1DTTA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-2 (pett130a94)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
543
structure length
540
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-CHAIN
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/transferase
total genus 126
structure length 540
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dttA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dttA05
1BGXT 4IFYA 4RW4B 1C1AA 3M8PA 4URQU 4E89A 5KFBA 4DTRA 4TYAA 4CGGA 3NGDA 4ZPAA 2IOCA 1NJZA 4CF8A 4O3PA 2KZZA 2D5RA 3HP9A 1S1WB 5KFXA 2NUBA 3KLEB 2OZSA 5KFTA 4FJJA 5KFNA 4KPYA 5KG3A 1Y97A 3GIKA 2ITGA 2YKMA 1EXQA 3NF6A 4FJNA 1JLCA 4QW8A 3OYKA 3DRRB 4ZVHA 1L3UA 2HHXA 4DFKA 1REVA 5J2PA 2RF2A 3KLGB 3KLHA 4NLWA 4L8RB 4NLOA 4RW9A 3SI6A 2W8LA 3CJ0A 1WSHA 3AA3A 3TWHA 1EX4A 1IKVB 1S1XA 3HPHA 3LP1A 4I7FA 3V1QA 1WN7A 5HLFA 1A5WA 3AA2A 4CK1A 4DSFA 4CE9A 4NLXA 2W8KA 5KG7A 5F8NA 1U45A 1NHVA 3AVHA 4Y2AA 4ZPCA 4Z4FA 4KAZA 2OZMA 1DTQB 1HPZA 2BANA 3E01B 3NGZA 2BR0A 2OYQA 3SFUA 3KIOA 2VG6B 4EZ9A 4O55A 1ZBLA 3K57A 3OS1A 2W9CA 2DTUA 3WNFA 4AHRA 1S0OA 4OKEA 3TI0A 1GX6A 4JRQA 2W9BA 4Y1DA 1RYRA 4QAGA 1TAUA 2XWYA 4CJUA 3E51A 4CEEA 1T7PA 2AX0A 1C1BB 1QE1A 3OYJA 3H2LA 4RNFA 3GILA 4K50A 2VWJA 4J9PA 5J2QB 4MK9A 3OLAA 1ASWA 2B43A 3OYHA 2XGQA 3CFRA 3BQ1A 2JEGA 3OYCA 3VQEA 1BQNB 2R2SA 2VA3A 1S6QB 1TL1A 3MR6A 5HROB 4TLRA 4DL7A 2VG5B 4KHSA 4ECXA 4FS1A 3SFGA 2ILZA 2FLNA 2HMIB 1IKYB 3OLBA 3U3YA 3A2FA 2FVCA 3KK2A 3VQAA 3ZSQA 2P1JA 3ASMA 5T7BA 4NZ0A 5CYMB 1RT6A 3KTQA 3WNHA 3QIPB 3HPOA 4J2DA 5HRPA 5T14A 4WZQA 4B9LA 2VA2A 2QE5A 1HQUB 4ZP8A 4ELVA 2KW4A 1RT1A 2V4RA 2AGOA 1KSPA 2HNYB 4XPEA 4KHYA 1HYVA 3N6MA 5FROA 5E41A 2UVRA 3OYLA 2WOMA 1JLFB 2JC0A 2V9WA 3KLFA 4DFPA 1Q9YA 4B9SA 5F8JA 3TVKA 2YNFA 4ZHRB 3JYTA 3DOLA 2ATQA 2YKNB 3I5BA 4F8RA 3RB0A 4CESA 2WCXA 1ASUA 1SUQA 2E9ZA 4FLWA 1ZBIA 4B8AB 2RN2A 3C94A 2OPSA 4CF0A 4CJLA 4NLDA 4URSA 2FLLA 1KHWA 5DQIA 3HVTA 2YNGA 3CVKA 4CEAA 4DTJA 2QKKA 4O5BA 4YR2A 3KLHB 4CF9A 3LP2A 1TL3A 2Z1GA 3BSCA 2EHGA 3TABA 4LY7A 1LW0A 4X2BA 4IRKA 1S9FA 3RAQA 4BDPA 3AVMA 4CHZA 2F8SA 1EETB 2LSNA 4U6PA 4KHRA 4AHCA 2R8IA 2R8JA 4MQ3A 4KBIA 3L2UA 3SUOA 2ALZA 4J9KA 4C8NA 4FJ7A 4ZVFA 2X78A 1NOZA 1QAJA 4JS5A 4FJ9A 4O3OA 3NGIA 3DOKA 3HKWA 4HVJA 4EBEA 3MR2A 1S9EB 3CJ3A 2YNHA 2EX3A 1SH3A 4JUZA 2J6TA 2BQRA 3AO1A 2HNDA 4CF1A 1JLEA 4F2SA 1FXXA 4UQGA 4M41A 3RR8A 3HSTB 4DU1A 4N56A 2G8HA 4W5RA 2WONA 5KFKA 4K4ZA 4CFBA 1NKCA 4J2BA 4CJ4A 2E6MA 1QE1B 2X74A 4PUOB 3CYMA 2P5OA 4I9LA 3SUQA 4RW8B 1X1PA 1LV5A 1JLQA 1S5JA 4J9NA 1N48A 2KTQA 2QKBA 4LD0A 1XR7A 4F4WA 2WRMA 3ICLA 3M9NB 2HWIA 4NYNA 1DTTA 4HCCA 4M95A 3L2WA 4FW2A 1XI1A 3HVAA 2R7YA 4CGDA 1JLBB 4CERA 3PO4A 4B3OB 3BGRA 3KK2B 4DWIA 1NK5A 3ITHB 5F9LA 1LWFA 1N6QA 2OA8A 2W42A 3KOAA 2XCAA 3PR5B 4K8ZA 2HHUA 3QGGA 1G15A 4BWMA 3OL7A 3OVNA 3OS2A 3CIZA 4JLHA 1U47A 1RT1B 3PO5A 3I0RB 1KRPA 4CGIA 3DLKB 3ULDA 4IR9A 4NRUA 2WOMB 1TK5A 1IG9A 4RW6A 1C6VA 4ZMMA 4W5NA 3KLFB 4NLGA 4XPCA 3T19A 3GYNA 3IAYA 4K4WA 1RTHB 3V6DA 3DOLB 4ICLA 3SNNA 4ID5A 3OL8A 3OY9A 3H5UA 3H4BA 3AVKA 5K14B 5F8IA 3VQQA 4YQWA 5KFGA 4DSIA 5HP1A 2C28A 4FK0A 4TY8A 1TV6B 5KT2A 1HNIB 1HNVB 1HQEA 3QO9A 3LP3A 5I42B 3SV4A 4ED8A 2JGUA 3P83D 2A1SA 3HJFA 1LWCB 4B9TA 4PQUA 2P5GA 2OH2A 4DG1B 1JIHA 3G86A 3AV9A 4ZPDA 3Q8PB 3LP2B 4FJ8A 1VSKA 4MIAA 2I5JA 1S9GA 2I1RA 5EWGA 1BISA 3VA3A 4O3QA 2GUIA 4CHOA 1RBTA 1ZTWA 4QWEA 1T03A 2XY5A 4J9RA 3B6OA 1W0HA 3IGVA 4Q45A 3K5LA 5KFHA 1C0TA 1VRTA 4ED0A 4CJQA 1XHZA 3NH2A 4WZMA 4TSXA 2KFZA 1EP4A 4J9OA 4K4SA 3WNEA 4FJXA 4JS4A 3HO1A 1LWEA 3OYBA 2KQ2A 4RNOA 4ID1A 2DY4A 4RUCA 5KFJA 2YNHB 3MF5A 1RAJA 3QNOA 1YVFA 1RT2B 4DSLA 3CDEA 4CJRA 4ZTFA 3VA0A 2RDIA 4IFVA 3RRGA 4LH4A 1X9WA 3PY8A 1RT4A 2WONB 4J9SA 4EYIB 3KK1A 3BREA 2RDJA 4EP4A 2V0NA 4B9VA 3KJVB 1RTDA 5EWFA 4OGCA 4CHYA 5DGAA 3M8QB 1RT3B 3ZSXA 4F50A 3PVXA 4CEZA 3O3FA 1C0UA 3PR4A 5KGWA 1YT3A 2YV0X 4M94A 4NYFA 5CYQA 3PHEA 1D5AA 5D3GA 1VRUA 2O4GA 4R8UA 5KFDA 2UVVA 3IGNA 1VSLA 2HHVA 4I2PA 4DSEA 3QEVA 3JSMB 4YR0A 2AJQA 4O44A 3LWMA 1X9SA 2D0CA 3MECA 1IM4A 4ECRA 4O0JA 1ASVA 4FJMA 1S1UA 1HYSB 3K2PA 5JS1A 5FDLB 3NE6A 4MKAA 1SV5B 4JV2A 3RMAA 2YNIB 4KFBB 4U7CA 3H5XA 4IG0A 5DG9A 1S1TA 2GV9A 3NL0A 4K4YA 5I3UA 4NCBA 4ICLB 4FM0A 4DQPA 4DL4A 1I39A 3IN5A 5L9XA 3K58A 4FJKA 3VQ5A 3KHLA 2PYLA 4KHUA 3DRSA 3D28A 2FBYA 5DLFA 4TY8B 4CIFA 3SUNA 1RDAA 5CZ1A 3HYFA 3PW5A 1HQEB 3QO9B 5DLGA 4J2EA 5KFRA 1S1VB 5KT3A 1HYZA 2B5JA 1NJXA 3PW0A 3OJUA 4PQUB 2IAJA 4NLSA 1C1CA 2OPQA 1OS5A 4E7IA 3WNGA 3I8DA 2E4LA 5KFPA 2HHSA 3AVFA 4GW6A 1Q8IA 3SCXA 4CJVA 4CJSA 4LSNB 2VG7A 3N6NA 4ECUA 1T03B 1S4FA 4LSLB 4OPKA 5FRMA 3V1OA 2HWHA 3I0SA 3IS9A 2R2RA 3AVNA 4BACA 1C0TB 1VRTB 1JXLA 3SV3A 5KT5A 1YVUA 1HMVA 4ECWA 2AGPA 4TYBA 1D0EA 3ZT2A 4NRTA 3OYGA 2JEJA 3D0PA 1SL2A 1KVCA 1LWEB 4AHSA 2HHTA 2HW3A 2HVHA 3RB6A 3AA5X 3MAQA 3NBPB 3QLHA 5KFEA 1TKZA 3KHGA 4BE2A 4M3XA 1RDCA 4M3RA 2AQ4A 3V1RA 4NCGA 4IH6A 3OHAA 3V9WA 1RTDB 1NK9A 2ZD1A 2XY8A 2HHWA 3Q8SB 4URGA 4R5PB 2D7SA 4C8OA 4Y34A 5J1EB 1BCMA 1GOCA 3HXMA 4IR1A 1J5OA 4J9LA 2XI3A 4MH8A 1S10A 5D3GB 4M3WA 2RKIB 4R8UB 1NKEA 4CGFA 3FFIA 3RB3A 3RMDA 3V81B 1RTIA 3SZ2A 4RW7A 2C2DA 3CG7A 5KFVA 1TVRA 3MECB 3MXJA 4KKOA 3HP6A 1TKXA 3KMSA 3FRZA 2IGIA 4N5SA 3BDPA 3C95A 5KGXA 4QOZB 3LPUA 4AHTA 3DM2A 4JV1A 2WHOA 4TY9A 4Z4IA 4KO0A 1LAWA 1D8YA 1IKXB 1SL1A 1HJRA 2IBKA 2AGQA 3G0ZA 3PX0A 4Q5VA 3GV5B 4CEOA 2IM1A 3AVIA 1LW2B 4KHNA 1KLMB 1JLGA 3VQ9A 5KG0A 2IC3B 1XR6A 3G6YA 5KTQA 5J2NB 3V4IA 4H54A 1J53A 1KFSA 3DLBA 3H40A 1VSHA 3GIMA 3V9UA 3TARA 4DLEA 4OJRA 2FC0A 1FK9A 3AO2A 4DTXA 3TAMB 4BDZA 4EP5A 4YR3A 3DYAB 3BQ2A 1TKDA 3RR7A 4PWDA 3KNAA 2GIRA 1J9AA 5FRNA 1SL0A 5KFZA 4N41A 1RT5A 2JEFA 2XHBA 1K1SA 1UAXA 4NLUA 2ASLA 5L1LA 3T5JA 5KG2A 4H8KA 4ED6A 2Z1HA 4F3OA 2OPRA 3T5LA 4IFYB 3QGIA 4NYZA 4IH7A 5F9NA 3KLIA 3M8PB 5KRSA 3MFHA 3NGYA 4E3SA 2CJQA 4CGJA 4Z4CA 5KI6A 3CDWA 4OLAA 1BQMA 4DEZA 3OJSA 4IQXA 4OKKA 5L1JA 3CJ2A 2IJNA 4EBDA 1HRHA 1JXEA 5KT7A 1TKZB 4Q0BA 5KFUA 4IDKA 4FS2A 4W5QA 3MXMA 3DMJA 3NF8A 4KTQA 1D9DA 1BCOA 4C8LA 2B4JA 2YKMB 5CZ2A 1JLCB 4OVLA 4O3RA 2P51A 1CXUA 1F21A 3QIOA 1REVB 4KV8A 5J2PB 2RF2B 3HM9A 3QINA 1RTJA 4RW9B 1UWBA 3MEGA 3KK3A 3V9ZA 1S1XB 3ZT1A 3LP1B 4I7FB 3C6TA 3OYDA 5HLFB 5F8MA 1TKTA 1SKRA 3DRPA 3CWJA 1ZYQA 2Y1IA 1TAQA 1BIUA 3HHKA 2OPPA 4O4GA 2UVWA 2DFHA 2ILYA 3M9MB 2HVIA 5C24A 3SJJA 3H4DA 1R0AA 4FLZA 3SQ1A 1HPZB 2BANB 3KHRA 4F4KA 4WFXA 2GBZA 1ZETA 2ETJA 1X9MA 4IG3A 3RWUA 1C2PA 1S0NA 2D0AA 3NF9A 2W9CB 5KRTA 3ZSVA 3NH0A 2G8UA 1ZBHA 4DTSA 3RMBA 4CFAA 3UR0A 2W9BB 3MEEA 4E1NA 3FDSA 4F4YA 3NH1A 2IDOA 3MEDA 3PJXA 4XIUA 4Y3CA 3DI6A 1IKWA 3HVRA 3IG1A 4ECVA 3ZT3A 5J2MA 3AA4A 3RMCA 2QV6A 5L1IA 3EY1A 2D0BA 4YMEA 2BE2A 3L8BA 3GQCA 3CM6A 4LH5A 5C25A 1TL1B 4KB0A 3U6FA 4G3IA 4FJ5A 3LALA 3BQ0A 1FK9B 1QSSA 2FBTA 3V9XA 5KFMA 3K5NA 1JLAA 1UA1A 3LP0A 1XR5A 4F4ZA 5DG8A 4OKJA 2O4IA 1RT6B 3BSOA 1IO2A 3NHGA 4FJHA 4FLXA 4CJTA 3BSNA 1EKEA 1FKOA 1J54A 3LANA 2FJWA 1UA0A 3ALYA 4JRPA 1JL1A 1ZBUA 3G6VA 1S97A 4R0EA 4QW9A 2YNFB 4CF2A 3JYTB 3LZJA 3THVA 3LAKA 5C42A 1RBVA 1BQMB 2FVSA 1S0MA 1WAJA 1SUQB 4FXDA 1T94A 2ZE2A 3CM5A 4DL3A 4DQQA 2FBVA 5C5JA 4M3YA 2OPSB 1RA6A 1U4BA 1YTAA 5DK5A 4M3ZA 3QEIA 4E7JA 4HCBA 2ASJA 3SUPA 1S6PA 3DDKA 4CECA 4GVMA 3HVTB 4I2QA 2YNGB 4GMJB 4GC7A 2FVRA 3AVBA 2B6AA 4B9UA 1TL3B 1N5YA 4DMNA 2HAIA 4F4XA 4Z4GA 1LW0B 1GOAA 4E0DA 3NFAA 4FYDA 3C6TB 2Z1JA 2HNZA 4Y1CA 4MK8A 3ZSWA 1QSLA 5KG5A 5KFWA 4FBTA 1I3AA 4O4GB 5SZTA 3EPIA 4FLUA 4CJEA 4G1QA 2HB5A 3QZ8A 2GIQA 3PJWA 4FZYA 3DLGA 4MFBA 3DOKB 3HVWA 3I5CA 2F8EX 2C2RA 3P5JA 1DLOA 3RBDA 4DS5A 5HBMA 1K6YA 5DGBA 2HNDB 1WNSA 1JLEB 5F8HA 3RBEA 4KHQA 4RW4A 4W5TA 3MEDB 5L1KA 1KFDA 2KFNA 2DPJA 1LAVA 1MMLA 3AVAA 3BR9A 4PY5A 3B6PA 4HYKA 1GOBA 2XY7A 4DTNA 1NK7A 3DI6B 1QAIA 3AO5A 3MFIA 1A5VA 1JLQB 3VQCA 3V6KA 2PYJA 1RA7A 5KG1A 1KHVA 1B9DA 2C2EA 4FLTA 4B8CA 3LWLA 1DTTB 3C6UA 3DRRA 3QEPA 2ATLA 2XI2A 3KHHA 1T8EA 3KLGA 5F8GA 3QERA 3BGRB 3N6LA 2FBXA 4IH5A 3NDKA 1RDDA 4IBNA 1JKHA 1LWFB 2R8KA 1N6QB 2AWZA 2W7OA 1B9FA 1VSFA 3M8RA 3V6HA 1WSGA 4AHVA 3H08A 2IMWP 4IRCA 2EC0A 3V9SA 3T5KA 1DTQA 1CXQA 2W9AA 3P1GA 3E01A 2UUTA 3QETA 4RW6B 4FJGA 2VG6A 4BWJA 3F73A 1VSDA 4RNMA 2D3ZA 3HK2A 3AVJA 4CIGA 1NK0A 3RTVA 3V6DB 5KFCA 3PZPA 1XHXA 4TN2A 4ID5B 2JLEA 5SWMA 4ECTA 4FCYA 4EO6A 3KD1E 4K4XA 3MXIA 4DF8A 5HP1B 4FK2A 3VQ6A 5JXSA 4F3TA 1S48A 5KFAA 4DTOA 2O5DA 2R8GA 4Q44A 4ED3A 2QXFA 3TAQA 4J9MA 5J2QA 4HTUA 4EZ6A 5KFIA 4QCLA 1TQLA 1BIZA 4NLTA 1IH7A 4H4MA 2J6UA 1BQNA 4FZZA 4FLVA 1N5YB 3VQSA 1S6QA 4IKFA 2JC1A 4RNHA 4N47A 2I5JB 4K4UA 1S9GB 4QPXA 2VG5A 3K5MA 4CCHA 2HMIA 1IKYA 1W25A 1VSMA 4NLYA 3GIJA 3EZUA 2UVUA 4KREA 4O3NA 5CYMA 2ASDA 2CKWA 3HPGA 4OLBA 4AHUA 3QIPA 1EP4B 1TK8A 2IJFA 3NAIA 3SQ0A 1HQUA 3UPFA 2ZKUA 1WAFA 2HNYA 4NCAA 4DQRA 1D1UA 3TQ1A 4MKBA 3EZ5A 3G6XA 3V6JA 1NKBA 3SYZA 5HBMB 4KI4A 4KRFA 1U04A 4RZRA 3CQ8A 3SQ4A 3HL8A 5EU7A 4M3TA 2R2TA 4IFVB 2BDPA 4ZHRA 1VK0A 4DLGA 1RT4B 2FLPA 3OHBA 2YKNA 3KKSA 4IRDA 2R8HA 3KK1B 3O3GA 3EYZA 1RCHA 2FVPA 2X6NA 1YTUA 2Z1IA 3S9HA 4E1MA 3ZT0A 1C0UB 3U3GA 4RG8A 3NAHA 4KHMA 4O4RA 1NHUA 3AVCA 2XC9A 2IM0A 1MU2A 5CYQB 3K5OA 1VRUB 4FM1A 2KZMA 3C6UB 3PV8A 1WNEA 4I2PB 4FK4A 4Y2CA 2WB4A 4DU4A 2UUWA 4O44B 4E7LA 1JKHB 4HKQA 1WLJA 3O4QA 1KCFA 1QQCA 3H59A 1C0MA 1KVBA 1VSJA 1S1UB 4KE5A 3ZSRA 4KSEB 1EETA 2IA6A 4WFZA 2DFFA 4CGHA 4ZP7A 4Z0UA 1RDBA 2G8KA 4M45A 3TAFA 2BRLA 3T5HA 2XY6A 3AO4A 3SPYA 5JS2A 4M3UA 4IG0B 4FZXC 2E6LA 5KFSA 1KTQA 1S1TB 1VSIA 3FQKA 4ZPBA 1S9EA 5I3UB 2J6SA 1BHLA 2DFEA 4CEDA 1SKSA 4RNNA 4TQSA 3UQSA 2D3UA 4CEBA 1ZTTA 1RNHA 3OYFA 3H5SA 4FBUA 3DRSB 3M8SA 4Q8EA 4H4OA 4N76A 3AVGA 4HUGA 4FW1A 4CK2A 4LQ9A 3ISNC 4PUOA 3CFOA 1NNDA 4RW8A 4FJLA 4CJFA 2RPIA 4ECZA 2B5JB 3NMAA 4DTUA 2IAJB 3I5AA 2FJVA 1C1CB 2OPQB 3CJ4A 1WSEA 4H4MB 2V4QA 1U09A 3MR5A 4ECYA 1XC9A 4Q43A 3VN5A 4YFUA 2AX1A 2VG7B 4O0IA 3NF7A 4QWAA 5HRNA 1JLBA 4B3OA 3IRXA 3PW2A 1JL2A 4EEYA 1TGOA 1L3TA 4Z4HA 3I0SB 3ITHA 1ITGA 3IS9B 3ISND 4CEQA 2R2UA 1HMVB 1Z26A 1WSFA 3D45A 3KD5E 3I0RA 4CHPA 2XCPA 4KI6A 3DLKA 1RDRA 1SH2A 3LZIA 1HARA 4BE0A 3TR8A 1K1QA 1QHTA 3QLHB 3TAGA 2C22A 4DSKA 3VQDA 4B9NA 1RTHA 4ZP9A 2W7PA 2G8WA 3KLVA 4OL8A 4I9QA 4NCGB 5K14A 5JUMA 4ECSA 2ZD1B 4CJPA 1TV6A 1N56A 3Q8QB 1HNIA 1HNVA 4DL5A 3NAEA 1RT7A 4WE1A 1J5OB 5EDWA 3OL6A 5I42A 4FM2A 3OSNA 1MU2B 4B9MA 4QWBA 1LWCA 3KKRA 3VQ8A 1CSJA 4KHWA 4DQSA 3PX4A 4DG1A 4FLYA 3FFIB 3QEXA 4E19A 4KTWA 4FVMA 5KFYA 4C8MA 3QYYA 2A1RA 1RTIB 4RW7B 3FQLA 2QK9A 3SI8A 1TVRB 4KKOB 1TKXB 1TK0A 2WTFA 3NCIA 4AILC 3H98A 3L2QA 4F2RA 5DQGA 3DM2B 3L3VA 3L2VA 4CJ3A 4KO0B 1BL3A 2F8TA 5KFFA 4CJWA 1ZBFA 1KLNA 5F8LA 1RYSA 3CDUA 1T05A 3OYAA 3CO9A 1SH0A 1RT2A 1JLGB 4WFYA 3Q8RB 4ELTA 1QS4A 3V4IB 4H4OB 2WK4A 1A5XA 3O3HA 3RRHA 1JX4A 1RBRA 1TP7A 3KJVA 4WXOA 3ZSZA 2PZSA 4IOBA 3PW7A 4ZVEA 4KTZA 3OYMA 3UDLA 3DLHA 3M8QA 4GC6A 4YP3A 5KFLA 1RT3A 3SQ2A 4DTMA 4O3SA 4DL2A 4ZVGA 4PWDB 1RILA 3HT3A 4OPJA 4EO8A 1FKPA 4BDYA 3BSAA 2VWKA 3QGHA 3O4NA 1RT5B 2YHAA 3IRXB 3JSMA 5DMRA 1GX5A 3FSIA 4ELUA 2E9RX 1QSYA 2OPRB 1HYSA 3NKYA 4IKAA 3KLIB 4QWDA 5FDLA 1SV5A 1XWLA 5CY4A 3DLRA 2XGPA 1U49A 2YNIA 4KFBA 4HUFA 1JXBA 4K4VA 4DFJA 4Q0BB 4IDKB 1KVAA 1Z25A 2Q3SA 3DMJB 3VQ4A 4EBCA 1BI4A 1D9FA 5EWEA 5DG7A 2HHQA 4B08A 1U48A 2G8IA 4TXSA 2DPIA 4DU3A 4KB7A 4KV8B 1SKWA 3DLEA 4HHTA 4ZP6A 2F96A 1RTJB 4DFMA 3GIIA 2FVQA 2BQUA 1UWBB 2ZQBA 3T3FA 4BE1A 3MEGB 3KK3B 1L5UA 2BQ3A 2G8FA 2G8VA 3UIQA 3F9KA 3TAEA 1RT7B 4WE1B 1S1VA 1TKTB 3DRPB 1S49A 1NK6A 3L2RA 2OPPB 1B92A 3GV8B 5HRRA 3ZSYA 4K8XA 3L3UA 1W9HA 5C24B 3LDSA 1Q9XA 3LAMA 1R0AB 4PA1A 1RBSA 3G10A 4LSNA 4EYHB 4IG3B 4LSLA 5KT4A 3AO3A 2Y1JA 1NJYA 4QWCA 3VQ7A 1N4LA 3ZCMA 4LQ3A 3PUFA 4KAIA 3T1AA 3MEEB 2GC8A 2FJXA 2IS3A 4CEFA 4MK7A 1NK4A 4CHQA 4CIEA 4Q8FA 1CZ9A 1T05B 2IM2A 1IKWB 3NBPA 3QNNA 4DQIA 3AVLA 4NLPA 1S1WA 3IG1B 1Z4UA 4Z4EA 4RUAA 5J2MB 3KLEA 4CJ5A 3K59A 1VSEA 3VQPA 3S3MA 3PX6A 4MIBA 2BE2B 5C25B 4XO0A 2AU0A 2PY5A 3MR3A 4CFDA 2XRIA 3SPZA 4DSJA 4NLVA 3OYEA 4CFCA 1CLQA 3EPGA 1JLAB 1L3VA 3LP0B 4R5PA 1QUVA 1IKVA 5KG4A 3ZSOA 5J1EA 1QTMA 4WYLA 1NK8A 4CHNA 4E7KA 3RAXA 2RKIA 4ED1A 4AH9A 1NOYA 4WYWA 5KT6A 1FKOB 1FKPB 5KFQA 4OGEA 1WSJA 3VQBA 4DTPA 3V81A 2D41A 3LPTA 3OL9A 3CJ5A 1WSIA 4C8KA 5KFOA 4NLRA 2IM3A 3MTKA 3OSPA 3OS0A 2X6SA 4J2AA 5C42B 3H5YA 2YHBA 5EUHA 3QEWA 3KMQA 3PW4A 4E7HA 3QZ7A 1T3NA 2ZE2B 1NJWA 4KB1A 2XO7A 1IKXA 4FJIA 2BGGA 3TAPA 3D5MA 4ECQA 3GV7B 4ZTJA 1UOCA 1C1BA 1BI4B 1S6PB 4YNQA 3TANA 3S3NA 1LW2A 1KLMA 2IC3A 4I2QB 4HUEA 3M9OB 5KG6A 4JV0A 5J2NA 3RB4A 3ZT4A 3CFPA 3DLEB 4DL6A 2B6AB 3QESA 2E9TA 4DF4A 5HROA 4CJKA 4ED7A 2HNZB 2BRKA 3TAMA 1RBUA 3DYAA 4W5OA 4NLQA 4ED2A 2JEIA 1L3SA 4G1QB 3S3OA 4K4TA 3OYIA 4RU9A 3DLGB 4MFBB 1CZBA 1O1WA 4WXWA 3OYNA 4CK3A 4M42A 4J9QA 5DQHA 3BJYA 1DLOB 4DS4A 1JLFA 5HRSA 4TQRA 1I6JA 3QIDA
chains in the Genus database with same CATH superfamily
3J7ZT 4UUXA 5D0RA 3HM8A 2J4RA 4IFYA 2GJ2A 1C1AA 2IVOA 4YB6A 3T1YK 5I4MA 4DTRA 4TYAA 4ILHA 4CGGA 2EFGA 3NGDA 2F7TA 3G2XA 1VQ6N 4QS8A 3WX4A 1NJZA 3NEKA 2KZZA 2HS4A 3ZTSA 3HP9A 3J7Z5 5KFXA 2BKPA 2OZSA 2AEMA 5KFTA 1YUWA 1V5VA 4G1PA 2GVDB 1Y97A 3GIKA 2YX6A 2YKMA 3GE1A 2HQIA 2D9PA 3OYKA 2Z8QA 4ANEA 2EK1A 4CLZA 4DFKA 2LEPA 4B3RJ 3OTCA 4RW9A 4OZJA 2W8LA 1EX4A 1IKVB 3J80U 1B99A 1IQTA 1YBAA 5IC6B 2VICA 4CE9A 3IBWA 2W8KA 3SDEA 1OY6A 4Y2AA 4IZ9A 4A8QA 3O9TA 4KT0C 1HUXA 2OZMA 2DHXA 1HPZA 3E01B 3NGZA 4M5IA 1YTYA 3OS1A 2V4JB 3KZBA 4AL6A 2DTUA 4RX6A 2D0OA 3EE3A 1VR6A 3CE8A 3QT7A 2Q97A 4JRQA 4Y1DA 3PM9A 2NRTA 5K8PA 3MM7A 2HK2A 1OMSA 3SBMA 1T7PA 1QE1A 3H2LA 3CPWM 5AXNA 4K50A 2VWJA 5FLXO 2D3O1 3FBCA 4MK9A 1YKWA 4DV6F 2B43A 3OYHA 3M7VA 1Q82T 2GX9A 2HFZA 3OYCA 3O08A 2FGCA 4K25A 3TZWA 2R2SA 1Q95G 3CCVS 4BC5A 1TL1A 4MKYA 5HROB 4DL7A 2FXUA 1T9XA 4H0XB 4KHSA 1XTZA 2YHWA 4UOFA 1IKYB 3KK2A 3VQAA 3ZSQA 5T7BA 3HMJG 4C0HA 4LVOP 4HLBA 2F65A 1OO0B 2X1AA 4JI0K 3BO3A 2KW4A 1RT1A 4BRQA 4XPEA 4LC9B 1HYVA 2R7SA 5E41A 3OYLA 2QSWA 2WOMA 5AQGA 3SAFA 2B4PA 5KOWA 2V9WA 1Q9YA 1TL7A 2HOEA 4IOCQ 2QLXA 2YNFA 4ZHRB 2A40A 2ATQA 4HDHA 3I5BA 3RB0A 5CCMA 2Q43A 2KXNB 3MPDA 2WCXA 1ASUA 4BRAA 4FLWA 3UN2A 1YJWN 3ZZOA 2RN2A 2QZ8A 2J0WA 2OPSA 3W8GA 4FWKA 1U1RA 4NLDA 5GAHU 4URSA 2FLLA 4JAXA 1G2EA 1VQNS 2D74B 1PYTA 2RE2A 4YN3B 3GYGA 2AJ0A 2QKKA 2DNLA 4CF9A 3NGTA 2EHGA 5SUHA 1WOPA 3MR7A 2Y1RI 3AB4B 4GKJF 3C19A 4UY8T 2ZF5O 3AVMA 1WSRA 1Q7LB 1EETB 1IV0A 3CMAS 4KHRA 3SUOA 1GMWA 2DTJA 2OEJA 5C2CA 5IWAJ 4F04B 4C8NA 1WOQA 2PN6A 4NXMJ 1DARA 4FYWB 3NGIA 3DOKA 3DN9A 1UPMB 2XNQA 4UY85 4BRNA 4FYXB 3KWGA 1FWKA 4DV0K 5THWA 5K20B 3CJ3A 2MZJA 4CJ7A 3AO1A 4CF1A 1FXXA 2O67A 1SQGA 2QTDA 2M4MA 3O5TB 1VQ4S 2E5IA 3O8WA 5HAOA 4OI0A 1X1PA 3O9QA 1SC1B 5KAKA 1S5JA 4J9NA 1S99A 2ALYB 4F4WA 3VAJA 1PBAA 4BRIA 2YWWA 1OKJA 1FWLA 3OV7A 3C3LA 1XI1A 2R7YA 2GA7A 4XH4A 4CERA 1EB0A 4DU8A 1HJOA 2KXHA 3CC7S 1IWGA 1NK5A 3TSPA 4JI8F 5KPZA 3UE5A 3CCUS 2XCAA 4J9UE 4K8ZA 4L76A 1VC6A 4BR9A 3OVNA 3PO5A 2CPYA 4W98A 1RLCL 3LDNA 1PCAA 3IM8A 4IR9A 4NRUA 5D78A 5IT4A 3IUCA 4FPBA 2MJNA 4DV7F 3O8MA 4U9RA 2QLFB 4ZMMA 4NLGA 4CVNE 2MQLA 4XPCA 2DY9A 4RWXA 3J7A1 3V6DA 1BD6A 5DDPC 3CJ8A 4FL9A 4M5GA 4RO0A 4ID5A 4X84A 4H0VB 4MLHA 3SNNA 4KHPK 2HFNA 2VBZA 3AVKA 1CJTA 2EFVA 3VQQA 3UO0A 1R27B 4TY8A 3MWPA 1HNIB 3P8BB 1O13A 3CD0A 4QS9A 1WC6A 3MPUB 3LP3A 3HJFA 4B9TA 4PQUA 3E66A 2P5GA 2WAQD 3G86A 3TEGA 5HI7A 3MMAB 1AT1B 4CBUA 1HI8A 3DDIA 4FWSA 4A5BA 1AXQA 3CCJS 4USHA 3RU0A 3GSDA 2W2QP 3R5BA 1T9YA 4CZEA 2H65B 3K5LA 3TVZA 3K0JA 2LQ9A 2L9WA 2QA1A 2KN4A 2XMMA 3NH2A 5DZ7A 3S01A 3I4PA 2B8QA 3JQMA 1GLAG 4J9OA 5IFMA 4M5MA 2E66A 1TL5A 3M6UA 5H1SQ 3HO1A 3I32A 1LWEA 1F1BB 4OX9K 2CNNB 3R9PA 3GJQB 2XQCA 2VPXB 1WKKA 2E2NA 3GCXP 1RHKB 1YVFA 1NM1A 2AJ4A 4U95A 4CJRA 3PSIA 4IYQA 4DPYA 4CO0A 3VWSA 4ZPTR 4EGLA 4JI7K 1X60A 1VGYA 4B3RF 3SIPB 3KJVB 4OGCA 3ENVA 3V2UC 3C7NB 1Q5VA 3VR1A 1VQ9S 2UU9F 3ZSXA 4F50A 5BJRA 2YBVA 5L8RC 2EBGA 2JRSA 4C48A 3TP2A 1HBMA 4NYFA 3PHEA 3MM6A 2O4GA 5D3GA 5KFDA 2UVVA 2E20A 3DWLA 3QEVA 3UD3P 3M30B 2OKQA 4OI2A 4YR0A 2AJQA 3VAGA 2D0CA 3MECA 2OCEA 1MWZA 2HS0A 4FJMA 1DZ5A 1OIAA 2ZGYA 3O5BA 5LSRA 2Q6BA 3C15B 1OH8A 1SV5B 3IKMA 2W7AA 2DNPA 3RMAA 2LXIA 3OTEA 3LO3A 3H5XA 1BQXA 1EKSA 1NGIA 3UKUA 1S1TA 4CTAB 3SMPA 2WUSA 1WKJA 3CJ7A 4IOCL 4K4YA 5I3UA 2AYGA 3T1YJ 3DLLQ 3IP0A 1ZH5A 3GLJA 5IC4B 4OZ1A 5L9XA 2DXDA 2QX0A 1APSA 1URNA 3AOCA 3D28A 1JB0C 1HBNA 3K17A 2QWLA 3PW5A 5HMWA 1YRTA 5DLGA 1YWXA 2NYIA 4ZN1A 4J2EA 1S1VB 5ETKA 1C1CA 2O8FA 3B6BA 4E7IA 1J6ZA 3FBBA 1YVNA 4QIFA 2XZDB 3MM5A 4PWUA 1NRKA 3A8JA 3AVFA 1Q8IA 2ZBPA 1ZZNA 3W9IA 2V51B 3N6NA 2VBYA 1T03B 5DZ6A 3AT1B 1U1LA 1S4FA 3FGUA 2HWHA 2XULA 4PXEA 3TA0A 3IS9A 3AVNA 1YVUA 3TA1A 2L48A 2QYGA 3Q7BA 2V6AA 3UB5A 3IBCB 1KVCA 2PFUA 2HW3A 1FE4A 3W9JA 3AA5X 3MAQA 5CE3A 2RRAA 3NBPB 2ZUAA 1VQ6S 2CUYA 1HKBA 3VQTA 2YX7A 2B9WA 4NA3A 1MWMA 1Q4RA 2IBOA 4M3RA 3V1RA 4NCGA 3KJNB 3OHAA 2OSRA 3QRPA 1FX2A 4ZA1A 2XY8A 3FUYA 2HHWA 2R7VA 4YOTA 1GOCA 1J5OA 3HHLA 4CZMA 4MH8A 5IWAF 1FFWB 4ILMA 5AQMA 3EGWB 2FLOA 2JVOA 3SZ2A 1DJ0A 4IJNA 3A3PB 2BJ8A 5KFVA 1R8PA 3MXJA 2FPHX 2Q36A 1XIQA 4KKOA 3GB0A 4X66J 1GXTA 3FRZA 4JI0J 4N5SA 3OBWA 1VISA 3C95A 5KGXA 2Z57B 4F36A 3DM2A 3MUTP 1SIWB 3FBFA 4WCEQ 3MM9B 3CERA 1TUGB 2GVZA 1HJRA 5GMKa 1ATNA 3WIVA 2OSQA 4KHNA 4PKDB 2QFIA 5J2NB 1VJQA 1HHQA 1T9VA 1R0CB 3VAMA 4DLEA 2BW2A 5DDOC 4DL0C 1TUUA 2I6WA 5AFUH 1P8ZA 2RNEA 1HWLA 3A0IX 4BR5A 3HJVA 3KG4A 1U0SA 4XTTA 1RU2A 1SL0A 1Y5LB 4C1NK 5H9FJ 4PXCA 4GV9A 1YLXA 3PEJA 3D6HB 4F3OA 3T5LA 4KH1B 2FHJA 3ILJA 2XO6A 4NEYA 3QFWA 1IJJA 1WEYA 3M8PB 5KRSA 2GHPA 3MFHA 3NGYA 1QZ5A 1KD1O 1JMTA 3CDWA 3E3XA 3OJSA 2ATCB 1MROA 4JYAK 3CIPA 3KK7A 1HRHA 1EARA 5KT7A 3O6WA 1YJWS 4IDKA 4FS2A 1JQGA 3MXMA 3DMJA 1UVKA 3NF8A 1QQNA 2GWJA 3RRKA 3GONA 5BRDA 3L4QA 3OBIA 1TELA 2PIIA 1AZSA 3VAHA 3QIOA 1REVB 4KV8A 2RF2B 4I6MA 1N0UA 3ZT1A 3EGZA 2ZVIA 2V8GA 2CYYA 5ELZA 1TAQA 1BIUA 1TFWA 3NNAA 2OPPA 2MQMA 2UVWA 2DNGA 3M9MB 3T7ZA 3NMUA 4NEZA 2BANB 4HACA 2YTCA 2ETJA 1X9MA 1S0NA 3NF9A 3Q86A 5KRTA 2G8UA 3R27A 4UF4A 1VYAA 3F44A 1Q86T 1R43A 2NS1B 3MEEA 4FF2A 2HQGA 3P5TL 4F4YA 3GIRA 3MEDA 3CSKA 2FZGB 4L74A 2E2QA 3W7BA 1UPPA 1H98A 3TSUA 1WG5A 3VEZA 3THYA 2IRUA 1FDDA 3DLLL 4MT1A 2CDQA 4F0KA 3EY1A 2D0BA 5I3QA 3GTYX 5C25A 4JKCA 3U6FA 3R7SB 1S4EA 1QZ6A 1RCXB 1VAZA 5IM0A 3ATUA 1XR5A 2IIHA 4I64A 5DG8A 2O4IA 1RT6B 4HL9A 3PTWA 4LFCJ 5AQYA 1YGYA 1FRJA 1FKOA 1J54A 4CD3A 5BRHA 3VTHA 5MLCQ 2OFHX 4ITSA 3QQCD 3MMBB 5AQOA 2RD5C 1GXLA 1FX4A 1WG4A 1IBMJ 1S97A 4QW9A 4LF1A 2EK6A 3JYTB 4MDBA 5CQGA 2O8EA 4OX9J 5C42A 1SCJB 2UUCF 1S0MA 2XZTB 4A8YA 1SUQB 3DFEA 2ZE2A 4PPZA 3B8HA 4KGXB 4WIQA 2W6KA 4M3YA 5DK5A 2OLWA 5F0UA 2JFDA 2C2MB 2VQFK 1M1HA 1GLFO 3FEXB 3PRVA 3DXKA 4B9UA 1TL3B 1N5YA 3BKTA 4UOGA 4FYDA 1F9EB 4Y1CA 4MK8A 5KG5A 3JSRA 4M5LA 4FBTA 4O4GB 5SZTA 3EPIA 4CJEA 1TUWA 5E33A 2AP6A 2G1HA 1VQ5N 1VOMA 3I5CA 1YDLA 4D3GA 1O0PA 4OYPA 1Q16B 3I9V9 4ZPVR 1FVSA 2E2OA 4OZNA 1VQ8N 3D0IE 2W40A 3SMSA 2HNDB 4KHQA 1RTZA 1H72C 4Y2KA 4DUYJ 4WCEL 2UXCJ 2DPJA 4JI1K 2LEBA 3BR9A 3K7RA 4R79A 4YEAA 1QAIA 4A4JA 4ISFA 4ZN3A 1NNEA 2OEMA 1A5VA 2N82B 2GVDA 2KJWA 1KHVA 2DB1A 2WSEC 3LWLA 3C6UA 1X3MA 4DR6K 2ATLA 2XI2A 5GAEU 2DRBA 3W5YA 3QERA 3BV8A 4CLFA 4X66F 1PAEX 5AQKA 3MCOA 1P27B 2R8KA 3D68A 5LL6d 2AWZA 4FN5A 1T3VA 2HWTA 1OH6A 2V94A 3GFYA 4CZHA 3V6HA 3IMXA 2V7YA 2BV3A 3ZEUB 3V9SA 2CQ0A 3T5KA 4I68A 1FFSB 3E01A 2UUTA 1KN6A 4P52A 1X4GA 1D3WA 1OY8A 3D54A 3AVJA 3THXB 3HI9A 4PG6A 1NWKA 3OR2B 1WF2A 4C11B 1FE0A 1ZAVA 4P2SA 3KD1E 5HVHA 1ACMB 3D1OA 3TRGA 4DF8A 3VEWA 3AD9C 2HFVA 3UDEA 2DKOB 2R8GA 3MK6A 1Q81O 3TAQA 2KRRA 4EZ6A 4TU7A 3QBCA 1UVIA 3VQSA 4ZJOA 4IKFA 2O8CB 4K4UA 4QPXA 3CTRA 3CXCR 2GGPB 1IKYA 1I51B 5IT0A 3D3BJ 1A9NB 2O1PA 2DH8A 4NXNJ 2ASDA 3ZX2A 2DD8S 1EP4B 2IJFA 1IXKA 2MQ8A 4B3SJ 4ISGA 5LJVA 4JKFA 2BOPA 5ETMA 1WAFA 3BP8A 4YHHK 1ZA2B 4OYMA 2E5GA 2FSKA 3EZ5A 3G6XA 3SYZA 4KRFA 4RZRA 3CQ8A 3THTA 3HL8A 1FD8A 4GVBB 4ZHRA 4NE9C 4CZLA 1HLUA 2Q1LA 3MX2A 1NDKA 4IO8A 2MQNA 1YTUA 3S9HA 4E1MA 4DV5F 1F3VA 1MN9A 3UR3C 2MZQA 5HK4A 1MSWD 3G6EN 1F9FA 3NAHA 4KHMA 3AVCA 4JV5K 3VZIA 1KVIA 1VRUB 2XS7A 1TL4A 1WORA 5BN9A 2ZHOA 3PV8A 4FK4A 4USMA 2EI5A 2M70A 3M5RA 2IA0A 4E7LA 4HKQA 1WLJA 4AM6A 2XM3A 4ES2A 3NGKA 1C0MA 3ENQA 1S1UB 4FYYB 4L6V3 2VF3A 1EETA 3BS9A 4JEPA 3BGUA 1ITPA 2JH3A 4CGHA 1ELOA 2CQIA 4ZP7A 1P9QC 4M45A 4M5NA 1XMOK 3T5HA 4IDHA 3NS5A 3SPYA 5JS2A 2B9EA 4K41A 1NPKA 3W2VA 4JI2J 2E6LA 5KFSA 3VMFB 4ZIWA 2A6AA 3H3OB 2VKZG 1W26A 4RUHA 4CEDA 1UAWA 2XHWA 4QBUA 1SKSA 4RNNA 1N33K 3CD7A 4NA2A 4TQSA 2ZITA 1YQHA 3OYFA 2P9KB 4Q8EA 4N76A 3AVGA 4RPFA 4HH1A 1JCEA 3CJBA 4FW1A 1Z2LA 5DETA 3TSQA 2ZDPA 5BR8K 1Y00A 4UZCA 4OHWA 4ETZA 3J7YP 2HBKA 2B5JB 4DTUA 2FJVA 4LFCF 3DXSX 3WEEB 1IR1A 5B0CA 2A5XA 4ECYA 1AW0A 4LF9K 3KFWX 5AQNA 2GO9A 1N5QA 3QB0A 4O0IA 1GLCG 1NU4A 3WZ0A 5HRNA 1KWMA 3IRXA 1YZ6A 3RSEB 1IBMF 4KH0B 1DHMA 2P9GA 2Q0UA 3WXMB 4BRFA 5LMNK 3MM8A 3MPVA 3R5CA 1X3NA 2ZH7A 2E1ZA 2XCPA 4KI6A 4FVCA 4X4PA 4BBYA 1HARA 3LZIA 4JKAA 4DR2K 4BE0A 3TR8A 3PYDA 2P9IA 4WQ4A 3TAGA 4PQAA 2V7ZA 1F60B 3BO2A 2CPJA 2RIJA 4WWSA 3MN7A 1U24A 2HKEA 3QT6A 3N5FA 3PRBA 1PJ6A 3QDKA 1HNIA 2E7XA 2MKHA 5D0GA 3QRRA 1RT7A 4WE1A 5EDWA 2J9EA 2WFBA 1YBTA 1SJ3P 2CQGA 2RILA 4LF8K 4WFNQ 4DV2J 3FFIB 4E19A 1Y3KA 2AJ2A 3SCLE 4C7QA 4Y2IA 2QM1A 4PPDA 3RVCA 4LRAA 3D0GE 3NLCA 2WTFA 3DXMB 1G4CA 3NMRA 2UUAF 2KL8A 2MY7A 3H98A 4YY3K 3L2QA 4DUYF 1K44A 2UXCF 1RAGB 4C9DA 2RH3A 4CNZA 3TOQA 4CJWA 2ZWOA 1ZBFA 5HL7L 1F6TA 3R1LA 5F8LA 3OYAA 3B78A 4A8SA 2E29A 1SH0A 1NXIA 1AUSL 4WFYA 3ZZUA 4ELTA 2DJWA 2RQMA 1Y5NB 5C10A 2MSTA 3V4IB 2CPEA 4GMKA 4H4OB 2WK4A 3O3HA 3RRHA 4JI3J 2K7KA 4IFEA 4LRDA 4BY9C 3KJVA 4J7CA 3ZSZA 2N7CA 4WQ5C 2WSCC 1EO1A 4FWMA 2LDIA 3C7NA 2VQFJ 3SQ2A 1Q1KA 3M6WA 1YAGA 1VFJA 2EG2A 5AE3A 2CIMA 2EPIA 4PWDB 2RAQA 3M6VA 4JKBA 1RILA 4Y28C 2UUBJ 4EO8A 3PDNA 2KM8C 2P8IA 3QGHA 3O4NA 2I0XA 5DMRA 2UV8A 4L75A 1PKUA 1GX5A 2K7JA 2A6OA 4U7BA 2HSEB 4ELUA 3AJ1A 2CJKA 4LF5J 2OPRB 3I55S 4QR1A 1FNXH 2YWFA 2CVEA 3C15A 4OHVA 2CJXB 1SV5A 2CG4A 1M1KT 4LF6J 1V3SA 1NMNA 2MTLA 3HULA 3UKRB 3UE2A 1HWUA 2GTDA 4KC5A 4DFJA 3CJRA 3WT0A 1KVAA 3ID8A 1Y11A 5M1FA 1CEZA 4CZGA 3LPEA 1BI4A 4DV1F 2DRAA 3L4BC 5A8RB 4B08A 1U48A 4YB7A 4DU3A 1ZM2A 2ZH1A 1SKWA 2UXDJ 2PA8D 1RTJB 3PCOB 5AJ3K 1LKZA 1WELA 2ZQBA 3LDLA 1K9MO 1L5UA 2OHDA 2G8FA 3CPEA 3UIQA 3TAEA 4NXNF 1S1VA 1TKTB 3RAMA 3DRPB 3P4IA 1N8RT 4K8XA 1BY9A 4B3SF 4JK9A 3L3UA 1JJCB 5C24B 3LDSA 3AD7C 2CQ3A 1R0AB 4PA1A 1HNWK 2KU7A 3BZQA 2W1BA 1KAYA 2YPYA 4EYHB 5E3RA 3I4HX 2DVIA 5KT4A 1VQ5S 4FF1A 3VQ7A 4OYIA 3PG9A 2HF3A 3PUFA 3G4SN 2WTUA 4KAIA 2IRYA 3AD8C 2FJXA 2A2CA 3H42A 2IHR1 1O51A 3Q8VA 1NK4A 1C4AA 2BX6A 4Q8FA 1CZ9A 1IKWB 3NBPA 3QNNA 5K8NA 2DR8A 4RUAA 3SSSA 2P9LB 3K59A 1NPPA 1ZM4A 1VSEA 2HZVA 5E5NA 4U8YA 2HQCA 4LFAJ 1E4FT 4RLEA 4CFDA 2OD6A 2DO4A 4DSJA 4NLVA 3RZAA 1ZS6A 1UZHA 1SXLA 1L3VA 3CMEN 3LP0B 5GAHI 3NNHA 1I94F 3ZSOA 1N32K 1U8SA 4WYLA 2VH7A 4CH7A 4CHNA 2DGUA 5AE2A 1ZZFA 3UWTA 1RBAA 5AQVA 4G6VB 2DISA 4CLKA 3LTOA 4HT5A 2YHYA 5IQQA 2W6LA 4AM7A 4JI2F 3LPTA 2W4DA 1OPIA 2G13A 3ZXWA 4NLCA 4DPWA 3OSPA 2MLXA 3M2UA 3OS0A 4CLPA 4YHHJ 5H9EJ 2JWKA 3CJ9A 3PW4A 1S57A 2DHSA 2QTWA 4PCQA 2KG1A 1BG3A 3MM9A 4DR7K 1NJWA 2XO7A 3JSYA 3RG6A 2BGGA 3Q23A 2E5LK 3Q8YA 4DCPB 2B56A 3FMBA 3H0PA 4ZTJA 3CCWA 5DO2A 2MZ1A 1S6PB 3TANA 1ATRA 4YOEA 2I9SA 4I2QB 5DDRC 2DCLA 5J2NA 4DL6A 5D6GA 2B6AB 3QESA 3I6PA 2Z2LA 2VC1A 4CJKA 1VQMN 1Q8BA 3GCWP 2UXBJ 3FRYA 2HNZB 4JV5J 1IBLF 2BRKA 4BRCA 3QJJA 3CUNA 5BYSA 4OZ3A 3W1YC 4ED2A 2JEIA 4WFNL 3VALA 4G1QB 3ZYYX 4MFBB 2QFJA 3NOCA 1DLOB 3ZLJA 2F63A 5EX5A 1XMOJ 3EXCX 1JWWA 4B3MK 4RW4B 3M8PA 4CLWA 3HSDA 1UVLA 3SXLA 1EQYA 2FUG9 1QTNB 3W8PA 1RWMB 5D0HA 1S72N 3J7YI 2G2ZA 5FPEA 3KG0A 2GMHA 2RB7A 2NUBA 4FJJA 3DU6A 4KPYA 3CPWR 3MCNA 4DV2F 3R2DJ 1JNRB 4CM0A 5B7WA 3G6ES 4FJNA 4QW8A 3OVBA 1REVA 3UW1A 2RF2A 4X65K 3SI6A 3M8ZA 5D4PA 1OWXA 2RJZA 2X3DA 4OZLA 3HPHA 3V1QA 1RDWX 5GAGU 1WN7A 4Z7YA 1YJVA 2XMWA 4CK1A 2CGKA 2VWBA 1LOUA 3D1HA 5ITHA 2MGZA 2F4VK 1NHVA 2CVIA 3G9CA 4DN0A 4KAZA 1DTQB 3B8AX 2BANA 1RDUA 1G6BA 4EZ9A 4EFAC 3U8XA 3D6TB 4I69A 2A3JA 1LWXA 5K8OA 1FRLA 1S0OA 3PIPL 4OKEA 4DR2J 1DQ9A 4JI3F 1RYRA 1RABB 3E51A 2ZDOA 1U26A 2P5VA 1CQNA 4K0KK 3L7PA 2Z2MA 2EVZA 4J9PA 3OLAA 4Z2XA 3F2KA 1QD1A 5CAAA 5BPLA 1NO8A 3CIMA 2UUBF 4KYZA 3N0VA 1QLNA 2VA3A 1S6QB 2CPZA 2VDHA 1Q7YO 5GINA 4C0BA 2ILZA 4LF8J 2FLNA 2HMIB 4Q2LA 4LF5F 3ET6B 3A2FA 1FJGK 2FVCA 1GMWD 2L41A 4IJAA 4E98A 3VV2B 5KPRA 2P1JA 3ASMA 4NZ0A 2D9OA 1RT6A 3PSFA 3M1VB 2ZZNA 4J2DA 5HRPA 4WZQA 2VA2A 4LF6F 1HQUB 4ELVA 5HATA 2WVEA 5J1NA 4X62K 4DX6A 4USIA 3KYLA 1Q79A 4EI2A 2GFFA 3WIUA 5TKWA 4LF7J 1NGJA 3KLFA 1Q53A 3B4DA 5F8JA 5K9FA 1U6ZA 3TVKA 3OFHA 3JYTA 3MHYA 3MD1A 1QVGM 4ILLA 4F8RA 2UXDF 4CH0S 2FSJA 1NEEA 3SAGA 1SUQA 2E9ZA 2HURA 4PWWA 3GDQA 4B8AB 2J8AA 4BR4A 4Q7AA 1OSCA 1N36K 4YUDA 1OH5A 2W4PA 5M2RA 1WC5A 3VF6A 2MPUA 5EGYA 2VQEF 4CYUB 3QRQA 2QWMA 1WC1A 3MMCA 1GMUA 1T9UA 1V6HA 3CVKA 3TA2A 4BRLA 3K0SA 5HQMA 2VGMA 4BREA 2L9NA 3LP2A 2QLWA 1TL3A 4LY7A 2FJDB 1S59A 4JI6K 4QYZJ 2L3MA 4F9OA 4ZVQB 4ZDNA 4AHCA 4MQ3A 3CETA 3R7NB 3KHYA 2X78A 1QAJA 4JS5A 4FJ9A 2AD9A 4O3OA 4YORA 1QQMA 2K3IA 5AXLA 1XNRJ 2I38A 3M32B 3MR2A 1S9EB 2YNHA 2EX3A 4IOXA 4DR3K 2CZVC 4C0OC 3J7AP 5LJ3Y 2BQRA 2HNDA 3CF5L 1SBRA 4BRHA 3RR8A 4LFAF 2W2MP 3QBWA 3VENA 3P31A 2G8HA 3D6MB 2VONA 4CFBA 1GT8A 3CCMN 1NKCA 4J2BA 4CJ4A 5AQJA 1QE1B 2X74A 4I9LA 3SUQA 1VHIA 3SBTA 2QL5B 1LV5A 2ZEJA 3HZ6A 3HKZD 4O8KA 5AZIB 2DGQA 1KP6A 1N48A 3SAHA 5EX0A 4LD0A 5AJ3J 1RISA 2MQPA 4U7UD 1FXLA 1TYQB 2HWIA 4NYNA 3DLJA 1YZ7A 3G71N 4M7XA 3FGVA 3L2WA 4CGDA 2P9UA 4USJC 1NGFA 4B3OB 3KK2B 4DWIA 3Q83A 1P1TA 3CJKB 3N4QA 4C4WA 5F9LA 1WSVA 3KOAA 3PR5B 2IDEA 3QGGA 1H38A 2OFGX 1IJFB 4BG9A 1RT1B 4AXIA 4CT8A 3ZEUA 1CULB 1TUVA 2B4OA 1LCUA 2WOMB 2HAFA 1TL7B 3THXA 4IEEA 3MUVP 2K06A 1WBBA 4ICLA 3OR2A 4C11A 3OY9A 5K14B 1NDLA 3NRBA 4YQWA 5KFGA 2UXBF 4JI4J 1X4AA 4A8FA 3FZBA 1HQEA 3PXGa 3QO9A 2NNWA 1LWCB 2HMPA 2VODA 2RS8A 3DHXA 4DG1B 2A0FB 3UFCX 4ZPDA 1CJUB 3O9SA 4FJ8A 4MIAA 4DV6K 2O8CA 4A48A 3VAFA 3BF4A 2OTLS 4CHOA 1X5OA 1UVNA 2V5HG 3GMGA 4Q45A 1C0TA 2K2PA 1QQOA 4L3KA 4WZMA 3I8BA 1KAXA 4TSXA 2R7UA 2KFZA 1EP4A 3QPIA 1ZXOA 2DEJA 4K4SA 4LRBA 4KGKA 3G4SS 4JS4A 2IVMA 4RNOA 3BKFA 2M5YA 5BYRA 1WC3A 4ID1A 7AT1B 5KFJA 1RAJA 1X7VA 1VBYA 3QNOA 4FNHA 3E2EA 3CDEA 4GVBA 4UQTA 1U1OA 3RRGA 3DDNA 2FD2A 4USTA 4WP8A 2JL9A 1RAIB 2E5LJ 4KH4A 4J9SA 1MWKA 2CQ2A 2FJEB 4EP4A 1LNQA 5IV4A 3MPWA 2V0NA 1MWQA 1RWNB 1RTDA 3X1LB 2IYIA 2VIHA 3O3FA 2MKCA 3CMES 2YV0X 4M5DB 5HO4A 1VRUA 4R8UA 5KOXA 5AR0A 5CD4A 4DSEA 3TJ8A 1WG1A 2LMIA 3AJ2A 3JSMB 4C1NI 1X9SA 4M7YA 4Y0FA 5BYQA 3R1HA 1ASVA 4DCOB 4A8OA 1S1UA 3K2PA 3UCGA 5AQFA 5HVFA 5CA5A 3NE6A 4GKJK 4JV2A 1HKAA 1UJ5A 2CA9A 3HHLC 2HLUA 1BLUA 3RJMB 1LOTB 4AE5A 2VPZB 2GQ2A 2V63A 1SKUB 3EVWA 3E8OA 5I3PA 1PJ7A 3FK4A 4B3MJ 5A2QY 3Q24A 1HNXJ 3NL0A 3IAM9 4NCBA 4LREA 5LXRA 4DQPA 1S7IA 4KBOA 3IN5A 2B0GA 3K58A 3I96A 4BR2A 2PGCA 4IWVA 1NLKL 2PYLA 2P9KA 4KHUA 1VC5A 4TY8B 3PIOQ 1RDAA 5CZ1A 3KUHA 3HYFA 3HHLD 3C46A 4CO5A 4YOWA 1HYZA 2B5JA 4OLOA 1VQMS 4PQUB 4R0JA 3WEEA 3TQEA 1OS5A 3WNGA 3I8DA 2E4LA 4LBHA 3U1NA 5E3CA 2HHSA 4CIOA 2GNKA 4LIRA 4P7VA 3SCXA 4CJSA 3O2IA 4LSNB 3O9RA 4LF7F 4OX8A 1WBDA 2MXYA 4LSLB 3ISZA 4OPKA 3T6JA 4ZITA 1R6VA 3RSEA 2F4VJ 5KT5A 1SJ1A 3AOAA 4AT1B 5ETTA 2JEJA 4CZCA 3QWUA 4JI8K 1SL2A 1FA0A 1LWEB 4IOAL 1GH8A 3VEXA 2HHTA 1Y10A 9ATCB 2HVHA 1YI2N 3RB6A 2QLJB 3HBTA 2LCWA 1JCFA 1S3XA 1TKZA 2B3TB 2J8SA 3KHGA 4DV7K 2B9XA 4I6YA 3U1LA 2VUGA 5LXYA 3N01A 4H5VA 1RDCA 3O1BA 1IM6A 4O0NA 2BUNA 4K0KJ 2V68A 2N3LA 2WVFA 4C8OA 2R7XA 4Y34A 3NCPA 1BCMA 4I1TA 4HH0A 3HXMA 4JK7A 3QGPA 2XI3A 2J0QD 5D3GB 4M3WA 1FVQA 2HBYB 3N79A 1NKEA 3FFIA 3RB3A 3QJLA 3TU5A 4OJ3A 1M5VC 2RMLA 1XNRF 2LKZA 3CCQN 3MECB 2U2FA 3CD6N 3A8IA 2FHJD 4KPCA 2F7VA 2F4FA 3NWRA 3BDPA 3DXMA 3ZZ0A 4X62J 1R0BG 1KVKA 3IM9A 3LPUA 4AHTA 2CPDA 5AQUA 1NH7A 1S5ZA 4TY9A 1E3MA 1I5OB 1NGAA 5L46A 1LAWA 1NSQA 1SL1A 4A57A 1ZBTA 3MMVA 4Q5VA 1CJKB 4ZVUB 4ZLPA 1LW2B 5AJ3F 4WFAQ 1XR6A 2YCHA 2R7RA 3PRDA 2KKHA 3V4IA 1KFSA 4PHTX 3V9UA 3TARA 3S6EA 1P8GA 1GNKA 4OJRA 2FC0A 1FK9A 4B1ZA 1MMNA 2GQQA 4DTXA 4X4TA 4EP5A 4B3RK 3QFHA 4NPOA 2O8FB 1TKDA 3VCDA 2LECA 4PWDA 1J9AA 1Y0HA 5FRNA 5AE1A 3ZTOA 4JI6J 2UU9K 3BYPA 1KVJA 1FNMA 5D4LA 2ASLA 2CADA 2F9JA 2Z0GA 2VPWB 4J5OA 1XQIA 2OPRA 1YJTA 3FVYA 3BBBA 1KNZA 3M6XA 4HDGA 1FEHA 1J5EK 2CJQA 1BQMA 4BR7A 4DEZA 4JI4F 3IO1A 5JVHQ 2ZHAA 3UKRA 4MO4A 2F8HA 2APOA 5KFUA 1K8AO 1D9DA 1TMMA 5A8RA 5D77A 3OR1B 1JLCB 2KVIA 3PEHA 2R42A 1RHUB 2RSQA 1CXUA 3HM9A 1RTJA 1RFQA 4NYPA 4OX6A 1S1XB 2CZ4A 4L73A 3LP1B 2EWHA 3C6TA 3PYGA 1TKTA 3DRPA 1ZYQA 5M2UA 5BREA 2LYVA 2IVFB 2DFHA 2ILYA 2HVIA 5CXTA 5C24A 2VBXA 3H4DA 1R0AA 3SQ1A 2JNJA 1SJFA 2IJRA 1ZETA 4ALZA 3RWUA 3V4MA 1LXNA 1UZDA 2D0AA 4AFFA 2W9CB 2M3DA 4WK1A 1ZBHA 1IBCB 4Y0WA 3RMBA 4DPXA 4CFAA 2W9BB 2CPXA 2BYCA 4E1NA 3FDSA 4ZVRB 3PJXA 3QBXA 5M1NA 1S6UA 4XIUA 5DDQC 4B1XB 2IFXA 1IKWA 1U7LA 4LIWA 1VIXA 2AJ1A 3CCMS 4ZCIA 4HT7A 2KYXA 3MEKA 3AA4A 3RMCA 2P9LA 2W2NP 1Z2ZA 2PI5A 5L1IA 2ZHBA 3CEDA 3FCHA 3GQCA 3TX8A 4ED5A 1N0VC 3C6AA 4KB0A 1RWWB 1S7HA 2ZH8A 4X4UA 2I7PA 4FJ5A 1QSSA 2FBTA 3V9XA 2DR7A 3G71S 5KFMA 4OMFG 2MB0B 1S12A 3LP0A 4P2MA 1RAEB 2QMWA 2A42A 4QOTA 3BSOA 2QSFA 1IO2A 1RUSA 2VYPA 4FJHA 2GJIA 4J90A 4DR5J 3LM9A 3LANA 3CDAA 1UA0A 3GJRB 5IWAK 2QRRA 2H4WB 2D69A 3FCWA 1HNXF 4WFBQ 1I1GA 1WTFA 4RCHA 3CCSN 1T02A 2W25A 4R0EA 4KJIA 4JK8A 3GFXA 3BR8A 4CF2A 5M1QA 2XNRA 1LQ9A 2DGSA 3FFKB 2ZH5A 2HIYA 3THWA 2FBVA 2MEWA 1RA6A 3D6RA 5E3AA 2QN6B 1YTAA 4M3ZA 2AT1B 4EMDA 4F7VA 1S6PA 4JN4A 3A4TA 4CECA 3TVYA 4DHVA 4I2QA 4GMJB 2YKAA 5GIOA 4KGMA 2FVRA 1TZ0A 3EEQA 3BDEA 2B6AA 4M63C 2HAIA 5CZXA 4KQZA 4F4XA 3GYXB 3NFAA 2BBEA 2HNZA 2X7IA 1SVDA 1X4HA 1QSLA 1TUYA 4DV3F 3T41A 3WUHA 4G1QA 4FF4A 2NPFA 3QZ8A 2J9DE 1PC5A 4MFBA 2IDLA 2Q66A 4LT6A 1NJIT 4FXWA 4BC7A 3JSBA 4ANCA 1DLOA 2EFOA 4GKJJ 2K1RB 4DX7A 1YITN 3K2YA 5DGBA 1JLEB 5LL6Z 1A0OB 3CD5A 4HTIA 3BN7A 4RW4A 3AGKA 3MEDB 4MYUA 5L1KA 3MMJA 2CNOB 4B17A 2KFNA 1LAVA 3VGLA 4PY5A 3B6PA 1GOBA 2XY7A 4DTNA 1EHWA 3AO5A 1RHJB 3THYB 4RU2A 4C23A 2JWNA 3KNGA 2RHQB 3I56N 3CJQA 4WFAL 1K0VA 2P9SB 4K2JA 2E44A 2BUPA 3OA9A 4FLTA 1HWJA 4B8CA 1DTTB 2MY8A 4OLPA 3KHHA 5F0WA 4ZLJA 2FBXA 4IH5A 2OI2A 5AQSA 2B4VA 1LWFB 2H1YA 5IXUA 1BOTO 4FWQA 1N6QB 2W7OA 1B9FA 4NO7A 2QT7A 4V19X 2GS8A 4NOHA 4YDUA 2IMWP 3W60A 4OYBA 4XDDA 1RAFB 4IRCA 2DHHA 3LOUA 1OVQA 1DTQA 3EZOA 3P1GA 3QETA 4RW6B 1T11A 3AODA 5AZJB 3D66A 2ZH4A 2DO0A 4P72A 2E1CA 2JLEA 5SWMA 1WUAA 4ECTA 4LF2A 3HFZB 3MXIA 2DNYA 5JVHL 3OVSA 2PBDA 3VQ6A 2A3ZA 5KFAA 4H4KA 2ZBQA 1FDAA 2GO8A 5E84A 4J9MA 2HQ3A 2QW9A 3FE1A 4HTUA 1J2VA 4QCLA 2ZH2A 1BIZA 1IH7A 3EXYA 3JS9A 2QWOA 1HD0A 4H4MA 4FZZA 4FLVA 5AT1B 1N5YB 1S6QA 3LA0A 2G2OA 4N47A 2KHOA 1S9GB 4Z94A 3CJTA 1K73T 4FPIA 3K5MA 3R3TA 2YWGA 1BO5O 2HMIA 3MN5A 1VSMA 3EZUA 1GFWB 3L09A 5HMXA 4KREA 3HPGA 4OLBA 5AQZA 4CZJA 3M1VA 1WC0A 3X3UA 4UUWA 3SQ0A 1HQUA 2ZKUA 3VGMA 4OV1A 3DHWC 4DDFA 4DQRA 2W24A 2GJFA 4MYTA 3C8YA 1NKBA 4KI4A 1U04A 3SQ4A 1ZBSA 1YI2S 5EU7A 4DUZJ 2KM8B 4IFVB 2BDPA 1VK0A 4U67L 1RT4B 2MMYA 3KKSA 1UL3A 2MKSA 4IRDA 3O3GA 3KK1B 3V5RA 3EYZA 1WOSA 4C6AA 1FRKA 2UUCK 1EQMA 1UW9A 1MLAA 4NZ7A 4ID8A 3ZX0A 2DXEA 2MQQA 3U3GA 4RG8A 2ZC3A 1NHUA 4H0YB 1MU2A 4CT9A 4CYUA 5CYQB 3K5OA 2DYAA 3HT0A 4WP9A 2RU3A 5IT9Y 3C6UB 3H45C 4I2PB 1SC3B 1NSAA 3ZO7A 2LU1A 2PMHA 1HD1A 2U1AA 4DU4A 2DEIA 2KT5A 4A2AA 3TZZA 4O44B 3VF4A 3OXGA 1KCFA 1QQCA 3AQPA 3BH7B 2GAGC 3CCQS 2UU9J 4KE5A 4P71A 2NLXA 4KSEB 3CD6S 4G65A 4WFZA 4Z0UA 1RDBA 1RWKB 2XY6A 3HHNB 4LBPA 1HA1A 2VFUA 3EE9A 4WFBL 3MOZA 4OJHA 4IG0B 1VCTA 2CFXA 3ULEB 1U1KA 4BVOA 1VQSA 2GMLA 3M32A 1S9EA 1J5EJ 2ZNYA 1BHLA 3VPZA 2DFEA 2AMCB 3OBYA 4JKGA 5CABA 3DRSB 3GZ7A 3NS6A 3BGOP 4LQ9A 3ISNC 3BGLA 3TUPA 4FJLA 2RPIA 5LMUJ 4ECZA 3NMAA 2R7TA 4ZCLA 3I5AA 5AZIA 2CG8A 1IQZA 2PA3A 2OPQB 2DNKA 1FD2A 4DR5F 1U09A 1XC9A 2ROGA 1NLVA 1TYQA 4YFUA 3VN5A 1FKAF 2AX1A 1YJNN 2VG7B 4B3OA 1ZM3A 4ED4A 3PW2A 1JL2A 2FZKB 3CJKA 3I0SB 4DI6A 1VQPS 1ITGA 3ISND 3J80Y 4CEQA 2R2UA 4Q2MA 2DGWA 3N28A 1HMVB 3A1YG 2KFYA 4IO9Q 1AYEA 3ZX3A 4X66K 4NI2A 3CULA 2H54B 3Q89A 4LFBF 3O4WA 4CHPA 2RQCA 1RDRA 1PJ5A 1CULA 3MCSA 3MCPA 2AYMA 3QLHB 2NLWA 2HBRB 1X4FA 2XSJB 2NZTA 5AQPA 4LSZB 1ZM9A 4I9QA 3GPAA 1KC8T 5K14A 3R2CJ 3OPKA 4JD2B 2P6TA 5M1KA 1WKLA 1G3OA 2MZSA 3G82B 4WBFA 3W63A 4DL5A 4GVLA 3OTOJ 4CP5A 4B9MA 3OVAA 1LWCA 3KKRA 3VQ8A 1CSJA 4NB4A 2J5AA 4BC9A 4KHWA 4DQSA 3PX4A 4DG1A 3ENHA 2XBPA 4KTWA 1PYOB 3F56A 4EUVA 1CJUA 1YHQN 5KFYA 5F2RA 3QYYA 2A1RA 1RTIB 3ELHA 4DZ6A 1ZC6A 3KKFA 5H9FK 3R5JB 1M5SA 1TK0A 4AILC 3OQ2A 3FEZA 4F2RA 4TVAB 1T9TA 1Y5IB 5G0RB 4QU7A 1Q5YA 2ROEA 2F8TA 5KFFA 1KAZA 5EX3A 3W2VB 3TZYA 1KLNA 2RRNA 1T05A 2KLAA 3FZMA 3CO9A 3FMWA 3SK3A 2LXFA 2QEXS 2OTJS 3PW7A 3OYMA 3GJSB 3DLHA 1NDPA 4GC6A 1B7YB 3TTFA 4AL7A 2FDNA 2Q79A 4DV5K 4M5DA 2OEKA 4KY3A 3SCIE 1FKPA 2VWKA 3C16B 2FY8A 3IRXB 2DNRA 4BRKA 3JSMA 1UVMA 4BC3A 3FSIA 1VRQC 2WW4A 3ETOA 4X4SA 2YX1A 4R25A 1GMVA 3MM8B 3CCSS 1XMQF 3KLIB 4ZVPB 4OHXA 2HGMA 1UEVA 2P9IB 1JXBA 4K4VA 1RAHB 4B1WB 5M1OA 4CDIA 4X4VA 3VQ4A 4EBCA 5EWEA 3NOGA 5DG7A 2HHQA 4TXSA 4AXJA 2DPIA 3H2UB 3NVMA 4KB7A 1IR0A 3FBEA 3DLEA 2D1CA 5HMYA 4BR0A 2BQUA 1UWBB 3MEGB 3KK3B 4DOZA 2AYBA 1RT7B 4WE1B 4FYVB 2VFTA 3L7OA 4ZVOB 3QT8A 2X1FA 3L2RA 4FOEA 2D0PA 2ACMA 1B92A 3R8YA 3EMTA 1W9HA 4OPAA 3ID6A 1D8ZA 4C3KA 1RBSA 3G10A 4LFCK 5DM6Q 2ASYA 3RGIA 4LSNA 3I31A 2OO4A 1NMDA 4LSLA 1HWIA 5TKYA 1RHQB 4HI2A 4DUZF 1IUJA 4QWCA 4KGZB 1IBKJ 4AQYJ 4E8UA 1PC4A 4TU9A 1N4LA 4GNIA 3ILLA 1U6FA 3VGUA 3LM2A 2OGUA 1VQLN 1UVJA 2GC8A 1IBMK 2IS3A 4CRJA 4CEFA 3JXUA 4UOCA 4B3TJ 2V2KA 4CIEA 3IFRA 1SJ4P 1KQGB 4A8KA 4FZVA 3A5OC 2VOPA 5K8MA 1HR0J 1RB0A 1S1WA 1Z4UA 4Z4EA 1V9OA 3KLEA 2ITMA 4CJ5A 2XSFA 4NL5A 3I56S 3S3MA 1CLFA 1WUUA 2BE2B 3JAMY 3NVKA 4XO0A 1DQ8A 1RGIA 4ZKAA 4ILJA 2RUGA 5GADP 3OYEA 1DAXA 2ABYA 1M90T 3EPGA 1JLAB 4ZJQA 1HPMA 2RUSA 3VF0B 2GEMA 5KG4A 1NK8A 4OYAA 3IR7B 4E7KA 3RAXA 1O6XA 3N4WA 2HLTA 4ED1A 1M5KC 5KT6A 3HZGA 5KFQA 2BJ3A 3BYRA 2W2OP 3JB9k 2FF3B 3D0HE 4BQZA 3CJ5A 3T9ZA 3IXQA 1J5EF 2NRXA 4IO9L 3ATVA 4ISEA 2IM3A 4DPUA 3TO8A 4J2AA 2YHBA 3KMQA 3QZ7A 4Y6IA 3ENWA 2UUAK 4DUYK 1VK8A 2FSNA 1VBXA 4JI5F 4C98A 1KTVA 5LMUF 2UXCK 3D5MA 1UOCA 1C1BA 1RWXB 4H5TA 1CJKA 2NXNA 1WC4A 1BI4B 2DXFA 3S3NA 1LW2A 3MAAA 3TJAA 3BUZB 4J9VA 4JV0A 4FWNA 2UUCJ 3HHEA 2GHWA 1UFWA 2E9TA 4QR0A 1QVFM 4DF4A 1WB9A 3P39A 2LEAA 3LDQA 2CJAA 4ED7A 3UVJB 1RBUA 1U8WA 4W5OA 2MLYA 1NBEB 2ZBRA 1V3ZA 4CZIA 4K4TA 4RU9A 3DLGB 2HQFA 1H73A 2CQCA 5HANA 4CK3A 4BC2A 1M0SA 4RTFD 4J9QA 5DQHA 1RQ0A 4JP8A 1YIJN 4ZVSB 1JLFA 3QIDA 4OKKA 3GFHA 1QM9A 2F9WA 1BGXT 3CO0P 5GVQA 5JMNA 2XYHB 3PHTA 4URQU 4E89A 1Q78A 5KFBA 4DR1J 4ZPAA 4O3PA 2CZ9A 2D5RA 2CQPA 3A5MC 2NXJA 2PT0A 3OTOF 1HIYA 5KFNA 5KG3A 4QS7A 3K8WA 2E5HA 2ITGA 4LBIA 4LRFA 3VVTA 2HGLA 3OR1A 1JLCA 3DRRB 4GRSA 1L3UA 1BA0A 4OX7A 3ZZPA 2HVEA 3KLHA 3KLGB 4DV1K 4NLWA 4L8RB 3CJ0A 4K5SA 3TWHA 1S1XA 5F3TA 3LP1A 2DBBA 3EWGA 1GTEA 2FB0A 1A5WA 1DQAA 3L0QA 2HS3A 4NLXA 5KG7A 5F8NA 2QWPA 4NXNK 1QY7A 2BEFA 2O66A 2IPOB 5AQIA 1X5PA 2ZZMA 2JX2A 4CQ1A 1V3RA 2BR0A 4B3SK 3KIOA 2H5IB 3T6BA 4O55A 5A0YB 1F2GA 2YQ3A 3W64A 1NM2A 2LQ8A 3K57A 3R5AA 3M2UB 2CNKB 4DPOA 2W9CA 5B0BA 1A7GE 1PBUA 3TI0A 2ZH9A 4JNEA 1GX6A 2W9BA 3J7ZO 1QVGR 4QAGA 2CJ9A 2NXEA 4HI1A 4B1UB 2HRYA 2XWYA 4CJUA 3D2FB 5A76A 1XNQK 4XDCA 3GILA 2BM1A 4CZFA 1H3DA 4QIGA 5J2QB 1ASWA 1NZAA 4HEA9 2E1MC 2QL9B 3L9ZA 2NRVA 1BQNB 3MAHA 2M2BA 3SQOP 2XG8A 2VG5B 4M5KA 4FS1A 4FO0A 3SFGA 1O8BA 3U3YA 2D4WA 1YJNS 3AH6A 3HSCA 4N77A 4UW2A 3WNHA 3QIPB 3HPOA 4I67A 2VKRA 3DKDA 3H90A 3MWBA 5T14A 4B9LA 1I94K 2QE5A 2V8VA 3K5PA 1RBOB 1PO6A 1YBUA 2HSTA 5AQQA 2V4RA 1DGKN 1KSPA 2HNYB 1AUDA 4KHYA 1AFIA 5FROA 2M52A 2UVRA 3ZETB 4OHZA 4AYBD 3G96A 2VDIA 4B9SA 4JI2K 2NRZA 3DOLA 2A18A 2NRHA 1FT8A 2Z56B 4CESA 3ETMA 2JJ4D 1X4CA 2YJFA 4CF0A 2A6MA 2DGOA 4CJLA 3C0BA 1R3NA 2QG9B 2V2ZA 4MIWA 1FDBA 3D9BA 3RW6A 4OYOA 4P6QA 3H46O 4CEAA 4DTJA 4O5BA 5RUBA 3ZFVA 1Q82O 2Z1GA 2VL1A 4CI6A 4O5FA 2GZOA 4ES1A 4X2BA 4IRKA 4CBXA 1IBKF 4DV5J 2KVQE 4AQYF 3C66A 1X8DA 3T69A 2F8SA 3AAQA 5DJBA 2R8JA 4KBIA 3L2UA 2MGZB 1HKCA 2N4DA 1IBLK 2V50A 1H74A 4B3TF 2A10A 4FPRA 3QJPA 1WJ9A 4FWOA 2NYHA 3EN9A 5A2QO 1HR0F 2QC3A 4Y65A 4DXLA 3HKWA 1B0VA 2BABA 3KXDA 1SH3A 2K1RA 4JUZA 3UN3A 1JLEA 8RUCA 1F3FA 1HNZF 4UQGA 2D1KA 4QR2A 4M41A 4V19J 4DU1A 4N56A 4W5RA 2WONA 5KFKA 4K4ZA 5AQXA 3TW0A 2E6MA 4PUOB 2AJFE 4A5AA 1N34F 2QXLA 3MCMA 2P9SA 2V8DA 2QKBA 4EHUA 3HF5A 5C2DA 1XR7A 3LQVA 2WRMA 2Z2ZA 3ICLA 3M9NB 3U7JA 4PL7A 1DTTA 3FSXA 4HCCA 4WIIA 4M95A 1RK8A 4FW2A 3HVAA 4LR9A 4DV2K 1JLBB 2C3MA 1S6OA 4K43A 1R89A 3ITHB 3MOJB 1LWFA 1N6QA 1CC7A 4KH5A 2W42A 2OA8A 4NZ6A 2FHKA 4K7QA 4UY8O 3OS2A 3CIZA 3M8YA 3I0RB 3DLKB 3ADAC 3ULDA 2Y0BB 1OVYA 2DH9A 2PE8A 1TK5A 1IG9A 4RW6A 1VHFA 2DCUB 3KLFB 2RRBA 3FSYA 5AZJA 5BXIA 4N8NA 3QNWB 4B1VA 4ATNA 3QAEA 3IA0A 3H4BA 1RJJA 2O8BA 2EC2A 5F8IA 5GADI 3E9OA 1RHRB 3T1HF 4FK0A 3UDCA 1TV6B 5KT2A 1XEZA 2F3JA 3EE8A 3BPSP 5BRFA 4DR4J 3E1YA 5ETRA 2HRUA 4JI3K 1HLWA 1ULRA 5CHIA 5I42B 3SV4A 1HW9A 2H51B 3MMCB 3LF0A 1PGZA 1MG7A 1CG2A 4F3MA 2OH2A 1JIHA 1UJ6A 2BXJA 1CZAN 3LP2B 1BXNA 1VSKA 3PKMA 1S9GA 2I1RA 2UUBK 5EWGA 1BISA 4O3QA 2GUIA 1RBTA 4QWEA 2XY5A 3AA9A 1R8CA 2YWEA 1N5VA 4I56A 1ZA1B 4J9RA 3TTCA 1P1LA 5FPDA 3B6OA 1HBUB 5KFHA 7FDRA 1VRTA 4CJQA 2GV1A 2ZC4A 1XHZA 4LF5K 2BA9A 5B0GA 4DR1F 3WNEA 4FJXA 3CJAA 3OYBA 1VQLS 2ASOA 2VZ9A 2XTJP 5B0FA 3EVMA 2DY4A 4NWBA 2YNHB 4LF6K 1FCAA 3DOMA 2EXUA 5HOOA 5FPMA 4ZTFA 3VA0A 1U2CA 3NXZA 2HYIB 2UUAJ 4IFVA 1F5AA 2K8GA 2KT3A 1X9WA 3PY8A 1RT4A 2EKNA 1N54B 3AJDA 3D2EB 3KK1A 2CJYB 4B9VA 2GX8A 2R7WA 4CHYA 5DGAA 2UXDK 5G4DA 3PVXA 4JKDA 5HMZA 4M94A 1OYDA 3P4UB 2E7VA 4WPAA 3KDOA 5CYQA 1X4BA 2Z4PA 1VSLA 3IGNA 4I2PA 5HJYA 3L4IA 2VQEK 2P9UB 3HOTA 3DU5A 3U1MA 4O44A 1RAOA 4F0HA 4ECRA 4O0JA 1HYSB 2MQOA 5JS1A 3GWCA 3S41A 4X4QA 1QAYA 4MKAA 2KT2A 4OV6A 3EGVA 1X4DA 4P73A 3W65A 4KFBB 4ZVTB 5F1XA 2BW7A 1NH8A 3MDQA 2QWNA 4IG0A 1ROFA 5DG9A 3ULEA 3CCEN 2GV9A 3VOVA 3TUJC 4ICLB 4A59A 4FM0A 1H0HB 2N3OA 1BC6A 2ZWPA 3VEOA 1DURA 2HK3A 3DRSA 2FBYA 4B9QA 2R3VA 3SUNA 3TEHB 4LFAK 1HQEB 2V8PA 1MN7A 2CRLA 4CNYA 3QO9B 2X3GA 2YWHA 3C6HA 5KT3A 3DRXA 3PW0A 4A47A 4NLSA 3VAKA 2OPQA 4DV1J 1UEKA 3MUMP 2QI2A 4ZCKA 5KFPA 2WBMA 2AV5A 3ZTRA 5B0DA 2VG7A 4PG4A 1T0TV 4ECUA 1NU0A 1RSCA 3KWIA 4JBCA 4Z7CA 3I0SA 1FJ7A 5GAHP 4BACA 1C0TB 3SV3A 2QMUB 1DBDA 1HMVA 1VMBA 1YIJS 1JJ2M 3EUNA 2AGPA 3ZT2A 4NRTA 3OYGA 5DRKA 5DM7Q 3K9KA 3D0PA 3OUYA 1YRXA 5H9EK 1N52B 4YDDB 3ZNUA 4DMZA 2G4BA 1ZAXA 1AB8A 2R7QA 2CQ4A 3QLHA 5KFEA 3M6GA 5C12A 2XSJA 4BE2A 1VQ7N 1D09B 2E88A 5E7OB 1UFKA 1XNQJ 3FR0A 3AY9A 4IH6A 1S0VA 1RTDB 4JD2A 3SLCA 4CW7B 3CGIA 4URGA 4R5PB 2D7SA 2FC9A 2FHOB 4U96A 5J1EB 3G82A 2P9PB 1CC8A 3AY0A 2EFQA 2UXBK 4J9LA 2RKIB 4R8UB 2HQDA 2HHHF 2NQPA 2KJVA 1RE1B 4DU7A 1Q18A 1Z1ZA 4PXBA 1RTIA 3KDNA 2ZJPQ 3CG7A 3HOSA 3M2VA 3HP6A 3VGKA 1KD1T 1I94J 5FIIA 1IR2A 4NYOA 3DGPB 4QOZB 3JQJA 2VASA 3RW7A 4I0WA 3WXJA 2V52B 2CDRB 1UWAA 4NMLA 1TFYA 3RBZA 5G0RA 3MX5A 3UI3A 1SI9A 4UT4A 2CWXA 3ZTQA 2FJAB 2DIUA 3G0ZA 4PG7A 4A8MP 2VV5A 3GV5B 2GMJA 3AVIA 4L3QA 2OMOA 1RWPB 3HD1A 3HFVA 1F5CA 4C8YA 1HBOB 1SJQA 4H54A 3H40A 3OFGA 3GIMA 4ERDA 5EVZA 2E1AA 1FWPA 2MKKA 3AO2A 3IDHA 3TAMB 1YJ7A 1T9WA 2Y3YA 4YR3A 2D3OR 1YG0A 2RVJA 3VTIA 3HSZA 4RL1A 3RR7A 2XMJA 3KNAA 2GIRA 4UZBA 3K8VA 1U2FA 2CPFA 4CLYA 2W01A 4N41A 3C16A 3W3DA 3CJSA 2JEFA 5L1LA 4BG8A 3T5JA 5KG2A 4M8LA 4X4RA 1IBLJ 4ED6A 2Z1HA 4HHJA 4MKVA 3QGIA 4NYZA 3Q8UA 4GY2B 5F9NA 4PG8A 3KLIA 4KR0B 4E3SA 4Z4CA 5KI6A 1XQSC 3WX8A 4QU6A 4DR4F 3CJ2A 4USVA 1JXEA 1TKZB 3AXMA 2KI2A 2XMTA 2FQQB 2WZ1A 2JFKA 3MI7X 2C3YA 2HF4A 3D6FB 2P51A 1F21A 5J2PB 3OHRA 5HQ8A 3SSRA 1UWBA 3MEGA 3KK3A 3V9ZA 4I7FB 5HLFB 2F40A 2R4FA 5F8MA 3P49B 1SKRA 3EKSA 3HHKA 3EL2A 3SCJE 2BJDA 1R31A 2HHPA 2CXEA 3MTJA 3KHRA 4F4KA 2GBZA 2UYTA 4GKKF 5JMVA 4Y2MA 1C2PA 2AF6A 2CWKA 2ASPA 1QAXA 5A6WA 3ZSVA 3NH0A 2PEHA 4LF7K 4FF3A 4DTSA 1OH7A 4LF4F 5AQTA 3NH1A 4CLTA 4U7UK 3KUGA 2V2QA 1KEKA 1FTRA 3LGNA 3DI6A 1P6TA 2G9OA 3NGSA 4DV4F 3HVRA 3ZT3A 4PL8A 3K89A 3FCVA 2QV6A 3AOBA 4YMEA 2BE2A 4E2FB 3L8BA 2VBWA 1WI8A 1EIYB 3HI0A 4G3IA 5I9EB 3CW2C 1FK9B 1H6KX 3D1QA 3EM1A 3G8QA 1JLAA 3HDSA 1UA1A 4F4ZA 4OKJA 2E5JA 3IRWP 2FTRA 4BROA 4P75A 4QYZK 3NHGA 3G8TA 4CJTA 3BSNA 1EKEA 3WHIA 4EIAA 2FJWA 4CBWA 2MHEA 3ALYA 4JRPA 1JL1A 2CQBA 1RXOB 3S8SA 1K47A 4V1Ak 5D15A 3J7YU 4BGAA 1XNRK 4PXDA 5DM7L 3JS6A 1UW4A 1X4EA 2Y1LB 1HKGA 3JAMU 2Y8WA 4X64J 1RBVA 1BQMB 2HFUA 2FVSA 3FZFA 3HFKA 2DR6A 4FXDA 1T94A 3WQTA 3RBXA 3CM5A 1TU0B 4DL3A 1Q86O 5IOLA 4YDUC 5KQ8A 2Q1NA 3FZLA 5LJWA 1M5OC 2ZUGA 3QEIA 3SUPA 5BR9A 4G9ZA 5IT9O 4ZIVA 2B7BB 4GVMA 3HVTB 4A8W