2B6AA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with thr-50
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase p66 subunit
publication title Crystal structure of HIV-1 reverse transcriptase (RT) in complex with THR-50
rcsb
source organism Human immunodeficiency virus 1
total genus 136
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2b6aA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b6aA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2b6aA05
3GV5B 4KTZA 3DRRB 1TK5A 4R8UA 3TAEA 4EYHB 2AJQA 3LAKA 3Q8RB 2HNYB 4CF0A 4QOZB 1D9DA 2HWHA 3NAIA 3RWUA 2BQUA 1T05B 1JKHA 3SQ4A 1NJXA 4M94A 4DTRA 3T5JA 1CSJA 4H4MA 4EBDA 4J9KA 1HNVA 4I2PA 4DFJA 3OVNA 2BQ3A 3DI6B 5KFWA 4NLXA 5EWGA 4KAZA 3V9SA 3KKRA 3KLIB 1B92A 1RTJA 4ZVEA 3VQ7A 3SCXA 4YR0A 2IBKA 4FJKA 5HBMA 3OYCA 4CCHA 4WZMA 4DFPA 2W8LA 2E4LA 4MK7A 1EP4B 1C1BB 2ITGA 3LP2A 1Z26A 1C0TB 4EEYA 2B6AA 3MF5A 1RT6A 2R8KA 4IDKA 2XRIA 3OYDA 5C5JA 4ECVA 2HMIA 4K8ZA 1S49A 2KQ2A 2JEJA 2R2SA 2OPPB 1TGOA 2GUIA 3TAMB 3KK3B 5HP1A 2DFFA 1WSJA 4IFVA 5F8LA 3BREA 3OLBA 3QEVA 3B6PA 4ZP7A 5KFAA 1UWBA 5KT2A 2R8IA 2R8GA 2IAJA 1REVB 3HPOA 4KPYA 3DOLB 3K5MA 1VRTA 5KFIA 1FK9B 1D5AA 3N6LA 2WTFA 4K4SA 3RBDA 2IMWP 3AA3A 1BQMA 1VSIA 5J2MB 2AQ4A 2AX1A 4H4OB 4Q44A 2ZE2B 4YQWA 3NHGA 1VSDA 4IG0A 1WLJA 3PR5B 3NDKA 4U7CA 3V9UA 3H4DA 1XHXA 1Q9YA 4J9RA 1U47A 2WHOA 4HVJA 4KHQA 5HLFB 1HQEA 3VQDA 1KHVA 1N4LA 5J2QB 3AVGA 1EKEA 1BIZA 3LZJA 2A1RA 1KVBA 2DPIA 4LY7A 4IOBA 4FLWA 2E6LA 5DQHA 2HHXA 2GIRA 1HQUA 3HVAA 1KVAA 2VWJA 2HHTA 4NLGA 1NJZA 1NHUA 2E9TA 4U6PA 3ZT4A 1X9MA 4FS2A 2ILZA 3NH0A 2O4IA 4IFYA 3LP0A 1RA6A 3OLAA 1VSFA 3K5NA 2ASLA 5KFHA 3DRRA 3QO9B 2HW3A 4FJ9A 3JYTB 5DQGA 2W9BB 2JGUA 5DGBA 2HNYA 4TLRA 1U09A 1KSPA 1KFDA 2W9AA 4W5NA 1T05A 3I0SB 3AO5A 5KG7A 3CYMA 4OKJA 4DTUA 2R8JA 3SZ2A 3PO5A 4Q8FA 3P83D 3FFIB 2HNDB 4J2DA 4E3SA 1GOAA 3SFUA 3QEIA 3DI6A 2VA2A 4FK2A 3O3GA 3VQCA 2V4QA 3C6UB 2EC0A 4FK0A 3ISNC 4FZZA 3KLIA 1ASUA 4GC6A 2Z1JA 5KFQA 1N6QB 3OL6A 5KFUA 1R0AB 4BE1A 1NK8A 1RT3B 4EZ6A 1IO2A 4DSIA 2YKMB 1L3TA 2YKNB 1EP4A 1C1BA 1RT5B 2LSNA 4C8OA 3MR5A 1S1VB 1DLOB 3K2PA 1C0TA 2C2EA 3BGRB 2B43A 3K5OA 5KGXA 4ZTJA 4MK9A 4NLOA 3KK2B 4NCGB 5F8NA 2OPPA 3TAMA 4EBEA 4FM1A 5KG4A 3KK3A 4ZVGA 5KG3A 2XY8A 5KTQA 4B9VA 4KHUA 1NNDA 1VSHA 1MU2B 2FLLA 5T7BA 2JC1A 1REVA 3T5KA 3DOLA 4K4YA 1FK9A 4FJJA 4ED0A 4J9LA 1U49A 4FW2A 3VQBA 5J2MA 2AWZA 3AVNA 3NBPB 3MXJA 3VQ9A 3I5CA 3M8SA 4H4OA 2ZE2A 1QQCA 4N5SA 4W5OA 3OYBA 2ASDA 4E1MA 3Q8PB 4K8XA 1S0MA 3NF6A 3DLBA 3V81B 5HLFA 4Q5VA 5KFVA 4CK2A 2BANB 2C2DA 5J2QA 3MR3A 5JUMA 2GC8A 3KKSA 5JS1A 1KLMB 3PR4A 3VQ6A 3ZT0A 3SNNA 1NJYA 1SL1A 4WXOA 1L3SA 4F2SA 2WCXA 3KHLA 5DG9A 1NJWA 2D3ZA 3AVHA 1S1XB 4CEEA 4KSEB 4QAGA 3T19A 3QO9A 2W9BA 1RBSA 4CEOA 4LD0A 4F8RA 3PX6A 4MIAA 3I0SA 3L3VA 3PV8A 3C6TA 4J9NA 4PWDB 4DQQA 3NGZA 4EO6A 3FFIA 4AHSA 2HNDA 4CJKA 3NGDA 2Y1IA 3CQ8A 4B08A 3C6UA 1BGXT 5J2PB 3CDUA 4FZYA 3S3OA 4KREA 1N6QA 2D41A 3SQ0A 1R0AA 1RT3A 3VA0A 4J9MA 4YR2A 3RAXA 4CGJA 1J5OB 2YKNA 1WNEA 1RT5A 2YNHB 5I42B 1S1VA 1DLOA 5F8JA 3BGRA 5CZ1A 4NYZA 5KT6A 3K59A 3L2VA 3O3HA 4EZ9A 2BE2B 1JX4A 4DSFA 3KK2A 2AX0A 4NCGA 5JXSA 2W7OA 4ED6A 2WONB 3KMSA 2VG7B 1NKEA 4J9OA 1S4FA 4DSEA 3QIDA 3PO4A 4B9SA 1O1WA 1WNSA 5KFMA 4KE5A 2YV0X 2HHQA 2WK4A 2HWIA 2HVHA 4K4VA 3ITHB 3M9NB 4CEDA 4E7HA 1NOZA 3KJVB 3SPZA 3KLGB 2O5DA 1TK0A 2HHVA 1YVFA 3AA4A 4MKAA 3PW0A 2OPSB 3PW2A 1TL3A 4AHUA 3NBPA 1YT3A 4DL4A 3NFAA 1IG9A 3T5HA 3E01B 4ECXA 2XWYA 5HRPA 2E6MA 3AA2A 3SUQA 4FVMA 2W42A 2F8SA 3DRPB 3RB3A 4FJGA 3NAEA 5SWMA 4O3SA 3V81A 3ZSWA 1HJRA 4DLEA 4RNFA 2BANA 4O55A 4OKKA 3QYYA 4CGFA 5KGWA 4Q0BB 4LSNB 1QSSA 1KLMA 1S6PB 5KFZA 2XY7A 4DTNA 2FVSA 3DOKB 2JLEA 1C2PA 2RF2B 4BACA 3ICLA 1S1XA 4I2QB 2FLPA 4JV2A 4F4KA 2EX3A 4CF8A 5E41A 1K1SA 4DSLA 4Z4HA 3EPGA 3OYNA 2RDJA 1JL1A 3AVJA 5DG7A 3ZT1A 1IKXB 3V9XA 2ETJA 5T14A 2Z1IA 4JV1A 4G1QB 3TI0A 4KHRA 5F8HA 4Z4CA 3V1QA 4PWDA 4W5QA 2KW4A 2ZD1B 4Q43A 3PW4A 2B6AB 2RN2A 3DLEB 3G6XA 2Q3SA 1JL2A 4E0DA 4E89A 1S6QB 3CDWA 2XC9A 5J2PA 1J53A 3CDEA 3I8DA 5F8MA 4N41A 3BSOA 4AH9A 4CJ3A 5KG6A 3T3FA 4CHQA 1TK8A 5KT5A 1KTQA 1HYZA 1RT7B 3NGIA 3H5SA 4HHTA 4CF1A 2YNHA 5I42A 4MIBA 5SZTA 4HKQA 3PW5A 3V9WA 4O0JA 2BE2A 3I5AA 1A5WA 1C0MA 4F2RA 1HMVB 2CJQA 3QGIA 4M3WA 4TN2A 2WONA 3NE6A 2VG7A 5KG2A 3DRSB 4KO0A 3SV3A 2R8HA 3N6NA 3DDKA 3ITHA 3KJVA 3E51A 3KLGA 3G86A 3TAPA 1S1UB 3OSPA 3TAFA 4PQUB 4CFCA 1GX5A 4FJNA 1ZTTA 4PA1A 4UQGA 3CFOA 2OPSA 1KLNA 3GIIA 2IS3A 4NLVA 3U3GA 3DM2B 1ZBHA 4BDZA 1ZETA 1Z25A 3S9HA 1HQUB 2PYLA 3E01A 3AVAA 3VA3A 3AO2A 2UVRA 3EYZA 1BIUA 4ZVFA 4M3XA 3CFPA 4CEQA 3DRPA 1VK0A 4NLDA 2Z1HA 4K4UA 5EWFA 1JXEA 4C8LA 1KFSA 4RNMA 4Q0BA 4LSNA 5KFCA 2ZKUA 3OJSA 5L9XA 1S6PA 2ILYA 1T3NA 4F3OA 1ZBFA 2KZMA 4CJ5A 3GILA 1RDDA 3HVRA 3DOKA 2I5JB 4ZP9A 4JS5A 3IG1B 5FRMA 3HVTB 1ZBIA 2RF2A 3DLGB 1RILA 3AV9A 3WNHA 3V6KA 3AVFA 1MMLA 4I2QA 4B9TA 1RBTA 1T94A 2IGIA 1RTHB 1QS4A 1Q8IA 2F8TA 4IRCA 2XHBA 3HVWA 1IKXA 2V4RA 2JEIA 1N56A 3H08A 3ZSOA 1RT1B 4XPCA 3PX0A 4G1QA 3C95A 3MAQA 2ZD1A 1TAUA 3QNNA 4I7FB 3DLEA 5K14B 4RUCA 4CJEA 1Q9XA 4DS5A 2IC3B 3WNEA 2ATLA 3OYEA 1YTUA 1S6QA 4DQSA 4KB1A 4ZPDA 3P1GA 3BSNA 4O3PA 5EU7A 2QE5A 5KFTA 3PUFA 3NF8A 1RT7A 4TY9A 4CJTA 4E7JA 5F8GA 4JUZA 2XGPA 2X74A 3KD1E 1LWFB 4Q45A 4DFKA 3T1AA 5DLGA 1GOCA 2AGQA 4O4GB 3DLHA 1HMVA 4NRTA 1X9SA 1A5VA 2P5OA 5DGAA 3NL0A 1EXQA 1KCFA 1TKXB 2IM3A 1CXUA 5J1EA 4FJXA 3DRSA 4OGEA 1TKZB 4IRKA 2KZZA 3NF9A 3MR6A 3TABA 4CEBA 1VRUB 3QEPA 3HSTB 3SI6A 3TAQA 1S1UA 4RW7B 4PQUA 5FROA 4B9NA 4E19A 4CJRA 2OPRB 3MR2A 4EP5A 3KHRA 3DM2A 3AVLA 1SL2A 4B8CA 4ELTA 2KFNA 1C0UB 1NHVA 3KIOA 2VWKA 3V4IA 1BQNB 4FBTA 3HKWA 3RRGA 1XR5A 1SKWA 4NLTA 4DTOA 2O4GA 3AVIA 4LH5A 2FBXA 4ID1A 4KTQA 1LWEB 2WRMA 3RB4A 2E9ZA 4WYLA 4CJFA 4TY8B 3RRHA 1ZBUA 4RW6B 3KTQA 4IQXA 3TR8A 4Y2AA 3CJ4A 4ZP6A 4M45A 5KG1A 2AGOA 3OJUA 3C6TB 2I5JA 4FJMA 3F73A 3IG1A 3HVTA 3AO4A 3V6HA 3DLGA 2F8EX 4J2EA 1U4BA 3JSMA 4O44B 1RTHA 1KRPA 4KV8B 1RT1A 2X78A 5HRNA 1HNIB 2FVPA 4DTXA 5CZ2A 3LWMA 4KB0A 4JS4A 4KHSA 1S97A 1SH0A 1RBUA 4KHYA 4B3OB 4I7FA 1JIHA 2G8IA 5K14A 1JXLA 3L2UA 4TSXA 4ECRA 3S3MA 4IBNA 3U6FA 4WZQA 2IC3A 4WFZA 4DU4A 4RW4B 4URSA 4CJWA 2ASJA 3QLHB 4KHNA 4CF9A 4BDPA 4CGGA 1IKVB 1QAJA 3OYGA 2D0AA 1BL3A 1VSJA 3AVMA 3OHAA 3L2QA 4DSJA 4XO0A 1K6YA 2R2UA 5FRNA 2X6NA 4NLSA 4KAIA 1HARA 5DQIA 2FLNA 3UDLA 1LWFA 1TL3B 3ZSYA 4E7KA 4O4GA 4QWBA 1YVUA 1BCMA 2Z1GA 4K4TA 5C24B 1SUQB 4AHRA 1D0EA 1S0OA 4C8KA 4GC7A 1Z4UA 2GV9A 3KHGA 3FDSA 1TKXA 3SV4A 3F9KA 2YNGB 4Z0UA 3SJJA 1TKZA 1VSLA 4O4RA 4URQU 4FM0A 3VQEA 1VRUA 2XY6A 3K5LA 4OPJA 4RW7A 1ZTWA 3AA5X 4TYAA 4Y2CA 4CJSA 2IJNA 2OPRA 3CJ3A 1WAFA 4QCLA 4F3TA 4FK4A 4BDYA 4J9PA 3RMBA 1C0UA 4LSLB 4CHNA 2DFHA 1BQNA 4N47A 3GV8B 3GYNA 3ZSQA 4IR9A 3CVKA 2G8UA 1CZ9A 1SH2A 4BWMA 3G10A 1LWEA 5F8IA 2RDIA 2RKIB 4TY8A 2A1SA 4CJ4A 4RW6A 3UIQA 3M9OB 1ASVA 4ZTFA 4C8NA 3K57A 1EETB 2E9RX 3BSCA 2R2RA 2IJFA 4DTMA 4OPKA 3QZ8A 3LZIA 4YR3A 3NMAA 4TQSA 4DF8A 3MXIA 1WSFA 2JC0A 4ECYA 3V6DB 4HCBA 3HT3A 1LW2B 4DU1A 1ZBLA 4O44A 4QWCA 3DLKB 2R2TA 2OA8A 5FDLB 2GBZA 4KV8A 3OHBA 1HNIA 5KFOA 1G15A 4N56A 3Q8SB 3PY8A 2KTQA 2BGGA 2OZSA 1TP7A 1L3VA 4B3OA 3G0ZA 1CLQA 3MECA 4M3TA 3VQSA 3KLVA 3KK1B 3IRXA 1RTIB 4RW4A 4NLYA 4TXSA 5EUHA 3QLHA 2OZMA 4Z4EA 2YNIB 1IKVA 3D45A 3IGVA 4NCAA 4KO0B 4FJ5A 1S1TB 1QHTA 3CIZA 1JLQB 4O3QA 3I5BA 3B6OA 1XC9A 3HK2A 1CXQA 3N6MA 4MQ3A 3VQ8A 4E7LA 1BI4B 4LH4A 4CEAA 2P5GA 3NGYA 3RR8A 1S1WB 1FKOB 5KFPA 5C24A 1SUQA 1XHZA 4KTWA 3HO1A 3U3YA 2QV6A 1KVCA 4CFAA 1HYSB 1S9GA 2YNGA 4IG3B 3KOAA 3V1RA 4RNHA 1W9HA 1VSEA 1WSEA 3BR9A 4DSKA 4GW6A 1BHLA 5KFGA 4O3OA 3PHEA 4WXWA 5I3UB 3UR0A 4ECQA 3DLRA 4RZRA 3ZSZA 4WE1B 1NK4A 1L5UA 4LSLA 1X9WA 4W5TA 3VQQA 3ZT3A 1SV5B 4Y1CA 4Q8EA 4CEZA 1I39A 3OYHA 5KT7A 4RNNA 1N5YB 4HUGA 3OYIA 2UUWA 5KFKA 4DL7A 2ALZA 4RG8A 3VQPA 1JLEB 4DWIA 1HYVA 3RTVA 2RKIA 2DFEA 5D3GB 3ASMA 1WN7A 4F4WA 1EETA 4URGA 2FBVA 3QZ7A 4KRFA 2UVVA 4FYDA 3KHHA 1TAQA 3V6DA 3VN5A 3BSAA 1LW2A 5EDWA 3LPUA 2G8FA 4IH7A 4E1NA 4ECSA 5KFDA 4OL8A 5KG0A 3DLKA 5FDLA 4FJHA 3H40A 1RTDB 2XI2A 3D5MA 4ED1A 4AHTA 3WNGA 1UA1A 1ZYQA 3PX4A 5DG8A 4MH8A 3NKYA 2XO7A 1RT2A 1NK0A 2UUTA 2RPIA 2P1JA 3KK1A 1UAXA 1RTIA 5DLFA 1S0NA 3TWHA 2J6TA 1TVRB 3OSNA 5KFXA 2YNIA 5J1EB 2FJXA 5KG5A 2XCPA 1S1TA 5KFEA 1BCOA 2HAIA 1JXBA 3I0RB 1JLQA 4CGDA 5KT4A 1QSLA 3ZCMA 2CKWA 2JEFA 3RMCA 1NOYA 3SPYA 4M3UA 1BI4A 2B5JB 3ZSVA 2G8VA 4ZHRB 3LANA 1JLFB 4CERA 3THVA 2FC0A 4JV0A 5KRTA 4YNQA 1S1WA 1FKOA 3H4BA 4IRDA 4BE2A 3NH1A 2HVIA 3V4IB 5KT3A 2D0CA 4KFBB 4HUEA 1HYSA 1XWLA 4IG3A 4MKBA 3QETA 3EZ5A 2OH2A 1JLGB 4FLUA 3IN5A 3TAGA 3VQ5A 5I3UA 1XI1A 4C8MA 1LWCA 3ISND 3HP9A 1FKPB 4WE1A 3OS2A 4KKOB 3OS0A 4M41A 3CWJA 1SV5A 4WFYA 3HPHA 3IS9B 4QW9A 4HCCA 3SQ2A 1L3UA 2V9WA 4DG1B 1YTAA 2FBYA 3PZPA 3KD5E 5L1JA 1N5YA 4NZ0A 5HROB 5L1IA 4FLZA 3JSMB 1BISA 4HUFA 3SYZA 1JLEA 4ZVHA 4FLVA 3OL7A 3GV7B 4KHMA 5F9NA 3DYAB 5D3GA 3UPFA 1LW0A 4WYWA 1B9DA 5CYQB 4CE9A 3HPGA 1TQLA 4LQ9A 1CZBA 4FLTA 4R5PB 3KLHB 4DL3A 1RDRA 2GIQA 1NK9A 4ICLB 4F4XA 1QE1B 3CFRA 4ZPAA 3FRZA 2B4JA 4QPXA 3MEDB 2WOMB 4I9QA 4CGIA 2IM1A 2NUBA 2QK9A 4K4WA 4ZPCA 3KNAA 1RCHA 3T5LA 1RTDA 3C94A 3VQAA 2Y1JA 3V6JA 3CG7A 4TQRA 3CO9A 2D5RA 3M8QB 3G6VA 1RT4B 2QXFA 5KFLA 2BRLA 4IH5A 4ZMMA 3HM9A 1IKYB 1WSIA 3HHKA 5KFYA 4RU9A 1EX4A 1S9FA 2HHWA 1SKRA 4DQPA 3PJWA 1T7PA 2FJWA 4I9LA 3CJ5A 4CIEA 2YHBA 4DLGA 1TVRA 1TKTB 3M9MB 3RBEA 3NCIA 3OYKA 4EP4A 3I0RA 3MEEB 1K1QA 4BWJA 3ALYA 1JLAB 1FXXA 1JLCB 4QWAA 3BQ2A 2B5JA 4OGCA 3QEXA 4ZHRA 2HB5A 1JLFA 4DL5A 4DTPA 4DMNA 1UOCA 3GIKA 2D0BA 5CYMB 4CF2A 1J9AA 4KFBA 4OVLA 3H5XA 2UVUA 1QSYA 4GVMA 1JLGA 1RBVA 2XI3A 3PJXA 4MFBB 4NLUA 3BQ1A 3LWLA 4IKAA 3AVBA 1Y97A 1ASWA 3TVKA 1JLBB 1A5XA 5C42A 4CJQA 3DMJB 1FKPA 4Z4IA 1VSMA 4H8KA 1TV6A 3QIOA 4YMEA 4KKOA 3QINA 1C1AA 2X6SA 4XIUA 3IS9A 2XGQA 4DG1A 5HROA 4FJIA 1TKDA 3AVCA 1XR6A 4O0IA 4CJPA 4RW9B 3HXMA 3DYAA 3UQSA 4DQRA 3FQKA 2UVWA 3MTKA 5CYQA 4DQIA 1WSHA 5HRSA 4R5PA 3KLHA 4PUOB 4FLXA 4ELUA 1N48A 3SUNA 3OS1A 4CIGA 2IM0A 3MECB 4ICLA 1QE1A 2W7PA 2FVQA 4CESA 3IRXB 2C2RA 3MEDA 3QIPB 2PY5A 3GIJA 2WOMA 2VG5B 3OYJA 3PVXA 2V0NA 4CFDA 4CHOA 1RNHA 1T8EA 4OKEA 3V1OA 4ECZA 3OYAA 1DTQB 4GMJB 1U48A 4L8RB 3ZSXA 3O4QA 3M8QA 2C28A 2D7SA 1DTTB 1RT4A 4DL6A 4FJ8A 1UA0A 5L1KA 1IKYA 3MXMA 4HTUA 3RB0A 1T03B 4NLWA 3V9ZA 2FVRA 1TKTA 1S9GB 4CGHA 4ID5B 4HYKA 3CJ0A 3KLFB 3MFIA 5KFJA 3MEGB 3MEEA 2DY4A 1NK6A 1JLAA 5KFFA 2HNZB 1JLCA 1J54A 5L1LA 2FJVA 3LALA 4Z4FA 1F21A 4LQ3A 2G8KA 3MFHA 2I1RA 3OYLA 3OYFA 2C22A 5CYMA 3O4NA 1HPZB 4ZPBA 4H54A 5KFNA 1S5JA 3KLEB 3CJ2A 3LP3A 3SUOA 3PW7A 4MFBA 3FQLA 3A2FA 2VA3A 2IA6A 3SFGA 4FCYA 4Y34A 1ITGA 1JLBA 3DMJA 1IH7A 4QW8A 2VG6B 3D28A 4TYBA 5CY4A 4ELVA 1SL0A 1W25A 1TL1B 4CHYA 1SKSA 4CECA 5C25B 1GOBA 4CK3A 1C6VA 2G8HA 4DTSA 3GIMA 1C1CB 2OPQB 3K58A 4Y1DA 3JYTA 2J6SA 4K50A 5KI6A 4RUAA 4DFMA 2YHAA 4J2BA 3RR7A 4Z4GA 1QUVA 4FZXC 2W9CB 3OL8A 4RW9A 4NLPA 1NKBA 3QEWA 4G3IA 1D9FA 1VSKA 3ULDA 4M3RA 2EHGA 4K4XA 1S9EB 1B9FA 4J9QA 4F50A 4CJVA 1U04A 1KHWA 3M8RA 3EPIA 1IKWB 4EBCA 4PUOA 2IM2A 2IDOA 4EO8A 1RBRA 1RYRA 1RT2B 2ATQA 2BQRA 3RAQA 3ZSRA 2XY5A 3QIPA 4M42A 1RYSA 3TARA 2YKMA 2VG5A 4IKFA 4RNOA 4J9SA 4AHCA 1LAWA 4ZP8A 1X1PA 1DTQA 2P51A 4O3NA 3SUPA 4R0EA 4XPEA 3QESA 4RW8B 2OYQA 1DTTA 3EY1A 3HYFA 5HRRA 3LP1B 3RMDA 3HL8A 3TANA 3O3FA 5KFRA 3SI8A 1T03A 4ECUA 4NCBA 1NK7A 3WNFA 5KFSA 1RDCA 1MU2A 3G6YA 4J2AA 4CFBA 1HRHA 4ID5A 2AGPA 4F4ZA 4IR1A 4N76A 4JRPA 3AVKA 3KLFA 4B9MA 3MEGA 3BJYA 2YNFB 2QKKA 4OLBA 4M3ZA 1RDAA 2HNZA 4CK1A 5J2NB 3M8PB 3LAMA 3NF7A 4OLAA 4DU3A 1LWCB 4DS4A 4ECWA 4CEFA 4DF4A 4O5BA 2ZQBA 3L2RA 4ED3A 2AU0A 3HJFA 2FBTA 1NKCA 4B9UA 4JLHA 4R8UB 1SH3A 2DPJA 1HPZA 1GX6A 4WFXA 3H98A 4EYIB 1D8YA 3KLEA 2HHUA 4B9LA 3RMAA 5JS2A 4M3YA 1JKHB 3LPTA 3SQ1A 4FS1A 1QTMA 2W8KA 2R7YA 3LDSA 1I6JA 4QWEA 3AO3A 4DL2A 4X2BA 4FXDA 3QGGA 1LW0B 3NH2A 2VG6A 4YP3A 4H4MB 5KFBA 4IH6A 3IGNA 1TL1A 1HNVB 5C25A 4DEZA 4ECTA 4I2PB 3CM6A 4ED8A 2HHSA 1C1CA 3TQ1A 2OPQA 1LV5A 1WAJA 3QGHA 3H2LA 4CIFA 3OYMA 5DMRA 4NLQA 1RTJB 3P5JA 4AHVA 4KI4A 2KFZA 4NLRA 4QWDA 4ED7A 3OL9A 5DK5A 3L3UA 4NYFA 1NK5A 5HBMB 3BQ0A 2W9CA 2DTUA 5EWEA 4ED2A 4KB7A 4FM2A 2PYJA 1S9EA 4JRQA 3FSIA 3EZUA 3H5YA 3LP2B 1RT6B 3GQCA 3Q8QB 1IKWA 4IDKB 4M95A 2G8WA 1D1UA 4B8AB 3HP6A 2HMIB 2BRKA 4KHWA 4K4ZA 4CJUA 2JEGA 3BDPA 3L2WA 4W5RA 5HP1B 1RDBA 1S48A 4IFVB 3NAHA 1WSGA 2BR0A 4CHPA 4NYNA 4DTJA 4E7IA 1UWBB 1LAVA 1U45A 4FLYA 2F96A 2IAJB 3ZT2A 1J5OA 4MK8A 4AILC 3L8BA 1VRTB 3VQ4A 3RB6A 3AO1A 4OJRA 4NRUA 3CM5A 4KBIA 5KRSA 1BQMB 3D0PA 1OS5A 3IAYA 3KMQA 4PY5A 5F9LA 3QNOA 3QERA 4RW8A 3S3NA 4IG0B 3LP1A 4O3RA 4FW1A 2WB4A 2FVCA 2QKBA 4FJLA 4Y3CA 4YFUA 1RAJA 4FJ7A 2XCAA 1W0HA 1HQEB 1QAIA 4BE0A 1RA7A 4FBUA 2PZSA 4KI6A 1XR7A 2J6UA 1S10A 3H5UA 1I3AA 4CJLA 4F4YA 2YNFA 4CHZA 5J2NA 3M8PA 3OY9A 2IOCA 5C42B 3H59A 2D3UA 1IM4A 2BDPA 1TV6B 4IFYB 3LP0B
chains in the Genus database with same CATH superfamily
4DPUA 4KTZA 1CC7A 3TAEA 2AJQA 3NGKA 3LAKA 1WC6A 2VDIA 3CCVN 3AGKA 3KXDA 4HT7A 5B0CA 1N8RO 2O8BB 4PAAA 3RWUA 3MUVP 3SQ4A 2FY8A 1NJXA 3NEKA 1U0HA 1X4BA 4ILHA 3BYPA 4DTRA 5B8HA 3OVBA 3H45C 4HACA 4EBDA 3ENWA 3PSIA 2DITA 2MQOA 2BQ3A 3DI6B 3GB0A 1NMNA 2VC1A 4CH7A 2VV5A 4NLXA 2C3YA 3V9SA 3KKRA 1OKJA 1XEZA 1RTJA 5DDRC 2A3ZA 2LU2A 3FBEA 4EWTA 4FJKA 2UXCK 2E4LA 1YIJS 4FOEA 2LXIA 2AJFE 4B02A 1C1BB 3UKRB 3PJ9A 4EEYA 2XRIA 3ZZ0A 2UZAA 3G82A 3I31A 1OO0B 2FTRA 2JEJA 2YY3A 1E3MA 1TL7A 3L7UA 2Y1RI 4DR4J 5KT2A 3IBFB 1AFJA 4F0MA 2PIIA 1IWAA 2R8GA 3T7ZA 3HPOA 4KPYA 1VQMN 3DOLB 5KFIA 4MKYA 2WTFA 3PKYA 2RRBA 3IP0A 1T02A 3DDIA 3RBDA 1WBDA 5J2MB 4H4OB 1R27B 3CD7A 1WLJA 2G0IA 1JJ4A 1NGHA 2B0GA 2ZHBA 2V9KA 1KXPA 2RSQA 2D74B 1W2BR 1MDUB 1HQEA 2BJDA 1N4LA 5J2QB 4PG5A 1EKEA 1KVJA 1BIZA 2A1RA 2IVOA 4K2XA 3G25A 3OT9A 1BE4A 2DPIA 4LY7A 2IDLA 2E6LA 2MGZA 4M63A 2XS2A 1KVAA 3NGUA 1N33F 2F7TA 4U6PA 3ZT4A 1C4CA 3M30A 3J7ZT 3NH0A 4IFYA 1RA6A 5F3TA 4DN0A 3QO9B 1FE4A 4FJ9A 3JYTB 2F9TA 1F2HA 1G4CA 3BGUA 3V5RA 2NPIA 1F0XA 3GFXA 4W5NA 1T05A 3I0SB 2LCWA 3CYMA 2KRBA 2XULA 4DTUA 3PO5A 4Q8FA 2YX1A 2F40A 1RBAA 4UTGA 3U9ZA 3U1MA 1D4XA 1JCEA 1U1NA 1ZPWX 2HNDB 3KG0A 4LF4J 3CMAS 5HMWA 3W66A 2WW4A 4OZ1A 2ZVSA 3QEIA 2ZH9A 1VISA 1N34F 4A8MP 4NXNF 4FK2A 2V4QA 3CSKA 2ZWOA 4FZZA 2H54B 3KLIA 1ASUA 4GC6A 1N6QB 4IQMA 4OI2A 1KDNA 3CHWA 2AJ2A 4U7BA 4EZ6A 2CJKA 3BY5A 5JVHQ 2LU1A 5FLXU 2LSNA 3D2EB 4C8OA 4BG9A 3MR5A 3BGRB 2B43A 1NBEB 4USVA 4B3RF 3CCJN 4NLOA 3D9BA 4LRDA 4M8LA 4NCGB 2OPPA 3VTHA 5KG4A 4AL5A 2AKWB 2IVMA 2EW9A 4B9VA 5H9EK 5AQLA 4GVLA 1U25A 4QU6A 2AYBA 4FDFA 1R8AA 5CHIA 3OTEA 3P31A 3HZEA 1FK9A 1U49A 4XH1A 3KFWX 2VL1A 3VQBA 4DKWA 1R89A 2D3OR 3D54A 3AVNA 3I5CA 2L9DA 4DI6A 2XLJA 2RE2A 4X62K 1X60A 5F1XA 3JS6A 2K7JA 4HVZA 3Q8PB 3QFUA 3OV7A 2OFGX 1T9WA 4Q2LA 5KFVA 3MM5A 1I5OB 5ADZA 1WG4A 5TKYA 4BVOA 1CS4B 5LY3A 3PR4A 4CO5A 5GADI 1NJYA 1SL1A 2DT9A 2QMXA 1DGKN 2HVDA 1F1BB 3AVHA 5DS7A 4JI5K 5E7OB 2KM8C 2VFUA 1JCGA 2W9BA 1RBSA 3IWLA 4WTOB 3AJ2A 3PX6A 4IOCQ 4DR1F 2HQFA 3C6TA 4PWDB 4DV6F 2FF3B 4BRQA 4DQQA 3QJPA 5HVGA 1VQON 1R3NA 4EO6A 3P39A 4CJKA 1CEZA 4B08A 3C6UA 1BGXT 1U7LA 2Y9HA 5AQSA 1RT3A 3OD2A 4J9MA 2LQ5A 2I38A 3RG6A 1J5OB 2YNHB 4JI6F 2ZVIA 4JI4F 1DLOA 5CZ1A 4ANCA 2CH6A 3OVAA 1HIYA 1KONA 3L2VA 3O3HA 2XTJP 4DSFA 5DM6L 2DR9A 3KK2A 5SUHA 1NG9A 4PKDB 3M3ZA 4ED6A 3KMSA 2FJAB 2VG7B 3ENVA 1NKEA 3EKUA 4IO1A 1S4FA 4D3GA 3QIDA 1O1WA 2ZDOA 2FHJD 3TW0A 2WK4A 4K4VA 3EGWB 4E7HA 3SPZA 1RU1A 2HHVA 3ENQA 3L9ZA 4GV6A 2K3KA 4W92B 2KHOA 3AD8C 3NBPA 2BKOA 3OFEA 3NFAA 3T5HA 1QLNA 2XWYA 3VGSA 2CFXA 3SUQA 2F8SA 3THYB 4FJGA 3VTIA 4O3SA 3ZSWA 1HJRA 2VYPA 1B99A 1RWPB 3TTFA 2BJ7A 4OKKA 5KGWA 4Q0BB 2VOOA 1ZM3A 1UVNA 5DETA 2HURA 3R1LA 5KFZA 3CCTA 1MROA 2FVSA 1C2PA 4BACA 1S1XA 1DURA 4I2QB 1U2CA 4F4KA 4CF8A 2OIHA 4Z4HA 1RK8A 1MWYA 1GAOA 2ROGA 5M1QA 3KG1A 1IKXB 2EI5A 2O8EA 4XK8C 4DV0F 2Z1IA 3TI0A 4DHVA 3HM8A 3V1QA 2OGUA 2CH5A 2N82B 2RN2A 1AUDA 3CXCM 3DLEB 4KHPK 3G6XA 2F4FA 2YI1A 4E0DA 4LIRA 2XC9A 5J2PA 4BC2A 1YDLA 2WVFA 3C6AA 5F8MA 4CJ3A 5KG6A 4GY2B 3T3FA 3D3CJ 5KT5A 4DV2K 1HYZA 1RT7B 3NGIA 5A0YB 4A61A 4ES3A 4HHTA 4CF1A 5D4NA 1Q53A 2P8IA 5SZTA 1HLWA 2L41A 3WBZA 3RBXA 4HKQA 3PW5A 2VJUA 1FTRA 2BE2A 3IKMA 4Y6IA 1A5WA 4F2RA 2CJQA 5J1PA 5DM7Q 2FPHX 2PEBA 1XNQJ 5KG2A 1W2IA 3LF0A 3DRSB 2QWLA 1CG2A 3SV3A 3SQGA 3CUNA 3OR1A 5ETRA 3BGFA 3G86A 3TAPA 1X4FA 3QPIA 4CFCA 4DR4F 1ZTTA 3KUGA 2OPSA 1NWKA 3DM2B 2XQCA 4GV3A 2NRHA 3E01A 3AVAA 1Y11A 3GSDA 2DNPA 1I94K 3L7PA 2YKAA 4CBUA 3O6WA 4ZVFA 3LH2S 3DRPA 1URRA 1S7IA 2ZH5A 2Z1HA 3AJ1A 4DV3J 5EWFA 4IJNA 1KFSA 2N4DA 3N79A 3QSYB 1KWMA 4F9OA 4JK9A 3ZXWA 3GILA 3NS7B 4B3MJ 3AOCA 4ZP9A 5AQXA 3LOUA 2RF2A 1REGX 4JV5F 3WNHA 3ZX3A 4B9TA 5EY4A 2B7BB 1LOUA 2F8TA 3BN7A 3VEVA 1AW0A 2F9WA 2JEIA 1N56A 3NNAA 3NWRA 2CPDA 3L3CA 1RT1B 3WIUA 2P9IB 5ELZA 1RDUA 4LF9K 1X4HA 2W2PP 1IBLF 1IR2A 1XMOF 2ZD1A 2CGKA 5K14B 1Q9XA 1VQ7S 3WNEA 1CJTB 1RACB 3IAS9 3OYEA 4BRIA 2QL9B 5GIPA 4KB1A 3CPWM 1VQ8N 4LF4F 2KYZA 1LFWA 4FXVA 4E7JA 2ZM6K 1WELA 2CJ9A 4HWIA 1VQOS 3DLHA 1FJGJ 5DGAA 1CXUA 5J1EA 1DQ8A 1GLLO 4OGEA 2Q6CA 1TKZB 3OPKA 2NRRA 1RWXB 1YTYA 1WD6A 4HTLA 3HSTB 4QS8A 3TAQA 1OH5A 4PQUA 5FROA 3IXQA 3IBCB 3EDQB 2OJ3A 4EP5A 5LMUF 3GBTA 4B8CA 1FNOA 1M1KO 4CLFA 1RCOB 3HKWA 4M5GA 5G0RB 4C48A 3CC2N 2KXNB 3MM8A 2JLGA 2ZEJA 3T1HJ 4WQ5C 4LH5A 2NZTA 1KEKA 2FBXA 2J9DE 4QBUA 4ID1A 2EFQA 3W65A 3R7BB 1LWEB 2WRMA 4DR3J 4NA1A 3EDRB 2EKYA 4CJFA 3VESA 2DK2A 1ZM4A 3KTQA 4LFBF 1HWUA 3TR8A 4ZP6A 4TVAB 5KG1A 3K7RA 2AGOA 3J7AP 5FLXY 2N7CA 1FX4A 3NOCA 3FZBA 4FJMA 4JI8F 3IG1A 3IRWP 2RE1A 5D15A 2C3MA 3AH6A 1JWWA 5BPMA 3F0NA 5F3ZA 4J2EA 5DZ6A 1VQNN 4O44B 4AXIA 3TPQA 4ZPVR 3OFFA 1SJ4P 2X78A 3TSUA 1H74A 4QYRA 5E3AA 5B0EA 3D67A 3LWMA 4JS4A 1S97A 1SH0A 1GMUA 2VBWA 3FC9A 4I7FA 3UVJB 3L2UA 3N01A 2CNOB 4BY9C 5A8WA 4ECRA 2JZ5A 4DU4A 4JI7K 4BDPA 1IKVB 5BR8F 3DGPB 3WX4A 1BL3A 1VSJA 3AVMA 3OHAA 2R2UA 3TVZA 1HWJA 5ETLA 2Q1LA 4Y65A 5DQIA 1Y3KA 3OFGA 4J9VA 4E8UA 4ZA1A 2HVEA 1YVUA 1BCMA 3LA0A 1S0OA 2VASA 4W4MA 5BRDA 1Z4UA 4ZCIA 1TKXA 5FJ4A 4A2AA 5HVHA 3FRYA 4JI0J 4OPAA 2VQEJ 3SSSA 2VBXA 3Q7CA 3JTOA 3VQEA 2CQBA 3HULA 1GLBG 2K2PA 5C2CA 5LM7E 3AA5X 4TYAA 4UQTA 1TTHB 4LVOP 4Y2CA 4CJSA 2IJNA 3U9DA 4G9ZA 1WAFA 1YVNA 3L6QA 2PC6A 5HATA 1BQNA 4OLOA 1VK8A 2SXLA 4EUVA 4OQJA 4DOZA 3G6ES 3R6GB 3R7NB 3P96A 3FMBA 1SZ2A 1U1LA 4X4NA 3HF5A 3DOMA 4EAHD 1FFGB 5F8IA 2RDIA 4LF6J 1ATRA 4ERDA 1ASVA 3K57A 2E9RX 2UUBJ 5ETSA 2GWJA 3HSDA 3OTBA 3HX9A 4DTMA 1WACA 4OPKA 4YR3A 2E5LJ 3MXIA 4ZKAA 3Q86A 3HT3A 1LW2B 2QYCA 3TUZC 3MM9B 1DARA 4LFCJ 5IC4B 2EWSA 3QGPA 3GL1A 2H4WB 2HBMA 1G15A 3LDLA 3TZWA 2QA4S 1L3VA 1RAAB 3MECA 4E2FB 5D8HB 4JD2B 3IRXA 1RTIB 2W2MP 2NYHA 3QLHA 1HA1A 3D45A 3IGVA 4NCAA 3THXA 2KYXA 1S1TB 1T9UA 2NPFA 2KJWA 3WXIA 4E7LA 4CEAA 2CWKA 3X1LB 3J7ZO 1GLJO 3NGYA 2YTCA 1BLUA 1NDKA 3VOVA 5KFPA 5C24A 4KTWA 2B9WA 4Y0FA 3KJQB 5LSOA 1KVCA 3GIRA 4CFAA 2YNGA 1V6HA 1VQ8S 3V1RA 2XWXA 4U67Q 4RNHA 3BZQA 1W9HA 5C12A 4CLYA 4Z7CA 1SBRA 4O3OA 1XNQF 1ACMB 1U0SA 4ECQA 4ES1A 1WOSA 3UW1A 4WE1B 1NK4A 2ZZNA 3P45B 4LSLA 4PWUA 2BKNA 3R5BA 1HHTP 4JYAK 3OYHA 3NMUA 2ZBIA 2HGLA 4M5NA 3VQPA 2MKJA 4LF5K 2JX2A 5LXRA 2LECA 3G8SA 4USKA 3BF1A 2WTUA 4DV3F 3HJVA 3UKUB 4F4WA 2A1BA 2OMOA 4Z94A 4YY3K 3NCPA 4KRFA 2UVVA 4NMXA 2Y0BB 4Y28C 2AIRB 3CC2S 5LJ5Y 1B0TA 2ZKTA 3KDOA 1I51B 4B3MF 3TUIC 2G8FA 2BV3A 5KG0A 3H40A 1RTDB 2ZFHA 3GYXB 1YG0A 3Q23A 1X9JA 2L9WA 3NGTA 2AYEA 3NKYA 1NK0A 5DO2A 5M1KA 3GDQA 3KK1A 1WG1A 2BX6A 2QWRA 1PYTA 3QRPA 1HNXK 3SDEA 2J6TA 3ID8A 1VQNS 5KFXA 2KJVA 2XCPA 2VPYB 2HAIA 3VEXA 2RQKA 2DHSA 2E66A 5D0EA 4BR2A 2DO0A 2CKWA 4M3UA 4CP5A 2B5JB 3ZSVA 1KP6A 2G8VA 2OD6A 3LANA 3VAJA 3THVA 3VMFB 3QJJA 2BJ1A 1RLCL 1FKOA 1OH7A 2E1AA 4IRDA 1KR4A 4M5HA 3WC0A 2RJZA 3Q22A 4KFBB 3W9IA 2QLWA 3QETA 2XHCA 4B3TF 3EZ5A 3HFKA 3EX7B 3DKDA 3GE9A 4CZFA 2DR7A 2P9EA 3C66A 4EK2A 2RRAA 1XI1A 2BUNA 3CIPA 5IT9O 1WWHA 1P1LA 5KQDA 4X4QA 3WXLA 1UFWA 1SV5A 4WFYA 1B7FA 5HI7A 1TMMA 1Y7PA 1L3UA 3SQ2A 3LQVA 2V9WA 3D1HA 3HSGA 2DNMA 3D0HE 2UXDF 2MQ8A 5AJ3K 5AQTA 1O0PA 3JSMB 4DR2K 1YJTA 4NMLA 4CZKA 2CUYA 1YJNN 3DYAB 2CPEA 2G1DA 2OI2A 4DXLA 3M2VB 3A4TA 1CZBA 1AZSB 1N5QA 2GO8A 1TYQA 3V4MA 3IM8A 3GOIA 3VERA 1URNA 1K9MT 2P9SB 4I9QA 4ZLLA 1WUUA 2XSJB 3T5LA 2BOPA 3VAGA 2Y1JA 3V6JA 3CG7A 3GLJA 5AFUH 3HKZD 5KFLA 2BRLA 5LSLA 4DR6F 2E1ZA 1IKYB 4DV4F 2ZOFA 1R7IA 1G7CB 5LMNJ 1SKRA 4DQPA 3PJWA 4I9LA 3CJ5A 1TKTB 2AP6A 3M9MB 2D1KA 2ZF5O 4S0MA 3RBEA 1FRJA 2CVIA 5HK4A 4EP4A 4C9DA 3IFEA 4P9SA 4H0XB 3W7BA 5AZIB 3GG0A 3SBGA 3M2UA 3RBZA 5EOYA 4RWXA 4QWAA 3ISZA 4ZHRA 2HB5A 3BM7A 5GAGP 3CCSN 4DMNA 4LVNP 4A4JA 1UOCA 1M5HA 4PL7A 3GFHA 3GIKA 4JK7A 1HNZF 1Q18A 4CF2A 4DCPB 1KQFB 1ZAXA 3H5XA 1K8AO 2UVUA 5D4OA 1FHTA 3BB5A 2CYYA 1JLGA 4MFBB 2YXLA 3O1LA 5IV3A 4AYBD 1JLBB 1BUXA 1T9YA 4Z4IA 1NGJA 2JH3A 1FJEB 3QIOA 4YMEA 4KKOA 1C1AA 5DDQC 5H9FJ 3GFZA 1I3OB 2XGQA 3M7VA 4DG1A 1S79A 3ONQA 5HROA 2XO6A 1WG5A 4NE9C 3QRRA 3FQKA 1E6VB 5T7LB 4LF6F 5HRSA 3OUYB 4R5PA 3KLHA 1N48A 3EE3A 1RADB 4LJMA 4OYPA 2UUBF 2UU9K 3M2RB 3TO8A 3DXMA 4KBOA 1OH8A 4TU8A 2GZOA 3GIJA 2QT7A 3KWGA 3MAAB 5JICA 1DTQB 3I56S 4WFNQ 1VQKS 4U8VA 4E98A 4X66J 3WEEA 3M8QA 4ES2A 1DTTB 1RT4A 4JP8A 1IN0A 2EFGA 4CTAA 2IFXA 3LGHA 4HTUA 2ZJPQ 1KAYA 4WWSA 1H0HB 2XMKA 4I6MA 4I4BA 5AQGA 4HYKA 2Q36A 1H72C 1S6OA 2A3JA 5JJBA 3MEGB 4JEPA 2DY4A 4DV1F 1EAYC 1JLCA 5LJ3Y 4X65K 4ITSA 4A5BA 5AFUA 4Z4FA 4IEEA 4LBHA 4JI2J 3PFEA 2G8KA 5IQ6A 3O80A 1PJ7A 2PFUA 4ZVRB 4M63C 2NRVA 5CYMA 4HDHA 2NRTA 3O4NA 4NX9A 1HBOA 1H73A 3H6EA 1GT8A 1S5JA 2M8HA 3RSEA 3SUOA 3MR7A 3S41A 3FQLA 4F25A 2HRUA 4Y34A 3OR2A 1BA0A 3BEXA 3TYTA 1IH7A 1PSDA 1RWVB 3D0GE 3C46A 5C25B 1C6VA 4P10A 3GIMA 3FCWA 1C1CB 2V8HA 2OPQB 4Y1DA 4FN5A 2YHAA 1IBMF 4PYDA 1E4FT 4FL9A 3QMLA 1GH8A 3P4IA 2W9CB 4C97A 4RW9A 3W3SA 1JJ2M 1D9FA 1VSKA 1B9FA 4MLHA 1KHWA 3M8RA 1P8GA 3MOJB 1IKWB 3D6HB 2GX8A 5CQGA 2O3DA 4LF1A 1HW8A 2A42A 1RYRA 2HVZA 3UCUP 2X51A 2ZNYA 2MKYA 3UCGA 1S4EA 4CNZA 1K8KB 1OYEA 2Y8YA 5BYQA 4CO2A 2ZUAA 1M5VC 2F63A 2QC3A 1X7VA 1OPIA 2IJRA 3J80O 4J9SA 1H98A 4AHCA 4ZP8A 2XMJA 1X1PA 4O3NA 2P6SA 4TLQA 4Y2MA 3MWBA 3RYLA 3EMTA 3EY1A 1RDWX 3LP1B 2B7CB 4OIXA 4FO0A 5KFRA 3SI8A 5BYSA 4ECUA 1XK8A 1PAUB 3DGVA 3OTOJ 3PYGA 1MU2A 3G6YA 4J2AA 4CFBA 3SMZA 2AGPA 4F4ZA 4N76A 4FWQA 2W25A 1Z1ZA 1HPMA 3OVSA 3MXHP 4OI1A 1VBXA 1X4CA 4B3SJ 2QW9A 4OYMA 3D2FA 3LAMA 1YWXA 4DS4A 5FPDA 4RPFA 4ECWA 2OCEA 3R1XA 3NNCA 2AU0A 4OZ5A 4BRLA 2E7VA 4DR7J 1NJIO 4OYBA 4B9UA 3CJ9A 4JLHA 5IWAJ 2RU3A 4I64A 4GO7X 3W61A 4DUZJ 3TZZA 3H98A 4EYIB 3HHLA 3KLEA 4F4AA 4B9LA 3GR0A 1ZBSA 4M3YA 1KNZA 1JKHB 2G0JA 2EWHA 3LPTA 1OVYA 1T6CA 2Y0SD 2W8KA 1JB0C 2VKZG 3AO3A 2VCPA 1ZZFA 2CAJA 2HFNA 4DR5F 3NH2A 4YP3A 3KNGA 5KFBA 4IH6A 3FNNA 3IGNA 3CCSS 4IEIA 4I2PB 4ED8A 1N52B 4AQYF 3KJFB 3QGHA 2FHOB 4CIFA 3OYMA 4GVBB 3SXLA 3P5JA 4FSVA 1RHMB 2MY7A 2KFZA 3NXZA 2LP4A 4DX8H 5D4LA 4ED7A 3SQOP 3L3UA 4NYFA 5HBMB 3BQ0A 4J37A 3ZEUB 4KB7A 2PYJA 4JRQA 2HMPA 1FW6A 4FYWB 3OXLA 3H5YA 4BRNA 3ILJA 4LF2A 1RT6B 1H2VZ 3EEQA 4B8AB 1N0VC 2HMIB 3GJQB 4L72B 3MWTA 3HHNB 4K4ZA 3FCHA 4A47A 3A8JA 2ERRA 1TL5A 3L2WA 1VK3A 1RDBA 4IFVB 1GXTA 2BR0A 4DTJA 4KC5A 2F96A 4AILC 3IA0A 2MKKA 3QFWA 3TTDA 3RB6A 3AO1A 1BXNA 2GVZA 2RHSB 2X1BA 1VBZA 2RIJA 3QMQA 4GVEA 3QERA 4RW8A 4ZJOA 4I0WA 4CQ1A 2FZKB 2B4OA 5GAEP 1PO6A 1EKSA 4L75A 5ETMA 4BLGA 1DQ9A 3U02A 2EFOA 4Y3CA 2DYAA 4QYZK 3ID6A 3T1YF 3JSBA 5LMNF 5ETOA 5LT5A 1RA7A 3BDEA 1S10A 3A1YG 1I3AA 4F4YA 1SCJB 2RB7A 4ATNA 4CO4A 4CH1A 3ULEB 1Y5IB 2IOCA 3VCDA 5C2FA 3R3TA 2D3UA 1GLEG 3PNIA 2DGSA 2OP5A 2PE8A 1XUPO 3ZTQA 2GX9A 3EXCX 1YBTA 1Y10A 2G0CA 1U6BA 4CF0A 4A8YA 2GO9A 3CJKA 4BGAA 1CJVA 1EX8A 4H4MA 3SLCA 4OV6A 1HNVA 3CCEN 5MLCV 1UWAA 4LBPA 3RZAA 4AFFA 4DFJA 3OVNA 1HUXA 4F0KA 3JQKA 1OWXA 2DJWA 2YWGA 2P5VA 3K9JA 1HX1A 4ISEA 1H3DA 2ITGA 4NI2B 3W9HA 3UFCX 1XNRJ 3JAMO 1C0TB 2D69A 2B6AA 4CZCA 2KLAA 2N3LA 2P9NA 5C5JA 4HT5A 2MKCA 2VPWB 3A13A 3TWZA 2CQ4A 4Z7YA 2KVQE 4AL7A 2GUIA 3TAMB 4CBWA 2E5IA 5F8LA 3BREA 4ZP7A 1UWBA 4M7YA 3SCKE 5B0FA 1REVB 3K5MA 1G1XA 3N6LA 1E6YB 3AA3A 2IMWP 2O8FB 1BQMA 4X64F 3HSJA 4Q44A 4YQWA 3NHGA 3LO3A 3ZZRA 4YORA 1CULA 1S57A 4U7CA 3V9UA 3H4DA 2CA9A 2IDEA 2Q31A 2CQ0A 3IR6B 3M6GA 2D1CA 2G2OA 5U47A 1RXOB 2XLIA 2WHOA 4HVJA 4KHQA 5HLFB 3B82A 2NYIA 1FJGK 3AVGA 4UOFA 3LZJA 2ASOA 4BRPA 3M1VB 1KVBA 5AQFA 2NZ4A 5MAOA 5DQHA 1HQUA 1X31C 2VWJA 4IOAQ 3JSRA 4NLGA 3KWIA 3QBCA 1IBKK 1X9MA 1WOOA 4Q2MA 2W4PA 1J5EK 3UDVA 3ZNJ1 2QI2A 3OLAA 3K5NA 4U8YA 2ASLA 5AE2A 1HHSA 1NM1A 2HGMA 4CO3A 2C3UA 1Y9OA 1M1HA 1V9OA 2V67A 4K43A 1KC8T 2E2QA 2F8HA 1U09A 3EL2A 1U2RA 1KSPA 1KFDA 2O8BA 3C14B 2HHHF 3AO5A 1QQMA 3SZ2A 2R8JA 2HZVA 4DR3K 1RTZA 1X8DA 4NXMJ 3P83D 3FFIB 2ZZMA 1NH8A 4J2DA 4MIWA 4YHHF 3GZ7A 3DI6A 2J0QD 3JQJA 2LQBA 3HHEA 1VQ5S 2ADCA 5KFQA 1T95A 3OL6A 1HWIA 3WQPA 4DSIA 2YKMB 1L3TA 2YKNB 2DBBA 1C1BA 4OLPA 1RT5B 1FKAF 3MGJA 3UKRA 1S1VB 1UW4A 3K2PA 2C2EA 1M5PC 2BJEA 4HI2A 1IJEB 2OLWA 3MM6B 4YOEA 3RAMA 3FEYB 4OYIA 5F8NA 4BQZA 4EBEA 5GAGI 1OY8A 1N5TA 2R42A 3GFYA 2XY8A 2ITMA 2WW8A 3VF6A 4ZOSA 3K2YA 1NNDA 2V4JB 4FWPA 1DQAA 4X62J 3U27A 3DOLA 2QGFB 2BJ3A 5K8MA 2IYGA 4J9LA 1Y4ZB 5J2MA 3M8SA 4H4OA 2B4UA 5HOOA 3CMEN 1PCAA 2ASDA 1RABB 5KPZA 4L74A 3ETMA 2H65B 4K8XA 4N8OA 3CCLN 3DLBA 2QYGA 2BANB 2U1AA 5J2QA 2O67A 2Z56B 1WKKA 3KKSA 1TUGB 2EXUA 3GJTB 4JI0K 1SVDA 3EZWA 2VQEK 2JFDA 3SNNA 3Q8UA 3C7NB 1W26A 1HBNB 5AQMA 2Z2ZA 2WCXA 5JMVA 1NJWA 2X1GA 3SSQA 2CZ9A 1SJFA 4CEEA 1NGCA 1EQ0A 4OHZA 3QO9A 3E66A 1JK9B 4F8RA 4J90A 5JLHA 5IWAF 4QIGA 3LM2A 2X1FA 4I6WA 2AYMA 2Q6BA 3I0SA 1S22A 1QQOA 2DTJA 2R7SA 2MPUA 1WHYA 2D9PA 2HNDA 1YHQN 2Y1IA 4IO9L 4EGLA 2V2ZA 1QVGM 5AQQA 3SCIE 3UO0A 1N6QA 2E5LK 4WJBA 3H7HB 4C1NK 1WOQA 4YR2A 5BRHA 3D2EA 1U1RA 1R31A 4LFCK 5FLXO 3BGRA 1UVIA 2B9XA 4NYZA 2H1YA 2QM1A 5KT6A 3K59A 4NCGA 5JXSA 3ATVA 2OEMA 2WONB 1T11A 3UD4P 5KFMA 2R4FA 2HHQA 2HWIA 2HVHA 3ITHB 1NOZA 1C0FA 2LXUA 2O5DA 5IOLA 1YVFA 3GR1A 2DR5A 4OX6A 4MKAA 2F65A 3PW0A 1TL3A 4AHUA 1S76D 2LEBA 1XMBA 4LFAF 1T3OA 5C15A 4DV5J 4ECXA 3C65A 2ZC3A 2HBRB 3AA2A 4FVMA 2W42A 2GCFA 5C10A 4OHXA 3Q7BA 4CVNE 3EKSA 3NAEA 5K8NA 1AUSL 4DLEA 1K47A 1QDUB 5ADXH 4O55A 5IS2A 4LSNB 1MNEA 1FE0A 4KGVB 1CS4A 2XY7A 3M4XA 1UPMB 3DHXA 1X5TA 1YRTA 4OJ1A 2ADBA 1VQ6S 3QWUA 3DOKB 2JLEA 3VGKA 1HI0P 1GXUA 1RAHB 5E3QA 4F36A 5ETPA 2EX3A 2PD1A 2ZUGA 1NGGA 4ZIVA 1JL1A 5DG7A 4KYZA 5AZJB 4NZ6A 2CQHA 1NDCA 2ETJA 2HFUA 4G1QB 1FDDA 5F8HA 3D6RA 3Q89A 4PWDA 5IM0A 4W5QA 2KW4A 4Q43A 2O8CB 1Q7YO 4WFBL 2Q3SA 1VYAA 2Z57B 3FEZA 2CGLA 1S6QB 4Y0WA 1R0BG 2H5JB 3I8DA 2NXJA 4PCQA 2UXCF 4AH9A 1FNXH 1LQ9A 3O08A 1BMQB 2VBZA 1GQEA 3BPSP 1NNEA 1SKUB 3AHPA 3H5SA 3D6MB 3MUMP 2YNHA 1N5SA 1UVLA 2XMAA 4A8KA 4RBTA 1RWNB 4C4WA 2EFPA 1H6KX 4FWOA 2CWXA 3ZZUA 3I5AA 2IHR1 1HMVB 3EVWA 3NE6A 2VG7A 4ER8A 2LKZA 3BPDA 4DPWA 3DDKA 2YQ1A 5E3RA 2XS5A 3E51A 1S1UB 3OSPA 3VR1A 3H1QA 1GX5A 4FJNA 2DNHA 1KLNA 1O51A 3BR8A 2QEXN 2KDOA 3CD6N 4ILMA 5EHHA 3KHYA 3C3LA 3M6UA 4FF4A 1Z25A 2PYLA 3NVMA 3EVOA 3AO2A 3Q24A 1BIUA 4FVUA 3CFPA 4CEQA 3THYA 2P9PA 1Q16B 4Y2IA 2W4DA 3POTB 4NLDA 1F60B 1JXEA 3VVUA 1ZA2B 4RNMA 4Q0BA 4YB7A 5LJVA 4A57A 1XJWB 3OJSA 1X3MA 1PJ6A 5D0RA 1ZBFA 2KZMA 1RU2A 1FNMA 1ZM9A 3CQXA 1RDDA 2I5JB 4D3HA 3HVTB 3CMES 3DLGB 2HIQA 1RILA 2LFVA 2HKEA 4I2QA 2F1FA 1HD0A 2IGIA 1RTHB 1QS4A 5K5MA 4CZIA 5ADXA 2HZCA 1IKXA 4XPCA 3NCRA 2GWKA 5L9NA 3AODA 4B9QA 2BJ9A 4G65A 1XERA 2F3JA 2NUHA 3DLEA 2XMVA 2YHYA 2IC3B 1IR0A 2BA9A 4KIAA 1WF1A 2Z4PA 3NMRA 4U9RA 3P1GA 4O3PA 2QE5A 4LRFA 5KFTA 2XG8A 4GKJJ 3NF8A 1RT7A 5HJYA 5D4PA 4TY9A 5A0YA 2ZH1A 4B1VA 4JUZA 5AR0A 2BYCA 2XGPA 3KD1E 1LWFB 4Q45A 3T1AA 1IM6A 1Y5NB 5DLGA 1B0VA 1GOCA 2AGQA 1V4TA 1MG7A 3MEKA 3DRXA 4FWSA 5HQLA 3IWNC 1X9SA 1A5VA 4CLWA 2FC9A 1KCFA 4M5IA 3DRSA 2DB1A 4IRKA 3A3PB 1SAZA 3NF9A 2JL9A 5B0GA 2GFFA 2CPYA 5IV4A 2PSZA 3QEPA 2DHAA 2YKPA 3ELHA 4JBCA 4FPBA 4RW7B 3H3OB 4B9NA 1S99A 1YITN 3MR2A 1S3XA 4KH4A 2C2ZB 3DM2A 1RWWB 1NHVA 1OQ3A 3KIOA 1ZAWA 4ZCMA 2QSFA 4F04B 3RRGA 1XR5A 1N54B 2MQNA 2CDRB 2LLZA 3L09A 3AVIA 3QICA 3MZIA 4K41A 1Z2ZA 2J9EA 2XBPA 1Q1KA 3CDAA 4TY8B 3CCRS 2YWFA 4FKYA 2O1PA 4IQXA 2XYPB 3B8AX 4LRAA 3I82A 2FZGB 2KXFA 3CJRA 4EFAC 3C6TB 5LJWA 2X3GA 5L46A 4JI5F 1KTVA 1BD6A 2AEMA 3AO4A 3V6HA 2OKQA 1FT8A 1U4BA 2PI4A 2AD9A 5BN8A 4CJ7A 1KRPA 1RT1A 1HNIB 1TUYA 2P9IA 4IOXA 5HMZA 3K8VA 5CZ2A 2GJFA 4KHYA 4B3OB 4OPHA 2G8IA 2NZCA 5K14A 3AB4B 4TSXA 1HNWK 4WP3A 4WZQA 2C2MB 4RW4B 1CJTA 4URSA 2E2PA 2VGMA 4X84A 2ASJA 5CE3A 3GJSB 2DO4A 4CF9A 4M5DB 2IIHA 4CGGA 3QDKA 3VEWA 5IFMA 4UOGA 3D7EO 1D9AA 4B1YB 2MZQA 4DX6A 4JKBA 1BQXA 3R97A 3UDLA 2KT2A 4ZLJA 4E7KA 3CCUN 3HZ6A 4K4TA 1SUQB 3HMJG 4C3LA 2XMWA 2EBGA 4RX6A 3HOSA 3FDSA 5FD1A 3CCMS 4UZCA 1TKZA 4O4RA 4Y00A 1JJ2R 4R25A 3HFVA 1EQMA 4AF1A 1VHXA 5B0DA 4ZVOB 3MX5A 3O9UA 3HLUA 4QCLA 4F3TA 4BDYA 3SMSA 3RMBA 1WF0A 2GGPB 2NRWA 2XNQA 5G0RA 3HD2A 3VAFA 3GYNA 2DIVA 4JI2K 2GA7A 4ED5A 2G8UA 1CZ9A 1SH2A 1YIJN 1LWEA 3ETOA 2A1SA 4CJ4A 4WF9Q 3AAWB 3ZETB 2AJ0A 4C8NA 3EJMA 4BC4A 4B1ZA 2QEXS 7AT1B 2IJFA 2RQ4A 1YK9A 3QZ8A 5C2GA 4CLPA 1WSFA 1RKJA 2B8QA 2OMLA 4K0KJ 3HTVA 1ZBLA 4O44A 1KOOA 2EFVA 1VQ4S 4QWCA 2OA8A 5FDLB 4GKKJ 2OTLS 3ZX2A 4X4UA 3IUCA 3TR5A 4YB5A 3TJAA 2MJNA 2HFVA 1UCNA 4KHPF 2BGGA 1TP7A 1CLQA 3UVJA 3BS9A 1ZPVA 3GG4A 2NSBA 2B4PA 5KPTA 1UP1A 4K5SA 4TXSA 3O9TA 3BGLA 2OTJS 4XDDA 4Z4EA 4DV2F 3M32B 1IKVA 2E1CA 4Z37A 3DGPA 1TUUA 2PMZD 1JLQB 3EWGA 4O3QA 5AXKA 1H7XA 1XC9A 3B6OA 3W60A 1G99A 4MQ3A 3PIOL 1NLKL 1BI4B 1RAIB 2P5GA 2ZJQQ 2YQ0A 3KUHA 1UVMA 3HO1A 3U3YA 2QV6A 3AY0A 1HYSB 2LQ9A 1S9GA 3PRVA 4IG3B 3KOAA 3CCWA 1WEXA 2PN6A 3K5PA 3E9OA 3O3LA 3J81j 1NAQA 1WSEA 4GW6A 3UE5A 3OTOK 3N4PA 1S7HA 4WXWA 2OEJA 4WP9A 2AZ3A 3THPA 3CMAN 2XZWA 1X9WA 1I94F 5D77A 1JXVA 2GS8A 4C11B 4B3SK 3CJAA 2V34A 1BG3A 4BRDA 1I39A 4H0TB 5KT7A 3G87A 3RGIA 4RNNA 2DRBA 2V8VA 4DL7A 5GADU 4RG8A 1JLEB 4DR7K 5AQZA 1V3SA 3T41A 4DUZK 1NDPA 1C4AA 3IR7B 2BE7D 4O8KA 5D3GB 1FXLA 2CJBA 1WN7A 1HKBA 2J76E 2YWEA 4UW2A 2FHMA 3KDNA 2FBVA 1F2GA 2UUAK 2H51B 1NU4A 2ZJRQ 1NGEA 1QHAA 1LW2A 3R9PA 5EDWA 3LPUA 2QMWA 3MM9A 3MD3A 4OL8A 3GG1A 4FNHA 5K20B 2A40A 4OX9K 3QATA 4LF9F 1DEJA 2XI2A 3D5MA 2VQFK 1RBLA 3BZCA 4MH8A 1FD2A 4DUYK 3C16B 3HRGA 4MO5A 1RT2A 3AA8A 1UEKA 4JD2A 4OI6A 1UAXA 1RTIA 3C6HA 3O6QA 2UXBJ 4NYPA 5J1EB 1S1TA 1BCOA 1BOTO 3I0RB 1UZHA 3VALA 2ZM6F 1QSLA 3J8AA 4CD3A 2JEFA 3L0QA 4CERA 2FC0A 2ZHOA 4JV0A 1RISA 2JWNA 2VU5A 3EO3A 4YNQA 1O13A 2WVEA 3WQUA 4BE2A 3PM9A 2DNKA 1YSJA 3MM8B 4AUKA 4MKBA 4YOUA 3UN5A 3OW2M 2NRXA 3H2UB 1NGAA 5CD4A 4A8QA 4FLUA 3IN5A 3TAGA 1GMWA 2L48A 4XEIA 1IR1A 4C8MA 1LWCA 3E3XA 3HHLC 1FKPB 3H20A 4WE1A 2Q97A 5AJ3J 5ETVA 3OS0A 1S0VA 4RL1A 1BO5O 3CCUS 3IS9B 2LA4A 1RFQA 4HCCA 3CPEA 5CZXA 4MKVA 4J91A 1YTAA 2FBYA 4NZ0A 2V8GA 1GTEA 2BABA 3PEJA 4ZVHA 5KPRA 4CDIA 4KH5A 1QAYA 2E8AA 2FGOA 4P74A 1JNZB 3UPFA 1B9DA 3UKUA 4JI3J 3E9PA 3PIPL 3SCJE 5CYJA 4OI0A 3D1OA 2KVIA 1NK9A 1KQSR 4ICLB 1QE1B 2B9EA 2JFKA 4CIOA 2KT5A 2JRSA 2B4JA 4FPRA 3BO4A 2QK9A 2Q1NA 4OI3A 1DFDA 4K4WA 4P7TA 5E84A 1RTDA 5E3PA 3DXSX 1VQ9S 4CT8A 2DISA 4IH5A 3X3UA 5EX3A 3HHKA 2QLFB 1XNRK 5KFYA 1W7WA 4JI7F 1S9FA 1QM9A 2AHOB 1U1OA 4WFAQ 1T7PA 4UOCA 5D6GA 5AQVA 4CIEA 2E1PA 1XC3A 3NCIA 2QN6B 1NSQA 1FEEA 3OYKA 1MLAA 1GFWB 2V2KA 3MEEB 3ALYA 2DRDA 4JN4A 3TUJC 1HFEL 1MMNA 1ELOA 3BQ2A 2B5JA 3CEDA 3HOTA 2J9DA 2ZH3A 3U1NA 2XLKA 4K7QA 2D0BA 4HHHA 2MLXA 2RDDA 4USUA 4KFBA 2DNQA 5CXTA 3ILIA 2HQCA 4GVMA 4DBQA 2GUPA 2W24A 4NLUA 3LWLA 3BQ1A 1LOTB 4DPOA 1F9EB 2DNZA 4CJQA 3DMJB 2X3DA 1RHJB 2OHDA 1VSMA 3LDPA 3QINA 3W3DA 3DLLL 4OZNA 1EHWA 1HWLA 1KAXA 1IQTA 2NR0A 3BO3A 4FPIA 4FJIA 2B3TB 2VUGA 1VI7A 3DDNA 3HXMA 4L6V3 3DYAA 4NYOA 2UU9J 3M2VA 3MTKA 4DQIA 2RS2A 2RHKA 1AZSA 4FLXA 1HW9A 3OS1A 1KVIA 3MECB 1R6VA 4DR6K 1RWMB 2LQ8A 2FVQA 2V50A 4NXMK 3IRXB 4C0BA 1VQPS 2P9SA 2MLZA 3QIPB 1S72S 2VG5B 2KB2A 3OYJA 4NWBA 1ITPA 1OSCA 1T8EA 2HBYB 2NQPA 2XSJA 3W63A 2FXUA 2JHEA 1X0FA 3SBTA 3UDEA 1TMJA 1DJ0A 2HBZB 2V94A 4L8RB 1D3WA 3O4QA 2C28A 2D7SA 2DY9A 2CPZA 1HBMB 5BYRA 1IKYA 2PFFB 4CLLA 1B0PA 4WCEL 4YDDB 2M8DB 3RB0A 1T03B 4NLWA 3V9ZA 4X65J 1NMDA 2FVRA 5GMDA 4I68A 3FGUA 1TKTA 1N32J 2CRLA 2C3OA 3KLFB 2GQCA 4LF8K 5AZIA 5L8RC 1NK6A 5KFFA 2HNZB 4EI2A 2FJVA 3MFHA 2YHWA 3FMWA 1QVGR 3OYFA 3FCVA 2C22A 1HPZB 2A5XA 4ZPBA 2CQDA 3CJ7A 5KFNA 3PTWA 2DKOB 4ANDA 3CJ2A 4X4OA 3TZYA 1NRKA 3OA9A 3PW7A 3BH6B 4MFBA 1NCLA 1T9XA 2O8DB 4XAKA 4H03B 1ITGA 1RGVA 4XH5A 1JLBA 2DCUB 1B70B 1DHMA 4JI1J 1VQ7N 4HI1A 5CY4A 1NB2A 1TL1B 1SKSA 2BE9B 4AE5A 3ILOA 4JYAF 2R7XA 4OZLA 3LDNA 2J7KA 2BZ2A 4RUAA 3MMCB 4LF5F 4J2BA 3RR7A 3JTPA 3PDNA 1CZAN 1YLXA 5DZ7A 2KFYA 2F4VK 2QTDA 1NMEB 3MMJA 2VC0A 3JB9k 3TSPA 3CJSA 2WSCC 4K4XA 1S9EB 1U04A 4WF9L 2V52B 2FLOA 1FEHA 4AD6A 2MHNA 4YY3F 1E6VA 5T7LA 3W62A 3OUYA 1HR0J 3PRDA 4DX5A 2MJUA 1IBCB 1N0UA 3RAQA 3M2RA 4FWRA 1OQ6A 4CW7B 2XY5A 3TARA 4IKFA 1NEEA 1PC5A 3VGTA 1PIEA 3MAAA 3KZBA 2DY1A 1DTQA 4K8RA 4XPEA 3O2IA 2PA8D 1RZMA 1DTTA 1RLDA 5HRRA 3AY9A 1RAEB 2OSQA 3HL8A 3O3FA 1HNXF 3S6EA 4NCBA 1NK7A 2UYTA 1RDCA 3J7YP 3PEHA 3P3DA 3MEGA 3LM9A 1PILA 1LXJA 4AXJA 4C23A 4DU3A 3OHRA 1O6XA 3O5BA 1GK8A 2ZQBA 1Z6RA 1UEUA 2D0OA 2NS1B 2MSTA 4OYWA 4R8UB 1SH3A 3RUBL 1NLVA 4DV5K 1D8YA 1KD1O 3VV2B 5JS2A 5HAOA 1VHFA 4CBXA 3VGMA 1X5OA 1BUPA 3LDSA 2ZBCA 2OEKA 1I6JA 2MKSA 4QWEA 1YJ7A 4FXDA 1RCXB 3ENHA 1QD1A 3QGGA 2M70A 2R7QA 3G71N 4JKAA 2V2QA 4OO1J 5C25A 2QX0A 1C1CA 3TQ1A 2OPQA 5AJ3F 1SXLA 4WBFA 4F3QA 4DR2F 4BRMA 4AHVA 4P2SA 3OL9A 4BBYA 1EKRA 2DTUA 2W9CA 3MN7A 2M0GB 3EE9A 4ED2A 4BC9A 5AQOA 2RNEA 3QQCD 2DH7A 2Y3YA 3LP2B 3VF2A 3LGMA 5M1PA 1IKWA 4IDKB 3HP6A 1VMBA 2XMUA 1CC8A 1VBKA 2ZBRA 2ZJRL 4H0PA 4W5RA 5HP1B 2CJYB 2A41A 1WC0A 1S48A 3D4JA 4PKIA 3NAHA 4PG7A 2BMBA 1K8KA 3ATUA 3LUYA 4E7IA 4FLYA 2IAJB 5KOXA 1VRTB 3ZTOA 3TOQA 4OJRA 4NRUA 3D0PA 1K0VA 5GAHP 1SIWB 4QYZJ 3S3NA 4IG0B 3DJCA 3ZFVA 3G6EN 5AQKA 3LP1A 3PYFA 2YX4A 1Q8KA 1YX2A 3S01A 1EWQA 4FJLA 4KH6A 4DUTA 1RAJA 1RP5A 1QAIA 2VD3A 4BE0A 4CLTA 4QS9A 4KI6A 1XR7A 3H5UA 2E1YA 3CC4N 3C15B 4L3NA 1SB6A 1KS2A 1E4GT 3G8TA 1U1QA 3C8YA 4HR2A 1KAZA 3LP0B 3GV5B 4DR5K 3DRRB 1TK5A 2AMCB 1ZOTA 3Q8RB 2HNYB 4ZVTB 4QOZB 5LXYA 2ACYA 1D9DA 4RU2A 2HWHA 2YPZA 1NGBA 1JKHA 2LQJA 4LMZA 2DNYA 2H5EA 4M94A 2QA4N 4WIIA 1YXQA 3T5JA 2LDYA 1CSJA 1NM2A 3IFRA 2XZDB 5LSRA 4DN9A 1I1GA 4ID8A 4I2PA 2BACA 2FY1A 3H3NO 2JDJA 2A2CA 4CZGA 4IYQA 4IO8A 4KAZA 4JOUA 4OJGA 1OSDA 4GVBA 1XMQJ 3VQ7A 3SCXA 2HQ3A 3AXKA 2IBKA 1MN7A 5HBMA 2W8LA 3ZEUA 4MK7A 1EP4B 1WSVA 3GU0A 1XIQA 4F02A 4BROA 1Z26A 3MF5A 1RT6A 2R8KA 3OYDA 1CJUB 1UVJA 2HMIA 3A3NB 1S49A 5A6PA 2OD4A 2UU9F 2KQ2A 1A7GE 5M1OA 1LXNA 2R2SA 3KK3B 1XTZA 2DFFA 1NUEA 4IFVA 3OLBA 1ZXOA 3TUPA 3B6PA 4U95A 4CM0A 5KFAA 2W2NP 2IIRA 4AM7A 3I8BA 2A0FB 3H42A 1D5AA 4ZN3A 3CIMA 1Q4RA 1VSIA 1X5PA 2AQ4A 4UY85 3A0IX 1CLFA 2AX1A 2ZE2B 4JKCA 5CH7B 4GKJK 2QJ3A 2DXFA 3NDKA 4MMOA 1DKGD 2XEXA 1HI8A 1XHXA 5T41A 1Q9YA 3IDHA 4EHUA 3O1WA 4OYXA 4DU7A 1J6ZA 1U47A 1ICEB 2GHPA 1RHRB 1KHVA 4PEOA 3C2PA 1IBKJ 3K0SA 4DCOB 1J5EJ 4X65F 4IOBA 3CDBA 4BRKA 5GINA 4YDXA 2G1HA 2C2NA 2HHXA 4ZCKA 3HVAA 3ULEA 1GTHA 1U02A 2YH0A 2HHTA 3F56A 1NJZA 2YX6A 2E9TA 2HFSA 2ILZA 3PKMA 2O4IA 2D0PA 2ZOGA 5KFHA 3FZKA 2HW3A 2ZITA 1D09B 5DQGA 1VC0A 3D68A 2PAVA 4MJKA 5DGBA 4ZK7M 4KJIA 4ETXA 4TLRA 2HSEB 3DHWC 4I69A 3CULA 2GJIA 4W90B 2DGWA 3TA2A 2BM0A 2UP1A 3PSFA 5M1FA 2YJFA 4YDUA 4ISFA 2DGTA 4HL9A 2AW0A 2VA2A 2EEYA 3O3GA 3VQCA 4WU3A 4FK0A 1LFPA 3EGNA 3ISNC 2NXUA 2APOA 2Z1JA 2DGOA 2RQCA 1HL6A 1R0AB 5KFUA 1MWZA 3CF5Q 3ZYYX 3O1BA 2G2YA 1U26A 3TTCA 1BU6O 4A46A 1C0TA 4P7VA 4C6AA 5GAHU 3K5OA 3UI3A 4ZTJA 3G71S 1PBAA 3R6MA 1WTFA 2GAGC 3W2WB 4ED4A 3TAMA 3P5TL 3MPVA 4IWVA 3P6YC 5KTQA 3MX2A 4J5OA 2KXHA 1VSHA 2YWWA 1MU2B 2FLLA 2ZZTA 1SPBP 4B1UB 1REVA 3T5KA 2Y1LB 2JVRA 5JVHL 4K4YA 1N33J 4ED0A 2HLTA 2HEKA 1E6YA 4FW2A 1N36K 5D0HA 2O8FA 1U1MA 1CQNA 4PABA 2IVPA 2AWZA 5B08A 3MXJA 3VQ9A 1QQCA 3A3OB 4N5SA 3FVYA 4W5OA 4LREA 4H5WA 3QFHA 4WU2A 4C3KA 2V7YA 3S7RA 1S0MA 3V81B 2A10A 4OZ2A 5HLFA 3CGIA 2WVCA 4RR5A 1IG8A 5AQHA 1PAEX 5JUMA 3M1VA 2K7KA 3ZO7A 4YOTA 1KLMB 4LRBA 3ZT0A 1RSCA 5HO4A 1UVKA 2FGCA 1L3SA 4F2SA 1N34J 2QRRA 4HTIA 2IBOA 3EN9A 3KHLA 2CQCA 4DU8A 4M7XA 1J27A 4KSEB 3D3BJ 2NREA 4QAGA 1EO1A 4HEA9 4LD0A 4MIAA 3CJ8A 4CLKA 2E7WA 4DJBA 3C14A 2ZBPA 3CC4S 4J9NA 4V19J 3NGZA 3FFIA 1ZA1B 3IR5B 2W1BA 5DM6Q 3CQ8A 5B0AA 4ZLNA 4NB4A 4RKUC 4LR8A 3S3OA 4KREA 3SQ0A 1QZ5A 4P2FA 1FRHA 3VA0A 4IOCL 2FJEB 1RBOB 3RAXA 4K0KK 2YKNA 4PXDA 4TU7A 7FDRA 1RT5A 1Q79A 5I42B 2KKZA 1S1VA 4GKKK 3A8EA 4H0VB 3MM6A 3C19A 1JX4A 1WJ9A 1QQNA 1NXIA 3VWSA 2AX0A 2DVIA 3HHLD 1Y3JA 4DSEA 2WBMA 4TU9A 3PO4A 4B9SA 1WNSA 4KE5A 2YV0X 5BXIA 3M9NB 1TK0A 4CEDA 3KJVB 3KLGB 2V6AA 5CA5A 2ZNZA 3AA4A 3Q8VA 4U96A 4JB8B 3BKUA 3IMQJ 3DXKB 1YJ9S 1YT3A 2ZGZA 3R1HA 2P9CA 3UN3A 5HANA 2E1MC 5HRPA 2E6MA 2GVDB 1F5BA 1NGFA 3O9RA 2B56A 3RB3A 5SWMA 1T9TA 4UZBA 5A8RB 4RNFA 1P9QC 2BANA 1SQFA 3QYYA 3MOZA 1NB7A 4DV6J 1S6PB 1Y0HA 3C7NA 6AT1B 1HBNA 1HBUB 2PO4A 3TEHB 1GLDG 1U6ZA 1YAGA 2FLPA 1K1SA 3BGOP 3RVCA 3ZTSA 4LSZB 2IRYA 3UR3C 2Z58B 2KHCA 3I56N 3ZT1A 1VQKN 4JI4J 3V9XA 3THWB 4BR5A 4JKGA 5T14A 4JV1A 4FKXA 3VGLA 3KWMA 1L3KA 5AQPA 3JAMU 1FFSB 1WC5A 2B6AB 3PW4A 5E3CA 1NHKL 1B4SA 2FSJA 5AXNA 1WBBA 9ATCB 3AGRA 4IJAA 4ZVPB 3UNGC 3OW2R 1J53A 2COLA 1YJRA 4N41A 2Q66A 5BPNA 1KTQA 1VC5A 1GMVA 1WORA 1UKUA 1VJWA 4P75A 4YOWA 4MIBA 1MN9A 1XQSC 3V9WA 5DDPC 4O0JA 1QTNB 4WP8A 1NGDA 1MWMA 1Q8BA 3QGIA 2QLXA 3J7AN 2WONA 2AJ1A 3ZZTA 5GIOA 4KO0A 3TA1A 4N8NA 1P1TA 3M8WA 4EIAA 1WKJA 2R8HA 3N6NA 4H0YB 3ITHA 3TAFA 2UXBK 1T9VA 3QT8A 5M2PA 1FTCA 2YVSA 4UQGA 3CFOA 4C98A 4QJVA 1ZM2A 2DGVA 2MMYA 2IS3A 4NLVA 3VETA 5BREA 2CQPA 5E2QA 1ZBHA 1ZETA 4HH1A 1HQUB 2ZWHA 3S9HA 3W0LA 1V3ZA 3VA3A 1VHIA 3FR0A 2VOPA 5DM7L 3CERA 3EYZA 3OTDA 1RHQB 5K9FA 4M3XA 1HKGA 1TFWA 1FJGF 5DDOC 4LF7K 3LDOA 5AT1B 2VFVA 4K4UA 1HJOA 4DV0J 2GIFA 1VRQC 4NASA 4LSNA 3FZFA 4A5AA 3N28A 3JSYA 1HQ2A 2CPIA 3T6JA 2UV8G 1T3NA 3VGVA 2IVYA 1PYSB 1IBKF 2E5HA 4UOHA 4H5RA 3HVRA 3DOKA 1J5EF 2KM8B 4JS5A 1AFIA 2CQ3A 1NDLA 4QR2A 1G3OA 1VAZA 3AV9A 2H4YB 1P8ZA 4K59A 3VAMA 1MMLA 2QWQA 4A8FA 2K1RB 3M6VA 3T1HF 3J81U 2GV1A 4RUHA 1T6DA 2XHBA 5AZJA 2V4RA 2AZ1A 2ZH8A 4DR3F 3PX0A 4G1QA 5CZVA 2WB1D 2HWTA 3W9JA 3MAQA 2AYGA 3QNNA 2FJBB 2EK1A 2O8CA 4RUCA 4CJEA 1DBDA 5GAHI 4JI3K 2NSCA 2VICA 1YTUA 1S6QA 5K8OA 4DQSA 2VPZB 4ZPDA 1WOPA 1WI8A 2GW8A 5CABA 1WI6A 4KGMA 4CJTA 5A2QO 8RUCA 3B78A 3MDQA 4ZLPA 4BRAA 2MZJA 4KGZB 3NLCA 4DFKA 3P8BB 3ADAC 2M7SA 4O4GB 2MYFA 3QWPA 1FJ7A 1HMVA 4NRTA 2P5OA 1RGIA 3N9UC 1VJQA 2MXYA 1EXQA 4BC3A 4FJXA 1BHNA 4JKFA 2YCHA 2M52A 3E9LA 2RAQA 2KZZA 3OBYA 2XS7A 2ZGYA 3TABA 4CEBA 1VRUB 3MCPA 3SI6A 4I67A 1S1UA 1U2VB 2XZTB 2VFSA 2OPRB 3AAQA 4HHUA 1Z2LA 3BV8A 3KHRA 2KFNA 2FZCB 4ELTA 3AVLA 1C0UB 4DMZA 1KKHA 4JV5J 2VWKA 3AD7C 4M5MA 4BHQA 3V4IA 3LGNA 4NLTA 4DTOA 3FZ2A 2O4GA 2E5JA 2QA1A 2OFHX 5LL6d 4CYUA 2KG1A 3RW6A 2GHVC 3POTA 2P9LB 2P9UB 2WVDA 4NA2A 4CH0S 2E9ZA 4JI0F 3ENAA 1SIZA 3PACA 3HI0A 4OHVA 2VQEF 3RRHA 1IBLJ 1ZBUA 4RW6B 2YKOA 3PXGa 1XMOJ 4Y2AA 3P4UB 5IT4A 3BBBA 5D0GA 3J80Y 3WQTA 4M45A 2FUG9 2I5JA 3HVTA 3DLGA 4AM6A 2JLFA 2F8EX 3FK4A 5E0OA 1FDBA 1RB0A 3ENOA 4PL8A 5H1SV 1RTHA 4DB3A 4UUXA 1HNWJ 4WYBA 4KV8B 5HRNA 2FVPA 1WHWA 1RBUA 1R8PA 1JIHA 3SAGA 4EU0A 3S3MA 3U6FA 2IC3A 4CJWA 3U7JA 3N5FA 2E5LF 1P6TA 3W2VB 3VAIA 4LUBA 4JK8A 3OYGA 4DSJA 3CF5L 4XO0A 1K6YA 1PBUA 4LFCF 5LMUJ 3CB4A 1T44A 2X6NA 4KAIA 2HGNA 4R0JA 2FLNA 1VFJA 3AD9C 1LWFA 1TL3B 2E20A 4M5KA 4OYOA 3B4MA 4JHDB 4AHRA 3CC7S 2LEAA 4GC7A 2GV9A 5ITHA 3G96A 3KHGA 3SV4A 1HWKA 1HHQA 1OY6A 3SJJA 2AF6A 4URQU 3CI5A 3UNYA 4LFBJ 4FM0A 5B09A 3BBCA 2GELA 5AQIA 1ZAVA 4FYYB 4OPJA 2V63A 4RW7A 4QR0A 4PXEA 1LKZA 1N32K 4JI8J 4FK4A 3OTCA 4CHNA 2VODA 4OYAA 2P6TA 3GV8B 2E29A 3ZSQA 3V2UC 1M90T 4IR9A 3CVKA 2IPOB 2QMUB 2ROEA 5AQJA 1BWFO 2RUSA 2B51A 3G4SS 2RKIB 4DPYA 4TY8A 3I55N 4ZTFA 2V2VA 1EETB 2J7UA 3BSCA 4YOYA 2R2RA 2EVZA 5IM0B 5BRFA 3L7OA 3LZIA 5E33A 4JI1K 3V6DB 1RWKB 4QPTA 5BR8J 4HLBA 3UD3P 4DU1A 3KUEA 1VGYA 3OBIA 3DLKB 2R2TA 1CJKB 3SAHA 2IA0A 3CCVS 3HSZA 1HNIA 2H48B 4L76A 5KFOA 3A8IA 4N56A 3Q8SB 3PY8A 2QXLA 1PG5B 1ULRA 3GSIA 4H5VA 3CQYA 4B3OA 3G0ZA 2B8PA 4M3TA 2KI2A 4RW4A 4J7CA 3CT9A 2MQMA 4NLYA 1HR0K 4M5DA 2YNIB 1AYEA 3QRQA 2FHKA 3A5NC 3CIZA 3MPYA 1YJWN 2NXEA 3HK2A 2E7XA 5HSPA 3N6MA 3VQ8A 3ZNUA 4KH1B 4FWLA 4LH4A 5GAGU 4UT4A 4CZJA 2UUCK 3FZHA 2K8GA 4UF4A 5FPMA 1PJ5A 4ILLA 3RR8A 1PKUA 1S1WB 3O5TB 1SUQA 4P52A 2E1RA 4IZ9A 3D0IE 2VBYA 2JWKA 2MSSA 4I6YA 2P9PB 5A76A 2EBEA 3CD0A 1WDDA 1UETA 3BR9A 2MQQA 1R43A 2HLUA 3BF3A 1BHLA 5I3UB 3UR0A 3DLRA 4WIQA 1BC6A 4FF3A 2HHPA 1VQMS 1R0CB 5D78A 2R7UA 4CI0B 4CM2A 5AXMA 1UJ5A 1L5UA 2HG4A 5AE3A 1ESVA 4W5TA 2GGPA 1K73T 1VQ5N 3IO1A 4Y1CA 3JAMY 3GJRB 3VENA 3DWLA 5AQWA 1N5YB 2KN4A 3MMBB 4U67L 3OYIA 4PG6A 2UUWA 5KFKA 4BRHA 2UUAJ 1IJJA 3QAUA 3HFZB 1HYVA 3RTVA 2EC2A 3EZOA 2DFEA 1K8AT 4GNIA