2QTDA

Crystal structure of a putative dinitrogenase (mj0327) from methanocaldococcus jannaschii dsm at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
MINMKVAISMDVDKISNSFEDCKYFLIVRIDDNEVKSTKVIFNDESGKKSIVKENVNAIICKNISEENYKKFSKKIEIYHAEGDDVDKNISLFIEGELSKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein MJ0327
publication title NMR structure of the protein NP_247299.1: comparison with the crystal structure.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Oxidoreductase
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2qtdA00
2KLAA 2RE2A 1RDUA 2WFBA 1T3VA 1EO1A 1P90A 2QTDA 1O13A 2YX6A
chains in the Genus database with same CATH superfamily
3AGKA 2WFBA 3M8PA 1BI4A 4DMNA 5E26A 3SPYA 1QS4A 2YX6A 4BRFA 3UKUB 2JWLA 4JKBA 4CW7B 4F8RA 1JLEA 3QEXA 2I7PA 2HBMA 1MWKA 1U48A 3B6OA 2F8TA 4OKEA 3CQYA 3SMSA 3UIQA 1VSKA 1JL1A 3JS6A 4DR1K 1TKZA 1SL1A 1L5UA 2XRIA 1TK5A 4K8XA 1Y64A 3AVFA 4CHQA 3M8QA 3OVNA 4MLHA 3L3UA 4IO9L 1TKTA 4BE2A 1FKOA 4M3ZA 4K25A 3EE8A 1E4FT 4IDKA 3NFAA 4FWOA 4B3SK 4JLHA 1W7AA 1REVA 3MX5A 3VQAA 4FJ7A 1BI4B 2KW4A 4BGBA 3HVRA 4H0VB 4DV5K 2BTFA 1NGAA 1NLVA 4J8FA 3VETA 3KD5E 3GE1A 4H4MA 3O1BA 1SV5A 4LC9B 3CM5A 3EZWA 4OPHA 4O0JA 4WQ5C 3OYCA 4CHNA 1IKVA 2F4VK 4YDUA 3LP0A 4NYFA 1C6VA 2YNFA 3CPWM 3KLGA 4KHUA 2YJEA 1NOZA 4M3TA 1SKRA 1HNXK 2KQ2A 2A3ZA 4CGDA 3H3OB 4BE0A 1ZBUA 3VQEA 5BPMA 3QICA 5AQWA 2QW9A 1HNZK 1KFDA 3LM9A 3OW2M 4PA1A 2Q1NA 1WBBA 1BQNA 5I9EB 5GIOA 1BQMA 3FFKB 3ZX3A 4FWQA 3EY1A 4LFAK 4BQLA 5JS2A 1XUPO 2HBKA 3IMXA 4O55A 4LSNA 4GMJB 3N4QA 3IKMA 3V9XA 3VGLA 3A0IX 3EKUA 5KGWA 1NGJA 2YHYA 1SQKA 2ZF5O 3MDQA 4YOYA 2HF4A 1HYVA 1IKYA 1JLFA 1GLBG 3VQQA 4DR4K 4G1QA 1J5OA 1IG9A 3CFOA 4CD3A 1C0TA 3AVBA 4XEIA 3VMFB 3VQPA 4FM2A 3RRHA 3SUOA 4Z4GA 4CBWA 4CERA 2ZQBA 3SJHA 3NF8A 3ISNC 4CF2A 4RW6A 4EP4A 2LSNA 4GVEA 2KKZA 3WEEB 1SS6A 4H0PA 1TAUA 5EX5A 1KRPA 2OTJN 2E2QA 3MN7A 1XMQK 4DTPA 2Q0UA 2A40A 4PQUA 1DEJA 3G0ZA 4CIEA 1J53A 5AQMA 3CPEA 4Z4CA 4MLEA 4DFJA 4HUFA 2HHTA 4LSLA 4ILGB 3R1XA 2F8SA 3VTIA 4M41A 3C6AA 1WNSA 4FJMA 3SNNA 1ATNA 3SCXA 2V52B 1S6QA 2QWRA 5AQQA 4E1NA 4AM7A 3HRGA 2ZGYA 1VQ8N 5FLXO 3HP9A 1IO2A 3P39A 3THXA 4H5RA 3SAHA 3QEWA 3KK2A 3BF1A 4AHCA 3V1RA 1SKWA 2D1KA 3MECA 1HYZA 1FW6A 2VWBA 1VSEA 3EYZA 2G8HA 2FBYA 3M5RA 2IAJA 2VQFK 3TI0A 4FVUA 2W42A 4FOEA 2QWNA 1ZBIA 3CC2N 3U9ZA 2G8UA 3AGRA 5DM6L 5JS1A 3L4QA 2HHQA 4CBUA 1TL3A 3AO3A 1RILA 4YOTA 4JK7A 3R3LA 4BRPA 5AZJA 2ATQA 3L2WA 3ENBA 4E3SA 3WXKA 4H8KA 1C1CA 1Q18A 1TAQA 2NRTA 3OYGA 3PO4A 4DSIA 1IV0A 1UA0A 4DV0K 2QKBA 4KTWA 3O9UA 1IG8A 1O1WA 3THXB 3PX0A 2BGGA 2KTQA 4BRDA 2WTUA 4FJHA 3V6DA 4OGEA 4BVOA 4BRAA 3EE9A 3AAQA 2BUPA 2UXCK 4Y0WA 1RT5A 3QERA 3MWPA 2E1YA 5FRMA 3IAYA 2GUIA 3E9OA 4GKKK 4Z4HA 4YNQA 2E88A 3AVHA 3T1AA 4DFPA 3L3VA 4IOCL 4LF4K 4EAHD 2XHBA 3AVCA 4F4KA 5AFUA 4FO0A 4K43A 4DQSA 2F7TA 1RT6A 3H46O 4V19S 3MN5A 4BG8A 1RDWX 3ZX0A 1YVNA 4DTRA 5HRRA 2O8FB 3OHRA 4H5VA 1WSJA 3M8RA 4FLUA 5C15A 2GEMA 5M1QA 3KTQA 2X6NA 2DFHA 3D2FA 4LF5K 3JSMA 4HTLA 2FBXA 2HMIA 1XQSC 4DV7K 1JLQA 2QK9A 3ZT1A 1W2BM 3HI0A 5JLFA 1C0FA 1T44A 4BWJA 2NRWA 5FROA 4M45A 4CI6A 3DMJA 4KBOA 1T7PA 1RNHA 3ZSXA 2EX3A 3F2KA 1RTDA 2GTDA 2YHXA 4YOWA 3QESA 2HVHA 3UB5A 3BP8A 4BDZA 4CEAA 5LMNK 4WFNL 4AHSA 3AV9A 4FWRA 3O80A 1RCHA 1VSIA 3AO2A 3VEVA 1HRHA 3CJ7A 2G8FA 4F3TA 3CMAN 4GW6A 3D2FB 1V4TA 3TWHA 4BVPA 3AA3A 3O08A 2P5OA 4N41A 2ZE2A 2A1SA 4JKDA 4PL7A 4BR0A 1ESVA 1JKHA 4YHHK 3C6HA 1ZBHA 4JRPA 3U6FA 4O8UA 2P9SA 3DXMB 3MK6A 2Y1IA 1K73O 3SMPA 4JI8K 3OYKA 1UA1A 4J2BA 3R9PA 4CJEA 1VQKN 1YIJN 3TAPA 3DRSA 3V9SA 4DLEA 4JHDA 4OVLA 4U67L 1IBLK 2BH1A 2QTDA 4EZ9A 1LAWA 5FPDA 4DFMA 3T3FA 5JLHA 4DS4A 2YCHA 1XC3A 5BRDA 4IFYA 3CCEN 3VQBA 3AO4A 2P9KA 3HTVA 1ZBFA 1TYQA 5GADP 1KVCA 1YAGA 2XY6A 1A5WA 2W41A 2PFUA 4FJXA 3I8DA 4RW4A 1WSIA 2ZWHA 2JGUA 3NGZA 4JKEA 4PKGA 1XC9A 3RVCA 2YI1A 4A2BA 5M1OA 1UOCA 1HUXA 3CCRN 1KQSM 3OYDA 4CEDA 1YVUA 2HHWA 3NF9A 1CXUA 2P9SB 4NO7A 3VQ9A 2F9TA 5AFUH 1YXQA 2ETJA 4OPJA 2E20A 5CY4A 1LWEA 3CCVN 1NGHA 4CF8A 4O5BA 4AM6A 4DQIA 4H03B 3SAFA 4M63C 4JHDB 4UY8O 1ASUA 1IBMK 3HO1A 1CZAN 1S5JA 5AQTA 2J4RA 3A2FA 3JXUA 4O0IA 3TSQA 2DPNA 4E19A 3FE1A 4WQ4C 4M3XA 1DKGD 1I39A 1LOTB 4BGAA 1LW0A 4CJ7A 4DKWA 1TYQB 4CIFA 4KH4A 4YY3K 3TU5A 2KHOA 4CJUA 3NDKA 4LH4A 4LFBK 4RW9A 3AO5A 3KK1A 3V9UA 3VEXA 3ATUA 2NRRA 3PSIA 4B8CA 2YNGA 2E5LK 1S1WA 3BF3A 4DR2K 1N34K 4FPAA 3LWLA 1KFSA 4J2EA 1X9WA 1VQON 4DQ8A 3V9WA 2UU9K 3DWLA 2H3GX 3FZFA 3PX4A 3CG7A 4FW1A 3VQ7A 4A2AA 4BWMA 1J5EK 1RBRA 1WLJA 3VEWA 5HRSA 1HKCA 2E8AA 4N5SA 2Q36A 1GLDG 1ASWA 1DTTA 4JI2K 3LDSA 3SQ0A 4H0YB 3VEOA 5CZ1A 1S1XA 3AVJA 3H3NO 3IS9A 3UKUA 4DWIA 4B8AB 5J2NA 4IOXA 3K5MA 3K58A 1ZBLA 4DV6K 3AA4A 2A1RA 4HTUA 5J2QA 2NRZA 2P9NA 3AVMA 3C6TA 3ENOA 2DTUA 3GG4A 1IBKK 4ELUA 4DTUA 1CXQA 3E9LA 3OYNA 1HPMA 4H5NA 3ULDA 3VOVA 4M3YA 3VN5A 3A8YA 1F21A 4FZXC 2P1JA 3WQTA 4BC3A 3K59A 2HMPA 4M7YA 4FLYA 5I3UA 1TUUA 1H1VA 3O9SA 3VESA 4LD0A 3U3YA 4R79A 2RPIA 3TAEA 4H0XB 1NGFA 4KHWA 2GX9A 3QBXA 3OYMA 4E1JA 4NLCA 3DOLA 1X1PA 1WAFA 4HHTA 4FLTA 2GELA 3VQ6A 5JVGL 4NCBA 3H6EA 2Q2RA 1TL1A 2HNZA 1Q9YA 3EN9A 2P9NB 5KPZA 3MN9A 1S3XA 1HJOA 4YDUC 5LJWA 3F73A 1BWFO 4CZJA 3DLLL 4IO8A 2IC3A 3RR7A 2OA8A 4QAGA 2R7YA 3O9RA 4DTNA 1IKXA 2E6LA 2Z1IA 1EQYA 4FLZA 3JYTA 3HVTA 4FJJA 3LP1A 4U7BA 2BANA 3OJSA 4B1XB 2P5GA 2E4LA 4BRQA 4IKFA 1RBUA 4RW8A 1GOBA 1TGOA 1JLBA 1ASVA 1T8EA 1Y97A 3DM2A 1D8YA 2O4IA 1EX4A 4E89A 3B6PA 3QBWA 5EU7A 3CXCM 1BGXT 5C42A 3SYZA 3J7AP 3O4NA 2W40A 3C94A 1OKJA 4JKGA 3PIOL 4DU4A 5KQDA 1M1KO 4O44A 4EFHA 5HOOA 1NK5A 4KI4A 4ICLA 4A57A 3WXLA 3CERA 4CHYA 3WXIA 4DTMA 1NK7A 5FPEA 4C8OA 3CQ8A 4CVNE 1C1AA 3O1WA 2IGIA 1NKCA 3CMEN 3P83D 1VQ6N 3NF7A 4DG1A 3VQ4A 4CJTA 4KHQA 5LL6Z 4AQYK 4CK2A 4ISEA 5C25A 5JICA 4B3OA 3S3OA 3LDPA 3OS2A 5KGXA 2QWPA 4I9LA 3VQ8A 3WEEA 1YT3A 3FZLA 4CFAA 3LZJA 2DFFA 4B1WB 5KI6A 4CFCA 1HNIA 4B9VA 1QHAA 4CIGA 1NK8A 3AVGA 4CZIA 5HROA 2CH5A 4NYNA 3NAEA 1N33K 2QEXN 1X9MA 4J2DA 4IEEA 1ZXOA 4CGGA 4GVMA 4CZKA 4I2QA 5TKYA 1QQNA 3TSPA 3WT0A 1NJYA 4B3TK 1MWMA 2X78A 4DB3A 1QTMA 2FSNA 3IFRA 3PIPL 4LF6K 3QFUA 2QWLA 3D45A 4JKGB 3T1HK 1NGIA 4BACA 2XY8A 3HK2A 3L2UA 4A61A 3OYBA 3TANA 3DLGA 3OYLA 1ZC6A 4IZ9A 4CJ3A 4A5BA 1N8RO 5JMVA 4EHUA 2WONA 2IVPA 4BQZA 5C2FA 1KVAA 2O8DA 1VK0A 3A5OC 4CJVA 1HKBA 1VQLN 1NGBA 1BCMA 1V4SA 2GBZA 5C10A 3O6WA 3OBYA 4I7FA 4PUOA 3RWUA 1X3MA 4GKJK 4LF8K 2CH6A 1VSMA 2WC9A 5AQSA 1DGKN 3Q7BA 3M6GA 3T1YK 3DJCA 3VQCA 4AHVA 5F0XA 5IWAK 3OYEA 2ZD1A 4M3WA 1HR0K 4FJ9A 3BZCA 3AVLA 4XH1A 1NK6A 4OO1J 1JL2A 4JD2A 1A5XA 1KLNA 3I56N 5CHIA 4BC4A 1Q7YO 1QSYA 3ITHA 2Q97A 1ZYQA 4CGHA 3HPOA 1S9EA 2G8WA 2VGMA 1HJRA 1HLUA 3DXKA 4LF9K 2W6KA 3P38A 1RTHA 4BRGA 1RTIA 3MXJA 4JI6K 4CJFA 2HHSA 3HXMA 4FJLA 1NKBA 4RWTA 3MN6A 4FWKA 3HPGA 1FK9A 4FJGA 1QZ5A 4JV5K 4FK0A 1BOTO 5FPMA 1FXXA 3V1QA 1JXBA 3LWMA 4K41A 3CFPA 1RBVA 4KHNA 2O8DB 5KPRA 4DSEA 2ASOA 4EZ6A 4KKOA 3SJJA 1BA1A 2ZM6K 1DT9A 2UUAK 3J8AA 4ISGA 4BRNA 5BRHA 4IJAA 3L4IA 4JI5K 1EP4A 2YNIA 1WSEA 3RTVA 1JCGA 3SV4A 4K42A 2YHAA 2CGJA 2VYPA 2O8FA 4JD2B 4BDPA 1IJJA 1OH5A 4DQRA 2YHWA 4XIUA 2WOMA 3KKRA 2P9UA 3C0BA 4DR5K 4LFCK 4W5RA 3L2QA 1C1BA 3CQXA 3DXKB 1S1TA 5CYQA 4DSJA 1K8AO 1BCOA 5KRTA 4I6MA 1VRTA 2D5RA 1JCFA 1XNRK 3MMVA 4QS7A 1RDDA 2QKKA 2VWKA 1HQUA 2ZGZA 1RT4A 2D0CA 1WSFA 3EZ5A 4CEFA 3QINA 1NG9A 3SLCA 1C0MA 1CZ9A 4CJLA 1L3SA 2ITMA 4OGCA 4MQ3A 2G8VA 4FWLA 1VSDA 4PKHA 5CZ2A 2EWSA 1SL2A 2VGNA 4JI1K 1MU2A 4N56A 3IUCA 2HF3A 2FSKA 4FZZA 5LJVA 1YI2N 4BRLA 1Z26A 4CFDA 1YHQN 2PYLA 4E7LA 3LAMA 5E41A 4KTZA 3RR8A 1LWFA 5AQKA 3LAKA 4EHTA 3MX2A 3SAGA 1S72N 3SUPA 2YV0X 4IEIA 1Z6RA 3ID6A 1NJZA 3KJVA 2P9UB 3CJAA 4CK1A 1OVQA 2D0BA 3M3ZA 3OY9A 1ATRA 2NRVA 4I6MB 3TABA 3G71N 1N36K 3MCPA 3VQDA 3ALYA 4C1NK 3DLBA 3QMLA 4MDAA 1VHXA 2VG7A 4KI6A 1JLCA 5AQPA 4ELVA 3SBGA 1S9GA 3DXMA 1RT2A 4KAZA 4DF8A 3DLRA 4DTJA 2BE2A 3F5TA 1BA0A 3ZLJA 3QNOA 3P4IA 3VERA 4DFKA 4FSVA 1WOQA 2HB5A 1BG3A 1WSHA 5HBMA 4CJ4A 4DSKA 3LANA 3UKRA 2ASMA 4KRFA 3VENA 4CJWA 3PX6A 3HPHA 3C95A 4FK4A 4W5NA 2OYQA 4OPAA 3PUFA 1JLAA 2NZTA 4FJIA 4FJ8A 3D7EO 5HLFA 3LP3A 4JKHA 3THYA 4GY2B 4CCHA 3CI5A 4QCLA 4FYDA 1QHTA 3QIOA 1BUPA 3R6MA 3LM2A 1WB9A 4KV8A 4OPKA 4DV3K 4KTQA 4WFAL 3MXMA 3D6RA 1E3MA 4O8KA 3HOSA 2VG6A 3GL1A 1NKEA 1U45A 2B4JA 4FL9A 5H1SQ 4CHZA 4FXDA 1QQMA 4CJRA 2UXDK 4JYAK 5AQFA 1RFQA 2PZSA 4ID1A 3MXIA 2X74A 3TAFA 1O13A 2OPSA 3K5OA 3HT3A 1J6ZA 4XH4A 2Q3SA 1SL0A 3CYMA 3UKRB 2W6LA 4NXMK 4JI7K 4LH5A 4WYBA 4TSXA 5AJ3K 1BDGA 2E1ZA 2HHVA 4BE1A 4X66K 5HRNA 3ZT2A 4DU3A 3W0LA 4C8KA 5F2RA 2P9LA 4Y1DA 4GV9A 4CFBA 3EO3A 2QXLA 3P31A 3THYB 1XMOK 4JKAA 1NGDA 4C8LA 3CCMN 1UAXA 1S1VA 5AQJA 4CHPA 4CJKA 2PAVA 4CF9A 3QB0A 2Q0RA 5BN9A 1VQPN 1GLJO 3MCAB 2FSJA 1BHLA 3ZT0A 5AQRA 4L8RB 2FF6A 4DSFA 4BRCA 3KK3A 5BR8K 1NMNA 1P8ZA 5CR4A 4FLXA 4Z4EA 4AHTA 1NWKA 1A5VA 2V51B 4FPBA 1KCFA 2QI2A 4JK9A 2HHHK 3LDNA 1TKXA 2DFEA 4CGJA 2IDOA 1SAZA 2O8BA 5ADXA 2XY7A 3AVKA 1YJNN 3HJFA 1KD1O 5M1FA 1DTQA 3I8BA 4X64K 2ZJQL 3E9PA 3CF5L 4QOZB 3TR8A 4IG3A 4CZHA 1SKSA 3L8BA 1YF5L 4Q5VA 2V7YA 3ZETA 2P9LB 4BR5A 4CZFA 1Q9XA 5E84A 2O8EA 3OS1A 4DF4A 3WNGA 1IKWA 3SK3A 1JJ2M 1Q8IA 2NUBA 4FWSA 1D9DA 1K6YA 1YJWN 3C6UA 2D4WA 3LPTA 1GOCA 2G8KA 3CCSN 4QS9A 3O4QA 2HSTA 3ATVA 3ZSRA 4W5QA 4DCHA 3P1GA 5DK5A 5KPTA 1SZ2A 1TK8A 1YUWA 3T19A 2P51A 1VQ5N 4N47A 1B9DA 2IVNA 1HYSA 5AQXA 4E7KA 1MA9B 3OYFA 4B08A 3AVAA 1Q81O 3NVMA 4CZMA 4FW2A 3SQ2A 4L3QA 2O8BB 3IG1A 3NE6A 4DQPA 4WFBL 1GLFO 5SZTA 3I0SA 3V4IA 2CGKA 2RE2A 5BR9A 4E0DA 1RT1A 1GLEG 3CJCA 3OS0A 2NNWA 2FLOA 3G10A 3VEZA 5GIPA 4F2SA 3LDOA 4RTFD 5J1EA 2HHUA 4FWMA 4NCGA 5HRPA 1NJXA 2YNHA 1NU0A 3ZETB 1HQEA 3EEQA 4DR6K 4FVMA 5AQZA 2O8EB 3CJ1A 4ID5A 4DV1K 3ZSWA 4YOUA 3JAMO 3HL8A 3VEYA 2AA4A 3EL2A 4KHSA 4DSLA 1NGEA 4A59A 1XWLA 3HBTA 2E2OA 3THWA 1RT3A 3KKSA 1BL3A 2HBJA 4ISFA 4CJSA 1TK0A 3BZKA 1GOAA 4BRHA 1U49A 4A5AA 3THVA 3D2EA 3PV8A 3CCQN 3J80O 3CC7N 4CD1A 3FZHA 4BR4A 1VQ9N 3OYJA 3CETA 4PWDA 1JCEA 2OANA 5GAGP 2NLXA 4JN4A 2WUSA 2QWMA 4NB4A 4CJ5A 4DLGA 3SZ2A 1HMVA 4JNEA 5C0YA 4M3UA 2HW3A 3LZIA 4FJKA 2Z1JA 4CZEA 3G25A 3K2PA 3WXMB 3NGYA 4KREA 3FZKA 4Q0BA 2QM1A 4CZLA 1OH8A 3AAPA 2FC0A 3DOKA 3EKSA 1HKGA 3L2RA 4OJRA 4AHUA 2IS3A 4B9NA 3CC4N 3NHGA 3H45C 3QETA 1DLOA 3DYAA 5FPNA 3PO5A 1L3VA 1NGCA 3CD6N 4CESA 5ADXH 3THWB 3VTHA 4ILHA 3DLEA 3HSCA 4I2PA 3J7ZO 4DR7K 1WAJA 1TVRA 3D2EB 2OTLN 1NOYA 3O3GA 4HUEA 3M1FA 3Q7CA 1W0HA 2A42A 2UYTA 2I7NA 2G8IA 4ZTFA 1N32K 2V7ZA 4EIAA 1T6DA 5DMRA 4HCCA 4YOVA 1N5YA 1NMDA 4GV6A 3NGIA 2JWKA 1MDUB 2O4GA 5HL7L 4N76A 1NBWA 4HWIA 2B6AA 4M7XA 2X6SA 4OLBA 5A2QO 3RMDA 2FF3B 2A6AA 3TSUA 3ULEA 4BG9A 3P5JA 4X62K 2PBDA 1HNWK 2KZZA 4BR2A 3K57A 1BISA 2IIRA 2A5XA 4DV4K 1SUQA 1YTUA 2QWOA 3L6QA 4FOIA 1TKDA 4NXNK 3T7ZA 1QE1A 4FM1A 1U2VA 3M8SA 5D3GA 3PLAA 2E2PA 4DUYK 3SPZA 3RMBA 5AQLA 3UE5A 4B3RK 1QZ6A 3FZMA 3NF6A 4B9UA 2P9IA 5CE3A 2JLEA 4CEZA 4FCYA 1TV6A 3ZX2A 4WCEL 2KZMA 4BREA 1Q86O 1KAXA 4JKCA 4FJ5A 1J9AA 4OKKA 3NMUA 1QVGM 1RT7A 3NH0A 1RDUA 5AQHA 3IDHA 3TTFA 4A62A 1NM1A 1VSHA 1JXEA 1GLCG 3LPUA 2OZMA 2YHBA 3VF6A 1X9JA 2AP1A 3D0PA 2VQEK 4KH6A 3DRPA 1QSSA 3W3DA 2VG5A 4H0TB 1Z25A 4H4OA 5AQNA 3ULEB 5C24A 3OYAA 3U4LA 5KTQA 4IOAL 5DM7L 3H08A 2VWJA 4CE9A 3SUQA 4OKJA 5AQVA 3PSFA 4ILJA 4JAXA 3WNEA 4QS8A 3HSTB 4UQGA 1S6PA 1E4GT 3TTCA 2P9PA 3KIOA 5K14A 1U2VB 4WQ5A 4BC2A 3U8XA 2KLAA 3VGKA 1BIZA 4FK2A 1U04A 3HP6A 4M42A 1ZBSA 1XHXA 2P9IB 1ILYA 3CCUN 1ATSA 1T3VA 3DAWA 3SV3A 1FJGK 3GBTA 3GOIA 2YKNA 3TTDA 4BRKA 5LMUK 2AJQA 1LAVA 4HUGA 4MDBA 3BGRA 4B9TA 4J2AA 4KB1A 1X3NA 4FZYA 4JEPA 5AR0A 1B92A 4E7IA 1LV5A 4I9QA 3SQ1A 2RF2A 4EP5A 1NJWA 4F3OA 4KB0A 1WBDA 3GDQA 3QIPA 3CJBA 3MEGA 4JI0K 3SQ4A 1M90O 3CIPA 5EVZA 4E1MA 3ZSQA 5I42A 3NVKA 3O3HA 3FR0A 3LALA 4BRMA 3QEVA 4NLBA 3MAQA 3TAQA 4FM0A 1R0AA 2E2NA 4DTSA 3NBPA 5HP1A 1NJIO 4JI3K 1VAZA 2P9PB 5M1PA 1UWBA 3AY9A 4CECA 3IRXA 3V9ZA 3MEEA 4OX9K 1HX1A 1KVBA 3FLCO 5ELZA 3OJUA 5GAEP 2NRXA 3MWTA 4B1ZA 2KFNA 3K5NA 4B1VA 1B9FA 1I3AA 1LCUA 5EOYA 2PY5A 1X9SA 4C23A 3KWGA 3V1OA 3G4SN 1C0GA 2GV9A 4DU1A 3G6EN 1QQOA 3C7NA 4KPYA 4IDHA 3QNNA 3ZSVA 2D0AA 3VF4A 3AARA 1P90A 3QLHA 4BR9A 4DQQA 2Q31A 1NK4A 4MO5A 4W5OA 3S41A 1VQMN 3KLFA 2Z1HA 4LF7K 5M1NA 4BROA 4JRQA 3O4WA 1EWRA 5J2PA 4CEEA 3NH2A 3KLHA 3OA9A 4C8NA 3S3NA 4F2RA 4AILC 3N4PA 4FWPA 3RMAA 3KZBA 4B9MA 3WNFA 5J2MA 3A5MC 4WE1A 3WUHA 4B9LA 3AA2A 1BO5O 3H1VX 1W9HA 4RW7A 3BEXA 4CJPA 1QQCA 3OBWA 4FLWA 3ZSYA 2YJFA 2HVIA 4YORA 5JVHL 1K9MO 1EKEA 3RRGA 5BRFA 5T7BA 1D5AA 3LL3A 3CM6A 3A5NC 5AQUA 3C7NB 3ZT4A 5GINA 2RN2A 3K5LA 3ID8A 2QXFA 3BY5A 4DR3K 3VF2A 4ELTA 3ENHA 2HHXA 5EXWA 3RSEA 4BY9C 1TUYA 3AA5X 3SI6A 2FBVA 5AZJB 3J81O 1QSLA 1K8KA 1XNQK 1VSLA 5FDLA 1KAYA 5FRNA 1D4XA 1NNEA 4JI4K 4ZTJA 3U9DA 4K0KK 3DI6A 2I5JA 1WSGA 2BDPA 1KC8O 4B9SA 4WF9L 3B8AX 1S22A 3OYIA 3J7YP 4PL8A 4IBNA 5AQOA 3KWIA 4DHYA 2UUCK 4NCAA 4Z0UA 3RMCA 4PY5A 4AF1A 5SWMA 3E01A 2HOEA 3WQUA 2F96A 2ITGA 3CHWA 5BREA 3A5LC 4G9ZA 3TAGA 4H5TA 3E66A 3HM8A 2OZSA 4AH9A 1YJ9N 3R8EA 5LY3A 3KLIA 3AO1A 2YKMA 1JLGA 3OYHA 1FKPA 1RGIA 4BDYA 3K9JA 3CCJN 3VQ5A 2PYJA 2OPPA 3RSEB 4MFBA 4CEBA 4H0OA 2NRHA 4B1YB 4DV2K 4H5WA 1K8KB 1OH7A 3VPZA 1R59O 1G99A 1KXPA 1U6ZA 3AVIA 4B3MK 5AQIA 3ZCMA 4BRIA 3ZYYX 1BU6O 3HYFA 3F9KA 3TPQA 4JK8A 1CZBA 3QDKA 1VQNN 1NK9A 4M3RA 1RDCA 4ZHRA 1XI1A 3O8MA 4IXCA 4DTXA 4BR7A 3AVNA 4W5TA 1EETA 3I55N 1T03A 4IG0A 1LW2A 4KHPK 1VSJA 4E7HA 3TARA 2D0OA 3L2VA 4PHTX 3KHYA 1KAZA 1VSFA 3WXJA 4OLAA 3VGMA 4C8MA 4Z4FA 4O4GA 2RKIA 1W97L 1KLMA 4C1NI 1LWCA 2CGLA 5M1KA 3QEPA 1VQ7N 1Q82O 3VA3A 1KTQA 4KH5A 2ZJRL 3HZ6A 2O8CA 3S3MA 3NH1A 4R5PA 2OCEA 3ZT3A 3DLKA 3ZSZA 5F1XA 1KSPA 3DRRA 2RHKA 3BUZB 2EHGA 4IWVA 4HCBA 4CEOA 5KQ8A 1T05A 3O3FA 5KRSA 4CF0A 5MLCQ 4DUZK 3WNHA 1VQ4N 2UXBK 5BN8A 3TAMA 4CGIA 4IJNA 4CK3A 4KO0A 1RDBA 1QVFM 3LDLA 1OVYA 3VA0A 1NGGA 4FLVA 3ZEUA 3K9KA 1EO1A 2Y1JA 4KFBA 3KLEA 1EWQA 5C12A 5TKWA 1S1UA 2DY4A 4RG8A 3S9HA 3CCLN 2GUPA 3KVGA 4CHOA 5AZIA 3FFIA 2D0PA 3E1YA 1VRUA 3ZSOA 4CEQA 3PY8A 1RBTA 1HPZA 2FXUA 2P9KB 3U3GA 1YTAA 5IT9O 4IFVA 4X65K 4GV3A 2Z1GA 4XH5A 2ASPA 3H1QA 2O8CB 1HNVA 1EXQA 3LDQA 4DS5A 1YITN 4FWNA 2FBTA 3CJ9A 5EY4A 1WN7A 2B5JA 4AHRA 1U47A 3DLHA 5GAHP 1OH6A 4CBXA 1NK0A 4B9QA 3I0RA 4YOXA 1RBSA 4CGFA 4Z4IA 3L0QA 3V81A 1IH7A 3NCIA 3FGUA 3ZEUB 1RTJA 1L3TA 2WBNA 2ZJPL 4CJQA 4K8ZA 2F9WA 3KD1E 2KFZA 5B8HA 3KK7A 3QO9A 4O5FA 3MEDA 1T6CA 3SBTA 1J54A 1I94K 3HM9A 3F9MA 2OPQA 3C65A 1CLQA 5BPNA 3BDPA 5AZIB 4GNIA 2XY5A 4WQ4A 5CYMA 4HVJA 1L3UA 4E7JA 3ASMA 3LP2A 2VCPA 3O9TA 5AQYA 5BPLA 3QEIA 4CF1A 4FJNA 4CZGA 1GLLO 2HNYA 1ITGA 2A41A 1D9FA 4IFEA 3T69A 2QWQA 4MO4A 1RDAA 5C2DA 2HBLA 3K0SA 4YFUA 2E6MA 2OPRA 2IOCA 4PKIA 1N6QA 4Y1CA 1GLAG 2UUBK 2IVOA 2XO7A 4Z94A 2HNDA 1C0UA 4RCHA 4BC5A 4B1UB 3O9QA 4F9OA 2GWJA 1G15A 4JS5A 3QFPA 1XHZA 5AQGA 4JKFA 2GWKA 2QA4N 1BIUA 1U4BA 4DTOA 1WUAA 3CFRA 4JS4A 3SUNA 1Z05A 4KHYA 3O5BA 3OTOK 3HOTA 4LY7A 3I33A
chains in the Genus database with same CATH topology
3TTCA 1Z6RA 2WFBA 3AGKA 2P9PA 3ID6A 1HUXA 1U2VB 2P9UB 3CCRN 4WQ5A 1KQSM 4BC2A 3CJAA 5E26A 3U8XA 2YX6A 2KLAA 3VGKA 2P9SB 3M3ZA 4NO7A 2F9TA 5AFUH 1YXQA 4BRFA 3UKUB 1ATRA 2NRVA 4I6MB 1ZBSA 2JWLA 4JKBA 3G71N 2E20A 2P9IB 1ILYA 3MCPA 3CCUN 1ATSA 4C1NK 1T3VA 3DAWA 1NGHA 3CCVN 3QMLA 4AM6A 2I7PA 2HBMA 4H03B 1MWKA 4MDAA 3GBTA 3GOIA 3SAFA 4M63C 3TTDA 4BRKA 4JHDB 4MDBA 5AQPA 4UY8O 1X3NA 3SBGA 4JEPA 5AR0A 1CZAN 3CQYA 3SMSA 5AQTA 2J4RA 3JXUA 3TSQA 2DPNA 3JS6A 3DXMA 3FE1A 1Y64A 4WQ4C 1DKGD 1LOTB 3GDQA 3CJBA 4BGAA 4CJ7A 4DKWA 1TYQB 3F5TA 1BA0A 4MLHA 3P4IA 4KH4A 3VERA 3CIPA 4FSVA 5EVZA 4IO9L 3TU5A 1M90O 1WOQA 2KHOA 3NVKA 3FR0A 1BG3A 4BRMA 4K25A 3EE8A 3UKRA 1E4FT 2ASMA 4NLBA 3VEXA 3ATUA 2NRRA 4FWOA 3VENA 3BF3A 4FPAA 2E2NA 1NJIO 1VQON 3MX5A 4OPAA 1VAZA 2P9PB 2NZTA 5M1PA 4DQ8A 4BGBA 3DWLA 2H3GX 3FZFA 3D7EO 4H0VB 3AY9A 4JKHA 2BTFA 4GY2B 1NGAA 1NLVA 3CI5A 1HX1A 3FLCO 4J8FA 5ELZA 3VETA 4A2AA 5GAEP 2NRXA 1BUPA 3R6MA 3MWTA 4B1ZA 3LM2A 3VEWA 4B1VA 1LCUA 1HKCA 3GE1A 5EOYA 2E8AA 2Q36A 4WFAL 3D6RA 1GLDG 3KWGA 3O1BA 4LC9B 4O8KA 4C23A 3EZWA 4OPHA 3G4SN 1C0GA 4WQ5C 4H0YB 3HOSA 3VEOA 3G6EN 1QQOA 4YDUA 3H3NO 3C7NA 3GL1A 4IDHA 3UKUA 3CPWM 3VF4A 4FL9A 3AARA 5H1SQ 1P90A 2YJEA 4BR9A 4IOXA 1QQMA 2Q31A 5AQFA 1RFQA 4MO5A 3S41A 1VQMN 2NRZA 2A3ZA 1O13A 2P9NA 3H3OB 3ENOA 5M1NA 3GG4A 1J6ZA 4XH4A 4BROA 5BPMA 3QICA 3O4WA 3E9LA 3UKRB 5AQWA 1HPMA 4H5NA 2QW9A 3OA9A 3VOVA 3LM9A 3OW2M 4WYBA 3A8YA 3N4PA 1BDGA 2E1ZA 2Q1NA 4FWPA 3WQTA 3KZBA 5I9EB 5GIOA 3A5MC 4BC3A 3W0LA 5F2RA 2P9LA 3FFKB 3WUHA 3ZX3A 4GV9A 1BO5O 4FWQA 3EO3A 3H1VX 2QXLA 4BQLA 2HMPA 3P31A 3BEXA 1XUPO 4M7YA 2HBKA 4JKAA 3IMXA 1NGDA 3CCMN 3OBWA 3N4QA 5AQJA 3IKMA 2PAVA 3QB0A 3VGLA 3A0IX 1TUUA 1H1VA 2YJFA 3O9SA 3VESA 2Q0RA 5BN9A 3EKUA 4R79A 1VQPN 4YORA 1GLJO 1NGJA 2YHYA 1SQKA 2ZF5O 3MCAB 2FSJA 5JVHL 1K9MO 3MDQA 4YOYA 2HF4A 5BRFA 4H0XB 1NGFA 5AQRA 2GX9A 3QBXA 2FF6A 4BRCA 1GLBG 3LL3A 3A5NC 4E1JA 4NLCA 5AQUA 1P8ZA 3C7NB 5CR4A 5GINA 4CD3A 1NWKA 4XEIA 3VMFB 2V51B 4FPBA 3ID8A 2QI2A 4JK9A 2GELA 3LDNA 4CBWA 5JVGL 3H6EA 2Q2RA 3SJHA 3VF2A 3ENHA 5EXWA 3RSEA 1SAZA 3EN9A 2P9NB 4GVEA 4BY9C 2KKZA 1TUYA 3WEEB 1SS6A 4H0PA 3MN9A 5KPZA 5ADXA 5AZJB 1S3XA 5EX5A 1K8KA 1HJOA 1YJNN 4YDUC 5LJWA 1KAYA 1KD1O 2OTJN 1BWFO 5M1FA 4CZJA 1D4XA 2E2QA 3I8BA 3MN7A 4IO8A 3DLLL 3U9DA 2ZJQL 3E9PA 3O9RA 3CF5L 2Q0UA 2A40A 1DEJA 1EQYA 4CZHA 1YF5L 2V7YA 1KC8O 5AQMA 3CPEA 3ZETA 4U7BA 2P9LB 4BR5A 3B8AX 4MLEA 1S22A 4CZFA 4WF9L 4PL8A 5E84A 4B1XB 5AQOA 3KWIA 4BRQA 4ILGB 3R1XA 4DHYA 3VTIA 3C6AA 3SK3A 1JJ2M 4FWSA 1ATNA 2V52B 4AF1A 2QWRA 5AQQA 1YJWN 2D4WA 2HOEA 4AM7A 3WQUA 3HRGA 3CCSN 2ZGYA 3CHWA 5BREA 1VQ8N 4QS9A 3P39A 3A5LC 4H5RA 3SAHA 4G9ZA 2HSTA 3ATVA 3BF1A 4H5TA 4DCHA 5KPTA 1SZ2A 3E66A 3HM8A 2D1KA 1YJ9N 1YUWA 3QBWA 3R8EA 5LY3A 3CXCM 1VQ5N 2IVNA 2W40A 2VWBA 5AQXA 1OKJA 4JKGA 3PIOL 1MA9B 5KQDA 1M1KO 4EFHA 1RGIA 5HOOA 3K9JA 1Q81O 3M5RA 3NVMA 4CZMA 3CCJN 4A57A 3WXLA 3CERA 3RSEB 3WXIA 4H0OA 4FVUA 4L3QA 5FPEA 2NRHA 4B1YB 4H5WA 4FOEA 4WFBL 2QWNA 1K8KB 1GLFO 3O1WA 2CGKA 2RE2A 3CC2N 3U9ZA 3VPZA 3CMEN 1R59O 1G99A 1KXPA 5BR9A 1VQ6N 1U6ZA 1GLEG 3CJCA 5AQIA 2NNWA 3AGRA 2FLOA 5DM6L 3L4QA 4ISEA 3VEZA 3ZYYX 4BRIA 3LDOA 5JICA 4CBUA 5GIPA 4RTFD 1BU6O 4FWMA 3LDPA 3TPQA 2QWPA 3ZETB 4YOTA 3WEEA 4JK7A 4JK8A 3R3LA 4BRPA 3FZLA 5AZJA 3QDKA 5AQZA 4B1WB 3CJ1A 1VQNN 3ENBA 3WXKA 1QHAA 3O8MA 1Q18A 2NRTA 4IXCA 4CZIA 4YOUA 3VEYA 2CH5A 2AA4A 4BR7A 2QEXN 3EL2A 3O9UA 1IG8A 4IEEA 1NGEA 4A59A 1ZXOA 4CZKA 3I55N 4BRDA 3HBTA 2E2OA 5TKYA 1QQNA 3TSPA 3WT0A 2D0OA 1MWMA 4PHTX 3KHYA 4DB3A 1KAZA 2HBJA 4BRAA 4BVOA 3EE9A 2FSNA 3AAQA 3IFRA 4ISFA 3WXJA 3VGMA 3PIPL 2BUPA 3QFUA 2QWLA 4BRHA 4A5AA 4JKGB 1W97L 1NGIA 3D2EA 4Y0WA 3CCQN 4C1NI 3MWPA 2CGLA 2E1YA 4A61A 5M1KA 1VQ7N 3E9OA 3CC7N 4CD1A 3FZHA 1ZC6A 2E88A 4BR4A 1Q82O 4IZ9A 1VQ9N 3CETA 4A5BA 4KH5A 2ZJRL 1N8RO 4IOCL 3HZ6A 1JCEA 2OANA 4EHUA 5JMVA 2IVPA 4BQZA 4EAHD 5C2FA 5GAGP 2NLXA 4JN4A 4FO0A 2WUSA 4K43A 2QWMA 2F7TA 4NB4A 5AFUA 3A5OC 3H46O 1HKBA 1VQLN 1NGBA 5F1XA 3MN5A 4BG8A 1V4SA 1RDWX 4JNEA 2RHKA 3BUZB 3ZX0A 1YVNA 5C0YA 4IWVA 5C10A 5KQ8A 3O6WA 3OBYA 5MLCQ 4CZEA 1X3MA 3OHRA 3G25A 4H5VA 2CH6A 5AQSA 2WC9A 3WXMB 3FZKA 1VQ4N 5C15A 1DGKN 2GEMA 2QM1A 3M6GA 3Q7BA 5M1QA 4CZLA 5BN8A 3AAPA 3DJCA 3EKSA 4IJNA 1HKGA 3D2FA 5F0XA 1QVFM 3LDLA 1OVYA 1NGGA 3CC4N 4HTLA 3H45C 4XH1A 4OO1J 4JD2A 3ZEUA 3K9KA 5FPNA 1EO1A 3I56N 5CHIA 4BC4A 1Q7YO 1NGCA 5C12A 2Q97A 1XQSC 5TKWA 3CD6N 5ADXH 1W2BM 3VTHA 2VGMA 3HI0A 1HLUA 3DXKA 1C0FA 4ILHA 3HSCA 3P38A 1T44A 2GUPA 3CCLN 3KVGA 4BRGA 3J7ZO 2NRWA 5AZIA 3D2EB 4RWTA 2OTLN 2D0PA 3MN6A 4FWKA 3E1YA 4CI6A 4KBOA 2FXUA 1QZ5A 3M1FA 2P9KB 3Q7CA 4GV3A 2A42A 2UYTA 3F2KA 1BOTO 4XH5A 2I7NA 5FPMA 2ASPA 3H1QA 2GTDA 2YHXA 4YOWA 2V7ZA 4K41A 4EIAA 1T6DA 3UB5A 3LDQA 4YOVA 3BP8A 5KPRA 1YITN 4FWNA 3CJ9A 5EY4A 1NMDA 4GV6A 2ASOA 2JWKA 1MDUB 1BA1A 5GAHP 1DT9A 5HL7L 4WFNL 3J8AA 4ISGA 4BRNA 4CBXA 5BRHA 1NBWA 4FWRA 3O80A 4HWIA 4M7XA 4IJAA 4B9QA 3L4IA 3VEVA 2FF3B 2A6AA 3TSUA 3ULEA 1JCGA 4BG9A 4YOXA 3CJ7A 3CMAN 4K42A 2PBDA 3D2FB 1V4TA 4BR2A 3L0QA 2IIRA 2A5XA 4BVPA 2CGJA 2VYPA 3O08A 2QWOA 3L6QA 3FGUA 4FOIA 4JD2B 3ZEUB 1IJJA 4JKDA 4PL7A 4BR0A 2WBNA 1ESVA 2YHWA 3T7ZA 2ZJPL 2F9WA 3C6HA 3KK7A 5B8HA 1U2VA 4O5FA 5JLFA 2P9UA 3C0BA 1T6CA 3SBTA 2E2PA 3PLAA 3CQXA 4O8UA 3DXKB 2P9SA 3F9MA 5AQLA 3UE5A 1QZ6A 3C65A 3DXMB 3FZMA 3MK6A 5BPNA 1K8AO 1K73O 3SMPA 4I6MA 4GNIA 5AZIB 4WQ4A 2P9IA 5CE3A 3R9PA 1JCFA 1VQKN 3MMVA 1YIJN 4QS7A 3ZX2A 4WCEL 4BREA 1Q86O 4JHDA 4U67L 1KAXA 4JKCA 2VCPA 3NMUA 2BH1A 2QTDA 1QVGM 3O9TA 4IEIA 1RDUA 5AQYA 2ZGZA 3IDHA 5AQHA 5BPLA 5FPDA 3TTFA 4A62A 1NM1A 4CZGA 1GLLO 5JLHA 2YCHA 1GLCG 3SLCA 1XC3A 5BRDA 2A41A 4IFEA 2ITMA 3T69A 3VF6A 3CCEN 1X9JA 2AP1A 2QWQA 4MO4A 5C2DA 4KH6A 2P9KA 2HBLA 3HTVA 4FWLA 1TYQA 4H0TB 4PKHA 3W3DA 5GADP 2EWSA 4PKIA 2VGNA 1GLAG 1YAGA 2IVOA 5AQNA 3ULEB 4Z94A 3U4LA 3IUCA 4RCHA 2HF3A 2FSKA 4B1UB 4BC5A 4IOAL 5LJVA 1YI2N 2W41A 3O9QA 2GWJA 2PFUA 4BRLA 4F9OA 3QFPA 5DM7L 5AQGA 4JKFA 1YHQN 2GWKA 2QA4N 2ZWHA 4JKEA 4PKGA 5AQVA 4JAXA 4ILJA 1WUAA 3RVCA 4QS8A 1Z05A 5AQKA 4EHTA 3MX2A 3O5BA 2YI1A 3SAGA 3HOTA 4A2BA 1S72N 5M1OA 1E4GT 3I33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLA A;  2RE2 A;  1RDU A;  2WFB A;  1T3V A;  1EO1 A;  1P90 A;  2QTD A;  1O13 A;  2YX6 A; 
#chains in the Genus database with same CATH topology
 3AGK A;  2WFB A;  3M8P A;  1BI4 A;  4DMN A;  5E26 A;  3SPY A;  1QS4 A;  2YX6 A;  4BRF A;  3UKU B;  2JWL A;  4JKB A;  4CW7 B;  4F8R A;  1JLE A;  3QEX A;  2I7P A;  2HBM A;  1MWK A;  1U48 A;  3B6O A;  2F8T A;  4OKE A;  3CQY A;  3SMS A;  3UIQ A;  1VSK A;  1JL1 A;  3JS6 A;  4DR1 K;  1TKZ A;  1SL1 A;  1L5U A;  2XRI A;  1TK5 A;  4K8X A;  1Y64 A;  3AVF A;  4CHQ A;  3M8Q A;  3OVN A;  4MLH A;  3L3U A;  4IO9 L;  1TKT A;  4BE2 A;  1FKO A;  4M3Z A;  4K25 A;  3EE8 A;  1E4F T;  4IDK A;  3NFA A;  4FWO A;  4B3S K;  4JLH A;  1W7A A;  1REV A;  3MX5 A;  3VQA A;  4FJ7 A;  1BI4 B;  2KW4 A;  4BGB A;  3HVR A;  4H0V B;  4DV5 K;  2BTF A;  1NGA A;  1NLV A;  4J8F A;  3VET A;  3KD5 E;  3GE1 A;  4H4M A;  3O1B A;  1SV5 A;  4LC9 B;  3CM5 A;  3EZW A;  4OPH A;  4O0J A;  4WQ5 C;  3OYC A;  4CHN A;  1IKV A;  2F4V K;  4YDU A;  3LP0 A;  4NYF A;  1C6V A;  2YNF A;  3CPW M;  3KLG A;  4KHU A;  2YJE A;  1NOZ A;  4M3T A;  1SKR A;  1HNX K;  2KQ2 A;  2A3Z A;  4CGD A;  3H3O B;  4BE0 A;  1ZBU A;  3VQE A;  5BPM A;  3QIC A;  5AQW A;  2QW9 A;  1HNZ K;  1KFD A;  3LM9 A;  3OW2 M;  4PA1 A;  2Q1N A;  1WBB A;  1BQN A;  5I9E B;  5GIO A;  1BQM A;  3FFK B;  3ZX3 A;  4FWQ A;  3EY1 A;  4LFA K;  4BQL A;  5JS2 A;  1XUP O;  2HBK A;  3IMX A;  4O55 A;  4LSN A;  4GMJ B;  3N4Q A;  3IKM A;  3V9X A;  3VGL A;  3A0I X;  3EKU A;  5KGW A;  1NGJ A;  2YHY A;  1SQK A;  2ZF5 O;  3MDQ A;  4YOY A;  2HF4 A;  1HYV A;  1IKY A;  1JLF A;  1GLB G;  3VQQ A;  4DR4 K;  4G1Q A;  1J5O A;  1IG9 A;  3CFO A;  4CD3 A;  1C0T A;  3AVB A;  4XEI A;  3VMF B;  3VQP A;  4FM2 A;  3RRH A;  3SUO A;  4Z4G A;  4CBW A;  4CER A;  2ZQB A;  3SJH A;  3NF8 A;  3ISN C;  4CF2 A;  4RW6 A;  4EP4 A;  2LSN A;  4GVE A;  2KKZ A;  3WEE B;  1SS6 A;  4H0P A;  1TAU A;  5EX5 A;  1KRP A;  2OTJ N;  2E2Q A;  3MN7 A;  1XMQ K;  4DTP A;  2Q0U A;  2A40 A;  4PQU A;  1DEJ A;  3G0Z A;  4CIE A;  1J53 A;  5AQM A;  3CPE A;  4Z4C A;  4MLE A;  4DFJ A;  4HUF A;  2HHT A;  4LSL A;  4ILG B;  3R1X A;  2F8S A;  3VTI A;  4M41 A;  3C6A A;  1WNS A;  4FJM A;  3SNN A;  1ATN A;  3SCX A;  2V52 B;  1S6Q A;  2QWR A;  5AQQ A;  4E1N A;  4AM7 A;  3HRG A;  2ZGY A;  1VQ8 N;  5FLX O;  3HP9 A;  1IO2 A;  3P39 A;  3THX A;  4H5R A;  3SAH A;  3QEW A;  3KK2 A;  3BF1 A;  4AHC A;  3V1R A;  1SKW A;  2D1K A;  3MEC A;  1HYZ A;  1FW6 A;  2VWB A;  1VSE A;  3EYZ A;  2G8H A;  2FBY A;  3M5R A;  2IAJ A;  2VQF K;  3TI0 A;  4FVU A;  2W42 A;  4FOE A;  2QWN A;  1ZBI A;  3CC2 N;  3U9Z A;  2G8U A;  3AGR A;  5DM6 L;  5JS1 A;  3L4Q A;  2HHQ A;  4CBU A;  1TL3 A;  3AO3 A;  1RIL A;  4YOT A;  4JK7 A;  3R3L A;  4BRP A;  5AZJ A;  2ATQ A;  3L2W A;  3ENB A;  4E3S A;  3WXK A;  4H8K A;  1C1C A;  1Q18 A;  1TAQ A;  2NRT A;  3OYG A;  3PO4 A;  4DSI A;  1IV0 A;  1UA0 A;  4DV0 K;  2QKB A;  4KTW A;  3O9U A;  1IG8 A;  1O1W A;  3THX B;  3PX0 A;  2BGG A;  2KTQ A;  4BRD A;  2WTU A;  4FJH A;  3V6D A;  4OGE A;  4BVO A;  4BRA A;  3EE9 A;  3AAQ A;  2BUP A;  2UXC K;  4Y0W A;  1RT5 A;  3QER A;  3MWP A;  2E1Y A;  5FRM A;  3IAY A;  2GUI A;  3E9O A;  4GKK K;  4Z4H A;  4YNQ A;  2E88 A;  3AVH A;  3T1A A;  4DFP A;  3L3V A;  4IOC L;  4LF4 K;  4EAH D;  2XHB A;  3AVC A;  4F4K A;  5AFU A;  4FO0 A;  4K43 A;  4DQS A;  2F7T A;  1RT6 A;  3H46 O;  4V19 S;  3MN5 A;  4BG8 A;  1RDW X;  3ZX0 A;  1YVN A;  4DTR A;  5HRR A;  2O8F B;  3OHR A;  4H5V A;  1WSJ A;  3M8R A;  4FLU A;  5C15 A;  2GEM A;  5M1Q A;  3KTQ A;  2X6N A;  2DFH A;  3D2F A;  4LF5 K;  3JSM A;  4HTL A;  2FBX A;  2HMI A;  1XQS C;  4DV7 K;  1JLQ A;  2QK9 A;  3ZT1 A;  1W2B M;  3HI0 A;  5JLF A;  1C0F A;  1T44 A;  4BWJ A;  2NRW A;  5FRO A;  4M45 A;  4CI6 A;  3DMJ A;  4KBO A;  1T7P A;  1RNH A;  3ZSX A;  2EX3 A;  3F2K A;  1RTD A;  2GTD A;  2YHX A;  4YOW A;  3QES A;  2HVH A;  3UB5 A;  3BP8 A;  4BDZ A;  4CEA A;  5LMN K;  4WFN L;  4AHS A;  3AV9 A;  4FWR A;  3O80 A;  1RCH A;  1VSI A;  3AO2 A;  3VEV A;  1HRH A;  3CJ7 A;  2G8F A;  4F3T A;  3CMA N;  4GW6 A;  3D2F B;  1V4T A;  3TWH A;  4BVP A;  3AA3 A;  3O08 A;  2P5O A;  4N41 A;  2ZE2 A;  2A1S A;  4JKD A;  4PL7 A;  4BR0 A;  1ESV A;  1JKH A;  4YHH K;  3C6H A;  1ZBH A;  4JRP A;  3U6F A;  4O8U A;  2P9S A;  3DXM B;  3MK6 A;  2Y1I A;  1K73 O;  3SMP A;  4JI8 K;  3OYK A;  1UA1 A;  4J2B A;  3R9P A;  4CJE A;  1VQK N;  1YIJ N;  3TAP A;  3DRS A;  3V9S A;  4DLE A;  4JHD A;  4OVL A;  4U67 L;  1IBL K;  2BH1 A;  2QTD A;  4EZ9 A;  1LAW A;  5FPD A;  4DFM A;  3T3F A;  5JLH A;  4DS4 A;  2YCH A;  1XC3 A;  5BRD A;  4IFY A;  3CCE N;  3VQB A;  3AO4 A;  2P9K A;  3HTV A;  1ZBF A;  1TYQ A;  5GAD P;  1KVC A;  1YAG A;  2XY6 A;  1A5W A;  2W41 A;  2PFU A;  4FJX A;  3I8D A;  4RW4 A;  1WSI A;  2ZWH A;  2JGU A;  3NGZ A;  4JKE A;  4PKG A;  1XC9 A;  3RVC A;  2YI1 A;  4A2B A;  5M1O A;  1UOC A;  1HUX A;  3CCR N;  1KQS M;  3OYD A;  4CED A;  1YVU A;  2HHW A;  3NF9 A;  1CXU A;  2P9S B;  4NO7 A;  3VQ9 A;  2F9T A;  5AFU H;  1YXQ A;  2ETJ A;  4OPJ A;  2E20 A;  5CY4 A;  1LWE A;  3CCV N;  1NGH A;  4CF8 A;  4O5B A;  4AM6 A;  4DQI A;  4H03 B;  3SAF A;  4M63 C;  4JHD B;  4UY8 O;  1ASU A;  1IBM K;  3HO1 A;  1CZA N;  1S5J A;  5AQT A;  2J4R A;  3A2F A;  3JXU A;  4O0I A;  3TSQ A;  2DPN A;  4E19 A;  3FE1 A;  4WQ4 C;  4M3X A;  1DKG D;  1I39 A;  1LOT B;  4BGA A;  1LW0 A;  4CJ7 A;  4DKW A;  1TYQ B;  4CIF A;  4KH4 A;  4YY3 K;  3TU5 A;  2KHO A;  4CJU A;  3NDK A;  4LH4 A;  4LFB K;  4RW9 A;  3AO5 A;  3KK1 A;  3V9U A;  3VEX A;  3ATU A;  2NRR A;  3PSI A;  4B8C A;  2YNG A;  2E5L K;  1S1W A;  3BF3 A;  4DR2 K;  1N34 K;  4FPA A;  3LWL A;  1KFS A;  4J2E A;  1X9W A;  1VQO N;  4DQ8 A;  3V9W A;  2UU9 K;  3DWL A;  2H3G X;  3FZF A;  3PX4 A;  3CG7 A;  4FW1 A;  3VQ7 A;  4A2A A;  4BWM A;  1J5E K;  1RBR A;  1WLJ A;  3VEW A;  5HRS A;  1HKC A;  2E8A A;  4N5S A;  2Q36 A;  1GLD G;  1ASW A;  1DTT A;  4JI2 K;  3LDS A;  3SQ0 A;  4H0Y B;  3VEO A;  5CZ1 A;  1S1X A;  3AVJ A;  3H3N O;  3IS9 A;  3UKU A;  4DWI A;  4B8A B;  5J2N A;  4IOX A;  3K5M A;  3K58 A;  1ZBL A;  4DV6 K;  3AA4 A;  2A1R A;  4HTU A;  5J2Q A;  2NRZ A;  2P9N A;  3AVM A;  3C6T A;  3ENO A;  2DTU A;  3GG4 A;  1IBK K;  4ELU A;  4DTU A;  1CXQ A;  3E9L A;  3OYN A;  1HPM A;  4H5N A;  3ULD A;  3VOV A;  4M3Y A;  3VN5 A;  3A8Y A;  1F21 A;  4FZX C;  2P1J A;  3WQT A;  4BC3 A;  3K59 A;  2HMP A;  4M7Y A;  4FLY A;  5I3U A;  1TUU A;  1H1V A;  3O9S A;  3VES A;  4LD0 A;  3U3Y A;  4R79 A;  2RPI A;  3TAE A;  4H0X B;  1NGF A;  4KHW A;  2GX9 A;  3QBX A;  3OYM A;  4E1J A;  4NLC A;  3DOL A;  1X1P A;  1WAF A;  4HHT A;  4FLT A;  2GEL A;  3VQ6 A;  5JVG L;  4NCB A;  3H6E A;  2Q2R A;  1TL1 A;  2HNZ A;  1Q9Y A;  3EN9 A;  2P9N B;  5KPZ A;  3MN9 A;  1S3X A;  1HJO A;  4YDU C;  5LJW A;  3F73 A;  1BWF O;  4CZJ A;  3DLL L;  4IO8 A;  2IC3 A;  3RR7 A;  2OA8 A;  4QAG A;  2R7Y A;  3O9R A;  4DTN A;  1IKX A;  2E6L A;  2Z1I A;  1EQY A;  4FLZ A;  3JYT A;  3HVT A;  4FJJ A;  3LP1 A;  4U7B A;  2BAN A;  3OJS A;  4B1X B;  2P5G A;  2E4L A;  4BRQ A;  4IKF A;  1RBU A;  4RW8 A;  1GOB A;  1TGO A;  1JLB A;  1ASV A;  1T8E A;  1Y97 A;  3DM2 A;  1D8Y A;  2O4I A;  1EX4 A;  4E89 A;  3B6P A;  3QBW A;  5EU7 A;  3CXC M;  1BGX T;  5C42 A;  3SYZ A;  3J7A P;  3O4N A;  2W40 A;  3C94 A;  1OKJ A;  4JKG A;  3PIO L;  4DU4 A;  5KQD A;  1M1K O;  4O44 A;  4EFH A;  5HOO A;  1NK5 A;  4KI4 A;  4ICL A;  4A57 A;  3WXL A;  3CER A;  4CHY A;  3WXI A;  4DTM A;  1NK7 A;  5FPE A;  4C8O A;  3CQ8 A;  4CVN E;  1C1A A;  3O1W A;  2IGI A;  1NKC A;  3CME N;  3P83 D;  1VQ6 N;  3NF7 A;  4DG1 A;  3VQ4 A;  4CJT A;  4KHQ A;  5LL6 Z;  4AQY K;  4CK2 A;  4ISE A;  5C25 A;  5JIC A;  4B3O A;  3S3O A;  3LDP A;  3OS2 A;  5KGX A;  2QWP A;  4I9L A;  3VQ8 A;  3WEE A;  1YT3 A;  3FZL A;  4CFA A;  3LZJ A;  2DFF A;  4B1W B;  5KI6 A;  4CFC A;  1HNI A;  4B9V A;  1QHA A;  4CIG A;  1NK8 A;  3AVG A;  4CZI A;  5HRO A;  2CH5 A;  4NYN A;  3NAE A;  1N33 K;  2QEX N;  1X9M A;  4J2D A;  4IEE A;  1ZXO A;  4CGG A;  4GVM A;  4CZK A;  4I2Q A;  5TKY A;  1QQN A;  3TSP A;  3WT0 A;  1NJY A;  4B3T K;  1MWM A;  2X78 A;  4DB3 A;  1QTM A;  2FSN A;  3IFR A;  3PIP L;  4LF6 K;  3QFU A;  2QWL A;  3D45 A;  4JKG B;  3T1H K;  1NGI A;  4BAC A;  2XY8 A;  3HK2 A;  3L2U A;  4A61 A;  3OYB A;  3TAN A;  3DLG A;  3OYL A;  1ZC6 A;  4IZ9 A;  4CJ3 A;  4A5B A;  1N8R O;  5JMV A;  4EHU A;  2WON A;  2IVP A;  4BQZ A;  5C2F A;  1KVA A;  2O8D A;  1VK0 A;  3A5O C;  4CJV A;  1HKB A;  1VQL N;  1NGB A;  1BCM A;  1V4S A;  2GBZ A;  5C10 A;  3O6W A;  3OBY A;  4I7F A;  4PUO A;  3RWU A;  1X3M A;  4GKJ K;  4LF8 K;  2CH6 A;  1VSM A;  2WC9 A;  5AQS A;  1DGK N;  3Q7B A;  3M6G A;  3T1Y K;  3DJC A;  3VQC A;  4AHV A;  5F0X A;  5IWA K;  3OYE A;  2ZD1 A;  4M3W A;  1HR0 K;  4FJ9 A;  3BZC A;  3AVL A;  4XH1 A;  1NK6 A;  4OO1 J;  1JL2 A;  4JD2 A;  1A5X A;  1KLN A;  3I56 N;  5CHI A;  4BC4 A;  1Q7Y O;  1QSY A;  3ITH A;  2Q97 A;  1ZYQ A;  4CGH A;  3HPO A;  1S9E A;  2G8W A;  2VGM A;  1HJR A;  1HLU A;  3DXK A;  4LF9 K;  2W6K A;  3P38 A;  1RTH A;  4BRG A;  1RTI A;  3MXJ A;  4JI6 K;  4CJF A;  2HHS A;  3HXM A;  4FJL A;  1NKB A;  4RWT A;  3MN6 A;  4FWK A;  3HPG A;  1FK9 A;  4FJG A;  1QZ5 A;  4JV5 K;  4FK0 A;  1BOT O;  5FPM A;  1FXX A;  3V1Q A;  1JXB A;  3LWM A;  4K41 A;  3CFP A;  1RBV A;  4KHN A;  2O8D B;  5KPR A;  4DSE A;  2ASO A;  4EZ6 A;  4KKO A;  3SJJ A;  1BA1 A;  2ZM6 K;  1DT9 A;  2UUA K;  3J8A A;  4ISG A;  4BRN A;  5BRH A;  4IJA A;  3L4I A;  4JI5 K;  1EP4 A;  2YNI A;  1WSE A;  3RTV A;  1JCG A;  3SV4 A;  4K42 A;  2YHA A;  2CGJ A;  2VYP A;  2O8F A;  4JD2 B;  4BDP A;  1IJJ A;  1OH5 A;  4DQR A;  2YHW A;  4XIU A;  2WOM A;  3KKR A;  2P9U A;  3C0B A;  4DR5 K;  4LFC K;  4W5R A;  3L2Q A;  1C1B A;  3CQX A;  3DXK B;  1S1T A;  5CYQ A;  4DSJ A;  1K8A O;  1BCO A;  5KRT A;  4I6M A;  1VRT A;  2D5R A;  1JCF A;  1XNR K;  3MMV A;  4QS7 A;  1RDD A;  2QKK A;  2VWK A;  1HQU A;  2ZGZ A;  1RT4 A;  2D0C A;  1WSF A;  3EZ5 A;  4CEF A;  3QIN A;  1NG9 A;  3SLC A;  1C0M A;  1CZ9 A;  4CJL A;  1L3S A;  2ITM A;  4OGC A;  4MQ3 A;  2G8V A;  4FWL A;  1VSD A;  4PKH A;  5CZ2 A;  2EWS A;  1SL2 A;  2VGN A;  4JI1 K;  1MU2 A;  4N56 A;  3IUC A;  2HF3 A;  2FSK A;  4FZZ A;  5LJV A;  1YI2 N;  4BRL A;  1Z26 A;  4CFD A;  1YHQ N;  2PYL A;  4E7L A;  3LAM A;  5E41 A;  4KTZ A;  3RR8 A;  1LWF A;  5AQK A;  3LAK A;  4EHT A;  3MX2 A;  3SAG A;  1S72 N;  3SUP A;  2YV0 X;  4IEI A;  1Z6R A;  3ID6 A;  1NJZ A;  3KJV A;  2P9U B;  3CJA A;  4CK1 A;  1OVQ A;  2D0B A;  3M3Z A;  3OY9 A;  1ATR A;  2NRV A;  4I6M B;  3TAB A;  3G71 N;  1N36 K;  3MCP A;  3VQD A;  3ALY A;  4C1N K;  3DLB A;  3QML A;  4MDA A;  1VHX A;  2VG7 A;  4KI6 A;  1JLC A;  5AQP A;  4ELV A;  3SBG A;  1S9G A;  3DXM A;  1RT2 A;  4KAZ A;  4DF8 A;  3DLR A;  4DTJ A;  2BE2 A;  3F5T A;  1BA0 A;  3ZLJ A;  3QNO A;  3P4I A;  3VER A;  4DFK A;  4FSV A;  1WOQ A;  2HB5 A;  1BG3 A;  1WSH A;  5HBM A;  4CJ4 A;  4DSK A;  3LAN A;  3UKR A;  2ASM A;  4KRF A;  3VEN A;  4CJW A;  3PX6 A;  3HPH A;  3C95 A;  4FK4 A;  4W5N A;  2OYQ A;  4OPA A;  3PUF A;  1JLA A;  2NZT A;  4FJI A;  4FJ8 A;  3D7E O;  5HLF A;  3LP3 A;  4JKH A;  3THY A;  4GY2 B;  4CCH A;  3CI5 A;  4QCL A;  4FYD A;  1QHT A;  3QIO A;  1BUP A;  3R6M A;  3LM2 A;  1WB9 A;  4KV8 A;  4OPK A;  4DV3 K;  4KTQ A;  4WFA L;  3MXM A;  3D6R A;  1E3M A;  4O8K A;  3HOS A;  2VG6 A;  3GL1 A;  1NKE A;  1U45 A;  2B4J A;  4FL9 A;  5H1S Q;  4CHZ A;  4FXD A;  1QQM A;  4CJR A;  2UXD K;  4JYA K;  5AQF A;  1RFQ A;  2PZS A;  4ID1 A;  3MXI A;  2X74 A;  3TAF A;  1O13 A;  2OPS A;  3K5O A;  3HT3 A;  1J6Z A;  4XH4 A;  2Q3S A;  1SL0 A;  3CYM A;  3UKR B;  2W6L A;  4NXM K;  4JI7 K;  4LH5 A;  4WYB A;  4TSX A;  5AJ3 K;  1BDG A;  2E1Z A;  2HHV A;  4BE1 A;  4X66 K;  5HRN A;  3ZT2 A;  4DU3 A;  3W0L A;  4C8K A;  5F2R A;  2P9L A;  4Y1D A;  4GV9 A;  4CFB A;  3EO3 A;  2QXL A;  3P31 A;  3THY B;  1XMO K;  4JKA A;  1NGD A;  4C8L A;  3CCM N;  1UAX A;  1S1V A;  5AQJ A;  4CHP A;  4CJK A;  2PAV A;  4CF9 A;  3QB0 A;  2Q0R A;  5BN9 A;  1VQP N;  1GLJ O;  3MCA B;  2FSJ A;  1BHL A;  3ZT0 A;  5AQR A;  4L8R B;  2FF6 A;  4DSF A;  4BRC A;  3KK3 A;  5BR8 K;  1NMN A;  1P8Z A;  5CR4 A;  4FLX A;  4Z4E A;  4AHT A;  1NWK A;  1A5V A;  2V51 B;  4FPB A;  1KCF A;  2QI2 A;  4JK9 A;  2HHH K;  3LDN A;  1TKX A;  2DFE A;  4CGJ A;  2IDO A;  1SAZ A;  2O8B A;  5ADX A;  2XY7 A;  3AVK A;  1YJN N;  3HJF A;  1KD1 O;  5M1F A;  1DTQ A;  3I8B A;  4X64 K;  2ZJQ L;  3E9P A;  3CF5 L;  4QOZ B;  3TR8 A;  4IG3 A;  4CZH A;  1SKS A;  3L8B A;  1YF5 L;  4Q5V A;  2V7Y A;  3ZET A;  2P9L B;  4BR5 A;  4CZF A;  1Q9X A;  5E84 A;  2O8E A;  3OS1 A;  4DF4 A;  3WNG A;  1IKW A;  3SK3 A;  1JJ2 M;  1Q8I A;  2NUB A;  4FWS A;  1D9D A;  1K6Y A;  1YJW N;  3C6U A;  2D4W A;  3LPT A;  1GOC A;  2G8K A;  3CCS N;  4QS9 A;  3O4Q A;  2HST A;  3ATV A;  3ZSR A;  4W5Q A;  4DCH A;  3P1G A;  5DK5 A;  5KPT A;  1SZ2 A;  1TK8 A;  1YUW A;  3T19 A;  2P51 A;  1VQ5 N;  4N47 A;  1B9D A;  2IVN A;  1HYS A;  5AQX A;  4E7K A;  1MA9 B;  3OYF A;  4B08 A;  3AVA A;  1Q81 O;  3NVM A;  4CZM A;  4FW2 A;  3SQ2 A;  4L3Q A;  2O8B B;  3IG1 A;  3NE6 A;  4DQP A;  4WFB L;  1GLF O;  5SZT A;  3I0S A;  3V4I A;  2CGK A;  2RE2 A;  5BR9 A;  4E0D A;  1RT1 A;  1GLE G;  3CJC A;  3OS0 A;  2NNW A;  2FLO A;  3G10 A;  3VEZ A;  5GIP A;  4F2S A;  3LDO A;  4RTF D;  5J1E A;  2HHU A;  4FWM A;  4NCG A;  5HRP A;  1NJX A;  2YNH A;  1NU0 A;  3ZET B;  1HQE A;  3EEQ A;  4DR6 K;  4FVM A;  5AQZ A;  2O8E B;  3CJ1 A;  4ID5 A;  4DV1 K;  3ZSW A;  4YOU A;  3JAM O;  3HL8 A;  3VEY A;  2AA4 A;  3EL2 A;  4KHS A;  4DSL A;  1NGE A;  4A59 A;  1XWL A;  3HBT A;  2E2O A;  3THW A;  1RT3 A;  3KKS A;  1BL3 A;  2HBJ A;  4ISF A;  4CJS A;  1TK0 A;  3BZK A;  1GOA A;  4BRH A;  1U49 A;  4A5A A;  3THV A;  3D2E A;  3PV8 A;  3CCQ N;  3J80 O;  3CC7 N;  4CD1 A;  3FZH A;  4BR4 A;  1VQ9 N;  3OYJ A;  3CET A;  4PWD A;  1JCE A;  2OAN A;  5GAG P;  2NLX A;  4JN4 A;  2WUS A;  2QWM A;  4NB4 A;  4CJ5 A;  4DLG A;  3SZ2 A;  1HMV A;  4JNE A;  5C0Y A;  4M3U A;  2HW3 A;  3LZI A;  4FJK A;  2Z1J A;  4CZE A;  3G25 A;  3K2P A;  3WXM B;  3NGY A;  4KRE A;  3FZK A;  4Q0B A;  2QM1 A;  4CZL A;  1OH8 A;  3AAP A;  2FC0 A;  3DOK A;  3EKS A;  1HKG A;  3L2R A;  4OJR A;  4AHU A;  2IS3 A;  4B9N A;  3CC4 N;  3NHG A;  3H45 C;  3QET A;  1DLO A;  3DYA A;  5FPN A;  3PO5 A;  1L3V A;  1NGC A;  3CD6 N;  4CES A;  5ADX H;  3THW B;  3VTH A;  4ILH A;  3DLE A;  3HSC A;  4I2P A;  3J7Z O;  4DR7 K;  1WAJ A;  1TVR A;  3D2E B;  2OTL N;  1NOY A;  3O3G A;  4HUE A;  3M1F A;  3Q7C A;  1W0H A;  2A42 A;  2UYT A;  2I7N A;  2G8I A;  4ZTF A;  1N32 K;  2V7Z A;  4EIA A;  1T6D A;  5DMR A;  4HCC A;  4YOV A;  1N5Y A;  1NMD A;  4GV6 A;  3NGI A;  2JWK A;  1MDU B;  2O4G A;  5HL7 L;  4N76 A;  1NBW A;  4HWI A;  2B6A A;  4M7X A;  2X6S A;  4OLB A;  5A2Q O;  3RMD A;  2FF3 B;  2A6A A;  3TSU A;  3ULE A;  4BG9 A;  3P5J A;  4X62 K;  2PBD A;  1HNW K;  2KZZ A;  4BR2 A;  3K57 A;  1BIS A;  2IIR A;  2A5X A;  4DV4 K;  1SUQ A;  1YTU A;  2QWO A;  3L6Q A;  4FOI A;  1TKD A;  4NXN K;  3T7Z A;  1QE1 A;  4FM1 A;  1U2V A;  3M8S A;  5D3G A;  3PLA A;  2E2P A;  4DUY K;  3SPZ A;  3RMB A;  5AQL A;  3UE5 A;  4B3R K;  1QZ6 A;  3FZM A;  3NF6 A;  4B9U A;  2P9I A;  5CE3 A;  2JLE A;  4CEZ A;  4FCY A;  1TV6 A;  3ZX2 A;  4WCE L;  2KZM A;  4BRE A;  1Q86 O;  1KAX A;  4JKC A;  4FJ5 A;  1J9A A;  4OKK A;  3NMU A;  1QVG M;  1RT7 A;  3NH0 A;  1RDU A;  5AQH A;  3IDH A;  3TTF A;  4A62 A;  1NM1 A;  1VSH A;  1JXE A;  1GLC G;  3LPU A;  2OZM A;  2YHB A;  3VF6 A;  1X9J A;  2AP1 A;  3D0P A;  2VQE K;  4KH6 A;  3DRP A;  1QSS A;  3W3D A;  2VG5 A;  4H0T B;  1Z25 A;  4H4O A;  5AQN A;  3ULE B;  5C24 A;  3OYA A;  3U4L A;  5KTQ A;  4IOA L;  5DM7 L;  3H08 A;  2VWJ A;  4CE9 A;  3SUQ A;  4OKJ A;  5AQV A;  3PSF A;  4ILJ A;  4JAX A;  3WNE A;  4QS8 A;  3HST B;  4UQG A;  1S6P A;  1E4G T;  3TTC A;  2P9P A;  3KIO A;  5K14 A;  1U2V B;  4WQ5 A;  4BC2 A;  3U8X A;  2KLA A;  3VGK A;  1BIZ A;  4FK2 A;  1U04 A;  3HP6 A;  4M42 A;  1ZBS A;  1XHX A;  2P9I B;  1ILY A;  3CCU N;  1ATS A;  1T3V A;  3DAW A;  3SV3 A;  1FJG K;  3GBT A;  3GOI A;  2YKN A;  3TTD A;  4BRK A;  5LMU K;  2AJQ A;  1LAV A;  4HUG A;  4MDB A;  3BGR A;  4B9T A;  4J2A A;  4KB1 A;  1X3N A;  4FZY A;  4JEP A;  5AR0 A;  1B92 A;  4E7I A;  1LV5 A;  4I9Q A;  3SQ1 A;  2RF2 A;  4EP5 A;  1NJW A;  4F3O A;  4KB0 A;  1WBD A;  3GDQ A;  3QIP A;  3CJB A;  3MEG A;  4JI0 K;  3SQ4 A;  1M90 O;  3CIP A;  5EVZ A;  4E1M A;  3ZSQ A;  5I42 A;  3NVK A;  3O3H A;  3FR0 A;  3LAL A;  4BRM A;  3QEV A;  4NLB A;  3MAQ A;  3TAQ A;  4FM0 A;  1R0A A;  2E2N A;  4DTS A;  3NBP A;  5HP1 A;  1NJI O;  4JI3 K;  1VAZ A;  2P9P B;  5M1P A;  1UWB A;  3AY9 A;  4CEC A;  3IRX A;  3V9Z A;  3MEE A;  4OX9 K;  1HX1 A;  1KVB A;  3FLC O;  5ELZ A;  3OJU A;  5GAE P;  2NRX A;  3MWT A;  4B1Z A;  2KFN A;  3K5N A;  4B1V A;  1B9F A;  1I3A A;  1LCU A;  5EOY A;  2PY5 A;  1X9S A;  4C23 A;  3KWG A;  3V1O A;  3G4S N;  1C0G A;  2GV9 A;  4DU1 A;  3G6E N;  1QQO A;  3C7N A;  4KPY A;  4IDH A;  3QNN A;  3ZSV A;  2D0A A;  3VF4 A;  3AAR A;  1P90 A;  3QLH A;  4BR9 A;  4DQQ A;  2Q31 A;  1NK4 A;  4MO5 A;  4W5O A;  3S41 A;  1VQM N;  3KLF A;  2Z1H A;  4LF7 K;  5M1N A;  4BRO A;  4JRQ A;  3O4W A;  1EWR A;  5J2P A;  4CEE A;  3NH2 A;  3KLH A;  3OA9 A;  4C8N A;  3S3N A;  4F2R A;  4AIL C;  3N4P A;  4FWP A;  3RMA A;  3KZB A;  4B9M A;  3WNF A;  5J2M A;  3A5M C;  4WE1 A;  3WUH A;  4B9L A;  3AA2 A;  1BO5 O;  3H1V X;  1W9H A;  4RW7 A;  3BEX A;  4CJP A;  1QQC A;  3OBW A;  4FLW A;  3ZSY A;  2YJF A;  2HVI A;  4YOR A;  5JVH L;  1K9M O;  1EKE A;  3RRG A;  5BRF A;  5T7B A;  1D5A A;  3LL3 A;  3CM6 A;  3A5N C;  5AQU A;  3C7N B;  3ZT4 A;  5GIN A;  2RN2 A;  3K5L A;  3ID8 A;  2QXF A;  3BY5 A;  4DR3 K;  3VF2 A;  4ELT A;  3ENH A;  2HHX A;  5EXW A;  3RSE A;  4BY9 C;  1TUY A;  3AA5 X;  3SI6 A;  2FBV A;  5AZJ B;  3J81 O;  1QSL A;  1K8K A;  1XNQ K;  1VSL A;  5FDL A;  1KAY A;  5FRN A;  1D4X A;  1NNE A;  4JI4 K;  4ZTJ A;  3U9D A;  4K0K K;  3DI6 A;  2I5J A;  1WSG A;  2BDP A;  1KC8 O;  4B9S A;  4WF9 L;  3B8A X;  1S22 A;  3OYI A;  3J7Y P;  4PL8 A;  4IBN A;  5AQO A;  3KWI A;  4DHY A;  2UUC K;  4NCA A;  4Z0U A;  3RMC A;  4PY5 A;  4AF1 A;  5SWM A;  3E01 A;  2HOE A;  3WQU A;  2F96 A;  2ITG A;  3CHW A;  5BRE A;  3A5L C;  4G9Z A;  3TAG A;  4H5T A;  3E66 A;  3HM8 A;  2OZS A;  4AH9 A;  1YJ9 N;  3R8E A;  5LY3 A;  3KLI A;  3AO1 A;  2YKM A;  1JLG A;  3OYH A;  1FKP A;  1RGI A;  4BDY A;  3K9J A;  3CCJ N;  3VQ5 A;  2PYJ A;  2OPP A;  3RSE B;  4MFB A;  4CEB A;  4H0O A;  2NRH A;  4B1Y B;  4DV2 K;  4H5W A;  1K8K B;  1OH7 A;  3VPZ A;  1R59 O;  1G99 A;  1KXP A;  1U6Z A;  3AVI A;  4B3M K;  5AQI A;  3ZCM A;  4BRI A;  3ZYY X;  1BU6 O;  3HYF A;  3F9K A;  3TPQ A;  4JK8 A;  1CZB A;  3QDK A;  1VQN N;  1NK9 A;  4M3R A;  1RDC A;  4ZHR A;  1XI1 A;  3O8M A;  4IXC A;  4DTX A;  4BR7 A;  3AVN A;  4W5T A;  1EET A;  3I55 N;  1T03 A;  4IG0 A;  1LW2 A;  4KHP K;  1VSJ A;  4E7H A;  3TAR A;  2D0O A;  3L2V A;  4PHT X;  3KHY A;  1KAZ A;  1VSF A;  3WXJ A;  4OLA A;  3VGM A;  4C8M A;  4Z4F A;  4O4G A;  2RKI A;  1W97 L;  1KLM A;  4C1N I;  1LWC A;  2CGL A;  5M1K A;  3QEP A;  1VQ7 N;  1Q82 O;  3VA3 A;  1KTQ A;  4KH5 A;  2ZJR L;  3HZ6 A;  2O8C A;  3S3M A;  3NH1 A;  4R5P A;  2OCE A;  3ZT3 A;  3DLK A;  3ZSZ A;  5F1X A;  1KSP A;  3DRR A;  2RHK A;  3BUZ B;  2EHG A;  4IWV A;  4HCB A;  4CEO A;  5KQ8 A;  1T05 A;  3O3F A;  5KRS A;  4CF0 A;  5MLC Q;  4DUZ K;  3WNH A;  1VQ4 N;  2UXB K;  5BN8 A;  3TAM A;  4CGI A;  4IJN A;  4CK3 A;  4KO0 A;  1RDB A;  1QVF M;  3LDL A;  1OVY A;  3VA0 A;  1NGG A;  4FLV A;  3ZEU A;  3K9K A;  1EO1 A;  2Y1J A;  4KFB A;  3KLE A;  1EWQ A;  5C12 A;  5TKW A;  1S1U A;  2DY4 A;  4RG8 A;  3S9H A;  3CCL N;  2GUP A;  3KVG A;  4CHO A;  5AZI A;  3FFI A;  2D0P A;  3E1Y A;  1VRU A;  3ZSO A;  4CEQ A;  3PY8 A;  1RBT A;  1HPZ A;  2FXU A;  2P9K B;  3U3G A;  1YTA A;  5IT9 O;  4IFV A;  4X65 K;  4GV3 A;  2Z1G A;  4XH5 A;  2ASP A;  3H1Q A;  2O8C B;  1HNV A;  1EXQ A;  3LDQ A;  4DS5 A;  1YIT N;  4FWN A;  2FBT A;  3CJ9 A;  5EY4 A;  1WN7 A;  2B5J A;  4AHR A;  1U47 A;  3DLH A;  5GAH P;  1OH6 A;  4CBX A;  1NK0 A;  4B9Q A;  3I0R A;  4YOX A;  1RBS A;  4CGF A;  4Z4I A;  3L0Q A;  3V81 A;  1IH7 A;  3NCI A;  3FGU A;  3ZEU B;  1RTJ A;  1L3T A;  2WBN A;  2ZJP L;  4CJQ A;  4K8Z A;  2F9W A;  3KD1 E;  2KFZ A;  5B8H A;  3KK7 A;  3QO9 A;  4O5F A;  3MED A;  1T6C A;  3SBT A;  1J54 A;  1I94 K;  3HM9 A;  3F9M A;  2OPQ A;  3C65 A;  1CLQ A;  5BPN A;  3BDP A;  5AZI B;  4GNI A;  2XY5 A;  4WQ4 A;  5CYM A;  4HVJ A;  1L3U A;  4E7J A;  3ASM A;  3LP2 A;  2VCP A;  3O9T A;  5AQY A;  5BPL A;  3QEI A;  4CF1 A;  4FJN A;  4CZG A;  1GLL O;  2HNY A;  1ITG A;  2A41 A;  1D9F A;  4IFE A;  3T69 A;  2QWQ A;  4MO4 A;  1RDA A;  5C2D A;  2HBL A;  3K0S A;  4YFU A;  2E6M A;  2OPR A;  2IOC A;  4PKI A;  1N6Q A;  4Y1C A;  1GLA G;  2UUB K;  2IVO A;  2XO7 A;  4Z94 A;  2HND A;  1C0U A;  4RCH A;  4BC5 A;  4B1U B;  3O9Q A;  4F9O A;  2GWJ A;  1G15 A;  4JS5 A;  3QFP A;  1XHZ A;  5AQG A;  4JKF A;  2GWK A;  2QA4 N;  1BIU A;  1U4B A;  4DTO A;  1WUA A;  3CFR A;  4JS4 A;  3SUN A;  1Z05 A;  4KHY A;  3O5B A;  3OTO K;  3HOT A;  4LY7 A;  3I33 A; 
#chains in the Genus database with same CATH homology
 3TTC A;  1Z6R A;  2WFB A;  3AGK A;  2P9P A;  3ID6 A;  1HUX A;  1U2V B;  2P9U B;  3CCR N;  4WQ5 A;  1KQS M;  4BC2 A;  3CJA A;  5E26 A;  3U8X A;  2YX6 A;  2KLA A;  3VGK A;  2P9S B;  3M3Z A;  4NO7 A;  2F9T A;  5AFU H;  1YXQ A;  4BRF A;  3UKU B;  1ATR A;  2NRV A;  4I6M B;  1ZBS A;  2JWL A;  4JKB A;  3G71 N;  2E20 A;  2P9I B;  1ILY A;  3MCP A;  3CCU N;  1ATS A;  4C1N K;  1T3V A;  3DAW A;  1NGH A;  3CCV N;  3QML A;  4AM6 A;  2I7P A;  2HBM A;  4H03 B;  1MWK A;  4MDA A;  3GBT A;  3GOI A;  3SAF A;  4M63 C;  3TTD A;  4BRK A;  4JHD B;  4MDB A;  5AQP A;  4UY8 O;  1X3N A;  3SBG A;  4JEP A;  5AR0 A;  1CZA N;  3CQY A;  3SMS A;  5AQT A;  2J4R A;  3JXU A;  3TSQ A;  2DPN A;  3JS6 A;  3DXM A;  3FE1 A;  1Y64 A;  4WQ4 C;  1DKG D;  1LOT B;  3GDQ A;  3CJB A;  4BGA A;  4CJ7 A;  4DKW A;  1TYQ B;  3F5T A;  1BA0 A;  4MLH A;  3P4I A;  4KH4 A;  3VER A;  3CIP A;  4FSV A;  5EVZ A;  4IO9 L;  3TU5 A;  1M90 O;  1WOQ A;  2KHO A;  3NVK A;  3FR0 A;  1BG3 A;  4BRM A;  4K25 A;  3EE8 A;  3UKR A;  1E4F T;  2ASM A;  4NLB A;  3VEX A;  3ATU A;  2NRR A;  4FWO A;  3VEN A;  3BF3 A;  4FPA A;  2E2N A;  1NJI O;  1VQO N;  3MX5 A;  4OPA A;  1VAZ A;  2P9P B;  2NZT A;  5M1P A;  4DQ8 A;  4BGB A;  3DWL A;  2H3G X;  3FZF A;  3D7E O;  4H0V B;  3AY9 A;  4JKH A;  2BTF A;  4GY2 B;  1NGA A;  1NLV A;  3CI5 A;  1HX1 A;  3FLC O;  4J8F A;  5ELZ A;  3VET A;  4A2A A;  5GAE P;  2NRX A;  1BUP A;  3R6M A;  3MWT A;  4B1Z A;  3LM2 A;  3VEW A;  4B1V A;  1LCU A;  1HKC A;  3GE1 A;  5EOY A;  2E8A A;  2Q36 A;  4WFA L;  3D6R A;  1GLD G;  3KWG A;  3O1B A;  4LC9 B;  4O8K A;  4C23 A;  3EZW A;  4OPH A;  3G4S N;  1C0G A;  4WQ5 C;  4H0Y B;  3HOS A;  3VEO A;  3G6E N;  1QQO A;  4YDU A;  3H3N O;  3C7N A;  3GL1 A;  4IDH A;  3UKU A;  3CPW M;  3VF4 A;  4FL9 A;  3AAR A;  5H1S Q;  1P90 A;  2YJE A;  4BR9 A;  4IOX A;  1QQM A;  2Q31 A;  5AQF A;  1RFQ A;  4MO5 A;  3S41 A;  1VQM N;  2NRZ A;  2A3Z A;  1O13 A;  2P9N A;  3H3O B;  3ENO A;  5M1N A;  3GG4 A;  1J6Z A;  4XH4 A;  4BRO A;  5BPM A;  3QIC A;  3O4W A;  3E9L A;  3UKR B;  5AQW A;  1HPM A;  4H5N A;  2QW9 A;  3OA9 A;  3VOV A;  3LM9 A;  3OW2 M;  4WYB A;  3A8Y A;  3N4P A;  1BDG A;  2E1Z A;  2Q1N A;  4FWP A;  3WQT A;  3KZB A;  5I9E B;  5GIO A;  3A5M C;  4BC3 A;  3W0L A;  5F2R A;  2P9L A;  3FFK B;  3WUH A;  3ZX3 A;  4GV9 A;  1BO5 O;  4FWQ A;  3EO3 A;  3H1V X;  2QXL A;  4BQL A;  2HMP A;  3P31 A;  3BEX A;  1XUP O;  4M7Y A;  2HBK A;  4JKA A;  3IMX A;  1NGD A;  3CCM N;  3OBW A;  3N4Q A;  5AQJ A;  3IKM A;  2PAV A;  3QB0 A;  3VGL A;  3A0I X;  1TUU A;  1H1V A;  2YJF A;  3O9S A;  3VES A;  2Q0R A;  5BN9 A;  3EKU A;  4R79 A;  1VQP N;  4YOR A;  1GLJ O;  1NGJ A;  2YHY A;  1SQK A;  2ZF5 O;  3MCA B;  2FSJ A;  5JVH L;  1K9M O;  3MDQ A;  4YOY A;  2HF4 A;  5BRF A;  4H0X B;  1NGF A;  5AQR A;  2GX9 A;  3QBX A;  2FF6 A;  4BRC A;  1GLB G;  3LL3 A;  3A5N C;  4E1J A;  4NLC A;  5AQU A;  1P8Z A;  3C7N B;  5CR4 A;  5GIN A;  4CD3 A;  1NWK A;  4XEI A;  3VMF B;  2V51 B;  4FPB A;  3ID8 A;  2QI2 A;  4JK9 A;  2GEL A;  3LDN A;  4CBW A;  5JVG L;  3H6E A;  2Q2R A;  3SJH A;  3VF2 A;  3ENH A;  5EXW A;  3RSE A;  1SAZ A;  3EN9 A;  2P9N B;  4GVE A;  4BY9 C;  2KKZ A;  1TUY A;  3WEE B;  1SS6 A;  4H0P A;  3MN9 A;  5KPZ A;  5ADX A;  5AZJ B;  1S3X A;  5EX5 A;  1K8K A;  1HJO A;  1YJN N;  4YDU C;  5LJW A;  1KAY A;  1KD1 O;  2OTJ N;  1BWF O;  5M1F A;  4CZJ A;  1D4X A;  2E2Q A;  3I8B A;  3MN7 A;  4IO8 A;  3DLL L;  3U9D A;  2ZJQ L;  3E9P A;  3O9R A;  3CF5 L;  2Q0U A;  2A40 A;  1DEJ A;  1EQY A;  4CZH A;  1YF5 L;  2V7Y A;  1KC8 O;  5AQM A;  3CPE A;  3ZET A;  4U7B A;  2P9L B;  4BR5 A;  3B8A X;  4MLE A;  1S22 A;  4CZF A;  4WF9 L;  4PL8 A;  5E84 A;  4B1X B;  5AQO A;  3KWI A;  4BRQ A;  4ILG B;  3R1X A;  4DHY A;  3VTI A;  3C6A A;  3SK3 A;  1JJ2 M;  4FWS A;  1ATN A;  2V52 B;  4AF1 A;  2QWR A;  5AQQ A;  1YJW N;  2D4W A;  2HOE A;  4AM7 A;  3WQU A;  3HRG A;  3CCS N;  2ZGY A;  3CHW A;  5BRE A;  1VQ8 N;  4QS9 A;  3P39 A;  3A5L C;  4H5R A;  3SAH A;  4G9Z A;  2HST A;  3ATV A;  3BF1 A;  4H5T A;  4DCH A;  5KPT A;  1SZ2 A;  3E66 A;  3HM8 A;  2D1K A;  1YJ9 N;  1YUW A;  3QBW A;  3R8E A;  5LY3 A;  3CXC M;  1VQ5 N;  2IVN A;  2W40 A;  2VWB A;  5AQX A;  1OKJ A;  4JKG A;  3PIO L;  1MA9 B;  5KQD A;  1M1K O;  4EFH A;  1RGI A;  5HOO A;  3K9J A;  1Q81 O;  3M5R A;  3NVM A;  4CZM A;  3CCJ N;  4A57 A;  3WXL A;  3CER A;  3RSE B;  3WXI A;  4H0O A;  4FVU A;  4L3Q A;  5FPE A;  2NRH A;  4B1Y B;  4H5W A;  4FOE A;  4WFB L;  2QWN A;  1K8K B;  1GLF O;  3O1W A;  2CGK A;  2RE2 A;  3CC2 N;  3U9Z A;  3VPZ A;  3CME N;  1R59 O;  1G99 A;  1KXP A;  5BR9 A;  1VQ6 N;  1U6Z A;  1GLE G;  3CJC A;  5AQI A;  2NNW A;  3AGR A;  2FLO A;  5DM6 L;  3L4Q A;  4ISE A;  3VEZ A;  3ZYY X;  4BRI A;  3LDO A;  5JIC A;  4CBU A;  5GIP A;  4RTF D;  1BU6 O;  4FWM A;  3LDP A;  3TPQ A;  2QWP A;  3ZET B;  4YOT A;  3WEE A;  4JK7 A;  4JK8 A;  3R3L A;  4BRP A;  3FZL A;  5AZJ A;  3QDK A;  5AQZ A;  4B1W B;  3CJ1 A;  1VQN N;  3ENB A;  3WXK A;  1QHA A;  3O8M A;  1Q18 A;  2NRT A;  4IXC A;  4CZI A;  4YOU A;  3VEY A;  2CH5 A;  2AA4 A;  4BR7 A;  2QEX N;  3EL2 A;  3O9U A;  1IG8 A;  4IEE A;  1NGE A;  4A59 A;  1ZXO A;  4CZK A;  3I55 N;  4BRD A;  3HBT A;  2E2O A;  5TKY A;  1QQN A;  3TSP A;  3WT0 A;  2D0O A;  1MWM A;  4PHT X;  3KHY A;  4DB3 A;  1KAZ A;  2HBJ A;  4BRA A;  4BVO A;  3EE9 A;  2FSN A;  3AAQ A;  3IFR A;  4ISF A;  3WXJ A;  3VGM A;  3PIP L;  2BUP A;  3QFU A;  2QWL A;  4BRH A;  4A5A A;  4JKG B;  1W97 L;  1NGI A;  3D2E A;  4Y0W A;  3CCQ N;  4C1N I;  3MWP A;  2CGL A;  2E1Y A;  4A61 A;  5M1K A;  1VQ7 N;  3E9O A;  3CC7 N;  4CD1 A;  3FZH A;  1ZC6 A;  2E88 A;  4BR4 A;  1Q82 O;  4IZ9 A;  1VQ9 N;  3CET A;  4A5B A;  4KH5 A;  2ZJR L;  1N8R O;  4IOC L;  3HZ6 A;  1JCE A;  2OAN A;  4EHU A;  5JMV A;  2IVP A;  4BQZ A;  4EAH D;  5C2F A;  5GAG P;  2NLX A;  4JN4 A;  4FO0 A;  2WUS A;  4K43 A;  2QWM A;  2F7T A;  4NB4 A;  5AFU A;  3A5O C;  3H46 O;  1HKB A;  1VQL N;  1NGB A;  5F1X A;  3MN5 A;  4BG8 A;  1V4S A;  1RDW X;  4JNE A;  2RHK A;  3BUZ B;  3ZX0 A;  1YVN A;  5C0Y A;  4IWV A;  5C10 A;  5KQ8 A;  3O6W A;  3OBY A;  5MLC Q;  4CZE A;  1X3M A;  3OHR A;  3G25 A;  4H5V A;  2CH6 A;  5AQS A;  2WC9 A;  3WXM B;  3FZK A;  1VQ4 N;  5C15 A;  1DGK N;  2GEM A;  2QM1 A;  3M6G A;  3Q7B A;  5M1Q A;  4CZL A;  5BN8 A;  3AAP A;  3DJC A;  3EKS A;  4IJN A;  1HKG A;  3D2F A;  5F0X A;  1QVF M;  3LDL A;  1OVY A;  1NGG A;  3CC4 N;  4HTL A;  3H45 C;  4XH1 A;  4OO1 J;  4JD2 A;  3ZEU A;  3K9K A;  5FPN A;  1EO1 A;  3I56 N;  5CHI A;  4BC4 A;  1Q7Y O;  1NGC A;  5C12 A;  2Q97 A;  1XQS C;  5TKW A;  3CD6 N;  5ADX H;  1W2B M;  3VTH A;  2VGM A;  3HI0 A;  1HLU A;  3DXK A;  1C0F A;  4ILH A;  3HSC A;  3P38 A;  1T44 A;  2GUP A;  3CCL N;  3KVG A;  4BRG A;  3J7Z O;  2NRW A;  5AZI A;  3D2E B;  4RWT A;  2OTL N;  2D0P A;  3MN6 A;  4FWK A;  3E1Y A;  4CI6 A;  4KBO A;  2FXU A;  1QZ5 A;  3M1F A;  2P9K B;  3Q7C A;  4GV3 A;  2A42 A;  2UYT A;  3F2K A;  1BOT O;  4XH5 A;  2I7N A;  5FPM A;  2ASP A;  3H1Q A;  2GTD A;  2YHX A;  4YOW A;  2V7Z A;  4K41 A;  4EIA A;  1T6D A;  3UB5 A;  3LDQ A;  4YOV A;  3BP8 A;  5KPR A;  1YIT N;  4FWN A;  3CJ9 A;  5EY4 A;  1NMD A;  4GV6 A;  2ASO A;  2JWK A;  1MDU B;  1BA1 A;  5GAH P;  1DT9 A;  5HL7 L;  4WFN L;  3J8A A;  4ISG A;  4BRN A;  4CBX A;  5BRH A;  1NBW A;  4FWR A;  3O80 A;  4HWI A;  4M7X A;  4IJA A;  4B9Q A;  3L4I A;  3VEV A;  2FF3 B;  2A6A A;  3TSU A;  3ULE A;  1JCG A;  4BG9 A;  4YOX A;  3CJ7 A;  3CMA N;  4K42 A;  2PBD A;  3D2F B;  1V4T A;  4BR2 A;  3L0Q A;  2IIR A;  2A5X A;  4BVP A;  2CGJ A;  2VYP A;  3O08 A;  2QWO A;  3L6Q A;  3FGU A;  4FOI A;  4JD2 B;  3ZEU B;  1IJJ A;  4JKD A;  4PL7 A;  4BR0 A;  2WBN A;  1ESV A;  2YHW A;  3T7Z A;  2ZJP L;  2F9W A;  3C6H A;  3KK7 A;  5B8H A;  1U2V A;  4O5F A;  5JLF A;  2P9U A;  3C0B A;  1T6C A;  3SBT A;  2E2P A;  3PLA A;  3CQX A;  4O8U A;  3DXK B;  2P9S A;  3F9M A;  5AQL A;  3UE5 A;  1QZ6 A;  3C65 A;  3DXM B;  3FZM A;  3MK6 A;  5BPN A;  1K8A O;  1K73 O;  3SMP A;  4I6M A;  4GNI A;  5AZI B;  4WQ4 A;  2P9I A;  5CE3 A;  3R9P A;  1JCF A;  1VQK N;  3MMV A;  1YIJ N;  4QS7 A;  3ZX2 A;  4WCE L;  4BRE A;  1Q86 O;  4JHD A;  4U67 L;  1KAX A;  4JKC A;  2VCP A;  3NMU A;  2BH1 A;  2QTD A;  1QVG M;  3O9T A;  4IEI A;  1RDU A;  5AQY A;  2ZGZ A;  3IDH A;  5AQH A;  5BPL A;  5FPD A;  3TTF A;  4A62 A;  1NM1 A;  4CZG A;  1GLL O;  5JLH A;  2YCH A;  1GLC G;  3SLC A;  1XC3 A;  5BRD A;  2A41 A;  4IFE A;  2ITM A;  3T69 A;  3VF6 A;  3CCE N;  1X9J A;  2AP1 A;  2QWQ A;  4MO4 A;  5C2D A;  4KH6 A;  2P9K A;  2HBL A;  3HTV A;  4FWL A;  1TYQ A;  4H0T B;  4PKH A;  3W3D A;  5GAD P;  2EWS A;  4PKI A;  2VGN A;  1GLA G;  1YAG A;  2IVO A;  5AQN A;  3ULE B;  4Z94 A;  3U4L A;  3IUC A;  4RCH A;  2HF3 A;  2FSK A;  4B1U B;  4BC5 A;  4IOA L;  5LJV A;  1YI2 N;  2W41 A;  3O9Q A;  2GWJ A;  2PFU A;  4BRL A;  4F9O A;  3QFP A;  5DM7 L;  5AQG A;  4JKF A;  1YHQ N;  2GWK A;  2QA4 N;  2ZWH A;  4JKE A;  4PKG A;  5AQV A;  4JAX A;  4ILJ A;  1WUA A;  3RVC A;  4QS8 A;  1Z05 A;  5AQK A;  4EHT A;  3MX2 A;  3O5B A;  2YI1 A;  3SAG A;  3HOT A;  4A2B A;  1S72 N;  5M1O A;  1E4G T;  3I33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...