1C0TA

Crystal structure of hiv-1 reverse transcriptase in complex with bm+21.1326
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
536
structure length
490
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTGKISNPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 133
structure length 490
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c0tA05
4MQ3A 3V6JA 2J6UA 1HJRA 4YFUA 4DL4A 4KBIA 1T05B 4O3PA 3H4DA 2WONB 2XGPA 1TKZA 1QE1A 1S6QA 4NLQA 4DL3A 1NNDA 1TKXA 1JLBB 1S9GB 2G8HA 3V1RA 1VRUB 1SV5A 2R8JA 3EZ5A 2IAJA 3TVKA 3CJ3A 4LH5A 5HRPA 4R5PB 5I3UA 3SUPA 4OKJA 4F2SA 3BQ1A 2ZE2A 1HMVB 4KHNA 3VQ6A 2BR0A 4BE1A 2HVHA 4CJPA 4F8RA 5DG8A 4NLSA 4NZ0A 4ZVEA 5KGWA 3MF5A 2IGIA 1TP7A 3S3MA 1Z26A 1VRTA 3IGNA 3AO3A 2KFNA 4JV1A 3DLBA 4IRCA 4RW6B 3KLVA 1RYSA 4EZ6A 3ITHA 3KKSA 5KRSA 2G8UA 1LWCA 4NLTA 4E19A 1S9EB 3PW0A 4ZTFA 3PY8A 2YHAA 2XY8A 5J1EB 4CFDA 1QTMA 1S0MA 3PX0A 4M3TA 4Y2CA 3TQ1A 2AGPA 3AVBA 4Z0UA 3OYKA 4XO0A 4DLEA 2D5RA 4CEDA 1JLAA 2RF2A 3KK2B 4PQUA 4C8KA 3GILA 4ED3A 4EP4A 1IKYA 4QWEA 3AA4A 1IG9A 4M3RA 3DOKB 4E7LA 3KLEA 1WAFA 2QXFA 4DFKA 1BCMA 5C25A 4DTSA 3LP2A 4Y34A 3HVAA 1VSKA 1S6PA 4FCYA 1N4LA 3KLGB 1S1XB 5J2PA 4KRFA 4K50A 1RBVA 3OL8A 1UWBA 1EXQA 1X1PA 1FK9B 5HRSA 1RA7A 3I0SA 3IRXB 4Q44A 3M8QB 4ZPCA 3RRHA 4NLOA 4KTZA 1REVB 2WB4A 4FJLA 1TV6B 2KZZA 1XHXA 2YNIB 3KLHB 1KVAA 3V1QA 5F8HA 3PJWA 4IH5A 1CZ9A 2BRKA 2C2RA 1TVRA 3RB0A 2V0NA 3T5JA 1O1WA 1CLQA 4OPKA 4CE9A 1LWEA 3U3GA 1RT2B 3ZSQA 4KSEB 1WAJA 2AGOA 1J54A 4F3TA 4OGEA 3QERA 2F8EX 4FVMA 3V6DA 4FXDA 3DM2A 3KLIB 4FJ7A 4KB7A 1S48A 4RW8A 4AHSA 2VWJA 4IRKA 1TAQA 4TQSA 2E9TA 1LW0A 3V6HA 1TK0A 4ZHRB 3JSMA 3DRRB 4O44B 4FLTA 2JLEA 3SUQA 1HQUA 4WXWA 5CYQB 1WSGA 1WSJA 4I2QB 3ZT3A 1SKRA 4KKOB 1L5UA 4OKKA 4Q43A 4NLVA 2XHBA 4DQIA 4B3OB 5CYMB 3TAEA 4LD0A 1VSJA 1S1VB 4LH4A 4PWDB 4MIBA 1JLFB 1LWFA 2D3ZA 1BI4A 3C6TB 1VSIA 1RTHB 1MU2A 3T3FA 4QW8A 3QEVA 3DDKA 2VG6B 4IFYA 4EEYA 1C0TB 3MEGA 3LP0A 4DSKA 4C8OA 1IKWB 3NGYA 1S1WB 3H98A 3AA2A 4JS4A 2ATQA 4TSXA 4NLGA 1R0AB 3OL7A 3FFIB 3GIIA 1RBUA 3VQ9A 4G1QB 2P5OA 4EYIB 4E7KA 5KFIA 2GIQA 4CESA 4WXOA 4MK9A 1L3TA 4ZPAA 2W9BA 2J6SA 4FJ9A 1BQNA 2W9CB 3CM5A 4NCGB 4DU3A 4HUEA 4J9KA 5KG5A 4Q5VA 3VN5A 4RU9A 1VSDA 3HPHA 4HKQA 4MH8A 1C0UB 2R8KA 1DLOA 1FKOB 3LALA 4DMNA 3LAKA 4CHPA 4LSLA 4E1MA 5E41A 5DGBA 3IGVA 4B9SA 2VG7A 2GBZA 4J2BA 4CIGA 3HL8A 4CEQA 4FM1A 1HRHA 3N6NA 1J5OA 1XI1A 3VQ4A 2HW3A 3SPZA 3DOLA 1T3NA 4G3IA 4J9SA 5L9XA 2IA6A 5KFUA 4YR3A 3S3OA 1T03A 4N76A 1FXXA 3TAMB 4YP3A 3SV3A 4E0DA 3MEDA 4LSNB 3NBPB 3SZ2A 4Q0BB 4W5RA 2A1SA 2IMWP 3NF7A 5L1LA 4CCHA 4B9NA 3VQPA 3QIPA 4CF1A 3OY9A 3OHBA 4WE1B 4WZMA 3KK1B 1C1AA 3OYIA 3L2VA 4Z4CA 1JXLA 2GC8A 1NJWA 1RTIA 3V6KA 2OPSA 3V9WA 3Q8RB 4ZVGA 3KHHA 4LY7A 3TAPA 3CDUA 4ECYA 4F4XA 2AQ4A 1WSEA 3ZT2A 3OYMA 1N48A 1TKDA 2E9ZA 1VK0A 3HVRA 2YNHA 4DL5A 3M8SA 3DMJB 3O4QA 3WNHA 2ZE2B 1TKTA 2HHXA 2DTUA 3QEWA 3CWJA 1G15A 4IBNA 4CF0A 1KLMA 3ZSVA 4KI6A 1Z4UA 3HP9A 1KRPA 4KHUA 4KB0A 4CK2A 3M8PB 2HB5A 3VQQA 2B5JB 4W5QA 1HARA 5F8LA 3C6UB 3L2WA 4B9VA 3I5BA 3K57A 4E7HA 2HHVA 3L3UA 1C1BA 2JC1A 3SUOA 2PZSA 4HCCA 1DTTB 5F9LA 5KT2A 1JX4A 3MR2A 4CGJA 4FJJA 4I2PA 3DLEB 4CK3A 4TXSA 1C1CA 3ASMA 2IOCA 4FM2A 4CJ3A 4GC6A 4CEFA 4CJVA 1RILA 4RW7B 4ECZA 2C2EA 4HVJA 4RNMA 2W7PA 1NOZA 2HWIA 4GMJB 3MEEA 2OPPB 3T5HA 2FVQA 4I7FA 3TAQA 3V1OA 4J9OA 4K4XA 2YHBA 3NAIA 4NCAA 4W5OA 5J2QA 3JYTA 5D3GA 2IBKA 4DSIA 5HBMA 1ASWA 2DFFA 1XR5A 1WLJA 5KFXA 3SCXA 2HNZA 2BE2B 2OPRB 1I39A 5C25B 1SL0A 3LP2B 4CF9A 2E4LA 3BQ0A 2IS3A 3C95A 4RW9A 2FJVA 4CHOA 3PV8A 2A1RA 3NGZA 5KFRA 3CFRA 4DTUA 2YNGB 1WSIA 1TK5A 3VQBA 4NYNA 2HNDB 4CGIA 1HNVA 3PW4A 1WN7A 3UR0A 4NLPA 3DRPA 3K59A 4KB1A 2HHQA 4CHYA 3DLKA 1YTUA 4M3WA 4KV8A 4H8KA 3PUFA 4PA1A 3LPTA 4ZP7A 1EETA 4I9LA 2I5JA 4W5TA 3CDEA 3RBDA 3WNEA 3SQ2A 3ALYA 1S1UA 1TL1A 1RT3B 4FLZA 5CY4A 4FJGA 4ICLB 1SUQA 1NK8A 3PW2A 4BE2A 4F3OA 3G6VA 1VSEA 3L2UA 3V4IB 3QINA 2IM1A 4DQSA 1BQMA 1GX5A 4MIAA 1FKPB 4N5SA 1LWEB 2R7YA 3IG1B 4DF8A 3HXMA 2EX3A 2XY5A 4DTPA 1K6YA 3U3YA 2DPIA 2VA3A 5F9NA 4ID1A 3SQ4A 4KFBA 1S10A 1ITGA 2J6TA 2RKIB 4FBTA 3UPFA 3THVA 3UDLA 4N47A 3OSNA 4H4OB 2QE5A 1NK9A 4ECRA 3BSOA 4AHRA 4B9LA 3NFAA 3QO9A 3MFHA 1HQUB 3OYGA 5JS1A 4FJKA 2G8KA 4DTJA 4C8MA 2YKMA 3ISND 1RT5B 2UUTA 3FQKA 1EP4B 1RT1A 3RMDA 2HMIA 5DG9A 2OZMA 3KJVB 4HYKA 2BQUA 1UA0A 3G6YA 1UOCA 3TANA 3PO4A 1IKVA 4QWAA 1HNIA 1KHVA 2XCAA 1D0EA 1LWFB 3T1AA 2FBVA 1BI4B 3CG7A 2WK4A 3KHGA 2C2DA 2R8IA 4CJ5A 4ED1A 4AILC 1HPZB 3I5AA 1IKXB 1RBTA 1I6JA 4CK1A 1JLEA 1LAVA 3VQAA 3PW7A 3QESA 5KFEA 3H40A 1K1QA 4CJQA 1RBSA 3AVMA 4FJMA 3QIDA 5KFAA 4OJRA 3EY1A 2BANA 1XR7A 2D7SA 3M9MB 1TL3B 2IM3A 3CM6A 4DTRA 1D8YA 3QZ7A 5F8JA 4J2EA 4IOBA 1BQNB 1NHUA 4X2BA 3EYZA 3SUNA 5EDWA 4J9QA 3RB4A 1U48A 4ECWA 1YVUA 4ECVA 3CVKA 3OLAA 5J2NB 4O3QA 1ZBUA 4O5BA 4KHSA 3QIOA 2PYJA 5HP1B 4KTQA 3P1GA 1B9DA 2R2UA 4B9MA 2ATLA 5KFJA 4FLXA 4DFMA 1WNEA 3A2FA 4I9QA 3SYZA 2ETJA 2RN2A 4CF8A 3DRSA 1L3VA 5C42A 3TAGA 2IM0A 5F8GA 2ASJA 4KTWA 3S9HA 3AA3A 4CJUA 3LANA 3SPYA 1RCHA 1MMLA 1JLQB 1L3UA 5KI6A 1KSPA 1RTJB 2YNFA 3DI6B 5FDLB 1BIZA 1JL2A 4WFZA 3T19A 1VSHA 2ZD1B 3TABA 2FLPA 4QWCA 4AHUA 1T94A 5KG6A 3HPGA 3EPIA 4R8UB 3HVWA 4IKAA 4EZ9A 3HKWA 3RMBA 4HHTA 4K4ZA 4IRDA 3PX6A 4EBCA 5C24A 4M95A 3PHEA 3NHGA 4HTUA 3HM9A 5KFYA 2UVRA 2HHWA 3OYJA 3CYMA 1GOCA 1DTQA 3CJ5A 1RTDA 1CXQA 1N6QA 3B6PA 2Z1HA 5HLFA 4RW4A 4PUOB 1RT4B 4KO0B 1LW2A 2O4IA 4DSJA 2B6AA 3B6OA 3KLFA 3AVKA 3PW5A 4OLAA 1KHWA 5KFPA 4DSLA 2UVWA 3SQ0A 3AO4A 4N41A 2LSNA 5KRTA 2FJWA 3AVIA 3K5OA 2AJQA 3QLHA 4FJ5A 1JKHB 2DPJA 5HROB 2IJNA 3I8DA 3SQ1A 2BGGA 4BDYA 1S1TB 4LQ3A 2KW4A 3VQDA 4H4MA 3V9ZA 1NKBA 1TKTB 1JLGB 1RT7B 2FBTA 3O3FA 2IC3B 3VA0A 4O4GB 3E01B 4FW1A 2VG5B 2RPIA 3QEPA 1QAJA 3GQCA 3WNGA 1RDAA 1JLCB 3UQSA 4WYLA 5EWFA 4OVLA 4ED6A 2CKWA 5KGXA 4JV2A 4B08A 4FJIA 4QOZB 3DYAB 2OZSA 2AU0A 4IDKA 4WZQA 4FLWA 2FBXA 5KFMA 4RG8A 2FBYA 4E89A 2BDPA 1SL1A 3I0RA 3MEEB 5T14A 1D5AA 2WHOA 3GV8B 3C94A 3D45A 1N5YB 1IO2A 1IM4A 3LP1A 5J2QB 5J2MA 3DLGB 2F8SA 1S0NA 1QS4A 3V9SA 3CQ8A 3EPGA 3PZPA 4RUCA 3ZT0A 3PX4A 3ULDA 4FLVA 3O3HA 5DQGA 3KMQA 2KZMA 1YTAA 1HQEB 1KTQA 3OYAA 2JEIA 4IG3A 4FJNA 4CHZA 3CJ2A 3F9KA 2OPQB 1HNVB 4NYFA 2JEGA 5KFSA 4J9RA 5K14B 4ED8A 2KTQA 1WSFA 5EWGA 5F8IA 3U6FA 1SH0A 1T05A 4MFBB 5FRNA 3NF9A 2WONA 4B8CA 3KD1E 3NCIA 2PY5A 1S97A 3MECB 3V81B 3F73A 3LPUA 1QSLA 4IH7A 1JLBA 2YKNB 2FJXA 2ZQBA 3BR9A 1S9GA 5I42B 1VRUA 4XIUA 5KFDA 4RUAA 3GIJA 4BWJA 4R5PA 3NH1A 4OGCA 4O4RA 3V9XA 1RNHA 3M9NB 2ALZA 1HMVA 2GUIA 3TR8A 2XC9A 4FJXA 4K4WA 3GIKA 1Q9XA 1TGOA 3T5LA 3H5YA 3SI8A 1NJZA 4Y1DA 3OJSA 1ZBIA 3MFIA 5KFQA 3NKYA 3KTQA 3GYNA 4RW6A 3QGGA 1RT6B 4Z4FA 5KFGA 4ID5B 4Z4IA 4URQU 3M9OB 2VWKA 4FZYA 1ZBLA 1S9EA 1VSLA 3H08A 4BDPA 4YR0A 5J1EA 3VQ8A 4E7IA 4IFVB 3SNNA 1U49A 3LAMA 1BIUA 5KT5A 3KK3B 3HSTB 2P51A 2HVIA 3VA3A 3OYBA 4KHWA 2QK9A 4J9PA 3CIZA 1SL2A 3RB3A 4KAIA 3KK2A 1NOYA 3DOKA 4Z4GA 3OLBA 1BGXT 3HT3A 4CJRA 1BL3A 3BSNA 1D9FA 3L8BA 3OJUA 5KFZA 2ASDA 3HYFA 1TKZB 1QE1B 1S6QB 3KLGA 1S1XA 1JLEB 3ZT1A 3QEIA 1TKXB 3G6XA 4DU4A 1JL1A 4K4UA 3IN5A 1FK9A 4ZP8A 1SV5B 4WFYA 2B4JA 2IAJB 2ILZA 3H5UA 4DL7A 4L8RB 5I3UB 3M8QA 3HP6A 2HWHA 4PY5A 1SKWA 1NHVA 1RAJA 3IS9A 1REVA 3HO1A 4ECSA 3Q8QB 1UA1A 1TV6A 4BE0A 1RDRA 1S49A 1S0OA 2YNIA 3KLHA 2R8GA 3BGRA 3MTKA 4BWMA 3ISNC 3QEXA 2XI3A 1T7PA 4CIFA 3ZCMA 4QCLA 1VRTB 3OYEA 2ASLA 1A5WA 1S4FA 2E6LA 3ITHB 4ELTA 3QNNA 3EZUA 1LWCB 1RT2A 4AHTA 4DSFA 4H54A 3DLRA 4CJLA 4FBUA 3ZT4A 3SFGA 4O3RA 1CXUA 3H5XA 2XGQA 4ECQA 1ASUA 2FVPA 3NGDA 3LDSA 1KFDA 3O4NA 1YVFA 4TY8A 3NF8A 2O4GA 4ZHRA 3DRRA 4O44A 1JLAB 2RF2B 4PQUB 4IG0A 1IKYB 1U45A 4FYDA 2KFZA 5HRNA 5CYQA 3KLEB 4F2RA 1VSFA 4F50A 3K58A 4DQRA 4EP5A 3OS0A 4M3YA 2W8KA 4I2QA 4NLRA 1S6PB 4KKOA 2R2TA 3AVCA 4DU1A 3MXMA 4KHRA 4B3OA 2C28A 5J2PB 5CYMA 3SFUA 1DTQB 1GOAA 4CEEA 1RTDB 1S1VA 4FZXC 4PWDA 1UWBB 5KFOA 2AX0A 1JLFA 2WRMA 4CJ4A 2NUBA 3H4BA 2JC0A 3LZJA 3C6TA 3I0SB 5KG4A 4JRPA 1NK6A 1LW2B 4J2DA 1RTHA 3MR3A 2X78A 4ECUA 2FVRA 2VG6A 1L3SA 1C0TA 4CJFA 1IKWA 1S1WA 3QLHB 3CDWA 2E9RX 3FFIA 4FJ8A 3AVFA 4G1QA 5DGAA 1TVRB 4QPXA 4JS5A 4J9NA 4U7CA 4K4VA 5SZTA 4CERA 4DS4A 5F8MA 4M3UA 3P83D 2W9CA 1ZBHA 4NCGA 3K2PA 3OS2A 3V6DB 4F4YA 3S3NA 3DM2B 1QSSA 4RNNA 1C0UA 4RW8B 4KHQA 3AO1A 4N56A 4NLDA 4TN2A 1FKOA 1LW0B 1ZTWA 1KCFA 3NDKA 1U4BA 3AV9A 3PR5B 3JSMB 3SV4A 4NLUA 2P1JA 2AGQA 4K8ZA 2HHTA 2W7OA 1SKSA 2R2RA 2WTFA 4E7JA 1B92A 3WNFA 2ZKUA 3RB6A 1UAXA 3L2QA 1J53A 3DLHA 4FM0A 3OYDA 4CJTA 4RZRA 5KFVA 2V4RA 4ED0A 2PYLA 4F4ZA 4GW6A 2Y1IA 2ITGA 1KVCA 2QV6A 3TAMA 2XCPA 2W9AA 5KFCA 2FLNA 4LSNA 3NBPA 3ICLA 4URSA 4RNHA 4Q0BA 3RR7A 3QYYA 1XHZA 1MU2B 3NE6A 4DTOA 4CHQA 3AVNA 4CIEA 2KQ2A 3NAHA 4IFYB 1XWLA 3MEGB 1QQCA 5FRMA 3P5JA 4KPYA 3LP0B 5CZ1A 3CJ4A 4DFJA 4WE1A 1VSMA 4NCBA 3PR4A 3KK1A 3HVTA 3KKRA 4FS1A 4HUGA 1ZETA 3FQLA 2W9BB 4J9MA 4FK0A 3AO2A 3LWMA 1HYSA 4NRUA 2G8FA 4JV0A 2Z1JA 2DY4A 4FLYA 3VQEA 4DL6A 3SI6A 3DMJA 4B9TA 5KFWA 4GC7A 1DLOB 3IAYA 5L1IA 4DTMA 4LSLB 3M8PA 3BJYA 4FK4A 2B5JA 5DG7A 2W42A 2D41A 4ZP6A 2VG7B 3Q8SB 2EC0A 4C8NA 4ELUA 3C6UA 3PJXA 2V4QA 3CFOA 3G86A 4FLUA 5KFLA 4DF4A 4DG1A 2Y1JA 1J5OB 4URGA 4XPCA 4CJSA 1RDCA 4CFCA 2VA2A 3DOLB 1DTTA 1ZYQA 3D0PA 4O3NA 4KHYA 3OVNA 3DLEA 2UUWA 1T03B 2X6NA 2WOMA 2FC0A 4DWIA 4RW7A 3MEDB 4ZTJA 3TWHA 3RMAA 4DSEA 3ZSWA 5F8NA 1JXBA 2JGUA 2OPPA 1TK8A 3LWLA 2IJFA 3HJFA 1KLNA 3RWUA 4BDZA 3BQ2A 3N6LA 4O55A 4MKBA 3QIPB 4FK2A 1XR6A 4TYAA 3I5CA 4ZPDA 1A5VA 4DTNA 2BE2A 2OPRA 1NK7A 1NK5A 2OYQA 3PO5A 4CGGA 3MXIA 4W5NA 1JXEA 3AO5A 2HNYA 3NAEA 2E6MA 3GIMA 2GV9A 4B8AB 1RTIB 3G0ZA 2OPSB 2JEFA 2BRLA 1A5XA 2YNGA 1QSYA 4NLXA 3VQCA 2BQ3A 1RBRA 1ASVA 4AHCA 4DLGA 2HNDA 3L2RA 1TAUA 2F96A 5CZ2A 4O3OA 5KG2A 2IDOA 5JS2A 2YNHB 4CJWA 2C22A 3NL0A 2FVCA 3IS9B 1KLMB 2WCXA 2R2SA 4CF2A 2OA8A 4OPJA 1RT3A 5KT4A 3ZSOA 3BGRB 4ZVHA 4ICLA 1LV5A 2D3UA 3V4IA 4JUZA 1SH3A 3FSIA 1C1BB 4RNFA 1S9FA 2EHGA 1LAWA 3BSAA 4YR2A 1FKPA 1C0MA 2W8LA 5HRRA 3IG1A 4I2PB 4TYBA 1Z25A 3AVGA 1C1CB 1W25A 3TI0A 5DLFA 5EWEA 4IKFA 4ELVA 3T5KA 2RKIA 4DS5A 3KNAA 5DQHA 5KT3A 4CEAA 2GIRA 4I7FB 2D0AA 4H4OA 4TY8B 2DFEA 4M94A 4CGHA 4C8LA 3JYTB 5D3GB 4IG0B 5HBMB 2D0CA 2UVUA 2YV0X 4NLWA 2HNZB 4ZP9A 4ECTA 2AWZA 3MAQA 3KHLA 1RT5A 4CFAA 5SWMA 1EP4A 1SH2A 3H2LA 4NRTA 4RW9B 4YQWA 4NYZA 2QKKA 3KJVA 1EKEA 2QKBA 5KFBA 2CJQA 4OKEA 1KVBA 4ZMMA 3QGHA 3BSCA 3DRPB 1RYRA 5JXSA 3DLKB 4KV8B 4TQRA 3RAQA 4Q45A 4MK8A 3MXJA 1EETB 5KFKA 1HPZA 4O0IA 2I5JB 4K4SA 4U6PA 1IKXA 1D9DA 3OL9A 4CJKA 4Y3CA 1S1UB 5DMRA 3O3GA 3FDSA 2HHUA 1TL1B 1OS5A 4Y1CA 2X6SA 4DQPA 3NH0A 4AH9A 3VQ5A 1SUQB 3ZSXA 4TY9A 4IR9A 3NF6A 2XY7A 1NK0A 5KFFA 4UQGA 2XO7A 1BQMB 4EO8A 2FLLA 1TL3A 3FRZA 4QAGA 4FS2A 2X74A 5KG3A 3OSPA 5EUHA 4K4YA 1Q9YA 1QUVA 4KFBB 5J2NA 1C6VA 4M41A 4M45A 4EYHB 1ZBFA 2I1RA 5HP1A 4M3XA 4EBEA 3OL6A 3PVXA 4QWBA 4CGFA 1WNSA 1Q8IA 5KFHA 4OL8A 2G8VA 3KHRA 4O0JA 3QO9B 3H5SA 4CECA 1JIHA 4IH6A 2YKMB 1Y97A 3OS1A 1RT1B 2XI2A 2HMIB 1JLQA 4Z4EA 1RTJA 3DI6A 5FDLA 2O5DA 1J9AA 1NJYA 2ZD1A 4E1NA 4KHMA 1IKVB 2ILYA 1HNIB 3OYLA 3Q8PB 4ED2A 1I3AA 5C5JA 1ZTTA 4ZPBA 4R8UA 2BQRA 4O3SA 3NGIA 3K5NA 1GX6A 4ECXA 1NKEA 3NMAA 3RAXA 2IM2A 5L1JA 4HCBA 4CGDA 4CEOA 1QHTA 4CFBA 4K4TA 3TAFA 2HAIA 3GV7B 5DLGA 5JUMA 3QNOA 4BACA 2FVSA 1N56A 4JLHA 4KI4A 1YT3A 4PUOA 1RT4A 4KO0A 4EBDA 1XC9A 3IRXA 3SJJA 1CSJA 4DEZA 3HVTB 2BANB 5DQIA 3LP3A 4M3ZA 2XWYA 3CO9A 1X9WA 5KFNA 2XY6A 1HYSB 4CHNA 4M42A 1JKHA 5HROA 4DFPA 4HUFA 3HK2A 3HPOA 3NH2A 3OHAA 4CEBA 1X9MA 3QETA 5KFTA 1S1TA 4Q8FA 1W9HA 2B43A 3RTVA 4J9LA 1JLGA 3H59A 2JEJA 1RT7A 4ZVFA 3ZSYA 3AVHA 3MR6A 4MKAA 3DRSB 1HYZA 5C42B 2IC3A 1D1UA 4O4GA 5KG0A 3OYFA 2V9WA 3KD5E 2Z1IA 1BCOA 4KE5A 4MK7A 3E01A 3UIQA 2VG5A 2OH2A 3KLIA 4DG1B 3N6MA 4DQQA 1JLCA 3CJ0A 2YNFB 3DYAA 2D0BA 2UVVA 1KFSA 3TARA 4F4KA 2WOMB 4F4WA 3RRGA 1S5JA 4KREA 4WFXA 5C24B 2P5GA 3AVAA 1NK4A 3AA5X 1EX4A 3KOAA 1GOBA 1N5YA 3DLGA 1TQLA 3M8RA 4FZZA 3OYHA 1N6QB 3LZIA 5HLFB 3BDPA 4RW4B 5EU7A 4Q8EA 3QGIA 4IR1A 5KG1A 1U09A 4K8XA 2RDIA 2HNYB 3BREA 3HHKA 2B6AB 4JRQA 1HQEA 3KLFB 3E51A 1NJXA 4FJHA 2OPQA 4DL2A 5K14A 4YNQA 4IQXA 4J2AA 3KMSA 1R0AA 4NLYA 1U47A 4CJEA 4YMEA 3K5LA 4MFBA 3RBEA 1BHLA 5KT7A 3L3VA 4H4MB 1C2PA 2G8IA 1BISA 4GVMA 3OYCA 2G8WA 5T7BA 3MECA 4RNOA 4ED7A 3V81A 3D28A 3MR5A 1B9FA 1T8EA 1RA6A 2DFHA 3VQ7A 2R8HA 2YKNA 3ZSRA 2Q3SA 5I42A 4XPEA 4EO6A 3CFPA 5KG7A 1WSHA 2HHSA 5L1KA 3ZSZA 2Z1GA 4OLBA 1F21A 1NKCA 3GV5B 3RMCA 4FW2A 4KAZA 3KIOA 5KTQA 2RDJA 4IDKB 4DTXA 4LQ9A 4Z4HA 3K5MA 3RR8A 3AVLA 4WYWA 3G10A 4CEZA 1X9SA 3I0RB 3OYNA 1U04A 1RDDA 1IH7A 4Y2AA 4QW9A 5FROA 2XRIA 3LP1B 5J2MB 1RT6A 4AHVA 1QAIA 4ID5A 1HYVA 1CZBA 1RDBA 1W0HA 3QZ8A 4IFVA 4E3SA 2F8TA 3AVJA 5DK5A 4TLRA 3KK3A 3D5MA 3VQSA 5KT6A 3V9UA 4QWDA 4IG3B 2AX1A 4R0EA 4B9UA 1K1SA
chains in the Genus database with same CATH superfamily
3UW1A 1XMOF 1NO8A 4IJNA 1NH7A 4KBIA 1T05B 4O3PA 4QYZJ 2VFRA 1NMNA 2QLBB 2HQIA 3OTBA 2BJ8A 2EWHA 1O8BA 1VOMA 1QE1A 3ENQA 1H7WA 3VGTA 3ZTOA 4DV1F 1URNA 2CNLB 5AQWA 1H2TZ 3Q0AA 2ZWHA 3IDHA 2OFGX 2V63A 5H1SQ 3PXGa 3GJQB 2G8HA 4FPBA 1VRUB 2W2MP 1BWVA 3BZQA 3CJ3A 3VR1A 5HRPA 4R5PB 2EFGA 2XZTB 3VF0B 4QR2A 4OKJA 5EVZA 3TA0A 5AQKA 3VQ6A 1UFKA 2AW0A 1U1MA 1NGFA 2UXDJ 4BE1A 5LM7E 5F0WA 4NLSA 2FB0A 3N9UC 4NZ0A 1FX2A 1VRTA 3IGNA 1FCAA 4JV1A 2YWHA 4RW6B 3KLVA 2BKOA 3UD3P 1RYSA 1H2UX 3ITHA 3KKSA 1LWCA 1A0OB 3G87A 4FYXB 3PW0A 1IBLK 1S0MA 2Q2RA 5I9EB 3TQ1A 1AYEA 3RBZA 2AGPA 2IPOB 4OYIA 2YHYA 5M1KA 4XO0A 1Q18A 2D5RA 4CEDA 2RF2A 4ED3A 4QWEA 1IG9A 1S7HA 4M3RA 4B1YB 5RUBA 1EQYA 3D6FB 5C25A 3TOQA 1M5SA 3AFGA 2IIRA 3LO3A 4YDUC 1HI1A 3K8VA 4Y34A 3KKFA 2YTCA 2HBLA 2DGXA 3KLGB 1S1XB 5JLFA 4HTIA 3OL8A 4CLUA 4P9SA 4E1JA 1EXQA 1I3OB 2FHMA 2DK2A 4F9OA 1FK9B 4PEOA 3AAWB 1RA7A 2NXCA 3RSEA 4ZPCA 5BYSA 3FE1A 3JB9k 1M1KT 1REVB 2PO4A 4PXBA 4X4OA 1UW4A 2H4YB 3SJHA 5AQHA 1CZ9A 2F9JA 5JLHA 3AODA 2FY8A 3BY5A 1TVRA 3RB0A 5HANA 5HAOA 2V0NA 1X4FA 4CE9A 4BC9A 1RT2B 3BPDA 3ZSQA 4KSEB 2NNWA 1RGIA 1WAJA 4K2XA 4F3TA 4KHPK 3A8JA 1LOUA 3MI7X 2F8EX 3MX2A 4FVMA 2VWJA 3O1WA 1DARA 1HNWJ 3D68A 3W9IA 3SUQA 4WXWA 4USTA 4ZVSB 1MMNA 4AYBD 1WSJA 1SKRA 3GE9A 2NQPA 2Q97A 2XHBA 1S0VA 4B3OB 3I56S 5CYMB 1F6TA 3PYDA 3Q89A 4LD0A 2C3UA 3VESA 5D4PA 4LH4A 1K9MT 2HHHK 2D3ZA 1BI4A 1U02A 3C6TB 3C16A 1RHQB 1VCTA 2ZBQA 4YOWA 3NS7B 4QW8A 3QEVA 2I7NA 3DDKA 3IBFB 2A41A 2CWXA 1M90O 4C8OA 1S1WB 1X5SA 3OW2M 1R0AB 3OL7A 3FFIB 3VQ9A 4G1QB 2U1AA 4P2XA 3OPKA 2VBXA 2GIQA 3M6UA 3K0JA 4MK9A 3MMAA 2CJYB 2YHXA 2UUAK 2V67A 1VQNS 3C65A 4H0XB 3CM5A 2FHJD 3L4BC 4NCGB 2DXDA 4DU3A 3VGSA 1TYQB 3KWMA 5LL6Z 4J9KA 3FZMA 2G0CA 5BYQA 3VN5A 1ZAXA 4RU9A 3CCRS 4B1WB 3HPHA 4HKQA 4L3KA 1C0UB 2HKEA 4X66F 1W97L 2LDIA 4K7QA 2V4JA 4HR2A 4A2AA 2DJWA 3AAQA 5TKYA 2ZH3A 2R9LA 3VF6A 1FFGB 3IGVA 3D2FB 1X7VA 3ET6A 5DM7Q 3R8EA 2GBZA 3ZX3A 4XK8C 3HL8A 4JI6K 1R0CB 4CO5A 2KYXA 4OZNA 2K8GA 3ZFVA 4WQ5A 2P9LA 3VQ4A 1NHKL 3U8XA 2J76E 2LVWA 3SMZA 3D1HA 4YR3A 4NXNJ 1BDGA 1S4EA 5MLCV 4DN9A 5A8RA 5DS7A 3TAMB 3MEDA 5LL6d 5E33A 2Z2MA 1F60B 4BS2A 1VQPS 4W5RA 2QWMA 5D77A 2DYAA 1JWWA 2E2QA 1SB6A 3QIPA 3TVZA 3OY9A 2VQFK 2MZTA 4LRFA 1YHQN 3KK1B 3THYB 2VIHA 1JXLA 2IRXA 2GC8A 1RTIA 3KHHA 3CPWM 3ZETB 2NXUA 1UJ4A 3MM5B 4QR1A 2YNHA 4HEA9 1WUAA 4RUHA 3DMJB 4LRDA 4BRAA 4EIAA 3IO1A 3QPIA 2ZE2B 2HHXA 1EKRA 4JI1F 4IZ9A 4AT1B 1Z4UA 1ACMB 4KHUA 4CK2A 2HB5A 3O3LA 2B5JB 2I0XA 1N8RO 4QS8A 2DTJA 2XULA 3L2WA 2VWBA 4QU7A 2HHVA 2MZQA 4DR7J 3U27A 2A3ZA 1OH5A 3WXMB 3SUOA 5F9LA 3RVCA 1JX4A 4CGJA 4B3MK 1C1CA 3IFEA 2AT1B 2F4VF 4CJ3A 1QQOA 3M8YA 4HVJA 3HULA 1X3MA 3V1OA 1CQNA 2YHBA 3RW7A 4W5OA 2BV3A 4CM0A 1ATNA 5D3GA 2IBKA 4BC7A 2C1EB 4DSIA 3VEYA 2LLZA 4BGAA 1XR5A 1WLJA 5KFXA 5C2DA 1GLJO 4LF4K 4TU9A 1I39A 3MZIA 1M1GA 1PC5A 2IS3A 2E1MC 2ZH5A 4LFAF 1OSDA 3CFRA 5AQMA 3VQBA 2DIUA 2EI5A 3PW4A 3A8YA 1Q5YA 3UR0A 4NLPA 1CJTA 2HHQA 3MAAB 2VL1A 3M6GA 4DV3K 2DB1A 4KV8A 4Y0FA 1WOOA 2MMYA 3OQ2A 2VC0A 2VQEJ 1S59A 1WC1A 4I9LA 7AT1B 4W5TA 2AJ1A 4JI3K 3SQ2A 1QAYA 3ALYA 3PYFA 3MCOA 2ZBIA 3C7NB 1TL1A 3ETMA 3SBTA 3UE5A 4BC2A 4X62K 2QIFA 4LFBJ 3G6VA 3R5AA 1VSEA 2IM1A 2O8EB 3U1NA 1GX5A 1N33J 1FNXH 4OZ3A 4MIAA 4DR3K 4BLGA 1LWEB 4DF8A 3TQEA 4A46A 9ATCB 4OX6A 1AZSB 1CG2A 3U02A 3OBYA 2XY5A 3J7A1 4YDXA 5F9NA 1H6KX 4V19X 1S10A 2J6TA 3QAUA 4FBTA 1R89A 3HBTA 4N47A 3D54A 1XMQF 1NM2A 5ADXH 1I5OB 2HZAA 1SQEA 1GXTA 4IOAQ 4AHRA 4OHXA 2CNNB 1WF2A 2MTLA 1X5OA 2W4PA 5JS1A 4DTJA 1V5IB 3S7RA 1G99A 1WELA 1RT5B 3FQKA 4LBHA 3I56N 4FOEA 1RT1A 1U1RA 4OQJA 3KJVB 3OR2B 3G6YA 3QBCA 1BXNA 4LF8F 2XSJB 3T1YJ 1HNIA 5M1PA 1D0EA 3CG7A 4B3TJ 3EXCX 4AILC 3FEXB 1T9WA 4TKTA 3I5AA 1IKXB 2ZDPA 1WEXA 1HLUA 3DNCA 3M30B 4CK1A 1MSWD 2L9WA 3VQAA 3PW7A 3QESA 2E29A 5EX0A 4B1UB 3A0IX 3MTJA 3ZNJ1 2J7UA 4C9DA 1U0HA 3W3DA 1KQGB 1XR7A 1YDLA 1TL3B 3QZ7A 1YRTA 2GWJA 4ANDA 5ETNA 4FKYA 3R27A 2DHHA 3SUNA 3OTOJ 4ECWA 2LQBA 2CPXA 2PIIA 2A3JA 5LMNJ 4GVBA 1YVUA 1Y7PA 3CVKA 3OLAA 2HVZA 1SC6A 5J2NB 3J7YU 1ZBUA 3THTA 1SJRA 3QIOA 1U1OA 1YJTA 1FJGK 2XMKA 1B9DA 4CYUB 4WQ5C 4QYZK 1NDLA 4DV6K 2ATLA 5KFJA 4U7UD 1WNEA 2J0QD 1IQTA 1FJEB 3CCTA 2RN2A 3LM2A 2Y0BB 2IM0A 5F8GA 3S9HA 2OEJA 1S76D 1MN7A 3LANA 3NOCA 1KSPA 2C3OA 2GZOA 3DI6B 2HBMA 5FDLB 1JL2A 1KAYA 1DRZA 3FZKA 1KQSR 4LR8A 3EE8A 3CCSN 4AHUA 5KG6A 4R8UB 3JXUA 3GG0A 2IVOA 2GVDA 3RMBA 4JHDB 2NRZA 4K4ZA 5THWA 4M95A 3CCMS 3HM9A 1SI9A 5KFYA 5EY4A 5FPNA 4WCEQ 2W4DA 2IDEA 4M5MA 1DQAA 3DOMA 4C2MA 2CQ0A 1KR4A 3B6PA 1JQGA 5AXNA 5HLFA 5AJ3F 2N7CA 2Z1HA 4RW4A 4AXJA 3ZX0A 3JAMY 2ZHOA 1P1TA 1VR6A 4G1PA 3UDVA 1LEOA 4DSLA 1URRA 2VBWA 2CDQA 3K5OA 4C0OC 2A18A 2DGVA 4FJ5A 2VDHA 4AM7A 1PAEX 4CO4A 3I8DA 4BDYA 3MMVA 1N0UA 1NMDA 3V9ZA 5AQRA 1MWQA 1NKBA 1TKTB 1WKJA 1UJ6A 1RT7B 2VONA 3D2EA 4DPXA 1RE1B 3GR1A 5D0GA 2FBTA 2F7TA 2EXUA 2IC3B 3VA0A 4ES2A 5H9EJ 2Z30B 2DNOA 3NNHA 3S8SA 2A10A 3SDEB 1FA0A 2P9GA 3GQCA 2YQ1A 4V1Ak 5DM6L 2D4WA 5EWFA 4ED6A 4L75A 2OTLS 2QLXA 5ETOA 4JV2A 1JNRB 2ZZTA 4OI2A 4FJIA 2OZSA 2AU0A 1EQ0A 2QA4N 2E5LK 2LU2A 2F65A 4FO0A 2HPUA 2QL5B 2BDPA 1SL1A 2F63A 2IDLA 5T14A 1WDDA 2WHOA 3GV8B 2XHCA 3C6HA 5J2QB 3ID6A 1VLOA 2F8SA 2MLZA 5BR8F 1S0NA 4LVNP 4DR1F 4JYAJ 1QS4A 3G4SS 4ES1A 1Q81T 2JLGA 3EPGA 3PZPA 3PX4A 4FLVA 4LF2A 2KJWA 4USWA 1VJWA 5A0YB 3N4QA 2PGCA 1KTQA 2K1RA 4FJNA 1F5CA 2R7OA 2GVZB 4WF9Q 4NYFA 5GIOA 5KFSA 5MLCQ 2QFJA 3KNGA 3U6FA 3SBGA 1HBNA 2ACMA 3N4PA 3QBXA 4YOVA 4B8CA 1BC6A 3KD1E 3A5OC 3MECB 3J8AA 3FMBA 2V50A 2CA9A 1QSLA 2ZQBA 1S9GA 2YKOA 3R5JB 2VPXB 3GIJA 5HOOA 3CCWA 1PYOB 3MPUB 2HBJA 1S6UA 2ALZA 1HMVA 3CJKA 2V9KA 2QTDA 4C98A 3CPEA 2ZVIA 3QT6A 2NZTA 2NPFA 2RQMA 2XC9A 1WACA 1E6YB 3GIKA 1Q9XA 1TGOA 2Q1NA 4Z7YA 3SI8A 4JKEA 1FRMA 4C4WA 3O8MA 1IBMJ 3NKYA 3KTQA 4CLWA 3OVAA 3AGRA 1HD0A 5KFGA 2RUSA 2VWKA 4A8YA 1S9EA 3H08A 4HL9A 3CCUS 1KD1T 4HI2A 3HDSA 2YWWA 3SNNA 5BRDA 1BIUA 1LWXA 1FDBA 3CF5L 2HVIA 3VA3A 3HHLA 3C6AA 1EZZB 2QK9A 1SL2A 1TL5A 4DV1K 5IXUA 1YGYA 3KK2A 5LOQA 4V19J 2UXDF 1NOYA 2RSQA 2VHGA 4JNEA 2MKJA 5KOXA 1BGXT 4WP9A 1Q7YT 4CJRA 1BL3A 3MUMP 2ASDA 1JNZB 4OYOA 4ILMA 5HMWA 1GH8A 3QEIA 1TKXB 1BHNA 1G6BA 1N32J 4K4UA 1KVJA 3IN5A 4JKCA 1S22A 2IAJB 4DL7A 4NXNK 2F3JA 1UVJA 4RO0A 1YG0A 2XMVA 5GAHI 1I94J 4DR6K 3GYGA 1RKIA 5IOLA 1S72S 3IS9A 6FDRA 3RJMB 1HD1A 2FF6A 4V19S 2HVDA 1UA1A 1S49A 4KGXB 1S0OA 3MTKA 3QEXA 1RACB 4QCLA 3ZCMA 1ZA2B 4F36A 1KQKA 3QT7A 1RXOB 3HZGA 3R7NB 4KIAA 2P9UB 4B1ZA 1A5WA 1S4FA 3PACA 3K9KA 3I55N 5DETA 1Q82O 1HBMA 3QNNA 2POKA 2DCUB 4PXEA 3ZT4A 3F44A 4N7TA 4DOZA 2M7SA 2BOPA 4OLPA 1FO1A 2EK6A 1IVZA 3R9PA 1QZ6A 4ZVOB 3O4NA 4ETXA 4USIA 5ETSA 2O4GA 4EMDA 4IG0A 3CCMN 1NM1A 4F2RA 4NI2B 1Q86O 1UL3A 4DQRA 4HDHA 3OS0A 4M3YA 4U8VA 1U0SA 1S6PB 4KKOA 2R2TA 2XLIA 3AVCA 1FXLA 2Z2LA 3SFUA 2IVPA 4CEEA 1VQ6N 1RTDB 1S1VA 4DCOB 2HFUA 5KFOA 4BG9A 2AX0A 2WRMA 4CJ4A 2NUBA 2BJEA 3H4BA 5E3RA 4C48A 4JKFA 4JRPA 1QVFR 2PBDA 3Q8UA 2CJXB 4MLEA 4X4NA 4LF9K 5LMUJ 1C0TA 4CJFA 5D4LA 3S41A 1HNWF 2E8AA 2GGPB 3H20A 3HT0A 1NSAA 4CZMA 1RBAA 4K4VA 3LGNA 4DS4A 5F8MA 3IWLA 5G0RB 3VEWA 2OSRA 3K2PA 4LF7J 2GQ2A 3H90A 3V6DB 3MMJA 1RLDA 4DV2J 4EAHD 1KVIA 2NLWA 4KHQA 2KDOA 1IJJA 1FKOA 1LW0B 3IM9A 1KCFA 3PR5B 1F5AA 2QLFB 3SV4A 3G6EN 2AGQA 3H2VE 1TR0A 1J53A 4ZJLA 3OYDA 2Y1LB 3NLCA 2OAUA 3TZXA 2U2FA 4LFBK 4C8ZA 3MM9A 4F4ZA 2Y1IA 1KS2A 2LEPA 3WQPA 1AXQA 1KVCA 1J5EK 3PDNA 3LF0A 1RWWB 1ZAVA 1HWJA 2EFOA 1PJ5A 3ZXWA 3LH2S 5KFCA 3KWGA 3NBPA 3ICLA 3BB5A 4URSA 4RNHA 2Z0GA 1Q78A 3RR7A 1K44A 1VQ5N 1MU2B 3NE6A 4C1NK 4CHQA 4CIEA 3NAHA 4AFFA 4IFYB 2XYPB 2AZ1A 1IWAA 1OH7A 2PFUA 1W2IA 5FRMA 3E2EA 5FPEA 5B0EA 4WE1A 3IXQA 1VSMA 3B82A 5L39A 3PR4A 3D6HB 2COLA 3SAGA 2OKQA 3AD8C 3KKRA 5CZXA 2EPIA 4HUGA 1MWKA 4QJVA 2ZFHA 2W9BB 2MQQA 3I9V9 3AO2A 5GAGI 2G8FA 1WSVA 2DY4A 2CG4A 3T1YK 1PG5B 2Q66A 2E1PA 5KFWA 3TPQA 3CI5A 3SEOA 5BPNA 4B3TK 1KN6A 3I4HX 3M8PA 4FDFA 2VG7B 3Q8SB 2IVNA 5JMNA 3C6UA 4NL5A 3CFOA 3G86A 5IWAJ 2HQGA 2NZ4A 1J5OB 2ZOFA 4CFCA 1Q4RA 2VA2A 3DOLB 1DTTA 1ZYQA 2E1AA 4O3NA 3C14A 4KHYA 1TUVA 2NRRA 3LM9A 3JTNA 1MROA 2C2NA 4PPDA 1IJFB 4ZLPA 3MMBB 3G71S 2WOMA 3TWHA 3RMAA 1T3OA 2ASOA 5F8NA 1G3OA 3HF5A 1JXBA 2JGUA 5LMNK 3LWLA 2IJFA 1KLNA 4BGBA 3RWUA 4GKJF 4PG8A 3BQ2A 4TYAA 2QC3A 3I5CA 2D1CA 2IYGA 2GEMA 3TWZA 2NZCA 3BEXA 1TELA 3MXIA 4DV5F 4Y28C 3CCQN 3W1YC 2CIMA 1PO6A 3O9QA 3NAEA 4F7VA 2UXBK 3JQJA 2OPSB 4ITSA 1QSYA 4DR7F 4JI1K 1ASVA 3TW0A 2B9EA 2CVEA 3OR1A 3S6EA 4CJWA 4IO8A 1UJ5A 2XMWA 3NL0A 2UXCK 3CMAS 1UTAA 1U1LA 4MTPA 1AROP 3Q7BA 5FPDA 2E1YA 3P5TL 2QWQA 5GADI 2WVFA 1XNQJ 2QGFB 1RLCL 1RT3A 1SC3B 1BE4A 3ZSOA 4NEYA 4A57A 2MQ8A 4ICLA 2F4VK 2P9NB 1S7IA 3FLCO 4DXLA 3CJSA 2W6LA 4YHHK 2W24A 4FNIA 2AV5A 3JAMO 1YJNS 4TYBA 3AVGA 4NA3A 2K3KA 2ZH4A 4IKFA 2O66A 4ELVA 3T5KA 4LR7A 1WG1A 2VOPA 1WHWA 5KT3A 2ZH1A 2J9CA 1WEZA 3ZO7A 3B4DA 4LFAK 4DR4F 4M94A 5C10A 2VQEF 3K9JA 3JYTB 4J8FA 5HBMB 1TFWA 4ZP9A 1KDNA 2KT2A 3PHTA 5D8HB 2WC9A 3KHLA 4PHTX 5A2QY 3F2KA 1EP4A 3M2RA 3NEKA 4NYZA 2QKKA 1S57A 1EKEA 5AQYA 1NGCA 4HLBA 1RWPB 2ZF5O 2VGNA 1VIXA 4YOTA 1OH6A 4A2BA 1Q1KA 3BSCA 3TU5A 1FVQA 1RYRA 3MN9A 5JXSA 3DLKB 2V69A 3MXJA 2Q1LA 5K5MA 2J4RA 2I5JB 3SSQA 4K4SA 3L7UA 4DKWA 4Y3CA 2R7XA 2Q6CA 2HHUA 1FDDA 3OHRA 2Q0RA 3NH0A 4ALZA 1PKUA 4M5DA 3LPEA 3QJJA 4JYAK 1BQMB 2QWRA 4EO8A 3PEJA 4NA2A 3KG0A 3ENOA 3EVWA 5B0DA 2XYGB 3OSPA 4PR6A 1U6FA 1N5TA 1QUVA 3NVKA 2VC1A 4A8OA 1E6VB 1C6VA 4M41A 4KQZA 4EYHB 5HP1A 4M3XA 5DM7L 3BPSP 2P6SA 2W2QP 2QX0A 1AB8A 2KI2A 1WNSA 1LFWA 3JTOA 3KHRA 4P7TA 3CGIA 3O4WA 1K8AO 1N5SA 1JIHA 3O80A 2YKMB 2E7XA 2DGUA 3J7ZO 1B70B 2OANA 3FBBA 2HMIB 4A59A 3MEKA 1OMSA 4KHMA 4CWBA 1IKVB 2ILYA 2HS4A 5C2CA 3OYLA 2HBQB 4DR5J 4JV5K 1GX6A 4ECXA 4X64F 3GCWP 3T9ZA 2IM2A 4U96A 2QI2A 4GVEA 4HCBA 5AQIA 1FJCA 1HBUB 5AZIA 2HAIA 2G1DA 1IBMK 1N56A 1K8KA 1EQMA 1CVJA 1XC9A 1CSJA 2B7BB 2FHJA 5DQIA 2Z8QA 5J1NA 3HSZA 4PYDA 2V52B 3W65A 4IXCA 2CQ3A 1JKHA 3ZEUB 4ZIVA 4ZLLA 4BROA 3NH2A 1X9MA 3QETA 4Q8FA 3G8SA 5LSRA 3G2XA 4TU8A 3FMWA 2GA7A 2AJ4A 3MR6A 3CCJN 3DRSB 5ADXA 4JI2F 5C42B 3NP5A 2N7YA 4JKGA 1D1UA 2HF4A 3C46A 2RAQA 4CLLA 2B4VA 2ZC3A 1N32K 3WEEA 1T9XA 2AP1A 2YNFB 2GJFA 4DUZJ 5ETKA 4B3RF 4M5LA 1ESVA 5LSLA 2D0BA 1KFSA 4F4KA 1NBWA 1YSJA 1GFWB 3LDPA 3O2IA 4F02A 1EX4A 5A6WA 2MGZA 1X0FA 1HFEL 1TQLA 4FZZA 4KBOA 1YBTA 5HMYA 4Q8EA 3QGIA 4FKXA 5DDPC 5GMDA 4C23A 1U09A 1NB7A 4K8XA 1VQOS 2KT3A 4WU3A 3BREA 1NGDA 4EGLA 3MOZA 2DNMA 2AJFE 2IMOA 1KXPA 3POTB 4DL2A 3ZZZA 2XB2D 4DU8A 3MPYA 1NG9A 1F9HA 1R0AA 3K5LA 1F5BA 3O5BA 3OV7A 3ATVA 3BGFA 3FUYA 3O6QA 2G8IA 4GVMA 3V81A 1JB0C 4ED7A 1ATRA 1OY8A 2DFHA 3LPYA 2E5GA 3MWPA 2YKNA 3ZSRA 2W25A 2FZCB 2W6KA 1U8WA 5HI7A 1BLUA 2K7KA 4ZS6A 2HHSA 1YJNN 3ZSZA 1NJIO 4LFCF 1OIAA 2H3GX 2H65B 4QIEA 1HNZF 4FYWB 4I67A 1R59O 5KTQA 4YOUA 4LQ9A 4OZ1A 5L9NA 4DR1K 4DCJB 5LMUK 4JK8A 3SCKE 3THXA 5JVGQ 4IOAL 1X9SA 3W3SA 3P5BP 3R6GB 2M52A 2QEXS 1NGJA 2MEWA 4AHVA 1QAIA 4ID5A 4LF5K 1T95A 3ILLA 1CZBA 1RDBA 5D4OA 3P96A 1W0HA 2MLXA 2GHVC 2F8TA 3ENWA 4CT9A 3E66A 4TLRA 1RU1A 3A5LC 2XSFA 1UW9A 3DXKA 4FWPA 3VQSA 3V9UA 4GV3A 1FRXA 2AX1A 2GMHA 1T44A 4B1VA 3V6JA 1HJRA 3JAMU 1OWXA 1YI2S 2XLJA 3HHNB 1VQ4S 2YPYA 2AMCB 3CETA 2LU1A 2WONB 2NUUG 4JI8J 2YHWA 3I82A 1TKZA 4L3NA 2DNHA 1S6QA 2Z58B 3HLUA 2MKIA 4JI7K 3HM8A 1JLBB 5BRHA 3MM5A 1SV5A 3TUJC 5AXMA 5I3UA 5M2RA 4F2SA 4HTLA 2ZE2A 2HWTA 2JRSA 4CJPA 2CQ2A 5DG8A 1HHTP 2H48B 2E1ZA 2GELA 2UUCJ 1DJ0A 4ZVEA 2HGLA 3MF5A 2IGIA 1TP7A 4BRIA 2KXHA 1Z26A 1NUEA 4JI0F 4WQ4A 3R5DA 4A48A 1XQIA 4YB5A 3DLBA 2XS5A 2G8UA 3VEVA 4PQAA 1X4CA 4R25A 4OHZA 4NLTA 2VOOA 1QTMA 3U1LA 3PX0A 4NLCA 4Y2CA 2DKOB 3AVBA 1ZBTA 3OYKA 3S01A 3QWPA 6AT1B 4PQUA 3CC2N 4C8KA 2YH1A 1IKYA 4WCEL 1EKSA 2Z56B 3DOKB 4E7LA 3KLEA 1WAFA 4DFKA 1BCMA 3CT9A 4DTSA 1HUXA 3TUZC 2OMLA 4FCYA 3OFGA 5IWAK 2G4BA 2JH3A 3BH7B 4FWKA 3CCLN 1X1PA 4CBXA 2RS8A 2Q6BA 5HRSA 4H03B 3IRXB 5B7WA 5IT9Y 4Q44A 4WP8A 4ZN3A 2H1YA 4NLOA 2ZH8A 4DCPB 2PA3A 4FJLA 1TV6B 2KZZA 4GKKF 2MKKA 3KLHB 2NSBA 3FZ2A 4IH5A 3EZWA 2MZSA 2BRKA 2C2RA 2AA4A 4C97A 1KKHA 1E4GT 1KNZA 3BUZB 1CZAN 4O8KA 1LWEA 3R3LA 2NRXA 1YIJN 4QS7A 4ZJQA 2FGCA 2AGOA 3QERA 2ZOMA 5C7PA 2P9KB 4FJ7A 4KB7A 5DJBA 4TQSA 3PM9A 2MKSA 4JKAA 3F0NA 3I4PA 2YWEA 4DPYA 5F3TA 2E9TA 1JCEA 2M8HA 1RU2A 4B3SJ 1TK0A 3VVUA 4GNIA 4CZJA 4WFBL 2FF3B 2P9IB 4AQYJ 2CQGA 4H0OA 2ZM6F 2P9SA 1WSGA 4C3MA 2DVIA 4I2QB 3ZT3A 2LMIA 4OYBA 4Q43A 4NLVA 1KONA 4DQIA 3CMES 2RQ4A 2DH7A 1VC5A 2X1AA 4NXMF 3J7Z5 3GJSB 3PSIA 3LTOA 3VGUA 1TL7B 2HSTA 4LJMA 4DV7K 2HK2A 1WD6A 4DV2F 3T3FA 2MSSA 5E5NA 3M05A 3SQOP 1R43A 3CD0A 2HG4A 3AA2A 3H98A 2BJDA 1KOHA 1RBUA 4BVPA 2PFDA 1T9TA 5KFIA 4CESA 5HK4A 1B0VA 1H73A 5A2QO 1L3TA 3DU6A 3SSSA 1C4AA 4FJ9A 4X84A 1A7GE 2W9CB 2EC2A 5KG5A 3BBCA 3CCZA 2YWFA 3TO8A 5DZ7A 3DGPB 2R8KA 3VZIA 2DR7A 1IWGA 4ZPWR 3SIPB 4DMNA 4CHPA 4LSLA 1T6DA 1WF1A 1FE4A 1NSKL 1EWRA 3CJRA 2ZC4A 4FM1A 1WWHA 1EIYB 1T3NA 2IA6A 5L9XA 1VDHA 4B1XB 5ETTA 1D8ZA 5CCMA 3L4IA 3S3OA 4H5WA 2QW9A 1FXXA 2RRNA 5K8NA 2ZBRA 2J9DA 3E9PA 2MY8A 2PSZA 4LSNB 2QMWA 3BV8A 3CULA 1O13A 3SZ2A 4Q0BB 4CTAA 3BF3A 4K0KF 2XBPA 4ES3A 1T11A 3I33A 4CF1A 3EICA 3US5A 2VICA 4PWWA 2V8DA 2B7CB 3Q2TC 1C1AA 2GIFA 3QATA 4P2FA 3OYIA 4A8WA 4Z4CA 3UN3A 4BR0A 1SJ1A 2EBGA 2Y1RI 2DNKA 3TAPA 1DURA 3QRRA 1BA0A 4BY9C 3ZT2A 3CIPA 1N48A 3HVRA 2O01C 4DL5A 3SQGB 1RBOB 4XTTA 3O4QA 3WNHA 1R8AA 1AUDA 4K42A 1TKTA 1CLFA 2EVZA 4RJVA 3J81j 1G15A 2MZJA 2XO6A 4IBNA 4CF0A 4KI6A 1KRPA 3HP9A 4KB0A 2QWNA 4WP3A 3CTRA 4WTYA 1AFJA 1NDKA 1XQSC 5CE3A 4IEEA 4B9VA 3I5BA 1SZ2A 5KQDA 2LEBA 3K57A 2PT0A 4FL9A 2PZSA 2JC1A 4YB7A 4Z2XA 5KT2A 2HLUA 4QIGA 1PJ6A 4I2PA 3DLEB 2V2ZA 4CK3A 2CGKA 1KBRA 4GC6A 5AZJB 5A8KB 4RW7B 2NXNA 4ECZA 2J8AA 2HWIA 5A8WB 5KOWA 3QQCD 1VI7A 3TRGA 4I7FA 2CQPA 4K4XA 4OX7A 5J2QA 4RBVA 4JB8B 1ASWA 1HX1A 4ISGA 4WWSA 3PSFA 3UO0A 3CD6S 3MN6A 2HNZA 2YX7A 1KOOA 3M6VA 4OYWA 3LP2B 1Q8KA 3L3CA 2E4LA 3A5MC 3C95A 4RPFA 4CHOA 2ROPA 2YNGB 1P27B 4I4BA 2XMAA 4W92B 3FZHA 2YKQA 5FIIA 4NYNA 1WN7A 3DRPA 3K59A 4CHYA 1YTUA 2XNRA 4M3WA 2W41A 3PEHA 3SLCA 3HI0A 4PA1A 5IV3A 4A5AA 4CZHA 1EETA 4YN3B 3WIUA 4OYAA 4RWTA 1GNKA 3A8EA 3BF1A 3G82B 1GMUA 2E66A 4FWMA 2K7JA 3L95X 3V4IB 2GV1A 2MY7A 4DQSA 3F9MA 1VIOA 5MAOA 3H1QA 4IEIA 3BKTA 2CH6A 3MMCB 1HNXF 3TSQA 4DX5A 2CPZA 4R0JA 3U3YA 2VA3A 1RAGB 4H5TA 2J0WA 3SQ4A 3G8TA 2RKIB 1HWIA 3THVA 4WKYA 1VQYA 3A12A 2Z57B 4H4OB 1VAZA 1X3NA 3KJQB 4M7XA 4ECRA 2V8PA 3MFHA 2FUG9 4LREA 5A6PA 3D66A 5K8OA 2KL8A 4TVAB 4HYKA 2BQUA 1DAXA 5EN1A 1GLLO 1TZ0A 4QWAA 1QD1A 2XCAA 4BRDA 3TUIC 1KAXA 3FBEA 2EFPA 5T7LB 3I87A 4S0MA 2R8IA 1PYTA 1HPZB 5HVGA 1Y3KA 3T6BA 1D09B 4M8LA 3IR6B 3EO3A 3CO0P 4EHUA 4FPRA 2OO4A 3H40A 1FFSB 1K1QA 4CJQA 1RBSA 2HFNA 3PYEA 3QIDA 2OTJN 3IAM9 5LY3A 3EY1A 1RBLA 2OJ3A 3M9MB 1ZZNA 5F8JA 3FGUA 1T9UA 1HW8A 2W2OP 3MGJA 4YY3K 3EYZA 2UUBF 4J9QA 3OUYA 5B08A 4ECVA 1W7WA 2EWSA 4M5IA 4O3QA 4DR5F 4HACA 4KTQA 4FLXA 4I9QA 4I1TA 4RTFD 1L3VA 3A1YG 1CJUA 1W2BR 4RUBA 2ASJA 3M1VB 2BX6A 1HW9A 2W2NP 4CJUA 4X64K 1RCHA 1DFDA 1JLQB 1RTJB 1HHSA 1BIZA 4WFZA 3T19A 2FDNA 4CO1A 4FWRA 1JJCB 3HPGA 5M1NA 3EPIA 3HVWA 4IKAA 5A2QU 3CIMA 2E1CA 4IRDA 4XH5A 4EBCA 3NHGA 1CJKB 1OVQA 3OYJA 3EDRB 2BYCA 3CYMA 1M1HA 3MWTA 5AE1A 5H1SV 2HBKA 1GOCA 3CJ5A 1RTDA 1CXQA 1N6QA 1F9FA 1KQSM 3E1YA 4MDBA 3PLAA 2R7QA 2VPZB 1RT4B 1H74A 4KO0B 3MM6A 4LSZB 2O4IA 3N79A 1LKZA 1S77D 5EHHA 5LJWA 2LXFA 1WC6A 4KHPJ 4MLHA 4PKIA 4OLAA 1IBKF 2QA1A 1KHWA 2P9PB 4LBIA 2KKZA 3SQ0A 4N41A 5KRTA 4DUZF 3AARA 3OTEA 3H2UB 5HROB 3LDOA 1X60A 1Q8LA 3K89A 4XH1A 3BO2A 3G25A 2XYHB 3VQDA 5HQMA 4H4MA 1JLGB 2ZBCA 4F0HA 2IBOA 3VEZA 4ZK7M 3UFCX 4O4GB 1V3SA 4FW1A 2RPIA 3WNGA 1RDAA 4X4VA 4WYLA 4OVLA 2BJ1A 1R6YA 5IT9O 2HHHJ 2CKWA 2C2OB 3FEZA 4QOZB 5DM6Q 5F2RA 4IDKA 4WZQA 1VMBA 2IFXA 2OEKA 4Z37A 3P39A 2AEFA 3J81U 5GAHP 4E89A 4CZKA 5CCLA 3TYTA 4JOUA 3MEEB 2I8EA 4TU7A 1D5AA 3C94A 1IO2A 2H4WB 2CH5A 1IM4A 5J2MA 4QR0A 2PC6A 1SIZA 5AQQA 3R6MA 2G1HA 2M88A 1TL4A 2B56A 3CQ8A 4DV4J 2GNKA 2VKRA 2KZMA 2W1BA 3TVYA 2YWKA 3BEGB 3OYAA 2JEIA 4IG3A 3UNGC 2FZGB 3CJ2A 3I96A 1SQGA 1HNVB 2Q43A 2DIVA 2JEGA 4W98A 1H38A 2DO0A 4ILGB 1YK9A 1ZH5A 5C2FA 1QVGR 4NLBA 3AY0A 4AQYK 4JI6J 4LFCK 1Q95G 3F73A 4IH7A 3VF4A 1HNZK 5DDOC 4FWLA 2IA0A 5I42B 5KFDA 4BWJA 1M0SA 1HR0F 1DBDA 2WSCC 3J7AP 5AQZA 3ZZRA 1T3VA 2GUIA 5AR0A 1CC8A 4FJXA 4A5BA 4M1KA 2AIRB 4Y1DA 3OJSA 1ZBIA 4OYMA 3MFIA 4CM2A 2VQFJ 5E3CA 1RT6B 3IM8A 4Z4FA 3Q8YA 4JI8F 4Z4IA 5HMZA 4L76A 1ZBLA 2OIHA 1PAUB 3MMBA 5J1EA 1KEKA 4O5FA 4NEZA 2MKCA 4FF3A 2MQMA 3KK3B 1H98A 5IQQA 1BUXA 1W26A 2A40A 1PC4A 4PG4A 1MW7A 2KO1A 2HQ3A 4G9ZA 1DQ9A 3CIZA 4PWUA 3FEYB 1RAEB 5C15A 4U9RA 4Z4GA 2BTFA 2XZWA 3HT3A 3VGKA 3SAFA 1ZA1B 3QFWA 1D9FA 4I6MA 2B8QA 3HYFA 1QE1B 3DLJA 4F26A 2L9NA 4NPOA 5GAEI 1JLEB 3TEGA 3ZT1A 4FF2A 3EGVA 1U2CA 3G6XA 4YDUA 1VBZA 4DU4A 1R27B 3KG1A 3H1VX 4WFYA 3HSCA 3H5UA 4J7CA 2QWPA 2QO3A 3HP6A 3M8QA 1V9OA 4ID8A 4KYZA 4B3MJ 1SKWA 2GHPA 2K2PA 1HBOA 2MXYA 1HJOA 4ECSA 4X4QA 2FSKA 3TJ8A 2YNIA 3BDEA 5EGYA 4BWMA 3ISNC 2V6AA 2BM1A 1T7PA 4CIFA 3C19A 1YBAA 1FNOA 1VRTB 4PCQA 5I3QA 4LF4J 2ERRA 1N36K 3ITHB 3HI9A 1X4AA 1YQHA 1LWCB 4P71A 4FBUA 3SFGA 4JK7A 4O3RA 2LXUA 1CXUA 3H5XA 2XGQA 3OFHA 2C3PA 4ECQA 4EI2A 2KRBA 1KFDA 2CZ4A 4DV3J 4OHWA 3LDQA 4RKUC 1B7FA 4ZHRA 3DRRA 5GAGP 4O44A 2RF2B 1G2EA 1YJ9N 3UN5A 4CLPA 1U45A 2AJ0A 1RHJB 2BBEA 5CYQA 4JI3J 3ZNUA 1VSFA 4F50A 3VZHA 4EP5A 2BUNA 2NYHA 2W8KA 4NLRA 1H72C 5CD4H 2QL7B 2N82B 4X62J 3IAS9 4DU1A 2ZJRQ 1I1GA 3MXMA 4X65F 2C28A 1NDPA 3FZBA 4PWDA 1BUPA 1JLFA 1Y00A 5IC4B 4OV1A 3HSDA 4GKKK 2F9WA 5KG4A 2QA2A 3RSEB 2I38A 2E2OA 3UKUA 1RTHA 1W7AA 5ETPA 3MR3A 1RAOA 4CP5A 4ECUA 4G65A 3C3LA 2VG6A 5ETMA 3VETA 3KJNB 4AE5A 1IKWA 4LF6F 2W4CA 1U6ZA 3CDWA 3TSUA 4B3SF 2D0OA 1LK7A 3AVFA 1EHWA 1TVRB 2VBZA 3D2WA 4KJIA 4JS5A 1QVFM 3JXOA 2PI5A 5SZTA 2R7SA 4OX9K 1RDWX 4FWSA 3CNQP 2HBRB 3HOTA 3U9DA 3LDNA 1FEHA 3FJ2A 2G0IA 4F4YA 4MIWA 1QSSA 4RNNA 4QOTA 1YVNA 3AO1A 2J5AA 5EX5A 2UV8A 3WQTA 4TN2A 4ZKAA 3NGRA 4WIIA 3NDKA 3W5XA 3AV9A 4NLUA 5JVGL 2ZH2A 4K8ZA 1Q5VA 4NXMK 4E7JA 3DLHA 4NB4A 2UYTA 4CJTA 4J90A 2B9XA 4JD2A 5KFVA 2F7VA 5GMEA 5GADP 4I6WA 2VV5A 1N0VC 4PYAA 2EFQA 1GAOA 3VCDA 1IR2A 2F5GA 3BN4A 2RQCA 3K7RA 2LA6A 1RWXB 2W9AA 2FHKA 3C16B 4BQLA 2KN4A 2BH1A 1XHZA 1XWLA 1QQCA 3P5JA 2H54B 5CZ1A 4ZCMA 4DFJA 4K25A 2DXFA 1FJGJ 4WYBA 5IT9U 3D3BJ 4DV6J 1JJ2M 4RCHA 2V2QA 4F3QA 4DV0F 2CPIA 3MMAB 1YHQS 4RU2A 1PSDA 2ZZNA 4J9MA 1B4SA 4KRWA 3VGVA 2RU3A 3L09A 4NRUA 3H8YA 2MHEA 4CZGA 1YJVA 1CPZA 1XUPO 2Z1JA 4FLYA 4P72A 4JI5K 4O8UA 2HLTA 4OZ5A 3IAYA 2V4JB 5AQPA 1FNMA 3R1HA 4FK4A 3ET6B 4ELUA 2KVIA 5KFLA 2Y1JA 2P9LB 1I51B 2X3GA 4URGA 1V5VA 4XPCA 4DQ8A 1RDCA 2O8DA 1U25A 3O9UA 3OVNA 1YAGA 2JFKA 1EARA 2UUWA 2YY3A 1N34K 5T41A 5A8RB 2RILA 2GW8A 2FC0A 4FNHA 3MEDB 4OFZA 4ZTJA 3EZOA 3W9JA 2OPPA 4ER8A 1TK8A 3AH6A 3TX8A 3N6LA 4MKBA 2OCEA 4H5NA 3QIPB 2LECA 2CGJA 3I9ZA 4I56A 1SC1B 2BE2A 2OPRA 1NK7A 2UU9F 5M1QA 1F3VA 3PO5A 2QMUB 3LGHA 1LCUA 4CGGA 4P2MA 3AO5A 4UOFA 3MM8A 2QL9B 2E6MA 5FD1A 2DEIA 4B8AB 2BJ7A 1RTIB 3JQKA 2JEFA 2BRLA 3OVBA 2ROEA 1RBRA 4RX6A 3ILOA 2HNDA 3POTA 1WOPA 4O23A 5JS2A 2YNHB 4CH1A 2EK1A 2C22A 4MT1A 1SXLA 2FVCA 4OJ3A 2E5LJ 1FESA 5LT5A 4CLSA 1ZM9A 1FWPA 2DNNA 2R2SA 2HRYA 3ZZYA 1NGIA 1NWKA 5ADZA 2FHOB 4IJAA 2BKNA 3MX5A 4OPJA 3C15A 3BGRB 4ZVHA 2D3UA 2ASYA 1NGAA 4J9VA 2XG8A 3MPWA 3M3ZA 1SH3A 3FSIA 3FZFA 3BSAA 4YR2A 1FKPA 5HRRA 5D78A 3IG1A 3NMUA 1ZAWA 2B4OA 1C1CB 5DLFA 5EWEA 2QYCA 5IT0A 2AD9A 4PPZA 4DS5A 3KNAA 4FVCA 5DQHA 1X5TA 4IDHA 2O3DA 4TY8B 4OPHA 2DFEA 1U1KA 4CZFA 4OZ0A 1XC3A 1H2VZ 5D3GB 2PE8A 1CULA 4USUA 4K5RA 5HMXA 1NGBA 4NLWA 2WVEA 3TSPA 1Y10A 1SH2A 1GLBG 4YQWA 4PABA 2AYMA 5F0XA 4AUKA 1K0VA 2QKBA 3ENBA 4JI4F 3W60A 5KFBA 2CADA 2JHEA 4OKEA 3T7ZA 2GAHC 1CJTB 2KJVA 1CS4B 3E9LA 3WXIA 1QY7A 4KV8B 4Q2MA 5K20B 4HT7A 4CLZA 2P8IA 3MCNA 4O0IA 3M4XA 3TR5A 5AFUH 3OL9A 1YX2A 1B3TA 5DMRA 3O3GA 1ZPVA 2XQCA 4X4TA 1HNXK 1TL1B 1OS5A 2A6MA 5AQXA 4AH9A 3VQ5A 1F0XA 4TY9A 3P4UB 4H4KC 4IR9A 3UNYA 1NK0A 1Y0HA 1RWMB 3A13A 5KFFA 4UQGA 2N4CA 2R7RA 2N4DA 3FRZA 2DBBA 3AXMA 4FS2A 1XMOJ 4DV4K 1XN9A 2X74A 5KG3A 4E2FB 1HQ2A 3GZ7A 3KYLA 2CG8A 2NYIA 1RDUA 4H0YB 5BXIA 4CT8A 4DV1J 4M45A 4LT6A 2DR5A 1P8GA 3TP2A 3PVXA 1G4CA 1ZS6A 5KFHA 4OL8A 2HBYB 2G8VA 1WDTA 3THWA 3GCXP 4O0JA 1Y9OA 1YRUA 5H9FK 3ATUA 4CECA 4IH6A 1OY6A 3KFWX 1Y97A 3OS1A 1RT1B 2OGUA 2HZVA 1VHIA 4DR2K 2KXNB 2O5DA 3UCZP 2ZD1A 2Q79A 1HNIB 4ZN1A 4DUYF 3GG1A 1IBLF 4DR6J 4BRCA 1ITPA 3OTCA 2VBYA 3CCSS 3NGIA 3FCWA 1OO0B 5L1JA 1BD6A 5IQ6A 3MCMA 1MG7A 1HLWA 4CGDA 4CEOA 4USJC 4K4TA 2D0PA 3QDKA 1RCXB 5DLGA 3QNOA 1Z6RA 4U95A 2FVSA 1SJQA 1GLCG 2UUBK 3TUPA 1MWMA 1VQKN 1YT3A 3FCHA 4PUOA 3RW6A 2WVDA 3IRXA 3SJJA 2ZNZA 1U0HB 1IM6A 1GXLA 3RAMA 2NXEA 4OI4A 2J9DE 3CJ8A 1WBDA 1XNRK 2KKHA 2GCFA 4NA1A 4KGZB 4GVBB 4DFPA 4KT0C 3MOJB 4HUFA 4OMFG 4CEBA 1S1TA 3EJMA 5ETQA 1C0FA 5E84A 3D4JA 4ZVFA 3HCXA 4PAAA 1HYZA 2IVFB 4A47A 2V9WA 1N8RT 3E01A 2VG5A 2OH2A 4QIWD 4DG1B 2J0XA 2JZ5A 2LDYA 2VPWB 4RWXA 1JLCA 3EWGA 2ZUAA 2M4MA 4DPTA 4RLEA 2GWKA 5AE2A 2CQ1A 2P9EA 3DYAA 2RVJA 4KHPF 3ZTRA 1VQ9N 3ULEA 3RRGA 2GVDB 4KREA 4LF9J 2QA4S 2P5GA 5AE3A 1H7XA 1NK4A 2HFOA 1N5YA 1GOBA 3DLGA 3O44A 1T9YA 3DOMB 3M8RA 4CW7B 1IBKK 1N88A 3LZIA 5HLFB 1UWAA 4RW4B 4IR1A 5KG1A 2C3YA 1FT8A 2HNYB 3NGTA 4JRQA 1RFQA 3BH6B 1HQEA 3E51A 1P6TA 2CAJA 3FNNA 1OH8A 4FJHA 2OPQA 4X4PA 3TA1A 4ETZA 5K14A 4MKYA 4IQXA 4J2AA 4Q2LA 4H0VB 4K8RA 1Q16B 4MFBA 1YITS 3DHWC 3L3VA 4ZVUB 3E3XA 3AXKA 4F0KA 1BQXA 3HJVA 1FD8A 1FTCA 2V94A 3D28A 2RS2A 1NPKA 1Y3JA 2Q3SA 4XPEA 1RHUB 3VTHA 2BJ9A 1U8SA 3CFPA 2QN6B 1J5EJ 2UUAF 4AL5A 5D6GA 2Z1GA 2DHAA 3PCOB 4BC5A 3GV5B 3RMCA 4FW2A 4KAZA 2Q31A 3K5MA 3RR8A 4QIVA 4HI1A 1PBUA 1GMWD 1TUGB 2QTWA 4USHA 1X0PA 4UOHA 1RDDA 4Y2AA 4QW9A 1RCOB 3FCVA 1MWZA 2LXIA 3MXHP 4JI6F 4KY3A 4IFVA 3NWRA 3AVJA 2BW7A 5DK5A 4BR4A 2NLXA 2RUGA 3CCVN 3PKYA 3EX7B 3IR5B 2K1RB 2KB2A 2DR8A 4LUBA 3ZTSA 2YX1A 2RRAA 1KTVA 3R7BB 4MQ3A 1ZXOA 5F1XA 4YFUA 2W01A 1F3FA 4DL4A 3IA0A 3N5FA 2CPDA 1WB9A 1HBNB 3R5CA 2XGPA 3OVSA 4BR2A 1HR0K 4LMZA 2PMHA 4BRFA 1RJJA 2D9OA 2ZBPA 4NLQA 1NNDA 2VQFF 3BS9A 5AXKA 2R3VA 4OHVA 1S9GB 4A8MP 3V1RA 2R8JA 4I64A 3EZ5A 4LH5A 2LYVA 3SUPA 3KXDA 2CPJA 1HMVB 3CJKB 1VS3A 4JN4A 4WFAL 4CZIA 1RAAB 1Y5NB 3M2VA 3QSYB 2V2KA 3UVJA 4OYPA 3V5RA 5C2GA 1KAZA 3HD2A 3S3MA 3KVGA 2WVCA 1OYEA 1NPRA 4EZ6A 4OHYA 4E19A 2UXBJ 1S9EB 2DGSA 3I55S 2XY8A 4CFDA 3MN5A 3RYLA 4JI1J 4FXWA 3OA9A 2Q0UA 3LUYA 2D9PA 2E20A 3HHLB 1ROFA 4Z0UA 5F41A 3IMQJ 3DRYA 2OP5A 1JLAA 3KK2B 2UXCJ 5DRKA 2QXFA 3D3CJ 3A3PB 3LP2A 3HVAA 1VSKA 3MPVA 2ADCA 1N4LA 2F4VJ 5J2PA 3WC0A 1REGX 4KRFA 4K50A 1G7CB 2MKYA 4YHHJ 1UWBA 1X4GA 1YJWN 3SSRA 1X4EA 5B0AA 1VQ6S 1FTRA 3I0SA 1Z05A 1QHAA 1LNQA 3CXCR 2O8BA 4KTZA 4CZLA 3O8WA 4WK1A 2WB4A 4UF4A 4LC9B 1SBRA 1KVAA 4XDCA 4LFAJ 5F8HA 4E8UA 2A6AA 2VJUA 1YZ6A 3QJPA 4OPKA 3IWNC 1R31A 3HZ6A 2DGTA 2R7TA 1HBMB 4NX9A 1YF5L 4X62F 2BEFA 2WFBA 3AY9A 4HWIA 3CHWA 1HWKA 5EOYA 4FXDA 3DM2A 3KLIB 2WB1D 1J2VA 2IRYA 1S48A 4RW8A 1TAQA 3NCPA 4IRKA 5BN9A 1V6HA 4DR3F 1TUUA 4N8NA 4J91A 4CBUA 4IOCL 3JSMA 4CO0A 4X65K 2F40A 3IUCA 3UI3A 3G6ES 3T1HF 4CH0S 1AT1B 4AL7A 1ULRA 1WSRA 4KKOB 4WFBQ 1CQMA 2L48A 4B17A 1DKGD 4L72B 2MKHA 2QSWA 3O9SA 1R8PA 1BA1A 4C0HA 2WUSA 3TAEA 4MMOA 3KZBA 1S1VB 1SJFA 2AYBA 3VEOA 3DGVA 3VWSA 1B99A 4LF6K 3CCEN 2BOAA 1XMQJ 1VSIA 4J37A 3RRKA 3B54A 1VQLN 2OD6A 4EEYA 1C0TB 3MEGA 1VQ5S 1UVLA 3LP0A 4DSKA 3FC9A 3WXLA 4G1IA 3NGYA 1YITN 4DDFA 2JL9A 2ATQA 2XLKA 3GIIA 3A8KA 4H0PA 4EYIB 4E7KA 3PYGA 3HMJG 2PD1A 4WKRA 4WXOA 4ZCIA 2W2PP 1WC3A 1FVSA 1NGGA 4QQBA 2LQ5A 3DJCA 4YOEA 1H3DA 2ZKTA 4CIOA 1VBYA 2I9SA 2HMPA 2A2DA 4JV5J 1DLOA 4FZVA 1FKOB 3WZ0A 3UE2A 3LALA 2D69A 4CBWA 1YZ7A 2CJ9A 1UVIA 4BRQA 3M1VA 3DXMA 1HRHA 1N5QA 3N6NA 1FJGF 2HW3A 4DV6F 4G3IA 4J9SA 3MM9B 5KFUA 3MR7A 5CD4A 5ELZA 5TKWA 1T03A 2DRAA 1YBUA 2HIYA 4YP3A 4K41A 1XMOK 3SV3A 3IRWP 4DN0A 3NBPB 2DRBA 4X4SA 1RSCA 4DV0K 2A1SA 2IMWP 4Z7CA 4B9NA 1AW0A 2ABYA 3Q24A 4DI6A 3CMQA 3QICA 3OHBA 2GFFA 3GYXB 4WE1B 2J9EA 5DZ6A 4OZJA 3QFHA 3Q8RB 4ZVGA 3V9WA 2KFYA 4LY7A 3CCQS 1KVKA 4NYOA 2G2ZA 2CZ9A 2MYFA 4F4XA 4JK9A 1WSEA 3NWGA 1TKDA 1BWFO 2E9ZA 3UCUP 1KC8O 3AHPA 1R6VA 1EO1A 1B7YB 2DTUA 5AJ3J 4ZA1A 1KLMA 1U2VA 3ZSVA 1WKLA 3J7YI 3M8PB 3JSRA 4I0WA 4W5QA 1VGYA 1WF0A 3C6UB 1BMQB 5E3PA 4E7HA 2ZVSA 1C1BA 3SCJE 1NAQA 4HCCA 1DTTB 3C14B 8AT1B 3MR2A 2GQCA 4F25A 1S6OA 3BP8A 4JAXA 5KQ8A 4FJJA 1MROB 4TXSA 5B0GA 1Q82T 3ASMA 1YJ7A 4F0MA 3UCGA 1IG8A 1BU6O 2KHCA 3TTDA 4CEFA 1RILA 4CJVA 3HOSA 3D9BA 3IBCB 4BR7A 3MEEA 3GJRB 3D0HE 3CD5A 2BXJA 3GONA 3HFVA 2FSJA 3SCXA 1SL0A 2JVRA 3NS6A 2FIUA 4MJKA 2ZJRL 3CC7N 2HRUA 1Q86T 4CF9A 1O0PA 3BQ0A 2C2MB 4RW9A 2A1RA 3NGZA 5IM0A 2DNLA 1TK5A 1WSIA 1TFYA 3CJBA 1WC4A 1HNVA 3MAHA 4Y65A 2AZ3A 4KB1A 1TUYA 2CQ4A 3OR1B 4H8KA 3R2CJ 4ZP7A 2QT7A 2FJEB 3KHYA 1KQFB 2CZVC 4DR1J 1T9VA 3CDEA 3FRYA 1S1UA 1JCFA 1WKKA 2A2CA 3O5TB 5AQVA 4FP9A 3B8AX 1RT3B 5CY4A 5HVHA 4ICLB 1SUQA 4DX8H 1NK8A 1AA1B 4F3OA 4LF5J 3R3TA 1DY3A 4CVNE 3CB4A 2ITMA 2QA4G 2R7YA 5SUHA 4Z94A 2R42A 2EX3A 1VQMN 4DTPA 1GLAG 1CC7A 3VHQA 2OMOA 4KFBA 1RAIB 4C11A 3UDLA 2HQDA 3BKFA 3OSNA 2RE2A 2JNJA 3KJFB 1Q79A 2YXLA 2BZ2A 1NK9A 1S3XA 3BSOA 4B9LA 4JI4K 3QO9A 1HQUB 4PXCA 2QG9B 3OYGA 3TZZA 4FJKA 1VJQA 2EFVA 3IFRA 2B4PA 2CPFA 2KG1A 3BGUA 3ISND 4JI7J 2UUTA 1EP4B 3M2RB 5DG9A 2MB0B 5JJBA 2UZAA 1UOCA 1K73O 3CJAA 3TANA 3Q86A 3QT8A 4CLYA 1UAWA 3NCQA 2IRUA 1LWFB 3T1AA 3OD2A 2WK4A 4MDAA 3KHGA 4QU6A 2C2DA 3HFZB 4CJ5A 4ED1A 4C1NI 5AQJA 3SAHA 1QZ5A 1SC4B 2QYGA 1VQ7S 1JLEA 2M9KA 4UZCA 1C0GA 3CW2C 4FF1A 1X4DA 3M32A 4M5DB 4FJMA 4OJRA 2BANA 4CJ7A 3W2VB 1D8YA 2D7SA 4J2EA 1RZMA 3GWCA 4X66K 2YI1A 1Y11A 2HYIB 2JWLA 3JS6A 1BQNB 1NB2A 4X2BA 1U1QA 4EFHA 1U48A 3LGMA 2HF3A 3M2UA 4OJGA 4YS2A 4NXNF 2ZITA 2HHPA 1QTNB 4DR6F 4KHSA 4W90B 2PYJA 3OBIA 1TU0B 5HP1B 2ADBA 5BREA 2R2UA 4B9MA 4A8QA 2CXEA 4DFMA 5AQFA 2V8VA 2ETJA 4CF8A 2APOA 3TAGA 3U7JA 4DUYK 4G6VB 4KTWA 3AA3A 4BRLA 2V7YA 3CCJS 2ZNYA 3F5TA 2CPYA 1MMLA 5KI6A 1Y5IB 3H6EA 3W2WA 2HIQA 1VSHA 2BE9B 3W9HA 4IOXA 3BGOP 5E0OA 2K3IA 3AQPA 3DDIA 2CYYA 5L8RC 3W0LA 3P45B 1W2BM 2CVIA 3IKMA 5IFMA 5C24A 4HTUA 4OI0A 5E2QA 3UN2A 2HHWA 2P6TA 5AZIB 1FRLA 4QYRA 3TJ9A 3IWXA 5AFUA 3MCAB 4P7VA 3HFKA 4QPTA 3AB2B 2G13A 3HD1A 3BBFA 1K8KB 3CJ1A 4QZVB 1U7LA 3I31A 3NOGA 2B6AA 3TZYA 1M1KO 3KLFA 2OEMA 3AVKA 4EHTA 3PW5A 2ZGZA 5KFPA 2LSNA 5HL7Q 2FJWA 3AVIA 3EGZA 2AJQA 5CQGA 1XERA 1JKHB 2DPJA 4BRMA 2IJNA 3SQ1A 2RNEA 1LXJA 2EKYA 4WK3A 2KW4A 2HS3A 3L4QA 2YQ3A 2VFUA 4LF9F 3EDQB 1NU0A 4ERDA 1F1BB 4EU0A 5FLXU 3NG8A 2FPHX 4KH1B 3HSJA 5CH7B 3HZEA 4JKGB 1AFIA 5LXYA 3CE8A 3GL1A 3X3UA 1QAJA 4W4MA 3WEEB 5GAEP 2WBNA 2NPIA 4B08A 4CD1A 1YKWA 4DV7J 3U4LA 1FW6A 1RHRB 3CUNA 1NGEA 2FBXA 5KFMA 4RG8A 2DGQA 1QDUB 2FBYA 3AGKA 4LRBA 1F9EB 1P9YA 7FDRA 4C6AA 2OSQA 3I0RA 4DMZA 1IJEB 4J5OA 3MM7A 2MGZB 3LP1A 1K9MO 4UOCA 3BBBA 4BCAA 3D0IE 2RJZA 2LQ9A 1ATSA 3O3HA 2O8CA 5DQGA 1FKAF 3KMQA 3J80Y 4LFBF 1YTAA 2CUYA 1A9NB 3N5BA 1V3ZA 1J5EF 1N33F 4EWTA 4OI3A 2YX4A 3D67A 5EWGA 1T05A 1OSCA 5FRNA 2R7VA 3NCIA 5CZVA 2PY5A 1S97A 1VK8A 3DLLL 3V81B 3VALA 1GXUA 1QQNA 3PNIA 2X51A 2YKNB 3H0PA 2FJXA 1VRUA 4R5PA 1RADB 4OGCA 2LA4A 4O4RA 1RNHA 3M9NB 1QVGM 5KPRA 2BJ3A 2VGMA 4KGVB 3ELHA 2A42A 2ZHAA 1XMQK 2O1PA 3TR8A 5AT1B 3H25A 2IVYA 4IO1A 3T1YF 4CLTA 3T5LA 3THXB 2Y0SD 2DRDA 2MQPA 1OPIA 5KFQA 4B3TF 4EUVA 4RW6A 3OFEA 3QGGA 4ID5B 4URQU 3M9OB 4LF8K 4BQZA 5IS2A 4Y6IA 4BDPA 4YR0A 1RTZA 2H5IB 3NNAA 3VQ8A 4E7IA 3MUVP 1K8AT 5ETLA 3FZLA 1U49A 3MD1A 3T6JA 1WTBA 2CPHA 3J81Y 3DXKB 1GMVA 3HSTB 2P5VA 4FF4A 3J7ZT 2NRTA 5L46A 2BE7D 2GAGC 3VMFB 3OYBA 2R7UA 4KHWA 1HHQA 1F2HA 2FXUA 5D0HA 2ZJPL 3EKUA 3OLBA 3CC2S 1VQ7N 1J27A 3OTOF 3BSNA 9RUBA 5LMNF 5KFZA 1TKZB 2I7PA 1S6QB 3ZZOA 5AQOA 3KLGA 1S1XA 3IP0A 1FDAA 3NGKA 1ZC6A 5GINA 3E9OA 1JL1A 1FK9A 2D3O1 2CPEA 4ZP8A 1SV5B 1PCAA 2B4JA 2ILZA 4L8RB 3CCLS 2UXBF 5I3UB 4GKJJ 3BO4A 3R6LB