2FSKA

Crystal structure of ta0583, an archaeal actin homolog, semet data
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
326
structure length
321
Chain Sequence
MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTETESWGIGGKIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIPVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural protein
molecule keywords hypothetical protein Ta0583
total genus 90
structure length 321
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fskA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fskA01
1MWMA 3WQTA 1E4GT 4BRPA 2PAVA 5EVZA 3BEXA 5AZIA 4B1YB 2FF3B 4BQLA 1NGHA 1C0GA 3HM8A 1QQOA 3L4IA 4H0YB 3QFPA 5BN8A 3H3NO 3AAQA 4BR2A 1ATNA 3A8YA 3GBTA 1HUXA 1T6CA 4BC4A 1T44A 4BRQA 1NGAA 1K8KA 3MMVA 4RTFD 4CZMA 5BREA 4CZLA 3UE5A 3VF2A 1XQSC 1RFQA 5AQKA 4FWMA 4DQ8A 3LDOA 3CIPA 4BRGA 4BGAA 5BN9A 4BC5A 4DHYA 4EHTA 1HPMA 3M1FA 5F2RA 3FFKB 4FSVA 3VGMA 4B1VA 5B8HA 1NGCA 3S41A 1IG8A 3VOVA 4FL9A 4BRAA 4ISFA 4FWRA 5AQJA 2VWBA 3ENOA 1SQKA 3MN9A 3VERA 2IIRA 4J8FA 2FSJA 3C7NA 1BA0A 3VENA 3CJ1A 1TUYA 5AQTA 2P9LA 2QWLA 2D1KA 5AQGA 3D2EA 3A5OC 5BPLA 4FWOA 3VPZA 3CJ9A 2HF4A 3VEVA 4EAHD 3HI0A 1SZ2A 4BR7A 4CZEA 3EKUA 5AR0A 3QICA 5AQYA 5E84A 2EWSA 4HTLA 3ATUA 4WYBA 3LDPA 4PL8A 4H0OA 3HSCA 4BC2A 1NGDA 2P9NB 2YCHA 2E2NA 2E1ZA 4CBWA 5EY4A 2P9UB 3KZBA 4BVPA 1H1VA 3W0LA 3DXMA 5AFUH 3WXKA 3CI5A 1ZXOA 4GY2B 1ATSA 3FGUA 1HKBA 2QW9A 3IUCA 5AZIB 3EN9A 3CJBA 2A6AA 3KHYA 5AQIA 4JAXA 3LM9A 3SMPA 2A40A 4A2AA 1Z6RA 4IJAA 2BTFA 4H0PA 5KPTA 5JLHA 2V7YA 4BRIA 2D0PA 4B1UB 3JS6A 3EO3A 1NGEA 1T6DA 1E4FT 1TYQA 5ELZA 1GLEG 2P9NA 4XEIA 4IWVA 2I7NA 3HBTA 3AAPA 3ATVA 5E26A 5AQMA 1GLBG 5F0XA 1HKGA 3UKUB 2F9TA 3LL3A 1BUPA 2A5XA 5AQQA 4JNEA 2P9LB 3DXKB 1DGKN 3M3ZA 3EL2A 1GLFO 2J4RA 1CZAN 1Y64A 5AQPA 1P8ZA 3CJAA 4MO4A 4K25A 4YDUC 4XH1A 5AQOA 3CETA 4K41A 3FZHA 2YI1A 1U2VA 1DEJA 1NGIA 3QBXA 3R8EA 1LOTB 3C7NB 1NM1A 3U9DA 1GLLO 3ULEA 3I8BA 1XUPO 3ZEUA 4BRDA 4ISGA 3WXIA 2AP1A 4O5FA 4K42A 2E88A 4EHUA 5AQSA 4BRHA 3LDNA 1K8KB 3ULEB 1NGBA 1KAXA 4MLHA 2P9SB 4H0XB 4NB4A 1Q18A 5BPMA 1U2VB 2D4WA 2P9KB 4GNIA 2E1YA 2QWPA 1MWKA 3D2FB 1X3MA 5AQVA 3UB5A 1RGIA 2ZGYA 5BRHA 3IMXA 3QB0A 3L0QA 4I6MA 4PKHA 2VCPA 3GE1A 4JHDB 4DCHA 2Q0UA 3A0IX 3O08A 2CGKA 3O4WA 3IFRA 3UKUA 1YVNA 3O5BA 3ZETB 5KPRA 5LJWA 3VETA 5BPNA 1JCEA 4B1WB 2YHWA 3GDQA 1MA9B 2UYTA 3BUZB 3ZETA 5BR9A 4NO7A 3D2EB 3TPQA 3DXMB 5AQHA 2FSNA 4M63C 2V51B 3WEEB 2FXUA 3LDQA 3O80A 1TUUA 3WQUA 4PKIA 3VGLA 5EX5A 5CE3A 3I33A 4WQ5A 1MDUB 4FWPA 4IJNA 4ISEA 1U6ZA 3R6MA 4H5VA 4RWTA 3GG4A 1J6ZA 5LJVA 5EOYA 1ATRA 4BVOA 2P9PB 2E2PA 4BRKA 3VGKA 3W3DA 4MO5A 2GWJA 4CZFA 2GWKA 5LY3A 4M7XA 2I7PA 2FLOA 1HLUA 2W41A 4H5NA 4IZ9A 2V52B 3CERA 2CGJA 1QHAA 4O8KA 2CH5A 3VEWA 5KPZA 1GLDG 4PKGA 3FZLA 4CBXA 1D4XA 3D2FA 1BU6O 4FWQA 4EFHA 3GL1A 3U8XA 3AARA 4JD2B 4CZIA 4B1ZA 2E2OA 3H3OB 3CJ7A 4BQZA 3MN5A 5AQRA 3EZWA 2VYPA 4QS7A 3G25A 2P9IA 3QMLA 4H5RA 2Q36A 3EKSA 2A42A 4FPBA 2GTDA 2Q0RA 2YJEA 1HX1A 3A5NC 1HKCA 2YJFA 3VEYA 3TU5A 2GEMA 1X3NA 2ASOA 3DWLA 3HZ6A 3WEEA 3FE1A 2WUSA 1KAZA 4BRLA 4FWNA 2V7ZA 3BF3A 3MK6A 3LDLA 3OHRA 1R59O 3ZX2A 5FPNA 4QS9A 4CI6A 5EXWA 3U4LA 4CD1A 2GUPA 5FPEA 3FLCO 2QWRA 4QS8A 1XC3A 4BREA 3MDQA 4BR9A 3P4IA 4CD3A 2ITMA 4E1JA 2NZTA 3ENHA 4WQ4C 3VEOA 4AM6A 3ID8A 1BG3A 4JD2A 3VEXA 5FPDA 1NMDA 3R9PA 3A5MC 1S22A 4XH4A 5AZJB 4BROA 2P9IB 4B1XB 3M6GA 3MCPA 3SJHA 4YDUA 3CJCA 3B8AX 2PBDA 2E8AA 3VF4A 1KAYA 4A2BA 5KQ8A 3WT0A 2P9UA 4H0VB 5BRDA 5ADXA 1GLJO 3ZX0A 5AZJA 4BC3A 1C0FA 1QZ6A 4H5WA 3KVGA 2HMPA 3CHWA 4Y0WA 5KQDA 1V4SA 1G99A 3QDKA 2DPNA 3ZEUB 1NLVA 5AQXA 2W40A 3C0BA 3QBWA 4RCHA 4BGBA 1GLCG 3D7EO 2FF6A 3WUHA 2Q97A 4BRCA 5FPMA 1WOQA 2P9KA 5AQZA 3AY9A 2A3ZA 3LM2A 3HTVA 1Z05A 3IDHA 1V4TA 4FWKA 2ASMA 1RDWX 3SK3A 2ASPA 1ESVA 3MN6A 4FOIA 3SMSA 1QQMA 3DXKA 3VF6A 1NGJA 4BR0A 3O8MA 1NBWA 2FSKA 1DKGD 2P9PA 3DAWA 2OANA 4AM7A 4BG9A 1BOTO 3FR0A 4IXCA 3UKRA 2HOEA 3RSEA 3DJCA 4CBUA 1QQNA 3MN7A 4CZHA 4XH5A 1KXPA 2YHXA 3FZMA 5AQWA 2CH6A 1OKJA 3H46O 2Q2RA 4JN4A 1BA1A 4H0TB 4K43A 3FZKA 2QXLA 5AQLA 4WQ5C 2KHOA 5JLFA 3RSEB 1SAZA 1JCFA 2A41A 3O1BA 4B9QA 2NRHA 4L3QA 3BF1A 4Z94A 2ZGZA 4CJ7A 4KBOA 5AFUA 4BG8A 2GELA 4IO8A 4EIAA 2ZF5O 2Q31A 4BRFA 2IVNA 4A61A 3A5LC 2YHYA 2QWQA 4CZGA 1GLAG 3WXLA 4FWLA 1YUWA 2P9SA 3O1WA 4BRMA 1BWFO 5BRFA 3H45C 4HWIA 5F1XA 5JICA 2IVOA 4CZJA 2IVPA 2AA4A 2BUPA 1NWKA 1ZC6A 1YXQA 3VESA 1S3XA 5AQFA 3H6EA 3CQYA 2D0OA 3L6QA 2H3GX 3WXJA 4FO0A 5TKYA 2HF3A 5AQUA 4MLEA 4BRNA 5JMVA 3BP8A 1NGGA 2E20A 1BDGA 3GOIA 3U9ZA 4CZKA 1NGFA 4BR4A 4FPAA 3VEZA 3ZX3A 4H5TA 1ZBSA 3FZFA 2Q1NA 3CQXA 4FOEA 2QM1A 4PL7A 2ZWHA 4A62A 1JCGA 4F9OA 1TYQB 4LC9B 1QZ5A 3H1VX 2QWOA 2F9WA 4C23A 2NLXA 1IJJA 3QFUA 4H03B 2QWMA 4DB3A 5ADXH 1WUAA 2E2QA 5AQNA 1EQYA 4M7YA 1BO5O 3SLCA 2QWNA 1LCUA 4I6MB 4BR5A 2CGLA 3J8AA 4FWSA 3JXUA 5I9EB 1X9JA 4WQ4A 3H1QA 1YAGA 4JHDA 1HJOA 3UKRB 3O6WA 3F9MA
chains in the Genus database with same CATH superfamily
1MWMA 3AA4A 1S1TA 4AHVA 3BEXA 3F9KA 2FF3B 2HSTA 4K8ZA 3HL8A 4E3SA 4JI5K 4H0YB 5BN8A 4FZYA 1ATNA 1WBDA 3GBTA 2IDOA 1HUXA 3OBYA 1B92A 1K8KA 3MMVA 3O9UA 4DUYK 5BREA 2HMIA 3VF2A 4F2SA 4IFEA 1OH6A 4OKJA 3TARA 1O1WA 4DHYA 3K0SA 4DSFA 1IV0A 3TSQA 2ITGA 4FSVA 3VGMA 3OYMA 1IG8A 3VOVA 5C12A 1N8RO 4F3TA 1B9DA 4FJGA 2ZD1A 1FW6A 4ILJA 3C7NA 3VENA 4IOCL 1OH5A 5AQTA 2P9LA 2D1KA 1KLMA 1XHZA 3D2EA 3A5OC 2HF4A 5FROA 4EAHD 3OYLA 4DTRA 1SZ2A 1RT3A 4DV2K 2KQ2A 4CHZA 3AVMA 2X74A 3QICA 1Q9YA 5AQYA 2E4LA 2EWSA 4WYBA 4KH5A 3P31A 2XO7A 4PL8A 3THWA 4H0OA 1JLCA 4CE9A 2G8IA 4CJWA 3AVGA 3KZBA 4BVPA 4CF1A 1MU2A 3CI5A 4FK2A 4OX9K 2NUBA 2QTDA 3OYEA 5HRSA 2Z1JA 3CJBA 4DQPA 4B3OA 3MX5A 1IO2A 4A2AA 3IKMA 4IJAA 1VSEA 1WLJA 4JKEA 3OYKA 2BTFA 1HMVA 4AHSA 4B1UB 1T6DA 1NGEA 1E4FT 4DR4K 1WSEA 3ZSXA 1HNWK 1JLFA 4CJVA 5E26A 4CFCA 4CFDA 1HKGA 3LL3A 2A5XA 3OYAA 1TGOA 5AQPA 4W5QA 3F5TA 4YOTA 1U47A 1TKDA 1P90A 4C8KA 4XH1A 3THWB 3CETA 3C65A 4K41A 1QSYA 3QO9A 3QBXA 3AVAA 2O8FA 3K59A 3LP1A 1QTMA 1NM1A 1SKRA 3U9DA 1GLLO 4RW6A 2WC9A 3I8BA 3K5OA 3K5LA 3VQCA 4JLHA 2OTLN 3PY8A 1QHTA 4DWIA 2E88A 3KWGA 1EWQA 4BRHA 4C8MA 1NGBA 1HYSA 1KAXA 2W6KA 2P9SB 4B8CA 4OLBA 5BPMA 4GNIA 3AO3A 4KHNA 1OVQA 3S3OA 4ELUA 2D0AA 1LW2A 2VCPA 3A0IX 2CGKA 1RTHA 3O4WA 3IFRA 1LV5A 3M8RA 1JCEA 1U48A 1FJGK 3D45A 2HVHA 1MA9B 2VG5A 4BACA 3ZETA 3SV4A 4NO7A 3D2EB 3AO2A 3DXMB 4CJRA 2FSNA 3HPHA 4NYFA 4E0DA 1BCMA 3QEPA 2B6AA 4TSXA 2V51B 2FC0A 1D8YA 2YKMA 3P5JA 3TR8A 1OH7A 1Q7YO 1LWEA 4DV1K 3CPEA 4FWPA 4IJNA 3CC7N 5M1NA 2Z1HA 5HRRA 4JI4K 1U6ZA 3R6MA 4IFVA 4CK1A 1ATRA 4FM2A 3OYDA 2P9PB 3W3DA 3DM2A 2GWJA 4PY5A 2GWKA 4WFNL 4AHRA 5LL6Z 3VQ7A 3VQPA 4DR3K 3ZT3A 1BISA 3HOTA 3EY1A 4KHSA 2CGJA 2CH5A 3VEWA 4CJTA 1C1CA 1GLDG 1CXQA 3CM6A 3NH1A 5JVHL 4FM1A 1FKPA 4DV5K 4EFHA 3KKRA 3MEGA 1QVGM 1QVFM 2XY8A 3U8XA 4CZIA 2E2OA 3H3OB 1L3UA 4BQZA 1YHQN 4CF2A 2VYPA 3G25A 2P9IA 3QMLA 1RILA 4N41A 1EP4A 2A42A 2YJEA 5C0YA 1UA1A 2P51A 4DF4A 1Q86O 2GEMA 4X64K 3KIOA 4ZTFA 2ASOA 3T19A 4QCLA 3WEEA 4C1NK 2WUSA 3ZSRA 4HTUA 4J2BA 4BRLA 4DR1K 4GV9A 3OVNA 1HQUA 4K0KK 3ZX2A 5HL7L 3U3YA 1D9DA 1VQLN 4CI6A 3T69A 3CCLN 2GUPA 3KK3A 3TWHA 4DR2K 2QXFA 3FLCO 4QS8A 1NK8A 4BREA 3P4IA 2O8EB 2A1RA 4CEEA 3LP2A 3ENHA 2IS3A 1HRHA 3VEXA 4KO0A 2NRTA 4BDZA 3CC4N 5HOOA 1S22A 4XH4A 3RVCA 1NJIO 4FLZA 3T7ZA 1ASWA 2E8AA 2PBDA 3TI0A 5KQ8A 3WT0A 1KVCA 4OGEA 4KTWA 1GLJO 1D9FA 3P1GA 4E1NA 1VAZA 3CHWA 4Y0WA 3V9WA 1C1BA 4E1MA 2HBLA 3QDKA 2OPQA 3ZEUB 3QERA 3IS9A 4M3ZA 3V9SA 5J2MA 2DY4A 1UAXA 2Q97A 3P83D 4R5PA 1WOQA 3QEWA 5AQZA 4CGJA 5GIOA 1V4TA 2HHUA 1HQEA 1WB9A 1QQMA 3TAQA 3AGKA 3OA9A 2B4JA 4DTSA 4LF5K 1XNQK 1O13A 2NRVA 3C6HA 3HO1A 3EE8A 1FKOA 2F7TA 3AVNA 3OYJA 3HK2A 3HPOA 3KK7A 3DAWA 3RSEA 2PYJA 4N56A 4O0IA 1KXPA 3FZMA 4ID1A 1K9MO 4DSLA 1XI1A 4J2EA 1TL1A 1Z26A 4H0TB 3FZKA 2ZJRL 4KRFA 4YOUA 5KI6A 2KTQA 1JCFA 2RF2A 3O1BA 4B9QA 4KREA 4CFBA 5DK5A 5CY4A 1HNXK 5AFUA 2GELA 4NXNK 5FRNA 3I55N 1HR0K 1VSKA 4HUGA 2IVNA 4FJMA 3TTCA 1GLAG 4M42A 1BWFO 3DLRA 3H45C 2UUAK 4KB0A 2DFEA 2IVOA 4BWJA 1NWKA 3VTHA 1YXQA 4FJJA 2D0OA 4HCBA 4CJ4A 1RTJA 1NJWA 4FO0A 1IKWA 2HF3A 3TAGA 4BRNA 1X9SA 3B6OA 1KFDA 3VEZA 2Q1NA 2Z1GA 3CPWM 4JYAK 1TYQB 4ZHRA 3OYNA 5JS2A 2NLXA 3QIPA 4DR7K 5MLCQ 1GOCA 5ADXH 5GINA 2E2QA 3QEVA 4O4GA 4X62K 1BO5O 2RN2A 3SLCA 2QWNA 2D0BA 4GMJB 1W2BM 3J8AA 3JXUA 4N47A 1L3VA 1NKBA 1NK7A 3VN5A 3H1QA 3VQDA 3THYB 3ZLJA 3NF8A 3SAHA 3ZT0A 3LPUA 3RMDA 3WNEA 4BRPA 2PAVA 1S1WA 5EVZA 3VA0A 2HBKA 5SZTA 4XIUA 3IG1A 1NK0A 3L2RA 2IGIA 3ASMA 1QQOA 4ELTA 1VQMN 3AAQA 3A8YA 1M1KO 1T6CA 4BC4A 4BRQA 1XMOK 4RTFD 3NF7A 4CZLA 4DTJA 2HVIA 5M1PA 4DQ8A 4M3UA 3LDOA 1WNSA 5I42A 1U4BA 4BRGA 2YX6A 5BN9A 5K14A 4BC5A 1KSPA 3TSUA 2DTUA 5B8HA 4GKJK 4FWRA 5AQJA 2D0CA 1SQKA 3VERA 3HM9A 4J8FA 4CJQA 1N34K 3THXA 4J2AA 3PIOL 1TUYA 3PX6A 3I0SA 2QWLA 4DV0K 4Q0BA 5AQGA 3EZ5A 4AQYK 4WE1A 2KKZA 4FWOA 1X1PA 1JLEA 4YORA 3OYIA 3QETA 3EEQA 4KTZA 4DU1A 4JV5K 4KHUA 3CXCM 1ILYA 1VSLA 1CZBA 2IAJA 4C8OA 4Q5VA 3LDPA 1KVAA 1U04A 2HHWA 2NRXA 4CJUA 4IOAL 3KWIA 3CMEN 3NFAA 2RPIA 4DTOA 1BI4B 2YCHA 4CBWA 1H1VA 3W0LA 3DXMA 3WXKA 4JI6K 4AHUA 5SWMA 2UU9K 3SUQA 3NVKA 2HW3A 3O9RA 1KD1O 4GY2B 1HKBA 5AJ3K 2WOMA 3IUCA 1SKSA 5AZIB 3VQQA 3QEXA 3OYHA 4JI1K 4M3TA 3L3VA 1Z6RA 1ZBHA 4H0PA 5KPTA 4OKEA 5JLHA 4W5TA 3JS6A 1TYQA 1GLEG 2I7NA 3HBTA 3AAPA 1GLBG 2AJQA 2KZZA 1DGKN 3LP3A 2QKKA 1GOBA 1VQNN 4KH4A 3ZT2A 1YTUA 4YDUC 2KLAA 3VQ4A 1DEJA 1NGIA 1S5JA 3QEIA 3T1YK 4B9LA 1UA0A 1HPZA 4YFUA 1VQ6N 3ULEA 2O8BA 4FYDA 1BHLA 1LWFA 4CK3A 3HP6A 1OVYA 1S6QA 4EHUA 1J53A 2UXBK 1SL0A 1N5YA 3T1AA 4B9NA 4MLHA 4H0XB 3ZSQA 1Q18A 4JK8A 1IBMK 4DF8A 1X3MA 3AO1A 3UB5A 2ZGYA 3LAMA 3OW2M 3L0QA 2PY5A 4I6MA 4PKHA 3NCIA 4JHDB 2O4GA 3O08A 3C6UA 3ID6A 5J2PA 5KPRA 4FZZA 4CK2A 2O8EA 5BPNA 3AVIA 4B1WB 3GDQA 2UYTA 2G8WA 4YOVA 3K2PA 1T8EA 5AQHA 3HRGA 4M63C 4CF0A 4IG3A 5C2FA 3LAKA 3WEEB 3WQUA 4CCHA 2VG7A 4KB1A 3CCUN 5C2DA 3VGLA 3I33A 3QESA 3DLKA 4IOXA 3G71N 4JI7K 4ISEA 4RWTA 4BVOA 3V9ZA 2E2PA 3SQ0A 4FM0A 4MO5A 2QEXN 3AVCA 1YF5L 1TL3A 4KHYA 4CHNA 1G15A 3PSIA 4M7XA 2I7PA 2FLOA 3OS2A 1HLUA 2W41A 1NU0A 4H5NA 3TAEA 3PX0A 2E5LK 2V52B 3CERA 1K8AO 1RBSA 3CD6N 4DU3A 1EO1A 2GUIA 4CBXA 4CF9A 1D4XA 4B9MA 4B3RK 4DU4A 4CEAA 4IG0A 3AARA 3SPYA 4DTMA 1LWCA 4PQUA 3EZWA 3DI6A 3NH0A 1FK9A 5M1KA 4ZTJA 2Q36A 1ASVA 3CMAN 1HKCA 2YJFA 4MDAA 4DS5A 4OPAA 2GV9A 4KPYA 4DSKA 3HZ6A 3CFRA 1RBUA 3FE1A 1KAZA 3V81A 1RT7A 2V7ZA 3BF3A 5CHIA 3NHGA 3MK6A 3OHRA 4EZ6A 5FPNA 5BR8K 3NVMA 3S3MA 5EXWA 2FBTA 4CD1A 3O3GA 4KFBA 3FFIA 5EU7A 1BQNA 3CM5A 1J9AA 1U49A 4CD3A 2ITMA 3E9OA 2PZSA 2HBJA 2NZTA 4WQ4C 4IKFA 4E7KA 3K5NA 1VQ4N 4AM6A 5J1EA 1KFSA 4JI3K 1BG3A 3DRSA 1NMDA 3A5MC 3DMJA 5GAEP 3G0ZA 4DTNA 3M8QA 5AZJB 4AHCA 4B1XB 1VQ9N 2BDPA 3CJCA 3VF4A 4E7IA 3IRXA 3K9KA 4CEZA 3ULDA 4CERA 4BC3A 3CG7A 1QZ6A 2O8FB 1QE1A 4U7BA 5KQDA 4O0JA 3F73A 3RRHA 5AQXA 2W40A 4MDBA 4G1QA 3TAMA 2FF6A 3L2WA 4IEEA 3WUHA 4BRCA 5FPMA 4B9TA 2P9KA 4N76A 3MAQA 1Z05A 3HTVA 3KD5E 2HNZA 4M3WA 3SAGA 1ZBIA 2ASPA 1VRUA 3DOLA 2OPPA 2WBNA 4O44A 1NGJA 3O8MA 3NE6A 1RCHA 1DKGD 3NBPA 4BG9A 3FR0A 3QINA 4NCBA 4BY9C 1J5EK 4CBUA 1QQNA 2YV0X 3MN7A 4CIEA 4CZHA 4XH5A 1S1XA 4GVEA 3KJVA 3KK2A 5AQWA 1OKJA 4CJKA 3H46O 3G4SN 4FLTA 3SV3A 5AQLA 4DUZK 2OZMA 4WQ5C 1A5XA 1HNIA 3HXMA 5CZ2A 4JKFA 4KBOA 2X78A 3OJUA 3NH2A 4M3YA 4IO8A 4EIAA 2ZF5O 4KHWA 1NOZA 4BWMA 1ITGA 2YHYA 2QWQA 4CZGA 4ILHA 3WXLA 3J80O 3CFPA 5DMRA 3O1WA 1LW0A 3TANA 5BRFA 2W6LA 4N5SA 5F1XA 5JICA 3ZSYA 4Z4IA 2HHQA 4B9UA 3RMCA 2AA4A 2BUPA 2OZSA 4A5AA 1XWLA 3VESA 4CIFA 1JLAA 1S3XA 5AQFA 2OYQA 3SZ2A 1Q8IA 4FK4A 2RE2A 1LAVA 3WXJA 3KLEA 5TKYA 1BL3A 4MLEA 3AA5X 3O9QA 1NGGA 3J7ZO 2E20A 1BDGA 2UXCK 1NGFA 4BR4A 1RDDA 4FPAA 3N4QA 1IH7A 1TK5A 1ZBSA 2W42A 4DV3K 4FLVA 2QM1A 3PV8A 1YTAA 3H1VX 2F9WA 5HBMA 2QWMA 2XY7A 4JI8K 4FLWA 4M7YA 4DR6K 1NK9A 3J7YP 2CGLA 2G8VA 5C10A 4CJLA 4FWSA 3HPGA 1VSHA 4B08A 3CCQN 4DQSA 1X9JA 2HNDA 4DKWA 3KKSA 2FBYA 3UKRB 3AGRA 3THXB 3KD1E 4AH9A 1E4GT 3SCXA 3ZT4A 1EETA 5M1QA 5AZIA 4B1YB 3D0PA 4BQLA 3S9HA 4GV3A 4WF9L 1C0GA 3L4IA 3H3NO 3JSMA 1EKEA 2ZE2A 1T44A 1RBVA 1NGAA 4CZMA 1WSGA 1TK8A 5GAGP 1RFQA 4FWMA 4IEIA 4YHHK 3CIPA 1S9GA 3V1QA 3BGRA 3CCEN 4EHTA 4BE2A 2O8BB 3CQ8A 2KZMA 2WONA 1QSSA 1VSFA 5F2RA 5KTQA 1Q81O 3S41A 1RDAA 4C1NI 4FL9A 4BRAA 1RNHA 3JAMO 5FRMA 3WXMB 2VWBA 2IIRA 3DLLL 2PYLA 2O8DA 2XY6A 3AA2A 4GVMA 1BGXT 1BA0A 3ISNC 3CJ1A 1WN7A 4CEBA 2HHTA 3SUNA 5BPLA 4FK0A 4WFBL 4DTXA 4CGDA 3VEVA 3HI0A 4JKDA 4BR7A 4CZEA 2YHBA 4OO1J 4J2DA 2FBVA 4HTLA 3CYMA 3NF6A 4YNQA 3SI6A 2F4VK 5J2NA 3QLHA 1NG9A 1UOCA 2P9NB 1TKTA 2E2NA 2E1ZA 1S1VA 4CGIA 3CCMN 5EY4A 1NJZA 2P9UB 4CJEA 1C6VA 1A5WA 5KGWA 3AVBA 4V19S 2QW9A 4FLYA 3UIQA 4F4KA 2UXDK 3EN9A 4DQIA 1B9FA 4LH4A 2YKNA 4OVLA 1YJNN 1VSIA 5AQIA 4FXDA 3ZSVA 3LM9A 2A40A 1L5UA 5H1SQ 3CC2N 2F96A 4OGCA 1NKEA 2D0PA 3ZSZA 4A59A 3L8BA 5ELZA 1C0TA 4DSIA 3QNNA 4ELVA 4OPKA 1NMNA 3P39A 2O8DB 4E7HA 2UUBK 1D5AA 1N36K 5AQMA 3E9LA 5F0XA 2F9TA 5AQQA 2HNYA 1VQ7N 4JNEA 3DXKB 4JKAA 3ALYA 3I56N 4NYNA 3EL2A 5KRSA 1GLFO 2J4RA 3V4IA 1P8ZA 3CJAA 4MO4A 4DTPA 4K25A 4M45A 3KTQA 3LDSA 3FZHA 4JKBA 1U2VA 2D5RA 3NGIA 3V1RA 1REVA 2G8UA 1J54A 1N32K 4ISGA 1ASUA 2YNGA 3MXMA 4CHYA 2AP1A 4O5FA 3CCJN 4LD0A 1TKXA 4FW1A 3TTFA 3LDNA 4RW4A 3BY5A 3E9PA 4NB4A 4YY3K 4KI6A 3L4QA 1U2VB 2D4WA 2P9KB 2E1YA 2QWPA 2P5OA 5C24A 5AQVA 4CHQA 1KRPA 3QB0A 1QS4A 4BE0A 3RWUA 3GE1A 2Q0UA 4PHTX 3SJJA 1CLQA 2OCEA 1I39A 5LJWA 3C95A 4MQ3A 1N6QA 4I2PA 3KLFA 4NXMK 1YJ9N 5CZ1A 4FVUA 2EHGA 5BR9A 4H4MA 3TPQA 1J5OA 4FJHA 2FXUA 4RW9A 3O9SA 1TAQA 1YJWN 5EX5A 5CE3A 2ZJQL 3RR7A 3G10A 4O5BA 3VQ6A 1JKHA 4OPJA 4H5VA 1J6ZA 1FXXA 5EOYA 4DFMA 4BRKA 5M1FA 4IDHA 4FJXA 5IT9O 1WSIA 5LY3A 1XMQK 4LF7K 1GOAA 5CYMA 1WSHA 2WTUA 1QHAA 2NRRA 4I7FA 3U6FA 4O8KA 2VQEK 3FZLA 1BU6O 4DMNA 3GL1A 5DM6L 4JD2B 4Z4HA 4B1ZA 4I2QA 4NLCA 3S3NA 1XNRK 1K6YA 3MN5A 2ZJPL 4FJIA 5AQRA 4QS7A 1W7AA 4CJPA 2NRZA 1SKWA 4B3SK 4FLXA 3OS0A 2YNIA 3AVKA 4GV6A 2GTDA 1HX1A 3A5NC 1ZYQA 3VEYA 1XHXA 1UWBA 4IO9L 4JRPA 4I9QA 4FJ7A 4DV6K 4B3MK 3DWLA 1W9HA 4FZXC 1IBLK 1L3SA 3DLGA 4B9VA 4FWNA 4YOWA 2OA8A 3M8SA 3VQ9A 3KLHA 3WNFA 3AA3A 3OY9A 4HCCA 1VHXA 3RMAA 1SV5A 1NK6A 2BANA 5FDLA 2ATQA 5TKWA 2PFUA 3DLEA 2QWRA 1XC3A 3K5MA 3THYA 3PSFA 5CYQA 4Z4EA 3VEOA 4EZ9A 4IDKA 4JD2A 4CEQA 2YNHA 2WFBA 3TAPA 3QNOA 4BROA 3M6GA 4PWDA 5DM7L 3SJHA 1BIUA 2LSNA 5HROA 1KAYA 3F2KA 4DFJA 4PA1A 4DFPA 5BRDA 2P9UA 4MFBA 2F8SA 4B8AB 1RDCA 1JL1A 1DTTA 3RTVA 3KVGA 1F21A 2DFHA 1G99A 2DPNA 4B3TK 4DSEA 3LZJA 1RT4A 1VSMA 4RCHA 3SQ1A 1GLCG 3D7EO 4F8RA 3AO5A 4W5OA 2VWJA 3AY9A 3IDHA 3V9XA 3O4QA 3OTOK 2ASMA 4M3RA 1RBRA 4JK9A 3SK3A 4BE1A 3MN6A 4FOIA 3VF6A 1IG9A 3AVJA 4CHOA 4Z4CA 4JKGB 1S72N 4WFAL 3L2UA 3LWMA 1NBWA 2FSKA 1YT3A 2P9PA 2OANA 3U3GA 3VQ5A 3CCSN 1BOTO 1LAWA 4JI2K 2KFZA 3O9TA 4FLUA 4F3OA 3DJCA 3J81O 2CH6A 4JN4A 1BA1A 4K43A 4PUOA 2QXLA 1NKCA 1KQSM 3RSEB 2XY5A 2A41A 4I9LA 1KVBA 2NRHA 4L3QA 3BF1A 4O8UA 3LANA 4A57A 2ZGZA 4CJ7A 4BG8A 4OKKA 3SUPA 3T3FA 2A1SA 3I8DA 3DLHA 5M1OA 4A61A 3KLGA 1HYVA 3D6RA 4E89A 4FWLA 1YUWA 1WSJA 2P9SA 4C8NA 4CIGA 5HRNA 2VQFK 4BRMA 4UY8O 4R79A 4Y1DA 3AV9A 4HWIA 4JKCA 1W97L 5E41A 1TVRA 4DS4A 3N4PA 4CZJA 4FJKA 1ZC6A 1QSLA 2RHKA 3MWPA 4CJSA 2HHSA 3H6EA 3CQYA 3L6QA 4X66K 3ENBA 4DR5K 3SQ4A 4RG8A 3MEDA 1T05A 1JLBA 5JMVA 3BP8A 4FJLA 4DLGA 2QI2A 4Z4FA 3U9ZA 3R1XA 4CEDA 4CZKA 3LWLA 3MWTA 3OYGA 4A5BA 3ZX3A 4H5TA 5KGXA 3H08A 4FOEA 3E01A 1YI2N 4PL7A 1JCGA 4F9OA 4LC9B 2QWOA 3EE9A 3QFUA 4H03B 4FW2A 3PX4A 5J2QA 1WUAA 5AQNA 4AHTA 3HP9A 3DYAA 1NJXA 1NOYA 3WNHA 4I6MB 4BR5A 2OPRA 4KKOA 3OYFA 3V9UA 2HHVA 4JHDA 1HJOA 2Y1JA 3NMUA 4KV8A 3DOKA 3O6WA 3WQTA 4CJ3A 3VQ8A 3VQBA 2E6LA 1BCOA 2IC3A 3QIOA 4QAGA 1NGHA 3HM8A 1C1AA 3QFPA 4BR2A 4FVMA 3AO4A 2GBZA 1OH8A 2Z1IA 3SYZA 2JLEA 4KAZA 3WNGA 4CJFA 3OBWA 3UE5A 1XQSC 5AQKA 1TV6A 2OTJN 2ETJA 4HUEA 2G8HA 4CECA 4BGAA 1RDUA 2BE2A 1HPMA 3MEEA 4LF4K 3M1FA 1VSDA 3FFKB 4B1VA 1NGCA 1SUQA 2EX3A 3VQEA 4ISFA 3ENOA 1YIJN 4FJ9A 3MN9A 2FSJA 4KHQA 3JYTA 4M41A 1E3MA 4ID5A 4DFKA 4LY7A 1VSJA 2KW4A 3RMBA 2P5GA 1KLNA 3SBTA 3VPZA 3CJ9A 4RW8A 2HHHK 4WCEL 3EKUA 5AR0A 5E84A 3ATUA 3HSTB 3C6AA 1YVUA 3PO4A 3OS1A 5D3GA 3HSCA 4BC2A 1RTDA 1NGDA 1JLQA 4JS5A 5AFUH 1ZXOA 3B6PA 1YITN 1I94K 1N33K 1ATSA 3FGUA 3L2VA 1VRTA 4CEOA 1EX4A 1DLOA 4Y1CA 4GW6A 3CCRN 3CF5L 2A6AA 3KHYA 3HVRA 4JAXA 4JKHA 3SMPA 2V7YA 4BRIA 4E19A 5IWAK 3BDPA 3EO3A 4JKGA 3C6TA 3K58A 1SL2A 3KLIA 4Z4GA 2P9NA 4XEIA 4IWVA 2BGGA 4CGHA 4YOYA 3SUOA 1S6PA 1JJ2M 1C0MA 3ATVA 4EP4A 3MCAB 3UKUB 1BUPA 3VMFB 3E1YA 3G6EN 2P9LB 3P38A 3E66A 3M3ZA 5GADP 4OLAA 4HVJA 2BH1A 1CZAN 1Y64A 3VTIA 4FJ5A 5AQOA 1IKVA 2VG6A 2YI1A 3TABA 2YHAA 3R8EA 1LOTB 3C7NB 4JI0K 1XUPO 3ZEUA 5FLXO 4GKKK 2GX9A 4BRDA 3CFOA 3LP0A 3WXIA 4H8KA 5C15A 4Z0UA 4X65K 4K42A 5AQSA 2XHBA 1K8KB 4IFYA 3ULEB 1NNEA 5JVGL 1I3AA 2HBMA 3ZCMA 1VK0A 1A5VA 3V1OA 3ZSOA 1MWKA 3D2FB 1RGIA 5BRHA 3IMXA 1IKXA 3NGYA 4DCHA 3HT3A 4JRQA 5GAHP 2I5JA 1VQPN 3IAYA 2G8FA 3PLAA 1BQMA 3UKUA 2E6MA 1RT6A 1YVNA 3O5BA 3ZETB 4E7JA 3VETA 2YHWA 3HYFA 4LF9K 1WAJA 2R7YA 4KH6A 1IKYA 3BUZB 4OPHA 1HJRA 3R3LA 2KFNA 3LDQA 3O80A 1TUUA 3DRPA 4KHPK 4PKIA 1JL2A 4W5RA 3TTDA 4WQ5A 1MDUB 1HYZA 4LSNA 3GG4A 1JLGA 3BZKA 5LJVA 1QQCA 4BDYA 3VGKA 4CHPA 4FJNA 4JS4A 4CZFA 4E7LA 3NGZA 3EYZA 3MXIA 1C0UA 4O55A 4CVNE 1Z25A 5I3UA 1DT9A 2G8KA 1RT2A 4KTQA 2O8CA 4IZ9A 4DG1A 3OYBA 1RT1A 3BZCA 5KPZA 4CGGA 4PKGA 2F8TA 1WAFA 3D2FA 4FWQA 3OYCA 2X6NA 2HB5A 2Y1IA 3VQAA 3K9JA 1RBTA 1RDBA 3CJ7A 4NCGA 3THVA 4LH5A 4DLEA 4RW7A 4CJ5A 1Y97A 4H5RA 3SAFA 4OJRA 3EKSA 4FPBA 2Q0RA 1TKZA 1S1UA 3TU5A 5JS1A 2O8CB 3TAFA 4W5NA 4CF8A 4DTUA 1X3NA 3KK1A 3ITHA 4DV4K 4HHTA 4JEPA 4FCYA 1Q82O 1EWRA 4LF6K 3LDLA 2RKIA 3OJSA 1R59O 4QS9A 3M8PA 3MX2A 2JWLA 3U4LA 1VQKN 1HNZK 2ZQBA 5FPEA 4BDPA 1T03A 1U45A 2HHXA 4F2RA 4CESA 3MDQA 3CCVN 2B5JA 4DQRA 4CFAA 3T1HK 4BR9A 2NRWA 2VWKA 4E1JA 4DSJA 4ILGB 1SS6A 1RT5A 3ID8A 5LMUK 2XRIA 5FPDA 3R9PA 1NK4A 1IBKK 5HP1A 2VGNA 1X9MA 4CW7B 1NJYA 1BI4A 2P9IB 3HVTA 5KRTA 2VGMA 3MCPA 4B9SA 4YDUA 3B8AX 3M5RA 4CGFA 3SPZA 4QOZB 3I0RA 4A2BA 3O4NA 4H0VB 3VA3A 3O3FA 1KC8O 5ADXA 4NLBA 2YNFA 3ZX0A 5AZJA 1JXEA 4C8LA 1KTQA 1C0FA 4H5WA 2HMPA 3J7AP 4FJ8A 4KI4A 3DLBA 1V4SA 4LFAK 1NLVA 1CXUA 3C0BA 4EP5A 3QBWA 1VQON 4BGBA 1RTIA 1HNVA 4JK7A 1ZBUA 5GIPA 3AVHA 4IBNA 4U67L 2A3ZA 3LM2A 4FWKA 1RDWX 3NF9A 3V6DA 1X9WA 3L2QA 1ESVA 3SMSA 3DXKA 1ZBLA 3RRGA 4LF8K 2P1JA 4M3XA 1BIZA 3A2FA 4NCAA 4BR0A 3C94A 4LSLA 3Q7CA 4ICLA 1TK0A 4HUFA 2QA4N 1S9EA 2UUCK 4AM7A 4IXCA 3UKRA 2HOEA 3Q7BA 4YOXA 1W0HA 2YHXA 4L8RB 2X6SA 2IOCA 2Q2RA 3MXJA 5T7BA 2KHOA 5JLFA 3ZSWA 1SAZA 4Z94A 3NDKA 3LALA 4AF1A 3ZT1A 5CR4A 3LZIA 1T7PA 3PO5A 5A2QO 3K57A 4BRFA 2Q31A 3A5LC 3SNNA 1K73O 1Q9XA 5C25A 2ZM6K 3O3HA 3RR8A 1CZ9A 1SL1A 5LMNK 4LFCK 3PUFA 3L3UA 4DV7K 1T3VA 4G9ZA 2OPSA 1ZBFA 2FBXA 1TAUA 2IVPA 4DQQA 5C42A 1EXQA 1VQ8N 3HJFA 2H3GX 3AVLA 2Q3SA 1WBBA 3SBGA 4LFBK 5AQUA 3LPTA 3PIPL 1NK5A 1XC9A 3GOIA 2NNWA 3ZYYX 4AILC 3HOSA 3AVFA 2JWKA 3FZFA 5HLFA 4K8XA 3NAEA 3CQXA 1KCFA 2O4IA 2ZWHA 4A62A 3SQ2A 1L3TA 2JGUA 1WSFA 1DTQA 1QZ5A 2QK9A 4H4OA 4C23A 4CEFA 1IJJA 4DB3A 1R0AA 1EQYA 3TSPA 5HRPA 1LCUA 4UQGA 1VQ5N 3DRRA 1JXBA 2QKBA 5I9EB 4WQ4A 2DFFA 1YAGA 1M90O 3MECA 3F9MA
chains in the Genus database with same CATH topology
1MWMA 3WQTA 1E4GT 4BRPA 2PAVA 5EVZA 3BEXA 2HBKA 5M1QA 5AZIA 4B1YB 2FF3B 2HSTA 4BQLA 4GV3A 4WF9L 1NGHA 1C0GA 3HM8A 1QQOA 3L4IA 4H0YB 3QFPA 5BN8A 3H3NO 1VQMN 3AAQA 4BR2A 1ATNA 3A8YA 3GBTA 1M1KO 1HUXA 1T6CA 4BC4A 3OBYA 1T44A 4BRQA 1NGAA 1K8KA 3MMVA 3O9UA 4RTFD 4CZMA 5BREA 3OBWA 4CZLA 3UE5A 3VF2A 1XQSC 5GAGP 1RFQA 5AQKA 4FWMA 5M1PA 4DQ8A 2OTJN 3LDOA 4IFEA 4IEIA 3CIPA 4BRGA 2YX6A 4BGAA 5BN9A 1RDUA 4BC5A 3CCEN 4DHYA 4EHTA 1HPMA 3TSQA 3M1FA 5F2RA 3TSUA 3FFKB 4FSVA 3VGMA 4B1VA 5B8HA 1Q81O 1NGCA 3S41A 1IG8A 3VOVA 4FL9A 4BRAA 4C1NI 5C12A 1N8RO 4ISFA 4FWRA 3WXMB 5AQJA 2VWBA 3ENOA 1YIJN 1SQKA 3MN9A 3VERA 2IIRA 4J8FA 3DLLL 2FSJA 4ILJA 3C7NA 1BA0A 3VENA 4IOCL 3CJ1A 3PIOL 1TUYA 5AQTA 2P9LA 2QWLA 2D1KA 5AQGA 3D2EA 3SBTA 3A5OC 5BPLA 2KKZA 4FWOA 4WFBL 3VPZA 3CJ9A 2HF4A 4YORA 3VEVA 4EAHD 3HI0A 1SZ2A 4JKDA 4BR7A 4CZEA 3CXCM 1ILYA 4WCEL 3EKUA 5AR0A 3QICA 4OO1J 5AQYA 5E84A 2EWSA 4HTLA 3ATUA 4KH5A 4WYBA 3P31A 3C6AA 3LDPA 4PL8A 2NRXA 4H0OA 4IOAL 3HSCA 4BC2A 1NGDA 3KWIA 2P9NB 3CMEN 2YCHA 2E2NA 2E1ZA 4CBWA 3CCMN 5EY4A 2P9UB 3KZBA 4BVPA 1H1VA 3W0LA 3DXMA 5AFUH 3WXKA 3CI5A 3NVKA 1ZXOA 1YITN 3O9RA 1KD1O 4GY2B 1ATSA 3FGUA 1HKBA 2QW9A 3IUCA 5AZIB 3EN9A 2QTDA 3CJBA 3CCRN 3CF5L 2A6AA 1YJNN 3KHYA 5AQIA 3MX5A 4JAXA 4JKHA 3LM9A 3SMPA 2A40A 4A2AA 1Z6RA 3IKMA 4IJAA 4JKEA 2BTFA 4H0PA 5KPTA 5JLHA 5H1SQ 2V7YA 3CC2N 4BRIA 2D0PA 4A59A 4B1UB 1T6DA 1NGEA 3EO3A 1E4FT 1TYQA 3JS6A 4JKGA 5ELZA 1GLEG 2P9NA 4XEIA 4IWVA 3P39A 2I7NA 4YOYA 3HBTA 1JJ2M 3AAPA 3ATVA 3E9LA 5E26A 3MCAB 5AQMA 1GLBG 5F0XA 1HKGA 3UKUB 2F9TA 3LL3A 1BUPA 2A5XA 5AQQA 3E1YA 4JNEA 2P9LB 3DXKB 3P38A 3VMFB 3G6EN 1DGKN 4JKAA 3E66A 3M3ZA 5GADP 3EL2A 3I56N 1VQNN 1GLFO 4KH4A 2J4RA 2BH1A 1CZAN 1Y64A 5AQPA 1P8ZA 3CJAA 3F5TA 4MO4A 4YOTA 3VTIA 1P90A 4K25A 4YDUC 4XH1A 5AQOA 3CETA 3C65A 4K41A 2KLAA 3FZHA 2YI1A 4JKBA 1U2VA 1DEJA 1NGIA 3QBXA 3R8EA 1LOTB 3C7NB 1NM1A 3U9DA 1GLLO 1VQ6N 2WC9A 3ULEA 3I8BA 1XUPO 3ZEUA 2GX9A 4BRDA 4ISGA 3WXIA 2OTLN 2AP1A 5C15A 4O5FA 3CCJN 4K42A 1OVYA 2E88A 3KWGA 5AQSA 4EHUA 4BRHA 3TTFA 3LDNA 1K8KB 3ULEB 1NGBA 1KAXA 4MLHA 5JVGL 2P9SB 2HBMA 3E9PA 4H0XB 4NB4A 1Q18A 5BPMA 3L4QA 1U2VB 2D4WA 4JK8A 2P9KB 4GNIA 2E1YA 2QWPA 1MWKA 3D2FB 1X3MA 5AQVA 3UB5A 1RGIA 2ZGYA 5BRHA 3IMXA 3OW2M 3QB0A 3L0QA 4I6MA 4PKHA 2VCPA 3GE1A 4JHDB 4DCHA 2Q0UA 3A0IX 3O08A 2CGKA 3ID6A 4PHTX 5GAHP 1VQPN 3PLAA 3O4WA 3IFRA 3UKUA 1YVNA 3O5BA 3ZETB 5KPRA 5LJWA 3VETA 5BPNA 1JCEA 4B1WB 2YHWA 3GDQA 1YJ9N 1MA9B 4FVUA 4KH6A 2UYTA 3BUZB 4OPHA 3ZETA 5BR9A 4NO7A 3D2EB 3TPQA 4YOVA 3DXMB 5AQHA 2FSNA 3HRGA 4M63C 5C2FA 2V51B 3R3LA 3WEEB 2FXUA 3O9SA 1YJWN 3LDQA 3O80A 1TUUA 3WQUA 4PKIA 5C2DA 3CCUN 3VGLA 5EX5A 5CE3A 2ZJQL 3I33A 3TTDA 4WQ5A 1Q7YO 3CPEA 1MDUB 4FWPA 4IJNA 4IOXA 3G71N 5M1NA 3CC7N 4ISEA 1U6ZA 3R6MA 4H5VA 4RWTA 3GG4A 1J6ZA 5LJVA 5EOYA 1ATRA 4BVOA 2P9PB 2E2PA 4BRKA 3VGKA 3W3DA 4MO5A 4IDHA 5M1FA 2QEXN 2GWJA 4CZFA 2GWKA 5LY3A 4WFNL 1YF5L 4M7XA 2I7PA 1DT9A 2FLOA 1HLUA 2W41A 4H5NA 4IZ9A 3HOTA 2V52B 3CERA 2CGJA 2NRRA 1QHAA 1K8AO 3CD6N 4O8KA 2CH5A 3VEWA 5KPZA 1EO1A 1GLDG 4PKGA 3FZLA 4CBXA 5JVHL 1D4XA 3D2FA 1BU6O 4FWQA 4EFHA 1QVGM 1QVFM 3GL1A 3U8XA 3AARA 4JD2B 4CZIA 5DM6L 3K9JA 2E2OA 3H3OB 4B1ZA 3CJ7A 4NLCA 4BQZA 1YHQN 3MN5A 2ZJPL 5AQRA 3EZWA 2VYPA 4QS7A 3G25A 2NRZA 2P9IA 3QMLA 5M1KA 4H5RA 3SAFA 2Q36A 3EKSA 4GV6A 2A42A 4FPBA 2GTDA 2Q0RA 2YJEA 1HX1A 3A5NC 5C0YA 3CMAN 1HKCA 2YJFA 3VEYA 4MDAA 3TU5A 4IO9L 4OPAA 1Q86O 2GEMA 1X3NA 2ASOA 3DWLA 3HZ6A 3WEEA 4C1NK 3FE1A 2WUSA 1KAZA 4BRLA 4FWNA 4JEPA 4YOWA 2V7ZA 4GV9A 3BF3A 5CHIA 1Q82O 3MK6A 3LDLA 3OHRA 1R59O 3ZX2A 5HL7L 5FPNA 4QS9A 3MX2A 3NVMA 4CI6A 1VQLN 5EXWA 2JWLA 3T69A 3U4LA 4CD1A 1VQKN 3CCLN 2GUPA 5TKWA 5FPEA 2PFUA 3FLCO 2QWRA 4QS8A 1XC3A 4BREA 3MDQA 3CCVN 4BR9A 2NRWA 3P4IA 4CD3A 2ITMA 4E1JA 3E9OA 2HBJA 2NZTA 3ENHA 4ILGB 4WQ4C 3VEOA 1SS6A 1VQ4N 4AM6A 3ID8A 1BG3A 4JD2A 3VEXA 5FPDA 1NMDA 3R9PA 3A5MC 2NRTA 3CC4N 5GAEP 5HOOA 1S22A 4XH4A 3RVCA 1NJIO 2VGNA 5AZJB 2WFBA 4BROA 2P9IB 4B1XB 3T7ZA 1VQ9N 3M6GA 2VGMA 3MCPA 3SJHA 4YDUA 5DM7L 3CJCA 3B8AX 3M5RA 2PBDA 2E8AA 3VF4A 1KAYA 3F2KA 4A2BA 5KQ8A 3WT0A 2P9UA 4H0VB 5BRDA 1KC8O 3K9KA 4NLBA 5ADXA 1GLJO 3ZX0A 5AZJA 4BC3A 1C0FA 1QZ6A 1VAZA 4H5WA 3KVGA 2HMPA 3CHWA 4Y0WA 4U7BA 5KQDA 1V4SA 1G99A 2HBLA 3QDKA 2DPNA 3ZEUB 1NLVA 5AQXA 2W40A 4MDBA 3C0BA 3QBWA 4RCHA 1VQON 4BGBA 1GLCG 3D7EO 2FF6A 4IEEA 4JK7A 5GIPA 3WUHA 2Q97A 4BRCA 5FPMA 1WOQA 2P9KA 5AQZA 3AY9A 4U67L 2A3ZA 3LM2A 1Z05A 3HTVA 3IDHA 5GIOA 1V4TA 4FWKA 2ASMA 1RDWX 4JK9A 3SAGA 3SK3A 2ASPA 1ESVA 3MN6A 4FOIA 3SMSA 1QQMA 3DXKA 3VF6A 4JKGB 2WBNA 3AGKA 3OA9A 1NGJA 1O13A 2NRVA 4BR0A 1S72N 3C6HA 3O8MA 4WFAL 3EE8A 2F7TA 3Q7CA 1NBWA 2FSKA 2QA4N 1DKGD 3KK7A 2P9PA 3DAWA 2OANA 4AM7A 4BG9A 3CCSN 1BOTO 3FR0A 4IXCA 4BY9C 3UKRA 2HOEA 3O9TA 3RSEA 3DJCA 4CBUA 1QQNA 3MN7A 3Q7BA 4CZHA 4XH5A 4GVEA 1KXPA 4YOXA 2YHXA 3FZMA 5AQWA 1K9MO 2CH6A 1OKJA 1VQ7N 3H46O 3G4SN 2Q2RA 4JN4A 1BA1A 4H0TB 4K43A 3FZKA 2QXLA 5AQLA 2ZJRL 4YOUA 1KQSM 4WQ5C 2KHOA 5JLFA 3RSEB 1SAZA 1JCFA 2A41A 3O1BA 4B9QA 2NRHA 4L3QA 3BF1A 4Z94A 4O8UA 4A57A 4AF1A 2ZGZA 4JKFA 4CJ7A 4KBOA 5AFUA 4BG8A 2GELA 5CR4A 4IO8A 3I55N 4EIAA 2ZF5O 2Q31A 5M1OA 4BRFA 2IVNA 4A61A 3A5LC 1K73O 2YHYA 3D6RA 3TTCA 2QWQA 4CZGA 1GLAG 4ILHA 3WXLA 4FWLA 1YUWA 2P9SA 3O1WA 4BRMA 1BWFO 4UY8O 5BRFA 4R79A 3H45C 4JKCA 4HWIA 1W97L 1T3VA 5F1XA 5JICA 3N4PA 4G9ZA 2IVOA 4CZJA 2IVPA 2AA4A 2BUPA 1NWKA 1ZC6A 3VTHA 4A5AA 2RHKA 1YXQA 3MWPA 3VESA 1VQ8N 1S3XA 5AQFA 3H6EA 3CQYA 2D0OA 3L6QA 2H3GX 3ENBA 2RE2A 3WXJA 4FO0A 3SBGA 5TKYA 2HF3A 5AQUA 4MLEA 4BRNA 3O9QA 5JMVA 3PIPL 3BP8A 1NGGA 3J7ZO 2E20A 1BDGA 3GOIA 2QI2A 3U9ZA 3R1XA 2NNWA 3ZYYX 4CZKA 3MWTA 1NGFA 4BR4A 4A5BA 4FPAA 3HOSA 3N4QA 2JWKA 3VEZA 3ZX3A 4H5TA 1ZBSA 3FZFA 2Q1NA 3CQXA 4FOEA 2QM1A 1YI2N 4PL7A 2ZWHA 4A62A 1JCGA 3CPWM 4F9OA 1TYQB 4LC9B 1QZ5A 3H1VX 2QWOA 2F9WA 4C23A 2NLXA 3EE9A 1IJJA 3QFUA 4H03B 5MLCQ 2QWMA 4DB3A 5ADXH 1WUAA 2E2QA 5GINA 5AQNA 1EQYA 4M7YA 1BO5O 3SLCA 3TSPA 2QWNA 1LCUA 4I6MB 4BR5A 2CGLA 1W2BM 5C10A 3J8AA 4FWSA 1VQ5N 3JXUA 3CCQN 5I9EB 1X9JA 4WQ4A 3H1QA 4DKWA 1YAGA 3SAHA 4JHDA 1M90O 1HJOA 3NMUA 3UKRB 3AGRA 3O6WA 3F9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MWM A;  3WQT A;  1E4G T;  4BRP A;  2PAV A;  5EVZ A;  3BEX A;  5AZI A;  4B1Y B;  2FF3 B;  4BQL A;  1NGH A;  1C0G A;  3HM8 A;  1QQO A;  3L4I A;  4H0Y B;  3QFP A;  5BN8 A;  3H3N O;  3AAQ A;  4BR2 A;  1ATN A;  3A8Y A;  3GBT A;  1HUX A;  1T6C A;  4BC4 A;  1T44 A;  4BRQ A;  1NGA A;  1K8K A;  3MMV A;  4RTF D;  4CZM A;  5BRE A;  4CZL A;  3UE5 A;  3VF2 A;  1XQS C;  1RFQ A;  5AQK A;  4FWM A;  4DQ8 A;  3LDO A;  3CIP A;  4BRG A;  4BGA A;  5BN9 A;  4BC5 A;  4DHY A;  4EHT A;  1HPM A;  3M1F A;  5F2R A;  3FFK B;  4FSV A;  3VGM A;  4B1V A;  5B8H A;  1NGC A;  3S41 A;  1IG8 A;  3VOV A;  4FL9 A;  4BRA A;  4ISF A;  4FWR A;  5AQJ A;  2VWB A;  3ENO A;  1SQK A;  3MN9 A;  3VER A;  2IIR A;  4J8F A;  2FSJ A;  3C7N A;  1BA0 A;  3VEN A;  3CJ1 A;  1TUY A;  5AQT A;  2P9L A;  2QWL A;  2D1K A;  5AQG A;  3D2E A;  3A5O C;  5BPL A;  4FWO A;  3VPZ A;  3CJ9 A;  2HF4 A;  3VEV A;  4EAH D;  3HI0 A;  1SZ2 A;  4BR7 A;  4CZE A;  3EKU A;  5AR0 A;  3QIC A;  5AQY A;  5E84 A;  2EWS A;  4HTL A;  3ATU A;  4WYB A;  3LDP A;  4PL8 A;  4H0O A;  3HSC A;  4BC2 A;  1NGD A;  2P9N B;  2YCH A;  2E2N A;  2E1Z A;  4CBW A;  5EY4 A;  2P9U B;  3KZB A;  4BVP A;  1H1V A;  3W0L A;  3DXM A;  5AFU H;  3WXK A;  3CI5 A;  1ZXO A;  4GY2 B;  1ATS A;  3FGU A;  1HKB A;  2QW9 A;  3IUC A;  5AZI B;  3EN9 A;  3CJB A;  2A6A A;  3KHY A;  5AQI A;  4JAX A;  3LM9 A;  3SMP A;  2A40 A;  4A2A A;  1Z6R A;  4IJA A;  2BTF A;  4H0P A;  5KPT A;  5JLH A;  2V7Y A;  4BRI A;  2D0P A;  4B1U B;  3JS6 A;  3EO3 A;  1NGE A;  1T6D A;  1E4F T;  1TYQ A;  5ELZ A;  1GLE G;  2P9N A;  4XEI A;  4IWV A;  2I7N A;  3HBT A;  3AAP A;  3ATV A;  5E26 A;  5AQM A;  1GLB G;  5F0X A;  1HKG A;  3UKU B;  2F9T A;  3LL3 A;  1BUP A;  2A5X A;  5AQQ A;  4JNE A;  2P9L B;  3DXK B;  1DGK N;  3M3Z A;  3EL2 A;  1GLF O;  2J4R A;  1CZA N;  1Y64 A;  5AQP A;  1P8Z A;  3CJA A;  4MO4 A;  4K25 A;  4YDU C;  4XH1 A;  5AQO A;  3CET A;  4K41 A;  3FZH A;  2YI1 A;  1U2V A;  1DEJ A;  1NGI A;  3QBX A;  3R8E A;  1LOT B;  3C7N B;  1NM1 A;  3U9D A;  1GLL O;  3ULE A;  3I8B A;  1XUP O;  3ZEU A;  4BRD A;  4ISG A;  3WXI A;  2AP1 A;  4O5F A;  4K42 A;  2E88 A;  4EHU A;  5AQS A;  4BRH A;  3LDN A;  1K8K B;  3ULE B;  1NGB A;  1KAX A;  4MLH A;  2P9S B;  4H0X B;  4NB4 A;  1Q18 A;  5BPM A;  1U2V B;  2D4W A;  2P9K B;  4GNI A;  2E1Y A;  2QWP A;  1MWK A;  3D2F B;  1X3M A;  5AQV A;  3UB5 A;  1RGI A;  2ZGY A;  5BRH A;  3IMX A;  3QB0 A;  3L0Q A;  4I6M A;  4PKH A;  2VCP A;  3GE1 A;  4JHD B;  4DCH A;  2Q0U A;  3A0I X;  3O08 A;  2CGK A;  3O4W A;  3IFR A;  3UKU A;  1YVN A;  3O5B A;  3ZET B;  5KPR A;  5LJW A;  3VET A;  5BPN A;  1JCE A;  4B1W B;  2YHW A;  3GDQ A;  1MA9 B;  2UYT A;  3BUZ B;  3ZET A;  5BR9 A;  4NO7 A;  3D2E B;  3TPQ A;  3DXM B;  5AQH A;  2FSN A;  4M63 C;  2V51 B;  3WEE B;  2FXU A;  3LDQ A;  3O80 A;  1TUU A;  3WQU A;  4PKI A;  3VGL A;  5EX5 A;  5CE3 A;  3I33 A;  4WQ5 A;  1MDU B;  4FWP A;  4IJN A;  4ISE A;  1U6Z A;  3R6M A;  4H5V A;  4RWT A;  3GG4 A;  1J6Z A;  5LJV A;  5EOY A;  1ATR A;  4BVO A;  2P9P B;  2E2P A;  4BRK A;  3VGK A;  3W3D A;  4MO5 A;  2GWJ A;  4CZF A;  2GWK A;  5LY3 A;  4M7X A;  2I7P A;  2FLO A;  1HLU A;  2W41 A;  4H5N A;  4IZ9 A;  2V52 B;  3CER A;  2CGJ A;  1QHA A;  4O8K A;  2CH5 A;  3VEW A;  5KPZ A;  1GLD G;  4PKG A;  3FZL A;  4CBX A;  1D4X A;  3D2F A;  1BU6 O;  4FWQ A;  4EFH A;  3GL1 A;  3U8X A;  3AAR A;  4JD2 B;  4CZI A;  4B1Z A;  2E2O A;  3H3O B;  3CJ7 A;  4BQZ A;  3MN5 A;  5AQR A;  3EZW A;  2VYP A;  4QS7 A;  3G25 A;  2P9I A;  3QML A;  4H5R A;  2Q36 A;  3EKS A;  2A42 A;  4FPB A;  2GTD A;  2Q0R A;  2YJE A;  1HX1 A;  3A5N C;  1HKC A;  2YJF A;  3VEY A;  3TU5 A;  2GEM A;  1X3N A;  2ASO A;  3DWL A;  3HZ6 A;  3WEE A;  3FE1 A;  2WUS A;  1KAZ A;  4BRL A;  4FWN A;  2V7Z A;  3BF3 A;  3MK6 A;  3LDL A;  3OHR A;  1R59 O;  3ZX2 A;  5FPN A;  4QS9 A;  4CI6 A;  5EXW A;  3U4L A;  4CD1 A;  2GUP A;  5FPE A;  3FLC O;  2QWR A;  4QS8 A;  1XC3 A;  4BRE A;  3MDQ A;  4BR9 A;  3P4I A;  4CD3 A;  2ITM A;  4E1J A;  2NZT A;  3ENH A;  4WQ4 C;  3VEO A;  4AM6 A;  3ID8 A;  1BG3 A;  4JD2 A;  3VEX A;  5FPD A;  1NMD A;  3R9P A;  3A5M C;  1S22 A;  4XH4 A;  5AZJ B;  4BRO A;  2P9I B;  4B1X B;  3M6G A;  3MCP A;  3SJH A;  4YDU A;  3CJC A;  3B8A X;  2PBD A;  2E8A A;  3VF4 A;  1KAY A;  4A2B A;  5KQ8 A;  3WT0 A;  2P9U A;  4H0V B;  5BRD A;  5ADX A;  1GLJ O;  3ZX0 A;  5AZJ A;  4BC3 A;  1C0F A;  1QZ6 A;  4H5W A;  3KVG A;  2HMP A;  3CHW A;  4Y0W A;  5KQD A;  1V4S A;  1G99 A;  3QDK A;  2DPN A;  3ZEU B;  1NLV A;  5AQX A;  2W40 A;  3C0B A;  3QBW A;  4RCH A;  4BGB A;  1GLC G;  3D7E O;  2FF6 A;  3WUH A;  2Q97 A;  4BRC A;  5FPM A;  1WOQ A;  2P9K A;  5AQZ A;  3AY9 A;  2A3Z A;  3LM2 A;  3HTV A;  1Z05 A;  3IDH A;  1V4T A;  4FWK A;  2ASM A;  1RDW X;  3SK3 A;  2ASP A;  1ESV A;  3MN6 A;  4FOI A;  3SMS A;  1QQM A;  3DXK A;  3VF6 A;  1NGJ A;  4BR0 A;  3O8M A;  1NBW A;  2FSK A;  1DKG D;  2P9P A;  3DAW A;  2OAN A;  4AM7 A;  4BG9 A;  1BOT O;  3FR0 A;  4IXC A;  3UKR A;  2HOE A;  3RSE A;  3DJC A;  4CBU A;  1QQN A;  3MN7 A;  4CZH A;  4XH5 A;  1KXP A;  2YHX A;  3FZM A;  5AQW A;  2CH6 A;  1OKJ A;  3H46 O;  2Q2R A;  4JN4 A;  1BA1 A;  4H0T B;  4K43 A;  3FZK A;  2QXL A;  5AQL A;  4WQ5 C;  2KHO A;  5JLF A;  3RSE B;  1SAZ A;  1JCF A;  2A41 A;  3O1B A;  4B9Q A;  2NRH A;  4L3Q A;  3BF1 A;  4Z94 A;  2ZGZ A;  4CJ7 A;  4KBO A;  5AFU A;  4BG8 A;  2GEL A;  4IO8 A;  4EIA A;  2ZF5 O;  2Q31 A;  4BRF A;  2IVN A;  4A61 A;  3A5L C;  2YHY A;  2QWQ A;  4CZG A;  1GLA G;  3WXL A;  4FWL A;  1YUW A;  2P9S A;  3O1W A;  4BRM A;  1BWF O;  5BRF A;  3H45 C;  4HWI A;  5F1X A;  5JIC A;  2IVO A;  4CZJ A;  2IVP A;  2AA4 A;  2BUP A;  1NWK A;  1ZC6 A;  1YXQ A;  3VES A;  1S3X A;  5AQF A;  3H6E A;  3CQY A;  2D0O A;  3L6Q A;  2H3G X;  3WXJ A;  4FO0 A;  5TKY A;  2HF3 A;  5AQU A;  4MLE A;  4BRN A;  5JMV A;  3BP8 A;  1NGG A;  2E20 A;  1BDG A;  3GOI A;  3U9Z A;  4CZK A;  1NGF A;  4BR4 A;  4FPA A;  3VEZ A;  3ZX3 A;  4H5T A;  1ZBS A;  3FZF A;  2Q1N A;  3CQX A;  4FOE A;  2QM1 A;  4PL7 A;  2ZWH A;  4A62 A;  1JCG A;  4F9O A;  1TYQ B;  4LC9 B;  1QZ5 A;  3H1V X;  2QWO A;  2F9W A;  4C23 A;  2NLX A;  1IJJ A;  3QFU A;  4H03 B;  2QWM A;  4DB3 A;  5ADX H;  1WUA A;  2E2Q A;  5AQN A;  1EQY A;  4M7Y A;  1BO5 O;  3SLC A;  2QWN A;  1LCU A;  4I6M B;  4BR5 A;  2CGL A;  3J8A A;  4FWS A;  3JXU A;  5I9E B;  1X9J A;  4WQ4 A;  3H1Q A;  1YAG A;  4JHD A;  1HJO A;  3UKR B;  3O6W A;  3F9M A; 
#chains in the Genus database with same CATH topology
 1MWM A;  3AA4 A;  1S1T A;  4AHV A;  3BEX A;  3F9K A;  2FF3 B;  2HST A;  4K8Z A;  3HL8 A;  4E3S A;  4JI5 K;  4H0Y B;  5BN8 A;  4FZY A;  1ATN A;  1WBD A;  3GBT A;  2IDO A;  1HUX A;  3OBY A;  1B92 A;  1K8K A;  3MMV A;  3O9U A;  4DUY K;  5BRE A;  2HMI A;  3VF2 A;  4F2S A;  4IFE A;  1OH6 A;  4OKJ A;  3TAR A;  1O1W A;  4DHY A;  3K0S A;  4DSF A;  1IV0 A;  3TSQ A;  2ITG A;  4FSV A;  3VGM A;  3OYM A;  1IG8 A;  3VOV A;  5C12 A;  1N8R O;  4F3T A;  1B9D A;  4FJG A;  2ZD1 A;  1FW6 A;  4ILJ A;  3C7N A;  3VEN A;  4IOC L;  1OH5 A;  5AQT A;  2P9L A;  2D1K A;  1KLM A;  1XHZ A;  3D2E A;  3A5O C;  2HF4 A;  5FRO A;  4EAH D;  3OYL A;  4DTR A;  1SZ2 A;  1RT3 A;  4DV2 K;  2KQ2 A;  4CHZ A;  3AVM A;  2X74 A;  3QIC A;  1Q9Y A;  5AQY A;  2E4L A;  2EWS A;  4WYB A;  4KH5 A;  3P31 A;  2XO7 A;  4PL8 A;  3THW A;  4H0O A;  1JLC A;  4CE9 A;  2G8I A;  4CJW A;  3AVG A;  3KZB A;  4BVP A;  4CF1 A;  1MU2 A;  3CI5 A;  4FK2 A;  4OX9 K;  2NUB A;  2QTD A;  3OYE A;  5HRS A;  2Z1J A;  3CJB A;  4DQP A;  4B3O A;  3MX5 A;  1IO2 A;  4A2A A;  3IKM A;  4IJA A;  1VSE A;  1WLJ A;  4JKE A;  3OYK A;  2BTF A;  1HMV A;  4AHS A;  4B1U B;  1T6D A;  1NGE A;  1E4F T;  4DR4 K;  1WSE A;  3ZSX A;  1HNW K;  1JLF A;  4CJV A;  5E26 A;  4CFC A;  4CFD A;  1HKG A;  3LL3 A;  2A5X A;  3OYA A;  1TGO A;  5AQP A;  4W5Q A;  3F5T A;  4YOT A;  1U47 A;  1TKD A;  1P90 A;  4C8K A;  4XH1 A;  3THW B;  3CET A;  3C65 A;  4K41 A;  1QSY A;  3QO9 A;  3QBX A;  3AVA A;  2O8F A;  3K59 A;  3LP1 A;  1QTM A;  1NM1 A;  1SKR A;  3U9D A;  1GLL O;  4RW6 A;  2WC9 A;  3I8B A;  3K5O A;  3K5L A;  3VQC A;  4JLH A;  2OTL N;  3PY8 A;  1QHT A;  4DWI A;  2E88 A;  3KWG A;  1EWQ A;  4BRH A;  4C8M A;  1NGB A;  1HYS A;  1KAX A;  2W6K A;  2P9S B;  4B8C A;  4OLB A;  5BPM A;  4GNI A;  3AO3 A;  4KHN A;  1OVQ A;  3S3O A;  4ELU A;  2D0A A;  1LW2 A;  2VCP A;  3A0I X;  2CGK A;  1RTH A;  3O4W A;  3IFR A;  1LV5 A;  3M8R A;  1JCE A;  1U48 A;  1FJG K;  3D45 A;  2HVH A;  1MA9 B;  2VG5 A;  4BAC A;  3ZET A;  3SV4 A;  4NO7 A;  3D2E B;  3AO2 A;  3DXM B;  4CJR A;  2FSN A;  3HPH A;  4NYF A;  4E0D A;  1BCM A;  3QEP A;  2B6A A;  4TSX A;  2V51 B;  2FC0 A;  1D8Y A;  2YKM A;  3P5J A;  3TR8 A;  1OH7 A;  1Q7Y O;  1LWE A;  4DV1 K;  3CPE A;  4FWP A;  4IJN A;  3CC7 N;  5M1N A;  2Z1H A;  5HRR A;  4JI4 K;  1U6Z A;  3R6M A;  4IFV A;  4CK1 A;  1ATR A;  4FM2 A;  3OYD A;  2P9P B;  3W3D A;  3DM2 A;  2GWJ A;  4PY5 A;  2GWK A;  4WFN L;  4AHR A;  5LL6 Z;  3VQ7 A;  3VQP A;  4DR3 K;  3ZT3 A;  1BIS A;  3HOT A;  3EY1 A;  4KHS A;  2CGJ A;  2CH5 A;  3VEW A;  4CJT A;  1C1C A;  1GLD G;  1CXQ A;  3CM6 A;  3NH1 A;  5JVH L;  4FM1 A;  1FKP A;  4DV5 K;  4EFH A;  3KKR A;  3MEG A;  1QVG M;  1QVF M;  2XY8 A;  3U8X A;  4CZI A;  2E2O A;  3H3O B;  1L3U A;  4BQZ A;  1YHQ N;  4CF2 A;  2VYP A;  3G25 A;  2P9I A;  3QML A;  1RIL A;  4N41 A;  1EP4 A;  2A42 A;  2YJE A;  5C0Y A;  1UA1 A;  2P51 A;  4DF4 A;  1Q86 O;  2GEM A;  4X64 K;  3KIO A;  4ZTF A;  2ASO A;  3T19 A;  4QCL A;  3WEE A;  4C1N K;  2WUS A;  3ZSR A;  4HTU A;  4J2B A;  4BRL A;  4DR1 K;  4GV9 A;  3OVN A;  1HQU A;  4K0K K;  3ZX2 A;  5HL7 L;  3U3Y A;  1D9D A;  1VQL N;  4CI6 A;  3T69 A;  3CCL N;  2GUP A;  3KK3 A;  3TWH A;  4DR2 K;  2QXF A;  3FLC O;  4QS8 A;  1NK8 A;  4BRE A;  3P4I A;  2O8E B;  2A1R A;  4CEE A;  3LP2 A;  3ENH A;  2IS3 A;  1HRH A;  3VEX A;  4KO0 A;  2NRT A;  4BDZ A;  3CC4 N;  5HOO A;  1S22 A;  4XH4 A;  3RVC A;  1NJI O;  4FLZ A;  3T7Z A;  1ASW A;  2E8A A;  2PBD A;  3TI0 A;  5KQ8 A;  3WT0 A;  1KVC A;  4OGE A;  4KTW A;  1GLJ O;  1D9F A;  3P1G A;  4E1N A;  1VAZ A;  3CHW A;  4Y0W A;  3V9W A;  1C1B A;  4E1M A;  2HBL A;  3QDK A;  2OPQ A;  3ZEU B;  3QER A;  3IS9 A;  4M3Z A;  3V9S A;  5J2M A;  2DY4 A;  1UAX A;  2Q97 A;  3P83 D;  4R5P A;  1WOQ A;  3QEW A;  5AQZ A;  4CGJ A;  5GIO A;  1V4T A;  2HHU A;  1HQE A;  1WB9 A;  1QQM A;  3TAQ A;  3AGK A;  3OA9 A;  2B4J A;  4DTS A;  4LF5 K;  1XNQ K;  1O13 A;  2NRV A;  3C6H A;  3HO1 A;  3EE8 A;  1FKO A;  2F7T A;  3AVN A;  3OYJ A;  3HK2 A;  3HPO A;  3KK7 A;  3DAW A;  3RSE A;  2PYJ A;  4N56 A;  4O0I A;  1KXP A;  3FZM A;  4ID1 A;  1K9M O;  4DSL A;  1XI1 A;  4J2E A;  1TL1 A;  1Z26 A;  4H0T B;  3FZK A;  2ZJR L;  4KRF A;  4YOU A;  5KI6 A;  2KTQ A;  1JCF A;  2RF2 A;  3O1B A;  4B9Q A;  4KRE A;  4CFB A;  5DK5 A;  5CY4 A;  1HNX K;  5AFU A;  2GEL A;  4NXN K;  5FRN A;  3I55 N;  1HR0 K;  1VSK A;  4HUG A;  2IVN A;  4FJM A;  3TTC A;  1GLA G;  4M42 A;  1BWF O;  3DLR A;  3H45 C;  2UUA K;  4KB0 A;  2DFE A;  2IVO A;  4BWJ A;  1NWK A;  3VTH A;  1YXQ A;  4FJJ A;  2D0O A;  4HCB A;  4CJ4 A;  1RTJ A;  1NJW A;  4FO0 A;  1IKW A;  2HF3 A;  3TAG A;  4BRN A;  1X9S A;  3B6O A;  1KFD A;  3VEZ A;  2Q1N A;  2Z1G A;  3CPW M;  4JYA K;  1TYQ B;  4ZHR A;  3OYN A;  5JS2 A;  2NLX A;  3QIP A;  4DR7 K;  5MLC Q;  1GOC A;  5ADX H;  5GIN A;  2E2Q A;  3QEV A;  4O4G A;  4X62 K;  1BO5 O;  2RN2 A;  3SLC A;  2QWN A;  2D0B A;  4GMJ B;  1W2B M;  3J8A A;  3JXU A;  4N47 A;  1L3V A;  1NKB A;  1NK7 A;  3VN5 A;  3H1Q A;  3VQD A;  3THY B;  3ZLJ A;  3NF8 A;  3SAH A;  3ZT0 A;  3LPU A;  3RMD A;  3WNE A;  4BRP A;  2PAV A;  1S1W A;  5EVZ A;  3VA0 A;  2HBK A;  5SZT A;  4XIU A;  3IG1 A;  1NK0 A;  3L2R A;  2IGI A;  3ASM A;  1QQO A;  4ELT A;  1VQM N;  3AAQ A;  3A8Y A;  1M1K O;  1T6C A;  4BC4 A;  4BRQ A;  1XMO K;  4RTF D;  3NF7 A;  4CZL A;  4DTJ A;  2HVI A;  5M1P A;  4DQ8 A;  4M3U A;  3LDO A;  1WNS A;  5I42 A;  1U4B A;  4BRG A;  2YX6 A;  5BN9 A;  5K14 A;  4BC5 A;  1KSP A;  3TSU A;  2DTU A;  5B8H A;  4GKJ K;  4FWR A;  5AQJ A;  2D0C A;  1SQK A;  3VER A;  3HM9 A;  4J8F A;  4CJQ A;  1N34 K;  3THX A;  4J2A A;  3PIO L;  1TUY A;  3PX6 A;  3I0S A;  2QWL A;  4DV0 K;  4Q0B A;  5AQG A;  3EZ5 A;  4AQY K;  4WE1 A;  2KKZ A;  4FWO A;  1X1P A;  1JLE A;  4YOR A;  3OYI A;  3QET A;  3EEQ A;  4KTZ A;  4DU1 A;  4JV5 K;  4KHU A;  3CXC M;  1ILY A;  1VSL A;  1CZB A;  2IAJ A;  4C8O A;  4Q5V A;  3LDP A;  1KVA A;  1U04 A;  2HHW A;  2NRX A;  4CJU A;  4IOA L;  3KWI A;  3CME N;  3NFA A;  2RPI A;  4DTO A;  1BI4 B;  2YCH A;  4CBW A;  1H1V A;  3W0L A;  3DXM A;  3WXK A;  4JI6 K;  4AHU A;  5SWM A;  2UU9 K;  3SUQ A;  3NVK A;  2HW3 A;  3O9R A;  1KD1 O;  4GY2 B;  1HKB A;  5AJ3 K;  2WOM A;  3IUC A;  1SKS A;  5AZI B;  3VQQ A;  3QEX A;  3OYH A;  4JI1 K;  4M3T A;  3L3V A;  1Z6R A;  1ZBH A;  4H0P A;  5KPT A;  4OKE A;  5JLH A;  4W5T A;  3JS6 A;  1TYQ A;  1GLE G;  2I7N A;  3HBT A;  3AAP A;  1GLB G;  2AJQ A;  2KZZ A;  1DGK N;  3LP3 A;  2QKK A;  1GOB A;  1VQN N;  4KH4 A;  3ZT2 A;  1YTU A;  4YDU C;  2KLA A;  3VQ4 A;  1DEJ A;  1NGI A;  1S5J A;  3QEI A;  3T1Y K;  4B9L A;  1UA0 A;  1HPZ A;  4YFU A;  1VQ6 N;  3ULE A;  2O8B A;  4FYD A;  1BHL A;  1LWF A;  4CK3 A;  3HP6 A;  1OVY A;  1S6Q A;  4EHU A;  1J53 A;  2UXB K;  1SL0 A;  1N5Y A;  3T1A A;  4B9N A;  4MLH A;  4H0X B;  3ZSQ A;  1Q18 A;  4JK8 A;  1IBM K;  4DF8 A;  1X3M A;  3AO1 A;  3UB5 A;  2ZGY A;  3LAM A;  3OW2 M;  3L0Q A;  2PY5 A;  4I6M A;  4PKH A;  3NCI A;  4JHD B;  2O4G A;  3O08 A;  3C6U A;  3ID6 A;  5J2P A;  5KPR A;  4FZZ A;  4CK2 A;  2O8E A;  5BPN A;  3AVI A;  4B1W B;  3GDQ A;  2UYT A;  2G8W A;  4YOV A;  3K2P A;  1T8E A;  5AQH A;  3HRG A;  4M63 C;  4CF0 A;  4IG3 A;  5C2F A;  3LAK A;  3WEE B;  3WQU A;  4CCH A;  2VG7 A;  4KB1 A;  3CCU N;  5C2D A;  3VGL A;  3I33 A;  3QES A;  3DLK A;  4IOX A;  3G71 N;  4JI7 K;  4ISE A;  4RWT A;  4BVO A;  3V9Z A;  2E2P A;  3SQ0 A;  4FM0 A;  4MO5 A;  2QEX N;  3AVC A;  1YF5 L;  1TL3 A;  4KHY A;  4CHN A;  1G15 A;  3PSI A;  4M7X A;  2I7P A;  2FLO A;  3OS2 A;  1HLU A;  2W41 A;  1NU0 A;  4H5N A;  3TAE A;  3PX0 A;  2E5L K;  2V52 B;  3CER A;  1K8A O;  1RBS A;  3CD6 N;  4DU3 A;  1EO1 A;  2GUI A;  4CBX A;  4CF9 A;  1D4X A;  4B9M A;  4B3R K;  4DU4 A;  4CEA A;  4IG0 A;  3AAR A;  3SPY A;  4DTM A;  1LWC A;  4PQU A;  3EZW A;  3DI6 A;  3NH0 A;  1FK9 A;  5M1K A;  4ZTJ A;  2Q36 A;  1ASV A;  3CMA N;  1HKC A;  2YJF A;  4MDA A;  4DS5 A;  4OPA A;  2GV9 A;  4KPY A;  4DSK A;  3HZ6 A;  3CFR A;  1RBU A;  3FE1 A;  1KAZ A;  3V81 A;  1RT7 A;  2V7Z A;  3BF3 A;  5CHI A;  3NHG A;  3MK6 A;  3OHR A;  4EZ6 A;  5FPN A;  5BR8 K;  3NVM A;  3S3M A;  5EXW A;  2FBT A;  4CD1 A;  3O3G A;  4KFB A;  3FFI A;  5EU7 A;  1BQN A;  3CM5 A;  1J9A A;  1U49 A;  4CD3 A;  2ITM A;  3E9O A;  2PZS A;  2HBJ A;  2NZT A;  4WQ4 C;  4IKF A;  4E7K A;  3K5N A;  1VQ4 N;  4AM6 A;  5J1E A;  1KFS A;  4JI3 K;  1BG3 A;  3DRS A;  1NMD A;  3A5M C;  3DMJ A;  5GAE P;  3G0Z A;  4DTN A;  3M8Q A;  5AZJ B;  4AHC A;  4B1X B;  1VQ9 N;  2BDP A;  3CJC A;  3VF4 A;  4E7I A;  3IRX A;  3K9K A;  4CEZ A;  3ULD A;  4CER A;  4BC3 A;  3CG7 A;  1QZ6 A;  2O8F B;  1QE1 A;  4U7B A;  5KQD A;  4O0J A;  3F73 A;  3RRH A;  5AQX A;  2W40 A;  4MDB A;  4G1Q A;  3TAM A;  2FF6 A;  3L2W A;  4IEE A;  3WUH A;  4BRC A;  5FPM A;  4B9T A;  2P9K A;  4N76 A;  3MAQ A;  1Z05 A;  3HTV A;  3KD5 E;  2HNZ A;  4M3W A;  3SAG A;  1ZBI A;  2ASP A;  1VRU A;  3DOL A;  2OPP A;  2WBN A;  4O44 A;  1NGJ A;  3O8M A;  3NE6 A;  1RCH A;  1DKG D;  3NBP A;  4BG9 A;  3FR0 A;  3QIN A;  4NCB A;  4BY9 C;  1J5E K;  4CBU A;  1QQN A;  2YV0 X;  3MN7 A;  4CIE A;  4CZH A;  4XH5 A;  1S1X A;  4GVE A;  3KJV A;  3KK2 A;  5AQW A;  1OKJ A;  4CJK A;  3H46 O;  3G4S N;  4FLT A;  3SV3 A;  5AQL A;  4DUZ K;  2OZM A;  4WQ5 C;  1A5X A;  1HNI A;  3HXM A;  5CZ2 A;  4JKF A;  4KBO A;  2X78 A;  3OJU A;  3NH2 A;  4M3Y A;  4IO8 A;  4EIA A;  2ZF5 O;  4KHW A;  1NOZ A;  4BWM A;  1ITG A;  2YHY A;  2QWQ A;  4CZG A;  4ILH A;  3WXL A;  3J80 O;  3CFP A;  5DMR A;  3O1W A;  1LW0 A;  3TAN A;  5BRF A;  2W6L A;  4N5S A;  5F1X A;  5JIC A;  3ZSY A;  4Z4I A;  2HHQ A;  4B9U A;  3RMC A;  2AA4 A;  2BUP A;  2OZS A;  4A5A A;  1XWL A;  3VES A;  4CIF A;  1JLA A;  1S3X A;  5AQF A;  2OYQ A;  3SZ2 A;  1Q8I A;  4FK4 A;  2RE2 A;  1LAV A;  3WXJ A;  3KLE A;  5TKY A;  1BL3 A;  4MLE A;  3AA5 X;  3O9Q A;  1NGG A;  3J7Z O;  2E20 A;  1BDG A;  2UXC K;  1NGF A;  4BR4 A;  1RDD A;  4FPA A;  3N4Q A;  1IH7 A;  1TK5 A;  1ZBS A;  2W42 A;  4DV3 K;  4FLV A;  2QM1 A;  3PV8 A;  1YTA A;  3H1V X;  2F9W A;  5HBM A;  2QWM A;  2XY7 A;  4JI8 K;  4FLW A;  4M7Y A;  4DR6 K;  1NK9 A;  3J7Y P;  2CGL A;  2G8V A;  5C10 A;  4CJL A;  4FWS A;  3HPG A;  1VSH A;  4B08 A;  3CCQ N;  4DQS A;  1X9J A;  2HND A;  4DKW A;  3KKS A;  2FBY A;  3UKR B;  3AGR A;  3THX B;  3KD1 E;  4AH9 A;  1E4G T;  3SCX A;  3ZT4 A;  1EET A;  5M1Q A;  5AZI A;  4B1Y B;  3D0P A;  4BQL A;  3S9H A;  4GV3 A;  4WF9 L;  1C0G A;  3L4I A;  3H3N O;  3JSM A;  1EKE A;  2ZE2 A;  1T44 A;  1RBV A;  1NGA A;  4CZM A;  1WSG A;  1TK8 A;  5GAG P;  1RFQ A;  4FWM A;  4IEI A;  4YHH K;  3CIP A;  1S9G A;  3V1Q A;  3BGR A;  3CCE N;  4EHT A;  4BE2 A;  2O8B B;  3CQ8 A;  2KZM A;  2WON A;  1QSS A;  1VSF A;  5F2R A;  5KTQ A;  1Q81 O;  3S41 A;  1RDA A;  4C1N I;  4FL9 A;  4BRA A;  1RNH A;  3JAM O;  5FRM A;  3WXM B;  2VWB A;  2IIR A;  3DLL L;  2PYL A;  2O8D A;  2XY6 A;  3AA2 A;  4GVM A;  1BGX T;  1BA0 A;  3ISN C;  3CJ1 A;  1WN7 A;  4CEB A;  2HHT A;  3SUN A;  5BPL A;  4FK0 A;  4WFB L;  4DTX A;  4CGD A;  3VEV A;  3HI0 A;  4JKD A;  4BR7 A;  4CZE A;  2YHB A;  4OO1 J;  4J2D A;  2FBV A;  4HTL A;  3CYM A;  3NF6 A;  4YNQ A;  3SI6 A;  2F4V K;  5J2N A;  3QLH A;  1NG9 A;  1UOC A;  2P9N B;  1TKT A;  2E2N A;  2E1Z A;  1S1V A;  4CGI A;  3CCM N;  5EY4 A;  1NJZ A;  2P9U B;  4CJE A;  1C6V A;  1A5W A;  5KGW A;  3AVB A;  4V19 S;  2QW9 A;  4FLY A;  3UIQ A;  4F4K A;  2UXD K;  3EN9 A;  4DQI A;  1B9F A;  4LH4 A;  2YKN A;  4OVL A;  1YJN N;  1VSI A;  5AQI A;  4FXD A;  3ZSV A;  3LM9 A;  2A40 A;  1L5U A;  5H1S Q;  3CC2 N;  2F96 A;  4OGC A;  1NKE A;  2D0P A;  3ZSZ A;  4A59 A;  3L8B A;  5ELZ A;  1C0T A;  4DSI A;  3QNN A;  4ELV A;  4OPK A;  1NMN A;  3P39 A;  2O8D B;  4E7H A;  2UUB K;  1D5A A;  1N36 K;  5AQM A;  3E9L A;  5F0X A;  2F9T A;  5AQQ A;  2HNY A;  1VQ7 N;  4JNE A;  3DXK B;  4JKA A;  3ALY A;  3I56 N;  4NYN A;  3EL2 A;  5KRS A;  1GLF O;  2J4R A;  3V4I A;  1P8Z A;  3CJA A;  4MO4 A;  4DTP A;  4K25 A;  4M45 A;  3KTQ A;  3LDS A;  3FZH A;  4JKB A;  1U2V A;  2D5R A;  3NGI A;  3V1R A;  1REV A;  2G8U A;  1J54 A;  1N32 K;  4ISG A;  1ASU A;  2YNG A;  3MXM A;  4CHY A;  2AP1 A;  4O5F A;  3CCJ N;  4LD0 A;  1TKX A;  4FW1 A;  3TTF A;  3LDN A;  4RW4 A;  3BY5 A;  3E9P A;  4NB4 A;  4YY3 K;  4KI6 A;  3L4Q A;  1U2V B;  2D4W A;  2P9K B;  2E1Y A;  2QWP A;  2P5O A;  5C24 A;  5AQV A;  4CHQ A;  1KRP A;  3QB0 A;  1QS4 A;  4BE0 A;  3RWU A;  3GE1 A;  2Q0U A;  4PHT X;  3SJJ A;  1CLQ A;  2OCE A;  1I39 A;  5LJW A;  3C95 A;  4MQ3 A;  1N6Q A;  4I2P A;  3KLF A;  4NXM K;  1YJ9 N;  5CZ1 A;  4FVU A;  2EHG A;  5BR9 A;  4H4M A;  3TPQ A;  1J5O A;  4FJH A;  2FXU A;  4RW9 A;  3O9S A;  1TAQ A;  1YJW N;  5EX5 A;  5CE3 A;  2ZJQ L;  3RR7 A;  3G10 A;  4O5B A;  3VQ6 A;  1JKH A;  4OPJ A;  4H5V A;  1J6Z A;  1FXX A;  5EOY A;  4DFM A;  4BRK A;  5M1F A;  4IDH A;  4FJX A;  5IT9 O;  1WSI A;  5LY3 A;  1XMQ K;  4LF7 K;  1GOA A;  5CYM A;  1WSH A;  2WTU A;  1QHA A;  2NRR A;  4I7F A;  3U6F A;  4O8K A;  2VQE K;  3FZL A;  1BU6 O;  4DMN A;  3GL1 A;  5DM6 L;  4JD2 B;  4Z4H A;  4B1Z A;  4I2Q A;  4NLC A;  3S3N A;  1XNR K;  1K6Y A;  3MN5 A;  2ZJP L;  4FJI A;  5AQR A;  4QS7 A;  1W7A A;  4CJP A;  2NRZ A;  1SKW A;  4B3S K;  4FLX A;  3OS0 A;  2YNI A;  3AVK A;  4GV6 A;  2GTD A;  1HX1 A;  3A5N C;  1ZYQ A;  3VEY A;  1XHX A;  1UWB A;  4IO9 L;  4JRP A;  4I9Q A;  4FJ7 A;  4DV6 K;  4B3M K;  3DWL A;  1W9H A;  4FZX C;  1IBL K;  1L3S A;  3DLG A;  4B9V A;  4FWN A;  4YOW A;  2OA8 A;  3M8S A;  3VQ9 A;  3KLH A;  3WNF A;  3AA3 A;  3OY9 A;  4HCC A;  1VHX A;  3RMA A;  1SV5 A;  1NK6 A;  2BAN A;  5FDL A;  2ATQ A;  5TKW A;  2PFU A;  3DLE A;  2QWR A;  1XC3 A;  3K5M A;  3THY A;  3PSF A;  5CYQ A;  4Z4E A;  3VEO A;  4EZ9 A;  4IDK A;  4JD2 A;  4CEQ A;  2YNH A;  2WFB A;  3TAP A;  3QNO A;  4BRO A;  3M6G A;  4PWD A;  5DM7 L;  3SJH A;  1BIU A;  2LSN A;  5HRO A;  1KAY A;  3F2K A;  4DFJ A;  4PA1 A;  4DFP A;  5BRD A;  2P9U A;  4MFB A;  2F8S A;  4B8A B;  1RDC A;  1JL1 A;  1DTT A;  3RTV A;  3KVG A;  1F21 A;  2DFH A;  1G99 A;  2DPN A;  4B3T K;  4DSE A;  3LZJ A;  1RT4 A;  1VSM A;  4RCH A;  3SQ1 A;  1GLC G;  3D7E O;  4F8R A;  3AO5 A;  4W5O A;  2VWJ A;  3AY9 A;  3IDH A;  3V9X A;  3O4Q A;  3OTO K;  2ASM A;  4M3R A;  1RBR A;  4JK9 A;  3SK3 A;  4BE1 A;  3MN6 A;  4FOI A;  3VF6 A;  1IG9 A;  3AVJ A;  4CHO A;  4Z4C A;  4JKG B;  1S72 N;  4WFA L;  3L2U A;  3LWM A;  1NBW A;  2FSK A;  1YT3 A;  2P9P A;  2OAN A;  3U3G A;  3VQ5 A;  3CCS N;  1BOT O;  1LAW A;  4JI2 K;  2KFZ A;  3O9T A;  4FLU A;  4F3O A;  3DJC A;  3J81 O;  2CH6 A;  4JN4 A;  1BA1 A;  4K43 A;  4PUO A;  2QXL A;  1NKC A;  1KQS M;  3RSE B;  2XY5 A;  2A41 A;  4I9L A;  1KVB A;  2NRH A;  4L3Q A;  3BF1 A;  4O8U A;  3LAN A;  4A57 A;  2ZGZ A;  4CJ7 A;  4BG8 A;  4OKK A;  3SUP A;  3T3F A;  2A1S A;  3I8D A;  3DLH A;  5M1O A;  4A61 A;  3KLG A;  1HYV A;  3D6R A;  4E89 A;  4FWL A;  1YUW A;  1WSJ A;  2P9S A;  4C8N A;  4CIG A;  5HRN A;  2VQF K;  4BRM A;  4UY8 O;  4R79 A;  4Y1D A;  3AV9 A;  4HWI A;  4JKC A;  1W97 L;  5E41 A;  1TVR A;  4DS4 A;  3N4P A;  4CZJ A;  4FJK A;  1ZC6 A;  1QSL A;  2RHK A;  3MWP A;  4CJS A;  2HHS A;  3H6E A;  3CQY A;  3L6Q A;  4X66 K;  3ENB A;  4DR5 K;  3SQ4 A;  4RG8 A;  3MED A;  1T05 A;  1JLB A;  5JMV A;  3BP8 A;  4FJL A;  4DLG A;  2QI2 A;  4Z4F A;  3U9Z A;  3R1X A;  4CED A;  4CZK A;  3LWL A;  3MWT A;  3OYG A;  4A5B A;  3ZX3 A;  4H5T A;  5KGX A;  3H08 A;  4FOE A;  3E01 A;  1YI2 N;  4PL7 A;  1JCG A;  4F9O A;  4LC9 B;  2QWO A;  3EE9 A;  3QFU A;  4H03 B;  4FW2 A;  3PX4 A;  5J2Q A;  1WUA A;  5AQN A;  4AHT A;  3HP9 A;  3DYA A;  1NJX A;  1NOY A;  3WNH A;  4I6M B;  4BR5 A;  2OPR A;  4KKO A;  3OYF A;  3V9U A;  2HHV A;  4JHD A;  1HJO A;  2Y1J A;  3NMU A;  4KV8 A;  3DOK A;  3O6W A;  3WQT A;  4CJ3 A;  3VQ8 A;  3VQB A;  2E6L A;  1BCO A;  2IC3 A;  3QIO A;  4QAG A;  1NGH A;  3HM8 A;  1C1A A;  3QFP A;  4BR2 A;  4FVM A;  3AO4 A;  2GBZ A;  1OH8 A;  2Z1I A;  3SYZ A;  2JLE A;  4KAZ A;  3WNG A;  4CJF A;  3OBW A;  3UE5 A;  1XQS C;  5AQK A;  1TV6 A;  2OTJ N;  2ETJ A;  4HUE A;  2G8H A;  4CEC A;  4BGA A;  1RDU A;  2BE2 A;  1HPM A;  3MEE A;  4LF4 K;  3M1F A;  1VSD A;  3FFK B;  4B1V A;  1NGC A;  1SUQ A;  2EX3 A;  3VQE A;  4ISF A;  3ENO A;  1YIJ N;  4FJ9 A;  3MN9 A;  2FSJ A;  4KHQ A;  3JYT A;  4M41 A;  1E3M A;  4ID5 A;  4DFK A;  4LY7 A;  1VSJ A;  2KW4 A;  3RMB A;  2P5G A;  1KLN A;  3SBT A;  3VPZ A;  3CJ9 A;  4RW8 A;  2HHH K;  4WCE L;  3EKU A;  5AR0 A;  5E84 A;  3ATU A;  3HST B;  3C6A A;  1YVU A;  3PO4 A;  3OS1 A;  5D3G A;  3HSC A;  4BC2 A;  1RTD A;  1NGD A;  1JLQ A;  4JS5 A;  5AFU H;  1ZXO A;  3B6P A;  1YIT N;  1I94 K;  1N33 K;  1ATS A;  3FGU A;  3L2V A;  1VRT A;  4CEO A;  1EX4 A;  1DLO A;  4Y1C A;  4GW6 A;  3CCR N;  3CF5 L;  2A6A A;  3KHY A;  3HVR A;  4JAX A;  4JKH A;  3SMP A;  2V7Y A;  4BRI A;  4E19 A;  5IWA K;  3BDP A;  3EO3 A;  4JKG A;  3C6T A;  3K58 A;  1SL2 A;  3KLI A;  4Z4G A;  2P9N A;  4XEI A;  4IWV A;  2BGG A;  4CGH A;  4YOY A;  3SUO A;  1S6P A;  1JJ2 M;  1C0M A;  3ATV A;  4EP4 A;  3MCA B;  3UKU B;  1BUP A;  3VMF B;  3E1Y A;  3G6E N;  2P9L B;  3P38 A;  3E66 A;  3M3Z A;  5GAD P;  4OLA A;  4HVJ A;  2BH1 A;  1CZA N;  1Y64 A;  3VTI A;  4FJ5 A;  5AQO A;  1IKV A;  2VG6 A;  2YI1 A;  3TAB A;  2YHA A;  3R8E A;  1LOT B;  3C7N B;  4JI0 K;  1XUP O;  3ZEU A;  5FLX O;  4GKK K;  2GX9 A;  4BRD A;  3CFO A;  3LP0 A;  3WXI A;  4H8K A;  5C15 A;  4Z0U A;  4X65 K;  4K42 A;  5AQS A;  2XHB A;  1K8K B;  4IFY A;  3ULE B;  1NNE A;  5JVG L;  1I3A A;  2HBM A;  3ZCM A;  1VK0 A;  1A5V A;  3V1O A;  3ZSO A;  1MWK A;  3D2F B;  1RGI A;  5BRH A;  3IMX A;  1IKX A;  3NGY A;  4DCH A;  3HT3 A;  4JRQ A;  5GAH P;  2I5J A;  1VQP N;  3IAY A;  2G8F A;  3PLA A;  1BQM A;  3UKU A;  2E6M A;  1RT6 A;  1YVN A;  3O5B A;  3ZET B;  4E7J A;  3VET A;  2YHW A;  3HYF A;  4LF9 K;  1WAJ A;  2R7Y A;  4KH6 A;  1IKY A;  3BUZ B;  4OPH A;  1HJR A;  3R3L A;  2KFN A;  3LDQ A;  3O80 A;  1TUU A;  3DRP A;  4KHP K;  4PKI A;  1JL2 A;  4W5R A;  3TTD A;  4WQ5 A;  1MDU B;  1HYZ A;  4LSN A;  3GG4 A;  1JLG A;  3BZK A;  5LJV A;  1QQC A;  4BDY A;  3VGK A;  4CHP A;  4FJN A;  4JS4 A;  4CZF A;  4E7L A;  3NGZ A;  3EYZ A;  3MXI A;  1C0U A;  4O55 A;  4CVN E;  1Z25 A;  5I3U A;  1DT9 A;  2G8K A;  1RT2 A;  4KTQ A;  2O8C A;  4IZ9 A;  4DG1 A;  3OYB A;  1RT1 A;  3BZC A;  5KPZ A;  4CGG A;  4PKG A;  2F8T A;  1WAF A;  3D2F A;  4FWQ A;  3OYC A;  2X6N A;  2HB5 A;  2Y1I A;  3VQA A;  3K9J A;  1RBT A;  1RDB A;  3CJ7 A;  4NCG A;  3THV A;  4LH5 A;  4DLE A;  4RW7 A;  4CJ5 A;  1Y97 A;  4H5R A;  3SAF A;  4OJR A;  3EKS A;  4FPB A;  2Q0R A;  1TKZ A;  1S1U A;  3TU5 A;  5JS1 A;  2O8C B;  3TAF A;  4W5N A;  4CF8 A;  4DTU A;  1X3N A;  3KK1 A;  3ITH A;  4DV4 K;  4HHT A;  4JEP A;  4FCY A;  1Q82 O;  1EWR A;  4LF6 K;  3LDL A;  2RKI A;  3OJS A;  1R59 O;  4QS9 A;  3M8P A;  3MX2 A;  2JWL A;  3U4L A;  1VQK N;  1HNZ K;  2ZQB A;  5FPE A;  4BDP A;  1T03 A;  1U45 A;  2HHX A;  4F2R A;  4CES A;  3MDQ A;  3CCV N;  2B5J A;  4DQR A;  4CFA A;  3T1H K;  4BR9 A;  2NRW A;  2VWK A;  4E1J A;  4DSJ A;  4ILG B;  1SS6 A;  1RT5 A;  3ID8 A;  5LMU K;  2XRI A;  5FPD A;  3R9P A;  1NK4 A;  1IBK K;  5HP1 A;  2VGN A;  1X9M A;  4CW7 B;  1NJY A;  1BI4 A;  2P9I B;  3HVT A;  5KRT A;  2VGM A;  3MCP A;  4B9S A;  4YDU A;  3B8A X;  3M5R A;  4CGF A;  3SPZ A;  4QOZ B;  3I0R A;  4A2B A;  3O4N A;  4H0V B;  3VA3 A;  3O3F A;  1KC8 O;  5ADX A;  4NLB A;  2YNF A;  3ZX0 A;  5AZJ A;  1JXE A;  4C8L A;  1KTQ A;  1C0F A;  4H5W A;  2HMP A;  3J7A P;  4FJ8 A;  4KI4 A;  3DLB A;  1V4S A;  4LFA K;  1NLV A;  1CXU A;  3C0B A;  4EP5 A;  3QBW A;  1VQO N;  4BGB A;  1RTI A;  1HNV A;  4JK7 A;  1ZBU A;  5GIP A;  3AVH A;  4IBN A;  4U67 L;  2A3Z A;  3LM2 A;  4FWK A;  1RDW X;  3NF9 A;  3V6D A;  1X9W A;  3L2Q A;  1ESV A;  3SMS A;  3DXK A;  1ZBL A;  3RRG A;  4LF8 K;  2P1J A;  4M3X A;  1BIZ A;  3A2F A;  4NCA A;  4BR0 A;  3C94 A;  4LSL A;  3Q7C A;  4ICL A;  1TK0 A;  4HUF A;  2QA4 N;  1S9E A;  2UUC K;  4AM7 A;  4IXC A;  3UKR A;  2HOE A;  3Q7B A;  4YOX A;  1W0H A;  2YHX A;  4L8R B;  2X6S A;  2IOC A;  2Q2R A;  3MXJ A;  5T7B A;  2KHO A;  5JLF A;  3ZSW A;  1SAZ A;  4Z94 A;  3NDK A;  3LAL A;  4AF1 A;  3ZT1 A;  5CR4 A;  3LZI A;  1T7P A;  3PO5 A;  5A2Q O;  3K57 A;  4BRF A;  2Q31 A;  3A5L C;  3SNN A;  1K73 O;  1Q9X A;  5C25 A;  2ZM6 K;  3O3H A;  3RR8 A;  1CZ9 A;  1SL1 A;  5LMN K;  4LFC K;  3PUF A;  3L3U A;  4DV7 K;  1T3V A;  4G9Z A;  2OPS A;  1ZBF A;  2FBX A;  1TAU A;  2IVP A;  4DQQ A;  5C42 A;  1EXQ A;  1VQ8 N;  3HJF A;  2H3G X;  3AVL A;  2Q3S A;  1WBB A;  3SBG A;  4LFB K;  5AQU A;  3LPT A;  3PIP L;  1NK5 A;  1XC9 A;  3GOI A;  2NNW A;  3ZYY X;  4AIL C;  3HOS A;  3AVF A;  2JWK A;  3FZF A;  5HLF A;  4K8X A;  3NAE A;  3CQX A;  1KCF A;  2O4I A;  2ZWH A;  4A62 A;  3SQ2 A;  1L3T A;  2JGU A;  1WSF A;  1DTQ A;  1QZ5 A;  2QK9 A;  4H4O A;  4C23 A;  4CEF A;  1IJJ A;  4DB3 A;  1R0A A;  1EQY A;  3TSP A;  5HRP A;  1LCU A;  4UQG A;  1VQ5 N;  3DRR A;  1JXB A;  2QKB A;  5I9E B;  4WQ4 A;  2DFF A;  1YAG A;  1M90 O;  3MEC A;  3F9M A; 
#chains in the Genus database with same CATH homology
 1MWM A;  3WQT A;  1E4G T;  4BRP A;  2PAV A;  5EVZ A;  3BEX A;  2HBK A;  5M1Q A;  5AZI A;  4B1Y B;  2FF3 B;  2HST A;  4BQL A;  4GV3 A;  4WF9 L;  1NGH A;  1C0G A;  3HM8 A;  1QQO A;  3L4I A;  4H0Y B;  3QFP A;  5BN8 A;  3H3N O;  1VQM N;  3AAQ A;  4BR2 A;  1ATN A;  3A8Y A;  3GBT A;  1M1K O;  1HUX A;  1T6C A;  4BC4 A;  3OBY A;  1T44 A;  4BRQ A;  1NGA A;  1K8K A;  3MMV A;  3O9U A;  4RTF D;  4CZM A;  5BRE A;  3OBW A;  4CZL A;  3UE5 A;  3VF2 A;  1XQS C;  5GAG P;  1RFQ A;  5AQK A;  4FWM A;  5M1P A;  4DQ8 A;  2OTJ N;  3LDO A;  4IFE A;  4IEI A;  3CIP A;  4BRG A;  2YX6 A;  4BGA A;  5BN9 A;  1RDU A;  4BC5 A;  3CCE N;  4DHY A;  4EHT A;  1HPM A;  3TSQ A;  3M1F A;  5F2R A;  3TSU A;  3FFK B;  4FSV A;  3VGM A;  4B1V A;  5B8H A;  1Q81 O;  1NGC A;  3S41 A;  1IG8 A;  3VOV A;  4FL9 A;  4BRA A;  4C1N I;  5C12 A;  1N8R O;  4ISF A;  4FWR A;  3WXM B;  5AQJ A;  2VWB A;  3ENO A;  1YIJ N;  1SQK A;  3MN9 A;  3VER A;  2IIR A;  4J8F A;  3DLL L;  2FSJ A;  4ILJ A;  3C7N A;  1BA0 A;  3VEN A;  4IOC L;  3CJ1 A;  3PIO L;  1TUY A;  5AQT A;  2P9L A;  2QWL A;  2D1K A;  5AQG A;  3D2E A;  3SBT A;  3A5O C;  5BPL A;  2KKZ A;  4FWO A;  4WFB L;  3VPZ A;  3CJ9 A;  2HF4 A;  4YOR A;  3VEV A;  4EAH D;  3HI0 A;  1SZ2 A;  4JKD A;  4BR7 A;  4CZE A;  3CXC M;  1ILY A;  4WCE L;  3EKU A;  5AR0 A;  3QIC A;  4OO1 J;  5AQY A;  5E84 A;  2EWS A;  4HTL A;  3ATU A;  4KH5 A;  4WYB A;  3P31 A;  3C6A A;  3LDP A;  4PL8 A;  2NRX A;  4H0O A;  4IOA L;  3HSC A;  4BC2 A;  1NGD A;  3KWI A;  2P9N B;  3CME N;  2YCH A;  2E2N A;  2E1Z A;  4CBW A;  3CCM N;  5EY4 A;  2P9U B;  3KZB A;  4BVP A;  1H1V A;  3W0L A;  3DXM A;  5AFU H;  3WXK A;  3CI5 A;  3NVK A;  1ZXO A;  1YIT N;  3O9R A;  1KD1 O;  4GY2 B;  1ATS A;  3FGU A;  1HKB A;  2QW9 A;  3IUC A;  5AZI B;  3EN9 A;  2QTD A;  3CJB A;  3CCR N;  3CF5 L;  2A6A A;  1YJN N;  3KHY A;  5AQI A;  3MX5 A;  4JAX A;  4JKH A;  3LM9 A;  3SMP A;  2A40 A;  4A2A A;  1Z6R A;  3IKM A;  4IJA A;  4JKE A;  2BTF A;  4H0P A;  5KPT A;  5JLH A;  5H1S Q;  2V7Y A;  3CC2 N;  4BRI A;  2D0P A;  4A59 A;  4B1U B;  1T6D A;  1NGE A;  3EO3 A;  1E4F T;  1TYQ A;  3JS6 A;  4JKG A;  5ELZ A;  1GLE G;  2P9N A;  4XEI A;  4IWV A;  3P39 A;  2I7N A;  4YOY A;  3HBT A;  1JJ2 M;  3AAP A;  3ATV A;  3E9L A;  5E26 A;  3MCA B;  5AQM A;  1GLB G;  5F0X A;  1HKG A;  3UKU B;  2F9T A;  3LL3 A;  1BUP A;  2A5X A;  5AQQ A;  3E1Y A;  4JNE A;  2P9L B;  3DXK B;  3P38 A;  3VMF B;  3G6E N;  1DGK N;  4JKA A;  3E66 A;  3M3Z A;  5GAD P;  3EL2 A;  3I56 N;  1VQN N;  1GLF O;  4KH4 A;  2J4R A;  2BH1 A;  1CZA N;  1Y64 A;  5AQP A;  1P8Z A;  3CJA A;  3F5T A;  4MO4 A;  4YOT A;  3VTI A;  1P90 A;  4K25 A;  4YDU C;  4XH1 A;  5AQO A;  3CET A;  3C65 A;  4K41 A;  2KLA A;  3FZH A;  2YI1 A;  4JKB A;  1U2V A;  1DEJ A;  1NGI A;  3QBX A;  3R8E A;  1LOT B;  3C7N B;  1NM1 A;  3U9D A;  1GLL O;  1VQ6 N;  2WC9 A;  3ULE A;  3I8B A;  1XUP O;  3ZEU A;  2GX9 A;  4BRD A;  4ISG A;  3WXI A;  2OTL N;  2AP1 A;  5C15 A;  4O5F A;  3CCJ N;  4K42 A;  1OVY A;  2E88 A;  3KWG A;  5AQS A;  4EHU A;  4BRH A;  3TTF A;  3LDN A;  1K8K B;  3ULE B;  1NGB A;  1KAX A;  4MLH A;  5JVG L;  2P9S B;  2HBM A;  3E9P A;  4H0X B;  4NB4 A;  1Q18 A;  5BPM A;  3L4Q A;  1U2V B;  2D4W A;  4JK8 A;  2P9K B;  4GNI A;  2E1Y A;  2QWP A;  1MWK A;  3D2F B;  1X3M A;  5AQV A;  3UB5 A;  1RGI A;  2ZGY A;  5BRH A;  3IMX A;  3OW2 M;  3QB0 A;  3L0Q A;  4I6M A;  4PKH A;  2VCP A;  3GE1 A;  4JHD B;  4DCH A;  2Q0U A;  3A0I X;  3O08 A;  2CGK A;  3ID6 A;  4PHT X;  5GAH P;  1VQP N;  3PLA A;  3O4W A;  3IFR A;  3UKU A;  1YVN A;  3O5B A;  3ZET B;  5KPR A;  5LJW A;  3VET A;  5BPN A;  1JCE A;  4B1W B;  2YHW A;  3GDQ A;  1YJ9 N;  1MA9 B;  4FVU A;  4KH6 A;  2UYT A;  3BUZ B;  4OPH A;  3ZET A;  5BR9 A;  4NO7 A;  3D2E B;  3TPQ A;  4YOV A;  3DXM B;  5AQH A;  2FSN A;  3HRG A;  4M63 C;  5C2F A;  2V51 B;  3R3L A;  3WEE B;  2FXU A;  3O9S A;  1YJW N;  3LDQ A;  3O80 A;  1TUU A;  3WQU A;  4PKI A;  5C2D A;  3CCU N;  3VGL A;  5EX5 A;  5CE3 A;  2ZJQ L;  3I33 A;  3TTD A;  4WQ5 A;  1Q7Y O;  3CPE A;  1MDU B;  4FWP A;  4IJN A;  4IOX A;  3G71 N;  5M1N A;  3CC7 N;  4ISE A;  1U6Z A;  3R6M A;  4H5V A;  4RWT A;  3GG4 A;  1J6Z A;  5LJV A;  5EOY A;  1ATR A;  4BVO A;  2P9P B;  2E2P A;  4BRK A;  3VGK A;  3W3D A;  4MO5 A;  4IDH A;  5M1F A;  2QEX N;  2GWJ A;  4CZF A;  2GWK A;  5LY3 A;  4WFN L;  1YF5 L;  4M7X A;  2I7P A;  1DT9 A;  2FLO A;  1HLU A;  2W41 A;  4H5N A;  4IZ9 A;  3HOT A;  2V52 B;  3CER A;  2CGJ A;  2NRR A;  1QHA A;  1K8A O;  3CD6 N;  4O8K A;  2CH5 A;  3VEW A;  5KPZ A;  1EO1 A;  1GLD G;  4PKG A;  3FZL A;  4CBX A;  5JVH L;  1D4X A;  3D2F A;  1BU6 O;  4FWQ A;  4EFH A;  1QVG M;  1QVF M;  3GL1 A;  3U8X A;  3AAR A;  4JD2 B;  4CZI A;  5DM6 L;  3K9J A;  2E2O A;  3H3O B;  4B1Z A;  3CJ7 A;  4NLC A;  4BQZ A;  1YHQ N;  3MN5 A;  2ZJP L;  5AQR A;  3EZW A;  2VYP A;  4QS7 A;  3G25 A;  2NRZ A;  2P9I A;  3QML A;  5M1K A;  4H5R A;  3SAF A;  2Q36 A;  3EKS A;  4GV6 A;  2A42 A;  4FPB A;  2GTD A;  2Q0R A;  2YJE A;  1HX1 A;  3A5N C;  5C0Y A;  3CMA N;  1HKC A;  2YJF A;  3VEY A;  4MDA A;  3TU5 A;  4IO9 L;  4OPA A;  1Q86 O;  2GEM A;  1X3N A;  2ASO A;  3DWL A;  3HZ6 A;  3WEE A;  4C1N K;  3FE1 A;  2WUS A;  1KAZ A;  4BRL A;  4FWN A;  4JEP A;  4YOW A;  2V7Z A;  4GV9 A;  3BF3 A;  5CHI A;  1Q82 O;  3MK6 A;  3LDL A;  3OHR A;  1R59 O;  3ZX2 A;  5HL7 L;  5FPN A;  4QS9 A;  3MX2 A;  3NVM A;  4CI6 A;  1VQL N;  5EXW A;  2JWL A;  3T69 A;  3U4L A;  4CD1 A;  1VQK N;  3CCL N;  2GUP A;  5TKW A;  5FPE A;  2PFU A;  3FLC O;  2QWR A;  4QS8 A;  1XC3 A;  4BRE A;  3MDQ A;  3CCV N;  4BR9 A;  2NRW A;  3P4I A;  4CD3 A;  2ITM A;  4E1J A;  3E9O A;  2HBJ A;  2NZT A;  3ENH A;  4ILG B;  4WQ4 C;  3VEO A;  1SS6 A;  1VQ4 N;  4AM6 A;  3ID8 A;  1BG3 A;  4JD2 A;  3VEX A;  5FPD A;  1NMD A;  3R9P A;  3A5M C;  2NRT A;  3CC4 N;  5GAE P;  5HOO A;  1S22 A;  4XH4 A;  3RVC A;  1NJI O;  2VGN A;  5AZJ B;  2WFB A;  4BRO A;  2P9I B;  4B1X B;  3T7Z A;  1VQ9 N;  3M6G A;  2VGM A;  3MCP A;  3SJH A;  4YDU A;  5DM7 L;  3CJC A;  3B8A X;  3M5R A;  2PBD A;  2E8A A;  3VF4 A;  1KAY A;  3F2K A;  4A2B A;  5KQ8 A;  3WT0 A;  2P9U A;  4H0V B;  5BRD A;  1KC8 O;  3K9K A;  4NLB A;  5ADX A;  1GLJ O;  3ZX0 A;  5AZJ A;  4BC3 A;  1C0F A;  1QZ6 A;  1VAZ A;  4H5W A;  3KVG A;  2HMP A;  3CHW A;  4Y0W A;  4U7B A;  5KQD A;  1V4S A;  1G99 A;  2HBL A;  3QDK A;  2DPN A;  3ZEU B;  1NLV A;  5AQX A;  2W40 A;  4MDB A;  3C0B A;  3QBW A;  4RCH A;  1VQO N;  4BGB A;  1GLC G;  3D7E O;  2FF6 A;  4IEE A;  4JK7 A;  5GIP A;  3WUH A;  2Q97 A;  4BRC A;  5FPM A;  1WOQ A;  2P9K A;  5AQZ A;  3AY9 A;  4U67 L;  2A3Z A;  3LM2 A;  1Z05 A;  3HTV A;  3IDH A;  5GIO A;  1V4T A;  4FWK A;  2ASM A;  1RDW X;  4JK9 A;  3SAG A;  3SK3 A;  2ASP A;  1ESV A;  3MN6 A;  4FOI A;  3SMS A;  1QQM A;  3DXK A;  3VF6 A;  4JKG B;  2WBN A;  3AGK A;  3OA9 A;  1NGJ A;  1O13 A;  2NRV A;  4BR0 A;  1S72 N;  3C6H A;  3O8M A;  4WFA L;  3EE8 A;  2F7T A;  3Q7C A;  1NBW A;  2FSK A;  2QA4 N;  1DKG D;  3KK7 A;  2P9P A;  3DAW A;  2OAN A;  4AM7 A;  4BG9 A;  3CCS N;  1BOT O;  3FR0 A;  4IXC A;  4BY9 C;  3UKR A;  2HOE A;  3O9T A;  3RSE A;  3DJC A;  4CBU A;  1QQN A;  3MN7 A;  3Q7B A;  4CZH A;  4XH5 A;  4GVE A;  1KXP A;  4YOX A;  2YHX A;  3FZM A;  5AQW A;  1K9M O;  2CH6 A;  1OKJ A;  1VQ7 N;  3H46 O;  3G4S N;  2Q2R A;  4JN4 A;  1BA1 A;  4H0T B;  4K43 A;  3FZK A;  2QXL A;  5AQL A;  2ZJR L;  4YOU A;  1KQS M;  4WQ5 C;  2KHO A;  5JLF A;  3RSE B;  1SAZ A;  1JCF A;  2A41 A;  3O1B A;  4B9Q A;  2NRH A;  4L3Q A;  3BF1 A;  4Z94 A;  4O8U A;  4A57 A;  4AF1 A;  2ZGZ A;  4JKF A;  4CJ7 A;  4KBO A;  5AFU A;  4BG8 A;  2GEL A;  5CR4 A;  4IO8 A;  3I55 N;  4EIA A;  2ZF5 O;  2Q31 A;  5M1O A;  4BRF A;  2IVN A;  4A61 A;  3A5L C;  1K73 O;  2YHY A;  3D6R A;  3TTC A;  2QWQ A;  4CZG A;  1GLA G;  4ILH A;  3WXL A;  4FWL A;  1YUW A;  2P9S A;  3O1W A;  4BRM A;  1BWF O;  4UY8 O;  5BRF A;  4R79 A;  3H45 C;  4JKC A;  4HWI A;  1W97 L;  1T3V A;  5F1X A;  5JIC A;  3N4P A;  4G9Z A;  2IVO A;  4CZJ A;  2IVP A;  2AA4 A;  2BUP A;  1NWK A;  1ZC6 A;  3VTH A;  4A5A A;  2RHK A;  1YXQ A;  3MWP A;  3VES A;  1VQ8 N;  1S3X A;  5AQF A;  3H6E A;  3CQY A;  2D0O A;  3L6Q A;  2H3G X;  3ENB A;  2RE2 A;  3WXJ A;  4FO0 A;  3SBG A;  5TKY A;  2HF3 A;  5AQU A;  4MLE A;  4BRN A;  3O9Q A;  5JMV A;  3PIP L;  3BP8 A;  1NGG A;  3J7Z O;  2E20 A;  1BDG A;  3GOI A;  2QI2 A;  3U9Z A;  3R1X A;  2NNW A;  3ZYY X;  4CZK A;  3MWT A;  1NGF A;  4BR4 A;  4A5B A;  4FPA A;  3HOS A;  3N4Q A;  2JWK A;  3VEZ A;  3ZX3 A;  4H5T A;  1ZBS A;  3FZF A;  2Q1N A;  3CQX A;  4FOE A;  2QM1 A;  1YI2 N;  4PL7 A;  2ZWH A;  4A62 A;  1JCG A;  3CPW M;  4F9O A;  1TYQ B;  4LC9 B;  1QZ5 A;  3H1V X;  2QWO A;  2F9W A;  4C23 A;  2NLX A;  3EE9 A;  1IJJ A;  3QFU A;  4H03 B;  5MLC Q;  2QWM A;  4DB3 A;  5ADX H;  1WUA A;  2E2Q A;  5GIN A;  5AQN A;  1EQY A;  4M7Y A;  1BO5 O;  3SLC A;  3TSP A;  2QWN A;  1LCU A;  4I6M B;  4BR5 A;  2CGL A;  1W2B M;  5C10 A;  3J8A A;  4FWS A;  1VQ5 N;  3JXU A;  3CCQ N;  5I9E B;  1X9J A;  4WQ4 A;  3H1Q A;  4DKW A;  1YAG A;  3SAH A;  4JHD A;  1M90 O;  1HJO A;  3NMU A;  3UKR B;  3AGR A;  3O6W A;  3F9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...