1DTTA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-2 (pett130a94)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
543
structure length
540
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/transferase
molecule keywords HIV-1 RT A-CHAIN
total genus 126
structure length 540
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dttA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dttA05
2HNDA 4E7LA 3IN5A 2WONA 4DTOA 1S9GB 2C2DA 5KFRA 3LP0A 4EP4A 5KFTA 4LSNB 1S0MA 3G6VA 3HSTB 5C24B 1DLOA 3H4BA 1HYZA 1WAFA 4CJQA 1VRTB 4CGIA 2XY6A 3DLBA 1XR6A 3ITHA 4DTNA 3RBDA 1QQCA 4NLDA 3CO9A 4TY8B 4B9LA 3CQ8A 1JLFB 2QKBA 4IFYA 1SKRA 2ZKUA 3QIPB 2UVWA 2HNZA 3KK2B 1UWBA 2HHWA 3PY8A 4ED7A 3BJYA 3QINA 2JC1A 3K2PA 1K1SA 4CJPA 3KLEB 1WSIA 1UOCA 1TV6A 3DMJB 4DQQA 1I39A 5K14B 4M41A 1BCMA 3G86A 1NJWA 4CF0A 3CIZA 2OPPA 4NRUA 1RBRA 2AX0A 4RW4A 4J9MA 4IQXA 4Y1DA 4IH7A 5KFJA 3IRXA 3T5JA 3P83D 3DRRA 4KHUA 3QLHA 5HRRA 2IGIA 3AA2A 3S3OA 4O3QA 3O4QA 4BE2A 2FLPA 4WXOA 3PR4A 4J9RA 3IAYA 1W0HA 3HXMA 5FDLB 1HQEB 3T5HA 4MK8A 4RZRA 2RN2A 5I42A 1S49A 2BR0A 4E1MA 4DTXA 1XC9A 1TK5A 2ATLA 4BWJA 2XGQA 3Q8RB 4ZHRA 1SKSA 4AHVA 4F8RA 2VG5B 4U7CA 1KVAA 4GC7A 4LSNA 2VA2A 1RTDA 4FJXA 3I0RA 4KHQA 4DSLA 3NH1A 2RPIA 4FJ8A 1WNEA 2QXFA 3M9OB 2AWZA 1QE1A 1XI1A 2B5JA 4Y2AA 5KG6A 2XWYA 2YV0X 3CFPA 1R0AB 3BGRB 4ZP8A 2IAJB 1ZTWA 4O44B 4ZVFA 3H40A 1JLBB 3MAQA 3H5SA 2WCXA 3V9WA 3HO1A 1X9WA 1IKWB 3I0SA 5EWEA 2BQUA 2RDJA 4CGJA 5J2MB 1N6QB 3V6DA 1SV5A 3C94A 4Q8FA 4MKAA 3SPYA 1REVB 2I5JA 5DQGA 3L2RA 1C0MA 5J2NB 4FLVA 2FBTA 3OL7A 5KFFA 1KFDA 4ZPBA 4CK2A 4B3OA 4E7KA 4RUAA 5J1EB 3LPTA 4KFBA 2FLNA 3L3VA 5HP1B 3OYMA 2D7SA 4FK4A 5DQHA 4WE1A 5F9NA 4QWBA 3TAQA 1S1UB 1IKYB 3CVKA 4I2QA 5DMRA 3QESA 1LWCB 1N48A 1Q9YA 4F3TA 4CEDA 3VQQA 1TAQA 2G8VA 3N6LA 3PW4A 4IG0A 1RDRA 1RA6A 1JLGB 1IKWA 2G8KA 3DI6B 3E51A 2X78A 4AHRA 4IOBA 3MEEA 3K5OA 1S1VB 4M3YA 4KTQA 1C1CB 3CFOA 5KG7A 5J2NA 2J6UA 4DL5A 4H4MA 3CJ2A 1DTTA 1U45A 4O4GA 3MR3A 4PUOA 1BCOA 3TAGA 2OA8A 4RW8B 4F4XA 3PW2A 4W5OA 3QEXA 3VQBA 1RT2B 4Q43A 3BGRA 1SH2A 2VWKA 3HP6A 4DG1B 3CJ4A 4LD0A 3OL9A 1WSGA 3VQ4A 1QAIA 3IRXB 3AO1A 1NJXA 4O0IA 1BQNB 1HYSA 1S1TA 2J6TA 3PJWA 2BANA 4R8UA 4KRFA 3OVNA 4FJKA 4ED2A 4ZTFA 1TL1B 1LWEB 1FKOB 3D0PA 3MEDA 4J9QA 4FVMA 4WYWA 2KFZA 1NK4A 2FVCA 4WZQA 2UUTA 4IR9A 4N56A 4FLYA 2W8KA 1KRPA 3KLIA 3AVJA 2ILYA 2R8IA 3I5BA 5L1KA 3D45A 3VQDA 2IA6A 4IRDA 3S9HA 4BDZA 1KFSA 3HHKA 1RBTA 4ECTA 4NLSA 4WE1B 4TYAA 1RYSA 2F8EX 1HNVA 4PQUA 2W9AA 3V1OA 4KAIA 1D9FA 3V81A 1JLEB 3L2VA 3CDWA 1IKYA 2CKWA 1QTMA 1LWFB 2F8TA 2O4IA 1ASUA 4F4YA 3EPIA 4QAGA 4ECVA 3L2QA 4C8OA 2ZE2A 2WB4A 3VA3A 4HHTA 1S6PB 1EKEA 2ZD1A 3CJ3A 1W25A 3S3NA 5KT3A 1RT3A 3C6TA 3RBEA 3RRGA 2RF2A 3V6HA 4BDYA 4FJIA 3GV8B 3KIOA 3AV9A 1BQMB 3M8QB 3HVAA 2O4GA 1EX4A 4HCCA 3D5MA 2W9CB 1ASVA 5KGXA 5F8GA 4B9TA 4DQIA 2XY7A 3OYFA 2WONB 4W5NA 5KFQA 2D0AA 5C5JA 2DY4A 3DLRA 4DTRA 3KLGA 4CGHA 4YR2A 4R5PB 3PV8A 4BACA 1B9DA 3ZT3A 4CIFA 2AQ4A 1UA1A 4KBIA 5EWFA 4H4OB 4MIAA 4ZP7A 4FJ9A 4Q5VA 3CM5A 4DL6A 4J2AA 1O1WA 4H8KA 4CCHA 3PX6A 1C1CA 1JKHB 2QE5A 2ATQA 1S1XA 4DLEA 2Y1IA 4CK3A 3CFRA 3V1RA 3OYAA 3SQ2A 4FYDA 4DS4A 3MR2A 5K14A 4K4TA 4DTMA 1RILA 4IR1A 1KTQA 3ZT4A 4Q45A 1C1BA 3KHRA 3RB6A 4FLUA 3KTQA 2XY5A 5KT7A 4E7IA 3NF8A 5F8MA 1TK0A 4ED8A 1SL1A 4KTWA 3O3FA 4K4XA 4R8UB 4UQGA 3UQSA 5C42A 1LW2B 4N5SA 5KFYA 4FCYA 3SQ4A 3C6UA 4XO0A 4CGFA 5C25A 3E01B 1SL2A 3SQ0A 1HYSB 3IG1B 3KK3B 3OSPA 1T05B 4OJRA 3TANA 1KHWA 4RUCA 1A5WA 5HBMA 3DM2B 4MK9A 5KG1A 1HRHA 4C8NA 1Z26A 1OS5A 2IBKA 1D1UA 5KFVA 3AVIA 1RDCA 1D9DA 4ECQA 5KFBA 3H5UA 5KRSA 1JL1A 3P1GA 5KG2A 4XIUA 1S1WA 4E7JA 4DL7A 4FJNA 5KTQA 4R5PA 2G8HA 4CECA 2IAJA 4OL8A 3DOLB 4DLGA 3ITHB 3T5KA 5D3GA 1WN7A 5F8IA 3LDSA 2D0BA 1TGOA 1RT7B 4Z4IA 1QSYA 4PA1A 3PZPA 4ECXA 5L1IA 4FS2A 1KLMA 4FZXC 2ZE2B 5KI6A 4O3PA 3SFGA 2VG7A 2FVQA 2AU0A 1L5UA 2EC0A 4M3TA 1RNHA 3ASMA 2OZSA 1WSJA 4O4RA 2C2RA 1REVA 2I5JB 4EBCA 4E0DA 4DS5A 4IRCA 5KG0A 1EETB 4IRKA 4JS4A 3A2FA 4EP5A 1I6JA 3QGHA 4F4KA 3MFHA 3QLHB 2JEIA 1Q8IA 3SZ2A 4CHOA 3MECA 5HP1A 3T1AA 3ZT2A 3QNOA 4RW4B 1TKZA 5D3GB 3DDKA 4HVJA 1RT7A 2BQ3A 4IH5A 1RT4A 4LH5A 1HMVA 3K57A 2KW4A 3UIQA 2B4JA 4Z4GA 2BRKA 3LANA 1RA7A 4H4OA 3Q8PB 4DL2A 1IH7A 1XHZA 3MXIA 4CEQA 5KT2A 3IS9B 1TKXB 3DYAB 4NRTA 4Z4CA 4LQ9A 4CGDA 2YKNB 2OH2A 1JLCA 3K5LA 2GIQA 2IC3B 1RBSA 2G8IA 2QK9A 2HMIA 4DEZA 4R0EA 3AVKA 3AO4A 2W8LA 4RW8A 4M3RA 3OS1A 2V4RA 4IG3A 3HVTA 4ICLA 3QNNA 3SV3A 4TLRA 3HL8A 3H5YA 4E7HA 1QSSA 4DTJA 3SYZA 1TVRB 4CJ5A 3B6PA 3TAMA 1FKOA 3KLFB 4NCGA 1TKDA 1DTQA 2BANB 4DU1A 3OJUA 3IG1A 1T3NA 2HNYB 5HLFA 4K4ZA 2VWJA 4L8RB 1D0EA 1JXLA 3NGZA 3LP2B 2R2SA 2OPSB 4MH8A 4DTSA 1RT1B 3KLIB 2FVPA 1ZBFA 1D8YA 4I7FB 4Z0UA 3DYAA 4EEYA 3HK2A 2Y1JA 3IGVA 2FBVA 4QWEA 4URSA 5T14A 2ZQBA 2KZMA 3VQ7A 3I0RB 1C0TB 1L3VA 1KCFA 4CJUA 1LAVA 4KHWA 3EZUA 4CFDA 2XCAA 2I1RA 3ALYA 1XR7A 2B6AB 4Q8EA 2KZZA 1R0AA 4ECUA 3RTVA 3QEVA 1S9EB 4ZVHA 4TQSA 3PJXA 4DQRA 4IDKA 3G0ZA 4YR3A 5CYQA 3OS2A 4K4YA 1SKWA 3NF7A 3QIOA 1S6PA 5L1LA 4CHQA 4AHTA 1TKXA 3KLEA 4FZYA 4YP3A 1VSKA 3K58A 4RW7A 2YKMB 4FW1A 4ID5A 2PY5A 2CJQA 3B6OA 2XGPA 3NE6A 2X6NA 1XHXA 2FJVA 1LW0A 2FVSA 3CWJA 2FLLA 4B3OB 4ECWA 1JLAA 4RW9B 4FM1A 3SUPA 3G10A 5L1JA 3NAEA 2HHSA 2GC8A 1BI4A 3K59A 1RDBA 3OYLA 1T94A 1TKTA 5KFGA 4RNMA 5DGBA 3RMDA 4DFMA 2OZMA 4GVMA 4FBTA 2UVRA 4M95A 4TY9A 1J5OB 1RTJA 3DLKA 1IKXB 2JLEA 3MF5A 1RBUA 3DOKB 3BSCA 2UUWA 2OPQB 2FC0A 1UAXA 3WNHA 3JYTA 1ZBLA 4ID5B 3H08A 4EBEA 5KFXA 2QV6A 2P1JA 3HM9A 1DTTB 4E3SA 3LP0B 1ZBUA 4DSIA 2ILZA 1S5JA 4OLAA 3FFIB 5EU7A 3U6FA 4NYFA 2BRLA 2D0CA 1NK0A 4PQUB 2FBXA 1SH0A 2HHXA 3KK3A 4DG1A 4O44A 4KB1A 2RKIA 4Y34A 4KHYA 3H59A 2E9ZA 1NK8A 3TAMB 3RMCA 4DQSA 3GYNA 4DL3A 1SV5B 4IFYB 1X9MA 5I3UA 1N4LA 4ZP9A 3RB4A 4F2RA 3KJVB 4DTPA 2P5OA 1T7PA 4EO6A 4CEAA 1NK9A 2BE2B 3TAFA 3VQ8A 4G1QB 3OYJA 2X6SA 2YNIA 2HWHA 4M3XA 1GX6A 4NLYA 2RF2B 4PWDA 3L2UA 3AO5A 2UVVA 4DF4A 4M42A 2OPPB 3I5AA 4Y1CA 2A1SA 3DLEA 4XPCA 4NLTA 1BGXT 2FJXA 5DG9A 2E6MA 1SL0A 4WXWA 1YT3A 3DRRB 5KFLA 1YTAA 3MR5A 2R2RA 3KLVA 3VQ6A 1VSDA 4EZ9A 4IBNA 3QEWA 1JXEA 4O5BA 1S1UA 3S3MA 3QIPA 3QO9A 2RKIB 4CF1A 2HHQA 4YR0A 1J5OA 3QERA 2XHBA 3DOKA 4IDKB 2OPQA 2BDPA 2WK4A 1EP4B 4KHMA 1CZ9A 4CEOA 4G3IA 4OVLA 1JLQA 3PHEA 4CFBA 4BDPA 1LW0B 3ICLA 3DRSA 3TAPA 5SWMA 1Y97A 1JLAB 3AVFA 4RW9A 3ZT0A 4ECSA 1NKEA 3QETA 1RTHA 2KTQA 1BQNA 3KKSA 2BGGA 2B5JB 3BQ1A 5DG7A 3LWMA 1RT4B 2WOMB 2J6SA 2R8KA 1NKBA 4IKFA 1F21A 3RMBA 1ZBHA 3PR5B 4MKBA 3OHBA 2Z1JA 3PO5A 4CJWA 1HQEA 3V1QA 1ASWA 3QO9B 5HRPA 4KB7A 1NOYA 1I3AA 4ELTA 4G1QA 1IG9A 2YHAA 4X2BA 4J9SA 5DG8A 3WNFA 3PX4A 4LSLA 3OYEA 4B9NA 4ZVEA 4JS5A 3CDUA 1KSPA 2JGUA 4M3UA 3JYTB 3RAXA 3MXMA 4KREA 4CESA 4RW6B 3IS9A 2XY8A 2IC3A 2D3UA 2ASJA 3SUQA 3SPZA 2YKNA 4CF8A 3BR9A 4DFPA 4DU3A 3OYIA 2YHBA 3N6NA 5KFWA 1MMLA 4TN2A 4F4ZA 5J2PA 5J2QA 4FXDA 2ITGA 2WOMA 3LALA 4HCBA 3K5NA 2JEGA 4O55A 3H2LA 4J2EA 3L8BA 2OPSA 1RT3B 5KFHA 2PZSA 4MIBA 2ZD1B 1C0UA 2YNIB 4NCGB 3CJ5A 4E1NA 1KVCA 1W9HA 4CFAA 2DFEA 2OPRB 3VQCA 1BQMA 3M8QA 4YNQA 3M9MB 4N47A 3MXJA 4JLHA 2HVIA 4RW6A 2W7PA 4DF8A 5DGAA 2AJQA 3NH0A 4Z4EA 1EXQA 1L3TA 3SQ1A 2HW3A 3I8DA 3TQ1A 1S1TB 3HPOA 1IO2A 3PUFA 2B6AA 3H5XA 3MECB 3FDSA 3MEDB 1NK5A 5KFDA 3K5MA 1S9EA 3OHAA 4KV8A 3JSMB 1JLFA 2E9RX 2YNHB 3QEIA 4ZTJA 4RU9A 1XR5A 3SI6A 1JLCB 1VK0A 4ZVGA 4EZ6A 2WRMA 1RTHB 4HUGA 4FJ5A 1YTUA 2DPJA 1S10A 2W42A 4FJMA 3ZSQA 4AILC 2IDOA 1YVFA 4KAZA 1TKTB 5KT6A 1N5YB 4FJ7A 3OLBA 3LZJA 2HAIA 3N6MA 3VQ5A 1QHTA 2QKKA 1RT5A 4CERA 3E01A 4I2QB 2ETJA 1SH3A 4J2BA 4J9KA 3RB3A 1LW2A 1HPZA 4CFCA 4ED3A 1BIUA 1WSFA 4KI6A 3U3YA 1QAJA 3KK1B 2IOCA 3HJFA 5KFNA 4RNFA 3ZCMA 1TVRA 4XPEA 1VSHA 2Z1GA 4CEEA 3KLFA 3H98A 1ZETA 4DMNA 1RTJB 4M45A 3WNEA 2HNYA 5HLFB 1XWLA 1BISA 4FS1A 3LP1A 1VSIA 4H54A 4NLPA 1RT6A 5KFOA 4WFXA 3AVNA 1QSLA 3KLGB 1CXQA 3QGGA 4LQ3A 4B9VA 3NGDA 4NCBA 3KKRA 4ED0A 1SUQA 1RYRA 5HROA 1TP7A 2PYLA 1QE1B 2ASLA 4Q0BB 3NAIA 2D41A 5KFCA 3U3GA 5J2QB 1NJZA 2XC9A 3M8PA 3FQKA 4KSEB 5KRTA 3I5CA 3OL6A 3M8SA 4ZMMA 4K4WA 5DLFA 2VA3A 4DFKA 3DLGB 4EBDA 4IKAA 2V9WA 5FDLA 1MU2B 4J9PA 1S1VA 2BE2A 4WZMA 1FK9A 3ZSYA 1HARA 3PW0A 3G6YA 5FRMA 1KHVA 3KJVA 1NK7A 2WTFA 2DPIA 3NBPA 2IS3A 1FKPA 1HJRA 4JRQA 4O3NA 3DLHA 3VQEA 1HYVA 5JXSA 1HQUB 4F3OA 1RTDB 4KTZA 4LY7A 1VSLA 4CE9A 3TABA 4CJKA 3VA0A 3ZSOA 4JV1A 4FLXA 5KG4A 3FRZA 4FLWA 1JXBA 1JLEA 3NKYA 2F8SA 4NLXA 4O0JA 4QWAA 4ECRA 1T03A 5CZ1A 1WAJA 4ID1A 1IKXA 3PW7A 3MEGB 4CJRA 2W9BB 3I0SB 4YQWA 2C2EA 2IMWP 4CK1A 1UA0A 1TQLA 1GX5A 3HKWA 4CJFA 3THVA 3AVHA 4CGGA 4QWCA 4DU4A 1NJYA 3PVXA 1TAUA 2G8WA 3RR8A 2VG6A 3LZIA 2JC0A 4O3SA 4ED1A 3EZ5A 4M3ZA 3OYKA 4NLGA 2AX1A 3LAKA 3HVTB 4ICLB 2YNGB 4QW9A 3KHHA 5KFMA 4QCLA 3CG7A 4CF9A 2XRIA 3GIKA 1RT5B 4K8XA 3AVCA 2XI2A 1KLNA 4B8CA 3SNNA 4KO0B 3L2WA 2FVRA 2AGOA 1NNDA 4B08A 4JRPA 4F2SA 3MR6A 3AVAA 4NLOA 4DSFA 2P5GA 4CEZA 4AHSA 5F8LA 2FBYA 3CYMA 2YNFB 1FXXA 4WFZA 3SV4A 3RR7A 3V9UA 3GILA 3ULDA 4NCAA 5I3UB 3QZ8A 5I42B 3OS0A 3NAHA 1JIHA 1JKHA 1QS4A 4FBUA 4BE0A 4HYKA 4H4MB 1ZBIA 2C28A 3QZ7A 4PUOB 3VQPA 3OYCA 4ZHRB 3OSNA 1D5AA 4OPJA 1U09A 4CJTA 3RWUA 4FK0A 5EUHA 2BQRA 1KVBA 4YFUA 4KPYA 2DFHA 3LP3A 1C1BB 2R2UA 3NHGA 3DLEB 1WSHA 2O5DA 1Z25A 4KHNA 3ISND 4MFBA 2B43A 2IM2A 2W9BA 5E41A 3TWHA 4URGA 4TQRA 4CEBA 5F8JA 4N41A 4IFVB 1FK9B 1S97A 4E89A 5L9XA 3PO4A 4KKOB 1JLBA 3DLGA 4K4VA 1C0UB 1G15A 1FKPB 3V6DB 2IJNA 3DRPB 4DSKA 4W5QA 1HNIA 4FZZA 5DK5A 5SZTA 1L3SA 4KFBB 1HQUA 2P51A 2YNGA 2V0NA 2NUBA 4YMEA 4OKJA 4NYZA 4E19A 3EYZA 3O4NA 1S1WB 1S9FA 1TKZB 4M3WA 4KHSA 4Y2CA 1U48A 5KFUA 1S0NA 4QOZB 2R2TA 1VSJA 4IG3B 5KT4A 3MTKA 1BHLA 3GQCA 4IG0B 1GOBA 1NKCA 3OL8A 4HUFA 5KFSA 4N76A 4OKKA 1LV5A 3ZSRA 3MEEB 3HVRA 3NFAA 4RNNA 3AO2A 4ZP6A 3Q8SB 4FK2A 1VSFA 4BE1A 4NLRA 4CJLA 4FJHA 3FQLA 2HHVA 3HPHA 2YNHA 4CHYA 5DQIA 2ALZA 1VSEA 4KI4A 2EX3A 2E6LA 1C2PA 2R7YA 3C95A 3KLHA 3V4IA 4CJEA 3LWLA 4B9UA 3UR0A 1A5VA 4MFBB 4CIGA 1S6QB 2IM3A 4W5RA 3Q8QB 1C1AA 3QGIA 3SJJA 1N5YA 1DTQB 4WFYA 4EO8A 4CJSA 3AA3A 1HPZB 3LAMA 1TL1A 4IH6A 2EHGA 4OGCA 1N6QA 3DRPA 3NGYA 3ISNC 1JX4A 3CJ0A 4FM0A 4RW7B 4KE5A 4J9OA 2XI3A 2C22A 1YVUA 3SUNA 1Z4UA 1VRUB 2XCPA 3GIIA 5CZ2A 4KHRA 4AHUA 1HNVB 3SFUA 4CF2A 1NOZA 2AGPA 5C24A 4M94A 4PWDB 3OYDA 2A1RA 1WNSA 3HP9A 4I2PA 5CYMB 3GV7B 5FROA 4ZPAA 4O3RA 1NHVA 5HROB 1VRTA 3AA4A 3RRHA 2JEFA 3NH2A 1U4BA 4FJJA 3KNAA 4URQU 2E4LA 1HMVB 1SUQB 2D5RA 1LWFA 5CYQB 3DOLA 1TL3A 1J54A 3MFIA 3TVKA 3VQSA 4IFVA 1QUVA 1T05A 1JLGA 3F9KA 2PYJA 3DI6A 3NBPB 3CM6A 4RNOA 1GOCA 1RDAA 4LH4A 4AH9A 5J1EA 3AVGA 3AVMA 3F73A 1X1PA 4W5TA 3LP2A 3AVBA 5KGWA 1VRUA 3QYYA 4J2DA 4KV8B 3JSMA 2OYQA 4DSEA 1HNIB 4CJ3A 5F8HA 3V4IB 4QPXA 2W9CA 1TV6B 2GIRA 1U49A 1BI4B 4U6PA 5T7BA 3FSIA 5DLGA 3AO3A 5JS1A 4DFJA 1EETA 1B9FA 2IM0A 4Z4FA 2F96A 1J53A 1K1QA 5EDWA 2XO7A 4NLVA 4GW6A 3TAEA 4DQPA 4F4WA 4DSJA 1LAWA 4O3OA 2Q3SA 4I9LA 4B8AB 3OYHA 3MEGA 4J9NA 4HKQA 4CHZA 3NF9A 4CEFA 3SCXA 4B9SA 2GV9A 1S4FA 2IJFA 3O3HA 1CLQA 4EYHB 1RBVA 4EYIB 1ITGA 3BSAA 4I9QA 2WHOA 4NLWA 3ZT1A 5F9LA 4FLTA 4TSXA 4QWDA 4AHCA 3QIDA 4CIEA 4I7FA 1S0OA 3KK1A 3KHLA 1C6VA 4FM2A 1TK8A 1A5XA 3GIMA 5KT5A 4I2PB 5CYMA 1IKVB 4CJVA 5HRSA 3BQ2A 2VG6B 3CDEA 3AVLA 1T8EA 2HVHA 5JUMA 2RDIA 4Y3CA 5FRNA 4DTUA 4Z4HA 4ZPDA 5J2PB 3LP1B 3V6JA 1BL3A 1RT2A 1TL3B 1RTIA 1ZTTA 4TYBA 2HB5A 5HBMB 4MQ3A 3DM2A 4CHNA 4OLBA 1WLJA 3GIJA 1MU2A 5C25B 5KFAA 3C6TB 1CZBA 1BIZA 3M9NB 2V4QA 3BSOA 4NYNA 5KFIA 3TI0A 2YNFA 3C6UB 3KD5E 3D28A 4ZPCA 1RCHA 3M8PB 3V9SA 1WSEA 3BDPA 3O3GA 3SUOA 5HRNA 3KMSA 2AGQA 5JS2A 2OPRA 3M8RA 3DRSB 3NGIA 4K50A 3OLAA 4F50A 3KOAA 3T19A 2HHUA 5KFKA 3EPGA 4CHPA 1IKVA 3NCIA 2FJWA 2JEJA 3KMQA 2DTUA 1U47A 1RDDA 4PY5A 3BSNA 3RMAA 3HYFA 4QW8A 1ZYQA 3OY9A 4NLQA 4DWIA 5KFZA 4TY8A 5KG5A 1LWCA 4WYLA 4HTUA 1VSMA 4ECZA 3V9ZA 3H4DA 3RAQA 4K4SA 3WNGA 5KG3A 1CXUA 3V6KA 1KLMB 3RB0A 4GC6A 2W7OA 2GBZA 2HWIA 4CJ4A 3EY1A 3OYBA 1UWBB 2R8HA 1S1XB 3SI8A 3UPFA 1X9SA 3BQ0A 2GUIA 4RNHA 3T5LA 4B9MA 2ASDA 3DMJA 2LSNA 3VQ9A 1J9AA 3ZSXA 1U04A 1CSJA 3FFIA 3ZSVA 4NZ0A 4FJGA 2HNDB 3VN5A 1C0TA 4O4GB 1RTIB 4J9LA 1N56A 4KB0A 3NF6A 3HT3A 3GV5B 5EWGA 4KO0A 3P5JA 4JUZA 1S48A 1LWEA 1DLOB 3G6XA 3NDKA 3NMAA 1Q9XA 3KD1E 3LPUA 4FW2A 4C8MA 3ZSZA 3TR8A 1T03B 4GMJB 3PX0A 4HUEA 4JV0A 3KHGA 4RG8A 5KFPA 3ZSWA 4ELUA 3PW5A 2Z1HA 2R8JA 2IM1A 2G8FA 4OKEA 3UDLA 2YKMA 1GOAA 4FJLA 4K8ZA 1RAJA 3V81B 2KQ2A 4OPKA 1S9GA 5F8NA 2VG5A 4TXSA 4MK7A 2E9TA 1K6YA 3V9XA 3KLHB 4ED6A 5C42B 1B92A 3NL0A 3BREA 2R8GA 1NHUA 2DFFA 3OYNA 4JV2A 1RT6B 4NLUA 4C8LA 3QEPA 2HMIB 2KFNA 4C8KA 2D3ZA 1JL2A 3OJSA 1S6QA 2VG7B 3T3FA 3AA5X 4DL4A 1NK6A 3VQAA 4ECYA 4Q0BA 4KKOA 5J2MA 2X74A 2HNZB 3KK2A 4FLZA 2G8UA 1EP4A 3HVWA 3OYGA 3L3UA 5CY4A 4ELVA 1JLQB 3DLKB 4Q44A 2HHTA 2UVUA 4K4UA 5KFEA 3IGNA 1RT1A 1L3UA 3HPGA 1IM4A 4OGEA 4LSLB 2Z1IA 4BWMA 3TARA
chains in the Genus database with same CATH superfamily
3G8TA 2CWKA 1X31C 3LOUA 2WONA 2C2DA 4PPZA 2QYCA 3R2CJ 3LP0A 3H46O 2G0CA 4OV6A 3HSTB 5C24B 2MMYA 4F67A 4D3GA 4IXCA 4CJQA 1XMQK 3EVOA 1VRTB 3M6WA 2WVDA 1FD2A 5G0RB 1XR6A 1ZA2B 2OO4A 4DTNA 3CO9A 5CCMA 1VBYA 4IFYA 5A8WB 2XB2D 4BRAA 2HHWA 3ZLJA 2KHCA 3U02A 1WSRA 3QAEA 2JL9A 3L7PA 3F44A 1VQOS 1TV6A 3FUYA 4GKJK 5LL6Z 1BU6O 1X0FA 2UXCJ 3MZIA 4F0HA 3C16B 4ILJA 4CF0A 4CLLA 5EXWA 1RBRA 2AX0A 4RW4A 3BBFA 2P2CB 4Y1DA 2E1RA 4IH7A 1T6CA 3GFZA 4U67Q 3P83D 2NCKL 1KR4A 3THYB 4KHUA 4J8FA 5DDPC 3IBCB 3MMVA 3S3OA 4C8YA 3JTPA 3VAHA 3NGUA 3O4QA 4C1NI 5AQMA 3CJRA 2P9LA 4X66J 3PR4A 4J9RA 1H74A 5FDLB 1U2FA 5AXLA 1HBMA 3OR2A 3G96A 1S59A 5I42A 1Q86T 2Y0SD 3MMCA 1VISA 2ATLA 4I68A 4BWJA 2HOEA 1WTFA 1CQNA 2VG5B 4QR1A 2MGZB 1RTDA 3I0RA 4KHQA 5AT1B 2RPIA 4H0OA 2QXFA 2YKAA 1QQNA 3P31A 1XI1A 2B5JA 4BROA 2PE8A 5HSPA 5CCLA 5KG6A 2XWYA 3SSRA 2YV0X 1HNWK 1W97L 1S79A 3DRYA 2JNJA 1HKCA 3SAHA 1B7FA 5A8KB 2HK2A 4JI6F 3W9JA 3F41A 4HEA9 3AD9C 3HX9A 3V9WA 1IBKK 4AXJA 3N4PA 4H0YB 4NZ6A 3ONQA 2QWRA 4B3MF 2RDJA 4CGJA 2HRTA 5J2MB 1XNRJ 1ATSA 1GLEG 2M8HA 3C94A 3CB4A 4JEPA 2I5JA 5DQGA 3PHTA 3W61A 3OL7A 1KFDA 3AAWB 5KFFA 2E2OA 5J1EB 3LPTA 2P9NB 3OYMA 3J81U 5B0EA 4FK4A 4WE1A 1BWVA 4QWBA 1FFWB 2ATCB 3HHLD 1CULB 5DMRA 1SCJB 1N48A 1T9XA 2BJDA 2A2CA 4F3TA 3SMZA 5A8KA 4F26A 2PSZA 2DR8A 2G8VA 3J7YU 4B3RK 5AQWA 1RA6A 1TUUA 1B7YB 1XMOJ 2X78A 4AHRA 3KDOA 2AIRB 2LU2A 4I6AA 4M3YA 1C1CB 4X66F 2J6UA 4Z2XA 1LFWA 1VOMA 1MN9A 2N82B 4NYOA 2DRDA 2M7SA 4PUOA 3TAGA 1RBLA 3ZTRA 1H2TZ 3QEXA 3AY0A 1SH2A 1UW4A 5A6WA 3QRPA 2MDAA 2F3JA 2AP1A 4DG1B 2QWNA 3JXUA 2E7WA 1B0PA 3IRXB 5K8MA 5IT4A 3W9HA 5M2RA 3VHQA 1S1TA 2J6TA 4OYZA 4E2FB 4KRFA 3OVNA 4FJKA 2YQ0A 1GMVA 4DQ8A 3D0PA 4J9QA 3J7ZO 2KFZA 4P9SA 2FVCA 2UUTA 2AHOB 4IR9A 1R89A 1UEKA 5HJYA 2E1PA 3EEQA 3UFCX 1LKZA 1MW7A 4JI5F 2R8IA 1DHMA 4YN3B 3VQDA 4OI6A 2J0SD 3KG1A 4IRDA 1DQAA 2Y8WA 1K8KB 2NRRA 4ECTA 2KKZA 2G13A 4NLSA 2Y0BB 1RYSA 2F8EX 3I8BA 3WHIA 3V81A 3F5TA 3ZZYA 3SLCA 3CDWA 2CKWA 4CLUA 1LWFB 3MM6B 2F8TA 3VAMA 2IRUA 2O4IA 4EFAC 5L39A 4QAGA 1ACMB 4JAXA 2WB4A 1Q86O 3VA3A 3GSIA 3UDEA 2DRBA 3BPDA 1NB7A 2NPFA 4HHTA 3GG0A 4GNIA 4UY8O 2O66A 4WQ4C 3IR7B 3CJ3A 1W25A 2M88A 1ELOA 3C6TA 2R7XA 3C15A 3V6HA 4USHA 3CCWA 1N8RT 4CZHA 2F1FA 3AB2B 3M8QB 3HVAA 3L95X 5D0RA 3I55S 3ZC4A 2XY7A 4USTA 2UXCK 3OYFA 3C8YA 2CPIA 3SAFA 2H5IB 3BKFA 3VVTA 3GWCA 2KDOA 2MYFA 1EAYC 2OGUA 3HD1A 4FXVA 4UUXA 4CGHA 2J9DE 1VQ6S 3ENAA 4R5PB 3P96A 4W4MA 2D9PA 3FJ2A 2CJYB 3ZT3A 2AQ4A 3P38A 3GL1A 1V5VA 3PRBA 3R5AA 4UOGA 4KBIA 2CNLB 4DX8H 4MIAA 4ZP7A 1KQGB 1VQ8S 1J27A 5C10A 2JDJA 1NHKL 3CM5A 4HI1A 4CCHA 5AQXA 2OTJS 1DQ8A 2IVYA 2P6TA 4LFBK 2Y1IA 5AE3A 3V1RA 3CUNA 4LVOP 5AE2A 4FYDA 2ZF5O 2MY8A 4Y0WA 3MR2A 2CUYA 5K14A 4K4TA 3T6JA 1C1BA 2XY5A 1BLUA 2KO1A 3MM7A 4ED8A 3R3TA 5AQOA 3PRDA 4K4XA 1DBDA 3UQSA 5C42A 4UQGA 3N28A 4JI2J 4JI5K 3RUBL 1T9UA 4ILRA 4WP8A 1XEZA 5C25A 1OSCA 4OJRA 3TANA 1YK9A 4EAHD 1U26A 2RRNA 3P5BP 4MK9A 1U1PA 2XMMA 2KU7A 1HR0J 4HHUA 4U7UD 3FRYA 1ATNA 1D1UA 3IWNC 1RDCA 1N8RO 2DJWA 1TUVA 5KRSA 4P2FA 3U7JA 3IBFB 3Q86A 3P1GA 5KG2A 2DK2A 4J91A 4E7JA 3CC2N 4A8XA 2EK6A 5AQPA 2AYBA 4X65K 4B3RJ 5D3GA 1WN7A 5F8IA 1RT7B 2IPOB 4PA1A 2HIYA 2RD5C 2B9YA 2LKZA 1C4AA 1UL3A 3TA1A 2ZE2B 2MQLA 4OYWA 3KUHA 4O3PA 4ZLLA 4G9ZA 3AXMA 5GADU 1Y5IB 2FVQA 2HBLA 1V4SA 1R8BA 3GMGA 3ASMA 2NUHA 3FR0A 4O4RA 1REVA 5AQYA 2DNHA 3EMTA 4E0DA 3PIOL 3R6MA 3THWB 4DS5A 2DT9A 4IRCA 2UUAK 2FYXA 2D0PA 1EETB 5E26A 2P9SA 3PJ9A 3VWSA 4F4KA 3MFHA 1WF0A 2A0FB 1RUSA 1PAEX 4DR7F 3QFHA 3TEHB 3ZT2A 2RB7A 2W2PP 3MR7A 5D3GB 2H9ZA 4LRFA 4HVJA 3R7NB 4EMDA 1RT7A 3TRGA 2VV5A 5K9FA 2IVFB 3P4UB 4GKKF 2ZNYA 5I3QA 3NVMA 2BRKA 2XEXA 1RWVB 5FIIA 1UVJA 3HFVA 3UVJA 2PFFB 1M1KT 3Q0AA 1E4GT 1PYTA 4NRTA 4Z4CA 4TU9A 2YKNB 2OH2A 3JAMO 1JLCA 4WKYA 1RBSA 2FTRA 3AO4A 4P7VA 4RW8A 3UKUB 3E8OA 3GE9A 1N52B 3SV3A 3I82A 4TLRA 2LQ5A 1GMWD 1WF2A 4BCAA 4W98A 2GX9A 3CJ1A 2NRTA 4CJ5A 1VS3A 2FY8A 5DS7A 1YLXA 3A3PB 2IIRA 1ZM2A 1DTQA 3K8VA 5HLFA 4K4ZA 1D0EA 3NGZA 2R2SA 1VQ7S 2OPSB 2LU1A 2GIFA 4P10A 2F4FA 3T1HJ 1D8YA 1RKIA 1PYSB 2M5YA 2Y1JA 1N34F 5CD4H 5HN0A 2V8HA 4MDBA 5H9EJ 1EB0A 1D9AA 2JOQA 2H4WB 1GLCG 4PXEA 2I1RA 2KZZA 3RTVA 3QEVA 1S9EB 1NO8A 4DQRA 3NF7A 3QIOA 3MK6A 3KLEA 3K9JA 3K58A 3MTJA 3C3LA 2PY5A 1SQEA 1GTHA 5IQ6A 2XGPA 3DDNA 4NXNK 4DXLA 4OI3A 1JLAA 4GV9A 3CJ8A 4IQMA 3SUPA 2ZOGA 3RW7A 3G10A 4KPCA 1ILYA 2N4CA 2YPYA 1VJQA 2UVRA 4M95A 5IXUA 1H73A 4C0OC 2DR5A 3UD4P 3IR5B 3BSCA 2UUWA 2OPQB 2VL1A 4ES1A 3J7AP 2CJ9A 3VAFA 1UAXA 3WNHA 1ZBLA 5JLHA 1YHQN 1R8AA 5DZ6A 3L6QA 2VFRA 2O8EB 1DTTB 2QGFB 4DSIA 4OHZA 1WJ9A 2ILZA 2RS2A 3FFIB 3UW1A 1CJVA 1S72S 1APSA 2FHMA 1NK0A 3MCMA 4A8WA 3E66A 3LO3A 4PQUB 2FBXA 2CQ2A 3KK3A 3H42A 2QTDA 4Y34A 4YOYA 2A5XA 3WZ0A 3CJBA 5IT9O 4B3TK 2WW4A 4X62K 3R9PA 4DV3K 3R5JB 1NMDA 5I3UA 2W24A 4ZP9A 4RPFA 1F60B 3T1HF 4A8SA 4E98A 1QM9A 3VQ8A 1QLNA 3KWIA 3OYJA 3D7EO 4JKHA 1RFQA 3MPDA 1OKJA 1GX6A 3BGOP 2ACYA 1SPBP 3CW2C 1JCGA 3O80A 2CYYA 4L3QA 5M2UA 4NOHA 2OPPB 2ZFHA 4Y1CA 1LCUA 2OD6A 3LH2S 4JI0J 3R1XA 2E6MA 1HWIA 2CPZA 4WXWA 5B0CA 1Q0NA 3KLVA 5IT9Y 1VSDA 3VQ6A 4EZ9A 4K41A 3FGUA 1Q81O 2HZCA 4O5BA 3QIPA 3W3SA 2HHQA 1J5OA 1S4EA 4ZVSB 5ETKA 1SJ1A 1YRXA 1NSKL 2BYCA 4WJBA 2MJNA 2WK4A 1CZ9A 1OYEA 4PL7A 2LP4A 1JLQA 3ICLA 5T41A 3DRSA 2NZ4A 4PHTX 1CLFA 2JLGA 3OFGA 1TUYA 2RRBA 2V69A 1ZC6A 1NKEA 3BN4A 2GCFA 1OQ6A 1N0UA 4DPOA 3CCUS 2XS2A 2QL5B 2KTQA 1BQNA 1RI7A 3BP8A 3AAQA 5GMKa 1E6YB 4YY3F 1ZBHA 2BKOA 3EICA 3CCLS 3TQEA 3MOJB 4DR5F 3M5RA 4NO7A 2LEAA 4CJWA 1HQEA 2V52B 3SJHA 5HRPA 4NE9C 1I3AA 2YHAA 5BREA 4X2BA 3QJPA 3PFOA 4P2XA 5JMVA 4TLQA 4B9NA 3AGRA 3F9MA 4CLWA 4ZVEA 4JS5A 1RAOA 1GMUA 1KSPA 4M3UA 3PNIA 2ZJQL 3BO4A 3MXMA 4CESA 1RHKB 4TN2A 4QYZJ 1YI2S 4MAKA 1NUEA 1N32F 1YQHA 4HCBA 1P9QC 5AFUA 3CJKB 1DT9A 4DV2F 1S77D 2DGTA 2ZWHA 1RT3B 5KFHA 1NGIA 5HAOA 2DNQA 3M4XA 4GKKJ 3SCIE 2JFDA 4NCGB 3B82A 3VGUA 1Z2ZA 5IWAK 4TVAB 1HL6A 2O8BA 3IXQA 4FPBA 3VQCA 3M8QA 3M9MB 4N47A 2VF3A 2P9IB 2V4JB 4FYYB 2VWBA 4NYPA 3WC0A 2HVIA 1VQYA 2NSBA 4FNHA 5H9FK 5CHCB 4DF8A 1Q53A 2AJQA 4Z4EA 1L3TA 3SQ1A 2B51A 3I8DA 1H7XA 1IO2A 2Q1LA 2B6AA 4A8YA 2Z30B 2DR6A 3H5XA 1WKLA 3MEDB 2YKQA 3UE5A 3K5MA 3ZO7A 4OJGA 3JSMB 1HHQA 1JLFA 1RWMB 1Q7YO 2QMXA 2ZWPA 1N34K 3SI6A 1RSCA 1SXLA 4DJBA 1JLCB 3CC4S 2AZ3A 2UXDJ 4P71A 3D68A 2WRMA 1RCXB 3GJTB 3MM8A 1RTHB 2OP5A 4FJ5A 5SUHA 1S10A 2W42A 4AILC 1CC7A 3GLJA 4ZCIA 4KAZA 2CPYA 2Q66A 1TKTB 1TU0B 5KT6A 1N5YB 4FJ7A 2RAQA 4LFAJ 5AQRA 1WD6A 2QKKA 4QOTA 1QAXA 3MM7B 3CMAS 1CJUB 3PYGA 4P75A 3VEYA 2UYTA 3T1YF 1UP1A 4J2BA 1SQFA 1R7IA 4CFCA 4ED3A 1MN7A 5BPLA 2IOCA 1NU4A 3HJFA 4BC2A 2C3MA 1VSHA 3H98A 1ZETA 2XMKA 2VQFF 1ZA1B 3CF5Q 3WNEA 2YWGA 1XWLA 1NBEB 2MZQA 5EHHA 5M1QA 3LP1A 3ZZ0A 2A1BA 4JI7J 2QWQA 3AVNA 1HPMA 4B1XB 2UUBK 1BA0A 2RT3A 4WYBA 4LQ3A 4B9VA 3FKBA 3BKTA 1SUQA 1QE1B 3KWGA 5J2QB 2B7BB 1VI7A 5KRTA 1TL7B 2W40A 2OCEA 3N5BA 2VA3A 4LF5K 2IDLA 4DFKA 2NRVA 2UXBK 4CO2A 1F5CA 1R31A 2BH1A 4N7TA 1S1VA 3ZSYA 2E7XA 2VC0A 2WTFA 2DPIA 3Q2SC 4M5LA 4QIFA 4DHVA 2HS0A 3DLHA 3RSEA 3OR1A 2JVOA 1HYVA 4MJKA 2RQCA 1HQUB 3DOMB 3BF4A 1VSLA 2WB1D 3TEGA 4LFCK 1EWQA 5A76A 1JLEA 5F3ZA 1HA1A 3VTIA 3FEZA 2HBZB 1T03A 4OLPA 3JAMU 2F4VF 3CCJS 4RO0A 1YSJA 1A9NB 1X60A 3T69A 1BE4A 4HTJA 3MEGB 2CVIA 3JTNA 5LOQA 4CJRA 3I0SB 4H5TA 1UZHA 3OUYB 2IMWP 4JOUA 1P9YA 4QWCA 2FSKA 1NJYA 3PVXA 1TAUA 2DGQA 3RR8A 3RSEB 2BV3A 2RQMA 4ED1A 3TPQA 2YXLA 4PWWA 1A0OB 2KVQE 1L3KA 1U1KA 3HVTB 4QW9A 1RADB 1FJ7A 4CF9A 2XMUA 3NS6A 2NREA 4CWBA 3SNNA 4JI3F 1D8ZA 3QGPA 2N3LA 1Q8BA 4NLOA 3ZZOA 3QJLA 5F8LA 3EKSA 2H5JB 3SV4A 3MDQA 3V9UA 1HWKA 1FRHA 2DNMA 5I42B 2B9WA 1ICEB 3NAHA 1JKHA 4PXBA 4JI0F 2ZUAA 4H4MB 4QIEA 5B0BA 3QZ7A 3VQPA 3L09A 1RK8A 1SBRA 1ULRA 4DV4K 2LECA 4K7QA 1M1HA 1B3TA 4KPYA 3J7ZT 3BGLA 4I64A 2AV5A 2PD1A 3NHGA 3DLEB 5CE3A 1VGYA 3Q23A 1V5IB 4RBVA 4C97A 2DNLA 4C23A 4M5GA 2W9BA 2EPIA 3UB5A 2QJ3A 3TWHA 4C3KA 3C66A 3PKYA 4BRDA 4TQRA 5F8JA 4GVLA 2N3OA 5M1NA 5KAKA 4H03B 1HBUA 5L9XA 4KKOB 3U1NA 1ZZNA 3DLGA 2IJNA 1MNEA 3O6WA 5DK5A 1L3SA 3QT7A 3MN6A 1A7GE 1SS6A 4GY2B 2ASYA 3KUEA 2YNGA 2V0NA 1ZOTA 1RTZA 4JK8A 3EYZA 4CQ1A 4XEIA 2FGCA 1YBUA 2V8VA 4KHSA 4Y2CA 4FWNA 2ZBCA 5KFUA 1PC4A 5CQGA 3FE1A 4K25A 1N5VA 3NY0A 3GQCA 4CLPA 3OL8A 4Y2IA 5KFSA 1LK5A 3ZNJ1 3AO2A 1G7CB 2VKZG 2IFXA 4NLRA 4C4WA 4TU8A 4FKXA 2DXEA 3FQLA 2EFPA 4RJVA 3K0JA 2ALZA 5THWA 2W4CA 4KI4A 2M2BA 1C2PA 4XH1A 4DB3A 2GX8A 1S57A 3V4IA 4CJEA 2VDHA 3ENOA 4CI0B 4MFBB 4CIGA 4CLYA 1S6QB 2O8FB 4OJ1A 3OVBA 2HSEB 1HWLA 3ULEB 2QSFA 3SJJA 2E29A 5JVHL 2D69A 1UCNA 1UAWA 4DV7J 4CW7B 2EHGA 2B56A 3LA0A 1YZ6A 3DRPA 4QZVB 1OSDA 3MURP 5HMYA 2HGNA 1X3MA 2CVEA 4RW7B 1GNKA 4RL1A 4ZPTR 5CZ2A 3SFUA 2Q1NA 4DDFA 4M94A 2PFUA 1K8KA 1WKKA 2O8DB 4U95A 4DV3F 3W5YA 5CYMB 1Z6RA 2Y9HA 1KQSM 5FROA 3Q8UA 2J7UA 5C2CA 5E3AA 2Q97A 5AZJB 3AA4A 2JEFA 2OTLS 3D6RA 3AJ2A 1O13A 1LWFA 3MM6A 3BZKA 3DOLA 4PZVA 1FRIA 3DXKA 1TL3A 1J54A 3NNAA 2Z58B 3VQSA 4IFVA 2FSJA 1T05A 4UOHA 2ACMA 3DI6A 4FF2A 2R7SA 1S22A 2KXHA 3CM6A 4RNOA 3M8WA 4LRDA 1SAZA 4G6VB 3B54A 3EVMA 3CD6S 3AVBA 1ROFA 4KV8B 2OYQA 3GE1A 3O8MA 4YDXA 1IBLJ 1FX4A 2GIRA 1TUGB 4J5OA 2C3UA 3AO3A 1B9FA 4NXMK 2KG0A 1IQTA 2A6AA 4JD2B 3TAEA 1UVKA 3CTRA 4CHZA 1O5JA 4CEFA 4BRPA 2GV9A 2IJFA 4DUZJ 4EYHB 3VOVA 2HZAA 3MWPA 2W2NP 1ITGA 1NSAA 4WQ4A 2QWPA 4NLWA 3ZT1A 4QWDA 4AHCA 4I7FA 1GLAG 2OMLA 1S0OA 1PBAA 3O9UA 1ZBTA 1A5XA 4FZVA 4JKCA 4W90B 2MHEA 3CMES 5AQVA 2XYPB 2MKHA 3SSSA 3K7RA 2HVHA 1R6VA 4HDGA 4Z4HA 2PDAA 4B1ZA 4UZCA 1RT2A 4K8RA 1RTIA 1HLWA 3M6VA 4AE5A 1BHNA 1ZTTA 4WTYA 1TL7A 4DBQA 2HB5A 3C65A 1U0SA 3MPUB 1YAGA 2DD8S 3GIJA 5C25B 5KFAA 4ZN3A 3WXJA 1BIZA 5GVQA 2LEBA 3U1LA 5IWAF 3BSOA 2ASPA 2YNFA 3KD5E 3D28A 1RCHA 2ZHOA 1VHXA 1WSEA 2HEKA 5CXTA 4NWBA 5CH7B 2PEHA 3VEOA 5JS2A 2GWKA 2OPRA 2DNYA 3M8RA 1VC5A 4PYAA 4LFBF 1YGYA 2YWHA 3NCIA 4DZDA 2GUPA 2HMPA 5E3QA 3KMQA 1RDDA 5FJ4A 1VQ9S 4QW8A 1ZYQA 4C98A 5KFZA 1S6UA 2WVCA 2J9CA 4BR4A 2EG2A 2PIIA 2MKJA 5KG5A 1LWCA 3NVKA 2K7KA 5KG3A 5DZ7A 3ELHA 2IDEA 2W7OA 4WIIA 3FBBA 4CJ4A 3EY1A 3R1HA 4DR4F 2R8HA 4OHWA 1Q82T 1CJKB 1TYQB 2XLJA 2ASDA 3ZSXA 1U04A 3MM5A 1CSJA 2NUUG 4NZ0A 1VQ7N 4FJGA 3VN5A 4DR6J 1VLOA 2XHCA 4A8FA 4KB0A 1HNZF 4CH1A 3HT3A 2OJ3A 3GV5B 3P5JA 2GNKA 4DV0J 1S48A 3NDKA 1Q9XA 2J8AA 3W9IA 2E5GA 3KD1E 4YDDB 4FW2A 3G25A 1U0HB 2ZBQA 2V2KA 2W7AA 4WBFA 4QQBA 4RG8A 4B9QA 1JCEA 3Q7CA 4ELUA 3OXGA 2ERRA 3PW5A 1DJ0A 1PSDA 1EZZB 3CQYA 2K1RA 1VQNS 1P6TA 5F8NA 1AUDA 4CZJA 4DN9A 1NAQA 3J80Y 2NR0A 2VC1A 1SVDA 4OZ2A 3KLHB 3NL0A 1RGVA 1CZAN 2R8GA 1NHUA 1F9HA 3UNGC 3KG0A 1R43A 4C8KA 3KWMA 2Q79A 1JL2A 1HI8A 1IJJA 2Q31A 3UKUA 1JXVA 2DR7A 3ZZZA 4KKOA 5J2MA 2HNZB 5BJRA 2G8UA 1BWFO 1EX8A 3DLKB 3FMWA 3AH6A 3ZXWA 2CIMA 3ISZA 3A3NB 3QRQA 3T9ZA 3AT1B 5KFEA 4XH5A 1Y5LB 4FOIA 1IM4A 4OGEA 4LSLB 1U8WA 3PDNA 3H7HB 4BWMA 2HNDA 1FNMA 3VTHA 2PFDA 2XLKA 5KFTA 4WFBL 1S0MA 3OA9A 3G6VA 1HYZA 5D4OA 5L46A 2DIUA 1VBXA 1IBMK 3DDIA 2DPNA 2I6WA 5AQFA 5EGYA 2BABA 5EY4A 2HVEA 3RBDA 1G99A 1WI8A 4TY8B 3CQ8A 5ETRA 2E5LF 5HVFA 3VGSA 1NGGA 1HD0A 2CQ0A 2HNZA 1VC0A 1H7WA 3BJYA 3QINA 1WOOA 2JC1A 1HNXJ 1HBNA 3K2PA 4P6QA 3KLEB 5GAHU 1WSIA 3DMJB 1FWPA 1I39A 3O9SA 4FXWA 4FWLA 1RAIB 4QBUA 2FC8A 5D6GA 1NJWA 3G86A 1BCMA 5DDRC 1PILA 4DV1F 5E33A 1KQKA 4IQXA 2B9EA 4LSZB 2GVZB 5KFJA 3L4BC 2B8QA 3IRXA 2X3DA 5A8RB 4LVNP 4ED5A 3DRRA 1N36F 1GH8A 2P6SA 2UUAJ 1K47A 1Q1KA 2GQCA 2PA8D 1CC8A 4AM7A 4P7TA 1RB0A 3T9NA 4RZRA 4DKWA 2L9NA 4PPDA 1S49A 4E1MA 4DTXA 3J8AA 3THXA 3VF6A 5HO4A 1SKSA 4F8RA 4U7CA 3WT0A 1UFWA 2QYGA 3CMQA 4GC7A 1BDGA 1FNXH 4IJNA 2OTJN 1RHJB 4DSLA 2KI2A 1KD1T 2LQ9A 2FB0A 4JKAA 2QMUB 2QA4G 4ZOSA 2FHJA 4DU8A 2FY1A 3CFPA 4MDAA 3CXCM 1R0AB 1RCOB 1BOTO 2GEMA 1ZTWA 2GW8A 5C15A 3H40A 4RBUA 2ROGA 1X3NA 5A2QY 1JLBB 1RHUB 4FP9A 4CM0A 4JKDA 4LR7A 2Q3PA 1X9WA 3U4LA 1F9FA 5EWEA 4H0PA 2IIHA 4N8OA 5RUBA 4AM6A 4KT0C 4LBIA 3L2RA 5DETA 1C0MA 3CNQP 4AT1B 4FLVA 4WQ5A 4B1WB 4OHVA 4B3OA 4E7KA 2FLNA 1H1VA 3L3VA 5HP1B 2R7RA 1P27B 4JI0K 2K06A 2YX7A 3VMFB 2QW9A 5F9NA 1Q5YA 2BVZA 3CVKA 4I2QA 3QESA 3I4PA 3TWZA 1Q9YA 4JYAF 2IRYA 1G6BA 1VIOA 1RXOB 2MKKA 5K8NA 4Y0FA 1TAQA 2GV1A 1HQ2A 1RDRA 3M7VA 4JI4J 3I31A 4JI3K 2G8KA 5H9EK 4CZKA 2XYGB 1RWKB 3K5OA 4ZN1A 4KTQA 4QIWD 5M1OA 5KG7A 1Z05A 3A5NC 4DL5A 3WEEA 4O4GA 1K0VA 1HNZJ 1BCOA 3PW2A 2QLJB 1WG1A 1RT2B 4M5DA 4Q43A 2H4YB 2V63A 1WTBA 4CZFA 3FZLA 3AB4B 3N0VA 2QL7B 1H72C 2Z2YB 2DXDA 3CJ4A 4LD0A 1K8AT 1WSGA 3BBBA 1WC1A 1CS4A 3AO1A 1BQNB 2DIVA 4O8KA 4R8UA 4CD3A 1E6YA 1TL1B 2E5LJ 2GWJA 1FKOB 3TJ8A 2AZ1A 4FVMA 4ZA1A 2D3O1 4WZQA 2E8AA 4FLYA 1VK3A 3KLIA 2PEBA 2CPFA 5L1KA 2J0WA 1IBMJ 1UVLA 4G1IA 4PEOA 3HHKA 5CD4A 1X5SA 2D3OR 1IBKF 2HPUA 2JJ4D 2RS8A 3P6YC 1NPKA 3E3XA 1QTMA 4X65F 1JWWA 1YIJS 1WC5A 2ZE2A 1F9EB 5JVGL 3RBZA 4LF5F 1C4CA 1EKEA 1PAUB 2ZD1A 3RRKA 2ZH2A 1NU0A 4DV4F 3S3NA 1RT3A 3RRGA 2RF2A 3CCES 1BG3A 1RAGB 1IXKA 3AV9A 4F0KA 1BQMB 3VF4A 2O4GA 2CZ4A 2UUBF 1EX4A 3D5MA 5K5MA 4B3RF 4MYTA 2AEFA 4DQIA 3C14B 2F63A 4W5NA 3DGVA 3MM9A 5KFQA 2VH7A 4LIRA 4KH0B 5C5JA 2E1AA 1U1LA 4DTRA 2J9DA 2VIHA 2NRXA 3KLGA 2N7YA 1WWHA 4YR2A 3AODA 3R7SB 1KVIA 2A40A 4FSVA 3T41A 1KKHA 2V2ZA 1OO0B 4ATNA 1UA1A 5D4PA 2F4VJ 3CD6N 1GTEA 1KEKA 5FPDA 2GMHA 2CGJA 5C7PA 2COLA 4Q5VA 1OJ4A 2IMOA 4H8KA 4ERDA 3O44A 5BN9A 4RWTA 4AL7A 5GAEP 4ANEA 3CFRA 3HD2A 5LJ3Y 1FWKA 4DS4A 2LVWA 2X1GA 4DTMA 3E9OA 1RILA 3KHRA 1NM2A 4BLGA 2RSQA 1HHTP 3WBZA 1M0SA 2HBRB 1HNWF 3NF8A 4ZLJA 1X8DA 1WELA 3O3FA 1LW2B 1MROA 3NCQA 3WIUA 5LMUK 3CCMS 3H25A 1FRKA 4MMOA 3ZX0A 4R0JA 3TO8A 3GFYA 3J81Y 5KG1A 1DY3A 2VFTA 4IEEA 3ZX3A 1E3MA 1ATRA 4HACA 5KFVA 2E1YA 1D9DA 1U2VB 1I5OB 5F2RA 2ZOFA 1VQON 4CYUA 1JL1A 3LM9A 2GQQA 1S1WA 3Q2TC 5KTQA 1YXQA 3GR0A 2G8HA 1DEJA 4DLGA 3QFUA 3T5KA 5BR8F 2D0BA 1TGOA 2DNNA 1Q81T 1SJRA 1N54B 3PZPA 2FSNA 4OYXA 1EKRA 2QT7A 4FS2A 1XBWA 2IRXA 1KLMA 5ETVA 3OFFA 1BUPA 1MWQA 2VQEK 2E1MC 3D6TB 2VG7A 5AFUH 2UXBJ 2VGMA 1PCAA 4I67A 1BO5O 3MMJA 1L5UA 3R7BB 1RNHA 4LF1A 2OZSA 2VPWB 2C2RA 3A8IA 2FZKB 4CZGA 3SQOP 3O6QA 5MAOA 5KG0A 4CM2A 1H6KX 3FBCA 3A2FA 4EP5A 3QGHA 1RLDA 1VJWA 1FESA 4CHOA 4XH4A 4RW4B 1TKZA 1UMJA 1SI9A 1K44A 5LMNK 1XERA 4IH5A 1NSQA 2FHJD 3GP9A 2PMWA 3DXSX 2W41A 1RA7A 3SCJE 3L9ZA 2OSQA 4H0TB 4H4OA 1JNZB 4DL2A 3OTOF 5BXIA 3KZBA 2XMAA 1XHZA 5KOWA 4CEQA 3D9BA 5DDQC 2O67A 3EO3A 4C2MA 3MHYA 1F2GA 3DYAB 3JAMY 1HBMB 3MXHP 4LQ9A 4DV6J 4F9OA 4ID8A 3CJAA 2X1AA 2QWMA 3B8AX 2G8IA 2QK9A 2DNRA 4JBCA 1VDHA 2EFGA 3I56S 3GR1A 2V4RA 3N4QA 4IG3A 3HVTA 3QNNA 5IC4B 1U7LA 1QSSA 1N34J 1AUSL 3SYZA 1TVRB 4M7XA 5JICA 3UWTA 1TKDA 1IWAA 4DU1A 2BANB 3IG1A 1T3NA 2VWJA 4L8RB 3LP2B 3ENBA 1RT1B 1VYAA 4JK9A 4DR1J 1VQKN 4RCHA 3HM8A 3DYAA 2LA4A 4EEYA 3HK2A 3ENVA 5IT0A 2FBVA 5T14A 2MB0B 3I0RB 1C0TB 2R7TA 1XMOK 2HBKA 2XCAA 4JNEA 2HQFA 3OTEA 4OZ1A 3ALYA 4OX7A 1XMBA 3O9TA 2QA1A 1Q4RA 4DR3F 3W0LA 4ZVHA 1NGDA 3VGTA 3PJXA 1F5AA 3C15B 2JX2A 5F0XA 4CVNE 3G0ZA 3CIPA 4C0HA 4YR3A 2H3EB 3OS2A 1RDUA 1NXIA 4K4YA 1DFDA 1S6PA 4WFNQ 4CHQA 4AHTA 1TKXA 2EI5A 4YP3A 2GJIA 2XULA 1G4CA 3VETA 1JB0C 1IWGA 2CJQA 3B6OA 1CJTB 2JRSA 4OHYA 1KAYA 1QVGR 2KM8B 4M5DB 3D66A 4RW9B 4FM1A 2ABYA 2P9NA 3NAEA 3BM7A 2HZVA 3K59A 2PGCA 1RDBA 1T94A 3G82A 1RWWB 5KFGA 4CT9A 3AQOA 3GSDA 5L38A 3PFEA 2OZMA 1K73O 2GTDA 2GJFA 1J5OB 4BRCA 1J5EF 1X5PA 4BR5A 3MF5A 4NPOA 2FC0A 4IOAL 3TZYA 1NG9A 3EZOA 3EWGA 3ID8A 1KBRA 4I6MA 3H08A 4EBEA 1YITS 1KAZA 4E3SA 3J81j 2ZJPQ 1YJNS 1S5JA 1X4HA 2V8GA 2P9KA 4LF7K 2OFHX 1SH0A 3D0HE 4DG1A 1LOTB 4O44A 4YOXA 4LFCF 3R3LA 4USJC 2RKIA 3TAMB 3RMCA 3GYNA 3EN9A 3LPYA 3GDQA 4RTFD 1UTAA 3RB4A 2P5OA 2BE2B 1ZPWX 4IZ9A 3MPYA 2YNIA 4M3XA 4NLYA 4PWDA 5I4MA 3QATA 1F5BA 4DV1J 3CMAN 5IM0A 3AO5A 3N01A 4PG8A 5DM6Q 5HOOA 2M0GB 2QA2A 3ZFVA 2A1SA 1ZAXA 3VF2A 5DG9A 3GYGA 4ZVUB 1YT3A 2EWSA 3K8WA 5KFLA 5AQLA 1N33J 2R2RA 3CJSA 2BOPA 9RUBA 5HL7Q 1JXEA 3EGWB 3S3MA 2QO3A 3QO9A 2RKIB 2ZZTA 4H4KC 4CF1A 3QJJA 3P3DA 5LSRA 2HRUA 3M6GA 2G0JA 4IDKB 2NPIA 3G6ES 3GBTA 4ES3A 3ZTSA 1TR0A 3MOZA 4OVLA 1G1XA 2MXYA 1F3FA 1IR2A 4NI2A 4BDPA 1LW0B 2DGWA 5LJVA 1NJIO 3L4IA 1V3ZA 3AVFA 3GJRB 4ECSA 4L74A 3MCAB 3EJMA 2HHHJ 2Z2LA 3QQCD 1FDDA 4BQLA 3Q22A 3W62A 2R42A 3HF5A 1NGAA 4Z37A 1X4FA 4X84A 3TSPA 4BRMA 3A8EA 1RLCL 3HHDA 7FDRA 2WOMB 2R8KA 1MROB 4IKFA 2F8MA 5KQDA 3RMBA 1EHWA 4MKBA 3UN2A 3PO5A 2IY5B 2ZOMA 1ASWA 3QO9B 1NOYA 4C11A 4G1QA 4M63C 2DNKA 5AQUA 1HX1A 1N5TA 3R1LA 1HI1A 1AROP 3OYEA 4IOXA 5AZIA 2LXFA 2BW7A 4B3SF 4H5RA 3TTDA 2JGUA 4TU7A 1M1GA 4RW6B 3IS9A 2IC3A 2D3UA 2ASJA 2BJ3A 4CF8A 1SC1B 1ZH5A 1T9WA 3OYIA 3HOSA 2CZVC 3N6NA 5KFWA 1MMLA 3WXIA 5J2QA 2FUG9 2ITGA 4KIAA 2WOMA 3MDFA 4F0MA 2BJ7A 1FDBA 1M5HA 4J2EA 3L8BA 2OPSA 3H8YA 4DV5K 2R7VA 2E1ZA 3ZZTA 4MIBA 2ZD1B 1C0UA 2ZH5A 2QFJA 4HT5A 1FWLA 2EVZA 2OD4A 4U67L 4E1NA 2MQNA 1W9HA 5D78A 3OTOJ 3CCLN 4CFAA 1I51B 1V4TA 2OPRB 1QZ6A 1BQMA 3GONA 4BRQA 1EO1A 4RW6A 4P72A 1KONA 3DFEA 3WIVA 2RQ4A 2DNPA 3AY9A 1EXQA 4TNOA 3BZQA 3UKRB 3I9V9 3EM1A 5FLXY 1U6FA 2HW3A 5BPNA 2QZ8A 3TJ9A 3HPOA 3CXCR 3PUFA 3NXZA 5DM7L 4CZLA 4JI1J 4NEZA 1TFWA 3FDSA 4CZCA 4YB1P 5BRFA 4GV6A 5LMNJ 3HSDA 4JHDA 1SJ4P 1T9YA 1U6ZA 4A59A 2YNHB 4ZTJA 5DRKA 4RU9A 3E9LA 4QPTA 1XR5A 2KT3A 1VMBA 4FF4A 1U6BA 3OW2M 2VFSA 4ZVGA 3S01A 1TYQA 1WKJA 4UOFA 1LXJA 1PIEA 3R8YA 2OMOA 3CPWM 4BR0A 1KC8T 4FJMA 3ZSQA 3OXLA 1YJ9N 5AJ3F 4LBHA 2ZKTA 2B7CB 3MM5B 4V19X 5IWAJ 4ISFA 4CERA 2ZITA 1FRMA 4JB8B 2XSJA 1QJHA 1SH3A 4F3MA 1LW2A 1HPZA 5KQ8A 4WK1A 2VD3A 1AA1B 3U3YA 4KGVB 3KK1B 3ZZPA 3G71N 5E7OB 3H1VX 4RNFA 3NNHA 4OI1A 2P9LB 4XPEA 3C19A 1DKGD 4DMNA 1RTJB 4M45A 5HLFB 2DBBA 2R4FA 4B3MJ 4FS1A 1T9VA 1VSIA 4H54A 4NA2A 3K17A 4CYUB 4BG9A 3QGGA 1ZPVA 4KHPJ 3GJSB 3CDAA 1D4XA 1RYRA 5HROA 3OBYA 2RHSB 2ASLA 4Q0BB 2AF6A 1U02A 3AD8C 1LEOA 3U3GA 4GMKA 2QLXA 3M8PA 4KSEB 4RLEA 2XTJP 1HBUB 3I5CA 3IWLA 3OL6A 1NEEA 5ETMA 3M8SA 4LMZA 2M52A 4O0NA 3DLGB 4DPUA 4IKAA 5FDLA 2OANA 4WZMA 2I7NA 1B64A 2V68A 3KJVA 3NBPA 3PEHA 1FKPA 1HJRA 5HANA 3VAJA 4JRQA 4O3NA 3CJQA 3VQEA 3O1LA 3JQMA 3GG1A 4CBUA 5JXSA 4HWIA 3GCXP 1RTDB 1R0BG 2DHHA 4ZLPA 4OYIA 4CJKA 1UETA 2DCUB 3ZSOA 5ETNA 5KG4A 3FRZA 2BJ1A 3MAAA 4FWQA 2CQ4A 1M5PC 3NKYA 4NLXA 4QWAA 4ECRA 1BC6A 5K20B 3FCWA 5GAHI 1FT8A 4XK8C 4JKEA 4DR5J 4AYBD 2W9BB 4YOTA 2NXUA 2H54B 2BOAA 4A5BA 2UUBJ 1YJWN 4DPXA 3HKWA 4CJFA 3THVA 3ET6B 4J7CA 3B4DA 2G8WA 1Y4ZB 4IOCL 4BVPA 5HQLA 1QZ5A 1RBOB 1BWEA 3OYKA 4NLGA 2AX1A 2MLXA 4ICLB 2YNGB 5F1XA 5BR8J 2D1KA 5KFMA 1IUJA 4QCLA 3WXMB 1E6VA 2ROPA 3GIKA 5FPNA 1RT5B 1XC3A 3GU0A 3HSZA 1KLNA 4NA3A 1OVYA 4KO0B 3M8YA 3L2WA 1CJVB 4LREA 4DCHA 4N8NA 4U7UK 3AVAA 1RISA 3MUTP 2FBYA 2YJEA 3GILA 2AMCB 1KC8O 2FLOA 1UJ5A 4I6WA 4DR6K 5I3UB 3QZ8A 5D4NA 1QS4A 1NPPA 2FD2A 1EKSA 4KGXB 4QR2A 3HSGA 3SBTA 4PUOB 3RWUA 4OPJA 4FK0A 4OHXA 1YBAA 3CJ7A 3LP3A 2BUNA 1VQLS 4QIGA 3GJQB 5T7LA 4ED4A 2R2UA 3CJKA 1WSHA 1DAXA 2GGPB 2O5DA 3ISND 4MFBA 5BYSA 4HR2A 2YWWA 2OAUA 2P9GA 4BC7A 2G0IA 4URGA 4HDHA 2GO8A 5DM6L 1FK9B 3W2WB 3S7RA 2XWXA 3TZXA 1JLBA 4BGAA 4K4VA 1UVMA 2R3VA 2FJEB 3EUNA 3DRPB 1FVSA 1YJRA 4ANCA 4KFBB 5HI7A 4BVOA 3IA0A 1GLLO 1RP5A 2NUBA 5BRHA 1J5EJ 1ZBSA 5HL7L 4C0BA 4OKJA 2WTUA 4NYZA 3O4NA 3WXLA 1U1QA 2VONA 3EZWA 2A2DA 2KXNB 3RYLA 1HNXF 5KT4A 3GIRA 1BHLA 4OZ3A 2RE1A 3U9ZA 1WOPA 4PG5A 2ZUGA 4IG0B 3RU0A 4N76A 3X1LB 3MEEB 3VVUA 4RNNA 2HFOA 3BN7A 5FLXU 1FRLA 4BR9A 5L9NA 4JV5J 1O6XA 3F56A 3HPHA 4CHYA 4B3TF 4JKFA 1VSEA 3IR6B 3EDRB 3BV8A 5AE1A 3OQ2A 4DV6F 3IM8A 2CRLA 1FFSB 1UVNA 3MUVP 3CC7S 1U1NA 3LWLA 1U8SA 4JKGA 4LT6A 1WUUA 3H2VE 4DR7K 4W5RA 3VEWA 3Q8QB 2YY3A 2CQPA 1VR6A 2X51A 2VQFK 2KJVA 4JD2A 3IAM9 4WFYA 2FGOA 3AA3A 4FVUA 3DU6A 2G1HA 4OYPA 1TL1A 3SDEB 4OFZA 1N6QA 3VGVA 3ISNC 4B3SK 5ADZA 2OLWA 4FM0A 3TTCA 1VRUB 2XCPA 4YOUA 3GIIA 1W26A 3MMBA 3A13A 1HNVB 1NOZA 5E3PA 5C24A 4PWDB 4NLBA 3OYDA 1WNSA 3V5RA 3GV7B 4ZPAA 1NHVA 2HURA 4ILHA 4MT1A 1VRTA 4DUYJ 4KH1B 3SQGA 1QY7A 3KFWX 3NH2A 1VQ5S 3QMLA 4FJJA 4MLEA 1WF1A 4Y28C 5CYQB 4Z7YA 4NMLA 4DOZA 4ZJQA 2E7VA 1H0HB 4FWOA 4WFAL 1QUVA 1JLGA 3CPEA 1BXNA 2PYJA 1FXRA 4K0KJ 1MSWD 2J9EA 4D3HA 4DV0F 3WXKA 3F0NA 3F73A 1X1PA 4W5TA 1NH8A 1VRUA 3CCQS 3AA8A 4X4QA 4J2DA 3JSMA 2MQPA 4QPXA 2F9WA 4NI2B 4LRCA 2W2OP 1QVFR 1BI4B 1HHSA 2QM1A 1VQ6N 3FSIA 2CDRB 5DLGA 5JS1A 4DFJA 1EETA 3TR5A 1K1QA 2XO7A 2CJBA 4NLVA 4GW6A 1LAWA 4OJHA 4O3OA 1FXLA 2HQ3A 4I9LA 3NCPA 3MEGA 1WBDA 3I55N 4NX9A 3SCXA 1S4FA 3O3HA 5AQZA 3IC1A 4EYIB 3L3CA 1Q78A 5KOXA 3BSAA 5IC6B 1XJWB 1TFYA 2WHOA 2RH3A 5F9LA 4CIEA 2MGZA 2ASMA 1N32K 4FM2A 1IM6A 5B08A 3GIMA 5KT5A 4I2PB 2M3DA 5HRSA 3BF1A 3BQ2A 3Q8VA 2VG6B 1VQLN 1T8EA 2N7CA 5JUMA 3PYFA 3TOQA 3CT9A 1IJEB 4ZPDA 4FF1A 3LP1B 2BEFA 4DCJB 4NL5A 4L73A 4TYBA 3A5MC 5HBMB 2XSFA 4MQ3A 4OLOA 4CHNA 2FHKA 2I9SA 4CTAB 3ENQA 3ZETA 5KFIA 4EHTA 5HVHA 3MCNA 1S12A 4EIAA 4DR2J 3BDPA 3A8JA 1PKUA 3O3GA 1K8AO 2RNEA 2GVDA 3POTA 5KFKA 3DU5A 1WI6A 4UQTA 3A8YA 2DTUA 2NXNA 4PY5A 3OXFA 1H2UX 1S7HA 3OY9A 4NLQA 2KB2A 2QSWA 2NZTA 2X1BA 4TY8A 4WYLA 1VSMA 3V9ZA 1WB9A 1RQ0A 4U9RA 4I0WA 1N88A 4DR6F 1KLMB 3RB0A 1VQ5N 1YJWS 4GC6A 3NRBA 4USUA 3NG8A 2JFKA 3EGNA 2HWIA 4DUZK 1S1XB 4HHHA 3UPFA 2XS5A 2UU9K 2J5AA 3BQ0A 4RNHA 4BHQA 2LSNA 3VQ9A 3QBXA 3FFIA 2L48A 5B0AA 2HNDB 2KN4A 4J9LA 4Q2MA 3NF6A 2LMIA 2DITA 3D1QA 2HHHK 4KO0A 4OX6A 1PJ6A 2E2QA 3G6XA 1M5OC 1O0PA 4WIQA 4C8MA 1V9OA 2HF3A 1T03B 3PSIA 1KWMA 1LNQA 1EQYA 3THXB 4R25A 3G8QA 5CZVA 2CAJA 2Z1HA 1SB6A 5H1SV 2ZC4A 2R8JA 3CC7N 2IM1A 2G8FA 3UDLA 1NRKA 4PABA 4OYOA 1NM1A 2DNGA 1GOAA 3V81B 1S9GA 5TKWA 4Y6IA 2MSSA 2VG5A 4HH0A 4IO9L 3G2XA 1RAEB 3FCVA 1FD8A 3V9XA 4IWVA 2DFFA 3OYNA 4WU3A 4LIWA 4NLUA 4C8LA 2GVZA 1H3DA 3LDQA 1RE1B 3O9QA 2Q0RA 4AQYJ 3AA5X 1NK6A 4RWXA 4ECYA 2NQPA 4Q0BA 1OPIA 2BMBA 2X74A 2KRBA 3KK2A 3FZMA 4BRKA 3NGKA 3OYGA 4ELVA 5GAHP 1PJ7A 1JLQB 1DURA 2UVUA 1FJGF 3PACA 1UPMB 1GXUA 1RT1A 1L3UA 2XYHB 4FYWB 2Z1IA 2GFFA 2LXIA 3K9KA 4E7LA 3IN5A 3R6GB 4DTOA 1S9GB 1RGIA 1TL5A 1DLOA 3NS7B 4DR4K 4CGIA 1CG2A 2C2NA 1NGCA 2P9PB 4G65A 3UD5A 2APOA 4JYAK 3VF0B 3M8ZA 2D9OA 2QC3A 4NLDA 4DN0A 4DUTA 4B9LA 2VB6A 3ADAC 2QKBA 3O8WA 4AFFA 4E8UA 2HGLA 2YTCA 4JI1K 1SKRA 2VU5A 3QIPB 3KK2B 1UWBA 2EBGA 3OBIA 4ED7A 2G9OA 3GPAA 2E1CA 1K1SA 3K5PA 3M6XA 1UOCA 1YJUA 4O8UA 5K14B 2QG9B 3ID6A 3EX7B 3ET6A 4M41A 2F65A 3HMJG 3R97A 3W3DA 2OPPA 1AZSB 4NRUA 4DX7A 5AQHA 2KT5A 2X3GA 1ZAVA 4BC9A 2MZTA 1VBKA 4OI0A 2P9UB 2R7OA 3LF0A 4R79A 3QLHA 3DAWA 5HRRA 4DUYF 4USKA 2IGIA 3AA2A 1HW8A 4C6AA 4USMA 3TUPA 4OYMA 1KAXA 1REGX 4XAKA 2CGLA 3IAYA 2A3ZA 2HG4A 1HQEB 3T5HA 4MK8A 2RN2A 2BR0A 3D67A 1XC9A 1TK5A 4PR6A 1NGHA 3LDOA 2XGQA 3SAGA 4NLCA 3Q8RB 4AHVA 3KNGA 2MKCA 3M32B 5F0WA 3EXYA 1KVAA 1EIYB 4LSNA 1OVQA 2K3KA 2VA2A 1UPPA 4FJXA 3GFXA 3NH1A 3DC2A 5CA5A 1K9MT 4QYZK 3SQGB 3M9OB 2AWZA 3MCPA 1CPZA 1OIAA 4L76A 4Y2AA 3I32A 3HKZD 3VZHA 2AEJA 2IAJB 4OV1A 4O44B 3PLAA 3MAQA 3H5SA 1BA1A 2JSXA 1GQEA 3HO1A 2KHDA 1IKWB 1VQSA 3MAHA 3D2EA 4B3TJ 3QWPA 3S8SA 7AT1B 4Q8FA 4LUBA 3HZEA 3SPYA 1REVB 4CZIA 5J2NB 1BMQB 2P9SB 2FBTA 3FFKB 3N4WA 4DUZF 2DGOA 4BC4A 3WX8A 1FO1A 3CJ9A 4CK2A 4DHYA 1GLFO 3HZ6A 2RHQB 2KVIA 4KFBA 1HKBA 5HQ8A 4FPIA 2D7SA 5DQHA 4KBOA 3CD0A 4B1UB 1R8HA 4FYXB 3ILLA 4OMFG 2K2PA 4PG7A 3O08A 1B0TA 4DR2F 4A62A 2RILA 2XMVA 3HHEA 2UXBF 3TUZC 4BR7A 3N6LA 4IG0A 3R8EA 1WC0A 3G6EN 1IKWA 3D2EB 3HI9A 4IYQA 3RG6A 3DI6B 3E51A 4IOBA 3QFWA 3EE3A 2D4WA 3MEEA 4FVCA 3M6UA 4L6V3 3QMQA 3RW6A 1EWRA 3CFOA 5J2NA 3P5TL 1U45A 3MR3A 2E5JA 4PWUA 4ZVOB 2OA8A 4RW8B 4W5OA 1VQPN 3HBTA 1KTVA 3THPA 3BGRA 2VWKA 3HP6A 3G71S 4EK2A 1KXPA 3W5ZA 1NJXA 4O0IA 1KDNA 3PJWA 3C6AA 2W4DA 1RHRB 4DV4J 4YB6A 1LWEB 3MEDA 4BBYA 2ZJRQ 1YJVA 2P5VA 4AUKA 4N56A 5E3RA 2W8KA 2F40A 1KRPA 3DHXA 1FJCA 1OMSA 2LDIA 2JWNA 3POTB 5GAGP 2ILYA 3ZNUA 3I5BA 4LRAA 3D45A 2PC6A 3S9HA 1AXQA 1KFSA 1RBTA 1OH8A 2CPJA 4TYAA 6FD1A 5AZIB 4J9UE 1HNVA 2W9AA 6AT1B 1D9FA 1JLEB 1IKYA 5KPZA 2Q6BA 4OIXA 2RU3A 3I9ZA 2V7ZA 4JI3J 4ECVA 2HFUA 2WUSA 2CNKB 1RHMB 3J7YP 4HLBA 1M90T 1QTNB 3T1YJ 5BYRA 2ZVIA 3HSJA 3KIOA 4V1Ak 4LBPA 4X4NA 4PKDB 2N4DA 4HCCA 3U27A 4A46A 4LF7J 5KGXA 5F8GA 4B9TA 2SXLA 3TNVA 4CLKA 1FW6A 3EKUA 4HACB 5ELZA 2WONB 4DR3J 1CJKA 3W2VA 3UD3P 1UVIA 2D0AA 3SK3A 1R3NA 1ZM3A 2UXDF 2UZAA 4CLFA 1GLJO 1VFJA 4DMZA 1WG4A 4OZ5A 1X9JA 5IV3A 4BACA 1XUPO 3CD5A 4CIFA 2LQ8A 3CCVS 4GRSA 3SMSA 3M2UA 1XNQK 4H4OB 1YUWA 3VR1A 4LF8J 4S0MA 3HI0A 1C1CA 1JKHB 2QE5A 2ATQA 4WF9L 4JN4A 4CK3A 4P73A 2MPUA 3OYAA 3MCOA 1D09B 3ZTOA 5B7WA 3AJ1A 1HJOA 3LDNA 2WZ1A 1JNRB 2PO4A 4LF2A 2WFBA 1KTQA 4X64F 4IR1A 3ZT4A 4Q45A 2DRAA 3RB6A 3KTQA 5KT7A 4E7IA 3ZEUA 4KHPF 3FSYA 2E20A 4N5SA 3W5XA 4DR7J 5KFYA 4A8OA 3WC2A 2DXFA 3A0IX 3SQ0A 4ZVTB 1HYSB 3IG1B 4NEYA 2FPHX 3OSPA 4JI7F 5EVZA 2VQEF 1KHWA 1VQMN 1A5WA 5HBMA 2H51B 5A2QU 4M1KA 2YVSA 2CQCA 1HFEL 1HRHA 4DU7A 1Z26A 5BR8K 1OS5A 2HVDA 5GIPA 3L7OA 2K1RB 4ECQA 3TJAA 2F9JA 1HIYA 2Q6CA 3I56N 3CO0P 7FD1A 4MKVA 4DL7A 3UN3A 2YH1A 5C12A 4FJNA 2CG4A 2W6LA 4OL8A 3LDSA 2MSTA 4Z4IA 1QSYA 3GFHA 4ECXA 1Y3KA 1YRUA 3HHLA 4KY3A 4ZITA 3SFGA 2YPZA 4J90A 3JS6A 2AU0A 2MLYA 4K0KK 2KFYA 5BRDA 2CA9A 5D15A 1WSJA 2I5JB 3IFEA 2OHDA 4EBCA 3R5GA 1UZDA 5H1SQ 4MLHA 8AT1B 4IRKA 3VEVA 5LMUJ 3BEGB 1I6JA 3CD7A 3QLHB 2JEIA 1Q8IA 3TVYA 2QI2A 3MECA 3OFHA 4P2MA 2BQ3A 4DV7F 4M5HA 1RT4A 2RUSA 4LH5A 4DL0C 1HMVA 2CWXA 3UIQA 2Y3YA 2B4JA 4Z4GA 1XQIA 2VOOA 4A2AA 3KYLA 4GO7X 3H2UB 6FDRA 3IWXA 3WEEB 5FPEA 1SIZA 1LFPA 3MXIA 2LQJA 3QNWB 4I6MB 1MWMA 1OQ3A 1TKXB 3OD2A 3P39A 4PYDA 4CGDA 2XBPA 2HWTA 1KQSR 3C7NA 1V6HA 1CJTA 2MQMA 4QJVA 2BTFA 3M30B 2W8LA 2RDDA 1TTHB 2XZTB 3B6BA 3OS1A 1NPRA 3EGZA 2HKEA 4ICLA 3A8KA 2FC9A 2PA3A 3HL8A 1NDKA 3KXDA 2K7JA 3P4IA 3LL3A 4DR3K 5LSLA 4AD6A 4DTJA 5GMEA 4QU7A 1OH7A 3KLFB 4LR9A 4NCGA 2KYZA 3OJUA 1TMJA 2HNYB 1FE0A 1JXLA 2BE7D 4MH8A 1RAAB 3CCMN 2FVPA 4PXDA 2DY1A 4K2JA 5CHIA 3CULA 1HKGA 2V50A 1U25A 2V4JA 2UV8A 2CQHA 4QWEA 3J80U 4ZDNA 1KCFA 4CJUA 4I6YA 4JYAJ 1GMWA 4KHWA 3EZUA 3R2DJ 4K59A 1KP6A 2B6AB 1R0AA 4TQSA 1NB2A 4IDKA 2ZZMA 2UV8G 5J1PA 3UCZP 3DXKB 4DCPB 1SKWA 4JI1F 5L1LA 3CPWR 3AOBA 3CE8A 4FZYA 2F9TA 1HW9A 4RW7A 2YKMB 1Q16B 3GYXB 4LC9B 4FW1A 4ID5A 5EN1A 3KKFA 3HDSA 1OH5A 3NE6A 2X6NA 1B70B 1TL4A 2DH9A 2B4VA 3W63A 2EWHA 2H5EA 5IT9U 5D4LA 3CWJA 1VQKS 4B3OB 1URRA 1SIWB 5IM0B 5ADXA 3ATVA 3TVZA 1MWZA 1T11A 2HHSA 2Q0UA 4CDIA 1RU1A 2I8EA 4Z7CA 3OYLA 5LL6d 3NP5A 4CO4A 3RMDA 4BRNA 2QWLA 3MCSA 2E2NA 4IEIA 2CQGA 4GVMA 2MZRA 4FBTA 3BY5A 4BG8A 3CCEN 2ZH9A 1RWNB 2V8PA 2ZJRL 1RBUA 4QS7A 2J7KA 4JV5K 3O5TB 2OEJA 4ID5B 2NXEA 5KFXA 3HM9A 2P1JA 3LP0B 1ZBUA 2ZH6A 5EOYA 2VPYB 4OLAA 4NYFA 2D0CA 3BB5A 3G4SS 4DPTA 2HHXA 2C2KB 4KB1A 3LM2A 3ENHA 2JWLA 4KHYA 3I33A 5F3TA 3NGRA 3H45C 4DL3A 1SV5B 4IFYB 1X9MA 4ZS6A 3US5A 3J81O 3DLJA 2ZH3A 4F2RA 4DTPA 3C2PA 1NK9A 4KGZB 2GELA 4A5AA 4G1QB 1F6TA 5JMNA 4JK7A 2VUGA 4V19J 1EQMA 2X6SA 4WCEL 3MN9A 4CNZA 1PJ5A 1YJTA 2RJZA 1NBWA 4DX6A 2RF2B 3PIPL 4YEAA 3CCRS 4M42A 3I5AA 4XPCA 3MMBB 4NA1A 5LT5A 4WCEQ 1GLDG 3UKRA 3KVGA 4CO3A 2ITMA 1YTAA 4BGBA 4EU0A 4CH7A 3MMAA 1B99A 4DR4J 4IBNA 3QEWA 4YB7A 2XHBA 3DOKA 4YUDA 4X4PA 1XTZA 2ZDPA 3OR2B 1EP4B 2ZBRA 4KHMA 4CEOA 2VASA 4G3IA 3WUHA 1IQZA 2GA7A 2Y8YA 3C16A 2QTWA 3PHEA 1FJGJ 4CFBA 4FDFA 3LPEA 3TAPA 1LQ9A 5SWMA 1JLAB 3DHWC 3MPWA 4RBTA 2UUCJ 4EFHA 1RTHA 2KLAA 4CBXA 4WU2A 4C3LA 3KKSA 3NMRA 2B5JB 2EW9A 1IVZA 1HLUA 3T1HK 5AQJA 1F21A 3PR5B 2EFNA 3OHBA 2EFVA 4PQAA 5GAGU 3BYPA 3V1QA 4FWPA 3VALA 2E5LK 2XS7A 3FZBA 4ELTA 2V34A 1IG9A 3R6LB 4J9SA 1MA9B 3CF5L 3PX4A 2I38A 4OYBA 4LFCJ 4LF9K 1JQGA 4DR1F 4LSLA 4IO8A 2VHGA 1TZ0A 1VK8A 2GJ2A 3IUCA 4PL8A 3JYTB 3RAXA 4KR0B 2GHPA 5I9EB 4KREA 1P90A 4X4OA 2YKNA 3BR9A 2KRRA 2YHBA 4F4ZA 1O8BA 3HHLB 4C1NK 2ZH4A 4FXDA 3O1BA 2QA4N 4FYVB 3D1HA 2QRRA 1Y00A 5AQGA 2OEMA 2IYIA 4O55A 3LDLA 4NASA 1XNQF 1Q79A 2M70A 4ANDA 2XZWA 3S6EA 4GV3A 2Z57B 2ZEJA 3ZX2A 3CCTA 5ETPA 3CJ5A 2VQFJ 5IOLA 1G2EA 3VZIA 4KQZA 4HTIA 4DV5F 3PG9A 1XNQJ 3MXJA 1IBLF 4AXIA 2W7PA 4H5VA 5LXYA 3W2VB 1QUPA 2OELA 1QAYA 1RWXB 1FDAA 5D8HB 2EFOA 5DM7Q 4PAAA 3FMBA 1EQ0A 1S1TB 2MKSA 2MQOA 1Y11A 1HWUA 4H0VB