB A;  4FWP A;  3LDQ A;  4H5W A;  1GLJ O;  5AZI A;  3WXK A;  4BR5 A;  1MA9 B;  4FO0 A;  4BC4 A;  2ASP A;  4PL8 A;  3SMP A;  3C7N A;  3IUC A;  4BC3 A;  2P9P B;  3OHR A; 
#chains in the Genus database with same CATH topology
 3DOL A;  3CFO A;  1BIZ A;  1WSH A;  1JCE A;  2UUA K;  3IMX A;  4B3M K;  3D7E O;  3VEY A;  1S9G A;  4H5N A;  1OVY A;  1LWF A;  4C1N I;  4HUF A;  4DQR A;  3O6W A;  1XI1 A;  1V4T A;  2RN2 A;  3RMC A;  2A5X A;  4O5B A;  4LF9 K;  1C1C A;  3AY9 A;  1XMQ K;  2E6M A;  3ITH A;  4DR7 K;  2E2O A;  1S6P A;  3HOS A;  2HF3 A;  1YVU A;  4Z4E A;  2OCE A;  4B3T K;  4K42 A;  4PKH A;  4LD0 A;  5GIO A;  4AHU A;  3NF8 A;  3L2V A;  4LC9 B;  5GIN A;  5AQZ A;  2P9L A;  1BG3 A;  4H8K A;  4Z4C A;  1BI4 B;  2FBX A;  4CK1 A;  3F2K A;  1S3X A;  4JKC A;  4DS5 A;  2NRR A;  4CZM A;  4KH4 A;  1WBD A;  1UAX A;  3CCR N;  4YOW A;  1WAF A;  4DQP A;  1Q18 A;  1J9A A;  3MN9 A;  4JI6 K;  1KD1 O;  1QE1 A;  3RTV A;  1KVA A;  1ZBI A;  4DTS A;  3UB5 A;  2UXC K;  3B6O A;  3VOV A;  2QA4 N;  1T7P A;  3LZJ A;  1FW6 A;  3DLH A;  4I9Q A;  4BRQ A;  1LW0 A;  1N33 K;  1YT3 A;  2D5R A;  4I2Q A;  3VEN A;  2XY5 A;  4KHQ A;  3A0I X;  1N8R O;  5HP1 A;  1GLD G;  3KTQ A;  4WQ5 A;  1YIJ N;  4J2D A;  3C6U A;  4NCG A;  4FK0 A;  4Z4I A;  4PHT X;  4IEE A;  3J7A P;  3QB0 A;  3TTD A;  4EHT A;  1ZXO A;  2GUI A;  5JVH L;  4B08 A;  3AVI A;  3AAR A;  3R3L A;  4KH6 A;  3RSE B;  2P9N B;  2D0P A;  4XH1 A;  4CHY A;  3KVG A;  1A5V A;  3HM8 A;  3LM9 A;  3TAR A;  3PO5 A;  4JI5 K;  2RE2 A;  4KRE A;  3MEE A;  4NYN A;  3A5N C;  3DLG A;  5AQJ A;  4AHC A;  3D0P A;  4BRD A;  2IVN A;  1M90 O;  3CMA N;  4CHO A;  4WQ4 A;  2JLE A;  4GY2 B;  1FKO A;  4DSI A;  2OPR A;  2Q0U A;  2O8C B;  4N41 A;  2ZQB A;  4JI7 K;  1Z25 A;  1NK7 A;  2IGI A;  4C8K A;  1X1P A;  3DRS A;  4J2A A;  4HUE A;  2E6L A;  5M1P A;  3CET A;  2PZS A;  1XHX A;  3ZSV A;  4M3Y A;  4FJN A;  4FLV A;  4B1W B;  1J5E K;  1Q9X A;  3M8P A;  3KKR A;  3CM6 A;  4FVU A;  4G9Z A;  3VER A;  2E2Q A;  1DT9 A;  3SQ4 A;  3VF6 A;  1SKS A;  3ZT0 A;  5H1S Q;  3W3D A;  3TAB A;  2KLA A;  3J7Z O;  3I56 N;  3ULE B;  1KC8 O;  4FJK A;  5DMR A;  1HJR A;  5TKY A;  3CME N;  1BCO A;  3F9K A;  4ILH A;  4PKI A;  3TTC A;  5FPE A;  4DTP A;  4JI8 K;  2HBL A;  3QEW A;  3MWT A;  4BR4 A;  4LH4 A;  3EY1 A;  3PV8 A;  3HRG A;  4FZX C;  3DYA A;  2G8F A;  5JIC A;  3DMJ A;  2DFH A;  3PIP L;  5FDL A;  4DQQ A;  1W7A A;  4LH5 A;  4CEC A;  2VQF K;  1NGF A;  4H0X B;  3TSP A;  2VG5 A;  2X74 A;  4KKO A;  2NLX A;  4X65 K;  3K58 A;  2DFE A;  4CF1 A;  4OO1 J;  3K5O A;  3VPZ A;  1NK0 A;  1JLG A;  3QEX A;  3RMA A;  1V4S A;  3CG7 A;  3HP6 A;  3SPY A;  2GWJ A;  1S1W A;  3RR7 A;  3SQ1 A;  4U7B A;  3LDP A;  3CQY A;  3KK3 A;  3OBW A;  2PYL A;  2F96 A;  4BVO A;  3CF5 L;  2O4G A;  1HYV A;  1WN7 A;  4O4G A;  1K9M O;  4R79 A;  3O9Q A;  4F2R A;  3K59 A;  1KVB A;  4LSL A;  1TK5 A;  4BRM A;  3LAN A;  1RT1 A;  3AO5 A;  2F9T A;  1L5U A;  1N32 K;  3O9U A;  4ZTF A;  1X3M A;  3V81 A;  3QER A;  1D9D A;  3O08 A;  4A5B A;  1E4F T;  2E1Z A;  4MO4 A;  1K8K A;  3ASM A;  4O0I A;  3CJ9 A;  3DWL A;  3CJA A;  4DWI A;  5AQX A;  4B9L A;  3PIO L;  4BG8 A;  4ISE A;  4CVN E;  2HHT A;  3OJS A;  3CXC M;  3OS1 A;  1FXX A;  2BDP A;  1RTD A;  1C0T A;  1IKX A;  3WNF A;  3SZ2 A;  4M3W A;  1X9J A;  3SNN A;  3E1Y A;  4EAH D;  2E88 A;  1SKR A;  4JHD B;  4IWV A;  1HNV A;  3JSM A;  1NK8 A;  3MN5 A;  3VEW A;  3AVA A;  2CGL A;  3L0Q A;  4IZ9 A;  1L3V A;  1S72 N;  3TSQ A;  1J54 A;  4HTU A;  4CBX A;  3UKU B;  4CEB A;  2QWQ A;  1NK4 A;  4RWT A;  3THY A;  1VQO N;  5KPZ A;  3AV9 A;  4JI4 K;  3OS0 A;  3AVF A;  1VSI A;  1WNS A;  4Z4H A;  5CHI A;  3THV A;  5KGX A;  4CZL A;  2YJF A;  3H3O B;  1YTU A;  1DTT A;  1T8E A;  4EFH A;  3IS9 A;  1HKB A;  2GWK A;  2QTD A;  3VQQ A;  5D3G A;  5HBM A;  4KPY A;  3SAG A;  4FWM A;  4YOX A;  4BR7 A;  3TAP A;  1NG9 A;  2O8F B;  4CF8 A;  1SQK A;  5TKW A;  4OJR A;  2A42 A;  3QES A;  1VQ7 N;  1W0H A;  3Q7C A;  4I6M B;  4HCC A;  1C0U A;  3KWI A;  5EU7 A;  2VG6 A;  4BG9 A;  4OGE A;  3WNG A;  1R59 O;  1RT5 A;  4JD2 B;  3UKR A;  1GOC A;  2E2N A;  3AO4 A;  4CFA A;  3BGR A;  1U6Z A;  4CHP A;  3CI5 A;  4K8X A;  3Q7B A;  3ULE A;  3SBG A;  5CZ1 A;  3HVR A;  4RW6 A;  2OPQ A;  3BP8 A;  4B1U B;  5JS1 A;  4BQZ A;  3HZ6 A;  2DPN A;  3OYN A;  4ILJ A;  2P5O A;  2O8E A;  1OVQ A;  4DV7 K;  3NF7 A;  4FPB A;  4BGB A;  3C6A A;  1Q81 O;  2GTD A;  1C0G A;  5BPM A;  5EVZ A;  4B1V A;  1S1U A;  3OJU A;  4CZJ A;  1XNR K;  1QSL A;  4KV8 A;  4N76 A;  3MWP A;  1WSG A;  3C65 A;  5HOO A;  4WYB A;  2YNI A;  4BRF A;  2A40 A;  4CJL A;  1HR0 K;  1TAQ A;  1VSL A;  1XWL A;  3NH1 A;  4WF9 L;  3NE6 A;  3LZI A;  3TAF A;  3FZF A;  3DLE A;  1NK9 A;  3QIN A;  4YDU A;  1HUX A;  3A2F A;  3I55 N;  2ZE2 A;  4A57 A;  2G8H A;  2Z1H A;  4M7Y A;  1S5J A;  4HTL A;  3QEV A;  3I8B A;  3SK3 A;  4IJN A;  1QZ6 A;  1H1V A;  4QS9 A;  4FJH A;  5GAG P;  5E84 A;  4CK3 A;  4JS5 A;  2LSN A;  5KPR A;  3K5M A;  3G10 A;  4IEI A;  3CQX A;  2ZGZ A;  4Z4F A;  4DF8 A;  4IKF A;  2D1K A;  4DV1 K;  4C1N K;  1QVF M;  5DM6 L;  5KRS A;  1XQS C;  1TVR A;  2P9I A;  1QHA A;  5C15 A;  3KK1 A;  2OZM A;  1TGO A;  4IG0 A;  4IFV A;  4H5W A;  3BY5 A;  4BR5 A;  3OTO K;  4FO0 A;  3V9Z A;  3ZSZ A;  1I39 A;  2ZM6 K;  4E89 A;  4LFC K;  1N5Y A;  4KI6 A;  4GV3 A;  3SQ2 A;  5GAE P;  1N36 K;  4ID1 A;  1B9D A;  3M5R A;  1K8A O;  1HLU A;  1NGA A;  4I7F A;  1S1T A;  4DU1 A;  4CJQ A;  3CCU N;  4E0D A;  4NYF A;  4CIE A;  1TL1 A;  3FLC O;  2UU9 K;  4WFN L;  3KK7 A;  3G25 A;  3KHY A;  3CJ1 A;  3O9T A;  2HBM A;  3NVK A;  5KI6 A;  4WFB L;  2HHU A;  5KRT A;  3KLG A;  3CCV N;  3T19 A;  3E01 A;  3PX6 A;  3EKU A;  3BF1 A;  4CF2 A;  3LWM A;  1LWC A;  5JVG L;  3HI0 A;  2B4J A;  3HTV A;  4FLZ A;  1NJZ A;  3V9W A;  3RR8 A;  4FJ9 A;  2KZZ A;  1OKJ A;  2YHX A;  1VRT A;  4GMJ B;  2E2P A;  3VGM A;  5C10 A;  3NHG A;  4KB1 A;  1JXB A;  5AQT A;  3AVH A;  5M1Q A;  4CJU A;  2RF2 A;  5F2R A;  4KFB A;  3IRX A;  1VQ6 N;  4RW8 A;  5CZ2 A;  4J2E A;  5M1N A;  2XHB A;  4MFB A;  4C23 A;  2D0O A;  2CGK A;  3GBT A;  1QQN A;  1P8Z A;  3PY8 A;  1ASU A;  3BEX A;  1W9H A;  3OYH A;  4PL7 A;  1BDG A;  1EKE A;  1NGG A;  3O80 A;  2NRX A;  4CEQ A;  3KKS A;  2NNW A;  4I6M A;  3VN5 A;  1IG8 A;  5AQQ A;  3DRR A;  5AQK A;  1VSM A;  1UOC A;  3K9J A;  3HO1 A;  4DTN A;  5KTQ A;  4LFB K;  4JD2 A;  4EIA A;  3HST B;  2P9U A;  4FJ5 A;  3LAL A;  3TPQ A;  3C95 A;  4FWR A;  4L3Q A;  1IBL K;  4PWD A;  3DRP A;  4B3R K;  4DR2 K;  3AVN A;  5JMV A;  1NKE A;  4MDB A;  4F8R A;  3ZLJ A;  1XHZ A;  5GAH P;  3U9D A;  2YNH A;  4DTR A;  4BR0 A;  4BVP A;  3N4P A;  5C2D A;  4CI6 A;  3L2U A;  3L2R A;  4KHU A;  3EE8 A;  5AZI B;  4FWQ A;  3EZW A;  2Y1I A;  4G1Q A;  3K5L A;  3S41 A;  3DI6 A;  3PUF A;  3K5N A;  5J1E A;  2QEX N;  3EL2 A;  1XMO K;  1VSH A;  3HVT A;  3E66 A;  2F9W A;  4YY3 K;  4W5O A;  1RIL A;  3RVC A;  4DF4 A;  1EXQ A;  3O9R A;  4ELV A;  2YI1 A;  5FPD A;  4LF6 K;  1MWK A;  3CFP A;  3ZYY X;  4E1N A;  1BHL A;  1NGC A;  4XH4 A;  5A2Q O;  4CEF A;  5IWA K;  2XO7 A;  1SL2 A;  4DKW A;  3HL8 A;  4DU3 A;  4GV9 A;  3L4I A;  4FK4 A;  4BQL A;  1IJJ A;  2X6S A;  2A1S A;  1IG9 A;  4RTF D;  3FZM A;  4OPH A;  1RTI A;  3MDQ A;  3DXK B;  2HHW A;  3JXU A;  4JRQ A;  3SPZ A;  4CZF A;  5LL6 Z;  1UA0 A;  3K57 A;  3TTF A;  4CZI A;  2D0C A;  1J6Z A;  4FJG A;  4DQI A;  3V1Q A;  3AA5 X;  4FCY A;  1KLM A;  3VQ8 A;  4DCH A;  3T69 A;  3WEE A;  5AQM A;  3TWH A;  2ITM A;  4JV5 K;  3VQ7 A;  3QLH A;  4LSN A;  4E7K A;  2IVP A;  5LY3 A;  3AGR A;  4WQ5 C;  3L3U A;  5BN8 A;  1JCF A;  3SI6 A;  3E9O A;  4BRE A;  4MLE A;  5C42 A;  2YV0 X;  1Q86 O;  1NOY A;  3I8D A;  2E1Y A;  3WQT A;  5ELZ A;  1GLF O;  3MAQ A;  4DV4 K;  4CJ7 A;  1NGE A;  3G71 N;  1GOA A;  3RRG A;  1HYZ A;  2E8A A;  3CFR A;  2PY5 A;  3D2F A;  1X9S A;  2P9S B;  3MEC A;  3ID6 A;  2CH6 A;  1C1B A;  2WTU A;  3TI0 A;  3LL3 A;  4CED A;  1MDU B;  3KK2 A;  4KTQ A;  3HYF A;  2F8T A;  4B9N A;  2FF3 B;  2Q31 A;  4DSK A;  3HXM A;  1TYQ A;  2HF4 A;  5AQO A;  1DEJ A;  3DAW A;  2W40 A;  3ZT3 A;  4BRC A;  1HQU A;  1HKG A;  4DSJ A;  2OTJ N;  1TV6 A;  1C0M A;  5BRH A;  4H0P A;  5HRR A;  3MN6 A;  4YOR A;  1S1V A;  4QS8 A;  1GLL O;  4N47 A;  4DUY K;  1TL3 A;  2V52 B;  3T1A A;  5KPT A;  3NAE A;  4E1J A;  5BR9 A;  2ETJ A;  2QW9 A;  1KVC A;  3FR0 A;  1RT3 A;  4DFM A;  1RNH A;  2V51 B;  3VEO A;  3CD6 N;  3P4I A;  3H45 C;  1NGB A;  4M3X A;  4FM1 A;  2F4V K;  3O3F A;  1FJG K;  4ISG A;  4XIU A;  1UWB A;  1RDB A;  2HST A;  2PBD A;  3A5M C;  2VWJ A;  3U3G A;  4JKH A;  3TAN A;  4EP4 A;  2YNF A;  3SBT A;  1ZBS A;  4JK9 A;  2D0B A;  4DV2 K;  3ATU A;  4DLG A;  1HNX K;  4CEO A;  4CJ4 A;  4CK2 A;  2QXL A;  4DB3 A;  5J2M A;  2BAN A;  3IG1 A;  2G8I A;  1HMV A;  2A3Z A;  3N4Q A;  3CCM N;  1YXQ A;  4FWS A;  3OYF A;  1IKV A;  3SJH A;  1E4G T;  4QCL A;  4BAC A;  3H46 O;  2B6A A;  4E7H A;  3HPG A;  4MQ3 A;  1IO2 A;  3WXJ A;  4YOY A;  2QI2 A;  2YHA A;  5K14 A;  4YHH K;  3QET A;  2V7Z A;  4O8U A;  4M3R A;  4B9U A;  1Q82 O;  4CZH A;  3VA0 A;  2Q1N A;  3DLB A;  3OYG A;  4B3S K;  3VTH A;  3TSU A;  4CD3 A;  2P9P A;  3NGY A;  3ENB A;  4JI0 K;  1N34 K;  3PSF A;  1NKB A;  3NFA A;  2DY4 A;  2D0A A;  1EP4 A;  2AP1 A;  3ZX0 A;  3OYK A;  1SS6 A;  3S3N A;  2O8D B;  4RG8 A;  3QIC A;  2BTF A;  4BRA A;  1ZBH A;  3AVM A;  3DXK A;  4YNQ A;  2H3G X;  2E20 A;  1CXQ A;  3OYL A;  3AO1 A;  3NH0 A;  1IKY A;  1NGJ A;  4R5P A;  5CYQ A;  1Z26 A;  1HJO A;  1SV5 A;  5BRF A;  4RW7 A;  4IFE A;  1IV0 A;  3L6Q A;  2CH5 A;  3SV4 A;  3MN7 A;  3DLL L;  4FLY A;  3AVG A;  3O4Q A;  3P83 D;  3M1F A;  2HNZ A;  3T1Y K;  3OA9 A;  4BR2 A;  4FJ8 A;  4DLE A;  3DXM B;  3RMB A;  2Q0R A;  4O8K A;  4AIL C;  3R1X A;  3ZET B;  3HJF A;  4CES A;  1YJ9 N;  3VQ4 A;  1BI4 A;  2HHX A;  3ZEU B;  5LJV A;  4K8Z A;  3O8M A;  4N5S A;  4FSV A;  4M3T A;  5CYM A;  4GNI A;  1QS4 A;  3V9S A;  4YOU A;  4CFB A;  1U2V B;  4M63 C;  4IOX A;  3MXJ A;  5AQV A;  5AQY A;  2P9S A;  1HPM A;  1WSI A;  2HW3 A;  3MCA B;  3THX B;  2UUB K;  1T05 A;  4A2A A;  3OVN A;  4IG3 A;  4BRN A;  4DHY A;  1Q8I A;  3DJC A;  3WNE A;  3WUH A;  2GV9 A;  1WB9 A;  3S3O A;  4BRI A;  4CJS A;  1YVN A;  2DFF A;  4I2P A;  5LMN K;  3CC7 N;  5FRN A;  3HP9 A;  5BN9 A;  5KQ8 A;  1NK5 A;  4DUZ K;  4CIG A;  3CCQ N;  1VQK N;  3CCE N;  2AJQ A;  3QBW A;  1RCH A;  4MO5 A;  5F0X A;  4HHT A;  1SZ2 A;  1EO1 A;  4L8R B;  1VQN N;  3TU5 A;  1OH7 A;  2ZJR L;  1K73 O;  2WC9 A;  1L3U A;  3RSE A;  2P9N A;  2UYT A;  5B8H A;  4CER A;  5CE3 A;  4EP5 A;  4YOV A;  4H4M A;  2RPI A;  1GLJ O;  4NLB A;  4BC4 A;  2ASP A;  3CYM A;  1BCM A;  3DM2 A;  3SMP A;  4PUO A;  1BIS A;  2D4W A;  3CPE A;  2QWL A;  3VQD A;  5M1O A;  3CHW A;  3SAH A;  1LV5 A;  2O8C A;  4B8C A;  2OA8 A;  4O5F A;  4DSF A;  5GIP A;  3CQ8 A;  1CZB A;  1YF5 L;  1RBT A;  3J8A A;  3CER A;  1S6Q A;  1RTH A;  1JLQ A;  4BWJ A;  2KFN A;  2OPP A;  3L2W A;  2HBK A;  4FJ7 A;  1RBR A;  3JYT A;  1RDC A;  1T6C A;  3SMS A;  1QQC A;  3I0S A;  4FWL A;  1OH8 A;  3FFK B;  5C12 A;  1MWM A;  3QIO A;  4CGG A;  3CPW M;  3ZCM A;  1KLN A;  3PLA A;  4CE9 A;  1X9M A;  2QWP A;  4BRG A;  4JAX A;  1ASW A;  4BR9 A;  4CGI A;  3KLH A;  1BA1 A;  3PO4 A;  3GG4 A;  3EZ5 A;  3ZX3 A;  4EZ6 A;  1WSF A;  4O0J A;  3P1G A;  2W6K A;  2F7T A;  3HBT A;  3NF6 A;  4CCH A;  2B5J A;  5E26 A;  4BY9 C;  1BWF O;  1C1A A;  3LDL A;  4GKK K;  2ATQ A;  4DR6 K;  4GV6 A;  2O8D A;  4FYD A;  1NGH A;  4A5A A;  1T3V A;  1ATR A;  3AA3 A;  3OBY A;  3VQE A;  1HKC A;  3ZSQ A;  3UIQ A;  4OKJ A;  3TR8 A;  5I42 A;  4JEP A;  5I3U A;  3BF3 A;  3OW2 M;  4CHQ A;  3SUN A;  1ZBL A;  2YNG A;  4LF5 K;  1GOB A;  2IAJ A;  2R7Y A;  4CJE A;  3LPU A;  4OVL A;  2O8B B;  3J7Y P;  4C8N A;  4KTZ A;  2Z1I A;  5BR8 K;  1HNW K;  2QWO A;  1JLE A;  3EE9 A;  3E9L A;  4OGC A;  4NXN K;  1A5X A;  4GVM A;  4X62 K;  1VK0 A;  5FLX O;  1XC3 A;  3ZET A;  3BZC A;  5J2Q A;  4KI4 A;  3SUO A;  5BPL A;  4B8A B;  1EQY A;  3V9X A;  4KO0 A;  3VQ5 A;  5HRN A;  1QHT A;  4W5Q A;  2VG7 A;  3AGK A;  2IS3 A;  2Y1J A;  1N6Q A;  1W2B M;  4E3S A;  4O44 A;  1U2V A;  1RTJ A;  1XUP O;  4FW1 A;  2KHO A;  3S9H A;  2IIR A;  4CJK A;  4LF4 K;  1RT2 A;  3NH2 A;  3NF9 A;  1CLQ A;  2GUP A;  2DTU A;  3THX A;  4BE1 A;  2PAV A;  2HMI A;  1ATS A;  3OS2 A;  3LPT A;  1OH5 A;  4V19 S;  4PQU A;  2KTQ A;  2I7P A;  3JS6 A;  4H0V B;  3AAP A;  1L3T A;  5KGW A;  3M8R A;  4ELU A;  5AQR A;  3P31 A;  1KAZ A;  1ZYQ A;  2HHQ A;  2FXU A;  3ENO A;  2WON A;  2Z1J A;  4BRK A;  4EZ9 A;  4AF1 A;  3TAQ A;  3R8E A;  3VES A;  4IBN A;  2G8K A;  3NMU A;  1NMD A;  2Q3S A;  1WUA A;  3R6M A;  5AR0 A;  4JHD A;  1FK9 A;  1Q7Y O;  3I0R A;  2GEM A;  4DSE A;  2YCH A;  2FLO A;  5AFU A;  1CXU A;  2QWN A;  1NBW A;  2Q36 A;  4B1Y B;  3ZX2 A;  1VQP N;  4ZHR A;  4DS4 A;  1TAU A;  3UKU A;  2P9L B;  1NGD A;  3CC4 N;  1YJN N;  1BL3 A;  4YOT A;  2A41 A;  2HOE A;  1NOZ A;  3O1B A;  3PSI A;  2A6A A;  3VTI A;  3AAQ A;  3V9U A;  4H5R A;  3AO3 A;  3ID8 A;  4Z4G A;  2FF6 A;  4IO9 L;  4JK8 A;  1QZ5 A;  3LP2 A;  4Q0B A;  4OKK A;  3K0S A;  4H4O A;  3HPO A;  2O8F A;  3SJJ A;  2GEL A;  2I5J A;  3H08 A;  3B8A X;  2A1R A;  2YX6 A;  2QKK A;  1ZC6 A;  3FZL A;  4F2S A;  3LP1 A;  1NJW A;  3P39 A;  4MDA A;  4M3U A;  1TKD A;  4O55 A;  1JCG A;  4FLT A;  3KLI A;  3GDQ A;  3NCI A;  4LY7 A;  4WCE L;  1OH6 A;  4W5N A;  4CZK A;  4JK7 A;  4JKG B;  2PFU A;  1LOT B;  3AVJ A;  4CIF A;  2Q2R A;  1RDU A;  3LM2 A;  1NWK A;  3EKS A;  3F73 A;  2GX9 A;  1YIT N;  1X9W A;  3GOI A;  3K9K A;  1VSE A;  1XNQ K;  3MX2 A;  2BGG A;  4JKB A;  1QQM A;  3ENH A;  2NRW A;  4FL9 A;  5FPN A;  5HLF A;  3A5O C;  1BIU A;  1ESV A;  4Z0U A;  3R9P A;  5C24 A;  3T7Z A;  1JL2 A;  2HNY A;  3GL1 A;  1GLC G;  3M3Z A;  2KFZ A;  3OYJ A;  1JL1 A;  1VQM N;  4OPK A;  1XC9 A;  3U3Y A;  1U04 A;  4ISF A;  1IKW A;  1BA0 A;  4K0K K;  4KH5 A;  1RDW X;  2IOC A;  2YHW A;  4YFU A;  3GE1 A;  3QFP A;  1QSY A;  4FZZ A;  1T44 A;  2YKM A;  2O8B A;  3CJB A;  4DQ8 A;  5M1K A;  5ADX A;  5AQS A;  1BOT O;  1D9F A;  4PY5 A;  4CGH A;  3LAM A;  3LAK A;  5J2P A;  2KW4 A;  4CF9 A;  4DMN A;  2F8S A;  2EHG A;  4CBU A;  3U9Z A;  4CEE A;  2CGJ A;  4E19 A;  4BWM A;  4FPA A;  1U45 A;  5F1X A;  4M41 A;  2KZM A;  1X3N A;  5AQH A;  4N56 A;  2OPS A;  2ITG A;  3LDN A;  2HBJ A;  1O1W A;  1T6D A;  4LF8 K;  2P51 A;  3KWG A;  4ID5 A;  3QIP A;  1I94 K;  3CCS N;  1Y97 A;  3T3F A;  5I9E B;  2OZS A;  4OLA A;  1TK8 A;  3VGL A;  1VSJ A;  2ZD1 A;  3TAM A;  5CR4 A;  3S3M A;  4FZY A;  4IFY A;  4ICL A;  4FJJ A;  2HND A;  3WT0 A;  4FOI A;  1NKC A;  4JS4 A;  4LFA K;  3O4N A;  2NUB A;  5FRM A;  5AQL A;  5AQP A;  1SAZ A;  3KZB A;  1JLC A;  3CJ7 A;  1KFD A;  1EET A;  5AQF A;  4BRO A;  3VQC A;  4WQ4 C;  1IH7 A;  5EOY A;  2QKB A;  4BGA A;  2I7N A;  4NCA A;  1IBK K;  3LP0 A;  4BDZ A;  5SWM A;  4FJL A;  5AJ3 K;  1LWE A;  1VHX A;  1U48 A;  1J53 A;  2VGM A;  3MK6 A;  1K8K B;  4FLW A;  2QWR A;  4DTJ A;  2IVO A;  4KBO A;  3OYE A;  1SKW A;  3FZK A;  1QTM A;  4OKE A;  1DLO A;  1TUU A;  3PX0 A;  2FC0 A;  3P5J A;  3VQA A;  1VQ5 N;  3SUQ A;  4BC5 A;  1D8Y A;  1S1X A;  3MX5 A;  2XRI A;  4KAZ A;  4FLX A;  4AHV A;  5LMU K;  2VWK A;  2RHK A;  2NZT A;  1REV A;  5AQI A;  4JI2 K;  3V1R A;  4FW2 A;  5JS2 A;  4JKG A;  1YHQ N;  4JYA K;  1M1K O;  3LP3 A;  3SCX A;  2OYQ A;  4JLH A;  4CGD A;  3PX4 A;  2BE2 A;  5AQN A;  1KTQ A;  3KJV A;  3D2E B;  4K25 A;  4NO7 A;  1JJ2 M;  4FJI A;  1JLA A;  3K2P A;  1HQE A;  3CIP A;  2YJE A;  1JXE A;  3THY B;  2QWM A;  1NNE A;  4IOC L;  4DTU A;  4OPA A;  1C0F A;  1KQS M;  3ZSX A;  3FE1 A;  3VQ9 A;  4RCH A;  3P38 A;  4DFK A;  2PYJ A;  4UY8 O;  2HB5 A;  2VWB A;  3LDQ A;  5AZI A;  2X78 A;  1MA9 B;  1DTQ A;  3M8S A;  1VQL N;  1R0A A;  4DTO A;  1Q9Y A;  1YTA A;  4GVE A;  3ZT2 A;  3OHR A;  3ZSR A;  4DR4 K;  5C0Y A;  3EEQ A;  3LWL A;  4B1Z A;  2G8V A;  4IO8 A;  4DV0 K;  1CZ9 A;  4DTX A;  4E7J A;  2P5G A;  3OYM A;  3H3N O;  4CZE A;  4DQS A;  2JWK A;  5FPM A;  2XY8 A;  4CFC A;  1UA1 A;  3UKR B;  3U6F A;  4CEZ A;  1NLV A;  4X66 K;  3QEI A;  3VF4 A;  4JI1 K;  3WXL A;  3AVB A;  4B1X B;  3EN9 A;  4DG1 A;  4DR3 K;  3O3G A;  2O8E B;  1HRH A;  4XH5 A;  1QQO A;  1ZBU A;  2J4R A;  3DLK A;  2BUP A;  3VQP A;  3KD5 E;  2V7Y A;  3SAF A;  3ZSW A;  3U4L A;  4FLU A;  4E7L A;  2ZGY A;  1RT7 A;  4OLB A;  4OPJ A;  3WQU A;  3B6P A;  2WBN A;  4A62 A;  4XEI A;  4H5V A;  3QML A;  4Y1C A;  5AQG A;  3H1V X;  2HVI A;  3VF2 A;  4DU4 A;  1U47 A;  3M8Q A;  2W42 A;  1YI2 N;  1RDA A;  3JAM O;  4BE0 A;  4IJA A;  5AQU A;  3QNN A;  4QOZ B;  2FSN A;  1ILY A;  1B92 A;  2OTL N;  3EO3 A;  3NDK A;  4U67 L;  3HM9 A;  4QS7 A;  1RGI A;  3NVM A;  2VYP A;  4ZTJ A;  1VQ8 N;  4JI3 K;  1TKZ A;  3L2Q A;  5EY4 A;  4ILG B;  4CZG A;  4F4K A;  1HYS A;  3VMF B;  1EWQ A;  2BH1 A;  5C25 A;  1GLE G;  3F5T A;  4CJT A;  4CGJ A;  1WLJ A;  3IAY A;  1NK6 A;  2RKI A;  1G99 A;  4Y0W A;  4FM0 A;  1YUW A;  3MXI A;  2P9I B;  5FRO A;  3RRH A;  1HNI A;  2AA4 A;  4DR5 K;  2HHS A;  3ZT1 A;  5E41 A;  2UXB K;  5HL7 L;  3QBX A;  1W97 L;  4AHS A;  3VGK A;  2XY7 A;  4IDK A;  5KQD A;  1WSJ A;  2QK9 A;  3THW B;  3ISN C;  3KIO A;  3H1Q A;  1RFQ A;  3OYD A;  1DGK N;  1RDD A;  3C6T A;  3OYA A;  4JKF A;  4BE2 A;  3ALY A;  1KRP A;  4B9V A;  3ZSY A;  4AHT A;  3T1H K;  1NGI A;  4KHP K;  3DOK A;  4CHZ A;  2EWS A;  1KCF A;  1ATN A;  4I9L A;  3U8X A;  2WOM A;  5EX5 A;  4Q5V A;  4B9M A;  4NXM K;  2JGU A;  4EHU A;  3MED A;  4H0O A;  4W5R A;  1JLB A;  2FBT A;  2OAN A;  3AA2 A;  3D2E A;  3SYZ A;  3AA4 A;  3W0L A;  3F9M A;  1EWR A;  3WXM B;  4HWI A;  3HK2 A;  4B3O A;  4CJW A;  4DV3 K;  4RW9 A;  4FWN A;  3L8B A;  4IDH A;  4JNE A;  1SL1 A;  4E7I A;  3CM5 A;  5AFU H;  3AVC A;  1HNZ K;  2FSK A;  2Q97 A;  3ZSO A;  1I3A A;  3V6D A;  4F9O A;  3IKM A;  4UQG A;  3AVK A;  4FXD A;  4FWO A;  4PA1 A;  1BGX T;  4M7X A;  1FKP A;  1BO5 O;  3HT3 A;  4YDU C;  3ATV A;  4DV5 K;  3CJC A;  4BC2 A;  4M45 A;  3G4S N;  4KHN A;  5DK5 A;  4BRH A;  3FGU A;  1LAV A;  4FK2 A;  1Z05 A;  4KRF A;  2ZWH A;  3VQB A;  4M42 A;  3M6G A;  3RMD A;  1ASV A;  4CEA A;  4KB0 A;  2O4I A;  2P9U B;  4H5T A;  4Y1D A;  3V4I A;  4H0Y B;  4ELT A;  2VQE K;  4AQY K;  4B9T A;  3BUZ B;  1NM1 A;  1VRU A;  2HHH K;  1VQ4 N;  2Z1G A;  3C6H A;  4K41 A;  3G0Z A;  2HHV A;  4HCB A;  1TKT A;  4H0T B;  1RBS A;  5HRS A;  4B9Q A;  4PKG A;  4W5T A;  3ULD A;  2WFB A;  4CJP A;  3I33 A;  2W41 A;  5EXW A;  1C6V A;  4JKD A;  4KHW A;  4FJM A;  4F3T A;  4NB4 A;  1KAX A;  5BRD A;  3QFU A;  3HSC A;  5AZJ B;  2P9K B;  4C8O A;  2WUS A;  1VQ9 N;  4C8L A;  1KXP A;  2FSJ A;  1JKH A;  4RW4 A;  5JLH A;  3DXM A;  1Z6R A;  4DFP A;  2YKN A;  1CZA N;  3ZEU A;  3O4W A;  1KAY A;  1E3M A;  1BU6 O;  5CY4 A;  1SUQ A;  1VAZ A;  5AQW A;  2IC3 A;  3LDO A;  3VEX A;  3BZK A;  2UUC K;  4CBW A;  3C7N B;  3HOT A;  3O5B A;  1KSP A;  1S9E A;  4CJR A;  3C0B A;  3MEG A;  2ZJQ L;  4CGF A;  4WFA L;  3VA3 A;  3KLE A;  1SL0 A;  4X64 K;  2P1J A;  3NGI A;  1ITG A;  3VEV A;  5SZT A;  5HRP A;  1J5O A;  4KHY A;  3NGZ A;  1GLB G;  2FBV A;  4DR1 K;  4CJ3 A;  3FZH A;  4GKJ K;  3A5L C;  5GAD P;  1S22 A;  3CC2 N;  1NJI O;  2JWL A;  5ADX H;  1HX1 A;  3V1O A;  2NRT A;  1BUP A;  4BDP A;  4JKA A;  5DM7 L;  3O3H A;  1RT6 A;  3E9P A;  5MLC Q;  3THW A;  5J2N A;  3SQ0 A;  3WEE B;  4A2B A;  3OY9 A;  1GLA G;  2ASO A;  1T03 A;  1WAJ A;  3AO2 A;  3O1W A;  4J8F A;  4BRP A;  3SUP A;  1U4B A;  4FWK A;  3VET A;  1IBM K;  4JN4 A;  4CJ5 A;  1LCU A;  2NRV A;  4HUG A;  3OYI A;  2YHB A;  1LAW A;  2NRZ A;  3D2F B;  1B9F A;  3DLR A;  1YJW N;  1VSK A;  1DKG D;  1TK0 A;  4F3O A;  2E5L K;  3HPH A;  1RT4 A;  2XY6 A;  3QNO A;  3BDP A;  3O9S A;  1NMN A;  4TSX A;  3ZT4 A;  4NLC A;  1BQM A;  1VSD A;  3UE5 A;  2HVH A;  3L3V A;  4HVJ A;  4DSL A;  4Z94 A;  1K6Y A;  4FJX A;  3FFI A;  4IXC A;  4BRL A;  1JLF A;  2YHY A;  3KLF A;  1QSS A;  3VQ6 A;  4QAG A;  4LF7 K;  1TYQ B;  4AH9 A;  1QVG M;  4C8M A;  4IOA L;  4E1M A;  3L4Q A;  2GBZ A;  3D6R A;  3QDK A;  4WE1 A;  4K43 A;  4CFD A;  4NCB A;  4FVM A;  2QXF A;  1WSE A;  1F21 A;  3VEZ A;  1HPZ A;  1RBU A;  4CW7 B;  1O13 A;  4JKE A;  3MMV A;  4FM2 A;  3SV3 A;  5BPN A;  3RWU A;  5C2F A;  4AM7 A;  3WNH A;  4A61 A;  2G8W A;  5M1F A;  3NBP A;  2ASM A;  1WBB A;  4CD1 A;  2VGN A;  1G15 A;  1Y64 A;  3D45 A;  2QM1 A;  4A59 A;  4KTW A;  3TAE A;  3A8Y A;  3OYB A;  4JRP A;  1L3S A;  2ZF5 O;  3AVL A;  3TAG A;  5BRE A;  1BQN A;  3IFR A;  3QEP A;  5LJW A;  1A5W A;  4MLH A;  2HMP A;  4GW6 A;  2FBY A;  2G8U A;  1TUY A;  1P90 A;  3H6E A;  5JLF A;  4H03 B;  1WOQ A;  2UXD K;  4AM6 A;  1NJX A;  2EX3 A;  2IDO A;  3IDH A;  3CCL N;  5T7B A;  4DV6 K;  5HRO A;  1D5A A;  2E4L A;  1U49 A;  4FOE A;  3MXM A;  1YAG A;  3WXI A;  4DFJ A;  4CF0 A;  1TKX A;  3LDS A;  2VCP A;  3MCP A;  4OX9 K;  1RBV A;  5IT9 O;  5AZJ A;  4AHR A;  2P9K A;  3SLC A;  3KD1 E;  4B9S A;  2NRH A;  4J2B A;  4CJV A;  2KKZ A;  3EYZ A;  4CJF A;  1D4X A;  3OYC A;  4DTM A;  1KFS A;  3CCJ N;  4FWP A;  2KQ2 A;  3C94 A;  4BDY A;  4M3Z A;  1ZBF A;  2W6L A;  3WXK A;  2X6N A;  1NU0 A;  3QO9 A;  4CHN A;  1NJY A;  2ZJP L;  3G6E N;  1VSF A;  1LW2 A;  1EX4 A;  1MU2 A;  4PL8 A;  3C7N A;  3IUC A;  3J80 O;  4BC3 A;  3J81 O;  2P9P B;  4KHS A; 
#chains in the Genus database with same CATH homology
 2D4W A;  3CPE A;  2QWL A;  5C0Y A;  3M5R A;  5M1O A;  1K8A O;  1HLU A;  1NGA A;  4B1Z A;  1JCE A;  3CHW A;  3SAH A;  4IO8 A;  3IMX A;  3CCU N;  3D7E O;  4O5F A;  3VEY A;  3FLC O;  5GIP A;  4WFN L;  3H3N O;  4H5N A;  4CZE A;  1OVY A;  3KK7 A;  3G25 A;  3KHY A;  4C1N I;  3CJ1 A;  1YF5 L;  2JWK A;  3J8A A;  3CER A;  3O9T A;  2HBM A;  3O6W A;  3NVK A;  5FPM A;  1V4T A;  3UKR B;  4WFB L;  2HBK A;  2A5X A;  1NLV A;  1T6C A;  3AY9 A;  3CCV N;  3SMS A;  3VF4 A;  2E2O A;  3EKU A;  3BF1 A;  3WXL A;  3HOS A;  4B1X B;  2HF3 A;  4FWL A;  5JVG L;  3HI0 A;  3HTV A;  3EN9 A;  3FFK B;  5C12 A;  1MWM A;  1OKJ A;  2YHX A;  3VGM A;  2E2P A;  5C10 A;  3CPW M;  4K42 A;  4PKH A;  5AQT A;  4XH5 A;  5M1Q A;  3PLA A;  1QQO A;  2J4R A;  5GIO A;  5F2R A;  2QWP A;  2BUP A;  4BRG A;  4JAX A;  2V7Y A;  3SAF A;  4BR9 A;  4LC9 B;  1BA1 A;  3U4L A;  5GIN A;  5AQZ A;  1VQ6 N;  2P9L A;  1BG3 A;  2ZGY A;  5M1N A;  3GG4 A;  3WQU A;  3ZX3 A;  4C23 A;  3F2K A;  2D0O A;  2WBN A;  4A62 A;  1S3X A;  2CGK A;  2F7T A;  2NRR A;  3GBT A;  3HBT A;  1QQN A;  1P8Z A;  4JKC A;  4XEI A;  4H5V A;  4KH4 A;  5E26 A;  4CZM A;  4BY9 C;  3CCR N;  1BWF O;  3BEX A;  3QML A;  5AQG A;  4YOW A;  3H1V X;  1Q18 A;  3MN9 A;  1KD1 O;  4PL7 A;  3LDL A;  1BDG A;  3VF2 A;  1NGG A;  3O80 A;  2NRX A;  1YI2 N;  2NNW A;  4GV6 A;  4I6M A;  4IJA A;  1IG8 A;  5AQQ A;  1NGH A;  5AQU A;  3UB5 A;  4A5A A;  3VOV A;  5AQK A;  2QA4 N;  2FSN A;  1T3V A;  1ATR A;  1ILY A;  3K9J A;  3OBY A;  1HKC A;  3EO3 A;  2OTL N;  4BRQ A;  4U67 L;  4JEP A;  4JD2 A;  4QS7 A;  1RGI A;  3VEN A;  3NVM A;  2VYP A;  4EIA A;  1VQ8 N;  3A0I X;  3BF3 A;  2P9U A;  1N8R O;  3OW2 M;  3TPQ A;  5EY4 A;  1GLD G;  4ILG B;  4CZG A;  4WQ5 A;  1YIJ N;  3VMF B;  4FWR A;  2BH1 A;  1GLE G;  3F5T A;  4L3Q A;  4PHT X;  4IEE A;  5JMV A;  4MDB A;  2QWO A;  3QB0 A;  3TTD A;  4EHT A;  3EE9 A;  1ZXO A;  3E9L A;  5GAH P;  3U9D A;  5JVH L;  1G99 A;  4Y0W A;  4BR0 A;  3AAR A;  3R3L A;  4BVP A;  4KH6 A;  1YUW A;  3N4P A;  3RSE B;  5C2D A;  2P9N B;  2D0P A;  1XC3 A;  2P9I B;  4XH1 A;  3ZET A;  4CI6 A;  2AA4 A;  3KVG A;  5BPL A;  3HM8 A;  3LM9 A;  1EQY A;  2RE2 A;  5HL7 L;  3QBX A;  1W97 L;  3A5N C;  3EE8 A;  5AQJ A;  5AZI B;  3VGK A;  4FWQ A;  5KQD A;  4BRD A;  3EZW A;  2IVN A;  3AGK A;  1M90 O;  1W2B M;  3CMA N;  3S41 A;  1U2V A;  4WQ4 A;  3H1Q A;  2QEX N;  1RFQ A;  1XUP O;  3EL2 A;  2KHO A;  1DGK N;  2IIR A;  4GY2 B;  4JKF A;  2GUP A;  3E66 A;  2F9W A;  2PAV A;  2Q0U A;  3RVC A;  1ATS A;  3O9R A;  1NGI A;  2I7P A;  2YI1 A;  5FPD A;  3JS6 A;  4H0V B;  3AAP A;  2EWS A;  1ATN A;  1MWK A;  3U8X A;  5AQR A;  3P31 A;  1KAZ A;  3ZYY X;  5EX5 A;  1NGC A;  2FXU A;  4XH4 A;  5M1P A;  3ENO A;  3CET A;  4BRK A;  4EHU A;  4H0O A;  4DKW A;  4GV9 A;  3L4I A;  4AF1 A;  2OAN A;  3R8E A;  3D2E A;  3VES A;  3NMU A;  1NMD A;  4B1W B;  1IJJ A;  4BQL A;  1WUA A;  3R6M A;  4RTF D;  5AR0 A;  3FZM A;  3W0L A;  4JHD A;  3F9M A;  4OPH A;  3MDQ A;  3WXM B;  1Q7Y O;  4FVU A;  4HWI A;  3VER A;  4G9Z A;  2GEM A;  2YCH A;  3DXK B;  2FLO A;  3JXU A;  4FWN A;  5AFU A;  2QWN A;  1NBW A;  2Q36 A;  2E2Q A;  1DT9 A;  4IDH A;  4JNE A;  3ZX2 A;  4B1Y B;  3VF6 A;  4CZF A;  1VQP N;  3TTF A;  4CZI A;  5H1S Q;  5AFU H;  3W3D A;  1J6Z A;  2KLA A;  3J7Z O;  3I56 N;  3UKU A;  2P9L B;  3ULE B;  1KC8 O;  1NGD A;  2FSK A;  5TKY A;  2Q97 A;  3CC4 N;  4DCH A;  3CME N;  4PKI A;  3IKM A;  4ILH A;  4F9O A;  4YOT A;  1YJN N;  2A41 A;  2HOE A;  3T69 A;  3TTC A;  3O1B A;  3WEE A;  5FPE A;  5AQM A;  2A6A A;  2ITM A;  3VTI A;  3AAQ A;  2HBL A;  4H5R A;  4FWO A;  3MWT A;  4BR4 A;  3ID8 A;  2IVP A;  4M7X A;  2FF6 A;  3HRG A;  5LY3 A;  4IO9 L;  1BO5 O;  3AGR A;  4WQ5 C;  4JK8 A;  5JIC A;  1QZ5 A;  4YDU C;  3ATV A;  1JCF A;  5BN8 A;  3E9O A;  4BRE A;  3PIP L;  3CJC A;  4MLE A;  4BC2 A;  3G4S N;  1Q86 O;  2E1Y A;  3WQT A;  5ELZ A;  1GLF O;  4BRH A;  1NGF A;  3FGU A;  4CJ7 A;  1NGE A;  1Z05 A;  4H0X B;  3TSP A;  3G71 N;  2ZWH A;  2GEL A;  3B8A X;  2YX6 A;  2E8A A;  1ZC6 A;  2NLX A;  3FZL A;  3M6G A;  2P9U B;  3D2F A;  4H5T A;  3P39 A;  2P9S B;  4MDA A;  4OO1 J;  3VPZ A;  3ID6 A;  2CH6 A;  4H0Y B;  1JCG A;  1V4S A;  3GDQ A;  2GWJ A;  3BUZ B;  1NM1 A;  3LL3 A;  4WCE L;  4U7B A;  1VQ4 N;  4CZK A;  1MDU B;  3LDP A;  4JK7 A;  3C6H A;  4JKG B;  2PFU A;  3CQY A;  1LOT B;  4K41 A;  2FF3 B;  2Q31 A;  2Q2R A;  3OBW A;  1RDU A;  4BVO A;  4H0T B;  3CF5 L;  3LM2 A;  1NWK A;  1TYQ A;  3EKS A;  4B9Q A;  4PKG A;  2HF4 A;  5AQO A;  1DEJ A;  2WFB A;  2GX9 A;  3I33 A;  2W41 A;  5EXW A;  3DAW A;  2W40 A;  4BRC A;  1K9M O;  2OTJ N;  1HKG A;  4JKD A;  4R79 A;  5BRH A;  3O9Q A;  4H0P A;  4NB4 A;  3MN6 A;  1KAX A;  5BRD A;  4YOR A;  1YIT N;  3QFU A;  3GOI A;  4QS8 A;  3HSC A;  3K9K A;  1GLL O;  2P9K B;  5AZJ B;  2WUS A;  4BRM A;  2V52 B;  3MX2 A;  5KPT A;  4JKB A;  1VQ9 N;  1KXP A;  1QQM A;  2FSJ A;  2NRW A;  3ENH A;  4FL9 A;  3DXM A;  3A5O C;  2F9T A;  2QW9 A;  5FPN A;  4E1J A;  5BR9 A;  3O9U A;  1Z6R A;  1ESV A;  1X3M A;  3FR0 A;  3R9P A;  3T7Z A;  1CZA N;  2V51 B;  3O08 A;  3ZEU A;  3VEO A;  4A5B A;  1E4F T;  3O4W A;  3P4I A;  3H45 C;  1NGB A;  3GL1 A;  3CD6 N;  1GLC G;  2E1Z A;  3M3Z A;  4MO4 A;  1K8K A;  1KAY A;  3CJ9 A;  3DWL A;  1VQM N;  1BU6 O;  1VAZ A;  5AQW A;  3VEX A;  3LDO A;  3CJA A;  4ISG A;  5AQX A;  4CBW A;  3C7N B;  3PIO L;  3HOT A;  3O5B A;  4BG8 A;  4ISE A;  2HST A;  4ISF A;  3C0B A;  2PBD A;  3A5M C;  2ZJQ L;  1BA0 A;  3CXC M;  4KH5 A;  1RDW X;  4JKH A;  4WFA L;  2YHW A;  3SBT A;  1ZBS A;  3GE1 A;  3QFP A;  4JK9 A;  1X9J A;  3VEV A;  1T44 A;  3E1Y A;  4EAH D;  2E88 A;  1GLB G;  3CJB A;  4DQ8 A;  5M1K A;  4JHD B;  3ATU A;  4IWV A;  2QXL A;  4DB3 A;  3FZH A;  3MN5 A;  3VEW A;  5ADX A;  2CGL A;  5AQS A;  1BOT O;  3L0Q A;  2A3Z A;  3A5L C;  3N4Q A;  4IZ9 A;  5GAD P;  1S22 A;  3CCM N;  3CC2 N;  1S72 N;  1NJI O;  3TSQ A;  1YXQ A;  2JWL A;  4FWS A;  5ADX H;  4CBX A;  1HX1 A;  3UKU B;  2QWQ A;  2NRT A;  4RWT A;  3SJH A;  1BUP A;  1E4G T;  1VQO N;  4JKA A;  5DM7 L;  5KPZ A;  3E9P A;  3H46 O;  3U9Z A;  4CBU A;  2CGJ A;  5MLC Q;  3WEE B;  4FPA A;  5CHI A;  4A2B A;  3WXJ A;  5F1X A;  4CZL A;  1GLA G;  4YOY A;  2YJF A;  3H3O B;  2QI2 A;  1X3N A;  2ASO A;  2V7Z A;  5AQH A;  4EFH A;  4O8U A;  1HKB A;  3O1W A;  2GWK A;  4J8F A;  1Q82 O;  4BRP A;  2QTD A;  4CZH A;  3LDN A;  2Q1N A;  2HBJ A;  4FWK A;  3VTH A;  3VET A;  3SAG A;  4JN4 A;  4FWM A;  5JLH A;  4YOX A;  4BR7 A;  3TSU A;  4CD3 A;  1T6D A;  1LCU A;  2NRV A;  2P9P A;  1SQK A;  3ENB A;  3KWG A;  5TKW A;  2A42 A;  3CCS N;  2NRZ A;  3D2F B;  1YJW N;  2AP1 A;  1DKG D;  1VQ7 N;  3ZX0 A;  5I9E B;  3Q7C A;  1SS6 A;  3VGL A;  4I6M B;  3QIC A;  5CR4 A;  3KWI A;  3O9S A;  2BTF A;  4BRA A;  3DXK A;  4BG9 A;  4NLC A;  3UE5 A;  2H3G X;  2E20 A;  4Z94 A;  1R59 O;  3WT0 A;  4FOI A;  4JD2 B;  3UKR A;  4IXC A;  4BRL A;  1NGJ A;  2YHY A;  2E2N A;  1HJO A;  5AQL A;  5AQP A;  1U6Z A;  1TYQ B;  5BRF A;  3CI5 A;  3Q7B A;  1QVG M;  3ULE A;  1SAZ A;  4IOA L;  3SBG A;  3KZB A;  4IFE A;  3CJ7 A;  3L4Q A;  3L6Q A;  3D6R A;  3QDK A;  5AQF A;  4K43 A;  4BRO A;  3BP8 A;  4B1U B;  2CH5 A;  3MN7 A;  4BQZ A;  3HZ6 A;  2DPN A;  3DLL L;  4ILJ A;  4WQ4 C;  3M1F A;  5EOY A;  3VEZ A;  4BGA A;  2I7N A;  1O13 A;  3OA9 A;  4FPB A;  3MMV A;  4JKE A;  4BR2 A;  4BGB A;  5BPN A;  3DXM B;  5C2F A;  4AM7 A;  3C6A A;  2Q0R A;  4O8K A;  3R1X A;  3ZET B;  4A61 A;  1Q81 O;  1YJ9 N;  2GTD A;  1C0G A;  5BPM A;  5M1F A;  2ASM A;  5EVZ A;  3ZEU B;  4B1V A;  4CD1 A;  2VGN A;  5LJV A;  3O8M A;  4FSV A;  4CZJ A;  2VGM A;  1Y64 A;  2QM1 A;  3MK6 A;  1K8K B;  4A59 A;  2QWR A;  2IVO A;  4KBO A;  4GNI A;  3MWP A;  3A8Y A;  4YOU A;  3C65 A;  3FZK A;  1U2V B;  5HOO A;  2ZF5 O;  1TUU A;  4WYB A;  4M63 C;  4IOX A;  4BRF A;  2A40 A;  5BRE A;  5AQV A;  5AQY A;  2P9S A;  1HPM A;  4WF9 L;  1VQ5 N;  3IFR A;  4BC5 A;  3FZF A;  3MCA B;  5LJW A;  4MLH A;  1HUX A;  3MX5 A;  4YDU A;  4A2A A;  3I55 N;  2HMP A;  4BRN A;  4A57 A;  2RHK A;  4M7Y A;  2NZT A;  4DHY A;  5AQI A;  1TUY A;  1P90 A;  3H6E A;  4JKG A;  1YHQ N;  5JLF A;  4H03 B;  3DJC A;  1WOQ A;  4HTL A;  3WUH A;  4AM6 A;  1M1K O;  3I8B A;  3SK3 A;  4IJN A;  1QZ6 A;  4BRI A;  3IDH A;  3CCL N;  1YVN A;  4FOE A;  5AQN A;  1H1V A;  1YAG A;  4QS9 A;  3WXI A;  3CC7 N;  5BN9 A;  5KQ8 A;  5GAG P;  1VQK N;  3CCQ N;  2VCP A;  3D2E B;  4K25 A;  4NO7 A;  5E84 A;  1JJ2 M;  3CCE N;  3QBW A;  3MCP A;  3CIP A;  5KPR A;  2YJE A;  4MO5 A;  4IEI A;  2QWM A;  5F0X A;  3CQX A;  1SZ2 A;  2ZGZ A;  5AZJ A;  4IOC L;  2P9K A;  3SLC A;  1EO1 A;  4OPA A;  2NRH A;  1C0F A;  2D1K A;  3TU5 A;  1VQN N;  1KQS M;  4C1N K;  2ZJR L;  2WC9 A;  1K73 O;  2KKZ A;  1QVF M;  5DM6 L;  3FE1 A;  1D4X A;  1XQS C;  3RSE A;  2P9N A;  2UYT A;  2P9I A;  4RCH A;  1QHA A;  5B8H A;  3P38 A;  5C15 A;  5CE3 A;  4YOV A;  4UY8 O;  3CCJ N;  2VWB A;  4FWP A;  3LDQ A;  4H5W A;  1GLJ O;  4NLB A;  5AZI A;  3WXK A;  1MA9 B;  4FO0 A;  4BR5 A;  4BC4 A;  1VQL N;  2ZJP L;  2ASP A;  3G6E N;  4PL8 A;  3SMP A;  4GV3 A;  4GVE A;  3C7N A;  3IUC A;  4BC3 A;  2P9P B;  5GAE P;  3OHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...