1JLQA

Crystal structure of hiv-1 reverse transcriptase in complex with 739w94
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
540
structure length
533
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2-Amino-6-arylsulfonylbenzonitriles as non-nucleoside reverse transcriptase inhibitors of HIV-1.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 140
structure length 533
sequence length 540
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlqA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlqA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlqA05
3ZSQA 1Z4UA 3H5XA 1FKPB 4WZQA 2FC0A 4ECYA 1HMVB 4PWDA 3BJYA 5J2NA 5KG0A 1L3UA 2WOMA 4WXOA 4XIUA 4RW9A 4HKQA 3NBPB 5KFAA 3H2LA 3DLEB 1JL1A 1RYSA 2XY6A 4CJFA 1JLQA 4JRPA 3ICLA 4K8XA 4FJGA 4ED3A 4AHVA 4J9QA 3AVFA 2GIQA 1SH2A 3QGIA 3RMAA 4CK2A 3SQ4A 5KFIA 3ZSOA 4FBUA 1WAJA 3D5MA 1W0HA 3DRPA 1WAFA 2D3ZA 3PV8A 3HP6A 4CE9A 3SI6A 3NGYA 2AX1A 3CJ5A 3RAQA 4RW9B 3D0PA 2Z1IA 1VRTA 3F73A 4IFVB 2ILZA 4JV2A 1TL1A 4ECUA 5K14B 4YP3A 4IFYB 3IGVA 5I3UB 3KK2A 2VA2A 4EP5A 3DLHA 2YNHA 4I2PA 4FCYA 3QEWA 2XGQA 1CXUA 3NH2A 2AGPA 2PY5A 1RA7A 2WHOA 4FLZA 1ZETA 1N6QA 3H4DA 2FBXA 1VSMA 4M42A 4EBCA 1QTMA 3D28A 2BQUA 1S10A 4Y3CA 3MEEB 3VQEA 3MR6A 5DG9A 4WYWA 5KFCA 2R8GA 2E9RX 2ILYA 4NLWA 3N6LA 2JLEA 3L2RA 3I0RB 2YNFA 4IDKB 2V4RA 3TABA 4F4YA 2D5RA 4PQUB 1R0AB 3DI6B 1HQUA 1EETB 2GC8A 1RYRA 2LSNA 2KZZA 1TP7A 5DLFA 1HYSB 3M9MB 4K4TA 1YTUA 3QNNA 4DL3A 4KI4A 2Y1JA 4RW6A 3H59A 4IRKA 3HPOA 3ZT3A 1JLGB 3ZT1A 4Y1DA 3DLKA 1C0UB 4DTNA 4HYKA 4DTSA 3PO4A 4ECXA 4I7FA 3BDPA 5CYQB 4NLVA 2P5GA 4EO6A 4JV1A 1S4FA 1HQUB 3AA3A 1SUQA 3AVKA 2W42A 4F2RA 1ZTWA 3I5AA 4F3OA 1LV5A 3KLIA 3PVXA 4CCHA 3M8PB 4DFPA 2UVRA 4FJ9A 4JV0A 3V6HA 3BSCA 1JLEA 4KO0B 4MKBA 1WSEA 1RDRA 1RT6B 3ALYA 3VA0A 4W5TA 3QERA 3FQKA 4KTZA 3QZ8A 2RDJA 1MMLA 4NYZA 4ELUA 2XO7A 4TXSA 4BWJA 1JXBA 1LAWA 4BE1A 3RBDA 3V1QA 1T3NA 1RBRA 3PJWA 2F8TA 1JL2A 4O3OA 1KFSA 1K1SA 1GX5A 4ZMMA 3MEGA 1HQEA 3QO9A 3VQBA 1JLEB 5KRSA 3IRXA 2J6TA 3OVNA 2O5DA 1CSJA 4DQQA 1SV5B 3GIKA 1TKTA 1T05A 4ZPAA 4C8NA 1EETA 1RT5B 5KG6A 4KFBB 1W9HA 3AVLA 2ATQA 4KPYA 1C1AA 1Z26A 4GVMA 1HARA 4KHMA 3CQ8A 2R8IA 1KSPA 1QE1A 4KHUA 4ZTFA 4H54A 3DLKB 2E6LA 4CGFA 3OJUA 1D0EA 4ZVHA 2C28A 1BHLA 1TL1B 3V6DA 1EP4A 1IG9A 1SH0A 4URQU 3SZ2A 4CEFA 3SYZA 1DTTA 4KV8A 2HW3A 5KFGA 4E7JA 4OLAA 3VQ7A 3QGGA 3NKYA 1L3SA 3CFOA 2RPIA 4N76A 3KLGB 2UVUA 3MEDA 3V6KA 4QWBA 2YNGA 2D0AA 3OSPA 3KLEA 1QE1B 1T8EA 4B9SA 4E7IA 4CGHA 4DMNA 1XHXA 5F8LA 1WNEA 1S9GB 2HNYA 4ECSA 1LW0B 2V4QA 5HRRA 5L1JA 3SQ0A 2DTUA 4JS4A 4Q5VA 1UOCA 3RR7A 4XPEA 3PX0A 3PW4A 3HVWA 5KFTA 1TKZA 4CJPA 4LD0A 1LW0A 2AX0A 5K14A 4EBDA 1U4BA 3AO4A 3OY9A 4QWDA 4FLVA 3MEGB 1S1WA 3KKRA 5T14A 3K57A 4F2SA 4O44B 3AVBA 3UPFA 4DL2A 3AA2A 1TKXB 1S1VB 4MIBA 4O3PA 2QKKA 5EWGA 2RF2B 1XI1A 3V4IB 3AA5X 4J2AA 1BQMB 4LSNB 2FVCA 3CDWA 4WYLA 4CECA 4CHOA 3TWHA 5HRPA 2IBKA 1WSFA 3ZSVA 3NAHA 3PO5A 4TQRA 4IRCA 2BE2A 4FVMA 4GC7A 4CHNA 1FKPA 1U09A 4DFMA 4BDYA 1DLOB 3RRHA 1D9DA 4CF8A 2BRLA 4ED8A 4M3RA 2BQ3A 1T94A 2RN2A 3IS9B 4C8MA 1FKOB 4B9UA 4CJ5A 3MEDB 1C1BA 2YNIA 4DL6A 3PR5B 3V9WA 3EPIA 3KHGA 1IKWB 3EYZA 3CDEA 4RNMA 3AVHA 1DTTB 4KV8B 1ZYQA 1S9EA 1HYSA 4N47A 4H8KA 2VG5A 4Z4IA 3QEVA 2KW4A 2BRKA 4J2BA 3C6UA 3PX6A 4DSLA 4MK9A 1ZBFA 1RDCA 4KB0A 4OVLA 2YKNA 3LP1B 4Z4CA 1IKYA 4I2QA 2VWKA 4M94A 3Q8RB 5KFBA 3KHHA 1S1XB 3CM6A 3V4IA 3PHEA 3BQ0A 5DG7A 4AH9A 4HUFA 3JYTA 5I42B 3M9NB 2HB5A 3NAEA 3I0RA 1RT4A 1HPZB 3FDSA 3KD5E 4DL5A 4R0EA 4E7HA 2EC0A 5CYMB 3OJSA 2WB4A 2ATLA 1LWCA 1ZBIA 4J9MA 2FLLA 4OKJA 3DI6A 3ULDA 4KB7A 3QEIA 1TK8A 4DQIA 2PYJA 2HNDB 2WCXA 2DY4A 4DLGA 1D9FA 4KRFA 1NOZA 4FJLA 1HPZA 3MECA 3KK2B 2HMIA 1IKWA 3KK1B 2GUIA 2R2UA 1S6PB 4CJ4A 5KT7A 4ELTA 2KZMA 2JEFA 1ZBUA 5KI6A 3LZJA 3KLIB 2G8WA 1KTQA 4FJ7A 2G8FA 2D3UA 1GOCA 3G10A 4Z4FA 4ZP8A 1K1QA 3MECB 4ECRA 4EZ9A 3TAPA 4ECQA 4CEOA 4KKOA 4FS1A 1ZBLA 4H4OA 3VQ6A 3NF9A 4U7CA 4M3TA 2DFHA 3CWJA 2E9TA 4M3YA 4O3NA 5EU7A 4I2QB 4MK8A 3OS0A 3ZSZA 4CIFA 4NZ0A 1C1CB 3VN5A 4GMJB 1RT1A 4WFXA 4IBNA 3PJXA 4CEEA 3NGZA 3K5LA 2P51A 3RBEA 2B5JB 3MXMA 4QWAA 1W25A 3NE6A 5J2PA 5L1IA 4NLDA 4RW8B 3MR2A 4TY9A 3WNHA 4CERA 2G8KA 1U49A 2G8VA 4H4MB 4FXDA 2HHSA 1ZBHA 3KK3A 3CDUA 4BE0A 2C2EA 5EWFA 3M9OB 1NK4A 1IH7A 2OZMA 3H4BA 3K2PA 3NGDA 4KAZA 3SV4A 3DLEA 3KMSA 5J2PB 3ZT2A 5SZTA 5KT6A 3M8QB 3OYHA 3ITHA 4NLYA 1VSJA 4F4WA 3DLBA 3M8RA 4KI6A 1A5XA 4NRUA 1J54A 1SKRA 4OPKA 2X6NA 4CK3A 3T5LA 4IKAA 4YFUA 4PUOB 5HROA 2YHBA 4FK0A 3IAYA 4B08A 2HHWA 1SUQB 4AHRA 4O4GB 1IKVA 1JLAB 4CGGA 3VQQA 4FLYA 2C2DA 3WNFA 1BI4B 2FJWA 2HNZB 4QOZB 4CHYA 4CEAA 1TGOA 2G8UA 2FLPA 2OPPB 4YR3A 3QYYA 2W9CB 3HJFA 3DRPB 1X1PA 3H5UA 3KLGA 5HRNA 4LQ3A 2VG6B 2O4GA 3QLHB 4HCCA 3Q8SB 4O0JA 4CJKA 3DOLB 5C42B 3FSIA 2QK9A 3PW5A 4G1QA 2AQ4A 5HBMA 3NH0A 4G3IA 1K6YA 4ECWA 1A5WA 2ZD1A 1IO2A 4CF1A 3V81B 4DTUA 2A1SA 3EY1A 2VG7A 4ED0A 1HNIB 1RT6A 4FJ8A 4DL7A 3QEPA 4R5PA 1S5JA 1S6QA 2DFEA 4KREA 3HVTA 3OYLA 4EBEA 4J9PA 3OYIA 3AVMA 3OYNA 1BQMA 3NH1A 3SFUA 2Y1IA 4NCAA 5KG1A 4R5PB 4M3UA 2YHAA 3G6YA 1EX4A 4M41A 5SWMA 1SL0A 2OPQA 2QXFA 4DTXA 1EKEA 3NF7A 5KG3A 3V9SA 4W5RA 1D5AA 3V6DB 4WXWA 4O0IA 2XHBA 5KFNA 3BGRA 3SV3A 3OLAA 3DYAA 2XY5A 3EZ5A 4LSLB 2FVQA 3T3FA 4J9KA 5DQIA 1X9SA 1QSSA 4K4WA 3LP0B 4MQ3A 5F8JA 3NGIA 4J2EA 4M3ZA 2C22A 1SV5A 1TV6A 4C8OA 4K50A 3T5HA 3SCXA 1RT7B 4HTUA 1RT3B 1IM4A 1S97A 1SH3A 4QPXA 3H08A 3M8PA 3VQSA 4CJSA 3CO9A 4K4VA 3K5NA 4DU1A 2X78A 1D1UA 3DRRA 4O3QA 4M3WA 1VSLA 4RNOA 2Z1HA 2HHVA 1X9WA 4EYHB 3T5KA 1G15A 5F8HA 5KG2A 3V1RA 1JLQB 2VWJA 1IKYB 2I5JA 3GYNA 2BGGA 2R2SA 4NCGB 1NKEA 1J5OB 3ZSXA 1KVAA 1REVA 3N6MA 2YNFB 4IH5A 1A5VA 1FXXA 1LW2B 3ZSYA 4B8AB 1TAQA 5I3UA 3L3VA 2YNGB 1RDDA 2AGOA 1ASUA 4K4SA 4DG1B 4DFKA 4M95A 3VA3A 4H4OB 3TAMA 3DMJA 3OYFA 4YR0A 1Z25A 1HNVA 4ID5A 1NK5A 3HPHA 1TVRA 4CJ3A 4FLTA 2A1RA 2R2TA 2JGUA 4TSXA 1YVUA 5JS1A 2FLNA 4FBTA 2B43A 1JLAA 4DU3A 2OPSB 2YNIB 4KTWA 1C0TA 1RDAA 4I9LA 4LSLA 4KE5A 4QW8A 1RTHA 1KHVA 1RILA 3O4QA 3NHGA 3BSNA 1Q8IA 1WN7A 4DLEA 4FM0A 2OPSA 2FBYA 4CJUA 1WSJA 2IM1A 1F21A 3U3YA 3G6VA 3SUPA 3RB6A 3KLVA 4CFAA 4FM2A 2WOMB 2W7PA 3DOLA 4Y2CA 1KLNA 3HK2A 2XWYA 3CJ0A 3O3HA 1CLQA 1NK0A 4DFJA 4DQRA 3QESA 5DK5A 4CF9A 3C95A 1VSKA 4IFVA 1I6JA 5KGWA 3OYBA 2XI2A 2ASJA 2VA3A 3VQ9A 3SI8A 3KIOA 4YMEA 2OH2A 3MXJA 1J5OA 1BQNB 3U6FA 1TKZB 2HVHA 4WZMA 4LH5A 3P83D 2WONB 2VG7B 4Q0BB 1C0UA 3V1OA 4KSEB 4CHPA 3A2FA 3BQ2A 3BSOA 4O3RA 4E7KA 4ED7A 2JEIA 3KMQA 4KTQA 3ZCMA 3DRSB 3KLFA 1NK7A 2E4LA 2HHXA 5KFLA 4O3SA 1WNSA 2GBZA 1TK0A 2FBVA 2XCAA 4DS5A 1RTJA 1HJRA 3FQLA 2KFNA 5FRNA 4CK1A 4ZVEA 2IMWP 5HLFB 4ZHRA 3HKWA 4IKFA 1JXLA 3OLBA 5L1KA 5KFEA 4Z0UA 4YQWA 1QSYA 3KK3B 5KFVA 2XCPA 3FFIB 5KTQA 4DSJA 3MFHA 4FM1A 2R7YA 3AA4A 2BE2B 2D0CA 2FVPA 3SUOA 4E1MA 1GX6A 4JLHA 5DGBA 4ZVGA 4PQUA 4TYBA 1DTQB 2ZKUA 4DSFA 4B8CA 2F8SA 2HVIA 5KFZA 4HUGA 4NYNA 5KFMA 3IN5A 4R8UA 3DRRB 5JS2A 3FFIA 5KFWA 5DQHA 2PYLA 3RMCA 2W9CA 1HYVA 1KVBA 2YKMB 4KAIA 4CIEA 2W9BB 3G0ZA 4RW8A 3T19A 2IAJB 3OHBA 2WONA 4Q0BA 4CEBA 4FJKA 4H4MA 1CZBA 3TAMB 1VSFA 3JSMB 2RKIB 1ZTTA 3CFPA 3OL7A 1NHUA 3OS1A 3ZSRA 3SJJA 1CXQA 4WFYA 3SPZA 3AVAA 4NLOA 3ASMA 4CEQA 4DQSA 4DSEA 4KHNA 4TN2A 2GIRA 4URSA 3GILA 1S0NA 4IQXA 1N5YA 3OHAA 3M8QA 3RMBA 4CHQA 2PZSA 3QEXA 3IG1B 3RTVA 4RW7A 4ICLA 1WLJA 1RTIB 4O55A 2O4IA 1VRUB 3IGNA 4Y34A 4Z4GA 3S9HA 4DTMA 4MH8A 4KHSA 1J9AA 5HLFA 1LAVA 3AO3A 4YR2A 3NF8A 1C1BB 4K8ZA 3DYAB 5HP1A 1O1WA 5KFSA 1LWFA 1RBVA 1YVFA 1N48A 1J53A 5KFHA 2IJFA 3LDSA 2V9WA 3OYCA 4DQPA 4CFCA 3OYEA 1UWBA 1S48A 1Y97A 1NOYA 3PW0A 4QWEA 3THVA 4TLRA 2E6MA 1OS5A 3Q8PB 2ZE2B 2ITGA 5HRSA 4CJLA 2IM2A 3RWUA 3CJ2A 4EP4A 4FLWA 1NJXA 3OL6A 4K4XA 4FS2A 1TQLA 2VG5B 4RNNA 4IDKA 4OLBA 5E41A 2FVSA 5KT4A 3KOAA 1U47A 4M3XA 4CGIA 1RCHA 1S1XA 5T7BA 4TY8B 3S3NA 3I0SA 2ALZA 2I5JB 4IRDA 3HT3A 3BR9A 5KT3A 3G86A 1LWEA 1XC9A 2ZE2A 2HHTA 1DLOA 2KFZA 1TAUA 2OZSA 3GV5B 3I0SB 4ECZA 4FLUA 4AILC 2ASDA 5FDLB 1TKDA 3HL8A 4CHZA 4B9VA 2KQ2A 2BANA 1CZ9A 5J2QB 4OL8A 2XC9A 1QAJA 1NK9A 4CJTA 3KTQA 1VSHA 4DWIA 1TL3A 4NLSA 1RDBA 5J2QA 1C0TB 3CIZA 3QETA 3MXIA 4K4ZA 4ICLB 3DLRA 2AU0A 3S3MA 3OL9A 3NFAA 2Q3SA 4BDZA 3VQCA 3QGHA 4ECTA 4JRQA 3QZ7A 4E1NA 3CFRA 4RNFA 4FW2A 1VSDA 1NHVA 3LPTA 1R0AA 2V0NA 4Q8FA 1BCOA 1RTHB 3DLGB 4NLGA 4KHRA 3O4NA 3VQ5A 3H5YA 4NLUA 3QIPB 2X6SA 3LP2B 2AGQA 3T1AA 5KT2A 4J9OA 2OPQB 3TARA 2IAJA 3RAXA 4ECVA 1U04A 4EZ6A 2XGPA 2E9ZA 3LPUA 2HWHA 5CYQA 2IA6A 4DTOA 4FJ5A 2R8JA 1BISA 4IH7A 1YT3A 3KHLA 5J2MA 4F4XA 4B3OA 5EUHA 3H5SA 1KFDA 5C5JA 4DSIA 3LP1A 1S1TA 3PZPA 4O5BA 5CY4A 4Y1CA 5FDLA 2IM0A 3V81A 4CF0A 2J6SA 1NK6A 2ZD1B 2W7OA 5KFRA 3SUNA 2R2RA 4LSNA 3LZIA 5C25A 4C8LA 3UR0A 4QWCA 5HP1B 1NNDA 4ED6A 4FLXA 1MU2A 5C42A 4FZZA 3F9KA 1BIZA 1C0MA 2D41A 4E89A 1IKXB 3CJ4A 4Q45A 3IRXB 1S49A 2WK4A 1T7PA 1UAXA 5KFXA 1TK5A 1JLCB 4EEYA 1RT2A 3NAIA 1S9GA 3V9UA 1NJWA 3SUQA 1T05B 3PX4A 4F3TA 2FJXA 1LWFB 2IM3A 4NCGA 3QO9B 4KBIA 1RBTA 4O4GA 4K4YA 3V6JA 1WSHA 1TL3B 3C6TB 3DM2B 1I39A 3RRGA 3P1GA 5J2NB 3MFIA 1SL2A 3PW7A 1LW2A 3MF5A 2WRMA 1JLGA 1DTQA 4TY8A 3E01B 4CJEA 4IG3A 2G8IA 4JUZA 3NDKA 1HYZA 4MK7A 4RW4A 3BGRB 3VQAA 4DL4A 4WE1B 1KHWA 3Q8QB 3LWMA 1HMVA 2W9AA 5KFJA 1RT3A 3ITHB 2HNZA 2W8KA 3AVGA 2OYQA 4HUEA 5KRTA 5L1LA 1S1UB 3OSNA 4EYIB 1HRHA 3LANA 5J1EB 3TR8A 3KK1A 4B3OB 4DF8A 3TANA 1S1UA 2RKIA 1SL1A 1VK0A 3E51A 1JXEA 1FK9A 4O4RA 4MIAA 2GV9A 3L3UA 2AWZA 4ZP7A 1KLMB 1QAIA 3JYTB 1Q9XA 1GOBA 4OKEA 1BL3A 4GC6A 2QKBA 4FK4A 4CGDA 3HXMA 4CFBA 3NL0A 2IC3A 2UUWA 1KCFA 1I3AA 3QLHA 4AHUA 1RT1B 1SKWA 3LAKA 4F8RA 4YNQA 4CF2A 2UUTA 4J9LA 1S0MA 4RW7B 1NKBA 1WSIA 3OYDA 2F8EX 4I9QA 1BIUA 1VRUA 1TVRB 1N4LA 3CYMA 1BQNA 3HVRA 3LP0A 1RT2B 3SQ1A 1JLBB 3O3GA 3DMJB 3CVKA 4G1QB 3UIQA 4Q8EA 4FZYA 2BQRA 1HQEB 4RU9A 2WTFA 2XY7A 5KG4A 2UVVA 3DLGA 4BACA 3QIOA 3ISNC 4ZVFA 2X74A 5FROA 1C2PA 1VRTB 2JC0A 4OGEA 3BSAA 4MFBA 1S1TB 5I42A 3SFGA 3E01A 1B92A 3OYJA 1C1CA 3ISND 3MR5A 3L2VA 3AO2A 4NCBA 4CJVA 3HYFA 3TVKA 2W8LA 5HROB 3KKSA 2NUBA 2B6AA 4IH6A 3IS9A 3D45A 5F8MA 3QIDA 1KLMA 5F8GA 3LP2A 3P5JA 2P1JA 4DU4A 3PY8A 1BI4A 4CJWA 4B9LA 4Y2AA 3L2UA 1L3VA 4B9MA 4LH4A 2B6AB 5F9NA 3RB4A 4RNHA 3HPGA 3N6NA 4F4KA 2QV6A 5DG8A 4CESA 5DMRA 3DRSA 4IR1A 1IKXA 3CJ3A 3NF6A 2JEGA 3PUFA 4JS5A 1LWEB 3RB0A 4FJMA 1S6PA 2BANB 4IG0A 3KLHB 1EXQA 3JSMA 3LWLA 1XR7A 4UQGA 3AV9A 3HO1A 2P5OA 2OPRA 1RTJB 3V9XA 3TAGA 1JKHA 1JLFB 3UQSA 3MAQA 3SNNA 4E19A 3OYGA 2HNYB 4FJXA 4W5QA 3DDKA 1TKTB 2JC1A 3GQCA 4FZXC 3C6TA 3DM2A 2B4JA 2YV0X 3HVTB 4CEZA 3TQ1A 2XI3A 2DPIA 1XWLA 1QQCA 2FBTA 3AO1A 4CFDA 3LAMA 5C24A 1ASWA 4W5OA 3NBPA 2OPRB 4CJRA 3OYMA 4K4UA 4KFBA 1RT5A 3AVJA 3HHKA 1YTAA 3H40A 4CJQA 1U45A 5CZ2A 4C8KA 3NCIA 3RMDA 3I5CA 2G8HA 3OYAA 4LQ9A 5KFPA 4PWDB 1Q9YA 4X2BA 4XO0A 5EDWA 5D3GA 3MR3A 4OJRA 1UWBB 4ZTJA 4WFZA 3GIMA 3KJVB 3UDLA 4DTJA 3ZSWA 3K5OA 2W9BA 1VSEA 2HHUA 3FRZA 5KG5A 4FJIA 4KKOB 5JUMA 4AHTA 1C6VA 3SQ2A 3RB3A 4NLXA 2RDIA 2AJQA 1QS4A 3QNOA 3TAFA 1IKVB 4MKAA 5F9LA 1RBUA 2YKMA 1S0OA 4EO8A 4OPJA 2HWIA 3ZT0A 4TQSA 4ZPBA 4WE1A 5KG7A 4HCBA 2YNHB 4I2PB 3KLFB 4QCLA 4M45A 5L9XA 2BDPA 3GV8B 2Z1JA 1MU2B 2IS3A 4ED1A 4BDPA 4NLRA 3K58A 5KFQA 3WNEA 1KRPA 1N5YB 3KHRA 3WNGA 5KFFA 3PW2A 2XRIA 4TYAA 1KVCA 4DEZA 1TKXA 5HBMB 1HNVB 4ID5B 3S3OA 3AVIA 2DPJA 1SKSA 3HVAA 3GIJA 4FJJA 3M8SA 3EZUA 5KFYA 3IG1A 1JLCA 4ID1A 5CZ1A 4FK2A 1D8YA 4FYDA 2ZQBA 2YKNB 3MEEA 1TV6B 2IGIA 2RF2A 3L2QA 3VQ4A 4HVJA 1ASVA 3OS2A 3LALA 3U3GA 4RZRA 4IG3B 2J6UA 2QE5A 3HM9A 2F96A 4ZPCA 5C24B 5DQGA 5FRMA 1S6QB 4PUOA 3ZT4A 2CKWA 1NJYA 3L2WA 4KB1A 1BCMA 2D7SA 3H98A 1T03B 3HSTB 1XHZA 3V9ZA 1RAJA 1RTDA 3PR4A 1S9EB 1FK9B 1N56A 3DOKA 3BQ1A 1RNHA 4NLQA 1XR6A 3O3FA 4W5NA 3KJVA 1GOAA 2VG6A 4DTPA 5DLGA 1B9DA 3CG7A 3LP3A 4ZP9A 5J1EA 5KT5A 4DTRA 4URGA 1RTDB 3QINA 1UA0A 4IG0B 1RTIA 3KLHA 5F8IA 4OGCA 4RG8A 2D0BA 2FJVA 4Z4EA 3QIPA 1N6QB 4Z4HA 4N56A 3OYKA 4NLPA 3VQDA 1BGXT 4KHWA 3KNAA 1S9FA 1JX4A 1S1VA 2IC3B 4CEDA 1QUVA 4Q44A 4PA1A 3B6OA 1QSLA 1JIHA 3AVNA 3BREA 2EHGA 3HP9A 4FJHA 5KFOA 1HNIA 4RUCA 3B6PA 4ZPDA 1RT4B 3TAEA 4LY7A 4QW9A 4RW6B 4E3SA 4XPCA 4ED2A 3TAQA 4Q43A 1RBSA 1L3TA 1RA6A 4RUAA 2R8KA 1L5UA 4DG1A 4U6PA 1U48A 4J9RA 4B9NA 4FW1A 3MTKA 2ASLA 3TI0A 4RW4B 1ITGA 1QHTA 1XR5A 5KFKA 1NKCA 3OL8A 4ELVA 3C94A 2CJQA 2FVRA 2HNDA 4L8RB 4MFBB 4IR9A 2OPPA 3AVCA 4B9TA 2IJNA 1LWCB 4AHSA 1X9MA 3C6UB 5KGXA 5EWEA 4FJNA 2HAIA 2OA8A 4N41A 4NRTA 4F50A 1EP4B 2Z1GA 4N5SA 3RR8A 4IOBA 5J2MB 3KLEB 4NLTA 1VSIA 4E7LA 4KHQA 4NYFA 5D3GB 1RT7A 4QAGA 1WSGA 3K59A 3VQPA 1FKOA 3DOKB 4ZP6A 4J9SA 4KHYA 3T5JA 2IDOA 1UA1A 3AO5A 4J2DA 5C25B 4CIGA 3G6XA 4J9NA 2UVWA 2B5JA 3KD1E 2R8HA 2DFFA 4HHTA 4I7FB 3EPGA 1NJZA 3SPYA 1S1WB 3GV7B 4KO0A 4IFYA 5CYMA 4DSKA 5KFUA 4AHCA 4GW6A 4CGJA 1NK8A 2BR0A 3VQ8A 1REVB 5JXSA 2JEJA 4E0DA 3NMAA 2XY8A 1JLBA 2I1RA 4BE2A 3GIIA 4F4ZA 4DS4A 1B9FA 3I5BA 2EX3A 2ETJA 1JLFA 1JKHB 4OKKA 2KTQA 4PY5A 4O44A 1T03A 2HHQA 4BWMA 4DF4A 2HMIB 5KFDA 2C2RA 3K5MA 3L8BA 3I8DA 2IOCA 3CM5A 4R8UB 5F8NA 5DGAA 4ZHRB
chains in the Genus database with same CATH superfamily
3ENVA 1YRTA 1VQPN 4JI7F 5M2UA 2I0XA 4HHUA 3H5XA 4WZQA 2FC0A 1HMVB 2CQHA 3QBCA 3PHTA 5J2NA 1L3UA 4WXOA 4XIUA 2CJKA 3ILOA 4RWTA 4F04B 3CQYA 3E9OA 3D0IE 1JLQA 4K8XA 4FJGA 2E1CA 2E5IA 4PYDA 5ETRA 4AUKA 4CK2A 1S7HA 4FBUA 3D5MA 3O8MA 3K0SA 1W0HA 1T3VA 1WAFA 3HP6A 2UUAF 2PFDA 2AX1A 2EBGA 5A8WB 3BDEA 1R89A 1TL1A 3IGVA 2VA2A 5EGYA 4FCYA 4IFEA 2XGQA 4CI0B 2IMOA 1DGKN 5E84A 4FP9A 1QTMA 3GIRA 2YVSA 4Y3CA 4LREA 3CW2C 5DG9A 4OX8A 5KFCA 3OTEA 4F3MA 4NLWA 3N6LA 1CPZA 3FEXB 3SXLA 4F02A 2D5RA 4PQUB 3BYPA 1O5JA 1M5HA 2KZZA 3M4XA 1TP7A 1V4TA 1S57A 4JEPA 4HI1A 1YTUA 4FF4A 4KI4A 1X5PA 4YEAA 3H59A 4OYOA 3Q0AA 4AXIA 2V8GA 1JLGB 2E2OA 3ZT1A 4Y1DA 2LEPA 1C0UB 4DTSA 4USJC 3EZWA 1UEUA 2KVQE 4Y00A 3CD6S 1TELA 2XG8A 1HI0P 3IKMA 4JV1A 4QIWD 1KP6A 3DLJA 1S59A 3J80O 3FE1A 4F3OA 3KLIA 1WI6A 4NYPA 3PVXA 4JK8A 4FJ9A 2HZVA 1JLEA 1N5TA 2XS5A 2HF4A 2W41A 3MPVA 4WTOB 3VA0A 4W5TA 3QERA 1RBOB 4QR1A 4C1NI 3LUYA 4OJ1A 3V1QA 1RBRA 3PJWA 1IVZA 4DBQA 1ZM4A 4BG8A 4CI6A 1IJJA 4XK8C 2AEFA 1NEEA 1HQEA 5KRSA 1CJTA 1CSJA 3PDNA 2KVIA 1NXIA 3GIKA 4IJNA 1T05A 2LECA 4R79A 4P75A 5T7LB 3R6LB 4C8NA 2KLAA 1RT5B 5KG6A 2GQ2A 1UVLA 4KFBB 1A0OB 2MQNA 2CZ4A 1Z26A 2RHKA 4OIXA 3CQ8A 3VGTA 4KHUA 1VQMS 4BRPA 4ZVHA 1X4EA 2WW4A 4CBUA 1EZZB 1BHLA 3D6HB 2DEJA 1CQNA 1WOSA 1N36K 4L75A 1DTTA 4KV8A 3UFCX 2VUGA 3J8AA 4CQ1A 4OYIA 3TQEA 1L3SA 2RPIA 3KLGB 3QBWA 3V6KA 3P8BB 1QE1B 3QWPA 4A4JA 4E7IA 3AOCA 2UYTA 5F8LA 2E88A 2XTJP 1HUXA 2DHGA 2DTUA 4Q5VA 1UOCA 3BN4A 3MX2A 1VQPS 1BWFO 1TKZA 1Q81O 4LD0A 1GXUA 2NRRA 4A8SA 5K14A 4EBDA 3AO4A 3OY9A 4IOCQ 1F5BA 2GWJA 2C2OB 3VF0B 3FZMA 3KKRA 4JKDA 4F2SA 6FDRA 4DR6K 4O44B 4F67A 3KG4A 1Y5IB 3AVBA 3UPFA 3TEGA 5AQLA 4ED4A 4MIBA 3P4UB 2GQQA 3V4IB 4DZDA 2F63A 3FUYA 3SQOP 3G9CA 1FD2A 3TTFA 4DV2K 4CECA 1CS4A 4IO9Q 5HRPA 2HURA 2IBKA 1WSFA 3VZHA 4JD2B 1E6VA 4CO2A 2MKKA 4IRCA 3FR0A 1U6FA 3EGZA 1NHKL 4WFBQ 4H03B 1FKPA 1U09A 4C3KA 1DLOB 3RRHA 4M3RA 1H72C 2YWGA 4FWQA 3WEEB 1T94A 4MKVA 1S12A 1FKOB 4YHHF 4B9UA 3MURP 1DY3A 3N5FA 1YJTA 1GH8A 4DX8H 3KHGA 4RNMA 4J9UE 2FSKA 1BMQB 1S9EA 2HQGA 4H8KA 3VZIA 3PLAA 2BRKA 3PX6A 4DSLA 1ZBFA 1CJVB 2V4JB 4KB0A 2GX8A 1FHTA 2DNNA 2POKA 2PI5A 3OTCA 2HZCA 1RB0A 3I4PA 1ZPWX 3MM5B 1NGIA 2NRXA 3BP8A 2HB5A 1VR6A 1DEJA 4C8ZA 1HPZB 2YWEA 1CULB 2VQFJ 3EVWA 4PHTX 1ZZFA 2ZF5O 2MB0B 4EWTA 5AZIA 3AA8A 3FCHA 1RHKB 1UFWA 1U1KA 3DI6A 4OKJA 4DQIA 4DLGA 3BKTA 4FJLA 1HPZA 4X66J 2XZWA 3MECA 5CCMA 4JI2J 2R2UA 2VYPA 4DR1J 4S0MA 3WQTA 4ELTA 2ZH8A 3D2FB 2ZDOA 5HVFA 5HMZA 3H3OB 2C1EB 2CJAA 2IYGA 1KTQA 2G8FA 2D3UA 2L9NA 1GOCA 4Z4FA 4ZP8A 1FE4A 1HKCA 4LF9F 3JSYA 4ECQA 4CEOA 4KKOA 2D3OR 2U2FA 4K42A 5G0RB 3OA9A 1SI9A 3IP0A 4WTYA 3OS0A 4CIFA 3GFYA 1VQOS 1U1PA 4PKGA 4IBNA 3NGZA 1LQ9A 3DXSX 5BN8A 3DXKB 4DR6F 1W25A 2MSTA 2F9WA 3J81Y 5HO4A 4OX9J 5E3QA 2NCKL 3MR2A 3J80Y 3M30A 1ZBHA 3TSUA 3WIVA 2XSFA 2OFHX 4V1Ak 2NPIA 1GLCG 3PYEA 4HH0A 5D15A 2UXBJ 1CBKA 4PABA 3M9OB 1NK4A 1IH7A 3THWA 2W40A 2HHPA 2NSCA 4NO7A 3AJ1A 3DLEA 5IWAF 3ATVA 4NLYA 1HR0F 3QFHA 2GIFA 3K5PA 2JNJA 3M8RA 1A5XA 3MN5A 1J54A 1R43A 1SKRA 3A5LC 2Q79A 3ET6B 1W2BR 2XNQA 4IKAA 5HROA 2V4JA 4FK0A 1XTZA 1SUQB 2M5YA 3HHDA 1TFYA 1GK8A 1T9XA 4OHWA 2C2DA 2FJWA 2HNZB 4CLYA 4H5RA 5AQVA 4DCHA 4CEAA 3TX0A 5B0DA 3HJFA 1X1PA 4F9OA 3H5UA 1UETA 2VG6B 4C11A 3H1QA 4CJKA 3AB2B 4YY3K 3PEHA 2QK9A 3O44A 5HBMA 4BRNA 3POTA 3QRPA 1K6YA 4FZVA 3GJQB 3V81B 1V3RA 4X65F 2XNRA 2VG7A 4ED0A 1HNIB 3SMSA 4DL7A 1TYQA 4DR2J 2BXJA 3A5MC 4R5PA 1S6QA 2PE8A 3MM9B 4PCQA 4X84A 3FJ2A 5GAHP 4E1JA 1FXLA 4NA3A 2Y1IA 4NCAA 2MEWA 1WORA 3TVYA 5KG1A 7AT1B 2DITA 4R5PB 3G6YA 1EX4A 2XLIA 2QXFA 1MW7A 1EKEA 3NF7A 1CJKB 4PL8A 3V9SA 3HOTA 5L9NA 4HDHA 4WXWA 4O0IA 3OLAA 4ZCLA 2XY5A 4CNYA 3EZ5A 1ZZNA 4EMDA 3W65A 3LGHA 1FESA 2B9WA 1Y9OA 1S4EA 1FW6A 3LP0B 2DBBA 3WIUA 3TA1A 3BYRA 4DPXA 4A8XA 1Q0NA 3M8ZA 3NRBA 3TZZA 5IM0B 3H08A 4OYBA 2CPDA 2X78A 1EWRA 1RWNB 5D4NA 5F8HA 1G15A 2EWSA 3BY5A 2KH9A 2QEXS 2I5JA 2YBVA 4QR0A 2QJ3A 3BH7B 1REVA 2E5JA 1S6OA 2UXCF 4C0HA 4A8YA 1B3TA 4B8AB 1GTEA 2YPZA 2YNGB 3I96A 3T1HF 1J6ZA 3CCVS 3OFEA 4DFKA 3RZAA 3VA3A 2OGUA 1GNKA 3DMJA 3OYFA 1MROB 4D3HA 4ID5A 5T7LA 4CT9A 1JJ2R 3P4IA 4LRDA 4TSXA 1YVUA 5HMXA 2FLNA 2Z2MA 8RUCA 1RDAA 1EJ7L 4NMXA 4YOVA 1KHVA 3O4QA 1N34F 3QBXA 2GMJA 1VS3A 1Q8IA 3C16A 1WN7A 2QI2A 4D3GA 1M5PC 4CJUA 1F21A 3KLVA 1WHXA 4CFAA 3WXLA 2WOMB 4DR1K 1YQHA 4F0MA 9ATCB 2HLTA 3Q8VA 2HQIA 4WIIA 3E1YA 1N8RO 1NK0A 5E3RA 1X9JA 5DK5A 2QEXN 3GR1A 5E3PA 1TZ0A 3PSIA 1I6JA 3N5BA 4JB8B 3GG0A 3KYLA 3VQ9A 2J7KA 4BRLA 3SI8A 1Y64A 2RQ4A 2OH2A 1KVJA 4JV5F 4CO3A 3K8VA 2HVHA 2PT0A 2WONB 4Q0BB 3VETA 1C0UA 3M05A 5K20B 3OUYA 2FJEB 2VB6A 4O3RA 4ED7A 2MJUA 5GMEA 5ETMA 5D6GA 1NK7A 1FEEA 2E4LA 2YX7A 1VQ6S 1T6DA 4BR7A 5GAGI 1BQXA 2IBOA 4JI4F 2HBMA 3OR2A 2XCAA 4DS5A 2GHPA 3FQLA 3RU0A 1TL4A 1QQNA 4RTFD 5FRNA 3BPSP 5HLFB 3O9SA 2QSWA 1ROFA 4GKJK 3FFIB 4FM1A 1KQSM 3AA4A 4EI2A 2D0CA 2FVPA 3DOMB 1DJ0A 1FDDA 1PC5A 4GKKJ 2JSXA 1GX6A 4JLHA 2MKIA 5DGBA 1FFSB 1IBKJ 4LF4K 4U7BA 1DTQB 2ZKUA 3WXJA 5KFZA 4UOGA 1P27B 3FSYA 3A3NB 4HUGA 1Y10A 4NYNA 4KGXB 3G6EN 5JS2A 3FFIA 4HEA9 3BBFA 4ZIWA 1U1NA 3ID8A 4AE5A 4B3SK 1FERA 2M7SA 4A8QA 1NNEA 1NMNA 1CQMA 4YY3F 1RAIB 2FDNA 4ITSA 3KHYA 1Q82O 3OHBA 1JK9B 5GADI 4H4MA 3TAMB 3FGUA 1KQFB 1U2VA 2APOA 1ZTTA 1FRIA 3TA2A 3OS1A 1NHUA 5LJ5Y 2K1RA 4USHA 4WFYA 3PKYA 2LEBA 2B4PA 3TJ9A 4KHNA 2GIRA 3HRGA 3OHAA 3M8QA 1XMOJ 4CHQA 4RX6A 3QEXA 4BRGA 1FVSA 4M7XA 4K2JA 1VQLS 1RTIB 4O55A 3CCEN 2O4IA 1SZ2A 3MCMA 3R5BA 3IC1A 5HLFA 3QGPA 4BLGA 1XMQK 3TPQA 3OBWA 4WFAQ 5HP1A 3HFVA 2QWLA 3ULEA 3PCOB 1J53A 5KFHA 2LQ8A 2O8CB 2IJFA 2AIRB 3VTIA 4Q7AA 4CFCA 3OYEA 1UWBA 3MMJA 1NOYA 4JHDB 3GU0A 3CCLN 1PJ6A 4QWEA 3Q8PB 4PL7A 3T6BA 2VHGA 3LA0A 3RWUA 2HS4A 1NGAA 1NJXA 3K0JA 2XM3A 4CNZA 2J9EA 5HANA 1SBRA 3P45B 4IDKA 1DQ9A 1BG3A 3KOAA 1KAZA 1KQKA 3HD2A 4M3XA 2OHDA 2RQCA 4OYPA 2CRLA 2W25A 3R8EA 4ZN1A 1RISA 4WFAL 4HL9A 1XQIA 2HGMA 3FEZA 2W6KA 4M7YA 1DLOA 2KFZA 1TAUA 1O0PA 4UUWA 2P2CB 1TKDA 3BF1A 1EARA 2GAHC 3CC2S 4RWXA 3VEXA 5I3QA 3CETA 2KQ2A 2BANA 1OY9A 4B3RF 1CZ9A 5J2QB 1WC6A 4UQTA 2J0WA 2VKZG 4BC4A 1QTNB 3EDRB 3LH2S 5DRKA 5AQUA 1Q5YA 1C0TB 3E66A 4KPCA 4MIWA 3TA0A 1HNZK 4KT0C 1U1RA 4CBWA 2E44A 1VQON 4BDZA 3S41A 5BR9A 3QZ7A 4RNFA 2AD9A 3T1YK 4LMZA 1MA9B 2JOQA 1ESVA 2V94A 4Q8FA 2KRRA 1BCOA 2YJEA 2DH9A 3OTOF 3W2VA 2KG0A 3L09A 3J81U 4JHDA 2X6SA 3LP2B 2VPZB 5H1SV 2IAJA 2IY5B 5ELZA 3AJDA 1GLDG 2VOPA 2R8JA 1BISA 4IH7A 2ZJPQ 3J7YI 3R1LA 3KHLA 1C0GA 3EDQB 3GSDA 4DUZF 1EX8A 3AB4B 3WUHA 3QQCD 3GPAA 1WC1A 3LP1A 4FNIA 1RP5A 4I6MB 3IMQJ 2F7VA 3N4WA 5KFRA 3OBYA 3LZIA 4I69A 2JVOA 1XBWA 3CJ1A 3D3BJ 1BIZA 4WFBL 5DDQC 4E89A 1IKXB 1T44A 3LPYA 3CJ4A 4CBXA 2K1RB 1RHJB 1KAXA 1TK5A 2NRZA 3NAIA 4I6AA 2XSJA 1T05B 1UL3A 1LWFB 2QGFB 4AQYK 1GLEG 1LWXA 3G71N 4ANCA 4A8FA 2O3DA 4KBIA 2Z2YB 3ILLA 4LF2A 3Q2SC 1SL2A 2D69A 4B3TF 4CJEA 2HVZA 1QDUB 1O51A 4IOCL 2LEAA 4DL4A 4WE1B 3OD2A 3W8PA 2W8KA 1URRA 3CNQP 4B3SJ 5KRTA 5L1LA 4FWMA 4BRAA 3GCXP 2O8BA 1HRHA 3LANA 2FGOA 4CW7B 4LSZB 4L74A 3LGMA 4DU8A 4FXVA 3RW6A 3TANA 1SL1A 2RKIA 2DVIA 3A3PB 4GRSA 1HBUA 4ZP7A 3WC2A 3JYTB 4DCJB 1Q1KA 1YJ9N 1RWWB 2MQLA 4E2FB 1DT9A 4OKEA 3MMCB 3H0PA 1F3VA 2XHWA 2BZ2A 5U47A 4BC2A 5M1FA 4H5NA 1LOUA 4A48A 2WVEA 3LL3A 1RT1B 1RAHB 1SJ3P 2DNHA 2MKSA 4CF2A 2UUTA 4YNQA 1CJTB 1BIUA 1WJ9A 1W2BM 2ZH6A 1VRUA 1N4LA 1C0FA 4UY85 3BF3A 2B9YA 2HRYA 2DNYA 1Z2ZA 3KDOA 2ZH9A 3MUVP 3UIQA 4HLBA 4DHVA 4FZYA 5CHCB 2BQRA 3M2RA 1F9EB 4B3MK 1YRXA 4ZVSB 4YS2A 1VLYA 1KEKA 4ZVFA 2KL8A 2VJUA 1E4GT 1H0HB 2ZH3A 1C2PA 1SKUB 3R2DJ 4ES2A 3OFFA 4CT8A 2OKQA 1E4FT 4H0VB 4DR7K 3CCUN 3ISND 3MR5A 2P9LA 3ZZUA 4OX9K 4CLSA 2W8LA 5HROB 4CO4A 2E1PA 1RU2A 3T6JA 5HL7L 1DQ8A 4IH6A 1JWWA 3D45A 3QIDA 1D09B 4DI6A 3LP2A 2N7CA 4DV3F 1H6KX 1BI4A 2R7TA 4B9LA 2BYCA 1YLXA 2IVNA 5F9NA 5BR8F 2JH3A 2LXFA 5BREA 2RQKA 4BQLA 2Q2RA 2E7VA 1Q4RA 3VCDA 5JICA 4IOAQ 1H7XA 4IR1A 1IKXA 4JS5A 1WSRA 4OI3A 4FJMA 1S6PA 1UVNA 2G13A 3QRQA 4CDIA 2MYFA 1CJUB 3HO1A 1K8KB 1YAGA 4DR4J 2OPRA 3S6EA 1WBDA 1RTJB 3R1XA 1HNWK 3SCKE 3IAM9 1JLFB 1NG9A 2GWKA 2CZ9A 2HNYB 4FJXA 4F4AA 2OAUA 3ZNJ1 1TKTB 3DM2A 2QLXA 4C0BA 2YV0X 1A6LA 4CEZA 1NSQA 1IBLJ 5DM6L 1XWLA 5LJWA 3UVJA 3AO1A 1G6BA 3HSJA 1SAZA 1FJCA 3SDEB 1X3MA 1DURA 4K25A 3R9LA 1H73A 5AXNA 4RPFA 1YTAA 1VQ5N 1U45A 2XYHB 3FFKB 5CZ2A 4C8KA 3NCIA 4H0OA 3RMDA 1WHYA 2OMOA 2LCWA 4Z7YA 2QA4S 4LQ9A 5KFPA 4PWDB 4OX6A 4GVEA 4X2BA 4XO0A 2BJ3A 5EDWA 5D3GA 5DJBA 3HULA 2JL9A 3TW0A 5I4MA 4DTJA 2W9BA 1RWUA 2P9GA 3FRZA 2YI1A 5AQJA 2UP1A 1L3KA 1C6VA 4AHTA 3SBGA 4JI3K 2DR5A 2ZM6F 1UVMA 1OMSA 1IKVB 2JWKA 5F9LA 4JI5F 4TU8A 3ZT0A 3R2CJ 1K0TA 3M2VB 2YX1A 4HCBA 2YNHB 4I2PB 4CYUB 2CJ9A 3O4WA 3KLFB 5A76A 2NYHA 4QCLA 4M45A 5L9XA 2BDPA 2I8EA 3FC9A 1SCJB 4BDPA 2FF6A 2EFVA 2VOOA 3K58A 1KRPA 1FRLA 2VJVA 3GJSB 1UKUA 1IBMK 1RWOB 3UE2A 4LIRA 1DARA 2L3MA 4NXMK 2O8DA 5HBMB 2ABYA 3EVMA 1FDNA 2MGZB 4PWUA 3S3OA 4AQYJ 2HWTA 4C11B 2HBRB 3P6YC 5ADZA 3GCWP 2DKOB 1IUJA 1OQ6A 3MEEA 1AA1B 2P5VA 3L2QA 2E1YA 3VQ4A 3DXBA 3K7RA 3LALA 2W24A 3CCSN 3R7SB 4J8FA 4IG3B 3C8YA 3D6FB 1I51B 4CZLA 2QE5A 1S99A 2WFBA 4ZPCA 5C24B 5DQGA 4FVCA 2CQCA 1T9UA 1XNRJ 1NJYA 3DLLQ 3L2WA 1UAWA 2MQMA 3W2WB 3AD9C 5F41A 2EG2A 3HSTB 3ZTOA 5FPEA 1XHZA 3V9ZA 2LVWA 1RI7A 3EGWB 4LRCA 2BTFA 1FK9B 4DR5K 3DOKA 3BQ1A 1MNEA 3VGKA 2M3DA 2A40A 1YG0A 3R1HA 3JSRA 2HGNA 4ED5A 1BY9A 1RTDB 4BRDA 1UA0A 2QWRA 3KLHA 1RTIA 2X3GA 5F8IA 3CC4S 3TJ8A 3MD1A 2QIFA 3N01A 4Z4EA 1R6YA 1N88A 4HWIA 4Z4HA 5CH7B 4FF2A 3VQDA 1BGXT 4LF5F 1S9FA 1XNQK 3T41A 2Q6CA 4B1UB 1X4CA 2IC3B 1T3OA 4F36A 4CEDA 1QUVA 1QSLA 2HOEA 3HP9A 3HZEA 1NJIT 4Z37A 3B6PA 4ZPDA 4GVLA 2G2YA 4QW9A 3NS5A 4RW6B 5AQWA 4U67Q 3MMBA 3IBFB 2BV3A 4C48A 4YOEA 3W61A 1U48A 2QL5B 1VQ7S 4J9RA 2AYMA 4B9NA 4PRFA 4FW1A 1RAEB 3MTKA 1P1TA 2VGMA 3I82A 4KYZA 1O6XA 2FVRA 2Z2ZA 2XMAA 3CMAS 2OPPA 1JB0C 3WC0A 3BV8A 4UOCA 2BM1A 2JHEA 1VHIA 4B9TA 4X66K 3W3SA 1GLJO 3BBCA 1FX4A 4DX5A 4FJNA 4P52A 2XQCA 3THWB 1B4SA 3DCAA 1X4GA 2RE2A 3RR8A 4IOBA 1VAZA 2UUBF 2J9DA 4KHQA 2I7PA 2XS7A 3QAUA 3ZX0A 2EG1A 3ULHA 1U8SA 4HTLA 4JI7K 4KHYA 2HFOA 1CC7A 3AO5A 3CMQA 3LDQA 2LMIA 3W9IA 2OEJA 4OYZA 1G7CB 2UVWA 1HHSA 3W5ZA 1TL5A 3WZ0A 2DFFA 5IV4A 4HHTA 1NJZA 4DR4K 4IO1A 5HQMA 3VGVA 4GW6A 4CGJA 2JEJA 4JI8F 4BE2A 3AD8C 1B9FA 2V2KA 3AXMA 1N32J 1IBLK 5EOYA 3MHYA 4O44A 3LGNA 2KU7A 2HMIB 2C2RA 5BN9A 1NGJA 3MK6A 4R8UB 4ZHRB 1HNZF 4OZLA 2B7CB 3CCES 3G87A 2FYXA 1F9FA 4DZ6A 3JS6A 3MM7B 4BGAA 2WOMA 3NBPB 4HH1A 3H2LA 1RYSA 2CZVC 3DLLL 2AEMA 4OLPA 2NPFA 3ICLA 3CERA 3W9HA 4K5SA 4J9QA 1AUDA 3AVFA 2EKNA 3EUNA 3TX8A 1SH2A 1FE0A 3RMAA 1CULA 2DGXA 3SQ4A 1K73O 3ENBA 1WWHA 3ZSOA 1WAJA 4CZJA 3DRPA 4LBIA 2D3ZA 4CTAA 4EAHD 3RAQA 4RW9B 2Z1IA 2ILZA 1TUWA 3OBIA 2CQ4A 3POTB 4ECUA 1OJ4A 1PYSB 2QLFB 4X4PA 3KK2A 2FY8A 2FC9A 4JKEA 2YNHA 4I2PA 4CYUA 4DV0J 1I3OB 1RA7A 4NXMJ 4FLZA 3UD3P 1IJFB 3CD5A 4WKRA 3SAFA 4KGVB 1OH7A 1VSMA 4EBCA 1FX2A 2BQUA 3QT5A 3S8SA 2AYEA 3MEEB 3MR6A 5LMNF 1X4DA 2QN6B 5A8KB 3CCUS 2E9RX 2ILYA 4DHYA 3OTDA 2JLEA 1JMTA 4LR9A 2BW2A 3L2RA 3I0RB 2YNFA 3CC2N 2EWHA 1YWXA 3Q23A 3MR7A 4Q2LA 1HQUA 1BO5O 3M6XA 1EETB 2LSNA 2VU5A 1XNRK 1HYSB 2G2ZA 4MMOA 3M9MB 3J7AN 2BMBA 4K4TA 5IC6B 2A6MA 4DN0A 4DL3A 5C0YA 4RW6A 1PYOB 5C15A 4IRKA 1N36F 3ZT3A 4DTNA 4HYKA 3PO4A 4JKGB 2C2NA 4I7FA 1ZXOA 3ETOA 4NLVA 5LMUK 5F0WA 4EO6A 4L3KA 3B8AX 4ILJA 4QYZK 2DR6A 1SUQA 5FIIA 2RDDA 3VESA 4C97A 4FOEA 5JVHL 2UVRA 1B7YB 3H42A 1WSEA 3LM9A 2XULA 1UMJA 3QT8A 1N5QA 1Y3KA 3MWBA 1MMLA 1S7IA 2XO7A 3KUEA 4CH1A 3Q86A 1JXBA 1LAWA 1QVGR 4MLHA 3RSEB 2ZBRA 2NUHA 1LXNA 2F8TA 1PAEX 4B02A 2DGQA 1YIJN 3MEGA 4I68A 3W62A 4H0XB 3QO9A 3W63A 3VQBA 3ZTRA 3THPA 1JLEB 5KPRA 1N5VA 2RH3A 2G0IA 3OVNA 5B08A 2DRDA 4YOWA 3X1LB 1AZSA 4PG5A 4LFCK 5F1XA 1TKTA 4AFFA 2R7WA 3MXHP 2Q1NA 3EM1A 5CYJA 2UV8A 4ZN3A 4X4UA 4DJBA 3L3CA 1TUYA 5H9EJ 2R8IA 1KSPA 4DV6F 4ZTFA 3E3XA 1BD6A 1YZ7A 1D0EA 1O8BA 3R6MA 3UE5A 4M5IA 4URQU 3B82A 4LUBA 4EFAC 3EMTA 3SYZA 3HM8A 3CMES 4ANEA 2R7VA 4GVBA 5KFGA 3HSCA 3QGGA 3RUBL 2RILA 3CFOA 4XEIA 4DV5J 4USTA 3BB5A 2D0AA 3OSPA 3KLEA 3MCSA 2IDLA 1QVFM 1T8EA 1XHXA 1WNEA 2HNYA 4ECSA 1LW0B 4JS4A 3KNGA 3C7NB 3QJLA 3M2VA 2HQDA 4DUTA 3RR7A 2YQ0A 4Y65A 4BR9A 4FNHA 2OSRA 3THXB 1LW0A 4G9ZA 3K9KA 2AX0A 4ZPTR 2ZGZA 1U4BA 1U8WA 2IIRA 4QWDA 4WKYA 5T14A 3MDQA 4NB4A 3U4LA 3DGPA 3AA2A 1TKXB 4ETZA 4QPTA 1S1VB 2GQCA 2QKKA 1P6TA 1XI1A 2R4FA 4EU0A 4J2AA 4LSNB 4NXNJ 1HKBA 3G71S 4CHOA 3IM8A 2VFUA 2EFOA 2FB0A 3TWHA 1S3XA 3MWTA 1QZ5A 3PSFA 3ZSVA 1SJ1A 3BGUA 4USVA 4ZVOB 2YH1A 3TTCA 3A8IA 3U8XA 4PG6A 2BE2A 2X1AA 4FSVA 4BVPA 2PMZD 4GC7A 1KVKA 1FWLA 2NZ4A 2H3GX 4V19X 4CF8A 4ED8A 2ZWPA 4ZVQB 2WAQD 2BQ3A 3D6TB 5BYSA 3IR7B 4C8MA 3CJQA 3KKFA 2UXCK 2J8AA 4K59A 4H0YB 3MEDB 2YNIA 1Z6RA 2P9IB 1JJ4A 3V9WA 4BVOA 3W60A 2V8VA 2IVMA 4NYOA 1APSA 4MTPA 2NXUA 4N47A 4Z4IA 1HW9A 4P7TA 2MZ1A 1ZC6A 2UXDK 1RWXB 1EQMA 1FDBA 3IM9A 4GKJF 1ATSA 1R31A 1YJ9S 2KT3A 1RDCA 2IRYA 2YKNA 5AJ3K 3LP1B 2VWKA 3ZNUA 2KO1A 3GJRB 2WBRA 2HIYA 3VEYA 3OQ2A 5KFBA 1RBAA 1U1MA 1UW4A 3C46A 3L4QA 1RCOB 1IR1A 3RRKA 4UT4A 3HKZD 1W97L 4HUFA 3JYTA 1FRHA 1NSPA 3M9NB 2B3TB 3NAEA 2AHOB 4BRQA 3AQOA 5AQGA 3KD5E 3IWXA 5HVHA 4JYAK 4DL5A 2NUUG 5CYMB 3UDEA 2X1GA 3OJSA 5AQPA 2E1AA 4JN4A 2WB4A 1QD1A 2ATLA 4FWKA 4J9MA 3NGKA 2NZCA 3ULDA 4DX7A 4ALZA 3QEIA 4PZVA 3HD1A 5LSOA 2WCXA 4X64F 4WU2A 3DRXA 5CAAA 1WKKA 5LMUJ 1NOZA 4K41A 2P9KB 3O9TA 5C12A 6AT1B 1HNWJ 4QIEA 3SQGA 3VAKA 4QS7A 3S7RA 3BR8A 1F60B 3ZTPA 1BDGA 4CD3A 2NQPA 5KI6A 4YDDB 3G10A 3FZKA 1K1QA 2DXEA 1MWMA 1S72S 2KG1A 2KB2A 4ECRA 1V5IB 1VQ5S 2VQFK 5HOOA 3VQ6A 2UXBK 4GV9A 2QA4N 2E9TA 4M3YA 1F2GA 2VWBA 1AW0A 4JI3F 2E5LF 4GMJB 3FSXA 2QFJA 2GNKA 3PJXA 3R8YA 5KQ8A 2EFGA 4J5OA 1D4XA 3K5LA 4YDUC 2P51A 5TKYA 3RBEA 1H2TZ 2CWXA 4IUFA 2B5JB 2QLJB 3MXMA 1ZAXA 4X62F 4NEZA 5J2PA 3FZFA 4H0PA 4DCOB 3M32B 1ZH5A 3BGLA 4RW8B 3GE9A 1WG1A 5ETPA 2HHSA 5A6PA 3KK3A 4LFCJ 1YF5L 4U96A 2DHAA 5IFMA 3BZKA 5AQMA 1O13A 4YDUA 5IWAK 2Z8QA 5EWFA 1U02A 2NLWA 4X4QA 4PG8A 1LFPA 4CVNE 3NS6A 4CZMA 2OZMA 3I55S 1VHFA 3H4BA 4UW2A 3CJRA 4KAZA 4P2XA 3KVGA 3I55N 3KMSA 5J2PB 3ZT2A 5D4OA 1PYTA 1PIEA 1B64A 1OPZA 4F4WA 1HNXK 3EICA 2O8EB 3HHLC 3FCWA 3L6QA 2P9PB 2I38A 5E5NA 3UWTA 2YHBA 3IAYA 4KJIA 4AHRA 1T9WA 1IKVA 3QB0A 3SAHA 1JLAB 3BEGB 1K73T 3VQQA 4FLYA 3SJHA 3GB0A 4QOZB 3VPZA 3U7JA 1TGOA 3VWSA 2RU9A 3DRPB 1V9OA 4I6MA 3L7OA 2AZ1A 3NS7B 5CZXA 3HMJG 2O4GA 4H0TB 2DNGA 3R5JB 3Q8SB 4HCCA 4NZ6A 2F3JA 5C42B 3AGKA 3MDFA 3PW5A 4M63A 4OHXA 2AQ4A 4U8YA 2D3O1 4DV7K 1A5WA 1IO2A 4CF1A 4HACA 2CGKA 3MAHA 2OTLN 1KNZA 1XERA 1WD6A 2FSNA 3QEPA 1NGEA 1EAYC 2CPHA 4MJKA 1Q78A 4A57A 3OYLA 4J9PA 3EJMA 1RJJA 4ID8A 3MOZA 3OYNA 1VJQA 3BKUA 3SFUA 3SBTA 3ENHA 1BU6O 1S0VA 3ADAC 5SWMA 1SL0A 4MT1A 2Z0GA 4DV1J 4YOXA 2OPQA 2AW0A 2OTJS 1UPMB 1HX1A 5FPDA 3HSZA 3JQJA 2O01C 2DY1A 2P9NB 1HA1A 2Y8YA 3V6DB 2XHBA 3X3UA 3VAIA 2OTJN 3SV3A 3UN5A 3H7HB 5FD1A 2ACMA 2FVQA 4ILGB 1P1LA 5E7OB 3T3FA 5DQIA 1X9SA 4R25A 4MQ3A 1EKSA 3NGIA 4J2EA 1SV5A 4OI0A 2H5EA 3A1YG 1TV6A 3CT9A 4BRHA 1FTCA 3ZEUB 2EI5A 3HCXA 4M5JA 3SCXA 4HTUA 1IM4A 1S97A 3ZYYX 1B0PA 2ZBIA 2VZ9A 2CADA 3CO9A 4P10A 1HR0K 2P9IA 3NCRA 3OV7A 1D1UA 4O3QA 4M3WA 4PR6A 1HJOA 4RNOA 3D2WA 4EYHB 3T5KA 3OUYB 4LFBF 2J9DE 2VWJA 1E6YA 2VQEJ 3M1VA 4MDBA 1OIAA 4JI6F 2ZH1A 4NCGB 3I9ZA 3AT1B 1KVAA 3ENQA 3J7Z5 2DH8A 5D0RA 3Q22A 1Y3JA 4IH5A 3W8GA 1LW2B 3ZSYA 2NZTA 3L3VA 1CEZA 4K4SA 4DG1B 2BKNA 3GSIA 2FPHX 3TAMA 1EQYA 3HSDA 4YR0A 4K5RA 2N7YA 3U1NA 2MGZA 1IJEB 1TVRA 4CJ3A 3GYXB 3KUGA 2P9SB 2ADBA 3OFHA 4FBTA 4DV2F 5B0GA 4KTWA 1W7AA 4I9LA 4LSLA 4KE5A 4QW8A 3NHGA 3BSNA 3IFEA 5AQOA 4DLEA 4FM0A 3D3CJ 1MN7A 4E98A 4DR7J 3U3YA 4FM2A 3QSYB 4JKHA 4ILMA 3M3ZA 2DPNA 3HK2A 1U6ZA 1RSCA 3CIMA 4W4MA 1XNQF 1CLQA 2AJ2A 3R5GA 4DFJA 2E2PA 3QESA 3G96A 1RAAB 3H20A 2M9KA 1Q82T 1HD1A 5KGWA 3OYBA 2XI2A 4GVBB 2YX6A 4LBHA 3KIOA 3KG1A 3MCAB 2GJFA 4CTAB 1F1BB 5JVHQ 4DUZK 4MYUA 1BQNB 3U1LA 1TKZB 4WZMA 2DNPA 4LVNP 4DR5F 3BQ2A 4E7KA 1I94J 2JEIA 4BC5A 1VQ9S 4O23A 5HQLA 2U1AA 2KYXA 2GBZA 5KFLA 1TK0A 1WNSA 3ZLJA 2FBVA 4PAAA 3MMBB 2GV1A 4NEYA 2LXUA 1RDWX 4ZVEA 1U0HB 3W66A 1NDCA 4ZHRA 3DKDA 2XSJB 4W98A 1MROA 5KFVA 4OYAA 2QXLA 5HJXA 2R7YA 1HHTP 3ZX2A 3MPWA 1HNXJ 5AQRA 2JVRA 3FBCA 3FEYB 2O8CA 1D3WA 2UUBK 5AQTA 5AQYA 3C16B 5KOWA 4M5HA 4UF4A 2KKZA 1RU1A 2W01A 2RS2A 3PJ9A 1R7IA 3CCWA 5LL6d 1XMOK 1Q8LA 2GMHA 5KFMA 3RBXA 4DV7F 3DRRB 3RMCA 2KHCA 1MWKA 1BXNA 4CWBA 2P9KA 2K3KA 5D78A 5DDPC 3G0ZA 2R7UA 2IAJB 2JWNA 1J5EF 1AXQA 4DPUA 2WONA 4Q0BA 2RJZA 5IM0A 4CEBA 1CZBA 3JAMO 1VSFA 4WF9Q 4ISEA 2RKIB 2HVEA 4PPDA 3G8SA 4NLBA 2CGLA 3SMPA 4OX7A 1CXQA 2MTLA 4LF4J 3OR1B 4NLOA 3ASMA 4DQSA 4CEQA 4DSEA 1HL6A 4TN2A 2RQMA 4OZJA 4IQXA 1JJCB 2BE9B 1UVKA 2PZSA 2HRUA 4WQ5A 1YDLA 2CJYB 2VC1A 3GG1A 3GJTB 1VRUB 3MCPA 4Y34A 3S9HA 1WUUA 4MH8A 4DR3F 1X4FA 1LAVA 2GVZB 4YR2A 3NF8A 1C1BB 2KXHA 3DYAB 4LFBK 3D66A 2NXJA 2GO9A 1Q18A 1X31C 1LWFA 4ERDA 1N48A 3O1LA 2HHHJ 2N4DA 2B4VA 5AQHA 3W64A 4TLRA 2E6MA 1VFJA 2RVJA 3GP9A 2H1YA 4A2AA 2ITGA 4CJLA 2QA2A 2BEFA 3CJ2A 3OL6A 1KTVA 2VG5B 1CZAN 2FVSA 2B4UA 2HHHF 4JI2K 1U47A 3SBMA 5EXWA 4CZIA 1S1XA 1NM1A 4C7QA 2I5JB 2V6AA 4I6WA 4IRDA 3HT3A 3BR9A 3G86A 4XAKA 4PXCA 4DV3K 1LWEA 3C6HA 2UUAK 3EXCX 3I0SB 3GWCA 3R9PA 3L4BC 2DR7A 4LF7J 3ELHA 5M1NA 3HL8A 1U1QA 3ZFVA 3CDAA 3VGLA 2DNRA 4LFAF 1QAJA 2PO4A 4LF4F 4K7QA 5D4LA 4CJTA 5DO2A 3IXQA 1NJIO 1WTBA 2MKJA 3FK4A 1ZM3A 1VLOA 1I1GA 4DWIA 1RDBA 1VQ8N 3CIZA 3MXIA 5F3TA 4DV5K 4L3NA 4B3MF 2E2NA 2FZKB 2ZVIA 3NFAA 2Q3SA 4JYAF 3VQCA 4ECTA 5HI7A 3CFRA 3H8YA 3G4SN 3MEKA 1NHVA 1HIYA 3ET6A 2Z4PA 1R0AA 5A0YA 2N82B 4KHRA 3VEWA 1IWAA 2NXEA 3O4NA 2K06A 1T9TA 4M5DA 3D1OA 2CQ2A 3AOAA 3CD0A 5B0BA 1Q7YO 4C6AA 3TARA 4UTGA 2AJ0A 1U04A 4PPZA 4OYWA 2MZTA 1HBUB 1WC4A 2HWHA 5CR4A 5CYQA 2IA6A 4OJGA 3ZZ0A 5I9EB 3AQPA 1V3ZA 2QWPA 4FWOA 4F4XA 3H5SA 1KFDA 1KQGB 3QICA 4DSIA 3NCPA 1Y5LB 1RWPB 5CY4A 3CCQN 5FDLA 1HW8A 5LXRA 2PEHA 2IM0A 2J6SA 2ZD1B 2IVFB 2YWKA 2M8HA 4JKCA 4C8LA 5THWA 5F2RA 2V68A 4FLXA 4FZZA 3MZIA 3UD4P 1Y00A 2WK4A 3AAPA 5E0OA 1UAXA 2PD1A 2BJEA 3V9UA 3SUQA 3CJKA 2ASOA 4FO0A 4IWVA 4LF6F 2DGVA 1RBTA 4O4GA 4K4YA 3L4IA 2ZVSA 3OXGA 1TL3B 1H38A 1GQEA 2HS0A 3DM2B 1I39A 3RRGA 1YRUA 1GTHA 3PW7A 1LW2A 3MF5A 2ZEJA 2WRMA 1DTQA 3J7AP 2GHWA 4CZFA 4RW4A 1SB6A 1HMVA 1RT3A 3ITHB 1UJ4A 3EWGA 3AVGA 2OYQA 1SJFA 4KHPK 1S1UB 3C15B 3QMQA 2ALYB 4EYIB 3B4DA 4DPOA 1YHQS 3D6RA 1NWKA 3O5BA 5A6WA 2EFNA 3KK1A 3NLCA 4LF8F 3I4HX 5JLFA 1UP1A 3E51A 1FD8A 4DV2J 1FK9A 2DIUA 4MIAA 4O4RA 2AWZA 2J0XA 4UY8O 3ZO7A 4OZ2A 4NZ7A 2SXLA 4J9VA 1BL3A 3DXMB 4GC6A 1FJGJ 2ZDPA 4X4VA 4CGDA 1ZM2A 1Y5NB 2W2MP 4WFNQ 2BVZA 3MN9A 1I3AA 4AHUA 2DISA 3LAKA 1X0FA 2UU9K 1WSIA 3OYDA 2F8EX 1YXQA 2E1RA 4BRCA 3RG6A 1WEZA 3DWLA 4RO0A 1NZ8A 4JI6J 4ZLNA 2M2BA 3VAJA 3LP0A 1QY7A 2VQEF 5LT5A 4L72B 3DMJB 2ZJQL 4G1QB 4Q8EA 3U1MA 2KJVA 5CXTA 3NVMA 4RU9A 3VGSA 2WTFA 2XY7A 1LCUA 2WUSA 1HLUA 4BRMA 4BACA 2G4BA 5GAHI 3ISNC 1PO6A 2VDIA 2M88A 2X74A 4LF6J 5BXIA 1Q86O 2JC0A 4OGEA 3QFPA 4IZ9A 4HDGA 4OLOA 5ETSA 3E01A 2FHMA 3GOIA 4QIGA 1BUXA 3ZZRA 2RB7A 3G2XA 3HYFA 3TVKA 4Y0FA 1KN6A 3ISZA 2B6AA 2K3IA 2CYYA 2I6WA 5F8MA 2UZAA 2C2ZB 2OELA 2V7ZA 1HWJA 4GO5X 4RNHA 3HPGA 1KQSR 3A8EA 3LTOA 3ID6A 2VD3A 2MY7A 1FFGB 3RB0A 1RFQA 5L38A 1U2VB 4EIAA 4DL0C 1PGZA 3NNAA 2BOAA 5D4PA 4ZS6A 3SNNA 3WXKA 2ASYA 3OW2M 1FWPA 2CQDA 2JC1A 2B4JA 3OR2B 1N0UA 2HEKA 1R59O 2NSBA 1BA0A 2V34A 4U8VA 2DPIA 3P5BP 4KH1B 4YUDA 4CFDA 4W5OA 2OEMA 2Q36A 4ZVTB 2OPRB 1JNRB 4A5BA 4CJRA 2MLXA 1WF0A 3J81j 2YHWA 3H40A 4CJQA 2XLJA 5AZIB 3I5CA 3CQXA 4ZCIA 1D9AA 1IBMJ 4USWA 3CCJS 5JLHA 3IWLA 3MR3A 1RDUA 4LFAJ 4XH1A 2DGSA 1M90O 1K8AO 3EXYA 3UDLA 5ETLA 2HHUA 5KG5A 4FJIA 5JUMA 3G8QA 2P8IA 1N8RT 1FXRA 3RB3A 2OO4A 4Y6IA 3TAFA 3LQVA 1S0OA 4WE1A 5KG7A 1SC4B 3TP2A 5C2FA 2VFRA 1RABB 4FDFA 1VBKA 3CTRA 3BZCA 2Z1JA 4LFCF 3KJQB 3WNEA 1EWQA 3ZZTA 4ZKAA 3KHRA 1IG8A 1MWZA 4GY2B 3CJ7A 1BWVA 2WVBA 2XRIA 3EVOA 3OR1A 1YJVA 2W4PA 1PILA 4DEZA 1TKXA 4ID5B 1SKSA 4X4RA 4Q2MA 3GIJA 4FJJA 1SC6A 3M8SA 2E5LJ 4JI3J 1R8HA 3EZUA 5KFYA 3IG1A 5CZ1A 2F9DA 1MWYA 2ZQBA 3K9JA 2IGIA 2RF2A 4FVUA 1ASVA 2MJNA 3OS2A 1QAYA 1XMQJ 3MMAA 2F96A 4LBPA 2KI2A 1S6QB 3IDHA 1U24A 4W92B 1X4BA 5A2QO 4KB1A 4CZEA 4DR2K 2ROPA 2Y3YA 2VBYA 3N4QA 3PR4A 3IRWP 3R7BB 3MCOA 3FNNA 2E29A 4W5NA 2E1MC 3I8BA 1FDAA 3KJVA 2QT7A 3IBCB 1SJ4P 2VG6A 4DTPA 5DLGA 1B9DA 1J2VA 2ZHBA 5EY4A 4A8OA 5AE1A 3QINA 3UI3A 4PXBA 4OGCA 5DM7L 5AJ3J 5H9FJ 2D0BA 5DS7A 3QIPA 4ZJQA 3UKUA 3OT9A 3A0IX 5E26A 4G1PA 4P72A 3OYKA 5HK4A 4P6QA 1JX4A 3C7NA 3M8YA 5GADP 4PA1A 1JIHA 3AVNA 1OH6A 2F9JA 4ZCKA 4DQ8A 4F26A 4P7VA 2ZH2A 3NOCA 5EX5A 2QM1A 4LY7A 5HATA 4E3SA 1N34K 1FRJA 3WHIA 4ED2A 3TAQA 1RBSA 1RA6A 2R8KA 4DG1A 4DCPB 2JFDA 4CZHA 5HMYA 5CA5A 1HKAA 3CCMS 4U95A 2QYCA 5I3PA 3SIPB 1ITGA 2H51B 1QHTA 5KFKA 2VFTA 5M2PA 4ZLJA 2LQJA 2Q6BA 3C94A 3M5RA 3NP5A 4MFBB 3AD7C 3T1YJ 3AVCA 2ZBPA 1VBZA 4PG7A 3KWGA 6FD1A 2QZ8A 2HFVA 1EP4B 2Z1GA 2VICA 3C65A 2ZWHA 4ZVUB 3KLEB 1VSIA 1Y0HA 4E7LA 2XMUA 3DU6A 5D3GB 1NUEA 4QAGA 3EGNA 1FKOA 2C3YA 3DOKB 1HWKA 5CQGA 3UB5A 2J5AA 2IDOA 1TTHB 1XIQA 3MD3A 1R0CB 1N33F 2CH6A 1OWXA 5C25B 1EIYB 4J2DA 2PMHA 5FJ4A 2W7AA 4NMLA 2R8HA 3JTOA 2EFPA 4C2MA 3P3DA 3SPYA 3ETMA 3GV7B 3PKMA 4IFYA 4AHCA 3CCLS 3VQ8A 2R3VA 3QATA 1JLBA 3CMAN 3GIIA 2M0GB 3SSQA 4B17A 2DYAA 1JLFA 2KTQA 1QVFR 5AJ3F 1T03A 4DKWA 4FWSA 3FMWA 1C4AA 2XWXA 2HHQA 1QQMA 4BWMA 3OXLA 5KFDA 3L8BA 1JCFA 5DDOC 4IO9L 3I8DA 2IOCA 1P8ZA 3TWZA 3CF5L 5F8NA 1RKJA 3F41A 3HT0A 3I87A 1FNOA 1FKPB 4PWDA 3LW5C 4CO1A 3BJYA 3UDVA 2K7KA 1SS6A 4RW9A 1B0VA 5KFAA 2UUCF 4LFAK 3OVAA 4RKUC 2VPXB 4C8YA 4KHPF 1DQAA 2CPJA 2QA1A 4GV6A 5KFIA 3D2EB 5B0EA 3PV8A 3SI6A 1PC4A 1NBEB 2VBXA 1VQYA 4G65A 3NGYA 3HHLD 3CJ5A 2G1DA 4P73A 4LRBA 2H65B 3F73A 4WK1A 3WX4A 4LFBJ 1HD0A 1T02A 2ZM6K 5A8RA 1DFDA 5K14B 1VYAA 1RWKB 4IFYB 5I3UB 4TKTA 3VEZA 2VFSA 4EP5A 1WG5A 3AHPA 4NLCA 3NH2A 2AGPA 2PY5A 4OJ3A 1WC3A 2WHOA 4RLEA 1ZETA 1MMNA 2K2PA 4JBCA 3O6WA 2JRSA 4P2FA 3H4DA 4RBVA 2FBXA 4P74A 3D28A 2RRAA 3ILIA 2JJ4D 3D1QA 2Z58B 3IR5B 3VQEA 3RVCA 5E2QA 4DV1K 4R0JA 3MM9A 2HQ3A 3K2YA 2R8GA 3THYB 3NWRA 3J7ZT 4JK7A 4OHVA 2GJ2A 4M5MA 1R0AB 4FKXA 3DI6B 4Z94A 1FNMA 4CO0A 4NOHA 5LXYA 5DLFA 4OZ1A 5JJBA 3QNNA 5IQQA 1R27B 4LF7K 2Y1JA 3HPOA 3D0HE 2OCEA 3DLKA 1FO1A 4OZ5A 3O2IA 1YI2N 1DKGD 3VGUA 2NNWA 2P5GA 4P71A 2H5IB 2PN6A 1YI2S 1HQUB 1FRMA 2KT2A 3G4SS 3AA3A 3AVKA 3KDNA 2BJ9A 2W42A 1ZTWA 3I5AA 1VC5A 2DO4A 3R5AA 4NA1A 3NVKA 2BX6A 4JV0A 3V6HA 3BSCA 3MGJA 2OP5A 4KO0B 5LMNJ 3ZTSA 2V51B 1RDRA 1VQKN 1TMJA 1X5OA 2QC3A 1RT6B 3ALYA 3QZ8A 5B0FA 4NYZA 1WSVA 1YX2A 3UKUB 2IVYA 1SQEA 2IRXA 1T3NA 4NXMF 2R42A 2GAGC 4ZA1A 1KFSA 2OTLS 2MY8A 1GX5A 3MN6A 3M2RB 3THTA 2J6TA 4NI2A 4DQQA 2RHSB 2PEBA 1YJNN 3ZZPA 1NH7A 3G82B 2CAJA 2ATQA 4KPYA 1C1AA 4WQ4A 2GEMA 3D7EO 1WDTA 2E6LA 1WKJA 4YB7A 4CGFA 4CZCA 3H45C 2JZ5A 3MMAB 1TL1B 3V6DA 4USUA 1OPIA 4DV4K 5KAKA 5F0XA 1GEHA 4CLZA 4CEFA 2E2QA 2KHOA 5FPNA 4X62J 2HW3A 4WQ4C 4E7JA 4CLKA 3NKYA 2VV5A 1VQKS 4N76A 2UVUA 3MEDA 3V5RA 2CXEA 3EO3A 3AJ2A 4QOTA 2KXNB 4JI0K 1NLVA 4DMNA 3QAEA 2V4QA 4XTTA 3E9LA 2N3OA 5GAGP 5H9EK 4XPEA 3PW4A 2QLBB 3HVWA 5KFTA 4BY9C 3FZBA 4CRJA 4JI8J 4L76A 2YWFA 4NA2A 5H1SQ 2CNNB 2A41A 1WEXA 2A3ZA 4FLVA 3MEGB 4KGKA 1HKGA 1HNWF 1YJNS 3H3NO 1FRKA 1XEZA 3THYA 4KHPJ 1H2VZ 2IPOB 3OPKA 4DL2A 2O8DB 4O3PA 4KC5A 3CCRN 2PDAA 2UUCJ 5ETQA 2IHR1 3NG8A 1IQTA 1IWGA 1JXVA 3M6VA 1BQMB 1ILYA 4WYLA 4L6V3 1T9YA 4LF8J 3ZC4A 5A0YB 1PG5B 2X51A 1NZAA 2UUBJ 5JVGL 3L7PA 3PO5A 3IO1A 4TQRA 2EXUA 4AL6A 2RIJA 4BG9A 3AY0A 5IZHA 4FVMA 1MDUB 1U6BA 4PQAA 4CHNA 2EEYA 2BRLA 3IS9B 2KKHA 1C1BA 2DHHA 4DL6A 1NGFA 3PR5B 2QSFA 5FLXO 3AAQA 3EPIA 1IKWB 2ZWOA 3CDEA 4ZJLA 4NXNK 2CQ0A 1HYSA 3ZZOA 3QEVA 2W2PP 2KW4A 2O8FB 3CJCA 4J2BA 1N33J 3C6UA 1RQ0A 2CQGA 2X1BA 2Q97A 2RRBA 4CLPA 4OVLA 1P9QC 4B1YB 4Z4CA 3VVTA 1H98A 4I2QA 2BA9A 1Y4ZB 5ETOA 2CVEA 3I6PA 4KIAA 1YJRA 1Q53A 2VKRA 3Q8RB 4O8UA 5ETVA 4IJAA 1N54B 3KHHA 5FPMA 1S1XB 1B7FA 1X8DA 3V4IA 5DG7A 4AH9A 2ZNZA 2P9UB 1WOPA 3MPYA 5I42B 3VR1A 4ZLPA 4M63C 2ZFHA 3VQTA 3T1YF 1WF2A 5LY3A 2HSEB 4BREA 2Q1LA 4Z7CA 1UWAA 2BOPA 1X5TA 4E7HA 2HBZB 2ZGYA 2B8QA 1LWCA 5EX3A 3VVUA 1S76D 2FLLA 1TK8A 2HBYB 2UV8G 1NCLA 2PYJA 2HNDB 3PG9A 5D0EA 5IS2A 5G4DA 3FBEA 1D9FA 2HPUA 2QA4G 4KRFA 1DZ5A 4I4BA 1IKWA 5KT7A 2KZMA 2JEFA 1ZBUA 3VEVA 4A5AA 3KLIB 3DNCA 2G8WA 4F0HA 1NGHA 1VBYA 2D0OA 4FJ7A 2G1HA 3MECB 2ZZTA 3Q8UA 3TAPA 4FS1A 4OI1A 2C3UA 1ZBLA 4U7CA 4M3TA 2DFHA 4I2QB 3H46O 4MK8A 1KWMA 2YPYA 1BWEA 4NZ0A 1K8KA 3JXUA 2V5HG 1C1CB 2RHQB 4B1ZA 4AQYF 4CEEA 3FLCO 2YXLA 1Q86T 4CLWA 4QWAA 3SDEA 3PRVA 3NE6A 4A61A 5L1IA 4NLDA 4HT7A 2K8GA 3BM7A 4LF7F 4TY9A 4BCAA 3WNHA 4CERA 2G8KA 4K0KK 4H4MB 3PRBA 2DD8S 4C1NK 3CDUA 2Y1LB 2X7IA 1H74A 1NSAA 2H3EB 3HDSA 1QHAA 8AT1B 1RE1B 1XMQF 3NGDA 5KT6A 3M8QB 2NREA 1VSJA 2XMVA 4L3QA 4TLQA 1NAQA 2PI4A 5ETKA 3T5LA 4LRFA 4YFUA 4PUOB 1AYEA 4X62K 3JQMA 4OZ3A 2G0JA 1P9YA 3B78A 2OJ3A 4O4GB 1MLAA 2KJWA 3QRRA 4CGGA 4RBTA 5IXUA 2M4MA 3WNFA 1M5OC 5AFUH 2EPIA 4F25A 3JAMY 1BLUA 3Q83A 4CHYA 3UNGC 3W3DA 1FI4A 1OVYA 4H5WA 1ACMB 2OPPB 3CCRS 3QYYA 4FF1A 3K8WA 5IT9Y 2L9DA 3KLGA 4FL9A 5M1KA 2VPWB 1YBUA 4LQ3A 4CH7A 5M1QA 3QLHB 3L7UA 3EEQA 4O0JA 3DOLB 3KJNB 3GDQA 1X7VA 1P8GA 3HJVA 2QWMA 3NH0A 5F3ZA 4ECWA 2GJIA 2ZD1A 2AJ1A 4DTUA 4YOYA 5AZJB 3AGRA 1FJEB 2F40A 4FJ8A 4Y2KA 2DGUA 3C66A 4DUYK 4B3RK 3MWPA 1XQSC 3D54A 2YHYA 4ETXA 3SCJE 1S5JA 2F8MA 1M90T 2UUCK 4MAKA 4KREA 3HVTA 4EBEA 1IBMF 3OYIA 1BQMA 1N5SA 3NH1A 4N77A 3MOJB 5J1PA 4M3UA 3HTVA 3MM5A 1J5EJ 4DTXA 3J7ZO 3TSPA 3TOQA 3QJJA 3G25A 4W5RA 5H9FK 2N3LA 5KFNA 1AB8A 3DYAA 3OXFA 1WC5A 4AT1B 2J9CA 4LSLB 3TUIC 4J9KA 5C2DA 4RUHA 2HFZA 1K9MT 3WXMB 3H1VX 1IR0A 3QT6A 4M3ZA 2C22A 3HI0A 5EN1A 2YQ3A 4C8OA 3CCMN 2ROEA 2ZITA 5M1OA 3T5HA 2FJAB 1BHNA 4QPXA 1F3FA 4V19S 5CD4A 1HNXF 2C2MB 3VQSA 4CJSA 4DV0F 1NPPA 3Q2TC 3CC7N 4F0KA 1SQKA 2QWNA 1VSLA 2HHVA 3WQUA 5KG2A 3V1RA 1JLQB 2RS8A 1QM9A 3UCZP 1IKYB 5HVGA 1U2CA 3GYNA 4AM7A 2R2SA 4NL5A 2EK6A 4HACB 1HBMB 1NKEA 1J5OB 3ZSXA 3N6MA 2LQBA 3DAWA 2HBKA 2V8PA 3CCSS 2D1KA 1HBOB 3LF0A 1RDDA 2AGOA 1U2RA 3TZXA 1ASUA 1OY8A 3MAAA 4M95A 1I94F 4H4OB 4HVZA 3VAMA 1X3NA 1VC0A 1Z25A 1HNVA 3VENA 1LKZA 2AA4A 4NX9A 3HPHA 2DK2A 3D6MB 1NM2A 1PBUA 4FLTA 1ZA1B 4NI2B 2B43A 1JLAA 4DU3A 2YNIB 3CDBA 5BR8K 2D4WA 1HNZJ 4LF6K 4ZK7M 2MKCA 1RTHA 1RILA 3W2VB 5MLCV 4OZNA 3O9QA 1WACA 1XNQJ 2OPSA 2FBYA 4PG4A 1WSJA 2IM1A 4UOFA 4CP5A 2AYBA 4H5TA 3G6VA 3FKBA 3DOLA 1KLNA 3HHEA 4MLEA 1EKRA 4DR7F 1BE4A 3CJ0A 3O3HA 2ZOFA 4X64K 4DQRA 4FWRA 2GHVC 4CF9A 2P9LB 1T11A 2QL9B 3N28A 2VA3A 3GLJA 4YMEA 5KPZA 1FJGF 2R7RA 3MXJA 5IT9U 1N0VC 3U6FA 4KRWA 4UOHA 1LOTB 3NNHA 3P83D 2VG7B 4KSEB 1FFWB 1EHWA 2FZGB 4CHPA 5CCLA 2VF3A 5D0HA 3BSOA 2ZOGA 3KMQA 4KTQA 3ZCMA 3DRSB 3KLFA 4RL1A 2HHXA 3VAFA 2E7XA 4O3SA 2QMUB 2BJDA 3TVZA 2DTJA 2LU1A 2MLYA 1RTJA 1HJRA 2V63A 3P96A 2IMWP 3HKWA 1JXLA 3OLBA 2CDRB 5KFEA 3I33A 2V8DA 4Z0UA 1PBAA 1QSYA 3FZLA 3AFGA 3MCNA 5BJRA 4PKIA 4DUZJ 2FUG9 1GMWD 1VQLN 4DB3A 4K2XA 2BE2B 1RXOB 3SUOA 3CXCM 5AT1B 5C2CA 4E1MA 4QYRA 4TYBA 3C14B 4I6YA 3TSQA 4B8CA 1VDHA 5IT9O 4FWNA 2HVIA 2NXCA 3IBWA 3HI9A 4KH6A 3F56A 3IN5A 3EZOA 4R8UA 5K9FA 5KFWA 1UCNA 2PYLA 1VOMA 1HYVA 1KVBA 1HI8A 5GINA 1LK5A 4CIEA 1VC6A 2W9BB 1X4HA 4CLLA 4BR2A 4RW8A 3BF4A 1YJWS 3T19A 4FJKA 3D2EA 3H2VE 1S5ZA 3SJJA 3L95X 3W7BA 3SPZA 2JLFA 4B3RJ 4EGLA 4HTIA 2MDAA 4URSA 1S0NA 2GZOA 3RMBA 2VPYB 1OSDA 2W4CA 1WLJA 2LLZA 3VF4A 4V19J 1XNRF 3E8OA 1JQGA 3IGNA 5LJVA 5BRHA 4KHSA 2P9UA 3U27A 1CLFA 3DJCA 5TKWA 4K8ZA 4ANDA 1XJWB 5KFSA 4FF3A 1CJUA 2JWLA 1QVGM 1RBVA 4IEIA 5BPNA 3R6GB 1X60A 4JYAJ 2B51A 3MX5A 4B3MJ 3RGIA 3OYCA 2V67A 4DQPA 1S48A 2IJRA 3W1YC 2J7UA 2AYGA 1H3DA 4ER8A 4CLTA 1GLLO 5HRSA 2IM2A 2ZKTA 3NY0A 4OFZA 4FLWA 4ZDNA 2GS8A 4K4XA 5GAGU 3WX8A 2EK1A 5LSRA 4ILRA 2XYGB 4OLBA 5C7PA 5KT4A 3JS9A 3LM2A 3WEEA 1AFJA 4CGIA 1RCHA 5T7BA 2J0SD 2DCUB 3I0SA 2ALZA 4E8UA 1KC8T 5GMKa 4X4TA 5KT3A 2M52A