1C0TA

Crystal structure of hiv-1 reverse transcriptase in complex with bm+21.1326
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
536
structure length
490
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTGKISNPYNTPVFAKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (A-CHAIN)
publication title Crystallographic analysis of the binding modes of thiazoloisoindolinone non-nucleoside inhibitors to HIV-1 reverse transcriptase and comparison with modeling studies.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 133
structure length 490
sequence length 536
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1999-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1c0tA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1c0tA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1c0tA05
3ITHB 3AO5A 4ZTFA 1S6QB 3O3FA 5J1EA 2E9TA 1C6VA 3FDSA 3DM2B 3G6YA 3T3FA 3LZIA 3PZPA 1SKRA 2JC1A 1HQEB 2HHTA 2E9ZA 1S5JA 5F8NA 3DLEB 4OGEA 3H5XA 4FJLA 3DRRA 4YQWA 1WAFA 2BRLA 3KD1E 2D3UA 2BRKA 3BSCA 2HHWA 3SV4A 4IQXA 3HVTB 4E7LA 5KGXA 3SFGA 2KFZA 3M8QA 2J6TA 4CEQA 2OYQA 3H08A 4LY7A 2YNFA 3KHRA 3WNFA 2QXFA 1HARA 3MR2A 4IBNA 2WK4A 4KI6A 4F4KA 1HYZA 4EZ6A 5DMRA 3K5MA 1EETB 4NLWA 2IAJB 4IH5A 5JUMA 3THVA 4RW7A 3VQ8A 2W7OA 2HNYB 2KZZA 3ITHA 3K57A 1KVCA 1JXLA 1S6QA 4Q44A 1LAVA 3E01A 2VG5B 2IGIA 4TY9A 3AVGA 3DM2A 3IN5A 2YNHA 2RN2A 4N5SA 1GX5A 2AU0A 4M3TA 1S0MA 1HQEA 1JLGB 4O3QA 3DLEA 4K4ZA 4NYFA 1QUVA 3BSAA 3GIKA 3PX0A 1JLAB 1KSPA 4ZPDA 3I8DA 1QSLA 1IKYB 1YTAA 1L3SA 3QIDA 1W25A 1VSDA 2D0CA 5KI6A 1X1PA 3JYTB 2R8JA 4YR3A 3AVMA 1ZTWA 4ID1A 3QYYA 4CJVA 3RB4A 3TR8A 4XO0A 3QZ7A 4AHCA 2EHGA 3Q8SB 1ZBLA 1EETA 4KBIA 2IAJA 5KG5A 3KK3B 1IKVB 2OPQB 4CJEA 4CJRA 3MTKA 2O4GA 2UVRA 4K8XA 4CJFA 5KG2A 1HJRA 3ZT3A 4CF0A 4ELTA 3RR7A 1JLGA 3CWJA 4MIBA 3VQ5A 4KB0A 4K8ZA 1SL0A 4JV1A 4ZTJA 4J9NA 1T8EA 1T3NA 1IKYA 1N56A 4OLBA 2BQUA 1N4LA 3NGDA 3ULDA 1HPZB 4O3SA 1NJWA 5KTQA 4O4GB 3RMDA 1BQMB 4LSNA 4YFUA 4HYKA 5KRTA 2BDPA 1C1CB 4TQSA 4YNQA 4FLXA 2UUWA 4IDKA 2RKIA 2YNGA 4HTUA 1KLMB 1A5XA 2HNDA 1WSHA 4I2QB 3PVXA 3G10A 4CFAA 5J2QB 1JLFB 1HMVA 3DLHA 1WLJA 3DRPA 1HYSB 4DS4A 3M8PA 3V81B 4RUAA 5I42B 4H4OB 3NCIA 3UIQA 3FFIB 3PO4A 2W8KA 3B6OA 3C95A 1DLOB 4DMNA 3ZCMA 1RTDB 1Q9XA 2F8TA 3OYDA 3CIZA 2YV0X 5FRMA 1RT1A 3PW5A 3I0RB 2DY4A 2ILZA 1S1XB 4OKKA 1HPZA 2IM1A 3H98A 3L2VA 4TQRA 1UAXA 3OS1A 4O4GA 4TN2A 1BQMA 2IC3B 4R8UB 2HWIA 4CF8A 4Y3CA 2XO7A 4IRKA 4ECXA 3QINA 2HWHA 1ASVA 5KFPA 4JRPA 1RDCA 4I2QA 2P51A 3GQCA 1TK0A 3K59A 1N6QA 1SV5B 5C5JA 5KFMA 3RMCA 4WYLA 3V81A 5K14A 3WNEA 3RRGA 4DL4A 4H4OA 3NAIA 4EP5A 3FFIA 3TAPA 1DLOA 2R8IA 1RTDA 3OYHA 2DFFA 3LWMA 4CERA 2WRMA 3S3MA 1BI4A 1SUQB 4EZ9A 4BDYA 3ZT4A 3OS0A 1LAWA 3CJ0A 2ETJA 2IC3A 3BREA 4R8UA 3OHAA 4FJNA 1TKTB 3NHGA 3U3GA 4XPCA 4KKOB 3AV9A 2HHQA 4B8CA 2FJWA 3T5JA 3UQSA 3HKWA 4RW6A 2GV9A 4KHWA 3V9ZA 2AX1A 4WZQA 3KLGA 1NK0A 1TQLA 3KKRA 3RR8A 1S9FA 1XWLA 4CJ4A 2DPJA 3PW0A 5F8JA 4EP4A 2GIQA 5F9LA 4KE5A 1B9DA 2HVIA 4K50A 2QE5A 4CGDA 4CIGA 4LH5A 1SKWA 4CJWA 4FVMA 3BJYA 3OJUA 3V1RA 3D5MA 3IAYA 3LP1B 4FJKA 4O0JA 4DL7A 4KKOA 3KOAA 1RILA 3RRHA 2A1RA 1LV5A 1JLQA 1YT3A 1S97A 5KFBA 4ED2A 4AH9A 3V4IA 3OY9A 1TL3B 2YNIB 2X6SA 3RBEA 4ZPCA 3CJ3A 4ZVGA 1D0EA 4FCYA 3OVNA 4KTZA 4HCBA 3NFAA 2FJVA 4M3XA 3UPFA 4Z4EA 1UWBA 4F3TA 4IG0A 4NLUA 4WE1A 5KFZA 1KRPA 4O44A 5F8IA 3LWLA 1TKDA 4H54A 5T7BA 1BQNA 1S1UB 4IR1A 4Y2CA 1S6PB 2FLNA 3SFUA 3PW7A 4M41A 3H5UA 2ITGA 5DGAA 1TL1B 4AHVA 1JLCB 4CJ3A 4M45A 4CGFA 3RMAA 3LAKA 1VRTA 4QWCA 3WNHA 3SV3A 4CFCA 1U09A 4ZVHA 3CDWA 4IR9A 1U45A 3GV8B 4K4YA 1XC9A 1WSJA 1TL3A 2YNIA 5KGWA 3ZT0A 2ASLA 4FJHA 1U48A 3PJXA 4TY8B 3IGVA 5F8LA 4DTMA 3V6KA 1QSYA 3QO9A 2NUBA 1ZBIA 2D0AA 5T14A 4E7HA 3NH0A 1QTMA 1S1UA 4M94A 4NLSA 4CHNA 3OYCA 1NK4A 3LDSA 5CY4A 4DG1B 1TL1A 1NKEA 1FXXA 1JLCA 3T1AA 4DTJA 1JXEA 4KHSA 1HNVB 2IOCA 4DU1A 5HRSA 2ZD1A 2JLEA 4W5NA 1MU2B 3TAMB 3K58A 2OPRB 3OYLA 3U3YA 2D3ZA 3Q8PB 3L3UA 1RTJA 3V9WA 3TWHA 2KZMA 4FBUA 4ZHRA 1A5VA 5CYMB 2HHVA 3PUFA 4CJQA 4WXOA 3LP0B 4FM1A 1SH3A 3OL7A 1RBTA 4CCHA 3VQ9A 1WNSA 1C0TB 2BE2A 3PR5B 3PV8A 4F2SA 1S10A 4ZVFA 4JS5A 1ASUA 4DG1A 4J9OA 3OS2A 4ECQA 5EWFA 4OGCA 1HRHA 4FJ8A 5HROB 1BIUA 2P5GA 4CEFA 5E41A 1RBSA 2VG6B 3CJ2A 3KHGA 4EBDA 1W0HA 2X78A 5DG9A 3DI6B 5J2PB 1DTTB 3HPHA 1ZETA 2JEFA 3VQSA 3TAMA 3HVRA 3O3HA 3P1GA 2OPRA 2HHXA 3QEXA 4NLXA 4YP3A 1IKXB 4H4MA 2DFHA 1KTQA 4OJRA 4R5PB 3TARA 1RTHB 5CYMA 5KFVA 3LP0A 2C2DA 1HQUB 4Z4HA 1Z4UA 2W9BA 1RT3B 2V4RA 4NCAA 4ECYA 3B6PA 5DQGA 2B5JA 2W42A 2XCPA 3SJJA 1ZBUA 2B43A 4DSEA 3SQ4A 3QETA 5KFTA 4IFYB 2AGQA 4G1QB 1S9GA 4BWMA 3DI6A 1K1SA 4NLVA 4ECUA 2X6NA 1IO2A 3IRXB 4QW9A 4XPEA 3CDUA 1Q9YA 4Y2AA 4RZRA 1GX6A 2OPSB 2WOMB 3PJWA 4ECRA 4B9LA 3OYBA 2WB4A 1IKXA 2F8EX 4ID5B 2IBKA 4DTOA 4R5PA 4CEDA 1D9DA 1RTHA 1NJXA 3M9MB 4FM2A 3KMSA 4FS1A 1HQUA 4CK3A 3H2LA 4OL8A 3TAEA 4RG8A 4Z4FA 1RT3A 4CJ5A 4C8KA 2R2SA 3BSOA 3OYFA 3FQKA 3MR3A 3MXMA 4Z4GA 5KG7A 2UVUA 4K4VA 4FLTA 4I2PB 1Z25A 3HVWA 1N5YB 2G8HA 4IFYA 3EPIA 3CM6A 2WCXA 4YMEA 3AO4A 3DMJA 5J2NA 1JL1A 4CF1A 2IA6A 1JLBA 2OZSA 3HT3A 3LPUA 2DFEA 2WOMA 2XY8A 4CHYA 4DWIA 4EYIB 2AGPA 2OPPB 2R8GA 3BGRA 3MR5A 4CIEA 3KD5E 4BE2A 3VQPA 4TSXA 1WSFA 1ZBFA 3NF8A 4Y34A 3ZSQA 1K6YA 3FRZA 3OYEA 4ED6A 5KFCA 4GC7A 3OYKA 1B9FA 4CHPA 1EP4B 2ASJA 3SYZA 2FC0A 4DL5A 4TYBA 3G0ZA 3A2FA 1U49A 4I2PA 3O4NA 4MKAA 4HKQA 1J53A 3QEWA 3NH2A 1VSKA 3ISNC 3H4DA 3CQ8A 4GW6A 3HP6A 1EXQA 1RT6B 2BQRA 5KFWA 1BISA 3ALYA 3QGHA 4KHNA 4F50A 2YKMB 3HVTA 1L3TA 4NCBA 4W5TA 2WHOA 5KFSA 3MECB 2D7SA 3H4BA 4ED7A 3HP9A 2YKNB 1T05B 2OPPA 1VSIA 3KKSA 4DS5A 1R0AB 2EC0A 2FBTA 1JXBA 2ILYA 4I9QA 3AA2A 3I5AA 4MK9A 1TK5A 3BSNA 4Q5VA 2HNYA 2IJFA 2WTFA 3SCXA 4B9NA 3V6DB 2Z1IA 4G3IA 2F8SA 2VG5A 2X74A 3V1QA 1EP4A 3ASMA 2XI3A 5HBMB 5HRPA 3HPOA 2JC0A 1TAUA 4ZVEA 2OA8A 3NKYA 3NBPB 4OPKA 3AA5X 4PY5A 1VRUB 1LWEB 3VQCA 1JLAA 2YKMA 4J2DA 3SZ2A 4KHQA 4BACA 4CJLA 4DTSA 3JYTA 2FVRA 3MECA 3Q8RB 5CZ2A 3F73A 4NLDA 4DFPA 3U6FA 1ITGA 1T05A 4C8MA 4NLPA 2I5JB 1VSLA 4ZP8A 4MQ3A 1DTQB 3AVNA 4RW9B 3HPGA 3KK3A 1IKVA 5KT2A 1UA0A 2OPQA 4PQUB 1S1VB 3E51A 3SQ1A 4MIAA 2CKWA 4Z0UA 4CHQA 3HL8A 3DDKA 3RMBA 1BCOA 2A1SA 5HBMA 1ASWA 3C6UB 4NYZA 3CG7A 3LPTA 4AHRA 2IJNA 5KFHA 3N6LA 5EWGA 2PYLA 3VQ4A 3HXMA 4DL3A 5KT7A 5KFQA 4IG3B 4F4ZA 1X9MA 4KHRA 3KLIB 1TP7A 4JLHA 4EBEA 4QW8A 3MF5A 4O3RA 2I5JA 3C94A 4FLVA 2HW3A 1RT5B 2RDIA 1DTQA 4WFXA 3MAQA 4FJ5A 4B3OB 1QHTA 4RW9A 1JIHA 2ATQA 1C1CA 1S1VA 4E1MA 3LP2B 4CEBA 4LD0A 5D3GB 3ZSOA 2GC8A 3ZSVA 3LP3A 3I0SB 3NGYA 1KLMA 2P5OA 5KFRA 1RTIB 5DQIA 2Y1JA 2XHBA 2R2RA 5J2QA 1JLFA 2C22A 1UOCA 2R7YA 2XGQA 4NLQA 3VA3A 3TAQA 1HYSA 4EYHB 4J9LA 5DK5A 3NGZA 4EO8A 1LWFB 5I42A 2XY6A 2AQ4A 3M8SA 3RB6A 4NRUA 3QLHB 4RNFA 3K5NA 1KVBA 2XCAA 1YVFA 1HYVA 4J2BA 5F8MA 3I0RA 2ZQBA 2HNZB 1FKPB 1S1XA 2UVVA 3AVLA 1L5UA 4QPXA 3CVKA 4IRCA 4W5OA 3G86A 1SL2A 1TAQA 1L3UA 5HRRA 4WZMA 2FVPA 4B3OA 1VSFA 4CJUA 2BANB 3OL9A 3KK2B 4RW4B 3TABA 3MFIA 3MXJA 3SUQA 3TAFA 4HVJA 1NK6A 4RW8B 3TVKA 1RDDA 4CIFA 3GIIA 4J9SA 1C1BB 3KLFB 3HJFA 1VSHA 1JKHB 4OKEA 5C25B 2CJQA 4CESA 3KMQA 3MEEB 3AVCA 4FJMA 1SV5A 5CYQB 3C6TB 3M8RA 1FK9B 3OL8A 3QIOA 3D0PA 2ZKUA 3N6NA 3CO9A 1S0OA 4GVMA 1RDAA 4B9VA 4X2BA 1RBVA 3KJVB 1SKSA 3DLKB 3GILA 5EDWA 4BE0A 5KT5A 3PX4A 5EU7A 1SUQA 4K4WA 4DSJA 4CF9A 2EX3A 3DOLB 1WAJA 4DU3A 2BANA 4RW4A 4WFYA 1J54A 4NLTA 1TKTA 1LW2B 5CZ1A 4KAIA 4RW8A 1NOYA 3L8BA 4FXDA 1VSMA 3EY1A 1C1BA 3KLFA 3CFRA 1JKHA 1KHVA 3QGGA 4MH8A 1JLEB 1FKOB 3H40A 3MEEA 4ECWA 2IMWP 4PWDB 4TYAA 5CYQA 5C42B 4IKFA 3C6TA 5SWMA 3QEVA 1FK9A 5DG7A 1CLQA 1S0NA 4ZMMA 4DTNA 4F4XA 4DEZA 1RCHA 1X9WA 5L1LA 3KJVA 3S3OA 1S1WB 3DLKA 1IKWB 3P83D 4FJ7A 4B8AB 4N56A 5SZTA 2XGPA 1TK8A 4GC6A 4CK1A 4W5RA 1C0MA 3NAEA 3VQQA 2FBVA 4Q0BB 3LP1A 4F2RA 4FZYA 4M3WA 5C24B 2RDJA 1D9FA 4IFVB 1WSGA 3PX6A 1FKOA 1QE1B 3QERA 3NF6A 5FDLB 2GBZA 3AVKA 4KTWA 2JGUA 4PWDA 3FQLA 3EYZA 3H5YA 3PO5A 4DQPA 2AX0A 4RU9A 5C42A 4E7JA 4TXSA 1QS4A 4MK7A 1RDBA 4URGA 3AA3A 2IM3A 3NL0A 2FVCA 1LWCB 2HHUA 4DF4A 5JXSA 1NJYA 4FK4A 1S6PA 1C2PA 1RBUA 4CGIA 2D0BA 2HMIB 2YHBA 2VWKA 3T5LA 3CFPA 3MEDB 1SL1A 4L8RB 3KLVA 1WN7A 4Q0BA 3BQ0A 5C24A 3CDEA 1C1AA 4FJIA 4J9PA 3TI0A 4ECVA 2B6AB 2FVSA 2XY7A 4GMJB 4CHOA 2C28A 1L3VA 1QE1A 5F8GA 5FDLA 4Q43A 2O5DA 4MFBB 4TY8A 4YR0A 1NKBA 3S9HA 2FLLA 3KTQA 3I5BA 4WXWA 1GOBA 2F96A 1LWCA 3KHLA 1S48A 1TGOA 3KK1B 4LSLB 4UQGA 1XR5A 4CJTA 3UDLA 4KFBB 1D1UA 4O3NA 1SH2A 2GUIA 1G15A 4FW2A 1EX4A 3MEDA 5KFEA 3VQ7A 2JEJA 1NNDA 4B08A 1U4BA 3KLHB 1HNVA 4XIUA 4ZP9A 2P1JA 3BDPA 4CEAA 3HHKA 2B6AA 4PUOB 2PZSA 1MU2A 2DTUA 4NRTA 4FLZA 3EZ5A 3AO1A 4MFBA 3OLAA 5KT6A 3M9NB 3PR4A 4ECTA 3L2WA 4ECSA 4JV0A 4KHMA 4ZP7A 3OSPA 4CGHA 2ASDA 4E7KA 3SUPA 4WFZA 2JEGA 1C0UB 3IS9B 3VQEA 3G6XA 3KK1A 1C0TA 3OSNA 4C8OA 4KFBA 1IH7A 3VN5A 2G8FA 5DQHA 3AVBA 2HAIA 3HYFA 1XI1A 3UR0A 4KB1A 4KREA 3O3GA 3KLHA 3DOKB 4Z4CA 5HROA 4DFMA 4I9LA 4KPYA 2VG6A 4OPJA 3IG1B 4FS2A 3F9KA 3OYMA 3GV7B 3T19A 5J2PA 3WNGA 1DTTA 3QNOA 3K5OA 4HCCA 4DLEA 1S4FA 2D41A 4CJKA 4CHZA 4FLYA 2G8KA 1LW0B 1JX4A 4LH4A 3KNAA 1F21A 2QV6A 4EBCA 1U04A 1SH0A 1A5WA 3DRRB 5KRSA 4RNOA 1C0UA 3H5SA 1Z26A 2W9AA 3M8QB 1CZ9A 4AHTA 1NHVA 5KFDA 1D5AA 3H59A 3AVFA 3HM9A 2XY5A 3RAQA 3DOKA 3TANA 3AVAA 2FLPA 2VWJA 4G1QA 4RW7B 4B9MA 4IH6A 3IRXA 3I5CA 3KHHA 4J2AA 5KG0A 3E01B 4WYWA 2Z1HA 4NCGB 4CJSA 3AO2A 4CFDA 2OPSA 2YNHB 1LW0A 4M3UA 4ID5A 4KSEB 4NYNA 4HUGA 3OLBA 2B4JA 1KFSA 4F4WA 4RNNA 4M3ZA 3EPGA 1VSJA 1Y97A 3HVAA 5L1JA 2IDOA 1IM4A 5JS2A 1BIZA 3CJ4A 4NLYA 3V6JA 1D8YA 2V0NA 4Y1CA 4C8NA 3DRSB 2E6LA 4AHUA 4DF8A 1N5YA 4E89A 3RB3A 4ZP6A 2BGGA 1RA7A 4KI4A 4NCGA 5DG8A 4FJGA 3PW4A 4Z4IA 2FVQA 4EEYA 3OJSA 2J6SA 2XRIA 5F8HA 1Q8IA 3OL6A 2W8LA 4IRDA 1NK5A 1YVUA 2YHAA 3ZSRA 4OLAA 4NZ0A 1ZBHA 3ISND 1XHZA 1WNEA 4FM0A 3OYNA 4FZZA 3D28A 3ZSYA 1RA6A 1W9HA 3SQ0A 4U7CA 2G8VA 4URQU 3DRSA 5JS1A 4LSNB 1KCFA 1CXQA 3QZ8A 2PYJA 1RT6A 4BDPA 4FLUA 2KFNA 4IDKB 1I6JA 4K4UA 2RKIB 2XC9A 2YNGB 1CZBA 4O3OA 4QWDA 3TQ1A 3SPYA 2HNDB 3MEGB 4O3PA 4DQRA 3SUOA 3QIPB 1HMVB 2YKNA 4FJ9A 3L2UA 2FBYA 2PY5A 3DRPB 3M8PB 1R0AA 2RPIA 3VQ6A 2WONB 4DTRA 2R2TA 5L1KA 1RYSA 3CYMA 4DL6A 2V4QA 1QAIA 4DU4A 3RAXA 5KFIA 3NE6A 1OS5A 1RT1B 3V6DA 2JEIA 3DLGB 3MFHA 2HHSA 3AVJA 4FW1A 3K2PA 5DLGA 3RTVA 5KFLA 3EZUA 1YTUA 1KLNA 4U6PA 4KAZA 3SUNA 3PY8A 5FROA 1RDRA 1J9AA 2C2RA 1NK9A 3NBPA 3FSIA 2QK9A 1T7PA 1VRUA 2BQ3A 1LWEA 1RT7B 4E19A 4BWJA 4DFKA 3HO1A 4QCLA 3MEGA 5DGBA 2ATLA 3QIPA 3QESA 4M3YA 3HK2A 1N6QB 5KFYA 4HHTA 4Q8EA 4CEZA 2XWYA 3ICLA 2WONA 4DL2A 4EO6A 2Z1JA 5K14B 4O0IA 4R0EA 2C2EA 4PQUA 3OYIA 1BHLA 3RWUA 2KTQA 3DLGA 3N6MA 1BI4B 3ZSZA 1NJZA 2Z1GA 2W7PA 4Q45A 4N41A 3NMAA 3C6UA 4HUEA 5EUHA 3V6HA 4IH7A 2IS3A 2G8IA 4ZPBA 1TVRB 3D45A 1NK7A 1NK8A 4IG3A 4QWBA 1RT7A 2BR0A 4DTXA 1ZTTA 4M95A 5KT4A 5L1IA 3BQ1A 3KLIA 1GOCA 3VQDA 4W5QA 1VK0A 3GIMA 4RW6B 1XR6A 5KFNA 3MXIA 4C8LA 1RT5A 2VA2A 3GV5B 2DPIA 3KLGB 3OYAA 2OH2A 5F9NA 2LSNA 4URSA 2KW4A 4CJPA 2W9CB 4M42A 3OYGA 5HLFB 5KFXA 3LP2A 3VQBA 4LQ9A 5D3GA 2I1RA 3NGIA 2FBXA 3I0SA 1WSEA 1KVAA 1RTIA 4B9SA 1EKEA 3ZT1A 3OYJA 1RNHA 1TVRA 4HUFA 4DSIA 1LWFA 3AVHA 1JLQB 4ECZA 4BDZA 3QLHA 4O4RA 2E9RX 4F8RA 2ALZA 4ED0A 3V4IB 3CJ5A 2QKKA 4BE1A 5KFUA 1O1WA 4RUCA 2HNZA 1FKPA 1UA1A 5KFKA 3QNNA 1HNIB 3KLEB 1J5OB 5KFGA 1S1TB 4N47A 1UWBB 4J9MA 4CE9A 4IG0B 4CFBA 5I3UB 3LZJA 3BR9A 1RT4B 4ICLB 3KK2A 3HSTB 3SPZA 3L2RA 4WE1B 4PA1A 4ED8A 2W9CA 4O44B 5HRNA 5HLFA 4DFJA 4IOBA 2G8UA 1REVB 1KFDA 4KO0B 1BQNB 3DYAB 3T5HA 2VG7B 3KIOA 5C25A 4MKBA 1QSSA 4CF2A 4JS4A 3P5JA 1VRTB 4E1NA 1S9EB 4JV2A 4NLRA 3L2QA 4Y1DA 3LAMA 2E4LA 1IG9A 4KV8B 5KG4A 5KG3A 4J9KA 4FJJA 1NHUA 4FYDA 3JSMB 1RT2B 5KG1A 1HNIA 3PW2A 3KLEA 4RNHA 2R8HA 4NLOA 1J5OA 4QOZB 1S1TA 3GYNA 4J9QA 3QO9B 3VA0A 3PHEA 2Q3SA 3DOLA 5I3UA 1QAJA 1RT4A 4ICLA 4IKAA 3NH1A 3V9UA 3IGNA 1LW2A 2D5RA 3L3VA 3SQ2A 3O4QA 1REVA 2G8WA 4KO0A 3DYAA 4B9TA 4DLGA 2VG7A 1JLEA 2HVHA 4LQ3A 1T03B 3QGIA 4DTPA 1RYRA 2OZMA 1S9EA 2XI2A 2QKBA 4KV8A 4FLWA 1B92A 5KFOA 2ZD1B 3ZSXA 4K4TA 1GOAA 1U47A 1N48A 4FK2A 5KT3A 4OVLA 4I7FB 4JUZA 1S1WA 4JRQA 1IKWA 3JSMA 1RT2A 4DQSA 4QAGA 5HP1B 4DQQA 3V9XA 1RTJB 3G6VA 3RB0A 2V9WA 4Q8FA 3DLRA 2O4IA 4ZHRB 4CEOA 1I3AA 2FJXA 4B9UA 1X9SA 4FJXA 1WSIA 4FBTA 2BE2B 1BL3A 3AVIA 4E7IA 4IFVA 2IM0A 4M3RA 1T94A 3VQAA 2E6MA 1T03A 3TAGA 4DSLA 4O55A 4F3OA 2Y1IA 4MK8A 3V9SA 1TV6B 4ED1A 4AHSA 5EWEA 4I7FA 3NF9A 3ZT2A 3S3NA 5KG6A 4O5BA 1I39A 3NDKA 4KHYA 5HP1A 2HMIA 3QEIA 4ZPAA 3SNNA 4ED3A 4H4MB 3AA4A 4CK2A 2UVWA 4NLGA 4E3SA 3DLBA 4KHUA 2RF2B 2AGOA 3CFOA 1TKZB 4DQIA 2W9BB 4QWEA 2AWZA 4CECA 4K4XA 2R2UA 2HB5A 4J9RA 2B5JB 2J6UA 4CEEA 3BQ2A 3RBDA 3LANA 1RBRA 4KTQA 2AJQA 4FZXC 4KB7A 1ZYQA 1TV6A 1S9GB 4ELUA 3MR6A 2GIRA 2R8KA 2UUTA 5L9XA 3T5KA 1NOZA 4LSLA 1BGXT 1VSEA 1XHXA 3SI8A 4E0DA 2VA3A 5KFFA 4RNMA 4H8KA 4TLRA 4J2EA 4K4SA 3K5LA 2ZE2B 1MMLA 3NF7A 3M9OB 1TKXB 2RF2A 1RAJA 1NKCA 4F4YA 3OHBA 1TKZA 5J2MB 3Q8QB 4AILC 1QQCA 4PUOA 4DSKA 4QWAA 5J1EB 2IM2A 1CSJA 4DSFA 4ELVA 4N76A 1KHWA 4YR2A 3NAHA 3AO3A 4CGGA 1S49A 4CGJA 3SI6A 3DMJB 5J2NB 5FRNA 5KFJA 3IS9A 3ZSWA 1JLBB 3V1OA 3GIJA 1BCMA 1K1QA 3BGRB 4FK0A 3LALA 4DTUA 2YNFB 2ZE2A 2KQ2A 1TKXA 1JL2A 5DLFA 5KFAA 4OKJA 3CM5A 4KRFA 5J2MA 1XR7A 1CXUA 3IG1A 3QEPA
chains in the Genus database with same CATH superfamily
3MN6A 4BRKA 3BKFA 2E9TA 3PHTA 3VAKA 2GUPA 3T3FA 3A12A 1N36K 4DPXA 3JQJA 2A3ZA 1S5JA 3PFEA 4MO4A 3DLEB 4OGEA 5THWA 4OZ1A 3A8KA 5IV4A 4FJLA 3DRRA 5DETA 4BRFA 3N0VA 2QWPA 4A62A 4IQXA 5M1OA 5ETVA 3SFGA 2KFZA 4WPAA 1KD1T 1SI9A 2NRVA 1BG3A 3KFWX 1GT8A 1HARA 2WK4A 4EZ6A 5DMRA 3CC2N 2XMJA 4IH5A 2DGSA 3T7ZA 2DHHA 5JUMA 1Y3JA 2NLXA 2KZZA 1CPZA 3OTOK 4Q44A 1SJFA 2VG5B 2YPYA 3L09A 3VENA 4N5SA 1SB6A 1GX5A 3JSRA 2U1AA 4KGZB 4O3QA 2SXLA 4M5LA 3DLEA 4NYFA 1R59O 3GIKA 1KSPA 4EHTA 1YTAA 1DARA 2ZM6K 3QIDA 1W25A 5ADZA 1VSDA 2D0CA 5KI6A 2R42A 4YOYA 3BZQA 3RB4A 4XH4A 2GMHA 1U6BA 3FGUA 2HGMA 4HI2A 5IC4B 3TOQA 3KK3B 2OPQB 4DHVA 3DRXA 5IT4A 1VK8A 4CRJA 2OELA 2CQGA 3D3CJ 1UVIA 3FCVA 4P52A 4NO7A 4OYIA 5KG2A 3ZT3A 1YJRA 3CWJA 2XZWA 1SL0A 4JV1A 2HURA 2V68A 1J27A 3UD3P 3L4IA 3UDCA 4PXDA 3B4MA 3FZMA 4DPTA 1I51B 2BQUA 1N4LA 4JV5J 1MMNA 3VTIA 3OUYB 3ETOA 1HPZB 1BWVA 3UW1A 4JBCA 3J80Y 4WQ4C 5GADU 3RMDA 1IBMF 2HF3A 2H48B 2O8CB 1R8CA 4HT7A 4YNQA 1QDUB 4GKJK 4HTUA 3CD7A 1WKLA 2VDHA 2J9CA 3D6TB 2HNDA 1WSHA 1YRTA 3G10A 4CFAA 3I6PA 4LJMA 5LXRA 1HMVA 3TSPA 3FUYA 3LDQA 5D8HB 4IOCQ 1NAQA 3THPA 3OTCA 4H4OB 3FR0A 3UIQA 2BEFA 2W8KA 3B6OA 2E1RA 5FRMA 4LF1A 3I0RB 3OUYA 1S1XB 1HPZA 3MI7X 5GVQA 4P73A 1G1XA 1NU4A 3L2VA 1HD0A 3TPQA 3NNHA 3OS1A 5AZJB 4MT1A 3MM9A 1WOSA 2ROGA 2HWIA 1F3FA 4WCEL 2MSSA 1HR0F 4IRKA 4MKYA 4ECXA 4FOEA 2QZ8A 1CS4B 3KUGA 3QINA 4LT6A 2HWHA 2CVEA 3MD3A 4JRPA 4DR7K 3CJBA 3LM2A 1NSAA 2OTJN 3K59A 4USKA 2B51A 4DL4A 4H4OA 4EP5A 2A0FB 2V2VA 5SUHA 4DV4J 4C23A 3LWMA 3CTRA 1D4XA 1SUQB 1WC4A 3ATUA 3OXGA 2N4DA 4EZ9A 1NDLA 5AZJA 2AKWB 4Q7AA 3CJ0A 1Q95G 2VBXA 3BREA 2B9EA 1TKTB 4KKOB 2Y8WA 4B8CA 3D6RA 2FJWA 3T5JA 1YZ6A 2B8QA 5D6GA 2P9EA 4DCPB 3GFYA 1VBYA 4IO9L 3M05A 2B8PA 4M8LA 2AX1A 4JI6F 1HUXA 2KVIA 4CZFA 4ZVTB 3TUJC 1XWLA 1YJWS 2IRXA 2YWWA 2CRLA 1W2BR 4KE5A 2BYCA 4DJBA 3P4UB 1YQHA 2QE5A 3OA9A 2DXEA 3IAM9 4UY85 4DU7A 4LH5A 4CJWA 3I31A 3M7VA 3OJUA 3BJYA 4XEIA 3AB4B 3VAJA 4O0JA 4YHHF 4KKOA 3KOAA 2ZOMA 3QT7A 1HWLA 3MM8B 1YT3A 4OYOA 1S97A 5KFBA 2YNIB 1V4SA 4ZPCA 3TEHB 3ILIA 3I9ZA 3ZZUA 4FCYA 1HNXF 4KTZA 2MJNA 2RRAA 4HCBA 1RJJA 2FJVA 2E5LF 3UPFA 3CCEN 2ZC4A 3NVMA 4XAKA 1HX1A 2YHXA 4CZLA 2QL7B 3BDEA 4RKUC 1T9XA 4O44A 3BZKA 5E2QA 1Y0HA 1TKDA 3W63A 1T9VA 3CE8A 4HLBA 4AE5A 1CQMA 4M41A 5DGAA 3RMAA 4J91A 3WNHA 1H7XA 3CDWA 1VQ6N 4FPIA 2W4CA 3ILLA 4ES2A 4ZOSA 3NGSA 1WUUA 4K4YA 2LCWA 1WSJA 2QC3A 2YNIA 3ZT0A 2MB0B 1U48A 4DTMA 4DR4K 3IBWA 1HWUA 2DEJA 3CCJN 1ZS6A 1VQLS 3AY0A 3NH0A 4DR3F 2C2OB 1BLUA 1HLWA 4NLSA 3HLUA 2GGPB 1EIYB 3OFHA 3OTOF 3OBWA 1WELA 4DG1B 1NKEA 3NOCA 1OYEA 4DTJA 1JXEA 3KNGA 1Q5YA 2E5IA 1MA9B 1VQ8N 2IOCA 4FVCA 1RKIA 4ZCMA 1VQNN 3EGZA 4WFAL 2MQLA 3G6ES 2ZD1A 2JLEA 1WOQA 1N33K 4W5NA 4OYAA 3CJCA 5E3PA 4CO0A 2D3ZA 1RTJA 2DO0A 5ETMA 4JAXA 3TWHA 3THTA 4ZHRA 1A5VA 5CYMB 2P9NB 3C15B 4CJQA 3OL7A 3VQ9A 3MM6B 3PR5B 4ZVFA 5B0EA 4DG1A 3OS2A 2RQ4A 4WIIA 2B9YA 1WF1A 3M6UA 2FPHX 5GAGI 3THYA 4FJ8A 1BIUA 3FSYA 4Q2MA 1TR0A 3KHGA 2A6MA 1W0HA 1G3OA 4AUKA 2X78A 2G0CA 3DI6B 1K8AO 3OR2A 3SLCA 2EEYA 5GINA 4CZKA 3O3HA 1U6ZA 1RCOB 3R7SB 4XDCA 4YP3A 1KTQA 2DNNA 4R5PB 3CF5L 3W3DA 3TARA 3AY9A 5CYMA 2FJAB 2APOA 2ZJQQ 1HQUB 4KGVB 4OPHA 4YS2A 4JI0F 2QWRA 2XMUA 1IUJA 4RU2A 1NPPA 4GKJF 2HFNA 3SMZA 2XCPA 2P9CA 3NEKA 3SQ4A 4F04B 2GO8A 3PLAA 2J76E 4G1QB 1S9GA 3TTFA 1NMNA 5CH7B 3DI6A 1IO2A 3IRXB 2YBVA 1DEJA 3TQEA 4DMZA 4MIWA 1Q9YA 4Y2AA 1VR6A 4RZRA 1GX6A 5LJVA 1N88A 4LRCA 2HHPA 2WOMB 4BRAA 2XG8A 2WB4A 2F8EX 4ID5B 3GPAA 2IBKA 4R5PA 3F9MA 1IR1A 3M9MB 4FYXB 3TX8A 7FD1A 2MGZA 3KMSA 1HQUA 1WOPA 4C8KA 2ZC3A 1VLOA 3BS9A 1EJ7L 3BSOA 3BKUA 4DR7F 4KH4A 4K4VA 2VBWA 2BJEA 1Y3KA 2QLFB 4HEA9 4D3GA 1W2BM 1M1KT 1GLAG 1Z25A 1FEEA 2O01C 5F0WA 3EZWA 2G8HA 3K0SA 4I1TA 5F2RA 3CM6A 2WCXA 3AO4A 4OQJA 5J2NA 4CF1A 1HIYA 3D2FB 2C3OA 2WOMA 2XY8A 2CDRB 3GSIA 2OPPB 5A6WA 4CIEA 3GB0A 2CVIA 4TSXA 2XM3A 5KQ8A 3ZSQA 2KYXA 3OYEA 2R7WA 3OYKA 3HI9A 1KKHA 3Q24A 1FD8A 2N3OA 4ISFA 2R7QA 2FC0A 4TYBA 3G0ZA 3L0QA 3O4NA 3PRVA 4MKAA 4HKQA 4K42A 3HOTA 3CQ8A 1QQOA 1Q8KA 4C1NK 1RLCL 4X64K 3KDNA 3VR1A 5KFWA 2LKZA 2NRWA 4IOAQ 4KHNA 1L3TA 4W5TA 2E1MC 5KFSA 2AIRB 4DOZA 3G4SN 5JVGL 1FNXH 2Q2RA 1VQMS 1IBCB 2VWBA 5T41A 2OPPA 3IWXA 4A46A 6FD1A 5AQUA 4ZPVR 3VF6A 4Q5VA 4KGXB 2IJFA 2WTFA 3A3OB 1RQ0A 4HHUA 4G3IA 2G0JA 1P9QC 3DRYA 4BVOA 2B4VA 1D09B 3ASMA 5HBMB 2K1RA 2OP5A 2J0SD 2VOPA 1TAUA 1CC8A 4ZVEA 4BRMA 3NKYA 3NBPB 2PMHA 3SDEA 2R7SA 4OPKA 1K73T 3AA5X 3VQCA 1U6FA 4R79A 4YY3K 3A5OC 1VRQC 2POKA 4KHQA 1NPRA 4DTSA 5CZ2A 2GX9A 4C8MA 4BRPA 2YQ3A 4GMKA 4ZP8A 2OTLN 2RNEA 2VODA 1HNZJ 4BC4A 1FWLA 2G1DA 2XHWA 4RW9B 3UDVA 1IKVA 3MM5B 5H9FJ 3N5FA 2AEJA 3EN9A 4JI1F 4CHQA 1UEVA 3HL8A 4DN9A 1X31C 2L9NA 4M63A 5CE3A 5HBMA 4OYXA 2FTRA 2FHOB 3LPTA 1UVKA 2IVMA 3ZZOA 5C2DA 3N6LA 2UXDK 3C6HA 3PYGA 4DL3A 3W65A 5KFQA 2IY5B 5IFMA 4EMDA 4A8SA 1X9MA 1V4TA 4ERDA 1TP7A 4OZNA 4HWIA 1RHRB 4QW8A 1RT5B 2QLWA 2RDIA 3MAQA 3I8BA 3K9JA 2Z2LA 4V19J 1N32J 4DV1J 4DV5F 4RW9A 4LF5J 3LUYA 3LP2B 3VMFB 3ZSOA 2GC8A 3LP3A 2WW4A 1FHTA 1RTIB 5AFUA 2R2RA 1L3KA 3WBZA 2R7YA 2CNNB 4DX7A 5D0RA 2VZ9A 1AZSB 2CWXA 4JKFA 3QLHB 3K5NA 5A0YB 4J2BA 4NE9C 2ZQBA 1LNQA 2UU9F 3AVLA 1VQYA 2JFDA 4QPXA 4IRCA 4W5OA 4ZVOB 3M30B 3PDNA 2ZBIA 4BCAA 1VHFA 2V50A 1VSFA 2O8EB 1RAOA 3SUQA 1NK6A 2M88A 1RDDA 3WEEA 4BQZA 3DC2A 4CIFA 3GIIA 4J9SA 1GLBG 4QU7A 4GNIA 1WHVA 2UUAK 1H0HB 3W0LA 2XMAA 4K43A 4Z2XA 1RUSA 5M1NA 3B4DA 3M8RA 2CJBA 3M3ZA 4HR2A 2WB1D 3D7EO 2CJKA 4M5GA 3SAHA 4G6VB 5A0YA 1RDAA 5DRKA 3D2EA 1RBVA 3OVBA 1SKSA 3B82A 5EU7A 4CZGA 3IKMA 4A59A 4J90A 3J81Y 3H2VE 1RWMB 4NLTA 3VERA 5IXUA 2VQEJ 2A2DA 2XNRA 3BY5A 1LW2B 1HA1A 1CJTB 4J9UE 4FXDA 3EY1A 3CFRA 1KHVA 1KOOA 1JLEB 4DR1J 3VAMA 3GJSB 4ECWA 3EE8A 4PWDB 4NXMK 3W2VB 2O1PA 3WIUA 5SWMA 4OI4A 4PG5A 5DG7A 4JKGB 4ZMMA 4DTNA 3VGTA 3HOSA 2YWKA 2CA9A 1R0CB 4P71A 2CPDA 1IKWB 3RW6A 4DCHA 4B8AB 4N56A 3FFKB 2XGPA 3IRWP 2AA4A 2ITMA 4HH1A 1XNRJ 3NAEA 2CQCA 3VQQA 2FBVA 1RB0A 4YORA 3P38A 2RDJA 2ZOGA 1CJTA 4TKTA 4CT8A 3GTYX 2YKPA 3CMQA 4FWLA 3PX6A 2DEIA 1QE1B 3D0GE 3QERA 3QMQA 5FDLB 5ETTA 2GBZA 4Y6IA 3QJPA 4PWDA 3FQLA 2AX0A 3W2VA 3HCXA 2Y0BB 3J7YP 4E7JA 4JKGA 1QS4A 2DITA 3NL0A 4CBWA 3PIOL 4FK4A 1S6PA 1HBOB 1RBUA 2W24A 3MEDB 3D6MB 3KLVA 2HRUA 2KL8A 3MWTA 3EICA 4FJIA 1WD6A 4X64F 2B6AB 2FVSA 1PBAA 4CHOA 3CGIA 4O8KA 2DVIA 1QE1A 1HLUA 5FDLA 4Q43A 4TY8A 4C0HA 4DX6A 3E8OA 4YR0A 5TKYA 1WI6A 4PL7A 3MPVA 1WEZA 1AB8A 5DM6L 1GOBA 3V4MA 3CPEA 1TELA 3S41A 1XR5A 4KGMA 4CT9A 4DR5J 2Z0GA 4O3NA 1G15A 4ILMA 4ILLA 3MEDA 3VQ7A 2JEJA 1RBAA 1Y10A 1NNDA 1ZBSA 3POTB 3QFUA 1NJIT 3KLHB 5LMNK 4PKIA 2K7JA 2OSQA 3ZEUB 2W6LA 2BJDA 3JAMY 2B6AA 3FZBA 4WTOB 3U27A 1MU2A 4YOWA 3VV2B 3EZ5A 2RU9A 1I94K 4NMLA 4OZ5A 2GVDA 4UUXA 5HANA 2FZGB 3A8IA 3JS9A 4E7KA 4CGHA 1TMJA 2ASDA 1DT9A 5B0DA 3IS9B 1HBMB 1C0TA 2UXBK 1QVFR 2O8FA 2B9XA 2JZ5A 5DQHA 3HYFA 2G8FA 3UR0A 3OBIA 4JKBA 5D78A 3POTA 5EHHA 1U1QA 3O2IA 1NUEA 3KLHA 4E98A 1NZ8A 2CUYA 1SC6A 2DD8S 4DFMA 2E2OA 2VG6A 3IG1B 4X4TA 3A3PB 3OYMA 5B0AA 2JH3A 2CWKA 1RGVA 4X4VA 4C3LA 4ZKAA 4FO0A 2V63A 4N8OA 2G8KA 2CPXA 3BYPA 4YDDB 4EBCA 3CSKA 3H6EA 1BA0A 1T02A 2E5JA 1P1LA 4QS7A 2ZZTA 1I5OB 1KNZA 5CAAA 2PC6A 9ATCB 1T3OA 1OQ3A 4I6AA 1YLXA 1V9OA 3AT1B 4IQMA 3FRYA 4CTAA 2XWXA 4B9MA 1UJ5A 5AQJA 4OJ1A 5KG0A 5IV3A 1NGFA 2Z1HA 4NCGB 1YITS 4NMXA 3C46A 4CFDA 2OPSA 4DR2J 4FYYB 4B9QA 5JJBA 1VBXA 5GAHI 3T1YJ 4JYAJ 1HKGA 1FD2A 2JRSA 4X4OA 3HFZB 4OHWA 2L3MA 4HUGA 3UN3A 4OFZA 2V4JA 2Q1LA 1VQ4S 4P2MA 4F4WA 1B4SA 1R8BA 1XC3A 3EPGA 1M90T 1YUWA 4OLOA 4OX7A 2EFVA 4CZHA 2P9LB 4Y1CA 1NEEA 4C8NA 2M52A 2F9WA 4H4KC 5GAGU 2P9KA 4E89A 4CYUA 1DRZA 1RA7A 4NCGA 4QPTA 1ESVA 1Y00A 2OAUA 5BPNA 1M1GA 4ISGA 4FJGA 4E8UA 4QIGA 2J6SA 5F8HA 2PN6A 2W8LA 2DGUA 2O3DA 4C3KA 3I82A 4UY8T 3O1LA 1YVUA 3HI0A 2YHAA 1LFPA 4DU8A 4NZ0A 2EW9A 1FDBA 1ZBHA 4IUFA 1A6LA 2V69A 4FZZA 2HBLA 3ZSYA 2KVQE 2JLFA 1Q82T 1W9HA 2P9LA 3R6GB 3SQ0A 4U7CA 4P10A 5JS1A 3VEWA 4NXMF 3M2UB 1NGIA 3W5YA 4FLUA 4CZIA 4DPOA 1VQOS 4DV6K 2RKIB 2HHHK 1UWAA 2HGNA 1VHIA 1DKGD 2OGUA 3US5A 2YXLA 4O3PA 4DQRA 3SUOA 2MLXA 3QIPB 2YKNA 1U1KA 3J80U 2D3OR 2EFGA 2FBYA 2C42A 2KXFA 4FWNA 3DRPB 3BUZB 1R0AA 4JI2J 3CJ7A 2R2TA 4M5KA 5FPDA 1RYSA 4EI2A 4C48A 4QIFA 5LSRA 1RAHB 4DU4A 1R8HA 4KH1B 1OS5A 3V6DA 2JEIA 4FPAA 1VGYA 3K2PA 3C3LA 5DLGA 1YTUA 3O6WA 1VJWA 2O67A 1WORA 1KQKA 2ZWOA 3M2UA 5KAKA 2D4WA 2ZH5A 4MAKA 2UUBK 3FSIA 1LWEA 2QN6B 3FZ2A 1RT7B 4GV3A 1YBTA 2NCKL 3GIRA 3HRGA 2LQBA 1QAYA 4DKWA 3QIPA 2NYIA 3CCUS 4Q8EA 2QWMA 2KJWA 3RGIA 1GK8A 4CEZA 3ENOA 2Z1JA 3J7ZO 4W90B 4ED4A 4O0IA 1C4CA 1P90A 2C2EA 3NXZA 3W5ZA 1U1OA 1BI4B 2Z1GA 2W7PA 1QAXA 3EMTA 1N8RO 3GJQB 3V6HA 2MZTA 1I3OB 3CDAA 2IS3A 2EK1A 3L6QA 4DUYK 3HKZD 1NK7A 2ACYA 1IBKK 2GWJA 4IG3A 4QWBA 2F9JA 1RT7A 2U2FA 3CO0P 5CXTA 4M5IA 4M7YA 1ZTTA 1T9WA 1R0BG 4WIQA 3VF2A 2VV5A 5AE3A 4RUHA 2WVCA 4A2AA 1HKAA 1ZM4A 3ENQA 1DAXA 4Z94A 5F9NA 2LSNA 2KW4A 5HLFB 1R43A 3B54A 5KFXA 2R7XA 5D3GA 1FRMA 4OZ3A 3IMXA 2XYPB 4B9SA 1QD1A 1MG7A 3ZNJ1 5D15A 4EFHA 2E1YA 3OYJA 4LF5K 2PI5A 3PIPQ 5L8RC 4HUFA 4B3MJ 5AQFA 4DSIA 4BR4A 4NB4A 4JI7K 1S22A 4BDZA 3I96A 2ALZA 4ED0A 3G9CA 3CJ5A 2QKKA 1J2VA 5FLXY 2HNZA 1FKPA 3WX8A 4B17A 1J5OB 1CG2A 1Y4ZB 3GFHA 1GMUA 4CH7A 3X1LB 1UWBB 4CE9A 4CFBA 3BR9A 4ICLB 2F4FA 3CT9A 3EZOA 3L2RA 5HAOA 4WE1B 1KN6A 3M2RB 3TUIC 4DFJA 5HLFA 3D6HB 1KAZA 1KFDA 1SJQA 1BQNB 1GLFO 1MWQA 1UW4A 5HOOA 2HQIA 3PRDA 4CF2A 4JS4A 3P5JA 1VRTB 2D69A 4E1NA 2FSKA 4M1KA 1Q7YT 3LAMA 5KG4A 3KYLA 4ZLJA 4FJJA 3CJRA 4WKYA 2GVZB 1RT2B 1OPZA 3PW2A 3OBYA 3PFOA 1J5OA 2YVSA 3GYNA 1SJ4P 4FWQA 2C3UA 4PRFA 4KJIA 1NGAA 2Q3SA 3DOLA 4ICLA 5LL6Z 5LSLA 2VC1A 3SQ2A 2FY1A 3O4QA 2FY8A 2G8WA 3CC2S 1U0HB 4P72A 4H0TB 4B9TA 1OSDA 3M32B 1ZA1B 4ZJOA 1NBWA 2H3GX 4LQ3A 4LF7J 3QGIA 4OI3A 4CO2A 1JCFA 2LYVA 2XI2A 1EQMA 4LF2A 3F0NA 4RWWA 1FEHA 5KFOA 4K4TA 2KKHA 3ULHA 4PAAA 2KHCA 4JUZA 4JRQA 1AW0A 1RT2A 2BOAA 4FWMA 3QJJA 4H0YB 4KH6A 2WVDA 4NZ7A 2JWLA 3V9XA 1KWMA 4ILJA 3HTVA 2H54B 4C2MA 3DLRA 1MLAA 3SCLE 4K2XA 4CEOA 2A6AA 1U0HA 1EB0A 1RGIA 2BE2B 3AA8A 3M32A 4KH5A 2IM0A 4M3RA 3BM7A 3VQAA 2F8HA 3SMSA 2EC2A 5B0BA 3Q2SC 4IO1A 2CNOB 2E1PA 4MK8A 3MURP 3U4LA 1TV6B 4ED1A 4ITSA 1X3MA 4DL0C 5CZVA 3BPSP 5EWEA 1EWQA 3UFCX 3NF9A 4IJAA 1E4FT 5M1QA 4O23A 3QEIA 1CJKB 3AA4A 3P6YC 2UVWA 3A13A 4USVA 4BBYA 4UQTA 3CCRN 2YCHA 2E5GA 3LTOA 5B0FA 1VQ5N 4P75A 3OHRA 5EXWA 3THWB 2B5JB 2HHHF 2MY7A 1LCUA 5BRHA 5F0UA 1FKAF 4ILGB 3RBDA 3LANA 4KTQA 4KB7A 2N7YA 1VQKN 5TKWA 2BA9A 1O51A 1TV6A 2D0PA 4ELUA 1N5SA 4FNHA 2F4VJ 1VLYA 1FJCA 1BGXT 3QGPA 3RVCA 4E0DA 2GHPA 4X62J 3N4PA 1YI2N 5LSOA 3K5LA 3NF7A 2ALYB 1H72C 1C4AA 1RAJA 3CJSA 4NL5A 4JHDA 5J2MB 2KJVA 4AILC 1WF2A 1QQCA 4PUOA 4KC5A 4I67A 2HVEA 3CJKA 3THWA 1CSJA 2C1EB 2DHXA 2XYGB 4M5JA 1KHWA 2KM8C 2OTJS 4WQ4A 3NAHA 2QYGA 1XIQA 3NGTA 4V19S 3VALA 1RWVB 1FDDA 3C6AA 2CQ3A 5KFJA 3ZSWA 3NS5A 4F4AA 1GLCG 1JLBB 2MKIA 3FCWA 4RBVA 1K1QA 3FBFA 1H74A 3QRPA 2LU1A 1G99A 4KRFA 1SKUB 3HSCA 4DUYF 4XTTA 3Q8UA 3BO3A 2RHKA 5J2MA 1IBKF 2AD9A 3ITHB 4ZTFA 1G7CB 1C6VA 5EVZA 4UTGA 4BREA 2UYTA 4O5FA 2EPIA 1WACA 3DN9A 3J8AA 3LZIA 4DV2K 5LJ5Y 2Q79A 2E9ZA 3ZX3A 4DUZJ 3S01A 3H5XA 2YQ1A 1HD1A 2NXNA 4YQWA 3VGKA 2IA0A 1WAFA 3I4PA 2BRKA 1WBDA 2HHWA 2FXUA 3HVTB 4E7LA 2ZNYA 4DPYA 2OYQA 3ETMA 4LY7A 2I38A 3R27A 3SCKE 1N32F 3UI3A 4F25A 2BJ9A 3KHRA 2QXFA 3WNFA 4F36A 3MR2A 4KI6A 3G2XA 1R89A 3D1OA 4LF5F 3SMPA 2LQ9A 3K5MA 1X7VA 1EETB 4NLWA 2GQ2A 2HNYB 2HFVA 3ITHA 1H2TZ 3K57A 1JXLA 2YX1A 4FF2A 2ZFHA 2IGIA 4TY9A 3QRRA 1CZAN 5DDQC 5BXIA 2YNHA 2MKHA 3TVYA 3UO0A 2D74B 4GV6A 5HQMA 1UJ6A 1D3WA 5C7PA 4LF8K 5HATA 1JLAB 3HD2A 3W3SA 1IKYB 1L3SA 3JYTB 2XZDB 4CJVA 1GLEG 3FE1A 2VB6A 3R7BB 2DGWA 3N4QA 3TR8A 3HJVA 5K5MA 2QEXN 1E3MA 1F3VA 2VONA 2EHGA 1B99A 3Q8SB 1EETA 5KG5A 4OIXA 4AF1A 3MTKA 1VQ6S 4QYZJ 1KAXA 3GSDA 4HACB 2O4GA 4K8XA 3FZKA 1GFWB 4CF0A 3KHYA 5DZ7A 1R31A 4DPUA 1U8SA 3CCJS 2MQPA 1T3NA 1IKYA 1N56A 1S3XA 3KUEA 2MKSA 1R6VA 4CZMA 1SCJB 1NJWA 2FC8A 5KTQA 4O4GB 1BQMB 4LFCJ 3H42A 1FRKA 4YFUA 4HYKA 3ZTQA 1SC1B 1VQ8S 4FLXA 4RLEA 4IDKA 3FGVA 2E29A 1S76D 4DR1F 1KLMB 4OX9J 1ATNA 3NCQA 1VQ7N 3W61A 4DV0K 3DLHA 3PKMA 1HYSB 4DS4A 3L9ZA 2CQBA 3PYDA 3V81B 5GAHU 4RUAA 1YWXA 2Y0SD 1XK8A 3GYXB 3PO4A 2Y3YA 2F8TA 1Q9XA 3OYDA 1YG0A 1RT1A 2MKCA 2XMWA 2ILZA 2IM1A 3AD9C 4QU6A 3IUCA 3AGRA 4B3TJ 4N77A 5A76A 4O4GA 1BQMA 1U1LA 4ZK7M 4H0VB 1NDPA 2EFNA 4K25A 2IC3B 4CO1A 5CCLA 4CF8A 2VQFJ 1JCEA 4WYBA 2HQFA 1FRHA 1ULRA 1ASVA 1RDCA 4DQ8A 5HJYA 4JI4J 5AQKA 1N6QA 3ET6B 5EGYA 2LQJA 1SV5B 3CCMN 1Q18A 4WYLA 4RO0A 3V81A 5K14A 1SPBP 4PR6A 3NAIA 2LXIA 3G8QA 1HWIA 2DFFA 4CERA 2WRMA 3S3MA 2PD1A 4CZCA 4I68A 4NLCA 4YDUC 3GFXA 3ZT4A 3FEYB 3OS0A 1KAYA 1LAWA 3JXUA 2IC3A 4FJNA 3RRKA 4K5RA 1PAEX 4XPCA 5E3QA 2L9DA 2ROPA 2JOQA 1NGBA 1A9NB 1FI4A 5I4MA 4RW6A 2GV9A 4QQBA 3ET6A 1BOTO 2PA8D 3U1NA 4CLSA 3PACA 1E6VB 2Y1LB 3M6XA 1MDUB 2EFQA 4G1PA 2BJ7A 2GIQA 3MHYA 5F9LA 1RWWB 1ROFA 4NA1A 1B9DA 3AJ2A 2RS2A 5BN9A 2HZVA 2XSJB 1RDUA 2HBRB 5JICA 4ZDNA 3LQVA 3LP1B 3JB9k 3T9ZA 4FJKA 5LY3A 3KG1A 1OKJA 6FDRA 1RILA 1RI7A 4QR1A 1JLQA 4ED2A 3V4IA 3OY9A 3S6EA 1TL3B 4B3MK 3OVNA 2ZVIA 3WT0A 4LF9K 2Q6CA 3BH7B 1H38A 2NZTA 3W8PA 3W2WA 3KVGA 3U9DA 1KRPA 3EVMA 3LWLA 1Y9OA 3HSGA 1S1UB 1N0VC 4L72B 2RT3A 4D3HA 4YOVA 2FLNA 5BR8J 1YF5L 3H5UA 1HHSA 3DU5A 2OD6A 3ONQA 4CJ3A 4FVUA 4M45A 3H0PA 4QWCA 4CFCA 1U09A 1UZHA 2K7KA 1U45A 1XC9A 4LIRA 1TL3A 5ETPA 4OZLA 2HAFA 3D9BA 3PJXA 3IGVA 4C11B 3G4SS 1FTCA 1QSYA 3QO9A 3D54A 3O9QA 4DCOB 3O9UA 2NUBA 3R5DA 1ZBIA 3TTDA 2B4UA 3FC9A 4F7VA 3RBZA 5T14A 1K0TA 5KPZA 2CQDA 3R5GA 1XMQJ 2HBQB 4YDXA 4JK9A 2YKOA 1S1UA 4M94A 1M5OC 3OYCA 4CH0S 2WSFC 5F1XA 1FXXA 4PKHA 3IR5B 2BACA 4KHSA 1F2HA 4DZ6A 1HNVB 1FRJA 2ZBQA 4LF8F 3MMAB 3GE1A 1RWOB 4WP3A 3KUHA 2XNQA 3T1YF 4JYAF 2CH5A 4K41A 3Q8PB 4HDHA 2LA6A 3V9WA 4X66J 2DNKA 4F0HA 2ZH4A 3QBWA 4Y0WA 5MLCQ 4P6QA 2HHVA 3PG9A 4WXOA 2UZAA 2BUNA 1RBTA 4PABA 3CD5A 4U67L 2HPUA 3L4QA 3MCPA 1YK9A 1APSA 4ES1A 1ASUA 2BVZA 2GZOA 2DR8A 3RSEB 4QYRA 2RSQA 1N0UA 2DR9A 4A61A 2RRBA 1HRHA 2YH0A 2QA2A 1B0PA 2V2KA 3IR7B 1PO6A 2EG2A 4CEFA 2AEMA 1RBSA 5DG9A 4KPCA 5J2PB 1DTTB 2XMTA 4C8YA 4B1XB 4JK7A 2QTDA 3D6FB 4FF3A 3VPZA 3ZTPA 3QEXA 1ZAXA 4F3MA 2QWOA 2NS1B 4H4MA 3H1VX 4OJRA 3W64A 3AGKA 2OLWA 3KWGA 2W6KA 4AT1B 4Y2IA 5HO4A 2NZ4A 2HVDA 4OX8A 2HSTA 4P74A 2W9BA 2J7UA 1H98A 2V4RA 4NCAA 2HOEA 1YRUA 2PBDA 2I0XA 5T7LB 2QMWA 5IOLA 3QETA 1W7AA 2E7XA 3DLLQ 4ZVSB 5DM6Q 3H45C 4UOCA 2F9DA 4K5SA 4ECUA 4NLVA 2X6NA 1R7IA 3HZGA 4XPEA 3AOCA 2KG0A 2HFUA 1UKUA 2ASPA 3CDUA 2HKEA 1FJGK 1F1BB 4JI2F 1V6HA 4BRQA 1D9DA 2VCPA 3W8GA 4FS1A 4CK3A 3H2LA 4CJ5A 2X1BA 3CCVN 4BR9A 3MR3A 1RE1B 1RWPB 2MEWA 4J5OA 3HVWA 1VQPN 5HQ8A 2PGCA 2RU3A 2QMXA 2VPWB 2CDQA 3EPIA 3HHEA 4ZVPB 5AXNA 4IYQA 4YMEA 4JP8A 1M1HA 5FD1A 2OZSA 2PT0A 3LPUA 3DOMB 2AGPA 3BGRA 3MR5A 3CPWR 3KD5E 4BE2A 2CGLA 4IJNA 3VQPA 1ZBFA 5CD4H 1HJOA 4ED6A 1N5TA 1YX2A 1EP4B 4L3NA 3QSYB 1U49A 2E44A 1KVKA 3NRBA 4KR0B 3QEWA 3ISNC 2O8BB 3AODA 3K9KA 4CLYA 1BISA 5A8KB 2VGNA 5A8RA 4XH5A 3TYTA 4NCBA 2WHOA 3DOMA 5HMWA 4KIAA 3H4BA 4ED7A 1O6XA 1T05B 2M0GB 1QTNB 2J5AA 3CCLN 4DS5A 5D0EA 2EC0A 1IJEB 2CQPA 1CJUB 4I9QA 3AA2A 3I5AA 3Q22A 1JJ4A 1TK5A 3MXHP 4O0NA 2XB2D 4K8RA 3V1QA 1EP4A 4USMA 3RYLA 2F40A 3OFGA 4B3MF 2JC0A 4WKRA 2O8BA 2WVBA 2LP4A 1HW9A 4PY5A 4ZA1A 5A8KA 4I0WA 1UVNA 2CJAA 2V7YA 3O1WA 4BACA 4CJLA 3NCRA 1U7LA 1ITGA 3I33A 1T05A 4NLPA 2RAQA 2I5JB 2YH1A 4MQ3A 4UOFA 1RP5A 2W2MP 4OHXA 3AAWB 1NSQA 1CJUA 2A42A 4AXIA 2A5XA 1M0SA 3AAPA 4BG9A 3MMBB 4PQUB 1FNMA 1S1VB 3SQ1A 2DTJA 4Z0UA 3P5TL 4JB8B 5G0RB 2Z58B 4NZ6A 1BA1A 3P8BB 1QZ6A 3B78A 1ASWA 2IJNA 2WVEA 5KFHA 4JI3J 2PYLA 1S79A 1KD1O 5KT7A 3M8YA 3RW7A 3FMWA 2LFVA 3CQXA 4OZJA 4CBXA 1KONA 4KHRA 3KLIB 1KEKA 4EBEA 4O3RA 2I5JA 3C94A 1RBOB 3BPDA 2HW3A 1U2FA 3BBFA 5AQVA 4PG4A 3K5PA 3EL2A 4NLBA 2CQ1A 1JIHA 3MMBA 4FWPA 3VAFA 1C1CA 1S1VA 3EGWB 2W25A 3AAQA 1NM2A 4PXBA 3I0SB 3NGYA 3HULA 2PEHA 4DV7J 5KFRA 1U2CA 1IJJA 4ETZA 2C22A 5J2QA 1JLFA 2XHBA 3U7JA 2YKAA 2AYEA 3VA3A 4B3SK 5CZXA 2JDJA 4DR6K 4EO8A 1LWFB 4LR7A 5I42A 1IWAA 4OX9K 2AQ4A 4GVBA 4A2BA 1TUWA 2BW2A 1KVBA 1HYVA 2BTFA 5F8MA 2QWNA 5G4DA 4XH1A 4JK8A 4JKDA 1K44A 2C2ZB 1NZAA 3TZZA 4WZMA 2W40A 4LF6J 2EK6A 3KK2B 4GVLA 2BMBA 3ID6A 4U7BA 3TAFA 3TA2A 3O3LA 1AYEA 5HMYA 5BRFA 5ETQA 2XHCA 5BYSA 1FFWB 2WC9A 3KLFB 4CLPA 3HJFA 1JKHB 4USUA 1FRLA 3KMQA 3MEEB 2VQFK 4OI2A 2FJBB 2G9OA 4DV3K 5E33A 3PCOB 3HFVA 3OW2R 1XMOJ 3MMCB 2XEXA 3OL8A 3QIOA 3D0PA 3N6NA 2GA7A 3HHLD 3D3BJ 1S0OA 1YVNA 4GVMA 4JI4K 2NRHA 5C10A 4X2BA 3DLKB 3WUHA 4BE0A 1HQ2A 1JB0C 1J5EJ 4G65A 1RAAB 2K2PA 3WQPA 1WAJA 4EFAC 3H8YA 2RUSA 5CZ1A 4KAIA 3BH6B 1NOYA 1AFJA 3A8JA 3L8BA 3N5BA 3O9TA 4QIEA 3KLFA 3CPWM 1GMWD 1JKHA 4BRNA 3AOBA 5F3ZA 4H0XB 4BVPA 1FKOB 3KJQB 5ETLA 3H40A 3MEEA 4AL7A 3O9RA 1N34J 3RAMA 1FJGF 4TYAA 4K0KJ 2G2ZA 4IKFA 2VFUA 3MMCA 3CD0A 5A8WB 1CLQA 2F4VF 3U1LA 4F4XA 1RCHA 2B9WA 3S3OA 1OVYA 3DLKA 2PAVA 4X62F 5LMUJ 3P83D 5IM0B 3QRQA 4GC6A 3P45B 3D2WA 2AJ0A 1JNZB 3TUPA 4CP5A 3VEZA 2N7CA 3KKFA 1WWHA 4Q0BB 2KXHA 5LJWA 2VOOA 5GMDA 3HM8A 2VH7A 1D9FA 1RSCA 4A8OA 1UVJA 4BY9C 1FKOA 5AQZA 3TZWA 4L73A 2HIQA 3I55N 4KTWA 1IBMK 2F7TA 4PG6A 2LU2A 4A8KA 3PO5A 4RU9A 5JMNA 4BR5A 5A8WA 2GWKA 1LWCB 4TU8A 3P31A 2HHUA 4DF4A 1KBRA 1MROB 4CGIA 2HMIB 5IM0A 2VWKA 1WEXA 3CFPA 1SL1A 5GMKa 2KDOA 2HFZA 1WN7A 4Q0BA 1RTZA 3RUBL 1PJ6A 3BQ0A 4JI5J 2BM1A 2QIFA 3T1HK 3R9LA 4ANDA 2OEJA 3TI0A 4ECVA 3MOJB 4C0OC 2C28A 1KC8T 2Q0UA 4CNYA 1OH6A 5F8GA 1YJVA 4ID8A 2O5DA 2MQNA 5IS2A 4OPAA 2VPYB 2MMYA 1ZM2A 1HR0K 3I5BA 1Y64A 1XTZA 2HBKA 4H4KA 4WXWA 3TU5A 1LWCA 4RX6A 3CC4N 1TGOA 2IJRA 4LSLB 4CJTA 1ACMB 1SH2A 2QTWA 2GUIA 4FW2A 3OPKA 2RD5C 4MDBA 1S59A 1XMQK 4B08A 4G1IA 3GZ7A 3I4HX 2P1JA 2OHDA 4RWXA 2XQCA 4NXNJ 3JQMA 3JXOA 2MHEA 3ZLJA 2PZSA 3AB2B 3AD8C 2XLJA 3A4TA 4NRTA 3M5RA 5LXYA 3FJ2A 5E7OB 5KT6A 3PR4A 4ECTA 3ILOA 2HYIB 3ZZTA 1FT8A 4JV0A 3E66A 4KHMA 4ZP7A 3OSPA 1X60A 2DISA 4WFZA 1VC6A 2JEGA 4X65J 1QVGR 3VQEA 2HLTA 2UXCJ 3OSNA 2XS7A 3WC2A 4C8OA 4X66K 3G87A 3HBTA 3AVBA 1MSWD 2D9PA 4JI6K 2QLBB 2XMKA 1LXJA 2ASOA 4Z4CA 5HROA 2BABA 4DX5A 4OPJA 1SJ1A 2CJYB 3GV7B 4H0PA 3T19A 2ZKTA 4TU9A 2PE8A 1WC6A 1WTBA 2EWSA 3MPUB 2QV6A 1U04A 5B8HA 3C7NB 4YHHK 1SH0A 2UUCJ 2AW0A 3DRRB 1LXNA 2OFGX 4F0MA 2COLA 3W9IA 2DBBA 3OW2M 1D5AA 2KH9A 1RCXB 3BYRA 3RAQA 3TANA 5AE2A 2X7IA 3MD1A 2FLPA 4DR6F 2VWJA 1WDTA 3BN4A 4OX9F 4IH6A 2WVFA 2DIVA 3UCGA 1FVQA 4LC9B 3C7NA 4U95A 2WSEC 1A7GE 4LF4J 1Y5NB 3OLBA 2HGLA 4RNNA 5A2QO 5ETNA 1VSJA 2DNHA 2LQ5A 1X8DA 5L1JA 3VGVA 3DLJA 3V6JA 2K06A 4CZJA 2VQFF 2P6SA 3M8ZA 4U96A 1E4GT 1N5YA 4DV3F 4DR3K 3UDEA 4YB5A 2W1BA 4ZP6A 5HL7Q 4KHPK 4JI4F 5IT9O 2F9TA 2EKNA 2ZH8A 1W7WA 3C2PA 5GMEA 2HK2A 1TUUA 4B1WB 2E66A 2Z57B 3ZSRA 4OLAA 1M5HA 4B3RJ 3ISND 1KOHA 5CHCB 3VEXA 3AD7C 2AJ4A 5IQQA 5J1NA 3K8WA 2Z56B 5KOXA 1RT6A 1NPKA 4BDPA 2QWLA 2KFNA 3UD5A 1A0OB 3NGRA 4K4UA 3DXBA 1UP1A 4O3OA 4QWDA 5H1SQ 2HNDB 2IIHA 5HN0A 1HMVB 4FJ9A 4CW7B 3T9NA 2MZ1A 3LGMA 2GJFA 2RPIA 4DTRA 5KOWA 5FPMA 5L1KA 2V4QA 3J7A1 5KFIA 3HZEA 2DR5A 2L48A 1M1KO 3AJ1A 2VGMA 1BD6A 3QQCD 2OCEA 3TZYA 3FZFA 1YJUA 3D0HE 3CCSN 1YBUA 4YB6A 3D1QA 4KAZA 3IP0A 3MM9B 3TRGA 3MUMP 5FROA 1RDRA 5GAEI 2WBRA 4FWOA 4JI0K 1VRUA 2HK3A 3CJQA 2ZHOA 4E19A 4BWJA 1CEZA 2IMOA 4M3YA 1SJRA 3BF4A 1UCNA 2XWYA 2GQQA 2IVYA 2O66A 4DL2A 2CPJA 4YB1P 1MWZA 1HI0P 1Q81T 5AJ3K 4R0EA 4KH0B 3OYIA 3W7BA 3T1HF 4J7CA 5AQSA 4H5WA 1BHLA 1VQ5S 2KTQA 3N6MA 1NJZA 1ICEB 2D1KA 1LEOA 2VC0A 3JTNA 4N41A 3C6UA 4JKHA 3PJ9A 3DGPB 3Q23A 2WW8A 1X4HA 4IH7A 3PEJA 2G8IA 1QVGM 1TVRB 4LFBJ 3A5LC 3D45A 2ZITA 1VQKS 5I3QA 1UEKA 4M95A 4X4SA 3IAS9 1I1GA 3BB5A 1GOCA 3R8EA 2GAHC 3VQDA 2CNLB 4W5QA 3GIMA 5HMZA 3MXIA 2PMWA 3GV5B 1RWKB 2DPIA 3D68A 2HBJA 2YX4A 1XMQF 4BGBA 2B4OA 3R7NB 1MWYA 4M42A 1E6YA 3VQBA 3TX0A 2I1RA 2R7RA 3NGIA 2LEPA 3IM8A 4C9DA 5GIOA 2I6WA 1KVAA 4USJC 1K73O 2QT7A 3DGPA 5BJRA 5EN1A 1TVRA 4DV7K 3MAAB 2MLZA 4WP9A 4O4RA 5H9EJ 3C14B 2BW7A 2Q31A 4MTPA 5KFUA 3NNAA 4X66F 3CCQN 3QNNA 4ALZA 3Q7CA 5E5NA 4N47A 3O5BA 3RJMB 5I3UB 1RT4B 3HSTB 4A57A 2DHGA 4UZCA 1T3VA 4PA1A 2H9ZA 4O44B 2G8UA 1REVB 2NXUA 5C12A 2I7NA 4K59A 3R5CA 3KIOA 5C25A 2QFJA 3CERA 1NRKA 1QSSA 4WK1A 1IBLJ 1S9EB 3MAAA 2E4LA 3J81j 4HVZA 4J9KA 4FF1A 2BX6A 1B0VA 1NHUA 3C14A 1YJNN 3JSMB 2W2QP 4M63C 2NXCA 4YOEA 2UV8G 4CO5A 2OJ3A 5I3UA 1RT4A 5E3CA 2N3LA 2D5RA 4Y65A 1REVA 1G6BA 3VOVA 4QR2A 4DI6A 3VGUA 5FPNA 5LOQA 1U1RA 4DTPA 2FSJA 2B56A 3NNCA 1VBKA 3NMUA 1S9EA 1FESA 1HL6A 2P9SA 3TEGA 1VAZA 4JI1K 2ZD1B 3ZSXA 1U47A 1OH5A 4FK2A 3GG0A 4I7FB 1S1WA 2W4DA 4Y0FA 3JSMA 4CNZA 1K9MO 2LXUA 1RTJB 1R3NA 3G6VA 2V9WA 4Q8FA 4FYVB 4ZHRB 2NZCA 5GIPA 2NYHA 2Z4PA 4NYOA 1QUPA 1PSDA 2FJXA 2QEXS 4B9UA 1X9SA 1WSIA 1CVJA 2H5IB 1ZBTA 3AVIA 4KHPF 4E7IA 4IFVA 1S0VA 2HS4A 1T94A 5M2PA 2E6MA 4BGAA 3ZZZA 4DSLA 4O55A 2FHJD 1UFWA 4RCHA 4DV5K 3THYB 2IPOB 2L9WA 3W9JA 3V9SA 4AHSA 2W2PP 3OR2B 4I7FA 2CQ0A 2ROEA 3FBEA 1RAEB 1Y7PA 2NLWA 4JI8J 5KG6A 4O5BA 4MYTA 1URRA 1WC3A 1FVSA 2JLGA 4KHYA 1HNWJ 2QA1A 4ZPAA 3LDLA 3OD2A 1MWMA 4NLGA 2RF2B 1BWEA 1YTYA 1FJEB 3IO1A 4DQIA 2ACMA 2WTUA 1F2GA 2UU9K 2LDIA 4CECA 3EX7B 2HB5A 2J7WA 2J6UA 4CEEA 3H3OB 4AQYJ 1T6DA 4NOHA 4MYUA 2ZH1A 4FZXC 2HQCA 1HNXJ 2RILA 5AXKA 1S9GB 2E5LJ 3RU0A 1T11A 3ZTRA 5F0XA 2GIRA 4B1UB 3T5KA 3P4IA 1NOZA 1LOUA 3Q8VA 3DFEA 2Q43A 4QIWD 1XHXA 3ULEB 3P39A 5LM7E 3SI8A 4H8KA 1VISA 1RHUB 4J2EA 2ZE2B 3M9OB 1TKXB 2RF2A 4F4YA 1N36J 3OHBA 4V19X 2MGZB 3CUNA 3MCNA 2LVWA 1SQFA 1XQSC 1HHQA 2V7ZA 1S57A 2OFHX 2H4WB 1Q86T 4ELVA 1R8AA 3CEDA 2CG8A 4OYZA 2YJFA 1NGHA 3MX2A 3UKUB 3AO3A 3P49B 1HWKA 2C3PA 3LPYA 3BKTA 3CCMS 2OANA 1RWXB 1OWXA 4MDAA 5J2NB 2CPEA 5AJ3F 5FRNA 2CFXA 3V1OA 1EWRA 3CETA 1B3TA 4MLHA 3K89A 3FMBA 1FE4A 1UFKA 3GIJA 3Q89A 3ULEA 1RACB 3LALA 4OYPA 3OTOJ 2ZE2A 5E0OA 1TKXA 1JL2A 5DLFA 1X0FA 3CM5A 3QBXA 1XR7A 3M8WA 2Z8QA 4EGLA 3AO5A 1TZ0A 3O3FA 3FDSA 5FJ4A 2A40A 3WQUA 2ERRA 4ETXA 3DM2B 3D4JA 2PFDA 4JI3F 3PZPA 1MN9A 2ZM6J 1SKRA 1HQEB 3UKUA 3CD6S 1ZH5A 4NA3A 4FDFA 3IBFB 4PYAA 3ZZRA 3KD1E 2D3UA 2XBPA 2DRDA 3BSCA 1Z2ZA 1NJIO 2IYGA 3M8QA 2J6TA 4CEQA 1H2VZ 2UUCK 1B7YB 4LREA 2AP1A 4FZVA 4IBNA 3F56A 4P9SA 1HYZA 1YJ7A 5A6PA 2DNOA 1WHXA 4RW7A 5JLFA 2W7OA 4DV7F 2HZCA 5ADXH 2ADCA 3BGLA 3FZHA 3E01A 3LGHA 5GAGP 3DM2A 4BHQA 2RN2A 2VD3A 2K1RB 1TYQB 2ZHBA 3HHLA 4M3TA 2FIUA 4YDUA 1S0MA 1HQEA 1VYAA 4LVOP 4BS2A 4C97A 4K4ZA 1BO5O 3SDEB 3PX0A 3CHWA 4DZDA 3L4BC 1EKRA 4KY3A 4FWRA 4ZPDA 1RAFB 3WZ0A 1WDDA 4OJ3A 1ZTWA 4ID1A 4JKEA 3QYYA 4LF6F 4GV9A 2CIMA 4GKJJ 3QZ7A 4AHCA 4BC7A 1GMWA 3N79A 1ZBLA 4A5BA 1YJ9N 1NNEA 3QAEA 1IKVB 4CJEA 4CJRA 2YTCA 2XULA 5H1SV 4MKVA 1TYQA 1XN9A 2MHNA 2WUSA 1XMOF 3VQ5A 4PZVA 5B7WA 3H20A 4Z7CA 1PCAA 4DUTA 3G8TA 2J0WA 2RB7A 4J9NA 3OTEA 4OLBA 4QIVA 2ZJPQ 3MX5A 1NB2A 3ULDA 2JWKA 4RBUA 2BV3A 5AFUH 1BY9A 3ENVA 2VKRA 2YWEA 4LSNA 3QMLA 1KQSR 4YB7A 4U7UK 5KRTA 4TQSA 3TR5A 2WBMA 4LBPA 2MTLA 2YNGA 1N54B 2D1CA 2CJXB 4H0OA 1N34F 4I2QB 3PVXA 4GKKJ 4HHHA 2JX2A 4K0KF 2A3JA 1X3NA 3M8PA 4I6MA 1FJ7A 2PFFB 2F5GA 3G71N 3AFGA 3NCIA 2EVZA 5LMUF 3C95A 1F60B 1SC4B 1RTDB 3CMEN 2DY4A 2FYXA 1RWNB 3H98A 4ENOA 2P5VA 3AXMA 2FQQB 4TN2A 3G82B 2XMMA 4JV5K 1PBUA 4F26A 1Y5LB 4Y3CA 3SBGA 3HHNB 2QM1A 2MKYA 1HHTP 3WEEB 2QXLA 4KRWA 5KFPA 4UY8O 4I2QA 1SZ2A 1O8BA 4OLPA 1D9AA 2ASYA 1LQ9A 2RE1A 5KFMA 4NPOA 5C5JA 3RMCA 2DH7A 3WNEA 1NGDA 3H3NO 2R8IA 1RTDA 3D2EB 5DDPC 4PWUA 3IM9A 4ANEA 1FDAA 3FZLA 1JNRB 3BR8A 2FHKA 4BDYA 2QX0A 4PWWA 3BF3A 4IWVA 1UPMB 3G82A 3UVJA 2M3DA 3OHAA 3O08A 3U3GA 1LK5A 4UF4A 2DGOA 3AV9A 2HHQA 3E1YA 2CXEA 4JN4A 4BRGA 4ZIVA 3HKWA 4BRCA 3H25A 3ZETA 2WZ1A 4JNEA 1DY3A 4WZQA 3KLGA 4IFEA 2ZGZA 4FOIA 3GG1A 2DPJA 1BWFO 2LECA 4HTJA 2HIYA 3MN7A 4M7XA 3E3XA 3OR1A 2M2BA 2CQIA 1YXQA 2V8DA 2C2MB 3CCVS 8ATCB 4PG7A 3TSQA 3V1RA 1UETA 4DV4K 3AA9A 3D5MA 4NXNF 1Z6RA 1VQPS 5GAEU 3RRHA 2A1RA 1LV5A 4I6YA 4DR4J 3JS6A 5BPMA 3CULA 2J0QD 2X6SA 3RBEA 1R8PA 4ZVGA 1D0EA 3MTJA 4M3XA 2F63A 4Z4EA 2PMZD 4F3TA 4IG0A 5H9EK 2UXCF 2QGFB 1GH8A 5KFZA 1X4GA 1B64A 4BC9A 2BKOA 2V34A 5T7BA 1S6PB 3PW7A 4ZJQA 1TL1B 2LEBA 5B0GA 1N33J 2AJ1A 3SV3A 3GCWP 4IR9A 3GV8B 2DCUB 2OO4A 2C2NA 1IBLK 5KGWA 2GAGC 3O6QA 1ZM9A 3NCPA 2ZWHA 5BREA 4TY8B 2UUCF 2G2OA 3K2YA 2CGJA 4RWTA 3CCLS 2D0AA 2R4FA 1EARA 1QTMA 1WC1A 4B1VA 1NK4A 3D66A 3LDSA 3LW5C 4FF4A 3QB0A 5IT9Y 1TL1A 5DJBA 2B7CB 3R97A 4WFNL 4BC3A 4HT5A 1YIJS 1HPMA 2IRYA 3LOUA 5HRSA 2CPYA 2DR7A 2VBYA 2YJEA 3DHXA 3WQTA 4WQ5C 2BZ2A 4I4BA 1MU2B 3TAMB 1M5SA 2NRTA 3OYLA 3U3YA 2YKQA 5C2CA 1EQ0A 2PFUA 1KQSM 3L3UA 2GVDB 1FX4A 2KRBA 2DNLA 4FM1A 1AT1B 2ZWPA 2QSWA 1WNSA 1C0TB 3PV8A 4F2SA 2VFVA 2O8FB 4JS5A 1RAIB 4J9OA 3TUZC 5AQTA 3A8EA 1UAWA 4ECQA 5EWFA 3THXB 3HT0A 2DIUA 3S7RA 3UWTA 2O8DB 2VG6B 4NI2B 1VQSA 3MM7A 2Y8YA 1H3DA 3HPHA 1S7HA 1ZETA 4ZVUB 3TAMA 3HVRA 2HHXA 4I56A 4NLXA 1S72N 3PSIA 1IKXB 1KP6A 5F3TA 2EBGA 4JKCA 4B3RF 2C2DA 3GFZA 1X5SA 1TUVA 4RUBA 1URNA 4Z4HA 3QT5A 3B6PA 2W42A 2OEMA 2BUPA 3SJJA 3J81O 1ZBUA 2B43A 3THXA 1EZZB 1MWKA 2RIJA 4CBUA 2V8GA 4A8XA 2O8DA 4NI2A 4CTAB 3MCSA 4AQYK 4OYBA 5AQIA 5K8NA 3C0BA 1RISA 2OPSB 4IEIA 4ECRA 4B9LA 5IZHA 2OIHA 5AQGA 3OYBA 1IKXA 2DNZA 1XERA 4DTOA 1PYOB 2V8HA 4CEDA 5HVGA 3H90A 1JXVA 2V4JB 4JV5F 1WC5A 4FM2A 1X5TA 3M1VB 1AROP 1PAUB 2DR6A 5D4OA 4Z4FA 3MCOA 1FRIA 4LIWA 4X64J 3KXDA 3OYFA 3FQKA 3MXMA 4Z4GA 5KG7A 1YAGA 3OTDA 2MLYA 4I2PB 5ELZA 1B7FA 1NU0A 2NRZA 4QZVB 3IC1A 2Q36A 2P9KB 2K3IA 4TNOA 1GQEA 4CYUB 5KPTA 3DMJA 1JL1A 2X51A 5FIIA 2NNWA 1DJ0A 2IA6A 3HT3A 4R0JA 2GEMA 3TNVA 3VCDA 2DFEA 2KO1A 2IDEA 7AT1B 4CHYA 4DWIA 2R3VA 4P7TA 4IXCA 2R8GA 4BC2A 1REGX 2J7KA 4LR8A 3F5TA 3I32A 1WSFA 4O8UA 5CR4A 1K6YA 3FRZA 3M1VA 3VAHA 2ABYA 5KFCA 4GC7A 5LL6d 4WF9Q 4CD1A 4CHPA 3OFFA 1P6TA 2ASJA 3GMGA 4RPFA 4LFBF 1XJWB 3A2FA 1XMBA 4I2PA 4YY3J 2ZBRA 4AYBD 4X4RA 3NH2A 2JVRA 3H4DA 4GW6A 4DPWA 2I8EA 1BMQB 4ANCA 4F50A 4BQLA 1YHQS 2YKMB 4CLZA 3MECB 3UE2A 1M5VC 1WB9A 2YKNB 2FC9A 3TA0A 1NSKL 2DKOB 4HTIA 1R0AB 4B1YB 4U7UD 4DV4F 1YGYA 4N7TA 3BSNA 4A8YA 4B9NA 3QWPA 2UXDJ 3SCXA 3GYGA 3V6DB 3N4WA 1WUAA 3SJHA 4L3KA 4A5AA 2VG5A 3CW2C 5CHIA 2X74A 2F8SA 2XI3A 1ZPVA 3HPOA 4OX6A 5I9EB 3G25A 3I55S 3DWLA 2DY1A 2FGCA 1LWEB 3JAMO 3SBMA 1BC6A 2YKMA 3DGVA 4J2DA 3SZ2A 1X4FA 2FVRA 4DFPA 3MECA 3Q8RB 3U9ZA 4PHTX 2MZJA 4V1Ak 1K0VA 1NWKA 2P8IA 4ZN1A 3U1MA 1ZC6A 1DTQB 3K17A 3AVNA 3HPGA 4PEOA 3KK3A 1UA0A 2OPQA 3E51A 2CKWA 4MO5A 4BR2A 1OY9A 3GR1A 1IBLF 3NS6A 1TFYA 4NYZA 4AHRA 4DDFA 4EWTA 2Y9HA 3HXMA 3VQ4A 4BR7A 5EX0A 4IG3B 3PIPL 2J9DA 4F4ZA 3R6LB 4XDDA 5GAHP 4JLHA 4Z37A 4P2XA 3CC4S 4FLVA 2M8DB 2I2YA 3UB5A 1DTQA 4CIOA 4WFXA 4PPDA 3DXMB 4FJ5A 4B3OB 2JWNA 3KJNB 2X1FA 2O8CA 2UUAJ 4E1MA 4CEBA 5D77A 4LD0A 5D3GB 2FHJA 5BPLA 3DNCA 3CDBA 2E1ZA 1HNZK 3TTCA 2WSCC 2Y1JA 1XBWA 3JTPA 1VHXA 5H9FK 4NLQA 4NA2A 2RMLA 1OY8A 3MPDA 4EYHB 4J9LA 5DK5A 4OYWA 3BZCA 1NMEB 2XY6A 4NASA 3WDOA 4OHYA 5JMVA 3M8SA 4GKKK 4NRUA 2XCAA 3I0RA 2HNZB 1FKPB 1S1XA 1HBUB 1L5UA 1WEYA 3CVKA 3I56N 4ISEA 4BRHA 2ZH6A 1PILA 1TAQA 3K0JA 5AQPA 2RVJA 3QAUA 1L3UA 2P9PB 3DXMA 5HRRA 4B3OA 3F44A 3ZTOA 3M6GA 4CJUA 1NH8A 2BANB 3EDRB 3OL9A 4RW4B 2K3KA 4P7VA 1BE4A 3N28A 3MFIA 3M2VB 1CS4A 1X0PA 4NXMJ 1SIWB 2VF3A 2MJUA 1NO8A 3PTWA 4ZCKA 1Q4RA 1VSHA 1SJ3P 3WXLA 1N32K 1RADB 4DV1K 3HZ6A 4CESA 3VF4A 3AVCA 2CAJA 4FJMA 3AXKA 3C6TB 2B3TB 1FK9B 2ZKUA 4JI8F 1N52B 3CO9A 4GY2B 3CIPA 3WIVA 2MYFA 4B9VA 3KJVB 1HNWF 3TZXA 4LRAA 3GILA 1HBUA 2KLAA 1N5VA 4TVAB 1SUQA 4K4WA 1Z05A 2P9PA 4CF9A 4WCEQ 3DOLB 4DU3A 2BANA 4RW4A 4OZ0A 1J54A 3FLCO 1TKTA 3M2VA 1CQNA 2YPZA 3L95X 4BRDA 4RR5A 4FPRA 4AQYF 3QGGA 4MH8A 4EK2A 4IOXA 2CYYA 3P96A 4PKDB 2PO4A 2XLIA 1G2EA 1TUYA 3C6TA 3ZO7A 3QEVA 1FK9A 5L1LA 1YKWA 1MN7A 5EX3A 3KJVA 4I6WA 2QLJB 2ZH7A 4CVNE 2OUGA 3PSFA 4DB3A 1GEHA 4CK1A 2V9KA 4W5RA 2G0IA 1C0MA 1N36F 5E3RA 4FZYA 1GLLO 3MM8A 2MXYA 1GLDG 4IO9Q 1LOTB 2PI4A 5IWAJ 2Z30B 3HF5A 2VQEK 4C8ZA 3H5YA 4DQPA 2P9GA 3C16B 2AYMA 3EWGA 2ADBA 3V2UC 1RDBA 3AA3A 3MPWA 4DR1K 2FVCA 4A8MP