4CGHA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cghA00
2A1RA 3K58A 3WNGA 1GOAA 5HRSA 1G15A 3P1GA 3SQ1A 5HLFA 1UOCA 3AO5A 1D8YA 4KRFA 2KZZA 4IDKA 4O4GA 4CJPA 1ZBUA 1JLAA 3SUOA 1O1WA 1C1BA 1FKPA 3B6OA 3VA3A 1SL0A 3JSMA 1ZBHA 4F4KA 5FROA 1BI4A 2E6MA 3OVNA 3WNEA 5J2NA 4FM1A 4DF8A 3NF6A 2W42A 3TANA 1L5UA 4IBNA 4UQGA 2F8TA 3VQQA 5KGXA 3SPZA 3U3GA 3KLFA 2VG6A 4B8CA 4PA1A 4CESA 4E19A 4M41A 1JLEA 4FK2A 2HHTA 4XIUA 3L2QA 3RMDA 4BDZA 3AO2A 1SKRA 3LALA 1WAJA 1RT1A 1L3SA 4FW2A 2QKBA 4CF0A 2EHGA 2LSNA 4I7FA 4W5QA 2YV0X 1QE1A 3CFPA 1VSFA 3HT3A 3CYMA 4IG3A 4KTQA 3F73A 2KFNA 1Q9YA 3LAMA 1TAUA 3TAMA 4FW1A 3VQ4A 3RTVA 3L3UA 3MXMA 3A2FA 3ZSQA 3ULDA 4DQIA 3PX6A 2OPQA 4DG1A 4E7IA 1HYZA 1EX4A 1N5YA 1S1TA 4FJLA 5D3GA 3DLEA 2HHSA 2G8WA 4RG8A 3AVGA 3SJJA 4E7JA 3QETA 4CJ3A 3OJSA 3AVKA 1WSEA 5J1EA 1HPZA 2RKIA 3QINA 3L2RA 1S1UA 4NCGA 2PZSA 3DYAA 1A5VA 4FLYA 4AHRA 4RW8A 4N5SA 3UIQA 3PO4A 3DM2A 2FBYA 5HRRA 2JLEA 1RILA 4DTPA 4F2SA 3D0PA 4AHTA 3LPTA 1K6YA 3LP3A 1TAQA 3SYZA 4FLTA 3OYDA 3DOLA 4O0IA 1WSHA 1S5JA 4Z4IA 2VG5A 4M3YA 3SV4A 3RR7A 3PV8A 4I9LA 5KI6A 4CGFA 4BWMA 1CZ9A 1NOZA 4EP5A 2D5RA 3NGYA 4E7KA 4L8RB 4OVLA 3NGZA 4K8XA 3VQ5A 2X6NA 4M45A 1VSEA 1CXQA 1TVRA 1X1PA 3KK1A 2AJQA 4YFUA 3DLRA 4KPYA 3F9KA 1QSYA 1KTQA 3DLGA 4DFJA 4B9TA 3EY1A 3LZJA 3AA2A 3S3NA 4ICLA 2Z1HA 2G8HA 1SKSA 1EXQA 1KLMA 1RTJA 1C0TA 3ASMA 3EYZA 3V9XA 1NK4A 4FJMA 2PYJA 1RT2A 3CM5A 3DOKA 3V1RA 2OPSA 4PUOA 4FJ5A 5C25A 4FCYA 4DTSA 3DRPA 4DTNA 2Y1JA 1JLQA 3RWUA 1NKBA 1S6PA 3K5MA 3T19A 3L2VA 4KREA 3OJUA 4DTMA 3MXIA 3NH1A 1X9SA 1NKEA 3TAPA 4OGCA 1ITGA 4CJ4A 2P5GA 4ID5A 1L3VA 4C8NA 4FJHA 1XHZA 3K5LA 2IGIA 4CF1A 2WONA 3OYKA 3NGIA 1NJWA 2XY6A 4DSJA 1WSFA 4KHWA 4HUGA 1XHXA 1EETA 1S1WA 3C6TA 4CHYA 3OS1A 3HSTB 1VSLA 2KQ2A 1J54A 3I0SA 3VA0A 4FXDA 4BE1A 3QLHA 4Z4CA 1FXXA 1ZYQA 4DU1A 3V9UA 4QCLA 2D0CA 3AVBA 3AVNA 4CJRA 4EZ9A 3HPGA 1NJXA 4Z0UA 3VQ9A 3KLGA 1U4BA 4H8KA 4BE2A 4CE9A 2F96A 3QEVA 4OKJA 3H08A 4I2QA 1TK8A 4CJLA 5KTQA 2P5OA 1SV5A 4TSXA 4CGGA 1T03A 4IG0A 1KLNA 1L3UA 1SL1A 4N76A 4KO0A 1YVUA 4CGHA 3IS9A 4O55A 1NK0A 3LP0A 5J2MA 5SZTA 5T7BA 3AO4A 4FLZA 1NK5A 4EZ6A 3AVLA 4J2DA 2IS3A 1HMVA 3OYBA 3QEPA 4AHCA 4WE1A 3V9ZA 3HO1A 3AO1A 4ID1A 1TKDA 1IKYA 1HRHA 1VSDA 1WAFA 4HUFA 3QESA 4JRPA 1JLCA 1WLJA 4CJFA 3HVRA 3C6UA 3K2PA 4AHUA 4FLUA 1HYVA 4DMNA 3HP6A 4NYNA 4FM2A 1LAVA 3I8DA 1S1XA 3SQ0A 4CFCA 2DFEA 3IAYA 3T1AA 3TWHA 2OZMA 3OYAA 4E3SA 3VQ6A 4IFVA 4CK1A 3PO5A 4E7HA 1BHLA 1JL1A 3MXJA 1RT4A 1L3TA 2DFHA 3PX0A 1N6QA 3ITHA 1TK5A 4FJJA 1TL1A 4FLWA 2RN2A 3QEXA 1KFDA 3QNNA 1D9FA 3KKRA 4GMJB 4CJUA 4KHQA 4I9QA 3NFAA 1SKWA 3AVJA 4IKFA 2D0AA 2YHAA 4BDPA 4DTXA 1RT3A 3NAEA 3QNOA 4CERA 2IC3A 3QIPA 1I3AA 3K5OA 5CYMA 4B08A 1D5AA 4E89A 4O0JA 2R7YA 1Q9XA 4B9LA 4DLGA 4DQPA 3CQ8A 1SL2A 3RMBA 3DLBA 4E0DA 4CHNA 4DSEA 2XY8A 4FVMA 3O3FA 3MEEA 4DU3A 3OYCA 3SZ2A 1IG9A 1JKHA 1RCHA 2HNDA 4JLHA 1DTQA 4NYFA 1KFSA 3AVHA 3KIOA 4OKEA 1QTMA 1C0MA 5EU7A 2XRIA 1C1CA 1CZBA 1XI1A 3OS0A 2YHBA 4CGJA 1I39A 3HXMA 3I0RA 3TAFA 2QXFA 5K14A 2OA8A 3C94A 3IG1A 2VG7A 3DRSA 3QO9A 4CEAA 3RRHA 1D9DA 3AVMA 4FJNA 3OYGA 3DRRA 3BGRA 4CJTA 3AO3A 2HMIA 5HP1A 2B4JA 3WNHA 3LP2A 1S6QA 2FBVA 3LZIA 1ZBFA 3VQEA 1SUQA 4RW7A 1B9FA 2G8VA 4F3OA 3AA3A 4Q0BA 4FYDA 4M3TA 4YNQA 3HP9A 1IKXA 2XY7A 2E4LA 3O4QA 4DSKA 4KKOA 3WNFA 3U3YA 1X9MA 1IH7A 1QS4A 3V9SA 2HNZA 3ZSRA 1T05A 3ZSZA 4FZXC 2X78A 3OYNA 3SUQA 4JRQA 1RBSA 3K59A 1B9DA 3SNNA 4CIFA 4Z4GA 4PQUA 4B3OA 3DLKA 4H4MA 4CJVA 3TARA 4DS5A 2D0BA 1EKEA 1S9GA 3OYEA 3OY9A 4O5BA 1NJYA 2KW4A 4HVJA 3KK3A 3U6FA 3O4NA 1LWEA 4E1NA 3MEGA 2XHBA 3AVAA 2KZMA 5HROA 5HRPA 4CF2A 2YKNA 4AH9A 5KGWA 2QKKA 3L8BA 5I3UA 3NF8A 1T8EA 3D45A 3AA4A 3OYLA 3SQ4A 2HVHA 3KJVA 1HNVA 4R5PA 3K57A 1GOBA 5CYQA 2Y1IA 1IKWA 1KVCA 2KTQA 3ZSVA 1ASWA 1QHTA 2ATQA 3VQBA 3ZCMA 1HJRA 4E1MA 4HHTA 3AVFA 5J2QA 2BDPA 3AV9A 2FBXA 4Z4EA 1RT5A 4CHPA 4W5RA 4ZHRA 2DTUA 4CECA 3KLHA 4FJ8A 1S9EA 3V4IA 2Q3SA 4KHSA 1NOYA 2E6LA 2GUIA 3NF9A 4CJKA 4CHQA 4B8AB 2PY5A 1U04A 4E7LA 4CEBA 4Z4FA 4Y1CA 3MECA 3NBPA 4KV8A 3QEIA 3LAKA 3TI0A 5JS2A 3NF7A 3ZSYA 4FJIA 5FRNA 3KKSA 4BACA 4FK0A 1B92A 1TGOA 2DY4A 4CEZA 3VQ7A 3OYMA 4DFPA 3V1QA 1LWCA 4LH5A 1BIUA 1F21A 1VSJA 3M8SA 4M42A 2FBTA 4CJ5A 4RW9A 1W9HA 4AHVA 4LSLA 2YNGA 4OPJA 4RW4A 1Q8IA 4M3RA 3OYFA 1QSSA 4B9UA 4B9SA 3CFRA 2YNHA 5KRSA 3ZSWA 4DQRA 1ASVA 1VSIA 1S1VA 4LY7A 3LP1A 3ZT3A 2RPIA 2RF2A 2O4IA 4DWIA 3HPOA 1KCFA 1RTIA 3VQDA 3M8RA 1WN7A 1LV5A 5JS1A 3VQAA 4CK3A 5C42A 1DTTA 1RT6A 1EP4A 3DMJA 4HCBA 4KHNA 2BANA 1FKOA 2ITGA 1ZBLA 3T3FA 2WOMA 4B9MA 3C95A 4DLEA 3SQ2A 1BIZA 1C6VA 4FJGA 5C24A 1FK9A 1VRUA 4JS5A 1X9WA 2IDOA 3G0ZA 5CZ2A 4CEFA 4ELUA 4W5NA 3KK2A 1NK7A 1LW0A 3ISNC 1JLGA 1VSMA 3B6PA 4GVMA 3NHGA 4CGIA 1RDAA 2G8KA 3PY8A 3AA5X 4LD0A 4OJRA 4CK2A 1VRTA 4ZTJA 3HYFA 3AVIA 4OKKA 4C8KA 4RW6A 4DSFA 4FLVA 3ZT0A 3TAEA 1BISA 4C8LA 1YT3A 2HHQA 2G8IA 4J2EA 4OLBA 3RMCA 1Z26A 5CY4A 3QEWA 2QK9A 1BQNA 4AHSA 1RDDA 2HHVA 3S3MA 1VSKA 1RBVA 4CJQA 1NK8A 4C8OA 2XY5A 3P83D 2OYQA 4Z4HA 4J2BA 5E41A 3SPYA 4IFYA 4DSIA 4FJ7A 1JL2A 2YNIA 4FM0A 2P51A 1BGXT 3S9HA 1KVAA 1YTUA 2IAJA 1UWBA 1CLQA 3S3OA 3MAQA 3SUNA 4KAZA 1BCMA 2B6AA 1UA1A 4DFKA 1ZBIA 1KRPA 1UAXA 1Z25A 3V6DA 1U47A 1RBUA 4DTRA 1CXUA 4BWJA 4CF9A 1WSJA 4N56A 3PUFA 1NKCA 3HVTA 1C1AA 2HB5A 3HPHA 4CJWA 2Z1JA 1RBRA 4DS4A 1DLOA 1VSHA 3KTQA 3CG7A 3OYJA 4PY5A 3KLIA 4C8MA 4ELVA 1XC9A 2F8SA 2VWKA 2HW3A 1IKVA 3M8QA 2B5JA 2IOCA 2X6SA 3ZT4A 4F3TA 2YNFA 4QAGA 1JLFA 2ZE2A 3LANA 1U48A 3ZSXA 1W0HA 4W5TA 5DK5A 3NCIA 2GV9A 2Z1IA 4W5OA 4AILC 4CIEA 2OPRA 4CFDA 3DI6A 4M3UA 3V1OA 4FJXA 1TL3A 4NCBA 2YKMA 5HBMA 4KTZA 4CFBA 4Q5VA 4FJKA 1BL3A 2OPPA 4B9NA 1RT7A 3ALYA 3AVCA 3ZSOA 1YTAA 4CFAA 4HUEA 4CGDA 1HQEA 3RRGA 5SWMA 5I42A 4BDYA 2G8FA 4FK4A 4H4OA 4MQ3A 3RR8A 3CM6A 4KTWA 3SUPA 3THVA 2KFZA 4DQQA 1T7PA 1GOCA 4K8ZA 2X74A 2A1SA 1WSIA 2HNYA 1RDCA 2NUBA 3MEDA 1J5OA 1RTDA 2G8UA 1WSGA 4KI4A 3NH0A 1NK9A 4KFBA 1BQMA 5FRMA 3CFOA 3EZ5A 4DU4A 4DTUA 2HHXA 1XWLA 2I5JA 5FDLA 1WNSA 4CEDA 3PX4A 2PYLA 3P5JA 4O44A 4DFMA 2P1JA 2ETJA 4I2PA 3VN5A 2Z1GA 4PWDA 4MFBA 4M3XA 3VQPA 1RBTA 1IO2A 4M3ZA 1LAWA 4CHZA 3NDKA 1TK0A 3E01A 4FLXA 4ELTA 1C0UA 3VQCA 3KLEA 2DFFA 4KI6A 3KD5E 3SCXA 1R0AA 4CF8A 3K5NA 1Y97A 4CJEA 1U45A 3G10A 1U49A 1TKZA 1JLBA 1KVBA 3L2WA 4FJ9A 4QOZB 1MU2A 4N47A 3V9WA 5DMRA 1NJZA 3V81A 4KHYA 1RDBA 2ZQBA 1TV6A 2GBZA 3LWLA 1LW2A 3RMAA 3TAGA 1HNIA 1TKXA 4CJSA 3BDPA 4CCHA 3TABA 1BCOA 1UA0A 1A5XA 4F8RA 3HL8A 4N41A 3LWMA 4OGEA 5CZ1A 3O3HA 3NE6A 4J2AA 3HJFA 3L3VA 3IRXA 3TR8A 1TKTA 4DSLA 3SI6A 4M3WA 3LDSA 1QQCA 3OS2A 4DTOA 4HCCA 3FFIA 4CHOA 4KB0A 2HHUA 3HK2A 4CEQA 1VK0A 4BE0A 4CIGA 3ZT2A 3VQ8A 5HRNA 4G1QA 3ZT1A 2O4GA 3QIOA 4FZYA 3OYIA 3L2UA 3TAQA 3KD1E 2HHWA 5J2PA 4KB1A 4CEEA 1QSLA 1A5WA 3M8PA 4ZTFA 4KHUA 2XO7A 2HVIA 1RTHA 4JS4A 2OZSA 4DQSA 1HYSA 3NH2A 4NCAA 4EP4A 4HTUA 3JYTA 2EX3A 1LWFA 3DLHA 3LPUA 4GW6A 1J9AA 4CEOA 3HM9A 1NK6A 4B9VA 4OPKA 1REVA 4DTJA 1ASUA 2VWJA 4LH4A 3OYHA 1KSPA 1J53A 1BI4B 1JXEA 3O3GA 4FZZA 4LSNA 1HQUA 2JGUA 5KRTA 2BGGA 4OLAA 4Y1DA 2FC0A 4F2RA 3SV3A 2BE2A 4DF4A 1RNHA 2ZD1A 1JXBA 3QERA
chains in the Genus database with same CATH superfamily
4DV5K 1G15A 1WBDA 4LC9B 1BO5O 2QM1A 4DR4K 4CJPA 4A62A 4DB3A 3HBTA 4F4KA 4LF5K 1BI4A 4JKEA 5KGXA 3U3GA 4B8CA 4FK2A 4PA1A 1S22A 1KC8O 2UXCK 3AO2A 4I6MA 1WAJA 3ZYYX 4CF0A 2LSNA 4I7FA 1LCUA 4KTQA 3F73A 1Q9YA 4YOTA 4FW1A 3J8AA 3L3UA 4DQIA 2OPQA 1EX4A 1GLBG 1S1TA 4FJLA 2HHSA 5FPEA 3AVGA 2PZSA 4DTRA 1HPZA 3QINA 3L2RA 2P9LB 1S1UA 5FPMA 3SMSA 2E1YA 4RW8A 3VMFB 4K0KK 1HKCA 5AQJA 4F2SA 3LPTA 3T1YK 3A5OC 3LP3A 1TAQA 3SYZA 4FLTA 4O0IA 4KH5A 4B1WB 2VG5A 4M3YA 3RR7A 3SJHA 4BRDA 5KI6A 4IO9L 3VEVA 3MK6A 4BWMA 3NGYA 3O9TA 3EL2A 5EY4A 2NRWA 3P4IA 5F1XA 2J4RA 2F4VK 1KTQA 1ATRA 3LZJA 4ICLA 3FZLA 4GVEA 1EXQA 4X64K 3CJAA 5LJWA 3EYZA 3O9UA 1RT2A 4PUOA 5C25A 1NKBA 3CMEN 4M7YA 3H6EA 3T19A 3OJUA 3MXIA 3Q7BA 4CJ4A 4B1ZA 2P5GA 4JEPA 3K5LA 1NGHA 4BG8A 4HUGA 3C6TA 1KQSM 4BRPA 2KQ2A 1BU6O 3IDHA 1P8ZA 4FXDA 4BE1A 3QLHA 1FXXA 5IT9O 3AVBA 3AVNA 4CJRA 4EZ9A 3HPGA 3VQ9A 3FZFA 2WC9A 2F96A 4OKJA 4I2QA 3NVMA 4CJLA 5C0YA 4MO4A 1T03A 4TSXA 1SL1A 3WXJA 1NJIO 4KO0A 3WQTA 1NK0A 5SZTA 3AO4A 5C12A 2QI2A 3THYA 4J2DA 2IS3A 4WE1A 3V9ZA 1TKDA 1HRHA 3VEOA 3WT0A 3W3DA 4CJFA 1WLJA 3HVRA 3C6UA 4AHUA 3LM2A 1LAVA 3LDLA 5AQVA 5AQWA 3T1AA 2OZMA 3OYAA 3CC2N 4IFVA 4LF7K 1VQNN 4E7HA 1L3TA 2DFHA 4B1VA 5BREA 3PX0A 1Q18A 3ITHA 2O8EA 1TL1A 4FO0A 3KKRA 4GMJB 4JI8K 3ATUA 3SK3A 3P38A 3NAEA 4CERA 1DT9A 1I3AA 4DUYK 4B9LA 3KZBA 4DLGA 4DQPA 2EWSA 4CZEA 1HX1A 4H0XB 2O8CA 2W41A 4IO8A 4JKFA 4JKBA 3H3NO 4JLHA 3VETA 3KIOA 4OKEA 1S72N 4CZMA 1CZBA 4JI7K 4CEAA 3DRRA 3BGRA 3UE5A 3LP2A 3LZIA 1T6DA 2G8VA 2NRTA 3O8MA 1GLJO 3ZSRA 3SBGA 3ZSZA 1T05A 4FZXC 3GG4A 3AAQA 1RBSA 3AARA 1B9DA 3K59A 4PQUA 3O80A 3DLKA 5GAHP 3TARA 3O5BA 1S9GA 3OYEA 3TTDA 1VQ9N 1Y64A 1NJYA 3TSQA 1NMNA 4HVJA 3KK3A 3U6FA 3O4NA 3FZMA 2RHKA 4B1XB 4EAHD 5HRPA 4CF2A 4UY8O 4CZKA 5KGWA 2QKKA 1OH7A 3NF8A 3KVGA 2ZGYA 2E5LK 3K57A 4O8UA 3VEXA 4CZIA 4E1MA 5J2QA 2FBXA 2OTJN 2DTUA 1QVFM 5AQOA 4B8AB 4AQYK 1U04A 4CEBA 3QEIA 5AQMA 3NF7A 3OA9A 4BACA 2Q97A 2QWRA 3OYMA 1F21A 1HKBA 4CJ5A 1W9HA 2CGKA 4AHVA 3WXKA 4M3RA 4B9UA 2ITMA 3ZSWA 1EO1A 2O8EB 5LL6Z 4IEEA 1Z6RA 3GOIA 3M8RA 1LV5A 2Q0UA 1RT6A 3CJCA 4HCBA 4KHNA 2ITGA 3T3FA 4H5RA 2V51B 2QXLA 3KWGA 1FK9A 5CZ2A 4BG9A 1LW0A 1VSMA 2G8KA 3AA5X 2E2PA 4IEIA 4BRHA 1VRTA 3RSEA 3HYFA 4ZTJA 3PSIA 4BR0A 4FLVA 3TAEA 2HHQA 2PAVA 4J2EA 3RMCA 5CY4A 4AHSA 2NRHA 3S3MA 1RBVA 4BRCA 1NK8A 2F7TA 4EFHA 1SAZA 2YCHA 3AGRA 1VQ7N 3VGKA 4OO1J 1NU0A 3VESA 4YHHK 5C15A 3D6RA 4JAXA 4DR3K 4NLCA 3M5RA 4ILGB 4JN4A 5BRFA 3KWIA 4CJWA 1DLOA 3QFPA 4AF1A 2HW3A 2VCPA 2IOCA 4JI5K 1QVGM 3Q7CA 4K25A 1GLEG 4QAGA 1U48A 4W5TA 2OPRA 4CFDA 3DI6A 4X66K 4Q5VA 4FJKA 4PL8A 1BA1A 3AVCA 3EKSA 4HUEA 2W6LA 1ZBSA 2E2OA 4FK4A 4H4OA 2KKZA 2KFZA 2V7ZA 1NNEA 4DQQA 2WTUA 4LFBK 2QTDA 2X74A 1K9MO 4DHYA 2A1SA 2NUBA 1WSGA 4DU4A 3MN6A 2HHXA 2I5JA 1WNSA 2GWJA 3GDQA 3O08A 4O44A 2O8BB 3ZEUA 5AQRA 4PWDA 4BR4A 4JYAK 4M3ZA 3NDKA 1TK0A 5AQQA 3BP8A 4FLXA 4IOXA 2AA4A 3KLEA 2NRXA 2CGJA 1U49A 1TKZA 1MU2A 4N47A 3V9WA 4KBOA 1K8AO 3D7EO 2ZQBA 1TV6A 2GBZA 4H0OA 3LWLA 4J8FA 3BDPA 2WFBA 1BCOA 1K8KB 1A5XA 2FLOA 1UA0A 3HL8A 4PHTX 4OGEA 4FWMA 1N32K 5AZJA 3SI6A 5FPDA 3LDSA 1QQCA 3C6AA 4MO5A 4B3SK 4DTOA 2P9UA 3RSEB 1QZ6A 4CHOA 2UU9K 1Q86O 3HK2A 4BE0A 4CIGA 3UKUA 2KHOA 5HRNA 3ZT1A 3RVCA 2HHWA 1QSLA 4KHUA 1A5WA 5AQYA 1HYSA 4HTUA 2O8DA 1LWFA 3DLHA 3C6HA 2VQEK 1J9AA 3HM9A 1NK6A 4B9VA 5M1OA 3LDOA 1ASUA 4BR2A 3OYHA 1VAZA 3H45C 1J53A 1HQUA 5KRTA 4OLAA 4Y1DA 2FC0A 3SV3A 3MN9A 5BPLA 2ZD1A 4DV6K 4C1NI 3KK7A 3IMXA 3SQ1A 4IDKA 3I55N 1ZBUA 1JLAA 1C1BA 3HOSA 3VA3A 3JSMA 4MDBA 5J2NA 4WQ4C 3VGLA 4FM1A 4C1NK 2W42A 4UQGA 4JKGB 3VQQA 4IJAA 2A5XA 4CESA 4E19A 2HHTA 3VF6A 4Y0WA 3LALA 3EO3A 1L3SA 1VQ8N 2QKBA 4B3RK 1FW6A 1NGCA 3G4SN 3CFPA 4IG3A 2QWLA 2CH5A 1TAUA 3TAMA 2UXBK 4DG1A 4E7IA 4WFAL 5D3GA 3DLEA 5IWAK 4RG8A 1TUUA 3OJSA 4NCGA 3BZKA 3DYAA 1A5VA 3UIQA 1SZ2A 3ZEUB 2FBYA 5HRRA 1RILA 1NGAA 3DLLL 3D0PA 3DOLA 1S5JA 4Z4IA 4WFNL 4L8RB 2P9LA 3PSFA 2FF3B 2X6NA 2NRZA 4M45A 1WOQA 3ZX2A 1QSYA 2WBNA 3DLGA 4V19S 5ADXH 4DFJA 4B9TA 2P9SB 1N8RO 2G8HA 3ASMA 1C0TA 4BRAA 2PYJA 2OANA 3PIPL 3DOKA 1IBLK 3V1RA 2OPSA 4DTSA 2QWOA 3UKUB 3DRPA 4DTNA 3ZLJA 5LMNK 1JLQA 3RWUA 1S6PA 5TKWA 2E2QA 1NKEA 3NH1A 1K73O 2D0OA 1N36K 1YXQA 2O8DB 4OPHA 4DSJA 4KHWA 5LJVA 5KQDA 1XHXA 1EETA 4WCEL 1S1WA 3E66A 3EE8A 1HLUA 3VA0A 3MDQA 4CBUA 4DU1A 4LFAK 4FOIA 4JD2A 3ENBA 2I7PA 2BH1A 4CBXA 3QEVA 1TK8A 3H1VX 3MCAB 4CGGA 5KTQA 1KLNA 2P5OA 1SQKA 4IG0A 1L3UA 3JXUA 1YVUA 4BRLA 4CGHA 4DV1K 1GLLO 3LP0A 4FLZA 3D2FB 3JAMO 4AHCA 2PBDA 3HO1A 3AO1A 5EXWA 3M6GA 3CCRN 3VGMA 1NGBA 4FLUA 3HSCA 4DMNA 3HP6A 3CPEA 1S1XA 4CFCA 3IAYA 4K42A 4E3SA 3L4QA 4WQ4A 3MXJA 3AGKA 1TK5A 4FJJA 4H5NA 4DUZK 3QNNA 4QS7A 4KHQA 4CJUA 3NFAA 3AVJA 2ZJRL 2D0AA 3HZ6A 1RT3A 3QIPA 4H0TB 3K5OA 4B08A 1QQNA 4NB4A 1U6ZA 4E89A 2P9IA 4JI0K 4JI6K 2W6KA 3K9KA 3RMBA 5JVGL 4DSEA 3O4WA 3O3FA 5H1SQ 3SZ2A 1QTMA 1VQ4N 4H5TA 3WXLA 3OS0A 1VQ5N 3I0RA 2QXFA 5FLXO 5AFUA 1HNXK 3IG1A 2VG7A 1D9DA 4FJNA 3AVMA 4CJTA 4H5VA 2V52B 3WNHA 2FBVA 1BDGA 3VQEA 1B9FA 4Q0BA 3U3YA 3WNFA 3OBYA 1Q7YO 2HNZA 4JI1K 4JI4K 3SUQA 4Z4GA 1TYQA 1ESVA 4DS5A 2D0BA 1EKEA 2HMPA 3VF2A 2KZMA 3DXKA 1J5EK 4JKCA 4DR1K 2YKNA 4AH9A 3J7ZO 5I3UA 1IBKK 3D45A 2YJEA 1YAGA 3L0QA 3SQ4A 2HVHA 3KJVA 1HNVA 4R5PA 4JD2B 1IKWA 2HBMA 1SS6A 1T44A 4WQ5A 2Q31A 1HJRA 4ISGA 1BOTO 1NGFA 1WBBA 1S9EA 3V4IA 4CJKA 3NF9A 4A2AA 2YHWA 2D1KA 4Z4FA 5ELZA 3NBPA 2O8FB 1C0FA 4X65K 4B9QA 3CF5L 5FRNA 3KKSA 1NLVA 1QQOA 1LWCA 3M8SA 3MX2A 4OPJA 4B9SA 3CFRA 2YNHA 1JCFA 3OTOK 1ASVA 3H3OB 1VSIA 1S1VA 5AQGA 2RF2A 4DWIA 1QHAA 4GKKK 2NRVA 3VEZA 3EKUA 4CK3A 5F0XA 5C42A 1DTTA 3WXMB 3VPZA 3DMJA 1MWMA 2P9IB 5BR8K 3SQ2A 1C6VA 5C24A 4ELUA 5JLFA 1X9WA 3G0ZA 3DJCA 4CEFA 4W5NA 3O9QA 1RDAA 2GUPA 4OJRA 4BRNA 5TKYA 5M1NA 5JMVA 4C8LA 2FXUA 1V4SA 2G8IA 3LM9A 3TPQA 4OLBA 4JI2K 1JCGA 1Z26A 4PKHA 3QEWA 2QK9A 3CHWA 1VSKA 4CJQA 4C8OA 3F2KA 3FR0A 1OH6A 1ZC6A 3CCJN 3SPYA 3HRGA 1BA0A 4BRGA 4FM0A 4DR5K 1BGXT 1UWBA 1VQLN 2HF3A 3KHYA 5EVZA 4KAZA 1Z25A 3V6DA 1NBWA 4IZ9A 4YOYA 1HUXA 4JHDA 5CE3A 1TYQB 4N56A 3PUFA 1NKCA 3HVTA 3KTQA 3HPHA 4DS4A 2KLAA 1VSHA 4BRIA 4PY5A 4C23A 1YF5L 1Z05A 4A5AA 5A2QO 2B5JA 2X6SA 4BREA 1XMQK 3QDKA 1JLFA 3DXKB 3ZSXA 1W0HA 4AILC 4W5OA 4FWNA 4GNIA 4FWSA 4M3UA 3O9SA 4FJXA 4XH1A 5HBMA 3ALYA 4R79A 1HQEA 3T7ZA 4BDYA 2G8FA 5BN9A 2GTDA 2QWNA 4KTWA 5BRHA 4A2BA 1WSIA 1RDCA 1RTDA 1NK9A 4KFBA 1J6ZA 4L3QA 4FWKA 4CEDA 3PX4A 3P5JA 3SMPA 3ULEA 2P1JA 3VN5A 3LL3A 4MFBA 4M3XA 3VQPA 4CHZA 4CZJA 1YJWN 3A5LC 4Z94A 2DFFA 4CJEA 4H0YB 3G10A 1JLBA 4IOCL 3L2WA 4FJ9A 1OVYA 3V81A 4KHYA 5AZIB 2E8AA 1T3VA 3RMAA 1HNIA 1TKXA 4CCHA 3ID8A 2O8BA 1YUWA 2Q36A 1KD1O 5M1KA 4N41A 4J2AA 5CZ1A 3I8BA 1KAZA 3DXMA 4DSLA 2P9KA 3N4PA 3OS2A 5KPZA 3CCEN 4CW7B 5I9EB 3CCQN 3ZT2A 3VQ8A 5GADP 2O4GA 4WYBA 3OYIA 3L2UA 4EHUA 1K8KA 4BY9C 2HVIA 1E4GT 4JS4A 2OZSA 4CI6A 4PKIA 4RCHA 3B8AX 3CI5A 3TTFA 2VWJA 2OCEA 4LH4A 5AQPA 2GX9A 4F2RA 4DF4A 4JHDB 5EOYA 1NWKA 3CC7N 4PKGA 3K58A 2ZM6K 3WNGA 1GOAA 4B1UB 3P1GA 4U7BA 5GAGP 4XH4A 5HLFA 1KAXA 1UOCA 3AO5A 1D8YA 4KRFA 1OH5A 3LDPA 3B6OA 1FKPA 1Q81O 1SL0A 5FPNA 3K0SA 4M3TA 3GE1A 3WNEA 4DSKA 3CCMN 3NF6A 1QZ5A 3MX5A 4IBNA 4LF8K 1Q82O 3KLFA 2VG6A 3PLAA 4XIUA 5M1QA 1SKRA 4E1JA 2EHGA 2VGNA 2YV0X 1QE1A 3FGUA 3HT3A 5M1PA 4YY3K 2Q1NA 3LAMA 1E3MA 3E9OA 2HSTA 3VQ4A 3RTVA 3MXMA 3A2FA 3ZSQA 3ULDA 3PX6A 3S41A 1HJOA 4HTLA 4X62K 2A6AA 3CD6N 1HYZA 4CZHA 4JKGA 1N5YA 5JICA 3WXIA 3QETA 4CJ3A 1WSEA 5J1EA 4DR2K 4FLYA 4AHRA 3ULEB 4EHTA 2JLEA 3SAFA 4AHTA 3OYDA 1WSHA 3SV4A 4XH5A 3PV8A 1ILYA 1X3NA 4EP5A 2D5RA 4YOVA 4OVLA 3NGZA 4K8XA 2HF4A 3VQ5A 2QWPA 4ISEA 1NGEA 1VSEA 1CXQA 3KK1A 1X1PA 3E9LA 4YFUA 3DLRA 5BPNA 4KPYA 4YOUA 3F9KA 3DXMB 2P9KB 3S3NA 2Z1HA 1RFQA 4GV9A 1RTJA 1KLMA 3V9XA 1NK4A 4B3MK 4FJMA 3CM5A 4NXMK 1KXPA 1WUAA 3E1YA 4RWTA 3QBXA 1N33K 3K5MA 3L2VA 4DTMA 4DR6K 1X9SA 3SAHA 1ITGA 4BR9A 1L3VA 3FFKB 3E9PA 2P9SA 4CF1A 3OYKA 3NGIA 2CH6A 1NJWA 2XY6A 1WSFA 3O1BA 3W0LA 3HSTB 1J54A 4Z4CA 1ZYQA 3V9UA 1X9JA 1NJXA 1S3XA 4IJNA 4Z0UA 3KLGA 2GEMA 1U4BA 4H8KA 4CE9A 2QEXN 3IKMA 4YDUC 1RDUA 4LF6K 3HOTA 5T7BA 4EZ6A 3CJ7A 3AVLA 2YHXA 1HMVA 3C7NA 4YOWA 2IVNA 1IKYA 1VSDA 1WAFA 4HUFA 1M1KO 4JRPA 1JLCA 4FSVA 4NYNA 1H1VA 3I8DA 3SQ0A 4H0PA 4FVUA 2NRRA 3R6MA 1R59O 4CK1A 5M1FA 2JWKA 3T1HK 1BHLA 1JL1A 3PO5A 1N6QA 1YHQN 4BRKA 3D2FA 3QEXA 5KPRA 1D9FA 4I9QA 3CXCM 3SAGA 4IKFA 1XNRK 1NM1A 1HR0K 4BDPA 3QNOA 2IC3A 1YITN 1D5AA 4JNEA 4O0JA 4H5WA 3R8EA 4FL9A 3CQ8A 3DLBA 4E0DA 4CHNA 2BUPA 1BG3A 2XY8A 4BQLA 5CHIA 3MEEA 3OYCA 4CJ7A 5HOOA 5E26A 1IG9A 1JKHA 2HNDA 4DV7K 3AVHA 1C0MA 5EU7A 2XRIA 2YHBA 4CGJA 1I39A 5K14A 2OA8A 3C94A 3DRSA 5C10A 4A57A 1T6CA 4AM6A 3CC4N 1W7AA 3R1XA 1HPMA 1ZBFA 3ZX0A 3WQUA 1SUQA 4RW7A 4CD1A 4F3OA 3AA3A 3WEEB 4YNQA 1IKXA 2XY7A 2E4LA 3O4QA 5AQHA 1IH7A 1QS4A 4AM7A 1C0GA 3OYNA 1N34K 3QB0A 4CIFA 4B3OA 4CJVA 4H4MA 1RGIA 2P9NA 4O5BA 2P9PA 1LWEA 4E1NA 2XHBA 2JWLA 4MDAA 3BZCA 3AVAA 5HROA 2A41A 1NGGA 5BR9A 3L8BA 3EN9A 3AA4A 3CJBA 3G25A 4WFBL 3HTVA 1GOBA 3N4QA 2Y1IA 2KTQA 2ATQA 3THWB 3SLCA 3VQBA 3CCVN 3ZCMA 1NGJA 3AVFA 4Z4EA 3VENA 4ZHRA 4CECA 3KLHA 4FJ8A 2Q3SA 2FSJA 4KHSA 3C7NB 4CHQA 3MECA 4YDUA 3LAKA 5JS2A 4FK0A 5AQNA 1B92A 5LY3A 4CEZA 4LH5A 1BIUA 2FBTA 3D2EA 4RW9A 4LSLA 4RW4A 1Q8IA 5KRSA 4DQRA 4LY7A 4HWIA 1OKJA 4NXNK 3LP1A 3ZT3A 2RPIA 2O4IA 3AAPA 1RTIA 3HPOA 2O8FA 1W2BM 1IBMK 2HBLA 1FKOA 4B9MA 2WOMA 4B3TK 5CR4A 1GLAG 3U9DA 1BIZA 5JVHL 1VRUA 1U2VA 2IDOA 4DQ8A 1NK7A 3ISNC 1JLGA 5MLCQ 4IFEA 3NHGA 3PY8A 4CK2A 4OKKA 4C8KA 4RW6A 3ZT0A 1BISA 1G99A 3CCLN 1RDDA 1VQON 5AQUA 2XY5A 2OYQA 4Z4HA 2AP1A 2I7NA 4FJ7A 4IFYA 4DSIA 3LDNA 3NVKA 4OX9K 4OPAA 1KVAA 1YTUA 4ILHA 5DM6L 3S3OA 3BF3A 4GKJK 1BCMA 2B6AA 2A40A 1X3MA 1ZBIA 1U47A 1RBUA 3BEXA 1CXUA 4BWJA 4CF9A 1EWRA 2Z1JA 4BRQA 2P9NB 3CG7A 3OYJA 2P9PB 4IXCA 3KLIA 2F8SA 4ELVA 1XC9A 2PFUA 4G9ZA 2NLXA 2E88A 3LANA 3J7AP 3NCIA 2GV9A 2Z1IA 2VGMA 4CBWA 3V1OA 4M63C 4NCBA 4KTZA 1BL3A 4B9NA 3ZSOA 2UUCK 3CQXA 4BROA 5I42A 3A8YA 4MQ3A 4CZGA 3CM6A 5GIPA 3SUPA 3THVA 3RR8A 4K8ZA 1FJGK 3I33A 3U4LA 2HHHK 2HNYA 3NH0A 1BQMA 5FRMA 3K9JA 5JLHA 3EZ5A 5E84A 1HKGA 3OBWA 1XWLA 3THXA 4KHPK 3DWLA 2PYLA 2ETJA 4I2PA 1I94K 1RBTA 4BGBA 1LAWA 4CD3A 3D2EB 3ENHA 4GY2B 1C0UA 3VQCA 3SCXA 4CF8A 1Y97A 1U45A 3VF4A 1EWQA 1XUPO 1VQMN 3FE1A 1YJ9N 5DMRA 5DM7L 3AY9A 5KPTA 3C65A 3HI0A 4CJSA 5C2FA 1XMOK 4NO7A 3TABA 3LWMA 3L3VA 2VYPA 1U2VB 3IRXA 4K41A 3TR8A 4JI3K 4M3WA 4HCCA 3FFIA 4CVNE 4XEIA 4KB0A 2HHUA 5AZIA 3TU5A 4PL7A 3QIOA 3SBTA 3KD1E 4U67L 4CEEA 3M8PA 4ZTFA 1RTHA 5AQLA 2UUBK 4EP4A 3JYTA 2E1ZA 3GBTA 3CERA 3CJ9A 4CEOA 5BPMA 1MDUB 2HBKA 3MCPA 1REVA 4DTJA 3DAWA 4JV5K 2ZF5O 2QW9A 1KAYA 1BI4B 2JGUA 2BGGA 4BGAA 2UUAK 4KH4A 1JXBA 4I6MB 4NLBA 3QERA 2A1RA 4WF9L 1YVNA 5HRSA 3T69A 2KZZA 4O4GA 3CPWM 1DGKN 3SUOA 1O1WA 3QMLA 1TUYA 1ZBHA 5F2RA 5FROA 3OVNA 2E6MA 4DF8A 1L5UA 3TANA 2F8TA 3SPZA 4ISFA 1JLEA 4M41A 3L2QA 3RMDA 4BDZA 1RT1A 3UB5A 4FW2A 5AQFA 4W5QA 1VSFA 3CYMA 4BRMA 3H46O 2VWBA 2KFNA 3CIPA 4FOEA 1XQSC 3M3ZA 1GLFO 2G8WA 3SJJA 1XC3A 4E7JA 3AVKA 3THXB 2RKIA 3QICA 4N5SA 1IG8A 3PO4A 3DM2A 3VEYA 4DTPA 1EQYA 3U8XA 1M90O 1K6YA 3QFUA 1P90A 1VQ6N 4BVPA 4I9LA 4CGFA 3WUHA 2BTFA 3ID6A 1CZ9A 1NOZA 1MA9B 4E7KA 2UYTA 4B1YB 2CGLA 4IDHA 1TVRA 3CCSN 3A5NC 2AJQA 1E4FT 2E2NA 1CZAN 2IIRA 3VTIA 3EY1A 3AA2A 4JK7A 3H1QA 1YI2N 1SKSA 4LFCK 2D4WA 1VQPN 3ENOA 4FJ5A 4FCYA 2YI1A 2Y1JA 3CQYA 2IVPA 4KREA 2ZWHA 3JS6A 3TAPA 4OGCA 4ID5A 5AR0A 4C8NA 1XHZA 4FJHA 2IGIA 2WONA 1W97L 1OH8A 4A61A 3QBWA 3O6WA 4CHYA 3OS1A 4DV2K 3THYB 1VSLA 3I0SA 3VEWA 4QCLA 2D0CA 3BY5A 5AFUH 4BE2A 1NGDA 1MWKA 3H08A 4KI4A 1SV5A 4N76A 4JKDA 2HOEA 3IS9A 4O55A 1DKGD 4BVOA 5J2MA 2FSKA 1NK5A 2ASPA 4JKAA 2QA4N 2FF6A 3MWTA 3OYBA 3QEPA 4ID1A 3QESA 3TTCA 4CZLA 2A3ZA 3K2PA 4DV4K 1HYVA 2YJFA 4FM2A 5ADXA 4M7XA 2DFEA 3TWHA 3VQ6A 2O8CB 2DPNA 5B8HA 4DCHA 1RT4A 1O13A 4FLWA 2RN2A 1KFDA 5AQZA 1HNWK 3P39A 2OTLN 3J7YP 1SKWA 2RE2A 2YHAA 4DTXA 5CYMA 2R7YA 1Q9XA 2F9TA 3TSPA 1SL2A 4FWLA 1JCEA 4FVMA 3I56N 4DU3A 1VHXA 1D4XA 1RCHA 4NYFA 1DTQA 1KFSA 1C1CA 4GV3A 1XI1A 3TAFA 3HXMA 3MN5A 4FWQA 3QO9A 3RRHA 4DV0K 4H0VB 3OYGA 2IVOA 3AO3A 2HMIA 4RTFD 5HP1A 2B4JA 1S6QA 2VQFK 3PIOL 4BC3A 4JKHA 4O8KA 3IUCA 3OHRA 4FYDA 3HP9A 4KKOA 4BC5A 1X9MA 3VTHA 3V9SA 4FWRA 2X78A 2YHYA 4JRQA 3SNNA 5LMUK 3IFRA 2QWMA 5BRDA 4FWPA 4A5BA 3OY9A 2FSNA 2WUSA 3L6QA 3M1FA 2F9WA 2KW4A 3EE9A 3MMVA 3MEGA 1YIJN 3WEEA 5AJ3K 3L4IA 1T8EA 3OYLA 2ASMA 5CYQA 1KVCA 3ZSVA 1ASWA 1QHTA 4BC4A 3VERA 4HHTA 2BDPA 3AV9A 4DKWA 1RT5A 4CHPA 4W5RA 2A42A 3CJ1A 1NOYA 2E6LA 2GUIA 2PY5A 4E7LA 4Y1CA 4KV8A 3TI0A 3ZSYA 4FJIA 2ASOA 2Q0RA 3CCUN 1TGOA 2DY4A 3VQ7A 4DFPA 1IJJA 3V1QA 3THWA 3FZKA 1VSJA 3BF1A 4M42A 3ZETA 4FWOA 2Q2RA 2YNGA 2V7YA 1QSSA 3OYFA 1NG9A 5AQKA 3R9PA 4BRFA 3UKRA 3HM8A 1KCFA 3VQDA 5BN8A 1WN7A 3OW2M 5JS1A 1GLCG 3O1WA 3VQAA 1YJNN 1EP4A 3CMAN 2BANA 1ZBLA 4MLHA 3C95A 4DLEA 2QWQA 4FJGA 5GAEP 4JS5A 4BR7A 4F9OA 3KK2A 4LF4K 1JJ2M 3B6PA 4GVMA 4CGIA 3U9ZA 4LD0A 3G6EN 3NMUA 4GV6A 3AVIA 4DSFA 4YOXA 1YT3A 3A5MC 1BQNA 2HHVA 4LF9K 3P83D 1BWFO 1ATSA 4J2BA 5E41A 3BUZB 3FZHA 1JL2A 2YNIA 2W40A 2P51A 5GIOA 3S9HA 2HBJA 2IAJA 1CLQA 3MAQA 3SUNA 1UA1A 3EEQA 4DFKA 1KRPA 1UAXA 1ZXOA 3EZWA 4JK8A 1WSJA 1NMDA 1C1AA 2H3GX 2HB5A 1RBRA 4EIAA 3J81O 3R3LA 4FPAA 4C8MA 3GL1A 3ZX3A 2VWKA 1OVQA 1IKVA 3M8QA 4JK9A 3ZT4A 2ZJQL 4BQZA 4MLEA 4F3TA 2YNFA 4IOAL 2ZE2A 4A59A 4DR7K 5DK5A 4QS9A 3P31A 4CIEA 4O5FA 1TL3A 1LOTB 2YKMA 2D0PA 4CFBA 1XNQK 4H03B 2OPPA 1RT7A 1GLDG 1YTAA 4CFAA 4IWVA 4CGDA 3RRGA 5SWMA 3MWPA 1HNZK 4FPBA 1IV0A 1T7PA 1GOCA 3A0IX 4BC2A 4KH6A 3G71N 5C2DA 3MEDA 4CZFA 1J5OA 2G8UA 2NNWA 3CFOA 2YX6A 3ATVA 4DTUA 5FDLA 3TSUA 3O9RA 4DFMA 1ATNA 1QQMA 2Z1GA 1RDWX 5HL7L 1IO2A 4K43A 5AQTA 3ZETB 3E01A 4ELTA 2GWKA 4KI6A 3KD5E 5AZJB 1R0AA 1BUPA 3K5NA 2P9UB 1KVBA 4QOZB 4BR5A 3UKRB 1NJZA 5AQIA 1RDBA 1LW2A 3TAGA 4QS8A 4F8RA 4YORA 3NE6A 5AQXA 3O3HA 3HJFA 1WB9A 1TKTA 5EX5A 3J80O 2UXDK 1V4TA 4WQ5C 4CEQA 1VK0A 3VOVA 3C0BA 4G1QA 4FZYA 3TAQA 3MN7A 5J2PA 4KB1A 2XO7A 4DV3K 4DQSA 3NH2A 2ZJPL 5KQ8A 4NCAA 2NZTA 3FLCO 2EX3A 3CETA 3LPUA 5AQSA 4GW6A 4OPKA 1NGIA 3F5TA 1KSPA 4ILJA 1JXEA 2GELA 3O3GA 4FZZA 3F9MA 4LSNA 1VQKN 2BE2A 5GINA 1DEJA 2E20A 1RNHA 2ZGZA 3LDQA
chains in the Genus database with same CATH topology
2A1RA 3K58A 3WNGA 1GOAA 5HRSA 1G15A 3P1GA 3SQ1A 5HLFA 1UOCA 3AO5A 1D8YA 4KRFA 2KZZA 4IDKA 4O4GA 4CJPA 1ZBUA 1JLAA 3SUOA 1O1WA 1C1BA 1FKPA 3B6OA 3VA3A 1SL0A 3JSMA 1ZBHA 4F4KA 5FROA 1BI4A 2E6MA 3OVNA 3WNEA 5J2NA 4FM1A 4DF8A 3NF6A 2W42A 3TANA 1L5UA 4IBNA 4UQGA 2F8TA 3VQQA 5KGXA 3SPZA 3U3GA 3KLFA 2VG6A 4B8CA 4PA1A 4CESA 4E19A 4M41A 1JLEA 4FK2A 2HHTA 4XIUA 3L2QA 3RMDA 4BDZA 3AO2A 1SKRA 3LALA 1WAJA 1RT1A 1L3SA 4FW2A 2QKBA 4CF0A 2EHGA 2LSNA 4I7FA 4W5QA 2YV0X 1QE1A 3CFPA 1VSFA 3HT3A 3CYMA 4IG3A 4KTQA 3F73A 2KFNA 1Q9YA 3LAMA 1TAUA 3TAMA 4FW1A 3VQ4A 3RTVA 3L3UA 3MXMA 3A2FA 3ZSQA 3ULDA 4DQIA 3PX6A 2OPQA 4DG1A 4E7IA 1HYZA 1EX4A 1N5YA 1S1TA 4FJLA 5D3GA 3DLEA 2HHSA 2G8WA 4RG8A 3AVGA 3SJJA 4E7JA 3QETA 4CJ3A 3OJSA 3AVKA 1WSEA 5J1EA 1HPZA 2RKIA 3QINA 3L2RA 1S1UA 4NCGA 2PZSA 3DYAA 1A5VA 4FLYA 4AHRA 4RW8A 4N5SA 3UIQA 3PO4A 3DM2A 2FBYA 5HRRA 2JLEA 1RILA 4DTPA 4F2SA 3D0PA 4AHTA 3LPTA 1K6YA 3LP3A 1TAQA 3SYZA 4FLTA 3OYDA 3DOLA 4O0IA 1WSHA 1S5JA 4Z4IA 2VG5A 4M3YA 3SV4A 3RR7A 3PV8A 4I9LA 5KI6A 4CGFA 4BWMA 1CZ9A 1NOZA 4EP5A 2D5RA 3NGYA 4E7KA 4L8RB 4OVLA 3NGZA 4K8XA 3VQ5A 2X6NA 4M45A 1VSEA 1CXQA 1TVRA 1X1PA 3KK1A 2AJQA 4YFUA 3DLRA 4KPYA 3F9KA 1QSYA 1KTQA 3DLGA 4DFJA 4B9TA 3EY1A 3LZJA 3AA2A 3S3NA 4ICLA 2Z1HA 2G8HA 1SKSA 1EXQA 1KLMA 1RTJA 1C0TA 3ASMA 3EYZA 3V9XA 1NK4A 4FJMA 2PYJA 1RT2A 3CM5A 3DOKA 3V1RA 2OPSA 4PUOA 4FJ5A 5C25A 4FCYA 4DTSA 3DRPA 4DTNA 2Y1JA 1JLQA 3RWUA 1NKBA 1S6PA 3K5MA 3T19A 3L2VA 4KREA 3OJUA 4DTMA 3MXIA 3NH1A 1X9SA 1NKEA 3TAPA 4OGCA 1ITGA 4CJ4A 2P5GA 4ID5A 1L3VA 4C8NA 4FJHA 1XHZA 3K5LA 2IGIA 4CF1A 2WONA 3OYKA 3NGIA 1NJWA 2XY6A 4DSJA 1WSFA 4KHWA 4HUGA 1XHXA 1EETA 1S1WA 3C6TA 4CHYA 3OS1A 3HSTB 1VSLA 2KQ2A 1J54A 3I0SA 3VA0A 4FXDA 4BE1A 3QLHA 4Z4CA 1FXXA 1ZYQA 4DU1A 3V9UA 4QCLA 2D0CA 3AVBA 3AVNA 4CJRA 4EZ9A 3HPGA 1NJXA 4Z0UA 3VQ9A 3KLGA 1U4BA 4H8KA 4BE2A 4CE9A 2F96A 3QEVA 4OKJA 3H08A 4I2QA 1TK8A 4CJLA 5KTQA 2P5OA 1SV5A 4TSXA 4CGGA 1T03A 4IG0A 1KLNA 1L3UA 1SL1A 4N76A 4KO0A 1YVUA 4CGHA 3IS9A 4O55A 1NK0A 3LP0A 5J2MA 5SZTA 5T7BA 3AO4A 4FLZA 1NK5A 4EZ6A 3AVLA 4J2DA 2IS3A 1HMVA 3OYBA 3QEPA 4AHCA 4WE1A 3V9ZA 3HO1A 3AO1A 4ID1A 1TKDA 1IKYA 1HRHA 1VSDA 1WAFA 4HUFA 3QESA 4JRPA 1JLCA 1WLJA 4CJFA 3HVRA 3C6UA 3K2PA 4AHUA 4FLUA 1HYVA 4DMNA 3HP6A 4NYNA 4FM2A 1LAVA 3I8DA 1S1XA 3SQ0A 4CFCA 2DFEA 3IAYA 3T1AA 3TWHA 2OZMA 3OYAA 4E3SA 3VQ6A 4IFVA 4CK1A 3PO5A 4E7HA 1BHLA 1JL1A 3MXJA 1RT4A 1L3TA 2DFHA 3PX0A 1N6QA 3ITHA 1TK5A 4FJJA 1TL1A 4FLWA 2RN2A 3QEXA 1KFDA 3QNNA 1D9FA 3KKRA 4GMJB 4CJUA 4KHQA 4I9QA 3NFAA 1SKWA 3AVJA 4IKFA 2D0AA 2YHAA 4BDPA 4DTXA 1RT3A 3NAEA 3QNOA 4CERA 2IC3A 3QIPA 1I3AA 3K5OA 5CYMA 4B08A 1D5AA 4E89A 4O0JA 2R7YA 1Q9XA 4B9LA 4DLGA 4DQPA 3CQ8A 1SL2A 3RMBA 3DLBA 4E0DA 4CHNA 4DSEA 2XY8A 4FVMA 3O3FA 3MEEA 4DU3A 3OYCA 3SZ2A 1IG9A 1JKHA 1RCHA 2HNDA 4JLHA 1DTQA 4NYFA 1KFSA 3AVHA 3KIOA 4OKEA 1QTMA 1C0MA 5EU7A 2XRIA 1C1CA 1CZBA 1XI1A 3OS0A 2YHBA 4CGJA 1I39A 3HXMA 3I0RA 3TAFA 2QXFA 5K14A 2OA8A 3C94A 3IG1A 2VG7A 3DRSA 3QO9A 4CEAA 3RRHA 1D9DA 3AVMA 4FJNA 3OYGA 3DRRA 3BGRA 4CJTA 3AO3A 2HMIA 5HP1A 2B4JA 3WNHA 3LP2A 1S6QA 2FBVA 3LZIA 1ZBFA 3VQEA 1SUQA 4RW7A 1B9FA 2G8VA 4F3OA 3AA3A 4Q0BA 4FYDA 4M3TA 4YNQA 3HP9A 1IKXA 2XY7A 2E4LA 3O4QA 4DSKA 4KKOA 3WNFA 3U3YA 1X9MA 1IH7A 1QS4A 3V9SA 2HNZA 3ZSRA 1T05A 3ZSZA 4FZXC 2X78A 3OYNA 3SUQA 4JRQA 1RBSA 3K59A 1B9DA 3SNNA 4CIFA 4Z4GA 4PQUA 4B3OA 3DLKA 4H4MA 4CJVA 3TARA 4DS5A 2D0BA 1EKEA 1S9GA 3OYEA 3OY9A 4O5BA 1NJYA 2KW4A 4HVJA 3KK3A 3U6FA 3O4NA 1LWEA 4E1NA 3MEGA 2XHBA 3AVAA 2KZMA 5HROA 5HRPA 4CF2A 2YKNA 4AH9A 5KGWA 2QKKA 3L8BA 5I3UA 3NF8A 1T8EA 3D45A 3AA4A 3OYLA 3SQ4A 2HVHA 3KJVA 1HNVA 4R5PA 3K57A 1GOBA 5CYQA 2Y1IA 1IKWA 1KVCA 2KTQA 3ZSVA 1ASWA 1QHTA 2ATQA 3VQBA 3ZCMA 1HJRA 4E1MA 4HHTA 3AVFA 5J2QA 2BDPA 3AV9A 2FBXA 4Z4EA 1RT5A 4CHPA 4W5RA 4ZHRA 2DTUA 4CECA 3KLHA 4FJ8A 1S9EA 3V4IA 2Q3SA 4KHSA 1NOYA 2E6LA 2GUIA 3NF9A 4CJKA 4CHQA 4B8AB 2PY5A 1U04A 4E7LA 4CEBA 4Z4FA 4Y1CA 3MECA 3NBPA 4KV8A 3QEIA 3LAKA 3TI0A 5JS2A 3NF7A 3ZSYA 4FJIA 5FRNA 3KKSA 4BACA 4FK0A 1B92A 1TGOA 2DY4A 4CEZA 3VQ7A 3OYMA 4DFPA 3V1QA 1LWCA 4LH5A 1BIUA 1F21A 1VSJA 3M8SA 4M42A 2FBTA 4CJ5A 4RW9A 1W9HA 4AHVA 4LSLA 2YNGA 4OPJA 4RW4A 1Q8IA 4M3RA 3OYFA 1QSSA 4B9UA 4B9SA 3CFRA 2YNHA 5KRSA 3ZSWA 4DQRA 1ASVA 1VSIA 1S1VA 4LY7A 3LP1A 3ZT3A 2RPIA 2RF2A 2O4IA 4DWIA 3HPOA 1KCFA 1RTIA 3VQDA 3M8RA 1WN7A 1LV5A 5JS1A 3VQAA 4CK3A 5C42A 1DTTA 1RT6A 1EP4A 3DMJA 4HCBA 4KHNA 2BANA 1FKOA 2ITGA 1ZBLA 3T3FA 2WOMA 4B9MA 3C95A 4DLEA 3SQ2A 1BIZA 1C6VA 4FJGA 5C24A 1FK9A 1VRUA 4JS5A 1X9WA 2IDOA 3G0ZA 5CZ2A 4CEFA 4ELUA 4W5NA 3KK2A 1NK7A 1LW0A 3ISNC 1JLGA 1VSMA 3B6PA 4GVMA 3NHGA 4CGIA 1RDAA 2G8KA 3PY8A 3AA5X 4LD0A 4OJRA 4CK2A 1VRTA 4ZTJA 3HYFA 3AVIA 4OKKA 4C8KA 4RW6A 4DSFA 4FLVA 3ZT0A 3TAEA 1BISA 4C8LA 1YT3A 2HHQA 2G8IA 4J2EA 4OLBA 3RMCA 1Z26A 5CY4A 3QEWA 2QK9A 1BQNA 4AHSA 1RDDA 2HHVA 3S3MA 1VSKA 1RBVA 4CJQA 1NK8A 4C8OA 2XY5A 3P83D 2OYQA 4Z4HA 4J2BA 5E41A 3SPYA 4IFYA 4DSIA 4FJ7A 1JL2A 2YNIA 4FM0A 2P51A 1BGXT 3S9HA 1KVAA 1YTUA 2IAJA 1UWBA 1CLQA 3S3OA 3MAQA 3SUNA 4KAZA 1BCMA 2B6AA 1UA1A 4DFKA 1ZBIA 1KRPA 1UAXA 1Z25A 3V6DA 1U47A 1RBUA 4DTRA 1CXUA 4BWJA 4CF9A 1WSJA 4N56A 3PUFA 1NKCA 3HVTA 1C1AA 2HB5A 3HPHA 4CJWA 2Z1JA 1RBRA 4DS4A 1DLOA 1VSHA 3KTQA 3CG7A 3OYJA 4PY5A 3KLIA 4C8MA 4ELVA 1XC9A 2F8SA 2VWKA 2HW3A 1IKVA 3M8QA 2B5JA 2IOCA 2X6SA 3ZT4A 4F3TA 2YNFA 4QAGA 1JLFA 2ZE2A 3LANA 1U48A 3ZSXA 1W0HA 4W5TA 5DK5A 3NCIA 2GV9A 2Z1IA 4W5OA 4AILC 4CIEA 2OPRA 4CFDA 3DI6A 4M3UA 3V1OA 4FJXA 1TL3A 4NCBA 2YKMA 5HBMA 4KTZA 4CFBA 4Q5VA 4FJKA 1BL3A 2OPPA 4B9NA 1RT7A 3ALYA 3AVCA 3ZSOA 1YTAA 4CFAA 4HUEA 4CGDA 1HQEA 3RRGA 5SWMA 5I42A 4BDYA 2G8FA 4FK4A 4H4OA 4MQ3A 3RR8A 3CM6A 4KTWA 3SUPA 3THVA 2KFZA 4DQQA 1T7PA 1GOCA 4K8ZA 2X74A 2A1SA 1WSIA 2HNYA 1RDCA 2NUBA 3MEDA 1J5OA 1RTDA 2G8UA 1WSGA 4KI4A 3NH0A 1NK9A 4KFBA 1BQMA 5FRMA 3CFOA 3EZ5A 4DU4A 4DTUA 2HHXA 1XWLA 2I5JA 5FDLA 1WNSA 4CEDA 3PX4A 2PYLA 3P5JA 4O44A 4DFMA 2P1JA 2ETJA 4I2PA 3VN5A 2Z1GA 4PWDA 4MFBA 4M3XA 3VQPA 1RBTA 1IO2A 4M3ZA 1LAWA 4CHZA 3NDKA 1TK0A 3E01A 4FLXA 4ELTA 1C0UA 3VQCA 3KLEA 2DFFA 4KI6A 3KD5E 3SCXA 1R0AA 4CF8A 3K5NA 1Y97A 4CJEA 1U45A 3G10A 1U49A 1TKZA 1JLBA 1KVBA 3L2WA 4FJ9A 4QOZB 1MU2A 4N47A 3V9WA 5DMRA 1NJZA 3V81A 4KHYA 1RDBA 2ZQBA 1TV6A 2GBZA 3LWLA 1LW2A 3RMAA 3TAGA 1HNIA 1TKXA 4CJSA 3BDPA 4CCHA 3TABA 1BCOA 1UA0A 1A5XA 4F8RA 3HL8A 4N41A 3LWMA 4OGEA 5CZ1A 3O3HA 3NE6A 4J2AA 3HJFA 3L3VA 3IRXA 3TR8A 1TKTA 4DSLA 3SI6A 4M3WA 3LDSA 1QQCA 3OS2A 4DTOA 4HCCA 3FFIA 4CHOA 4KB0A 2HHUA 3HK2A 4CEQA 1VK0A 4BE0A 4CIGA 3ZT2A 3VQ8A 5HRNA 4G1QA 3ZT1A 2O4GA 3QIOA 4FZYA 3OYIA 3L2UA 3TAQA 3KD1E 2HHWA 5J2PA 4KB1A 4CEEA 1QSLA 1A5WA 3M8PA 4ZTFA 4KHUA 2XO7A 2HVIA 1RTHA 4JS4A 2OZSA 4DQSA 1HYSA 3NH2A 4NCAA 4EP4A 4HTUA 3JYTA 2EX3A 1LWFA 3DLHA 3LPUA 4GW6A 1J9AA 4CEOA 3HM9A 1NK6A 4B9VA 4OPKA 1REVA 4DTJA 1ASUA 2VWJA 4LH4A 3OYHA 1KSPA 1J53A 1BI4B 1JXEA 3O3GA 4FZZA 4LSNA 1HQUA 2JGUA 5KRTA 2BGGA 4OLAA 4Y1DA 2FC0A 4F2RA 3SV3A 2BE2A 4DF4A 1RNHA 2ZD1A 1JXBA 3QERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1R A;  3K58 A;  3WNG A;  1GOA A;  5HRS A;  1G15 A;  3P1G A;  3SQ1 A;  5HLF A;  1UOC A;  3AO5 A;  1D8Y A;  4KRF A;  2KZZ A;  4IDK A;  4O4G A;  4CJP A;  1ZBU A;  1JLA A;  3SUO A;  1O1W A;  1C1B A;  1FKP A;  3B6O A;  3VA3 A;  1SL0 A;  3JSM A;  1ZBH A;  4F4K A;  5FRO A;  1BI4 A;  2E6M A;  3OVN A;  3WNE A;  5J2N A;  4FM1 A;  4DF8 A;  3NF6 A;  2W42 A;  3TAN A;  1L5U A;  4IBN A;  4UQG A;  2F8T A;  3VQQ A;  5KGX A;  3SPZ A;  3U3G A;  3KLF A;  2VG6 A;  4B8C A;  4PA1 A;  4CES A;  4E19 A;  4M41 A;  1JLE A;  4FK2 A;  2HHT A;  4XIU A;  3L2Q A;  3RMD A;  4BDZ A;  3AO2 A;  1SKR A;  3LAL A;  1WAJ A;  1RT1 A;  1L3S A;  4FW2 A;  2QKB A;  4CF0 A;  2EHG A;  2LSN A;  4I7F A;  4W5Q A;  2YV0 X;  1QE1 A;  3CFP A;  1VSF A;  3HT3 A;  3CYM A;  4IG3 A;  4KTQ A;  3F73 A;  2KFN A;  1Q9Y A;  3LAM A;  1TAU A;  3TAM A;  4FW1 A;  3VQ4 A;  3RTV A;  3L3U A;  3MXM A;  3A2F A;  3ZSQ A;  3ULD A;  4DQI A;  3PX6 A;  2OPQ A;  4DG1 A;  4E7I A;  1HYZ A;  1EX4 A;  1N5Y A;  1S1T A;  4FJL A;  5D3G A;  3DLE A;  2HHS A;  2G8W A;  4RG8 A;  3AVG A;  3SJJ A;  4E7J A;  3QET A;  4CJ3 A;  3OJS A;  3AVK A;  1WSE A;  5J1E A;  1HPZ A;  2RKI A;  3QIN A;  3L2R A;  1S1U A;  4NCG A;  2PZS A;  3DYA A;  1A5V A;  4FLY A;  4AHR A;  4RW8 A;  4N5S A;  3UIQ A;  3PO4 A;  3DM2 A;  2FBY A;  5HRR A;  2JLE A;  1RIL A;  4DTP A;  4F2S A;  3D0P A;  4AHT A;  3LPT A;  1K6Y A;  3LP3 A;  1TAQ A;  3SYZ A;  4FLT A;  3OYD A;  3DOL A;  4O0I A;  1WSH A;  1S5J A;  4Z4I A;  2VG5 A;  4M3Y A;  3SV4 A;  3RR7 A;  3PV8 A;  4I9L A;  5KI6 A;  4CGF A;  4BWM A;  1CZ9 A;  1NOZ A;  4EP5 A;  2D5R A;  3NGY A;  4E7K A;  4L8R B;  4OVL A;  3NGZ A;  4K8X A;  3VQ5 A;  2X6N A;  4M45 A;  1VSE A;  1CXQ A;  1TVR A;  1X1P A;  3KK1 A;  2AJQ A;  4YFU A;  3DLR A;  4KPY A;  3F9K A;  1QSY A;  1KTQ A;  3DLG A;  4DFJ A;  4B9T A;  3EY1 A;  3LZJ A;  3AA2 A;  3S3N A;  4ICL A;  2Z1H A;  2G8H A;  1SKS A;  1EXQ A;  1KLM A;  1RTJ A;  1C0T A;  3ASM A;  3EYZ A;  3V9X A;  1NK4 A;  4FJM A;  2PYJ A;  1RT2 A;  3CM5 A;  3DOK A;  3V1R A;  2OPS A;  4PUO A;  4FJ5 A;  5C25 A;  4FCY A;  4DTS A;  3DRP A;  4DTN A;  2Y1J A;  1JLQ A;  3RWU A;  1NKB A;  1S6P A;  3K5M A;  3T19 A;  3L2V A;  4KRE A;  3OJU A;  4DTM A;  3MXI A;  3NH1 A;  1X9S A;  1NKE A;  3TAP A;  4OGC A;  1ITG A;  4CJ4 A;  2P5G A;  4ID5 A;  1L3V A;  4C8N A;  4FJH A;  1XHZ A;  3K5L A;  2IGI A;  4CF1 A;  2WON A;  3OYK A;  3NGI A;  1NJW A;  2XY6 A;  4DSJ A;  1WSF A;  4KHW A;  4HUG A;  1XHX A;  1EET A;  1S1W A;  3C6T A;  4CHY A;  3OS1 A;  3HST B;  1VSL A;  2KQ2 A;  1J54 A;  3I0S A;  3VA0 A;  4FXD A;  4BE1 A;  3QLH A;  4Z4C A;  1FXX A;  1ZYQ A;  4DU1 A;  3V9U A;  4QCL A;  2D0C A;  3AVB A;  3AVN A;  4CJR A;  4EZ9 A;  3HPG A;  1NJX A;  4Z0U A;  3VQ9 A;  3KLG A;  1U4B A;  4H8K A;  4BE2 A;  4CE9 A;  2F96 A;  3QEV A;  4OKJ A;  3H08 A;  4I2Q A;  1TK8 A;  4CJL A;  5KTQ A;  2P5O A;  1SV5 A;  4TSX A;  4CGG A;  1T03 A;  4IG0 A;  1KLN A;  1L3U A;  1SL1 A;  4N76 A;  4KO0 A;  1YVU A;  4CGH A;  3IS9 A;  4O55 A;  1NK0 A;  3LP0 A;  5J2M A;  5SZT A;  5T7B A;  3AO4 A;  4FLZ A;  1NK5 A;  4EZ6 A;  3AVL A;  4J2D A;  2IS3 A;  1HMV A;  3OYB A;  3QEP A;  4AHC A;  4WE1 A;  3V9Z A;  3HO1 A;  3AO1 A;  4ID1 A;  1TKD A;  1IKY A;  1HRH A;  1VSD A;  1WAF A;  4HUF A;  3QES A;  4JRP A;  1JLC A;  1WLJ A;  4CJF A;  3HVR A;  3C6U A;  3K2P A;  4AHU A;  4FLU A;  1HYV A;  4DMN A;  3HP6 A;  4NYN A;  4FM2 A;  1LAV A;  3I8D A;  1S1X A;  3SQ0 A;  4CFC A;  2DFE A;  3IAY A;  3T1A A;  3TWH A;  2OZM A;  3OYA A;  4E3S A;  3VQ6 A;  4IFV A;  4CK1 A;  3PO5 A;  4E7H A;  1BHL A;  1JL1 A;  3MXJ A;  1RT4 A;  1L3T A;  2DFH A;  3PX0 A;  1N6Q A;  3ITH A;  1TK5 A;  4FJJ A;  1TL1 A;  4FLW A;  2RN2 A;  3QEX A;  1KFD A;  3QNN A;  1D9F A;  3KKR A;  4GMJ B;  4CJU A;  4KHQ A;  4I9Q A;  3NFA A;  1SKW A;  3AVJ A;  4IKF A;  2D0A A;  2YHA A;  4BDP A;  4DTX A;  1RT3 A;  3NAE A;  3QNO A;  4CER A;  2IC3 A;  3QIP A;  1I3A A;  3K5O A;  5CYM A;  4B08 A;  1D5A A;  4E89 A;  4O0J A;  2R7Y A;  1Q9X A;  4B9L A;  4DLG A;  4DQP A;  3CQ8 A;  1SL2 A;  3RMB A;  3DLB A;  4E0D A;  4CHN A;  4DSE A;  2XY8 A;  4FVM A;  3O3F A;  3MEE A;  4DU3 A;  3OYC A;  3SZ2 A;  1IG9 A;  1JKH A;  1RCH A;  2HND A;  4JLH A;  1DTQ A;  4NYF A;  1KFS A;  3AVH A;  3KIO A;  4OKE A;  1QTM A;  1C0M A;  5EU7 A;  2XRI A;  1C1C A;  1CZB A;  1XI1 A;  3OS0 A;  2YHB A;  4CGJ A;  1I39 A;  3HXM A;  3I0R A;  3TAF A;  2QXF A;  5K14 A;  2OA8 A;  3C94 A;  3IG1 A;  2VG7 A;  3DRS A;  3QO9 A;  4CEA A;  3RRH A;  1D9D A;  3AVM A;  4FJN A;  3OYG A;  3DRR A;  3BGR A;  4CJT A;  3AO3 A;  2HMI A;  5HP1 A;  2B4J A;  3WNH A;  3LP2 A;  1S6Q A;  2FBV A;  3LZI A;  1ZBF A;  3VQE A;  1SUQ A;  4RW7 A;  1B9F A;  2G8V A;  4F3O A;  3AA3 A;  4Q0B A;  4FYD A;  4M3T A;  4YNQ A;  3HP9 A;  1IKX A;  2XY7 A;  2E4L A;  3O4Q A;  4DSK A;  4KKO A;  3WNF A;  3U3Y A;  1X9M A;  1IH7 A;  1QS4 A;  3V9S A;  2HNZ A;  3ZSR A;  1T05 A;  3ZSZ A;  4FZX C;  2X78 A;  3OYN A;  3SUQ A;  4JRQ A;  1RBS A;  3K59 A;  1B9D A;  3SNN A;  4CIF A;  4Z4G A;  4PQU A;  4B3O A;  3DLK A;  4H4M A;  4CJV A;  3TAR A;  4DS5 A;  2D0B A;  1EKE A;  1S9G A;  3OYE A;  3OY9 A;  4O5B A;  1NJY A;  2KW4 A;  4HVJ A;  3KK3 A;  3U6F A;  3O4N A;  1LWE A;  4E1N A;  3MEG A;  2XHB A;  3AVA A;  2KZM A;  5HRO A;  5HRP A;  4CF2 A;  2YKN A;  4AH9 A;  5KGW A;  2QKK A;  3L8B A;  5I3U A;  3NF8 A;  1T8E A;  3D45 A;  3AA4 A;  3OYL A;  3SQ4 A;  2HVH A;  3KJV A;  1HNV A;  4R5P A;  3K57 A;  1GOB A;  5CYQ A;  2Y1I A;  1IKW A;  1KVC A;  2KTQ A;  3ZSV A;  1ASW A;  1QHT A;  2ATQ A;  3VQB A;  3ZCM A;  1HJR A;  4E1M A;  4HHT A;  3AVF A;  5J2Q A;  2BDP A;  3AV9 A;  2FBX A;  4Z4E A;  1RT5 A;  4CHP A;  4W5R A;  4ZHR A;  2DTU A;  4CEC A;  3KLH A;  4FJ8 A;  1S9E A;  3V4I A;  2Q3S A;  4KHS A;  1NOY A;  2E6L A;  2GUI A;  3NF9 A;  4CJK A;  4CHQ A;  4B8A B;  2PY5 A;  1U04 A;  4E7L A;  4CEB A;  4Z4F A;  4Y1C A;  3MEC A;  3NBP A;  4KV8 A;  3QEI A;  3LAK A;  3TI0 A;  5JS2 A;  3NF7 A;  3ZSY A;  4FJI A;  5FRN A;  3KKS A;  4BAC A;  4FK0 A;  1B92 A;  1TGO A;  2DY4 A;  4CEZ A;  3VQ7 A;  3OYM A;  4DFP A;  3V1Q A;  1LWC A;  4LH5 A;  1BIU A;  1F21 A;  1VSJ A;  3M8S A;  4M42 A;  2FBT A;  4CJ5 A;  4RW9 A;  1W9H A;  4AHV A;  4LSL A;  2YNG A;  4OPJ A;  4RW4 A;  1Q8I A;  4M3R A;  3OYF A;  1QSS A;  4B9U A;  4B9S A;  3CFR A;  2YNH A;  5KRS A;  3ZSW A;  4DQR A;  1ASV A;  1VSI A;  1S1V A;  4LY7 A;  3LP1 A;  3ZT3 A;  2RPI A;  2RF2 A;  2O4I A;  4DWI A;  3HPO A;  1KCF A;  1RTI A;  3VQD A;  3M8R A;  1WN7 A;  1LV5 A;  5JS1 A;  3VQA A;  4CK3 A;  5C42 A;  1DTT A;  1RT6 A;  1EP4 A;  3DMJ A;  4HCB A;  4KHN A;  2BAN A;  1FKO A;  2ITG A;  1ZBL A;  3T3F A;  2WOM A;  4B9M A;  3C95 A;  4DLE A;  3SQ2 A;  1BIZ A;  1C6V A;  4FJG A;  5C24 A;  1FK9 A;  1VRU A;  4JS5 A;  1X9W A;  2IDO A;  3G0Z A;  5CZ2 A;  4CEF A;  4ELU A;  4W5N A;  3KK2 A;  1NK7 A;  1LW0 A;  3ISN C;  1JLG A;  1VSM A;  3B6P A;  4GVM A;  3NHG A;  4CGI A;  1RDA A;  2G8K A;  3PY8 A;  3AA5 X;  4LD0 A;  4OJR A;  4CK2 A;  1VRT A;  4ZTJ A;  3HYF A;  3AVI A;  4OKK A;  4C8K A;  4RW6 A;  4DSF A;  4FLV A;  3ZT0 A;  3TAE A;  1BIS A;  4C8L A;  1YT3 A;  2HHQ A;  2G8I A;  4J2E A;  4OLB A;  3RMC A;  1Z26 A;  5CY4 A;  3QEW A;  2QK9 A;  1BQN A;  4AHS A;  1RDD A;  2HHV A;  3S3M A;  1VSK A;  1RBV A;  4CJQ A;  1NK8 A;  4C8O A;  2XY5 A;  3P83 D;  2OYQ A;  4Z4H A;  4J2B A;  5E41 A;  3SPY A;  4IFY A;  4DSI A;  4FJ7 A;  1JL2 A;  2YNI A;  4FM0 A;  2P51 A;  1BGX T;  3S9H A;  1KVA A;  1YTU A;  2IAJ A;  1UWB A;  1CLQ A;  3S3O A;  3MAQ A;  3SUN A;  4KAZ A;  1BCM A;  2B6A A;  1UA1 A;  4DFK A;  1ZBI A;  1KRP A;  1UAX A;  1Z25 A;  3V6D A;  1U47 A;  1RBU A;  4DTR A;  1CXU A;  4BWJ A;  4CF9 A;  1WSJ A;  4N56 A;  3PUF A;  1NKC A;  3HVT A;  1C1A A;  2HB5 A;  3HPH A;  4CJW A;  2Z1J A;  1RBR A;  4DS4 A;  1DLO A;  1VSH A;  3KTQ A;  3CG7 A;  3OYJ A;  4PY5 A;  3KLI A;  4C8M A;  4ELV A;  1XC9 A;  2F8S A;  2VWK A;  2HW3 A;  1IKV A;  3M8Q A;  2B5J A;  2IOC A;  2X6S A;  3ZT4 A;  4F3T A;  2YNF A;  4QAG A;  1JLF A;  2ZE2 A;  3LAN A;  1U48 A;  3ZSX A;  1W0H A;  4W5T A;  5DK5 A;  3NCI A;  2GV9 A;  2Z1I A;  4W5O A;  4AIL C;  4CIE A;  2OPR A;  4CFD A;  3DI6 A;  4M3U A;  3V1O A;  4FJX A;  1TL3 A;  4NCB A;  2YKM A;  5HBM A;  4KTZ A;  4CFB A;  4Q5V A;  4FJK A;  1BL3 A;  2OPP A;  4B9N A;  1RT7 A;  3ALY A;  3AVC A;  3ZSO A;  1YTA A;  4CFA A;  4HUE A;  4CGD A;  1HQE A;  3RRG A;  5SWM A;  5I42 A;  4BDY A;  2G8F A;  4FK4 A;  4H4O A;  4MQ3 A;  3RR8 A;  3CM6 A;  4KTW A;  3SUP A;  3THV A;  2KFZ A;  4DQQ A;  1T7P A;  1GOC A;  4K8Z A;  2X74 A;  2A1S A;  1WSI A;  2HNY A;  1RDC A;  2NUB A;  3MED A;  1J5O A;  1RTD A;  2G8U A;  1WSG A;  4KI4 A;  3NH0 A;  1NK9 A;  4KFB A;  1BQM A;  5FRM A;  3CFO A;  3EZ5 A;  4DU4 A;  4DTU A;  2HHX A;  1XWL A;  2I5J A;  5FDL A;  1WNS A;  4CED A;  3PX4 A;  2PYL A;  3P5J A;  4O44 A;  4DFM A;  2P1J A;  2ETJ A;  4I2P A;  3VN5 A;  2Z1G A;  4PWD A;  4MFB A;  4M3X A;  3VQP A;  1RBT A;  1IO2 A;  4M3Z A;  1LAW A;  4CHZ A;  3NDK A;  1TK0 A;  3E01 A;  4FLX A;  4ELT A;  1C0U A;  3VQC A;  3KLE A;  2DFF A;  4KI6 A;  3KD5 E;  3SCX A;  1R0A A;  4CF8 A;  3K5N A;  1Y97 A;  4CJE A;  1U45 A;  3G10 A;  1U49 A;  1TKZ A;  1JLB A;  1KVB A;  3L2W A;  4FJ9 A;  4QOZ B;  1MU2 A;  4N47 A;  3V9W A;  5DMR A;  1NJZ A;  3V81 A;  4KHY A;  1RDB A;  2ZQB A;  1TV6 A;  2GBZ A;  3LWL A;  1LW2 A;  3RMA A;  3TAG A;  1HNI A;  1TKX A;  4CJS A;  3BDP A;  4CCH A;  3TAB A;  1BCO A;  1UA0 A;  1A5X A;  4F8R A;  3HL8 A;  4N41 A;  3LWM A;  4OGE A;  5CZ1 A;  3O3H A;  3NE6 A;  4J2A A;  3HJF A;  3L3V A;  3IRX A;  3TR8 A;  1TKT A;  4DSL A;  3SI6 A;  4M3W A;  3LDS A;  1QQC A;  3OS2 A;  4DTO A;  4HCC A;  3FFI A;  4CHO A;  4KB0 A;  2HHU A;  3HK2 A;  4CEQ A;  1VK0 A;  4BE0 A;  4CIG A;  3ZT2 A;  3VQ8 A;  5HRN A;  4G1Q A;  3ZT1 A;  2O4G A;  3QIO A;  4FZY A;  3OYI A;  3L2U A;  3TAQ A;  3KD1 E;  2HHW A;  5J2P A;  4KB1 A;  4CEE A;  1QSL A;  1A5W A;  3M8P A;  4ZTF A;  4KHU A;  2XO7 A;  2HVI A;  1RTH A;  4JS4 A;  2OZS A;  4DQS A;  1HYS A;  3NH2 A;  4NCA A;  4EP4 A;  4HTU A;  3JYT A;  2EX3 A;  1LWF A;  3DLH A;  3LPU A;  4GW6 A;  1J9A A;  4CEO A;  3HM9 A;  1NK6 A;  4B9V A;  4OPK A;  1REV A;  4DTJ A;  1ASU A;  2VWJ A;  4LH4 A;  3OYH A;  1KSP A;  1J53 A;  1BI4 B;  1JXE A;  3O3G A;  4FZZ A;  4LSN A;  1HQU A;  2JGU A;  5KRT A;  2BGG A;  4OLA A;  4Y1D A;  2FC0 A;  4F2R A;  3SV3 A;  2BE2 A;  4DF4 A;  1RNH A;  2ZD1 A;  1JXB A;  3QER A; 
#chains in the Genus database with same CATH topology
 4DV5 K;  1G15 A;  1WBD A;  4LC9 B;  1BO5 O;  2QM1 A;  4DR4 K;  4CJP A;  4A62 A;  4DB3 A;  3HBT A;  4F4K A;  4LF5 K;  1BI4 A;  4JKE A;  5KGX A;  3U3G A;  4B8C A;  4FK2 A;  4PA1 A;  1S22 A;  1KC8 O;  2UXC K;  3AO2 A;  4I6M A;  1WAJ A;  3ZYY X;  4CF0 A;  2LSN A;  4I7F A;  1LCU A;  4KTQ A;  3F73 A;  1Q9Y A;  4YOT A;  4FW1 A;  3J8A A;  3L3U A;  4DQI A;  2OPQ A;  1EX4 A;  1GLB G;  1S1T A;  4FJL A;  2HHS A;  5FPE A;  3AVG A;  2PZS A;  4DTR A;  1HPZ A;  3QIN A;  3L2R A;  2P9L B;  1S1U A;  5FPM A;  3SMS A;  2E1Y A;  4RW8 A;  3VMF B;  4K0K K;  1HKC A;  5AQJ A;  4F2S A;  3LPT A;  3T1Y K;  3A5O C;  3LP3 A;  1TAQ A;  3SYZ A;  4FLT A;  4O0I A;  4KH5 A;  4B1W B;  2VG5 A;  4M3Y A;  3RR7 A;  3SJH A;  4BRD A;  5KI6 A;  4IO9 L;  3VEV A;  3MK6 A;  4BWM A;  3NGY A;  3O9T A;  3EL2 A;  5EY4 A;  2NRW A;  3P4I A;  5F1X A;  2J4R A;  2F4V K;  1KTQ A;  1ATR A;  3LZJ A;  4ICL A;  3FZL A;  4GVE A;  1EXQ A;  4X64 K;  3CJA A;  5LJW A;  3EYZ A;  3O9U A;  1RT2 A;  4PUO A;  5C25 A;  1NKB A;  3CME N;  4M7Y A;  3H6E A;  3T19 A;  3OJU A;  3MXI A;  3Q7B A;  4CJ4 A;  4B1Z A;  2P5G A;  4JEP A;  3K5L A;  1NGH A;  4BG8 A;  4HUG A;  3C6T A;  1KQS M;  4BRP A;  2KQ2 A;  1BU6 O;  3IDH A;  1P8Z A;  4FXD A;  4BE1 A;  3QLH A;  1FXX A;  5IT9 O;  3AVB A;  3AVN A;  4CJR A;  4EZ9 A;  3HPG A;  3VQ9 A;  3FZF A;  2WC9 A;  2F96 A;  4OKJ A;  4I2Q A;  3NVM A;  4CJL A;  5C0Y A;  4MO4 A;  1T03 A;  4TSX A;  1SL1 A;  3WXJ A;  1NJI O;  4KO0 A;  3WQT A;  1NK0 A;  5SZT A;  3AO4 A;  5C12 A;  2QI2 A;  3THY A;  4J2D A;  2IS3 A;  4WE1 A;  3V9Z A;  1TKD A;  1HRH A;  3VEO A;  3WT0 A;  3W3D A;  4CJF A;  1WLJ A;  3HVR A;  3C6U A;  4AHU A;  3LM2 A;  1LAV A;  3LDL A;  5AQV A;  5AQW A;  3T1A A;  2OZM A;  3OYA A;  3CC2 N;  4IFV A;  4LF7 K;  1VQN N;  4E7H A;  1L3T A;  2DFH A;  4B1V A;  5BRE A;  3PX0 A;  1Q18 A;  3ITH A;  2O8E A;  1TL1 A;  4FO0 A;  3KKR A;  4GMJ B;  4JI8 K;  3ATU A;  3SK3 A;  3P38 A;  3NAE A;  4CER A;  1DT9 A;  1I3A A;  4DUY K;  4B9L A;  3KZB A;  4DLG A;  4DQP A;  2EWS A;  4CZE A;  1HX1 A;  4H0X B;  2O8C A;  2W41 A;  4IO8 A;  4JKF A;  4JKB A;  3H3N O;  4JLH A;  3VET A;  3KIO A;  4OKE A;  1S72 N;  4CZM A;  1CZB A;  4JI7 K;  4CEA A;  3DRR A;  3BGR A;  3UE5 A;  3LP2 A;  3LZI A;  1T6D A;  2G8V A;  2NRT A;  3O8M A;  1GLJ O;  3ZSR A;  3SBG A;  3ZSZ A;  1T05 A;  4FZX C;  3GG4 A;  3AAQ A;  1RBS A;  3AAR A;  1B9D A;  3K59 A;  4PQU A;  3O80 A;  3DLK A;  5GAH P;  3TAR A;  3O5B A;  1S9G A;  3OYE A;  3TTD A;  1VQ9 N;  1Y64 A;  1NJY A;  3TSQ A;  1NMN A;  4HVJ A;  3KK3 A;  3U6F A;  3O4N A;  3FZM A;  2RHK A;  4B1X B;  4EAH D;  5HRP A;  4CF2 A;  4UY8 O;  4CZK A;  5KGW A;  2QKK A;  1OH7 A;  3NF8 A;  3KVG A;  2ZGY A;  2E5L K;  3K57 A;  4O8U A;  3VEX A;  4CZI A;  4E1M A;  5J2Q A;  2FBX A;  2OTJ N;  2DTU A;  1QVF M;  5AQO A;  4B8A B;  4AQY K;  1U04 A;  4CEB A;  3QEI A;  5AQM A;  3NF7 A;  3OA9 A;  4BAC A;  2Q97 A;  2QWR A;  3OYM A;  1F21 A;  1HKB A;  4CJ5 A;  1W9H A;  2CGK A;  4AHV A;  3WXK A;  4M3R A;  4B9U A;  2ITM A;  3ZSW A;  1EO1 A;  2O8E B;  5LL6 Z;  4IEE A;  1Z6R A;  3GOI A;  3M8R A;  1LV5 A;  2Q0U A;  1RT6 A;  3CJC A;  4HCB A;  4KHN A;  2ITG A;  3T3F A;  4H5R A;  2V51 B;  2QXL A;  3KWG A;  1FK9 A;  5CZ2 A;  4BG9 A;  1LW0 A;  1VSM A;  2G8K A;  3AA5 X;  2E2P A;  4IEI A;  4BRH A;  1VRT A;  3RSE A;  3HYF A;  4ZTJ A;  3PSI A;  4BR0 A;  4FLV A;  3TAE A;  2HHQ A;  2PAV A;  4J2E A;  3RMC A;  5CY4 A;  4AHS A;  2NRH A;  3S3M A;  1RBV A;  4BRC A;  1NK8 A;  2F7T A;  4EFH A;  1SAZ A;  2YCH A;  3AGR A;  1VQ7 N;  3VGK A;  4OO1 J;  1NU0 A;  3VES A;  4YHH K;  5C15 A;  3D6R A;  4JAX A;  4DR3 K;  4NLC A;  3M5R A;  4ILG B;  4JN4 A;  5BRF A;  3KWI A;  4CJW A;  1DLO A;  3QFP A;  4AF1 A;  2HW3 A;  2VCP A;  2IOC A;  4JI5 K;  1QVG M;  3Q7C A;  4K25 A;  1GLE G;  4QAG A;  1U48 A;  4W5T A;  2OPR A;  4CFD A;  3DI6 A;  4X66 K;  4Q5V A;  4FJK A;  4PL8 A;  1BA1 A;  3AVC A;  3EKS A;  4HUE A;  2W6L A;  1ZBS A;  2E2O A;  4FK4 A;  4H4O A;  2KKZ A;  2KFZ A;  2V7Z A;  1NNE A;  4DQQ A;  2WTU A;  4LFB K;  2QTD A;  2X74 A;  1K9M O;  4DHY A;  2A1S A;  2NUB A;  1WSG A;  4DU4 A;  3MN6 A;  2HHX A;  2I5J A;  1WNS A;  2GWJ A;  3GDQ A;  3O08 A;  4O44 A;  2O8B B;  3ZEU A;  5AQR A;  4PWD A;  4BR4 A;  4JYA K;  4M3Z A;  3NDK A;  1TK0 A;  5AQQ A;  3BP8 A;  4FLX A;  4IOX A;  2AA4 A;  3KLE A;  2NRX A;  2CGJ A;  1U49 A;  1TKZ A;  1MU2 A;  4N47 A;  3V9W A;  4KBO A;  1K8A O;  3D7E O;  2ZQB A;  1TV6 A;  2GBZ A;  4H0O A;  3LWL A;  4J8F A;  3BDP A;  2WFB A;  1BCO A;  1K8K B;  1A5X A;  2FLO A;  1UA0 A;  3HL8 A;  4PHT X;  4OGE A;  4FWM A;  1N32 K;  5AZJ A;  3SI6 A;  5FPD A;  3LDS A;  1QQC A;  3C6A A;  4MO5 A;  4B3S K;  4DTO A;  2P9U A;  3RSE B;  1QZ6 A;  4CHO A;  2UU9 K;  1Q86 O;  3HK2 A;  4BE0 A;  4CIG A;  3UKU A;  2KHO A;  5HRN A;  3ZT1 A;  3RVC A;  2HHW A;  1QSL A;  4KHU A;  1A5W A;  5AQY A;  1HYS A;  4HTU A;  2O8D A;  1LWF A;  3DLH A;  3C6H A;  2VQE K;  1J9A A;  3HM9 A;  1NK6 A;  4B9V A;  5M1O A;  3LDO A;  1ASU A;  4BR2 A;  3OYH A;  1VAZ A;  3H45 C;  1J53 A;  1HQU A;  5KRT A;  4OLA A;  4Y1D A;  2FC0 A;  3SV3 A;  3MN9 A;  5BPL A;  2ZD1 A;  4DV6 K;  4C1N I;  3KK7 A;  3IMX A;  3SQ1 A;  4IDK A;  3I55 N;  1ZBU A;  1JLA A;  1C1B A;  3HOS A;  3VA3 A;  3JSM A;  4MDB A;  5J2N A;  4WQ4 C;  3VGL A;  4FM1 A;  4C1N K;  2W42 A;  4UQG A;  4JKG B;  3VQQ A;  4IJA A;  2A5X A;  4CES A;  4E19 A;  2HHT A;  3VF6 A;  4Y0W A;  3LAL A;  3EO3 A;  1L3S A;  1VQ8 N;  2QKB A;  4B3R K;  1FW6 A;  1NGC A;  3G4S N;  3CFP A;  4IG3 A;  2QWL A;  2CH5 A;  1TAU A;  3TAM A;  2UXB K;  4DG1 A;  4E7I A;  4WFA L;  5D3G A;  3DLE A;  5IWA K;  4RG8 A;  1TUU A;  3OJS A;  4NCG A;  3BZK A;  3DYA A;  1A5V A;  3UIQ A;  1SZ2 A;  3ZEU B;  2FBY A;  5HRR A;  1RIL A;  1NGA A;  3DLL L;  3D0P A;  3DOL A;  1S5J A;  4Z4I A;  4WFN L;  4L8R B;  2P9L A;  3PSF A;  2FF3 B;  2X6N A;  2NRZ A;  4M45 A;  1WOQ A;  3ZX2 A;  1QSY A;  2WBN A;  3DLG A;  4V19 S;  5ADX H;  4DFJ A;  4B9T A;  2P9S B;  1N8R O;  2G8H A;  3ASM A;  1C0T A;  4BRA A;  2PYJ A;  2OAN A;  3PIP L;  3DOK A;  1IBL K;  3V1R A;  2OPS A;  4DTS A;  2QWO A;  3UKU B;  3DRP A;  4DTN A;  3ZLJ A;  5LMN K;  1JLQ A;  3RWU A;  1S6P A;  5TKW A;  2E2Q A;  1NKE A;  3NH1 A;  1K73 O;  2D0O A;  1N36 K;  1YXQ A;  2O8D B;  4OPH A;  4DSJ A;  4KHW A;  5LJV A;  5KQD A;  1XHX A;  1EET A;  4WCE L;  1S1W A;  3E66 A;  3EE8 A;  1HLU A;  3VA0 A;  3MDQ A;  4CBU A;  4DU1 A;  4LFA K;  4FOI A;  4JD2 A;  3ENB A;  2I7P A;  2BH1 A;  4CBX A;  3QEV A;  1TK8 A;  3H1V X;  3MCA B;  4CGG A;  5KTQ A;  1KLN A;  2P5O A;  1SQK A;  4IG0 A;  1L3U A;  3JXU A;  1YVU A;  4BRL A;  4CGH A;  4DV1 K;  1GLL O;  3LP0 A;  4FLZ A;  3D2F B;  3JAM O;  4AHC A;  2PBD A;  3HO1 A;  3AO1 A;  5EXW A;  3M6G A;  3CCR N;  3VGM A;  1NGB A;  4FLU A;  3HSC A;  4DMN A;  3HP6 A;  3CPE A;  1S1X A;  4CFC A;  3IAY A;  4K42 A;  4E3S A;  3L4Q A;  4WQ4 A;  3MXJ A;  3AGK A;  1TK5 A;  4FJJ A;  4H5N A;  4DUZ K;  3QNN A;  4QS7 A;  4KHQ A;  4CJU A;  3NFA A;  3AVJ A;  2ZJR L;  2D0A A;  3HZ6 A;  1RT3 A;  3QIP A;  4H0T B;  3K5O A;  4B08 A;  1QQN A;  4NB4 A;  1U6Z A;  4E89 A;  2P9I A;  4JI0 K;  4JI6 K;  2W6K A;  3K9K A;  3RMB A;  5JVG L;  4DSE A;  3O4W A;  3O3F A;  5H1S Q;  3SZ2 A;  1QTM A;  1VQ4 N;  4H5T A;  3WXL A;  3OS0 A;  1VQ5 N;  3I0R A;  2QXF A;  5FLX O;  5AFU A;  1HNX K;  3IG1 A;  2VG7 A;  1D9D A;  4FJN A;  3AVM A;  4CJT A;  4H5V A;  2V52 B;  3WNH A;  2FBV A;  1BDG A;  3VQE A;  1B9F A;  4Q0B A;  3U3Y A;  3WNF A;  3OBY A;  1Q7Y O;  2HNZ A;  4JI1 K;  4JI4 K;  3SUQ A;  4Z4G A;  1TYQ A;  1ESV A;  4DS5 A;  2D0B A;  1EKE A;  2HMP A;  3VF2 A;  2KZM A;  3DXK A;  1J5E K;  4JKC A;  4DR1 K;  2YKN A;  4AH9 A;  3J7Z O;  5I3U A;  1IBK K;  3D45 A;  2YJE A;  1YAG A;  3L0Q A;  3SQ4 A;  2HVH A;  3KJV A;  1HNV A;  4R5P A;  4JD2 B;  1IKW A;  2HBM A;  1SS6 A;  1T44 A;  4WQ5 A;  2Q31 A;  1HJR A;  4ISG A;  1BOT O;  1NGF A;  1WBB A;  1S9E A;  3V4I A;  4CJK A;  3NF9 A;  4A2A A;  2YHW A;  2D1K A;  4Z4F A;  5ELZ A;  3NBP A;  2O8F B;  1C0F A;  4X65 K;  4B9Q A;  3CF5 L;  5FRN A;  3KKS A;  1NLV A;  1QQO A;  1LWC A;  3M8S A;  3MX2 A;  4OPJ A;  4B9S A;  3CFR A;  2YNH A;  1JCF A;  3OTO K;  1ASV A;  3H3O B;  1VSI A;  1S1V A;  5AQG A;  2RF2 A;  4DWI A;  1QHA A;  4GKK K;  2NRV A;  3VEZ A;  3EKU A;  4CK3 A;  5F0X A;  5C42 A;  1DTT A;  3WXM B;  3VPZ A;  3DMJ A;  1MWM A;  2P9I B;  5BR8 K;  3SQ2 A;  1C6V A;  5C24 A;  4ELU A;  5JLF A;  1X9W A;  3G0Z A;  3DJC A;  4CEF A;  4W5N A;  3O9Q A;  1RDA A;  2GUP A;  4OJR A;  4BRN A;  5TKY A;  5M1N A;  5JMV A;  4C8L A;  2FXU A;  1V4S A;  2G8I A;  3LM9 A;  3TPQ A;  4OLB A;  4JI2 K;  1JCG A;  1Z26 A;  4PKH A;  3QEW A;  2QK9 A;  3CHW A;  1VSK A;  4CJQ A;  4C8O A;  3F2K A;  3FR0 A;  1OH6 A;  1ZC6 A;  3CCJ N;  3SPY A;  3HRG A;  1BA0 A;  4BRG A;  4FM0 A;  4DR5 K;  1BGX T;  1UWB A;  1VQL N;  2HF3 A;  3KHY A;  5EVZ A;  4KAZ A;  1Z25 A;  3V6D A;  1NBW A;  4IZ9 A;  4YOY A;  1HUX A;  4JHD A;  5CE3 A;  1TYQ B;  4N56 A;  3PUF A;  1NKC A;  3HVT A;  3KTQ A;  3HPH A;  4DS4 A;  2KLA A;  1VSH A;  4BRI A;  4PY5 A;  4C23 A;  1YF5 L;  1Z05 A;  4A5A A;  5A2Q O;  2B5J A;  2X6S A;  4BRE A;  1XMQ K;  3QDK A;  1JLF A;  3DXK B;  3ZSX A;  1W0H A;  4AIL C;  4W5O A;  4FWN A;  4GNI A;  4FWS A;  4M3U A;  3O9S A;  4FJX A;  4XH1 A;  5HBM A;  3ALY A;  4R79 A;  1HQE A;  3T7Z A;  4BDY A;  2G8F A;  5BN9 A;  2GTD A;  2QWN A;  4KTW A;  5BRH A;  4A2B A;  1WSI A;  1RDC A;  1RTD A;  1NK9 A;  4KFB A;  1J6Z A;  4L3Q A;  4FWK A;  4CED A;  3PX4 A;  3P5J A;  3SMP A;  3ULE A;  2P1J A;  3VN5 A;  3LL3 A;  4MFB A;  4M3X A;  3VQP A;  4CHZ A;  4CZJ A;  1YJW N;  3A5L C;  4Z94 A;  2DFF A;  4CJE A;  4H0Y B;  3G10 A;  1JLB A;  4IOC L;  3L2W A;  4FJ9 A;  1OVY A;  3V81 A;  4KHY A;  5AZI B;  2E8A A;  1T3V A;  3RMA A;  1HNI A;  1TKX A;  4CCH A;  3ID8 A;  2O8B A;  1YUW A;  2Q36 A;  1KD1 O;  5M1K A;  4N41 A;  4J2A A;  5CZ1 A;  3I8B A;  1KAZ A;  3DXM A;  4DSL A;  2P9K A;  3N4P A;  3OS2 A;  5KPZ A;  3CCE N;  4CW7 B;  5I9E B;  3CCQ N;  3ZT2 A;  3VQ8 A;  5GAD P;  2O4G A;  4WYB A;  3OYI A;  3L2U A;  4EHU A;  1K8K A;  4BY9 C;  2HVI A;  1E4G T;  4JS4 A;  2OZS A;  4CI6 A;  4PKI A;  4RCH A;  3B8A X;  3CI5 A;  3TTF A;  2VWJ A;  2OCE A;  4LH4 A;  5AQP A;  2GX9 A;  4F2R A;  4DF4 A;  4JHD B;  5EOY A;  1NWK A;  3CC7 N;  4PKG A;  3K58 A;  2ZM6 K;  3WNG A;  1GOA A;  4B1U B;  3P1G A;  4U7B A;  5GAG P;  4XH4 A;  5HLF A;  1KAX A;  1UOC A;  3AO5 A;  1D8Y A;  4KRF A;  1OH5 A;  3LDP A;  3B6O A;  1FKP A;  1Q81 O;  1SL0 A;  5FPN A;  3K0S A;  4M3T A;  3GE1 A;  3WNE A;  4DSK A;  3CCM N;  3NF6 A;  1QZ5 A;  3MX5 A;  4IBN A;  4LF8 K;  1Q82 O;  3KLF A;  2VG6 A;  3PLA A;  4XIU A;  5M1Q A;  1SKR A;  4E1J A;  2EHG A;  2VGN A;  2YV0 X;  1QE1 A;  3FGU A;  3HT3 A;  5M1P A;  4YY3 K;  2Q1N A;  3LAM A;  1E3M A;  3E9O A;  2HST A;  3VQ4 A;  3RTV A;  3MXM A;  3A2F A;  3ZSQ A;  3ULD A;  3PX6 A;  3S41 A;  1HJO A;  4HTL A;  4X62 K;  2A6A A;  3CD6 N;  1HYZ A;  4CZH A;  4JKG A;  1N5Y A;  5JIC A;  3WXI A;  3QET A;  4CJ3 A;  1WSE A;  5J1E A;  4DR2 K;  4FLY A;  4AHR A;  3ULE B;  4EHT A;  2JLE A;  3SAF A;  4AHT A;  3OYD A;  1WSH A;  3SV4 A;  4XH5 A;  3PV8 A;  1ILY A;  1X3N A;  4EP5 A;  2D5R A;  4YOV A;  4OVL A;  3NGZ A;  4K8X A;  2HF4 A;  3VQ5 A;  2QWP A;  4ISE A;  1NGE A;  1VSE A;  1CXQ A;  3KK1 A;  1X1P A;  3E9L A;  4YFU A;  3DLR A;  5BPN A;  4KPY A;  4YOU A;  3F9K A;  3DXM B;  2P9K B;  3S3N A;  2Z1H A;  1RFQ A;  4GV9 A;  1RTJ A;  1KLM A;  3V9X A;  1NK4 A;  4B3M K;  4FJM A;  3CM5 A;  4NXM K;  1KXP A;  1WUA A;  3E1Y A;  4RWT A;  3QBX A;  1N33 K;  3K5M A;  3L2V A;  4DTM A;  4DR6 K;  1X9S A;  3SAH A;  1ITG A;  4BR9 A;  1L3V A;  3FFK B;  3E9P A;  2P9S A;  4CF1 A;  3OYK A;  3NGI A;  2CH6 A;  1NJW A;  2XY6 A;  1WSF A;  3O1B A;  3W0L A;  3HST B;  1J54 A;  4Z4C A;  1ZYQ A;  3V9U A;  1X9J A;  1NJX A;  1S3X A;  4IJN A;  4Z0U A;  3KLG A;  2GEM A;  1U4B A;  4H8K A;  4CE9 A;  2QEX N;  3IKM A;  4YDU C;  1RDU A;  4LF6 K;  3HOT A;  5T7B A;  4EZ6 A;  3CJ7 A;  3AVL A;  2YHX A;  1HMV A;  3C7N A;  4YOW A;  2IVN A;  1IKY A;  1VSD A;  1WAF A;  4HUF A;  1M1K O;  4JRP A;  1JLC A;  4FSV A;  4NYN A;  1H1V A;  3I8D A;  3SQ0 A;  4H0P A;  4FVU A;  2NRR A;  3R6M A;  1R59 O;  4CK1 A;  5M1F A;  2JWK A;  3T1H K;  1BHL A;  1JL1 A;  3PO5 A;  1N6Q A;  1YHQ N;  4BRK A;  3D2F A;  3QEX A;  5KPR A;  1D9F A;  4I9Q A;  3CXC M;  3SAG A;  4IKF A;  1XNR K;  1NM1 A;  1HR0 K;  4BDP A;  3QNO A;  2IC3 A;  1YIT N;  1D5A A;  4JNE A;  4O0J A;  4H5W A;  3R8E A;  4FL9 A;  3CQ8 A;  3DLB A;  4E0D A;  4CHN A;  2BUP A;  1BG3 A;  2XY8 A;  4BQL A;  5CHI A;  3MEE A;  3OYC A;  4CJ7 A;  5HOO A;  5E26 A;  1IG9 A;  1JKH A;  2HND A;  4DV7 K;  3AVH A;  1C0M A;  5EU7 A;  2XRI A;  2YHB A;  4CGJ A;  1I39 A;  5K14 A;  2OA8 A;  3C94 A;  3DRS A;  5C10 A;  4A57 A;  1T6C A;  4AM6 A;  3CC4 N;  1W7A A;  3R1X A;  1HPM A;  1ZBF A;  3ZX0 A;  3WQU A;  1SUQ A;  4RW7 A;  4CD1 A;  4F3O A;  3AA3 A;  3WEE B;  4YNQ A;  1IKX A;  2XY7 A;  2E4L A;  3O4Q A;  5AQH A;  1IH7 A;  1QS4 A;  4AM7 A;  1C0G A;  3OYN A;  1N34 K;  3QB0 A;  4CIF A;  4B3O A;  4CJV A;  4H4M A;  1RGI A;  2P9N A;  4O5B A;  2P9P A;  1LWE A;  4E1N A;  2XHB A;  2JWL A;  4MDA A;  3BZC A;  3AVA A;  5HRO A;  2A41 A;  1NGG A;  5BR9 A;  3L8B A;  3EN9 A;  3AA4 A;  3CJB A;  3G25 A;  4WFB L;  3HTV A;  1GOB A;  3N4Q A;  2Y1I A;  2KTQ A;  2ATQ A;  3THW B;  3SLC A;  3VQB A;  3CCV N;  3ZCM A;  1NGJ A;  3AVF A;  4Z4E A;  3VEN A;  4ZHR A;  4CEC A;  3KLH A;  4FJ8 A;  2Q3S A;  2FSJ A;  4KHS A;  3C7N B;  4CHQ A;  3MEC A;  4YDU A;  3LAK A;  5JS2 A;  4FK0 A;  5AQN A;  1B92 A;  5LY3 A;  4CEZ A;  4LH5 A;  1BIU A;  2FBT A;  3D2E A;  4RW9 A;  4LSL A;  4RW4 A;  1Q8I A;  5KRS A;  4DQR A;  4LY7 A;  4HWI A;  1OKJ A;  4NXN K;  3LP1 A;  3ZT3 A;  2RPI A;  2O4I A;  3AAP A;  1RTI A;  3HPO A;  2O8F A;  1W2B M;  1IBM K;  2HBL A;  1FKO A;  4B9M A;  2WOM A;  4B3T K;  5CR4 A;  1GLA G;  3U9D A;  1BIZ A;  5JVH L;  1VRU A;  1U2V A;  2IDO A;  4DQ8 A;  1NK7 A;  3ISN C;  1JLG A;  5MLC Q;  4IFE A;  3NHG A;  3PY8 A;  4CK2 A;  4OKK A;  4C8K A;  4RW6 A;  3ZT0 A;  1BIS A;  1G99 A;  3CCL N;  1RDD A;  1VQO N;  5AQU A;  2XY5 A;  2OYQ A;  4Z4H A;  2AP1 A;  2I7N A;  4FJ7 A;  4IFY A;  4DSI A;  3LDN A;  3NVK A;  4OX9 K;  4OPA A;  1KVA A;  1YTU A;  4ILH A;  5DM6 L;  3S3O A;  3BF3 A;  4GKJ K;  1BCM A;  2B6A A;  2A40 A;  1X3M A;  1ZBI A;  1U47 A;  1RBU A;  3BEX A;  1CXU A;  4BWJ A;  4CF9 A;  1EWR A;  2Z1J A;  4BRQ A;  2P9N B;  3CG7 A;  3OYJ A;  2P9P B;  4IXC A;  3KLI A;  2F8S A;  4ELV A;  1XC9 A;  2PFU A;  4G9Z A;  2NLX A;  2E88 A;  3LAN A;  3J7A P;  3NCI A;  2GV9 A;  2Z1I A;  2VGM A;  4CBW A;  3V1O A;  4M63 C;  4NCB A;  4KTZ A;  1BL3 A;  4B9N A;  3ZSO A;  2UUC K;  3CQX A;  4BRO A;  5I42 A;  3A8Y A;  4MQ3 A;  4CZG A;  3CM6 A;  5GIP A;  3SUP A;  3THV A;  3RR8 A;  4K8Z A;  1FJG K;  3I33 A;  3U4L A;  2HHH K;  2HNY A;  3NH0 A;  1BQM A;  5FRM A;  3K9J A;  5JLH A;  3EZ5 A;  5E84 A;  1HKG A;  3OBW A;  1XWL A;  3THX A;  4KHP K;  3DWL A;  2PYL A;  2ETJ A;  4I2P A;  1I94 K;  1RBT A;  4BGB A;  1LAW A;  4CD3 A;  3D2E B;  3ENH A;  4GY2 B;  1C0U A;  3VQC A;  3SCX A;  4CF8 A;  1Y97 A;  1U45 A;  3VF4 A;  1EWQ A;  1XUP O;  1VQM N;  3FE1 A;  1YJ9 N;  5DMR A;  5DM7 L;  3AY9 A;  5KPT A;  3C65 A;  3HI0 A;  4CJS A;  5C2F A;  1XMO K;  4NO7 A;  3TAB A;  3LWM A;  3L3V A;  2VYP A;  1U2V B;  3IRX A;  4K41 A;  3TR8 A;  4JI3 K;  4M3W A;  4HCC A;  3FFI A;  4CVN E;  4XEI A;  4KB0 A;  2HHU A;  5AZI A;  3TU5 A;  4PL7 A;  3QIO A;  3SBT A;  3KD1 E;  4U67 L;  4CEE A;  3M8P A;  4ZTF A;  1RTH A;  5AQL A;  2UUB K;  4EP4 A;  3JYT A;  2E1Z A;  3GBT A;  3CER A;  3CJ9 A;  4CEO A;  5BPM A;  1MDU B;  2HBK A;  3MCP A;  1REV A;  4DTJ A;  3DAW A;  4JV5 K;  2ZF5 O;  2QW9 A;  1KAY A;  1BI4 B;  2JGU A;  2BGG A;  4BGA A;  2UUA K;  4KH4 A;  1JXB A;  4I6M B;  4NLB A;  3QER A;  2A1R A;  4WF9 L;  1YVN A;  5HRS A;  3T69 A;  2KZZ A;  4O4G A;  3CPW M;  1DGK N;  3SUO A;  1O1W A;  3QML A;  1TUY A;  1ZBH A;  5F2R A;  5FRO A;  3OVN A;  2E6M A;  4DF8 A;  1L5U A;  3TAN A;  2F8T A;  3SPZ A;  4ISF A;  1JLE A;  4M41 A;  3L2Q A;  3RMD A;  4BDZ A;  1RT1 A;  3UB5 A;  4FW2 A;  5AQF A;  4W5Q A;  1VSF A;  3CYM A;  4BRM A;  3H46 O;  2VWB A;  2KFN A;  3CIP A;  4FOE A;  1XQS C;  3M3Z A;  1GLF O;  2G8W A;  3SJJ A;  1XC3 A;  4E7J A;  3AVK A;  3THX B;  2RKI A;  3QIC A;  4N5S A;  1IG8 A;  3PO4 A;  3DM2 A;  3VEY A;  4DTP A;  1EQY A;  3U8X A;  1M90 O;  1K6Y A;  3QFU A;  1P90 A;  1VQ6 N;  4BVP A;  4I9L A;  4CGF A;  3WUH A;  2BTF A;  3ID6 A;  1CZ9 A;  1NOZ A;  1MA9 B;  4E7K A;  2UYT A;  4B1Y B;  2CGL A;  4IDH A;  1TVR A;  3CCS N;  3A5N C;  2AJQ A;  1E4F T;  2E2N A;  1CZA N;  2IIR A;  3VTI A;  3EY1 A;  3AA2 A;  4JK7 A;  3H1Q A;  1YI2 N;  1SKS A;  4LFC K;  2D4W A;  1VQP N;  3ENO A;  4FJ5 A;  4FCY A;  2YI1 A;  2Y1J A;  3CQY A;  2IVP A;  4KRE A;  2ZWH A;  3JS6 A;  3TAP A;  4OGC A;  4ID5 A;  5AR0 A;  4C8N A;  1XHZ A;  4FJH A;  2IGI A;  2WON A;  1W97 L;  1OH8 A;  4A61 A;  3QBW A;  3O6W A;  4CHY A;  3OS1 A;  4DV2 K;  3THY B;  1VSL A;  3I0S A;  3VEW A;  4QCL A;  2D0C A;  3BY5 A;  5AFU H;  4BE2 A;  1NGD A;  1MWK A;  3H08 A;  4KI4 A;  1SV5 A;  4N76 A;  4JKD A;  2HOE A;  3IS9 A;  4O55 A;  1DKG D;  4BVO A;  5J2M A;  2FSK A;  1NK5 A;  2ASP A;  4JKA A;  2QA4 N;  2FF6 A;  3MWT A;  3OYB A;  3QEP A;  4ID1 A;  3QES A;  3TTC A;  4CZL A;  2A3Z A;  3K2P A;  4DV4 K;  1HYV A;  2YJF A;  4FM2 A;  5ADX A;  4M7X A;  2DFE A;  3TWH A;  3VQ6 A;  2O8C B;  2DPN A;  5B8H A;  4DCH A;  1RT4 A;  1O13 A;  4FLW A;  2RN2 A;  1KFD A;  5AQZ A;  1HNW K;  3P39 A;  2OTL N;  3J7Y P;  1SKW A;  2RE2 A;  2YHA A;  4DTX A;  5CYM A;  2R7Y A;  1Q9X A;  2F9T A;  3TSP A;  1SL2 A;  4FWL A;  1JCE A;  4FVM A;  3I56 N;  4DU3 A;  1VHX A;  1D4X A;  1RCH A;  4NYF A;  1DTQ A;  1KFS A;  1C1C A;  4GV3 A;  1XI1 A;  3TAF A;  3HXM A;  3MN5 A;  4FWQ A;  3QO9 A;  3RRH A;  4DV0 K;  4H0V B;  3OYG A;  2IVO A;  3AO3 A;  2HMI A;  4RTF D;  5HP1 A;  2B4J A;  1S6Q A;  2VQF K;  3PIO L;  4BC3 A;  4JKH A;  4O8K A;  3IUC A;  3OHR A;  4FYD A;  3HP9 A;  4KKO A;  4BC5 A;  1X9M A;  3VTH A;  3V9S A;  4FWR A;  2X78 A;  2YHY A;  4JRQ A;  3SNN A;  5LMU K;  3IFR A;  2QWM A;  5BRD A;  4FWP A;  4A5B A;  3OY9 A;  2FSN A;  2WUS A;  3L6Q A;  3M1F A;  2F9W A;  2KW4 A;  3EE9 A;  3MMV A;  3MEG A;  1YIJ N;  3WEE A;  5AJ3 K;  3L4I A;  1T8E A;  3OYL A;  2ASM A;  5CYQ A;  1KVC A;  3ZSV A;  1ASW A;  1QHT A;  4BC4 A;  3VER A;  4HHT A;  2BDP A;  3AV9 A;  4DKW A;  1RT5 A;  4CHP A;  4W5R A;  2A42 A;  3CJ1 A;  1NOY A;  2E6L A;  2GUI A;  2PY5 A;  4E7L A;  4Y1C A;  4KV8 A;  3TI0 A;  3ZSY A;  4FJI A;  2ASO A;  2Q0R A;  3CCU N;  1TGO A;  2DY4 A;  3VQ7 A;  4DFP A;  1IJJ A;  3V1Q A;  3THW A;  3FZK A;  1VSJ A;  3BF1 A;  4M42 A;  3ZET A;  4FWO A;  2Q2R A;  2YNG A;  2V7Y A;  1QSS A;  3OYF A;  1NG9 A;  5AQK A;  3R9P A;  4BRF A;  3UKR A;  3HM8 A;  1KCF A;  3VQD A;  5BN8 A;  1WN7 A;  3OW2 M;  5JS1 A;  1GLC G;  3O1W A;  3VQA A;  1YJN N;  1EP4 A;  3CMA N;  2BAN A;  1ZBL A;  4MLH A;  3C95 A;  4DLE A;  2QWQ A;  4FJG A;  5GAE P;  4JS5 A;  4BR7 A;  4F9O A;  3KK2 A;  4LF4 K;  1JJ2 M;  3B6P A;  4GVM A;  4CGI A;  3U9Z A;  4LD0 A;  3G6E N;  3NMU A;  4GV6 A;  3AVI A;  4DSF A;  4YOX A;  1YT3 A;  3A5M C;  1BQN A;  2HHV A;  4LF9 K;  3P83 D;  1BWF O;  1ATS A;  4J2B A;  5E41 A;  3BUZ B;  3FZH A;  1JL2 A;  2YNI A;  2W40 A;  2P51 A;  5GIO A;  3S9H A;  2HBJ A;  2IAJ A;  1CLQ A;  3MAQ A;  3SUN A;  1UA1 A;  3EEQ A;  4DFK A;  1KRP A;  1UAX A;  1ZXO A;  3EZW A;  4JK8 A;  1WSJ A;  1NMD A;  1C1A A;  2H3G X;  2HB5 A;  1RBR A;  4EIA A;  3J81 O;  3R3L A;  4FPA A;  4C8M A;  3GL1 A;  3ZX3 A;  2VWK A;  1OVQ A;  1IKV A;  3M8Q A;  4JK9 A;  3ZT4 A;  2ZJQ L;  4BQZ A;  4MLE A;  4F3T A;  2YNF A;  4IOA L;  2ZE2 A;  4A59 A;  4DR7 K;  5DK5 A;  4QS9 A;  3P31 A;  4CIE A;  4O5F A;  1TL3 A;  1LOT B;  2YKM A;  2D0P A;  4CFB A;  1XNQ K;  4H03 B;  2OPP A;  1RT7 A;  1GLD G;  1YTA A;  4CFA A;  4IWV A;  4CGD A;  3RRG A;  5SWM A;  3MWP A;  1HNZ K;  4FPB A;  1IV0 A;  1T7P A;  1GOC A;  3A0I X;  4BC2 A;  4KH6 A;  3G71 N;  5C2D A;  3MED A;  4CZF A;  1J5O A;  2G8U A;  2NNW A;  3CFO A;  2YX6 A;  3ATV A;  4DTU A;  5FDL A;  3TSU A;  3O9R A;  4DFM A;  1ATN A;  1QQM A;  2Z1G A;  1RDW X;  5HL7 L;  1IO2 A;  4K43 A;  5AQT A;  3ZET B;  3E01 A;  4ELT A;  2GWK A;  4KI6 A;  3KD5 E;  5AZJ B;  1R0A A;  1BUP A;  3K5N A;  2P9U B;  1KVB A;  4QOZ B;  4BR5 A;  3UKR B;  1NJZ A;  5AQI A;  1RDB A;  1LW2 A;  3TAG A;  4QS8 A;  4F8R A;  4YOR A;  3NE6 A;  5AQX A;  3O3H A;  3HJF A;  1WB9 A;  1TKT A;  5EX5 A;  3J80 O;  2UXD K;  1V4T A;  4WQ5 C;  4CEQ A;  1VK0 A;  3VOV A;  3C0B A;  4G1Q A;  4FZY A;  3TAQ A;  3MN7 A;  5J2P A;  4KB1 A;  2XO7 A;  4DV3 K;  4DQS A;  3NH2 A;  2ZJP L;  5KQ8 A;  4NCA A;  2NZT A;  3FLC O;  2EX3 A;  3CET A;  3LPU A;  5AQS A;  4GW6 A;  4OPK A;  1NGI A;  3F5T A;  1KSP A;  4ILJ A;  1JXE A;  2GEL A;  3O3G A;  4FZZ A;  3F9M A;  4LSN A;  1VQK N;  2BE2 A;  5GIN A;  1DEJ A;  2E20 A;  1RNH A;  2ZGZ A;  3LDQ A; 
#chains in the Genus database with same CATH homology
 2A1R A;  3K58 A;  3WNG A;  1GOA A;  5HRS A;  1G15 A;  3P1G A;  3SQ1 A;  5HLF A;  1UOC A;  3AO5 A;  1D8Y A;  4KRF A;  2KZZ A;  4IDK A;  4O4G A;  4CJP A;  1ZBU A;  1JLA A;  3SUO A;  1O1W A;  1C1B A;  1FKP A;  3B6O A;  3VA3 A;  1SL0 A;  3JSM A;  1ZBH A;  4F4K A;  5FRO A;  1BI4 A;  2E6M A;  3OVN A;  3WNE A;  5J2N A;  4FM1 A;  4DF8 A;  3NF6 A;  2W42 A;  3TAN A;  1L5U A;  4IBN A;  4UQG A;  2F8T A;  3VQQ A;  5KGX A;  3SPZ A;  3U3G A;  3KLF A;  2VG6 A;  4B8C A;  4PA1 A;  4CES A;  4E19 A;  4M41 A;  1JLE A;  4FK2 A;  2HHT A;  4XIU A;  3L2Q A;  3RMD A;  4BDZ A;  3AO2 A;  1SKR A;  3LAL A;  1WAJ A;  1RT1 A;  1L3S A;  4FW2 A;  2QKB A;  4CF0 A;  2EHG A;  2LSN A;  4I7F A;  4W5Q A;  2YV0 X;  1QE1 A;  3CFP A;  1VSF A;  3HT3 A;  3CYM A;  4IG3 A;  4KTQ A;  3F73 A;  2KFN A;  1Q9Y A;  3LAM A;  1TAU A;  3TAM A;  4FW1 A;  3VQ4 A;  3RTV A;  3L3U A;  3MXM A;  3A2F A;  3ZSQ A;  3ULD A;  4DQI A;  3PX6 A;  2OPQ A;  4DG1 A;  4E7I A;  1HYZ A;  1EX4 A;  1N5Y A;  1S1T A;  4FJL A;  5D3G A;  3DLE A;  2HHS A;  2G8W A;  4RG8 A;  3AVG A;  3SJJ A;  4E7J A;  3QET A;  4CJ3 A;  3OJS A;  3AVK A;  1WSE A;  5J1E A;  1HPZ A;  2RKI A;  3QIN A;  3L2R A;  1S1U A;  4NCG A;  2PZS A;  3DYA A;  1A5V A;  4FLY A;  4AHR A;  4RW8 A;  4N5S A;  3UIQ A;  3PO4 A;  3DM2 A;  2FBY A;  5HRR A;  2JLE A;  1RIL A;  4DTP A;  4F2S A;  3D0P A;  4AHT A;  3LPT A;  1K6Y A;  3LP3 A;  1TAQ A;  3SYZ A;  4FLT A;  3OYD A;  3DOL A;  4O0I A;  1WSH A;  1S5J A;  4Z4I A;  2VG5 A;  4M3Y A;  3SV4 A;  3RR7 A;  3PV8 A;  4I9L A;  5KI6 A;  4CGF A;  4BWM A;  1CZ9 A;  1NOZ A;  4EP5 A;  2D5R A;  3NGY A;  4E7K A;  4L8R B;  4OVL A;  3NGZ A;  4K8X A;  3VQ5 A;  2X6N A;  4M45 A;  1VSE A;  1CXQ A;  1TVR A;  1X1P A;  3KK1 A;  2AJQ A;  4YFU A;  3DLR A;  4KPY A;  3F9K A;  1QSY A;  1KTQ A;  3DLG A;  4DFJ A;  4B9T A;  3EY1 A;  3LZJ A;  3AA2 A;  3S3N A;  4ICL A;  2Z1H A;  2G8H A;  1SKS A;  1EXQ A;  1KLM A;  1RTJ A;  1C0T A;  3ASM A;  3EYZ A;  3V9X A;  1NK4 A;  4FJM A;  2PYJ A;  1RT2 A;  3CM5 A;  3DOK A;  3V1R A;  2OPS A;  4PUO A;  4FJ5 A;  5C25 A;  4FCY A;  4DTS A;  3DRP A;  4DTN A;  2Y1J A;  1JLQ A;  3RWU A;  1NKB A;  1S6P A;  3K5M A;  3T19 A;  3L2V A;  4KRE A;  3OJU A;  4DTM A;  3MXI A;  3NH1 A;  1X9S A;  1NKE A;  3TAP A;  4OGC A;  1ITG A;  4CJ4 A;  2P5G A;  4ID5 A;  1L3V A;  4C8N A;  4FJH A;  1XHZ A;  3K5L A;  2IGI A;  4CF1 A;  2WON A;  3OYK A;  3NGI A;  1NJW A;  2XY6 A;  4DSJ A;  1WSF A;  4KHW A;  4HUG A;  1XHX A;  1EET A;  1S1W A;  3C6T A;  4CHY A;  3OS1 A;  3HST B;  1VSL A;  2KQ2 A;  1J54 A;  3I0S A;  3VA0 A;  4FXD A;  4BE1 A;  3QLH A;  4Z4C A;  1FXX A;  1ZYQ A;  4DU1 A;  3V9U A;  4QCL A;  2D0C A;  3AVB A;  3AVN A;  4CJR A;  4EZ9 A;  3HPG A;  1NJX A;  4Z0U A;  3VQ9 A;  3KLG A;  1U4B A;  4H8K A;  4BE2 A;  4CE9 A;  2F96 A;  3QEV A;  4OKJ A;  3H08 A;  4I2Q A;  1TK8 A;  4CJL A;  5KTQ A;  2P5O A;  1SV5 A;  4TSX A;  4CGG A;  1T03 A;  4IG0 A;  1KLN A;  1L3U A;  1SL1 A;  4N76 A;  4KO0 A;  1YVU A;  4CGH A;  3IS9 A;  4O55 A;  1NK0 A;  3LP0 A;  5J2M A;  5SZT A;  5T7B A;  3AO4 A;  4FLZ A;  1NK5 A;  4EZ6 A;  3AVL A;  4J2D A;  2IS3 A;  1HMV A;  3OYB A;  3QEP A;  4AHC A;  4WE1 A;  3V9Z A;  3HO1 A;  3AO1 A;  4ID1 A;  1TKD A;  1IKY A;  1HRH A;  1VSD A;  1WAF A;  4HUF A;  3QES A;  4JRP A;  1JLC A;  1WLJ A;  4CJF A;  3HVR A;  3C6U A;  3K2P A;  4AHU A;  4FLU A;  1HYV A;  4DMN A;  3HP6 A;  4NYN A;  4FM2 A;  1LAV A;  3I8D A;  1S1X A;  3SQ0 A;  4CFC A;  2DFE A;  3IAY A;  3T1A A;  3TWH A;  2OZM A;  3OYA A;  4E3S A;  3VQ6 A;  4IFV A;  4CK1 A;  3PO5 A;  4E7H A;  1BHL A;  1JL1 A;  3MXJ A;  1RT4 A;  1L3T A;  2DFH A;  3PX0 A;  1N6Q A;  3ITH A;  1TK5 A;  4FJJ A;  1TL1 A;  4FLW A;  2RN2 A;  3QEX A;  1KFD A;  3QNN A;  1D9F A;  3KKR A;  4GMJ B;  4CJU A;  4KHQ A;  4I9Q A;  3NFA A;  1SKW A;  3AVJ A;  4IKF A;  2D0A A;  2YHA A;  4BDP A;  4DTX A;  1RT3 A;  3NAE A;  3QNO A;  4CER A;  2IC3 A;  3QIP A;  1I3A A;  3K5O A;  5CYM A;  4B08 A;  1D5A A;  4E89 A;  4O0J A;  2R7Y A;  1Q9X A;  4B9L A;  4DLG A;  4DQP A;  3CQ8 A;  1SL2 A;  3RMB A;  3DLB A;  4E0D A;  4CHN A;  4DSE A;  2XY8 A;  4FVM A;  3O3F A;  3MEE A;  4DU3 A;  3OYC A;  3SZ2 A;  1IG9 A;  1JKH A;  1RCH A;  2HND A;  4JLH A;  1DTQ A;  4NYF A;  1KFS A;  3AVH A;  3KIO A;  4OKE A;  1QTM A;  1C0M A;  5EU7 A;  2XRI A;  1C1C A;  1CZB A;  1XI1 A;  3OS0 A;  2YHB A;  4CGJ A;  1I39 A;  3HXM A;  3I0R A;  3TAF A;  2QXF A;  5K14 A;  2OA8 A;  3C94 A;  3IG1 A;  2VG7 A;  3DRS A;  3QO9 A;  4CEA A;  3RRH A;  1D9D A;  3AVM A;  4FJN A;  3OYG A;  3DRR A;  3BGR A;  4CJT A;  3AO3 A;  2HMI A;  5HP1 A;  2B4J A;  3WNH A;  3LP2 A;  1S6Q A;  2FBV A;  3LZI A;  1ZBF A;  3VQE A;  1SUQ A;  4RW7 A;  1B9F A;  2G8V A;  4F3O A;  3AA3 A;  4Q0B A;  4FYD A;  4M3T A;  4YNQ A;  3HP9 A;  1IKX A;  2XY7 A;  2E4L A;  3O4Q A;  4DSK A;  4KKO A;  3WNF A;  3U3Y A;  1X9M A;  1IH7 A;  1QS4 A;  3V9S A;  2HNZ A;  3ZSR A;  1T05 A;  3ZSZ A;  4FZX C;  2X78 A;  3OYN A;  3SUQ A;  4JRQ A;  1RBS A;  3K59 A;  1B9D A;  3SNN A;  4CIF A;  4Z4G A;  4PQU A;  4B3O A;  3DLK A;  4H4M A;  4CJV A;  3TAR A;  4DS5 A;  2D0B A;  1EKE A;  1S9G A;  3OYE A;  3OY9 A;  4O5B A;  1NJY A;  2KW4 A;  4HVJ A;  3KK3 A;  3U6F A;  3O4N A;  1LWE A;  4E1N A;  3MEG A;  2XHB A;  3AVA A;  2KZM A;  5HRO A;  5HRP A;  4CF2 A;  2YKN A;  4AH9 A;  5KGW A;  2QKK A;  3L8B A;  5I3U A;  3NF8 A;  1T8E A;  3D45 A;  3AA4 A;  3OYL A;  3SQ4 A;  2HVH A;  3KJV A;  1HNV A;  4R5P A;  3K57 A;  1GOB A;  5CYQ A;  2Y1I A;  1IKW A;  1KVC A;  2KTQ A;  3ZSV A;  1ASW A;  1QHT A;  2ATQ A;  3VQB A;  3ZCM A;  1HJR A;  4E1M A;  4HHT A;  3AVF A;  5J2Q A;  2BDP A;  3AV9 A;  2FBX A;  4Z4E A;  1RT5 A;  4CHP A;  4W5R A;  4ZHR A;  2DTU A;  4CEC A;  3KLH A;  4FJ8 A;  1S9E A;  3V4I A;  2Q3S A;  4KHS A;  1NOY A;  2E6L A;  2GUI A;  3NF9 A;  4CJK A;  4CHQ A;  4B8A B;  2PY5 A;  1U04 A;  4E7L A;  4CEB A;  4Z4F A;  4Y1C A;  3MEC A;  3NBP A;  4KV8 A;  3QEI A;  3LAK A;  3TI0 A;  5JS2 A;  3NF7 A;  3ZSY A;  4FJI A;  5FRN A;  3KKS A;  4BAC A;  4FK0 A;  1B92 A;  1TGO A;  2DY4 A;  4CEZ A;  3VQ7 A;  3OYM A;  4DFP A;  3V1Q A;  1LWC A;  4LH5 A;  1BIU A;  1F21 A;  1VSJ A;  3M8S A;  4M42 A;  2FBT A;  4CJ5 A;  4RW9 A;  1W9H A;  4AHV A;  4LSL A;  2YNG A;  4OPJ A;  4RW4 A;  1Q8I A;  4M3R A;  3OYF A;  1QSS A;  4B9U A;  4B9S A;  3CFR A;  2YNH A;  5KRS A;  3ZSW A;  4DQR A;  1ASV A;  1VSI A;  1S1V A;  4LY7 A;  3LP1 A;  3ZT3 A;  2RPI A;  2RF2 A;  2O4I A;  4DWI A;  3HPO A;  1KCF A;  1RTI A;  3VQD A;  3M8R A;  1WN7 A;  1LV5 A;  5JS1 A;  3VQA A;  4CK3 A;  5C42 A;  1DTT A;  1RT6 A;  1EP4 A;  3DMJ A;  4HCB A;  4KHN A;  2BAN A;  1FKO A;  2ITG A;  1ZBL A;  3T3F A;  2WOM A;  4B9M A;  3C95 A;  4DLE A;  3SQ2 A;  1BIZ A;  1C6V A;  4FJG A;  5C24 A;  1FK9 A;  1VRU A;  4JS5 A;  1X9W A;  2IDO A;  3G0Z A;  5CZ2 A;  4CEF A;  4ELU A;  4W5N A;  3KK2 A;  1NK7 A;  1LW0 A;  3ISN C;  1JLG A;  1VSM A;  3B6P A;  4GVM A;  3NHG A;  4CGI A;  1RDA A;  2G8K A;  3PY8 A;  3AA5 X;  4LD0 A;  4OJR A;  4CK2 A;  1VRT A;  4ZTJ A;  3HYF A;  3AVI A;  4OKK A;  4C8K A;  4RW6 A;  4DSF A;  4FLV A;  3ZT0 A;  3TAE A;  1BIS A;  4C8L A;  1YT3 A;  2HHQ A;  2G8I A;  4J2E A;  4OLB A;  3RMC A;  1Z26 A;  5CY4 A;  3QEW A;  2QK9 A;  1BQN A;  4AHS A;  1RDD A;  2HHV A;  3S3M A;  1VSK A;  1RBV A;  4CJQ A;  1NK8 A;  4C8O A;  2XY5 A;  3P83 D;  2OYQ A;  4Z4H A;  4J2B A;  5E41 A;  3SPY A;  4IFY A;  4DSI A;  4FJ7 A;  1JL2 A;  2YNI A;  4FM0 A;  2P51 A;  1BGX T;  3S9H A;  1KVA A;  1YTU A;  2IAJ A;  1UWB A;  1CLQ A;  3S3O A;  3MAQ A;  3SUN A;  4KAZ A;  1BCM A;  2B6A A;  1UA1 A;  4DFK A;  1ZBI A;  1KRP A;  1UAX A;  1Z25 A;  3V6D A;  1U47 A;  1RBU A;  4DTR A;  1CXU A;  4BWJ A;  4CF9 A;  1WSJ A;  4N56 A;  3PUF A;  1NKC A;  3HVT A;  1C1A A;  2HB5 A;  3HPH A;  4CJW A;  2Z1J A;  1RBR A;  4DS4 A;  1DLO A;  1VSH A;  3KTQ A;  3CG7 A;  3OYJ A;  4PY5 A;  3KLI A;  4C8M A;  4ELV A;  1XC9 A;  2F8S A;  2VWK A;  2HW3 A;  1IKV A;  3M8Q A;  2B5J A;  2IOC A;  2X6S A;  3ZT4 A;  4F3T A;  2YNF A;  4QAG A;  1JLF A;  2ZE2 A;  3LAN A;  1U48 A;  3ZSX A;  1W0H A;  4W5T A;  5DK5 A;  3NCI A;  2GV9 A;  2Z1I A;  4W5O A;  4AIL C;  4CIE A;  2OPR A;  4CFD A;  3DI6 A;  4M3U A;  3V1O A;  4FJX A;  1TL3 A;  4NCB A;  2YKM A;  5HBM A;  4KTZ A;  4CFB A;  4Q5V A;  4FJK A;  1BL3 A;  2OPP A;  4B9N A;  1RT7 A;  3ALY A;  3AVC A;  3ZSO A;  1YTA A;  4CFA A;  4HUE A;  4CGD A;  1HQE A;  3RRG A;  5SWM A;  5I42 A;  4BDY A;  2G8F A;  4FK4 A;  4H4O A;  4MQ3 A;  3RR8 A;  3CM6 A;  4KTW A;  3SUP A;  3THV A;  2KFZ A;  4DQQ A;  1T7P A;  1GOC A;  4K8Z A;  2X74 A;  2A1S A;  1WSI A;  2HNY A;  1RDC A;  2NUB A;  3MED A;  1J5O A;  1RTD A;  2G8U A;  1WSG A;  4KI4 A;  3NH0 A;  1NK9 A;  4KFB A;  1BQM A;  5FRM A;  3CFO A;  3EZ5 A;  4DU4 A;  4DTU A;  2HHX A;  1XWL A;  2I5J A;  5FDL A;  1WNS A;  4CED A;  3PX4 A;  2PYL A;  3P5J A;  4O44 A;  4DFM A;  2P1J A;  2ETJ A;  4I2P A;  3VN5 A;  2Z1G A;  4PWD A;  4MFB A;  4M3X A;  3VQP A;  1RBT A;  1IO2 A;  4M3Z A;  1LAW A;  4CHZ A;  3NDK A;  1TK0 A;  3E01 A;  4FLX A;  4ELT A;  1C0U A;  3VQC A;  3KLE A;  2DFF A;  4KI6 A;  3KD5 E;  3SCX A;  1R0A A;  4CF8 A;  3K5N A;  1Y97 A;  4CJE A;  1U45 A;  3G10 A;  1U49 A;  1TKZ A;  1JLB A;  1KVB A;  3L2W A;  4FJ9 A;  4QOZ B;  1MU2 A;  4N47 A;  3V9W A;  5DMR A;  1NJZ A;  3V81 A;  4KHY A;  1RDB A;  2ZQB A;  1TV6 A;  2GBZ A;  3LWL A;  1LW2 A;  3RMA A;  3TAG A;  1HNI A;  1TKX A;  4CJS A;  3BDP A;  4CCH A;  3TAB A;  1BCO A;  1UA0 A;  1A5X A;  4F8R A;  3HL8 A;  4N41 A;  3LWM A;  4OGE A;  5CZ1 A;  3O3H A;  3NE6 A;  4J2A A;  3HJF A;  3L3V A;  3IRX A;  3TR8 A;  1TKT A;  4DSL A;  3SI6 A;  4M3W A;  3LDS A;  1QQC A;  3OS2 A;  4DTO A;  4HCC A;  3FFI A;  4CHO A;  4KB0 A;  2HHU A;  3HK2 A;  4CEQ A;  1VK0 A;  4BE0 A;  4CIG A;  3ZT2 A;  3VQ8 A;  5HRN A;  4G1Q A;  3ZT1 A;  2O4G A;  3QIO A;  4FZY A;  3OYI A;  3L2U A;  3TAQ A;  3KD1 E;  2HHW A;  5J2P A;  4KB1 A;  4CEE A;  1QSL A;  1A5W A;  3M8P A;  4ZTF A;  4KHU A;  2XO7 A;  2HVI A;  1RTH A;  4JS4 A;  2OZS A;  4DQS A;  1HYS A;  3NH2 A;  4NCA A;  4EP4 A;  4HTU A;  3JYT A;  2EX3 A;  1LWF A;  3DLH A;  3LPU A;  4GW6 A;  1J9A A;  4CEO A;  3HM9 A;  1NK6 A;  4B9V A;  4OPK A;  1REV A;  4DTJ A;  1ASU A;  2VWJ A;  4LH4 A;  3OYH A;  1KSP A;  1J53 A;  1BI4 B;  1JXE A;  3O3G A;  4FZZ A;  4LSN A;  1HQU A;  2JGU A;  5KRT A;  2BGG A;  4OLA A;  4Y1D A;  2FC0 A;  4F2R A;  3SV3 A;  2BE2 A;  4DF4 A;  1RNH A;  2ZD1 A;  1JXB A;  3QER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...