1JLQA

Crystal structure of hiv-1 reverse transcriptase in complex with 739w94
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
540
structure length
533
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
publication title 2-Amino-6-arylsulfonylbenzonitriles as non-nucleoside reverse transcriptase inhibitors of HIV-1.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 140
structure length 533
sequence length 540
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlqA05
2ZKUA 3DLGA 5HRNA 2BQ3A 3OYDA 1N5YB 5C25A 3DYAB 4GW6A 4DTOA 4J9KA 1S9GB 3QIPB 5J2NB 3JYTB 3V6DA 1SL0A 1JXBA 1SUQA 1JXEA 4CGGA 3LP2A 3NGIA 5F9NA 2BDPA 1S6QA 5KFHA 5KFKA 5CYMB 4CEDA 1TKDA 3HPGA 4B08A 4QWEA 4QW9A 2J6SA 1IKXA 1VSHA 4CHPA 1J5OB 2E9TA 3QLHA 5KFOA 3KK3B 4Z4FA 3KLHA 2WRMA 4O44A 3OLAA 2W9CB 4I9LA 1KLMA 1U49A 1S9EA 5KG4A 3N6NA 4FJHA 1QE1B 4AH9A 4OKKA 4QOZB 1SV5B 1CZ9A 4LQ9A 1NK8A 2FBXA 4CJFA 1ZBHA 2JEFA 1TKXA 4KRFA 5C24B 3G0ZA 1U09A 2XY6A 4CJTA 3SUOA 1I3AA 3NFAA 4CJLA 4J2DA 4U7CA 3DRRB 4DTSA 5KT2A 2QV6A 3TAQA 3K59A 3DOLB 1GOBA 1VSIA 5F8IA 4JV1A 2OPPB 4ZPDA 2F8EX 1N6QA 1ZTWA 1C6VA 1C0TB 5KG5A 3DOKB 4ZPAA 2R2UA 4WXWA 3EY1A 4PUOB 3H4DA 2J6UA 1NKEA 1IKYB 4JLHA 3I0SB 4J9SA 2LSNA 1BQNA 2R8IA 2OZSA 4KV8B 1TVRA 4F3TA 4ZP9A 4KHUA 3CFOA 2XGQA 3VQ5A 3HSTB 4WZMA 2V4QA 2ASJA 2DFFA 3G6VA 4OGEA 4F4YA 3KLVA 4FJ7A 1D0EA 3TAPA 2JLEA 1VSLA 4IRCA 2Z1GA 1TKTB 1S10A 4CJ5A 3DI6B 2E4LA 1RCHA 1X9SA 3V9ZA 4HUEA 4OLAA 1I39A 1KFSA 3MEGA 5J2MB 1S1TB 1TP7A 2HNYB 1QS4A 4H4MB 4JV2A 4CJVA 2AQ4A 3HVAA 1LV5A 4ZHRB 1RTDB 4R5PA 4PA1A 1MMLA 2R8HA 4K50A 2XI3A 5EWFA 4BACA 4ED8A 4RW6A 3RMAA 1Q9XA 2KZZA 3V9XA 3CJ0A 4ZMMA 4DU4A 3AVCA 4M41A 1YTAA 1J53A 2VWJA 4TY9A 3SQ2A 4NLVA 2ALZA 2AGPA 1IO2A 5EU7A 4R0EA 5HRSA 4RNFA 3QINA 3ZSOA 4AHUA 1RTIB 2WONA 4DS5A 1RT7A 4NLWA 3MEDA 1T05B 4EO8A 2D0BA 5CY4A 5DG9A 1RBVA 4CGIA 3D0PA 2DFEA 3BSOA 3E01B 5J2PA 1RDAA 4PQUA 4O3QA 1RILA 2C2DA 5J1EB 2HNDB 5DLGA 4EZ9A 3M9MB 4DG1A 4DSIA 4YMEA 3BGRA 2FLLA 2XY7A 2KW4A 4BDPA 3IG1B 4I7FB 4ECWA 3LAKA 2IJFA 4CJ3A 3BQ1A 2B5JB 3BR9A 4LH4A 3AA5X 1D9DA 1BIUA 4O3OA 1D8YA 5K14A 1HNIA 4MFBB 1SKRA 3DM2A 4DL7A 3ITHA 3MFIA 4TN2A 3NGYA 3H5SA 3OS1A 4M3RA 4M42A 3V81B 2QKKA 1S49A 3O3FA 4K4UA 5L9XA 1HQEA 4F4KA 3AVGA 3KLFB 3D28A 4AHSA 3AA2A 3CDEA 4EO6A 4DTJA 5J2QA 4WFXA 1XHXA 1U04A 2YHBA 4E7KA 3SUQA 4CJKA 3V9SA 4B9VA 2D3ZA 3PW0A 2YV0X 1RA7A 5L1KA 3OYEA 2AJQA 4CF2A 2HHXA 3L8BA 4DQPA 3K5OA 3IRXA 1JLQB 1RDDA 1FKOA 2IGIA 3L2VA 4FJ5A 2G8UA 2HMIA 3KJVA 5JS1A 1FKPA 3PW5A 4RG8A 3TARA 1UWBA 4IQXA 4CCHA 3PR4A 3C95A 4Y2CA 1WSEA 4E7HA 3EPIA 4FBTA 3AO3A 3K5LA 4QWCA 3QO9B 3CVKA 3B6OA 4Z0UA 4DFPA 4BE0A 3S3MA 2R8GA 4YFUA 1IH7A 1TL3A 1W25A 2Y1JA 4J9PA 3SQ1A 4I2PA 1K1QA 2VG6A 4WE1B 1RT3A 4DFJA 3C6UA 3GV5B 3GYNA 3NMAA 3RR7A 4CF9A 4LY7A 1QSSA 4HKQA 4CEAA 2KTQA 4TQRA 3MR5A 2YNHA 4FJ9A 1NJZA 4ZPBA 3I0RB 2AX0A 4NLOA 3Q8PB 3V1QA 3MECA 1RT2B 2VA3A 2GUIA 2C2EA 1R0AB 4YNQA 3U3YA 3S3NA 5KFSA 4O0IA 3OL7A 4GMJB 4JS4A 1SL2A 1A5WA 1IKVA 3QEPA 4Q0BB 1CZBA 4ZTJA 1VRUA 3KHGA 4O5BA 2JGUA 3KKSA 4B3OA 4B9UA 5DQIA 4OPKA 4ED3A 1L5UA 3G6YA 4KREA 1LWFB 3WNEA 3BDPA 4M3TA 2OPSA 3O4QA 5EUHA 1J54A 3WNGA 4NCAA 3SFGA 2J6TA 2W9BA 5C42A 4DEZA 2BE2B 1WN7A 3QEIA 3SPYA 4O3PA 4AHRA 5CZ2A 1D5AA 2VG7B 1VSEA 3ZSRA 1ZETA 5EWGA 2VA2A 1JLGB 4O4RA 1GOCA 1JL1A 1RT4B 4EBCA 1JLEB 1JLFA 1RTJA 1BCOA 3O4NA 2FVSA 4U6PA 2R8KA 3KHRA 5FRNA 5F8HA 3OHBA 3V6KA 1XR7A 2X74A 1TV6B 4B9SA 5FDLA 3HT3A 3VQSA 4Q45A 1JLCB 4FZZA 3QNNA 4ECZA 1EP4A 1XR5A 2F96A 2GC8A 4RW4A 3PW7A 4FS2A 2AGQA 4HHTA 4O3RA 5KI6A 3VQEA 3CJ2A 5HLFB 1TGOA 5KG7A 3KIOA 1T03B 1Q8IA 3DMJB 4IG0B 4G1QB 1RT1B 2JEIA 2OPRA 1WSJA 4TYBA 3RBDA 3IS9B 3ISND 2IJNA 1SH2A 4ZVGA 2V9WA 3JSMB 5KGWA 5HROA 2IDOA 2D7SA 4DLEA 1HRHA 4I9QA 1C0UB 4H4OA 1DLOB 4IBNA 3ZSZA 4DFMA 4N41A 4XO0A 3TWHA 2OYQA 4ELVA 3FSIA 2UVWA 3BJYA 4CHNA 2HVIA 5KFFA 2DFHA 3H2LA 3AA3A 3PX6A 4NYZA 4RW9B 4CF1A 3KTQA 5CYQA 2FJVA 3F73A 2ETJA 4ECRA 3CO9A 4NLSA 5HP1B 3K2PA 3SJJA 4CJUA 4CEQA 5HRPA 3GIIA 3C6TB 4H54A 2X6NA 4CGHA 3NAHA 1WSFA 3K57A 3TAFA 2ASDA 3AVBA 4CFDA 2B43A 4Z4HA 5DQHA 4OVLA 4KAIA 1HNVA 3NCIA 5DK5A 2FBVA 1X1PA 1JLBB 3LDSA 4IG3B 5I42B 1S1XA 1IKWB 3VQ8A 4Z4EA 2D41A 3SZ2A 4M94A 2OH2A 5DG8A 3OJSA 1KFDA 1HPZB 2IBKA 3ALYA 1KRPA 4F2RA 5KFCA 4OKJA 5KFTA 4IKFA 4EP5A 4M95A 4W5OA 5JUMA 5KT7A 2YNFA 1S1WB 4KBIA 4BDYA 4DQSA 3AVIA 1S6PA 5KFLA 3LP0B 4BWJA 5DLFA 1KHWA 1MU2A 3TAGA 4PWDB 3HYFA 4KTWA 1BI4B 1BQMB 3NH2A 2W8LA 4Q8EA 4F4WA 2ZD1B 3ZSWA 3M8PA 3V4IB 2ZE2B 2G8FA 5T14A 4CHZA 1YVFA 2D5RA 1A5VA 4RW7B 4IH7A 1HJRA 2XHBA 1L3TA 3DLGB 1IG9A 4ED2A 4E3SA 1QTMA 3DLRA 5C25B 1RYRA 4TSXA 4KB0A 3KLGB 3CG7A 4KI6A 2FVQA 2RF2B 4TYAA 3CDWA 1N48A 3Q8QB 1S6QB 1W9HA 3OYHA 4FLZA 3DLEB 1LW2B 4CFAA 3SV4A 1RAJA 4IDKA 2ITGA 4DL4A 5KG6A 3ASMA 1IKXB 1TL1A 3QLHB 2RDJA 3KLHB 4O44B 4E19A 3KHLA 1KLMB 1KLNA 1KVAA 1S9EB 3P83D 4DF4A 5HBMA 4IFVA 4QAGA 1HYVA 2YKMB 4F3OA 2PYLA 4F50A 4DU1A 1RBTA 3S3OA 3TAMA 1RBUA 4HCBA 4EYHB 3OL9A 1TKXB 1Z4UA 3T5JA 3FRZA 3QEWA 1NK4A 3OY9A 3KLEB 2OPQB 4EBEA 1N5YA 1LAVA 4UQGA 3QIPA 3VN5A 3THVA 5L1JA 3QEVA 5KFBA 4M3XA 3QNOA 4YP3A 4DTUA 1N6QB 3NBPA 4LSNB 4YR3A 1RT5B 3PO4A 5KGXA 1LW0A 1RT6A 4ED7A 2R7YA 4FBUA 1G15A 3VQBA 3CJ3A 2VG5A 2HHQA 1T3NA 1WNEA 1J5OA 3V6JA 3KK3A 4FZXC 4Z4GA 2R8JA 4FLTA 1RBRA 2WTFA 1RTHA 4MK8A 4MIBA 3ZSVA 5DQGA 1QE1A 4J9LA 4RNNA 4ECSA 1TKZA 4FM1A 2UUTA 3HVTB 3GIJA 4NZ0A 1GX5A 1S97A 3DRRA 2WOMB 4K4ZA 1WNSA 3AO5A 3HO1A 5KFPA 3MEGB 3DOLA 2V4RA 1WSGA 5KFEA 1XWLA 3MR2A 1L3SA 4N47A 4B8AB 3NGZA 4FS1A 4R5PB 3NH1A 4FM2A 5KFDA 3DOKA 4WXOA 4ZPCA 4ZVEA 1LAWA 4C8NA 1GOAA 1IKYA 4FW2A 3PJWA 4RW6B 3L2QA 3CWJA 2IC3B 4GC7A 4DL3A 4M3UA 2YKNA 4GC6A 4KV8A 1ASWA 4RW8A 4M3WA 4NLPA 3VQQA 4FLXA 4KHNA 2AWZA 5KT3A 2IA6A 1RT7B 4I2QA 1TK5A 3MEDB 3SV3A 3T1AA 3T3FA 2RKIA 4PQUB 2JEGA 3S9HA 2G8WA 2XRIA 3EZ5A 3AVHA 1T8EA 3MXIA 4FJIA 3CM5A 4Z4CA 2HVHA 1CXQA 5SWMA 4DG1B 3BGRB 3LWMA 3CDUA 3QESA 3VQ7A 5J2MA 4CEZA 3VQCA 4YR0A 5DGBA 4IKAA 5T7BA 4B8CA 3QYYA 3A2FA 3VQDA 4ZHRA 5K14B 1HNIB 1RTDA 3ITHB 3PY8A 3AO2A 3PZPA 1XHZA 4B9TA 4DTRA 4NLXA 4ELTA 3MFHA 3PW2A 4KO0A 1C1CB 1F21A 4NLRA 4FJ8A 1T7PA 4J9OA 2IMWP 2QK9A 3KMSA 4CIGA 5E41A 3VQ6A 5I3UA 3WNHA 4KFBB 4C8LA 1X9MA 4K4TA 3HL8A 2FBTA 1KVBA 3IRXB 4DWIA 3E01A 1FKOB 2A1RA 2HMIB 3LP1A 5J1EA 3KJVB 1FKPB 4O55A 4BWMA 3MEEB 2BRLA 4N56A 2HNDA 4FZYA 3I5AA 2BANA 4Y34A 2IAJA 4CJ4A 4M3YA 4FW1A 2BQRA 3HM9A 4CJPA 1KVCA 3CFPA 5KRTA 2QKBA 2Q3SA 2D0AA 2O5DA 1RYSA 3LANA 3DLBA 1ZBIA 2C2RA 5KG1A 4KHRA 3MXJA 1O1WA 2XWYA 2W42A 2F8SA 4TXSA 1UOCA 2B6AB 2HAIA 4MFBA 1TL3B 1T94A 3OYCA 3AO4A 4I2PB 1TAUA 2VG6B 1U48A 2UUWA 2P5OA 4CEOA 4XPEA 1RDRA 3SUNA 2YNHB 3OS2A 2FVRA 1SKSA 5KFMA 3EZUA 3MECB 4DS4A 4EP4A 1TAQA 3FFIA 4NRTA 2FJWA 5KFQA 4EYIB 3CM6A 1FK9A 3KHHA 2WHOA 4KE5A 4B9MA 1IKVB 2YNIA 4Z4IA 5DMRA 4CGJA 5KT5A 4ECQA 4QWBA 1NHUA 1BIZA 1JX4A 4TY8B 3H5YA 5F8GA 4O4GA 4AILC 1C1BA 4QW8A 3T5KA 3RMCA 3H4BA 3LWLA 3BQ2A 4EEYA 2OPSB 1WSIA 4RNHA 2G8VA 3O3GA 2C22A 4RNOA 4WYWA 5C42B 3M9NB 4LH5A 4LSLA 3OL6A 1S1VA 3MAQA 4IRDA 5KFIA 4Q44A 4CFBA 2KZMA 2BGGA 1KHVA 2OA8A 1S1UB 4YQWA 4FXDA 4K4XA 1HMVA 4BE2A 5KT6A 1XI1A 1JLFB 3V9WA 1RTJB 4CF8A 1VSKA 4NYNA 1UAXA 3KLIA 4KHSA 2O4IA 1L3UA 3H08A 3UR0A 3RTVA 3ZCMA 4KSEB 5FDLB 4NCGA 4AHCA 5CZ1A 4CE9A 3OYIA 1JKHA 4K8ZA 1HQUB 1DTTB 1EP4B 4DSJA 5D3GA 4IFYB 4MIAA 3UQSA 4RW4B 3IGVA 1U47A 3GIMA 1JXLA 3H5XA 3K58A 1C1AA 3KK2A 3L2RA 1NOYA 2HNZA 4ZTFA 1RDCA 3GIKA 4NLYA 3DDKA 2OPRB 1NJXA 4X2BA 3SQ4A 1RBSA 2BE2A 3P1GA 4ZP8A 4O3NA 2FVPA 3AVJA 2VG7A 3V9UA 3L3VA 1U45A 3PX0A 3DLKA 2V0NA 1QHTA 1KSPA 4Y1DA 4H4OB 2E6MA 1EETB 2CJQA 4CGDA 1REVB 5HRRA 4CEFA 4FJXA 5KG2A 5C5JA 1S0NA 5SZTA 1D1UA 5KFUA 3LP3A 3ZSXA 4CEEA 3OHAA 5CYQB 5KFGA 1HARA 2NUBA 3L2WA 4DF8A 3M8QA 2Y1IA 3NDKA 4KB1A 3FQKA 1VRTA 1B9FA 2YNGB 2HWIA 1D9FA 1VK0A 4BDZA 1ASVA 3H5UA 1T03A 3BSAA 2I5JA 3QETA 5KFZA 4WFYA 4CIEA 4FJKA 2HB5A 1HNVB 3MXMA 3GV8B 3VA0A 4FLUA 3HP9A 4DQQA 4FJLA 3MF5A 1S1XB 1OS5A 4Y2AA 3VA3A 3OYGA 3HP6A 4O3SA 3M8SA 4PY5A 1NKCA 3AVLA 3K5MA 3ZT2A 5F8MA 4KTQA 1B92A 4NLQA 3SCXA 1QUVA 4FM0A 4OPJA 4CGFA 4Q43A 4ED6A 2YHAA 3V1RA 2XO7A 2YNFB 3ICLA 3PO5A 1S6PB 3QIOA 2AGOA 2QXFA 4FJGA 3ULDA 4AHTA 5KG3A 2DY4A 4E7LA 2GBZA 3B6PA 1DTQB 4H8KA 4DTMA 2G8KA 3E51A 4E1MA 3M8PB 1BHLA 3IGNA 1HYSA 4R8UA 3D5MA 4FJNA 1N4LA 3HK2A 1ZTTA 1JLAA 1QSLA 2Z1IA 3GILA 3DRPA 3ZT4A 3I5BA 3PVXA 5L1LA 3T5LA 5KFYA 1JLBA 4DQIA 4MK7A 4KHYA 3OL8A 5I42A 5KFVA 3RRGA 3N6LA 3OSNA 4M45A 4JRQA 4J2AA 2FLPA 2KFZA 4CK2A 3V6DB 1TL1B 4W5TA 4ICLA 2IOCA 3RMDA 3OYKA 3NGDA 1SL1A 1SUQB 4KI4A 4IRKA 3KK1A 3LP2B 2F8TA 1S1WA 2IM0A 3QERA 4YR2A 4IFVB 3DRSA 3KMQA 1RNHA 4ID5A 2E9ZA 1K6YA 3TAMB 3HVRA 2HHVA 1LWEA 4E1NA 3OVNA 1NK6A 1S0MA 4DL6A 1YTUA 4KKOA 3RBEA 2R2RA 3OYFA 4K4SA 4B9LA 2HHTA 3KLGA 2XCPA 4F4ZA 3AVFA 3OYJA 2RF2A 4CK1A 2UVUA 3NBPB 4KTZA 1KTQA 3RB6A 4KHWA 4JUZA 1LWCA 1XC9A 1LW0B 1RT6B 3DLEA 1LW2A 4NLDA 2VG5B 3DYAA 1S9GA 5JXSA 2XC9A 2ASLA 5J2NA 3JYTA 3SI6A 5KFJA 3PR5B 1I6JA 2HW3A 3V1OA 4RNMA 4KHQA 4CERA 1WSHA 3KNAA 1UA1A 4F4XA 1RTHB 3PHEA 1NKBA 4J9QA 1EX4A 2ILZA 2HHUA 2JC1A 5CYMA 3OS0A 1CXUA 4NLGA 2YKMA 4W5NA 1BQNB 2FVCA 3LZIA 1TKZB 5DGAA 1TVRB 3QGGA 3BSNA 2W9CA 4WZQA 3HJFA 3KLEA 2OPQA 4CFCA 2BRKA 3RAXA 4M3ZA 3UDLA 3OYBA 1SV5A 1CLQA 1ZBUA 1W0HA 4FLVA 1S48A 4LSNA 1RT5A 3NAIA 5C24A 3QIDA 4CECA 2KFNA 3LAMA 4XPCA 1WAJA 2EHGA 2Z1HA 3SYZA 3N6MA 2IS3A 3QEXA 1BCMA 4Y1CA 3U3GA 4E89A 2OPPA 2YKNB 5KFRA 2A1SA 1K1SA 4ZVHA 4CEBA 4FK4A 4RW8B 3RR8A 1C0TA 4CJEA 3AA4A 2RN2A 3NF6A 4Q5VA 3CFRA 4I2QB 4PUOA 1HYZA 2OZMA 3HVWA 4FLWA 3CJ5A 2PYJA 3PW4A 3I0SA 1JL2A 2W9AA 2PY5A 3TAEA 4XIUA 2RKIB 2EC0A 3AVAA 2FLNA 1GX6A 4ECTA 3HVTA 1VSJA 2C28A 3NL0A 4OKEA 2WONB 4Q8FA 2WOMA 1SKWA 3GQCA 3T19A 4ED0A 1B9DA 4FJJA 1C0MA 4MH8A 4GVMA 3H98A 3KKRA 4CHQA 5J2PB 3NHGA 3TVKA 3RB4A 4J2EA 3K5NA 1IM4A 3HPHA 4IH5A 3LPTA 1UA0A 3LZJA 1TKTA 1C2PA 3HHKA 3DI6A 2JC0A 3EYZA 2VWKA 1S9FA 4ZP7A 2KQ2A 2QE5A 5KG0A 3NF7A 4L8RB 3C94A 4LQ3A 1S1TA 3ZT1A 2HNYA 4IR9A 2P51A 2IC3A 4H4MA 4KO0B 3MTKA 2HWHA 4MQ3A 4HTUA 1EKEA 4CJSA 2RDIA 4DSKA 3RMBA 3DM2B 3MR3A 3BREA 1ZBLA 3HPOA 3KOAA 5I3UB 1VSMA 3M8RA 3TR8A 1YVUA 2FJXA 3FDSA 1ZYQA 2X78A 1HQEB 1RDBA 3L2UA 5EWEA 4JV0A 3CYMA 2P5GA 3LP1B 4J9RA 5J2QB 4FK0A 4BE1A 4AHVA 2ILYA 1QAIA 4C8KA 2BANB 1RTIA 4RZRA 4CHYA 4RUAA 2IAJB 3NAEA 1T05A 4IR1A 4WFZA 3ISNC 2ZQBA 4TLRA 2AX1A 5L1IA 1VSFA 4LD0A 4DQRA 1QSYA 3QZ7A 5F8NA 4C8OA 4F8RA 4K4YA 3ZT3A 1ITGA 1UWBB 3BSCA 3TANA 2FC0A 3IG1A 4I7FA 2IM2A 1NK0A 4IOBA 2W7OA 3D45A 2B5JA 4URGA 4DU3A 3L3UA 1C1CA 4FVMA 2DTUA 3FFIB 2P1JA 3RB3A 4N5SA 4ECXA 5F9LA 1NK7A 5DG7A 1FK9B 4TQSA 1RT3B 4KFBA 3V81A 3C6UB 3UIQA 3FQLA 4ZP6A 2YNIB 5KT4A 3KLFA 2G8HA 4WYLA 1VSDA 1BGXT 5JS2A 4ED1A 4QWAA 2D0CA 3KD5E 1KCFA 3MEEA 5KFWA 1Q9YA 3G10A 4O4GB 4CJRA 1C1BB 3NF8A 4DTXA 3Q8RB 3ZT0A 4N76A 4CHOA 2AU0A 1JLQA 3NE6A 1VRUB 3H40A 4B3OB 3VQ9A 4LSLB 4DL5A 2B6AA 2R2SA 4DL2A 1S1VB 4DFKA 3OYNA 4QWDA 2GV9A 3CJ4A 3GV7B 4B9NA 3AV9A 4DTNA 1HMVB 2O4GA 1SH3A 4RU9A 3QO9A 4K8XA 3H59A 4MKAA 2UVVA 2W9BB 3KLIB 4CF0A 4IH6A 4NCGB 1QAJA 4HUGA 4ID1A 3LALA 3Q8SB 4J9NA 1Y97A 4WE1A 5FROA 1JKHB 3UPFA 5KFXA 5D3GB 2IM1A 4DSEA 1NHVA 3OYAA 4W5QA 2HHSA 2RPIA 3I0RA 4QCLA 4QPXA 1RT2A 3KK2B 4TY8A 1R0AA 1Z25A 3TQ1A 3RRHA 1NK5A 2DPJA 2E9RX 2BR0A 2HNZB 1TK8A 4E0DA 4F2SA 4J9MA 4KB7A 4Q0BA 1NK9A 4NLUA 2DPIA 3O3HA 3SQ0A 4CIFA 1L3VA 3AO1A 2CKWA 1A5XA 4MK9A 4DSFA 3AVNA 1LWFA 1EXQA 1S1UA 3NKYA 3DLKB 2W8KA 2E6LA 1S0OA 4URQU 2D3UA 4ECUA 3NH0A 1NNDA 1X9WA 2R2TA 3ZSQA 3EPGA 5HROB 2ATQA 1N56A 4JRPA 1RA6A 4KPYA 3VQ4A 5KFAA 4CK3A 3OJUA 1HQUA 2IM3A 1DTTA 1JLGA 3M8QB 1RT4A 4IFYA 3P5JA 4RUCA 1JLEA 4C8MA 4OLBA 4HCCA 4OGCA 1VRTB 2W7PA 2EX3A 1TV6A 1S4FA 1FXXA 4FYDA 4DLGA 3DLHA 3OLBA 2I5JB 1NOZA 1JLCA 4EBDA 5FRMA 3VQPA 4ECYA 1TQLA 1ASUA 4NCBA 4KHMA 3OYMA 2FBYA 5KFNA 1WLJA 3V6HA 4KAZA 3I8DA 5HLFA 4Y3CA 2GIQA 1BISA 3DMJA 4MKBA 4IG0A 3PJXA 5KRSA 4JS5A 4G1QA 3IAYA 1RT1A 5EDWA 4ZVFA 3AVKA 1S5JA 3CQ8A 4URSA 4EZ6A 1TK0A 3IS9A 1EETA 3SNNA 1REVA 2G8IA 3JSMA 4K4WA 2WK4A 3OYLA 3G6XA 2WCXA 1CSJA 1WAFA 2UVRA 3SUPA 4O0JA 1Z26A 3LPUA 4DSLA 3QZ8A 4FJMA 1C0UA 3QGIA 4FLYA 1DLOA 3SPZA 1HYSB 3SI8A 4R8UB 4J2BA 2BQUA 3MR6A 2YNGA 3RAQA 2HHWA 2XY5A 3QGHA 5F8JA 2XY8A 1JLAB 3NF9A 1BL3A 1MU2B 3DRPB 1U4BA 4HYKA 4RW9A 4NYFA 3TI0A 4FCYA 5F8LA 4CJQA 3I5CA 4CJWA 2WB4A 3HKWA 4NRUA 3WNFA 3PUFA 4FK2A 5KTQA 5HP1A 3M9OB 3SFUA 1QQCA 1XR6A 3C6TA 4HUFA 3G86A 3F9KA 4DTPA 2JEJA 3HXMA 1NJYA 2I1RA 3TABA 4HVJA 4DMNA 4ICLB 4NLTA 3RWUA 3KK1B 2XCAA 3PX4A 1JIHA 4IG3A 2GIRA 1SH0A 3VQAA 3AVMA 1IKWA 3RB0A 1NJWA 3CIZA 2B4JA 2ATLA 4IDKB 3DRSB 2XI2A 4ID5B 2PZSA 1DTQA 1HPZA 3U6FA 4W5RA 3ZSYA 4OJRA 1LWEB 4ECVA 4ELUA 1YT3A 2XGPA 3LP0A 3OSPA 2Z1JA 1J9AA 5HBMB 4E7JA 4CESA 4KKOB 4G3IA 4PWDA 3KD1E 1BI4A 1BQMA 1ZBFA 3IN5A 2ZD1A 4K4VA 2X6SA 3BQ0A 4OL8A 3V4IA 3PV8A 4E7IA 2ZE2A 1LWCB 4RW7A 3T5HA
chains in the Genus database with same CATH superfamily
3DLGA 5HRNA 3MAAB 3LUYA 1BQXA 3DYAB 4JI4K 2ADBA 5B7WA 1XMQJ 5J2NB 3JYTB 4YOYA 4M5GA 3ENBA 3PRBA 5SUHA 1JXEA 1M5KC 4CGGA 4LF6J 4DUYJ 2FJAB 5F9NA 4I56A 5KFHA 3JS9A 4FSVA 5KFKA 3GONA 2QWQA 4B08A 4CD3A 2FTRA 1IKXA 4CHPA 2NUHA 4Q2MA 3M2VA 1F1BB 3G8QA 2RE2A 3NMRA 4A46A 2W9CB 1HBUB 4NXNK 1U49A 3OFFA 5KG4A 1NGJA 2D9OA 2W24A 1KNZA 3M2RA 4X4UA 3CNQP 3W3DA 4AH9A 2KG1A 4QOZB 2NZTA 4H0PA 3M6GA 1VQ6S 3NGUA 2AP1A 1ZBHA 2QTWA 3FEYB 5C24B 1U09A 2DXFA 1XNRJ 3NFAA 4LF4J 1A0OB 3D6TB 1KQGB 4DTSA 5KT2A 2RQCA 1E6YA 2CVIA 3DOLB 1W2BM 4Y2IA 4X64F 3MMCB 1QVFR 1M90O 3SCIE 2QEXN 4RL1A 3AD9C 3DOKB 3GBTA 4EAHD 2NZCA 5G0RB 3THWA 2HZCA 2O3DA 2ASPA 1EB0A 2Z4PA 4IWVA 1KP6A 4A4JA 4DB3A 4JLHA 4J9SA 1KEKA 4NWBA 3I82A 3D6FB 3QGPA 3QPIA 2R8IA 4KH1B 5D0RA 3VR1A 4F3TA 4NXMK 3PKYA 3CFOA 3VQ5A 3JAMO 4ZLPA 2R42A 2ZJPQ 2ASJA 4H5WA 1UFKA 1FJ7A 2HVZA 2CPYA 4HHJA 4WFNQ 2V52B 2RUGA 4HTLA 3DJCA 3I31A 4YOEA 3OTOF 1TKTB 1HI0P 3G8SA 1N32F 2YWEA 4CJ5A 3DI6B 1M1KO 1RCHA 3I55N 4OLAA 2LMIA 3MEGA 5J2MB 2R7QA 2GV1A 4AFFA 4JV2A 3HVAA 1KD1O 2JZ5A 3K8VA 4R5PA 4PWWA 2R8HA 4K50A 4JI3J 2DXEA 2MEWA 4A2BA 5BRFA 2HWTA 2L08A 4I68A 3RMAA 3V9XA 5GIPA 4A8QA 1VC0A 1YTAA 3P39A 4C23A 4DV3F 5ETQA 1HHQA 2AGPA 2HFNA 5EU7A 4ANEA 4NZ7A 4R0EA 3DGVA 5HRSA 1FRKA 2MGZB 4DDFA 1AUDA 1A9NB 1IBLK 1URNA 2DGTA 3OVSA 1BUXA 3MEDA 1T05B 1X5TA 2FGCA 3FMWA 3L6QA 1RBVA 2QJ3A 4CO4A 4PQUA 4Y65A 2C2DA 4H5NA 5DLGA 5B0CA 1E3MA 4EZ9A 3OTCA 5AFUA 3MPUB 4DSIA 2HBKA 4YMEA 5DDPC 3IG1B 4I7FB 2C1EB 3CCJS 2QMUB 2B9EA 2J76E 4CJ3A 4BC3A 1D9DA 2QIFA 1D8YA 1SKRA 1K9MT 3ITHA 1VQLN 2HLUA 2QKKA 2RIJA 1RWOB 3T9NA 1HQEA 3AVGA 4C98A 4AHSA 3QRQA 4QIVA 2BE9B 5HN0A 4EO6A 4DTJA 2B9YA 4WFXA 3BGOP 1U04A 2YHBA 5IWAK 1FXRA 2LU2A 2D3ZA 1S5ZA 4NLBA 3AOCA 3PW0A 1U2RA 4RWXA 4ED5A 4CF2A 3DXMB 1Z2LA 4ZLJA 4DQPA 3CPWR 3IRXA 2RQKA 3D6HB 2LA4A 3L2VA 4FJ5A 1RISA 5L39A 2HMIA 5JS1A 2EFPA 3PW5A 4OX7A 4RG8A 3CW2C 2YX1A 3SJHA 2ZUGA 1N5VA 3C95A 5IC4B 4OPHA 1TFWA 2NLWA 3BPSP 2HIYA 2D0OA 4RBTA 4B3MJ 1RAGB 4FBTA 4KH4A 5A76A 3QO9B 3C7NA 4DFPA 4FPIA 1SBRA 1Y7PA 3VENA 2HBMA 2BXJA 2DEIA 1ZAVA 1MW7A 2DR7A 3IC1A 2Y1JA 4JI1K 4LF7F 4DFJA 2W1BA 5GAEP 2P9NA 3RW6A 2KTQA 4CEAA 3MR5A 3B8HA 5AQNA 4FJ9A 4NLOA 2AX0A 3I6PA 3V1QA 4FKYA 4JI7F 2C2EA 1YJNS 5DM6L 3S3NA 5KFSA 2NZ4A 1X9JA 1FTRA 2ZHBA 1IKVA 1CZBA 2FHJA 5IC6B 2J0SD 1VRUA 2Q3PA 3MEKA 4P71A 3NS7B 1H1VA 2WW8A 1X5SA 3VGLA 4OPKA 4ED3A 3F0NA 5AQQA 1L5UA 5LM7E 4KREA 1LWFB 4DR5J 1UW9A 3JQJA 3BDPA 3KFWX 1H38A 3VALA 1UJ5A 4USUA 4NCAA 2RQ4A 2Q66A 3MAHA 4DEZA 1FXLA 4LFCK 1CC7A 3GYXB 1C4CA 4X4PA 3D6MB 3CQXA 3R8EA 1GQEA 1JL1A 2WBMA 1JLEB 3HHLC 5B0BA 1BCOA 5HAOA 2R8KA 4L3QA 1U2VA 3V6KA 2X74A 1TV6B 2D69A 1WHVA 3CCMS 3HT3A 5GADP 1N34F 1N36F 2DR5A 3FLCO 5A8RA 3ZO7A 2GC8A 2VBXA 3PW7A 4OI3A 1O51A 4FS2A 3SLCA 5M1PA 1M90T 2GHVC 1VC5A 4OYWA 2K2PA 1T03B 1F6TA 2FZCB 2ZJRL 4TYBA 2V2ZA 1T11A 1QVGR 1QLNA 3ISND 4CYUA 2CDQA 2HGMA 2FGOA 1SH2A 4ZVGA 2AEMA 2YH1A 5HROA 1KVIA 2GWKA 2D7SA 1FNOA 3RBZA 4N41A 4DV2J 2HFSA 1M1GA 2OYQA 3NGRA 4B3RK 4OYXA 1SJ4P 2HVIA 1D8ZA 3GWCA 2M4MA 3PX6A 5DETA 4K0KK 5D0HA 4RW9B 1WC5A 1M1KT 3KTQA 4IQMA 3VF2A 5EGYA 2XEXA 3CDAA 1IVZA 5AFUH 3B78A 3SJJA 4JK8A 3FE1A 5C2GA 5H9FK 2V9KA 4CGHA 4DV7J 1GTHA 3BKTA 2QSWA 4FPBA 4Z4HA 1F9EB 4BLGA 1RCXB 3M6XA 1HNVA 1AZSB 3ZZUA 2CADA 1X1PA 2VQEF 2YCHA 2IHR1 2XMJA 3EEQA 1HKGA 1NBEB 2BBEA 3G82A 3HDSA 4DR7K 2ZM6K 4M94A 3HRGA 5D4NA 5DG8A 2ASMA 1WUUA 2BOAA 4CBXA 1KFDA 1HPZB 1KRPA 2CGJA 2Y8WA 4F2RA 5KFTA 3IKMA 2M52A 4IKFA 4USMA 3N28A 3SAHA 2ZBCA 2OO4A 5JUMA 5KFLA 3LP0B 5DLFA 3WT0A 1MU2A 4LF9J 3HYFA 2CZ9A 1AFIA 1K8AO 1CJKA 1BI4B 4N8NA 3KWGA 2N7YA 4W92B 4F4WA 2YI1A 3CD5A 3V4IB 2ZE2B 2G8FA 4CHZA 2D5RA 1NNEA 1L3TA 1P9QC 4ED2A 3DLLL 1T95A 4TSXA 4KBOA 2YPZA 3KLGB 1HI1A 1HFEL 2ZFHA 2RF2B 3CDWA 1RBLA 2RRNA 3CCES 1LFWA 4A8KA 5CR4A 3IBFB 4LVNP 1RAJA 5L38A 3PRDA 4FOIA 1ZAWA 1TL1A 4H5VA 2H51B 4PABA 2GJIA 4M5LA 2DNHA 4B02A 3EX7B 1YITN 1VQ7N 2WB1D 5L46A 5JMNA 3IRWP 1EX8A 4AT1B 3H1VX 2LFVA 3R6GB 2YKMB 4F50A 4DU1A 3S3OA 3TAMA 4PR6A 1FWLA 1RBUA 2C3OA 3MWBA 1MLAA 1IR1A 3OY9A 2QA2A 3PRVA 2ZITA 1LAVA 3VMFB 3N5BA 4UQGA 3QIPA 2GVZA 3THVA 3MXHP 5HL7L 2QSFA 5DS7A 2KXFA 1H72C 3NBPA 2CQDA 1RT5B 2XYGB 4ED7A 2R7YA 3OTDA 4DL0C 3W2VB 3OBYA 2VG5A 5C7PA 1UEVA 3TW0A 2W6LA 1PG5B 1LEOA 2FXUA 4WCEL 4CT8A 3A8KA 4UZBA 1B7FA 1T9TA 4FLTA 2YWWA 4DMZA 2QWRA 4XTTA 4JI2K 2L9WA 2IBOA 3FZHA 1QE1A 4J9LA 1RKJA 4BRQA 1H2VZ 5CHCB 5A0YA 5E3AA 4NZ0A 4OI2A 2KHOA 4CTAA 2DJWA 2WOMB 3HO1A 4ILHA 4NOHA 2AEJA 2V4RA 1XWLA 4KH5A 4KY3A 4N47A 3B82A 3I33A 4M5HA 2J7UA 3EICA 4B8AB 1RWMB 1Q7LB 2CJAA 4ZPCA 5J1PA 1WHWA 4FWOA 4ZVEA 3TX0A 1DFDA 2F4VJ 2O8DB 4HTIA 2ZVSA 4FF4A 4PCQA 4DN0A 1WSVA 3B4DA 2H65B 3L2QA 3CWJA 2IC3B 4GC7A 2BA9A 2YKNA 4GC6A 1Q5VA 3MMBA 2RNEA 3EM1A 3VQQA 4KHNA 2AWZA 5HQMA 2QLWA 2QA4N 2Z8QA 3EDRB 2G0CA 2RRAA 1WC4A 3T3FA 2RKIA 3GPAA 2Y1RI 4KRWA 3S9HA 3AVHA 2E8AA 3G6ES 2HVHA 4Z4CA 1IR2A 5SWMA 1Q53A 3I9V9 4FO0A 3Q89A 3VQ7A 4OZ3A 5T7BA 1SJ3P 2H1YA 3A2FA 1VCTA 4NX9A 1AUSL 1RTDA 2VD3A 2Z2ZA 3PY8A 4BRFA 4FXWA 1SI9A 5E3RA 4DR4J 1OWXA 3GSDA 2PMZD 2VC0A 3NRBA 4JI4F 4NLXA 3PJ9A 4KO0A 4XAKA 2GNKA 4ILGB 3CD7A 1F21A 3OHRA 4MDAA 4J9OA 2HQDA 3D68A 2IMWP 4CLTA 3KMSA 2IFXA 4RX6A 2WBRA 3ZNUA 2Q79A 3VQ6A 1X8DA 2CRLA 3BDEA 4KHPK 1UJ6A 2FBTA 1KVBA 2V7YA 3E01A 1FKOB 3F41A 4P9SA 3UFCX 2GUPA 5AJ3K 3TZWA 5LXRA 2A1RA 5E3CA 1UVLA 4N56A 3VOVA 2I7PA 3NNAA 4NXNF 1NMEB 2BQRA 4CJPA 5KRTA 2QT7A 2QKBA 1FRXA 3DLBA 4KHRA 2QFIA 1O1WA 2F8SA 4LF6K 1UOCA 5GAEI 2XSJA 1GH8A 2VG6B 3R3TA 4EGLA 2D3O1 2QZ8A 5HVFA 4CH1A 2W4DA 4OHWA 1K8AT 1G2EA 1HBNB 4J7CA 4X66K 4ED4A 2FVRA 4OX9K 2C3PA 2Q2RA 2F8HA 1FX2A 3MECB 3FFIA 1QVFM 3DHWC 1YQHA 5KFQA 2N4CA 3KHHA 1NH7A 1MN9A 1X5PA 5KPZA 1HWJA 4B9MA 4Z4IA 2YNIA 3HBTA 4RU2A 4WYBA 4MO5A 2DH9A 3VEWA 4FWLA 2YQ1A 3AH6A 3BBCA 3TTDA 4NXMF 2E7XA 4C0BA 1TZ0A 1C1BA 1YJVA 2QL7B 4V19J 3RMCA 3EGNA 2OPSB 1VQKS 1WSIA 2P9PB 4RNHA 3O6WA 3OQ2A 2L9DA 4WYWA 5C42B 4LH5A 2YKPA 1S1VA 2A1BA 3MAQA 2Y1LB 3O2IA 4Q44A 3W2WA 5BXIA 3SBTA 2HBZB 2OA8A 3E9OA 4PXCA 3K0JA 2VYPA 2ZGYA 1RTJB 1KVKA 1QM9A 5GADI 2A6OA 2Z56B 3MM8B 4Z7YA 2UU9K 1I1GA 5IZHA 4Q7AA 1DKGD 4LF8F 3CJKA 3UQSA 5ETNA 4ZPVR 2GHPA 1VQ4S 1CBKA 5JVHQ 5CE3A 4OZ5A 2GA7A 1A7GE 1IBMF 2XS5A 4JBCA 1VGYA 3L2RA 3FZ2A 2MZTA 4ZTFA 1IBLF 3OBIA 3DDKA 4HT7A 1S6UA 2O66A 4FPRA 5F1XA 4DR1J 1VQ9S 3OT9A 3VF0B 4ZP8A 3FFKB 1KC8O 2BKPA 2CQ1A 2VG7A 6AT1B 2AZ3A 4H4KC 1U45A 4CH0S 3LDPA 3PX0A 2GX9A 4J9VA 4YOXA 4WP3A 2BJDA 2FSJA 3U9ZA 4Y1DA 4ZVOB 2A2DA 1REVB 1VC6A 2H4WB 5KG2A 1S57A 5CD4A 1S0NA 4MIWA 3JTPA 3LP3A 3NGTA 3W7BA 1HARA 3HOSA 4DF8A 3M8QA 2P9CA 4I64A 1KQKA 1JK9B 1RDWX 1VQPS 4KB1A 3E3XA 2GZOA 4ZN1A 4I6MB 1YBUA 5HMYA 4QZVB 5ETKA 1VK0A 1GXTA 3EWGA 4A8MP 2IY5B 4C3KA 4ILJA 3QETA 4DZ6A 4WFYA 2QLJB 4FJKA 4MYUA 4FWNA 3R3LA 4FWQA 7AT1B 5LY3A 3PTWA 4TNOA 4LIWA 2BW2A 3AVLA 5KOWA 3U7JA 3LDOA 1ICEB 3LQVA 5D78A 4FM0A 2F3JA 2YHAA 3EDQB 2XO7A 2HEKA 2QXFA 1RHKB 3ULDA 3HSCA 2MKIA 5JLFA 2OP5A 4JI1F 4DTMA 3P31A 3M30A 1XK8A 3HHEA 3TU5A 5BR8J 3M8PB 4HL9A 3EO3A 4DCOB 4JI8J 1N4LA 2ASOA 2NPIA 4LFBF 2MKJA 3I5BA 5IT9Y 2J4RA 4M8LA 2J9DA 4F4AA 2N3OA 4C3LA 3OL8A 3NVMA 5KFVA 1T02A 1FRJA 4QS8A 2KFZA 3V6DB 2Q6CA 3HFKA 4O0NA 3IFEA 2IOCA 1U0SA 3RMDA 1U6BA 1SL1A 3VEYA 3AOBA 1SUQB 4KI4A 5HQ8A 3OV7A 1U2CA 4TU8A 2DNQA 4LFCF 1T3OA 2W4PA 2HZAA 4JI5J 3DRSA 3KMQA 2IRXA 1WF1A 4NZ6A 2BJ9A 4CLZA 2J7KA 1RK8A 4ZK7M 3HVRA 1MROB 3GYGA 4U7UD 3KVGA 1PYSB 4E1NA 3FNNA 3EZOA 1OSDA 1RWKB 2AF6A 4ANCA 2P9IA 4UF4A 1YTUA 2ZBPA 4OZLA 4PL7A 3GG0A 2O8CA 3CEDA 3OYFA 1VJQA 4K4SA 2HHTA 2XCPA 2VONA 2X51A 4KTZA 1KTQA 3RB6A 4KHWA 1XC9A 1LW0B 2HURA 3DLEA 2LQ8A 1LW2A 2OTJS 4NLDA 3MAAA 1GLCG 2Q0RA 3DYAA 3VGSA 5JXSA 5J2NA 3JYTA 3PR5B 2HW3A 1VHIA 3V1OA 5AQPA 4KHQA 2E5LF 3FGVA 2MQLA 4WK1A 1F2GA 5D77A 3PHEA 4UOHA 5FIIA 3D1OA 2EKNA 3Q0AA 1U8WA 3BH6B 3FK4A 1T44A 1Y3JA 1BQNB 3LZIA 5I3QA 1TKZB 1TVRB 3DN9A 1W2IA 3QGGA 4DN9A 2W9CA 4WZQA 3ULEB 2W40A 5HO4A 2XZDB 1ZM2A 1T6DA 1ZBUA 3G9CA 4IYQA 3KYLA 1W0HA 4OJHA 1U6ZA 2R4FA 1QAYA 2QO3A 4EK2A 2YKAA 3NAIA 5C24A 3QIDA 1YLXA 4FYWB 4M63A 1ZZFA 3R2DJ 2BTFA 1I5OB 2XSFA 3JAMU 1RAAB 4RWWA 2Z1HA 1BWFO 1P8GA 2VPXB 3ZXWA 1HUXA 2DXDA 1E6VB 4ZVHA 2A1SA 1OJ4A 4CEBA 3T1YJ 2ZBIA 4CJEA 1G7CB 3VHQA 5G0RA 2VJUA 2CYYA 3W8PA 4LF5F 4I2QB 3MMVA 2Z2LA 3CJ5A 3O9RA 3PW4A 2PYJA 1JL2A 3P45B 4QQBA 1FRMA 1Q1KA 3ZZYA 1VQON 3TAEA 4XIUA 2XM3A 2EC0A 4USJC 1UFLA 2YXLA 5IOLA 3JSYA 2C28A 3GFYA 2GX8A 2J9EA 4IO8A 2ZC3A 2HSEB 4Q8FA 2PFDA 1ZXOA 2VQFK 1KC8T 2NRTA 4A8WA 4FJJA 4NA2A 1YK9A 3H98A 4CO5A 5FD1A 4CHQA 2POKA 3TVKA 1KQSR 4GO7X 4DV5K 2P5VA 2RS2A 2GHWA 1UA0A 3GIRA 1TKTA 2FC9A 4LC9B 2JHEA 3HHKA 3DI6A 2JC0A 1VBXA 2VWKA 2PC6A 1X4CA 1RTZA 3HZEA 1Q16B 1Y5LB 3C94A 3ZT1A 4IR9A 3A8IA 2HQFA 2W2OP 2EK1A 3I4PA 2QA4G 4FWKA 2RDIA 3DM2B 3MCOA 3CT9A 4UY8O 4EHTA 3TR8A 3FDSA 5BYSA 1ZYQA 2EFOA 3TA2A 2VICA 2VF3A 4F7VA 1PIEA 2LA6A 4OI4A 2UXDK 1QAIA 2MGZA 3W9JA 4L74A 4RZRA 3WXIA 4X64J 1T05A 2PD1A 2GJFA 3UN5A 4W98A 3ZZTA 3A8YA 4TLRA 3QAUA 2ZZTA 5L1IA 4LD0A 1QSYA 2RHKA 1WTBA 4F8RA 2XO6A 4K4YA 3WQPA 1P1TA 3TANA 4NB4A 3ZZ0A 2FC0A 3IG1A 4I7FA 4DR3K 2IM2A 2W7OA 2Y9HA 3EKSA 5HJXA 3R97A 1C1CA 3J8AA 4L3NA 2LQJA 1FK9B 2DCLA 5M2UA 1RT3B 2UUBJ 3C6UB 3WC2A 1YXQA 3DXBA 4P75A 4ZP6A 1MWMA 2NRRA 3OTOJ 2OFHX 5JS2A 3Q83A 3CC4S 4PKGA 1FNXH 4KGZB 1NLKL 3CCUS 4X65K 1HWUA 2B9WA 3W61A 1Q9YA 3VEVA 2FUG9 4JI2F 3VEXA 1VQYA 3NF8A 3KWIA 2HBLA 2CQIA 2UXBK 1L3KA 2QC3A 4QJVA 3IMXA 1HNWJ 4ID8A 4LSLB 1H6KX 2GQQA 2LQBA 1IBKK 4IOAL 3CJ4A 2G0JA 3BYPA 3AV9A 4AYBD 4AM6A 2C2NA 2O4GA 3QO9A 4DV3J 1R43A 5M1FA 1GLLO 3KLIB 1NU4A 4QYZJ 4CF0A 1OPZA 3QWPA 1Y97A 5LMNJ 5KFXA 1CQMA 5I3PA 4W5QA 2K7JA 3DNCA 2XULA 4QPXA 1V5VA 5GAHP 3VAJA 3KK2B 1T9WA 1Q86O 4CQ1A 4DV1F 1NDKA 1HNXK 2DPJA 2ZJQQ 1VQ6N 3O44A 1TK8A 4Z7CA 4BR2A 1NK9A 1DQ9A 1MDUB 4ES1A 4RBVA 3O3HA 2QEXS 2CKWA 2CH6A 4DV4K 1LWFA 1XC3A 1MWZA 2V8PA 1EXQA 3CGIA 3NKYA 3UNYA 3H7HB 1B70B 3LOUA 4USTA 2W8KA 2NR0A 4B1XB 2VOPA 3TUZC 1NEEA 2D3UA 1Z2ZA 2R2TA 3ZSQA 3FMBA 3EPGA 2ATQA 5FPNA 3DAWA 4JRPA 3FZLA 2V68A 1HIYA 3S01A 1B0PA 4JKHA 1DTTA 3C6HA 3P5JA 2IIRA 1JLEA 3M1VB 4C8MA 2PEHA 1HKCA 4JB8B 2D74B 1G6BA 1TV6A 2DHAA 3GZ7A 4EBDA 3I55S 1RHQB 3OR2B 3NS5A 4KHPF 4FF3A 4OHYA 5AJ3F 2HMPA 5KFNA 4Z37A 1WLJA 4MTPA 3V6HA 5EOYA 4WFBQ 3QJPA 3FBBA 3DC2A 3D2WA 4WQ4A 4JS5A 5EDWA 2AW0A 4JI7J 2BACA 3SQOP 4P7TA 1SIWB 2DIVA 1EQMA 4CLYA 4JD2B 5BJRA 4MJKA 1PYOB 4DSLA 1DGKN 5DO2A 2JVRA 4X66F 1QUPA 3BBBA 3JSRA 4OX9F 3RAQA 2HHWA 2MY8A 3HSJA 1GEHA 4HYKA 4RW9A 4BRIA 3TPQA 3VVTA 3CF5Q 4YDUA 3ZLJA 1K44A 3SFUA 1QQCA 3EGZA 3G86A 2P9SA 2JEJA 1NJYA 2APOA 5MLCV 4UY8T 2ZVIA 4ICLB 2HRTA 3M7VA 2BMBA 3GJSB 1Z05A 5K8NA 1AZSA 2XCAA 1FNMA 2PSZA 4TVAB 4C6AA 1SH0A 3AVMA 2E7VA 3RBXA 1AW0A 4GKKF 5ETSA 3TSQA 1N34J 2B4JA 4FWRA 1OIAA 4ID5B 5EX5A 1HPZA 1Y10A 4W5RA 2FHOB 3RSEA 2HQGA 2JH3A 1RUSA 4ELUA 1YT3A 2XGPA 2UU9F 3LP0A 5AQWA 5JMVA 3OSPA 2Z1JA 3AD8C 3LH2S 4Y28C 5HBMB 1Y3KA 4KKOB 3KD1E 1BI4A 2DRBA 4OYIA 3TJ8A 3IN5A 1TL7B 4K41A 1YJWN 3BQ0A 3V4IA 4E7IA 2ZE2A 2XTJP 1LWCB 2BQ3A 4IFEA 1N5YB 4DTOA 4J9KA 1S9GB 4DV6F 3SCKE 3SBMA 4CI0B 2YHXA 4BQLA 1SL0A 2CPFA 4FN5A 5AQXA 1XQSC 1T3VA 2MKYA 2LDYA 3HPGA 3EKUA 3J80O 2YQ0A 3KK3B 4OJ1A 2WRMA 4ZA1A 4JYAK 1T9XA 4DR2K 5HOOA 5C2FA 1X5OA 3TJ9A 4BR7A 2UUAK 3UDCA 2FY1A 2B4OA 1SV5B 3C66A 5A2QY 4LQ9A 3TTCA 2KU7A 1TL4A 2M2BA 2VOOA 2FBXA 5AQYA 2JEFA 4KGVB 4U67L 4CD1A 1F2HA 2ZC4A 2LKZA 3G0ZA 3SUOA 3N0VA 1I3AA 4CJLA 4U7CA 3DRRB 1P27B 3HSDA 2QV6A 5F8IA 5D0GA 4P74A 1VJWA 5AQMA 2MQPA 2KH9A 1XNQK 4YY3K 3EVMA 1C0TB 5KG5A 1C6VA 4AL5A 1HBMB 1RU2A 2Q6BA 4ZPAA 2EG1A 2R2UA 5B08A 1N33F 5BR9A 3DCAA 4PUOB 3H4DA 3W2VA 1IKYB 1R8CA 3I0SB 1Q86T 3TVYA 3UKUB 4P52A 2CPXA 1AA1B 4CM2A 2EXUA 3BBFA 2IDEA 3AXMA 3R5JB 3W5YA 3RAMA 3POTB 4KV8B 4KHUA 2XGQA 1OMSA 4PKIA 4WZMA 1PKUA 3J81O 3G6VA 5C10A 4OGEA 4XK8C 3FCWA 4FJ7A 5RUBA 1SQKA 2MLZA 1D0EA 3TAPA 2JLEA 4IRCA 5GMKa 2ACMA 2A0FB 2OD4A 4CBWA 2E4LA 1S4EA 1BA0A 4XH5A 4EHUA 1IJJA 1X9SA 3V9ZA 3ENVA 2KRRA 4MYTA 7FDRA 1KFSA 3Q8UA 1SCJB 1TP7A 2EW9A 2HNYB 4P72A 1QS4A 3ID8A 4ZHRB 2KT2A 1DURA 3R5CA 1XJWB 2O8DA 1I51B 5A8KB 2CIMA 5DDRC 4KYZA 3QFHA 4BACA 4ED8A 3CJ0A 4ZMMA 1R59O 1HWIA 4M41A 9ATCB 2F9DA 4MDBA 1FWKA 5T7LA 1TFYA 4YDUC 1J53A 2VWJA 4TY9A 4NLVA 3IA0A 3PXGa 4D3HA 1IO2A 4BY9C 4RNFA 3QINA 3ZSOA 2WONA 4ZCMA 5B8HA 2CVEA 2KM8C 4WJBA 4DI6A 4DV0F 2QWMA 2E2OA 1ZBSA 2NS1B 1HPMA 2B8QA 1RDAA 5J2PA 3FRYA 2IRUA 2LXIA 3QWUA 2XBPA 5AQTA 2ZNZA 2HNDB 2DNPA 4QBUA 2DBBA 2FLLA 2XY7A 2KW4A 3BEGB 3FGUA 4ECWA 1IJEB 5LXYA 2B5JB 2MJNA 3MOZA 4LH4A 3AA9A 1LOTB 1G4CA 4K5SA 4OI0A 3CJTA 3H5SA 3OS1A 4M3RA 3V81B 3HOTA 1WOQA 1XEZA 4K4UA 2HFOA 1ZM3A 1WC3A 1N8RO 5J2QA 4X4OA 2ZZMA 1XHXA 4E7KA 2D0PA 3OFGA 5L1KA 1HKBA 2VGMA 2HHXA 3L8BA 2Z57B 3K5OA 1FKOA 2L3MA 4N7TA 2UP1A 4ILRA 1AYEA 1UWBA 2DGWA 3QT7A 5AQOA 4CCHA 3PR4A 4E7HA 2FYXA 5A6PA 1UVKA 3N9UC 1Q0NA 2BJ1A 4QWCA 3NMUA 4Z0UA 2FPHX 4QS9A 4Y0FA 1HI8A 1IH7A 4F9OA 3EJMA 1BC6A 2HAFA 4WKYA 4HWIA 1B64A 1YITS 1W25A 1VQ7S 2VG6A 3HKZD 5GAHI 1BA1A 4M5MA 1MG7A 2UZAA 5DM6Q 1HBNA 3I0RB 2HGNA 2UV8G 2GMHA 3MECA 2F7TA 2NXUA 5GMEA 2VKZG 1PJ7A 3M8ZA 2OELA 5KAKA 2XHCA 3QEPA 4JP8A 4DCHA 4J9UE 4O5BA 3GTYX 3KKSA 3D1HA 4IOCL 4B9UA 2DPNA 4FYYB 4B1YB 5LMUF 3H42A 3L7UA 2P9UB 3AHPA 4JI4J 3WNEA 5B09A 1WDTA 1W7WA 4M3TA 2V2VA 2OPSA 2UXCK 1UEKA 2P9PA 1J54A 4DZDA 2VBWA 4MKYA 3SFGA 4R79A 2W9BA 4DV5F 5C42A 3SIPB 1RQ0A 3QEIA 2MLYA 3ZTPA 1KQSM 5CZ2A 5B0AA 1VSEA 3ZSRA 4RKUC 1NO8A 1RSCA 4FNIA 3LL3A 1ZPVA 4EBCA 1RTJA 1NGFA 1XQIA 3ZX3A 2VDHA 3WIVA 4C9DA 3OHBA 5FRNA 4J8FA 4NXNJ 4LR9A 1ZAXA 4B9SA 3T69A 3QNNA 4ECZA 1RKIA 1QAXA 2HQIA 4OYBA 5BRDA 4O3RA 3HD1A 2ZJRQ 3H3NO 1G3OA 2Z30B 3KIOA 1UFWA 2UXDF 1Q8IA 4IG0B 3H3OB 1HD1A 1LOUA 5AQLA 5E3PA 3OW2R 3RBDA 3IS9B 2KI2A 5EXWA 5ETLA 3JSMB 3R5BA 4KGXB 2OMLA 2IDOA 2QA4S 4I9QA 1Q8KA 3H20A 1C0UB 2ZBQA 4IBNA 1DLOB 4NXMJ 3BS9A 3NGKA 1FVSA 3UD3P 5DZ7A 2V7ZA 3D2FA 2UVWA 3BJYA 3H2LA 5AXNA 3GSIA 4K42A 4ZVUB 2R7XA 3BKUA 2FJVA 2ETJA 1IQZA 3V5RA 4CT9A 2P9LB 5HP1B 4I6MA 4CEQA 3HJVA 4NI2B 2O8BB 1V3ZA 3VAFA 4H54A 2X6NA 3E2EA 4AQYF 4X65F 3NAHA 1ACMB 3K57A 4G6VB 3TAFA 2BJ8A 2HSTA 3AVBA 4CFDA 2UXBF 4H0VB 2FBVA 1JLBB 3ZETB 3S6EA 2A41A 4A48A 5I42B 1FDBA 4FPAA 1IBKF 4Z4EA 2A3ZA 2ROGA 3P5BP 2BYCA 3VGVA 4OKJA 3O3LA 1N32K 4M95A 3C19A 4KBIA 4DQSA 1RZMA 2YWGA 1NBWA 4ES2A 1FE0A 1IBLJ 1K0VA 4PL8A 3TAGA 2FY8A 3CUNA 4KTWA 5EX0A 1NAQA 1CS4B 1FERA 3OBWA 2ZH5A 3M8PA 3DLLQ 2EEYA 4CH7A 2XG8A 2XHBA 1UPPA 3ZFVA 1FCAA 2DCUB 4WQ5A 4KB0A 1HNXF 4ZIWA 1RP5A 2CNKB 3GE9A 1WELA 2FVQA 4C8YA 1ELOA 2WVFA 1JJ4A 4TYAA 3Q8QB 2CZ4A 1S6QB 4BGAA 2LCWA 3OYHA 2IYGA 1EWQA 2X1BA 1R8PA 4CFAA 3SV4A 1N8RT 4IDKA 1VBKA 3RU0A 2ITGA 4DL4A 1REGX 3AY9A 4TU7A 3SMSA 3UI3A 5D4OA 4O44B 4ISEA 3WQTA 2WC9A 2NRXA 1KVAA 2YJEA 5IWAJ 2MYFA 4DF4A 4CZIA 1RHMB 2ZGZA 3J7AN 4QAGA 1HYVA 2PYLA 5B0FA 2PN6A 2DNMA 4HCBA 1TKXB 3FRZA 4CJ7A 1SJFA 2P9EA 5HL7Q 3I56N 1RWUA 4EBEA 2UV8A 3VN5A 3QEVA 5KFBA 1ZA2B 3VV2B 5KPTA 4ES3A 2ALYB 1KS2A 4ZJLA 1N6QB 4I4BA 5AQSA 4YR3A 1KTVA 3MOJB 5C12A 1VQ5N 1LW0A 4JI1J 4HVZA 1UVMA 2VFSA 1IBCB 1G15A 1Y9OA 4WCEQ 3FC9A 2OAUA 1T3NA 4HHHA 4ISGA 1J5OA 1RWWB 4M1KA 2QA1A 3HZ6A 1PBAA 2DO4A 1PAEX 1RBRA 3P8BB 3MHYA 2V8HA 1OVQA 4MIBA 1GNKA 2DR8A 4DCPB 5DQGA 1YIJN 3PEHA 2Q31A 3K9JA 3SSRA 4CZGA 1NGHA 2DH8A 1TKZA 4X4SA 1JCFA 3BO2A 3HVTB 4LF7K 2AKWB 1S97A 3JQMA 1WNSA 3AO5A 1UTAA 4K7QA 5KFPA 1B4SA 2DNLA 3G2XA 3IUCA 3QB0A 2RHQB 5E2QA 2KT3A 3TOQA 5AR0A 4LFCJ 3CJ7A 4FM2A 3VAHA 4HH0A 4C8NA 3SAFA 3ELHA 3M8WA 4NL5A 3MMAB 3O1LA 4FYVB 4LVOP 4IEEA 4WPAA 1E6VA 1EHWA 3SAGA 4M3WA 3QMQA 4NLPA 4CVNE 4E2FB 1XERA 1RT7B 4I2QA 3IO1A 1U8SA 1TK5A 2CPDA 3T1AA 2XB2D 3BH7B 2I9SA 3NCQA 1EJ7L 4OYOA 3LM9A 3H45C 5ADXH 3OFEA 3KDNA 2JEGA 1RCOB 4FF2A 3CCQN 3FJ2A 3O9UA 3T9ZA 2DGVA 3MXIA 1U1NA 3LWMA 3CDUA 9RUBA 4RJVA 4IO9L 2NRHA 4QR0A 3VQCA 2KN4A 4YR0A 4B8CA 2Z2YB 1H98A 2DGSA 2QL9B 3VQDA 1HNIB 4FF1A 4ZLLA 3AO2A 5AQGA 1N36K 1P9YA 1WACA 4CZHA 1JNZB 4C0OC 3MFHA 3PW2A 4Y00A 4B3RJ 2G1HA 3T6JA 5H1SQ 2E88A 3NOGA 3T1HK 4KFBB 4DPWA 2DITA 4K0KJ 1X9MA 1ZZNA 3HL8A 1SKUB 3AB2B 1RAIB 1I94K 2BKOA 1IM6A 5J1EA 2X1GA 3SEOA 4JYAF 4DR2F 1HW9A 5H9FJ 3H46O 4FZYA 4IXCA 2ASYA 4Y34A 2UUAF 4M3YA 3THXB 1KVCA 3TR5A 2Q3SA 2D0AA 2O5DA 4JHDA 1ZBIA 2C2RA 5KG1A 2XWYA 3UN2A 4TXSA 4UY85 2B6AB 4MFBA 1T94A 4WFAL 3OYCA 2K8GA 3AO4A 3TEHB 1TAUA 4DR7J 2ZM6J 2Y0BB 5HMXA 3P5TL 1GLDG 1RWXB 2UUWA 3Q8YA 1JJCB 3SUNA 3CDBA 1PAUB 3N4WA 3VPZA 1CULB 2V67A 3KJFB 2QN6B 1XNQF 2J8AA 1W26A 1TAQA 4YY3F 3BN7A 3QFUA 2FJWA 1FK9A 5LJ3Y 4F02A 4KE5A 5E0OA 3S8SA 2XLJA 5C2DA 2C2KB 2HKEA 3VCDA 5DMRA 2VQEK 2FZKB 5KT5A 3THYB 3PCOB 4TY8B 2C3MA 4ZDNA 4CLUA 5F8GA 5CAAA 1M1HA 4YOUA 3H4BA 3BQ2A 1H2TZ 4U95A 3WX4A 2G8VA 2A3JA 1G1XA 2C22A 4RNOA 3M9NB 4LSLA 4CFBA 4ATNA 2Q43A 1UZHA 1S1UB 4YQWA 3TUIC 4K4XA 2UUCK 1XI1A 1JLFB 3V9WA 2MLXA 3KLIA 3UR0A 3RTVA 4ZITA 1UKUA 2PGCA 4AHCA 2VHGA 4W90B 5CZ1A 4CE9A 2QX0A 4YB6A 4DSJA 4IFYB 4MIAA 4JKCA 1JWWA 3G96A 1U47A 2F63A 5E5NA 3PYDA 3H5XA 4FL9A 1C1AA 2EG2A 3KK2A 2I2YA 1N5QA 4HLBA 3GIKA 5ETOA 5F0UA 4BR9A 1WC0A 2BE2A 3WDOA 4JI0K 3ENAA 2P6TA 4OX6A 2RDDA 4YS2A 1KSPA 1N0VC 1VQOS 4H4OB 1FJGK 2E6MA 1EETB 2CJQA 4OZ1A 2WVCA 4JI2J 5C5JA 1SVDA 1LXNA 2EBGA 3PIOL 2KB2A 3ZSXA 3WQUA 5CYQB 4HH1A 3NDKA 1XMQF 2ZEJA 3LO3A 4OZ0A 4X62K 4UTGA 4NPOA 1S76D 2YNGB 2HWIA 2MXYA 2K1RB 5B0DA 1VQNN 4BDZA 2FHMA 1ASVA 2GO9A 2NUUG 3E9PA 2FIUA 1RBOB 1Q7YO 1HA1A 2BM0A 1VLYA 2HB5A 3QJLA 3GV8B 3D6RA 4WIIA 3KG4A 3HP9A 4F0MA 1UMJA 1GXUA 5IM0B 4M7YA 1UZDA 3FSXA 4NEYA 5AZJB 4ZJQA 1NZ8A 1XN9A 4PRFA 4O3SA 1EO1A 3M8SA 4PY5A 3W62A 1NKCA 3K5MA 4G65A 5GAGU 2FSKA 3ZT2A 2V2KA 3T7ZA 4KTQA 3MCPA 6FD1A 3UB5A 1QUVA 3GL1A 1NGEA 4CGFA 2KDOA 3WXJA 4Z94A 4PXEA 3PO5A 1S6PB 4OYAA 3QNWB 4FJGA 4AHTA 4JD2A 4H8KA 3TA1A 3E51A 3MWTA 4B1WB 4ZVQB 1YI2N 1X3NA 4FJNA 1GLEG 3HK2A 2Z1IA 4UW2A 3EGVA 5L1LA 3T5LA 3R1HA 2CJBA 3M1FA 4MK7A 2FZGB 2HRUA 3N6LA 5ETPA 4RUBA 3OSNA 3BO4A 4M45A 3VGUA 1YAGA 3JS6A 3O8MA 4J2AA 2M8HA 2GW8A 4BC9A 4EFAC 4W5TA 4ICLA 4C1NI 3FVYA 4IRKA 2DB1A 4A47A 4PG7A 5ADZA 1RGIA 1S1WA 2IM0A 3AARA 2EI5A 3QERA 1WJ9A 2ROPA 2IMOA 1NGDA 5G4DA 4IFVB 1WD6A 1RNHA 3FCHA 4KHPJ 4ID5A 3ENOA 3A3OB 4A5BA 5AJ3J 3U4LA 3JB9k 5M2PA 3CJAA 4YDXA 1NK6A 3HHLD 2IIHA 1Q78A 3BPDA 3M2RB 4YB5A 4KKOA 3RBEA 4TLQA 2H48B 1KKHA 4B9LA 3R1XA 5HSPA 1WORA 1R0CB 1TL7A 3AVFA 3J80U 1R8HA 3OYJA 4CK1A 2B51A 1OH8A 4B3TK 1LWCA 1ATRA 1RT6B 1F3FA 1Q4RA 1E6YB 2BKNA 1S9GA 3MZIA 1CJVA 4P2FA 4X66J 4RNMA 4H0TB 2V69A 4OX9J 1UWAA 1UA1A 1RTHB 4J9QA 2DKOB 2NPFA 2G2ZA 1ESVA 3OW2M 2A5XA 4NLGA 1YJRA 5DGAA 3FCVA 5GINA 4A2AA 3KLEA 2D1KA 4CZLA 2OPQA 1FDNA 4JK7A 3MN6A 3Q7CA 3L09A 4TU9A 3VAMA 2QLBB 1SV5A 4LRDA 2NXNA 1BOTO 2OGUA 4BR5A 4LSNA 4CECA 3OD2A 3LAMA 2ZH7A 1VQSA 3J81U 2DK2A 2QM1A 3LF0A 4LRAA 2IS3A 5AZIA 3L4QA 4QS7A 1K1SA 3BKFA 2UU9J 1C0TA 1WKLA 3HZGA 2RN2A 2E7WA 2GMJA 5D8HB 4GMKA 2AJFE 4Q5VA 1NMNA 1NB7A 1T6CA 4PUOA 1T0TV 3HVWA 4FLWA 3I0SA 3L3CA 2W9AA 1XMBA 1J2VA 4B3MF 1VRQC 3HHLA 3AVAA 3I96A 3SQGA 3POTA 4FVUA 1VSJA 2F9TA 3VZIA 2XMUA 4HACB 3OXGA 1CVJA 1FT8A 3GQCA 2DRAA 2Q97A 4ERDA 3GOIA 1C0MA 4MH8A 1FEEA 1R6VA 3AJ2A 5FLXO 2LU1A 3AOAA 1IM4A 2FF3B 3HPHA 1KAYA 4GV3A 2CJXB 1TELA 2VKRA 3LZJA 2ITMA 1LFPA 4X4NA 1M5OC 3EYZA 1S9FA 4ZP7A 4LF8K 2QE5A 5KG0A 4YDDB 2MKCA 1Y0HA 4L8RB 2RVJA 3HSGA 1K73O 2WTUA 2HNYA 2P51A 3C16B 2KG0A 4GVEA 4MQ3A 4AF1A 1EKEA 4DSKA 2R9LA 1IBMK 3OFHA 5EHHA 3BREA 1ZBLA 1EQ0A 4HI2A 5I3UB 3M8RA 5BYRA 2KYZA 1UPMB 1SAZA 2VH7A 4DR5F 1VBYA 2X78A 1HQEB 1Q7YT 3H0PA 1IN0A 3CYMA 1TUGB 3LP1B 4YEAA 2FHJD 2BANB 4CHYA 3TZZA 2IAJB 1S0VA 3NAEA 1TTHB 5CCLA 2NSCA 3BF3A 3ZTSA 4L72B 1SC6A 1FRLA 5F8NA 3O4WA 3U02A 4DR6K 3O5TB 4C8OA 3KJQB 3K9KA 2N4DA 1HNZK 2H3GX 4MLHA 3BSCA 1WF2A 2HFZA 3BGFA 1NK0A 4P2SA 3QT5A 2WAQD 3M6UA 2B5JA 2XMTA 3GB0A 2IVFB 3SMPA 5LJWA 2V4JA 3OVAA 5F9LA 1YX2A 2OSQA 3V81A 1KONA 3C15B 5KT4A 2G8HA 2AJ4A 1VSDA 5F3TA 2EFQA 3ENWA 4BVOA 2D0CA 4BRDA 1YJWS 3FSYA 2MZJA 1LQ9A 3MEEA 3F44A 4CJRA 3JAMY 2RU9A 1U1PA 3W0LA 4CHOA 4IOAQ 2XLKA 1VRUB 5L9NA 1PJ5A 3N01A 3VQ9A 1CG2A 2YHWA 3OYNA 4BCAA 3H2VE 3D4JA 3GV7B 4B9NA 4KH6A 1FTCA 3RJMB 4DTNA 2XMWA 1HMVB 2EWHA 4RU9A 4K8XA 3H59A 4I69A 4MKAA 2UVVA 4H03B 3VESA 5LL6d 3E66A 4LFBK 2FJEB 2I0XA 2PI4A 3LALA 3Q8SB 3MR7A 5D3GB 2IM1A 4DSEA 3L95X 1J6ZA 1U2VB 3I0RA 2GIFA 3DGPA 1OO0B 4JN4A 2O67A 1NK5A 4E0DA 1MA9B 3H90A 1BY9A 4IJAA 1APSA 4CIFA 3BZKA 3LDNA 4MK9A 3UE2A 1TMJA 3MPWA 3DLKB 1KBRA 4LF9F 2J0QD 5TKYA 3LGHA 2DGXA 3AJ1A 3M32A 1JMTA 2OLWA 5IQQA 1BWEA 5HROB 1N56A 1HD0A 3W64A 2EFGA 4CZKA 3VQ4A 5KFAA 1FX4A 1HQUA 2IM3A 1J27A 2JDJA 4LT6A 4BRAA 5E3QA 5AQRA 4HCCA 2AD9A 4OGCA 1S79A 5CABA 4DLGA 5M1QA 1MSWD 3O9QA 3P49B 3T1HF 4WTOB 3KHYA 3VQPA 4ECYA 2E5LK 4LF2A 5HMWA 4NCBA 2PO4A 4CZMA 1IV0A 1I94F 4KHMA 3OYMA 1NDPA 2B8PA 1W2BR 2YX7A 3QFWA 1R7IA 4Y3CA 1BISA 5KRSA 4MKBA 4IG0A 3AVKA 2E1AA 1CJUB 3R9LA 3AFGA 4URSA 4XH4A 4CLFA 1NGIA 1TK0A 4C1NK 2O8EB 5J1NA 3MX2A 3IS9A 1YHQN 5CA5A 4JKAA 3JSMA 4K4WA 3ETOA 2QMWA 5F2RA 1XIQA 2H5JB 2M88A 3DRXA 4FZVA 4GRSA 3G6XA 2WCXA 1CSJA 4P6QA 4KT0C 1WAFA 4BBYA 1Z26A 4IO1A 3LPUA 1VLOA 1C0UA 3QGIA 1B0TA 4FLYA 1DLOA 3SPZA 4R8UB 2BQUA 2M0GB 1GK8A 4K2XA 1NDCA 2KM8B 5F8JA 2VQFJ 3NF9A 1MU2B 3DRPB 4BG9A 1CJKB 4NYFA 4DCJB 2E1CA 4FCYA 3B6BA 3GU0A 1G99A 4LMZA 4CJWA 4DPYA 4DV5J 2M8DB 4WU2A 3IWNC 3PUFA 2VUGA 4I67A 1K73T 4UOGA 5HP1A 1FKAF 4LF5K 4NI2A 1XR6A 2O8BA 5CXTA 5KOXA 4K25A 1GMVA 3F9KA 1ATSA 3QBWA 3UDVA 3P38A 4HVJA 3J7YU 4USWA 2CJKA 1TL5A 4BR0A 1RAHB 3KK1B 3VTHA 3ZETA 2GIRA 5ITHA 3I4HX 3RB0A 3J7YI 3CIZA 2ATLA 2XI2A 1X4GA 2PZSA 1DTQA 1DZ5A 2UUCF 3KWMA 2O8FA 3AGKA 3GCWP 2AA4A 3FBEA 3UD5A 5IXUA 1ITPA 2UXDJ 3MM5B 4PWUA 1J9AA 1NCLA 4G3IA 2F4VF 1RB0A 5K8PA 1ZBFA 1OVYA 1CS4A 3GJQB 3UCGA 2W4CA 2X6SA 4K4VA 3PV8A 1BWVA 2MJUA 5JVGL 1HL6A 5AQJA 3T5HA 2WUSA 2HYIB 2CDRB 4QIWD 1Z6RA 1RHRB 4DR3J 4DPOA 3QIPB 2DRDA 1XTZA 1KN6A 2DISA 3LP2A 2HOEA 3NGIA 2BDPA 1S6QA 5F0XA 1ZC6A 4WU3A 2LEBA 5CYMB 4CEDA 4JI0F 1TKDA 4QWEA 5TKWA 4QW9A 2J6SA 4A5AA 5KFOA 3HD2A 3CCVN 3GFZA 4O44A 4DUZK 2KL8A 4I9LA 2CH5A 4JI6K 3ENQA 1FJGF 1R0BG 4X65J 1NMDA 3N6NA 3IR6B 4FJHA 4U67Q 1QE1B 4PYDA 4OKKA 4BGBA 1CZ9A 2UXBJ 1NK8A 4CJFA 5A0YB 3QDKA 1TKXA 4OJ3A 4X62F 4H0XB 4Y0WA 4CTAB 1IBKJ 4BRKA 1OYEA 4J2DA 2MQ8A 3CHWA 2JRSA 4HT5A 1UJ4A 4Y6IA 4ZPDA 4HHUA 2VFTA 2F8EX 3JXUA 1N6QA 2I38A 1IUJA 4WXWA 3VF4A 3EY1A 2J6UA 2DGUA 1NKEA 4BRMA 3X1LB 5C15A 4RR5A 1WKJA 1WBDA 2HBQB 4UUWA 5HQLA 1SJRA 3V4MA 3UWTA 2HG4A 1RAOA 3WXLA 2J5AA 1R3NA 3HSTB 2V4QA 2QFJA 3IM9A 1HNXJ 8AT1B 3ILLA 4F4YA 5IS2A 2MPUA 4CO3A 1O13A 2Z2MA 2Z1GA 3TZXA 4QR1A 3RGIA 4DV4J 4HUEA 3MN7A 5AE2A 1I39A 3NEKA 1S1TB 3I8BA 4H4MB 1KQFB 2PAVA 2Z0GA 2J9CA 1LV5A 1RTDB 2QI2A 1EIYB 1H2UX 1BG3A 4PA1A 4DV1K 3MM7B 4ETZA 2HHHK 2HK2A 4H4KA 4LBIA 3MMAA 2KZZA 1NSAA 3KZBA 4DU4A 3GJTB 5ETRA 2FLOA 3SQ2A 3BB5A 5EY4A 2MY7A 3NG8A 4F3MA 1EQYA 4AHUA 4NLCA 1RT7A 4NLWA 4B17A 1LK7A 2D0BA 4EO8A 1B3TA 4CGIA 3D0PA 2DFEA 3E01B 2EKYA 3QRRA 4G9ZA 2B4PA 2XMMA 4E1JA 1RXOB 3QT8A 1EZZB 3Q86A 3GP9A 3HCXA 1CQNA 1M5HA 1VFJA 4EI2A 3LAKA 3KUEA 2IJFA 3BR9A 3EUNA 1BIUA 3L7OA 4O3OA 5LOQA 4F26A 3TVZA 1HNIA 2LXUA 3H2UB 4B3TF 4CZJA 2CQCA 5AQZA 3AODA 4TN2A 1S7HA 3L4BC 2P9KB 5D0EA 1HQ2A 4K8RA 2AHOB 3KLFB 3D28A 3UE5A 4HTJA 3AA2A 2XZWA 3VVUA 2F9WA 1WWHA 3J81j 2HK3A 4ETXA 2YTCA 5GVQA 4NA1A 4V19S 2QWOA 3MK6A 3SUQA 5GAEU 4CJKA 4B9VA 3GR1A 4B9QA 2AJQA 2ZDPA 1BUPA 4CLWA 3TUPA 1DAXA 1RDDA 2IGIA 4K2JA 3UD4P 4W4MA 3BY5A 4H0YB 3TARA 1K47A 3CD0A 4LR7A 4Y2CA 1WSEA 1AXQA 2GELA 2WVDA 4B1ZA 3THXA 3K5LA 3ZEUB 3R1LA 1A6LA 3CVKA 3B6OA 4BE0A 2CGLA 2R8GA 2H5EA 4YFUA 2VODA 2B7CB 4JKGB 4J9PA 1K1QA 4RUHA 3OTEA 3C0BA 2DNZA 1HR0K 3GV5B 3GYNA 1SC1B 4CF9A 1HKAA 5HVGA 1CULA 3S7RA 5CHIA 3R5DA 3Q8PB 1RT2B 2P6SA 2V94A 3I56S 2A42A 3H6EA 2M7SA 4IOCQ 4GMJB 4JS4A 3CJKB 1ZA1B 3CJBA 2JGUA 4B3OA 4QU7A 4GKKK 4FWMA 5GADU 2B4VA 4IEIA 3UW1A 3A12A 1VQ5S 1QZ5A 4ER8A 1QHAA 3OR1B 2VPWB 3N4QA 3OUYA 3A13A 1BO5O 3JTOA 3A5MC 4O3PA 3UCUP 3TQEA 4AHRA 2O01C 4P2MA 2VG7B 2F1FA 4KIAA 2IVYA 4F04B 1YIJS 2MHNA 2F5GA 4O4RA 1GOCA 1RT4B 1JLFA 2MKHA 4L6V3 1CZAN 4F0KA 3KHRA 4F3QA 4JYAJ 2WBNA 4DR2J 3H8YA 5F8HA 1HWKA 1XR7A 4U7UK 2UUAJ 2XYHB 4DPTA 4DV6K 1JLCB 4FZZA 1FWPA 3CSKA 1XR5A 2F96A 3Q2SC 1X4DA 1EKRA 5IV4A 1JJ2R 2E1PA 2B4UA 5KI6A 3VQEA 1CJTB 1TGOA 3D7EO 1ATNA 1H7WA 4G1QB 1BE4A 4OYZA 2M3DA 1RT1B 2NSBA 3HF5A 2F40A 2JEIA 3DU6A 1WSJA 1FD2A 1XNQJ 1N0UA 4YY3J 2QMXA 5BREA 3F56A 4DR6F 2G2OA 5IT0A 1U1MA 1HNZF 4CWBA 1RHUB 4DLEA 3CMQA 1HRHA 2VFVA 2XQCA 1HJOA 1WG1A 3CCLN 5C0YA 4ZPWR 2OJ3A 4H4OA 3UKRB 4DFMA 3TWHA 1RJJA 2FQQB 3CCQS 1NRKA 4J5OA 4NYZA 2YBVA 3G8TA 5CYQA 3MDFA 3F73A 4ECRA 3CO9A 3HHDA 3EE3A 2JWKA 1ZOTA 2QLXA 1N33K 2K1RA 5HRPA 3CPWM 4C8ZA 1S6OA 2IJRA 2B43A 1F0XA 4OVLA 1R89A 2IA0A 4KAIA 3NCIA 4L75A 1NGAA 2CQBA 2HGLA 2L9NA 2MZRA 3LDSA 5IM0A 5M1KA 3QICA 2H4YB 2IVPA 5AZJA 3CETA 1IKWB 2JVOA 2EFVA 3VQ8A 2D41A 3OJSA 2IBKA 2HF4A 3UN3A 2KHDA 3KG1A 4EP5A 4USVA 4DBQA 5K5MA 5KT7A 3BP8A 1S6PA 2DD8S 2R7UA 1UETA 5AXKA 2EVZA 1MMDA 4JV5K 3NH2A 3KG0A 5I9EB 2HBRB 2W8LA 4Q8EA 2ZH9A 3ZSWA 5T14A 1U1QA 1NXIA 1SZ2A 4CZFA 1HJRA 2PFFB 1IG9A 4C11A 2P9IB 4E3SA 5C25B 1LWXA 2YX4A 1RYRA 5H9EK 1IG8A 3O5BA 2YY3A 2A2CA 2AJ2A 1N48A 4BC5A 1YSJA 4NYPA 3UO0A 4E8UA 3RVCA 4PXBA 2PT0A 3DLEB 1LW2B 4OHVA 4DV0K 4G1PA 5AXMA 1LNQA 3ASMA 1DRZA 3QLHB 2RDJA 3KLHB 4E19A 3KHLA 2CAJA 1KLMB 1NGGA 1S9EB 1CEZA 2JSXA 4JKEA 1JXVA 2CXEA 3MMJA 3LGMA 4IFVA 1X0FA 1Q81O 4F3OA 1SS6A 2ERRA 1CLFA 3OL9A 3FZBA 2MZ1A 2DVIA 3ET6B 3B8AX 2BW7A 1UVJA 2OSRA 1XBWA 1X3MA 5AQKA 3QNOA 3SXLA 4YP3A 4DTUA 4CIOA 1FESA 3D3CJ 2AV5A 5DRKA 3VAGA 4CI6A 1TU0B 3PO4A 2CZVC 5KGXA 2M5YA 1RT6A 3CJ1A 4FBUA 3VQBA 4ZIVA 1QVGM 3CJ3A 2HHQA 5FPDA 3O1WA 1VQMN 3MM6B 3V6JA 3D9BA 4YHHK 2KYXA 2VPZB 2WTFA 1HBUA 1RTHA 2E5HA 3TWZA 5A8WB 1Y5IB 5L8RC 3ZSVA 3WX8A 3IP0A 3R6MA 2YWFA 2OTLN 1V5IB 1FD8A 2LEPA 3K2YA 4BG8A 4FM1A 3VETA 5BN9A 2U2FA 1K0TA 3FZFA 2ZHAA 1OY9A 2UXCJ 3DOLA 2WSFC 1WSGA 5JLHA 2UUBF 5D6GA 1L3SA 2W2PP 3MMCA 3MN9A 3AA8A 5CD4H 1P90A 4I6WA 4FS1A 5KFDA 2NNWA 3DOKA 4WXOA 1SC3B 4LRCA 4EWTA 1JJHA 1Z1ZA 1GOAA 4FW2A 1FXDA 3PJWA 4RW6B 4M3UA 3LPEA 1ASWA 3MCAB 2QYGA 5FLXU 5LMUK 1YZ6A 4FLXA 1HNWF 1WSRA 1X60A 5K8OA 2IA6A 1VQNS 1UL3A 1IJFB 3SV3A 4M5NA 3SMZA 1XMOK 2G8WA 2FSNA 3NP5A 2XRIA 3CTRA 3PSIA 4IO9Q 4UOCA 1YBAA 1OQ6A 1VHFA 2GWJA 4HACA 3CM5A 1ILYA 2PA3A 2LDIA 3QT6A 1CXQA 4DG1B 3BGRB 3WBZA 4LR8A 3QESA 5J2MA 5MAOA 4CEZA 4LSZB 3ISZA 5LMNF 2RAQA 3QYYA 2YPYA 5K14B 3M05A 4BRCA 2JFKA 3FKBA 5HMZA 1XHZA 4B9TA 4G1IA 1IWAA 1TUUA 5D15A 4DTRA 3C16A 5BYQA 2HQ3A 2VGNA 3QATA 1C1CB 4NLRA 1ZPWX 4EUVA 1T7PA 8RUCA 1YI2S 3GE1A 4CIGA 1RAEB 2YQ3A 1GLAG 3G25A 5I3UA 4NO7A 4BR4A 2D3OR 2MSTA 2DR6A 2A18A 3C8YA 2IVOA 3IR5B 3LP1A 2B3TB 2XHWA 3KJVB 1FKPB 4O55A 4DUZF 2BRLA 4JI6F 3I5AA 2BANA 1NGCA 4S0MA 2IAJA 3EXYA 4FW1A 4WFAQ 1RYSA 3LANA 2GS8A 3MXJA 2W42A 5GIOA 1U1RA 2DEJA 3R9PA 1TL3B 3CJRA 1GT8A 3A5NC 2RQMA 4I2PB 1PC4A 1AFJA 3N5FA 2JFDA 2P5OA 4CEOA 4CLSA 4BRHA 4OZNA 2YNHB 5AQVA 1N32J 1SKSA 2HFUA 4EP4A 4AQYK 4NRTA 4H5TA 2D4WA 3CM6A 4IDHA 2BM1A 4ISFA 2WSCC 3RZAA 2WHOA 1HHTP 3C15A 3DXMA 4GVBB 4CGJA 4QYRA 3PDNA 3NNHA 3QRPA 4ECQA 1NHUA 1BIZA 1JX4A 3P3DA 3H5YA 2YHYA 2Q36A 2QGFB 2GGPB 4QW8A 3T5KA 3LWLA 2RRBA 2VZ9A 2J0WA 1U0HB 4IZ9A 2BABA 5DDOC 1BD6A 1NSPA 2NRWA 2F9JA 4IRDA 2KZMA 3MUTP 2E2QA 2JNJA 1HMVA 5KT6A 1FFGB 3F5TA 5AQUA 1MN7A 1Q81T 1VSKA 3NWRA 4B3SK 4NYNA 1UAXA 1M5PC 3P6YC 4HI1A 2O4IA 3H08A 3L0QA 3ZCMA 2LQ5A 4KSEB 5FDLB 3TEGA 3ZZZA 3CC2N 2AZ1A 2HHHF 3OYIA 3BEXA 1DTTB 1EP4B 5D3GA 1VISA 2CQ2A 5K9FA 4RW4B 3IGVA 1SIZA 2ZH3A 4N77A 3GIMA 1JXLA 3K58A 1Q82O 3ZZPA 2CPHA 1WUAA 1NOYA 3ULHA 3A8EA 3OXLA 4NLYA 2WVBA 2OPRB 1FDDA 3WXKA 1NJXA 4X2BA 4O5FA 1GTEA 5BPNA 2CQGA 3VQTA 2CQHA 1D09B 3P1GA 4O3NA 2FVPA 3AVJA 4GKJK 3TZYA 5BPLA 3DLKA 1OPIA 4YORA 1YKWA 2V0NA 3PHTA 1Y00A 3PIOQ 4CGDA 3L9ZA