2FSKA

Crystal structure of ta0583, an archaeal actin homolog, semet data
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
326
structure length
321
Chain Sequence
b'MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTETESWGIGGKIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIPVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Ta0583
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural protein
total genus 90
structure length 321
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fskA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fskA01
1BUPA 4FPBA 4MO5A 3ATUA 1ESVA 4L3QA 4BC2A 1HKCA 2P9KA 3DXKA 4FO0A 5AQXA 4BC5A 1E4GT 5TKYA 5BPMA 3UKRB 2P9PA 3IDHA 3D2FB 1BOTO 3JXUA 3UB5A 2HF4A 2IVNA 4QS8A 2GUPA 3GL1A 5JMVA 4FPAA 4B1XB 2P9LA 4B1WB 3OHRA 4H03B 1D4XA 5AQWA 2QWLA 5KPZA 1V4SA 1BWFO 1R59O 1CZAN 1QQNA 3WXIA 3QICA 4JD2A 5E84A 2FLOA 1BA0A 2FSJA 1NGEA 2QXLA 3LDOA 3W3DA 2P9IA 1X3NA 3MN9A 4H5WA 3CJBA 3KZBA 5FPDA 2NLXA 3LM9A 2E1YA 3HI0A 2YCHA 1V4TA 3MMVA 4BVPA 4DB3A 5I9EB 4CZJA 4RCHA 4H5VA 4IJNA 1GLLO 4BG8A 5AZIA 1OKJA 5EOYA 4I6MB 4CZIA 1HX1A 4CZHA 3SJHA 1NGIA 1NGAA 1BU6O 3A0IX 3VF2A 1G99A 4FSVA 3H45C 3H6EA 4IJAA 3CIPA 3UKRA 4H5RA 3D2FA 1MDUB 4B1ZA 1NMDA 4BC4A 2HMPA 3WQUA 3JS6A 3BP8A 4BC3A 2WUSA 4AM6A 3ENOA 3VEZA 4CZGA 3QMLA 4BQZA 5AZIB 4EHTA 5B8HA 3H1QA 1Z05A 3HBTA 3UKUB 4FWKA 4BRGA 1NGGA 4WQ4A 1TUUA 2V51B 5BN9A 4K42A 2F9TA 3O8MA 4DHYA 1GLCG 5AQHA 3AAPA 4PKHA 1GLEG 1LCUA 2FF3B 4XH4A 5AQGA 4NO7A 4BR5A 5BPNA 1DKGD 4FWQA 5KQDA 5AQFA 5AFUH 1QQOA 1ATRA 2VYPA 2E88A 1YXQA 4XH5A 4A2AA 3WQTA 1SQKA 5AQVA 2P9SB 3U9ZA 1Z6RA 5BRHA 2OANA 3AARA 3GG4A 5FPEA 4BRDA 1C0FA 3LDPA 4H5NA 3D2EB 2QWNA 5AQQA 3A5LC 4CBWA 1T44A 2Q97A 1GLDG 3DXMB 4FWSA 4PKIA 5BPLA 3IFRA 3LDLA 3HSCA 4EAHD 2KHOA 1T6CA 3LDNA 4K25A 2VWBA 4AM7A 3UKUA 3F9MA 3H46O 2FF6A 2V7YA 3CJ9A 4XEIA 1ATSA 2A40A 3A5MC 4C23A 3U8XA 3CERA 3EO3A 2V7ZA 2YHYA 3QDKA 5AQKA 5AQLA 2GTDA 3VGLA 1MWKA 5E26A 3VGMA 2QWRA 3ZX2A 5EY4A 4FOIA 3A5NC 3MK6A 4M7XA 4BRHA 4ISEA 1DGKN 1TYQB 3ATVA 3M6GA 4MO4A 4NB4A 4YDUA 1HPMA 4WQ5C 3R8EA 2IVOA 5AQPA 2P9SA 2QWPA 1ZC6A 3CQXA 4CBUA 1YUWA 3B8AX 2GWKA 5AR0A 3IUCA 1H1VA 3GBTA 1HKBA 3M1FA 2BUPA 3ZX3A 3H3OB 4BRKA 1WUAA 4EIAA 1NGDA 3DXMA 3ID8A 1EQYA 2H3GX 3H3NO 4BROA 5LJVA 3D7EO 3QFPA 4O5FA 1NWKA 5JICA 3VESA 3TU5A 5BRFA 4BRIA 2QWQA 1U2VB 4FWOA 3VF6A 1S22A 4FWPA 4BRQA 3C0BA 4BRFA 3VEWA 5AQRA 2QWMA 3GE1A 3ULEB 2A5XA 4BG9A 5F0XA 3EN9A 4QS9A 1JCFA 2ZGYA 1C0GA 3ZETB 1IG8A 2Q36A 3L4IA 3DAWA 3MN5A 3J8AA 1IJJA 4CZMA 3MDQA 5AQNA 3O80A 3I8BA 4FWMA 3CJ1A 3GDQA 3O6WA 3CQYA 3LM2A 1NLVA 2E8AA 1TYQA 3MN6A 3QBWA 4B1YB 4BRNA 5FPMA 4RTFD 4BR2A 4B9QA 3VERA 4JNEA 2P9UB 1NGCA 3KVGA 1Q18A 4IZ9A 3FZFA 4WYBA 2HOEA 4FWLA 1XQSC 1HJOA 5AQZA 5F2RA 3SK3A 3QBXA 2ASOA 3L0QA 5AQIA 5LJWA 1MWMA 2YHWA 2E1ZA 3HTVA 1ATNA 4CD1A 4FL9A 3FR0A 3WUHA 3VEVA 4CD3A 5BREA 5AQSA 1SAZA 5ADXA 2Q2RA 5AQMA 2D0OA 2FSNA 3R9PA 3MN7A 3G25A 1DEJA 4BR0A 1NGBA 4B1UB 2D0PA 4I6MA 3S41A 4BRMA 4BVOA 1QZ6A 3O4WA 4XH1A 1XUPO 3H1VX 3ZEUB 2D1KA 3FZHA 3LDQA 4BRCA 2YJEA 1GLJO 2EWSA 5AQOA 1X9JA 5AQTA 2ASMA 4Z94A 4BGBA 3SMPA 4CBXA 1BG3A 2P9KB 3W0LA 1RGIA 2A41A 3DXKB 3HM8A 1KAYA 3EKUA 2CGJA 3HZ6A 4BREA 5AZJB 5KQ8A 2CGLA 3SLCA 2ZWHA 5LY3A 2PAVA 5CE3A 4IXCA 2E2QA 1QHAA 2P9UA 5EXWA 4M63C 2BTFA 3VETA 2I7PA 1GLBG 4O8KA 4LC9B 3VENA 1MA9B 5JLFA 2P9NB 2DPNA 4FWNA 1BO5O 3CJ7A 4KBOA 2A6AA 3U4LA 4JD2B 4IWVA 3U9DA 1NGFA 1JCEA 2CH5A 1BDGA 3AAQA 4HWIA 5FPNA 3UE5A 2FXUA 2P9IB 3BUZB 1GLFO 4MLHA 3AY9A 1HKGA 2CGKA 3FLCO 5AQJA 4FOEA 5JLHA 1YAGA 1S3XA 4CI6A 2E2PA 2QM1A 3BEXA 3EKSA 1ZBSA 3ZEUA 3VOVA 4H0OA 3KHYA 1QZ5A 2HF3A 4JN4A 3VEYA 1K8KB 4CJ7A 3MCPA 2Q0RA 3D2EA 1RDWX 1U6ZA 3VF4A 4CZKA 5AZJA 4H0VB 4PL7A 2FSKA 3BF3A 4RWTA 1NM1A 1P8ZA 4CZLA 1E4FT 2ITMA 1KAZA 2ZF5O 4BQLA 2VCPA 3IMXA 2YI1A 4JAXA 4BRLA 3CETA 2NRHA 4BRAA 4J8FA 2J4RA 2PBDA 2P9NA 3M3ZA 2Q0UA 4B1VA 4WQ5A 5KPTA 5ELZA 2A3ZA 4EFHA 3VPZA 4IO8A 3LL3A 4BR4A 4M7YA 2YJFA 2AA4A 5BN8A 1HUXA 4F9OA 2ZGZA 5KPRA 1LOTB 2GWJA 2I7NA 4WQ4C 3I33A 3C7NB 4PKGA 3TPQA 4BRPA 3A5OC 1T6DA 2GEMA 3FZMA 3L6QA 4QS7A 3VEOA 4K43A 3O1BA 1GLAG 1K8KA 3EL2A 3FZKA 5BR9A 4A2BA 4H5TA 4DCHA 1ZXOA 1TUYA 3GOIA 1NGHA 1X3MA 3P4IA 1WOQA 3QB0A 5AFUA 4HTLA 2E2NA 3VEXA 4PL8A 4H0PA 2E20A 1HLUA 3DJCA 3R6MA 5F1XA 4DQ8A 2F9WA 3WEEB 4JHDB 2IIRA 2Q1NA 3BF1A 2UYTA 1U2VA 4GNIA 4EHUA 1Y64A 1SZ2A 3CJCA 3RSEB 3QFUA 3WXKA 3EZWA 3ULEA 4E1JA 3A8YA 1NBWA 2A42A 3O5BA 3ZETA 5BRDA 4BR9A 4H0TB 4K41A 3ENHA 2GELA 4A62A 1KXPA 2V52B 1KAXA 4Y0WA 2D4WA 5EVZA 1QQMA 4FWRA 2P9PB 3ZX0A 3C7NA 3VGKA 3O1WA 5AQUA 4CZEA 1NGJA 2W41A 2P9LB 3FE1A 4MLEA 3CJAA 2NZTA 2YHXA 3DWLA 4H0YB 2ASPA 3CI5A 3FZLA 4A61A 3CHWA 2IVPA 5ADXH 4BGAA 3FFKB 3FGUA 5AQYA 5EX5A 2W40A 1J6ZA 1JCGA 4CZFA 4ISFA 4ISGA 4YDUC 3O08A 2E2OA 1XC3A 3WEEA 4JHDA 2Q31A 3WXJA 4BR7A 1RFQA 4H0XB 4GY2B 3RSEA 2QWOA 3WT0A 1BA1A 3SMSA 2QW9A 3WXLA 2CH6A 2AP1A 1YVNA
chains in the Genus database with same CATH superfamily
1BUPA 3OY9A 1JL2A 4DQRA 4IEIA 4MO5A 1HRHA 3ATUA 1ESVA 3DOLA 4L3QA 1JXBA 4EP4A 1XC9A 1HKCA 4FK0A 4FO0A 1WAFA 4IOCL 3TWHA 2FC0A 3B6OA 3P5JA 4DF8A 1BOTO 4CECA 3HVTA 4AF1A 4CIGA 1REVA 1B9DA 4YOXA 3OHRA 5D3GA 3LWMA 4CGFA 1Y97A 5AQWA 5HBMA 3AA2A 3V9XA 3KTQA 3THYB 1R59O 2PYLA 3EZ5A 4B9MA 3WXIA 1BL3A 3C65A 2FLOA 3AVHA 1BA0A 2FSJA 4KTWA 5AJ3K 2VG6A 3THWB 2JWKA 1X3NA 1DT9A 1C1BA 3KZBA 3BDPA 3LPUA 2YCHA 5DK5A 2IGIA 5MLCQ 4F8RA 1I39A 3ZYYX 3OTOK 4K0KK 4H5VA 4BG8A 4M42A 4GV9A 4M3RA 1RBRA 1KFSA 1HX1A 1BU6O 3VF2A 4N41A 4FSVA 1U45A 3ZSWA 3THVA 4OVLA 3U3YA 3JS6A 3BP8A 1VSFA 2WUSA 3J7YP 4AM6A 4NXMK 3VQBA 3VEZA 3E9LA 4E7HA 3OW2M 3H1QA 1S6PA 4FLZA 3UKUB 3LANA 1YJNN 1L3SA 2VWKA 3OYGA 4WQ4A 1TUUA 3RVCA 4B3MK 2E5LK 4K42A 4JKGB 2O8EB 4PKHA 3OYAA 4KI4A 1T03A 3VQ7A 3EE9A 4JV5K 3CQ8A 1DKGD 5KQDA 4DKWA 1QQOA 1ATRA 4XH5A 2ZJPL 4M3WA 3SQ0A 3V9UA 1KLNA 3D45A 1RT2A 2P9SB 1Z6RA 2Q3SA 1O1WA 2PFUA 4M3ZA 1ZBLA 3VQ5A 3LDPA 5AQQA 2WC9A 3JAMO 2BH1A 1OVYA 3DXMB 5KRTA 4PKIA 5BPLA 3LDLA 1RBVA 4EAHD 4C8LA 4AM7A 3UKUA 4UQGA 4CGJA 4L8RB 1CLQA 2DY4A 2Z1IA 3HT3A 3NVMA 1WSHA 1RCHA 4JKGA 2O8EA 4LSLA 4LY7A 3TI0A 2GTDA 1NJYA 3VQ6A 1MWKA 1LV5A 3CPWM 4LFAK 3CG7A 3MK6A 4M7XA 3OYNA 4ISEA 1TV6A 1DGKN 4A5BA 1D5AA 3M6GA 3TSUA 4YDUA 4IFYA 4DTPA 4WQ5C 3AO2A 1S6QA 4KHQA 2P9SA 2IS3A 2HHQA 4QAGA 2QWPA 4B3TK 1NJXA 4OKKA 1YUWA 1RTIA 2GWKA 4HHTA 3CPEA 3IUCA 1H1VA 3JSMA 3DLLL 1MU2A 3ZX3A 1XMOK 4ZTFA 1HNXK 4CCHA 4EIAA 3DXMA 3NF7A 1EQYA 1T05A 3H3NO 3QFPA 3AVAA 4NCGA 1B92A 4DR2K 4OO1J 4MDAA 1RT3A 3VF6A 4BRQA 4CEEA 4FM2A 3VEWA 1FXXA 4PA1A 3GE1A 4FJNA 3ULEB 4BG9A 3G4SN 3ZSVA 2ZGYA 1IBLK 4LF5K 3V6DA 3L4IA 2LSNA 4RW9A 1NK5A 3J8AA 4E7JA 3OBYA 3QBWA 3V1RA 4DTNA 1HJRA 1KFDA 3KK3A 3KWGA 3O3HA 4BR2A 3HP9A 4JNEA 5GIPA 3TAEA 1Q18A 4KKOA 1VQ7N 5HP1A 4YOTA 2QEXN 1A5XA 1MWMA 2E1ZA 2YX6A 4KHYA 4CD3A 1U4BA 3VQ8A 1SAZA 5ADXA 1NK4A 5DMRA 1S9EA 4CJLA 3OJUA 2D0PA 3C6HA 1KCFA 4XH1A 1XUPO 2F8SA 3FZHA 2HSTA 2YJEA 5AQOA 1X9JA 3K0SA 4Z94A 2WBNA 3SAHA 3NGYA 4B9SA 4DSJA 2HHHK 3TAMA 3DXKB 3HM8A 3EKUA 1TAQA 3G6EN 4AHSA 2CGLA 3SLCA 5C2DA 5LY3A 4BWJA 2O8DA 5HRPA 4ZTJA 4U67L 2JGUA 4KHNA 1B9FA 3MCAB 2G8HA 2I7PA 1TKZA 1HYZA 3DOKA 4O8KA 1MA9B 3DLRA 4FWNA 3QLHA 4AHUA 3CCEN 1D8YA 3DMJA 3U4LA 4PUOA 2NRWA 1FK9A 3LP2A 4JD2B 2WONA 5JS1A 1JCEA 2CH5A 3O9UA 1N8RO 1S9GA 2P9IB 4NLCA 4CJEA 1KLMA 1GLFO 3LP3A 5AQJA 1WN7A 3FLCO 3ASMA 3TAFA 1NMNA 5FRMA 3SAGA 4CI6A 2QM1A 3EKSA 4B8CA 2QKKA 2HF3A 2FBVA 4KB1A 4JK7A 2XO7A 4FJ8A 4CJKA 3VF4A 5FROA 2GX9A 4H0VB 2HHTA 3KIOA 4PL7A 1M90O 4LH4A 4J2DA 4I2PA 3Q7CA 1Q9XA 4CZLA 2ITMA 1KAZA 4BQLA 3ZSQA 5HRSA 4DU1A 3CETA 1EO1A 2HVHA 1JLCA 4AILC 4DS4A 4AHCA 4B9NA 4DV5K 4IDHA 1BQNA 4B1VA 4WQ5A 5KPTA 4EFHA 3CMEN 3LL3A 4FJXA 1U47A 1HUXA 1NJZA 1CXQA 5KRSA 1RDCA 1LOTB 2IAJA 3MAQA 2NRTA 3L2VA 2I7NA 3I33A 5CYQA 1EWRA 1NK8A 3KD5E 4FVMA 4QS7A 3L6QA 3SQ1A 3ULDA 4OX9K 4DU3A 1LWEA 5M1QA 2QK9A 3S3NA 3C95A 3DLGA 3HP6A 2G8FA 1TK5A 1S5JA 3QB0A 5AFUA 3CCSN 4PL8A 4H0PA 4F3OA 1F21A 4DV7K 1HLUA 3DJCA 3KK1A 4DQ8A 1CZ9A 3OYKA 4WCEL 3WEEB 1RDDA 2Q1NA 4CJQA 4EHUA 3J7ZO 1YJ9N 4A5AA 3CJCA 4G1QA 4JYAK 3RSEB 3WXKA 4G9ZA 4CJTA 4E1JA 4JKBA 2YHAA 1NOZA 1RT6A 4H0TB 4A62A 4HUFA 3WNGA 1FJGK 5EVZA 4DR4K 4U7BA 3O9TA 4FWRA 4WE1A 2A1RA 5C0YA 3O1WA 1NGJA 1N5YA 2W41A 1JLGA 1Z25A 2OYQA 3DWLA 1K6YA 3AGKA 4W5TA 2IVPA 1KQSM 2X6NA 1C0TA 2W40A 3OS1A 2UUBK 1SKWA 4CIEA 4IO9L 1YHQN 4FLXA 4E7IA 3WEEA 4M3UA 3THXA 3HPGA 4DFPA 4H0XB 3RSEA 2XY8A 2NNWA 3SMSA 3WNHA 2AP1A 3MWPA 4V19S 1BQMA 3F9KA 4FPBA 2ETJA 4E0DA 4Z4FA 3K59A 3SYZA 5C42A 3T3FA 3OYIA 2XY7A 5AQXA 4BC5A 3AVIA 1GOBA 5TKYA 3VQPA 3UKRB 3UB5A 4IG3A 4GW6A 2HF4A 4IEEA 1GOAA 3GL1A 3V4IA 4FPAA 4B1XB 2HVIA 4H03B 4EZ6A 4FZZA 1U48A 1BWFO 4F2SA 2UXBK 1QQNA 3QICA 4KREA 1JLFA 3AVLA 1FKPA 1HQEA 5CZ2A 3LDOA 4FLVA 1HNVA 4LH5A 3SBGA 3CJBA 5KGXA 4DB3A 2OPPA 4PWDA 4FCYA 4XIUA 3OYEA 1OH8A 1GLLO 1L5UA 1OKJA 2X6SA 5EOYA 4I6MB 4WFNL 1VQ8N 3I56N 3RRHA 2HNDA 2F8TA 2BANA 4FJMA 2P5GA 3NVKA 1QQCA 2GBZA 2HHSA 3H6EA 4IJAA 3UKRA 4CJ5A 4H5RA 3SPZA 4BC4A 2NRRA 2HMPA 3WQUA 1IV0A 4RW6A 3MXIA 1YF5L 1DLOA 3DRRA 1RBTA 2RPIA 5C12A 4GKJK 3ENOA 4YY3K 5IT9O 4EHTA 1EP4A 2R7YA 1Z05A 3N4PA 2OPQA 3HBTA 4FWKA 1KD1O 1NGGA 3ZSXA 4JK8A 3RWUA 4FZXC 3CC4N 2V51B 2F9TA 4NYFA 3O8MA 4DHYA 1L3UA 4DSIA 5AQHA 3ZT2A 4JS5A 1LCUA 1LAVA 3TTDA 2FF3B 4NO7A 4BR5A 4O55A 4YFUA 3HM9A 1TL1A 4FWQA 3K5MA 2Z1JA 4FLTA 3P31A 2Y1IA 1SQKA 4I2QA 3IG1A 1S1WA 3U9ZA 4HCBA 1ASUA 1N36K 3B6PA 3NE6A 4CJ3A 3MX2A 3D2EB 3ZSRA 3CXCM 1T44A 1S1XA 1GLDG 4FWSA 1HYVA 3O9SA 3PIOL 1NK7A 3G71N 1IKVA 3HSCA 2KHOA 3HPHA 4K25A 3VQAA 4X64K 4DLGA 4KB0A 2VWBA 3P38A 4CJVA 3QERA 4ILJA 2BE2A 2GUIA 1VSJA 1ATSA 2HBJA 5HLFA 4H4MA 2B5JA 4CF1A 3PIPL 4DUZK 2V7ZA 4C1NK 5AQLA 3LZIA 4N76A 3VGLA 4CF2A 3OYMA 3VGMA 4BE1A 4QCLA 3ZX2A 4EZ9A 3A5NC 4FLUA 4BRHA 3O4NA 2AJQA 1VSMA 4GV6A 4YOUA 4CBUA 3CCVN 4DUYK 1SUQA 3J80O 3PO4A 2IOCA 3NGIA 3M8SA 4JI0K 3OJSA 1LWCA 4DFKA 4AH9A 2XY5A 3ID8A 2W42A 3AA3A 2OZSA 3F2KA 4BROA 4O5FA 1NWKA 5JICA 2D0BA 5BRFA 4BRIA 1U2VB 3NF9A 4FWOA 1IKXA 4BY9C 3NDKA 3C0BA 4BRFA 3NF6A 1UWBA 4K8ZA 4QS9A 4KH6A 3MECA 4M45A 1JCFA 3CD6N 2ZD1A 3ZETB 3E9PA 3S3MA 3K2PA 2Q36A 3MN5A 4J2EA 3HK2A 2O4IA 4CZMA 3T19A 5KGWA 3MDQA 4EP5A 4IDKA 1ASVA 1ZBFA 3GDQA 3O6WA 3LM2A 1NLVA 2ATQA 3O3GA 1HR0K 4ELTA 4W5QA 4BRNA 3L4QA 5FPMA 3NAEA 2B6AA 1WSIA 2P9UB 1NGCA 1XNRK 4W5NA 3THYA 3T1AA 2IC3A 1DTQA 4WYBA 3HRGA 3SK3A 2F4VK 5AQIA 2ASOA 1HNIA 4E3SA 3QETA 3THWA 4Q0BA 1VK0A 3HTVA 4Z4IA 3FR0A 3VEVA 5AQSA 3AGRA 3ITHA 3AVNA 3BY5A 5AQMA 3DYAA 5EU7A 2FSNA 4YOYA 1ZYQA 3G25A 4BR0A 4DQSA 4DSEA 1HQUA 4BVOA 1QZ6A 1KVBA 3NF8A 1IKYA 1DTTA 1GLJO 2EWSA 1VQKN 5AQTA 2WOMA 1BG3A 4OPKA 2P9KB 4FJJA 3NGZA 4FLWA 1KAYA 1WNSA 3SUNA 4BREA 2KQ2A 3U3GA 5KQ8A 3V81A 5DM6L 5H1SQ 4DFMA 2HHXA 4DR5K 2NRZA 2VWJA 2A1SA 2P9UA 5EXWA 1Q82O 4M63C 1VHXA 3MWTA 2G8KA 1GLBG 5GAGP 3VENA 2DPNA 3HOSA 2O8CB 3CJ7A 1ITGA 4KBOA 4Z4GA 4B3OA 5GADP 2HNYA 3U9DA 3DI6A 4PQUA 3UE5A 1BDGA 3E66A 1JLEA 4HWIA 1RILA 2JLEA 2QKBA 2KTQA 1EXQA 3AVGA 4MLHA 4W5OA 4FOEA 3DM2A 1YAGA 4O44A 2OPRA 3BEXA 3T7ZA 4H0OA 4DFJA 3VQEA 3LPTA 3MCPA 5IWAK 4HUGA 1WB9A 2P1JA 3TABA 4FK4A 4YHHK 3FFIA 4OKJA 4DR7K 3BF3A 4FK2A 4O8UA 3JYTA 1P8ZA 5J2PA 5C2FA 3AVBA 3L2RA 2ZF5O 3VQ4A 4CJWA 3IMXA 3WNEA 1YT3A 3I0SA 2NRHA 5FRNA 3M3ZA 2Q0UA 2OA8A 4DQIA 3KLGA 4CK2A 3VPZA 5HL7L 2HB5A 2YHBA 1XMQK 1YITN 1RDUA 2AA4A 4LF8K 3QNOA 4I9LA 4Y1CA 2GWJA 4CHPA 2VQFK 2O8FB 3A5OC 1T6DA 2GEMA 3FZMA 2RHKA 3O1BA 3VQ9A 3SI6A 3FZKA 1TVRA 4A2BA 4H5TA 4DCHA 1ZXOA 1TUYA 4KH4A 2HHUA 3KD1E 3PO5A 4DTJA 5BR8K 3P1GA 4UY8O 5HRNA 3VEXA 4Y1DA 3CFPA 4FJLA 2UYTA 4GNIA 3MEDA 5HROA 1A5WA 1Y64A 1SZ2A 3HPOA 3M8RA 5T7BA 3RR7A 3QFUA 3ULEA 4FJHA 3A8YA 1NBWA 1YVUA 4BE0A 4ILHA 3PSIA 4BR9A 1TKDA 2W6KA 4GVMA 2BDPA 1IKWA 3S3OA 4QOZB 4KH5A 3VGKA 1YI2N 2O8FA 4TSXA 3I55N 4OPHA 4JK9A 3VN5A 2NZTA 2YHXA 4H0YB 3A2FA 2ASPA 4OLAA 4A61A 3BZKA 3FFKB 2P5OA 1BIUA 1LAWA 1JCGA 2D5RA 3ZT4A 2ZJQL 4ISFA 4ISGA 2DFHA 3O08A 5CZ1A 1YTAA 4B9LA 4CFDA 3D0PA 2E2OA 4GV3A 1XC3A 4X62K 1QS4A 3IRXA 3TR8A 4KV8A 2FBXA 4JLHA 1HNWK 4B9UA 5M1NA 5LMUK 1RDAA 4H8KA 3QEWA 5AZIB 2CH6A 1JJ2M 2UUCK 1LWFA 1C1AA 2O8BB 4CEZA 4FJ9A 4JKAA 4JI8K 3DXKA 4RG8A 5BPMA 3IDHA 1C0UA 1TK0A 4QS8A 5JMVA 4B1WB 3DRSA 3TTFA 2KZMA 4FM1A 2FBTA 1D4XA 3IS9A 3AA5X 3CCUN 1YIJN 2QWLA 4CHNA 4O0IA 5KPZA 2PYJA 1V4SA 3OYHA 1NOYA 1CZAN 1J5OA 4DQPA 4JD2A 3LWLA 3L2UA 1NGEA 1TL3A 3K9JA 4CJFA 4KHPK 2P9IA 2VGNA 4LFBK 1KVAA 2YNGA 5FPDA 2E1YA 3ID6A 1V4TA 3L2WA 4RCHA 3NMUA 4C8MA 5AZIA 2KW4A 1IBKK 4CFAA 3KLIA 4DTOA 4JKHA 4CZIA 4FXDA 3CCJN 1NGIA 4CHYA 2O8BA 1NGAA 3A0IX 1NKCA 3K57A 4JKEA 4DF4A 1BI4B 1G15A 4B1ZA 1MDUB 1I3AA 1NMDA 1EX4A 1WSFA 3VQDA 4BC3A 1XWLA 1D9FA 4FZYA 1NNEA 3PLAA 4CZGA 2KKZA 3V1QA 4MDBA 4BQZA 4E7LA 3ZSOA 4LD0A 3ZSYA 2G8IA 1NK9A 4CGDA 3L3UA 1OH6A 4C8NA 1KVCA 3AAPA 1VSEA 4KTZA 4J2BA 4XH4A 4CGHA 3T69A 2YNHA 5BPNA 4F3TA 5I3UA 2E88A 4A2AA 4JI2K 4CERA 1K9MO 2RE2A 1JKHA 4BWMA 4FJIA 1W97L 5FLXO 4BACA 1J5EK 3AARA 4AHRA 1ZBHA 1C0FA 4N47A 5K14A 4CJSA 1RT5A 1BI4A 3AVKA 2QWNA 3A5LC 1NU0A 3AO4A 4DU4A 3SUPA 4LFCK 3QEIA 1QVGM 2GV9A 3LDNA 4FJ5A 3QNNA 3F9MA 3H46O 2BGGA 3PX4A 1W2BM 4XEIA 1X9MA 4JI6K 4IG0A 3U8XA 3SV3A 1WSJA 1QHTA 1WSGA 3TAGA 4CE9A 1Q7YO 1WLJA 4CEQA 2IDOA 1L3VA 3CFOA 3LAKA 5CY4A 3CFRA 4C8KA 2QWRA 4K8XA 4DTSA 4DSLA 3NHGA 1TYQB 4FVUA 3I8DA 4MO4A 4NB4A 1HPMA 3R8EA 3S9HA 4AHVA 5GAHP 1S1UA 1BISA 1VSIA 3CQXA 3B8AX 1Q81O 3ISNC 5AR0A 5J2NA 2OTLN 1VQ6N 1X1PA 4Q5VA 1HKBA 3T1YK 2BUPA 4DV3K 2NUBA 3H3OB 4BRKA 5C24A 1NGDA 1K8AO 2UXDK 3DRPA 2H3GX 4O5BA 5LJVA 4WFBL 3AA4A 1JL1A 3TU5A 3VESA 3RTVA 4B9VA 2QWQA 4DWIA 3V1OA 1S22A 3L2QA 5AQRA 2QWMA 5E41A 2A5XA 3K5LA 1FKOA 1VQMN 4ZHRA 1UOCA 3ZSZA 1J9AA 3SZ2A 3DAWA 2RN2A 5GIOA 1IJJA 5AQNA 5JS2A 4CJ4A 1KTQA 3I8BA 3O80A 4IKFA 3O9QA 2E8AA 1TYQA 4JI1K 3HO1A 4B1YB 3NFAA 4DV6K 1ZBIA 4BDYA 3E01A 3E1YA 1SL1A 3UIQA 3MEGA 4DTXA 3NH1A 1HPZA 3PUFA 4IZ9A 1RBSA 3TSQA 2DFEA 2HOEA 4IOXA 3VQQA 1XQSC 1HJOA 5AQZA 5F2RA 1SKRA 3QBXA 2YV0X 4WF9L 4JKFA 1VQ9N 1ATNA 4FL9A 1RTDA 4OJRA 3WXMB 4Z4HA 3CC2N 1DEJA 4C8OA 1IG9A 4WFAL 4I6MA 4BRMA 1I94K 4BRCA 3ZT1A 2VGMA 1VAZA 4BGBA 3SMPA 3HJFA 3CCLN 3CCQN 3W0LA 1RGIA 2CGJA 4PY5A 4JEPA 4IOAL 1J53A 5I42A 3LP1A 4AHTA 4IXCA 1CZBA 2E2QA 1QHAA 1T3VA 2OTJN 4LF7K 2BTFA 3VETA 1SL2A 2D0AA 3G0ZA 5JLFA 2P9NB 2HW3A 3PV8A 4R5PA 4JI5K 4KI6A 1E3MA 3ALYA 3CYMA 3VQCA 4H4OA 4CJPA 3C6UA 4B3RK 3LDSA 3EY1A 1RT4A 4E1NA 5KTQA 4HVJA 3MX5A 4R79A 4ID5A 4DV0K 4W5RA 1HKGA 2CGKA 3E9OA 2QTDA 3P39A 5JLHA 3WNFA 4CEOA 1S3XA 2E2PA 1HNZK 1QSSA 3VOVA 4A59A 3KHYA 4DR3K 4JN4A 3VEYA 3KJVA 1Q8IA 2Y1JA 1K8KB 3D6RA 3DLKA 4IFEA 4CJ7A 3OYJA 3SCXA 1NJWA 2Q0RA 3D2EA 4KHWA 1RDWX 3NH2A 1U6ZA 1TK8A 4PHTX 4DQQA 2X78A 4DTMA 2FSKA 4RWTA 1NM1A 2VCPA 3SPYA 4JAXA 4BRLA 3P83D 3QEPA 4BRAA 1NK6A 4CVNE 2F7TA 2P9NA 4M41A 3NBPA 1HMVA 5ELZA 2A3ZA 4IO8A 1SL0A 2KFNA 4JRQA 5TKWA 4M7YA 2YJFA 4J2AA 2E4LA 3K5OA 4Z4CA 3HL8A 2RKIA 5GAEP 2VG7A 2YNFA 3C7NB 4BRPA 3RMBA 5SZTA 1N6QA 2WTUA 3V9SA 4DMNA 1QTMA 4FW2A 2QI2A 4K43A 1K8KA 3EL2A 1NGHA 3P4IA 4CEDA 1QE1A 3RMAA 4HTLA 2E2NA 3BGRA 3OVNA 2E20A 3R6MA 4B9TA 1W7AA 4KHSA 4JHDB 2IIRA 3BF1A 4JKCA 1U2VA 1Q9YA 2UUAK 3MXMA 4FJGA 2G8UA 3SBTA 1C0MA 3R1XA 2KFZA 3EZWA 4CHZA 4E89A 2A42A 4X66K 3O9RA 4CHQA 3ZETA 5BRDA 4K41A 3ENHA 2GELA 5CHIA 3SQ2A 1KAXA 4DTUA 4I7FA 1A5VA 1LW0A 2D4WA 3HYFA 4JI7K 3OBWA 1QQMA 2NRVA 1LW2A 2P9PB 4CJRA 3O3FA 3ZX0A 3NCIA 3C7NA 4KPYA 5AQUA 3BZCA 4CZEA 5M1FA 1RDBA 3CF5L 1D9DA 2P9LB 3FE1A 4RW7A 4B8AB 3CJAA 4DS5A 1VQ4N 3QIPA 3LAMA 1ZBUA 3CHWA 5DM7L 3RR8A 5ADXH 4BGAA 3FGUA 5EX5A 4DV4K 5LMNK 4CZFA 4LF4K 4I9QA 3IKMA 4JHDA 3WXJA 2RF2A 3K9KA 4GY2B 3KLFA 2QWOA 4CFBA 3WT0A 4F4KA 5JVHL 3LZJA 1X9SA 1YVNA 2VG5A 2PY5A 1RTHA 3KK2A 2WFBA 4BC2A 2YKNA 2P9KA 1VQ5N 1QVFM 1VSKA 1E4GT 4YORA 2P9PA 3JXUA 3D2FB 2Z1HA 2IVNA 5J2MA 4DR1K 3SJJA 2GUPA 4FM0A 1NKEA 3J7AP 2P9LA 5LL6Z 2YNIA 3U6FA 3N4QA 3K5NA 5HRRA 3ZT0A 4HTUA 2O8CA 2YKMA 5FDLA 4CW7B 1QSLA 4FYDA 1J54A 3M8QA 5E84A 3LALA 2QXLA 1R0AA 3VMFB 3QEXA 3W3DA 3IAYA 1ASWA 2OPSA 3MN9A 4CEFA 4H5WA 3CMAN 3AVJA 2NLXA 1XHZA 1SKSA 2KLAA 3LM9A 3HI0A 1N33K 1C6VA 3MMVA 4BVPA 5I9EB 4CZJA 4FJKA 4GMJB 4IJNA 2Z1GA 1JLAA 3CCRN 4KAZA 3KLHA 5M1PA 3M5RA 3SJHA 4CZHA 4CFCA 1G99A 3H45C 5J2QA 1W9HA 3HSTB 3CIPA 5JVGL 3D2FA 3L8BA 1L3TA 1VQLN 1TAUA 2P51A 5SWMA 4ID1A 3QMLA 2O8DB 4M3YA 1NK0A 5B8HA 4NXNK 1T7PA 4Z4EA 4FJ7A 4BRGA 1WAJA 5BN9A 3DLEA 3OA9A 3SUOA 1GLCG 1N34K 5HOOA 2HNZA 4FLYA 1GLEG 3CCMN 4KHUA 5AQGA 4DTRA 1XI1A 3OS2A 1YJWN 4DV1K 5AQFA 2XY6A 4DSKA 5AFUH 1RBUA 4DR6K 3OYLA 3C94A 2VYPA 4C1NI 4CGIA 1YXQA 3KLEA 3T1HK 3WQTA 4CK3A 5AQVA 3ENBA 3VA0A 1NJIO 1VRTA 3VTIA 5BRHA 2JWLA 2OANA 2F96A 1VQON 3GG4A 5FPEA 4BRDA 1RTJA 5KI6A 4H5NA 4CHOA 1IBMK 1RNHA 4CBWA 4CK1A 1S72N 1CXUA 2Q97A 1RT7A 1TKTA 3AVFA 3PX0A 1K73O 3HXMA 5C15A 3PY8A 2EHGA 2QA4N 3IFRA 1C1CA 3OYBA 1T6CA 1S1VA 3AVMA 4E19A 1Z26A 1VRUA 2FF6A 2V7YA 3CJ9A 4NYNA 2NRXA 3RRGA 4OPJA 2A40A 3A5MC 1U49A 4C23A 3CERA 3EO3A 3V9ZA 3L3VA 5C25A 2YHYA 3QDKA 5AQKA 2UU9K 3CM5A 1KC8O 5E26A 1OH7A 5EY4A 4FOIA 1ILYA 4ELUA 1KSPA 1BIZA 2ZJRL 3ATVA 3LP0A 3CM6A 3QO9A 2IVOA 5AQPA 1VQNN 3DLBA 1Q86O 1ZC6A 4NLBA 1EETA 4N56A 1BHLA 4DSFA 3GBTA 3M1FA 1VSDA 3Q7BA 2ITGA 1WUAA 3AO3A 4M3XA 2XRIA 3D7EO 4N5SA 4FWPA 3SAFA 4DLEA 1P90A 1UAXA 4O4GA 4IBNA 5F0XA 3C6AA 3EN9A 3OYDA 2B4JA 4E1MA 3QINA 1C0GA 4ILGB 1IG8A 4ELVA 5CYMA 3J81O 1RT1A 4FWMA 2E6LA 3CJ1A 3CQYA 3MN6A 3SV4A 4NCBA 1TKXA 4CIFA 3NH0A 4O0JA 3F5TA 2HHVA 4RTFD 1NG9A 1EKEA 5M1KA 4B9QA 3VERA 3HVRA 3M8PA 3KWIA 4CF0A 3KVGA 2ZQBA 3EEQA 3FZFA 3RMDA 4FWLA 2W6LA 3L0QA 5LJWA 1M1KO 2YHWA 5C10A 4CD1A 3WUHA 5BREA 3THXB 4JRPA 1OVQA 3SNNA 3OYFA 2Q2RA 2D0OA 3R9PA 3MN7A 3VA3A 4KTQA 1NGBA 3ZT3A 4B1UB 3R3LA 3S41A 3O4WA 3ZEUB 3H1VX 3TAPA 2D1KA 3LDQA 2UXCK 4KFBA 4CEBA 2HBMA 2ASMA 4CBXA 3TSPA 2EX3A 1SV5A 1OH5A 4BDPA 3V9WA 2A41A 4DV2K 3HZ6A 3MEEA 4RW4A 5AZJB 1FW6A 2ZWHA 1JLBA 2QXFA 2E6MA 4LF9K 4DG1A 3ZLJA 2PAVA 5CE3A 3I0RA 1SS6A 1KRPA 1VSLA 2PZSA 3CC7N 3KKRA 3DLHA 4LC9B 1BO5O 4CESA 4CJUA 2A6AA 4JKDA 1VSHA 2I5JA 4IWVA 2G8WA 1NGFA 3AAQA 2ZM6K 5FPNA 2FXUA 1JLQA 3BUZB 1UA1A 3EYZA 1EWQA 3AY9A 3QESA 4LSNA 1GOCA 4ICLA 4YOVA 1ZBSA 3ZEUA 2KZZA 1QZ5A 4M3TA 4E7KA 4IFVA 1WBBA 4B08A 4CZKA 2XHBA 5AZJA 1U04A 4OGEA 3VTHA 1E4FT 2HBKA 3QEVA 2X74A 4OKEA 1O13A 4MFBA 3TAQA 4HUEA 2YI1A 4A57A 3SUQA 4CF8A 2G8VA 4J8FA 2J4RA 2PBDA 3TANA 1WSEA 1W0HA 4AQYK 2DTUA 4B3SK 4OGCA 4BR4A 5J1EA 4JI3K 3AVCA 4LF6K 4CEAA 5BN8A 4X65K 2HBLA 2ZGZA 4F9OA 2OCEA 4F2RA 5KPRA 1TGOA 1BCOA 1S1TA 2FBYA 3AV9A 4WQ4C 4GKKK 1XHXA 4PKGA 3TPQA 3OYCA 4OPAA 4BE2A 1X9WA 3G10A 4YOWA 2O4GA 3SQ4A 3VEOA 3H08A 1QSYA 1IO2A 3K58A 1GLAG 5BR9A 4JS4A 3TTCA 1WBDA 1HYSA 3GOIA 5M1OA 1BGXT 1X3MA 1WOQA 4YNQA 3PX6A 2HHWA 3C6TA 5F1XA 3AO1A 2F9WA 3ZCMA 3AO5A 4CF9A 2DFFA 4KRFA 3KKSA 4CGGA 2D0CA 4GVEA 3O5BA 4Z0UA 3RMCA 1KXPA 4OLBA 3PSFA 2V52B 4Y0WA 4BDZA 4JI4K 2HMIA 3KK7A 5A2QO 1VQPN 3F73A 2OZMA 4MLEA 4HCCA 1UA0A 1BCMA 3QIOA 3CI5A 1IH7A 3FZLA 3OS0A 4FW1A 5AQYA 3HOTA 4NCAA 2ZE2A 1YTUA 1J6ZA 4KO0A 3O4QA 1N32K 4YDUC 1JXEA 1T8EA 4RW8A 2Q31A 4BR7A 1RFQA 3TARA 1XNQK 3EE8A 5CR4A 5GINA 2VQEK 4MQ3A 1NKBA 1BA1A 2QW9A 3MXJA 3WXLA
chains in the Genus database with same CATH topology
3MWPA 1BUPA 4IEIA 4FPBA 4MO5A 3ATUA 1ESVA 2WFBA 4L3QA 4BC2A 1HKCA 2P9KA 4JKAA 1VQ5N 3DXKA 4FO0A 5AQXA 4BC5A 1QVFM 1E4GT 4YORA 5TKYA 5BPMA 4IOCL 3UKRB 2P9PA 3IDHA 3D2FB 1BOTO 3JXUA 3UB5A 4AF1A 2HF4A 2IVNA 4IEEA 4QS8A 2GUPA 3GL1A 5JMVA 4FPAA 4B1XB 2P9LA 4B1WB 4YOXA 3TTFA 3OHRA 4H03B 3N4QA 1D4XA 3CCUN 5AQWA 1YIJN 2QWLA 5KPZA 1V4SA 1BWFO 1R59O 1CZAN 1QQNA 3WXIA 3QICA 4JD2A 3C65A 5E84A 2FLOA 1BA0A 2FSJA 1NGEA 2QXLA 3K9JA 3VMFB 3LDOA 3W3DA 2P9IA 2VGNA 2JWKA 1X3NA 3MN9A 4H5WA 1DT9A 3CJBA 3SBGA 3KZBA 5FPDA 2NLXA 3CMAN 2KLAA 3LM9A 2E1YA 3HI0A 2YCHA 1V4TA 3ID6A 3MMVA 4BVPA 4DB3A 5I9EB 4CZJA 4RCHA 3ZYYX 5MLCQ 3NMUA 4H5VA 4IJNA 1GLLO 4BG8A 5AZIA 1OKJA 5EOYA 4I6MB 3CCRN 4GV9A 4JKHA 4WFNL 4CZIA 1HX1A 3M5RA 5M1PA 1NGIA 3SJHA 4CZHA 3I56N 3CCJN 1VQ8N 1NGAA 1BU6O 3A0IX 3VF2A 1G99A 4FSVA 3NVKA 3H45C 4JKEA 3H6EA 4IJAA 3CIPA 3UKRA 4H5RA 3D2FA 1MDUB 4B1ZA 1NMDA 4BC4A 5JVGL 2NRRA 2HMPA 3WQUA 3JS6A 3BP8A 4BC3A 1YF5L 2WUSA 1VQLN 3PLAA 4AM6A 5C12A 3ENOA 3VEZA 3E9LA 4CZGA 3QMLA 2KKZA 4MDBA 4BQZA 5AZIB 4EHTA 3OW2M 5B8HA 3H1QA 1Z05A 3N4PA 3HBTA 3UKUB 1YJNN 4FWKA 4BRGA 1KD1O 1NGGA 4WQ4A 1TUUA 4JK8A 3RVCA 3CC4N 2V51B 5BN9A 3OA9A 2F9TA 4K42A 3O8MA 4DHYA 1GLCG 4JKGB 5AQHA 5HOOA 3AAPA 4PKHA 1GLEG 1LCUA 3TTDA 2FF3B 3CCMN 4XH4A 5AQGA 4NO7A 3T69A 4BR5A 5BPNA 3EE9A 1YJWN 1DKGD 4FWQA 5KQDA 5AQFA 4DKWA 5AFUH 1QQOA 4C1NI 1ATRA 2VYPA 2E88A 1YXQA 3P31A 4XH5A 4A2AA 3WQTA 2ZJPL 1SQKA 1K9MO 2RE2A 5AQVA 2P9SB 1W97L 3ENBA 3U9ZA 1Z6RA 1NJIO 3VTIA 5BRHA 2JWLA 2OANA 2PFUA 3AARA 3GG4A 1VQON 5FPEA 4BRDA 1C0FA 3LDPA 3MX2A 4H5NA 3D2EB 2QWNA 5AQQA 3A5LC 4CBWA 3CXCM 2WC9A 1S72N 1T44A 2Q97A 1GLDG 2BH1A 1OVYA 3DXMB 4FWSA 1K73O 3O9SA 5C15A 3PIOL 4PKIA 3G71N 2QA4N 5BPLA 3IFRA 3LDLA 3HSCA 1QVGM 4EAHD 2KHOA 1T6CA 3LDNA 4K25A 2VWBA 3P38A 4AM7A 3UKUA 3F9MA 3H46O 2FF6A 4ILJA 2V7YA 1W2BM 3CJ9A 4XEIA 2NRXA 1ATSA 2HBJA 3NVMA 2A40A 3A5MC 4JKGA 4C23A 3U8XA 3CERA 3EO3A 3PIPL 2V7ZA 2YHYA 3QDKA 5AQKA 5AQLA 4C1NK 1Q7YO 2GTDA 3VGLA 1KC8O 1MWKA 5E26A 3VGMA 3CPWM 2QWRA 3ZX2A 5EY4A 4FOIA 1ILYA 3A5NC 3MK6A 4M7XA 4BRHA 2ZJRL 4ISEA 1DGKN 1TYQB 4A5BA 4FVUA 3ATVA 3M6GA 4MO4A 4NB4A 4YDUA 3TSUA 1HPMA 4WQ5C 3R8EA 2IVOA 5AQPA 2P9SA 5GAHP 1VQNN 4GV6A 2QWPA 1Q86O 1ZC6A 3CQXA 4YOUA 1YUWA 3B8AX 4NLBA 4CBUA 3CCVN 2GWKA 1Q81O 3CPEA 5AR0A 2OTLN 3IUCA 1VQ6N 1H1VA 3GBTA 1HKBA 3M1FA 2BUPA 3DLLL 3ZX3A 3H3OB 3Q7BA 4BRKA 1WUAA 4EIAA 1NGDA 3DXMA 1K8AO 3ID8A 1EQYA 2H3GX 3F2KA 3H3NO 4BROA 5LJVA 3D7EO 3QFPA 4WFBL 4O5FA 1NWKA 5JICA 3VESA 4OO1J 3TU5A 4MDAA 5BRFA 4BRIA 2QWQA 1U2VB 4FWOA 3VF6A 4BY9C 1S22A 4FWPA 4BRQA 3C0BA 3SAFA 4BRFA 3VEWA 5AQRA 2QWMA 1P90A 3GE1A 3ULEB 2A5XA 4BG9A 5F0XA 3C6AA 3EN9A 4KH6A 4QS9A 3G4SN 1VQMN 1JCFA 2ZGYA 3CD6N 1C0GA 3ZETB 4ILGB 3E9PA 1IG8A 2Q36A 3L4IA 3DAWA 3MN5A 3J8AA 5GIOA 1IJJA 4CZMA 3MDQA 5AQNA 3O80A 3I8BA 4FWMA 3CJ1A 3GDQA 3O6WA 3CQYA 3LM2A 1NLVA 3O9QA 2E8AA 1TYQA 3MN6A 3OBYA 3QBWA 4B1YB 4BRNA 3L4QA 5FPMA 3F5TA 4RTFD 3KWGA 3E1YA 4BR2A 5M1KA 4B9QA 3VERA 4JNEA 2P9UB 1NGCA 5GIPA 3KWIA 3KVGA 1Q18A 4IZ9A 1VQ7N 3FZFA 4WYBA 3HRGA 3TSQA 2HOEA 4IOXA 4FWLA 1XQSC 1HJOA 5AQZA 5F2RA 4YOTA 3QBXA 2ASOA 3L0QA 5AQIA 3SK3A 5LJWA 2QEXN 1MWMA 4WF9L 1M1KO 2YHWA 4JKFA 2E1ZA 2YX6A 3HTVA 5C10A 1ATNA 4CD1A 4FL9A 3FR0A 3WUHA 3VEVA 4CD3A 1VQ9N 5BREA 3WXMB 5AQSA 1SAZA 3AGRA 5ADXA 2Q2RA 5AQMA 2D0OA 2FSNA 3R9PA 3MN7A 3G25A 1DEJA 4YOYA 3CC2N 4BR0A 4WFAL 1NGBA 4B1UB 2D0PA 3R3LA 3C6HA 4I6MA 3S41A 4BRMA 4BVOA 1QZ6A 3O4WA 4XH1A 1XUPO 3H1VX 3ZEUB 2D1KA 3FZHA 3LDQA 2HSTA 4BRCA 2YJEA 2HBMA 1VQKN 1GLJO 2EWSA 5AQOA 1X9JA 5AQTA 2ASMA 2VGMA 1VAZA 4BGBA 2WBNA 3SMPA 3TSPA 1BG3A 4CBXA 4Z94A 3SAHA 2P9KB 3CCQN 3CCLN 3W0LA 1RGIA 2A41A 3DXKB 3HM8A 1KAYA 3EKUA 2CGJA 3HZ6A 4BREA 3G6EN 5AZJB 5KQ8A 2CGLA 3SLCA 5DM6L 5C2DA 2ZWHA 5H1SQ 5LY3A 4JEPA 4IOAL 2PAVA 5CE3A 4IXCA 2NRZA 2E2QA 1QHAA 1T3VA 4U67L 2P9UA 5EXWA 2OTJN 1SS6A 3MCAB 1Q82O 4M63C 2BTFA 3VETA 3MWTA 2I7PA 3CC7N 1GLBG 5GAGP 4O8KA 4LC9B 3VENA 1MA9B 5JLFA 2P9NB 2DPNA 4FWNA 3HOSA 1BO5O 3CJ7A 3CCEN 4KBOA 2A6AA 4JKDA 3U4LA 2NRWA 4JD2B 4IWVA 5GADP 3U9DA 1NGFA 1JCEA 2CH5A 1BDGA 3AAQA 3E66A 3O9UA 4HWIA 5FPNA 2FXUA 3UE5A 2P9IB 1N8RO 4NLCA 3MX5A 4R79A 3BUZB 1GLFO 4MLHA 3AY9A 1HKGA 2CGKA 3E9OA 2QTDA 3FLCO 3P39A 4FOEA 5AQJA 5JLHA 1JJ2M 3SAGA 1YAGA 1S3XA 4CI6A 2E2PA 2QM1A 3BEXA 3EKSA 1ZBSA 3T7ZA 3ZEUA 4YOVA 3VOVA 4A59A 4H0OA 3KHYA 1QZ5A 2HF3A 4JN4A 3VEYA 1K8KB 3D6RA 4IFEA 4CJ7A 3MCPA 4JK7A 2Q0RA 3D2EA 1RDWX 1U6ZA 3VF4A 2GX9A 4CZKA 5AZJA 4H0VB 4PHTX 4PL7A 1M90O 3Q7CA 2FSKA 3BF3A 4RWTA 4O8UA 3VTHA 1NM1A 1P8ZA 4CZLA 1E4FT 2HBKA 5C2FA 2ITMA 1KAZA 2ZF5O 1O13A 4BQLA 2VCPA 3IMXA 2YI1A 4A57A 4JAXA 4BRLA 3CETA 2NRHA 4BRAA 1EO1A 4J8FA 2J4RA 2PBDA 2F7TA 2P9NA 3M3ZA 2Q0UA 4IDHA 4B1VA 4WQ5A 5KPTA 5ELZA 2A3ZA 4EFHA 3VPZA 4IO8A 3CMEN 3LL3A 4BR4A 5HL7L 5TKWA 4M7YA 2YJFA 1YITN 1RDUA 2AA4A 5BN8A 1HUXA 2HBLA 2ZGZA 4F9OA 5KPRA 1LOTB 2NRTA 2GWJA 2I7NA 4WQ4C 5GAEP 3I33A 3C7NB 4PKGA 3TPQA 4BRPA 4OPAA 3A5OC 1T6DA 2GEMA 4YOWA 3FZMA 3L6QA 2QI2A 4QS7A 3VEOA 2RHKA 4K43A 3O1BA 1GLAG 1K8KA 3EL2A 3FZKA 5M1QA 4A2BA 5BR9A 4H5TA 4DCHA 1ZXOA 3TTCA 1TUYA 4KH4A 3GOIA 5M1OA 1NGHA 1X3MA 3P4IA 1WOQA 3QB0A 5AFUA 4HTLA 4UY8O 2E2NA 3CCSN 3VEXA 4PL8A 4H0PA 2E20A 1HLUA 3DJCA 3R6MA 5F1XA 4DQ8A 2F9WA 4WCEL 3WEEB 4JHDB 2IIRA 2Q1NA 3BF1A 2UYTA 4JKCA 1U2VA 4GNIA 4EHUA 3J7ZO 1YJ9N 1Y64A 4A5AA 1SZ2A 3CJCA 3SBTA 3RSEB 3QFUA 3R1XA 3WXKA 3EZWA 4G9ZA 3ULEA 4E1JA 3A8YA 1NBWA 4GVEA 2A42A 4JKBA 4ILHA 3O9RA 3O5BA 3ZETA 5BRDA 4BR9A 4H0TB 4K41A 3ENHA 2GELA 5CHIA 4A62A 1KXPA 2V52B 1KAXA 4Y0WA 2D4WA 5EVZA 3OBWA 1QQMA 4U7BA 2NRVA 3O9TA 4FWRA 3KK7A 2P9PB 3ZX0A 3C7NA 4KH5A 3VGKA 5C0YA 1YI2N 3O1WA 5AQUA 4CZEA 1NGJA 5M1FA 3I55N 4OPHA 2W41A 1VQPN 3CF5L 2P9LB 3FE1A 4JK9A 4MLEA 3CJAA 2NZTA 2YHXA 3DWLA 4H0YB 1VQ4N 3AGKA 2ASPA 3CI5A 3FZLA 4A61A 3CHWA 5DM7L 2IVPA 5ADXH 4BGAA 1KQSM 3FFKB 3FGUA 5AQYA 5EX5A 3HOTA 2W40A 1J6ZA 1JCGA 4CZFA 2ZJQL 4ISFA 4ISGA 4YDUC 3O08A 4IO9L 1YHQN 2E2OA 4GV3A 1XC3A 3WEEA 3IKMA 4JHDA 2Q31A 3WXJA 4BR7A 1RFQA 3K9KA 4H0XB 3EE8A 5CR4A 5GINA 4GY2B 3RSEA 2QWOA 3WT0A 5M1NA 2NNWA 1BA1A 3SMSA 2QW9A 5JVHL 3WXLA 2CH6A 2AP1A 1YVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUP A;  4FPB A;  4MO5 A;  3ATU A;  1ESV A;  4L3Q A;  4BC2 A;  1HKC A;  2P9K A;  3DXK A;  4FO0 A;  5AQX A;  4BC5 A;  1E4G T;  5TKY A;  5BPM A;  3UKR B;  2P9P A;  3IDH A;  3D2F B;  1BOT O;  3JXU A;  3UB5 A;  2HF4 A;  2IVN A;  4QS8 A;  2GUP A;  3GL1 A;  5JMV A;  4FPA A;  4B1X B;  2P9L A;  4B1W B;  3OHR A;  4H03 B;  1D4X A;  5AQW A;  2QWL A;  5KPZ A;  1V4S A;  1BWF O;  1R59 O;  1CZA N;  1QQN A;  3WXI A;  3QIC A;  4JD2 A;  5E84 A;  2FLO A;  1BA0 A;  2FSJ A;  1NGE A;  2QXL A;  3LDO A;  3W3D A;  2P9I A;  1X3N A;  3MN9 A;  4H5W A;  3CJB A;  3KZB A;  5FPD A;  2NLX A;  3LM9 A;  2E1Y A;  3HI0 A;  2YCH A;  1V4T A;  3MMV A;  4BVP A;  4DB3 A;  5I9E B;  4CZJ A;  4RCH A;  4H5V A;  4IJN A;  1GLL O;  4BG8 A;  5AZI A;  1OKJ A;  5EOY A;  4I6M B;  4CZI A;  1HX1 A;  4CZH A;  3SJH A;  1NGI A;  1NGA A;  1BU6 O;  3A0I X;  3VF2 A;  1G99 A;  4FSV A;  3H45 C;  3H6E A;  4IJA A;  3CIP A;  3UKR A;  4H5R A;  3D2F A;  1MDU B;  4B1Z A;  1NMD A;  4BC4 A;  2HMP A;  3WQU A;  3JS6 A;  3BP8 A;  4BC3 A;  2WUS A;  4AM6 A;  3ENO A;  3VEZ A;  4CZG A;  3QML A;  4BQZ A;  5AZI B;  4EHT A;  5B8H A;  3H1Q A;  1Z05 A;  3HBT A;  3UKU B;  4FWK A;  4BRG A;  1NGG A;  4WQ4 A;  1TUU A;  2V51 B;  5BN9 A;  4K42 A;  2F9T A;  3O8M A;  4DHY A;  1GLC G;  5AQH A;  3AAP A;  4PKH A;  1GLE G;  1LCU A;  2FF3 B;  4XH4 A;  5AQG A;  4NO7 A;  4BR5 A;  5BPN A;  1DKG D;  4FWQ A;  5KQD A;  5AQF A;  5AFU H;  1QQO A;  1ATR A;  2VYP A;  2E88 A;  1YXQ A;  4XH5 A;  4A2A A;  3WQT A;  1SQK A;  5AQV A;  2P9S B;  3U9Z A;  1Z6R A;  5BRH A;  2OAN A;  3AAR A;  3GG4 A;  5FPE A;  4BRD A;  1C0F A;  3LDP A;  4H5N A;  3D2E B;  2QWN A;  5AQQ A;  3A5L C;  4CBW A;  1T44 A;  2Q97 A;  1GLD G;  3DXM B;  4FWS A;  4PKI A;  5BPL A;  3IFR A;  3LDL A;  3HSC A;  4EAH D;  2KHO A;  1T6C A;  3LDN A;  4K25 A;  2VWB A;  4AM7 A;  3UKU A;  3F9M A;  3H46 O;  2FF6 A;  2V7Y A;  3CJ9 A;  4XEI A;  1ATS A;  2A40 A;  3A5M C;  4C23 A;  3U8X A;  3CER A;  3EO3 A;  2V7Z A;  2YHY A;  3QDK A;  5AQK A;  5AQL A;  2GTD A;  3VGL A;  1MWK A;  5E26 A;  3VGM A;  2QWR A;  3ZX2 A;  5EY4 A;  4FOI A;  3A5N C;  3MK6 A;  4M7X A;  4BRH A;  4ISE A;  1DGK N;  1TYQ B;  3ATV A;  3M6G A;  4MO4 A;  4NB4 A;  4YDU A;  1HPM A;  4WQ5 C;  3R8E A;  2IVO A;  5AQP A;  2P9S A;  2QWP A;  1ZC6 A;  3CQX A;  4CBU A;  1YUW A;  3B8A X;  2GWK A;  5AR0 A;  3IUC A;  1H1V A;  3GBT A;  1HKB A;  3M1F A;  2BUP A;  3ZX3 A;  3H3O B;  4BRK A;  1WUA A;  4EIA A;  1NGD A;  3DXM A;  3ID8 A;  1EQY A;  2H3G X;  3H3N O;  4BRO A;  5LJV A;  3D7E O;  3QFP A;  4O5F A;  1NWK A;  5JIC A;  3VES A;  3TU5 A;  5BRF A;  4BRI A;  2QWQ A;  1U2V B;  4FWO A;  3VF6 A;  1S22 A;  4FWP A;  4BRQ A;  3C0B A;  4BRF A;  3VEW A;  5AQR A;  2QWM A;  3GE1 A;  3ULE B;  2A5X A;  4BG9 A;  5F0X A;  3EN9 A;  4QS9 A;  1JCF A;  2ZGY A;  1C0G A;  3ZET B;  1IG8 A;  2Q36 A;  3L4I A;  3DAW A;  3MN5 A;  3J8A A;  1IJJ A;  4CZM A;  3MDQ A;  5AQN A;  3O80 A;  3I8B A;  4FWM A;  3CJ1 A;  3GDQ A;  3O6W A;  3CQY A;  3LM2 A;  1NLV A;  2E8A A;  1TYQ A;  3MN6 A;  3QBW A;  4B1Y B;  4BRN A;  5FPM A;  4RTF D;  4BR2 A;  4B9Q A;  3VER A;  4JNE A;  2P9U B;  1NGC A;  3KVG A;  1Q18 A;  4IZ9 A;  3FZF A;  4WYB A;  2HOE A;  4FWL A;  1XQS C;  1HJO A;  5AQZ A;  5F2R A;  3SK3 A;  3QBX A;  2ASO A;  3L0Q A;  5AQI A;  5LJW A;  1MWM A;  2YHW A;  2E1Z A;  3HTV A;  1ATN A;  4CD1 A;  4FL9 A;  3FR0 A;  3WUH A;  3VEV A;  4CD3 A;  5BRE A;  5AQS A;  1SAZ A;  5ADX A;  2Q2R A;  5AQM A;  2D0O A;  2FSN A;  3R9P A;  3MN7 A;  3G25 A;  1DEJ A;  4BR0 A;  1NGB A;  4B1U B;  2D0P A;  4I6M A;  3S41 A;  4BRM A;  4BVO A;  1QZ6 A;  3O4W A;  4XH1 A;  1XUP O;  3H1V X;  3ZEU B;  2D1K A;  3FZH A;  3LDQ A;  4BRC A;  2YJE A;  1GLJ O;  2EWS A;  5AQO A;  1X9J A;  5AQT A;  2ASM A;  4Z94 A;  4BGB A;  3SMP A;  4CBX A;  1BG3 A;  2P9K B;  3W0L A;  1RGI A;  2A41 A;  3DXK B;  3HM8 A;  1KAY A;  3EKU A;  2CGJ A;  3HZ6 A;  4BRE A;  5AZJ B;  5KQ8 A;  2CGL A;  3SLC A;  2ZWH A;  5LY3 A;  2PAV A;  5CE3 A;  4IXC A;  2E2Q A;  1QHA A;  2P9U A;  5EXW A;  4M63 C;  2BTF A;  3VET A;  2I7P A;  1GLB G;  4O8K A;  4LC9 B;  3VEN A;  1MA9 B;  5JLF A;  2P9N B;  2DPN A;  4FWN A;  1BO5 O;  3CJ7 A;  4KBO A;  2A6A A;  3U4L A;  4JD2 B;  4IWV A;  3U9D A;  1NGF A;  1JCE A;  2CH5 A;  1BDG A;  3AAQ A;  4HWI A;  5FPN A;  3UE5 A;  2FXU A;  2P9I B;  3BUZ B;  1GLF O;  4MLH A;  3AY9 A;  1HKG A;  2CGK A;  3FLC O;  5AQJ A;  4FOE A;  5JLH A;  1YAG A;  1S3X A;  4CI6 A;  2E2P A;  2QM1 A;  3BEX A;  3EKS A;  1ZBS A;  3ZEU A;  3VOV A;  4H0O A;  3KHY A;  1QZ5 A;  2HF3 A;  4JN4 A;  3VEY A;  1K8K B;  4CJ7 A;  3MCP A;  2Q0R A;  3D2E A;  1RDW X;  1U6Z A;  3VF4 A;  4CZK A;  5AZJ A;  4H0V B;  4PL7 A;  2FSK A;  3BF3 A;  4RWT A;  1NM1 A;  1P8Z A;  4CZL A;  1E4F T;  2ITM A;  1KAZ A;  2ZF5 O;  4BQL A;  2VCP A;  3IMX A;  2YI1 A;  4JAX A;  4BRL A;  3CET A;  2NRH A;  4BRA A;  4J8F A;  2J4R A;  2PBD A;  2P9N A;  3M3Z A;  2Q0U A;  4B1V A;  4WQ5 A;  5KPT A;  5ELZ A;  2A3Z A;  4EFH A;  3VPZ A;  4IO8 A;  3LL3 A;  4BR4 A;  4M7Y A;  2YJF A;  2AA4 A;  5BN8 A;  1HUX A;  4F9O A;  2ZGZ A;  5KPR A;  1LOT B;  2GWJ A;  2I7N A;  4WQ4 C;  3I33 A;  3C7N B;  4PKG A;  3TPQ A;  4BRP A;  3A5O C;  1T6D A;  2GEM A;  3FZM A;  3L6Q A;  4QS7 A;  3VEO A;  4K43 A;  3O1B A;  1GLA G;  1K8K A;  3EL2 A;  3FZK A;  5BR9 A;  4A2B A;  4H5T A;  4DCH A;  1ZXO A;  1TUY A;  3GOI A;  1NGH A;  1X3M A;  3P4I A;  1WOQ A;  3QB0 A;  5AFU A;  4HTL A;  2E2N A;  3VEX A;  4PL8 A;  4H0P A;  2E20 A;  1HLU A;  3DJC A;  3R6M A;  5F1X A;  4DQ8 A;  2F9W A;  3WEE B;  4JHD B;  2IIR A;  2Q1N A;  3BF1 A;  2UYT A;  1U2V A;  4GNI A;  4EHU A;  1Y64 A;  1SZ2 A;  3CJC A;  3RSE B;  3QFU A;  3WXK A;  3EZW A;  3ULE A;  4E1J A;  3A8Y A;  1NBW A;  2A42 A;  3O5B A;  3ZET A;  5BRD A;  4BR9 A;  4H0T B;  4K41 A;  3ENH A;  2GEL A;  4A62 A;  1KXP A;  2V52 B;  1KAX A;  4Y0W A;  2D4W A;  5EVZ A;  1QQM A;  4FWR A;  2P9P B;  3ZX0 A;  3C7N A;  3VGK A;  3O1W A;  5AQU A;  4CZE A;  1NGJ A;  2W41 A;  2P9L B;  3FE1 A;  4MLE A;  3CJA A;  2NZT A;  2YHX A;  3DWL A;  4H0Y B;  2ASP A;  3CI5 A;  3FZL A;  4A61 A;  3CHW A;  2IVP A;  5ADX H;  4BGA A;  3FFK B;  3FGU A;  5AQY A;  5EX5 A;  2W40 A;  1J6Z A;  1JCG A;  4CZF A;  4ISF A;  4ISG A;  4YDU C;  3O08 A;  2E2O A;  1XC3 A;  3WEE A;  4JHD A;  2Q31 A;  3WXJ A;  4BR7 A;  1RFQ A;  4H0X B;  4GY2 B;  3RSE A;  2QWO A;  3WT0 A;  1BA1 A;  3SMS A;  2QW9 A;  3WXL A;  2CH6 A;  2AP1 A;  1YVN A; 
#chains in the Genus database with same CATH topology
 1BUP A;  3OY9 A;  1JL2 A;  4DQR A;  4IEI A;  4MO5 A;  1HRH A;  3ATU A;  1ESV A;  3DOL A;  4L3Q A;  1JXB A;  4EP4 A;  1XC9 A;  1HKC A;  4FK0 A;  4FO0 A;  1WAF A;  4IOC L;  3TWH A;  2FC0 A;  3B6O A;  3P5J A;  4DF8 A;  1BOT O;  4CEC A;  3HVT A;  4AF1 A;  4CIG A;  1REV A;  1B9D A;  4YOX A;  3OHR A;  5D3G A;  3LWM A;  4CGF A;  1Y97 A;  5AQW A;  5HBM A;  3AA2 A;  3V9X A;  3KTQ A;  3THY B;  1R59 O;  2PYL A;  3EZ5 A;  4B9M A;  3WXI A;  1BL3 A;  3C65 A;  2FLO A;  3AVH A;  1BA0 A;  2FSJ A;  4KTW A;  5AJ3 K;  2VG6 A;  3THW B;  2JWK A;  1X3N A;  1DT9 A;  1C1B A;  3KZB A;  3BDP A;  3LPU A;  2YCH A;  5DK5 A;  2IGI A;  5MLC Q;  4F8R A;  1I39 A;  3ZYY X;  3OTO K;  4K0K K;  4H5V A;  4BG8 A;  4M42 A;  4GV9 A;  4M3R A;  1RBR A;  1KFS A;  1HX1 A;  1BU6 O;  3VF2 A;  4N41 A;  4FSV A;  1U45 A;  3ZSW A;  3THV A;  4OVL A;  3U3Y A;  3JS6 A;  3BP8 A;  1VSF A;  2WUS A;  3J7Y P;  4AM6 A;  4NXM K;  3VQB A;  3VEZ A;  3E9L A;  4E7H A;  3OW2 M;  3H1Q A;  1S6P A;  4FLZ A;  3UKU B;  3LAN A;  1YJN N;  1L3S A;  2VWK A;  3OYG A;  4WQ4 A;  1TUU A;  3RVC A;  4B3M K;  2E5L K;  4K42 A;  4JKG B;  2O8E B;  4PKH A;  3OYA A;  4KI4 A;  1T03 A;  3VQ7 A;  3EE9 A;  4JV5 K;  3CQ8 A;  1DKG D;  5KQD A;  4DKW A;  1QQO A;  1ATR A;  4XH5 A;  2ZJP L;  4M3W A;  3SQ0 A;  3V9U A;  1KLN A;  3D45 A;  1RT2 A;  2P9S B;  1Z6R A;  2Q3S A;  1O1W A;  2PFU A;  4M3Z A;  1ZBL A;  3VQ5 A;  3LDP A;  5AQQ A;  2WC9 A;  3JAM O;  2BH1 A;  1OVY A;  3DXM B;  5KRT A;  4PKI A;  5BPL A;  3LDL A;  1RBV A;  4EAH D;  4C8L A;  4AM7 A;  3UKU A;  4UQG A;  4CGJ A;  4L8R B;  1CLQ A;  2DY4 A;  2Z1I A;  3HT3 A;  3NVM A;  1WSH A;  1RCH A;  4JKG A;  2O8E A;  4LSL A;  4LY7 A;  3TI0 A;  2GTD A;  1NJY A;  3VQ6 A;  1MWK A;  1LV5 A;  3CPW M;  4LFA K;  3CG7 A;  3MK6 A;  4M7X A;  3OYN A;  4ISE A;  1TV6 A;  1DGK N;  4A5B A;  1D5A A;  3M6G A;  3TSU A;  4YDU A;  4IFY A;  4DTP A;  4WQ5 C;  3AO2 A;  1S6Q A;  4KHQ A;  2P9S A;  2IS3 A;  2HHQ A;  4QAG A;  2QWP A;  4B3T K;  1NJX A;  4OKK A;  1YUW A;  1RTI A;  2GWK A;  4HHT A;  3CPE A;  3IUC A;  1H1V A;  3JSM A;  3DLL L;  1MU2 A;  3ZX3 A;  1XMO K;  4ZTF A;  1HNX K;  4CCH A;  4EIA A;  3DXM A;  3NF7 A;  1EQY A;  1T05 A;  3H3N O;  3QFP A;  3AVA A;  4NCG A;  1B92 A;  4DR2 K;  4OO1 J;  4MDA A;  1RT3 A;  3VF6 A;  4BRQ A;  4CEE A;  4FM2 A;  3VEW A;  1FXX A;  4PA1 A;  3GE1 A;  4FJN A;  3ULE B;  4BG9 A;  3G4S N;  3ZSV A;  2ZGY A;  1IBL K;  4LF5 K;  3V6D A;  3L4I A;  2LSN A;  4RW9 A;  1NK5 A;  3J8A A;  4E7J A;  3OBY A;  3QBW A;  3V1R A;  4DTN A;  1HJR A;  1KFD A;  3KK3 A;  3KWG A;  3O3H A;  4BR2 A;  3HP9 A;  4JNE A;  5GIP A;  3TAE A;  1Q18 A;  4KKO A;  1VQ7 N;  5HP1 A;  4YOT A;  2QEX N;  1A5X A;  1MWM A;  2E1Z A;  2YX6 A;  4KHY A;  4CD3 A;  1U4B A;  3VQ8 A;  1SAZ A;  5ADX A;  1NK4 A;  5DMR A;  1S9E A;  4CJL A;  3OJU A;  2D0P A;  3C6H A;  1KCF A;  4XH1 A;  1XUP O;  2F8S A;  3FZH A;  2HST A;  2YJE A;  5AQO A;  1X9J A;  3K0S A;  4Z94 A;  2WBN A;  3SAH A;  3NGY A;  4B9S A;  4DSJ A;  2HHH K;  3TAM A;  3DXK B;  3HM8 A;  3EKU A;  1TAQ A;  3G6E N;  4AHS A;  2CGL A;  3SLC A;  5C2D A;  5LY3 A;  4BWJ A;  2O8D A;  5HRP A;  4ZTJ A;  4U67 L;  2JGU A;  4KHN A;  1B9F A;  3MCA B;  2G8H A;  2I7P A;  1TKZ A;  1HYZ A;  3DOK A;  4O8K A;  1MA9 B;  3DLR A;  4FWN A;  3QLH A;  4AHU A;  3CCE N;  1D8Y A;  3DMJ A;  3U4L A;  4PUO A;  2NRW A;  1FK9 A;  3LP2 A;  4JD2 B;  2WON A;  5JS1 A;  1JCE A;  2CH5 A;  3O9U A;  1N8R O;  1S9G A;  2P9I B;  4NLC A;  4CJE A;  1KLM A;  1GLF O;  3LP3 A;  5AQJ A;  1WN7 A;  3FLC O;  3ASM A;  3TAF A;  1NMN A;  5FRM A;  3SAG A;  4CI6 A;  2QM1 A;  3EKS A;  4B8C A;  2QKK A;  2HF3 A;  2FBV A;  4KB1 A;  4JK7 A;  2XO7 A;  4FJ8 A;  4CJK A;  3VF4 A;  5FRO A;  2GX9 A;  4H0V B;  2HHT A;  3KIO A;  4PL7 A;  1M90 O;  4LH4 A;  4J2D A;  4I2P A;  3Q7C A;  1Q9X A;  4CZL A;  2ITM A;  1KAZ A;  4BQL A;  3ZSQ A;  5HRS A;  4DU1 A;  3CET A;  1EO1 A;  2HVH A;  1JLC A;  4AIL C;  4DS4 A;  4AHC A;  4B9N A;  4DV5 K;  4IDH A;  1BQN A;  4B1V A;  4WQ5 A;  5KPT A;  4EFH A;  3CME N;  3LL3 A;  4FJX A;  1U47 A;  1HUX A;  1NJZ A;  1CXQ A;  5KRS A;  1RDC A;  1LOT B;  2IAJ A;  3MAQ A;  2NRT A;  3L2V A;  2I7N A;  3I33 A;  5CYQ A;  1EWR A;  1NK8 A;  3KD5 E;  4FVM A;  4QS7 A;  3L6Q A;  3SQ1 A;  3ULD A;  4OX9 K;  4DU3 A;  1LWE A;  5M1Q A;  2QK9 A;  3S3N A;  3C95 A;  3DLG A;  3HP6 A;  2G8F A;  1TK5 A;  1S5J A;  3QB0 A;  5AFU A;  3CCS N;  4PL8 A;  4H0P A;  4F3O A;  1F21 A;  4DV7 K;  1HLU A;  3DJC A;  3KK1 A;  4DQ8 A;  1CZ9 A;  3OYK A;  4WCE L;  3WEE B;  1RDD A;  2Q1N A;  4CJQ A;  4EHU A;  3J7Z O;  1YJ9 N;  4A5A A;  3CJC A;  4G1Q A;  4JYA K;  3RSE B;  3WXK A;  4G9Z A;  4CJT A;  4E1J A;  4JKB A;  2YHA A;  1NOZ A;  1RT6 A;  4H0T B;  4A62 A;  4HUF A;  3WNG A;  1FJG K;  5EVZ A;  4DR4 K;  4U7B A;  3O9T A;  4FWR A;  4WE1 A;  2A1R A;  5C0Y A;  3O1W A;  1NGJ A;  1N5Y A;  2W41 A;  1JLG A;  1Z25 A;  2OYQ A;  3DWL A;  1K6Y A;  3AGK A;  4W5T A;  2IVP A;  1KQS M;  2X6N A;  1C0T A;  2W40 A;  3OS1 A;  2UUB K;  1SKW A;  4CIE A;  4IO9 L;  1YHQ N;  4FLX A;  4E7I A;  3WEE A;  4M3U A;  3THX A;  3HPG A;  4DFP A;  4H0X B;  3RSE A;  2XY8 A;  2NNW A;  3SMS A;  3WNH A;  2AP1 A;  3MWP A;  4V19 S;  1BQM A;  3F9K A;  4FPB A;  2ETJ A;  4E0D A;  4Z4F A;  3K59 A;  3SYZ A;  5C42 A;  3T3F A;  3OYI A;  2XY7 A;  5AQX A;  4BC5 A;  3AVI A;  1GOB A;  5TKY A;  3VQP A;  3UKR B;  3UB5 A;  4IG3 A;  4GW6 A;  2HF4 A;  4IEE A;  1GOA A;  3GL1 A;  3V4I A;  4FPA A;  4B1X B;  2HVI A;  4H03 B;  4EZ6 A;  4FZZ A;  1U48 A;  1BWF O;  4F2S A;  2UXB K;  1QQN A;  3QIC A;  4KRE A;  1JLF A;  3AVL A;  1FKP A;  1HQE A;  5CZ2 A;  3LDO A;  4FLV A;  1HNV A;  4LH5 A;  3SBG A;  3CJB A;  5KGX A;  4DB3 A;  2OPP A;  4PWD A;  4FCY A;  4XIU A;  3OYE A;  1OH8 A;  1GLL O;  1L5U A;  1OKJ A;  2X6S A;  5EOY A;  4I6M B;  4WFN L;  1VQ8 N;  3I56 N;  3RRH A;  2HND A;  2F8T A;  2BAN A;  4FJM A;  2P5G A;  3NVK A;  1QQC A;  2GBZ A;  2HHS A;  3H6E A;  4IJA A;  3UKR A;  4CJ5 A;  4H5R A;  3SPZ A;  4BC4 A;  2NRR A;  2HMP A;  3WQU A;  1IV0 A;  4RW6 A;  3MXI A;  1YF5 L;  1DLO A;  3DRR A;  1RBT A;  2RPI A;  5C12 A;  4GKJ K;  3ENO A;  4YY3 K;  5IT9 O;  4EHT A;  1EP4 A;  2R7Y A;  1Z05 A;  3N4P A;  2OPQ A;  3HBT A;  4FWK A;  1KD1 O;  1NGG A;  3ZSX A;  4JK8 A;  3RWU A;  4FZX C;  3CC4 N;  2V51 B;  2F9T A;  4NYF A;  3O8M A;  4DHY A;  1L3U A;  4DSI A;  5AQH A;  3ZT2 A;  4JS5 A;  1LCU A;  1LAV A;  3TTD A;  2FF3 B;  4NO7 A;  4BR5 A;  4O55 A;  4YFU A;  3HM9 A;  1TL1 A;  4FWQ A;  3K5M A;  2Z1J A;  4FLT A;  3P31 A;  2Y1I A;  1SQK A;  4I2Q A;  3IG1 A;  1S1W A;  3U9Z A;  4HCB A;  1ASU A;  1N36 K;  3B6P A;  3NE6 A;  4CJ3 A;  3MX2 A;  3D2E B;  3ZSR A;  3CXC M;  1T44 A;  1S1X A;  1GLD G;  4FWS A;  1HYV A;  3O9S A;  3PIO L;  1NK7 A;  3G71 N;  1IKV A;  3HSC A;  2KHO A;  3HPH A;  4K25 A;  3VQA A;  4X64 K;  4DLG A;  4KB0 A;  2VWB A;  3P38 A;  4CJV A;  3QER A;  4ILJ A;  2BE2 A;  2GUI A;  1VSJ A;  1ATS A;  2HBJ A;  5HLF A;  4H4M A;  2B5J A;  4CF1 A;  3PIP L;  4DUZ K;  2V7Z A;  4C1N K;  5AQL A;  3LZI A;  4N76 A;  3VGL A;  4CF2 A;  3OYM A;  3VGM A;  4BE1 A;  4QCL A;  3ZX2 A;  4EZ9 A;  3A5N C;  4FLU A;  4BRH A;  3O4N A;  2AJQ A;  1VSM A;  4GV6 A;  4YOU A;  4CBU A;  3CCV N;  4DUY K;  1SUQ A;  3J80 O;  3PO4 A;  2IOC A;  3NGI A;  3M8S A;  4JI0 K;  3OJS A;  1LWC A;  4DFK A;  4AH9 A;  2XY5 A;  3ID8 A;  2W42 A;  3AA3 A;  2OZS A;  3F2K A;  4BRO A;  4O5F A;  1NWK A;  5JIC A;  2D0B A;  5BRF A;  4BRI A;  1U2V B;  3NF9 A;  4FWO A;  1IKX A;  4BY9 C;  3NDK A;  3C0B A;  4BRF A;  3NF6 A;  1UWB A;  4K8Z A;  4QS9 A;  4KH6 A;  3MEC A;  4M45 A;  1JCF A;  3CD6 N;  2ZD1 A;  3ZET B;  3E9P A;  3S3M A;  3K2P A;  2Q36 A;  3MN5 A;  4J2E A;  3HK2 A;  2O4I A;  4CZM A;  3T19 A;  5KGW A;  3MDQ A;  4EP5 A;  4IDK A;  1ASV A;  1ZBF A;  3GDQ A;  3O6W A;  3LM2 A;  1NLV A;  2ATQ A;  3O3G A;  1HR0 K;  4ELT A;  4W5Q A;  4BRN A;  3L4Q A;  5FPM A;  3NAE A;  2B6A A;  1WSI A;  2P9U B;  1NGC A;  1XNR K;  4W5N A;  3THY A;  3T1A A;  2IC3 A;  1DTQ A;  4WYB A;  3HRG A;  3SK3 A;  2F4V K;  5AQI A;  2ASO A;  1HNI A;  4E3S A;  3QET A;  3THW A;  4Q0B A;  1VK0 A;  3HTV A;  4Z4I A;  3FR0 A;  3VEV A;  5AQS A;  3AGR A;  3ITH A;  3AVN A;  3BY5 A;  5AQM A;  3DYA A;  5EU7 A;  2FSN A;  4YOY A;  1ZYQ A;  3G25 A;  4BR0 A;  4DQS A;  4DSE A;  1HQU A;  4BVO A;  1QZ6 A;  1KVB A;  3NF8 A;  1IKY A;  1DTT A;  1GLJ O;  2EWS A;  1VQK N;  5AQT A;  2WOM A;  1BG3 A;  4OPK A;  2P9K B;  4FJJ A;  3NGZ A;  4FLW A;  1KAY A;  1WNS A;  3SUN A;  4BRE A;  2KQ2 A;  3U3G A;  5KQ8 A;  3V81 A;  5DM6 L;  5H1S Q;  4DFM A;  2HHX A;  4DR5 K;  2NRZ A;  2VWJ A;  2A1S A;  2P9U A;  5EXW A;  1Q82 O;  4M63 C;  1VHX A;  3MWT A;  2G8K A;  1GLB G;  5GAG P;  3VEN A;  2DPN A;  3HOS A;  2O8C B;  3CJ7 A;  1ITG A;  4KBO A;  4Z4G A;  4B3O A;  5GAD P;  2HNY A;  3U9D A;  3DI6 A;  4PQU A;  3UE5 A;  1BDG A;  3E66 A;  1JLE A;  4HWI A;  1RIL A;  2JLE A;  2QKB A;  2KTQ A;  1EXQ A;  3AVG A;  4MLH A;  4W5O A;  4FOE A;  3DM2 A;  1YAG A;  4O44 A;  2OPR A;  3BEX A;  3T7Z A;  4H0O A;  4DFJ A;  3VQE A;  3LPT A;  3MCP A;  5IWA K;  4HUG A;  1WB9 A;  2P1J A;  3TAB A;  4FK4 A;  4YHH K;  3FFI A;  4OKJ A;  4DR7 K;  3BF3 A;  4FK2 A;  4O8U A;  3JYT A;  1P8Z A;  5J2P A;  5C2F A;  3AVB A;  3L2R A;  2ZF5 O;  3VQ4 A;  4CJW A;  3IMX A;  3WNE A;  1YT3 A;  3I0S A;  2NRH A;  5FRN A;  3M3Z A;  2Q0U A;  2OA8 A;  4DQI A;  3KLG A;  4CK2 A;  3VPZ A;  5HL7 L;  2HB5 A;  2YHB A;  1XMQ K;  1YIT N;  1RDU A;  2AA4 A;  4LF8 K;  3QNO A;  4I9L A;  4Y1C A;  2GWJ A;  4CHP A;  2VQF K;  2O8F B;  3A5O C;  1T6D A;  2GEM A;  3FZM A;  2RHK A;  3O1B A;  3VQ9 A;  3SI6 A;  3FZK A;  1TVR A;  4A2B A;  4H5T A;  4DCH A;  1ZXO A;  1TUY A;  4KH4 A;  2HHU A;  3KD1 E;  3PO5 A;  4DTJ A;  5BR8 K;  3P1G A;  4UY8 O;  5HRN A;  3VEX A;  4Y1D A;  3CFP A;  4FJL A;  2UYT A;  4GNI A;  3MED A;  5HRO A;  1A5W A;  1Y64 A;  1SZ2 A;  3HPO A;  3M8R A;  5T7B A;  3RR7 A;  3QFU A;  3ULE A;  4FJH A;  3A8Y A;  1NBW A;  1YVU A;  4BE0 A;  4ILH A;  3PSI A;  4BR9 A;  1TKD A;  2W6K A;  4GVM A;  2BDP A;  1IKW A;  3S3O A;  4QOZ B;  4KH5 A;  3VGK A;  1YI2 N;  2O8F A;  4TSX A;  3I55 N;  4OPH A;  4JK9 A;  3VN5 A;  2NZT A;  2YHX A;  4H0Y B;  3A2F A;  2ASP A;  4OLA A;  4A61 A;  3BZK A;  3FFK B;  2P5O A;  1BIU A;  1LAW A;  1JCG A;  2D5R A;  3ZT4 A;  2ZJQ L;  4ISF A;  4ISG A;  2DFH A;  3O08 A;  5CZ1 A;  1YTA A;  4B9L A;  4CFD A;  3D0P A;  2E2O A;  4GV3 A;  1XC3 A;  4X62 K;  1QS4 A;  3IRX A;  3TR8 A;  4KV8 A;  2FBX A;  4JLH A;  1HNW K;  4B9U A;  5M1N A;  5LMU K;  1RDA A;  4H8K A;  3QEW A;  5AZI B;  2CH6 A;  1JJ2 M;  2UUC K;  1LWF A;  1C1A A;  2O8B B;  4CEZ A;  4FJ9 A;  4JKA A;  4JI8 K;  3DXK A;  4RG8 A;  5BPM A;  3IDH A;  1C0U A;  1TK0 A;  4QS8 A;  5JMV A;  4B1W B;  3DRS A;  3TTF A;  2KZM A;  4FM1 A;  2FBT A;  1D4X A;  3IS9 A;  3AA5 X;  3CCU N;  1YIJ N;  2QWL A;  4CHN A;  4O0I A;  5KPZ A;  2PYJ A;  1V4S A;  3OYH A;  1NOY A;  1CZA N;  1J5O A;  4DQP A;  4JD2 A;  3LWL A;  3L2U A;  1NGE A;  1TL3 A;  3K9J A;  4CJF A;  4KHP K;  2P9I A;  2VGN A;  4LFB K;  1KVA A;  2YNG A;  5FPD A;  2E1Y A;  3ID6 A;  1V4T A;  3L2W A;  4RCH A;  3NMU A;  4C8M A;  5AZI A;  2KW4 A;  1IBK K;  4CFA A;  3KLI A;  4DTO A;  4JKH A;  4CZI A;  4FXD A;  3CCJ N;  1NGI A;  4CHY A;  2O8B A;  1NGA A;  3A0I X;  1NKC A;  3K57 A;  4JKE A;  4DF4 A;  1BI4 B;  1G15 A;  4B1Z A;  1MDU B;  1I3A A;  1NMD A;  1EX4 A;  1WSF A;  3VQD A;  4BC3 A;  1XWL A;  1D9F A;  4FZY A;  1NNE A;  3PLA A;  4CZG A;  2KKZ A;  3V1Q A;  4MDB A;  4BQZ A;  4E7L A;  3ZSO A;  4LD0 A;  3ZSY A;  2G8I A;  1NK9 A;  4CGD A;  3L3U A;  1OH6 A;  4C8N A;  1KVC A;  3AAP A;  1VSE A;  4KTZ A;  4J2B A;  4XH4 A;  4CGH A;  3T69 A;  2YNH A;  5BPN A;  4F3T A;  5I3U A;  2E88 A;  4A2A A;  4JI2 K;  4CER A;  1K9M O;  2RE2 A;  1JKH A;  4BWM A;  4FJI A;  1W97 L;  5FLX O;  4BAC A;  1J5E K;  3AAR A;  4AHR A;  1ZBH A;  1C0F A;  4N47 A;  5K14 A;  4CJS A;  1RT5 A;  1BI4 A;  3AVK A;  2QWN A;  3A5L C;  1NU0 A;  3AO4 A;  4DU4 A;  3SUP A;  4LFC K;  3QEI A;  1QVG M;  2GV9 A;  3LDN A;  4FJ5 A;  3QNN A;  3F9M A;  3H46 O;  2BGG A;  3PX4 A;  1W2B M;  4XEI A;  1X9M A;  4JI6 K;  4IG0 A;  3U8X A;  3SV3 A;  1WSJ A;  1QHT A;  1WSG A;  3TAG A;  4CE9 A;  1Q7Y O;  1WLJ A;  4CEQ A;  2IDO A;  1L3V A;  3CFO A;  3LAK A;  5CY4 A;  3CFR A;  4C8K A;  2QWR A;  4K8X A;  4DTS A;  4DSL A;  3NHG A;  1TYQ B;  4FVU A;  3I8D A;  4MO4 A;  4NB4 A;  1HPM A;  3R8E A;  3S9H A;  4AHV A;  5GAH P;  1S1U A;  1BIS A;  1VSI A;  3CQX A;  3B8A X;  1Q81 O;  3ISN C;  5AR0 A;  5J2N A;  2OTL N;  1VQ6 N;  1X1P A;  4Q5V A;  1HKB A;  3T1Y K;  2BUP A;  4DV3 K;  2NUB A;  3H3O B;  4BRK A;  5C24 A;  1NGD A;  1K8A O;  2UXD K;  3DRP A;  2H3G X;  4O5B A;  5LJV A;  4WFB L;  3AA4 A;  1JL1 A;  3TU5 A;  3VES A;  3RTV A;  4B9V A;  2QWQ A;  4DWI A;  3V1O A;  1S22 A;  3L2Q A;  5AQR A;  2QWM A;  5E41 A;  2A5X A;  3K5L A;  1FKO A;  1VQM N;  4ZHR A;  1UOC A;  3ZSZ A;  1J9A A;  3SZ2 A;  3DAW A;  2RN2 A;  5GIO A;  1IJJ A;  5AQN A;  5JS2 A;  4CJ4 A;  1KTQ A;  3I8B A;  3O80 A;  4IKF A;  3O9Q A;  2E8A A;  1TYQ A;  4JI1 K;  3HO1 A;  4B1Y B;  3NFA A;  4DV6 K;  1ZBI A;  4BDY A;  3E01 A;  3E1Y A;  1SL1 A;  3UIQ A;  3MEG A;  4DTX A;  3NH1 A;  1HPZ A;  3PUF A;  4IZ9 A;  1RBS A;  3TSQ A;  2DFE A;  2HOE A;  4IOX A;  3VQQ A;  1XQS C;  1HJO A;  5AQZ A;  5F2R A;  1SKR A;  3QBX A;  2YV0 X;  4WF9 L;  4JKF A;  1VQ9 N;  1ATN A;  4FL9 A;  1RTD A;  4OJR A;  3WXM B;  4Z4H A;  3CC2 N;  1DEJ A;  4C8O A;  1IG9 A;  4WFA L;  4I6M A;  4BRM A;  1I94 K;  4BRC A;  3ZT1 A;  2VGM A;  1VAZ A;  4BGB A;  3SMP A;  3HJF A;  3CCL N;  3CCQ N;  3W0L A;  1RGI A;  2CGJ A;  4PY5 A;  4JEP A;  4IOA L;  1J53 A;  5I42 A;  3LP1 A;  4AHT A;  4IXC A;  1CZB A;  2E2Q A;  1QHA A;  1T3V A;  2OTJ N;  4LF7 K;  2BTF A;  3VET A;  1SL2 A;  2D0A A;  3G0Z A;  5JLF A;  2P9N B;  2HW3 A;  3PV8 A;  4R5P A;  4JI5 K;  4KI6 A;  1E3M A;  3ALY A;  3CYM A;  3VQC A;  4H4O A;  4CJP A;  3C6U A;  4B3R K;  3LDS A;  3EY1 A;  1RT4 A;  4E1N A;  5KTQ A;  4HVJ A;  3MX5 A;  4R79 A;  4ID5 A;  4DV0 K;  4W5R A;  1HKG A;  2CGK A;  3E9O A;  2QTD A;  3P39 A;  5JLH A;  3WNF A;  4CEO A;  1S3X A;  2E2P A;  1HNZ K;  1QSS A;  3VOV A;  4A59 A;  3KHY A;  4DR3 K;  4JN4 A;  3VEY A;  3KJV A;  1Q8I A;  2Y1J A;  1K8K B;  3D6R A;  3DLK A;  4IFE A;  4CJ7 A;  3OYJ A;  3SCX A;  1NJW A;  2Q0R A;  3D2E A;  4KHW A;  1RDW X;  3NH2 A;  1U6Z A;  1TK8 A;  4PHT X;  4DQQ A;  2X78 A;  4DTM A;  2FSK A;  4RWT A;  1NM1 A;  2VCP A;  3SPY A;  4JAX A;  4BRL A;  3P83 D;  3QEP A;  4BRA A;  1NK6 A;  4CVN E;  2F7T A;  2P9N A;  4M41 A;  3NBP A;  1HMV A;  5ELZ A;  2A3Z A;  4IO8 A;  1SL0 A;  2KFN A;  4JRQ A;  5TKW A;  4M7Y A;  2YJF A;  4J2A A;  2E4L A;  3K5O A;  4Z4C A;  3HL8 A;  2RKI A;  5GAE P;  2VG7 A;  2YNF A;  3C7N B;  4BRP A;  3RMB A;  5SZT A;  1N6Q A;  2WTU A;  3V9S A;  4DMN A;  1QTM A;  4FW2 A;  2QI2 A;  4K43 A;  1K8K A;  3EL2 A;  1NGH A;  3P4I A;  4CED A;  1QE1 A;  3RMA A;  4HTL A;  2E2N A;  3BGR A;  3OVN A;  2E20 A;  3R6M A;  4B9T A;  1W7A A;  4KHS A;  4JHD B;  2IIR A;  3BF1 A;  4JKC A;  1U2V A;  1Q9Y A;  2UUA K;  3MXM A;  4FJG A;  2G8U A;  3SBT A;  1C0M A;  3R1X A;  2KFZ A;  3EZW A;  4CHZ A;  4E89 A;  2A42 A;  4X66 K;  3O9R A;  4CHQ A;  3ZET A;  5BRD A;  4K41 A;  3ENH A;  2GEL A;  5CHI A;  3SQ2 A;  1KAX A;  4DTU A;  4I7F A;  1A5V A;  1LW0 A;  2D4W A;  3HYF A;  4JI7 K;  3OBW A;  1QQM A;  2NRV A;  1LW2 A;  2P9P B;  4CJR A;  3O3F A;  3ZX0 A;  3NCI A;  3C7N A;  4KPY A;  5AQU A;  3BZC A;  4CZE A;  5M1F A;  1RDB A;  3CF5 L;  1D9D A;  2P9L B;  3FE1 A;  4RW7 A;  4B8A B;  3CJA A;  4DS5 A;  1VQ4 N;  3QIP A;  3LAM A;  1ZBU A;  3CHW A;  5DM7 L;  3RR8 A;  5ADX H;  4BGA A;  3FGU A;  5EX5 A;  4DV4 K;  5LMN K;  4CZF A;  4LF4 K;  4I9Q A;  3IKM A;  4JHD A;  3WXJ A;  2RF2 A;  3K9K A;  4GY2 B;  3KLF A;  2QWO A;  4CFB A;  3WT0 A;  4F4K A;  5JVH L;  3LZJ A;  1X9S A;  1YVN A;  2VG5 A;  2PY5 A;  1RTH A;  3KK2 A;  2WFB A;  4BC2 A;  2YKN A;  2P9K A;  1VQ5 N;  1QVF M;  1VSK A;  1E4G T;  4YOR A;  2P9P A;  3JXU A;  3D2F B;  2Z1H A;  2IVN A;  5J2M A;  4DR1 K;  3SJJ A;  2GUP A;  4FM0 A;  1NKE A;  3J7A P;  2P9L A;  5LL6 Z;  2YNI A;  3U6F A;  3N4Q A;  3K5N A;  5HRR A;  3ZT0 A;  4HTU A;  2O8C A;  2YKM A;  5FDL A;  4CW7 B;  1QSL A;  4FYD A;  1J54 A;  3M8Q A;  5E84 A;  3LAL A;  2QXL A;  1R0A A;  3VMF B;  3QEX A;  3W3D A;  3IAY A;  1ASW A;  2OPS A;  3MN9 A;  4CEF A;  4H5W A;  3CMA N;  3AVJ A;  2NLX A;  1XHZ A;  1SKS A;  2KLA A;  3LM9 A;  3HI0 A;  1N33 K;  1C6V A;  3MMV A;  4BVP A;  5I9E B;  4CZJ A;  4FJK A;  4GMJ B;  4IJN A;  2Z1G A;  1JLA A;  3CCR N;  4KAZ A;  3KLH A;  5M1P A;  3M5R A;  3SJH A;  4CZH A;  4CFC A;  1G99 A;  3H45 C;  5J2Q A;  1W9H A;  3HST B;  3CIP A;  5JVG L;  3D2F A;  3L8B A;  1L3T A;  1VQL N;  1TAU A;  2P51 A;  5SWM A;  4ID1 A;  3QML A;  2O8D B;  4M3Y A;  1NK0 A;  5B8H A;  4NXN K;  1T7P A;  4Z4E A;  4FJ7 A;  4BRG A;  1WAJ A;  5BN9 A;  3DLE A;  3OA9 A;  3SUO A;  1GLC G;  1N34 K;  5HOO A;  2HNZ A;  4FLY A;  1GLE G;  3CCM N;  4KHU A;  5AQG A;  4DTR A;  1XI1 A;  3OS2 A;  1YJW N;  4DV1 K;  5AQF A;  2XY6 A;  4DSK A;  5AFU H;  1RBU A;  4DR6 K;  3OYL A;  3C94 A;  2VYP A;  4C1N I;  4CGI A;  1YXQ A;  3KLE A;  3T1H K;  3WQT A;  4CK3 A;  5AQV A;  3ENB A;  3VA0 A;  1NJI O;  1VRT A;  3VTI A;  5BRH A;  2JWL A;  2OAN A;  2F96 A;  1VQO N;  3GG4 A;  5FPE A;  4BRD A;  1RTJ A;  5KI6 A;  4H5N A;  4CHO A;  1IBM K;  1RNH A;  4CBW A;  4CK1 A;  1S72 N;  1CXU A;  2Q97 A;  1RT7 A;  1TKT A;  3AVF A;  3PX0 A;  1K73 O;  3HXM A;  5C15 A;  3PY8 A;  2EHG A;  2QA4 N;  3IFR A;  1C1C A;  3OYB A;  1T6C A;  1S1V A;  3AVM A;  4E19 A;  1Z26 A;  1VRU A;  2FF6 A;  2V7Y A;  3CJ9 A;  4NYN A;  2NRX A;  3RRG A;  4OPJ A;  2A40 A;  3A5M C;  1U49 A;  4C23 A;  3CER A;  3EO3 A;  3V9Z A;  3L3V A;  5C25 A;  2YHY A;  3QDK A;  5AQK A;  2UU9 K;  3CM5 A;  1KC8 O;  5E26 A;  1OH7 A;  5EY4 A;  4FOI A;  1ILY A;  4ELU A;  1KSP A;  1BIZ A;  2ZJR L;  3ATV A;  3LP0 A;  3CM6 A;  3QO9 A;  2IVO A;  5AQP A;  1VQN N;  3DLB A;  1Q86 O;  1ZC6 A;  4NLB A;  1EET A;  4N56 A;  1BHL A;  4DSF A;  3GBT A;  3M1F A;  1VSD A;  3Q7B A;  2ITG A;  1WUA A;  3AO3 A;  4M3X A;  2XRI A;  3D7E O;  4N5S A;  4FWP A;  3SAF A;  4DLE A;  1P90 A;  1UAX A;  4O4G A;  4IBN A;  5F0X A;  3C6A A;  3EN9 A;  3OYD A;  2B4J A;  4E1M A;  3QIN A;  1C0G A;  4ILG B;  1IG8 A;  4ELV A;  5CYM A;  3J81 O;  1RT1 A;  4FWM A;  2E6L A;  3CJ1 A;  3CQY A;  3MN6 A;  3SV4 A;  4NCB A;  1TKX A;  4CIF A;  3NH0 A;  4O0J A;  3F5T A;  2HHV A;  4RTF D;  1NG9 A;  1EKE A;  5M1K A;  4B9Q A;  3VER A;  3HVR A;  3M8P A;  3KWI A;  4CF0 A;  3KVG A;  2ZQB A;  3EEQ A;  3FZF A;  3RMD A;  4FWL A;  2W6L A;  3L0Q A;  5LJW A;  1M1K O;  2YHW A;  5C10 A;  4CD1 A;  3WUH A;  5BRE A;  3THX B;  4JRP A;  1OVQ A;  3SNN A;  3OYF A;  2Q2R A;  2D0O A;  3R9P A;  3MN7 A;  3VA3 A;  4KTQ A;  1NGB A;  3ZT3 A;  4B1U B;  3R3L A;  3S41 A;  3O4W A;  3ZEU B;  3H1V X;  3TAP A;  2D1K A;  3LDQ A;  2UXC K;  4KFB A;  4CEB A;  2HBM A;  2ASM A;  4CBX A;  3TSP A;  2EX3 A;  1SV5 A;  1OH5 A;  4BDP A;  3V9W A;  2A41 A;  4DV2 K;  3HZ6 A;  3MEE A;  4RW4 A;  5AZJ B;  1FW6 A;  2ZWH A;  1JLB A;  2QXF A;  2E6M A;  4LF9 K;  4DG1 A;  3ZLJ A;  2PAV A;  5CE3 A;  3I0R A;  1SS6 A;  1KRP A;  1VSL A;  2PZS A;  3CC7 N;  3KKR A;  3DLH A;  4LC9 B;  1BO5 O;  4CES A;  4CJU A;  2A6A A;  4JKD A;  1VSH A;  2I5J A;  4IWV A;  2G8W A;  1NGF A;  3AAQ A;  2ZM6 K;  5FPN A;  2FXU A;  1JLQ A;  3BUZ B;  1UA1 A;  3EYZ A;  1EWQ A;  3AY9 A;  3QES A;  4LSN A;  1GOC A;  4ICL A;  4YOV A;  1ZBS A;  3ZEU A;  2KZZ A;  1QZ5 A;  4M3T A;  4E7K A;  4IFV A;  1WBB A;  4B08 A;  4CZK A;  2XHB A;  5AZJ A;  1U04 A;  4OGE A;  3VTH A;  1E4F T;  2HBK A;  3QEV A;  2X74 A;  4OKE A;  1O13 A;  4MFB A;  3TAQ A;  4HUE A;  2YI1 A;  4A57 A;  3SUQ A;  4CF8 A;  2G8V A;  4J8F A;  2J4R A;  2PBD A;  3TAN A;  1WSE A;  1W0H A;  4AQY K;  2DTU A;  4B3S K;  4OGC A;  4BR4 A;  5J1E A;  4JI3 K;  3AVC A;  4LF6 K;  4CEA A;  5BN8 A;  4X65 K;  2HBL A;  2ZGZ A;  4F9O A;  2OCE A;  4F2R A;  5KPR A;  1TGO A;  1BCO A;  1S1T A;  2FBY A;  3AV9 A;  4WQ4 C;  4GKK K;  1XHX A;  4PKG A;  3TPQ A;  3OYC A;  4OPA A;  4BE2 A;  1X9W A;  3G10 A;  4YOW A;  2O4G A;  3SQ4 A;  3VEO A;  3H08 A;  1QSY A;  1IO2 A;  3K58 A;  1GLA G;  5BR9 A;  4JS4 A;  3TTC A;  1WBD A;  1HYS A;  3GOI A;  5M1O A;  1BGX T;  1X3M A;  1WOQ A;  4YNQ A;  3PX6 A;  2HHW A;  3C6T A;  5F1X A;  3AO1 A;  2F9W A;  3ZCM A;  3AO5 A;  4CF9 A;  2DFF A;  4KRF A;  3KKS A;  4CGG A;  2D0C A;  4GVE A;  3O5B A;  4Z0U A;  3RMC A;  1KXP A;  4OLB A;  3PSF A;  2V52 B;  4Y0W A;  4BDZ A;  4JI4 K;  2HMI A;  3KK7 A;  5A2Q O;  1VQP N;  3F73 A;  2OZM A;  4MLE A;  4HCC A;  1UA0 A;  1BCM A;  3QIO A;  3CI5 A;  1IH7 A;  3FZL A;  3OS0 A;  4FW1 A;  5AQY A;  3HOT A;  4NCA A;  2ZE2 A;  1YTU A;  1J6Z A;  4KO0 A;  3O4Q A;  1N32 K;  4YDU C;  1JXE A;  1T8E A;  4RW8 A;  2Q31 A;  4BR7 A;  1RFQ A;  3TAR A;  1XNQ K;  3EE8 A;  5CR4 A;  5GIN A;  2VQE K;  4MQ3 A;  1NKB A;  1BA1 A;  2QW9 A;  3MXJ A;  3WXL A; 
#chains in the Genus database with same CATH homology
 3MWP A;  1BUP A;  4IEI A;  4FPB A;  4MO5 A;  3ATU A;  1ESV A;  2WFB A;  4L3Q A;  4BC2 A;  1HKC A;  2P9K A;  4JKA A;  1VQ5 N;  3DXK A;  4FO0 A;  5AQX A;  4BC5 A;  1QVF M;  1E4G T;  4YOR A;  5TKY A;  5BPM A;  4IOC L;  3UKR B;  2P9P A;  3IDH A;  3D2F B;  1BOT O;  3JXU A;  3UB5 A;  4AF1 A;  2HF4 A;  2IVN A;  4IEE A;  4QS8 A;  2GUP A;  3GL1 A;  5JMV A;  4FPA A;  4B1X B;  2P9L A;  4B1W B;  4YOX A;  3TTF A;  3OHR A;  4H03 B;  3N4Q A;  1D4X A;  3CCU N;  5AQW A;  1YIJ N;  2QWL A;  5KPZ A;  1V4S A;  1BWF O;  1R59 O;  1CZA N;  1QQN A;  3WXI A;  3QIC A;  4JD2 A;  3C65 A;  5E84 A;  2FLO A;  1BA0 A;  2FSJ A;  1NGE A;  2QXL A;  3K9J A;  3VMF B;  3LDO A;  3W3D A;  2P9I A;  2VGN A;  2JWK A;  1X3N A;  3MN9 A;  4H5W A;  1DT9 A;  3CJB A;  3SBG A;  3KZB A;  5FPD A;  2NLX A;  3CMA N;  2KLA A;  3LM9 A;  2E1Y A;  3HI0 A;  2YCH A;  1V4T A;  3ID6 A;  3MMV A;  4BVP A;  4DB3 A;  5I9E B;  4CZJ A;  4RCH A;  3ZYY X;  5MLC Q;  3NMU A;  4H5V A;  4IJN A;  1GLL O;  4BG8 A;  5AZI A;  1OKJ A;  5EOY A;  4I6M B;  3CCR N;  4GV9 A;  4JKH A;  4WFN L;  4CZI A;  1HX1 A;  3M5R A;  5M1P A;  1NGI A;  3SJH A;  4CZH A;  3I56 N;  3CCJ N;  1VQ8 N;  1NGA A;  1BU6 O;  3A0I X;  3VF2 A;  1G99 A;  4FSV A;  3NVK A;  3H45 C;  4JKE A;  3H6E A;  4IJA A;  3CIP A;  3UKR A;  4H5R A;  3D2F A;  1MDU B;  4B1Z A;  1NMD A;  4BC4 A;  5JVG L;  2NRR A;  2HMP A;  3WQU A;  3JS6 A;  3BP8 A;  4BC3 A;  1YF5 L;  2WUS A;  1VQL N;  3PLA A;  4AM6 A;  5C12 A;  3ENO A;  3VEZ A;  3E9L A;  4CZG A;  3QML A;  2KKZ A;  4MDB A;  4BQZ A;  5AZI B;  4EHT A;  3OW2 M;  5B8H A;  3H1Q A;  1Z05 A;  3N4P A;  3HBT A;  3UKU B;  1YJN N;  4FWK A;  4BRG A;  1KD1 O;  1NGG A;  4WQ4 A;  1TUU A;  4JK8 A;  3RVC A;  3CC4 N;  2V51 B;  5BN9 A;  3OA9 A;  2F9T A;  4K42 A;  3O8M A;  4DHY A;  1GLC G;  4JKG B;  5AQH A;  5HOO A;  3AAP A;  4PKH A;  1GLE G;  1LCU A;  3TTD A;  2FF3 B;  3CCM N;  4XH4 A;  5AQG A;  4NO7 A;  3T69 A;  4BR5 A;  5BPN A;  3EE9 A;  1YJW N;  1DKG D;  4FWQ A;  5KQD A;  5AQF A;  4DKW A;  5AFU H;  1QQO A;  4C1N I;  1ATR A;  2VYP A;  2E88 A;  1YXQ A;  3P31 A;  4XH5 A;  4A2A A;  3WQT A;  2ZJP L;  1SQK A;  1K9M O;  2RE2 A;  5AQV A;  2P9S B;  1W97 L;  3ENB A;  3U9Z A;  1Z6R A;  1NJI O;  3VTI A;  5BRH A;  2JWL A;  2OAN A;  2PFU A;  3AAR A;  3GG4 A;  1VQO N;  5FPE A;  4BRD A;  1C0F A;  3LDP A;  3MX2 A;  4H5N A;  3D2E B;  2QWN A;  5AQQ A;  3A5L C;  4CBW A;  3CXC M;  2WC9 A;  1S72 N;  1T44 A;  2Q97 A;  1GLD G;  2BH1 A;  1OVY A;  3DXM B;  4FWS A;  1K73 O;  3O9S A;  5C15 A;  3PIO L;  4PKI A;  3G71 N;  2QA4 N;  5BPL A;  3IFR A;  3LDL A;  3HSC A;  1QVG M;  4EAH D;  2KHO A;  1T6C A;  3LDN A;  4K25 A;  2VWB A;  3P38 A;  4AM7 A;  3UKU A;  3F9M A;  3H46 O;  2FF6 A;  4ILJ A;  2V7Y A;  1W2B M;  3CJ9 A;  4XEI A;  2NRX A;  1ATS A;  2HBJ A;  3NVM A;  2A40 A;  3A5M C;  4JKG A;  4C23 A;  3U8X A;  3CER A;  3EO3 A;  3PIP L;  2V7Z A;  2YHY A;  3QDK A;  5AQK A;  5AQL A;  4C1N K;  1Q7Y O;  2GTD A;  3VGL A;  1KC8 O;  1MWK A;  5E26 A;  3VGM A;  3CPW M;  2QWR A;  3ZX2 A;  5EY4 A;  4FOI A;  1ILY A;  3A5N C;  3MK6 A;  4M7X A;  4BRH A;  2ZJR L;  4ISE A;  1DGK N;  1TYQ B;  4A5B A;  4FVU A;  3ATV A;  3M6G A;  4MO4 A;  4NB4 A;  4YDU A;  3TSU A;  1HPM A;  4WQ5 C;  3R8E A;  2IVO A;  5AQP A;  2P9S A;  5GAH P;  1VQN N;  4GV6 A;  2QWP A;  1Q86 O;  1ZC6 A;  3CQX A;  4YOU A;  1YUW A;  3B8A X;  4NLB A;  4CBU A;  3CCV N;  2GWK A;  1Q81 O;  3CPE A;  5AR0 A;  2OTL N;  3IUC A;  1VQ6 N;  1H1V A;  3GBT A;  1HKB A;  3M1F A;  2BUP A;  3DLL L;  3ZX3 A;  3H3O B;  3Q7B A;  4BRK A;  1WUA A;  4EIA A;  1NGD A;  3DXM A;  1K8A O;  3ID8 A;  1EQY A;  2H3G X;  3F2K A;  3H3N O;  4BRO A;  5LJV A;  3D7E O;  3QFP A;  4WFB L;  4O5F A;  1NWK A;  5JIC A;  3VES A;  4OO1 J;  3TU5 A;  4MDA A;  5BRF A;  4BRI A;  2QWQ A;  1U2V B;  4FWO A;  3VF6 A;  4BY9 C;  1S22 A;  4FWP A;  4BRQ A;  3C0B A;  3SAF A;  4BRF A;  3VEW A;  5AQR A;  2QWM A;  1P90 A;  3GE1 A;  3ULE B;  2A5X A;  4BG9 A;  5F0X A;  3C6A A;  3EN9 A;  4KH6 A;  4QS9 A;  3G4S N;  1VQM N;  1JCF A;  2ZGY A;  3CD6 N;  1C0G A;  3ZET B;  4ILG B;  3E9P A;  1IG8 A;  2Q36 A;  3L4I A;  3DAW A;  3MN5 A;  3J8A A;  5GIO A;  1IJJ A;  4CZM A;  3MDQ A;  5AQN A;  3O80 A;  3I8B A;  4FWM A;  3CJ1 A;  3GDQ A;  3O6W A;  3CQY A;  3LM2 A;  1NLV A;  3O9Q A;  2E8A A;  1TYQ A;  3MN6 A;  3OBY A;  3QBW A;  4B1Y B;  4BRN A;  3L4Q A;  5FPM A;  3F5T A;  4RTF D;  3KWG A;  3E1Y A;  4BR2 A;  5M1K A;  4B9Q A;  3VER A;  4JNE A;  2P9U B;  1NGC A;  5GIP A;  3KWI A;  3KVG A;  1Q18 A;  4IZ9 A;  1VQ7 N;  3FZF A;  4WYB A;  3HRG A;  3TSQ A;  2HOE A;  4IOX A;  4FWL A;  1XQS C;  1HJO A;  5AQZ A;  5F2R A;  4YOT A;  3QBX A;  2ASO A;  3L0Q A;  5AQI A;  3SK3 A;  5LJW A;  2QEX N;  1MWM A;  4WF9 L;  1M1K O;  2YHW A;  4JKF A;  2E1Z A;  2YX6 A;  3HTV A;  5C10 A;  1ATN A;  4CD1 A;  4FL9 A;  3FR0 A;  3WUH A;  3VEV A;  4CD3 A;  1VQ9 N;  5BRE A;  3WXM B;  5AQS A;  1SAZ A;  3AGR A;  5ADX A;  2Q2R A;  5AQM A;  2D0O A;  2FSN A;  3R9P A;  3MN7 A;  3G25 A;  1DEJ A;  4YOY A;  3CC2 N;  4BR0 A;  4WFA L;  1NGB A;  4B1U B;  2D0P A;  3R3L A;  3C6H A;  4I6M A;  3S41 A;  4BRM A;  4BVO A;  1QZ6 A;  3O4W A;  4XH1 A;  1XUP O;  3H1V X;  3ZEU B;  2D1K A;  3FZH A;  3LDQ A;  2HST A;  4BRC A;  2YJE A;  2HBM A;  1VQK N;  1GLJ O;  2EWS A;  5AQO A;  1X9J A;  5AQT A;  2ASM A;  2VGM A;  1VAZ A;  4BGB A;  2WBN A;  3SMP A;  3TSP A;  1BG3 A;  4CBX A;  4Z94 A;  3SAH A;  2P9K B;  3CCQ N;  3CCL N;  3W0L A;  1RGI A;  2A41 A;  3DXK B;  3HM8 A;  1KAY A;  3EKU A;  2CGJ A;  3HZ6 A;  4BRE A;  3G6E N;  5AZJ B;  5KQ8 A;  2CGL A;  3SLC A;  5DM6 L;  5C2D A;  2ZWH A;  5H1S Q;  5LY3 A;  4JEP A;  4IOA L;  2PAV A;  5CE3 A;  4IXC A;  2NRZ A;  2E2Q A;  1QHA A;  1T3V A;  4U67 L;  2P9U A;  5EXW A;  2OTJ N;  1SS6 A;  3MCA B;  1Q82 O;  4M63 C;  2BTF A;  3VET A;  3MWT A;  2I7P A;  3CC7 N;  1GLB G;  5GAG P;  4O8K A;  4LC9 B;  3VEN A;  1MA9 B;  5JLF A;  2P9N B;  2DPN A;  4FWN A;  3HOS A;  1BO5 O;  3CJ7 A;  3CCE N;  4KBO A;  2A6A A;  4JKD A;  3U4L A;  2NRW A;  4JD2 B;  4IWV A;  5GAD P;  3U9D A;  1NGF A;  1JCE A;  2CH5 A;  1BDG A;  3AAQ A;  3E66 A;  3O9U A;  4HWI A;  5FPN A;  2FXU A;  3UE5 A;  2P9I B;  1N8R O;  4NLC A;  3MX5 A;  4R79 A;  3BUZ B;  1GLF O;  4MLH A;  3AY9 A;  1HKG A;  2CGK A;  3E9O A;  2QTD A;  3FLC O;  3P39 A;  4FOE A;  5AQJ A;  5JLH A;  1JJ2 M;  3SAG A;  1YAG A;  1S3X A;  4CI6 A;  2E2P A;  2QM1 A;  3BEX A;  3EKS A;  1ZBS A;  3T7Z A;  3ZEU A;  4YOV A;  3VOV A;  4A59 A;  4H0O A;  3KHY A;  1QZ5 A;  2HF3 A;  4JN4 A;  3VEY A;  1K8K B;  3D6R A;  4IFE A;  4CJ7 A;  3MCP A;  4JK7 A;  2Q0R A;  3D2E A;  1RDW X;  1U6Z A;  3VF4 A;  2GX9 A;  4CZK A;  5AZJ A;  4H0V B;  4PHT X;  4PL7 A;  1M90 O;  3Q7C A;  2FSK A;  3BF3 A;  4RWT A;  4O8U A;  3VTH A;  1NM1 A;  1P8Z A;  4CZL A;  1E4F T;  2HBK A;  5C2F A;  2ITM A;  1KAZ A;  2ZF5 O;  1O13 A;  4BQL A;  2VCP A;  3IMX A;  2YI1 A;  4A57 A;  4JAX A;  4BRL A;  3CET A;  2NRH A;  4BRA A;  1EO1 A;  4J8F A;  2J4R A;  2PBD A;  2F7T A;  2P9N A;  3M3Z A;  2Q0U A;  4IDH A;  4B1V A;  4WQ5 A;  5KPT A;  5ELZ A;  2A3Z A;  4EFH A;  3VPZ A;  4IO8 A;  3CME N;  3LL3 A;  4BR4 A;  5HL7 L;  5TKW A;  4M7Y A;  2YJF A;  1YIT N;  1RDU A;  2AA4 A;  5BN8 A;  1HUX A;  2HBL A;  2ZGZ A;  4F9O A;  5KPR A;  1LOT B;  2NRT A;  2GWJ A;  2I7N A;  4WQ4 C;  5GAE P;  3I33 A;  3C7N B;  4PKG A;  3TPQ A;  4BRP A;  4OPA A;  3A5O C;  1T6D A;  2GEM A;  4YOW A;  3FZM A;  3L6Q A;  2QI2 A;  4QS7 A;  3VEO A;  2RHK A;  4K43 A;  3O1B A;  1GLA G;  1K8K A;  3EL2 A;  3FZK A;  5M1Q A;  4A2B A;  5BR9 A;  4H5T A;  4DCH A;  1ZXO A;  3TTC A;  1TUY A;  4KH4 A;  3GOI A;  5M1O A;  1NGH A;  1X3M A;  3P4I A;  1WOQ A;  3QB0 A;  5AFU A;  4HTL A;  4UY8 O;  2E2N A;  3CCS N;  3VEX A;  4PL8 A;  4H0P A;  2E20 A;  1HLU A;  3DJC A;  3R6M A;  5F1X A;  4DQ8 A;  2F9W A;  4WCE L;  3WEE B;  4JHD B;  2IIR A;  2Q1N A;  3BF1 A;  2UYT A;  4JKC A;  1U2V A;  4GNI A;  4EHU A;  3J7Z O;  1YJ9 N;  1Y64 A;  4A5A A;  1SZ2 A;  3CJC A;  3SBT A;  3RSE B;  3QFU A;  3R1X A;  3WXK A;  3EZW A;  4G9Z A;  3ULE A;  4E1J A;  3A8Y A;  1NBW A;  4GVE A;  2A42 A;  4JKB A;  4ILH A;  3O9R A;  3O5B A;  3ZET A;  5BRD A;  4BR9 A;  4H0T B;  4K41 A;  3ENH A;  2GEL A;  5CHI A;  4A62 A;  1KXP A;  2V52 B;  1KAX A;  4Y0W A;  2D4W A;  5EVZ A;  3OBW A;  1QQM A;  4U7B A;  2NRV A;  3O9T A;  4FWR A;  3KK7 A;  2P9P B;  3ZX0 A;  3C7N A;  4KH5 A;  3VGK A;  5C0Y A;  1YI2 N;  3O1W A;  5AQU A;  4CZE A;  1NGJ A;  5M1F A;  3I55 N;  4OPH A;  2W41 A;  1VQP N;  3CF5 L;  2P9L B;  3FE1 A;  4JK9 A;  4MLE A;  3CJA A;  2NZT A;  2YHX A;  3DWL A;  4H0Y B;  1VQ4 N;  3AGK A;  2ASP A;  3CI5 A;  3FZL A;  4A61 A;  3CHW A;  5DM7 L;  2IVP A;  5ADX H;  4BGA A;  1KQS M;  3FFK B;  3FGU A;  5AQY A;  5EX5 A;  3HOT A;  2W40 A;  1J6Z A;  1JCG A;  4CZF A;  2ZJQ L;  4ISF A;  4ISG A;  4YDU C;  3O08 A;  4IO9 L;  1YHQ N;  2E2O A;  4GV3 A;  1XC3 A;  3WEE A;  3IKM A;  4JHD A;  2Q31 A;  3WXJ A;  4BR7 A;  1RFQ A;  3K9K A;  4H0X B;  3EE8 A;  5CR4 A;  5GIN A;  4GY2 B;  3RSE A;  2QWO A;  3WT0 A;  5M1N A;  2NNW A;  1BA1 A;  3SMS A;  2QW9 A;  5JVH L;  3WXL A;  2CH6 A;  2AP1 A;  1YVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...