1JLQA

Crystal structure of hiv-1 reverse transcriptase in complex with 739w94
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
540
structure length
533
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title 2-Amino-6-arylsulfonylbenzonitriles as non-nucleoside reverse transcriptase inhibitors of HIV-1.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 140
structure length 533
sequence length 540
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlqA05
1Y97A 2R8IA 3HT3A 2WONB 2HHUA 4BDYA 5KT2A 1REVA 1CLQA 3LPUA 3SCXA 2ZKUA 3P83D 3VQ5A 1JKHA 3E01B 3UQSA 3RR8A 4KHYA 2GV9A 3IS9B 1KHWA 3L2VA 4J9KA 3BGRB 4LSNA 3GQCA 3OS0A 3L2WA 4G1QB 4IDKB 3CJ3A 3OJUA 3VQ8A 4RNOA 4E7IA 1X9WA 3LP0A 1KLNA 3I5CA 3SUQA 4DLEA 4CJVA 3OS1A 1HYZA 5JXSA 3DOLA 3M9OB 2XC9A 2FVPA 4CF1A 2IC3B 1JL1A 3PX0A 3V1RA 3IRXA 4FJLA 3PHEA 5CZ2A 2B43A 3CJ2A 1NK8A 4F3TA 3O3HA 2QK9A 4DSLA 4I9QA 4O4GA 5DLGA 1VRUB 4FK4A 2B6AA 4NLGA 4KTZA 3H5UA 3V9UA 2FLNA 4Q8EA 2W9CB 4I2PA 2AGOA 3NCIA 4N41A 3Q8PB 1RDCA 3RMCA 2IM0A 1REVB 4FLTA 1BIZA 1JKHB 1L3VA 2QV6A 4CHYA 3I0RB 4DSIA 2E9RX 4LSNB 1RCHA 2R8KA 1ASWA 4C8KA 3FSIA 1R0AA 4CJEA 3LP0B 1S6PA 2ALZA 4J9PA 1D5AA 4FJ9A 3DOLB 5HP1B 1G15A 3C6TA 4J9OA 1EP4A 4CFDA 4CHOA 4E7HA 1DTQA 3SQ2A 3MFIA 5KFRA 3IRXB 3NFAA 1SUQA 4QWCA 4FLVA 4C8OA 4TQRA 4CGIA 3KNAA 4KV8A 4O4GB 3WNGA 2HB5A 3VQAA 1RYRA 3PV8A 3LDSA 3P1GA 1A5VA 4Q5VA 2B6AB 2YNFA 4J2BA 5CY4A 3I5AA 4M3ZA 3OYLA 4I2PB 3S9HA 3EZ5A 3BR9A 4NLRA 3NF8A 2KW4A 3Q8RB 4K4VA 1RT3A 3N6MA 3A2FA 2UUTA 1S0MA 5F8GA 3KHLA 3KMQA 4BDPA 1WSEA 4OPJA 2P51A 4KHMA 4Y3CA 2EC0A 3RRHA 4Z4CA 3RB0A 1S10A 4CGDA 1R0AB 2IMWP 1T03A 1S6PB 3CIZA 2AU0A 2HVIA 3BDPA 3TR8A 5KGXA 4ED7A 3C6TB 2JEGA 4F4WA 1EP4B 1DTQB 5KFQA 2BQUA 2YHAA 4DFPA 4ZPCA 3AV9A 3K5NA 4B8AB 4FZYA 4W5NA 3PO5A 4K50A 2O4GA 2PZSA 1WSIA 1SUQB 4DQPA 1RTDA 3ISNC 3MEGA 4KV8B 4OKKA 2O4IA 5KFLA 3KJVA 5E41A 2YNFB 1IKXA 3DLGA 1ZYQA 1T8EA 1VSLA 3VQDA 4RW7A 3SQ0A 3OYEA 1RDRA 1FKOA 4IKAA 3T1AA 1WAJA 1C0TA 4Y1DA 4KAZA 1RBVA 3ZSYA 5F8IA 1JLFA 1CSJA 1RT3B 2BRLA 1RTJA 1S9FA 1B92A 4WYLA 4CJ5A 3RWUA 4DTSA 4ED1A 4I9LA 2KTQA 2RDJA 1TVRA 1RDBA 3QIPA 3MR3A 4MIBA 1T03B 1RBSA 2DPIA 4NLYA 1KRPA 1XWLA 4IFVA 2O5DA 1HPZA 4RNHA 4IRCA 3WNEA 5KRSA 2V4RA 4ECWA 5KG2A 2ATLA 5HRRA 1SH3A 3KHGA 4CHNA 1RT7A 1RBTA 3PX6A 3V4IA 3EYZA 4B3OA 5CYMA 4N5SA 4B9VA 4DLGA 4I7FA 3PR4A 4JUZA 3HPHA 5DQIA 5J2QA 5SZTA 3QEXA 1RTDB 4F4YA 1MMLA 4CJTA 1RBRA 3ZT2A 3MEGB 4DL5A 2XRIA 4FLWA 1NKBA 4QOZB 3KJVB 2FVCA 1IKXB 3DLGB 1RTHA 4BE0A 1SKSA 4J2AA 1VK0A 3NBPA 3M8SA 4JV0A 1JLGA 4RW7B 1B9DA 2X6NA 1FKOB 4QW9A 4DTUA 2UVUA 5DQGA 3EZUA 1C0TB 4NZ0A 3OHAA 4CEOA 1BISA 1WSFA 4FJXA 1K6YA 2DFEA 1JLFB 4MK9A 4FS1A 5KG0A 3SFUA 3PVXA 4IH6A 4MQ3A 2R2UA 1LW0A 1JLBA 2VA2A 3AVLA 4M3TA 1TVRB 4LQ3A 4ICLA 4ELVA 4F3OA 3QIPB 1RDAA 2BR0A 5KFCA 4CF8A 3S3OA 4E0DA 3THVA 5EWFA 2HWIA 4IFVB 2I1RA 5L1KA 2G8FA 4KHSA 1HPZB 4O3OA 2GBZA 5KG7A 3SI6A 5KFWA 3QEIA 2E9TA 2AGPA 3AO5A 1RT7B 4EZ9A 3V4IB 4B3OB 4DFJA 5CYMB 3PW2A 1S4FA 4I7FB 4LH4A 4B9LA 2F8SA 4DSFA 1S1TA 5J2QB 3H4DA 4FVMA 4CCHA 4RNNA 4K4ZA 4CIEA 3HPGA 1C1CA 4TY8A 4MIAA 3K5MA 3M8PA 2W7PA 1RT1A 5KG5A 5DK5A 4KB1A 1RTHB 3KD1E 1ZBFA 4J9QA 3OYJA 4EO8A 4CF2A 1JLGB 4CEBA 4KB0A 4FXDA 1QSSA 1S97A 1S5JA 1N56A 4PA1A 3AVJA 4JLHA 1ZTWA 4TN2A 1ZETA 1XHZA 4HHTA 4URQU 3CFRA 1ASVA 1IO2A 1CZ9A 5KFVA 4FYDA 3SNNA 4HCBA 1RNHA 4WZMA 4DU1A 1LW0B 1JLBB 2V0NA 1VSKA 3CVKA 4ICLB 3O4QA 1EETA 3RB4A 4NCGA 4J9MA 5KFIA 3V6KA 2ILYA 4OLBA 4NYNA 2JC1A 3V1QA 3OYKA 3M9NB 1ZTTA 3IN5A 3H2LA 3ZT4A 4CECA 4DS5A 1T05A 4RNFA 5DMRA 3RAXA 4H4OA 4FJHA 2HHTA 4FM1A 5F8NA 3OYHA 4CK2A 2FJXA 1U09A 1S1TB 3VA3A 5KFAA 4ZPDA 4ECTA 4OVLA 3BQ2A 3DDKA 4IH7A 3TWHA 4Z4IA 2FVQA 1C1CB 4TY8B 3M8PB 1ITGA 1RT1B 1X9MA 4FJMA 2OZSA 3HM9A 4U6PA 1JLAA 3DLKA 4LSLA 1RT4A 2F96A 4PY5A 2R2SA 4EO6A 1D9DA 5EWGA 3H5XA 4ZVEA 1CXUA 4ECXA 5KT6A 4ECUA 1JL2A 4ED0A 4DTRA 3NH0A 5EWEA 2W42A 4F2RA 3QO9A 4F4KA 4MH8A 3ASMA 4QW8A 4W5QA 2J6UA 2EHGA 3F9KA 1S1WA 4X2BA 2W9AA 3KKRA 1JLEA 4NLSA 1T94A 4EBEA 3V9XA 4DEZA 4DSKA 2HHQA 4FLXA 1EETB 4MK8A 4NCGB 5DQHA 5FDLA 5KT3A 2W7OA 4WZQA 4CEEA 4M94A 3NH1A 3D5MA 3TQ1A 3B6PA 4FCYA 1TL1A 1FK9A 1T05B 3DM2A 4H4OB 1WLJA 2OPQA 2WOMB 1CXQA 3PUFA 4Z0UA 3RRGA 4QWDA 1T7PA 3T19A 3PO4A 4F8RA 1BIUA 2ASLA 4ED8A 1SL1A 5DG9A 1WN7A 1XI1A 3AVMA 4CGFA 4M3WA 4LD0A 4ZMMA 3HVTA 4FM0A 4URSA 3L8BA 2DY4A 4E7KA 4OGCA 1JLAB 2E6LA 3DLKB 4LSLB 1W25A 1RT4B 2W8KA 1IKYB 1D0EA 4EYHB 4K8XA 1I3AA 3CJ0A 3NL0A 3MEEA 1TAUA 1C0MA 3QGGA 3GIMA 5HROA 3RAQA 2D0AA 3QO9B 2HAIA 4URGA 4XPEA 1LWCA 2BGGA 4Y34A 5K14A 2KQ2A 4BE1A 3RR7A 1QAIA 4FZXC 1S1WB 1JLEB 4RW9A 4YFUA 1RILA 2OPRA 1KLMA 1KSPA 1N6QA 5KFYA 1S0NA 3HKWA 5FDLB 1NOZA 4I2QA 3D0PA 2HNDA 4M3UA 3O3GA 2XGPA 1BGXT 3SUNA 1HQEA 4E1NA 3TVKA 1KFDA 3LAMA 2V9WA 1TL1B 1FK9B 2X74A 3D45A 2XY6A 3DM2B 3SPZA 3TAQA 2OPQB 4AHCA 4ZHRA 3QEVA 3I0RA 4LY7A 4CJKA 3ZSZA 3ZT0A 5J2PA 3PR5B 3OYAA 2X6SA 2GUIA 3NAEA 2R8GA 4ZPAA 4KFBB 5HP1A 4KPYA 4FJ7A 3AVBA 3HVTB 2YHBA 1XR7A 3EPIA 2AGQA 2BQRA 4CEAA 3CFOA 4CJ4A 1I6JA 3HJFA 3V9SA 3KHRA 3CDUA 2LSNA 1JXBA 2DPJA 3MEEB 4CERA 5HROB 4HTUA 4RW8B 3DOKA 1YVFA 3MR6A 4JV2A 1LWCB 5K14B 4CEZA 2P1JA 2Z1HA 3EY1A 4FK2A 4RW9B 1TQLA 2R8JA 2OPSA 3O3FA 3SYZA 2OPRB 1KLMB 3TAMA 1N6QB 4Q45A 4KHNA 4J9LA 3DLEA 4QWAA 4QAGA 1IKVA 4I2QB 3H98A 3ICLA 2HNDB 2FVRA 2OZMA 1IM4A 1HQEB 2GIRA 4YR2A 3SFGA 3PZPA 4B9MA 2R8HA 1VSEA 3O4NA 4CEQA 4CFCA 3IAYA 5EDWA 4ZHRB 5DG7A 3L2RA 5KFOA 1C1BA 5J2PB 2DFHA 3V81A 4DF8A 2G8VA 4RW6A 3WNHA 1WAFA 1IG9A 5KGWA 4DQSA 3L2QA 3OYGA 5L1LA 5HRPA 1SKRA 1KVCA 3H5SA 5J2NB 4ID5A 4DU4A 1N4LA 3SPYA 1S1UA 1NHVA 2YKMA 3H4BA 3VQ4A 1J53A 4EZ6A 3RBEA 3LALA 1QE1B 5KFGA 2C2RA 4H4MA 2KFNA 3RBDA 3UDLA 1ZBIA 3DOKB 5KFSA 4YR0A 1RA7A 2GC8A 4JV1A 4EBDA 3KLHA 4NLUA 2OPSB 3TAMB 3NGDA 3DRSA 3LWMA 3DLEB 1IKVB 5KFZA 3HVWA 5KTQA 2W9BA 1TK0A 2IA6A 2Z1IA 4CF9A 4RUAA 3AVHA 4L8RB 4FS2A 4E7JA 5HRNA 1XR5A 2ITGA 4BACA 2XO7A 1C1BB 1BCOA 3OY9A 3V81B 5KFNA 4RW6B 5CYQA 2RKIB 5L1IA 1GX5A 4BE2A 4FZZA 1K1QA 4PWDA 3LP1A 4Y2CA 2AX0A 2A1RA 4ID5B 4EP5A 1S1UB 5EU7A 2YKMB 3KKSA 1NK0A 3I8DA 4GVMA 2QKKA 5F8HA 2D5RA 4H4MB 2BANA 3D28A 4Q8FA 3IGNA 4K4TA 4OKEA 2VWKA 3NAHA 2HNYA 2QKBA 4WXOA 4R8UA 2OH2A 2IOCA 1BQMA 3MXIA 4RW4A 2D0CA 3KLHB 5KFBA 4TYBA 3DRSB 1K1SA 2GIQA 3GIIA 2XCPA 2Z1JA 4RG8A 4Y1CA 4R5PA 2W9BB 5F9LA 3VQSA 1HYVA 4AHVA 1L3UA 3BJYA 3QERA 1TP7A 1I39A 4CK1A 1GOBA 4DFMA 1WNEA 3AA5X 4R0EA 4FJ5A 5CYQB 1S1XA 4KBIA 3AO1A 3V1OA 4B9SA 2ATQA 3ZSQA 3OYMA 4PWDB 3KLIA 3LP1B 3V6HA 3ALYA 4HCCA 5KFUA 1NK4A 1NK5A 1HRHA 3QYYA 2BRKA 2BANB 3HO1A 4DQQA 2VG7A 1SH0A 2XY7A 3PW5A 2HNYB 3GV5B 4ZVGA 1EX4A 3OYBA 3DYAA 4R8UB 3VQCA 1BQMB 2FC0A 3ULDA 3OSNA 4RW4B 3GV7B 3BSNA 3ZT1A 4IQXA 1KFSA 3NH2A 4GC7A 4O44A 3MFHA 2HHWA 4TSXA 2AJQA 4TY9A 1S0OA 4DQIA 1QAJA 3SUPA 2KFZA 2QE5A 2HVHA 4DL3A 4R5PB 3MXMA 4Z4FA 1LAWA 4NLDA 3NF7A 5HBMB 2IGIA 1O1WA 1VRTA 2R7YA 4M45A 3MTKA 3CG7A 5I3UA 4M3XA 4ED6A 1QQCA 3TAGA 4MKAA 3VQEA 3NMAA 3KMSA 1TGOA 3QIDA 1GOAA 2JEJA 3M8RA 4BWMA 4DL7A 1S1XB 2JEFA 4ZPBA 4CF0A 4ECRA 3OYNA 1NK6A 1JXEA 1VSIA 2YNIA 4QWEA 1N5YA 3KLIB 2ASDA 1TV6A 2XWYA 3QZ8A 3SZ2A 3N6NA 5DGAA 3CDWA 3KK2A 5C5JA 3S3MA 3FQLA 4OJRA 2G8KA 4AHTA 4FM2A 4PUOA 2VG7B 3DYAB 2IJNA 2IJFA 3HP9A 4Z4EA 3SJJA 4JS5A 5I42A 1TKZA 3GIKA 1SH2A 4U7CA 4O44B 4E7LA 3RMDA 2F8EX 4DL4A 5KT7A 5FRMA 2RF2A 5JUMA 3L3VA 3MAQA 4K4SA 4CJFA 4ZP8A 1SL0A 4N76A 2IM3A 5CZ1A 4CESA 3TI0A 1LV5A 1VRTB 1IH7A 3I0SA 4EP4A 5F8LA 4FJIA 3QEWA 5I3UB 2D7SA 3ZCMA 2R2TA 1JLCA 2HNZA 5C42A 1TL3A 4CJQA 3VQ6A 3HPOA 2XCAA 4DFKA 1D8YA 2KZMA 1TKXA 1Z4UA 4DSEA 2ASJA 1RT5A 2PYLA 3I5BA 3T5HA 3K5LA 2YNIB 1N5YB 1C2PA 1TV6B 2HHVA 4KHRA 3KLGA 1NNDA 1DLOA 4FK0A 3KK2B 2IM2A 2YNGA 2FBXA 2WOMA 3T5JA 3PW4A 4DL2A 4Z4GA 4B9TA 4O3PA 4EEYA 4QWBA 1QS4A 4PUOB 1J9AA 4OL8A 3VQPA 3ITHB 1HJRA 1A5WA 5I42B 1TKZB 1C1AA 4G3IA 3KLVA 2IS3A 4NLXA 3ZT3A 5EUHA 3CM5A 1HARA 3K2PA 1D1UA 2RF2B 3FRZA 1IKYA 2WB4A 3V6DA 3SUOA 2B5JB 3VA0A 3KTQA 4MFBA 3DMJA 3FQKA 5KFKA 3I0SB 3TANA 3ZSXA 1NHUA 4Q43A 4K4UA 3HYFA 1JLCB 2BQ3A 4Y2AA 2HNZB 5C42B 4ELUA 1TL3B 3NDKA 2Q3SA 1TKXB 2IM1A 1B9FA 4FBTA 2AX1A 1RT5B 1VSJA 4FLUA 4FJNA 3IG1B 5KI6A 1ASUA 4GMJB 4CGJA 3P5JA 1U4BA 3WNFA 3KK3A 4B9UA 3KLGB 1DLOB 2RN2A 3LWLA 3ISND 2YNGB 4C8LA 4WE1A 1QSYA 1S48A 3PW0A 3MXJA 1J5OA 3NKYA 5KFDA 2ZQBA 4DTXA 2Y1JA 2VA3A 3VQ7A 1QHTA 1BHLA 4KI6A 4Q44A 1NKCA 1WSHA 3GYNA 4KFBA 2C28A 3QESA 4M95A 3T5LA 1TKTA 4O0IA 2XY8A 3VQQA 4NLPA 3V6DB 1ZBHA 4ECVA 3BREA 2XI2A 4KHWA 1IKWA 3OYCA 4ID1A 4MFBB 3DMJB 4ECYA 5KRTA 4RW8A 3E51A 2F8TA 3SV3A 1RDDA 2A1SA 3N6LA 3NHGA 4NCAA 3NGIA 5HLFA 3IGVA 2BDPA 1ZBUA 4CEFA 1HNVA 1S9GA 4TXSA 3G0ZA 4E1MA 3H40A 1KVBA 1VSFA 4IH5A 4WXWA 1ZBLA 3RTVA 3M9MB 2OA8A 4Z4HA 3KK3B 1NK7A 2YV0X 3ZSRA 2CKWA 4ZVFA 3ZSVA 4CJWA 4DMNA 4KTQA 5KG1A 3BSOA 2QXFA 3QZ7A 4KE5A 3V6JA 1S49A 4K8ZA 3GILA 4WE1B 4AH9A 4DSJA 3AVGA 1D9FA 2Z1GA 1NJZA 3U3YA 1J5OB 4FJJA 5FRNA 3KD5E 4IG0B 1U47A 4HUEA 4JRPA 4M3RA 1KTQA 3U6FA 4KHQA 4C8NA 1TKTB 1XC9A 3NGYA 5J2NA 4ECSA 4CIGA 2E6MA 4FLZA 1UA1A 5KG4A 3RB6A 4KAIA 1IKWB 4J2EA 5KT4A 3OYFA 1QE1A 4IR1A 2ZE2A 4WFXA 4F50A 2D3UA 1HNIA 3OLAA 4C8MA 2UVRA 3SV4A 4DTOA 3QGHA 4CJRA 4FJKA 3NGZA 5HLFB 1KVAA 3NE6A 3RMBA 1YTUA 4IOBA 4IG3A 3CJ4A 1HNVB 2FBVA 1S9GB 3TAFA 4ZTFA 5DGBA 1J54A 5J1EA 4DTPA 1SV5A 4TQSA 3OLBA 5DLFA 1SL2A 4BWJA 3C95A 3TAPA 1BI4B 4ZP9A 4XO0A 4ECQA 4GW6A 3AA2A 3DLBA 3KLEA 4NYFA 4CIFA 5F8MA 4K4XA 5F9NA 3G6XA 2ILZA 2RKIA 4B08A 1TAQA 5KFPA 4J9SA 3SQ1A 2PY5A 1RTIA 5C24A 1LAVA 1L3TA 4LH5A 4OKJA 4NLOA 4HVJA 2ZD1A 4OLAA 3UR0A 4O5BA 3B6OA 2ZE2B 3G6VA 1HNIB 2I5JA 4DWIA 3LP2A 2NUBA 3HK2A 5FROA 3AO2A 4PQUA 4LQ9A 1QSLA 3T3FA 3TABA 2P5GA 3OL7A 4IG3B 1U48A 3SI8A 3LZIA 2R2RA 2OYQA 3OVNA 4FBUA 1HYSA 4H8KA 5J1EB 1SV5B 2JC0A 5F8JA 3KHHA 4IKFA 1VSMA 3PJXA 3SQ4A 3NF9A 4NRUA 3BQ0A 3KLEB 2FLLA 1X9SA 1QUVA 1LWFA 3CM6A 4DTJA 1NJYA 1UA0A 4NCBA 3AO4A 1EXQA 3G10A 4O3QA 1TKDA 1FKPA 5DG8A 4F2SA 3VQBA 1C6VA 4IRDA 1NOYA 2DFFA 2XHBA 1RTIB 4ZP7A 5C24B 1UWBA 1YT3A 3AVKA 4CFBA 3AVNA 2FVSA 2CJQA 3FDSA 4YMEA 2ZD1B 4UQGA 4O4RA 4MKBA 5L1JA 2HHSA 3LANA 3DLRA 2IBKA 2UVVA 1RA6A 2I5JB 3AVCA 1RBUA 3EPGA 3C6UA 1JLQA 4YNQA 3LP2B 3S3NA 2BE2A 2J6TA 4E19A 2D0BA 5KFMA 2WCXA 1DTTA 4J9RA 4PQUB 4IFYA 1NJXA 3OS2A 4DF4A 3F73A 1HYSB 4MK7A 1Z26A 3RB3A 4ED3A 3VN5A 3TARA 4CFAA 2C22A 1VSDA 1NKEA 5HBMA 3DRPA 3V9WA 3BSCA 4ZVHA 1TK5A 1RT6A 1LWFB 2IAJA 4KO0A 3UPFA 3PX4A 3QGIA 2X78A 1Q9YA 4NLWA 1FKPB 3FFIA 5SWMA 2WHOA 4GC6A 4CJSA 1UOCA 4W5TA 3MEDA 2XGQA 1F21A 3K5OA 2FBTA 4FJ8A 1UWBB 3QNOA 3QEPA 1W9HA 3NF6A 1L5UA 4CHZA 3CJ5A 4DTNA 4B8CA 4CJPA 5C25A 4ZTJA 1XR6A 4WYWA 4AHSA 1LW2A 2PYJA 4CJLA 3DI6A 3C6UB 1JLQB 2D3ZA 2BE2B 2E4LA 3LP3A 2HWHA 4EYIB 3OL9A 4OGEA 5KG6A 2FJWA 1DTTB 4CK3A 1TK8A 2XI3A 4IFYB 4RU9A 2WK4A 3LPTA 3CYMA 3RMAA 4KHUA 1NK9A 2WRMA 2AWZA 2B4JA 2HHXA 4KI4A 1LWEA 3OYIA 2V4QA 1WNSA 5KFJA 3DRPB 2VG6A 4DQRA 3T5KA 3JSMA 4DS4A 2JLEA 4RUCA 1W0HA 1RT6B 3HP6A 2G8HA 3DRRA 2HMIA 3CO9A 2IAJB 4BDZA 2WTFA 4KO0B 4JS4A 5JS2A 2G8WA 3FFIB 3JYTA 4KKOA 3QLHA 1UAXA 4DU3A 4FJGA 1WSGA 3MEDB 1RTJB 3AVAA 4XIUA 2UUWA 1MU2A 4KRFA 3AA3A 4Q0BA 1S9EA 5L9XA 3OSPA 3QIOA 3MR5A 5C25B 2J6SA 3M8QA 4FLYA 3VQ9A 3UIQA 3QINA 2C2EA 1LW2B 3Q8QB 4M3YA 3DI6B 2XY5A 2E9ZA 1Q9XA 3L3UA 4ZP6A 2FJVA 2EX3A 4CEDA 3ITHA 4NRTA 1BCMA 4O3NA 5KG3A 3OL6A 4CHPA 1VSHA 4NLTA 4TLRA 4O3SA 3H59A 3K57A 1RAJA 2P5OA 4DTMA 3K59A 1RT2A 1U04A 3BSAA 1LWEB 1GX6A 2B5JA 2D41A 4IBNA 2FLPA 3KLFA 4ED2A 4E3SA 2VG6B 3MR2A 4J9NA 1X1PA 3JSMB 3AO3A 3AVFA 3H5YA 3NBPB 3DRRB 2HMIB 4NLVA 4WFYA 5D3GA 2OPPA 3JYTB 4O55A 4KKOB 4DG1A 3KIOA 3QLHB 4ECZA 3IG1A 3DLHA 4KREA 3AVIA 4J2DA 1MU2B 5J2MA 3CWJA 1OS5A 4HUFA 4Q0BB 1S9EB 2JGUA 1Z25A 1T3NA 3M8QB 5HRSA 4W5OA 1CZBA 1A5XA 3ZSOA 3AA4A 1JXLA 3KK1A 1S6QA 4F4XA 1JX4A 3OYDA 3TAEA 1JIHA 4HKQA 3GIJA 3HSTB 3LZJA 1U45A 3OL8A 2AQ4A 1HQUA 4KB7A 3HL8A 3ZSWA 4HUGA 5KFTA 3G6YA 3HHKA 4DL6A 3MECA 4JRQA 3GV8B 3HVAA 1RT2B 3V9ZA 4CE9A 5KFHA 1U49A 2G8UA 2DTUA 2C2DA 4YR3A 3KLFB 3BQ1A 3HXMA 4N47A 3HVRA 4W5RA 1N48A 1HMVA 2YKNA 4WFZA 1RYSA 4OPKA 3CDEA 5KFEA 5T14A 4ELTA 5D3GB 2OPPB 2IDOA 4K4WA 1WSJA 2VG5A 4YP3A 4DG1B 4AILC 3Q8SB 2RPIA 4CGGA 4AHRA 4CJ3A 1C0UA 1FXXA 3OJSA 4E89A 1Q8IA 4QPXA 4M42A 4TYAA 3C94A 4RZRA 5J2MB 2UVWA 4CGHA 3KOAA 3K58A 2KZZA 1KHVA 3H08A 1S1VA 4HYKA 4NYZA 4FW2A 4KSEB 2YNHA 1L3SA 3NAIA 4AHUA 3KK1B 1S6QB 1BQNA 4NLQA 3CQ8A 2G8IA 3U3GA 3PY8A 3G86A 2WONA 4IG0A 1YVUA 4B9NA 1KCFA 3LAKA 2W8LA 5KT5A 3E01A 4YQWA 3IS9A 1HQUB 4N56A 4XPCA 3BGRA 2Y1IA 3OHBA 4K4YA 4O3RA 1QTMA 3MECB 4G1QA 4FW1A 4IDKA 3QETA 4QCLA 4M41A 2FBYA 4IRKA 3QNNA 1GOCA 1BL3A 2RDIA 1HMVB 2YKNB 4EBCA 2IC3A 5KFFA 3L2UA 1NJWA 3PJWA 4O0JA 4CJUA 2ETJA 2VG5B 3CFPA 3MF5A 4CHQA 1SKWA 1C0UB 2HW3A 1EKEA 1VRUA 4H54A 1BI4A 4RNMA 2VWJA 1S1VB 5KFXA 3PW7A 1YTAA 2JEIA 4KTWA 1XHXA 5T7BA 2YNHB 2W9CA 5JS1A 4F4ZA 4IR9A 1BQNB
chains in the Genus database with same CATH superfamily
1Y97A 2P9PA 2V2VA 2R8IA 2RRBA 1XNRJ 2QMUB 5KT2A 1REVA 5KOXA 1CLQA 3SCXA 2ZKUA 3P83D 3E01B 3RR8A 4N8NA 3ISZA 1FNOA 4LSNA 1BHNA 3L2WA 4G1QB 2AP6A 1QY7A 1VJWA 3V2UC 3FK4A 1X9WA 3LP0A 1KLNA 4GRSA 3I5CA 3SUQA 4DLEA 1SIWB 3BO2A 1YK9A 3TA2A 1RBOB 1BUXA 4A8KA 3MM7A 3CXCR 2XC9A 1JL1A 3V1RA 4FJLA 4V19S 4OYWA 4X4VA 3CJ2A 3OHRA 1R27B 3M2UB 1SS6A 2I8EA 5EXWA 2QK9A 2LQ5A 2Z0GA 4DKWA 2ZGYA 3I33A 1VRUB 3B8HA 3C7NA 2OELA 1FT8A 4KTZA 4DR4K 1S4EA 3H1VX 2FLNA 4Q8EA 2W9CB 4I2PA 5T41A 4N41A 2FXUA 2Q2RA 3OD2A 4BRGA 3QFWA 4K0KK 1RDCA 3RMCA 3ZC4A 3HMJG 1XMQF 4ZLJA 1JKHB 1L3VA 5LXRA 2V52B 3I0RB 1HLWA 4D3GA 4JI8K 2E9RX 1WF1A 1VHFA 2Z2LA 4DPOA 2OCEA 2V69A 4C8KA 1R0AA 1A7GE 4JI0F 3I87A 2ALZA 4J9PA 3B54A 4J9OA 1BWFO 1CJUA 3SQ2A 4B3MJ 3MFIA 2IA0A 3LPEA 4USVA 2LMIA 1QJHA 4FLVA 4C8OA 2WB1D 4CGIA 3U7JA 4FYYB 4O4GB 1RYRA 3LDSA 3P1GA 2O8DB 3Q8VA 2YNFA 3D2EA 1W2BR 3OYLA 4DR7K 3S9HA 1GMUA 3EZ5A 3OQ2A 1Y7PA 1TU0B 5A0YB 1HBUA 1WORA 1HKAA 3A2FA 2UUTA 1ATRA 1H3DA 4LRCA 1PGZA 3FZHA 3FZBA 3ZZPA 1VQSA 3JAMY 3ADAC 2XMAA 2P51A 2EC0A 3DDIA 2LEBA 2IMWP 3D7SB 3CIZA 4CH7A 3CJQA 3GFYA 3BDPA 4KH6A 1OY8A 5KGXA 3Q2TC 2V94A 2A6MA 1EP4B 3UFCX 4LFAF 1AT1B 1BWVA 2H5IB 5KFQA 1UP1A 4ZVPB 4FSVA 1RSCA 1YSJA 5H9FJ 3C6AA 4DL0C 1YJRA 3M6UA 4K50A 2W41A 2XMTA 3CTRA 1SUQB 1D8ZA 3POTB 1RTDA 3EXCX 1T0TV 5DDRC 3TZYA 2GAHC 1BE4A 2BMBA 4LVOP 1FJEB 3PACA 4DV7F 1ZYQA 3QPIA 4KT0C 2CQ2A 4RW7A 3C19A 4BC3A 1RDRA 1FKOA 2IVPA 1BY9A 4QU7A 2NYHA 1WAJA 4HLBA 1GMVA 5CR4A 1U0HA 1CSJA 2BRLA 1HR0J 4ZDNA 1B92A 4WYLA 3FSXA 1NDLA 3R7BB 3U27A 2DK2A 4WP3A 4PKIA 3D0IE 2C2OB 1RAHB 3S1TA 1B0VA 3M6XA 4NLYA 2O5DA 4IRCA 3VESA 3KK7A 2Y8YA 4ECWA 1VQMS 4ISGA 1UWAA 2EFVA 3UD5A 3O1BA 3R3TA 1RBTA 4X65F 3NGUA 1YX2A 3GJRB 4F4YA 5JVHQ 3CIPA 1KKHA 1MMLA 4NO7A 1RBRA 1NU0A 2HBYB 1GLCG 3HTVA 2ZH6A 1N54B 1WEYA 3KJVB 1RTHA 3S8SA 1SKSA 1WC1A 1N36K 4OJ3A 3M8SA 5ELZA 1OMSA 2X6NA 2L41A 3K2YA 1FDNA 2L08A 5DQGA 4NZ0A 3D2WA 1S6OA 3AA9A 2HBKA 1PAUB 1TTHB 4C6AA 2E5HA 4IH6A 1U1MA 2R2UA 1LW0A 1OQ3A 3N0VA 4RUHA 3AVLA 1K0TA 3QIPB 2BR0A 2YKPA 2C2KB 2LQ8A 1HNWK 3S3OA 2XG8A 5EWFA 2I1RA 2QSWA 2G8FA 2ZDOA 3D67A 2B0GA 3QBWA 2NLXA 1I94F 2E9TA 2DEIA 3V4IB 2DR7A 1YBUA 4B3OB 1IBKF 2GJIA 1QVFM 4I7FB 2JSXA 4B9LA 1S1TA 3H4DA 3VAHA 2FJEB 1YLXA 4TY8A 1QUPA 4MIAA 1S76D 7FD1A 2MQOA 4UY8T 4QIVA 1ZBFA 1UZHA 2IHR1 1PSDA 1JLGB 2GQQA 4CT8A 1N56A 1UPPA 1FVSA 4PA1A 1DFDA 1QDUB 4DPYA 1ZTWA 2GGPA 4URQU 1IO2A 1BWEA 2QFJA 4UW2A 4FYDA 3SNNA 3PYGA 2DKOB 4QZVB 3EGWB 4CW7B 2CWKA 2E5LF 1B64A 5GMEA 1EETA 4FYXB 3RB4A 4NCGA 5KFIA 4NYNA 4ZVTB 2RDDA 3OYKA 1ZOTA 3M9NB 2H5EA 4CECA 3J81j 3BZQA 3JTPA 1VGYA 2Q3PA 3EWGA 3F9MA 4B9QA 1T9TA 4YHHF 2RE1A 5F8NA 5IQQA 2L9DA 2RU3A 2HIYA 1OY6A 3VERA 1U09A 1S3XA 2CQGA 3EM1A 2W4PA 2NZCA 2E88A 4DR2K 1RT1B 2QWQA 2MJUA 1IBMJ 1RTZA 4LF4F 3NVKA 1JLAA 3ELHA 1RT4A 4H03B 3JSYA 1SZ2A 2KM8C 1U1OA 4DV3K 3HSDA 2ZJPQ 4ED0A 4FPIA 4DTRA 3NH0A 5EWEA 2JOQA 3QO9A 1EKSA 2HF3A 4DR6K 4F25A 4MH8A 2Q1LA 5B7WA 2J9DE 4RWWA 3KKRA 1JLEA 4NLSA 4P7VA 1G3OA 3IM8A 1RDUA 4LR8A 3D1QA 3I9ZA 2ZM6J 5FPNA 2YWWA 4MK8A 3KHYA 2VQFK 5FDLA 5KT3A 4WZQA 3U02A 2YHYA 4M94A 3NH1A 4L72B 4CLPA 3B6PA 1VLYA 3BDEA 4H4OB 2XMKA 3AD7C 2O8FB 2MLZA 1NU4A 2OSRA 2IDLA 3UI3A 4JI3J 3RRGA 3NMRA 1GTHA 3NOCA 1HD1A 3T19A 1CS4A 3AOBA 2M9KA 1U1PA 1WN7A 1R59O 4WIQA 1X0FA 1IWGA 2CJYB 4ZMMA 3HVTA 4FM0A 1H2TZ 2DY4A 4E7KA 2QTDA 3J7ZT 3CCUS 2E6LA 4EYHB 3NL0A 3AY0A 3GIMA 1VQ9S 4OLOA 2OO4A 5DS7A 2D0AA 4ZN1A 2Y8WA 4URGA 1P1LA 3FEZA 3C8YA 2KQ2A 4BC5A 2V2QA 1PCAA 5FIIA 1OIAA 1LQ9A 1KLMA 1KSPA 3VETA 3GE9A 1H74A 2CPIA 1NOZA 4I2QA 3D0PA 1K8KA 3O3GA 2XGPA 2XZDB 1KFDA 3TVKA 2Z56B 3D45A 4DCHA 4O23A 3SPZA 4EWTA 2OPQB 4HL9A 2J4RA 3AT1B 4BRLA 2VCPA 2MKKA 4DOZA 3K17A 2YQ1A 3PR5B 1FE0A 4HACB 3BBFA 2R8GA 3NAEA 3SJHA 3WXJA 3D0GE 2OD6A 2DXFA 3H90A 2A2CA 3AVBA 1UCNA 4DQ8A 2CXEA 3VAFA 1XR7A 3VWSA 4CEAA 2I9SA 2CQPA 2E5JA 4KBOA 3KHRA 1SKUB 2B4PA 1GXTA 3MEEB 5HMWA 1IV0A 4B3TJ 1FFGB 3MR6A 1LWCB 2HHHF 3AQPA 2DNNA 2W25A 4JD2A 4RW9B 3O3FA 2BX6A 1N8RO 1UVNA 3P4IA 2MKSA 1Q7YO 3ICLA 2HNDB 1WD6A 2ZUGA 2VJUA 3P49B 3SFGA 3PZPA 4B9MA 4H4KC 3VENA 4NPOA 5EDWA 2CZ9A 5BR8J 1NLVA 2YWEA 3I55N 3L2RA 1C1BA 4NA1A 4X84A 1YQHA 3ATUA 4DF8A 2G8VA 3BR8A 4BVPA 1IG9A 2CNNB 5KGWA 2UZAA 3RSEA 4DUYJ 3L2QA 1KOHA 3OYGA 4NXNF 3CF5Q 3A5OC 3NP5A 1UVMA 1S1UA 3VQ4A 4IO9Q 4C98A 1K8AT 1J53A 4MO4A 4EZ6A 4LIRA 3J81Y 3MHYA 2C2RA 4JKGA 3WDOA 3CPWM 1VQ8N 1PYOB 1ZBIA 3DOKB 3VAJA 1KAZA 3F41A 1S59A 3WX8A 3FEXB 4DPTA 5AZJA 1IBCB 3SSSA 4E8UA 3GB0A 2YTCA 1IKVB 1K9MT 2J9CA 3Q2SC 5HJXA 2AYGA 3QFUA 1X5SA 5LMUK 2AA4A 3LDPA 4OPAA 4IOCL 1KQGB 2J0SD 1XERA 4FNHA 5HRNA 2ITGA 2XO7A 1NGCA 4EUVA 3V81B 1WBBA 1VISA 4B3SF 4P72A 2RKIB 1NGGA 2JLFA 2R9LA 1EO1A 1GX5A 4BE2A 3GLJA 1S7IA 3KJNB 2VQEK 3NEKA 3H1QA 4ID5B 5LOQA 2A3ZA 2CPFA 1XQSC 4GVMA 4R79A 2I2YA 1OH8A 3WQPA 2QKBA 4R8UA 2WW8A 3MR7A 5KAKA 2IOCA 1H73A 4CNYA 3MXIA 5BYRA 2K06A 4DV6J 1Y4ZB 4TYBA 3R8YA 3AD8C 2CDQA 2GHPA 2YPZA 1PJ7A 4Y1CA 4YORA 2W9BB 1HYVA 2VUGA 4NA2A 3R5GA 4IYQA 1L3UA 1X5TA 4AUKA 2DR5A 1I39A 4OX9K 1GOBA 1N5VA 5KQDA 3AY9A 2B3TB 4FJ5A 1S79A 2LU2A 1MA9B 4F4AA 5CYQB 2B4UA 3GFXA 4KBIA 1XMQJ 1NM1A 3AO1A 3V1OA 4JI2K 2EFPA 3PTWA 3HULA 3FKBA 3N01A 2J5AA 3GZ7A 4V19X 3R1LA 3LP1B 3NMUA 3V6HA 5E7OB 1U1NA 4HCCA 1NPPA 1SC1B 3M6WA 1VHIA 3D7EO 2F9JA 3ZZ0A 2ZHOA 4DQQA 2VG7A 3PW5A 1EX4A 3A3OB 2CJXB 1RDWX 2FC0A 3GV7B 5IQ6A 3BSNA 2JWLA 2LP4A 2BJ3A 2HHWA 4TSXA 2K1RB 4C4WA 2GFFA 2M8DB 2E1RA 3LA0A 1DJ0A 1KQSR 3RJMB 2OIHA 3NF7A 3PJ9A 1VRTA 2R7YA 4M45A 2J7WA 2KT2A 4WPAA 3DAWA 1OH7A 3CG7A 2F8MA 3HI9A 4QR2A 1Q81T 3O9TA 1QQCA 4EAHD 2W2OP 3NMAA 1T9VA 4KHPF 2OEJA 2XO6A 3HZEA 3T6BA 1KBRA 3BKUA 1S1XB 4ZPBA 3P3DA 2M7SA 4ECRA 5IFMA 1VSIA 4JI6K 4QWEA 1F5CA 2MHNA 2AYEA 2ASDA 2XWYA 5L39A 3QZ8A 4CP5A 3SZ2A 2HSTA 3CDWA 3KK2A 3CETA 3S3MA 2M52A 1ZA1B 2DNRA 1N0VC 2G8KA 2DIUA 2YX7A 3O5TB 4KC5A 3Q0AA 4AHTA 2JH3A 4FM2A 4QR0A 1R8HA 2HK2A 2IJFA 2NRWA 4JS5A 1SH2A 3CD6N 4YOEA 4U7CA 1VQNN 4E7LA 2MQPA 4DL4A 5KT7A 4LVNP 2FYXA 4K4SA 4ZP8A 2IM3A 3GL1A 2IMOA 1VS3A 2F65A 1YF5L 5I3UB 2AJFE 4A2AA 2E44A 3A8IA 4CJQA 4DFKA 4A8SA 1D8YA 1BUPA 3G25A 2OGUA 4OHVA 3O5BA 3MUTP 1V5IB 3RBXA 4A8MP 3K5LA 3T5HA 4IEIA 4HWIA 1V4TA 3PSFA 3ET6B 2EFOA 1NAQA 2WOMA 2XULA 4P7TA 3VF6A 1F2HA 4PUOB 4EGLA 2QWOA 3P5BP 1XMOF 3KUHA 1I1GA 1A5WA 1M5VC 5I42B 4EFAC 4E2FB 4X65J 3TX0A 2G2OA 5EUHA 1VQ7S 1WHYA 3NCRA 3OTBA 2RF2B 3DU5A 2YQ3A 1VHXA 1UFWA 2G2ZA 2V67A 3MN7A 2E2OA 2EVZA 3THTA 1PG5B 2LFVA 3KTQA 4LF6F 4YDUA 2CPJA 4F9OA 5D0HA 3U4LA 3SDEB 3ZSXA 4NZ6A 4K4UA 1TMJA 2BQ3A 4Y2AA 4ELUA 1ESVA 3C16A 2DGOA 4BC9A 1SC4B 2ZZMA 4OQJA 2N3LA 2QMWA 1NSPA 5A8KA 2VODA 2EG1A 5AQTA 3GWCA 2KYZA 5KI6A 2R7OA 4YOTA 1U4BA 3WNFA 3GFHA 1WUAA 3KLGB 1DLOB 2R42A 1KD1O 4PKHA 4DCPB 1QSYA 1S48A 5KPTA 1FRJA 3NKYA 4OJ1A 1H7XA 2Y1JA 2VA3A 3Q83A 3C2PA 3R2DJ 1SI9A 1IBKJ 4PG5A 3QESA 4M95A 1KVIA 4DV4F 4OJHA 4OFZA 1IR2A 1UL3A 1FTCA 2GHVC 1ZBHA 3V6DB 1PBAA 3BREA 4HDHA 3VAKA 3CCLN 2DNZA 3HLUA 3P31A 2QWPA 1LEOA 3NCPA 3OR1B 3NGIA 3KJFB 2CQHA 1KOOA 4F0MA 5D0EA 5M2RA 4CZMA 2D74B 4YB7A 3UVJA 3HHLA 3G0ZA 4E1MA 4J90A 3DU6A 4WXWA 1ZBLA 3RTVA 2OA8A 4B3RF 3ZSRA 4LFCF 5KG1A 3BSOA 2QXFA 5AQKA 3QZ7A 3PKMA 1PJ6A 4XH5A 1T9XA 1CJKB 4DSJA 4BCAA 1MWMA 2D69A 1NJZA 2Z1GA 2DHAA 1MWKA 4NLBA 4RR5A 3KG4A 4Q2MA 4OYBA 4IG0B 4WQ4C 1U47A 4JRPA 4M3RA 1KTQA 5ITHA 1HNXJ 1YJNS 4C8NA 2P9SA 4RU2A 4ZCLA 1XC9A 3CJ7A 4PL8A 3J80O 3K0SA 4CO0A 1GLJO 1UA1A 2P9CA 4HT7A 1QE1A 4WFXA 4F50A 2D3UA 4C8MA 1FRXA 2UVRA 4LF4J 1U6BA 4LF8J 4FF3A 2XS5A 1PILA 5LSRA 1UFKA 3NE6A 1HNVB 2FBVA 4ZN3A 1AYEA 2ZITA 2H5JB 4JI5F 5DGBA 2B4OA 4LF9K 1Y00A 4Y28C 3W2VB 1SL2A 5LL6Z 2VOPA 3T1HK 2OEKA 3CC2N 3Q86A 3GYGA 4WYBA 4XO0A 4GW6A 3KLEA 4DV0J 4NYFA 4CIFA 4M5GA 2WVEA 3EDQB 3DFEA 1EJ7L 4ZOSA 2P9PB 5F9NA 1BDGA 5DO2A 4WK3A 4B08A 3CULA 1VC0A 3CT9A 1NGEA 5E3QA 2PY5A 1LAVA 4LH5A 2DT9A 3SCIE 4OKJA 1RHKB 4O0NA 1KAYA 3CMEN 3AARA 5M1FA 2ZE2B 1Q78A 2A18A 2EWHA 4P2FA 3G6VA 1HNIB 3TR5A 3KYLA 2CG4A 1OWXA 4DR3F 1HWJA 4LRAA 3PDNA 3AO2A 3J7YP 4USIA 3W5XA 4PQUA 5MAOA 1HFEL 4LQ9A 3MEKA 2ZJQQ 2C2NA 3CB4A 1QVFR 1HYSA 1RCOB 2H4YB 5F8JA 4IKFA 3PIOQ 3NF9A 4NRUA 3I6PA 1HW9A 4NASA 3CJ9A 1WKJA 3AO4A 3GG1A 1EXQA 2B9WA 4HVZA 2KI2A 3T9ZA 3MM5A 1FKPA 3R9LA 3I96A 4IRDA 4Z2XA 1NOYA 1VQKS 4IQMA 2XHBA 4X4OA 2W4CA 1YT3A 3AVNA 2FVSA 2CJQA 1UAWA 3Q8UA 1EQ0A 2ZD1B 5B09A 1VDHA 3MPUB 4BRNA 2D0OA 2HBZB 3LANA 1YJTA 3QFPA 2UVVA 4RBUA 1CC7A 2I5JB 3AVCA 4MAKA 2KKZA 3UDEA 1WOSA 2RQCA 4YNQA 1F3VA 3LP2B 2UXCJ 1T6CA 3GCXP 3NXZA 2WCXA 1HA1A 3CCEN 3CJTA 5C2FA 1B70B 4DF4A 1TFWA 1VQ5N 2ZH2A 2HHHJ 1PYTA 2C22A 1VSDA 4K5SA 3BSCA 2IFXA 3ID8A 3M2RA 1RT6A 4Y0FA 2EC2A 2QC3A 2XB2D 1YI2N 1UEKA 2WHOA 3DRXA 4GC6A 4CJSA 2P9LB 4DX8H 3MEDA 2FBTA 3QEPA 1L5UA 4CDIA 4CHZA 2UXBF 4DTNA 4B8CA 5C25A 4ZTJA 2E66A 4PPDA 3G2XA 4WYWA 2ZH5A 5KQ8A 5BRDA 1LW2A 2BW7A 4CJLA 1N0UA 4K42A 5CH7B 3EKUA 3HFKA 5CHIA 2FTRA 4OGEA 4F26A 1P1TA 3C15B 2FJWA 2ZC4A 2I6WA 3NWGA 3H0PA 2SXLA 4CK3A 1TK8A 2QEXS 4GKKK 2RJZA 2F4VK 1DURA 3IFRA 1S6UA 3QBCA 3LPTA 4BQLA 1HKBA 3RMAA 4B1XB 2WRMA 3GP9A 2AWZA 4KI4A 2C3UA 1XNRK 3QJJA 4JHDB 5HI7A 1EKRA 1WOPA 1VIOA 4DS4A 4RUCA 2OAUA 3HP6A 4BRCA 2HMIA 3D2FA 1BG3A 3FFIB 3JYTA 1F1BB 1DARA 3J80U 1B7YB 3BM7A 2NRZA 4KRFA 2GJFA 3OTEA 4IOXA 1S9EA 2J6SA 2VBWA 3G71S 4FLYA 3ENWA 3E9PA 3W3SA 5AXMA 4O8UA 5F1XA 3Q8QB 3OTOJ 4U8YA 5K5MA 2E9ZA 1Q9XA 3L3UA 3BS9A 2EX3A 2CJAA 1J5EK 1R8CA 3ITHA 4NRTA 4X4UA 1NGHA 1VSHA 4ES1A 3FZMA 3HBTA 4M1KA 3KUEA 2GIFA 4TLRA 3SAHA 3QT6A 4H0PA 3HHLD 3K57A 1ITPA 1K47A 4UY85 4DTMA 4CWBA 1U04A 2B5JA 4E3SA 2KL8A 5JJBA 1M5OC 3H5YA 4LF7F 3TYTA 2ZJRQ 2HF4A 3T9NA 2CRLA 1ZM4A 3FC9A 4WFYA 1RWOB 2OPPA 1FD2A 5GAGU 1FJCA 1NMDA 4KKOB 3QLHB 1CQMA 4ECZA 3IG1A 1JQGA 4WFAQ 3HZGA 4OYZA 3BBCA 3R1HA 3L0QA 3AVIA 1MU2B 4B3MK 1GXUA 3EL2A 2OMLA 4ATNA 4ILLA 4W5OA 1A5XA 2EWSA 1Q95G 3KK1A 4X4PA 4F4XA 3TAEA 5GAHP 2YJFA 2MZSA 3SXLA 4QS8A 2QRRA 4HTLA 2YH0A 4WFBQ 2AT1B 2AD9A 3QRRA 1MMDA 4DV2J 1HQUA 1GNKA 3ZSWA 5KFTA 3J7AN 3MECA 1RT2B 4GO7X 3DDNA 2V63A 2G8UA 4MYTA 3WXIA 3A8YA 2KXHA 3BQ1A 3MN6A 3HVRA 2FZKB 1YWXA 1N48A 2MQMA 5B8HA 2DIVA 2IJRA 5KFEA 4ELTA 3QRQA 3DCAA 2IDOA 4BC4A 2DH7A 4AILC 3Q8SB 4AHRA 3HZ6A 4NXMF 1FXXA 3CPWR 4E89A 4JV5F 4QPXA 2VDIA 2X3DA 3C94A 2HBMA 4KHPJ 4CGHA 2KZZA 5H9FK 1Y3KA 1KHVA 3MPWA 3H08A 4HYKA 4NYZA 4KSEB 2RS2A 1L3SA 3NAIA 1DQ8A 3BY5A 4WQ5A 4NLQA 4A8QA 2HVEA 1Z1ZA 1E4GT 1S7HA 5CZVA 1RJJA 4UT4A 1T11A 4X66F 2C42A 3E01A 1NSAA 2LQBA 9RUBA 2MZTA 1YHQN 5ADZA 4MJKA 4N56A 1X3NA 4K4YA 1QTMA 4O3RA 4G1QA 2HSEB 5BPNA 3J7Z5 4QCLA 4M41A 4ZPVR 2RHKA 2MXYA 1HR0K 2CQ0A 1AUDA 2VKZG 4QIGA 4YEAA 5F3TA 2BKOA 2G9OA 5HQMA 5I9EB 3L2UA 2VICA 2WUSA 4GY2B 1ICEB 4MDAA 3EMTA 1EIYB 2CYYA 2VG5B 3CFPA 3M2UA 1N34J 3MF5A 1N32K 3CCZA 3U1NA 4AM7A 2DGUA 3AAQA 3GFZA 5M1PA 1Y0HA 4WK1A 1VRUA 3PFEA 1WB9A 3TOQA 5KFXA 2LDYA 2JEIA 2UYTA 2YNHB 2ZH9A 2GQ2A 2W9CA 5JS1A 2QL9B 2IIHA 3THPA 4F4ZA 1Q8LA 4CH0S 2HIQA 2Q31A 1KR4A 3B8AX 4YOVA 4M63C 4BDYA 2W2PP 4BR5A 2NZ4A 3W5YA 1JKHA 1U1QA 1U25A 4ZIVA 1FTRA 2VPWB 3THYB 1PC4A 3A0IX 2AW0A 4BRPA 3OS0A 3HD2A 5ETNA 5HL7Q 3VQ8A 5AQPA 3I56N 4DUZF 2BUPA 1HYZA 3E9LA 3W65A 2FVPA 2IC3B 4RUBA 3PX0A 1VJQA 2V4JB 1MWQA 4DV1J 5CZ2A 3SBGA 1HL6A 2D9PA 3UKUB 3AHPA 4M5HA 3QJLA 3M2VB 2HG4A 4DSLA 4O4GA 2N3OA 3TA0A 2O8DA 4NLGA 1NDKA 2JWNA 3ZETB 3LPYA 2FLOA 2G1DA 3CSKA 3VVTA 2ZHBA 1BIZA 2KXFA 3TUPA 4CHYA 4E98A 4U7BA 4BGBA 2R8KA 2DGWA 3BUZB 3E8OA 2VIHA 3FSIA 1MROA 3AJ1A 4DV4J 2GX8A 3PIPL 4FJ9A 2AF6A 2H48B 1EP4A 3KWMA 1P9YA 4CHOA 3BGFA 4LREA 1FRHA 2JVRA 2BJ9A 3NFAA 4KY3A 2CQCA 1KC8T 1SUQA 4QWCA 3MURP 3POTA 4FVCA 2XZWA 4TQRA 3H46O 3KNAA 1H72C 3WNGA 4OO1J 2C1EB 1QZ6A 3R6GB 3SBTA 2B6AB 3W9HA 1XC3A 2BABA 4CBUA 4J2BA 2O8EB 3I5AA 4BRAA 4PQAA 3DKDA 3K5PA 4NLRA 4C8YA 2E1AA 2WFBA 1IBMK 4CM0A 3NLCA 3N6MA 3FFKB 1S0MA 2EFNA 3KMQA 1CPZA 1R3NA 4Z4CA 4CGDA 3IMXA 3KXDA 4CZJA 1S6PB 2J76E 4DBQA 5HVHA 2HVIA 4ED7A 3C6TB 2CPXA 2HKEA 2JEGA 2VONA 4F4WA 2KFYA 1Y3JA 2BQUA 2YHAA 4ZPCA 2DBBA 2UV8G 3K5NA 4B8AB 4K0KF 3U9ZA 4O8KA 4W5NA 4PCQA 4DQPA 3EXYA 3FVYA 3DGPB 4JI8F 3I55S 4OZ5A 5M2UA 2O4IA 5HVFA 4L3QA 1R0BG 1QLNA 3KJVA 4CZHA 5E41A 4JI5J 4TU7A 2QI2A 4JI3K 3DLJA 4DDFA 2Q0RA 2A6AA 4L6V3 3L7PA 4WJBA 2QLJB 4IKAA 3W2WB 4I64A 2EFQA 3ZLJA 4KAZA 4J91A 2GELA 3IR7B 1RT3B 1RTJA 1S9FA 5AE3A 2RB7A 3CQYA 1BU6O 1UW4A 3CERA 4I9LA 1VQ8S 5FPDA 2PIIA 3QIPA 3U9DA 3MR3A 1NMNA 1T03B 2OSQA 2J8AA 2F9DA 2W6LA 3TWZA 5KRSA 1OVYA 2V4RA 4DR7F 2R7VA 1X31C 5KG2A 3MMJA 5HRRA 3KHGA 3PX6A 3V4IA 2GA7A 4B3OA 4CM2A 4N5SA 1HBOB 4I7FA 3PR4A 1WHXA 3CW2C 3VGLA 3OT9A 5DQIA 3MM6B 5SZTA 2O8BB 3LM9A 3MEGB 3MCMA 3GSDA 4DL5A 3SQGB 3DHWC 3H3NO 5DM7Q 1IKXB 1Q8BA 2X1GA 4CZGA 3QAUA 1U1KA 4J2AA 3NBPA 3BN4A 2XSJB 1JLGA 5BYSA 4GKJK 5D78A 1HWKA 4QW9A 4DTUA 1C0TB 3OHAA 4CO3A 1SAZA 4FJXA 1JLFB 1RWMB 3D6TB 4ZKAA 3PVXA 4MQ3A 2JDJA 4WFNL 1Q18A 4F3OA 2MSSA 3VGMA 1JJ4A 5KFCA 2BZ2A 4CF8A 2IRUA 3JTOA 2RQKA 2G2YA 3WIVA 3NCQA 3THVA 4B3TK 4DR1K 1LK7A 1CULB 1WF2A 1HPZB 1TYQB 2GBZA 4GO5X 3CJKB 5KG7A 4NX9A 2NRRA 4DB3A 4DFJA 5CYMB 4FP9A 2FQQB 3TRGA 3PW2A 1S4FA 2HQDA 4A5AA 4WF9L 5J2QB 5AFUA 4QYZJ 4K4ZA 1EX8A 2YXLA 2Z4PA 2E1CA 2E7WA 3K5MA 1RT1A 2KB2A 1RHRB 3P5TL 1JJ2R 4KB1A 5BR8K 3KD1E 3WQUA 2ZBQA 5DETA 2OTLN 2A2DA 4EO8A 4CF2A 2HURA 2AJ0A 4CEBA 3UE5A 1S97A 1U02A 4JLHA 4TN2A 4DUYK 4HHTA 3T41A 1V6HA 2CIMA 5I3QA 1HW8A 5AQJA 4ZVRB 2V0NA 3CVKA 3IAM9 3IAS9 1T3VA 4I6YA 3RRKA 2HPUA 2JVOA 1FESA 3V1QA 1N36F 2MKCA 2UXBJ 4BQZA 4H5NA 3H2LA 4DS5A 3ENOA 3PYDA 3IBCB 3RAXA 4H4OA 2HHTA 2O8FA 5E5NA 3I32A 2AMCB 3OYHA 3NS7B 4CK2A 5KFAA 2ZZNA 2YHXA 2QL5B 3DDKA 1RGVA 1AFJA 3TWHA 2RT3A 4JB8B 3BYPA 3W1YC 3HHEA 3UE2A 2UUCJ 2PE8A 2DNMA 1HNWF 4CO2A 5AQWA 2MGZB 3J81O 4RBVA 1W2IA 2P6TA 1WEXA 3Q7CA 1BO5O 3CJCA 4JKBA 3FR0A 5EWGA 4JI1J 1CXUA 1RZMA 2MQ8A 4D3HA 4FDFA 1JL2A 3D6RA 2DISA 2AV5A 4F4KA 2ZH8A 4V1Ak 2P9NB 2ZH4A 4W5QA 2J6UA 2EHGA 3F9KA 1T9WA 1T94A 2GW8A 4DEZA 2HHQA 4BS2A 4AE5A 2J7KA 5DQHA 3EGZA 3RUBL 2QA1A 3TQ1A 4CLTA 2YKOA 3D3CJ 5B08A 4DV6K 1T05B 4N8OA 3O9SA 2OPQA 2WOMB 4A8WA 4QWDA 6FDRA 4P2XA 5GVQA 3NG8A 4L3NA 4X4RA 4A8YA 1BIUA 1MN7A 1MN9A 4ED8A 1SL1A 4HACA 3HSJA 3TPQA 5DG9A 2DGQA 2VBXA 3L8BA 4OGCA 1RHQB 2W8KA 2DD8S 3CJ0A 3MEEA 1NSKL 4CBXA 1R43A 3ATVA 1DHMA 3C14B 4XPEA 2UU9J 1LWCA 2Q6BA 4BE1A 1SQGA 1S1WB 4RW9A 2B51A 2MLYA 5CZXA 1RILA 4RX6A 3MM9B 4IEEA 3HKWA 5HMZA 2GVZB 2XS7A 2HNDA 4M3UA 4ES3A 3SUNA 1WC3A 2ZBCA 3EE8A 5LMNJ 4BR7A 1E6YB 5GIOA 1FK9B 4NEZA 2X74A 1FCAA 5HN0A 4AHCA 3P6YC 2NSCA 4NE9C 4DR6F 3GG0A 3ZT0A 5F0XA 1VQPN 4RLEA 2OTJN 4ZPAA 5HP1A 1RLDA 4KPYA 2DTJA 2VQFF 4OHWA 3JS6A 3JQJA 2FY8A 3OTDA 4ZVQB 1N5SA 5F41A 2CPEA 4XTTA 1I6JA 3HJFA 3V9SA 4UZBA 3NGSA 3OXGA 4CERA 2MLXA 4FWPA 4J37A 4CRJA 4AM6A 3DOKA 4XAKA 2Z1HA 2W7AA 2ZUAA 3J7YU 1TQLA 2R8JA 1K73T 1N6QB 4Q45A 4KHNA 1AW0A 1NMEB 4NXMJ 2PAVA 4QAGA 5LJ3Y 1IKVA 2ITMA 1NGAA 1F9EB 1HQEB 4HH1A 3H42A 1Q5YA 2DXDA 1FKAF 4H5WA 4PHTX 1VBZA 2RQMA 2CZVC 1C4AA 4CEQA 4CFCA 4JYAJ 4ZHRB 3CJSA 2BW2A 4DN9A 3C66A 5KFOA 2YWKA 5J2PB 3V81A 3WNHA 1WAFA 2WW4A 3I31A 4X66J 2PMWA 3O6WA 2P8IA 1A6LA 2PA3A 4ID5A 3MWPA 4DU4A 1D09B 3GJQB 4MO5A 1NHVA 3H4BA 2KRRA 3CI5A 3CCMN 1QQOA 3RBEA 1OYDA 3LALA 4A62A 1QE1B 1CVJA 2KFNA 2XYPB 5LY3A 2YX1A 4K2XA 2HYIB 4GVEA 4W4MA 2IVOA 3ZTRA 1CQNA 1Y5NB 7AT1B 4NLUA 3TAMB 3DLEB 3KDOA 1S77D 4QYRA 1RU2A 5KFZA 4ZCIA 2W9BA 3DNCA 2JLGA 3CJBA 3A5MC 3KWIA 3LDLA 2Z1IA 4RUAA 1ZAWA 4E7JA 4RBTA 5AJ3K 4BACA 1R7IA 2RRNA 5BPLA 5KFNA 1NH8A 4R0JA 4KIAA 3UN3A 4MKVA 5CYQA 4MMOA 1XMBA 4FZZA 1EWRA 3LP1A 4CNZA 4DPXA 2AX0A 3TVYA 3M5RA 5D15A 2QJ3A 5B0EA 1TL7B 5CQGA 4DUZJ 1NK0A 3KKSA 3CCRN 5F8HA 2QKKA 1ZM2A 4FWKA 3CC2S 3D28A 1RAGB 3K0JA 4NEYA 2D4WA 1WELA 3R6LB 2VWKA 4OKEA 2OH2A 5HQ8A 2QG9B 5F0UA 4ZJLA 3KLHB 5KFBA 3OFGA 1Z6RA 3DRSB 2K1RA 2HEKA 4EK2A 2XCPA 1E6VB 1IVZA 1EHWA 4RG8A 3UO0A 2W2NP 2MQLA 3QFHA 4HHUA 3VQSA 4IO1A 4CZCA 3QERA 4A8OA 3AGRA 3AB4B 4B02A 3I8BA 2OHDA 2NYIA 1TP7A 4PXEA 1ATNA 1SJRA 1YG0A 1TR0A 4OZ1A 3IM9A 1S1XA 3N79A 1B3TA 1WEZA 1IXKA 1YDLA 2P9GA 4KH1B 2DNOA 2MQQA 2RILA 1UVJA 2H1YA 4PAAA 1H2UX 2NPFA 1NK4A 3NVMA 1NK5A 3QYYA 2BRKA 5LMUF 4FL9A 3TUJC 3HO1A 4H0XB 1SH0A 3OYBA 2QN6B 1T9YA 4PG6A 1NO8A 3EZWA 4L74A 3H2UB 3RAMA 1HI8A 1MW7A 4DQIA 4HHHA 2VQEF 3SUPA 2QX0A 2KFZA 2XMWA 2HVHA 2DGTA 2QE5A 1LOUA 4R5PB 2A42A 2J9DA 2O3DA 3MCAB 4Z4FA 1FXLA 2NUHA 1HNXK 2ZC3A 3FCWA 1TELA 2JWKA 5I3UA 2NRXA 3W0LA 3TAGA 4ZJOA 3FJ2A 3W64A 1JCFA 2JEJA 3M8RA 3UW1A 1NK6A 5LT5A 4N7TA 3CCES 4AF1A 5AZIB 4LF8K 1NZ8A 5A2QO 3KLIB 4WBFA 2BM0A 3ET6A 1M5PC 3NS6A 5C5JA 4TU9A 3FQLA 1M90T 2PEHA 2JFDA 4PUOA 4OX9F 5GIPA 1F0XA 5I42A 5GAHU 4K0KJ 2C3PA 3O9QA 3HD1A 4NB4A 4DV0K 3Q7BA 4O44B 3THXB 4JI2F 5FRMA 2RF2A 3EGNA 1VBXA 5JUMA 5JICA 3MD1A 1URNA 1BLUA 2D3O1 3O9RA 3B4DA 5CZ1A 3BBBA 3CCJN 2PFFB 1IUJA 3TI0A 4AL7A 4CO4A 4EHTA 4Z37A 1T3OA 2A3JA 2AZ1A 3SDEA 5TKWA 4ILMA 3EE3A 2XMMA 1BD6A 5EY4A 2EG2A 2D7SA 2E5IA 1Y5LB 2PI5A 4WKRA 4LT6A 1JMTA 1Z4UA 3M6GA 2D3OR 2JL9A 3I5BA 4PG4A 2YNIB 1N5YB 1C2PA 2EBEA 2CPHA 1P8GA 3KLGA 1DLOA 4LJMA 3JS9A 2IM2A 3QJPA 2FBXA 3T5JA 4Z4GA 4B9TA 3BZKA 4QWBA 3RW7A 1QS4A 2AEMA 9ATCB 1HBNB 3ITHB 4BG8A 2Q1NA 1WWHA 3TJ9A 1TKZB 1C1AA 4HH0A 1RI7A 2GZOA 4NLXA 3WUHA 3T1YJ 3CM5A 4JI6F 3K2PA 1D1UA 1NGIA 3FRZA 1IKYA 3CC7N 2W24A 3V6DA 2PT0A 1VRQC 5M1QA 4LFBK 3SUOA 2B5JB 3VA0A 4FPBA 4BC2A 3FQKA 3I0SB 4FOIA 3TANA 1NHUA 2KG1A 3OR1A 2V8DA 5C42B 5GMDA 3NDKA 4IWVA 2O8CB 1IBLJ 1TKXB 4OI6A 3A3NB 4YB1P 4CZKA 1DY3A 1VCTA 1RT5B 4G1PA 1VSJA 2UXCK 3IG1B 2IVYA 1ASUA 4USTA 3M30B 3G82B 3P5JA 5LSOA 2ROEA 2RN2A 2QO3A 1BC6A 1IJJA 5JVHL 2KVQE 4C8LA 4P9SA 3VGVA 1QZ5A 1CJKA 2HWTA 1F9HA 2UXDF 4OYXA 3W60A 1BHLA 5AQUA 4KI6A 3Q22A 1NKCA 4Y65A 3IR6B 3GYNA 1FJGJ 3T5LA 3D1OA 2IVMA 1HWIA 3O80A 5CCLA 3FUYA 2XI2A 3Q23A 4XDCA 4MFBB 3DMJB 3O4WA 2F8TA 3JB9k 4JOUA 2MB0B 1X5OA 1RXOB 4W90B 1HNVA 4FF2A 4TXSA 3H40A 3TTCA 5FJ4A 5IM0B 4OHYA 1EB0A 3GG4A 3W2VA 2RHQB 2CKWA 3ZSVA 4CJWA 4F7VA 3EN9A 4DMNA 5C10A 4KE5A 3V6JA 1DEJA 4UOCA 2Q97A 3GILA 4AH9A 1D9FA 4I6MB 3U3YA 1J5OB 5AQXA 4FJJA 4W92B 1WI6A 3FSYA 2IY5B 4PRFA 2NLWA 3KD5E 1FWKA 2DH8A 4BHQA 1KAXA 1HD0A 3U6FA 4KHQA 1TKTB 4OX7A 5BN8A 3NGYA 3FCHA 4AXIA 2ACMA 1J27A 4M5MA 3W66A 2Y3YA 1S99A 3EKSA 3ZTQA 3TP2A 3RB6A 4M5IA 2ZE2A 1HNIA 3OLAA 1GXLA 3EVOA 1HNWJ 2ACYA 3Q89A 5B0BA 4FJKA 3NGZA 3P8BB 5HLFB 1U2CA 1KVAA 1YTUA 4IOBA 4JI4J 1HX1A 3MMAB 5A2QU 1MDUB 3TAFA 3KG1A 3OTOK 1YJWN 1ZXOA 5GAGI 4BWJA 3C95A 3HRGA 4JAXA 3F44A 3DLBA 2J0WA 3OPKA 5F8MA 1VQ4S 1YJ9N 2P9EA 3G6XA 4TVAB 2VU5A 5KFPA 3PRVA 4UF4A 1WC5A 3KG0A 4U7UK 5KPZA 2VYPA 3IKMA 3UN2A 1KONA 2ZF5O 2ZD1A 3UR0A 3K89A 1KVJA 1YVNA 1WHWA 2I5JA 3OBIA 5EX0A 1NJIT 4DWIA 8RUCA 3LP2A 4FWSA 4U67Q 1IWAA 1H98A 3GU0A 1F5BA 1QSLA 1FHTA 4Q2LA 3SI8A 3LZIA 2R2RA 1VQMN 3LGHA 3AFGA 4H8KA 4JBCA 2JC0A 3GJSB 3KHHA 1VSMA 3ZTPA 3OBWA 4NI2B 1J6ZA 3SQ4A 4JKEA 3M1FA 2EI5A 4DV2K 4M7YA 2FLLA 3RVCA 3R27A 2O1PA 1X9SA 2ASYA 1U8SA 3G10A 4O3QA 1URRA 2LXUA 2ZVIA 2P9LA 2UP1A 2DFFA 3CMAN 1RTIB 2K8GA 5C24B 4RL1A 3AVKA 4CFBA 2JX2A 3LOUA 4KR0B 4LF9F 2CPZA 2P9UB 4PXBA 4O4RA 3CHWA 4C1NK 2LXFA 1AZSB 3T1HF 3WC2A 1MROB 2V50A 1RA6A 5ETVA 2QZ8A 2VQFJ 3EPGA 1OY9A 2NCKL 1LWXA 4KHPK 4E19A 2D0BA 1WDDA 2CAJA 4QR1A 3C15A 4KGZB 3R3LA 4OI2A 1XBWA 3PEHA 1NGFA 5EOYA 2J0XA 4ED3A 3TARA 5JLFA 2HLTA 1CJVB 1UZDA 4JHDA 3WT0A 4B17A 5D4PA 1Q82O 5HBMA 3V9WA 1TK5A 1YRXA 2L48A 1LWFB 3P96A 3EO3A 4CTAA 4C0BA 5FPEA 3PX4A 2CQIA 3QGIA 3FFIA 2HHPA 2XGQA 2UUBJ 3VR1A 3K5OA 5ETOA 4B1UB 1NGBA 4EHUA 4ZPWR 3OXLA 4CVNE 4CJPA 1WUUA 3FMBA 5AFUH 1RGIA 3CO0P 3HDSA 3R7SB 3N9UC 2H54B 5E2QA 4YDDB 3PXGa 1HNZJ 1U8WA 1N34K 3M1VB 1UMJA 5DDOC 3C6UB 1LXJA 1JLQB 4S0MA 2D3ZA 5DDQC 2BE2B 2BJEA 2IRYA 1NM2A 3FBEA 4IFYB 1OYEA 1ZBTA 3EJMA 2PFDA 2B4JA 2R7RA 1WNSA 2FSJA 5KFJA 4DQRA 3UKRB 1T9UA 1YZ6A 1TL5A 2ZEJA 2G1HA 4DJBA 4ZLLA 2G8HA 4Y00A 1Y11A 3CO9A 2RS8A 2IAJB 3CF5L 2G8WA 2GAGC 4KKOA 3L95X 3QLHA 1XUPO 1WSGA 4TNOA 2CADA 1RTJB 4GV9A 1MU2A 2G0JA 2QW9A 3AA3A 4OX8A 4ER8A 3ULEB 4DV1K 5A8RB 3MR5A 3ZZOA 4QS9A 2ZH7A 1KN6A 5H1SQ 2B7BB 3MPVA 5K20B 2M2BA 4P2SA 4ILHA 4M3YA 4EIAA 3DI6B 2XY5A 4ZP6A 2DB1A 5KG3A 1UEVA 3LTOA 2QLWA 1PJ5A 4NLTA 2XMJA 2G13A 3M8WA 2FPHX 5IZHA 3AB2B 4I56A 1GLBG 1RT2A 3BSAA 2AEFA 3UWTA 2D41A 2W1BA 3SCLE 2FLPA 4BRKA 4BGAA 4J9NA 2CVEA 3JSMB 2AJ2A 3NBPB 3DRRB 2HQIA 4ZJQA 3W9JA 5HMXA 2RUGA 3IA0A 4BRIA 5FLXY 3MZIA 5ETKA 2VC1A 4GKKF 2DNLA 2GV1A 2F4VF 4JI7J 4F36A 2UUAK 3ZNUA 2DCUB 4J2DA 2DHXA 2KJWA 1VQ9N 4HUFA 4Q0BB 1XNRF 2BUNA 2Q43A 3M8QB 2HQGA 2V2KA 1H7WA 2HBQB 1CZBA 3ZSOA 4BVOA 2DHHA 2P9IB 2PSZA 3OYDA 3M6VA 1XEZA 1M1KO 4HKQA 2KN4A 2MSTA 3MAAB 4HUGA 2KJVA 2XMVA 3B6BA 4DL6A 4M5DB 5AQNA 2CGKA 3KVGA 2DTUA 4KGMA 2VFVA 3VAIA 2C2DA 3PKYA 3HXMA 3W5ZA 4N47A 4KPCA 4AQYK 3TVZA 2QA4N 5IC4B 2CQ3A 3CDEA 3M32A 1J5EF 4C0OC 5GAGP 5D3GB 4TLQA 1LXNA 4DMZA 1WSJA 2VG5A 4CZEA 2QL7B 1WG5A 4CGGA 2VHGA 2CH5A 3OJSA 1Q8IA 3RBZA 2ATCB 4M42A 4TYAA 4RZRA 1ZC6A 5J2MB 3KOAA 3UDCA 3I4HX 4FW2A 4WQ4A 2YNHA 3X1LB 1S6QB 2RH3A 3ENQA 4JNEA 3TNVA 1EZZB 3CQ8A 2G8IA 1VQ6S 2OTLS 1YVUA 1OKJA 2PEBA 2W8LA 5GMKa 1N52B 4DHYA 1FEEA 4YQWA 1T44A 3THYA 4OX9J 4XPCA 2R7XA 3FZ2A 5LJWA 4FW1A 4B3MF 3QNWB 1S57A 4U9RA 2FBYA 5D4OA 4IRKA 1ZS6A 4JI2J 2CUYA 1E3MA 2RDIA 1HMVB 2YKNB 2Z2MA 2IC3A 3A13A 5KFFA 1Q1KA 2V4JA 2AP1A 5HATA 4O0JA 3A4TA 3LDOA 4USKA 4CH1A 1FRKA 3UKUA 1ZPWX 3M2VA 4A48A 1OPZA 3JSRA 4FF4A 3QATA 2CGLA 5L9NA 1BI4A 5K8OA 2LYVA 2VWJA 3PW7A 3MTJA 3X3UA 4KTWA 1WJ9A 5E84A 3ZETA 1RBLA 3A5LC 4IR9A 2KHDA 3OXFA 4CT9A 3HT3A 2WONB 3VCDA 3LPUA 3VTIA 3VQ5A 4KHYA 4OYIA 5E33A 5KOWA 1IG8A 3L2VA 4J9KA 3GQCA 2VGMA 4IDKB 3CJ3A 2DPNA 1X4DA 4RNOA 4E7IA 2YX6A 3DC2A 3WX4A 3OS1A 4QIFA 5JXSA 2GO8A 2DR6A 1LK5A 2FF3B 1XN9A 4JN4A 1NDCA 4A8XA 3PHEA 1VOMA 2DCLA 1X4EA 3B4MA 5C2GA 1REGX 4F3TA 2ADCA 3O3HA 4L73A 4LRDA 1UW9A 3MWTA 5AE1A 5DLGA 4FK4A 2E5GA 3CDBA 2B6AA 3H5UA 2MZRA 2O8EA 1X60A 3EICA 1HR0F 1CLFA 2V2ZA 2H65B 4JKCA 2AGOA 4OIXA 4Z7YA 5J1NA 2HFUA 2X1BA 3MCNA 2IM0A 4FLTA 4YB5A 2FC9A 4YY3J 3HHDA 5BN9A 5E3RA 3VALA 2UXDJ 1N32F 3HX9A 4DSIA 2CNLB 1B4SA 3SBMA 4CIOA 1RAEB 1S6PA 2VFRA 3KZBA 4DU7A 2CQBA 3DOLB 5HP1B 1G15A 3C6TA 1DGKN 4USHA 2F4FA 4BBYA 4E7HA 2BBEA 5H1SV 4LF1A 4OYPA 1X7VA 3IRXB 5CE3A 3LUYA 5MLCQ 3D6FB 3A12A 1MNEA 1VQYA 2HGLA 3DGPA 1KNZA 4PL7A 1M1GA 1RWUA 3CPEA 3PV8A 3J8AA 1A5VA 3SMSA 4HEA9 5A76A 2OTJS 3G8QA 1R8AA 3ZZYA 1IM6A 4M3ZA 5U47A 2MY8A 2ZOFA 3W2WA 1NUEA 1TUVA 5M2PA 2ZFHA 3NF8A 2CG8A 2UUCK 2KW4A 1IR1A 1UJ5A 1RT3A 2Z8QA 2NXCA 4FXWA 4J8FA 1FA0A 5E3PA 3TW0A 2VH7A 5F8GA 1JJCB 2J7UA 3MMCB 4B1VA 2KRBA 3CIMA 4JI1K 2FD2A 3RRHA 2K3KA 3U8XA 3BO3A 4AL6A 2NQPA 1H1VA 2FHKA 1T03A 4OZ2A 2BA9A 2FUG9 1NWKA 1DTQB 3FMWA 3AV9A 3IWNC 1MSWD 1HBOA 1C0FA 1WSIA 3F0NA 4ZIWA 3MM6A 8AT1B 2O8BA 3ISNC 1Q16B 3MEGA 4KV8B 1HHQA 4OKKA 5BR9A 1XNQK 3SQGA 5KFLA 2DVIA 2CQ4A 4G9ZA 1IKXA 2KT3A 1Q86O 4AYBD 1T8EA 4FXVA 1VSLA 5CCMA 2NUUG 3VQDA 2XSJA 3SQ0A 3OYEA 4X64F 1C0TA 1M0SA 2QIFA 4Y1DA 2KXNB 1RBVA 2HRYA 1VBKA 5GADI 5F8IA 4K25A 3P4UB 4P52A 1JLFA 4P6QA 2PC6A 4DUTA 3UD4P 2MPUA 3QQCD 3MCPA 4BR9A 2FHJA 4CJ5A 3RWUA 1P90A 2KTQA 2ZDPA 2RDJA 5ADXH 2MMYA 3FNNA 4MIBA 2APOA 1RBSA 4QPTA 3LM2A 2UU9K 1XWLA 2Q66A 1CULA 1HPZA 1TYQA 1I5OB 4KGVB 3CJKA 5A6PA 4DR5K 1SH3A 4CHNA 4FPAA 4JI0J 3EYZA 1ACMB 5CYMA 4B9VA 4DLGA 4JUZA 1IBMF 3HPHA 4QS7A 5J2QA 4OI3A 5AE2A 4CJTA 5LMNK 2XRIA 1DT9A 4QOZB 5HANA 2FVCA 3DLGB 3G87A 4N77A 4DPWA 4BE0A 1N8RT 3ILLA 1FEHA 3J7YI 1Q7YT 1B9DA 4L75A 1W7WA 1QM9A 2P2CB 1VQ7N 2AJ1A 4OZJA 1KP6A 2NXJA 3BPDA 4CYUB 1OPIA 1BISA 1WSFA 1SJ1A 4AD6A 1K6YA 2DFEA 4FS1A 5KG0A 4RPFA 3SFUA 3CCRS 1U2VB 2VA2A 5CXTA 3NGRA 4M3TA 1TVRB 2X3GA 4LQ3A 2F1FA 4ELVA 1RDAA 3H8YA 3PCOB 3ZXWA 5HAOA 1SIZA 2BJDA 3VPZA 2BM1A 4JI3F 2HWIA 4IFVB 4KHSA 4O3OA 1ZPVA 2BOAA 4LF9J 2ZJQL 2XS2A 4WKYA 2DR9A 2AGPA 1KS2A 2DXEA 1G99A 3AO5A 3FGUA 4B1WB 1RT7B 4EZ9A 4FWQA 5AQFA 4K8RA 4NXMK 2C3YA 1CJTA 4F0HA 4DSFA 4FVMA 3MCSA 4LFAJ 1FW6A 1QD1A 2GWKA 1DBDA 4CIEA 3HPGA 3L7UA 2W7PA 4JYAK 4ZLNA 2MGZA 3VF4A 3OYJA 2ERRA 1S5JA 3DOMB 1R8PA 3AVJA 1IJFB 1U6ZA 1ZETA 1XHZA 3O08A 4DCJB 3OR2A 3TUZC 4DV7J 5IT4A 3V4MA 4EMDA 1CZ9A 1D4XA 2OJ3A 3MUVP 5KFVA 2P9NA 3I4PA 3R5BA 3K9KA 4WZMA 1CC8A 4DU1A 1JLBB 3CCQS 2ZWPA 4ICLB 1Z2ZA 2B9EA 4P75A 3O4QA 2VV5A 4X62K 3V6KA 3MWBA 3SAFA 3SEOA 1O0PA 2JC1A 4OZ3A 3CCVS 2FSNA 1VYAA 1N5QA 4GKJF 1T05A 4RNFA 2ASMA 3TZWA 4NYOA 5RUBA 2DNGA 4FJHA 4WTYA 4DX7A 1HBMB 1JWWA 2FJXA 5LJ5Y 1VQOS 4J9UE 2YCHA 4ECTA 4KRWA 4ZK7M 2FVQA 1C1CB 3M8PB 1X9MA 2OZSA 2KM8B 1O6XA 2DNQA 4U6PA 4DR1F 1YBTA 1BQXA 4J5OA 4EO6A 4FWOA 1D9DA 3JXOA 3H5XA 4ZVEA 1GH8A 1RAIB 4ECUA 2W42A 3C14A 1WACA 2GQCA 4QW8A 2EFGA 1S1WA 2W9AA 4I6AA 4EBEA 3V9XA 3MM9A 1RHJB 1WG1A 4PKDB 4FLXA 1TMMA 5TKYA 2GVZA 1Q0NA 2W7OA 2R7SA 4CEEA 5BR8F 3EEQA 3D5MA 5T7LB 1U26A 2V7YA 5LXYA 4FCYA 2WC9A 2FDNA 1E6YA 1FK9A 5GAEU 1NH7A 3AODA 4DUYF 1CEZA 3K9JA 3PUFA 3LO3A 3JTNA 3HF5A 4YOUA 1VI7A 4CLFA 3PO4A 3ZX2A 2XNQA 2ASLA 1SVDA 1I94J 1V3SA 3QAEA 3V5RA 1XI1A 3AVMA 4M3WA 5K8MA 4A46A 1NPRA 5IWAF 4GVBB 4NL5A 2HFNA 2N4DA 3DLKB 4USMA 2ZH3A 4LSLB 1IKYB 1D0EA 4K8XA 1I3AA 5H9EJ 2YVSA 1TAUA 3R5DA 1C0MA 4USWA 4BRMA 3D6HB 3RAQA 1RWKB 1FNMA 2BXJA 5IT0A 4YOWA 2PO4A 2HAIA 2BGGA 4RTFD 3F5TA 2K2PA 1QAYA 4FZXC 3AAWB 1N6QA 2F7VA 4GKKJ 2O66A 1S0NA 2BEFA 1HPMA 2HFSA 1BGXT 1FRMA 1HQEA 4E1NA 3LAMA 3SCKE 1TL1B 3CC7S 2XY6A 3DM2B 5A2QY 2E5LJ 2GS8A 1X9JA 1RAAB 3WIUA 4ZHRA 2JFKA 3DJCA 4LY7A 4CJKA 3ZSZA 4LF5K 3MX5A 5J2PA 3OYAA 3PEJA 2X6SA 4NLCA 2ZJRL 2Q36A 1UVKA 1VC5A 4UTGA 2CGJA 4C23A 4YHHJ 3HSCA 1RUSA 1BXNA 3D9BA 2V51B 1ZBSA 2YHBA 2JNJA 4FO0A 3EPIA 5GAHI 4IJAA 1SJ3P 3T69A 3TQEA 5D77A 1VC6A 4WFAL 3VGKA 1VQKN 3CDUA 1JXBA 2DPJA 4DV6F 3EVWA 3IMQJ 4YS2A 2XMUA 5HROB 3N4PA 1HHTP 4HTUA 1MWYA 4X4TA 2FHJD 4Z7CA 5K14B 4CEZA 1J5EJ 2P1JA 3SMZA 1T95A 4M5KA 1GLDG 3BV8A 4FK2A 4H0TB 2OPRB 2CVIA 3TAMA 2WSFC 2FJBB 1NB7A 3VMFB 5GADP 1S22A 4J9LA 3TSUA 4MIWA 3DLEA 2I38A 5BREA 4WFBL 3H98A 2FVRA 4MLEA 3VGSA 2OZMA 1XIQA 2ABYA 2HBJA 2QLXA 1FDBA 1HWUA 4YR2A 2M5YA 4IUFA 3O4NA 4U96A 1G6BA 4EI2A 3FRYA 1D3WA 2VFSA 2VFUA 3DN9A 1RFQA 4P2MA 1H38A 3JQKA 1SKRA 5D6GA 3H5SA 3N4QA 2HS4A 3HSGA 1L3KA 4LF2A 2H3GX 1FE4A 3SPYA 4LRFA 1TL7A 2KKHA 5JMNA 4CLYA 1UPMB 3QMLA 2A10A 3BF4A 1W7AA 2VC0A 2LQ9A 3UCUP 3QMQA 3UDLA 1V4SA 5KFSA 4YR0A 1RA7A 2HS0A 3E3XA 5ETLA 4JKHA 3C3LA 3DXKB 4EBDA 4UY8O 3KLHA 2OPSB 3CJRA 3BN7A 3NGDA 5E26A 3DRSA 3LWMA 1E6VA 5IV3A 4XEIA 3HVWA 5KTQA 2KO1A 2QEXN 2HS3A 4R25A 2L3MA 2DO4A 3BPSP 2IA6A 1W97L 3EZOA 1IQZA 1XK8A 3T1YK 4CF9A 3BEXA 3AVHA 4L8RB 1KD1T 4FS2A 3HSZA 1V5VA 1RACB 3BGLA 1BCOA 1GLAG 1VQLN 3P45B 4YOYA 3OY9A 2C2MB 4RW6B 3ZO7A 2F5GA 1VR6A 1Z05A 5L1IA 1AA1B 3Q8YA 5IT9O 4K5RA 3H25A 2CJBA 5D0GA 2W40A 2A1RA 3CMQA 4C11B 3UDVA 5HVGA 1IBLK 1YJWS 2YKMB 2FJDB 1LCUA 2D5RA 4H4MB 2XZTB 1FFSB 3IGNA 3G8TA 4K4TA 2MEWA 1SJ4P 3ZTSA 3G71N 2RE2A 2D0PA 2CZ4A 1YJ9S 2D0CA 1S12A 4Y0WA 3D4JA 2VFTA 2IVNA 2YHWA 1RADB 2GIQA 3GIIA 4BRQA 4FPRA 3VGTA 4Y6IA 4R5PA 1M5KC 2YY3A 5F9LA 1YRTA 1FJGK 5HL7L 5IXUA 1C4CA 1ZM3A 2VZ9A 1WNEA 3AA5X 2GMLA 3L4BC 5AT1B 2ATQA 5AZIA 3ZSQA 2EPIA 1FF2A 5BYQA 2AYMA 4PWDB 3KLIA 2XSFA 2WSEC 1N32J 4ED4A 3ALYA 3OYMA 3AJ2A 1T6DA 3IBFB 5KFUA 2GVDB 3LW5C 1HI1A 2NRVA 3TU5A 2BE7D 5AQHA 5BRFA 2BANB 4NXNJ 2XTJP 2XY7A 2HNYB 3GV5B 5BXIA 1X4BA 5AJ3F 2Q6CA 3VQCA 4DN0A 1BQMB 1AROP 3O1WA 3ULDA 4RW4B 4KH0B 3ZT1A 4IQXA 1RP5A 2EW9A 3U1LA 3NH2A 2PMHA 4ETZA 3L3CA 4CLKA 4O44A 3THXA 3MFHA 2AJQA 3J7ZO 4TY9A 4ED5A 2XYHB 3I82A 1NG9A 4XH1A 3CMAS 2PA8D 2LCWA 3MXMA 1JCEA 4NMXA 4F67A 1LAWA 5HBMB 1KWMA 3HCXA 1O1WA 2E2PA 2DY1A 3MGJA 1RLCL 4ED6A 1HQ2A 2E1YA 1K44A 3KMSA 4CTAB 1C0GA 4CBWA 1GOAA 1VAZA 1O51A 1X4CA 4BWMA 3OYNA 3DGVA 4A4JA 2YNIA 2P9KB 1N5YA 4MT1A 3VHQA 1RB0A 4I67A 1RBAA 2EXUA 3N6NA 4I69A 3LQVA 4B3SJ 4JI4K 1NGDA 1N33F 2QLFB 2VPYB 1U7LA 4A59A 3IR5B 3DYAB 2IJNA 1HBNA 3HP9A 4JP8A 4Z4EA 3PFOA 1TKZA 3GIKA 1UJ6A 2XEXA 2PD1A 2F8EX 4L3KA 3HOSA