1DTTA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-2 (pett130a94)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
543
structure length
540
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-CHAIN
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase/transferase
total genus 126
structure length 540
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dttA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dttA05
1YVUA 2R8KA 3OLBA 4Y2AA 4J9QA 4K4SA 4TY8B 3VQ6A 2HHQA 5CYMB 3B6PA 4FJGA 2BANB 3KMQA 1UA1A 3PO5A 4XPEA 1RDDA 4B9SA 1ASWA 2BQUA 2X6SA 4JLHA 4KHMA 2Z1GA 3MR3A 2PYJA 1VK0A 2ZD1B 3KHGA 3VQBA 1ASUA 1HYSA 1ZBUA 3DMJB 3VQCA 4K4XA 3JYTB 4G3IA 4DQPA 3TVKA 3KMSA 4LSNA 3VQ9A 2FVCA 3ZSVA 5KGXA 4KPYA 4CEEA 1S6QB 4DFMA 3L3UA 4FLTA 1NOYA 3MEEA 1HJRA 3H59A 2P5OA 4DWIA 4CEDA 2IM0A 4ED6A 1XHZA 1RDRA 3T5JA 3HPOA 1RTHB 5EDWA 4MK9A 1KLNA 1W0HA 3HVWA 2Y1JA 1Q9YA 4JRPA 1S49A 4RW9A 3E01B 4CFCA 3WNFA 4K4ZA 2V4RA 2HNDB 3LANA 1EP4B 1RTIB 2RPIA 1F21A 1EETB 4QCLA 5KFWA 1W25A 3AO3A 1DTTA 3DLEB 1VSKA 4CHNA 4CE9A 2VG5B 5J2PB 3THVA 2HMIA 3MEDB 3RMCA 1RT1B 5C25A 3CIZA 2QK9A 4OL8A 4DTRA 4WXWA 5KFDA 2A1SA 1RTDB 3QETA 5EWEA 1QTMA 3JSMA 4JRQA 3ZSRA 3WNGA 3DRRA 2XI3A 3OL6A 4B9VA 1FKPB 3AVIA 3O3GA 4CF8A 4O44B 4CGGA 3V6JA 1JLFB 2O4GA 3TAGA 4PA1A 5F8MA 4E1NA 4KKOA 1U45A 1HNVA 4AHSA 2W9BB 3D28A 3KLIA 3ZT1A 4NLYA 4QWCA 4DL5A 1RDBA 5J1EB 2FBYA 4LH5A 3BGRA 3C6TA 4O3PA 4FS1A 2DFEA 1FXXA 2E9RX 2FJWA 1I39A 3TAMB 4E7JA 2UUTA 1JLBB 5KT6A 3HKWA 1MU2A 2UVVA 5D3GB 4RUCA 4Z4HA 1ASVA 1SUQA 3SUQA 2JC1A 3LPUA 4MKAA 5KT2A 1RT7B 3SPYA 4MIAA 2BE2A 3OYCA 4F4ZA 4R8UB 1RT6B 4FJLA 3GYNA 2EX3A 1TQLA 2R8GA 4FK0A 1S1UB 1TKZA 3TQ1A 1VSLA 3NF7A 5KFAA 4KV8A 3Q8PB 4FLYA 1NKCA 1UOCA 1IKXA 1SL2A 1RBRA 3MXIA 4GC6A 4OGCA 1D5AA 5HRNA 3PX6A 3OYJA 5FDLA 4DSJA 3QO9A 3AVBA 4IG0A 1BIZA 5K14A 4EBDA 3HL8A 1RCHA 4E7KA 1L3VA 2IJFA 4CGIA 5KFPA 4BE2A 4TSXA 1SH2A 3LPTA 4ZVFA 1S4FA 4CIEA 5CYMA 3KKSA 3OL9A 2G8FA 1LW0B 2BANA 4Q45A 4ZVEA 3P5JA 3DLRA 2YNHB 4PY5A 3SQ4A 4DL4A 4M42A 2C2EA 2R8JA 3TAQA 1RT5B 2PZSA 3MR6A 1R0AA 1DTQA 2YV0X 2OPRB 2VA2A 2RDIA 2ZD1A 4HHTA 4NYNA 3V4IB 4MK8A 1HARA 3DMJA 2X78A 3WNEA 1ZBIA 3JYTA 1NK8A 2BRLA 4XPCA 3PZPA 3OYBA 4NLGA 2JEGA 3QYYA 1L5UA 2YNGB 3OS0A 1SH0A 2IMWP 3HXMA 4B8AB 3OHBA 4ZP7A 2VG7B 3KD5E 2UUWA 4XIUA 3LZJA 3DLBA 2FBVA 4ZPDA 4CEQA 4M3ZA 2AGPA 4ED3A 2C2RA 1VSFA 2IBKA 1QAJA 5FRNA 3E01A 1B92A 1TL1B 4RW6B 2HNDA 2YKNA 1EP4A 4KSEB 2XCPA 2GIQA 2R8IA 1KTQA 1EETA 4Y1CA 4KHSA 4DTUA 4URGA 3DM2A 3DLEA 3G10A 1VSJA 1UAXA 2YKMA 4F4XA 5L1KA 2VG5A 4DQIA 3OYMA 1HQEB 4PUOB 3UPFA 1X9SA 2HWHA 3H98A 3MEDA 3NBPB 1RT1A 4M94A 3HHKA 3KLVA 3PV8A 4OLBA 1RTDA 3DRSA 3KLHB 5T7BA 1SL0A 4H54A 5KFRA 3SZ2A 4DFJA 1S9GB 1JX4A 2IA6A 4WXOA 3H5YA 1IH7A 3MEGB 4DL6A 1FKPA 3HPHA 3VQPA 2EHGA 4RG8A 4O44A 1JLFA 4O55A 4PWDB 3QEVA 5E41A 4YFUA 4JV2A 3K5MA 1GOAA 3KK1B 4YMEA 3V1QA 2D5RA 2W9BA 3IGNA 1IKYB 2IM2A 2G8HA 1RT2B 4ID5B 4OPKA 3RR7A 5J1EA 4B9NA 3EYZA 3PW5A 5DGBA 2CKWA 3MAQA 3AA4A 1BQMB 2G8IA 4TN2A 4TYBA 1HQUB 3VQQA 3TAMA 1NJZA 4I7FB 5HRPA 3CWJA 4FJKA 2KW4A 3H5SA 4CJ3A 5D3GA 5C5JA 4KHRA 5EWGA 1KHVA 1RT7A 1NJYA 4LD0A 4LQ9A 4R8UA 1RT6A 1FKOB 5KFZA 4FS2A 1S10A 4NLSA 1S1UA 3N6NA 2W9AA 3KLFB 1WSFA 2UVWA 4DU4A 4IH5A 2HHVA 4CECA 4IH7A 3IS9B 4J9KA 2Q3SA 4E7HA 4CCHA 1YVFA 3BREA 1N48A 4B08A 3SQ0A 1JLCB 2YNIB 4LH4A 3AVCA 3HK2A 1C1CB 3PW7A 1N56A 1KVBA 1X1PA 2ZQBA 4NLDA 1KCFA 3D0PA 2D0AA 4DG1B 4LSLB 4NRUA 5KT5A 1T03B 4RUAA 1LW0A 3PY8A 4Q0BB 5HBMB 4ED7A 1L3UA 2YNHA 4FW1A 2Z1IA 3ZT3A 1RT5A 2R8HA 3KKRA 2W9CB 2C2DA 3OSPA 4DQRA 3SQ1A 2BQRA 2OPRA 1Z4UA 4YNQA 3MR5A 1WSEA 5KG7A 4K50A 4O3NA 4ED8A 3LWMA 2B5JB 1RYRA 5T14A 4ECVA 2OPPB 1C1BB 3V4IA 3BR9A 3DLHA 3IAYA 1REVB 4KB0A 3LZIA 3LP0B 2E9TA 3M8QB 3O3HA 3RRGA 4KTZA 3OS2A 4H8KA 4HVJA 2E4LA 3OJSA 2YNGA 3NFAA 3I0SB 4F4KA 2JEJA 3HPGA 2VG7A 1HMVA 1YTAA 1TAUA 2EC0A 4EYHB 4ZP8A 3NH0A 3T3FA 3QERA 3T5HA 5DMRA 2WOMA 3N6MA 4FJIA 2R2UA 1TL1A 4RW6A 1LAWA 1CXUA 3KLGB 4B9UA 3M8RA 4CHYA 2HHUA 1BQNB 3SYZA 1HRHA 5KFOA 4WFXA 2JEIA 4C8LA 4OKJA 2AGOA 5DLGA 3KTQA 1N4LA 3RB0A 4CJWA 5I42B 5L9XA 4CJ5A 1HQEA 4PUOA 3NBPA 3NCIA 4EZ6A 4CGFA 4KHYA 4BDPA 1WAFA 2C28A 1B9FA 3M9MB 3K58A 3VQ5A 4FM1A 1S9GA 3ALYA 4N76A 3GILA 4DTPA 3MEGA 4H4MB 5KFUA 1CXQA 4PWDA 5JS2A 4N56A 4DF4A 4F2SA 1S6PB 3KK1A 4NYZA 5SWMA 4FM0A 3UIQA 1IKYA 1XI1A 1RT2A 4ID5A 4NRTA 4O0IA 2FC0A 3NHGA 2UVRA 1VSDA 3V1RA 3IG1B 4KI4A 3T5LA 2RF2B 1QE1B 1J5OB 3M9OB 3KLEB 3I0RB 1HQUA 4GC7A 2BGGA 4I2PB 3I8DA 4I7FA 4OLAA 4ZHRB 3C6UA 5KFHA 3NKYA 2AX0A 3SUOA 5KGWA 3RMDA 3G0ZA 3PW4A 1HNIB 4FYDA 3OYNA 4ELTA 3ZT0A 3B6OA 3RWUA 5KI6A 2D0CA 1FKOA 5KT7A 4RNFA 1VSEA 1O1WA 5KG2A 2F8EX 3V9WA 3KLFA 3GQCA 2XGQA 5DLFA 3DI6B 4FLUA 4DS4A 5KTQA 3IS9A 4ZVHA 3OY9A 2KZZA 1SKSA 3PO4A 4FJMA 3RMAA 4CFAA 1JLCA 2YHBA 4FW2A 2IS3A 1C1CA 4AHUA 2UVUA 1N5YB 2V0NA 1S0NA 4EO6A 2JC0A 3LP1B 3HVAA 4DG1A 3TR8A 3MFIA 4EYIB 4LSLA 1RBSA 4LQ3A 3CO9A 2WCXA 2BRKA 4M41A 3BSOA 1T03A 4HUFA 5KFNA 4Q0BA 3H2LA 5C24B 3NAEA 2G8UA 5KFGA 2W9CA 4F2RA 2FJVA 1U09A 3NGDA 2HWIA 2RDJA 2B5JA 2OPPA 2WONB 3HSTB 1C1BA 2KTQA 1JXEA 4CIFA 1REVA 3SCXA 3LP0A 3M8QA 3KD1E 5F9NA 3AVNA 4B9TA 1T94A 4IG3B 1L3SA 3I0SA 4Q44A 4Z4GA 4J2DA 4J9RA 3QNNA 1BCMA 3AA5X 4B3OB 1D9DA 4CJLA 4IFVB 4W5OA 1S97A 3ISND 2J6UA 2OPQB 1JLEB 3GV8B 2HHTA 4QWDA 2R2TA 4CIGA 4CHOA 4DL3A 4EP4A 3PR4A 3VQ8A 4G1QB 3DLKB 3KLGA 3QZ8A 2QKBA 1BQNA 4MH8A 3L2WA 2XWYA 3DDKA 5DQIA 3CM5A 4GVMA 3VA3A 1IKVB 3QIPB 2AU0A 3EPGA 4KREA 5JUMA 2FBTA 2ITGA 4F4WA 5I42A 4FJNA 4I9QA 3OL8A 3TAPA 4DU3A 3K2PA 1BGXT 3LP3A 1BL3A 1NK6A 1IM4A 4O0JA 3RB3A 3LALA 1JL2A 3LWLA 3V9SA 1JXBA 4H4MA 1T05B 4KBIA 1ZTTA 3GIKA 3OYHA 4U7CA 2KZMA 3HVTB 3GIIA 4IDKB 1GX6A 3EPIA 1S6PA 3QNOA 4TYAA 4ZMMA 3BDPA 3RB6A 4CJVA 3DOKB 5C42B 5KFSA 4O3OA 3K57A 2IOCA 5KFFA 5HROA 2IM1A 3BSCA 1TAQA 1VRUB 3AVLA 2RF2A 1QE1A 1J5OA 3KLEA 3I0RA 2R2RA 3BSAA 2D3UA 2XY5A 2W8LA 3UR0A 3SNNA 1WLJA 3VN5A 4CHPA 3U3YA 3DYAB 2LSNA 5DK5A 3NGYA 3PVXA 1VSMA 3FDSA 1HNIA 4AH9A 4KHQA 5I3UB 4NYFA 4TY8A 4F8RA 3GV5B 4WZMA 5KFBA 2FBXA 4FLXA 3DI6A 3MECB 4E0DA 4TQRA 3NH2A 3LAKA 4Q8FA 1U48A 2PY5A 3OJUA 1RBTA 2P5GA 2FVQA 1XWLA 4J9LA 1S5JA 1GX5A 2DY4A 4NCBA 1N5YA 1BHLA 1C2PA 4ED0A 4O4GB 3LP1A 2DTUA 2ILZA 2OA8A 4Y2CA 3SUNA 3SJJA 4ECWA 1S6QA 4WFYA 3PUFA 3S3MA 2ZKUA 2WRMA 3QGHA 2AX1A 3OYFA 3H4DA 4J2AA 1WSGA 2BR0A 1RTHA 4GW6A 2WONA 5KFJA 2HVHA 4ZP6A 3NGIA 4ICLB 4KAZA 1RTIA 4E7LA 2AJQA 4FJ8A 4NLXA 1CSJA 2XO7A 4KFBB 5F8NA 4YR2A 2D0BA 4W5RA 4W5NA 1IO2A 5J2PA 2D7SA 1NHVA 3T1AA 4B3OA 4IFVA 4CJPA 4W5TA 4FLWA 3OYEA 2OPQA 3CDWA 1JLEA 3PR5B 3L8BA 3AVMA 2HAIA 3ASMA 2I5JB 1RDAA 4G1QA 5KFEA 3DLKA 2JEFA 4FJ5A 1EKEA 5KRSA 3QLHB 1D1UA 4TQSA 1J53A 3ZSZA 2J6SA 2IJNA 1IKVA 3QIPA 2ASDA 4FK4A 3CDUA 2IAJB 1HPZB 2GBZA 1ITGA 3V9ZA 1RA6A 3VQ7A 4N41A 5CZ2A 4IR9A 5J2NB 1TV6B 2XY7A 4M3UA 3SV3A 1D9FA 2RKIB 2C22A 5EUHA 3MXMA 3L2UA 2ALZA 3TABA 4DSFA 1ZBHA 2OZMA 4ECSA 3QIOA 4FZYA 3VQ4A 3BSNA 2W8KA 3K5NA 3IRXB 1NKEA 1JLBA 1T05A 1Z26A 4JUZA 1S1VB 3T5KA 1YTUA 3HVTA 3VQAA 1C0UB 3K5LA 3VA0A 3FRZA 1LWFB 4NCGB 4MKBA 4IRDA 3HO1A 3DOKA 5C42A 3AVGA 3FFIB 1RBUA 3DOLB 1VRUA 1ZETA 3K5OA 1JLQB 4QOZB 2XGPA 3V9UA 4DS5A 3ZSYA 3AV9A 3ICLA 3QEPA 3TI0A 4NLOA 2OH2A 1LV5A 3DYAA 3L2QA 3H08A 4AHTA 4RNMA 4DFKA 3AO5A 3SQ2A 3ULDA 1RT4B 3F73A 4B9MA 5I3UA 3QESA 4FJHA 3D5MA 3PX0A 4BE0A 2FVSA 4IH6A 4OPJA 4E3SA 1K6YA 1C0MA 4FJXA 2HHWA 4O3QA 4KAIA 3HP9A 5KG4A 3KK3B 1JXLA 3MECA 3OVNA 3TWHA 1NHUA 4Z4IA 3K59A 3KK2B 3P1GA 4K4WA 3NH1A 1RTJB 4KRFA 4CFBA 4F3OA 3QGGA 5JXSA 3ZSOA 5DQHA 2YHAA 3GIJA 4MFBB 4O4GA 1XR5A 5KG6A 3VQEA 4FCYA 3M8PB 3ISNC 4HKQA 4Q43A 1A5VA 3L2VA 4JS5A 4CHZA 4C8OA 5KRTA 4HCCA 5KFXA 4E7IA 1LWCB 3AO2A 4HUEA 3OYGA 3BQ0A 3IN5A 1GOCA 4KHWA 3HJFA 4IRKA 3KIOA 3QEIA 4ICLA 2Y1IA 4Q8EA 3MR2A 3OHAA 4B8CA 1Q9XA 4ELVA 3G6VA 5CY4A 1RA7A 2A1RA 5J2MB 4ZPCA 1SV5B 3DLGB 3SI6A 3MXJA 1ZYQA 4KFBA 1HYVA 3PHEA 5CYQB 4CGDA 5F8HA 4JV0A 2IM3A 4CJRA 2ATLA 2OPSB 4KTQA 5FROA 2Z1HA 3V1OA 2G8VA 4E89A 4RNHA 1EXQA 1QHTA 5HRRA 4K8XA 3KLHA 4O5BA 2VWJA 4CFDA 4F50A 2I5JA 4Z4CA 1S0OA 1ZBLA 4NCAA 3CDEA 1TK5A 3KLIB 2DPIA 3QLHA 4ECZA 5F8JA 3AVAA 3ZSXA 5F8IA 1A5WA 1D0EA 1Q8IA 4KI6A 1QUVA 5KT4A 5J2NA 1TV6A 3MF5A 4ED1A 3CYMA 4U6PA 3KHLA 4YQWA 2RKIA 4ECQA 2G8KA 3RB4A 1BQMA 2WB4A 4I9LA 5KG5A 2B6AB 2BQ3A 4K4VA 5KFMA 1CZ9A 4ELUA 4IQXA 3PJWA 4CJKA 3LDSA 1VSIA 5DG8A 3IRXA 1K1SA 2J6TA 1U4BA 5SZTA 4QPXA 4AHCA 2VG6B 1BCOA 2F96A 3V81B 4KHNA 4J9MA 1C0UA 2E9ZA 3PJXA 3OS1A 4M3RA 3CFRA 2B43A 1DLOB 3CJ3A 4NLTA 4NLRA 4J2BA 4NCGA 4ZPBA 1LWEB 3OYIA 4OGEA 1S0MA 3KNAA 1TKTB 1TP7A 3SUPA 3FFIA 4K4TA 1JKHB 2ILYA 4ECXA 3DOLA 4DLGA 1S1XB 2W7PA 2E6LA 1JLQA 4FM2A 4TXSA 4DU1A 2XY6A 4CEBA 4RNOA 4L8RB 3V6DB 1VSHA 4Y34A 3NGZA 2YNIA 3U6FA 2ASJA 3QINA 3KJVB 3EZUA 3AA3A 4CEFA 3ITHB 1RT4A 4KB7A 3WNHA 3DRPB 1R0AB 1DTQB 3S3NA 1S9FA 5HBMA 4O3SA 3KK3A 3C95A 3IGVA 1CZBA 4RU9A 3KK2A 1WAJA 1U47A 1RTJA 1A5XA 4MQ3A 3I5CA 2P1JA 4KE5A 3CQ8A 1NKBA 3N6LA 1RYSA 4R5PB 2ETJA 3H5XA 2E6MA 4MFBA 4KHUA 3Q8RB 4RW4B 4K4UA 3M8PA 4CJ4A 2V9WA 3G6XA 4M3YA 4MK7A 4NZ0A 4HCBA 3BQ2A 4J9PA 5KFLA 3H40A 4LY7A 4HUGA 1LWCA 3CFOA 1JIHA 3I5AA 1Y97A 2YKNB 1KVCA 2W42A 4F4YA 1QS4A 2I1RA 4CEZA 4YR3A 1GOBA 3DM2B 4C8KA 1IKWB 2YKMB 1BISA 3NE6A 3OYAA 4FZZA 3MFHA 4CJUA 4DTXA 5J2MA 1SV5A 3DLGA 5KFVA 1KVAA 1C1AA 3HYFA 4FJ7A 4QAGA 1FK9B 4CHQA 5KFIA 5JS1A 5L1JA 3DRSB 5CYQA 3SFUA 4KO0B 4C8MA 2OPSA 2CJQA 4UQGA 5KT3A 1CLQA 1G15A 4DL2A 5J2QB 4WE1B 3AO4A 3KHHA 4F3TA 5DGAA 1I6JA 3F9KA 4EBEA 1MMLA 4GMJB 2AGQA 4NLPA 4CGJA 1NJWA 2FVRA 2B4JA 4URSA 2P51A 4M3WA 3V6HA 2IGIA 1RILA 4EO8A 4CJEA 4EEYA 3RBEA 1NOZA 1WNSA 3OLAA 4DMNA 4Q5VA 1TKDA 4C8NA 4M45A 1NK5A 1S1WB 4EBCA 3CFPA 1KFDA 5KFKA 1S1TB 4ZVGA 3M9NB 4Y3CA 2JLEA 4J2EA 3D45A 3H5UA 3ZCMA 3IG1A 2B6AA 2XI2A 2HNZB 2HVIA 3HT3A 3PX4A 2F8TA 4I2PA 4RZRA 4YP3A 5L1IA 4WFZA 5KFTA 4AHVA 3CVKA 4AHRA 4ZHRA 5KG0A 3CG7A 4DTJA 3S9HA 2VG6A 3V6KA 3V81A 1U49A 2ZE2B 3AO1A 1TGOA 4NLUA 3O3FA 4CF2A 4DSKA 1NK4A 2D3ZA 1DLOA 5F9LA 1WSHA 1LWEA 2D41A 3OSNA 1RBVA 2HHXA 5HP1B 3CJ0A 1TKTA 4HTUA 3FQLA 1ZBFA 2VA3A 4FVMA 1JKHA 2R7YA 4EZ9A 1UA0A 1S1XA 3ZT2A 5EU7A 4QWBA 4FK2A 2X6NA 2QXFA 1TK0A 4K4YA 3NMAA 4CJTA 3V6DA 2KQ2A 2X74A 1B9DA 2WTFA 4FLVA 4WZQA 4PQUB 1W9HA 3KJVA 2DFHA 3CJ2A 3ITHA 3KOAA 3RR8A 2XHBA 3BJYA 3OL7A 3DRPA 2VWKA 3L3VA 3U3GA 4BE1A 1IG9A 4O3RA 4M95A 4ECRA 3OYDA 3VQSA 5C24A 1X9WA 3A2FA 2V4QA 4CGHA 3ZT4A 3C94A 3EZ5A 3ZSQA 3TARA 4N5SA 1EX4A 5DQGA 4W5QA 5DG7A 4NLVA 1XR7A 3PW2A 3QIDA 1UWBB 1BI4B 1TKXB 2RN2A 4R5PA 4DSEA 4ZPAA 1N6QB 2O5DA 4R0EA 2HB5A 1HMVB 3LP2B 4RW4A 4TLRA 4I2QB 1HYZA 4JV1A 2FVPA 2HNYB 3HVRA 1TVRB 4IG3A 4QW9A 4J9SA 2WOMB 1XC9A 2OYQA 2ATQA 4ID1A 4FJJA 2IC3B 4DFPA 5KG3A 1X9MA 4DQSA 4DSIA 4FJ9A 3AVFA 1IKWA 4CEAA 1TL3B 4CK3A 2ASLA 4RW7B 2GV9A 1NK9A 2YNFB 3Q8QB 4FBUA 4BWMA 3S3OA 1SKRA 1FK9A 1VRTB 3FSIA 2FJXA 4IKFA 4H4OB 2GIRA 3AA2A 3NF6A 1C0TB 2WK4A 4KO0A 1LW2B 4ECYA 5CZ1A 4DF8A 1WN7A 3SFGA 3HP6A 1C6VA 4OJRA 5J2QA 4B9LA 4WE1A 1KLMB 4Z4FA 5L1LA 4CERA 1T7PA 2FLNA 5FRMA 4CF0A 3FQKA 2PYLA 3SPZA 5F8LA 3M8SA 1NK7A 4DTSA 3NAIA 4IDKA 5KFYA 3NF8A 4X2BA 3L2RA 4IKAA 1JLGB 4CF9A 1RT3B 1S1WA 1WNEA 4CJQA 5HLFB 1S9EB 4BACA 1S1TA 1QSYA 2R2SA 4RW8A 4M3TA 4IFYB 3AVKA 2KFZA 2FLLA 3C6UB 3G86A 1JLAB 3RBDA 2AQ4A 2HNZA 1QSLA 3AVHA 4MIBA 4NLWA 4RW8B 3G6YA 4J9NA 1YT3A 2NUBA 4URQU 4FZXC 2ZE2A 3TANA 4ECUA 4AILC 1SKWA 4CK2A 1J54A 1TK8A 3CJ5A 5HP1A 2GC8A 3EY1A 4E19A 4BDYA 4BWJA 2O4IA 1OS5A 4ECTA 1HYSB 4DL7A 4HYKA 3O4QA 3QZ7A 2DPJA 1BIUA 2IDOA 4LSNB 4QW8A 1QAIA 4DTNA 4JS4A 4PQUA 4DSLA 4N47A 2FLPA 4QWAA 3MEEB 4EP5A 1J9AA 1KRPA 2WHOA 4M3XA 2OZSA 4CESA 3E51A 1T8EA 1SL1A 4ZP9A 2W7OA 3BQ1A 2HW3A 3T19A 1U04A 3RAQA 3RTVA 4ZTJA 4RW9B 3I5BA 2XRIA 4OKEA 1S48A 5KFQA 4IOBA 1WSJA 3CJ4A 4WYWA 1WSIA 3KHRA 2AWZA 3OYKA 1DTTB 4CJSA 1UWBA 1K1QA 1BI4A 1TKXA 4DLEA 4FBTA 3QEWA 1N6QA 3NL0A 3LP2A 1XHXA 3UQSA 3GV7B 4I2QA 2JGUA 1NNDA 2HMIB 5HRSA 5C25B 4TY9A 1I3AA 3TAEA 2XCAA 2HNYA 5KFCA 1TVRA 1NK0A 3ZSWA 3RRHA 2GUIA 3P83D 3JSMB 5KG1A 4Z4EA 2BDPA 4CK1A 3DRRB 1KFSA 4NLQA 3NAHA 2Z1JA 2IC3A 4OKKA 5DG9A 1T3NA 3OYLA 1NJXA 3PW0A 3SV4A 4BDZA 4FLZA 1TL3A 3HM9A 4KKOB 3Q8SB 4DEZA 1HNVB 2XC9A 1QSSA 1Z25A 4RW7A 2YNFA 4XO0A 1SH3A 3VQDA 1RDCA 3MTKA 5EWFA 4DTMA 3RMBA 1KHWA 1RAJA 1VRTA 1D8YA 3BGRB 3C6TB 1ZTWA 4DTOA 2IAJA 1HPZA 4H4OA 1C0TA 4DQQA 1LW2A 4CJFA 1QQCA 2QV6A 4WYLA 4ED2A 4Y1DA 1KLMA 1MU2B 4K8ZA 3V9XA 1SUQB 3RAXA 3CM6A 4IBNA 4RNNA 2XY8A 2BE2B 3AVJA 3NF9A 4ZTFA 3SI8A 3TAFA 4CEOA 3QEXA 1JL1A 4IR1A 1RNHA 1S1VA 1L3TA 1KSPA 1TKZB 1XR6A 3NDKA 4OVLA 5HROB 5F8GA 4O4RA 4KTWA 4KV8B 2KFNA 1JLGA 1LWFA 1RT3A 2QE5A 3LAMA 1S9EA 5HLFA 1IKXB 3UDLA 4CF1A 2G8WA 2DFFA 4E1MA 4IRCA 4IFYA 4FXDA 3H4BA 1LAVA 3QGIA 3GIMA 3O4NA 2HHSA 1JLAA 5FDLB 4J9OA 4QWEA 4KB1A 2F8SA 3QO9B 4IG0B 4YR0A 4Z0UA 2QKKA 5K14B
chains in the Genus database with same CATH superfamily
1YVUA 2R8KA 2GNKA 4K4SA 2FY8A 4BC2A 1FTRA 2HHQA 5CYMB 2MZTA 1OQ3A 1VQ5S 3MN7A 2V68A 1RDDA 4B9SA 1ASWA 3ENQA 2ZOMA 4JI6J 3J7AN 3R8EA 4DR4J 2Y1LB 2F4VJ 4UF4A 1ASUA 1HYSA 2DGOA 3G82A 4L76A 4L73A 1P9YA 3IBCB 1PJ6A 3VQ9A 5DM6L 5KGXA 2XEXA 4EMDA 1KOOA 4CEEA 2D0OA 4DFMA 1NOYA 3GJTB 1YJTA 3SDEB 4BRQA 3MCMA 3MEEA 3H59A 2P5OA 3CJ8A 4X65J 1P1TA 2IM0A 4ED6A 1RDRA 3KG0A 1K73T 4PWUA 3HPOA 1W0HA 2Y1JA 4JRPA 2HF3A 3N5FA 3SQOP 3E01B 1E6VA 2HNDB 3LANA 3O9TA 1EP4B 4Y6IA 1X8DA 2M4MA 4ZVOB 1F21A 1CJTA 2FF3B 1PAEX 2P9NA 1V9OA 3O9QA 4HT5A 1GT8A 2CPFA 1JNRB 1QZ6A 2IY5B 2HMIA 3QPIA 3RMCA 4EHUA 3CIZA 3V4MA 4OL8A 4WXWA 1GLJO 7FD1A 4OMFG 3QQCD 5A6WA 2R3VA 4DR7J 2A6MA 1WOQA 3DRRA 1GXUA 1DT9A 2HFUA 2XMAA 2YBVA 1H1VA 3AVIA 4CGGA 4CO5A 4RPFA 3V6JA 4CD1A 4PA1A 2RQ4A 5EHHA 1GTEA 4E1NA 1U45A 1SXLA 2MZQA 3D28A 1QAYA 1P8ZA 1VQ7N 2JVOA 2DRBA 2BZ2A 5J1EB 4I68A 3AJ2A 1AFJA 3BGRA 3C6TA 4FS1A 1M1HA 2DFEA 1LK7A 3A8EA 1CC7A 4U8YA 1VDHA 4E7JA 1E3MA 1S6UA 3HKWA 2H5JB 1MU2A 2ZWOA 3SUQA 5KT2A 2W2PP 3SPYA 4JBCA 2GJIA 4LR9A 5DO2A 2GMJA 3OYCA 5LMUF 4FJLA 3GYNA 4ENOA 2EX3A 2LLZA 2XMMA 1Q86O 3U4LA 2FXUA 2YCHA 1HQ2A 1IBKJ 5K20B 3D4JA 3PNIA 1NNEA 2DRAA 4LRFA 1FJCA 4YOUA 3M32B 1BIZA 4JI3J 3J80O 5F3TA 1RHMB 2VIHA 2A5XA 5K14A 4EBDA 1RCHA 1M1KT 1PYOB 4C48A 2NXNA 3LPTA 3JSBA 1YJRA 4CIEA 3UVJB 2O67A 2G8FA 4C23A 4ZVEA 1T11A 2IVFB 1MLAA 2H4WB 1IM6A 4DL4A 4M42A 3EE3A 2UXCK 4BGAA 3MR6A 3OFGA 1QQOA 1AROP 1SQEA 2KB2A 2WC9A 1VQ4N 4DV3K 2VJUA 4MK8A 4JD2B 3I55S 4LBHA 2YX6A 4FYWB 5HK4A 1H72C 2NSBA 1RKJA 3LA0A 4ZVUB 1VRQC 1ZZNA 3AA9A 1EKSA 1HI0P 5IS2A 3OS0A 2IMWP 5GVQA 3OHBA 3VTHA 3QJJA 1GLFO 1HR0K 3CCES 2O3DA 3U9ZA 1TL7B 1U6FA 3CQYA 1FVSA 4DTUA 2MPUA 3UFCX 1OVYA 3I8BA 2POKA 3R9LA 3HHNB 4QOTA 2NZTA 1KN6A 2VG5A 1GH8A 3ELHA 1X9SA 2DK2A 2HWHA 3T1HJ 2E1ZA 3P4IA 2UV8G 2LMIA 3B54A 3CC7N 4OLBA 1RTDA 1DKGD 4CLWA 1WHYA 4DFJA 1JX4A 3DN9A 3H5YA 2GVZB 1IH7A 3MEGB 2PI4A 3QEVA 1ZOTA 2RH3A 3MD3A 2ZHOA 3KK1B 2D5RA 4D3HA 4X4TA 3BKTA 4DHYA 3D2WA 5D4NA 2IM2A 1M5OC 2G8HA 1RT2B 2QLWA 4OPKA 2MY8A 2ZZNA 1HKBA 4Q2MA 3EYZA 1ELOA 3ULHA 3MURP 5AXNA 3VQQA 2Z58B 1T3VA 1KQGB 3TAMA 3T1YJ 4J8FA 3K0SA 1U0SA 3MI7X 4W98A 2ZHBA 1N54B 2YH0A 4NASA 4A8MP 3WHIA 2DPNA 1RT7A 2KXHA 2OHDA 1HW9A 4USHA 1RT6A 1FKOB 4X4NA 1S10A 2DNMA 4NLSA 1PBUA 2NZCA 1WSFA 4YOXA 4DU4A 3UW1A 4IH5A 3C16A 3ZNUA 4B3MF 2Q3SA 1FDDA 3I56N 4JKGA 3BREA 1N48A 3MM6B 3FBEA 2BMBA 1N56A 3QJLA 3F56A 1RHUB 4LSLB 2IVPA 2A18A 1Q7LB 2CG8A 2J0QD 4UZCA 1RGVA 3O5TB 4WFBQ 1YIJS 2Z1IA 5G0RB 3IAM9 1NSKL 1NPPA 1TUGB 3TYTA 2R8HA 3OSPA 1WSEA 5KG7A 4QIGA 4ED8A 4DU7A 4GKKJ 2EI5A 2ZITA 2L3MA 3TZZA 3HHLB 4YY3J 1C1BB 3V4IA 4A46A 3EO3A 1HBMA 3IAYA 1REVB 1FT8A 2E9TA 3M8QB 3VGMA 3ENVA 1RBOB 2M70A 2YNGA 2D69A 3NFAA 1Q78A 3K89A 2CPZA 3HPGA 4BRDA 4CYUB 5BR8F 2GHPA 2GO9A 3DDNA 1TAUA 2V5HG 3R2DJ 4EYHB 3NH0A 3QERA 2VUGA 2PSZA 2EKYA 4YS2A 3M30B 4PPDA 3IRWP 3N6MA 2QWMA 4FJIA 4P52A 1UPPA 4RW6A 1CXUA 1MMNA 3KLGB 2E7VA 3M8RA 2HFVA 1BQNB 4LF5K 4ZPWR 1YITS 4DU8A 4C97A 2JEIA 4C8LA 4OKJA 2AGOA 4LF4K 1WEYA 2GJ2A 2O66A 3ULEB 5L9XA 2LECA 4B17A 4CGFA 4KHYA 3O9SA 4PG8A 4BS2A 4ZCMA 2K06A 3LQVA 1WAFA 3AJDA 1FRKA 2J9DA 2HPUA 1RXOB 3IC1A 3MOJB 4ZLLA 2XMTA 4H4MB 5KFUA 1DGKN 4PWDA 1W2IA 3HOTA 4F2SA 3KNGA 2F9DA 5SWMA 4FM0A 3UIQA 1IKYA 1XI1A 4OI0A 2RHKA 4UOGA 2F9WA 4NRTA 4O0IA 3BP8A 3V1RA 3VF0B 1YAGA 1QE1B 1IBCB 1J5OB 2BGGA 5HQLA 1XMBA 2APOA 1MROA 2KVIA 1Q81O 2AX0A 5AQHA 3B6OA 5KI6A 3MOZA 5KG2A 3V9WA 3GQCA 4QU6A 4RKUC 4CI0B 4YN3B 3ILJA 3N4PA 2FHJA 4ZVHA 3MMBB 3D1OA 4FJMA 3D9BA 3RMAA 1JLCA 4B3SK 4KH6A 3BGLA 1LXNA 1B4SA 4F67A 2UVUA 2CZ9A 3HVAA 3LP1B 5AXKA 3TR8A 3MFIA 3R7NB 3DXMA 1ZPVA 2DD8S 1J2VA 1T03A 1NHKL 4DV1F 5EXWA 4HH1A 3ET6B 3MX2A 5E84A 1RU1A 1F6TA 1SC3B 1YJ7A 4ZS6A 1OKJA 3NS5A 2CWKA 4A8FA 1FA0A 4CIOA 5DDOC 3D6MB 3W2WB 3BEXA 3SCXA 2L41A 4DV4F 2W25A 3GCWP 1U1NA 4Q2LA 1WB9A 3AB2B 2B4UA 4B9TA 2UU9J 4IG3B 3ZZTA 1L3SA 4RBTA 3X3UA 1KVIA 3EM1A 1RKIA 4A8YA 4JKFA 3PDNA 4CI6A 3GSIA 5B0EA 3CETA 2P9CA 2UUCJ 4CIGA 2VB6A 3VQ8A 2DHAA 3WXMB 3DLKB 3R8YA 5HOOA 4E1JA 3L2WA 2QG9B 5DQIA 4GVMA 4OJ1A 3R5AA 3MMVA 2IVOA 5HN0A 2AU0A 4PHTX 3W5ZA 2CUYA 2D74B 3JXOA 5AQXA 4DV1K 4IFEA 4BVPA 1BGXT 2DNKA 1BL3A 3NCPA 3IDHA 5D4LA 1B70B 1M5PC 3LALA 4BRFA 1J27A 1JL2A 5GAHI 1IBMF 5H1SQ 2DCUB 4U7CA 1CS4A 3HF5A 1CJVA 3BDPA 4LUBA 3GP9A 3VESA 2IRYA 2WVBA 4RCHA 3SJHA 4JB8B 1H38A 5C42B 3QSYB 2UUBF 5HROA 4ISGA 1B64A 3BSCA 1VRUB 3CCZA 4LF6J 5KPRA 2Y0BB 3KLEA 3I0RA 3BSAA 4W92B 4QYRA 3VQTA 3RSEA 4CHPA 1YRTA 3U3YA 3DYAB 2LSNA 5DK5A 2JWLA 3NGYA 1Q7YO 1VSMA 2P2CB 1X4DA 2CQ0A 1KQFB 1HNIA 3SBTA 1HNWK 5I3UB 3IM8A 3CCRN 1J6ZA 3VALA 3AD7C 3CCWA 2AF6A 5DETA 3GV5B 2V4JB 3DI6A 3MECB 1UVLA 5F41A 3NH2A 1VQSA 2U1AA 3LAKA 2NRRA 4Q8FA 4QYZJ 1MG7A 1NMDA 1FXRA 1C0GA 3THWB 2DR9A 2CQ3A 5GADU 1M5KC 4RBVA 1BHLA 4ED0A 4O4GB 2OA8A 1WF1A 3FJ2A 3W1YC 1FRMA 1WTFA 1FX2A 1K9MO 2ZKUA 2CQ1A 2M7SA 2Q6BA 1NBEB 4EI2A 4EFHA 2AX1A 3H4DA 5CH7B 4M8LA 4C1NK 3MM7A 3OTBA 2VQFF 3D6HB 1ZM3A 1RTHA 2WTUA 3NGIA 3P5TL 4FYYB 1PYSB 4KAZA 5LMNF 2ZM6J 1YVNA 2R7OA 2EBEA 4E7LA 1VISA 2F7VA 4FJ8A 1RWNB 1N5QA 5HJYA 1CSJA 1RWXB 2KXNB 3RVCA 4YR2A 2D0BA 3S41A 4FWLA 4W5RA 2NQPA 4PEOA 3MPWA 2VQEJ 1IO2A 5ETSA 5J2PA 2D7SA 1NHVA 1S76D 2DVIA 4X62K 3L8BA 2I38A 3ASMA 2I5JB 1OY8A 2DXFA 4YB6A 4I56A 3D3CJ 2HS3A 2MLXA 3P45B 4K43A 1VQ8S 1YSJA 1EKEA 5KRSA 3QLHB 5BPLA 1JJHA 4TQSA 2GUPA 5B7WA 2M52A 1IKVA 3MM5B 3BN4A 2CH6A 4DV2K 2Y9HA 1SJ4P 1ITGA 1YI2N 5ETTA 4IR9A 1WC5A 4M3UA 3FFKB 1D9FA 2GCFA 2N3LA 3RYLA 4CTAB 2PBDA 2MKJA 3L2UA 2ALZA 4DUZF 4CZJA 3C2PA 5LJ3Y 1HW8A 2W8KA 2JWNA 3K5NA 3IRXB 4X66J 1S1VB 4FPAA 1OH8A 3GU0A 3VQAA 1YTUA 2QO3A 3VA0A 4RUHA 3FRZA 3I32A 4NCGB 4B3RF 2UXBF 3FFIB 1F9EB 3DOLB 3PACA 2QXLA 1ZETA 3WXJA 2CNNB 1I5OB 3MUTP 3F0NA 4K7QA 4U7UK 4DS5A 3AV9A 2XBPA 4KH1B 4FOEA 3H08A 4AHTA 3SLCA 3ZC4A 3AO5A 2QIFA 3R3TA 4JI2J 5DZ7A 1RT4B 3OFEA 3QESA 1U2VA 1RWVB 4BE0A 1I94K 4E3SA 3HFKA 4LRAA 3PIOL 2HHWA 3HP9A 1X4BA 3G82B 4OYWA 5HANA 3OVNA 3MK6A 1HWKA 8RUCA 1EQMA 2HSEB 2E5LK 4K4WA 4WK1A 3NH1A 1NZAA 4TNOA 4CFBA 4DUZK 3EGNA 3ZNJ1 2XO6A 3GYXB 3HMJG 5LM7E 4JI0K 1TMJA 2HAFA 2CZ4A 3V5RA 3M8PB 4BVOA 4E2FB 4HKQA 4WU3A 4R25A 4NOHA 2JRSA 3DGPA 5L38A 4C8OA 5KRTA 4HCCA 5AQOA 2WW4A 1HWJA 4E7IA 4CM0A 4WBFA 4DV0K 4QPTA 3BQ0A 3IN5A 1IBLF 1GOCA 4KHWA 4ICLA 4ZVSB 3MR2A 3CE8A 3OHAA 1Q9XA 4L6V3 1RA7A 4L3KA 1F2HA 4ZKAA 2G2YA 2PFFB 4DR2K 2QYCA 4CGDA 2VU5A 3I4PA 4B9QA 1UJ4A 1UEUA 3QJPA 5AQQA 2CQDA 1S72S 4WQ4A 2ZUAA 4E89A 4RNHA 1QHTA 3HT0A 1X4GA 4O5BA 1ZAVA 4Z4CA 1S0OA 3LDOA 4UY8O 3AODA 1FEHA 2DPIA 2ZJQQ 4CZIA 5F8JA 5AQZA 3HZ6A 4F4AA 4B3MJ 2ZGYA 3CCUN 3CYMA 1Y5NB 3MM9A 1PG5B 2JH3A 4YQWA 2RKIA 2QA4N 3RB4A 1T3OA 1BQMA 2WB4A 2CPXA 5F0WA 1T9WA 4USMA 5KFMA 1CZ9A 3F41A 1T44A 2XWXA 2AD9A 1HKGA 3CD7A 3G87A 3GB0A 1NDPA 2DH7A 4ZVPB 2Q1NA 1K1SA 1U4BA 2VG6B 1URNA 1U2RA 1Y3JA 2E9ZA 3PJXA 3OS1A 3NY0A 5IWAF 1URRA 4IOAL 3OYIA 4C7QA 1UW9A 1N32J 3KNAA 4K42A 3SUPA 4LFBK 3VAKA 1JKHB 2KH9A 1GFWB 2GX9A 4PZVA 3CULA 2RMLA 3D54A 4FM2A 4TXSA 3NS6A 4AE5A 3I31A 1NB7A 4BREA 4V1Ak 5ETPA 3HM8A 1OPZA 1VBXA 3M8WA 4AXIA 3CD6N 1PKUA 1KAXA 4BROA 4LC9B 4RL1A 1J5EJ 3JS6A 2OUGA 3DRPB 3EUNA 5IV3A 2RRNA 5CA5A 3IXQA 5D0RA 2DNHA 1U24A 4OYPA 4ISEA 2IYIA 4O3SA 2NZ4A 4MDBA 2XB2D 1NAQA 2HFZA 4RU9A 3HCXA 2R7WA 3KK2A 1U7LA 3O9UA 3E1YA 3TP2A 4ZLNA 4OX6A 3IR7B 3WIVA 3JTOA 2B4OA 1RYSA 1TELA 1XNQK 1DEJA 5HVFA 2HZCA 3Q24A 3CJCA 2FGOA 4K5RA 4K4UA 4JI5J 3GE9A 2V51B 4CJ4A 2V9WA 1R0CB 1PCAA 2LP4A 4Z94A 4FPRA 5IWAK 3OBYA 2DITA 3H40A 4X4PA 1LWCA 3JTPA 4CLPA 4X4QA 1KVCA 1Q86T 2UUAK 2PAVA 4CEZA 2A41A 3ZZPA 1KQSR 1BISA 3K5PA 2HG4A 3MFHA 4ZK7M 3BKUA 4DTXA 5J2MA 1KNZA 2CQ2A 1KVAA 3CJSA 5AE1A 5AZJB 1KD1O 2G0IA 1MWQA 1FK9B 3J7Z5 4AXJA 1RJJA 5JS1A 1EQ0A 2DY9A 3DXKA 1FKAF 3W2VA 2V52B 4QBUA 1Y5LB 4CBUA 2OPSA 2PEHA 1R8AA 4UQGA 4J9UE 5M1NA 4DL2A 3CPWM 2F5GA 3B8HA 3W60A 3KDNA 4OYIA 3BUZB 4B1XB 4MIWA 1MMLA 1WG1A 3MDQA 3FC9A 4G6VB 1NJWA 4CGJA 5K8PA 4RBUA 4CZCA 2B4JA 3WBZA 2ITMA 4M3WA 2AJ4A 4EAHD 2P9KA 3UDVA 1Y9OA 4EEYA 1WNSA 3OLAA 4Q5VA 2RD5C 4C8NA 3HJVA 4EBCA 1KFDA 4ZVGA 3M6VA 2GAGC 5IQQA 3IG1A 2B6AA 3ZZYA 2HNZB 2HBRB 3PX4A 2VHGA 4RZRA 5JMVA 4NA1A 4YP3A 4WFZA 2EFQA 2ASPA 4AHRA 1UP1A 3V6KA 3V81A 1WG5A 1HL6A 4NLUA 3QRPA 2O8CA 2O8DA 4CF2A 2F4FA 1NK4A 1HBUA 1VC6A 2DISA 4ATNA 4WFAL 5HP1B 3CJ0A 4HTUA 4WIIA 3FQLA 2MYFA 3GDQA 1LXJA 4FVMA 2R7YA 1R7IA 1N34F 5EU7A 2W2OP 4OI2A 4QWBA 2QXFA 3NMAA 2MLYA 2I2YA 4I0WA 1N36K 2WTFA 1ZC6A 3AB4B 2IFXA 4PQUB 1WELA 3MGJA 1NPRA 2DFHA 4H4KA 4O23A 3N9UC 3OL7A 2NYHA 1U1MA 3TZWA 1PC5A 2GIFA 4NXNJ 3HOSA 2IRUA 2ZNYA 3FKBA 2OFHX 3C94A 3HHLD 1UW4A 3ZSQA 3E3XA 4BHQA 1EX4A 5DQGA 4W5QA 3CDBA 2ZC3A 2FZCB 2CWXA 1TKXB 2RN2A 4R5PA 1H2VZ 2HB5A 4MDAA 3TPQA 1NU4A 4RTFD 2B56A 2GHWA 5IM0A 2B0GA 4JV1A 1HYZA 3W9HA 4ZLPA 2VH7A 1XMQF 1XC9A 2OYQA 4JK8A 4AL6A 4WQ5C 2C3UA 1WOSA 3A1YG 4DFPA 2CJXB 3US5A 4B3TK 1IVZA 4FJ9A 2MKSA 1IKWA 4DR5J 2A3JA 3PHTA 3J7A1 4LFAF 1W2BM 4RW7B 3A8IA 1OIAA 2ZJRQ 3MEKA 2UUBJ 1ITPA 3UB5A 4OZ2A 1FD2A 1SKRA 3N0VA 2YI1A 2W6KA 1M5HA 2LEAA 4CZEA 1UWAA 3AA2A 2WK4A 4KO0A 4P2XA 1C6VA 5C0YA 3AHPA 3SQGA 1YWXA 5IT0A 1YJNS 4DR3F 1R6VA 3VERA 2EG2A 2FLNA 2WSCC 1MWKA 5AQJA 2HGMA 3SPZA 3M8SA 3KHYA 4ZPTR 2Z0GA 2LA6A 4RWWA 2HBKA 2DNGA 1RT3B 1S1WA 1QTNB 1VQPS 4KH5A 2MKKA 3A5LC 4FYVB 2FZKB 3POTB 2FLLA 3G86A 3UR3C 1H2UX 1NMNA 3CCMS 1Q82O 4NLWA 3SAFA 3K8VA 5L8RC 4J9NA 3THYA 1Z2ZA 3CCQN 4UUXA 4FZXC 4LFAK 2HHHF 3MWBA 4CK2A 3R6LB 2CDRB 3MN9A 2UXDK 2PIIA 1FFSB 3W7BA 5AQTA 3A13A 4BWJA 2O4IA 1OS5A 4ECTA 4X4VA 3AY0A 4DL7A 1RTZA 4CZMA 2GWKA 3FGVA 2RAQA 2VD3A 3QZ7A 2VFUA 3H1VX 2BYCA 1RCXB 4O5FA 3TUJC 1QAIA 2KM8B 4PCQA 3FEXB 2W2MP 4JS4A 1IXKA 4DSLA 2FLPA 1KRPA 3AARA 2OSRA 4M3XA 4KGKA 2O1PA 3RRKA 2YHXA 2OZSA 4ZP9A 3BQ1A 2BJDA 1U04A 2LFVA 3RAQA 4J9VA 1NGEA 2C1EB 2RUSA 4OKEA 1VQPN 3FCHA 3W0LA 5AQPA 4C3LA 5CQGA 4IOBA 3QT5A 4OX9K 1FRXA 2RQKA 1WC1A 2V7ZA 2ZJQL 3IWLA 4ETXA 2C2MB 1K1QA 2DNPA 1BI4A 2MJUA 4ZDNA 1XHXA 4RU2A 3MCOA 4H5VA 2AEFA 4K8RA 5HRSA 5C25B 9RUBA 2QA2A 1I3AA 2HHHK 1NK0A 2HFNA 1NPKA 3RRHA 3P83D 2VKRA 1Q79A 5ADXH 5KG1A 3MN6A 3OXLA 4DJBA 1AUSL 2KT2A 4CK1A 4NLQA 2YVSA 1FJGF 3CSKA 4OKKA 1XMOJ 1NJXA 4DL0C 1VLOA 1UEVA 1X0FA 4BR0A 4UQTA 2HIQA 1QSSA 4B3RJ 2H3GX 4V19S 2MQLA 1RDCA 1MMDA 5H9FJ 3MTKA 3VF6A 3SBMA 5T41A 1VRTA 4DTOA 4JI1F 2CFXA 3ZX0A 1LW2A 2P9LB 3GR0A 4BLGA 1DQ8A 2YWWA 3W63A 1VS3A 1JXVA 2W1BA 1E6YB 3VGVA 4WYLA 4ED2A 2DR7A 1KLMA 1DHMA 1BO5O 1CS4B 3IWXA 1SUQB 2YY3A 4IBNA 2YPZA 3TW0A 3AVJA 2M0GB 3QEXA 1JL1A 4AL5A 3LGMA 3J81j 1L3TA 1TKZB 1Q95G 2KKHA 4OVLA 5HROB 3CMAS 1CZAN 4O4RA 5CXTA 4KV8B 1I51B 2KFNA 2XS5A 1FW6A 4Y2MA 2CPJA 4JK9A 3H4BA 3ZYYX 5EX5A 3I87A 5JJBA 3MMAA 2QKKA 2CZVC 3K9KA 2AJFE 3VQ6A 2BV3A 4XPEA 3CGIA 3LW5C 2BQUA 4JLHA 2VL1A 2Z1GA 3G6ES 3G25A 2A2CA 4AQYK 2DT9A 2PYJA 2ZD1B 3CCVN 2WSEC 1FRJA 3KHGA 4FF1A 3NNAA 1V6HA 4ZITA 3W64A 2V2QA 2PFDA 4K4XA 4XH4A 5FJ4A 3LF0A 2FVCA 2KRBA 1IJFB 2VFVA 2N3OA 4IO8A 3L3UA 4FLTA 5A8KA 2KG1A 3PRDA 2D3O1 2MZSA 1HJRA 2P6SA 4A59A 2VGMA 4CEDA 1XHZA 3C7NA 3N4WA 3ZXWA 2DH9A 3AXMA 3T5JA 4DV5F 2DGXA 5M2PA 1RTHB 5M2UA 4IO1A 5EDWA 5HL7Q 4M63C 2HK2A 1OVQA 1Q9YA 1K8AO 5A8RA 4CFCA 4K4ZA 2V4RA 2Q66A 2GTDA 2XSJA 2AA4A 2BJEA 4QCLA 1KOHA 1W25A 3C6HA 4LFCF 2UZAA 3AO3A 1DTTA 3DLEB 3QAEA 4C3MA 1VSKA 4DUYF 5J2PB 3UN2A 4HACA 2ASMA 3MEDB 1WF2A 1RT1B 5DDRC 4JNEA 4DTRA 2A1SA 2DKOB 1APSA 3QETA 4JRQA 3DWLA 1XQIA 4NA3A 3ZSRA 3WNGA 2XI3A 1NGJA 2EK1A 4NI2B 4B9VA 1FKPB 3O3GA 2E2OA 1JLFB 1V5IB 2O4GA 3TAGA 4P10A 2C2KB 2FC9A 4KKOA 1ATNA 3KLIA 3HSJA 3KUHA 2D3OR 1RDBA 4LRCA 3W5YA 1WBBA 1NJIT 4O3PA 3HDSA 3MM8A 1T6CA 2DGTA 1I39A 4NXMK 1QHAA 4DN0A 1K9MT 5KT6A 3A8YA 5AJ3K 5D3GB 4Z4HA 1U25A 2FJDB 5K8MA 1SC6A 2JC1A 1ZAXA 1F5CA 3CCJS 5T7LB 1QJHA 4R8UB 4ERDA 3WDOA 3M2VA 2A3ZA 4A5AA 1S1UB 4H5NA 4DUYK 1HBNA 3NF7A 2LEPA 4C8ZA 4JI7J 4FLYA 1HNXF 1IKXA 4D3GA 1RBRA 5CD4H 4OGCA 5A0YB 3L9ZA 3PX6A 3RW6A 5AQNA 4FWSA 5BYSA 2EVZA 4OJGA 4P9SA 4E7KA 4JV5F 5KFPA 5CYMA 3GBTA 4Q45A 3P5JA 3BH7B 1IJJA 4F7VA 2HOEA 1RT5B 2PZSA 2MQPA 2OPRB 3DKDA 3KWMA 2VA2A 4WU2A 3W8PA 3P38A 3HBTA 1HARA 5FPEA 3PKMA 2QTWA 2MKIA 3WNEA 3NXZA 3G8SA 1W7AA 1NK8A 4QS7A 2BRLA 5EVZA 1VFJA 4LF7F 4TU8A 2JEGA 3QYYA 4DB3A 1L5UA 1JK9B 3SDEA 2CVIA 2VG7B 1B99A 4KH0B 1O5JA 2J9DE 3DCAA 4ZPVR 3TWZA 5DDPC 4CEQA 3WUHA 5ELZA 4M3ZA 2I7PA 4ED3A 4DV3J 1FXDA 2LQ9A 3GG1A 3E01A 2CNLB 1XK8A 1RSCA 2M8DB 2HNDA 2YKNA 2XS2A 1EP4A 4KSEB 2XCPA 2GIQA 1Q16B 2DO4A 3P6YC 1S4EA 1T02A 4KHSA 3DM2A 2WUSA 1JB0C 2EEYA 1SQGA 4XH5A 3OYMA 3CJRA 1HQEB 2FIUA 4PYAA 1OSDA 5JVHQ 3NBPB 3PFOA 1VI7A 1HR0J 3JQKA 1TL5A 3PV8A 3KLVA 2HLTA 3KG1A 2OMLA 3HKZD 2QLFB 1SL0A 4H54A 2VF3A 1S9GB 4FNIA 2OD6A 4WXOA 4EHTA 1VQNN 3VQPA 3WXIA 4O55A 3Q8YA 3LM2A 3FSYA 4LF8F 4YFUA 4JV2A 3K5MA 1VBZA 3AOBA 4IOCQ 4EWTA 4YMEA 4Y0FA 3V1QA 4LF7K 2CXEA 2G1DA 4XK8C 1IR0A 3BBBA 2PO4A 5J1EA 5GAEP 4BRMA 3WX8A 5DGBA 4ED4A 1BQMB 4FF2A 4WP8A 1N33J 4TYBA 1HQUB 2WVFA 4B1VA 2KW4A 4YHHK 4CJ3A 3AAWB 1KXPA 1R8HA 5EGYA 2HBQB 4DZ6A 2HWTA 4LD0A 3A8KA 2KG0A 4LQ9A 1EWQA 1WKLA 2VBWA 3N6NA 2W9AA 4MKYA 2K7JA 2UVWA 4FWMA 4CCHA 5HMZA 1QVGR 3UE2A 4A8OA 4IJAA 2NRTA 3PG9A 3EJMA 4LH4A 3AVCA 3M32A 4DOZA 1X1PA 2ZQBA 4YDDB 2DCLA 1KCFA 4WP3A 4DG1B 4LF8K 4NRUA 3G2XA 3EKSA 2QMXA 2YPYA 3UVJA 2BEFA 4RUAA 1GLAG 4Q0BB 1UZHA 1LCUA 4FW1A 2IBOA 2VOOA 3ZT3A 2XMWA 3KKRA 2VPWB 4DQRA 3SQ1A 1Z4UA 5BRHA 3LWMA 5BREA 5ADZA 1SZ2A 1RYRA 2OPPB 5HQ8A 4JD2A 2WW8A 4OX7A 3DLHA 4B1YB 4LR8A 4FXVA 3LP0B 3RRGA 2WBNA 1R43A 4GV9A 3OS2A 2E1YA 2E4LA 3CJTA 4BBYA 4DCPB 4F4KA 1HHSA 4C2MA 1V3SA 4DV7F 2FGCA 4JI6F 3NEKA 1Y00A 4KT0C 3T3FA 4P72A 4DR3J 2F4VF 3T5HA 5DMRA 1RAIB 2WOMA 3FZKA 1HHQA 1LAWA 4B9UA 3M2RB 1TL7A 2HHUA 2E88A 3SYZA 3EZWA 1HRHA 5KFOA 1N4LA 3RB0A 4CJWA 2X1GA 5B0CA 4X65F 4P74A 5SUHA 2MY7A 2QC3A 4CJ5A 3SSQA 2OD4A 2DR5A 3GMGA 2DGQA 3CJQA 1B9FA 3K58A 2OTJN 4FM1A 2V9KA 2GVZA 4LF5J 3MEGA 5GAHP 3QBWA 1CXQA 1KDNA 5K8OA 4KHPK 5F0UA 4LIWA 4LF4J 2H5EA 4N56A 4ZCKA 3KK1A 3HTVA 2NXUA 1RT2A 3NHGA 2UVRA 4OO1J 2IVMA 4IO9L 1VJWA 3IG1B 4FKXA 4KI4A 2RF2B 1LQ9A 4OV6A 5B08A 4JI6K 4DR7F 1FDNA 4DR4K 2XYGB 1IQTA 4OLAA 3EE9A 3C6UA 4IYQA 4ZOSA 1QM9A 3MCNA 3AOAA 5KGWA 4H0PA 3PIPQ 3G0ZA 2A10A 2RQCA 3RWUA 2D0CA 1FKOA 4RNFA 1EO1A 2YH1A 2F8EX 2ZWHA 3RAMA 5DLFA 3U9DA 1BMQB 3WT0A 2W4CA 5IT4A 2Q6CA 2XYPB 3OY9A 4BRGA 1U02A 4CLYA 1KD1T 3MM6A 2KYXA 3SAGA 2HIYA 4AHUA 4X84A 1N5YB 2V0NA 1S0NA 1VQ6S 4EO6A 2P9SB 3JSRA 4EYIB 4LSLA 1BA1A 4BC3A 4DMZA 2WCXA 2BRKA 3QGPA 4HUFA 5KFNA 2YWGA 1T9VA 3OW2R 1JNZB 4CLTA 2A40A 5G0RA 3PTWA 4HDGA 3BO2A 4GKJK 2UV8A 2G8UA 1IBKF 1RHQB 4F2RA 2FJVA 1S7IA 2IDEA 2HWIA 2CQIA 2WONB 3HHLA 3HSTB 1C1BA 1OYEA 4UTGA 2FSNA 3JSYA 2J5AA 2ZJPQ 1REVA 3NNCA 4CIFA 3TZXA 5C12A 2K8GA 4JI3F 5AQWA 1WORA 3M8QA 4F0HA 2A6AA 5F9NA 2VASA 1A9NB 2CGLA 1MWYA 4P7TA 4JI1J 1ESVA 2HQGA 4CYUA 3C15A 1D9DA 4IFVB 2E1RA 2H48B 3ISND 3MPDA 5K9FA 4C1NI 1JLEB 2R7XA 2J9CA 4CHOA 4DL3A 3K9JA 3M30A 4EP4A 1WI6A 2ZH2A 4AF1A 4G1QB 3KLGA 3G71N 1BQNA 5FLXY 2E66A 4YDUC 3DDKA 3QIPB 2OAUA 4GVEA 3EPGA 5JUMA 1ZAWA 3ULEA 1OY6A 4FJNA 3OL8A 2U2FA 4GVLA 3LP3A 1NK6A 3L4IA 1IM4A 2QL7B 3FMBA 4ES2A 4HEA9 5M1FA 3LWLA 2ZFHA 2E5IA 5C10A 4BC9A 1JXBA 1IR1A 4H4MA 3TUPA 1T05B 1ZTTA 4ITSA 3GIKA 1HIYA 3C6AA 1N52B 3HVTB 1GX6A 1VIOA 5BPMA 4F36A 1S57A 4ZMMA 5AQUA 2J9EA 3RB6A 2EWHA 4UOFA 3O5BA 3EN9A 1K0VA 4O3OA 3K57A 3KJFB 3T1HF 2RQMA 1O13A 1ZBSA 3PEJA 3AVLA 3RJMB 2BE9B 4G1IA 4HHJA 1QE1A 4JYAK 1J5OA 1IQZA 2R2RA 3A8JA 4K0KJ 3SXLA 2W8LA 4NLBA 3UR0A 1FE0A 1WLJA 1NLVA 4MKVA 2JVRA 4OZJA 1FTCA 2R42A 5TKYA 3AJ1A 3VOVA 2XNQA 2F63A 2ZOGA 2E5JA 4AH9A 4KHQA 3TTFA 3ATUA 4DV5J 3CEDA 1P1LA 1OMSA 2YTCA 1RAEB 4F8RA 3VZIA 2FBXA 2ZZMA 1BLUA 3OA9A 1NZ8A 2CIMA 4TQRA 4GNIA 3MMBA 4LRDA 3OJUA 4BRHA 5M2RA 4M5IA 3T1YF 2FVQA 1R3NA 1XWLA 3JAMY 4J9LA 1S5JA 4NCBA 3LP1A 3SUNA 4ECWA 1S6QA 4WFYA 4CZFA 4X64K 1XERA 3T41A 2ZH4A 2NS1B 5A8WB 5JVHL 1TFYA 1UJ5A 6FD1A 1KC8O 4ILLA 3ET6A 1WACA 1X3MA 4DV6J 5E3AA 2ROGA 1HWIA 3T1HK 5ETKA 5IZHA 1YTYA 2R7TA 1HI1A 3FZLA 4IOCL 2E2QA 4JI8J 2OTLS 5DRKA 4DPTA 3KG4A 5BYQA 2BJ3A 1VC0A 2QN6B 4NL5A 3B4DA 4W5NA 2VC1A 4NZ6A 3T1AA 4K41A 3GFYA 5A2QY 1PAUB 1Q5VA 3C19A 4CJPA 2P9PA 4W5TA 2V8DA 3Q2SC 2HAIA 4GKKF 2RSQA 3H46O 5EY4A 1RDAA 3MMCB 4YY3F 3WEEB 2QWOA 5ETOA 1TYQB 2AKWB 3DLKA 3OQ2A 5KFEA 5C2GA 1BWVA 4ETZA 1D1UA 3MN5A 2XZWA 4USJC 1J53A 2IJNA 1UCNA 1R8CA 1YRUA 5AQSA 3V9ZA 4N41A 2F3JA 5J2NB 1TV6B 1RHKB 3MZIA 4X62J 5FLXO 3MXMA 4DSFA 1ZBHA 3ZX3A 4ECSA 5LJ5Y 2FUG9 3MPUB 2LEBA 1DRZA 1U1RA 3ZX2A 1NKEA 1Z26A 4DV2J 3UKRB 1FRLA 1C0UB 1N0UA 1TMMA 4M5DB 3K5LA 3N01A 4CVNE 4MKBA 1ZA1B 5C42A 3CCSS 1VRUA 2QL9B 2R7RA 3FZBA 3M6XA 1JLQB 4KGMA 4QOZB 2XGPA 3V9UA 4BR7A 1QQNA 5THWA 3ZSYA 1V4TA 3ICLA 3QEPA 3DYAA 4EFAC 4RNMA 4DFKA 1VQ9S 3GLJA 1FWKA 1U2FA 3ULDA 4JKAA 4PL8A 1OJ4A 4QR1A 5I3UA 2K2PA 5AXLA 4A61A 4IH6A 1K6YA 3QDKA 4O3QA 5KQDA 3T9ZA 2V4JA 3KK3B 3MECA 1R8BA 3CCLS 3TWHA 1NHUA 2KVQE 3KUEA 1M90O 3LH2S 4C6AA 4ZN3A 4E8UA 1S99A 2IJRA 2NYIA 3ZO7A 4F3OA 5JXSA 1IR2A 5DQHA 1OSCA 3THWA 4ANDA 3MCSA 3C7NB 4O4GA 4Y0WA 3QT8A 3VQEA 3VEZA 2BUPA 4Q43A 1RZMA 1I94J 2R9LA 4W90B 4NYPA 2ZBRA 1CPZA 4JS5A 4HL9A 2ZNZA 4N77A 2HQIA 4HUEA 2E5LJ 3JAMO 3OYGA 4IZ9A 3CMEN 2DNRA 3LPYA 2F1FA 4JI0J 4HI2A 2A1RA 1SV5B 3E2EA 3DLGB 4HACB 1GEHA 4WIQA 2A1BA 4RWXA 1HYVA 5CYQB 5L39A 4Y2KA 3WC0A 2PDAA 4CQ1A 4QS9A 3PJ9A 4DV0J 4G9ZA 2F40A 1ZM9A 4CM2A 4A8QA 3T7ZA 4CW7B 3KLHA 3S01A 2VWJA 2I5JA 3CDEA 3KLIB 1FRIA 4YB1P 3QLHA 3R7BB 4ECZA 4ZVRB 3MM5A 3QFUA 2UU9F 4JHDB 3FEYB 1Z1ZA 1IG8A 3MF5A 5ETQA 3VEOA 4ECQA 3GYGA 2UUCF 2BQ3A 5CZVA 4IQXA 4CJKA 3LDSA 1WDDA 1VSIA 2XLJA 3IRXA 1YJ9N 4KBOA 2BACA 4J9MA 4M3RA 1HA1A 1FD8A 4JEPA 1BHNA 4NLRA 4NCGA 4C9DA 4OGEA 1S0MA 1TKTB 1TP7A 3IAS9 3FFIA 2R7VA 2E29A 2OEMA 3DOLA 1EARA 1R27B 1U0HB 3EKUA 3EVMA 1B0TA 1X4FA 2E6LA 1YZ7A 1GXLA 3CJ1A 4RNOA 3EEQA 2ZJPL 1VSHA 4Y34A 4NLCA 1VOMA 2YNIA 2MTLA 4CO1A 1TFWA 3ENHA 3HULA 2ASJA 3QINA 3KJVB 1X31C 4P71A 1D8ZA 3NRBA 4OYMA 4DV7J 1RT4A 4KB7A 4HHHA 1ZH5A 2DXDA 3VVTA 2UU9K 2P5VA 1S9FA 4LFBJ 2VFRA 3C95A 3IGVA 3THPA 3OBIA 2MSSA 4LF6F 5A2QU 3FCVA 2DB1A 4NYOA 1SKUB 1VQ7S 1A5XA 2CH5A 2BJ7A 3SEOA 4MQ3A 4IXCA 3CQ8A 5DS7A 3HHEA 3OFHA 2C3YA 2DY1A 4P2MA 3MD1A 1XNRF 2VPZB 3LDNA 2ETJA 3I33A 4OJHA 2I6WA 3Q8RB 4RW4B 4P2FA 3M8PA 4NZ0A 1LOTB 2PD1A 3VF2A 3RBZA 1PILA 3CFOA 4UW2A 4ILGB 2YKNB 2BX6A 1VQMN 1Q4RA 3B4MA 2V2ZA 4WCEL 3ID8A 4JKDA 3BM7A 3DM2B 2VPXB 2JSXA 1XNQJ 4BRIA 3DRYA 4BCAA 4CHQA 5KFIA 1ZZFA 3FZ2A 2OKQA 2BKPA 2F65A 2AHOB 2CJQA 2M8HA 5KT3A 2DNOA 1G15A 4P73A 4WE1B 1FO1A 2UUAJ 3F2KA 1H7XA 4J7CA 3P3DA 5DGAA 5D0EA 3CO0P 2AGQA 1K73O 4ZVTB 2ZM6F 2HZVA 3S8SA 3AD9C 4DPXA 1BA0A 4EO8A 2HK3A 3T6BA 3C65A 3RBEA 2CJKA 1NOZA 4DMNA 1VQ4S 3LPEA 5C7PA 2VQEF 1QLNA 1NK5A 3E9PA 4M45A 3CFPA 5KFKA 4OQJA 1YJUA 4QU7A 5E0OA 4Y3CA 3M9NB 1Q8BA 2JLEA 3D45A 3H5UA 2P8IA 5LOQA 1BY9A 4NWBA 3VZHA 3H0PA 1RADB 1G6BA 5KFTA 4UZBA 3QBCA 5KG0A 1BUPA 1RDWX 2VG6A 3WQUA 4QJVA 2ZE2B 1TGOA 3O3FA 3A5OC 3O8WA 1NGHA 2EPIA 2LVWA 2D41A 1RBVA 2HHXA 4L3QA 3TNVA 5BN8A 4EZ9A 3UKUB 1JKHA 2RE1A 3TSPA 2HRUA 4USTA 3ZTOA 4BC7A 1TK0A 4K4YA 3TX0A 2KQ2A 2F9TA 4IOXA 4X66F 3FZMA 3LOUA 2W2QP 3CC7S 1WG4A 2ZM6K 3P96A 2QEXN 3BJYA 3L3VA 3DRPA 4BE1A 2HS0A 4ECRA 3OYDA 3BBFA 3PKYA 5B8HA 5C24A 2B9YA 4M5KA 3WC2A 3QMQA 3TARA 2PE8A 3M3ZA 1U26A 1XR7A 3I6PA 2KRRA 3A5MC 2YKQA 3P5BP 3VEXA 1WKJA 4DDFA 1G1XA 3AQOA 4ZPAA 1N6QB 4R0EA 2DNNA 5LMUK 2AMCB 1NGAA 4JI2F 4TLRA 1ZM2A 2HNYB 1WOOA 4QW9A 4S0MA 3ZTQA 2WOMB 4ALZA 4J5OA 3FMWA 2DYAA 4FJJA 2IC3B 1X5OA 2M3DA 2NXEA 1WI8A 1D4XA 2KL8A 3M1FA 1TL3B 2GA7A 4CK3A 1I1GA 2XS7A 3Q8QB 1TL4A 2EC2A 1HLWA 5AZJA 3C46A 2VDHA 4BWMA 3I56S 1FK9A 3FSIA 2FJXA 1RBLA 2D9PA 1X5PA 1OH7A 4H4OB 1UJ6A 1C0TB 1LK5A 4ECYA 2EK6A 2G0CA 5HI7A 4O0NA 5D0HA 4PG5A 1YBUA 4B3TJ 4WWSA 4J91A 2ZKTA 1MNEA 5CE3A 1LWXA 2G4BA 4OHZA 3FQKA 4C11B 4FO0A 3NAIA 3QSIA 4IDKA 5HATA 1CJKB 4X2BA 4BY9C 1LFPA 3OVBA 4IKAA 1JLGB 2PI5A 4WFNQ 1YHQN 4CF9A 5HLFB 5KPTA 5DM7Q 4BACA 2R2SA 1NM2A 4M3TA 3L09A 3AVKA 3C6UB 4J90A 1JLAB 1UVMA 2AQ4A 2HNZA 1RUSA 4MIBA 5MLCV 3AAQA 2FC8A 2ROPA 4JK7A 1SQKA 4LJMA 2QWQA 4AILC 1V5VA 3LO3A 3OTCA 1J54A 3L95X 1XJWB 4AM7A 5HP1A 3B8AX 3EY1A 3D67A 5I3QA 3GJRB 4HTIA 3IBWA 2LU1A 4CZGA 1VBKA 1FNMA 2DPJA 1BIUA 1VGYA 2IDOA 4LSNB 4QW8A 2VYPA 5RUBA 3TSQA 4PQUA 3ZETA 2WHOA 3DLJA 4GO7X 3HFVA 4CESA 4DX5A 2YWKA 2QW9A 3WQTA 5BJRA 3QATA 3T19A 1N32F 2A0FB 3MX5A 4RW9B 2XRIA 1NDLA 1S48A 1BOTO 4F9OA 2EFGA 2BW2A 5M1OA 2AWZA 4WYBA 4CLFA 4H5RA 1TKXA 4DLEA 2HS4A 3G9CA 1N88A 1J5EF 3UQSA 3GV7B 5CYJA 3C15B 1F3VA 2J7WA 5CAAA 2PA8D 2OIHA 2GUIA 3SSSA 3JSMB 2HFOA 3OR1B 2AEMA 3O8MA 4B3MK 4UOHA 2AJ0A 3N5BA 3TUIC 1KFSA 3NAHA 4OX9J 1T3NA 3PW0A 3HM9A 1WKKA 3Q8SB 4DEZA 1HNVB 3IWNC 4RW7A 1SC4B 4XO0A 1SH3A 1DURA 4JI5F 4FWOA 3O1LA 1ZTWA 2HBJA 1HPZA 3EE8A 2ASYA 2V7YA 3THXB 4CJFA 1C4CA 1S6OA 4J37A 2HVDA 3J7YI 1QQCA 2QV6A 4NMXA 2ZH3A 1JWWA 4Y1DA 1BWEA 4K8ZA 4GVBB 3RAXA 2GFFA 1PYTA 4RNNA 1VQLN 2XZDB 3R2CJ 2BE2B 4CEOA 3U1NA 5GAEI 4I6MB 2V63A 3L4QA 3O6WA 1KSPA 2F8MA 2E5HA 5BR8K 3EXYA 1RT3A 2QE5A 2R7QA 4CWBA 3J81U 1RBAA 4CF1A 2G8WA 4IQMA 3RW7A 4E1MA 3POTA 2J7KA 1Q8KA 3SCJE 1LAVA 3C14B 3QGIA 1EX8A 2XTJP 5FDLB 2QA1A 2X7IA 1RWOB 3QO9B 4IG0B 4IDHA 3CC2N 4Y2AA 1K0TA 1EIYB 3B6PA 4FJGA 2BANB 1RWMB 4OZLA 1UA1A 3PO5A 3KMQA 2X6SA 4KHMA 4BRCA 3MR3A 4JI5K 2YWEA 3P39A 4K59A 4B1WB 1VK0A 2XMUA 4OZ5A 3BO3A 4F25A 5JLHA 3NLCA 1ZBUA 3H3OB 3DMJB 5GAEU 3VQCA 3JYTB 4G3IA 3NWGA 4DQPA 1F0XA 3KMSA 2ATCB 2DNYA 4KPYA 1S6QB 2LQ5A 5IQ6A 3CI5A 3RUBL 2HBMA 5HMYA 1MWMA 4AQYJ 3DAWA 4MYTA 3HSDA 1KLNA 5FPDA 3VAHA 3A0IX 4R79A 3QAUA 1S49A 1MWZA 2Z4PA 3WNFA 4TLQA 1FFGB 3PLAA 7FDRA 2MQMA 1EETB 3MUMP 5KFWA 5L9NA 5DM6Q 1TUVA 3CERA 1NSAA 4OI1A 5BXIA 1DAXA 1Q1KA 4USIA 3RGIA 4CE9A 3THVA 4PYDA 1UVJA 2ZH5A 4NO7A 4CBWA 3IO1A 2KLAA 1SJRA 1HLUA 5C25A 5AFUA 1FDAA 2K3KA 2P9PB 2QK9A 4LRBA 2FPHX 4NXNF 4H0TB 1RLCL 4ISFA 2XLKA 1RWKB 3I96A 4OZ3A 3OL6A 3CJAA 4O44B 2JX2A 3CCRS 1H3DA 4PXCA 1JJCB 1REGX 3Q23A 3EGWB 3K7RA 4AHSA 2W9BB 1FWLA 4ZIWA 4F0KA 4HHUA 4QWCA 2RU3A 5E3CA 5C2FA 4LREA 4LF9J 4CLSA 3EXCX 5G4DA 4OI3A 2XULA 4ZVQB 2P9LA 1XTZA 3D2FB 4BG9A 4U95A 1E6YA 2UVVA 1RK8A 4XTTA 1SUQA 1RAFB 2M5YA 2OI2A 4MKAA 2DTJA 4ES3A 4DV4K 4DR5F 4MIAA 2PFUA 5AT1B 4F4ZA 4ER8A 1VQON 4IUFA 1SJ1A 4GV6A 1A0OB 2ZVIA 4FK0A 4R0JA 1TKZA 1VSLA 1IWGA 5KFAA 4KV8A 1WHWA 2X3DA 1RWWB 2C3PA 4FVUA 1WSVA 2XSFA 3DHXA 1SL2A 3BYPA 3MXIA 2DBBA 2FHJD 4ZJLA 5AJ3J 1D5AA 4I6YA 5HRNA 3OYJA 4FZVA 1XNRJ 2UYTA 3AVBA 1ULRA 2O8EB 5LL6d 2JL9A 1JMTA 1F2GA 2IJFA 4CGIA 3H42A 3R9PA 4L75A 4H5TA 1SH2A 1BU6O 4ZVFA 1S4FA 3KKSA 3OVAA 3UCUP 2L9DA 3OL9A 3BY5A 1LW0B 1SPBP 3DLRA 5GAHU 1UTAA 2YNHB 4U8VA 4PY5A 1SIWB 3SQ4A 3LDQA 2B9XA 2ABYA 5AQMA 3TAQA 1R0AA 4K5SA 2ZD1A 1BUXA 2QA4G 1B0VA 1SJQA 1RHJB 2X78A 1ZBIA 4MMOA 1IBMK 3HZEA 4XPCA 4TU9A 3PZPA 1FHTA 2HKEA 3OYBA 2WZ1A 1CC8A 1YI2S 2H4YB 1BG3A 3O80A 1RE1B 4A62A 1SH0A 4M1KA 2KFYA 4B8AB 2H51B 2LDYA 4ILHA 2LYVA 1SBRA 3KD5E 4OLPA 2UUWA 2A42A 4XIUA 1R59O 3LZJA 3E9LA 2FBVA 2UUBK 1OYDA 4ZPDA 4P6QA 2E8AA 2AGPA 1VSFA 2IVYA 1B92A 1GLDG 5MAOA 1TL1B 1RCOB 3TVYA 1YJWN 2BVZA 2LCWA 3C66A 2YKAA 1QVGM 4URGA 2Q1LA 2K1RB 3DLEA 4A48A 4ANCA 4DR6J 4HDHA 3NP5A 4DQIA 3L3CA 4Z7CA 2GWJA 4PUOB 3UPFA 3H98A 4WFNL 3MEDA 4M94A 1RT1A 3HHKA 5DM7L 3AGRA 3KLHB 5T7BA 3FEZA 3SZ2A 3ZZ0A 2FHKA 2IA6A 1WHVA 1T0TV 4NI2A 1GNKA 4DHVA 3CJ7A 1FKPA 1PO6A 3HPHA 3CCTA 4RG8A 2ZOFA 3FVYA 4CP5A 1JLFA 3O44A 1N5TA 3ENWA 2I0XA 1GOAA 3D66A 1M90T 1XUPO 1CJUA 1PGZA 4ID5B 3UI3A 4B9NA 1GMWD 4CZKA 2CKWA 3MAQA 2VCPA 4JI4J 5FPNA 4TN2A 3B6BA 4K25A 2FSKA 2VQFK 3QT6A 1NJZA 4I7FB 5HRPA 4FJKA 3MXHP 1XMOF 3U1MA 5D3GA 2CNKB 4HTJA 4KHRA 2YWHA 5EWGA 5LMNK 2PN6A 5T7LA 1NJYA 3MUVP 4R8UA 4WFBL 1S77D 1S1UA 1FESA 3KLFB 2VONA 2HHVA 4CECA 4IH7A 3IS9B 1YVFA 2B8QA 2O8BB 3KUGA 4B08A 2XNRA 5A0YA 4YHHJ 1HI8A 2YNIB 2Y1RI 1C1CB 3OTOJ 2D0AA 4A8XA 1UVNA 5KT5A 2DNLA 3MCPA 2RNEA 3NGKA 4ED7A 1L3UA 4OLOA 1EZZB 3FE1A 1KQKA 3HSCA 1RT5A 2RVJA 1NB2A 2W9CB 4GRSA 4CJ7A 1GTHA 2BQRA 2OPRA 4YNQA 4K50A 4O3NA 1JCEA 2B5JB 3CXCM 4ECVA 1VHFA 1VQKN 1LFWA 4FN5A 2HHPA 5JMNA 3LZIA 1N8RO 2HVZA 2YKOA 3O3HA 2YJEA 4KTZA 2V8VA 1B3TA 4H8KA 4WQ4C 2GO8A 2ZC4A 3NGSA 3CCUS 2CQBA 3I0SB 1QZ5A 2VG7A 2QA4S 1ZPWX 4FYXB 1HMVA 5HO4A 1YTAA 4B3RK 3CDAA 5EX3A 2VFSA 2UXBK 4FPIA 2AP6A 4ZP8A 5HJXA 3A12A 2FSJA 4M7XA 3H45C 3KKFA 3RU0A 4I6AA 1F5AA 4CHYA 2MKCA 1CULB 1FX4A 2DGVA 3FBBA 1HHTP 2Q0UA 3GL1A 5BR9A 3KTQA 4GY2B 4QIFA 5I42B 3MR7A 4QQBA 3GONA 5HMXA 4CO3A 3HI0A 2Z8QA 1HQEA 4OHVA 4H0OA 4USKA 1HBOB 3NBPA 3NCIA 4EZ6A 3BYRA 2OO4A 4BRLA 1NDKA 3NNHA 3X1LB 3CD6S 2KHCA 1S9GA 3OW2M 5IT9U 2ADBA 1XN9A 3GILA 4N76A 4MO4A 5AQRA 1X9JA 4DTPA 1WOPA 2MHEA 2DGUA 3GR1A 2CRLA 1S6PB 4XAKA 4NYZA 3CQXA 2DGSA 1FJEB 4C8YA 2FC0A 1VK3A 3J80Y 1VSDA 2HGNA 3TQEA 2JJ4D 1WEZA 1HQUA 4GC7A 2JNJA 3H2VE 1F5BA 1IBLK 2ZH6A 3FGUA 2ZGZA 4KHPJ 3NKYA 2KHDA 3VWSA 3SCIE 3SUOA 3RMDA 2P9UA 5FPMA 1VR6A 3PW4A 4FYDA 3OYNA 4ELTA 3ZT0A 5B0FA 3VAGA 4FKYA 3OR2B 1MW7A 2O8FB 2KZZA 1SKSA 3PO4A 2LDIA 1YX2A 1CG2A 2IA0A 2YHBA 2V2KA 2PEBA 4FW2A 3LUYA 2IS3A 1E4GT 2JC0A 1W7WA 4DG1A 3FZFA 1RBSA 2GGPB 4LQ3A 3CC4N 4M41A 4Q0BA 2HMPA 1O8BA 3ZTPA 4JI7F 3R5BA 5C24B 1NRKA 3NAEA 4ZJOA 1U09A 4DQ8A 2QMUB 3IA0A 1WUUA 2OPPA 5L46A 2KTQA 1Q5YA 4C0BA 4BC4A 1S12A 3SBGA 3LP0A 2DR6A 3CB4A 1T94A 4DZDA 1KKHA 2CPEA 2QX0A 5CHCB 1B7YB 1FJ7A 1P9QC 4Q44A 4Z4GA 4U7BA 4J2DA 4J9RA 1BCMA 3AA5X 4B3OB 4GKJJ 4H0VB 4CJLA 1VQ5N 2W41A 1S97A 2OPQB 4BC5A 3GV8B 2HHTA 2R2TA 1KAYA 3PR4A 1ROFA 2J76E 4NPOA 3M2RA 1YBAA 4MH8A 2XWYA 2DNZA 1RACB 4CZLA 3VA3A 1Y5IB 1Z2LA 4KREA 4G1PA 4LIRA 2ITGA 3ZTRA 2DHXA 1P90A 2UXCF 2LQJA 1UL3A 2NXJA 4I9QA 3FZHA 3CMQA 3BGOP 4WJBA 2JOQA 3D0IE 4DU3A 3ZZOA 3K2PA 4KY3A 2XHCA 4JI7K 4DV3F 2CJYB 4BR4A 2ZH9A 1GK8A 4CO2A 3V9SA 3TTDA 3OYHA 3GIIA 4IDKB 1WJ9A 3QNOA 3DJCA 4CJVA 2KDOA 3DOKB 2CNOB 5KFSA 5KFFA 5LSLA 3ENBA 1HR0F 2IM1A 3UCGA 2RF2A 1QAXA 3JB9k 3VMFB 1YRXA 2CYYA 4DCOB 1OH5A 2XY5A 2X1BA 3SNNA 3UO0A 4H4KC 5FD1A 2BKOA 3VTIA 1H7WA 3ISZA 2MZ1A 3Q8VA 3PVXA 2DIUA 1UZDA 3FDSA 4KC5A 3BZKA 3UE5A 4NYFA 4TY8A 1KS2A 1LKZA 4WZMA 2C2NA 4E0DA 4JYAJ 1XC3A 1N33F 1FF2A 2J0XA 2K7KA 1U48A 2PY5A 1PIEA 1U8SA 5AQGA 3B78A 4B02A 2DO0A 1UEKA 2H3EB 3ZETB 2VOPA 1GX5A 2DY4A 3OV7A 3CUNA 1P8GA 4WK3A 1N5YA 2P9SA 3UN5A 2ILZA 4Y2CA 1WEXA 2L9WA 3F44A 1NSPA 3IMXA 2W01A 3S3MA 2WRMA 4G65A 1D3WA 2YWFA 3QFHA 5D6GA 3IBFB 4M5GA 3TTCA 3QGHA 2C3MA 4QR0A 1GMUA 2JLFA 5C2CA 2ERRA 2BJ8A 1WSGA 3NGRA 4M5LA 1EQYA 4GW6A 4FWNA 3CPEA 3NS7B 3D68A 2WONA 5KFJA 3W9JA 4ZP6A 1Y11A 2QMWA 1ZM4A 1RTIA 2HRYA 4NLXA 4X64J 2Q31A 5GINA 4KFBB 5AR0A 2DJWA 2IRXA 1RWUA 4IFVA 3J80U 3FSXA 4FLWA 3OYEA 3CDWA 4CDIA 1JLEA 3PR5B 3AVMA 4PAAA 1N34K 3MAAB 3CCQS 1N33K 3HD2A 4G1QA 2BTFA 1NU0A 2C2OB 2JEFA 2FY1A 1GAOA 2RHQB 3ZSZA 3I55N 3QIPA 2ASDA 1WC3A 4FK4A 4CH1A 3CDUA 3FCWA 1HPZB 2GBZA 3LGHA 4FOIA 4KGVB 3VQ7A 3SK3A 5CZ2A 4PL7A 2XY7A 3SV3A 5LJVA 5IXUA 5KOXA 4IJNA 1HNZJ 4XDDA 4DPWA 5GMDA 3FUYA 5EUHA 1JJ4A 2N7YA 2Y8YA 2B8PA 2OZMA 3QIOA 3PRVA 4FZYA 3CCEN 2OFGX 3CJKB 1V4SA 1JLBA 1T05A 3M1VB 3D6FB 1PJ5A 4JUZA 3T5KA 3HSGA 3HVTA 3Q22A 1Y64A 1YF5L 2XHWA 5GAGP 4IRDA 3HO1A 1S5ZA 3AVGA 1XMQK 2UP1A 3AD8C 3K5OA 2KJWA 2WBMA 1Y4ZB 3TJAA 3GTYX 4LF5F 4O8KA 3CT9A 1X7VA 4NLOA 2B9WA 4LF4F 2GQCA 1CEZA 5GMKa 4FWRA 1NGDA 2FJEB 3QFPA 4B9MA 5LJWA 4FJHA 3FLCO 4FJXA 1AZSB 4YOTA 1C0MA 1NWKA 2OEKA 1NGIA 3T9NA 3ILLA 1TU0B 1JXLA 3ZEUB 3AA8A 2ACYA 3WXKA 3K59A 3P1GA 3VEWA 4OZ1A 1RTJB 1DJ0A 3IFRA 4U9RA 4KRFA 1QY7A 4DR3K 1PJ7A 4A2BA 3ATVA 2LXUA 4I69A 3ZSOA 2MJNA 2HRTA 5C2DA 1NH8A 4MFBB 3OUYB 1YUWA 1AW0A 4FCYA 1HJOA 5CZXA 3NVMA 1A5VA 2VFTA 4RO0A 2RJZA 5A8WA 4CHZA 3BEGB 2Q36A 1WDTA 3PIOQ 3C3LA 3AO2A 4LR7A 3E66A 9ATCB 1YJVA 1EB0A 2HF4A 2D4WA 3HJFA 4IRKA 5ETLA 3GPAA 3QEIA 5ETMA 2Y1IA 3DU5A 4ELVA 3U8XA 5CY4A 4ZPCA 3NOCA 4ILMA 1O51A 4TU7A 2PA3A 2QRRA 1VIXA 3PHEA 1Q81T 5F8HA 1BQXA<