1DTTA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-2 (pett130a94)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
543
structure length
540
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/transferase
molecule keywords HIV-1 RT A-CHAIN
total genus 126
structure length 540
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dttA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dttA05
1SUQA 2R8IA 3LPTA 3AO4A 2WRMA 3TAGA 5C24A 4H54A 4RNMA 4UQGA 1DLOB 5JXSA 3OYEA 1TKDA 3NGDA 4KPYA 3RB0A 3PVXA 2UVRA 3DRPA 2DPJA 4FS2A 1IH7A 1RT1A 2RPIA 3ZSOA 2ATLA 1QSSA 2FJVA 4O44B 4XIUA 4O55A 1ZBFA 3V9UA 1S1WA 4O4GB 4XPEA 4FK0A 4LSLA 4NCGB 2C28A 5KT5A 2IGIA 3K57A 5J2NA 1N5YA 5KT2A 1SH2A 3DOLB 3PW0A 4M3TA 3OJSA 1RA6A 2J6UA 4DTUA 4M3RA 1S6QB 3SNNA 1C0TA 3RAXA 4IQXA 3BSCA 3UPFA 4K4XA 3AO1A 2E4LA 4I2PB 2ASJA 4K4YA 4Y2AA 3OLAA 2HHTA 4TQRA 1XC9A 4ZP9A 4LSNA 1QS4A 2D41A 1WAJA 1B9DA 3AVMA 3RMDA 2IJFA 4BE2A 1SL2A 2Z1HA 5EWEA 1U4BA 3ULDA 1LWEA 1KLMA 2VWKA 3SFUA 3GV7B 4CFDA 2YNGB 3DI6A 3OYGA 4CIFA 4FLYA 3L2RA 3PW2A 4ED3A 3HVTB 1JLEA 3S9HA 2KTQA 3AVIA 3OL8A 2VG7B 1RT5B 1JLFB 4YR3A 5DQGA 4CJ3A 2R2UA 2BDPA 3THVA 4OKJA 3AVFA 5KFPA 4DTMA 3KMSA 3OLBA 5KFDA 1VRUB 3DLGB 5KRSA 2QKKA 2XCAA 4H4MA 3P1GA 1XR7A 2HB5A 2B5JB 3NMAA 1QUVA 4KHWA 5KG4A 4FBUA 3CIZA 4M3XA 5DGAA 4FM2A 5DG9A 4KHRA 4LSNB 2ILZA 3HYFA 5KG0A 2D0CA 3OS1A 2FVSA 4IOBA 5DK5A 1NHUA 2XI2A 4KB7A 3NHGA 1ZETA 3NH0A 4BE1A 1ZTTA 2F8SA 1JKHA 1KLNA 5DQHA 3OYHA 3KLEA 5CYQA 4EP4A 3DLEA 3ISNC 1Z26A 1TK0A 4JS5A 3DYAA 3KK2B 4MKAA 3FSIA 3HVTA 3PR4A 1LW2B 4IR1A 1RTHB 3SQ1A 3F9KA 3LP0A 2R8GA 1S6PB 5KFQA 4KHMA 2DPIA 3AA3A 4RW7B 4IRDA 4DU3A 3H5UA 5JUMA 4ECVA 1S9FA 2Z1GA 2HMIA 3LALA 1ZBHA 3MEGA 4TY8A 5J2PB 3VQ9A 4R0EA 2HHWA 2FBVA 1SV5B 2IJNA 2EX3A 4CIGA 2XGPA 4O3PA 5DLGA 4B3OB 3BQ0A 4I7FB 5HRRA 4K4VA 1C2PA 2HHUA 3G6YA 3DI6B 3RB3A 4DQRA 3KLIA 3MEDB 1WSGA 2XO7A 4YR2A 1JLEB 2HHQA 1EETB 3KLHB 4ED2A 3FFIA 5J2QB 4FS1A 3HJFA 3VQ5A 1RTDA 3QESA 2O5DA 1FK9A 4DU1A 4PWDA 3CJ4A 3VQAA 3QGHA 2O4IA 3HT3A 4YNQA 5F8LA 1Q9XA 1N4LA 4Q0BA 4WXOA 4RW9A 2R7YA 1ZTWA 3NF6A 4CCHA 4DFPA 2AGOA 2FC0A 5KFGA 4AHRA 2E6LA 3VQBA 2KQ2A 1IM4A 4CEDA 4KBIA 1TGOA 3ZT0A 5J2PA 4W5NA 4PY5A 4ZHRB 3U3GA 4RNOA 4JLHA 1K1QA 4OVLA 4CJKA 1KHVA 3V1QA 4IFVA 2KW4A 4CF0A 1QSYA 3V6DA 4KREA 1TKZB 1WN7A 1TKXB 3M8RA 2R2SA 4EBDA 4IDKB 3QEVA 4Z4FA 3KLEB 1S9GB 2R8JA 3V4IB 4B9UA 1S49A 4CJUA 2OPSB 2I5JB 1RTJB 4OGCA 1TK5A 4F4XA 2OPQB 1S6PA 4J2DA 1S1TA 4LSLB 4KTQA 5T7BA 4C8LA 4WZQA 1LWFA 3TAPA 3CQ8A 5CZ2A 4PWDB 5L1JA 1OS5A 3NAEA 5J2MA 3GIJA 3AVBA 4BE0A 3NBPB 5C42A 4H4MB 3OYMA 4OLAA 3AO3A 4ID1A 3L2WA 3SQ4A 3RR7A 5HP1A 2AX0A 3LP3A 3QEPA 4KV8B 1C1BA 5HRSA 3L2UA 4AH9A 4O3QA 3QIOA 2D3UA 5DQIA 5F8MA 3TWHA 4NLYA 4ICLA 3MXMA 4DL5A 1RCHA 4IFVB 4FJHA 3VQPA 4CEQA 3O3FA 3OS0A 3KLGA 3DDKA 5DMRA 1D9FA 3KKRA 3RMBA 2Z1JA 1UWBB 4TXSA 1LV5A 2BANB 2W9CA 1NK8A 1RYRA 1S5JA 2FVCA 5J1EB 1RA7A 1B92A 4FJXA 1S1UA 5FRNA 2PZSA 1LWCA 4KI4A 4KB1A 3ZT4A 1WNEA 2VG5B 4E0DA 1O1WA 2OPPA 4CHQA 4O3RA 1TVRB 4FLXA 4OLBA 1SKRA 4H8KA 3V1RA 1RT6A 2E9TA 3PX0A 4WXWA 4CK2A 4K4ZA 2YNIB 2RDJA 2I1RA 1JLBB 3RRHA 3T5JA 5KRTA 1GOBA 4DFKA 3I8DA 4I7FA 3A2FA 3I0SA 4O3SA 1JX4A 4M45A 5L1IA 3KLFB 3C6UB 3SV3A 2R8HA 4E7IA 4NLDA 2WB4A 1L3TA 4YQWA 4G1QB 2KZMA 1D8YA 4ZPCA 4NLWA 4ZPDA 1C1CB 3UR0A 3LZJA 4WE1A 4KHSA 4CF9A 3QEIA 3KLVA 3QIPA 3H5XA 1NJZA 2W42A 2BQUA 2DFFA 3M8QB 3DMJB 3VQ7A 4JRPA 1HJRA 4CJRA 4HKQA 3CM5A 5HROA 2WONB 4J9NA 2FBYA 1S6QA 4E19A 1KTQA 5C42B 1BIZA 2ETJA 1GX6A 2GUIA 1GOAA 3QGGA 1RT2B 4WFYA 4J9PA 4B9MA 2XI3A 3BDPA 1BCOA 2Q3SA 3C95A 1VSIA 1C0UB 1S1XB 3CVKA 1HMVB 4FBTA 2AJQA 4FVMA 3DRRA 3E51A 1DTTB 1NK9A 2IM3A 3MXIA 1J54A 3PUFA 1U45A 1FKPB 1BHLA 1Y97A 4FJGA 4CHYA 2W9BB 3CM6A 4IFYA 1XHZA 3BSAA 3Q8RB 4F4ZA 2KFNA 4M3ZA 1D0EA 3RMCA 1SL0A 4DEZA 2W7OA 4URQU 4CEAA 2IM1A 4RUCA 2VG5A 4HTUA 3SZ2A 1N6QA 1WSHA 3WNHA 4F3OA 3OYDA 5KFKA 4I2PA 4CJSA 3OYAA 4ECRA 1ZBLA 1JXBA 2ALZA 3O3GA 3L2VA 4WFXA 4QW8A 3BQ1A 1T03A 1JLGB 3IGNA 3JSMB 1ITGA 2KFZA 3ZSYA 1W0HA 4H4OA 3I0SB 3FDSA 4Q43A 1G15A 4C8MA 5HRNA 4ECUA 4EYHB 4FJ5A 4N76A 3FQKA 1WSJA 1VSDA 2YHBA 1LW0A 3IGVA 2XY6A 4QWAA 3CFOA 1F21A 1U49A 1LAVA 1DTTA 4IKAA 5D3GA 4N5SA 3ZSRA 2E9RX 1NK0A 4Z4EA 3HKWA 4YP3A 4IH5A 1A5XA 1A5WA 3D5MA 5KFBA 5DG8A 5F8IA 4F4KA 3LP1A 2R2TA 1EP4A 2J6SA 3VQEA 3SUPA 1RTDB 1IO2A 1HPZA 5CYMA 1HQUA 5KFTA 4JUZA 2GBZA 3BQ2A 3H4BA 4DQIA 4YR0A 1K6YA 2ZE2A 2B5JA 4Z0UA 5I42B 1IKWA 2X78A 3QERA 4ELVA 2W9AA 5FDLA 4CEOA 4KO0B 3AO2A 3HM9A 3MFHA 4DG1A 2YNFA 4ZPAA 1SV5A 3TVKA 1IKXB 3PJXA 1RYSA 3O3HA 1JL1A 1RAJA 4OJRA 2UUWA 3P83D 4B8AB 4IH6A 2QK9A 1YVUA 4J2BA 4QWCA 2ZKUA 3U3YA 3SUNA 3WNFA 2Y1JA 4LY7A 1CXUA 4NYNA 5F9NA 2UVVA 4E7JA 4CJ4A 1TL1B 1S9GA 1R0AA 3N6MA 4WZMA 1MU2A 4FM0A 5J2QA 1T05B 3AVNA 2GV9A 4NLUA 1RTJA 3MEEA 3PO5A 3TAEA 4ZVGA 4KHUA 3ITHB 4Z4HA 3H59A 3M9NB 3PX4A 1XHXA 2V9WA 4E1NA 2IM2A 4JRQA 5C5JA 2XY5A 4NLXA 5KFRA 4JV1A 4K8XA 4M3UA 3BGRB 5F8GA 3LP2B 1KVAA 2ZE2B 4OGEA 2LSNA 2D7SA 4CK3A 2F8TA 3RMAA 4ZHRA 4DSIA 5F9LA 1VRTB 4F2RA 1S1VB 1N56A 4LQ9A 3DRRB 1ZYQA 4ZTFA 3T5HA 2BGGA 2G8UA 3H5SA 5HRPA 3ZSXA 4ZP8A 4CFAA 4FW2A 4FLVA 4O3NA 4Q8FA 3FQLA 1BQNB 3TR8A 1WSEA 3MXJA 1KFDA 2FBXA 3KNAA 3OHAA 5KT3A 2J6TA 4Q5VA 4DU4A 3CFRA 2W9CB 3PO4A 3HXMA 2G8IA 2AQ4A 4BWJA 1QHTA 3HPOA 1VSFA 1TL3B 4CEFA 2OZSA 3CJ0A 4KKOA 3I5AA 4CECA 3P5JA 2HNYB 1QE1A 4W5OA 5L9XA 3K2PA 4J9QA 1RDDA 3G6XA 3IS9A 3T5LA 1RBTA 3T1AA 4DG1B 5KG6A 3K5MA 4O4RA 4DLGA 2AX1A 4Q44A 3ZSVA 4CK1A 1TKZA 2A1RA 3GILA 1J5OA 3OSPA 3DRPB 1RBSA 4BDPA 2GIQA 3H4DA 4R8UB 5KFMA 4DQSA 3VQCA 3NDKA 3KOAA 4MK8A 2AWZA 4F4WA 3OY9A 3EYZA 3V9ZA 4QWBA 1KRPA 4PQUA 1S1WB 2DTUA 3ASMA 2W7PA 4RG8A 4Y34A 4CGDA 3LP1B 1N5YB 4RU9A 5F8NA 5HLFA 3MEDA 1R0AB 4KHNA 1S1TB 1EXQA 4DF8A 4K8ZA 4ED7A 1EETA 4ED1A 3QIPB 1VSLA 3OSNA 2AGQA 1LWCB 3M9MB 3KK3A 1TV6A 5EUHA 4KAZA 4LD0A 3NBPA 1HQEA 2C2RA 4K50A 2HMIB 4JS4A 4KKOB 1Q9YA 4N56A 1ASUA 4AHVA 4FLTA 4FJIA 4BDZA 2WTFA 2YNIA 4J2EA 1RDBA 2A1SA 3NKYA 4FCYA 3LPUA 4NLRA 3QLHA 2P5OA 3T5KA 4F8RA 3NL0A 4DSFA 2JEJA 3AVLA 1KHWA 1JLGA 4Z4GA 4OPKA 1W25A 3V81A 5I3UB 2C22A 3VQ4A 4FLUA 5KG1A 1Q8IA 4RNHA 4YFUA 1BQMA 4QAGA 2OA8A 5EDWA 3SI6A 4ECZA 4DTOA 3QIDA 4CEZA 3N6NA 3M9OB 4DSJA 3RWUA 3SPYA 3ISND 4O4GA 1BL3A 4OL8A 4IG0B 3CDWA 2V4QA 4E7HA 4ECYA 4IRCA 4DL4A 3MFIA 3VQ8A 3QYYA 4KHYA 3OHBA 4EZ6A 3LAKA 4RNNA 1KSPA 4B9NA 4XO0A 1RT2A 3IS9B 3OS2A 1S1VA 4Z4IA 3K5NA 4KAIA 4CJWA 5KFCA 2BRLA 2W8LA 4KO0A 2ZQBA 4IRKA 3G10A 3KJVA 5KFFA 3S3MA 3KLFA 1IKVA 1U47A 1VSHA 4DTJA 2ASLA 2XCPA 3K58A 1X9WA 4I2QB 1JLCB 1SL1A 4CJ5A 3E01B 4IDKA 1QSLA 1JLQA 3NGYA 1VSMA 3Q8PB 4DQQA 5KFZA 1W9HA 3UQSA 3MECB 4M42A 4BACA 3BSOA 5J2NB 5KFNA 3SI8A 2OPQA 4U6PA 1IKYB 4RW7A 2IS3A 1TV6B 1NNDA 3CDUA 4CF8A 3D28A 2BQ3A 1RBRA 1SKWA 4IBNA 2Y1IA 2IAJA 3SQ2A 4FJLA 3D45A 2YNHB 2PYLA 4TY8B 4J9RA 1L5UA 1TAUA 4NLOA 4MK9A 1Z25A 2AGPA 4URSA 4MKBA 3VA0A 3KMQA 3KD5E 3OYJA 4ZTJA 1VSEA 4ECXA 1HMVA 3HVWA 5EU7A 3H2LA 4E3SA 5JS1A 4RW8A 3CJ5A 1LW0B 3OYBA 3KJVB 4ZVHA 1NOYA 2G8FA 2BRKA 1RDCA 2G8HA 2JEFA 3UDLA 3HPGA 2OH2A 1SH0A 4DS4A 3C6UA 3DLBA 2BE2A 4F3TA 2VA3A 4GMJB 4Q8EA 4K4SA 3QNNA 3OYFA 1UAXA 2B6AA 1UWBA 5KFXA 2HW3A 3NF7A 4CF2A 3FRZA 3OJUA 2OPRA 4PA1A 1I39A 3V1OA 3DOLA 4EBEA 4IG3B 5SZTA 3AVGA 4IG0A 4CJQA 1WAFA 2D0BA 3CJ3A 3QEWA 1HRHA 3ICLA 1VSJA 1JIHA 4M95A 4WYWA 4NYZA 5HROB 3K5OA 3AVHA 5FDLB 1RT6B 4G3IA 4I9LA 1IKWB 3MR3A 4DTRA 1IKXA 3LZIA 4KFBB 5KFVA 2QE5A 4DSKA 4DS5A 3QGIA 1D9DA 3V81B 1T94A 4KRFA 3GV8B 2HNDA 3NE6A 3PV8A 3PY8A 2ZD1A 3IRXB 4ZPBA 4MFBA 1I6JA 5L1LA 2FLLA 2XY7A 1UA1A 3M8PB 1BCMA 2VG7A 2BANA 1FKPA 4FZXC 3RB6A 1MU2B 4RW6A 3SPZA 4CEBA 3I0RB 5HLFB 3G6VA 4B9LA 4NZ0A 4IKFA 5KT7A 3B6PA 2E9ZA 1L3UA 3NGIA 4NCBA 1VRUA 2YNHA 3DOKA 3NFAA 1DTQB 4NYFA 3PR5B 1X1PA 3VA3A 3Q8QB 4X2BA 5DGBA 2F8EX 4K4UA 3RTVA 1JLAA 4RW9B 2F96A 4NLSA 1QTMA 4HUGA 2EHGA 2IC3B 3EPGA 4EO6A 3QZ7A 1C0UA 2XWYA 4KSEB 5KGWA 4LH5A 1S9EA 2JGUA 4CGJA 3DRSA 1J5OB 4CFCA 4CE9A 1J53A 2IDOA 4IR9A 5KFOA 2JEIA 2YKMB 2FVPA 4DL6A 3F73A 3KLIB 4J9SA 3EZ5A 5KFYA 2D3ZA 4E7KA 1LWEB 2YKNA 4MIAA 3MEEB 1IKYA 4U7CA 1BGXT 1WSFA 2HAIA 4OPJA 5KFAA 3KHHA 3DMJA 4CHNA 2IAJB 1X9SA 1REVB 2DFHA 1SH3A 2WONA 4K4WA 1HYVA 3VN5A 2KZZA 1JLFA 1RT4B 4DTNA 3V9WA 1NK7A 4Q0BB 3TARA 1HQEB 3BGRA 1BISA 5KG5A 2CJQA 2NUBA 3LAMA 4CHPA 3GV5B 4ELUA 4MIBA 3RBDA 3TAQA 4ECSA 3TAMB 3CJ2A 4LH4A 4DFMA 2HNDB 1WSIA 3V6DB 1U09A 4ICLB 4AILC 5FROA 3IG1B 4ED8A 5K14A 5D3GB 3LANA 4TQSA 3RRGA 3ALYA 2RDIA 5KFWA 3ZSWA 2YNGA 5KTQA 3FFIB 4NLGA 3OYIA 2QKBA 4QPXA 1HNVA 1NKEA 3BJYA 2OPSA 4DL3A 5KI6A 3MAQA 3TI0A 1TAQA 5C25B 3KKSA 1BI4B 3PW4A 3I0RA 2XHBA 4AHUA 5L1KA 1CSJA 1RTHA 1T7PA 4ED0A 5KT6A 4TYBA 2XGQA 1VK0A 4FJ9A 1LWFB 3ZT1A 3GQCA 1FKOB 4FYDA 4NLVA 1ASVA 3DOKB 4I9QA 1BIUA 4CGFA 3HP9A 3TANA 2FVQA 4NLQA 2FLNA 1C1BB 2X6NA 4QOZB 3LP2A 3GIIA 4AHCA 3KIOA 2YNFB 1FXXA 4EBCA 5DLFA 2B43A 3AVKA 1NK4A 3T19A 1NJYA 1XR6A 4JV0A 3AA2A 1RT1B 1KLMB 4YMEA 3U6FA 4R5PA 3RAQA 2YKMA 4CF1A 4E89A 4HVJA 3MR6A 3K59A 1CLQA 4MH8A 3TAFA 1TL1A 4W5RA 2WHOA 3QINA 4PUOA 1RT3A 1HYSA 1EP4B 3DYAB 4DF4A 3T3FA 5KFLA 1CZ9A 4DFJA 5F8JA 4J2AA 3BR9A 1TKTB 1YVFA 4O0IA 3DLRA 3ZSZA 3B6OA 4RUAA 4FLWA 3HO1A 1TL3A 2V0NA 1TVRA 2IBKA 2RN2A 3AA5X 1T03B 1S97A 3IAYA 4J9MA 4Y1DA 3AV9A 3MR5A 4DQPA 3BSNA 2CKWA 4Y2CA 2FVRA 4RW4A 3TAMA 2HVHA 4ZVEA 3PW7A 1RTIA 3IN5A 4QCLA 3CO9A 3V6JA 3NGZA 2G8VA 1XWLA 1DLOA 4ID5B 4N41A 1S0MA 4E7LA 2WOMA 2W8KA 1YTAA 4HHTA 5CYQB 4ECWA 4E1MA 3E01A 3K5LA 1C1CA 2BR0A 1KFSA 4Z4CA 5CZ1A 4EYIB 3QEXA 4FW1A 2B6AB 4ZMMA 1B9FA 1RT7A 3LWMA 1JXEA 2FJXA 3WNGA 5CYMB 4CHOA 3M8QA 4RNFA 2DY4A 3OL6A 2HVIA 3GIMA 1HNIB 5DG7A 4FJJA 1TK8A 4EZ9A 2UVUA 4M3WA 3KHRA 4TYAA 3AVCA 5J2MB 4ZP7A 2ASDA 3MEGB 1EX4A 1C0TB 3TABA 4GC7A 1Z4UA 3NCIA 3PJWA 3M8SA 3KHLA 3SJJA 5F8HA 3HSTB 1IKVB 4O3OA 3OVNA 1X9MA 4TY9A 5C24B 4CIEA 1MMLA 3QLHB 3C94A 2P1JA 1S1XA 5KFHA 1T8EA 4EP5A 1KVBA 4FLZA 1JLCA 5KG7A 4G1QA 4Y3CA 2O4GA 1TP7A 4URGA 4FJNA 4GW6A 2WOMB 3ZCMA 2BE2B 2BQRA 1KCFA 4TSXA 5HBMB 5C25A 5KT4A 1A5VA 3LDSA 3KLHA 4ZP6A 4K4TA 4HCCA 4F50A 2YHAA 3BREA 4FZZA 2P51A 5KFIA 4B9TA 4M3YA 5E41A 4QW9A 3DM2A 4TN2A 4KB0A 1JXLA 1NKBA 1N6QB 1UOCA 1NOZA 1JL2A 1XR5A 3HVAA 1CXQA 3AO5A 1N48A 3VQDA 1C6VA 3S3OA 3SQ0A 2OPPB 3L3UA 3PHEA 1WNSA 3KK1A 2UUTA 4KFBA 3HVRA 4CJPA 4RW4B 4CFBA 3OL9A 1NK5A 4KV8A 3JSMA 1JLBA 1L3VA 2QV6A 4CJVA 3L3VA 2V4RA 3MF5A 1HARA 3M8PA 1RBVA 5KFJA 3VQQA 4B9VA 1S4FA 4O44A 4FK2A 5KG3A 4PUOB 2VWJA 4CJTA 1L3SA 3V4IA 2OPRB 5KFSA 1ZBUA 3CYMA 4TLRA 3WNEA 3V6HA 4DTXA 2OZMA 3HL8A 1U04A 4NCAA 3I5CA 1RT7B 3KK2A 3OYLA 4WE1B 2IMWP 4ED6A 4HCBA 4FK4A 3LP0B 2FLPA 3EZUA 1S1UB 2VA2A 1BI4A 2HWHA 2X6SA 4W5TA 4B8CA 3G86A 3H5YA 2VG6B 3DM2B 3CWJA 3CFPA 5KFEA 1JLAB 4BDYA 2RF2B 4KHQA 4GC6A 3PW5A 1T3NA 1K1SA 4MK7A 1RDAA 3UIQA 4CGIA 1D1UA 3PX6A 4J9KA 3OL7A 4J9OA 2IOCA 3DRSB 2JC0A 1RBUA 4R8UA 4MFBB 5I3UA 3C6TB 3SV4A 3HHKA 1TQLA 3MR2A 3SUOA 1BQMB 1D5AA 3EPIA 3KLGB 1JKHB 3O4NA 4I2QA 3DLKB 1IG9A 2PYJA 4C8NA 3RBEA 1C0MA 4R5PB 3DLEB 4DSEA 2ATQA 3SUQA 3S3NA 2C2EA 4BWMA 3RB4A 5CY4A 1RT5A 1LW2A 3OYNA 5J1EA 4IFYB 3MECA 1BQNA 3KK3B 3JYTB 1NK6A 1T05A 1RT3B 1REVA 1HNIA 4KTWA 1HQUB 1C1AA 2WK4A 1UA0A 4CGGA 1XI1A 4B08A 4O0JA 2WCXA 3RR8A 4WYLA 2ILYA 3VQSA 2D5RA 3NH2A 4OKEA 1RT4A 3H08A 2FJWA 1QAJA 4B9SA 1J9AA 3NAIA 3L8BA 4HYKA 3MTKA 3KK1B 3O4QA 2JLEA 3QETA 1HYZA 1EKEA 2QXFA 3G0ZA 3D0PA 4RW8B 2ITGA 2UVWA 4JV2A 4M41A 2G8WA 1RDRA 5SWMA 2Z1IA 4F2SA 3GIKA 5KG2A 4DL7A 3KD1E 3AVJA 3SFGA 3ZSQA 2XY8A 3PZPA 5K14B 4ELTA 1NJXA 3NF8A 5KFUA 5T14A 4EO8A 4FJ8A 2OYQA 3DLKA 4CESA 3QO9B 3DLHA 4N47A 4W5QA 1VSKA 4QWDA 3NH1A 2I5JA 2IM0A 3AA4A 4IG3A 3JYTA 4HUEA 1FK9B 2JEGA 4EEYA 3QNOA 3HPHA 2HWIA 4QWEA 1FKOA 1LAWA 3EY1A 4FJ7A 3HP6A 4DL2A 2VG6A 2XRIA 3OYKA 3KHGA 1SKSA 1YTUA 1QE1B 2RKIB 1VRTA 5EWFA 4Y1CA 4FXDA 4OKKA 5EWGA 1SUQB 2R2RA 2HHSA 3VQ6A 2IC3A 1ASWA 1NKCA 4C8OA 4F4YA 4Q45A 3H40A 3GYNA 4DTPA 2D0AA 3C6TA 4ECTA 2HHVA 1NJWA 3IRXA 2ZD1B 4DMNA 1S0OA 1TKXA 4ID5A 3N6LA 2X74A 3CG7A 2W9BA 3LWLA 2HNZA 1HNVB 4MQ3A 3SYZA 1HYSB 4KI6A 4NCGA 4RW6B 2DFEA 2YV0X 1QQCA 4CERA 1QAIA 2E6MA 1YT3A 4NLPA 1S10A 4DTSA 2EC0A 1ZBIA 2AU0A 2JC1A 3H98A 2HHXA 4NLTA 4RZRA 1NHVA 2RF2A 3V9XA 4J9LA 3ZT2A 4AHTA 5HP1B 4M94A 1RILA 4GVMA 4H4OB 2P5GA 3SCXA 4B3OA 3ZT3A 2GIRA 4CHZA 4ECQA 3L2QA 1S9EB 1RTIB 5JS2A 2G8KA 2B4JA 1CZBA 2PY5A 4CJFA 4DWIA 4PQUB 5FRMA 1KVCA 1S48A 3NF9A 3HK2A 4KTZA 2R8KA 3CDEA 4CEEA 3QO9A 3KTQA 3IG1A 4FJMA 4XPCA 2HNZB 1GOCA 2FBTA 2YKNB 1JLQB 5HBMA 1RNHA 1WLJA 3V6KA 4HUFA 4LQ3A 3QZ8A 1TKTA 4FM1A 2GC8A 1S0NA 4NRTA 2IA6A 1HPZB 4ZVFA 4CJEA 1DTQA 4C8KA 3ITHA 3Q8SB 4KE5A 1U48A 4DSLA 4FZYA 3I5BA 4NRUA 3OYCA 3V9SA 2XC9A 4L8RB 2C2DA 4DLEA 3DLGA 5KGXA 4IH7A 4AHSA 4O5BA 1I3AA 3TQ1A 1GX5A 2RKIA 5I42A 4CGHA 4CJLA 4FJKA 4WFZA 3NAHA 2HNYA 3AVAA
chains in the Genus database with same CATH superfamily
1SUQA 3TA2A 4LRCA 3TAGA 3C15B 4ANCA 2QWNA 4NXMJ 1TFYA 1IWGA 5DRKA 3SAGA 2F9JA 2Z56B 3ID8A 1X4EA 1E4FT 3M2RA 2BE7D 1IH7A 3AODA 3P31A 3BH7B 3CCMS 4O44B 4XIUA 4O55A 1UL3A 1ZPVA 4DV1K 1S1WA 4IDHA 5AE3A 3J7Z5 5HMZA 4ZLNA 2C28A 5KT5A 5BREA 4X4VA 3MMBA 4M3TA 1XNRK 3DNCA 3DXBA 2XB2D 1S6QB 1HNZJ 2X7IA 3RAXA 4IQXA 3BSCA 4K4XA 1DURA 3AO1A 2E4LA 2FYXA 3BV8A 5L46A 5F0WA 4Y2AA 2NLXA 5HMXA 2HHTA 4P75A 4ZP9A 4HACA 2XHWA 2J7KA 1PGZA 2XBPA 4C9DA 4BE2A 1NEEA 4FWLA 3C6HA 2F4VF 3J80U 4JI3J 2VQEJ 3ULDA 2VWKA 1P9QC 4E2FB 4LR7A 3SFUA 3VGUA 4CFDA 2DNMA 3WX4A 3BS9A 3OYGA 4FLYA 4FXWA 2FJEB 3LOUA 2B4VA 3AVIA 2VG7B 2VWBA 5BRDA 2UYTA 2NPFA 2ADCA 1K8AT 4NPOA 1JLFB 2P2CB 1FEHA 2R2UA 3FJ2A 2FC9A 4ZVRB 5I4MA 3LF0A 4DTMA 1WKKA 5GAHU 2KM8C 2NCKL 2WVCA 5KFDA 1VRUB 3U4LA 2YHYA 5AQYA 5KRSA 1NGCA 3P1GA 1WHVA 2FGCA 4FNIA 5JMVA 4KHWA 3O2IA 1M5VC 4O5FA 5DG9A 4KHRA 1ZXOA 3NNHA 5KG0A 1ATNA 1WC6A 1H0HB 2HQFA 3T69A 4IOBA 5DK5A 4A47A 4KB7A 3IFRA 3QFUA 2GWKA 2NLWA 1ZETA 4A5BA 4BE1A 1ZTTA 2F8SA 1KLNA 3CMQA 3GJQB 2V6AA 1S22A 2KXFA 3CCSS 3S41A 4MMOA 3DYAA 1WI8A 3R9LA 3FSIA 1U24A 5E26A 2IYGA 4OYWA 1W2BM 2R8GA 4LT6A 1WJ9A 1MMDA 4OHVA 1RHRB 2BJDA 2ZEJA 4RUBA 2F3JA 3MAAB 1FWPA 4DU3A 2ASMA 1E6YB 2R7VA 1S9FA 1CC8A 4BR7A 4OYXA 4PKIA 3DGVA 4OHWA 3NS5A 1H72C 3JSRA 3P49B 1F5AA 1SV5B 1WG4A 4A2AA 4UY85 1IBMF 4C1NI 2IJNA 1CQNA 1VI7A 4DR7K 3ZTRA 2XGPA 1SJFA 1Q7LB 1V6HA 3UNGC 4K4VA 4KQZA 4A46A 3W2WB 3DI6B 4DQRA 1YRUA 5IXUA 2B8QA 1FESA 3D9BA 2HQDA 1V3ZA 2XO7A 3HBTA 2HHQA 3SCJE 2NYHA 2QA4S 2OEKA 4ED2A 1HL6A 5J2QB 4FS1A 2HHHF 3HJFA 4FWRA 1PCAA 2O67A 2RHKA 1ZM2A 2PEHA 5KQDA 3QESA 1PJ6A 2O4IA 2PA8D 4YNQA 2F5GA 2AJFE 5BYQA 4Q0BA 1S72N 4WXOA 4RW9A 1N34J 3H1QA 4CCHA 2AGOA 4PXCA 1F2HA 3CERA 3VQBA 2ZH5A 3CF5L 4H4KA 4AD6A 5DDPC 1AROP 4K5RA 5A8RA 1TGOA 2H48B 5J2PA 4PY5A 4FWSA 3ZEUB 4JLHA 4OVLA 2PMWA 3MD1A 3Q8VA 2KW4A 1QSYA 3JSBA 1Q81T 3TW0A 3T9NA 1TKXB 1YF5L 3M8RA 2QWQA 4GY2B 3QEVA 1HNXK 2HKEA 1GLEG 1Q81O 4RL1A 4WU3A 1F9HA 4OGCA 1TUGB 2LMIA 1S1TA 4KTQA 2DNGA 1FX2A 3TAPA 4AUKA 4AF1A 5CZ2A 4PWDB 1OY9A 2EI5A 2J9CA 4OLAA 3QBCA 1K44A 2ZJRL 2NRVA 2R7SA 2N3OA 5HP1A 2V5HG 4GRSA 3LP3A 4LMZA 3QEPA 4KV8B 4AH9A 3X1LB 2QWLA 3TZZA 4ZVUB 1VYAA 4GV6A 3PIOQ 5JMNA 2CNNB 2R42A 2EFQA 4CH0S 3VQPA 2D4WA 3ID6A 4CEQA 3KLGA 2WVEA 2JFDA 3ETMA 1D9FA 2OMOA 2QC3A 2ZFHA 1WG1A 1LV5A 1NK8A 3UW1A 1NMEB 1VFJA 3MM7B 4X66J 1XUPO 1FW6A 4FWKA 1LWCA 1VLYA 3G4SN 3JXOA 3T6BA 5CYJA 3J81Y 4E0DA 4FKYA 2ZKTA 4HLBA 1SKRA 4H8KA 1MA9B 4LF5K 3GJRB 3CCRN 2E9TA 1U1QA 3PX0A 4CK2A 1KEKA 3FFKB 5ITHA 2I1RA 3RRHA 5KRTA 5E0OA 3C14A 3LW5C 3MOZA 1QTNB 3I8BA 2FQQB 2P9KA 4BHQA 1JX4A 1S7IA 1CJUA 1U1NA 1FWLA 1FDNA 2E7VA 2LU1A 1HBNA 3FZMA 2Y3YA 3H8YA 3QNWB 3CJQA 4ZN3A 4M5GA 4OYZA 2LP4A 4JD2B 3UD4P 3H5XA 2W42A 5HATA 4JI7F 3DMJB 3P4UB 1GLFO 4JRPA 4CJRA 3CM5A 5HROA 4J9NA 4E19A 4B1WB 4LF1A 3D0IE 4PYAA 3AOAA 2PEBA 2PO4A 4UOCA 3BP8A 1XNQF 3GJSB 2CQ4A 4OYBA 5AQQA 3D68A 4NB4A 3C95A 4FDFA 1RHJB 1TL7A 2AJQA 4JYAK 3DRRA 1PAUB 4BRKA 3E51A 4ATNA 3OHRA 2I7PA 1NK9A 2IM3A 1J54A 4BVPA 1U45A 1BHLA 2B56A 4CHYA 3P38A 4YOXA 2OEJA 1IR0A 4OI0A 2O8EB 2E20A 3Q8RB 1DQ8A 1IVZA 3RMCA 1RSCA 1NGIA 1OYEA 3B8HA 4URQU 2W7OA 4HTUA 3CCEN 4I68A 3WXLA 4DV6F 4EHUA 2G0IA 2CGJA 1JXBA 3TUIC 4HEA9 5DZ7A 4B3RJ 1JLGB 2P6TA 5D4NA 1ITGA 5GMEA 3GTYX 4L73A 4FWMA 3AD9C 3FDSA 1G15A 4C3LA 4GKKK 4O23A 1P8ZA 5HRNA 1VQNS 4FJ5A 2K1RA 1VSDA 2VOPA 4YHHJ 4QWAA 1F21A 3T1YK 5D3GA 1RWVB 3AY9A 4XDCA 1WOOA 4OPHA 3LL3A 1A5WA 3D5MA 5DG8A 3W9JA 3MM7A 4F4KA 4CYUB 1WDDA 3F2KA 2M3DA 4DR6J 1N8RT 5JLHA 2EEYA 1EP4A 3VVTA 3H1VX 2XTJP 2OTLS 3CW2C 1RTDB 3A8YA 4FPBA 3TZYA 4ID8A 3PRDA 5KFTA 4JUZA 4DQIA 4DV5J 1K9MT 4YR0A 4X65J 2ZE2A 2B5JA 1EJ7L 4Z0UA 1SJ1A 1IKWA 2MKHA 1BY9A 3H7HB 4KO0B 4OHYA 3DGPA 3TVKA 4JV5K 1DGKN 3O3HA 1K9MO 5A8RB 5LMUK 1JL1A 2B8PA 2NUHA 2UUWA 3EUNA 3TA0A 4OX9J 4M7YA 3QAUA 2QK9A 2FHOB 1E4GT 5B0DA 4J2BA 3MM6A 3SIPB 4FWOA 3T1HK 3SUNA 1KAYA 1LWXA 4LY7A 3GFZA 1I94K 2UVVA 2KRBA 3N6MA 1RADB 5BRFA 1X5SA 4FM0A 5J2QA 4KIAA 3MX2A 1CS4A 3TAEA 1W7AA 3H59A 5I3QA 3PX4A 4JI5K 2V9WA 4AQYF 5C5JA 1S6OA 2CH6A 4ED5A 4K8XA 4M3UA 1KN6A 3BGRB 4KH0B 4BVOA 3OR1A 4LQ9A 2GJ2A 1VBYA 4CD1A 1DARA 1XTZA 4ZTFA 3T5HA 3GYXB 2JLFA 1H3DA 3M8WA 3O08A 4ZVSB 2G8UA 5CAAA 4QR1A 3PRBA 2P9PB 3D1OA 3US5A 4Q8FA 1WSEA 2MQLA 4ISEA 5KT3A 3MDQA 2QL5B 2GWJA 3LUYA 1N32F 4G1PA 2AQ4A 1YSJA 2GQ2A 1EZZB 4PG7A 9RUBA 4WFNL 3KJFB 4E98A 1JJ4A 2OCEA 1LK7A 3VR1A 2L3MA 1QE1A 4W5OA 5L9XA 3K2PA 4OYPA 4J9QA 3IS9A 3X3UA 1RBTA 3LO3A 4BREA 2QSWA 1M1HA 3K5MA 5KG6A 2Q1NA 3M5RA 4FN5A 3ZSVA 3J7ZT 3FBEA 1TKZA 3ZETA 1RBSA 4L75A 1Q53A 2BEFA 3ENVA 4QIFA 1VQ4S 5LXYA 4DQSA 4RJVA 3CT9A 1X4GA 2HK3A 4QWBA 2VPWB 1DBDA 2XHCA 4RG8A 3CJ9A 4CGDA 4ZVOB 7FD1A 5A0YB 3MEDA 1R0AB 3KG0A 4ZIVA 2GTDA 4U67L 2GQQA 1VQ7S 3MHYA 3HFVA 2XMJA 4X4OA 2HBLA 3NBPA 2Z0GA 1U2VB 3SBTA 4JYAJ 3TU5A 5CCLA 2HMIB 4JS4A 1VQPN 1ASUA 2GVDB 1IBKF 4FLTA 4K43A 4BDZA 3DCAA 1JXVA 3NKYA 1GLDG 2P5OA 4F8RA 3MMAB 2C3MA 4X4NA 4LF2A 5C7PA 4F3MA 2DNPA 3HSJA 2JEJA 3AVLA 3BN4A 1JLGA 2QI2A 4OPKA 5I3UB 5AE2A 3DXSX 2MSTA 4YFUA 4X4TA 2CQBA 4YN3B 3SI6A 2GO9A 2CPYA 3QSYB 3D4JA 4WJBA 3N6NA 3DWLA 7AT1B 3WQUA 4V19X 1FX4A 3RRKA 2V4QA 4E7HA 4ECYA 4IRCA 1ULRA 2RVJA 3VQ8A 4XK8C 2VQEK 4EZ6A 2J8SA 3SQGA 1KSPA 4B9NA 4XO0A 5F3ZA 2GIFA 4NL5A 3IS9B 4IXCA 3OS2A 4O0NA 2CZVC 5IV4A 2E2QA 2EKNA 2FXUA 1M5HA 4Z4IA 3BGOP 5IT9Y 4CJWA 4LJMA 2EK6A 1YIJS 3G10A 2ZZMA 2MKKA 2R7OA 4Y00A 3KLFA 1U47A 2LXIA 2CVIA 1QLNA 2HS4A 1YHQS 1SC1B 1FNMA 2J9DE 4HHJA 1YJ9N 4CJ5A 2AMCB 1JLQA 5SUHA 3Q8PB 5AXLA 1W9HA 3MECB 3W64A 1P8GA 4M42A 3UN3A 2KHOA 4HT7A 5T7LA 3SI8A 2OPQA 4CZCA 1IKYB 4CF8A 3CDUA 1NNDA 2G2ZA 2GUPA 3OTEA 3M32B 1SKWA 2IY5B 2G9OA 1PILA 3CB4A 3UKRA 2NXNA 2Y1IA 1V3SA 2GS8A 3SQ2A 2H5EA 1YJ9S 2MJNA 1H1VA 1EWQA 3GFYA 5HVFA 1XIQA 1Z25A 3HZ6A 2YHWA 2RT3A 4MKBA 2XLJA 4USHA 5C2CA 3VA0A 2XMVA 3K0SA 3HVWA 4I6YA 5EU7A 2WTUA 3BZKA 4FYWB 4RW8A 5F1XA 3HKZD 4I0WA 1LW0B 2G8FA 2C2MB 4J8FA 2P9CA 3OR2B 3CPWR 3IR7B 3ATVA 2JEFA 1HHSA 4Z7YA 1R6VA 2LA6A 1NSQA 1YAGA 4LFCF 1NZ8A 3QMQA 4GMJB 1ICEB 2FSJA 4CTAA 5AXKA 1OVYA 3HCXA 5KFXA 2HW3A 2CZ4A 1R8BA 4AXIA 4CF2A 3FRZA 2OPRA 4ZPTR 3V1OA 2NXJA 3W0LA 2DGSA 4IG0A 2AHOB 3ZFVA 1XJWB 4DZ6A 2MKYA 4M95A 2BKPA 4NYZA 1N32K 1UFLA 2ZH2A 2NRHA 1UEVA 3R6LB 3AVHA 4IOXA 5FDLB 3HF5A 1IKWB 4A8MP 5BR8K 4WK1A 2V7YA 2YVSA 4H0PA 2E2PA 4DTRA 1IKXA 3LZIA 4DV0K 4KFBB 5KFVA 4WIQA 2QE5A 4DUYK 4DS5A 2J9DA 3FBCA 2OFHX 4JI0F 4KRFA 2HNDA 3NE6A 5GAGI 2J4RA 1I6JA 1I94F 2XMKA 2XY7A 2XMTA 3RSEA 4FO0A 2IDEA 1FKPA 2K3KA 5E5NA 4L76A 1PBAA 2RDDA 3VZHA 2D9PA 4M5MA 2RJZA 4NZ0A 4AQYK 2E9ZA 1EIYB 1L3UA 2DNQA 2LFVA 3NFAA 3VV2B 4CT9A 3TA1A 4IQMA 3Q8QB 5DGBA 4K4UA 2UV8G 1RWPB 1DZ5A 1XNRF 1A6LA 2IVNA 4DV0F 3KKFA 3QZ7A 1BC6A 5AZIB 2DTJA 3EICA 1S9EA 2CJXB 3J8AA 3MPWA 4CFCA 1J53A 5AZJA 1N33K 3MCOA 4Y0WA 1LWEB 3UE2A 5M1QA 3MEEB 4HI2A 9ATCB 1IKYA 1BGXT 4U7CA 3HTVA 3E1YA 2HAIA 4OPJA 3KHHA 1VC5A 3DMJA 3Q24A 4CHNA 1REVB 1W7WA 2DFHA 2WONA 2A1BA 3VN5A 1HYVA 2AYEA 3R2CJ 3V9WA 1NK7A 3QATA 4Y2MA 3J80Y 3BO4A 1YHQN 1BISA 1SAZA 2AW0A 3W3SA 2HLUA 1AFJA 5KG5A 3UKUA 1Q79A 2CAJA 4ETXA 4JI1F 3DOMB 2DHXA 1Y3JA 3GV5B 4ELUA 1JMTA 1PO6A 1BWFO 4MO4A 3ZLJA 3EXYA 3ZXWA 4LH4A 2CQCA 4QR2A 4K0KJ 3SDEA 5EVZA 2YY3A 3HSGA 2HBYB 4AILC 1LK5A 1D09B 4TQSA 3RRGA 2I2YA 3R5JB 2YNGA 1RBOB 2OI2A 3DC2A 5KTQA 4NLGA 3OYIA 2QKBA 4DL3A 1NH7A 4EUVA 2DH8A 4ED0A 5KT6A 4KJIA 1VK0A 4PL8A 4FJ9A 3KWIA 1FKOB 3NRBA 3UDVA 1ASVA 4E1JA 2MGZA 4CGFA 2CPFA 1UWAA 3HP9A 3TANA 2QJ3A 4LF5J 4JKGB 2X6NA 3LP2A 2RNEA 4BQZA 5DLFA 4Y2KA 1PSDA 3TRGA 5GADI 2C2OB 3MZIA 2B43A 4U9RA 2KKHA 1XR6A 1SJQA 4H4KC 2B3TB 1B7YB 2D3O1 4YMEA 2YKMA 1U1RA 4HVJA 3MR6A 1B70B 3K59A 2N7CA 1TL1A 2RQ4A 1G7CB 3VEOA 3VHQA 1RT3A 1HYSA 3SMSA 1EP4B 3WXIA 3MWPA 1WC3A 4K25A 1ZAXA 1WC1A 3F56A 3T3FA 5KFLA 5T7LB 3LGNA 3EKUA 1O13A 1P1LA 2JWKA 1TKTB 1YVFA 3QICA 3DLRA 2H54B 3TZWA 2IBKA 1T03B 1WF0A 4FP9A 4H0OA 2MJUA 3OBWA 4TLQA 2HHPA 4N8OA 2FVRA 3VGKA 2DH9A 3THPA 2C2ZB 3TJAA 3LM2A 3M1FA 4QCLA 3O9QA 2V8DA 2NXCA 1RUSA 4ALZA 2ZJPL 4R0JA 2WOMA 3CC2N 2DXEA 4LF4F 4E1MA 5D0EA 4K2JA 5ETSA 1EWRA 3MCSA 4Z4CA 3GE9A 4JKEA 2OFGX 1ILYA 3HI0A 2HVIA 3UKRB 2FZCB 1HNIB 4FJJA 4OI4A 3CMES 4FF3A 3D0HE 3WC2A 2C3UA 3AH6A 4ZPVR 2W40A 3VENA 2IRYA 2VB6A 3HHLB 3SCLE 4F7VA 4BGBA 3MEGB 3POTB 3QT6A 3TABA 4GC7A 1Z4UA 4RU2A 4Z37A 3KHLA 1IKVB 2R4FA 4TY9A 3C15A 1Y64A 4OYOA 4EP5A 1KVBA 3TJ9A 4H0YB 4J7CA 1JLCA 2I6WA 2ZF5O 2GAGC 1XEZA 4DV7F 4A57A 2FHKA 3PCOB 3G8QA 2CPJA 1NDCA 2ZOMA 1A5VA 3LDSA 2ASPA 4OZ0A 4ZP6A 4ZKAA 2H3GX 1NUEA 3BREA 2FPHX 4OJ1A 2LXFA 3H6EA 2E5HA 4YUDA 5IFMA 4CZJA 1JXLA 4Q7AA 1UOCA 4OQJA 2W7AA 2BX6A 3S3OA 4GMKA 3MUMP 3TTDA 1NO8A 4ZLLA 3VPZA 1FE0A 4RW4B 4EI2A 1NK5A 1W2BR 1WUAA 5E33A 3CCTA 3D7SB 3VERA 3GYGA 3MF5A 1VAZA 3GIRA 3R5BA 2IVOA 1RBVA 1T44A 4M7XA 4B9VA 2BJ7A 4BR5A 3J7AP 3UDEA 1E3MA 5KG3A 3MM6B 4NMLA 2DNHA 1S76D 4TLRA 4WFBL 2UV8A 3C16A 3TVYA 1RHUB 4DR4F 4GVBB 4LFBF 4IZ9A 3CD6S 3RGIA 3O9TA 4N7TA 2M8DB 3MPDA 2FLPA 3EZUA 1S1UB 2G0CA 2HWHA 1P1TA 1IQZA 3H5YA 3G82A 4JI4F 2P9UB 5CA5A 4X65F 3C66A 3TO8A 3CWJA 4OYAA 4A8SA 5ADZA 3CFPA 5KFEA 3PRVA 1KKHA 3J7A1 5M1NA 3IBWA 4GC6A 2AD9A 4MK7A 4C8YA 3PX6A 3OL7A 1RGIA 4JAXA 3NVKA 3DRSB 2VDIA 1RBUA 4J91A 1HX1A 1NNEA 4M5HA 1HWIA 3SUOA 2CJAA 2CQHA 3LA0A 1PC4A 5GVQA 1GH8A 3E9PA 3QB0A 3KLGB 1HKCA 1FWKA 4DV3K 3DLKB 5AJ3K 2PYJA 1C0MA 1YJ7A 1ZAVA 4JYAF 3DLEB 1WUUA 2ATQA 2C2EA 2C3YA 3J7YP 4K8RA 3OYNA 5J1EA 2VODA 3ENQA 4QS7A 3J81O 3JYTB 1FXRA 2LU2A 3JAMY 1HNIA 2RD5C 1WHXA 1C1AA 1UA0A 4O0JA 2WCXA 3RR8A 3NH2A 2V51B 3NLCA 1X5OA 1NZAA 2D9OA 2RU9A 5IT0A 2MHNA 3NAIA 1UKUA 4HYKA 2OAUA 3MTKA 2CFXA 3KK1B 1HBOB 3J7YU 2QXFA 4RW8B 4LF6J 4M41A 4OZNA 2I0XA 3SSRA 3O5BA 4F2SA 3GIKA 4QYZJ 4BC2A 3SFGA 2XY8A 2BM0A 3BB5A 2MLYA 2MXYA 4CESA 1VQ8S 3JQKA 4W5QA 1Q8BA 2I5JA 2IM0A 5LOQA 3MM8A 4HUEA 1FK9B 1G2EA 2QLWA 3HPHA 2J7WA 1K8KA 3M6XA 2OD6A 1LOUA 1Y3KA 2VG6A 2VDHA 3PFOA 2XRIA 5LL6Z 2O8DA 3JTOA 4LREA 1HI0P 1QE1B 4FF4A 4LIRA 1Q78A 3BBCA 4USWA 4HWIA 5EWFA 5AR0A 4P52A 4CZMA 2XS5A 4BRIA 2K7JA 3CJSA 2IC3A 5JVHQ 1NKCA 4F4YA 4Q45A 1U26A 2D0AA 3C6TA 5FLXU 2Y8YA 1T6CA 2WSCC 4L74A 1S0OA 3VOVA 1HIYA 3QRQA 2VZ9A 1YJNN 2EW9A 3ZC4A 2ADBA 4HDHA 3M30A 3K17A 2UUBJ 3BGUA 2VFUA 3EVWA 2DFEA 2HFUA 4CERA 1H98A 2F8HA 4NLPA 4DTSA 3V4MA 1ZBIA 3A8JA 4B1ZA 1S6UA 1SB6A 2DH7A 1NHVA 1X5PA 2B0GA 1UEUA 1RJJA 2ZDPA 3R1XA 5HP1B 3I4HX 4GVMA 4H4OB 3A3PB 4B3OA 2VIHA 3ZT3A 2GIRA 5T41A 1CZBA 2OJ3A 2OSQA 1NSPA 3HHDA 2CZ9A 3CCES 1UZHA 3CDEA 1ZC6A 5AT1B 3QO9A 3KTQA 2BTFA 4JKAA 2LDIA 1Q4RA 2FBTA 1RNHA 1VBZA 3QZ8A 3Q2TC 2GC8A 2ZHBA 2IA6A 3H46O 1HPZB 1DTQA 1U48A 4KE5A 3OYCA 4DLEA 4AHSA 1SC3B 4X4SA 5AXNA 4HR2A 5MAOA 2RKIA 5BR8J 2P9LB 4CJLA 4FJKA 4WFZA 4JI4K 2NRZA 4LF5F 1B0VA 2LDYA 2QG9B 3D6RA 3AD7C 4XH1A 2DGWA 4H54A 5JXSA 1ZBTA 3QBXA 3OYEA 3L4QA 4KPYA 1K73T 3PVXA 2NXEA 2UVRA 3DRPA 4L3KA 3HSCA 4JI8K 1RT1A 2KXNB 2F65A 4NE9C 4BRPA 5HN0A 3CXCM 5MLCQ 1WHYA 1QSSA 2FJVA 3OT9A 4O4GB 4XPEA 1R43A 3O8WA 4LSLA 3P96A 1RTZA 5CABA 5KT2A 1WORA 1BG3A 1WG5A 2R7RA 5DM7Q 3PW0A 1Q7YO 3MM9A 1O0PA 1NXIA 1XK8A 1E6VA 1C0TA 5B0FA 3SBGA 3SEOA 5D0HA 4KH4A 3D1HA 4M5LA 3OLAA 4LSNA 2CH5A 3G71S 4C97A 2FJAB 1M5PC 4BRFA 1B9DA 3AVMA 3LDOA 1B0TA 1Q0NA 5CR4A 3EZWA 2YX7A 3B4MA 1B7FA 3A12A 3VGVA 1KLMA 3DHXA 3VCDA 3GV7B 1EX8A 3DI6A 3IC1A 2YKPA 4LVNP 3DKDA 1NBEB 4PXBA 2FB0A 2IYIA 3L2RA 1MMNA 1ZZNA 1N52B 3K2YA 2MLZA 2KTQA 4JKHA 3S9HA 3G71N 2MB0B 1RT5B 4ES1A 6AT1B 3NGTA 4LF6K 4DR1J 4QPTA 4YR3A 3PYGA 3JTNA 4CZGA 3A8EA 4HH0A 5KFPA 2APOA 4ZVTB 3HHLD 3EEQA 2HZCA 3DLGB 1EB0A 2XCAA 2FTRA 1VJWA 1YITN 1KR4A 3CUNA 1XR7A 2B5JB 4ZN1A 3NMAA 3AAWB 3BBFA 3IA0A 1YUWA 5DGAA 2Y1LB 4AL6A 3HYFA 5J1PA 4NXMK 2V34A 4PRFA 2D0CA 3OS1A 3MI7X 2W4CA 4L72B 1FJEB 4W98A 4PR6A 4LF8F 1NHUA 1R8CA 2XI2A 1BQXA 1F5CA 2AA4A 2QFJA 3IXQA 5DQHA 3IMQJ 3KLEA 5AQMA 4EP4A 1Q95G 1NLVA 4MKAA 4H5NA 4IR1A 3F9KA 3LP0A 1S6PB 4X66F 5KFQA 4KHMA 1HKGA 5F41A 3UI3A 4MIWA 5TKYA 1Z6RA 1ZS6A 4X62K 4YY3J 1X4HA 3MD3A 2XG8A 3BZQA 1FD8A 3W61A 5DETA 3M05A 5JUMA 4ECVA 2Z1GA 1Q86O 2D0PA 5E3QA 3A8IA 3M6UA 2ITMA 4FF2A 4P2XA 4TY8A 3UNYA 5J2PB 2HHWA 3LQVA 5FPDA 2FBVA 3EO3A 4CIGA 2DYAA 3IBCB 5I9EB 5DM7L 1VCTA 2YWFA 3HSDA 1TU0B 3P45B 4B3OB 2W41A 4I7FB 2XMWA 5D0GA 5LJWA 2Q2RA 1C2PA 3G6YA 3CF5Q 5HVHA 3MEDB 1JLEB 1BWEA 1EETB 4Y2IA 2MMYA 1YZ6A 1NGAA 3VQ5A 3U7JA 3IWXA 1FK9A 5DJBA 3CJ4A 1YKWA 3W63A 5K5MA 3L7UA 1Y5IB 2DIVA 2R7YA 3NF6A 2UU9J 2ZBIA 2FC0A 4G65A 1LNQA 2QXLA 3AOCA 2KQ2A 3ZT0A 3AAQA 4USIA 4TNOA 2OELA 2LEPA 3U3GA 4RNOA 5BR8F 1KHVA 3H20A 4IFVA 3V5RA 1TKZB 2VQFJ 3UR3C 3BY5A 1XN9A 2BZ2A 3O4WA 4EBDA 2AZ3A 3BEXA 3CQXA 1N36F 4IDKB 1TUUA 4Z4FA 3NGRA 3AB2B 2WC9A 4DV2J 2MQ8A 2VBWA 3Q89A 4KC5A 3UN2A 4B9UA 2OPSB 1NRKA 2CRLA 1RTJB 4W92B 3W7BA 2JWNA 4MYUA 4DR4K 3W8GA 1HA1A 2L9NA 4AXJA 3AY0A 3HHLA 2V9KA 1H7WA 3IR5B 1VQKN 4ID1A 4CLKA 2CNOB 2EKYA 3L2WA 1E6VB 2AX0A 2UXDF 2XYHB 4C0BA 3L2UA 4P7TA 1X0PA 4O3QA 4B3MJ 1NPPA 1P9YA 4NLYA 2HBKA 3MXMA 4DL5A 4FJHA 3O3FA 3R1HA 2E8AA 2V52B 4DV3F 4HL9A 2IVPA 1MROA 2Z1JA 4TXSA 1VHIA 2W9CA 2FJDB 1S5JA 2O66A 1S1UA 2BABA 3FSYA 4KI4A 3ZT4A 4ILJA 2OPPA 4CHQA 1NHKL 4UY8T 3AOBA 3EDRB 1C4CA 4DN9A 1RT6A 3AGRA 4BY9C 2RDJA 4Q2MA 2R7UA 4ZJQA 1GOBA 3P3DA 2KT3A 5DDRC 5AQOA 2H5JB 1WSVA 2FC8A 5A8KA 4EK2A 4YHHF 4O3SA 4L3QA 3FVYA 3KLFB 3C6UB 3KUHA 3M2RB 2R8HA 5M1PA 4G1QB 1SQEA 2IVFB 3CD0A 3I32A 4NLWA 2Q31A 2BJEA 2X1BA 4KHSA 2Q79A 4CF9A 3DLLQ 3KLVA 1KP6A 2XMUA 2BQUA 4YB6A 3I9ZA 1FI4A 1HJRA 3AA9A 2R7TA 2FBYA 3PYDA 2ALYB 3U27A 5C42B 2ETJA 4A8OA 2VQEF 1XMQJ 1GOAA 2ROEA 3P5BP 3QGGA 2XI3A 1PAEX 3EJMA 3VGTA 2E1PA 1Z05A 1BCOA 1QJHA 4H03B 1GTHA 1V5IB 5EOYA 3NS6A 1VSIA 3CVKA 3I4PA 4EFHA 4FVMA 1P6TA 1V4TA 2YXLA 1CJUB 3T1YF 3CJKA 3VMFB 2FHJD 4FJGA 2Z8QA 6FD1A 2W9BB 3ET6A 4DV2K 1HNWK 4F4ZA 1UVKA 1H6KX 2FGOA 1SIZA 1FO1A 4X84A 1LEOA 3F5TA 2DGOA 4DEZA 4RUCA 2VG5A 1MN7A 3L7OA 3SAFA 5AE1A 3LPEA 4I64A 2B9WA 5KFKA 4X62F 4ITSA 4CJSA 4ECRA 1S77D 1ZBLA 1SQGA 1OJ4A 3O3GA 4A8QA 4DV5F 3L2VA 4QW8A 2R7WA 3BQ1A 4NXMF 3GG0A 3JSMB 4TKTA 2GW8A 1RU1A 5E84A 1T95A 1WB9A 3I0SB 4WKRA 3PNIA 4Q43A 4C8MA 3OVSA 1FHTA 2Z2ZA 4EYHB 2YHBA 1LW0A 2ZUGA 2P9GA 1DTTA 2F9WA 3MPYA 3LDPA 1WC4A 1XBWA 2RIJA 4Z4EA 4IO8A 3B82A 2HAFA 3HKWA 1A5XA 3GLJA 1XMOF 3MM8B 2G1HA 2R2TA 1BE4A 4OMFG 1YWXA 4CZEA 1HNXF 2J6SA 3VQEA 3T9ZA 4CWBA 1V5VA 3D2FB 1RCOB 3L4IA 1HPZA 3UCUP 2AJ4A 2W25A 1WC5A 3DRXA 2J7UA 1N33J 1JCGA 2KN4A 3NY0A 4CZFA 1K6YA 3CD7A 3SCKE 3QERA 4O8KA 5FDLA 2I9SA 4QOTA 1X31C 2VOOA 2YNFA 2QTWA 1RYSA 3PJXA 2V8GA 3H25A 3N4WA 3P83D 4B8AB 5BPLA 1YVUA 1NGJA 2ZUAA 4PABA 2CJYB 4CLLA 1NMDA 2XS7A 1OY6A 3WNFA 1FRJA 3TUJC 4DR6F 5M1FA 2UUBF 5F9NA 4NWBA 2CJ9A 4CJ4A 1S9GA 3TR5A 1R0AA 1HWKA 1MU2A 4J37A 4CO0A 2VC1A 3CDAA 3EWGA 4NLUA 1RTJA 3MEEA 1LFPA 1RISA 4B3MK 4ZVGA 3QPIA 3ITHB 3HMJG 4JI3K 2DBBA 2A6OA 1N0UA 4E1NA 4PWUA 1ESVA 2IM2A 4EIAA 1RQ0A 1NLKL 3AXMA 4JV1A 1U2CA 1ATRA 3R7SB 3RYLA 3UKUB 5IQQA 4DSIA 5F9LA 4F2RA 1R0CB 1CJVB 4YEAA 3R1LA 3W1YC 1ZYQA 4CIOA 2QMXA 2E5LJ 1CVJA 1MSWD 3OFHA 2YBVA 1VBKA 1ZBSA 3KZBA 3H5SA 4WK3A 4IOCQ 1Q1KA 4MAKA 3BZCA 3H0PA 4FW2A 2V2VA 4O3NA 5LJVA 4USVA 3AXKA 1BQNB 2HEKA 5DS7A 5EX0A 3TR8A 3ZZZA 3KNAA 2H9ZA 1WEXA 1ATSA 4DU4A 3CFRA 3HXMA 3CCUS 3A0IX 4BWJA 3UCZP 3HPOA 3AHPA 4DR5J 4WYBA 1QY7A 1KQKA 3CJ0A 3AQPA 4KKOA 1BLUA 4CECA 1KVKA 3AAPA 1FRIA 3A4TA 5CE3A 5DZ6A 2QX0A 5ETTA 3FEZA 3CC2S 2YJEA 5MLCV 3TZXA 1DRZA 3T1AA 4O4RA 2HIQA 4Q44A 5F3TA 1J5OA 3SJHA 4YOEA 3DRPB 4OX9K 1T6DA 1WF1A 4BDPA 2QLJB 5ETLA 3VALA 4K42A 4DR2F 1QQMA 3VQCA 3NDKA 2WSEC 3EYZA 3V9ZA 1MWQA 1G99A 2W7PA 4Y34A 3LP1B 4HTJA 1HW8A 4UF4A 4KHNA 1S1TB 3BO3A 4DF8A 2VC0A 5HQ8A 4K8ZA 4USUA 5ADXH 5LL6d 2HRYA 4X64J 3L95X 4KAZA 1LQ9A 4ISGA 2D3OR 4U67Q 3POTA 4BG8A 1Q9YA 2YWEA 2QEXN 1RKJA 1OSCA 4W90B 3RVCA 2DHSA 3S8SA 5AQGA 2YX1A 2PIIA 4UUWA 2YNIA 5ETNA 2DY9A 4FCYA 4NLRA 3EL2A 2OO4A 4DSFA 2QMUB 1NDKA 1SJRA 1KHWA 1J2VA 2AP1A 2OTLN 1MLAA 1HBNB 3LGMA 3Q0AA 3BM7A 2P9EA 4RNHA 1BQMA 2YH1A 2OA8A 1U6FA 2BYCA 3IAS9 3OUYB 4DTOA 3QIDA 1WEZA 1H2UX 3G25A 4DSJA 2W1BA 2QA4G 2MSSA 1BL3A 4OL8A 3TP2A 1VQNN 2RH3A 3CNQP 4IG0B 2H51B 5HOOA 2FZKB 4DL4A 2O01C 1D8ZA 7FDRA 3OHBA 1VQOS 5LM7E 4RNNA 2NZCA 5RUBA 2P9LA 1QVGR 3RAMA 5AQPA 5KFCA 4C1NK 1HWUA 2W8LA 1NGGA 3KHYA 2VASA 4IRKA 3CTRA 1F1BB 2BUNA 2DD8S 4UT4A 1IKVA 1Y0HA 2WSFC 2YI1A 3D3BJ 4YDUC 3F0NA 3ADAC 3N0VA 2KJVA 5L8RC 1X9WA 1VQON 4ZITA 1U7LA 4MLHA 3VAKA 1JLCB 1R31A 3FCVA 3E01B 3LGHA 1HNWF 3NGYA 3VEVA 2A41A 1VQLN 3FR0A 4DQQA 3GJTB 5KFZA 1R8PA 3CC4N 4P2FA 1H2TZ 1T9TA 5IC6B 5J2NB 5KFNA 2C3PA 4Y0FA 4U6PA 2N4CA 2DEIA 4RW7A 2IS3A 4RLEA 3D28A 3Q83A 2BQ3A 1FVQA 1JJHA 3O8MA 2C2NA 2M70A 2YNHB 1W2IA 1CJKA 4TY8B 4J9RA 4NLOA 3S7RA 4MK9A 2QIFA 4URSA 1JWWA 1F3FA 2EVZA 3KMQA 4DMZA 4ECXA 1RLCL 3Q2SC 1N34F 4E3SA 3CJ5A 3ZTSA 2WBMA 3CCUN 1CJVA 4OZ2A 1GAOA 4ZVHA 4XTTA 1RDCA 3UFCX 2G8HA 1DJ0A 4I6MA 3UDLA 2KLAA 3U9DA 2O8BA 1SH0A 1D9AA 1VJQA 5M2PA 1ZAWA 4CO3A 4KR0B 2VA3A 4Q8EA 3QNNA 5DDOC 2L41A 1U1PA 2W6LA 1YBTA 2HBQB 1EKSA 3ENWA 3QFPA 1WAFA 2D0BA 2XSJB 1HRHA 2GVZA 1JIHA 3N79A 2EG2A 3ZNUA 4WYWA 1VRQC 2NRRA 3K5OA 3THXA 3ELHA 3PKYA 2OIHA 2EFNA 4M5IA 1RT6B 4I9LA 2CG4A 3MCMA 5C10A 4CO5A 2GMLA 1VQ8N 3V81B 4IOAQ 2E7XA 2KXHA 3GV8B 3O5TB 2HQ3A 3PV8A 1X3MA 4ZPBA 2BJ3A 3OR2A 1UA1A 3PEJA 2BANA 2WUSA 3LDQA 3RB6A 2UZAA 2RE1A 3TJ8A 5IT9U 1UFKA 3KUGA 3NP5A 2VL1A 4B9LA 1F6TA 8ATCB 2A5XA 5C15A 3B6PA 5ETKA 1RDUA 1RWKB 3NGIA 2AZ1A 4NCBA 4ILHA 1VRUA 2YNHA 2HVEA 2R3VA 1C4AA 4UUXA 1FTRA 3RTVA 1JLAA 3G9CA 4DV7J 4OZLA 4F36A 2CQ0A 2EHGA 2HS0A 2D0OA 3H45C 1TMJA 2HQGA 1C0UA 4KSEB 4F67A 4CGJA 2DO4A 3DRSA 3MN5A 4CE9A 3J7YI 1UVLA 4N77A 3FBFA 4NZ6A 4A8FA 2CPDA 1KAXA 2HFSA 4J9SA 3M6WA 4J9VA 2D3ZA 1B99A 1R59O 4DCJB 3QDKA 2GHVC 2AIRB 3L3CA 4A48A 1WSFA 1NGDA 1NDPA 1IJEB 1YBAA 1FRLA 1X9SA 3MAAA 3PIPL 1SH3A 4DV4J 3RW7A 3O3LA 3VVUA 1JLFA 1QQNA 1RT4B 3Q86A 3TARA 1XNRJ 1HQEB 3Q8YA 2PFDA 2HBMA 2CJQA 1B4SA 5K9FA 1VQLS 3L4BC 5G0RA 4CHPA 4MIBA 2M9KA 2EBGA 4OX6A 3RBDA 1Y4ZB 2PSZA 4A2BA 2ZZTA 1NU4A 3CJ2A 1XNQJ 3NGKA 4G9ZA 1WSIA 4GKKF 4ICLB 2VPYB 2HPUA 1RWNB 2GELA 5FROA 4ED8A 5K14A 2JDJA 3LANA 5KOXA 4MDBA 3GP9A 2A3ZA 3EGZA 1CEZA 1BHNA 2Q0RA 4DU7A 3BJYA 2OPSA 5KI6A 3VGMA 2W4DA 2JNJA 3ZX2A 1XMOK 5C25B 2ZC4A 3PW4A 3H2UB 4WIIA 1K47A 4JI2J 2FY8A 2BUPA 2LA4A 4J90A 4DOZA 3ZT1A 1IBKK 1UPMB 4FYDA 4NLVA 3DOKB 3RJMB 1SJ3P 1RLDA 4M5DA 1KNZA 1EAYC 4NLQA 1C1BB 4QOZB 3WIVA 2L9WA 3K8VA 3GIIA 2ZGZA 3KIOA 2O8CA 2YKQA 4ZCMA 4JV5F 4DCPB 3VF2A 1NJYA 1LOTB 3AA2A 2KDOA 1RT1B 3OTBA 4DV2F 2O3DA 4DR7F 1KLMB 3CGIA 1RAOA 2CUYA 3RAQA 4WQ5C 4CF1A 4E89A 1APSA 2WFBA 1NGBA 2E5IA 4UQTA 3T1HF 3TAFA 4OZ3A 4W5RA 1VQMN 2WHOA 5GAEI 4PUOA 4HI1A 3DYAB 4DFJA 1U2VA 3MM9B 4PG8A 4C6AA 4J2AA 1U0SA 2CJBA 4O0IA 3B6OA 3M8ZA 4PG6A 2CNKB 2AEMA 3HO1A 1NDLA 3P4IA 1Q8KA 2V0NA 2E1AA 3C7NA 2HGNA 2XNQA 3AA5X 4MLEA 1S97A 2J0QD 4IEEA 1B3TA 4J9MA 3AV9A 1HNWJ 4DQPA 3WXJA 1HQ2A 4Y2CA 1C0GA 4JKGA 2P9IA 2H4WB 3CPWM 4D3HA 2HVHA 4ZVEA 1CULB 3VEZA 3V6JA 2G8VA 4ID5B 2QA1A 4N41A 4JI8J 2B7CB 2KM8B 5LSRA 4WF9Q 5CYQB 1IUJA 1WD6A 3E01A 1KTVA 2PBDA 3VZIA 5D15A 1KFSA 5CZ1A 2HG4A 3KDOA 2VBYA 1B9FA 1RT7A 2P8IA 2FJXA 3M8QA 4CZHA 2DY4A 3CJ8A 1R3NA 5A6PA 2ZH3A 4DV4K 1KQSM 4EZ9A 4PPDA 1CJKB 1HW9A 2RQKA 1UPPA 3R7NB 4AL7A 3OVBA 2ASDA 3GBTA 1C0TB 1KD1T 2BH1A 3CCSN 3SJJA 2V8PA 5F8HA 4O3OA 3OVNA 1X9MA 1URNA 3P6YC 3AQOA 2JHEA 1MMLA 1H74A 3ZNJ1 3CPEA 2AEJA 2O4GA 1TP7A 4EGLA 4URGA 5AQZA 2WOMB 4LF8J 1HHQA 4TSXA 5B0BA 5HBMB 5C25A 5KT4A 3KLHA 3L09A 4K4TA 1T0TV 3OBYA 3NMUA 3C2PA 4M3YA 3RUBL 2QTDA 4TN2A 4OZ1A 4FVUA 1IBCB 4JP8A 1NKBA 1TUYA 3DU6A 3IBFB 1JL2A 1HNZK 3HVAA 2WVDA 3VQDA 3SQ0A 4KHPJ 5KPTA 4FKXA 5H9FJ 1WNSA 2UUTA 4QZVB 4C2MA 4KFBA 1YLXA 4CJPA 2XLKA 4CFBA 3OTCA 3OPKA 3OL9A 4KV8A 3JSMA 1JLBA 5U47A 1JJ2M 3L3VA 2V4RA 2J76E 4V19J 3Q23A 4KT0C 2DITA 5M1OA 3WEEA 2PN6A 5KFJA 3VQQA 1OVQA 1A0OB 1O8BA 4WQ4C 2VWJA 3OTOF 4CJTA 1WKJA 2Z4PA 2OPRB 1S79A 5KFSA 3JAMO 3WNEA 5AQNA 1OWXA 4QJVA 5AQIA 1NU0A 2OZMA 4CLYA 3HL8A 4C3MA 1K0TA 3MN6A 3THWA 1KD1O 3OYLA 5AQJA 4JK9A 1RB0A 3E3XA 2KVIA 3LP0B 2VA2A 3P8BB 2LLZA 3GU0A 5A2QO 2VG6B 4QU7A 3DM2B 4B3SF 1P27B 4NLCA 3OXGA 1JLAB 4DR3F 4BDYA 3PW5A 1AYEA 1K1SA 3I87A 1D1UA 4PPZA 5ETQA 4GVEA 3JB9k 3NMRA 4DR1K 2IOCA 3BN7A 3C6TB 2ASOA 1TQLA 2NUUG 3MR2A 4NXNF 4JI2K 1JCFA 1HD0A 4LIWA 1IG9A 4G6VB 3RBEA 3G6ES 1YTYA 2E5GA 5DM6L 2AV5A 4BRMA 1RDWX 1YDLA 1OIAA 3DN9A 3MECA 1NK6A 1FRKA 1REVA 3VEXA 1OQ6A 1HQUB 1Q7YT 5AQTA 4B3TK 3VQSA 1HD1A 1FFSB 4DCOB 4DR5K 2VGMA 3L8BA 4GO5X 3L7PA 3NWRA 3BYRA 1RABB 3DDNA 2ACYA 2H1YA 1VGYA 3QETA 4KGVB 3G0ZA 3D0PA 2A0FB 1GEHA 2KT5A 4JV2A 2UXBF 2G8WA 5SWMA 2HBZB 1N32J 5KG2A 1T3OA 3FRYA 3NS7B 4BRHA 5K14B 4QS8A 1NJXA 3NF8A 4EO8A 4FJ8A 1F3VA 4JB8B 4UZBA 3DLKA 3TWZA 4OV6A 5KAKA 2KFYA 2ZM6K 5K8OA 4N47A 2OHDA 1VSKA 2VONA 4OLOA 3PDNA 4EEYA 5EX3A 3QNOA 2CVEA 2HWIA 4QWEA 2HIYA 1FKOA 1LAWA 4WP8A 3EY1A 4FJ7A 3T6JA 3HP6A 3KHGA 3OXFA 1YTUA 1J5EJ 4YB7A 2VFTA 3SQOP 3CE8A 4B1YB 1VRTA 2LYVA 4JOUA 5D77A 1MDUB 1MG7A 2JVRA 3H42A 2R2RA 4CJ7A 1ELOA 2GCFA 4AQYJ 1ASWA 4B3RK 1A9NB 1SXLA 3QFWA 1QVFR 1DAXA 1CULA 4FYXB 4ECTA 2YTCA 4OX7A 3IRXA 4DMNA 4JI0K 5LJ5Y 1TKXA 4ZS6A 2M7SA 3ZZPA 1VQ5N 3MPUB 2QL9B 4QIVA 2W9BA 3LWLA 4LFBJ 4P6QA 1HYSB 3CQYA 3NCPA 5BR9A 2RAQA 5ETOA 4NCGA 4RW6B 2KKZA 2CQ1A 4ER8A 3BO2A 1RBAA 2PFUA 2WAQD 1SKUB 2MKIA 3BGLA 1S10A 1NWKA 3AJDA 2EC0A 2B4OA 2JC1A 1X60A 3H98A 3G8SA 4NLTA 4RZRA 2RF2A 1CBKA 4DHVA 4AHTA 2AEFA 3DDIA 5E2QA 4ILLA 2A3JA 2P9IB 5LMUJ 4CLTA 1RTIB 2G8KA 1VISA 2MZRA 4CJFA 3B4DA 3NF9A 3ET6B 2GMHA 3R27A 4CEEA 5H9FK 2DR7A 4FJMA 2QW9A 2HQCA 2G2YA 3W5XA 3PYEA 5HBMA 1GQEA 1KONA 2V7ZA 4HUFA 3R6GB 2MZSA 4BCAA 4V1Ak 1OYDA 1TKTA 3FSXA 2HF3A 1QD1A 1S0NA 3PIOL 3G87A 4F25A 4ZVFA 4CJEA 3D6HB 1K8KB 4FPAA 3I5BA 4NRUA 2KB2A 3W2VB 4GKJF 2C2DA 4IH7A 2NNWA 4O5BA 4M5KA 3GZ7A 2ABYA 2HRUA 4WTOB 5G0RB 3WZ0A 2HNYA 3LPTA 3AO4A 4CH7A 3UO0A 3CD6N 5B0EA 2X1FA 4ISFA 5C24A 1AUSL 3C19A 1RAEB 1TKDA 3NGDA 3ULHA 3RB0A 2QWOA 4CBUA 2MKSA 2RPIA 1KQGB 1X4CA 4IO1A 5GADP 2QWPA 2IPOB 4FK0A 5HQLA 5AJ3F 5J2NA 3VAHA 2BW7A 4F0MA 2PI4A 3AB4B 3OJSA 2GFFA 4ED4A 2J6UA 5GMDA 3N4PA 2DR6A 5L9NA 3IO1A 5TKWA 4JI4J 2HRTA 1PYSB 3MM5B 2A10A 1XC9A 4JI1K 3MCNA 2D41A 1WAJA 1JK9B 2MZ1A 3RMDA 2IJFA 3WDOA 4NOHA 1SL2A 1TELA 1UMJA 2GQCA 5EWEA 4DQ8A 1C0FA 4Y65A 4CIFA 3PW2A 4ED3A 3HVTB 1JLEA 4LFBK 3OL8A 2QRRA 8RUCA 4YB5A 1Q16B 3G2XA 3THVA 2W2QP 3IRWP 3KMSA 3VQTA 3OLBA 3QRRA 2ZZNA 3HT0A 4J5OA 5LMNJ 1IR2A 3D6MB 1XMQF 5JVHL 3JS6A 4H4MA 1YJNS 2C3OA 2IBOA 2HB5A 4OLPA 1QUVA 2YQ1A 4F3QA 1RE1B 4GNIA 1RFQA 3CIZA 2B9YA 2YWKA 4FM2A 4PKGA 4LSNB 3NHGA 3D2EA 1JKHA 1OMSA 4WWSA 3EZOA 5BN8A 3ISNC 1Z26A 3KK2B 3PR4A 1LW2B 1RTHB 3SQ1A 4YORA 3KK7A 2EBEA 4BRAA 3M2UA 1CJTB 1TZ0A 2ZH4A 3OV7A 3GE1A 1S12A 2K8GA 5I3PA 3UWTA 2BW2A 1LKZA 4WP9A 2RHQB 3UVJA 3AFGA 3W62A 4DV5K 2F4VJ 2Y0SD 2QLFB 2VJVA 1FXLA 2HMIA 2DHHA 2VJUA 1ZBHA 2ATCB 3EX7B 5LT5A 3TEHB 4R0EA 4JK8A 2JRSA 4ES2A 2R7QA 2OMLA 4IEIA 5DLGA 5LMUF 2E5LK 3BQ0A 4WCEL 3CDBA 2L48A 1HR0F 6FDRA 2XULA 2HHUA 2CPZA 2IJRA 3D67A 3KLIA 4NI2A 1WSGA 1IM6A 3OTDA 4YB1P 3IWNC 3THYB 5FJ4A 3KLHB 3FFIA 3HOTA 4ERDA 1DHMA 1RTDA 3QMLA 1WBDA 2MQNA 1HJOA 3QGHA 3HT3A 1ZM3A 1EQ0A 1EQYA 3EGVA 1Q9XA 2HSEB 1HBOA 5GINA 1X7VA 2E6LA 3RG6A 3OW2R 1IM4A 4CEDA 1OPZA 4KGKA 2I8EA 2W2NP 2P5VA 4ZHRB 1NAQA 4EU0A 1RWMB 4RBVA 4BRNA 4NX9A 3PACA 3V1QA 4BLGA 2V2QA 4CLPA 3V6DA 1Y7PA 4KREA 4DKWA 5LSLA 3MPVA 3TEGA 3MX5A 3PEHA 2R8JA 1S49A 2AJ0A 1JQGA 2I5JB 3CCJS 1NJIT 2ZJQQ 2IRXA 1NGHA 2OPQB 3W3DA 1S6PA 4J2DA 4RCHA 5T7BA 3DLJA 3FZFA 4C8LA 4WZQA 3CCLN 1LWFA 1YJRA 3CQ8A 5CD4H 4YY3K 3JQJA 5L1JA 5J2MA 3LPYA 4PWWA 3AVBA 4BE0A 5C42A 5AFUH 1IJFB 3TSUA 4H4MB 3AO3A 2HZAA 4EFAC 4FOIA 1FCAA 3SQ4A 1C1BA 3PLAA 4NYPA 1N5SA 4K59A 5DQIA 2FSNA 3S1TA 5F8MA 3TWHA 3H2VE 3BPSP 3R5DA 1O6XA 4JKCA 2POKA 4IFVB 4KGZB 1B0PA 4USTA 3FNNA 5DMRA 3IP0A 2Q6CA 1KXPA 3KKRA 5CZXA 4JI8F 4NLBA 3ILJA 3J7ZO 5B0AA 3CIPA 1UWBB 2Q66A 4OPAA 3THWB 3FK4A 1RYRA 1PKUA 4LF7F 5J1EB 1RA7A 3FEXB 1VQ9S 5FRNA 3SCIE 4QYZK 2PZSA 2HFZA 3F41A 4KB1A 3JXUA 1WNEA 1U1KA 1O1WA 1FJGJ 4O3RA 3EGNA 4FLXA 3ZTQA 4OLBA 1U1MA 1Y10A 3V1RA 2VHGA 4DR3K 4K4ZA 1JLBB 2VU5A 2XSFA 3T5JA 5ETRA 1DFDA 5D4OA 4K5SA 1AT1B 3I8DA 4A8XA 4M45A 4DCHA 1GMWA 1SI9A 4E7IA 4NLDA 4YQWA 3ZZUA 4NO7A 3TX0A 1D8YA 4KPCA 4ZPDA 4LF8K 1C1CB 3UR0A 4WE1A 5EX5A 1VBXA 3GCXP 4LR8A 1JJ2R 4WCEQ 4PYDA 1Q86T 2G1DA 1NJZA 2DFFA 3M8QB 2MZTA 2DGQA 2Z2LA 3IWLA 4IWVA 2MZQA 3L9ZA 2HHHJ 3GSDA 4HKQA 2M2BA 2WONB 1CJTA 4X4UA 1MWYA 1S6QA 1KTQA 4FNHA 1XERA 2UXCJ 4R25A 2GUIA 2DHGA 4J9PA 4B9MA 3BDPA 3DHWC 2MQOA 4JI2F 4UOFA 2NQPA 1S1XB 1HMVB 1VQ7N 2NZTA 4YDDB 3PYFA 2D1CA 3IM9A 1DTTB 2OTJS 5K8MA 3MXIA 2IHR1 2HQIA 2MHEA 2QN6B 3BDEA 2CQDA 2LQBA 2OKQA 5D4PA 3W2WA 1QDUB 3RW6A 1H38A 5AQXA 5DDQC 3DXKA 1D0EA 3FMWA 1M1KT 1SL0A 3VEWA 3MURP 1ZA1B 1H73A 4CEAA 1N6QA 3FZLA 2CDQA 1GTEA 3OYDA 1XMQK 4A8YA 2Z2MA 4I2PA 4FZVA 5CHCB 3OYAA 3WQTA 3R5CA 2BOPA 3N01A 4CZIA 1DY3A 4OHZA 3CJBA 1T03A 4TVAB 1VQYA 3IGNA 1CG2A 2KFZA 4H4OA 3HHNB 4YOTA 1FVSA 3FQKA 1NB7A 3IGVA 2QSFA 2XY6A 3CFOA 2CPEA 1LAVA 4IKAA 4N5SA 3ZSRA 2B4UA 2E9RX 4YP3A 5KFBA 2ZM6J 5F8IA 2PFFB 1RXOB 3K8WA 1Q8LA 5EXWA 4FSVA 3O1BA 3NOGA 1H7XA 3K9KA 2JLGA 2D69A 3DFEA 4E8UA 2UP1A 1HQUA 3GR1A 3W2VA 3H4BA 3BQ2A 3KG1A 3BBBA 2X78A 2W9AA 4DG1A 5E7OB 1SV5A 2MY7A 3VWSA 3HDSA 2F63A 2JH3A 4OJRA 3WXMB 3MR7A 4QIEA 4IH6A 1XMBA 2Z30B 3ULEB 3ZX0A 3U3YA 1FFGB 2Y1JA 4NYNA 2BMBA 5BYSA 3R8EA 1GMWD 1F5BA 1TL1B 3MWBA 1AZSB 3BH6B 1T05B 3AVNA 2GV9A 2DKOB 1Y11A 3PO5A 4QIGA 2DRAA 2MDAA 2XLIA 3J81U 4Z4HA 4ZLJA 2H65B 1YXQA 2GHWA 4I4BA 4H5VA 1WDTA 2F1FA 1XHXA 1SQFA 3R5AA 4QU6A 4JRQA 2XY5A 4NASA 1N34K 4NLXA 4I1TA 5F8GA 4HVZA 4RWTA 4CK3A 5H1SQ 2RRNA 2F8TA 3B6BA 1EHWA 3RMAA 3FGUA 1FRMA 1VRTB 1WACA 3FE1A 5HMYA 3DRRB 1RKIA 1UCNA 2FIUA 5B09A 2OSRA 3G4SS 2VD3A 4DB3A 2BGGA 1YJTA 4IO9L 2XM3A 1IJJA 5HRPA 1YRTA 1U0HB 3ZSXA 2YQ0A 3R8YA 2L9DA 1N88A 1JJCB 1KFDA 3RBZA 4Q5VA 3I55N 3PO4A 5ETPA 2LQ5A 3P5TL 1GMUA 4DDFA 4JKBA 1IBLJ 3JQMA 1M5KC 4CEFA 1IBKJ 1IR1A 2OTJN 3I5AA 5A2QY 2HNYB 4BC3A 4M8LA 1I94J 3T5LA 2N82B 2CGLA 4DG1B 4DLGA 1U6BA 3FC9A 4QIWD 1M0SA 2P9NB 1BA1A 2Q43A 4CK1A 2EC2A 3GILA 4CLWA 2HOEA 3DU5A 2GIQA 2GX8A 4R8UB 4JI5J 1BUPA 5AQFA 4MK8A 5CHIA 1KRPA 4PQUA 1S1WB 2DR9A 3ASMA 3R5GA 1MROB 3MXHP 5H1SV 4RU9A 5F8NA 5HLFA 2ZH7A 2EK1A 1EXQA 3D6TB 3ZYYX 2M8HA 4BRGA 4ED7A 1EETA 4ED1A 1AXQA 1VSLA 3I9V9 2AGQA 1QHAA 3UD5A 3M9MB 1YJWN 3ZZRA 5AQWA 1OY8A 3KNGA 5HL7L 2E29A 4A59A 4JKFA 5HO4A 5GAGP 4JN4A 2P9UA 1VHXA 1PYTA 3ATUA 2AYBA 4KKOB 4PQAA 4N56A 1BWVA 2HGLA 1VS3A 3ENOA 3VTIA 4AHVA 4CO4A 4FJIA 4J2EA 1RDBA 2O8FB 3LPUA 3QLHA 4BC9A 1MNEA 4MDAA 3C14B 2HVDA 3KVGA 4Z4GA 1HBMA 3SAHA 3GFHA 1TL7B 4NXNJ 1N5QA 4FLUA 3VQ4A 1Q8IA 3WC0A 4ZA1A 4QAGA 4MO5A 3M8YA 4C4WA 2IMOA 1HR0K 3CCVN 2KVQE 1FEEA 1KC8T 1GT8A 2X3GA 4CEZA 1RAHB 1S7HA 4NMXA 3RWUA 3ISND 1IXKA 2XWXA 4RR5A 3OVAA 1KS2A 2GVZB 1YGYA 3MFIA 3HOSA 1IV0A 4KHYA 3O9UA 4UZCA 1RT2A 2KYZA 1FNXH 3D3CJ 4AYBD 3IAM9 4PHTX 3K5NA 3QJLA 2P9NA 4KAIA 2BRLA 1KWMA 4KO0A 1NG9A 3ZETB 3KJVA 3S3MA 3HLUA 3PXGa 2VBZA 2ASLA 4I6MB 2XCPA 3R2DJ 3K58A 3MN9A 4I2QB 1SL1A 2QT7A 2LCWA 1UJ6A 4IDKA 1QSLA 3E2EA 2KHCA 3QAEA 1VSMA 1Y00A 2NRXA 2EFGA 3M2UB 4BACA 4LF4K 4FF1A 2KL8A 2CYYA 3MK6A 1K8AO 3A8KA 4IBNA 5GADU 2B51A 8AT1B 4FJLA 4JI6K 2PYLA 3W65A 4KHPK 2AGPA 3Q7BA 3G6EN 3EVOA 1OH6A 3KD5E 3OYJA 4ZTJA 3MMAA 4QQBA 3DGPB 5AFUA 5F2RA 1G6BA 5JS1A 1RZMA 2ZNZA 4XEIA 4WQ4A 5K8NA 3OYBA 1NB2A 1N36J 4B17A 3AJ1A 2BRKA 4KYZA 3VAIA 1TTHB 5JJBA 5AZJB 3HPGA 4DS4A 3C6UA 3DLBA 3ULEA 4ETZA 3WBZA 2BE2A 2C42A 3VEYA 1UAXA 5EGYA 1UWBA 3TSPA 1UZDA 2QM1A 4DR6K 3AT1B 2ZITA 4PA1A 4Z7CA 2OANA 2CQGA 3DOLA 4CLUA 3J81j 2XZTB 4IG3B 1HWLA 2Q3PA 3AVGA 4ZPWR 4CJQA 4M5JA 4FVCA 4DX7A 4NEZA 3CJ3A 4DPYA 3TOQA 4R79A 4C7QA 1KBRA 1QAXA 1U6ZA 5CH7B 4AL5A 2XYPB 3Q8UA 4G3IA 3VAJA 3MR3A 3W66A