3IRXA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with the non-nucleoside rt inhibitor (e)-s-methyl 5-(1-(3,7-dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of HIV-1 reverse transcriptase (RT) in complex with the alkenyldiarylmethane (ADAM) Non-nucleoside RT Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
total genus 129
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3irxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3irxA05
4H54A 1HARA 5J2PA 1W25A 4FJLA 4O55A 2HHTA 2WRMA 3NGDA 3CJ5A 3ZT2A 4ZP9A 1RBTA 4Y1DA 2W7PA 4J9PA 1S1UB 1XR6A 3BQ2A 3I0SA 1RBUA 1LWEB 1BI4B 1EX4A 3QEWA 3OYIA 5F8MA 2RF2A 2HVIA 5KFRA 5L1KA 3AA3A 3CWJA 4R8UB 4IOBA 1TK8A 3DMJA 2W8KA 3HK2A 4ECSA 5EDWA 3PR4A 5DK5A 1NK4A 4B3OB 5F8JA 4FJ9A 1NKBA 2C2DA 4CJRA 1NK5A 3OYNA 4EO6A 3AO1A 5CYQB 2WHOA 4B9VA 1A5XA 2Z1IA 1U45A 3AVAA 4CHQA 3NF6A 4WXWA 4CCHA 2DPIA 4ZTFA 1BQMB 3M9MB 4F4YA 5CZ2A 4LSNA 4DTXA 3NKYA 4XPEA 4PQUA 4FJ8A 4IFYA 4M3XA 5KFDA 4B08A 4CGGA 1ZYQA 3AA5X 1TV6A 4ZMMA 3BR9A 3V9ZA 1LWCB 4RW9A 3BSOA 4DSKA 5KG0A 2B43A 2HNDA 3JYTA 3M8PA 4CJ5A 3PVXA 2HHQA 3CDWA 4KO0A 4KE5A 3RB3A 3QO9B 4YMEA 4Z4EA 3OS2A 3NE6A 4DTOA 1IKVA 3M8QA 3DYAA 4NLRA 2IOCA 2G8HA 4ECVA 2FVSA 3FQKA 2YNFB 4ED1A 1JXLA 4DU1A 2OPPA 3V81A 1KLNA 3C95A 1WLJA 3O3GA 2GV9A 3DRRB 4FZXC 2YKMB 1A5WA 1QHTA 2UVUA 3AO2A 4G3IA 4DG1B 4B9SA 5C25A 3Q8RB 4IFVA 1HYSB 3BSAA 2B5JB 3Q8PB 4F4ZA 3ITHB 1HMVA 2P5OA 5J1EA 3IS9B 2HMIB 1RYSA 3TAMB 4ZPDA 1SL0A 4IG3B 1RT5B 5HP1A 4Y1CA 3MXJA 1RTIA 3L2RA 4E0DA 1JLGA 3ISNC 1NK9A 4FJMA 2Z1JA 4C8NA 4M42A 2OPSB 4ECXA 4KV8B 4HYKA 4E7KA 1RT7A 3QNOA 1J5OA 4KTWA 1FK9A 4URQU 3UR0A 4CJTA 3GV7B 1DTTA 1S9EB 1NOZA 3AA4A 5JXSA 5KG4A 4LH5A 3QGIA 1YT3A 2W9CA 3VA0A 5DGBA 3NF8A 3PW2A 4B8CA 1KHWA 1RA6A 3K5NA 4XO0A 3MTKA 4ED0A 1WSHA 3CYMA 4NLDA 4CEZA 4N47A 1UA1A 3NL0A 5J2QB 3VQAA 3G10A 3ZSXA 4C8OA 2ATQA 1KLMA 3Q8SB 2AX1A 4Y34A 1JLAA 4QWBA 2D0BA 4CIGA 3LP1A 1KVCA 3ZT3A 1WSEA 1NJXA 1SV5A 4E3SA 4NLVA 3CVKA 4ECQA 2BQUA 3MXMA 1TL3A 1EP4A 2FBYA 1CXUA 5F9LA 3IN5A 4CJQA 4M45A 4ZHRB 1RT2B 5HRRA 4CFAA 5KFWA 2KZZA 2XGPA 2HWIA 2E9RX 4Q0BA 2FLPA 4EYHB 4CJEA 4E1MA 4NRTA 4N76A 1HNVA 5C24B 4KRFA 3PV8A 4IQXA 3LPTA 1I39A 3RB0A 2IGIA 3HSTB 4E1NA 2WONA 1HQEB 1W9HA 3VQEA 1TKTB 4R0EA 1HQUA 2IJNA 2BQRA 5KFIA 2JEIA 5KFJA 4PWDA 2JC1A 3KLGB 3G6VA 1RTDB 3GQCA 4OLAA 3MEDB 2Q3SA 4G1QA 3EY1A 5KFVA 4ELUA 4MKBA 2HVHA 1LW0A 2P1JA 1EXQA 4I2PB 3BQ1A 1ZBFA 3K5OA 4HKQA 2FBXA 1K1SA 2IAJB 1NNDA 1JLEB 3DM2B 4TLRA 4M3YA 3TAFA 4DL7A 4CJWA 3KLFB 4URSA 3SFGA 5EWFA 3KLHA 3O4QA 1S6PB 4EO8A 3SYZA 3BGRA 4ICLA 5KG1A 2J6TA 2RN2A 1CZ9A 2XC9A 2D0AA 4KTZA 3MECA 1CZBA 3OYCA 2EC0A 3K58A 4NCGA 3F9KA 5CY4A 4ED2A 3S3NA 4FK0A 3LP0A 4JV1A 3AVJA 1KVAA 2JC0A 4BACA 3DLEA 1ASVA 3QEVA 2VG5A 4YFUA 3KHHA 4LSLB 3MEEB 2JEJA 2ZD1B 3N6MA 4TN2A 4KTQA 3NAIA 4K8ZA 3LPUA 4IDKB 4U7CA 2KW4A 4O44B 2KFNA 3LZJA 3VQ7A 1BISA 4M3UA 2RKIB 4CF9A 3T3FA 5K14A 5KGWA 4R5PA 3HO1A 1DTQA 2O4IA 2W9AA 4ZTJA 3VQ6A 4BE1A 3LDSA 4NLSA 3CM6A 1RA7A 4GC6A 2ITGA 3GIKA 4WE1A 4MK8A 5KRSA 2OA8A 3I0RB 4FLWA 1X9SA 4JS4A 3TR8A 2PYLA 5DQHA 4RW7A 3LP2A 5KFCA 4CEBA 2FJXA 2IJFA 1SKSA 2C2EA 3SQ1A 4H8KA 4FVMA 4OGCA 3GYNA 1FKPA 1GX5A 4E19A 3DI6B 1JLFA 4WZQA 4TY8A 4ED6A 2WTFA 2I5JB 1IKYB 4Q43A 1NJYA 4ZVEA 1MMLA 3KIOA 2XI2A 3LZIA 3SUOA 4FJ5A 4BWMA 4AHVA 1HPZA 4Y2AA 1J9AA 3HVTB 4QWDA 4K4VA 5F8NA 4EBCA 4CJPA 4O3QA 2JEFA 4DS5A 4FJGA 4CK3A 2IMWP 1XI1A 3RRHA 4HUGA 1C2PA 3SI6A 2IC3B 4FLUA 4LH4A 5C42B 3AV9A 1ITGA 4J9OA 1S5JA 2AU0A 5KRTA 2IM0A 1C0UA 4IKFA 1C1BB 4CJFA 4FM1A 1B92A 4KSEB 2YNIB 3IRXA 1GOBA 5DG9A 2FVPA 5EWGA 1ZBIA 5DG8A 3OL7A 2C28A 1S97A 4KBIA 5SZTA 1SL1A 3RMDA 1REVB 4JLHA 4PUOB 5KG3A 4F50A 2HNZB 4FW1A 2G8UA 4J9RA 3KK2B 4B9TA 4DWIA 1D5AA 1QE1B 3MF5A 4FK2A 2D7SA 3ASMA 1S6QB 4DTNA 3KLIB 1BQNA 4K4XA 1A5VA 4KFBB 3CFRA 3CM5A 2YKNB 3E01B 3C6TB 4ECWA 1I6JA 3OL8A 4H4OB 5FDLA 3SZ2A 4DU4A 4FZYA 4FM2A 3AVGA 4ECYA 3QNNA 3GIMA 3FSIA 3U3YA 4NYFA 4NLPA 1TK5A 1SL2A 4F2SA 3RMAA 1XHZA 4DSLA 3M9NB 3KHLA 3QIPA 3KLEA 4KHYA 3EYZA 2IA6A 3EPGA 1KFDA 3OYGA 4DTJA 1UAXA 1RT4B 3HVAA 4JUZA 5KFTA 1LW2B 3RBEA 3SI8A 5KTQA 3IG1B 4DTUA 1L3UA 4CGJA 4I2QB 4XPCA 1TVRB 3LANA 2ZKUA 3RR8A 4B9LA 1JKHB 3AVHA 3ZT4A 2OPQA 3VQ5A 5D3GA 2D3UA 2VWKA 1JLBB 3ZSRA 4KI4A 4YNQA 1S10A 2WOMB 4CIEA 3ULDA 4MIAA 5EWEA 1VSEA 1UWBA 3H5SA 2C2RA 4CIFA 4FJ7A 3OLBA 3OYMA 1RT6A 1TK0A 1TQLA 4AHRA 2XHBA 3NDKA 4DFMA 2HW3A 3MEGB 2HHXA 3P1GA 3NBPA 1N5YA 4FLZA 4LD0A 5J2PB 3HL8A 3I5AA 4ED3A 4IH7A 1NJZA 4TXSA 4NLWA 1TGOA 2W42A 3FDSA 3I0SB 3H5UA 3SPYA 4RNHA 2VG6A 4JS5A 1BCOA 2HHWA 1MU2A 3G86A 2RF2B 2R2RA 2AX0A 1VSMA 3VQ9A 3BQ0A 3GIJA 4OLBA 3DMJB 1WAFA 1LWFA 2B6AA 2V4RA 3TABA 1TKDA 3OLAA 5F8GA 3OYHA 1WSFA 4F8RA 3HJFA 4DL6A 5KG6A 2QK9A 2ASJA 4TY9A 4YR0A 1Z26A 4KHUA 4Q5VA 3JSMA 5DG7A 3TAGA 4GMJB 1IKXA 4QW8A 3H5XA 3NCIA 1RT3A 3QZ7A 4HCBA 1S0OA 4ID5A 2JEGA 5FRNA 1JXEA 2HB5A 3CJ2A 1N56A 1J54A 4DF4A 4ED7A 4F3OA 4LSNB 2QE5A 1D9FA 4PQUB 4DFPA 3V6HA 1DLOB 4IFYB 3HVWA 4YP3A 1KTQA 1ZBHA 4Z4CA 3KK1A 4M95A 3HVRA 3OHAA 1TV6B 4BE2A 3K57A 5F9NA 2X6SA 1S1WA 3IGNA 1RDDA 2HHSA 3TQ1A 1I3AA 4RW9B 1U48A 4KAZA 3N6LA 2HNDB 3JYTB 1C6VA 4QAGA 2KFZA 2IBKA 1S9FA 4KO0B 2BE2A 3HP6A 3L2QA 2VG7B 1ZBLA 4PA1A 5KFBA 2W8LA 3RB4A 1BIZA 4Y3CA 3IAYA 3K2PA 1LAWA 3HP9A 4FLVA 4DL5A 2OZMA 1IKVB 4NLTA 3KJVA 3OYKA 3M8QB 3DYAB 3CJ0A 4DFKA 4DTRA 4CECA 4K4WA 4CEFA 2FVQA 4RW4A 3V81B 1QAIA 5DMRA 1SUQA 1KHVA 3BSCA 5HRPA 3NGYA 4IH5A 3UDLA 1T94A 3SCXA 2ZE2A 2CJQA 1Q9XA 5C25B 3NH1A 4C8KA 2V9WA 3NH2A 1JXBA 4IFVB 1S4FA 4ZPBA 1IKWA 4PY5A 1HMVB 3CDUA 4CEOA 5J1EB 2W9BA 3I8DA 2BQ3A 4J2BA 3A2FA 4CF2A 1T8EA 3PHEA 3TARA 3LALA 2ASLA 1WAJA 1RTIB 1HNIA 1JLGB 3QIOA 1U09A 5DLFA 4CGDA 4KHWA 4QW9A 2B4JA 4Q8EA 1TAQA 1RCHA 3V4IA 3QZ8A 3QGGA 3MR2A 3D45A 3PW4A 4Z4FA 4OPKA 1RT7B 4CEDA 1J5OB 2FBVA 4FZZA 1FK9B 4CJ3A 2EHGA 4HUEA 1DTTB 1L3SA 4AH9A 3TAMA 3L8BA 3QIDA 3NF9A 3DLBA 3OS1A 3QLHA 1YTAA 2W9CB 1D0EA 1HJRA 1XC9A 3OYAA 1GOCA 4O5BA 3RMCA 5KFKA 3TI0A 2XY7A 2V0NA 2XCAA 2UVWA 1TKZA 2FC0A 4ZVHA 3CQ8A 5I3UA 1KLMB 2BANA 1QS4A 1RBRA 1JLAB 1S1XB 2R8JA 3LP1B 2YNHA 3HT3A 3HPOA 1SV5B 1VSDA 3V9UA 4W5TA 2R2TA 1TL3B 1EP4B 2AJQA 1XR5A 4FCYA 2C22A 4AHTA 4E7LA 3O3FA 4C8MA 3CDEA 4Q0BB 4FXDA 4CJ4A 3ZT0A 5L1IA 1UOCA 4HTUA 1HNVB 3DRPA 3P5JA 4CEQA 3OYEA 2Z1GA 1K1QA 3H4BA 1ZTWA 2X78A 1TL1A 5KFNA 3ZT1A 1SKRA 1S0MA 5J2NA 3RWUA 2FBTA 2WONB 4MKAA 5KFLA 2IM2A 3S9HA 4Z0UA 5KT4A 1U04A 4QWEA 1VK0A 3KD1E 1C0TA 4PWDB 4NLOA 2R7YA 4BDPA 4ID1A 3OSNA 4DTPA 1BL3A 4F4KA 4G1QB 1QSSA 4NLUA 3OYDA 4Q8FA 1LW0B 3MR6A 1K6YA 4CK2A 5KFSA 4ZP8A 1HQEA 4FJKA 4FJXA 1T05A 3AVLA 3MR5A 5T14A 3OS0A 4NLXA 1RTDA 3KLHB 5J2MB 4RW8A 1SKWA 1IM4A 1Q9YA 4OGEA 4MQ3A 1SH0A 3BGRB 1WNEA 4EZ6A 4I2PA 4ICLB 2XY5A 1T03A 2HWHA 4OKKA 3RAQA 4Q45A 1JLEA 1RDRA 3MECB 5KT5A 3DM2A 1TKXA 3CJ4A 5EU7A 3VQQA 4FS2A 3PW7A 4DS4A 4NCGB 1JLCA 2UVVA 4M41A 3SUPA 3OHBA 3GV8B 3DRSA 1BIUA 1HYZA 3H08A 3KMQA 1WN7A 3LP0B 3H40A 4J9QA 4RNNA 3DLEB 1R0AA 4ZP7A 4B8AB 2VG5B 2OPRB 3LWMA 5FRMA 4IBNA 3M8SA 4GVMA 1ZETA 3MFHA 3V9WA 2R8KA 4CEEA 1BGXT 3B6PA 2OZSA 3M9OB 4KAIA 3D28A 4W5QA 3SFUA 4FW2A 1C1CB 5K14B 1G15A 4R5PB 4WYLA 1SH2A 3QGHA 4EYIB 2PY5A 4MFBA 5KFYA 1DTQB 4NRUA 1EETA 3EZ5A 4KKOA 3LP3A 1X9MA 3QINA 1JLQA 1NK8A 1D8YA 3AO3A 3PX6A 4DTMA 1L3TA 3GILA 3LAKA 4WE1B 4K4SA 4W5NA 2QKBA 3U6FA 3V9XA 4RW7B 3LP2B 5C5JA 3BDPA 1O1WA 3WNEA 3TANA 3KLVA 2VA3A 4CF8A 4W5RA 3Q8QB 4DQRA 4KHNA 3CG7A 5DGAA 4I7FA 2BRLA 5KGXA 2YHBA 4RW6A 4CGIA 1FKPB 2KTQA 1JLFB 3KD5E 4TY8B 3V6DA 4J9MA 2R2UA 2YV0X 4MIBA 4O3RA 2E6MA 3L3VA 2UUWA 4KHQA 3SUNA 4W5OA 1HPZB 2R8HA 4IRDA 3NFAA 4DMNA 3QERA 4KHSA 2HNYB 3UPFA 3DOLA 3I5BA 1NK7A 4IKAA 1WNSA 5KT6A 4TYAA 1S1VA 4CEAA 3C94A 3DOKA 3VQSA 3PW5A 4X2BA 1C0UB 2XWYA 2XY6A 1KRPA 4RNMA 1NHVA 1QTMA 1VRTA 1RNHA 3AVCA 1RTJA 4B9UA 2D41A 4DQPA 4GC7A 4ZPAA 3IRXB 4GW6A 1VRUA 3DLGA 2D0CA 3D5MA 4CFCA 3NGIA 3T5HA 4FK4A 2DFFA 1RT1A 3DLKA 3DLRA 4O3SA 3ICLA 1GOAA 2IM1A 4DQSA 2OH2A 5KFMA 1NKEA 4ECTA 3MFIA 4F2RA 4IH6A 2YNIA 4FLTA 5CYMA 1HYVA 3NMAA 1T7PA 5FDLB 4KB7A 2R8IA 3KOAA 3ZCMA 1X9WA 1YVUA 5HROA 4FLYA 4PUOA 1B9DA 1B9FA 3CO9A 3MR3A 2DTUA 1N6QA 4MH8A 2LSNA 3QIPB 3KLIA 1VSIA 4CHOA 4E89A 1JL1A 3B6OA 1S9GA 5I42A 4DSEA 3HYFA 1RDCA 3K5LA 3C6TA 4H4OA 5KFOA 4CJSA 4ECRA 1Q8IA 4QPXA 3CIZA 2ASDA 4ZVGA 4IRCA 4J2EA 3L3UA 2FVCA 3NHGA 1S1TA 2UVRA 3SPZA 3PO4A 2YNGA 1IG9A 2XI3A 4JV0A 3S3OA 2RDIA 3C6UA 3FFIA 2AQ4A 4IRKA 2O4GA 2OPQB 1X1PA 4KI6A 5D3GB 2IDOA 1VSLA 4NCAA 3SQ0A 2HHUA 3RR7A 2XCPA 4KB1A 4O4GB 2YHAA 3K5MA 4TQRA 4ZP6A 1IO2A 1UWBB 3NGZA 3N6NA 2XY8A 3OYBA 4H4MA 1RT6B 2O5DA 2VA2A 4CK1A 3QEPA 2WK4A 3V9SA 4N41A 1XWLA 4IG0A 4O4RA 3PY8A 3PZPA 3KK3A 4O3OA 3O3HA 3NBPB 1N5YB 1KFSA 1LAVA 3PUFA 4K8XA 3NAEA 4DQIA 4FM0A 1NJWA 3OJUA 5HLFA 3AVFA 4M94A 4TQSA 3HHKA 3KHGA 5HBMA 1FKOA 2OYQA 4YR2A 3K59A 2VG6B 3P83D 3S3MA 4OVLA 5KT3A 1MU2B 3DDKA 2JGUA 1RTHA 3KKSA 3VQDA 1LWFB 2B6AB 4CFDA 2Z1HA 3VQ8A 2I1RA 1U47A 1CXQA 4ELTA 2AGQA 1S1UA 3PJWA 5EUHA 1LWEA 3JSMB 3O4NA 1BI4A 5FROA 3OYFA 4EZ9A 1IKXB 1RT3B 2E9ZA 4R8UA 4ID5B 3OVNA 4CJUA 3VQPA 1JX4A 3F73A 1QAJA 1N48A 4URGA 4LQ3A 4B3OA 1D1UA 3WNGA 3H59A 3D0PA 4KHRA 2BDPA 3AVNA 2ILZA 4CHZA 5KG2A 2FJVA 3KK1B 4MK9A 5CYQA 2GBZA 1SH3A 3FQLA 2IM3A 2BRKA 2D3ZA 1S1WB 4NLYA 1U4BA 3G6XA 4MK7A 4WFZA 1KSPA 4RUCA 4RU9A 2V4QA 4FBTA 4FYDA 1BQMA 3QEXA 3M8PB 1DLOA 4J9SA 3L2VA 4OPJA 2BE2B 4DL2A 3PJXA 5CZ1A 3LAMA 4DSJA 2IS3A 3TAPA 4KHMA 3KJVB 2BGGA 4B9NA 4EP4A 4E7JA 1LWCA 4J2DA 3V6JA 4RW4B 2RPIA 4HHTA 4K4ZA 4DFJA 2OPPB 3H5YA 3AO5A 1SUQB 5JS1A 3PO5A 2VG7A 2GIRA 2ZE2B 4KREA 3QO9A 4WYWA 3V6KA 3PX4A 3MXIA 3T5KA 4CF1A 3V1OA 5KFGA 1IKWB 4CHPA 2GC8A 4WFYA 3M8RA 2Y1IA 2W9BB 3OSPA 2E6LA 3SQ4A 2YNFA 4DL3A 1D9DA 1BCMA 4CF0A 1NOYA 4OKEA 4OL8A 3VN5A 5HP1B 4Y2CA 4JRPA 3DRRA 1CLQA 1ASUA 1HNIB 4DTSA 3L2UA 3NH0A 2YKMA 4KB0A 4CE9A 4DG1A 3V4IB 4Z4HA 3NAHA 4CGFA 1HYSA 2BR0A 2B5JA 3ITHA 4M3RA 4O0IA 4DL4A 5L1JA 3EZUA 3IS9A 2HMIA 2GIQA 4UQGA 3QLHB 5KFFA 4J9NA 4IG3A 2JLEA 1RT5A 2R8GA 2G8IA 5L1LA 3GIIA 4F3TA 5L9XA 5DQIA 2OPSA 4QOZB 1NKCA 4KV8A 4DLGA 4U6PA 3KKRA 3ZSOA 4EP5A 1TKZB 2FVRA 4E7IA 4CESA 1N4LA 1S9EA 2XO7A 4TYBA 5I3UB 2BANB 4M3TA 4FS1A 3V1QA 4JRQA 4CGHA 2PYJA 5KFZA 2YNHB 3WNHA 1RILA 4DF8A 1WSIA 2VWJA 3ZSVA 2QV6A 3MAQA 4NYZA 4N5SA 3THVA 1C1AA 1NHUA 5J2QA 4M3WA 2RDJA 2D5RA 2EX3A 3DRPB 3HPGA 1L3VA 3AVBA 4C8LA 1RBVA 2HAIA 2QXFA 1S1XA 1XR7A 4QWCA 5F8IA 3AVKA 4F4XA 3T5JA 2P5GA 1TL1B 3I5CA 3ZSZA 1YVFA 5J2NB 1L5UA 3PW0A 2DFHA 2CKWA 2F8TA 1F21A 3RAXA 2DPJA 3CJ3A 1J53A 4ZHRA 1RT2A 4TSXA 4DEZA 4EBDA 2J6SA 3SV4A 1HQUB 1C0TB 4O0JA 1WSGA 4NLQA 5C24A 3H4DA 4WZMA 2WCXA 2WB4A 1HRHA 4DQQA 1VSJA 3AA2A 1ZTTA 2G8KA 2AGOA 3T5LA 4Z4GA 2F96A 3VQ4A 1T05B 2FLLA 3GV5B 1TKTA 3KTQA 3AVIA 4FJNA 4CHYA 5DLGA 3VQCA 2AGPA 3KLGA 3QEIA 4RW8B 4AHSA 3MEDA 4HUFA 1XHXA 3KHRA 1VSKA 1T03B 2G8WA 2ETJA 3ALYA 2IAJA 2HHVA 3HM9A 5KG5A 1TKXB 1S49A 4NLGA 3G6YA 3OYLA 3SUQA 3KLFA 2GUIA 1JLCB 1TP7A 5J2MA 3IGVA 3DRSB 2F8EX 1NK6A 2FJWA 4JV2A 1S6PA 2P51A 2Y1JA 3OL9A 1KVBA 1LV5A 4EBEA 1R0AB 4BDYA 1CSJA 1VSFA 3ZSWA 3TAEA 3CFOA 4BWJA 1Y97A 2J6UA 4FJHA 4RNFA 4IR1A 1RBSA 3RMBA 3TAQA 4K4TA 2DY4A 3QETA 5E41A 2FLNA 3SJJA 1IH7A 4J2AA 2ILYA 4BE0A 2XRIA 4O3NA 4MFBB 2OPRA 5HRSA 4M3ZA 4RUAA 1EETB 4LSLA 3KMSA 4CJLA 4KKOB 2ALZA 3MEEA 2ZD1A 1JLQB 4IDKA 2ATLA 1RYRA 4LY7A 1UA0A 5KT2A 4O44A 2G8FA 2RKIA 3BSNA 1C1CA 3L2WA 3ZSQA 2KZMA 2E9TA 3FRZA 3SNNA 1QUVA 4FBUA 3QESA 4J9LA 4OKJA 4DU3A 4DSIA 4CFBA 4I7FB 4RW6B 3BREA 4I9LA 3TWHA 4CERA 3T1AA 4EEYA 5KFUA 4Q44A 2R2SA 3I0RA 1OS5A 1VSHA 1ASWA 2NUBA 3V6DB 2E4LA 4RNOA 5KFPA 1BHLA 5JUMA 4CJKA 3CFPA 3PR5B 4O3PA 1S0NA 1QQCA 5HRNA 3DOLB 4DLEA 2QKKA 2PZSA 4OJRA 3KNAA 4AHCA 3DI6A 3OL6A 1S1VB 2I5JA 1IKYA 3DOKB 5DQGA 2UUTA 3TVKA 5SWMA 3OY9A 3HVTA 1WSJA 3UQSA 2HNYA 1VRTB 4WFXA 3HPHA 1JL2A 1RTJB 5KFQA 4YQWA 4ED8A 4NCBA 1VRUB 3DLGB 2IC3A 4QWAA 3RRGA 3G0ZA 1TAUA 5C42A 1RT1B 3DLKB 1YTUA 4F4WA 1C1BA 4ECZA 2F8SA 4ZVFA 1BQNB 3RB6A 5KFXA 1ZBUA 1W0HA 4B9MA 4HCCA 5JS2A 4YR3A 5CYMB 4Z4IA 1EKEA 2A1RA 3PX0A 1KCFA 5HROB 4FJIA 4WXOA 1REVA 3HXMA 2HNZA 3EPIA 3SQ2A 3KK2A 5F8LA 5KFEA 1N6QB 5KT7A 3AO4A 1QE1A 3LWLA 1S6QA 1QSLA 3OJSA 3KLEB 3WNFA 1S9GB 5I42B 4AHUA 4E7HA 3BJYA 4K4YA 4KFBA 4LQ9A 2W7OA 2YKNA 3E01A 1RAJA 1RDBA 3RBDA 4N56A 4L8RB 3VQBA 4RG8A 4HVJA 5KG7A 2X6NA 4IR9A 2ZQBA 5KI6A 3NF7A 1S1TB 5KFHA 3V1RA 2YNGB 3C6UB 3FFIB 3U3GA 4CJVA 3VA3A 1RDAA 5KFAA 5F8HA 3ZSYA 4RZRA 3T19A 1RT4A 1T3NA 4NYNA 1QSYA 1S48A 1GX6A 3HKWA 1NK0A 1LW2A 2A1SA 5T7BA 4K4UA 1JIHA 4ECUA 3IG1A 4I2QA 1TVRA 4KPYA 4H4MB 1C0MA 4K50A 2KQ2A 4CHNA 4XIUA 1JKHA 4IG0B 4BDZA 3KK3B 2AWZA 1JLBA 3H98A 3RTVA 3OYJA 4FJJA 4J9KA 4NZ0A 4AILC 2WOMA 4O4GA 3DLHA 4DSFA 5HLFB 3AVMA 1FXXA 4ELVA 5HBMB 1FKOB 1Z4UA 3H2LA 4ZPCA 3E51A 2X74A 3ISND 2G8VA 3SV3A 2XGQA 4FLXA 3UIQA 1Z25A 4QCLA 3MEGA 2DFEA 4I9QA 1RTHB 1U49A 3QYYA
chains in the Genus database with same CATH superfamily
1W25A 4FJLA 3LGNA 3N4WA 2WRMA 5ELZA 3ZT2A 2W7PA 2UXBJ 3KDNA 2ZITA 3UVJA 4JI7K 3I0SA 1QY7A 1LWEB 1OPIA 1NUEA 4M63C 4LF4J 3AOCA 1XNRF 5F8MA 2HQFA 3H0PA 4XH5A 4R8UB 4IOBA 2JOQA 1R43A 2E5LF 3HK2A 4B1XB 2FHJD 5AQMA 1NK4A 2HF3A 3DKDA 1WOOA 3DXBA 3OFHA 2LKZA 1NK5A 3QSIA 3Q7BA 3AJDA 1OO0B 5CYQB 2BEFA 2NRWA 4B9VA 4C8YA 2NUHA 4OMFG 4PR6A 3HSJA 3K9KA 2CJBA 4NMXA 3OW2M 3NF6A 1BOTO 4YORA 2CPYA 4ZTFA 3M9MB 1DGKN 4LSNA 2BZ2A 2I38A 3NKYA 3VGTA 4IFYA 1WB9A 3NY0A 2FZCB 4ZCLA 3M7VA 4RLEA 3RSEB 4MT1A 3MWPA 4PKGA 4B3SK 3THPA 1LWCB 2H9ZA 4LBPA 4EMDA 1N34F 3JYTA 3IWLA 2UUBF 3RB3A 4YMEA 2D9OA 3S1TA 2PFFB 2UYTA 2MSSA 1V3RA 3NE6A 3FZMA 4ES3A 2VKZG 5ADXA 2G8HA 1X31C 3HHLC 2RVJA 4R0JA 1JXLA 1PO6A 1KLNA 2WUSA 3C95A 4I6WA 3QT6A 2GV9A 2CDQA 5GIOA 1RDWX 1ROFA 2KU7A 1QHTA 1MSWD 3AO2A 3O6QA 1FNXH 1F2GA 1OH6A 1H7XA 1WG4A 3BSAA 4FWNA 3ELHA 5AQQA 2E7WA 4ZPDA 5HP1A 3MXJA 2NYIA 3EXCX 3QWPA 3L2RA 1PJ6A 3JTOA 1NK9A 2ASOA 2Z1JA 3OUYB 1KD1T 2OPSB 2CPDA 4LBIA 1WF2A 4WQ5A 1TMJA 4HYKA 4BVPA 2OCEA 4KTWA 1FK9A 1NMEB 3OFFA 5IOLA 3GV7B 3H20A 1DTTA 4KGVB 4ISEA 2OEMA 1R0BG 2QA4N 3AA4A 4U9RA 5JXSA 2QXLA 5A6PA 3PW2A 1KHWA 5CCMA 3AXMA 2V2QA 2YX1A 4HVZA 1WSHA 3SCLE 1RHRB 1VQPN 4M5IA 4CYUA 3CJSA 4NLDA 4CEZA 1UA1A 3NL0A 1B3TA 3G10A 2XMMA 4C8OA 3I56S 5GVQA 4WTOB 3MEKA 3NCRA 2N7CA 1AZSB 3KYLA 4CTAB 1WC4A 1X0PA 5A8RB 2A0FB 3MCMA 4NLVA 3I87A 4ECQA 3A5LC 3MR7A 3MXMA 3KFWX 4LREA 1YRUA 1CXUA 5KOWA 4DV6J 4AE5A 5HRRA 3CQXA 2KZZA 2XGPA 4LFBF 2E9RX 3I31A 3QJLA 2V67A 4N76A 1HNVA 3PV8A 3W3DA 4ILHA 3LPTA 2JHEA 4MYTA 3FR0A 4FKXA 3THXB 1RDUA 3D2EA 3EDRB 2IGIA 4E1NA 2WONA 5LSOA 3VQEA 3ZNJ1 3NGKA 1HQUA 2BQRA 1AFIA 5AE1A 2IDEA 4BS2A 1Q82T 4G1QA 1RK8A 2WVEA 4AUKA 4MKBA 2EK1A 2CA9A 4I2PB 4A47A 1B0TA 4DKWA 4PEOA 3P96A 3V5RA 2F4VK 4Y0FA 4DPWA 4X4VA 2FBXA 2CGJA 2PI5A 3VF4A 3TAFA 4WTYA 4DL7A 4CJWA 1AW0A 1Z2ZA 3ULEA 3KLHA 1VQNN 4QS9A 4LRAA 5EX0A 1S6PB 3DN9A 4EO8A 3SYZA 2JDJA 2MYFA 2MZJA 2RN2A 1W2BR 3D2FA 1VQ8N 4PG6A 1CZBA 1NGAA 3T41A 2P9EA 4OX7A 2KN4A 3HRGA 4NCGA 1LWXA 5CY4A 2QL9B 2UV8G 2MZTA 1W2IA 4PXEA 3EZOA 4KH1B 4BC2A 3LP0A 1JK9B 3T6JA 2VG5A 4YDUC 4YFUA 1RQ0A 1PSDA 4X66F 4LSLB 3O80A 2ZH8A 2ZD1B 2HZVA 3FEXB 4K8ZA 1LQ9A 3P8BB 4JI3J 2VFVA 3VQ7A 4BROA 4J5OA 3G8SA 2RKIB 1VQMS 1Y5IB 2HF4A 1TU0B 4DU8A 4R5PA 1YGYA 2FGOA 1M5VC 2L9DA 1FESA 1DTQA 4OYBA 2UUAK 2KM8B 2CYYA 1YZ6A 3VQ6A 2J7WA 5AQRA 2XSJB 3LDSA 1RKIA 4B3RK 1SIWB 4ZK7M 4DR1J 2OA8A 1X9SA 1EJ7L 3D6MB 2ZBCA 4RW7A 3LP2A 1HLUA 2DRDA 2OIHA 5A8KB 4CEBA 1TR0A 1PYSB 3US5A 2AJ2A 2IJFA 1SKSA 3QFUA 2CQ1A 2FJDB 1VRQC 3NXZA 4FVMA 2CPHA 1F6TA 2I8EA 1NGIA 4E19A 3DI6B 4TY8A 3LM2A 3GBTA 1N32J 3VZHA 4ZVEA 4MKYA 1RE1B 3K5PA 2V8GA 1HD0A 1HPZA 1H0HB 2ROGA 3C0BA 1RISA 1JJHA 2JEFA 4GKKK 4FJGA 4CK3A 3C65A 4DV4K 1XI1A 2WB1D 4HUGA 2EFOA 4GKJF 1Q78A 3VAHA 1HI1A 4LH4A 5C42B 4V19S 4J9OA 2BUPA 1KNZA 2AU0A 2HHPA 2IM0A 4KT0C 1C0UA 4IKFA 1C1BB 3Q7CA 4CJFA 1YIJN 4I56A 3TPQA 4F26A 4DR7K 1CULB 1GOBA 2NQPA 2DHSA 5DG8A 1S97A 4KBIA 5SZTA 4JLHA 4PUOB 2G8UA 2HNZB 4FW1A 4JNEA 3UDCA 4QIFA 1NSKL 3NRBA 3R5AA 4BCAA 2CADA 2RHKA 4DWIA 1Q7YO 4KH0B 1S6QB 4JN4A 5MAOA 1A5VA 4WCEQ 3GG1A 1PAUB 5CYJA 2DR8A 2M3DA 4KFBB 3E01B 3BUZB 2YKAA 4M7XA 1NSQA 3SCKE 3GIMA 3QNNA 1U6ZA 2MQLA 2KO1A 4NLPA 1U1KA 1TK5A 1SL2A 4F2SA 1N0UA 3KHLA 3K0SA 2M8HA 3QIPA 1X4DA 4KHYA 4JHDA 3CJTA 3QAEA 4C11A 4R25A 1PBUA 1KFDA 4DTJA 3KWGA 1UPMB 2E1MC 5JVGL 2GHPA 4MKVA 4JUZA 4B3TJ 3NGRA 1RHMB 2Q6BA 5CABA 2XMAA 1CJUB 4DTUA 3M6VA 4ZIVA 1L3UA 4CGJA 2ZKUA 3IR6B 3RR8A 4B9LA 4WF9Q 3ETOA 3E8OA 4USVA 2RRBA 3SMZA 3ZX0A 3WC0A 4KI4A 1MN9A 1XK8A 4OV6A 3GR1A 2OD6A 3FZFA 2E29A 4KHPF 2BJ9A 4ZJLA 1W26A 1VSEA 3IMQJ 4CM2A 1ZM4A 1Q53A 1TK0A 1K8KA 3L7UA 4I68A 3NBPA 1N5YA 3O8WA 5AXKA 3HL8A 3I5AA 3VAKA 3FEYB 2BW2A 2F40A 4ZVUB 1NJZA 4C3KA 1TGOA 2N7YA 2VFUA 3AB4B 3UVJB 1UMJA 2RE1A 3I0SB 3UDEA 2I6WA 2ACMA 2VG6A 3PTWA 2DR5A 2W25A 4CLUA 3GB0A 2HHWA 1MU2A 4DN0A 1MN7A 4X64J 1WAFA 1LWFA 1HWKA 3A5MC 4JI4J 4USJC 1IWGA 5GINA 1TKDA 3OYHA 3KVGA 2HBZB 4YR0A 1Z26A 3CJBA 3L95X 5EVZA 2EC2A 4KHUA 4Q5VA 4LUBA 1ACMB 5DG7A 4W98A 3CD5A 4QW8A 3NCIA 4NWBA 4HCBA 4ID5A 2VBZA 5FRNA 5F0XA 2H1YA 4RX6A 2HB5A 1RWNB 2DGSA 3CJ2A 4LF2A 5HMYA 4LSNB 2LXIA 4DFPA 4IFYB 3CDAA 2B9XA 3BKTA 4DR3J 4IJAA 1J5EJ 5C12A 4BE2A 5LXYA 2ZVSA 2KJWA 1ESVA 4BBYA 3IGNA 4I1TA 4KAZA 2NLXA 3JYTB 5F0UA 4QAGA 4V1Ak 2DR6A 5HAOA 3HP6A 2VG7B 1ZBLA 1I94J 3MCSA 3IAYA 3K2PA 4A8SA 1LAWA 1TUUA 1D8ZA 4NLTA 4FKYA 4K4WA 5ETTA 4YY3J 1QAIA 4KY3A 3MCPA 2CJQA 1PCAA 2V9WA 1BD6A 5ETLA 4ZPBA 1IKWA 5AQKA 4DDFA 2FXUA 2GHWA 1TUWA 2EKYA 3I8DA 1Q8KA 1QLNA 5JMVA 4OIXA 2DNYA 3TWZA 1YUWA 4YHHK 3CF5Q 4CBUA 4RWWA 4CGDA 4KHWA 5IT9O 2GJFA 1IBLJ 3KHYA 1BMQB 5DM6Q 4DR2J 2HSEB 3OQ2A 1ATSA 2FBVA 1FK9B 2AJ0A 2MDAA 4WFBL 2N4CA 4HUEA 3DFEA 1DTTB 4BQZA 3TAMA 1YHQN 3ZTRA 2UUCK 2OJ3A 1FD8A 4JI8K 1ZAWA 3RBXA 4BRKA 4O5BA 3NOCA 2RQKA 1NB2A 2XCAA 2IIHA 1UW9A 2CJAA 4CYUB 2UVWA 4LF1A 2CJ9A 2A6AA 1S6UA 1HKBA 4P75A 4ZVHA 3CQ8A 5I3UA 3SAFA 2BANA 1UKUA 1ZXOA 1RI7A 3OXGA 4MDAA 1N88A 2RB7A 3HT3A 2YNHA 2ZJPL 2GELA 1VSDA 3UO0A 5GMKa 2MQQA 1TFWA 5M1NA 2LDYA 4CZEA 2LQ8A 1XR5A 4FCYA 1FWLA 3NLCA 4JI0F 1GMUA 5DDQC 3O3FA 2O3DA 3A12A 1I51B 4LF8F 2IVFB 4FXDA 5D0HA 4PHTX 1UOCA 2XHWA 1HNVB 3M30A 3J81j 3OYEA 3IWXA 1K1QA 3TTFA 5KFNA 1SKRA 3I32A 2W6LA 3D2EB 2WONB 3DU6A 5KT4A 1U04A 2GVDA 5DS7A 2VICA 2MB0B 4BDPA 4G1QB 2KT3A 1QSSA 3OYDA 4FNHA 4TU9A 1K6YA 4OLPA 4FJKA 4FJXA 3W2WA 5JLFA 9RUBA 1Q79A 3IWNC 5BN9A 2HWTA 3AVLA 4EFHA 3ATUA 4AL6A 4CLPA 1Q1KA 2QA4G 4DR4J 3ULEB 3KLHB 5SUHA 1WG5A 3O1BA 4JKEA 3PACA 1BE4A 4MQ3A 2VQEF 1LXNA 3AAPA 1KQSM 1Q8LA 1RWWB 4CLWA 1SIZA 2GJ2A 4JKDA 4LC9B 4JI1J 4JYAJ 3D2FB 1JLEA 1RDRA 3DM2A 3CJ4A 1DRZA 3GOIA 3VALA 3MPVA 4NCGB 3DRSA 4M5MA 2HQ3A 5LMNJ 3N4PA 4CLSA 2J0QD 1B0PA 2K3KA 3LP0B 4I64A 3H40A 1FTCA 4XH4A 3R1XA 2MKSA 1XC3A 3H1QA 2VG5B 1IJEB 2A2CA 3LWMA 5FRMA 4IBNA 1ZETA 3D7EO 1ZAVA 5CAAA 3NWRA 3HSZA 2IMOA 1W7AA 4GV6A 4M1KA 1GTEA 3TP2A 4K5RA 2M70A 4CQ1A 4FW2A 1C1CB 3EEQA 4R5PB 4EYIB 1S79A 2PY5A 3KK7A 2BX6A 1DTQB 4NRUA 4IEIA 4DCOB 1H6KX 4OZ1A 4DN9A 1NDPA 2DGXA 1YJ9N 5E2QA 3O9UA 3MUTP 4CZKA 3DCAA 4FPAA 2NPFA 4W5NA 2BW7A 4JD2B 4RW7B 3LP2B 1XN9A 3BDPA 3WNEA 2RIJA 3AT1B 3SQOP 1S59A 3NS7B 2MQPA 4W5RA 2RU9A 3Q8QB 4RUBA 1GLCG 3O9QA 3CG7A 4BRLA 3P5TL 1S77D 3SMSA 3MZIA 4ZVQB 4DUYF 4HTJA 2RD5C 1FERA 1P1LA 2QRRA 4TY8B 1IWAA 3M5RA 2CQ0A 4C9DA 4DXLA 1NJIT 2IYGA 1HPZB 1Y3JA 2PO4A 2E88A 1OWXA 3NS5A 3G6EN 4A4JA 2QZ8A 1XMQF 3ID6A 1EQMA 3I5BA 3IM9A 2R3VA 1ATNA 5KT6A 2APOA 3NGUA 1S1VA 2CQBA 2KB2A 3PW5A 1SJFA 2YI1A 1C0UB 4DR3K 4U7UD 1KRPA 2W2OP 4RNMA 1NHVA 1IBKF 2F7VA 4B9UA 1SZ2A 3HZ6A 1VRUA 3D5MA 1WJ9A 1OVYA 4FK4A 1JQGA 3T1HF 1K0VA 3DLKA 3DLRA 3MHYA 3Q24A 4O3SA 4ZLLA 3W65A 2E1PA 2P2CB 2C3MA 4DQSA 1APSA 1CEZA 1M1GA 2Q1NA 2XEXA 3CCQS 4ECTA 4DPOA 2F9WA 2YNIA 1F60B 2C42A 5CYMA 4DV7K 4LF5J 3VOVA 1T7PA 4NA2A 4KB7A 3NOGA 1X9WA 1YVUA 3U7JA 2QIFA 4NZ7A 3MR3A 1WC6A 2IVMA 4NLCA 2Z2ZA 4G9ZA 1N6QA 2YKOA 3R6GB 4BREA 3CERA 3QIPB 1RU1A 2HBJA 1N36K 3PEJA 4JHDB 4C11B 1S9GA 4ZVTB 4DSEA 3C6TA 4OZ2A 4H4OA 1KONA 5H9EK 4QIVA 4BRFA 5B09A 3BV8A 1JCFA 3X1LB 4PXDA 3WQTA 4ZVGA 4IRCA 3FVYA 2UVRA 3SPZA 3Q8YA 1MROA 1NB7A 3EN9A 3FFIA 1MW7A 2O4GA 1KAYA 3EKUA 1WWHA 3SQGA 2HHUA 5EXWA 3CCZA 3G71N 1OVQA 4ZP6A 1FTRA 3NGZA 4ILRA 1OIAA 3N6NA 4B1YB 4H4MA 1EZZB 2UXCK 3QEPA 4HEA9 4N41A 2NUUG 3AOAA 1XWLA 3H1VX 4I6YA 3O3HA 4CWBA 5AJ3F 3NBPB 1N5YB 2GO8A 3PUFA 4K8XA 1YJWS 2ZBPA 3CXCM 4DQIA 3CPWM 1NJWA 4OI2A 1QAXA 3LO3A 1SJQA 4IO8A 3KHGA 5HBMA 2OYQA 2ZUGA 1LFWA 3JQKA 3AAQA 3BGLA 1GXUA 3K59A 2VG6B 4CO4A 3S3MA 5KT3A 1MU2B 1AA1B 4C6AA 3DDKA 4A8YA 1M5PC 3KKSA 2RUGA 1LWFB 4CFDA 1YVNA 2Z58B 1VLYA 3VQ8A 1U47A 5E26A 2OANA 1HL6A 5F3TA 3EO3A 1SJRA 5EUHA 1D3WA 4LF7J 2DGWA 1BI4A 3OYFA 2VGNA 2JFDA 1R31A 3A4TA 2IDLA 3ZO7A 4ID5B 3ZYYX 3OVNA 3OTDA 5BR8F 4H4KC 3IBCB 1N48A 5FPMA 5HN0A 3JAMO 1IBCB 3AVNA 1IVZA 1HHTP 4YDUA 4ZVSB 1XMOJ 4CLKA 1S0VA 2AP6A 3R7BB 3TZXA 1NGJA 2QYCA 1HR0J 3A8IA 4QS8A 2QMWA 4LVOP 3FQLA 2UXDJ 4DUZK 3SSRA 2G0JA 4MK7A 4WFZA 1KSPA 3FRYA 3T69A 4FYDA 2CVIA 1BQMA 3WXKA 3O1WA 1DQ9A 2DNHA 2ADBA 1QZ6A 4JI5J 4DSJA 3CDBA 2CVEA 3VEYA 1QDUB 3PSIA 4E7JA 1DHMA 2VKRA 5L38A 4J2DA 4RU2A 3TU5A 3CCJS 1KQKA 4K4ZA 3AO5A 3ZTPA 3PO5A 2GIRA 4WYWA 2MQOA 3PX4A 3I55N 3MXIA 3UI3A 1VJWA 2N3OA 2Q66A 2YWHA 3V1OA 5KFGA 1IKWB 3S7RA 4FOEA 4WFYA 2DNLA 5BYQA 2BVZA 1KVKA 3HOTA 2XMJA 2P9IA 3AHPA 3F41A 1WHYA 3RUBL 4OKEA 4OL8A 3DRRA 1CLQA 2YJFA 4KB0A 2PAVA 2W1BA 4CE9A 4DG1A 3O4WA 4Z4HA 4LFBK 3U1NA 3NAHA 2ZEJA 2DGQA 3ITHA 1M0SA 1RUSA 3QBWA 2DH9A 3T1YJ 1KKHA 4UQGA 5D6GA 2G8IA 2GWKA 3H90A 2NCKL 1OY9A 4F3TA 3OV7A 4B3MF 4QOZB 4DLGA 3KKRA 4EP5A 1IR1A 3M6GA 4WF9L 2E5IA 4CESA 2JJ4D 2C3PA 4TYBA 4UY85 5I3UB 2BANB 4C48A 2PE8A 3V1QA 2D0OA 2PYJA 4ZS6A 3R7SB 5KFZA 2YNHB 1RILA 2VWJA 3ZSVA 2QV6A 3M2RA 4A5BA 2QWQA 1D4XA 2WBNA 4KJIA 1NAQA 3M30B 3C46A 1HFEL 4WWSA 1RBVA 2HAIA 5CCLA 1S1XA 1VQ6S 4QWCA 3HMJG 3FC9A 1U2FA 1V3SA 1RKJA 3ZSZA 1YVFA 3PW0A 2DFHA 4JK9A 4OYAA 2F8TA 1F21A 2NNWA 3R5BA 4YOXA 4ZHRA 2J6SA 3OR2A 4NLQA 2ZDOA 2WB4A 1HRHA 1VSJA 4X66K 2LXUA 4Z4GA 3W2WB 3VQ4A 1U1LA 3NMUA 2RHSB 3X3UA 2HBMA 2PMHA 3GV5B 1SAZA 3E9PA 3THYA 3AVIA 4JK8A 2ZH2A 2LA6A 2AGPA 3D1QA 1N54B 4HUFA 2ATCB 3EUNA 3B4MA 1T6DA 2K1RA 1KS2A 1VQSA 3P6YC 4K25A 2IAJA 2HHVA 1T95A 5JJBA 3OYLA 1FO1A 4OO1J 5L39A 2VBXA 3DRSB 2HHHJ 4QZVB 1IM6A 2DHGA 2FJAB 3R5GA 4JV2A 2P51A 1NNEA 1Z05A 4EBEA 1UJ5A 3QB0A 1LK5A 4BDYA 1CSJA 4BWJA 2J6UA 2KT5A 3QMLA 3HLUA 3TAQA 5MLCQ 4K4TA 1SC6A 2EK6A 2PDAA 1D09B 5CR4A 4B1UB 4IOCQ 2LVWA 2MJNA 4J2AA 3R3LA 1EQYA 1UW4A 2VYPA 4O3NA 3SXLA 4NLBA 2OPRA 4DZDA 3H2VE 1M5OC 1RAEB 4M3ZA 1RBLA 2W2QP 2JWKA 3N28A 2XLJA 2ALZA 4BG8A 4CP5A 3BDEA 2ATLA 5KT2A 4O44A 1Q5VA 2G8FA 4DV3J 4KQZA 2J9EA 1SC3B 4ISGA 1Q81O 5I4MA 1HI0P 1S6OA 2DB1A 1NPKA 1WF1A 3FRZA 1UETA 5HANA 3SNNA 3QATA 1X4EA 3AD8C 3GFZA 4DU3A 3CF5L 4BR9A 4GO7X 1KAZA 1U1NA 2BM1A 3I0RA 2V50A 1ASWA 1UFLA 1HNZJ 2E4LA 2MQNA 1ITPA 1BHLA 2QFIA 3HDSA 5JUMA 1N33F 1OYDA 4O3PA 2V2VA 1SJ4P 5KAKA 4ZVOB 2UV8A 3D6HB 4OJRA 2ZH9A 2DCUB 4OHYA 1TUVA 1QAYA 1S1VB 3HD2A 2I5JA 2BV3A 3H25A 4YB7A 3HX9A 3TVKA 3QJJA 4NXMJ 3HVTA 1DT9A 2ZM6F 3OW2R 3AFGA 5KFQA 3CUNA 1VRUB 1V6HA 1U7LA 3AD7C 4FYYB 5B0BA 1TAUA 3DLKB 1YTUA 1U1MA 8AT1B 2C3YA 3ENOA 5KPTA 2QMUB 3F44A 2ROPA 4ECZA 3WHIA 2BE9B 3RB6A 1FHTA 4B9MA 5CYMB 3A5OC 3DDIA 2FDNA 3R6LB 4KHPK 4WXOA 1REVA 3ENHA 2JLFA 3EPIA 2D3O1 1YKWA 2A5XA 2AEFA 1N6QB 3AO4A 4UF4A 1IQTA 3TVZA 3OJSA 3KLEB 1S9GB 4E7HA 4AHUA 3BJYA 2W7OA 4C7QA 2YKNA 4YOWA 1RDBA 2Y3YA 1YRXA 3GTYX 3EGZA 3UE5A 3C66A 2GVZB 1SPBP 5KFHA 3V1RA 1MROB 5E0OA 3FFIB 3ETMA 5KFAA 1JXVA 3ZSYA 5CZVA 3W8PA 5FLXU 3SQGB 4RBTA 3GJRB 3T19A 3CCMS 1QSYA 1EWQA 5IWAJ 4I4BA 1LW2A 1E6YA 2Y8YA 2I9SA 1S57A 3VVTA 4ECUA 1NSAA 3DC2A 4KPYA 4H4MB 1C0MA 4LFAF 1C4CA 1MWKA 3ZZRA 1X3MA 2IFXA 1U2CA 4OQJA 3OYJA 4CLLA 4NZ0A 4J9KA 3SCJE 3TA2A 3O2IA 2WOMA 2GMHA 1YI2S 5HBMB 1UEUA 2OO4A 3FMBA 2E1RA 3H2LA 1OSDA 2B9YA 1KVJA 1FVSA 4JI6J 3GU0A 2G8VA 3JSBA 2XGQA 1FJGJ 3E1YA 4H0VB 4FLXA 1VQON 3MEGA 2A3JA 2BACA 1IV0A 4H54A 5J2PA 4DR5F 5K9FA 2V7YA 2E8AA 3CJ5A 2HVEA 4PWUA 3ILJA 3G4SN 1T9VA 2XULA 3BQ2A 4QYZK 2H51B 4Z2XA 1R6YA 1BI4B 3QEWA 4GV3A 2QLJB 2RF2A 2HVIA 5KFRA 3AA3A 2GZOA 3DMJA 3MUMP 4TU8A 3O3LA 2W6KA 1XBWA 4HI2A 2CWKA 2O66A 2C2DA 3OYNA 4ANDA 3O6WA 3JSRA 1A5XA 4JP8A 4CH1A 3I33A 2Z1IA 1U1QA 5HJYA 3AVAA 5FLXO 2DPIA 1YJNS 4PWWA 4NXNF 1BQMB 4USWA 2KM8C 3TUZC 4DTXA 4XPEA 2YPYA 3W61A 3LDQA 5E3QA 1GLBG 5KQ8A 2H3GX 1TV6A 4WKRA 4ZMMA 1HW8A 1X60A 2DKOB 2Q6CA 5G0RA 5BPLA 2B4OA 5GADU 4DSKA 4M5NA 3M8PA 1RWXB 3MMCA 3ZXWA 4CJ5A 4WK1A 2R7RA 2GWJA 3RYLA 4Y28C 4KO0A 5AQHA 4OYXA 4KE5A 1R6VA 2KH9A 4Z4EA 1G7CB 2DH8A 3S01A 5FLXY 1HHSA 5LT5A 2DVIA 3MX2A 1HNWJ 4NLRA 3Q0AA 4OJGA 2EKNA 5C15A 4BRGA 2P9IB 4DU1A 3D3CJ 3K0JA 4DI6A 1WLJA 1A0OB 3DRRB 3OT9A 5AQJA 1A5WA 2R7VA 1BWVA 4DG1B 4JI0K 3Q8RB 1VLOA 3FZ2A 4LF8K 2KKHA 3MN7A 4DV3K 3Q8PB 4F4ZA 2Z0GA 4Q2MA 2RRNA 3ITHB 1XNRJ 5AQWA 1RHUB 1EHWA 1GFWB 4YB1P 4UOGA 4A62A 2YWEA 1OKJA 2E5LJ 1SL0A 3VAMA 4Y1CA 2G1DA 1RTIA 5DDRC 5E5NA 4FJMA 2E2OA 1U1RA 4XH1A 4C8NA 4M42A 1OH7A 2I7PA 1D9AA 2D4WA 4BR7A 4CJTA 4JKGA 1GXLA 2YQ3A 3I4PA 3CIPA 2OSRA 3A3PB 5C10A 3QGIA 5J1NA 5LMUF 3J80U 1YT3A 2IRUA 2W9CA 4BY9C 3VA0A 5DGBA 2MMYA 1S99A 2FHKA 3M2RB 2KYZA 2Q1LA 1HPMA 4MLHA 2O67A 2UU9K 3CC4S 3VQAA 4UZCA 3ZSXA 2ATQA 2W7AA 2ZH6A 1KLMA 3Q8SB 1HX1A 2FQQB 3CJRA 1CJKA 2ZHOA 1N34J 1RJJA 2D0BA 3LP1A 3PIOQ 2UUBJ 1FWPA 1SV5A 5D4NA 3IKMA 4E3SA 4F7VA 4WFNQ 2BQUA 2DNMA 1ZOTA 1TL3A 1EP4A 5GMEA 4K5SA 5F9LA 2PT0A 2DGVA 3IN5A 4CJQA 4ZHRB 4CFAA 2VF3A 1WBBA 5KFWA 2J0XA 2HWIA 4Q0BA 3OR2B 4MIWA 4CJEA 4A8WA 4AYBD 2QSWA 4CZLA 3R27A 3N5FA 3TQEA 5ETSA 3TZZA 3QBCA 4JB8B 2CH6A 1UEKA 1F5CA 3QRQA 3NNHA 2I7NA 3THYB 2IJNA 1F5AA 2JEIA 1ZA1B 4ED5A 3AA9A 3VEOA 1RTDB 1VJQA 3GQCA 1VQYA 3W66A 3AAWB 2K1RB 2P1JA 3WXIA 3AOBA 3MPWA 4ED4A 1ZBFA 3K5OA 2MKIA 4HKQA 3D1OA 1VC6A 2IAJB 3V2UC 3KUGA 5CXTA 4LR8A 1AROP 3FZKA 1Y9OA 3UWTA 3P5BP 2K06A 1U25A 5LJ3Y 4RKUC 5B0GA 2BXJA 2XNRA 3BGRA 4EGLA 4A8QA 5KG1A 2J6TA 5C0YA 1VQLS 2CZ4A 3QFHA 4OPAA 3BO4A 4ETXA 3SBTA 4DUYK 3OYCA 3TZWA 1ATRA 4JI2K 3UN5A 3K58A 2FYXA 1RAFB 4PKDB 3QRRA 3F0NA 2VQFF 4B9QA 4BRAA 1XNQK 5C2FA 4JV1A 4QR1A 1KVAA 3ENWA 1SCJB 4BACA 3BF1A 3ZETA 4PG5A 1ASVA 3KHHA 2W01A 1WHVA 2Q2RA 3H42A 4KTQA 5AFUA 1WTBA 3NAIA 3LPUA 1VBXA 1F9FA 4MO4A 2C2MB 4O44B 2QC3A 2V7ZA 4H4KA 1H2VZ 3QT7A 4CF9A 3J80Y 4F4AA 3M8YA 3CMEN 3HO1A 1YXQA 2O4IA 4CNZA 3FCHA 3DGVA 4WP8A 2NRHA 4IUFA 2J7KA 4CH7A 1JWWA 3T1HK 4ZDNA 2K7KA 2QT7A 3I0RB 4NYPA 1JB0C 2QI2A 4JS4A 2FJBB 2PYLA 5DQHA 4Q7AA 3CJ9A 3ZZPA 2LLZA 3VAGA 1UZHA 4FPBA 5DDPC 5CD4A 3GYNA 4M5HA 3JS6A 4AXJA 1JLFA 2CNNB 4LIRA 1T11A 1WC5A 4ED6A 2I5JB 4Q43A 3CCEN 3HCXA 2HFZA 4FJ5A 2E2QA 4AHVA 4PAAA 4Y2AA 2G2ZA 3HVTB 4K4VA 5F8NA 4EBCA 2FSNA 4P9SA 4DS5A 3VV2B 2DIUA 2QMXA 3MM8A 4FWMA 4FLUA 4DV0K 2LEBA 2VASA 4C4WA 3CCVS 1BO5O 2F5GA 3RAMA 4YOTA 3FSYA 2UUAF 1SJ3P 4WQ5C 1UJ4A 1URRA 5E3PA 3TX8A 4B3RF 1ZBIA 3AQOA 2C28A 2OTLS 1R8CA 3RMDA 1REVB 3NWGA 4F50A 2QLFB 2FF3B 4UZBA 3MD3A 4B9TA 4FK2A 2HYIB 2IIRA 2VUGA 4K4XA 1RSCA 5AJ3K 3CMAS 2YKNB 3VMFB 1N5TA 2AYEA 1I6JA 3OL8A 2CZVC 1QHAA 3AVGA 3FSIA 4NYFA 1NGBA 1X5TA 4BRIA 5DETA 3ZZUA 1XHZA 4P72A 4FOIA 3BH7B 2W2MP 3CJKB 2VJUA 3OYGA 4GKKF 3QQCD 4DV4F 3E9OA 1FE0A 3HVAA 4GRSA 3CJCA 1LW2B 1E6YB 2C3UA 4K0KJ 3ZC4A 2P9LA 2B8PA 3EVMA 5H1SV 3PRDA 4FXVA 5AXMA 3ZT4A 5D3GA 2VWKA 3BN4A 2ZJRQ 3R5DA 2GO9A 2M0GB 2F63A 4GKJJ 2WOMB 2C2ZB 3FK4A 3EVOA 3ULDA 4MIAA 5EWEA 1YX2A 4IOCL 2C2RA 4A5AA 3B54A 4LJMA 4EWTA 1RT6A 1YQHA 2IPOB 3L7OA 1E3MA 1UZDA 2E1YA 3NDKA 2E5HA 2AT1B 3VGUA 3MEGB 4K2XA 2QJ3A 5LL6Z 5J2PB 5FPEA 5CA5A 1JJ4A 3HJVA 3KNGA 4IH7A 1DY3A 4TXSA 1Y3KA 4NLWA 3VPZA 3GG4A 3ZZZA 3DAWA 3K89A 3D6TB 3AJ1A 1BCOA 2RF2B 3VQ9A 1QVFR 1KAXA 3DMJB 1VCTA 5HMWA 2B6AA 2CPFA 4MMOA 2V4RA 3ZX2A 3OLAA 5F8GA 3D67A 4NZ6A 2BMBA 2XYGB 3HJFA 5D8HB 3CCTA 3W64A 3WX4A 3JSMA 2Y0SD 4OYOA 1IKXA 3H5XA 1NMNA 1O0PA 1RT3A 3IMXA 3DLLL 3B4DA 3MWTA 1SB6A 3PNIA 1JXEA 2X1AA 1J54A 3IP0A 1D9FA 1DLOB 3OPKA 3KK1A 4M95A 1KQSR 1TV6B 4J9VA 3ID8A 2QO3A 4FDFA 2LP4A 1S1WA 5LM7E 3ENAA 3EVWA 5B0CA 1CJVA 1Y5NB 1U48A 1TL5A 4C3LA 3CI5A 3FBEA 3L4BC 3MMCB 2X1FA 3WX8A 3ZEUA 4KH4A 3NVKA 4KO0B 2BE2A 4B3MK 3L2QA 1ZM3A 5K8MA 3RB4A 2GW8A 3RSEA 2OZMA 1LNQA 3OYKA 2Q97A 3VTHA 3CJ0A 4DFKA 4ZKAA 4IFEA 3AXKA 2B9EA 1VQ5S 1SUQA 1KHVA 3BSCA 5HRPA 3MDFA 1PKUA 1X7VA 8ATCB 3IAS9 4NA3A 4Y0WA 2V2ZA 2LMIA 2GUPA 3DXSX 1S4FA 1YJWN 5A8WA 3CDUA 3C15A 2W9BA 4J2BA 3A2FA 3CPEA 3WXJA 3TARA 3SIPB 2ASLA 1RTIB 3VGSA 1HNIA 5DLFA 5HQLA 2N4DA 3V4IA 3QGGA 3MR2A 3J7ZO 3WZ0A 4F02A 4J7CA 4FZZA 1BQXA 4CEDA 4ZCKA 4CJ3A 3LF0A 4OHWA 4JKGB 1L3SA 4AH9A 3QIDA 3DLBA 3NF9A 1RHQB 3C14A 2DYAA 2LDIA 3F56A 2W9CB 2ITMA 3OYAA 1NLKL 3OR1A 1BA1A 2W41A 4KBOA 2GCFA 3T9NA 4GNIA 2DISA 4OI6A 1KLMB 1CG2A 2A18A 2H3EB 1CJKB 4QS7A 2V8PA 2R8JA 3LP1B 1SV5B 1XTZA 2RSQA 4X4QA 1BHNA 1TL3B 1EP4B 2AJQA 3TEHB 4CLZA 4OX8A 4E7LA 4C8MA 3CDEA 4Q0BB 3LQVA 2Z57B 3Q2SC 2EW9A 4XAKA 4CEQA 1CLFA 3P5JA 1P6TA 2Z1GA 5AE3A 4FF1A 3WC2A 2X78A 1TL1A 5J2NA 3RWUA 2XB2D 4Z0UA 2DNZA 4PPZA 4DV1J 4QWEA 3CCJN 1VK0A 2RT3A 5AQOA 2R7YA 1IJJA 4ID1A 4GVEA 3OSNA 3CCRS 1R27B 2JL9A 5HSPA 1WTFA 3MR6A 4CK2A 2GAHC 1GLFO 1WUUA 2Z2LA 3G8TA 2AF6A 4JI8F 1T05A 1MNEA 2A2DA 2A41A 4CO1A 5KOXA 5M1OA 3MR5A 4MJKA 3PDNA 5J2MB 1WF0A 5C7PA 1N32F 5HVGA 1Q9YA 4OGEA 3BGRB 1WNEA 4I2PA 1T03A 4OKKA 3RAQA 4Q45A 5JVGQ 5KT5A 1TKXA 4QOTA 2ZHBA 3WIVA 4FS2A 4DS4A 1HI8A 3UR3C 3OHBA 3W8GA 3D6RA 3H08A 4OI3A 3T9ZA 2DY9A 4RNNA 3ZETB 3QSYB 1R0AA 4B8AB 1WKLA 1VQ4S 3AGRA 3VAIA 4GVMA 3J8AA 2X7IA 3NP5A 1WOSA 1UVIA 1BGXT 2OZSA 3M9OB 4KAIA 4W5QA 3SFUA 3HZGA 3QGHA 4BC3A 4DQ8A 2DNKA 2CH5A 2KXNB 3KG4A 1EETA 3EZ5A 3LP3A 3CXCR 3A0IX 1X9MA 3QINA 3CPWR 1M90O 1FRXA 2J9DE 1MWMA 3GILA 4MAKA 4K4SA 2QKBA 2V8HA 1JCGA 2EFGA 5E7OB 2LQ5A 2FC9A 3V9XA 4UW2A 1O1WA 4U7BA 4AFFA 2FUG9 4ZJOA 2VA3A 4CF8A 4OZLA 1FRHA 5DGAA 4I7FA 2YHBA 4RW6A 1WHXA 2FY8A 3TRGA 4BHQA 3M6XA 3GYXB 1JLFB 4YOYA 4M5LA 4HDHA 5D15A 3CJ1A 2VBYA 2YV0X 3OTOK 2E1ZA 1YBUA 2E6MA 4LF9J 1H73A 2VPWB 2VQEJ 3HZEA 1S3XA 3KWMA 1QD1A 3SUNA 4KHQA 2M2BA 2R8HA 4IRDA 2VIHA 3QERA 2HNYB 3DOLA 5I3QA 3R5JB 5A2QU 3MM8B 1WNSA 2O8DA 2AW0A 1UL3A 4TYAA 3MN6A 3CW2C 4X4TA 4CEAA 1EO1A 3VQSA 1QM9A 3N5BA 4TLQA 2KRBA 3HSCA 2J76E 3HF5A 3TUJC 2M5YA 2KDOA 1FW6A 1RNHA 5HMZA 4AQYK 1N0VC 5JMNA 1PJ7A 1SQEA 4MTPA 4DQPA 4MO5A 4GC7A 4P52A 4ZPAA 4PRFA 4WFNL 1M5SA 5KPRA 1I3OB 2MLZA 1R7IA 1GOAA 2P9NA 3CD6N 2OH2A 1NCLA 5KFMA 1NKEA 2L41A 4XDCA 1J2VA 2X51A 4CZIA 3R97A 4CD3A 3GJQB 1Q82O 5HROA 4PUOA 1B9DA 3O9RA 1IUJA 3CO9A 1Y64A 2DTUA 4JI4F 3R7NB 4MH8A 3JB9k 1RWMB 4CHOA 3B6OA 3HYFA 4FF2A 3FFKB 1HWUA 3SSQA 4H0YB 5KFOA 4CJSA 4DR5K 3VETA 4X65K 3EM1A 3OTEA 3CIZA 2ASDA 4J2EA 2P9LB 3M6UA 3GZ7A 3MMBA 3JXOA 4CO2A 4WFBQ 4DR3F 3S3OA 3BBFA 5D3GB 1B99A 1P9YA 1XMQJ 1VSLA 2IDOA 2CXEA 4Z7YA 2ERRA 4QJVA 3R5CA 1MWQA 3FGVA 3K5MA 4HH1A 2AKWB 3D3BJ 1NZAA 1IO2A 4N77A 4HTIA 1WDDA 2XY8A 5AQYA 2VC1A 1I94F 1RT6B 4CK1A 2WK4A 2COLA 1IBKJ 1CBKA 4O4RA 1WSRA 2UP1A 4TKTA 3KK3A 1VQKN 1G3OA 4DV7F 5BXIA 1KFSA 1MWYA 1RBAA 1Q18A 3NAEA 5ETOA 1T9WA 4YY3F 4BR0A 2EBEA 5HLFA 1KOHA 1RAGB 1X3NA 1TMMA 1OY6A 3MPUB 3P83D 5A2QY 1FFWB 3G25A 1CC7A 2NRZA 1MMDA 3RGIA 2B6AB 4RL1A 3WT0A 5M1KA 4PL7A 2CPZA 1Q7LB 1RZMA 1PC5A 2QA4S 4ELTA 1CXQA 2XZTB 4Y2MA 1IBLF 1VQ9N 3PJWA 2ZGYA 4I6MA 4P2MA 4DR2F 3JSMB 2SXLA 2GJIA 2GGPA 4I0WA 1YG0A 4ALZA 1G1XA 5FROA 1IKXB 1ULRA 1RT3B 2F9TA 3VQPA 1JX4A 2WW8A 1QAJA 1FFSB 4URGA 4LQ3A 4NX9A 1D1UA 3WNGA 2BDPA 2ROEA 4NA1A 2ILZA 4PPDA 1T44A 1HW9A 4UOHA 4Y2KA 2FJVA 3LDPA 3KK1B 4MK9A 2UXCF 1SH3A 3MN5A 2D3ZA 3MAHA 1S1WB 1NEEA 4NLYA 4BRHA 1CJVB 4HH0A 2V4QA 2Y1RI 3D4JA 3QEXA 3ZEUB 4X62J 1OQ6A 2Z2YB 2BE2B 4ZPWR 1YWXA 2D1KA 5CZ1A 1SXLA 3QNWB 2IS3A 3TAPA 4C1NI 2BGGA 5LMUK 5GMDA 2JNJA 2RPIA 5JS1A 2OPPB 2RRAA 1SUQB 1NRKA 2GHVC 2VG7A 3QO9A 1H74A 1X4HA 2Y9HA 2VZ9A 1ZA2B 3O44A 2FC8A 4NO7A 3PXGa 1RWKB 3ENVA 3EDQB 4E2FB 5A8WB 2KHOA 2Y1IA 1GLJO 3C15B 2W9BB 5KQDA 3SQ4A 1Q81T 2YNFA 4CF0A 1NOYA 4AF1A 2ZNYA 1UP1A 1VQNS 1HNIB 3UKRB 3GE1A 2YKMA 2LA4A 3NH0A 1Y4ZB 4DV5J 3V4IB 4YDXA 3EJMA 3M2UA 5E84A 2B5JA 2LQJA 4M3RA 3ILOA 4DCPB 4DHVA 1VQ8S 4DR4F 3TSQA 5L1JA 3EZUA 2HMIA 5AZJA 5BR8J 3OD2A 4DUZF 3IAM9 3C14B 4IG3A 2GQ2A 2R8GA 2YCHA 1UWAA 4OYMA 3GG0A 3MMVA 4JI1F 3OR1B 5L9XA 5DQIA 4KV8A 2AJ4A 2P9GA 2Q36A 3Q22A 4OYZA 5EHHA 4WIQA 1F2HA 1NBEB 3BR8A 5LMNF 2RQCA 4ES1A 3AY9A 2ZJRL 4K2JA 2H54B 1X5SA 3RVCA 4CBWA 2O8CB 2XS2A 4ATNA 3ISZA 1C1AA 4M5DA 4M3WA 3BPDA 2RDJA 2D5RA 2EX3A 3SBMA 3DOMB 2E5JA 3JTNA 4C8LA 1XR7A 3HSGA 3MOZA 3T5JA 4FWPA 1TL1B 2HZCA 3I5CA 2ZH4A 1WI6A 5J2NB 3VAJA 2HQDA 4UY8O 4CH0S 2DPJA 2XMVA 3AA8A 5LJ5Y 1RT2A 2VQFK 4EBDA 2ZKTA 5FIIA 1WDTA 4O0JA 4F3QA 5C24A 3H4DA 1CJTA 3JTPA 3AA2A 2NRRA 4EHTA 1VISA 3T5LA 1QVGM 3PYGA 2F96A 2OTJN 1T05B 2Q31A 4O8UA 4ANCA 1VQ7N 1TKTA 4C1NK 4FJNA 1VIOA 1RWOB 3KLGA 2IA0A 2E2NA 3MEDA 4QR2A 1E4FT 4PZVA 1UVNA 2PFDA 5CQGA 4RO0A 3CCLN 2XZDB 4HT5A 1T03B 4FNIA 3PJ9A 3UNGC 2V4JA 4DPYA 2AP1A 3HM9A 1TKXB 1S49A 3C8YA 4P7TA 1ZBSA 2GUIA 3TO8A 1X8DA 3IGVA 1YIJS 1NPPA 3GL1A 3G2XA 4HTLA 1PGZA 2H4YB 2PN6A 3OTBA 3R2DJ 2Y1JA 3OL9A 1HJOA 4O5FA 1R0AB 4ID8A 1VSFA 3ZSWA 1X4FA 3AY0A 5AQFA 2DY4A 2AJ1A 1UJ6A 4D3HA 2YKPA 2FLNA 2LEPA 1X9JA 5D77A 4BE0A 1B7FA 2EFQA 4RUAA 1EETB 3G8QA 3MEEA 3IR5B 2EFNA 2DXFA 4LY7A 4USUA 4LF5F 5FPNA 2ZVIA 1UA0A 1NPRA 3JQJA 1BC6A 2M4MA 1GXTA 7FDRA 1C1CA 3L2WA 2RDDA 3ZSQA 2KZMA 1QUVA 2QWPA 3QESA 4J9LA 2QLWA 3DJCA 4CFBA 4I7FB 2RH3A 4ES2A 4RW6B 2B51A 4P2XA 3J81U 1VR6A 1VHFA 4I9LA 1U24A 4O8KA 4EEYA 3P39A 4Q44A 2CNLB 1GLLO 4JD2A 1GT8A 4FF4A 2MZSA 1FEHA 2UXBK 4CT8A 2MTLA 3D6FB 5J1PA 2P6SA 4CJKA 2OHDA 2V69A 4NE9C 3VCDA 4LF4K 1S0NA 1A9NB 3DOLB 2JFKA 2OFGX 2XZWA 5I9EB 2PZSA 4ZCMA 1YLXA 2VFTA 4AHCA 2O8DB 3OL6A 1U0SA 2BUNA 2HLUA 1TFYA 5GAEP 5B8HA 3MCAB 3TJ8A 3UQSA 2NZCA 4LVNP 3KUEA 2ZNZA 3HPHA 3POTA 1E4GT 3HFZB 1GLAG 5CE3A 2O01C 1T0TV 2IC3A 3RRGA 3G0ZA 2GTDA 4BLGA 5DZ6A 3I6PA 2C3OA 4LF6J 2P9NB 1R89A 3CC7S 2F8SA 4X4NA 1U2VA 1BQNB 2POKA 3IDHA 5KFXA 1ZBUA 4C0OC 4YR3A 2AHOB 1KOOA 2DHHA 2ABYA 3WUHA 3PKMA 3C16A 1ZM9A 2LFVA 5HROB 3M05A 4FJIA 1VI7A 2L48A 4OZJA 5HQMA 3HXMA 5EOYA 1UAWA 3H6EA 3SQ2A 3KK2A 1FXDA 5F8LA 2AMCB 1FCAA 3A8JA 4WKYA 3WNFA 3PLAA 4LF7F 1PYOB 2DT9A 1WHWA 4EU0A 4K4YA 3S41A 4A2AA 2OEKA 2Y0BB 1HWJA 1RAJA 2R7QA 3CQYA 1RCOB 2H48B 3C3LA 4L8RB 3VQBA 2MJUA 4QR0A 2X6NA 4C97A 3EE8A 1A7GE 1K73O 3LH2S 3NF7A 3DDNA 3MMBB 1N33J 2A6MA 2DO4A 3SLCA 1XUPO 5IM0A 1HR0F 2NZ4A 5F8HA 4UUWA 4LMZA 1EB0A 2UXDF 4FXWA 1OH8A 2EI5A 2A1SA 3VWSA 3IG1A 4I2QA 2JZ5A 2KQ2A 2ZM6J 4XIUA 2DHXA 4JI5F 3VTIA 1AFJA 1HLWA 3KK3B 2HBKA 2L3MA 1NH8A 3PHTA 5H9FJ 3WXLA 2P8IA 3DLHA 4DSFA 2VU5A 1K47A 2LYVA 1VAZA 2VBWA 1IR0A 5HLFB 4C23A 3AVMA 2FY1A 4ELVA 3IFRA 4NPOA 2X74A 1IBMJ 2BJ1A 3IC1A 3SV3A 5L8RC 2JVRA 4UUXA 2G1HA 1SC4B 4LFCJ 1HARA 1U02A 1U8SA 3GP9A 4O55A 1AUDA 2CG8A 3NGDA 4ZP9A 3U27A 1RBTA 4Y1DA 1YHQS 4DV2J 5C2CA 4J9PA 2ZH3A 4DV6K 3W0LA 4I6MB 2OSQA 2GGPB 4BGBA 1EX4A 2GMJA 3OYIA 4JEPA 5L1KA 2HFUA 3CWJA 4B02A 1S5ZA 3D1HA 2W8KA 4PXBA 3PR4A 4H0TB 7FD1A 5D4OA 4FJ9A 1NKBA 4RR5A 2R42A 3BBBA 1VK3A 4CJRA 1FNMA 3EE3A 2QFJA 3K7RA 2V94A 3A3OB 2YJEA 1SQGA 2R7TA 1FRIA 4JK7A 1U45A 1LKZA 1RXOB 1T9TA 4WXWA 2QWOA 4CCHA 3TVYA 2HMPA 2B4VA 1XIQA 2P5VA 4P2FA 5CZ2A 3PG9A 4OX9J 4M3XA 4MYUA 5KFDA 4B08A 4LFAJ 4CGGA 2OUGA 1NMDA 1GLDG 3TA0A 2HBQB 1X4BA 2XTJP 4K7QA 2QWMA 2WVFA 1VK8A 5KG0A 2VL1A 2B43A 2HLTA 3V4MA 3PVXA 4P6QA 3QO9B 2QN6B 3UD4P 2OKQA 3R8EA 4U8VA 2C2NA 3OS2A 1R8BA 4QIEA 2DNOA 4K43A 4GO5X 1EAYC 2IOCA 5GADP 4L73A 1L3KA 3PSFA 4NEZA 2FVSA 2YNFB 3J7Z5 4ED1A 1HNXJ 4I6AA 4JV5J 2W4DA 1X4AA 1WC3A 4FZXC 2YKMB 2DO0A 2UVUA 3HBTA 1RBOB 5C25A 4JI3K 4IFVA 3M2UB 2B5JB 2W4PA 1HMVA 2CFXA 2QYGA 3K9JA 2J0SD 5J1EA 2HMIB 1VDHA 2DK2A 5AZJB 1RYSA 2Q0RA 4IG3B 2B3TB 1FKAF 4E0DA 1JLGA 3ISNC 3G87A 3TX0A 2AZ1A 5LY3A 3MDQA 3IRWP 4DR1K 4KV8B 3W9JA 5HO4A 4ANEA 3R6MA 4E7KA 1RT7A 3QNOA 1S12A 2HHHF 2IVYA 1NOZA 4JKHA 4LH5A 5KG4A 5D4LA 2LCWA 4NXNJ 4B8CA 5BPMA 3CCUN 5DZ7A 2L9NA 3MTKA 4GVBA 2MLXA 3CYMA 1G2EA 3I8BA 2EVZA 1WORA 1N32K 4M5DB 4N47A 1YJ9S 4L76A 3P31A 4Y34A 1NM1A 3D54A 1JLAA 4CNYA 5IT4A 1R59O 4Y00A 4CIGA 2V5HG 4CD1A 2RMLA 2FBYA 3W62A 3NS6A 5DDOC 2NSCA 4JI7J 1RT2B 4DV3F 2DRAA 4EYHB 1AYEA 4E1MA 1EKSA 4NRTA 4KRFA 5C24B 3U1LA 1CJTB 4IQXA 1I39A 2OLWA 1VBYA 5L9NA 2VDHA 2RUSA 3RB0A 4CBXA 3HSTB 1HQEB 1W9HA 4FWQA 3M3ZA 5AFUH 1TKTB 4DCJB 3IO1A 2CZ9A 5KFJA 3G6ES 4PWDA 3G6VA 3KLGB 3CC2S 1HNZF 4OLAA 3MEDB 4H0XB 2IBOA 5KFVA 4ELUA 2PA3A 1LW0A 3KG0A 1EXQA 4OZNA 2RQMA 2V4JB 2YXLA 1K1SA 3U02A 4NB4A 2QG9B 1RADB 3WBZA 4M3YA 3BS9A 2CPEA 5EWFA 2C2KB 1IR2A 2UU9F 5DRKA 3BB5A 4A8KA 2ZOGA 4X4PA 2ADCA 2ASMA 4B3SJ 3GR0A 3ET6A 4ICLA 1HWIA 2ZF5O 4NXMF 1CZ9A 4F0KA 4W4MA 4KTZA 2EC0A 4B1ZA 4PKIA 1GMWA 3F9KA 1B64A 4B3TK 4C0BA 5AR0A 3S3NA 2AZ3A 2ASYA 1OPZA 1UTAA 3AVJA 2JC0A 3QEVA 3MK6A 3MEEB 2JEJA 2K2PA 4IZ9A 1S72N 1RACB 4U7CA 2KW4A 3CMQA 2KFNA 3LZJA 1BISA 3BZQA 2QEXN 1NHKL 4OZ3A 2DJWA 1YAGA 3T3FA 5K14A 3L6QA 3UNYA 1LOTB 2ZWPA 3BY5A 4ILMA 2W9AA 2BH1A 4CT9A 4BE1A 4NLSA 3CM6A 3QBXA 5THWA 4GC6A 2ITGA 3GIKA 4MK8A 2FHMA 5KRSA 4IO1A 1IN0A 3NG8A 4FLWA 2B56A 3D2WA 2Y1LB 4FWLA 5E3RA 1F9HA 5KFCA 3CCSN 2FJXA 3ENQA 3MX5A 5HL7Q 4AL7A 2C2EA 3VQTA 3SQ1A 3G71S 4H8KA 4D3GA 1CVJA 4QYRA 4DX7A 4X64K 1EWRA 4JI2F 1FKPA 3BKFA 1FDDA 4WZQA 4JKCA 4JI4K 2WTFA 4EK2A 5IWAF 4F25A 1MMLA 1XNQF 2XI2A 3KIOA 2RILA 3LZIA 2OP5A 3TA1A 4DPUA 1F3FA 1ZM2A 3POTB 3VEWA 1T3VA 2KXHA 2IMWP 3RRHA 1FXLA 2KG1A 4HWIA 2R7WA 2IC3B 2H65B 2BOPA 1HA1A 1S5JA 2MQ8A 2NXJA 3DXKA 5KRTA 4BRDA 4OX9K 4TNOA 1J5EK 2YWGA 1U2VB 4KSEB 1X0FA 1FJGF 3QWUA 2VGMA 1FFGB 4YDDB 2FVPA 3C16B 5EWGA 3BGFA 3OL7A 1SL1A 2VDIA 1QTNB 4WBFA 4J9RA 3KK2B 3G82A 1I94K 2D7SA 5D0RA 3ASMA 2VFSA 5ETKA 3KLIB 3U1MA 2F4VJ 4OJ1A 3CFRA 2KL8A 4USIA 4ECWA 2GIFA 2Z8QA 1SQFA 5FDLA 4YY3K 4DU4A 4FZYA 3HT0A 4ECYA 1OY8A 3U3YA 2ZJQQ 2ASPA 5U47A 3KZBA 2HK3A 3RMAA 1Q86O 3QFPA 3KLEA 3VEXA 1ELOA 2XBPA 1H38A 3IR7B 1KDNA 5IM0B 2Z4PA 3J7ZT 1M1KO 2XLKA 4KGXB 3L9ZA 5KFTA 1PIEA 4DV0F 4EIAA 3RBEA 1U8WA 3SI8A 2GVZA 4KH5A 4LRBA 1IBLK 3IG1B 4DR2K 4OYPA 4I2QB 3HD1A 3AVHA 2OPQA 3ENBA 3VQ5A 3QDKA 3ZSRA 2J8SA 1ZPWX 3I55S 4BC7A 5AQLA 3HHEA 2NPIA 4CIEA 3GCWP 1X4GA 3DHXA 1UWBA 3H5SA 3BPSP 4U95A 1NLVA 3BZKA 3EGWB 4CIFA 3D0HE 4FJ7A 3CIMA 1XQIA 4W90B 2UUAJ 4FSVA 1H72C 1TQLA 3KUHA 4DFMA 1HNWF 4B3RJ 2HHXA 3P1GA 1DBDA 4FLZA 4Z7CA 3Q8VA 2N3LA 1R0CB 3MXHP 2L9WA 1YTYA 1F5BA 3EMTA 4PCQA 5AE2A 3SPYA 4RNHA 1C0FA 2XS5A 2AX0A 2G0IA 4FWRA 3GIJA 4OLBA 2CAJA 1WI8A 3A1YG 3ILLA 3BYPA 4FWOA 1JMTA 2E20A 1OSCA 1WSFA 4F8RA 4DL6A 5KG6A 2QK9A 2ASJA 4TY9A 2WVBA 1K8AO 4DX8H 3J7YP 3ZTOA 3OA9A 2XHCA 4CZMA 3B82A 3QZ7A 4GKKJ 4DV4J 2JEGA 4QIWD 4C8ZA 3W5XA 1FDNA 4DF4A 3B6BA 3V6HA 3HVWA 3E2EA 3QRPA 1FT8A 5ETVA 4DR4K 4USTA 2OMOA 2GQQA 3W5ZA 5F9NA 1YF5L 2CNKB 4DR7J 1RDDA 2HHSA 1I3AA 2QLXA 4ER8A 3N6LA 1C6VA 1XQSC 2MKHA 4JI1K 4JYAK 2DNPA 1HD1A 4PA1A 5KFBA 1YRTA 1BIZA 4WU3A 3AH6A 4RBUA 3HP9A 4DL5A 5LMNK 1HIYA 5M1QA 2GFFA 3PYFA 2QTDA 1NZ8A 4DTRA 2FVQA 4J91A 3A13A 2BOAA 5DMRA 1WUAA 4U96A 3UDLA 2W40A 2J8AA 5C25B 4C8KA 3NH1A 1JXBA 4IFVB 1QJHA 1M90T 1HMVB 5J1EB 2BQ3A 4Q2LA 2YBVA 4DR6J 4CF2A 5A0YA 5ETNA 4Y65A 3MTJA 4K41A 4IYQA 3AARA 4UTGA 3RW7A 1WAJA 3FNNA 1JLGB 3QIOA 4QW9A 3H8YA 1SVDA 2EEYA 3QZ8A 4BQLA 3D45A 3PW4A 4Z4FA 1RT7B 2VB6A 1CZAN 2EHGA 1J6ZA 3L8BA 2LU2A 3QLHA 1HBMA 2A3ZA 1S4EA 1D0EA 3DU5A 3HKZD 1HJRA 3QT5A 1XC9A 1GOCA 3TI0A 1X4CA 2XY7A 2V0NA 5CHCB 4GVBB 1H2TZ 1HQ2A 4CW7B 2KVIA 2FC0A 3HOSA 1QS4A 5D0GA 1RBRA 1JLAB 5JVHL 2XMUA 3SAHA 3HPOA 2CG4A 3FE1A 3V9UA 1PBAA 3P38A 2NRXA 1U2RA 3IM8A 2JWLA 1V3ZA 3ILIA 1V5IB 1E6VA 2J9DA 2XG8A 5DJBA 2GAGC 3KJNB 5GIPA 2C22A 4AHTA 1KWMA 2HVZA 4CJ4A 2M88A 3ZT0A 1LK7A 1YDLA 1YITS 1A6LA 1ZTWA 3H4BA 3LOUA 3PFOA 1S0MA 2FBTA 1ZC6A 4MKAA 2IM2A 3S9HA 2AIRB 5TKWA 5G4DA 2RQ4A 4M7YA 3KD1E 1RAOA 4PWDB 4L75A 4DTPA 1BL3A 4F4KA 1JJ2M 2PEHA 4IQMA 2CQ3A 1LW0B 2MHEA 2D1CA 3W60A 5KFSA 3MGJA 4WP9A 3QMQA 3MN9A 1KC8O 1NBWA 1JJCB 4LF5K 2WVDA 2EBGA 2JX2A 3L3CA 4LR7A 1YJRA 2GQCA 2G13A 2HOEA 1PAEX 5T14A 2DD8S 3OS0A 4NLXA 1RTDA 4KGZB 3EXYA 1RGIA 1IM4A 5BREA 3ADAC 3ET6B 4ICLB 5CHIA 1GEHA 2HWHA 2ZH7A 2EWHA 3MURP 5I3PA 2A6OA 5AQSA 5EU7A 2OAUA 3LW5C 2UVVA 1JLCA 3SUPA 3GV8B 1BIUA 4ETZA 1HYZA 1HUXA 4J8FA 5EX3A 1WN7A 1BU6O 4J9QA 4JOUA 1FEEA 4FYVB 4ZP7A 1VC5A 1DQAA 3CETA 3CSKA 4L72B 2Q0UA 3M8SA 3MFHA 5L46A 1FX4A 1MA9B 3V9WA 4V19X 1XERA 1VGYA 3LDNA 2R7SA 2IYIA 1F3VA 3Q83A 5K14B 1QQNA 1G15A 1Y5LB 3BP8A 2ZUAA 4MFBA 5KFYA 4LT6A 2AYMA 2DHAA 1T3OA 4KKOA 4YHHJ 5HQ8A 2MXYA 1D8YA 3AO3A 3VF2A 3I56N 1L3TA 1KR4A 3EGNA 2YVSA 3U6FA 1FJ7A 5CZXA 2IY5B 3E66A 3BO2A 3NCPA 1LOUA 3QFWA 3TANA 4H0PA 2UUCJ 2AD9A 2G2OA 4JI8J 2DXEA 2CJYB 2MY8A 2HBRB 2V68A 2PBDA 1FKPB 2KTQA 3UW1A 5LL6d 4E