1C0TA

Crystal structure of hiv-1 reverse transcriptase in complex with bm+21.1326
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
536
structure length
490
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTGKISNPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
total genus 133
structure length 490
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c0tA05
4ECSA 1C0MA 2HWHA 1NKEA 4IG3A 1TQLA 3BSNA 4J9LA 2HHUA 3ZT4A 4DG1B 2B43A 1XR6A 1N5YB 1BQMA 4FM1A 4NRTA 3DMJB 1GOAA 3L2VA 2VWKA 4RW7A 3HPGA 4F4YA 4ED1A 3PW7A 3LWLA 4IG0A 3PW4A 2Z1JA 3OYKA 2UUWA 4BDZA 4WFZA 5F9LA 2HW3A 4KB1A 5FDLA 3QINA 4IKFA 5F8IA 2XY7A 1BIZA 1EX4A 4KHQA 1RBTA 2XCAA 4NLSA 5KFVA 4RUAA 1C0UA 2IA6A 3RBDA 3CYMA 5DGAA 4IRCA 1RTJA 1IH7A 2VA3A 2W9AA 2V4QA 2V9WA 4J9PA 4FJIA 1QAJA 1RBSA 2GC8A 1SH0A 3HL8A 2HNDB 1WSFA 3L2QA 3B6PA 1SV5A 4O3QA 3RB0A 1VSEA 3SQ4A 2HAIA 1HPZB 4ZHRA 4KAZA 1NK4A 4OPKA 4ECWA 3PX4A 3C94A 3V9UA 5KFFA 4Y2AA 1Z26A 1SH2A 3K58A 4MK9A 2EHGA 3ZSXA 4C8OA 2B6AA 1X1PA 4PWDA 1S4FA 4DTSA 4LSLA 3DRRB 4U7CA 3HPOA 4LSNA 1JXBA 3NGZA 2IJNA 2FVSA 3QIPB 2YKMB 2VG7B 3V4IA 3VQ4A 5J2MB 1N48A 1WSIA 3MR6A 3SFUA 4EYHB 1HQEA 1VRTA 1LWCB 2OA8A 3G6YA 3NL0A 5KFQA 1WSEA 1LW0B 2W9BB 3FDSA 4CGIA 1S9FA 1C1AA 1WSHA 4DQSA 2W7OA 2IM2A 5C5JA 4DL2A 4G1QA 4CJQA 4M3WA 3DM2A 1MMLA 1RT6A 3OL6A 3HYFA 4FM2A 4KV8B 1RDRA 4J2BA 1WAFA 3HK2A 3MECA 3RAXA 4ECXA 4J9SA 3AA4A 3KHHA 3SQ1A 1UA0A 4CFAA 2YNGA 3OYMA 4AILC 2D7SA 1S6PB 4DMNA 2FLLA 5CYMA 1LWEB 2OPRA 1KHVA 4CHZA 1B9FA 3MEDB 2YNHB 4CFBA 4M3TA 3LANA 4ZPAA 3C6UA 5KT3A 3E01A 4J2AA 1LW2B 4RNOA 4CEBA 2HWIA 4QOZB 1BHLA 4CK3A 3V6HA 4H4OB 3NE6A 1DTTA 2YKNB 4KKOA 1RT1B 1TKXA 3GIKA 5KT7A 1BI4A 1I6JA 3ZSRA 1TL3B 5F8NA 3E01B 2DY4A 1TAQA 4H8KA 3AVBA 3QEIA 1R0AA 4AHRA 3GV8B 3KOAA 1RDAA 3LZJA 3KLIB 1JLGB 3ALYA 3MEEA 1XI1A 3RR7A 4KTWA 2B4JA 5I42A 2ZD1A 3V4IB 3QIDA 2EC0A 1L3UA 3I0SA 4NYZA 1QSSA 2BRKA 2W9CA 2G8FA 5EDWA 5KT2A 4HKQA 3TVKA 3I5AA 1JLFB 2AGPA 2ZD1B 4KB7A 4O3PA 4EZ6A 4FJ9A 4B3OA 1EP4A 4IH7A 4ECUA 3MEGB 4CF1A 1XHZA 3D28A 1D9DA 1VK0A 1QSYA 3U3GA 4YR0A 5KG0A 1ZTTA 3VN5A 3SV3A 1C1CA 2FBTA 2BQUA 3TARA 2R8IA 1JL2A 4DS4A 3NMAA 1J54A 3O3HA 3RWUA 4ZPBA 3DI6B 3DLKA 3EZUA 4CJRA 5HBMB 3V81A 2C22A 3HPHA 3UDLA 3FFIB 5CYMB 2HHWA 1RT6B 2I5JA 4NLUA 1L5UA 1S1TA 4Q43A 1S1VB 2E6MA 4DQPA 3PR5B 2PZSA 5DGBA 1IKYB 2YKNA 5DK5A 5KT5A 1KVBA 3SV4A 3MEDA 4ZVFA 3PW2A 3I0RA 3QNOA 4DFJA 1IKWA 1CZBA 3NF6A 4DF4A 2AJQA 1R0AB 4DS5A 4FJJA 3OJSA 4ZP7A 1C0TB 4IG0B 4TY8A 1DTTB 1LAVA 4O4GB 1IG9A 2IC3A 3JYTB 3TABA 2FLPA 5KFYA 4KO0B 4OGCA 3L3VA 5HRSA 2OYQA 4Z4CA 4FLUA 4TYBA 3OHAA 5L1IA 2P5GA 1SKRA 2E6LA 4FK2A 4Q8EA 4B3OB 4WFYA 2IAJA 5KFZA 4QWAA 2ATQA 2D0CA 4KI4A 4C8MA 4NLRA 2WONA 1XR7A 3CJ5A 5KT4A 1N6QB 1JXLA 5KFEA 3MR2A 2IBKA 1HQUB 4CJKA 4NLPA 4TQSA 4IDKA 3V6KA 1YTUA 1S1WB 5E41A 2FJWA 2ATLA 1KFSA 2RF2A 3QEVA 1JX4A 4ZP9A 3TANA 1TV6A 1S48A 3UIQA 3SUPA 4DTPA 2PYJA 3OY9A 3AVJA 4FJXA 3OS1A 4OL8A 1WAJA 4O55A 4YNQA 3KD1E 4IOBA 1WN7A 5FRMA 2F8TA 5FROA 2ILYA 4HVJA 1A5VA 1EKEA 2BGGA 4I7FB 4C8NA 3PX0A 3NBPB 4H4MA 3GIJA 2X6NA 1JL1A 3THVA 4Q8FA 3JSMB 1XC9A 3QZ8A 4DL6A 3RTVA 5C25A 4IBNA 5HP1A 2JEJA 1O1WA 4TN2A 3T5LA 2F8SA 4RW8B 1NHVA 4O4GA 1BCOA 1SL1A 3SNNA 4URGA 2B5JA 1FK9B 3DM2B 3UPFA 3SQ2A 2FVRA 1Z4UA 2AX1A 4W5NA 4NLTA 1WNEA 1HYVA 1SUQB 3IGVA 3KLEB 1U49A 4QWDA 4YP3A 4Q5VA 1RT7B 1VSLA 3ISNC 2D41A 4FZXC 5KFNA 4CHNA 3TAPA 2G8KA 2HHTA 1VSJA 1D9FA 1LW2A 1S6QA 4FS1A 4N41A 4KREA 4ZVHA 4EBCA 1BQNA 5KFOA 4YMEA 4QWBA 1RT4B 4URQU 3VQEA 4CF8A 1N6QA 3NAHA 3VA0A 3BQ2A 1S1UB 4ED0A 2UVWA 3MXIA 2YNHA 2OH2A 3PW5A 4TLRA 4KKOB 4BWJA 3KK3A 3HVTA 4RUCA 2A1RA 5KFRA 1QE1B 3SI6A 3DOKA 1RT1A 3PJWA 2B6AB 3BSOA 4QCLA 4CEAA 4CJWA 5KFCA 5F8GA 1C6VA 2D0BA 3AVNA 4I9QA 4K4TA 1TL1A 4FS2A 3I5CA 1RDCA 4MFBA 4DL5A 3MXMA 3OYNA 3CIZA 3KLGB 2HVIA 4O4RA 3OLAA 2JEFA 4DTNA 1VRTB 2NUBA 3AO4A 4N76A 4K4SA 1DLOA 1T3NA 4F2SA 4CECA 5J1EA 3CJ0A 4FLVA 3M9OB 2WHOA 2ASLA 3JSMA 3H5YA 1C1BA 3ITHB 4Q44A 1EP4B 3RB3A 3AO5A 4DL7A 3KLFB 3U6FA 3RAQA 1QSLA 1ZTWA 5KGXA 1X9MA 5JS2A 2DPIA 4KHSA 4RW6A 5L1JA 4M94A 1JLBB 2FLNA 2VG6A 3QO9A 4F4ZA 3GQCA 4K4ZA 3V81B 4QWCA 2HNZA 3RBEA 1C1CB 3CDUA 1S0OA 1T05A 4H4OA 1VSHA 1RA7A 2Y1IA 3H98A 4G3IA 1KLNA 4ELVA 2R8HA 1TKZA 4AH9A 1IM4A 4MK7A 3GIIA 3CFRA 3LP0A 4O5BA 1S1VA 2ZE2B 1NK9A 3U3YA 4CFCA 3OYAA 3HVWA 1S5JA 1KLMB 1S1XA 1GOBA 3RMDA 4RG8A 3BJYA 1IKWB 1QHTA 1TKZB 1UA1A 3OYLA 3LWMA 4KHNA 5KFPA 4EBEA 3DOKB 2HMIB 1JLCA 2KQ2A 4LQ9A 4K4XA 3N6LA 4NCBA 1JLQA 4CJUA 2WRMA 5L1KA 4AHUA 3KD5E 5L9XA 2X6SA 4TSXA 4DTJA 3FQLA 3MEGA 2XY6A 3ZT3A 1NKCA 2XGPA 3DRRA 1LV5A 3DLEB 2W8LA 4CGHA 4W5OA 4MK8A 3KIOA 4IRKA 4FLTA 3GV7B 1NJYA 3H5UA 4E0DA 3OL7A 2OPQB 4E7LA 1TAUA 3CWJA 4NLOA 3OS2A 1BIUA 4DWIA 4CE9A 4RW4B 4FM0A 1HQUA 5EWFA 2JC0A 3DLEA 4ICLA 3VQAA 4CHPA 3ITHA 4MH8A 5C42B 4EP5A 4RNMA 3G10A 2C28A 2YKMA 1UWBB 2ETJA 3OVNA 3H08A 4HUFA 3ZSYA 4OGEA 1T8EA 1WNSA 1CXQA 1RT3A 4FW2A 2W7PA 1Y97A 4Q0BB 3DYAB 2P51A 1TKTA 1TV6B 3OYGA 4J9MA 4DSJA 1RTDB 2QE5A 4E7JA 1GX5A 4CF2A 3KHGA 2JEGA 3NKYA 4R5PA 5J2QA 2DFFA 1U4BA 1RT3B 5T14A 4ZPDA 1CZ9A 3T19A 4DSKA 2UVUA 1RT2B 4CEEA 1HRHA 1U04A 3SUQA 4O3OA 5SWMA 3NBPA 4RW8A 4CEFA 3MF5A 1U47A 1T03B 1ZBUA 3N6MA 3C6TA 4FZYA 5T7BA 3QEWA 3SYZA 2P5OA 4FJNA 1SKSA 1J5OA 4KO0A 4CJTA 1S97A 2KZZA 3HP9A 2C2DA 4J9OA 4ECQA 1C2PA 4ED3A 4FJ7A 2HVHA 2YNFB 2JC1A 3Q8SB 3PUFA 2ZQBA 4NZ0A 3QESA 1BISA 1TK5A 3AA3A 4QAGA 1S49A 4ED6A 5KFBA 3ZT0A 4KTZA 1SL0A 2RPIA 1DTQA 3PY8A 1RTJB 1NJWA 4FZZA 1UAXA 1TKXB 3PR4A 3DLBA 4JUZA 1FKPA 1B92A 2XC9A 1ITGA 4F2RA 1LWFB 1RAJA 2HNYB 3ZSVA 2QV6A 3AVAA 1L3SA 2IS3A 1RA6A 3V9XA 4KHRA 3LP2B 4B9LA 4DF8A 3ISND 1D0EA 4CGJA 2ASJA 3UQSA 1X9WA 4WXOA 4LD0A 1RTIA 5HRPA 2O4IA 1D1UA 5KFGA 3RMBA 4JV1A 4OKKA 3NGYA 1Q9XA 4LH5A 4Q0BA 4KTQA 4NLYA 4O3SA 4ECVA 1QAIA 1CSJA 2VG7A 5K14B 3PV8A 3G6VA 3NAEA 1RTDA 4IRDA 4NYNA 2XI2A 4CJ5A 3PVXA 3EYZA 4E89A 2DFEA 4YR2A 3DMJA 3H5SA 3GILA 1T7PA 4B9VA 4Y3CA 3O4QA 2FVCA 4K4UA 3MFHA 2A1SA 3S3OA 4CIGA 4E7KA 2AX0A 5KG2A 4O3NA 3TAMA 1LW0A 4B9UA 1KTQA 3FFIA 4FVMA 3MR5A 5DQIA 1ASVA 1WSJA 1JIHA 3M8QB 4EP4A 3BSCA 3FSIA 5KFJA 2VA2A 1D5AA 4KHUA 1EETA 1BQNB 2F8EX 1KHWA 2OPPA 4FJ5A 2RDIA 4E7IA 3D5MA 5KFKA 3K5NA 3VA3A 4F8RA 2HNDA 4DLEA 3KHLA 4LH4A 3M8PA 2R2UA 4CJFA 1HYSA 4GC6A 2FJXA 4MIAA 2V4RA 4CEZA 3NHGA 4J2EA 2O5DA 4CGDA 5F8LA 4Z4IA 1X9SA 2AWZA 4YFUA 1RNHA 5KTQA 4NLQA 3T3FA 5F8JA 3AVGA 2JGUA 4BDYA 3AA2A 4PWDB 1DTQB 3P1GA 3KLVA 5KI6A 2Z1HA 4E7HA 4ECYA 3QIPA 4Y1CA 4L8RB 1NJXA 5DLGA 3QGHA 4LSNB 4NLWA 2YV0X 3PHEA 4TYAA 4DQQA 1HQEB 4NCGB 1OS5A 3S3MA 2G8WA 4MFBB 3OL8A 3HVRA 1GOCA 4BWMA 3L2UA 2F96A 4FXDA 1REVB 3NH2A 3WNEA 1W0HA 3Q8QB 3GYNA 4U6PA 3K2PA 3GV5B 3KLFA 4AHTA 4ELTA 4MKAA 5KFUA 4KFBB 4PUOB 2FVPA 4KPYA 3SZ2A 4LQ3A 4MKBA 3NF9A 4RW6B 3SFGA 4M3RA 4DTUA 4DL3A 1RILA 5KFIA 3M8RA 3QEXA 5EWEA 4K50A 4B9TA 2FBXA 4YR3A 1C1BB 1T05B 4HYKA 1SKWA 1S1WA 1RBVA 4JS5A 4DQIA 3FQKA 4KV8A 3KMQA 4CJVA 4B9MA 5D3GB 4CCHA 4EO8A 4WXWA 1HMVB 3MXJA 4GMJB 1IO2A 4Z4FA 3MFIA 3DYAA 1J53A 5JUMA 3M8QA 3TAGA 1TGOA 4CESA 4GW6A 3VQ6A 3HXMA 3DOLA 1ZBHA 1FXXA 2DFHA 1NJZA 3TAFA 4RU9A 4DFMA 2E9ZA 3SUOA 1Q9YA 2XGQA 3LP3A 5KFLA 1RT7A 1NOYA 2HHQA 4IFVA 1S1UA 1CLQA 4FBTA 1FK9A 2YNIB 1RDDA 1TL3A 2E4LA 4CJSA 2XCPA 3V1OA 3L8BA 2VG5A 1RBUA 4IKAA 4O3RA 4XPCA 2IM3A 2UVRA 1HNVA 2Y1JA 5DQGA 1SV5B 3RRGA 4K4VA 4J2DA 1YTAA 1IKXA 2ALZA 4B9NA 1NKBA 3I5BA 3LPUA 3SCXA 2KFNA 1HNIA 3O3GA 3TAEA 4QW9A 3ZCMA 3BQ1A 1TP7A 3ZSOA 4H54A 4QWEA 3DRSB 2FC0A 4DTXA 4DFKA 3EPIA 2R7YA 4CIEA 3RR8A 4KBIA 3VQ9A 4OLBA 3BGRB 1VRUB 1LWFA 3K5MA 3L2WA 5HRNA 3L2RA 3V9ZA 3HHKA 3DI6A 3DRSA 4F3TA 4FYDA 2Q3SA 1JKHA 4FK0A 1ZBLA 1RT5A 3C95A 1VSKA 4YQWA 3VQDA 2KW4A 2RF2B 3V9WA 1F21A 2XY5A 4KAIA 3ICLA 4HUEA 1IKVA 4FLWA 4E3SA 3DLKB 1ZBIA 1N5YA 3SPZA 4FK4A 4EO6A 4NRUA 1S10A 4M3YA 5J2NA 4RW7B 3QNNA 3IAYA 5DQHA 4I2PA 5F9NA 4E19A 1HARA 1RTHB 4NLVA 1SH3A 4PQUA 2D5RA 3HKWA 2ASDA 3KJVA 5J2NB 3WNHA 3IG1B 1C0UB 2J6UA 1T03A 5L1LA 5KGWA 4I2PB 4QPXA 1A5WA 3HM9A 4Y1DA 4LY7A 3HJFA 1S6PA 3DRPA 4FCYA 3F73A 1BL3A 3HT3A 1NK6A 2DPJA 1MU2B 3NGIA 3C6UB 4CJ4A 1KRPA 4ZTFA 1J5OB 4I9LA 2QK9A 4DEZA 4IQXA 1NK8A 1JLEB 3ASMA 2DTUA 1S1XB 2OPPB 4ZHRB 1LWEA 1J9AA 4J9RA 3PO5A 3ZT2A 5KFHA 3LALA 2EX3A 3G0ZA 2BANB 1U45A 3CM6A 3SQ0A 3PJXA 3DLGB 4FLXA 3BDPA 2PY5A 1HYSB 3RMCA 3AA5X 1JLEA 3KLIA 1JLAA 4NLDA 3O4NA 1JLQB 3S3NA 1BI4B 3AVKA 4CJEA 2QKBA 1Q8IA 3HP6A 4ECTA 4EZ9A 3OYFA 4AHSA 4IR1A 4N56A 1RTIB 4ID1A 3WNFA 3D0PA 3AO1A 3T5KA 3LZIA 3Q8RB 1QTMA 4JRPA 4LSLB 2RN2A 1RYRA 2AGOA 4IH6A 4E1NA 5EU7A 3LP2A 3HVTB 4BE0A 3LP1A 4AHVA 1RBRA 5KG3A 2W9CB 4EYIB 1RT5B 3NFAA 1QS4A 5C25B 3G6XA 1S9EB 4O44B 4B9SA 3OS0A 4KRFA 4K8XA 3RB4A 1RTHA 4R8UA 5KT6A 5DLFA 4RNNA 4N5SA 4JRQA 4CEOA 2W9BA 2R2RA 4DG1A 4CIFA 3EY1A 5KG5A 3OSPA 3TQ1A 4O0JA 3KJVB 3VQPA 4OPJA 4FJGA 3HO1A 3RB6A 1WSGA 2KFZA 3CDEA 3NAIA 5KFWA 3QGGA 2RKIA 3SI8A 4JV2A 3T5JA 4KFBA 4PUOA 3DRPB 3MR3A 3VQBA 3KKRA 3S9HA 4WYLA 4I2QB 1S1TB 3LAKA 1NK7A 5DG7A 3I8DA 3OYIA 3P5JA 3GIMA 4Z4HA 2AU0A 3HSTB 4CHQA 3KK1A 2ZKUA 4CGGA 2BDPA 1HMVA 3ULDA 4RW9B 4DSIA 3KLEA 4NCAA 2VG6B 4ZVEA 4M3XA 3CFPA 4W5TA 3AO3A 4ED8A 3QGIA 3VQ5A 1KCFA 3PX6A 2R2SA 1W25A 4WYWA 4CK1A 2JLEA 1RT2A 3KK3B 2BRLA 4RNHA 3H40A 2IC3B 3JYTA 2C2RA 5CYQB 3VQCA 3G86A 4NCGA 4CHOA 4CEQA 1C0TA 4TY8B 1JLGA 1XHXA 3SUNA 1HPZA 3AVCA 3QLHB 3DLRA 3LAMA 1B9DA 4M45A 3TR8A 2UVVA 4TY9A 3AVMA 4XO0A 3V6DB 2YNIA 2CKWA 3L3UA 3NH1A 3TAQA 3AO2A 2IOCA 3B6OA 1JLCB 4WZQA 4N47A 3FRZA 3V1QA 2V0NA 1S9GA 1JLFA 3HVAA 5EUHA 4DLGA 4C8LA 5KG6A 4CERA 2XWYA 4JV0A 2XRIA 5C24A 4ID5B 3TI0A 1VSIA 3M9NB 3CDWA 4M95A 5D3GA 4DTOA 2CJQA 2BE2B 2QKKA 1FKPB 3CFOA 2KZMA 4GC7A 3MECB 3Q8PB 2HNZB 4ID5A 3CO9A 4EEYA 1TK0A 2R8GA 2XHBA 1NOZA 4J9KA 2YNGB 5HBMA 2IM1A 3TAMB 3KK1B 2WB4A 5KFTA 2OPRB 4OLAA 4FJLA 2I5JB 3H5XA 3QO9B 2RDJA 1JKHB 5JXSA 2ZE2A 3T1AA 1YVUA 3KLHA 1T94A 2FJVA 4URSA 3QEPA 1K6YA 4OJRA 1YT3A 1GX6A 1EETB 2J6TA 4DTRA 4H4MB 1KLMA 1L3VA 4FLYA 4Z0UA 4IFVB 5I3UA 4PQUB 1I3AA 1LAWA 4FBUA 1QUVA 3QETA 1BQMB 1EXQA 4FJKA 4CEDA 2BR0A 3IS9B 1UOCA 2E9RX 3E51A 4OKJA 4TXSA 4WZMA 3MAQA 5J2PA 4IG3B 3AVLA 4NYFA 5KRSA 5CY4A 1IKXB 4J9NA 2HHSA 3RMAA 5CYQA 5KFDA 1SUQA 5HLFB 4Z4GA 3IG1A 1KFDA 3M8PB 2D3ZA 3KNAA 2FBYA 4BDPA 1KVCA 4CJLA 3OYCA 4CJPA 1RYSA 4GVMA 1BGXT 3SPYA 1JXEA 5F8MA 2BANA 2IAJB 3BR9A 3ZSZA 4CF0A 1G15A 3KMSA 2OPQA 3AVIA 4F3OA 1U09A 3CM5A 5EWGA 5KFSA 4WFXA 3OYBA 1RT4A 4ED7A 4HUGA 3P83D 3OJUA 3DLGA 3UR0A 2XI3A 4NLXA 4DSEA 5I42B 3KKSA 4Y34A 1FKOB 2R8KA 5C42A 4KB0A 4K8ZA 3QIOA 1KVAA 1TL1B 4X2BA 5KG7A 4M3ZA 3K5LA 1IKVB 2JEIA 1L3TA 1N56A 1TKDA 4PA1A 3AVHA 4CGFA 4BACA 3LP1B 5KG4A 4DQRA 2G8UA 3NCIA 5HP1B 4Q45A 2J6SA 1TKTB 1DLOB 4IH5A 3BQ0A 5KFAA 4FW1A 3QERA 1LWCA 4EBDA 3OYEA 1ZETA 1HJRA 4RZRA 4ZMMA 3T5HA 4E1MA 2YHAA 4QW8A 1K1QA 4B8AB 1N4LA 1YVFA 3IN5A 1XR5A 2HB5A 3H4BA 1S9EA 4O44A 3CQ8A 3DOLB 3CJ2A 3D45A 5K14A 4WE1A 2RKIB 2BQRA 4PY5A 3TWHA 5CZ2A 1HYZA 3QZ7A 1ASWA 4HHTA 5FDLB 3DDKA 4ECZA 5HLFA 1VSMA 3C6TB 4MIBA 5KFMA 2IMWP 2FBVA 4JLHA 4RW9A 2GIRA 2YNFA 3OHBA 4F50A 4CF9A 2VG5B 5F8HA 4B08A 2GIQA 2GUIA 1BCMA 3EZ5A 3LPTA 4M41A 2WOMB 3LDSA 4KSEB 2HMIA 3EPGA 2X74A 2I1RA 3KHRA 1JLAB 5HRRA 3CG7A 4F4KA 5KFXA 3M8SA 4ZPCA 3OL9A 2IJFA 4DU1A 3OYJA 3M9MB 4Y2CA 4B8CA 4KHMA 4DSFA 5CZ1A 4IDKB 1TVRB 1D8YA 2WTFA 1W9HA 3QLHA 2G8HA 1ZYQA 1QQCA 4R8UB 3I0SB 4DFPA 3KTQA 2HNYA 4C8KA 3V6DA 2XO7A 3RRHA 2WONB 4I7FA 5HROB 3WNGA 3O3FA 2PYLA 2OPSA 1NK0A 2GBZA 4DU4A 4W5QA 3A2FA 3IRXB 3QYYA 2KTQA 1TVRA 4F4WA 3V9SA 5JS1A 3PO4A 4ED2A 4DTMA 5KRTA 5HROA 4MQ3A 5FRNA 1S9GB 2ILZA 4RNFA 3VQQA 4DL4A 2HHXA 1VSDA 4ICLB 4WE1B 4KI6A 3OSNA 2B5JB 3MTKA 2Z1IA 2BE2A 3BGRA 2YHBA 1TK8A 4G1QB 3OLBA 3SJJA 3NDKA 3DLHA 4OKEA 2C2EA 4I2QA 3LP0B 4CFDA 4W5RA 3VQ7A 4XIUA 4CHYA 3NGDA 3V6JA 3KK2B 2IDOA 1WLJA 2ITGA 3H59A 3BSAA 5DG8A 4ZTJA 1S6QB 3PZPA 3N6NA 1NK5A 3ZT1A 4M3UA 4K4WA 4UQGA 2GV9A 4HCBA 3AVFA 2D0AA 3K5OA 4ELUA 1VSFA 4IR9A 4KHWA 4CK2A 2IGIA 3CJ4A 5I3UB 1ZBFA 3ZSWA 3I0RB 2OZMA 1CXUA 4Z4EA 2W42A 1XWLA 4M42A 1IKYA 3NF8A 2WOMA 5J2PB 4O0IA 1SL2A 2O4GA 3MEEB 2WK4A 1S0MA 2P1JA 3PW0A 1NHUA 4ECRA 4CJ3A 2R2TA 4DSLA 4IFYB 3K59A 5DG9A 3VQ8A 2IM0A 2LSNA 1ASUA 2BQ3A 4F4XA 2FVQA 2G8VA 4AHCA 4FJ8A 1MU2A 4J9QA 1HNVB 2AGQA 3OYHA 2OPSB 1KSPA 1A5XA 3ZSQA 3H4DA 4RW4A 4NLGA 4IFYA 5C24B 1REVA 1Z25A 2X78A 5SZTA 3VQSA 4JS4A 1UWBA 1S0NA 1QE1A 3OYDA 4BE2A 3CJ3A 3CVKA 3IRXA 4DU3A 1NNDA 3V1RA 2OZSA 4ZVGA 2W8KA 1VRUA 3AV9A 4OVLA 4R0EA 2G8IA 2XY8A 1HNIB 4KHYA 2E9TA 4KE5A 3F9KA 4FLZA 3NF7A 5KG1A 1JLBA 4BE1A 1K1SA 2R8JA 4HCCA 1U48A 2UUTA 3KLHB 2WCXA 4K4YA 3KLGA 3K57A 3KK2A 1I39A 4R5PB 1FKOA 5J2QB 2D3UA 1RCHA 3NH0A 4TQRA 2QXFA 2Z1GA 4ZP6A 2VWJA 3BREA 3IGNA 4XPEA 4FJMA 4ZP8A 2AQ4A 4HTUA 1RDBA 4FJHA 5J1EB 3H2LA 5J2MA 3IS9A 2HHVA 5DMRA
chains in the Genus database with same CATH superfamily
2QA4N 4ECSA 1C0MA 1NKEA 3ATUA 1TQLA 3CQYA 1GT8A 1J5EK 4NRTA 3L2VA 2QFIA 3BEXA 1GMWD 4RW7A 2FYXA 1RABB 3M2UA 4ED1A 2OKQA 4XEIA 1GNKA 2PT0A 4AL7A 2E7WA 5GAHP 4ES3A 1NGJA 5M1PA 4KHQA 2KFYA 4YOUA 4C2MA 2XCAA 5KFVA 3BYPA 3RBDA 3CYMA 1H38A 2UYTA 4LUBA 4IRCA 1RWPB 2V9KA 1R31A 4BR7A 3LUYA 4FJIA 3HL8A 4FO0A 4KY3A 4OX9J 1FO1A 2Q3PA 2I8EA 5M2RA 4KGXB 1VQSA 2NSCA 4ZCLA 2A6OA 3K0SA 5AQSA 5ETNA 3J80U 1SH2A 3ZSXA 3THWA 4G1PA 3DRRB 4U7CA 3HPOA 2IJNA 3WHIA 3QIPB 1RJJA 2RUSA 3V4IA 1RGIA 1T9TA 5KPRA 1BD6A 1N48A 2CNOB 2ZUAA 2VU5A 2LLZA 4W4MA 4NXMJ 2GVDB 2ZKTA 2KDOA 1U1QA 1WSEA 3OTEA 1LW0B 2VFSA 1R8AA 1TUVA 3TVZA 1V6HA 2Y0SD 3QAEA 1VQLS 3W61A 1Q78A 1S99A 4H5NA 2B9XA 2LXIA 1F3FA 1S9FA 4DQSA 1U6BA 3EE9A 1VQ4N 3S8SA 1OY6A 4ISFA 2MQPA 4G1QA 2P9PA 3DM2A 3OL6A 2LECA 3HYFA 4FM2A 4H0YB 4O8KA 2ZWPA 4J2BA 3RAXA 4ECXA 4LF7F 1W7AA 3KHHA 1U2VA 1U24A 4KGMA 3KWMA 2DGUA 5CYMA 1LWEB 1KHVA 3MEDB 3EDQB 2YNHB 3LANA 2NR0A 1KQKA 3C6UA 2OCEA 4LF7K 5FLXU 2ITMA 4RNOA 3IFEA 2Q97A 4BRAA 4WF9Q 4K41A 4H4OB 2ADBA 2YKNB 4UUXA 1RT1B 2WUSA 1U6FA 2O8DA 1I6JA 2NRRA 5B8HA 1HWKA 1YITN 2DNZA 5F8NA 4YDXA 2DY4A 2VBZA 4H8KA 2NREA 1RDWX 1PKUA 2HWTA 2IVFB 1RDAA 3LZJA 3KLIB 1JLGB 5AZIB 3ALYA 3MEEA 5G4DA 2ZD1A 4BCAA 1IBCB 2XNRA 2DB1A 3LL3A 5EVZA 1RISA 2CJ9A 1DHMA 2BRKA 2W9CA 4HKQA 1TR0A 4X65J 2B9YA 4ID8A 3W5YA 4PRFA 1XNRF 4KB7A 4DZDA 1FJGK 1APSA 1WF0A 1FRXA 2O01C 4B3OA 1EP4A 3OTDA 4M63C 4ECUA 2DITA 1RBAA 1WF2A 1BHNA 5KAKA 3AD7C 1Y5LB 5KG0A 4DCHA 4I67A 2ASMA 4LC9B 2C2NA 1HBUB 3NMAA 1XK8A 2D74B 4XK8C 4DV1F 4MIWA 2XS2A 3NCPA 1HX1A 4OV6A 4KPCA 3UD5A 1YBTA 4C98A 5HBMB 3FJ2A 3L7OA 2P6TA 5H9FK 2L9DA 4NLUA 1CPZA 3CHWA 3PCOB 4Q43A 2J7UA 2UXCF 2E6MA 1S6OA 1YRTA 3BGFA 2R7XA 5MAOA 2HIYA 2QIFA 3PR5B 2PZSA 5DGBA 1IKYB 3J7AN 3ZTSA 1VGYA 5IWAF 2KT5A 3I0RA 4EAHD 2FJAB 1SC6A 1CZBA 3NF6A 4BC7A 4ZKAA 2G0JA 2BE7D 2MPUA 1C0TB 4IG0B 4ZP7A 5GADI 3VAHA 5BYRA 4V1Ak 5BR9A 5GMDA 3D7EO 1FT8A 1KBRA 3SBTA 2W4DA 3A1YG 5KFYA 4ZLLA 1NU4A 4FLUA 4TYBA 3R27A 3K9JA 2EI5A 3O6QA 4A48A 4E8UA 4A46A 4Q8EA 5KFZA 2OANA 2WONA 4F9OA 2VDHA 5C2FA 4ZITA 3R6MA 1XR7A 3CJ5A 1JXLA 2UUAF 1MNEA 4IDKA 4RBUA 4ZCMA 3FK4A 4CZIA 1S1WB 5E41A 1WKJA 1KFSA 1YITS 4ANEA 2OO4A 1OY8A 1BLUA 4CO3A 5D0EA 4B1YB 4C0OC 2PYJA 3OS1A 1R8CA 1WN7A 3A8KA 1HA1A 3KVGA 2RSQA 3CJQA 3B4DA 4BC5A 3GIJA 2X6NA 1JL1A 1VQMN 3NCRA 2A10A 2VPZB 1XC9A 2OGUA 3TW0A 3BY5A 5HP1A 4CZJA 2QWRA 4PHTX 1WSVA 2Y1LB 2DNPA 3QAUA 3HZGA 4YHHF 2F8SA 1NHVA 3QRPA 2ZDOA 3EICA 3HSDA 3ZTOA 3UPFA 1M5OC 2FVRA 4EFAC 4J90A 2MSTA 1MROA 2BTFA 3ENBA 5H1SV 3IM8A 1WTBA 5BR8F 5K8PA 5B09A 3CCLS 1D9FA 1I94F 2KH9A 3K0JA 2VFUA 2XYPB 1LW2A 1RADB 2ZUGA 4KREA 4ZIVA 4EBCA 3RW7A 3BKTA 3VQEA 2B51A 1N6QA 2D3OR 4P7VA 3VA0A 1S1UB 3MXIA 2YNHA 3U7JA 3MN6A 4TLRA 2UUCK 1W2BR 5GAGP 4A8SA 4UZBA 2CQGA 4RUCA 2R3VA 4NOHA 4LIWA 4DR5F 1RT1A 2BUNA 4E98A 4AFFA 4B1UB 2B6AB 4DX6A 4BQLA 4CJWA 2KL8A 1RXOB 1Y3JA 1VIOA 1NGCA 1QAYA 2P9UA 3CT9A 3SSQA 1RDCA 5JICA 1X4HA 4BVOA 4DL5A 1YTYA 3ZX2A 3DDNA 2JEFA 3NRBA 1VRTB 2MGZA 1ZAWA 3FNNA 4ER8A 4K4SA 1VDHA 4L73A 4A5AA 4MLEA 1G7CB 4ZS6A 4DR1J 4Y2MA 4FLVA 2YKAA 4X84A 1R8PA 2ASLA 3IKMA 3C3LA 1EP4B 1FJGF 3WDOA 1FFGB 2FJEB 2QFJA 2L9WA 4WFNL 5L1JA 3TO8A 3CC7S 1B4SA 2VG6A 3CPWM 4F4ZA 1OSCA 4JI0F 4QWCA 2MHNA 2PI5A 3CDUA 2DRAA 2QMXA 1S79A 1TFYA 1B70B 3WUHA 1KLNA 1TKZA 4MK7A 1SQGA 3CFRA 2G2ZA 4KJIA 3LP0A 2ADCA 1NGHA 3VGLA 4CFCA 4Z94A 1LXJA 3FZLA 1F5AA 1FI4A 1IKWB 2MQOA 3BJYA 3F5TA 1YWXA 3OYLA 2VKZG 2PGCA 3A5LC 4EBEA 1RHQB 5ETTA 3R3TA 4FN5A 4JKCA 3NGRA 2YH0A 3A3NB 2R7RA 1MWMA 1RAFB 4OMFG 3ZZYA 4PZVA 4DTJA 2BXJA 2XY6A 5F2RA 3ZT3A 3EDRB 2L3MA 4ERDA 3H20A 2JZ5A 4IRKA 2NRTA 3SAFA 3CTRA 1NJYA 2KT2A 3OL7A 5E84A 4NLCA 3FGVA 2CQ3A 4DWIA 5AXNA 4RW4B 1TL7A 4RX6A 3DLEA 4ICLA 3VQAA 1FJEB 2A6MA 4MH8A 1NPRA 1PYOB 4OYXA 5GAHI 4EP5A 3SQGA 3M32B 4WF9L 1Y9OA 1ZAXA 1F9HA 3KUHA 4B3MK 4K5SA 4OGEA 5F0WA 1YGYA 1KQSR 4WU3A 1AUSL 1LQ9A 3GJRB 3Q2SC 3EEQA 4M7YA 4Q0BB 1KVKA 3C0BA 1LK7A 5CAAA 1Q8LA 4DSJA 1VLOA 4E7JA 1ZPWX 3L6QA 1X7VA 1GX5A 4CF2A 2PBDA 2RILA 2JEGA 3NKYA 1KAZA 2R7UA 2DFFA 2M70A 3ID6A 1RB0A 3LGHA 2FLOA 1F60B 3OBIA 5SWMA 3THYA 2CWXA 1V5IB 2D69A 3HD2A 4RW8A 4ZOSA 3A12A 2I2YA 3L3CA 3PYEA 2F40A 1EWQA 3PYDA 3W7BA 4FZYA 5T7BA 4BR9A 4BRCA 1J5OA 1S97A 3LTOA 4B3SK 4J9OA 2QRRA 2E88A 4ECQA 3EGVA 4ED3A 2YNFB 2E5GA 2JC1A 3Q8SB 3PUFA 3QESA 4HL9A 1Q0NA 1U6ZA 1TK5A 1BUXA 2NXUA 2YBVA 2F9WA 4CO2A 3PKYA 4KTZA 3GIRA 2RPIA 1K0TA 2EXUA 3JQKA 2CDRB 4FWLA 4C48A 3OXFA 4IJAA 2VQFF 3QJPA 4J8FA 3TR5A 1RE1B 5A2QU 3A5NC 1ITGA 4ES1A 1LWFB 2VPWB 5HI7A 2EBGA 1RAJA 2HNYB 2XZWA 4CTAB 2AEFA 2DIVA 3V9XA 3LP2B 1WELA 1D0EA 3UQSA 3RJMB 4NASA 3B6BA 5HRPA 2JVRA 1HR0F 4QQBA 4JV1A 3NGYA 4OKKA 3M1VA 1WC5A 4O3SA 4ECVA 2IFXA 1T0TV 5AR0A 2VG7A 5K14B 2ZWHA 4UOGA 3NAEA 5LJWA 1QVFR 5EGYA 2B8QA 2H48B 5GMKa 2FVCA 3C7NB 3QB0A 2A1SA 4JI8J 1YI2S 3QRRA 4EHUA 5B0BA 1KTQA 3FFIA 1XTZA 5DQIA 4PYAA 3L9ZA 3D2FB 1W2BM 3FGUA 3V5RA 4N8OA 2VA2A 1RWWB 3ZX3A 1YAGA 1WHVA 1PJ6A 3VR1A 1FNXH 1KHWA 4ZDNA 2IY5B 4FJ5A 2RDIA 3HFKA 4M5DA 4H03B 3SMPA 4OZ0A 2XMVA 2HNDA 5IC4B 1FD2A 3M8PA 1EWRA 1WDDA 2WFBA 2FJXA 4MIAA 4YDUC 2HGNA 4CEZA 1TTHB 3FMBA 4J2EA 4KYZA 4BC3A 5F8LA 1YG0A 3AFGA 1X9SA 2AWZA 1RNHA 3M05A 4XH5A 5D0GA 4PWDB 2H5EA 1YJVA 4CYUA 4USHA 3CMEN 2C2KB 4LSNB 3G8QA 2BW2A 2QI2A 3PHEA 1I51B 4CJ7A 2ZC3A 1HQEB 4NCGB 1OS5A 3S3MA 4Z7YA 2DO0A 2G8WA 2MQMA 1Y64A 4B1WB 2NPFA 4FXDA 3AGRA 3A4TA 3NH2A 3WNEA 1W0HA 3G6EN 3GYNA 4AHTA 4ELTA 4DV6J 3SZ2A 4MKBA 3NF9A 3CDAA 4DTUA 4AT1B 1YZ6A 3HOSA 1KAXA 4WYBA 4B9TA 4K50A 2FBXA 4JYAK 5HQ8A 1C1BB 2VYPA 3CSKA 1NZAA 3NMUA 3R2DJ 4JS5A 2K3IA 2LA4A 2HBRB 3VHQA 4OI6A 3CCVN 4CJVA 1PC4A 5AJ3K 4CCHA 4DDFA 4WXWA 4KR0B 3C2PA 3RGIA 1IO2A 3DYAA 5CH7B 2DGSA 2Q66A 3EVOA 2VJVA 3JQJA 3AAQA 3TUZC 2CUYA 3HXMA 1CJUB 1RHMB 3I82A 4I68A 3FVYA 3TZXA 4DV0F 3TAFA 1ZZNA 3OXGA 2Z0GA 3DCAA 4RU9A 2E9ZA 1Q9YA 4USVA 2OD4A 1O8BA 4DR2J 2CNKB 3QT5A 5JVHL 5ETLA 2NRWA 4DV7J 2DEJA 3CCQS 3CD5A 4CJSA 2M0GB 3D0HE 1URNA 4YY3K 3JSRA 1HNVA 4YN3B 4FNHA 1SV5B 1PC5A 4L74A 2LQ9A 2DCUB 4ZN1A 4X62F 2ALZA 3CUNA 3SCXA 3DHWC 1VQYA 3HHNB 3RSEA 4H54A 2W25A 4QWEA 2CQ2A 4HWIA 4C8YA 2R7YA 4CIEA 3RR8A 3VQ9A 1FJ7A 3VEYA 2PFUA 2AW0A 3K5MA 2NPIA 5HRNA 1S22A 3HHKA 2DHGA 5IM0B 4FYDA 2Q3SA 4LRFA 3W63A 4WQ4C 2VWBA 4JI7J 3VQDA 1W7WA 2I38A 1WG4A 3AARA 1FRJA 3NMRA 2Y3YA 3ICLA 1ZS6A 2QX0A 3I32A 4UT4A 2R7VA 4EO6A 4EU0A 4NRUA 1S10A 2DGXA 4BRGA 2FHMA 3MAAA 1YLXA 4TKTA 1I5OB 2VGMA 2JFDA 2Q6CA 3HKWA 4RL1A 3I55N 3M1VB 2EK1A 4B02A 1C0UB 3NWRA 5L1LA 2RD5C 1Q5YA 4Y1DA 3BPSP 4LY7A 3Q8UA 3F73A 2MKSA 2DPJA 2E7VA 5A0YB 4CM2A 4WCEQ 4WQ5A 4IQXA 2JWLA 4CW7B 3CJ1A 1U2CA 1NK8A 1HWJA 3ASMA 3GG4A 8AT1B 1S1XB 1Q8KA 4WTYA 1J9AA 5KFHA 1OVQA 2PO4A 3MCMA 2QA2A 3HM8A 1U45A 3SQ0A 2Z58B 1VQLN 2AP6A 4JI6K 4FLXA 1HYSB 4I6AA 3HHLA 3MI7X 1JLEA 3O4NA 1JLQB 3C16A 1BI4B 3AVKA 3BPDA 1R8BA 2P9NA 1Q8IA 3HP6A 4DR5K 1AT1B 4UY8T 3P39A 1QD1A 3AO1A 3ENHA 4JRPA 2P9LA 4LSLB 2RN2A 3TZZA 1RYRA 1IJFB 2AGOA 4ED5A 2K7KA 3PKMA 2BH1A 3WXLA 4BE0A 2ZJQQ 2DNKA 1HFEL 2H65B 1DQ8A 3MPVA 2L9NA 3CCLN 5M2PA 3G9CA 3N9UC 4EIAA 2IRXA 2Y9HA 5AQHA 4RNNA 4CEOA 4HT7A 2R2RA 2W9BA 3TQ1A 2XBPA 4OPJA 4JN4A 3R5DA 3HO1A 2CJBA 1EQMA 1H74A 1VQKS 2BKPA 4JV2A 2CQCA 3MR3A 3VQBA 3TTDA 1PBAA 4OZ5A 4P2XA 3AJ1A 4JHDB 4X62J 5AQZA 3IBFB 4CHQA 3KK1A 2ZKUA 3H0PA 4RW9B 2VUGA 3QJLA 2W6LA 1E6VB 4L76A 5E3PA 3I55S 4F4AA 1KTVA 2V2QA 3FBFA 4QPTA 4ED8A 3BUZB 3VWSA 1JWWA 1Y00A 1W25A 4WYWA 3KK3B 1RT2A 2AJFE 2BRLA 3HX9A 3JYTA 3D3BJ 3SDEA 1X4CA 1F2HA 3NG8A 4ZVTB 3NWGA 1OO0B 4TY8B 1QQNA 1XHXA 4B3RF 1WBBA 3QLHB 1B9DA 3TR8A 2UVVA 4B9QA 3J81Y 3V6DB 1MWYA 3NH1A 3TAQA 1DZ5A 2C3OA 4WZQA 1IBLK 4N47A 5FIIA 3FRZA 3V1QA 1M5VC 2NXCA 4HT5A 5M1QA 1JLFA 4AYBD 2RU3A 1GQEA 1SJQA 2NRVA 5EUHA 2ZH3A 3TI0A 2XRIA 3PEJA 3W9JA 2ACYA 2OTJS 1VSIA 3M9NB 2ZHOA 5GAEU 3U1MA 1FKPB 3WEEA 3CFOA 2RH3A 2KZMA 2NXNA 1D8ZA 3MECB 2XHBA 1NOZA 3UB5A 2YNGB 4PWUA 4X66K 2BKNA 4RU2A 4BQZA 2OPRB 4FJLA 2QL7B 2Q6BA 3K2YA 1REGX 2ZE2A 1Z05A 2XSJB 4QYZJ 3GR0A 2K1RB 3KLHA 3CNQP 5E0OA 2FJVA 2GCFA 1YT3A 2J6TA 4H4MB 1VQKN 4OYPA 4PG4A 3CD6N 4PQUB 3I9V9 4FBUA 1TMMA 4LR7A 3OR2B 1UOCA 2XMAA 8RUCA 1NGEA 1IBMK 4DV4F 4TXSA 2KM8C 3DXMB 2IPOB 5CY4A 1WEYA 3UNGC 3R7NB 4K59A 2MY7A 5BN8A 3MM6A 1HNWF 2NUUG 4DUYK 2D3ZA 4BDPA 5M2UA 1Q1KA 3DXBA 4CJLA 2B9WA 1QHAA 4BC9A 5F0UA 3MN7A 2K7JA 2O8BA 2FC9A 2BANA 4K0KK 4NEYA 1G15A 3VAJA 3AVIA 3DOMB 4B3MF 1U09A 4PG7A 5EWGA 2ZHAA 3DLGA 2GFFA 4DSEA 3GFHA 2ZFHA 1FKOB 1K73T 1U1OA 1NMNA 5C42A 4PAAA 1G6BA 4USTA 3P3DA 3QIOA 2W01A 4KQZA 4LF6F 4U7BA 2CQ4A 4LF8F 2QW9A 3K5LA 3M3ZA 3W3DA 3P31A 3BF1A 1GFWB 2Z2YB 4PA1A 2DXEA 4CGFA 3NNAA 4Q2MA 3LP1B 2HHHK 2G8UA 4O8UA 2KVIA 1TKTB 3MM7A 4IH5A 2IMOA 3HT0A 3K9KA 5KFAA 3QERA 3O1LA 2BJDA 2XMTA 4FF3A 2DGQA 3M7VA 4CP5A 3VESA 2ZBIA 2PD1A 3ET6A 3PDNA 5A8KA 3HI0A 2X1GA 3T7ZA 3FCHA 4I64A 1ELOA 1R43A 2R7SA 1F3VA 4EFHA 2YWGA 4PY5A 5M1KA 2CG4A 4LFAK 4BLGA 4HHTA 3TJ8A 3DDKA 4FZVA 4FVUA 3C6TB 5I9EB 1HIYA 4MIBA 2DNLA 4B1VA 2H5JB 3ZTRA 1WSRA 3MCNA 2GIRA 1RSCA 3DGVA 2RNEA 4OZJA 4ZN3A 4DOZA 5F8HA 2GIQA 1U2FA 4WFBQ 1BCMA 3EZ5A 4OI0A 1UVJA 5GAEP 3JSBA 2HMIA 3EPGA 4A62A 2HOEA 1T9VA 1JNZB 5HRRA 3R6LB 3MPDA 3J7ZO 5KFXA 3OL9A 2M3DA 1OWXA 4DU1A 4A8WA 4DSFA 1NBEB 3J8AA 2AEMA 4P72A 1RFQA 1YJUA 2WTFA 3W2VA 4AXJA 5DM6Q 3O9SA 1HI1A 4R8UB 3I0SB 3KTQA 4C8KA 2HNYA 2H51B 4MKYA 2N82B 4NA1A 2O1PA 2GBZA 2KYXA 9ATCB 3I96A 2WW8A 3V9SA 4A8MP 1CJVB 1RGVA 1XIQA 5LMUJ 3AGKA 3GB0A 5KRTA 1GMVA 4JI3K 1YJRA 4GO7X 2ILZA 2RHKA 1AUDA 2EWHA 3VQQA 2A40A 1VSDA 1P1LA 2N7YA 2B5JB 4X66F 3LH2S 3QWPA 3RW6A 2YHBA 3SJJA 3NDKA 1PJ7A 1L3KA 3ZO7A 2Q0RA 3VQ7A 4FOEA 2YXLA 5AXMA 1Z1ZA 3MX5A 3TTFA 2EKYA 2EFPA 2LEBA 1T9UA 3BSAA 1NK5A 4LFBK 2UUAK 2XS7A 1ZBSA 4HCBA 1JMTA 2D0AA 2N7CA 4IR9A 1VSFA 4NYPA 4CK2A 3OQ2A 2ATCB 3Q22A 1TYQB 5E2QA 3OBYA 1X4BA 3ZFVA 1IKYA 3NF8A 2VOOA 5B0AA 5A6WA 4O0IA 2O4GA 4OLPA 2E8AA 3MEEB 4I56A 2WK4A 4LVNP 1S0MA 4BRMA 4CJ3A 3EX7B 3K59A 1FRHA 2IM0A 2LSNA 1QZ6A 3C46A 4AHCA 4FJ8A 3UKRB 1MU2A 4J9QA 3OYHA 2OPSB 1KSPA 1RTZA 2UV8G 4CYUB 1GLLO 4OV1A 4IFYA 3B8AX 3SJHA 3WQPA 4FKXA 1ZOTA 1QTNB 4M5MA 2X78A 1UFLA 3VQSA 2ASOA 4JS4A 4H5RA 1QLNA 1RKJA 4TU7A 1EHWA 3OYDA 1W2IA 3CJ3A 3QBXA 3CVKA 2CQ0A 2F63A 3H3OB 3S41A 1NNDA 5K8MA 4DU3A 4ZVGA 1VRUA 3QATA 4R0EA 4EMDA 4HHHA 3JXUA 3DOMA 4WCEL 1VQ7N 3E9OA 4BE1A 3WT0A 4HCCA 1UWAA 4JI8F 4B3MJ 2ZH1A 2HBJA 3KLGA 3K57A 1I39A 4K2XA 1FKOA 1RCHA 4DU7A 3NH0A 2J0XA 4TU8A 4ZP6A 2VWJA 1T9YA 2MZSA 4ZP8A 1RDBA 3WC2A 1V5VA 5J1EB 5J2MA 3IS9A 2CH5A 3NGTA 1ACMB 3P45B 3BGUA 4IG3A 2YTCA 3CPWR 2QWPA 1EAYC 2VB6A 4DG1B 2B43A 4DCOB 1BQMA 4FM1A 2GA7A 3DMJB 1GOAA 4LF5K 1VQPN 1EIYB 3HPGA 1VYAA 4F4YA 3OW2M 1U0HB 3LWLA 1NHKL 4ZLJA 2UUWA 5IQ6A 4LR9A 2IDEA 4IKFA 5F8IA 2JL9A 4X4VA 4EHTA 2J9DA 3A3PB 4USUA 1YJWS 1RBTA 5HQLA 4RUAA 2IA6A 2G9OA 3PEHA 3G4SS 2MXYA 3FKBA 1RTJA 3UDEA 2W9AA 2V4QA 4J9PA 3MHYA 1SJRA 1LOTB 2HZCA 1QAJA 3PIPL 5B7WA 1WSFA 3PRVA 1SV5A 4O3QA 5B0CA 3O6WA 3SQ4A 2UXDF 3IP0A 1AA1B 5IFMA 3MUTP 1F1BB 3Q2TC 4ZHRA 2QLWA 3D6FB 3R1XA 4CI6A 3PX4A 3C94A 3EGZA 5CXTA 3PIOQ 2E5LJ 2MKIA 1RWXB 3Q83A 4NMXA 4LSNA 1JXBA 3F2KA 5D8HB 2FVSA 5CA5A 1Q16B 2WSEC 2YKMB 2ACMA 2GS8A 4P73A 4BR0A 1V3SA 1WSIA 3R9PA 3SFUA 4EYHB 3FCVA 2OA8A 2B4UA 3G6YA 3D66A 3NL0A 3O2IA 2PFFB 3QSYB 2O8CA 4IO1A 1GLEG 4M8LA 3HI9A 4V19X 5C5JA 2EFNA 1NSPA 5M1OA 1VS3A 2QMWA 3H2UB 2DNYA 3W62A 4M3WA 1SQKA 1S7HA 2HFZA 3P6YC 3AA4A 3BB5A 3NP5A 1OQ6A 2NLWA 3POTB 3HZ6A 3IXQA 1JCGA 1UFKA 1B9FA 1B0VA 5AJ3J 5KT3A 3E01A 3CJ7A 1VAZA 3LGNA 3CEDA 4CO4A 1VK3A 5HVHA 2OTLN 2FSKA 2HK3A 1GLDG 3VF4A 3V6HA 3LDNA 1T9XA 1DTTA 3PRBA 4QIFA 4PYDA 4JI5F 1TKXA 3GIKA 5KT7A 4Z2XA 4ETXA 3ZSRA 3SAHA 4BRFA 2KYZA 4DUZF 1TAQA 3AVBA 4FPRA 1R0AA 4BC4A 4AHRA 5E3AA 3GV8B 5GVQA 3RR7A 2GO8A 4KTWA 2HQDA 1ZH5A 2VONA 2DPNA 3O08A 3G87A 3QIDA 3QT6A 2OHDA 5BRHA 1VC6A 4NYZA 5EX3A 2EKNA 2G8FA 5EDWA 2DVIA 1TFWA 2HQ3A 1G4CA 4C3LA 3IWNC 4DV6K 3GBTA 4RWXA 4FPAA 4O3PA 3ZETA 4P2MA 2OI2A 1R0BG 2MYFA 3EZWA 4CF1A 4CNYA 3D28A 3KKFA 2GVZB 3J81O 1NGDA 1WOQA 1CZAN 2FBTA 2CWKA 2BQUA 1NG9A 3WQUA 4DS4A 2DNQA 2CFXA 2HFUA 3O3HA 2CAJA 3UN2A 1UZHA 1IXKA 5GINA 5JVGL 1JB0C 3V81A 2UUCJ 3HPHA 2CVEA 3DDIA 1L5UA 3BDEA 3TEGA 3TSUA 3GJQB 4JNEA 3CC7N 3VF2A 2ZH5A 4WJBA 1KVBA 4WP8A 3MEDA 3MTJA 3QNOA 3G96A 4NZ7A 4LREA 2AJQA 3QNWB 3VZHA 1OQ3A 1LAVA 2V2VA 4Y00A 1VMBA 3JYTB 1OYDA 3KFWX 1VQ4S 2ZBPA 3B78A 2E2OA 4OGCA 1XBWA 3ZTQA 3AAPA 3IBWA 1SKRA 4Z37A 2COLA 1PAUB 1TMJA 4ZA1A 4WFYA 3W9IA 3KJQB 2IAJA 1R89A 2MZJA 3TX0A 4QWAA 2ATQA 2D0CA 1Q4RA 3NOGA 3M2RA 1IBKJ 2A3ZA 1SAZA 1SIWB 5AQMA 5KT4A 1NMDA 4IWVA 4X65K 5KFEA 3DGPA 3MR2A 1HQUB 2IBKA 4DR2K 4OJHA 2W2OP 2MJUA 4ZVUB 3Q24A 2RF2A 3FZ2A 2LFVA 3QEVA 2EWSA 4ZP9A 3TANA 1S48A 1HW8A 3UIQA 4RPFA 2W7AA 2ZBCA 3CCWA 3QFHA 2LP4A 4EUVA 3T1YK 3OY9A 4OL8A 3LQVA 5THWA 4DXLA 4O55A 2J0SD 3OTCA 4IOBA 1H1VA 5FRMA 2QO3A 5ELZA 2ILYA 4Y6IA 1U26A 1PBUA 2WB1D 2MZTA 1U8WA 4I7FB 4C8NA 4GMKA 3HHLC 1NH8A 2V50A 3GU0A 4MT1A 3QZ8A 4DL6A 2VQFK 2M88A 2CGKA 3T6BA 3DU6A 1HR0J 1XJWB 2YHWA 3VETA 4TN2A 4B1ZA 3TSQA 1VQ8S 1RQ0A 4JKAA 3T5LA 3VAIA 2XLKA 3ZZUA 1N34K 4O4GA 1VQ5N 3SNNA 3ZTPA 3DM2B 4F3QA 4FWMA 1VJWA 3PFEA 1YQHA 2AX1A 3IGVA 5MLCQ 1U49A 3DRXA 2FHJA 1RT7B 2BJ9A 3OTOJ 3ISNC 1VSLA 5KFNA 2G8KA 4I0WA 1W97L 4RLEA 2D0PA 3K5PA 5DM7Q 2A18A 4H5VA 4U95A 3HSZA 4N41A 4FNIA 2F9DA 4NI2B 4YMEA 3OHRA 1RT4B 2YPYA 5ETPA 3NAHA 3QGPA 1KNZA 1W26A 2E29A 2AD9A 3OUYA 2GQ2A 1WB9A 2OH2A 1DARA 1YDLA 3MCOA 4BWJA 5HATA 4OHVA 5A8WA 5DDQC 3HVTA 4UF4A 3IO1A 4WKRA 4LFBF 5KFRA 1V3ZA 1E4GT 3IR7B 1NB2A 2JH3A 1QUPA 3F9MA 1C6VA 1WD6A 1WEZA 2XQCA 2ZDPA 4LF9K 1QVFM 2D0BA 3AVNA 4I9QA 1QJHA 4K4TA 5K5MA 4RWWA 1EQ0A 4ZVSB 1EZZB 4BROA 2F3JA 5LMUF 4C7QA 5JMNA 1YBUA 1NM2A 4O4RA 2F4FA 4A8YA 5IC6B 4DTNA 4LF1A 1ATNA 5ETQA 1LNQA 3TUIC 3LM2A 2XHCA 4F2SA 2G2OA 4CD1A 3WX4A 2DGWA 4IEEA 3CD6S 4M7XA 3ITHB 4Q44A 2PEBA 3RB3A 2H3EB 4CZEA 2SXLA 1ZTWA 3GDQA 1X9MA 4M94A 5M1FA 1ICEB 2PMWA 2HNZA 2CQDA 2DH9A 1S0OA 2G1HA 3E66A 4ZVPB 4JI1K 1VSHA 3FFKB 3H98A 4OPAA 1B64A 2ZH9A 3IAS9 3THXA 2NYIA 3GIIA 2GEMA 4HACA 5LSLA 1RHRB 4F0KA 4K0KJ 1QAXA 3I4PA 1S5JA 4C11A 4JV5K 4JI2K 1HBOA 1QZ5A 4CWBA 1KC8T 1UA1A 3LWMA 1MWKA 1RBLA 5KFPA 1GLBG 4LF8K 3EKUA 3DOKB 3VMFB 2HMIB 2NRHA 2ZH2A 1XERA 2KKZA 1NM1A 4DQ8A 3D1QA 2F7VA 1SI9A 3T1YJ 5L1KA 1X0FA 5L9XA 2PI4A 4TSXA 3MEGA 2ALYB 2YWEA 3TSPA 1NKCA 2LXFA 3Q8YA 2W8LA 4CGHA 4W5OA 4N8NA 5T7LB 3KIOA 3DLLL 3GV7B 4ES2A 5HK4A 1TAUA 1BIUA 4H0OA 1FXRA 2HHPA 2KU7A 4CE9A 1U25A 4KH1B 3QBWA 3MMBB 3R7SB 5C42B 2L08A 1VRQC 3SIPB 5AXKA 2UUAJ 3IMXA 3JB9k 4GY2B 1CS4A 2ETJA 3OVNA 3H08A 4K42A 1P8GA 1GMUA 2P5VA 3DGPB 3ZSYA 3M8ZA 1CXQA 3GG0A 1RT3A 1TUGB 5AQFA 3DYAB 2P51A 5AQNA 1TKTA 2P9SA 2UU9K 1KVIA 5IM0A 1Q86T 1RTDB 2Q0UA 2KJWA 3KHGA 2MQ8A 2G2YA 3OFFA 4HEA9 1U4BA 1CZ9A 3Q0AA 3T19A 2ZGZA 1SC1B 4QS7A 2APOA 4CEEA 1HRHA 3UI3A 3SUQA 2Z56B 1WOSA 5LMUK 2DNRA 4DR1K 5HJXA 1QDUB 2YKPA 4K0KF 3C8YA 1WHYA 1HQ2A 3O3LA 2KRRA 4FWOA 1U47A 1T03B 3MAAB 5DM7L 3A5OC 3VEVA 5B0GA 2UU9J 3MMAB 2UZAA 3C6TA 4O23A 3I9ZA 4CLKA 2C3YA 3GE9A 4DR7F 2AJ4A 4KO0A 3S01A 3HP9A 4P6QA 1JJ2R 4PKHA 2A1BA 4P9SA 2C3UA 2HVHA 4FJ7A 1N32K 1S12A 2Q1NA 5C7PA 1N88A 3AA3A 4QAGA 4DV4K 1BQXA 1FF2A 3NS6A 2QXLA 4A8OA 2RJZA 4ED6A 5KFBA 1P9YA 1NNEA 1DTQA 2PIIA 1KDNA 1Q95G 2KI2A 2WVBA 4FZZA 3ETOA 1M1KT 3PR4A 3MDFA 3LGMA 1FD8A 5C2DA 4AF1A 1B92A 3MR7A 2E44A 5IT4A 3ZSVA 1RZMA 5GAEI 3OUYB 2HG4A 1T3OA 2VHGA 3IRWP 3ISND 4CGJA 2OD6A 3P5BP 2IHR1 1RWKB 4HR2A 3ZZZA 3JAMO 1Q7YO 4JKHA 3RMBA 4LF8J 5B0EA 4LH5A 1Q9XA 4Q0BA 4C8ZA 1RK8A 1A7GE 2GX8A 1QAIA 4USKA 4KHPJ 1YJNS 4JK8A 4NYNA 2G4BA 3PVXA 1CULA 3QFPA 2BJEA 3S3OA 1R7IA 5KG2A 3TAMA 1LW0A 4B9UA 4WP9A 3HBTA 3MR5A 1WSJA 1VQ6S 1MSWD 5KPTA 3M8QB 3MPYA 2E2PA 3CCVS 5H1SQ 1D5AA 3PIOL 3PHTA 3CCSN 1EETA 1BQNB 1NUEA 3CCUS 4LFCF 2DNNA 4E7IA 5KFKA 5HMZA 5AZJA 2HS0A 3VA3A 2ZNYA 2GQQA 3AODA 1UVKA 3KHLA 2PA3A 1HYSA 4DHVA 1QVGM 4LFBJ 3NVMA 4LF6J 2PDAA 5IWAK 3CCMS 4YFUA 4GRSA 5KTQA 4NLQA 3M2VA 1EKRA 3T3FA 3K8WA 2JGUA 4BDYA 4DV7F 3AA2A 4MJKA 3GZ7A 3JAMU 4JI3F 4XAKA 3EWGA 3VF0B 3KLVA 5KI6A 3FBEA 3W65A 4CI0B 4ECYA 2QM1A 1TUWA 3QIPA 5CD4A 3CB4A 4L8RB 5DLGA 4A8XA 4IO9Q 4ILJA 4CBUA 3QJJA 5CCMA 7AT1B 2YV0X 5M1NA 3GCWP 4TYAA 2YJFA 1H6KX 4KT0C 4MFBB 3OL8A 3HVRA 3US5A 1GOCA 4OYWA 4BWMA 4P7TA 1BOTO 1REVB 2E5LF 3G25A 1B0TA 2X3GA 3NS5A 3GV5B 1IM6A 4DPTA 4MKAA 5KFUA 4RW6B 3SFGA 3HJVA 7FDRA 2DY1A 1RILA 2OMLA 3HRGA 3QEXA 2KXHA 3U9DA 4RUBA 3P8BB 3FEYB 1T05B 5A6PA 4HYKA 1S1WA 2YVSA 2P2CB 5MLCV 3DHXA 2LDYA 4B9MA 3ZZ0A 5C10A 2EG2A 5CQGA 3IFRA 5DO2A 4FWQA 3MXJA 3R5BA 3T9ZA 1NGFA 2V63A 4LR8A 2VFVA 3KK7A 4P52A 3H6EA 4YS2A 4GW6A 3VQ6A 3QMLA 5HQMA 4MDBA 2CQ1A 2FUG9 2RMLA 4FP9A 4HI1A 3IC1A 1VQ6N 5LOQA 3SDEB 4W92B 3FCWA 3AOAA 1WC1A 1M1KO 2F8HA 2E1PA 3RU0A 1RDDA 3QDKA 1VC5A 1T9WA 3GJTB 2VG5A 1RBUA 3C15B 4IKAA 4O3RA 2IYGA 4XPCA 3CETA 2VQEK 5JLFA 5DQGA 3RRGA 2DNHA 4J2DA 1FEEA 1YTAA 4S0MA 1NKBA 1FJGJ 2JWKA 3I5BA 3VGTA 4DCPB 3O3GA 2LU2A 4E2FB 3TAEA 4QW9A 4D3HA 3BQ1A 4PPZA 3ZSOA 1QQOA 2FC0A 4BRDA 3EPIA 4DR7J 1GTEA 1N34J 3VQTA 2GAHC 1WDTA 3BGRB 1LWFA 1CQMA 3L2WA 3V9ZA 3DRSA 3MURP 5C2GA 5IT9Y 1JKHA 1S77D 2E5HA 3EGWB 5EX0A 2OUGA 3MM9A 4YQWA 1RAAB 4F04B 1IR2A 4UOFA 2XY5A 4HUEA 4E3SA 1N5YA 4FK4A 4CM0A 3FLCO 1FFSB 2B4PA 5J2NA 3FBCA 1NJIT 3U9ZA 4M5NA 2MGZB 1WORA 4BBYA 4I2PA 1RTHB 3AHPA 4NLVA 1SH3A 2ASDA 3KJVA 5F3ZA 4A8KA 2V6AA 1VQ9S 1DT9A 2J6UA 5GIOA 2VASA 3Q89A 3MUMP 4LBHA 3ULEB 4CDIA 1IBKK 4FCYA 3MDQA 2GW8A 1ITPA 1M5HA 3VAGA 4N7TA 4U7UK 4CJ4A 2XMKA 4I9LA 4DEZA 2DJWA 2GUPA 5LSRA 2DTUA 1ZXOA 3UKUA 1Q53A 2OPPB 5HL7Q 3GMGA 4B3SJ 3ZT2A 3G0ZA 1SCJB 2C1EB 4YHHK 4PG8A 2J5AA 1B0PA 3DLGB 3AY0A 2BUPA 2HHHJ 4DV0K 3ILLA 3EMTA 5CABA 2EEYA 4CJEA 2AKWB 4DUTA 4IR1A 4N56A 4ID1A 1ZBTA 1XMQJ 2P9KB 3LZIA 5AQXA 3D6RA 3D3CJ 3D0IE 4E1NA 4CQ1A 5AQUA 3UVJB 4IOXA 2Y0BB 1UPPA 3MCSA 1J5EF 4HHJA 3GWCA 5KG3A 4IEIA 1NB7A 4PXEA 4DV0J 1PSDA 3VTHA 1QS4A 4RBVA 3G6XA 4B9SA 1N8RO 4K8XA 4R8UA 1S59A 5KT6A 3E9PA 3IBCB 3M30B 1UFWA 2G13A 9RUBA 2NRXA 3VQPA 2GVZA 1NXIA 1WSGA 3FZKA 2KG1A 4AM6A 3CDEA 2WVFA 1HUXA 2MQLA 3SI8A 2NQPA 1N36F 1B7FA 1Q79A 2F4VK 2KRBA 3DRPB 4IFEA 4ZCKA 1X3NA 4U8VA 1S1TB 3A8EA 1SJ4P 5DG7A 3P5JA 1T6DA 2AU0A 3M8YA 2WSFC 3VVUA 4BR5A 1VQOS 4CGGA 1HMVA 3CJAA 3ULDA 5LJVA 1PILA 1CEZA 1EQYA 2VG6B 4ED4A 4AL5A 3LM9A 2ZBRA 2J7WA 1FE4A 1FRMA 3VQ5A 4YUDA 3PX6A 4OHZA 1H98A 4P2SA 3JSYA 2B3TB 1OY9A 3H40A 3EKSA 2IC3B 2A41A 4KGVB 5CYQB 3VQCA 4DV3J 5JVGQ 3O44A 2V8GA 3LDPA 1IBMJ 4MKVA 4O5FA 1JLGA 4YDUA 4TY9A 2QYCA 2CZVC 4XO0A 2YNIA 4OJ1A 2D9OA 3AO2A 2P8IA 2BZ2A 2CYYA 3DRYA 1UKUA 2Z30B 2F1FA 4K2JA 1VCTA 4FWRA 1GLCG 1S9GA 4BGAA 2VJUA 4KH0B 3UKRA 2OP5A 1E3MA 4DLGA 2H4WB 2KKHA 1E6YA 5KG6A 4JV0A 2LKZA 1TELA 1XNQJ 2W41A 1CQNA 2BOAA 4JP8A 4DTOA 5D3GA 1KEKA 3M6WA 2BE2B 3HF5A 4FSVA 2QKKA 1YF5L 3VEXA 4GC7A 4A4JA 2V4JB 4ID5A 2NNWA 2CPHA 3MPWA 3UCZP 3J7YI 3JTPA 5HBMA 2IM1A 1XQSC 4IOAQ 5K8NA 4OLAA 2RQKA 2BJ7A 3H5XA 4LBPA 3THPA 4OI4A 1JKHB 5JXSA 2XYGB 3PFOA 4JI6J 1K8AT 1HBMB 2UXCK 4FLYA 4LFAF 1UJ4A 1ATSA 1LAWA 2EFOA 5TKWA 1QUVA 3QETA 3IS9B 4Q2LA 1HL6A 2GELA 4OKJA 3VZIA 1Q5VA 3BO4A 1NGGA 3MAQA 5ADZA 4IG3B 3AVLA 2C3PA 1RWMB 1LCUA 3BZCA 4QJVA 3BV8A 4IDHA 3ENQA 1SUQA 4JKFA 4ILRA 4CBXA 1KFDA 2FBYA 4DUZK 3MZIA 1PAEX 1IBLJ 1X4AA 4ZCIA 3NEKA 4GVMA 1T95A 3SPYA 3IAM9 1CC8A 1JXEA 4UZCA 4TNOA 4CLYA 1M5KC 3E8OA 3H90A 2OPQA 5ADXH 4F3OA 3EM1A 1KOHA 2EFQA 1KONA 5KFSA 4WFXA 3A0IX 4ED7A 5FLXY 3C16B 4NXNJ 3W5XA 3J7YP 3W3SA 4DPUA 5H9EJ 4JI2J 5G0RA 4KC5A 2P9GA 1WUAA 5LM7E 1TL1B 3MM5A 1OPZA 1N56A 4WWSA 2VC0A 5C2CA 1NGAA 5ETRA 1F0XA 5KG4A 3N79A 3KWIA 3NCIA 4Q45A 1DLOB 2EW9A 4FW1A 4IOCL 3OVSA 1FRIA 4USIA 4EBDA 2GJ2A 3OYEA 4U67Q 4ZPVR 2VBWA 1UAWA 4E1MA 3BH6B 1K1QA 4CIOA 1SJFA 2FSJA 1XR5A 1IBMF 2HB5A 3DOLB 2QLJB 2QGFB 2JJ4D 3D45A 5K14A 3IDHA 1HYZA 3CJRA 3FZMA 2JVOA 5FDLB 4LFCJ 5HLFA 1H72C 1VSMA 3DWLA 3N01A 3P38A 2ZJRL 3GYGA 1G99A 3FZHA 4I1TA 5CZXA 3UCGA 4G6VB 1BUPA 1HHSA 1BWVA 3O1BA 4JLHA 3DJCA 4RW9A 1KQFB 2XLJA 4OZ2A 2E5LK 4CF9A 2AT1B 4B08A 3IR6B 5E3RA 3O80A 3NOCA 3BBFA 3D0GE 3IMQJ 2V34A 4KSEB 4NXNK 5EXWA 5AFUA 2I1RA 1R0CB 1JLAB 1X4EA 2KM8B 3THTA 2O3DA 4M5JA 2RUGA 3OPKA 4ZPCA 2ROGA 4PWWA 3J80Y 3OYJA 5DETA 4U96A 3UN3A 4Y2CA 5AZIA 4JAXA 4B8CA 4KHMA 2BV3A 4IDKB 1TVRB 4HHUA 1W9HA 4RKUC 2W2QP 3TP2A 4OI1A 1VBXA 4DFPA 4Y0WA 1B99A 2MJNA 3RRHA 2HS3A 4L6V3 2WONB 5HROB 2RIJA 1NK0A 4DU4A 3ZEUA 2BE9B 4OZLA 3IRXB 3QYYA 3RG6A 2XM3A 4B3RK 1MWQA 4ED2A 3LA0A 5HMYA 4FF2A 1S9GB 1RACB 4ZPWR 1N32J 4RNFA 3I33A 4DL4A 2NZCA 2HHXA 2YX6A 4NX9A 4WE1B 3MTKA 1CJTA 2DR9A 4AM7A 1TK8A 4LRDA 4ZVQB 5HL7L 4I6MB 3L95X 3SCKE 4OFZA 3DLHA 2C2EA 4I2QA 1ILYA 3SCLE 4XIUA 4CHYA 3KK2B 4M5DB 2QWLA 3GSIA 3QFUA 1WLJA 4LF4F 5DG8A 1S6QB 1N8RT 4WK1A 1J6ZA 4M3UA 2MKJA 5CZVA 3AVFA 3K5OA 4KHWA 2I7NA 1BMQB 4JD2B 3CJ4A 2ZVIA 1ZBFA 1URRA 3I0RB 4IOCQ 1GLJO 2OZMA 1CXUA 4O0NA 2HQCA 2FQQB 3BN7A 4PKDB 1YI2N 4DV2F 4BRPA 1S72S 1NHUA 5DG9A 3PSFA 2DCLA 1FDAA 4WP3A 3VQ8A 2OEJA 4J9VA 4F4XA 2KLAA 5A0YA 1XMBA 3G71S 1A5XA 2QL5B 3OBWA 1A9NB 5C24B 4CLLA 4WKYA 3TX8A 5DZ7A 3U1LA 2ZHBA 1X9JA 4DR6F 2GGPA 4CZGA 1P6TA 1Z25A 4UOCA 3BN4A 3TUPA 4IXCA 2IYIA 1UWBA 4F0MA 1O0PA 1RKIA 1S0NA 3U4LA 2N3OA 2QWQA 4DPWA 4UW2A 1WHXA 2I9SA 3V1RA 4OX9K 2W8KA 3TA2A 1IWAA 2XY8A 3A3OB 1H2UX 2E9TA 3H25A 4KE5A 3F9KA 3N4WA 5KG1A 1JLBA 1K1SA 3THWB 2ZZTA 2WCXA 2P9LB 4R5PB 5J2QB 1SC3B 2QXFA 3UCUP 3MMCB 2DH8A 4KRWA 2AQ4A 3AAWB 4FJHA 3MX2A 2V8VA 2L48A 1UL3A 1MN9A 4DUYJ 2FTRA 1UVIA 2W40A 4J9LA 2H9ZA 4DV2K 3EE8A 4ILLA 2QN6B 4QOTA 1BY9A 3FC9A 1NZ8A 1X5OA 5DDOC 1BO5O 1R8HA 5L39A 1U1LA 2VWKA 3OW2R 1K8KA 4FXWA 4QYZK 2HF4A 2Z1JA 3OYKA 3QINA 3OV7A 2ASPA 1PG5B 3RYLA 2XY7A 2AYEA 1BIZA 2JNJA 4H5TA 4NLSA 1C0UA 5D0RA 2VA3A 1RHJB 4FL9A 2DYAA 4J37A 4WU2A 4NXNF 5HSPA 3L2QA 5HMXA 1VSEA 3BKFA 4JI0J 1RU2A 2CZ9A 4L72B 2JLGA 3KWGA 2DY9A 3FEZA 1HPZB 3BO2A 4KAZA 3LDQA 5CR4A 4OPKA 4ECWA 1YKWA 3Q23A 3KYLA 1SPBP 2HVZA 3ULHA 5KFFA 1Z26A 3K58A 2GZOA 2EHGA 2B6AA 1I3OB 1X1PA 1S4FA 3FE1A 1HD1A 2B56A 2NRZA 2V69A 2PE8A 3NGZA 3CCQN 1WBDA 2HGLA 1IQTA 3NNHA 4JI2F 2ERRA 3CPEA 1F2GA 1X31C 3MR6A 1U8SA 2A6AA 2CPJA 4QBUA 3NLCA 1VRTA 1LWCB 3PYGA 2GMJA 2MHEA 5KFQA 3UFCX 1AW0A 1RCXB 2GIFA 1X5PA 5HANA 2P9PB 3CC2N 4U67L 4X64J 3CW2C 2Y8YA 4CGIA 3AD9C 1NPKA 1C1AA 1IBKF 4BRQA 2HZVA 3M2UB 4GV6A 2QA4S 4CT8A 4CJQA 1MMLA 1RT6A 4NA3A 1Q82O 3WEEB 2YJEA 1RDRA 3HK2A 3MECA 3WC0A 4J9SA 3OVAA 2OSRA 3SQ1A 2P9IA 1HNWK 4A2BA 2YNGA 3OYMA 4AILC 3CCSS 4L3KA 3AA8A 4DMNA 2OPRA 4CHZA 1UVNA 2IVNA 3DXKB 1WI6A 1FKAF 4JI0K 4J2AA 2YKQA 3GJSB 2HWIA 4CEBA 4QOZB 4NE9C 2KHDA 3NE6A 1TYQA 2R7WA 4QR1A 1BI4A 3Q8VA 4DPXA 2HSTA 4DR3J 1PIEA 1JQGA 4C3MA 2YX1A 3PG9A 3CJKA 3QEIA 2ASYA 2EC2A 3GPAA 5I42A 1NO8A 2MZRA 2O8EA 3V4IB 2MEWA 3E3XA 4NZ6A 2EC0A 2PAVA 1L3UA 2P9KA 1XNQF 3I56N 4DV2J 3DU5A 2AGPA 2ZD1B 1N0VC 4EZ6A 5AQIA 3DLLQ 3MEGB 3EGNA 5E33A 4MLHA 4AXIA 3G4SN 4CTAA 1QSYA 1S3XA 4YR0A 4ILMA 3VN5A 2WBRA 3R97A 2VD3A 3MM8A 1F9FA 1S4EA 4IOAL 5B0DA 2XTJP 3ONQA 3RBXA 5AQTA 1J54A 2EVZA 1YXQA 4H0XB 3RWUA 4ZPBA 3DI6B 2WSCC 5CYJA 2E1ZA 4YB6A 3EZUA 2DR8A 4USMA 3FFIB 5CYMB 1HBUA 3N5BA 2I5JA 1PO6A 2ZOMA 4OX9F 1S1TA 2G1DA 1ZZFA 2WAQD 2FD2A 2YKNA 1EJ7L 5E5NA 1SB6A 3SV4A 5F1XA 2M2BA 4DR4K 4OX7A 3PW2A 3N4PA 4DFJA 4LF7J 4NYOA 4FJJA 3KJFB 4TY8A 1DTTB 3EN9A 2DHAA 4HTLA 4RWTA 2M8HA 3NGSA 4XDDA 3M1FA 2IC3A 3TABA 3CCEN 3WZ0A 2RRBA 3M6XA 2YWHA 2J4RA 2KJVA 2VZ9A 2CA9A 4NPOA 1P1TA 3L3VA 5HRSA 4M5KA 1S5ZA 1BC6A 4Z4CA 1HR0K 3OHAA 2P5GA 3D2WA 1UEKA 1JJ2M 4B3OB 3JS9A 1IJJA 3ILJA 3CXCM 4LF5J 4DL0C 3F41A 1IG8A 4LIRA 5D6GA 2HVEA 4CLPA 4U8YA 3BH7B 1N6QB 1T6CA 4DN0A 1M90T 1FX2A 1YTUA 3N4QA 5IT9U 1LEOA 2E5JA 4P74A 3VCDA 1HWLA 1TV6A 3M4XA 4C0BA 4QS8A 3VEWA 2ZH8A 1K8AO 4XH1A 4YNQA 5GAGI 4MO4A 1S76D 3W2VB 3MD1A 1A5VA 2V4JA 4HH1A 3PX0A 5D77A 1HNXK 3NBPB 1YIJS 4H4MA 2GJIA 2F65A 4OLOA 3THVA 4DX7A 3JSMB 1F5BA 2BJ3A 1DFDA 1H2TZ 5C25A 4IBNA 1O1WA 3T1HJ 2IJRA 1HNXF 1YHQN 4CH1A 2GMLA 1VISA 1UETA 4LJMA 2GMHA 1M0SA 2F9TA 3SCIE 4ZPTR 2P6SA 1BCOA 1SL1A 4URGA 2B5JA 1FK9B 2B7CB 1Z4UA 5LL6d 4D3GA 4NLTA 1S0VA 1WNEA 1HBNB 3B54A 2YPZA 2HFOA 2D41A 4CHNA 3TAPA 3P5TL 2XLIA 1VSJA 2UUBJ 1NMEB 3MAHA 1RP5A 4ZVHA 1BQNA 1H7WA 1XNQK 1RBOB 4CF8A 4AQYJ 3FEXB 1BA1A 2QWOA 4ED0A 3GCXP 2UVWA 2AYMA 5B0FA 3FBBA 3PW5A 4KKOB 3D1OA 3SMZA 4CZMA 2A1RA 4CO0A 4F02A 1Q81T 1QE1B 3SI6A 2K3KA 3PJWA 4CEAA 3HSJA 3CCJN 1XNRK 3DN9A 4OYBA 3CCMN 1TL1A 1YSJA 2V8HA 4FS2A 4X4OA 4BR4A 3EXCX 1M5SA 5ETVA 3CIZA 4B3TJ 3OLAA 2O8EB 4X4UA 3O9TA 3O5TB 4N76A 2W2MP 1DLOA 4G9ZA 1UZDA 4RUHA 1T3NA 3M6GA 5BN9A 4CECA 2NZTA 3CJ0A 2K2PA 3M9OB 5D4NA 1C1BA 4ATNA 3AO5A 3RAQA 4AE5A 3L4QA 2CJXB 4JI6F 5JS2A 4RW6A 4CLTA 2GV1A 3QO9A 4K4ZA 3V81B 1J2VA 4OX6A 3RBEA 1T05A 5AZJB 4G3IA 4ELVA 3MWBA 4CO1A 2R8HA 4JV5J 4CD3A 4AH9A 1IM4A 3UNYA 4O5BA 4DV1J 1S1VA 1NK9A 2UU9F 1VQNN 5GMEA 5A2QY 1EX8A 3OYAA 3WXMB 2UUBF 1KLMB 2MKYA 1S1XA 1GOBA 2AMCB 1VBYA 4RG8A 1UP1A 1MWZA 1SQEA 2ZOGA 2QTDA 1QHTA 1TKZB 4NI2A 4KHNA 1CLFA 1XEZA 1JLCA 3S1TA 3HFVA 5IS2A 4DV5K 5CCLA 2QL9B 4LQ9A 4K4XA 1OH8A 1JLQA 5HVGA 5A8WB 4CJUA 1GXTA 3D4JA 3IM9A 4AHUA 2X6SA 2IDLA 2UV8A 2UXDK 1IJEB 1N5VA 4Y2KA 2XGPA 3DRRA 4AL6A 3DLEB 3D6TB 1XMQK 4JB8B 3J81U 4JKDA 1X3MA 4F25A 4OO1J 2J8AA 4DV3F 3H5UA 4E0DA 4DBQA 2OPQB 3OS2A 3ZC4A 2AJ1A 2ZM6F 1IUJA 3QT8A 1HQUA 5EWFA 1KQSM 2IVPA 4OIXA 1S72N 3SBMA 3AOBA 2AP1A 2GHVC 4RNMA 5AQWA 5DDPC 5JMVA 2HAFA 4DKWA 1WNSA 2W7PA 3FSYA 5U47A 2E1MC 1TV6B 2LQ8A 2OFHX 4J9MA 4X66J 1WF1A 2QE5A 3I8BA 2H54B 2Q1LA 4YOTA 1FVQA 4ZPDA 4JK7A 1HD0A 3D68A 4DSKA 1U7LA 1DKGD 2UVUA 1EO1A 1U04A 3ID8A 4PKGA 3NBPA 1RWNB 1VQMS 5ITHA 4JI8K 3AB2B 2QEXN 1RHUB 2QYGA 4L3NA 3K7RA 3UWTA 3H46O 5FPNA 4H4KA 3DAWA 3N6MA 1FDDA 4M5LA 5J1NA 4KIAA 3QEWA 2P5OA 3JXOA 2D9PA 1SKSA 4CJTA 1WG1A 3B8HA 1C2PA 5KOWA 1NAQA 2C2ZB 2ZOFA 3L09A 1DEJA 3TQEA 1BISA 4BRIA 1S49A 1X4GA 1IBLF 1Q8BA 2DO4A 5HN0A 2MKCA 1SL0A 3H7HB 1KC8O 3PY8A 4Q7AA 2IVMA 1RTJB 3H45C 2AIRB 1NJWA 4FYXB 1LK5A 4QYRA 1UAXA 1TKXB 3SQGB 1M1HA 2VCPA 4E1JA 3MN5A 3DLBA 2LXUA 2MKHA 2HRYA 4F2RA 1C0FA 2FF6A 4Z7CA 2QV6A 1P9QC 1DGKN 3AVAA 1WOPA 2ZH4A 2IS3A 4LT6A 1WUUA 4KHRA 4B9LA 4DF8A 4X64K 3EUNA 4BRLA 2ASJA 1DRZA 2FY8A 1D09B 2CH6A 5E3QA 4A8QA 1BU6O 2O4IA 1D1UA 5KFGA 3A8JA 4ISEA 1B7YB 5BRFA 4GVEA 3GFXA 3SK3A 4KTQA 1HKGA 2HEKA 4NLYA 1CSJA 2ZH6A 4BHQA 3G6VA 1RTDA 4IRDA 3I87A 1HJOA 1M90O 3EYZA 4E89A 3HCXA 4YR2A 3DMJA 3LPYA 3BKUA 1T7PA 4B9VA 4Y3CA 3MFHA 2AF6A 4CIGA 4E7KA 2QG9B 2AX0A 4O3NA 1YJ9N 2U2FA 4PEOA 3K8VA 4YY3J 4OHYA 2AYGA 1G3OA 3ENWA 4OYMA 4FWNA 3D2EA 4EP4A 5KFJA 3W9HA 3W66A 2F8EX 4OI3A 2A2CA 2OPPA 3VGUA 2AV5A 1EARA 4MAKA 3D5MA 4QIVA 1BDGA 1CBKA 2V94A 4JEPA 1C4CA 4OYZA 4LH4A 2R2UA 4CJFA 4GC6A 4BVPA 3LPEA 3AY9A 2V4RA 1AYEA 1K9MT 4X4SA 2O5DA 1IVZA 2YHXA 1N0UA 1XMOK 3AVGA 2R42A 2L41A 3SAGA 3C66A 1PYSB 4PG6A 1E4FT 1DTQB 4E7HA 2F4VJ 1ZAVA 1KP6A 1NJXA 3SCJE 5DZ6A 4IO8A 2F96A 4IYQA 1AFJA 4NMLA 1SJ3P 4ANDA 3Q8QB 2VODA 5F3TA 2AZ1A 2BM0A 3KLFA 1XC3A 4PUOB 4KPYA 4LQ3A 3U1NA 3M8WA 4F3MA 1ROFA 4DL3A 2JWNA 5KFIA 3M8RA 5EWEA 4PR6A 4QIWD 5BR8J 3VEOA 2VICA 2UXCJ 4YR3A 1G2EA 2VOPA 1SKWA 3D2FA 1RBVA 1KXPA 5A8KB 3OTBA 2RE2A 1VQ5S 3FQKA 4HTIA 4KV8A 1GMWA 3KMQA 2ZWOA 3GP9A 3J80O 5D3GB 1QVGR 4EO8A 1N32F 1HMVB 2K8GA 1FNMA 4Z4FA 1IQZA 3MFIA 4K5RA 5JLHA 3M8QA 2E20A 3TAGA 2C2MB 1LKZA 2V7YA 1TGOA 4CESA 2DRBA 3BYRA 2NLXA 1FJCA 1ZBHA 2QWMA 3LF0A 2DFHA 2VPXB 4JOUA 4DFMA 4A8FA 3GONA 4JI4J 5AQPA 3GR1A 2CNLB 2YX4A 2XGQA 5LMNF 2YCHA 2NUHA 5CHCB 3AOCA 2ZC4A 1NOYA 4LF6K 2Q43A 4JKEA 1S1UA 1CLQA 3T41A 4CH7A 2G0IA 2YNIB 4X4QA 3L8BA 1RWUA 1ZPVA 5IXUA 4DJBA 2Y1JA 2ZM6K 3NVKA 5LMNK 4K4VA 4B9NA 3ISZA 3UDVA 1RAHB 3LPUA 3VEZA 1HNIA 3CF5Q 4GVBB 3ZCMA 4DTXA 3OR1A 2I7PA 1FWPA 4K7QA 2FSNA 4MTPA 1Y11A 1WOOA 1VRUB 1EKSA 4FWPA 2JX2A 3L2RA 3W2WB 4CLSA 4U7UD 1BG3A 4FK0A 2HSEB 3WXIA 1ZBLA 4P10A 1RT5A 3C95A 1NU0A 5G0RB 1RLCL 2KW4A 4NLBA