2QTDA

Crystal structure of a putative dinitrogenase (mj0327) from methanocaldococcus jannaschii dsm at 1.70 a resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
MINMKVAISMDVDKISNSFEDCKYFLIVRIDDNEVKSTKVIFNDESGKKSIVKENVNAIICKNISEENYKKFSKKIEIYHAEGDDVDKNISLFIEGELSKISNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein MJ0327
publication title NMR structure of the protein NP_247299.1: comparison with the crystal structure.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii dsm 2661
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 2qtdA00
1T3VA 1RDUA 1O13A 2RE2A 2WFBA 2KLAA 1P90A 2QTDA 2YX6A 1EO1A
chains in the Genus database with same CATH superfamily
4B08A 3K0SA 2ASPA 4GMJB 3S3MA 3OYLA 1MA9B 4GVEA 4GW6A 3LP1A 4FOEA 4YY3K 4CJ5A 2XY7A 3L4QA 4JKCA 3HM8A 4CIEA 4CF2A 4BC5A 5GAEP 3VA0A 4B1VA 5FPEA 3V9WA 1BL3A 3TI0A 1SAZA 1O13A 2QXFA 4GKJK 2D5RA 3QEIA 4FJMA 3GL1A 4YOWA 1U47A 4RG8A 3U9ZA 3PX4A 4ZTJA 3ENOA 3OS2A 4WYBA 4Q5VA 1HX1A 4B3TK 3LM9A 3FLCO 5EX5A 3DXKA 3MEDA 2VCPA 3F5TA 1QSYA 4QOZB 2DPNA 3VQDA 2FBYA 3ATUA 1NK9A 3EKUA 3RMCA 1SKSA 1S6PA 2P9UA 3R1XA 4I6MA 1RT6A 3ZSQA 3LDLA 3CM5A 4FZXC 4DSLA 3VQ4A 4FK2A 3BF3A 1W9HA 4CJ3A 1RBTA 2HHTA 2QI2A 4XH5A 3ZSRA 4FJ7A 4KBOA 4KH5A 1LV5A 3J7AP 1FXXA 1NKBA 4W5RA 3OYDA 1TAUA 2RN2A 3LZIA 3U3YA 4DR1K 5HRRA 3I33A 3QINA 5AQJA 3FFKB 3Q7BA 4A2AA 4IG3A 3ZX2A 2GTDA 5F2RA 4DQQA 3BZKA 4F2SA 3EE8A 5JVGL 3V6DA 1W97L 1XMQK 3OYHA 2ZJPL 3V9SA 4OKKA 2QWPA 2GWJA 3K2PA 3VQEA 3OY9A 4DU3A 1VQLN 2A40A 3THXB 4JI6K 5J2PA 3THWB 4BRNA 4M3XA 3C6UA 2HF3A 4GV9A 5IT9O 3WUHA 4NB4A 3R8EA 4L3QA 1VQNN 2DFHA 2PYJA 1HUXA 4HCBA 1Y64A 1TUUA 1C1AA 2ATQA 1M90O 3VGMA 2I5JA 3NDKA 1ZBIA 1J5OA 3ZSVA 1S3XA 3LALA 3HP9A 3MEEA 1VSJA 3ULEB 2G8FA 2GV9A 5BN9A 1SQKA 5AQOA 4OLAA 1XNQK 1NLVA 3P83D 2PYLA 3HT3A 3D2EB 4WFAL 2F9TA 3HSCA 4LC9B 4B3RK 4M42A 1DKGD 1BDGA 1KRPA 1IKYA 2IOCA 4IEIA 1HMVA 1MDUB 2E1YA 3E66A 3HVRA 3N4QA 4U7BA 2QWRA 4BGAA 1YT3A 4LSNA 3VEZA 4JI1K 4O44A 4CECA 4CEEA 1NM1A 3G25A 2BUPA 4HUGA 1HNWK 4AHRA 5KGXA 1D9DA 4CFDA 5IWAK 1N36K 3A0IX 3AVJA 1UAXA 3J81O 4NYFA 4OGCA 1LCUA 1S22A 3T1YK 3F9MA 4DV6K 4IO8A 1GLCG 4O8UA 1BI4B 3CC4N 4DLGA 1S72N 1SKRA 3M8SA 2LSNA 4IZ9A 1K8AO 2Y1IA 5KTQA 4LSLA 4JKFA 4BRHA 4A5BA 3SJJA 1FKPA 1NMDA 2A5XA 4RW4A 2GUPA 1S1UA 1K9MO 2E2NA 4BG9A 3U4LA 1XUPO 2HHUA 2HSTA 2A41A 4EIAA 4DV5K 2EHGA 3DLGA 4JLHA 4RW8A 1VQPN 5AQVA 3I0RA 4H8KA 3V1RA 4CE9A 4EP5A 2E1ZA 2KKZA 3ID8A 4H0VB 4IKFA 2YHYA 1T8EA 4DR4K 2ZM6K 3KD5E 2RHKA 4YOVA 2E4LA 4IG0A 4PA1A 3OYJA 4FLZA 4CBWA 1T6CA 1HJRA 3G6EN 2ZD1A 3O3FA 1JLBA 3AVIA 3J8AA 2VQFK 4H03B 4B9VA 3B6OA 1YJNN 3S3NA 1B9DA 5KPRA 5D3GA 3TSPA 4DU4A 5C2DA 1LOTB 1KAYA 3AO3A 4FWKA 3AVLA 2OPSA 1N32K 5GIOA 2Z1JA 4QS9A 2UXDK 1EETA 4KTZA 3EZWA 5FRMA 3O9UA 1YVNA 1OH6A 4DR2K 3MN6A 4BR5A 4DR5K 2P9NB 4YOTA 1WLJA 4BWMA 3WT0A 5HL7L 1OVYA 3KVGA 1K73O 3VQ8A 2E8AA 4W5TA 2V51B 4JD2A 5EY4A 2BDPA 4FWRA 3F73A 3S3OA 3P5JA 1RDCA 1SKWA 4O55A 3C0BA 3RMAA 1JCFA 5AQTA 4F2RA 4E1JA 1WAJA 3EZ5A 3NH1A 3LDOA 3KIOA 4Y0WA 3ISNC 2GX9A 1P90A 3E9PA 2I7PA 2V52B 4LF7K 4CZIA 2P9IB 2JLEA 3TTCA 1XI1A 1IBMK 3H1VX 1JKHA 4KB1A 1XHXA 3AVAA 4FJ8A 2W6LA 3TAQA 4PKGA 5AQUA 1Y97A 4JHDB 1O1WA 3AY9A 3WXJA 1HKGA 4IFYA 3MCAB 4DCHA 4F8RA 4BDPA 4DTXA 2HHQA 4QCLA 4M41A 1YUWA 3L8BA 4OGEA 2IVOA 4KREA 4V19S 4WFBL 2OZMA 1BISA 5T7BA 2QKBA 4IDKA 4YDUC 4H5RA 1NGCA 5KPTA 2G8VA 3DWLA 4CEFA 4XH4A 3AVFA 3KKRA 3EL2A 4BQZA 1NJYA 1KD1O 4ILJA 1NKCA 4CEOA 1JXBA 4XIUA 4HHTA 3MEGA 3ZETB 1V4TA 5I9EB 3PIPL 2HF4A 1JJ2M 3LP3A 1X1PA 2FC0A 1T7PA 4JRQA 3MXIA 5C0YA 3J80O 4N47A 4B1ZA 1TK5A 4FJXA 1FW6A 1W7AA 1XNRK 1UOCA 1BCOA 1EQYA 1X9WA 2OTJN 3RRHA 3HP6A 4LF5K 3SQ2A 4BR9A 3M6GA 1HJOA 4HTLA 4KHUA 2P9LA 3WNEA 4CCHA 3DLEA 4DTSA 3VA3A 2NUBA 4JKGB 3BDPA 2GELA 1T05A 4KHSA 2HMPA 1NOZA 3UKRA 4BR7A 3NF7A 2GEMA 3EEQA 1LW0A 3MXJA 1X3MA 1KCFA 1Q18A 2VG5A 4CEDA 1HNZK 4F3OA 3V4IA 3VF2A 4GV3A 4EHTA 3M5RA 1IG8A 4DMNA 3KLIA 3OHRA 1Q7YO 3L2UA 4K8ZA 2WFBA 4DF4A 2Y1JA 4AILC 5BPNA 4DSFA 3BEXA 3MECA 3CHWA 4ILHA 2ZGYA 1KQSM 4IWVA 1VSKA 4K42A 2PFUA 5HRSA 4MLHA 5J1EA 1TAQA 1QS4A 3CJ1A 4CD3A 4PQUA 3I55N 2ZGZA 3MXMA 4H0YB 3CERA 3NHGA 3KZBA 3SCXA 3C6HA 4BREA 4BC2A 2EX3A 4OPAA 5DK5A 1LAVA 2O8BA 2FXUA 5I42A 1B9FA 4CHQA 2Q31A 2Z1GA 4FJIA 3PY8A 3K59A 4DQPA 3V1QA 3HJFA 4DQ8A 4JI4K 3O3HA 3CCVN 1RBRA 3K9JA 4CEBA 3WQUA 2XY6A 4AHVA 2D0CA 3ULDA 1H1VA 1Q8IA 1ESVA 2IIRA 4AHSA 4QAGA 4DV4K 1M1KO 2W42A 5BN8A 5FPMA 3CCJN 2NRVA 1VHXA 1Z6RA 1FKOA 4PL7A 4LD0A 4FM0A 2JWLA 2QWLA 3VQ6A 3SQ1A 1KFSA 4JK7A 1DLOA 1WBBA 3G10A 3FZFA 1U48A 3DRPA 5LL6Z 3DXMA 5FDLA 1EX4A 1NK4A 4UY8O 4CF8A 5BRHA 1XC3A 3I8BA 4QS7A 4DQIA 3CCQN 4FWSA 4DUYK 2YHAA 5EXWA 1QZ6A 3M8QA 3E01A 4XEIA 4FZYA 3T1AA 2BANA 3QICA 1L3TA 1MU2A 3LZJA 2UUAK 3H6EA 5KPZA 5AQWA 5A2QO 4E1NA 3H45C 1QVGM 3SK3A 2HHSA 4CJUA 4X66K 1EWQA 3IRXA 1YVUA 4UQGA 5J2QA 2P9PA 1MWKA 1LW2A 2F8SA 2D0PA 5BRFA 1RDBA 4BRQA 4FYDA 3CQ8A 3IKMA 3SAFA 3VMFB 2WONA 1E4GT 2W41A 4Z4CA 1RTHA 1DTTA 4ZHRA 4BRKA 3MCPA 2AP1A 4EHUA 4IOCL 1LWCA 4ELVA 2O8DA 4FLTA 4BVOA 3HXMA 3GE1A 3SLCA 4KB0A 4FW2A 3PIOL 4DV2K 2F9WA 1CXQA 3EE9A 1J5EK 1RCHA 4BC4A 5E26A 3NCIA 4MO4A 2UXBK 3LAMA 2OA8A 2YKNA 3AO5A 5FLXO 1BWFO 3KJVA 1KLNA 4YOYA 3HPOA 4FZZA 3KK2A 4KAZA 1U6ZA 2QEXN 1OKJA 4CHZA 3ZSOA 4CGHA 1ITGA 2I7NA 3RRGA 3W3DA 4I2PA 4DV3K 4KI6A 1JCEA 3FZMA 4H4OA 4CBXA 1ILYA 1CZ9A 2NRXA 4M63C 4J8FA 3DOKA 3TSUA 3SMSA 4DSJA 4A57A 3L2VA 4CZLA 3JXUA 3CCEN 4MDAA 3UKUA 3CIPA 4FWOA 4K41A 5AZIB 2VGNA 1QQCA 2Q36A 3H08A 4Z4GA 1E3MA 1HRHA 1NKEA 4Z0UA 2DFEA 1RT7A 1KFDA 4JV5K 1BCMA 2Z1HA 2Q0RA 2YHXA 2G8UA 3WXIA 4M3WA 3MN5A 1YHQN 2KFNA 1J53A 3P1GA 4BR2A 3CFPA 5H1SQ 2HOEA 4Z4FA 4AHCA 1SL0A 1L3UA 4CJRA 4NCGA 4DTRA 2F8TA 4R79A 3QEVA 2HBMA 3AA5X 1D8YA 1U2VA 1DEJA 4DKWA 2IVPA 1ZBUA 1JLEA 3KWGA 4GVMA 3ASMA 3V9ZA 1N6QA 2ETJA 1TKZA 3SUPA 3H1QA 4FLVA 5HOOA 3KHYA 4JI8K 1OH7A 3AA4A 2KZZA 3MWTA 1GOAA 3NAEA 1NGHA 4CEQA 4JAXA 4O5FA 4EZ9A 2QW9A 1NJIO 3GDQA 1KVCA 1IO2A 4LFBK 5M1KA 3D2FA 5J2MA 3E1YA 4PL8A 3THYA 2WC9A 1U04A 3AVCA 5F1XA 1U45A 4CFBA 4E19A 4FO0A 1RBVA 5AJ3K 5M1OA 4FM1A 3O9SA 5AQGA 4DSIA 2KZMA 3VESA 3VEXA 1JLAA 3M8RA 2GBZA 2JGUA 1YI2N 4N5SA 4ZTFA 3ZCMA 5AQFA 5LJWA 4DHYA 5LMNK 4LF8K 2O4IA 1NGEA 3L3UA 1QHAA 1YJ9N 1QQMA 4FCYA 3SUNA 1HKCA 3RR8A 1HNXK 4RCHA 1BHLA 1ZXOA 3NF9A 2NRWA 4E7JA 1I3AA 2W6KA 4HWIA 3V1OA 1C0MA 2X6SA 3QEPA 1RTIA 3WXKA 2DY4A 4A59A 3WQTA 3D7EO 3O6WA 1BGXT 1WN7A 2OPRA 1WSJA 3AVMA 3SPYA 2F7TA 1VQON 3SJHA 5AQXA 3KK1A 2CGJA 4CEZA 5FROA 5AQIA 3CI5A 3HPHA 3CMEN 3D6RA 3CG7A 4BRIA 5JS2A 3ITHA 3VQ5A 3O1WA 4WCEL 4B3OA 1LWFA 5AQLA 4BRFA 4BRDA 5K14A 4JN4A 3OYCA 1K6YA 1K8KB 2A1SA 2P9LB 3I56N 4Z4HA 3SNNA 3VEYA 1TKXA 3F2KA 4W5QA 3GBTA 1HNVA 1GLEG 3UKRB 4KPYA 3ENBA 4CF9A 3AAQA 4JKBA 3WXMB 3VQ7A 4AHUA 4AM6A 1N33K 3CCRN 4MQ3A 1A5XA 1ATSA 1IKVA 3FZHA 3LWLA 1GOBA 4DV1K 1Q9XA 4FPAA 1ASWA 2HVIA 2W40A 4H5WA 3AARA 1NU0A 4BRLA 3E9LA 4CHNA 3W0LA 2FBTA 3HOTA 3HBTA 4DFMA 3R3LA 2P5GA 2YI1A 3LDNA 4KHNA 1S6QA 2D0BA 2RF2A 5B8HA 4O4GA 5I3UA 2UUBK 3QLHA 3OA9A 4MLEA 1QSLA 3I8DA 2OCEA 3EYZA 4KHYA 4K25A 3R6MA 4JKHA 1EKEA 3CPWM 1WSIA 4IJNA 1HQUA 1T03A 2G8HA 2A3ZA 3BUZB 3KD1E 4KO0A 5CZ1A 3PV8A 2YHBA 2XO7A 3ENHA 2YV0X 4EAHD 2J4RA 2YJEA 4BRPA 2O8FB 4CFCA 2HHHK 4DFKA 2KTQA 2ZWHA 4CVNE 4CJLA 4CK2A 5FPDA 3UB5A 3WEEB 3QBWA 1QZ5A 3TAMA 3SBTA 3CCUN 5AR0A 1J9AA 4I9QA 1XWLA 4B8CA 4GV6A 4CZFA 4M7YA 3HOSA 1NGAA 3C95A 4DTMA 4LF6K 3AO1A 2ITGA 3C6TA 5M1NA 3K57A 2PY5A 3ZYYX 2P9SA 1C0FA 1WAFA 2O8CB 3UE5A 1X9JA 5CE3A 4ELUA 4FLYA 2VQEK 1SL2A 2ZQBA 2NZTA 2P9KB 3DXMB 1IBLK 4JI7K 5TKWA 4BDZA 5EU7A 4CD1A 2KQ2A 1VSHA 4E0DA 1JL1A 4ISGA 1GLFO 4FLUA 1TYQA 3LWMA 2O8EB 4NXNK 2FF3B 5KI6A 1N8RO 3L4IA 4IO9L 4FOIA 3MN9A 3EKSA 2G8KA 4B9MA 4HCCA 5CHIA 5JICA 1TK0A 1IV0A 4CJSA 4CFAA 4YOUA 3PUFA 3D2EA 5KQ8A 2YCHA 5CR4A 3BY5A 5SZTA 3A5NC 1VAZA 3TANA 3DI6A 1B92A 4DR6K 1NJWA 4C23A 4LH5A 4CIFA 1XQSC 2D1KA 4IDHA 1KLMA 4C8OA 3AGKA 3OYIA 4E7IA 1V4SA 5AQZA 5AFUH 4LF9K 3PSIA 3KK7A 4JI2K 1VQKN 3HZ6A 3QEXA 5JS1A 5AZJA 2QWMA 4FLXA 3P38A 4BWJA 4PHTX 3LDSA 2FLOA 4N41A 4DWIA 1R59O 3OVNA 1REVA 1FJGK 1NMNA 1BI4A 1ZC6A 4JK9A 1VRTA 4Q0BA 5M1PA 4DG1A 2E6LA 1YXQA 4CI6A 3U6FA 4YOXA 4C8LA 3AGRA 3HL8A 1IJJA 1ZYQA 4H5TA 1YTUA 3NMUA 4FWNA 4I2QA 3ALYA 4E3SA 2V7YA 2KLAA 4CEAA 3QERA 4CW7B 1F21A 4CK3A 5DM6L 4DB3A 5AFUA 4JKEA 4FVMA 3J7ZO 4W5NA 3CQYA 1S1XA 1UWBA 3FZKA 3CCSN 3DXKB 4ID1A 3UKUB 4CJTA 4I7FA 4I9LA 4DQSA 3NVMA 3LPUA 3IUCA 5KQDA 5ELZA 2P9UB 4I6MB 3HYFA 1BUPA 2HW3A 2ZJQL 2E88A 3TARA 3K5NA 1I94K 2NRZA 2YNFA 4ILGB 2QWOA 3QMLA 1JLCA 3D0PA 4J2BA 4FWMA 4DSEA 3L6QA 4C8MA 1WSGA 3PSFA 4KH6A 3VEOA 3SQ4A 4FL9A 4WFNL 1CZBA 3P4IA 3LL3A 1ZBHA 1J6ZA 3PX6A 1NJXA 4FJLA 5E84A 3U9DA 3VERA 2KW4A 3CD6N 1NGGA 4BVPA 3QBXA 3EN9A 3RWUA 4B1XB 2A6AA 1RT1A 1C0UA 3DLBA 4DFPA 2ASOA 4CHPA 2PBDA 3A5OC 4F9OA 4FPBA 4KH4A 4FSVA 4IXCA 4H4MA 2P5OA 1KTQA 3TAGA 1S9GA 3WNGA 1S5JA 4NCAA 3AO4A 3B8AX 3AO2A 3WXLA 2VG6A 5GINA 4DTNA 3OYAA 5GADP 1EWRA 3NGZA 4X62K 3L2QA 1Q86O 2O4GA 3VEVA 4FJ5A 3C94A 1JLQA 4CGDA 3E9OA 4MDBA 4B9TA 4MFBA 3CYMA 3TTDA 3CCMN 2OZSA 1TV6A 1TVRA 5C15A 4CJEA 3DJCA 2B6AA 3VTIA 1TL1A 4KRFA 1HYSA 2YX6A 1KAZA 3HTVA 3CJCA 3OS1A 5AQSA 5C42A 3IDHA 2GWKA 2HBJA 4H5NA 3K58A 3QIOA 3DRSA 3O4WA 3KK3A 3HO1A 2FBXA 2QK9A 1DGKN 1JL2A 4CJ7A 4HUFA 3KLEA 2D4WA 3SYZA 2F4VK 4LY7A 4JHDA 4NLCA 1HPMA 3H46O 1QVFM 4A61A 1NG9A 3BGRA 1GLBG 3T1HK 1UA0A 2RKIA 2OPQA 4BRAA 3SUQA 1C0TA 1BOTO 3LDQA 1KC8O 2ASMA 5FPNA 4BGBA 1MWMA 1ATRA 3DYAA 3O4NA 3F9KA 4HUEA 4CGFA 4NO7A 5KRTA 3K9KA 3OYGA 4ELTA 3SBGA 5ADXH 1X3NA 4CJPA 3A2FA 3MWPA 1VSFA 4IBNA 4O8KA 4FWLA 4R5PA 4FJ9A 4M3ZA 1BQMA 1RT3A 4IOAL 5AQNA 2ZF5O 2YNHA 5GAGP 1SUQA 3KLFA 3PO5A 2WUSA 4K8XA 5AQYA 2XY8A 1VSLA 1GLLO 3L2WA 4KI4A 1LWEA 2QXLA 3CF5L 4DU1A 2FSNA 2E5LK 4CHYA 3CM6A 3FFIA 1ATNA 1Q81O 4OPJA 1HYZA 4X64K 4C8KA 2HNYA 3TR8A 1NK5A 1IBKK 4WQ5C 3OJUA 2UYTA 3NVKA 3PLAA 2PAVA 1G99A 1RTJA 3VGLA 3JSMA 4FJNA 5BR8K 1RT5A 3Q7CA 3O3GA 3MAQA 3VQ9A 3FZLA 2NLXA 1VQ5N 1ASVA 3LP2A 3U3GA 2V7ZA 1KSPA 3T69A 3QNOA 3ZSWA 5JLHA 5ADXA 1TGOA 1RDUA 3M3ZA 3AA2A 3G4SN 4H0PA 4HTUA 2Q0UA 4FJJA 4AH9A 1TKDA 5EVZA 3L2RA 4OKEA 3LANA 4NYNA 4Z94A 1X9SA 1SL1A 3TTFA 4RW7A 2XY5A 3EO3A 3O9RA 4KKOA 4FW1A 4KTWA 4Z4IA 1IH7A 1BO5O 3KTQA 4M3YA 4CGJA 4ID5A 3DRRA 3LP0A 1SV5A 1JXEA 3BP8A 2QKKA 2P51A 4KFBA 2OYQA 5CYQA 4JKAA 3OBYA 4EFHA 3CJ9A 4B3MK 3JAMO 5M1FA 4OO1J 4DV7K 3TAEA 1VSIA 3O80A 3VPZA 1WSHA 4LFAK 1VQ9N 4BE2A 5AQMA 1S1WA 3SPZA 1TKTA 3IS9A 3HI0A 2BH1A 2HHXA 2Q97A 1Z26A 5C25A 4M45A 4G1QA 4DTUA 2X78A 1BA1A 1ZBSA 3AAPA 5FRNA 1VRUA 1YTAA 1XHZA 4DSKA 4CIGA 3SI6A 1JLFA 3HSTB 4JD2B 1BA0A 2NNWA 4CESA 1C1CA 3CXCM 4A62A 2IS3A 3R9PA 3VN5A 3V9XA 4JEPA 2CH5A 3ZT4A 1YITN 1GOCA 2KHOA 1NK0A 2BE2A 2P9SB 2AA4A 3A8YA 4JKDA 4M7XA 2RPIA 1WBDA 4B9UA 3O4QA 4EP4A 3VF6A 4Z4EA 1L3SA 4WQ4A 4NLBA 1A5VA 1RT2A 2PZSA 1LAWA 2VWBA 1VQ6N 3OW2M 3MDQA 1VQ4N 3LAKA 3NBPA 1HLUA 4BC3A 1VSEA 2HNZA 3S9HA 1BIUA 4QS8A 3TABA 2A42A 3P31A 2VG7A 1WSFA 4PKHA 2FSJA 1TYQB 2Q2RA 1HKBA 1OH8A 4X65K 4BACA 4PUOA 3CMAN 4CJWA 1XC9A 4OLBA 1NGBA 3QB0A 4RW9A 3WNFA 4KTQA 4FK4A 1E4FT 1VSDA 3RSEA 5HP1A 1CZAN 2BGGA 3K5OA 4DTOA 4FXDA 4GNIA 1NJZA 4CJ4A 3V9UA 3VOVA 3TAPA 1YAGA 3CPEA 5HLFA 4IEEA 1NK6A 4TSXA 3ZEUA 2BTFA 1VSMA 5CZ2A 3C7NA 2ITMA 4JYAK 3AVHA 3OS0A 4ISFA 5MLCQ 3QETA 4FWPA 2HVHA 5HBMA 1YIJN 3MMVA 5KGWA 2JWKA 3MN7A 3D45A 1WNSA 3O9TA 4E7HA 1OVQA 2E6MA 5AZJB 3RMDA 3OYNA 2QM1A 3OYFA 3DOLA 4L8RB 3NH0A 2EWSA 2KFZA 1YF5L 1RNHA 4BR4A 4BR0A 3DM2A 2WOMA 5KRSA 3EY1A 4LFCK 2UU9K 4FJHA 5AQPA 4DS4A 3OBWA 5TKYA 3SAHA 4NXMK 1NNEA 3K5MA 3ZT0A 3K5LA 3M8PA 1EXQA 4BRMA 3OYEA 3ID6A 4OPKA 4B8AB 4CF1A 3JYTA 4OPHA 1RBUA 3LDPA 4CZMA 3OYBA 4PWDA 2ZE2A 2HBLA 2YHWA 4DTPA 3CC2N 3VENA 2VWKA 3QIPA 1TUYA 3LM2A 5DM7L 2X74A 4WQ5A 4DFJA 4B1WB 1DT9A 2OANA 3AVBA 2CGLA 3ZSZA 4BROA 3QO9A 4O5BA 4XH1A 4CZGA 1Q82O 5M1QA 1S9EA 4H0TB 4OX9K 3AVGA 4B9LA 4KV8A 2RE2A 3SV4A 3RVCA 1VQ8N 1RDDA 4O0JA 3VGKA 3HPGA 5C24A 4KHQA 1NK7A 5AZIA 2QTDA 4BE1A 3VQPA 4H5VA 1KAXA 3M1FA 3PX0A 1RILA 3NF8A 1Q9YA 3PO4A 3VQAA 4CK1A 2O8BB 2NRRA 5CY4A 2UXCK 1T6DA 5BPMA 3H3NO 3KKSA 1D9FA 3N4PA 3DLHA 1EO1A 2FF6A 4O0IA 4CJQA 4FLWA 3DLLL 3U8XA 3O1BA 5GAHP 1CLQA 4OVLA 4AQYK 3QEWA 3OYKA 1RDWX 1WUAA 1U4BA 2YJFA 1TL3A 2QWNA 4HVJA 1IKXA 2HB5A 3MK6A 2X6NA 3JS6A 1C0GA 4CHOA 2D0OA 1N34K 3VEWA 4OKJA 4PKIA 2ZJRL 3T3FA 3P39A 3O9QA 1S1TA 2VYPA 3ATVA 1KVAA 1R0AA 4CZKA 4DV0K 3THXA 5AQHA 2NRTA 2IVNA 3THWA 3CQXA 3CJBA 3VTHA 4H0XB 3ZSYA 4CJKA 1NGIA 1JLGA 3GG4A 3NH2A 4K0KK 3ZT2A 3A5MC 2YNIA 4J2AA 1QHTA 1GLDG 4DR7K 3L3VA 3HRGA 5DMRA 2D0AA 4Y1DA 5BPLA 4B1UB 1QE1A 4NCBA 2QA4N 3BF1A 2DTUA 1A5WA 4IJAA 4BG8A 5HROA 3SV3A 3T19A 1JCGA 1RFQA 3FGUA 2Q3SA 4JRPA 3ULEA 2OPPA 3NGIA 4A5AA 3MX2A 5F0XA 3KLHA 1NGFA 3SAGA 4G9ZA 4DUZK 3O08A 4H0OA 2VWJA 4DR3K 1X9MA 3IFRA 3O8MA 2IC3A 2VGMA 3DAWA 2P9PB 3TPQA 4B9QA 1W2BM 3RR7A 3UIQA 2HMIA 3DMJA 4F4KA 3T7ZA 5JLFA 4N76A 4GKKK 1FK9A 1SZ2A 1NGDA 4Y1CA 1KVBA 4M3RA 1NBWA 3CJAA 4RTFD 3SZ2A 5EOYA 4YHHK 4DLEA 4E7KA 3WNHA 3DLRA 1UA1A 5BR9A 3NGYA 2O8DB 2R7YA 3ZT1A 1QSSA 4IFEA 4E89A 1U49A 4JI0K 3B6PA 4KHPK 3IMXA 3NF6A 4JI3K 3TSQA 2G8WA 1NK8A 2XHBA 1BG3A 2OTLN 4CJVA 3CFOA 5HRNA 4DF8A 2H3GX 4C1NI 2NRHA 4CGGA 2E2QA 1BIZA 1NOYA 2Q1NA 4LF4K 1K8KA 4B3SK 1I39A 5SWMA 3SMPA 3QNNA 4JS4A 5AQKA 4E7LA 3CJ7A 4CF0A 1HYVA 3KWIA 1QQOA 3SQ0A 3C6AA 3DLKA 5E41A 1RTDA 4B9NA 4IFVA 3S41A 1D5AA 1ZBFA 5JMVA 3A5LC 2HHVA 1WSEA 5C2FA 4B9SA 2IAJA 1ZBLA 1EP4A 3GOIA 4BY9C 1RT4A 1VQ7N 3KLGA 1GLJO 3VQCA 3ZX3A 3SUOA 4DTJA 1P8ZA 5LY3A 1HNIA 3FE1A 3O5BA 1RBSA 2Z1IA 2QWQA 3J7YP 1XMOK 4DQRA 2CH6A 2UUCK 4BRCA 3RTVA 3C65A 4B1YB 2E2OA 2GUIA 5LMUK 1VQMN 1KXPA 1BU6O 5C12A 3VF4A 3CFRA 1RDAA 5GIPA 4YNQA 2AJQA 1U2VB 4YFUA 2P1JA 5BRDA 1QQNA 4CZHA 3VETA 2F96A 1BQNA 3IAYA 3RMBA 4FVUA 1Z05A 2YNGA 4LH4A 3ZX0A 4EZ6A 1T44A 3QFPA 1YJWN 2P9NA 1TK8A 4AHTA 4WQ4C 2O8FA 3VQQA 4C8NA 2WBNA 3AVKA 4JI5K 4KHWA 3BZCA 4DS5A 3WEEA 1QTMA 4RW6A 4C1NK 4FJGA 4FJKA 3ZLJA 4MO5A 3OTOK 3THVA 3OJSA 2A1RA 1C6VA 3QESA 5JVHL 4RWTA 3D2FB 1Z25A 2B4JA 1WB9A 4CZJA 3THYB 4JK8A 2O8CA 3FR0A 1HR0K 3MX5A 4JNEA 1OH5A 4CZEA 4F3TA 1NGJA 3NFAA 3IG1A 2YKMA 3ZSXA 2P9IA 5BREA 2P9KA 3G71N 4AF1A 5HRPA 4CJFA 4OJRA 3HVTA 3HK2A 4FK0A 1T3VA 1L3VA 2FSKA 1HPZA 1CXUA 1DTQA 4M3UA 2IGIA 3QFUA 3TU5A 2WTUA 2O8EA 1IG9A 3RSEB 4CGIA 5CYMA 3NE6A 3CC7N 4N56A 3H3OB 4IOXA 1ASUA 2G8IA 1WOQA 4K43A 1W0HA 4BE0A 5AQQA 4WF9L 3CCLN 3ZEUB 2FBVA 3AVNA 4BRGA 1VK0A 1G15A 4M3TA 1L5UA 3OYMA 3HM9A 1RGIA 4FWQA 4ISEA 1C1BA 3V81A 1HQEA 3C7NB 4FM2A 2E2PA 1D4XA 4W5OA 4JS5A 4A2BA 5C10A 2B5JA 2HNDA 3L0QA 4J2DA 3AA3A 3G0ZA 1N5YA 2IDOA 3ZETA 4CERA 5LJVA 1J54A 3TWHA 3AV9A 4BDYA 4J2EA 4BQLA 4YORA 3VQBA 5J2NA 4PY5A 2HHWA 2HBKA 2XRIA 4YDUA 3CETA 1S1VA 4AM7A 4ICLA 5AQRA 2E20A 3ZT3A 1IKWA 3LPTA 4WE1A 1SS6A 4E1MA 4CBUA 1NWKA 2DFFA 3I0SA 3TAFA 2CGKA 4U67L 1GLAG 4GY2B 3QDKA 4JKGA
chains in the Genus database with same CATH topology
3UE5A 4MLHA 1X9JA 5CE3A 3CJ1A 2ASPA 4CD3A 3I55N 2ZGZA 4H0YB 2BTFA 1MA9B 3CERA 4GVEA 4FOEA 3KZBA 3C7NA 3L4QA 4JKCA 3C6HA 2ITMA 2NZTA 4BREA 2P9KB 3HM8A 4ISFA 4OPAA 4BC2A 4BC5A 3DXMB 5MLCQ 2FXUA 4FWPA 5GAEP 1YIJN 4B1VA 5FPEA 3MMVA 5TKWA 2JWKA 4CD1A 3MN7A 1SAZA 2Q31A 1O13A 1GLFO 3O9TA 4ISGA 1TYQA 3GL1A 5AZJB 2QM1A 4DQ8A 2FF3B 3CCVN 1N8RO 3K9JA 3L4IA 2EWSA 3U9ZA 1YF5L 4FOIA 3WQUA 4IO9L 3ENOA 3MN9A 4BR4A 1H1VA 4BR0A 1ESVA 3EKSA 4WYBA 1HX1A 2IIRA 3LM9A 3FLCO 5AQPA 3OBWA 3DXKA 5EX5A 1M1KO 5TKYA 2VCPA 3SAHA 5CHIA 3F5TA 5BN8A 5JICA 5FPMA 2DPNA 4BRMA 3CCJN 2NRVA 3ID6A 4YOUA 3ATUA 3D2EA 3EKUA 2YCHA 4OPHA 1Z6RA 2P9UA 5CR4A 3R1XA 4I6MA 3A5NC 5KQ8A 1VAZA 3LDPA 4CZMA 4PL7A 4C23A 2JWLA 2QWLA 1XQSC 2HBLA 2YHWA 3LDLA 2D1KA 4IDHA 4JK7A 3CCLN 3CC2N 3VENA 3FZFA 1TUYA 3AGKA 3LM2A 5DM7L 3DXMA 4WQ5A 4B1WB 1DT9A 2OANA 3BF3A 1V4SA 5AQZA 5AFUH 2CGLA 4UY8O 4BROA 2QI2A 5BRHA 1XC3A 4XH5A 3KK7A 1VQKN 3I8BA 4QS7A 3HZ6A 4KBOA 4XH1A 4KH5A 4CZGA 5AZJA 1Q82O 2QWMA 3P38A 4PHTX 5M1QA 2FLOA 3CCQN 4FWSA 4H0TB 5EXWA 1R59O 1QZ6A 2RE2A 4XEIA 3RVCA 1VQ8N 1ZC6A 3I33A 3QICA 5AQJA 3VGKA 4JK9A 3FFKB 3Q7BA 4A2AA 3ZX2A 2GTDA 5F2RA 5M1PA 3H6EA 5KPZA 5AQWA 5AZIA 2QTDA 1YXQA 3EE8A 5JVGL 4H5VA 1KAXA 3H45C 4CI6A 1QVGM 1W97L 3SK3A 3M1FA 4YOXA 3AGRA 2ZJPL 1IJJA 4H5TA 2QWPA 2GWJA 1VQLN 4FWNA 3NMUA 2A40A 2NRRA 2V7YA 2KLAA 1T6DA 5BPMA 4BRNA 3H3NO 2P9PA 3N4PA 1MWKA 1EO1A 2D0PA 2HF3A 4GV9A 2FF6A 5BRFA 5DM6L 3WUHA 4BRQA 4NB4A 4DB3A 5AFUA 3R8EA 4L3QA 3IKMA 3SAFA 3VMFB 1VQNN 3DLLL 3U8XA 1E4GT 2W41A 4JKEA 3O1BA 5GAHP 1HUXA 3J7ZO 1Y64A 4CZHA 1TUUA 3CQYA 4BRKA 1RDWX 1WUAA 1M90O 3VGMA 2YJFA 2QWNA 3FZKA 2AP1A 3MCPA 4EHUA 3MK6A 3DXKB 3JS6A 3UKUB 3CCSN 4IOCL 1S3XA 1C0GA 4BVOA 3ULEB 2D0OA 3NVMA 5BN9A 1SQKA 5AQOA 3VEWA 1NLVA 3GE1A 3IUCA 4PKIA 5KQDA 3D2EB 5ELZA 4WFAL 3SLCA 2P9UB 2ZJRL 2F9TA 4I6MB 3HSCA 4LC9B 3PIOL 1BUPA 1DKGD 3P39A 1BDGA 2E88A 2F9WA 2ZJQL 3O9QA 2NRZA 2VYPA 3EE9A 4IEIA 1MDUB 2E1YA 3E66A 5E26A 4BC4A 3ATVA 4ILGB 3N4QA 2QWOA 4CZKA 4U7BA 2QWRA 3QMLA 4BGAA 3VEZA 4MO4A 4FWMA 5AQHA 2NRTA 2IVNA 1NM1A 3CQXA 3G25A 3L6QA 3CJBA 4GY2B 3VTHA 1BWFO 4H0XB 4KH6A 3VEOA 2BUPA 4FL9A 1NGIA 4YOYA 4WFNL 1U6ZA 3GG4A 3LL3A 3P4IA 2QEXN 1J6ZA 1OKJA 3A5MC 3A0IX 5E84A 3U9DA 3VERA 2I7NA 3CD6N 3W3DA 1NGGA 4BVPA 3QBXA 3EN9A 1JCEA 1GLDG 3FZMA 4CBXA 1ILYA 4B1XB 2A6AA 2NRXA 3HRGA 4M63C 1LCUA 1S22A 4J8FA 3F9MA 5BPLA 4IO8A 2ASOA 1GLCG 4O8UA 3TSUA 4B1UB 3SMSA 2PBDA 3CC4N 3A5OC 4F9OA 4A57A 1S72N 4CZLA 3JXUA 3CCEN 4MDAA 3BF1A 3UKUA 4FPBA 4BG8A 3CIPA 4IJAA 2QA4N 4FWOA 4FSVA 4IXCA 4K41A 1JCGA 1RFQA 3FGUA 4KH4A 5AZIB 2VGNA 3ULEA 4IZ9A 2Q36A 4A5AA 1K8AO 3MX2A 5F0XA 1NGFA 3B8AX 3SAGA 4G9ZA 3O08A 4H0OA 3WXLA 5GINA 3IFRA 3O8MA 4JKFA 2VGMA 5GADP 2Q0RA 4A5BA 4BRHA 2YHXA 3DAWA 1NMDA 2A5XA 3WXIA 2P9PB 2GUPA 3MN5A 3TPQA 3VEVA 4B9QA 1YHQN 1W2BM 1Q86O 1K9MO 2E2NA 3E9OA 4MDBA 3U4LA 4BG9A 4BR2A 5H1SQ 3TTDA 2HOEA 3CCMN 1XUPO 2HSTA 3T7ZA 2A41A 5JLFA 4EIAA 5C15A 3DJCA 1SZ2A 1NGDA 3VTIA 1VQPN 1NBWA 2YX6A 5AQVA 1KAZA 3HTVA 3CJAA 4RTFD 3CJCA 5EOYA 4R79A 5AQSA 2E1ZA 2HBMA 2KKZA 3ID8A 3IDHA 4H0VB 1U2VA 1DEJA 4DKWA 2HBJA 2YHYA 2GWKA 4H5NA 2IVPA 5BR9A 3KWGA 2RHKA 3O4WA 4YOVA 1DGKN 4IFEA 4CBWA 4CJ7A 1T6CA 2D4WA 3H1QA 3G6EN 3IMXA 5HOOA 3TSQA 3KHYA 3J8AA 4JHDA 1BG3A 4NLCA 4H03B 1HPMA 3MWTA 2OTLN 3H46O 1QVFM 4A61A 4WF9L 1YJNN 2H3GX 4C1NI 2NRHA 1GLBG 5KPRA 2E2QA 2Q1NA 4BRAA 3TSPA 1K8KA 1NGHA 5C2DA 1LOTB 1KAYA 1BOTO 4FWKA 3LDQA 1KC8O 2ASMA 4JAXA 4O5FA 5FPNA 4BGBA 1MWMA 3SMPA 1ATRA 2QW9A 1NJIO 3GDQA 5AQKA 5GIOA 4QS9A 3CJ7A 5M1KA 3D2FA 3E1YA 4NO7A 4PL8A 3K9KA 3KWIA 1QQOA 2WC9A 3C6AA 3EZWA 3SBGA 5ADXH 1X3NA 3O9UA 1YVNA 3MWPA 4O8KA 5F1XA 4YOWA 4FWLA 3S41A 4IOAL 4FO0A 5AQNA 3MN6A 4BR5A 2ZF5O 5GAGP 2P9NB 4YOTA 5M1OA 3O9SA 5AQGA 3A5LC 5JMVA 2WUSA 5AQYA 3VESA 3VEXA 1OVYA 3KVGA 3WT0A 5C2FA 1GLLO 5HL7L 1YI2N 1K73O 2E8AA 5AQFA 5LJWA 4DHYA 2QXLA 3GOIA 3CF5L 4BY9C 1NGEA 2FSNA 1QHAA 1VQ7N 1YJ9N 2V51B 1QQMA 4JD2A 5EY4A 1GLJO 1ATNA 4FWRA 1Q81O 3ZX3A 4WQ5C 1P8ZA 2UYTA 1HKCA 5LY3A 2PAVA 3NVKA 3PLAA 3FE1A 3O5BA 4RCHA 1G99A 2QWQA 3C0BA 3VGLA 1ZXOA 1JCFA 2CH6A 3Q7CA 5AQTA 4BRCA 1VQ5N 2NRWA 2NLXA 3FZLA 3C65A 4B1YB 2E2OA 4E1JA 1VQMN 1KXPA 3LDOA 1BU6O 4HWIA 2V7ZA 4Y0WA 3VF4A 5C12A 2GX9A 3T69A 1P90A 3E9PA 2I7PA 5GIPA 2V52B 1U2VB 4CZIA 2P9IB 5JLHA 5ADXA 5BRDA 1QQNA 1RDUA 3TTCA 3M3ZA 3VETA 3WXKA 3H1VX 4H0PA 3WQTA 4A59A 3D7EO 1Z05A 3O6WA 3G4SN 4FVUA 2Q0UA 3ZX0A 1T44A 3QFPA 1YJWN 2P9NA 5EVZA 2F7TA 1VQON 4WQ4C 4PKGA 3SJHA 5AQUA 5AQXA 4Z94A 2CGJA 3TTFA 2WBNA 4JHDB 3EO3A 3CI5A 3O9RA 5AQIA 3CMEN 3AY9A 3D6RA 3WXJA 4BRIA 1HKGA 1BO5O 3O1WA 3MCAB 4DCHA 3WEEA 4WCEL 5AQLA 4BRFA 4BRDA 4C1NK 4JN4A 1K8KB 2P9LB 3BP8A 4MO5A 3I56N 1YUWA 3VEYA 3F2KA 2IVOA 3GBTA 4JKAA 3OBYA 4EFHA 1GLEG 3CJ9A 3UKRB 5M1FA 4WFBL 4RWTA 5JVHL 4OO1J 3D2FB 3O80A 3ENBA 4H5RA 1NGCA 4YDUC 3AAQA 3DWLA 4JKBA 4XH4A 4CZJA 5KPTA 4JK8A 3EL2A 3VPZA 3WXMB 4BQZA 3FR0A 1VQ9N 1KD1O 5AQMA 3MX5A 4ILJA 4JNEA 4CZEA 3HI0A 4AM6A 3CCRN 1NGJA 2BH1A 2P9IA 2Q97A 5BREA 5I9EB 1ATSA 1V4TA 3ZETB 3FZHA 3PIPL 2P9KA 2HF4A 4AF1A 3G71N 1JJ2M 1BA1A 1ZBSA 4FPAA 3AAPA 2W40A 4H5WA 5C0YA 4B1ZA 1T3VA 3AARA 4JD2B 2FSKA 1BA0A 2NNWA 4BRLA 3E9LA 3W0LA 3HOTA 3CXCM 3QFUA 3TU5A 3HBTA 1EQYA 3QDKA 4A62A 3R3LA 3RSEB 2YI1A 3LDNA 2OTJN 3R9PA 3CC7N 5B8HA 4BR9A 3H3OB 3M6GA 1HJOA 4HTLA 4IOXA 1WOQA 2P9LA 4JEPA 2CH5A 1YITN 2KHOA 4K43A 2P9SB 2AA4A 4JKGB 5AQQA 3A8YA 3OA9A 4JKDA 4M7XA 2GELA 4MLEA 3ZEUB 4BRGA 2HMPA 3UKRA 3VF6A 4BR7A 4WQ4A 4NLBA 1RGIA 2GEMA 4FWQA 3R6MA 4ISEA 4JKHA 4K25A 2VWBA 1VQ6N 3CPWM 3OW2M 3C7NB 4IJNA 3MDQA 1X3MA 2E2PA 1VQ4N 2A3ZA 1HLUA 1Q18A 3BUZB 4BC3A 1D4XA 4A2BA 5C10A 3VF2A 4QS8A 3ENHA 3L0QA 4EAHD 2J4RA 2A42A 2YJEA 3P31A 4BRPA 4EHTA 3M5RA 1IG8A 4GV3A 3ZETA 5LJVA 2ZWHA 4PKHA 2FSJA 1TYQB 5FPDA 2Q2RA 4YORA 3UB5A 1HKBA 3OHRA 4BQLA 1Q7YO 3WEEB 3QBWA 2HBKA 1QZ5A 3CMAN 3SBTA 2WFBA 1NGBA 3CCUN 4YDUA 3QB0A 3CETA 5BPNA 5AR0A 4AM7A 5AQRA 2E20A 1E4FT 4GV6A 3RSEA 1CZAN 1SS6A 3BEXA 4M7YA 4CZFA 1NGAA 3HOSA 4CBUA 1NWKA 4GNIA 3CHWA 5M1NA 4ILHA 3VOVA 2ZGYA 1YAGA 3CPEA 4IEEA 2CGKA 1KQSM 4IWVA 4U67L 1GLAG 4K42A 2P9SA 2PFUA 4JKGA 3ZYYX 3ZEUA 1C0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T3V A;  1RDU A;  1O13 A;  2RE2 A;  2WFB A;  2KLA A;  1P90 A;  2QTD A;  2YX6 A;  1EO1 A; 
#chains in the Genus database with same CATH topology
 4B08 A;  3K0S A;  2ASP A;  4GMJ B;  3S3M A;  3OYL A;  1MA9 B;  4GVE A;  4GW6 A;  3LP1 A;  4FOE A;  4YY3 K;  4CJ5 A;  2XY7 A;  3L4Q A;  4JKC A;  3HM8 A;  4CIE A;  4CF2 A;  4BC5 A;  5GAE P;  3VA0 A;  4B1V A;  5FPE A;  3V9W A;  1BL3 A;  3TI0 A;  1SAZ A;  1O13 A;  2QXF A;  4GKJ K;  2D5R A;  3QEI A;  4FJM A;  3GL1 A;  4YOW A;  1U47 A;  4RG8 A;  3U9Z A;  3PX4 A;  4ZTJ A;  3ENO A;  3OS2 A;  4WYB A;  4Q5V A;  1HX1 A;  4B3T K;  3LM9 A;  3FLC O;  5EX5 A;  3DXK A;  3MED A;  2VCP A;  3F5T A;  1QSY A;  4QOZ B;  2DPN A;  3VQD A;  2FBY A;  3ATU A;  1NK9 A;  3EKU A;  3RMC A;  1SKS A;  1S6P A;  2P9U A;  3R1X A;  4I6M A;  1RT6 A;  3ZSQ A;  3LDL A;  3CM5 A;  4FZX C;  4DSL A;  3VQ4 A;  4FK2 A;  3BF3 A;  1W9H A;  4CJ3 A;  1RBT A;  2HHT A;  2QI2 A;  4XH5 A;  3ZSR A;  4FJ7 A;  4KBO A;  4KH5 A;  1LV5 A;  3J7A P;  1FXX A;  1NKB A;  4W5R A;  3OYD A;  1TAU A;  2RN2 A;  3LZI A;  3U3Y A;  4DR1 K;  5HRR A;  3I33 A;  3QIN A;  5AQJ A;  3FFK B;  3Q7B A;  4A2A A;  4IG3 A;  3ZX2 A;  2GTD A;  5F2R A;  4DQQ A;  3BZK A;  4F2S A;  3EE8 A;  5JVG L;  3V6D A;  1W97 L;  1XMQ K;  3OYH A;  2ZJP L;  3V9S A;  4OKK A;  2QWP A;  2GWJ A;  3K2P A;  3VQE A;  3OY9 A;  4DU3 A;  1VQL N;  2A40 A;  3THX B;  4JI6 K;  5J2P A;  3THW B;  4BRN A;  4M3X A;  3C6U A;  2HF3 A;  4GV9 A;  5IT9 O;  3WUH A;  4NB4 A;  3R8E A;  4L3Q A;  1VQN N;  2DFH A;  2PYJ A;  1HUX A;  4HCB A;  1Y64 A;  1TUU A;  1C1A A;  2ATQ A;  1M90 O;  3VGM A;  2I5J A;  3NDK A;  1ZBI A;  1J5O A;  3ZSV A;  1S3X A;  3LAL A;  3HP9 A;  3MEE A;  1VSJ A;  3ULE B;  2G8F A;  2GV9 A;  5BN9 A;  1SQK A;  5AQO A;  4OLA A;  1XNQ K;  1NLV A;  3P83 D;  2PYL A;  3HT3 A;  3D2E B;  4WFA L;  2F9T A;  3HSC A;  4LC9 B;  4B3R K;  4M42 A;  1DKG D;  1BDG A;  1KRP A;  1IKY A;  2IOC A;  4IEI A;  1HMV A;  1MDU B;  2E1Y A;  3E66 A;  3HVR A;  3N4Q A;  4U7B A;  2QWR A;  4BGA A;  1YT3 A;  4LSN A;  3VEZ A;  4JI1 K;  4O44 A;  4CEC A;  4CEE A;  1NM1 A;  3G25 A;  2BUP A;  4HUG A;  1HNW K;  4AHR A;  5KGX A;  1D9D A;  4CFD A;  5IWA K;  1N36 K;  3A0I X;  3AVJ A;  1UAX A;  3J81 O;  4NYF A;  4OGC A;  1LCU A;  1S22 A;  3T1Y K;  3F9M A;  4DV6 K;  4IO8 A;  1GLC G;  4O8U A;  1BI4 B;  3CC4 N;  4DLG A;  1S72 N;  1SKR A;  3M8S A;  2LSN A;  4IZ9 A;  1K8A O;  2Y1I A;  5KTQ A;  4LSL A;  4JKF A;  4BRH A;  4A5B A;  3SJJ A;  1FKP A;  1NMD A;  2A5X A;  4RW4 A;  2GUP A;  1S1U A;  1K9M O;  2E2N A;  4BG9 A;  3U4L A;  1XUP O;  2HHU A;  2HST A;  2A41 A;  4EIA A;  4DV5 K;  2EHG A;  3DLG A;  4JLH A;  4RW8 A;  1VQP N;  5AQV A;  3I0R A;  4H8K A;  3V1R A;  4CE9 A;  4EP5 A;  2E1Z A;  2KKZ A;  3ID8 A;  4H0V B;  4IKF A;  2YHY A;  1T8E A;  4DR4 K;  2ZM6 K;  3KD5 E;  2RHK A;  4YOV A;  2E4L A;  4IG0 A;  4PA1 A;  3OYJ A;  4FLZ A;  4CBW A;  1T6C A;  1HJR A;  3G6E N;  2ZD1 A;  3O3F A;  1JLB A;  3AVI A;  3J8A A;  2VQF K;  4H03 B;  4B9V A;  3B6O A;  1YJN N;  3S3N A;  1B9D A;  5KPR A;  5D3G A;  3TSP A;  4DU4 A;  5C2D A;  1LOT B;  1KAY A;  3AO3 A;  4FWK A;  3AVL A;  2OPS A;  1N32 K;  5GIO A;  2Z1J A;  4QS9 A;  2UXD K;  1EET A;  4KTZ A;  3EZW A;  5FRM A;  3O9U A;  1YVN A;  1OH6 A;  4DR2 K;  3MN6 A;  4BR5 A;  4DR5 K;  2P9N B;  4YOT A;  1WLJ A;  4BWM A;  3WT0 A;  5HL7 L;  1OVY A;  3KVG A;  1K73 O;  3VQ8 A;  2E8A A;  4W5T A;  2V51 B;  4JD2 A;  5EY4 A;  2BDP A;  4FWR A;  3F73 A;  3S3O A;  3P5J A;  1RDC A;  1SKW A;  4O55 A;  3C0B A;  3RMA A;  1JCF A;  5AQT A;  4F2R A;  4E1J A;  1WAJ A;  3EZ5 A;  3NH1 A;  3LDO A;  3KIO A;  4Y0W A;  3ISN C;  2GX9 A;  1P90 A;  3E9P A;  2I7P A;  2V52 B;  4LF7 K;  4CZI A;  2P9I B;  2JLE A;  3TTC A;  1XI1 A;  1IBM K;  3H1V X;  1JKH A;  4KB1 A;  1XHX A;  3AVA A;  4FJ8 A;  2W6L A;  3TAQ A;  4PKG A;  5AQU A;  1Y97 A;  4JHD B;  1O1W A;  3AY9 A;  3WXJ A;  1HKG A;  4IFY A;  3MCA B;  4DCH A;  4F8R A;  4BDP A;  4DTX A;  2HHQ A;  4QCL A;  4M41 A;  1YUW A;  3L8B A;  4OGE A;  2IVO A;  4KRE A;  4V19 S;  4WFB L;  2OZM A;  1BIS A;  5T7B A;  2QKB A;  4IDK A;  4YDU C;  4H5R A;  1NGC A;  5KPT A;  2G8V A;  3DWL A;  4CEF A;  4XH4 A;  3AVF A;  3KKR A;  3EL2 A;  4BQZ A;  1NJY A;  1KD1 O;  4ILJ A;  1NKC A;  4CEO A;  1JXB A;  4XIU A;  4HHT A;  3MEG A;  3ZET B;  1V4T A;  5I9E B;  3PIP L;  2HF4 A;  1JJ2 M;  3LP3 A;  1X1P A;  2FC0 A;  1T7P A;  4JRQ A;  3MXI A;  5C0Y A;  3J80 O;  4N47 A;  4B1Z A;  1TK5 A;  4FJX A;  1FW6 A;  1W7A A;  1XNR K;  1UOC A;  1BCO A;  1EQY A;  1X9W A;  2OTJ N;  3RRH A;  3HP6 A;  4LF5 K;  3SQ2 A;  4BR9 A;  3M6G A;  1HJO A;  4HTL A;  4KHU A;  2P9L A;  3WNE A;  4CCH A;  3DLE A;  4DTS A;  3VA3 A;  2NUB A;  4JKG B;  3BDP A;  2GEL A;  1T05 A;  4KHS A;  2HMP A;  1NOZ A;  3UKR A;  4BR7 A;  3NF7 A;  2GEM A;  3EEQ A;  1LW0 A;  3MXJ A;  1X3M A;  1KCF A;  1Q18 A;  2VG5 A;  4CED A;  1HNZ K;  4F3O A;  3V4I A;  3VF2 A;  4GV3 A;  4EHT A;  3M5R A;  1IG8 A;  4DMN A;  3KLI A;  3OHR A;  1Q7Y O;  3L2U A;  4K8Z A;  2WFB A;  4DF4 A;  2Y1J A;  4AIL C;  5BPN A;  4DSF A;  3BEX A;  3MEC A;  3CHW A;  4ILH A;  2ZGY A;  1KQS M;  4IWV A;  1VSK A;  4K42 A;  2PFU A;  5HRS A;  4MLH A;  5J1E A;  1TAQ A;  1QS4 A;  3CJ1 A;  4CD3 A;  4PQU A;  3I55 N;  2ZGZ A;  3MXM A;  4H0Y B;  3CER A;  3NHG A;  3KZB A;  3SCX A;  3C6H A;  4BRE A;  4BC2 A;  2EX3 A;  4OPA A;  5DK5 A;  1LAV A;  2O8B A;  2FXU A;  5I42 A;  1B9F A;  4CHQ A;  2Q31 A;  2Z1G A;  4FJI A;  3PY8 A;  3K59 A;  4DQP A;  3V1Q A;  3HJF A;  4DQ8 A;  4JI4 K;  3O3H A;  3CCV N;  1RBR A;  3K9J A;  4CEB A;  3WQU A;  2XY6 A;  4AHV A;  2D0C A;  3ULD A;  1H1V A;  1Q8I A;  1ESV A;  2IIR A;  4AHS A;  4QAG A;  4DV4 K;  1M1K O;  2W42 A;  5BN8 A;  5FPM A;  3CCJ N;  2NRV A;  1VHX A;  1Z6R A;  1FKO A;  4PL7 A;  4LD0 A;  4FM0 A;  2JWL A;  2QWL A;  3VQ6 A;  3SQ1 A;  1KFS A;  4JK7 A;  1DLO A;  1WBB A;  3G10 A;  3FZF A;  1U48 A;  3DRP A;  5LL6 Z;  3DXM A;  5FDL A;  1EX4 A;  1NK4 A;  4UY8 O;  4CF8 A;  5BRH A;  1XC3 A;  3I8B A;  4QS7 A;  4DQI A;  3CCQ N;  4FWS A;  4DUY K;  2YHA A;  5EXW A;  1QZ6 A;  3M8Q A;  3E01 A;  4XEI A;  4FZY A;  3T1A A;  2BAN A;  3QIC A;  1L3T A;  1MU2 A;  3LZJ A;  2UUA K;  3H6E A;  5KPZ A;  5AQW A;  5A2Q O;  4E1N A;  3H45 C;  1QVG M;  3SK3 A;  2HHS A;  4CJU A;  4X66 K;  1EWQ A;  3IRX A;  1YVU A;  4UQG A;  5J2Q A;  2P9P A;  1MWK A;  1LW2 A;  2F8S A;  2D0P A;  5BRF A;  1RDB A;  4BRQ A;  4FYD A;  3CQ8 A;  3IKM A;  3SAF A;  3VMF B;  2WON A;  1E4G T;  2W41 A;  4Z4C A;  1RTH A;  1DTT A;  4ZHR A;  4BRK A;  3MCP A;  2AP1 A;  4EHU A;  4IOC L;  1LWC A;  4ELV A;  2O8D A;  4FLT A;  4BVO A;  3HXM A;  3GE1 A;  3SLC A;  4KB0 A;  4FW2 A;  3PIO L;  4DV2 K;  2F9W A;  1CXQ A;  3EE9 A;  1J5E K;  1RCH A;  4BC4 A;  5E26 A;  3NCI A;  4MO4 A;  2UXB K;  3LAM A;  2OA8 A;  2YKN A;  3AO5 A;  5FLX O;  1BWF O;  3KJV A;  1KLN A;  4YOY A;  3HPO A;  4FZZ A;  3KK2 A;  4KAZ A;  1U6Z A;  2QEX N;  1OKJ A;  4CHZ A;  3ZSO A;  4CGH A;  1ITG A;  2I7N A;  3RRG A;  3W3D A;  4I2P A;  4DV3 K;  4KI6 A;  1JCE A;  3FZM A;  4H4O A;  4CBX A;  1ILY A;  1CZ9 A;  2NRX A;  4M63 C;  4J8F A;  3DOK A;  3TSU A;  3SMS A;  4DSJ A;  4A57 A;  3L2V A;  4CZL A;  3JXU A;  3CCE N;  4MDA A;  3UKU A;  3CIP A;  4FWO A;  4K41 A;  5AZI B;  2VGN A;  1QQC A;  2Q36 A;  3H08 A;  4Z4G A;  1E3M A;  1HRH A;  1NKE A;  4Z0U A;  2DFE A;  1RT7 A;  1KFD A;  4JV5 K;  1BCM A;  2Z1H A;  2Q0R A;  2YHX A;  2G8U A;  3WXI A;  4M3W A;  3MN5 A;  1YHQ N;  2KFN A;  1J53 A;  3P1G A;  4BR2 A;  3CFP A;  5H1S Q;  2HOE A;  4Z4F A;  4AHC A;  1SL0 A;  1L3U A;  4CJR A;  4NCG A;  4DTR A;  2F8T A;  4R79 A;  3QEV A;  2HBM A;  3AA5 X;  1D8Y A;  1U2V A;  1DEJ A;  4DKW A;  2IVP A;  1ZBU A;  1JLE A;  3KWG A;  4GVM A;  3ASM A;  3V9Z A;  1N6Q A;  2ETJ A;  1TKZ A;  3SUP A;  3H1Q A;  4FLV A;  5HOO A;  3KHY A;  4JI8 K;  1OH7 A;  3AA4 A;  2KZZ A;  3MWT A;  1GOA A;  3NAE A;  1NGH A;  4CEQ A;  4JAX A;  4O5F A;  4EZ9 A;  2QW9 A;  1NJI O;  3GDQ A;  1KVC A;  1IO2 A;  4LFB K;  5M1K A;  3D2F A;  5J2M A;  3E1Y A;  4PL8 A;  3THY A;  2WC9 A;  1U04 A;  3AVC A;  5F1X A;  1U45 A;  4CFB A;  4E19 A;  4FO0 A;  1RBV A;  5AJ3 K;  5M1O A;  4FM1 A;  3O9S A;  5AQG A;  4DSI A;  2KZM A;  3VES A;  3VEX A;  1JLA A;  3M8R A;  2GBZ A;  2JGU A;  1YI2 N;  4N5S A;  4ZTF A;  3ZCM A;  5AQF A;  5LJW A;  4DHY A;  5LMN K;  4LF8 K;  2O4I A;  1NGE A;  3L3U A;  1QHA A;  1YJ9 N;  1QQM A;  4FCY A;  3SUN A;  1HKC A;  3RR8 A;  1HNX K;  4RCH A;  1BHL A;  1ZXO A;  3NF9 A;  2NRW A;  4E7J A;  1I3A A;  2W6K A;  4HWI A;  3V1O A;  1C0M A;  2X6S A;  3QEP A;  1RTI A;  3WXK A;  2DY4 A;  4A59 A;  3WQT A;  3D7E O;  3O6W A;  1BGX T;  1WN7 A;  2OPR A;  1WSJ A;  3AVM A;  3SPY A;  2F7T A;  1VQO N;  3SJH A;  5AQX A;  3KK1 A;  2CGJ A;  4CEZ A;  5FRO A;  5AQI A;  3CI5 A;  3HPH A;  3CME N;  3D6R A;  3CG7 A;  4BRI A;  5JS2 A;  3ITH A;  3VQ5 A;  3O1W A;  4WCE L;  4B3O A;  1LWF A;  5AQL A;  4BRF A;  4BRD A;  5K14 A;  4JN4 A;  3OYC A;  1K6Y A;  1K8K B;  2A1S A;  2P9L B;  3I56 N;  4Z4H A;  3SNN A;  3VEY A;  1TKX A;  3F2K A;  4W5Q A;  3GBT A;  1HNV A;  1GLE G;  3UKR B;  4KPY A;  3ENB A;  4CF9 A;  3AAQ A;  4JKB A;  3WXM B;  3VQ7 A;  4AHU A;  4AM6 A;  1N33 K;  3CCR N;  4MQ3 A;  1A5X A;  1ATS A;  1IKV A;  3FZH A;  3LWL A;  1GOB A;  4DV1 K;  1Q9X A;  4FPA A;  1ASW A;  2HVI A;  2W40 A;  4H5W A;  3AAR A;  1NU0 A;  4BRL A;  3E9L A;  4CHN A;  3W0L A;  2FBT A;  3HOT A;  3HBT A;  4DFM A;  3R3L A;  2P5G A;  2YI1 A;  3LDN A;  4KHN A;  1S6Q A;  2D0B A;  2RF2 A;  5B8H A;  4O4G A;  5I3U A;  2UUB K;  3QLH A;  3OA9 A;  4MLE A;  1QSL A;  3I8D A;  2OCE A;  3EYZ A;  4KHY A;  4K25 A;  3R6M A;  4JKH A;  1EKE A;  3CPW M;  1WSI A;  4IJN A;  1HQU A;  1T03 A;  2G8H A;  2A3Z A;  3BUZ B;  3KD1 E;  4KO0 A;  5CZ1 A;  3PV8 A;  2YHB A;  2XO7 A;  3ENH A;  2YV0 X;  4EAH D;  2J4R A;  2YJE A;  4BRP A;  2O8F B;  4CFC A;  2HHH K;  4DFK A;  2KTQ A;  2ZWH A;  4CVN E;  4CJL A;  4CK2 A;  5FPD A;  3UB5 A;  3WEE B;  3QBW A;  1QZ5 A;  3TAM A;  3SBT A;  3CCU N;  5AR0 A;  1J9A A;  4I9Q A;  1XWL A;  4B8C A;  4GV6 A;  4CZF A;  4M7Y A;  3HOS A;  1NGA A;  3C95 A;  4DTM A;  4LF6 K;  3AO1 A;  2ITG A;  3C6T A;  5M1N A;  3K57 A;  2PY5 A;  3ZYY X;  2P9S A;  1C0F A;  1WAF A;  2O8C B;  3UE5 A;  1X9J A;  5CE3 A;  4ELU A;  4FLY A;  2VQE K;  1SL2 A;  2ZQB A;  2NZT A;  2P9K B;  3DXM B;  1IBL K;  4JI7 K;  5TKW A;  4BDZ A;  5EU7 A;  4CD1 A;  2KQ2 A;  1VSH A;  4E0D A;  1JL1 A;  4ISG A;  1GLF O;  4FLU A;  1TYQ A;  3LWM A;  2O8E B;  4NXN K;  2FF3 B;  5KI6 A;  1N8R O;  3L4I A;  4IO9 L;  4FOI A;  3MN9 A;  3EKS A;  2G8K A;  4B9M A;  4HCC A;  5CHI A;  5JIC A;  1TK0 A;  1IV0 A;  4CJS A;  4CFA A;  4YOU A;  3PUF A;  3D2E A;  5KQ8 A;  2YCH A;  5CR4 A;  3BY5 A;  5SZT A;  3A5N C;  1VAZ A;  3TAN A;  3DI6 A;  1B92 A;  4DR6 K;  1NJW A;  4C23 A;  4LH5 A;  4CIF A;  1XQS C;  2D1K A;  4IDH A;  1KLM A;  4C8O A;  3AGK A;  3OYI A;  4E7I A;  1V4S A;  5AQZ A;  5AFU H;  4LF9 K;  3PSI A;  3KK7 A;  4JI2 K;  1VQK N;  3HZ6 A;  3QEX A;  5JS1 A;  5AZJ A;  2QWM A;  4FLX A;  3P38 A;  4BWJ A;  4PHT X;  3LDS A;  2FLO A;  4N41 A;  4DWI A;  1R59 O;  3OVN A;  1REV A;  1FJG K;  1NMN A;  1BI4 A;  1ZC6 A;  4JK9 A;  1VRT A;  4Q0B A;  5M1P A;  4DG1 A;  2E6L A;  1YXQ A;  4CI6 A;  3U6F A;  4YOX A;  4C8L A;  3AGR A;  3HL8 A;  1IJJ A;  1ZYQ A;  4H5T A;  1YTU A;  3NMU A;  4FWN A;  4I2Q A;  3ALY A;  4E3S A;  2V7Y A;  2KLA A;  4CEA A;  3QER A;  4CW7 B;  1F21 A;  4CK3 A;  5DM6 L;  4DB3 A;  5AFU A;  4JKE A;  4FVM A;  3J7Z O;  4W5N A;  3CQY A;  1S1X A;  1UWB A;  3FZK A;  3CCS N;  3DXK B;  4ID1 A;  3UKU B;  4CJT A;  4I7F A;  4I9L A;  4DQS A;  3NVM A;  3LPU A;  3IUC A;  5KQD A;  5ELZ A;  2P9U B;  4I6M B;  3HYF A;  1BUP A;  2HW3 A;  2ZJQ L;  2E88 A;  3TAR A;  3K5N A;  1I94 K;  2NRZ A;  2YNF A;  4ILG B;  2QWO A;  3QML A;  1JLC A;  3D0P A;  4J2B A;  4FWM A;  4DSE A;  3L6Q A;  4C8M A;  1WSG A;  3PSF A;  4KH6 A;  3VEO A;  3SQ4 A;  4FL9 A;  4WFN L;  1CZB A;  3P4I A;  3LL3 A;  1ZBH A;  1J6Z A;  3PX6 A;  1NJX A;  4FJL A;  5E84 A;  3U9D A;  3VER A;  2KW4 A;  3CD6 N;  1NGG A;  4BVP A;  3QBX A;  3EN9 A;  3RWU A;  4B1X B;  2A6A A;  1RT1 A;  1C0U A;  3DLB A;  4DFP A;  2ASO A;  4CHP A;  2PBD A;  3A5O C;  4F9O A;  4FPB A;  4KH4 A;  4FSV A;  4IXC A;  4H4M A;  2P5O A;  1KTQ A;  3TAG A;  1S9G A;  3WNG A;  1S5J A;  4NCA A;  3AO4 A;  3B8A X;  3AO2 A;  3WXL A;  2VG6 A;  5GIN A;  4DTN A;  3OYA A;  5GAD P;  1EWR A;  3NGZ A;  4X62 K;  3L2Q A;  1Q86 O;  2O4G A;  3VEV A;  4FJ5 A;  3C94 A;  1JLQ A;  4CGD A;  3E9O A;  4MDB A;  4B9T A;  4MFB A;  3CYM A;  3TTD A;  3CCM N;  2OZS A;  1TV6 A;  1TVR A;  5C15 A;  4CJE A;  3DJC A;  2B6A A;  3VTI A;  1TL1 A;  4KRF A;  1HYS A;  2YX6 A;  1KAZ A;  3HTV A;  3CJC A;  3OS1 A;  5AQS A;  5C42 A;  3IDH A;  2GWK A;  2HBJ A;  4H5N A;  3K58 A;  3QIO A;  3DRS A;  3O4W A;  3KK3 A;  3HO1 A;  2FBX A;  2QK9 A;  1DGK N;  1JL2 A;  4CJ7 A;  4HUF A;  3KLE A;  2D4W A;  3SYZ A;  2F4V K;  4LY7 A;  4JHD A;  4NLC A;  1HPM A;  3H46 O;  1QVF M;  4A61 A;  1NG9 A;  3BGR A;  1GLB G;  3T1H K;  1UA0 A;  2RKI A;  2OPQ A;  4BRA A;  3SUQ A;  1C0T A;  1BOT O;  3LDQ A;  1KC8 O;  2ASM A;  5FPN A;  4BGB A;  1MWM A;  1ATR A;  3DYA A;  3O4N A;  3F9K A;  4HUE A;  4CGF A;  4NO7 A;  5KRT A;  3K9K A;  3OYG A;  4ELT A;  3SBG A;  5ADX H;  1X3N A;  4CJP A;  3A2F A;  3MWP A;  1VSF A;  4IBN A;  4O8K A;  4FWL A;  4R5P A;  4FJ9 A;  4M3Z A;  1BQM A;  1RT3 A;  4IOA L;  5AQN A;  2ZF5 O;  2YNH A;  5GAG P;  1SUQ A;  3KLF A;  3PO5 A;  2WUS A;  4K8X A;  5AQY A;  2XY8 A;  1VSL A;  1GLL O;  3L2W A;  4KI4 A;  1LWE A;  2QXL A;  3CF5 L;  4DU1 A;  2FSN A;  2E5L K;  4CHY A;  3CM6 A;  3FFI A;  1ATN A;  1Q81 O;  4OPJ A;  1HYZ A;  4X64 K;  4C8K A;  2HNY A;  3TR8 A;  1NK5 A;  1IBK K;  4WQ5 C;  3OJU A;  2UYT A;  3NVK A;  3PLA A;  2PAV A;  1G99 A;  1RTJ A;  3VGL A;  3JSM A;  4FJN A;  5BR8 K;  1RT5 A;  3Q7C A;  3O3G A;  3MAQ A;  3VQ9 A;  3FZL A;  2NLX A;  1VQ5 N;  1ASV A;  3LP2 A;  3U3G A;  2V7Z A;  1KSP A;  3T69 A;  3QNO A;  3ZSW A;  5JLH A;  5ADX A;  1TGO A;  1RDU A;  3M3Z A;  3AA2 A;  3G4S N;  4H0P A;  4HTU A;  2Q0U A;  4FJJ A;  4AH9 A;  1TKD A;  5EVZ A;  3L2R A;  4OKE A;  3LAN A;  4NYN A;  4Z94 A;  1X9S A;  1SL1 A;  3TTF A;  4RW7 A;  2XY5 A;  3EO3 A;  3O9R A;  4KKO A;  4FW1 A;  4KTW A;  4Z4I A;  1IH7 A;  1BO5 O;  3KTQ A;  4M3Y A;  4CGJ A;  4ID5 A;  3DRR A;  3LP0 A;  1SV5 A;  1JXE A;  3BP8 A;  2QKK A;  2P51 A;  4KFB A;  2OYQ A;  5CYQ A;  4JKA A;  3OBY A;  4EFH A;  3CJ9 A;  4B3M K;  3JAM O;  5M1F A;  4OO1 J;  4DV7 K;  3TAE A;  1VSI A;  3O80 A;  3VPZ A;  1WSH A;  4LFA K;  1VQ9 N;  4BE2 A;  5AQM A;  1S1W A;  3SPZ A;  1TKT A;  3IS9 A;  3HI0 A;  2BH1 A;  2HHX A;  2Q97 A;  1Z26 A;  5C25 A;  4M45 A;  4G1Q A;  4DTU A;  2X78 A;  1BA1 A;  1ZBS A;  3AAP A;  5FRN A;  1VRU A;  1YTA A;  1XHZ A;  4DSK A;  4CIG A;  3SI6 A;  1JLF A;  3HST B;  4JD2 B;  1BA0 A;  2NNW A;  4CES A;  1C1C A;  3CXC M;  4A62 A;  2IS3 A;  3R9P A;  3VN5 A;  3V9X A;  4JEP A;  2CH5 A;  3ZT4 A;  1YIT N;  1GOC A;  2KHO A;  1NK0 A;  2BE2 A;  2P9S B;  2AA4 A;  3A8Y A;  4JKD A;  4M7X A;  2RPI A;  1WBD A;  4B9U A;  3O4Q A;  4EP4 A;  3VF6 A;  4Z4E A;  1L3S A;  4WQ4 A;  4NLB A;  1A5V A;  1RT2 A;  2PZS A;  1LAW A;  2VWB A;  1VQ6 N;  3OW2 M;  3MDQ A;  1VQ4 N;  3LAK A;  3NBP A;  1HLU A;  4BC3 A;  1VSE A;  2HNZ A;  3S9H A;  1BIU A;  4QS8 A;  3TAB A;  2A42 A;  3P31 A;  2VG7 A;  1WSF A;  4PKH A;  2FSJ A;  1TYQ B;  2Q2R A;  1HKB A;  1OH8 A;  4X65 K;  4BAC A;  4PUO A;  3CMA N;  4CJW A;  1XC9 A;  4OLB A;  1NGB A;  3QB0 A;  4RW9 A;  3WNF A;  4KTQ A;  4FK4 A;  1E4F T;  1VSD A;  3RSE A;  5HP1 A;  1CZA N;  2BGG A;  3K5O A;  4DTO A;  4FXD A;  4GNI A;  1NJZ A;  4CJ4 A;  3V9U A;  3VOV A;  3TAP A;  1YAG A;  3CPE A;  5HLF A;  4IEE A;  1NK6 A;  4TSX A;  3ZEU A;  2BTF A;  1VSM A;  5CZ2 A;  3C7N A;  2ITM A;  4JYA K;  3AVH A;  3OS0 A;  4ISF A;  5MLC Q;  3QET A;  4FWP A;  2HVH A;  5HBM A;  1YIJ N;  3MMV A;  5KGW A;  2JWK A;  3MN7 A;  3D45 A;  1WNS A;  3O9T A;  4E7H A;  1OVQ A;  2E6M A;  5AZJ B;  3RMD A;  3OYN A;  2QM1 A;  3OYF A;  3DOL A;  4L8R B;  3NH0 A;  2EWS A;  2KFZ A;  1YF5 L;  1RNH A;  4BR4 A;  4BR0 A;  3DM2 A;  2WOM A;  5KRS A;  3EY1 A;  4LFC K;  2UU9 K;  4FJH A;  5AQP A;  4DS4 A;  3OBW A;  5TKY A;  3SAH A;  4NXM K;  1NNE A;  3K5M A;  3ZT0 A;  3K5L A;  3M8P A;  1EXQ A;  4BRM A;  3OYE A;  3ID6 A;  4OPK A;  4B8A B;  4CF1 A;  3JYT A;  4OPH A;  1RBU A;  3LDP A;  4CZM A;  3OYB A;  4PWD A;  2ZE2 A;  2HBL A;  2YHW A;  4DTP A;  3CC2 N;  3VEN A;  2VWK A;  3QIP A;  1TUY A;  3LM2 A;  5DM7 L;  2X74 A;  4WQ5 A;  4DFJ A;  4B1W B;  1DT9 A;  2OAN A;  3AVB A;  2CGL A;  3ZSZ A;  4BRO A;  3QO9 A;  4O5B A;  4XH1 A;  4CZG A;  1Q82 O;  5M1Q A;  1S9E A;  4H0T B;  4OX9 K;  3AVG A;  4B9L A;  4KV8 A;  2RE2 A;  3SV4 A;  3RVC A;  1VQ8 N;  1RDD A;  4O0J A;  3VGK A;  3HPG A;  5C24 A;  4KHQ A;  1NK7 A;  5AZI A;  2QTD A;  4BE1 A;  3VQP A;  4H5V A;  1KAX A;  3M1F A;  3PX0 A;  1RIL A;  3NF8 A;  1Q9Y A;  3PO4 A;  3VQA A;  4CK1 A;  2O8B B;  2NRR A;  5CY4 A;  2UXC K;  1T6D A;  5BPM A;  3H3N O;  3KKS A;  1D9F A;  3N4P A;  3DLH A;  1EO1 A;  2FF6 A;  4O0I A;  4CJQ A;  4FLW A;  3DLL L;  3U8X A;  3O1B A;  5GAH P;  1CLQ A;  4OVL A;  4AQY K;  3QEW A;  3OYK A;  1RDW X;  1WUA A;  1U4B A;  2YJF A;  1TL3 A;  2QWN A;  4HVJ A;  1IKX A;  2HB5 A;  3MK6 A;  2X6N A;  3JS6 A;  1C0G A;  4CHO A;  2D0O A;  1N34 K;  3VEW A;  4OKJ A;  4PKI A;  2ZJR L;  3T3F A;  3P39 A;  3O9Q A;  1S1T A;  2VYP A;  3ATV A;  1KVA A;  1R0A A;  4CZK A;  4DV0 K;  3THX A;  5AQH A;  2NRT A;  2IVN A;  3THW A;  3CQX A;  3CJB A;  3VTH A;  4H0X B;  3ZSY A;  4CJK A;  1NGI A;  1JLG A;  3GG4 A;  3NH2 A;  4K0K K;  3ZT2 A;  3A5M C;  2YNI A;  4J2A A;  1QHT A;  1GLD G;  4DR7 K;  3L3V A;  3HRG A;  5DMR A;  2D0A A;  4Y1D A;  5BPL A;  4B1U B;  1QE1 A;  4NCB A;  2QA4 N;  3BF1 A;  2DTU A;  1A5W A;  4IJA A;  4BG8 A;  5HRO A;  3SV3 A;  3T19 A;  1JCG A;  1RFQ A;  3FGU A;  2Q3S A;  4JRP A;  3ULE A;  2OPP A;  3NGI A;  4A5A A;  3MX2 A;  5F0X A;  3KLH A;  1NGF A;  3SAG A;  4G9Z A;  4DUZ K;  3O08 A;  4H0O A;  2VWJ A;  4DR3 K;  1X9M A;  3IFR A;  3O8M A;  2IC3 A;  2VGM A;  3DAW A;  2P9P B;  3TPQ A;  4B9Q A;  1W2B M;  3RR7 A;  3UIQ A;  2HMI A;  3DMJ A;  4F4K A;  3T7Z A;  5JLF A;  4N76 A;  4GKK K;  1FK9 A;  1SZ2 A;  1NGD A;  4Y1C A;  1KVB A;  4M3R A;  1NBW A;  3CJA A;  4RTF D;  3SZ2 A;  5EOY A;  4YHH K;  4DLE A;  4E7K A;  3WNH A;  3DLR A;  1UA1 A;  5BR9 A;  3NGY A;  2O8D B;  2R7Y A;  3ZT1 A;  1QSS A;  4IFE A;  4E89 A;  1U49 A;  4JI0 K;  3B6P A;  4KHP K;  3IMX A;  3NF6 A;  4JI3 K;  3TSQ A;  2G8W A;  1NK8 A;  2XHB A;  1BG3 A;  2OTL N;  4CJV A;  3CFO A;  5HRN A;  4DF8 A;  2H3G X;  4C1N I;  2NRH A;  4CGG A;  2E2Q A;  1BIZ A;  1NOY A;  2Q1N A;  4LF4 K;  1K8K A;  4B3S K;  1I39 A;  5SWM A;  3SMP A;  3QNN A;  4JS4 A;  5AQK A;  4E7L A;  3CJ7 A;  4CF0 A;  1HYV A;  3KWI A;  1QQO A;  3SQ0 A;  3C6A A;  3DLK A;  5E41 A;  1RTD A;  4B9N A;  4IFV A;  3S41 A;  1D5A A;  1ZBF A;  5JMV A;  3A5L C;  2HHV A;  1WSE A;  5C2F A;  4B9S A;  2IAJ A;  1ZBL A;  1EP4 A;  3GOI A;  4BY9 C;  1RT4 A;  1VQ7 N;  3KLG A;  1GLJ O;  3VQC A;  3ZX3 A;  3SUO A;  4DTJ A;  1P8Z A;  5LY3 A;  1HNI A;  3FE1 A;  3O5B A;  1RBS A;  2Z1I A;  2QWQ A;  3J7Y P;  1XMO K;  4DQR A;  2CH6 A;  2UUC K;  4BRC A;  3RTV A;  3C65 A;  4B1Y B;  2E2O A;  2GUI A;  5LMU K;  1VQM N;  1KXP A;  1BU6 O;  5C12 A;  3VF4 A;  3CFR A;  1RDA A;  5GIP A;  4YNQ A;  2AJQ A;  1U2V B;  4YFU A;  2P1J A;  5BRD A;  1QQN A;  4CZH A;  3VET A;  2F96 A;  1BQN A;  3IAY A;  3RMB A;  4FVU A;  1Z05 A;  2YNG A;  4LH4 A;  3ZX0 A;  4EZ6 A;  1T44 A;  3QFP A;  1YJW N;  2P9N A;  1TK8 A;  4AHT A;  4WQ4 C;  2O8F A;  3VQQ A;  4C8N A;  2WBN A;  3AVK A;  4JI5 K;  4KHW A;  3BZC A;  4DS5 A;  3WEE A;  1QTM A;  4RW6 A;  4C1N K;  4FJG A;  4FJK A;  3ZLJ A;  4MO5 A;  3OTO K;  3THV A;  3OJS A;  2A1R A;  1C6V A;  3QES A;  5JVH L;  4RWT A;  3D2F B;  1Z25 A;  2B4J A;  1WB9 A;  4CZJ A;  3THY B;  4JK8 A;  2O8C A;  3FR0 A;  1HR0 K;  3MX5 A;  4JNE A;  1OH5 A;  4CZE A;  4F3T A;  1NGJ A;  3NFA A;  3IG1 A;  2YKM A;  3ZSX A;  2P9I A;  5BRE A;  2P9K A;  3G71 N;  4AF1 A;  5HRP A;  4CJF A;  4OJR A;  3HVT A;  3HK2 A;  4FK0 A;  1T3V A;  1L3V A;  2FSK A;  1HPZ A;  1CXU A;  1DTQ A;  4M3U A;  2IGI A;  3QFU A;  3TU5 A;  2WTU A;  2O8E A;  1IG9 A;  3RSE B;  4CGI A;  5CYM A;  3NE6 A;  3CC7 N;  4N56 A;  3H3O B;  4IOX A;  1ASU A;  2G8I A;  1WOQ A;  4K43 A;  1W0H A;  4BE0 A;  5AQQ A;  4WF9 L;  3CCL N;  3ZEU B;  2FBV A;  3AVN A;  4BRG A;  1VK0 A;  1G15 A;  4M3T A;  1L5U A;  3OYM A;  3HM9 A;  1RGI A;  4FWQ A;  4ISE A;  1C1B A;  3V81 A;  1HQE A;  3C7N B;  4FM2 A;  2E2P A;  1D4X A;  4W5O A;  4JS5 A;  4A2B A;  5C10 A;  2B5J A;  2HND A;  3L0Q A;  4J2D A;  3AA3 A;  3G0Z A;  1N5Y A;  2IDO A;  3ZET A;  4CER A;  5LJV A;  1J54 A;  3TWH A;  3AV9 A;  4BDY A;  4J2E A;  4BQL A;  4YOR A;  3VQB A;  5J2N A;  4PY5 A;  2HHW A;  2HBK A;  2XRI A;  4YDU A;  3CET A;  1S1V A;  4AM7 A;  4ICL A;  5AQR A;  2E20 A;  3ZT3 A;  1IKW A;  3LPT A;  4WE1 A;  1SS6 A;  4E1M A;  4CBU A;  1NWK A;  2DFF A;  3I0S A;  3TAF A;  2CGK A;  4U67 L;  1GLA G;  4GY2 B;  3QDK A;  4JKG A; 
#chains in the Genus database with same CATH homology
 3UE5 A;  4MLH A;  1X9J A;  5CE3 A;  3CJ1 A;  2ASP A;  4CD3 A;  3I55 N;  2ZGZ A;  4H0Y B;  2BTF A;  1MA9 B;  3CER A;  4GVE A;  4FOE A;  3KZB A;  3C7N A;  3L4Q A;  4JKC A;  3C6H A;  2ITM A;  2NZT A;  4BRE A;  2P9K B;  3HM8 A;  4ISF A;  4OPA A;  4BC2 A;  4BC5 A;  3DXM B;  5MLC Q;  2FXU A;  4FWP A;  5GAE P;  1YIJ N;  4B1V A;  5FPE A;  3MMV A;  5TKW A;  2JWK A;  4CD1 A;  3MN7 A;  1SAZ A;  2Q31 A;  1O13 A;  1GLF O;  3O9T A;  4ISG A;  1TYQ A;  3GL1 A;  5AZJ B;  2QM1 A;  4DQ8 A;  2FF3 B;  3CCV N;  1N8R O;  3K9J A;  3L4I A;  2EWS A;  3U9Z A;  1YF5 L;  4FOI A;  3WQU A;  4IO9 L;  3ENO A;  3MN9 A;  4BR4 A;  1H1V A;  4BR0 A;  1ESV A;  3EKS A;  4WYB A;  1HX1 A;  2IIR A;  3LM9 A;  3FLC O;  5AQP A;  3OBW A;  3DXK A;  5EX5 A;  1M1K O;  5TKY A;  2VCP A;  3SAH A;  5CHI A;  3F5T A;  5BN8 A;  5JIC A;  5FPM A;  2DPN A;  4BRM A;  3CCJ N;  2NRV A;  3ID6 A;  4YOU A;  3ATU A;  3D2E A;  3EKU A;  2YCH A;  4OPH A;  1Z6R A;  2P9U A;  5CR4 A;  3R1X A;  4I6M A;  3A5N C;  5KQ8 A;  1VAZ A;  3LDP A;  4CZM A;  4PL7 A;  4C23 A;  2JWL A;  2QWL A;  1XQS C;  2HBL A;  2YHW A;  3LDL A;  2D1K A;  4IDH A;  4JK7 A;  3CCL N;  3CC2 N;  3VEN A;  3FZF A;  1TUY A;  3AGK A;  3LM2 A;  5DM7 L;  3DXM A;  4WQ5 A;  4B1W B;  1DT9 A;  2OAN A;  3BF3 A;  1V4S A;  5AQZ A;  5AFU H;  2CGL A;  4UY8 O;  4BRO A;  2QI2 A;  5BRH A;  1XC3 A;  4XH5 A;  3KK7 A;  1VQK N;  3I8B A;  4QS7 A;  3HZ6 A;  4KBO A;  4XH1 A;  4KH5 A;  4CZG A;  5AZJ A;  1Q82 O;  2QWM A;  3P38 A;  4PHT X;  5M1Q A;  2FLO A;  3CCQ N;  4FWS A;  4H0T B;  5EXW A;  1R59 O;  1QZ6 A;  2RE2 A;  4XEI A;  3RVC A;  1VQ8 N;  1ZC6 A;  3I33 A;  3QIC A;  5AQJ A;  3VGK A;  4JK9 A;  3FFK B;  3Q7B A;  4A2A A;  3ZX2 A;  2GTD A;  5F2R A;  5M1P A;  3H6E A;  5KPZ A;  5AQW A;  5AZI A;  2QTD A;  1YXQ A;  3EE8 A;  5JVG L;  4H5V A;  1KAX A;  3H45 C;  4CI6 A;  1QVG M;  1W97 L;  3SK3 A;  3M1F A;  4YOX A;  3AGR A;  2ZJP L;  1IJJ A;  4H5T A;  2QWP A;  2GWJ A;  1VQL N;  4FWN A;  3NMU A;  2A40 A;  2NRR A;  2V7Y A;  2KLA A;  1T6D A;  5BPM A;  4BRN A;  3H3N O;  2P9P A;  3N4P A;  1MWK A;  1EO1 A;  2D0P A;  2HF3 A;  4GV9 A;  2FF6 A;  5BRF A;  5DM6 L;  3WUH A;  4BRQ A;  4NB4 A;  4DB3 A;  5AFU A;  3R8E A;  4L3Q A;  3IKM A;  3SAF A;  3VMF B;  1VQN N;  3DLL L;  3U8X A;  1E4G T;  2W41 A;  4JKE A;  3O1B A;  5GAH P;  1HUX A;  3J7Z O;  1Y64 A;  4CZH A;  1TUU A;  3CQY A;  4BRK A;  1RDW X;  1WUA A;  1M90 O;  3VGM A;  2YJF A;  2QWN A;  3FZK A;  2AP1 A;  3MCP A;  4EHU A;  3MK6 A;  3DXK B;  3JS6 A;  3UKU B;  3CCS N;  4IOC L;  1S3X A;  1C0G A;  4BVO A;  3ULE B;  2D0O A;  3NVM A;  5BN9 A;  1SQK A;  5AQO A;  3VEW A;  1NLV A;  3GE1 A;  3IUC A;  4PKI A;  5KQD A;  3D2E B;  5ELZ A;  4WFA L;  3SLC A;  2P9U B;  2ZJR L;  2F9T A;  4I6M B;  3HSC A;  4LC9 B;  3PIO L;  1BUP A;  1DKG D;  3P39 A;  1BDG A;  2E88 A;  2F9W A;  2ZJQ L;  3O9Q A;  2NRZ A;  2VYP A;  3EE9 A;  4IEI A;  1MDU B;  2E1Y A;  3E66 A;  5E26 A;  4BC4 A;  3ATV A;  4ILG B;  3N4Q A;  2QWO A;  4CZK A;  4U7B A;  2QWR A;  3QML A;  4BGA A;  3VEZ A;  4MO4 A;  4FWM A;  5AQH A;  2NRT A;  2IVN A;  1NM1 A;  3CQX A;  3G25 A;  3L6Q A;  3CJB A;  4GY2 B;  3VTH A;  1BWF O;  4H0X B;  4KH6 A;  3VEO A;  2BUP A;  4FL9 A;  1NGI A;  4YOY A;  4WFN L;  1U6Z A;  3GG4 A;  3LL3 A;  3P4I A;  2QEX N;  1J6Z A;  1OKJ A;  3A5M C;  3A0I X;  5E84 A;  3U9D A;  3VER A;  2I7N A;  3CD6 N;  3W3D A;  1NGG A;  4BVP A;  3QBX A;  3EN9 A;  1JCE A;  1GLD G;  3FZM A;  4CBX A;  1ILY A;  4B1X B;  2A6A A;  2NRX A;  3HRG A;  4M63 C;  1LCU A;  1S22 A;  4J8F A;  3F9M A;  5BPL A;  4IO8 A;  2ASO A;  1GLC G;  4O8U A;  3TSU A;  4B1U B;  3SMS A;  2PBD A;  3CC4 N;  3A5O C;  4F9O A;  4A57 A;  1S72 N;  4CZL A;  3JXU A;  3CCE N;  4MDA A;  3BF1 A;  3UKU A;  4FPB A;  4BG8 A;  3CIP A;  4IJA A;  2QA4 N;  4FWO A;  4FSV A;  4IXC A;  4K41 A;  1JCG A;  1RFQ A;  3FGU A;  4KH4 A;  5AZI B;  2VGN A;  3ULE A;  4IZ9 A;  2Q36 A;  4A5A A;  1K8A O;  3MX2 A;  5F0X A;  1NGF A;  3B8A X;  3SAG A;  4G9Z A;  3O08 A;  4H0O A;  3WXL A;  5GIN A;  3IFR A;  3O8M A;  4JKF A;  2VGM A;  5GAD P;  2Q0R A;  4A5B A;  4BRH A;  2YHX A;  3DAW A;  1NMD A;  2A5X A;  3WXI A;  2P9P B;  2GUP A;  3MN5 A;  3TPQ A;  3VEV A;  4B9Q A;  1YHQ N;  1W2B M;  1Q86 O;  1K9M O;  2E2N A;  3E9O A;  4MDB A;  3U4L A;  4BG9 A;  4BR2 A;  5H1S Q;  3TTD A;  2HOE A;  3CCM N;  1XUP O;  2HST A;  3T7Z A;  2A41 A;  5JLF A;  4EIA A;  5C15 A;  3DJC A;  1SZ2 A;  1NGD A;  3VTI A;  1VQP N;  1NBW A;  2YX6 A;  5AQV A;  1KAZ A;  3HTV A;  3CJA A;  4RTF D;  3CJC A;  5EOY A;  4R79 A;  5AQS A;  2E1Z A;  2HBM A;  2KKZ A;  3ID8 A;  3IDH A;  4H0V B;  1U2V A;  1DEJ A;  4DKW A;  2HBJ A;  2YHY A;  2GWK A;  4H5N A;  2IVP A;  5BR9 A;  3KWG A;  2RHK A;  3O4W A;  4YOV A;  1DGK N;  4IFE A;  4CBW A;  4CJ7 A;  1T6C A;  2D4W A;  3H1Q A;  3G6E N;  3IMX A;  5HOO A;  3TSQ A;  3KHY A;  3J8A A;  4JHD A;  1BG3 A;  4NLC A;  4H03 B;  1HPM A;  3MWT A;  2OTL N;  3H46 O;  1QVF M;  4A61 A;  4WF9 L;  1YJN N;  2H3G X;  4C1N I;  2NRH A;  1GLB G;  5KPR A;  2E2Q A;  2Q1N A;  4BRA A;  3TSP A;  1K8K A;  1NGH A;  5C2D A;  1LOT B;  1KAY A;  1BOT O;  4FWK A;  3LDQ A;  1KC8 O;  2ASM A;  4JAX A;  4O5F A;  5FPN A;  4BGB A;  1MWM A;  3SMP A;  1ATR A;  2QW9 A;  1NJI O;  3GDQ A;  5AQK A;  5GIO A;  4QS9 A;  3CJ7 A;  5M1K A;  3D2F A;  3E1Y A;  4NO7 A;  4PL8 A;  3K9K A;  3KWI A;  1QQO A;  2WC9 A;  3C6A A;  3EZW A;  3SBG A;  5ADX H;  1X3N A;  3O9U A;  1YVN A;  3MWP A;  4O8K A;  5F1X A;  4YOW A;  4FWL A;  3S41 A;  4IOA L;  4FO0 A;  5AQN A;  3MN6 A;  4BR5 A;  2ZF5 O;  5GAG P;  2P9N B;  4YOT A;  5M1O A;  3O9S A;  5AQG A;  3A5L C;  5JMV A;  2WUS A;  5AQY A;  3VES A;  3VEX A;  1OVY A;  3KVG A;  3WT0 A;  5C2F A;  1GLL O;  5HL7 L;  1YI2 N;  1K73 O;  2E8A A;  5AQF A;  5LJW A;  4DHY A;  2QXL A;  3GOI A;  3CF5 L;  4BY9 C;  1NGE A;  2FSN A;  1QHA A;  1VQ7 N;  1YJ9 N;  2V51 B;  1QQM A;  4JD2 A;  5EY4 A;  1GLJ O;  1ATN A;  4FWR A;  1Q81 O;  3ZX3 A;  4WQ5 C;  1P8Z A;  2UYT A;  1HKC A;  5LY3 A;  2PAV A;  3NVK A;  3PLA A;  3FE1 A;  3O5B A;  4RCH A;  1G99 A;  2QWQ A;  3C0B A;  3VGL A;  1ZXO A;  1JCF A;  2CH6 A;  3Q7C A;  5AQT A;  4BRC A;  1VQ5 N;  2NRW A;  2NLX A;  3FZL A;  3C65 A;  4B1Y B;  2E2O A;  4E1J A;  1VQM N;  1KXP A;  3LDO A;  1BU6 O;  4HWI A;  2V7Z A;  4Y0W A;  3VF4 A;  5C12 A;  2GX9 A;  3T69 A;  1P90 A;  3E9P A;  2I7P A;  5GIP A;  2V52 B;  1U2V B;  4CZI A;  2P9I B;  5JLH A;  5ADX A;  5BRD A;  1QQN A;  1RDU A;  3TTC A;  3M3Z A;  3VET A;  3WXK A;  3H1V X;  4H0P A;  3WQT A;  4A59 A;  3D7E O;  1Z05 A;  3O6W A;  3G4S N;  4FVU A;  2Q0U A;  3ZX0 A;  1T44 A;  3QFP A;  1YJW N;  2P9N A;  5EVZ A;  2F7T A;  1VQO N;  4WQ4 C;  4PKG A;  3SJH A;  5AQU A;  5AQX A;  4Z94 A;  2CGJ A;  3TTF A;  2WBN A;  4JHD B;  3EO3 A;  3CI5 A;  3O9R A;  5AQI A;  3CME N;  3AY9 A;  3D6R A;  3WXJ A;  4BRI A;  1HKG A;  1BO5 O;  3O1W A;  3MCA B;  4DCH A;  3WEE A;  4WCE L;  5AQL A;  4BRF A;  4BRD A;  4C1N K;  4JN4 A;  1K8K B;  2P9L B;  3BP8 A;  4MO5 A;  3I56 N;  1YUW A;  3VEY A;  3F2K A;  2IVO A;  3GBT A;  4JKA A;  3OBY A;  4EFH A;  1GLE G;  3CJ9 A;  3UKR B;  5M1F A;  4WFB L;  4RWT A;  5JVH L;  4OO1 J;  3D2F B;  3O80 A;  3ENB A;  4H5R A;  1NGC A;  4YDU C;  3AAQ A;  3DWL A;  4JKB A;  4XH4 A;  4CZJ A;  5KPT A;  4JK8 A;  3EL2 A;  3VPZ A;  3WXM B;  4BQZ A;  3FR0 A;  1VQ9 N;  1KD1 O;  5AQM A;  3MX5 A;  4ILJ A;  4JNE A;  4CZE A;  3HI0 A;  4AM6 A;  3CCR N;  1NGJ A;  2BH1 A;  2P9I A;  2Q97 A;  5BRE A;  5I9E B;  1ATS A;  1V4T A;  3ZET B;  3FZH A;  3PIP L;  2P9K A;  2HF4 A;  4AF1 A;  3G71 N;  1JJ2 M;  1BA1 A;  1ZBS A;  4FPA A;  3AAP A;  2W40 A;  4H5W A;  5C0Y A;  4B1Z A;  1T3V A;  3AAR A;  4JD2 B;  2FSK A;  1BA0 A;  2NNW A;  4BRL A;  3E9L A;  3W0L A;  3HOT A;  3CXC M;  3QFU A;  3TU5 A;  3HBT A;  1EQY A;  3QDK A;  4A62 A;  3R3L A;  3RSE B;  2YI1 A;  3LDN A;  2OTJ N;  3R9P A;  3CC7 N;  5B8H A;  4BR9 A;  3H3O B;  3M6G A;  1HJO A;  4HTL A;  4IOX A;  1WOQ A;  2P9L A;  4JEP A;  2CH5 A;  1YIT N;  2KHO A;  4K43 A;  2P9S B;  2AA4 A;  4JKG B;  5AQQ A;  3A8Y A;  3OA9 A;  4JKD A;  4M7X A;  2GEL A;  4MLE A;  3ZEU B;  4BRG A;  2HMP A;  3UKR A;  3VF6 A;  4BR7 A;  4WQ4 A;  4NLB A;  1RGI A;  2GEM A;  4FWQ A;  3R6M A;  4ISE A;  4JKH A;  4K25 A;  2VWB A;  1VQ6 N;  3CPW M;  3OW2 M;  3C7N B;  4IJN A;  3MDQ A;  1X3M A;  2E2P A;  1VQ4 N;  2A3Z A;  1HLU A;  1Q18 A;  3BUZ B;  4BC3 A;  1D4X A;  4A2B A;  5C10 A;  3VF2 A;  4QS8 A;  3ENH A;  3L0Q A;  4EAH D;  2J4R A;  2A42 A;  2YJE A;  3P31 A;  4BRP A;  4EHT A;  3M5R A;  1IG8 A;  4GV3 A;  3ZET A;  5LJV A;  2ZWH A;  4PKH A;  2FSJ A;  1TYQ B;  5FPD A;  2Q2R A;  4YOR A;  3UB5 A;  1HKB A;  3OHR A;  4BQL A;  1Q7Y O;  3WEE B;  3QBW A;  2HBK A;  1QZ5 A;  3CMA N;  3SBT A;  2WFB A;  1NGB A;  3CCU N;  4YDU A;  3QB0 A;  3CET A;  5BPN A;  5AR0 A;  4AM7 A;  5AQR A;  2E20 A;  1E4F T;  4GV6 A;  3RSE A;  1CZA N;  1SS6 A;  3BEX A;  4M7Y A;  4CZF A;  1NGA A;  3HOS A;  4CBU A;  1NWK A;  4GNI A;  3CHW A;  5M1N A;  4ILH A;  3VOV A;  2ZGY A;  1YAG A;  3CPE A;  4IEE A;  2CGK A;  1KQS M;  4IWV A;  4U67 L;  1GLA G;  4K42 A;  2P9S A;  2PFU A;  4JKG A;  3ZYY X;  3ZEU A;  1C0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...