2FSKA

Crystal structure of ta0583, an archaeal actin homolog, semet data
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
326
structure length
321
Chain Sequence
MVVVGLDVGYGDTKVIGVDGKRIIFPSRWAVTETESWGIGGKIPVLSTDGGQTKFIYGKYASGNNIRVPQGDGRLASKEAFPLIAAALWESGIPVDLVIGSGTPLGTFDLEVKAAKEALENKVLTVTGPEGEVRQFNITRLIMRPQGVGAALYLLNQGIIEQQPGYGVVIDVGSRTTDVLTINLMDMEPVVELSFSLQIGVGDAISALSRKIAKETGFVVPFDLAQEALSHPVMFRQKQVGGPEVSGPILEDLANRIIENIRLNLRGEVDRVTSLIPVGGGSNLIGDRFEEIAPGTLVKIKPEDLQFANALGYRDAAERSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Ta0583
publication title Crystal structure of an archaeal actin homolog
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Structural protein
total genus 90
structure length 321
sequence length 326
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17989 ALP_N Actin like proteins N terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fskA02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2fskA01
1X3NA 4PKHA 3KZBA 1U2VB 1YAGA 1ZXOA 1JCGA 2DPNA 3A8YA 4CI6A 4RCHA 1TUYA 3AAQA 4B1VA 3KVGA 3CIPA 4WQ4A 4BGAA 3HSCA 4RTFD 3WXIA 1QQMA 4M63C 2HF3A 1G99A 2P9SB 4BC3A 3GE1A 3MCPA 3QB0A 3SLCA 3VF2A 4BGBA 1J6ZA 1HX1A 3ULEA 4IXCA 5CE3A 2CGJA 4H0TB 3FZLA 1BUPA 4FWOA 4BC4A 3F9MA 2ZGYA 2CH5A 4BRDA 3VOVA 4NB4A 3H3OB 4QS7A 3D2FA 3A5MC 3AAPA 3I8BA 2P9PA 1JCEA 5BPNA 3OHRA 2Q36A 4H0XB 5AQHA 1QZ6A 3ULEB 5EY4A 3IFRA 4E1JA 2AA4A 4BREA 4FWPA 4JHDA 5F0XA 4HTLA 2W41A 5AQSA 3U8XA 5AQQA 4H0YB 3S41A 2CH6A 2E1ZA 4JNEA 4KBOA 4FWQA 3ENHA 5AZJA 5EXWA 4CZJA 2P9PB 3HBTA 5AQUA 1SAZA 2VYPA 4CBWA 4DHYA 5AQWA 4BROA 2ZGZA 4AM6A 4BRQA 4EAHD 3GBTA 2OANA 4JHDB 3ZX0A 2E2NA 3UB5A 1JCFA 3P4IA 1NGAA 4BRCA 2QWOA 1OKJA 3WQUA 1BWFO 3U9DA 4IWVA 1NLVA 5EVZA 3WT0A 4O8KA 3LDOA 4CBUA 4BC5A 2VCPA 4PL8A 2ZWHA 1E4FT 2P9NA 3MN5A 3W0LA 3MN9A 1HJOA 3SMSA 1GLCG 4BRPA 1RFQA 1BO5O 4H03B 3TU5A 3VEVA 2AP1A 3CI5A 3QDKA 4F9OA 1NGHA 4MO5A 5EX5A 1KXPA 1Q18A 2ZF5O 4FO0A 3EZWA 1Y64A 3HI0A 1HPMA 3H46O 3C0BA 1Z6RA 1BOTO 1K8KB 5AQYA 5AQJA 4FPAA 3CJ1A 2YHXA 5BREA 2YCHA 2P9NB 5AQLA 3VEOA 3O08A 4B1WB 3WXKA 3GG4A 3DXKA 2FLOA 3CJBA 2P9LB 4WQ4C 4EHTA 4IZ9A 1S22A 5AQTA 3VF4A 4BRHA 2A5XA 3A5NC 1HKBA 3ZX2A 1GLEG 3IMXA 3CQYA 4BRIA 1YVNA 4FPBA 3CETA 1ZC6A 4H5VA 4WYBA 4A62A 3UKUA 4DQ8A 5JMVA 3L4IA 3QBXA 4K43A 2Q97A 2F9WA 3DXKB 4WQ5C 3LM9A 4BRMA 2IIRA 4FOIA 1TYQA 1X3MA 4K42A 3H1VX 2GELA 3EKUA 1ZBSA 4CZEA 2FXUA 3FZMA 4BG9A 5BR9A 3CERA 5AFUA 5KQDA 3M1FA 5FPEA 2A6AA 1DGKN 1GLJO 2CGLA 3VETA 2E2QA 1MA9B 4BRAA 3BEXA 3O1WA 2ASPA 5EOYA 2E2PA 3MN6A 3WXJA 2A3ZA 3JS6A 4A2BA 3UKUB 4BVOA 2Q2RA 2ASOA 5AQFA 1ATNA 2VWBA 1BG3A 4DB3A 3I33A 3QMLA 1TYQB 5AQZA 2IVNA 4CD3A 2WUSA 4CZIA 3AARA 4WQ5A 1NGFA 5JLHA 3HM8A 5AQPA 1XC3A 2GUPA 5E26A 4MO4A 4H0VB 2NLXA 3BF1A 3U9ZA 3VPZA 1KAYA 2E1YA 1XQSC 2GWKA 3G25A 3CJCA 2GEMA 3UE5A 4FL9A 2HOEA 5AQIA 5AFUH 4A2AA 3M6GA 1NGCA 2A40A 1V4SA 4BR7A 4XH1A 2IVOA 4B1UB 1C0GA 1T44A 2PBDA 3CJ9A 4FWKA 5KPZA 3R9PA 3VEXA 5AZIA 5LY3A 3EO3A 4XEIA 2Q31A 3D2FB 3O5BA 4LC9B 3CJAA 4NO7A 1CZAN 1SZ2A 4AM7A 1TUUA 5AQMA 3BF3A 2E8AA 4CJ7A 2QWMA 1NGEA 4FWSA 3O1BA 5ELZA 2J4RA 4H5RA 2E2OA 5KQ8A 2D0PA 2PAVA 1QZ5A 3EKSA 2UYTA 4HWIA 5AZIB 4FWMA 1V4TA 1YXQA 3FZFA 3QFPA 5AZJB 2ASMA 2P9UA 2BTFA 4BVPA 2QWQA 1BA1A 2YHYA 3LL3A 2QM1A 3GDQA 3U4LA 4I6MA 3VESA 4IJNA 3MN7A 5B8HA 4YDUA 4ISEA 4QS8A 5BPMA 1QQNA 4XH4A 1GLAG 2KHOA 3SJHA 3WEEA 4QS9A 1XUPO 4GNIA 1MWMA 3UKRA 2P9UB 5AQNA 3CQXA 4BR2A 3VEZA 1GLFO 3WXLA 3LM2A 3H1QA 3BUZB 3C7NA 3ZX3A 3FZKA 4I6MB 1NMDA 3QBWA 5E84A 3A5OC 4CZFA 3H45C 4BQLA 2EWSA 4K41A 4CZMA 1WOQA 3VEWA 4BC2A 1RDWX 3D7EO 4K25A 2V52B 3ENOA 4L3QA 3A5LC 1HKCA 5BPLA 3QICA 1MDUB 2CGKA 2GTDA 5JICA 2FSJA 1U2VA 4BG8A 3ZEUA 4DCHA 4EFHA 2HF4A 5AQGA 2D4WA 3VEYA 4B9QA 2NZTA 2H3GX 2A41A 3ATVA 5FPMA 3EL2A 2Q1NA 1HLUA 1E4GT 4CZGA 1P8ZA 3LDLA 5ADXH 3TPQA 3B8AX 4MLEA 4CD1A 1GLDG 3O6WA 2FF3B 2Q0UA 4BRGA 3LDNA 3CJ7A 3ZEUB 1BA0A 3DJCA 1DKGD 3EN9A 2W40A 4JN4A 4CBXA 2P9IA 1KAXA 4H5TA 5JLFA 1MWKA 4Y0WA 3VERA 4PL7A 5KPRA 2E88A 3DXMA 4GY2B 4M7XA 4BR4A 5BRDA 4H5WA 1NGJA 5LJVA 1WUAA 3CHWA 4FOEA 3R6MA 4CZKA 3LDQA 4MLHA 2IVPA 2QW9A 1C0FA 2QWLA 3M3ZA 4IJAA 5TKYA 4BR5A 4FWLA 3O80A 3SMPA 4BRKA 3VGLA 3GL1A 2P9IB 4PKGA 3ID8A 3RSEA 3ATUA 4FWRA 4B1ZA 3L0QA 1ATSA 2I7PA 1NGDA 3VGMA 3VF6A 3H3NO 2P9KA 1X9JA 4EIAA 4BQZA 3SK3A 5AQOA 1NWKA 5AQRA 1NGBA 3DXMB 3L6QA 4IO8A 1BDGA 3FLCO 1R59O 4YDUC 2Q0RA 4CZLA 3WUHA 3JXUA 3FR0A 5FPNA 1GLLO 3R8EA 4B1XB 3IUCA 3RSEB 3IDHA 4H5NA 3A0IX 3DAWA 2E20A 5F2RA 4BRLA 4EHUA 4H0PA 4XH5A 2P9KB 1U6ZA 1ATRA 2FF6A 1T6CA 3H6EA 4O5FA 1H1VA 1ESVA 3D2EA 1T6DA 4BR9A 3MDQA 2V7YA 4BRFA 5AQKA 4C23A 5BRHA 4BR0A 1DEJA 1YUWA 2V7ZA 3ZETA 5BN8A 1LOTB 5I9EB 1D4XA 1RGIA 4J8FA 2NRHA 4BRNA 1NM1A 4RWTA 2FSKA 1NBWA 3O8MA 4PKIA 2QWNA 5AQXA 3HTVA 1EQYA 3FGUA 2V51B 1SQKA 3WQTA 2A42A 2YHWA 1GLBG 3VGKA 3AY9A 4A61A 1K8KA 3J8AA 3D2EB 5F1XA 2YJEA 1HUXA 5FPDA 1QQOA 2D0OA 2D1KA 3ZETB 2P9LA 2QXLA 5BN9A 1Z05A 2ITMA 4JD2A 3FZHA 3HZ6A 3FE1A 5LJWA 5ADXA 3W3DA 3MMVA 3WEEB 3VENA 4B1YB 1IG8A 3BP8A 4ISGA 1IJJA 1S3XA 2F9TA 3KHYA 1KAZA 4CZHA 3UKRB 4ISFA 5AQVA 1NGIA 3LDPA 1LCUA 2QWPA 5BRFA 2HMPA 5KPTA 4FWNA 2FSNA 3MK6A 1BU6O 1NGGA 3C7NB 4H0OA 2I7NA 4JD2B 3FFKB 4JAXA 3DWLA 2BUPA 4FSVA 3GOIA 2GWJA 3O4WA 4M7YA 2QWRA 2YJFA 5AR0A 1QHAA 2P9SA 1HKGA 2YI1A 4Z94A 3QFUA
chains in the Genus database with same CATH superfamily
3JSMA 4PKHA 3TTDA 1JLBA 1XI1A 2NRWA 2VQFK 3B6OA 3KZBA 4C8OA 3QIPA 1YAGA 1JCGA 2DPNA 3KK7A 1L3TA 4CEZA 3OYIA 4GKKK 4B1VA 3KVGA 3C65A 3CIPA 3K9JA 3HSCA 1RT4A 3K9KA 2FBXA 4M63C 5GAEP 4BC3A 3OBWA 4ZTFA 2NRZA 4AH9A 4DV7K 2UXCK 4DTPA 3EE9A 3ULEA 4DQSA 4AHCA 4IXCA 5EU7A 1X9MA 4IOXA 4FJ8A 3NF9A 2R7YA 4NLBA 3E9LA 3VMFB 1VRTA 4FWOA 2ZGYA 3KLFA 3CCEN 3OS1A 3SQ2A 3OW2M 1ASWA 4KREA 4QS7A 1NJZA 4OKJA 2O4IA 3P1GA 3OHRA 3IFRA 3K5OA 2AA4A 4E1JA 3NHGA 4OX9K 4BREA 2YX6A 4HTLA 2W41A 5C0YA 4B9TA 1C6VA 4GKJK 3RVCA 5HRPA 2HHVA 4OPJA 5GADP 4M3ZA 4LF6K 3DOKA 4OLAA 3HBTA 4FZZA 1EO1A 2VYPA 5AQWA 3CM6A 3OYFA 3OJUA 4DR1K 2ZGZA 2X78A 4BRQA 4EAHD 3F9KA 4I9LA 4JHDB 3D45A 3ZX0A 3R3LA 3KLIA 3DLHA 3QEXA 3WQUA 1BWFO 4JKBA 4F4KA 3TAQA 3WT0A 2YKMA 1NJIO 4FLUA 4CBUA 4YFUA 4Z0UA 1E4FT 4E1NA 1ZBFA 3J81O 1HJOA 5C12A 4HUEA 5M1FA 3EZ5A 4QCLA 4H03B 1KRPA 3LWLA 2AP1A 3VQAA 2YNFA 4B3OA 4B9MA 4JKCA 3AVCA 1BOTO 2IDOA 3DYAA 2GX9A 5AQJA 5BREA 2YCHA 3QEWA 3O08A 3GG4A 2FLOA 3CJBA 4WQ4C 1KVAA 3KLGA 3ZYYX 3NGZA 4EHTA 1HMVA 5LMNK 5HLFA 1ZBIA 4CEBA 4M45A 3ZX2A 5GAGP 2O4GA 1IKXA 3CETA 2G8UA 3L3UA 2KLAA 2E5LK 3DMJA 3L4IA 4K43A 3DXKB 4WQ5C 3LM9A 3QNOA 3ZSXA 1NK7A 2WONA 1TYQA 1TKTA 4DV2K 4B9UA 1T05A 1NG9A 4CZEA 2FXUA 1F21A 3KD5E 4BG9A 2UUBK 1VSEA 4W5TA 4JI5K 2OPQA 4M3RA 5FPEA 2A6AA 3CD6N 1GLJO 1W97L 2E2QA 5H1SQ 4KB1A 3BEXA 2O8DA 4JKHA 4GV6A 4JI3K 2ZE2A 2ASPA 2PZSA 5EOYA 2E6MA 3THWA 2IS3A 3UKUB 2Q2RA 4DV6K 4FJ9A 2BANA 3QMLA 5T7BA 1SKSA 5AQZA 1EX4A 4WQ5A 1NGFA 2BDPA 2X6NA 4E7IA 1XC3A 5E26A 4CJUA 3OYJA 1VQ6N 3VPZA 4DUZK 3ZT3A 1KAYA 3WNGA 2GWKA 3TR8A 4DR3K 3Q7CA 1R0AA 5AJ3K 2ZJPL 4BDZA 3KTQA 4B1UB 3ULDA 4CHNA 3VQQA 4N56A 4MFBA 3R9PA 3VEXA 2IGIA 5AZIA 5LY3A 1IKWA 1L3UA 4C8NA 3DM2A 2QKBA 4X65K 1QHTA 2G8IA 3LZJA 4JI0K 4LC9B 2HB5A 4KFBA 3CJAA 4JKGB 4NO7A 1KFSA 3L2VA 1B9FA 4CJLA 3N4PA 3O1BA 4FLWA 4Z4EA 3HT3A 2EHGA 1RT7A 4LD0A 1BGXT 2O8CA 2UYTA 1CZBA 3SAFA 3THXB 1D9DA 3U3YA 1Q86O 1BA1A 1XMQK 3U4LA 3OYNA 2WBNA 1NK8A 4IJNA 3KKRA 5B8HA 1RBVA 4LSNA 4CJQA 5HBMA 4I9QA 1S1TA 3QEPA 3PSFA 5FRMA 4A5AA 3K57A 1WLJA 1HNXK 3H1QA 2FBYA 5C42A 2YNHA 3FZKA 4I6MB 5E84A 2RF2A 3A5OC 4CZFA 4GV3A 4DSKA 4JI8K 1TL1A 4K41A 4CESA 4JK8A 2JGUA 3AVMA 1WOQA 3PO4A 2F8SA 4JKDA 2XY7A 4CGJA 1CLQA 5J2MA 3T1HK 2CGKA 2HW3A 4IFYA 3SPZA 2LSNA 2HF4A 2D4WA 3OYMA 1CZ9A 2YKNA 5LMUK 2A41A 2G8VA 3NH2A 1HYVA 3HP6A 1VQPN 5I3UA 1HR0K 3VA0A 4DFKA 3O3FA 2UUCK 1RBTA 4CGHA 5CYQA 4K8XA 3MXIA 4CJ3A 2JWLA 1N5YA 1MWKA 5SZTA 1Q7YO 1VQMN 2OPSA 3OYLA 4KHSA 4PL7A 4DSIA 1S1VA 2E88A 4BR4A 3PX6A 1NGJA 1WUAA 3DI6A 4MLHA 1YJ9N 1XNRK 1FKOA 4DF8A 3K5LA 3M3ZA 1C0FA 4IJAA 4BR5A 3DRPA 4BRKA 2NUBA 2P9IB 3ID8A 3RSEA 2G8KA 3HL8A 1RBSA 3L0QA 1QTMA 1NGDA 3VGMA 4C1NK 2W6KA 1X9JA 3HPHA 4ILGB 4EIAA 1L5UA 5AQOA 1UA1A 5SWMA 4HTUA 3DXMB 1BDGA 4JI2K 1D5AA 3FLCO 1R59O 4YDUC 4CZLA 3FR0A 4YOWA 3NCIA 3L2WA 2Z1JA 4ID1A 4H5NA 2P5GA 3DAWA 4JLHA 2X6SA 1EETA 4FJXA 4H0PA 3DRSA 2FF6A 1TK0A 4O5FA 2Y1IA 1ESVA 2Z1HA 3D2EA 5JVHL 3MDQA 4NYNA 4CK2A 1SS6A 3L3VA 1YUWA 2V7ZA 3ZETA 5BN8A 2YNIA 5HRRA 3TARA 2HVHA 4Z4HA 4GV9A 4CIGA 3HTVA 3NVMA 4HUGA 2B5JA 3WQTA 1GLBG 4A61A 4DQPA 5FPDA 4CK3A 2D0OA 3PX0A 3AVGA 4QOZB 2OZSA 5M1KA 4CHPA 1BCOA 2QXFA 2QXLA 2ITMA 3PUFA 4ID5A 3ZSOA 3C95A 1E3MA 3PLAA 5ADXA 4YOVA 4O0JA 4EP5A 5I42A 3VENA 4C8KA 4F8RA 4CJSA 3BP8A 4BDYA 1I39A 1S3XA 3KHYA 2OZMA 3THYA 3OYCA 3A2FA 3LP3A 2ZJQL 3CF5L 5BRFA 2HMPA 5KPTA 1HPZA 2HHXA 1BU6O 3C7NB 4B3MK 3AA3A 3KWGA 4JD2B 4IFEA 3TAGA 4JAXA 3DWLA 2BUPA 5CYMA 3LP0A 4FSVA 3VTHA 4CW7B 1QHAA 1TV6A 3DOLA 4FYDA 1X3NA 4JI6K 1VSIA 4DV1K 4KTWA 2KFNA 3QETA 4CEOA 4CF8A 3VQPA 1C0TA 4OPHA 3OS2A 4M3YA 4RCHA 4Z4GA 3AAQA 3AV9A 2Q3SA 3LDSA 4RTFD 1RBRA 1XWLA 3K58A 1HNIA 4B08A 3OYHA 3GE1A 4OPKA 4BGBA 4KH4A 1HX1A 3CQ8A 1EKEA 1QQCA 3NDKA 2NRTA 5CE3A 4IO9L 3AA4A 1BUPA 1VRUA 4AHSA 4DV4K 4PA1A 4CVNE 3M8SA 4NB4A 3CMEN 1MU2A 4KHQA 1EWRA 1YF5L 1JCEA 5BPNA 2RHKA 4H0XB 3G6EN 4DSLA 4CGIA 4KO0A 3LP2A 1O1WA 2RPIA 4I2QA 4MQ3A 4HCCA 1EWQA 3KJVA 1OVYA 5AQSA 4H0YB 3CCSN 2W42A 4DF4A 2E1ZA 3ENHA 4YOYA 5KRSA 2P9PB 3PSIA 4DHYA 1VQON 3AO4A 3S3OA 2B4JA 3GBTA 1GOAA 3V9WA 5IT9O 4LSLA 3UB5A 3CC4N 4FK2A 3P4IA 1NGAA 2YV0X 1OKJA 1YTUA 3T1YK 1NLVA 2IC3A 4CFAA 1Q8IA 4PWDA 1WAJA 3LDOA 3VQEA 4JYAK 1SL1A 4RW7A 4PL8A 2ZWHA 1YHQN 2P9NA 3BDPA 3F73A 3ZSZA 3P31A 1GLCG 4BRPA 3SAHA 1RFQA 3AA2A 3ZT0A 3TU5A 2A1SA 3J7AP 4F9OA 4MO5A 5EX5A 1KXPA 2ZF5O 4E3SA 3EZWA 1JL2A 3C0BA 5M1QA 3F5TA 4CFBA 1K8KB 5AQYA 2OCEA 1WSHA 4FPAA 1FK9A 2GBZA 3E9PA 1IBMK 2F7TA 3VEOA 4B1WB 3C6HA 4FJ5A 4KHPK 1ZYQA 4IZ9A 4KH6A 1Q81O 2ITGA 2JWKA 2HHTA 1GLEG 2HBKA 3CQYA 4ILJA 1YVNA 2X74A 4H5VA 4YNQA 3CC7N 3DLKA 2OTJN 3QBXA 2Q97A 1NK5A 4CHYA 4FOIA 1WAFA 4K42A 2GELA 3F2KA 3FZMA 1QSLA 5AFUA 5KQDA 4DMNA 4BRAA 4DTNA 3VETA 1MA9B 3NH1A 4F2SA 2E2PA 1YT3A 3MN6A 2A3ZA 3JS6A 4BVOA 4F3OA 2ASOA 5AQFA 1B9DA 3AO3A 4CD3A 4PHTX 4YY3K 4CZIA 3V9SA 4A57A 2HHWA 1RT6A 5AQPA 4U7BA 1J53A 1QVFM 1LWFA 2OYQA 4H0VB 2NLXA 1NK9A 3U9ZA 2E1YA 3G25A 3CJCA 1OH7A 5JS2A 3T69A 3TI0A 2HOEA 3S3NA 4A2AA 3RTVA 1NGCA 4JRQA 2A40A 3QEIA 1JJ2M 3EEQA 1V4SA 3HPOA 2IVOA 4FZXC 1T44A 4OVLA 4U67L 3CJ9A 1NK4A 4FWKA 3EO3A 3NGIA 1GOBA 1VSHA 4W5OA 3O5BA 4OKKA 3V9XA 3QNNA 1VQNN 1SZ2A 2E6LA 4AM7A 5AQMA 2QWMA 2P5OA 1NGEA 4FWSA 5ELZA 3HO1A 3IAYA 4JRPA 5KQ8A 1JXEA 3O3GA 1BHLA 2D0PA 2PAVA 3TSQA 1QZ5A 4CJEA 1V4TA 3NF7A 2Y1JA 4M3XA 3DLEA 5AZJB 3RMBA 2ASMA 2P9UA 2QWQA 3CXCM 5HRNA 3NGYA 3IKMA 3MN7A 1M90O 3ALYA 4KHWA 3FFIA 4M42A 1GLAG 1BL3A 3KWIA 4W5QA 4GNIA 3NBPA 4CJ4A 1UAXA 3WXLA 5MLCQ 3C7NA 1VAZA 4YOTA 5CY4A 2HSTA 4CGFA 4L8RB 4BQLA 4CZMA 4CF1A 3VEWA 1N32K 3CCVN 2V52B 3HM9A 4L3QA 3A5LC 1N6QA 2XHBA 1LAWA 4YOUA 4C8LA 2GTDA 4RW6A 2FSJA 3ZEUA 4CJWA 1JLEA 4BWMA 1U4BA 4X66K 5AQGA 3VEYA 2VGMA 3OVNA 2NZTA 2KFZA 3OYAA 3ATVA 4J2BA 2Q1NA 1HLUA 1E4GT 4AILC 3KLEA 4LH5A 5ADXH 4XIUA 3LPTA 2VGNA 1GLDG 4BRGA 4CE9A 1JXBA 1JL1A 1ZBHA 1LWEA 4V19S 2W40A 5C24A 4JN4A 3O3HA 1NJYA 3SBGA 1KAXA 4O55A 4B9LA 1S6PA 5BR8K 3LAKA 3HYFA 3V4IA 3KLHA 3RMAA 3LALA 4AHVA 5BRDA 3VQ9A 4EZ6A 5LJVA 3TWHA 3CHWA 2HHUA 2IVPA 3AVLA 1QE1A 2QWLA 5TKYA 1RDUA 4E0DA 2VWJA 3SMPA 1HQUA 3LPUA 3TAEA 4DFJA 3BY5A 4NXNK 2AJQA 1RT3A 3ATUA 3VF6A 3H3NO 3HOTA 3VQ7A 1A5WA 3KD1E 1WSFA 3C6TA 1T8EA 1C1BA 4RG8A 3WNFA 4X62K 3AVBA 4DQRA 2Q0RA 5FPNA 3OBYA 2F8TA 1GLLO 3RMDA 2O8FB 3L4QA 2HHHK 2P1JA 5K14A 4Q0BA 3A0IX 2E20A 2P9KB 4FVUA 1GOCA 3HXMA 4BR9A 3TABA 2V7YA 3MCAB 4A59A 4BRFA 1TAQA 4EZ9A 2YHBA 5BRHA 4GMJB 4BR0A 4DS4A 1JLAA 1LOTB 1D4XA 1RGIA 4YOXA 4J8FA 1NM1A 2IAJA 2FSKA 3RWUA 1NBWA 3D6RA 3O8MA 2QWNA 1K9MO 3FGUA 2V51B 3SUNA 2A42A 2YHWA 3VGKA 4PY5A 4IEEA 3VTIA 1K8KA 2OPRA 1YTAA 5F1XA 5GAHP 1QQOA 3G71N 4IFVA 4CIEA 4B9VA 3HZ6A 2BGGA 1KLMA 4FLXA 5LJWA 1NKEA 4N47A 4CEFA 4B1YB 3ZLJA 1LW0A 4KRFA 1IJJA 3OY9A 4CJKA 5J1EA 3DRRA 4HHTA 4BE1A 1LCUA 1NKCA 3MK6A 3LAMA 3K5MA 1NGGA 1Q9YA 3TANA 2OA8A 2VWKA 3GOIA 4B9SA 3MWPA 1W7AA 4M7YA 1IO2A 4FM0A 3OYDA 2YJFA 3AGRA 2YI1A 1XMOK 3SUQA 1S1XA 4WFNL 1VK0A 4LF5K 4B8AB 2QKKA 2FBTA 3KK2A 1ZXOA 1WN7A 4CI6A 1S1UA 5C2DA 3M5RA 1TUYA 4CGDA 4BGAA 3WXIA 1HJRA 1QQMA 1C1CA 2BH1A 3SPYA 2P9SB 4ZHRA 3KK1A 2B6AA 4NCBA 3BZKA 2O8BB 3VF2A 1VQLN 1J6ZA 3AVNA 3AO5A 4CGGA 3L2RA 1BI4B 3ZT1A 2NNWA 2CGJA 4H0TB 4N41A 3FZLA 1OH5A 1S5JA 1S9EA 1KVCA 3HJFA 3F9MA 4N5SA 3CC2N 3QESA 1KC8O 3AAPA 1DTTA 3VN5A 4ICLA 5KRTA 3SV4A 2Q36A 1QZ6A 3VQCA 3ULEB 1S72N 1DLOA 4KAZA 4JHDA 4F3TA 3M8PA 4CEEA 5DK5A 2HNZA 1UWBA 4FWQA 4B3TK 3RMCA 5AZJA 2D0CA 5EXWA 4CZJA 4YHHK 5AQUA 3AO1A 1KCFA 1RTIA 4BROA 4AM6A 1JLQA 3N4QA 2OANA 4CJPA 2E2NA 3CM5A 4O0IA 4M3WA 3T1AA 3CCMN 2QWOA 4DR5K 2G8HA 4JEPA 2VG5A 4O8UA 1NK0A 1Y97A 2PY5A 5EVZA 4LF9K 4O8KA 2VG7A 4CF2A 2XY6A 4ELTA 4DQIA 2VCPA 4IG0A 4TSXA 5CR4A 3HVRA 4YORA 3E66A 3W0LA 4IKFA 4UQGA 3SMSA 3MECA 1VQ8N 2UUAK 3VQ4A 1VQKN 3OYEA 4DR6K 2ZD1A 1SL2A 4MDBA 1NGHA 1X9WA 1Q18A 1W2BM 1Y64A 1HPMA 3H46O 3I55N 4BACA 5A2QO 4LFCK 5D3GA 3CMAN 3CFPA 3CJ1A 4C1NI 4B3SK 1YI2N 3WXKA 3DXKA 2P9LB 4QAGA 4KKOA 1S22A 2ATQA 5AQTA 2EX3A 3VF4A 3M8RA 2O8EB 1I94K 4BRHA 4FJKA 2A5XA 3A5NC 3I0SA 1G15A 4OPAA 1T7PA 4FLYA 3IMXA 4BRIA 1ZC6A 3MX5A 4A62A 4O4GA 3UKUA 4DQ8A 4E19A 5JMVA 1RILA 4BRMA 3I8DA 2F9WA 1NNEA 4UY8O 5DM6L 4R79A 2IIRA 3H1VX 5CZ1A 3PIPL 3EKUA 4KV8A 3RRHA 3CG7A 4FW1A 3R1XA 1DGKN 4CHQA 1ZBLA 4K8ZA 4OLBA 1OVQA 4GVMA 4A2BA 1RDCA 4J2DA 3ZSYA 2VWBA 4IDKA 3E01A 1J5EK 1QVGM 1TYQB 2IVNA 5TKWA 3AARA 3Q7BA 4J2EA 1FXXA 4LFBK 1IKVA 5JLHA 1XHZA 3LZIA 3E9OA 4CJ5A 5KGWA 4CEQA 2O8DB 1XQSC 4C8MA 3CCJN 1X1PA 1YJWN 3UE5A 4FL9A 2HBMA 5AQIA 3THWB 4JKGA 3M6GA 1VQ7N 2NRRA 3K2PA 1QSSA 3IS9A 4CFDA 1XC9A 1IKYA 4XH1A 4CCHA 4W5NA 2KZZA 5KPZA 1ASUA 4H4MA 4XEIA 4CEDA 3CFRA 3QLHA 1JLCA 2DY4A 3THXA 3D2FB 1C1AA 1XHXA 3H08A 5FROA 3WNEA 2NRVA 1CZAN 3MAQA 1UOCA 1TUUA 2DFEA 4EP4A 3NH0A 2E8AA 4CJ7A 2J4RA 2E2OA 4CF9A 4B3RK 4DU1A 1KSPA 1X9SA 4E7HA 5GIOA 3EKSA 4HWIA 5AZIB 4FWMA 1YXQA 3QFPA 4DU4A 4BVPA 4FJ7A 3LL3A 4BE0A 3AVAA 3O9QA 1U48A 3ZT2A 4I6MA 4LF8K 2UU9K 4OO1J 1U04A 1UA0A 3TAFA 5BPMA 4CJVA 4NCGA 1J5OA 2D0BA 3SJHA 2HNDA 4QS9A 1OH6A 4DU3A 1XUPO 3CCUN 2ZQBA 5AQNA 3CQXA 4DTRA 3QERA 3LM2A 3BUZB 1TK5A 1NMDA 3QBWA 5KGXA 1RT5A 1HQEA 4NYFA 4IDHA 2FBVA 2EWSA 4G9ZA 3ZSWA 2G8FA 2WOMA 4BC2A 1N34K 3D7EO 3ENOA 3G0ZA 1HKCA 4DR4K 3K59A 3QEVA 5BPLA 3QICA 1MDUB 5JVGL 2F4VK 5JICA 3K0SA 4CECA 1WNSA 3P39A 3NFAA 3V9ZA 4B9QA 2HVIA 2H3GX 5E41A 4A5BA 4AHRA 1TAUA 3EL2A 4IOCL 1P8ZA 1YJNN 5HOOA 3LDLA 3T19A 3SNNA 2O8BA 1HNVA 2P51A 5LL6Z 3B8AX 1VSMA 3OYBA 3O6WA 3LDNA 3OYKA 1BI4A 4CK1A 1WSIA 2XY5A 4CBXA 1M1KO 2P9IA 5DMRA 4H5TA 4CIFA 1IH7A 3CPWM 1VSKA 2RE2A 4O5BA 3TTFA 1JLGA 1RT2A 3HK2A 3DXMA 4GY2B 2XY8A 4FK4A 5FDLA 4FOEA 3R6MA 1BIZA 3C6UA 4I2PA 4B8CA 3LDQA 2VG6A 3ZT4A 4FWLA 1WB9A 1CXUA 3O80A 4WCEL 1KD1O 3VGLA 3NVKA 3I0RA 1KVBA 2I7PA 2KKZA 1FKPA 4E7LA 3AGKA 1KTQA 4GVEA 3SK3A 4HCBA 3G10A 2NRXA 1NK6A 3L6QA 4IO8A 1KFDA 4E89A 1RBUA 2VQEK 4LY7A 4KHYA 4DLGA 1QS4A 2RKIA 4KI6A 3VQBA 3IUCA 4WFAL 2HMIA 1S1WA 3RSEB 4BRLA 5F2RA 1J54A 2WFBA 1A5VA 1U6ZA 5DM7L 1N8RO 4JI4K 4G1QA 4JKAA 1T6DA 3K5NA 1J9AA 4O44A 3HSTB 1QSYA 5AQKA 4C23A 1DEJA 3AVHA 4DTXA 4OGCA 5M1NA 5I9EB 5KI6A 2NRHA 2KZMA 2YNGA 2KTQA 4RWTA 4FXDA 3TAPA 4B9NA 4DV5K 4FM2A 1EXQA 1HYZA 1TKXA 1N33K 1JLFA 3QO9A 4M3TA 3AVFA 3J8AA 3D2EB 2YJEA 5J2PA 3KKSA 1L3VA 3TTCA 4DWIA 2OPPA 4JK9A 4K0KK 3ZETB 5HL7L 4DR7K 4FJMA 2P9LA 5BN9A 4JD2A 3FZHA 4KH5A 2HHQA 3O9TA 1RTDA 3FE1A 4W5RA 2O8EA 3S3MA 4DV0K 1NKBA 3W3DA 3WEEB 4CF0A 3VQ5A 1IG8A 4KTQA 1SKWA 3BGRA 3ZSRA 4CEAA 5JS1A 4Y1CA 4CZHA 3TSPA 3UKRB 1VSDA 4ISFA 2BE2A 4HVJA 5GINA 3SQ4A 1NGIA 3DLLL 3SQ0A 3VQ8A 1EP4A 3FFKB 3J80O 4DSJA 1TKZA 4DUYK 1BISA 4FLVA 4FJGA 2GWJA 3O4WA 4Y1DA 3ISNC 2JLEA 5AR0A 1HKGA 1TK8A 4JK7A 3AA5X 3THYB 1NOYA 1LW2A 3MXJA 3LWMA 3I56N 1U2VB 1SL0A 3JYTA 4CHOA 3A8YA 1ITGA 5CZ2A 4DFPA 2W6LA 4WQ4A 2GUIA 3P5JA 4I7FA 1LWCA 2HF3A 3O4NA 3NE6A 1G99A 1A5XA 5HP1A 3MCPA 1KLNA 4FCYA 3QB0A 3SLCA 3JAMO 2QTDA 1VQ5N 1IG9A 1I3AA 1ILYA 1IBLK 1NMNA 3LANA 2G8WA 3CPEA 4FJIA 1Z25A 1WBDA 4BC4A 2OTLN 2CH5A 4BRDA 3VOVA 3H3OB 4JV5K 1TL3A 3D2FA 3A5MC 1TKDA 3MEDA 3I8BA 2P9PA 4CJRA 5AQHA 3EY1A 1N36K 3ITHA 4RW9A 5EY4A 1BCMA 4FWPA 3ASMA 4ELUA 5F0XA 3U8XA 2QK9A 5AQQA 5HRSA 4PQUA 3S41A 2CH6A 3ZSQA 4JNEA 4KBOA 1NOZA 3HPGA 1HRHA 2QEXN 1SAZA 4WF9L 4CBWA 3PO5A 3RR8A 4JKEA 1RDAA 4PUOA 4KI4A 4LFAK 3O4QA 3O9RA 1RTHA 4IG3A 4E7KA 3VA3A 3NMUA 1JCFA 3O9SA 3MXMA 4BRCA 1NJXA 3J7YP 3NF8A 3U9DA 3CYMA 4IWVA 3AVIA 3L2QA 4BC5A 3J7ZO 1VHXA 3WNHA 4JS4A 3T3FA 3MN5A 1REVA 2DFFA 1U45A 3MN9A 3KK3A 3TAMA 1BO5O 5FRNA 3VEVA 3CI5A 3U6FA 3SQ1A 3QDKA 3OS0A 4FO0A 3HI0A 4RW4A 1Z6RA 4J2AA 2Z1GA 3DLRA 4WFBL 4FZYA 2XO7A 2YHXA 2P9NB 5AQLA 1VQ9N 3ENBA 1BIUA 1VQ4N 3QIOA 4DFMA 3EYZA 1RCHA 1T03A 5HROA 4FW2A 3T7ZA 3PY8A 4JI7K 1XNQK 3ZSVA 2QI2A 1HKBA 4FJNA 1Q82O 4FPBA 3SBTA 4DS5A 3C94A 4WYBA 3NAEA 4FK0A 4DR2K 3CCQN 1X3MA 2QA4N 4LF7K 2HBJA 1ZBSA 4H4OA 5BR9A 3CERA 4NCAA 3M1FA 2CGLA 3AVKA 1ZBUA 3SI6A 3O1WA 2WTUA 3WXJA 4DB3A 1ATNA 1BG3A 3I33A 3HVTA 1D8YA 3ZCMA 2WUSA 1K8AO 3E1YA 4KPYA 3EE8A 3IRXA 4M41A 1SKRA 3QINA 4BDPA 4LH4A 2KW4A 3HM8A 4CFCA 2GUPA 4MO4A 4HUFA 1Q9XA 3BF1A 4ZTJA 3KIOA 4DTUA 3SZ2A 2GEMA 3RR7A 4IOAL 5AFUH 1RT1A 3C6AA 1K73O 1B92A 1YVUA 5C2FA 4AHTA 1JKHA 2KQ2A 3HP9A 4BR7A 4DKWA 2UXDK 1C0GA 2PBDA 3CFOA 5CHIA 3DLBA 2A1RA 2Q31A 4DTOA 3MEGA 2I5JA 5J2QA 5C10A 1ASVA 3HOSA 3BZCA 4CERA 3BF3A 3V9UA 2IOCA 4H5RA 4Z4IA 1CXQA 1LV5A 1TGOA 4CJTA 1S9GA 2DTUA 4DTSA 3FZFA 3OTOK 4OGEA 4BY9C 2BTFA 4DG1A 2YHYA 2QM1A 3GDQA 4M3UA 4FJJA 3VESA 2D0AA 4YDUA 4ISEA 4DTJA 4QS8A 1NU0A 1QQNA 4XH4A 2KHOA 4OJRA 3WEEA 3B6PA 2HBLA 2DFHA 3L2UA 3SCXA 1MWMA 1TVRA 3UKRA 3PX4A 2P9UB 3U3GA 5IWAK 4BR2A 3VEZA 2E4LA 1GLFO 1HNZK 3MWTA 3ZX3A 3SYZA 5M1PA 1S6QA 3HRGA 3V1OA 3DLGA 3H45C 1RNHA 4KTZA 4N76A 3O9UA 1IBKK 4DSEA 1RDWX 4K25A 4KB0A 3AO2A 3UIQA 5C25A 2RN2A 1U2VA 4BG8A 3AVJA 4IEIA 2HNYA 4DCHA 4EFHA 3VQ6A 4JS5A 4Z4FA 3SUOA 4DSFA 5FPMA 3OA9A 3SV3A 3TSUA 4CZGA 1W9HA 4DLEA 3OJSA 5FLXO 3TPQA 4MLEA 4IBNA 4CD1A 2FF3B 2Q0UA 3CJ7A 3ZEUB 1BA0A 3DJCA 4NLCA 1DKGD 5KTQA 3EN9A 4F2RA 2F96A 1FJGK 1KQSM 4FLZA 3V6DA 3ID6A 2ZM6K 3CCRN 5JLFA 4DQQA 4Y0WA 3SUPA 1LAVA 3VERA 5KPRA 1HNWK 3S9HA 4M7XA 1D9FA 4H5WA 2PFUA 3V81A 3G4SN 3V1QA 1T3VA 3P38A 4CZKA 3SAGA 1VSFA 3PV8A 1IV0A 2QW9A 3WXMB 2O8FA 4JI1K 3V1RA 3GL1A 1WSEA 3LP1A 4PKGA 4FWRA 1W0HA 4B1ZA 1U47A 1ATSA 4FJLA 3L8BA 2P9KA 4ILHA 4Z4CA 4BQZA 1NWKA 1RTJA 5AQRA 4DV3K 1NGBA 2XRIA 4KHUA 3MEEA 1NJWA 3VQDA 1HYSA 4MDAA 1L3SA 1VSLA 5GIPA 3WUHA 3SJJA 3JXUA 2D5RA 1C0UA 3R8EA 4KHNA 4AQYK 3THVA 4B1XB 3IDHA 1BQMA 3CCLN 4EHUA 4XH5A 1ATRA 1DT9A 1DTQA 4CJFA 1U49A 1T6CA 1VSJA 3M8QA 1C0MA 1H1VA 2YHAA 3H6EA 1Z26A 4FJHA 4DTMA 4BWJA 2WC9A 4E1MA 1BQNA 4FVMA 2PYLA 1YIJN 1O13A 4BRNA 4FLTA 2HHSA 2GV9A 2FC0A 1FW6A 4PKIA 1RDBA 5AQXA 3MX2A 1EQYA 1SV5A 4ELVA 1SQKA 5C15A 4R5PA 2O8CB 3D0PA 3AY9A 5M1OA 4RW8A 1RDDA 4AF1A 1HUXA 4AHUA 2D1KA 4X64K 1OH8A 1Z05A 4FM1A 3PIOL 3RRGA 1SUQA 1P90A 3MMVA 4H8KA 4ISGA 2F9TA 4WE1A 4BE2A 4NXMK 1KAZA 1WSJA 2ZJRL 3P83D 5AQVA 4CHZA 4OKEA 3LDPA 2Z1IA 2QWPA 2ETJA 4FWNA 2FSNA 3IG1A 4H0OA 2I7NA 1YITN 4Q5VA 1K6YA 2UXBK 4E7JA 5J2NA 2PYJA 3OYGA 2QWRA 4LF4K 4JKFA 2P9SA 1WSGA 4GW6A 3NF6A 4Z94A 3QFUA 1WBBA
chains in the Genus database with same CATH topology
4JK7A 1X3NA 4PKHA 4WFNL 3TTDA 2NRWA 3KZBA 3I56N 1U2VB 4OPHA 1YAGA 1ZXOA 1JCGA 2DPNA 3A8YA 3KK7A 4CI6A 5C2DA 4RCHA 3M5RA 1TUYA 3AAQA 4B1VA 3KVGA 3C65A 3CIPA 3K9JA 4WQ4A 4BGAA 3HSCA 4RTFD 3WXIA 1QQMA 3K9KA 4M63C 2HF3A 2BH1A 5GAEP 1G99A 2P9SB 4BC3A 3GE1A 3MCPA 3OBWA 3QB0A 3SLCA 2NRZA 3VF2A 4BGBA 1VQLN 1J6ZA 2QTDA 4KH4A 1VQ5N 1HX1A 3EE9A 3ULEA 1ILYA 2NRTA 1HKGA 4IXCA 5CE3A 3CPEA 2NNWA 4IOXA 4IO9L 2CGJA 4H0TB 3FZLA 1BUPA 3E9LA 4NLBA 3VMFB 4FWOA 4BC4A 3F9MA 2ZGYA 2CH5A 2OTLN 3CCEN 4BRDA 3VOVA 4NB4A 3OW2M 3H3OB 3CC2N 4QS7A 1KC8O 3CMEN 3D2FA 3A5MC 1YF5L 3AAPA 3I8BA 2P9PA 1JCEA 5BPNA 2RHKA 3OHRA 2Q36A 4H0XB 3G6EN 5AQHA 1QZ6A 3ULEB 5EY4A 3IFRA 4E1JA 2AA4A 1S72N 4BREA 2YX6A 4FWPA 4JHDA 5F0XA 4HTLA 1OVYA 2W41A 5AQSA 3U8XA 5C0YA 5AQQA 3RVCA 4H0YB 3CCSN 3S41A 2CH6A 5GADP 2E1ZA 4JNEA 4KBOA 4FWQA 3ENHA 4YOYA 5AZJA 5EXWA 4CZJA 2P9PB 3HBTA 5AQUA 1EO1A 2QEXN 1SAZA 4WF9L 2VYPA 4CBWA 4DHYA 5AQWA 1VQON 4JKEA 4BROA 2ZGZA 4AM6A 3N4QA 4BRQA 4EAHD 3O9RA 3GBTA 2OANA 4JHDB 3ZX0A 3R3LA 3NMUA 2E2NA 3UB5A 1JCFA 3O9SA 3CC4N 3P4IA 1NGAA 4BRCA 3CCMN 2QWOA 1OKJA 3WQUA 1BWFO 3U9DA 4JKBA 4JEPA 4IWVA 1NLVA 4O8UA 5EVZA 3WT0A 4O8KA 1NJIO 3LDOA 4CBUA 4BC5A 2VCPA 4PL8A 5CR4A 3J7ZO 2ZWHA 1YHQN 1E4FT 2P9NA 3MN5A 4YORA 3E66A 3W0LA 3MN9A 1HJOA 3SMSA 3P31A 5C12A 1GLCG 4BRPA 5M1FA 3SAHA 1RFQA 1BO5O 4H03B 1VQ8N 3TU5A 3VEVA 2AP1A 1VQKN 3CI5A 4MDBA 3QDKA 4F9OA 1NGHA 4MO5A 5EX5A 1KXPA 1Q18A 2ZF5O 4FO0A 3EZWA 1W2BM 1Y64A 3HI0A 1HPMA 3H46O 4JKCA 3C0BA 5M1QA 3I55N 1Z6RA 1BOTO 3F5TA 1K8KB 5AQYA 4WFBL 2GX9A 5AQJA 3CMAN 4FPAA 3CJ1A 3E9PA 2YHXA 4C1NI 2YCHA 2F7TA 2P9NB 5AQLA 3VEOA 3C6HA 3O08A 4B1WB 3ENBA 3GG4A 3DXKA 3WXKA 2FLOA 1YI2N 3CJBA 2P9LB 1VQ4N 4WQ4C 3ZYYX 4EHTA 4IZ9A 1S22A 5AQTA 3VF4A 4KH6A 3T7ZA 1Q81O 4BRHA 2JWKA 2A5XA 3A5NC 2QI2A 1HKBA 3ZX2A 1GLEG 4OPAA 5GAGP 2HBKA 1Q82O 3IMXA 3CQYA 4ILJA 1YVNA 4FPBA 3SBTA 4BRIA 3CETA 1ZC6A 4H5VA 3MX5A 3CC7N 4WYBA 4A62A 2KLAA 2OTJN 3CD6N 3UKUA 4DQ8A 5JMVA 3L4IA 3QBXA 4K43A 2Q97A 2F9WA 3DXKB 4WQ5C 3LM9A 4BRMA 5DM6L 3CCQN 4UY8O 4R79A 2IIRA 4FOIA 1TYQA 1X3MA 4K42A 2QA4N 3H1VX 2GELA 3PIPL 2HBJA 3EKUA 1ZBSA 3F2KA 4CZEA 2FXUA 3FZMA 4BG9A 5BR9A 3CERA 5AFUA 5KQDA 3M1FA 5FPEA 2A6AA 3R1XA 1DGKN 1GLJO 2CGLA 1W97L 2E2QA 1MA9B 3VETA 4BRAA 5H1SQ 3BEXA 4JKHA 3O1WA 4GV6A 2ASPA 5EOYA 2E2PA 3MN6A 3WXJA 2A3ZA 3JS6A 4A2BA 3UKUB 4BVOA 2Q2RA 2ASOA 5AQFA 1ATNA 2VWBA 1BG3A 4DB3A 3I33A 3QMLA 1QVGM 1TYQB 5AQZA 2IVNA 5TKWA 4CD3A 2WUSA 4PHTX 3E1YA 1K8AO 3EE8A 4CZIA 3AARA 3Q7BA 4WQ5A 4A57A 1NGFA 5JLHA 3HM8A 5AQPA 1XC3A 2GUPA 4U7BA 1QVFM 5E26A 4MO4A 4H0VB 2NLXA 3E9OA 3BF1A 3U9ZA 1VQ6N 3VPZA 1KAYA 2E1YA 1XQSC 2GWKA 3G25A 3CJCA 3CCJN 1YJWN 2GEMA 3UE5A 4FL9A 2HBMA 3T69A 2HOEA 5AQIA 5AFUH 3C6AA 3M6GA 4JKGA 4A2AA 1K73O 4IOAL 5C2FA 1NGCA 1VQ7N 2A40A 3Q7CA 2NRRA 1JJ2M 1V4SA 2ZJPL 4BR7A 4XH1A 4DKWA 2IVOA 4B1UB 1C0GA 1T44A 2PBDA 4U67L 3CJ9A 4FWKA 5KPZA 3R9PA 3VEXA 5CHIA 5AZIA 5LY3A 3EO3A 4XEIA 2Q31A 3D2FB 3O5BA 4LC9B 3CJAA 5C10A 3HOSA 4JKGB 4NO7A 1VQNN 2NRVA 1CZAN 1SZ2A 4AM7A 1TUUA 5AQMA 3BF3A 3N4PA 2E8AA 4CJ7A 2QWMA 1NGEA 4FWSA 3O1BA 5ELZA 2J4RA 4H5RA 2E2OA 5KQ8A 2D0PA 2PAVA 1QZ5A 3TSQA 3EKSA 2UYTA 4HWIA 5AZIB 4FWMA 5GIOA 1V4TA 1YXQA 3FZFA 3SAFA 4BY9C 3QFPA 5AZJB 2ASMA 2P9UA 2BTFA 4BVPA 2QWQA 1Q86O 1BA1A 2YHYA 3LL3A 2QM1A 3GDQA 3U4LA 3O9QA 3CXCM 2WBNA 4I6MA 3VESA 4IJNA 4OO1J 3IKMA 3MN7A 5B8HA 4YDUA 4ISEA 1M90O 4QS8A 5BPMA 1QQNA 4XH4A 1GLAG 2KHOA 3SJHA 3KWIA 3WEEA 2HBLA 4QS9A 1XUPO 3CCUN 4GNIA 1MWMA 3UKRA 2P9UB 5AQNA 3CQXA 4BR2A 3VEZA 4A5AA 1GLFO 3WXLA 3LM2A 3H1QA 5MLCQ 3BUZB 3C7NA 1VAZA 3MWTA 3ZX3A 3FZKA 4I6MB 1NMDA 2HSTA 3QBWA 5E84A 3A5OC 4YOTA 5M1PA 4CZFA 4GV3A 3HRGA 3H45C 4IDHA 4BQLA 2EWSA 4G9ZA 4K41A 3O9UA 4CZMA 4JK8A 1WOQA 3VEWA 4BC2A 3CCVN 1RDWX 3D7EO 4K25A 2V52B 3ENOA 4L3QA 3A5LC 1HKCA 4JKDA 5BPLA 3QICA 1MDUB 4YOUA 5JVGL 2CGKA 2GTDA 5JICA 2FSJA 1U2VA 4BG8A 3ZEUA 4IEIA 4DCHA 4EFHA 3P39A 2HF4A 5AQGA 2D4WA 3VEYA 4B9QA 2VGMA 2NZTA 2H3GX 2A41A 4A5BA 3ATVA 5FPMA 3OA9A 3EL2A 3TSUA 1VQPN 2Q1NA 4IOCL 1HLUA 1E4GT 4CZGA 1P8ZA 1YJNN 5HOOA 3LDLA 5ADXH 3TPQA 2VGNA 3B8AX 4MLEA 4CD1A 1GLDG 3O6WA 2FF3B 2Q0UA 4BRGA 3LDNA 3CJ7A 3ZEUB 1BA0A 3DJCA 4NLCA 1DKGD 3EN9A 1KQSM 2W40A 4JN4A 4CBXA 1M1KO 2P9IA 3ID6A 3SBGA 1KAXA 4H5TA 3CPWM 3CCRN 2JWLA 2RE2A 5JLFA 1MWKA 4Y0WA 3TTFA 1Q7YO 1VQMN 3VERA 4PL7A 5KPRA 2E88A 3DXMA 4GY2B 4M7XA 4BR4A 5BRDA 4H5WA 1VQ9N 1NGJA 2PFUA 5LJVA 1WUAA 3CHWA 4FOEA 1T3VA 3P38A 3R6MA 3G4SN 4CZKA 3LDQA 4MLHA 3SAGA 1YJ9N 2IVPA 2QW9A 1C0FA 2QWLA 3M3ZA 4IJAA 1RDUA 5TKYA 3WXMB 4FWLA 4BR5A 3O80A 3SMPA 4WCEL 4BRKA 1KD1O 3VGLA 3GL1A 2P9IB 4PKGA 3ID8A 3RSEA 3ATUA 4FWRA 4B1ZA 3NVKA 3L0QA 1ATSA 2I7PA 1NGDA 2KKZA 3VGMA 3VF6A 3H3NO 2P9KA 4C1NK 4ILHA 3AGKA 3HOTA 1X9JA 4ILGB 4GVEA 4BQZA 3SK3A 5AQOA 1NWKA 5AQRA 4EIAA 2NRXA 1NGBA 3DXMB 3L6QA 4IO8A 1BDGA 4MDAA 3FLCO 1R59O 5GIPA 4YDUC 2Q0RA 4CZLA 3WUHA 3JXUA 3FR0A 3OBYA 5FPNA 1GLLO 3R8EA 4YOWA 3L4QA 4B1XB 3IUCA 4WFAL 3RSEB 3IDHA 4H5NA 3A0IX 3DAWA 2E20A 5F2RA 4BRLA 4EHUA 3CCLN 4H0PA 2WFBA 2P9KB 1U6ZA 4XH5A 1ATRA 1DT9A 2FF6A 5DM7L 1N8RO 4FVUA 1T6CA 3H6EA 4O5FA 1H1VA 1ESVA 4JKAA 3D2EA 1T6DA 4BR9A 5JVHL 2WC9A 2V7YA 3MCAB 3MDQA 4A59A 4BRFA 5AQKA 4C23A 5BRHA 4BR0A 1SS6A 1DEJA 1YUWA 2V7ZA 3ZETA 5BN8A 5M1NA 1LOTB 5I9EB 1D4XA 1RGIA 4YOXA 4J8FA 2NRHA 1O13A 4BRNA 1YIJN 1NM1A 4RWTA 2FSKA 1NBWA 3D6RA 3O8MA 4PKIA 2QWNA 5AQXA 4GV9A 3MX2A 1K9MO 3HTVA 3NVMA 1EQYA 3FGUA 2V51B 5BREA 1SQKA 3WQTA 5C15A 2A42A 2YHWA 1GLBG 3VGKA 3AY9A 4IEEA 3VTIA 4A61A 1K8KA 5M1OA 3J8AA 4AF1A 3D2EB 5F1XA 2YJEA 5GAHP 1HUXA 5FPDA 3TTCA 1QQOA 2D0OA 2D1KA 4JK9A 3ZETB 3G71N 5M1KA 5HL7L 2P9LA 2QXLA 5BN9A 1Z05A 2ITMA 4JD2A 3FZHA 4KH5A 3O9TA 3HZ6A 3FE1A 3PIOL 5LJWA 5ADXA 3PLAA 4YOVA 1P90A 3W3DA 3MMVA 3WEEB 3VENA 4B1YB 1IG8A 3BP8A 4ISGA 1IJJA 1S3XA 2F9TA 3KHYA 1KAZA 4CZHA 3TSPA 3UKRB 2ZJRL 4ISFA 5GINA 5AQVA 1NGIA 3LDPA 1LCUA 2ZJQL 3CF5L 3DLLL 2QWPA 5BRFA 2HMPA 5KPTA 4FWNA 2FSNA 3MK6A 1BU6O 1NGGA 3C7NB 4H0OA 2I7NA 1YITN 3KWGA 4JD2B 4IFEA 3FFKB 4JAXA 3DWLA 2BUPA 4FSVA 3GOIA 2GWJA 3MWPA 3O4WA 3VTHA 4M7YA 2QWRA 4JKFA 2YJFA 5AR0A 1QHAA 2P9SA 3AGRA 2YI1A 4Z94A 3QFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3N A;  4PKH A;  3KZB A;  1U2V B;  1YAG A;  1ZXO A;  1JCG A;  2DPN A;  3A8Y A;  4CI6 A;  4RCH A;  1TUY A;  3AAQ A;  4B1V A;  3KVG A;  3CIP A;  4WQ4 A;  4BGA A;  3HSC A;  4RTF D;  3WXI A;  1QQM A;  4M63 C;  2HF3 A;  1G99 A;  2P9S B;  4BC3 A;  3GE1 A;  3MCP A;  3QB0 A;  3SLC A;  3VF2 A;  4BGB A;  1J6Z A;  1HX1 A;  3ULE A;  4IXC A;  5CE3 A;  2CGJ A;  4H0T B;  3FZL A;  1BUP A;  4FWO A;  4BC4 A;  3F9M A;  2ZGY A;  2CH5 A;  4BRD A;  3VOV A;  4NB4 A;  3H3O B;  4QS7 A;  3D2F A;  3A5M C;  3AAP A;  3I8B A;  2P9P A;  1JCE A;  5BPN A;  3OHR A;  2Q36 A;  4H0X B;  5AQH A;  1QZ6 A;  3ULE B;  5EY4 A;  3IFR A;  4E1J A;  2AA4 A;  4BRE A;  4FWP A;  4JHD A;  5F0X A;  4HTL A;  2W41 A;  5AQS A;  3U8X A;  5AQQ A;  4H0Y B;  3S41 A;  2CH6 A;  2E1Z A;  4JNE A;  4KBO A;  4FWQ A;  3ENH A;  5AZJ A;  5EXW A;  4CZJ A;  2P9P B;  3HBT A;  5AQU A;  1SAZ A;  2VYP A;  4CBW A;  4DHY A;  5AQW A;  4BRO A;  2ZGZ A;  4AM6 A;  4BRQ A;  4EAH D;  3GBT A;  2OAN A;  4JHD B;  3ZX0 A;  2E2N A;  3UB5 A;  1JCF A;  3P4I A;  1NGA A;  4BRC A;  2QWO A;  1OKJ A;  3WQU A;  1BWF O;  3U9D A;  4IWV A;  1NLV A;  5EVZ A;  3WT0 A;  4O8K A;  3LDO A;  4CBU A;  4BC5 A;  2VCP A;  4PL8 A;  2ZWH A;  1E4F T;  2P9N A;  3MN5 A;  3W0L A;  3MN9 A;  1HJO A;  3SMS A;  1GLC G;  4BRP A;  1RFQ A;  1BO5 O;  4H03 B;  3TU5 A;  3VEV A;  2AP1 A;  3CI5 A;  3QDK A;  4F9O A;  1NGH A;  4MO5 A;  5EX5 A;  1KXP A;  1Q18 A;  2ZF5 O;  4FO0 A;  3EZW A;  1Y64 A;  3HI0 A;  1HPM A;  3H46 O;  3C0B A;  1Z6R A;  1BOT O;  1K8K B;  5AQY A;  5AQJ A;  4FPA A;  3CJ1 A;  2YHX A;  5BRE A;  2YCH A;  2P9N B;  5AQL A;  3VEO A;  3O08 A;  4B1W B;  3WXK A;  3GG4 A;  3DXK A;  2FLO A;  3CJB A;  2P9L B;  4WQ4 C;  4EHT A;  4IZ9 A;  1S22 A;  5AQT A;  3VF4 A;  4BRH A;  2A5X A;  3A5N C;  1HKB A;  3ZX2 A;  1GLE G;  3IMX A;  3CQY A;  4BRI A;  1YVN A;  4FPB A;  3CET A;  1ZC6 A;  4H5V A;  4WYB A;  4A62 A;  3UKU A;  4DQ8 A;  5JMV A;  3L4I A;  3QBX A;  4K43 A;  2Q97 A;  2F9W A;  3DXK B;  4WQ5 C;  3LM9 A;  4BRM A;  2IIR A;  4FOI A;  1TYQ A;  1X3M A;  4K42 A;  3H1V X;  2GEL A;  3EKU A;  1ZBS A;  4CZE A;  2FXU A;  3FZM A;  4BG9 A;  5BR9 A;  3CER A;  5AFU A;  5KQD A;  3M1F A;  5FPE A;  2A6A A;  1DGK N;  1GLJ O;  2CGL A;  3VET A;  2E2Q A;  1MA9 B;  4BRA A;  3BEX A;  3O1W A;  2ASP A;  5EOY A;  2E2P A;  3MN6 A;  3WXJ A;  2A3Z A;  3JS6 A;  4A2B A;  3UKU B;  4BVO A;  2Q2R A;  2ASO A;  5AQF A;  1ATN A;  2VWB A;  1BG3 A;  4DB3 A;  3I33 A;  3QML A;  1TYQ B;  5AQZ A;  2IVN A;  4CD3 A;  2WUS A;  4CZI A;  3AAR A;  4WQ5 A;  1NGF A;  5JLH A;  3HM8 A;  5AQP A;  1XC3 A;  2GUP A;  5E26 A;  4MO4 A;  4H0V B;  2NLX A;  3BF1 A;  3U9Z A;  3VPZ A;  1KAY A;  2E1Y A;  1XQS C;  2GWK A;  3G25 A;  3CJC A;  2GEM A;  3UE5 A;  4FL9 A;  2HOE A;  5AQI A;  5AFU H;  4A2A A;  3M6G A;  1NGC A;  2A40 A;  1V4S A;  4BR7 A;  4XH1 A;  2IVO A;  4B1U B;  1C0G A;  1T44 A;  2PBD A;  3CJ9 A;  4FWK A;  5KPZ A;  3R9P A;  3VEX A;  5AZI A;  5LY3 A;  3EO3 A;  4XEI A;  2Q31 A;  3D2F B;  3O5B A;  4LC9 B;  3CJA A;  4NO7 A;  1CZA N;  1SZ2 A;  4AM7 A;  1TUU A;  5AQM A;  3BF3 A;  2E8A A;  4CJ7 A;  2QWM A;  1NGE A;  4FWS A;  3O1B A;  5ELZ A;  2J4R A;  4H5R A;  2E2O A;  5KQ8 A;  2D0P A;  2PAV A;  1QZ5 A;  3EKS A;  2UYT A;  4HWI A;  5AZI B;  4FWM A;  1V4T A;  1YXQ A;  3FZF A;  3QFP A;  5AZJ B;  2ASM A;  2P9U A;  2BTF A;  4BVP A;  2QWQ A;  1BA1 A;  2YHY A;  3LL3 A;  2QM1 A;  3GDQ A;  3U4L A;  4I6M A;  3VES A;  4IJN A;  3MN7 A;  5B8H A;  4YDU A;  4ISE A;  4QS8 A;  5BPM A;  1QQN A;  4XH4 A;  1GLA G;  2KHO A;  3SJH A;  3WEE A;  4QS9 A;  1XUP O;  4GNI A;  1MWM A;  3UKR A;  2P9U B;  5AQN A;  3CQX A;  4BR2 A;  3VEZ A;  1GLF O;  3WXL A;  3LM2 A;  3H1Q A;  3BUZ B;  3C7N A;  3ZX3 A;  3FZK A;  4I6M B;  1NMD A;  3QBW A;  5E84 A;  3A5O C;  4CZF A;  3H45 C;  4BQL A;  2EWS A;  4K41 A;  4CZM A;  1WOQ A;  3VEW A;  4BC2 A;  1RDW X;  3D7E O;  4K25 A;  2V52 B;  3ENO A;  4L3Q A;  3A5L C;  1HKC A;  5BPL A;  3QIC A;  1MDU B;  2CGK A;  2GTD A;  5JIC A;  2FSJ A;  1U2V A;  4BG8 A;  3ZEU A;  4DCH A;  4EFH A;  2HF4 A;  5AQG A;  2D4W A;  3VEY A;  4B9Q A;  2NZT A;  2H3G X;  2A41 A;  3ATV A;  5FPM A;  3EL2 A;  2Q1N A;  1HLU A;  1E4G T;  4CZG A;  1P8Z A;  3LDL A;  5ADX H;  3TPQ A;  3B8A X;  4MLE A;  4CD1 A;  1GLD G;  3O6W A;  2FF3 B;  2Q0U A;  4BRG A;  3LDN A;  3CJ7 A;  3ZEU B;  1BA0 A;  3DJC A;  1DKG D;  3EN9 A;  2W40 A;  4JN4 A;  4CBX A;  2P9I A;  1KAX A;  4H5T A;  5JLF A;  1MWK A;  4Y0W A;  3VER A;  4PL7 A;  5KPR A;  2E88 A;  3DXM A;  4GY2 B;  4M7X A;  4BR4 A;  5BRD A;  4H5W A;  1NGJ A;  5LJV A;  1WUA A;  3CHW A;  4FOE A;  3R6M A;  4CZK A;  3LDQ A;  4MLH A;  2IVP A;  2QW9 A;  1C0F A;  2QWL A;  3M3Z A;  4IJA A;  5TKY A;  4BR5 A;  4FWL A;  3O80 A;  3SMP A;  4BRK A;  3VGL A;  3GL1 A;  2P9I B;  4PKG A;  3ID8 A;  3RSE A;  3ATU A;  4FWR A;  4B1Z A;  3L0Q A;  1ATS A;  2I7P A;  1NGD A;  3VGM A;  3VF6 A;  3H3N O;  2P9K A;  1X9J A;  4EIA A;  4BQZ A;  3SK3 A;  5AQO A;  1NWK A;  5AQR A;  1NGB A;  3DXM B;  3L6Q A;  4IO8 A;  1BDG A;  3FLC O;  1R59 O;  4YDU C;  2Q0R A;  4CZL A;  3WUH A;  3JXU A;  3FR0 A;  5FPN A;  1GLL O;  3R8E A;  4B1X B;  3IUC A;  3RSE B;  3IDH A;  4H5N A;  3A0I X;  3DAW A;  2E20 A;  5F2R A;  4BRL A;  4EHU A;  4H0P A;  4XH5 A;  2P9K B;  1U6Z A;  1ATR A;  2FF6 A;  1T6C A;  3H6E A;  4O5F A;  1H1V A;  1ESV A;  3D2E A;  1T6D A;  4BR9 A;  3MDQ A;  2V7Y A;  4BRF A;  5AQK A;  4C23 A;  5BRH A;  4BR0 A;  1DEJ A;  1YUW A;  2V7Z A;  3ZET A;  5BN8 A;  1LOT B;  5I9E B;  1D4X A;  1RGI A;  4J8F A;  2NRH A;  4BRN A;  1NM1 A;  4RWT A;  2FSK A;  1NBW A;  3O8M A;  4PKI A;  2QWN A;  5AQX A;  3HTV A;  1EQY A;  3FGU A;  2V51 B;  1SQK A;  3WQT A;  2A42 A;  2YHW A;  1GLB G;  3VGK A;  3AY9 A;  4A61 A;  1K8K A;  3J8A A;  3D2E B;  5F1X A;  2YJE A;  1HUX A;  5FPD A;  1QQO A;  2D0O A;  2D1K A;  3ZET B;  2P9L A;  2QXL A;  5BN9 A;  1Z05 A;  2ITM A;  4JD2 A;  3FZH A;  3HZ6 A;  3FE1 A;  5LJW A;  5ADX A;  3W3D A;  3MMV A;  3WEE B;  3VEN A;  4B1Y B;  1IG8 A;  3BP8 A;  4ISG A;  1IJJ A;  1S3X A;  2F9T A;  3KHY A;  1KAZ A;  4CZH A;  3UKR B;  4ISF A;  5AQV A;  1NGI A;  3LDP A;  1LCU A;  2QWP A;  5BRF A;  2HMP A;  5KPT A;  4FWN A;  2FSN A;  3MK6 A;  1BU6 O;  1NGG A;  3C7N B;  4H0O A;  2I7N A;  4JD2 B;  3FFK B;  4JAX A;  3DWL A;  2BUP A;  4FSV A;  3GOI A;  2GWJ A;  3O4W A;  4M7Y A;  2QWR A;  2YJF A;  5AR0 A;  1QHA A;  2P9S A;  1HKG A;  2YI1 A;  4Z94 A;  3QFU A; 
#chains in the Genus database with same CATH topology
 3JSM A;  4PKH A;  3TTD A;  1JLB A;  1XI1 A;  2NRW A;  2VQF K;  3B6O A;  3KZB A;  4C8O A;  3QIP A;  1YAG A;  1JCG A;  2DPN A;  3KK7 A;  1L3T A;  4CEZ A;  3OYI A;  4GKK K;  4B1V A;  3KVG A;  3C65 A;  3CIP A;  3K9J A;  3HSC A;  1RT4 A;  3K9K A;  2FBX A;  4M63 C;  5GAE P;  4BC3 A;  3OBW A;  4ZTF A;  2NRZ A;  4AH9 A;  4DV7 K;  2UXC K;  4DTP A;  3EE9 A;  3ULE A;  4DQS A;  4AHC A;  4IXC A;  5EU7 A;  1X9M A;  4IOX A;  4FJ8 A;  3NF9 A;  2R7Y A;  4NLB A;  3E9L A;  3VMF B;  1VRT A;  4FWO A;  2ZGY A;  3KLF A;  3CCE N;  3OS1 A;  3SQ2 A;  3OW2 M;  1ASW A;  4KRE A;  4QS7 A;  1NJZ A;  4OKJ A;  2O4I A;  3P1G A;  3OHR A;  3IFR A;  3K5O A;  2AA4 A;  4E1J A;  3NHG A;  4OX9 K;  4BRE A;  2YX6 A;  4HTL A;  2W41 A;  5C0Y A;  4B9T A;  1C6V A;  4GKJ K;  3RVC A;  5HRP A;  2HHV A;  4OPJ A;  5GAD P;  4M3Z A;  4LF6 K;  3DOK A;  4OLA A;  3HBT A;  4FZZ A;  1EO1 A;  2VYP A;  5AQW A;  3CM6 A;  3OYF A;  3OJU A;  4DR1 K;  2ZGZ A;  2X78 A;  4BRQ A;  4EAH D;  3F9K A;  4I9L A;  4JHD B;  3D45 A;  3ZX0 A;  3R3L A;  3KLI A;  3DLH A;  3QEX A;  3WQU A;  1BWF O;  4JKB A;  4F4K A;  3TAQ A;  3WT0 A;  2YKM A;  1NJI O;  4FLU A;  4CBU A;  4YFU A;  4Z0U A;  1E4F T;  4E1N A;  1ZBF A;  3J81 O;  1HJO A;  5C12 A;  4HUE A;  5M1F A;  3EZ5 A;  4QCL A;  4H03 B;  1KRP A;  3LWL A;  2AP1 A;  3VQA A;  2YNF A;  4B3O A;  4B9M A;  4JKC A;  3AVC A;  1BOT O;  2IDO A;  3DYA A;  2GX9 A;  5AQJ A;  5BRE A;  2YCH A;  3QEW A;  3O08 A;  3GG4 A;  2FLO A;  3CJB A;  4WQ4 C;  1KVA A;  3KLG A;  3ZYY X;  3NGZ A;  4EHT A;  1HMV A;  5LMN K;  5HLF A;  1ZBI A;  4CEB A;  4M45 A;  3ZX2 A;  5GAG P;  2O4G A;  1IKX A;  3CET A;  2G8U A;  3L3U A;  2KLA A;  2E5L K;  3DMJ A;  3L4I A;  4K43 A;  3DXK B;  4WQ5 C;  3LM9 A;  3QNO A;  3ZSX A;  1NK7 A;  2WON A;  1TYQ A;  1TKT A;  4DV2 K;  4B9U A;  1T05 A;  1NG9 A;  4CZE A;  2FXU A;  1F21 A;  3KD5 E;  4BG9 A;  2UUB K;  1VSE A;  4W5T A;  4JI5 K;  2OPQ A;  4M3R A;  5FPE A;  2A6A A;  3CD6 N;  1GLJ O;  1W97 L;  2E2Q A;  5H1S Q;  4KB1 A;  3BEX A;  2O8D A;  4JKH A;  4GV6 A;  4JI3 K;  2ZE2 A;  2ASP A;  2PZS A;  5EOY A;  2E6M A;  3THW A;  2IS3 A;  3UKU B;  2Q2R A;  4DV6 K;  4FJ9 A;  2BAN A;  3QML A;  5T7B A;  1SKS A;  5AQZ A;  1EX4 A;  4WQ5 A;  1NGF A;  2BDP A;  2X6N A;  4E7I A;  1XC3 A;  5E26 A;  4CJU A;  3OYJ A;  1VQ6 N;  3VPZ A;  4DUZ K;  3ZT3 A;  1KAY A;  3WNG A;  2GWK A;  3TR8 A;  4DR3 K;  3Q7C A;  1R0A A;  5AJ3 K;  2ZJP L;  4BDZ A;  3KTQ A;  4B1U B;  3ULD A;  4CHN A;  3VQQ A;  4N56 A;  4MFB A;  3R9P A;  3VEX A;  2IGI A;  5AZI A;  5LY3 A;  1IKW A;  1L3U A;  4C8N A;  3DM2 A;  2QKB A;  4X65 K;  1QHT A;  2G8I A;  3LZJ A;  4JI0 K;  4LC9 B;  2HB5 A;  4KFB A;  3CJA A;  4JKG B;  4NO7 A;  1KFS A;  3L2V A;  1B9F A;  4CJL A;  3N4P A;  3O1B A;  4FLW A;  4Z4E A;  3HT3 A;  2EHG A;  1RT7 A;  4LD0 A;  1BGX T;  2O8C A;  2UYT A;  1CZB A;  3SAF A;  3THX B;  1D9D A;  3U3Y A;  1Q86 O;  1BA1 A;  1XMQ K;  3U4L A;  3OYN A;  2WBN A;  1NK8 A;  4IJN A;  3KKR A;  5B8H A;  1RBV A;  4LSN A;  4CJQ A;  5HBM A;  4I9Q A;  1S1T A;  3QEP A;  3PSF A;  5FRM A;  4A5A A;  3K57 A;  1WLJ A;  1HNX K;  3H1Q A;  2FBY A;  5C42 A;  2YNH A;  3FZK A;  4I6M B;  5E84 A;  2RF2 A;  3A5O C;  4CZF A;  4GV3 A;  4DSK A;  4JI8 K;  1TL1 A;  4K41 A;  4CES A;  4JK8 A;  2JGU A;  3AVM A;  1WOQ A;  3PO4 A;  2F8S A;  4JKD A;  2XY7 A;  4CGJ A;  1CLQ A;  5J2M A;  3T1H K;  2CGK A;  2HW3 A;  4IFY A;  3SPZ A;  2LSN A;  2HF4 A;  2D4W A;  3OYM A;  1CZ9 A;  2YKN A;  5LMU K;  2A41 A;  2G8V A;  3NH2 A;  1HYV A;  3HP6 A;  1VQP N;  5I3U A;  1HR0 K;  3VA0 A;  4DFK A;  3O3F A;  2UUC K;  1RBT A;  4CGH A;  5CYQ A;  4K8X A;  3MXI A;  4CJ3 A;  2JWL A;  1N5Y A;  1MWK A;  5SZT A;  1Q7Y O;  1VQM N;  2OPS A;  3OYL A;  4KHS A;  4PL7 A;  4DSI A;  1S1V A;  2E88 A;  4BR4 A;  3PX6 A;  1NGJ A;  1WUA A;  3DI6 A;  4MLH A;  1YJ9 N;  1XNR K;  1FKO A;  4DF8 A;  3K5L A;  3M3Z A;  1C0F A;  4IJA A;  4BR5 A;  3DRP A;  4BRK A;  2NUB A;  2P9I B;  3ID8 A;  3RSE A;  2G8K A;  3HL8 A;  1RBS A;  3L0Q A;  1QTM A;  1NGD A;  3VGM A;  4C1N K;  2W6K A;  1X9J A;  3HPH A;  4ILG B;  4EIA A;  1L5U A;  5AQO A;  1UA1 A;  5SWM A;  4HTU A;  3DXM B;  1BDG A;  4JI2 K;  1D5A A;  3FLC O;  1R59 O;  4YDU C;  4CZL A;  3FR0 A;  4YOW A;  3NCI A;  3L2W A;  2Z1J A;  4ID1 A;  4H5N A;  2P5G A;  3DAW A;  4JLH A;  2X6S A;  1EET A;  4FJX A;  4H0P A;  3DRS A;  2FF6 A;  1TK0 A;  4O5F A;  2Y1I A;  1ESV A;  2Z1H A;  3D2E A;  5JVH L;  3MDQ A;  4NYN A;  4CK2 A;  1SS6 A;  3L3V A;  1YUW A;  2V7Z A;  3ZET A;  5BN8 A;  2YNI A;  5HRR A;  3TAR A;  2HVH A;  4Z4H A;  4GV9 A;  4CIG A;  3HTV A;  3NVM A;  4HUG A;  2B5J A;  3WQT A;  1GLB G;  4A61 A;  4DQP A;  5FPD A;  4CK3 A;  2D0O A;  3PX0 A;  3AVG A;  4QOZ B;  2OZS A;  5M1K A;  4CHP A;  1BCO A;  2QXF A;  2QXL A;  2ITM A;  3PUF A;  4ID5 A;  3ZSO A;  3C95 A;  1E3M A;  3PLA A;  5ADX A;  4YOV A;  4O0J A;  4EP5 A;  5I42 A;  3VEN A;  4C8K A;  4F8R A;  4CJS A;  3BP8 A;  4BDY A;  1I39 A;  1S3X A;  3KHY A;  2OZM A;  3THY A;  3OYC A;  3A2F A;  3LP3 A;  2ZJQ L;  3CF5 L;  5BRF A;  2HMP A;  5KPT A;  1HPZ A;  2HHX A;  1BU6 O;  3C7N B;  4B3M K;  3AA3 A;  3KWG A;  4JD2 B;  4IFE A;  3TAG A;  4JAX A;  3DWL A;  2BUP A;  5CYM A;  3LP0 A;  4FSV A;  3VTH A;  4CW7 B;  1QHA A;  1TV6 A;  3DOL A;  4FYD A;  1X3N A;  4JI6 K;  1VSI A;  4DV1 K;  4KTW A;  2KFN A;  3QET A;  4CEO A;  4CF8 A;  3VQP A;  1C0T A;  4OPH A;  3OS2 A;  4M3Y A;  4RCH A;  4Z4G A;  3AAQ A;  3AV9 A;  2Q3S A;  3LDS A;  4RTF D;  1RBR A;  1XWL A;  3K58 A;  1HNI A;  4B08 A;  3OYH A;  3GE1 A;  4OPK A;  4BGB A;  4KH4 A;  1HX1 A;  3CQ8 A;  1EKE A;  1QQC A;  3NDK A;  2NRT A;  5CE3 A;  4IO9 L;  3AA4 A;  1BUP A;  1VRU A;  4AHS A;  4DV4 K;  4PA1 A;  4CVN E;  3M8S A;  4NB4 A;  3CME N;  1MU2 A;  4KHQ A;  1EWR A;  1YF5 L;  1JCE A;  5BPN A;  2RHK A;  4H0X B;  3G6E N;  4DSL A;  4CGI A;  4KO0 A;  3LP2 A;  1O1W A;  2RPI A;  4I2Q A;  4MQ3 A;  4HCC A;  1EWQ A;  3KJV A;  1OVY A;  5AQS A;  4H0Y B;  3CCS N;  2W42 A;  4DF4 A;  2E1Z A;  3ENH A;  4YOY A;  5KRS A;  2P9P B;  3PSI A;  4DHY A;  1VQO N;  3AO4 A;  3S3O A;  2B4J A;  3GBT A;  1GOA A;  3V9W A;  5IT9 O;  4LSL A;  3UB5 A;  3CC4 N;  4FK2 A;  3P4I A;  1NGA A;  2YV0 X;  1OKJ A;  1YTU A;  3T1Y K;  1NLV A;  2IC3 A;  4CFA A;  1Q8I A;  4PWD A;  1WAJ A;  3LDO A;  3VQE A;  4JYA K;  1SL1 A;  4RW7 A;  4PL8 A;  2ZWH A;  1YHQ N;  2P9N A;  3BDP A;  3F73 A;  3ZSZ A;  3P31 A;  1GLC G;  4BRP A;  3SAH A;  1RFQ A;  3AA2 A;  3ZT0 A;  3TU5 A;  2A1S A;  3J7A P;  4F9O A;  4MO5 A;  5EX5 A;  1KXP A;  2ZF5 O;  4E3S A;  3EZW A;  1JL2 A;  3C0B A;  5M1Q A;  3F5T A;  4CFB A;  1K8K B;  5AQY A;  2OCE A;  1WSH A;  4FPA A;  1FK9 A;  2GBZ A;  3E9P A;  1IBM K;  2F7T A;  3VEO A;  4B1W B;  3C6H A;  4FJ5 A;  4KHP K;  1ZYQ A;  4IZ9 A;  4KH6 A;  1Q81 O;  2ITG A;  2JWK A;  2HHT A;  1GLE G;  2HBK A;  3CQY A;  4ILJ A;  1YVN A;  2X74 A;  4H5V A;  4YNQ A;  3CC7 N;  3DLK A;  2OTJ N;  3QBX A;  2Q97 A;  1NK5 A;  4CHY A;  4FOI A;  1WAF A;  4K42 A;  2GEL A;  3F2K A;  3FZM A;  1QSL A;  5AFU A;  5KQD A;  4DMN A;  4BRA A;  4DTN A;  3VET A;  1MA9 B;  3NH1 A;  4F2S A;  2E2P A;  1YT3 A;  3MN6 A;  2A3Z A;  3JS6 A;  4BVO A;  4F3O A;  2ASO A;  5AQF A;  1B9D A;  3AO3 A;  4CD3 A;  4PHT X;  4YY3 K;  4CZI A;  3V9S A;  4A57 A;  2HHW A;  1RT6 A;  5AQP A;  4U7B A;  1J53 A;  1QVF M;  1LWF A;  2OYQ A;  4H0V B;  2NLX A;  1NK9 A;  3U9Z A;  2E1Y A;  3G25 A;  3CJC A;  1OH7 A;  5JS2 A;  3T69 A;  3TI0 A;  2HOE A;  3S3N A;  4A2A A;  3RTV A;  1NGC A;  4JRQ A;  2A40 A;  3QEI A;  1JJ2 M;  3EEQ A;  1V4S A;  3HPO A;  2IVO A;  4FZX C;  1T44 A;  4OVL A;  4U67 L;  3CJ9 A;  1NK4 A;  4FWK A;  3EO3 A;  3NGI A;  1GOB A;  1VSH A;  4W5O A;  3O5B A;  4OKK A;  3V9X A;  3QNN A;  1VQN N;  1SZ2 A;  2E6L A;  4AM7 A;  5AQM A;  2QWM A;  2P5O A;  1NGE A;  4FWS A;  5ELZ A;  3HO1 A;  3IAY A;  4JRP A;  5KQ8 A;  1JXE A;  3O3G A;  1BHL A;  2D0P A;  2PAV A;  3TSQ A;  1QZ5 A;  4CJE A;  1V4T A;  3NF7 A;  2Y1J A;  4M3X A;  3DLE A;  5AZJ B;  3RMB A;  2ASM A;  2P9U A;  2QWQ A;  3CXC M;  5HRN A;  3NGY A;  3IKM A;  3MN7 A;  1M90 O;  3ALY A;  4KHW A;  3FFI A;  4M42 A;  1GLA G;  1BL3 A;  3KWI A;  4W5Q A;  4GNI A;  3NBP A;  4CJ4 A;  1UAX A;  3WXL A;  5MLC Q;  3C7N A;  1VAZ A;  4YOT A;  5CY4 A;  2HST A;  4CGF A;  4L8R B;  4BQL A;  4CZM A;  4CF1 A;  3VEW A;  1N32 K;  3CCV N;  2V52 B;  3HM9 A;  4L3Q A;  3A5L C;  1N6Q A;  2XHB A;  1LAW A;  4YOU A;  4C8L A;  2GTD A;  4RW6 A;  2FSJ A;  3ZEU A;  4CJW A;  1JLE A;  4BWM A;  1U4B A;  4X66 K;  5AQG A;  3VEY A;  2VGM A;  3OVN A;  2NZT A;  2KFZ A;  3OYA A;  3ATV A;  4J2B A;  2Q1N A;  1HLU A;  1E4G T;  4AIL C;  3KLE A;  4LH5 A;  5ADX H;  4XIU A;  3LPT A;  2VGN A;  1GLD G;  4BRG A;  4CE9 A;  1JXB A;  1JL1 A;  1ZBH A;  1LWE A;  4V19 S;  2W40 A;  5C24 A;  4JN4 A;  3O3H A;  1NJY A;  3SBG A;  1KAX A;  4O55 A;  4B9L A;  1S6P A;  5BR8 K;  3LAK A;  3HYF A;  3V4I A;  3KLH A;  3RMA A;  3LAL A;  4AHV A;  5BRD A;  3VQ9 A;  4EZ6 A;  5LJV A;  3TWH A;  3CHW A;  2HHU A;  2IVP A;  3AVL A;  1QE1 A;  2QWL A;  5TKY A;  1RDU A;  4E0D A;  2VWJ A;  3SMP A;  1HQU A;  3LPU A;  3TAE A;  4DFJ A;  3BY5 A;  4NXN K;  2AJQ A;  1RT3 A;  3ATU A;  3VF6 A;  3H3N O;  3HOT A;  3VQ7 A;  1A5W A;  3KD1 E;  1WSF A;  3C6T A;  1T8E A;  1C1B A;  4RG8 A;  3WNF A;  4X62 K;  3AVB A;  4DQR A;  2Q0R A;  5FPN A;  3OBY A;  2F8T A;  1GLL O;  3RMD A;  2O8F B;  3L4Q A;  2HHH K;  2P1J A;  5K14 A;  4Q0B A;  3A0I X;  2E20 A;  2P9K B;  4FVU A;  1GOC A;  3HXM A;  4BR9 A;  3TAB A;  2V7Y A;  3MCA B;  4A59 A;  4BRF A;  1TAQ A;  4EZ9 A;  2YHB A;  5BRH A;  4GMJ B;  4BR0 A;  4DS4 A;  1JLA A;  1LOT B;  1D4X A;  1RGI A;  4YOX A;  4J8F A;  1NM1 A;  2IAJ A;  2FSK A;  3RWU A;  1NBW A;  3D6R A;  3O8M A;  2QWN A;  1K9M O;  3FGU A;  2V51 B;  3SUN A;  2A42 A;  2YHW A;  3VGK A;  4PY5 A;  4IEE A;  3VTI A;  1K8K A;  2OPR A;  1YTA A;  5F1X A;  5GAH P;  1QQO A;  3G71 N;  4IFV A;  4CIE A;  4B9V A;  3HZ6 A;  2BGG A;  1KLM A;  4FLX A;  5LJW A;  1NKE A;  4N47 A;  4CEF A;  4B1Y B;  3ZLJ A;  1LW0 A;  4KRF A;  1IJJ A;  3OY9 A;  4CJK A;  5J1E A;  3DRR A;  4HHT A;  4BE1 A;  1LCU A;  1NKC A;  3MK6 A;  3LAM A;  3K5M A;  1NGG A;  1Q9Y A;  3TAN A;  2OA8 A;  2VWK A;  3GOI A;  4B9S A;  3MWP A;  1W7A A;  4M7Y A;  1IO2 A;  4FM0 A;  3OYD A;  2YJF A;  3AGR A;  2YI1 A;  1XMO K;  3SUQ A;  1S1X A;  4WFN L;  1VK0 A;  4LF5 K;  4B8A B;  2QKK A;  2FBT A;  3KK2 A;  1ZXO A;  1WN7 A;  4CI6 A;  1S1U A;  5C2D A;  3M5R A;  1TUY A;  4CGD A;  4BGA A;  3WXI A;  1HJR A;  1QQM A;  1C1C A;  2BH1 A;  3SPY A;  2P9S B;  4ZHR A;  3KK1 A;  2B6A A;  4NCB A;  3BZK A;  2O8B B;  3VF2 A;  1VQL N;  1J6Z A;  3AVN A;  3AO5 A;  4CGG A;  3L2R A;  1BI4 B;  3ZT1 A;  2NNW A;  2CGJ A;  4H0T B;  4N41 A;  3FZL A;  1OH5 A;  1S5J A;  1S9E A;  1KVC A;  3HJF A;  3F9M A;  4N5S A;  3CC2 N;  3QES A;  1KC8 O;  3AAP A;  1DTT A;  3VN5 A;  4ICL A;  5KRT A;  3SV4 A;  2Q36 A;  1QZ6 A;  3VQC A;  3ULE B;  1S72 N;  1DLO A;  4KAZ A;  4JHD A;  4F3T A;  3M8P A;  4CEE A;  5DK5 A;  2HNZ A;  1UWB A;  4FWQ A;  4B3T K;  3RMC A;  5AZJ A;  2D0C A;  5EXW A;  4CZJ A;  4YHH K;  5AQU A;  3AO1 A;  1KCF A;  1RTI A;  4BRO A;  4AM6 A;  1JLQ A;  3N4Q A;  2OAN A;  4CJP A;  2E2N A;  3CM5 A;  4O0I A;  4M3W A;  3T1A A;  3CCM N;  2QWO A;  4DR5 K;  2G8H A;  4JEP A;  2VG5 A;  4O8U A;  1NK0 A;  1Y97 A;  2PY5 A;  5EVZ A;  4LF9 K;  4O8K A;  2VG7 A;  4CF2 A;  2XY6 A;  4ELT A;  4DQI A;  2VCP A;  4IG0 A;  4TSX A;  5CR4 A;  3HVR A;  4YOR A;  3E66 A;  3W0L A;  4IKF A;  4UQG A;  3SMS A;  3MEC A;  1VQ8 N;  2UUA K;  3VQ4 A;  1VQK N;  3OYE A;  4DR6 K;  2ZD1 A;  1SL2 A;  4MDB A;  1NGH A;  1X9W A;  1Q18 A;  1W2B M;  1Y64 A;  1HPM A;  3H46 O;  3I55 N;  4BAC A;  5A2Q O;  4LFC K;  5D3G A;  3CMA N;  3CFP A;  3CJ1 A;  4C1N I;  4B3S K;  1YI2 N;  3WXK A;  3DXK A;  2P9L B;  4QAG A;  4KKO A;  1S22 A;  2ATQ A;  5AQT A;  2EX3 A;  3VF4 A;  3M8R A;  2O8E B;  1I94 K;  4BRH A;  4FJK A;  2A5X A;  3A5N C;  3I0S A;  1G15 A;  4OPA A;  1T7P A;  4FLY A;  3IMX A;  4BRI A;  1ZC6 A;  3MX5 A;  4A62 A;  4O4G A;  3UKU A;  4DQ8 A;  4E19 A;  5JMV A;  1RIL A;  4BRM A;  3I8D A;  2F9W A;  1NNE A;  4UY8 O;  5DM6 L;  4R79 A;  2IIR A;  3H1V X;  5CZ1 A;  3PIP L;  3EKU A;  4KV8 A;  3RRH A;  3CG7 A;  4FW1 A;  3R1X A;  1DGK N;  4CHQ A;  1ZBL A;  4K8Z A;  4OLB A;  1OVQ A;  4GVM A;  4A2B A;  1RDC A;  4J2D A;  3ZSY A;  2VWB A;  4IDK A;  3E01 A;  1J5E K;  1QVG M;  1TYQ B;  2IVN A;  5TKW A;  3AAR A;  3Q7B A;  4J2E A;  1FXX A;  4LFB K;  1IKV A;  5JLH A;  1XHZ A;  3LZI A;  3E9O A;  4CJ5 A;  5KGW A;  4CEQ A;  2O8D B;  1XQS C;  4C8M A;  3CCJ N;  1X1P A;  1YJW N;  3UE5 A;  4FL9 A;  2HBM A;  5AQI A;  3THW B;  4JKG A;  3M6G A;  1VQ7 N;  2NRR A;  3K2P A;  1QSS A;  3IS9 A;  4CFD A;  1XC9 A;  1IKY A;  4XH1 A;  4CCH A;  4W5N A;  2KZZ A;  5KPZ A;  1ASU A;  4H4M A;  4XEI A;  4CED A;  3CFR A;  3QLH A;  1JLC A;  2DY4 A;  3THX A;  3D2F B;  1C1A A;  1XHX A;  3H08 A;  5FRO A;  3WNE A;  2NRV A;  1CZA N;  3MAQ A;  1UOC A;  1TUU A;  2DFE A;  4EP4 A;  3NH0 A;  2E8A A;  4CJ7 A;  2J4R A;  2E2O A;  4CF9 A;  4B3R K;  4DU1 A;  1KSP A;  1X9S A;  4E7H A;  5GIO A;  3EKS A;  4HWI A;  5AZI B;  4FWM A;  1YXQ A;  3QFP A;  4DU4 A;  4BVP A;  4FJ7 A;  3LL3 A;  4BE0 A;  3AVA A;  3O9Q A;  1U48 A;  3ZT2 A;  4I6M A;  4LF8 K;  2UU9 K;  4OO1 J;  1U04 A;  1UA0 A;  3TAF A;  5BPM A;  4CJV A;  4NCG A;  1J5O A;  2D0B A;  3SJH A;  2HND A;  4QS9 A;  1OH6 A;  4DU3 A;  1XUP O;  3CCU N;  2ZQB A;  5AQN A;  3CQX A;  4DTR A;  3QER A;  3LM2 A;  3BUZ B;  1TK5 A;  1NMD A;  3QBW A;  5KGX A;  1RT5 A;  1HQE A;  4NYF A;  4IDH A;  2FBV A;  2EWS A;  4G9Z A;  3ZSW A;  2G8F A;  2WOM A;  4BC2 A;  1N34 K;  3D7E O;  3ENO A;  3G0Z A;  1HKC A;  4DR4 K;  3K59 A;  3QEV A;  5BPL A;  3QIC A;  1MDU B;  5JVG L;  2F4V K;  5JIC A;  3K0S A;  4CEC A;  1WNS A;  3P39 A;  3NFA A;  3V9Z A;  4B9Q A;  2HVI A;  2H3G X;  5E41 A;  4A5B A;  4AHR A;  1TAU A;  3EL2 A;  4IOC L;  1P8Z A;  1YJN N;  5HOO A;  3LDL A;  3T19 A;  3SNN A;  2O8B A;  1HNV A;  2P51 A;  5LL6 Z;  3B8A X;  1VSM A;  3OYB A;  3O6W A;  3LDN A;  3OYK A;  1BI4 A;  4CK1 A;  1WSI A;  2XY5 A;  4CBX A;  1M1K O;  2P9I A;  5DMR A;  4H5T A;  4CIF A;  1IH7 A;  3CPW M;  1VSK A;  2RE2 A;  4O5B A;  3TTF A;  1JLG A;  1RT2 A;  3HK2 A;  3DXM A;  4GY2 B;  2XY8 A;  4FK4 A;  5FDL A;  4FOE A;  3R6M A;  1BIZ A;  3C6U A;  4I2P A;  4B8C A;  3LDQ A;  2VG6 A;  3ZT4 A;  4FWL A;  1WB9 A;  1CXU A;  3O80 A;  4WCE L;  1KD1 O;  3VGL A;  3NVK A;  3I0R A;  1KVB A;  2I7P A;  2KKZ A;  1FKP A;  4E7L A;  3AGK A;  1KTQ A;  4GVE A;  3SK3 A;  4HCB A;  3G10 A;  2NRX A;  1NK6 A;  3L6Q A;  4IO8 A;  1KFD A;  4E89 A;  1RBU A;  2VQE K;  4LY7 A;  4KHY A;  4DLG A;  1QS4 A;  2RKI A;  4KI6 A;  3VQB A;  3IUC A;  4WFA L;  2HMI A;  1S1W A;  3RSE B;  4BRL A;  5F2R A;  1J54 A;  2WFB A;  1A5V A;  1U6Z A;  5DM7 L;  1N8R O;  4JI4 K;  4G1Q A;  4JKA A;  1T6D A;  3K5N A;  1J9A A;  4O44 A;  3HST B;  1QSY A;  5AQK A;  4C23 A;  1DEJ A;  3AVH A;  4DTX A;  4OGC A;  5M1N A;  5I9E B;  5KI6 A;  2NRH A;  2KZM A;  2YNG A;  2KTQ A;  4RWT A;  4FXD A;  3TAP A;  4B9N A;  4DV5 K;  4FM2 A;  1EXQ A;  1HYZ A;  1TKX A;  1N33 K;  1JLF A;  3QO9 A;  4M3T A;  3AVF A;  3J8A A;  3D2E B;  2YJE A;  5J2P A;  3KKS A;  1L3V A;  3TTC A;  4DWI A;  2OPP A;  4JK9 A;  4K0K K;  3ZET B;  5HL7 L;  4DR7 K;  4FJM A;  2P9L A;  5BN9 A;  4JD2 A;  3FZH A;  4KH5 A;  2HHQ A;  3O9T A;  1RTD A;  3FE1 A;  4W5R A;  2O8E A;  3S3M A;  4DV0 K;  1NKB A;  3W3D A;  3WEE B;  4CF0 A;  3VQ5 A;  1IG8 A;  4KTQ A;  1SKW A;  3BGR A;  3ZSR A;  4CEA A;  5JS1 A;  4Y1C A;  4CZH A;  3TSP A;  3UKR B;  1VSD A;  4ISF A;  2BE2 A;  4HVJ A;  5GIN A;  3SQ4 A;  1NGI A;  3DLL L;  3SQ0 A;  3VQ8 A;  1EP4 A;  3FFK B;  3J80 O;  4DSJ A;  1TKZ A;  4DUY K;  1BIS A;  4FLV A;  4FJG A;  2GWJ A;  3O4W A;  4Y1D A;  3ISN C;  2JLE A;  5AR0 A;  1HKG A;  1TK8 A;  4JK7 A;  3AA5 X;  3THY B;  1NOY A;  1LW2 A;  3MXJ A;  3LWM A;  3I56 N;  1U2V B;  1SL0 A;  3JYT A;  4CHO A;  3A8Y A;  1ITG A;  5CZ2 A;  4DFP A;  2W6L A;  4WQ4 A;  2GUI A;  3P5J A;  4I7F A;  1LWC A;  2HF3 A;  3O4N A;  3NE6 A;  1G99 A;  1A5X A;  5HP1 A;  3MCP A;  1KLN A;  4FCY A;  3QB0 A;  3SLC A;  3JAM O;  2QTD A;  1VQ5 N;  1IG9 A;  1I3A A;  1ILY A;  1IBL K;  1NMN A;  3LAN A;  2G8W A;  3CPE A;  4FJI A;  1Z25 A;  1WBD A;  4BC4 A;  2OTL N;  2CH5 A;  4BRD A;  3VOV A;  3H3O B;  4JV5 K;  1TL3 A;  3D2F A;  3A5M C;  1TKD A;  3MED A;  3I8B A;  2P9P A;  4CJR A;  5AQH A;  3EY1 A;  1N36 K;  3ITH A;  4RW9 A;  5EY4 A;  1BCM A;  4FWP A;  3ASM A;  4ELU A;  5F0X A;  3U8X A;  2QK9 A;  5AQQ A;  5HRS A;  4PQU A;  3S41 A;  2CH6 A;  3ZSQ A;  4JNE A;  4KBO A;  1NOZ A;  3HPG A;  1HRH A;  2QEX N;  1SAZ A;  4WF9 L;  4CBW A;  3PO5 A;  3RR8 A;  4JKE A;  1RDA A;  4PUO A;  4KI4 A;  4LFA K;  3O4Q A;  3O9R A;  1RTH A;  4IG3 A;  4E7K A;  3VA3 A;  3NMU A;  1JCF A;  3O9S A;  3MXM A;  4BRC A;  1NJX A;  3J7Y P;  3NF8 A;  3U9D A;  3CYM A;  4IWV A;  3AVI A;  3L2Q A;  4BC5 A;  3J7Z O;  1VHX A;  3WNH A;  4JS4 A;  3T3F A;  3MN5 A;  1REV A;  2DFF A;  1U45 A;  3MN9 A;  3KK3 A;  3TAM A;  1BO5 O;  5FRN A;  3VEV A;  3CI5 A;  3U6F A;  3SQ1 A;  3QDK A;  3OS0 A;  4FO0 A;  3HI0 A;  4RW4 A;  1Z6R A;  4J2A A;  2Z1G A;  3DLR A;  4WFB L;  4FZY A;  2XO7 A;  2YHX A;  2P9N B;  5AQL A;  1VQ9 N;  3ENB A;  1BIU A;  1VQ4 N;  3QIO A;  4DFM A;  3EYZ A;  1RCH A;  1T03 A;  5HRO A;  4FW2 A;  3T7Z A;  3PY8 A;  4JI7 K;  1XNQ K;  3ZSV A;  2QI2 A;  1HKB A;  4FJN A;  1Q82 O;  4FPB A;  3SBT A;  4DS5 A;  3C94 A;  4WYB A;  3NAE A;  4FK0 A;  4DR2 K;  3CCQ N;  1X3M A;  2QA4 N;  4LF7 K;  2HBJ A;  1ZBS A;  4H4O A;  5BR9 A;  3CER A;  4NCA A;  3M1F A;  2CGL A;  3AVK A;  1ZBU A;  3SI6 A;  3O1W A;  2WTU A;  3WXJ A;  4DB3 A;  1ATN A;  1BG3 A;  3I33 A;  3HVT A;  1D8Y A;  3ZCM A;  2WUS A;  1K8A O;  3E1Y A;  4KPY A;  3EE8 A;  3IRX A;  4M41 A;  1SKR A;  3QIN A;  4BDP A;  4LH4 A;  2KW4 A;  3HM8 A;  4CFC A;  2GUP A;  4MO4 A;  4HUF A;  1Q9X A;  3BF1 A;  4ZTJ A;  3KIO A;  4DTU A;  3SZ2 A;  2GEM A;  3RR7 A;  4IOA L;  5AFU H;  1RT1 A;  3C6A A;  1K73 O;  1B92 A;  1YVU A;  5C2F A;  4AHT A;  1JKH A;  2KQ2 A;  3HP9 A;  4BR7 A;  4DKW A;  2UXD K;  1C0G A;  2PBD A;  3CFO A;  5CHI A;  3DLB A;  2A1R A;  2Q31 A;  4DTO A;  3MEG A;  2I5J A;  5J2Q A;  5C10 A;  1ASV A;  3HOS A;  3BZC A;  4CER A;  3BF3 A;  3V9U A;  2IOC A;  4H5R A;  4Z4I A;  1CXQ A;  1LV5 A;  1TGO A;  4CJT A;  1S9G A;  2DTU A;  4DTS A;  3FZF A;  3OTO K;  4OGE A;  4BY9 C;  2BTF A;  4DG1 A;  2YHY A;  2QM1 A;  3GDQ A;  4M3U A;  4FJJ A;  3VES A;  2D0A A;  4YDU A;  4ISE A;  4DTJ A;  4QS8 A;  1NU0 A;  1QQN A;  4XH4 A;  2KHO A;  4OJR A;  3WEE A;  3B6P A;  2HBL A;  2DFH A;  3L2U A;  3SCX A;  1MWM A;  1TVR A;  3UKR A;  3PX4 A;  2P9U B;  3U3G A;  5IWA K;  4BR2 A;  3VEZ A;  2E4L A;  1GLF O;  1HNZ K;  3MWT A;  3ZX3 A;  3SYZ A;  5M1P A;  1S6Q A;  3HRG A;  3V1O A;  3DLG A;  3H45 C;  1RNH A;  4KTZ A;  4N76 A;  3O9U A;  1IBK K;  4DSE A;  1RDW X;  4K25 A;  4KB0 A;  3AO2 A;  3UIQ A;  5C25 A;  2RN2 A;  1U2V A;  4BG8 A;  3AVJ A;  4IEI A;  2HNY A;  4DCH A;  4EFH A;  3VQ6 A;  4JS5 A;  4Z4F A;  3SUO A;  4DSF A;  5FPM A;  3OA9 A;  3SV3 A;  3TSU A;  4CZG A;  1W9H A;  4DLE A;  3OJS A;  5FLX O;  3TPQ A;  4MLE A;  4IBN A;  4CD1 A;  2FF3 B;  2Q0U A;  3CJ7 A;  3ZEU B;  1BA0 A;  3DJC A;  4NLC A;  1DKG D;  5KTQ A;  3EN9 A;  4F2R A;  2F96 A;  1FJG K;  1KQS M;  4FLZ A;  3V6D A;  3ID6 A;  2ZM6 K;  3CCR N;  5JLF A;  4DQQ A;  4Y0W A;  3SUP A;  1LAV A;  3VER A;  5KPR A;  1HNW K;  3S9H A;  4M7X A;  1D9F A;  4H5W A;  2PFU A;  3V81 A;  3G4S N;  3V1Q A;  1T3V A;  3P38 A;  4CZK A;  3SAG A;  1VSF A;  3PV8 A;  1IV0 A;  2QW9 A;  3WXM B;  2O8F A;  4JI1 K;  3V1R A;  3GL1 A;  1WSE A;  3LP1 A;  4PKG A;  4FWR A;  1W0H A;  4B1Z A;  1U47 A;  1ATS A;  4FJL A;  3L8B A;  2P9K A;  4ILH A;  4Z4C A;  4BQZ A;  1NWK A;  1RTJ A;  5AQR A;  4DV3 K;  1NGB A;  2XRI A;  4KHU A;  3MEE A;  1NJW A;  3VQD A;  1HYS A;  4MDA A;  1L3S A;  1VSL A;  5GIP A;  3WUH A;  3SJJ A;  3JXU A;  2D5R A;  1C0U A;  3R8E A;  4KHN A;  4AQY K;  3THV A;  4B1X B;  3IDH A;  1BQM A;  3CCL N;  4EHU A;  4XH5 A;  1ATR A;  1DT9 A;  1DTQ A;  4CJF A;  1U49 A;  1T6C A;  1VSJ A;  3M8Q A;  1C0M A;  1H1V A;  2YHA A;  3H6E A;  1Z26 A;  4FJH A;  4DTM A;  4BWJ A;  2WC9 A;  4E1M A;  1BQN A;  4FVM A;  2PYL A;  1YIJ N;  1O13 A;  4BRN A;  4FLT A;  2HHS A;  2GV9 A;  2FC0 A;  1FW6 A;  4PKI A;  1RDB A;  5AQX A;  3MX2 A;  1EQY A;  1SV5 A;  4ELV A;  1SQK A;  5C15 A;  4R5P A;  2O8C B;  3D0P A;  3AY9 A;  5M1O A;  4RW8 A;  1RDD A;  4AF1 A;  1HUX A;  4AHU A;  2D1K A;  4X64 K;  1OH8 A;  1Z05 A;  4FM1 A;  3PIO L;  3RRG A;  1SUQ A;  1P90 A;  3MMV A;  4H8K A;  4ISG A;  2F9T A;  4WE1 A;  4BE2 A;  4NXM K;  1KAZ A;  1WSJ A;  2ZJR L;  3P83 D;  5AQV A;  4CHZ A;  4OKE A;  3LDP A;  2Z1I A;  2QWP A;  2ETJ A;  4FWN A;  2FSN A;  3IG1 A;  4H0O A;  2I7N A;  1YIT N;  4Q5V A;  1K6Y A;  2UXB K;  4E7J A;  5J2N A;  2PYJ A;  3OYG A;  2QWR A;  4LF4 K;  4JKF A;  2P9S A;  1WSG A;  4GW6 A;  3NF6 A;  4Z94 A;  3QFU A;  1WBB A; 
#chains in the Genus database with same CATH homology
 4JK7 A;  1X3N A;  4PKH A;  4WFN L;  3TTD A;  2NRW A;  3KZB A;  3I56 N;  1U2V B;  4OPH A;  1YAG A;  1ZXO A;  1JCG A;  2DPN A;  3A8Y A;  3KK7 A;  4CI6 A;  5C2D A;  4RCH A;  3M5R A;  1TUY A;  3AAQ A;  4B1V A;  3KVG A;  3C65 A;  3CIP A;  3K9J A;  4WQ4 A;  4BGA A;  3HSC A;  4RTF D;  3WXI A;  1QQM A;  3K9K A;  4M63 C;  2HF3 A;  2BH1 A;  5GAE P;  1G99 A;  2P9S B;  4BC3 A;  3GE1 A;  3MCP A;  3OBW A;  3QB0 A;  3SLC A;  2NRZ A;  3VF2 A;  4BGB A;  1VQL N;  1J6Z A;  2QTD A;  4KH4 A;  1VQ5 N;  1HX1 A;  3EE9 A;  3ULE A;  1ILY A;  2NRT A;  1HKG A;  4IXC A;  5CE3 A;  3CPE A;  2NNW A;  4IOX A;  4IO9 L;  2CGJ A;  4H0T B;  3FZL A;  1BUP A;  3E9L A;  4NLB A;  3VMF B;  4FWO A;  4BC4 A;  3F9M A;  2ZGY A;  2CH5 A;  2OTL N;  3CCE N;  4BRD A;  3VOV A;  4NB4 A;  3OW2 M;  3H3O B;  3CC2 N;  4QS7 A;  1KC8 O;  3CME N;  3D2F A;  3A5M C;  1YF5 L;  3AAP A;  3I8B A;  2P9P A;  1JCE A;  5BPN A;  2RHK A;  3OHR A;  2Q36 A;  4H0X B;  3G6E N;  5AQH A;  1QZ6 A;  3ULE B;  5EY4 A;  3IFR A;  4E1J A;  2AA4 A;  1S72 N;  4BRE A;  2YX6 A;  4FWP A;  4JHD A;  5F0X A;  4HTL A;  1OVY A;  2W41 A;  5AQS A;  3U8X A;  5C0Y A;  5AQQ A;  3RVC A;  4H0Y B;  3CCS N;  3S41 A;  2CH6 A;  5GAD P;  2E1Z A;  4JNE A;  4KBO A;  4FWQ A;  3ENH A;  4YOY A;  5AZJ A;  5EXW A;  4CZJ A;  2P9P B;  3HBT A;  5AQU A;  1EO1 A;  2QEX N;  1SAZ A;  4WF9 L;  2VYP A;  4CBW A;  4DHY A;  5AQW A;  1VQO N;  4JKE A;  4BRO A;  2ZGZ A;  4AM6 A;  3N4Q A;  4BRQ A;  4EAH D;  3O9R A;  3GBT A;  2OAN A;  4JHD B;  3ZX0 A;  3R3L A;  3NMU A;  2E2N A;  3UB5 A;  1JCF A;  3O9S A;  3CC4 N;  3P4I A;  1NGA A;  4BRC A;  3CCM N;  2QWO A;  1OKJ A;  3WQU A;  1BWF O;  3U9D A;  4JKB A;  4JEP A;  4IWV A;  1NLV A;  4O8U A;  5EVZ A;  3WT0 A;  4O8K A;  1NJI O;  3LDO A;  4CBU A;  4BC5 A;  2VCP A;  4PL8 A;  5CR4 A;  3J7Z O;  2ZWH A;  1YHQ N;  1E4F T;  2P9N A;  3MN5 A;  4YOR A;  3E66 A;  3W0L A;  3MN9 A;  1HJO A;  3SMS A;  3P31 A;  5C12 A;  1GLC G;  4BRP A;  5M1F A;  3SAH A;  1RFQ A;  1BO5 O;  4H03 B;  1VQ8 N;  3TU5 A;  3VEV A;  2AP1 A;  1VQK N;  3CI5 A;  4MDB A;  3QDK A;  4F9O A;  1NGH A;  4MO5 A;  5EX5 A;  1KXP A;  1Q18 A;  2ZF5 O;  4FO0 A;  3EZW A;  1W2B M;  1Y64 A;  3HI0 A;  1HPM A;  3H46 O;  4JKC A;  3C0B A;  5M1Q A;  3I55 N;  1Z6R A;  1BOT O;  3F5T A;  1K8K B;  5AQY A;  4WFB L;  2GX9 A;  5AQJ A;  3CMA N;  4FPA A;  3CJ1 A;  3E9P A;  2YHX A;  4C1N I;  2YCH A;  2F7T A;  2P9N B;  5AQL A;  3VEO A;  3C6H A;  3O08 A;  4B1W B;  3ENB A;  3GG4 A;  3DXK A;  3WXK A;  2FLO A;  1YI2 N;  3CJB A;  2P9L B;  1VQ4 N;  4WQ4 C;  3ZYY X;  4EHT A;  4IZ9 A;  1S22 A;  5AQT A;  3VF4 A;  4KH6 A;  3T7Z A;  1Q81 O;  4BRH A;  2JWK A;  2A5X A;  3A5N C;  2QI2 A;  1HKB A;  3ZX2 A;  1GLE G;  4OPA A;  5GAG P;  2HBK A;  1Q82 O;  3IMX A;  3CQY A;  4ILJ A;  1YVN A;  4FPB A;  3SBT A;  4BRI A;  3CET A;  1ZC6 A;  4H5V A;  3MX5 A;  3CC7 N;  4WYB A;  4A62 A;  2KLA A;  2OTJ N;  3CD6 N;  3UKU A;  4DQ8 A;  5JMV A;  3L4I A;  3QBX A;  4K43 A;  2Q97 A;  2F9W A;  3DXK B;  4WQ5 C;  3LM9 A;  4BRM A;  5DM6 L;  3CCQ N;  4UY8 O;  4R79 A;  2IIR A;  4FOI A;  1TYQ A;  1X3M A;  4K42 A;  2QA4 N;  3H1V X;  2GEL A;  3PIP L;  2HBJ A;  3EKU A;  1ZBS A;  3F2K A;  4CZE A;  2FXU A;  3FZM A;  4BG9 A;  5BR9 A;  3CER A;  5AFU A;  5KQD A;  3M1F A;  5FPE A;  2A6A A;  3R1X A;  1DGK N;  1GLJ O;  2CGL A;  1W97 L;  2E2Q A;  1MA9 B;  3VET A;  4BRA A;  5H1S Q;  3BEX A;  4JKH A;  3O1W A;  4GV6 A;  2ASP A;  5EOY A;  2E2P A;  3MN6 A;  3WXJ A;  2A3Z A;  3JS6 A;  4A2B A;  3UKU B;  4BVO A;  2Q2R A;  2ASO A;  5AQF A;  1ATN A;  2VWB A;  1BG3 A;  4DB3 A;  3I33 A;  3QML A;  1QVG M;  1TYQ B;  5AQZ A;  2IVN A;  5TKW A;  4CD3 A;  2WUS A;  4PHT X;  3E1Y A;  1K8A O;  3EE8 A;  4CZI A;  3AAR A;  3Q7B A;  4WQ5 A;  4A57 A;  1NGF A;  5JLH A;  3HM8 A;  5AQP A;  1XC3 A;  2GUP A;  4U7B A;  1QVF M;  5E26 A;  4MO4 A;  4H0V B;  2NLX A;  3E9O A;  3BF1 A;  3U9Z A;  1VQ6 N;  3VPZ A;  1KAY A;  2E1Y A;  1XQS C;  2GWK A;  3G25 A;  3CJC A;  3CCJ N;  1YJW N;  2GEM A;  3UE5 A;  4FL9 A;  2HBM A;  3T69 A;  2HOE A;  5AQI A;  5AFU H;  3C6A A;  3M6G A;  4JKG A;  4A2A A;  1K73 O;  4IOA L;  5C2F A;  1NGC A;  1VQ7 N;  2A40 A;  3Q7C A;  2NRR A;  1JJ2 M;  1V4S A;  2ZJP L;  4BR7 A;  4XH1 A;  4DKW A;  2IVO A;  4B1U B;  1C0G A;  1T44 A;  2PBD A;  4U67 L;  3CJ9 A;  4FWK A;  5KPZ A;  3R9P A;  3VEX A;  5CHI A;  5AZI A;  5LY3 A;  3EO3 A;  4XEI A;  2Q31 A;  3D2F B;  3O5B A;  4LC9 B;  3CJA A;  5C10 A;  3HOS A;  4JKG B;  4NO7 A;  1VQN N;  2NRV A;  1CZA N;  1SZ2 A;  4AM7 A;  1TUU A;  5AQM A;  3BF3 A;  3N4P A;  2E8A A;  4CJ7 A;  2QWM A;  1NGE A;  4FWS A;  3O1B A;  5ELZ A;  2J4R A;  4H5R A;  2E2O A;  5KQ8 A;  2D0P A;  2PAV A;  1QZ5 A;  3TSQ A;  3EKS A;  2UYT A;  4HWI A;  5AZI B;  4FWM A;  5GIO A;  1V4T A;  1YXQ A;  3FZF A;  3SAF A;  4BY9 C;  3QFP A;  5AZJ B;  2ASM A;  2P9U A;  2BTF A;  4BVP A;  2QWQ A;  1Q86 O;  1BA1 A;  2YHY A;  3LL3 A;  2QM1 A;  3GDQ A;  3U4L A;  3O9Q A;  3CXC M;  2WBN A;  4I6M A;  3VES A;  4IJN A;  4OO1 J;  3IKM A;  3MN7 A;  5B8H A;  4YDU A;  4ISE A;  1M90 O;  4QS8 A;  5BPM A;  1QQN A;  4XH4 A;  1GLA G;  2KHO A;  3SJH A;  3KWI A;  3WEE A;  2HBL A;  4QS9 A;  1XUP O;  3CCU N;  4GNI A;  1MWM A;  3UKR A;  2P9U B;  5AQN A;  3CQX A;  4BR2 A;  3VEZ A;  4A5A A;  1GLF O;  3WXL A;  3LM2 A;  3H1Q A;  5MLC Q;  3BUZ B;  3C7N A;  1VAZ A;  3MWT A;  3ZX3 A;  3FZK A;  4I6M B;  1NMD A;  2HST A;  3QBW A;  5E84 A;  3A5O C;  4YOT A;  5M1P A;  4CZF A;  4GV3 A;  3HRG A;  3H45 C;  4IDH A;  4BQL A;  2EWS A;  4G9Z A;  4K41 A;  3O9U A;  4CZM A;  4JK8 A;  1WOQ A;  3VEW A;  4BC2 A;  3CCV N;  1RDW X;  3D7E O;  4K25 A;  2V52 B;  3ENO A;  4L3Q A;  3A5L C;  1HKC A;  4JKD A;  5BPL A;  3QIC A;  1MDU B;  4YOU A;  5JVG L;  2CGK A;  2GTD A;  5JIC A;  2FSJ A;  1U2V A;  4BG8 A;  3ZEU A;  4IEI A;  4DCH A;  4EFH A;  3P39 A;  2HF4 A;  5AQG A;  2D4W A;  3VEY A;  4B9Q A;  2VGM A;  2NZT A;  2H3G X;  2A41 A;  4A5B A;  3ATV A;  5FPM A;  3OA9 A;  3EL2 A;  3TSU A;  1VQP N;  2Q1N A;  4IOC L;  1HLU A;  1E4G T;  4CZG A;  1P8Z A;  1YJN N;  5HOO A;  3LDL A;  5ADX H;  3TPQ A;  2VGN A;  3B8A X;  4MLE A;  4CD1 A;  1GLD G;  3O6W A;  2FF3 B;  2Q0U A;  4BRG A;  3LDN A;  3CJ7 A;  3ZEU B;  1BA0 A;  3DJC A;  4NLC A;  1DKG D;  3EN9 A;  1KQS M;  2W40 A;  4JN4 A;  4CBX A;  1M1K O;  2P9I A;  3ID6 A;  3SBG A;  1KAX A;  4H5T A;  3CPW M;  3CCR N;  2JWL A;  2RE2 A;  5JLF A;  1MWK A;  4Y0W A;  3TTF A;  1Q7Y O;  1VQM N;  3VER A;  4PL7 A;  5KPR A;  2E88 A;  3DXM A;  4GY2 B;  4M7X A;  4BR4 A;  5BRD A;  4H5W A;  1VQ9 N;  1NGJ A;  2PFU A;  5LJV A;  1WUA A;  3CHW A;  4FOE A;  1T3V A;  3P38 A;  3R6M A;  3G4S N;  4CZK A;  3LDQ A;  4MLH A;  3SAG A;  1YJ9 N;  2IVP A;  2QW9 A;  1C0F A;  2QWL A;  3M3Z A;  4IJA A;  1RDU A;  5TKY A;  3WXM B;  4FWL A;  4BR5 A;  3O80 A;  3SMP A;  4WCE L;  4BRK A;  1KD1 O;  3VGL A;  3GL1 A;  2P9I B;  4PKG A;  3ID8 A;  3RSE A;  3ATU A;  4FWR A;  4B1Z A;  3NVK A;  3L0Q A;  1ATS A;  2I7P A;  1NGD A;  2KKZ A;  3VGM A;  3VF6 A;  3H3N O;  2P9K A;  4C1N K;  4ILH A;  3AGK A;  3HOT A;  1X9J A;  4ILG B;  4GVE A;  4BQZ A;  3SK3 A;  5AQO A;  1NWK A;  5AQR A;  4EIA A;  2NRX A;  1NGB A;  3DXM B;  3L6Q A;  4IO8 A;  1BDG A;  4MDA A;  3FLC O;  1R59 O;  5GIP A;  4YDU C;  2Q0R A;  4CZL A;  3WUH A;  3JXU A;  3FR0 A;  3OBY A;  5FPN A;  1GLL O;  3R8E A;  4YOW A;  3L4Q A;  4B1X B;  3IUC A;  4WFA L;  3RSE B;  3IDH A;  4H5N A;  3A0I X;  3DAW A;  2E20 A;  5F2R A;  4BRL A;  4EHU A;  3CCL N;  4H0P A;  2WFB A;  2P9K B;  1U6Z A;  4XH5 A;  1ATR A;  1DT9 A;  2FF6 A;  5DM7 L;  1N8R O;  4FVU A;  1T6C A;  3H6E A;  4O5F A;  1H1V A;  1ESV A;  4JKA A;  3D2E A;  1T6D A;  4BR9 A;  5JVH L;  2WC9 A;  2V7Y A;  3MCA B;  3MDQ A;  4A59 A;  4BRF A;  5AQK A;  4C23 A;  5BRH A;  4BR0 A;  1SS6 A;  1DEJ A;  1YUW A;  2V7Z A;  3ZET A;  5BN8 A;  5M1N A;  1LOT B;  5I9E B;  1D4X A;  1RGI A;  4YOX A;  4J8F A;  2NRH A;  1O13 A;  4BRN A;  1YIJ N;  1NM1 A;  4RWT A;  2FSK A;  1NBW A;  3D6R A;  3O8M A;  4PKI A;  2QWN A;  5AQX A;  4GV9 A;  3MX2 A;  1K9M O;  3HTV A;  3NVM A;  1EQY A;  3FGU A;  2V51 B;  5BRE A;  1SQK A;  3WQT A;  5C15 A;  2A42 A;  2YHW A;  1GLB G;  3VGK A;  3AY9 A;  4IEE A;  3VTI A;  4A61 A;  1K8K A;  5M1O A;  3J8A A;  4AF1 A;  3D2E B;  5F1X A;  2YJE A;  5GAH P;  1HUX A;  5FPD A;  3TTC A;  1QQO A;  2D0O A;  2D1K A;  4JK9 A;  3ZET B;  3G71 N;  5M1K A;  5HL7 L;  2P9L A;  2QXL A;  5BN9 A;  1Z05 A;  2ITM A;  4JD2 A;  3FZH A;  4KH5 A;  3O9T A;  3HZ6 A;  3FE1 A;  3PIO L;  5LJW A;  5ADX A;  3PLA A;  4YOV A;  1P90 A;  3W3D A;  3MMV A;  3WEE B;  3VEN A;  4B1Y B;  1IG8 A;  3BP8 A;  4ISG A;  1IJJ A;  1S3X A;  2F9T A;  3KHY A;  1KAZ A;  4CZH A;  3TSP A;  3UKR B;  2ZJR L;  4ISF A;  5GIN A;  5AQV A;  1NGI A;  3LDP A;  1LCU A;  2ZJQ L;  3CF5 L;  3DLL L;  2QWP A;  5BRF A;  2HMP A;  5KPT A;  4FWN A;  2FSN A;  3MK6 A;  1BU6 O;  1NGG A;  3C7N B;  4H0O A;  2I7N A;  1YIT N;  3KWG A;  4JD2 B;  4IFE A;  3FFK B;  4JAX A;  3DWL A;  2BUP A;  4FSV A;  3GOI A;  2GWJ A;  3MWP A;  3O4W A;  3VTH A;  4M7Y A;  2QWR A;  4JKF A;  2YJF A;  5AR0 A;  1QHA A;  2P9S A;  3AGR A;  2YI1 A;  4Z94 A;  3QFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...