3IRXA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with the non-nucleoside rt inhibitor (e)-s-methyl 5-(1-(3,7-dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Crystal Structure of HIV-1 reverse transcriptase (RT) in complex with the alkenyldiarylmethane (ADAM) Non-nucleoside RT Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/hydrolase
total genus 129
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3irxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3irxA05
1TV6B 1L3UA 4E1MA 5KFJA 2QK9A 1HQEB 4IG3A 1XR6A 2KTQA 4ID1A 3KD5E 5KFKA 3IRXA 1JXEA 5F8LA 3OYJA 1HYZA 2B5JB 3L2WA 1S1UA 4O4GB 1TKTA 3TVKA 1JL1A 4CGGA 1CXUA 5KFHA 1T7PA 3AVMA 3SZ2A 5CZ2A 3HT3A 2X6SA 3HPGA 4CEFA 3OYHA 4DU3A 2IM3A 2ATQA 1XWLA 3DM2B 4Z4FA 5C42A 4JV2A 3NFAA 1GX5A 4I2QB 4RW8A 1RYRA 3KMQA 1S1XB 1R0AA 1RBVA 3O3FA 2OZSA 4KHUA 4N5SA 3OLBA 4KSEB 2O4GA 4E7JA 1CZ9A 3T5LA 5DGAA 2W9BA 1TKXB 3IAYA 4J9KA 4DSFA 1J5OB 1TGOA 3RMCA 4OLAA 2ILYA 2DTUA 2C2RA 2VA3A 1X1PA 1TK8A 3LZJA 4NCAA 3KJVA 4R0EA 3LAMA 4Z0UA 4B08A 3OL8A 3Q8PB 1ZBUA 3IG1B 4N76A 3HVTA 5CYQB 4Q8FA 3MR2A 3DLGB 1BQNB 3L2QA 1XC9A 1DTTB 4K4XA 5HRRA 4AHUA 2XCAA 1HYVA 2W42A 4LSNB 4Y3CA 3H5YA 3PW4A 3NF9A 1TAQA 4KTWA 2IC3B 4QWEA 4F50A 4O5BA 2R8GA 4ECZA 2OPRB 3DOLB 4FXDA 2W9CA 4O3OA 2XWYA 3HKWA 4N41A 3KK1A 1C0UB 3V1OA 2AX1A 3CM5A 4GC7A 4K8XA 3DRSB 3RMAA 4KTQA 1VRTA 1TV6A 4J2AA 1RDAA 4KRFA 4DEZA 3RRHA 1Z25A 3LDSA 3QLHB 3SV4A 4FK0A 4NLSA 2UUTA 1QE1B 3QESA 2J6SA 3I5AA 3Q8QB 4O4GA 5HLFA 4PA1A 3C6TB 2PYJA 3RWUA 1HYSB 4ICLB 4CEZA 4KB0A 5KFWA 4DG1B 3DRRB 5KGXA 3NAEA 2C2EA 2UVVA 1GX6A 1WLJA 4FK4A 3DM2A 4DL2A 2EX3A 1YVUA 3NHGA 4FS2A 3VN5A 5DK5A 4CJUA 4DLEA 4CJLA 1VRUB 2RN2A 5KT5A 4QWBA 1I3AA 5KT4A 3V6DB 5KG3A 3ZSXA 2VG7B 3IS9B 4CEDA 4KHYA 4H54A 3CVKA 3ZT4A 4HHTA 4KPYA 4I9QA 3CYMA 2ILZA 2W8KA 1KHVA 1EKEA 1TKDA 3IG1A 3NF7A 4ED2A 3DLGA 1BQNA 3NGIA 1DTTA 3SCXA 4G1QB 3DYAB 2IJNA 2IGIA 5DQHA 3PX4A 5FDLA 2BDPA 4B9UA 1NJWA 2R8HA 5CYMB 3OYFA 2Z1HA 1L3SA 3CO9A 4XPEA 3ZSWA 2HHSA 4MIAA 2AGPA 1A5WA 2VA2A 3LPTA 2OPRA 3OYMA 5KFXA 3M9NB 1T3NA 1K1SA 1Z26A 1C0UA 4RW6A 2FBXA 2R2TA 1Z4UA 3OL9A 1UOCA 2YNIB 1TQLA 4FM2A 3PO4A 2F8TA 3AA3A 3ISND 4BWMA 5J1EB 2HW3A 3KLHB 3OYCA 3QLHA 2RPIA 1YTAA 3HO1A 1MMLA 4TLRA 1S9EA 4NLYA 1QE1A 3U6FA 4F2RA 4IH6A 3QEIA 3HP9A 3SUPA 3MXMA 2BE2A 2A1SA 1S9FA 3T5JA 2XGPA 2IM2A 2R2SA 3OVNA 3O4NA 4DG1A 4NYZA 4B9VA 1SV5A 1RBSA 3VQ8A 3VQ9A 4YR0A 4EEYA 3GIJA 4FJ5A 3QEXA 3HPOA 1VRUA 4M42A 1Q9YA 2BANB 2C2DA 2ATLA 3AO5A 2WCXA 3I8DA 2RF2B 1C1AA 3SI6A 3S3MA 4CIEA 4DL6A 4CJQA 2ZD1A 3GIIA 3V6DA 2VG7A 3IS9A 3DLEB 4FVMA 5KTQA 3AVNA 3HVAA 2FC0A 2CJQA 1LAWA 5EWEA 4F2SA 4B9TA 4K4WA 4KFBA 4CHYA 4CJSA 3V9SA 1S97A 4M3XA 5SZTA 2WTFA 4B9SA 1U4BA 3RB4A 1RBTA 4DQSA 4G1QA 2DFHA 5CY4A 1ZTWA 4U7CA 4ZVGA 3L2RA 4NRUA 2OPQB 3LP1A 1RT1B 1RDCA 3QGGA 5KFEA 5CYMA 4DTOA 1XHXA 1SKRA 3C6UB 4DL3A 4K4ZA 1SUQA 3T1AA 3QO9A 3T3FA 3VQDA 3VQ4A 5F8IA 3TAFA 1TK0A 4G3IA 3ZCMA 4EBCA 4TY8B 3AVHA 4DWIA 4HCCA 1T03B 3ZSOA 1JLEB 1BCMA 2YNIA 2HVIA 4B9NA 1G15A 1NJZA 5J1EA 4PQUB 1NK9A 2WHOA 1T94A 4W5QA 3V1QA 4M94A 3MR6A 1RDRA 1S1TA 4ED6A 4B9LA 2JGUA 4M3ZA 4AILC 4TYBA 4F4KA 3OHBA 3CDEA 1RBRA 1RCHA 4JS5A 2RDIA 3E01A 4FBUA 1VSIA 4DF8A 5KT7A 1REVA 1BCOA 1WN7A 1HPZB 3SNNA 4W5OA 1LWFB 5KFGA 4M95A 4CHNA 4KAIA 5EWGA 3VQPA 3G6YA 2B4JA 3MAQA 2AGQA 1EETB 2VG5B 2BANA 4ECUA 2AJQA 5EDWA 1NJXA 4IFYA 1RT3A 2X78A 1RT5B 4URQU 4ECYA 5KG0A 3UQSA 3OL6A 3DLKB 1IKWA 4BACA 3AVAA 1HMVB 2GIRA 2R2RA 5KFMA 3SV3A 1T8EA 1KVCA 3TQ1A 1S9GB 4UQGA 1RTDA 3OS1A 5EUHA 4FJJA 4QWDA 3TARA 3QIOA 3TAGA 2OPQA 1RT1A 4NLPA 3WNEA 3C6UA 3L3VA 5HRNA 4BDPA 3T19A 2B6AA 3NF6A 2BR0A 5C24B 2FVQA 3FQKA 4AHTA 4DSLA 5HP1B 4IKAA 4DL5A 3KOAA 4CJRA 1T03A 1JLEA 1KLNA 2VWJA 1RBUA 1JLCB 3ITHB 2HVHA 3VQ5A 4Y34A 1EX4A 4DMNA 2QKKA 3MECB 4TN2A 4DFPA 1VSLA 1U47A 2IM0A 1TL1B 4KKOB 3CM6A 4EBDA 1JL2A 5KG6A 1RTIA 1VSFA 3K5OA 3QYYA 5KG2A 4MKAA 4E7HA 3SQ1A 5L1JA 2BRLA 1RT2B 2FVRA 1HPZA 1QS4A 3RAXA 3PUFA 4CGHA 4AHVA 4CFAA 1SKSA 3F73A 1RT7B 2HMIB 1NHUA 2A1RA 2YNFB 4CHOA 3SQ2A 4CECA 3NE6A 3BSOA 1JLBB 3DMJB 1D5AA 4IRKA 1BI4B 2VG5A 3PW2A 2GV9A 4FZZA 1TP7A 2HNZA 4DQIA 3BSAA 1TL3A 2B43A 3VQCA 3CJ3A 3HSTB 1NHVA 4O0JA 2XO7A 4DF4A 3LP3A 4EP4A 4ECTA 1DTQA 4LQ9A 4CFDA 2ZE2B 3JSMA 3N6NA 4CF0A 5KG5A 3VQSA 1C0MA 4BDYA 3V81B 4FLTA 4BE1A 1S9GA 2HNDA 1N6QB 1JIHA 4ECWA 3NMAA 4CFCA 2FJVA 5C25A 3AA2A 3GV7B 3CIZA 3GQCA 2IA6A 2HHWA 1RTJA 2R7YA 1VSEA 3MR3A 3OYIA 4M3RA 3CQ8A 3G0ZA 4DU4A 1BISA 1IKVA 1WAFA 2FLNA 1WAJA 4BWJA 3KLFB 5C24A 3KLEB 1ASVA 3UDLA 1UA1A 4TSXA 2D0BA 4F8RA 1TVRA 1QTMA 3MEGB 4DFJA 4KHRA 1LWCB 1A5XA 3ITHA 5J2MB 3ALYA 4EBEA 3K58A 4HUFA 4Y2CA 3RB6A 2X74A 3OLAA 4EYIB 3I0RA 3PX0A 1XI1A 5J2NB 3K5NA 2XRIA 4FJ7A 2I5JB 1TL1A 4KKOA 4J2DA 2I1RA 1Q8IA 1RT2A 3I0SB 5KFVA 3HVWA 3EYZA 2JLEA 1HNIB 2P1JA 2YNFA 1QHTA 3BJYA 3U3YA 1JLBA 3UIQA 2FJXA 3DMJA 4OPJA 3QGIA 3M8PA 1BI4A 4CERA 4NLVA 1S1WB 1S6QA 3NF8A 4CEAA 4MQ3A 2WK4A 2UVWA 1MU2A 3NL0A 1JKHB 1NOZA 5KFDA 3QGHA 2ZE2A 1RT4B 4QW9A 4J9NA 4ELUA 2FJWA 1KRPA 4EP5A 1LW0B 3V81A 5DGBA 2YKNB 2JC1A 3VQEA 2IAJA 3MEDA 2ASLA 1UA0A 1JLAB 3CG7A 5KFPA 2G8FA 1UAXA 1S0OA 4FJHA 1N48A 3QERA 1S1VB 3CJ5A 3KK2A 4XIUA 2YHBA 4QOZB 1SH3A 2D3ZA 4I9LA 3DRPA 2C28A 3KLVA 4CF9A 4K8ZA 3PR5B 4RG8A 2CKWA 4OGCA 4LSLA 2DFFA 3E51A 4YP3A 4JRPA 2JEGA 3KLEA 4O0IA 1X9SA 4TY9A 3C95A 3NCIA 3RB0A 3ZSRA 2XI2A 2RKIB 4Q8EA 2ASJA 5F8HA 3BREA 1U48A 1RDBA 2W8LA 1CLQA 5J2NA 2Z1GA 5KRTA 1HQEA 3H08A 3KLGB 4FW1A 3LALA 1IH7A 1WSHA 2HB5A 5K14B 2B5JA 4QWAA 1WSIA 4DTRA 4TXSA 5KFTA 3CDUA 1HNIA 4KHNA 5FRNA 3H40A 3THVA 4PY5A 1D1UA 4X2BA 4DSJA 4CF8A 1RDDA 1BIUA 3RMBA 3SQ0A 2BQ3A 4CIFA 4CJ5A 2FBTA 1S1WA 4I2QA 3MXJA 1U49A 2AQ4A 3CWJA 1S1XA 4HUEA 4K4YA 4EO6A 3CDWA 1OS5A 4E89A 2EHGA 3CJ2A 1VSJA 3QNNA 3MEEB 1RT4A 5KG4A 2G8WA 1TKXA 5DG7A 4Y2AA 3AO3A 4WYLA 4DSKA 1J5OA 1C0TB 1IKXB 4BE0A 1NKCA 1I6JA 3AVGA 4CHQA 1LW0A 4NLQA 4QAGA 2XHBA 2YKNA 1JLAA 3BQ1A 4JV1A 3KK3B 4IR9A 5CYQA 1HJRA 2YV0X 4FJ9A 3GYNA 2DY4A 1HQUB 1W0HA 2FLPA 2D0AA 4RU9A 1S0NA 1Q9XA 3DOKB 4LSNA 5F8GA 1UWBB 4DTSA 3H5XA 4FJ8A 3V1RA 3O3HA 2IC3A 2ZKUA 4MK8A 3DOLA 4JV0A 2WRMA 4DQPA 1U04A 4OVLA 4R8UB 3NH0A 4CJEA 2XY7A 1N56A 3OYNA 5J2PB 3DRSA 1SL2A 3NDKA 3OSNA 5KFQA 5L1LA 3FRZA 5FRMA 3OYGA 3KLGA 3KHGA 4MK9A 1IKYB 3QEVA 4O3NA 3NBPB 1L5UA 3EPGA 3OYAA 3KTQA 3ISNC 5K14A 1LWEB 2C22A 3SFUA 2QXFA 3LPUA 4LD0A 3C6TA 4YNQA 3L2UA 1HYSA 4ICLA 4ZPCA 3DRRA 1T05B 2ALZA 4BDZA 2AU0A 4IG0B 1KTQA 2JEFA 2KW4A 4H4MB 5KFCA 5JXSA 3PX6A 4FBTA 5DLFA 3ZSYA 3MFIA 4OKKA 4MH8A 2YHAA 4DTXA 4ED7A 5KFYA 4O3PA 5L1IA 1L3VA 4IQXA 1C0TA 4NRTA 2XY5A 3LP0B 1Y97A 3PW5A 4FW2A 4CEOA 4NLDA 5HRPA 4K4VA 2IM1A 4KB7A 2VWKA 2HHQA 5D3GB 1RAJA 4ZTFA 4DTUA 2VG6B 3KK3A 4DS4A 1HQUA 1B9DA 3OYEA 2OYQA 1JLQB 1BL3A 2E4LA 1U09A 4KHQA 3DYAA 3LWMA 1ZTTA 4CGIA 5F8MA 2IJFA 1QSYA 1D9FA 3QIDA 2V0NA 2WOMB 1UWBA 4K4TA 3RAQA 1LW2B 3ZSQA 4OL8A 4AHCA 3AVFA 1ZBFA 1J53A 4CHZA 4WXOA 4CJPA 2KZMA 1NNDA 3FFIB 3HK2A 1S5JA 1QSSA 4ZPDA 5EU7A 4JLHA 2W7OA 4J9MA 4R8UA 2XCPA 4CGJA 1RNHA 4ZPAA 3SUQA 3RBEA 3D45A 4KB1A 4I7FB 5J2PA 3KLHA 4FLVA 3AA5X 2UUWA 3KHHA 1WSGA 3K2PA 3DI6B 1IKYA 2FBYA 3NBPA 3HXMA 4Q0BB 4EZ6A 3LWLA 2ITGA 4WFZA 4CGFA 4RNOA 4C8MA 1T05A 3DLRA 1QSLA 4IG0A 3EPIA 2XY6A 5C5JA 2Y1IA 3CJ4A 3UR0A 3KD1E 4NLRA 1JLGB 3AO2A 3P83D 3LANA 3L8BA 2RF2A 4F4WA 2XY8A 1HNVB 4RNFA 3D5MA 1ZYQA 4N56A 4NLUA 3LP0A 1YTUA 3DLEA 3VQQA 3KHLA 2FVPA 4HYKA 1XHZA 4R5PB 2GBZA 3EZ5A 5D3GA 3GIMA 4OLBA 4NCGB 2VG6A 4CIGA 4RW7B 2BRKA 2WB4A 3PR4A 5J2QB 4RNNA 1JLQA 1K1QA 5JS2A 5I42B 3H5UA 3OYKA 1S49A 1S10A 5I3UB 4O4RA 3PJXA 1S6PB 3QIPB 3GIKA 3K59A 3PY8A 3CJ0A 2AGOA 1LW2A 1F21A 2F8SA 2R8JA 5KFFA 4ECQA 3M9MB 3OJSA 4CHPA 3H4BA 3BQ2A 2OPSB 3FFIA 2OPPB 4J9RA 1S4FA 4GC6A 4ID5B 5JS1A 2DFEA 1BQMB 4TY8A 4O3RA 4FZYA 1JX4A 4FM0A 4F3OA 4I7FA 2HWHA 3VQ6A 2E6LA 3ULDA 3TABA 3PHEA 4PQUA 1CZBA 4Y1CA 1ITGA 3TAMB 4CF2A 2DPJA 2YNGB 2GC8A 3SI8A 4Q0BA 4HCBA 5KFOA 4DTJA 1RA7A 4CJ3A 4ZP8A 1LWFA 3NKYA 3RB3A 3M9OB 3SPYA 1LV5A 3ZT3A 1ASWA 3RTVA 1JLGA 4I2PB 2IS3A 4YMEA 1EETA 2IDOA 3IRXB 2JEJA 4NCBA 4E0DA 4CK1A 3BQ0A 1S1UB 1RT5A 1TKTB 4J9QA 4PWDB 4JS4A 2PY5A 3DLKA 4DLGA 4Y1DA 1WSEA 4R5PA 1HMVA 2XI3A 4CEEA 3OS2A 2OH2A 4K50A 5KFNA 4NCGA 3G10A 3ASMA 3F9KA 4RW8B 5J2QA 4M3WA 4B8AB 4CF1A 1JXLA 2JC0A 5I3UA 1KLMB 3HM9A 4OKJA 3NGYA 1B92A 3VA0A 4J2BA 3KNAA 3PV8A 3IN5A 4NZ0A 3KJVB 2OPSA 2OZMA 1QAIA 4ID5A 1BQMA 4NYFA 3SYZA 2PYLA 5KFLA 4MIBA 2D41A 5HP1A 1TAUA 3PVXA 3SUNA 4WE1B 3OJUA 3VA3A 1W25A 4C8NA 1JLCA 2GUIA 2G8HA 3TAMA 3V9XA 3MECA 3OS0A 3OL7A 3O3GA 3IGVA 2LSNA 1BIZA 3KKRA 2P5GA 3A2FA 3K57A 1EXQA 3KK1B 5DQGA 5KFZA 3QZ8A 2EC0A 4W5NA 1NK6A 4FJXA 1RT7A 3NAHA 2NUBA 2D7SA 2HMIA 5KFAA 2V4QA 1SKWA 4I2PA 1YVFA 3PW7A 4NYNA 3TANA 4F3TA 4RZRA 3BSCA 3ZT1A 3MF5A 3PO5A 3I5BA 4NLWA 5HLFB 3S3OA 4C8KA 4PWDA 4FCYA 1C6VA 4MFBB 2O4IA 3CFRA 1NK7A 4CJTA 2HHXA 5HRSA 5KI6A 4KI6A 3DLBA 3DLHA 1SH0A 3OYLA 1FK9B 3GV8B 1N6QA 4DQRA 3V4IB 4WZMA 4Q43A 2D5RA 1KLMA 3SJJA 4W5RA 3SUOA 4CJVA 4RUAA 4YFUA 2D0CA 3HHKA 1GOAA 4GVMA 4LH4A 4DSIA 3AO4A 1WSJA 3KLFA 2HNYB 4N47A 3OHAA 5T7BA 4HTUA 3AV9A 2IOCA 5JUMA 4ELVA 1RTHB 3MEGA 3Q8SB 1QAJA 4WE1A 2KZZA 3EY1A 4Q5VA 1LWCA 3D0PA 2R8KA 4M45A 1NKBA 2Z1JA 4IOBA 5J2MA 2ETJA 5FDLB 4FLXA 3O4QA 1BHLA 4ZTJA 5DG9A 1VK0A 2KQ2A 1KCFA 1NKEA 3RR7A 1S48A 2I5JA 3KLIB 1JXBA 4IBNA 4Z4EA 2QKBA 2R2UA 3H4DA 3EZUA 2WONB 5SWMA 3V9UA 1RT6B 2HAIA 3I0SA 4H4OB 4KBIA 4RW6B 3TR8A 1NK5A 2FVSA 4QWCA 3QNOA 2RDJA 1IG9A 3FDSA 3M8SA 2QE5A 3LP2B 3V6JA 4M41A 4CESA 1S9EB 4JUZA 3ZSVA 5KFRA 1GOBA 3VQAA 4E19A 4DFKA 2BE2B 4URGA 5KFBA 4RW9B 1JKHA 4MFBA 4GMJB 3TAPA 3BR9A 4ZVHA 4HVJA 4PUOB 3KHRA 3AVKA 1SV5B 3DDKA 3B6PA 4IFVB 1D9DA 1YT3A 1FK9A 4KHWA 3HP6A 4OJRA 1WNSA 3VQ7A 3G86A 4ED3A 3AVCA 3V4IA 3AO1A 1SL0A 4KREA 4RNMA 1N4LA 4AHSA 4FJLA 1S1VA 2J6TA 2E9RX 5F8NA 2G8UA 4IRCA 4ZMMA 4NLXA 1S0MA 2ZD1B 2Y1JA 4HUGA 4KTZA 1O1WA 4FJMA 5KT2A 2FBVA 4NLOA 2HNYA 3OSPA 2YKMB 4KFBB 3KMSA 4WYWA 1ZBLA 1RTHA 2JEIA 5T14A 4FM1A 2RKIA 5HBMB 2HHTA 3LP1B 4W5TA 1VSHA 2P51A 4OKEA 1SUQB 3QO9B 4ZP6A 4DS5A 4DU1A 3BSNA 3QEPA 3KLIA 4IKFA 3V6HA 4YR2A 2WONA 4KHSA 4ZP9A 1RT6A 2ASDA 4H4OA 3TWHA 2D3UA 3MFHA 5KFSA 4F4ZA 3RRGA 4BE2A 3LP2A 3AVLA 4M3UA 4LQ3A 5HROB 4IR1A 2R8IA 3HJFA 4ECVA 2XC9A 1QQCA 4QCLA 1CXQA 2BQRA 2ZQBA 1S1TB 5KRSA 1LAVA 4EZ9A 4FJGA 3V9WA 2DPIA 1XR7A 5KT3A 1TKZB 4RW9A 1SH2A 1GOCA 2W9AA 5KFIA 3E01B 4ZVFA 3L3UA 4JRQA 3P1GA 3MEEA 1REVB 3NH2A 4PUOA 3GV5B 4HKQA 3L2VA 4IFVA 1IKXA 4KV8B 1KHWA 4TQSA 3LAKA 2F96A 3MR5A 3FSIA 4OGEA 3I5CA 3H59A 4IFYB 4J2EA 1RT3B 2UVRA 2YNHB 1IM4A 4O55A 4E7KA 2BGGA 1TK5A 1IKWB 3DOKA 5KG7A 3S3NA 4FZXC 2GIQA 3HYFA 5KFUA 4FLUA 2YKMA 5F9NA 4J9PA 3WNFA 2P5OA 4E1NA 3P5JA 4IDKB 3JYTB 4MK7A 4RW4B 4ECRA 1RTDB 5HBMA 3V9ZA 4FLWA 1ZBHA 1C1BB 3BGRB 3WNHA 3UPFA 3ICLA 1N5YB 4Q45A 3CFPA 4AH9A 3OYDA 4ZPBA 3WNGA 5E41A 1K6YA 4CJWA 1NOYA 2QV6A 2UVUA 4ZHRB 5KG1A 2B6AB 4WZQA 1ZETA 4CCHA 4O44B 4MKBA 4TQRA 3K5LA 1X9MA 4CFBA 4WFXA 2G8KA 3N6MA 1KVAA 3TAQA 1DLOB 5FROA 1LWEA 3AA4A 1XR5A 3AVJA 4RUCA 4CGDA 3M8QB 4FJNA 3SFGA 5KT6A 5HROA 2FVCA 3H5SA 2G8IA 3RR8A 1CSJA 4H4MA 1KVBA 4ED1A 1WNEA 4FYDA 3U3GA 1TKZA 3T5HA 5L9XA 1RTIB 3G6XA 1KSPA 1IO2A 1VSKA 5DMRA 2XGQA 4EYHB 4XO0A 3KKSA 4KO0B 4KV8A 3AVIA 4OPKA 4B3OB 3ZT2A 1A5VA 4Q44A 1X9WA 4FJKA 2J6UA 4QW8A 4B8CA 1VSDA 2HNZB 3Q8RB 3TAEA 2YNHA 1TL3B 3C94A 1EP4B 1BGXT 3OY9A 1FKOB 3NGZA 4DQQA 2G8VA 1JLFB 3TI0A 1DTQB 1FKPB 1RILA 2Q3SA 4EO8A 4IH5A 1J54A 1U45A 3CFOA 4FJIA 3PW0A 3JSMB 4KI4A 4E3SA 2WOMA 1C2PA 4ECXA 4FS1A 4ED8A 4U6PA 3RMDA 4ECSA 1J9AA 1L3TA 4IDKA 3ZSZA 3JYTA 2HNDB 3HPHA 4AHRA 4URSA 2BQUA 4RW4A 4TYAA 2PZSA 1W9HA 3B6OA 1C1BA 3BGRA 5C25B 3KIOA 3H2LA 4F4XA 3ZT0A 1N5YA 1HRHA 1I39A 3NAIA 1RTJB 1NK8A 4ZHRA 1VSMA 3G6VA 1IKVB 4CEQA 4C8OA 2HHUA 4O44A 4E7LA 1RA6A 3DI6A 4M3YA 1C1CB 3H98A 1TVRB 1DLOA 2E6MA 3N6LA 4KAZA 2E9ZA 1D0EA 4DSEA 4WXWA 4IRDA 3M8QA 4GW6A 4DTNA 3QETA 3MXIA 3HVRA 2KFZA 4Z4CA 3I0RB 5F9LA 4O3SA 3SQ4A 1ASUA 4IG3B 4RNHA 1NK0A 2OA8A 4Z4IA 4ELTA 4O3QA 3NGDA 3OYBA 5DQIA 3D28A 2HHVA 4DTPA 3NH1A 5DLGA 2IMWP 1HNVA 3FQLA 4WFYA 4KO0A 4CJ4A 2V9WA 4Z4GA 3M8RA 4B3OA 3K5MA 1D8YA 1B9FA 4E7IA 1KFDA 4CJFA 2Z1IA 5EWFA 3M8PB 4LY7A 3IGNA 5C42B 4XPCA 4DFMA 4RW7A 1WSFA 3QEWA 1NK4A 4L8RB 2F8EX 1S6QB 4J9LA 1EP4A 4LH5A 1R0AB 1FKOA 1MU2B 5I42A 1JLFA 1FKPA 2W9BB 3LZIA 1S6PA 3QIPA 5CZ1A 1QUVA 3BDPA 3PJWA 2X6NA 4FK2A 1ZBIA 3RBDA 4YQWA 4K4SA 3V6KA 4FLZA 4DL7A 2AX0A 4CK2A 2IAJB 2IBKA 4DTMA 4NLTA 4K4UA 3MEDB 2O5DA 4C8LA 4Z4HA 5DG8A 2HWIA 2OPPA 3HVTB 4CJKA 3KK2B 5L1KA 4ZVEA 3DRPB 4NLGA 3PZPA 3HL8A 1NJYA 3VQBA 4KHMA 2W7PA 4CK3A 1KFSA 4LSLB 1SL1A 1FXXA 3QINA 1HARA 4CEBA 4CE9A 4B9MA 2V4RA 3MTKA 5F8JA 3T5KA 1C1CA 4YR3A 4KE5A 2YNGA 4QPXA 4F4YA 2AWZA 4IH7A 4H8KA 2KFNA 3GILA 2W9CB 3S9HA 4J9OA 3SPZA 4J9SA 4ED0A 4ZP7A 1RYSA 2FLLA 4FLYA 3AVBA 4DL4A 3QZ7A 2E9TA 4M3TA 5KGWA 1VRTB
chains in the Genus database with same CATH superfamily
3TRGA 4E1MA 1IBKF 2QK9A 1HQEB 1YRXA 3MPVA 2XS2A 5KFKA 1JXEA 1R0BG 2UV8A 2LU1A 3OYJA 5DDRC 2B5JB 1S1UA 3P5BP 2AYGA 1NM2A 1P6TA 4YUDA 5KFHA 1T7PA 4NXMF 3HPGA 2W7AA 4Z7YA 2BX6A 4KJIA 4JV2A 2CAJA 3FK4A 3TNVA 1YJWN 1S1XB 2XMAA 3HF5A 4PAAA 1RBVA 2QWPA 4PCQA 3OLBA 1CZ9A 5DGAA 4JK8A 4PZVA 3OXGA 3T1YJ 3IAYA 2EK6A 4OLAA 3IBCB 4BRKA 3KJVA 2NPIA 3TR5A 2C2OB 3Q8PB 5FLXU 3PHTA 1DRZA 1ZBUA 1WC4A 1FJGK 3CMAN 2KM8C 1DTTB 3G2XA 4PRFA 3OHRA 1YLXA 4LSNB 1X9JA 2V4JA 4P75A 2LEAA 1SQKA 3OFFA 3GSDA 3PW4A 1RWUA 4H5WA 5M2RA 2UUBK 2IC3B 2RVJA 1H6KX 4DN9A 4O5BA 1O51A 2R8GA 2KU7A 2O8DA 4AQYF 3HKWA 3UCZP 5LMNF 3KVGA 1WTFA 2HBZB 2AX1A 2MY8A 3EGVA 3EO3A 4GC7A 4K8XA 3IMQJ 3RMAA 1VRTA 3D6RA 2Q0RA 1IJEB 3ILJA 4DEZA 1BA1A 4KGXB 2C3MA 3AODA 4XH1A 2UUTA 3IXQA 2J6SA 1MG7A 2BM1A 2VPZB 1M5HA 4ICLB 4CEZA 1N36K 4KB0A 3U27A 2QEXS 3S01A 3NGKA 3NAEA 3GWCA 3DAWA 2QYGA 1VQPS 1WLJA 3LW5C 1ZC6A 5D77A 3GCWP 3NHGA 5DK5A 4LF2A 1TELA 2RS8A 4JYAF 1RWOB 4YB1P 2IHR1 1UTAA 4J90A 4F7VA 5KT5A 1SS6A 3NRBA 5KT4A 2H4WB 1VQPN 5HL7Q 3V6DB 5KG3A 4C4WA 2VG7B 4KHYA 2FSNA 1X5PA 1NU4A 2MQ8A 3ETMA 4HHTA 2BXJA 1VQ6N 2PDAA 3BPDA 2ZM6J 1FF2A 3CE8A 1TKDA 3MMCB 2XS5A 4JI7F 1YDLA 4U67L 3QBWA 1XJWB 2YTCA 3KZBA 1FHTA 3NGIA 1TYQB 1DTTA 3SCXA 2HRUA 3DYAB 3J7A1 1U8SA 2IGIA 5DQHA 5B0DA 4B9UA 5CYMB 1AYEA 3PKMA 3D9BA 3E9PA 4LIRA 1HWKA 1S6OA 3AY9A 3OYMA 1FKAF 3IAM9 3X3UA 3KG1A 4H4KA 4NASA 1IQTA 2AEFA 4RW6A 2R2TA 4NO7A 3OL9A 1TQLA 2F8TA 3ISND 3E9LA 1Y5IB 4BWMA 4F9OA 3OYCA 2RPIA 2Q3PA 3HO1A 3QICA 2YPZA 4NLYA 4NI2B 4NZ7A 1TL5A 3QEIA 2VPYB 3T5JA 1QZ5A 4ILLA 2R2SA 2KYZA 2AYEA 3CMES 1HBMB 2YX6A 1X5OA 3VQ9A 4YR0A 5GIOA 4EEYA 4M8LA 3WIUA 3C2PA 4FJ5A 4OZ5A 2UXCK 1WJ9A 3TWZA 2CJXB 2BANB 2ATLA 4DPOA 2RF2B 5F0WA 1FFGB 4CIEA 4OV6A 1U2CA 3V6DA 2VG7A 3DLEB 2LA4A 1VIXA 2CJQA 3S41A 2LCWA 4K4WA 3ULEA 1TUUA 2DHHA 2CPIA 3MCNA 4CJSA 1S97A 4M3XA 4HVZA 3I56N 4O23A 3VAIA 4N8NA 3DLLQ 2DFHA 3IDHA 3M6GA 3P4IA 5CY4A 5FPNA 5AFUH 1FE0A 4NRUA 2OPQB 3FC9A 3SAFA 3F56A 2XMKA 1Y7PA 3D3CJ 5CYMA 4USVA 3C6UB 4DL3A 1SKRA 1SUQA 4BR4A 4CYUB 2VFUA 4M5JA 4FN5A 4X4RA 3TAFA 3THWB 3THTA 3VPZA 4CH1A 4EBCA 1WEZA 1DAXA 3R27A 4DHVA 1T03B 1JLEB 2O8FA 5FD1A 1G15A 5IT4A 3KNGA 1NK9A 2WHOA 4W5QA 3CPEA 3R5GA 2HBRB 4DX5A 3L4BC 1VC6A 2NCKL 3QQCD 4TYBA 3ZC4A 3CDEA 5AQPA 2RDIA 3E01A 2C3YA 1EB0A 4P72A 5KT7A 3AJDA 4W5OA 1LWFB 4PXDA 5KFGA 5HMYA 4M95A 3K8WA 3HRGA 2JWLA 1VQON 3G6YA 3HOSA 3MAQA 4HLBA 2VL1A 1EETB 2G1HA 1NZAA 2BANA 2Z58B 3R5DA 3OXFA 1RT3A 3CCTA 2XBPA 1RT5B 5K5MA 5IQ6A 3OL6A 4UOGA 2GAGC 3C15B 2KI2A 2GIRA 2LU2A 2UUCJ 3MMAB 5LL6d 1KR4A 4IEEA 2FTRA 2HF4A 2E5LF 4I68A 4FJJA 4FNHA 3LTOA 5ETVA 3TAGA 2OPQA 4USMA 2Q6BA 4DZDA 2RMLA 3C6UA 1LXNA 4G65A 3CO0P 2B6AA 4WFAQ 2BR0A 1ESVA 2I0XA 5C24B 2FVQA 3FQKA 1OQ3A 1YI2S 2UUBF 1NLVA 3CUNA 1QHAA 1VQ5N 1T03A 2F9WA 1JLEA 5GADI 3MAAB 3KWMA 3DNCA 4MO5A 1O5JA 2H4YB 3I6PA 2HFZA 1Y11A 4NE9C 3MWPA 4FVCA 3VQ5A 3B82A 3DGPA 1EX4A 2KKZA 2GGPB 4A8QA 3E1YA 3TYTA 2IM0A 1TL1B 4KKOB 2JWNA 1JL2A 1ELOA 2ZM6K 1RTIA 5AQXA 3SQ1A 2BRLA 1ZOTA 2HBJA 4FWSA 4AHVA 1SC6A 3OBWA 3O6WA 4LF4F 2HMIB 2C3PA 1VJWA 4CHOA 3HSDA 2V9KA 1BI4B 2DIVA 2Y8YA 4OJHA 2GV9A 3MMBB 2MZ1A 5HANA 4DQIA 3QNWB 2BOAA 2A18A 3O44A 3EXYA 2B43A 3HSTB 1BWVA 3NY0A 1W2BR 2ZWHA 4P71A 2KO1A 5AQOA 3W5XA 4X4SA 4GVBA 3JSMA 5A2QU 3WXIA 1UPMB 1IVZA 4BDYA 3MMAA 3V81B 2DT9A 3W2VA 1JIHA 5M1OA 2ZH8A 1CG2A 1V5VA 1A6LA 3DOMA 1JNZB 4CFCA 1ZAWA 3G6EN 4G1IA 2W41A 5BPMA 5EX0A 3AA2A 3BB5A 1GXTA 2HFOA 3CIZA 2H1YA 4B3RJ 4JNEA 3CQ8A 3G9CA 3HJVA 4DU4A 1WAJA 4BWJA 3KLFB 1IR2A 1N5SA 5AE2A 4NX9A 5C24A 1ASVA 2E66A 1PILA 1OWXA 2BJ7A 2VZ9A 2V67A 4GVEA 2A2CA 1LWCB 3HDSA 3MAAA 2MZTA 3ALYA 3E8OA 1P1LA 3K58A 4HUFA 3RB6A 2X74A 3SCIE 5J2NB 3GB0A 2XRIA 2D9PA 4FYXB 3A5LC 1TL1A 4KKOA 3RBZA 5AQVA 3J7AN 2I1RA 1KWMA 3WQTA 2VOPA 4P73A 2FZKB 3HVWA 3ISZA 3MZIA 4OZ2A 2KJWA 4A5BA 1FX4A 3JTOA 4X66F 2FJXA 4OPJA 5TKWA 1HD1A 1BI4A 2B9YA 3DLJA 9RUBA 1S1WB 3NF8A 2R9LA 3PACA 4CEAA 2W4PA 2KG1A 4HWIA 1MROA 1T9UA 1N0VC 2FJWA 4ANEA 1XERA 4GO7X 4KH5A 3AOCA 4O8KA 3V81A 1LK7A 3MEDA 1MWZA 4NMXA 1EQMA 3DRXA 1UAXA 3ZO7A 2U1AA 3KK2A 4I9LA 4F0KA 3KLVA 3AXMA 1FXRA 2CQHA 2XMUA 3PR5B 2CQCA 4RG8A 2FHJD 4OGCA 3RJMB 3DGVA 2QRRA 3E51A 3M2UA 2GMLA 1GTEA 4JRPA 2JEGA 4BY9C 1RWVB 2JLGA 1N34K 3G25A 3C95A 2IMOA 3HHLD 3HZGA 2L48A 1NUEA 3NS6A 2KJVA 3BREA 1U48A 3KXDA 1E3MA 4CNZA 3L7OA 2IPOB 3BGLA 3HX9A 2YVSA 1CLQA 2XSFA 5J2NA 4ZOSA 2Z1GA 4C3MA 2MLYA 3CJKA 3KLGB 1NJIT 1RWKB 4ZVRB 4X4VA 3EX7B 2KYXA 1EIYB 4FPAA 2UUCK 3AAWB 1WSIA 4ZDNA 4TXSA 5KFTA 2CQ3A 2HEKA 1XNRJ 1HNXK 1VQLN 4PY5A 2XYHB 2HZVA 1D1UA 3H3NO 3TW0A 4BG9A 1V3SA 3OFHA 2BA9A 4A59A 2FBTA 1S1WA 3KUHA 4EO6A 2B4PA 2EHGA 3TUPA 2DNHA 1VHFA 3CCRN 4DSKA 1J5OA 2Z30B 3D0IE 4HH1A 4BE0A 4YOTA 3AD8C 4CHQA 3FBCA 5F3ZA 4DB3A 4QJVA 2DRDA 3VQTA 1PCAA 1W7WA 4FYWB 1IWAA 2LLZA 5CYQA 2C3OA 4IR9A 4BR7A 4IOCQ 3NWGA 3SMPA 4C6AA 1W0HA 2ZH9A 2D0AA 2RHQB 3DOKB 3CD6N 4G6VB 4S0MA 5F8GA 1VHIA 3W8GA 1UWBB 4DTSA 1H7XA 1H2VZ 2ZJRQ 1FDBA 4ILHA 1YJTA 1QDUB 4JV0A 3EEQA 1NGGA 1H3DA 5J2PB 1SL2A 2V7YA 4ILJA 3NDKA 2VBYA 1WHVA 5L1LA 2GV1A 3KLGA 2LECA 4EAHD 4MK9A 1CJTB 1IKYB 2FB0A 1RDUA 1L5UA 2ASOA 3EPGA 3OYAA 1SC4B 3G87A 4TVAB 4PWWA 3CD7A 5DM7Q 3Q7BA 5DJBA 3DRRA 4CVNE 2KW4A 3CIMA 3FCWA 3HBTA 5DLFA 4LC9B 2DY1A 5ETSA 1UVIA 4DTXA 4ED7A 2NZTA 4LF5J 1Y10A 3M6VA 2P9LB 1OSCA 4CZKA 2XNRA 4Q7AA 3V5RA 3CC4N 4NLDA 1VQ7S 4K4VA 4KB7A 2ZWOA 1BWFO 2VWKA 3N79A 7FD1A 4JKFA 2VG6B 2P9SA 4LF8F 1B9DA 2MQQA 1Q95G 5C0YA 3ZZUA 2F9JA 2E4LA 1U09A 3AFGA 2CPJA 4DI6A 4PKIA 4JI8J 2V2KA 4CGIA 5THWA 5F8MA 4HDGA 3G82B 1UWBA 1PBUA 4PKGA 3J80Y 1HWUA 5HATA 5IQQA 4DR7F 2V8HA 1VC0A 1S5JA 3CQYA 3N4PA 5FJ4A 4JLHA 2AJ2A 4J9MA 2XCPA 2QYCA 5E7OB 3PJ9A 2WVBA 3SUQA 1EWQA 4GV3A 4NL5A 2R7UA 1GMUA 1RHKB 5J2PA 1HLUA 3VAJA 1RP5A 4PEOA 2QXLA 1TMJA 3DI6B 1IKYA 3LM2A 4NEYA 4BR9A 2VU5A 4BRIA 4KGVB 3W62A 2HGNA 4WFZA 2Q97A 1W2BM 1K9MO 4RNOA 2BKOA 3BBCA 3DLRA 3CJQA 4KH4A 2P6TA 4KGKA 2KLAA 1IQZA 2DNZA 4ZVQB 4NLRA 2GMJA 2B56A 3P83D 2CJAA 2HBMA 5D8HB 1ZYQA 4N56A 4X65K 1V3RA 1Q79A 2XLJA 3VQQA 2DK2A 5JJBA 4A8KA 4XK8C 1G2EA 5I4MA 5LJWA 3A3NB 4LRCA 1GLFO 1IR0A 2BYCA 2VG6A 3ZTQA 5BN8A 3EDQB 1V4TA 3O2IA 3GG4A 5I42B 4JI2J 1RAFB 3PJXA 1S6PB 1DJ0A 2AP1A 1PIEA 3PY8A 3A8YA 2AGOA 1UEVA 3SQGA 1F3VA 1XNRK 2K3IA 1NSQA 1B70B 2R8JA 5KFFA 1X4CA 1S4FA 1N34F 3PKYA 2DFEA 4TY8A 2OD6A 2YWKA 4DCHA 2V51B 4A48A 5GAHP 2CPFA 4FZYA 3ZZ0A 4FM0A 5CZVA 2JDJA 3JXOA 2HWHA 2MSSA 5BJRA 2YNGB 3QFWA 2BACA 4LSZB 4DTJA 3K5PA 3W5ZA 1HWLA 1HNXF 3RB3A 2EKNA 3D0HE 1PYOB 1UP1A 3RTVA 1D9AA 3HHEA 2IS3A 2RU3A 2KRBA 3A8JA 3EVMA 2IDOA 5TKYA 3IRXB 2LP4A 2JFDA 3MDQA 2J0XA 4PWDB 4JS4A 5BYQA 1H0HB 3FZHA 1GLCG 4RBVA 1X3MA 3H1QA 3TEGA 2VQEK 1VRTB 2FQQB 4RW8B 2UP1A 1LCUA 4X4PA 2YQ3A 3ZZPA 1CC8A 2RJZA 3O8WA 1JXLA 3Q7CA 3W1YC 1VQ8S 4OKJA 1B92A 3D67A 2JVRA 2YHXA 2V63A 1TUGB 4U8YA 4NZ0A 1FVQA 2V50A 4FF1A 4C1NK 2W1BA 3AJ1A 5KFLA 2D41A 2XLKA 5MLCQ 3PVXA 1W25A 1PC5A 4LF5K 5JLHA 3GJQB 2GUIA 3ATVA 4QBUA 1BXNA 3OS0A 4EU0A 2FF3B 2LSNA 4QQBA 5ADZA 1ICEB 2HQGA 1ILYA 3W65A 3UVJB 2MJNA 3A2FA 3K57A 1KAZA 3MM9B 2EC0A 3QATA 4ETZA 1U25A 2NUBA 4M63A 2D7SA 2K06A 4YDXA 4B1XB 5GAGU 5D6GA 4JI8K 1HKBA 3CJ7A 2AZ3A 1ZA2B 2G0IA 3FZMA 1CPZA 3AARA 1S79A 3ZT1A 3I5BA 4B3SJ 5H1SV 3VCDA 5HLFB 1F9FA 4PWDA 1C6VA 4X4TA 3FFKB 1RFQA 3KDOA 1HR0J 5EY4A 3CSKA 2RHKA 3Q8VA 2B8PA 1VBZA 3FZ2A 1I3OB 3G4SS 3T9ZA 1JCEA 2HVDA 4IYQA 3EZWA 4XAKA 2YX7A 5IFMA 4LFBF 3CCQS 3S1TA 3FZLA 4OYZA 1JJ4A 2JLFA 4RUAA 2P9KA 4OX6A 2D0CA 3HHKA 4U7UD 3K9JA 1HJOA 2KH9A 2O01C 1GK8A 2IOCA 2NYHA 1ITPA 4ELVA 4DV4F 3H90A 4C11B 5IM0B 5F3TA 4Q5VA 3D6FB 3D0PA 3U4LA 3D1OA 1NKBA 4IOBA 5FDLB 2RH3A 4FLXA 2MZRA 1T44A 1KCFA 4L3NA 4AUKA 3I31A 2I5JA 1JXBA 3W3SA 3DRYA 3UVJA 3D3BJ 1WOSA 5SWMA 4ZCMA 2HAIA 3I0SA 2KHCA 3HSJA 3VEZA 4KBIA 1S7IA 3MM9A 3AH6A 2RDJA 1IG9A 4JI2K 3FDSA 3LP2B 3V6JA 3UKRB 2GCFA 4YY3J 4FWPA 1IR1A 3LH2S 3VETA 4CESA 2P9EA 5DM6L 5KFRA 2HFVA 1J6ZA 4B1ZA 3VQAA 2FHKA 3KUEA 4DFKA 2UXBJ 3DKDA 2BE2B 4GMJB 4HVJA 2GELA 1SV5B 4X65F 3B6PA 1HD0A 4KHWA 3FBBA 1VMBA 1WNSA 3G86A 4PR6A 2FC8A 2ZH4A 4ISEA 3AO1A 1SL0A 5H9FK 3MTJA 1S1VA 4LF6F 1NPPA 2E9RX 2G8UA 3J7ZO 4DZ6A 1S0MA 4QS8A 1O1WA 4B1YB 2QTDA 2PSZA 2CADA 2FBVA 2KG0A 4NLOA 1YJRA 2WVFA 4I6WA 3OSPA 2LQ8A 3N28A 2PFFB 2YKMB 1G4CA 3ILLA 1Q8BA 5IS2A 3KMSA 4QIGA 1UWAA 2D1CA 2NR0A 1RBLA 2B51A 3VZHA 1RAEB 2HHTA 3LP1B 1WD6A 4QU7A 3SQOP 2GJ2A 4EI2A 3ET6A 3TPQA 4DV1F 2YHYA 4IKFA 3V6HA 4RBTA 3R9PA 1RI7A 4ZJOA 3W64A 4FWMA 4KHSA 4ZP9A 3UN2A 1J2VA 2QO3A 4FF2A 3OTDA 1HBOA 3MFHA 1EWRA 4F4ZA 3J80O 2HQFA 3LP2A 4AFFA 5HROB 3BZKA 2R8IA 3HJFA 4ECVA 2L41A 2ZQBA 4EZ9A 4V1Ak 4RWWA 2HRTA 1M1KO 1TKZB 3CCJN 4RLEA 1F9EB 4X64J 2W9AA 3TTFA 5D4OA 2NUHA 1HA1A 3KJNB 4A8XA 4LRAA 2F96A 3BGUA 1VQ9S 4MKVA 2DKOB 2ZC4A 2VQEF 3CCZA 2RE2A 1OQ6A 1K8KB 4OX7A 4CO2A 2J7KA 5CAAA 5ETLA 3MM7B 2CDRB 3S3NA 1VQ9N 4FZXC 5BR9A 3NS7B 2GIQA 2YY3A 5FLXY 1HW8A 2YKMA 5F9NA 1EQ0A 2J9EA 1RAAB 1OPZA 3JYTB 3A3OB 3Q8UA 4BC7A 5HJYA 4I69A 1H1VA 4ECRA 1RTDB 1ZPVA 2EK1A 3V9ZA 1ZBHA 2E1YA 4B3SK 3I87A 3H2UB 4HACA 3UWTA 3PYEA 3VTHA 2VASA 4B1VA 2ZC3A 3BN7A 2QV6A 1V5IB 1PAUB 3AJ2A 1ZETA 4CCHA 1QVFR 1MMDA 3D2WA 1X9MA 4IWVA 3MD3A 4WFXA 2ZBPA 1RKIA 1VLYA 1CS4B 3AA4A 5ETMA 3D1HA 1WTBA 1RTZA 3SFGA 4OHWA 5HROA 2FVCA 2Y0SD 2G8IA 3DU5A 3RR8A 4H4MA 4KGZB 2E2QA 2GEMA 1QAXA 1KVBA 3US5A 4ED1A 4FYDA 2ADCA 1X4FA 3HZ6A 1TKZA 2AKWB 2F4VK 3PRBA 3GFXA 3T5HA 3CF5L 1FT8A 1GT8A 2AA4A 2NRHA 4Z37A 1OSDA 3WBZA 1Q82T 2DXFA 5ETPA 3AVIA 4YDUA 3BZQA 3ZT2A 3SEOA 4LT6A 1YZ6A 2MPUA 4CRJA 4I4BA 4HH0A 2HNZB 2K8GA 1EP4B 1RE1B 1K8KA 3GZ7A 1VBYA 3NLCA 3NGZA 3H6EA 3MM7A 2AIRB 1FKPB 4CM2A 4IH5A 1U45A 4FJIA 1ZA1B 3MAHA 3PW0A 1IBCB 4E3SA 2WOMA 3K7RA 4FS1A 2GVDB 3RMDA 2E20A 1VHXA 4BHQA 3JYTA 1KQKA 1WF0A 4DV6J 3HPHA 4UY8O 2G2OA 3M1FA 5BR8J 2F8HA 3BYRA 5C25B 4F4XA 2QIFA 2UXBK 3C16A 3W60A 1HRHA 3IBWA 4MLEA 3G6VA 5GAEU 4CEQA 2HHUA 1XMQJ 2P6SA 1RA6A 4DUYJ 2HLUA 1GH8A 2E9ZA 4OI6A 4P10A 4OMFG 1D0EA 3GYGA 2E5JA 4DSEA 4U9RA 4GW6A 1SIWB 3OVSA 2J0WA 3QETA 3A5MC 5KOXA 3SQ4A 2YKAA 3QSYB 2J9CA 5KPTA 4IG3B 1NK0A 5AQYA 1VCTA 1FJCA 4O3QA 4NA1A 5DQIA 1T9WA 2HHVA 3GFZA 2RQMA 2ZH3A 1AFJA 3VVUA 4IOAQ 2IVYA 3AHPA 5DDPC 1VS3A 2EXUA 1O13A 3BN4A 2MQNA 5EWFA 3M8PB 5C42B 4RW7A 3GIRA 1WSFA 5EGYA 3OBIA 2F8EX 1S6QB 5GVQA 4J9LA 4CO5A 1EP4A 2W2QP 1R0AB 4LH5A 4DKWA 2G0JA 4JI5J 3L6QA 1FKPA 3LZIA 3UNGC 3FSXA 2DPNA 3CJBA 4OZLA 4OYOA 1K47A 4DR5J 2GZOA 4WKYA 4YQWA 4MMOA 4K4SA 2GVDA 3JQMA 2IAJB 1A0OB 2IBKA 4NLTA 4LF9J 1TTHB 4CP5A 1D09B 1NSKL 4CJKA 2IRUA 1RHRB 2OEJA 1U1NA 4XTTA 3W8PA 2EFPA 1NJYA 3VQBA 4CK3A 4X64K 1KNZA 3CNQP 1YBTA 3SDEB 4X62J 2DTJA 2CH6A 4CE9A 4B9MA 2V4RA 1F2GA 5LJVA 2DNLA 1GLAG 5F8JA 3T5KA 3ZTSA 2AD9A 4IH7A 3R2DJ 4H8KA 2VBXA 2DR9A 2W9CB 3S9HA 4J9OA 2MKYA 2M3DA 2FLLA 4FLYA 4F04B 4ZPVR 3OTEA 4JKHA 4LJMA 2MZQA 2VICA 2DR7A 3WEEB 4IG3A 1XR6A 2KTQA 4ID1A 3OV7A 1PJ5A 3HFKA 5H9EJ 1TKTA 3PG9A 1FNXH 1CXUA 2OELA 1RWWB 4BGBA 3A8EA 5GAHI 4CEFA 1FESA 2DR5A 4QYZJ 2ATQA 3VMFB 4IO9L 2Y3YA 2MKCA 4Z4FA 5C42A 3PIOQ 1R0AA 3O3FA 4FKXA 1VJQA 4N5SA 4KSEB 1U2VA 3GJSB 1VGYA 3T5LA 2QWLA 5BN9A 4ZVSB 1CJKA 2K1RB 4J9KA 4DSFA 1TGOA 2GMHA 4CZMA 5CHIA 3G71S 2C2RA 2VA3A 2P9IB 1X1PA 1FTCA 4NCAA 4R0EA 3LAMA 4Z0UA 4B08A 2ZZMA 2E7XA 1WC1A 3MCMA 4Q8FA 1NMEB 3BH7B 3DLGB 1RLDA 4OI0A 3DU6A 3MR7A 2HS3A 4K41A 3POTA 4CBWA 4PG6A 3LDLA 3QMLA 2PBDA 3SDEA 1FJ7A 2B4OA 2WSEC 2N7CA 4OZ0A 3O80A 4E8UA 2Q1LA 4KTWA 1FRJA 5I3QA 2E2NA 3TSQA 4F50A 2VPXB 1MWKA 2BUPA 4ECZA 3B8AX 1Y5LB 2W9CA 2VQFJ 4N41A 4QS7A 4GNIA 1LK5A 3O3LA 1C0UB 4CDIA 4N8OA 3CM5A 4HTLA 1GEHA 4DV7F 3QLHB 3VALA 1RWPB 4FK0A 4OHZA 4NLSA 1QE1B 1N54B 1KAXA 5F0UA 3I5AA 1N5VA 3C6TB 2PYJA 3G8QA 2F4VF 5KFWA 4YB5A 5BR8K 4A46A 2R42A 1R6YA 2GFFA 4FK4A 4DL2A 1TL4A 2XZDB 3G8SA 1E6VA 2LFVA 2OHDA 4KBOA 4CJUA 4CJLA 2YXLA 1XMQK 3KG4A 2CQ2A 3SSQA 1T3OA 4BRDA 4DUYK 4HTIA 1YJ7A 5A2QY 3W7BA 2FSKA 3ZSXA 2HAFA 2P9IA 2DJWA 2IYGA 4I9QA 3QPIA 4OYWA 2ZBCA 2D74B 3SBMA 1QVFM 2HBQB 1ATSA 4ED2A 3DLGA 1VQYA 1HBNB 4U7UK 2LVWA 1P1TA 1HX1A 2V34A 2MKHA 4OZ3A 5ELZA 2RUSA 1NJWA 1QQNA 2Z1HA 2MQOA 1WBBA 2V94A 2UUAF 2AGPA 1A5WA 2CNOB 5AQIA 2MHNA 2W6KA 3CD5A 2CG4A 5KFXA 2BJ8A 1T3NA 1C0UA 3QMQA 5FLXO 2FBXA 1Z4UA 4D3GA 2X3DA 4JI5K 4FM2A 1Q8KA 2P9NA 2HW3A 3UB5A 2V8VA 1M1HA 3QLHA 5HK4A 4DR5K 4M5DB 5RUBA 4DQ8A 4TLRA 1S9EA 2M8HA 1QE1A 1S72N 5GMKa 4LF9K 3SUPA 2XGPA 2IM2A 3CC7S 3TP2A 2PEBA 2AYMA 1XN9A 5C12A 5H1SQ 2DD8S 1VQMN 4PABA 2C2ZB 4B9VA 1JMTA 1RBSA 1E6YB 3ZZTA 1SC3B 3BV8A 4ZVTB 1RKJA 3QEXA 2F5GA 3CC7N 2KT3A 3HPOA 2CPHA 4M42A 2C2DA 1RB0A 2WCXA 3FR0A 1C1AA 4V19X 1DQ8A 2J8SA 4DL6A 4B02A 1DEJA 1YGYA 4CJQA 3EE9A 1R6VA 5IWAF 2BTFA 1NCLA 3HVAA 4ZLPA 4OYXA 3ENHA 4B9TA 4C2MA 4KFBA 4CD3A 4ZVPB 5ETOA 4GKJJ 3QSIA 1YQHA 3EE8A 4RUHA 3QFHA 3M2VB 1HBNA 2EG2A 4ZVGA 4JK9A 4K5RA 1RDCA 1RCXB 5H9EK 2X3GA 1Q81T 3HM8A 3DXSX 4K4ZA 3T1AA 3QO9A 5GAGP 3T3FA 1NMNA 3RSEA 4QYZK 5CHCB 4OYIA 2FC9A 4N7TA 2PI4A 3MM5A 5DZ6A 3H3OB 5E3RA 4DWIA 2XULA 4HCCA 3NWRA 3THYB 1IBMJ 4PQUB 5I3PA 1T94A 4M5DA 3HI0A 3SLCA 3V1QA 2A3ZA 3MR6A 1S1TA 3OT9A 1Q4RA 1AZSA 4I64A 2QFIA 1KBRA 1RBRA 1N32F 1RCHA 3GR0A 1FTRA 1VSIA 4DF8A 1BCOA 1REVA 1FRMA 3CC2N 4B3MF 2FY8A 4DR2F 3SAHA 2HLTA 1E6YA 2IFXA 5CR4A 4LFCF 3OVAA 1RHUB 1RWXB 2B4JA 2AGQA 2VG5B 1TFYA 2AJQA 1NJXA 4DL0C 2B3TB 3M32B 2FYXA 3PDNA 4URQU 4AD6A 3UQSA 3DLKB 4WCEQ 1IKWA 4QZVB 5D78A 4BACA 3AVAA 1HMVB 4FL9A 2J7UA 5KFMA 1QZ6A 3AA9A 4C98A 1YJNS 3TQ1A 4GKKJ 4C8ZA 2YH1A 4OI2A 1ZAVA 1J5EF 2OTLN 1YVNA 4ED5A 2YCHA 2O8EB 3CJ1A 1DT9A 3T19A 3NF6A 3VAGA 4LFAJ 4AHTA 4DSLA 3C46A 2A5XA 2DH8A 1QJHA 3C8YA 5HP1B 1Y0HA 2JL9A 4IKAA 4DL5A 1HW9A 3KOAA 3LPYA 3HCXA 1KVIA 1KLNA 4LF7J 2IY5B 1QD1A 2UV8G 3PEJA 2HVHA 3VGLA 1Y4ZB 4I56A 2WW4A 2QKKA 4DMNA 3MECB 3KWGA 4DFPA 2P9GA 1U47A 4EBDA 2O8CB 3QYYA 4MKAA 4E7HA 5HI7A 1RT2B 2VHGA 3PUFA 2F3JA 4CFAA 2AHOB 2NXUA 3ZETA 3BGFA 3NMRA 4PG4A 1NHUA 2A1RA 3OUYB 4P7TA 3UN5A 3SQ2A 4CECA 2GTDA 1UPPA 3E2EA 3DMJB 1D5AA 1DBDA 3AY0A 1FDDA 4HHJA 2VG5A 3PW2A 2QFJA 4FZZA 2E29A 1I1GA 1TL3A 3M32A 1NPKA 3CJ3A 1NHVA 2ACYA 3LP3A 2PC6A 3PIPQ 3LUYA 2PE8A 5KG5A 3VQSA 3WUHA 2FPHX 2ZHAA 4CZCA 2HNDA 4QOTA 2HSTA 1N6QB 3OTOJ 4PG8A 3H42A 3P39A 5L46A 2FJVA 1FXLA 4ERDA 1X31C 1CQNA 4PXCA 1RTJA 2LEBA 3MR3A 2DH7A 2RDDA 2DR6A 2O8EA 1WAFA 2FLNA 4ANCA 2VPWB 3KLEB 3UDLA 4NXMJ 2XZWA 4ZS6A 4F8RA 3MEGB 1SB6A 4DFJA 2D9OA 4MAKA 3CCLS 3BH6B 2O8BB 1RSCA 4EK2A 2YPYA 1RABB 4EBEA 4I6MA 3I0RA 2XLIA 3K5NA 4KT0C 2YWGA 4A8MP 1U1LA 4DR5F 4HEA9 3TZYA 4GKJK 1RT2A 5KFVA 3TSPA 4DU8A 4LF9F 3EYZA 2HOEA 2KHDA 3U02A 1HNIB 2XB2D 4DUZF 4BC9A 3SBGA 3UIQA 3DMJA 4F0MA 5HQLA 4IDHA 2HF3A 3IKMA 2UVWA 1MU2A 1NOZA 2LMIA 5KFDA 4YEAA 5DRKA 3MUMP 3EGWB 3OFEA 4J9NA 2IRXA 4ELUA 4J5OA 1KRPA 1NGIA 2ASPA 3SSRA 4AQYJ 4EP5A 5LMNJ 5DGBA 3MXHP 3VQEA 4K25A 1IBMK 1UA0A 1JLAB 5KFPA 5IV4A 2W6LA 4FJHA 1N48A 3QERA 4F3QA 1BG3A 4CLTA 4XIUA 1BU6O 2QC3A 1SH3A 2V52B 2YHBA 4QOZB 3DRPA 4CF9A 3A5OC 2ZJPL 3X1LB 5A8KB 4IXCA 1EARA 1YTYA 4JI0F 4M1KA 2D4WA 2YWFA 4LSLA 2HMPA 2IRYA 2DFFA 3ZEUB 4OHYA 4YP3A 3FKBA 3FZFA 2GHPA 3KLEA 5AXLA 4CO1A 1OYEA 3ZNUA 5A2QO 4TY9A 3TZXA 2CQDA 3NCIA 3RB0A 2RKIB 4TU8A 4Q8EA 2ASJA 3R5AA 1QUPA 3OR2B 3M30A 4WPAA 1RDBA 4JYAJ 4A8FA 1B99A 2PA8D 5J1NA 3EGZA 9ATCB 5HQ8A 4JHDA 5JVGL 1NSPA 3U1NA 1EKSA 1WSHA 4A2AA 2CQGA 2OUGA 3QRPA 1PYTA 2NRXA 1HPMA 2DHGA 5K14B 3RRKA 2J0QD 2DXEA 4GKKK 3CETA 4JI7J 5AJ3K 1FJEB 3CULA 1HNIA 5FRNA 3H40A 2JFKA 4UOFA 4DSJA 3ID6A 1RDDA 4CF8A 3WX4A 3RMBA 3BZCA 2YX4A 4BCAA 2BQ3A 3JTPA 4EMDA 3FEZA 1OH7A 3M8WA 1UFKA 4I2QA 1FRXA 2OKQA 4HUEA 2QWNA 4UUWA 3CDWA 1OS5A 4LFAK 4CM0A 1NJIO 3QNNA 1TKXA 3RU0A 5DG7A 3O1BA 3AO3A 3Q23A 1ZZFA 5IT9U 1IKXB 1C0FA 4QAGA 3FRYA 3FCHA 2A1BA 1JLAA 2IVNA 4LR8A 3BQ1A 4B3TK 1HJRA 3LOUA 1HQUB 3DHWC 2EVZA 3KJFB 3GSIA 5A8KA 2OCEA 2MQMA 1XTZA 4J9UE 3ZEUA 2Y9HA 4AL7A 5F41A 4LRDA 3H5XA 1H7WA 4FJ8A 3O3HA 1MW7A 1QTNB 2ZKUA 3DOLA 1RGVA 2HSEB 2WRMA 4DQPA 1F5CA 3TZZA 3UNYA 1KS2A 3OR2A 3HZEA 3WZ0A 3MCPA 2XY7A 2BZ2A 2D0OA 3WXJA 3W9JA 1M1KT 3GDQA 3DRSA 3BR8A 5IOLA 2DB1A 2EFQA 4CBUA 2ZH5A 2EWHA 3OYGA 4BRQA 1RAHB 3RYLA 2MKSA 5EOYA 3KTQA 1T6CA 5K14A 5AXMA 1Y3JA 3J7Z5 3L2UA 2IVPA 1HYSA 4ZPCA 1AXQA 4ZITA 4B9QA 4X4QA 1T05B 4BDZA 1P8GA 4I1TA 1IBLK 4FBTA 3MFIA 4OKKA 4DV0F 5KFYA 3N4QA 4NXMK 4DBQA 5AQGA 4O3PA 2X1AA 4NRTA 4YN3B 2XY5A 4JKEA 1TL7B 3H20A 5ETQA 4FW2A 1WDTA 5HRPA 4ZPWR 2IM1A 5BYRA 3I4HX 3UW1A 2B7BB 5D3GB 4ZTFA 4DTUA 4I6AA 4A61A 1HQUA 2H9ZA 5T7LB 4KHQA 4K7QA 3U7JA 4KGMA 3FMWA 3GU0A 2FZGB 3K8VA 3N5FA 1S22A 2XM3A 4OL8A 1Q78A 1J53A 4CJPA 2KZMA 1NNDA 1QSSA 3BBBA 4OZNA 3D2EA 2E1PA 3RBEA 3AGRA 3FZKA 3D45A 3AD7C 4BC3A 1XK8A 3T69A 1H74A 4I6YA 3V2UC 2RE1A 2ZNZA 3NVMA 3KLHA 5I9EB 3AA5X 2UUWA 1XNQF 3W66A 3CJ8A 4AQYK 3K2PA 5LMNK 5B08A 4Q0BB 1UVJA 5CE3A 2ITGA 4CGFA 1HNZF 2HPUA 1T05A 1QSLA 3LGNA 2E5LJ 1RACB 2Q36A 3UR0A 3CJAA 3HSZA 1VK3A 3AQOA 1RU2A 4WF9L 3BEXA 2CGJA 5IZHA 1EX8A 3D5MA 1PJ7A 4JI1F 4OHXA 4PHTX 2P9CA 2FVPA 2GBZA 3WXMB 2ZOMA 5D3GA 4JYAK 4OLBA 4LVNP 1U1QA 1JWWA 2A6AA 2GA7A 2HBLA 3T6JA 5J2QB 3JTNA 1UAWA 4JN4A 3NP5A 1ZS6A 5T7LA 3OYKA 1S10A 4NB4A 3FLCO 4O4RA 3QIPB 3GIKA 2ZEJA 2Q79A 4OJ1A 2BJ1A 3EVWA 4DMZA 2P9PA 4ECQA 4W98A 3H4BA 2OPSB 4LF4J 5JS1A 3A8KA 1SJQA 3BDEA 3TX0A 3Q2TC 1YITN 3VQ6A 3PHEA 5ETKA 2UU9K 4BLGA 3SCLE 2W25A 3QJJA 1WORA 2MB0B 2A10A 2DPJA 1K8AT 2BKNA 3SI8A 4Q0BA 5AE1A 3QAEA 2XHWA 4H5NA 2RRAA 3BYPA 2XS7A 2OSQA 2E88A 4ZP8A 2LDYA 1APSA 3E9OA 5GMEA 5AJ3F 2FY1A 1RK8A 3DHXA 2JEJA 4UY85 5GAGI 4UUXA 1S1UB 2PY5A 4DLGA 2YI1A 2C1EB 2MEWA 2XI3A 5KFNA 2WSFC 4NPOA 2DO0A 1WOPA 5J2QA 3BO3A 2FJDB 4AF1A 4B8AB 4BBYA 2XYGB 2JVOA 2Z2ZA 5IXUA 4B3TF 1H73A 3ENQA 1Q7YT 2MZSA 1EO1A 2CDQA 1PG5B 3O4WA 5K20B 2WBRA 3KJVB 2OPSA 1LFPA 3UFCX 2QA4N 4X66J 1FFSB 3SYZA 1N52B 2NPFA 3IP0A 1NZ8A 3SUNA 4WE1B 4C1NI 1VQSA 1JLCA 4HDHA 2DY9A 2QN6B 3HKZD 1YSJA 4EFAC 3ZTRA 2I7NA 2EG1A 4H0TB 1KOOA 5KPZA 2O8DB 3KKRA 2P5GA 3C7NB 1F6TA 3VEVA 2ROGA 4W5NA 3LO3A 1NK6A 4FJXA 1RT7A 3NAHA 4DHYA 2K3KA 4TU9A 4HTJA 5AT1B 1V4SA 3BSCA 4OPAA 4CWBA 3MF5A 1IBLF 2GQCA 2HS4A 4IO8A 3IR5B 4OYPA 3BPSP 2HQDA 4CJTA 1YWXA 3DLHA 3VGVA 1JCGA 3PFOA 4DQRA 2ALYB 1R59O 2QMUB 4WZMA 1I5OB 5CXTA 3QT7A 2D5RA 3PRDA 3VGTA 4W5RA 2Q31A 5E0OA 2KXNB 5DDOC 1J27A 2A41A 1GTHA 3CCES 4LH4A 4F26A 3J7YU 4OX9K 1CEZA 2E5LK 3JQKA 1FRHA 4HTUA 1YIJS 3AV9A 2WZ1A 4ZJQA 4O0NA 1TU0B 4WE1A 3EY1A 4WYBA 5DETA 2Z1JA 5J2MA 1X4GA 4NXNF 2ETJA 5LSOA 3N9UC 4NA2A 3EN9A 3O4QA 3G96A 1VK0A 4WTYA 1NKEA 3RW7A 4Z4EA 3IRWP 3EZUA 2WONB 2AJ4A 4FDFA 3V9UA 3C7NA 4H4OB 2WAQD 3R6GB 4RW6B 5HL7L 4OYMA 3TR8A 1WEXA 2FVSA 4QWCA 1YJVA 3M8SA 1S3XA 5B7WA 2NXCA 3F9MA 2EKYA 4M41A 3FCVA 5A8RB 5G0RB 2B4VA 4JUZA 1G6BA 4DDFA 4WQ5A 1S7HA 4AL6A 5GAHU 4URGA 2CJ9A 4ZLNA 3UKUA 1JKHA 1U6ZA 4LF4K 2CIMA 3TAPA 2Z56B 5LY3A 3CCSS 4ZVHA 1FD2A 3VR1A 2KVQE 3FEXB 4IFVB 3QGPA 2ZHBA 2GVZB 2XMWA 3HP6A 4OJRA 1UEKA 3VQ7A 3D4JA 3AVCA 5AQZA 1HHTP 2QEXN 4AHSA 2RQKA 1BWEA 2AEJA 1BHNA 2RIJA 4KTZA 4FJMA 5KT2A 4M7XA 3ULEB 2W01A 1CJVA 2QZ8A 2Y8WA 4K2JA 5T14A 3J8AA 2CNKB 3MEKA 4FWLA 1FO1A 2BVZA 2FD2A 1NDPA 5CCMA 2B9XA 1VSHA 4OKEA 4USTA 5K8MA 1U2FA 2Q0UA 1SUQB 1URNA 2NSCA 1N88A 2UU9F 1UZHA 2HRYA 2WONA 3KWIA 4H4OA 4YHHF 2QWQA 3JAMO 2D3UA 2A3JA 1UJ5A 4LF8J 4KIAA 2O8FB 1K73T 1SQGA 1GMVA 1C4AA 2OANA 3BF1A 5AE3A 5A8RA 5G0RA 3IM9A 3KUGA 4FJGA 3V9WA 4YDUC 3C65A 1WOOA 2RRNA 4OFZA 3E01B 3DLLL 1HNWK 4ZVFA 2PI5A 2E5HA 4JRQA 1UJ6A 3MEEA 3A8IA 2JJ4D 2VYPA 4DR7J 4X66K 3GV5B 3ONQA 3L2VA 4IFVA 2GVZA 2E1ZA 1HKCA 3LAKA 2P2CB 3MR5A 3B78A 2QL9B 1F3FA 3DXBA 2DNOA 3A5NC 3I5CA 3CMEN 2X1BA 4MJKA 2ZH6A 4J2EA 3EJMA 1RT3B 2YNHB 4O55A 3MCOA 4E7KA 5MAOA 2CGLA 1X4HA 1R8PA 2R7XA 2VKZG 4Y00A 3HYFA 5KFUA 2O1PA 1KQFB 4LRFA 2P5OA 2BH1A 4E1NA 4BG8A 4IDKB 4XEIA 1FA0A 2LQJA 4I67A 1CJUA 3EVOA 2HFSA 4FLWA 1F2HA 1C0GA 1N5YB 1RCOB 4AH9A 3LL3A 2ZWPA 3OYDA 1K6YA 5AQQA 2O3DA 2P9UB 1VISA 5BYSA 2B6AB 4O44B 1VYAA 3K5LA 3K9KA 4C0OC 1PYSB 5EVZA 4EFHA 5GAEI 2G8KA 1KVAA 1LWEA 2QWRA 4A8WA 2DRBA 1T0TV 4CGDA 1NMDA 3TUZC 3SCKE 1NB2A 1R8CA 1BE4A 1CSJA 3THXB 3DGPB 5BRDA 1DQAA 4NLCA 3L4IA 5M2PA 1KXPA 4CNYA 1RTIB 2CJBA 2D69A 3W3DA 4EYHB 1N34J 4B3OB 2GX9A 3Q0AA 1NGJA 4Q44A 3MN5A 5AZIA 4WFAL 4FJKA 1I94F 1ZH5A 4BGAA 2YNHA 3C94A 3RUBL 2NLWA 2QSFA 4MT1A 4DQQA 5ITHA 1JLFB 3TI0A 4TKTA 1J54A 3CFOA 4GVBB 3JSMB 4KI4A 4H5VA 4ECXA 2HK3A 1Q82O 4ANDA 1J9AA 4IDKA 3W2VB 4IO1A 4OX9F 1FXDA 2BQUA 1HNXJ 4QR2A 2PZSA 3DOMB 3B6OA 4WFBQ 3KIOA 3H2LA 3M8YA 1N5YA 3F0NA 1UFLA 2A42A 4UOHA 3Q24A 4YOYA 2P9UA 2F40A 4QPTA 4WKRA 3CMQA 1Q0NA 4O44A 3PM9A 4E7LA 2GNKA 1C1CB 3N6LA 5D0RA 3GE9A 3MGJA 2KFZA 4AE5A 3KJQB 4Z4CA 1Z1ZA 3GPAA 1YI2N 5HVGA 3THXA 4JAXA 1G7CB 3M05A 3RG6A 1FRLA 2MGZB 4Z4IA 2ZUGA 4ELTA 1X8DA 2F1FA 3D28A 3ENOA 3NH1A 1HNVA 3GG0A 3MN9A 3FQLA 5HMZA 4WFYA 3D54A 4CJ4A 2V9WA 3K0JA 4B3OA 3MM6B 1B9FA 1F9HA 4CJFA 1LEOA 3UI3A 5C2CA 3EMTA 3QEWA 1TUYA 4RR5A 1K0TA 1U26A 1UCNA 2NRRA 3CCWA 1JLFA 2W9BB 4P2MA 5CZ1A 1MROB 2XEXA 2BE7D 2X6NA 2DGWA 3RBDA 4PPZA 4RPFA 3QWUA 2R7SA 4FLZA 4LF8K 2AX0A 3HOTA 1NBEB 3MEDB 1YJ9S 2OPPA 4WFNQ 3KK2B 4ZVEA 3PZPA 2Z8QA 3NGUA 1S59A 2KHOA 5LMUF 4ZKAA 2EBEA 1FXXA 4DR7K 3QINA 4CEBA 3M2UB 1XMOF 5AQRA 1WUAA 2BE9B 1C1CA 4F4YA 2PD1A 2VC0A 7FDRA 2NRVA 3SPZA 2YQ0A 2NS1B 2OFHX 3QZ7A 2E9TA 4M3TA 4JKAA 4LFBJ 3M2RB 1TV6B 1L3UA 4ED4A 3CJKB 2MGZA 3MM8A 3EXCX 4FXWA 1SKUB 4IOXA 1N33K 5AQUA 1HYZA 1JL1A 4CGGA 1Z2ZA 1HNWF 2M7SA 3SZ2A 4DV4J 5CZ2A 3MM6A 2X6SA 3IWLA 3A4TA 2PMZD 2HFNA 3OYHA 2EPIA 3IM8A 1XWLA 2VBWA 3AB4B 2M88A 4XH5A 2DNMA 3NFAA 1GX5A 4L76A 1RYRA 2OZSA 2A6MA 4KHUA 1XQIA 3FBEA 2W9BA 1YAGA 1KTVA 3TZWA 1J5OB 2ILYA 4K59A 2V8PA 1Y5NB 1TK8A 3LZJA 4B17A 2G9OA 3IG1B 4Y2KA 4DCPB 5CYQB 1FNOA 2U2FA 4KHPF 4N76A 3IAS9 3MR2A 3UE5A 1ZBTA 1BQNB 3L2QA 3DJCA 3EDRB 3DXKA 2OTJS 1XC9A 4USHA 3LDQA 5HRRA 4AHUA 2XCAA 1HYVA 1SPBP 4MIWA 2ZVSA 1WSVA 5CD4A 2W42A 2MY7A 3L3CA 3TVYA 4Y2IA 1TAQA 4V19J 1S99A 4QWEA 3NVKA 2MJUA 4X65J 2IIHA 3VV2B 2OPRB 2HGMA 3RBXA 4FXDA 3KK1A 3QBCA 1NB7A 4GV6A 2L9DA 4NYPA 4DR4F 4LF6J 3OFGA 2R7RA 4KTQA 3M2RA 1TV6A 1RDAA 4KRFA 3RRHA 1P9QC 4DR3F 1CQMA 3WX8A 1QQMA 3SV4A 4Y0WA 5HN0A 4IOCL 3QESA 2WBNA 3TJ9A 2DCLA 3Q8QB 4PA1A 1U7LA 2QSWA 4EGLA 1ATRA 3N01A 4DG1B 3A0IX 4FVUA 3DRRB 2ACMA 5KGXA 4P9SA 1B0VA 1NO8A 4BRGA 1A7GE 2BKPA 2EX3A 1YVUA 1R8BA 3VN5A 1OMSA 4DLEA 1VRUB 3CCMS 4JK7A 1K0VA 1ZM9A 4DV1J 1I3AA 2GAHC 3CVKA 1TUWA 4OJGA 1R8HA 2W8KA 1EKEA 3VAMA 3IG1A 1RHQB 2P9SB 2PN6A 3NF7A 2J8AA 1X4EA 1DZ5A 2QLJB 1BQNA 5B0CA 4Q2LA 3FJ2A 3VEOA 3GG1A 4FO0A 2NQPA 2IJNA 5HMWA 2L9NA 3CD0A 2NZ4A 3PX4A 2R8HA 3OYFA 1L3SA 3O9QA 3CO9A 4XPEA 2CPDA 1JB0C 3B8HA 1B0TA 3LPTA 1HKAA 4RL1A 2OPRA 1ZBSA 1A9NB 3R8YA 4X4NA 4LF1A 3R6MA 2FJBB 1K1SA 2OI2A 2VQEJ 1LFWA 4QR0A 1UOCA 3PO4A 1X4AA 4P2XA 3ZTPA 2VDHA 1F5AA 2K2PA 1YTAA 2M4MA 5D4NA 3P8BB 1YRTA 4A62A 4CLFA 3HP9A 1LOUA 2A1SA 4BS2A 3OVNA 3O4NA 5M1NA 4DG1A 4FYYB 4PG7A 4NYZA 2AV5A 1MMNA 2LQ5A 1HLWA 3P5TL 4M5LA 1IXKA 2NXEA 3JSBA 3GIJA 4BC4A 4F67A 2V2QA 1VRUA 3W61A 2R7TA 2PAVA 1Q9YA 4ID8A 3OD2A 4A2BA 4F36A 5GADP 3SI6A 2XNQA 2VFRA 3S3MA 1RXOB 2ZD1A 3A13A 4M5HA 4A8YA 3TTCA 4KH1B 3AVNA 1XMBA 1WDDA 1Q53A 2OD4A 3AOBA 1SIZA 4Y2MA 2FC0A 3ENWA 1LAWA 1ULRA 5EWEA 3CJCA 4F2SA 2PGCA 1UKUA 2I2YA 4CHYA 2XMTA 4LFBK 3V9SA 3SCJE 2WTFA 1LQ9A 1U4BA 4ES3A 3VEXA 4DQSA 1RBTA 1VQ7N 4CT9A 3MD1A 1ZTWA 2HHHF 1SAZA 2ITMA 1RT1B 2XQCA 1X5SA 3IWXA 2MYFA 2R7QA 2NXNA 3SQGB 4DTOA 4DV4K 4M5GA 1TR0A 3VQDA 2Z2MA 3VQ4A 3HLUA 4YB6A 3S6EA 1WG4A 5HAOA 1TK0A 3L7PA 4G3IA 3ZCMA 2M52A 4TY8B 2P8IA 3CXCR 1PO6A 3LDNA 2J5AA 2VOOA 3ZSOA 4M5MA 3QBXA 3WT0A 3CJ9A 1N5TA 1BCMA 2HVIA 4B9NA 1NJZA 3OTBA 1Q18A 1YBUA 3O08A 2JGUA 4M3ZA 1SI9A 4DV2F 1Q81O 4F4KA 3OHBA 4YDDB 2I8EA 2M9KA 4L6V3 1N33F 1WN7A 3GCXP 1RHJB 5DDQC 3SNNA 1FWPA 1KQSR 3CI5A 3T1HJ 4LRBA 2E5IA 4BROA 4CHNA 3VVTA 3C0BA 4EHUA 3VQPA 2A2DA 3DDNA 3J7YP 4IJNA 1P9YA 1KOHA 3R3LA 5EDWA 4IFYA 3OQ2A 1GLBG 2X78A 4OX8A 5EXWA 5IT9Y 1JXVA 2ZDOA 5BRHA 4ECYA 5KG0A 1SQEA 1H98A 4OI3A 1WB9A 4IEIA 2Z0GA 4CD1A 2R2RA 3D68A 2DGSA 3VEYA 1QY7A 3SV3A 3A1YG 1WHXA 1VRQC 1KVCA 4LF6K 5ETTA 2N4CA 4RWTA 1S9GB 4UQGA 2MTLA 4LIWA 3OS1A 3P49B 5EUHA 2CJYB 1HL6A 1RT1A 3WNEA 3H25A 4CZJA 5KOWA 3UCUP 4FXVA 3L3VA 5A76A 4BDPA 5HRNA 3MDFA 4EUVA 2RSQA 2ZVIA 2YKOA 1WG1A 1EQYA 2R7VA 2UXDK 4CJRA 4DR1K 1T02A 2NUUG 2VWJA 4LREA 4DV1K 4JI4F 3ITHB 4OYAA 3AQPA 3B4DA 3O9RA 5H9FJ 1SCJB 1MWMA 4V19S 1VSLA 2F7VA 1FX2A 1VSFA 4EWTA 3F5TA 3BF4A 3CHWA 2FVRA 1SJ1A 4J7CA 4P52A 1AFIA 3RAXA 2E44A 4CGHA 1SKSA 1YJUA 2AP6A 2VB6A 2GHWA 4FWRA 2HBKA 3TUJC 2Z2YB 1OY9A 1JLBB 4FP9A 4IRKA 3P6YC 3Q22A 1TP7A 1GXLA 2KT2A 3VGMA 2BW2A 1UVMA 3UD4P 2XO7A 4O0JA 2GQQA 4DF4A 4EP4A 4ECTA 1DTQA 4LQ9A 4CFDA 4PL8A 2ZE2B 3D6TB 1N0UA 4C0HA 3N6NA 4CF0A 1C0MA 3VF2A 2Q1NA 8ATCB 1KP6A 4FLTA 1UL3A 5CA5A 1S9GA 4BVOA 4CH7A 4MKYA 4WTOB 4ECWA 3NMAA 1Y00A 1M5OC 2CQPA 3GV7B 3GL1A 3GQCA 2P9KB 1VSEA 3WIVA 2XG8A 4N77A 1EJ7L 2POKA 1IKVA 1YKWA 3QJLA 4ES2A 2BABA 1UA1A 4TSXA 2D0BA 1VQ8N 2PT0A 1TVRA 1G3OA 2BJ9A 3N4WA 5CD4H 1WHYA 2D3OR 1A5XA 3ITHA 5JLFA 2OLWA 4Y2CA 4CBXA 1XI1A 4CIOA 3TA0A 3HI9A 3K2YA 2EFGA 2DYAA 1M90T 3UD5A 2I5JB 3CJTA 4R0JA 4J2DA 5F2RA 3I0SB 3GJTB 2FGOA 1E4FT 1SVDA 3WC2A 4JI3F 1YJWS 2ATCB 4KH6A 3FZBA 4GMKA 2P1JA 1QHTA 3BJYA 4DV3F 3U3YA 4DR6J 1JLBA 4DCJB 2H54B 1B64A 1T6DA 2XSJA 4MQ3A 2WK4A 3NL0A 1FFWB 1BC6A 2ZE2A 1RT4B 3CMAS 3NMUA 4EHTA 5FIIA 3MURP 2JC1A 2W4CA 1U24A 2ASLA 5CYJA 5GIPA 1LKZA 1S0OA 3JSYA 4DV7J 5ADXA 4CO3A 1S1VB 3CJ5A 1YX2A 2D3ZA 4G9ZA 2C28A 4K8ZA 2B9EA 2B0GA 1U6BA 3M6UA 3G4SN 5HJXA 1S12A 4R79A 3NNAA 2F4VJ 3T1HK 3JAMU 4ZVUB 3CCQN 1NH8A 3DN9A 2IYIA 5FPEA 3ZSRA 2XI2A 1NGFA 2QTWA 1HI0P 3ZYYX 4OI4A 3O6QA 2O66A 5EX5A 3ET6B 2V6AA 1HQEA 1LOTB 3H08A 3C19A 4RUBA 3LALA 4QIWD 4Y6IA 2B5JA 2CZ4A 4DTRA 3C66A 1FW6A 3CDUA 1HBOB 3SK3A 3THVA 2OEKA 3BY5A 2RU9A 3H2VE 4JV5F 4CJ5A 2CG8A 3OVBA 1U49A 2AQ4A 3D7SB 1S1XA 5D0HA 5K8NA 2MLXA 3R97A 4AYBD 1VQ6S 4DJBA 3GFYA 2UUAJ 4E89A 4K5SA 3QRRA 2AMCB 1RT4A 3UO0A 5KG4A 3SMSA 5D15A 3NCQA 4Y2AA 3O1WA 3AOAA 3AVGA 1T11A 4LMZA 2XHBA 2WVEA 3MWTA 3D6HB 4UW2A 4CZHA 1WF2A 4JV1A 1ZXOA 3KK3B 3QT6A 2IVFB 2YV0X 4FJ9A 3GYNA 2DY4A 3EGNA 2FLPA 4WBFA 3CXCM 2EI5A 2OSRA 1FERA 4RU9A 4CLZA 1S0NA 1Q9XA 2QLXA 4LSNA 2MDAA 3VEWA 1FEHA 2CYYA 2DGUA 3GONA 4ZLJA 4WP9A 1WELA 2ASYA 2X7IA 3HT0A 1NGAA 2IC3A 4FSVA 5HO4A 3LGHA 4OZJA 4A57A 2FUG9 4R25A 3TJ8A 1U04A 2F7TA 4R8UB 1DURA 3NH0A 4CJEA 1UJ4A 1OYDA 2Z4PA 4CLPA 1N56A 4FWNA 1NBWA 2DBBA 2UXDF 3OYNA 4HACB 1KQSM 4DR1F 3QRQA 1UVNA 3OSNA 2HFUA 3FRZA 5C2DA 5FRMA 5IWAJ 3AGKA 5LXYA 3KHGA 4U67Q 3QEVA 5FPMA 3EICA 3NBPB 1RISA 2C22A 3LPUA 2VGMA 4ICLA 1NU0A 5D4LA 3ZZZA 1GLLO 2ALZA 2YJEA 2OP5A 1AUDA 1MN7A 1KTQA 4OLPA 1PGZA 2JEFA 1NGHA 4BRFA 2W24A 4H4MB 5KFCA 5JXSA 1KEKA 2DIUA 4MH8A 3TTDA 1ZM3A 5AQTA 1W7AA 2V8DA 1VLOA 4XH4A 1Y64A 3UD3P 5L1IA 4IQXA 1YF5L 3I56S 1Y97A 3PW5A 3C14B 4LR7A 3U9ZA 4CEOA 2CPZA 3H7HB 3BM7A 1RAJA 2CQ4A 2QLWA 4U7BA 3KK3A 3MMCA 4DS4A 2E1CA 4WK3A 4NMLA 2RS2A 1PJ6A 4UF4A 4M7YA 2MQPA 4J9VA 1JLQB 5KAKA 1BL3A 1TYQA 2CVIA 3DYAA 1ZTTA 3BP8A 2DGTA 3I33A 3NOCA 1N32J 2IJFA 1D9FA 4DOZA 4DV5F 3L9ZA 2WOMB 3RAQA 1LW2B 5E84A 2V5HG 1WC3A 4B1UB 2GWKA 1B4SA 4B3MJ 4DR2J 3AVFA 5IT9O 4WXOA 2GX8A 4DR6K 3FFIB 3HK2A 3M7VA 1PSDA 4ZPDA 4CI0B 4NYOA 5MLCV 4LFCJ 3PYGA 4R8UA 1RNHA 3C16B 4DPTA 4I7FB 2DH9A 3CERA 4M5KA 3MI7X 3T1YK 4FLVA 4GV9A 4U96A 2KL8A 2HG4A 2Y0BB 3MMJA 1NSAA 4NI2A 5EN1A 3NBPA 2AEMA 3WHIA 1OJ4A 3HXMA 2WTUA 1VQOS 2DNQA 2DR8A 4L73A 3NS5A 2LYVA 4DV7K 2VUGA 3TVZA 5ETRA 4C8MA 4WIIA 1AUSL 1U6FA 2XY6A 1HBMA 2B9WA 5C5JA 5K9FA 1J5EJ 5L39A 3M5RA 5LXRA 3KK7A 2E1RA 3AO2A 1JCFA 2ZBQA 1KVKA 3LANA 3L8BA 2RF2A 3HD1A 4F4WA 4PG5A 2Z57B 4Z94A 4RNFA 1WKKA 5E3PA 4NLUA 3DLEA 4U95A 3C14A 2QLBB 3KHLA 4HYKA 2RQCA 1XHZA 4C8YA 3J81U 1S4EA 2F9TA 5JVHL 4CO0A 1VBKA 3BKUA 4RW7B 2WB4A 4A47A 1JLQA 1RZMA 5JS2A 4J37A 1OY6A 3H5UA 5CZXA 1WI6A 1FJGF 1GFWB 3CJ0A 1VQ5S