3IRXA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with the non-nucleoside rt inhibitor (e)-s-methyl 5-(1-(3,7-dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
555
structure length
555
Chain Sequence
b'VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of HIV-1 reverse transcriptase (RT) in complex with the alkenyldiarylmethane (ADAM) Non-nucleoside RT Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/hydrolase
total genus 129
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3irxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3irxA05
2ASJA 4CK1A 3HVTA 2HNZB 1CXQA 4RW9A 2VA2A 2FBYA 3SFGA 4N41A 1JLAA 2VWJA 2YNHB 1WAFA 5C5JA 3THVA 4RNNA 3LP0B 3ASMA 3KLHB 2JC1A 4CHZA 3AVMA 3PUFA 1DLOA 2OPQA 4KTZA 3LPUA 1HJRA 4I7FA 1S49A 2ATQA 2G8UA 1RTHB 1XR6A 4KE5A 3LDSA 3H59A 3NF6A 4ZHRA 3HPGA 1C1BB 4AILC 1ZBHA 2YNGB 4QAGA 5KT3A 4U7CA 4NYNA 4CJ4A 5CZ2A 1Y97A 4O5BA 2XY7A 5J2PB 4Q45A 4RUAA 3VQAA 4C8MA 3ZSZA 3IS9B 1DTTB 1TVRB 3IRXA 4FLXA 1U48A 1WN7A 2WTFA 2FBVA 5C24B 1KVBA 3OLAA 5FRMA 3OYIA 2HAIA 4ID5B 2BRLA 4NLPA 4FBTA 1N5YA 3RAQA 3K2PA 3DLEB 1S9GA 1I39A 2VG5A 1QE1A 4DTXA 5KFWA 1NJXA 4FXDA 2G8VA 3I5CA 4PA1A 1CSJA 1C0TA 1LW2A 4FJMA 3KKSA 2YNIA 5KFBA 1ZBFA 4Y1CA 4CJRA 4K4VA 2PY5A 4ZP7A 2E9ZA 4WFZA 3HT3A 4ZTFA 1SUQA 5CYQB 1VSJA 1JLEB 2IDOA 5I3UA 3LP1B 2WOMB 2AGPA 5F8HA 4ZP9A 1HYSB 2IM0A 2QXFA 2W42A 3PV8A 3UPFA 4JUZA 1HQUA 3DI6A 1FK9A 2XCAA 3F9KA 1BI4A 3OYEA 4YQWA 4QWAA 2HWHA 4K4WA 4Z4CA 4NYFA 3PZPA 1A5VA 2Z1HA 4CIFA 3L2VA 3RTVA 4RNOA 4CEBA 1O1WA 3NH2A 4NLTA 5KG6A 1U09A 3I0SA 1RDBA 2QV6A 5F9NA 5HRSA 1FKOB 4KTQA 3KLGA 2AX0A 4LY7A 1NK8A 2CJQA 1J9AA 2VG6B 4AHUA 1JXEA 4ICLB 4RUCA 4JV1A 1T05A 5KFCA 4MIAA 3ICLA 4CFCA 1RTIA 4O4GB 3K58A 4CGDA 2HNYB 4DU4A 2VA3A 1JKHA 5DK5A 4J9RA 3KLFB 2C2EA 5KG2A 4IRCA 1NJYA 1KRPA 4RW8A 4IFYA 1RT6A 2R8GA 4DSLA 3NDKA 1UA0A 5DQGA 3SUQA 4YFUA 2D0AA 4ELUA 4MQ3A 2HWIA 1F21A 4FK0A 3NH1A 4CIGA 2NUBA 3D0PA 4RZRA 3EZ5A 3TQ1A 3WNFA 1JLQA 2IS3A 2IC3A 3GQCA 1JLCA 2W7OA 2RF2B 4KFBA 4BDYA 3PW5A 4HKQA 1S6PB 1HARA 3V6DA 3SQ0A 4O3NA 5CYMB 4EZ6A 3VQ4A 1D8YA 4KV8A 5HP1B 1XR7A 5KFNA 4J9KA 4F3OA 5J2QB 3UR0A 1TL3B 1QHTA 1JLBA 3OYCA 1TKZB 1TAUA 1RTJA 2ZD1B 4DTSA 3I8DA 2DPJA 1TK0A 1RA6A 2BANB 2J6SA 4CJWA 2DFHA 3NCIA 2ZKUA 3DOLB 4EYIB 2OA8A 2XGQA 4CESA 2W9CB 3QNNA 1HMVB 4DL3A 1ZYQA 4IRKA 2OPPB 2AX1A 3E51A 1RBUA 1HPZA 4Q0BA 5KFOA 4BE1A 4CF8A 1S4FA 2B6AA 1RBVA 5KFJA 5DGAA 4O3SA 5L1LA 4NLXA 4F4XA 3OS2A 5I42B 1S1TA 3AA2A 4EBEA 4IH7A 2ZQBA 3O3FA 4R5PB 1RT2B 2FBXA 1XHZA 3BR9A 3G6XA 3CFPA 1EKEA 1U4BA 4YNQA 5EWGA 3LZJA 2BGGA 3RR8A 4KTWA 4CECA 3T19A 4LSNA 1RT7A 5HROA 4DWIA 1QS4A 3KD5E 2AJQA 2RDIA 4W5OA 4FJGA 2ILYA 1RAJA 5J2NB 2EX3A 1KVAA 2KFZA 1S6QB 3M8RA 4DF8A 3KK1B 3L8BA 1Z26A 3BDPA 3QO9B 2KQ2A 4IDKA 1QAJA 4YR0A 5L1JA 1S1VA 4WFXA 1ZTTA 4E1NA 3A2FA 3OHAA 2FLLA 2HW3A 2YNFA 3JSMB 4M94A 3RMBA 1R0AB 5T7BA 4ED2A 4K8ZA 3LWMA 2LSNA 3SZ2A 3V81A 3OY9A 1VSEA 1C2PA 1NJWA 1UA1A 2A1SA 3DYAA 5KG3A 4PQUA 4RW4A 4URQU 1WNEA 3C95A 3ITHB 4YP3A 4CJQA 1KTQA 3BSCA 3TAQA 4BWMA 3NBPA 3CIZA 2XI3A 5KFKA 2FJWA 4IKFA 2IAJA 3MXJA 3DRSB 1EP4A 3KNAA 3BGRB 2HB5A 1XC9A 1U49A 3DLHA 4K4ZA 4FLYA 2Q3SA 1RYSA 4CK3A 1IKYA 2IOCA 3FQLA 5KT4A 2XHBA 4IG3B 3ZT2A 4NRUA 3UDLA 1KHVA 3CJ4A 5CY4A 1A5WA 1J54A 3ZSQA 1TKDA 3VA3A 4O4RA 3LZIA 1BIUA 1LAWA 3I5AA 3TARA 2HMIA 4LH5A 3NF9A 3EY1A 3QNOA 2FVSA 1REVB 4NCAA 2XI2A 3S9HA 2D0CA 1S97A 3QEXA 3SPYA 1NK7A 3OVNA 2IMWP 5SZTA 4PUOB 1VRTB 3QGHA 3H98A 1RT3A 4QWCA 4ZVHA 4FLZA 4E7HA 3ZSWA 4L8RB 3S3OA 3GV7B 4ZPBA 2OPSA 3OYJA 4Q8FA 3H08A 4DTNA 1JX4A 1MU2A 4C8KA 3HO1A 1LW0B 2FVCA 4KPYA 4FW1A 3LALA 4FJHA 4F3TA 3N6LA 2B43A 3ULDA 4O0IA 4WE1B 3FRZA 3EPGA 3QLHA 3CM6A 3AA4A 3KMSA 3RMCA 3DMJB 1RDDA 1QTMA 1S9EB 4C8LA 5KFTA 2ASDA 3AVJA 3KK3A 3QIOA 1LWFB 1SKWA 1TP7A 4HVJA 2P5GA 1RT4B 2RKIB 4WFYA 4CJ5A 4FJ5A 4FLWA 4O0JA 4QWEA 2ATLA 2V9WA 3WNHA 4B3OB 3SI8A 2KTQA 2QKKA 5C25B 1IKWA 3HYFA 1RTDA 4CJKA 4K8XA 2YKNB 3K5MA 4K4XA 2HHWA 5HLFA 3OL7A 4O3QA 3V6HA 1L3SA 4TLRA 4NCBA 1UWBB 4Y3CA 4CGFA 3V4IA 3KLVA 4OLBA 3SJJA 4TQRA 1RBRA 3CM5A 2XO7A 1C1CA 2WB4A 4CEAA 1TKTB 3CFOA 4BACA 3HHKA 3OYDA 4CF9A 2WONA 4QWDA 1T03B 2O5DA 5KFDA 1J5OB 5L9XA 1HNVB 3OL6A 4CK2A 4FJKA 4OPKA 1S48A 2HNDA 2XC9A 4W5NA 4DQQA 1VSDA 1JLGA 1NHUA 2V0NA 4TY8A 4EO8A 4BDPA 4I2PA 3C6TA 2OZMA 4M95A 4E19A 3OYGA 1TV6B 3V9SA 3O3HA 4JV2A 4FJJA 1VRUA 5EUHA 3HVTB 1YT3A 4F2SA 3GIMA 4M3YA 4DTJA 1EXQA 3TAMA 4PWDA 3SCXA 1DTQB 4RW6B 2V4RA 1ZETA 4KKOB 4DG1B 1N6QA 4EEYA 2B4JA 1B9FA 3SV3A 1Q9XA 4N76A 4H4MA 3EZUA 2OPQB 5EU7A 1LWCB 2IM1A 3E01B 2FJVA 3G0ZA 4Z4HA 3CG7A 5KGXA 3GIIA 3MEDB 1S1WA 2BDPA 2YV0X 4WYLA 1HQEA 3Q8PB 3M8QA 2R8HA 3NL0A 3NF8A 1QUVA 5F8NA 2IM3A 3FFIB 3CDUA 3KLEA 5F8LA 3OS0A 2IJNA 4DL5A 4DTRA 3CJ0A 3MEEA 5J1EA 5FROA 3L3VA 2UVRA 4FJLA 5DG8A 2V4QA 3T5JA 2JEGA 4IKAA 3AVGA 4FS2A 4XO0A 2E9TA 1WSHA 3KK2A 4TYBA 3TR8A 1RT5B 2QK9A 1QE1B 3KLIA 4ECSA 2W9BA 5FRNA 2ASLA 2HNZA 5T14A 4WZMA 1C0TB 5C42B 1U47A 3P83D 2W8LA 3IAYA 2RPIA 4LSLB 3IGNA 2D0BA 1NHVA 2R2RA 2YNHA 3L2RA 4KHRA 3LP0A 3OSPA 5KFFA 3LP2B 3T1AA 1X9SA 2P1JA 4MH8A 5I3UB 3I0RA 4H54A 3CFRA 3PW4A 4FM2A 1HYVA 4RW7B 2X74A 4FM0A 1RTHA 2G8HA 4J9NA 1C1BA 2YNGA 3V9ZA 3M8PB 3V6KA 4ECUA 1FK9B 2VG7B 1BI4B 3HPOA 3OL9A 4E0DA 3VQ8A 3TABA 4CHPA 5J2PA 3IS9A 1DTTA 4E7KA 1NK9A 3ZSYA 1TVRA 2Z1GA 4ED8A 5C24A 4M42A 4KO0A 2KW4A 3VQCA 3DLEA 3DLRA 4O3OA 2DTUA 4ZP8A 1T3NA 1SL0A 2JLEA 2YHAA 3TAEA 2D5RA 3AVIA 5KI6A 3HP6A 2AU0A 2Z1IA 4IR1A 3RRHA 1HYZA 4DFKA 4CJSA 4YMEA 2BE2B 1RTIB 3QEIA 3C6UB 4KHMA 4FZYA 5KFAA 2ZE2B 5CYQA 4ZVGA 1JLEA 1RCHA 4ED6A 2C2DA 4CF1A 3WNGA 2WOMA 4NLQA 4F8RA 1QQCA 1HYSA 3HK2A 3KHRA 4HUEA 4ZP6A 4IFYB 1BL3A 1RT6B 4I9QA 1QAIA 1S5JA 2I5JB 3PJWA 4M45A 4AH9A 3H5SA 4O44B 3Q8SB 3SUNA 4DU3A 1D1UA 2HVHA 1ASWA 3BJYA 4CERA 3GV8B 3VQBA 4JRPA 2E4LA 1GX6A 1W0HA 1Z25A 4CHNA 1JLQB 3ZSOA 1NKBA 2O4IA 3KJVB 3NGZA 2G8IA 3CJ2A 1FKOA 3LAKA 4YR3A 4UQGA 1YTUA 2HVIA 4KHQA 3MEGB 4ED7A 3G10A 2VG6A 1D9FA 4IBNA 3TAGA 3Q8QB 4J2BA 3OYNA 4KV8B 4ICLA 4LH4A 4CEDA 1T7PA 4CEEA 1VSKA 1BCMA 3AVHA 4Y34A 1T8EA 4EBCA 4KHSA 3HM9A 3CJ5A 3MECB 1JLFA 3V1RA 3NGIA 2HNYA 2CKWA 3QGIA 3OSNA 4JLHA 1TL1B 5KFPA 3OYAA 3RMDA 3V9WA 3KLFA 3ZT0A 3RB4A 2JEJA 1LWEA 3QZ8A 2FLNA 5KG0A 1YVFA 4R8UB 5EWEA 4ECXA 2XY8A 3HXMA 1LV5A 4J2EA 2FJXA 3NHGA 3FQKA 3FDSA 4RNFA 4FJIA 4BWJA 3B6OA 1ITGA 3O4QA 1SH3A 4W5RA 2YKMA 1K1QA 3VN5A 3HP9A 1SV5B 3H4DA 3K5LA 3DRPB 1GX5A 2PYLA 4K50A 4AHSA 3P1GA 4ECYA 3CDEA 1X9WA 4Z4GA 5F8JA 4WXWA 3AO1A 4NCGB 2R2TA 4EBDA 2RF2A 1TQLA 2F96A 1CZBA 4KHUA 4LSNB 3DLBA 4G1QB 5HROB 1L3VA 3OLBA 3RR7A 1S6PA 3TVKA 4CJ3A 4PY5A 5KFQA 3OYLA 4CCHA 3QEWA 2HHVA 4KREA 1RT1B 3KOAA 3G86A 3PX4A 5J2QA 1TL3A 3H40A 5JS2A 4KB1A 1KLMB 2X6SA 3I5BA 2ZD1A 1BQMB 1QSLA 1S1UB 2BANA 3QEPA 4KI6A 4HCBA 3DOLA 3DDKA 4DSFA 2DY4A 2W9CA 1HMVA 4HHTA 2IM2A 3QZ7A 1U45A 2OPPA 4DMNA 3DYAB 4C8NA 3SUOA 3G6YA 3T5LA 5J2MB 1N48A 3KMQA 1XR5A 1L5UA 4K4SA 3AO5A 5I42A 4FJXA 5L1IA 4N56A 2E6LA 4MFBB 3LPTA 3NBPB 4N47A 1SL2A 1RT2A 3IG1B 2R8JA 3CYMA 2UVWA 2FVQA 4CJEA 1SKSA 2IAJB 1Q9YA 4U6PA 3VQQA 3OYKA 4YR2A 3EYZA 4CF2A 4FJ9A 4DSEA 4M3UA 4J9LA 4ED3A 3CO9A 2XY6A 3DLGB 5J2NA 4B9VA 4B9UA 4DQPA 4CGHA 2FVRA 1S6QA 4NLDA 2G8WA 3KK1A 4CJUA 2G8FA 4CHQA 5F9LA 4EP4A 3ZT3A 4F4KA 4FM1A 4CEZA 1KFDA 2J6UA 1B9DA 5D3GB 3NAIA 4GC6A 1C0UB 1BIZA 1CZ9A 1RDAA 2I1RA 1XWLA 1FKPA 4MKAA 3SPZA 3JSMA 1R0AA 4CF0A 4FBUA 3S3NA 5HBMB 3AO4A 3PHEA 4H4OB 5KFLA 1G15A 1UOCA 4BDZA 3KHHA 1S1XB 4KI4A 4W5TA 2D3ZA 2OPSB 4KAIA 3V6JA 4IQXA 3PO5A 3ITHA 3IGVA 2B5JA 1HNIB 4CFAA 4NLUA 3U3YA 1RBSA 1TK5A 3LWLA 4KB0A 3JYTB 4NLVA 4AHVA 2Y1IA 2XGPA 4CHYA 2X78A 2DFEA 3DRSA 3CWJA 3BGRA 5KTQA 4J9QA 4NLYA 3DRRA 4DTOA 3PVXA 4ZPAA 2IA6A 1D0EA 1ZBUA 3EPIA 4KHYA 1WLJA 3KTQA 2X6NA 4Q44A 4IG3A 2WHOA 3N6MA 2GV9A 1X1PA 1S10A 1VSMA 4IH6A 3RRGA 3QIPB 1RDRA 3UIQA 4TN2A 4HUFA 4O3RA 5KRSA 3PJXA 1IKWB 1REVA 4IFVB 1RTDB 3ZT1A 4GMJB 4O55A 1TGOA 4OGEA 1IKVB 2E6MA 4W5QA 4EYHB 5HRPA 2OZSA 4KHNA 4PUOA 1N56A 3T3FA 2BQUA 2WRMA 5KT7A 1C1CB 2Y1JA 1JL2A 1BQNB 4HCCA 3DM2B 4MK7A 4CJPA 1XI1A 4ECTA 5KFRA 5HRNA 4Z4IA 3AVNA 1HRHA 1LW0A 3PY8A 3ZT4A 4CEFA 2OPRB 4CJTA 4IG0B 2HNDB 1RDCA 2GC8A 4H8KA 4M3XA 3AA5X 1TKXB 3HVRA 3MAQA 3C6TB 2OH2A 3OYBA 1BISA 3DMJA 1K6YA 4CJFA 5KFXA 1XHXA 4CGJA 1S9EA 4MIBA 2E9RX 1D9DA 3NF7A 3DOKB 4ZTJA 5FDLB 4DSKA 4GVMA 1LWFA 1L3UA 4TYAA 2W9AA 1RT4A 4FK4A 2RKIA 4CIEA 3SQ2A 2JGUA 2ITGA 4I2QB 3SYZA 3CDWA 1ASUA 4E7IA 4F50A 4RG8A 3GV5B 4CGIA 4JV0A 3M9NB 5KFGA 3MFIA 1D5AA 2YKNA 3F73A 2EHGA 3HL8A 3PX6A 1IKXA 3U3GA 4DSIA 4OVLA 3CVKA 1UWBA 3KIOA 4K4YA 4J2AA 4FJNA 3OJUA 4DL6A 4RW9B 4Q43A 2F8EX 3RWUA 2FLPA 1JLAB 2W8KA 3ZSRA 3V1QA 1B92A 1T94A 4NLWA 3RBDA 4DF4A 1DLOB 4ECZA 2HHTA 4I7FB 4EO6A 3ISND 3MEEB 1SKRA 4ZVEA 5DG7A 1VSHA 3BQ2A 1IM4A 1SL1A 2D7SA 4ECQA 2G8KA 4ZHRB 1MMLA 4K4TA 2HHSA 3NE6A 5KG5A 1EETA 1TV6A 4OPJA 4DL2A 4NRTA 4FCYA 3CQ8A 3K5NA 5KFEA 3RBEA 3IRXB 4Y2CA 4QPXA 1U04A 1DTQA 4ECWA 4F4YA 4RW6A 5F8MA 4KKOA 4DG1A 1N5YB 1RYRA 4FLUA 2Z1JA 4F4ZA 4TY9A 1S9GB 3LAMA 2VG5B 3ZSXA 3DLKA 5K14A 1LWCA 3I0RB 2GUIA 1QSYA 3E01A 2KZZA 1LW2B 2ETJA 1S0OA 3MEDA 1WSGA 3CJ3A 2XWYA 5DLGA 2YNIB 2ILZA 1CLQA 4BE0A 4KAZA 2JEIA 1C1AA 3AVBA 3KLHA 4FJ8A 1SUQB 3FFIA 3D28A 4DFJA 1ZBIA 2QE5A 4J9SA 5KFYA 5JS1A 1S0MA 4XPEA 4DFMA 2P5OA 2XRIA 4NLRA 2KZMA 4QCLA 4WZQA 4KO0B 4NLOA 2R8IA 4Z4FA 2DPIA 2R8KA 4HYKA 4R0EA 3MR6A 3MFHA 1HQUB 3DI6B 3V9XA 4FLTA 1RT5A 4ZPDA 3HVWA 3SI6A 3VQDA 2W7PA 3PW7A 1WSJA 2BRKA 1VSFA 2IJFA 5C42A 4GC7A 5DLFA 3PW0A 4B9MA 4Q8EA 4J9MA 4LSLA 4KRFA 4B9SA 4ID5A 3BSAA 3PX0A 3SNNA 3T5KA 2R2UA 4DTMA 3C94A 3VA0A 3I0SB 4MK8A 2FVPA 3OYFA 2RDJA 4B08A 4CEOA 2C2RA 4M3RA 3LP2A 3L2QA 3KLGB 3AVAA 1X9MA 4C8OA 5DQIA 4RNMA 1ASVA 5DMRA 4AHTA 4RW7A 2WK4A 3M9MB 4JS4A 4EZ9A 4Q5VA 1T05B 3N6NA 3AA3A 3PR4A 3BSOA 3RMAA 3M8PA 1Q8IA 2VG7A 4CE9A 2YHBA 4ECRA 2AWZA 4NZ0A 1JKHB 4KHWA 2J6TA 3ISNC 3IN5A 1GOBA 2XCPA 1NOYA 3LP1A 3AVKA 1WSEA 4HUGA 4OJRA 3MR5A 5KT2A 1ZBLA 2PZSA 3B6PA 4RW8B 3QETA 2DFFA 3TWHA 2O4GA 4AHRA 3UQSA 2RN2A 4NLGA 1OS5A 4DFPA 4DQRA 3QIDA 1C0MA 3NAEA 3RB3A 4XIUA 4DU1A 4AHCA 5KFZA 5F8GA 2JEFA 1RNHA 3QESA 4N5SA 3V1OA 3LANA 4E1MA 1NK5A 4M3WA 3KHLA 2FBTA 2IC3B 1WNSA 1JLCB 4ECVA 2BE2A 3KD1E 2D3UA 3C6UA 4KFBB 1A5XA 1JLFB 4DEZA 2ZE2A 4HTUA 3OJSA 3SFUA 4I9LA 4BE2A 4DTPA 3V6DB 3NKYA 1LWEB 4FVMA 4J9PA 4B9LA 3KHGA 1JLBB 5JXSA 4O4GA 1RTJB 2I5JA 3VQ6A 4CFDA 4O44A 2YKMB 1NJZA 2UVVA 3OHBA 2BR0A 4OKJA 4B9NA 3AVCA 4MKBA 4M3TA 5DQHA 1RBTA 1HPZB 4WYWA 4Q0BB 1CXUA 3KJVA 2B6AB 2P51A 3VQ7A 4FZZA 5SWMA 5HRRA 1BGXT 3MF5A 5KFUA 4CEQA 3P5JA 1S1TB 3MEGA 4JRQA 4E7LA 3TAFA 5KFHA 4M3ZA 1TAQA 4NYZA 4CFBA 3OYMA 3WNEA 1TK8A 2JC0A 1W9HA 3MECA 5KRTA 4JS5A 2C28A 1RT7B 4B8CA 2EC0A 1TL1A 4DLGA 3AO3A 3ZSVA 3G6VA 2F8TA 2IBKA 1KSPA 3RB6A 1L3TA 5CYMA 1KVCA 3ZCMA 4NLSA 4R8UA 5HP1A 4FS1A 3L2UA 4ELVA 1GOCA 5KG7A 1BCOA 4CGGA 4IDKB 1WAJA 1TKZA 4ID1A 3SUPA 1S1VB 3GILA 4B8AB 3ALYA 2BQ3A 5DGBA 3FSIA 4K4UA 1S9FA 1SV5A 3DRPA 4DQSA 4J9OA 4DLEA 2YNFB 1IG9A 2AGQA 4OGCA 1NK4A 4E7JA 3VQPA 4FZXC 3D5MA 1YVUA 3V81B 3MXMA 4NCGA 4CJVA 4PQUB 1FXXA 4G1QA 4J2DA 3LP3A 2KFNA 4RW4B 3RAXA 1K1SA 4WXOA 3NH0A 3SQ4A 1VSLA 5KT5A 3HPHA 1RT1A 4R5PA 4ZMMA 1N4LA 1RA7A 3O3GA 3OL8A 1KLMA 4ZPCA 3MR3A 1WSFA 1EP4B 4IOBA 1BQMA 5DG9A 3NGYA 1S1UA 3QEVA 3VQSA 1C6VA 4F2RA 2D41A 1FKPB 1IKYB 3H2LA 4KBIA 4Z4EA 4F4WA 2WCXA 1W25A 4B9TA 1I6JA 3GYNA 3QO9A 3K57A 3K5OA 4E3SA 2HHQA 1I3AA 2GBZA 5L1KA 3O4NA 2HMIB 4ED1A 2C22A 5J2MA 3SV4A 1S0NA 1VSIA 4LD0A 1NK6A 4IRDA 2AGOA 2B5JB 3M9OB 3T5HA 3AVFA 4MFBA 3IG1A 1EX4A 5F8IA 2HHXA 2UVUA 4RU9A 3V9UA 3QGGA 3OYHA 3PO4A 4DTUA 2F8SA 1Z4UA 1SH2A 1RT3B 2VWKA 3DRRB 1ZTWA 2GIRA 2R7YA 3TAPA 3DLGA 4IH5A 2IGIA 1NKCA 1MU2B 3QERA 1GOAA 3MR2A 3VQ5A 2XY5A 4RNHA 3H5YA 3VQEA 5D3GA 1C0UA 1JXLA 4DQIA 4DL4A 3NFAA 3QLHB 1WSIA 4QW9A 3BQ1A 4IR9A 3VQ9A 3K59A 4LQ3A 1UAXA 4FW2A 5CZ1A 5KG4A 4FJ7A 5HBMA 3KK3B 4Y2AA 4H4OA 4DSJA 2BQRA 4DS4A 1S1XA 1NKEA 3BQ0A 4LQ9A 1JIHA 3QYYA 4DS5A 5HLFB 4CHOA 5EDWA 3S3MA 1HNIA 4OL8A 4QWBA 3U6FA 2R2SA 3AO2A 1LAVA 4URGA 3BSNA 4O3PA 3JYTA 4OKEA 4DL7A 5KFVA 4QW8A 3V4IB 1VRTA 3BREA 3MTKA 2FC0A 4E89A 3MXIA 4FYDA 2UUTA 5E41A 1VK0A 1RILA 4ZVFA 2WONB 3Q8RB 2GIQA 2HHUA 3GIJA 4CJLA 1KHWA 3HSTB 3GIKA 4EP5A 3QIPA 1NNDA 5KFMA 3OS1A 1NK0A 3H5XA 1JLGB 4TQSA 4WE1A 3L3UA 4TY8B 5KGWA 4I2PB 3PR5B 1KLNA 4MK9A 4M41A 4IFVA 4ELTA 4KB7A 1IKXB 1IKVA 5KFIA 1JL1A 1VRUB 5KT6A 3AVLA 1KCFA 3TAMB 4PWDB 2ALZA 3NMAA 3L2WA 4B3OA 4XPCA 4OLAA 1BQNA 5C25A 3NAHA 3DM2A 1N6QB 4TSXA 3QINA 1QSSA 4G3IA 2OPRA 4H4MB 2QKBA 1YTAA 5KG1A 1JXBA 1BHLA 3TI0A 4IG0A 3H4BA 3HVAA 3RB0A 3TANA 3PW2A 1S1WB 1TKXA 1J53A 1HQEB 4URSA 1IO2A 2UUWA 3M8QB 1TKTA 4TXSA 2A1RA 4GW6A 1KFSA 1EETB 3DOKA 1NOZA 1SH0A 5FDLA 3AV9A 4FLVA 3HKWA 1T03A 2OYQA 3KLEB 1J5OA 3SQ1A 2PYJA 1IH7A 3H5UA 1HNVA 4I2QA 3D45A 2AQ4A 3HJFA 5J1EB 4X2BA 4FK2A 5EWFA 3KKRA 3KK2B 4OKKA 3DLKB 4KSEB 5JUMA 3NGDA 3KLIB 3M8SA 4Z0UA 4Y1DA 4ED0A 5KFSA 5K14B 4QOZB 2W9BB
chains in the Genus database with same CATH superfamily
3HVTA 3B54A 2KJWA 2KO1A 1HA1A 3UI3A 1JLAA 4NXNJ 3DGPA 3A8YA 3OR1A 4LR9A 3ASMA 3KLHB 1IJEB 3D2FB 3AVMA 1VQSA 3PUFA 4U7UD 2OEJA 1OH7A 1S49A 4OHVA 3UVJA 2P9EA 1XR6A 3C19A 4OYWA 2MSSA 3H59A 4DCPB 1C1BB 4AILC 4FPIA 4U7CA 4NYNA 3S8SA 1RWPB 4A2BA 4Q45A 2HBRB 3VQAA 3PXGa 1Y00A 2F5GA 4LR8A 3IRXA 4FLXA 1U48A 1JJCB 1ZM4A 2WTFA 1KVBA 1U1MA 1GK8A 3OYIA 3J81O 2ATCB 4FBTA 3SBMA 4C8ZA 3ETOA 4BY9C 3SBTA 3KWGA 1QE1A 1QVFM 5KFWA 1N36J 3I5CA 1OMSA 1GLAG 1CSJA 4PA1A 4FJMA 3WEEA 4LVOP 4YB1P 4K25A 2YNIA 4V19S 4K4VA 2PY5A 2XYHB 1H2VZ 5CYQB 1X4FA 2IDOA 5I3UA 1YBUA 2O66A 2IM0A 2GA7A 3UNGC 4A57A 3QQCD 4JUZA 1OPZA 4P2XA 3K9KA 3ONQA 2FY1A 5B0DA 1RDUA 2YWEA 2HZCA 2E5HA 4F67A 5H9FJ 4K4WA 2AF6A 3DXMA 4NYFA 3PZPA 1A5VA 5DETA 2QYGA 3EXCX 3W8PA 3L2VA 1V5VA 4RNOA 1ULRA 5HMXA 2BJ7A 3I0SA 4ZS6A 5M1FA 3IWNC 4ZLNA 4LY7A 2QX0A 2DHAA 2JX2A 4RBUA 2L41A 3Q8UA 5KFCA 3A3OB 4QQBA 3W66A 3VTIA 5EX3A 4O4GB 4OQJA 1HLWA 1NDCA 2K1RA 2ZH8A 2WZ1A 4FP9A 2Y9HA 3SSQA 4CTAB 1MW7A 1UMJA 1VC6A 1GFWB 4ZVOB 3A5NC 2UP1A 3BPSP 5CXTA 3JAMU 3J80U 1UVKA 1T9YA 3GZ7A 4JI0F 4AQYK 4DSLA 1QZ5A 3NDKA 4YFUA 2D0AA 2HWIA 1N5VA 1K8KB 1S4EA 3NH1A 2V8VA 2W01A 4CIGA 2NUBA 5DS7A 4X4VA 4RZRA 2D69A 3EZ5A 2NNWA 2ZVSA 2W7OA 4KFBA 2KVIA 3RBXA 4BDYA 2UU9J 3I56S 2QL9B 1SKUB 2LQBA 3V6DA 2FC8A 4FSVA 4EZ6A 2DNMA 5DDPC 3QT8A 2QWRA 3L9ZA 2EEYA 3VF0B 1ZM3A 4KV8A 2QRRA 4YEAA 2HHHJ 1TL3B 4ZCKA 3OYCA 1TKZB 2I7NA 2KRRA 1TK0A 3ZLJA 1RA6A 5F2RA 4DL0C 2J6SA 2XLIA 3BZQA 1AZSA 1FDNA 4X66J 3MXHP 4XH4A 5BPLA 3D7EO 3H90A 1YJRA 4QZVB 4IRKA 2P9PA 2ROGA 3E51A 2ACYA 2DO0A 3FSXA 2J8SA 3LTOA 4CF8A 4NLCA 1RBVA 4DZ6A 1WC4A 2HHHF 3MCAB 1WUUA 1Y5LB 3QFUA 5BYRA 2VQEK 3OS2A 2MDAA 2ZQBA 4R5PB 2FBXA 4IXCA 2OD4A 4MT1A 3A13A 3E9OA 4HTLA 1P90A 3CCMS 4B3RJ 4YNQA 3E1YA 1FJGF 4JBCA 1X3NA 1QS4A 1ZPWX 4W5OA 4FJGA 1TZ0A 1RAJA 2EX3A 4WJBA 3M8RA 4DF8A 4NXMF 2E2NA 2NZCA 1JJHA 1O0PA 1CZAN 3MWTA 2VPYB 2KQ2A 4IDKA 1RLDA 1WELA 3Q86A 1QAJA 3R6GB 3DDNA 1F0XA 3KDOA 2HW3A 4M63C 4M94A 3JTNA 4ED2A 1UAWA 3UE2A 4CLFA 3EDQB 4LRDA 1NZAA 4OI2A 4IWVA 2F9TA 1NM2A 3ZZRA 2FZCB 1C2PA 2JFDA 3NCRA 1UA1A 2A1SA 4PQUA 5IT0A 1KD1O 4ANCA 3FK4A 1T9UA 4RW4A 4IO1A 2M8DB 3C95A 3CCLN 3EICA 3ITHB 3L3CA 1KTQA 4W4MA 5LMNF 3UFCX 3D6FB 1HNWF 4WIQA 1R8PA 4BWMA 5KFKA 4OZ0A 3DRSB 3LH2S 1XC9A 3DLHA 4FXWA 4M5DA 4X65F 3R8EA 2Q3SA 3BV8A 2ZGZA 1YRXA 3FCWA 3JQKA 5AQTA 3UDLA 4JK8A 5CY4A 1NDKA 2EKYA 3VTHA 1T0TV 2HWTA 5HAOA 2DY9A 3IAM9 1LAWA 3I5AA 3TARA 2GJIA 2HMIA 3E9LA 3R7NB 4O8UA 4CQ1A 3SQGA 4NCAA 3CCSS 5MLCQ 3S7RA 3AFGA 4BC3A 2C3MA 1LKZA 2FUG9 2IMWP 4U95A 4EGLA 4PUOB 2FQQB 3H98A 4ZVHA 1NLVA 4FLZA 2E7VA 2XM3A 3DC2A 4QS9A 1IQZA 5CCLA 3ZX0A 3MN6A 4Q8FA 3BN7A 1URNA 4YY3K 4OX9F 3H08A 4DTNA 1YJWN 1MU2A 1R31A 3CIMA 4G6VB 2QWLA 4QBUA 1LW0B 2FVCA 4KPYA 2P9LA 4A5AA 3CCRN 3LALA 2F65A 2Q66A 1I1GA 3N6LA 1SBRA 2B43A 4FZVA 5CHIA 3HJVA 4JB8B 1S9EB 2GWKA 4NE9C 4OJHA 2ASDA 3AVJA 4AF1A 1LWFB 2K7JA 3KHYA 4DBQA 4CJ5A 4A61A 4FJ5A 4JP8A 2FZKB 2V9WA 3JSYA 4NWBA 3SI8A 2UZAA 3HYFA 4CJKA 4K8XA 2YKNB 1UL3A 1Y10A 4F3QA 3D66A 4TLRA 1RUSA 4NCBA 1LWXA 3FZHA 4BRCA 3E8OA 4MAKA 2WAQD 3VAJA 3CM5A 3MPUB 2JZ5A 3ZEUB 3O2IA 2WB4A 3I31A 2RQCA 3KDNA 4BACA 3HHKA 1RAEB 3BM7A 4NA1A 3MM7A 1T03B 5KFDA 4JI0K 3BBBA 2DXFA 4CK2A 4FJKA 4CZJA 4DV2F 3EO3A 1S48A 2XC9A 1IQTA 4AXJA 1VSDA 1NHUA 2XSJB 3BH7B 2ZZTA 5KOWA 4I2PA 3I33A 2GMHA 1TV6B 3VPZA 1CS4A 1YRTA 4JI4K 1MN9A 2IIHA 2IVYA 1VRUA 2FHJA 2JDJA 1TL4A 1EXQA 4YOTA 4I1TA 1ZETA 4LFBJ 3FUYA 1PGZA 3MAAA 1M1HA 2RRAA 2QMUB 2YX6A 3K5PA 2HHPA 2IM1A 1KOOA 4Z4HA 5F0XA 3CG7A 1H7WA 2G4BA 3OTOF 5CD4A 3BKTA 3CGIA 1S1WA 5AZIA 4WYLA 1HQEA 1F5CA 2R8HA 3NL0A 1NLKL 3NF8A 2DGUA 4BC2A 2R9LA 2H54B 2IM3A 3MMCB 3KLEA 4J37A 2NRRA 2EG2A 3R5GA 1OVYA 3UCGA 5EX0A 2JNJA 3L3VA 5DG8A 2R3VA 3OVAA 2QI2A 4HI2A 3AVGA 2ZH3A 2J0XA 2E9TA 5GAHU 1WSHA 3TR8A 2QK9A 3KLIA 4WPAA 5D4OA 3J7YU 5T14A 2OFHX 3LUYA 3IAYA 2RPIA 3IGNA 1NGEA 2R2RA 2ZBQA 3L2RA 4RWTA 1N0UA 2XMJA 3GCWP 4C48A 2QW9A 4YDXA 2KN4A 5KFFA 3D2WA 3T1AA 2FHJD 3I0RA 3MM5B 1M90O 3IO1A 1MROB 3HSGA 1YKWA 1RTHA 2D74B 5IT4A 1UZDA 4J9NA 2YNGA 3V9ZA 2VG7B 2RB7A 4CLTA 4E0DA 3VQ8A 3TABA 4F02A 3NLCA 1NK9A 2EKNA 3RRKA 5C24A 4H0PA 1NSKL 1IR2A 3OW2M 3T9NA 2HQGA 5AQWA 5LMNK 4LF4J 2KW4A 1QUPA 1KQSM 1PBAA 3N01A 3TRGA 3VQCA 4LBIA 1RAGB 3R5JB 4YDDB 2CZ4A 4I0WA 1QY7A 2Z4PA 3TAEA 6FDRA 1RWNB 3AVIA 1DURA 2B9YA 3H25A 2Z1IA 1RHUB 4HL9A 3NS5A 3L95X 5F0UA 3RRHA 1PAUB 2FF3B 1B0VA 2JRSA 4YMEA 2VV5A 2BE2B 1RTIB 3F56A 4LF5F 5KFAA 2ZE2B 1OJ4A 4ZVGA 2N82B 2C2DA 4PG4A 3AARA 4CF1A 4USVA 4NLQA 5KPTA 1VC5A 2R7UA 2Q97A 1HYSA 4IFYB 1XEZA 3TJ8A 4MIWA 1I94J 2I5JB 3TSUA 2O8BA 4AH9A 4LFAF 4X4UA 3H5SA 4O44B 3I4HX 6FD1A 5T41A 3GV8B 2HFUA 1SCJB 3FGVA 1V4SA 5HMZA 3GPAA 2E20A 1VRQC 3U8XA 1CJUB 2POKA 1T6DA 3IUCA 1I94F 1YTUA 1F60B 4QU7A 2HVIA 4ED7A 1EHWA 3OYNA 4LH4A 5CAAA 1BCMA 2GAGC 3AVHA 3MDQA 4EBCA 3CJ5A 5IQ6A 2XMMA 3WX8A 2B4PA 2HNYA 5LT5A 1QD1A 2B3TB 3D4JA 1U7LA 3B78A 5BPNA 4CT8A 2JH3A 4CM2A 3QZ8A 3IBFB 2XY8A 4QR1A 1KAXA 4J2EA 4OO1J 3FQKA 2GW8A 3FDSA 4I64A 1WG5A 2MLYA 1ITGA 3HOTA 3EJMA 2H1YA 3O4QA 4UUWA 2YKMA 1SV5B 3H4DA 3MPVA 2ZH1A 4AHSA 3VEXA 4UY8O 2UXBK 3CDEA 3ZZ0A 4PWWA 1JB0C 1VS3A 4WXWA 4CP5A 2ZWHA 4HDGA 1WBDA 4NCGB 2R2TA 2WVCA 4KHUA 3RSEB 4G1QB 1S6PA 4CJ3A 4DV2K 5GINA 1N54B 1F9FA 3HKZD 2CJXB 2QO3A 1S0VA 3BP8A 4DUYK 4DV7F 2DNZA 1VQ4N 1P6TA 5IV3A 2V67A 1CBKA 2FPHX 5J2QA 5AZJB 2IRUA 4DR3K 1KLMB 3I5BA 4X64J 1HKBA 2ZD1A 1S76D 4BC4A 3SMZA 1S1UB 4JI8J 3QEPA 4QPTA 1YZ6A 3DDKA 2V94A 4DSFA 1WF1A 4DV4F 3BEXA 3TSQA 2V50A 1SQEA 3UCZP 3DYAB 5G0RB 3SUOA 1MMNA 3JQJA 3T5LA 3GG1A 3M2VA 1L5UA 3OTOK 4K4SA 4X64F 5L1IA 1VQOS 5JICA 3NMRA 2E5LF 1ELOA 4N47A 1SL2A 2UVWA 1R3NA 1S99A 4G1PA 1Q9YA 3VQQA 3OYKA 4CF2A 3IR7B 5EVZA 4J9LA 3WQPA 4DQPA 4PPDA 3NS7B 2D1KA 3FR0A 3TA2A 4EP4A 4F4KA 2KH9A 3R2DJ 5BJRA 2MHNA 4NOHA 2WTUA 3F44A 3BO3A 3NAIA 2A41A 2Q1NA 2Q36A 3KUEA 1VK3A 1RE1B 3MN5A 2I1RA 1GMWD 3AB4B 4Y0FA 5ETMA 1ILYA 3JSMA 3HHLA 4CF0A 1IBMK 4B3TF 4DV6K 1N0VC 3AO4A 1ZXOA 5KFLA 2DXEA 2P9GA 2OJ3A 5D0EA 2Y8YA 2QIFA 4KI4A 1F3VA 4LRBA 2HLUA 4H03B 5D0RA 3OR2B 1HWKA 4JV5J 4KPCA 3QSYB 2OPSB 2QJ3A 3IGVA 2B5JA 1HNIB 1RJJA 4NLUA 2EFVA 1DAXA 3LWLA 3AJDA 2XGPA 3T7ZA 4OPAA 4BHQA 3BGRA 3SCIE 5BR9A 2E88A 3DRRA 2P5VA 4ZPAA 4DPTA 3N5FA 4HH1A 1FXLA 1ZBUA 3KTQA 1WLJA 5LXRA 4X4NA 1U2VB 3CPWM 3NP5A 3C2PA 3ZZOA 2KHCA 1VSMA 3D68A 3RRGA 2PN6A 4QIFA 4R25A 3TOQA 2KI2A 1FJEB 2XG8A 3M32A 3VZIA 4O3RA 1H0HB 3PJXA 1RTDB 5KOXA 4B02A 4FWPA 2QLBB 4YOUA 3VMFB 4HWIA 3NNHA 5C2CA 5AFUA 2KM8C 4OLPA 4KHNA 4PR6A 2ZHAA 2DR9A 1UVMA 3ZNJ1 4A8QA 5KT7A 4OI0A 2D0PA 4C97A 1BQNB 3CCWA 3K9JA 2AIRB 2KYZA 3OXFA 5HRNA 4FXVA 1FTCA 2DGWA 3AVNA 3PRDA 1HRHA 2VQEJ 3ZT4A 4CEFA 3Q83A 3UD3P 4UUXA 1SC3B 2HNDB 2L48A 1RKJA 2F4FA 2GC8A 1WWHA 2LU2A 1TKXB 5LSRA 1AT1B 3Q22A 1BISA 2Q31A 4KGVB 4CGJA 1D9DA 3AD8C 3DOKB 3CC2S 4FK4A 2RKIA 3SQ2A 2JGUA 3SYZA 2H5IB 1FWLA 4CGIA 5IFMA 1IBLF 1OIAA 1JMTA 3PX6A 3VZHA 3MOJB 4CIOA 1XK8A 2F40A 2GWJA 4K4YA 3KIOA 3G2XA 4D3HA 2MMYA 4DL6A 2CXEA 3E66A 3H2VE 4XH1A 2GAHC 1WEYA 3PKYA 1BO5O 3V1QA 4J91A 5FD1A 3SSRA 4ECZA 2V68A 2HHTA 4QIEA 3FRYA 3VEYA 4ISEA 1SKRA 1NH8A 5KQ8A 2HFZA 3IFEA 2MGZA 3M1VA 1FRLA 3NE6A 1EETA 1HI8A 4K59A 3CQYA 2F7VA 3H42A 1NSPA 1U04A 1DTQA 4ECWA 4F4YA 4DG1A 1N5YB 1CJTA 4DV7K 2Z1JA 4F4ZA 1YITS 3BKUA 1LOUA 2CPHA 2VG5B 1MWZA 4HDHA 3DLKA 1VCTA 1LWCA 2GUIA 3R97A 2NQPA 2W6KA 4KGXB 4K41A 1CG2A 2BW2A 2DEJA 2ILZA 3VF4A 1CLQA 4EFAC 4BE0A 4BRDA 2W25A 3RUBL 4RU2A 3AXKA 4DV4K 2JEIA 3AVBA 2X3DA 3KLHA 2Q2RA 4P9SA 3UD5A 4DFJA 1YJ9S 4C7QA 4L3QA 5GAGU 4YY3J 2N7YA 4F0KA 4MO4A 2P5OA 2KXFA 3TZYA 1WI8A 2R8IA 4Z4FA 2R8KA 3JQMA 3DI6B 3HVWA 3T1YF 3VVUA 3WQUA 2P6TA 3UN2A 4CZEA 2IJFA 3W5XA 5DLFA 4B9MA 4A8MP 4LSLA 2VH7A 4KRFA 3VQTA 3T5KA 3W1YC 2XNQA 1L3KA 4DTMA 2HZVA 2FSJA 2MQLA 4LF9F 2V52B 2FVPA 2MY8A 1VQ8S 2RDJA 4B08A 3PKMA 3VAFA 3CMAN 1FNMA 4RNMA 1ASVA 4AHTA 5AQMA 1FW6A 4KRWA 4JKDA 2M70A 3BSOA 1SVDA 2BKNA 3PRVA 1GLEG 3VGMA 4ECRA 1GMUA 1OVQA 1WDTA 4C0BA 4NZ0A 1JKHB 1F9EB 2XCPA 1NOYA 3MR7A 4FF2A 3CJ1A 4RW8B 3QETA 3TA1A 1RI7A 4AHRA 2RN2A 4DFPA 1KVKA 4DQRA 3NAEA 2DGSA 1IV0A 4OPHA 5DZ6A 2HIQA 2AJ4A 4JI4J 5F8GA 2JEFA 4QR2A 3UKRB 3ZTQA 2K06A 4E1MA 2MZTA 1YX2A 1NK5A 4AXIA 1BXNA 4ECVA 2CADA 4DEZA 1Y64A 2XYPB 1HWIA 1T9WA 3H1VX 3AXMA 3SEOA 4I9LA 4BE2A 3GJQB 4CH7A 3NKYA 1VQ5N 4FVMA 5GAHI 1X9JA 1NXIA 2CQBA 4O4GA 1YIJN 3J7YI 1NRKA 2AEFA 3GONA 1TL5A 4NI2B 2IVMA 3OHBA 2O8CB 2BR0A 4M3TA 2O01C 4WP3A 3W2VA 1RBTA 1UP1A 1HPZB 4WYWA 1CXUA 1YDLA 5CHCB 3VAIA 2B6AB 2V4JB 3THXA 1OY8A 3CCUN 5GAEU 3P5JA 1RAOA 3TAFA 5KFHA 4CFBA 5K8PA 2O3DA 1YVNA 2JC0A 1S79A 1W9HA 4I56A 3MECA 3A1YG 2C28A 2G13A 2EC0A 4DLGA 4AT1B 3KFWX 2OD6A 2F8TA 1RBAA 3RB6A 2HGLA 3DAWA 1ROFA 1IBKK 2UUAK 2E1CA 1FO1A 4M5KA 2YQ3A 4L74A 4JKGB 2CPDA 3EXYA 2QWMA 4IO9L 1BCOA 1TKZA 3GJSB 4ID1A 2WBMA 1VGYA 1LK5A 1RADB 5DGBA 1SIZA 3A5OC 2CDRB 1S9FA 3DRPA 4J9OA 3MI7X 2AGQA 2PI4A 1FRXA 2A18A 4NA3A 4LF8J 4CJVA 1Q86T 1U0HA 4YDUC 1FXXA 2GVZB 2HMPA 5J1PA 4DR1K 1FD2A 5H9EJ 3M2RB 4CO5A 4A5BA 3T6JA 2G1HA 1VSLA 3HPHA 1RT1A 4R5PA 3W5YA 3MCOA 2DNPA 3O3GA 3MR3A 1R43A 1EP4B 4N7TA 1BQMA 5DG9A 4KBOA 3AA8A 4P72A 4DR2J 4F2RA 2D41A 1WOQA 3MMJA 3MX5A 3GP9A 2WC9A 4L73A 4F4WA 4Z4EA 2WCXA 1W25A 1FRKA 1ZPVA 2VBWA 3K57A 1KR4A 3LQVA 2HRUA 4FWLA 4JKBA 5J2MA 1JJ2R 2JHEA 1M5SA 1A9NB 3OBIA 1VSIA 5AQXA 2Q79A 2DT9A 5IT9O 4EIAA 3IG1A 3O9SA 4DR7F 2KHOA 3V9UA 3EUNA 3QGPA 2FJBB 4DTUA 2F8SA 2J0WA 2RILA 4FF1A 1ZTWA 2DGTA 2VBXA 3LGMA 1PJ6A 3MMVA 2ZUGA 3R5BA 2Z58B 5ETTA 2FF6A 5DM7L 3VQEA 5D3GA 1VI7A 1C0UA 4IUFA 3NFAA 1HW9A 5HQLA 2J9DA 3I32A 4GO7X 4QW9A 3VQ9A 4KY3A 4LQ3A 4J9UE 4FW2A 5CCMA 2BH1A 1JNZB 2Z2ZA 3KK3B 2RUSA 4IOAQ 2QWOA 4LF9K 1UPPA 3UKUA 3QFHA 2BQRA 1NKEA 2LKZA 1Q78A 5LJ3Y 2VOOA 2KLAA 2DNGA 5A8KB 4LQ9A 4QIVA 1YJNS 3QT5A 1JIHA 4PL8A 4QS8A 4ILRA 3U6FA 3AO2A 5AE3A 4WFAQ 4URGA 2J7UA 2HBJA 4O3PA 3JYTA 2NZ4A 1VHFA 2XMAA 2UXBJ 4B17A 4AE5A 2K8GA 3MXIA 4FYDA 1VK0A 1SPBP 3SJHA 1VQYA 3CCQS 4FL9A 2HHUA 1NGAA 4OYXA 4I6MB 1HWUA 1VHXA 4DUYJ 3HSTB 1HD1A 3GIKA 4EP5A 3CC4S 1JLGB 4TQSA 1H6KX 3PR5B 1KLNA 2XHWA 4M41A 4DR3J 4M5HA 3R5AA 5KQDA 3UR3C 3T1HJ 1IKVA 5GADP 4DV0F 4PG5A 3AVLA 3H46O 4L3KA 3NMAA 1PSDA 3L2WA 1UCNA 4XPCA 2XMUA 4OLAA 3U27A 2FJDB 2E1RA 3QINA 1ZH5A 3WC2A 3C66A 2OPRA 3HLUA 4Y28C 5B8HA 1YTAA 5KG1A 3TI0A 2O8EA 4WQ4C 4EAHD 3GE9A 3KG0A 4URSA 1IO2A 4WP8A 4HTIA 4TXSA 1XC3A 3KJFB 3CCJN 3CF5Q 2IYIA 3HCXA 4I4BA 5FDLA 1NSAA 3HKWA 1T03A 1K8AT 1W2BR 4BR2A 4P6QA 2D9PA 3OFFA 2D3OR 1ATSA 4DPWA 1U2CA 3HJFA 4X2BA 3O3LA 2WSEC 2IJRA 4Z0UA 4ED0A 4QOZB 2ASJA 1IBMJ 3NVKA 2HQDA 4RW9A 4KYZA 1X4AA 3ILLA 2JWLA 2VA2A 2AV5A 4RNNA 3LP0B 2VHGA 3U4LA 4QS7A 3N5BA 4ATNA 4DV5F 3SCLE 4KTZA 4X4OA 1R0BG 3VVTA 3LPUA 1HJRA 2G8UA 4CLWA 1X31C 1RHJB 2VCPA 5SUHA 1VBYA 3PRBA 4LSZB 4BLGA 3LDSA 1DQ9A 3HHLC 3FFKB 2L3MA 1B7YB 4ZHRA 3NF6A 1ZBHA 2XZDB 4QAGA 3H7HB 2YBVA 5D4PA 1Y97A 4O5BA 3GJRB 1YHQN 3DDIA 2YKAA 5J1NA 4F9OA 3R1XA 2FBVA 3OLAA 3RW7A 2KG1A 4P10A 1NGFA 3G8QA 3RAQA 4PRFA 5AT1B 2V8DA 1FRIA 4FXDA 2C3PA 4F3MA 2G8VA 2B9EA 3KKSA 1PYOB 2VFTA 4A8YA 3VENA 5KFBA 4Y1CA 1Q79A 4FYYB 5AQSA 1SUQA 4A47A 3NGSA 3AT1B 1JCEA 1NGDA 3H6EA 5F8HA 3BN4A 4PZVA 3OA9A 2QXFA 3PV8A 4CZGA 1HQUA 3FBBA 8RUCA 4F36A 4Y6IA 4DR7K 4BR5A 3THYB 3L7UA 2HBLA 3LGNA 4U7BA 4PQAA 1VQLN 3HI9A 4QJVA 3I82A 4UTGA 4LF7J 2CQ1A 3BGOP 4PYAA 4NMXA 4OZ1A 2HS0A 1CVJA 2OCEA 4DPOA 3JSBA 4DV3K 1X0PA 1S7HA 1SQGA 4ZCLA 1RDBA 2QV6A 2MLZA 1FKOB 5HRSA 3KLGA 2AX0A 4C0OC 2YWFA 2VFRA 1NK8A 5HJYA 4M5MA 2VG6B 1VQKN 4AHUA 2VD3A 1JXEA 4ICLB 4RUCA 3H20A 4JV1A 1LXJA 1T05A 2RH3A 2V5HG 1HNXF 2C3YA 1RTIA 1KP6A 1YI2N 1LEOA 3G8SA 4WFAL 4DOZA 3BF4A 2MZRA 1EKSA 2AD9A 4B3SJ 4Y2KA 4UW2A 5KG2A 3ULHA 3QB0A 1W7AA 1E6YB 4IFYA 4KIAA 2NUHA 4XDDA 2YJEA 1TMJA 1UA0A 4FOEA 1F21A 2B9WA 3OFEA 4FK0A 3C7NB 4NO7A 4DX7A 3D0PA 3TQ1A 1K9MT 1GXTA 2IC3A 4EK2A 1QHAA 5LMUF 5GAGI 3O8WA 2OP5A 2RT3A 4ZN1A 1CJUA 1ZA1B 2HGMA 2MSTA 4NLBA 4M5GA 2J4RA 3SQ0A 5CYMB 4JYAF 1R8AA 2I8EA 3ENHA 2PD1A 3VQ4A 2QEXN 4J9KA 2KVQE 2BM1A 2C2ZB 1JLBA 3SMPA 4DTSA 4JI6J 3EMTA 1T9VA 3MCNA 2XGQA 2W4DA 5EGYA 1HMVB 1YWXA 1U2FA 2AX1A 1RBUA 3J7AN 5HMYA 4Q0BA 3SDEA 1JK9B 1D9AA 1S4FA 3S01A 2MPUA 5KFJA 5IM0A 5DGAA 1FXDA 3PYGA 3IP0A 1T02A 4EUVA 3G6ES 5L1LA 1S1TA 3MK6A 4IH7A 3O3FA 1XHZA 3G6XA 1U4BA 4ZJOA 3DHXA 2MQOA 2BMBA 2BGGA 1RT7A 2FJAB 4UZBA 5DM6Q 3CQXA 4GKJJ 2AJQA 2RDIA 3CETA 1VLOA 3LDNA 4E2FB 2ILYA 5J2NB 3D3CJ 2KFZA 1KVAA 2LMIA 1N34K 1S6QB 4LFCF 2MKCA 2B4UA 1T95A 4JI2K 4LF6K 1B0PA 5L1JA 1ZTTA 3ET6A 4XAKA 4FYXB 4OI4A 2FLLA 3HDSA 3MUVP 3RMBA 1R0AB 1GNKA 1NCLA 2F4VF 1X4GA 4DJBA 3UDVA 5AQHA 5E5NA 1DJ0A 2ZNYA 3NGUA 1NJWA 3A5LC 3DYAA 1B4SA 4CLUA 4ZPVR 2ASOA 4DV5K 3BGUA 1LQ9A 3GYGA 5HQMA 1VMBA 2OTJS 4F0HA 2IVNA 5BXIA 4YOWA 5T7LB 4E8UA 1WKLA 2LECA 3CPEA 4C11B 3BEGB 2XI3A 4DZDA 4IKFA 5A0YA 3CJBA 2R7TA 2I38A 2HB5A 4K4ZA 1M5VC 4WCEL 1YXQA 4FLYA 2CJYB 4B1XB 1R6VA 4IQMA 1G7CB 4ZVRB 4ZVTB 1Y3JA 3ZT2A 2FTRA 1BUXA 4KGMA 4A46A 2WW8A 4O4RA 1BIUA 3D6RA 2Z2LA 1LFWA 2MB0B 3NF9A 5GAEI 3EY1A 3BH6B 1REVB 3SMSA 3G4SN 3M1FA 2GZOA 1OY9A 4DPXA 3IAS9 4KH0B 1NK7A 3SPYA 2FC9A 3KJQB 2DK2A 3GWCA 3ZZUA 4E7HA 4KGKA 3ZSWA 2BYCA 3L4BC 2CJKA 3D6MB 2OPSA 4OX8A 4DR4J 3OYJA 2H5JB 3CJCA 2PEBA 1UKUA 4FWOA 3G96A 5A8RA 2J5AA 3D54A 3I8BA 4JI5F 4FJHA 5ELZA 3ULDA 1GLCG 2HFNA 4O0IA 1OH6A 3CM6A 3AA4A 2N3OA 2QWPA 3RMCA 1QTMA 3FBFA 1YSJA 3CE8A 5KFTA 2WFBA 3T6BA 1U2VA 3ISZA 3QIOA 1TP7A 3P5TL 4HVJA 1IBKJ 2UUAJ 4DR4F 4UOFA 3VAHA 4JI1F 4J7CA 5EY4A 2E7WA 1FX4A 1N33J 2VODA 4CLKA 5U47A 3MD3A 3UN3A 1U24A 2KTQA 4EHUA 2QKKA 1RTDA 5ADXA 4K4XA 3CJ8A 2UYTA 1L3SA 4TNOA 4X4RA 3BYPA 5EHHA 5LSOA 1HNXK 4ANEA 3HRGA 3V4IA 3NOCA 3KLVA 2HQFA 4OLBA 3SJJA 4TQRA 2ZNZA 2Q0RA 5BR8K 2XO7A 4CEAA 1N33F 1HKGA 4DR1J 4BRHA 2M7SA 2O5DA 3QJJA 5L9XA 1HNVB 2HNDA 2G1DA 4W5NA 1YLXA 2KXHA 4WF9L 4USUA 4BDPA 3THWA 1CULB 2QA2A 5AQGA 2OZMA 4M95A 2DRDA 2P9CA 2ZKTA 5C2GA 3UB5A 4QYZJ 4K0KJ 3OYGA 3V9SA 3O3HA 4JV2A 2YVSA 5IXUA 1KEKA 5LMUK 2HG4A 3GIMA 1XNQF 3TAMA 2MKYA 4PWDA 1X3MA 3I96A 1D4XA 3QRRA 2L9WA 4JYAK 2LU1A 1N6QA 1QLNA 2B4JA 1VQ6N 2UXCJ 3GYXB 3SV3A 2NSCA 4N76A 4CJ7A 4K0KF 3E01B 3R9LA 3GIIA 4R79A 5E3AA 4OYPA 1IWAA 5BRDA 4H5NA 4RUHA 4HVZA 2H65B 2IFXA 2RS8A 1QUVA 2HF3A 3FFIB 1FTRA 2B7CB 2MZQA 4JHDA 4DTRA 3P45B 2CJAA 5DM6L 5J1EA 2UVRA 4FJLA 2GUPA 3CD5A 3TZXA 1F5AA 4GKKF 1HNZF 4FS2A 3J8AA 3O4WA 1RT5B 4RTFD 5ETQA 3CC7N 2Q6BA 2NRXA 1G2EA 4NL5A 3ENVA 2Y0BB 2ASLA 2OEMA 2HNZA 4WZMA 1C0TB 5C42B 2DH8A 3AY0A 1O13A 2I2YA 2D0BA 2YNHA 2OSQA 4LFCK 1SC1B 3NCPA 2LXFA 3ZX2A 3D9BA 3LP2B 2YCHA 3DNCA 2P1JA 4XDCA 1UVLA 3PW4A 2EXUA 1TMMA 3GB0A 1HYVA 3J7Z5 2HSEB 5BN9A 2X74A 1OY6A 2HYIB 2F4VK 4O5FA 4DHYA 3M8PB 4ECUA 1FK9B 1F2GA 3HPOA 2DITA 4R0JA 2E44A 2IRYA 5HL7Q 2UUBJ 5J2PA 2ALYB 3MURP 3IS9A 1DTTA 2A10A 1EAYC 3AH6A 1QQOA 1TVRA 2Z1GA 1CJVB 1XN9A 2DR8A 4CLZA 4PYDA 1HR0J 5FLXU 3DLEA 1Q18A 1AYEA 1PYTA 1SJRA 1T3NA 2JFKA 4JI7F 2JLEA 4BC7A 2YHAA 5KI6A 3HP6A 1EWRA 2UUBF 3IR5B 4U8VA 5LL6Z 3CCVN 2CWKA 4CJSA 2QA4N 1YBAA 3C6UB 4KHMA 3BO4A 2QFJA 1XNRK 1HR0F 2Z57B 1JLEA 4MDBA 4ED6A 2V8HA 3WNGA 2WOMA 4J90A 3EVMA 5M2PA 2EFQA 4F8RA 3PM9A 1PCAA 3OBWA 1QQCA 5A6WA 4HUEA 2ROPA 2BABA 3DKDA 5FLXO 3SUNA 4DU3A 2P9SB 2XMKA 3DLLQ 5LSLA 2E4LA 2B4OA 1Z25A 4CHNA 1JLQB 1IG8A 1P1TA 5E26A 5BPMA 3KJVB 3C6HA 3NGZA 2G8IA 4YR3A 2YJFA 1UWAA 4B3MJ 1FCAA 3MEGB 3RVCA 3Q8QB 1S3XA 3UKRA 3A12A 1E6VB 1T7PA 5KPZA 1QVFR 4PHTX 4MLEA 4A2AA 2LEBA 3MM6B 4A8KA 3OSNA 4CYUB 4JI1K 2VZ9A 5KFPA 5AQLA 3RMDA 5IC6B 3KLFA 1XMOJ 3ZT0A 2GO8A 2JEJA 2DCLA 1NGHA 4JNEA 4TU7A 4R8UB 1HBMA 2VIHA 4ECXA 2O8FA 5EOYA 1VQ7N 1LV5A 2VFSA 3G8TA 3B6OA 1RHRB 4OMFG 5HJXA 3UW1A 4W5RA 2IVFB 3HP9A 2YKPA 2QGFB 1UFKA 1N32F 3P1GA 2HFVA 4WU2A 5AJ3J 2RF2A 1SC6A 4ZITA 2DY1A 1SAZA 3MPYA 1L3VA 3QPIA 3RR7A 2XYGB 4PY5A 5KFQA 2OO4A 3RZAA 2V7YA 3B8HA 1XBWA 3KOAA 3WBZA 4BR9A 1NZ8A 5JS2A 3EL2A 2X6SA 1BD6A 3CNQP 1XNQK 2BANA 4HI1A 3Q2SC 5AJ3F 2H3EB 3FEZA 4KI6A 4HCBA 3Q23A 3DOLA 4AYBD 2CNOB 2IPOB 2DY4A 2YHWA 2W9CA 4HHTA 1X4CA 3ENBA 3AA9A 2OPPA 2NXUA 4IOXA 1IWGA 3QICA 4WFBL 5IS2A 3TA0A 2ZM6F 3KMQA 1XR5A 3BS9A 4TVAB 3AO5A 5I42A 3VF6A 1EJ7L 1WF2A 2VB6A 3NBPB 1RT2A 2R8JA 2G2OA 4CJEA 5GVQA 3U7JA 4YN3B 4M3UA 4DV3J 3FZBA 1T3OA 3DLGB 3M2RA 1BC6A 5HO4A 3KK1A 4PKIA 1TUYA 1Z6RA 4L72B 2OFGX 1KFDA 1TYQB 1VBKA 2IA0A 1IJJA 1CZ9A 1WG4A 2CZVC 1RDAA 1FEEA 5E3PA 4DCHA 3SPZA 3GTYX 4DPYA 2AEMA 3S3NA 2CVEA 3CD6N 3DLJA 3NRBA 3FZ2A 1DT9A 1HBUB 4BDZA 3KHHA 1ZBTA 1EIYB 5HSPA 5HL7L 2J8AA 4W5TA 1ZOTA 4KAIA 1V3RA 2CDQA 3CEDA 1RBSA 1EWQA 5HK4A 4JKAA 3TTDA 4CHYA 4HACB 4DTOA 3ZTSA 4FNIA 1BOTO 1D0EA 1QQNA 1LNQA 2X6NA 1GLBG 4QR0A 2A2DA 3KXDA 4IG3A 3DFEA 2HOEA 1WC3A 4DUZK 2GV9A 1J5EK 1S10A 3FLCO 3QIPB 3I9V9 4JI7K 1AFIA 3IA0A 1IKWB 4GMJB 1TGOA 1F1BB 3G82A 3WZ0A 2J76E 2E6MA 1D09B 4Z7CA 4PG6A 3F5TA 4JI3K 4W5QA 1FNOA 3W2WA 2CG4A 5ETPA 3DLLL 4K43A 2ZZNA 2QTWA 2Y1JA 4FDFA 3X1LB 3POTB 3LF0A 3DM2B 4JAXA 2ZEJA 5E3QA 3W61A 5IOLA 3OUYA 1RU1A 3NGKA 4CJTA 3AQOA 3AOAA 2JSXA 4H8KA 3EX7B 3AA5X 2FSNA 3OYBA 4KHPJ 3DMJA 1K6YA 3QRQA 4MIBA 2E9RX 3GFXA 3GIRA 3OT9A 4ZTJA 4EFHA 1O51A 4DSKA 3M2UB 4GVMA 4IJNA 1RT4A 3WXLA 2KL8A 4CIEA 1N34J 2HF4A 3CT9A 1WC1A 2ZWOA 5CD4H 1NU4A 4NEYA 1SJ4P 2H4WB 3VV2B 4F50A 2ZOGA 4LIRA 4RG8A 3BZKA 4JI2J 1SQFA 4LF6J 1VBZA 4ZJQA 1D5AA 4DR6J 3HL8A 3O08A 4BBYA 1T11A 1UWBA 2XSFA 2OUGA 3OFHA 2FHMA 3GSDA 4H5WA 3KZBA 4Q43A 3P8BB 2F8EX 2FLPA 1JLAB 2CQIA 2YH1A 3ZSRA 2K3IA 4J9VA 3OR1B 1H1VA 2NRWA 3CCES 4DF4A 1IN0A 2CQGA 1FERA 2DNQA 3W0LA 4WBFA 2DHGA 4EO6A 3MEEB 4ZN3A 4FKYA 3UVJB 3BQ2A 1IM4A 3DN9A 2PE8A 3FKBA 1WDDA 4K4TA 2HHSA 3H3OB 4BRPA 4O23A 4OPJA 3CXCR 5L46A 3D67A 4CZCA 3IRXB 4Y2CA 4QPXA 2PO4A 4RW6A 4KKOA 5K5MA 4DV1J 3M6WA 3JSRA 3KK7A 2RSQA 2PGCA 3ZSXA 2KFYA 3I56N 1NGJA 4P74A 5ITHA 3IWXA 1S0OA 3MEDA 1M1KT 5DLGA 2YNIB 5CZVA 2V69A 3U1MA 1QZ6A 2PMHA 4H0VB 4KAZA 3L4IA 1J2VA 5G4DA 3OVSA 4C23A 4FJ8A 4DUTA 2RHSB 4NXNF 5DRKA 4J9SA 5A2QY 2ZM6K 4NLRA 4RLEA 4TKTA 1DKGD 3I6PA 5LY3A 2DPIA 2YH0A 4R0EA 3MR6A 2YWKA 4W92B 1KN6A 4ZLJA 2K3KA 3SI6A 4PEOA 3VQDA 2W7PA 2BUPA 3K8WA 1VSFA 3AOBA 2PMZD 5LXYA 3DXMB 2N3LA 3PW0A 1T6CA 4Q8EA 2YWGA 4B9SA 1WSRA 3CCMN 2R2UA 3IKMA 4ERDA 2BJ1A 3VA0A 2VUGA 3I0SB 3MPWA 4MK8A 1B70B 2ZGYA 2CQ4A 1A6LA 2F8HA 3O9TA 1FVSA 3CJ9A 2GGPB 1KC8T 2Q0UA 1ZZFA 4RW7A 2WK4A 2JWKA 2V2QA 4JS4A 2OAUA 1NBEB 1N36F 2A42A 1AA1B 3PR4A 3RMAA 4JD2A 1Q8IA 2VQFJ 1RAHB 5BR8J 2K1RB 2G9OA 1RBLA 5K8NA 3CJTA 4KHWA 3ISNC 3CD7A 4HUGA 1OSDA 3MR5A 2CZ9A 3B6PA 1BA1A 3SK3A 5L9NA 3BUZB 4USIA 5TKYA 1GQEA 4UY8T 2H3GX 1OS5A 1C0MA 3PYDA 4AHCA 5DDOC 3OTBA 2EI5A 2Y0SD 3QESA 4N5SA 4CLLA 2H9ZA 4M3WA 3KHLA 2FBTA 3H1QA 3KD1E 3D3BJ 2D3UA 2KM8B 4KFBB 1A5XA 3JTPA 2FJEB 1NGBA 3SFUA 2VONA 3UNYA 2MYFA 4M5NA 3V6DB 4EU0A 2MQNA 5E84A 3WXMB 2UXDJ 2CRLA 3CI5A 1X4HA 2BKPA 3P96A 3MMAA 3Q0AA 5D77A 1WOPA 3VEOA 3MN7A 4YHHJ 4CFDA 1OQ3A 1LOTB 2V9KA 3TYTA 1AZSB 3SQOP 3CCSN 1E4GT 4BQZA 2FD2A 5M1QA 4NB4A 3FZLA 4MKBA 2P9PB 5DQHA 2YQ1A 3VQ7A 4FZZA 5HRRA 1BGXT 3MF5A 2XMTA 2M52A 3OW2R 2VPWB 4CEQA 2QL7B 1KQSR 3AHPA 4M3ZA 1TAQA 3VALA 3OYMA 3P3DA 4RCHA 1NPPA 2V34A 4PL7A 3L4QA 3JAMO 3J80O 1TL1A 3ZSVA 5CYMA 3ZCMA 3HT0A 2UU9F 4F25A 5A8WB 5GIPA 3BBCA 4FS1A 2DJWA 3MHYA 1MWQA 3LM9A 4IDKB 3SUPA 2J9EA 1U1RA 4RBVA 2BQ3A 2BACA 3NS6A 4DQSA 5KAKA 5FJ4A 4ALZA 1R59O 4U67L 3D0HE 4OGCA 3NNAA 4L3NA 4E7JA 1V3SA 4X66F 3MXMA 2CPZA 5IWAJ 4RX6A 4PQUB 4RWWA 4CZFA 1PYSB 2Z56B 3VEZA 4ILGB 4RW4B 3RAXA 1J27A 4WXOA 1EO1A 3SQ4A 3RBZA 4LRAA 5AQPA 2LFVA 2Q3PA 1XMQJ 3N0VA 1N4LA 1Y9OA 1H38A 3J81j 3IMXA 1PIEA 2O67A 4ZPCA 4X4TA 3QWPA 1HI1A 5EX5A 3OD2A 4B3RF 4M5DB 3OXLA 3VQSA 2NRVA 1XNRJ 3C8YA 4RUBA 5L39A 4FWQA 1W2IA 2B51A 5AE2A 1H74A 2C1EB 2QZ8A 4CNZA 2DHHA 3OVBA 1RGVA 3EKUA 3OTCA 2HMIB 4ED1A 3KG4A 3AVFA 1RWMB 1VQ9S 4Z94A 4MFBA 5F8IA 2HHXA 1HPMA 2UVUA 4FVCA 1RAAB 3C15A 3PFOA 1FRJA 3PO4A 1Z4UA 1SH2A 1ZM9A 3EWGA 4HT5A 2BBEA 3VAGA 1DGKN 1EB0A 2IGIA 5AFUH 1MU2B 2GHPA 2P9LB 3QERA 1WUAA 2CPXA 1SS6A 3BO2A 2XY5A 4RNHA 3O1BA 1FT8A 3TUPA 2RNEA 1JXLA 4DQIA 4MMOA 2VFVA 2ZJQQ 2OMOA 5C12A 1UAXA 5HBMA 2DBBA 2QLFB 1DFDA 1DQAA 2W2MP 4Y2AA 4H4OA 1G6BA 3FSYA 2GQQA 2VICA 1IJFB 4DS4A 1S1XA 1P1LA 4BG9A 3J81Y 3BQ0A 3CJKA 4GO5X 2DH9A 3QYYA 4CHOA 3S3MA 3MWPA 2NRHA 1LAVA 2R7WA 4DL7A 3CXCM 5KFVA 2PFDA 3BREA 4AM6A 2GV1A 2X7IA 1JWWA 2W2OP 4E89A 5C10A 1UVNA 2UUTA 5BYSA 3TUIC 1RILA 4ZVFA 3CULA 1X4EA 3MM7B 3QMQA 4I6AA 3GIJA 2MTLA 2UV8G 4WK3A 5KFMA 3R6MA 5ETSA 4I2PB 3ZZTA 4IFVA 4ELTA 1NB2A 1S59A 3HHEA 5AQFA 1IKXB 5M1NA 5H9FK 4IFEA 3GJTB 1JL1A 1H2TZ 1VRUB 4WFNL 4OI3A 4FNHA 2W24A 5HN0A 1ACMB 3NAHA 4A48A 1RWXB 2CPEA 3W8GA 5B08A 4USJC 3MAAB 2W2NP 2XEXA 4X62J 2QKBA 3D6TB 1BHLA 4IG0A 3IWLA 4B9QA 3V4MA 3RB0A 2E2QA 4OX6A 2PT0A 1S1WB 2XB2D 2ZH2A 1HQEB 2UUWA 4WYBA 4BRGA 4BC9A 1RTZA 1SH0A 3DRYA 2Z8QA 2OYQA 3KLEB 3CB4A 3SQ1A 2PYJA 1IH7A 3VETA 1HNVA 2G2ZA 4I2QA 1MN7A 2AQ4A 4ZVQB 3CPWR 3O6WA 3HZGA 4FK2A 3GR0A 2VDHA 4LBHA 3KKRA 3VWSA 2GELA 2RUGA 4OKKA 3W60A 4KSEB 4OHZA 1S6OA 3KLIB 1R7IA 5K14B 3M8ZA 2L9NA 4CK1A 2U1AA 1NMNA 3CMES 3AGKA 2FBYA 3H2UB 3NWRA 4N41A 3A0IX 2VWJA 2HKEA 3THVA 2UU9K 4ZOSA 1V6HA 2GMJA 4BGAA 4OJ1A 2JC1A 4LFBF 1YJ7A 4X4PA 1DLOA 4DX8H 4FF4A 3ZC4A 1QTNB 4OI1A 4I7FA 2HHHK 5ETOA 4K7QA 1RTHB 4KE5A 3VGKA 4IJAA 3HPGA 2YNGB 3OHRA 5KT3A 1KKHA 4X66K 5CZ2A 1FJGK 3BYRA 1UEUA 2UUCJ 5GMDA 2CNKB 3CJQA 2A2CA 4RUAA 4C8MA 3ZSZA 1PJ7A 2VF3A 1WN7A 5C24B 2YWHA 5D0HA 2BRLA 2YWWA 2CA9A 4NXMK 3K2PA 2FYXA 2YKQA 2QC3A 1S9GA 2AEJA 1I39A 1CLFA 6AT1B 4KJIA 4RWXA 4Y2MA 2QA4G 3HI0A 4XEIA 4UZCA 4UT4A 3E9PA 3VESA 1C0TA 1LW2A 2B0GA 4JI3J 2H48B 3G71S 2ASMA 2HBKA 3M05A 4CJRA 1YJVA 1F6TA 4DR5J 4ZP7A 4IOCQ 3HT3A 2YI1A 4ZTFA 1O6XA 3NGTA 3PYFA 4ISFA 3O5BA 2J7WA 1HYSB 5LJ5Y 2LDIA 3GSIA 1YAGA 1HNWK 1RWOB 3K89A 4MYTA 3EGZA 3UPFA 1FK9A 2XCAA 3F9KA 2Z0GA 3O44A 1VQNS 2O8BB 2XWXA 2IIRA 4I69A 3HSZA 1YGYA 1DARA 3AAWB 4IDHA 2KT3A 4KT0C 4DR5F 2HWHA 4U96A 4Z4CA 5CH7B 2N7CA 3TSPA 1VQON 4X65K 3DU6A 2H4YB 4CBUA 2VPZB 4CIFA 4AL7A 3RTVA 2ZJQL 1AUDA 4KGZB 4LBPA 1BDGA 3NH2A 4NLTA 5KG6A 2RVJA 2CAJA 4Z37A 3ZETA 3HF5A 1UEKA 4LF4F 4P2MA 3CDAA 1BE4A 5F9NA 1OH5A 1J9AA 2DISA 1FDAA 3QAUA 3H0PA 4ZLPA 3ICLA 4CFCA 1U1KA 3FEXB 3K58A 2YQ0A 4CGDA 2HNYB 2C2KB 1NU0A 2VA3A 2ITMA 2RAQA 4J9RA 3RYLA 2PAVA 1AFJA 4Y00A 4IRCA 1NJYA 1S72S 4OX9K 2JJ4D 1UJ4A 4BVOA 2K7KA 4ZCIA 3CDBA 3SUQA 5A2QU 2XBPA 4ELUA 2DRAA 1QAYA 2R4FA 1UPMB 2GMLA 2GVDB 3TPQA 3WNFA 3GFHA 1JLQA 3NXZA 4UY85 1JLCA 1FDBA 3TVYA 3IFRA 1S77D 2EWSA 5AXLA 5TKWA 3O1LA 1RQ0A 1S6PB 2GEMA 1HARA 2P9UA 3F9MA 1M5OC 3TW0A 3A5MC 1D8YA 2MXYA 5HP1B 5KFNA 3O6QA 4DKWA 5AXMA 3WIUA 2AYEA 5J2QB 3BF3A 1BHNA 2ZH6A 1RTJA 1GLLO 2ZD1B 4H0XB 5H1SV 1C0FA 3NCIA 4IEEA 4EYIB 2OA8A 4OV1A 3M6GA 2KT2A 3HHDA 3QNNA 1ZYQA 3OTEA 3QFWA 1HD0A 1VIXA 5D8HB 4CWBA 5KFOA 3D2EA 2DR6A 4C8YA 4M5JA 4O3SA 1C0GA 1GMWA 1WJ9A 4NLXA 4F4XA 4FWRA 4EBEA 3W64A 3BR9A 2A6AA 1EKEA 5EWGA 1VFJA 5D4LA 1S12A 4CECA 3MCMA 2IVPA 4DWIA 3ADAC 3LPEA 2A3JA 1FVQA 2JLGA 1K9MO 2PDAA 3ZFVA 4Q2LA 3CC2N 1LFPA 3GCXP 3L8BA 3BDPA 1Z26A 3QO9B 4YORA 1KAZA 3TJ9A 5JVHL 1Q82T 4YR0A 4E1NA 1S1VA 1CJKA 4GY2B 2AJ0A 1R8CA 2YNFA 3JSMB 3HHLB 4HH0A 3K17A 4TU8A 4JI8F 4K8ZA 1Y4ZB 1X7VA 1U6BA 2LSNA 3SZ2A 3V81A 3N28A 3OY9A 2A3ZA 1WEXA 4OHXA 3NY0A 4LFBK 1FEHA 2DR7A 3TQEA 3L7PA 3WQTA 2BJ3A 3QNWB 4GVBA 3QWUA 3PIOQ 3IC1A 2ZFHA 4YP3A 5CYJA 3GG4A 3WT0A 2MKIA 3TAQA 3NBPA 3H8YA 3CIZA 3I87A 1U0SA 2FJWA 2CG8A 3I4PA 1DEJA 3I55S 3MXJA 3THPA 3KNAA 3BGRB 2LLZA 1U49A 1NGGA 4E1JA 2BE9B 1RYSA 3P4UB 1IKYA 3O80A 3ZTRA 2IOCA 5KT4A 4OI6A 2XHBA 3CJ4A 1A5WA 2VKZG 3ULEB 1J54A 1TKDA 4IOCL 4YOEA 3LZIA 1HBNB 4ANDA 4LH5A 1HBOA 3M32B 1X5OA 3TZZA 3QNOA 1UVIA 4AQYJ 1YITN 2XI2A 3ID8A 3S9HA 2W7AA 4LMZA 1S97A 2ZH7A 2HZAA 3QEXA 2IDLA 1ATRA 1S22A 1VOMA 3OVNA 3TEHB 4DQ8A 1VQMS 2DHXA 1VRTB 3QGHA 1RT3A 2DGOA 4L8RB 3S3OA 3GV7B 2OMLA 4JKFA 3DOMA 3DXKB 4QIWD 1JX4A 1VQPS 4JV5F 1YJ9N 4E98A 1KQFB 5B0AA 1HL6A 1ATNA 3BZCA 4WE1B 3FRZA 1JCGA 3QLHA 2ZC3A 1N88A 1NHKL 4BREA 1RDDA 1Q81O 4FO0A 1H72C 1Q5VA 4FWMA 1SKWA 3QMLA 2BA9A 2P5GA 2RKIB 2AA4A 2RS2A 4LF5K 2AKWB 4FLWA 2NXEA 4O0JA 3RG6A 3U1NA 3GFZA 3WNHA 4PAAA 4BR4A 2EBGA 5C25B 1IKWA 3K5MA 5HLFA 3C16A 3V6HA 4O3QA 4MLHA 2MQ8A 1VQ8N 1KOHA 2E2OA 4KR0B 4RR5A 4A8WA 5I3PA 4I67A 4RO0A 2YX1A 4LFAK 2DH7A 1RBRA 2KDOA 7FD1A 5B0GA 3I9ZA 4HHHA 3KWIA 4P52A 3CFOA 2HRYA 3K0SA 1YJUA 2KXNB 3OYDA 5F41A 3Q8VA 2WONA 4QWDA 2EPIA 2O8DA 4BRKA 3VGSA 2OTLS 4OPKA 4OYZA 1HKAA 1K0VA 4DQQA 1I94K 3KUHA 2VQEF 2V0NA 5B7WA 4TY8A 4EO8A 1ZM2A 2PA8D 1N8RT 2X1AA 2P9IA 3MUMP 1E3MA 2MGZB 3M1VB 2JLFA 1VHIA 2DYAA 3TJAA 3R1HA 4FJJA 2FIUA 3LL3A 4F2SA 1KS2A 1WB9A 4ZDNA 4DTJA 3OFGA 2XZTB 1M5HA 1DTQB 3M8YA 4ZVPB 1ICEB 2V4RA 3T41A 4DG1B 1CJTB 2E29A 3M5RA 4PABA 2CQPA 4EEYA 2DGXA 2QG9B 4IO9Q 1B9FA 5HVFA 2Z2YB 1MMDA 1FFSB 5RUBA 3B8AX 1Q9XA 2DNLA 3MM8A 3AD7C 5GADU 4H4MA 3EZUA 1XMBA 2OPQB 5EU7A 2NS1B 1LWCB 3GDQA 1FRHA 1GTEA 3J81U 3G0ZA 2BDPA 4EWTA 3M8QA 2FLOA 1PKUA 1TL7A 3X3UA 1CQNA 3OTDA 3MM9A 3VEVA 2LCWA 2IJNA 4ENOA 1LK7A 4DL5A 2MKKA 5HVGA 3CJ0A 3MEEA 5FROA 5B09A 3T5JA 1RACB 4IKAA 1FA0A 3KK2A 3LDPA 1Z2LA 1VYAA 3MWBA 1V9OA 1MNEA 1Q5YA 3W5ZA 2RRNA 2W9BA 4OZ5A 3TUJC 3VR1A 2W8LA 3P83D 4LSLB 2BV3A 4M1KA 1T9XA 4KHRA 1FFGB 3OSPA 2VKRA 3D2FA 3TVZA 4U8YA 4MH8A 2GTDA 3US5A 4FM2A 2NZTA 1A7GE 4FM0A 2DNKA 2V2VA 4X64K 3PIOL 2EFNA 4BRAA 2E5LK 1C1BA 4JI8K 1NMDA 3V6KA 4OHWA 2ZJRL 1BI4B 2FB0A 1WHXA 2XHCA 4CHPA 1F9HA 1OKJA 1H98A 3ZZYA 4E7KA 5LM7E 3CJ7A 1V3ZA 4CI0B 4YY3F 2VC1A 3DLRA 2CYYA 5DM7Q 2DTUA 1U8SA 3VHQA 4PXBA 4ZP8A 1GLJO 2CPFA 1FWKA 1MWKA 2EFGA 1QDUB 1AUSL 2MEWA 4N8NA 4C2MA 2F9WA 3R2CJ 4ZPWR 1GXUA 5E7OB 3HFZB 5E3CA 2MZJA 4B3TK 2E1AA 2E1YA 5CYQA 5D15A 1HFEL 1T3VA 2VFUA 1VR6A 4JKCA 1YG0A 3EEQA 2ZF5O 1OH8A 2GGPA 4JI0J 2GO9A 2HK3A 1RT6B 4I9QA 1QAIA 1U6ZA 4OZNA 1EQMA 2ZJPL 1QVGM 4M45A 3A3PB 1D1UA 1MWYA 2RIJA 1Y11A 2DGQA 1WACA 1W0HA 2A0FB 2PMWA 5D78A 3W2VB 1NKBA 2J9CA 4JV5K 1DBDA 5HOOA 4X4SA 4I6YA 2ZH4A 2ZHOA 3THXB 3CJ2A 1KNZA 4ZVUB 2VJUA 1ZA2B 1HJOA 1D9FA 3G10A 4IBNA 5M1KA 3TAGA 4J2BA 3ILIA 1KQGB 4CEDA 2KJVA 4CEEA 1BWEA 4IZ9A 5HATA 2LQJA 4Y34A 1ZS6A 4JI4F 4CT9A 3HM9A 1BWFO 3MECB 3F41A 2IY5B 3V1RA 3QGIA 2HBQB 2BKOA 4DHVA 4CTAA 3V9WA 3CJAA 5HANA 3RB4A 2A5XA 3RAMA 1XQSC 4MKYA 5KG0A 5EWEA 4CD1A 1X5TA 2FJXA 3NHGA 2OHDA 4RNFA 4CBXA 3CW2C 3ATUA 1QAXA 2QSWA 3EDRB 4BS2A 1K8KA 3K5LA 3DRPB 1YJNN 4L76A 2WB1D 3O1WA 1GX5A 4EHTA 1FJGJ 3N4QA 4K50A 3TX0A 2CQCA 2MZ1A 4ECYA 3RGIA 4Z4GA 5F8JA 2WVFA 2AYGA 1TQLA 2F96A 1U0HB 2BEFA 4LSNB 5HROB 3OLBA 4F0MA 4NXMJ 3TVKA 4JOUA 1U1NA 3CCZA 4CCHA 4LRCA 5C15A 3QEWA 1IBLK 3CCQN 2CQDA 1RT1B 3ZZZA 5AXNA 4P71A 1UETA 3PX4A 3JXOA 2P9KB 1ZAVA 1TL3A 4AL5A 5DJBA 3CC4N 4KB1A 2N4DA 1BQMB 5CA5A 3D0IE 2ZOFA 4A8OA 1B99A 1X8DA 5A8WA 2IM2A 3QZ7A 3MAHA 3ZO7A 1Q7YT 3C6AA 2GQCA 2GHWA 4DMNA 4PXCA 4HTJA 5LMNJ 3PNIA 5J2MB 1HI0P 2H51B 2COLA 2CQ2A 1HNWJ 3PJ9A 3LM2A 1Y3KA 2F7TA 2NUUG 2KYXA 4MKVA 4N56A 2Y8WA 4FYVB 2E6LA 5BREA 3LPTA 3IG1B 3CYMA 3K7RA 2FVQA 1SKSA 4X65J 5IC4B 2IAJB 4CM0A 4OZ2A 4H4KA 4ED3A 4LF8F 4LVNP 2XY6A 2W6LA 3L09A 4B9VA 4NLDA 4CJUA 2G8FA 1K0TA 5F9LA 4M5LA 3ZT3A 1U1OA 4HT7A 2EK6A 1DZ5A 1NUEA 1NG9A 3BF1A 2J6UA 1B9DA 5AQIA 5D3GB 3KNGA 4GC6A 1C0UB 1G3OA 2ZH5A 5AQJA 3HD1A 4HR2A 1X4BA 1ZAXA 5FPMA 3EVWA 1RU2A 4FBUA 1MSWD 4DN0A 5F3ZA 4DR2F 1RSCA 1WKJA 3UKUB 1G15A 1UOCA 3QBWA 3ZYYX 1SJQA 2GHVC 4OX9J 1FDDA 2D3ZA 4XTTA 3V6JA 3PO5A 3ITHA 4C4WA 1EQ0A 4CFAA 1UFLA 1WC6A 3U3YA 1JNRB 2DNNA 3PSIA 3T1YK 1SIWB 4KB0A 3JYTB 4NLVA 4AHVA 2E2PA 4ER8A 2X78A 2DFEA 3DRSA 3CWJA 2ZC4A 4GV3A 5KTQA 4J9QA 4WQ5A 5ADXH 2DD8S 3EPIA 3GFYA 4Q44A 2WHOA 5DDQC 4DU7A 4QU6A 3N6MA 1X1PA 1I51B 2DNYA 4IH6A 3UIQA 4H0OA 4HUFA 4CRJA 4FPAA 4O55A 5AQQA 2I6WA 2XO6A 1IKVB 2DGVA 1G1XA 2CPJA 1FI4A 4EYHB 5HRPA 2BW7A 2F63A 4PUOA 4YOXA 2XZWA 2PIIA 2WRMA 3AJ1A 1C1CB 1YBTA 4MK7A 2XNRA 4CO3A 4CJPA 2X3GA 4ECTA 5KFRA 4DV2J 1WD6A 1LW0A 2OPR