1DTTA

Crystal structure of hiv-1 reverse transcriptase in complex with pett-2 (pett130a94)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
543
structure length
540
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transferase
molecule keywords HIV-1 RT A-CHAIN
publication title Phenylethylthiazolylthiourea (PETT) non-nucleoside inhibitors of HIV-1 and HIV-2 reverse transcriptases. Structural and biochemical analyses.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 126
structure length 540
sequence length 543
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1dttA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1dttA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1dttA05
4WE1A 1RAJA 5DQIA 3PX6A 4FW2A 3AVNA 2OZMA 3ZSXA 4FM1A 3T5HA 2ZKUA 4ZP6A 5KT6A 4K4XA 4DLEA 4CEAA 4K4YA 4WYLA 5J2QA 5KFZA 3CVKA 4H4OA 4KKOA 4HHTA 4ZMMA 2IC3B 2HNZA 3HPGA 2OPRB 3OS2A 4E7KA 2RF2B 2HW3A 3FFIB 5FROA 1HQUA 4FJMA 4RNMA 1NNDA 3V9UA 3ZCMA 4HCCA 4DU3A 1JLFA 3MEDB 1RBUA 2R2SA 3RMAA 1TK5A 3BSAA 3MECA 3AVHA 3DM2A 2IDOA 3KK2B 3LP2B 3QLHA 4LH4A 1UWBB 3V6JA 4DG1B 1NK7A 2HHSA 4IH5A 3T3FA 1QE1A 4HKQA 5HLFB 4HUEA 4NLXA 3LP0B 3TANA 4C8MA 2HMIA 2FJWA 2DPJA 3MXJA 2WONB 5C24A 3O4QA 4IFVA 2V4RA 1VK0A 1REVA 2F8EX 5J2PB 5KFMA 2OPPA 5KFKA 3NCIA 2VG6A 4M3WA 3CQ8A 2FBYA 1TKTB 4CHPA 1IKYB 2V9WA 5FDLA 4CFDA 2OPQA 4B9MA 4RW8A 4ICLA 3VQSA 2YKNA 3VQ8A 4F4XA 2JGUA 3RMCA 2I5JA 4KREA 5EWEA 5DGBA 2F96A 3TABA 2AGOA 3F9KA 1NK4A 3M8QA 5T14A 1WSJA 3FSIA 1JXEA 3KK1B 1JLAA 3CG7A 1JX4A 3KLIA 1R0AB 3G0ZA 4JRQA 3RBEA 1ZTTA 1LW2B 5K14A 1TVRB 2J6UA 1L3TA 3HHKA 4OLBA 5KFRA 4QWEA 4ZPDA 1Z25A 1VRTB 1FK9B 4O3RA 3EZUA 2UVRA 2G8KA 5FRMA 4Z0UA 4CJPA 3MEEB 3KNAA 2HNDB 3V9SA 3OYAA 3O3HA 4OGEA 3RRGA 1SKSA 2D0AA 5I42B 1W9HA 1ASVA 3CFOA 2VWKA 4E19A 3TAFA 4FJKA 3KIOA 4EP5A 3OYIA 4CFCA 4B9NA 2RN2A 2G8IA 4FLTA 2X78A 5KG7A 3SFGA 3OYDA 3K5NA 5HP1B 3I5AA 3QYYA 4YFUA 1TK0A 2G8WA 1S1WA 3UQSA 4CJKA 1VSIA 4Y1DA 4WFZA 1JLQB 4J9OA 4O44B 1VSMA 3AA4A 3I0RB 1C1AA 3KK3B 3T19A 1SKWA 5SZTA 4MFBA 3LP3A 4FW1A 4FLUA 4ECWA 4JS5A 2AU0A 4NCAA 4ZP8A 2AGQA 4C8NA 4PWDB 3MR6A 3D0PA 1SL2A 3K5LA 2ILYA 1WN7A 3PW5A 1XR7A 2X6NA 3CWJA 3HYFA 4IG3A 1TAQA 1HNVA 3PJXA 1N48A 1OS5A 3EZ5A 4KO0A 3LAKA 4H4MB 2KZMA 4FLWA 4RW6B 4F2SA 3DRRB 4CCHA 2YNIB 4G1QB 4DSKA 3OYKA 4E1MA 1ZTWA 3VQAA 1FKOA 2YNFA 4RUCA 2ZE2A 2HWHA 3B6OA 4KFBB 4Q8FA 1C0TB 3SYZA 5SWMA 3DLKB 3L8BA 4DTUA 1F21A 1KVCA 4CHZA 4Q44A 4JV2A 4EYHB 2HB5A 1HMVB 4Y34A 2XCAA 4F4YA 3DOLA 4ELVA 3OYMA 3QINA 5KG3A 1RT7A 3NMAA 3DDKA 1Z4UA 1U4BA 5DG8A 5F9LA 2ATQA 3K5OA 4FLXA 4W5OA 4F2RA 2UUTA 3DRPB 1JLGB 5C25A 4RW9A 4JS4A 1X9SA 3CDEA 3HSTB 1SKRA 4Y2CA 2PY5A 3ZT3A 4KE5A 3QGIA 3BSNA 4B9UA 2DFFA 3IRXB 3DYAB 1XR6A 4IH7A 4CJUA 2XY5A 4EZ9A 4M42A 3AV9A 3HKWA 4O3QA 4M3TA 1JLEA 2WOMB 1ZBIA 4YP3A 4WXWA 4NCBA 4QWDA 4N41A 5KFTA 3V1OA 4HUFA 3I0SA 1BIUA 4AH9A 1FKPB 1C0UB 5F8MA 4FS1A 1KVAA 3ITHB 2XHBA 2IC3A 3AVKA 1RT6B 4R8UA 3RB4A 2OPRA 4CEDA 4IR9A 4NRUA 1RTIB 3OL6A 2IJFA 3MEDA 3Q8RB 5D3GB 4CEZA 1D0EA 4AHSA 1GOBA 3TQ1A 3LP2A 2R2UA 1UWBA 4IR1A 1U47A 1NJZA 1CZBA 2BR0A 4RU9A 4DFPA 5JS1A 4DU4A 5HLFA 3SPYA 1XWLA 4KBIA 4KKOB 3NH2A 4DF4A 3K5MA 3H2LA 1HQUB 2J6SA 1XC9A 3WNFA 5KFEA 5JXSA 2XGPA 1JLFB 1BCOA 4CJFA 3MECB 3KLFB 4IQXA 3LPUA 3DM2B 5KG5A 3T5LA 4M45A 4BDPA 1TKTA 2B6AB 2IM1A 5KGXA 3OYGA 2P5GA 1IKYA 4NLSA 3SUOA 4TQRA 4FLZA 1QE1B 3BJYA 3EY1A 4ZP9A 1UOCA 2HMIB 4KAZA 1SH3A 3DLEA 1W0HA 2FLNA 4DQIA 1C1CB 5C24B 3NH1A 4NCGB 5KG4A 4XO0A 3ZSQA 5J2MB 1L5UA 1TKZB 1GX6A 4DL5A 1REVB 2Z1IA 1RT2B 1R0AA 1IKWB 3DOKA 1LW2A 2OPPB 3CM6A 1TVRA 2EHGA 3GV5B 1TP7A 1K1QA 2IMWP 3DRSA 2XWYA 5CZ2A 4F4WA 4CJRA 3QEIA 3DLGB 5FDLB 4IRCA 1QAIA 5F8GA 4RW8B 2PZSA 4ICLB 3MEEA 1MU2A 1IM4A 1IO2A 5KFSA 4R0EA 4ECZA 2BGGA 3AO4A 4CGJA 3D28A 2I5JB 3M8SA 5KFIA 1T03A 4KHYA 3M8QB 2FLLA 2A1SA 1JLAB 4DU1A 4TXSA 4K50A 3KLIB 5KFFA 1QSYA 5K14B 4JLHA 5C42B 5CZ1A 1KLNA 3DMJA 4FS2A 4FXDA 4ECXA 3SI8A 1KRPA 3KLGA 1FXXA 2BANB 1NJWA 4Q5VA 4E89A 5KFCA 1JLQA 3QEWA 2G8VA 3M9NB 1JIHA 1CZ9A 3I0RA 4OJRA 4TY8B 3KK3A 2BE2A 2AQ4A 2P1JA 4BE1A 1DTTA 4KHQA 1S97A 2BDPA 4CEBA 3RB0A 4GW6A 4IBNA 3S3MA 3NBPB 5KFPA 4H54A 1D9DA 1VRUB 4CHQA 3OYJA 4FK4A 3GQCA 4W5QA 3Q8SB 4M3RA 4Y1CA 4Z4EA 4HTUA 4NLRA 4DSIA 4RW6A 3OS1A 1TL3B 1TGOA 3UR0A 3LPTA 3NF7A 3SZ2A 1Q9YA 5L1IA 2WK4A 4CGGA 4E1NA 3Q8PB 3KMQA 1NJYA 4N5SA 4KFBA 1HNIA 5KG2A 3PO5A 3DLKA 2WRMA 1BCMA 4QWBA 4EO8A 4IG3B 3EYZA 3GILA 5T7BA 4FJ9A 3IS9B 4Q8EA 1S1UA 4MKBA 3DI6B 2IBKA 5DLFA 1YT3A 2HVIA 4M3XA 1RCHA 4ED1A 4HCBA 2FJVA 2IA6A 1RILA 1T8EA 1K1SA 4CERA 4NLVA 3SUQA 1RNHA 1A5WA 4KHWA 3SV4A 1J5OB 1NKCA 4K8ZA 4E7LA 3SPZA 4K4UA 1HYSA 4FJNA 2ZE2B 1JLGA 3ISNC 4YMEA 1C6VA 5DQHA 5KFGA 5KG1A 5HRPA 4Z4HA 4CHNA 4M94A 1D9FA 3IRXA 3G6YA 2JC0A 1C0MA 4CIFA 2YNHA 3AVLA 3RR8A 2D41A 3F73A 3OYEA 3DOLB 3AVBA 2O4GA 3C94A 2I1RA 4FJJA 2VG5B 1U09A 4ZHRA 1J53A 1RT7B 5EU7A 3IAYA 4M95A 4ECRA 3GYNA 1S1XA 1FKPA 4OGCA 1C0UA 4CHOA 3VA0A 4CF1A 1S4FA 2OPSB 2W8LA 4O3OA 4CJQA 3PW0A 4CEFA 1RT6A 3O3GA 5C25B 1RT5A 5KFDA 4RW9B 1CLQA 3NAIA 3HP6A 5L1LA 1GOCA 4KB1A 2C22A 3NGIA 3KHGA 3PV8A 4B3OB 4YQWA 3SCXA 1BHLA 4ID1A 3QNOA 1JLEB 3IG1B 4WFYA 2W7OA 4OPJA 2KW4A 4N76A 2ASLA 3V1RA 3AVMA 4J2BA 4IFYB 3FRZA 3I0SB 2BQUA 3O4NA 2HWIA 4MK7A 1T94A 5FRNA 4R8UB 3HPOA 5CY4A 5EDWA 3NGDA 5KT3A 2CKWA 1Q9XA 1WNSA 3KLFA 3H5XA 1NKEA 4F4ZA 4FZZA 4DTMA 4TQSA 4DL6A 3NF8A 2B6AA 3AVFA 5KFOA 1KLMB 4NLWA 1TKDA 4N47A 3ALYA 5CYQB 3AO2A 4MK8A 1IH7A 4B8CA 4ECUA 3GIMA 4CJWA 3KHRA 4ZVHA 1WSGA 4KHMA 3OL8A 1C1CA 1LAVA 4NCGA 5J2MA 4DS4A 3VQ4A 4ED3A 3SNNA 1X9MA 1TKZA 3AVAA 2G8UA 1RT2A 1IKWA 3VQDA 5KFLA 1YVUA 1TKXB 1RDAA 1WSEA 3OLBA 4CF9A 3ULDA 1I3AA 3M8RA 3OY9A 1JXBA 2NUBA 3DLGA 3PJWA 3NAHA 2GBZA 3DLRA 4O55A 1I39A 4DTXA 1WAFA 3CJ0A 3DLEB 4RNHA 4BWMA 3OSPA 2AX0A 3QESA 5HRRA 5KRSA 3LANA 4MIAA 2XO7A 4CGHA 4F50A 4FM2A 2OA8A 3DOKB 3P1GA 4DTNA 2KFNA 1S1VB 4IH6A 2D3UA 3LWLA 5C42A 3FQKA 4W5RA 2W42A 2R2TA 3C95A 3DRSB 3E01B 3MFHA 2BANA 4FM0A 4Q45A 5J2NA 2HAIA 3U6FA 1JLCA 1MU2B 3AA3A 4TY8A 4RW7B 2W9BA 4WFXA 1VSFA 2FVSA 3ZSVA 1DLOB 1T03B 2HNYB 1J9AA 1C1BB 4PY5A 3NBPA 4WYWA 4ECSA 3QZ8A 1VRUA 4ECVA 5CYMB 5HBMA 2Z1JA 1TK8A 3DMJB 3KLGB 1NHVA 4CJSA 4CK1A 3LZIA 5KFHA 1TL3A 4IG0A 2BE2B 3LDSA 4TN2A 2ETJA 4O0IA 2CJQA 1S9GA 1DTTB 5KG0A 1XR5A 3OYCA 2R8IA 1S0MA 4ZVGA 1RTDB 3CM5A 1WLJA 3D45A 2VWJA 4I7FA 3SQ1A 1SL1A 2W7PA 4F8RA 3PX0A 2XI3A 3MR3A 3IS9A 1NK9A 3DI6A 3TAEA 4ECYA 4NLYA 1RT3A 3GV7B 2P5OA 4FJIA 5JUMA 1J5OA 4XPCA 3QGHA 3C6UB 5I3UB 3UDLA 5L9XA 5KFBA 3CIZA 4U7CA 3E51A 4CJLA 3MEGB 1NKBA 5F9NA 1HNIB 4JV1A 2UVUA 4RG8A 4O3SA 4ED2A 2E6LA 4B9TA 1X9WA 3T5JA 4NYFA 4KHUA 5KT2A 5F8IA 4O3PA 1NHUA 2ASDA 1S1UB 4J9PA 1BQMB 3QEXA 4DL4A 2VG5A 4OKEA 3IN5A 4QPXA 2ITGA 4J2DA 3ISND 4U6PA 3RMDA 1HYSB 4KTWA 3V4IB 4E7IA 4FJGA 3SV3A 1RBRA 4CECA 1KFSA 3LP1B 2OPSA 3HT3A 3MFIA 1QAJA 1UA0A 1L3SA 4CHYA 4EO6A 4MK9A 4B3OA 3MAQA 2YNHB 3RB3A 3NF9A 3KMSA 2KQ2A 2BRKA 4EZ6A 3IG1A 4ZHRB 4Z4CA 1HPZB 2BRLA 5EUHA 4IFYA 4GC6A 2WTFA 4AHTA 1S1XB 4ID5A 4NLUA 4CJEA 3TWHA 3KJVB 1TQLA 1ZYQA 4FJHA 2O5DA 2HHXA 1RT5B 3T5KA 3VN5A 1GOAA 3GV8B 2V0NA 4AHCA 3BQ0A 3SUPA 3PHEA 3L2RA 4DTSA 3HXMA 3V6DB 2XC9A 2HHVA 1QUVA 2FVCA 1TAUA 1RA7A 3OYFA 2QXFA 1MMLA 1KLMA 3ZSOA 4ECTA 4WZQA 5CYQA 3CDUA 5E41A 3PW7A 3HL8A 1CSJA 4O5BA 1D8YA 1LWFB 4ED0A 2QV6A 3MTKA 4C8OA 1ZBHA 4I2QA 3C6TA 3RAXA 4J9LA 3ZT2A 3TAMA 2D5RA 4DQPA 1LWCB 4FJ7A 2DFHA 4ZPCA 1BI4A 1TKXA 2W9CA 1BIZA 3VQCA 3NGZA 1TV6B 3HK2A 4FK0A 1XHXA 3VA3A 3L2WA 1HYZA 4E7HA 3RAQA 4E7JA 1N6QA 2YV0X 4LY7A 2XI2A 3PZPA 5F8HA 4B9VA 4FZYA 1RDDA 4QWCA 2YKMB 2E9TA 1ZBFA 1WNEA 2Q3SA 1S1VA 3TARA 3OL9A 3OJSA 4KPYA 2AWZA 1YVFA 1T05B 5KFJA 3E01A 3SQ0A 5KI6A 1KHWA 2AJQA 4R5PB 1D1UA 2IM3A 2XRIA 4J2AA 4RW7A 4YR2A 1SH0A 1VSEA 1S6QA 1DLOA 4NLOA 2C28A 3HPHA 2HNYA 4MKAA 3ZSZA 2FJXA 3KTQA 4FJXA 2GIRA 1C1BA 1S48A 3BSOA 1WSIA 4XPEA 4F4KA 4KI6A 3QIPB 4LQ3A 3NL0A 5CYMA 3H5SA 3THVA 2RDJA 3K2PA 4ED6A 1X1PA 4IDKB 3OYBA 4DFJA 5J2NB 4K4SA 1JLCB 1CXQA 4OLAA 1SV5A 2W9BB 5DLGA 3TAQA 3GIIA 3HVAA 3NGYA 1BL3A 1RTDA 1EETB 5DG7A 2C2DA 4CF8A 2IJNA 2FC0A 4DTJA 2Y1IA 3V9ZA 1RDRA 5HBMB 5HROA 2Y1JA 1UA1A 4I2PA 4EYIB 4B8AB 4DL3A 4BE2A 4I9QA 2JEGA 3GIKA 3AVGA 2ASJA 4IG0B 3C6UA 5I3UA 4EBEA 1VSKA 4DQRA 1S9GB 2GC8A 2GUIA 1BISA 1XHZA 1IKXB 4RW4A 3MEGA 3TAGA 4FJLA 4EBCA 3KHHA 5DGAA 1Q8IA 4I7FB 2UVWA 4JRPA 3VQQA 4DLGA 1S0OA 3SI6A 2ATLA 3L2UA 4CF0A 4KRFA 4CJ5A 2FLPA 2UUWA 4DSFA 2R2RA 1BQMA 1RT3B 2RKIA 4J9RA 3VQ9A 2JEFA 2IOCA 3EPIA 5DQGA 1RYSA 4YNQA 1S6PB 3KLHA 2AGPA 3U3YA 2O4IA 2E6MA 1IKVB 3H40A 4GC7A 3V4IA 2DY4A 4EBDA 4DQQA 3HO1A 1KFDA 2BQRA 3LP1A 2F8TA 4K4VA 2VA2A 2HHUA 2E9ZA 3WNHA 1RT4A 1BQNA 5HRNA 3OYHA 1RBTA 2YHBA 3MR2A 4DFKA 4O3NA 1VSJA 4HYKA 2DTUA 1GX5A 2PYLA 3AO3A 4DFMA 3PR4A 1K6YA 2J6TA 4CK3A 3PR5B 2WCXA 4EP4A 3H4BA 4LSNB 1HPZA 3UIQA 4EEYA 4KTZA 4Z4GA 4TLRA 1S9EB 4NLDA 3KJVA 2LSNA 4DEZA 4TY9A 4I9LA 3OHBA 1A5XA 1RBSA 3K59A 2Z1HA 3MXIA 4YR0A 1LW0A 3V6DA 3HVWA 1QS4A 3RMBA 2FVPA 3Q8QB 3QGGA 2R8HA 3AVCA 1U45A 2R8GA 4IKFA 4M3ZA 3LZJA 3NKYA 3CFPA 3AO1A 4M3UA 4Y2AA 4K4TA 3ZT4A 1KTQA 4ID5B 1LV5A 2ALZA 3ZSRA 1LWFA 3V81B 1L3VA 4ZTFA 3BSCA 1JKHB 2FBTA 1SL0A 2QKKA 1S0NA 3VQBA 3NAEA 2IAJB 3CO9A 3IGNA 1LWCA 4DL2A 4FBTA 3V9WA 2A1RA 2YNGB 1S5JA 1HQEB 2W9AA 4FVMA 1TV6A 1T3NA 3LWMA 1HARA 3ZT0A 2EC0A 5KFXA 3KD5E 1TL1A 1ASWA 3BGRA 2D7SA 4ZVFA 3KOAA 5DG9A 1DTQA 1B92A 3AA5X 5KFNA 5F8JA 2D0CA 3TR8A 1VSLA 4PA1A 4Q43A 4URGA 4J9SA 4I2QB 3C6TB 3JSMA 3K57A 5F8NA 2YKMA 3NFAA 3QETA 3TAMB 4AHRA 1RDCA 3G10A 2PYJA 1BI4B 5KG6A 2W9CB 3PX4A 4QWAA 1KCFA 1T05A 1RTHB 1U49A 2WB4A 4KI4A 5L1JA 4R5PA 4O4GB 3FQLA 3UPFA 5KFQA 1NOZA 4FK2A 4KHNA 2KZZA 1N6QB 2XY7A 3N6NA 3OLAA 4ZPAA 4ELUA 2ILZA 4NLPA 4C8KA 4M41A 2EX3A 4DS5A 3VQPA 4AHVA 2IM2A 3OL7A 4CIGA 1RDBA 3QIPA 3HP9A 3L2VA 4FYDA 1EX4A 4N56A 3N6MA 1JLBB 1ZBLA 4IDKA 2B5JA 3G86A 4NYNA 5KFVA 1S1TB 4B9LA 1QSSA 1JL2A 1U04A 3O3FA 2GV9A 3JYTB 3IGVA 4LSLB 4B9SA 3NDKA 1RA6A 1S6QB 3HVTB 2G8HA 3MF5A 1EETA 3CJ3A 1SH2A 1J54A 1YTUA 1Y97A 4FCYA 4DMNA 4Q0BB 2IS3A 4RUAA 1VSDA 1RBVA 3M9OB 3NE6A 1XI1A 4OPKA 1JL1A 4KHRA 4ZVEA 1WSHA 1U48A 4UQGA 3OSNA 2C2EA 4HVJA 4IKAA 1KVBA 4WXOA 1SV5B 2ZQBA 2DFEA 3H5UA 1RTJA 1W25A 2FVQA 4TYBA 2OYQA 3QO9A 1G15A 1IKXA 1ZETA 3AA2A 3VQ6A 4FBUA 3CFRA 4E0DA 1RT1B 4ZTJA 4URQU 2X74A 4CEOA 4KV8A 5HROB 3P5JA 1KHVA 4OKKA 5F8LA 4I2PB 3SFUA 3S9HA 4DSEA 2ZD1A 5HRSA 1WAJA 4FJ5A 4CGFA 2F8SA 2BQ3A 3S3OA 4CFAA 4LD0A 1S6PA 4CJ3A 3P83D 4J9KA 4BWJA 1IKVA 3L3VA 4CJTA 4RW4B 2UVVA 4BDYA 2E9RX 1S9FA 4RNOA 4F3TA 2VG7B 4OVLA 4J9MA 1NK8A 5KGWA 4O4RA 5KT7A 1RYRA 2D0BA 5C5JA 3MXMA 2RKIB 3KKRA 1YTAA 4LSNA 3K58A 4RZRA 3NF6A 3RTVA 3KLHB 2D3ZA 1L3UA 1S9EA 3BREA 4CEQA 2GIQA 3D5MA 3GIJA 4G3IA 5L1KA 5EWGA 3OYNA 4QAGA 4OL8A 4DL7A 1WSFA 4J9QA 3QEPA 4QW8A 4PUOA 1RT4B 1BQNB 4JV0A 1EP4A 4PQUA 4DF8A 4GVMA 4H8KA 4K4WA 3M8PA 4CGDA 3CJ2A 5DMRA 1T7PA 1SUQA 3KLEA 3CDWA 4FZXC 4KTQA 3OVNA 5J1EB 4W5TA 3V81A 4IOBA 2V4QA 2FBXA 3PY8A 1UAXA 1N5YB 3EPGA 1JKHA 3FDSA 2QKBA 1N56A 3KD1E 3LALA 3QIOA 2IAJA 4CFBA 3V1QA 2HHTA 1LW0B 3DLBA 2JLEA 3BQ1A 2YNGA 1HQEA 5KT5A 4NRTA 4CK2A 5KTQA 3V6KA 4DWIA 1QQCA 3SUNA 4BE0A 3L2QA 3VQ5A 2RF2A 3FFIA 1S10A 3NHGA 1LWEB 4ED7A 3HM9A 1B9FA 3HJFA 4WE1B 3S3NA 3H98A 4ZPBA 3KK2A 4BACA 3WNGA 4DG1A 3BR9A 5EWFA 4BDZA 2HHQA 3LP0A 4IRDA 3AVJA 5J2QB 1NJXA 2AX1A 1NOYA 4H4OB 4E3SA 2WONA 2JEJA 4FLYA 4X2BA 2XCPA 4KAIA 4DQSA 1RTHA 2HNZB 1TL1B 3BGRB 2FVRA 3H08A 2B4JA 1DTQB 4O4GA 3CJ5A 4Y3CA 1IG9A 2KTQA 5J2PA 4K8XA 4KB0A 4FLVA 4YR3A 3CJ4A 3RR7A 1BGXT 1NK6A 3V9XA 2XGQA 3QLHB 2IM0A 3ZT1A 4F3OA 3JSMB 3U3GA 4RNFA 1LAWA 2C2RA 3B6PA 4TYAA 4DTRA 2HVHA 4QW9A 4CF2A 3OJUA 4ECQA 1JLBA 3L3UA 4W5NA 4NLTA 4CESA 3ZSYA 3PUFA 1HJRA 1S1TA 4MIBA 4IFVB 3KK1A 2WHOA 3JYTA 3OYLA 3AVIA 3PO4A 4LSLA 2VG6B 3HVTA 2IGIA 4CJ4A 1QHTA 3CYMA 2JEIA 1JXLA 4AHUA 2R8JA 1VRTA 1FK9A 4NYZA 5KT4A 4Q0BA 2OPQB 5KFAA 3I8DA 3PVXA 3SJJA 3DLHA 4QOZB 2YKNB 4KB7A 1Z26A 3RWUA 2HNDA 4K4ZA 3PW2A 4MH8A 4DTOA 2B5JB 2R7YA 3QERA 5I42A 3PW4A 2W8KA 2G8FA 3V6HA 4HUGA 3LAMA 2KFZA 3ASMA 5HP1A 3T1AA 3G6XA 3OHAA 1D5AA 3AO5A 2QE5A 1A5VA 1RT1A 3WNEA 3KLVA 4WZMA 4O44A 4M3YA 4ZP7A 2Z1GA 3TVKA 2OZSA 3TI0A 1HYVA 4CE9A 2FBVA 1NK0A 4PWDA 3SQ2A 3VQEA 4NLQA 3OS0A 3SQ4A 3BDPA 1RTJB 4KHSA 3BQ2A 1I6JA 4KSEB 3QO9B 4O0JA 2JC1A 4CGIA 1S1WB 3H59A 4TSXA 1EXQA 4B08A 1ITGA 4AILC 4H4MA 3QEVA 2VG7A 3QIDA 4DTPA 4C8LA 3DRRA 2VA3A 2YNIA 4G1QA 4LH5A 4CJVA 1QSLA 3QZ7A 1NK5A 4KV8B 3NH0A 2OH2A 4MFBB 2ZD1B 1C0TA 2RPIA 3TAPA 2R8KA 4L8RB 5KFWA 4MQ3A 1HNVB 2E4LA 3ZSWA 1HMVA 4XIUA 2YHAA 1QTMA 1ZBUA 1B9DA 3KHLA 4KO0B 1C2PA 3VQ7A 3H4DA 2B43A 4URSA 3ICLA 2X6SA 4ELTA 4FJ8A 3I5BA 2QK9A 1FKOB 2YNFB 5KFUA 2P51A 3DRPA 4CEEA 1CXUA 3KKSA 4NZ0A 1N4LA 4ED8A 1VSHA 4RNNA 3QNNA 1KSPA 2HHWA 4OKJA 5J1EA 5KFYA 3HVRA 4DSJA 4GMJB 3DYAA 1N5YA 5KRTA 4PUOB 5DK5A 3M9MB 4J9NA 4QCLA 1EP4B 3RB6A 2WOMA 4PQUB 2DPIA 5JS2A 1ASUA 3G6VA 2RDIA 1O1WA 3N6LA 4Z4IA 3M8PB 4J2EA 2XY6A 1S49A 4NLGA 4CIEA 4DSLA 3ITHA 3A2FA 4JUZA 1EKEA 1HRHA 1SUQB 3RRHA 4IRKA 3KLEB 3RBDA 3H5YA 1RTIA 3I5CA 3MR5A 1LWEA 2XY8A 5D3GA 4LQ9A 4Z4FA
chains in the Genus database with same CATH superfamily
3IC1A 4NWBA 3AT1B 3O1WA 4ILRA 2CRLA 1ZM2A 2QZ8A 2UV8A 3AVNA 3JSBA 2OZMA 3DCAA 3PIPQ 2DNYA 2CQ0A 4ZLLA 3H3NO 4ZP6A 4CEAA 5J2QA 5IFMA 4H0PA 1BE4A 4FYXB 2CWXA 4C6AA 4ZMMA 3W60A 1XMQK 1HQUA 4RNMA 2OTLN 5DJBA 2CZ9A 2R2SA 3RMAA 1RHKB 3W61A 3V6JA 2MJNA 1NK7A 5HI7A 2HHSA 1JNZB 1HX1A 3N4WA 3WUHA 3NOGA 3HSCA 2AP6A 3TANA 2HYIB 2G2OA 2DPJA 3MXJA 1AUSL 4BC2A 3JAMU 3CD5A 5IZHA 5IT9O 1E3MA 4FWSA 3R97A 1VK0A 1K9MO 5AQSA 1WB9A 4I56A 5J2PB 5KFMA 4R79A 1RE1B 4OZLA 3EWGA 5ETNA 4J5OA 1IKYB 2V9WA 4NB4A 4M5GA 5FDLA 1WOPA 4B9MA 1QD1A 1EHWA 3RZAA 2YKNA 4ER8A 2DNLA 2C3MA 3RMCA 2I5JA 5EWEA 3VAGA 2F96A 2E5LK 3THXB 1F5CA 4H0OA 1K8AT 2J7WA 1N36K 4LFAK 3FSIA 1HA1A 3KK1B 1JLAA 2ZJPL 4J90A 1QVFM 3KLIA 3I56N 4OZNA 2MLZA 1TVRB 2EVZA 1JMTA 4F0KA 2J6UA 2FGOA 4QWEA 2QL5B 2KFYA 4O3RA 2KL8A 3EZUA 5AQFA 3MMVA 2G8KA 4CJPA 3MEEB 3PRDA 4AQYK 3KNAA 2NQPA 2HNDB 1GLAG 2UUAJ 3OYAA 3O3HA 3RRGA 4OGEA 5BRHA 1SKSA 3EN9A 4X4SA 5I42B 2HQ3A 2X1BA 3CFOA 2VWKA 5IS2A 2MKCA 1TK0A 1BUPA 3I6PA 3DGPA 3LPYA 3I55S 2NLWA 4JI2J 5DDRC 2RE1A 1JLQB 2NLXA 4O44B 4OYWA 1XNRK 3I0RB 1VDHA 4X4UA 4NCAA 1VBKA 4ZP8A 5GIOA 4IUFA 4PWDB 2HGNA 3TNVA 3KHYA 3NGKA 2X6NA 2QL7B 3PJXA 1OS5A 4B3TF 2QJ3A 1YIJN 4C2MA 4OO1J 1T44A 4BRLA 4FLWA 2BJ8A 4CCHA 2YNIB 4DSKA 4KQZA 4OV6A 2ZH1A 2YNFA 2EFNA 2HQFA 3VF2A 2EWHA 3HF5A 4ZJQA 1M5HA 1LKZA 3SYZA 5SWMA 2FC8A 4P10A 3L8BA 4DTUA 1KVCA 4UF4A 4EYHB 4ZJLA 1XMQF 4F4YA 3QINA 1NBEB 3TU5A 3J80U 3LTOA 2VICA 2XTJP 5F9LA 1M1KO 3MN5A 4FLXA 2IVYA 1SS6A 3TW0A 4OYPA 2UUTA 3ZTQA 5C25A 2YXLA 1EIYB 2AP1A 5HL7L 2R7VA 2R7WA 4JS4A 5M1KA 1SKRA 4HT7A 2ZF5O 1HQ2A 1ZAVA 3QJJA 1RQ0A 4IH7A 2XY5A 2L9WA 2AD9A 3AV9A 4M3TA 1JLEA 2WOMB 4LFBK 4ZCMA 4YP3A 2J9DA 4QWDA 5H9EK 4OYXA 4HUFA 4AH9A 3D68A 1FNXH 1C0UB 1H73A 5FPEA 2BOAA 2XHBA 3AVKA 3JQKA 3A8IA 2ZM6K 4IR9A 2RQMA 2BTFA 1RTIB 1KAYA 2WTUA 2IJFA 1OPIA 2WSCC 4WP9A 4ZVSB 3TX0A 3PSIA 1S12A 4BC9A 2HRYA 4GKJK 4RWTA 1ZAXA 1NJZA 4RU9A 3M7VA 1VQSA 1UPPA 4KBIA 4ISFA 2CQ2A 4GVEA 3G87A 3M8YA 3RAMA 2O8BA 3VEYA 3GSIA 3H2LA 1NRKA 5JXSA 2XGPA 4AQYF 1JLFB 3MN6A 4JKGB 3FEYB 1YRXA 3J81j 2QM1A 3HSZA 3RUBL 1TYQB 3DM2B 1FERA 3ENBA 3T5LA 4M45A 3OTEA 2B6AB 5KGXA 2P5GA 2YHWA 1IKYA 5CHCB 3ENVA 4FLZA 1QE1B 3BJYA 3EY1A 4ZP9A 5JJBA 1HL6A 4KAZA 1SH3A 5ADXA 5F0UA 3MWTA 4HWIA 1GX6A 1RT2B 1IKWB 3DOKA 4OQJA 2PN6A 4FPIA 1TVRA 2A2DA 4AL7A 1K1QA 2GS8A 4K7QA 2XWYA 3PHTA 3P4UB 4F4WA 3EDQB 1WKKA 2PZSA 3MEEA 1CC7A 1YITS 3P5BP 4OIXA 4R0EA 2VYPA 4BQZA 4CM2A 1WI8A 4FNIA 4E8UA 4FPAA 3D54A 1AUDA 4XDCA 3M2UB 2HFOA 1XUPO 4A4JA 4JLHA 3CDAA 3ATUA 3ELHA 1FEEA 1KLNA 2OLWA 3DMJA 4FXDA 2CAJA 4I6MB 4LR8A 4LF5F 1JLQA 2XS2A 2G8VA 3M9NB 3VAMA 1JIHA 3I0RA 2BE2A 2F1FA 3A8EA 3CJRA 4KHQA 3J7AN 2MZSA 4RUBA 3VGTA 1WHVA 3BKTA 3QAEA 3AD8C 4EHTA 3NBPB 3MOZA 2QSFA 4X64K 4I68A 3QBWA 3OYJA 1K47A 2DXFA 2C42A 1SJ4P 2FHJA 1FCAA 4BRKA 5IWAK 3OS1A 2W6KA 1PKUA 4CO5A 5GAGP 3SZ2A 3HZ6A 2WK4A 1MW7A 2GJFA 2Q43A 1BCMA 2ZJQQ 4IEEA 2VV5A 5T7BA 3IS9B 3DWLA 3DI6B 5DLFA 2ZM6F 2HVIA 4M3XA 4BS2A 4WFBL 2MPUA 1RCHA 2W1BA 4NLVA 3SCIE 3SUQA 5BPNA 2AJ2A 3SV4A 1NKCA 4K8ZA 3PLAA 4QU6A 4E7LA 3O08A 4FJNA 2HOEA 2J5AA 3DDNA 2ZDPA 4GKJF 4NO7A 2CH5A 1KKHA 1KS2A 3R2DJ 4BRIA 5LMUK 3MMCB 5KFGA 5A76A 1KBRA 1D9FA 4JI3K 1C0MA 2YNHA 1UW4A 3UN2A 3F73A 3DOLB 3VAKA 4C4WA 3PIOL 3W1YC 5BN8A 2QN6B 1RWUA 4NYPA 3ZTOA 1RT7B 3IAYA 4M95A 2UP1A 3GYNA 1CBKA 1C0UA 2ZITA 4OZ5A 4CF1A 3MCMA 1S4FA 2OPSB 2FY8A 4XK8C 2W8LA 3PW0A 2RHKA 4I0WA 1NUEA 4RW9B 1CLQA 1U0HB 2C22A 2FZGB 1YKWA 5D0EA 3ZZYA 2ITMA 3PFEA 1NJIT 3QNOA 3IG1B 4WFYA 2LYVA 4OPJA 2KW4A 3GJQB 1JCEA 3I0SB 4ES3A 2W2PP 5FRNA 2VFUA 2ZH7A 4IOAL 1X5SA 1KONA 5GAEP 2HQIA 4JKGA 3T1YJ 1FX4A 4WJBA 3H5XA 1TYQA 4FZZA 3NF8A 2B6AA 3AVFA 2A6OA 1KLMB 3A8JA 3GYGA 4N47A 3ALYA 4DR3F 2CVEA 2OCEA 1VQ6S 3OXLA 5D0RA 4ECUA 2ZH2A 4ZVHA 4KHMA 3OL8A 1LAVA 4BRQA 3ADAC 4RCHA 1OY6A 4ZVPB 3VEOA 2AEMA 5GMKa 1H3DA 1RT2A 3TSPA 4JV5F 1IKWA 1AROP 3UD3P 1QQOA 2FSJA 1TKXB 1RDAA 3THWB 3HFKA 1B3TA 2L9NA 2MY8A 3HI9A 5AFUH 4IOCQ 4DTXA 2DNZA 2VWBA 4RNHA 4BWMA 2H65B 4B1VA 1HBMB 2HG4A 2I7NA 2QA2A 3OBWA 2RRAA 2Y9HA 1TUGB 1ZM4A 3BO3A 5HRRA 3OR2A 1RAOA 4MIAA 2NSBA 2XO7A 3M2UA 2KFNA 2YQ0A 2M4MA 1SVDA 5GAGU 2QWRA 1VQKN 4FM0A 5HMYA 4H0XB 5B09A 4OI3A 2DTJA 3EJMA 3AA3A 2VQFJ 3M6GA 1T6DA 4ZN3A 1J9AA 5CCMA 4DBQA 1GMVA 5D4OA 3H25A 3HHNB 4PY5A 3WQPA 3NBPA 4ECSA 2ZNYA 3QZ8A 1L3KA 5CYMB 5LMUF 1QZ6A 5HQ8A 4CJSA 3H2UB 1WBDA 3HFZB 4H4KA 2CGJA 4DR6K 4LF9J 4IG0A 2EEYA 4TN2A 4LRFA 5LMNJ 2CJQA 1U1OA 3O3LA 1NMEB 5I3QA 2R8IA 1RTDB 3ZZPA 1S79A 3ENAA 3ILOA 5B08A 4C1NK 3SQ1A 1CULB 2DCUB 1VQ8N 4F8RA 3PX0A 2HS0A 1VHIA 2XI3A 1RDWX 3CC7N 4ISGA 2QMUB 5C10A 3IS9A 2OSQA 3DI6A 4JI1F 3TAEA 4DR4K 1N0UA 4IO8A 3BV8A 4NLYA 2HFSA 1RT3A 4CH0S 5SUHA 4FKXA 4FWRA 2C3PA 4FJIA 3MR7A 1X8DA 5I3UB 4EUVA 2UU9K 2ZH4A 2G2YA 3CIZA 4U7CA 1MROB 1G1XA 2Z57B 1HNIB 4JV1A 2DH7A 2UVUA 3MMCA 5DDQC 3CCSN 4EU0A 3T5JA 5JICA 4KHUA 4WCEL 5KT2A 2JDJA 1S4EA 4O3PA 1EKRA 5LXYA 4DV7F 4HI1A 3P8BB 4J9PA 4DL4A 3A5NC 1IWAA 4B3SF 1KQKA 4B9QA 4LBHA 3SV3A 1N5SA 4M7XA 2E7VA 2OPSA 3HT3A 1AZSB 1K8AO 3D1OA 1RB0A 1UA0A 3PYDA 1IR2A 1XTZA 4BBYA 2HBMA 3EEQA 4CHYA 1N33F 2A18A 2I38A 5CQGA 3KMSA 5C2GA 4EZ6A 3IG1A 4ZHRB 4LF2A 3LQVA 5EUHA 4CVNE 1U7LA 1CLFA 4AHTA 1NZAA 4QIVA 1BDGA 2XYPB 1S6UA 2HFUA 1C0GA 3T5KA 3VN5A 1GOAA 4CZFA 2ADBA 1K0TA 5U47A 3PHEA 2F4VF 1NWKA 3HXMA 2XC9A 4BGBA 3ILJA 1KLMA 5E3CA 1Q18A 3WT0A 2VFRA 4ANDA 5LSOA 3I32A 1CSJA 1CQNA 2BX6A 4DMZA 4GMKA 4G1IA 4O5BA 1KD1T 2QV6A 1KWMA 4YY3J 3J80O 3R27A 5FIIA 1ZOTA 3G8QA 2ZVSA 4XTTA 3TAMA 3I31A 3DOMB 1NBWA 3VZHA 1YJTA 1HKBA 1TKXA 1SQKA 2GO9A 2AA4A 3HK2A 2F8HA 1D9AA 4GV6A 3C15B 3CPWM 3M6VA 2AZ3A 3BH7B 4CO4A 2NXCA 3RAQA 5H9FK 3CJ1A 1RDDA 4AXJA 1ZBFA 3OFHA 4DR6F 1QHAA 4U7UK 1M5KC 3NG8A 3TARA 3OJSA 1CJTB 1N52B 1KNZA 1T05B 4LF4F 3SQ0A 5KI6A 3DJCA 3A3OB 1D1UA 4JI8K 4NLOA 1PO6A 1TMMA 2C28A 1VQPN 2FJXA 4ZPWR 3PKMA 2BJ3A 2H5EA 1HNZJ 4FDFA 4RR5A 1M90T 4K43A 1ROFA 2E2OA 3EZWA 5BRDA 5I9EB 2UU9F 3BN7A 4LQ3A 4NXNK 5CYMA 4C8ZA 3THVA 2HZCA 3HSJA 3Q7BA 3FC9A 5B0EA 2ZOMA 3C65A 4OLAA 1VC6A 3DDIA 1Q5YA 3DHWC 3PIPL 1S72S 2UXDK 3GIIA 4PRFA 1RTDA 1EETB 5ETOA 4CF8A 1HHQA 1UAWA 2FC0A 1UCNA 1CULA 1DARA 1N5QA 2AYMA 2RNEA 1D09B 1RDRA 5HBMB 2PSZA 2XYHB 1SC4B 3U1NA 4DL3A 4DV6F 4IJAA 5C12A 1GLEG 4BE2A 4HEA9 2JEGA 3HJVA 2DRDA 1VHFA 4DUYF 5I3UA 4EBEA 1VSKA 4DQRA 1YHQS 1S9GB 3U1MA 2GC8A 3WQTA 4FJLA 2EG1A 1F9EB 3TEGA 4EBCA 2VZ9A 3N28A 3AJ1A 2XS7A 4JRPA 3VQQA 4DCHA 4CF0A 4KRFA 2KG1A 4CJ5A 5GINA 5ETMA 4PAAA 2HHPA 3I87A 5DQGA 3J7Z5 5TKYA 4YNQA 1S6PB 1BA0A 1H72C 2O4IA 1IKVB 4KGZB 5A8WA 3QRPA 1OSCA 4PXBA 1IBKJ 1AZSA 8AT1B 2VA2A 4MDBA 1RT4A 4JYAJ 2P6TA 3C7NA 4F02A 2YHBA 3CCQS 1FVSA 2DISA 1VQ7S 2XHWA 4QIFA 4DFMA 4RPFA 1ZZFA 2WCXA 5D4LA 4EP4A 3UIQA 4LSNB 3M32B 2BJDA 1XMOJ 1NB7A 3GG0A 4KTZA 3MM6B 3PACA 1EQ0A 3OD2A 3TZXA 4NPOA 1S9EB 4NLDA 2MTLA 2HS3A 1HKCA 2LSNA 1FJGK 3OHBA 4A8YA 3ZX2A 4ETXA 5K5MA 4BC3A 3HVWA 4C3KA 3SLCA 3FGVA 2FVPA 3AVCA 5FLXY 4IKFA 3F5TA 1MA9B 1JCFA 4A5AA 2CZVC 3TR5A 2E5GA 2FTRA 2B8QA 2QMWA 5HVGA 4B3MJ 4RWXA 3O8WA 1KVKA 2D74B 1SL0A 2FBTA 2EK6A 3N5BA 3CO9A 1QAYA 2W25A 3QMQA 2W6LA 3LM9A 2XNRA 3VGLA 1WG5A 1HQEB 2W9AA 4FVMA 3EMTA 3LWMA 4OX9J 2EC0A 3C15A 1NAQA 3VERA 3M8WA 3R5CA 4J91A 1CZAN 2P9GA 4QS9A 3L7OA 4U8VA 4I2QB 2Y1LB 4E1JA 1B7FA 3K57A 5F8NA 3NFAA 3ZZUA 4AHRA 3G10A 1BI4B 5KG6A 4PPDA 2W9CB 3PX4A 2NZ4A 1KCFA 2R7QA 2W40A 3RSEB 1T05A 2IIRA 1RTHB 2CJ9A 3G96A 3LUYA 5L1JA 4NXMK 2DKOB 3FQLA 4ES1A 5KFQA 2N7YA 4KHNA 2KZZA 2V2VA 2FGCA 2MEWA 3W62A 1N6QB 2KLAA 4ELUA 2ILZA 1TL4A 1RGVA 2ZUAA 4M41A 2IY5B 5GAHU 3NEKA 3VQPA 4AHVA 4YORA 1UZDA 1RDBA 3HP9A 3U02A 4N56A 3FRYA 3CQYA 2P9SB 3AOCA 2HSTA 3G86A 2W4CA 1QSSA 2K06A 2HHHF 3PYGA 3IGVA 4A48A 4B9SA 3R5AA 3EGZA 4X4NA 3HVTB 4OI6A 5AQLA 4ITSA 1SJ3P 1EETA 3CJ3A 1J54A 4FCYA 4Q0BB 4RUAA 3NE6A 3PYFA 1NH7A 1XI1A 4FOEA 2AEFA 1P1LA 2B3TB 4KHRA 1NJIO 2ZWOA 1H2UX 3W8PA 1WHYA 5D8HB 4HVJA 1Q7YT 1P1TA 2A5XA 4IKAA 4OHXA 1CJKB 5F3TA 3QNWB 2DRAA 2DGWA 3H5UA 3KWMA 3QB0A 2C2MB 1RTJA 4E2FB 1W25A 2MKIA 3VAFA 5A8KB 1Y5IB 4RUHA 2ZZTA 3O4WA 4CZEA 1N5VA 3VOVA 2X74A 3O6WA 2LXUA 5GADU 2F9TA 1VR6A 5F8LA 1FJGF 4I2PB 3SFUA 4CBWA 1WAJA 1R8AA 2K7KA 4CFAA 1S6PA 3D7EO 5AFUA 1K73T 1IKVA 2HFVA 2V8HA 1VOMA 3QT5A 3JXUA 1HR0J 2MXYA 3JTNA 3D3BJ 3MAHA 2Y8WA 2HGMA 4BDYA 2KDOA 4PWWA 4RNOA 2NXJA 1UJ4A 3MXHP 3SDEB 3DGVA 2M8HA 5KT7A 4DR7K 3MAAA 2LEPA 2M52A 3ZYYX 1R27B 5C5JA 4LSNA 4FO0A 3G2XA 3MZIA 3SQOP 3M6UA 3MM6A 1J5EJ 5A6WA 4QIGA 1S9EA 2V8GA 4QU7A 3CJQA 4G3IA 5L1KA 5EWGA 4PG5A 4NASA 4OL8A 4QW8A 3S1TA 3GLJA 1SAZA 4GVMA 4WP8A 2CFXA 1FJCA 2V7YA 4OHWA 3MEKA 3QT7A 1SUQA 3CDWA 3IFRA 4FZXC 3OVBA 4KTQA 3NNCA 3BUZB 4W5TA 4IOBA 3PY8A 4YS2A 3ATVA 1A9NB 3FDSA 1U1PA 2A41A 3GG1A 1W2IA 2YWEA 1U2VB 1VK3A 2JLEA 3MN9A 1HQEA 4NRTA 1S0VA 3L7PA 2RF2A 3FFIA 1FI4A 3FBEA 3NHGA 3CC2N 4KPCA 2R9LA 4ED7A 4H0TB 3NGRA 4X4PA 3S3NA 4KHPK 2NRRA 4H4KC 5LL6d 3LP0A 4JNEA 1XMQJ 2WONA 1Y11A 2ZJQL 4OLOA 4KAIA 1XEZA 1RTHA 4J9UE 2O1PA 1Z05A 4O8UA 2B4JA 3D9BA 2CJBA 3H3OB 3JQMA 3ZZTA 2NNWA 2W2OP 4FLVA 3RR7A 2IRYA 3FSYA 2DNGA 3QLHB 1W7WA 4XDDA 1FFGB 3LDOA 3MDQA 3PXGa 4RNFA 4ED4A 3B8HA 1I3OB 2VIHA 2FDNA 4LFCF 2HVHA 3LDLA 3ENWA 3CEDA 4ECQA 4OI2A 2B4OA 1H98A 4M5DB 2O8CB 3IP0A 2WHOA 2VGNA 5BREA 1P9YA 2ZBPA 3OYLA 2ZWPA 3PCOB 1OMSA 3HVTA 2IGIA 2YY3A 3GYXB 4CH7A 4AHUA 3EGWB 1DURA 4NYZA 4Q0BA 1RWKB 2OPQB 5KFAA 4QOZB 3IM9A 3Q86A 2NRXA 3TTDA 2GHWA 4MH8A 3HT0A 3BZKA 4F67A 1N36J 4LFAJ 4UT4A 3V6HA 1B0VA 2ZVIA 3PJ9A 3GJSB 1N32K 3LAMA 2MDAA 2KHDA 2DGVA 2KFZA 2KXHA 4C3MA 3T1AA 1WELA 2BMBA 1D5AA 5H1SQ 1VC5A 4DPXA 3ULHA 3WNEA 4AQYJ 2QLFB 4WZMA 2E7XA 1HNWF 4ZP7A 2Z1GA 2C3YA 4CZJA 1R8BA 3A0IX 2YBVA 1Q7LB 1VLYA 5AE1A 1NK0A 1NLKL 1FXLA 2W2NP 3VQEA 3KJNB 4NLQA 1GEHA 3SQ4A 4LF6K 1LWXA 2FHKA 2QLXA 3CMQA 4KSEB 4O0JA 2CQBA 1R0CB 3H59A 1RCOB 1EXQA 1FRLA 3CCVS 1ITGA 3AODA 4C8LA 3CJCA 3DRRA 1QSLA 5I4MA 4KV8B 4CLLA 2I6WA 2OP5A 1XMBA 3DXBA 3CJKB 3H7HB 5HMXA 4JI5K 2R8KA 5E2QA 3GU0A 1KOOA 1HNVB 1O13A 4IOCL 2YHAA 1XN9A 4OYAA 1UFKA 4KO0B 1C2PA 3K9KA 4NMXA 1URNA 4JKBA 1DZ5A 1FNOA 4F7VA 4ELTA 4FJ8A 4KHPF 3B54A 2P51A 2MQNA 3DRPA 3CXCM 1NMDA 3DXKB 2VHGA 4A8QA 3KKSA 3Q2TC 4OI1A 3UE5A 2Q3PA 1FEHA 3HVRA 2DT9A 3VF4A 2A6MA 1T9UA 4PUOB 5B0BA 1X4DA 1R6VA 5DK5A 3LH2S 4J9NA 1MWMA 3RB6A 4WIQA 1M90O 3G6VA 1QDUB 4FPRA 4Z4IA 2HBLA 4X84A 3U9DA 2QSWA 3UCZP 4CIEA 3ITHA 3CCWA 3AQOA 3RRHA 1HRHA 3RBDA 3MR5A 2YWWA 1YBTA 4LQ9A 2XSFA 1RAJA 5DQIA 2QWLA 4MMOA 1XK8A 2VBXA 4FN5A 3T5HA 2ZKUA 2E2QA 5KT6A 2GEMA 4K4XA 5BPMA 4K4YA 5M1PA 3CVKA 4KKOA 5JVGQ 2ZM6J 4LIRA 2NR0A 3K0SA 2IC3B 1IVZA 4V19S 2HW3A 5FROA 1VQ6N 1NNDA 3M2VB 3AOBA 3MEDB 3IM8A 1RWVB 1RBUA 4K5RA 2PC6A 4WIIA 3MECA 3FMWA 3T6JA 2UUAF 4GKJJ 1SIWB 3KK2B 3QLHA 3Q22A 4DG1B 5HO4A 3THYB 3BS9A 3T3FA 1P9QC 4HH0A 4HUEA 4NLXA 3BM7A 2HMIA 1M5PC 1KQSR 2E66A 1REVA 2RQ4A 4ILMA 4I6AA 2OPPA 3R6LB 1B0TA 4B3RF 3SJHA 2F4FA 4KH1B 4M3WA 4HTIA 5FD1A 2KM8B 3CQ8A 4CRJA 4CHPA 5LXRA 4C1NI 1N5TA 2OPQA 2KRRA 3H20A 5AT1B 1FHTA 4RW8A 2MKYA 3VQ8A 4F4XA 2JGUA 1P90A 3TABA 3MM5B 2CJYB 2AGOA 2RRNA 2F7TA 3F9KA 5T14A 1WSJA 3MCSA 3CG7A 1JX4A 1ZH5A 5ETQA 1R0AB 3G0ZA 4JRQA 1ZTTA 1LW2B 5K14A 4HDHA 3BBBA 3GMGA 5CXTA 4OLBA 4JHDB 4ZPDA 1Z25A 5HANA 1FK9B 2GGPB 1YWXA 2FD2A 2DPNA 4CLWA 1G3OA 2P6SA 2QWOA 2HURA 3TTFA 3W66A 1W9HA 1ASVA 1FD2A 4E19A 4FJKA 1A7GE 1ICEB 4ATNA 2RT3A 4B9NA 4IJNA 1VISA 4FLTA 3BP8A 2X78A 2Q36A 1N0VC 3FBFA 2DNPA 5AJ3K 3QFHA 3K5NA 2VPZB 5HP1B 3I5AA 4YFUA 3PKYA 4CJKA 5E5NA 1Q78A 3PRVA 4N8OA 4Y1DA 3U1LA 1OPZA 4J9OA 1UVMA 1GLJO 5HMWA 3KK3B 5SZTA 2IPOB 3LP3A 2K1RB 4FLUA 4ECWA 2X1FA 1VQOS 2E1MC 2AGQA 4LT6A 2DGOA 2CJXB 3K5LA 4X64J 2EXUA 3CJ8A 2PE8A 4A8MP 4M5KA 3Q24A 1MN7A 3HYFA 4IG3A 1HNVA 1ELOA 1N48A 1UWAA 3EZ5A 3HOSA 4KO0A 2BJ1A 3FZMA 5AZJB 4H4MB 2P5VA 2PEBA 1VHXA 3ZFVA 5IWAJ 1ATRA 4B1XB 2KZMA 1KAZA 4G1QB 2DGXA 2IDEA 3VQAA 2E5IA 2HRTA 4RUCA 2HWHA 3KXDA 3W3SA 2ZZMA 4KFBB 2OD6A 3OBYA 3DXKA 1BQXA 4USKA 1FXRA 2ROEA 1F21A 4CHZA 4JV2A 3JXOA 5CZVA 2CH6A 2XCAA 3EE9A 2OFHX 2OEKA 3S8SA 3OYMA 2CDRB 2IRXA 2Z8QA 5KG3A 5CH7B 3NMAA 2ZH3A 3DDKA 4BVPA 2ATQA 3K5OA 4F2RA 4W5OA 1OSDA 5LMUJ 5ETVA 2IMOA 1VFJA 4JI7K 4ILLA 3CDEA 3Q8YA 3PSFA 1HNXF 4Y2CA 1K44A 4JI3J 3BSNA 4B9UA 2DFFA 3NY0A 3JB9k 1NXIA 4DCPB 3O1LA 3JQJA 4M42A 1R8PA 3D7SB 1WC6A 4USUA 3HD2A 2CQIA 4N41A 1DKGD 5AQUA 4NA2A 3VAJA 3P5TL 2JWKA 3V1OA 4QJVA 1BIUA 3EL2A 1G6BA 1I94F 5F8MA 2KT3A 4FS1A 2IC3A 1RT6B 4R8UA 3RW6A 1Q7YO 3OL6A 3IWNC 1AB8A 3MEDA 4CEZA 1D0EA 3DNCA 4PCQA 1E6VA 3ZXWA 1U02A 4H0VB 4JKCA 3CCMN 3RVCA 4F9OA 3O44A 3PG9A 3HULA 1XWLA 1Y3KA 3AA8A 1FFSB 3U8XA 4DV7J 3M4XA 3K5MA 3V2UC 1WC4A 3BBFA 4ERDA 5GMDA 1HKGA 1OQ6A 1WTBA 5KFEA 3CMEN 1K73O 4MO4A 2QFJA 2RMLA 4IQXA 4CTAA 3A8KA 4NLSA 2NRTA 4TQRA 2JWLA 2HF4A 1UOCA 4CD3A 3UN5A 3DLEA 1W0HA 2AT1B 1E6YB 4DX5A 4DQIA 1C1CB 5C24B 3NH1A 3MM5A 3MD3A 5J2MB 3H1QA 3IBCB 3CIPA 3HX9A 2Q1LA 2V8DA 1UJ5A 1M1HA 2OAUA 2W4PA 1R0AA 2XZTB 5E33A 1LW2A 3CM6A 3G71S 4JHDA 5CZ2A 3J7YI 4X66K 1HWUA 2GGPA 4CJRA 3DLGB 2YPZA 2KKZA 4BG9A 1WJ9A 4ICLB 1MU2A 1IQZA 5KFSA 1IO2A 2BGGA 2BM0A 5AQIA 2G1HA 4C0OC 1YI2S 5ETKA 3VVUA 3M8SA 1T03A 3KUGA 3M8QB 2FLLA 2A1SA 2J4RA 4FKYA 2G4BA 4TXSA 2CJKA 1S72N 5KFFA 1QSYA 4O0NA 1FWPA 5C42B 3N0VA 2MQOA 4FS2A 4ECXA 2GELA 3KLGA 3LA0A 3TUPA 1JB0C 1Y3JA 2BANB 4Q5VA 2HBRB 4ZLNA 3KK3A 2DGTA 1RP5A 2K1RA 5GVQA 2BDPA 2YWFA 1LNQA 4DV0K 4H0YB 1FRKA 4X65K 3DXMB 3L4QA 1OH7A 1VRUB 4FK4A 3R7NB 4CZIA 3CDBA 3IMXA 4JI7F 4Y1CA 4Z4EA 2ASYA 4DSIA 5AQPA 4DR6J 3M5RA 4TU8A 4UW2A 2CNKB 5FJ4A 4F25A 1TL3B 3VGVA 1TGOA 2DNQA 4K2JA 1HBOB 1NJYA 2FZKB 4N5SA 3LL3A 4JI6K 4KFBA 2V5HG 1T6CA 3MMAB 3PO5A 3VGKA 2GX9A 1PAUB 4QWBA 3AY9A 4B1WB 3W64A 4DR4J 4FJ9A 3A12A 2E5HA 2BA9A 1S1UA 1QVGR 3E1YA 3KDOA 3CCQN 2V6AA 1ZA2B 1T8EA 4CERA 3D2FB 1VQ7N 5ETTA 2YQ3A 3AH6A 1K9MT 4AXIA 2UU9J 4K4UA 3ENQA 3T1YF 3D0IE 3KUHA 2ZE2B 1S7IA 4YMEA 2NCKL 2UXBK 1WC0A 2FUG9 2JFDA 4IWVA 3VESA 5HRPA 1K8KB 4CD1A 4F3MA 1YZ7A 5AXNA 3RR8A 5IT4A 2AYGA 3G82B 1RLCL 4FYVB 3SSQA 4BR2A 1VK8A 2I1RA 2BKOA 4LUBA 3OW2M 4F0MA 5EU7A 4Y2IA 3IBWA 2GUPA 4OGCA 2BUNA 4CEFA 1RT6A 2V34A 4UTGA 2CADA 2ZJRQ 2Z2MA 3EO3A 5L1LA 1GOCA 3LGNA 4WWSA 3VF6A 2QC3A 4DUYJ 3KHGA 2O01C 2V4JA 4FXVA 4YQWA 2Y0SD 4JI4K 2ASLA 2D0OA 3V1RA 3AVMA 3FRZA 1WD6A 3O4NA 2HWIA 4MK7A 1IBLK 3NLCA 4F26A 3K2YA 1ULRA 3CJ7A 4X66F 3HPOA 2DD8S 1NM1A 2L9DA 4LBPA 3TSQA 4NX9A 1SQEA 3ETMA 1W26A 3R5BA 1D8ZA 4F4ZA 4AM7A 3VPZA 4TQSA 4DL6A 3J7A1 2DB1A 4QPTA 2PEHA 4F3QA 5HVHA 5CYQB 1HBNB 1YJWN 1Y10A 2M5YA 3POTB 3V4MA 4FYYB 2UV8G 3GIMA 4DZDA 1WSGA 5G4DA 2O67A 1C1CA 2ZNZA 1IBCB 2J8AA 5J2MA 1NEEA 3VQ4A 4ED3A 2XMVA 3VQTA 2MB0B 1JCGA 4H5TA 3D6TB 3VQDA 2I2YA 1NGIA 5LMNF 4FOIA 1WSEA 2J76E 1GXLA 3M8RA 2V68A 3OY9A 1JXBA 3HHDA 3DLGA 2GBZA 1I39A 1HW8A 2EFVA 1WAFA 3Q7CA 3CJ0A 3CT9A 2HFZA 4DPUA 3EICA 3DLJA 3E9PA 5DZ6A 4A2AA 3P96A 2BW2A 3GJRB 5KRSA 1E4GT 2E1ZA 5IV3A 4F50A 1S77D 4FM2A 2OA8A 1ACMB 4DTNA 3TJ9A 2D3UA 1M1KT 5C42A 2N4CA 3Q8UA 3DRSB 2RDDA 2WC9A 4BHQA 2BANA 4DV2K 4Q45A 2OUGA 3CPWR 2CG8A 3CUNA 2P9PB 4JI8J 2W9BA 1KAXA 3HHLA 3HD1A 2FVSA 2MZQA 3BKFA 3EX7B 1VSFA 3W5XA 3WC2A 4QQBA 2MGZA 2BACA 2FF6A 1QAXA 4L75A 1U8SA 4NXNJ 3TJ8A 1NGDA 1HWKA 1VRUA 4ECVA 3CTRA 3V5RA 3J7AP 1I5OB 3HRGA 3QFUA 2N3OA 4DB3A 4Y65A 2IVNA 2BJ7A 4OJ3A 1TL3A 2UXDJ 1RHJB 1URRA 2ZH5A 2ZDOA 2ETJA 1DTTB 4J8FA 3O5TB 4PKGA 3BGUA 3D45A 2B8PA 3GG4A 1F5AA 2W7PA 4DX8H 3QATA 4CP5A 2LMIA 1EKSA 1HLUA 2X1AA 3W8GA 1NK9A 3NVKA 4ECYA 5FPNA 2E1CA 3GP9A 4UOGA 4MDAA 5AQTA 5A0YA 4ID8A 5JUMA 2FB0A 1Y5NB 4XPCA 3LOUA 2GMJA 3C6UB 3GSDA 2E1YA 2V52B 1SC3B 3E51A 3MEGB 4O3SA 2E6LA 2G0IA 3D1QA 4ZKAA 2RILA 4NYFA 1Q95G 2HHHJ 2FYXA 4L76A 2VUGA 4ZJOA 1WOQA 3G82A 4MLEA 1FRXA 2VH7A 1UL3A 5B0DA 4J2DA 4U6PA 5FPDA 1HYSB 4KTWA 1RBRA 1KFSA 5I3PA 3MFIA 1QAJA 1B70B 3NS7B 1CJVA 2F3JA 2YX7A 4EO6A 1HI0P 4MK9A 3MAQA 2DH8A 4CLKA 3RB3A 3ILLA 1NGHA 4TLQA 2CJAA 1FDBA 4JKEA 3CGIA 3FCVA 1S1XB 2NUUG 4ID5A 4NLUA 4CJEA 4K0KK 3BN4A 2YJFA 3KJVB 1TQLA 1O6XA 1FJGJ 1VQ4N 3SBMA 2PT0A 2O5DA 3AD7C 4FF2A 3GIRA 2HHXA 1RT5B 4H5VA 3SMPA 3GV8B 3ZEUB 5BYQA 4GO5X 2V0NA 4AHCA 3CERA 4GVLA 2G0JA 4DV5K 4C48A 3P38A 1QUVA 1TAUA 4HHHA 4DV1K 1PSDA 4HACB 1MMLA 4A5BA 2Z58B 4ECTA 5A2QO 5CYQA 1HBNA 4HDGA 1VLOA 1FX2A 3P31A 4PKHA 2ROPA 2RVJA 4A47A 2HQDA 2RS8A 1OH8A 1ZBHA 4DV2F 1ZPVA 3C6TA 2F63A 1ZM3A 3RAXA 4J9LA 3AAQA 4GV9A 5CD4A 3MPUB 1LWCB 4FJ7A 1LOUA 4BC4A 3TZWA 2Q0UA 4IZ9A 1XHXA 4C9DA 2NRVA 1SJFA 2J8SA 1HYZA 4YOYA 2E7WA 1LEOA 2IHR1 4E7JA 2YV0X 2HPUA 3PZPA 2OGUA 4WP3A 3O5BA 4B9VA 1NDPA 4AE5A 4QWCA 2RIJA 1UEKA 4DI6A 4KPYA 1QTNB 5AE2A 3R7BB 4KH0B 1VQ9N 1KHWA 4RKUC 3VTHA 4WQ4A 1UTAA 1IJFB 2ZUGA 2YKPA 2P9PA 3K8VA 4RBVA 1S6QA 3HPHA 3NXZA 2QRRA 4ED5A 4X4OA 5C2FA 3KTQA 2HVDA 1V4SA 1HI1A 4WTYA 4XPEA 4F4KA 4KI6A 2OFGX 3QIPB 2MQ8A 1QLNA 1UMJA 3RBZA 3H5SA 3QSYB 1RAGB 3CJ9A 1IBKF 4YUDA 2Z2ZA 5J2NB 4JI2K 1WC3A 3O9SA 4K4SA 4YDXA 4RL1A 1JLCB 4B02A 1SV5A 1WBBA 5DLGA 1Z1ZA 3TAQA 4P2FA 1LCUA 1R31A 1VJQA 5DG7A 2IJNA 2ZHBA 5AQMA 4DTJA 2B9EA 1JXVA 4WK3A 1P6TA 3V9ZA 3WIVA 4MYUA 2EK1A 3TUZC 4FWLA 2Y1JA 1UA1A 3CCVN 5HJYA 4B8AB 2VU5A 1OY9A 2O3DA 4DUTA 2MQQA 1N34F 3GR1A 4HL9A 4LFCJ 2QG9B 3C6UA 4DKWA 4KGXB 1SKUB 1XHZA 3TAGA 3MEGA 3CCJN 2D0PA 1YJNN 4I7FB 3MPDA 4DLGA 5DDOC 3MMBA 2EW9A 3SQGB 2FJDB 1IM6A 2ROGA 5M1FA 4MT1A 2R2RA 4HR2A 2GFFA 1I51B 2J9CA 2RKIA 4ZIWA 2JEFA 2IOCA 5B7WA 3EPIA 3H2VE 3U3YA 2AGPA 4ANEA 2WBRA 3L4IA 2DY4A 4DQQA 3CD0A 3MM8B 1XQSC 2F8TA 2VGMA 9ATCB 2N82B 3BYRA 2HHUA 3BY5A 3WNHA 4DFKA 4P73A 2GV1A 1BHNA 1RGIA 1VSJA 4HYKA 1HKAA 2DTUA 4OX6A 1P27B 2YH0A 2PYLA 3CCES 3PR4A 5LY3A 3SAGA 2LQ5A 4EK2A 5FLXU 2WW4A 2MHEA 3M1VB 2CGLA 4DV4F 1EQMA 2Z0GA 4Z4GA 2IYIA 2BH1A 5E84A 1LFPA 3KJVA 1U6FA 1RAFB 5L39A 4TY9A 1A5XA 3K59A 4ZVQB 3MXIA 2G1DA 2CVIA 1TZ0A 4NOHA 1X0FA 1A6LA 3H90A 3Q8QB 2LDIA 1QZ5A 2RRBA 2JLFA 4HACA 1KVIA 2UZAA 5CCLA 3NKYA 3UI3A 2P9EA 3CFPA 4M3UA 1DRZA 4K4TA 3ISZA 1KTQA 1AA1B 1LV5A 1U1RA 2VFTA 4JKHA 4BREA 1JKHB 3F41A 3VQBA 4WQ5A 3NAEA 4OJHA 1X4AA 2OMLA 4BCAA 3IGNA 1LWCA 4AM6A 1T95A 4FBTA 2XG8A 4GKKF 5AQQA 3V9WA 3MI7X 1S5JA 1T3NA 4HTLA 2JOQA 5KFXA 3W3DA 3KD5E 1ASWA 3BGRA 2U2FA 2D7SA 5D0GA 4ZVFA 3LGMA 5DG9A 3AA5X 4DZ6A 1T9YA 2D0CA 2CZ4A 3TR8A 4A8XA 3M8ZA 1VSLA 4Q43A 2ACMA 2WZ1A 2NXEA 4KHPJ 1SXLA 5J1PA 4URGA 4J9SA 3JSMA 2OI2A 3QETA 1RDCA 2PYJA 2DK2A 2HIQA 4DQ8A 3D66A 4WFNQ 1VBZA 1U49A 3X3UA 4KI4A 4FF1A 2W2QP 4FK2A 1S5ZA 4CLTA 1DGKN 2I7PA 3ZZ0A 2W41A 2XY7A 1GMWA 4PL8A 1ZBSA 5AQGA 4NLPA 1GLLO 2Z2LA 3D6FB 3PEHA 3QIPA 1VCTA 1EX4A 1BU6O 2DYAA 4DV3K 1HR0F 2QGFB 2MKJA 4OPAA 4I64A 3O3FA 1OO0B 1HD0A 4X62K 2KRBA 1PAEX 3H46O 4XEIA 1RA6A 3NDKA 1XJWB 3G4SN 4LSZB 3MF5A 2LU1A 1SH2A 1Y97A 4DMNA 5T41A 1ILYA 2CPHA 1RBVA 1J5EF 2UUBF 8RUCA 4OPKA 4DR1F 3MM9B 5C2CA 1JL1A 3HI0A 2YI1A 2X3GA 4ZVEA 2JWNA 2NZCA 1N32J 4UQGA 3OSNA 2C2EA 4WXOA 2JSXA 2ZQBA 5AE3A 2DFEA 4KGVB 1KXPA 2RQCA 3KG1A 1VQON 1A0OB 3QO9A 3AA9A 2GVDB 5IT0A 4CJ7A 2ZOGA 3VQ6A 5KAKA 2YCHA 1MG7A 1RT1B 1M5OC 1VJWA 2QWNA 2K2PA 4CEOA 3GDQA 4B3RJ 3NMUA 5HROB 2DEJA 3P5JA 1KHVA 3AJDA 3OTDA 5E26A 3QRQA 3AAWB 5LSRA 1LK5A 4R25A 1U1NA 2F8SA 3NS5A 4CT9A 1WEXA 4YOVA 1YIJS 4CJTA 4RW4B 5RUBA 2LA6A 4AYBD 4F3TA 3S41A 1BWEA 3PRBA 4AFFA 5KGWA 4ZPTR 2F8MA 3EE8A 3KKRA 1WC1A 3K58A 4RZRA 4GVBB 5AQRA 3KLHB 1OH5A 2D3ZA 5K8MA 1FW6A 3FZKA 3BREA 1KQFB 2XS5A 4NI2B 1Y0HA 3D5MA 2HVZA 1GMUA 4J9QA 4HLBA 2GMHA 1BQNB 4JV0A 1EP4A 5EXWA 4PQUA 2C2OB 4FWOA 2N7CA 2LQ8A 5HMZA 2DHSA 3M8PA 1BY9A 2GHPA 2VFVA 3BEXA 4CLSA 2ZJPQ 4FWPA 2J0XA 5DMRA 3EUNA 3G6ES 1T7PA 4EMDA 3DAWA 1RSCA 2L48A 3MN7A 3KLEA 4YOTA 2Q0RA 4A59A 4AL5A 3EPGA 1JKHA 2XLIA 1Z2LA 4WFAL 3OBIA 3D0HE 4E98A 4CFBA 3V1QA 4XH5A 2FJAB 2HHTA 5JLHA 1LW0B 3DLBA 3HHLC 3BQ1A 3I9ZA 1NM2A 2BW7A 5KT5A 4BRNA 1V9OA 2E44A 5KTQA 3SEOA 1QQCA 2MKHA 5HATA 4BE0A 2V69A 3VQ5A 3CXCR 1T11A 5AXLA 2VOOA 1S10A 1Y9OA 1LWEB 3SCKE 3A5LC 1RI7A 3MCAB 3ID8A 1RXOB 4HT5A 1AW0A 4DV3F 2E5LF 3CCLS 4DR2K 1G7CB 1N36F 4LFAF 1PBAA 1SI9A 2JZ5A 2HHQA 3DRYA 4USJC 2J9EA 3FK4A 2AX1A 1YJ9S 4H4OB 1XBWA 5BR8K 4FLYA 1DQ9A 4UZBA 4Z7CA 4DQSA 1NHKL 2H4YB 1TL1B 5F41A 4IQMA 2FVRA 1IQTA 2BYCA 3TSUA 4MYTA 2CPEA 1DTQB 5J2PA 2GX8A 3IXQA 1UZHA 1BGXT 1NK6A 3V9XA 2RAQA 4MTPA 3W5ZA 2XGQA 2IM0A 4Z7YA 1PGZA 4F3OA 2YX6A 1AFJA 1B4SA 4GO7X 1XNQK 3TA1A 4TYAA 4JKDA 2DGSA 3LW5C 1HNXJ 3G71N 2HGLA 1JJ4A 1FRHA 4NLTA 3THXA 3PUFA 5IXUA 5E0OA 4IFVB 2Q2RA 3KK1A 4BGAA 4PKDB 1XNRF 4FSVA 5EX3A 3PO4A 1Q4RA 1YI2N 1I94J 2VG6B 4CJ4A 2NXNA 2HBYB 2JEIA 2NPFA 1EO1A 2R8JA 4ZLJA 5B0GA 3I8DA 2B9WA 5DO2A 3DLHA 2ZJRL 1RU2A 1RKIA 1IBMK 3RWUA 2HNDA 3A3NB 2PFUA 2B5JB 4DPWA 5I42A 3A4TA 4PKIA 4OYBA 2CQ4A 2HBZB 3WEEB 3ASMA 2EFGA 2GVDA 1DQ8A 3NCQA 4CI6A 2HQCA 1V6HA 5IOLA 3EXCX 1A5VA 1RT1A 4O44A 2HMPA 3TVKA 4LF8K 4M5HA 5E7OB 4MJKA 2FBVA 1HHSA 4PWDA 3NRBA 3SQ2A 1F60B 4BG8A 5AJ3J 2A10A 4DU8A 3OS0A 2P9NB 3BPDA 3BDPA 1VI7A 2JC1A 5EHHA 3THTA 2DGQA 2DIUA 4AILC 3QEVA 3HM8A 2XB2D 2MZRA 2GQQA 1WG4A 2YNIA 1RABB 2PDAA 1NK5A 4P71A 2QYGA 4X4QA 2RD5C 2ZD1B 1U2FA 3IKMA 4LFBF 2J0WA 3N4QA 4PXCA 1NPPA 2MJUA 2DO4A 4GVBA 3TAPA 4L8RB 2VD3A 2E4LA 4KRWA 4NI2A 3ZSWA 3MCOA 1KTVA 1YBUA 1BWFO 4I6WA 3MUTP 2E2PA 3VQ7A 1RJJA 3H4DA 2NUHA 4H5NA 4BR9A 2CQGA 2YWGA 4DR2F 4Q2LA 2RUSA 4MKYA 2E88A 1N4LA 1X0PA 1Q86O 2F40A 2HZVA 3QNNA 3RG6A 2LECA 5BR8F 3NCRA 5KFYA 2HAFA 4Z2XA 2DY9A 3AOAA 3M9MB 4WQ4C 2WOMA 2DPIA 5JS2A 1ASUA 1O1WA 2RDIA 3CCUS 1PCAA 2L08A 5F2RA 4IO9Q 3VGUA 4NLGA 1YRUA 3LGHA 4DSLA 3QGPA 3KJFB 4JI7J 4UQTA 4IRKA 4ENOA 1RTIA 1NB2A 2VL1A 1LWEA 4EIAA 2VQEK 2XY8A 3E9LA 5EOYA 4G1PA 1V4TA 4FW2A 3WZ0A 4FM1A 1X4FA 3S6EA 4DLEA 3TTCA 1U6BA 2IVPA 4H4OA 3SSSA 4HHTA 4KH6A 2KYZA 3HPGA 2OPRB 3OS2A 4E7KA 3CD6S 3V9UA 4HCCA 4DU3A 1IBMF 1JLFA 3ZZRA 1U1QA 1TK5A 1KC8T 2LVWA 5AQWA 5FLXO 4QR1A 3DM2A 3J7YP 4GRSA 2IDOA 3L7UA 3LP2B 4LH4A 1UWBB 2XSJB 1O51A 2LCWA 1QE1A 4HKQA 4JK7A 2ZBRA 2EKYA 4NMLA 4YOXA 2IVOA 4YOUA 3O4QA 3SBGA 4IFVA 2V4RA 1T9VA 3QFPA 4L3KA 1VRQC 1X5PA 5KFKA 1IUJA 4RWWA 2VG6A 1GH8A 2FBYA 1TKTB 4X4RA 2VONA 3UR3C 3DU6A 4X64F 3D6MB 1VBXA 3R5GA 4CW7B 3CETA 2VKRA 4KREA 4QYZK 4H5RA 2H3EB 1T3VA 3L95X 5IC4B 5IWAF 3RBEA 3O9TA 3BYPA 4USWA 2ATCB 1L3TA 3VGMA 4X66J 5KFRA 2QIFA 3EKUA 1VRTB 4I6MA 3FUYA 4BLGA 4Z0UA 2RSQA 3M2RB 4YOWA 4C3LA 2D0AA 3C46A 4CO3A 3TAFA 4RU2A 3I4PA 4CI0B 3KIOA 3DC2A 1TELA 2G8IA 2MZ1A 2P9NA 3SFGA 4UY8T 3JAMO 3QYYA 2G8WA 1TMJA 5G0RB 2AKWB 2Q31A 3B4MA 2MYFA 1IG8A 5M1NA 4B17A 1VSMA 3AA4A 4JI3F 2MQLA 1SKWA 5CABA 2WVEA 4JS5A 2AU0A 4WQ5C 2KT5A 3MR6A 1M0SA 3D0PA 4C23A 1WN7A 3PW5A 3CWJA 1TAQA 3CC7S 2AMCB 1DEJA 2FZCB 4JYAK 4RW6B 3OYKA 5M2RA 4WTOB 3B4DA 4W98A 1ZTWA 4JI6J 1WG1A 4Q8FA 3GZ7A 1C0TB 3DLKB 3WBZA 3KJQB 2G13A 1XMOK 5IC6B 1NCLA 1JJ2M 5DRKA 1V5IB 1FESA 1HMVB 4Y34A 4C8YA 3JS9A 1KR4A 4LRBA 1MLAA 3DOLA 1XC3A 3W2VB 1RT7A 1Z4UA 2LQJA 2CUYA 5GAEU 1Q8LA 4KH4A 4BRHA 4CZMA 1JLGB 4KYZA 1ZZNA 4RW9A 1X9SA 1U0HA 3OXFA 2PY5A 2Y8YA 3ZT3A 4KE5A 4A46A 3QGIA 3MGJA 1G4CA 3DYAB 1XR6A 3Q2SC 4EZ9A 3HKWA 3AXKA 3O80A 2XM3A 3VWSA 1BMQB 2H4WB 4WXWA 2RB7A 1MN9A 3FEZA 3I0SA 1TU0B 3VETA 2LDYA 2YHYA 1KVAA 2CPXA 3Q0AA 3RB4A 2OPRA 1V3SA 3Q8RB 5D3GB 5GADI 4WPAA 2CPDA 3HKZD 4AHSA 4DXLA 3HSGA 1GOBA 1TUYA 2B4PA 2QTDA 3TQ1A 3LP2A 1UWBA 2XSJA 4JI4J 2AEJA 4IR1A 3HHEA 4B1UB 4LC9B 1U47A 2FHMA 1CZBA 3SPYA 1IR0A 1FDNA 1PC5A 1IBLJ 2GTDA 3TP2A 3HZEA 2HBQB 4B1ZA 2A6AA 1F9FA 7AT1B 1DBDA 2KHOA 1HQUB 1XC9A 3R9LA 4Y2MA 1GTEA 2WSFC 1NGFA 2CPFA 2GO8A 1BCOA 3KG4A 4CJFA 3LPUA 3CC4N 3THWA 2G9OA 5KG5A 1NDCA 4BDPA 1TKTA 4BRMA 1FF2A 3OYGA 3E2EA 4OZ0A 2J9DE 4BRCA 1H2TZ 4BVOA 5HJXA 3IFEA 1HBMA 1YGYA 4YHHK 4NCGB 5KG4A 4XO0A 3UKUB 1TKZB 4DL5A 3M30B 4F36A 5L9NA 2R3VA 2EHGA 2QMXA 2DR9A 3GFZA 2EFPA 1TP7A 1U25A 3LM2A 2GZOA 2IMWP 1N8RO 4P9SA 5FDLB 1J27A 4IRCA 2ADCA 3ZETB 5ITHA 1QAIA 5F8GA 5KOXA 1XERA 1IM4A 1LK7A 2HK2A 3M2RA 1YDLA 5BJRA 2E8AA 3AO4A 1RU1A 4DR4F 3D28A 2I5JB 1ESVA 2BUPA 2H48B 2NSCA 4KHYA 3BF1A 1JLAB 4CLFA 4K50A 3KLIB 4EWTA 1ZBTA 2FIUA 2X51A 4OZ2A 2F5GA 4HHUA 4MO5A 4CZKA 4YN3B 3WXIA 4KR0B 4DV2J 2XBPA 5EX5A 1S3XA 1FXXA 2XMUA 1NJWA 4E89A 5KFCA 3MURP 3QEWA 3ENHA 1T02A 1NPKA 1CPZA 3GL1A 2AQ4A 4BE1A 3QWPA 4QR2A 1S97A 3RB0A 2F9JA 1H0HB 3S3MA 5KFPA 1QY7A 2H9ZA 1SQFA 1D9DA 3FZLA 1B64A 3QSIA 4M3RA 3MPWA 4IOXA 3CB4A 4NLRA 2DHGA 4RW6A 5MLCV 3TEHB 3R5JB 4N77A 3NF7A 3Q8PB 1PJ5A 1MROA 3CO0P 1HNIA 4WFNL 2EWSA 2XYGB 3DLKA 1J6ZA 3M3ZA 2VDHA 1YT3A 4Q7AA 3NNAA 1RWPB 4HCBA 2FJVA 2IA6A 1RILA 3W2VA 2ZWHA 4KHWA 1VC0A 2FXUA 1IV0A 2O8EB 2KH9A 1U2CA 3B8AX 4JOUA 2V8PA 3IUCA 1JLGA 2E2NA 3ISNC 4DDFA 4NEYA 3CW2C 2VBYA 4O8KA 2ZOFA 3IAM9 2ZH6A 3MMJA 1WC5A 4Z4HA 4M94A 3G6YA 3AVLA 4PABA 3OYEA 2O4GA 2DXEA 3C94A 2ZH8A 2CQPA 4FJJA 2VG5B 4ZHRA 4U7UD 1J53A 4JKAA 2LXIA 3KWGA 3W9HA 4FWMA 5DETA 1UJ6A 4J9VA 5ETPA 4CHOA 3M6WA 3VA0A 4B3TK 2VJUA 2D4WA 3O3GA 5C25B 5KFDA 3ET6B 3NAIA 3HP6A 2LP4A 1N34J 4JAXA 4BR5A 3NGIA 2KT2A 3H8YA 1RCXB 1GNKA 4B3OB 1NSQA 4YHHF 1TTHB 3SCXA 3BO2A 4ID1A 1FWKA 3M6XA 4DN0A 1BLUA 1JLEB 2W7OA 3E8OA 4N76A 1YUWA 1C0FA 4IFYB 1BUXA 2BQUA 2XQCA 4K0KJ 2GIFA 1T94A 4NLBA 3R1XA 5KPTA 2VF3A 5CY4A 1FRJA 2AYEA 2B4UA 2XULA 5E3QA 5EDWA 4DV5J 3DOMA 5KT3A 1Q9XA 1U8WA 4JI8F 4DV1J 3C6HA 2ZHAA 4CDIA 1OY8A 2NZTA 5KFOA 1YTYA 4TNOA 4NLWA 4FF3A 1GQEA 2R42A 1C4AA 2X7IA 3D4JA 5BPLA 4NXNF 1IH7A 4B8CA 3AFGA 3KHRA 3GPAA 4NCGA 4P6QA 2O8BB 2HIYA 2UXCK 4DS4A 4WU2A 4OX7A 3SNNA 1NGCA 3UKUA 1TKZA 4DV4J 3M30A 2UXDF 5ELZA 2MLXA 1YVUA 3OV7A 1U1MA 1GLFO 3R8YA 1CJTA 2NPIA 3OLBA 4CF9A 3ULDA 4A57A 3O9RA 3ZETA 3DLRA 2U1AA 2LQ9A 2VPWB 4QR0A 3UNYA 3OSPA 2AX0A 1YRTA 4A8WA 2BOPA 3VEVA 4CLPA 2BKNA 1YVNA 1MDUB 2IFXA 4D3HA 2EI5A 3EKSA 4CGHA 3DOKB 3P1GA 3ZTRA 2PA8D 1S1VB 4YB5A 3LWLA 3FQKA 3SBTA 2R2TA 3C95A 3U27A 2WBNA 3E01B 3J81Y 2ZFHA 2XMKA 4JK8A 1RWNB 3U6FA 4K41A 4GKKJ 4USHA 4RW7B 4WFXA 2FHOB 3L3CA 2MSTA 2DJWA 3ZSVA 4YB7A 1YJ7A 3QT8A 3IAS9 4DR5K 4DHVA 3C6AA 4A2BA 3MDFA 2YKAA 1RKJA 3B6BA 1GLDG 2QWMA 3OHRA 4DN9A 5HBMA 4ZOSA 1R8CA 4LF1A 3CD7A 1TK8A 3I55N 3DMJB 4KJIA 3IR7B 3TA0A 4BC7A 3IWXA 4BQLA 1FD8A 4CK1A 3LZIA 1WKLA 3BKUA 5KFHA 2RU9A 3UVJB 2RS2A 2BE2B 1S9GA 5HK4A 2V7ZA 5KG0A 1XR5A 4KGMA 4LRCA 3OYCA 4ZVGA 5K9FA 1Q79A 3SXLA 5LJ5Y 4NZ6A 1SL1A 3UN3A 2MZTA 2B9XA 1KC8O 4FYWB 1X4BA 4ZCLA 4M5IA 3F0NA 4A61A 2O8EA 3QGHA 3UDLA 3MUMP 2COLA 5KFBA 5HVFA 4RG8A 4KGKA 2GW8A 1X9WA 4LF5K 1RBAA 2J7UA 5LSLA 2WW8A 1NHUA 1U0SA 2OD4A 3KG0A 1RAEB 3K17A 1OH6A 3M05A 1O5JA 1R89A 1BQMB 2H1YA 1Y4ZB 2VG5A 1FE0A 3M32A 1UEUA 3IN5A 1PC4A 4QPXA 2ITGA 3R7SB 4USTA 2UUBJ 3V4IB 4E7IA 4FJGA 1X4GA 4DR1J 3LP1B 4A62A 3C14B 2ALYB 1RAAB 3G6EN 3GWCA 2EBGA 4G6VB 3A5OC 3ET6A 4CNZA 1BC6A 4BR4A 5A2QY 5HQLA 2VKZG 2IIHA 1F6TA 4B3OA 3OVAA 2YNHB 2BJ9A 2UXCF 3NF9A 4BRFA 2KQ2A 2BRKA 3I33A 1F1BB 1Y5LB 4CWBA 3CMAS 2PBDA 1HPZB 3Q83A 2BRLA 3GFYA 4P75A 4RO0A 3RBXA 4IFYA 1WUUA 1ZYQA 1KQSM 1WEZA 2ASOA 2H5IB 4NXMF 5C0YA 2OHDA 2CQ1A 4FWQA 3BQ0A 1IXKA 5D0HA 4LRDA 5BYSA 3L2RA 2GWJA 3V6DB 3SCJE 4UY8O 3CCLN 2JRSA 4JEPA 3TVYA 4R0JA 4WZQA 3PW7A 2MQMA 3HL8A 1U6ZA 1YJ9N 4CBXA 3CC2S 1LWFB 4ED0A 1BD6A 4C8OA 4I2QA 4P7VA 1Q81O 1NSPA 3ZT2A 2VPYB 4CBUA 1BI4A 1K0VA 2W9CA 1BIZA 3NGZA 1TV6B 4NE9C 3RSEA 4DR5F 1CG2A 3CPEA 2I8EA 3KUEA 2IBOA 3K0JA 3VA3A 3L2WA 1BWVA 1WWHA 3FCHA 5ETSA 3GE9A 4DOZA 1N6QA 4LY7A 1EWQA 1ZA1B 2V9KA 4ZS6A 5F8HA 2PA3A 4FZYA 2E9TA 1JJHA 3ETOA 4LREA 1HJOA 3TOQA 1KOHA 1YJUA 4DX7A 4PXDA 4AL6A 1WNEA 3U7JA 1S1VA 2XNQA 1X3MA 3NOCA 2V51B 2AWZA 1SC1B 3E01A 2OMOA 2P9SA 4CZGA 2AJQA 1GXUA 4TKTA 4R5PB 1YITN 1Z2ZA 2IM3A 2XRIA 4J2AA 4RW7A 4YR2A 4NYOA 3GOIA 1VSEA 3BF4A 4IO9L 3ZSZA 3OR2B 2GIRA 1KN6A 4JKFA 1S48A 2GQCA 4DR3K 4J7CA 3RYLA 1FTRA 3NL0A 5DM6Q 3C66A 3QICA 2RDJA 4DV3J 5LT5A 2E5LJ 3K2PA 3QBCA 1X1PA 3OYBA 3DN9A 2X1GA 6FDRA 1RWWB 4DFJA 4X62J 1N88A 3LDPA 2LKZA 1R59O 2J0QD 4DR7F 1CXQA 1CJKA 2NYIA 4JV5K 3UVJA 3FLCO 2ZZNA 2LQBA 3HVAA 4HVZA 2D9PA 3W0LA 3NGYA 3G25A 5C15A 5A8KA 3TX8A 3T6BA 4FVUA 1F5BA 1MMNA 3IRWP 1D4XA 2GWKA 2ZC