1C0TA

Crystal structure of hiv-1 reverse transcriptase in complex with bm+21.1326
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
536
structure length
490
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTGKISNPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 133
structure length 490
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c0tA05
1ZTTA 3U3GA 3V6DA 1SL2A 3KJVA 4ICLB 4F4YA 3LP0B 1WSFA 4J9KA 4M3TA 3IS9A 1GOCA 2YNFA 2D3UA 4FJNA 3PW0A 3RR7A 5DGBA 2Q3SA 1BQMB 2R8JA 3KHHA 4J9RA 4DS5A 3V6DB 3KJVB 1C1AA 1XHZA 4C8KA 4ZP8A 1VSHA 2HHUA 3D0PA 3IS9B 3CJ3A 2YNFB 2QKBA 3NF8A 3N6LA 2NUBA 2VA2A 4H4MA 4KAZA 1IKVB 3PR5B 5HLFA 5F8NA 3HO1A 1CSJA 1KHVA 4IKFA 5EUHA 2J6SA 2C2DA 4EZ9A 5CY4A 4NYZA 3ZSXA 5KFTA 4DTPA 5K14B 2PYLA 5DK5A 4OGCA 3T3FA 3H5SA 5C42A 3F73A 4NLDA 4DS4A 3QLHB 5HLFB 3VQQA 2XGQA 3T5HA 4IFVB 1SUQA 4M3UA 4CGGA 2I5JA 1RT4A 3TARA 4AHUA 3LWMA 4FLYA 4CK3A 4KHWA 4DTXA 2YNGA 2PYJA 1Z25A 4DTSA 3KLGA 1IO2A 3OYDA 1DTQB 2X74A 3QNOA 3QO9A 1SUQB 2V4QA 3GYNA 3PUFA 4K4XA 2V4RA 2I5JB 1RT4B 4F4ZA 4ECQA 2WOMA 3OJSA 1KFDA 2BE2B 1FKOA 1LW2A 4DEZA 4J9LA 1U09A 1WSJA 3DRRA 1SKSA 1TKZA 4CIEA 4M3XA 2IOCA 3NGYA 1RTJB 3QO9B 2ITGA 2Z1HA 1BGXT 4ELTA 4G3IA 1YTAA 3HKWA 5KFRA 2KZMA 3ZSQA 4TQSA 2OH2A 3H4BA 1S49A 3NAEA 1FKOB 4YR3A 1GX5A 4EYIB 3KOAA 2YKMA 1MU2B 1RDAA 4NLTA 3HPGA 4L8RB 4C8MA 3S3NA 4B9SA 3OSNA 1NHVA 1ZBLA 4DSJA 2FLLA 1TKZB 1QS4A 4J9PA 5DG7A 1N4LA 1BIZA 1J9AA 2HHSA 3SFUA 1BL3A 4EBCA 2R8GA 5SWMA 4URQU 3IG1B 3Q8PB 2IAJB 2JLEA 3I5BA 1HNIA 3NDKA 2VG6A 3QGHA 4KI4A 1WAJA 5DLFA 4FXDA 4EO6A 2VG7B 1RT6A 3OL7A 5L9XA 4CF2A 5KG5A 2BDPA 1LWEB 4FZYA 1JIHA 2W9CA 5FDLB 2R2SA 3LAMA 3MXIA 4ELVA 1VRUA 5J2QA 2RN2A 2VG6B 1RTIB 3AVNA 4AHRA 1S97A 3P5JA 4CK1A 4DLGA 4ZVGA 4CK2A 4J9SA 2UVUA 1VSIA 5KT3A 5F8GA 2XI2A 4FK2A 3ZSRA 4FJ5A 2W9CB 4F50A 2E9TA 4AH9A 5KFGA 5L1JA 2I1RA 4RUAA 5J2QB 1QTMA 2EC0A 3KNAA 4FJ9A 4J2DA 4IH7A 4E89A 3EYZA 3SQ0A 1W0HA 4CFCA 3AO2A 5KFZA 1RDBA 3BGRB 3E01A 1RYSA 5F8HA 4CGDA 3IAYA 3AA4A 2E6MA 3TAFA 5L1LA 4CHNA 4GW6A 3JSMA 3SV4A 4MFBA 3SPZA 2WRMA 1RBSA 2HHWA 4FM2A 4KBIA 1FK9A 2UVVA 1HYSB 4EBEA 4CJWA 3SYZA 3E01B 3MXMA 3HP9A 4WFYA 4YFUA 5KT5A 3V9WA 3E51A 2QV6A 3T1AA 3JSMB 4JV1A 5KFIA 5EWFA 4MFBB 4F2RA 3LP1B 2UUTA 3AVAA 2KZZA 4FLXA 1FK9B 1XR5A 3ZT1A 1C0TB 1RT5A 4WXWA 5F8LA 4RW8A 5DG8A 3AV9A 3C94A 4K8ZA 3VQAA 2ZE2A 4G1QA 1JLCA 3DI6B 1TL1A 3N6MA 2XC9A 5J1EB 4JRQA 1RT3A 3SZ2A 4NLYA 2D41A 4DTNA 3MEGB 2IA6A 4W5OA 3LWLA 1NK6A 4M3WA 4K4SA 1QSYA 3CM6A 3QGIA 3KLVA 3OYAA 4GC6A 3OYMA 4GMJB 2ZE2B 4G1QB 1QAJA 4M3RA 4LSLB 1JLCB 4TY9A 4C8LA 4HCBA 1TL1B 3CJ0A 1RT3B 3HHKA 3S3MA 2HHXA 2XO7A 3SV3A 4B9VA 4HCCA 2IGIA 4JLHA 3HVTB 3MXJA 4KTWA 4FJHA 3QEPA 2O4GA 2YNIB 2XRIA 1TKTA 4DL5A 1NOYA 1I6JA 4ZP7A 5KFAA 5KG4A 2W7OA 2W42A 3OYNA 4FM1A 2YNHB 3ITHA 3SI8A 1IG9A 4DSIA 4EYHB 5SZTA 2PY5A 2F8EX 1B9DA 3ZT2A 3PJXA 5KRTA 4RW7A 4CJQA 1VRTB 2G8FA 4TSXA 2E4LA 2ZD1A 1EP4A 4N5SA 1U4BA 1B9FA 3KD5E 2WHOA 4FW2A 3TAMA 5J2PA 1JLBA 1HQUB 1TKTB 1TP7A 5KG6A 5CYMA 2IJFA 2XY5A 4NLSA 3NF6A 4FCYA 3RRGA 4DF8A 4CEAA 4M95A 2BQ3A 1J54A 2B43A 3GQCA 3BQ2A 4KV8A 2OZMA 4E7JA 3MECA 4HKQA 3TAMB 2VG5B 5J2PB 1IKWA 1TVRA 1RTHA 4R5PA 2W9AA 3DRPB 5CYMB 2BQUA 1D9FA 3OYKA 1WSHA 2FVRA 3TAPA 3OLAA 3KLEA 3F9KA 1XC9A 2DFHA 1SKWA 1K1SA 1U47A 5KFKA 4J9QA 3QIDA 1TK8A 3MFIA 4KHMA 3CYMA 3MECB 3QGGA 2WB4A 3RB3A 3DM2B 2O4IA 2WONB 3V81A 1NK8A 3HT3A 4BACA 1TVRB 1RTHB 4KAIA 4R5PB 5EWGA 4ZP6A 4CE9A 1BISA 4W5RA 4CJ3A 3KIOA 4FBUA 3KLEB 1T3NA 5FRMA 3QIPB 4HTUA 3OL8A 2GC8A 5DQHA 1S6QA 5KFQA 2F96A 1S0NA 1SH0A 4FZZA 4EP5A 4N56A 1U45A 4FK0A 1NK5A 4O44B 4EBDA 3V9ZA 3THVA 1QE1B 4CECA 3NH2A 4XIUA 3NMAA 5C25A 3AVIA 3AVBA 3WNEA 2B5JA 4J2EA 4BE1A 3HP6A 3MR2A 1WSGA 4KB0A 4ED7A 1TL3A 1S6QB 4Y3CA 1X9MA 4RNMA 1A5WA 1ZBUA 3VQ6A 4DG1B 3CJ5A 3ULDA 3OYIA 3I0SA 4MKAA 2A1RA 2G8KA 1RDRA 3OYEA 2HW3A 3QYYA 2B5JB 3QEWA 1JX4A 1N5YA 4ID5B 4IH5A 4E7KA 1TL3B 2EX3A 3EZUA 4Y1DA 4CF9A 3PW2A 1ASUA 3ISND 1KSPA 2DFEA 3TABA 4FS1A 4CGIA 4NLWA 1RBVA 4FLTA 4LQ3A 4Z4HA 5EDWA 4ECVA 2XWYA 4EZ6A 2OYQA 4CCHA 2HNYA 4E3SA 4QW8A 2FLNA 4KPYA 1C1BA 3GV7B 3O4QA 3MF5A 4DQQA 5KFPA 5C5JA 4ED1A 4I9LA 3CG7A 3M9MB 5KI6A 4YQWA 4E1NA 2BANA 1WSIA 3BR9A 1WLJA 1KVCA 3HYFA 4DSKA 1BCOA 1NK7A 4Q0BA 1QUVA 3GIJA 1XR7A 4DTUA 3GV5B 1JKHB 5EWEA 3VQPA 1JL2A 3MEDA 4DU4A 4K8XA 4PY5A 5KG7A 4W5TA 3FQLA 4RW9B 1JLQB 4CJVA 2BANB 1VSJA 4RW4A 4OLBA 1NJZA 2R2TA 2FJVA 4DFJA 2HHTA 3U6FA 2RDIA 4TXSA 3U3YA 3KTQA 2VWKA 1WAFA 2D7SA 1D5AA 3RBDA 4B9LA 1J53A 3MEDB 4PWDA 2JEGA 5KRSA 3D45A 4ZHRA 4B8CA 3L2WA 2VA3A 4FYDA 1U04A 4RW4B 1JLEA 1RAJA 3GIKA 1RBRA 4CGJA 1C0MA 2HHQA 4FS2A 4AHVA 3QERA 5DQGA 3QNNA 4BDZA 4Y1CA 3FSIA 3HK2A 3MR6A 4PWDB 2AX0A 2D5RA 3M8RA 4ECYA 3HVRA 1C0UA 4ZHRB 1RCHA 1ZBFA 3MEEA 4DF4A 3K59A 4OPJA 3QINA 4H4MB 4F2SA 2C2RA 1N48A 4TLRA 1T8EA 4UQGA 4DTOA 1JLEB 4IG3A 3CFOA 4JV0A 3CWJA 1KVBA 5J2MA 2P5OA 1T03A 4F4XA 3V6JA 1R0AA 2GUIA 3I0RA 2B4JA 5HBMA 4RW6A 3SI6A 4IH6A 1C0UB 4NCBA 3UR0A 4NYNA 3MEEB 4DU3A 1JLAA 4JUZA 3SPYA 5C42B 1VK0A 2FVQA 2FLPA 2OPRA 4Y2CA 4JS5A 4H54A 2JGUA 2KQ2A 2X78A 1HNVA 4O0JA 4KO0A 5CZ2A 1Q9YA 5J2MB 1T03B 3PO5A 5HROA 2ZQBA 1S10A 2YNGB 4CEEA 3BQ1A 4RW6B 4NLVA 1KFSA 2D0BA 3O3FA 5F9NA 2JEFA 1LW0A 4JRPA 1DLOA 3KLGB 1RILA 4Z0UA 4CIFA 4NRTA 2IBKA 2V0NA 4FLWA 1HNVB 4DL6A 4KO0B 2Y1IA 3D5MA 3PW4A 3CM5A 4DTJA 5HROB 2WOMB 4WYWA 4O4GA 3AVJA 1UWBA 5CYQA 3NHGA 1N56A 3LZJA 1LW2B 1CZ9A 4CHZA 2FC0A 1VSMA 4HUEA 4CF1A 3DLGA 2YV0X 1QSSA 3DRRB 1DLOB 3CIZA 4I9QA 4N76A 1OS5A 3NGZA 4KRFA 2AU0A 4K4WA 1FXXA 3VA0A 1GOBA 4DSEA 4CJ4A 4Y2AA 4ED3A 2HVHA 4K4TA 3UQSA 1TK0A 3OHAA 1S1WA 2KFZA 3Q8QB 4O4GB 4ZPDA 1KRPA 3VQ4A 1YT3A 4EO8A 4BE0A 3FQKA 1L3SA 4YR0A 1RTDA 1S9EA 2YKMB 4FJLA 3GV8B 5KT2A 4F4WA 2IJNA 3ZT3A 1NJXA 4KTQA 3PW7A 4IQXA 1G15A 3VA3A 2AJQA 2W8LA 4DFKA 2Z1IA 2XI3A 4JS4A 3DLKA 2OPSA 2AX1A 2IS3A 4AHTA 1HNIB 1RTDB 1S9EB 1SKRA 4OKJA 4ED0A 4IRCA 1YVFA 4NLRA 3RB4A 3TANA 2RPIA 3AA3A 1RT6B 2HMIA 1KTQA 3AVHA 3VN5A 4M45A 2FVCA 4B3OA 3EPIA 3DLKB 4RNNA 3NL0A 2OPSB 4WZMA 1VRUB 5DQIA 4E7HA 5KT4A 4X2BA 1X1PA 3CFRA 5HRPA 1L3VA 4CGFA 1LWCA 3CDUA 4DFMA 3ASMA 2XHBA 3BQ0A 4O5BA 3VQ7A 4KB7A 4KHNA 3H40A 2EHGA 2QK9A 2ETJA 3PX6A 1TV6A 4I2QA 4CJUA 4QWCA 1NK0A 1LWCB 3SNNA 1K6YA 4QPXA 2DPJA 1TGOA 5DLGA 3RMBA 4YMEA 1BQNA 4ED2A 1U48A 1S9GA 4MIBA 1QQCA 3NGIA 1RDDA 1RT1A 3K2PA 2GV9A 1TV6B 4I2QB 4B08A 3OL9A 3G0ZA 3ZSYA 4BDYA 3ICLA 1EX4A 4DQSA 3KK3A 3PZPA 4IRDA 2ASDA 3AVMA 3AVKA 4OL8A 3DOKA 3P1GA 4F8RA 4KFBA 4M3YA 4NLUA 1S9GB 3NAIA 2AQ4A 3B6OA 2W9BA 3KKRA 3ZSZA 2OPQA 4H4OA 4DWIA 4NRUA 3KK3B 4WE1A 4E1MA 2FVPA 2D0AA 5FROA 1RT5B 3BSCA 4KFBB 1A5VA 4RW8B 4EP4A 4CJEA 3D28A 3SQ1A 2W9BB 3AVFA 2GBZA 2OPQB 3TAGA 4B8AB 4H4OB 4ZTJA 4OJRA 2WCXA 4Y34A 3CVKA 4W5QA 1X9WA 3L2VA 3RR8A 1S0MA 3TR8A 2IC3A 3PV8A 4IBNA 3CO9A 5HP1A 1I3AA 4CEQA 4NYFA 4J2AA 2HWIA 2JC1A 2FJXA 1CXUA 4AHSA 4ELUA 4FVMA 3SUNA 1ZETA 4NLQA 3LAKA 1T7PA 1RBTA 3WNGA 3HXMA 2HHVA 1TKDA 3DMJA 4LSNA 3OL6A 4KHSA 3GIIA 1S1UA 3I5AA 3OYLA 3QESA 4O4RA 1REVA 1SL1A 4OKKA 4HUFA 3V4IA 4RZRA 3OYHA 1NJYA 4M41A 5HRNA 1TKXA 4BWJA 3SQ2A 4JV2A 3PVXA 3CDWA 2G8UA 4ECWA 4DL2A 1MMLA 4FJ8A 4WZQA 1BI4A 4LSNB 1S1UB 3ZCMA 3ITHB 3VQEA 1ASVA 5JS2A 3L2UA 5FRNA 3V4IB 2XY7A 4Q44A 1RNHA 4RW7B 3KK1A 4IOBA 2ASJA 2A1SA 5EU7A 3V9UA 2ILZA 1RDCA 2ZD1B 1EP4B 3AA2A 2OPPA 1QSLA 3SFGA 3VQBA 3LPTA 1BI4B 1JLBB 4TYAA 4O3SA 4ZPBA 1YTUA 3EPGA 4B9TA 3OYFA 3KLIA 5KG0A 3NBPA 3KK1B 1L5UA 1WSEA 3BJYA 5KFNA 4KV8B 4DTMA 1HMVA 4LH5A 2OPPB 4IR1A 4B9UA 4NLOA 4N47A 3P83D 3L2QA 1IKWB 3HPHA 3KHRA 3KLFA 4RG8A 3VQDA 4RUCA 1VSDA 3L8BA 3OLBA 4CJRA 4NCGA 1SH2A 1W25A 3NBPB 1N6QA 2O5DA 2ASLA 1BCMA 3KD1E 2HWHA 2B6AA 1HMVB 3V1RA 3LZIA 4FJGA 4Z4IA 1DTTA 4R8UA 3BSOA 3V81B 1KVAA 3N6NA 3BREA 4K4YA 3IRXA 1XWLA 2JC0A 4MIAA 4AILC 4K4ZA 4ED8A 3DLBA 3MR3A 3M8PA 3LALA 2B6AB 3LDSA 3C6UA 3VQCA 3RB6A 4KHUA 4ECUA 2YHBA 1DTTB 3TQ1A 4O3OA 5KFVA 4XPCA 2G8WA 4R8UB 3OS2A 4FLVA 4FZXC 3IRXB 4FJXA 1KLMA 4CHOA 4CFAA 3SQ4A 5C25B 1RA7A 4WFZA 1TQLA 5KFBA 4YP3A 4URGA 4TY8A 4F3OA 4Q5VA 2C2EA 3H98A 3Q8RB 4IFYA 4DLEA 4TQRA 1B92A 3H59A 1C1CA 2YHAA 1FKPA 4CHPA 3V9XA 4PQUA 4HYKA 2HNDA 1KLMB 3OVNA 3AVCA 3DRSA 1IM4A 3I0SB 5DMRA 3NF7A 3DLEA 3HL8A 4TY8B 1N5YB 5KG3A 4IFYB 2CJQA 3CQ8A 4PUOA 4FLUA 2G8VA 3HVWA 4N41A 4K4VA 3AO1A 3DOLA 3K5LA 1C1CB 1EETA 1FKPB 1XR6A 4TN2A 4B9MA 1S1VA 5D3GA 4W5NA 3DRSB 5J2NA 4M3ZA 3DLEB 3GILA 4PA1A 2ATLA 4MK8A 2FBXA 2HNYB 3JYTA 1C1BB 1VSEA 1XHXA 1EETB 4CERA 1IKXA 5KFLA 3ZSOA 4ICLA 2OZSA 1HRHA 3OJUA 2E9RX 1S1VB 3V6KA 5I3UA 1Q8IA 5D3GB 2X6NA 3O3HA 2KFNA 1LWFA 5JUMA 3B6PA 3NH0A 4YR2A 4BWMA 4CIGA 2XCPA 3GIMA 1S1TA 4OVLA 1BQMA 3OS0A 3NF9A 3JYTB 2J6TA 1ZBIA 3I8DA 2R8IA 2QE5A 5F8MA 1IKXB 4Q0BB 2F8TA 2HB5A 4IDKA 5CZ1A 5I3UB 2R2UA 2QXFA 1IKYA 1RT2A 2OA8A 1HPZA 1LWFB 4Z4EA 2R2RA 3RBEA 1S1TB 4O3RA 3RRHA 1IKVA 1GX6A 1CZBA 3QEVA 4KKOA 3PY8A 3H5YA 1KLNA 4CF0A 3HSTB 3L3UA 5HRSA 3RMCA 2YKNA 3TWHA 4IDKB 4ZVHA 3KK2A 3K57A 1IKYB 1S48A 1RT2B 1YVUA 1HPZB 1RA6A 4OLAA 3TVKA 5DG9A 5K14A 3TAEA 1TK5A 2ALZA 3QLHA 4KHQA 4KKOB 5F8IA 4DSLA 4IFVA 4CJLA 4XPEA 4CJTA 3O3GA 3DLRA 5KT6A 3H5UA 4ECXA 1CLQA 2YKNB 2WTFA 1SV5A 5T7BA 3KK2B 4URSA 4ID1A 3L2RA 1NK4A 3VQ8A 3CFPA 3QEIA 4GC7A 4KSEB 3DDKA 2Z1GA 3M9OB 1DTQA 1T05A 2JEJA 4E7IA 3HJFA 4U6PA 3M8QA 4IG3B 1WN7A 3QZ7A 4LD0A 4M94A 2QKKA 3SUOA 5KFSA 1RT7A 1SV5B 3LP2A 2BE2A 1RYRA 2R8KA 1R0AB 3DLHA 4F4KA 3I0RB 1GOAA 5HBMB 4I2PA 4FJKA 3NCIA 4ED6A 1QAIA 3T5JA 4FBTA 4Q45A 1D9DA 1JLAB 4DL4A 4CJ5A 1T05B 3MFHA 1CXQA 2OPRB 3QETA 1RTJA 3AO3A 3M8QB 4MQ3A 2RF2A 3RB0A 1RT7B 1L3TA 4FLZA 3LP2B 2RKIA 1RBUA 3FDSA 4I2PB 1Q9XA 1MU2A 5KG2A 1JXLA 1LW0B 1QHTA 1TAUA 1Z4UA 4CEBA 4KHYA 4O3PA 4CJKA 2Y1JA 2FVSA 2RF2B 3CJ2A 3IG1A 5F8JA 1UWBB 5CYQB 4B9NA 2IAJA 2RKIB 2IM2A 1UOCA 3K5NA 5L1KA 2R8HA 3WNFA 2HVIA 3DLGB 3C6TA 4FK4A 2XY6A 2VG7A 1XI1A 4HHTA 3RWUA 4DSFA 3TI0A 2X6SA 1LWEA 2AGPA 1S1WB 5FDLA 3RAXA 3OYCA 3G10A 1NJWA 3BDPA 1Z26A 4NLXA 2IM3A 4ZVEA 3PJWA 2J6UA 1RTIA 3AVLA 3OYGA 3EZ5A 3C6TB 2CKWA 3FFIA 3LANA 1NKCA 4FJIA 2VWJA 3AA5X 4J2BA 1HQEA 3V9SA 1D8YA 3G6VA 4ZTFA 4K50A 4CEOA 4H8KA 2D0CA 4DQRA 2RDJA 3OYBA 1S6PA 3V1QA 3MR5A 4QWBA 3FFIB 4R0EA 4OGEA 5KGWA 3M9NB 2HMIB 1S9FA 2GIRA 3K58A 1HQEB 4CJPA 1HYVA 4DL7A 3BGRA 4B3OB 3ZSVA 2DFFA 4DQPA 2C22A 3KKSA 1JLGA 1F21A 3Q8SB 4ECSA 3OSPA 1S6PB 4NZ0A 4MK7A 4FM0A 4AHCA 4QWAA 1Y97A 4Z4GA 5HRRA 4RNHA 5I42A 1HYSA 4CESA 5KFMA 1LAVA 4C8OA 1JLGB 1J5OA 3NH1A 3SJJA 3NGDA 3ZT4A 3UDLA 2V9WA 1TAQA 4KTZA 3K5OA 1NKBA 3LP1A 2UVWA 5KFFA 5I42B 1C0TA 1C2PA 2G8HA 2WK4A 1ZYQA 3UIQA 4WFXA 2C28A 3OY9A 1BQNB 3PX0A 3OYJA 4DU1A 3FRZA 1J5OB 2UUWA 1RT1B 1JXEA 3DI6A 5J1EA 1EKEA 3SUQA 2W7PA 4QAGA 5KG1A 4J9MA 1VSFA 4FJJA 3MEGA 3L3VA 3AVGA 3T5LA 3QZ8A 1T94A 2FJWA 2XCAA 3PX4A 1I39A 3DOKB 2IMWP 4HUGA 4CEFA 4WYLA 4ZMMA 4GVMA 5KGXA 2G8IA 3CDEA 1D0EA 4CFBA 4EEYA 4LSLA 4IRKA 4CGHA 4KI6A 3KHGA 2XY8A 2IDOA 4ECTA 4WE1B 1X9SA 3PW5A 3AO5A 1IH7A 3HPOA 1UA1A 5E41A 3HVTA 3G6YA 2P5GA 3BSAA 3NAHA 4DQIA 2JEIA 3PO4A 4DFPA 1A5XA 2YNIA 5KFOA 3H08A 3ZSWA 4ZPAA 4Z4FA 4WXOA 3KHLA 3PHEA 5JS1A 2YNHA 4XO0A 2DY4A 3IGVA 3NE6A 2IC3B 1VSLA 4DTRA 3KLHA 4E0DA 4ZVFA 5HP1B 1VRTA 1BHLA 2ILYA 5KFHA 4QW9A 1WNSA 3OS1A 2FBTA 3AO4A 1HQUA 4FJMA 3DMJB 4FJ7A 4ZP9A 2W8KA 2P51A 4I7FA 1REVB 3RAQA 3HM9A 5KFXA 3KLHB 3TAQA 3H4DA 3M8SA 3QEXA 4BE2A 3S9HA 1O1WA 4TYBA 1KCFA 3RTVA 2ATQA 3MAQA 1SH3A 4ZPCA 1TKXB 1W9HA 3QIOA 5KFCA 1ZTWA 4CEZA 2VG5A 2KTQA 2IM0A 2E9ZA 2LSNA 1K1QA 4CF8A 1NKEA 3DRPA 2BQRA 4I7FB 1LV5A 3K5MA 2F8SA 3G86A 3H2LA 4Q8FA 2BRLA 2AGQA 1NK9A 1HYZA 3C95A 4CJSA 4MH8A 4C8NA 2UVRA 3DM2A 2BGGA 2WONA 3NKYA 2HAIA 3BSNA 4BDPA 2PZSA 5L1IA 4O3NA 1NOZA 4YNQA 4Z4CA 4NLPA 4E19A 4ECRA 3KLIB 4CEDA 1C6VA 5JXSA 3QIPA 5F9LA 3NFAA 4CFDA 3H5XA 5KFDA 4LY7A 3ISNC 3SCXA 3T5KA 4LH4A 1EXQA 4M42A 4O44A 1QE1A 4MKBA 1S1XA 2Z1JA 1S5JA 3VQ5A 3SUPA 4KE5A 3KMSA 3KLFB 4MK9A 4QOZB 3V6HA 4NCGB 4QWDA 1N6QB 4E7LA 1NNDA 4K4UA 4RU9A 4CHQA 1BIUA 3PR4A 3CJ4A 4J9OA 4DG1A 4FW1A 5KFWA 3T19A 3IGNA 1SL0A 2DPIA 5DGAA 3LPUA 4ECZA 4IR9A 1S1XB 1JL1A 1HJRA 4O3QA 3IN5A 4U7CA 1KHWA 2AGOA 1NHUA 2R7YA 3OHBA 4ID5A 1UA0A 2ZKUA 3M8PB 3HVAA 3I5CA 3S3OA 4NCAA 2DTUA 1UAXA 3C6UB 3O4NA 1U49A 3LP3A 4HVJA 2AWZA 1WNEA 1JLFA 4IG0A 4NLGA 2BR0A 4Q8EA 5T14A 3RMDA 1D1UA 4KREA 3VQ9A 2BRKA 5KFUA 1VSKA 3ZT0A 1L3UA 3V1OA 2HNZA 4OPKA 5KFEA 4KB1A 3WNHA 1S4FA 3DYAA 2XGPA 2GIQA 2E6LA 1JLFB 4IG0B 4Q43A 4PQUB 3RMAA 3A2FA 5C24A 2HNDB 4QWEA 4F3TA 4O55A 3G6XA 5KFJA 3UPFA 4LQ9A 4QCLA 4RNOA 5KFYA 2P1JA 2HNZB 1S0OA 1HARA 4OKEA 1JXBA 4RNFA 4CHYA 1LAWA 2KW4A 4J9NA 3DYAB 4DMNA 2FBYA 4PUOB 5KTQA 1ZBHA 4O0IA 3DOLB 1ASWA 4CJFA 1ITGA 3VQSA 5C24B 4IKAA 2IM1A 3LP0A 4DL3A 1JKHA 3MTKA 2D3ZA 3ALYA 2FBVA 5J2NB 4RW9A 5KT7A 1JLQA 3EY1A 4KHRA 3KMQA
chains in the Genus database with same CATH superfamily
4RUBA 4QR1A 4ZCLA 1NJIT 1EWRA 4U8YA 1VIXA 1SL2A 2X51A 3VETA 1PC5A 2KRRA 1XERA 5D77A 1GMWD 3IS9A 1WG4A 2YNFA 2D3UA 4IO9L 2GQCA 2IHR1 2BXJA 4OI3A 3RR7A 2DNOA 5AE1A 2R8JA 3J81Y 1TUWA 4CH7A 4B3SJ 3UD5A 2DY9A 4DV4F 2QWQA 1W26A 2Q1LA 3UDCA 2CAJA 2HHHJ 2MKSA 1NSKL 2YJEA 3D0PA 3R1XA 3MM9B 5F0WA 2QKBA 2J7KA 2NUBA 4H4MA 5B7WA 2J0WA 4RX6A 2CNLB 3RW6A 2CQGA 2ZGYA 4B1XB 3FR0A 1U1MA 4EZ9A 3ZSXA 4BHQA 4YB1P 3A8IA 2PYLA 5DK5A 3T3FA 5C42A 3F73A 4ES1A 3QLHB 2VF3A 5HLFB 3VQQA 2ZJPL 1RAHB 2IA0A 3CCMS 2G9OA 2I5JA 4FLYA 4KHWA 2HIQA 4X4PA 4QR0A 3VZIA 3LO3A 1EWQA 4OPAA 2G0CA 3IUCA 2YKAA 4WQ4A 3QNOA 1I94F 3QO9A 1SUQB 1QHAA 1LQ9A 2CGKA 2GFFA 1B7FA 1N33F 2WOMA 2DR7A 3OJSA 1HUXA 3SBMA 5I9EB 1WBDA 3C6HA 1N34J 1DQ8A 1TKZA 1RTJB 9RUBA 3DOMB 3W63A 3LOUA 1YTAA 3HKWA 4TQSA 1FKOB 4EYIB 3JQJA 1PAUB 2JL9A 3KOAA 1NWKA 1RDAA 3EGVA 4LF1A 4L8RB 4C8MA 2PMHA 1ZBLA 4P73A 3MM6B 1YLXA 5GAGU 3ZETA 5E3AA 1BIZA 1J9AA 4FPAA 2DRAA 1BL3A 2GQQA 3TQEA 2IAJB 4JI5F 3BB5A 3M2RA 1JJ2M 4JI8J 3AD7C 2VJVA 4K8RA 1WC5A 1W2BM 1RT6A 5LOQA 1OVYA 1N54B 5KG5A 3M2VA 4OX7A 2LECA 5BPMA 4UQTA 4FZYA 4YY3F 3THWB 1JIHA 2Z30B 3MXIA 3LAMA 1S12A 2C3PA 3OT9A 3SQGB 5HQ8A 3H25A 2XMUA 1FRJA 1N52B 1YZ6A 2KH9A 4RJVA 2WVCA 5M2UA 4ZVGA 1C0FA 2VQEJ 2AA4A 2DNPA 3I33A 1IBLJ 5F8GA 1UFKA 2XI2A 1X4EA 3GL1A 3G25A 2ZBQA 4AH9A 3CO0P 5L1JA 2I1RA 3CDAA 1NGGA 1QTMA 2C1EB 1KAYA 2MB0B 3D3CJ 4ZS6A 2K3KA 2MY7A 2OGUA 3B6BA 1EIYB 4OYOA 5DETA 4WP8A 1XJWB 2VKRA 2FJEB 3IAYA 3GFYA 1Q81O 4FKXA 1X0PA 4QIEA 2FC9A 4MO4A 1AXQA 3FEXB 5K8PA 3C65A 2XZDB 4KBIA 1FK9A 4BC9A 2LQBA 4DV0J 2UVVA 3AQPA 4CJWA 3CERA 3MXMA 4XH5A 1ELOA 4U67L 3BP8A 2DNGA 4FF4A 2WFBA 3T1AA 4JV1A 5KFIA 3EL2A 3H3OB 2DIVA 4MFBB 2FF3B 4OYAA 1WB9A 4G1PA 1C0TB 1RT5A 4WU3A 4NXNJ 2KVIA 3C94A 1KNZA 2UUAK 5B0CA 4K0KK 1JLCA 1BWEA 1RT3A 3SZ2A 4DTNA 3DFEA 2MQQA 2IA6A 1T9VA 3G82B 4KRWA 7FDRA 1NK6A 1ZH5A 1QSYA 4CO2A 4ZPWR 2HVEA 2GUPA 3GBTA 1EQ0A 4GMJB 2NLXA 2OSQA 4G1QB 1FD8A 4HCBA 2F7VA 2A5XA 3FGUA 3F44A 2HHXA 2XO7A 1H0HB 2QMXA 4B3RJ 5JLFA 3VAGA 1KTVA 2RHSB 1V3SA 4FJHA 2BW7A 3CEDA 2IPOB 3R5AA 2KLAA 1Q5VA 4OI6A 4KGVB 5KFAA 4ZP7A 2YNHB 2RQKA 3ITHA 5SZTA 4PWWA 2F8EX 3ZT2A 5KRTA 1N8RO 4CJQA 4L76A 2RU3A 1EP4A 1B9FA 3OTBA 2F4VF 2WHOA 2DGOA 2NLWA 4B1UB 2Q1NA 5GAEU 5GADU 4NLSA 1XMOK 2GW8A 4CEAA 2PA8D 2VGNA 5A8WA 1J54A 1N5SA 1T3OA 1VQ4S 1Z05A 5HAOA 3TAMB 2VG5B 5J2PB 3W5XA 2NZ4A 1RTHA 5K8OA 5H1SV 2GHWA 5JMNA 1QY7A 3THXB 3OYKA 2YKOA 3UWTA 3F9KA 5HVGA 1SKWA 1N36K 1FX4A 4J9QA 3WXIA 4AM6A 4DR3K 3MFIA 4K43A 2A42A 3MECB 3QGGA 2WB4A 2L9WA 5THWA 1NK8A 1SI9A 4ZP6A 3EE9A 4QR2A 4IWVA 2W25A 4W4MA 2YHWA 2DITA 3KLEB 2LQ8A 5FRMA 3VTIA 4Y2IA 4C11B 2KG1A 4JHDA 3FLCO 2A1BA 4FWKA 2Z2LA 2HFNA 1S6QA 2WAQD 2UV8A 2PBDA 4N56A 5M1FA 3DLLL 3TJ9A 1NNEA 3BKFA 2AHOB 2XM3A 4PRFA 3ELHA 3V9ZA 4FNHA 4XIUA 3AVBA 3CJ9A 4WFBQ 3POTB 3HP6A 3ET6B 3AAQA 4RLEA 5AXNA 2CVIA 1HNZF 1Y00A 1YTYA 3WHIA 3KXDA 3ULDA 4B1YB 1H98A 4YOVA 2HF3A 2J8SA 5M1OA 3TZYA 3OYIA 2G8KA 2HW3A 2B5JB 3W2VA 4ID5B 4IH5A 2FD2A 1TL3B 4Y1DA 3ISND 5A8RB 1R8HA 1HHQA 2DHAA 1T95A 4YHHJ 1UPMB 3GG4A 3MAAB 3A5LC 4LVOP 3UCZP 5JICA 5BYRA 2NRTA 1XNRF 2EFGA 3O4QA 1ULRA 2QFIA 1P1TA 1S79A 3NNAA 2QWPA 1XC3A 3R97A 2ZVSA 3D0IE 3CG7A 2BJEA 4IJNA 1QZ6A 1RHJB 2BANA 1HQ2A 2DO0A 5B0EA 1WLJA 2UUBJ 1NK7A 4Q0BA 5B0FA 3CHWA 5A8KA 4R79A 4G1IA 3VQPA 3DJCA 1FJEB 4CT8A 3IBFB 1FKAF 1VSJA 4QU7A 2CQ2A 4RW4A 1HBUB 3IBWA 3UN3A 3U3YA 2FGCA 3NVKA 1S7HA 2MHEA 1WAFA 2D7SA 4B9LA 1HI8A 1S72N 4PWDA 3EGZA 1SS6A 3D45A 4ZHRA 4OX9K 4K0KJ 4LRBA 3M32A 1U04A 3LQVA 5FLXU 1NXIA 2GVDB 5GVQA 2DT9A 1JLEA 3GIKA 2DHXA 4AHVA 3CC7N 1HNXK 1KQKA 4UT4A 1RU1A 3MR6A 4IYQA 2AX0A 3HVRA 1C0UA 1RCHA 4DV2J 1ZBFA 3K59A 4OJGA 3AY0A 1RHUB 4LR9A 3QINA 1MWQA 1DKGD 4USHA 2OLWA 1HJOA 2KYXA 4UZBA 3LPEA 2K1RA 4CZLA 1R0AA 1HBNA 3CPWM 1T6DA 5HBMA 3MM7B 3AB4B 4IH6A 3G4SS 2FHJA 4DU3A 4OHVA 4HT5A 1B4SA 4JS5A 1K8AO 2X78A 5EN1A 1YQHA 2U2FA 1NDCA 3ISZA 1T03B 3PO5A 5HROA 2ZQBA 2WTUA 4B3SF 5DRKA 4RW6B 4YB5A 1BHNA 5F9NA 4USVA 4OZNA 3KLGB 2HHHF 2FQQB 1HNVB 4DL6A 2G2YA 3EDRB 3VGVA 4X4VA 4DKWA 2Y1IA 4B17A 3CM5A 4DTJA 4WYWA 1FJGJ 3AVJA 2CQ3A 3LZJA 1AA1B 3Q7CA 3L4QA 2ZWOA 4HUEA 2J0XA 2VOOA 2DHSA 2YV0X 1DLOB 2F9JA 3FSXA 5G0RB 4LFBJ 4K4WA 1GOBA 5MLCQ 2LDYA 4Y2AA 4ED3A 4K4TA 1O5JA 2XMTA 3OHAA 2J0QD 1KRPA 4LC9B 3KKFA 2V6AA 5BPNA 1YJNN 3MGJA 4YR0A 1N32K 2I7NA 3C15B 2MQLA 4ZJOA 5A0YB 4ED5A 1XNQK 2IJNA 4KGXB 3OFEA 3NXZA 4DCOB 3Q8UA 4DQ8A 4HTJA 3KNGA 4LBIA 4IQXA 3B8AX 3VA3A 1BQXA 1M1KT 2Z1IA 4JS4A 3DLKA 1S9EB 2W2QP 4ED0A 4IRCA 2KHDA 2G0JA 2RHKA 2RPIA 3AA3A 2PGCA 3BGOP 3JQKA 1N34F 4M45A 3IFEA 4GKKK 2F9TA 4LRFA 2RS2A 2Z56B 3IAM9 3MDQA 3NL0A 3W2WB 1VRUB 4N8OA 5KT4A 5IV4A 1NEEA 5HRPA 4CD3A 4CGFA 2XEXA 2MTLA 3CD7A 5GAEI 4ZVPB 5GADI 1FRIA 4LIWA 2R7WA 3H40A 3MCMA 4QYRA 5HMXA 3DXKA 4I2QA 1CULB 2QWOA 4CJUA 4GO5X 2W41A 2BACA 1LWCB 2RMLA 4QPXA 4JI8F 1CLFA 4YMEA 3I9ZA 4B1WB 1BG3A 1PJ7A 3NWGA 4LMZA 1S9GA 1VQKN 1T6CA 4A8WA 3R5DA 1IWGA 1VGYA 1RT1A 2VJUA 3N01A 4CIOA 2EXUA 4B08A 2OHDA 5LXRA 1RP5A 4P2MA 3AVMA 3SQOP 4MDBA 2AJ4A 3P1GA 4F8RA 4NLUA 2VQEF 3M2UA 4WFAQ 2AQ4A 3B6OA 1IBLF 1TELA 2W9BA 1YRXA 3ZSZA 4BCAA 2BYCA 4HI1A 4IOAQ 3J7YP 3NGSA 2ZH6A 5IT9O 4BROA 5LMUK 4E1MA 4I6MA 2M70A 1IM6A 1RBAA 4RW8B 3BR8A 3SQ1A 3M7VA 1U2VA 4P10A 4DV7J 4ZTJA 1JJ4A 4OJRA 1U1RA 3CVKA 5CZVA 1X9WA 4UZCA 1PSDA 2BE7D 4B3MK 1UTAA 1VC5A 4J2AA 1EARA 2VPXB 4DV0F 4O0NA 4EFAC 1ZETA 3D9BA 4NLQA 1S6OA 3LAKA 4UY8T 1SZ2A 1R6YA 3CC4N 3DMJA 3LM2A 1M5HA 1DRZA 4KHSA 1S1UA 5ETMA 1HNXJ 3QESA 2V8PA 2HBZB 5AXKA 2V8HA 4DUZJ 3WX4A 2IYGA 1NJYA 4JI2K 5BYSA 1TKXA 4BWJA 2RVJA 2WVEA 3LUYA 5BRFA 3BV8A 4F67A 3THYB 3CDWA 1QUPA 2G8UA 4NXNF 4DL2A 1X4HA 4H5VA 4LSNB 2YVSA 1UCNA 4BR0A 4HLBA 3V4IB 2Z0GA 4DUYJ 4Q44A 2E5JA 2CNNB 1RNHA 2A1SA 4UOHA 2JDJA 2ILZA 2ZD1B 4WU2A 5B0DA 3AA2A 1QSLA 1WJ9A 2DXDA 3DDIA 1JLBB 4PHTX 2QL9B 2KG0A 2E7XA 4ZPBA 4H0VB 1KAZA 2LXUA 4BRKA 4LF6K 3QSYB 3MN7A 3KK1B 2OD4A 4CZGA 4DTMA 2HBQB 4B3RF 1O0PA 3A8EA 1IKWB 4USKA 3KLFA 4RUCA 1VSDA 2VYPA 3ILOA 1SH2A 2AIRB 2XS2A 4LF9K 3E8OA 3MMAB 2O5DA 2I2YA 3K7RA 4JOUA 3V1RA 3BKUA 4LBHA 5H9FK 2GZOA 4FJGA 2J9CA 4FF3A 4R8UA 3BSOA 2PC6A 2ROPA 1KVAA 4K4YA 3KYLA 4AE5A 4Y0FA 1XWLA 4AILC 3QWUA 1HPMA 1TMJA 2E1CA 1VQKS 3WZ0A 3RW7A 2WSEC 3MD3A 5AQHA 2B6AB 3C6UA 4KHUA 4ECUA 1DTTB 3DGPA 2G8WA 3CJBA 5AQOA 1UFWA 3D2EA 4NPOA 5C25B 1PKUA 1RA7A 3OXLA 4J7CA 5KFBA 3VF6A 4YP3A 3BGLA 2PEBA 4TY8A 5BPLA 2MY8A 4JI6J 4LF8J 4IFYA 4ZJLA 4TQRA 2LP4A 2IVNA 1B92A 2CPYA 4ILHA 4HYKA 4KR0B 1X5TA 1V4SA 3MMCB 3WT0A 3J7ZT 2W2MP 1RADB 3AT1B 2L9DA 3HFZB 5DMRA 4OFZA 1PILA 4U7UD 3HL8A 2YHXA 1BWVA 3W1YC 4OV6A 5CH7B 1KKHA 1GLJO 4PUOA 4FLUA 3K17A 2HAFA 4ANCA 4N41A 3G9CA 3AO1A 3DOLA 3K5LA 1C1CB 5H9EJ 1PJ5A 3UKUB 1EAYC 1HKBA 4W5NA 3PRDA 3VVUA 1O13A 1F9EB 4X66J 3GILA 4CO0A 2I8EA 3JYTA 3AFGA 2FF6A 1O8BA 4OI4A 1XHXA 3ZSOA 3CC4S 1C4AA 3OJUA 3CCTA 2OI2A 3V6KA 4BC7A 1BOTO 1Q8IA 4AFFA 1LFPA 2X6NA 1EQYA 5ETRA 1UZHA 3B6PA 4CYUB 4BRIA 1QZ5A 4EFHA 4QPTA 4HACB 3NF9A 2DGVA 4ZVOB 4FPBA 2FY1A 5IT0A 4BQZA 4ZIVA 1KQGB 2F8TA 3CCVN 2EWHA 1LWFB 2R2RA 4YHHF 5HVHA 3HHDA 3JTOA 3I32A 3PY8A 1FRMA 2KJWA 1FO1A 3L3UA 5HRSA 2H1YA 4ZVHA 4BVOA 1GMWA 1IKYB 5ETPA 4FYWB 1S48A 1RT2B 1YVUA 3TVKA 4JYAK 5K14A 3TAEA 1QVGR 3IRWP 4CJLA 3GTYX 5KT6A 1R3NA 2QRRA 4ECXA 4B3MJ 2YKNB 3E9OA 1VQSA 5T7BA 2RH3A 4H4KC 4URSA 2UUBF 2E66A 5E7OB 1FJCA 2NR0A 3CFPA 2UUCJ 3QEIA 1K0VA 4KSEB 3M9OB 2NSBA 1DTQA 3VF0B 1MDUB 1Q86O 3CD6N 3HJFA 4OHWA 4U6PA 3M8QA 1H7XA 1NBEB 4JV5K 4L3NA 2CIMA 5KFSA 3ZTQA 1ZBSA 4F4KA 3I0RB 1AB8A 1RSCA 1X31C 2YI1A 5F3ZA 2RUGA 3NCIA 2MPUA 4WYBA 1QAIA 5T41A 4YEAA 2D9PA 2ZJRQ 2QYCA 2CGJA 1T05B 1CXQA 2OPRB 3QETA 3ZLJA 1QAYA 2BUPA 4K0KF 4QS8A 1ZOTA 5EX0A 1RT7B 2RQ4A 2PMWA 3P8BB 5AZJA 3W8PA 3FDSA 4I2PB 1Q9XA 1P9QC 2DR9A 1GLBG 2HWTA 4D3GA 1X4GA 2DK2A 3J7AP 4O3PA 4CRJA 4DV2F 1UPPA 4A8YA 3WC0A 2KDOA 3L09A 1R8CA 5F8JA 3MOZA 4DR4K 5CYQB 1V3RA 3DGVA 2HQFA 2IM2A 2CQIA 2RRBA 1WEZA 1HBMA 4FDFA 3ENOA 2VFSA 5FPDA 3DLGB 4LF4K 3CJKB 1NGHA 5I4MA 3PEJA 2GEMA 5IWAK 1MN9A 1FF2A 3M1VB 2ZNYA 2MQPA 1S1WB 5FDLA 1LOUA 1HBOB 1NJWA 3D6HB 2D0OA 1URNA 4X65K 1X3NA 3FFIA 4KIAA 1EJ7L 4FJIA 3FGVA 2P9IB 1RWPB 3AA5X 2PE8A 1VLYA 4J2BA 2Q0UA 4C98A 4HH0A 2XMAA 2WW4A 3OTEA 1GLDG 2Y0SD 4DMZA 2GJIA 4DQRA 4LREA 2QL7B 1YX2A 1FJGF 4AYBD 1AUDA 3MR5A 2XWXA 2JOQA 3H3NO 1X5PA 1KEKA 2LU1A 2DNNA 4RWXA 2UXDJ 4CJPA 4FPIA 1KR4A 4LFBF 4B3OB 2QYGA 3IR6B 1A9NB 1F21A 2NRXA 2CDRB 2BJ9A 1S6PB 2ZZMA 4NZ0A 4H0YB 4AHCA 2QTWA 4QWAA 1Y97A 1R8BA 1CJUB 5HRRA 5LJVA 4JI4J 1HYSA 2E88A 4JKFA 3ENWA 1NPPA 3JS9A 2FXUA 3TSQA 1LAVA 1JLGB 3SJJA 3CCQN 2HBKA 4C2MA 3UDLA 2XHCA 1TAQA 4U95A 1NKBA 4IFEA 1Y10A 1PYTA 1C2PA 1FDNA 3GG0A 3ZFVA 2A18A 3PX0A 2O8EB 2YXLA 3OYJA 4GKJJ 4DU1A 3AY9A 2C3UA 1J5OB 3T9ZA 2DHHA 3MN6A 5C2GA 3A3PB 2O66A 2KXHA 2ZZTA 2W7PA 3CD6S 3OR2A 4QQBA 1UVLA 3O9UA 1WTBA 1ATRA 4ZK7M 2B9YA 3UD4P 3T5LA 3QZ8A 2XCAA 3PX4A 1I39A 3DOKB 4NMLA 1RB0A 3PYGA 4CP5A 3L4BC 4C97A 4MKYA 4WYLA 1VS3A 1D0EA 3FNNA 2QGFB 1RGIA 2M8HA 1PG5B 4ECTA 3NCRA 4L72B 4WE1B 2K2PA 1WC4A 4HL9A 1CZAN 3W9IA 2K8GA 3HVTA 3G6YA 2V4JB 3NAHA 2XSJA 1OY8A 2XB2D 2JEIA 4J9UE 4DFPA 1VQ5N 3H08A 3ZSWA 1W7AA 4UW2A 1BY9A 2GVZA 4DV5J 2E2PA 3UKRB 4JYAJ 5IQQA 4ZVFA 5HP1B 5E0OA 1HKGA 2YCHA 3S7RA 2Z2ZA 3BGFA 3TW0A 1WBBA 1HLWA 1R6VA 1HQUA 1F60B 4FJ7A 2W8KA 2JLFA 4AL5A 5D78A 2VCPA 5KFXA 3KLHB 3H4DA 3QEXA 2VGMA 5LJ5Y 3ULEA 1KCFA 2HGNA 3RTVA 3P4IA 4FVUA 2UXCK 1W9HA 2YKPA 4WP3A 4CEZA 2IM0A 4JBCA 1NKEA 1EHWA 2BQRA 2KI2A 3WXJA 4A8OA 4PG6A 4DV7F 3MR7A 2ZOMA 3R2CJ 4LVNP 2DNLA 3WDOA 4Q8FA 2WW8A 2BRLA 2AGQA 5FLXY 1HYZA 3C95A 4CJSA 1TFYA 3W66A 4Z37A 3O9QA 1FTCA 5CHCB 3VZHA 3QBWA 4DDFA 1BXNA 2PZSA 4X4NA 1NOZA 2ZH1A 4DN0A 3SAHA 3CJ1A 4NLPA 5C2CA 4E19A 1K44A 4RBUA 4CEDA 4EI2A 3WC2A 1C6VA 1HNXF 2YH1A 5F9LA 2DNMA 3H5XA 4DUZF 3ISNC 3T5KA 3BO2A 1WOQA 2GQ2A 3N79A 4CTAA 4O44A 3HRGA 2P9SB 5D0RA 4MKBA 2CWXA 3SUPA 3VQ5A 3KMSA 3JSRA 4MK9A 1GLAG 2HBLA 4QOZB 2Q43A 4DPTA 4CNZA 2DNZA 4E7LA 1NH7A 3D7SB 4FSVA 3CCQS 3HSJA 1NGBA 2HS4A 4CZMA 8ATCB 4J9OA 4DUYF 5KFWA 1SL0A 1XEZA 2DPIA 1S1XB 5ETNA 1X4DA 2BUNA 1V9OA 4QOTA 4X4SA 1NHUA 2R9LA 3OTOJ 4X65J 2EW9A 1UA0A 4WK1A 4GVBB 4GNIA 1U49A 3LP3A 2RAQA 1WORA 4Q8EA 3JS6A 3RMDA 1D1UA 4B3TJ 2OIHA 1VSKA 1R31A 5E3PA 4OPKA 2OMOA 5AQNA 2OFHX 3AJ2A 2FYXA 3WXLA 3T41A 3EGNA 2A10A 4RBTA 2R7QA 3UVJB 4ETZA 3MCNA 5IM0B 5AZIA 3L3CA 3SDEA 3ZZZA 5KFJA 3NGTA 3LDNA 4QCLA 4C1NI 2CPEA 1S0OA 1K9MT 3R2DJ 1FJ7A 2HQDA 4JKCA 2F65A 2CJYB 1SC4B 5KTQA 1VQ5S 4O0IA 1KQSM 3VQSA 3C3LA 3FRYA 1X5OA 3MTKA 1UMJA 3CNQP 2D3ZA 2FBVA 3AARA 5J2NB 3KJFB 4RW9A 3QB0A 2NYHA 1YUWA 2OEKA 3KMQA 4AM7A 1Q4RA 1CG2A 3F2KA 3U3GA 2QA4N 4OYMA 1IBMK 2OEJA 1UWAA 4JI6F 3LGNA 4LF8F 3LP0B 2GMLA 4J9KA 4NZ6A 1IUJA 3FZBA 1P8ZA 2KXFA 3KK7A 2FIUA 1M5OC 5LMNJ 4NL5A 3MM9A 2VIHA 4FJNA 2GNKA 5L46A 3US5A 3M6WA 2Q3SA 1FNOA 2DCLA 2P8IA 3V6DB 1C1AA 2MZQA 3OVSA 2HHUA 1IR2A 3CJ3A 4L6V3 3NF8A 3C16B 5AQSA 1VI7A 4YOEA 4X4UA 3FBFA 5HLFA 5F8NA 1U1LA 3HO1A 4QJVA 4FYXB 4L73A 4X66F 2DHGA 3VCDA 3DU6A 2HFOA 5CY4A 5D15A 4JD2B 3MPVA 1HNWK 5KFTA 3SBTA 2C2MB 1GTEA 3P31A 1S5ZA 1I1GA 2CFXA 2Y8WA 1SUQA 4M3UA 1VQ6N 4CGGA 2OUGA 2DEJA 1RAGB 2QC3A 1T9WA 2YNGA 3OBWA 3PLAA 2PYJA 2EKNA 3OYDA 5AFUH 3R9PA 1BO5O 5M1QA 1LK7A 2VOPA 4A59A 2E5LJ 3N5BA 2V4RA 4FOEA 1T0TV 3SMPA 2QLJB 2BE2B 1FKOA 2MJUA 2ZWPA 1U09A 1RACB 1NGEA 3B4MA 4A61A 3DRRA 3I56N 2J9DA 2D1KA 4ELTA 4CM2A 3KJNB 3V2UC 1EKSA 2LU2A 1S49A 3VEOA 2JX2A 4YR3A 1RAAB 2YKMA 1MU2B 4HI2A 3A13A 3HPGA 1NHVA 4WQ5A 2GO9A 4C7QA 3TVZA 3FMWA 2UUCF 3EXYA 3D67A 1GH8A 2QFJA 1NJIO 2B9WA 3AJ1A 3CW2C 3AH6A 4EBCA 3THWA 2B9XA 4URQU 1RWKB 2JLEA 3P5TL 5IT9U 3UNGC 1Q53A 4FL9A 2VQFK 2GJ2A 2VG7B 4KPCA 2UP1A 2NSCA 1G3OA 5L9XA 3QQCD 4U96A 3M3ZA 1LWEB 2N4CA 2BZ2A 1J5EK 5BN9A 2RIJA 3OVBA 4ELVA 1GXLA 4LF5J 2XSFA 4DX6A 2RN2A 1KVJA 4YDUA 3AVNA 2EG1A 3J7A1 3CCWA 2ZH5A 1ZC6A 4CK1A 3NGUA 3BDEA 4BRLA 4CK2A 2IDEA 2UVUA 5KT3A 2B8PA 4FJ5A 2W9CB 4BRHA 3AA9A 1GLEG 2E9TA 1HWIA 4RUAA 5J2QB 4YDXA 1RZMA 4XEIA 2EC0A 1Q1KA 5GINA 4FJ9A 4JKGA 3C66A 2VFTA 1J2VA 4JI0K 3CCZA 2RQMA 1WOPA 1W0HA 4CFCA 3AXKA 2O8FA 3NY0A 1RYSA 1NO8A 2EFQA 2ACYA 3GCXP 3RRKA 3BN4A 5L1LA 3TAFA 4GW6A 2BW2A 4PG7A 3SV4A 5C2DA 4MFBA 1BLUA 3Q2TC 1MWKA 3GOIA 3CJ8A 3E01B 2CPXA 3E1YA 1FRXA 3ETMA 5FD1A 4HTIA 1TYQB 2RT3A 3GJQB 2QG9B 1D09B 3T1YK 2ZGZA 3JSMB 3J7YI 4GO7X 6FDRA 2M8DB 2A2DA 2QT7A 2UUTA 3F0NA 1VQ6S 4FLXA 5M2PA 2M2BA 5TKWA 3ZT1A 3CMAN 3FZFA 1KWMA 3AV9A 1XMQK 2UXDF 2RUSA 2IVMA 1U8WA 4G1QA 5EY4A 2CJXB 3N6MA 4JRQA 1ZPVA 2IVYA 4NLYA 3GU0A 2D41A 5K20B 3D1OA 3DC2A 4E98A 3MEGB 4B02A 1ZAWA 3KLVA 3OYAA 4JI4F 3W62A 3OYMA 2VHGA 3VAFA 2ZE2B 3M8ZA 4LSLB 4TY9A 4YUDA 4CW7B 3I56S 3CJ0A 3AJDA 2QLBB 2QI2A 3S3MA 3ZZ0A 4HCCA 2YTCA 3PCOB 4P75A 2NRVA 4JLHA 1BMQB 5J1NA 5BRHA 2ABYA 3HZ6A 3D2FA 4JI1K 2BJ1A 2YNIB 1U6BA 4GKJF 1NOYA 1I6JA 2IVFB 2W42A 1FI4A 3OYNA 3R7SB 3S8SA 3RJMB 4EYHB 1KC8T 1FFWB 2OMLA 1OYEA 1Y3KA 2OFGX 2W2PP 4RW7A 5B09A 3A5NC 3O1BA 1S7IA 4FW2A 3IMQJ 3TAMA 3Q8VA 5J2PA 3THPA 5K8MA 3MPYA 2HQCA 1TKTB 1NB7A 2AZ1A 1TP7A 3BY5A 5KG6A 2IJFA 2XY5A 3CCLN 3KDNA 3SCIE 4DL0C 3M05A 1R8AA 3IKMA 1YJ9N 2C2OB 2MZJA 4KV8A 2OZMA 5EHHA 3MECA 3UW1A 4NWBA 3PNIA 4FPRA 3FE1A 1BE4A 4Z7CA 3DRPB 4J9VA 1VQMN 5CYMB 3VPZA 1WSHA 1KD1O 2VDHA 2ZZNA 3TAPA 3OLAA 1TUVA 3KLEA 4ENOA 4F3QA 1XC9A 1K1SA 3HSCA 3QIDA 4DV5F 4P2FA 4JYAF 4X64J 3OUYB 4CBUA 3HT3A 4DV3K 4KAIA 4R5PB 2CQ4A 3WEEB 5AQWA 3G6EN 4W5RA 1W97L 4FBUA 2N3OA 3DHXA 1T3NA 1FRLA 4JNEA 3POTA 4CT9A 3QIPB 3OL8A 5DO2A 2GC8A 2UU9K 1QD1A 1SH0A 4UOCA 5D6GA 2DYAA 2EFPA 2I38A 1QE1B 2M0GB 4UUWA 4W98A 2QMWA 3NMAA 3G87A 1UFLA 2RS8A 2B5JA 4J2EA 2R7VA 4NA1A 1WSGA 4PG4A 1ZA1B 1O6XA 4KB0A 3CI5A 3LM9A 1TL3A 1UZDA 4RNMA 3QDKA 5A8RA 4DG1B 2E2QA 1RCOB 1RU2A 3BF1A 2VDIA 2GELA 3MAAA 2RRNA 2MQNA 3JSYA 1RBOB 4F7VA 1RDRA 4DCPB 2AYBA 1TFWA 3PRBA 5C10A 3W9HA 2EX3A 3EZUA 5JVGQ 2G13A 5D0EA 5E3CA 4LFCK 1WG5A 1KSPA 4EWTA 3LH2S 1SQKA 2E1YA 4LF7K 3U02A 4CLUA 4FS1A 4CGIA 2OJ3A 2NQPA 2N82B 4LQ3A 1HLUA 2XWYA 2NRRA 4CCHA 4JKHA 2HNYA 4E3SA 3IA0A 1C1BA 3MF5A 4ED1A 3J80O 2IRYA 1E6YB 1F5CA 4OI1A 5ADXH 1NG9A 3EWGA 2QSWA 3WIVA 5BN8A 4E1NA 2NXUA 1WSIA 1GLFO 4TNOA 3TSPA 1KVCA 3HYFA 4DSKA 1N5TA 1G6BA 1UJ4A 1NSPA 3OTOF 1BCOA 3UD3P 3GIJA 4DTUA 4M5IA 3GV5B 2ZJQL 2CPFA 4B1ZA 1JL2A 4K8XA 4PY5A 3R5BA 4W5TA 2XLJA 1JLQB 3OXGA 4CJVA 3T1YJ 4PKGA 1Q0NA 3AOCA 1NJZA 3HOTA 1YKWA 3PDNA 4B3TF 1WELA 2RDIA 3OPKA 4TXSA 3KUEA 3GFHA 2GA7A 2VWKA 2IFXA 1D5AA 3RBDA 3OFGA 3CCLS 3VGKA 3MEDB 1NH8A 2GTDA 1YJVA 2L41A 5KRSA 5C7PA 4N7TA 1FXRA 2FUG9 4FYDA 1JXVA 1ZXOA 4I6YA 1JJCB 4CGJA 4OJ1A 2OSRA 3QERA 3QNNA 1VQMS 1QQOA 3CJ7A 1KAXA 4Y1CA 1DZ5A 1HR0J 2D5RA 3M8RA 3HFVA 2VV5A 2ZJPQ 4DF4A 3IMXA 5LSLA 1HIYA 4H4MB 1VHIA 2C2RA 4FN5A 1SJFA 4F2SA 3DWLA 1UW9A 2LQ9A 2PT0A 2LA6A 3HJVA 2H51B 3TUIC 4JV0A 1KVBA 2P5OA 1T03A 4V19J 4K7QA 3NOGA 4U9RA 2B4JA 2B9EA 3G6ES 1OO0B 3T69A 2R7OA 4RW6A 3GONA 5ETTA 4BR5A 4NYNA 1JLAA 4JUZA 5M1PA 5C42B 3TWZA 2FVQA 4R0JA 2HVDA 2JGUA 1E6VB 3U1LA 2YX6A 1HNVA 5LMNF 4J91A 1NAQA 4A46A 1RISA 3R3TA 2JLGA 2PD1A 3IM9A 4WF9L 4NLVA 4ZLNA 4JRPA 1DLOA 3DXSX 1RILA 4CIFA 5G0RA 2IBKA 3LDPA 1E4GT 1ZM9A 3P6YC 4X62J 4KO0B 5BRDA 2P9EA 3D5MA 3NG8A 5CHIA 2WOMB 3FUYA 1H2UX 3TEGA 4BBYA 1M90T 2DGQA 2FC0A 4I56A 1VSMA 3C15A 2LLZA 2BOAA 4A5AA 3SBGA 2C2ZB 1EO1A 4N76A 5A0YA 3NGZA 4KRFA 2AU0A 3BPDA 1VK8A 2QLXA 4CJ4A 2P6SA 3TUJC 2GWJA 3UDEA 1NRKA 3Q8QB 4ZPDA 2V2QA 1SQGA 3MUVP 5EX3A 3FQKA 1L3SA 1S9EA 4FJLA 1VBKA 1OY9A 1UP1A 5KT2A 4NLCA 1VQ9N 1A7GE 4F4WA 1MA9B 4A8QA 3T1HJ 4KTQA 4CBWA 2DD8S 2AJQA 1BDGA 1G15A 1GXUA 2GJFA 4CO5A 1X7VA 1SBRA 2AX1A 3W2WA 2E5LF 2IS3A 1RTDB 4AHTA 3DRYA 1OY6A 1RI7A 1TL5A 3GJSB 2E8AA 3AB2B 1BUXA 1Z6RA 1RT6B 1WHWA 2HMIA 5CZXA 3UI3A 1UVNA 1T11A 3F41A 4FWNA 4PXCA 4ISEA 1N8RT 1RKIA 2FVCA 3CCRS 3R6MA 3EPIA 4RNNA 2OPSB 1HD0A 1RKJA 4X2BA 1X1PA 3CFRA 1HWKA 2IIHA 2HPUA 2FSJA 1LWCA 3CDUA 4LFAJ 3M6VA 3BQ0A 3VQ7A 3A5MC 3ADAC 1MNEA 5LJWA 2DXEA 3H20A 3VMFB 4DR6J 5LL6Z 2KHOA 3Q86A 3C14A 3P4UB 3QRQA 4BG8A 1M5SA 1YK9A 2HLTA 2PA3A 2WBNA 4M5KA 3TA0A 3SNNA 1TGOA 2CZVC 2YQ1A 5CCMA 4U67Q 1GQEA 3TUPA 4KGZB 1BQNA 2YJFA 3ZTOA 1U48A 1RDDA 3K2PA 3WQPA 4DR1K 2JVRA 2M88A 1MROB 2MJNA 2ZBPA 4JKEA 3G0ZA 4LF5F 2H54B 3ICLA 4DQSA 3T6JA 3AD9C 2BOPA 3PZPA 2KM8C 3NP5A 3NAIA 2DGWA 2H65B 4I6WA 3MI7X 1RABB 3TZZA 3UE5A 4DWIA 1FEHA 3KK3B 1U8SA 5FROA 3SCKE 1RT5B 3BSCA 4NE9C 1A5VA 2NXCA 4H5WA 2GBZA 3DDNA 3NNCA 3TAGA 5BYQA 1RWVB 3GMGA 4B8AB 1TUUA 3MURP 2QM1A 2WCXA 4C0BA 4Y34A 2JJ4D 1K8KA 4JI3K 3C2PA 1FTRA 3TR8A 3PV8A 4JK8A 4IBNA 5D4NA 2L48A 4WP9A 1I3AA 2ZH7A 1IJJA 2JC1A 2RE1A 3OA9A 1I5OB 4AHSA 3SUNA 3ZNJ1 1FWPA 1NCLA 2DNRA 1T7PA 3THYA 3D6RA 1VQYA 4LJMA 3RBZA 3C19A 1SB6A 4LSNA 3OL6A 3GIIA 4ZKAA 1REVA 2J9DE 4LBPA 1SL1A 4HUFA 4EU0A 3V4IA 1WOSA 4RZRA 1G7CB 4M41A 3DNCA 3SQ2A 4JV2A 2HFZA 2HK2A 3E2EA 3PVXA 2YPZA 1NUEA 4ECWA 2J4RA 4CLZA 3MDFA 4WZQA 3QBXA 1F6TA 4YOYA 3ZCMA 2VPYB 3OFFA 2R42A 2PIIA 3ITHB 1YIJS 1PAEX 3ULHA 3KK1A 4IOBA 1HX1A 2QJ3A 5EU7A 1EP4B 1M0SA 3U1NA 1NPKA 2AKWB 2U1AA 3ILJA 2ZH2A 3SFGA 1YITN 3MM5B 3LPTA 2ZFHA 1BI4B 4TYAA 1YSJA 3N4WA 2ZWHA 5KG0A 3MMAA 3H7HB 2CQHA 3AAPA 3Q22A 1J27A 2L9NA 3UN5A 3CJRA 1R43A 4A2BA 4PG8A 2V2ZA 1H2TZ 3OLBA 4CJRA 4NCGA 1W25A 3HHNB 2DR6A 3HHLB 4EMDA 2ZUGA 3DLLQ 3KD1E 3H90A 4FWRA 2B6AA 3I87A 4Z4IA 1DTTA 2MLYA 4ERDA 2ZC3A 3RBXA 3N6NA 2EPIA 1PYSB 2CWKA 2PEHA 3BREA 1IBKJ 4BC3A 4EAHD 1YJRA 1VDHA 2MMYA 1JCGA 2D69A 4CM0A 4DR7K 2VICA 3LALA 3LDSA 4E2FB 3IM8A 2EBGA 3O08A 3VQCA 1N5VA 2W40A 4Y65A 3OS2A 2F4FA 4O8UA 3AXMA 3MMCA 3HZGA 3IRXB 4CHOA 4CFAA 3SQ4A 4OYBA 5A76A 4PQAA 1FNXH 1U6ZA 2AJ1A 2C2EA 1VHXA 2VZ9A 3Q8RB 2BKPA 2RDDA 4CD1A 3H59A 5BR8K 1C1CA 5CABA 3GR0A 2BA9A 5GIOA 3DCAA 1YJ7A 3PKYA 3K89A 4NYOA 1KLMB 1LNQA 1LKZA 5J1PA 4X64F 2AT1B 3AVCA 4HDGA 3IFRA 3NF7A 3UN2A 3S41A 3W2VB 2ALYB 2G8VA 3HVWA 4K4VA 3GYGA 1FKPB 1OPZA 4USJC 1XR6A 4B9MA 2Y8YA 3JB9k 5IT9Y 4F36A 3DRSB 2G2OA 2XQCA 1AYEA 4CYUA 2JHEA 3G2XA 5JJBA 2ATLA 2HG4A 4HACA 2FBXA 3CCJS 4A47A 1RDUA 1VSEA 1H2VZ 4ISGA 3ZZPA 2YX1A 1GTHA 4ICLA 1Y11A 4DR5K 1EKRA 4DV6J 5D3GB 3R7BB 2VASA 1LWFA 5JUMA 3NH0A 4DPXA 3TP2A 7AT1B 4JKAA 2AV5A 2HQGA 5AJ3J 3FC9A 1BQMA 5IXUA 3GFXA 4CLTA 3R9LA 2JFKA 5F8MA 3D2WA 1IKXB 1TMMA 2FHOB 4Q0BB 2QWLA 5CZ1A 4ETXA 3Q83A 2R2UA 1IKYA 3PEHA 2QXFA 5HK4A 1RT2A 3RZAA 4Y2KA 2OA8A 5AQRA 3RSEA 2XNRA 3N5FA 5LL6d 4O3RA 2V68A 4IOCL 1IKVA 5H1SQ 1CZBA 1SJ1A 3QEVA 2MXYA 3H5YA 4CI6A 1YITS 4H5TA 3HSTB 3RMCA 2YKNA 1C0GA 4IDKB 2DH9A 4KQZA 3K57A 4GRSA 3VVTA 1HPZB 5DG9A 4C3LA 3HZEA 1TK5A 3M32B 2O8DA 4KHQA 4KKOB 5F8IA 4IFVA 4XPEA 2BBEA 3DLRA 2HBMA 1Y5IB 1CLQA 1FCAA 3OW2R 2P9KA 3KK2B 2GIFA 3FMBA 1NK4A 1VOMA 3VQ8A 2K06A 2HGLA 2UXBK 1T05A 4AQYK 2HOEA 4BQLA 3T1YF 4M94A 2QKKA 3SUOA 3HCXA 4CJ7A 4CH0S 1RT7A 3D6MB 2F1FA 2K1RB 1R0AB 1HBNB 3J7ZO 5HBMB 3K5PA 5CYJA 4I2PA 3QMQA 4ED6A 2KT3A 2P9UB 5B8HA 4LT6A 1D9DA 4DL4A 1OQ3A 3IO1A 4CJ5A 3MFHA 3ID6A 3AO3A 1FVSA 4OMFG 5U47A 4CZIA 4QIGA 4F04B 5KG2A 4L75A 3NCQA 4RU2A 3HSDA 3IWXA 1HR0F 1TAUA 1Z4UA 2CJAA 3CJKA 4CEBA 4L3QA 1BA1A 2Y1JA 1WI8A 2CRLA 3M1VA 5DJBA 1U24A 2B4OA 3IG1A 2CPIA 2KHCA 4KHPJ 1HBOA 1HI0P 2RKIB 4DPOA 3K5NA 4XK8C 4UOFA 2RQCA 2CPDA 2GAGC 4USWA 3PIPQ 4JI7J 3I9V9 1Q79A 1RFQA 2XY6A 3WUHA 3PG9A 4HHTA 5HQMA 3RWUA 1MG7A 2MZTA 4DSFA 2UV8G 1H7WA 5EOYA 2QLFB 4DV1K 3BDPA 2BE9B 1Z26A 2KYZA 1UL3A 4ZVEA 3HSZA 3AVLA 1RTIA 2YKQA 3OYGA 3C6TB 4IZ9A 3D0HE 3D68A 4F0MA 1K73T 2QL5B 5F2RA 1D8YA 4OZ1A 1MMNA 1U26A 4CEOA 1FDDA 4X62F 2BJ3A 3JTNA 4BRDA 1VQ4N 2ZNZA 1S6PA 4DV4K 4R0EA 4MYUA 3Q0AA 5KOXA 4QYZJ 3KG1A 5CD4H 5AQIA 3K58A 1HYVA 2YWFA 3BGRA 4P7VA 3ZSVA 5L39A 2VD3A 1JLGA 3PYDA 3OSPA 3DRXA 2EK1A 1S99A 3GE1A 4FM0A 5BR8J 4Y28C 4DHYA 1U6FA 4QS9A 4PXDA 4ZLPA 4WKRA 2NNWA 2I6WA 4LRAA 1S59A 2O8EA 2LXFA 5KPZA 4C8OA 3T1HF 4KY3A 1J5OA 4N8NA 3DXKB 3NH1A 3NGDA 3ZT4A 5LSRA 1FXLA 4KTZA 3LP1A 1CJVA 3C46A 2HHPA 4YS2A 3VQTA 2EC2A 4OHXA 5IQ6A 2KJVA 1ZYQA 3UIQA 3OY9A 1LXJA 2C3OA 2DIUA 3FRZA 1NLKL 1RT1B 2IMOA 5ETLA 3DI6A 2YH0A 2XHWA 1N33K 2VODA 2CPZA 5J1EA 1EKEA 2HEKA 4IUFA 4FJJA 3L3VA 4DR5J 2EI5A 5F3TA 2FTRA 1T94A 1PC4A 2IMWP 2V7ZA 4EK2A 4CEFA 4LFAF 5CE3A 4ZMMA 5KGXA 1WOOA 2R7RA 4NMXA 3M2UB 2XTJP 3O8MA 2G8IA 4Y00A 1EB0A 3CQXA 4IRKA 5KAKA 2C2KB 2OP5A 3PSFA 2RE2A 3KHGA 4DR6F 2A6AA 3A12A 3FK4A 4DB3A 4CLWA 1A6LA 4I6MB 3UKRA 4HEA9 2P5GA 3BSAA 1B70B 2MGZB 5GMKa 3U4LA 2DNKA 2GS8A 4ZPAA 3GWCA 2E1ZA 3KHLA 3PHEA 5JS1A 2YQ0A 3IGVA 4A48A 4JI5K 4OLOA 1VLOA 3KWIA 4DTRA 3KLHA 4WIQA 4E0DA 1S22A 3A8KA 1BHLA 1VRTA 2QN6B 2ILYA 2IVOA 3MPUB 1LEOA 3J8AA 1Q8BA 2Q2RA 4YY3K 1NM1A 2PFUA 4FJMA 3DMJB 2P51A 3OBYA 2HLUA 3QJPA 4OYIA 4C8YA 3H6EA 4HWIA 1QVGM 3P5BP 2ATQA 3MAQA 3HHLD 4ZPCA 1TKXB 2J5AA 1ZTWA 2Q3PA 1H38A 1K1QA 4I7FB 3C7NA 3VESA 1MN7A 2R7SA 2BH1A 3HI9A 3EDQB 3C6AA 2P9LB 2ZF5O 2F8SA 3G86A 4ALZA 1X4FA 2M3DA 3ZNUA 3R6GB 1NBWA 1U1PA 3RAMA 2XMJA 1HW8A 3J80U 3X3UA 4C8NA 4LIRA 3DM2A 2BGGA 2WONA 4K59A 2HSEB 3NKYA 5L1IA 4O3NA 1FWLA 1PJ6A 4A8SA 3QATA 5KQ8A 4Z4CA 4NA3A 4BLGA 3CETA 3SMZA 3PHTA 1HHSA 5KFDA 2CJ9A 3BO3A 1FD2A 1HFEL 3E66A 2D3O1 4FF1A 3BF3A 1R27B 1S1XA 2D3OR 4KE5A 3KLFB 2VFVA 4OZ3A 1DT9A 3G4SN 4QWDA 1A0OB 3MCOA 1DY3A 1GLLO 4TKTA 1B64A 3TX0A 4RU9A 2CPJA 4GVBA 3IGNA 4OQJA 4ECZA 2CJKA 3IN5A 2YY3A 3EZOA 3GJRB 4U7CA 2AGOA 4OI0A 4B1VA 2R7YA 3OHBA 2ZKUA 1KBRA 2VC0A 2DTUA 1DJ0A 3C6UB 1SJRA 3UVJA 1DAXA 1WNEA 4NLGA 3EVWA 3D2EB 3NEKA 4PZVA 2H5JB 4KREA 5KFUA 4CO3A 2CYYA 1L3UA 1T9XA 3V1OA 3PRVA 2E44A 1LK5A 3EVOA 2XGPA 2YHYA 1JLFB 2ZHBA 4IG0B 2HQ3A 3EMTA 1KXPA 3UPFA 2Z8QA 1KP6A 5KFYA 2BKOA 1KN6A 4BRFA 1AROP 3KDOA 1JXBA 1IBKF 4KH1B 4WIIA 4NX9A 4BC4A 2P9PA 3DYAB 4DMNA 1OPIA 4PUOB 3MMBA 1TL7B 3K0SA 3O8WA 3DOLB 4CJFA 5C24B 2Y0BB 3LP0A 2YWEA 4DL3A 1JKHA 1ZPWX 2VH7A 1HI1A 2DR8A 3ONQA 2FJDB 2F4VK 4MMOA 3VF2A 2X1FA 3L6QA 4RO0A 3SSRA 3WX8A 1ZTTA 4MLHA 3F56A 4CBXA 3V6DA 5GAGP 5AQPA 4DPYA 4F4YA 3TYTA 2MLZA 1RTZA 2V50A 4ANEA 3C16A 1OH7A 4PKDB 1T9UA 5SUHA 3PW0A 3MCPA 5DGBA 1AW0A 4FNIA 2QTDA 2QIFA 4DS5A 2V67A 4M63C 3KJVB 4R25A 2EEYA 3GPAA 1VSHA 5DZ6A 2UUAJ 1WI6A 2VA2A 2MEWA 3FZMA 4OO1J 2BM0A 3CPEA 2NS1B 4FWOA 4CZHA 1RHKB 1KHVA 4TU7A 1NDPA 4DX7A 4FP9A 5HJYA 2J6SA 3NGKA 2C2DA 3SIPB 2ASPA 4PPZA 1KDNA 1ACMB 3N9UC 3LPYA 3BPSP 5K14B 3H5SA 3LW5C 4B9QA 4NLDA 4DS4A 2CVEA 4DV6F 1OH6A 1M5PC 2XGQA 3T5HA 3UCGA 1HD1A 2AP1A 1U1OA 3GLJA 3TARA 3NMRA 2K7KA 4MTPA 4AHUA 5AJ3F 4DTXA 3AOBA 3NS7B 4Z94A 1HNZK 1UJ6A 1IO2A 3MWBA 1DTQB 4YY3J 3IWLA 3UO0A 3PUFA 2FDNA 1RT4B 2ZH4A 4F4ZA 4ECQA 3OR1A 2RHQB 1GK8A 2HKEA 1DQAA 1KFDA 1LW2A 4DEZA 4J9LA 2B7CB 1OSDA 2QLWA 4DOZA 1WSJA 1IJFB 2VC1A 1K9MO 1VQLN 2W4CA 1SKSA 1VBZA 4CIEA 3O2IA 4ZVSB 2ZBCA 4M3XA 2IOCA 2BTFA 5HJXA 4M63A 1BGXT 2W4PA 4CLLA 5KFRA 1XMOJ 1Y0HA 2HZCA 2KZMA 2OH2A 3CIMA 4C0OC 3NAEA 1GX5A 2J76E 2DGSA 1XNRK 2YPYA 4NLTA 4OYZA 3S3NA 4B9SA 3TX8A 3OSNA 4DSJA 2PO4A 4J9PA 5DG7A 4OHYA 3SFUA 2R8GA 3QRRA 1WF0A 2YWWA 3Q8PB 3H0PA 1N36J 1TZ0A 2B56A 5I3PA 1HNIA 2OEMA 5BXIA 1VAZA 4DR3J 1RWUA 3MXHP 3NDKA 2DTJA 3QGHA 1HBMB 4MO5A 4OYPA 2RRAA 1JQGA 2VONA 4M5DA 2B4UA 5DLFA 2KRBA 4FXDA 4HVZA 1IQZA 1U1KA 4YDDB 3VENA 3PIPL 1XQSC 1YJUA 4CF2A 1ZZNA 3PIOL 1NSAA 4DHVA 2GO8A 2W9CA 4MJKA 5FDLB 3X1LB 2R2SA 1ILYA 5J2QA 1EX8A 2ZH9A 2VG6B 4RPFA 1S97A 1VFJA 3H45C 1X9JA 3CJSA 3LL3A 2O8CB 4IEIA 4H5RA 4IEEA 4F50A 3SSQA 4AD6A 2QEXN 3PM9A 2MDAA 1FT8A 4KHPF 4IH7A 1NDKA 1R89A 1WUAA 2D9OA 1KS2A 2EKYA 4JI7F 5GAEP 3AO2A 2PDAA 1FA0A 1WF2A 3VAKA 5GADP 1JNZB 3E01A 1FFGB 1TYQA 3AA4A 3GDQA 4CHNA 4Z2XA 3JSMA 1WC1A 1IQTA 3AGRA 2EG2A 4AT1B 3CULA 1HYSB 5K9FA 3ILIA 4EBEA 3HP9A 5ELZA 2A0FB 4WFYA 4YFUA 1TL4A 5KT5A 1I51B 3V9WA 2QV6A 4M7XA 2HZAA 5EWFA 2M7SA 4CDIA 3CUNA 2VFRA 3FZ2A 2KZZA 4B3SK 2MKCA 3CGIA 5GIPA 1XR5A 4WXWA 5F8LA 2HHHK 4K8ZA 2MQMA 2ZE2A 4WCEL 1ZZFA 2XC9A 1UVIA 2ROGA 3OR2B 3H1VX 1NB2A 3QAUA 4W5OA 5BR8F 5HANA 2BMBA 5IC4B 3CM6A 3QGIA 4GC6A 1B3TA 4M3RA 1VQLS 1TL1B 5AQLA 2CQPA 4NASA 1QVFR 3WXMB 3HHKA 3U27A 2CG4A 1YBUA 2ASOA 3SV3A 4B9VA 1RUSA 2PI4A 1LCUA 3NOCA 5IFMA 4OX9J 2XS5A 2V63A 4P72A 3O1LA 3HVTB 1VIOA 2XSJB 4KTWA 2A41A 1TR0A 2CDQA 2O4GA 1CBKA 3VAHA 2GHVC 4K41A 2H5EA 1WC0A 1TKTA 3MN9A 4DL5A 3FCWA 2W7OA 5KG4A 4CZKA 3W9JA 1NMEB 2GVZB 2IDLA 4FM1A 4DU7A 1YI2N 1Q7LB 4DSIA 1IG9A 2PY5A 4PXBA 3PJXA 3I6PA 4PPDA 2G8FA 1L3KA 2P9CA 5M2RA 4TSXA 1NDLA 3V4MA 4A5BA 2CNOB 4N5SA 1U4BA 1PBUA 4A8KA 4LUBA 4EUVA 3KD5E 2F9DA 1ZM3A 3OTCA 1B0TA 2V5HG 1HQUB 5CYMA 2V94A 1Q7YT 3FBEA 3RRGA 4M95A 2BQ3A 2E5GA 2B43A 3CIPA 4WKYA 2ZH3A 4ITSA 3SSSA 2JZ5A 1F5BA 3OUYA 4R5PA 3ENVA 3KFWX 1D9FA 3G71N 1RDWX 4IDHA 2KM8B 2FHMA 1NPRA 1YGYA 2QEXS 3BS9A 3L4IA 1U47A 5KFKA 1OMSA 1LOTB 1TK8A 4JI8K 3CYMA 3OTDA 2O4IA 3V81A 4BACA 1TVRB 1GMUA 5EWGA 3JSBA 3OVAA 4FVCA 4CE9A 4DU8A 1BISA 3WQTA 4CJ3A 3GZ7A 4CLSA 1TU0B 3JQMA 4MIWA 1ZA2B 2MQOA 1SJQA 2QW9A 4FZZA 1F0XA 1ZS6A 2X1AA 3TTCA 4FK0A 1FWKA 1NK5A 4O44B 2VQEK 4CECA 4DUTA 3NH2A 1DEJA 1IBLK 1N32J 3A1YG 3WNEA 2PI5A 1DARA 4FXWA 4BE1A 3MR2A 1XBWA 5ETVA 4AL6A 1SJ3P 1XNQJ 3I55N 1X9MA 1ZBUA 3R5CA 2VFUA 4BR4A 4I4BA 1CC7A 1DHMA 3O44A 1YRTA 1R59O 4CZJA 3N28A 3I0SA 4MKAA 4M5HA 2IYIA 3OYEA 2RSQA 1N5YA 3PSIA 1KOHA 2GAHC 2LXIA 1U7LA 2RILA 3PW2A 1ASUA 2E2NA 2FZKB 1NGAA 3CD5A 4GKKJ 4WFNL 4NLWA 1RBVA 4Z4HA 4DV0K 4ECVA 4CWBA 1N0VC 2IIRA 4EZ6A 1IVZA 4I0WA 1RE1B 4QW8A 2FLNA 3U7JA 2V8DA 3GV7B 3W8GA 5M1KA 3ZZTA 2QWRA 5E84A 4BRGA 4H0OA 5FJ4A 5KFPA 1Q16B 1CS4A 5C5JA 3I96A 4I9LA 4F9OA 5KI6A 3H1QA 5AQQA 4FWPA 4WQ4C 2V52B 2HZVA 1H74A 3DXMB 1YI2S 3MEDA 4JK7A 4DU4A 3SAGA 4RW9B 1Y9OA 1SPBP 4OLBA 2Z2YB 1DURA 2YX7A 1CJTA 2H4WB 4DFJA 2C42A 4DPWA 4NXMK 2P6TA 1D9AA 3KTQA 4KT0C 2P2CB 5IC6B 1J53A 4J37A 1ROFA 4B3RK 4B8CA 4C1NK 1OIAA 2NUHA 5LMUJ 3CC2N 1RAJA 2JRSA 2HHQA 4FS2A 2XYHB 4YOTA 5DQGA 4BDZA 3FSIA 2OTJN 3G71S 3HK2A 3CF5L 3L7UA 5I3QA 3RUBL 1VBYA 1UAWA 1E6VA 4TLRA 4UQGA 4DTOA 4IG3A 4ILGB 3VGSA 2QZ8A 3V6JA 2NCKL 1U2FA 3SI6A 4NCBA 4I64A 2DVIA 3MEEB 1YJTA 1VK0A 4Y2CA 1I3OB 2KQ2A 2KL8A 5HO4A 3D6TB 4KO0A 4PYDA 1BD6A 1B7YB 5E2QA 5J2MB 2RU9A 3RGIA 2CPHA 1S10A 2FPHX 4JI2J 2YNGB 4CEEA 3BQ1A 3MM8B 1QLNA 1KFSA 2D0BA 3O3FA 5C0YA 3MWTA 1LW0A 5IS2A 2VL1A 5CCLA 4Z0UA 4FLWA 2UUAF 3I55S 1BWFO 2A6OA 1LFWA 2OCEA 7FD1A 4M1KA 1NGFA 1UWBA 1CC8A 2CGLA 3NHGA 1N56A 2DO4A 2ZOGA 1QSSA 3DRRB 3CIZA 4I9QA 2FSNA 1OS5A 3VA0A 1FESA 1FEEA 4P2SA 2HVHA 3UQSA 3WXKA 4A8XA 4H0PA 3GSDA 4O4GB 2N7YA 4LF6J 3AHPA 5CQGA 3VQ4A 4BE0A 3BM7A 1RTDA 2YKMB 3GV8B 2MYFA 2BVZA 2SXLA 2A6MA 3BZQA 2QWMA 4H4KA 4LF9J 2HF4A 4OHZA 8AT1B 2W8LA 4DFKA 2OPSA 1SKRA 4OKJA 3R5JB 5H9FJ 1YVFA 2LQ5A 5G4DA 4PYAA 1Q82O 5HL7Q 5DM6Q 5LM7E 2ASYA 2E7VA 2F8MA 2ZC4A 3JAMO 4ILLA 4YHHK 3EUNA 4KH5A 4WZMA 4M5MA 3J80Y 1XMOF 5DQIA 4V1Ak 4P52A 4E7HA 1D3WA 1L3VA 2YWKA 4M7YA 1MMDA 3VTHA 1HA1A 4DFMA 3DHWC 2XHBA 1XQIA 1Y7PA 3OFHA 1P90A 4KHNA 2EHGA 2XLKA 2ETJA 4BY9C 3A3NB 5E26A 4OIXA 4FWMA 4QWCA 2QA1A 1MROA 2ZBIA 2DBBA 3VEWA 1N36F 5ETQA 4JKGB 1CQNA 3BKTA 3CC2S 2UUBK 4DR3F 1OH5A 4KBOA 1VQON 5DDPC 1ATSA 3OD2A 1KD1T 5DDRC 5DLGA 3ZEUB 4C4WA 2OTJS 5EXWA 2O8FB 2Z2MA 3NGIA 1TV6B 1FW6A 3VWSA 2ERRA 2ZBRA 3OL9A 2ZOFA 6FD1A 4BDYA 3KK3A 4IRDA 2ASDA 3AVKA 2BJ7A 2C3MA 3QFHA 1RLCL 1OKJA 3I31A 5C15A 1ICEB 1M90O 3FBBA 2GMHA 4NI2B 3T6BA 2CQBA 5ETSA 2FVPA 1SQFA 2D0AA 2XLIA 4KFBB 1Q5YA 1NHKL 3JXOA 3HHLC 3SJHA 4DV2K 2O01C 1SC1B 2OPQB 1GFWB 1IJEB 3BO4A 4DR2K 4H4OB 4PAAA 4NXMJ 2NXJA 4OYXA 4W5QA 1R0CB 3L2VA 3RR8A 1S0MA 2IC3A 2DNYA 1OJ4A 3TA1A 3CO9A 4CEQA 1W2IA 4NYFA 2FJXA 5E3RA 1KQFB 4W92B 4ELUA 4FVMA 4A62A 3H2UB 1RBTA 3HXMA 1TKDA 4ZCMA 1B0PA 4QZVB 3I5AA 4O4RA 3PJ9A 4ZVQB 1U2RA 2DY1A 3P96A 5AQYA 5HRNA 3D2FB 1FXDA 3M6GA 3JXUA 4AF1A 4FOIA 5KPTA 3QT7A 3MM5A 1UW4A 1BI4A 1PBAA 3GCWP 2Y1RI 1FX2A 4FZVA 3VQEA 1ASVA 5JS2A 5LY3A 1FJGK 2XY7A 1MSWD 4RW7B 4F4AA 4M5GA 3V9UA 4MDAA 4PL7A 1ZM2A 4JV5J 3OV7A 2Y1LB 2W6LA 5D8HB 1XK8A 2X1GA 4LFBK 3VGTA 2OKQA 4ZJQA 3EPGA 4B9TA 1GEHA 2Q6BA 1Y3JA 5EVZA 3OYFA 3KLIA 2EBEA