2B6AA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with thr-50
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase p66 subunit
publication title Crystal structure of HIV-1 reverse transcriptase (RT) in complex with THR-50
rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 136
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b6aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b6aA05
1LAWA 1J53A 3T5LA 4RW8A 3B6PA 1TAUA 3CFPA 2FVCA 2XHBA 2YKMB 3KLIA 4CHOA 1C1BA 1UA0A 3DLHA 2WRMA 4K4YA 3AA5X 1MMLA 5KFOA 3I8DA 4AHUA 4DF4A 3N6MA 4J2AA 5KFIA 2UVRA 3MXJA 3QINA 2FJWA 3OL9A 3TAMA 4HUEA 1WAFA 3HPGA 2HWIA 2J6SA 4U6PA 3A2FA 1T05A 5J2PB 1T3NA 4RNNA 1TGOA 4RUAA 3T1AA 3PW0A 4LSNA 4WFYA 3GV5B 4JV2A 2JEIA 3AO5A 3RBDA 4NLRA 3MFIA 1L3VA 3I0RB 4NCAA 5L1IA 4CK2A 4CGJA 1NK9A 1ZBIA 2AWZA 2YKMA 4Z4CA 1X9SA 5KFJA 1HQUB 1O1WA 4Z4FA 4IH7A 4FVMA 2GBZA 3SV4A 3T5JA 5J2MB 1ZBLA 4E89A 4AH9A 2ATLA 1LWEB 1TKTB 3BSOA 5J2PA 2HB5A 3NF6A 2OPSB 4LQ3A 3OYEA 2W9BB 3ICLA 4M45A 3O3FA 2V9WA 3LP2B 3CJ3A 2F8EX 3CFOA 3QEXA 3KIOA 3I0RA 4DTJA 1WNSA 3JYTB 3NE6A 3MECB 4DL4A 4AHSA 1S1TB 5F8NA 3OS0A 5C24B 5KFZA 5KFNA 4ECWA 1HQUA 1GX6A 4Y2CA 2C2RA 3VA0A 4TY9A 4QWDA 3KLVA 3OL7A 2A1RA 5J2MA 5FROA 2HAIA 4IG3B 3V9UA 1NKBA 3SUPA 1LWEA 4CF2A 1TKTA 3KHGA 2WCXA 2OPSA 3HXMA 2W9BA 1JLBB 3LP2A 1VSJA 3ZSZA 2RPIA 2R8GA 1VSIA 3T5HA 1S6PB 3E51A 4F4ZA 1XHZA 4B9MA 3JYTA 3VQ8A 3MECA 4EBCA 1TP7A 2XGPA 3O4NA 1S1TA 4IDKB 5C24A 3PR4A 4Z0UA 3F73A 2X74A 4FJJA 2R2RA 3H40A 4EYIB 1VSLA 3DOKB 1TK0A 5KFAA 4F4XA 2EC0A 3NKYA 2QKKA 5KFCA 1JX4A 1N5YB 4IG3A 5KT6A 4TXSA 1Q8IA 4C8MA 4CJ5A 5C42B 1DTQB 1DTTB 4IG0B 3OSNA 1JLBA 4YP3A 3Q8RB 3AVHA 3ZCMA 1XHXA 3AVFA 5KFMA 4E7LA 4ED1A 4HKQA 5FRMA 1S6PA 4LQ9A 4NRTA 4CGFA 3KHRA 3P5JA 4IH5A 4IDKA 2AGPA 4E1MA 1RDCA 3HP6A 3FFIB 2BQUA 3DOKA 2KFNA 4JV0A 3VQ9A 2J6UA 1N5YA 3OL6A 3SYZA 1N48A 4Z4EA 4CJ3A 5T14A 3CDUA 4CERA 2ASDA 4CE9A 5C42A 1DTQA 1DTTA 2ILYA 4IG0A 3H2LA 4K4UA 3NBPB 1K6YA 3RMDA 1TKXB 4YMEA 3MEGB 4R8UB 5KFWA 3SV3A 3V1OA 3K5LA 4DEZA 4FLYA 3FFIA 4Q44A 1VRUB 1XR7A 1QTMA 4BWMA 1C0MA 1KCFA 4ZTFA 4CECA 3NFAA 4F3OA 4RG8A 4Q43A 1N56A 4IRDA 3ZSRA 4QCLA 2BANB 1W25A 3RAXA 1Z25A 4JS5A 3TQ1A 2P5OA 2IBKA 3KD5E 4CFBA 3DMJB 3PHEA 4J9MA 3NBPA 2QK9A 2G8HA 1NOYA 1WAJA 3V1RA 2FBXA 2C22A 1XWLA 1QHTA 1TKXA 5J2NB 3MEGA 3T3FA 4R8UA 1RYSA 4JUZA 1HQEB 1WSEA 2IMWP 4EBEA 3DI6B 4DQIA 3V9XA 4J9OA 2VG5B 4K8ZA 1VRUA 4FLVA 5KT4A 4JRQA 2HHSA 3KJVB 1S1VB 1RT6B 4E3SA 3QZ8A 4ICLB 4Y1CA 2WOMB 4IFVB 4PWDB 1VK0A 1YVFA 3V1QA 3VQSA 1S0OA 4GW6A 1S10A 1YVUA 2BANA 5KFTA 4E19A 4QW8A 1WLJA 4O44B 4ED3A 1G15A 4BDZA 5F8IA 4B9TA 4J9KA 4OLBA 3DMJA 1JL1A 3CM6A 4TQRA 4DL3A 4Q5VA 3KLEB 5J2NA 3NH0A 1HQEA 2RF2B 2E6LA 4KI6A 3V6KA 1S4FA 3DI6A 1CZBA 3RR8A 3D28A 2VG5A 3HYFA 2KTQA 4IRCA 3UR0A 3TAFA 1FK9B 2UUTA 4J9NA 2X6NA 4FM2A 1CXQA 1RDBA 3KJVA 1S1VA 1RT6A 3SUNA 5T7BA 4PQUB 2OYQA 5HRNA 4ICLA 2WOMA 4IFVA 4PWDA 1IKVB 2XO7A 1U04A 4W5RA 3AO2A 4CGGA 1HJRA 4O44A 4M41A 1RTIB 3L3UA 4OGEA 1EETB 5CY4A 1NJXA 4HCBA 5F9NA 4FW2A 1L3SA 3KLEA 1Y97A 1C0TB 2RF2A 3N6NA 1S9EB 3L2VA 4X2BA 3GQCA 4NLUA 2JC0A 1FK9A 4CF1A 2HHQA 5F8HA 3CJ5A 1T94A 4PQUA 3SNNA 3MR6A 2DFFA 1IKVA 4J2EA 4ZMMA 4KPYA 3VA3A 3TARA 3KD1E 3BSCA 3UQSA 1RTIA 4F50A 3DRSB 2JC1A 4HYKA 4N5SA 1RBVA 2AX0A 1EETA 4NRUA 3QEVA 4M3XA 3LP0B 3ZT3A 1RA6A 4FK2A 4DS4A 3DLEB 4MFBB 4Q8EA 2XRIA 2ITGA 2HNYB 1C0TA 3SQ1A 3D5MA 4M42A 1S9EA 1ZETA 3AVJA 4JS4A 4M3WA 3TVKA 3PR5B 5K14B 4EYHB 2AU0A 4RNOA 3JSMB 4OKEA 2AGOA 3GIKA 3I5AA 1Q9XA 4CJKA 3ZSQA 3ZSXA 4H4OB 5KFSA 4CESA 1NJWA 4B9NA 3DRSA 3MR5A 5KFXA 3L2QA 2E9RX 4ZP9A 3C94A 4Z4IA 2W9CB 1N4LA 4N41A 4O3PA 4JLHA 3LP0A 3DLEA 5DQGA 4IRKA 3SZ2A 4MFBA 4K4SA 2HNYA 2YHAA 3AVNA 4J9SA 3IG1B 3OHBA 4AHCA 4W5OA 1U45A 2JEGA 3ZSWA 3DYAB 2FBTA 1S9GB 5K14A 3GILA 3PZPA 5I42B 4HCCA 4LY7A 4JRPA 3RWUA 3JSMA 2VA3A 3PW4A 4CJ4A 1S1UB 4NLVA 4ZPAA 2DPIA 1SKSA 1IO2A 1J9AA 3ALYA 2WB4A 1CZ9A 5KG7A 5KRSA 2FLLA 4YR0A 2R8HA 3NH1A 1NJZA 3CJ2A 4H4OA 1NHUA 1NHVA 3QLHB 1HYZA 4DMNA 4CF8A 1HYSB 1C2PA 2W9CA 2UVUA 4CFCA 3PX4A 5EWEA 3H4BA 4BE2A 4IBNA 3RTVA 5EWFA 3BQ2A 3QESA 5HP1B 4F3TA 3IG1A 4CJFA 2R2SA 3L2WA 2Z1IA 3DYAA 1S9GA 3O3HA 5C5JA 4FZZA 5I42A 5CYMB 4M95A 1S1UA 3OSPA 4DSFA 1BQNB 2W8KA 4MK8A 4N76A 1LWFB 3TAEA 3T19A 4DQRA 4M94A 1REVB 1RDRA 3CG7A 3CQ8A 3QLHA 4CHPA 1HYSA 2IM2A 4CGDA 4QWEA 3V81B 2D0BA 3THVA 1U49A 5DQHA 3VQ6A 4H8KA 1D0EA 4FJ9A 1T05B 5HP1A 4GC7A 4DTRA 4O4RA 2VWJA 4O4GB 1JXEA 3KMQA 3LWLA 5CYMA 3N6LA 2CJQA 2V4QA 4DSKA 1QSSA 5KFYA 1BQNA 4CJPA 4J9LA 4H54A 1KLNA 1LWFA 2ETJA 5HRSA 3BR9A 3Q8PB 4QPXA 3KK3B 3BQ0A 3H5SA 2W42A 2XY5A 1REVA 4FJGA 3CJ4A 1RNHA 3CDWA 1I3AA 3M8PB 4WFXA 3V81A 1MU2B 5KG4A 3OYDA 3UPFA 4QWAA 4F4YA 4EO6A 3M8QB 5KFBA 4DLEA 3PW7A 4CEDA 4FW1A 4O4GA 4I9LA 5L1KA 1A5WA 4FLXA 2KW4A 3H59A 4FXDA 4NLDA 3BGRB 4J9PA 1U48A 3DRPB 4CJLA 2XWYA 4BWJA 3M9NB 3EZUA 4DFJA 1TQLA 3KK3A 4NLTA 1BQMB 4KTWA 4M3TA 3V6DB 3PO5A 2F8TA 3HSTB 4Y3CA 4G3IA 3HJFA 3CIZA 3M8PA 3AA4A 3AVGA 1BIZA 3K58A 4CJQA 3WNEA 1C6VA 5L1JA 3L2RA 1MU2A 4NLGA 3RMBA 5KGXA 3FSIA 3ZSVA 3RB4A 1JLQB 3PJWA 3NF9A 3RR7A 3M8QA 2Z1GA 1SH2A 4NYFA 1BGXT 4K50A 4FJIA 2XC9A 4FJKA 4HTUA 2KFZA 1IM4A 4RZRA 1J54A 1K1SA 5DLGA 2Y1JA 1A5XA 3BGRA 4TYAA 2G8UA 3PY8A 3DRPA 1Z4UA 1WSGA 3Q8QB 3QNOA 4EP4A 1BQMA 4FLTA 4FJXA 3V6DA 3TI0A 3TAGA 3PVXA 4G1QB 5F8JA 3OYJA 2F96A 3KHLA 1CSJA 3OVNA 1JLQA 1Z26A 1ZTTA 2WTFA 2GV9A 4CEQA 1L3UA 1XC9A 1T7PA 4MK9A 1S48A 3BREA 4O0JA 4CEAA 1C1AA 4KV8B 3CFRA 1XR5A 4W5TA 3KLGB 4DF8A 3CJ0A 3TAQA 1NK5A 3D45A 1ZBUA 4ZVFA 4WZMA 2FJXA 4WYWA 3OYHA 4FJMA 4EBDA 2Y1IA 3KLFB 3HK2A 5KT5A 3LZJA 4TQSA 4ZP7A 3OL8A 5KFRA 4G1QA 4B08A 4KI4A 2DY4A 4TLRA 3KLHB 4IQXA 4FBUA 3RRGA 5F9LA 4QAGA 3M9OB 4XPCA 5KFVA 5KFPA 4IOBA 1SL2A 2I5JB 1OS5A 2XI2A 3FDSA 4R0EA 3P1GA 4OKKA 1BCMA 2FLPA 3QERA 4KV8A 5CZ2A 3U6FA 4EZ6A 2FVPA 3KLGA 2ILZA 3NGIA 3MTKA 5KT7A 3PX6A 3HO1A 4CJUA 2IOCA 4XO0A 4FJHA 3F9KA 3OYMA 1HYVA 4BACA 4B8CA 3SJJA 1EXQA 1K1QA 1JLFB 3KLFA 5JS2A 2BRLA 1S1XB 1IKWB 2X78A 4YR3A 2G8FA 1RBTA 3KLHA 4F2SA 4FYDA 4M3YA 5JUMA 3RRHA 4Q0BB 3VQQA 4ECUA 1X9MA 4CHYA 2D3ZA 1S0NA 4Q45A 2HHXA 2R8IA 2V0NA 4J9RA 2I5JA 3SCXA 4CHZA 4ZVEA 2Q3SA 2Z1HA 4DG1B 4U7CA 4MH8A 3G6YA 1ZBHA 1ZYQA 4F4KA 3VN5A 4OVLA 1JXBA 4B9VA 4ED0A 5EU7A 2VG7B 4IR1A 1NKCA 2YNHB 1GOBA 3QIPB 3M9MB 1JLFA 3H98A 2ZKUA 2W7OA 2G8IA 3DLGB 3LAMA 5KT2A 3OY9A 4OL8A 1S1XA 1IKWA 4RW7B 4RW4B 1TK8A 3VQPA 1NKEA 2JGUA 3HPHA 3HVWA 2C2EA 4Q0BA 1KHWA 3HVAA 4C8KA 1D8YA 4CEZA 2KZZA 3QO9B 3I5CA 3QIDA 2HHVA 1VSFA 3LP1B 2FJVA 3L8BA 3NH2A 3MR3A 4FLZA 2WHOA 1S97A 1CXUA 3H5UA 1WSIA 4URQU 1SKRA 3V9WA 4DG1A 3WNGA 4RW6B 3DRRB 4NYNA 2R2TA 5KFDA 1JLCB 2VG7A 4URGA 4M3RA 4I2QB 2OZMA 4ELUA 2YNHA 2DFHA 1QUVA 4FJNA 3QIPA 4KHNA 3I5BA 4DTXA 4PA1A 3DLGA 2VA2A 4ECYA 2IAJB 4RW7A 3WNFA 3KMSA 4RW4A 4AHRA 2JEFA 3SFGA 1RTDB 4QW9A 4DTPA 2YHBA 1SH3A 5F8LA 2Z1JA 3QO9A 2E9ZA 3RMAA 4ECXA 1HNVB 1XR6A 4MKBA 4KHQA 2FBVA 3LP1A 3MXIA 4KRFA 3CYMA 1DLOB 4IKFA 4CGHA 4DWIA 4RW6A 4LH4A 4DLGA 1KVCA 2HMIB 3DRRA 2PZSA 1RILA 3T5KA 1JLCA 3U3GA 4I2QA 4CEFA 1X9WA 1D9DA 3CVKA 3QEIA 3G0ZA 3EZ5A 1S1WB 4IR9A 3ZSOA 3S9HA 2IAJA 2XY6A 4OLAA 3HT3A 1RTDA 3AVCA 3ZT1A 1IKYB 2O4GA 4BE1A 1TV6B 3G6XA 4ZPCA 1B9DA 1RTHB 4OPKA 2X6SA 1HNVA 2FBYA 4C8NA 5KG3A 5KFQA 3OYGA 3E01B 1DLOA 4W5NA 3HKWA 1NK6A 4FM0A 1S0MA 4WFZA 4GMJB 2HMIA 4DTNA 5HRRA 4ZP6A 5C25B 1U47A 1S1WA 2YNFB 3ZSYA 2R7YA 4FZYA 2RDJA 3PV8A 2G8WA 5KFHA 2D7SA 5F8MA 3G10A 2PY5A 5KFEA 1IKYA 5HLFB 1TV6A 4ZVHA 3PX0A 4B3OB 2IS3A 1RTHA 3G6VA 3CDEA 3MEDB 1RAJA 5CYQB 4KE5A 4CIFA 4OPJA 3QETA 4ZVGA 3E01A 3KK2B 2VG6B 4DTUA 2JEJA 3OYLA 4TY8B 4JV1A 3KTQA 4C8OA 4E7HA 4K4VA 1FKOB 1NNDA 2O4IA 3DOLB 5C25A 1RBSA 3PJXA 2YNFA 5DGBA 3OLBA 5I3UB 3ZT4A 4DU3A 4RW9B 2ALZA 3VQBA 1SV5B 5HLFA 4FS2A 1J5OB 4NZ0A 4B3OA 4DSEA 3NL0A 1JLGB 3C6TB 4ECSA 2OPQB 5JS1A 2FLNA 3MEDA 3CO9A 3AVBA 5CYQA 3G86A 3ZT0A 2CKWA 3NAHA 4J9QA 1QAIA 2XY7A 3KK2A 1ITGA 3K5MA 3LANA 2VG6A 3OHAA 3MFHA 2E6MA 2OH2A 4TY8A 1KTQA 4K8XA 1VSEA 2HVIA 4R5PB 1FKOA 3AVIA 1D1UA 1RT3B 3DOLA 3GIIA 4Y1DA 4CJVA 3HHKA 4OGCA 5I3UA 3EPGA 4WYLA 1ASUA 4WZQA 4L8RB 4RW9A 4EP5A 1SV5A 3LALA 1J5OA 4DU4A 1JLGA 4NLPA 4CJRA 3C6TA 1LW2B 3QNNA 4GVMA 2OPQA 2BRKA 4NLOA 4B9LA 4DFPA 5DK5A 2P1JA 4MKAA 4PUOB 2KQ2A 1QSYA 4M3UA 3S3OA 2QV6A 4NLYA 4K4XA 3K59A 4E7JA 4R5PA 3OYKA 5EDWA 1R0AB 1BL3A 3AVMA 1RT3A 4AHTA 2FVSA 1SL0A 2ASJA 4KTZA 3QZ7A 4HHTA 3V6HA 1TVRB 5DLFA 2FVRA 3K57A 2D0AA 4TSXA 3NCIA 4OKJA 2J6TA 1WSJA 3HL8A 3NF7A 1RT7B 1LW2A 1KLMB 3OYIA 2IJFA 4DSLA 3RB6A 4C8LA 4I9QA 4E0DA 3H4DA 3RB3A 4PUOA 2RKIB 1ASVA 4HUFA 4FS1A 3QGIA 1Q9YA 2NUBA 1R0AA 2WK4A 1NK7A 1QS4A 2PYLA 1RT2B 2IM3A 3QGHA 1TVRA 5F8GA 2P51A 4ECQA 4NCBA 3IN5A 4XPEA 3QGGA 3RAQA 1RT7A 3ULDA 1KLMA 3ASMA 4ID1A 4ZHRB 4FJ7A 3RMCA 4NLXA 1D9FA 2ATQA 2RKIA 1KVAA 3VQEA 1EKEA 2D5RA 2HHWA 3M8SA 4F4WA 1KFSA 4IFYB 1GOCA 2BGGA 2EX3A 3D0PA 2AJQA 3MF5A 4CJEA 5FRNA 4MK7A 3AVAA 4CFAA 1RT2A 3GYNA 4W5QA 1BCOA 4FM1A 3OYCA 5KGWA 3OYBA 3PO4A 1HARA 3UIQA 4LD0A 2HHUA 4TN2A 3RBEA 3BJYA 3KK1B 3Q8SB 4ZHRA 2UVWA 4FCYA 1SH0A 4KAIA 3SPZA 3IS9B 3SQ0A 2GC8A 4B9SA 3FQKA 4IFYA 4YR2A 1WSFA 3HVTB 1BIUA 1IG9A 1RTJB 1W9HA 5SWMA 3QEWA 3OYAA 3H5YA 3K2PA 5D3GB 4CK3A 1TKDA 1SKWA 5J1EB 2YV0X 1HPZB 1UAXA 3BSAA 4ECTA 3DM2B 3NDKA 5KFGA 1LWCB 2A1SA 1QE1B 1RT1B 2JLEA 3KK1A 3QIOA 4IKAA 5HBMB 3TANA 4KB1A 1UOCA 3LPUA 1YT3A 3CM5A 2BQ3A 4ZPDA 3NF8A 3VQDA 3IS9A 4KHSA 2QE5A 3IGNA 4KBIA 1HNIB 1JIHA 3HVTA 3SUQA 1NJYA 3O4QA 1RTJA 4BE0A 3SI8A 2V4RA 4N56A 2E9TA 2B6AB 5D3GA 1RYRA 4CFDA 2PYJA 3BDPA 4TYBA 4O55A 4E7KA 4O5BA 4NLSA 4O3RA 5J1EA 3NAEA 2UVVA 2W9AA 1HPZA 5KFKA 3RB0A 4FLWA 4E7IA 3DM2A 3S3NA 2C2DA 1LWCA 2DFEA 4EZ9A 2YKNB 4I7FB 3OLAA 1QE1A 1RT1A 4KO0B 1L3TA 1RBRA 4FBTA 5HBMA 1TKZB 1KRPA 2HNZB 1FKPB 3B6OA 2FC0A 2XCPA 4CEEA 1RT5B 2C28A 1NK0A 1HNIA 2XCAA 1VSMA 1VSHA 2ZQBA 3I0SB 4WXWA 2O5DA 4YNQA 3IAYA 3OS1A 4RUCA 1X1PA 3KKSA 5J2QB 2QKBA 1BHLA 4OJRA 4O3OA 2B6AA 3TABA 1VSKA 1TL3B 3FQLA 1U4BA 1JKHB 1SL1A 4RNHA 3V9ZA 1LW0B 2YKNA 4I7FA 4KO0A 2BR0A 4QWCA 5HROB 1TKZA 4FK0A 1TL1B 2HNZA 2LSNA 1FKPA 5DG7A 4FJ8A 2IC3B 4NYZA 1HMVB 1RT5A 1LV5A 1JXLA 2UUWA 2G8KA 3MXMA 3KNAA 3I0SA 4YQWA 2BDPA 4KTQA 4DQPA 4KHRA 2G8VA 3AVLA 5J2QA 1F21A 2DTUA 5DG8A 4AHVA 3SQ2A 3LDSA 1BISA 4ECVA 1TL3A 1S9FA 4KFBB 4LH5A 1JKHA 3KHHA 3C6UB 4O3QA 2D3UA 1QAJA 2B43A 2GIRA 2BQRA 3V4IB 4YFUA 3O3GA 1LW0A 2OPRB 3NAIA 4MIBA 4KHYA 4I2PB 1GX5A 2DPJA 3BQ1A 4H4MB 3MAQA 4CIEA 3KOAA 5HROA 3H08A 4HUGA 4Q8FA 3EPIA 1TL1A 3VQCA 1KVBA 3OJSA 4GC6A 2IC3A 4WE1B 4CEBA 3SQ4A 1HMVA 2BE2B 4DTSA 4EO8A 4KKOB 4XIUA 2IM1A 2YNIB 3HP9A 2FVQA 2HWHA 2ZE2B 4Z4HA 4F8RA 4J2DA 4KFBA 3BSNA 3V9SA 5KI6A 3SFUA 3LPTA 4IH6A 3C6UA 4N47A 1IH7A 5KFLA 3V4IA 4BDPA 3DLKB 1S49A 2OZSA 4HVJA 3WNHA 3DLRA 4FZXC 2OPRA 3CWJA 2D41A 4KHUA 4I2PA 1T03B 1KFDA 1FXXA 4MIAA 4H4MA 2R2UA 4RNFA 4M3ZA 3AVKA 4ZP8A 2ZD1B 4AILC 4FLUA 4CK1A 4ZPBA 1JLEB 2HNDB 4CJSA 2HW3A 1C0UB 3IRXB 2AQ4A 3ISNC 3NGZA 4WE1A 2OPPB 3GV8B 2BE2A 1RCHA 1TAQA 4KKOA 4KSEB 3OS2A 4DSIA 4CIGA 5DGAA 1SUQB 4Y34A 2YNIA 5L1LA 1RBUA 2ZE2A 1TK5A 3C95A 3SPYA 4J2BA 3UDLA 5KG6A 4CJTA 3AO4A 1N6QB 2HVHA 3HPOA 5KT3A 3HM9A 3NMAA 1C1CB 3DLKA 4DL2A 5CZ1A 4ED7A 2B5JB 2XI3A 5EWGA 1RDDA 1T03A 4DL6A 2ZD1A 2E4LA 4CJWA 2W7PA 1JLEA 2HNDA 3VQAA 2YNGB 1C0UA 3IRXA 2AGQA 2OPPA 4DL5A 1SUQA 1S5JA 3HVRA 4ID5B 3MEEB 4DS5A 5DQIA 4QWBA 3L3VA 3NGDA 3H5XA 4KHMA 1N6QA 3OYFA 4RNMA 4KAZA 1WN7A 2AX1A 2IJNA 4FK4A 1C1CA 3EYZA 2B5JA 1KSPA 1JLAB 4DFKA 2D0CA 3K5OA 3SUOA 4URSA 3NGYA 3ZT2A 1A5VA 2P5GA 4CCHA 1NOZA 4UQGA 4NLQA 4KB7A 3M8RA 4DFMA 1NK8A 2YNGA 4O3NA 4DTOA 3K5NA 2IA6A 4BDYA 3PUFA 1LAVA 4CF9A 4QOZB 2KZMA 4EEYA 4ID5A 3MEEA 1UA1A 5KG0A 5L9XA 1B92A 3ISND 4O3SA 4CEOA 3KKRA 1EP4B 1BI4B 2I1RA 4ED8A 2HHTA 3AA3A 3VQ7A 3VQ4A 4E1NA 3LP3A 1S6QB 1RT4B 1JLAA 5KFFA 5DG9A 1UWBB 1HRHA 3LZIA 5KRTA 3SI6A 5KTQA 4RU9A 3NHGA 4DU1A 5HRPA 1XI1A 5JXSA 5E41A 1ZBFA 4PY5A 1RA7A 4DSJA 3PW2A 1EP4A 1BI4A 4ECRA 2R8JA 4CHQA 3TAPA 1CLQA 3MR2A 1T8EA 1S6QA 2IDOA 3OJUA 5KG2A 1RT4A 3AV9A 1QQCA 1UWBA 4LSLB 1B9FA 5KG5A 3AO3A 4KB0A 1I6JA 4ELTA 5FDLB 1IKXB 1EX4A 3QEPA 3PW5A 1QSLA 4F2RA 5EUHA 1I39A 4K4ZA 5KFUA 2IM0A 3TR8A 1ASWA 4KHWA 4ED2A 4Y2AA 1YTAA 2IGIA 1D5AA 4O0IA 2W8LA 4ELVA 3V6JA 4FJ5A 4ECZA 2WONB 1VSDA 1WNEA 3TWHA 2EHGA 2XY8A 1RDAA 3L2UA 1GOAA 4FJLA 4DQQA 4LSLA 4ZTJA 1U09A 4Z4GA 1VRTB 3ITHB 1JL2A 5FDLA 1IKXA 4B9UA 3GV7B 5SZTA 3VQ5A 2ASLA 2GUIA 2B4JA 4K4TA 3S3MA 2XGQA 5DMRA 3U3YA 4NCGB 1ZTWA 4CF0A 5KG1A 3EY1A 1YTUA 4RW8B 3GIMA 1W0HA 3AO1A 3OYNA 3IGVA 3DDKA 1NK4A 3FRZA 2RN2A 3LWMA 3KLIB 2WONA 1C1BB 4MQ3A 1KHVA 2QXFA 3P83D 3QYYA 4KREA 4B8AB 3GIJA 4DL7A 2R8KA 3LAKA 1VRTA 3ITHA 4DQSA 2VWKA 2GIQA 2OA8A 4NLWA 3TAMB 4WXOA 4CGIA 4K4WA 3DLBA 4DTMA 4NCGA 4LSNB 1WSHA 4CHNA 2F8SA 3AA2A 1L5UA 4ED6A 2RDIA
chains in the Genus database with same CATH superfamily
1LAWA 1YITS 3D7SB 3SMPA 1TAUA 1KQKA 2FVCA 1LKZA 2FY1A 2IVYA 5D15A 5IOLA 1C1BA 4DV3K 2WRMA 3AA5X 3W2VA 1BA1A 3QMLA 4JI6K 3CHWA 5KFIA 3LM9A 5BJRA 1FJCA 1LQ9A 1PYSB 3D3BJ 2UYTA 2UU9K 3HPGA 2HWIA 1Y10A 3A2FA 1XMOK 5AQQA 5J2PB 1PYOB 4RUAA 4UT4A 1RAEB 1WHVA 4WFYA 3LTOA 4JV2A 2JEIA 5AXKA 3AO5A 3RBDA 1L3VA 4NCAA 3ZLJA 1NK9A 5BR9A 4LF8K 1REGX 4V19J 1HA1A 4Z4CA 1X9SA 3THPA 5KFJA 5HATA 3SV4A 2O8FB 1FWKA 4E89A 2HVZA 5J2PA 2HIQA 3W66A 3I55S 4LQ3A 4DUZJ 4M45A 4H5RA 2DXFA 3CJ3A 3CFOA 3FLCO 1IR0A 3AB2B 3H0PA 4EFAC 5KFZA 1WSVA 4LBIA 4E8UA 1WC3A 1PBUA 4J37A 3O8WA 2EKNA 1RKIA 3VA0A 3O5TB 2O8FA 1DZ5A 2QI2A 4DMZA 3KHGA 2C3UA 2F40A 2OLWA 2NXUA 3CCZA 4HTJA 3I8BA 2V5HG 1JLBB 2X1BA 3NNCA 4FF4A 2RPIA 1WOQA 3VGMA 4A48A 2DCUB 2YBVA 2OHDA 2YQ0A 1RWOB 2XEXA 3VQ8A 4NL5A 2XGPA 3GBTA 1IJFB 3PR4A 4JI4J 5LMNJ 1VSLA 3DOKB 4YY3J 2KDOA 1K44A 2EC0A 1EAYC 3NKYA 2Q6CA 4DV6J 5KFCA 5MLCV 1JX4A 4U67L 2B4OA 1VDHA 4TXSA 1VBZA 2E7VA 4K25A 1DTTB 1JLBA 4YP3A 3U1LA 3ZCMA 1XHXA 4ED1A 4LQ9A 4NRTA 4ZIWA 1NB7A 4CZGA 4WFAL 5IWAF 2HBMA 2MSTA 1K47A 4ZLJA 1RDCA 1Y11A 2ZWPA 1S22A 3FFIB 3DOKA 3FBEA 2M9KA 2KFNA 4JV0A 3DFEA 2ZDOA 5GIOA 4DOZA 3SBGA 3OL6A 1X9JA 2UUBK 3FCHA 1LNQA 4UY85 4DR5F 2ABYA 4DN9A 5T14A 4CERA 1GLCG 2ASDA 1DTTA 2ILYA 3IFEA 2GGPB 2JHEA 4K4UA 1Q81O 2A3JA 4IUFA 3P3DA 5KFWA 4Y65A 4NYPA 5D6GA 4ISFA 1KOHA 3FFIA 1XR7A 2NUUG 5BRFA 1C0MA 4LRDA 3NFAA 3N9UC 2J9DA 3ZX3A 4PXBA 4QCLA 2QA4N 1WD6A 3RAXA 2CH5A 2XBPA 4JS5A 1NU0A 1XUPO 3CPEA 1IBKJ 2GGPA 3PHEA 1P8GA 2DNRA 2BXJA 3MMAB 2FBXA 2C22A 3WZ0A 3FZMA 3GIRA 2R7TA 2ZC3A 4OJGA 1WSEA 4HWIA 2DBBA 2IMWP 2P6SA 2E1ZA 4DQIA 4J9OA 1QQMA 4FLVA 4DR7K 3MGJA 4IEIA 2HHSA 3KJVB 4USKA 1M0SA 4Y1CA 2Y0SD 2WOMB 2GX8A 4PWDB 5IQQA 2LFVA 3QSIA 1S10A 5KFTA 1WLJA 3WC0A 4O44B 3PNIA 4B9TA 1G15A 4BDZA 1RUSA 4ILJA 4WPAA 3CM6A 3CMAN 3MMAA 4DL3A 1RHMB 4Q5VA 2EFNA 3IMXA 2B4VA 2MHNA 4M5NA 2RF2B 3QPIA 4DV1F 1I94F 3HYFA 1FK9B 3JTPA 1CXQA 2K7KA 3KJVA 4F67A 3H1QA 5T7BA 2OYQA 2WOMA 4PWDA 1IKVB 2UUCJ 1QTNB 5HVHA 2DNQA 1G99A 2RU3A 3GDQA 3AO2A 4CGGA 4O44A 3NS5A 2YKQA 4M41A 1RTIB 2V69A 4CLUA 4JKHA 4HCBA 1JJHA 2VQEK 2ZZNA 5C2GA 5IT9U 1R0CB 2XYGB 3FBFA 1C0TB 2RF2A 3N6NA 5BYRA 4X2BA 5DRKA 3P4IA 4JK9A 2IJRA 3D7EO 1S57A 1UVNA 4NLUA 2ASMA 2JC0A 1FK9A 4GKKF 2HHQA 2E29A 3SNNA 3FBBA 1BQXA 1IKVA 3EDRB 4ZMMA 2ZHOA 2ROEA 3S41A 4WF9Q 1RTIA 5GADU 1HLWA 3WQTA 3DRSB 2AX0A 4DCHA 3QEVA 3LP0B 5E3QA 2VJVA 2YY3A 4FK2A 3DLEB 4PKHA 2QW9A 4GV9A 4Q8EA 2XRIA 2HNYB 1C0TA 4CO2A 4FDFA 4M42A 4DV3F 2HGLA 3AVJA 3CCVS 4M3WA 4ZCMA 3ZTOA 3ZEUB 3CCUN 1PSDA 4EYHB 1UTAA 1QLNA 2C1EB 3JSMB 4P9SA 4RNOA 5CABA 4BC4A 4OYIA 3ZSQA 2UV8A 4H4OB 4DR1J 4WYBA 1NJWA 4FN5A 4ES1A 4ZJLA 3DRSA 3L2QA 4ZP9A 4LF9J 3C46A 3H45C 4OZ5A 4O3PA 1H98A 3LP0A 2DCLA 4FOIA 5DDPC 3SMZA 3DLEA 3KJFB 2HNYA 1F5BA 5B09A 2RB7A 3ZEUA 2FBTA 1S9GB 3TUJC 5JVGQ 4JI8F 2J5AA 5I42B 4HCCA 3IR5B 3JSMA 3PW4A 4NLVA 3OUYB 2AYEA 1IO2A 3I56S 4FF3A 4DR3J 1VC5A 1CZ9A 5KRSA 2FLLA 4YR0A 2R8HA 2AF6A 3CJ2A 4H4OA 1NHUA 1HYZA 3QLHB 4DMNA 1GLDG 1SS6A 2BJ3A 2UVUA 4CFCA 3NOCA 4LRCA 2C3MA 3PX4A 3H4BA 2ACMA 4Y28C 4JI1K 1V3ZA 1XERA 3BZCA 3QESA 5HP1B 3JS6A 3O9UA 4CJFA 3VVTA 1HW8A 4KH5A 1S9GA 2WAQD 5I42A 4ZJQA 4BR7A 2H5EA 3MCSA 2KXNB 3OUYA 3AJ2A 3D0IE 4MK8A 4EI2A 5LL6Z 1K0VA 3RVCA 4DQRA 2HF3A 5F0WA 3QLHA 4BRMA 2CQCA 2IM2A 4QWEA 3M6XA 2E5GA 3THVA 1MN7A 2DD8S 1TU0B 3VQ6A 3OW2R 3Q8UA 1T05B 1AFJA 5HP1A 4J8FA 4BC2A 2MY7A 3NNHA 1SQFA 3R7NB 3B8AX 2LECA 3LF0A 3LWLA 3N6LA 2CJQA 4IOAL 4WFBQ 5B0FA 2QSFA 2ETJA 4Z37A 4B3TF 3MPVA 3OFEA 2B7BB 4USUA 5HQMA 4QPXA 4P7TA 2W42A 3U1NA 3HZEA 2Z2ZA 4AT1B 2HRYA 4USTA 5KPZA 1ICEB 3DGVA 5KG4A 3OYDA 3UPFA 1Q82T 4EUVA 3M8QB 3M2VB 3MD3A 1EO1A 4DLEA 1VIOA 1QHAA 3I4PA 4CEDA 4UUXA 4YDDB 4I9LA 4CZEA 1N36K 4FXDA 4NLDA 1KVJA 3F56A 1U48A 4K8RA 2UUBF 4DFJA 3BGLA 3DXKB 2KL8A 4NX9A 4WP9A 3QQCD 3NXZA 4RWXA 3LDNA 3S8SA 5IT0A 4G3IA 3C15B 3CIZA 3AVGA 1C6VA 3C16B 4K7QA 4JKDA 1WEXA 1JLQB 3B6BA 3NF9A 3M8QA 3M2VA 4NYFA 1X0PA 2E5LJ 2KFZA 4B1XB 1IM4A 1VOMA 2FPHX 1N32J 1K1SA 5DLGA 3SIPB 2Y1JA 5JVHQ 4TYAA 3TW0A 5E84A 4IEEA 1WSGA 3QNOA 1HKCA 5L9NA 2K7JA 3DXKA 5ETOA 4FJXA 1PKUA 3TI0A 2VDIA 4CM0A 2Q0RA 3TAGA 3CNQP 4G1QB 4OFZA 3C15A 1EQMA 3CETA 5FLXY 4C3LA 2AEMA 3C16A 3U9ZA 4MYTA 1TMMA 4NPOA 1CSJA 2W4CA 1FD8A 1JLQA 2DIUA 3CD5A 4B3RK 2WTFA 2GV9A 4CEQA 3NWGA 2CUYA 1C1AA 4DR7F 2APOA 2X3DA 4DV2J 3U7JA 1LK5A 5M1PA 4KHPK 2COLA 4ETXA 1X4FA 3K9JA 2FJXA 3MWBA 3C2PA 2ZBRA 1PC5A 3DRXA 3HK2A 2BUNA 5KFRA 4G1QA 4U7BA 4TLRA 2MKCA 3KLHB 1BY9A 1FRMA 3RRGA 2DXDA 5F9LA 2CQ1A 3M9OB 4XPCA 5KFVA 1AUSL 1IBCB 2I5JB 4JI7F 2XI2A 4R0EA 2FLPA 5HO4A 5CZ2A 2FVPA 1PIEA 2YWKA 3UNGC 4XO0A 4FJHA 1HNWJ 2GAHC 2E1YA 1KC8O 1N88A 5EOYA 2MLYA 4B8CA 1EXQA 2P6TA 4BRIA 1KXPA 1IKWB 4WU2A 4KH6A 2VPWB 1T9WA 1RBTA 3KLHA 4F2SA 1VQ4S 3SBTA 4M3YA 3RRHA 3AH6A 3H20A 3VQQA 4QQBA 2BOPA 4OHVA 2I5JA 5CAAA 2M88A 3SCXA 2E5JA 2Q3SA 2Z1HA 4MH8A 3G6YA 4F4KA 3VN5A 1JXBA 2Q2RA 3M8WA 5BYSA 1EQYA 2DR9A 2VG7B 2HF4A 4IR1A 2YNHB 3QIPB 1U2FA 4N77A 1SJFA 2GEMA 3LAMA 3W0LA 1IKWA 1G7CB 3HPHA 2C2EA 1URNA 1D3WA 1D8YA 4QR2A 4U7UK 4NA1A 3QIDA 2HHVA 1RZMA 4ZPTR 3A0IX 3VENA 5AJ3J 1ESVA 4FKXA 5CD4A 4YN3B 2CJAA 4NYNA 2R2TA 5KFDA 1R43A 4JI5K 1NB2A 2VG7A 4URGA 4M3RA 1SVDA 2YNHA 4DZDA 3QIPA 1J27A 5F1XA 2VA2A 1YZ7A 1FA0A 2LA4A 2AP6A 4WU3A 4AHRA 1NPKA 4K0KF 1YSJA 5F8LA 3TZZA 2E9ZA 2KG0A 4ECXA 2H5IB 2FBVA 3O9RA 3UDEA 3CYMA 3I33A 2UXBJ 4WCEL 2MKKA 3R9PA 4DLGA 3SBMA 2HMIB 3D2WA 3ULEB 3PIPQ 2F7VA 2FC8A 4C11B 3OTBA 2XNRA 3T5KA 3J7AN 3U3GA 2OFHX 3UE5A 1U02A 2PE8A 3CVKA 3QEIA 4AM7A 3QFWA 2OTLN 4IR9A 3ZSOA 2ROPA 3TP2A 2VZ9A 4X4RA 2HIYA 4YHHJ 4JI1F 3MMJA 1TV6B 3TPQA 4ZPCA 1FTRA 4OPKA 2FBYA 4WJBA 4WP3A 3TO8A 4GO5X 2PMZD 2BW7A 2OANA 5AQPA 1VQPN 3ZZ0A 2HMIA 4PHTX 3F41A 4ENOA 2B8QA 3HOSA 5LJVA 3ULEA 5LSRA 4C11A 2HYIB 4K59A 4G6VB 3T1YF 4DTNA 1FF2A 1CPZA 3DDNA 4FZVA 2HBRB 5HRRA 4ZP6A 3FZFA 5F0XA 1CLFA 1HR0K 3AD9C 2LDYA 3ZSYA 1K73O 1VS3A 2G8WA 4FZYA 5KFHA 1R0BG 1TV6A 4ZVHA 4OZNA 2HLUA 4TKTA 2IS3A 3FFKB 1KQSM 3D4JA 3G6VA 3BEXA 3AHPA 5DDQC 4HT5A 5GAEI 4A46A 4ZVGA 3MN6A 2VG6B 4BR4A 3MN7A 3QFHA 3UFCX 1YJNS 1N54B 3KTQA 1H72C 2HVDA 2DEIA 2O4IA 3DOLB 3TYTA 3PJXA 3CJ1A 3OLBA 1SCJB 3NCRA 4DU3A 4A4JA 4RTFD 2ALZA 4PPDA 4J90A 2LDIA 4KH0B 1B99A 4ZCIA 3QFUA 4V19X 2OPQB 1K0TA 5C12A 5CXTA 3AVBA 2V6AA 1WF2A 2XY7A 1K8AT 4J5OA 3TEGA 3K5MA 2C2NA 2VG6A 3THXB 5G0RB 2MZSA 2E6MA 4DV7K 4MTPA 2OH2A 2KT3A 4BROA 5DZ7A 4K43A 5LMUF 5FPNA 3DOLA 4WYLA 4L8RB 4FKYA 2ATCB 3IMQJ 1WB9A 2DH8A 2NNWA 4DUYJ 5L46A 3O2IA 4DU4A 1GXTA 4JKGB 3QNNA 2OPQA 2X51A 4C0HA 1YJUA 3QWPA 3AOCA 1U1KA 1HWIA 4MKAA 2VBZA 4F0KA 3THXA 5G0RA 2KQ2A 1UZDA 2WW8A 4NZ6A 2AP1A 1OQ6A 3W64A 5KQ8A 3DWLA 5D4OA 3OYKA 5EDWA 4M5MA 5A2QU 3AVMA 4NXNJ 4H0YB 4AHTA 2NXEA 1SL0A 2YX1A 1F0XA 4NMXA 2DO4A 2PAVA 4TSXA 2ZNYA 4OKJA 2J6TA 2HHHK 1WSJA 4B3RF 2IY5B 1U0HB 4JKGA 3A8KA 2W2OP 2ZJPQ 4P7VA 4RLEA 3SLCA 2CQ0A 1SI9A 3D68A 3TVZA 4E98A 1Q9YA 1KEKA 4DCOB 2EC2A 3P4UB 3ZX0A 1Q86T 2PYLA 1RT2B 4LT6A 2ZDPA 5A76A 2ZBPA 1ACMB 3R9LA 4HHHA 4DV4F 3M05A 3RAQA 1U0HA 2XMAA 3ULDA 4ZHRB 1HNXF 4NLXA 2HURA 2ATQA 3MWTA 5L38A 2ROGA 2PA8D 5H9EK 2B56A 4IFYB 1M1HA 2KJVA 1GOCA 2QA1A 5C2FA 3MF5A 5FRNA 3CCMS 2MGZB 3FZKA 1TZ0A 3KFWX 4CFAA 3QBXA 1RT2A 4W5QA 1KONA 3KDNA 1BCOA 1NGHA 4LD0A 4TN2A 3RBEA 1IBLJ 5AZIB 4ZHRA 2HRTA 3CCRS 1UEUA 3ULHA 4IWVA 2G2OA 2PN6A 5E3CA 1CC8A 4KAIA 3W7BA 2VQFK 2GC8A 2H65B 4IFYA 2BW2A 1MMNA 2E66A 3QEWA 1HQ2A 1MROB 3K2PA 4OHWA 2ZH1A 2MGZA 4CO3A 1OYEA 4CZCA 1FXRA 5HI7A 2E88A 1UAXA 4JKCA 3IFRA 2HQDA 4TVAB 2DGQA 4X64J 4DPWA 2J0QD 1RT1B 3QIOA 3IBWA 5AZIA 4NXMK 5DJBA 3TANA 4KB1A 1UOCA 1CJUB 1ZZNA 2R42A 1UKUA 2LEPA 3DLJA 3VQDA 1HNIB 4B02A 2A18A 2UXDJ 4JI2K 1MROA 1S59A 3KK7A 3SI8A 2V4RA 2E9TA 3R6MA 3BDPA 4O55A 3CJAA 1VQMS 1HD0A 3IC1A 1T6DA 2UVVA 2W9AA 4FLWA 3S3NA 2F9TA 4DKWA 1RT1A 3MZIA 2WSEC 3CD6N 5B8HA 1OWXA 1KRPA 3FVYA 1CJUA 1X4AA 1RHUB 2GMLA 1RBLA 4FVCA 2QFJA 2FC0A 2C28A 4RBTA 1HNIA 3BP8A 3L09A 1VSHA 4WXWA 2O5DA 3UN5A 1U1MA 2QMWA 4FSVA 1FJGJ 1MWQA 4OJRA 4BY9C 1WI6A 1VSKA 3W9HA 3VEXA 4BR5A 4JV5K 5HSPA 1BO5O 2QA2A 2C3PA 4XH1A 4LFBF 1NZAA 3TZWA 3V9ZA 1NWKA 1YJWN 2MPUA 2IC3B 3D6RA 2WB1D 1WF1A 4IO1A 5GINA 2OEKA 4JB8B 3WEEB 2HSTA 3BS9A 3MN5A 2BDPA 3NS7B 4KFBB 1U8WA 2LA6A 4LH5A 5LSOA 3KHHA 4G1PA 3GB0A 1MWZA 4O8KA 2JNJA 3LUYA 3NAIA 2OTJN 3R2CJ 4PRFA 1VQSA 3BZKA 3KOAA 3H08A 3HOTA 3VR1A 2QSWA 3JAMO 2IC3A 1SQEA 2HBYB 4WE1B 1NHKL 1S72S 3WEEA 1AZSB 2D0PA 2IDLA 2YNIB 3HP9A 5HOOA 2FVQA 1IQTA 3X3UA 1FNMA 4BRHA 3MPDA 1VMBA 4F8RA 4J2DA 2PO4A 2XMJA 3CJ9A 4KFBA 2Z8QA 1XNQF 7FDRA 4YOTA 4IH6A 3TZYA 2JL9A 1VLOA 4FNHA 1KDNA 2D41A 3NGRA 1I1GA 1T03B 4NE9C 3KG1A 3CERA 2XQCA 3AVKA 1Q79A 2ZD1B 4AILC 2CPFA 4ZPBA 5K9FA 2HNDB 3NGTA 4FNIA 1IBMK 2AJ2A 4WE1A 4CDIA 3DHWC 3OS2A 1AZSA 4DSIA 2RUGA 2YNIA 2EFVA 3N79A 3CB4A 1Z1ZA 5L1LA 1QZ5A 2DR5A 3C95A 3SPYA 2ASYA 5KG6A 3CO0P 2ZZTA 3UNYA 3GFZA 3HPOA 4EHUA 2Q6BA 3H46O 4ED7A 4TLQA 1RDDA 1T03A 4BLGA 4TU8A 4I6WA 1MNEA 1KQGB 2E4LA 2ZD1A 5AT1B 2CRLA 2MLZA 2HNDA 2YNGB 3A12A 4DV5J 5BR8K 5BPLA 3KNGA 1E6VB 1RWUA 2AGQA 1VQ9S 4LF6K 3HHLD 2AYBA 4NA2A 1S5JA 3MEEB 5DQIA 2UUAK 4ZJOA 1UW4A 4LF4F 1RP5A 2K3KA 1AXQA 4RNMA 4KAZA 4QS7A 3BV8A 5D0RA 3VGSA 3HZGA 1TFWA 4PYAA 1JLAB 4DFKA 1UP1A 2D0CA 3SUOA 4CCHA 1YAGA 4NLQA 4DFMA 1NK8A 2YNGA 4X62K 3T69A 2AIRB 1E6VA 5F3TA 3M6VA 2VB6A 2IA6A 2P9IB 3PUFA 4DXLA 1LAVA 1VAZA 3DRYA 4I68A 2VBYA 2RE2A 4EEYA 2CA9A 3MEEA 1UA1A 2G0IA 5KG0A 2HK2A 3ISND 4ED8A 2VF3A 2BJ8A 3W61A 2VJUA 3VQ7A 3OXLA 4K5RA 2AJ1A 3K8WA 3HTVA 1T11A 5D0EA 1MDUB 1RAHB 1JLAA 5KFFA 3R6LB 4WP8A 1HRHA 2LLZA 4F0HA 3LZIA 4FWSA 1YJ9S 3VF4A 2Z2YB 4TU9A 2AJFE 1X8DA 4FL9A 2P9IA 2PSZA 1IG8A 1XI1A 1PO6A 2FHMA 4PY5A 1KBRA 4ZOSA 1IWAA 2ZWOA 5AQGA 5FPEA 1O6XA 2LQBA 3N5BA 2DK2A 5HJXA 4CBUA 3MR2A 4Z7CA 2IDOA 4YOWA 1B9FA 2YX4A 3QSYB 4ZCKA 4D3HA 2OJ3A 3JS9A 1DFDA 4HI2A 1NGDA 3D0HE 3K89A 2MQMA 3MEKA 5EUHA 1YI2N 2IM0A 4AQYF 3L0QA 2F8HA 3JQJA 4CD3A 2IGIA 5L39A 2IVMA 3WIVA 2YKOA 1D5AA 3MCOA 1RADB 1U2RA 3SJHA 4ELVA 3V6JA 4DUZF 4FJ5A 3AAPA 3TWHA 1Q18A 1QAXA 3SSQA 2XY8A 1GOAA 3VAHA 1M5KC 2EK6A 5HMXA 1VQ8S 4DV1J 1HPMA 4Y00A 1XMQJ 3PM9A 4FOEA 3QT5A 2V51B 1JJ4A 1I94J 3HMJG 3LA0A 1VQKS 3GV7B 3CC4N 2ASLA 2GUIA 1ZXOA 3S3MA 2XGQA 3E2EA 1FRHA 4JI2F 2HGMA 1QQNA 1ZTWA 2Z56B 4CF0A 3NMUA 1MSWD 3TVYA 1YG0A 1H2UX 4FYYB 1CZAN 3GIMA 1W0HA 2NRZA 3M2UB 3OYNA 1NK4A 2NXJA 5AQIA 3KLIB 4ANDA 1HHQA 1OSCA 4UZBA 1KHVA 2FJAB 3JSBA 3QMQA 3R5GA 1IR1A 2MZRA 2N3OA 2W7AA 4JI4F 3A3OB 4L3NA 3VEOA 5E3RA 4GKKJ 4K4WA 3B78A 3DLBA 3DCAA 3WXIA 3HFVA 4LF5J 4ER8A 5AQXA 4BQZA 2F8SA 1WKLA 2GX9A 1J53A 4JV5F 2DGWA 1X4BA 3M2UA 3ZETB 3CFPA 3KLIA 1YITN 1P9YA 4M5IA 2R7WA 4K4YA 1WKJA 4RUHA 2QMUB 2QJ3A 1AROP 4DF4A 4DV3J 4JKBA 4J2AA 1VC6A 2CDQA 2UVRA 3MXJA 3QINA 2FJWA 1DQAA 4F7VA 1WAFA 4JI6J 2J6SA 5KPRA 4CT9A 1W2IA 4P6QA 2QMXA 3M5RA 1X31C 2YX7A 4OPAA 2UU9J 1XMOJ 3E9PA 4DHVA 2DNPA 3UDCA 4P73A 4Y6IA 4BQLA 4U67Q 4AFFA 4CK2A 4CGJA 2O8CB 3ZETA 2BA9A 5A6PA 2Z57B 2QX0A 2DEJA 2RS2A 4H5VA 5I9EB 1HQUB 4LF8J 1X4GA 2VCPA 2CZ9A 2YWGA 4Z4FA 1UL3A 2GBZA 4P2XA 1N5QA 2BABA 2E8AA 3HX9A 4WFAQ 2EWHA 5A2QY 4UW2A 4JI8J 5AQFA 1LWEB 2ZOMA 4P2SA 1CJVB 1Y3KA 2W9BB 2V9WA 3LP2B 3ENHA 4I56A 2J0SD 1EIYB 2F8EX 3QEXA 4DTJA 3I55N 3NE6A 3D67A 2O8CA 2P5VA 3D6MB 3LDQA 2HBKA 4BRCA 2F63A 2DIVA 3CEDA 1HQUA 1Q82O 2RT3A 2GELA 2C2RA 4TY9A 1JQGA 3OL7A 1IBMF 2HAIA 4PL8A 4IG3B 4WFBL 3SUPA 3A5LC 1LWEA 1FE4A 2HAFA 1NGBA 1CJVA 2CJXB 2VOPA 2W9BA 3LP2A 1VSJA 2QEXS 2A6OA 1VSIA 1S6PB 4F4ZA 1XHZA 4B9MA 1CEZA 3RZAA 2VDHA 3O4NA 4JN4A 3AJDA 4FJJA 4EYIB 4K41A 1M5HA 1RI7A 1UFLA 3OFHA 1MG7A 2BM1A 2VHGA 2W4PA 5BR8F 2NS1B 2WVBA 4OYWA 4IG3A 1RBAA 4C8MA 2YHYA 4KYZA 4U96A 1HBUB 2EG2A 2W2NP 4IG0B 1FRXA 4B3TJ 1HHTP 3Q8RB 1WELA 1LOTB 2P2CB 5KFMA 3O8MA 4B3SK 1S6PA 2KVIA 3DJCA 2KFYA 3KHRA 3VGLA 1UVIA 4IH5A 2AGPA 4BRAA 4E1MA 4ES2A 4FWKA 4KIAA 4Z94A 4OX9K 2XM3A 5GVQA 3AOAA 3CJSA 2J6UA 5DM6L 1KD1T 4DR2K 3CDUA 3ENVA 4DR6K 1HBUA 3PTWA 4OHXA 2UUBJ 4IG0A 3H2LA 3G71S 3NBPB 3J80O 3L3CA 3LL3A 2BACA 3R27A 1TKXB 3MEGB 2K2PA 2RE1A 1SC3B 1XK8A 3V1OA 3LW5C 4JAXA 4PR6A 2BJ9A 2B9YA 1P9QC 1EZZB 4BWMA 5K8NA 3BUZB 1SKUB 2AEFA 3ZSRA 3K0SA 4A8XA 4W4MA 3G96A 1Z25A 3V5RA 4I4BA 2F4FA 3TQ1A 2A2DA 4R25A 5EXWA 3NBPA 2HS4A 1K8KB 2G8HA 1U6FA 1WAJA 2OIHA 1F5AA 2G4BA 1CBKA 1QHTA 1TKXA 3MEGA 5AQHA 3T3FA 3G8QA 4ISGA 5TKWA 4EBEA 3V9XA 4K8ZA 3FC9A 5KT4A 2YTCA 1YLXA 1S1VB 2Q66A 2FJDB 2H4WB 4E3SA 4DR7J 1YVFA 1R7IA 2FZKB 3ID6A 4QW8A 1TTHB 2ZGZA 1S4EA 4OI6A 2B9EA 4IOCQ 1K8KA 2V8GA 2VH7A 4TQRA 4HACB 3U4LA 9ATCB 2E6LA 1GLJO 1WC1A 5AQJA 3RR8A 4QS8A 1NRKA 4IRCA 2UUTA 4J9NA 1RDBA 1ZH5A 1S1VA 1OPIA 4BRPA 3KJNB 3SUNA 5GIPA 4IJAA 3AA8A 2HEKA 3K17A 2W25A 2NLWA 2XO7A 3TU5A 1SZ2A 1FO1A 3L3UA 5IT9O 3ENOA 4IO9L 4KQZA 4HACA 5F9NA 4NEZA 1KP6A 1L3SA 2Q43A 2QC3A 1YWXA 3NCQA 3PJ9A 2DNZA 1QVFR 2VQEJ 3VF0B 4ZN3A 4WK1A 1UJ5A 4JBCA 4CF1A 4MDBA 3T6BA 3KWGA 2DNYA 3HSGA 5F2RA 2J76E 4A8MP 4JYAK 5AQOA 4KPYA 1JMTA 2QLBB 3VA3A 3SCJE 3KD1E 3BSCA 4F50A 1PJ7A 4JI3K 1RBVA 3O5BA 2XTJP 3NVKA 1Q7LB 4DS4A 4MFBB 1OYDA 2ITGA 5CHCB 1ZETA 2Q79A 2AYGA 2XZDB 4OQJA 3T1HK 3CCVN 4DPXA 2AGOA 1DARA 3I5AA 4CJKA 2A6AA 4Y2IA 1Y64A 3ZSXA 4LREA 1FT8A 4HT7A 5KFSA 4CESA 2E9RX 2RVJA 3C94A 4IOAQ 1N4LA 1SXLA 1ZM9A 1WTFA 3MXHP 1TUVA 3CDAA 4MFBA 4GY2B 4KGXB 3MPWA 2BVZA 3P96A 3AVNA 4AHCA 3IG1B 4K0KJ 1U45A 3FMBA 3QWUA 2JEGA 1WHWA 3Q24A 4F9OA 2DT9A 2W01A 3BPSP 4RU2A 3LDLA 3GILA 4CVNE 3R1XA 2E5LF 4JRPA 3RWUA 2XS2A 2VA3A 4ZPAA 1UW9A 2ZJQL 1J9AA 2WB4A 5KG7A 3GG1A 1N32F 4KC5A 1NJZA 4PYDA 4RR5A 3I56N 4CF8A 2B9XA 2AEJA 3R5AA 4IBNA 4LIWA 3BPDA 4UOCA 1XBWA 3IG1A 3MPUB 4JI1J 2FF3B 2YVSA 3O3HA 1V3SA 3QJLA 4FZZA 2YX6A 1BQNB 2GVDB 3U02A 5AQUA 1UAWA 3J81O 4CTAB 3TAEA 4DV2F 1K8AO 4M94A 1JNZB 1REVB 2ZOFA 1RDRA 1I51B 2V8DA 1XNRK 2DNNA 1FXLA 3CG7A 3T1YJ 1BWFO 1U49A 5DQHA 4ED5A 4H8KA 3TA1A 2KH9A 3GFHA 4CT8A 1DKGD 5EX5A 4O4RA 2VWJA 3BGFA 3PKYA 1S99A 1UFWA 3DNCA 4QZVB 1QSSA 1DURA 1T9VA 2XZWA 5KFYA 1BQNA 4CJPA 5GAEU 2CGJA 2GVDA 4CTAA 5HRSA 3Q8PB 2M5YA 3H5SA 1GH8A 2O3DA 1REVA 4U8YA 1R8AA 2HHPA 2JH3A 3LPEA 1EARA 3M8PB 3RAMA 1YRXA 1MU2B 3TJAA 4EO6A 4ZVUB 2CQ4A 2BEFA 3JSYA 1BMQB 5ELZA 1H6KX 1HNZK 1NSPA 2HK3A 2AHOB 4IFEA 1A5WA 2KW4A 2QRRA 2RMLA 3N5FA 2FSJA 3TEHB 3DRPB 2XWYA 3CJTA 4BWJA 3M9NB 5C15A 1N36J 3FNNA 4DR2F 3UVJB 1TQLA 4DR6F 1BQMB 4KTWA 4LVOP 3HSTB 4PKGA 4Y3CA 3HJFA 3AA4A 3M8PA 3K58A 5L1JA 4BR2A 1MU2A 2QWOA 5KGXA 3UD3P 3PJWA 3RR7A 1WHXA 4FJIA 2J8AA 1Q86O 1OQ3A 4ZCLA 4X65K 1TELA 2FZCB 2ZITA 4RZRA 4GV6A 1UVJA 5H1SV 5AE3A 1NGJA 1A5XA 3VOVA 2VPZB 5AJ3F 3PY8A 3DRPA 3PYGA 1U1PA 4M5LA 3DLLL 3UVJA 1BQMA 4KT0C 1B0VA 4YDUA 2CAJA 3PVXA 4ZIVA 2IBOA 3GMGA 3OYJA 3NCPA 3E1YA 4CNZA 2O8BB 3CCQS 1Z26A 1ZTTA 4OI3A 5L8RC 1VIXA 1FD2A 1RJJA 4MK9A 3ILJA 4XDDA 4WIIA 4O0JA 4CEAA 1Q53A 3W3DA 4B3RJ 1UVKA 2PFFB 2BKNA 4DF8A 4BC9A 4DX6A 3K2YA 2G2YA 3MTJA 3GJTB 4BHQA 3TAQA 1DRZA 3D45A 2UXBF 1Y5IB 1TUGB 3OYHA 4FJMA 2I6WA 3HDSA 2V4JB 4EBDA 2BTFA 3KLFB 3L9ZA 1RHQB 4B08A 3A8YA 2DY4A 5JLFA 4FBUA 2O8BA 3V2UC 5KFPA 4YHHF 3FKBA 1OS5A 3CCES 2YCHA 4OKKA 1BCMA 4KJIA 4LSZB 3JXOA 2KLAA 5ETQA 1HNXJ 3MTKA 3MHYA 4CJUA 2IOCA 3VEZA 1HYVA 4BACA 2Y1LB 4ZLLA 1ATSA 2V4JA 1K1QA 1JLFB 2R7SA 3KLFA 2BRLA 4WCEQ 1S1XB 4LF2A 3CULA 1APSA 4PABA 2QGFB 3N28A 4KRWA 4YR3A 4DR4K 3CJKB 5JUMA 1EWQA 2CPYA 4Q0BB 2ZH4A 4ECUA 5K8MA 2VUGA 3FUYA 2HHXA 2R8IA 2V0NA 2YJEA 1VQ4N 4J9RA 5ADXH 4A59A 1ZAWA 4ZVEA 3TR5A 4UOFA 1HWLA 1VQNS 2BJEA 5M2UA 4OVLA 4NMLA 4B9VA 2KU7A 2A41A 1GOBA 3M9MB 1JLFA 2ZKUA 2W7OA 2G8IA 3W8PA 3OY9A 1S1XA 3U8XA 4RW4B 2C42A 3CJKA 1WEYA 5JMVA 5ADZA 3NWRA 4Q0BA 3OBWA 1QJHA 3O9TA 3ILLA 2CGKA 1IBKK 5HVFA 3R3LA 3JSRA 1VSFA 3VAKA 4EHTA 3NH2A 4FLZA 1SKRA 1QZ6A 3NVMA 3JTOA 3DRRB 3GLJA 3N4WA 1KNZA 2E20A 2XHCA 4ZVRB 3BKFA 3TOQA 4CNYA 4FJNA 1QUVA 1RABB 3B54A 1A7GE 4JI5J 4C1NK 4OYZA 2MQLA 3KMSA 4RW4A 4AXJA 1RTDB 1SH3A 4GV3A 1RHRB 3VZIA 2Z1JA 3RMAA 1HNVB 2OKQA 4MKBA 4KHQA 2NZTA 3EGNA 5ETKA 1DLOB 2VKZG 4CGHA 2QT7A 5ETVA 3M8YA 3AFGA 5KQDA 2HBZB 4LH4A 3DRRA 5BN8A 3E9LA 3O4WA 2O67A 2U2FA 5GAGI 4JK8A 3BO4A 4EGLA 1ZA2B 2HSEB 5BN9A 2E44A 3BR8A 1IR2A 1RTZA 2W2PP 5U47A 3S9HA 2A40A 2UUCK 1RWKB 3HT3A 1RTDA 3ZT1A 1Q8BA 4BE1A 1E6YB 4ZS6A 2YWHA 1B9DA 4AUKA 1RTHB 1F2HA 2X6SA 2DGTA 1HNVA 4M5KA 1Y5LB 3ZZZA 2ZM6K 2YHXA 4LFBJ 1VHIA 2VGNA 1TL7B 3E01B 1DLOA 4W5NA 2CJKA 2MJUA 1Q7YT 4V19S 2F8MA 4WFZA 1LCUA 1FX4A 1W7AA 2Y8WA 3ZZRA 3WQUA 3J7YP 1XTZA 3D0GE 3PEHA 3MDFA 3B4DA 1WDTA 5KFEA 1HR0J 2GHWA 5HLFB 1E6YA 2KHOA 1RTHA 4E1JA 2ZBIA 5AE1A 4CIFA 1DQ9A 2SXLA 1TL7A 3E01A 2PFDA 4CW7B 4DQ8A 3OYLA 4JV1A 4C8OA 2MMYA 4MKYA 1RB0A 4WIQA 1NEEA 1FKOB 1UFKA 1NNDA 1YJNN 1TL5A 5K5MA 3PDNA 4RW9B 4CQ1A 3VQBA 1SV5B 5HLFA 1J5OB 4NZ0A 1UETA 4DSEA 4LF9K 4PL7A 3G86A 5AQRA 3ZT0A 2CKWA 4ZLNA 3EO3A 3NAHA 4J9QA 1QAIA 2EWSA 2L08A 5IV3A 2DVIA 3BYRA 4M5GA 2C3YA 3JQKA 1QD1A 5J1NA 5AR0A 3GTYX 1FKOA 3AVIA 2BM0A 4DV7J 4JNEA 1RT3B 3GIIA 2JJ4D 4CJVA 4P10A 4NA3A 4OGCA 3VF6A 2CQPA 4PQAA 1C4AA 1ASUA 4RW9A 1SV5A 1ZOTA 3LALA 4FWRA 3GCXP 1J5OA 4LR7A 4OX7A 1FVSA 3QBCA 5J1PA 1RLDA 4OV1A 4X65F 3VV2B 4GVMA 2BRKA 4NLOA 4B9LA 3GPAA 1NSQA 4FO0A 5DK5A 3S01A 3MCAB 2CQIA 4DV0K 4M3UA 3SEOA 2ZH7A 2QV6A 3OVAA 3KG0A 4NLYA 4K4XA 3IM8A 1N0UA 2UXCK 3VF2A 3R5DA 1RT3A 2J4RA 2FQQB 3QZ7A 3PXGa 4CBXA 3V6HA 3MMVA 1TVRB 5DLFA 1X5SA 2FVRA 1NM2A 2D0AA 2UXDF 2F3JA 2K1RB 3SAGA 2QLFB 1IM6A 3HL8A 1GAOA 3OYIA 3RU0A 2GMHA 2IJFA 3EXCX 5HMZA 2HHHJ 2OMLA 1NSKL 3GYGA 2NRHA 1HJOA 1W7WA 1PAEX 2J7WA 1OPZA 4I9QA 4E0DA 3A8JA 3H4DA 4L3KA 2V67A 2I0XA 3GP9A 4HUFA 4DZ6A 4FS1A 3UD4P 2CQGA 5IC6B 1GMWA 2NUBA 4H5NA 1IJEB 4JKEA 1QS4A 1G3OA 2P9EA 1TVRA 2J7KA 1GLLO 4C9DA 2Y0BB 4ECQA 4NCBA 2K1RA 3MM9B 1TUYA 3UW1A 4XPEA 4C2MA 1VYAA 1XJWB 2QLJB 1U25A 1FJGF 2ZZMA 3Q2SC 5FPDA 3TNVA 3VAGA 3GSDA 3FSYA 2FDNA 1VQLS 3RMCA 1NXIA 3M6UA 2H3GX 1YJVA 2CYYA 3IP0A 5CD4H 4ZVPB 2HHWA 3VQEA 3M8SA 5GMKa 4F4WA 2BGGA 3EE9A 2EX3A 2AJ4A 1CVJA 2AJQA 2HFNA 3H90A 5H9EJ 3AQPA 4F04B 2FIUA 3GYNA 4USHA 4DPUA 4DR4F 2MYFA 3OYBA 2ZH9A 3CCMN 1YTYA 4XDCA 4YDUC 3MM9A 2HHUA 1GMUA 4OPHA 3KK1B 2J9EA 4I67A 3D66A 1SH0A 4YDXA 3G25A 4C1NI 4Y0FA 2PIIA 1RWMB 3CCRN 3IS9B 3SQ0A 2DPNA 4B9SA 3PIOL 1WSFA 1VQ5S 4GO7X 1BIUA 1IG9A 2BKOA 2U1AA 1Y5NB 2LEBA 2FHJA 2VQFJ 1IV0A 3CC7S 3PRDA 2LYVA 3C0BA 5D3GB 4CK3A 5T41A 2EI5A 4GRSA 4AQYJ 3QB0A 2L9DA 2RQ4A 4EU0A 2KXHA 2YV0X 3T7ZA 3THYB 4EWTA 2PI4A 4X4VA 4ECTA 3DM2B 3CJBA 5KFGA 1QQOA 3PEJA 1ZPVA 1WC4A 3KK1A 4FVUA 4NO7A 5HBMB 2DY9A 1WJ9A 2VASA 4NXMJ 5K8PA 3IS9A 4KHSA 1VQ7S 3VGKA 4KBIA 2F4VK 1BXNA 3ILOA 3IXQA 3RG6A 2R9LA 2DGVA 2B6AB 1DQ8A 5D3GA 4CFDA 3I32A 2FC9A 4JI2J 4O5BA 2MEWA 4O3RA 3NAEA 5AFUH 3THYA 2OP5A 3DM2A 1BWVA 3CQYA 1YXQA 2YKNB 4I7FB 1VQMN 4KO0B 1RBRA 5HBMA 3WX8A 2QL9B 3TTCA 4BC5A 4MO4A 4X84A 3SAHA 4XAKA 3UI3A 2HWTA 1NCLA 1NK0A 3FBCA 2BUPA 2ZQBA 3EMTA 2KYXA 4RUCA 1JNRB 4DV5F 4N8OA 2QKBA 3A5NC 1BHLA 1UJ6A 2B6AA 3TABA 2YI1A 4QJVA 4O0NA 3FQLA 1L3KA 5AQYA 1U4BA 1RAAB 2A2CA 2O8DB 1ILYA 4JV5J 2YKNA 2HQFA 2ZM6F 4I7FA 4KO0A 3DN9A 2BR0A 3BGUA 3HZ6A 2RRNA 3W62A 4FK0A 3ELHA 1TL1B 3KVGA 2LSNA 3M4XA 3BM7A 1W2BR 2UUWA 3HSJA 2NXCA 4A61A 3KNAA 3EN9A 3G9CA 4KHRA 5IT4A 2G8VA 2DTUA 3LDSA 1BISA 4ECVA 3EKSA 2DGUA 3VPZA 3OFGA 2O8DA 3GR1A 4PWUA 3C6UB 4O3QA 1UPMB 1QAJA 2GIRA 3V4IB 2ITMA 3O3GA 1FFSB 2GO9A 1HKGA 2OPRB 3QFPA 4CO1A 2QZ8A 4HUGA 1MWKA 3HHLC 1TL1A 2G13A 3EPIA 2AZ3A 3PRBA 1KVBA 5EY4A 3OJSA 1OH6A 1NNEA 5HMWA 3J7A1 4CEBA 4F0MA 2L41A 4DTSA 4OV6A 4ZVOB 2IM1A 3VEVA 2HWHA 5HAOA 1B70B 1X3NA 1S72N 3V9SA 3GFYA 5KI6A 2HFVA 2ADCA 2RD5C 3SFUA 3C6UA 1F1BB 1TUUA 3V4IA 3DLKB 1S49A 3WNHA 2OPRA 2LQ5A 2V2ZA 3CWJA 4KHUA 4A8QA 1KFDA 4B3MK 4MIAA 4RNFA 4M3ZA 1RHJB 4ZP8A 2DRAA 1BA0A 1E4GT 4CK1A 1C0UB 3IRXB 2NRVA 3ISNC 1RU1A 2H51B 1S76D 2RRBA 3KYLA 4CRJA 4KSEB 1IBMJ 4CIGA 5DGAA 1SUQB 3JTNA 4Y34A 2KT2A 3UKRB 2V94A 1RBUA 3S6EA 3BY5A 1KD1O 1ATRA 4LMZA 4CJTA 2OTLS 1N6QB 2JX2A 2V34A 3HM9A 1C1CB 3DLKA 2F9DA 3IUCA 3CUNA 2CPEA 3KKFA 3LDPA 2BJ7A 5EWGA 1X4HA 2W2MP 4USWA 2VIHA 2IVOA 1PJ6A 3SMSA 3QNWB 3VQAA 1P8ZA 1F2GA 1C0UA 3IRXA 2RHSB 1XMQF 5LT5A 5BR8J 1SUQA 4ID5B 4CI6A 4DS5A 3UKRA 1GT8A 2OSRA 3EKUA 4QWBA 1VQ9N 4LF6J 4L75A 4M63A 4L72B 3CJ7A 1VK3A 3A3PB 4KHMA 3VETA 3SSSA 5FPMA 1N6QA 2UUAJ 1ZS6A 5DDOC 1WN7A 1C1CA 2ZNZA 4J9UE 5B0EA 2G9OA 2R7UA 3Q22A 1BDGA 2BZ2A 1ZZFA 3NGYA 2P5GA 3GL1A 1FKAF 2HOEA 3T9ZA 1ELOA 4DTOA 4BDYA 3HULA 3MK6A 4YOEA 4X62J 1WOPA 3L4BC 4CF9A 2KZMA 4ID5A 4BRDA 4IJNA 4WQ4A 1R6YA 4CEOA 4X66K 3KKRA 1EP4B 2G0JA 2I1RA 2GNKA 3DDIA 4LF5F 1Q95G 2CGLA 3OTCA 2N82B 1RCXB 2XMVA 4E1NA 1RT4B 2FSNA 4YOVA 4BR0A 4KH4A 3H7HB 1J5EK 1UWBB 2GS8A 1BC6A 3C7NB 4UOGA 1KKHA 4E2FB 3SI6A 5KTQA 3WIUA 4RU9A 2P9PB 3KHYA 3BO3A 1RWXB 2IPOB 1YJ9N 2VYPA 5JXSA 1VQOS 5E41A 1ZBFA 4JI6F 1RA7A 4DSJA 1EP4A 4IOCL 2F1FA 4ECRA 4AXIA 2UU9F 1XMOF 2W1BA 4CHQA 2OCEA 2IVFB 5D78A 4X4OA 3OJUA 1RT4A 1U1OA 1QQCA 4W92B 2W6LA 2ZBQA 5LXRA 1UWBA 1EKSA 3I82A 3ZFVA 3IWLA 4LFAK 1HW9A 4DUYK 1I6JA 4ELTA 3C7NA 5FDLB 2JLGA 3QEPA 1QSLA 4LF8F 4WTOB 1I39A 4K4ZA 2P9PA 3NEKA 2W2QP 2XLJA 2DHGA 2JWNA 1FJ7A 2CZVC 4FWPA 4DPTA 4O0IA 2R7XA 2CFXA 2KXFA 5HL7L 5LSLA 3BZQA 4NXNK 1F5CA 2DNHA 4ECZA 2WONB 1VSDA 3GYXB 3VTHA 3L2UA 2PC6A 2RSQA 1SJ3P 4Z4GA 3QJJA 4UF4A 3QT6A 1JL2A 5FDLA 1RXOB 4U7UD 4PG5A 1VQ8N 2DNLA 2B4JA 4K4TA 1FRLA 3R7SB 3U3YA 1VQKN 1UJ4A 2EFPA 1GLEG 1GXUA 2HS3A 5KG1A 3EY1A 4GKJK 4OHYA 2XULA 4RW8B 4V1Ak 1Z6RA 3DDKA 5GMDA 4MKVA 4OHZA 4Q7AA 2RN2A 2WONA 4MQ3A 2D1KA 2I38A 3W2WB 3IWXA 3QYYA 3UCZP 1Y00A 2ERRA 4B8AB 4IO8A 3LAKA 1UEKA 1NJIT 2QLXA 2VPXB 4LRBA 4NLWA 3TAMB 1XIQA 1XN9A 4OX8A 4X4QA 2DGOA 4BREA 4CJ7A 1WSHA 1MW7A 1GK8A 2CPDA 3M6GA 4P75A 2B8PA 2O66A 3T5LA 1LWXA 3PYEA 4RW8A 4P71A 3FR0A 1MWMA 2XHBA 3HHDA 4CHOA 1UA0A 3DLHA 1MMLA 2CNOB 2FHKA 3W2WA 4WKRA 4AHUA 1NSAA 4U9RA 4DCPB 2DY1A 3LPYA 2YWWA 2XLIA 3ID8A 2CQBA 1OY6A 3OL9A 3TAMA 4CZMA 2NYHA 4CH1A 4LF1A 1T05A 2V52B 1T3NA 2BV3A 1TGOA 3CW2C 3T1AA 3AODA 3EE3A 4FXVA 4EK2A 2O1PA 3I0RB 2E2PA 1VHXA 1EWRA 1ZBIA 3BH6B 4LFCK 4ILRA 1ITPA 1O1WA 1X4DA 4FVMA 2XNQA 2FSKA 3QT8A 5J2MB 1AYEA 1ZBLA 5IZHA 3O44A 3TA2A 4AH9A 5HJYA 1TKTB 3ENQA 3BSOA 4M1KA 3AXKA 2HB5A 2EPIA 3NF6A 3M1VB 2OPSB 1KC8T 1YKWA 3FE1A 3ICLA 3O3FA 1KS2A 5DM6Q 3I0RA 3KIOA 1WNSA 3MECB 4DL4A 4AHSA 1S1TB 3OS0A 1TMJA 2NRXA 1FWLA 1RGVA 4B3MF 2QWLA 4UOHA 1GX6A 4Y2CA 4QWDA 3G87A 2EBEA 5J2MA 2A1RA 2LQ8A 5FROA 2IYIA 3V9UA 2IRXA 4CF2A 1TKTA 1SJ1A 2PBDA 2EKYA 3IRWP 3FZBA 3M1VA 2OPSA 3GE1A 5A8KB 2AV5A 2R8GA 2ZF5O 3T5HA 3E51A 4CIOA 3MECA 4P72A 4EBCA 1FEEA 2FXUA 1S1TA 4IDKB 4C8ZA 1BD6A 1WKKA 2QEXN 3F73A 2ZVIA 4Z0UA 1N33K 2X74A 1R8HA 2R2RA 4OJHA 3H40A 2M8DB 4BRKA 4A2AA 4F4XA 2QKKA 3R5BA 4BBYA 5E0OA 3ENBA 1N5YB 2P9CA 5KT6A 3L7UA 2GFFA 1Q8IA 4B9QA 2P9KB 2Z0GA 5C42B 1DTQB 1Y7PA 2BKPA 3OSNA 4HTIA 5A8KA 2OUGA 3M3ZA 3A13A 3MM5B 3AVFA 4E7LA 4HKQA 2VD3A 4KGMA 4IDHA 2A0FB 4CGFA 2IFXA 4IDKA 4NB4A 4Z2XA 3HP6A 4WFNL 5D77A 3OR2B 2VOOA 3I6PA 2BQUA 5ETRA 4X4NA 2EFOA 3H2UB 2HQCA 2VQEF 1DHMA 1OY8A 4OX9J 2ALYB 1N5YA 8ATCB 2PEHA 4CJ3A 2P9KA 1X0FA 2D1CA 5C42A 2DHHA 1DTQA 4AL5A 4CZJA 3KXDA 3AGKA 2QL7B 4DR2J 4IXCA 4DJBA 4DR6J 3GZ7A 3RMDA 3MM5A 4R8UB 3G71N 5M1FA 3VALA 3SV3A 3JAMU 3R1LA 1VJWA 1WG5A 3OR2A 4DEZA 4FLYA 4Q44A 4IO9Q 1VRUB 4WTYA 3R6GB 4ZPWR 1QTMA 2KG1A 2GCFA 3UD5A 4CECA 1AFIA 1WOOA 1X5TA 4RG8A 1H73A 2Q31A 3HHNB 1N56A 2PGCA 5M1QA 2V2KA 3KD5E 2ZH3A 2MQOA 4QBUA 4J9MA 3FZLA 2QK9A 3F5TA 1TFYA 1NOYA 3EUNA 3VAMA 1N34K 1XWLA 3IR7B 4EFHA 4R8UA 4JUZA 2NPIA 4M63C 3ZXWA 3HJVA 4NYOA 1V5IB 2VG5B 1VRUA 4JRQA 4ZPVR 3CIPA 1YX2A 3QZ8A 4ICLB 1VK0A 4RKUC 4Q2LA 4GW6A 2FGCA 1M1KT 4J9KA 4OLBA 3DXSX 4PZVA 2D3O1 2G1DA 3OW2M 3KLEB 1AW0A 4WQ4C 2F65A 4KI6A 4EIAA 3HSCA 4LVNP 1CZBA 3LGNA 8AT1B 3D28A 2VG5A 3UR0A 4TU7A 2VICA 3NP5A 2X6NA 3EGWB 2ZH2A 1VQYA 4C0BA 4ICLA 2GQQA 5IWAK 2E1AA 3UO0A 3J7YI 3D2EB 1HJRA 4ISEA 3T6JA 1VCTA 1NPRA 3AD8C 4OGEA 4PXDA 3T41A 1NJXA 5LJ5Y 2ZJQQ 2V2VA 3VZHA 5SUHA 2HZAA 3KLEA 1Y97A 1B7YB 2D4WA 3J7AP 5D4NA 4DR5K 1WC6A 2V8VA 2BX6A 3GQCA 4FWOA 3BBCA 1RDWX 3WXJA 3HLUA 3CJ5A 1M5PC 4QPTA 1T94A 5DS7A 4LF7K 3EM1A 2QG9B 2DFFA 4PG4A 4J2EA 3L7OA 1HFEL 3D2EA 3TARA 4JYAJ 3UQSA 3C3LA 2JC1A 2Q3PA 4N5SA 4HYKA 3MURP 4M3XA 4UY8T 1P1LA 1J6ZA 3JQMA 2M0GB 1RA6A 3RGIA 4OYXA 1PYTA 1FFWB 3CPWR 3SQ1A 3D5MA 4OIXA 4JS4A 4X4UA 3OVSA 3D9BA 5DDRC 2PMWA 5IS2A 2R4FA 2QWNA 3CJCA 4PG8A 1Q9XA 1HIYA 4MIWA 1C4CA 3OTDA 3I9ZA 1T9TA 2LEAA 1Q7YO 3I87A 3HI9A 1YJRA 4CI0B 4B9NA 4Z4IA 1N36F 4JLHA 4KBOA 4CLLA 3SZ2A 4IRKA 3O1WA 1GMVA 4K4SA 2YHAA 4PPZA 4BRLA 3OHBA 2RJZA 2OD4A 5EX0A 3PZPA 5H9FK 4W90B 3DXMB 4CJ4A 1S1UB 2DPIA 1SKSA 5IC4B 1Q1KA 2P8IA 3ALYA 4YUDA 4DV1K 4D3GA 4P52A 3EX7B 5KOXA 1AUDA 5CQGA 2DNOA 3IR6B 4G1IA 2XLKA 2NSBA 1NHVA 1VFJA 1P90A 5GAGU 1C2PA 2HFZA 5EWEA 4BE2A 1WC5A 5ETPA 3RTVA 1FHTA 2HPUA 5E33A 4OI4A 5EWFA 4C4WA 3MM7B 1KR4A 4H03B 2HS0A 2R2SA 4QYZK 1VI7A 5C5JA 3HSDA 1RGIA 2P9SB 3DXMA 4M95A 1S1UA 2VGMA 2ADBA 3KUGA 2W8KA 2ZBCA 2RHQB 3T19A 1CQNA 3MD1A 4CHPA 1HD1A 2VODA 1NGCA 4CGDA 5M2RA 4KHPF 1XNRJ 1V6HA 4F4AA 3DLLQ 4FJ9A 3MM7A 4GC7A 4WBFA 2MKIA 4DTRA 1JXVA 1U1QA 2Y3YA 4Y2MA 4DSKA 2P9SA 1X7VA 4KY3A 4J9LA 4H54A 3R1HA 4M5JA 3BQ0A 2K06A 4FJGA 3QJPA 4RX6A 3CCJS 3CDWA 1GNKA 2IIRA 4QR1A 1I3AA 1NGAA 2IRUA 3DAWA 4QWAA 4OYMA 4Y2KA 4A2BA 5KFBA 2FHOB 2MKSA 3OPKA 4NWBA 3PW7A 1N0VC 4FW1A 1NPPA 2G2ZA 3AT1B 3J7ZO 3H59A 2MKYA 3CGIA 1HNZJ 3OXFA 2LXIA 4CJLA 3EZUA 1VGYA 4M3TA 3V6DB 3PO5A 2MQ8A 4WK3A 5TKYA 1S7IA 4JI8K 1BIZA 2QFIA 3GE9A 3WNEA 3HCXA 2KKZA 3L2RA 2OAUA 4NLGA 3F9MA 4LBPA 3FSIA 3FZHA 1HX1A 4FJKA 2NSCA 1SH2A 2HGNA 4K50A 2XC9A 3NMRA 1QAYA 2AZ1A 2DRDA 2CH6A 4NLBA 2Z4PA 3B8HA 1J54A 4X65J 3BGOP 1YZ6A 5E5NA 4YB7A 3IO1A 3BDEA 2G8UA 4EP4A 3CC2S 1GLFO 3V6DA 4C23A 4ITSA 4JKFA 2E7WA 2C2MB 3W1YC 5HK4A 1N34F 1SBRA 2F96A 2VFUA 4H4KA 1X5OA 3OVNA 4JI5F 1T7PA 1S48A 2P9LB 2KM8B 3BREA 4DPYA 5AQNA 4KV8B 3CFRA 1XR5A 3CCQN 3UCUP 4PXCA 1MLAA 3KLGB 4OJ3A 4GVEA 3A8IA 2CG4A 4IOXA 1ZBUA 4ZVSB 2DITA 3AGRA 2WW4A 2Y1IA 3EVWA 5KT5A 1FFGB 2BMBA 5LL6d 3UR3C 4TQSA 4ZP7A 3OL8A 1AT1B 2DKOB 1OVYA 1SPBP 4B3TK 4Q2MA 1SL2A 2HVEA 1PGZA 2P9LA 2KHDA 4KV8A 3U6FA 8RUCA 3KLGA 2ILZA 2KI2A 1NMDA 1LEOA 4KGVB 3CPWM 3CXCR 5KT7A 3CCEN 3NGKA 3M32B 4LR8A 3PX6A 2E1RA 3OYMA 2XWXA 3W3SA 5JS2A 2JFKA 2E2QA 1QUPA 3OT9A 4JI0K 1FI4A 2D3ZA 2J7UA 1S0NA 4DR4J 4Q45A 1JJCB 3IAS9 1HR0F 4BR9A 4U7CA 1ZYQA 2GQ2A 3CCLS 3RJMB 3M32A 5IFMA 4LF7F 4DBQA 3J80U 4RO0A 1T95A 5EU7A 1VQNN 3H98A 3DLGB 3GU0A 5KT2A 4OL8A 4YORA 1YHQN 4P2MA 1Q8LA 1H0HB 1TK8A 1FERA 1NKEA 3VQPA 2JGUA 5M1KA 3C8YA 4C8KA 4CEZA 2J9DE 3QO9B 2FJVA 3TX0A 3L8BA 3MR3A 4O8UA 3MAAB 1CXUA 3H5UA 4K2JA 1KQFB 4CZKA 3EL2A 3V9WA 1O51A 1ZA1B 3WNGA 4RW6B 2L9NA 2EFGA 3N01A 3LGHA 3K0JA 1JLCB 3QRRA 4UTGA 4DI6A 4I2QB 4ELUA 2DFHA 2D69A 3DLGA 4ECYA 3UWTA 2VC0A 4JEPA 3WNFA 4QW9A 5AQSA 1H2TZ 3TSUA 4DTPA 4DV7F 3F2KA 1FXDA 3VEYA 3QO9A 1FEHA 3PYDA 1XR6A 2F7TA 4HEA9 4KRFA 3MAAA 4KPCA 1T9UA 3SQGB 4HTLA 4RW6A 4OYPA 2PT0A 2PZSA 3FRYA 4RUBA 4XH4A 1T0TV 2QN6B 3SCLE 1JLCA 2AW0A 2Y9HA 4I2QA 4CEFA 1D9DA 4JI7K 3G0ZA 3EZ5A 1YJTA 2DB1A 4RWTA 2NQPA 1N8RT 4PG7A 2XY6A 1ZAVA 1U8SA 2N7CA 3AVCA 2OELA 2CQ3A 5JMNA 3G6XA 3SCKE 1OMSA 3RSEB 5GAGP 4C8NA 5KG3A 2BOAA 3L7PA 2Q36A 4HLBA 2FTRA 2XYPB 3HHEA 3B4MA 3HKWA 4FM0A 3SQGA 2XMMA 2ZM6J 1JB0C 4GMJB 2HHHF 2QO3A 1HBOB 1NH8A 4K5SA 5KPTA 2M8HA 5KOWA 5C25B 2CPIA 1YF5L 4Y0WA 2DYAA 3Q7BA 3BO2A 2RDJA 3JAMY 1N52B 4H0OA 3TTDA 4CO5A 2MSSA 3PX0A 1WORA 1W97L 3RSEA 3CDEA 3MEDB 5CYQB 4KE5A 4OYBA 1NUEA 4PEOA 4OPJA 1VQ6S 3OVBA 3F44A 3ZC4A 2NRRA 1PJ5A 4DTUA 1UWAA 2JEJA 4MMOA 4TY8B 4OZLA 1HBOA 1S0VA 4M8LA 1Q0NA 4E7HA 2VL1A 2D3OR 4FPIA 5C25A 3D54A 1RBSA 5DGBA 5I3UB 3ZT4A 1U24A 4OX6A 4L76A 3L4QA 5CH7B 4FS2A 4NOHA 3N4QA 4BRNA 3C6TB 4ECSA 2IIHA 2YKAA 2FLNA 2IMOA 3MEDA 3CO9A 5CYQA 5M1OA 3OR1B 2FD2A 3GONA 2HQ3A 3PHTA 3LANA 3OHAA 3MUTP 3MFHA 3GJRB 4K0KK 2RQMA 4TY8A 3MCMA 1KTQA 4K8XA 4R5PB 4ZN1A 4YB1P 4WWSA 2CWX