2B6AA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with thr-50
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Crystal structure of HIV-1 reverse transcriptase (RT) in complex with THR-50
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 136
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b6aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b6aA05
5EWEA 4Q0BA 1JLFB 3RR7A 4JV1A 2RDJA 2BQ3A 4R8UA 1S97A 2D5RA 4Z0UA 5D3GB 1S1WA 2RKIB 4B9TA 1ZTWA 2VG7A 4ED7A 2IMWP 1R0AB 1VRUA 4RW6A 3CQ8A 5KG0A 3DRSA 4OGCA 4KB1A 4ZP6A 2IDOA 4QW9A 3KOAA 2I5JA 3WNHA 3OYEA 2JEGA 2KZMA 3CWJA 2YNFA 3RR8A 4NZ0A 2F96A 5J2NB 5DQGA 3U3GA 4YR3A 4FS2A 3AO3A 4J2BA 4NCAA 4CCHA 3V1OA 3VQDA 4DSIA 4EYIB 5KFLA 1RT4A 1JL2A 4CGGA 4CFAA 3RMCA 3GV5B 4NRTA 4DLGA 3FFIB 4N5SA 3HPOA 1C1CA 3HHKA 3LP2A 4FZZA 1N56A 4PWDB 1JLQA 4RG8A 3KD5E 2P51A 4B8CA 3SV3A 4C8OA 1BISA 4KHSA 1RTIB 4TLRA 4J9RA 4FJ7A 4FXDA 1ZTTA 2KZZA 2DPJA 4NYNA 3CJ4A 3QEPA 1G15A 4GW6A 4IH5A 3KKRA 4H8KA 2W9AA 1U47A 1L3SA 2E6LA 4F4KA 4OVLA 4JS5A 4DF4A 3QIPA 4BE0A 1VSJA 4OL8A 1J5OA 4G3IA 5J2PA 4PQUA 2HHXA 2OYQA 3I5BA 1TV6B 5HP1A 4GMJB 5FDLB 5EWFA 2JC1A 4ECZA 5KFFA 3SFUA 4B9MA 2AGOA 4CERA 2BANA 3LP3A 1S6QA 3KLIA 2YNGB 4TN2A 3K59A 1BIZA 1RBTA 2UVUA 5KTQA 3EYZA 3C6TA 4CECA 1QSSA 3QZ7A 5HROA 3DI6A 3H5UA 1IKXA 3M8QA 4EZ9A 2VWJA 1LV5A 1D8YA 3TAMA 5KT7A 3PZPA 3GV7B 5EDWA 2E9TA 5C25B 5KFCA 3OY9A 2PZSA 3OS0A 1CSJA 3GILA 2OPPB 2HNZA 3LZIA 4MFBB 4DL4A 4CEEA 4Y2AA 1RDBA 3B6PA 3O4QA 4O4GB 5J1EA 3OS2A 4E7HA 5KFHA 4KFBB 5CYQB 5L9XA 2E4LA 3MFIA 1RT7B 4DQRA 3QGGA 3DRRB 4F4WA 1RBSA 4ZVEA 3QETA 4AHRA 3HSTB 1TL1A 3M8SA 2WTFA 5F8JA 3BDPA 4KI6A 2D0AA 4DEZA 3GIJA 2DTUA 2IM2A 2XGPA 4CEBA 4PUOB 2ZKUA 3SV4A 5C24B 4NLPA 5EUHA 1IG9A 1Q9YA 3PO5A 1WSIA 3JSMA 2VA3A 3C94A 2HHUA 4ZMMA 5L1LA 5KG5A 4BDYA 3QEWA 3DLGB 3BSAA 4I7FA 1JLGB 3K58A 4NCGA 3SPZA 1T03A 1YTAA 1S1TA 4CK1A 4DU4A 2DFEA 2J6SA 3V6DA 3V81A 3CJ3A 2BRLA 2WHOA 3F9KA 3T3FA 3M8RA 4FK4A 4NLWA 1N6QA 4ECQA 2ETJA 3SCXA 1LAWA 3OYGA 3L8BA 5K14B 4CFBA 5KG2A 3VQ7A 2B6AB 3V4IA 1SL0A 4E3SA 3ZT1A 4ECYA 2R2SA 4CJPA 3EZ5A 3MR2A 3RMBA 3CFRA 3TWHA 1TKDA 1LWEA 4YMEA 3PR4A 1MU2B 3DM2A 1TAQA 1SV5B 5F9NA 2D7SA 1S0NA 4BACA 1X9MA 3BQ1A 1JKHB 2YKNB 3G6VA 4CGHA 2J6UA 3HXMA 3PW0A 3MEDB 3IS9B 4IR1A 4IH6A 4CEOA 3ISNC 5L1KA 5DLFA 1L3TA 3QNNA 3HP9A 4B9SA 4E1NA 5KG7A 4Q43A 1S9GB 4XPCA 2IS3A 2KFNA 5KG3A 3OJUA 5KFIA 2OPRA 4CGIA 2ATLA 3EZUA 3LP0B 4BWMA 2BDPA 4LSLA 1ITGA 4KTZA 3PV8A 3LAMA 4Q0BB 4R8UB 1SL1A 1IM4A 4K50A 4CESA 3PX6A 1S1WB 1VSFA 2FVCA 3RTVA 5HBMB 2VG7B 2HWHA 2E9RX 4DTSA 4HHTA 3OS1A 3DRSB 5DLGA 4Q8EA 1XWLA 2I5JB 3OHAA 3BGRA 2YNFB 3CM6A 3OLAA 5KFAA 4OLBA 4FJ8A 3L2WA 4E7KA 3NH2A 3K5MA 2J6TA 4Z4CA 3V9UA 4QWCA 1TL3A 4CEAA 3S9HA 1NK6A 3NF6A 4O3RA 4TXSA 4ED2A 4TSXA 1XR5A 3LP2B 4F8RA 1JLQB 4J2AA 5DQIA 1S1UA 4U6PA 2HNDA 2ZD1A 2AU0A 1WNEA 3SJJA 5KT3A 2F8SA 3ZT4A 1REVB 3KK3A 5FROA 3D45A 1JX4A 4DTNA 3D0PA 2XO7A 4H4MA 1LW0A 5KT4A 1S1XA 2VG6A 1NK0A 1HYSA 2W8LA 4CJVA 3MXIA 4QWEA 1KFSA 4PY5A 3MAQA 2R8JA 4FJNA 1KFDA 2BRKA 2G8HA 1HYZA 3CJ0A 2IM0A 1UA1A 2X78A 3LP1B 3KHHA 1BGXT 1J5OB 3IG1A 5J2PB 1SL2A 4E7JA 2FBYA 3ZT0A 4PQUB 2W9CB 1WLJA 4J9NA 1RBUA 4JRQA 5HP1B 5KFPA 1C0UA 4FBUA 4RW7A 3U3YA 1RDCA 3O3FA 4NLGA 2BANB 1IKYA 1S6QB 4LQ9A 5KFSA 1RILA 3KLIB 1ASVA 4CGDA 3G6XA 3VA0A 4I2QB 4MK7A 4H54A 3C6TB 3RB0A 2UVWA 3KLGA 4B9VA 3TARA 3EY1A 1HARA 4EBDA 2ILYA 1SH3A 4O3SA 4ED0A 5HROB 3L2QA 3T5LA 4DL5A 1C1BA 1YVUA 3AV9A 1TK0A 1IKXB 4HKQA 2JEIA 3TAMB 5F8NA 4BE1A 2FVPA 3DMJA 4DFPA 3DYAA 3H4DA 5KG1A 2X6NA 3HVWA 4GC6A 3U6FA 1DTQA 3OYLA 3QZ8A 3BQ0A 2HNZB 1NHUA 2C28A 2FVRA 2FJXA 2O4GA 3CM5A 1FKOA 3IAYA 1IKVA 4BDZA 4M95A 5J1EB 1ZBHA 3L3UA 1BQMB 3PX0A 1RT6A 3GIIA 4Q5VA 3BREA 4FS1A 1T8EA 4XO0A 5KRTA 3G6YA 5HRRA 1XI1A 4YR0A 3ZSXA 1T05A 3ZSWA 2A1RA 2D0CA 4YQWA 1TL1B 3RWUA 1RT1A 5KFOA 3AVCA 1I3AA 3MXJA 3IGNA 2D41A 1DLOA 3SUPA 3HJFA 5J2MA 4ECSA 4TY9A 2HAIA 3AVMA 1IKWA 1VSHA 3JSMB 3AA2A 4BDPA 3JYTA 4IKAA 3SUOA 3M9NB 4JRPA 5DK5A 1RAJA 2IM1A 4IFVA 4EBCA 2GUIA 2QK9A 3Q8PB 4FYDA 4ZVHA 3G0ZA 2HMIA 4W5TA 5L1JA 4NLQA 4NCGB 3PVXA 4X2BA 5KFMA 2DFHA 1T03B 1BQNA 3O4NA 3I8DA 1S1TB 4DMNA 4ZVFA 3ALYA 3V6DB 1B9FA 3V81B 3SQ2A 3TVKA 1U09A 1JXLA 3VQEA 3BQ2A 3A2FA 4F4XA 4CJ3A 2ALZA 1TVRA 3TAFA 4F3TA 3DLEA 4J9LA 4RW4A 3AO2A 3V4IB 2Z1HA 4O0JA 4QCLA 1TGOA 4EEYA 1NK5A 4DTOA 4TY8A 3DOKA 3V1QA 3ICLA 1SUQB 4ZPAA 4QPXA 3UPFA 1LWEB 2AX0A 3AVKA 4ECXA 2OZMA 4ZPBA 4Y2CA 2YV0X 1NOZA 2FBVA 4HVJA 3NL0A 4CJQA 1HPZA 3K5OA 4LH5A 3AO1A 3MEGA 3KMQA 3VQBA 2YNIA 3SI8A 4F50A 1RNHA 3V6KA 2XRIA 3O3HA 5KFXA 3LAKA 4FLVA 2FVSA 4J2DA 2OPRB 4QAGA 4IQXA 2XC9A 1S0OA 1TKTA 3AA5X 4LY7A 4LSLB 4DTPA 5KG4A 3OHBA 4RW9B 4LD0A 2XY6A 1J53A 5CY4A 1XC9A 4QW8A 4O3OA 5KFKA 4C8LA 4C8MA 4QOZB 4CEQA 4KO0A 4B08A 3ASMA 1TKZA 4EZ6A 2I1RA 1NK9A 3E01A 1B92A 3PX4A 1HJRA 4M45A 4M3WA 1QAJA 1JXBA 4CJSA 3L2VA 5KGWA 4NLXA 5KFUA 4DQPA 2FJVA 3QIDA 2DFFA 1TL3B 1WSGA 4CK2A 2RN2A 1CXUA 4UQGA 1T3NA 3H4BA 2HWIA 3CG7A 2EC0A 1GOAA 5I42A 1S1UB 4YR2A 2V0NA 3ITHA 2HNDB 4M3ZA 2ZD1B 3AO4A 2XGQA 4RNMA 1L3UA 3KK3B 3BJYA 3V6JA 4WE1A 1JIHA 1RBVA 1NJZA 3K2PA 4CEZA 4TQSA 5T7BA 2D3ZA 4H4MB 1LW0B 1QAIA 4EYHB 1CZ9A 2PYLA 4I9QA 1S48A 5KFRA 5EU7A 4QWBA 3PW4A 2KQ2A 4URQU 2OPQA 2X74A 3SUQA 1QS4A 4NLOA 3DOLB 3L2RA 4ED3A 4K4YA 1J9AA 2B4JA 3IG1B 3H98A 3B6OA 4FLZA 2Z1IA 2IC3A 4RNHA 2CJQA 1C0UB 3AVFA 4RW7B 4KTWA 4DWIA 3QLHA 4FJKA 1RT3A 1LWCA 5HLFA 2R8KA 1VRTA 1YVFA 1IKYB 3NH1A 1N48A 3RMDA 4I9LA 1VSIA 4IKFA 5CZ2A 3GYNA 4K4VA 4BE2A 4RU9A 4YP3A 4OKKA 3AA4A 4KHQA 3IN5A 3KLGB 1W0HA 1NJYA 1WSFA 2DY4A 4WXOA 3V9SA 2C2DA 4CF9A 2QKKA 4H4OA 1C1BB 3GQCA 3S3NA 1T94A 4CJKA 1ZBIA 1KTQA 5JS1A 3DMJB 4HUGA 3TAQA 3DYAB 1RCHA 1DTQB 4M3TA 1S9EA 1A5VA 4CJTA 4F3OA 3D28A 2AQ4A 4Y3CA 1FKOB 1IKVB 3DLRA 1WSJA 1KRPA 3QYYA 3UQSA 3SYZA 4IBNA 4WZMA 4HCBA 5KFJA 1XR7A 3H08A 4O5BA 3TAPA 1S9FA 4KKOA 4RNNA 5CZ1A 4I2PA 5KFTA 3PJWA 3GIMA 3NAHA 1RT1B 3KJVB 3L3VA 4JV0A 4RZRA 3RRHA 4G1QA 4XIUA 4CJFA 1S0MA 2R2TA 4O3NA 4N56A 1DLOB 2HB5A 4JLHA 1RT2A 4M3RA 4CHOA 3LWMA 5J2MB 3L2UA 1U49A 1T7PA 4TYBA 3BSCA 4CE9A 1RTJA 3OL7A 2XHBA 1IKWB 4N76A 1W25A 4IFVB 1KVAA 4M3YA 3BSNA 4CJ4A 1NKEA 3KHGA 3DDKA 1S4FA 2HMIB 1A5XA 2BE2A 4URSA 1C0TA 3I5CA 3OYFA 1KLNA 1BQNB 3IRXA 1HQUA 3GV8B 3WNEA 3H40A 1TKXA 2C2EA 4K4XA 1SKRA 3RMAA 4CGFA 1XR6A 5KFYA 4KB0A 3UR0A 3QGHA 1TVRB 3S3MA 1QSYA 3ZSRA 3OYIA 4CJWA 3DLEB 4RW4B 1N4LA 1X9WA 1I39A 2XY8A 3H5SA 4NLDA 2IJFA 4Z4IA 2IJNA 4F4ZA 4CIEA 3NE6A 3N6NA 4MIAA 3LPUA 1J54A 4ID5A 1DTTB 3MEEA 4E89A 3UDLA 4CFDA 2Z1GA 1BI4B 1RTHA 4K8ZA 3ZT2A 2PY5A 4KSEB 4ZP8A 1RDRA 4DL6A 1HPZB 3PHEA 1WSEA 2KW4A 3VQCA 3MEGB 3ISND 4KPYA 2YNIB 1LAVA 4F2RA 4DU1A 2YKMA 4Z4EA 2G8VA 3FQLA 1C6VA 1UWBA 4M3UA 4CJLA 4NLTA 3OSNA 3RRGA 1D1UA 3OYNA 4DFMA 1TKTB 2F8EX 1VRUB 4RW6B 4HUEA 1LWFA 4LSNA 4NLVA 4N41A 3NF9A 1TP7A 1BL3A 2YHAA 4FJJA 5L1IA 1SH0A 1S5JA 2EX3A 2XI2A 4JUZA 1RT4B 2IBKA 1XHZA 4ICLA 1LW2A 1VSKA 3QEVA 2IA6A 4KO0B 3ZSYA 1C1CB 1TKZB 4OKJA 5KFBA 3E01B 4IH7A 3PR5B 4DTUA 3KTQA 2YNHA 4ID1A 1QSLA 4NLYA 3NGZA 2R8GA 1K1SA 3TAGA 5HRPA 3KKSA 2Z1JA 1EP4A 3QO9A 3CJ2A 1ZBLA 1RT5A 3MTKA 4FCYA 1JLCA 1HQEA 3QIOA 5KG6A 2ASDA 3PUFA 3KMSA 4CF8A 4KREA 3ITHB 3H2LA 3DLKA 5E41A 2F8TA 4URGA 3T5KA 4ED1A 3QIPB 1IH7A 3NHGA 4Z4GA 2P5GA 3LPTA 3T5JA 1EETA 5FDLA 2OPQB 2D0BA 2HNYA 5F8LA 3PW7A 5HRSA 3D5MA 4IRKA 2P5OA 3HK2A 1B9DA 4MH8A 4K4SA 1GOCA 2E6MA 4IG0A 3CO9A 3C6UA 5DG9A 3ZSZA 2HHSA 4HUFA 2XCAA 3MECA 2IC3B 5CYMA 3TI0A 4DG1A 1QE1A 4DQSA 3VQSA 3HT3A 3QLHB 3DI6B 1RT3B 1WNSA 1LWCB 5HLFB 3SQ4A 1VRTB 5JUMA 5I3UA 2R2UA 3M8QB 4ZTFA 3FRZA 2XI3A 1JXEA 4Q45A 4J9SA 5F8IA 4FJHA 1Q8IA 4Z4HA 5C25A 2XCPA 3RBEA 4E0DA 4NLUA 2OPPA 2HVIA 4MFBA 3TR8A 5C42A 1WAJA 4H4OB 3ZT3A 4O4GA 2GIQA 2Y1IA 2V9WA 2WCXA 4YFUA 4KFBA 3VQ4A 2JEFA 1RT7A 3EPIA 4DSEA 4E7IA 2VA2A 4B3OA 3HVRA 2FJWA 4W5QA 3OYMA 1NK7A 4Z4FA 2JGUA 4FJLA 1YTUA 3GIKA 4CHZA 4DS4A 4DQIA 4QWDA 3C95A 1D0EA 4PUOA 4XPEA 4KKOB 4M94A 4I2PB 3HYFA 4G1QB 4EP4A 4K8XA 3NGDA 2UUWA 1RT2B 4K4WA 4I7FB 4KHNA 2AWZA 1CLQA 4DL3A 3DRPA 5JXSA 3NCIA 2V4QA 2W9BA 3OLBA 2FVQA 1ZETA 1RTJB 5KFEA 1IO2A 3SUNA 4DTRA 1N6QB 3SZ2A 4DQQA 2FC0A 4O0IA 2BGGA 1X9SA 1RYRA 1VSEA 4IRDA 2ZQBA 3VQ5A 4RW8A 3G10A 4HYKA 1KVBA 1C0TB 5KRSA 3IRXB 3LANA 1HQUB 1UAXA 2OZSA 4TYAA 4DFJA 2G8UA 4O4RA 3DM2B 3TANA 3V6HA 3MF5A 1NK4A 4KBIA 4KB7A 1CZBA 2R2RA 2WOMA 4FM1A 3CDEA 3QEXA 2GC8A 5DG7A 2R8IA 4DSJA 4K4ZA 3RAQA 1NNDA 1X1PA 4ID5B 3P5JA 2R7YA 2O5DA 4HTUA 4U7CA 4FM0A 2JC0A 2QV6A 2HHTA 4BWJA 2KFZA 1RTHB 5KI6A 3RB4A 3VQAA 4WXWA 3OJSA 1OS5A 1NHVA 3KIOA 3ULDA 3P1GA 4O3QA 1A5WA 1JLEA 4NLRA 3AVAA 4ECUA 4K4TA 4MQ3A 3KLVA 4JS4A 2YKMB 3I0SA 1HNIA 3HKWA 4OJRA 1UWBB 4FBTA 2BQRA 1S1VA 3WNFA 5HBMA 3KLEA 1C0MA 3VQQA 4AHTA 3N6LA 1LWFB 4LSNB 1U4BA 3VQ8A 1JLBA 4Q44A 3BGRB 2VG5A 4CHNA 3OYCA 1VSDA 3KK1A 2VWKA 3KK2A 4CJUA 4DFKA 1Z4UA 4Q8FA 3IGVA 4FLUA 5FRMA 3TABA 4WZQA 4ICLB 1LW2B 3VA3A 4B9LA 1FKPA 4IDKA 2CKWA 2G8FA 3AVHA 1UOCA 5KFVA 3NF7A 4F2SA 4FJ5A 3FDSA 5DMRA 1RDAA 3VQPA 3DLHA 3AVJA 4KE5A 4CEFA 2YNHB 3SNNA 3ZCMA 3F73A 1S49A 1NOYA 3N6MA 3OL6A 1REVA 4WFXA 2OPSA 5SZTA 3PJXA 4E1MA 5FRNA 5KFQA 5F9LA 1EP4B 3QO9B 3AVGA 5KGXA 1RT5B 1FK9A 1JLCB 1S1XB 2VG6B 4IG3A 1HQEB 1HYSB 2DPIA 2B5JA 1BHLA 2B43A 5KFNA 1HMVA 3DLKB 4M41A 3I5AA 3NFAA 1S6PA 3LP1A 2XY5A 2LSNA 2IAJA 3ZSOA 1FXXA 1K1QA 2W9CA 1N5YA 2X6SA 1KLMA 1TAUA 1EETB 3RB3A 2RF2A 2HNYB 4RNOA 2HVHA 4AHVA 2G8IA 1RTDA 4IFYA 4WYWA 1XHXA 1D9FA 2FLNA 5J2QA 5KFDA 5DQHA 4IG0B 4I2QA 3C6UB 1QQCA 2HW3A 4OKEA 3MECB 3KLFA 5CYMB 4DG1B 2WONA 1QE1B 2XWYA 4MK9A 2ITGA 4DTXA 5I3UB 2W7OA 3NH0A 4NCBA 4KHYA 4ED8A 3PW2A 4CIGA 2WB4A 1SKWA 3NGIA 4J9OA 2EHGA 4KV8A 2IOCA 3AO5A 1RA6A 2JEJA 1SH2A 4EP5A 4FJIA 4DTJA 3KLHA 5C42B 4CGJA 4O44A 1BQMA 1RT6B 3FQKA 2HHQA 3VQ9A 4ED6A 1HRHA 2AGPA 5DGAA 3CDUA 1QUVA 1T05B 3BR9A 1ZBUA 4CFCA 4B3OB 1Q9XA 3OYKA 5KFGA 2ASJA 4KRFA 4DLEA 1YT3A 4Y1CA 4FLYA 2QKBA 5JS2A 4OGEA 3CJ5A 2RDIA 2WK4A 4ZPDA 2W7PA 1EXQA 3I0RA 4C8KA 3M9OB 4J9KA 3KNAA 4CJRA 3OYBA 3HO1A 4DS5A 3T19A 4CK3A 3PY8A 3PO4A 3JYTB 4Y1DA 1EKEA 4J9QA 4ELVA 4FLWA 1WSHA 1C1AA 2UUTA 3DRPB 3QNOA 3T5HA 3QESA 4FJMA 3NBPA 1UA0A 2W9BB 3M8PA 4C8NA 4ECWA 4KHRA 3E51A 3MR5A 4ZVGA 4B9NA 1HYVA 1WN7A 4NYFA 4O55A 3OYDA 2R8HA 1VK0A 1BIUA 1GX6A 2ILZA 4M3XA 1JLAA 3QGIA 2ZE2A 4CF0A 3CVKA 1HNVA 3K57A 4RW8B 3NMAA 4AH9A 4OPJA 3KHLA 3V1RA 2W42A 5HRNA 4ZHRA 4TY8B 3DOKB 4R5PA 2NUBA 4CHQA 4O3PA 2FBTA 4RUCA 2OA8A 1SUQA 4OLAA 4DL7A 3BSOA 5KT2A 3K5LA 4MIBA 5F8MA 4EO8A 3H5XA 4RUAA 4CEDA 3Q8SB 1WAFA 4ZTJA 4EBEA 3G86A 2YHBA 2WOMB 2GBZA 1U48A 3NKYA 4ZP9A 4AILC 1RA7A 3HVTA 1S10A 2OH2A 4MKAA 4ZPCA 4CIFA 4FZXC 5KT6A 3RBDA 1RDDA 1ZYQA 4QWAA 4ZP7A 1JLFA 4WFYA 1BCOA 4CJ5A 3AA3A 1SKSA 3OVNA 4CHPA 2UVRA 5D3GA 1D5AA 4KHMA 2KTQA 2RKIA 4KHUA 1R0AA 3H5YA 1JLEB 4FLTA 1L3VA 3CIZA 1GOBA 2JLEA 3I0SB 4RW9A 1HNIB 5J2NA 3V9WA 4R0EA 3T1AA 1NKBA 5DGBA 2P1JA 1S1VB 4DL2A 2ASLA 3KLEB 1JL1A 2AGQA 3FFIA 1JLBB 2HHWA 4N47A 4B8AB 2VG5B 3Q8QB 4CHYA 2AX1A 4L8RB 5F8HA 4KAZA 4PWDA 5C5JA 3KK1B 4KHWA 3KK2B 2WRMA 3SFGA 4J9MA 1RTIA 4CF2A 5DG8A 3HL8A 1FKPB 4IDKB 3NF8A 1QHTA 4LH4A 1D9DA 4PA1A 3LDSA 4ECRA 5I42B 4WFZA 4WYLA 1TK5A 4FW2A 3RAXA 3UIQA 4JV2A 1MMLA 3MXMA 1F21A 3TAEA 2W8KA 3PW5A 4GVMA 2OPSB 3MR6A 4DTMA 1KHVA 4WE1B 3HPGA 2QE5A 4J9PA 1FK9B 2FLPA 4FJGA 3OL8A 4IG3B 2G8WA 2B5JB 4IOBA 1TV6A 3KHRA 1U45A 2G8KA 3QERA 4CF1A 4ECTA 1RYSA 1KVCA 1HMVB 4W5RA 4FK0A 3SI6A 3LALA 3DOLA 1S6PB 1Z25A 2BR0A 4B9UA 2GIRA 2IAJB 1VSMA 2YNGA 4HCCA 3TQ1A 1N5YB 1KLMB 3NAIA 4FVMA 2FBXA 1O1WA 2D3UA 2RF2B 1BCMA 5T14A 3VN5A 5KFZA 4K4UA 3P83D 3ZSVA 1RTDB 2A1SA 4E7LA 4IFYB 2C22A 4Y34A 5J2QB 3AVBA 5SWMA 1U04A 1VSLA 3KLFB 3VQ6A 4AHUA 4TQRA 4AHSA 3QEIA 2WONB 4KTQA 1ASUA 4DU3A 4J2EA 3HM9A 3NDKA 3OYJA 3SQ0A 3AVIA 5CYQA 4KI4A 2FLLA 3EPGA 3DRRA 4F4YA 2E9ZA 4LQ3A 1CXQA 1Z26A 2HHVA 1S9EB 1TK8A 4KV8B 4NRUA 2IM3A 3WNGA 4DSFA 3MFHA 3Q8RB 4W5OA 3M9MB 3KLHB 4E19A 4FLXA 4O44B 4GC7A 2IGIA 2AJQA 1ASWA 2GV9A 3KD1E 5EWGA 4EO6A 2Y1JA 4MKBA 4NLSA 1TQLA 2PYJA 1NK8A 4ELTA 5C24A 4CJEA 1NKCA 3KJVA 3HVAA 3THVA 3OL9A 3K5NA 3DLGA 3NGYA 3AVNA 4ECVA 1JLGA 1NJWA 2V4RA 4ELUA 3I0RB 4FJXA 3HPHA 3CYMA 3NAEA 3CFOA 3CFPA 1NJXA 4AHCA 3SQ1A 1ZBFA 1KSPA 3AVLA 1KCFA 3RB6A 3DLBA 5K14A 2O4IA 4KAIA 3OSPA 2B6AA 2BE2B 3NBPB 5KT5A 4DF8A 3M8PB 2QXFA 1Y97A 1I6JA 3V9ZA 4RNFA 4M42A 4MK8A 1RBRA 1TKXB 3MR3A 1GX5A 4IR9A 3HP6A 5KFWA 3FSIA 1MU2A 2C2RA 4W5NA 1SV5A 1JLAB 4NYZA 2ZE2B 2RPIA 1JKHA 1HNVB 2YKNA 3LZJA 1EX4A 3MEDA 4YNQA 3IS9A 1W9HA 1QTMA 4ZHRB 3S3OA 4R5PB 3ZSQA 3QINA 4FK2A 5F8GA 2BQUA 3OYAA 3V9XA 1DTTA 3MEEB 4DSLA 2ATQA 1KHWA 1K6YA 4OPKA 1C2PA 4FZYA 1S9GA 4IRCA 1BI4A 3OYHA 3CDWA 2Q3SA 3H59A 4FJ9A 2XY7A 4DSKA 3HVTB 4FW1A 2UVVA 3LWLA 3LP0A 3O3GA 3SPYA 1L5UA 4FM2A
chains in the Genus database with same CATH superfamily
1UPPA 3ENVA 4Q0BA 4JV1A 4JI2K 4HT7A 5D3GB 1NLVA 2CPJA 1AW0A 3PIOL 2HMPA 4G9ZA 2ZWOA 1BC6A 2IMWP 1R0AB 1KDNA 2DNZA 2IDOA 3JAMO 3KOAA 5DO2A 4OQJA 4DR4F 2KZMA 2YNFA 3J80Y 3RR8A 4YR3A 4J2BA 2XMVA 3F0NA 4BRHA 1H6KX 4OI0A 3VQDA 4DR1K 4EYIB 3MDFA 2QMXA 4OX7A 4CZCA 3GV5B 4DLGA 3BGLA 1C1CA 4E8UA 4ZS6A 1NPKA 3CCSS 1N56A 4B1XB 4ISEA 3FBFA 2B9XA 1DARA 5BYQA 1UMJA 1NGBA 3IFEA 1YI2S 4V19X 2KI2A 1FD8A 2A5XA 3LPEA 2CDRB 4FJ7A 2XMMA 4A8FA 3CCLS 3CERA 4OX9J 3MM7A 5B08A 4ISGA 4YDXA 3MOJB 1E6VB 2ZVIA 1G15A 2YQ1A 4IH5A 4B3TK 5GMEA 2A3ZA 1L3SA 4FVCA 4OVLA 2IPOB 5LY3A 2YX6A 2NZCA 5E3QA 1J5OA 4W4MA 4PQUA 3I5BA 2R7SA 1KS2A 4ZIVA 2LU1A 3O6QA 4FL9A 4PHTX 3NWGA 2CZ4A 1QZ6A 3SFUA 4WP3A 4LF9F 3LP3A 1QQMA 4C3KA 3PYFA 1BIZA 3J7AN 2UVUA 4DR3K 5KTQA 2CWXA 2GVDB 3UN3A 1W7AA 4V19J 5HROA 3H5UA 1IKXA 2H4YB 4PKGA 4BRAA 2R7UA 4A47A 3PZPA 5ETVA 1B4SA 3OY9A 4DR5J 1CSJA 4DL4A 1FA0A 3EMTA 2CVIA 3IAM9 4Y2AA 3B6PA 2HQCA 3CCRS 3VGVA 5KFHA 2A18A 5E26A 3SBTA 1IBKK 2XO6A 2E4LA 4OIXA 4H4KC 3O2IA 1RBSA 1YJ9N 1VC0A 3QETA 2WTFA 3HBTA 3JSRA 2B51A 2EBEA 3GOIA 3GIJA 2L48A 1FFSB 2IM2A 3C8YA 2XGPA 1LWXA 4JI4K 3C7NA 3G87A 4JI2J 2ZKUA 4HH1A 5C24B 1X8DA 3B78A 3CETA 4AQYF 5KG5A 3QEWA 4NXNK 3JXUA 1ZC6A 2LDYA 4DV6F 1S1TA 1LK5A 4CO1A 4DR1J 3I32A 3V81A 1QAYA 3M2VB 3K89A 2FJAB 4F02A 2ETJA 2BXJA 2CQDA 5IS2A 1UFLA 3FZ2A 1FW6A 2KRRA 1SL0A 2R7WA 1VBKA 4WP9A 3C2PA 4CJPA 4CLWA 3VZIA 3A0IX 1S7HA 1U2FA 1TKDA 1LWEA 4Y2MA 1D3WA 4KBOA 2E5GA 4CGHA 3A13A 3HXMA 3IP0A 1PC4A 3GDQA 3IS9B 4FPIA 4CO4A 3AB4B 4DPTA 4IR1A 4YOUA 4AL5A 4B3TJ 4C0BA 2QWOA 2BV3A 1G4CA 3EXCX 4E1NA 1UCNA 4Q43A 4OI2A 4BRPA 6FDRA 2IS3A 3IWLA 5KG3A 3GZ7A 1Y11A 3DOMB 2R7QA 4BWMA 1YZ7A 1ITGA 2J8SA 2DRBA 2H5JB 1DEJA 5JVGQ 3CD6S 4DHYA 4M5JA 1MN9A 4DR3J 3PRVA 1VSFA 3RTVA 2EI5A 2MQNA 3ID8A 4B3SK 2HWHA 2Q36A 3MAAA 3OS1A 3DRSB 5DLGA 3L6QA 2GHWA 3C19A 5M2PA 5M1QA 2I5JB 3BGRA 2D1CA 2O1PA 1U0SA 4ZVPB 3OLAA 5B8HA 2HBJA 4KHPK 2ALYB 3I96A 4CLTA 4H0OA 3K5MA 2CA9A 2W2NP 3R1LA 4QWCA 4CEAA 3S9HA 4DUZK 3HZ6A 3FZKA 5T7LA 3NGUA 4TSXA 5A8WB 2CJKA 1IBKJ 6FD1A 3MM8A 1JLQB 1VQPS 4FWOA 1TR0A 4J2AA 5THWA 1JNRB 2ZD1A 1VISA 2QA4G 2Q1NA 2M7SA 3SJJA 1R8CA 3D3CJ 1RAHB 4ILLA 4XEIA 3D0PA 2XO7A 2KB2A 1JCEA 4H4MA 2UUBF 2DNPA 1LW0A 5KT4A 1X4CA 5AJ3F 1FXDA 1HYSA 3MXIA 3H2UB 2M0GB 4PY5A 3MAQA 4JI4J 2XNRA 2P2CB 2G8HA 4R0JA 4PKIA 1JJ4A 3NGRA 1MW7A 3EL2A 3L7OA 1RJJA 2DGXA 3LP1B 3M6XA 1GMUA 1HI1A 3VERA 5J2PB 1HNXF 4E7JA 2MJUA 4NXNJ 1XIQA 4J9NA 4LRDA 2O8FA 3OTOK 2YPYA 4C11B 4KH5A 1RDCA 1XMOF 1GT8A 1TTHB 2UU9F 4LFAK 1S6QB 1CS4A 4LQ9A 5KFSA 3N5BA 1HR0F 1ASVA 3G6XA 3FGVA 3VA0A 1KKHA 1O0PA 1VHFA 4G1PA 4H54A 2UVWA 2NSCA 1F1BB 5HK4A 4B9VA 3EY1A 1HARA 5JVGL 1SH3A 4P75A 3UDEA 1IVZA 3AV9A 3M4XA 4HKQA 2V2QA 5F8NA 4JI7K 1QZ5A 1V5IB 3H4DA 3HVWA 4GC6A 2CQIA 2QMWA 3U6FA 4OYWA 2O4GA 2C28A 1G2EA 2FJXA 4IO9L 1YWXA 1AYEA 3CM5A 3IAYA 1IKVA 5CABA 1GNKA 5GAHI 2H3EB 1V3RA 1U0HA 4Q5VA 4V1Ak 4LBIA 4UUXA 2KU7A 3G6YA 4FWQA 5HRRA 3B4DA 3DN9A 2A1RA 2V4JA 3LDPA 3VEYA 5IWAF 1RT1A 2CADA 2B8PA 3AVCA 2DEIA 3G2XA 1YTYA 2VBXA 1ZPWX 1LOUA 3R7BB 1NMNA 3HJFA 1NDLA 3H46O 3TUJC 3MPUB 1LFPA 2UUAF 4P2MA 4BDPA 4B3SJ 4QU7A 1OWXA 5JMNA 1U1PA 3M9NB 4M5IA 1IBMK 2IM1A 3BKUA 2EG2A 2QK9A 3HKZD 4FYDA 3EKUA 3G0ZA 3J7YI 3PVXA 2OFHX 2OHDA 4X4VA 4ZVFA 3VAJA 4KHPJ 1TUGB 1GLBG 1DGKN 1B9FA 4K5SA 2QA4S 4KC5A 4JYAK 2WUSA 4CJ7A 4F4XA 1TVRA 4DUZJ 4DV3K 3BGFA 4DX7A 3ULEA 3LGNA 2QZ8A 1EIYB 4FP9A 4BROA 4O0JA 2M88A 2G0CA 3ICLA 2RT3A 3RU0A 3VEZA 2KT5A 2ERRA 1HBMA 2IFXA 4ILMA 1VQ4S 2OZMA 4ZPBA 2YV0X 2FQQB 5F3ZA 1RHKB 3EICA 4C7QA 4LH5A 3PEHA 4A8YA 1ZH5A 2MLZA 5IT0A 2YNIA 3SK3A 2AIRB 3SI8A 1E4FT 3V6KA 1GMWD 5KFXA 4ZCLA 3CCQN 2BKOA 4KJIA 3GFXA 2DHAA 2FVSA 3HOSA 4QAGA 4WTYA 3OTOJ 3SCKE 3QQCD 2OANA 1S0OA 1TKTA 3AA5X 2OCEA 1AXQA 4LFAJ 2GIFA 2GJIA 4RW9B 5FLXU 3W0LA 5AZJA 2D1KA 5AQGA 2BM1A 1CZAN 4O3OA 2XBPA 4C8LA 3LF0A 4C8MA 3PNIA 1Q8BA 2E29A 2DNQA 3TSUA 3PX4A 4JI7J 3D6HB 1HJRA 4M45A 1QAJA 3TA1A 4L74A 4NLXA 2GWJA 2DNRA 5EX5A 2FJVA 2XTJP 1WC3A 1TL3B 2NRZA 1CXUA 5MLCQ 3WEEB 1VS3A 5GAHP 3SLCA 3CG7A 2EC0A 3VAIA 2IHR1 2YWEA 1GOAA 4X4NA 3H0PA 1S1UB 3ITHA 2DGSA 3UD3P 4M3ZA 1K9MT 4WF9Q 1SJ1A 4WFAQ 2XGQA 5IT4A 1W97L 3QBCA 4CEZA 1PG5B 3GSDA 4EYHB 1UAWA 3CT9A 2KQ2A 2OPQA 1GLFO 2X74A 1QS4A 3TU5A 3IXQA 3L2RA 2PA3A 4K4YA 3K17A 4IO8A 3ZTPA 3ZTQA 3IG1B 2Z1IA 1RWVB 5H9FK 1IBMJ 4I4BA 1VQ9S 2VPZB 2AYEA 5H1SV 1S59A 4U7BA 3QLHA 3KFWX 2RQCA 1UJ5A 1RT3A 2R8KA 1VRTA 4YOTA 1IKYB 3NS7B 1N48A 4PPDA 4QOTA 3EDQB 3GYNA 4JYAJ 2VQFK 1VK8A 1N36F 2D3OR 4DV3J 2L41A 3KLGB 5D6GA 1U1LA 1FX2A 1WSFA 1MROA 3Q23A 2OAUA 4WQ4A 1HW9A 2QKKA 1C1BB 3NP5A 3RW6A 1YK9A 3A5OC 3Q8UA 3D1HA 1J5EF 3O9QA 3BF1A 3IMQJ 1RCHA 1DTQB 5BRFA 4M3TA 1S9EA 2W24A 4F3OA 3D28A 2DH9A 3AD7C 1FKOB 1ILYA 1SC6A 3DLRA 1KRPA 3H42A 2WC9A 1QY7A 3QYYA 3SYZA 2NRTA 4GVLA 4Y2KA 1AROP 3BKTA 5GAEU 2F4FA 5KFJA 3QRPA 5IT9U 2L9WA 3TAPA 1S9FA 4KKOA 3BN4A 3KUHA 2QI2A 4BRQA 1WACA 3GIMA 1WC0A 2NZ4A 3L3VA 2KO1A 3O1WA 3M2UA 3RRHA 4WF9L 4WFAL 2R2TA 3TWZA 1YGYA 2GGPB 4JLHA 4FF2A 1RCXB 5CD4H 2IA0A 2V8DA 3LWMA 3AA9A 1IUJA 1APSA 1T7PA 3OUYB 4TYBA 3DLLQ 4FF1A 4N76A 2A6AA 3M7VA 2IDLA 1S22A 1W25A 4IFVB 1YSJA 1YJWS 1KVAA 3FBEA 1WUUA 3BP8A 3BSNA 4CJ4A 3KHGA 1NSQA 5IT9O 1S4FA 2HMIB 4ZJOA 2GA7A 3UVJA 4URSA 3DGVA 3AT1B 3IA0A 3H40A 4KRWA 1NGEA 5BJRA 4K4XA 4WYBA 2RILA 2Q1LA 4KB0A 2DNMA 4PCQA 3GJRB 5LJ5Y 1QSYA 4DCOB 4PKHA 4CJWA 4RW4B 3WDOA 1I39A 3H5SA 4NLDA 1HBNA 3M2RA 3SQGA 2IJNA 4F4ZA 4CIEA 4MJKA 3FE1A 1RAIB 3WXJA 1KOHA 4BRNA 4ID5A 1N0UA 1IBLF 4RWTA 1TELA 4F25A 1OH7A 3VTHA 5AQWA 1VQMS 4KSEB 1BA1A 2E1RA 4X64K 3M30A 3BZQA 3VQCA 1ZM4A 2WVDA 3ZX2A 3ZXWA 1UETA 1LAVA 3LDQA 4MKVA 2MQMA 4F2RA 4Z4EA 1X5PA 2G8VA 4IEIA 5H9FJ 1FFWB 4WK1A 1D1UA 5HATA 1Z6RA 1WC1A 3GU0A 3N4QA 2BJEA 3Q83A 2J0XA 4CBUA 5D4PA 1DY3A 1KAZA 5L1IA 4W90B 2VQFJ 1S5JA 4K2XA 2EX3A 2X51A 1UTAA 4JUZA 2IBKA 1LW2A 2MY7A 4ITSA 3DLLL 2FSNA 2NCKL 1TKZB 2FHMA 2NLWA 3H20A 5KFBA 3E01B 1BMQB 4O5FA 2WZ1A 3EWGA 3KTQA 1DURA 3GYGA 4JKGB 4NLYA 3SIPB 3NGZA 3TAGA 3HTVA 3LL3A 4JD2B 3GL1A 3FMWA 3K8WA 4FCYA 3IWNC 3QIOA 1Q8KA 4X62F 2E1YA 1IH7A 2NRRA 3NHGA 4LF5K 4Z4GA 2V7YA 3FCHA 2FGOA 3UW1A 3T5JA 2CXEA 4IYQA 3ZEUB 2D0BA 2HNYA 2VYPA 3POTA 1SC1B 5A6PA 3D5MA 1NM1A 5IFMA 4LJMA 2A2DA 4J5OA 1TYQA 1NBWA 2MQOA 2XCAA 2IC3B 4ZVRB 2OTLN 2MLXA 3AY9A 3HHLA 2IRUA 4QIVA 1QE1A 4DQSA 3HHNB 1WNSA 1LWCB 5HLFB 3GR0A 3FLCO 3WX4A 1YRUA 2XS5A 3M8QB 3DDNA 1FNMA 3IR6B 3D6TB 2XCPA 1H0HB 4OO1J 2CNLB 4NLUA 2HVIA 4IWVA 5C42A 2OI2A 1UJ4A 2DNKA 2Y1IA 1UKUA 2JEFA 1R0BG 2F7TA 3KZBA 3S41A 3DU5A 5E84A 4X64J 2DIVA 4ILGB 2SXLA 5AQPA 4ZVQB 4M5LA 3W9JA 4FJLA 2MZJA 2F1FA 4HT5A 4EFHA 1D0EA 2YX7A 4XPEA 4M7YA 4M94A 3HYFA 3L0QA 2VFUA 1SVDA 3O9UA 4M8LA 2JHEA 2KFYA 4K8XA 1RHJB 3NGDA 4BRMA 1Q53A 1YZ6A 2UUWA 5GAGI 1RT2B 2FGCA 1FD2A 3NEKA 3W64A 4KHNA 2ZHOA 3DRPA 5LT5A 3OLBA 4CLUA 3PHTA 3THPA 3QJJA 1VLOA 4B3RF 3BN7A 5DDRC 1GH8A 1BHNA 1W2IA 3TVZA 4O0IA 3AOAA 3DGPA 1X9SA 1RYRA 2RQKA 3G10A 1QDUB 1WC5A 2ZOFA 4YOYA 2E66A 2VH7A 2VOOA 3MN5A 4TYAA 3CC7S 4QIEA 1VAZA 4DFJA 4O4RA 3F56A 4F4AA 1SJ3P 2NYIA 4KBIA 4M5DB 2R2RA 3OTCA 1QJHA 3CDEA 3ENHA 2NYHA 2C3YA 4KH1B 3LA0A 5F0UA 1AZSA 2LU2A 1NNDA 4AFFA 4OLOA 2K1RB 3MCMA 5HVHA 4FM0A 4NZ6A 3FCWA 2HHTA 3CJAA 4MO4A 4BWJA 1BLUA 4HEA9 4LF5J 1RTHB 1Q81T 3BZCA 1YIJN 1FRHA 4USHA 1OS5A 3KIOA 3ULDA 3W60A 4F0HA 2EFGA 2YX4A 3G4SS 1JLEA 4NLRA 3VEXA 4ECUA 3LGHA 4K4TA 3A5MC 4JI8K 1EKRA 1FRIA 1X9JA 2AP6A 2RRBA 3AAQA 2AJ0A 3KLEA 3VQQA 2VQEK 4CLKA 1SJ4P 1F9HA 2A10A 4Q44A 2EVZA 1CJKB 3KK1A 3KWGA 3KK2A 1NH7A 1XTZA 2VFSA 1OY9A 1Z4UA 2HRTA 3IGVA 4DV7K 4CLZA 4WZQA 4C0OC 4GKKK 2YHXA 2G8FA 5A8RA 4DV5F 3NF7A 3O1BA 3FDSA 3BYRA 4EMDA 3DXKB 5GIPA 3ZCMA 1S49A 4GV3A 2IIHA 3U1MA 5ADXH 5HL7Q 2CZVC 1M0SA 3QO9B 3Q2SC 4G65A 3AVGA 5KGXA 1RT5B 4B1YB 2QEXN 1BHLA 2DGQA 5KFNA 3L4IA 3HHEA 4PG4A 1WG4A 2CFXA 1WWHA 2RIJA 3R2CJ 3LP1A 4ZJLA 2LSNA 2IAJA 2RVJA 3TTDA 5BRDA 2Q43A 5GAGP 3W65A 3SAHA 2EG1A 4DL0C 2OELA 2BE7D 4CH1A 3NVKA 2XSJA 3RG6A 1K73T 2G8IA 1RTDA 4I6AA 2ZHBA 1VQLS 5DQHA 1HA1A 3C6UB 3WHIA 3MECB 3KLFA 1UVLA 4H03B 2ROGA 2GNKA 3TZWA 2ZM6K 1IR0A 1Q79A 3CJKB 2CQ3A 2W7OA 4X4SA 4LF2A 4NCBA 4CIGA 5KQ8A 4BR0A 5JVHL 1SKWA 4J9OA 4KV8A 3VQTA 4B9QA 4UY85 3DJCA 3NNAA 4DTJA 4BRFA 1N5SA 3TR5A 1RAFB 2HIYA 1RT6B 2HIQA 2HHQA 3VQ9A 1OY8A 1S6OA 4TLQA 2A1BA 2AGPA 1UEVA 4JOUA 1Q82T 1T05B 3OYKA 4IQMA 1MDUB 4WP8A 2DNNA 4O8KA 3MMAA 2ASJA 3SXLA 1YT3A 1HBOB 4BC2A 2D0OA 4I64A 5HL7L 2QWQA 2UUCK 1FRMA 2EK6A 4JI8J 2RDIA 4CVNE 4ZPDA 2XHWA 5D8HB 5IT9Y 5M1FA 4CJRA 4DS5A 4WU3A 3T19A 2HFVA 3PY8A 3PO4A 3MCPA 5F1XA 2IY5B 4MLHA 3EO3A 2VQEJ 4M63A 3IBCB 3LUYA 1YHQN 3S1TA 4FLWA 3MCSA 1C1AA 5LM7E 1HNWK 2CNNB 5AXLA 3T5HA 1VQYA 3QNOA 3QESA 4FJMA 3UCUP 3MD1A 3MR5A 1XERA 4QBUA 1WHWA 4ZVGA 3C16B 4UZBA 5LL6Z 4NYFA 4DV7J 2R8HA 3C6AA 2P9LA 2XZDB 4GKKJ 4LFCF 1JLAA 3CVKA 3W2VA 2QFJA 3E9LA 1HNVA 2CYYA 3CC4S 4GKJK 2VICA 4RWXA 4OPJA 3KHLA 2W42A 3T1HJ 5HRNA 3BH7B 3RSEA 2G9OA 2I7PA 2OA8A 5EOYA 4OLAA 3BSOA 5AFUA 2NXCA 4CD1A 1NSKL 2DGWA 2DITA 2V94A 3CCJN 1WOOA 3CCMS 3A8IA 4FZXC 4YHHF 1EWQA 5E3PA 2YKQA 1JLFA 3PEJA 2DXFA 3OVNA 4X4QA 1YXQA 2JVOA 3A8YA 4FLTA 3MM5B 2GJ2A 2JLEA 1HUXA 1R3NA 3I0SB 4RW9A 1KBRA 1O5JA 4A57A 5LL6d 2Z2MA 2F8MA 2WVEA 3T1AA 1NKBA 5DGBA 1S1VB 4DL2A 3FZBA 3TYTA 2ZM6J 3HHLD 1NJIO 3FFIA 4USJC 4LF7F 2LEPA 2QSFA 4L8RB 5C5JA 3BH6B 3KJQB 1PBUA 2QXLA 4ANEA 1EWRA 3JXOA 4RUBA 3KXDA 1YITS 4OZNA 1RTIA 4CF2A 1FKPB 2MY8A 1B64A 3DHWC 4I69A 3MM6B 1QHTA 4LH4A 3P6YC 1NJIT 3TJAA 2V9KA 3LDSA 4BC5A 4WYLA 1TK5A 4FW2A 3MZIA 2B3TB 3W8GA 2W8KA 2OPSB 3LQVA 4DTMA 4WE1B 2QE5A 1N33K 5B7WA 1FK9B 5BR8F 4IG3B 2UUCJ 3KHRA 4DR2K 1LCUA 4ECTA 4FK0A 4CO5A 1FO1A 5K8PA 4FWSA 4B9UA 2GIRA 3HCXA 4FXWA 2J9EA 3A5NC 4PL7A 5D4OA 3KJFB 5J1NA 2MKHA 3TQ1A 1B7FA 4WIQA 2VDHA 1U8WA 2MKCA 5K5MA 1S12A 1WOSA 4FWNA 5KFZA 4ALZA 4M5NA 2CUYA 2W41A 2A1SA 2IDEA 4E7LA 4AUKA 3H3OB 2Q2RA 3AVBA 5SWMA 3OHRA 1VQ8S 3DXSX 2NNWA 4I6YA 3J7A1 1L3KA 1AFJA 4GKJJ 3VF6A 3QEIA 2NUUG 4J2EA 1QUPA 2J9DA 3OA9A 3OYJA 1VQNN 4XAKA 3AVIA 3C15A 1PYTA 3M6GA 2A42A 4XDCA 3WXIA 3DRRA 4F4YA 2BUNA 1HHQA 4H5VA 2HHVA 1TL5A 1DT9A 3VAHA 2FY8A 2Z57B 2F9TA 1EJ7L 4O44B 4GC7A 2DYAA 5AQMA 2P9UA 2GV9A 3FZMA 3KD1E 4BR5A 1KAYA 1FVQA 1HLWA 4BG8A 4BCAA 5IOLA 4ID8A 2BE9B 4FDFA 3RAMA 4CJEA 1OJ4A 1NKCA 1A9NB 3UE5A 2AMCB 3OL9A 2GGPA 4DR6K 1NJWA 4ELUA 3CJTA 3GYXB 3I0RB 1JB0C 2HGLA 3A4TA 3R5AA 1KQKA 3CYMA 3CFOA 1NJXA 4ISFA 2CPYA 1VYAA 1NAQA 3AVLA 2AP1A 2IBOA 2Q6BA 3DLBA 4DBQA 4CH0S 1KQSM 2B6AA 2BE2B 4PKDB 4JHDB 2V2ZA 3EX7B 1I6JA 3ZTOA 4RNFA 5FPMA 4M42A 1TKXB 3MR3A 2GWKA 4FOIA 3HP6A 3R7NB 2C2RA 2UV8A 3PDNA 4DV0F 1XK8A 4X65K 3OFEA 3CD0A 3LZJA 2BJ8A 5F0WA 2P9SB 2P6TA 3MEDA 4YNQA 1QTMA 2P9CA 2HYIB 2ZUAA 1GLAG 2DD8S 3DDIA 1XNRF 3MM9A 4DSLA 1KHWA 1K6YA 4OPKA 3THYB 2Z0GA 1N33J 2M70A 3OYHA 2M3DA 1NU4A 5FJ4A 4ZK7M 4FPAA 3H59A 2XY7A 1XEZA 4DR2J 4Z7YA 4KR0B 4QR1A 3SPYA 2DBBA 4YB6A 5AZIA 4OYXA 5EWEA 4NXMK 3RR7A 3J7ZT 2D5RA 1CPZA 4Z0UA 1S1WA 4DCJB 5AR0A 3QFWA 1KVKA 4PWUA 4PXCA 1HKBA 2RKIB 4B9TA 4OHYA 2M8DB 3OW2M 5KG0A 1X31C 4ZP6A 4O0NA 3GG0A 3OYEA 3R3LA 2JEGA 1V6HA 1GTHA 3G82B 1BQXA 2LXFA 2PO4A 4UY8O 4CCHA 2E44A 4DSIA 5KFLA 1C0FA 2NRXA 3PIPQ 1GMVA 2RU3A 4CFAA 2KM8B 4GRSA 4OYMA 1N52B 4FZZA 1UVJA 1QAXA 4PWDB 2IYGA 3KD5E 3HFKA 3THXB 3OVBA 4JKGA 3SV3A 3EVOA 4B8CA 3CUNA 4OX9F 4J9RA 1WKKA 2KZZA 2DPJA 1MWYA 3IR7B 4PEOA 3QEPA 2L9NA 3OXLA 2YJEA 3BUZB 4BRLA 3CO0P 1H2TZ 3TX8A 1BU6O 2W9AA 1U47A 5CHIA 1R8AA 2B8QA 1NCLA 2HGNA 3VVTA 5HOOA 1X60A 1FDNA 2DXEA 2HHXA 2OYQA 2EFOA 1RWPB 1TV6B 3CGIA 4DR6J 5HP1A 4GMJB 2KXHA 5FDLB 3H25A 5EWFA 1K0TA 4MAKA 4QR0A 5LSLA 2HBMA 3IFRA 2PMZD 2E1ZA 1RBTA 3JS6A 4ZOSA 3C6TA 3MMBB 1MWMA 4A8OA 2QIFA 3QZ7A 2WTUA 2ZWPA 2V6AA 2BOPA 1KNZA 3M8QA 2HSEB 1FJCA 4TVAB 4DR5F 1OH6A 3WIVA 1CVJA 5KT7A 3OFGA 1P1TA 3HX9A 3GV7B 5EDWA 4X65J 2E9TA 2PZSA 3R8YA 3CIPA 3MR7A 3GILA 1N8RO 2HNZA 3QFHA 3LOUA 2Y3YA 4ZLNA 1DRZA 3KVGA 3W5XA 2BW2A 2FZKB 2BABA 5U47A 5J1EA 3PIPL 4E7HA 2VPYB 3N0VA 2RHKA 3EDRB 5ITHA 1YG0A 4OMFG 3SEOA 2CIMA 3MFIA 3FJ2A 1RT7B 2UYTA 4DQRA 3QGGA 4F4WA 4P2FA 3N5FA 3MN6A 3ENWA 1AA1B 4AHRA 3HSTB 4KGXB 3HD2A 3BDPA 1DAXA 4KI6A 4BGBA 5F0XA 2XHCA 3KDNA 5E2QA 5LSOA 4JI2F 1FEEA 5A6WA 4PUOB 4NXMJ 1Q7LB 2FSJA 2G2OA 2ZZMA 2DHXA 4L6V3 2Z30B 4NLPA 1IG9A 5MLCV 3UCZP 4WIIA 2VA3A 2UXCK 1B0PA 4BDYA 3BSAA 1H2VZ 1Q95G 3P4UB 2ZZTA 1S6UA 4CZFA 7FDRA 2HFNA 4DR1F 3SPZA 1T03A 1RE1B 2RRNA 1N54B 4DU4A 4DOZA 1JMTA 1HLUA 3V6DA 2EXUA 3CJ3A 1DFDA 3T3FA 4FK4A 2DR9A 1CJVB 4U7UK 4DB3A 3CI5A 3OYGA 5K14B 2UXBF 4Y00A 4IZ9A 2EFPA 1S72N 2ABYA 3EZ5A 3MR2A 4A2AA 3RMBA 2HEKA 4HTLA 4YMEA 1MU2B 1SV5B 1JXVA 2ASPA 1Y7PA 2EWSA 2D7SA 1S0NA 1X9MA 1JKHB 2YKNB 3G6VA 1S4EA 4B3TF 2VODA 3ZTSA 2ZUGA 4IH6A 1HKAA 4BS2A 2O8BB 5DLFA 2K1RA 3EGWB 1IV0A 4H4KA 1I51B 1L3TA 2GVZB 3HP9A 4B9SA 3CJBA 1N5VA 3ZETA 2KN4A 2KHCA 4CGIA 4PL8A 1CULB 4A5BA 2E2NA 1VBYA 3QMLA 4KTZA 4WQ5C 4DR3F 3LAMA 4Q0BB 4MT1A 2DEJA 1X0FA 1IM4A 3EM1A 3MCOA 3RVCA 3BR8A 5A2QO 2MZTA 2C2NA 2LQ9A 2HRYA 5GADU 1W7WA 3DWLA 2YNFB 3KG1A 2MKKA 3CTRA 4FF4A 1VC6A 4FJ8A 3CMAS 2J6TA 3WC0A 3V9UA 3CMQA 1FF2A 4ED5A 2R4FA 3W7BA 1IBKF 4NLBA 1U24A 4O3RA 4TXSA 4ED2A 1MN7A 3M32A 2NREA 1VQ5N 3DXKA 3I82A 3W61A 2JFDA 2ZNZA 1WNEA 3T1YK 1JX4A 4DHVA 1NGCA 4DTNA 1WEYA 2HBRB 5AQYA 2RS8A 2PMWA 3MM7B 3R9PA 4U67Q 4AD6A 1KFSA 2BRKA 3QRQA 4IOCQ 2ZJPQ 2IM0A 9RUBA 5B0BA 4USWA 2BW7A 4ILJA 3KHHA 1BGXT 1J5OB 1SL2A 2FBYA 2UXCJ 4PQUB 2JSXA 3TO8A 4DX8H 1RBUA 4LVOP 4FBUA 4RW7A 3O3FA 3CCZA 4QYZK 1RILA 4CGDA 4EU0A 1T9TA 3MX2A 5LJ3Y 2HK3A 4FYYB 4U96A 1RLDA 2WW8A 3TARA 2ILYA 4O3SA 4ED0A 2YVSA 5SUHA 5HROB 5HN0A 4DL5A 2CQBA 2OTJN 1IKXB 4F04B 3DMJA 2DHHA 5KG1A 1VBZA 1WBDA 3OYLA 2N7CA 2QA2A 4UOHA 2EBGA 4WCEQ 3D2WA 3UR3C 2FVRA 4AL7A 5H9EK 2D4WA 4BDZA 2O8DA 4M95A 1ZBHA 3L3UA 3PX0A 1RT6A 1AUSL 4FS1A 1K0VA 4XO0A 3OTBA 5KRTA 4P72A 4O23A 1T05A 3ZSWA 2QN6B 3MDQA 5FIIA 5HQMA 3IGNA 4JK7A 1DLOA 3TZZA 3SUPA 3BM7A 2P6SA 2QO3A 3C7NB 1WOQA 4P71A 3CCUN 2DR8A 4HI1A 4I6MA 4U67L 4B3SF 2RUSA 5M2UA 5ETMA 2HAIA 3AVMA 3L09A 4FVUA 4RU2A 3GTYX 1BUPA 4IOCL 1Q7YO 2ZJPL 3CEDA 3SUOA 2QLJB 5DK5A 1RAJA 4EBCA 1FDDA 1GK8A 4ZVHA 4CBXA 2HURA 4ZVUB 4KHPF 1QM9A 4NLQA 2GHVC 3L9ZA 2KDOA 1S1TB 3O80A 4DMNA 3PJ9A 4LBPA 3SQ2A 4DUZF 3V81B 1GLJO 2HFOA 3TAFA 4F3TA 1XJWB 1F2HA 3I56S 1NK5A 1ICEB 2D74B 2XM3A 1VQON 5GAEI 3MK6A 4MYUA 4QPXA 1LWEB 3T1YJ 5CZXA 4Y0FA 4Y2CA 1NOZA 2FBVA 2FHJA 4HVJA 3GG1A 1YBUA 1WD6A 2P5VA 2GHPA 2JLFA 3KMQA 3VQBA 1VIOA 4WCEL 4E98A 3AD9C 2HFZA 2V50A 5FD1A 4PABA 2PMHA 3OTOF 3H2VE 4BR4A 1F3VA 3VVUA 4IQXA 4I0WA 1S5ZA 4LFAF 4NE9C 2WVBA 5KG4A 2IIRA 2LYVA 3O9RA 1YJNN 4QYZJ 4AQYK 2GW8A 2XY6A 4ZCIA 2N7YA 1J53A 5CY4A 1G3OA 3PTWA 2VGMA 4B1ZA 4QW8A 1U2VB 3AAPA 3MOZA 3J81U 4DR7K 2DNHA 3DHXA 3MAAB 3M5RA 1F3FA 4KO0A 3M1VA 4JI7F 4OJHA 3QAUA 4CO2A 1T6DA 2I1RA 1Y10A 1U2CA 1B92A 3S7RA 4CJSA 4OYIA 5KGWA 2VONA 1U2RA 4H5RA 5KFUA 2DJWA 2BYCA 5H9EJ 2ADCA 4UQGA 3C14A 5T7LB 1T3NA 2HWIA 2FIUA 3MM8B 4NA1A 2DKOB 4OI4A 3PFOA 4YR2A 3VF2A 2ZD1B 4O8UA 1K44A 1L3UA 1HBUA 1G99A 3V6JA 2BZ2A 4WE1A 1JIHA 1H74A 3L7UA 3ILOA 2ACYA 1NRKA 3M6UA 4PYAA 4TQSA 4H4MB 1LW0B 1CZ9A 2PYLA 4I9QA 2CJYB 1S48A 2GO9A 5CR4A 1E6YA 5EU7A 1K8AO 4URQU 1J27A 4Q2LA 3SUQA 4OHXA 4UW2A 3B8HA 1YJUA 3R6GB 2WW4A 3O5TB 1RXOB 2EFNA 3BDEA 5GVQA 2P9PA 1YJRA 5HANA 2O8FB 2CJQA 3D9BA 4KTWA 1ZAXA 2DB1A 1K8AT 2WBNA 4FJKA 4JYAF 1YVFA 1CS4B 3AA4A 5HI7A 3QT6A 1VLYA 4OJ1A 4C2MA 2CPFA 2RAQA 4OFZA 3V9SA 5GAEP 1DQ8A 1P27B 3TNVA 3S3NA 2QT7A 3UDVA 2JH3A 5EY4A 2R9LA 3MEKA 4HUGA 4KGKA 4YS2A 1M1KT 3LPYA 4BRDA 2AQ4A 5GMDA 1NU0A 1IKVB 5KOWA 3FEYB 4IBNA 3SMZA 1U0HB 1XR7A 3H08A 5DZ6A 5AJ3K 3IC1A 2QTDA 5CZ1A 1EKSA 2V4JB 3PJWA 5AQTA 1RT1B 2NXEA 4RZRA 4G1QA 2L3MA 3QPIA 4CHOA 2MMYA 3MMVA 1IQZA 4AQYJ 1U49A 1NXIA 3N9UC 5CXTA 3BSCA 1IG8A 2J0WA 4DR7J 3JQJA 2MKJA 4YOVA 2HBLA 1H7WA 2MHNA 4FWRA 3QT5A 4HTJA 5B0EA 1A5XA 2BE2A 1C0TA 3BEXA 3FK4A 2KKHA 3IRXA 3IR5B 1TKXA 1TUWA 2C2EA 1SKRA 3RMAA 4CGFA 3A5LC 3QGHA 1TVRB 4DU7A 1NWKA 3ZX0A 3S3MA 4CNZA 3ZSRA 5HQ8A 4G6VB 1X9WA 2Z2ZA 2IJFA 2BJ7A 4EHTA 2M52A 4C3MA 1HWKA 4A4JA 3ULHA 1J54A 1HBMB 2JJ4D 4OZ2A 4E89A 2Z1GA 2DHGA 1BI4B 2BKPA 4K8ZA 2HF4A 1WORA 3AA8A 3U7JA 2LKZA 5A2QY 3U4LA 4KPYA 1RGVA 4H0PA 4FF3A 4YDUC 2YNIB 2DT9A 2G2ZA 1N5TA 2MTLA 4DU1A 4CWBA 4NWBA 2YKMA 3ZZTA 2JFKA 1T9YA 3VGLA 3FQLA 4M3UA 1R27B 1XQIA 2DR6A 1IBCB 2M8HA 4P2XA 3RRGA 3OYNA 2J7WA 1TKTB 1VRUB 3K2YA 3M8ZA 2UUAK 1LWFA 4LSNA 4NLVA 4N41A 1T44A 2VQFF 5AZJB 4FJJA 3M6VA 4EWTA 2CQPA 4C8YA 1YX2A 4ES3A 1RT4B 3HZEA 3UKUA 1XBWA 1VSKA 3QEVA 1HKGA 2EK1A 3O1LA 4IH7A 3PR5B 2C2OB 1VDHA 2DNLA 1O8BA 1YF5L 4ID1A 2R8GA 3AY0A 2J5AA 3KKSA 5KPZA 2G1DA 1S76D 2E1MC 3HULA 1JLCA 3SCJE 2P9KA 1M90T 1VQKS 1S77D 2ASDA 1OYEA 2MHEA 3AARA 5ETPA 2EPIA 3ITHB 1B7YB 4X4RA 5AJ3J 3H2LA 1N34K 2F8TA 2L9DA 4C98A 3K9KA 3PM9A 4QPTA 2I7NA 4CZGA 3HI9A 4A48A 1EETA 2ZC3A 5FDLA 2OPQB 1PYSB 5F8LA 3PW7A 5HRSA 2RB7A 2YH0A 3HK2A 4YOWA 1B9DA 4QIFA 4MH8A 2HQGA 4ATNA 4XH4A 2E6MA 4IG0A 2N4DA 5DG9A 2I9SA 4HUFA 5CYMA 3H7HB 1H38A 4DG1A 3HT3A 3HZGA 3QLHB 5IM0A 1RT3B 4LBHA 2ZF5O 1VRTB 1HW8A 5JUMA 1P8GA 2GS8A 2R2UA 3EKSA 3FRZA 4WFBQ 9ATCB 2W4CA 5AQRA 1Q8IA 1T9VA 2CQ2A 2GMLA 4JP8A 2ITMA 4ZVOB 1IM6A 1MROB 3TR8A 1FJGK 4CI0B 1WAJA 3C65A 3ZT3A 4RLEA 2P9NA 2V9WA 1JJCB 1NSAA 3VQ4A 3ZZRA 1RT7A 3EPIA 2QWLA 4DSEA 3TUIC 2E5LF 3QATA 2VA2A 4B3OA 2BM0A 1WI6A 4FPRA 2FJWA 3CC2N 1YTUA 2ZBQA 4CHZA 3GJTB 4NI2B 3C95A 4PUOA 1O51A 3NNHA 3KK7A 4KKOB 1EB0A 2Z4PA 2J9DE 1BOTO 1RKJA 2BX6A 3M2UB 2IJRA 2VBYA 2QWMA 3G71N 2OKQA 4DKWA 3SCIE 3GONA 2UUAJ 1FE0A 3FNNA 3NY0A 5LMNF 1FI4A 2PEBA 5EN1A 2HQ3A 1Q78A 5JXSA 1VHXA 5BN8A 2VF3A 2FVQA 5B0AA 3ATVA 1KONA 1V4SA 2MZRA 4DTRA 3OTEA 3PKYA 1CJVA 2FC0A 2F8HA 2BGGA 1GFWB 4IRDA 4RW8A 4JI6K 3UVJB 5DDQC 1KVBA 3AQPA 2VGNA 3T69A 2XG8A 1LKZA 5HSPA 2J7KA 1NHKL 3H8YA 1KQFB 3K5PA 4MMOA 3DM2B 3E9OA 3TANA 3MF5A 1VK3A 4KB7A 1J5EK 4WFBL 1HBNB 1NB2A 4BC9A 3M2RB 3SQGB 2GUPA 3NMRA 2RQ4A 4PXBA 1OPZA 2XEXA 5ELZA 1Z05A 2JWLA 2YTCA 4DSJA 3RAQA 4K4ZA 4TU8A 4ID5B 1N34J 2YPZA 3P5JA 4LF5F 1T9WA 2XMJA 3JAMU 2JC0A 1U1KA 3IAS9 4DCHA 3J8AA 3DXMB 3RB4A 2LQ8A 3JSBA 3M30B 3OT9A 3P49B 1NHVA 3P1GA 2B9WA 3HRGA 2O3DA 5CD4A 3HKWA 3AOCA 4LRAA 1SI9A 5DM7Q 1P9QC 2YKOA 2AJ4A 4Z94A 1WG5A 2CDQA 5HVGA 3ZZOA 4AHTA 2ZZNA 2GO8A 3VQ8A 5IXUA 2LQBA 4ZCKA 3KUGA 2VKRA 1W26A 1FVSA 2F65A 3OYCA 4GVBA 3LDOA 3U9DA 1Y9OA 1AUDA 4Q8FA 4FLUA 3C66A 1LW2B 2KYXA 1KN6A 1FJGJ 4IDKA 3C6HA 2CKWA 3J81Y 3OXGA 4FJ5A 3VALA 2HVDA 3AVJA 4KE5A 1I1GA 1MNEA 2C2KB 1M5HA 2OO4A 4PAAA 4CD3A 3VENA 3OL6A 1WHYA 4WFXA 3THWA 2EKNA 4H0XB 3EGNA 5F9LA 2ZJQQ 1M5PC 5TKYA 3D1OA 5B09A 1IBLK 3TA2A 8AT1B 3R5GA 2VJVA 1S1XB 2VG6B 3CMES 2NLXA 2CNOB 4LF6K 2B5JA 2B43A 5F3TA 4PZVA 1TUYA 2OD4A 5I4MA 2XLIA 3R5BA 1R89A 2AJFE 3NFAA 1S6PA 3SAGA 2M5YA 1GMWA 2CWKA 3KG4A 4ZITA 2X3GA 1K1QA 4LF8K 4AM6A 4ILRA 2OEKA 4B1WB 1ZOTA 3N4PA 1PAUB 2MKSA 1HPMA 2RF2A 4FKXA 4CTAA 2HNYB 4RNOA 1RAOA 2EFVA 3POTB 3VGUA 3W5YA 3P96A 1P6TA 1TYQB 1B70B 2P9GA 2MSTA 5KFDA 1XMQK 1QQCA 4DUYK 2HOEA 1R8PA 1WF2A 3TJ9A 2K7JA 3HHLB 4JI6J 1QE1B 2XWYA 2JOQA 4ERDA 2V69A 3U8XA 2F7VA 5DM7L 2PFUA 3J7YU 1TL7A 1H73A 4IDHA 2RE2A 2G0JA 3NH0A 2Y9HA 4PG7A 1UFWA 3A8JA 2AJ2A 1J5EJ 3M05A 3QBXA 3NCQA 1KEKA 3WC2A 1R7IA 3NS5A 4DCPB 3AO5A 2DNGA 1SH2A 4QIWD 3ZNUA 3KLHA 5C42B 1PCAA 3RUBL 4P74A 1QVGR 3BV8A 3FQKA 4CZJA 2CQCA 1X7VA 4ED6A 4K7QA 4JKFA 4K43A 1SKUB 4TKTA 1QUVA 4CFCA 1Q16B 2WBRA 2V8HA 1I94F 5C2FA 2ZFHA 1Y5NB 4X62K 1NH8A 1RTZA 3KKFA 3MTJA 2VCPA 3CJRA 3CJ8A 3EVMA 3I9ZA 2QKBA 2ZJQL 3WZ0A 4OYZA 2WK4A 4CO3A 3S8SA 3M9OB 4J9KA 5DZ7A 3HO1A 2XMAA 1RSCA 2VQEF 1S99A 1X4GA 2W4PA 1EKEA 4ELVA 2QC3A 5AQVA 1RDWX 3DRPB 2DO4A 4C8NA 4RJVA 2N3OA 4GKKF 2MZSA 4QS7A 1WN7A 1FWPA 2MQQA 1VK0A 1BIUA 1JK9B 4JI0K 1GX6A 4M3XA 3QGIA 2MGZA 2ZE2A 1RP5A 3DGPB 3T1HF 3K57A 3CCTA 3V1RA 1YRTA 4ZHRA 4CHQA 1RDUA 3VTIA 1EQYA 2F4VK 3TEHB 1PAEX 5KT2A 1NO8A 4MIBA 1HWIA 3H5XA 4CEDA 1CQNA 1IBLJ 5CE3A 3QT7A 3G86A 2GBZA 1HX1A 2HAFA 4LF6J 4AILC 1RA7A 4XH5A 2CQHA 4EGLA 7FD1A 3HVTA 1S10A 1AZSB 2OH2A 1Z2LA 1QVGM 2CNKB 3RBDA 1RDDA 1ZYQA 4QWAA 4KH4A 2VFTA 4ZP7A 5E3RA 4WFYA 1BCOA 3TP2A 4LF8J 4L73A 2UVRA 3CCES 3OFFA 3I8BA 2KTQA 5IV4A 4KHUA 4Z2XA 1JLEB 3PFEA 3IBWA 4OLPA 3LM9A 2L08A 3DFEA 2KYZA 1XMQJ 5J2NA 4DUYJ 2QRRA 1HWUA 4Q2MA 2YY3A 1U2VA 2ASLA 3UNYA 1WG1A 3KLEB 1JL1A 2FSKA 4K25A 1OIAA 4BY9C 4IXCA 3K9JA 3CCVN 3GLJA 3SCLE 4B3RK 3Q8QB 4CHYA 3W2WA 2LEAA 4KAZA 3KK1B 3KK2B 4A59A 4A8WA 2V8VA 1JJHA 2IVPA 3CNQP 1R31A 2NR0A 4CLLA 5A8RB 3ET6A 2DIUA 2H65B 5K20B 4XTTA 3KWIA 2NXNA 2VD3A 1J2VA 1MMLA 3MXMA 2IVMA 2YCHA 2O67A 4X62J 2HVZA 1YAGA 2C3OA 3R7SB 1V4TA 2M2BA 2G8WA 1S0VA 5M2RA 3ILLA 2QWNA 4W5RA 2N3LA 3W5ZA 5GIOA 3W9IA 2IAJB 3QJPA 2A0FB 4DV4K 2YNGA 3K0SA 4HCCA 4FXVA 3MCAB 3NAIA 4FVMA 5A8KA 2D3UA 1O1WA 2XSJB 1BCMA 5T14A 5BPNA 2IVFB 3O9TA 3P83D 2ZH3A 2ZH1A 1RTDB 1WELA 2PI5A 2PAVA 3TSQA 4X4OA 1WOPA 2VIHA 4JI0J 5E3AA 4GKJF 5I3PA 3G8QA 3K7RA 3R1XA 3KLFB 4ES1A 1JCGA 1NGDA 4AHSA 1TMJA 1X4AA 1ASUA 3FZFA 3VESA 4DU3A 3LGMA 3I55S 3VHQA 2CVEA 1NPRA 2F4VJ 3SDEA 5JMVA 5CYQA 4DV5K 1X5SA 4KI4A 1MMDA 2X1AA 4F0KA 4LQ3A 3QT8A 1TK8A 4KV8B 4NRUA 4BGAA 5ADXA 4DSFA 3WNGA 2E7VA 3MFHA 1D9AA 2PSZA 4W5OA 3M9MB 2DHSA 2LLZA 4PR6A 4GO5X 1RQ0A 2V5HG 1FCAA 1ASWA 5EWGA 1ZA1B 2B9YA 4V19S 4FSVA 5CCLA 4MKBA 2GCFA 1Q1KA 4ZN1A 4MIWA 3Q2TC 3Q8VA 3MMAB 3HVAA 3THVA 4AXIA 2K3KA 2NXJA 2WSCC 3DLGA 3BBCA 4FWMA 1JLGA 5DJBA 2FHKA 4DUTA 1SAZA 2LMIA 4PG5A 3D4JA 2CPHA 3HPHA 1YKWA 3EXYA 2OLWA 2CZ9A 4ETXA 2RJZA 4YUDA 1VQSA 3CFPA 5D78A 3ZZZA 1X3NA 4JV5K 3SQ1A 2DY1A 1FWLA 3RB6A 4RR5A 4B3RJ 1WTBA 4KAIA 1LFWA 1RU1A 4ES2A 5CA5A 4MK8A 1RBRA 4IR9A 2QFIA 4D3HA 5KFWA 2HBKA 2P9LB 4W5NA 2DRDA 2FPHX 1JLAB 4QS8A 4NYZA 2RPIA 3W2VB 3TX0A 1HNVB 4Y28C 2R42A 2XMUA 2D69A 1EX4A 2IMOA 2OSRA 1DKGD 3JQMA 3RSEB 3QINA 1Q86T 1VQ7N 3OYAA 1YRXA 3V9XA 4N7TA 2JLGA 1S9GA 4IRCA 1BI4A 4FJ9A 4FW1A 3NCRA 3LP0A 2J76E 2GMHA 1L5UA 4A8MP 2CH6A 2MPUA 1JLFB 4DV4J 2RDJA 4R8UA 3JAMY 2E5JA 2QYCA 4JBCA 3ZO7A 2LP4A 1BWFO 4JI5K 4K0KF 1ITPA 1VQ6N 4KH0B 1ZTWA 2VG7A 4ED7A 1VRUA 3CQ8A 2A3JA 3WNHA 3CWJA 3U9ZA 3QRRA 2F96A 5DQGA 2Y8WA 2NS1B 4FS2A 4ZVTB 2I0XA 4NCAA 3AO3A 1G1XA 1JL2A 1RT4A 4CGGA 3RMCA 4NRTA 3FFIB 3HPOA 2F9JA 3J80O 3G6EN 3HHKA 4NYPA 3EZWA 3LP2A 3QSIA 1K9MO 3WXMB 3HSZA 4RG8A 2DH8A 4J9VA 2P51A 1KVJA 5D0HA 4C8OA 2AKWB 2CQ0A 2APOA 3LM2A 2PT0A 1RTIB 2XS7A 3UO0A 1V3ZA 3TZYA 4FXDA 2AA4A 4NYNA 4A8KA 2QTWA 2WAQD 1NEEA 2O01C 2V52B 2K8GA 4H8KA 4P52A 4F4KA 2E6LA 2JWKA 2ZOMA 4NB4A 1U6BA 2QX0A 4BE0A 4DR6F 1T3VA 4YHHK 4I68A 3P45B 4EUVA 4ZLLA 3CCSN 4X84A 3CD7A 5RUBA 2JC1A 4ECZA 2PDAA 5AQIA 5LSRA 2AGOA 3VAMA 2BANA 3EE3A 1YI2N 3MUTP 1XNQK 3KLIA 2HHHF 3K59A 3T6BA 4DPUA 4JV5J 1MWKA 1YJ9S 3CCLN 2PIIA 1V3SA 2DY9A 3SBMA 4YB1P 4USKA 2A40A 5AQXA 2VWJA 1RK8A 1LV5A 4X65F 4I6WA 3TAMA 3UI3A 2PC6A 5C25B 5KFCA 3AJDA 3OS0A 4LT6A 4MFBB 1UL3A 2VWBA 1RDBA 3O4QA 1YJVA 4O4GB 2ZBRA 2WVFA 4KFBB 3C15B 5L9XA 2BTFA 3BO2A 3DRRB 2E1AA 4ZVEA 2DGOA 1TL1A 5KOXA 5F8JA 5KQDA 2D0AA 4U8VA 1TMMA 1RBLA 2KKZA 2DH7A 1NMDA 2P9UB 4NI2A 1FTRA 4KPCA 5BR8K 3G9CA 3SV4A 3K0JA 2ZBPA 1EZZB 4YB5A 4N8OA 2GMJA 1VIXA 4JI5J 1WSIA 3JSMA 2X3DA 2HHUA 4ZMMA 1PGZA 3PXGa 3E3XA 3CCRN 3AODA 3GE1A 4CT8A 5M1PA 3K58A 4NCGA 4KGMA 2O8EA 3GCWP 2QLWA 3R5CA 3SSQA 3F9KA 1FEHA 4NLWA 4ECQA 2RH3A 3DAWA 2MJNA 2DO0A 1LAWA 2QL9B 4CM2A 3L8BA 3CHWA 5KG2A 1RI7A 5EX0A 2B6AB 2ATCB 3TEGA 3V4IA 1ZM9A 2XYPB 4I1TA 3ZT1A 4BHQA 1WB9A 3PR4A 3DM2A 5F9NA 2C42A 3PG9A 2HQFA 4BACA 2J6UA 3PW0A 3MEDB 4LSZB 2X1BA 4A61A 3R5JB 3QSYB 4CEOA 3TUPA 3ISNC 4DV1F 3MM9B 4L3QA 3QNNA 1LK7A 3D0HE 4XPCA 4YHHJ 5GADP 2KFNA 3DXMA 4P9SA 3OJUA 2OPRA 4LSLA 3H6EA 5AZIB 1XNQJ 3QNWB 2V8GA 2B56A 3M8WA 2I2YA 3KYLA 3JS9A 4ZCMA 2Z2LA 4K50A 1EX8A 1WSVA 1S1WB 2FVCA 5LMUK 4C48A 5HBMB 4HHTA 2B7BB 2K3IA 4IJAA 4Q8EA 1XWLA 1RB0A 3O3LA 1Y5LB 5BREA 1FRXA 3OHAA 3VGMA 4KGVB 3Q0AA 2YQ3A 3HOTA 2Z8QA 4YOXA 4OLBA 4C8ZA 2FYXA 3L2WA 4E7KA 3NH2A 1OQ3A 3PLAA 2LCWA 1K47A 1VHIA 2HBZB 4OZLA 3IUCA 1XR5A 3PACA 1OO0B 4F8RA 4X66K 4DV0K 1ZM2A 4U6PA 3CD6N 4ZPTR 2HNDA 4D3GA 2AU0A 5KT3A 2F8SA 1REVB 1PBAA 3KK3A 5FROA 2W2QP 1A0OB 1UVIA 3D2FA 4XK8C 2J8AA 1S1XA 2VG6A 1NK0A 2W8LA 4CJVA 5C15A 2H9ZA 2HS0A 5BR8J 2R8JA 4FJNA 5HMZA 4HACA 1HYZA 2DR5A 2ZH6A 1HWJA 3D2EA 2X78A 2UXCF 3X1LB 2HBQB 4IFEA 4HWIA 1UEUA 1WLJA 5HP1B 1HWLA 5KFPA 1C0UA 1VQPN 5AE2A 3CJCA 3U3YA 4WQ5A 1Y00A 4NLGA 5AQJA 3W66A 4U9RA 7AT1B 1IN0A 4MK7A 3OFHA 2PFFB 3D3BJ 2PI4A 3C6TB 2LA4A 3V4MA 2IRYA 3O5BA 1HIYA 2K7KA 2RHSB 1TK0A 3NRBA 4LFBK 3CJQA 1XC3A 1T9XA 5DRKA 4BE1A 1S57A 2ZGYA 2FVPA 3CQYA 3MUMP 2DTJA 3DYAA 4DFPA 2BJ9A 3QZ8A 3BQ0A 2HNZB 4QZVB 4R79A 2A41A 2HLUA 4JI1K 5J1EB 2I6WA 2ROEA 5FPDA 1BQMB 1U26A 4NEZA 5AQOA 3VAFA 2XMWA 1XI1A 3ZSXA 3UD5A 3MAHA 2QG9B 4YQWA 3RWUA 4BC3A 5K8NA 1NDCA 3MXJA 1SIWB 4DN0A 2V8PA 4OX8A 5J2MA 4ECSA 1V5VA 3EE8A 5LMUJ 1IKWA 2ASOA 3QBWA 4ZN3A 3AA2A 2W01A 4IKAA 4FYVB 2GUIA 1WTFA 4AL6A 3MN9A 4W5TA 5L1JA 2HG4A 3TW0A 5KFMA 4Y65A 1T03B 1BQNA 3I8DA 3D0IE 3Q89A 3ALYA 3V6DB 3BQ2A 3CCQS 3A2FA 4CJ3A 1RWKB 1BD6A 2BACA 3DLEA 4J9LA 3A1YG 4DV0J 4X66J 2Z1HA 1R59O 2CGJA 4DTOA 3T1YF 2JWNA 1Y0HA 3BO3A 4P2SA 4ZPAA 4F36A 1WHXA 3MWPA 3AVKA 3JQKA 1Q81O 1WKJA 4DV2F 2H5EA 1E4GT 1RAGB 4UT4A 3NL0A 1HPZA 4LR7A 4OHWA 3ELHA 3MEGA 4XH1A 1D09B 4YOEA 3G25A 2QA4N 4F50A 2LQJA 2ADBA 1ULRA 3R97A 2E2QA 3ZETB 1S7IA 1UJ6A 4J2DA 5HMWA 2HS3A 4A8SA 4GV6A 3N28A 1IWAA 4LY7A 1SCJB 1CJUA 1VC5A 1SIZA 5A0YA 1F60B 1VQ4N 4LD0A 3I87A 1XC9A 2YBVA 2EEYA 3HDSA 2KH9A 2V34A 2P9IB 2OJ3A 2OEMA 2UV8G 5KFKA 2R7RA 1BWVA 4CEQA 4B08A 4LFBJ 4EZ6A 2B4OA 2QLBB 1D8ZA 2QM1A 4DI6A 4DXLA 1JXBA 2F40A 2UXBK 4H5WA 1QLNA 3NXZA 3QIDA 3RW7A 2DFFA 2UXDK 4P7VA 4M1KA 4JI1J 2GTDA 4B1VA 3H4BA 3M32B 1R8HA 2GAGC 1MA9B 2M9KA 2VJUA 3AO4A 2CQ1A 1HD0A 1RLCL 1NJZA 3TA0A 4WWSA 2H1YA 1ELOA 5T7BA 2O8CB 3ZNJ1 2D3ZA 3X3UA 1QAIA 1K8KA 2FF3B 5KFRA 4B3MK 1K73O 3PW4A 5IV3A 3U1NA 1VI7A 3FSYA 4ED3A 2KVQE 4WBFA 1BXNA 2DGTA 1J9AA 2BMBA 1YBAA 3J7Z5 3H98A 3E9PA 4OZ0A 3AJ1A 5AQHA 4RNHA 3CPEA 4J91A 3AVFA 3DRYA 1FX4A 4NLCA 4RW7B 1U25A 3EJMA 3EE9A 4JNEA 1LOTB 1RKIA 3RMDA 4I9LA 4IKFA 2HS4A 5CZ2A 2CPEA 3HD1A 3ONQA 3FFKB 4BE2A 3WQPA 4YP3A 5E5NA 1F0XA 1W0HA 2DY4A 3FCVA 1LXJA 2C2DA 4CF9A 3G8TA 3I4PA 4H4OA 3GQCA 5IQQA 1T94A 4CJKA 4QJVA 1Q82O 1ZBIA 2QJ3A 4OZ3A 3DMJB 1WDTA 5F2RA 3BZKA 1VQ9N 2P8IA 3AAWB 2LFVA 4Y3CA 1NGAA 2O8DB 3D7EO 2Q0RA 3UQSA 5ADZA 1R8BA 1U02A 4WZMA 2DGUA 5JLHA 1EARA 4HCBA 3D1QA 4O5BA 1F2GA 3MPWA 4FWKA 4I2PA 2FC9A 4Z7CA 1Z1ZA 3UWTA 5KFTA 1WEZA 3NAHA 3LDLA 4BRIA 3FEXB 4XIUA 1A7GE 1VCTA 4BQZA 1S0MA 4O3NA 1DLOB 4K5RA 4CI6A 3J7AP 4M3RA 3L2UA 5B0CA 3QICA 2AEJA 4P6QA 4I6MB 1Y3KA 2QLXA 4A5AA 4DR7F 2XWXA 5G4DA 2WSFC 1RTJA 3EZOA 1RBOB 3RGIA 4A8QA 4M3YA 1UZDA 4OV6A 2LXIA 3DDKA 3CJ7A 2ZDOA 4JKDA 3I5CA 3B54A 1KD1O 1RU2A 1HQUA 2UXBJ 3GV8B 3WNEA 3TQEA 3O8MA 4WJBA 1XR6A 4KGZB 3UR0A 1H1VA 2UXDJ 3OYIA 1CC7A 3F5TA 3NE6A 1VFJA 2FXUA 3WT0A 4MIAA 3LPUA 5CYJA 3EN9A 1KD1T 1NUEA 4CFDA 1YJWN 1GQEA 2DVIA 4RBUA 3ZT2A 2PY5A 2KT3A 4DL6A 4B3MJ 4C6AA 3WXKA 1BDGA 5ETTA 2KXFA 4GNIA 5HAOA 4AE5A 4PG6A 3P3DA 3FR0A 2CAJA 1F5BA 1UWBA 4BRGA 4CJLA 4NLTA 2ZBCA 2FY1A 1RFQA 4DFMA 2F8EX 4J37A 1H7XA 4RW6B 3HT0A 5C12A 4CLSA 4EK2A 3NOCA 4X4UA 1VQMN 4IO9Q 3GWCA 5G0RB 4DDFA 5D77A 2MEWA 1XHZA 4I56A 4ICLA 4CDIA 4KO0B 3M1VB 1UVMA 2NRWA 4BRKA 4LR9A 4OKJA 2YWWA 1H72C 1CG2A 4DTUA 1NZAA 4A62A 1NG9A 2YNHA 2VV5A 3G96A 1QSLA 1K1SA 1SPBP 1ZPVA 3E8OA 5LOQA 5HRPA 2HLTA 1EP4A 3C14B 3W3SA 5HJYA 1BY9A 3A3NB 3W62A 2MYFA 1ATSA 1HQEA 3CPWR 2OTLS 3JSYA 3PUFA 2KHDA 3GJSB 2FUG9 1FJ7A 3DLKA 2E7XA 4FNIA 5E41A 5IC6B 2KLAA 5DDOC 1HHSA 1HBUB 4URGA 4ED1A 3T5KA 1YVNA 3QIPB 2XZTB 1RISA 5L38A 4B02A 2P5GA 1E6YB 2ZDPA 3LPTA 4X4PA 1P8ZA 2HBYB 1M1HA 3CIMA 3M1FA 4JKCA 4YDUA 1T02A 1A6LA 1FFGB 4IRKA 2KJWA 1CJTA 4EI2A 2I38A 2MKYA 3ID6A 2B4PA 3CO9A 3ZSZA 4CYUA 2P9PB 2HHSA 1KQSR 1EO1A 4J9U