3IRXA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with the non-nucleoside rt inhibitor (e)-s-methyl 5-(1-(3,7-dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of HIV-1 reverse transcriptase (RT) in complex with the alkenyldiarylmethane (ADAM) Non-nucleoside RT Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/hydrolase
total genus 129
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3irxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3irxA05
3P5JA 2EHGA 1JKHB 1HPZA 4KV8A 5C24A 4IBNA 3ITHB 1ZBHA 5D3GB 3OL8A 4LY7A 4IQXA 3MECA 2Z1JA 2AQ4A 4K4UA 3NH2A 3IN5A 2OZMA 3VQ6A 3IS9A 3UPFA 1C0UA 3HO1A 3TAMB 5KFFA 4DU4A 3UDLA 4NLWA 4TQSA 4B3OB 1TK0A 2WK4A 3ISND 2BQUA 4PUOB 2RN2A 1EXQA 2ETJA 1C1BA 5HLFA 1WNEA 1S6PB 1ITGA 3ICLA 1SH2A 2JEFA 4MFBB 4Y2CA 2KW4A 3KK2A 2O4GA 1S9GB 3NKYA 3NHGA 1JLGA 3RWUA 4CHNA 4FBUA 4M41A 2Q3SA 3PZPA 5DLFA 1LWEB 4DF4A 2IAJB 2A1RA 4E3SA 3NH1A 4FS2A 2FBTA 5KFDA 1KVAA 1S1VB 1BISA 3Q8QB 4FJXA 5HP1B 4IR9A 3RTVA 3KMQA 3E01B 1FKPA 3KK3A 3ISNC 4F4ZA 1SL2A 2BQ3A 3TI0A 3GQCA 1S0OA 4JV2A 4RNMA 4KI6A 2HHQA 2FVPA 1HQEB 1WSFA 3FFIA 4Q8FA 3NF6A 3VQDA 4LQ9A 5F8MA 2OPQA 5J2MA 1ZYQA 2VG5A 4B9TA 2P5GA 4FZZA 4YR3A 3M9OB 4FZYA 3MFHA 2XCAA 4KFBA 5SZTA 4DFKA 2P51A 1LAVA 3BR9A 3WNGA 3ZT2A 5FROA 5K14A 5CYMB 4DFMA 1Q8IA 3KLHB 1ASUA 2QE5A 5J2PA 5CZ1A 4RW6A 3AVIA 1BQNA 1SUQA 4F2RA 2DFHA 3I5AA 2OA8A 3KJVB 4I7FA 4DTXA 1JXEA 2HHUA 4JRPA 2OPRA 4ELVA 3MEEA 4YMEA 4EYIB 4G3IA 4CEQA 4RW4B 4HHTA 3KK1A 1UWBB 3SJJA 3FQKA 3O3GA 2E4LA 1SKSA 2DFEA 3VQQA 3KMSA 2VWKA 1ZBLA 3V1QA 1RA6A 1N6QA 3MFIA 4ECSA 4CGIA 1TL1A 1RT4B 4H4MA 4K4XA 3OYJA 2VWJA 1A5VA 2XY5A 3QLHB 1CXUA 5F9LA 3BDPA 2JLEA 1U48A 4Z4CA 3C6TA 3AVBA 4CJ4A 4CF9A 2G8VA 2KFZA 3BQ2A 3DLEB 4C8LA 4Y2AA 1KVBA 3AV9A 2QKKA 1KHWA 2WTFA 3H40A 4FW2A 1RT7B 3DMJB 4AHUA 2OPSB 1IKWB 3D5MA 4DTMA 2FBVA 3LDSA 1S48A 1HNIA 4K4ZA 1JLCB 3CG7A 4HTUA 3PO4A 3V81B 2HNZA 5KFAA 4I2QB 4KTWA 2V0NA 3CJ5A 3JYTB 2XHBA 3KLFB 3KLEA 3N6NA 4DSLA 1RBRA 3QGGA 1R0AA 1WN7A 5KG5A 3G6XA 2IM1A 4HCBA 4Q43A 3DLKB 1IKXB 3TARA 4FJ5A 3T5KA 4MIBA 5KT5A 3UQSA 4IDKB 1JXLA 4FJMA 4O3QA 3CWJA 1GX6A 4ED8A 4W5OA 1LV5A 4TSXA 1C2PA 1XR5A 2ALZA 3PV8A 1W25A 1LWCB 1RDCA 3DLRA 4ZP7A 1TL3B 4R5PA 2WB4A 4WE1A 1WSGA 1CZ9A 1J9AA 3MEGA 1U4BA 1QUVA 3QIOA 4W5NA 4FLZA 5C5JA 4DSEA 4MK8A 3RRHA 1Q9XA 3PJXA 3OJSA 3EYZA 5DMRA 4TY8B 3SI8A 3E51A 5KFZA 3A2FA 4N56A 3PW7A 2YKMA 3EZ5A 2FVSA 5KFCA 2YV0X 5F8NA 1RT2A 1UA1A 2G8UA 3LP2A 1HYZA 1D9FA 2Z1GA 4K4TA 3DOLB 3P83D 1TK8A 4RW8B 4CJFA 4ED1A 3OYAA 3HJFA 3MF5A 2X6NA 3MXJA 2HMIB 1L3TA 2OPPA 1REVB 1X9WA 3OJUA 2AX1A 1S1TB 2PY5A 3GV5B 2D41A 2HHTA 3EZUA 1TV6A 1U04A 2YNIA 4BWMA 3OS2A 1LW2A 2D0CA 1CSJA 1TVRB 2JEIA 4M3UA 3DRRB 1HYSA 4ZMMA 4OLBA 3TAGA 1T7PA 4IOBA 1LAWA 4FLWA 4NRUA 1YTAA 4JRQA 4B3OA 4FZXC 1VSEA 4CF2A 3QNOA 2GIRA 1JLBB 2JEJA 4ECWA 4DSFA 4F8RA 1S6PA 4DFPA 2XGPA 5DG7A 1EP4A 4DTUA 4B9VA 2FVQA 3GIIA 2IJNA 3DLBA 3NF9A 1ASVA 3QINA 4E1NA 3LP1B 4X2BA 2WONB 3I0SB 4CJKA 4WYWA 2XCPA 1HRHA 3AO1A 3DRPA 4GW6A 3HK2A 3FRZA 3NBPB 3OHAA 4FM1A 1KHVA 3ZSOA 1GOBA 5KFTA 2HWHA 4Z4GA 3N6MA 5HP1A 1FKOB 1RT5A 3OYNA 4CERA 3M8QB 1N5YB 2QKBA 4CJQA 1HJRA 3FQLA 4I9QA 4MK9A 1DLOA 4WFYA 1NJZA 3EPGA 2DPJA 2O5DA 4OPKA 3F73A 4JS4A 4ICLA 2JC1A 3GILA 3ALYA 3AO3A 3U6FA 4CJ5A 4CJ3A 1UA0A 3IGVA 3SUPA 4KPYA 4M3TA 3KKRA 2G8FA 3SFGA 3RAXA 4AHTA 5KFUA 4WZMA 4DLGA 3PX4A 3LALA 2W9BA 3IGNA 3LZIA 3V6DA 4NLVA 4KO0A 1ZTWA 4ZPBA 2AWZA 2R8KA 3CM5A 2RKIA 4Y1DA 1RILA 1JLEA 5KFIA 5C42B 3OL7A 3H2LA 2W8LA 4N47A 4O5BA 3QYYA 2BRKA 2YNHB 1S4FA 4OKEA 4Y34A 4J2AA 4HUGA 5JS2A 1WSHA 3TAEA 5KFWA 2ATQA 1BL3A 3AVGA 4K4WA 4KRFA 2HNDB 2YKNB 4FVMA 1NK5A 3S3MA 2D0BA 2BANB 3QLHA 4DSJA 1S1XB 1ZBIA 2FC0A 4ZP9A 1VRUB 4FJKA 2ILYA 2ASLA 3U3GA 2ATLA 3M8SA 5DQHA 3DLEA 2RF2B 1RTDB 4BACA 4CHOA 3VN5A 3LAKA 1WNSA 2OPSA 1IKWA 3BGRB 4E19A 1Z26A 3MXMA 4J2DA 3BQ0A 4ID1A 3I0RB 1NK9A 3QETA 2VA2A 4YR2A 3RMBA 2OYQA 3BSCA 3V6HA 4Q8EA 4B8CA 4ZPCA 5KFBA 2YHAA 4Z4EA 2HNYB 4ECYA 3IRXA 5KRTA 4KHNA 3QEVA 1JIHA 1VSJA 3CVKA 4DQPA 4B08A 4IDKA 4M42A 4F4XA 4HCCA 4KHUA 2BGGA 1W0HA 3NDKA 1S97A 4ECZA 2D3UA 3TAQA 5KT2A 3HPHA 2J6TA 4RW7B 5KRSA 1HMVA 1TQLA 5F9NA 3SQ2A 4ZVHA 5KT7A 3MR6A 5F8LA 4NYZA 1G15A 4E7IA 5HBMA 1RT3B 4RU9A 1JLFB 1BHLA 4DSIA 5KFNA 4N41A 1RTJB 1RTHA 3KLVA 4OGEA 1QE1B 1VRTB 5FRMA 3SNNA 2R2RA 2V4QA 3O3FA 2WOMB 1CXQA 2HVHA 1IKYB 3QGHA 2JGUA 3H5UA 4K8XA 4M3RA 1QSYA 1DTQB 4QWDA 4ECRA 1VK0A 1JLAB 4RW8A 4IG3A 5KG0A 1C1CA 4Z0UA 3KLIB 4C8NA 4H54A 3PR4A 4KI4A 2DTUA 1J54A 4CFBA 3BSAA 2AGQA 4TY9A 2HMIA 4CJWA 3LP3A 1KVCA 3RMCA 4OGCA 1REVA 3LPTA 2HVIA 3K59A 5KG6A 4ID5A 4IFVA 4YP3A 3TAPA 3DOKB 3G10A 4NLXA 2XO7A 4CF1A 1T03B 1QQCA 3DLGB 4CE9A 1T94A 4LQ3A 3IAYA 1KLNA 4XPEA 4OLAA 1BQMB 2PYJA 3NH0A 1S9EA 4AH9A 3CJ4A 3ZT1A 4TYBA 3SV3A 1C0TB 3V9ZA 2W9CA 1DTTB 3QIDA 5DG8A 4J9MA 5I3UA 1QAJA 4CF8A 3GIKA 4CGGA 1T8EA 1SV5B 3ZSRA 1D5AA 4DTPA 1F21A 4BWJA 4YR0A 5EWFA 3OL9A 4PWDB 4DU1A 1W9HA 4FJJA 2B5JB 2IC3B 2W7OA 1TKXB 4DSKA 1ZETA 3MR3A 4KTZA 3N6LA 4DU3A 3QO9A 1NOYA 3T5LA 3HVTA 3AVMA 1U47A 4ED6A 1XR6A 3OSPA 3RRGA 1JXBA 4IH7A 4Q0BA 4F50A 3HVAA 2W42A 1NHUA 5L1IA 3VQ5A 3ULDA 4MK7A 4O3RA 2YNFB 2HW3A 1QSLA 1UOCA 4OPJA 2X74A 2XY8A 3LPUA 4CGFA 1RDBA 2I5JA 3ZT3A 3PY8A 4NCGB 1RT1B 4B9UA 3BQ1A 5FDLA 1EETB 3AA2A 1WAFA 2YNGB 3BJYA 4LSLA 1K1SA 2J6SA 5KFXA 4KSEB 3TQ1A 4ELUA 4K4SA 3L2VA 2R2SA 3LP0A 3MTKA 1KRPA 2UVUA 5KT4A 4O55A 2FBYA 4EBDA 4JS5A 2KZMA 4Y1CA 3KOAA 5F8JA 5KFKA 3ZSXA 4RNFA 3PHEA 5CYQB 3CDWA 1K1QA 3QEXA 4DG1B 3TVKA 2ZQBA 2IM3A 3DRSB 5KT6A 2X78A 1KTQA 1BGXT 4EO8A 1MU2B 4CEZA 5J2NA 3MR5A 3OYIA 4M45A 3K5LA 1RBSA 1VRUA 3H4BA 5J1EA 4PQUA 4U6PA 1GOAA 1LW0A 3KHRA 1HNVA 3ZSYA 4OJRA 1TAQA 3DI6B 4QWCA 1S9FA 1J53A 1TK5A 4PY5A 4KAZA 2F8SA 4RW9A 1NK8A 2DY4A 3SUNA 4LSNA 4NLDA 4FXDA 4CEBA 2BDPA 1Q9YA 5HROA 2XY6A 3SZ2A 3I0RA 4B9LA 4CGDA 3NGDA 1S10A 3QIPA 2AGPA 1TKTA 2ZE2B 4YQWA 1QAIA 3SQ1A 4EP4A 5KFRA 4O4GB 1T05A 2AU0A 4CGJA 3HM9A 1VSHA 1VSIA 3IG1A 4DLEA 1S1WA 2VG6B 4GMJB 1BI4B 3ZT4A 3NF8A 3EY1A 1J5OA 4EP5A 4KHSA 2GBZA 4ECUA 2C2DA 4O0IA 2AX0A 1C6VA 4I2PA 4CEFA 4G1QA 3PW0A 3RB4A 5JXSA 3OYCA 2KFNA 1RTIB 1YVFA 1RT6A 5I42B 1BIUA 5C25B 3K2PA 2Z1HA 1N4LA 4H4OA 1IKVB 4DL7A 1D8YA 1QE1A 2JC0A 4DMNA 1S1UA 4KHWA 4M94A 3JSMA 4FM2A 1S6QA 4ZHRB 1FK9A 1WSEA 3V9SA 5DGBA 3LZJA 2G8KA 3SI6A 2GV9A 3SQ4A 2BE2B 1LWFB 4K4YA 1MMLA 2KTQA 4FJ9A 1BCMA 3QEIA 3DM2A 5J2QB 3AA3A 3F9KA 4BE2A 1JKHA 3V4IB 4AILC 3T5HA 3RB6A 3MXIA 4J2EA 2R8GA 5L1KA 4QW9A 3ITHA 4ECTA 5D3GA 3NF7A 5DLGA 4ELTA 2Y1JA 2E6MA 2IA6A 3T19A 1S49A 4TLRA 4LH4A 1HPZB 1NNDA 4KV8B 5C24B 3TAMA 5KFSA 4FLUA 4ZVEA 3AVLA 2J6UA 5F8HA 3MECB 4PUOA 3VQEA 4GC6A 1XHXA 1TKZB 2C2EA 4MFBA 1C0TA 3DYAB 1S9GA 4M3XA 4BE0A 1C1BB 1QHTA 5HLFB 3NL0A 4B9SA 4IR1A 1EKEA 1SV5A 5KG1A 1LWEA 2IAJA 4HUFA 3KK2B 2ZD1B 4RNNA 4O3NA 1YTUA 1JLGB 1C0MA 3OLAA 3MAQA 1S1VA 4CEAA 3L2RA 4UQGA 3VQSA 1NK7A 4M3ZA 2B5JA 4FLYA 1RCHA 4CHPA 3E01A 1XHZA 3OS0A 4KHYA 4I9LA 3M8PB 4CK3A 1HQEA 2XRIA 4KAIA 3O4NA 1VSFA 3KK3B 3MEDB 4E7KA 3PW2A 4HVJA 5HRSA 5JUMA 4MIAA 1SL0A 3G0ZA 3FFIB 3KLGB 1GOCA 1D9DA 2OPQB 5J2MB 4CJLA 4FCYA 5CYMA 4QAGA 3L3VA 4FW1A 2QXFA 3KLHA 2HB5A 3PVXA 5KFPA 4FBTA 3V1OA 4HYKA 4KFBB 4CHQA 1TP7A 1XC9A 5KFVA 4JV0A 5K14B 3OS1A 1UAXA 3KJVA 3VQPA 2G8WA 4CCHA 1Z25A 3SV4A 2G8HA 1RNHA 3OHBA 5J2PB 5HRRA 4ZPDA 4RW6B 3M8RA 4KB1A 4RW4A 3AA4A 1BQNB 3G6YA 1UWBA 4DS4A 4I7FB 4B8AB 3HP9A 4R8UB 3MEEB 3S3OA 5CYQA 1RT4A 3KK1B 3HHKA 3GIMA 4OKJA 1KCFA 3FDSA 5KFJA 3DRSA 4FJHA 3PW5A 2FBXA 5KG7A 5KFHA 4WFZA 3KD1E 1TKDA 3VQBA 2IDOA 2ASJA 1N6QB 4BE1A 1TL1B 4FK4A 1CZBA 1S5JA 1B92A 4H4MB 3BREA 3CIZA 4ZTFA 5KFLA 4F4YA 2C28A 4AHSA 3H4DA 4F3TA 1O1WA 3M9NB 3HT3A 1RDDA 3PJWA 3DI6A 3C6TB 1RT7A 3DMJA 3CJ3A 5KGXA 5E41A 1KFSA 3HVRA 4TYAA 2ZKUA 4K4VA 4N76A 1JLCA 3H5SA 4EEYA 4FJNA 4CJUA 3CFOA 3V81A 4Z4HA 3OYKA 2W8KA 1ZTTA 4I2QA 1HQUB 3JYTA 3KLFA 3HKWA 5DG9A 2ILZA 4Z4IA 1HNIB 2O4IA 3KKSA 3WNEA 3DLKA 4NZ0A 2HWIA 2HNZB 4KB7A 4URGA 2RPIA 1IKXA 2ZE2A 4DQRA 4URQU 3KLEB 1ZBUA 4URSA 4FJ7A 3NAEA 3P1GA 1R0AB 5DGAA 1SKWA 4J9KA 2I1RA 1D0EA 4KKOB 3RMAA 5L1LA 1RYSA 1BI4A 4KHQA 3KHGA 4FK2A 3WNFA 3K5MA 1LWCA 3AVHA 3SPYA 4NLGA 1TL3A 1SL1A 3C95A 4NLTA 2IM2A 3GV8B 1IG9A 2GUIA 4ECVA 3AA5X 3O3HA 1VSKA 2IJFA 2WRMA 4O3PA 3CDEA 4L8RB 4TY8A 4DL2A 4NCAA 4R5PB 5C25A 4WE1B 1ASWA 4B9NA 3MEGB 2F8TA 2JEGA 3NGIA 1X9SA 2UVRA 3OVNA 3H5YA 2UVWA 2EX3A 1D1UA 4C8KA 3DOLA 2YKMB 1YT3A 5EUHA 3VQ4A 5KG2A 1C1AA 1RT2B 3V6KA 3LP2B 3DDKA 2R8IA 3PW4A 4DF8A 1Y97A 2QV6A 1U45A 4NLYA 2RDJA 4EYHB 2OZSA 1NKCA 4CFAA 4W5TA 3VA0A 2QK9A 1JL1A 3V9XA 4TXSA 1S1TA 3ZT0A 3HVWA 2FLNA 4O44B 2UUWA 4CF0A 4FYDA 1TVRA 5KFOA 2OPPB 3DRRA 4IG0B 2B43A 3QGIA 4DS5A 5KG3A 3SPZA 1NK4A 1TV6B 4EZ6A 2YNIB 4B9MA 4CIEA 2HHWA 5EDWA 1LW2B 4QCLA 1RDRA 3RMDA 3OLBA 4FLXA 1HARA 2B6AB 1HYSB 3RR7A 4CEOA 1JLBA 3L8BA 4F4KA 5KT3A 2XY7A 4Y3CA 4CJPA 5HRPA 4ZPAA 4YNQA 1TKZA 2WCXA 1NJXA 4U7CA 3DYAA 3LP1A 2WONA 3I0SA 5FRNA 4M3WA 2R2TA 2R2UA 4JV1A 3GYNA 1EP4B 2CJQA 3NAHA 3C6UB 4MQ3A 3FSIA 3H5XA 1RDAA 3NBPA 2ZD1A 4CJEA 4E1MA 3BSNA 3NE6A 1CLQA 5DK5A 3CM6A 3SCXA 1FKOA 3B6OA 1L3VA 3OYBA 3NGYA 3RB3A 1L3SA 3DRPB 3M8QA 1N5YA 2B4JA 3M8PA 4BDZA 4TQRA 1A5WA 1WSIA 4BDYA 3RR8A 1RT5B 3KHLA 2WHOA 3AVAA 2GIQA 3MEDA 1L5UA 4IKFA 4C8MA 2IS3A 2FLLA 5EWGA 1X9MA 1TGOA 4FJLA 1DLOB 3KLGA 4F3OA 4KE5A 3BSOA 4XPCA 4E7LA 4ICLB 2BRLA 4DTOA 4HKQA 2XWYA 4CK2A 5KFEA 5HRNA 4NYNA 4CHYA 1SKRA 3D28A 4PA1A 3K58A 3GV7B 1S0NA 3CQ8A 2Y1IA 2W9BB 2EC0A 3AVJA 4LH5A 4ZVFA 5C42A 3V6DB 4O3OA 3TWHA 4GVMA 4DTRA 2R8JA 1EX4A 4KO0B 1SH3A 3ZSWA 2UUTA 2D7SA 3D0PA 3G6VA 3VQCA 4ED3A 2RKIB 2YNHA 4XIUA 1VSLA 3TR8A 1U49A 5EWEA 4KTQA 1JLEB 3I5CA 4MKAA 1RYRA 2A1SA 4DQSA 4R8UA 2F8EX 3QZ8A 4LD0A 3HP6A 3DLHA 3NCIA 1RBVA 4NLOA 4J9QA 4FJGA 4ZP6A 2HNDA 2YKNA 3RAQA 3CJ0A 2BANA 2DFFA 4IH6A 3L2UA 2V4RA 1S1XA 5DQGA 2XGQA 3OYEA 4CECA 4KHMA 4H8KA 3CO9A 2Z1IA 2RF2A 1RTDA 1KLMB 3OYHA 4QWBA 3SFUA 1SH0A 4DL5A 4ZP8A 3CDUA 3BGRA 4J9LA 2VG7B 4DEZA 3AVNA 3PX0A 1Z4UA 4C8OA 3PX6A 3AVCA 1X1PA 4FLVA 1HQUA 1JL2A 3S9HA 2HHXA 1I39A 4FK0A 4NYFA 3RBEA 4DWIA 4RUAA 4NLSA 2IMWP 4CGHA 3ZSZA 2HNYA 1RAJA 4CK1A 3V9WA 4IRKA 4DL6A 4DQQA 4CJTA 3CYMA 3QESA 1FXXA 3QEWA 4IFYB 1B9FA 4DL3A 4CJSA 4CFDA 3ASMA 4F2SA 4KBIA 2R8HA 4KKOA 4YFUA 5KFMA 3H98A 4NLRA 3IRXB 1QS4A 2FVRA 4QWAA 4O3SA 3THVA 4RW7A 3I8DA 3LWMA 4KHRA 3Q8PB 4AHVA 3WNHA 4RNHA 1BCOA 4CEDA 2P5OA 3OYLA 4J9NA 3AO5A 1RT3A 1JLFA 4NRTA 3HXMA 4DTNA 4J2BA 1HMVB 1KSPA 1RTJA 1JLQB 2HHSA 4CEEA 1VRTA 2E9RX 4E0DA 4MH8A 3NGZA 4NLPA 4ZVGA 4QWEA 2BR0A 4WYLA 5HBMB 4N5SA 4E7HA 2AJQA 2WOMA 2ITGA 1IKYA 2FLPA 4DL4A 2LSNA 3RBDA 2YHBA 1RTHB 3I5BA 1WSJA 1DTQA 3K5NA 3OYMA 4OL8A 4CIGA 2XI2A 1JLAA 3KD5E 3TABA 5CZ2A 2G8IA 3KLIA 4XO0A 2CKWA 2PYLA 4CESA 3V9UA 1NKEA 4NCBA 1N48A 5KGWA 5SWMA 4CJRA 4ED2A 2UVVA 2C22A 4IG3B 1C1CB 1XI1A 3HPOA 2HAIA 4Q44A 3HL8A 5KFGA 2E9ZA 4M3YA 4O44A 5KI6A 3DOKA 3HYFA 4WFXA 4IG0A 1KFDA 1T03A 3PO5A 3DLGA 4ID5B 4IFVB 3HSTB 4WXWA 1BQMA 3IS9B 1C0UB 4QPXA 3SUQA 1NJWA 4IKAA 2B6AA 2X6SA 4TN2A 3LANA 4RZRA 3L3UA 4CIFA 3SUOA 4CFCA 1DTTA 3VA3A 4OVLA 2R7YA 2PZSA 2HHVA 4OKKA 1ZBFA 1YVUA 1S9EB 1JX4A 2D0AA 3L2WA 3QEPA 1I3AA 2W9CB 2FJVA 4E7JA 4JUZA 3V1RA 5I3UB 3C6UA 3VQ7A 4FJIA 2OH2A 3AO2A 4M95A 5JS1A 1L3UA 1N56A 1VSDA 4PWDA 4CHZA 2E9TA 2IC3A 3CJ2A 3OYGA 2ASDA 1QTMA 2D5RA 3ZCMA 1TKXA 1WAJA 3C94A 5L9XA 4FJ8A 4FS1A 3EPIA 4EZ9A 1FKPB 3GIJA 4ED0A 3QO9B 5DQIA 3HVTB 5CY4A 2KZZA 1XR7A 5KG4A 3QNNA 2YNFA 3SQ0A 4Q0BB 1GX5A 3TANA 3K5OA 3OL6A 2FJWA 4Q45A 2VG5B 4NCGA 1RT1A 2W7PA 1I6JA 3G86A 3KIOA 1EETA 4WXOA 2YNGA 3UR0A 3HPGA 5F8IA 3AVKA 3D45A 5T14A 2I5JB 5L1JA 1WLJA 4O4RA 3Q8RB 5FDLB 2FVCA 1SUQB 1NK0A 4ECXA 4FLTA 4LSLB 3CFPA 5T7BA 4DTJA 3LAMA 1RA7A 3RB0A 3MR2A 1IM4A 1K6YA 3VQ9A 4RUCA 2OPRB 1NKBA 3LP0B 2IM0A 4RNOA 3O4QA 3NMAA 1IO2A 4DG1A 1TAUA 4JLHA 3SYZA 3AO4A 4MKBA 3KHHA 3TAFA 2GC8A 2IGIA 1MU2A 3H59A 4DQIA 2XC9A 3PUFA 4GC7A 4ECQA 3VQ8A 5F8GA 4RG8A 3V6JA 5KTQA 3UIQA 1NHVA 4W5RA 3U3YA 4DTSA 5J2NB 1KLMA 1QSSA 4J9OA 3VQAA 2IBKA 4J9RA 1IH7A 5J1EB 4PQUB 3OYFA 3AVFA 1LW0B 1HNVB 4EBCA 4AHCA 3CFRA 2VG7A 2BQRA 1XWLA 4DFJA 4QW8A 3ZSQA 2D3ZA 1VSMA 4RW9B 2F96A 4FM0A 4F4WA 3OYDA 4LSNB 4K50A 2IOCA 4EBEA 4WZQA 2XI3A 3K57A 1NJYA 3T3FA 5HROB 4O4GA 3NAIA 1BIZA 3QIPB 4IFYA 1TKTB 2VG6A 4IRDA 2E6LA 5KFYA 1B9DA 4J9SA 4K8ZA 3H08A 1T05B 4ZTJA 2AGOA 3IG1B 3NFAA 1S1WB 4EO6A 3OSNA 3PR5B 3T5JA 5KFQA 1J5OB 1S0MA 3QERA 4CJVA 1RTIA 1HYVA 5EU7A 3QZ7A 4KB0A 2NUBA 5I42A 1T3NA 4QOZB 1U09A 4I2PB 2P1JA 1IKVA 4G1QB 1JLQA 3ZSVA 3KTQA 4NLQA 4ED7A 4R0EA 1RBUA 1RT6B 3T1AA 3KNAA 4IRCA 2W9AA 4ZHRA 4H4OB 1A5XA 4O0JA 4IH5A 2VA3A 4NLUA 1S1UB 1NK6A 4W5QA 3Q8SB 4HUEA 2BE2A 4KREA 1LWFA 3JSMB 4AHRA 3OY9A 4BDPA 4E89A 4Q5VA 2RDIA 1S6QB 5J2QA 1FK9B 2DPIA 1RBTA 2FJXA 3V4IA 1NOZA 3S3NA 3L2QA 3LWLA 2V9WA 3M9MB 4J9PA 2C2RA 3B6PA 4Z4FA 3DM2B 2KQ2A 1OS5A
chains in the Genus database with same CATH superfamily
3WQTA 5DRKA 2BJEA 1JKHB 1RU2A 4CO1A 3O9SA 4IBNA 2W4CA 4LRAA 1AFJA 3OL8A 3T69A 1OH8A 3HSZA 2M4MA 4IQXA 4AQYJ 3G4SS 3R3LA 3VGTA 2R7SA 3VQ6A 1JMTA 3AOBA 2Z2ZA 4DR1K 5AQWA 3CMES 1EIYB 3IFRA 5HMYA 1EXQA 3I8BA 2CRLA 2WB1D 4DB3A 5HLFA 1BA0A 1S6PB 2ZH5A 1XC3A 2YHYA 1LWXA 4Y2CA 2KW4A 3KK2A 2BOPA 2CGKA 3NKYA 1JLGA 4HR2A 3AODA 4KGXB 1FJGF 3W2WB 3N01A 3PZPA 1LWEB 3VEZA 4CBUA 4E3SA 1K73O 1HHQA 3KJFB 2FBTA 5KFDA 3NGUA 4NZ6A 1BISA 2O8FA 3GMGA 4IR9A 2W24A 2IRXA 4DXLA 2NXNA 3KZBA 3P5BP 4X65F 4FWNA 1MWMA 3KK3A 4F4ZA 2BQ3A 5M1FA 3GQCA 1S0OA 4JV2A 3PIPL 5IV3A 1NGGA 1VAZA 1WSFA 3FFIA 1BUPA 3NF6A 4LF8K 1YITS 1IBLJ 2OPQA 4YHHJ 4CQ1A 3BR8A 3CCVS 2BABA 2VG5A 1VQOS 4QIGA 4CNYA 4YR3A 2RS8A 4KFBA 3T1YK 5SZTA 2B9EA 4DFKA 2D0PA 1X4BA 3WNGA 1NGEA 1WKJA 4WIQA 2QE5A 4BRKA 3ULEB 5CZ1A 2V8HA 3ZTPA 4M5MA 4B3SJ 3SCJE 4R25A 3AVIA 1BQNA 2HS0A 1P8GA 2YQ1A 2DFHA 2NXEA 2Q66A 3I5AA 3KJVB 3FGUA 4JRPA 4ELVA 4CEQA 2E7XA 4BC5A 5IWAJ 4HHTA 1PBUA 1FNOA 4M5NA 3UD3P 2CNNB 2FC8A 2DFEA 2AEMA 3JTPA 4BRMA 1VLOA 3Q2SC 3G82B 1U8WA 1N6QA 3MFIA 1F9HA 1RT4B 3D1QA 2GHPA 3OYJA 2QL7B 4BRQA 1A5VA 3A12A 4EAHD 2XY5A 4NA1A 4UZCA 3CCWA 2PEHA 5CD4H 2JLEA 1R6YA 4R79A 3CT9A 3C6TA 3AVBA 3GTYX 2DNOA 3Q0AA 3UE2A 2G8VA 3DLEB 4C8LA 1RWVB 3O8WA 3QRPA 3PKMA 5B0DA 4CYUA 2FHKA 3H40A 3DMJB 3PRBA 4EFAC 1SJFA 4B3MF 3J81Y 4A2AA 3MK6A 3LDSA 1S48A 1HNIA 3CG7A 3QATA 3V81B 2JVOA 3MDFA 3PLAA 4YHHK 3A4TA 4AL5A 2HFVA 1NGBA 4IO1A 3HLUA 5KG5A 2IM1A 4WQ5C 5HMXA 2E7WA 3FJ2A 1ZH5A 4RPFA 4GVEA 4MIBA 1AXQA 5DM7L 2AYGA 5AZIB 2WBNA 4B3SK 4O3QA 4TVAB 2GQCA 1GX6A 4W5OA 1LV5A 1XR5A 3PV8A 3MPYA 1S59A 4HT5A 3R8EA 4UY8T 4R5PA 5IWAK 4YDXA 1WSGA 2F8HA 2BM0A 3MEGA 2MHEA 3DKDA 1QUVA 1JQGA 4DSEA 1M5VC 3RRHA 3OJSA 4ED5A 2JZ5A 3EYZA 4GV6A 5L46A 5DMRA 5FLXO 3J7YP 2YKMA 5GADP 4GKJF 5DDPC 5F8NA 1RT2A 3RW6A 3J7AN 3CCSN 2Z1GA 2VONA 4IZ9A 1TK8A 1GLAG 1KP6A 1HBNB 3MF5A 2V2VA 4LRCA 1MN7A 5HK4A 4DV0J 2O8EA 2L9WA 2VC1A 2XZTB 1IBKF 3MXJA 2SXLA 4CZIA 2HMIB 3QWPA 2HBLA 2OPPA 3OJUA 1S1TB 1AUDA 4IOCL 2G4BA 2P9IA 4GO7X 1TVRB 4M3UA 3D2EB 4NB4A 4PHTX 2AZ3A 4OLBA 2V5HG 3CCMN 1TL5A 1OH6A 4G9ZA 4FLWA 2PFDA 5AQKA 2PIIA 4NRUA 4FZXC 2FZGB 2NRWA 1JLBB 2JEJA 4JK7A 2QLWA 3U7JA 3ZX2A 2XGPA 5DG7A 1EP4A 4DTUA 1IWGA 1B0PA 2EEYA 3QINA 3LP1B 2YVSA 4CJKA 4WYWA 2XCPA 1ELOA 3L4QA 2ROEA 1WBBA 1HRHA 5C12A 3AO1A 3ENBA 4GW6A 5AQUA 1YX2A 2XNQA 3GCWP 1OIAA 1WC1A 5A2QO 4Z4GA 2KFYA 1RAAB 3OYNA 3TA0A 2QKBA 3J80Y 2WW8A 4LRDA 1Y9OA 1S72N 1SKUB 3N9UC 2CQ0A 1U1OA 4WFYA 5H9EK 2O5DA 2EKNA 3NGRA 1CULA 4ICLA 3GILA 3AO3A 4PR6A 1S57A 4LF9K 1YJWN 1UA0A 2ZH2A 4ZVPB 1OYEA 3H0PA 3TU5A 3KKRA 3K7RA 2G8FA 3NNAA 4IUFA 4AHTA 1EHWA 3A5NC 4QPTA 5KFUA 4WZMA 4DLGA 2A41A 1WSRA 9ATCB 1HWUA 4WYBA 1RLCL 2AWZA 2RKIA 3WQUA 3TWZA 5H9FJ 3TJ9A 3OL7A 2Y8WA 1GLFO 2DPNA 4DR4J 3R1HA 2YNHB 4X66J 2E1ZA 4J2AA 2HBKA 1WSHA 3EZOA 4EGLA 1G7CB 3AVGA 1HBMA 1Y5LB 2MQNA 3I82A 3ENAA 3W5ZA 3L6QA 2YKNB 2D0BA 2K3IA 1BWFO 1NM2A 1FTRA 3OVAA 4H5RA 4FJKA 1KVJA 2B9WA 3NCQA 2XMTA 3K8VA 1FJ7A 1T6DA 2RF2B 3CJ8A 1WNSA 2HBYB 1IKWA 1TUUA 4E19A 3DDNA 5B0BA 2F9WA 3MXMA 3ZYYX 4BVPA 4J2DA 3MMCA 4K43A 3M6XA 3T1HF 2GAHC 2ZUAA 4ED4A 5F1XA 2GX8A 5KRTA 1GLBG 2ZH9A 3QEVA 3MPDA 4Y0WA 3D2FB 4HCCA 3MUMP 4ECZA 2D3UA 1FEEA 1RWNB 2XSJB 2ZJQQ 3D7EO 3NNHA 5KT7A 2P9LA 5F8LA 3R5JB 4HACB 5E3AA 1SI9A 5HBMA 2F65A 4RU9A 2WBMA 3TX8A 5KFNA 4I4BA 2JLGA 2WUSA 1UVMA 3KK7A 4CZHA 2CJBA 3O3FA 2WOMB 3MUTP 1IKYB 5GMDA 2FPHX 3DU5A 3QGHA 1H38A 3H5UA 4K8XA 1PCAA 3EXYA 4KGMA 4IG3A 3TEHB 3EKUA 4CFBA 4RKUC 1U2FA 4TY9A 3RMCA 2VODA 3NS5A 3M1VA 3TSUA 2DH9A 1WOPA 2CQBA 2HVIA 5EOYA 3K59A 2L3MA 2WAQD 4IFVA 3SMPA 4ZVTB 3QBWA 2DHAA 4RBUA 5IQQA 2DK2A 1XMBA 3H2UB 1B3TA 1GTHA 1A7GE 1DT9A 2UV8A 3J81j 4LT6A 4NWBA 1S9EA 4AH9A 1PJ7A 3CJ4A 4TYBA 4JAXA 4PRFA 3R7BB 1XNRK 2OTJN 5DG8A 4F04B 1VQ6N 1IR2A 2QFIA 3TW0A 1Y4ZB 2BA9A 4OI3A 3EL2A 4G6VB 1FRIA 4U67L 3SAGA 2VFSA 4CLSA 4YR0A 3OL9A 1XMOK 1W9HA 2W2MP 5EY4A 2DGWA 3NOGA 2B5JB 4JNEA 2W7OA 5LXYA 3MCOA 3Q24A 1ZETA 4DU3A 3QO9A 1NOYA 1CG2A 4CNZA 1V4TA 4F25A 5GAHP 4CTAB 5DM6Q 1NHUA 2IVPA 1QLNA 4WU3A 1Q8LA 4BC3A 1KR4A 2QMWA 1NSQA 4DV7F 2L9NA 5K8OA 2QI2A 1UOCA 1W7WA 1HW8A 3LF0A 3ZTRA 3M2UA 2I5JA 3ZT3A 2H65B 2V2ZA 2CQ3A 3C65A 3WXJA 2QEXN 2QC3A 2E5GA 5GAGP 2UYTA 3BJYA 2J6SA 2AYBA 3VEVA 3TQ1A 1VQYA 1NGHA 2KHDA 1OMSA 2GVDA 2DCLA 4ITSA 3KOAA 1TL7B 4PXCA 3B78A 2ZVIA 1PG5B 4WP8A 2JWLA 3HCXA 4DG1B 2HVDA 3ZZRA 1S7HA 3N28A 5ITHA 2ZJPL 1KS2A 4EO8A 3TUPA 1QHAA 2ASYA 2W1BA 1MU2B 1WC5A 5J2NA 2HQ3A 2UUBJ 1M1HA 2J8AA 2XYGB 4M45A 1Z2ZA 4GVBB 3AD7C 3D66A 4PQUA 1RKIA 8ATCB 1GOAA 1LW0A 3KHRA 1HNVA 3PEHA 3I4PA 2W2NP 3DI6B 4C3KA 1FRHA 1UVNA 2Y1RI 1KAZA 2PDAA 2O67A 4NXMF 2P9UA 2BTFA 4JI1K 3PSIA 4FWPA 4PY5A 1OY6A 5KQDA 4RW9A 3GFHA 1WC0A 4DZ6A 4P2MA 3BO2A 1NK8A 3E3XA 3SMZA 4JKGB 3F2KA 4NLDA 4Q7AA 4FXDA 3MZIA 1PKUA 4LF4K 4OLOA 3DHXA 2QT7A 4PXBA 3NGDA 1S10A 3FRYA 1TKTA 3W8GA 1QAIA 1Q18A 3SQ1A 4X4OA 1MSWD 3OBIA 4CO5A 1R43A 1T05A 2AU0A 4CGJA 2E5LJ 1UEKA 4DLEA 3IG1A 4DUZF 1BI4B 3NEKA 1BD6A 1WUAA 4M5LA 2KXFA 4CI0B 3A13A 2DHXA 4NE9C 4O0IA 2AX0A 5C2GA 2FLOA 3NP5A 4QR1A 4A47A 4LF1A 2IPOB 3VF0B 2KFNA 1YVFA 5B0AA 3VEYA 2GHVC 1RT6A 3W60A 3FC9A 1Q7LB 5C25B 2GELA 4KIAA 1J5EJ 4WKRA 2JC0A 4FYXB 1VQNS 4LFAK 1S1UA 4JYAF 4AYBD 4KHWA 4DV6K 3TEGA 2UUBK 1FK9A 1WSEA 3V4MA 2HQFA 2G8KA 3SQ4A 4F0KA 2QM1A 3AOCA 4J9VA 3AA3A 2U1AA 3F9KA 2FSKA 2ZOFA 1JKHA 3V4IB 4AILC 2QA2A 2B4VA 1OS5A 2J9DA 2O01C 3CPEA 4K2JA 1NDPA 2V50A 2B51A 2Y1JA 3CUNA 3OFHA 1UTAA 4A8YA 3QQCD 3AAWB 1B4SA 4LIWA 5KFSA 3PIOQ 1XNQF 2HQCA 2PA8D 2J6UA 3VEOA 3MECB 4YB1P 3VQEA 3CJRA 3P49B 3CJQA 5AXKA 2YY3A 4OYWA 1Q1KA 3QSIA 3W0LA 3BGOP 1M5HA 2ZNZA 5DETA 4M3XA 3FR0A 2M7SA 1LXNA 4BCAA 4B9SA 2HVZA 3W2WA 1EKEA 3A5LC 3SXLA 2CFXA 5KG1A 1LWEA 2H3EB 4PZVA 2HLUA 1C0MA 3VAHA 2M9KA 4PG7A 3L2RA 2RUGA 1NK7A 4TU9A 4AT1B 1RCHA 3H1VX 3HRGA 2MZQA 4A5AA 2AP1A 3M8PB 1Q5YA 4LFCF 4HL9A 3FFKB 1QVGM 1PYSB 2LLZA 3ZNUA 3K2YA 4WCEL 5HRSA 1NZ8A 3U4LA 3MM5B 4ZIVA 3KLGB 1GOCA 1Y00A 3R5BA 3P31A 4QAGA 2F4VK 2H51B 2I2YA 2FGOA 1AT1B 2E29A 4HYKA 3ULEA 3L9ZA 2VJUA 3D54A 1W97L 3LA0A 2DNQA 3K8WA 1M5SA 3KJVA 1YBTA 3FCVA 2ZWOA 3EM1A 1BUXA 3EO3A 3HI9A 2XLJA 4KB1A 2PGCA 2NLXA 2V67A 2O3DA 4EUVA 4ILHA 3BDEA 3ENHA 3OW2M 3R1XA 3T6JA 3MEEB 3G82A 3SQGB 3I56N 2HHHK 2ZWHA 1RT4A 3KK1B 3KFWX 1KC8O 1P27B 1K47A 4FWRA 3FDSA 3TJAA 3UD5A 5HMZA 4FJHA 2FBXA 2A2CA 2EFNA 2HRYA 3KD1E 1TKDA 2CGJA 3BKTA 3VQBA 2IDOA 2ASJA 1CZBA 3J80O 3W63A 3CIZA 3QB0A 1HIYA 1EAYC 5D6GA 1NDKA 4RUHA 1Y3JA 1WWHA 1NLVA 3H4DA 1IXKA 1WACA 2ADBA 1O1WA 3M9NB 2VBYA 5DZ7A 3DMJA 1XJWB 4P10A 1T9TA 1KFSA 2OD6A 2YBVA 3HVRA 1HHSA 4N76A 4K4VA 3DN9A 4FJNA 4H5TA 3V81A 3OYKA 1IV0A 4P71A 2N4DA 2LA4A 5B7WA 2ILZA 2AP6A 2JHEA 4RJVA 3WNEA 3RSEB 4Q2LA 4NZ0A 4ZPTR 4KB7A 4URQU 4OZ5A 3GP9A 4URSA 3P1GA 2AJ2A 2UZAA 5DGAA 4ZPWR 1FX4A 3FEXB 1Y3KA 5AZIA 3B4MA 3WUHA 1MWZA 3HZGA 2ZH6A 4JI5F 4KHQA 4JI2F 3WNFA 3K5MA 5ETLA 2M70A 1TTHB 4I1TA 2GUIA 2VB6A 3O3HA 2ZZTA 1VSKA 2MKKA 4O3PA 2VBZA 1HBOA 2W40A 3HFVA 4N8NA 4OI4A 3TZWA 4LSZB 1VYAA 2CQ2A 4YB6A 3NGIA 2UVWA 2QLFB 3W7BA 4FKXA 2LDYA 3BKFA 4ZPVR 5FJ4A 1LCUA 3BF3A 2AMCB 5HANA 3KJNB 1HBNA 5JJBA 4DCPB 2R8IA 4DF8A 2QV6A 2QLBB 4NLYA 2RDJA 1QQNA 1NU0A 4CFAA 4QIVA 2MEWA 1WG4A 3PSFA 1S1TA 5E7OB 2HOEA 3ZT0A 1P9QC 2FLNA 5K20B 1U0HB 1YLXA 2MHNA 1TVRA 5KFOA 2QWPA 4X4VA 3D2EA 1RHUB 2HHPA 2E2NA 2YNIB 3KHYA 1YJ9S 1FERA 1NSKL 4C9DA 2MZSA 4CEOA 1JLBA 6FDRA 3WEEB 4CLFA 1FD2A 2F3JA 3BF4A 4Y3CA 1I94F 4YNQA 1MNEA 3PHTA 2YHWA 4DU8A 2WC9A 3LP1A 1NGJA 2R2UA 2XG8A 3GYNA 1B64A 4DR2J 3H5XA 2Z56B 4E1MA 2XS5A 4E2FB 5D4OA 3SCXA 1EKSA 3M30B 3OYBA 4YOVA 5B0GA 2QYGA 2B4JA 1NPRA 4X62J 4A5BA 4C8YA 2AD9A 1HNXJ 1RT5B 1FRXA 2GIQA 3SLCA 4UZBA 4C8MA 1HNWF 5JICA 3CD5A 4FJLA 3UB5A 3HI0A 4F3OA 1IBMK 1U6FA 1UJ6A 2X1BA 4DTOA 4DCOB 4LFBK 4CK2A 1WTFA 1LQ9A 2OCEA 1N8RT 5I9EB 2DXDA 4FL9A 1RK8A 3CI5A 4WK1A 2EC0A 4BRLA 4ZVFA 3CC4N 1EX4A 4KO0B 1CJTB 3D0PA 3G6VA 2E8AA 4ED3A 1R0BG 2YNHA 2B3TB 2Q36A 5C10A 4MKAA 4C0OC 2A1BA 4R8UA 2Q3PA 2HGLA 4B3TF 3U8XA 1NMDA 3OTBA 2QRRA 2NYHA 4J9QA 4FJGA 4K0KF 2YKNA 2HF4A 3W64A 1UMJA 2F1FA 3WXIA 3G71N 1TYQB 2DFFA 3L2UA 4F26A 2DYAA 3GYXB 2ZNYA 3P96A 1CEZA 2J5AA 1FJGJ 4KHMA 1FJEB 3H42A 4H8KA 2RF2A 4HDGA 4QWBA 3GCXP 5AQJA 1GLCG 4LRFA 1FE0A 4ZP8A 3RBZA 3CDUA 1N5SA 3CIMA 5A8WB 3WX8A 2MQMA 4J9UE 3U1LA 4X65J 4HH1A 1HQUA 1S99A 1JL2A 4FWSA 4BY9C 4FWMA 3EMTA 5E5NA 4DI6A 3IWNC 4FK0A 4NYFA 1IUJA 3RBEA 4NEZA 2IMWP 4X4PA 1RAJA 4OQJA 4IRKA 4DQQA 1MROB 4HTIA 3ZZZA 4C3MA 3QESA 4IFYB 4OX9F 1JJ2M 4DL3A 3D2FA 2C42A 2BACA 1CC7A 4BHQA 4L3QA 3TVYA 2XSJA 3N4WA 2J0QD 1I3OB 4E8UA 3THVA 1S76D 1B70B 3ZXWA 5EHHA 4CEDA 2P5OA 4HACA 3MHYA 3TR5A 4J9NA 3BPSP 1T02A 4EWTA 1JLQB 1K0TA 1D4XA 4E0DA 3MX2A 3NGZA 2C3MA 4WYLA 2RDDA 3QBXA 2WOMA 2F7VA 4DR5F 1IKYA 2VPXB 4DL4A 1RTHB 1WSJA 2KYXA 2NCKL 5F3ZA 4KT0C 2GAGC 3FCHA 3IBWA 1D09B 3OYMA 4CIGA 5IT0A 5LT5A 4PG6A 5CZ2A 4XO0A 4AFFA 3CE8A 2YWGA 5KGWA 4OX7A 3OFGA 3JTNA 4ED2A 2C22A 1XI1A 3HPOA 4H5VA 3DLJA 2VQFK 3CD6N 3PYDA 2E9ZA 3L3CA 4X65K 4M3YA 4C1NI 2DGTA 4IG0A 1KFDA 3AQOA 2P9NB 3CC7N 4WF9Q 1V3RA 2L9DA 2BUNA 3SUQA 2HF3A 1Y64A 4TN2A 3LANA 3C19A 3NGKA 3FZKA 4CFCA 2B9XA 3W9HA 4OVLA 2R7YA 1R8BA 3OVBA 2PZSA 4ES2A 1YG0A 4OKKA 1ZBFA 1MMNA 3UKUB 4CLKA 1JX4A 2D0AA 1I5OB 1I3AA 2W9CB 2FJVA 5CCMA 4JUZA 4E7JA 5I3UB 1UEVA 3CIPA 1N56A 5J1NA 4CHZA 3R5DA 2ASDA 1QTMA 3HFZB 3I4HX 2HBRB 3CCES 3A8JA 2UXBF 3NVMA 1WAJA 3VENA 3WIVA 1FT8A 3H3NO 2ERRA 2EFQA 2MKIA 1T9VA 3PM9A 3O1BA 4X64F 2B4UA 4NA3A 1RUSA 4MAKA 4CTAA 3CHWA 2CQ1A 5DQIA 4LF6F 2KZZA 4GKJJ 3S01A 5MLCQ 4KQZA 5BPNA 4Q0BB 3RGIA 1KVIA 3OL6A 3BEXA 3LOUA 3A8IA 5A8RB 2W7PA 2YH1A 1S5ZA 3VERA 3VVUA 1KDNA 2QWMA 3HPGA 2VFVA 1NEEA 1IBKJ 4BRPA 5F8IA 4LR8A 1VQ8S 4YB7A 3MTJA 4CP5A 5ELZA 4NPOA 4ZVQB 3Q8RB 3QBCA 1SUQB 1NK0A 3DXSX 6AT1B 4FLTA 4PWWA 3CFPA 1YJNS 4C0HA 3M6UA 3LAMA 2NS1B 3VQ9A 1R0CB 2OPRB 3MWPA 1NKBA 1DHMA 3LP0B 2ACYA 3O4QA 3OV7A 4DG1A 4JLHA 2Z2LA 2Q97A 1V5VA 5FIIA 1SZ2A 1OPIA 1MU2A 3LGHA 1Q95G 2QG9B 1CS4B 3DJCA 4GC7A 2AHOB 5AJ3F 3PRDA 3O80A 3UIQA 3A3OB 1NHVA 4ZLJA 3U3YA 5BPMA 1YXQA 4QBUA 4DV5F 4MTPA 4LR7A 1VQPS 2MZJA 3BH6B 4AHCA 3NCPA 5JMVA 1VQKS 4I69A 3UN3A 1YSJA 4JKGA 3NCRA 3VGMA 2BQRA 4BREA 2FHOB 3BZCA 1GH8A 4GKJK 2D3ZA 3GPAA 3CCQN 3NNCA 4WBFA 2IMOA 3OYDA 3HHLD 2ZDOA 2FHJA 2XI3A 3K57A 5CHIA 3QIPB 3IRWP 1IBKK 2IBOA 2HSEB 3MM7B 3WC2A 2CYYA 3R97A 1C0FA 4ZTJA 2OLWA 1X5OA 3J7YI 5K8PA 3NFAA 5DDOC 3C0BA 5GADI 3M7VA 2MZ1A 3IMXA 4ETZA 2QA4G 3T5JA 1G4CA 3QERA 1HYVA 4KB0A 1TUVA 4QOZB 4QU7A 1WF2A 4I2PB 4ED7A 2O8CB 4DUYK 4R0EA 4JI4F 3VMFB 4U7BA 1RBUA 1R7IA 4CD3A 2QLXA 2W9AA 4O0JA 5IQ6A 2BH1A 2DNMA 2Z0GA 2VA3A 2ZOGA 4W5QA 4HUEA 2MQ8A 4KREA 3JSMB 2OELA 4BDPA 2DPIA 4OIXA 3UDEA 4CRJA 3V4IA 3L2QA 2I9SA 2YH0A 3M9MB 3OUYA 2C2RA 2NYIA 1R6VA 1WHXA 2KQ2A 1SJ3P 3FCWA 3UE5A 2CPIA 5SUHA 5D3GB 4CT8A 4LY7A 1H3DA 4JB8B 4USHA 3MECA 2RNEA 1T3VA 4K4UA 3KUGA 3IN5A 5ETSA 3AY0A 4PAAA 3T1HJ 2YTCA 4B3OB 4I6AA 3EGVA 4DJBA 1Q81O 2X1GA 2RN2A 3O5BA 4JI0F 4I67A 2ASPA 1WNEA 1LNQA 4BGBA 4L72B 1PSDA 1ITGA 1WG1A 3ICLA 1SH2A 4MFBB 2R7OA 1S9GB 3R2CJ 3NHGA 3E8OA 4CHNA 3HJVA 1J2VA 2ZH7A 1H2UX 4FBUA 4M41A 5DLFA 4DF4A 1XK8A 4FS2A 2V8PA 2ZJQL 4BBYA 1KVAA 4QZVB 1NSAA 2V34A 3RTVA 3GB0A 1BHNA 3ISNC 3TJ8A 3MD1A 4A2BA 1YJUA 1WDDA 1CC8A 1HQEB 2EK1A 1TUGB 3MPUB 2UXCF 3JXUA 2DKOB 3VQDA 4DV2F 2UU9K 4ZJLA 5F8MA 4PCQA 1ZYQA 4Z37A 1HD1A 2P5GA 2EXUA 3M9OB 4B1VA 2P6TA 1QVGR 5HJXA 1N36F 3G25A 4BR9A 2B0GA 5F0UA 1KQSM 2ZKTA 3JSBA 2MLZA 4J8FA 1N54B 4F2RA 1EQMA 4ES3A 3MEEA 3PJ9A 3SQGA 4EYIB 3FZFA 1X0FA 4G3IA 3O9UA 2ZITA 3KK1A 5DO2A 1TFYA 2DR9A 2DBBA 3KMSA 1NGFA 4IO8A 1ZBLA 4B3RF 3V1QA 3U1MA 4WFNL 4PPDA 4K4XA 1RGVA 2E44A 2I6WA 3QLHB 4PXEA 1CXUA 4IXCA 1XBWA 5F9LA 3OW2R 1U48A 4Z4CA 4CF9A 2KB2A 2COLA 3D1HA 5LL6d 2IRUA 2KFZA 4NA2A 1UJ5A 4Y2AA 2F8MA 3VALA 2WTFA 4FW2A 3LDPA 3VTHA 2OPSB 3D5MA 4IOCQ 4DTMA 2E1CA 2CQHA 5IM0B 4FN5A 3W5XA 3U9ZA 2CZ9A 4PQAA 1UAWA 3RSEA 3QJJA 4B1WB 5KFAA 4I2QB 4KTWA 2V0NA 2P9SB 1BC6A 3JYTB 3TYTA 4DSLA 1RBRA 5DM6L 3QGGA 4DV7J 1WN7A 3G6XA 4Q43A 3DLKB 3LGMA 2YPZA 4DZDA 2J0SD 1RAFB 1PC5A 5KT5A 1H73A 1VQ7N 2B7CB 2DISA 1Y11A 1JXLA 1V5IB 5BR9A 3HHNB 4NLCA 4MMOA 4ED8A 3R27A 3MN6A 2DXEA 1PC4A 3FBBA 1V3SA 1W25A 4JI7F 5F3TA 2CPFA 1RDCA 2PFUA 2N7CA 2U2FA 4ZP7A 4HH0A 1KQGB 1CZ9A 1BA1A 1HA1A 3QPIA 1BXNA 2RH3A 5C5JA 1WSVA 1RGIA 3PJXA 4OHWA 2A3JA 1VC5A 2UUCF 3OBWA 3ENOA 5KFZA 3A2FA 4CO3A 2YV0X 3OD2A 3AY9A 3P83D 3KWMA 1SBRA 4CJFA 4CBXA 4ED1A 3HJFA 4O8UA 3VOVA 5E33A 4EFHA 3CJ7A 4ISGA 4C48A 3TNVA 1U0HA 2AEJA 1WJ9A 3L7OA 4NXMJ 3AJ1A 1B0TA 5E26A 3VAMA 4CDIA 2PY5A 3GV5B 2HHTA 5LSLA 1U04A 1A6LA 4P6QA 1EB0A 1NMEB 2YNIA 3OS2A 3THTA 4ISFA 3IO1A 1K8KB 3RVCA 3R3TA 1N52B 2B4OA 2Z2YB 2Y0SD 2X3GA 4N77A 1LAWA 2EC2A 1YTAA 1FRKA 5AE2A 1FWPA 3MN9A 3WXMB 3QNOA 2Q43A 4ECWA 3H1QA 2CWKA 4DUZJ 2R7UA 3M1FA 3CC2N 2IJNA 3DLBA 1ASVA 1ZBTA 4E1NA 1VQ9S 2WONB 4MJKA 1C4AA 5GAHI 1PJ5A 1B7YB 1AYEA 2NUUG 4OPAA 2NXCA 3M30A 2E1AA 1GLDG 2XMMA 4FM1A 3ZSOA 1N88A 5KFTA 2WBRA 1H0HB 5HP1A 5B0EA 1FHTA 1RT5A 5AT1B 1RBOB 1N5TA 4CERA 2DHGA 2H5IB 3M8QB 4CJQA 2HFOA 4JYAJ 4LF7F 5GAGI 3FQLA 3IWLA 5M2UA 5B0CA 3FZLA 2BBEA 1SCJB 2DPJA 1OSCA 3F73A 4OPKA 1K73T 3IC1A 3CJKB 1CPZA 4TLQA 4JS4A 1RHRB 4CJ5A 2MSTA 4CJ3A 1ZM4A 4F9OA 3IGVA 3P38A 2EBEA 2ZVSA 4KPYA 4M3TA 3AARA 3CSKA 3B8HA 3OR1B 1MA9B 3BKUA 3T9ZA 3NGTA 4O8KA 2V7YA 2M5YA 3KXDA 2ACMA 3LZIA 4NLVA 4KO0A 4ZPBA 2VV5A 1V6HA 3OFEA 1QQOA 1XNQJ 1NB7A 3CPWM 3OTOF 3NWGA 2CWXA 4DDFA 3PIOL 5D0EA 2BKNA 2MTLA 1X4DA 4HUGA 3VF4A 2NZTA 1OQ6A 1G3OA 2CDQA 3C16B 3EE8A 2GA7A 2XM3A 2IIHA 2QX0A 4KRFA 1WG5A 2IDLA 4FVMA 3W5YA 2BANB 1S1XB 1ZBIA 2R7WA 2FC0A 1VRUB 2YWFA 4UF4A 2ASLA 1YJVA 2QXLA 3U3GA 2BJ1A 2RAQA 5A8WA 3CEDA 1XMQK 3HD1A 4J90A 1PBAA 3FMWA 4JI3F 2WFBA 2IJRA 4FKYA 5C15A 4LFCJ 1Z26A 2QL5B 2JH3A 3AGKA 2RRAA 3R6LB 4YR2A 3X3UA 1KOOA 3RMBA 2MQPA 1JCFA 3HTVA 3V6HA 4Q8EA 4NO7A 2B8PA 2DGQA 5KFBA 4BRCA 4F02A 4OFZA 2C2MB 1JIHA 1VSJA 4B08A 4IDKA 1YTYA 4CW7B 5E3RA 5GAEU 3TAQA 4B1ZA 1IVZA 5KT2A 4H0VB 3N5FA 1FE4A 2J6TA 4RW7B 1XNQK 5KRSA 1TQLA 3SQ2A 1JJ2R 3MR6A 2PC6A 4UOFA 4FWOA 1JLFB 2J76E 1BHLA 4LF2A 4N41A 4EHTA 5F41A 3B54A 1RTHA 2LU1A 2VQEF 3O9QA 1UW4A 2FD2A 5FRMA 4HHJA 4DOZA 3SNNA 2WSCC 2HVHA 1CXQA 2GS8A 4Y2IA 2PFFB 2C1EB 2LP4A 2JGUA 1DTQB 4QWDA 2JVRA 4RW8A 4Z0UA 1SB6A 2DTJA 4C8NA 3TRGA 4H54A 1N34F 2EFPA 4KI4A 2DTUA 3FEYB 5E3CA 3BSAA 1X4AA 2DHSA 1REVA 2C2KB 2P9NA 4YP3A 2GMHA 4BR0A 1SJ4P 2LU2A 3DOKB 3G10A 1SJ1A 2R7TA 4LQ3A 1AA1B 2CQDA 4OLAA 4JV5F 1H7WA 3BGUA 1YF5L 5EX5A 2P9PB 2GMJA 3UKUA 2E88A 3KKFA 4OX8A 3V9ZA 2W9CA 5I3UA 2F9TA 1QAJA 2VBWA 4JI5J 3LUYA 4UUWA 5L38A 2QA1A 4CGGA 3QWUA 4JI8K 1SV5B 5LMNK 1OH7A 1D5AA 4JI2J 3MD3A 3SSSA 4CVNE 1GFWB 5EWFA 3QJPA 5CD4A 8AT1B 1WF1A 4HDHA 2IA0A 2G2YA 1VMBA 1TKXB 2MKCA 3MR3A 3T5LA 3AVMA 1FJCA 1U47A 4QIEA 3DGPB 4OJGA 4M5KA 2UXDK 3JTOA 2GEMA 4Q0BA 1R8HA 3HVAA 4D3GA 4L6V3 4IOAL 3VQ5A 5I3PA 5ADZA 1LKZA 2OANA 4O3RA 3I33A 4ZITA 4M7YA 2UUAK 4OPJA 4L75A 3LPUA 1K9MO 3D0GE 2Z2MA 2ZZNA 2C3PA 2MMYA 4B9UA 4BRFA 4CZEA 3OFFA 3B4DA 3H6EA 1YDLA 4MKYA 1WAFA 2AV5A 3A5OC 1HKGA 1MMDA 2ITMA 2OEJA 3MEKA 3PFOA 4Y28C 3MR7A 4ELUA 4K4SA 2QL9B 3LP0A 2D0OA 5KT4A 2W6LA 4EBDA 4JS5A 3PEJA 4Y1CA 3RJMB 1HD0A 5AQRA 4XDDA 2MKJA 4RNFA 5CYQB 3AOAA 3CDWA 2FB0A 1K1QA 1I94J 3TVKA 1CS4A 3B6BA 1XQIA 4JI5K 2KRBA 3HBTA 1T0TV 4OJ3A 3GLJA 3CJTA 3ZZPA 3M6GA 2E1MC 1VHFA 4V19J 3CCSS 1MWYA 2G2OA 3LM9A 4DR6J 1N32F 5DS7A 4YOYA 1N33F 2DNYA 1K8AO 2Q6CA 4KAZA 4PXDA 2A6OA 4ES1A 3HZEA 3E9OA 4HWIA 1KAXA 5EN1A 4ANDA 2ZZMA 3GYGA 1CJUB 2BDPA 2XY6A 3I0RA 4B9LA 1HNWJ 2OUGA 3QIPA 2ZE2B 4YQWA 2W2QP 3MM7A 5KFRA 3CCMS 1UP1A 5B0FA 4O4GB 2L48A 2MKHA 4KY3A 3HM9A 1VSHA 2RIJA 2DY1A 3WX4A 2CIMA 2VG6B 5D4NA 2BE7D 4GMJB 5LL6Z 3ZT4A 2LA6A 3VEWA 4A61A 4OO1J 2W4DA 3EY1A 3CXCM 4KHSA 2GBZA 4ECUA 4BQZA 2CZ4A 3SSRA 4I2PA 4OZNA 4CEFA 4RL1A 2MPUA 3JAMO 2O8CA 1RTIB 1LFWA 4GMKA 1YUWA 1Q8BA 3F41A 1OSDA 1I94K 2D74B 4B3TJ 1QE1A 4DMNA 2OTLS 2EW9A 4M94A 3JSMA 4K0KJ 3KG1A 5BREA 1QUPA 4WCEQ 5DGBA 2QMXA 4FNIA 1H72C 3SI6A 5M1NA 1S72S 5LSOA 4DR6K 2BE2B 4XH1A 1LWFB 1MMLA 1N0VC 2OP5A 1YJTA 2M52A 2CADA 1RI7A 4BE2A 1YJWS 2DXFA 4J2EA 2R8GA 5L1KA 4OX6A 2FUG9 4ECTA 5D3GA 3WZ0A 4ELTA 2GW8A 2E6MA 3R2DJ 2IA6A 5AQYA 4TLRA 1HPZB 2VHGA 5C24B 1U1MA 3ZZTA 4ZVEA 1RB0A 1Z1ZA 4BRNA 5D15A 5F8HA 3BZKA 5E84A 1QDUB 3DRYA 1N5VA 5DDQC 1YZ7A 3ZC4A 5ETOA 2GIFA 2ZBRA 2MB0B 1YVNA 3MAHA 4OX9J 1TKZB 4JOUA 4MFBA 1C0TA 4LF5F 4DR7K 1S9GA 3VZHA 1C1BB 4IR1A 4CZCA 4DR3K 1HNZF 2A0FB 4Y65A 2ZD1B 3OLAA 3MAQA 1KEKA 2BKOA 1ZBSA 4UQGA 3VQSA 2OJ3A 2FYXA 4CH1A 4Y2MA 1HHTP 3CCRN 4FLYA 3IM8A 1XHZA 4ZVUB 2ZM6K 4AM6A 1HQEA 2XRIA 4DR5J 1VSFA 2GWKA 1QZ6A 4FDFA 1RTZA 3PTWA 3MEDB 3ZTSA 1YBAA 1R8PA 3UDCA 3PW2A 4DR1F 4QJVA 1HUXA 4YS2A 5JUMA 4MIAA 3N4QA 5CHCB 1X5PA 2Y0BB 2F9DA 1WB9A 1D9DA 2JSXA 5LMUK 1QAXA 4CJLA 2XB2D 3QT6A 3L3VA 2QXFA 5LJVA 1E6VB 3V1OA 4H0OA 4CHQA 1RE1B 1X60A 1XC9A 5KFVA 3K0SA 3P3DA 3VQPA 2O1PA 1Z25A 4JKDA 5J2PB 1WI6A 4ZLNA 2C2NA 1Z2LA 1ZM9A 3AA4A 2R4FA 2E2PA 2LQ5A 2M88A 2FJEB 4I7FB 3DAWA 4C2MA 4WF9L 5B08A 1KQSR 4UTGA 4OX9K 5KAKA 3HHKA 3GIMA 1CLFA 4RTFD 1D3WA 3DRSA 1Q8KA 5KFHA 4RBVA 4LF8F 2E5HA 1HI0P 1TL1B 4FK4A 4H4MB 3BREA 3THPA 4F3QA 2MZTA 5KFLA 4I68A 2HG4A 5ETPA 3T1YF 2OO4A 2PA3A 2MKYA 2C28A 4AHSA 1M1KO 1VFJA 2DJWA 1RDDA 5CABA 3PJWA 2XQCA 2UXBJ 4K42A 4QIWD 2BZ2A 2DNHA 1JK9B 5KGXA 3HKZD 3DU6A 2H3GX 2ZKUA 3K5PA 3H5SA 5D0HA 4CJUA 4X64J 3CFOA 4CZFA 4I2QA 4CO0A 3TZZA 2P9SA 3JYTA 4OHZA 5BR8K 4LF6J 3HKWA 5A8KB 5DG9A 1KD1O 3LW5C 4Z4IA 3KJQB 3ZZ0A 2Y3YA 3IR7B 3DLKA 1PAEX 3VV2B 2RPIA 5D8HB 3KLEB 1ZBUA 3NAEA 1NBWA 1SKWA 1MWQA 4CZLA 2ZH1A 4J9KA 3CCLN 3L0QA 1AW0A 1OWXA 5DZ6A 2NZCA 5LJ3Y 3HD2A 2OTJS 4FK2A 1VQ6S 3K9JA 1JWWA 2KKHA 1R27B 3C95A 3R6GB 3GV8B 5CR4A 3UVJB 3BO4A 2IY5B 4ECVA 2G0CA 2VYPA 2Q0RA 3CDEA 3HZ6A 4WE1B 1RAEB 3G8SA 1E3MA 4HT7A 3PYGA 4A8QA 4KH5A 1HJOA 1D1UA 3WQPA 1U02A 3IR5B 1OO0B 4BRDA 1YT3A 3VQ4A 5AJ3J 2IVNA 1VCTA 1PGZA 1C1AA 3AAQA 4FYYB 4Z7CA 3M2VA 4KR0B 4EYHB 2UXBK 2ZF5O 1IWAA 2XLKA 1RSCA 4TXSA 4DV5J 4B3SF 1DURA 3NS7B 4XH4A 4L73A 4X64K 1FDDA 2P6SA 2QEXS 4O44B 2QWRA 2H54B 5B09A 2HQDA 4FYDA 1K8KA 2YWWA 4DS5A 3J7ZO 5A2QU 1P1LA 1TV6B 4B9MA 4CIEA 2HHWA 1KKHA 2YX4A 1LW2B 3VTIA 2KLAA 3P5TL 3RMDA 1HARA 1K44A 5AQGA 4ZLLA 1Q0NA 6FD1A 3RR7A 3MWBA 3L8BA 2XY7A 2VL1A 5RUBA 4CJPA 5AQVA 2VFRA 4ZPAA 1NJXA 3M8YA 1URRA 2LKZA 3DYAA 2C2ZB 1FRLA 2WONA 3KYLA 4JV1A 2GQ2A 3R6MA 2CJQA 3I31A 2DR7A 4MQ3A 1Y5NB 3K17A 1RDAA 2RS2A 5DJBA 4CJEA 4FF4A 3QICA 4GKKK 1FNXH 1T44A 3O9TA 4MDAA 3BSNA 3DFEA 5KPRA 3CM6A 2LXIA 1L3VA 4HVZA 1L3SA 1IN0A 3M8QA 4X4NA 4JI4J 1VK3A 4TQRA 4YOUA 4BDYA 4O23A 1WOSA 4ZVOB 4QQBA 2EKYA 2WHOA 3CJKA 2EI5A 2VPYB 4YOEA 4FZVA 3RU0A 3BSOA 3BYRA 3SBTA 4E7LA 1HBUB 1X5TA 5KFEA 3IAM9 4CHYA 1SKRA 3D28A 1WHYA 3CTRA 2EFVA 1ZM2A 5LJWA 3AAPA 5TKWA 3GV7B 3CQ8A 2MXYA 2Y1IA 4I64A 3ZX3A 3THXB 3V6DB 3TWHA 3T41A 2FF6A 2D7SA 4AQYK 3KDOA 1RAHB 1TELA 2D3O1 1KNZA 1ATSA 1FESA 4XIUA 2P9EA 2YWEA 5EWEA 4J5OA 1JLEB 2A1SA 4DQSA 1NB2A 2F8EX 3QZ8A 3US5A 3C16A 1RBVA 4NLOA 3CJCA 4JI0J 4P74A 4ZP6A 3RAQA 3ID6A 2BANA 1ZAXA 1S1XA 2V4RA 1RP5A 2C3UA 3I87A 3CPWR 5DQGA 3AXKA 2DHHA 1TUYA 4LF9F 1HPMA 4CECA 4J7CA 2Z1IA 2HBZB 2YWHA 2UP1A 2VFUA 1APSA 5ETRA 2OFHX 1KC8T 1F6TA 1NLKL 2CPJA 1KQFB 4JI4K 4JHDB 4W4MA 2BJ8A 4DEZA 2DIUA 3PX0A 1OH5A 1BY9A 4C8OA 1JB0C 3PX6A 3AVCA 2EWHA 4ZLPA 2O66A 3VHQA 1HWIA 3S9HA 3GOIA 2UXCJ 4DWIA 4DV2J 5HO4A 4RUAA 1IBLK 3V9WA 4N7TA 4CJTA 3CYMA 3DRXA 5AE3A 3C6AA 4DPOA 1B9FA 2DD8S 3KG0A 3ASMA 4F2SA 2R8HA 4KKOA 4YFUA 5KFMA 4OLPA 3LO3A 2CQGA 1N36J 4NLRA 3IRXB 2P9GA 2FVRA 3CJAA 4RW7A 4KHRA 2HWTA 4RNHA 1BCOA 1HLWA 3GL1A 4P7TA 1JLFA 1T11A 2NRHA 1KSPA 5C7PA 5M1PA 4CEEA 2E9RX 3SEOA 4NLPA 4ZVGA 4QWEA 2BR0A 4K2XA 1LOTB 5KPTA 2ITGA 1U7LA 2FLPA 4RBTA 4B3RJ 3CDAA 3I5BA 1GMWA 3VAFA 1DTQA 4USMA 1VGYA 4OL8A 5BXIA 3TABA 2G8IA 5AQLA 2HZCA 3ZEUB 4NCBA 1NKEA 4CESA 5SWMA 2P8IA 4CJRA 2A2DA 1PAUB 2UVVA 1QVFM 4Q44A 3HL8A 1U1LA 3GR1A 4YDDB 4AE5A 5C2DA 1OYDA 1QD1A 3DOKA 1F60B 3KWGA 3PO5A 2XMKA 4ID5B 5L39A 4IWVA 4DV2K 2XLIA 3BV8A 2B6AA 2P9PA 2Z58B 4WQ4A 4L74A 4H5NA 4PL7A 3VQTA 3TPQA 2NXJA 4G65A 3I56S 3EE3A 3QEPA 3C6UA 2OH2A 4M95A 5JS1A 2BW7A 1RAGB 1U1NA 4USIA 1NRKA 3QSYB 4JKFA 4JI7J 3CJ2A 4LJMA 5JMNA 3ZCMA 1TKXA 3SMSA 3TP2A 1DZ5A 5L9XA 3PNIA 3C14B 3MUVP 5AQOA 1HKAA 3M05A 4Q2MA 3TQEA 2FXUA 4ED0A 3MDQA 1RWMB 3HVTB 1E6YB 3OVSA 2DR6A 4X84A 1SVDA 5G0RB 3QNNA 3SQ0A 1GX5A 1HWLA 3K5OA 2FJWA 3UKRA 4Q45A 2HZVA 4PWUA 2VG5B 4WFAQ 1I6JA 3A3NB 1XNRF 4WXOA 1W2BM 4OYOA 3S8SA 4DV0K 3D45A 3PFEA 5T14A 2GJFA 1O8BA 1WLJA 2RHKA 2HURA 3LTOA 2JOQA 1MDUB 1XMOF 3RB0A 3MR2A 1VRQC 2IM0A 3U27A 3NMAA 4DPWA 4X4TA 3AO4A 2POKA 4MKBA 3KHHA 3NLCA 4GVLA 1YHQN 2HRUA 3H59A 4KBOA 3SJHA 3PUFA 1ACMB 3G6EN 4MLHA 3QAEA 4A57A 3VQ8A 4RG8A 2KN4A 5KTQA 1PIEA 2HRTA 1ILYA 5AQZA 4QYRA 5IS2A 1NMNA 3ENQA 1KLMA 1QSSA 4KGKA 3VQAA 1VQSA 2BJ9A 3RW7A 2KT3A 1IH7A 5J1EB 4KJIA 3AVFA 1SIZA 5CZXA 3UI3A 3VPZA 2VG7A 2DNPA 1XWLA 3MM9B 4QW8A 1CJUA 1IJFB 3ZSQA 1VSMA 1KQKA 5AQTA 2YCHA 4FM0A 2CNKB 4OV6A 4LF7J 4LSNB 2IOCA 4EBEA 1DARA 4WZQA 3GSIA 3KDNA 1FDNA 3T3FA 1EJ7L 4O4GA 3LDLA 4YOTA 2VG6A 2E6LA 5HOOA 4A8SA 3MM8B 3GG0A 5KFYA 3O4WA 4P73A 4J9SA 4K8ZA 2HFUA 3H08A 3QMLA 2ALYB 4EO6A 4NOHA 5KFQA 1S0MA 1RTIA 4QR0A 2L08A 2NLWA 2NUBA 4XH5A 4KH1B 2MLYA 3OTOJ 2RU3A 1H6KX 5H9FK 3Q83A 4JI1F 1SC6A 4U96A 1P90A 3ZSVA 2QWNA 2VWBA 4DR4K 2CPEA 4OZ0A 2B8QA 4X66K 5JLFA 3T1AA 3CXCR 4UQTA 4LF4F 4B9QA 2BE2A 1LWFA 1O13A 1HI8A 2Z30B 3MAAB 3OY9A 2RDIA 1S6QB 1VOMA 3FBEA 1RBTA 1BU6O 4FPAA 3AD9C 3VZIA 3BN7A 3LWLA 2AZ1A 2HFZA 2RUSA 2QJ3A 2DR5A 2AF6A 4TU8A 3FZBA 4Z4FA 3DM2B 3MXHP 1O0PA 4L3KA 3CMAN 1RDUA 1VQ4N 1CQMA 5IT9O 4JI3J 4N8OA 4UUXA 1HPZA 5C24A 1ZBHA 2BW2A 2DH7A 2KVIA 2ROPA 5HI7A 3GONA 5D77A 4BC7A 2OZMA 3IS9A 3UPFA 1C0UA 3TAMB 4TU7A 5KFFA 3CC4S 3HSGA 2NRVA 2WK4A 4LFAF 3O8MA 2BQUA 4PUOB 1AB8A 4DV6F 2HIYA 1C1BA 4WFNQ 3DNCA 2UUBF 4FWLA 1P6TA 3ZX0A 1WC4A 2O4GA 1C4CA 3G71S 3JQMA 2Q3SA 3TZXA 2RU9A 2IAJB 3NGSA 2K7KA 2KM8C 4OYAA 3O6WA 2VZ9A 4LRBA 1S1VB 2VCPA 4FJXA 3W62A 2GQQA 3E01B 2HZAA 1FKPA 2VQEJ 3VGSA 2Y8YA 3KUHA 1EX8A 3OA9A 2ZOMA 2HHQA 2C3OA 1VHIA 3CULA 4Q8FA 3D6RA 2KRRA 2QMUB 3RUBL 1NNEA 5KPZA 4LUBA 1E6VA 2H1YA 4B9TA 2XCAA 4H0TB 2OKQA 4CLZA 1XTZA 1LAVA 3ZO7A 3BR9A 1N34J 3J80U 4RWWA 5FROA 4DFMA 1Q8IA 3CQXA 1OY8A 3AHPA 5J2PA 4NMLA 4JI6F 3CCZA 4A8WA 1RADB 3VEXA 2OA8A 4IEEA 4I7FA 3THWB 1FVQA 4DTXA 1JXEA 2W41A 3OXGA 1V4SA 4KH4A 1DJ0A 3SJJA 5A76A 4JV5J 3FQKA 4DV1F 2HS3A 2E4LA 1SKSA 3LDQA 4EI2A 1RCXB 2KM8B 1RWXB 3SIPB 1OVQA 1RA6A 4ECSA 3I32A 4K59A 4NXNJ 1TL1A 4H4MA 2VWJA 1DQ8A 2ZGZA 3POTB 1JCGA 4XTTA 2M8HA 1WI8A 3BDPA 1H7XA 1U2VB 4FF2A 2F4VF 1S22A 2XHCA 1ATRA 4CJ4A 3U9DA 2VC0A 3BQ2A 1KVBA 2QKKA 1YWXA 4C11A 1LOUA 4OMFG 4ZJQA 2J0XA 2K8GA 2LYVA 1RT7B 4AHUA 3D2WA 1IKWB 5A8KA 3DXKB 1Z05A 2FBVA 3CD6S 4ZDNA 2P9CA 4K4ZA 1JLCB 3PO4A 2CH5A 1FXDA 5GINA 2V94A 2FSJA 3CJ5A 1RJJA 3KLEA 3N6NA 4AUKA 3CC7S 1NXIA 1ZS6A 2HHHF 2FY1A 5D0GA 4HCBA 3W2VB 5E2QA 3IDHA 3TARA 2XS7A 1FA0A 3HFKA 4FJ5A 2NQPA 3HX9A 4CD1A 1K0VA 5IFMA 4FJMA 2MQOA 2RSQA 3M6WA 2H9ZA 4WWSA 1C2PA 3W8PA 2ALZA 3UVJA 3PACA 2RJZA 1KBRA 1TL3B 2WB4A 4WE1A 1I51B 1U4BA 3QIOA 2LVWA 4CO2A 1EARA 1Q9XA 4DN0A 4TY8B 3SI8A 3E51A 3FZHA 4NXNK 3Q8UA 2ZH8A 1S6UA 1H2TZ 5GMEA 5KFCA 3GG4A 2G8UA 1D9FA 4M1KA 1HYZA 4K4TA 2JJ4D 2D3OR 5A2QY 3ID8A 3DOLB 3J81O 3OYAA 4PPZA 1OVYA 1N32J 1TZ0A 2JFDA 1N33J 2RQCA 2MSSA 1L3TA 2VBXA 2LEPA 1DQ9A 1SQKA 5CE3A 2D41A 2HK3A 1TV6A 3SSQA 4OYBA 1LW2A 8RUCA 3RAMA 3O5TB 3VAGA 3T7ZA 3WBZA 2DR8A 4WKYA 5HMWA 1T7PA 4IOBA 4JBCA 4MO5A 2PMZD 1VSEA 4DX6A 4CF2A 4CWBA 4F8RA 4DCHA 1S6PA 1VK8A 4DFPA 2E5LK 3GIIA 2KG1A 3NF9A 2YQ3A 3BS9A 4X2BA 3BBFA 2GTDA 1GEHA 3VGUA 2F4FA 4ER8A 2QA4N 2XULA 3HHEA 3HK2A 2P9KB 1Q81T 2OSQA 2HIQA 1KHVA 5IOLA 3MWTA 5KQ8A 3N6MA 3D6TB 3FEZA 1FKOB 3I55N 1J5EK 1N5YB 1WEYA 4TKTA 4DV4F 1QQMA 3SCLE 4BVOA 1FW6A 4MK9A 4FXVA 1ROFA 3P6YC 1F3FA 2BV3A 1PO6A 5H1SV 4PKGA 2BJ7A 5JVHQ 4DN9A 2G0JA 2JC1A 3ALYA 3CCQS 1EQYA 1HBUA 2H5EA 1YRUA 1NGIA 1N32K 2I0XA 4FXWA 1NU4A 3J7AP 3MMVA 4UW2A 2N3OA 1X8DA 3PX4A 3LALA 2ZHOA 5AXNA 1T3OA 2NPIA 3THXA 3V6DA 4C8ZA 4KYZA 4H4KC 1IG8A 3QFHA 1ATNA 1DRZA 2R8KA 4X4UA 2BMBA 4Y1DA 4QS9A 1IQZA 1WC6A 2KI2A 2NRTA 1JLEA 5T41A 2A5XA 5C42B 3QYYA 1S4FA 4Y34A 3D1OA 4IO9Q 3TAEA 5KFWA 2XNRA 5AQNA 2RE2A 4LF5J 4P2FA 1W26A 2GO8A 4RX6A 3M3ZA 4R0JA 3C15B 3WDOA 3SBMA 1IBMF 1HNZJ 2XMWA 2WVCA 2ILYA 1HLUA 4CZJA 4LFBF 1WKLA 3M8SA 5DQHA 4JHDA 5FPDA 3DLEA 1ZPWX 1RTDB 4BACA 2VD3A 4YY3F 3A5MC 5IC6B 3J7Z5 4CHOA 3VN5A 4Y2KA 2HGMA 1R31A 3DWLA 3G96A 4H0XB 1UEUA 3CGIA 3UDVA 2OEMA 1U2RA 1NK9A 3CF5Q 4DR1J 3QETA 2VA2A 4USKA 4WPAA 2HSTA 3DGVA 4RCHA 4B8CA 4ZPCA 1BG3A 4BS2A 4CT9A 4BRHA 2YHAA 3FKBA 4M5DB 2HNYB 1P1TA 3IRXA 4KHNA 1LXJA 1VI7A 4MT1A 3O9RA 3KNGA 2ZGYA 4YOWA 2BGGA 3NDKA 4A8OA 3THYB 4BR2A 5A0YB 4EIAA 2WTUA 5F9NA 1ZOTA 4HI2A 1G15A 2J7KA 5EGYA 2V4JB 3W9IA 4DSIA 4DV3F 1RTJB 1DQAA 3A1YG 3CO0P 2YX1A 2CJXB 4MKVA 4P52A 3ZEUA 2HBJA 4M5JA 4IOAQ 4M3RA 3L7UA 4ALZA 5JVGQ 3OXLA 3OXFA 5KG0A 2RQ4A 2E1PA 1SS6A 1AFIA 3T1YJ 5AXMA 3KLIB 3PR4A 3JSYA 3QMQA 1J54A 2AGQA 2HMIA 4CJWA 4OGCA 3NVKA 1DAXA 5CQGA 3H3OB 4WQ5A 4ID5A 1HWKA 1RWWB 3LDOA 3TAPA 3HOTA 3HOSA 3BGLA 1YBUA 5GAEP 1QZ5A 1FWKA 4ZN3A 4NLXA 2XO7A 1M5KC 3MMBB 1QVFR 2JFKA 3S7RA 1RISA 3DLGB 4CE9A 4JKAA 1T94A 5EVZA 3IAYA 1DEJA 2QLJB 4XPEA 1V3ZA 3Q22A 2PYJA 3NH0A 1RWOB 4Z2XA 5KOXA 2GFFA 1FO1A 2FF3B 3ZT1A 4M63C 3SV3A 2KU7A 3UW1A 3CB4A 1ZAWA 3GFYA 1MG7A 2FJDB 4JKBA 1T8EA 3FK4A 3V2UC 1F21A 2VICA 4CO4A 3EGWB 3SDEB 3A8YA 3LH2S 3C14A 3C7NB 3CQYA 2VQFF 4PG8A 4HLBA 3E9PA 1RQ0A 5ETMA 1SC1B 4KTZA 2OAUA 3N6LA 4M7XA 3HVTA 1E6YA 1FFWB 4DX8H 3JXOA 3ZZYA 3OSPA 2FHJD 1NZAA 4IH7A 5G0RA 1JXBA 3DLLQ 1FDAA 5ADXA 4F50A 2W42A 2QFJA 2LFVA 4F3MA 2WVBA 2YNFB 2HW3A 1RWPB 4L76A 5GMKa 1B0VA 2X74A 1VQMN 2NPFA 4FF3A 3QRRA 2LQJA 2EPIA 3PKYA 3PYFA 1RDBA 3PY8A 2DRDA 2P5VA 2KH9A 3HSCA 3NY0A 3BQ1A 1SC4B 4CLTA 3QRQA 2PAVA 4GV3A 1VQ7S 2GUPA 3L2VA 2R2SA 3KVGA 1OY9A 1KRPA 2UVUA 3QT8A 4OZ3A 2DITA 1W2BR 1HWJA 4O55A 2FBYA 5L8RC 3TOQA 2KZMA 2QGFB 3NOCA 4F36A 4WK3A 2HMPA 3ZSXA 2HKEA 2N3LA 3PHEA 2Y9HA 4IEIA 3QEXA 1ZC6A 1WHVA 2IM3A 7AT1B 4GV9A 1KTQA 1BGXT 2A3ZA 2MQQA 2GJ2A 1CQNA 4RWXA 3SK3A 1F2GA 1NPKA 5D4PA 7FD1A 3MR5A 3C8YA 4HHHA 4DR2K 1WD6A 3K5LA 3H4BA 5J1EA 2B56A 1Q53A 4G1IA 1Q86O 1Y10A 1J53A 4OYZA 3MM9A 2A42A 3AH6A 3PCOB 4F4AA 2FY8A 4ZCIA 2F8SA 2HQGA 3Q8YA 1LEOA 2DY4A 4X62K 3SUNA 4LSNA 9RUBA 2C3YA 5EX3A 1HNXK 1NJIO 2QYCA 3CJBA 1UW9A 1NDLA 1FCAA 4E1JA 2G13A 2AGPA 4GY2B 3MM8A 1YGYA 1G6BA 2MKSA 1FTCA 4LBPA 1VSIA 3IBCB 2JL9A 2LQBA 3GU0A 1FD8A 3NF8A 4QS8A 2VGNA 2DH8A 3P4UB 3AA8A 3CC2S 1VBXA 5F0WA 3PW0A 2I38A 3OYCA 5HQLA 2LEBA 1TMMA 2KT5A 1AROP 4B1UB 1HBOB 2Z1HA 1D8YA 4YOXA 2VOOA 3QNWB 1YJ7A 3MAAA 4NYOA 1QY7A 3UR3C 1S6QA 4ZHRB 5AQFA 5H9EJ 3IR6B 4I6MB 3HHDA 3BO3A 3LL3A 2F5GA 2A6AA 4LF9J 2GV9A 2QO3A 1VQ5S 4K4YA 2CQ4A 4FJ9A 1FJGK 3GFXA 3LGNA 3QEIA 3DM2A 5J2QB 1Q78A 3T5HA 3MXIA 4WJBA 2A40A 2P2CB 2FIUA 3FNNA 2KHCA 5DLGA 3NF7A 4A8FA 4MLEA 1WBDA 1ZZNA 3T19A 1WF0A 4K5RA 4LH4A 2IVOA 5AQIA 4BGAA 4B3MJ 1NNDA 4KV8B 3ILLA 3TAMA 1FNMA 3BM7A 1YI2N 2OMLA 3AVLA 5ETVA 3JQKA 4DUYF 2QWLA 2HVEA 4PUOA 3S1TA 3BEGB 1ZA1B 3BYPA 4GC6A 3DC2A 1FFSB 2QTWA 4OHXA 2C2EA 5M1OA 1Y5IB 3AB4B 4BE0A 2FGCA 3Q7BA 1A9NB 4ATNA 2R3VA 4AXIA 2IAJA 4HUFA 1F9EB 2MDAA 2VKZG 4RNNA 1EQ0A 4O3NA 2A10A 4FNHA 1S1VA 3EEQA 4CEAA 2OHDA 2OTLN 1R8AA 4M3ZA 2B5JA 2I7NA 2J9EA 3E01A 1CVJA 4I6WA 1FEHA 4C0BA 2E5IA 4C6AA 5IT4A 4KC5A 3EE9A 1Q7YO 2DEIA 5I4MA 3AJDA 4QR2A 4HVJA 1RDWX 2RRBA 4LMZA 2PD1A 1MW7A 2GX9A 3EZWA 3R8YA 5J2MB 2M0GB 4FW1A 4ILLA 2HB5A 3PVXA 5KFPA 4ZA1A 1RHMB 3ZFVA 2AIRB 1TP7A 4CM2A 1B99A 2CPHA 3MOZA 4NI2B 1YJRA 5K14B 3OS1A 1UAXA 2IVMA 5BRDA 2G8WA 4B3MK 3THWA 4CCHA 2RQKA 3TSQA 5T7LB 1Q4RA 3M8RA 4RW6B 1JJHA