3IRXA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with the non-nucleoside rt inhibitor (e)-s-methyl 5-(1-(3,7-dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of HIV-1 reverse transcriptase (RT) in complex with the alkenyldiarylmethane (ADAM) Non-nucleoside RT Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 129
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3irxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3irxA05
1EX4A 1RILA 2IDOA 3KIOA 4LSNB 2G8VA 1KFDA 1FKPA 3ZSXA 1LW0A 1JLAA 5C5JA 1IKXA 4OPKA 4W5QA 1ZBLA 5EWGA 1TGOA 4PA1A 4CJWA 4G1QA 4FCYA 4CEZA 2D5RA 3L8BA 4ZTFA 2FJVA 4L8RB 1DLOB 3SPYA 3TAEA 1HNIB 1C0UA 4DFMA 3LP1B 4E1NA 3MR5A 4C8LA 3EZ5A 2UVVA 1RBRA 3T3FA 3RAXA 2W9CA 3TANA 5I3UA 2ASLA 3UDLA 5I42A 2WRMA 3E01A 2D0CA 1CZ9A 4ECWA 2ATQA 3BQ2A 3TAGA 3MEGA 2R8HA 4J2BA 4ELUA 4NLGA 1VSMA 3IG1A 4DTSA 2ILYA 3M9MB 1RT5B 4XPEA 5DG8A 4Q0BA 4HYKA 4RW9B 4YNQA 3H59A 2OH2A 5KFAA 4PUOB 1TP7A 1QAJA 4IFVA 4M3XA 3ZT4A 3BDPA 3O4QA 2VG7A 3MFIA 4KFBB 1QHTA 3CJ4A 1TQLA 2JEFA 4GMJB 3PW4A 4FJLA 4F50A 4O4RA 5DQGA 1RA6A 1S4FA 1EXQA 2WOMB 3CJ2A 5T7BA 4QW8A 4YQWA 2FJXA 4O0JA 3NL0A 1YT3A 3MR6A 3HP9A 3C6TB 4CEBA 1TV6A 2B6AB 4KPYA 3PW5A 1T03B 3GV7B 3VQ6A 1HQEA 3KLFA 4RUAA 4ZP9A 4DTOA 2I5JB 1HPZA 4QOZB 1T03A 5HP1A 3QEIA 3OYFA 3N6NA 1I39A 2HWIA 4DSEA 3V81A 5KFYA 4M3YA 2HNZA 3WNEA 1SH0A 3HM9A 2XHBA 4ICLA 4ED7A 4O4GB 5KT3A 2AJQA 2XI3A 4RG8A 3QESA 2O4GA 4DSJA 1S5JA 4KE5A 4TY9A 3D45A 2PY5A 4CJTA 3NF7A 3NGDA 1RBSA 4DL6A 1RNHA 4KFBA 4O0IA 1VSEA 3KLIB 3PHEA 4IH6A 2VG6A 4YR2A 4H4MA 4PQUB 2YNFA 2IM2A 4CJRA 5JS2A 4DFKA 3SUPA 5KFHA 3M8RA 1SV5A 3SJJA 2ILZA 4J2DA 3OHAA 5J2PA 1L3VA 1J9AA 1SV5B 3DLHA 2CJQA 1JLQB 2VWJA 3T5JA 2IC3A 5EWEA 3H98A 1JLCB 3FFIB 4DU4A 1U09A 2X6NA 4IKFA 4KHYA 1RTDB 3NGIA 5KRTA 5JUMA 1LWEA 3V9ZA 4JV0A 1S49A 4J9NA 4ID5B 3OYEA 3NF6A 2XGPA 3QEVA 3IN5A 4M41A 3TWHA 3MTKA 4DSKA 5FRNA 4QWBA 1U45A 5HLFA 3BSCA 2O4IA 5D3GA 2IM1A 3A2FA 4G1QB 5KFFA 4K4WA 2HMIA 2ZKUA 1C1BB 3MR2A 1W0HA 3I5BA 1HPZB 4I9LA 5KG4A 3OL8A 3ITHB 1I6JA 2JC0A 2I5JA 3SUQA 1DTTA 2GIRA 2R8JA 1XHXA 3RR8A 1IKXB 3PO5A 3SYZA 2OPPA 4TYBA 3V1OA 4EP5A 5KFRA 1LW0B 4J9KA 3HHKA 5EWFA 4FJ7A 2HNYB 2Y1JA 4CIEA 4KSEB 5E41A 1VK0A 3C6TA 3Q8SB 4DL2A 3OS1A 4DU1A 4ECSA 1HMVA 4QPXA 1RT4B 1KVBA 4CIGA 3MAQA 1RTJB 1FK9B 4B08A 3OYKA 4NLSA 4DL3A 2OPRA 5C42A 1RA7A 2YKNB 3BSOA 4B3OB 2BR0A 3UR0A 4DL5A 4TYAA 5KFCA 4FVMA 4K4VA 4FJNA 3OLAA 4TXSA 2FJWA 3P1GA 4C8NA 4CESA 4RW9A 4MKAA 5DMRA 4MIAA 4NLPA 2FBVA 4JV2A 1C1AA 3VQSA 3QO9A 4XO0A 2X6SA 1W25A 5L9XA 1WAJA 5KG5A 4FJ8A 3OSPA 5L1LA 2OPQA 3AO2A 4NYFA 4HCCA 3N6MA 3LPUA 4IOBA 4WXWA 3OYMA 4EBEA 4CJEA 1RBUA 3NKYA 4FLZA 1RTHB 1ASWA 4CHYA 3LDSA 5KFXA 3GIKA 1S48A 4DTUA 4BWJA 1D9DA 4CGFA 1WSEA 1C0UB 3AVNA 4DFPA 3FQKA 1TL3A 4E7IA 2XY5A 5KFMA 1NK8A 3RBDA 4CEEA 2DTUA 4JRQA 3VQDA 4F4ZA 1S1UA 1QAIA 3DYAA 1R0AB 2AQ4A 2BGGA 2E9TA 4NCBA 4RNHA 1ASVA 1QS4A 4TLRA 2BE2B 3F73A 1SKSA 1BQMB 5KG3A 3HVTA 1QE1B 2CKWA 3QLHA 2AU0A 3U3YA 4NCAA 3T5HA 3KK2A 4J9RA 5FROA 2V4RA 4CEFA 2XY6A 4CJSA 1U4BA 1NK4A 3CM5A 3PZPA 4ECZA 3VQQA 4B8AB 2HHXA 1JL1A 4QAGA 3HO1A 1TKXA 1NOZA 1ITGA 4M3RA 4M3WA 4KRFA 3DRRA 3CJ5A 4KB0A 3DM2A 3LALA 2XY7A 4KO0A 4CGGA 1BI4B 3OS2A 1X9MA 1UA1A 1NJYA 1TAUA 1QE1A 1C0TB 3DLEB 3V6DB 3ZSWA 4TQRA 4GC7A 3PVXA 2YV0X 4AHUA 4IG0B 3GIJA 1WNEA 3VQ5A 4CK1A 1RYRA 3KLEA 3DI6B 3LP2A 2DFFA 2VG5B 4Y2CA 4GVMA 4F4XA 3QIDA 2GUIA 5KFZA 4H4OA 1C1CB 1NJXA 3V4IB 2R2SA 3Q8PB 2J6TA 3MECA 2EC0A 5J2QA 3AO5A 3QGIA 5J2QB 4IH7A 3SV3A 4FW1A 4KHNA 1W9HA 3QGHA 4WZMA 2YNGB 3NH0A 4KHQA 3G6XA 4LQ9A 4DG1B 3WNHA 2ZQBA 3MXIA 4ZHRA 3CFRA 4ZPAA 1IKWB 4KKOA 3L3VA 4K4TA 4ZMMA 3MXMA 4QCLA 1RBVA 5C25A 4IG0A 2FVSA 3MR3A 1JL2A 3KOAA 3AVLA 1WAFA 4OLAA 1BHLA 4O3PA 5F8GA 3PJXA 1C0TA 1VSIA 2UUTA 4H8KA 3CWJA 2D0BA 3S3NA 3CVKA 2HHTA 4K8ZA 1NKEA 4KB7A 3DM2B 5J2NB 3CJ0A 4URQU 5F8MA 2GIQA 2FBXA 3VQ4A 3ALYA 3PX4A 3ZSZA 3NGYA 4IDKA 4DMNA 4LH5A 1S1XB 3S3OA 1NK7A 1HJRA 3MEEA 4N47A 3QLHB 1IO2A 3H2LA 1SUQA 4Y34A 4J9PA 3I5CA 4LH4A 5KTQA 1N48A 1NHUA 4LSLB 2B43A 1LWFB 1N5YA 3V9UA 4PWDA 4CJUA 4CCHA 3IS9A 1KVCA 1REVB 5KFDA 3KMSA 3ITHA 3RAQA 3BR9A 2R2UA 1C1BA 2XI2A 4MFBA 3U6FA 1SL2A 5EDWA 3GQCA 3I0RB 3I0SB 4CGHA 1TL3B 3HPHA 5DG9A 4ECUA 2XWYA 1NKCA 4O3QA 3DOLA 1VSLA 1TK5A 3ZT3A 2NUBA 2FVQA 4CJ4A 1RTIB 4OKKA 4CK2A 1LV5A 1MMLA 4JLHA 2R8IA 4IG3B 1D9FA 4RZRA 5FDLB 4J9LA 3DLGA 1Q9YA 5J1EA 1NK5A 4KHUA 2IC3B 5CYQB 3QETA 1REVA 1RT1A 1Z25A 2HHQA 3LAKA 2VA3A 3CFOA 1Z4UA 3QGGA 3TAPA 3THVA 5KFBA 1K1SA 2IBKA 4O55A 2C2EA 2YNFB 4LSLA 4IRCA 4PQUA 1L3UA 5CYMB 4ED1A 4YR3A 4Y1CA 3KJVA 3T5LA 5F8IA 3EPIA 4DTNA 4IDKB 1RT2A 3JSMB 3ZSOA 1JKHB 4DFJA 2YHAA 4HUEA 3NAIA 4ED2A 1D5AA 1GX5A 2C2RA 4IH5A 1IKVA 4M42A 4NLYA 4CF9A 3S3MA 5KFEA 4DF4A 2HMIB 3S9HA 4OGCA 3AA3A 4AHTA 3NAEA 4M3ZA 2QKBA 3AVMA 4JS5A 2JEGA 4CJQA 1D8YA 4KB1A 1BQNB 4FM1A 1ZBIA 1EP4A 4Q45A 4I2PA 2D0AA 5KG1A 3T1AA 4DG1A 4DL7A 2OZMA 4CIFA 1X9SA 2B5JB 4MKBA 3V6HA 1HYZA 2BQRA 3AA2A 4K8XA 1LWEB 4WYWA 4F2RA 3OYIA 1Z26A 3V9SA 3FFIA 1NK6A 3V4IA 2BQ3A 1JLBA 1KFSA 4B9SA 4H4OB 4DSFA 4J9QA 1C6VA 3DOKA 4O3SA 4IBNA 3LZIA 4IRDA 1HYSB 3DI6A 5KT2A 4KTQA 4RW6A 2BQUA 1HARA 4KAIA 1JLEB 3KLIA 5DQHA 3AA4A 5FDLA 4DQSA 3KK3B 2YHBA 1JIHA 4FBUA 4WE1A 4DLEA 4Y2AA 4WYLA 3VQPA 5HRPA 3HP6A 3AO1A 3SNNA 1WN7A 1S1VA 3LP1A 3MEDA 2YKMB 2HNZB 1CXUA 4WFYA 2C28A 3TAFA 5KFKA 4R5PB 3L2VA 2IAJB 5FRMA 2AX1A 1ZTTA 1VSKA 4HUFA 5JS1A 2QV6A 3NCIA 4CJFA 3KNAA 4FLTA 2RDIA 4BDPA 4C8OA 2W7PA 4IRKA 2KTQA 3P83D 2IJFA 3NHGA 4CHOA 3DRPB 1OS5A 1C0MA 2P5OA 2BANA 1LWFA 4W5OA 4N41A 3TAQA 1TV6B 2W9BA 1K1QA 3RMDA 4ECVA 2FVRA 4K4ZA 4ECXA 1TVRB 2OZSA 1SUQB 3DRPA 1QSSA 4Z4HA 2Y1IA 4OVLA 4OPJA 1JLGA 2ZE2A 3SFUA 3K2PA 4KV8A 4F3OA 4Q44A 1KLNA 2Q3SA 3OS0A 3ICLA 5DLFA 3P5JA 1XC9A 2ZD1B 3ISNC 3AVCA 1LW2B 4I7FB 4Y3CA 1TK8A 2HAIA 1KTQA 2RPIA 2YNIB 2R2TA 5KT5A 4PUOA 3QIPA 3CJ3A 1BGXT 4WE1B 4O44A 1Q9XA 4Q0BB 4HCBA 1RT5A 3OYJA 2V9WA 2B4JA 4J2EA 5C25B 3NE6A 2W42A 1TK0A 1IH7A 1IKWA 3HSTB 4MQ3A 1UAXA 3WNGA 2W9CB 3QIPB 1JLBB 4B9VA 5KI6A 2FLNA 3TQ1A 3K58A 2FBYA 4KHRA 4NRTA 3AVHA 4GW6A 1DLOA 3DLRA 1HQUB 4CEAA 3NBPB 3M8SA 2QE5A 4E1MA 2P5GA 4RNMA 1JLGB 2W8KA 4I2PB 1RT4A 2XY8A 3KLEB 1BQNA 3PY8A 3NF9A 3L2UA 2UVUA 2O5DA 1NJZA 4OL8A 4NLOA 3FQLA 3SQ4A 3SUOA 4BDYA 2W7OA 3EZUA 4QW9A 2AX0A 1X1PA 2OPPB 4RW7A 5F9LA 4KO0B 4CFDA 3HXMA 2BRKA 3DRRB 3HJFA 4CJ5A 4ZPBA 3QIOA 1JXLA 3C6UA 4DQQA 3QEPA 5D3GB 3NH2A 2G8IA 1RDBA 2R8KA 4TQSA 1T94A 2RN2A 2C2DA 3V1QA 3OYLA 4EEYA 2YKMA 3MEDB 4RW4A 3JSMA 4DSIA 3IGVA 3RTVA 2BDPA 4ECYA 1CSJA 1BIZA 1RDDA 4ID5A 4JV1A 2DFHA 1L3TA 1I3AA 3KJVB 4F4KA 4RW8B 3BREA 3KLGB 1RTDA 3H40A 1BQMA 5CYMA 1LAVA 4RU9A 4FLXA 4KHWA 1BCMA 4JRPA 4BWMA 4BDZA 1ZTWA 1UA0A 5K14A 1L5UA 4FJMA 5DK5A 1NKBA 3PJWA 2PYJA 4DTMA 1A5XA 1S1UB 5CYQA 5KFQA 5KFOA 3LANA 4XPCA 4F4YA 3AVBA 3OL9A 2JLEA 1DTQA 1QQCA 4CJKA 3OYGA 4IG3A 1S1WB 4RNFA 3VQBA 1B9FA 2Z1HA 4LD0A 4E7HA 1XI1A 2D41A 1RTHA 1NNDA 1LWCA 2GC8A 1BL3A 3AVIA 4FJ5A 3AVFA 4M95A 1EP4B 3I0RA 1RDAA 1TKTB 5DLGA 4J9SA 2HVHA 1B92A 2PZSA 4MFBB 4M94A 1WSFA 1VRTB 5F8HA 3KKSA 2RDJA 5EUHA 1FKOB 4FM2A 4FLVA 3AVKA 3KLFB 3T19A 3SV4A 4FLWA 4NYZA 4BE0A 1HYVA 4ZVEA 3H5UA 4YP3A 1N5YB 3O4NA 3RR7A 4IR9A 1VSFA 5L1KA 2QK9A 3OLBA 4U6PA 2KZZA 4B9NA 1CLQA 2FVPA 1JKHA 1CZBA 4B8CA 4ZP6A 2W9AA 2UVRA 4N56A 5HBMB 4AHSA 2FVCA 1FK9A 3AO4A 4O3NA 5KFVA 2F8EX 4OJRA 1BIUA 3VQ7A 1S6PB 3VN5A 3RMCA 3VA3A 4DU3A 1TKDA 4NRUA 4C8KA 3V1RA 1IKYA 3TR8A 3M8PA 4CHPA 1ASUA 4IFVB 3VA0A 3SPZA 4FJXA 3Q8RB 1NOYA 1DTTB 4B9MA 3V9XA 2F8TA 1FKOA 4QWAA 4AHVA 4LY7A 2IM0A 2Z1IA 3CG7A 1U48A 2UVWA 4MK9A 3HYFA 4DS5A 3OSNA 2R7YA 1KCFA 2E9ZA 1J5OA 1RTIA 3PX0A 2YNHB 2JC1A 3V6KA 1WSGA 1G15A 4FW2A 1J5OB 1D1UA 5T14A 3MECB 3LWLA 1N6QB 1RDRA 1O1WA 4FJ9A 1QSLA 1C1CA 3NAHA 1S1TA 2E4LA 4NZ0A 3MFHA 1D0EA 5J2PB 4NLQA 3IS9B 3PW7A 2VG5A 1RT6A 5DGBA 3PR5B 3T5KA 3TI0A 2A1SA 4Z4GA 3CM6A 2RKIA 3OYDA 4EZ9A 4H4MB 3L3UA 2XC9A 3RMAA 3SQ0A 3QNNA 3BGRA 3SCXA 4I2QB 3NF8A 1VRUA 5F9NA 3QZ7A 1RT7B 4DLGA 1NK0A 3HPOA 3MEEB 4WXOA 1S6QB 4ECTA 1S97A 4NLTA 4K50A 5HBMA 1TKXB 3GV8B 3OJSA 4K4YA 4F4WA 1HRHA 3PO4A 4J2AA 2Z1GA 4NLDA 5KFWA 2JGUA 5HP1B 3KK2B 3CYMA 4JUZA 4RUCA 2P51A 3GIIA 4Q5VA 1HQEB 4CGJA 3G86A 3L2WA 3BQ1A 4K4UA 4EP4A 3F9KA 3O3GA 2HW3A 4ED6A 4DTXA 1KHWA 4HKQA 2E6MA 3Q8QB 3V6JA 1BISA 4EYHB 4KHMA 4ED0A 2PYLA 4WFXA 5J2MB 4CERA 4NCGB 3HVRA 1VSDA 3HVAA 3QINA 3D5MA 5C24B 3HT3A 3K5OA 3OYBA 3CFPA 2OA8A 4DQIA 3CO9A 3QNOA 4E7JA 2V0NA 5HROB 4CFBA 4FS2A 1S9GB 2RF2B 4UQGA 2AWZA 2Z1JA 2KFNA 4J9OA 4BE1A 4ZPDA 3SFGA 3KKRA 5K14B 4DTRA 3CQ8A 3AA5X 5KG0A 4E3SA 1MU2B 3PV8A 2OPQB 4FK4A 4XIUA 3AV9A 5KG7A 3QO9B 1FXXA 4RW8A 4FLYA 4F2SA 4O44B 5KFTA 4YR0A 4FJHA 1S0MA 3NH1A 2FLLA 3ZT1A 2HHVA 2YNIA 4Z4IA 4CF8A 1WSHA 1X9WA 1LW2A 1GOBA 3MF5A 2YKNA 1IG9A 1QUVA 5C42B 4CGIA 2X74A 4DTJA 3H4BA 1BCOA 1RYSA 5KFGA 4K4XA 1TL1A 3C6UB 3QERA 4NLUA 3AVJA 1RTJA 2ZE2B 4IR1A 1HMVB 4RW7B 3NGZA 3G0ZA 1T05B 2G8UA 3OYAA 1FKPB 3ZSRA 2W9BB 4ZP8A 2BE2A 3UIQA 2HNYA 4B9TA 3WNFA 2OPSA 3RMBA 3FSIA 1T3NA 2XRIA 1NJWA 3HK2A 3C95A 1NK9A 4ECRA 1GOCA 4Q8EA 4J9MA 1F21A 2F8SA 5KRSA 4H54A 2QXFA 1A5WA 4KI4A 3KHGA 3ISND 2IAJA 5HRRA 5HLFB 4KBIA 3NBPA 4Q43A 4ZPCA 4CEOA 2HNDA 3DRSB 4YMEA 1S0OA 3QEXA 4E0DA 1S1VB 4TN2A 3H4DA 1S0NA 1KSPA 4KAZA 4DS4A 4FM0A 3KLVA 1EETA 4E7LA 3DLKB 4OKJA 3LAMA 2DPJA 2JEIA 1JLEA 4FZXC 3CDUA 4RW6B 1K6YA 3VQEA 2ITGA 3AVGA 4FZZA 3TAMB 3EY1A 3OHBA 3DOKB 3K5NA 2IGIA 4N5SA 1WSJA 5F8LA 4CF0A 5HRNA 4W5NA 5KT4A 4M3TA 2KQ2A 2XO7A 4URSA 3H5YA 3K5MA 3E51A 4X2BA 4ZP7A 2AGQA 3OVNA 4O5BA 3G6VA 2HNDB 3DRSA 4O3RA 1T7PA 4AILC 3ULDA 2R8GA 3BSNA 4FJIA 4FS1A 1JX4A 4LQ3A 4WFZA 2ZD1A 1ZYQA 5HRSA 3K57A 4ZVGA 1RT3B 4KV8B 2E6LA 3HL8A 3H5XA 4NCGA 1KRPA 4ICLB 4Z4EA 2WONA 4R0EA 3K59A 4Y1DA 3BSAA 1TVRA 3V81B 3CDWA 4N76A 1TKZA 4HHTA 3RB6A 3RBEA 4URGA 4Q8FA 3GILA 4CE9A 2BANB 2HWHA 4Z0UA 2DPIA 3LPTA 3M8QA 4HUGA 4ZTJA 3AVAA 1HNVA 1SH2A 1IKVB 4AHRA 4FK2A 4IQXA 4TSXA 2XCAA 3IGNA 4R5PA 3LWMA 2KZMA 3KHHA 4ID1A 1IM4A 3IAYA 2IM3A 4E89A 3KMQA 2WOMA 1RT2B 4I9QA 1YVFA 2IOCA 4EZ6A 5L1IA 3UPFA 1Q8IA 4HVJA 4EBCA 4HTUA 1S6QA 2FC0A 3B6PA 2XCPA 4KTWA 5F8JA 4ZVHA 3FRZA 4CGDA 4QWEA 3KK3A 4KTZA 2VG7B 3M9NB 1JLCA 2RKIB 1J53A 3SQ1A 1SKWA 1JLQA 1HYSA 1KLMA 1KLMB 1S9GA 2RF2A 5KGWA 1SH3A 2AGPA 1KVAA 4EO8A 3IG1B 1ZBUA 3RRGA 3KHLA 5J1EB 4E7KA 5KGXA 1N6QA 4O3OA 3V9WA 2VG6B 3MEGB 5DG7A 2ASJA 3BJYA 3M9OB 2IS3A 3E01B 1EKEA 3ASMA 2HHSA 1U49A 3TABA 3VQ9A 2B5JA 3UQSA 3OYCA 4DQRA 2YNHA 1XR5A 4EBDA 3SI8A 3QYYA 3DMJB 4O4GA 3ZSYA 3VQ8A 1SL1A 4PY5A 3HKWA 3I0SA 4W5RA 2WTFA 4R8UA 4AH9A 4ECQA 3OY9A 5KFNA 4FLUA 4CHZA 1N56A 3AO3A 4F8RA 3I8DA 3M8QB 4E19A 2D3ZA 2I1RA 4FJKA 4GC6A 3M8PB 1GX6A 2WHOA 2B6AA 1IKYB 4DL4A 2GBZA 4K4SA 3PUFA 3H5SA 1XWLA 1TKZB 4YFUA 4F3TA 2P1JA 4CEQA 1YVUA 1B9DA 1S6PA 1JLFA 3D28A 3GV5B 4CHNA 2IA6A 2FLPA 5KFJA 2ALZA 3O3HA 1S1XA 4CHQA 4MK8A 5KFIA 3CIZA 3N6LA 4C8MA 1JLFB 4IFYB 4MK7A 4I2QA 4KI6A 1N4LA 5SZTA 4B9LA 4FXDA 2BRLA 4W5TA 4WZQA 4KHSA 1ZBFA 2LSNA 2OYQA 3RB3A 1RT6B 3TARA 1S9EB 3U3GA 1RT1B 3OL7A 3I5AA 1S9FA 3TAMA 1VRTA 1VSHA 3IRXB 1S1TB 3KD5E 3KHRA 3ZSQA 3G10A 1TKTA 4CF2A 4RNNA 4R8UB 4TY8A 3SUNA 3DLGB 4ED8A 5KFLA 4Z4CA 5KG6A 3SI6A 3DDKA 4QWCA 1XR7A 3DLKA 3JYTB 5I42B 1SKRA 5L1JA 1EETB 5I3UB 3DMJA 1J54A 2X78A 4ELTA 3RB4A 3B6OA 3RRHA 1S10A 4Z4FA 3DOLB 3QEWA 4CECA 1S1WA 4DQPA 1NHVA 1RAJA 3KTQA 2HB5A 4EO6A 4KREA 1HNIA 4IKAA 2EHGA 4CK3A 1YTUA 4ZVFA 1WNSA 1DTQB 3OL6A 2G8HA 1U04A 2FBTA 2WCXA 3HPGA 4U7CA 3DLBA 2WK4A 4PWDB 3D0PA 1JLAB 4OLBA 1RDCA 3VQCA 5KFSA 2HHUA 1RCHA 1LAWA 4LSNA 3PR4A 4ED3A 3EPGA 3SZ2A 4CJ3A 1Y97A 1UOCA 3DLEA 3V6DA 2DY4A 2G8FA 1WLJA 1T05A 3SQ2A 4DTPA 5KG2A 1VSJA 3KLHB 3L2QA 4CJPA 1ZBHA 2WB4A 2J6SA 1TL1B 1L3SA 4RW4B 4CEDA 3GYNA 4CJLA 4NYNA 2VWKA 1YTAA 4MIBA 2R2RA 2V4QA 3QZ8A 2EX3A 4FBTA 5DQIA 2GV9A 4AHCA 3ZT2A 4DF8A 1GOAA 2HHWA 1HNVB 5J2NA 3KLHA 3NDKA 3PX6A 5JXSA 5KFUA 3O3FA 3EYZA 2G8KA 4FYDA 2IMWP 3FDSA 1KHVA 1XR6A 3GIMA 5CZ2A 1XHZA 3MXJA 1MU2A 3LP0B 4ELVA 4BACA 5KT7A 2VA2A 4FZYA 5EU7A 3TVKA 2E9RX 4KKOB 2WONB 1C2PA 3DYAB 1R0AA 1U47A 4EYIB 4MH8A 4ZHRB 1LWCB 1RT3A 3OYNA 3ZSVA 2IJNA 4FK0A 5HROA 3KD1E 2YNGA 4RNOA 5KFPA 5SWMA 4M3UA 4CFCA 4NLWA 3LZJA 3NMAA 1HQUA 1T8EA 2J6UA 1CXQA 4OGEA 1UWBB 3KK1B 2F96A 3PW0A 1A5VA 1UWBA 3KK1A 2DFEA 2UUWA 4CF1A 3VQAA 4CJVA 3RWUA 4G3IA 5C24A 2A1RA 4CFAA 2AGOA 3RB0A 2ETJA 3CDEA 2C22A 3JYTA 1RBTA 3G6YA 3BQ0A 3LP2B 5J2MA 1QSYA 3NFAA 5DGAA 4FJGA 4QWDA 4TY8B 3LP0A 2ATLA 1SL0A 3ZT0A 1JXBA 4DEZA 3IRXA 4DWIA 1JXEA 3KLGA 4FJJA 4BE2A 1BI4A 3OYHA 2XGQA 2JEJA 1S9EA 4M45A 1QTMA 2D3UA 1TAQA 3ZCMA 4DSLA 3PW2A 4B9UA 4NLVA 4B3OA 4JS4A 4I7FA 3C94A 3K5LA 5CZ1A 3H08A 4NLRA 2W8LA 4IFYA 2D7SA 2KW4A 2HVIA 5F8NA 2QKKA 2OPRB 3OJUA 3LP3A 1WSIA 5KT6A 4OKEA 2KFZA 4NLXA 2ASDA 5CY4A 1RT7A 1VRUB 3HVTB 2G8WA 3L2RA 1ZETA 3BGRB 2OPSB 3HVWA
chains in the Genus database with same CATH superfamily
4Y2KA 3QRQA 1EX4A 2IDOA 3KIOA 3CMEN 4LSNB 2G8VA 1F3VA 1KFDA 4HHUA 5GADI 1LW0A 2X7IA 2DNZA 5HMZA 4W5QA 2QL9B 1ZBLA 3AAWB 4CJWA 4BGBA 3UNGC 4CEZA 1YWXA 3MTJA 3CD6S 3TAEA 1Q81O 4E1NA 2ZVSA 2EC2A 3E9LA 2RE2A 2UVVA 3T3FA 1VDHA 1SQFA 3KJNB 4PG7A 1PCAA 2DNRA 2Q1LA 3NY0A 5I3UA 2FJBB 2E66A 4QU7A 2MKYA 2D0CA 4GVEA 5B8HA 3ET6B 1IQTA 1CZ9A 1QTNB 3BQ2A 2NRXA 3TAGA 4CLFA 4ELUA 4NXNJ 1VSMA 8RUCA 4XH4A 4OIXA 1YXQA 3VPZA 2NXNA 1UL3A 3M1VA 4LF9F 3H59A 5KFAA 1FEEA 3TWZA 4JKDA 1TP7A 1FT8A 4JKAA 4M3XA 3ZT4A 4OLOA 2YHYA 1UFKA 2CDRB 3CXCM 1CQMA 1MWKA 5BJRA 3FZKA 1G6BA 3E3XA 2WOMB 3ZZPA 2YTCA 4QW8A 4JI2J 2HVEA 1BDGA 3MR6A 3HP9A 2CQ0A 1VMBA 5H1SQ 3VERA 1BG3A 2AZ1A 3IWNC 3GJRB 1T03B 2RU9A 3GV7B 5JLFA 2HAFA 3VQ6A 3KLFA 1NLKL 4DTOA 4X62J 2Z57B 2KL8A 4QOZB 3GWCA 1K8KA 2QSWA 3VHQA 4U8VA 5KFYA 4CVNE 4JNEA 4M3YA 1FE0A 3KZBA 3WNEA 3HM9A 2XHBA 1YJ7A 2QM1A 3HRGA 9ATCB 1CBKA 3Q86A 3W5ZA 3R8EA 5MLCV 3IM8A 1S5JA 3LM2A 4TY9A 3D45A 1ICEB 4FSVA 4XDDA 2F4VK 1ZM3A 4KFBA 2AJ2A 1X4DA 1VSEA 2UUCJ 1T9WA 2YNFA 2D3O1 3SUPA 2ZH3A 3R5DA 3M8RA 2O66A 3SJJA 2ILZA 3ULHA 2DNQA 4LF6K 4K2XA 3PSIA 3HULA 1JLQB 2VODA 2IC3A 3SBGA 1N5SA 3AJ2A 3UFCX 4I64A 4DCHA 3B4DA 4KHYA 1RTDB 3MUTP 3MDFA 3J7YI 5JUMA 2W4CA 1U6FA 3NVMA 4ID5B 1NZ8A 2E1AA 3NF6A 5KPTA 4FYVB 3PG9A 3IN5A 3GFHA 2DKOB 3PLAA 2BV3A 4HR2A 1WORA 4CM0A 1CJVA 3FBFA 2K06A 4LBHA 3ENWA 2QLBB 4JI7F 3MR2A 1HPZB 4I9LA 5KG4A 3ITHB 1I6JA 3MM5B 3PO5A 5DM7L 3V1OA 2EPIA 5KFRA 3D54A 2K8GA 4J9KA 4YOTA 2ZH5A 3HHKA 1Q4RA 4LREA 4QU6A 1VJWA 3Q8SB 4ZIVA 1Z6RA 1HMVA 1RT4B 1RJJA 3U9DA 1RTJB 3NMRA 3EE8A 4JI4K 1FK9B 2V5HG 4QYZJ 3E9OA 2E5GA 3LTOA 1FWLA 3RSEA 4MDBA 1FD2A 3S01A 1UVJA 3M5RA 3BSOA 4L3QA 4DL5A 5KFCA 4OX9K 4FJNA 5F1XA 3J81U 4CESA 4MKAA 4MIAA 4DXLA 2MKKA 1C1AA 2Y9HA 2CQIA 3QO9A 2X6SA 1W25A 1WAJA 5KG5A 3F9MA 3A8IA 2OPQA 5DM7Q 3U9ZA 4DV1F 3CJRA 3N6MA 2QA4G 1RAFB 3OYMA 4EBEA 5ETRA 1RBUA 4FLZA 1ASWA 4CHYA 1CLFA 3CC4S 2HQDA 4CGFA 1MNEA 1C0UB 4DFPA 3FQKA 3P45B 4E7IA 2XY5A 4ETZA 3JTNA 3MD3A 2VIHA 3QSIA 1HA1A 1XBWA 1RWNB 3WZ0A 2VICA 5HANA 1OYEA 2V69A 2BGGA 3ZC4A 4FXVA 5IQ6A 5BPMA 2BE2B 4NWBA 3T6JA 1MA9B 5KG3A 2W2MP 3MHYA 4RCHA 1T9VA 1NM2A 3HVTA 4WTYA 5FPEA 3QLHA 4FNHA 4NCAA 3M30A 1OY8A 3U8XA 1T9UA 2Q6CA 4J9RA 4J90A 4X4OA 2DHAA 3VQQA 1Q53A 4QAGA 3HO1A 2XSJB 4M3WA 2HQIA 4E1JA 3FBBA 1MLAA 1H2UX 1BI4B 1TAUA 1QE1A 1YJRA 4DCJB 2BBEA 3KWIA 4TQRA 1UEUA 2FTRA 3ZEUB 3OW2R 3GIJA 4ILHA 2UXDK 3VQ5A 1RYRA 2B4PA 4F26A 2VG5B 4Y2CA 2VJUA 4QYZK 1HHTP 1ZPWX 3V4IB 4TVAB 4HTJA 1RAIB 2WBRA 4JI8J 1U2CA 1V5IB 3QGIA 4IH7A 2ZBQA 4CO2A 1FD8A 3QGHA 4WZMA 4KHQA 5E3QA 4LQ9A 1NUEA 4M5LA 1G99A 1IKWB 2HGNA 2CQ2A 1E3MA 5SUHA 2WC9A 5C25A 2SXLA 2A41A 5GADP 4IG0A 2OEJA 2Q3PA 3CCSS 1TL7A 1XJWB 1BY9A 4OLAA 4NASA 2CGJA 3FBCA 1VSIA 2F9JA 1KC8T 4H8KA 4BR7A 2HHTA 4K8ZA 4DUYJ 1NKEA 4ZVOB 2MDAA 3W9IA 4BRQA 1N0VC 5M2UA 5BRDA 3UVJA 1WB9A 3AY9A 5JVGL 4HACB 1HWIA 5E3PA 4LC9B 3FZHA 3BV8A 1U0HB 4H5NA 3ZSZA 3OQ2A 3A8YA 5EOYA 5GAGP 1VQNN 5M1NA 3QBWA 1P9YA 1WELA 4DV3K 2EKNA 5TKYA 2XLKA 1H73A 2MSTA 5A6WA 1RAOA 1F60B 1N48A 1NHUA 5LSLA 5CCLA 1LWFB 2FHJA 1WACA 3IS9A 3BF3A 2RUSA 2FZGB 1LOTB 4MFBA 3LDQA 2N4DA 4KBOA 4BC3A 1VQKN 5A8KB 2CNOB 2ZDOA 5EDWA 1YHQS 3CJ8A 3FKBA 3N5FA 2VD3A 1OSDA 1QY7A 2O01C 2ZHAA 2HMPA 4O3QA 1RUSA 4HWIA 3JQKA 5ETLA 2CRLA 2JOQA 4HTIA 5A8WA 2NUBA 1LV5A 1FX4A 4X62K 2R8IA 2D69A 2HLUA 5ITHA 3K8VA 1S3XA 3ZXWA 3DOMB 4IOCL 2N7CA 3DLGA 3BGFA 3K2YA 4XEIA 1YI2S 4A48A 1YBAA 2DNHA 3QETA 1XMQF 3QRPA 1WHXA 1RT1A 2VA3A 2ZH4A 2R4FA 1Z4UA 4CO1A 1XC3A 3OVBA 2CAJA 1ZXOA 4PQUA 2B7BB 3KJVA 1T9TA 3LM9A 2IRUA 1EX8A 1RT2A 5FD1A 3JSMB 1RAGB 1JKHB 4HUEA 4B1WB 4H4KC 1RHRB 1VISA 1GX5A 2GQCA 2C2RA 3SEOA 4CDIA 1AFJA 3ENBA 3BKUA 4M42A 2HRTA 3CC7S 4X64K 2FC8A 4OYWA 4X84A 4B1YB 2I2YA 3S3MA 4FPAA 5KFEA 3BS9A 2QLJB 3S9HA 1W2IA 1NM1A 2UXCJ 3NAEA 2CADA 3JAMO 2QKBA 4K41A 3AVMA 3RBXA 2Z4PA 3G6EN 3AB2B 3K5PA 3D7EO 4FM1A 4Q45A 3H46O 1S57A 1BUXA 4QS7A 1W2BM 3VAIA 4DG1A 4DL7A 4IEIA 1A9NB 4QS9A 2BQRA 4DV1J 3KJQB 3OXGA 2VFTA 2LU1A 3ADAC 3G4SN 3I9V9 3FFIA 1IM6A 3CCEN 2U2FA 4DB3A 1JLBA 2YXLA 4BG9A 2EWSA 2L9WA 1S72S 1X4EA 1NU0A 2CG8A 4IBNA 2AD9A 3DI6A 4HL9A 2KJWA 3NS6A 4ILJA 1O13A 1RAAB 4OZ5A 2YH0A 5DQHA 4DQSA 3ULEA 4WE1A 2DNNA 4CLLA 4X4PA 4DLEA 2HFSA 4L76A 3AO1A 2RRAA 1WN7A 2DGUA 3MEDA 3N79A 1PC5A 4LF7J 3U1NA 1LKZA 5KFKA 4OYIA 2AX1A 2DK2A 4KR0B 4BG8A 2W7PA 4IRKA 3P83D 2IJFA 3PYGA 3ZTOA 1MSWD 3DRPB 4DR6F 3SQOP 2AEJA 4N41A 4C23A 4W5OA 4KJIA 2ZNZA 3VCDA 2W9BA 4ECVA 1TVRB 1WOSA 1QSSA 1PKUA 1N32J 2Y1IA 4OVLA 2OCEA 3T1YJ 2ZE2A 3SFUA 3C6AA 3K2PA 1KLNA 2V2ZA 3P8BB 3SIPB 2H54B 3AQPA 4C9DA 2YQ0A 2C42A 2HVZA 3I87A 1LW2B 1LNQA 2QT7A 1UZHA 2R2TA 2N3OA 3ZETB 1GTEA 1Q0NA 3P4UB 2L48A 3MMCB 4WE1B 4BR2A 4M5IA 3OTCA 4Z37A 2UP1A 1HWKA 2JRSA 1AB8A 1Z2LA 2CQPA 2KKHA 1AUDA 3HSTB 4MQ3A 2O8EA 4ID8A 2QA2A 3A13A 3DXMA 2J9EA 2H4YB 5GIPA 1XUPO 1Y10A 1SJRA 5KI6A 3A8EA 2FLNA 3TQ1A 3THWB 2VKZG 2J9DA 4JKCA 3AVHA 3CW2C 4OI1A 1DLOA 3DLRA 1HQUB 3NBPB 3M8SA 1JQGA 2VPZB 4X66K 2NQPA 5HJYA 3UI3A 1JLGB 2PMHA 2F8MA 3Q83A 4YUDA 2O5DA 2UVUA 1Q86O 3SQ4A 4X4UA 3SUOA 3CQXA 2OPPB 3T9ZA 4RW7A 2P9IB 4P7VA 3HJFA 2FPHX 4CJ5A 3C6UA 2CZ4A 4DQQA 2HVDA 2KG0A 3E8OA 5IM0A 2POKA 1FKAF 2C2DA 3JSMA 4BRPA 4DKWA 4CZIA 3RTVA 2WW8A 2BDPA 4ECYA 1CSJA 1BIZA 4K8RA 2DFHA 3BF1A 3E66A 4RW8B 3BREA 1BQMA 4WU3A 3CJKA 4RU9A 2DRAA 3PEHA 4FLXA 4NI2B 3UD4P 1L5UA 2MZJA 1TMMA 1X4GA 3VQTA 2P6TA 1EWRA 4AL6A 4CLKA 1YJTA 5CYQA 3CCUS 1N8RT 4YOYA 4A5BA 3AVBA 3OL9A 1X8DA 4JI5F 2DR5A 3MI7X 2VBZA 4RNFA 3THYB 4LD0A 2D41A 4NXMF 1NNDA 4MDAA 1LWCA 2GC8A 1BL3A 2UV8A 3AVIA 4M95A 1NZAA 1EP4B 5AJ3K 4B3TF 1K47A 1UTAA 1L3KA 1M5SA 3MM6B 1RDAA 4S0MA 2WUSA 4MFBB 3M2VB 4NYZA 4ZVEA 3R5GA 1FXLA 3EE3A 1N5YB 1HBUB 3RR7A 4DJBA 1VSFA 2IVNA 1ATRA 4R79A 5F0WA 3ILJA 4A8WA 3OLBA 2LKZA 5HL7Q 1CZBA 3G96A 5K8MA 4N56A 3HHLD 4DV0K 3OT9A 4O3NA 4BRIA 5KFVA 4DV5J 1XQIA 4OHZA 2NLXA 1Y7PA 1SS6A 4N8NA 4LFCF 3AB4B 4CHPA 1ASUA 4LSZB 1HNXF 4JV5K 3Q8RB 1ATNA 3C2PA 3EGWB 4IUFA 1V5VA 4AHVA 3W3SA 4LY7A 1H38A 1U2VA 1NHKL 1VQ8N 2QJ3A 4B3RF 3WC2A 2VQEK 3NEKA 4DV6F 2GELA 1ZZNA 4GKKF 1FEHA 5HMYA 3VF6A 1W97L 4UZBA 5HAOA 1RISA 2MKSA 1AFIA 2W7AA 1WSGA 2NNWA 1SPBP 5A2QY 4DUYF 1D1UA 4XTTA 4X4RA 3CCTA 2FSKA 3SSRA 2ZWOA 3LWLA 4O23A 2R7RA 3NAHA 2M8DB 4JI7K 5HSPA 3MFHA 3BR8A 1YG0A 3GIRA 1D0EA 1WOPA 2A2CA 1X5OA 4HI1A 2VG5A 1YQHA 5DGBA 4W92B 3TI0A 2A1SA 3HOTA 4Z4GA 2RKIA 3OYDA 1VBZA 4H4MB 3RMAA 4FKYA 3QNNA 3FRYA 4I2QB 4DN0A 2H9ZA 2W4DA 2GNKA 3TEHB 4K0KF 2L41A 2G1DA 2LMIA 4CH0S 1S97A 2OTJS 2XSJA 5EN1A 2ZWHA 4F4WA 4DPTA 2Z1GA 4NLDA 3CGIA 3G8QA 5KFWA 5HP1B 4C48A 3GIIA 4C8YA 4Q5VA 1HQEB 3SK3A 3G86A 4I56A 4IO1A 2CNNB 4B3TJ 4NL5A 2E6MA 3MPVA 2FHJD 4BRDA 4EYHB 3VF2A 1DQ9A 4CERA 4NCGB 3HVAA 3M4XA 3D5MA 5EY4A 4BROA 3WXLA 2CPHA 3EGNA 1WKJA 1VIXA 5I4MA 3T1HJ 3OYBA 3CFPA 1DQAA 1SJ4P 8AT1B 1Y3JA 2FDNA 4JEPA 5HROB 3M6WA 2Z1JA 5BYRA 3QGPA 1T11A 2OUGA 3QNWB 1KKHA 2JNJA 2X51A 3R7NB 3AA5X 1AYEA 4P71A 3LDNA 4X66J 2BJEA 3W2VB 5M1QA 2O8DA 3D3CJ 2OPQB 2DR7A 5KG7A 4FLYA 5LMUK 2C3YA 3O80A 1VQLN 3WXJA 3O6WA 2LEAA 4AXJA 1TU0B 1M5OC 2F63A 2RQ4A 4PCQA 1WSHA 1E6VB 4NEZA 4P10A 2QN6B 4B1UB 3ILLA 1XMOF 5C42B 3CB4A 1EKRA 3H4BA 1BCOA 1RYSA 1HKAA 3VAHA 3QERA 1JK9B 2ZE2B 1O6XA 5GAEI 4IR1A 5D78A 1HMVB 4XAKA 1KOOA 3G0ZA 1T05B 2G9OA 1S59A 1FKPB 2W9BB 3ZX0A 1QUPA 5AXMA 3WNFA 3W63A 3RMBA 4C8ZA 3FSIA 3HK2A 3I4PA 4NLCA 1GOCA 4Q8EA 3DXBA 3ILIA 4C98A 2DY1A 1UPPA 2CWKA 3MMAA 4FNIA 3T1YK 4Q43A 3L6QA 1P8ZA 1VAZA 1JJHA 3P5TL 1RGVA 3DRSB 1S0OA 4TN2A 4WK3A 1KSPA 4KAZA 4DS4A 4HVZA 1PO6A 1IBMJ 3B4MA 2CZ9A 1FFWB 5B0AA 2HF4A 4OKJA 3NGRA 5BR8J 1N34J 4OI0A 2K3IA 2QIFA 1LCUA 3GYGA 3F5TA 1H72C 2ITGA 3AVGA 4DR1K 4FZZA 3K5NA 1GMVA 2IGIA 2ZH9A 3O44A 5GMKa 2NSBA 1YITS 2P5VA 4LMZA 2OTLN 4BRLA 4ZP7A 3FUYA 1OY9A 4O3RA 1T7PA 3P4IA 2P9KA 4DUYK 2EXUA 1U2RA 4FJIA 4FZVA 1S7HA 5AQYA 4F9OA 4MYUA 1RLCL 4ZVGA 1RT3B 3H2UB 2E6LA 4CZCA 1YRUA 3BO4A 1CC7A 3KUEA 3W9HA 4ICLB 5K8OA 5FJ4A 5B08A 1TKZA 2G2ZA 3FCHA 4DOZA 4URGA 2B8PA 4Q8FA 3GILA 5D0HA 1X3MA 3TZWA 4GKJK 4Z0UA 4FWSA 1DY3A 4JYAF 4MYTA 3AVAA 1NU4A 1IKVB 1KXPA 5IC6B 4ZKAA 5JJBA 2YWKA 2CVIA 4FK2A 3UCZP 4IQXA 2L3MA 2BJDA 3OR1A 1V3ZA 1UKUA 4ID1A 1IM4A 3T7ZA 1YJWN 4A8KA 3SQGB 2WOMA 1WUUA 2E1PA 5L1IA 2QWMA 4HVJA 4HTUA 3B6PA 2XCPA 4KTWA 4ZVHA 2E5LJ 3BPDA 4CGDA 3HX9A 2VHGA 1VHXA 4H5TA 1LFPA 2KN4A 9RUBA 2VG7B 3R6LB 1NDCA 2RKIB 3WIUA 2WZ1A 2YY3A 4M5NA 1F9EB 1SKWA 1HYSA 2RMLA 5AFUH 2C2MB 4CYUB 2DRBA 2JFKA 5KGWA 4I1TA 4QIEA 3RRGA 4IXCA 3KHLA 2VG6B 2NPIA 3MEGB 1AZSA 3KWMA 2RQCA 1Q8LA 1EKEA 4DUTA 3O2IA 2HHSA 1U49A 3KG4A 2HHHK 2B5JA 4PPDA 3MN9A 2QWOA 1AT1B 4UW2A 3SI8A 2LXUA 2VKRA 2ZOMA 3QYYA 3IM9A 3DMJB 1SL1A 4LF9J 4CLPA 2A3JA 3P49B 3L3CA 4JK9A 2WTFA 4JI1F 3BUZB 1U2VB 2XTJP 5A8KA 3Q22A 2YX6A 3CC7N 3OY9A 3U02A 4LF5K 3PRDA 4KGVB 4F8RA 1SVDA 4CZKA 4E19A 3VAMA 3IWXA 1SC3B 1MN9A 4JHDA 4BRNA 2WHOA 3HKZD 3A4TA 1XNRK 3CETA 1TKZB 4FWQA 1VBKA 3ZZYA 2P1JA 2B4VA 1B9DA 4OJGA 3D28A 3GV5B 4CHNA 2EFQA 2IA6A 2FLPA 2ACMA 1I94K 1N5VA 3WUHA 3WT0A 4UOGA 5D4OA 1M5PC 2W2OP 4M63A 4IOAQ 3A8JA 4KHSA 1RHJB 1RDWX 2OYQA 2MB0B 3HJVA 4DR7F 1B0TA 3U3GA 3T1HK 1U1LA 3I5AA 2W41A 4DV3J 3IRXB 3G10A 1Y0HA 4R8UB 2H1YA 1WI6A 3SUNA 3MM6A 2G13A 2GGPA 4H0XB 3DDKA 4FWRA 1SKRA 3F56A 5L1JA 1EETB 3D2FB 3RB4A 1IQZA 3RRHA 5EXWA 3DOLB 1HKGA 2LQ5A 3W3DA 1ZAWA 2HB5A 3OXFA 4KREA 3PHTA 4CK3A 1DTQB 3OL6A 3QWUA 5THWA 1WI8A 1BA0A 5GAHP 4WQ5A 2WK4A 2A40A 1K73T 3D0PA 2KI2A 3MCMA 2QA4S 2DH8A 3VQCA 2JWKA 4BHQA 3TQEA 3H1QA 4DV5F 3QT6A 1RBOB 1WLJA 1T05A 4LF8F 4DTPA 3L2QA 4Y00A 1TL1B 4OHXA 1L3SA 1VQ4S 4CEDA 3GYNA 3HD2A 4M63C 1YTAA 2GO9A 4L72B 4DF8A 2DISA 2AT1B 1FCAA 5D77A 3KLHA 2OSRA 3OFFA 2PDAA 1ZA1B 3R1XA 4LFAJ 2YHXA 4X65J 3LGNA 2YPYA 4FVUA 2ZOFA 4LF4F 3OTDA 3GIMA 3UDVA 3MX2A 2LU2A 4BACA 5KT7A 3TVKA 2E9RX 4KKOB 1K73O 4PEOA 1C2PA 1U47A 1OMSA 3TPQA 1N36J 4OZLA 5HROA 3UCGA 3BEXA 3UKRA 4M3UA 4CFCA 3NMAA 1HQUA 2ASYA 4OGEA 1UWBB 3KK1B 4B1XB 1A5VA 1DQ8A 1UWBA 3KK1A 2ZH6A 4C3MA 2ZJRL 2UUWA 3A1YG 4CJVA 3GE9A 2LQJA 3BBFA 1GLBG 4CLYA 2A1RA 3DHXA 4CFAA 2AGOA 3RB0A 4XH5A 3C8YA 2ETJA 3CDEA 3JYTA 5J2MA 3IBFB 5DGAA 2ZF5O 4TY8B 2ATLA 1SL0A 3AXMA 3ZT0A 1Y11A 3W61A 3BKTA 3I31A 5HL7L 1GFWB 3VVUA 4YY3J 1S9EA 4M45A 3GB0A 3MCSA 2YPZA 2D3UA 2XS5A 5AQNA 3PW2A 1MMNA 2FZCB 1FA0A 2V9KA 4JS4A 5JLHA 3L4BC 2W8LA 1JB0C 4WCEQ 2HVIA 4K43A 2RD5C 3GR0A 1C0FA 2CIMA 2OEKA 1BC6A 3EVMA 3BGUA 2ASDA 5CY4A 4J9VA 1Y64A 3L2RA 2E44A 3OTOK 1FDNA 4CRJA 3J7A1 5AQSA 3AD7C 3BB5A 5M1PA 2F3JA 2AYEA 1H6KX 3PRVA 4DV2J 2QWLA 1VQON 3L4IA 1KOHA 5L9NA 5EWGA 1TGOA 1HI1A 2V2KA 1CQNA 4FCYA 4C97A 5HOOA 4EK2A 2FJVA 3SPYA 4AQYJ 2R7UA 4YDDB 1VJQA 2C3OA 4C8LA 4WP3A 4IJNA 4ZVPB 2W9CA 3VEXA 1EO1A 3PM9A 1HBMA 1P90A 3VGKA 1HD1A 3GONA 1RT5B 4DX6A 3VAJA 3IO1A 4JI5J 4HYKA 3FMBA 1R8AA 4DBQA 2QGFB 3RVCA 3J7ZT 3DXSX 4PYDA 2GHPA 2H5EA 3BGOP 1Y00A 3I56S 3BDPA 4PXEA 1BOTO 5E3CA 3C7NA 1EJ7L 3QAEA 4KFBB 2NXCA 1REGX 1PBUA 2K1RA 2YBVA 5JVHQ 1VHFA 2HBZB 2F1FA 3UE5A 2HLTA 1FRIA 4FJLA 4LFBJ 4X65K 1Y9OA 3CJ2A 4YQWA 2FF3B 3VTIA 2FJXA 3NL0A 4KHPF 1YT3A 4ZJOA 2YWGA 4CLTA 7FDRA 2QLXA 4USTA 4JN4A 1G3OA 2IVYA 1N8RO 4DQ8A 5HQLA 4OO1J 1TUVA 1KQSR 4RUAA 1QVGR 2GZOA 2I8EA 4Y0FA 5JVGQ 2BH1A 1B99A 1I39A 2WVCA 4WPAA 4PG6A 3VVTA 2HNZA 4UOHA 3NWRA 4DU7A 2HRYA 3DU6A 5LXRA 2AJQA 4Y0WA 2Q6BA 2LFVA 2XI3A 4RG8A 2IPOB 3EJMA 4DSJA 4KE5A 6FD1A 1N33J 1R8PA 4CJTA 3DRXA 3NF7A 3NGDA 1RNHA 4JI6F 4O0IA 3KLIB 3TYTA 1VC5A 2CQ4A 4IH6A 1DRZA 4H4MA 2GVZB 4PQUB 1U1OA 4U8YA 4OZ1A 4CJRA 1WC6A 4Y2MA 4M7XA 3W2WA 1VQ5S 5J2PA 2W25A 4DHYA 3HSZA 4HTLA 1HNZJ 4YDUA 4FPRA 2RU3A 2EFNA 2LYVA 3AXKA 2KHOA 1LWEA 2PEBA 3SCLE 2ACYA 5DDOC 2A3ZA 5IC4B 4J9NA 2VFVA 2BTFA 2GQQA 2H4WB 1Q7LB 2XGPA 3QEVA 1KNZA 4C6AA 4BQZA 3Q24A 3G71S 2IIHA 3MTKA 5HO4A 4DSKA 4W98A 3EXCX 3GMGA 4DDFA 1U45A 2O4IA 1GTHA 2LDYA 2RILA 2BW7A 1X3NA 5KFFA 2HMIA 3OL8A 2XYPB 2MLXA 3SUQA 3RR8A 2KFYA 3SYZA 3FE1A 4TYBA 1LW0B 2O8BA 2OAUA 3AD9C 4DV4F 3MURP 3G9CA 2VYPA 3M6VA 3BZQA 2OKQA 3TZXA 3I8BA 1ACMB 2M4MA 3H25A 1XNRJ 1PJ6A 1J2VA 3DN9A 1KVBA 2NRWA 2P9NB 5L38A 2E5IA 3OYKA 4DL3A 2ZZMA 2OPRA 1NGBA 3V5RA 1FRLA 3HSDA 3BBCA 2HG4A 5HVFA 1RA7A 3I96A 1U0HA 3CCMN 4RWXA 5CQGA 4FOEA 2BR0A 4O8KA 1S99A 4FVMA 3UD5A 2ZM6J 2KXHA 4TXSA 2FYXA 2FJWA 5IS2A 3P1GA 1V4TA 4CLWA 2ASMA 1NGGA 5LSRA 4NLPA 4JV2A 3VQSA 2ZC3A 4XO0A 4KH0B 2ASPA 5L1LA 3IRWP 3ZFVA 4HCCA 2QEXS 1YJNN 5CE3A 2HZVA 4IOBA 3RUBL 4WYBA 3BYPA 4QIFA 4FOIA 2V6AA 5AR0A 5AQMA 1Y5IB 3RYLA 2F9WA 3SMZA 1SAZA 3AVNA 3FGUA 2KJVA 1NK8A 4NB4A 3IR5B 2DTUA 3VQDA 3HDSA 2UU9F 4K42A 1W2BR 2LA6A 3D1QA 4JKFA 2VFRA 3U1MA 1N0UA 2AQ4A 4NCBA 1Q86T 1QS4A 3HBTA 2WSCC 4TLRA 1ZA2B 3CJ9A 4PABA 3ZTRA 1I51B 3D6HB 2AU0A 3H45C 3T5HA 4U67Q 5E2QA 1TYQB 1T44A 2VQFJ 1K8AT 1J5EF 5F3TA 1WD6A 2DNKA 3SAGA 5BN8A 4ECZA 2HHXA 1JL1A 1WG4A 4FL9A 4M3RA 2E2OA 2OGUA 4TLQA 3DRRA 5E84A 3GG0A 3DM2A 2XY7A 2BKOA 3TOQA 4FDFA 1X9MA 3W64A 1NJYA 3V6DB 3ZSWA 2E2NA 4KY3A 2DTJA 4M5MA 4GC7A 3B6BA 3J81Y 1N36K 3WHIA 3KLEA 3LP2A 1MWZA 2R9LA 4K7QA 2DR8A 2DFFA 2ABYA 1RQ0A 3OPKA 2XZDB 1LWXA 2V8VA 3CCQS 1NJXA 3OBWA 3Q8PB 2H3EB 2C3PA 3MECA 1VI7A 5J2QB 4DR1J 3SV3A 4ZN1A 4ZA1A 4USMA 1FJEB 4N8OA 5JVHL 5AQOA 2CQBA 5EX0A 3NG8A 2EFGA 2O8EB 3T41A 3CCJS 4ZMMA 1RBVA 2DBBA 4GKKJ 3MR3A 5DDQC 1JL2A 1WAFA 2MQNA 3CJ1A 1C0TA 5CA5A 3S3NA 3CVKA 4M8LA 2QW9A 3PIPQ 5L39A 4V1Ak 5J2NB 1NG9A 1FWPA 2FHMA 2A2DA 3AOCA 2K7JA 5A2QU 4DPYA 3VQ4A 4G1IA 3TVYA 3LW5C 5BXIA 2EBEA 5H9EK 3NGTA 3A5NC 3D0IE 1S1XB 4FF4A 1O5JA 1IO2A 3H2LA 2VBYA 3LH2S 3AODA 2XMTA 2HFNA 1K8AO 1SBRA 4LSLB 3GU0A 1X4CA 1JCFA 2NSCA 2AJ0A 4DR5J 3MN5A 3WXIA 2NXUA 1KVCA 3KMSA 4ZCLA 4CWBA 2XI2A 1C1BA 3EE9A 3ENAA 2CJAA 3FSYA 3GLJA 3RW6A 3I0SB 1CJVB 2GMHA 1FDAA 4ECUA 3MM8A 2XWYA 2CQHA 3JSRA 1NKCA 4DV7F 2QLWA 2D0PA 3FGVA 3RGIA 2MXYA 1VSLA 1TK5A 3OTOJ 2FVQA 3X3UA 4OYXA 4IG3B 4WK1A 4RZRA 2CQ1A 1Q9YA 1DGKN 1D9AA 3E1YA 3CI5A 2P9PA 4Q7AA 3DLLQ 2HHQA 3TEGA 3TJAA 5F41A 2XEXA 2NYIA 4LIRA 3CFOA 1Y5LB 4JKEA 1J27A 1GXUA 1K1SA 4O55A 1WHWA 2MJUA 2CFXA 5ADXA 4GRSA 4UT4A 3M8WA 4YOUA 3EPIA 2ZBRA 4DTNA 5KOXA 1HLUA 3NS5A 5D4NA 4LUBA 3NAIA 1SC6A 1U1PA 2V68A 1D5AA 4E2FB 1UZDA 4A8XA 4IH5A 5D0EA 4RUHA 3MMBB 2YWWA 1S77D 2VL1A 4KT0C 3T6BA 3ZZTA 4NLYA 4BR4A 2RRNA 2NUHA 3QMLA 2Z2LA 1SJQA 2HMIB 4RUBA 3AA3A 4NO7A 2UUAF 4AHTA 1RHUB 1D8YA 5AQRA 1YJ9N 4DN9A 4KB1A 3DDNA 4P7TA 3TO8A 1PBAA 1N32K 4GV3A 1U26A 1HI8A 4X64J 2D0AA 4GV9A 4BC5A 1NGAA 4CIFA 2XQCA 1KTVA 3V6HA 1HYZA 5AJ3F 4AM7A 4K8XA 1LWEB 4WYWA 1Z26A 1OPZA 1OYDA 1NK6A 2HEKA 3W9JA 2E1ZA 1GLEG 1TR0A 4IO8A 4J9QA 4BRHA 3DOKA 4O3SA 2P9LA 3OBYA 5CZXA 3LZIA 1HYSB 5KT2A 3IKMA 4KTQA 4RW6A 2BQUA 4ANCA 4I6YA 4L75A 4JP8A 1JLEB 4USKA 3ET6A 2YHBA 4FBUA 2W6KA 3A3OB 4Y2AA 4WYLA 1JCGA 5IT9O 3SNNA 4B3SF 3CCVS 1GH8A 2Y8WA 4CTAA 2YKMB 4JAXA 2AJFE 3TAFA 4R5PB 2IAJB 1XIQA 5FRMA 1PC4A 1ZTTA 4HUFA 2QV6A 3OVAA 1UVIA 2CH5A 2W2NP 2KTQA 3CMAN 4TU8A 1OH6A 3CC2N 1Q16B 1E6YB 2P9GA 2WFBA 1PJ7A 1LWFA 1VQ9S 4HDHA 5L46A 2FVRA 3A12A 1RZMA 2DGTA 4ECXA 2Q0RA 3NGUA 3RRKA 3CTRA 4KV8A 1TL5A 5D0RA 3ICLA 3P5JA 3N01A 4BRKA 2X1GA 1KD1T 3NNAA 5E33A 3THPA 2P9KB 4P9SA 3AA9A 3S41A 2O1PA 4I67A 5DETA 5DDPC 4O8UA 3OTOF 3UVJB 3R5CA 4LF7F 1IXKA 3C46A 4JI3J 2BJ8A 3CJ3A 3DXMB 2CPIA 3H6EA 1EZZB 4D3GA 4AQYF 4HCBA 2JWNA 2ZJPQ 1RT5A 4YY3F 3CO0P 4LRCA 4F04B 1R89A 3R9PA 2GWKA 2UUAK 3UDCA 2B4JA 4J2EA 4YORA 2B4OA 3NE6A 4PKIA 2W42A 1TK0A 2V8GA 1U0SA 2BE9B 1IKWA 1OKJA 3C0BA 4PXCA 1IBLF 2O8FA 1U8SA 1HBMB 3WNGA 3QIPB 3QRRA 5AE2A 1TL4A 2L08A 1HQ2A 2BVZA 1YZ6A 1S6OA 4KHRA 4NRTA 1VQMN 5AZIB 1X5TA 4GW6A 3D7SB 4V19S 1OJ4A 2RT3A 5AQIA 4DV6K 4UTGA 2QE5A 4E1MA 2P5GA 1QQMA 3KJFB 5D4LA 4RNMA 4CBXA 1Q18A 2J0WA 5E3RA 4I2PB 1P6TA 1JMTA 4KH1B 4DR3J 2XY8A 4CP5A 4JI8K 1XN9A 3WEEA 5H9EJ 1NJZA 3BKFA 2PFUA 3PSFA 4OYPA 3EZUA 1EHWA 3QFHA 1X1PA 2D74B 4LFCK 3D6FB 4KO0B 3BEGB 3HZEA 4CFDA 4AL5A 3H7HB 2ZNYA 3CT9A 2BRKA 4ZPBA 2FJDB 5D6GA 4P75A 1JXLA 3EMTA 2VGMA 4X66F 3H3OB 4BRMA 4EU0A 4DR5F 4TQSA 1T94A 2RN2A 2C1EB 4EEYA 4YDXA 1BA1A 3IXQA 5AQVA 1R3NA 4DPXA 3SXLA 1SQGA 3IGVA 2CPEA 1NBEB 5ELZA 4ID5A 3ULEB 1NCLA 1N5TA 2IRYA 2ALYB 5C2GA 5F0XA 1Q82O 1RTDA 3H40A 1UEVA 4K0KJ 5CYMA 2FSJA 4JB8B 3POTA 3US5A 1BCMA 2XMJA 2KT2A 3TJ8A 4YY3K 5DK5A 3JQJA 4Z94A 1YAGA 3E9PA 3SLCA 4DTMA 2DR9A 1YK9A 2YQ1A 1A5XA 1DT9A 5KFQA 4F4YA 2WAQD 3P96A 1I94J 4E8UA 2YVSA 1GMWD 2GS8A 1KQSM 3OYGA 1OH7A 4ER8A 4GKJJ 1FI4A 4USHA 3WDOA 3KG1A 5CD4A 4YHHJ 1S1WB 3C3LA 4E7HA 3O9UA 1A6LA 4FJ5A 3AVFA 4USWA 4ANDA 3UO0A 4DR5K 2MY8A 1NMNA 1BLUA 4CT8A 1TKTB 4DR1F 2HVHA 2APOA 2R7XA 1X31C 1VRTB 2C2NA 4FM2A 3M6XA 3AVKA 3T19A 3PYEA 2VFUA 4BE0A 4G65A 1X5PA 4YP3A 3TJ9A 3NXZA 4IR9A 5U47A 4KGMA 2BMBA 2HHHJ 2QK9A 2E88A 3MCPA 1NGJA 3PTWA 4ZP6A 2UVRA 3UDEA 4UUXA 1FK9A 2OI2A 1FFGB 3OA9A 4OJRA 1BIUA 5HJXA 3TX8A 2CYYA 3HSJA 3J81j 4F0KA 1YDLA 3RMCA 3VA3A 1VBXA 4DU3A 4NRUA 3W5XA 4C8KA 3TR8A 4CW7B 4F36A 5TKWA 2Y1LB 4GVLA 4DX5A 2LECA 1XNQF 5G0RA 1VQMS 1FRKA 2A6MA 2YH1A 3V9XA 1NDKA 2QEXN 2MLYA 3MWBA 3DGPB 3IBWA 5FLXY 4JKHA 5LJWA 2NRTA 1U48A 3HYFA 1HW9A 4DS5A 3OSNA 1NSQA 3LDOA 3CCRN 2E9ZA 3K9JA 5KOWA 4LF2A 4JI3F 3G8SA 1FNXH 2YNHB 2JC1A 3D2FA 1X7VA 2RRBA 1KQGB 3MECB 4LR7A 4OHVA 1Q7YO 2VC0A 2G4BA 3K7RA 3C14B 1SJ1A 1E4FT 1O1WA 4EGLA 4DV7K 2E4LA 5K5MA 3PIOQ 1BMQB 2PGCA 3PRBA 2GJ2A 3CM6A 3TA0A 1IR0A 1MROB 3L3UA 2XC9A 2KT3A 2OEMA 3FZLA 3BGRA 2R7WA 5BYSA 3SCXA 4DLGA 4LF6J 1NK0A 1RT7B 2LXFA 2VASA 3HPOA 3MEEB 1S6QB 4QIGA 4NLTA 3EVOA 2I38A 3OJSA 5M1OA 2F4VJ 1HRHA 1LFWA 4J2AA 3CYMA 4RUCA 5C2DA 5GIOA 3CIMA 2DH9A 4QZVB 4CGJA 4K4UA 1HBOB 2CPYA 2HW3A 3O3GA 1T0TV 1DURA 3R97A 2DO0A 3DU5A 4HKQA 2MY7A 3Q8QB 3V6JA 3OBIA 4J91A 4WTOB 1BISA 2PYLA 1A0OB 1VSDA 2MHNA 2UXDF 2D0OA 1R8BA 4MKVA 5E7OB 2I7PA 1JJCB 3M2UA 1Z2ZA 3QNOA 4E7JA 2V0NA 1S9GB 3J7YU 4B3SJ 1Q1KA 2KFNA 4J9OA 2UXBJ 3SFGA 2UUCF 3CQ8A 5KG0A 3R7SB 3PV8A 1HHSA 4HT7A 2HRUA 1FXXA 2Z58B 3QFPA 4OYBA 4CLSA 2QYGA 3P31A 4O44B 5KFTA 4FJHA 4CO0A 2R7SA 1URNA 3NH1A 5LL6d 3A8KA 3FEXB 4NXNK 2XWXA 3M6UA 1F0XA 2PIIA 2YKPA 4FWMA 1GOBA 1B64A 3DCAA 2YKNA 4BC7A 1IG9A 5CR4A 1QUVA 4CGIA 3OV7A 3K8WA 3CPWM 5KFGA 4K4XA 3C6UB 2DNLA 2UUAJ 4FPIA 4NLUA 4B02A 2E1CA 2P9NA 1U1KA 4DR2J 3TSUA 2NR0A 1F2GA 4CM2A 4L3KA 4ZP8A 4DI6A 2BE2A 3UIQA 2HNYA 3GYXB 2OPSA 4K5RA 1T3NA 3QT5A 4CZMA 1VFJA 2HFZA 4BR0A 5KRSA 2J7WA 4H54A 1UPMB 1A5WA 2QXFA 1RTZA 1R7IA 3GR1A 5HLFB 2CQCA 2QFJA 1ILYA 5AE3A 4DCOB 2HNDA 2DNOA 4YMEA 3QEXA 5DM6Q 3H4DA 1S0NA 4RWWA 4PZVA 1HNZK 1WKLA 1IN0A 1HI0P 3QFWA 2DHHA 3KLVA 1DJ0A 2EI5A 4E7LA 2F65A 3LAMA 1KC8O 1EIYB 5IT9Y 4NZ6A 1TFYA 3ATUA 1HWLA 3OTBA 2PC6A 3EUNA 3CDUA 4RW6B 1K6YA 3VQEA 3O9RA 1D3WA 3OHBA 3DOKB 4IO9Q 4N5SA 1JJ4A 1WHYA 4NEYA 5KT4A 2KQ2A 3BYRA 3CD5A 3W0LA 3K5MA 3VGUA 1WJ9A 3E51A 4EAHD 2GVZA 2HBLA 1S72N 1FJGJ 4O5BA 1UVMA 3DRSA 3KDNA 3H1VX 3A0IX 3ULDA 3SMSA 4LQ3A 2Y0BB 1ZYQA 2B9WA 4P2XA 4C0OC 3TZYA 5K9FA 2P9CA 5DZ7A 3HL8A 3H5XA 3HSCA 5IT4A 4ENOA 1KRPA 1MWQA 2WONA 4R0EA 1LEOA 3RZAA 4AL7A 2E5HA 3V81B 1Q8KA 3CDWA 3PIPL 2UUBJ 1H1VA 3RBEA 1XNQJ 4P52A 4CO4A 5AT1B 4B17A 5AE1A 3M8QA 4PKDB 1UJ6A 1HNVA 3OTEA 3KVGA 4OX7A 1IBKF 3LWMA 2KZMA 4I6WA 3VGMA 3KHHA 1A7GE 4FXWA 3D4JA 2IOCA 3J7AN 2M3DA 1Q8IA 1S6QA 4NMXA 1FXRA 3H0PA 3FRZA 4PWUA 5KQ8A 3R6GB 1NMEB 4QWEA 2RQKA 2P9SA 1QZ5A 1NXIA 4KTZA 2GQ2A 2C2KB 2HQGA 1J53A 3D3BJ 4RX6A 1JLQA 2VONA 4RO0A 1CULB 1SH3A 2CJXB 4EUVA 2VPYB 2HFUA 1KVAA 5C0YA 4E7KA 1N6QA 2DGXA 3ENVA 3BJYA 1S79A 3M9OB 4GKJF 4UY85 5GAEU 3VQ9A 5BRHA 1PGZA 4NA3A 2FUG9 2IIRA 2M9KA 4DQRA 1FNOA 4EBDA 4O4GA 3ZSYA 3VQ8A 2MKCA 4PY5A 2DPNA 3MZIA 5BR8K 1KAYA 2HSEB 3AGRA 1OVYA 3HM8A 2XMUA 1TUWA 3S1TA 4OPAA 2D3ZA 3Q8VA 2DCUB 2I1RA 2HHHF 1CG2A 4ZITA 4DL4A 3PUFA 4ILGB 2GWJA 1JLFA 2QA4N 3QATA 4Y2IA 5ETNA 3FEZA 4LFCJ 5KFJA 3BDEA 4J5OA 4MIWA 2UU9K 3RJMB 1X0FA 4CHQA 2GA7A 3N0VA 3C66A 2J9DE 4KI6A 1N4LA 3W7BA 1BWFO 1WF1A 3SDEB 2Z30B 2NRVA 1ZBFA 2HSTA 2UUBF 3QSYB 1RT6B 3TARA 1S9EB 2WVEA 2VQFF 1YZ7A 4DV6J 2A1BA 2ZGZA 3TAMA 1VRTA 1MMDA 1VSHA 4CLUA 3KD5E 3MOZA 3PIOL 2PI4A 4LF8J 1O51A 3TTCA 3O6QA 4CF2A 4TY8A 3DLGB 1WDDA 4ED8A 2E1YA 3HFKA 2GAHC 5B0GA 5KG6A 4QWCA 1C0GA 1XR7A 2IY5B 3JYTB 5I42B 4M5JA 1GLLO 1J54A 2X78A 1S10A 2ZM6F 3VWSA 4CECA 1S1WA 1IBKJ 4IKAA 4KPCA 3NWGA 2R7OA 1U04A 3UKRB 2CG4A 1HBNA 3HPGA 2E8AA 1FDDA 1WKKA 3DLBA 4LFAK 4LF7K 4PWDB 1RDCA 5KFSA 1Q79A 1RCHA 2QL7B 1OH5A 1LAWA 1Y97A 3DLEA 2QRRA 1FFSB 3VEOA 3SQ2A 2MZ1A 5CABA 5KG2A 2ITMA 3TTFA 3SBMA 1W7AA 2R2RA 4CO3A 1MWMA 2EX3A 1YGYA 3ZT2A 1YRXA 3FNNA 2MQQA 2QFIA 3NDKA 4AQYK 3CD7A 4FYDA 4A2BA 2G8KA 4YN3B 2IMWP 1TL7B 4A47A 4PQAA 2H51B 2ZJQL 1XHZA 3F0NA 2HK3A 4FZYA 4PWWA 1UVKA 2GX8A 1XMOK 4EYIB 4ZHRB 4OJHA 1SJFA 5E26A 3R9LA 3SCIE 3KD1E 2YNGA 5KFPA 3EKSA 2J6UA 1IV0A 4J7CA 3M2RA 3HD1A 2D3OR 3VQAA 1UAWA 3O5TB 2MQOA 1H3DA 1MW7A 3RWUA 4G3IA 3OUYA 2MZSA 3BZCA 3Q8YA 4CI6A 1RBTA 4FJGA 4QWDA 3LP0A 5DZ6A 2BUPA 2VOPA 4K5SA 3MEKA 4DEZA 4DWIA 4FJJA 2GHVC 4ES2A 1VYAA 2GIFA 1BI4A 2D1KA 2MZRA 3OYHA 2XGQA 4M5HA 2JEJA 1WOOA 3L7PA 1QTMA 1TTHB 1WSRA 1N33F 4A57A 4MMOA 4NLVA 2KB2A 2OHDA 4B3OA 1XK8A 4A8MP 5CZ1A 5BN9A 4FF3A 2B9YA 2KW4A 3MPYA 4A46A 3F44A 1JJ2M 3QBCA 3OJUA 3LP3A 1WSIA 4KGKA 3M30B 5KT6A 1WOQA 4OKEA 2KFZA 4CBWA 3K0SA 1RT7A 1WEXA 3HVTB 1DFDA 2G8WA 3T1YF 4YS2A 1GLCG 1RILA 2HHPA 4ZK7M 3ZSXA 4DV0J 1JLAA 1ZZFA 2W01A 1RB0A 4G1QA 1G7CB 2D5RA 3C14A 3L8BA 1AUSL 4L8RB 1DLOB 1CZAN 1VCTA 2PE8A 3VV2B 3Q2TC 4CTAB 1E4GT 1C0UA 1RABB 4OI2A 1Z1ZA 3LP1B 3RG6A 4DFMA 1UETA 3LPYA 2ADCA 1KS2A 4NYOA 3RAXA 3OFGA 2ASLA 5I42A 3JSBA 1VC6A 1GLDG 5AJ3J 3MEGA 1AZSB 2A0FB 4J2BA 3SSQA 4NLGA 1P8GA 1VQ5N 3IG1A 3VAFA 4BS2A 1WTBA 2ILYA 2J9CA 5H1SV 4Q0BA 2P9LB 3W2WB 2YKAA 4C4WA 1R31A 1KVIA 4RW9B 3NGKA 2OH2A 4N77A 4PUOB 3MWPA 4EHUA 3QDKA 3O9SA 2B7CB 5FPDA 3O4QA 2VG7A 5BRFA 3ZNUA 3MFIA 4YEAA 1QHTA 2UXBK 1FRHA 1VGYA 1VBYA 3PW4A 4F50A 1I3OB 2JX2A 4O4RA 5DQGA 1RA6A 1WEYA 3FCVA 4IDHA 1S4FA 3C15A 4OV6A 1EXQA 1NPRA 1EKSA 2Y0SD 1IBMF 3FZBA 1NSPA 4O0JA 2PO4A 4U96A 3C6TB 3CCQN 4OZJA 1TV6A 4W90B 3O1WA 3S6EA 3KYLA 3HTVA 5HK4A 2JLFA 2GEMA 3PW5A 1NPPA 2RIJA 3MM5A 3HHLC 2OSQA 4ZP9A 2X3DA 1HPZA 2J7KA 2IDLA 1ZOTA 3QEIA 3NNHA 5LMUF 2HWIA 2F40A 3MAHA 3ZZUA 2V7YA 1QAYA 1YLXA 4ICLA 4ED7A 5KPRA 4O4GB 5KT3A 1B3TA 3G82A 2ZJPL 5E0OA 3K9KA 3O9QA 2PY5A 4A62A 4ITSA 2OJ3A 4DL6A 1RBSA 3HOSA 3OHRA 5HVHA 3C7NB 4JD2B 1H7XA 5JS2A 4IO9L 3MCAB 4K0KK 5KFHA 3K0JA 1C4CA 2GV1A 2GTDA 5LMNK 2QL5B 3TUZC 1EARA 4J2DA 3B78A 3KXDA 1J9AA 5HQMA 3MX5A 1NPKA 2CJQA 2AP1A 3MAAB 3T5JA 3G87A 1WWHA 2P9PB 5EWEA 1ELOA 2KYZA 3GCWP 4JD2A 3FFIB 5C12A 1U09A 4ZOSA 1LOUA 2W24A 4CQ1A 3NGIA 3LF0A 5KRTA 2QYCA 3MOJB 2DRDA 4HDGA 2XLIA 4JV0A 3GSIA 4BR5A 4AT1B 4M41A 2QMWA 4P72A 2H65B 4C7QA 4OZNA 2N82B 4QWBA 1WBBA 2IM1A 2EG1A 3Q8UA 3A2FA 1RWMB 3DGPA 1VQOS 1H74A 2ZKUA 1C1BB 3T9NA 3I5BA 4MT1A 2JC0A 4ZN3A 3NOCA 1X5SA 4NXMK 1IKXB 3HCXA 5G0RB 4PKHA 4FJ7A 4B3MK 2Y1JA 1M1KO 4KSEB 3A5OC 2UXCK 3WEEB 5E41A 1SC1B 1VK0A 3C6TA 4ZS6A 1GMWA 3HT0A 4ECSA 2XMWA 4QPXA 4UF4A 4CIGA 3C15B 2ZOGA 3O08A 4X65F 1NJIO 4B08A 4NLSA 5C42A 4A61A 5T7LA 4BLGA 1R0BG 3EZOA 2ZGYA 4TYAA 5GAHI 4X4QA 4K4VA 2LQ9A 5BYQA 4C8NA 2V50A 4RW9A 2NUUG 2HF3A 2FBVA 3EX7B 4FJ8A 2HKEA 3MPWA 3G8TA 4JI3K 3CPWR 3OSPA 3AO2A 4NYFA 5KQDA 2I6WA 2CPDA 3PXGa 3LPUA 1UJ4A 3NRBA 4IOAL 3CF5L 1ZM4A 5EX3A 4GNIA 3VAKA 5KFXA 3GIKA 1S48A 4DTUA 2RHQB 1HNXK 4BWJA 4J37A 1WSEA 2M7SA 5KFMA 1FX2A 1SIZA 3RBDA 2AA4A 4F4ZA 1BD6A 2JWLA 3EM1A 1VQ7S 1R0AB 2UYTA 2FY8A 2H5IB 3F73A 1SKSA 2GJFA 2ZUGA 4ZIWA 2CKWA 3VENA 1SIWB 2LEPA 2RHKA 5FROA 2V4RA 2XY6A 4CEFA 4DR7J 1NK4A 4F25A 3KDOA 2AYGA 2U1AA 4B8AB 2QA1A 3HHDA 1HW8A 4YB6A 1AA1B 1IUJA 1LXNA 1ITGA 1HLWA 3UB5A 4F7VA 4K59A 1KDNA 4KB0A 4KO0A 4CGGA 4LT6A 3ID8A 2D1CA 3UR3C 3NGSA 4KGXB 3PVXA 2YV0X 4IG0B 1GLAG 4CK1A 2MMYA 3CJQA 4H5RA 1FHTA 4GVMA 3QIDA 2GUIA 2ZEJA 1BE4A 5KFZA 4WQ5C 1FVQA 4H4OA 1C1CB 5J1PA 4WFBQ 1NGHA 2R2SA 2F9DA 2J6TA 4IWVA 2EC0A 4KQZA 5A6PA 3VZIA 4PG5A 1JNRB 4KHNA 4MTPA 3UW1A 1YSJA 2ZKTA 1W9HA 2YNGB 1G2EA 1OWXA 3R2DJ 2CPJA 4ERDA 2ZQBA 4QS8A 4ZHRA 1X4FA 3CFRA 4NXMJ 3L3VA 4K4TA 1JWWA 4AUKA 2NZCA 3FZ2A 5CCMA 4GO5X 4PG4A 3QQCD 1BHLA 5F8GA 2UUTA 2D0BA 1R59O 5AQZA 2F5GA 1ZS6A 5B09A 3CJ0A 4PG8A 5F8MA 3IUCA 2GIQA 1PJ5A 4GO7X 2FBXA 3HHEA 3L4QA 1NO8A 2ZBCA 2OO4A 4FYXB 2WBMA 3S7RA 3NGYA 3FJ2A 2KVQE 3DGVA 1H98A 2MTLA 3VF0B 1RBLA 3BM7A 1HKCA 1HJRA 3MEEA 2QG9B 3QLHB 1HNWJ 2EFPA 2OD6A 3P5BP 5A0YA 5F0UA 4EWTA 4X64F 4LH4A 2VPWB 1PYTA 3D67A 1N5YA 4PWDA 2M0GB 4AYBD 1HNWF 1REVB 5KFDA 3RAQA 1YJ9S 3GQCA 2DJWA 3I0RB 4G6VB 4CGHA 5D0GA 1F5CA 4CJ4A 1RTIB 1WC3A 2JDJA 3VESA 5ADZA 4ZJQA 1D9FA 3CCRS 1Q7YT 5DDRC 1JCEA 4AF1A 5LJ3Y 5D4PA 3OW2M 4P2SA 4MAKA 2V94A 4KHUA 5LJVA 5CYQB 1U6BA 5F2RA 3FFKB 4USUA 5ETSA 4CZEA 2BYCA 1M1HA 1Z25A 3LAKA 4BY9C 2A42A 2VQFK 1NB2A 2FHOB 3TAPA 3THVA 5KFBA 2IBKA 2C2EA 4LSLA 1L3UA 4IRCA 4DR4F 1IWGA 2F4FA 4OLPA 5FPNA 3HF5A 3OVSA 4A59A 3CJ7A 5F8IA 1YJWS 4A4JA 5B0BA 3O5BA 4IDKB 4OX9J 2NRZA 4X4VA 1F6TA 2VH7A 3TU5A 3ZSOA 3V4MA 4DFJA 1CC8A 1UCNA 3O8MA 7FD1A 1IKVA 5M2PA 1SB6A 4CZJA 1S22A 1I5OB 4CF9A 1F5BA 1ESVA 1EWQA 4CZFA 4PYAA 3L95X 5KPZA 4M3ZA 3ZTSA 3FC9A 2JEGA 4CJQA 3W1YC 1BQNB 1ZBIA 1WHVA 2IFXA 4WBFA 2BA9A 5KG1A 3T1AA 3D0GE 2CZVC 2OZMA 4B3TK 3UNYA 3ZNJ1 2ASOA 4QOTA 2Z2ZA 1VLOA 1RAEB 3EGVA 4QR1A 3AAPA 2BQ3A 4B9SA 3MN7A 2Q36A 4XDCA 1NDPA 4Y28C 1HL6A 4L3NA 1S76D 1HARA 1T6DA 1RCXB 5FDLA 3HHLB 3KK3B 1U1QA 3MMCA 1S0VA 2EVZA 3EXYA 2Q97A 5HRPA 3HI9A 1U02A 3JSYA 2ZZNA 1IJEB 1S1VA 1MG7A 2O67A 3MD1A 1CXUA 2C28A 2FJEB 1X9JA 3L2VA 3Q0AA 4BREA 3NCIA 3GBTA 2GMLA 4OYOA 3KNAA 4FLTA 1FVSA 5B0CA 3NHGA 4CHOA 1OS5A 2P5OA 1FDBA 5BREA 2QMXA 3J7Z5 2V7ZA 1AXQA 1TV6B 4M5GA 3RMDA 3G25A 1MN7A 2HBYB 1FESA 2OZSA 1OQ6A 2MGZA 3R5JB 1SUQB 3DRPA 4LF4J 1YUWA 4OPJA 4ES1A 4BC4A 1UVNA 2Q3SA 1YTYA 3MUMP 3O8WA 3B54A 4TNOA 5DLFA 4JI0K 2ROEA 3AVCA 4R25A 4FWKA 4I7FB 2YWFA 1TK8A 3Q23A 2RPIA 4JV5J 5IWAK 4L73A 2CPXA 5HVGA 5KT5A 4PUOA 3QIPA 1BGXT 1Q9XA 1V4SA 4Q0BB 3GJQB 1YKWA 3EDRB 2XZWA 1PIEA 1UAXA 1B4SA 3N5BA 4JV5F 5CYJA 2DNYA 1JLBB 3VR1A 3NNCA 2VBXA 3K58A 4OQJA 3CUNA 3VEVA 3DC2A 5LMUJ 1QDUB 2PMWA 4CEAA 1DHMA 2M70A 1YJVA 4RTFD 2VBWA 4ZJLA 5AQUA 4DV3F 5K20B 3Q89A 4BRAA 2AEMA 1OQ3A 3CJTA 3KLEB 1BQNA 5IZHA 2JVOA 3NF9A 2XBPA 4DR3F 2XO6A 1RWVB 2QWNA 4NLOA 1XMBA 5T41A 2W7OA 3NCRA 4QW9A 2AX0A 3O9TA 1R27B 2COLA 5F9LA 3HXMA 3DRRB 5FIIA 3DHWC 2J8SA 1R0CB 3QIOA 4A8OA 2N7YA 5D3GB 5C10A 2G8IA 2R8KA 2MJNA 2OMOA 3OYLA 5RUBA 2YKMA 1YJNS 4RW4A 4DSIA 3VEZA 1H7WA 1NRKA 3R1HA 1LQ9A 3TX0A 1L3TA 3KJVB 2V8PA 3CCMS 1QVGM 3FLCO 2V8HA 5AZJA 1FJGF 3KLGB 4JI1K 2IHR1 1K0VA 2WVFA 1LAVA 3HI0A 2W4PA 4I4BA 1ZTWA 1UA0A 3GE1A 5K14A 1OPIA 2IYIA 4FJMA 1WDTA 2V2QA 3PJWA 2PYJA 2Z8QA 3H8YA 1S1UB 5GAGI 2QTDA 4XPCA 2JLEA 4OMFG 4RLEA 4IOXA 1DTQA 3W5YA 1CJTB 3CQYA 4B1ZA 3AT1B 2HQFA 1NMDA 2QTWA 3AOBA 1B9FA 3GJSB 2Z1HA 5HMXA 1XI1A 1RTHA 2K2PA 4GKKK 2ZUAA 2NXEA 2EFOA 1VHIA 2GGPB 3I0RA 3G71N 2HURA 1VS3A 5DLGA 1B92A 2PZSA 1IR2A 3M32B 2PMZD 2XMMA 1FKOB 1VQ6S 4QQBA 2B4UA 4FF2A 3SV4A 4FLWA 3ZZZA 2X1FA 2E5LF 4FKXA 2Q0UA 4ISFA 1DARA 3O4NA 5CAAA 3MPDA 4LBIA 3EICA 2DGQA 5L1KA 1F3FA 4Y65A 3H2VE 4U6PA 2KZZA 4CD1A 4MO4A 4B8CA 2W9AA 5DM6L 5HBMB 3KK7A 4M5DB 4M5DA 2F8EX 1RAHB 2LXIA 1NGEA 5D8HB 3SJHA 1S6PB 3VQ7A 2K1RB 1N88A 4N7TA 5C7PA 3HHNB 3TVZA 3R1LA 3QWPA 3V1RA 3BN4A 3HMJG 2M88A 4IFVB 4JHDB 4Y6IA 3VA0A 4NZ7A 2MSSA 1NOYA 2CQ3A 1DTTB 2F8TA 1FKOA 4QWAA 4RJVA 2CJBA 4BCAA 3AOAA 3D0HE 2IM0A 2Z1IA 2EKYA 2LP4A 4JYAJ 1RWWB 2BOPA 1MWYA 4WP9A 1ULRA 4HLBA 4U67L 4WP8A 1P1LA 1PSDA 3I9ZA 4E98A 2R7VA 4V19J 2GVDA 2R7YA 5B0FA 3L7UA 4GVBB 1WC4A 1ROFA 3PX0A 3P39A 3V6KA 1SQEA 1G15A 3GFXA 1J5OB 3MM8B 2ZHBA 1KQFB 1CJTA 4FN5A 2VFSA 2UXDJ 4IEEA 4FJ9A 3GTYX 1QSLA 1C1CA 2G0CA 3QBXA 4MLEA 5J2PB 1SI9A 4NLQA 3PW7A 1VQ9N 4WFNQ 1RT6A 2VCPA 4RKUC 3JQMA 3CC2S 3D9BA 3CMAS 2IVOA 3A3PB 2HIQA 2HS0A 4C2MA 1VRUA 3NF8A 3AGKA 1UW9A 4QIWD 2M8HA 4B3MJ 2DD8S 2HZCA 4BRFA 3GZ7A 4W4MA 4K4YA