2QTDA

Crystal structure of a putative dinitrogenase (mj0327) from methanocaldococcus jannaschii dsm at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
MINMKVAISMDVDKISNSFEDCKYFLIVRIDDNEVKSTKVIFNDESGKKSIVKENVNAIICKNISEENYKKFSKKIEIYHAEGDDVDKNISLFIEGELSKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of the protein NP_247299.1: comparison with the crystal structure.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein MJ0327
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2qtdA00
1T3VA 2WFBA 1EO1A 2RE2A 1RDUA 1P90A 1O13A 2YX6A 2QTDA 2KLAA
chains in the Genus database with same CATH superfamily
4XH4A 3VEZA 4JYAK 4CEOA 3E9PA 1TUYA 1N34K 4W5OA 4N76A 2XY8A 4BQZA 4EFHA 1L3TA 3L2RA 5FPNA 3LM9A 3O4QA 4WQ5C 4JAXA 3M8SA 4DLGA 2ATQA 1O13A 4CGFA 3SLCA 4I9QA 2QI2A 3OYNA 1K8KA 2O8BA 1M1KO 1QTMA 1JLAA 1JL1A 2E2QA 1YAGA 3M8QA 4FJ5A 1J6ZA 1C6VA 3O3FA 1JJ2M 3ITHA 3L3VA 5JVGL 4CGIA 1NK6A 4JS5A 2Q0RA 4DU4A 2B5JA 1A5VA 3TI0A 4ID5A 3NGZA 1U2VB 3GOIA 4CZLA 4DSEA 4DR6K 3IDHA 4GV6A 2IAJA 4FWRA 4W5NA 3C7NA 3D2EA 3VF4A 4DWIA 4KRFA 3L3UA 3O6WA 3S3OA 3E1YA 4H4OA 1NJIO 3TAMA 3AVBA 1FKPA 5BPMA 3MEEA 1S9GA 5GAHP 3K9JA 2BDPA 3L6QA 3LPTA 3RSEB 5DM7L 5J2PA 2G8HA 4EAHD 3KK1A 5AQMA 4CJLA 1VQON 2Z1IA 1BL3A 3WXMB 4DV1K 1BCMA 4JI0K 3CHWA 3M8PA 3OYGA 4U7BA 3DXKB 4AHUA 4BE2A 1VSHA 2O8EB 3VQEA 1BHLA 4FYDA 3QLHA 5I42A 4DR4K 4DR2K 1LV5A 3MWTA 1TYQA 1HYVA 3KWIA 1RBVA 1X9MA 1KD1O 4J2AA 2RE2A 3LANA 4DV2K 3SAHA 3RRGA 3S3MA 3VQ4A 3LP1A 2QEXN 5D3GA 2EWSA 4BRIA 4I6MA 4B08A 1XWLA 3VPZA 5AZJB 4DV4K 4CJEA 1Q86O 1U2VA 4CEBA 1A5WA 3WT0A 4WE1A 3ZLJA 3P39A 4EZ9A 2PBDA 4BREA 3L0QA 1DEJA 3VEWA 4JI7K 4QCLA 3T69A 3CPEA 4WQ4C 4AM6A 4AQYK 1N6QA 4CZHA 4IZ9A 3ZX3A 4NYFA 1VRUA 1O1WA 5AQQA 5EU7A 4NXMK 4FSVA 4YOYA 2OPQA 3VESA 2HW3A 1QVFM 4H0XB 3J80O 1MWKA 3EEQA 3HK2A 4WFBL 5J2QA 3V9ZA 2NUBA 1SL2A 3FZKA 1BIZA 3K5NA 4BWJA 3JSMA 1V4TA 3NHGA 3OJSA 4JI2K 1NGJA 4B9UA 1J53A 1HKCA 3BZKA 4WFAL 4YFUA 3OHRA 4B9MA 2CH5A 5M1PA 4B1UB 4JI3K 3NH2A 4J2DA 1KXPA 3K58A 4N56A 3ULDA 3C94A 4CJRA 4JRPA 5C0YA 4FLXA 4UQGA 3R8EA 2DFEA 1VSMA 4JI5K 4BC2A 4YOXA 4CHQA 1P90A 2D0BA 4GV9A 4RCHA 4GMJB 4N41A 3O9TA 3VQDA 3D2FB 3HZ6A 3UKUA 2OTLN 4GY2B 3TU5A 1L3VA 1RTHA 4JK8A 4F2RA 3ZEUA 3EZ5A 3L2QA 1BDGA 1JLEA 3QBXA 4KAZA 5AZJA 2ASOA 4K8XA 5LMNK 3H3OB 4PL8A 3AVAA 2YNFA 2X74A 2W6LA 3AGRA 3WEEA 4BC5A 4A2BA 5C2DA 1C1BA 3PIPL 5AQUA 3E9LA 2E6LA 2NRRA 2OTJN 3VOVA 3DRPA 3WXJA 1HX1A 4IXCA 1HKBA 3VQ5A 3QEIA 2YHYA 4AF1A 1M90O 1BGXT 3ZT0A 3BF1A 3WNEA 2UUCK 3WUHA 3CCQN 4PL7A 2QWQA 1VQ7N 4FVMA 3TAQA 2QWMA 1UAXA 1N36K 1NMNA 2YHXA 3ZETA 3C6HA 5C15A 5AJ3K 3VF6A 2JWKA 3SYZA 2RHKA 4AM7A 1QQNA 1D4XA 2A3ZA 3NVMA 3ZT2A 2HNYA 2GEMA 4JHDA 3ZX0A 3QFUA 5KPTA 4KB0A 4KHYA 2E20A 4GNIA 5FRNA 4KHPK 3VGMA 3VENA 2D1KA 4A59A 3B6PA 1W9HA 5KI6A 1EWQA 3LALA 4B8CA 3DJCA 5A2QO 4LY7A 4NXNK 1CZ9A 2EX3A 2Q3SA 1I39A 3VETA 4KHNA 4MDAA 5TKYA 3O4WA 1B9DA 1VAZA 1ZYQA 4CI6A 4BGAA 1K8AO 2WBNA 4CHZA 1NGDA 4R79A 1NM1A 2BANA 3CMAN 1BA1A 3ZT4A 1ASVA 1TUUA 2O8FA 1C1CA 3T1AA 4NLBA 2E1ZA 1UOCA 3HYFA 1D9DA 1B9FA 3CC2N 4H5VA 1TKDA 3KVGA 3CXCM 3O9UA 4WFNL 3KTQA 3BEXA 3DLHA 1H1VA 2P9PA 1IKYA 4KB1A 3SJJA 4DS4A 1VSJA 2P9PB 4HTUA 5AQPA 3A0IX 2P9SA 3IS9A 4OPHA 2BGGA 1TK8A 2YNGA 4HCCA 3H45C 3CCRN 1GLDG 4O8KA 4M41A 1OVQA 2G8FA 3M3ZA 4KO0A 4LF7K 1XHXA 4MLHA 4DFMA 2A6AA 2HOEA 2O8FB 3SK3A 5BRFA 3JXUA 4W5QA 1I3AA 1XMQK 4I2QA 4FJ8A 3NDKA 4ZHRA 3C6AA 3QESA 4KTWA 2ZQBA 4C23A 3AO3A 4CF8A 3BUZB 1IG8A 3EE8A 3HM8A 2VWJA 1T6DA 4CZGA 1E4GT 4BG8A 4BQLA 3CJAA 1EP4A 1YTAA 3MCPA 5I3UA 3N4PA 4CGGA 3ZSRA 3IUCA 4DTJA 5HRSA 1YJ9N 2OCEA 4NCBA 4AH9A 3MX5A 1VSFA 3T7ZA 2AJQA 2F7TA 3S9HA 4FLVA 4CHYA 2ZJRL 4H0TB 3CCJN 1S1UA 1LWFA 2UXDK 2BH1A 4DF8A 3THXB 5T7BA 3WNHA 1L5UA 4E7KA 1LOTB 3FE1A 5JS2A 3KK7A 3DLBA 2O8BB 3AA3A 4FLUA 2EHGA 4FJXA 4A57A 3W0LA 5KGWA 2P9LB 1RT2A 5C2FA 4E7HA 4M42A 3AAQA 3HP9A 4K25A 3L8BA 3CIPA 1C0UA 3QFPA 5AQJA 4A62A 1P8ZA 1G15A 3QIOA 2IDOA 1RDDA 3ALYA 3FFKB 4CIFA 3A2FA 4IDKA 3NGIA 4CBXA 4U67L 4CZEA 4DSJA 3SI6A 1NK8A 1XNQK 1BIUA 3ID6A 5KPZA 2QKBA 2J4RA 3WNFA 1KVAA 4FLZA 2P9KA 2Z1HA 3WQUA 3NFAA 3J7YP 3D45A 3SMSA 3TSQA 2E88A 3WEEB 3RR8A 1C0TA 3TAGA 4B3MK 4E7JA 4CZFA 1KFSA 1NNEA 3MMVA 3I56N 3LWMA 4FJ7A 2P9NA 3AVCA 3SNNA 4OO1J 2NRZA 1VQ8N 3UKRA 1T03A 1RT1A 2HB5A 5KRSA 4CFCA 2WUSA 2YKMA 4LF8K 3TTCA 2FBTA 1ASUA 2P9UA 3IG1A 3CCVN 1TKXA 3AAPA 2HHVA 4DSIA 3SQ4A 3ZSXA 3LAMA 4DV7K 2AP1A 3VTIA 5KQ8A 4CF2A 3EKSA 1JLCA 2D0OA 1WAJA 1HKGA 1NK5A 3MCAB 4FK4A 3V81A 1BI4B 3LL3A 4HTLA 2NZTA 2KTQA 3PY8A 3HXMA 3V9SA 4X64K 1WB9A 4YOUA 1S1VA 4DU3A 3L2VA 4B9QA 1HPZA 3VF2A 2ZJPL 3T1YK 4DUYK 3B6OA 4JK9A 1HYSA 2WFBA 3G10A 4YORA 1HMVA 1GOAA 2R7YA 3O3GA 5LY3A 3V9WA 3OBYA 1NK4A 1YJWN 3G6EN 4G9ZA 3MECA 4Y1DA 4DV0K 1UWBA 2E6MA 1NJXA 4PUOA 4KTQA 4KH4A 4FWNA 1S3XA 4H0YB 4FXDA 2NRHA 1KLNA 1T05A 1W97L 1YF5L 5M1QA 4A5BA 3SQ2A 5LMUK 2QA4N 2I7NA 4R5PA 4K43A 4JRQA 1VHXA 3SUOA 5LJWA 3HBTA 4I7FA 3HOSA 4KHQA 3LZIA 4KH6A 4E0DA 4C8KA 3TSPA 4BR0A 1VK0A 4DF4A 3DLLL 5AFUA 3GBTA 4QS9A 3P1GA 3P4IA 4DTMA 1HNZK 3W3DA 3F5TA 1S1WA 5LL6Z 1FJGK 3ZCMA 2YI1A 2G8WA 5JLFA 5H1SQ 4DQRA 3O3HA 4KTZA 4LF4K 2YV0X 4HUEA 2FSNA 4BWMA 4FVUA 3O5BA 4FO0A 4HVJA 5AZIA 3ZETB 1HYZA 1L3SA 4OLBA 3TTDA 1ASWA 4YDUC 3M5RA 1VQNN 2HVHA 3J7ZO 1VQ4N 4CGDA 5BRDA 2GWKA 3CFPA 3OYMA 1Y97A 2D4WA 2KKZA 3J8AA 1WSEA 3UE5A 4PA1A 3P31A 4DR5K 3V1RA 3CCLN 4M3YA 3T19A 1S72N 4GVEA 3LP2A 2HHQA 3CPWM 1OVYA 5F2RA 3VQPA 3U3GA 3IAYA 2X6SA 1FKOA 5AQIA 4BACA 5GAEP 2GX9A 1JL2A 2HNDA 1RNHA 2QWOA 1N5YA 2X6NA 4C1NI 4XH5A 1RBSA 4CJ5A 1NG9A 3GL1A 3HPGA 3O08A 5E84A 2BTFA 4FM0A 2VGMA 1A5XA 5KGXA 3CQYA 1K9MO 5C12A 1OH6A 4O5BA 4LF6K 3AA2A 3V4IA 3CG7A 3TANA 3VA0A 4FM2A 4FM1A 1R0AA 1VQ5N 3MWPA 3VA3A 1T3VA 2XO7A 5CYMA 4L3QA 3VMFB 3AVIA 3HVRA 3I33A 3KLHA 2QW9A 5HRPA 1S6PA 4JD2B 3KD1E 3OS0A 1NGGA 4OLAA 5GAGP 3HI0A 4OPAA 4IFEA 3QIPA 3TAFA 1RDWX 3IFRA 4B9LA 3QEWA 3SUNA 2H3GX 4BRAA 1IKVA 1KAZA 4BR9A 4CIGA 2G8VA 3MK6A 3ENBA 2FSKA 1GOBA 3CYMA 1FW6A 4DFKA 3THYA 4F4KA 4XEIA 1JLQA 5FPEA 5HBMA 4H5RA 3LDNA 5AQZA 5AQXA 4GKJK 4CK3A 4DCHA 2VQEK 4PKGA 1QSYA 4DFPA 4JN4A 3VQQA 2Q0UA 1B92A 2FSJA 4OPJA 4FJNA 3GDQA 4FOIA 4DTOA 3DXMB 1DT9A 4K8ZA 4EZ6A 5HROA 4AHTA 5ELZA 4IG3A 3KK2A 4CE9A 2DFFA 2HBJA 4M7YA 3CJBA 1ZBFA 3A8YA 3CCEN 2V51B 3C0BA 2PYJA 1X9SA 3KLFA 3CC7N 3TAPA 1HPMA 1IO2A 4Z94A 3QEVA 1DTTA 5AR0A 1X9WA 1WSHA 5EXWA 3ZSZA 3OY9A 2O8CB 4FPBA 5DK5A 3KLEA 4Z4CA 4WQ5A 5AQTA 1RDAA 2QWRA 2JWLA 3HP6A 4CZJA 4I6MB 3NH0A 2NRXA 4FLWA 4FW2A 1YXQA 4YOTA 2O8DB 4YY3K 3B8AX 2CH6A 1NK0A 3U3YA 1LW0A 1S1XA 4CEEA 3OYKA 3O9QA 1CZBA 4NYNA 5MLCQ 4CGJA 2KZZA 5AQRA 3DLKA 2OPSA 5CZ1A 5EX5A 2Q1NA 3OYJA 2ITGA 2VWKA 4MFBA 3TR8A 4EP5A 4JV5K 4BRGA 2F96A 4FJHA 1OH8A 3QINA 3FZMA 3SJHA 4DR7K 2Q36A 1RT4A 3CETA 4KPYA 1WNSA 3RSEA 4LFCK 4RW6A 4CJ7A 3O1WA 4QS8A 5ADXH 2HSTA 2WC9A 4NLCA 3UIQA 4DU1A 1QHAA 1SV5A 1SQKA 1SUQA 4MO4A 2UXCK 1LAWA 5HRRA 3SMPA 4BROA 3WXIA 1IV0A 3VN5A 4F8RA 3FLCO 3MXIA 3V1OA 3KWGA 3HPOA 3ZSQA 1NKBA 2O4GA 1KSPA 3PO5A 4CFBA 1NGAA 4J8FA 4DSLA 1BO5O 3RMAA 1E4FT 1SS6A 4JI4K 1NJWA 5SWMA 3C95A 1RDBA 3AGKA 3WXLA 3SQ0A 4BRNA 4OGCA 4BRCA 2QXFA 3OA9A 4OKJA 2QKKA 4IBNA 2ASPA 3CQXA 1GLBG 1W7AA 3P83D 2YNIA 1IJJA 1WUAA 5HL7L 1U45A 2Q97A 4KI4A 1RILA 3CI5A 4HCBA 3S3NA 3AVKA 3DAWA 4BR2A 4FK0A 3K2PA 3DLRA 5E26A 4DTRA 5GIOA 1CZAN 3RMDA 2CGKA 4JKFA 4B3TK 4RWTA 4CJPA 3SV4A 1Q82O 2NRTA 4PWDA 3BP8A 4MDBA 3AVJA 1QSSA 1WOQA 2QWNA 3I8BA 4RW4A 3KJVA 4H4MA 3DOKA 1EKEA 3T1HK 2P5OA 3FZFA 3SAGA 3OYHA 3IMXA 4LH5A 1NOZA 3NCIA 1Q18A 4X65K 3EN9A 4IWVA 4CJFA 4CJVA 5HRNA 3KIOA 1DKGD 4B9SA 4O0JA 3VEXA 3MEGA 4CIEA 5C10A 1L3UA 5ADXA 1NJZA 4DTPA 2BE2A 3EL2A 4NCAA 3D0PA 2IOCA 3AVNA 2YHAA 5JMVA 3RTVA 4FWQA 1NK9A 1RCHA 3R3LA 3K5LA 4CF0A 3QNNA 2IS3A 4N47A 4CHNA 4CGHA 4CW7B 4CJSA 3U9DA 3RR7A 4H0OA 4W5RA 1HJOA 3NBPA 5GIPA 4YNQA 3OYDA 3EKUA 4ZTJA 1ZBHA 1XMOK 2DY4A 3V9XA 4ZTFA 5M1KA 3LDLA 2V52B 3CF5L 4LF9K 1GLLO 3QB0A 5F0XA 4PHTX 4JK7A 4KHSA 1SAZA 4G1QA 3CM5A 4AHRA 3EZWA 3K5MA 2F9WA 5BN8A 1T44A 3H3NO 4CZMA 1BCOA 1LWCA 3TWHA 3AY9A 3AO1A 5IWAK 2HHSA 3VGLA 1VQLN 4CEDA 5AQVA 2A41A 3QBWA 5AQYA 1WSGA 2DFHA 1QHTA 4BRPA 2D5RA 3K57A 1SKWA 5AZIB 1YVNA 4FJLA 4CVNE 3AVLA 1JXBA 1Z25A 1XI1A 1XQSC 4AILC 3FGUA 4RW9A 3ID8A 4Y0WA 1N8RO 3G71N 5J2MA 3RMBA 1QQCA 5SZTA 4C8OA 1ZBSA 2VG5A 1LAVA 1BG3A 5BPNA 3ZT1A 3VERA 3C6UA 3MN9A 3ATUA 4LSLA 1YI2N 4KBOA 3RMCA 2NNWA 1C0MA 3VEYA 1GLAG 4DQPA 4A5AA 1KAXA 1KAYA 4KH5A 1GLJO 1VSDA 4NB4A 3VGKA 3L4IA 3RRHA 3OJUA 3ASMA 2XHBA 2P1JA 5CYQA 3QEPA 1KVBA 1VQKN 4DSKA 1RDCA 1EX4A 4TSXA 1MA9B 4YOWA 2YJEA 1HUXA 4WCEL 3HT3A 3O8MA 2HF4A 4DTNA 4BE1A 5BR8K 1Q8IA 1S1TA 3CCMN 3THYB 1WLJA 5FLXO 4OKEA 4DTXA 2HHWA 4BVPA 5CR4A 2FBYA 3LAKA 1Q9YA 1J5OA 4UY8O 3HO1A 2P51A 2ZE2A 4FJIA 3THWB 4CFDA 2IVNA 1LWEA 4MLEA 3OYIA 1VSLA 3NF9A 4LD0A 4CJ3A 1TL1A 1T8EA 3VEVA 5HLFA 3E66A 1QS4A 2PAVA 4AHVA 3R6MA 4DTSA 3O80A 3V6DA 5AQKA 1NJYA 3SZ2A 3I8DA 4KHWA 4H8KA 4OGEA 3RVCA 3NF8A 4GKKK 2D0CA 3TABA 3I0SA 3LPUA 1ZC6A 2VGNA 1U6ZA 1UA0A 1KTQA 4IO9L 2IGIA 4OPKA 2OPRA 1ITGA 1XHZA 4Z4IA 3AVHA 4ILHA 4PKIA 4IOCL 3KKRA 4DR3K 2FLOA 3TAEA 4CBWA 4CJQA 1J5EK 1TGOA 4C1NK 2HVIA 3CJCA 3VEOA 4KV8A 2GUIA 4MQ3A 4BDYA 2GBZA 1LCUA 1VSKA 2E1YA 3CQ8A 2VYPA 3PIOL 2KFZA 3A5MC 4FL9A 3K59A 4ELUA 4JNEA 1VQ9N 2QWPA 3U8XA 1KQSM 1NGHA 1I94K 1SL1A 2Q31A 4Z4HA 3SQ1A 1VSIA 3L4QA 5M1FA 3JS6A 1X3NA 2QK9A 4JKGB 2AA4A 3SV3A 3H1QA 4AHSA 3CMEN 4F9OA 4FJMA 5K14A 4LF5K 1DGKN 3HOTA 2I7PA 5AQOA 1NWKA 3QEXA 3HL8A 1WSJA 1EWRA 2UYTA 4FWPA 3VQ6A 3OBWA 1SL0A 4QS7A 4CBUA 3J81O 3DMJA 3PX6A 4IDHA 2Z1JA 4Z0UA 1HNVA 1VQ6N 4HWIA 4BC3A 4DR1K 4XIUA 1WSFA 1KFDA 1D8YA 5FPMA 2HHHK 5B8HA 3EE9A 2OYQA 3F9MA 1ATRA 3S41A 1TKZA 5CHIA 2XY5A 5FRMA 3DYAA 3PUFA 3MDQA 4IO8A 1U48A 3M8RA 3QNOA 1C1AA 1U04A 5J2NA 1W0HA 5KPRA 2QWLA 2ETJA 2V7YA 1U47A 3TSUA 2YCHA 4FCYA 3THVA 2PZSA 3H1VX 4PQUA 3NAEA 1NKCA 4FZXC 4ILGB 3FZLA 1T6CA 4DLEA 3J7AP 3VQBA 3ULEB 1ESVA 3KKSA 4MO5A 4ELTA 2IIRA 1BWFO 5AQGA 4RW8A 3IRXA 3P38A 3MXMA 1EXQA 3M1FA 2A40A 2UXBK 4Z4GA 4K42A 1C0GA 4JI8K 5C25A 2W41A 4CF9A 3BY5A 5FPDA 2KHOA 1U4BA 4IFYA 1KCFA 3G4SN 5F1XA 1EQYA 1REVA 3PX4A 2HMIA 1YHQN 3H46O 3VQCA 4FLYA 1NK7A 4BR5A 2YNHA 3AO4A 4YDUA 2D0PA 1Z6RA 2GUPA 3EYZA 4PKHA 2NRVA 4IG0A 3D6RA 5CE3A 3O4NA 3O9SA 4K41A 1Q9XA 2E5LK 5JVHL 3ATVA 4DHYA 1JLFA 4BRQA 3DM2A 5FROA 4E7LA 2D0AA 2W6KA 4BR4A 5KQDA 1F21A 3GE1A 4K0KK 2IVPA 3PSIA 3HM9A 3SUPA 3AVFA 2A5XA 4FOEA 1WSIA 4IEIA 1VRTA 2F4VK 3NF7A 4JKBA 1YVUA 1XUPO 4CEAA 3CJ1A 2HBKA 1VQPN 3H6EA 1JLGA 4E89A 1MU2A 4GVMA 3ZT3A 4JS4A 3G25A 4B9TA 4CHOA 4I2PA 4JI6K 1LW2A 2HNZA 3VQ9A 2YX6A 2P9KB 2YKNA 4BDPA 2VG7A 1RTIA 4EIAA 3NVKA 1GLEG 1E3MA 4ILJA 3F2KA 1GLCG 4CZIA 3F9KA 1NGBA 2X78A 2ZWHA 2E2PA 3P5JA 4W5TA 2E8AA 2ZF5O 1X9JA 4LFAK 2JLEA 1RBRA 3LM2A 3AA4A 3PX0A 3KD5E 4O44A 4B3SK 4DKWA 2P9IA 5M1OA 3NH1A 1RFQA 1R59O 5EVZA 4BE0A 1QSLA 2B6AA 2QTDA 4JKAA 4KREA 2VQFK 4E1MA 3U4LA 4GW6A 3ULEA 4BR7A 4O5FA 3R1XA 3EY1A 3R9PA 2XY6A 3ZSOA 1GLFO 2ZJQL 4Y1CA 1JCFA 4CK1A 4BC4A 3Q7BA 4QOZB 4E7IA 1CXQA 3AVGA 2O8DA 2RPIA 3CC4N 1NGCA 3U9ZA 3ZSVA 4IJAA 1YT3A 1IG9A 3MN5A 4M3ZA 4BRMA 1ZBLA 3N4QA 3H08A 1KVCA 1QQMA 3SAFA 5AQLA 1HJRA 4DV3K 2O8CA 3GG4A 1TAUA 5I9EB 1RBUA 3LP3A 4H5TA 1V4SA 4M3RA 3OVNA 4FJJA 1NBWA 3D2FA 5C42A 3V9UA 5AFUH 5CZ2A 4HUFA 1HQUA 3TARA 3NF6A 4JKHA 4RW7A 4CK2A 5BPLA 1CLQA 2P9IB 3PO4A 4LH4A 4KHUA 3O1BA 2KFNA 1K73O 1WBDA 2FBXA 4M7XA 1YJNN 4JKGA 5C24A 3FR0A 3OTOK 4JLHA 4DSFA 3QICA 3DLGA 4OVLA 4ELVA 4FJKA 4DQIA 1X3MA 1NU0A 2V7ZA 1ATNA 2QM1A 4FWLA 3E01A 1TKTA 1NGEA 1VQMN 3KZBA 2PY5A 4DS5A 3LDPA 3ENOA 1TVRA 5JLHA 2ZGZA 2GELA 4M63C 4DFJA 4F3OA 1IBLK 2NLXA 4B8AB 4CD3A 2WTUA 5EOYA 1XC3A 4O55A 2UU9K 4E1NA 3MX2A 5HOOA 4BY9C 2CGLA 1RTJA 3AVMA 5AQSA 1TV6A 4CEFA 4ISEA 4E19A 2P5GA 5BR9A 4CJ4A 4ID1A 3AO5A 1NKEA 2BUPA 1NOYA 1QQOA 1JKHA 1HNXK 2I5JA 1YIJN 4O8UA 4ICLA 4E3SA 2F8TA 1Q7YO 3SPYA 4EP4A 3DRSA 5AQHA 2HBLA 2G8UA 2B4JA 4RTFD 1XC9A 2KLAA 3MN6A 4ISGA 4B3RK 2W42A 1CXUA 3WXKA 1UA1A 4Q5VA 2FC0A 4GV3A 1MWMA 2RKIA 1TAQA 4B1XB 1T7PA 4LSNA 2VG6A 4CESA 4B9NA 4CFAA 2F8SA 1MDUB 1TYQB 1QVGM 3DRRA 4M45A 5AQNA 4DQQA 3HRGA 4M3WA 1NLVA 2HHUA 4HHTA 4DTUA 1ATSA 3VTHA 4IOAL 4LFBK 1S6QA 3DXKA 2KW4A 2E2NA 2RN2A 4Z4EA 4H0VB 3KLGA 3LDSA 1S22A 3V1QA 5CY4A 1SKRA 3NMUA 1D9FA 1BISA 4N5SA 3D7EO 1HR0K 1IH7A 1Y64A 3UKRB 1XNRK 4RG8A 2ASMA 1FXXA 2P9NB 3K0SA 1ZBUA 2E2OA 2NRWA 4JKDA 4J2BA 2XRIA 2IC3A 4FWKA 4M3TA 5IT9O 1U49A 4FW1A 1KLMA 4WYBA 1JCGA 3K9KA 4JKCA 4BRKA 3OYCA 4HUGA 1DLOA 1RT5A 3LP0A 3O9RA 5DMRA 3UKUB 4YHHK 2YJFA 3BZCA 3CM6A 4FJ9A 1BQMA 1N32K 3QETA 4DQ8A 1K8KB 1JXEA 4IOXA 4CZKA 3VQAA 3L2WA 4J2EA 1D5AA 2HMPA 3L2UA 2Y1IA 2P9LA 4CHPA 4DG1A 3PV8A 2W40A 4FK2A 2WOMA 3ZYYX 3RWUA 1IKXA 1DTQA 3OYBA 3BF3A 1RGIA 3DWLA 3THXA 4Q0BA 2A1SA 1ZXOA 1Z05A 2FBVA 3OW2M 5HP1A 3HVTA 4CJWA 3UB5A 3C6TA 4OKKA 1FK9A 4IEEA 4BVOA 2KZMA 3K5OA 2YHWA 1YUWA 2OZMA 2HF3A 2G8IA 4H0PA 4O4GA 4EHUA 4KKOA 2OPPA 2Z1GA 4BRFA 4A61A 1QZ5A 5FDLA 4JD2A 2DPNA 2ZGYA 5KTQA 2O4IA 1G99A 3FFIA 4OJRA 4DQSA 4B1VA 3WNGA 1EO1A 3SBGA 4JI1K 4B9VA 4DV6K 4CERA 3LDOA 3HSCA 1YTUA 3CJ7A 2GTDA 3A5OC 3Q7CA 3A5NC 2LSNA 4DMNA 3AO2A 4FWSA 3AV9A 3QMLA 2F9TA 1BOTO 2ZD1A 2VCPA 3QERA 1SZ2A 3THWA 5E41A 3SUQA 4FZYA 4EHTA 4CEZA 1NGFA 3I55N 1HNIA 4CJKA 1J9AA 1IKWA 2KQ2A 2P9SB 3M6GA 2HHXA 3MN7A 1N33K 3LDQA 1QE1A 4X66K 4V19S 4NCGA 3MXJA 4CJUA 1TL3A 2A42A 3OS2A 1WBBA 4JEPA 3CJ9A 4CEQA 4WF9L 3ZSYA 5AQWA 1TK0A 3BDPA 1HLUA 3DLEA 1RDUA 1BI4A 4IFVA 4YOVA 4F3TA 3OYFA 1JLBA 2XY7A 1RTDA 2O8EA 1C0FA 1S5JA 1NGIA 3ZSWA 1HRHA 1RT3A 4FJGA 4BRDA 2OZSA 3CFOA 4F2SA 3F73A 4OX9K 3OYEA 4ISFA 3AARA 1X1PA 2P9UB 2OA8A 1ILYA 1JCEA 1EETA 4BG9A 4CD1A 4LC9B 3NE6A 4KI6A 2OANA 4E1JA 3KK3A 4KFBA 2CGJA 4M3UA 3QDKA 4BRHA 4DV5K 1RT6A 2JGUA 4DB3A 3HJFA 4CF1A 1WAFA 3C7NB 3D2EB 3QO9A 1HNWK 3SCXA 3FZHA 2FF3B 4C8MA 3SPZA 3MAQA 3LWLA 3CD6N 4FZZA 2WONA 4BRLA 1WN7A 2G8KA 3OYLA 4JHDB 1SKSA 5M1NA 3AA5X 1BU6O 1YITN 2E4LA 3HPHA 3OS1A 5KRTA 5BN9A 3VQ8A 3CCUN 4C8NA 2ITMA 1BUPA 3IKMA 4B1WB 4DUZK 5GADP 1OH7A 4NO7A 3DOLA 4CCHA 2UUBK 4CJTA 3G0ZA 4B3OA 5DM6L 1OKJA 4PY5A 1Q81O 5GINA 4BDZA 3EO3A 3ISNC 4L8RB 4JKEA 3PSFA 5BRHA 2GWJA 1S9EA 4B1ZA 3SBTA 3HTVA 3JYTA 5BREA 4X62K 3HSTB 3KHYA 2DTUA 1RBTA 2FXUA 1TK5A 3BGRA 3MEDA 4H5NA 4Z4FA 1QZ6A 1K6YA 3WQTA 2QXLA 1BQNA 4FWMA 5AQFA 4M3XA 3ZEUB 2PYLA 1Z26A 3LZJA 2IVOA 4WQ4A 1IBKK 2A1RA 1VSEA 1J54A 1W2BM 1NMDA 2ZM6K 3DI6A 3KLIA 3T3FA 3ZX2A 3JAMO 4O0IA 2VWBA 2HBMA 2FF6A 3TTFA 4AHCA 2YHBA 2Q2RA 5J1EA 4I9LA 4XH1A 3TPQA 1GOCA 3ENHA 2Y1JA 5TKWA 3E9OA 1KRPA 4QAGA 4C8LA 3CFRA 3CERA 3DXMA 2PFUA 2GV9A 4CECA 3OYAA 4H5WA 1ZBIA 2RF2A 3C65A 3CCSN 1OH5A 3NGYA 4H03B 5JS1A 1RT7A 4B1YB 5LJVA 4BGBA 4IKFA 4IJNA 1KC8O 3I0RA 4FPAA 3A5LC 4FWOA 4A2AA 1HQEA 1BA0A 2UUAK 5EY4A 2HHTA 3U6FA 4FLTA 3VQ7A 3PLAA 1IBMK 5JICA
chains in the Genus database with same CATH topology
4XH4A 3VEZA 2P9KA 3WQUA 3E9PA 3EL2A 5AFUH 1TUYA 5JMVA 4JKHA 3SMSA 4FWQA 2E88A 3TSQA 5BPLA 3WEEB 3R3LA 4BQZA 2P9IB 4EFHA 4CZFA 5FPNA 3O1BA 3LM9A 1K73O 3MMVA 4WQ5C 4JAXA 3I56N 4M7XA 3U9DA 1YJNN 2P9NA 4H0OA 4OO1J 1O13A 1HJOA 4JKGA 5GIPA 2NRZA 3SLCA 3UKRA 1VQ8N 3FR0A 2QI2A 1K8KA 3EKUA 3QICA 2WUSA 1M1KO 5M1KA 2E2QA 3LDLA 1YAGA 3TTCA 2V52B 2P9UA 1J6ZA 1JJ2M 3CF5L 1GLLO 3QB0A 3CCVN 1X3MA 5F0XA 3AAPA 5JVGL 4PHTX 2Q0RA 2V7ZA 4JK7A 1SAZA 2QM1A 1ATNA 2AP1A 4FWLA 3VTIA 3EZWA 5KQ8A 1NGEA 2F9WA 2D0OA 3EKSA 5BN8A 3KZBA 1VQMN 1T44A 3H3NO 1HKGA 4CZMA 1U2VB 3GOIA 3LDPA 3ENOA 3MCAB 5JLHA 4CZLA 2ZGZA 2GELA 3LL3A 4HTLA 2NZTA 3IDHA 4M63C 4GV6A 4FWRA 2NLXA 3AY9A 4CD3A 3C7NA 3D2EA 5EOYA 3VF4A 1XC3A 3VGLA 3O6WA 1VQLN 5AQVA 4YOUA 3MX2A 5HOOA 3E1YA 2CGLA 2A41A 3VF2A 4B9QA 3QBWA 2ZJPL 5AQYA 1NJIO 4BY9C 5AQSA 5BPMA 4BRPA 5GAHP 4JK9A 3K9JA 2WFBA 5AZIB 1YVNA 4ISEA 4YORA 3L6QA 5DM7L 3RSEB 5BR9A 4EAHD 5AQMA 5LY3A 1XQSC 3OBYA 1VQON 3FGUA 2BUPA 3WXMB 3ID8A 4Y0WA 1QQOA 1N8RO 3G71N 3CHWA 1YJWN 3G6EN 4G9ZA 1YIJN 4O8UA 4U7BA 4KH4A 1Q7YO 3DXKB 4FWNA 5AQHA 1S3XA 2HBLA 1ZBSA 4H0YB 4RTFD 2KLAA 2NRHA 3MN6A 4ISGA 1BG3A 5BPNA 3WXKA 3VERA 1W97L 1YF5L 5M1QA 4A5BA 3MN9A 4GV3A 3ATUA 1YI2N 1MWMA 4KBOA 4B1XB 2QA4N 2I7NA 2NNWA 3MWTA 4K43A 1TYQA 3KWIA 1KD1O 3VEYA 1GLAG 2RE2A 4A5AA 3SAHA 5LJWA 1KAXA 3HBTA 1KAYA 1MDUB 2QEXN 1TYQB 1GLJO 4KH5A 3HOSA 4NB4A 4KH6A 3VGKA 2EWSA 1QVGM 4BRIA 3L4IA 4I6MA 5AQNA 3HRGA 3TSPA 4BR0A 3VPZA 5JICA 5AZJB 3DLLL 5AFUA 3GBTA 1NLVA 4QS9A 1U2VA 1Q86O 3P4IA 1VQKN 3WT0A 1ATSA 1MA9B 3VTHA 3P39A 4YOWA 4IOAL 3W3DA 2YJEA 2PBDA 3F5TA 1HUXA 3L0QA 4BREA 1DEJA 3VEWA 3DXKA 3T69A 2E2NA 3CPEA 4WQ4C 2YI1A 3O8MA 4AM6A 4WCEL 5JLFA 5H1SQ 2HF4A 4H0VB 4CZHA 4IZ9A 3ZX3A 1S22A 2FSNA 3CCMN 5AQQA 4FVUA 4BVPA 5CR4A 4UY8O 3O5BA 4FO0A 3NMUA 3D7EO 4FSVA 5AZIA 3ZETB 4YOYA 1Y64A 3UKRB 2IVNA 3VESA 2ASMA 4MLEA 1QVFM 2P9NB 4H0XB 3TTDA 1MWKA 4YDUC 3M5RA 3CCSN 2E2OA 1VQNN 2NRWA 3VEVA 3J7ZO 3E66A 1VQ4N 5BRDA 2PAVA 4WFBL 2GWKA 4JKDA 4FWKA 2D4WA 2KKZA 3J8AA 3FZKA 3R6MA 3UE5A 3O80A 5AQKA 3P31A 1V4TA 4WYBA 3RVCA 3CCLN 1JCGA 3K9KA 1S72N 1NGJA 4GVEA 1ZC6A 4JKCA 2VGNA 4BRKA 3CPWM 3O9RA 1U6ZA 3UKUB 1OVYA 2YJFA 5F2RA 1HKCA 4WFAL 3OHRA 4IO9L 5AQIA 2CH5A 2GX9A 5M1PA 5GAEP 4B1UB 2QWOA 4ILHA 4PKIA 4DQ8A 4C1NI 1K8KB 4XH5A 4IOCL 2FLOA 3GL1A 3O08A 4IOXA 1KXPA 4CZKA 5E84A 4CBWA 2BTFA 4C1NK 2VGMA 2HMPA 2P9LA 3CQYA 5C0YA 3CJCA 3VEOA 5C12A 1K9MO 2W40A 3R8EA 3ZYYX 3BF3A 1LCUA 1RGIA 2E1YA 3DWLA 4BC2A 2VYPA 4BR2A 3PIOL 3A5MC 1ZXOA 4FL9A 1Z05A 4YOXA 3OW2M 1P90A 4GV9A 4JNEA 4RCHA 1VQ5N 1VQ9N 3O9TA 2QWPA 3U8XA 3MWPA 3UB5A 3D2FB 1KQSM 1NGHA 1T3VA 3HZ6A 3UKUA 4IEEA 2OTLN 2Q31A 4L3QA 4BVOA 3L4QA 4GY2B 3VMFB 5M1FA 3TU5A 2YHWA 1YUWA 3JS6A 3I33A 1X3NA 4JKGB 2QW9A 2AA4A 2HF3A 4JK8A 4H0PA 3ZEUA 4EHUA 4JD2B 3H1QA 1BDGA 3QBXA 5AZJA 2ASOA 3CMEN 3H3OB 1NGGA 4BRFA 4F9OA 4PL8A 1DGKN 5GAGP 3HI0A 1QZ5A 2I7PA 4A61A 3HOTA 4OPAA 4IFEA 5AQOA 1NWKA 3AGRA 3WEEA 4BC5A 4A2BA 5C2DA 2UYTA 4FWPA 1RDWX 3IFRA 4JD2A 2DPNA 2ZGYA 3OBWA 3PIPL 4QS7A 4CBUA 5AQUA 3E9LA 1G99A 2H3GX 2NRRA 4BRAA 2OTJN 4B1VA 4IDHA 1KAZA 3VOVA 4BR9A 3SBGA 1EO1A 3MK6A 3ENBA 3LDOA 1VQ6N 4HWIA 4BC3A 3WXJA 1HX1A 2FSKA 4IXCA 1HKBA 3HSCA 4XEIA 2YHYA 3CJ7A 5FPMA 5FPEA 4AF1A 5B8HA 2GTDA 3EE9A 3A5OC 3Q7CA 1M90O 3A5NC 4H5RA 3LDNA 3F9MA 1ATRA 5AQXA 5AQZA 3S41A 5CHIA 3BF1A 4DCHA 4FWSA 4PKGA 3QMLA 3WUHA 4JN4A 2F9TA 4PL7A 2QWQA 3CCQN 1VQ7N 2Q0UA 1BOTO 3MDQA 4IO8A 2VCPA 2FSJA 2QWMA 3GDQA 4FOIA 1SZ2A 5KPRA 2QWLA 2V7YA 2YHXA 3ZETA 4EHTA 3C6HA 3TSUA 3DXMB 1NGFA 1DT9A 2YCHA 5C15A 3I55N 3VF6A 2JWKA 3H1VX 2P9SB 2RHKA 4AM7A 3M6GA 5ELZA 1QQNA 3MN7A 1D4XA 2A3ZA 3LDQA 3NVMA 3CCEN 2HBJA 4ILGB 3CJBA 3A8YA 3FZLA 4M7YA 1T6CA 2V51B 3C0BA 2GEMA 4JHDA 3ZX0A 3QFUA 5KPTA 3ULEB 2E20A 1ESVA 2A42A 4GNIA 4JEPA 3CJ9A 4WF9L 3CC7N 4MO5A 1HPMA 2IIRA 5AQWA 3VGMA 4Z94A 3VENA 5AR0A 2D1KA 1BWFO 5EXWA 5AQGA 1HLUA 3P38A 4FPBA 1RDUA 4A59A 4WQ5A 5AQTA 3M1FA 4YOVA 2QWRA 2JWLA 1C0FA 2A40A 4CZJA 4I6MB 1NGIA 4BRDA 2NRXA 3DJCA 4K42A 4ISFA 1YXQA 1C0GA 4YOTA 3AARA 3B8AX 2W41A 2P9UB 2CH6A 5FPDA 2KHOA 1ILYA 3VETA 4MDAA 5TKYA 3O4WA 1JCEA 4BG9A 4CD1A 4LC9B 5F1XA 3G4SN 1VAZA 2OANA 3O9QA 4CI6A 1EQYA 4BGAA 1K8AO 2WBNA 4E1JA 5MLCQ 1YHQN 1NGDA 2CGJA 3H46O 1NM1A 4R79A 3QDKA 4BRHA 5AQRA 4DB3A 5EX5A 4BR5A 2Q1NA 3CMAN 1BA1A 3C7NB 3D2EB 1TUUA 4BRGA 4YDUA 2D0PA 1Z6RA 2GUPA 2E1ZA 3FZHA 2FF3B 2NRVA 3FZMA 4NLBA 4PKHA 3SJHA 3CC2N 3D6RA 2Q36A 5CE3A 4H5VA 3CETA 3KVGA 3CXCM 3O9SA 3O9UA 4K41A 4WFNL 3CD6N 3RSEA 3BEXA 3ATVA 4BRLA 4DHYA 5JVHL 4BRQA 4CJ7A 3O1WA 4QS8A 5ADXH 1H1VA 2HSTA 2P9PA 2WC9A 4JHDB 4NLCA 4BR4A 5KQDA 5M1NA 3GE1A 2P9PB 1QHAA 2IVPA 1SQKA 4MO4A 1BU6O 2A5XA 1YITN 3A0IX 4FOEA 2P9SA 4IEIA 5AQPA 4OPHA 3SMPA 4BROA 5BN9A 3CCUN 4JKBA 3WXIA 2ITMA 1BUPA 3H45C 3IKMA 4B1WB 1XUPO 5GADP 3CCRN 1GLDG 4O8KA 3CJ1A 2HBKA 3M3ZA 1VQPN 4NO7A 3H6EA 4MLHA 2A6AA 2HOEA 3FLCO 3SK3A 5BRFA 3JXUA 5DM6L 3G25A 1OKJA 3KWGA 1Q81O 5GINA 3EO3A 4JKEA 2YX6A 2P9KB 1NGAA 4J8FA 5BRHA 1BO5O 3C6AA 2GWJA 4B1ZA 1E4FT 4EIAA 1GLEG 1SS6A 4ILJA 3NVKA 4C23A 3SBTA 3F2KA 1GLCG 3HTVA 4CZIA 3BUZB 1IG8A 1NGBA 3EE8A 3HM8A 1T6DA 3AGKA 3WXLA 5BREA 2ZWHA 2E2PA 3KHYA 4CZGA 2E8AA 2ZF5O 4BRNA 1X9JA 1E4GT 3LM2A 4BG8A 4BQLA 4BRCA 2FXUA 3OA9A 3CJAA 2ASPA 3CQXA 4DKWA 1GLBG 2P9IA 3MCPA 5M1OA 4H5NA 3N4PA 3IUCA 1QZ6A 1RFQA 3WQTA 2QXLA 1R59O 4FWMA 1IJJA 1WUAA 5EVZA 5HL7L 5AQFA 1YJ9N 3ZEUB 2Q97A 2IVOA 4WQ4A 2QTDA 3CI5A 4JKAA 1W2BM 1NMDA 3DAWA 3MX5A 3U4LA 3ZX2A 3ULEA 3T7ZA 2VWBA 4BR7A 2F7TA 2HBMA 2FF6A 3TTFA 4O5FA 5E26A 2ZJRL 2Q2RA 3R1XA 4H0TB 3CCJN 4XH1A 3TPQA 3R9PA 5GIOA 3ENHA 1CZAN 1GLFO 5TKWA 2ZJQL 2CGKA 2BH1A 3E9OA 4JKFA 4RWTA 1LOTB 3FE1A 3KK7A 1Q82O 2NRTA 3CERA 3DXMA 1JCFA 2PFUA 3BP8A 4MDBA 4H5WA 4BC4A 3C65A 2P9LB 3Q7BA 3W0LA 1WOQA 4A57A 5C2FA 2QWNA 3AAQA 3I8BA 4H03B 4K25A 4B1YB 3CC4N 1NGCA 3CIPA 3QFPA 5LJVA 5AQJA 4BGBA 3U9ZA 4IJAA 3FZFA 4IJNA 1KC8O 3SAGA 3IMXA 3MN5A 4A62A 1P8ZA 4FPAA 3A5LC 4FWOA 4BRMA 1Q18A 3N4QA 4A2AA 3EN9A 3FFKB 4IWVA 4CBXA 1QQMA 4CZEA 1BA0A 4U67L 3SAFA 5AQLA 3GG4A 5EY4A 3ID6A 1DKGD 5KPZA 5I9EB 3VEXA 2J4RA 3PLAA 4H5TA 1V4SA 5C10A 5ADXA 1NBWA 3D2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3V A;  2WFB A;  1EO1 A;  2RE2 A;  1RDU A;  1P90 A;  1O13 A;  2YX6 A;  2QTD A;  2KLA A; 
#chains in the Genus database with same CATH topology
 4XH4 A;  3VEZ A;  4JYA K;  4CEO A;  3E9P A;  1TUY A;  1N34 K;  4W5O A;  4N76 A;  2XY8 A;  4BQZ A;  4EFH A;  1L3T A;  3L2R A;  5FPN A;  3LM9 A;  3O4Q A;  4WQ5 C;  4JAX A;  3M8S A;  4DLG A;  2ATQ A;  1O13 A;  4CGF A;  3SLC A;  4I9Q A;  2QI2 A;  3OYN A;  1K8K A;  2O8B A;  1M1K O;  1QTM A;  1JLA A;  1JL1 A;  2E2Q A;  1YAG A;  3M8Q A;  4FJ5 A;  1J6Z A;  1C6V A;  3O3F A;  1JJ2 M;  3ITH A;  3L3V A;  5JVG L;  4CGI A;  1NK6 A;  4JS5 A;  2Q0R A;  4DU4 A;  2B5J A;  1A5V A;  3TI0 A;  4ID5 A;  3NGZ A;  1U2V B;  3GOI A;  4CZL A;  4DSE A;  4DR6 K;  3IDH A;  4GV6 A;  2IAJ A;  4FWR A;  4W5N A;  3C7N A;  3D2E A;  3VF4 A;  4DWI A;  4KRF A;  3L3U A;  3O6W A;  3S3O A;  3E1Y A;  4H4O A;  1NJI O;  3TAM A;  3AVB A;  1FKP A;  5BPM A;  3MEE A;  1S9G A;  5GAH P;  3K9J A;  2BDP A;  3L6Q A;  3LPT A;  3RSE B;  5DM7 L;  5J2P A;  2G8H A;  4EAH D;  3KK1 A;  5AQM A;  4CJL A;  1VQO N;  2Z1I A;  1BL3 A;  3WXM B;  4DV1 K;  1BCM A;  4JI0 K;  3CHW A;  3M8P A;  3OYG A;  4U7B A;  3DXK B;  4AHU A;  4BE2 A;  1VSH A;  2O8E B;  3VQE A;  1BHL A;  4FYD A;  3QLH A;  5I42 A;  4DR4 K;  4DR2 K;  1LV5 A;  3MWT A;  1TYQ A;  1HYV A;  3KWI A;  1RBV A;  1X9M A;  1KD1 O;  4J2A A;  2RE2 A;  3LAN A;  4DV2 K;  3SAH A;  3RRG A;  3S3M A;  3VQ4 A;  3LP1 A;  2QEX N;  5D3G A;  2EWS A;  4BRI A;  4I6M A;  4B08 A;  1XWL A;  3VPZ A;  5AZJ B;  4DV4 K;  4CJE A;  1Q86 O;  1U2V A;  4CEB A;  1A5W A;  3WT0 A;  4WE1 A;  3ZLJ A;  3P39 A;  4EZ9 A;  2PBD A;  4BRE A;  3L0Q A;  1DEJ A;  3VEW A;  4JI7 K;  4QCL A;  3T69 A;  3CPE A;  4WQ4 C;  4AM6 A;  4AQY K;  1N6Q A;  4CZH A;  4IZ9 A;  3ZX3 A;  4NYF A;  1VRU A;  1O1W A;  5AQQ A;  5EU7 A;  4NXM K;  4FSV A;  4YOY A;  2OPQ A;  3VES A;  2HW3 A;  1QVF M;  4H0X B;  3J80 O;  1MWK A;  3EEQ A;  3HK2 A;  4WFB L;  5J2Q A;  3V9Z A;  2NUB A;  1SL2 A;  3FZK A;  1BIZ A;  3K5N A;  4BWJ A;  3JSM A;  1V4T A;  3NHG A;  3OJS A;  4JI2 K;  1NGJ A;  4B9U A;  1J53 A;  1HKC A;  3BZK A;  4WFA L;  4YFU A;  3OHR A;  4B9M A;  2CH5 A;  5M1P A;  4B1U B;  4JI3 K;  3NH2 A;  4J2D A;  1KXP A;  3K58 A;  4N56 A;  3ULD A;  3C94 A;  4CJR A;  4JRP A;  5C0Y A;  4FLX A;  4UQG A;  3R8E A;  2DFE A;  1VSM A;  4JI5 K;  4BC2 A;  4YOX A;  4CHQ A;  1P90 A;  2D0B A;  4GV9 A;  4RCH A;  4GMJ B;  4N41 A;  3O9T A;  3VQD A;  3D2F B;  3HZ6 A;  3UKU A;  2OTL N;  4GY2 B;  3TU5 A;  1L3V A;  1RTH A;  4JK8 A;  4F2R A;  3ZEU A;  3EZ5 A;  3L2Q A;  1BDG A;  1JLE A;  3QBX A;  4KAZ A;  5AZJ A;  2ASO A;  4K8X A;  5LMN K;  3H3O B;  4PL8 A;  3AVA A;  2YNF A;  2X74 A;  2W6L A;  3AGR A;  3WEE A;  4BC5 A;  4A2B A;  5C2D A;  1C1B A;  3PIP L;  5AQU A;  3E9L A;  2E6L A;  2NRR A;  2OTJ N;  3VOV A;  3DRP A;  3WXJ A;  1HX1 A;  4IXC A;  1HKB A;  3VQ5 A;  3QEI A;  2YHY A;  4AF1 A;  1M90 O;  1BGX T;  3ZT0 A;  3BF1 A;  3WNE A;  2UUC K;  3WUH A;  3CCQ N;  4PL7 A;  2QWQ A;  1VQ7 N;  4FVM A;  3TAQ A;  2QWM A;  1UAX A;  1N36 K;  1NMN A;  2YHX A;  3ZET A;  3C6H A;  5C15 A;  5AJ3 K;  3VF6 A;  2JWK A;  3SYZ A;  2RHK A;  4AM7 A;  1QQN A;  1D4X A;  2A3Z A;  3NVM A;  3ZT2 A;  2HNY A;  2GEM A;  4JHD A;  3ZX0 A;  3QFU A;  5KPT A;  4KB0 A;  4KHY A;  2E20 A;  4GNI A;  5FRN A;  4KHP K;  3VGM A;  3VEN A;  2D1K A;  4A59 A;  3B6P A;  1W9H A;  5KI6 A;  1EWQ A;  3LAL A;  4B8C A;  3DJC A;  5A2Q O;  4LY7 A;  4NXN K;  1CZ9 A;  2EX3 A;  2Q3S A;  1I39 A;  3VET A;  4KHN A;  4MDA A;  5TKY A;  3O4W A;  1B9D A;  1VAZ A;  1ZYQ A;  4CI6 A;  4BGA A;  1K8A O;  2WBN A;  4CHZ A;  1NGD A;  4R79 A;  1NM1 A;  2BAN A;  3CMA N;  1BA1 A;  3ZT4 A;  1ASV A;  1TUU A;  2O8F A;  1C1C A;  3T1A A;  4NLB A;  2E1Z A;  1UOC A;  3HYF A;  1D9D A;  1B9F A;  3CC2 N;  4H5V A;  1TKD A;  3KVG A;  3CXC M;  3O9U A;  4WFN L;  3KTQ A;  3BEX A;  3DLH A;  1H1V A;  2P9P A;  1IKY A;  4KB1 A;  3SJJ A;  4DS4 A;  1VSJ A;  2P9P B;  4HTU A;  5AQP A;  3A0I X;  2P9S A;  3IS9 A;  4OPH A;  2BGG A;  1TK8 A;  2YNG A;  4HCC A;  3H45 C;  3CCR N;  1GLD G;  4O8K A;  4M41 A;  1OVQ A;  2G8F A;  3M3Z A;  4KO0 A;  4LF7 K;  1XHX A;  4MLH A;  4DFM A;  2A6A A;  2HOE A;  2O8F B;  3SK3 A;  5BRF A;  3JXU A;  4W5Q A;  1I3A A;  1XMQ K;  4I2Q A;  4FJ8 A;  3NDK A;  4ZHR A;  3C6A A;  3QES A;  4KTW A;  2ZQB A;  4C23 A;  3AO3 A;  4CF8 A;  3BUZ B;  1IG8 A;  3EE8 A;  3HM8 A;  2VWJ A;  1T6D A;  4CZG A;  1E4G T;  4BG8 A;  4BQL A;  3CJA A;  1EP4 A;  1YTA A;  3MCP A;  5I3U A;  3N4P A;  4CGG A;  3ZSR A;  3IUC A;  4DTJ A;  5HRS A;  1YJ9 N;  2OCE A;  4NCB A;  4AH9 A;  3MX5 A;  1VSF A;  3T7Z A;  2AJQ A;  2F7T A;  3S9H A;  4FLV A;  4CHY A;  2ZJR L;  4H0T B;  3CCJ N;  1S1U A;  1LWF A;  2UXD K;  2BH1 A;  4DF8 A;  3THX B;  5T7B A;  3WNH A;  1L5U A;  4E7K A;  1LOT B;  3FE1 A;  5JS2 A;  3KK7 A;  3DLB A;  2O8B B;  3AA3 A;  4FLU A;  2EHG A;  4FJX A;  4A57 A;  3W0L A;  5KGW A;  2P9L B;  1RT2 A;  5C2F A;  4E7H A;  4M42 A;  3AAQ A;  3HP9 A;  4K25 A;  3L8B A;  3CIP A;  1C0U A;  3QFP A;  5AQJ A;  4A62 A;  1P8Z A;  1G15 A;  3QIO A;  2IDO A;  1RDD A;  3ALY A;  3FFK B;  4CIF A;  3A2F A;  4IDK A;  3NGI A;  4CBX A;  4U67 L;  4CZE A;  4DSJ A;  3SI6 A;  1NK8 A;  1XNQ K;  1BIU A;  3ID6 A;  5KPZ A;  2QKB A;  2J4R A;  3WNF A;  1KVA A;  4FLZ A;  2P9K A;  2Z1H A;  3WQU A;  3NFA A;  3J7Y P;  3D45 A;  3SMS A;  3TSQ A;  2E88 A;  3WEE B;  3RR8 A;  1C0T A;  3TAG A;  4B3M K;  4E7J A;  4CZF A;  1KFS A;  1NNE A;  3MMV A;  3I56 N;  3LWM A;  4FJ7 A;  2P9N A;  3AVC A;  3SNN A;  4OO1 J;  2NRZ A;  1VQ8 N;  3UKR A;  1T03 A;  1RT1 A;  2HB5 A;  5KRS A;  4CFC A;  2WUS A;  2YKM A;  4LF8 K;  3TTC A;  2FBT A;  1ASU A;  2P9U A;  3IG1 A;  3CCV N;  1TKX A;  3AAP A;  2HHV A;  4DSI A;  3SQ4 A;  3ZSX A;  3LAM A;  4DV7 K;  2AP1 A;  3VTI A;  5KQ8 A;  4CF2 A;  3EKS A;  1JLC A;  2D0O A;  1WAJ A;  1HKG A;  1NK5 A;  3MCA B;  4FK4 A;  3V81 A;  1BI4 B;  3LL3 A;  4HTL A;  2NZT A;  2KTQ A;  3PY8 A;  3HXM A;  3V9S A;  4X64 K;  1WB9 A;  4YOU A;  1S1V A;  4DU3 A;  3L2V A;  4B9Q A;  1HPZ A;  3VF2 A;  2ZJP L;  3T1Y K;  4DUY K;  3B6O A;  4JK9 A;  1HYS A;  2WFB A;  3G10 A;  4YOR A;  1HMV A;  1GOA A;  2R7Y A;  3O3G A;  5LY3 A;  3V9W A;  3OBY A;  1NK4 A;  1YJW N;  3G6E N;  4G9Z A;  3MEC A;  4Y1D A;  4DV0 K;  1UWB A;  2E6M A;  1NJX A;  4PUO A;  4KTQ A;  4KH4 A;  4FWN A;  1S3X A;  4H0Y B;  4FXD A;  2NRH A;  1KLN A;  1T05 A;  1W97 L;  1YF5 L;  5M1Q A;  4A5B A;  3SQ2 A;  5LMU K;  2QA4 N;  2I7N A;  4R5P A;  4K43 A;  4JRQ A;  1VHX A;  3SUO A;  5LJW A;  3HBT A;  4I7F A;  3HOS A;  4KHQ A;  3LZI A;  4KH6 A;  4E0D A;  4C8K A;  3TSP A;  4BR0 A;  1VK0 A;  4DF4 A;  3DLL L;  5AFU A;  3GBT A;  4QS9 A;  3P1G A;  3P4I A;  4DTM A;  1HNZ K;  3W3D A;  3F5T A;  1S1W A;  5LL6 Z;  1FJG K;  3ZCM A;  2YI1 A;  2G8W A;  5JLF A;  5H1S Q;  4DQR A;  3O3H A;  4KTZ A;  4LF4 K;  2YV0 X;  4HUE A;  2FSN A;  4BWM A;  4FVU A;  3O5B A;  4FO0 A;  4HVJ A;  5AZI A;  3ZET B;  1HYZ A;  1L3S A;  4OLB A;  3TTD A;  1ASW A;  4YDU C;  3M5R A;  1VQN N;  2HVH A;  3J7Z O;  1VQ4 N;  4CGD A;  5BRD A;  2GWK A;  3CFP A;  3OYM A;  1Y97 A;  2D4W A;  2KKZ A;  3J8A A;  1WSE A;  3UE5 A;  4PA1 A;  3P31 A;  4DR5 K;  3V1R A;  3CCL N;  4M3Y A;  3T19 A;  1S72 N;  4GVE A;  3LP2 A;  2HHQ A;  3CPW M;  1OVY A;  5F2R A;  3VQP A;  3U3G A;  3IAY A;  2X6S A;  1FKO A;  5AQI A;  4BAC A;  5GAE P;  2GX9 A;  1JL2 A;  2HND A;  1RNH A;  2QWO A;  1N5Y A;  2X6N A;  4C1N I;  4XH5 A;  1RBS A;  4CJ5 A;  1NG9 A;  3GL1 A;  3HPG A;  3O08 A;  5E84 A;  2BTF A;  4FM0 A;  2VGM A;  1A5X A;  5KGX A;  3CQY A;  1K9M O;  5C12 A;  1OH6 A;  4O5B A;  4LF6 K;  3AA2 A;  3V4I A;  3CG7 A;  3TAN A;  3VA0 A;  4FM2 A;  4FM1 A;  1R0A A;  1VQ5 N;  3MWP A;  3VA3 A;  1T3V A;  2XO7 A;  5CYM A;  4L3Q A;  3VMF B;  3AVI A;  3HVR A;  3I33 A;  3KLH A;  2QW9 A;  5HRP A;  1S6P A;  4JD2 B;  3KD1 E;  3OS0 A;  1NGG A;  4OLA A;  5GAG P;  3HI0 A;  4OPA A;  4IFE A;  3QIP A;  3TAF A;  1RDW X;  3IFR A;  4B9L A;  3QEW A;  3SUN A;  2H3G X;  4BRA A;  1IKV A;  1KAZ A;  4BR9 A;  4CIG A;  2G8V A;  3MK6 A;  3ENB A;  2FSK A;  1GOB A;  3CYM A;  1FW6 A;  4DFK A;  3THY A;  4F4K A;  4XEI A;  1JLQ A;  5FPE A;  5HBM A;  4H5R A;  3LDN A;  5AQZ A;  5AQX A;  4GKJ K;  4CK3 A;  4DCH A;  2VQE K;  4PKG A;  1QSY A;  4DFP A;  4JN4 A;  3VQQ A;  2Q0U A;  1B92 A;  2FSJ A;  4OPJ A;  4FJN A;  3GDQ A;  4FOI A;  4DTO A;  3DXM B;  1DT9 A;  4K8Z A;  4EZ6 A;  5HRO A;  4AHT A;  5ELZ A;  4IG3 A;  3KK2 A;  4CE9 A;  2DFF A;  2HBJ A;  4M7Y A;  3CJB A;  1ZBF A;  3A8Y A;  3CCE N;  2V51 B;  3C0B A;  2PYJ A;  1X9S A;  3KLF A;  3CC7 N;  3TAP A;  1HPM A;  1IO2 A;  4Z94 A;  3QEV A;  1DTT A;  5AR0 A;  1X9W A;  1WSH A;  5EXW A;  3ZSZ A;  3OY9 A;  2O8C B;  4FPB A;  5DK5 A;  3KLE A;  4Z4C A;  4WQ5 A;  5AQT A;  1RDA A;  2QWR A;  2JWL A;  3HP6 A;  4CZJ A;  4I6M B;  3NH0 A;  2NRX A;  4FLW A;  4FW2 A;  1YXQ A;  4YOT A;  2O8D B;  4YY3 K;  3B8A X;  2CH6 A;  1NK0 A;  3U3Y A;  1LW0 A;  1S1X A;  4CEE A;  3OYK A;  3O9Q A;  1CZB A;  4NYN A;  5MLC Q;  4CGJ A;  2KZZ A;  5AQR A;  3DLK A;  2OPS A;  5CZ1 A;  5EX5 A;  2Q1N A;  3OYJ A;  2ITG A;  2VWK A;  4MFB A;  3TR8 A;  4EP5 A;  4JV5 K;  4BRG A;  2F96 A;  4FJH A;  1OH8 A;  3QIN A;  3FZM A;  3SJH A;  4DR7 K;  2Q36 A;  1RT4 A;  3CET A;  4KPY A;  1WNS A;  3RSE A;  4LFC K;  4RW6 A;  4CJ7 A;  3O1W A;  4QS8 A;  5ADX H;  2HST A;  2WC9 A;  4NLC A;  3UIQ A;  4DU1 A;  1QHA A;  1SV5 A;  1SQK A;  1SUQ A;  4MO4 A;  2UXC K;  1LAW A;  5HRR A;  3SMP A;  4BRO A;  3WXI A;  1IV0 A;  3VN5 A;  4F8R A;  3FLC O;  3MXI A;  3V1O A;  3KWG A;  3HPO A;  3ZSQ A;  1NKB A;  2O4G A;  1KSP A;  3PO5 A;  4CFB A;  1NGA A;  4J8F A;  4DSL A;  1BO5 O;  3RMA A;  1E4F T;  1SS6 A;  4JI4 K;  1NJW A;  5SWM A;  3C95 A;  1RDB A;  3AGK A;  3WXL A;  3SQ0 A;  4BRN A;  4OGC A;  4BRC A;  2QXF A;  3OA9 A;  4OKJ A;  2QKK A;  4IBN A;  2ASP A;  3CQX A;  1GLB G;  1W7A A;  3P83 D;  2YNI A;  1IJJ A;  1WUA A;  5HL7 L;  1U45 A;  2Q97 A;  4KI4 A;  1RIL A;  3CI5 A;  4HCB A;  3S3N A;  3AVK A;  3DAW A;  4BR2 A;  4FK0 A;  3K2P A;  3DLR A;  5E26 A;  4DTR A;  5GIO A;  1CZA N;  3RMD A;  2CGK A;  4JKF A;  4B3T K;  4RWT A;  4CJP A;  3SV4 A;  1Q82 O;  2NRT A;  4PWD A;  3BP8 A;  4MDB A;  3AVJ A;  1QSS A;  1WOQ A;  2QWN A;  3I8B A;  4RW4 A;  3KJV A;  4H4M A;  3DOK A;  1EKE A;  3T1H K;  2P5O A;  3FZF A;  3SAG A;  3OYH A;  3IMX A;  4LH5 A;  1NOZ A;  3NCI A;  1Q18 A;  4X65 K;  3EN9 A;  4IWV A;  4CJF A;  4CJV A;  5HRN A;  3KIO A;  1DKG D;  4B9S A;  4O0J A;  3VEX A;  3MEG A;  4CIE A;  5C10 A;  1L3U A;  5ADX A;  1NJZ A;  4DTP A;  2BE2 A;  3EL2 A;  4NCA A;  3D0P A;  2IOC A;  3AVN A;  2YHA A;  5JMV A;  3RTV A;  4FWQ A;  1NK9 A;  1RCH A;  3R3L A;  3K5L A;  4CF0 A;  3QNN A;  2IS3 A;  4N47 A;  4CHN A;  4CGH A;  4CW7 B;  4CJS A;  3U9D A;  3RR7 A;  4H0O A;  4W5R A;  1HJO A;  3NBP A;  5GIP A;  4YNQ A;  3OYD A;  3EKU A;  4ZTJ A;  1ZBH A;  1XMO K;  2DY4 A;  3V9X A;  4ZTF A;  5M1K A;  3LDL A;  2V52 B;  3CF5 L;  4LF9 K;  1GLL O;  3QB0 A;  5F0X A;  4PHT X;  4JK7 A;  4KHS A;  1SAZ A;  4G1Q A;  3CM5 A;  4AHR A;  3EZW A;  3K5M A;  2F9W A;  5BN8 A;  1T44 A;  3H3N O;  4CZM A;  1BCO A;  1LWC A;  3TWH A;  3AY9 A;  3AO1 A;  5IWA K;  2HHS A;  3VGL A;  1VQL N;  4CED A;  5AQV A;  2A41 A;  3QBW A;  5AQY A;  1WSG A;  2DFH A;  1QHT A;  4BRP A;  2D5R A;  3K57 A;  1SKW A;  5AZI B;  1YVN A;  4FJL A;  4CVN E;  3AVL A;  1JXB A;  1Z25 A;  1XI1 A;  1XQS C;  4AIL C;  3FGU A;  4RW9 A;  3ID8 A;  4Y0W A;  1N8R O;  3G71 N;  5J2M A;  3RMB A;  1QQC A;  5SZT A;  4C8O A;  1ZBS A;  2VG5 A;  1LAV A;  1BG3 A;  5BPN A;  3ZT1 A;  3VER A;  3C6U A;  3MN9 A;  3ATU A;  4LSL A;  1YI2 N;  4KBO A;  3RMC A;  2NNW A;  1C0M A;  3VEY A;  1GLA G;  4DQP A;  4A5A A;  1KAX A;  1KAY A;  4KH5 A;  1GLJ O;  1VSD A;  4NB4 A;  3VGK A;  3L4I A;  3RRH A;  3OJU A;  3ASM A;  2XHB A;  2P1J A;  5CYQ A;  3QEP A;  1KVB A;  1VQK N;  4DSK A;  1RDC A;  1EX4 A;  4TSX A;  1MA9 B;  4YOW A;  2YJE A;  1HUX A;  4WCE L;  3HT3 A;  3O8M A;  2HF4 A;  4DTN A;  4BE1 A;  5BR8 K;  1Q8I A;  1S1T A;  3CCM N;  3THY B;  1WLJ A;  5FLX O;  4OKE A;  4DTX A;  2HHW A;  4BVP A;  5CR4 A;  2FBY A;  3LAK A;  1Q9Y A;  1J5O A;  4UY8 O;  3HO1 A;  2P51 A;  2ZE2 A;  4FJI A;  3THW B;  4CFD A;  2IVN A;  1LWE A;  4MLE A;  3OYI A;  1VSL A;  3NF9 A;  4LD0 A;  4CJ3 A;  1TL1 A;  1T8E A;  3VEV A;  5HLF A;  3E66 A;  1QS4 A;  2PAV A;  4AHV A;  3R6M A;  4DTS A;  3O80 A;  3V6D A;  5AQK A;  1NJY A;  3SZ2 A;  3I8D A;  4KHW A;  4H8K A;  4OGE A;  3RVC A;  3NF8 A;  4GKK K;  2D0C A;  3TAB A;  3I0S A;  3LPU A;  1ZC6 A;  2VGN A;  1U6Z A;  1UA0 A;  1KTQ A;  4IO9 L;  2IGI A;  4OPK A;  2OPR A;  1ITG A;  1XHZ A;  4Z4I A;  3AVH A;  4ILH A;  4PKI A;  4IOC L;  3KKR A;  4DR3 K;  2FLO A;  3TAE A;  4CBW A;  4CJQ A;  1J5E K;  1TGO A;  4C1N K;  2HVI A;  3CJC A;  3VEO A;  4KV8 A;  2GUI A;  4MQ3 A;  4BDY A;  2GBZ A;  1LCU A;  1VSK A;  2E1Y A;  3CQ8 A;  2VYP A;  3PIO L;  2KFZ A;  3A5M C;  4FL9 A;  3K59 A;  4ELU A;  4JNE A;  1VQ9 N;  2QWP A;  3U8X A;  1KQS M;  1NGH A;  1I94 K;  1SL1 A;  2Q31 A;  4Z4H A;  3SQ1 A;  1VSI A;  3L4Q A;  5M1F A;  3JS6 A;  1X3N A;  2QK9 A;  4JKG B;  2AA4 A;  3SV3 A;  3H1Q A;  4AHS A;  3CME N;  4F9O A;  4FJM A;  5K14 A;  4LF5 K;  1DGK N;  3HOT A;  2I7P A;  5AQO A;  1NWK A;  3QEX A;  3HL8 A;  1WSJ A;  1EWR A;  2UYT A;  4FWP A;  3VQ6 A;  3OBW A;  1SL0 A;  4QS7 A;  4CBU A;  3J81 O;  3DMJ A;  3PX6 A;  4IDH A;  2Z1J A;  4Z0U A;  1HNV A;  1VQ6 N;  4HWI A;  4BC3 A;  4DR1 K;  4XIU A;  1WSF A;  1KFD A;  1D8Y A;  5FPM A;  2HHH K;  5B8H A;  3EE9 A;  2OYQ A;  3F9M A;  1ATR A;  3S41 A;  1TKZ A;  5CHI A;  2XY5 A;  5FRM A;  3DYA A;  3PUF A;  3MDQ A;  4IO8 A;  1U48 A;  3M8R A;  3QNO A;  1C1A A;  1U04 A;  5J2N A;  1W0H A;  5KPR A;  2QWL A;  2ETJ A;  2V7Y A;  1U47 A;  3TSU A;  2YCH A;  4FCY A;  3THV A;  2PZS A;  3H1V X;  4PQU A;  3NAE A;  1NKC A;  4FZX C;  4ILG B;  3FZL A;  1T6C A;  4DLE A;  3J7A P;  3VQB A;  3ULE B;  1ESV A;  3KKS A;  4MO5 A;  4ELT A;  2IIR A;  1BWF O;  5AQG A;  4RW8 A;  3IRX A;  3P38 A;  3MXM A;  1EXQ A;  3M1F A;  2A40 A;  2UXB K;  4Z4G A;  4K42 A;  1C0G A;  4JI8 K;  5C25 A;  2W41 A;  4CF9 A;  3BY5 A;  5FPD A;  2KHO A;  1U4B A;  4IFY A;  1KCF A;  3G4S N;  5F1X A;  1EQY A;  1REV A;  3PX4 A;  2HMI A;  1YHQ N;  3H46 O;  3VQC A;  4FLY A;  1NK7 A;  4BR5 A;  2YNH A;  3AO4 A;  4YDU A;  2D0P A;  1Z6R A;  2GUP A;  3EYZ A;  4PKH A;  2NRV A;  4IG0 A;  3D6R A;  5CE3 A;  3O4N A;  3O9S A;  4K41 A;  1Q9X A;  2E5L K;  5JVH L;  3ATV A;  4DHY A;  1JLF A;  4BRQ A;  3DM2 A;  5FRO A;  4E7L A;  2D0A A;  2W6K A;  4BR4 A;  5KQD A;  1F21 A;  3GE1 A;  4K0K K;  2IVP A;  3PSI A;  3HM9 A;  3SUP A;  3AVF A;  2A5X A;  4FOE A;  1WSI A;  4IEI A;  1VRT A;  2F4V K;  3NF7 A;  4JKB A;  1YVU A;  1XUP O;  4CEA A;  3CJ1 A;  2HBK A;  1VQP N;  3H6E A;  1JLG A;  4E89 A;  1MU2 A;  4GVM A;  3ZT3 A;  4JS4 A;  3G25 A;  4B9T A;  4CHO A;  4I2P A;  4JI6 K;  1LW2 A;  2HNZ A;  3VQ9 A;  2YX6 A;  2P9K B;  2YKN A;  4BDP A;  2VG7 A;  1RTI A;  4EIA A;  3NVK A;  1GLE G;  1E3M A;  4ILJ A;  3F2K A;  1GLC G;  4CZI A;  3F9K A;  1NGB A;  2X78 A;  2ZWH A;  2E2P A;  3P5J A;  4W5T A;  2E8A A;  2ZF5 O;  1X9J A;  4LFA K;  2JLE A;  1RBR A;  3LM2 A;  3AA4 A;  3PX0 A;  3KD5 E;  4O44 A;  4B3S K;  4DKW A;  2P9I A;  5M1O A;  3NH1 A;  1RFQ A;  1R59 O;  5EVZ A;  4BE0 A;  1QSL A;  2B6A A;  2QTD A;  4JKA A;  4KRE A;  2VQF K;  4E1M A;  3U4L A;  4GW6 A;  3ULE A;  4BR7 A;  4O5F A;  3R1X A;  3EY1 A;  3R9P A;  2XY6 A;  3ZSO A;  1GLF O;  2ZJQ L;  4Y1C A;  1JCF A;  4CK1 A;  4BC4 A;  3Q7B A;  4QOZ B;  4E7I A;  1CXQ A;  3AVG A;  2O8D A;  2RPI A;  3CC4 N;  1NGC A;  3U9Z A;  3ZSV A;  4IJA A;  1YT3 A;  1IG9 A;  3MN5 A;  4M3Z A;  4BRM A;  1ZBL A;  3N4Q A;  3H08 A;  1KVC A;  1QQM A;  3SAF A;  5AQL A;  1HJR A;  4DV3 K;  2O8C A;  3GG4 A;  1TAU A;  5I9E B;  1RBU A;  3LP3 A;  4H5T A;  1V4S A;  4M3R A;  3OVN A;  4FJJ A;  1NBW A;  3D2F A;  5C42 A;  3V9U A;  5AFU H;  5CZ2 A;  4HUF A;  1HQU A;  3TAR A;  3NF6 A;  4JKH A;  4RW7 A;  4CK2 A;  5BPL A;  1CLQ A;  2P9I B;  3PO4 A;  4LH4 A;  4KHU A;  3O1B A;  2KFN A;  1K73 O;  1WBD A;  2FBX A;  4M7X A;  1YJN N;  4JKG A;  5C24 A;  3FR0 A;  3OTO K;  4JLH A;  4DSF A;  3QIC A;  3DLG A;  4OVL A;  4ELV A;  4FJK A;  4DQI A;  1X3M A;  1NU0 A;  2V7Z A;  1ATN A;  2QM1 A;  4FWL A;  3E01 A;  1TKT A;  1NGE A;  1VQM N;  3KZB A;  2PY5 A;  4DS5 A;  3LDP A;  3ENO A;  1TVR A;  5JLH A;  2ZGZ A;  2GEL A;  4M63 C;  4DFJ A;  4F3O A;  1IBL K;  2NLX A;  4B8A B;  4CD3 A;  2WTU A;  5EOY A;  1XC3 A;  4O55 A;  2UU9 K;  4E1N A;  3MX2 A;  5HOO A;  4BY9 C;  2CGL A;  1RTJ A;  3AVM A;  5AQS A;  1TV6 A;  4CEF A;  4ISE A;  4E19 A;  2P5G A;  5BR9 A;  4CJ4 A;  4ID1 A;  3AO5 A;  1NKE A;  2BUP A;  1NOY A;  1QQO A;  1JKH A;  1HNX K;  2I5J A;  1YIJ N;  4O8U A;  4ICL A;  4E3S A;  2F8T A;  1Q7Y O;  3SPY A;  4EP4 A;  3DRS A;  5AQH A;  2HBL A;  2G8U A;  2B4J A;  4RTF D;  1XC9 A;  2KLA A;  3MN6 A;  4ISG A;  4B3R K;  2W42 A;  1CXU A;  3WXK A;  1UA1 A;  4Q5V A;  2FC0 A;  4GV3 A;  1MWM A;  2RKI A;  1TAQ A;  4B1X B;  1T7P A;  4LSN A;  2VG6 A;  4CES A;  4B9N A;  4CFA A;  2F8S A;  1MDU B;  1TYQ B;  1QVG M;  3DRR A;  4M45 A;  5AQN A;  4DQQ A;  3HRG A;  4M3W A;  1NLV A;  2HHU A;  4HHT A;  4DTU A;  1ATS A;  3VTH A;  4IOA L;  4LFB K;  1S6Q A;  3DXK A;  2KW4 A;  2E2N A;  2RN2 A;  4Z4E A;  4H0V B;  3KLG A;  3LDS A;  1S22 A;  3V1Q A;  5CY4 A;  1SKR A;  3NMU A;  1D9F A;  1BIS A;  4N5S A;  3D7E O;  1HR0 K;  1IH7 A;  1Y64 A;  3UKR B;  1XNR K;  4RG8 A;  2ASM A;  1FXX A;  2P9N B;  3K0S A;  1ZBU A;  2E2O A;  2NRW A;  4JKD A;  4J2B A;  2XRI A;  2IC3 A;  4FWK A;  4M3T A;  5IT9 O;  1U49 A;  4FW1 A;  1KLM A;  4WYB A;  1JCG A;  3K9K A;  4JKC A;  4BRK A;  3OYC A;  4HUG A;  1DLO A;  1RT5 A;  3LP0 A;  3O9R A;  5DMR A;  3UKU B;  4YHH K;  2YJF A;  3BZC A;  3CM6 A;  4FJ9 A;  1BQM A;  1N32 K;  3QET A;  4DQ8 A;  1K8K B;  1JXE A;  4IOX A;  4CZK A;  3VQA A;  3L2W A;  4J2E A;  1D5A A;  2HMP A;  3L2U A;  2Y1I A;  2P9L A;  4CHP A;  4DG1 A;  3PV8 A;  2W40 A;  4FK2 A;  2WOM A;  3ZYY X;  3RWU A;  1IKX A;  1DTQ A;  3OYB A;  3BF3 A;  1RGI A;  3DWL A;  3THX A;  4Q0B A;  2A1S A;  1ZXO A;  1Z05 A;  2FBV A;  3OW2 M;  5HP1 A;  3HVT A;  4CJW A;  3UB5 A;  3C6T A;  4OKK A;  1FK9 A;  4IEE A;  4BVO A;  2KZM A;  3K5O A;  2YHW A;  1YUW A;  2OZM A;  2HF3 A;  2G8I A;  4H0P A;  4O4G A;  4EHU A;  4KKO A;  2OPP A;  2Z1G A;  4BRF A;  4A61 A;  1QZ5 A;  5FDL A;  4JD2 A;  2DPN A;  2ZGY A;  5KTQ A;  2O4I A;  1G99 A;  3FFI A;  4OJR A;  4DQS A;  4B1V A;  3WNG A;  1EO1 A;  3SBG A;  4JI1 K;  4B9V A;  4DV6 K;  4CER A;  3LDO A;  3HSC A;  1YTU A;  3CJ7 A;  2GTD A;  3A5O C;  3Q7C A;  3A5N C;  2LSN A;  4DMN A;  3AO2 A;  4FWS A;  3AV9 A;  3QML A;  2F9T A;  1BOT O;  2ZD1 A;  2VCP A;  3QER A;  1SZ2 A;  3THW A;  5E41 A;  3SUQ A;  4FZY A;  4EHT A;  4CEZ A;  1NGF A;  3I55 N;  1HNI A;  4CJK A;  1J9A A;  1IKW A;  2KQ2 A;  2P9S B;  3M6G A;  2HHX A;  3MN7 A;  1N33 K;  3LDQ A;  1QE1 A;  4X66 K;  4V19 S;  4NCG A;  3MXJ A;  4CJU A;  1TL3 A;  2A42 A;  3OS2 A;  1WBB A;  4JEP A;  3CJ9 A;  4CEQ A;  4WF9 L;  3ZSY A;  5AQW A;  1TK0 A;  3BDP A;  1HLU A;  3DLE A;  1RDU A;  1BI4 A;  4IFV A;  4YOV A;  4F3T A;  3OYF A;  1JLB A;  2XY7 A;  1RTD A;  2O8E A;  1C0F A;  1S5J A;  1NGI A;  3ZSW A;  1HRH A;  1RT3 A;  4FJG A;  4BRD A;  2OZS A;  3CFO A;  4F2S A;  3F73 A;  4OX9 K;  3OYE A;  4ISF A;  3AAR A;  1X1P A;  2P9U B;  2OA8 A;  1ILY A;  1JCE A;  1EET A;  4BG9 A;  4CD1 A;  4LC9 B;  3NE6 A;  4KI6 A;  2OAN A;  4E1J A;  3KK3 A;  4KFB A;  2CGJ A;  4M3U A;  3QDK A;  4BRH A;  4DV5 K;  1RT6 A;  2JGU A;  4DB3 A;  3HJF A;  4CF1 A;  1WAF A;  3C7N B;  3D2E B;  3QO9 A;  1HNW K;  3SCX A;  3FZH A;  2FF3 B;  4C8M A;  3SPZ A;  3MAQ A;  3LWL A;  3CD6 N;  4FZZ A;  2WON A;  4BRL A;  1WN7 A;  2G8K A;  3OYL A;  4JHD B;  1SKS A;  5M1N A;  3AA5 X;  1BU6 O;  1YIT N;  2E4L A;  3HPH A;  3OS1 A;  5KRT A;  5BN9 A;  3VQ8 A;  3CCU N;  4C8N A;  2ITM A;  1BUP A;  3IKM A;  4B1W B;  4DUZ K;  5GAD P;  1OH7 A;  4NO7 A;  3DOL A;  4CCH A;  2UUB K;  4CJT A;  3G0Z A;  4B3O A;  5DM6 L;  1OKJ A;  4PY5 A;  1Q81 O;  5GIN A;  4BDZ A;  3EO3 A;  3ISN C;  4L8R B;  4JKE A;  3PSF A;  5BRH A;  2GWJ A;  1S9E A;  4B1Z A;  3SBT A;  3HTV A;  3JYT A;  5BRE A;  4X62 K;  3HST B;  3KHY A;  2DTU A;  1RBT A;  2FXU A;  1TK5 A;  3BGR A;  3MED A;  4H5N A;  4Z4F A;  1QZ6 A;  1K6Y A;  3WQT A;  2QXL A;  1BQN A;  4FWM A;  5AQF A;  4M3X A;  3ZEU B;  2PYL A;  1Z26 A;  3LZJ A;  2IVO A;  4WQ4 A;  1IBK K;  2A1R A;  1VSE A;  1J54 A;  1W2B M;  1NMD A;  2ZM6 K;  3DI6 A;  3KLI A;  3T3F A;  3ZX2 A;  3JAM O;  4O0I A;  2VWB A;  2HBM A;  2FF6 A;  3TTF A;  4AHC A;  2YHB A;  2Q2R A;  5J1E A;  4I9L A;  4XH1 A;  3TPQ A;  1GOC A;  3ENH A;  2Y1J A;  5TKW A;  3E9O A;  1KRP A;  4QAG A;  4C8L A;  3CFR A;  3CER A;  3DXM A;  2PFU A;  2GV9 A;  4CEC A;  3OYA A;  4H5W A;  1ZBI A;  2RF2 A;  3C65 A;  3CCS N;  1OH5 A;  3NGY A;  4H03 B;  5JS1 A;  1RT7 A;  4B1Y B;  5LJV A;  4BGB A;  4IKF A;  4IJN A;  1KC8 O;  3I0R A;  4FPA A;  3A5L C;  4FWO A;  4A2A A;  1HQE A;  1BA0 A;  2UUA K;  5EY4 A;  2HHT A;  3U6F A;  4FLT A;  3VQ7 A;  3PLA A;  1IBM K;  5JIC A; 
#chains in the Genus database with same CATH homology
 4XH4 A;  3VEZ A;  2P9K A;  3WQU A;  3E9P A;  3EL2 A;  5AFU H;  1TUY A;  5JMV A;  4JKH A;  3SMS A;  4FWQ A;  2E88 A;  3TSQ A;  5BPL A;  3WEE B;  3R3L A;  4BQZ A;  2P9I B;  4EFH A;  4CZF A;  5FPN A;  3O1B A;  3LM9 A;  1K73 O;  3MMV A;  4WQ5 C;  4JAX A;  3I56 N;  4M7X A;  3U9D A;  1YJN N;  2P9N A;  4H0O A;  4OO1 J;  1O13 A;  1HJO A;  4JKG A;  5GIP A;  2NRZ A;  3SLC A;  3UKR A;  1VQ8 N;  3FR0 A;  2QI2 A;  1K8K A;  3EKU A;  3QIC A;  2WUS A;  1M1K O;  5M1K A;  2E2Q A;  3LDL A;  1YAG A;  3TTC A;  2V52 B;  2P9U A;  1J6Z A;  1JJ2 M;  3CF5 L;  1GLL O;  3QB0 A;  3CCV N;  1X3M A;  5F0X A;  3AAP A;  5JVG L;  4PHT X;  2Q0R A;  2V7Z A;  4JK7 A;  1SAZ A;  2QM1 A;  1ATN A;  2AP1 A;  4FWL A;  3VTI A;  3EZW A;  5KQ8 A;  1NGE A;  2F9W A;  2D0O A;  3EKS A;  5BN8 A;  3KZB A;  1VQM N;  1T44 A;  3H3N O;  1HKG A;  4CZM A;  1U2V B;  3GOI A;  3LDP A;  3ENO A;  3MCA B;  5JLH A;  4CZL A;  2ZGZ A;  2GEL A;  3LL3 A;  4HTL A;  2NZT A;  3IDH A;  4M63 C;  4GV6 A;  4FWR A;  2NLX A;  3AY9 A;  4CD3 A;  3C7N A;  3D2E A;  5EOY A;  3VF4 A;  1XC3 A;  3VGL A;  3O6W A;  1VQL N;  5AQV A;  4YOU A;  3MX2 A;  5HOO A;  3E1Y A;  2CGL A;  2A41 A;  3VF2 A;  4B9Q A;  3QBW A;  2ZJP L;  5AQY A;  1NJI O;  4BY9 C;  5AQS A;  5BPM A;  4BRP A;  5GAH P;  4JK9 A;  3K9J A;  2WFB A;  5AZI B;  1YVN A;  4ISE A;  4YOR A;  3L6Q A;  5DM7 L;  3RSE B;  5BR9 A;  4EAH D;  5AQM A;  5LY3 A;  1XQS C;  3OBY A;  1VQO N;  3FGU A;  2BUP A;  3WXM B;  3ID8 A;  4Y0W A;  1QQO A;  1N8R O;  3G71 N;  3CHW A;  1YJW N;  3G6E N;  4G9Z A;  1YIJ N;  4O8U A;  4U7B A;  4KH4 A;  1Q7Y O;  3DXK B;  4FWN A;  5AQH A;  1S3X A;  2HBL A;  1ZBS A;  4H0Y B;  4RTF D;  2KLA A;  2NRH A;  3MN6 A;  4ISG A;  1BG3 A;  5BPN A;  3WXK A;  3VER A;  1W97 L;  1YF5 L;  5M1Q A;  4A5B A;  3MN9 A;  4GV3 A;  3ATU A;  1YI2 N;  1MWM A;  4KBO A;  4B1X B;  2QA4 N;  2I7N A;  2NNW A;  3MWT A;  4K43 A;  1TYQ A;  3KWI A;  1KD1 O;  3VEY A;  1GLA G;  2RE2 A;  4A5A A;  3SAH A;  5LJW A;  1KAX A;  3HBT A;  1KAY A;  1MDU B;  2QEX N;  1TYQ B;  1GLJ O;  4KH5 A;  3HOS A;  4NB4 A;  4KH6 A;  3VGK A;  2EWS A;  1QVG M;  4BRI A;  3L4I A;  4I6M A;  5AQN A;  3HRG A;  3TSP A;  4BR0 A;  3VPZ A;  5JIC A;  5AZJ B;  3DLL L;  5AFU A;  3GBT A;  1NLV A;  4QS9 A;  1U2V A;  1Q86 O;  3P4I A;  1VQK N;  3WT0 A;  1ATS A;  1MA9 B;  3VTH A;  3P39 A;  4YOW A;  4IOA L;  3W3D A;  2YJE A;  2PBD A;  3F5T A;  1HUX A;  3L0Q A;  4BRE A;  1DEJ A;  3VEW A;  3DXK A;  3T69 A;  2E2N A;  3CPE A;  4WQ4 C;  2YI1 A;  3O8M A;  4AM6 A;  4WCE L;  5JLF A;  5H1S Q;  2HF4 A;  4H0V B;  4CZH A;  4IZ9 A;  3ZX3 A;  1S22 A;  2FSN A;  3CCM N;  5AQQ A;  4FVU A;  4BVP A;  5CR4 A;  4UY8 O;  3O5B A;  4FO0 A;  3NMU A;  3D7E O;  4FSV A;  5AZI A;  3ZET B;  4YOY A;  1Y64 A;  3UKR B;  2IVN A;  3VES A;  2ASM A;  4MLE A;  1QVF M;  2P9N B;  4H0X B;  3TTD A;  1MWK A;  4YDU C;  3M5R A;  3CCS N;  2E2O A;  1VQN N;  2NRW A;  3VEV A;  3J7Z O;  3E66 A;  1VQ4 N;  5BRD A;  2PAV A;  4WFB L;  2GWK A;  4JKD A;  4FWK A;  2D4W A;  2KKZ A;  3J8A A;  3FZK A;  3R6M A;  3UE5 A;  3O80 A;  5AQK A;  3P31 A;  1V4T A;  4WYB A;  3RVC A;  3CCL N;  1JCG A;  3K9K A;  1S72 N;  1NGJ A;  4GVE A;  1ZC6 A;  4JKC A;  2VGN A;  4BRK A;  3CPW M;  3O9R A;  1U6Z A;  3UKU B;  1OVY A;  2YJF A;  5F2R A;  1HKC A;  4WFA L;  3OHR A;  4IO9 L;  5AQI A;  2CH5 A;  2GX9 A;  5M1P A;  5GAE P;  4B1U B;  2QWO A;  4ILH A;  4PKI A;  4DQ8 A;  4C1N I;  1K8K B;  4XH5 A;  4IOC L;  2FLO A;  3GL1 A;  3O08 A;  4IOX A;  1KXP A;  4CZK A;  5E84 A;  4CBW A;  2BTF A;  4C1N K;  2VGM A;  2HMP A;  2P9L A;  3CQY A;  5C0Y A;  3CJC A;  3VEO A;  5C12 A;  1K9M O;  2W40 A;  3R8E A;  3ZYY X;  3BF3 A;  1LCU A;  1RGI A;  2E1Y A;  3DWL A;  4BC2 A;  2VYP A;  4BR2 A;  3PIO L;  3A5M C;  1ZXO A;  4FL9 A;  1Z05 A;  4YOX A;  3OW2 M;  1P90 A;  4GV9 A;  4JNE A;  4RCH A;  1VQ5 N;  1VQ9 N;  3O9T A;  2QWP A;  3U8X A;  3MWP A;  3UB5 A;  3D2F B;  1KQS M;  1NGH A;  1T3V A;  3HZ6 A;  3UKU A;  4IEE A;  2OTL N;  2Q31 A;  4L3Q A;  4BVO A;  3L4Q A;  4GY2 B;  3VMF B;  5M1F A;  3TU5 A;  2YHW A;  1YUW A;  3JS6 A;  3I33 A;  1X3N A;  4JKG B;  2QW9 A;  2AA4 A;  2HF3 A;  4JK8 A;  4H0P A;  3ZEU A;  4EHU A;  4JD2 B;  3H1Q A;  1BDG A;  3QBX A;  5AZJ A;  2ASO A;  3CME N;  3H3O B;  1NGG A;  4BRF A;  4F9O A;  4PL8 A;  1DGK N;  5GAG P;  3HI0 A;  1QZ5 A;  2I7P A;  4A61 A;  3HOT A;  4OPA A;  4IFE A;  5AQO A;  1NWK A;  3AGR A;  3WEE A;  4BC5 A;  4A2B A;  5C2D A;  2UYT A;  4FWP A;  1RDW X;  3IFR A;  4JD2 A;  2DPN A;  2ZGY A;  3OBW A;  3PIP L;  4QS7 A;  4CBU A;  5AQU A;  3E9L A;  1G99 A;  2H3G X;  2NRR A;  4BRA A;  2OTJ N;  4B1V A;  4IDH A;  1KAZ A;  3VOV A;  4BR9 A;  3SBG A;  1EO1 A;  3MK6 A;  3ENB A;  3LDO A;  1VQ6 N;  4HWI A;  4BC3 A;  3WXJ A;  1HX1 A;  2FSK A;  4IXC A;  1HKB A;  3HSC A;  4XEI A;  2YHY A;  3CJ7 A;  5FPM A;  5FPE A;  4AF1 A;  5B8H A;  2GTD A;  3EE9 A;  3A5O C;  3Q7C A;  1M90 O;  3A5N C;  4H5R A;  3LDN A;  3F9M A;  1ATR A;  5AQX A;  5AQZ A;  3S41 A;  5CHI A;  3BF1 A;  4DCH A;  4FWS A;  4PKG A;  3QML A;  3WUH A;  4JN4 A;  2F9T A;  4PL7 A;  2QWQ A;  3CCQ N;  1VQ7 N;  2Q0U A;  1BOT O;  3MDQ A;  4IO8 A;  2VCP A;  2FSJ A;  2QWM A;  3GDQ A;  4FOI A;  1SZ2 A;  5KPR A;  2QWL A;  2V7Y A;  2YHX A;  3ZET A;  4EHT A;  3C6H A;  3TSU A;  3DXM B;  1NGF A;  1DT9 A;  2YCH A;  5C15 A;  3I55 N;  3VF6 A;  2JWK A;  3H1V X;  2P9S B;  2RHK A;  4AM7 A;  3M6G A;  5ELZ A;  1QQN A;  3MN7 A;  1D4X A;  2A3Z A;  3LDQ A;  3NVM A;  3CCE N;  2HBJ A;  4ILG B;  3CJB A;  3A8Y A;  3FZL A;  4M7Y A;  1T6C A;  2V51 B;  3C0B A;  2GEM A;  4JHD A;  3ZX0 A;  3QFU A;  5KPT A;  3ULE B;  2E20 A;  1ESV A;  2A42 A;  4GNI A;  4JEP A;  3CJ9 A;  4WF9 L;  3CC7 N;  4MO5 A;  1HPM A;  2IIR A;  5AQW A;  3VGM A;  4Z94 A;  3VEN A;  5AR0 A;  2D1K A;  1BWF O;  5EXW A;  5AQG A;  1HLU A;  3P38 A;  4FPB A;  1RDU A;  4A59 A;  4WQ5 A;  5AQT A;  3M1F A;  4YOV A;  2QWR A;  2JWL A;  1C0F A;  2A40 A;  4CZJ A;  4I6M B;  1NGI A;  4BRD A;  2NRX A;  3DJC A;  4K42 A;  4ISF A;  1YXQ A;  1C0G A;  4YOT A;  3AAR A;  3B8A X;  2W41 A;  2P9U B;  2CH6 A;  5FPD A;  2KHO A;  1ILY A;  3VET A;  4MDA A;  5TKY A;  3O4W A;  1JCE A;  4BG9 A;  4CD1 A;  4LC9 B;  5F1X A;  3G4S N;  1VAZ A;  2OAN A;  3O9Q A;  4CI6 A;  1EQY A;  4BGA A;  1K8A O;  2WBN A;  4E1J A;  5MLC Q;  1YHQ N;  1NGD A;  2CGJ A;  3H46 O;  1NM1 A;  4R79 A;  3QDK A;  4BRH A;  5AQR A;  4DB3 A;  5EX5 A;  4BR5 A;  2Q1N A;  3CMA N;  1BA1 A;  3C7N B;  3D2E B;  1TUU A;  4BRG A;  4YDU A;  2D0P A;  1Z6R A;  2GUP A;  2E1Z A;  3FZH A;  2FF3 B;  2NRV A;  3FZM A;  4NLB A;  4PKH A;  3SJH A;  3CC2 N;  3D6R A;  2Q36 A;  5CE3 A;  4H5V A;  3CET A;  3KVG A;  3CXC M;  3O9S A;  3O9U A;  4K41 A;  4WFN L;  3CD6 N;  3RSE A;  3BEX A;  3ATV A;  4BRL A;  4DHY A;  5JVH L;  4BRQ A;  4CJ7 A;  3O1W A;  4QS8 A;  5ADX H;  1H1V A;  2HST A;  2P9P A;  2WC9 A;  4JHD B;  4NLC A;  4BR4 A;  5KQD A;  5M1N A;  3GE1 A;  2P9P B;  1QHA A;  2IVP A;  1SQK A;  4MO4 A;  1BU6 O;  2A5X A;  1YIT N;  3A0I X;  4FOE A;  2P9S A;  4IEI A;  5AQP A;  4OPH A;  3SMP A;  4BRO A;  5BN9 A;  3CCU N;  4JKB A;  3WXI A;  2ITM A;  1BUP A;  3H45 C;  3IKM A;  4B1W B;  1XUP O;  5GAD P;  3CCR N;  1GLD G;  4O8K A;  3CJ1 A;  2HBK A;  3M3Z A;  1VQP N;  4NO7 A;  3H6E A;  4MLH A;  2A6A A;  2HOE A;  3FLC O;  3SK3 A;  5BRF A;  3JXU A;  5DM6 L;  3G25 A;  1OKJ A;  3KWG A;  1Q81 O;  5GIN A;  3EO3 A;  4JKE A;  2YX6 A;  2P9K B;  1NGA A;  4J8F A;  5BRH A;  1BO5 O;  3C6A A;  2GWJ A;  4B1Z A;  1E4F T;  4EIA A;  1GLE G;  1SS6 A;  4ILJ A;  3NVK A;  4C23 A;  3SBT A;  3F2K A;  1GLC G;  3HTV A;  4CZI A;  3BUZ B;  1IG8 A;  1NGB A;  3EE8 A;  3HM8 A;  1T6D A;  3AGK A;  3WXL A;  5BRE A;  2ZWH A;  2E2P A;  3KHY A;  4CZG A;  2E8A A;  2ZF5 O;  4BRN A;  1X9J A;  1E4G T;  3LM2 A;  4BG8 A;  4BQL A;  4BRC A;  2FXU A;  3OA9 A;  3CJA A;  2ASP A;  3CQX A;  4DKW A;  1GLB G;  2P9I A;  3MCP A;  5M1O A;  4H5N A;  3N4P A;  3IUC A;  1QZ6 A;  1RFQ A;  3WQT A;  2QXL A;  1R59 O;  4FWM A;  1IJJ A;  1WUA A;  5EVZ A;  5HL7 L;  5AQF A;  1YJ9 N;  3ZEU B;  2Q97 A;  2IVO A;  4WQ4 A;  2QTD A;  3CI5 A;  4JKA A;  1W2B M;  1NMD A;  3DAW A;  3MX5 A;  3U4L A;  3ZX2 A;  3ULE A;  3T7Z A;  2VWB A;  4BR7 A;  2F7T A;  2HBM A;  2FF6 A;  3TTF A;  4O5F A;  5E26 A;  2ZJR L;  2Q2R A;  3R1X A;  4H0T B;  3CCJ N;  4XH1 A;  3TPQ A;  3R9P A;  5GIO A;  3ENH A;  1CZA N;  1GLF O;  5TKW A;  2ZJQ L;  2CGK A;  2BH1 A;  3E9O A;  4JKF A;  4RWT A;  1LOT B;  3FE1 A;  3KK7 A;  1Q82 O;  2NRT A;  3CER A;  3DXM A;  1JCF A;  2PFU A;  3BP8 A;  4MDB A;  4H5W A;  4BC4 A;  3C65 A;  2P9L B;  3Q7B A;  3W0L A;  1WOQ A;  4A57 A;  5C2F A;  2QWN A;  3AAQ A;  3I8B A;  4H03 B;  4K25 A;  4B1Y B;  3CC4 N;  1NGC A;  3CIP A;  3QFP A;  5LJV A;  5AQJ A;  4BGB A;  3U9Z A;  4IJA A;  3FZF A;  4IJN A;  1KC8 O;  3SAG A;  3IMX A;  3MN5 A;  4A62 A;  1P8Z A;  4FPA A;  3A5L C;  4FWO A;  4BRM A;  1Q18 A;  3N4Q A;  4A2A A;  3EN9 A;  3FFK B;  4IWV A;  4CBX A;  1QQM A;  4CZE A;  1BA0 A;  4U67 L;  3SAF A;  5AQL A;  3GG4 A;  5EY4 A;  3ID6 A;  1DKG D;  5KPZ A;  5I9E B;  3VEX A;  2J4R A;  3PLA A;  4H5T A;  1V4S A;  5C10 A;  5ADX A;  1NBW A;  3D2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...