3IRXA

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with the non-nucleoside rt inhibitor (e)-s-methyl 5-(1-(3,7-dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
555
structure length
555
Chain Sequence
VPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of HIV-1 reverse transcriptase (RT) in complex with the alkenyldiarylmethane (ADAM) Non-nucleoside RT Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 129
structure length 555
sequence length 555
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3irxA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3irxA05
4OLBA 4Q8EA 4CCHA 3JSMB 4OKJA 1VRUA 4ZPCA 1REVA 1VSLA 3TAFA 1R0AA 5DQGA 4RW6A 5KFEA 4DTUA 4QWEA 3Q8SB 4E1MA 3NDKA 5HLFB 1VSFA 2AGOA 1SUQA 4RNOA 3MECA 1S6QA 1L5UA 4I7FB 4O3OA 2J6UA 5KFSA 4PWDB 3L2VA 3LP0B 4AHRA 1T3NA 4OVLA 5J2NA 2C28A 3M9OB 4F4XA 3T5JA 1T03A 1VRTB 4K50A 3VQBA 3O4NA 1HQUB 3GIJA 3OL7A 3CM5A 2VG7B 5D3GA 2FVPA 3HP6A 4CECA 3C6UA 2LSNA 3TAMB 3DOLB 2C2RA 4J9SA 3QZ7A 2F8TA 3QZ8A 3S3OA 4WFXA 1RT3B 1K1SA 5EWGA 4JV1A 2FJXA 3P5JA 3EZUA 2ZD1A 4ZVEA 3BQ2A 3NH1A 4DSJA 1JIHA 4RW8A 3OL8A 1LV5A 4CF1A 2HNDA 3RR8A 1TP7A 3K5NA 4FLXA 1NK7A 3ALYA 4F2RA 2HNZB 4FJ5A 3NBPA 4ICLA 4K4VA 3V6JA 4IR9A 3RMCA 1JLAB 1N6QA 4KB0A 4M41A 4Q44A 4O3RA 3H5YA 4ICLB 2G8HA 2WK4A 1RYRA 4LD0A 3AVMA 4DTOA 4Q45A 2DY4A 4KHUA 3G6XA 4GMJB 4CGIA 3T1AA 1NK4A 2X6SA 4E3SA 4XPCA 4HVJA 3LP1A 3KOAA 1JLFB 1RA6A 4BDZA 1X9MA 4FZZA 2ILZA 4DTXA 4FZXC 3DRPB 4KB7A 4H8KA 2ZKUA 3GIKA 1S6PB 3AVKA 1CZ9A 2FVCA 5DQHA 2YKMB 4DF4A 2D0BA 1G15A 4ELUA 3PW2A 1VSHA 2ALZA 1W25A 3I5BA 4DLEA 1ZTWA 1IKVA 2HNYB 3MR5A 3RTVA 1RTJB 3OYLA 1XWLA 4DLGA 3TANA 1XI1A 4AHCA 2BANA 3GV7B 3TARA 4O55A 3O3HA 4GW6A 3MFHA 4MH8A 5EUHA 3TAPA 3CJ4A 1RTJA 3MR3A 2XCPA 3AA3A 3OYJA 4DSFA 3MEEB 5KFFA 1XHXA 4BACA 2W8LA 3ZT4A 4W5QA 5CYQA 2IAJA 3KLGB 1HQEB 1X9SA 5DK5A 4KAIA 1VRTA 1U04A 3LWMA 1KHWA 4DU3A 3MEDB 1VRUB 4EBCA 4JLHA 1GX5A 1JL2A 3T5KA 2E9ZA 1HNVA 3CJ3A 5I3UB 2KZMA 3CO9A 1YT3A 1BQMB 1ITGA 1LWEB 4DG1B 4CEZA 1HNVB 2HWIA 2BRKA 4WYLA 4CHPA 4FVMA 4CK3A 3LPUA 3S3MA 3RB3A 2D0AA 4RG8A 4KFBB 4O3NA 1REVB 4K8ZA 3DRPA 3H2LA 4GVMA 4FZYA 2OA8A 3OS0A 4TLRA 3BR9A 1HMVA 2RDIA 3PUFA 4M3XA 1B9DA 2FLLA 1S0OA 3MFIA 1S97A 3RRHA 4KKOA 3I5AA 2E4LA 5E41A 5KFQA 1QTMA 3TAMA 4NLGA 3LZIA 1QE1A 2E6MA 4TY8A 5KFIA 3GV5B 1CXUA 4PQUB 2V0NA 5KFTA 2VA3A 4CHOA 1RT3A 2FBVA 5HRSA 4FXDA 1RAJA 3MF5A 4Q5VA 4DSEA 4OPKA 4EO6A 3SQ4A 1KCFA 1NK0A 2G8FA 4FJHA 2XI3A 4DTNA 3I0SA 1EETA 2ZE2B 3B6OA 3GILA 1GOBA 3KK3A 2BE2A 4IRCA 4NLOA 1S1XA 1UWBA 3NE6A 4KSEB 2HHVA 1TV6A 4Q0BA 4M45A 2DFEA 4JV0A 4KHYA 1UOCA 3KJVB 3NF7A 5KFOA 1SKSA 4NCGB 3TAGA 4QCLA 1MU2B 1RT6A 5KFRA 2O4IA 3HKWA 3IGNA 3HM9A 2BQRA 4ELVA 5DMRA 3KJVA 3SUOA 3V6HA 1VSEA 2HNZA 1RDCA 3OYFA 4CJQA 2OPQB 5KT7A 1JXLA 1RTHB 4DU4A 2UUWA 3DOKA 3M8PB 4IRDA 3KLIA 2P5OA 4IOBA 3MAQA 1S1WA 3DRSB 4HUEA 3NH2A 3V4IB 4Y34A 4DFKA 4DFMA 1VSIA 4W5NA 3CDEA 2ZQBA 3CFPA 2HHWA 1B92A 1ASUA 3WNEA 4CHZA 2YNFA 5KT3A 3ISND 4M3UA 5KI6A 3DLEB 5HLFA 3VQPA 2W9BA 5FDLA 1KVAA 2VWKA 2FLNA 3C95A 1TAUA 1HYSB 2KFNA 3SUQA 1EKEA 3NAHA 2HWHA 3RBDA 3KLFB 4CIGA 2ATLA 1WAJA 4CEOA 3V9SA 5KT5A 1KRPA 5HBMB 2GUIA 1LWFA 3FDSA 1KVBA 1S1UA 1HYSA 2W8KA 4MIBA 4OGCA 4B9LA 4PUOA 5KFWA 2OH2A 3HPOA 1RDBA 4FBUA 3QEXA 1ASVA 1K1QA 1DTQA 2W9CB 1GOAA 2G8WA 2DFFA 3GQCA 5CYMB 4WYWA 2ASJA 1IH7A 4WE1B 5EU7A 3MR6A 4CK2A 2UUTA 1NK5A 1T03B 4RW7A 4R8UB 3KK1A 1D1UA 4ZP9A 4ECUA 4RW9A 2GBZA 4G1QA 5KFNA 1NOZA 3LWLA 1QQCA 3K2PA 3H5XA 1UA1A 2J6TA 4O44A 3QYYA 4H4OB 3ZSQA 4CFAA 1EXQA 4CJ5A 4ED7A 4CIFA 5C25B 3M8QB 1LAWA 3QEPA 1RYSA 1YTAA 4YR0A 3DDKA 4B3OB 3A2FA 4N56A 2BGGA 4WXWA 4K4TA 3OHBA 3ITHB 4ID5A 3VQQA 4CJEA 4Z0UA 3KHHA 1NK8A 2QXFA 1D9DA 5KFVA 4PWDA 3H5SA 1A5XA 1BGXT 1RT1A 1QUVA 4ID5B 3HYFA 4ZPDA 4ZHRA 4IG0B 4DQQA 1JLGA 4ED6A 3PW0A 1RTIA 1IM4A 3OJSA 2C2EA 3L3VA 3KLHB 1NKCA 1HARA 1EX4A 3RWUA 4BE0A 2F96A 1I3AA 2ITGA 4MK8A 4QWCA 1ZYQA 3HO1A 5F8MA 2P51A 1TK5A 2XRIA 1N48A 3VQCA 4LSLB 1TKDA 1JX4A 1RT7A 4KBIA 4TXSA 1QHTA 5HRNA 3N6LA 5F8IA 3H59A 3LANA 4QAGA 4RW8B 3NGDA 5J1EA 2HHSA 1XR6A 4F4ZA 4IFVA 4CEFA 4GC7A 1C1CB 3HXMA 4J9PA 3LP1B 2W9CA 1TKZB 3BSOA 3KLVA 4EBEA 2XO7A 2X6NA 4TSXA 2OPSB 3HVRA 5DLFA 4F50A 3LP3A 2WTFA 1DLOB 2B4JA 3VQDA 2IOCA 1WSFA 3H08A 4KTQA 1S4FA 3TAEA 4RUAA 2F8EX 3AA2A 1ZBFA 3Q8QB 3FQKA 2X78A 2XY6A 4MFBA 4L8RB 3SI6A 4Y2CA 2RPIA 3UIQA 3K5LA 5SWMA 2RN2A 3KLEB 4R0EA 3ZT0A 4AILC 2HB5A 4WE1A 3G6VA 2AX1A 4FJLA 2R2RA 4WXOA 4YQWA 2YNGA 1SKWA 3VN5A 4MK9A 4CEDA 2UVUA 4CIEA 2JC1A 3ZSYA 3LAMA 2YKMA 1JLBB 3TABA 4ECTA 4M3RA 4NLPA 3QO9B 1BHLA 2IM1A 5L9XA 3WNGA 4HHTA 1EP4B 2YNIB 2OPPA 4H54A 3RMBA 3T5LA 4EP4A 3ITHA 4ZVFA 3K5MA 4JV2A 1XHZA 4N47A 2RKIA 4DL3A 4OPJA 4ZVGA 3QESA 3CQ8A 2YHAA 1TQLA 3TWHA 3N6MA 1C1BA 1FKOA 5D3GB 4FCYA 3PO4A 2HMIB 3C6TA 2WCXA 2Y1IA 4CHYA 3DRRA 3ZCMA 2AU0A 2E9TA 1ZBLA 2JEIA 5EWFA 3KLHA 3KMSA 2G8VA 2R8KA 5C42B 4PUOB 4M94A 5J2NB 3G0ZA 4KTWA 2HNDB 4TY9A 3BQ1A 3AVAA 3RR7A 1S1VA 2P1JA 4NYNA 1LW2A 3DM2B 3KK2B 3QEVA 2AJQA 3PX4A 4FM2A 1MU2A 2XY5A 4J9LA 1RDDA 4NCAA 3CJ2A 5K14B 1QSSA 4TY8B 5F9LA 4F3TA 1IKXB 4PQUA 3VQEA 1RDAA 4NLXA 4H4OA 1TKTB 3QIOA 5T14A 2XY8A 2DTUA 4CHNA 5KG5A 3MXIA 3BSCA 2BQ3A 4KE5A 2PY5A 4FJ7A 2G8UA 3QEIA 3IG1B 1WAFA 4WZMA 1CSJA 1D0EA 4FJKA 4MK7A 4K4WA 1TKXA 3RB0A 1C0TA 1RILA 1BISA 3QIPA 5FDLB 4QPXA 5L1IA 2QK9A 4CF8A 1S0MA 2A1SA 2ASLA 2XCAA 1SL2A 3IRXB 3BQ0A 2IC3B 4IG3A 3IAYA 5EWEA 1EETB 3U3GA 3K57A 4ED3A 1TVRA 3RB6A 1HPZA 5FRNA 2C2DA 2IS3A 4FJJA 1X1PA 2R8JA 4Z4FA 2VG5B 1VK0A 4KB1A 4KHSA 4ED0A 4ED2A 1JKHB 4HUGA 3SI8A 2IA6A 2B6AB 3C6UB 1S48A 4K4SA 1RBSA 3NF6A 2B5JB 5HROA 4Z4EA 1LW2B 3CJ0A 3ZSRA 2R2UA 1BL3A 3KLIB 3HVAA 4LQ9A 4DEZA 3DLKB 3QGHA 2NUBA 1DTTB 4U7CA 2R8GA 3V6KA 1S0NA 4ECWA 1T7PA 1LWFB 3KLGA 1S49A 3OYBA 2YNFB 4DU1A 4H4MB 3DMJA 3DLEA 2W7OA 1N6QB 4YP3A 3BSNA 1RBRA 4RNNA 3DM2A 1RA7A 4J9OA 4N76A 5JS1A 5KT4A 4IFYB 5KFLA 4RZRA 2OPPB 4MKBA 4R5PB 3ZSXA 3F73A 1BI4B 3JYTA 2Z1GA 4TQSA 4C8OA 5KT6A 2D0CA 2UVVA 1KTQA 4CJ4A 1FKPA 3L2RA 4U6PA 3ICLA 2I5JA 3P1GA 4B3OA 5HRPA 3KNAA 3QO9A 2HMIA 4HCCA 4NRTA 3PHEA 4FJ9A 2P5GA 1BQNA 4O0IA 2RF2A 2GV9A 2OZMA 4ZPBA 3NF8A 1U47A 5KFPA 4CF0A 1U09A 1T94A 4EBDA 4AH9A 1D5AA 4RU9A 4URSA 1S1VB 2YHBA 1S1TA 3Q8RB 4WZQA 4C8KA 4K4XA 5JUMA 1TL3B 1C0UB 3KK2A 5J1EB 5C24A 4O3QA 4IH6A 4ED8A 3U3YA 3OYCA 2VG6B 1C1CA 4QOZB 2EHGA 1RTDB 1KVCA 3AVFA 3CG7A 4ZMMA 4CJVA 2XI2A 3C94A 3S3NA 1RT4B 4CHQA 3OS2A 1JLEB 5KFDA 4M3WA 4GC6A 4B9VA 3HSTB 3BDPA 5FRMA 1DLOA 1HYZA 4KPYA 1JLCB 1Q8IA 4O3SA 3AVNA 5DGAA 2CJQA 3IS9B 3NF9A 5KRTA 1QSYA 4CF2A 2AQ4A 1HJRA 3L3UA 3KK3B 2Z1IA 4BE2A 2YNHA 3KLEA 2HVHA 3KTQA 3HK2A 1FK9B 3H98A 3ZSOA 4YMEA 2WRMA 3VQ4A 2BRLA 4ECQA 2UVWA 3NHGA 1IO2A 3CVKA 2QKBA 3V81A 2WHOA 4ECZA 4HKQA 3MEGB 4B9TA 1N5YB 4ECYA 4FJGA 3BREA 4CJFA 4E0DA 1TK0A 3OYGA 5F8GA 4FLYA 1R0AB 3SCXA 2OPSA 2DPIA 5KGXA 4RNFA 3OLAA 2E6LA 1FKPB 2GIRA 3QLHA 3HVTA 1KLMA 4FJIA 1TVRB 3DLGB 3AVGA 4NLWA 3NAIA 4I7FA 3QGIA 4E7IA 3SQ2A 4KI6A 3Q8PB 1WSGA 2V4QA 3U6FA 4KV8A 3QLHB 3VQAA 4OKKA 4MFBB 3LP0A 2D7SA 4CGFA 4CGHA 1YTUA 3LAKA 2W9BB 4OJRA 3OYKA 4N41A 4K4UA 4CJUA 5J2PA 4LY7A 1N4LA 4J9QA 1S5JA 3KD1E 5L1LA 1WSIA 2FJVA 5J2QB 3DLHA 2AGQA 2IAJB 2KQ2A 1Z26A 4DSIA 3OL9A 4RW4B 3PJXA 3SZ2A 4IH5A 5HP1A 2XHBA 2WB4A 1ASWA 1WSJA 4FJXA 1MMLA 5JS2A 1NOYA 4RW4A 4YNQA 4HCBA 4J2DA 1C0MA 3D5MA 3LZJA 4JS4A 5HROB 1RT2A 1DTQB 4BDPA 4FK2A 3VQSA 4EP5A 4F4YA 3DYAA 3AVLA 4YFUA 4CESA 4NYZA 4FK4A 3SUPA 3DOLA 3CFRA 1SL1A 3AO5A 3AO4A 3CIZA 4IKAA 4LQ3A 2KZZA 4LH4A 4DTRA 4EYIB 1EP4A 2YNIA 4AHUA 3TR8A 4K8XA 2ILYA 3DI6A 2IMWP 4XIUA 1C1AA 3FFIB 3NKYA 4ECRA 2OPRA 4F3OA 2KTQA 2YKNB 1TK8A 3P83D 4IKFA 1BCMA 1Z25A 4KRFA 3L2WA 1TAQA 4NZ0A 5KFHA 4HYKA 2KFZA 3HVWA 1TV6B 3KIOA 1SV5B 3ZSVA 5KFUA 1RT1B 2BDPA 3EPIA 4YR2A 2FVRA 3LDSA 3HL8A 2BANB 1JXEA 1S10A 3OSPA 4KO0A 1S6PA 1HRHA 4KAZA 2G8IA 2IM2A 4Q0BB 2WONB 2XY7A 5KT2A 3RRGA 1LW0B 4I2QA 4FYDA 2R2TA 4DL5A 2PZSA 5F9NA 4J9MA 2GC8A 4NLSA 4ZTFA 3JSMA 2VG5A 3AO3A 4IFVB 3DLKA 4BWJA 3SYZA 3VQ8A 5KFAA 2O5DA 4AHVA 3VQ6A 5KGWA 3V6DB 3QNNA 1W9HA 4J9KA 1RT5A 2XC9A 3RMDA 5T7BA 4KTZA 2HNYA 4MIAA 2IJFA 3QIPB 4I9QA 3AVCA 5CYQB 1SKRA 2QE5A 3I5CA 1TL1A 3SNNA 4DG1A 3FRZA 2X74A 5EDWA 1RBUA 1LWCB 1XC9A 4DQPA 4J9NA 4M3YA 3JYTB 2R2SA 2W7PA 2Z1HA 1JLQA 3G10A 1QAIA 3OYIA 2BR0A 1GOCA 4TQRA 2OZSA 5HRRA 3N6NA 3MEDA 1ZETA 3PW7A 1CZBA 4PY5A 1LWCA 3QIDA 1SUQB 3GIIA 2HHQA 3HP9A 1L3VA 4IRKA 3EY1A 1JLQB 3BSAA 1GX6A 3DLRA 3SQ1A 4IFYA 1Q9YA 1KLMB 3HVTB 4DL2A 2YV0X 4FLTA 1NJWA 3V1RA 4CJTA 3DRRB 1QE1B 4EO8A 2PYLA 4NCBA 4H4MA 4NLDA 1CLQA 4LSNB 1T05A 5KRSA 3BGRA 3AV9A 1SH0A 2V4RA 1ZBUA 4CEAA 4KI4A 4CJWA 4LSNA 1T05B 2FC0A 2W42A 4R8UA 2ATQA 3KK1B 3KHGA 1IKYA 5KFZA 5KG1A 3SUNA 2HW3A 2HHXA 5DQIA 2PYJA 4QW8A 3VQ7A 4FW1A 3IN5A 3V1QA 4CGJA 1RTDA 4CJLA 2JEFA 3NBPB 3MR2A 3PY8A 5F8LA 1NJZA 1HMVB 3LP2A 4AHTA 2OYQA 4ZP7A 4ECSA 2XGQA 4KKOB 2FVSA 3LPTA 3I0SB 3B6PA 4DF8A 3NFAA 4E89A 4F4WA 4CEQA 5KFMA 3NGIA 3UQSA 1WN7A 3ZT3A 2YNGB 4FBTA 4Z4HA 1IKXA 1NKEA 1JLEA 3V9UA 5J2MB 4MKAA 2FBTA 4W5RA 2R8HA 3MTKA 3SFUA 4RNMA 2RDJA 1NJYA 1ZBHA 1NK6A 1TKZA 3FFIA 3V9ZA 3OYHA 3QEWA 3V81B 5FROA 1S9EA 2F8SA 1VSMA 3K5OA 4B9NA 1S1WB 3M8PA 3SPYA 2VG6A 4NLYA 3KLFA 2B43A 3UDLA 3RAQA 3ULDA 1LAVA 4J2BA 4NYFA 1HQEA 1Z4UA 2GIQA 1SV5A 1KSPA 3VQ5A 4C8LA 3PX6A 3CFOA 4CERA 4J2AA 3D28A 1CXQA 4Y1CA 3QNOA 3AVHA 4Y3CA 3KHLA 3RB4A 4KV8B 3NAEA 3MEEA 1ZBIA 4DSKA 4Q43A 3FSIA 3CYMA 5HP1B 4ECXA 4CEEA 4BDYA 5I3UA 2ETJA 3T5HA 2EC0A 5KG7A 4RW7B 1S9FA 1FK9A 4EZ9A 5KTQA 2IBKA 1Y97A 4CJKA 1BIZA 4CGDA 4FJMA 3IGVA 5KFYA 1KFDA 2JLEA 3DYAB 4URQU 2B6AA 4OLAA 3DMJB 2Z1JA 4NLRA 4I9LA 4JRPA 3M8RA 4X2BA 5C25A 1WSHA 4O4GB 4M3ZA 1BQMA 4RW9B 5KG6A 4I2PB 4ZP6A 3DI6B 4ZVHA 4JUZA 5KG4A 3ISNC 2HAIA 5KG2A 3KMQA 1SL0A 2D41A 1TL1B 4TYBA 2XWYA 2BQUA 4QWBA 1XR7A 4FM0A 3ZT2A 1RDRA 3M8QA 1BIUA 4O4RA 5DGBA 3QINA 3QETA 1RT2B 3PZPA 2EX3A 1F21A 1A5WA 1C1BB 1FKOB 3VA0A 1U48A 1O1WA 2D5RA 3OYAA 3D0PA 4DQIA 2UVRA 1J53A 5KFXA 1L3UA 3D45A 3QGGA 5KFBA 5CZ2A 1TL3A 2I1RA 3V9XA 4FLZA 3SQ0A 4CJSA 5C42A 4DQRA 1VSDA 3CWJA 5SZTA 3TI0A 3VA3A 1K6YA 1J5OA 4TYAA 4UQGA 1BCOA 3MXMA 3PW4A 3NMAA 4FJNA 3OYEA 4DMNA 3OLBA 4FW2A 1JLCA 4FJ8A 1NKBA 1TGOA 4M95A 3M9MB 3DRSA 4Q8FA 4W5OA 4IG0A 4ZP8A 2IM0A 3AVJA 3VQ9A 4EZ6A 1N56A 5DG8A 1HNIA 1QSLA 3NGYA 4NLUA 3OHAA 4C8NA 4B8AB 1I6JA 5KFJA 1C2PA 5DG9A 2J6SA 2IC3A 2OPQA 4B9UA 3LP2B 3SV3A 2E9RX 1I39A 4XPEA 3EZ5A 4IQXA 1RCHA 1TKXB 4DS4A 3TAQA 4DL7A 5CY4A 4OL8A 5I42A 3ZSZA 2HHTA 1HYVA 4CJPA 4F8RA 4FS2A 3SJJA 2IJNA 4E1NA 1RBTA 3PR5B 3PR4A 3ZSWA 4OGEA 4KHRA 3UR0A 3HT3A 3RBEA 4URGA 3T19A 2R8IA 4W5TA 2WOMA 5F8NA 4HUFA 1U49A 4DL4A 2A1RA 1J9AA 3V9WA 3OY9A 3THVA 2CKWA 1S6QB 5KG0A 1LWEA 1DTTA 2RKIB 1JL1A 1JLBA 3G6YA 4J9RA 3I8DA 5L1KA 3AA4A 3WNFA 2V9WA 4PA1A 4O44B 3OYMA 4E7LA 1S1TB 4B8CA 4BWMA 5C24B 1U4BA 2D3UA 4EYHB 3L2UA 3I0RB 2R7YA 3UPFA 4O5BA 5J2PB 1T8EA 4G3IA 3PVXA 5F8JA 4BE1A 5J2QA 2O4GA 3OS1A 1OS5A 3TVKA 3I0RA 3AO1A 3RMAA 2QV6A 1W0HA 4KHNA 2G8KA 3KD5E 1QAJA 4Z4CA 2VG7A 1IKYB 2JC0A 2FBXA 5HBMA 1JLGB 3H4DA 1XR5A 4IH7A 3F9KA 2YNHB 4AHSA 3AA5X 5L1JA 4CK1A 1KHVA 2ZD1B 1D8YA 4KHQA 5J2MA 4LH5A 5K14A 1RT7B 2Q3SA 4QW9A 3MEGA 4ECVA 4F2SA 1S9GA 4Z4GA 1RT6B 4ED1A 4DTMA 3V1OA 3ASMA 4K4ZA 1RTIB 1RT4A 3AO2A 4B9SA 3CDUA 1JLAA 4XO0A 1JLFA 1WLJA 4CFCA 2VWJA 2AWZA 1WNEA 3WNHA 1TKTA 3HPHA 3IG1A 4LSLA 4CFDA 1NNDA 3IS9A 3NGZA 1VSKA 3EPGA 4FS1A 4DTSA 1YVUA 1IG9A 3O3GA 1C0TB 3FQLA 1IKVB 3L8BA 3SFGA 3HHKA 1NK9A 2HHUA 3GIMA 3K58A 3CJ5A 3SPZA 3PX0A 2AX0A 5KFCA 3NL0A 3O3FA 4ZHRB 4DFJA 1HPZB 4DSLA 5DG7A 5KG3A 2B5JA 3V4IA 1KFSA 3NCIA 3HPGA 1IKWA 2ASDA 1NHUA 2JEJA 4KO0B 1SH3A 3NH0A 2WONA 1KLNA 4C8MA 1UA0A 3S9HA 4Z4IA 1LW0A 1U45A 4ZTJA 2HVIA 1JKHA 4WFYA 3GYNA 4HTUA 4O3PA 3M8SA 5DLGA 1RNHA 4RUCA 1J54A 5KFGA 4E7KA 3AVIA 3PO5A 1S9EB 3BJYA 2WOMB 3KKRA 1S1UB 3LALA 4CJRA 4DTJA 1SH2A 5KFKA 4E19A 4JS5A 4DTPA 2VA2A 2C22A 1S9GB 1BI4A 3C6TB 4ELTA 1WSEA 1YVFA 3E51A 3O4QA 4NRUA 2W9AA 2OPRB 4CJ3A 1WNSA 4QWAA 2Y1JA 5CZ1A 4KHMA 4CGGA 1HQUA 3G86A 3OVNA 4M42A 1BQNB 5C5JA 3EYZA 3PW5A 4J2EA 4DFPA 3E01B 4IDKB 4E7JA 4OKEA 3SV4A 3PV8A 4JRQA 3BGRB 1UAXA 3T3FA 3OJUA 4R5PA 4O4GA 4G1QB 1NJXA 1B9FA 1S1XB 1UWBB 4DL6A 3E01A 4IDKA 1ZTTA 4I2PA 4KFBA 2QKKA 3MECB 2FVQA 3PJWA 5JXSA 3H40A 3KKSA 3AVBA 4O0JA 5F8HA 2RF2B 4FLWA 4B9MA 4NCGA 1RBVA 2IM3A 4CE9A 3L2QA 4TN2A 3H4BA 3ZT1A 2IDOA 4RW6B 3OL6A 4IR1A 2BE2B 1C0UA 3DOKB 1J5OB 2I5JB 2AGPA 4K4YA 3CM6A 1JXBA 3K59A 1D9FA 4IBNA 4CEBA 4CFBA 4Y1DA 4DQSA 3CDWA 4F4KA 1QS4A 3QERA 2ZE2A 2FBYA 2IGIA 1C6VA 1Q9XA 1A5VA 1L3SA 3MXJA 4N5SA 3RAXA 4KHWA 4FLVA 1IKWB 4NLTA 2YKNA 2D3ZA 4DWIA 3KHRA 4FK0A 2XGPA 4E7HA 4CF9A 2JGUA 4Y2AA 3GV8B 1FXXA 2JEGA 2DPJA 4RNHA 4I2QB 3H5UA 1RTHA 3TQ1A 5I42B 3IRXA 4EEYA 1N5YA 4FLUA 4IG3B 4NLVA 4FM1A 1VSJA 4M3TA 1X9WA 4DS5A 5CYMA 2KW4A 3V6DA 3DLBA 4NLQA 4YR3A 3HJFA 4WFZA 4B08A 1NHVA 3OSNA 3OYNA 2FLPA 1RT5B 2DFHA 4ID1A 3OYDA 4MQ3A 3M9NB 4KREA 1L3TA 2FJWA 1HNIB 4QWDA 3DLGA 4ZPAA
chains in the Genus database with same CATH superfamily
2OEJA 4CCHA 4JYAJ 1GTHA 1VRUA 4XAKA 4ZPCA 2QL9B 4ILMA 3TAFA 2G0JA 3N79A 2FJBB 4DTUA 1U6ZA 3SLCA 3ZYYX 1RLCL 4E1MA 3I56N 5HLFB 1VSFA 2YBVA 4F04B 3FUYA 1HHTP 4OLOA 1WD6A 2LQ5A 4RNOA 1L5UA 1N36F 1NH8A 2J6UA 4A8YA 2E1YA 4B17A 3P96A 1WC4A 3LP0B 3L2VA 1RU1A 2R3VA 4AHRA 2NR0A 3BYPA 3A12A 4JI6F 1K73O 4BC7A 2ZBQA 1T03A 3GR0A 3C3LA 1VRTB 5GAEI 2DJWA 3O9RA 4HTLA 4TKTA 3QMLA 3D67A 1GT8A 4JI6J 3TAMB 5LMNK 1Q8LA 4J9SA 3QZ8A 3S3OA 2CQ3A 4GKJF 1K73T 5EWGA 1G2EA 2E88A 2FJXA 2ZD1A 1LKZA 3NH1A 2CPFA 2AJ1A 1JIHA 4RW8A 3OL8A 1LV5A 2MHEA 3Q24A 3RR8A 2FJAB 3H90A 1WHVA 1FRKA 3TA0A 4FJ5A 1KC8O 4K4VA 3V6JA 5B8HA 4PRFA 1E3MA 1JLAB 4JI5F 1WEZA 4DR1F 2DNPA 3EGWB 1VQ8S 3VEXA 5JVHL 2ROEA 1OVYA 4QR1A 1RYRA 1U0SA 4Y0WA 1NXIA 4CGIA 3T1AA 1IWAA 4HVJA 3KOAA 5EOYA 2ZOGA 3ILLA 2FSJA 1UP1A 4FNHA 3HTVA 4CLWA 1T9XA 2LA6A 1QM9A 3GG1A 2JJ4D 3DRPB 2MZSA 4OPHA 2VPYB 3AHPA 3AVKA 1CZ9A 1WTBA 2B9WA 4GV9A 2FVCA 5T7LA 1ZPVA 1G15A 4HWIA 1SPBP 1VSHA 3TW0A 1RWWB 3D7SB 2UU9K 4LFAJ 2CPHA 1XWLA 2KXHA 4DLGA 3WXKA 4O55A 2FSNA 1A0OB 2PEHA 2X1GA 2WVDA 2UUCF 2XZTB 2IVYA 1CQMA 3AA3A 4U7UK 4DSFA 1KVJA 4Y6IA 2W8LA 3MN7A 2UXCF 4LF5K 2M8HA 3SMSA 1VRTA 1FDBA 1NJIO 2H9ZA 3ZLJA 1NHKL 2E7XA 3L0QA 4OYPA 1RE1B 3EMTA 1T9TA 2XBPA 3AQPA 1UKUA 2UU9J 4X62J 3CJ3A 3LM9A 1ICEB 5AQPA 1ILYA 1BQMB 3THXB 4DG1B 4JKDA 3KK7A 2FF3B 2XZDB 4ED4A 1XNQJ 3GLJA 4NEZA 4FVMA 4BR5A 1WORA 1XMOF 1XNRK 4KFBB 4MO4A 1WUUA 2W2MP 1WI6A 2BTFA 3J7YU 3H2LA 3LUYA 1FJ7A 2OA8A 1FRIA 2ZNYA 3OS0A 4UOHA 2PI4A 4FVCA 3PUFA 3UN3A 2PFFB 3EE8A 1S0OA 5B0EA 5E41A 4NLGA 3LZIA 3HJVA 4AUKA 4DUYJ 1KAZA 2IRXA 2QFIA 2V0NA 2VA3A 2AJFE 3FZBA 3O08A 3I87A 4OI6A 3CCUN 4ES1A 5EHHA 4ED5A 4EO6A 3SQ4A 2ZKTA 3ETMA 2JL9A 1NK0A 1CJVB 1BWFO 2LECA 1XERA 1TL7A 2R7QA 5H9FK 4C8ZA 3QICA 3KK3A 4OHWA 4IRCA 3WEEA 4FYWB 3ET6B 3SDEA 2HEKA 4KSEB 2J9CA 2DFEA 4JV0A 1R8CA 3NF7A 1SKSA 4QCLA 2ZH8A 1MU2B 5KOXA 4I6WA 3CCZA 2QL7B 2V4JA 3CCEN 2P9GA 3U4LA 1TZ0A 4Y2MA 5ADXA 3NY0A 3SUOA 3V6HA 1NPKA 1RDCA 2RH3A 3HD2A 2UUWA 2WVFA 3DOKA 3MD3A 4IOXA 1LOTB 3KWIA 4IOBA 3AGKA 1U1RA 1S1WA 3DRSB 1NDLA 1VSIA 3CDEA 3ZC4A 1EARA 4XTTA 3T1HJ 1B92A 3CJ9A 1N36J 1RKJA 2YNFA 1HKAA 1VFJA 5KI6A 4ILGB 3NGRA 3QAEA 3QJPA 5HVFA 4NOHA 3C95A 4CZGA 4WF9Q 3BO3A 1YI2S 1MLAA 3H1QA 3NAHA 2HWHA 3RBDA 4U67Q 2RD5C 4CIGA 1WAJA 4DV2F 2R7SA 2QYCA 5KT5A 4UQTA 1X5PA 5AQYA 3L3CA 3OVAA 2W8KA 4F02A 1TUWA 3PJ9A 4RWXA 1DURA 2DNQA 4B9LA 5KFWA 2OH2A 3HPOA 4PG7A 1RGVA 2EFVA 3QEXA 2VHGA 2FF6A 1WHWA 1K1QA 3EDQB 2X1BA 2XEXA 2MQLA 3BF3A 3MR6A 4L76A 5EU7A 1ZPWX 1P90A 1QY7A 2BABA 1H2VZ 5AR0A 3KK1A 2MTLA 1D1UA 4ZP9A 4ECUA 4RW9A 3CCWA 5CR4A 3EXYA 4G1QA 3DN9A 1T9YA 2MQMA 3LWLA 1M5KC 3K2PA 5C2DA 5HVGA 3CCJS 2M0GB 1OWXA 1KBRA 2E1PA 2NLXA 4ED7A 3VZHA 3GE1A 1DHMA 3ISZA 5ETPA 1RYSA 1YTAA 2ZJPL 1PCAA 1FTCA 4XEIA 2W6KA 2DR7A 1PG5B 3VQQA 4CJEA 1HBUA 4Z0UA 3PYEA 1NK8A 5KFVA 2V50A 1IBKK 4ZPDA 1VQ9N 3VEVA 2V67A 3FCVA 4YDUC 3PW0A 4X65J 1ZOTA 2VQEJ 4F7VA 3OJSA 1X4BA 5IQQA 4CI0B 4PAAA 1SJFA 3Q86A 1M5PC 2CPZA 2XRIA 3MMCB 4LSLB 2GX9A 2W01A 5THWA 1EKRA 3KUHA 1RT7A 4OX9J 5HRNA 5KAKA 5GIOA 4KPCA 4F4ZA 3HXMA 3NLCA 2W9CA 5IT9U 1VLOA 3IBFB 1TKZB 3HFKA 4WTOB 3TSQA 2X6NA 1ZM4A 1R27B 3GFXA 1TMMA 3AJ1A 5DLFA 4F50A 3LP3A 2WTFA 3VQDA 2IOCA 2GQCA 5B0DA 1OO0B 1S4FA 2F8EX 2E5LF 2I7PA 4KT0C 3BZKA 3IR5B 2DITA 3EWGA 4TLQA 2X78A 2XY6A 2RPIA 3ZT0A 1F9EB 3Q8YA 3G6VA 4FJLA 2R2RA 4CEDA 2UVUA 4CIEA 2JC1A 1BE4A 2Z2ZA 4F0MA 1LQ9A 4ECTA 4NLPA 2DKOB 1BHLA 2IM1A 2LCWA 4HHTA 3KUGA 2YNIB 2LXIA 3BUZB 2I0XA 4DV4J 1M5OC 2HSEB 4ZVFA 2KFYA 3NCPA 5ADXH 4YB7A 4A8FA 3KJQB 4EHUA 2RKIA 4ZVGA 4USHA 3N6MA 4XH5A 2CYYA 2YKQA 3PO4A 4FCYA 5ETMA 3ZZZA 3M05A 3BYRA 3CJQA 3HD1A 1ZBLA 2XMUA 2QEXN 1OYEA 2GO8A 3CC7N 1NU0A 4PUOB 2K8GA 5J2NB 4PCQA 1IQTA 3G0ZA 4OYWA 3BQ1A 2GVDB 1S1VA 3RR7A 1FW6A 2P9LA 2ASPA 2WAQD 4JB8B 2XNQA 3CCRS 1YJNS 4OI0A 3KK2B 3TYTA 4RU2A 4DUZK 5AQFA 4FM2A 4CBWA 4B3TF 2ZC3A 4J9LA 1RDDA 1JCGA 3IO1A 3IR7B 3L4IA 3K9KA 3HSZA 1TR0A 1Q81T 3ILIA 4NLXA 3MN5A 4CZCA 1OSCA 2R7RA 1VQ8N 2XY8A 5KG5A 5M1KA 2BQ3A 2PY5A 3QEIA 1Q8BA 4FJKA 4K4WA 1TKXA 4JI4K 1HBUB 1BISA 3QIPA 5FDLB 3OR1B 2K2PA 5EX0A 2Y0SD 3EDRB 2DHGA 2RRBA 1Q4RA 3MTJA 2F5GA 4IO9L 1KQFB 2IC3B 3IAYA 5EWEA 1EETB 1Y5IB 1NZ8A 1BC6A 3OUYA 4DB3A 2V68A 4LFBK 2N3LA 2C2DA 5JMNA 4DOZA 4CZHA 4KB1A 5CH7B 3NP5A 1U1MA 1HNZF 1XN9A 2L48A 2FUG9 2YKOA 2QFJA 4ED2A 3MM6A 3NS7B 2KG0A 1JKHB 4HUGA 4WF9L 5IWAK 2CWKA 1RBSA 4UT4A 2BJEA 2A6MA 1M5HA 4GVBB 1BL3A 3FEYB 3KLIB 5FPDA 1S72S 2R8GA 3BGUA 4ECWA 1IBCB 5AZIB 3IM8A 1S49A 1U0HA 3M2VB 4M7YA 2FHJA 3QJLA 2HQGA 4YP3A 1GMWD 1RBRA 2BJ8A 4WTYA 2D3OR 3DM2A 4J9OA 2ZF5O 3UDVA 4IFYB 5KFLA 2NRVA 2AW0A 1ZM3A 4MKBA 1N52B 3JYTA 4TQSA 2J7KA 5KT6A 2YKPA 1FKPA 2WVEA 3R7SB 2W4CA 3AAWB 3P1GA 4B3OA 3G71S 4O0IA 4YHHF 1BUXA 4ZPBA 1SJRA 3TZYA 1KAXA 4DR7K 5KFPA 5G0RB 4EBDA 2JNJA 1D5AA 3HI0A 3A4TA 4ZN3A 2YHBA 3Q8RB 4WZQA 3LTOA 1VBKA 5J1EB 3U3YA 4IH6A 1X5OA 1UPPA 3CG7A 4ZMMA 4CJVA 4ILJA 2V34A 3O9QA 3OS2A 4LBPA 5K9FA 4GC6A 4B9QA 1V3ZA 1VQKN 4NWBA 1DLOA 1N0VC 4YHHJ 2PGCA 2KKZA 2CJAA 3LH2S 4KIAA 3IS9B 3MN6A 2Z1IA 3M5RA 3KTQA 2DGSA 3H98A 4P7VA 2BRLA 2QKBA 3IDHA 2HS0A 2KU7A 2LA4A 1MDUB 4BGBA 3AT1B 4ANCA 2N82B 4HKQA 1MROB 4B9TA 2RQKA 4FJGA 3BREA 4M5IA 4ILHA 4FLYA 2VKRA 4EI2A 2DPIA 1X4CA 2A2CA 5KGXA 5EXWA 3LDQA 2OJ3A 3BKUA 2HSTA 5AZIA 2HYIB 3A1YG 1TVRB 1V4SA 3CCES 3UB5A 1GLEG 2DGTA 3PLAA 4DQ8A 3QGIA 1HW9A 4E7IA 3Q8PB 4U7BA 2V4QA 3VHQA 4OKKA 4LVNP 1HI1A 1VISA 1R7IA 4CGHA 3LAKA 2W9BB 4OJRA 4DV1K 2IMOA 3CJRA 4K4UA 4DR2K 4DJBA 4CJUA 4LY7A 3UDEA 1S5JA 2GHVC 4NXNJ 5AXMA 2FJVA 2AEFA 1VQPN 3DLHA 4ZKAA 4FDFA 3FGUA 4IOAQ 2KQ2A 1Z26A 4MKVA 3ZO7A 4CLPA 3JTPA 5ETOA 2WB4A 1GLAG 5JS2A 2J9EA 5DRKA 4C1NI 4HCBA 1SAZA 3LZJA 4OZJA 1DTQB 2V8PA 2IFXA 4YFUA 4CESA 2FHJD 3SUPA 3DOLA 3CFRA 1SL1A 3AO4A 3EX7B 5K8MA 4FPBA 3TTFA 1B7FA 3DHWC 4GKKJ 4U8YA 5IZHA 3SBMA 4UOFA 4MLEA 3HZGA 3BPDA 4ECRA 4B1ZA 2IVFB 3P39A 2P9NA 4NEYA 4X66F 1TAQA 2KFZA 1NGDA 2XLKA 2DNYA 3CO0P 2ZITA 1WOOA 1U6BA 2EPIA 2H5IB 3KNGA 1SZ2A 3GG4A 1RT1B 3AODA 3PKYA 1UL3A 2G2OA 1KR4A 2J7WA 3HL8A 4NMXA 2BANB 1JXEA 1ZBSA 1Y10A 1IBKJ 3CMAN 2B9XA 4LT6A 1VCTA 4KO0A 2G8IA 2ASYA 1YRTA 2JHEA 4JOUA 1VQLN 1EQ0A 3RRGA 2DH7A 2FY1A 1LW0B 1U1LA 4FYDA 2L9DA 3D3CJ 4J9MA 4NLSA 4ZTFA 4IFVB 3G8TA 3SYZA 3VQ8A 4OX8A 3ZZUA 4FOIA 1NBEB 3DXMA 3LPEA 1VC6A 1WUAA 4ZVSB 1JJ2M 2DBBA 5E3RA 3WXIA 5AQIA 4AXJA 4KH0B 2IJFA 5AQWA 2XMAA 5CYQB 2H48B 2DO4A 2VOOA 4B3SJ 1TL1A 3SNNA 3DOMA 2Y8WA 4Y65A 1ZA2B 5M2PA 2BKNA 3IWLA 1VQ6S 2LDIA 5B7WA 1QAIA 4LRCA 5IWAJ 2DNGA 4TQRA 4KGZB 3N6NA 1ZETA 3PW7A 4ZVTB 3MMVA 1LWCA 3RW6A 2CH6A 1L3VA 4IRKA 2YH1A 3EY1A 5A2QU 2O67A 3TA2A 1CC8A 1GX6A 2CVIA 1XMQK 3DLRA 3U1NA 3EJMA 2YV0X 2AIRB 4CJTA 4DPTA 2W40A 4NCBA 1T05A 3Q83A 3TRGA 3ZTOA 1PC4A 3W2VB 5KRSA 3AV9A 2Z56B 2V4RA 1TL4A 3M8YA 2FC0A 2NZCA 1UPMB 1HPMA 2PEBA 3NWGA 2QYGA 1H6KX 2CJYB 3FBFA 5KFZA 1KNZA 2HHXA 4AQYJ 5DQIA 1Q1KA 5AQMA 2MYFA 3IN5A 2KG1A 1EWQA 2HQCA 2M52A 2NRHA 1BA1A 1W2BR 1XNQF 4EWTA 1OQ6A 3CD6N 1T9VA 2LXUA 5BYQA 4DMZA 1NGIA 2M4MA 4CEQA 1W97L 2ZOMA 5DDOC 2CQDA 3R1HA 3L4QA 4Z4HA 3BO4A 4OYZA 3AB2B 1RTZA 2QL5B 2FBTA 1NM1A 2R8HA 3MTKA 1NJYA 2E7VA 3D0HE 2GHPA 3FFIA 3OYHA 4KHPF 5FROA 1S9EA 1FRXA 1NGGA 4YDXA 4WFBL 2KO1A 4Z7YA 4JV5F 2PN6A 3BBBA 2A6OA 4LRBA 3UDLA 2HGLA 2V7YA 4BG9A 4P74A 1XQIA 4MAKA 4C8LA 3NNCA 3CFOA 1CXQA 4Y1CA 3MM6B 3CC2S 5AZJA 3KVGA 3NAEA 3MEEA 1ZBIA 5AXKA 2FQQB 3CYMA 4CEEA 2BVZA 2ETJA 2NRWA 4RW7B 1S4EA 1NRKA 3C8YA 4UY85 1BIZA 1Q8KA 1QVFR 3KG0A 4FJMA 5AJ3F 5F0XA 2XNRA 3IGVA 2Z4PA 3FK4A 2P9KA 3DYAB 1IBMJ 4OLAA 1FEEA 4DV5J 1N0UA 3M8RA 5HMYA 5CA5A 1WSHA 2P9KB 2GWKA 3K0JA 2NUUG 4ZP6A 3J81U 4CW7B 3DI6B 3UFCX 4DV2J 2HAIA 1TL1B 1OH8A 2U1AA 2NRRA 2BZ2A 1IXKA 3M8QA 2Q97A 2ROPA 1OQ3A 5MAOA 1U2VA 3PSFA 2UV8G 4O4RA 1YJ9S 3OFGA 1RT2B 3OR1A 4LFAK 1A5WA 3D6RA 5D4LA 2V51B 1UW9A 2KT5A 1L3UA 2QLBB 2RU9A 2HFOA 5BR8K 4QQBA 4X66K 4LFBJ 4FLZA 3SQ0A 3HOTA 2E1RA 2DD8S 3CWJA 5SZTA 4BR7A 2HBYB 5HQMA 1K6YA 1J5OA 4C1NK 3PACA 4UQGA 2QG9B 4X65K 1YVNA 3VMFB 4FWPA 3MXMA 3PW4A 5AQLA 3HRGA 4FJ8A 1TGOA 2A41A 1URRA 2FDNA 1C0GA 2X7IA 4ZP8A 4ZCKA 4C3MA 2A3ZA 3KWGA 1K0VA 2WW8A 4LF7F 4WK1A 2FTRA 3OHAA 1CC7A 5KFJA 2FGOA 1RWKB 2FHOB 2F65A 4ZVQB 2OPQA 2BOPA 1RB0A 3R97A 1I39A 4IQXA 1TKXB 4WQ5A 2ZWHA 3PKMA 3TAQA 4DL7A 4X62F 4FS2A 5AXLA 1DY3A 1RAFB 1KC8T 3ZXWA 1RBTA 4JI6K 3PR4A 4OGEA 4CLZA 2M3DA 2B56A 1D8ZA 3J7YI 2CDRB 4FWNA 4URGA 1F2GA 3T19A 3VAIA 5JMVA 5HMWA 1U49A 3UI3A 3THVA 2O66A 2CKWA 3K2YA 5FD1A 3G6YA 2NYHA 4J9RA 4H0VB 4QZVB 5A8WB 3I8DA 4WFNQ 3AA4A 5E3CA 3WNFA 2V9WA 4PA1A 4O44B 4KH4A 1NGHA 4P9SA 4B8CA 1KD1O 3MOJB 1B0TA 3CD0A 1O6XA 3J8AA 3ENAA 2R7YA 3OFFA 2YX7A 4O5BA 3FZHA 1YSJA 4B3SF 2PMWA 5A0YB 3VEYA 5J2QA 3OS1A 1OS5A 4E8UA 3EGVA 4BGAA 4DX5A 3MHYA 2KJWA 1W0HA 5IT0A 4C98A 2G8KA 2CQ2A 4Z4CA 5HBMA 3HKZD 3QT8A 4DV5F 4DV3J 2ZJRQ 1XR5A 4IH7A 2QMWA 3TJ8A 2NSBA 2MQNA 2F4VK 4DV0J 4ZVOB 4JK7A 1RQ0A 1D8YA 1TU0B 4USUA 1RT7B 4DUZJ 2E7WA 4F2SA 3ZZ0A 1RT6B 4ED1A 3RSEB 4K4ZA 5B08A 2E2NA 4B9SA 3AO2A 1RT4A 3CDUA 4XO0A 3SMZA 1JLFA 1NDKA 4B1VA 3CULA 3UN2A 3KXDA 2KLAA 3G4SN 1S99A 1SC3B 1F0XA 4ZS6A 4HHJA 1YHQS 4LF5F 1WF1A 4DTSA 1Q0NA 3QPIA 3W5ZA 1C0TB 5JVGQ 2IBOA 3CQYA 2Q66A 3SPZA 4BRMA 3THTA 1V5IB 5KFCA 4WFBQ 1ZH5A 4M5DA 3QT5A 1RWXB 4DFJA 1FJGK 2O8DB 3L95X 5KG3A 1UETA 2B5JA 3O80A 2ZGZA 3BY5A 2ASDA 1NHUA 2VH7A 1SH3A 4C8MA 1OY6A 4HDHA 4Z4IA 1T9UA 2GVZA 5AFUH 4V1Ak 4ZTJA 2P6TA 3M8SA 1HWUA 2K7KA 1QAXA 2HRYA 2LLZA 5KFGA 1VGYA 4A8OA 3PO5A 1BD6A 2H51B 4FOEA 2B4PA 4LR7A 4CD1A 3CDAA 4CJRA 1SH2A 5CHIA 2CPXA 3VV2B 4N77A 3AJDA 1S9GB 1BI4A 2ZUGA 2O8CB 1YVFA 1YITS 3MAHA 2Y1JA 3QWPA 3OVNA 3H42A 3Q8UA 4IDKB 4E7JA 2GX8A 4OKEA 3SV4A 1B0VA 5BJRA 3CJKB 1CJKB 4ZN1A 3OJUA 1OSDA 1S1XB 3FCHA 5BN9A 1ZTTA 4I2PA 3MECB 5JXSA 3DC2A 3H40A 3CJKA 5F8HA 4NCGA 5A8KA 1MMDA 4KC5A 2E1CA 4DV3F 4Z94A 3L2QA 4TN2A 3H4BA 1ZXOA 1FDAA 3T41A 2Y9HA 3OL6A 4KGVB 2I5JB 4NI2A 5C12A 2AGPA 3K59A 1D9FA 3PSIA 4IBNA 4Y1DA 4DQSA 1UZHA 3PEHA 2D0PA 3QBXA 4M5GA 1M1HA 2V2VA 5HK4A 1JJCB 3KDOA 1U1QA 1PAUB 4LF7K 3E9OA 4N5SA 4OQJA 3RAXA 4KHWA 2AZ3A 1SQKA 3TEGA 3IUCA 4UOGA 4DV7K 4B3RF 2XGPA 4FK0A 2EBEA 2DXFA 2QTWA 2JEGA 4K25A 3LM2A 3WQPA 3VAJA 3V5RA 1IVZA 1RTHA 3TQ1A 3P4IA 3MK6A 4M7XA 2IVOA 3CJ1A 3F0NA 4DV6F 4NLVA 2WBRA 3GFYA 2VOPA 4DS5A 1XQSC 3K89A 3NRBA 1PBUA 3HJFA 4WFZA 4B08A 2ASMA 1RT5B 4ID1A 3M9NB 4KREA 1B7YB 4QWDA 1FVQA 1U2CA 3VEZA 1VMBA 3JSMB 3H6EA 1HHQA 3H20A 4ZIWA 2XS5A 1VSLA 4NO7A 2HQFA 5AQZA 5FLXO 3QRQA 1N34F 3CD6S 2YJEA 3OBWA 4V19S 3B8AX 1SUQA 3MECA 1S6QA 3PHTA 4NA3A 2EFOA 4JN4A 2E44A 3R8YA 3CC4N 4DZ6A 5CYJA 2P8IA 2C28A 3QJJA 4GVLA 1K8AO 1NGCA 3M9OB 1NLKL 3UN5A 3GIJA 3J7YP 2VG7B 1GAOA 2FVPA 5E26A 1TUYA 3C6UA 2LSNA 4H5TA 3HHLB 3DOLB 2C2RA 3QZ7A 4G6VB 2JVRA 3W0LA 1K1SA 3AQOA 3BV8A 4JV1A 3P5JA 4DV7J 4DSJA 3T1YF 5LJ5Y 4CF1A 2HNDA 4YY3F 2LMIA 2EFPA 1EJ7L 3ALYA 1R43A 3RMCA 3IM9A 1N6QA 1H98A 4LF6K 1AXQA 4CLYA 1E6YA 2VIHA 2MKSA 2DY4A 2BJ9A 3PYDA 4FF4A 4Q2MA 1NSKL 3K9JA 3O2IA 1NK4A 3LA0A 1O0PA 5BR9A 4CNZA 1P1LA 1JLFB 1RA6A 4X4PA 4BDZA 1WC1A 1Y5NB 5H1SQ 1OYDA 2ZDPA 2ILZA 4BY9C 4FZXC 2IVNA 4KB7A 4H8KA 1WF0A 2J76E 4ELUA 1W25A 2I9SA 4DLEA 1UFKA 3I5BA 4GO5X 4MYUA 1IKVA 4K41A 2HNYB 3RTVA 5L9NA 1NB2A 3TANA 4EAHD 3FZKA 5M1PA 4DCJB 3O3HA 3AA9A 3MFHA 3CJ4A 1RTJA 3MR3A 2GCFA 4E98A 3R5BA 3OYJA 4D3GA 3MMBA 1XHXA 4BS2A 3TEHB 3ZT4A 4W92B 4W5QA 5CYQA 2AJ2A 3GWCA 3I33A 1X9SA 1N5QA 2X51A 5DK5A 1AZSB 4E2FB 3NG8A 2IY5B 3M8ZA 1U04A 2EC2A 1T0TV 2LU1A 1V3SA 3CCSN 2F9TA 4MYTA 2CVEA 4BR2A 1VRUB 4KJIA 5HN0A 3AGRA 1I94K 1GX5A 1JL2A 3T5KA 4K59A 5I3UB 1UEVA 3CO9A 5IM0A 3BS9A 1RKIA 2P9PA 5D77A 5HQ8A 4IQMA 1EQMA 4L3KA 4OZ0A 2VFSA 1RADB 2NPFA 3L7OA 4QS9A 2EFNA 3EM1A 1QQNA 2ADCA 4GVMA 4FZYA 3EKSA 2DGXA 4MT1A 1HMVA 2Q0RA 3RRHA 2MLXA 2CGKA 1OVQA 1QTMA 3TAMA 1QE1A 5KFIA 5KFTA 1RT3A 2ZZTA 3TVZA 2FBVA 4PPDA 2CNNB 3S41A 1RAJA 5G0RA 3VAKA 3O1LA 4Q5VA 2DHXA 1H72C 4OI1A 4J9UE 2YVSA 3GFHA 2QLWA 5D0GA 3EZWA 1PIEA 2G8FA 4FJHA 2OD6A 4DTNA 3JTOA 2P9UA 3GILA 2QA4G 3J7ZT 4ZLNA 2BE7D 1UWBA 3T1YJ 4H5RA 4P2MA 2PD1A 5B0AA 1W7AA 4PPZA 5KFOA 3EGZA 4DV0K 3DXSX 3SAFA 2O4IA 5KOWA 4CZJA 4F0HA 1NSAA 5ETVA 2DEJA 4W4MA 2BQRA 1KTVA 1YRUA 1LFWA 2B8QA 1OPZA 4H5VA 1WKJA 3KHYA 3VEOA 4DU4A 3D6MB 2BJ7A 3M8PB 2P5OA 2AEMA 3MAQA 4HUEA 3V4IB 3GYGA 4GRSA 2EVZA 4DFKA 3AOCA 2UUBF 3WT0A 3FMBA 2ZQBA 3BZCA 1HA1A 1VQ5N 3JB9k 1ASUA 2GO9A 2L9WA 5KT3A 4NXMF 5FDLA 2YPZA 3ZZPA 2C3MA 1UEUA 2DNKA 1HYSB 3P38A 2RRNA 3SSQA 3NS6A 4BC5A 3RBXA 4PG8A 1LWFA 1KVBA 2K3KA 1HYSA 1RWUA 3TOQA 2DGQA 2PSZA 4USVA 2PBDA 1QQOA 2MQOA 2GGPA 4PUOA 4N8OA 3JTNA 3OPKA 1RDBA 3PG9A 3CCVN 4GVEA 1H38A 1ASVA 3ADAC 2W9CB 2G8WA 4HVZA 2ASJA 4ID8A 4CH1A 4CK2A 1U8SA 1HKCA 2RNEA 4EK2A 5A2QO 4OYBA 5LJ3Y 4DXLA 4QBUA 2GBZA 5KFNA 3HSCA 1T3OA 3MWTA 2J6TA 3N9UC 4O44A 3QYYA 4H4OB 1Z6RA 5GAGI 2XMWA 1AZSA 4CJ5A 2QO3A 5FLXU 1GXTA 1CJTB 3M8QB 4C2MA 3W5YA 3PDNA 1S77D 4N56A 3D2EB 2BGGA 4K4TA 3R6LB 3ITHB 3OHBA 1I1GA 3NNAA 2P6SA 2QXFA 4PWDA 3B8HA 1A5XA 2OTJS 2XO6A 1MWZA 1QUVA 3HYFA 2O8FA 4IG0B 4DQQA 3I56S 1XTZA 1Q5YA 4DZDA 2C2EA 4PG5A 1HARA 4BE0A 1I3AA 4QWCA 2Q1NA 3D66A 2HLUA 3U1LA 1TKDA 1JX4A 1VS3A 1C0FA 3DLLQ 2RU3A 2CJXB 2EWHA 4I1TA 1S5ZA 2YI1A 1BXNA 3H2VE 1FVSA 2BW2A 4RW8B 2XYGB 3ET6A 2NS1B 5J1EA 2GMLA 1YJTA 5BYSA 1XR6A 5HJYA 4J91A 3HSGA 1BY9A 4GC7A 1NZAA 4JP8A 4QIWD 1UZDA 3BSOA 2IIRA 2BW7A 4HL9A 2ADBA 4ZCMA 3OTOF 4CD3A 1VQ7N 5D78A 3C2PA 2Y1RI 1HWLA 3J80O 2CJBA 3H08A 4JEPA 5EGYA 1U0HB 1APSA 3BN7A 5H9EJ 4MFBA 2XTJP 3UIQA 4R0EA 1HWIA 3I4HX 4M63A 3A5MC 3CF5L 4DUTA 2QA4N 2UXBJ 1RHMB 2YNGA 4ILRA 4RCHA 3P5BP 4KBOA 1MROA 2VUGA 1T6DA 2DGOA 3C7NA 5A8KB 3ZSYA 1JLBB 2W2PP 3QO9B 7AT1B 2H5JB 2G0IA 2R7OA 1FE0A 3QATA 4WBFA 4LR9A 3U9ZA 1EP4B 1YJ7A 1U1OA 4UZCA 3O5BA 4C48A 4H5WA 3RMBA 1P6TA 4MTPA 3ITHA 3JXUA 3UO0A 1XHZA 1VBZA 4N47A 5RUBA 2GMHA 3MXHP 1NMDA 4DCPB 3TQEA 4OPJA 2YHAA 1TQLA 2VQFK 1C1BA 1FKOA 5D3GB 2LQBA 4CHYA 3Q2SC 2E2QA 3IWXA 2AU0A 3KMSA 1WEXA 2Q43A 1YJWS 2YHWA 3D6TB 2HNDB 4TY9A 4RUHA 4XDDA 2RIJA 1SVDA 2MMYA 1BG3A 2RHKA 3D9BA 1Y0HA 3PRVA 1X4EA 3BBCA 5ETRA 2GV1A 3CJ2A 1QSSA 4F3TA 2F4VJ 2ZH6A 3VQEA 1QVGM 1QZ6A 2C2NA 4H4OA 4LF7J 2H54B 5T14A 2DTUA 3MXIA 3BSCA 1DAXA 4KE5A 4BG8A 3IG1B 1IN0A 1WAFA 4CO0A 2VICA 4BQLA 4MK7A 5M2UA 1IR1A 1UJ4A 1C0TA 3HZEA 3O3LA 5JJBA 3POTA 1RILA 1Z05A 2ALYB 2IIHA 2PAVA 2QK9A 4CF8A 2UUBK 2A1SA 2ASLA 4DHVA 2BYCA 1SL2A 2IDLA 1GTEA 3BQ0A 2OI2A 2VC0A 3OXGA 1WHXA 5GAHU 4KGKA 3N4PA 1OH5A 3G71N 1LNQA 4ED3A 3CJ8A 2VG5B 1VK0A 4NXNF 3CJAA 1W2BM 4ED0A 3GU0A 3A3NB 2IA6A 2MKJA 3MPUB 3J80U 4K4SA 4JI0F 4IEEA 3NF6A 5HROA 1LW2B 3CJ0A 1ZA1B 2VFTA 2CXEA 4DX8H 3MUVP 3HDSA 4UY8T 4DCOB 2V8DA 4DEZA 4ES2A 3ZNJ1 4OZ1A 3V6KA 1S0NA 5KQ8A 3LPYA 1V9OA 1LWFB 1T7PA 1VQOS 3N01A 3KLGA 2VDHA 2E5LJ 3CD7A 5K5MA 2YNFB 5F3ZA 4RJVA 1YX2A 3BSNA 1LWXA 4C7QA 1HD0A 2KI2A 4PG6A 4N76A 3THWA 1S12A 2OPPB 1JNRB 2JH3A 2OO4A 3F73A 3ZSXA 4BRQA 4JI2F 1VK8A 5CZVA 4ZPTR 3GE9A 3ICLA 2ZJQL 1Q16B 3BGFA 5HRPA 3KNAA 3QO9A 3GL1A 1X0FA 5ITHA 2Q1LA 4J8FA 1NM2A 2P5GA 1BQNA 1CQNA 2RHSB 4XK8C 1T94A 1M1KT 2VKZG 3LF0A 2UUBJ 4OV1A 1S1VB 4JKBA 4K5RA 3TU5A 4C8KA 2GJIA 5LMNF 3PYGA 1M1GA 4ED8A 3I9V9 4LF6J 4KHPJ 1PKUA 1F6TA 1KVCA 2WFBA 4WCEL 4AD6A 3C94A 2DT9A 3S3NA 4WK3A 4CHQA 1VLYA 3FSYA 4BHQA 1VQPS 4JI3F 4JAXA 4R0JA 1HL6A 1CBKA 3GG0A 4OPAA 2IRUA 1HYZA 4QIFA 3V4MA 1Q8IA 2J8SA 3CJBA 5A6WA 1TL7B 5KRTA 1PAEX 2O8BA 1FESA 1HJRA 3KK3B 2DR8A 2N7CA 3PIOQ 4U9RA 5GAEU 4UZBA 4B3MF 1FK9B 4IFEA 5LMNJ 3LW5C 1YJUA 3VQ4A 2UVWA 3NHGA 5FJ4A 3CVKA 1M90T 3PTWA 5IV4A 5D15A 1BU6O 5DS7A 1QVFM 3GSIA 4WFAQ 5GAEP 4E0DA 3OYGA 3TO8A 4KH6A 4A2AA 5IS2A 5F8GA 1H7WA 3SCXA 3HM8A 2DRAA 3KDNA 3MCSA 3OLAA 2FSKA 2GIRA 3QLHA 4LFCF 3HVTA 1YBTA 5T41A 2CGLA 5E3QA 3W64A 1N34J 3CF5Q 3C0BA 4BRCA 4I7FA 3SQ2A 3QLHB 3CI5A 4MFBB 3LP0A 2HF3A 1OMSA 5BN8A 4LBIA 2NCKL 3T6JA 3OYKA 3MMAA 3RU0A 1VYAA 3GJTB 5L1LA 4NLCA 2MY8A 2AGQA 2ZH2A 3CCMN 2DR9A 1Q53A 3J81O 3UVJB 1K9MO 4D3HA 3SZ2A 4NMLA 2BACA 4JI7F 3GJRB 1NOYA 3A0IX 4RW4A 4YNQA 4X65F 1C0MA 3D5MA 5C2FA 3MWBA 4JS4A 5HROB 1RT2A 1QJHA 4FK2A 4Y0FA 2CQ4A 1UCNA 3DYAA 4X4TA 3AVLA 4NYZA 2YWGA 4OZ2A 4B3RJ 5LJWA 1H2UX 1KXPA 3OVBA 4P52A 1AA1B 3CIZA 3L9ZA 3VGVA 2V9KA 3G2XA 4NB4A 2ACYA 2WBNA 4AHUA 1IUJA 1WF2A 1M90O 4K8XA 4XIUA 4FKYA 3FFIB 3NKYA 2P2CB 2KTQA 4F3QA 1NSQA 1BCMA 4ISGA 1Z25A 3CD5A 1VQ4S 4MKYA 4OZ3A 4HYKA 4CLTA 1TV6B 5D8HB 2IYGA 2HIQA 4ZJLA 3MZIA 3FC9A 2ZZMA 1W26A 4P2SA 2ZEJA 1Q86O 2ZWOA 3G8QA 5AQGA 1Y5LB 4JI8K 5DZ7A 1IBMF 3UKUB 4YR2A 4CBUA 2FVRA 3U02A 3R1LA 1N5VA 3ZEUA 2NREA 4P72A 5DETA 1S10A 1SIWB 1S6PA 1HRHA 3QNWB 4Q0BB 2WONB 5KT2A 4W90B 3POTB 2GHWA 3F5TA 2F63A 4I2QA 2XB2D 4OYAA 3SXLA 2CG8A 2ZWPA 4DL5A 3JSMA 2V63A 4BRPA 3DLKA 4PG4A 4F25A 4BWJA 4A4JA 2XMVA 4BRNA 2O5DA 1JXVA 4AHVA 3OBYA 1KWMA 2SXLA 3QNNA 3EVMA 4DBQA 1W9HA 4J9KA 2XC9A 3RMDA 5T7BA 4JV5J 3QIPB 4I9QA 4YEAA 3AVCA 5G4DA 1FI4A 1SKRA 3CJCA 5HOOA 2XSJB 4DG1A 4FVUA 1HHSA 5EDWA 1RBUA 1LWCB 4AXIA 2W7PA 1VR6A 2Z1HA 4M5HA 5MLCV 3G10A 2BR0A 1U2FA 5HRRA 3MEDA 1RCOB 2XWXA 2HHQA 3ZFVA 3HP9A 3QSIA 2D1KA 2AJ4A 2YWFA 1H0HB 2CUYA 4IFYA 2HBQB 3R5DA 2QEXS 3HVTB 2B7CB 2OCEA 1VRQC 3V1RA 2EKNA 2G13A 1FD2A 2PYLA 1FKAF 4H4MA 6AT1B 4NLDA 2XQCA 1VAZA 3L09A 3M6UA 2CPIA 1SH0A 4FO0A 1ZBUA 4ZPVR 4KI4A 4LSNA 2ATQA 4KGXB 3D0IE 4ANDA 1MWKA 1YJWN 1Q82T 3JAMY 3JS9A 3TUJC 2PYJA 3VQ7A 4WU3A 3UD5A 3QRRA 1KVIA 2W4PA 5I4MA 2ZHAA 2RRAA 1M5SA 4OI2A 2JEFA 3NBPB 3DXKA 2KKHA 2OYQA 4KKOB 3JSYA 2G4BA 3I0SB 3D2WA 4EFHA 3VVTA 4N7TA 2ZH4A 3VZIA 3DGVA 2CRLA 2L08A 4FL9A 2BXJA 2XS2A 1QZ5A 5H9FJ 3UQSA 2P9SA 3TSUA 2NXUA 2KDOA 2YNGB 2LYVA 1NKEA 4B3MK 5J2MB 4MKAA 1JJ2R 2CPYA 2VV5A 1NMEB 4LF8J 2BE9B 1F9FA 4CZFA 3QEWA 4LREA 1Q79A 1RWOB 2F8SA 3M8PA 1FEHA 1CG2A 1FX2A 3KLFA 2E8AA 3DRXA 4J2BA 5HATA 1U8WA 3ZX2A 1Z4UA 1KSPA 5JVGL 2GVZB 3NEKA 3VQ5A 5CD4A 3BR8A 1FE4A 9ATCB 3QNOA 2OD4A 4Y3CA 5JVHQ 1S22A 1RP5A 4KV8B 5M1OA 3EVWA 1PGZA 3OUYB 2AP1A 4ECXA 4BDYA 5I3UA 4M5DB 3J7AN 2W2NP 1KQSR 5CAAA 4CJKA 2CADA 2UXBF 3WX8A 2YKAA 2NQPA 4CZIA 1KFDA 4B1UB 2C2KB 2B6AA 1DEJA 2Z1JA 4NLRA 4JRPA 2HS4A 3SBTA 2POKA 1LEOA 1RDUA 5C25A 2DHAA 1UMJA 4OJGA 4O4GB 2DGVA 2V8VA 1BQMA 1KQKA 1IG8A 4I2PB 2C2ZB 4JUZA 4LIRA 2QI2A 3SEOA 3KMQA 1SL0A 4K42A 4TYBA 2BQUA 4BC2A 3EUNA 1OIAA 4F67A 4H0YB 1J2VA 3HHLD 4DR4F 4HTIA 3TX0A 2EX3A 1F21A 3QFHA 1C1BB 1FKOB 4OX9K 1WOPA 2D5RA 3OYAA 4I0WA 3D45A 3QGGA 2I1RA 3WBZA 5C0YA 4CJSA 5IT9Y 3VGTA 5CXTA 1KOOA 4MDBA 1TUVA 4TYAA 2W25A 1HQ2A 3IAM9 2I6WA 3VEWA 3U9DA 5HANA 3OYEA 4DMNA 2PE8A 5HI7A 4M95A 4KH5A 3MCNA 2PFUA 4W5OA 1RACB 3ILJA 4B3TK 1VQ5S 4AYBD 2QWRA 1QSLA 3PFOA 3DNCA 4B8AB 1RDWX 4QIGA 1I6JA 1C2PA 2KL8A 4KRWA 2IC3A 1RAIB 3EZ5A 5I9EB 4ENOA 4O5FA 4DS4A 3MPYA 2ZVIA 5CY4A 4LRFA 3DXMB 1EAYC 4ISEA 2HHHJ 3BBFA 3SJJA 4PXEA 4J9VA 4QR0A 3UR0A 2ZM6J 4LF9F 1TMJA 4GV6A 1Y7PA 2VFUA 4GV3A 3Q8VA 4W5TA 3D0GE 2B9EA 2WOMA 3NVMA 2NPIA 3BN4A 1MW7A 5K8PA 2OGUA 3KFWX 4HUFA 1VBYA 2BKOA 4PXCA 2NXEA 3BDEA 5EX5A 1GMUA 1S6QB 2M5YA 3THXA 3M30B 4LFBF 1S0VA 2RKIB 3I6PA 1JLBA 3GP9A 2UUCJ 2OEMA 5L1KA 2RE1A 3OYMA 2AYMA 3C65A 5IWAF 4RWWA 3PCOB 1Z2ZA 3CQXA 2X3GA 3AFGA 5J2PB 1VC5A 5F8JA 2UP1A 4CO3A 4BE1A 3EL2A 3RRKA 3TVKA 5GMDA 3BF1A 2V7ZA 2FD2A 2QV6A 4QPTA 4KHNA 1PC5A 3KD5E 1QAJA 1N33K 4EUVA 2JC0A 4P75A 2FBXA 2A2DA 2QJ3A 2HQIA 2QMUB 3O5TB 3F9KA 4UUWA 4OLPA 3AA5X 5L1JA 2J9DA 1KHVA 2ZD1B 2LQ9A 3S6EA 4LF4F 4LH5A 2ITMA 4QW9A 4FPIA 4FYVB 3AY9A 4YN3B 2NZ4A 4Y00A 3Q22A 2Y1LB 4DTMA 1FRMA 3ASMA 2QM1A 2HRUA 3E8OA 4IEIA 4U96A 2VWJA 2O1PA 5LMUJ 4PZVA 3P3DA 1VQ4N 1X0PA 3IG1A 3AD9C 1GLDG 4ES3A 5HL7Q 3H46O 3RG6A 1LFPA 1UFWA 1SXLA 3IS9A 1NB7A 4FS1A 2M2BA 1YVUA 2ATCB 3M6WA 4NE9C 1IKVB 1ZAWA 4BCAA 2XMKA 1FRLA 3L8BA 3HHKA 4DN0A 4JI5J 3CJ5A 1HNXJ 3PX0A 1VDHA 1K8KB 1WC3A 4DR7J 3W9HA 2EBGA 3MWPA 3V4IA 2F8MA 2HG4A 3NCIA 2O8BB 2CQCA 4A5AA 1K8KA 1SJ4P 5AZJB 2CH5A 3RVCA 3MN9A 1DQAA 1S3XA 3I4PA 3US5A 2V8GA 3S9HA 2YTCA 1YIJS 1LW0A 3S8SA 2HVIA 5LY3A 3W8PA 4CBXA 2VPXB 3DKDA 4O3PA 1DFDA 5MLCQ 1RNHA 1TFWA 4RUCA 3LDNA 3O8MA 4OZNA 5H1SV 1S9EB 3KKRA 4P7TA 4E19A 2W2QP 2BV3A 4LC9B 4HH1A 2HFVA 4JS5A 2DY9A 4X4QA 4WKYA 1EO1A 3C6TB 2MEWA 2GTDA 4ELTA 1WSEA 2PFDA 4DKWA 4KYZA 4QWAA 4CGGA 2CDQA 2FC9A 3G86A 3JQMA 3ZTRA 5BPMA 4M42A 2HBZB 3EYZA 2R7XA 3PW5A 4J2EA 4DFPA 1X4GA 3OTDA 4DV1F 2YWWA 1MN9A 2YH0A 4HH0A 1D4XA 4O4GA 1NJXA 1REGX 4DPYA 4DL6A 2RQCA 2QKKA 3QT6A 5F1XA 3R5AA 1TUUA 3EGNA 2MKCA 5M1FA 4WQ5C 2Z30B 3W3DA 3VF6A 2RF2B 4FLWA 1RBVA 3FSXA 1OKJA 4FWSA 1YJRA 1YDLA 1FA0A 1LXNA 3R5GA 2P9PB 1HR0F 2VPZB 1OPIA 1ATNA 1LCUA 4WP3A 2BE2B 2FIUA 4DR6J 3CTRA 2VJUA 1JXBA 3MMJA 4M5MA 1I51B 2L3MA 1QS4A 1JK9B 3SIPB 2ZE2A 2ZOFA 3BKFA 1F1BB 3IFRA 1C6VA 3LDLA 1U2VB 1L3SA 2GQ2A 4FLVA 3WXMB 4L3NA 3SJHA 1VBXA 3FFKB 1TFYA 1VHFA 3HF5A 3GV8B 2R7TA 5DM7L 2M70A 2QC3A 2ZH3A 3IBCB 1FXXA 5GADI 1T02A 1S7HA 2DPJA 4BQZA 4RNHA 3BF4A 2ZBRA 3H5UA 5I42B 3IRXA 2RMLA 4EEYA 3G6ES 3THPA 2OSQA 3CIMA 5GAHP 3PYFA 4FM1A 2A42A 4HLBA 4M3TA 1X9WA 1OH6A 2FJEB 1FFWB 2KW4A 4YR3A 4IWVA 1NHVA 3OSNA 3OYNA 3KWMA 3NCQA 4MQ3A 2F9WA 1HNIB 4OLBA 4AL7A 4ALZA 1U25A 4OKJA 4FWRA 1REVA 4FZVA 1RWPB 3R7BB 4HHUA 1R0AA 4UW2A 2MZRA 4WP9A 5DDQC 4QWEA 3DHXA 1YAGA 5HAOA 4BC9A 1RU2A 2YWHA 1Q5VA 4O3OA 5IC4B 5KFSA 1N5SA 2YQ3A 3LGHA 3HSDA 4OVLA 4JHDB 2J0WA 1G4CA 2HK3A 3DCAA 4F4XA 4GY2B 1EWRA 5F0WA 3ONQA 1N33F 4CVNE 4USIA 4HEA9 3O4NA 1HQUB 1QLNA 3OL7A 3CM5A 2JOQA 5D3GA 4C0OC 3HP6A 1R0BG 5C2CA 4CECA 2RILA 1CJUB 2F8TA 4A48A 4LF5J 5E3PA 1XMQF 3HULA 4JK9A 1CS4B 4ZLJA 4CDIA 3BQ2A 4CO5A 2A3JA 3SSSA 2CNOB 1ZM2A 1TP7A 1RBOB 2N7YA 3K5NA 4F2RA 2XYPB 4EU0A 4C0HA 4DR1K 4XH1A 2I8EA 4IR9A 3WC0A 4ISFA 1U2RA 2G0CA 4KB0A 4QU7A 4A61A 1KD1T 4DR6F 4M41A 4I6AA 1P9YA 3H5YA 2G8HA 4IO8A 4LD0A 5GMEA 4YB5A 3FBBA 4Q45A 4NASA 1FDDA 3CCQS 3G6XA 4DU7A 2D4WA 4WKRA 1RI7A 2X6SA 4E3SA 3CCQN 2V69A 4FZZA 4I69A 3PIPL 1XNQK 3A8EA 2ZKUA 3GIKA 1S6PB 2QLXA 4FKXA 4X66J 2PMHA 3TNVA 2YKMB 2DRBA 2D0BA 2BBEA 3MEKA 4BRHA 4AL5A 2ALZA 3WIVA 1FNXH 3MR5A 1RTJB 4H4KA 3OYLA 4QIEA 1NDPA 1XI1A 2BANA 3FNNA 3TUIC 1YHQN 2MDAA 4GW6A 3G96A 4MH8A 3KYLA 5EX3A 5EUHA 3TAPA 4HI2A 1CJVA 2KXFA 3C16A 4Z7CA 2XCPA 3RUBL 3BO2A 2UXCK 3W3SA 3MEEB 5KFFA 4BACA 2QWOA 4JV5K 1HBOA 2IAJA 5IQ6A 2H65B 3CHWA 5L39A 1WEYA 4RKUC 1H1VA 3WQUA 3O4WA 4KAIA 3DU5A 2P9IA 2ZUAA 3LWMA 2A6AA 2BM0A 1PJ7A 1TUGB 4DU3A 3MEDB 2ZM6F 2GVDA 2OTJN 3QSYB 1JJ4A 5LL6d 3MM7B 2BX6A 3GJQB 3V2UC 5GADP 2JFDA 2HF4A 1R89A 1ITGA 1LWEB 4I56A 2MKIA 4CEZA 3RYLA 2RHQB 5CHCB 1XMOK 2HWIA 2QWNA 4CHPA 4CK3A 3RB3A 2MKKA 1ZC6A 5C7PA 2D0AA 4ANEA 3OW2R 2UXDJ 1REVB 2J8AA 1HNXK 3LOUA 4K8ZA 3DRPA 5ETQA 4RWTA 4M3XA 4A5BA 2BKPA 1D9AA 3MFIA 3CERA 1RAEB 2IVPA 1UFLA 5TKYA 5KFQA 3HHLA 2E6MA 3WXJA 2L9NA 3GV5B 4U7UD 1CXUA 4CHOA 5HRSA 3IAS9 3VPZA 3MF5A 1RWMB 4OPKA 1ESVA 3CCMS 1MNEA 1HBNB 3I0SA 1EETA 2E5IA 3AXMA 1GOBA 2BE2A 4C4WA 3EKUA 2CQIA 4NLOA 1S1XA 4K0KK 1SC1B 4Q0BA 4M45A 2EKYA 3Q2TC 4KHYA 4P2XA 3KJVB 1X4FA 1CS4A 5IV3A 2R7WA 2MLZA 4U95A 3IGNA 2OEKA 3C16B 4ELVA 3HX9A 5DMRA 3KJVA 3CT9A 3A8YA 1YIJN 3OYFA 2OPQB 2RQ4A 1B64A 2UYTA 1VQMS 4IRDA 3KLIA 5A8WA 1Y3JA 3NH2A 5CCMA 2YX1A 4Y34A 1HNWK 4DR3F 3ZZTA 4A8KA 2W6LA 4U67L 2KRBA 4WFNL 2AV5A 4P71A 4CHZA 3ULHA 3EZOA 4M3UA 3DLEB 3VQPA 3DAWA 3FZFA 2W9BA 1JQGA 4KR0B 1V3RA 2HVEA 1KVAA 3M4XA 3JSBA 2FLNA 3E3XA 1IQZA 1TAUA 2KFNA 4JI2K 2JWKA 3N0VA 2ATLA 1SJ1A 5M1QA 4QYZK 3V9SA 4JKGB 1KRPA 5HBMB 3FDSA 2BA9A 4JD2A 4MIBA 4X62K 4LF1A 4OGCA 3CCUS 2YPYA 4PWWA 3HCXA 3GJSB 4NXMJ 2BJ1A 2KHDA 1JMTA 1FF2A 1DTQA 1GOAA 5CYMB 4WYWA 2E5JA 4WE1B 4CYUB 3L6QA 2CQHA 2X3DA 2UUTA 1T03B 3R5CA 4C3LA 4R8UB 2RS2A 2C3UA 2JVOA 2ZJPQ 3QQCD 1N5TA 2HQ3A 1NOZA 3H5XA 4JNEA 5IT4A 5HMZA 4CTAB 4JI3K 4CFAA 3D2EA 2P9IB 3H2UB 1J6ZA 2WZ1A 2D0OA 3A3PB 3MX2A 4YR0A 4B3OB 1UW4A 3TZWA 3UWTA 2HVZA 4DL0C 3UCUP 4L72B 2VJVA 3M6VA 1H73A 2DEIA 3C14B 4IZ9A 1D9DA 1UVJA 4DR6K 3OFHA 4ID5B 2C42A 4F0KA 3VAHA 1Q7LB 4EIAA 1RTIA 4Y28C 1E6YB 3L3VA 3P4UB 3KLHB 3ENWA 1IBKF 3J80Y 1S72N 2A10A 4JI7J 1PBAA 2ITGA 1UVNA 3OXFA 1HWKA 4ZVUB 4ERDA 1SB6A 2J0SD 5F8MA 1TK5A 5LXYA 3VQCA 3RJMB 4DPXA 4LFCK 3ULEB 4H5NA 1GLCG 4TXSA 4DR4J 1N88A 3CCSS 1QHTA 3N6LA 3THYA 3H59A 2GNKA 4DPOA 5EN1A 1C4CA 2RDDA 4L3QA 4LR8A 3VALA 4KGMA 3PIPQ 1TYQA 2LXFA 2G1HA 4GO7X 1M5VC 2XO7A 1EHWA 1G1XA 4DDFA 3HVRA 4BRKA 2LEBA 2E5LK 1DLOB 2B4JA 3M1VA 4AL6A 4WU2A 1Q95G 3TAEA 3IA0A 3AA2A 2UZAA 1VQSA 3Q8QB 2APOA 4L8RB 4Y2CA 2RN2A 3K0SA 4AILC 1CJKA 2HB5A 4WE1A 4CYUA 3QFUA 3M2UA 1Y3KA 2F1FA 4WXOA 4YQWA 2VWBA 4O0NA 4CP5A 4MK9A 3IC1A 1J27A 3LAMA 4QR2A 2FZKB 4M3RA 1KS2A 4CTAA 5LXRA 1RAHB 5L9XA 1S59A 5HJXA 3BB5A 3WNGA 4V19J 1VC0A 1QVGR 1IWGA 3J81j 4PHTX 5A6PA 3B82A 4QS7A 4H54A 2MY7A 4EP4A 2OKQA 3K5MA 3MMCA 4CO2A 3MR7A 4ZJQA 3QESA 1HW8A 3GCWP 3MAAB 2VF3A 2HMIB 3C6TA 3QMQA 3DRRA 4DR5J 4FWKA 4JD2B 2F8HA 5EWFA 3KLHA 4A62A 1YJ9N 2G8VA 5LSRA 2MB0B 1QDUB 1XEZA 4KTWA 3FZ2A 3VTHA 2P1JA 2DY1A 2LU2A 3VOVA 4NYNA 4TU8A 3IKMA 4OHVA 5H9EK 1RHQB 2GZOA 2HWTA 5E3AA 4Q7AA 3PX4A 1MU2A 3CETA 1YWXA 3MM9A 3NMRA 3QWUA 3OTOJ 4NZ7A 8RUCA 1T44A 3FGVA 4NCAA 3ENVA 3ZZOA 3HHLC 4RX6A 4TY8B 5F9LA 3LDPA 1IKXB 4L74A 2HGNA 4CI6A 1RDAA 3P8BB 1F5BA 3SBGA 4DV3K 4X4NA 1NEEA 3SK3A 4AF1A 4CHNA 2F7VA 1X4DA 3F2KA 4PXDA 4JI4F 4WZMA 1WDDA 3BEGB 1D0EA 3T1HF 4GKJJ 2OMOA 1NO8A 2I38A 3OFEA 2FYXA 3C14A 3FBCA 3HZ6A 4LSZB 2C2OB 2CZ9A 3Q0AA 4QPXA 4CLLA 3M32B 4A46A 1S0MA 4DR3K 2XCAA 3TJAA 1IBLF 3VENA 2UXDK 4IG3A 2ASOA 4K43A 4OYOA 3U3GA 3T9NA 3N4WA 2NXNA 4FF2A 4MMOA 1FERA 3O1BA 5BRDA 1TVRA 3RB6A 1H2TZ 2EEYA 5FRNA 1HNZK 1G6BA 2IS3A 4FJJA 3AAQA 3E1YA 2R8JA 3TWZA 3ID6A 2LEAA 3DFEA 2ZGYA 3FRYA 3SI8A 2JWLA 1JWWA 3C6UB 3BM7A 3QBCA 1TYQB 2B5JB 1DT9A 4Z4EA 3ZSRA 2GJFA 2IPOB 5B0CA 1AFIA 4IYQA 3DLKB 2WSCC 3DOMB 3C19A 1DTTB 4U7CA 3I55N 1LK5A 4B1XB 1WWHA 5DM7Q 1R6YA 4I67A 1CULA 3OYBA 3N4QA 4H4MB 3OBIA 3U8XA 2DXDA 1N6QB 3TUZC 4XH4A 4RNNA 2DNOA 3R6MA 1RA7A 2MGZA 2AJ0A 1RK8A 2HQDA 1NU4A 5JS1A 1P8ZA 4C23A 1JNZB 4RZRA 2A18A 1FNOA 4O8KA 4C8OA 4QOTA 2C2MB 1KTQA 4U6PA 3LGNA 3G82B 2I5JA 4NI2B 4FP9A 3W2VA 1OY8A 1X9JA 2QA2A 4NRTA 4FJ9A 1FJGJ 3H1VX 1ROFA 4BR0A 2RF2A 2GV9A 1P8GA 4JKFA 2OZMA 2B0GA 5AFUA 4PXBA 3RBZA 1U09A 4AH9A 1FTRA 1YKWA 4RU9A 4DR7F 5GVQA 3BKTA 1S1TA 1AFJA 3FMWA 5JUMA 1TL3B 2NZTA 3KK2A 3NS5A 3UNGC 3OYCA 1U02A 2VG6B 3ETOA 1C1CA 3CCVS 3CJTA 1RTDB 1OY9A 4JK8A 2GELA 2U2FA 4CT8A 1GMWA 1LK7A 1JLEB 5KFDA 4M3WA 1A6LA 2QLJB 3LL3A 3D68A 4YY3K 3HSTB 1WC0A 1QUPA 1CJTA 4KPYA 1KP6A 1JLCB 3J81Y 3AB4B 3NF9A 2B7BB 2G2YA 3IXQA 4CF2A 3L3UA 2YNHA 1XK8A 3KLEA 3QDKA 2HVHA 3HK2A 3ZSOA 1Q7YT 4YMEA 2WRMA 1Y4ZB 1IO2A 3V81A 3RAMA 3MEGB 2KN4A 4CJFA 1TK0A 2O3DA 1BMQB 1AUDA 2YXLA 5D4PA 3UCGA 4FJIA 3JAMU 1VQ6N 3D54A 1E6VA 1YLXA 3GR1A 3VQAA 4CRJA 1AB8A 1RAGB 2D7SA 2Z0GA 4M63C 1C4AA 3GZ7A 2E66A 3HSJA 3SCKE 3KJNB 4N41A 3CGIA 3G87A 5AQRA 3KD1E 3AA8A 4F4AA 5AE2A 1F60B 4BRAA 3O9UA 2EK6A 4DR2F 5LSOA 2JWNA 3QFWA 3UE5A 2IAJB 2OAUA 2KT3A 3R2CJ 1Q81O 4BR9A 1F3VA 3VQTA 2R4FA 4RW4B 1PILA 1X3MA 1I94J 1W2IA 4C8YA 2XHBA 2E5GA 1ASWA 4N8NA 1WSJA 4ZA1A 2QWQA 3GDQA 1UEKA 3HLUA 4J2DA 2DPNA 4PR6A 4H4KC 3AAPA 1I94F 2V52B 5CCLA 2LFVA 3AO5A 3OXLA 4LQ3A 7FDRA 2H3GX 5B0BA 4EYIB 2QIFA 3HBTA 4WQ4C 2YNIA 1NUEA 2YHXA 5IT9O 1B70B 2ILYA 2ZBCA 3DI6A 4YDUA 1PYTA 1I5OB 4USWA 3WC2A 3A5NC 2OPRA 1NBWA 2YKNB 4P2FA 3P83D 4IKFA 2ZBPA 3GB0A 3L2WA 4NZ0A 3UNYA 3WEEB 1Z1ZA 3VAGA 3CEDA 1B3TA 2QWMA 2Z57B 3KIOA 4HTJA 3ZSVA 5KFUA 4NA1A 4G65A 1SJQA 2P9LB 3TP2A 1P9QC 4FWOA 4BR4A 1OJ4A 3OSPA 3R3LA 1QHAA 1U1PA 4GNIA 5AE1A 5DM6L 2MHNA 3UD3P 2HBMA 1NGFA 1T95A 3MM8B 5AQQA 2PZSA 1U6FA 5F9NA 3AO3A 1D3WA 1R8PA 5KFAA 2D74B 3WQTA 3VQ6A 5KGWA 3V6DB 3GFZA 1QD1A 2VPWB 2FLOA 1FFSB 3CMES 1YUWA 1RT5A 2CQPA 2HNYA 2ZHOA 3KUEA 1FX4A 4A8WA 2QE5A 1YTYA 3I5CA 2UXCJ 3FRZA 2VASA 2X74A 3D3BJ 3MD1A 4DQPA 3J7Z5 4J9NA 1VQKS 4M3YA 3JYTB 2R2SA 4NXMK 2X1FA 2HBJA 3L4BC 4ETXA 1GOCA 2OZSA 2GAHC 2CZ4A 1CZBA 2VBZA 5K8NA 1SUQB 2MZJA 1YK9A 3OR2A 2DK2A 2DNLA