1DTTA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-2 (pett130a94)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
543
structure length
540
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-CHAIN
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/transferase
total genus 126
structure length 540
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dttA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dttA05
3PW0A 4CHQA 2E6MA 3FQKA 3NH1A 4M45A 5L1KA 5L9XA 1Z4UA 1UA1A 2JEJA 4B8AB 3OYHA 3BQ1A 1SV5B 3PY8A 2IAJB 3L2VA 1QSLA 3OS0A 1HQEA 1S1XA 3JSMA 1NJYA 3NF8A 1HNVB 1WSHA 5HBMB 3DRRB 3ALYA 4BDPA 5KFUA 3V4IB 3B6PA 1CSJA 2DPJA 3NKYA 3QEWA 2FVRA 3OSPA 2R8HA 5HRNA 3DLRA 1KVCA 3T5LA 1BI4B 4KB0A 3VQ7A 3PX6A 3SQ0A 4AHRA 2G8VA 4PUOB 4E89A 3C6TB 2HMIB 4DTJA 2HHXA 1TL1A 4R5PA 3ZSYA 5J2PA 1T7PA 4C8OA 4H8KA 4IR9A 1KFSA 1C1CA 2RPIA 5KI6A 5I3UB 4M95A 5KRSA 4H4MB 3QGGA 4CEFA 4I9LA 4LSNB 4CESA 3VQ4A 4E1MA 1I6JA 4XPEA 3H59A 1TV6B 1D8YA 2OH2A 4Y2AA 3OYKA 1L3UA 4I2PB 4ZTFA 4M3RA 1FKPB 5KGWA 3KJVB 4DG1B 3Q8RB 3AVIA 4CHZA 2AGOA 1TKZA 5EUHA 4Q43A 1QAIA 1C0TB 4O3SA 5KGXA 2B5JB 4JS5A 3A2FA 2HNYB 4CJ5A 4J9NA 2DY4A 1WN7A 1EETA 2HNZA 3N6LA 3L8BA 2FVSA 1S1WA 3U3YA 4HKQA 2YNHB 4TXSA 3SPYA 3GQCA 2OZSA 3V6DB 4AH9A 3B6OA 5DK5A 1B9FA 3P5JA 3TABA 3OSNA 3N6NA 1XWLA 2OPPB 1RTDA 3DRSB 4ECRA 3RB6A 4TY8B 4ZPBA 4ZPDA 3GIKA 2EHGA 3I5BA 3PHEA 4N47A 4OLAA 3KKRA 4U7CA 3V1QA 1FK9B 2OPQA 4CFCA 1QS4A 2UVRA 5EDWA 1ASVA 4G1QB 4FM2A 1RT7B 2AX0A 4GC7A 1QE1A 4E1NA 1N6QA 4FLXA 1VRTB 3TQ1A 2AJQA 4B9VA 1RCHA 5D3GA 3K58A 3H40A 2E6LA 4ECXA 5J2MB 4KBIA 4OJRA 2CKWA 3MAQA 4WYLA 1Z26A 4JLHA 1RNHA 1WSJA 3OYLA 3OJSA 3WNGA 4CJWA 4IG0A 4HHTA 2PZSA 4DQRA 3LP0B 4N76A 3MTKA 3HVRA 3TAMA 1HPZB 1SH3A 4JV2A 5CY4A 2W7PA 4FJLA 2VG6B 4JUZA 3WNEA 3TWHA 2C22A 5C24B 4ZP6A 1O1WA 1RTIB 4Z4FA 1RYSA 1SUQB 4RUAA 2KTQA 2G8FA 3H5XA 3DMJA 4XO0A 2D3UA 4QOZB 1JLFB 3PR4A 4CEBA 2JEGA 2BQ3A 4CGHA 3AVNA 3IG1B 4TN2A 2XCPA 3KLHA 1RBUA 1S48A 3ASMA 3VQEA 3AA2A 3HYFA 4RW9A 1IKWB 4CGJA 2HVIA 2BE2A 1WSEA 1TK0A 4EZ6A 3DLBA 4MFBA 2KFZA 4O4GA 2O4IA 4KI6A 1NKCA 2PY5A 4W5NA 1S1VA 1T03A 3SJJA 4FJJA 4O0IA 3OYEA 1HQEB 1S1XB 3HPGA 3JSMB 1K1SA 4WYWA 1JL2A 1NKBA 3T5HA 1LAVA 1I3AA 3HVTA 2IJFA 4FJ9A 1NHUA 1BL3A 4GMJB 2AQ4A 3GIJA 1NK9A 4ED2A 3IRXA 4DL2A 3F9KA 1LWEA 4ED8A 4XPCA 4EP5A 3HP9A 5FRMA 4R5PB 5J2PB 3MECA 1JLBA 4KRFA 1OS5A 2R2TA 1KHWA 4FJHA 2KQ2A 3KK3A 1S10A 4J2BA 3BGRB 4CIFA 3RR7A 2IM0A 1TAQA 3VQPA 3GV8B 3KLFA 3NGIA 3OYMA 3VQQA 3OY9A 3H08A 4DQSA 3NAHA 1TKDA 4O5BA 1EP4A 1TKZB 3V6HA 1JL1A 2GBZA 4DSJA 1RT1B 4FZXC 1LWCA 3HSTB 4B9NA 3LP1A 1S1TA 2D0BA 2YKMB 3AO5A 4CCHA 1HYVA 1YVUA 1EETB 2BQRA 1BISA 3T5JA 4FW1A 5KG0A 3ICLA 4BWMA 5KG7A 1FXXA 1S1WB 3LANA 3KLGB 2GV9A 3MFHA 4RNNA 4NYFA 5C42A 3H5YA 4Y1CA 4KO0A 3NE6A 4ECZA 3MR5A 3CFOA 1RTDB 4E7KA 3AVMA 1QTMA 2Z1IA 4DQQA 4YQWA 2BQUA 1L3TA 5KFAA 3QETA 3ZSVA 5T7BA 2W9CA 4F2RA 4DTXA 4CF2A 3RRGA 2ZKUA 2A1RA 4F4ZA 1KFDA 3IN5A 3SQ1A 1NK0A 1J5OA 3WNFA 2OPQB 2HHWA 4CJEA 4JV1A 5F8GA 1HMVA 1XHZA 3ZSOA 1WSGA 4B9TA 4Z4EA 1QE1B 3M8PA 3SUNA 5D3GB 2HHVA 2IGIA 1BIZA 4J9KA 4KHNA 1S0NA 1A5VA 1HQUA 3H5UA 4CHPA 3LWLA 3QEIA 3TAFA 4DFKA 4CJFA 4IRDA 4K50A 1C1AA 4IG0B 3QIPA 4QWCA 4DL3A 4FW2A 1NK8A 1ZTWA 4KHRA 3BSNA 2JGUA 3IGVA 4KE5A 3LDSA 4ELVA 2XY7A 1GX5A 4EP4A 3HM9A 1JKHB 3KLEA 3VA0A 4IKAA 3FFIA 3CFPA 2J6UA 2LSNA 2GC8A 4HVJA 4IQXA 3ZSZA 3DMJB 3Q8PB 1S9GA 3O3HA 1ZBUA 3QNNA 5KT7A 4CJUA 2EC0A 2ZD1A 4Z4HA 1R0AA 3NGYA 4TYBA 4FBUA 5EWFA 1HJRA 3ZT0A 3KLHB 3OYCA 4B8CA 2WOMA 4GC6A 2ATLA 5DLFA 3OL9A 4BACA 4EBCA 4RW9B 4F4YA 1IG9A 1TP7A 2VA2A 5E41A 3LWMA 3PO5A 4RW8A 4JRQA 4DF4A 4MFBB 1RT5A 3V6KA 4BWJA 4ID1A 4KTWA 1S1VB 3KNAA 4Y1DA 3H5SA 2R8KA 3BR9A 3OYIA 3DYAA 2WRMA 1Z25A 2ASDA 3DOKA 4W5RA 1LAWA 4O4RA 2DFFA 3DI6A 4BE1A 5DQHA 2ILYA 3ITHA 3PZPA 4CJPA 3NH2A 3BDPA 1TVRA 3IRXB 4KTZA 5FDLA 1XR6A 2YHBA 1LWEB 1WLJA 3VA3A 4R8UA 3NF7A 4E0DA 4YR0A 1JLBB 2RF2A 3KK3B 5KFIA 1TK8A 4DFJA 3HL8A 3AVBA 5EWGA 3CO9A 4CIEA 1U09A 1LWFA 3RBEA 1U49A 1X1PA 4O44A 3KLFB 3RB0A 3MEGA 1KLMA 2RKIA 4IOBA 2VWJA 5F8HA 3O4QA 3AO1A 2V0NA 1XI1A 4KB7A 4FXDA 1VRUA 4CEZA 4QCLA 4ELTA 1EP4B 1Q9XA 2X6NA 1GX6A 1TGOA 3CWJA 2ALZA 3CJ3A 1LWCB 3LP1B 1IKVA 2D7SA 3LAMA 2VG7A 1MU2A 2JLEA 4CF9A 4URSA 4FVMA 4FK2A 4FK0A 1VSFA 2UUWA 2C2RA 2Z1GA 3L2QA 4MK9A 4MKBA 1N48A 4YR3A 4MKAA 4Y34A 3SI8A 3BSOA 4B9MA 5DGBA 3V6JA 3LP2A 3RMAA 4ZHRA 4E7IA 1RYRA 4CF8A 5C42B 2OPSA 3AVJA 3QEVA 2IS3A 4KO0B 4KKOA 2FJVA 2UVWA 2YNFB 5J1EA 1N56A 4J9OA 4B9UA 4MH8A 5DG8A 2P5OA 3BQ2A 3K5LA 3U3GA 2W9CB 4KHSA 4IH5A 2XY6A 1JXBA 3TARA 1J5OB 4OGCA 4ECUA 4DF8A 1XHXA 4IBNA 3H2LA 4WFYA 2AGQA 1HMVB 5KT5A 4ECYA 4CFBA 2G8WA 1D1UA 2BANB 3PVXA 3M8PB 4B3OA 3SFGA 4Q8FA 1EKEA 5KFRA 3VQSA 4HCBA 3QIOA 3AO4A 1U4BA 4WXOA 4JV0A 5HROB 5HP1A 3OYAA 3BREA 1DLOA 4URGA 4X2BA 1JLEB 3EZUA 1C0MA 4J2DA 2FC0A 2ZQBA 4NLTA 4WFXA 4I7FA 4O3PA 2WB4A 3AVCA 2ZE2A 4WFZA 2X78A 1IKYA 3KLEB 1JLAA 3FFIB 3DM2A 4BDYA 1JXEA 2VG5A 1WNEA 1U45A 3V9XA 2HWHA 2I1RA 4E7HA 1C0UA 1BQMB 3MEDA 4NLUA 4IG3B 4CHYA 4OKKA 5KFZA 4F4KA 3ZT3A 2ZD1B 2AWZA 2J6SA 4RG8A 1R0AB 2HHUA 2E9RX 1D5AA 3SI6A 3DLHA 4DTRA 3CG7A 2E9ZA 4KTQA 4TQRA 3SV3A 4CF0A 4RW8B 5F8IA 2YKNA 1RT5B 3LALA 5J2QA 4KHQA 3OL8A 4MK8A 4DLGA 4E19A 4YP3A 2IDOA 3E01A 5KG6A 1NOYA 3DYAB 5JS2A 4IFYA 5DGAA 3AO3A 4IH6A 2IOCA 3DOKB 4CEQA 3VQAA 3ZSXA 3DI6B 3DRPA 3V9ZA 1RT3A 4M94A 1RT6A 3I0RA 3ITHB 4M41A 4FJGA 3PW2A 2HAIA 3K59A 3RB4A 1RT4A 4OLBA 3C95A 5FDLB 4FLZA 4R8UB 3QEPA 3O3GA 2E4LA 3RMDA 4O3OA 2RF2B 5DLGA 4J9LA 4DTMA 5KTQA 2W7OA 3IS9A 4J9SA 1RTJB 2V4RA 4K4ZA 2P51A 1LWFB 4O44B 5C25B 3T5KA 1CXQA 3HHKA 1KLMB 2RKIB 5KG3A 5DMRA 3SUQA 4EYIB 3KLIA 4BDZA 1Q9YA 4H4OA 1VRUB 1UA0A 4DSIA 4Q8EA 4J9QA 4PA1A 1VK0A 4FLWA 5CZ1A 2FBTA 1XR7A 3M9MB 3AVAA 5DG9A 3CM5A 3CDEA 1IO2A 2VG7B 5KFWA 1MU2B 3IAYA 3CQ8A 4I9QA 4IFVA 3M9OB 4CEEA 2VWKA 4AHSA 1RBSA 1NNDA 1RDBA 4EO8A 3QESA 1RBRA 1YVFA 2W8LA 5JS1A 3LP2B 2W9AA 3VQ5A 3QNOA 4ZHRB 4QWAA 1X9MA 3GILA 1SL0A 2OPSB 4QWBA 1S6PA 4QW8A 4OKJA 4KKOB 4ZPCA 4ID5A 5J1EB 4ZVGA 5KFTA 1X9WA 4K4UA 2F96A 3CIZA 3CJ0A 2HW3A 3DLGA 1RDCA 4QPXA 3PJWA 4CEOA 2RN2A 1U04A 1SKWA 3AA3A 5KT6A 3TR8A 3O3FA 2Y1IA 4FZYA 3KTQA 4NLRA 1I39A 4B3OB 3GV7B 4FJ8A 3AVGA 4KB1A 3OHAA 1LW2A 3M8QA 3ZT1A 2HVHA 4RNFA 4ELUA 4YR2A 3AVFA 3VN5A 3FSIA 4LY7A 5F8JA 4CJ3A 3ISNC 1EX4A 3RMCA 4EEYA 5KFMA 1DLOB 3V1OA 3S9HA 4O55A 4J9RA 1CXUA 4CJLA 3M8SA 2B43A 3NF9A 3TVKA 2ZE2B 3HXMA 1ZBFA 2GUIA 5L1JA 1TL1B 3AVKA 4ED7A 1Q8IA 1JLAB 4DSFA 3RAQA 3DM2B 4W5QA 1C1CB 1L5UA 3HKWA 1C0UB 4Z4CA 3MEDB 2XGQA 4DWIA 3E51A 4M42A 4NYZA 3CYMA 3OL7A 5K14A 3CDUA 3DOLA 2PYLA 1QQCA 3FRZA 4E3SA 3OL6A 1SL2A 3G10A 5EWEA 1S49A 2D3ZA 1BHLA 4QWEA 4KAZA 1RA7A 2G8UA 4ZP8A 3LZIA 3MR2A 4CF1A 5J2NA 4M3YA 3RBDA 5CZ2A 2YKNB 1S0OA 4F8RA 4W5OA 3I5AA 1YTUA 1RT2A 3KD1E 4FS2A 1TL3A 3NH0A 1REVA 1BQNA 3MF5A 1WSFA 4W5TA 2HNZB 2OPRA 3NCIA 3E01B 2DFHA 1KVAA 4IFYB 3L2WA 4TY9A 3AVHA 1TKTA 1QSYA 2ILZA 3DRPB 1KLNA 1RT3B 3ZT2A 1RT6B 3I0RB 1S1UA 2XHBA 1RT4B 1RTHA 5HRPA 1NKEA 2R7YA 2IC3A 4BE2A 2DTUA 3SFUA 4NZ0A 2YHAA 3ULDA 4F50A 3MXJA 3GIIA 4ECTA 3IS9B 2R8IA 4NLWA 3PUFA 3KK1A 3U6FA 3ISND 1RBVA 5HRSA 2FVQA 5F9NA 3AVLA 3PR5B 1CZBA 3I5CA 3RTVA 3V81A 2V9WA 4DU3A 1TKXA 3UPFA 3KLIB 1N6QB 3LP3A 1S6QA 3QGHA 4H4OB 1TAUA 4BE0A 3N6MA 1BCOA 5KFLA 3OS2A 2YNIA 2QKKA 4Q45A 5F8MA 3KIOA 3M9NB 4IDKA 3RAXA 3WNHA 2EX3A 4NLGA 4NLYA 4KV8A 3NHGA 1D9DA 4IFVB 3PW7A 3TAMB 4N56A 3SQ4A 1HNVA 1NHVA 3DRRA 3V4IA 4J9MA 4ED3A 4EBDA 4NYNA 3CVKA 4KFBA 3JYTA 3NBPA 1S6PB 2ATQA 2B6AA 1W0HA 1B92A 4ID5B 4PUOA 4ECVA 2R8GA 1ZBHA 2QK9A 3V1RA 4LD0A 2Q3SA 1LV5A 2HWIA 1KCFA 3DLGB 4ZVHA 2HHSA 5C5JA 3CJ4A 2J6TA 1FKOA 2JEFA 3HPHA 4HUGA 4H4MA 4R0EA 4LSNA 2BE2B 5KFBA 2OYQA 1QUVA 4RNOA 4O4GB 3AO2A 4NLVA 3ZSWA 2FVPA 4WZMA 1IH7A 1NK5A 3FQLA 4FCYA 1UOCA 1T03B 1LW2B 4DMNA 3M8QB 4ED0A 5KFSA 1SH0A 2I5JA 3P83D 3MXMA 4KHUA 1RDDA 2HNDA 3MEEA 1C0TA 3HVTB 1VSJA 4F2SA 1JLGA 3G6XA 1BCMA 3DLKA 3LPUA 2IM1A 2G8HA 3UQSA 5JUMA 3BJYA 1W25A 4DTNA 2HNYA 4IKFA 5HLFA 2F8EX 4K4TA 3KHHA 2HHQA 2IM2A 4KREA 3PO4A 4AILC 3MECB 3TI0A 4ZMMA 1IKXA 1JLQA 3EPIA 4M3UA 4Y2CA 4HUEA 1NOZA 3V6DA 2JC1A 3PW4A 1NK6A 1F21A 4M3ZA 3MXIA 4Q0BA 1DTTA 1GOBA 5K14B 3GIMA 3DOLB 4RW4A 3VQ9A 4FJIA 3ZCMA 5KFXA 3KMQA 2X74A 1NJZA 1WAJA 2O5DA 2GIQA 1VSEA 1T05A 1VSDA 2IMWP 4FJKA 4WE1A 5J2NB 4URQU 2QV6A 4NLSA 2BRKA 4CGFA 1RT2B 5CYMA 2XY5A 1S1TB 4RW7A 3OLBA 5FRNA 1RT7A 1TL3B 1REVB 1BQNB 4CFAA 4LH4A 2AU0A 4FLYA 4DL4A 2OPRB 1C1BA 4DS5A 5KFVA 5J2MA 4HTUA 2FLPA 4DEZA 3VQ6A 3S3OA 1T8EA 2KFNA 3OYGA 3LP0A 1S1UB 4CE9A 1RTHB 1VSKA 2F8SA 2C2DA 3ZSQA 5DQGA 4RNHA 2D41A 2NUBA 2WTFA 4CK1A 2XC9A 1RTIA 1WAFA 4K4VA 4J2EA 4DSEA 3KK1B 4IR1A 2WONA 4C8NA 2UVVA 4AHUA 3PJXA 1QAJA 1KHVA 3KHGA 4CJSA 3HP6A 3KHRA 1TKXB 4NLPA 3EY1A 4NCBA 3IG1A 4M3WA 1S6QB 4Z4GA 4E7JA 2XWYA 4NCAA 2R2UA 3D45A 3TAGA 1Y97A 5KT3A 2BDPA 3QO9A 1HQUB 1IKWA 2C28A 2YNIB 4DFPA 3S3NA 2FJWA 5KG2A 4IDKB 3QIPB 1JX4A 4KV8B 4PWDA 1QHTA 1JXLA 3KD5E 4DTPA 1C6VA 4DL7A 2R2SA 4PY5A 5KRTA 3OYNA 5KFYA 4PQUA 3SUOA 4FLVA 3HVWA 4CGGA 4Y3CA 2RDIA 4KFBB 3JYTB 3NBPB 4AHVA 1S9GB 2B6AB 2RDJA 4DSKA 4Q5VA 4C8LA 3G0ZA 4FYDA 5I42A 5CYQA 3OVNA 2YNGA 4FJXA 4K8ZA 1NK4A 3NDKA 3IGNA 1ITGA 1FKOB 1UAXA 3KKSA 2WOMB 4O0JA 1CLQA 1VSMA 3HT3A 2OA8A 4CGDA 3FDSA 4RUCA 2FBVA 3BGRA 2G8KA 5EU7A 4GVMA 4IRKA 3H4DA 2R2RA 2W9BA 3NL0A 3VQCA 3AA4A 3HVAA 1NJXA 3OYJA 1A5XA 4F4WA 4CECA 2XCAA 1B9DA 2D0CA 2I5JB 2HNDB 1RT1A 3MEEB 3OYFA 2O4GA 4LH5A 3G6YA 1JLGB 1S9EA 5KFJA 3DLKB 3QINA 2YKMA 2JC0A 3ZT4A 4ZVEA 2FBYA 5HLFB 4CJ4A 4NLOA 3QERA 1XR5A 1TVRB 4AHTA 2XO7A 4LSLA 2E9TA 4AHCA 1IKXB 1JLQB 4CHOA 1YT3A 4G3IA 5JXSA 3KLGA 2XI2A 2XGPA 1TK5A 3O4NA 3KK2A 4DL6A 4Q0BB 1DTTB 4IRCA 1VSIA 3MEGB 4RW4B 2FBXA 3K57A 4ED6A 4UQGA 4CJVA 1N5YA 3MR3A 2VA3A 3OYDA 4KHYA 2IJNA 4DTSA 1XC9A 4O3NA 1T05B 2WK4A 4WE1B 1NJWA 1GOAA 1S4FA 1SL1A 3T19A 5CYMB 1IKVB 3SQ2A 4RW7B 1U47A 1VSHA 1GOCA 3OLAA 3THVA 4MK7A 5L1LA 1C1BB 2X6SA 3D28A 3Q8SB 3RMBA 3C94A 4E7LA 1S5JA 4FJ7A 1KSPA 2QE5A 3PV8A 2DPIA 4ZTJA 1UWBA 2GIRA 4ECQA 4F3TA 4LQ9A 3HK2A 3QEXA 1DTQA 2CJQA 5F8LA 1CZ9A 4RW6A 1S9FA 4ECWA 4B9SA 1JKHA 5T14A 3QLHA 1KVBA 2Z1HA 2IA6A 4DQIA 2BR0A 4Z4IA 4NLQA 2WONB 5KFDA 4DSLA 4I2QA 3I0SA 3Q8QB 3NFAA 3CJ2A 3UDLA 1WNSA 4KHWA 3QO9B 1BIUA 4NRUA 4RU9A 5KFFA 4DTOA 5HP1B 4GW6A 3BSAA 1J54A 1HYSA 4U6PA 5FROA 4PWDB 4OPJA 4I7FB 2IM3A 3RB3A 1G15A 4YNQA 2YV0X 2KZMA 3C6UA 3F73A 3SZ2A 1W9HA 4OPKA 2ETJA 1S0MA 2BGGA 4L8RB 1IKYB 3ZSRA 4MIBA 5F8NA 4PQUB 4YMEA 2VG5B 1HRHA 3HPOA 1QSSA 4QWDA 4CK3A 3SNNA 5KFEA 4CHNA 5SWMA 5I42B 5CYQB 1RILA 2YNGB 4FLUA 3G86A 4NRTA 3QGIA 1HNIA 1D9FA 1WSIA 3D5MA 3EPGA 2DFEA 4CFDA 5KFKA 2OZMA 4LQ3A 4DS4A 3LZJA 4KI4A 2F8TA 4CK2A 1YTAA 4F3OA 4N41A 4WZQA 2ASLA 2A1SA 4M3TA 4QW9A 4DFMA 3DLEA 4B08A 2W9BB 5J2QB 1ZBIA 4YFUA 1U48A 4WXWA 3CFRA 4ZP7A 4FLTA 1KTQA 3CJ5A 3NMAA 1RAJA 2W42A 4K8XA 5KFCA 1ASUA 1S9EB 3NF6A 1X9SA 4FJNA 4M3XA 1JLCA 4NLXA 5KG5A 4J2AA 3VQDA 3L3VA 4K4YA 3K2PA 4FK4A 2R8JA 2AX1A 3V9WA 4LSLB 3H98A 4IH7A 5KFNA 3T3FA 3BSCA 1SKRA 1RA6A 1RDAA 1RBTA 4ZPAA 4CJQA 3VQ8A 3OHBA 2ASJA 1LW0A 4TQSA 4FM1A 3HJFA 3PW5A 4NCGA 3KK2B 3K5MA 4KPYA 3P1GA 2YNFA 4ICLA 4FJ5A 1J9AA 1KRPA 4DTUA 2D0AA 3SV4A 1N5YB 3L2RA 1NK7A 1RDRA 3MFIA 3TANA 4H54A 4KHMA 3AV9A 2XY8A 4FM0A 5DG7A 3UR0A 4TYAA 4OKEA 4JRPA 4ECSA 3K5OA 3GV5B 2BANA 4EYHB 2IBKA 3K5NA 1SV5A 3V9SA 2IAJA 4HUFA 1VSLA 1A5WA 5HRRA 5HBMA 4K4WA 3TAPA 1JIHA 3D0PA 5F9LA 2Y1JA 4KSEB 2UUTA 2FJXA 5HROA 2AGPA 3QZ7A 1UWBB 4TLRA 3NAEA 1BI4A 1JLEA 4DU4A 2Z1JA 1DTQB 3AA5X 1S97A 4DQPA 1D0EA 2FLLA 4K4SA 4RW6B 1J53A 3RRHA 3C6TA 3S3MA 4QAGA 2HMIA 2W8KA 4DLEA 3QLHB 4O3RA 4K4XA 1IM4A 3CM6A 1MMLA 4TSXA 5I3UA 1L3SA 1T3NA 2HHTA 4DL5A 1BQMA 4I2QB 5KT2A 3I0SB 4IG3A 4RNMA 4EO6A 3RWUA 5L1IA 3NAIA 1TV6A 3LAKA 2B4JA 2G8IA 5KG1A 2WHOA 4I2PA 3PX4A 1FKPA 4XIUA 3UIQA 3KJVA 4DG1A 4CEDA 4CJRA 5KT4A 4Z0UA 3M8RA 3TAEA 1K1QA 1HARA 4CERA 5KFQA 4CGIA 3G6VA 4JS4A 2B5JA 3NGZA 3EZ5A 5KG4A 1HYSB 4CJKA 4FS1A 3BQ0A 4EBEA 2KZZA 1BGXT 3V9UA 4KAIA 3C6UB 1ZYQA 4C8MA 4FZZA 2JEIA 3I8DA 3SUPA 4C8KA 1ZBLA 2FLNA 2YNHA 4OVLA 4O3QA 4EZ9A 2V4QA 2QXFA 3SCXA 3TAQA 3T1AA 4CEAA 3HO1A 3KLVA 4B9LA 3QIDA 4MQ3A 2OPPA 5KFGA 4NLDA 3DRSA 4FJMA 4TY8A 1HNIB 5DQIA 3SYZA 3RR8A 3KHLA 4HCCA 2D5RA 3QYYA 4F4XA 3KMSA 1RTJA 3CDWA 5KFOA 1FK9A 5KFPA 4MIAA 3OS1A 1L3VA 1SKSA 1C2PA 3H4BA 4G1QA 5C25A 3DLEB 5SZTA 2P1JA 1ZETA 4OGEA 5KFHA 1VRTA 1HYZA 2ITGA 3LPTA 1T94A 2P5GA 4ZP9A 2FVCA 1N4LA 1ZTTA 4RZRA 3QZ8A 1TKTB 3EYZA 3L2UA 3DDKA 4DU1A 3SPZA 1JLCB 3OJUA 1ASWA 3VQBA 4OL8A 3OYBA 1HPZA 2QKBA 4N5SA 4FBTA 2IC3B 2KW4A 1TQLA 4HYKA 2VG6A 2BRLA 3PX0A 3NGDA 1SH2A 3MR6A 5C24A 2WCXA 4J9PA 1LW0B 3L3UA 1SUQA 4NCGB 4ED1A 1EXQA 4ICLB 2HB5A 3KOAA 4CJTA 1JLFA 4ZVFA 2PYJA 2XI3A 1K6YA 2C2EA 4Q44A 3V81B 2UVUA 4CIGA 2XRIA 3GYNA
chains in the Genus database with same CATH superfamily
3PW0A 4U8YA 4DQ8A 1RAAB 2ROPA 1P27B 3E1YA 4RLEA 4DV2F 5AQVA 2MKHA 4IOAL 3S1TA 5L9XA 2G0JA 3PG9A 3OR2B 3OYHA 1QVGR 1RHJB 4F26A 2HSTA 3SMSA 4N8OA 4IOCL 2M8HA 1HNVB 1WSHA 2WVBA 2MY8A 2F9TA 2DGXA 2W41A 3OSPA 2R8HA 2QMUB 3DLRA 2DR6A 5E33A 3T5LA 4CLUA 4AHRA 1VK3A 2G8VA 2E2QA 1RWKB 4A59A 1SIZA 3ZSYA 3ZZ0A 1FDNA 3M2VA 1V6HA 4A46A 1GLAG 3OTBA 3BKUA 5BREA 1FVSA 1TU0B 1SC1B 2RPIA 5I3UB 3QSIA 4CEFA 3GFXA 4I9LA 1VC0A 2EFVA 5AZJA 1AW0A 2W2QP 1LNQA 4USWA 3PJ9A 3EGZA 5KGWA 1BMQB 3MCNA 3AVIA 1OJ4A 4CHZA 2AGOA 1TKZA 1RGVA 4ZLJA 1QAIA 5D4NA 1VQLN 2P9EA 2B4OA 4OZ0A 2HEKA 4USJC 2FY1A 3OTCA 2F3JA 2C3YA 2WBRA 3N6LA 4NO7A 1FTCA 3K9KA 1BXNA 1S1WA 4ZCIA 3SPYA 1YVNA 1FRKA 1S7IA 3GQCA 1RWMB 4PKGA 4AH9A 2NPFA 3B6OA 1CVJA 3P5JA 4YDXA 3CULA 4CJ7A 1XWLA 3EE9A 4NYPA 1RTDA 3D6TB 2HURA 2X3DA 2PD1A 3PHEA 3CD5A 3JSRA 4ANCA 4U7CA 3V1QA 4CFCA 1X60A 2MY7A 1SJ3P 5LMUJ 3NY0A 4IUFA 4LRDA 4JI0J 1KC8O 3A5OC 2MJUA 1K8KA 4TLQA 1MSWD 2VH7A 1VRTB 1TMJA 3TQ1A 5AQXA 3H40A 4FWOA 1MMNA 2V8PA 2CKWA 1MROA 2QMWA 3UDEA 2PBDA 3DXBA 1RNHA 3I32A 1WSJA 3OYLA 4I0WA 1CBKA 2ZM6K 1KBRA 3WNGA 3RZAA 3WBZA 2PZSA 4CZLA 4OJHA 1BY9A 2V2QA 3MTKA 3HVRA 3TAMA 2EVZA 3D6RA 4F3QA 5CY4A 4DCHA 4C6AA 3SIPB 2VG6B 2YXLA 3TWHA 2C22A 2B9XA 5C24B 2DKOB 4CZCA 1VJWA 1RTIB 1CLFA 5EX5A 3TJ8A 1LWXA 2G8FA 3H5XA 1TYQB 3MK6A 1YRUA 1WBBA 3PR4A 2DYAA 4JKDA 2BQ3A 4CGHA 5E0OA 3B82A 5AQWA 5BYRA 1S48A 5HJXA 2DGWA 3VQEA 1TR0A 4UF4A 4P2XA 4RW9A 4C11B 2A2DA 4EZ6A 4LIWA 2KFZA 1UJ6A 1U1MA 2XS2A 4YHHF 4W5NA 2QYGA 3OYEA 1HQEB 2L48A 1NKBA 4QYZK 3T5HA 2IJFA 1JWWA 1OYDA 1HQ2A 1MDUB 4HWIA 4FPIA 2M8DB 2K2PA 2WW8A 4RX6A 4ED2A 1GEHA 3IRXA 4CLKA 4DL2A 1YJ9N 1YJUA 1UPPA 1NG9A 4EP5A 1TMMA 4YN3B 3DOMB 3HP9A 5J2PB 3MMBB 4MAKA 3KK3A 3VEXA 2ZFHA 1S10A 2Q36A 5A2QY 3BGRB 3TR5A 4PL7A 2BEFA 3GV8B 4M5GA 3C15B 3D1QA 3GFYA 3EZWA 5L39A 3OYMA 3OY9A 4UUWA 1IN0A 3U4LA 2I9SA 4DQSA 3VGLA 2PA3A 3SSRA 2DGSA 2V8HA 4OV6A 1JL1A 4DSJA 2LDYA 3A8YA 4FZXC 3HSTB 3AAQA 1S1TA 1GMWD 2YKMB 5H9FK 1U6ZA 1U2FA 1GMWA 2BQRA 4ISGA 4FW1A 1K44A 3C65A 1YSJA 4M5NA 2HGMA 1VBKA 1XNQJ 2VQEK 3CJKB 4M8LA 4AQYF 1R31A 4NYFA 3THYB 4LFAF 2ZBPA 3NE6A 3MDFA 4A8YA 3CFOA 2ZHAA 1H7XA 4MT1A 4WQ5C 1PBAA 1GTHA 2MMYA 2NLXA 4DTXA 3FBEA 4CF2A 2ZKUA 4H4KA 3O9RA 4F4ZA 1KFDA 2B9YA 1WG5A 2VC1A 3GIRA 2YKQA 3ZSOA 1U1OA 5K5MA 1QQMA 1QE1B 4M7XA 2BJ7A 1QZ5A 3B54A 4J9KA 4KHNA 2VOOA 1R89A 1S0NA 1D9AA 1IBMF 2GS8A 1R27B 4FYVB 3MD3A 5ETNA 2Y0SD 3SEOA 2CJAA 2EFGA 1C1AA 4FW2A 1RDUA 3C14A 4FWSA 5T7LA 1E6YA 3POTA 4KE5A 4FWRA 1JB0C 3VALA 2YTCA 1UFWA 3BGLA 1SJFA 1I94J 2L9NA 5C10A 3HM9A 3VA0A 2DGQA 3ETMA 4L75A 4JI3F 3HF5A 4OZLA 1ITPA 4IQXA 4CVNE 2D0PA 4OZ3A 4CBXA 3F41A 2CPZA 3TJ9A 2QWRA 3N28A 3QNNA 4ZPWR 1VQOS 1YGYA 5EWFA 1F5BA 1HJRA 3KLHB 4ILGB 3MM8B 2WOMA 1Y0HA 4F4YA 1IG9A 1TP7A 2VA2A 3LWMA 4OX7A 2HIYA 1RT5A 4P2FA 3T1HK 3NGSA 3QICA 3W2VB 1U1NA 3N0VA 3OYIA 2ZZNA 3K2YA 3VF2A 3R6LB 2JFDA 3OUYA 2FHOB 1SB6A 2Y1RI 1X8DA 3FCHA 3B8HA 3FK4A 4F0KA 4BE1A 4GMKA 2GJ2A 4RWXA 3CI5A 3ZZUA 2ILYA 3D2FB 2UUBK 2HHHJ 2I7NA 4KTZA 4QIVA 5FDLA 3EGNA 2YHBA 1WLJA 3F5TA 2H65B 3OR1B 3CCSN 1JLBB 2WZ1A 1T95A 4X62F 1F60B 5KFIA 4DFJA 3HL8A 2AEFA 3UCUP 2MKYA 3G2XA 3L6QA 3ZETB 1FNMA 2DXEA 4C7QA 3RBEA 1BWEA 1OO0B 1X1PA 4CLPA 3X3UA 3FJ2A 2LQ8A 3MEGA 1F9EB 1EHWA 4FXDA 5BR9A 1E3MA 3ENQA 1SI9A 4QCLA 2MQNA 4TKTA 4ELTA 2QWOA 3V5RA 1EP4B 2ZH8A 5MAOA 3SAFA 2ALZA 3CC2N 5HVFA 2W2MP 5A6PA 2G1HA 4ZLLA 4RBVA 4J7CA 2CDRB 2IA0A 1MU2A 1NSKL 4F0MA 4YOTA 3TSPA 4URSA 4MK9A 1P6TA 1N48A 2V5HG 3CPWR 4GKKJ 2QGFB 1AROP 4DUZJ 3V6JA 2A6AA 3LP2A 4GV6A 3D2EB 1W2IA 4YY3F 4OI2A 3QEVA 4KKOA 2GGPA 1WG4A 3R9LA 2CIMA 4FO0A 2EK6A 2ZJQQ 3BQ2A 5C2DA 2NYHA 2W9CB 3HHLD 2Q66A 3I56S 4FYWB 2QRRA 4DR2J 1DARA 2HFNA 3U02A 2E8AA 5AR0A 3HHLA 2MGZB 4XH4A 1HMVB 1JNZB 5KT5A 3B78A 2AT1B 4B3OA 1Z1ZA 2UXDF 1EKEA 1WG1A 5KFRA 2QZ8A 3TPQA 4JI4J 2ZJQL 3GPAA 3QBXA 1S72S 4WXOA 5HROB 4BC3A 1M5HA 4CH0S 3DXKB 3CXCM 4JI8J 1C0MA 4J2DA 1RWXB 4O3PA 4P6QA 5F3TA 1S57A 3KLEB 1JLAA 3FFIB 4BDYA 1HJOA 3WXLA 1WNEA 2DH9A 4DV0K 2RRBA 2HWHA 4U7UD 2I1RA 4X4NA 1C0UA 1HIYA 3X1LB 3BM7A 4KH4A 2MZQA 4RG8A 1H2TZ 2QL7B 5A0YB 2C2ZB 1TUUA 4LF7F 1D5AA 5EN1A 1E6VB 3CG7A 4JI7J 2HMPA 5HVGA 4X4OA 1QM9A 2NRTA 1XUPO 2NLWA 1ICEB 2FJDB 2KM8B 4KHQA 4A2AA 4DLGA 4I4BA 4YP3A 2DNKA 3UD5A 1NOYA 2JX2A 3DYAB 2AV5A 4IFYA 4J37A 5DGAA 3AO3A 3P31A 4IH6A 1URRA 4CEQA 4OX9J 2VBWA 2NCKL 4M94A 1YHQS 3QFHA 2CPJA 3K59A 2F7VA 3C95A 2M70A 4FLZA 4DV4F 2DNPA 4R8UB 4CLTA 3QEPA 3O3GA 3RMDA 3D6FB 4O3OA 5FJ4A 2RF2B 4GVEA 4DTMA 2W7OA 3IS9A 3BB5A 1X9JA 1RTJB 2V4RA 1KS2A 3IAM9 1HWKA 1Q95G 3EX7B 2VFRA 5ELZA 1CXQA 3HKZD 3KLIA 3FE1A 1N5QA 4DSIA 1SC4B 3WQTA 1BOTO 4PA1A 5A8KB 2V68A 5M2RA 4O0NA 4Y65A 4QPTA 3THPA 3UO0A 1M5OC 3T7ZA 2VG7B 2ZZMA 5FPMA 4CLYA 3CQ8A 2CZ9A 3M9OB 3BEXA 4WCEQ 5HK4A 4C3MA 3G71N 3J80Y 3JS9A 4LBPA 1RBSA 1NNDA 4Y0FA 3A13A 4EO8A 1XQSC 3O8MA 1YVFA 4OI6A 5JS1A 3CQYA 5AQZA 1S77D 3QNOA 2BMBA 1SL0A 3M8WA 1VBYA 2OPSB 1YJWN 4ZDNA 2XS5A 4B1ZA 4ILHA 4JKBA 4ID5A 5J1EB 1F5CA 5KFTA 1X9WA 3UKRB 2G13A 4WKRA 1YJ9S 5A8RB 2ZC3A 1CULB 3BH6B 2Y1IA 4HVZA 4ZLPA 2F7TA 4WU3A 4FZYA 2Z2MA 1RWPB 1JMTA 1Z2LA 4JV5K 2BACA 4FJ8A 3AVGA 3CIMA 4KB1A 3D0GE 3ID6A 3THTA 4X66K 2ZOMA 1H2UX 4YR2A 5EHHA 4B02A 4LY7A 4EEYA 4LF4J 2ZJRQ 3V1OA 2UZAA 4LR9A 3SK3A 3QAEA 5E26A 3M8SA 1Q7YO 3IXQA 3TVKA 1EQ0A 4QZVB 2ZE2B 2H3GX 3HXMA 1ZBFA 1ROFA 2J5AA 2OSQA 5AJ3J 4KT0C 1TL1B 4LFBJ 3BEGB 1HFEL 2GCFA 4W5QA 1C1CB 1B0VA 2DISA 2EWSA 1L5UA 2Q0RA 2QLBB 4DV3F 1YWXA 3HKWA 4Z4CA 2PA8D 2XGQA 3ILJA 4M42A 3MCSA 4NYZA 3OL7A 2ZJRL 3DOLA 3BO4A 2PEHA 2JVRA 1SL2A 3P5BP 1BHLA 2CRLA 4QWEA 2Q2RA 2H51B 1KQGB 3LZIA 2QLFB 4CF1A 5J2NA 1XNRJ 4M3YA 2XBPA 3UD4P 2WAQD 3W3DA 3I5AA 1YTUA 1RT2A 3KD1E 1JJ2M 4O23A 2CQBA 1NSAA 1WORA 2E44A 2HNZB 1RHUB 4LR8A 1YJ7A 4CP5A 1HR0K 4OYPA 1SJ1A 1TKTA 2ILZA 4RPFA 5LMNF 3LA0A 4C48A 2W6LA 3GOIA 5CZXA 1ZOTA 3ZNUA 2VB6A 1HD0A 3JQJA 2YHAA 3MMVA 4YOEA 1NZ8A 2ACMA 4ECTA 4CTAB 1HWIA 5GMKa 5HRSA 2FVQA 2DGVA 2GHVC 5J1NA 1CZBA 4NMLA 4BS2A 2MDAA 2MZRA 1LXJA 2RAQA 3LP3A 4BC9A 5AZIB 4G1IA 2ZHBA 3PYFA 2HRUA 1BCOA 4LRBA 2R7SA 3OS2A 4WPAA 4Q45A 3OTEA 1YLXA 4DCPB 3M9NB 3H42A 3AY0A 4DX6A 4KV8A 1D9DA 2P8IA 3PW7A 4HACB 5KQDA 4N56A 5BN9A 3DRRA 3QMQA 1ZA1B 4EBDA 1HNZF 4NYNA 3CVKA 1TFWA 2GEMA 2A40A 2VL1A 1HBMB 1ZBHA 2QK9A 1FWLA 1BWFO 4FZVA 1LV5A 5IS2A 1KCFA 3DLGB 4E8UA 1Q16B 3ATUA 3DU6A 5C5JA 1S3XA 1FKOA 3CJBA 2JEFA 1IM6A 1RGIA 1X4DA 2EKYA 4H4MA 4R0EA 1JJ4A 1ZZFA 1UJ5A 3AO2A 5C2GA 2CJKA 3ZSWA 1NK5A 5I3PA 1KWMA 1EZZB 5DZ7A 3NVMA 3M2UB 1LW2B 1TL7A 4DMNA 1P9QC 1SH0A 1RDDA 3HVTB 4P74A 4F2SA 3G6XA 4FWKA 3J7A1 3CC2S 5JUMA 1O8BA 1W25A 2HNYA 1UWAA 4IKFA 4NWBA 1VQ9S 1FRIA 1QY7A 3ZZYA 1PJ5A 3DFEA 1QZ6A 4U95A 3R5GA 2VGMA 4KREA 1H1VA 4AILC 3MECB 3N79A 4ZMMA 1IKXA 4JYAF 3TX8A 3V6DA 5K9FA 2JC1A 1CJKA 4B3SJ 2J9CA 4M3ZA 3VAKA 2VQFJ 1B64A 1HBUB 3PFEA 2LA6A 1T9UA 2O5DA 2DXDA 1FJGF 4WE1A 4HHUA 1RLDA 4URQU 1FRJA 4NLSA 2BRKA 3CETA 4H0XB 2LU2A 4LSZB 3OLBA 5FRNA 3TQEA 1M0SA 2U2FA 2AU0A 4RBTA 4DS5A 4GKJF 4ZVUB 5ADXA 3HOTA 2FZCB 2R7UA 3VQ6A 3S3OA 4JD2B 2KFNA 4NXNJ 2CNOB 1RTHB 2ADBA 3MPUB 5DQGA 3VZIA 3QB0A 2D41A 3IFEA 1GLDG 4K4VA 5KPRA 4J2EA 2V51B 3VESA 4B3RF 1OVYA 3HHEA 8ATCB 1NJIT 1U0SA 3A5MC 2UU9J 3KHRA 1TKXB 3TA0A 3IG1A 4M3WA 4E7JA 2H9ZA 2H1YA 2V6AA 3E3XA 2O66A 1HQUB 1IKWA 1MLAA 2DBBA 1WEYA 4DFPA 2FJWA 3IMXA 5ETRA 4IDKB 2LXFA 3QIPB 1JX4A 2Y9HA 2FY8A 4PWDA 1N34K 4DR4K 1RHQB 2W7AA 1VRQC 1SQKA 1C6VA 2J9DA 3CC7N 4FYYB 3M1FA 4PY5A 3O08A 8AT1B 2LQ5A 5KFYA 5D4LA 2DIUA 4FLVA 4I69A 1H6KX 1CQNA 4CGGA 3JYTB 3NBPB 5C2CA 4AHVA 2G2ZA 5CYJA 3IR7B 3SBMA 1S9GB 3LDPA 2IJRA 4C8LA 3CJQA 5I42A 1WUUA 5CYQA 5A2QO 2HLTA 1VSMA 3HULA 3HT3A 3FDSA 4OHZA 3M32B 2G8KA 2HVDA 4UUXA 1RAHB 4GVMA 2E1MC 3G6EN 1R8BA 2ROGA 5IV3A 4A61A 3AA4A 3CO0P 4BRNA 4CECA 2GZOA 2D0CA 2RRAA 1N33F 2I5JB 5ETKA 2HNDB 1RT1A 3MEEB 2O4GA 1PYOB 4JI5K 2PI5A 3J81O 4L73A 2PMWA 5HLFB 4NLOA 1NM1A 2VUGA 4AHTA 2XO7A 1KQSM 4LSLA 2E9TA 4AHCA 3AAPA 4JI1K 2RHKA 1JLQB 3O1BA 1XJWB 2F4VF 3KLGA 1T6DA 2B9EA 2HFUA 3G87A 2BE7D 3O1WA 1IR1A 3C16B 3KK2A 2VPWB 4DL6A 1YJWS 1VSIA 2Q1LA 2FJBB 1U2VB 2MQPA 2XYPB 1N5YA 3MR3A 3EL2A 3FZLA 2MTLA 3ZO7A 4KHYA 3N4QA 2GHPA 1T05B 4WTYA 1VDHA 2XZDB 1GOAA 3GP9A 4MO4A 1U47A 2QL5B 3JSBA 3T41A 1RAEB 2O8BB 4GKKF 3PYGA 2A6OA 1T3VA 4IDHA 4OYMA 5E3CA 3RMBA 2AHOB 4DV6J 2Y8YA 2QWMA 2DNLA 5B7WA 4ECQA 1ESVA 4DR7K 3HK2A 1DTQA 3R1HA 1Y64A 1V5VA 1WC3A 1CZ9A 4DPWA 4ETXA 3RGIA 1SXLA 4ECWA 2YKOA 5HI7A 5AXNA 3FC9A 1JKHA 4U8VA 1NPRA 2IA6A 4HDHA 4C9DA 3L95X 2ZM6J 4DSLA 4DUYJ 3L3CA 1PC4A 3I0SA 2RH3A 4BRPA 2K3IA 3NFAA 1IBLJ 3M1VA 3IBFB 4CLLA 2J9DE 1YIJN 3VPZA 2A3JA 2FPHX 4P10A 4JKGB 1WNSA 4KHWA 1FF2A 4PXDA 3ILLA 3CCRS 4NRUA 4JK7A 1J54A 1VLYA 4JI8F 3CCQN 4I6MB 4OPJA 4I7FB 2IM3A 1G15A 1Q5YA 2LMIA 5DDRC 2YV0X 3C6UA 3OTOJ 2GHWA 4KR0B 4OPKA 1MWZA 1TZ0A 2DVIA 4UOCA 4MIBA 4LF8K 5F8NA 1Q5VA 4PQUB 3RAMA 3MX5A 3W61A 4CK3A 4AXJA 3K9JA 3MOZA 4ED5A 2YNGB 4NRTA 1HNIA 2RVJA 5HO4A 5EOYA 1D9FA 1NMNA 4CFDA 4LQ3A 4DX8H 4DS4A 3LZJA 5I4MA 2F40A 4WZQA 2HFVA 5M1PA 2A1SA 1VS3A 3O8WA 1RABB 1EWRA 3ILIA 4Y6IA 4ZLNA 2V7YA 1ZBIA 1X4FA 4WIQA 4QS9A 2PO4A 1O51A 5DM7Q 4FLTA 1QUPA 2C2MB 3AH6A 3O5TB 2E1RA 2O8CA 3NF6A 3EZOA 1VBXA 5AXLA 4PQAA 4WWSA 2G0CA 5HOOA 3L3VA 4TVAB 2P9CA 4K4YA 2AX1A 4PEOA 5KFNA 5G4DA 2DR5A 4PWWA 1SKRA 3HX9A 5KQ8A 4ZPAA 4BY9C 3FRYA 4GV9A 4NCGA 1G99A 5DM7L 1RDWX 3P1GA 5H9FJ 2YNFA 2CQ0A 1PYTA 4FJ5A 2DR7A 1E4GT 1KRPA 2N3LA 3ZTOA 1Q81T 3BO3A 3LGNA 3L2RA 2X1BA 3EXYA 1R59O 3MN7A 2D9OA 5A2QU 2XY8A 2VHGA 2VQEJ 4TYAA 3WQUA 2W2PP 2BJ3A 1G3OA 3MAHA 2DNQA 1ZPVA 4ECSA 3BO2A 3OR2A 4P72A 2BANA 1P1LA 4EYHB 1UL3A 4IO8A 2QM1A 4K4WA 2Y1JA 2UUTA 4ZVSB 5GAHP 4Q2LA 4OHVA 2XM3A 1PG5B 4F04B 1X3MA 2WSCC 5AXKA 4RW6B 5C0YA 2EI5A 2YX1A 4A5BA 2UV8G 4O3RA 4K4XA 3CUNA 4KHPF 2YWHA 2DNGA 1IM4A 3CM6A 5I3UA 2CQ1A 2IDLA 1FD2A 1BQMA 1N0VC 1YK9A 2RDDA 1EWQA 4J90A 4RU2A 3PRVA 2OFHX 1NWKA 2MKJA 1S12A 3QSYB 3PX4A 2JDJA 1RJJA 3EE3A 3KFWX 3BUZB 3TAEA 3BZKA 1K9MO 1K1QA 1NH8A 2HZAA 6FDRA 4DV7K 4ED4A 1UW9A 2XHWA 3HSZA 3EZ5A 1HYSB 5L8RC 4CJKA 4EBEA 4BC7A 2PFDA 3O9SA 4USMA 3ULEB 5GAHU 1Q8LA 1UZHA 3ZTRA 1BGXT 1ZYQA 1HKGA 3WEEA 3I8DA 4RUHA 1ZBLA 4O3QA 4EZ9A 3SCXA 1RUSA 3HO1A 3QIDA 1J2VA 2VF3A 1EQMA 5KFGA 4NLDA 3HT0A 5LY3A 4FVCA 5B0FA 4EMDA 5DQIA 2QL9B 3RR8A 3LDNA 2NZ4A 1SIWB 3V2UC 2BKNA 3SMPA 1XNRF 3PIOQ 5C25A 4DV1F 2NRHA 5SZTA 1M5PC 4WBFA 3GYXB 2UV8A 3D6MB 4OGEA 5KFHA 1VRTA 4YORA 2ITGA 2F65A 2P5GA 2ZJPQ 1N4LA 1ZTTA 4RZRA 1N32F 4CI0B 3CQXA 5C15A 2NPIA 4B9QA 2A3ZA 2B4VA 4OZJA 3SPZA 3OJUA 3VQBA 3R6MA 3J80O 3MOJB 4LVNP 3PIOL 1KD1T 2YWFA 3M8ZA 4X64K 4X4SA 3GDQA 5EGYA 2KW4A 2VG6A 4TU8A 4Y2IA 1SH2A 4L74A 5C24A 5E3QA 1OY6A 1LW0B 3D68A 3ZEUA 3MWPA 4WU2A 2ZJPL 3IWXA 4U67L 3PIPQ 4ED1A 2DRBA 1TYQA 3ZYYX 1HI0P 4ICLB 2HB5A 3CJ7A 4ZVFA 2PYJA 2I6WA 4Q44A 1NUEA 2UXBK 1DT9A 4CHQA 1HKBA 4EIAA 2E5GA 4U7UK 3G96A 3QWUA 2APOA 3NH1A 4OZ2A 4M5DB 5CABA 4C11A 3O9QA 3IWNC 3FBBA 4NL5A 2XMUA 3KG4A 1R8AA 3LL3A 3BZQA 4ZIWA 2P9GA 4B8AB 3PY8A 1DHMA 1F2HA 3PIPL 3L2VA 1HQEA 2ZF5O 4KYZA 2VPZB 1UKUA 3NF8A 4DV5F 5HBMB 3UDVA 3B6PA 3CPEA 4LF9J 4J9UE 2ZH1A 3AB2B 1KVCA 1Q18A 4EWTA 4KB0A 3VQ7A 3PX6A 1VC6A 4PUOB 4M5HA 5K8PA 2HSEB 2HMIB 4DTJA 1NU0A 3DOMA 5J2PA 4C8OA 1MWYA 2MZTA 1KFSA 3QGGA 3T6BA 4LSNB 2OEJA 3OT9A 4DR3F 1KNZA 2ABYA 3H6EA 1W2BR 2FSNA 3C15A 2OSRA 3QWPA 1D8YA 4LF6K 2WBMA 1QVFR 1FRXA 3LPEA 2ZH3A 2VONA 2H3EB 3DN9A 3MHYA 1HNWF 5EUHA 5HMZA 1C0TB 4O3SA 1M1KO 1Q79A 4DV0J 3A2FA 4QJVA 4DHYA 4K5RA 3CCZA 4LF5F 2KB2A 4GVBB 2AMCB 4ZJLA 5DDQC 3L8BA 2PAVA 3U3YA 2YNHB 2J0SD 1NRKA 4YOXA 4K25A 1VQNS 4DU7A 2I8EA 5LMUK 4JKEA 1F6TA 2RU9A 1B9FA 2OO4A 3M6WA 4JI0K 3THYA 4B3MF 2NZCA 4BR9A 2OPPB 2P9IB 1RHMB 1G2EA 4ECRA 2NQPA 2AJ1A 2J7WA 1WEZA 3DHXA 1SC6A 4ZPBA 3UW1A 3CHWA 4ZPDA 2VIHA 2EHGA 2WTUA 3VGUA 3KKRA 2H5JB 1QS4A 1NB2A 3I4HX 5JLHA 5D4PA 3DHWC 4GC7A 4CZEA 3I82A 1QE1A 1EQYA 1N6QA 3K58A 3Q7BA 4CDIA 2Q31A 3THXB 4DCJB 2E6LA 4ECXA 2ZH9A 3GJQB 4OHWA 4MTPA 1SVDA 4WFAQ 3HSGA 1KAXA 3I9ZA 5B0AA 2DK2A 1NDLA 3OJSA 3ET6B 1NGJA 4DQRA 3LP0B 4WK1A 3CCQS 1SH3A 4A62A 4JV2A 2ASMA 2W7PA 2LP4A 4JUZA 2MZSA 2CPFA 4BREA 3WNEA 5CAAA 4WFNQ 4FOIA 2KXNB 4ZP6A 1O1WA 1UVLA 1XMQK 3H90A 1HBOB 4LR7A 4WFAL 2D3UA 2UU9F 5D0HA 1VQMN 2VODA 1FESA 1XEZA 1N5VA 3KLHA 2HBJA 1RBUA 1RCXB 3ZZOA 3HTVA 3HYFA 4X4RA 3UWTA 3GE1A 3NGUA 2BE2A 2YY3A 2E7WA 4WFNL 2QFIA 2NXNA 1Y11A 4KI6A 2CZ4A 4A8QA 1TFYA 3SJJA 4H4KC 3RSEA 4XEIA 1PAEX 3J7AN 5GADP 2X3GA 4I56A 4CH7A 1K1SA 3VV2B 2ZGZA 5IQ6A 2XTJP 1LAVA 3NCRA 2EBGA 4EHTA 4ZCMA 4IEIA 2Q97A 2R3VA 1WF2A 2AQ4A 1HKCA 3D2FA 3QT5A 1NK9A 3J80U 2XULA 3VGTA 4ED8A 4XPCA 2EK1A 2F8HA 3OR1A 1G7CB 1X4BA 4R5PB 2IPOB 3TWZA 2GA7A 3M6VA 1JLBA 1OY9A 4X66J 1OS5A 2R2TA 1KHWA 3CD6S 2EFQA 3CPWM 1SAZA 3Q89A 4DN0A 4CIFA 1TAQA 1BA1A 1NPPA 2VZ9A 5G0RB 3NGIA 4ATNA 1WJ9A 3H8YA 1K8AO 4P9SA 2YJEA 1TKDA 3VEYA 1W7AA 1EP4A 1XNQK 2F4FA 2RE1A 5IWAJ 5GADU 2DY9A 2J8AA 4CCHA 2VFVA 1YVUA 3MD1A 1EETB 3GR0A 4OMFG 3ICLA 1I5OB 3LUYA 4H03B 1FXXA 2V63A 2CUYA 3LANA 4ZJOA 2GV9A 4C1NI 4DV2K 3D2EA 3MX2A 2G2YA 1NSPA 4YOWA 3D66A 5HQMA 3H5YA 4Y1CA 4USHA 4ECZA 3TUPA 3AVMA 1QTMA 2OUGA 2YQ1A 4YQWA 2YPYA 2D69A 3ZSVA 3QETA 5T7BA 2W9CA 4JAXA 1HR0J 5IC4B 1NK0A 3AJ1A 3WNFA 2HHWA 2EPIA 2A18A 4H5VA 1RBAA 4I64A 2MGZA 2MSSA 2GVZA 1HMVA 2VBXA 1WSGA 2CPDA 2E88A 5BRDA 3FGUA 2IVOA 5D3GB 1I94K 4Q7AA 2Z57B 2DO4A 3S8SA 1FFGB 3LTOA 2D9PA 4IG0B 2VFTA 1RCOB 3T1YF 1NK8A 3DXKA 2QA4S 1V5IB 3R27A 2JGUA 3CEDA 2XNQA 1R8CA 2KKZA 4UQTA 1FDBA 2ZBCA 1OYEA 3KLEA 3FFIA 2FGOA 1RE1B 2GC8A 5ETQA 2NYIA 4HVJA 3D4JA 3EUNA 3NS7B 2ZHOA 3RBZA 3DMJB 3Q8PB 3ENWA 1RQ0A 3O3HA 1ZBUA 5KT7A 2RRNA 4Z4HA 3KYLA 5A0YA 1FWKA 3J7ZT 5C12A 4B8CA 5DLFA 1UETA 4IJNA 4BACA 2MHNA 2V8VA 1TL4A 3PO5A 1YJNN 3E9LA 1S1VB 2V9KA 3HSCA 5LXRA 3HHLC 3BR9A 3MZIA 3DYAA 3JXOA 3DLLQ 2WRMA 1FEHA 3DXMA 3HDSA 1Z25A 3R8YA 2ASDA 2KRRA 1OSDA 2AZ3A 4W5RA 2FUG9 2DFFA 1S4EA 5DQHA 1DURA 4P71A 3PZPA 4CJPA 3VGMA 4KPCA 1YI2N 4TNOA 3VA3A 4X65J 1RBLA 4R8UA 5CCLA 2R7WA 3NF7A 1YKWA 2RF2A 2ZNYA 1HLWA 3I4PA 5EWGA 2IIHA 4IEEA 2JSXA 1U09A 2WC9A 2GAGC 1U49A 2IYIA 2O8DB 2XYGB 1J5EJ 3MCOA 3RB0A 1M5VC 4IOBA 5F8HA 3O4QA 3ZX0A 2V0NA 1XI1A 4EUVA 2WVDA 3I96A 1OH8A 1TGOA 3CWJA 2HBLA 4BRFA 3CJRA 5M1QA 1LWCB 1FT8A 3LP1B 2P6TA 2D7SA 2HBYB 2VG7A 3CCMN 3TZWA 4ZPVR 2JLEA 4CF9A 4FK2A 3NNHA 1VSFA 2HLUA 2UUWA 1Y00A 2CQDA 3L2QA 1HBNB 4Y34A 1T9WA 4BRMA 1RSCA 4DR2K 1RI7A 3SI8A 3OVBA 1U1LA 4B9MA 5F3ZA 4A8KA 1RYRA 1HWLA 5C42B 2OPSA 4OX8A 4KO0B 2B9WA 1YJRA 1VQKN 3LM2A 2QSWA 1GLCG 3AGKA 5J1EA 4O8UA 1N56A 3QNWB 2CQHA 4MH8A 4G65A 5DG8A 3VF4A 2HQ3A 5A8RA 1KP6A 2XY6A 4QQBA 1JXBA 1CULA 4ECUA 1V3ZA 4DF8A 1Q1KA 1XHXA 3H2LA 4JI6J 4QIGA 2OAUA 1D1UA 2JWNA 3PVXA 2ZH2A 3MPYA 3SFGA 2IBOA 1H98A 3VEVA 4LJMA 4EGLA 3VQSA 2E1ZA 4USKA 2BJ1A 2Y1LB 1U4BA 1T11A 5HP1A 1V4SA 4UOGA 1QTNB 1I1GA 4URGA 2IVMA 3G82B 2PMHA 3CD0A 4WFXA 2ZE2A 1CG2A 4AM6A 4JI7K 3GJTB 1IKYA 1N0UA 3KWMA 3CJ9A 5EX3A 2RD5C 4E7HA 2ZWOA 2ZD1B 3DWLA 1MWKA 4H0OA 1R0AB 2NS1B 2AYEA 2DNYA 2HHUA 2MYFA 2XWXA 3SI6A 2CG8A 4DTRA 3EN9A 4TQRA 2O3DA 2MXYA 3CCVN 5IT0A 3SV3A 3EDRB 1Y3JA 3F2KA 2LECA 1B7YB 3VWSA 4MK8A 2Y3YA 4E19A 5BPMA 2GMLA 1FXDA 5KG6A 2B56A 5E84A 1VOMA 4FNHA 3R7NB 2P9UB 4ILRA 3VQAA 3D9BA 3N4PA 2VFSA 3ITHB 3VAHA 2HAIA 4PR6A 3T1HF 1MMDA 3PDNA 3FBCA 5AQMA 2MQQA 4DR5J 4EI2A 4J9LA 4I1TA 5KTQA 1ZAWA 4H5NA 4WTOB 3GMGA 3MUMP 1EIYB 2FYXA 4CTAA 1IBMK 4K4ZA 4JI5J 2QLJB 4G9ZA 2ZC4A 5DZ6A 4JKAA 2CZVC 4O44B 2UUBF 2VGNA 2RKIB 3DAWA 3AJ2A 4HHHA 1PYSB 2E2OA 2AYGA 2IYGA 3CCTA 4ZITA 5AZIA 4Q8EA 4JI1J 4P2MA 2DY1A 4FLWA 4ER8A 2QWLA 3A1YG 2FBTA 3AVAA 4FNIA 2DGTA 4JI3K 5DG9A 4B1VA 4RWTA 2E7VA 3CW2C 5KFWA 2HFOA 4CEEA 4HACA 2VWKA 2XMKA 1AXQA 1N8RO 1RDBA 1RBRA 1LXNA 5HMYA 3A8KA 3GILA 2UUCJ 4A8WA 1IWAA 4HH1A 1HNXF 4OKJA 4LVOP 2AW0A 4ZPCA 2AYBA 1HBMA 2DEIA 4ZVGA 4ZCKA 3OFHA 3I8BA 3UCZP 2ZH6A 3DLGA 1RDCA 2DR9A 2B3TB 4QPXA 3TA1A 4F25A 4WFBQ 4C3LA 1SQFA 4ANEA 2YJFA 2A10A 2RN2A 4NLCA 5B0DA 1U04A 3G4SS 1SKWA 4CLFA 1R3NA 5KT6A 3O3FA 4LF4K 3N01A 3R5BA 3KHYA 5CHIA 1I39A 5D77A 5AE1A 3GV7B 3UD3P 2E1PA 3D2WA 2MZJA 1BUPA 3VHQA 4CT8A 3M2UA 5ETOA 4CBUA 5AJ3K 3OHAA 4LFBK 1LW2A 2QEXN 1VQ6N 4IOXA 2HVHA 2AJ2A 2O8EB 1YUWA 4ELUA 1CC8A 3FSIA 2Z2YB 1EX4A 4X62K 4WFBL 3S9HA 4O55A 1CXUA 4CJLA 2VYPA 4OYAA 4LRAA 2G1DA 4KGXB 2P2CB 4N8NA 1VGYA 4DPYA 4DSFA 1CS4B 1VIXA 4ENOA 2DHGA 1H0HB 3J81j 3O9TA 5AZJB 1EJ7L 1HBUA 4A4JA 2R7OA 1UVMA 3FRZA 5EWEA 1S49A 2HBKA 3R5AA 3QMLA 4ZP8A 4LF8J 4IWVA 2GIFA 2YKNB 2FD2A 4F8RA 3MPDA 4YOUA 4W5OA 4YY3K 4FS2A 2VJUA 3R9PA 1CQMA 4TU9A 1Q86T 1WSFA 5LOQA 4F36A 2M3DA 3E01B 1KVAA 3CCLS 1PBUA 1QSYA 2P9PB 4H5TA 1QDUB 4ALZA 4JD2A 4OHXA 1RT4B 1RTHA 1NKEA 4BE2A 3SFUA 5H1SQ 2UXDK 4NZ0A 2ASPA 3OW2R 1S6UA 4F50A 1Y5NB 3GIIA 1OMSA 4P7VA 4BG9A 4F4AA 2P9NB 2D1CA 4NLWA 3W5XA 3U6FA 3ISND 2W2OP 5ADXH 1V3SA 3RTVA 1Q4RA 4DU3A 1DAXA 1TKXA 1K8KB 3IA0A 4PRFA 1RAGB 4H4OB 4BE0A 3MMJA 4DHVA 2OP5A 3N6MA 4C2MA 3DRXA 2WW4A 5KFLA 3AJDA 2QKKA 5K8OA 2MKCA 4IYQA 3KIOA 4ZOSA 1OH7A 4IDKA 3RAXA 4CW7B 4Y2KA 2DHXA 3NHGA 5GAGI 4IFVB 2J8SA 3TAMB 4HEA9 4L6V3 5BPLA 1IJFB 3V4IA 2XS7A 4FWMA 2XB2D 2RS8A 2FF6A 3JYTA 3NBPA 1S6PB 4H0TB 5I9EB 3C7NA 4PG8A 2K3KA 4DPOA 2ATQA 1W0HA 3WIUA 1B92A 1D4XA 3OTDA 2BOPA 3EWGA 4PZVA 3V1RA 2DEJA 4P73A 1YI2S 2HHPA 2HHSA 3CJ4A 2HIQA 4ETZA 4HUGA 3CCES 2ADCA 3M32A 2OYQA 9ATCB 2XMMA 2EFNA 4NLVA 4BVOA 4WZMA 4YDUA 3FQLA 1NB7A 3R7SB 1NGDA 2HVZA 4DR6F 3GLJA 2QIFA 2I5JA 3P83D 3MXMA 2D3OR 2OTLN 4KHUA 2HNDA 1U6FA 2PE8A 4C97A 3MEEA 1KVJA 2CVEA 4B3SK 1BCMA 3LPUA 3BJYA 1AUSL 1IJEB 1ZC6A 4Z94A 5HLFA 4JV5F 2I7PA 4CZIA 4R79A 4UTGA 4MO5A 3KHHA 3O6WA 4LUBA 3PYEA 3PO4A 2QFJA 4PL8A 1JLQA 1RWWB 3CCJN 3VEWA 2L9DA 3JB9k 3MWTA 4I6WA 1NOZA 4AL5A 1NK6A 3C16A 5HJYA 3OXLA 2ZKTA 2JHEA 3HFVA 1EARA 3GIMA 3CMES 1U2VA 2I0XA 2ZH5A 3O1LA 3L4QA 5KFXA 3PFOA 2X74A 1Q7LB 2AZ1A 1WAJA 1T05A 2IMWP 4V19X 1X4AA 2QV6A 1VBZA 3BGUA 2RS2A 4X4UA 1S1TB 4OHYA 1U8SA 1RT7A 1TL3B 1ZXOA 3BBBA 3H3OB 2O8BA 5K8NA 5J2MA 4MDAA 4HTUA 2FLPA 1AA1B 2ZH7A 2OIHA 1V4TA 1S1UB 4M5KA 4IOAQ 3ZSQA 1UPMB 4RNHA 3C6HA 2NUBA 2WTFA 4CK1A 3KK1B 4C8NA 5DDOC 1SPBP 4CO2A 1NGFA 1QAJA 2A42A 3BZCA 4X64J 1KVIA 1U6BA 4NCBA 1S6QB 2HQDA 5LJ3Y 2R2UA 3D45A 2CGLA 1IQZA 4OYBA 4QIWD 2KG0A 2YNIB 3CCVS 1B70B 2QYCA 2CJ9A 4DV3K 1P90A 2GV1A 4I6MA 5H9EK 5T7LB 3VF6A 1E6YB 3POTB 2UXBJ 2DNHA 2GUPA 4NA1A 4TU7A 1Z6RA 3JTPA 4DL7A 2UUAF 3A8EA 2R2SA 5GAHI 3DCAA 2BV3A 3OYNA 3C3LA 4PQUA 2NRRA 4USUA 2IVYA 1RFQA 4Y3CA 4KFBB 5CHCB 2KT3A 5CH7B 2B4PA 5JVHL 2QWQA 3O4WA 2B6AB 2RDJA 2DH8A 3VGKA 3G0ZA 3KWGA 1R0CB 2YX7A 3THWB 4FYDA 1ILYA 5D4OA 1VK8A 3H46O 1HHTP 2YNGA 5FPNA 4FJXA 1NK4A 1UAXA 2E1CA 2OCEA 2WOMB 2V4JB 3JXUA 2PT0A 3O44A 4WP8A 1NLKL 3TA2A 2R2RA 2Z8QA 1T0TV 3NL0A 3VQCA 4DPXA 4BRKA 2E5LK 3BPSP 3RG6A 1A5XA 2HAFA 4JHDB 3ZX2A 1HWUA 2LCWA 1B9DA 2ZH4A 5HQLA 1B4SA 5TKYA 1XMOF 1JLGB 1WOSA 1VQ5N 2HQCA 3DLKB 3QINA 3MMCB 3GTYX 4CJ4A 3QERA 4LF6J 5AQGA 2VOPA 3HRGA 3BF1A 3N5FA 4DX7A 2B51A 2M52A 4CHOA 4G3IA 3GJSB 2JFKA 4DKWA 1G4CA 2Z58B 4JNEA 3O4NA 1GXUA 5HN0A 3W60A 4ZN3A 2P5VA 3CDAA 3MEGB 4RW4B 2FBXA 5B0GA 4USTA 2VA3A 5JLFA 3JAMY 4HI2A 2IJNA 3AODA 1XC9A 4O3NA 1X7VA 2R7VA 4DV6K 3RU0A 1PGZA 3UB5A 2R42A 1NJWA 1R6YA 2RUGA 1S4FA 4YEAA 1SL1A 5CYMB 3SQ2A 2X51A 4RW7B 2J7KA 1VQ8N 4FSVA 2CG4A 4MK7A 1HLUA 1FHTA 1C1BB 4KGZB 3BS9A 5IXUA 5JJBA 1S5JA 3PV8A 5AE2A 2V94A 4ZTJA 4B3TF 2XO6A 2V34A 2A41A 4DUYK 2GIRA 4F3TA 1UVNA 3HLUA 2CJQA 1FFWB 1IBLK 2W25A 4RW6A 2N3OA 3FCVA 4BRLA 1H3DA 1CJVB 3BKTA 3FZFA 3BPDA 4C8YA 2Z1HA 4DQIA 1NGGA 4Z4IA 4NLQA 4DDFA 2WONB 5KFDA 2VPXB 2QI2A 2ZBIA 1DEJA 4FKXA 3OTOK 3J7YP 1OY8A 1T6CA 2ACYA 2UXCF 2RQ4A 1BIUA 1GLBG 4PG4A 2CAJA 2R7RA 5KFFA 4DTOA 1XMQJ 2QSFA 3SBTA 1HYSA 5FROA 2DNNA 4HTJA 3F9MA 3OXGA 3ULEA 4WP9A 2H5IB 1IUJA 2QLXA 2B8QA 4J9VA 4GVLA 2WSFC 3SZ2A 2ETJA 1S0MA 5MLCV 1RZMA 2DNMA 2DO0A 1FJGK 4CM0A 3SNNA 1C0GA 5SWMA 2LEPA 1ZM9A 5ADZA 2DGOA 2M9KA 1WELA 4C0HA 4ILJA 1N34F 3L4IA 1X4HA 4KRWA 4DR4F 1RILA 4JKHA 4GKJK 2GELA 1FKAF 4K43A 4G1PA 1WHYA 5LL6Z 3CXCR 4F3OA 1YTAA 4N41A 1Q82T 2ASLA 1ATRA 4M3TA 3W9IA 3J7YU 2W9BB 3ENAA 3SSQA 2ZOGA 4JI2J 3D0IE 4YFUA 3UKUB 3ZLJA 4NI2A 2D0OA 1EKSA 4CD1A 3CFRA 4ZP7A 1KTQA 3CJ5A 3OFEA 1ZAVA 1RAJA 1S9EB 4DB3A 1X9SA 4P75A 1SZ2A 4X4TA 3J81Y 2N7CA 3K2PA 2NZTA 1X0PA 2N82B 2R8JA 2KHOA 3BSCA 3TVYA 5E3PA 3QBCA 1RDAA 1RBTA 3A3PB 3VQ8A 2ASJA 2LXIA 1LW0A 1Y5LB 3HJFA 4FM1A 4Y2MA 4C1NK 3IWLA 3K5MA 2Y0BB 3NRBA 5LSRA 2YPZA 4ICLA 3P49B 1P9YA 2VDIA 4KH1B 1VMBA 1J9AA 1NBWA 1A9NB 2OEMA 2M4MA 1K73T 3HSJA 1AUDA 1NK7A 1K0VA 4H54A 3SQGA 4ILLA 4JKCA 1M5SA 4KHMA 1NGBA 2LQBA 2IRUA 4KQZA 4M5DA 4DV2J 4WF9L 4OKEA 2J0WA 4CLSA 4BBYA 3GB0A 2O1PA 3GV5B 1FNXH 2AEMA 3KNGA 2WFBA 2R4FA 3WUHA 1VSLA 1W2BM 5HBMA 2FXUA 4PWUA 1JIHA 3MM7B 1T9TA 3Q2TC 3D0PA 1VJQA 4KSEB 2HF3A 3WX4A 1RAIB 1VQ4N 4TLRA 4L3KA 1JLEA 4DU4A 2KLAA 3AA5X 1S97A 4DQPA 3CC4N 1SKUB 2FLLA 3AD9C 4PG5A 1X5PA 1ZM2A 3UN3A 2HMIA 3D67A 4DLEA 3QLHB 1N33K 1WDDA 3N5BA 1L3SA 1T3NA 3RW7A 2PDAA 4XH1A 1KKHA 4I2QB 2CNKB 4DR7F 4IG3A 3OVAA 3GFHA 4EO6A 2DHHA 1KQFB 1EX8A 2ZVSA 2XMVA 2B4JA 3BP8A 4NZ6A 3UIQA 4CEDA 2UYTA 5SUHA 3P4IA 3G8QA 4IO1A 1N5TA 3S6EA 2DHSA 3SAGA 4CGIA 3G6VA 1WI6A 4JK9A 3CT9A 4FS1A 5GADI 3PKYA 1DQ9A 3H7HB 4EFAC 2KZZA 1FRHA 2ZOFA 4YOYA 4GVBA 1JJHA 1NCLA 2PIIA 4C8KA 2YNHA 2BM0A 2FIUA 2RILA 3FZHA 2X7IA 1Q8KA 2V4QA 2QXFA 2ZZTA 1ELOA 5DM6L 2NXUA 2OPPA 2P9IA 4A8FA 4H5WA 2VWBA 1G1XA 2W4DA 2IIRA 3CMAS 4HCCA 4LF8F 3GFZA 5KFOA 3CDBA 5KFPA 1LQ9A 3OS1A 2AD9A 3CCUN 3DLJA 4UT4A 3MAAB 2P9SB 3W9JA 2P1JA 1ZETA 1GLLO 4ZP9A 1PJ6A 3ZTSA 2M7SA 1CJUB 1TKTB 2AEJA 4RKUC 5AE3A 3F56A 3QJLA 4WJBA 4XTTA 4DU1A 1JLCB 4C3KA 3VOVA 4OL8A 3RW6A 1RWUA 3OYBA 2VBYA 3WZ0A 2KN4A 4N5SA 4PXCA 1TQLA 4A8XA 5F0UA 1W97L 3HI0A 3NGDA 3VTHA 2VD3A 5B8HA 5AT1B 4S0MA 3NOGA 4YDDB 5LSLA 3LDOA 3KOAA 2MKKA 4CJTA 2XI3A 1K6YA 1M1GA 1NDPA 3NWRA 2UVUA 6AT1B 3TW0A 4IFEA 4OYIA 2E6MA 3RVCA 1U7LA 4LF9K 4FXVA 4LFCF 4OFZA 2FSJA 1Z4UA 2K06A 2JEJA 4YHHJ 3BQ1A 2G4BA 1SV5B 1A6LA 4MIWA 2IAJB 2Z2LA 5B0BA 1NJYA 3PEJA 5A8WB 3DRRB 4BDPA 3ALYA 1N54B 5KFUA 5D78A 3HMJG 4ID8A 3QEWA 3QJPA 2FVRA 1TUWA 5HRNA 1VQLS 1BI4B 1VQ5S 2YCHA 3SQ0A 2FQQB 4E89A 3F44A 3C6TB 1ZBSA 2HHXA 3W2WB 4R5PA 2RB7A 3TJAA 1P1TA 2KO1A 4NXMF 1HI8A 2KXFA 3NNAA 2L9WA 4H4MB 1T9VA 4CESA 3A4TA 3VQ4A 4E1MA 1I6JA 5G0RA 5KOXA 2O67A 1TV6B 3KUGA 4UY85 4Z7CA 1CEZA 4Y2AA 5IOLA 2Q0UA 1FVQA 4CM2A 4I2PB 5M1OA 3UVJB 4M3RA 4ZTFA 3Q8RB 2ASOA 1DRZA 3GSIA 4WP3A 4LF2A 3K8VA 3VAIA 2F8MA 3MXHP 4JS5A 3TZYA 5BR8F 2HNYB 4CJ5A 4WIIA 1EETA 4JP8A 1WN7A 1KAYA 2KL8A 2W4CA 3ZFVA 1Q53A 2FVSA 1OQ3A 1FA0A 4LMZA 1RXOB 2AIRB 4OJGA 4NEZA 4PKHA 3V6DB 4GRSA 4DV7F 3OSNA 3IUCA 1CJKB 3P96A 3UN2A 5HQ8A 3DRSB 2HKEA 3RB6A 4TY8B 4Y28C 4OYZA 3CJ1A 4N47A 3IBCB 2DCUB 3LDLA 3CIPA 3B8AX 4KH0B 2X1GA 2UVRA 3BY5A 4LBHA 1ASVA 3BV8A 3C0BA 2XLJA 3Q83A 2JNJA 2AJQA 5D3GA 5LL6d 4KBIA 4OJRA 2BABA 1Z26A 4JLHA 1KR4A 1IBMJ 2HZVA 4QU6A 4CJWA 4IG0A 2OHDA 4N76A 1NGIA 4K7QA 3IKMA 1T02A 3T6JA 1FRMA 4M5MA 3PRDA 5U47A 4M5IA 1O13A 2V7ZA 3AXMA 1IBKF 1X5SA 1RYSA 3P5TL 4JI3J 4RUAA 4EHUA 3U1MA 3DMJA 1B0PA 3U9ZA 4Z7YA 4X64F 4CEBA 1BO5O 3IG1B 4TN2A 2XCPA 3ASMA 2DIVA 1KOOA 2NUUG 3V4MA 5JVGQ 1IKWB 2KXHA 1ULRA 4CGJA 3CB4A 2HVIA 3SCIE 3HBTA 3DLBA 4OQJA 4O4GA 4QR2A 1NKCA 1RKJA 2IVFB 1S1VA 2L08A 5IM0B 1T03A 3MM9A 3SCLE 5B09A 4O0IA 2DPNA 4ZVRB 1S1XB 3HPGA 3JSMB 4WYWA 1JL2A 1RAFB 4FJ9A 1U2CA 1NHUA 4CO0A 3NGRA 4EAHD 4GMJB 5IQQA 1NJIO 2FB0A 3GIJA 2AJFE 5JVGL 3F9KA 2GQCA 3IC1A 5FRMA 2BZ2A 4A48A 3FLCO 1OPIA 4FJHA 5IWAK 1N32K 2E5JA 2IRYA 4AFFA 4X62J 3RR7A 2C3MA 2O8DA 4ILMA 3VQQA 3MUVP 4NE9C 1IV0A 1IR0A 2EEYA 5L46A 4O5BA 3V6HA 1I51B 2GTDA 1RT1B 2Q79A 5AXMA 1N5SA 1LWCA 2ZDPA 3EO3A 3LP1A 3B4MA 1AFJA 3AO5A 3SQOP 2VASA 2LKZA 1RLCL 1H2VZ 3TRGA 2RIJA 3M2RB 3S41A 1VYAA 2HPUA 4AXIA 1U8WA 4OJ3A 2EG1A 3KLGB 3OA9A 2CQ3A 3MFHA 4RNNA 2RQMA 5C42A 2F1FA 4KO0A 1SJ4P 4YY3J 1BG3A 3MR5A 1WC0A 2RMLA 3CC4S 3M3ZA 4DQQA 5KFAA 3KJFB 4K0KK 3IR5B 2F5GA 3TUZC 3NS6A 1MNEA 2QWNA 2OPQB 5LMUF 4JV1A 4JI0F 3EGVA 2J76E 3DXSX 1KQSR 1XHZA 3CJAA 1BD6A 3T9ZA 3NOCA 4ISFA 4K8RA 1N88A 1RB0A 2UXDJ 2BYCA 3TOQA 1NGCA 1BIZA 1GLEG 4KBOA 1A5VA 3LWLA 2XSJA 3I87A 1MN9A 5E2QA 1FW6A 2CGJA 3VAJA 3MN9A 4DL3A 4QWCA 1NZAA 2ZWHA 4DR3K 3G82A 1B7FA 1FE4A 1JK9B 4F7VA 1ZTWA 4KHRA 5LJ5Y 4CH1A 3CJTA 5IV4A 4ELVA 3Q8YA 4F3MA 5AQRA 5M1FA 1GX5A 1WTBA 2NRWA 1JKHB 4IKAA 4CZJA 4OZ1A 3PLAA 2LSNA 1HNWK 4IQMA 1HW8A 3DDIA 4H0VB 3H25A 4CJUA 5DRKA 2ZD1A 4AUKA 5I3QA 4QR0A 1R0AA 3NGYA 1R8PA 4FBUA 3ZT0A 3CCSS 3OYCA 4LF7J 2HRYA 4GC6A 2ATLA 3OL9A 1IQTA 1ZA2B 3LW5C 4EBCA 4UY8T 5AQTA 3U8XA 4JRQA 1KDNA 1VCTA 4MFBB 3CCUS 4KTWA 3CJCA 1VR6A 4X65K 1X4CA 2FSKA 3M6XA 4CO3A 2W6KA 3H5SA 2R8KA 1UZDA 4LF1A 3HZGA 2P9UA 1LAWA 4O4RA 1JQGA 2QA4G 2MSTA 2V67A 3ITHA 1J5EK 3SMZA 3NH2A 4PKIA 5AQPA 3BDPA 1TVRA 1VQON 1XR6A 1LWEB 3E66A 5HMXA 4YR0A 4CZKA 4IXCA 5M2PA 3ZC4A 1TK8A 2LLZA 2F9DA 2Q1NA 4CIEA 1RP5A 4BQZA 1Q8BA 1DKGD 4Y00A 2QO3A 3U1LA 2MQLA 1BU6O 4O44A 3KLFB 5TKWA 3JAMO 2RKIA 2Q43A 4CZMA 4KB7A 4CEZA 2DXFA 1NNEA 3BDEA 3CD7A 2X6NA 3KG1A 3TTCA 3EGWB 1IKVA 2MJNA 3LAMA 2GAHC 3WQPA 1CJTA 4FVMA 2C2RA 2DNZA 1W7WA 4MKBA 4YR3A 3H3NO 2LFVA 1OKJA 1XNQF 2NRZA 2LQ9A 4UZCA 3RMAA 4E7IA 4V19S 3G8TA 4JI6K 2LYVA 2YX4A 2CPEA 1U0HB 3P4UB 3AVJA 2IS3A 4OLOA 2JZ5A 1WKKA 2UVWA 2YNFB 2E20A 4B9UA 2CQIA 1SQGA 3U3GA 4BRCA 4KHSA 4IH5A 4OI0A 3RYLA 1J5OB 2KFYA 4NMXA 4D3GA 1UVJA 3KJNB 4IBNA 4WFYA 4A2BA 3LF0A 2AGQA 3BF4A 2H48B 4ECYA 4HL9A 2ZWPA 2BANB 2H4WB 3M8PB 4Q8FA 1HUXA 1OVQA 3ENOA 2O8EA 3NP5A 4OIXA 3MCAB 3QIOA 3AO4A 2GWJA 2A2CA 2D74B 3OYAA 4CNZA 2LVWA 1UP1A 4X2BA 3CERA 2Q6BA 1Q81O 2FC0A 2ZQBA 2WB4A 4ES2A 4PPDA 1FD8A 1I94F 1RADB 1Y10A 2XMWA 3I56N 1F1BB 2X78A 1M5KC 4XK8C 2VKRA 3VAGA 3SXLA 1CS4A 2KYXA 1ZAXA 1U45A 2VG5A 1O0PA 3SCJE 3MM5B 1BQMB 3EXCX 4DV3J 4GY2B 4CHYA 5LSOA 4OKKA 3DDNA 5KFZA 4F4KA 3SLCA 5H9EJ 2GO8A 5CA5A 2DR8A 3DLHA 4KTQA 2JVOA 2W4PA 2GQ2A 1S72N 2V69A 2FZKB 3LH2S 4RW8B 5F8IA 3MN6A 3OW2M 2YKNA 2J9EA 3VF0B 5J2QA 4M7YA 4GNIA 3OL8A 3JQMA 1WB9A 2CQGA 2IDOA 3E01A 4DR5K 2KYZA 3WEEB 2IOCA 3DOKB 4OX6A 2E2NA 4GO5X 3HD2A 1S59A 2P9PA 2QTWA 3ZSXA 1WC1A 3Q2SC 3DI6B 1ACMB 2EKNA 3L7PA 5LMNJ 2HHHF 4FJGA 2B4UA 4OYWA 4CIOA 1RT4A 2E5LJ 3M7VA 3G71S 2CWKA 2AYMA 2M2BA 2E4LA 2HS3A 3KWIA 3NMUA 3BH7B 4J9SA 1Z2ZA 2P9NA 1FX2A 1LWFB 4HI1A 7AT1B 3KDOA 3C46A 3WXJA 1TTHB 5C25B 3T1YK 1KLMB 5KG3A 5DMRA 2O8FB 4EYIB 2EWHA 4BDZA 1HI1A 4FF2A 4E98A 3ATVA 4H4OA 1VRUB 1UA0A 1PO6A 3FNNA 4BC4A 1DZ5A 3GR1A 2UUCK 3CM5A 3SJHA 2HGLA 1YHQN 4FWQA 5CZVA 3IAYA 3AGRA 1VHXA 1YG0A 2WBNA 4IFVA 1X4EA 1S76D 1WHWA 2FTRA 4AHSA 2VU5A 5GAGP 4USIA 3R6GB 3R1XA 4DUZF 2UP1A 2W8LA 5RUBA 1NGHA 4AF1A 3JSYA 1FFSB 2W9AA 3VQ5A 3NNCA 5L9NA 4ZHRB 2BA9A 1HNZJ 4UW2A 3ZEUB 3MMAB 2CQPA 3OBWA 4QWBA 1S6PA 3QQCD 1WKLA 2YWKA 4QW8A 2EBEA 4WKYA 2NUHA 2OI2A 4MDBA 3CIZA 1UCNA 2HW3A 1N52B 4DR2F 3PJWA 3TO8A 3D54A 1WD6A 3AA3A 3UE5A 3ENVA 4NLRA 1KD1O 2CA9A 3W8GA 3MM6B 3JAMU 4LT6A 3I6PA 1NGAA 4JI4F 3W3SA 2QA2A 3AVFA 4NASA 1WBDA 2IDEA 3VN5A 1XMBA 1SBRA 5F8JA 3ISNC 2CPXA 1Y7PA 5GAGU 1KOHA 2BX6A 5KFMA 1DLOB 5K8MA 4RCHA 2B43A 2LU1A 2BJ8A 1U24A 3FZ2A 4Y0WA 2QWPA 3Q23A 5L1JA 1Q8IA 1AZSB 3RAQA 3DM2B 1M90T 4JYAJ 2XLIA 4JBCA 3O9UA 1U26A 3I31A 3MEDB 3VETA 4NEYA 3E51A 2QW9A 1Z05A 5DDPC 1LFWA 3GG4A 3FVYA 7FDRA 3CDUA 2PYLA 4E3SA 3OL6A 1YBAA 2XMAA 4JI7F 4ZPTR 3VTIA 4KAZA 1RA7A 2G8UA 1GXLA 5ETPA 2GNKA 1FJGJ 4J5OA 4A8MP 3RBDA 2POKA 5CZ2A 3A3OB 1VQPN 3VAMA 2HBQB 1TL3A 3NH0A 3L0QA 3MF5A 3FSXA 3AARA 3NCIA 3IM8A 5D0RA 1LK7A 4GKJJ 3D6HB 1S79A 4OX9F 3ETOA 4YDUC 3DRPB 1W26A 4KIAA 1KLNA 1RT3B 5GMDA 2J0XA 3ZT2A 1RT6B 3I0RB 4H0YB 3FZMA 4A8OA 1S1UA 4DR1K 2XHBA 3FFKB 1BDGA 3PSFA 1GT8A 5HRPA 3VR1A 2IC3A 1F9HA 3R5DA 3ULDA 3EICA 2JLGA 2OTJN 3RBXA 1QVGM 3MXJA 4R25A 3M05A 3D7EO 4WQ4A 2U1AA 2R7TA 3KK1A 1X3NA 4B3RJ 2ATCB 5F9NA 3V81A 3EJMA 1N6QB 1S6QA<