4CGHA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cghA00
1WAFA 3CFOA 4GVMA 2VG5A 1CLQA 2DTUA 4K8XA 3S9HA 1KVCA 1BGXT 4M41A 5C24A 4FYDA 5FRNA 2F96A 4CHYA 2QK9A 4M42A 1HMVA 4W5QA 5J1EA 3WNFA 4N5SA 2RN2A 3TAQA 4I2QA 4ID5A 1NK5A 2QKBA 3NF6A 4B3OA 4EP5A 2LSNA 3NFAA 5KRSA 3KJVA 1C0TA 4H4MA 3RR8A 1HPZA 4FJ8A 1C1CA 1NOYA 4DS4A 4Y1CA 1NK6A 4KRFA 3P83D 2E6LA 1RBRA 5CY4A 4PY5A 4O0JA 4TSXA 4N76A 3LP0A 3UIQA 3VA3A 1VSHA 3TANA 1WSEA 1WAJA 1EETA 3V9UA 2ETJA 3O4NA 1UA0A 1SUQA 3L3UA 2HVHA 3DRSA 2XY8A 4O0IA 2HMIA 1NKBA 3KLIA 2D0BA 3NAEA 3SPZA 1X9SA 2HNZA 4CESA 1CXUA 1KVBA 1S5JA 3S3OA 3LZJA 3U3YA 3DMJA 2A1RA 3CQ8A 4AHVA 1I3AA 3LALA 4I2PA 1WSJA 4NYFA 1IKVA 2XY6A 1D5AA 5KGWA 5KRTA 2YNGA 2HNYA 4CK1A 1L3VA 4FJXA 5HLFA 4OGEA 3TI0A 4KHUA 1RT7A 1XC9A 1QSLA 4N47A 3G0ZA 1VSEA 1EXQA 4DFJA 3SQ4A 1RT5A 4RW8A 4DTUA 1HNVA 1S1WA 3PX0A 4KAZA 4MQ3A 3I8DA 4FZXC 3QERA 2P1JA 3AVLA 3DLGA 5HP1A 4CK2A 4OVLA 3RWUA 4LD0A 3ALYA 3VQQA 4J2DA 3NF7A 4CHOA 5J2NA 3VQDA 3LDSA 4E19A 2YNIA 4E7IA 2E4LA 3O3GA 3SQ0A 4B9SA 4B9MA 3PO4A 4KKOA 3ZT2A 3NGYA 1QS4A 3QEVA 2JGUA 3DLBA 4CIGA 3OYEA 1S9EA 1IKXA 1VSFA 5FDLA 1F21A 3AVHA 4RG8A 5HROA 4F8RA 4M3UA 3M8QA 4J2BA 2VG7A 1JLQA 3K5NA 3SCXA 3VA0A 1BIZA 1U04A 3QEWA 4JLHA 4CGGA 4HHTA 2D0AA 1RT2A 4E89A 2G8HA 3OVNA 1U48A 2F8TA 1J9AA 4M3XA 4CCHA 3RMDA 1MU2A 3HO1A 4H8KA 1VRTA 1TGOA 4CEZA 4CE9A 1FKPA 2X74A 1ASVA 1JXBA 4DTXA 2QKKA 4FJGA 4FZZA 1X9WA 1CZBA 3I0SA 4KPYA 4E7HA 4CIFA 5HRPA 3OYDA 1ZBLA 4BACA 4CIEA 3QEPA 3SJJA 2Z1GA 3L2QA 3OYFA 2GUIA 4FJKA 4W5OA 2WOMA 3L2WA 1TK5A 4Z4IA 1BI4A 4KI4A 3SZ2A 3NGZA 2HW3A 4CJSA 4CF2A 2IC3A 3VQ9A 4E7JA 4B9LA 4QOZB 3M8PA 4M3RA 4F3OA 3HJFA 3LPUA 2XY5A 3HT3A 4KTWA 3WNGA 2XO7A 3WNEA 1A5XA 1FK9A 4B9VA 2PY5A 3M8RA 3SUOA 4IG3A 3AO4A 3C94A 4FZYA 2WONA 4AHCA 4E7KA 2Y1IA 1WLJA 4E0DA 4CGDA 4HUFA 1L5UA 4FJNA 1ZBIA 3AA2A 3AVBA 1T8EA 4IBNA 2P5GA 2KZMA 3VQ5A 4DLGA 4OPJA 3IG1A 4ZTFA 4FK2A 3MXIA 1JL1A 2PZSA 4FLYA 4B9UA 5FRMA 3V9SA 3AA5X 3AVMA 3ZCMA 4CJLA 2XRIA 3K59A 1VSLA 1Q9YA 3NHGA 1RTJA 1D9DA 1KCFA 3KKRA 3CG7A 4LH5A 3DYAA 3KK1A 1UWBA 2HHWA 3SNNA 4FK0A 3BGRA 2YNHA 3NH2A 5HRRA 4LSNA 3KK2A 2G8KA 3KTQA 2OZMA 4RW9A 5K14A 1ZBFA 3HVTA 3AVGA 3OYIA 1ZYQA 1QTMA 1KRPA 4DFMA 1X9MA 1RILA 4ELVA 3NH1A 3T19A 1D8YA 4DSKA 4EZ9A 1R0AA 3WNHA 3V6DA 1YTAA 3K58A 4ELTA 1NK7A 4DSEA 3OS1A 2VWKA 2G8FA 3LP2A 4G1QA 4DSFA 3LANA 2I5JA 3ZSXA 1IKWA 3TR8A 1TKTA 4CEQA 4DU3A 1GOAA 2F8SA 3OS2A 1RTHA 1DTTA 5DK5A 3ISNC 3C6TA 4M3YA 2P51A 3SQ1A 4CJPA 1J54A 4ELUA 4KV8A 3LP3A 4Z4GA 3DRPA 1ITGA 2Y1JA 1Y97A 1UA1A 2DFFA 2YHAA 5KGXA 3O3FA 1N6QA 4JRPA 1QHTA 1UOCA 4CJ4A 3AVIA 1QE1A 2B4JA 3L2RA 4K8ZA 2RF2A 1LAVA 3PX4A 1ASUA 4KFBA 4E3SA 4M3WA 2OPSA 1XI1A 4BDZA 1BQMA 3SYZA 4CJRA 4DTRA 1N5YA 1RDBA 3HPOA 2XHBA 2G8WA 1JLBA 3CM5A 2X6NA 3TARA 4OPKA 3RMBA 3QIOA 1RT3A 4PUOA 4O55A 1YTUA 4DQQA 4IKFA 4M3TA 4HUGA 3SUNA 4FJ5A 1NJZA 4CGIA 4O5BA 1YT3A 5JS2A 4R5PA 4KHYA 5J2MA 1SL1A 2HVIA 3TAEA 2B6AA 3HL8A 4KREA 4CJWA 4DU1A 3QESA 3AO5A 3SPYA 3OJUA 1KVAA 2YKNA 2XY7A 4Q0BA 2KFNA 3V1OA 1RBTA 2A1SA 3OYKA 2Z1HA 3MXJA 2YKMA 2O4GA 2PYJA 3OYGA 1FXXA 4CFAA 4W5NA 1A5WA 4XIUA 3MXMA 1JL2A 3TAFA 3SUQA 1Z25A 2RKIA 2VG6A 3MEEA 4PA1A 5C42A 1FKOA 1LWFA 4N56A 3RRHA 1B92A 1WSGA 3KLFA 3OYMA 4FCYA 4LSLA 4YNQA 4NCBA 1IO2A 4DG1A 3OYNA 3DM2A 4AH9A 2HHQA 4NCAA 4CEEA 1J5OA 1B9DA 1BL3A 1KTQA 4CGJA 4JS5A 3V9XA 1TAUA 5I3UA 2OPQA 3F73A 4CFCA 4OKKA 3V4IA 4NCGA 4B08A 4CJTA 4DQPA 4Z0UA 3DLRA 5SZTA 4BDYA 2KQ2A 1LWEA 3ZT0A 4I9LA 1ASWA 2NUBA 1BISA 3NH0A 1C6VA 2IS3A 1SL2A 1XWLA 1W9HA 4CJ3A 1RTDA 3LAKA 3OY9A 1EKEA 3CM6A 3V9WA 1NKCA 4Z4EA 2HHXA 1LV5A 1W0HA 3AVCA 4H4OA 3DOKA 3QINA 3T1AA 1RNHA 4FM0A 1S6QA 4W5RA 1TKDA 2OA8A 3ITHA 3H08A 1HQUA 3U6FA 1KLMA 1HYVA 4AHUA 3S3MA 1IG9A 4M3ZA 1VK0A 3SUPA 4PWDA 1VRUA 3VQBA 3HP9A 1JLAA 4IG0A 4CF9A 2FBYA 3AO3A 4FXDA 1C0MA 1L3SA 2KFZA 4CJQA 4CHNA 4FM2A 3VQCA 3QEXA 3OYCA 3KLEA 5KI6A 3C95A 3OYHA 1U4BA 4CEOA 1A5VA 1ZBUA 2OPRA 3F9KA 4BE0A 1BI4B 1RDDA 4CEBA 5J2QA 4WE1A 3LWLA 4PQUA 3G10A 4Z4HA 3PO5A 4OKJA 4E1NA 4OLAA 3K5MA 2X6SA 3FFIA 1RDAA 3CYMA 1NKEA 3A2FA 1VSDA 2IAJA 3SQ2A 3KLHA 4CF1A 2FBXA 1VSJA 3L8BA 3ZSZA 1LWCA 1TL3A 4FLUA 1JLCA 4DF8A 3IAYA 4EP4A 2HHVA 1S6PA 3BDPA 4J2EA 4FK4A 3DRRA 4CHQA 3VQ4A 4KHNA 3OYLA 4FJHA 4DWIA 2QXFA 4CEAA 4CHZA 3V1QA 4CEFA 4AHTA 1HRHA 3HSTB 3LP1A 1NK4A 3LPTA 1C1AA 4DTJA 1VSIA 3AA3A 1KLNA 4ZTJA 2E6MA 2EX3A 4FLTA 4FW1A 1TK0A 3TAMA 4CERA 3ZSRA 3KK3A 3OS0A 3QNNA 4E1MA 2ATQA 5CZ2A 5I42A 3V81A 1EP4A 3TABA 1LW0A 4B8AB 3L2VA 4FJLA 4HTUA 1LAWA 3EZ5A 4ID1A 3K5LA 3PX6A 3PUFA 3OYBA 1T05A 1S9GA 3P1GA 4AHRA 3MEGA 4DQSA 5CYMA 1DTQA 2DY4A 3HPGA 2YHBA 4HVJA 1WSFA 5CZ1A 3LAMA 4EZ6A 3EY1A 3NCIA 4F3TA 1NJWA 4KB0A 5SWMA 3QO9A 4LH4A 2BDPA 1VSKA 5HRSA 2GBZA 1RBVA 3PV8A 4KI6A 3RMCA 5FROA 3NF9A 3AVFA 4FJ9A 4F4KA 4OKEA 1RT6A 3DLHA 4FW2A 2W42A 1T7PA 1WN7A 4FVMA 4B9TA 4B9NA 4C8NA 2ZD1A 3NF8A 1TK8A 1L3TA 4DS5A 1KFSA 1TAQA 3ZSYA 1BCMA 4CJVA 4CECA 4KHSA 3HPHA 3K2PA 3E01A 4BWJA 3HP6A 4RW7A 3THVA 1U49A 1J53A 4CJFA 2ZE2A 3OYAA 4FM1A 2Q3SA 3RR7A 3QETA 1BHLA 1NK8A 2ITGA 3JSMA 2ZQBA 4C8LA 1TL1A 4CHPA 4CJKA 3S3NA 4Q5VA 4Y1DA 4BDPA 1RBSA 3PY8A 4FJMA 4ICLA 3C6UA 3AVKA 4CJEA 4DLEA 3OJSA 1XHZA 1L3UA 1KSPA 5EU7A 3AVJA 3QIPA 1VSMA 3KD5E 3TWHA 3NE6A 3TAPA 1U47A 3I0RA 1JLEA 1RDCA 4DMNA 4DTSA 4FJIA 3RTVA 1NK0A 2G8VA 4F2RA 3ZSOA 1Q9XA 4CJ5A 2B5JA 1S1TA 1NK9A 2X78A 1NJYA 2IGIA 1WSHA 3ZT1A 5E41A 3VN5A 1BCOA 2DFHA 3HXMA 4AILC 1Q8IA 2R7YA 1JLGA 1O1WA 4C8OA 4HUEA 3TAGA 1C0UA 2BANA 1TV6A 1RTIA 1LW2A 2IDOA 4FJJA 3IS9A 1U45A 1TVRA 1REVA 4CJUA 2Z1JA 3AA4A 3D45A 3RRGA 4OLBA 4NYNA 1Z26A 2VWJA 3B6PA 1WSIA 4FLZA 1QQCA 2G8IA 5T7BA 2DFEA 3HVRA 3ULDA 4DTPA 3MEDA 5DMRA 3VQPA 3AVAA 2AJQA 3O3HA 4F2SA 3KD1E 2JLEA 3B6OA 4HCBA 4QAGA 3CFPA 4KB1A 1K6YA 5HRNA 3ZT3A 3IRXA 4OGCA 2BE2A 2IOCA 1DLOA 2Z1IA 4Z4CA 1QSYA 4I9QA 3O4QA 5D3GA 3SI6A 2YV0X 4DQIA 2O4IA 1HJRA 1RT4A 1SKSA 3ZSVA 4AHSA 1UAXA 1SL0A 2OZSA 3U3GA 4O44A 2EHGA 4CK3A 1G15A 3NDKA 4DQRA 1D9FA 4DTOA 2D0CA 4CEDA 4RW6A 4DSIA 4QCLA 3VQAA 4CFDA 4IFVA 3JYTA 4O4GA 2G8UA 4LY7A 1TKXA 2OPPA 4M45A 3AO2A 1S1UA 5J2PA 2RPIA 4BWMA 4DU4A 3KIOA 4B8CA 1RCHA 4FLXA 3P5JA 4N41A 1B9FA 3NBPA 1CZ9A 1NJXA 2P5OA 1RBUA 2FBTA 1C1BA 4BE2A 3LZIA 3QEIA 4DSJA 4C8KA 1JXEA 1NOZA 4KHWA 1BIUA 1WNSA 2HNDA 4JRQA 1QSSA 4W5TA 3EYZA 3MAQA 3VQ7A 4HCCA 4Z4FA 2FBVA 4I7FA 3SV4A 1HYSA 2HHUA 1IKYA 3VQEA 3HYFA 4IDKA 3V9ZA 2PYLA 1S1XA 4IFYA 5KTQA 3L2UA 4GMJB 3M8SA 2OYQA 3DI6A 3ZSWA 4KO0A 4OJRA 4CF8A 4CGFA 3HK2A 1HYZA 1HNIA 1S1VA 1SKWA 4DTMA 3ZSQA 1YVUA 4CGHA 2BGGA 1T03A 1I39A 2FC0A 3AV9A 1GOCA 4GW6A 3VQ8A 3KLGA 3T3FA 5C25A 2KTQA 3SV3A 1TKZA 3L3VA 4KTZA 5CYQA 1GOBA 4C8MA 3AO1A 4YFUA 3OYJA 1RT1A 1CXQA 3DLKA 3QLHA 3QNOA 2HHSA 2KZZA 4KHQA 1ZBHA 4E7LA 1BQNA 3MECA 1HQEA 5JS1A 1SV5A 2KW4A 1KFDA 2GV9A 5HBMA 4DFPA 4CFBA 4RW4A 3AVNA 4JS4A 4L8RB 3RMAA 4KTQA 2YNFA 3K5OA 4CF0A 1IH7A 3VQ6A 3LWMA 3D0PA 4DTNA 4BE1A 1JLFA 2D5RA 4J2AA 4FLVA 4FJ7A 4DSLA 4DFKA 3CFRA 1SKRA 3DLEA 1XHXA 1EX4A 1JKHA 3ASMA 4ZHRA 3NGIA 2HHTA 3KKSA 1X1PA 3ZT4A 3DOLA 3V1RA 3HM9A 4DF4A 4FLWA 3K57A 4UQGA 4MFBA 2HB5A
chains in the Genus database with same CATH superfamily
1M1KO 2VG5A 4BR9A 4K8XA 5C24A 1HMVA 4W5QA 5J1EA 3FZMA 1JCFA 2RN2A 4ID5A 3NF6A 3KJVA 1C0TA 3ATUA 4KRFA 1J5EK 4LF5K 4O0JA 3LP0A 3VA3A 5AQJA 1VSHA 1WAJA 3GG4A 3VGMA 4BR4A 2HMIA 3FZFA 3NAEA 4DV1K 3U3YA 3DMJA 4JKEA 4H5NA 4AHVA 3LALA 3O1WA 4I2PA 1WSJA 2Q2RA 2YNGA 5BREA 4FJXA 5HLFA 4KHUA 2V52B 1QSLA 4ISGA 3SQ4A 4YOUA 1HKGA 1S1WA 5JMVA 3GE1A 4J2DA 4OVLA 4LD0A 3ALYA 4B1ZA 4FVUA 5J2NA 3OA9A 4FWRA 2JWKA 4LC9B 2O8CB 3CC2N 3QFPA 3NGYA 3BEXA 2JGUA 3DLBA 4CIGA 5FDLA 1VSFA 5HROA 3AVHA 4RG8A 5GADP 1QHAA 5AZJB 3VA0A 5AQSA 3QEWA 4CGGA 2G8HA 3QICA 2UUBK 5AQFA 1MU2A 1VRTA 3DXKB 3JAMO 3VF2A 1JXBA 4DTXA 3CJCA 4E7HA 3H6EA 5HRPA 3OYDA 2OTJN 1QVFM 1YI2N 2Z1GA 4DR5K 2WOMA 3CJAA 4Z4IA 1BI4A 3VQ9A 3WT0A 3ZEUB 4IDHA 2O8BA 4M3RA 4IOCL 3THYA 3HT3A 3LDLA 1WBDA 2P9NB 3CXCM 2PY5A 3AO4A 3C94A 2NRZA 5AQUA 1WLJA 2QI2A 1GLDG 4C1NK 4BQLA 4FJNA 3UKUA 5AQMA 1NNEA 2P5GA 4DLGA 4OPJA 4FK2A 1JL1A 4FLYA 3AA5X 3AVMA 1HX1A 3CG7A 3OHRA 3DYAA 1DT9A 1UWBA 3D6RA 3SNNA 2YNHA 5M1NA 5HRRA 2UXDK 3EE9A 4NXMK 2Q97A 5CHIA 1QTMA 4LFAK 4DFMA 1D8YA 5F2RA 3V6DA 3K58A 4B1XB 4C1NI 2G8FA 4BC5A 3LANA 1IKWA 1YUWA 2P9SB 3TR8A 3BP8A 4CEQA 4DU3A 2F8SA 2O8DB 1HKBA 2H3GX 3ISNC 2P51A 3SQ1A 3EO3A 4Z4GA 1ITGA 2Y1JA 5M1PA 3ZETA 1T3VA 4JEPA 3AVIA 3OBWA 4YORA 2ZJPL 1BQMA 4BDZA 4DTRA 2XHBA 3MX5A 2WFBA 3L6QA 4OPKA 1ZBSA 4CJ7A 1RT3A 2RE2A 4OO1J 4BR5A 1YTUA 4DQQA 4JYAK 1Q81O 5H1SQ 3LL3A 4FL9A 3VF4A 1XUPO 1YT3A 5JS2A 3TAEA 4BRQA 4CJWA 3TTFA 4Q0BA 1KVAA 5ADXH 2W40A 3SMSA 2YKMA 3OYGA 4BR0A 4W5NA 1A5WA 3MXMA 4GY2B 1Z25A 2VG6A 3MEEA 4PA1A 1T6DA 5C42A 3UKRB 3OYMA 4LSLA 4NCBA 3DM2A 1B9DA 4CGJA 3VF6A 4JKCA 3V9XA 2OPQA 2NZTA 3FFKB 4CFCA 1HNZK 4CJTA 4DR4K 4DR6K 1XWLA 1W9HA 1NGEA 3Q7CA 5LMNK 4Z4EA 4MO4A 1LV5A 1W0HA 3AVCA 2E2PA 1TKDA 4H5VA 1VQ4N 1HPMA 3J80O 2E20A 1XMOK 1IG9A 3SUPA 1OVQA 1JJ2M 1L3SA 1YJWN 2KFZA 4CJQA 1HJOA 4AF1A 4CHNA 5HOOA 3VQCA 4K43A 4JI7K 1M90O 4EIAA 2UU9K 4CEOA 2CGKA 2OPRA 5J2QA 1BI4B 3CJ7A 3VENA 3ULEA 4E1NA 3K5MA 2VGMA 3CYMA 1NKEA 2O8BB 2IAJA 3SQ2A 3THYB 1ZC6A 4H0OA 3OBYA 4I6MB 1Q82O 3ZSZA 3M3ZA 5BPMA 4DF8A 4CZHA 3CCEN 3BDPA 4BRNA 3OW2M 4KHNA 4FJHA 5EY4A 2QXFA 3AGKA 2QWMA 2CH5A 4JAXA 3GBTA 1KLNA 4KHPK 1TK0A 3KK3A 4X66K 1BWFO 2KHOA 3R1XA 3K5LA 2D1KA 3LDQA 3PUFA 4FWSA 5GAGP 1T05A 1EWQA 5CYMA 3P39A 2E1ZA 3LAMA 2KLAA 3O9UA 3MCPA 1VSKA 4LFCK 3NF9A 4X65K 4F4KA 4CJVA 1BCMA 3HPHA 3K2PA 4IO9L 5EX5A 3ZETB 4FM1A 2Q3SA 1NGIA 2ITGA 2ZQBA 4BRPA 2UUAK 4LF7K 1NWKA 3IMXA 2E5LK 1RBSA 3LM9A 3CJ9A 1NGDA 1KQSM 1XMQK 1L3UA 1KSPA 4BRDA 1VSMA 2P9LA 3KD5E 3TWHA 5KPTA 4DTSA 5LJVA 4BRCA 4DCHA 2P9KB 1NK9A 2X78A 2IGIA 5E41A 3HXMA 1BCOA 3MWPA 5C12A 2BANA 1TV6A 4GV3A 2QWNA 3A0IX 1REVA 4CJUA 3RRGA 4NYNA 1H1VA 1WSIA 3C6HA 2DFEA 3MDQA 5DMRA 3VQPA 5KQ8A 3AVAA 2JLEA 4QAGA 4BRMA 3ZT3A 3IRXA 4OGCA 2BE2A 4CZGA 1KAXA 4A2BA 1ESVA 2UYTA 2HHHK 4AHSA 4FZZA 1EWRA 1VQ6N 2EHGA 1QZ5A 1RGIA 4QCLA 4CFDA 4CI6A 1ATSA 1HKCA 4O4GA 5TKWA 2OCEA 4DU4A 3P38A 3CCJN 4FLXA 2EWSA 2FBTA 5M1KA 3O80A 2E2NA 1GLCG 1V4TA 4OPAA 1BIUA 4B3RK 2HNDA 4BC4A 1QSSA 1QQNA 3O9TA 2YHYA 5AQQA 3VQ7A 3U9DA 4Z4FA 2FBVA 1VQPN 4DV7K 2FSKA 1HYSA 4IDKA 1S1XA 4IFYA 5KTQA 1NU0A 4JI6K 4EHTA 1SKWA 3ZSQA 2WTUA 3ZYYX 3I33A 4KBOA 3T3FA 2RHKA 5CYQA 1GOBA 1RT1A 1CXQA 3DLKA 3U4LA 1BQNA 3ID6A 4WQ5C 2PBDA 1BA0A 3DAWA 4DFPA 4YHHK 3AVNA 3VQ6A 4C23A 4DTNA 1RDUA 4BE1A 2D5RA 2IVOA 4DSLA 3DLEA 4FOEA 1XHXA 1X3MA 3NGIA 3ATVA 5M1OA 2HHTA 1X1PA 4FLWA 4IZ9A 3ULDA 1YJNN 4GVMA 1IG8A 1SQKA 2PFUA 2UXBK 3S9HA 2F96A 4CHYA 4M42A 3WNFA 3EKSA 3CPEA 4B3OA 1X3NA 2LSNA 2VGNA 3HRGA 4H4MA 1HPZA 4FJ8A 1C1CA 4DS4A 4Y1CA 1NK6A 3A5NC 5CY4A 4PY5A 4TSXA 5BPLA 3UIQA 2YHWA 3O08A 3TANA 1EETA 3VGLA 1SUQA 2HVHA 3DRSA 2XY8A 1NKBA 3KLIA 3ZX3A 1CXUA 1KVBA 3BZKA 1QQMA 4NO7A 3VEYA 4AQYK 2P9LB 4NYFA 1IKVA 2ZJQL 4L3QA 3C7NA 1IV0A 4CK1A 3FZHA 1RDWX 1RT7A 1XC9A 2O8CA 2GX9A 4KH4A 3PX0A 4FZXC 1VQ9N 1BO5O 5AZJA 3NF7A 3WXMB 4YOVA 3LDSA 4E19A 1BA1A 2F7TA 3PO4A 5FLXO 1QS4A 2W41A 3QEVA 1HLUA 4BC2A 4M3UA 1IKXA 1F21A 2GEMA 3CPWM 2VG7A 3K5NA 2IIRA 1BIZA 4K25A 3CCSN 4JLHA 3IDHA 5IWAK 1RT2A 4E89A 4M3XA 3HO1A 2JWLA 1FKPA 2X74A 4RTFD 1GLBG 1X9WA 3GDQA 4KPYA 4IEEA 1JCGA 4CIFA 4YOWA 5BN9A 2P9NA 5KQDA 4BACA 3SJJA 3L2QA 4W5OA 1TK5A 2HW3A 3SZ2A 4CJSA 1NGGA 3RVCA 2ZM6K 4QOZB 3E9OA 4PKGA 3LPUA 3SJHA 4KTWA 4CBUA 3U8XA 4YOXA 3WNEA 1A5XA 1FK9A 4IG3A 4CBXA 4AHCA 4CGDA 1L5UA 4X64K 4JI0K 3TSPA 3VQ5A 2QWQA 3THWB 4ZTFA 1KAZA 2PZSA 5FRMA 3V9SA 3ZCMA 4CJLA 4RCHA 1VSLA 1Q9YA 1D9DA 1KCFA 4BGBA 2YJFA 2P9UB 3R9PA 4LSNA 2O8DA 3AVGA 1KRPA 4XH4A 1RILA 1MDUB 3WNHA 4ELTA 4DSEA 3BZCA 4JKDA 3CCRN 5JVGL 2VWKA 3C0BA 4DSFA 2E2QA 1TKTA 1GOAA 4WQ4A 5DK5A 5LY3A 3C6TA 4K0KK 2HOEA 4KV8A 3LP3A 1S72N 4JI1K 1N6QA 4JRPA 4LF6K 1QE1A 2B4JA 3L2RA 1K9MO 1LAVA 4KFBA 2OPSA 1XI1A 3TSQA 2G8WA 4CJRA 3CM5A 2X6NA 3O1BA 4A5BA 4PHTX 3VERA 4PUOA 4DHYA 4O55A 4H5WA 3CC7N 4CVNE 3DXMA 4Y0WA 3SUNA 4JK7A 4CGIA 1QQOA 4O5BA 1T44A 3UKRA 3L4IA 4KREA 4DU1A 3SPYA 3OJUA 3V1OA 2A1SA 1OVYA 1QZ6A 2Z1HA 2P9IA 4DR2K 2PYJA 1YVNA 1IBMK 3P31A 4N56A 1X9MA 1B92A 3C7NB 4YNQA 1IO2A 4IFEA 2HHQA 3I8BA 1J5OA 4JS5A 4JI5K 5I3UA 3C65A 4NCGA 4B08A 5C10A 4Z0UA 5SZTA 1VQMN 5AFUA 3F5TA 1LWEA 4I9LA 1ASWA 3MN7A 1BISA 5AJ3K 4YOYA 3A5MC 4CJ3A 3OY9A 5M1FA 1EKEA 4NXNK 2HHXA 3UE5A 4H4OA 4FM0A 3DOKA 5A2QO 1RNHA 3HOTA 1HQUA 3TTDA 3S3MA 4GV6A 1KAYA 3A5LC 3HP9A 3T1HK 2HBJA 2GTDA 3AO3A 4FXDA 3VEVA 4FM2A 1J6ZA 4I6MA 5KI6A 3KLEA 3GOIA 3OYHA 1U4BA 1E4FT 4DR1K 1ZBUA 3FZKA 4BE0A 4CEBA 4WE1A 5BRFA 3PO5A 4X62K 4OLAA 3T69A 1NGCA 2X6SA 1RDAA 4LF8K 1VSDA 3KLHA 4CF1A 1GLLO 2FBXA 1VSJA 4QS8A 3L8BA 2WUSA 1JLCA 2HHVA 4EP4A 2NLXA 4GNIA 3DLLL 4CEFA 1C1AA 2GELA 3AA3A 1YJ9N 4ZTJA 2BTFA 2E6MA 3TAMA 4E1MA 2ATQA 5I42A 3I56N 4B8AB 3ENOA 4B9QA 3EZ5A 4HTUA 3PX6A 3M6GA 3OYBA 1S9GA 3MEGA 4DQSA 1E3MA 3VETA 1NJIO 2DY4A 2YHBA 3T1YK 1WSFA 3CCQN 4F3TA 4B1WB 2BDPA 2NRRA 3PV8A 3EKUA 5FROA 1Z6RA 3AVFA 2CH6A 4B1UB 4OKEA 3DLHA 3NVKA 1T7PA 3CQYA 4FVMA 4BGAA 4B9NA 1L3TA 3NF8A 1KFSA 4DSKA 4KHSA 3THVA 4A57A 4CJFA 3RR7A 1NBWA 3MK6A 1BHLA 3JSMA 4IOXA 5KPRA 4CHPA 2P9KA 1Q7YO 1R59O 4CJKA 3S3NA 1XQSC 3AVKA 3I55N 3VTIA 1XHZA 3SAGA 4PKHA 2W6KA 3NE6A 4FJIA 2YCHA 3RTVA 2G8VA 3ZSOA 3DXMB 3A5OC 1S1TA 4O8UA 3VN5A 1Q8IA 4C8OA 1JLGA 4HUEA 4B1YB 3J7AP 1LW2A 2P9IB 4FJJA 3IS9A 4JN4A 1TVRA 5MLCQ 1K8AO 4A59A 3D45A 4OLBA 1KD1O 2VWJA 4FLZA 1QQCA 3IUCA 3MEDA 1LCUA 4HCBA 3R8EA 4KB1A 5HRNA 2QWLA 4I9QA 3F9MA 3O4QA 3PIPL 3CD6N 2YV0X 5BR8K 4FJMA 4O44A 1G15A 4RW6A 3CJ1A 3VQAA 4QS7A 1YXQA 3H1VX 5AQXA 2A40A 2WC9A 3QFUA 4IFVA 1NMNA 2G8UA 3VGKA 4B3SK 3B8AX 5AQWA 4BREA 1TKXA 3AO2A 1S1UA 4MDBA 2QW9A 4GKKK 4CZLA 2Q0UA 1RCHA 3P5JA 2P5OA 3TSUA 1RBUA 5FPDA 1Y64A 4B3MK 1JXEA 4PL8A 1NOZA 5FPEA 3J81O 4W5TA 3EYZA 3SK3A 3ENHA 3VESA 4I7FA 2HHUA 3V9ZA 3HYFA 3L2UA 5AQLA 4CGFA 4OJRA 1S1VA 1SS6A 2BGGA 1KC8O 1GOCA 3J7YP 5C25A 4MLHA 4JKGA 3L3VA 3TU5A 4YFUA 3OYJA 1C0GA 1ZBHA 3MECA 5JS1A 1SV5A 1KFDA 5HBMA 3M1FA 1IH7A 3VOVA 3FZLA 4IXCA 3LWMA 4AM6A 1JLFA 3VEXA 4DR7K 2E8AA 1EX4A 4ZHRA 3ZT4A 3DOLA 4JI4K 2QTDA 2QWPA 4UQGA 2HB5A 1WAFA 1CLQA 1KVCA 1BGXT 5FRNA 3TTCA 2QK9A 3VPZA 3TAQA 2QKBA 1Q18A 4UY8O 4I2QA 4M63C 5KRSA 4H0XB 1N36K 4H5TA 3KVGA 1K8KA 4DR3K 3P83D 2E6LA 1RBRA 4N76A 5C0YA 4G9ZA 1WSEA 3V9UA 2ETJA 3O4NA 4K41A 1UA0A 3O9QA 3QDKA 4ILJA 3PSFA 4CESA 3S3OA 1S5JA 3WXJA 3WQUA 2XY6A 1D5AA 3MN6A 5KRTA 3UB5A 2HNYA 3CCVN 4FWNA 4OGEA 2HMPA 4N47A 3SAFA 3G0ZA 4DFJA 1RT5A 4RW8A 1VQ5N 1FW6A 3QBWA 4KAZA 4MQ3A 2A3ZA 4IJAA 3QERA 5HP1A 2AA4A 2F9TA 3SQ0A 3O3GA 4B9MA 2FF3B 2ZGYA 1DGKN 4KKOA 3ZT2A 4A5AA 1T6CA 3O9SA 4H03B 1N32K 3OYEA 4B9UA 1S9EA 4K42A 3M8QA 3CQXA 4J2BA 1JLQA 1U04A 1O13A 4Z94A 2D0AA 3KK7A 3OVNA 3SLCA 1U48A 2F8TA 4A61A 3RMDA 4H0YB 4CEZA 4CE9A 2UXCK 3PIOL 2CGJA 1NGHA 3HBTA 1ZBLA 3BF3A 1MA9B 4FJKA 3L2WA 4KI4A 4A2AA 4BQZA 4CF2A 3THWA 3M8PA 5AFUH 4F3OA 2QA4N 2XY5A 3AARA 3R3LA 1IJJA 3M8RA 3SUOA 3CF5L 2WONA 2P9UA 4E7KA 4E0DA 2CGLA 1ZBIA 3AVBA 4DUYK 2O8FA 3IG1A 4B1VA 3FE1A 3MXIA 1JCEA 4FSVA 1W2BM 3EN9A 4WFNL 4JKGB 3BGRA 3KK2A 2DPNA 4RW9A 5K14A 1ZBFA 3LM2A 4DV5K 4OX9K 1NGAA 2P9PA 5GAHP 3SMPA 3J7ZO 3NH1A 3T19A 4EZ9A 1R0AA 5AQPA 4CZJA 3MN5A 3OS1A 3MCAB 3LP2A 2I5JA 4O8KA 4MDAA 2NNWA 4FWPA 5KPZA 3O5BA 3OS2A 1DTTA 2Q31A 4M3YA 4CJPA 1J54A 4DKWA 4ELUA 1UA1A 1Y97A 2DFFA 3O3FA 2HBKA 1UOCA 4DV6K 4K8ZA 1NLVA 1E4GT 4M3WA 1N5YA 3HPOA 1JLBA 5AQHA 3TARA 5E26A 3QIOA 1LOTB 5AQVA 4HUGA 1K8KB 4FJ5A 3K0SA 4A62A 4KHYA 5J2MA 2HVIA 5E84A 4KH5A 3HL8A 3QESA 5FPMA 5AQYA 3AO5A 2YKNA 2XY7A 1RBTA 4WFBL 3MXJA 4JHDA 2O4GA 1HUXA 1FXXA 1ZXOA 3HSCA 4H0VB 2VQFK 5BRHA 1OH7A 3SBTA 1JL2A 4U67L 3SUQA 3RRHA 1LWFA 1WSGA 5EOYA 3KLFA 4FCYA 3VEZA 3OYNA 4NCAA 4CEEA 1TAUA 3BF1A 3FLCO 4OKKA 4JKFA 3V4IA 4JD2B 5TKYA 4QS9A 3DLRA 5LMUK 1TUUA 2NRVA 2NUBA 5GIOA 3NH0A 3E66A 2IS3A 1SL2A 1RTDA 3BY5A 3LAKA 3V9WA 1NKCA 2PAVA 3T1AA 4W5RA 4BRLA 2OA8A 3H08A 3OTOK 1NM1A 2HF3A 1KLMA 5F1XA 5BR9A 1HYVA 3CMAN 4AHUA 4M3ZA 1VK0A 3CIPA 1TUYA 1JLAA 3A8YA 1C0MA 1OKJA 4R79A 3H3OB 2F9WA 3QEXA 3J8AA 3OYCA 3C95A 3KWIA 3H1QA 4JNEA 4PL7A 1RDDA 4NLBA 2D0PA 1YF5L 4PQUA 4Z4HA 4EAHD 3QBXA 4IWVA 3FFIA 3A2FA 3CCUN 4DUZK 4F9OA 4BRGA 1LWCA 2QWRA 1MWKA 1TL3A 1S6PA 4AM7A 5F0XA 3DRRA 3VQ4A 4CD3A 3OYLA 4DWIA 2FSJA 3EL2A 2VWBA 4CHZA 3V1QA 1HRHA 2O8FB 3VEOA 1VSIA 3ZSRA 5AQOA 3OS0A 5C2DA 4FWLA 3V81A 1EP4A 3TABA 1LW0A 3L2VA 5C2FA 1WOQA 1LAWA 4HTLA 4ID1A 3CETA 1BUPA 3P1GA 1DTQA 2P9PB 4HVJA 4EZ6A 1NJWA 5HRSA 1RBVA 3RMCA 4FJ9A 3G4SN 4FW2A 1WN7A 4WQ4C 4C8NA 2W6LA 1EO1A 4FK4A 4DS5A 1NG9A 2HHWA 4CECA 3HZ6A 2NRHA 3LDOA 4BWJA 4WF9L 4RW7A 3HP6A 3ID8A 4DB3A 1NK8A 3VTHA 4Q5VA 4WCEL 4BDPA 3TPQA 3C6UA 3HM8A 3OJSA 1IBLK 5EU7A 2A5XA 3TAPA 3HI0A 3I0RA 1U47A 4DMNA 1NMDA 1Q9XA 2B5JA 4B3TK 3KZBA 4J8FA 1WSHA 4OPHA 3ZT1A 2DFHA 4KH6A 4AILC 1DEJA 1O1WA 5AQGA 3CI5A 3TAGA 2QEXN 2E88A 4V19S 1C0UA 1TYQA 4DQ8A 4JHDB 1U45A 2VCPA 4XH1A 3B6PA 3W3DA 5T7BA 4DTPA 2AJQA 4F2SA 3KD1E 4O5FA 3NMUA 3THXB 3CFPA 1K6YA 3DWLA 3P4IA 3ZX0A 2IOCA 2QWOA 2NRTA 1DLOA 4Z4CA 3QMLA 5D3GA 3SI6A 4DQIA 1SL0A 1UAXA 3U3GA 3NDKA 4CK3A 4DQRA 1ATNA 4DTOA 2D0CA 3Q7BA 2V7ZA 4BROA 2FF6A 1S3XA 2E1YA 4M45A 2BH1A 5J2PA 1N33K 4BWMA 4CZMA 3KIOA 4B8CA 1B9FA 2FSNA 2OTLN 3NBPA 1CZ9A 1NJXA 2E2OA 5CR4A 3LZIA 4DSJA 4C8KA 1WNSA 3F2KA 4JRQA 2V7YA 4FOIA 3MAQA 4HCCA 3LDPA 3SV4A 1SZ2A 3VQEA 1Z05A 3AAQA 4GMJB 3M8SA 3DI6A 3HK2A 4KO0A 4CF8A 1ILYA 1GLJO 1GLFO 1OH6A 1T03A 2FC0A 3AV9A 4M7YA 3FGUA 4GW6A 3CCMN 3GL1A 4BR2A 2KTQA 1TKZA 4FWKA 3HOSA 4KTZA 4C8MA 4JK9A 3AO1A 5C15A 3QNOA 2D0OA 5AQKA 4E7LA 1HQEA 2AP1A 2ITMA 4BRIA 1XNRK 3AGRA 3H45C 4JS4A 3E9PA 4CF0A 2WBNA 1VAZA 4ILGB 3E9LA 4YOTA 4FJ7A 3CJBA 4DFKA 3CFRA 4U7BA 3ASMA 4MO5A 1VQKN 3KKSA 1ATRA 3HM9A 4FO0A 3K57A 4MFBA 3CFOA 2DTUA 4M41A 4JI8K 4FYDA 4BRHA 4N5SA 1NK5A 2BUPA 1U2VA 3EZWA 3NFAA 3O6WA 4EP5A 3RR8A 4CZIA 1NOYA 1HR0K 1VQ7N 1IBKK 5M1QA 3HTVA 3CHWA 3W0LA 3H46O 3L3UA 1HNXK 4IO8A 4CZKA 4O0IA 4CBWA 2D0BA 3SPZA 1X9SA 2HNZA 3VEWA 2HF4A 3LZJA 2A1RA 3CQ8A 5JVHL 3N4PA 1I3AA 4IEIA 3AY9A 2A41A 3M5RA 5KGWA 1L3VA 3AAPA 3TI0A 4LFBK 3RSEA 5LJWA 1VSEA 1EXQA 4DTUA 1WB9A 1HNVA 3D2EA 1TYQB 3I8DA 2ZJRL 2P1JA 3AVLA 3DLGA 2NRXA 3JXUA 4CK2A 3RWUA 3VQQA 3MX2A 5AQNA 4CHOA 3VQDA 2YNIA 3IFRA 4E7IA 2E4LA 4B9SA 3O4WA 2IVPA 3DJCA 4F8RA 4JKAA 1X9JA 3SCXA 3IKMA 2UUCK 5IT9O 4HHTA 1J9AA 4CCHA 2A42A 2FXUA 4H8KA 1TGOA 1I94K 1ASVA 2QKKA 4FJGA 4IJNA 1CZBA 3I0SA 5JLFA 3L0QA 4CIEA 4CW7B 3QEPA 1OH8A 2Q0RA 3OYFA 2A6AA 2VYPA 2GUIA 2ZGZA 2I7PA 3NGZA 4MLEA 2IC3A 4E7JA 4B9LA 1VQ8N 2FLOA 3K9JA 3HJFA 3WEEA 2NRWA 1VQLN 1BG3A 3WNGA 2XO7A 2YX6A 4B9VA 4LF4K 4FZYA 5AQZA 2Y1IA 4HUFA 2YI1A 3AA2A 1T8EA 2KZMA 4IBNA 5BN8A 1RFQA 4FWOA 3BUZB 4M7XA 5EVZA 2ASMA 2XRIA 5ELZA 3K59A 3NHGA 1RTJA 3KKRA 4LH5A 3KK1A 4FK0A 3NH2A 3KTQA 2OZMA 2G8KA 5EXWA 3UKUB 3HVTA 1D4XA 3OYIA 1ZYQA 3D2FA 4ELVA 1YTAA 1NK7A 2Q1NA 5AR0A 2QXLA 4G1QA 3ZSXA 1RTHA 1YITN 3DRPA 2YHAA 5KGXA 1QHTA 4CJ4A 1BU6O 4JI3K 4GVEA 2RF2A 3FR0A 3PX4A 1ASUA 4E3SA 3SYZA 1RDBA 2HBMA 5GIPA 3RMBA 4H0PA 2ZF5O 3K9KA 1NGBA 1W97L 3CCLN 1U2VB 1GLEG 4IKFA 3QB0A 4M3TA 1NJZA 4R5PA 4CZFA 4CZEA 1SL1A 2D4WA 2B6AA 4XEIA 1NGFA 2KFNA 5I9EB 3OYKA 3CC4N 1HNWK 4CFAA 3C6AA 4XIUA 3ZLJA 1VQNN 4JD2A 3TAFA 1QVGM 2RKIA 4NLCA 1FKOA 3MN9A 5B8HA 5DM7L 4DG1A 4AH9A 5CE3A 2ZWHA 1YHQN 1BL3A 1KTQA 1WBBA 3RSEB 3F73A 1CZAN 3D2EB 4DQPA 4BDYA 2KQ2A 3ZT0A 1C6VA 2IVNA 4XH5A 4NB4A 3CM6A 3QINA 3T7ZA 3G6EN 1S6QA 5GAEP 3ITHA 3E1YA 3U6FA 3G25A 2V51B 5JICA 3D7EO 1XNQK 5AZIA 4PWDA 1VRUA 1NGJA 3VQBA 4IG0A 1KXPA 4CF9A 4DV4K 3KWGA 2FBYA 1K73O 3SAHA 3WQTA 4JKBA 1A5VA 1Q86O 4EFHA 3H3NO 3F9KA 3LWLA 3G10A 3G71N 4OKJA 2OANA 3WEEB 1U6ZA 3MWTA 4WFAL 3ZX2A 1C0FA 4BC3A 4FLUA 3IAYA 1YIJN 4J2EA 4WQ5A 4CHQA 4HWIA 3ULEB 4CEAA 4AHTA 3HSTB 3LP1A 1NK4A 3LPTA 1N8RO 4DTJA 1OH5A 3CERA 2EX3A 4FLTA 4FW1A 4CERA 3QNNA 4JI2K 5DM6L 5CZ2A 1EQYA 1GLAG 4FJLA 4IOAL 4GKJK 1P8ZA 3U9ZA 4AHRA 3HPGA 3D2FB 5JLHA 5CZ1A 4BY9C 3EY1A 4JK8A 5ADXA 3NCIA 4KB0A 2O8EA 5SWMA 3QO9A 4LH4A 4KI6A 2GBZA 4BVPA 1RT6A 4GV9A 2W42A 4BVOA 5AQRA 4B9TA 2ZD1A 1TK8A 1TAQA 3ZSYA 3JS6A 3E01A 1U49A 1J53A 3OYAA 2ZE2A 3WXKA 3QETA 3O8MA 5LL6Z 4C8LA 4DV3K 1TL1A 2HSTA 4Y1DA 3PY8A 4ICLA 4RWTA 1DKGD 4CJEA 4DLEA 4BR7A 4FPBA 3AVJA 3QIPA 4BG8A 2YJEA 1JLEA 1RDCA 1NK0A 4F2RA 4CJ5A 4FWMA 1NJYA 2YHXA 3CMEN 3MMVA 1WUAA 3SBGA 2R7YA 3NVMA 3VMFB 3THXA 5AQIA 1RTIA 2IDOA 1P90A 1VHXA 2Z1JA 3AA4A 1Z26A 4H0TB 2G8IA 4YDUA 3HVRA 3O3HA 3B6OA 1MWMA 4DV0K 1FJGK 2Z1IA 1QSYA 4EHUA 2O4IA 1HJRA 1RT4A 5FPNA 3ZSVA 1SKSA 2OZSA 1SAZA 4YDUC 1D9FA 4BRFA 4JKHA 4CEDA 4DSIA 3DXKA 2ASPA 4BRAA 3LDNA 4CD1A 1G99A 3EEQA 2HBLA 3JYTA 3R6MA 4LY7A 2OPPA 4JV5K 2RPIA 2QM1A 4N41A 4LF9K 1C1BA 3S41A 3WXIA 4BE2A 3QEIA 3ZEUA 1BOTO 4KHWA 5HL7L 4PKIA 5AZIB 4ILHA 4BRKA 3WUHA 1N34K 3L4QA 4BG9A 1IKYA 1BDGA 4E1JA 2PYLA 4DV2K 1S22A 2Q36A 3ENBA 2OYQA 3ZSWA 3O9RA 1HYZA 1HNIA 4ISEA 4DTMA 1YVUA 4WYBA 4CGHA 1I39A 1V4SA 3VQ8A 3KLGA 2KKZA 3SV3A 2ASOA 2HHSA 2F4VK 3QLHA 2VQEK 1W7AA 2KZZA 4KHQA 2GWKA 2I7NA 4FPAA 2KW4A 2GV9A 2J4RA 4H5RA 1YAGA 3EE8A 3PLAA 4CFBA 4RW4A 1XC3A 5BRDA 4L8RB 3RMAA 4KTQA 2YNFA 3K5OA 2P9SA 3PSIA 3D0PA 4YY3K 3KHYA 3WXLA 4FLVA 4J2AA 4FWQA 1VQON 3N4QA 4ISFA 5AQTA 5GINA 1SKRA 1JKHA 5BPNA 3V1RA 4DF4A 2GUPA 2GWJA 2O8EB
chains in the Genus database with same CATH topology
1WAFA 3CFOA 4GVMA 2VG5A 1CLQA 2DTUA 4K8XA 3S9HA 1KVCA 1BGXT 4M41A 5C24A 4FYDA 5FRNA 2F96A 4CHYA 2QK9A 4M42A 1HMVA 4W5QA 5J1EA 3WNFA 4N5SA 2RN2A 3TAQA 4I2QA 4ID5A 1NK5A 2QKBA 3NF6A 4B3OA 4EP5A 2LSNA 3NFAA 5KRSA 3KJVA 1C0TA 4H4MA 3RR8A 1HPZA 4FJ8A 1C1CA 1NOYA 4DS4A 4Y1CA 1NK6A 4KRFA 3P83D 2E6LA 1RBRA 5CY4A 4PY5A 4O0JA 4TSXA 4N76A 3LP0A 3UIQA 3VA3A 1VSHA 3TANA 1WSEA 1WAJA 1EETA 3V9UA 2ETJA 3O4NA 1UA0A 1SUQA 3L3UA 2HVHA 3DRSA 2XY8A 4O0IA 2HMIA 1NKBA 3KLIA 2D0BA 3NAEA 3SPZA 1X9SA 2HNZA 4CESA 1CXUA 1KVBA 1S5JA 3S3OA 3LZJA 3U3YA 3DMJA 2A1RA 3CQ8A 4AHVA 1I3AA 3LALA 4I2PA 1WSJA 4NYFA 1IKVA 2XY6A 1D5AA 5KGWA 5KRTA 2YNGA 2HNYA 4CK1A 1L3VA 4FJXA 5HLFA 4OGEA 3TI0A 4KHUA 1RT7A 1XC9A 1QSLA 4N47A 3G0ZA 1VSEA 1EXQA 4DFJA 3SQ4A 1RT5A 4RW8A 4DTUA 1HNVA 1S1WA 3PX0A 4KAZA 4MQ3A 3I8DA 4FZXC 3QERA 2P1JA 3AVLA 3DLGA 5HP1A 4CK2A 4OVLA 3RWUA 4LD0A 3ALYA 3VQQA 4J2DA 3NF7A 4CHOA 5J2NA 3VQDA 3LDSA 4E19A 2YNIA 4E7IA 2E4LA 3O3GA 3SQ0A 4B9SA 4B9MA 3PO4A 4KKOA 3ZT2A 3NGYA 1QS4A 3QEVA 2JGUA 3DLBA 4CIGA 3OYEA 1S9EA 1IKXA 1VSFA 5FDLA 1F21A 3AVHA 4RG8A 5HROA 4F8RA 4M3UA 3M8QA 4J2BA 2VG7A 1JLQA 3K5NA 3SCXA 3VA0A 1BIZA 1U04A 3QEWA 4JLHA 4CGGA 4HHTA 2D0AA 1RT2A 4E89A 2G8HA 3OVNA 1U48A 2F8TA 1J9AA 4M3XA 4CCHA 3RMDA 1MU2A 3HO1A 4H8KA 1VRTA 1TGOA 4CEZA 4CE9A 1FKPA 2X74A 1ASVA 1JXBA 4DTXA 2QKKA 4FJGA 4FZZA 1X9WA 1CZBA 3I0SA 4KPYA 4E7HA 4CIFA 5HRPA 3OYDA 1ZBLA 4BACA 4CIEA 3QEPA 3SJJA 2Z1GA 3L2QA 3OYFA 2GUIA 4FJKA 4W5OA 2WOMA 3L2WA 1TK5A 4Z4IA 1BI4A 4KI4A 3SZ2A 3NGZA 2HW3A 4CJSA 4CF2A 2IC3A 3VQ9A 4E7JA 4B9LA 4QOZB 3M8PA 4M3RA 4F3OA 3HJFA 3LPUA 2XY5A 3HT3A 4KTWA 3WNGA 2XO7A 3WNEA 1A5XA 1FK9A 4B9VA 2PY5A 3M8RA 3SUOA 4IG3A 3AO4A 3C94A 4FZYA 2WONA 4AHCA 4E7KA 2Y1IA 1WLJA 4E0DA 4CGDA 4HUFA 1L5UA 4FJNA 1ZBIA 3AA2A 3AVBA 1T8EA 4IBNA 2P5GA 2KZMA 3VQ5A 4DLGA 4OPJA 3IG1A 4ZTFA 4FK2A 3MXIA 1JL1A 2PZSA 4FLYA 4B9UA 5FRMA 3V9SA 3AA5X 3AVMA 3ZCMA 4CJLA 2XRIA 3K59A 1VSLA 1Q9YA 3NHGA 1RTJA 1D9DA 1KCFA 3KKRA 3CG7A 4LH5A 3DYAA 3KK1A 1UWBA 2HHWA 3SNNA 4FK0A 3BGRA 2YNHA 3NH2A 5HRRA 4LSNA 3KK2A 2G8KA 3KTQA 2OZMA 4RW9A 5K14A 1ZBFA 3HVTA 3AVGA 3OYIA 1ZYQA 1QTMA 1KRPA 4DFMA 1X9MA 1RILA 4ELVA 3NH1A 3T19A 1D8YA 4DSKA 4EZ9A 1R0AA 3WNHA 3V6DA 1YTAA 3K58A 4ELTA 1NK7A 4DSEA 3OS1A 2VWKA 2G8FA 3LP2A 4G1QA 4DSFA 3LANA 2I5JA 3ZSXA 1IKWA 3TR8A 1TKTA 4CEQA 4DU3A 1GOAA 2F8SA 3OS2A 1RTHA 1DTTA 5DK5A 3ISNC 3C6TA 4M3YA 2P51A 3SQ1A 4CJPA 1J54A 4ELUA 4KV8A 3LP3A 4Z4GA 3DRPA 1ITGA 2Y1JA 1Y97A 1UA1A 2DFFA 2YHAA 5KGXA 3O3FA 1N6QA 4JRPA 1QHTA 1UOCA 4CJ4A 3AVIA 1QE1A 2B4JA 3L2RA 4K8ZA 2RF2A 1LAVA 3PX4A 1ASUA 4KFBA 4E3SA 4M3WA 2OPSA 1XI1A 4BDZA 1BQMA 3SYZA 4CJRA 4DTRA 1N5YA 1RDBA 3HPOA 2XHBA 2G8WA 1JLBA 3CM5A 2X6NA 3TARA 4OPKA 3RMBA 3QIOA 1RT3A 4PUOA 4O55A 1YTUA 4DQQA 4IKFA 4M3TA 4HUGA 3SUNA 4FJ5A 1NJZA 4CGIA 4O5BA 1YT3A 5JS2A 4R5PA 4KHYA 5J2MA 1SL1A 2HVIA 3TAEA 2B6AA 3HL8A 4KREA 4CJWA 4DU1A 3QESA 3AO5A 3SPYA 3OJUA 1KVAA 2YKNA 2XY7A 4Q0BA 2KFNA 3V1OA 1RBTA 2A1SA 3OYKA 2Z1HA 3MXJA 2YKMA 2O4GA 2PYJA 3OYGA 1FXXA 4CFAA 4W5NA 1A5WA 4XIUA 3MXMA 1JL2A 3TAFA 3SUQA 1Z25A 2RKIA 2VG6A 3MEEA 4PA1A 5C42A 1FKOA 1LWFA 4N56A 3RRHA 1B92A 1WSGA 3KLFA 3OYMA 4FCYA 4LSLA 4YNQA 4NCBA 1IO2A 4DG1A 3OYNA 3DM2A 4AH9A 2HHQA 4NCAA 4CEEA 1J5OA 1B9DA 1BL3A 1KTQA 4CGJA 4JS5A 3V9XA 1TAUA 5I3UA 2OPQA 3F73A 4CFCA 4OKKA 3V4IA 4NCGA 4B08A 4CJTA 4DQPA 4Z0UA 3DLRA 5SZTA 4BDYA 2KQ2A 1LWEA 3ZT0A 4I9LA 1ASWA 2NUBA 1BISA 3NH0A 1C6VA 2IS3A 1SL2A 1XWLA 1W9HA 4CJ3A 1RTDA 3LAKA 3OY9A 1EKEA 3CM6A 3V9WA 1NKCA 4Z4EA 2HHXA 1LV5A 1W0HA 3AVCA 4H4OA 3DOKA 3QINA 3T1AA 1RNHA 4FM0A 1S6QA 4W5RA 1TKDA 2OA8A 3ITHA 3H08A 1HQUA 3U6FA 1KLMA 1HYVA 4AHUA 3S3MA 1IG9A 4M3ZA 1VK0A 3SUPA 4PWDA 1VRUA 3VQBA 3HP9A 1JLAA 4IG0A 4CF9A 2FBYA 3AO3A 4FXDA 1C0MA 1L3SA 2KFZA 4CJQA 4CHNA 4FM2A 3VQCA 3QEXA 3OYCA 3KLEA 5KI6A 3C95A 3OYHA 1U4BA 4CEOA 1A5VA 1ZBUA 2OPRA 3F9KA 4BE0A 1BI4B 1RDDA 4CEBA 5J2QA 4WE1A 3LWLA 4PQUA 3G10A 4Z4HA 3PO5A 4OKJA 4E1NA 4OLAA 3K5MA 2X6SA 3FFIA 1RDAA 3CYMA 1NKEA 3A2FA 1VSDA 2IAJA 3SQ2A 3KLHA 4CF1A 2FBXA 1VSJA 3L8BA 3ZSZA 1LWCA 1TL3A 4FLUA 1JLCA 4DF8A 3IAYA 4EP4A 2HHVA 1S6PA 3BDPA 4J2EA 4FK4A 3DRRA 4CHQA 3VQ4A 4KHNA 3OYLA 4FJHA 4DWIA 2QXFA 4CEAA 4CHZA 3V1QA 4CEFA 4AHTA 1HRHA 3HSTB 3LP1A 1NK4A 3LPTA 1C1AA 4DTJA 1VSIA 3AA3A 1KLNA 4ZTJA 2E6MA 2EX3A 4FLTA 4FW1A 1TK0A 3TAMA 4CERA 3ZSRA 3KK3A 3OS0A 3QNNA 4E1MA 2ATQA 5CZ2A 5I42A 3V81A 1EP4A 3TABA 1LW0A 4B8AB 3L2VA 4FJLA 4HTUA 1LAWA 3EZ5A 4ID1A 3K5LA 3PX6A 3PUFA 3OYBA 1T05A 1S9GA 3P1GA 4AHRA 3MEGA 4DQSA 5CYMA 1DTQA 2DY4A 3HPGA 2YHBA 4HVJA 1WSFA 5CZ1A 3LAMA 4EZ6A 3EY1A 3NCIA 4F3TA 1NJWA 4KB0A 5SWMA 3QO9A 4LH4A 2BDPA 1VSKA 5HRSA 2GBZA 1RBVA 3PV8A 4KI6A 3RMCA 5FROA 3NF9A 3AVFA 4FJ9A 4F4KA 4OKEA 1RT6A 3DLHA 4FW2A 2W42A 1T7PA 1WN7A 4FVMA 4B9TA 4B9NA 4C8NA 2ZD1A 3NF8A 1TK8A 1L3TA 4DS5A 1KFSA 1TAQA 3ZSYA 1BCMA 4CJVA 4CECA 4KHSA 3HPHA 3K2PA 3E01A 4BWJA 3HP6A 4RW7A 3THVA 1U49A 1J53A 4CJFA 2ZE2A 3OYAA 4FM1A 2Q3SA 3RR7A 3QETA 1BHLA 1NK8A 2ITGA 3JSMA 2ZQBA 4C8LA 1TL1A 4CHPA 4CJKA 3S3NA 4Q5VA 4Y1DA 4BDPA 1RBSA 3PY8A 4FJMA 4ICLA 3C6UA 3AVKA 4CJEA 4DLEA 3OJSA 1XHZA 1L3UA 1KSPA 5EU7A 3AVJA 3QIPA 1VSMA 3KD5E 3TWHA 3NE6A 3TAPA 1U47A 3I0RA 1JLEA 1RDCA 4DMNA 4DTSA 4FJIA 3RTVA 1NK0A 2G8VA 4F2RA 3ZSOA 1Q9XA 4CJ5A 2B5JA 1S1TA 1NK9A 2X78A 1NJYA 2IGIA 1WSHA 3ZT1A 5E41A 3VN5A 1BCOA 2DFHA 3HXMA 4AILC 1Q8IA 2R7YA 1JLGA 1O1WA 4C8OA 4HUEA 3TAGA 1C0UA 2BANA 1TV6A 1RTIA 1LW2A 2IDOA 4FJJA 3IS9A 1U45A 1TVRA 1REVA 4CJUA 2Z1JA 3AA4A 3D45A 3RRGA 4OLBA 4NYNA 1Z26A 2VWJA 3B6PA 1WSIA 4FLZA 1QQCA 2G8IA 5T7BA 2DFEA 3HVRA 3ULDA 4DTPA 3MEDA 5DMRA 3VQPA 3AVAA 2AJQA 3O3HA 4F2SA 3KD1E 2JLEA 3B6OA 4HCBA 4QAGA 3CFPA 4KB1A 1K6YA 5HRNA 3ZT3A 3IRXA 4OGCA 2BE2A 2IOCA 1DLOA 2Z1IA 4Z4CA 1QSYA 4I9QA 3O4QA 5D3GA 3SI6A 2YV0X 4DQIA 2O4IA 1HJRA 1RT4A 1SKSA 3ZSVA 4AHSA 1UAXA 1SL0A 2OZSA 3U3GA 4O44A 2EHGA 4CK3A 1G15A 3NDKA 4DQRA 1D9FA 4DTOA 2D0CA 4CEDA 4RW6A 4DSIA 4QCLA 3VQAA 4CFDA 4IFVA 3JYTA 4O4GA 2G8UA 4LY7A 1TKXA 2OPPA 4M45A 3AO2A 1S1UA 5J2PA 2RPIA 4BWMA 4DU4A 3KIOA 4B8CA 1RCHA 4FLXA 3P5JA 4N41A 1B9FA 3NBPA 1CZ9A 1NJXA 2P5OA 1RBUA 2FBTA 1C1BA 4BE2A 3LZIA 3QEIA 4DSJA 4C8KA 1JXEA 1NOZA 4KHWA 1BIUA 1WNSA 2HNDA 4JRQA 1QSSA 4W5TA 3EYZA 3MAQA 3VQ7A 4HCCA 4Z4FA 2FBVA 4I7FA 3SV4A 1HYSA 2HHUA 1IKYA 3VQEA 3HYFA 4IDKA 3V9ZA 2PYLA 1S1XA 4IFYA 5KTQA 3L2UA 4GMJB 3M8SA 2OYQA 3DI6A 3ZSWA 4KO0A 4OJRA 4CF8A 4CGFA 3HK2A 1HYZA 1HNIA 1S1VA 1SKWA 4DTMA 3ZSQA 1YVUA 4CGHA 2BGGA 1T03A 1I39A 2FC0A 3AV9A 1GOCA 4GW6A 3VQ8A 3KLGA 3T3FA 5C25A 2KTQA 3SV3A 1TKZA 3L3VA 4KTZA 5CYQA 1GOBA 4C8MA 3AO1A 4YFUA 3OYJA 1RT1A 1CXQA 3DLKA 3QLHA 3QNOA 2HHSA 2KZZA 4KHQA 1ZBHA 4E7LA 1BQNA 3MECA 1HQEA 5JS1A 1SV5A 2KW4A 1KFDA 2GV9A 5HBMA 4DFPA 4CFBA 4RW4A 3AVNA 4JS4A 4L8RB 3RMAA 4KTQA 2YNFA 3K5OA 4CF0A 1IH7A 3VQ6A 3LWMA 3D0PA 4DTNA 4BE1A 1JLFA 2D5RA 4J2AA 4FLVA 4FJ7A 4DSLA 4DFKA 3CFRA 1SKRA 3DLEA 1XHXA 1EX4A 1JKHA 3ASMA 4ZHRA 3NGIA 2HHTA 3KKSA 1X1PA 3ZT4A 3DOLA 3V1RA 3HM9A 4DF4A 4FLWA 3K57A 4UQGA 4MFBA 2HB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WAF A;  3CFO A;  4GVM A;  2VG5 A;  1CLQ A;  2DTU A;  4K8X A;  3S9H A;  1KVC A;  1BGX T;  4M41 A;  5C24 A;  4FYD A;  5FRN A;  2F96 A;  4CHY A;  2QK9 A;  4M42 A;  1HMV A;  4W5Q A;  5J1E A;  3WNF A;  4N5S A;  2RN2 A;  3TAQ A;  4I2Q A;  4ID5 A;  1NK5 A;  2QKB A;  3NF6 A;  4B3O A;  4EP5 A;  2LSN A;  3NFA A;  5KRS A;  3KJV A;  1C0T A;  4H4M A;  3RR8 A;  1HPZ A;  4FJ8 A;  1C1C A;  1NOY A;  4DS4 A;  4Y1C A;  1NK6 A;  4KRF A;  3P83 D;  2E6L A;  1RBR A;  5CY4 A;  4PY5 A;  4O0J A;  4TSX A;  4N76 A;  3LP0 A;  3UIQ A;  3VA3 A;  1VSH A;  3TAN A;  1WSE A;  1WAJ A;  1EET A;  3V9U A;  2ETJ A;  3O4N A;  1UA0 A;  1SUQ A;  3L3U A;  2HVH A;  3DRS A;  2XY8 A;  4O0I A;  2HMI A;  1NKB A;  3KLI A;  2D0B A;  3NAE A;  3SPZ A;  1X9S A;  2HNZ A;  4CES A;  1CXU A;  1KVB A;  1S5J A;  3S3O A;  3LZJ A;  3U3Y A;  3DMJ A;  2A1R A;  3CQ8 A;  4AHV A;  1I3A A;  3LAL A;  4I2P A;  1WSJ A;  4NYF A;  1IKV A;  2XY6 A;  1D5A A;  5KGW A;  5KRT A;  2YNG A;  2HNY A;  4CK1 A;  1L3V A;  4FJX A;  5HLF A;  4OGE A;  3TI0 A;  4KHU A;  1RT7 A;  1XC9 A;  1QSL A;  4N47 A;  3G0Z A;  1VSE A;  1EXQ A;  4DFJ A;  3SQ4 A;  1RT5 A;  4RW8 A;  4DTU A;  1HNV A;  1S1W A;  3PX0 A;  4KAZ A;  4MQ3 A;  3I8D A;  4FZX C;  3QER A;  2P1J A;  3AVL A;  3DLG A;  5HP1 A;  4CK2 A;  4OVL A;  3RWU A;  4LD0 A;  3ALY A;  3VQQ A;  4J2D A;  3NF7 A;  4CHO A;  5J2N A;  3VQD A;  3LDS A;  4E19 A;  2YNI A;  4E7I A;  2E4L A;  3O3G A;  3SQ0 A;  4B9S A;  4B9M A;  3PO4 A;  4KKO A;  3ZT2 A;  3NGY A;  1QS4 A;  3QEV A;  2JGU A;  3DLB A;  4CIG A;  3OYE A;  1S9E A;  1IKX A;  1VSF A;  5FDL A;  1F21 A;  3AVH A;  4RG8 A;  5HRO A;  4F8R A;  4M3U A;  3M8Q A;  4J2B A;  2VG7 A;  1JLQ A;  3K5N A;  3SCX A;  3VA0 A;  1BIZ A;  1U04 A;  3QEW A;  4JLH A;  4CGG A;  4HHT A;  2D0A A;  1RT2 A;  4E89 A;  2G8H A;  3OVN A;  1U48 A;  2F8T A;  1J9A A;  4M3X A;  4CCH A;  3RMD A;  1MU2 A;  3HO1 A;  4H8K A;  1VRT A;  1TGO A;  4CEZ A;  4CE9 A;  1FKP A;  2X74 A;  1ASV A;  1JXB A;  4DTX A;  2QKK A;  4FJG A;  4FZZ A;  1X9W A;  1CZB A;  3I0S A;  4KPY A;  4E7H A;  4CIF A;  5HRP A;  3OYD A;  1ZBL A;  4BAC A;  4CIE A;  3QEP A;  3SJJ A;  2Z1G A;  3L2Q A;  3OYF A;  2GUI A;  4FJK A;  4W5O A;  2WOM A;  3L2W A;  1TK5 A;  4Z4I A;  1BI4 A;  4KI4 A;  3SZ2 A;  3NGZ A;  2HW3 A;  4CJS A;  4CF2 A;  2IC3 A;  3VQ9 A;  4E7J A;  4B9L A;  4QOZ B;  3M8P A;  4M3R A;  4F3O A;  3HJF A;  3LPU A;  2XY5 A;  3HT3 A;  4KTW A;  3WNG A;  2XO7 A;  3WNE A;  1A5X A;  1FK9 A;  4B9V A;  2PY5 A;  3M8R A;  3SUO A;  4IG3 A;  3AO4 A;  3C94 A;  4FZY A;  2WON A;  4AHC A;  4E7K A;  2Y1I A;  1WLJ A;  4E0D A;  4CGD A;  4HUF A;  1L5U A;  4FJN A;  1ZBI A;  3AA2 A;  3AVB A;  1T8E A;  4IBN A;  2P5G A;  2KZM A;  3VQ5 A;  4DLG A;  4OPJ A;  3IG1 A;  4ZTF A;  4FK2 A;  3MXI A;  1JL1 A;  2PZS A;  4FLY A;  4B9U A;  5FRM A;  3V9S A;  3AA5 X;  3AVM A;  3ZCM A;  4CJL A;  2XRI A;  3K59 A;  1VSL A;  1Q9Y A;  3NHG A;  1RTJ A;  1D9D A;  1KCF A;  3KKR A;  3CG7 A;  4LH5 A;  3DYA A;  3KK1 A;  1UWB A;  2HHW A;  3SNN A;  4FK0 A;  3BGR A;  2YNH A;  3NH2 A;  5HRR A;  4LSN A;  3KK2 A;  2G8K A;  3KTQ A;  2OZM A;  4RW9 A;  5K14 A;  1ZBF A;  3HVT A;  3AVG A;  3OYI A;  1ZYQ A;  1QTM A;  1KRP A;  4DFM A;  1X9M A;  1RIL A;  4ELV A;  3NH1 A;  3T19 A;  1D8Y A;  4DSK A;  4EZ9 A;  1R0A A;  3WNH A;  3V6D A;  1YTA A;  3K58 A;  4ELT A;  1NK7 A;  4DSE A;  3OS1 A;  2VWK A;  2G8F A;  3LP2 A;  4G1Q A;  4DSF A;  3LAN A;  2I5J A;  3ZSX A;  1IKW A;  3TR8 A;  1TKT A;  4CEQ A;  4DU3 A;  1GOA A;  2F8S A;  3OS2 A;  1RTH A;  1DTT A;  5DK5 A;  3ISN C;  3C6T A;  4M3Y A;  2P51 A;  3SQ1 A;  4CJP A;  1J54 A;  4ELU A;  4KV8 A;  3LP3 A;  4Z4G A;  3DRP A;  1ITG A;  2Y1J A;  1Y97 A;  1UA1 A;  2DFF A;  2YHA A;  5KGX A;  3O3F A;  1N6Q A;  4JRP A;  1QHT A;  1UOC A;  4CJ4 A;  3AVI A;  1QE1 A;  2B4J A;  3L2R A;  4K8Z A;  2RF2 A;  1LAV A;  3PX4 A;  1ASU A;  4KFB A;  4E3S A;  4M3W A;  2OPS A;  1XI1 A;  4BDZ A;  1BQM A;  3SYZ A;  4CJR A;  4DTR A;  1N5Y A;  1RDB A;  3HPO A;  2XHB A;  2G8W A;  1JLB A;  3CM5 A;  2X6N A;  3TAR A;  4OPK A;  3RMB A;  3QIO A;  1RT3 A;  4PUO A;  4O55 A;  1YTU A;  4DQQ A;  4IKF A;  4M3T A;  4HUG A;  3SUN A;  4FJ5 A;  1NJZ A;  4CGI A;  4O5B A;  1YT3 A;  5JS2 A;  4R5P A;  4KHY A;  5J2M A;  1SL1 A;  2HVI A;  3TAE A;  2B6A A;  3HL8 A;  4KRE A;  4CJW A;  4DU1 A;  3QES A;  3AO5 A;  3SPY A;  3OJU A;  1KVA A;  2YKN A;  2XY7 A;  4Q0B A;  2KFN A;  3V1O A;  1RBT A;  2A1S A;  3OYK A;  2Z1H A;  3MXJ A;  2YKM A;  2O4G A;  2PYJ A;  3OYG A;  1FXX A;  4CFA A;  4W5N A;  1A5W A;  4XIU A;  3MXM A;  1JL2 A;  3TAF A;  3SUQ A;  1Z25 A;  2RKI A;  2VG6 A;  3MEE A;  4PA1 A;  5C42 A;  1FKO A;  1LWF A;  4N56 A;  3RRH A;  1B92 A;  1WSG A;  3KLF A;  3OYM A;  4FCY A;  4LSL A;  4YNQ A;  4NCB A;  1IO2 A;  4DG1 A;  3OYN A;  3DM2 A;  4AH9 A;  2HHQ A;  4NCA A;  4CEE A;  1J5O A;  1B9D A;  1BL3 A;  1KTQ A;  4CGJ A;  4JS5 A;  3V9X A;  1TAU A;  5I3U A;  2OPQ A;  3F73 A;  4CFC A;  4OKK A;  3V4I A;  4NCG A;  4B08 A;  4CJT A;  4DQP A;  4Z0U A;  3DLR A;  5SZT A;  4BDY A;  2KQ2 A;  1LWE A;  3ZT0 A;  4I9L A;  1ASW A;  2NUB A;  1BIS A;  3NH0 A;  1C6V A;  2IS3 A;  1SL2 A;  1XWL A;  1W9H A;  4CJ3 A;  1RTD A;  3LAK A;  3OY9 A;  1EKE A;  3CM6 A;  3V9W A;  1NKC A;  4Z4E A;  2HHX A;  1LV5 A;  1W0H A;  3AVC A;  4H4O A;  3DOK A;  3QIN A;  3T1A A;  1RNH A;  4FM0 A;  1S6Q A;  4W5R A;  1TKD A;  2OA8 A;  3ITH A;  3H08 A;  1HQU A;  3U6F A;  1KLM A;  1HYV A;  4AHU A;  3S3M A;  1IG9 A;  4M3Z A;  1VK0 A;  3SUP A;  4PWD A;  1VRU A;  3VQB A;  3HP9 A;  1JLA A;  4IG0 A;  4CF9 A;  2FBY A;  3AO3 A;  4FXD A;  1C0M A;  1L3S A;  2KFZ A;  4CJQ A;  4CHN A;  4FM2 A;  3VQC A;  3QEX A;  3OYC A;  3KLE A;  5KI6 A;  3C95 A;  3OYH A;  1U4B A;  4CEO A;  1A5V A;  1ZBU A;  2OPR A;  3F9K A;  4BE0 A;  1BI4 B;  1RDD A;  4CEB A;  5J2Q A;  4WE1 A;  3LWL A;  4PQU A;  3G10 A;  4Z4H A;  3PO5 A;  4OKJ A;  4E1N A;  4OLA A;  3K5M A;  2X6S A;  3FFI A;  1RDA A;  3CYM A;  1NKE A;  3A2F A;  1VSD A;  2IAJ A;  3SQ2 A;  3KLH A;  4CF1 A;  2FBX A;  1VSJ A;  3L8B A;  3ZSZ A;  1LWC A;  1TL3 A;  4FLU A;  1JLC A;  4DF8 A;  3IAY A;  4EP4 A;  2HHV A;  1S6P A;  3BDP A;  4J2E A;  4FK4 A;  3DRR A;  4CHQ A;  3VQ4 A;  4KHN A;  3OYL A;  4FJH A;  4DWI A;  2QXF A;  4CEA A;  4CHZ A;  3V1Q A;  4CEF A;  4AHT A;  1HRH A;  3HST B;  3LP1 A;  1NK4 A;  3LPT A;  1C1A A;  4DTJ A;  1VSI A;  3AA3 A;  1KLN A;  4ZTJ A;  2E6M A;  2EX3 A;  4FLT A;  4FW1 A;  1TK0 A;  3TAM A;  4CER A;  3ZSR A;  3KK3 A;  3OS0 A;  3QNN A;  4E1M A;  2ATQ A;  5CZ2 A;  5I42 A;  3V81 A;  1EP4 A;  3TAB A;  1LW0 A;  4B8A B;  3L2V A;  4FJL A;  4HTU A;  1LAW A;  3EZ5 A;  4ID1 A;  3K5L A;  3PX6 A;  3PUF A;  3OYB A;  1T05 A;  1S9G A;  3P1G A;  4AHR A;  3MEG A;  4DQS A;  5CYM A;  1DTQ A;  2DY4 A;  3HPG A;  2YHB A;  4HVJ A;  1WSF A;  5CZ1 A;  3LAM A;  4EZ6 A;  3EY1 A;  3NCI A;  4F3T A;  1NJW A;  4KB0 A;  5SWM A;  3QO9 A;  4LH4 A;  2BDP A;  1VSK A;  5HRS A;  2GBZ A;  1RBV A;  3PV8 A;  4KI6 A;  3RMC A;  5FRO A;  3NF9 A;  3AVF A;  4FJ9 A;  4F4K A;  4OKE A;  1RT6 A;  3DLH A;  4FW2 A;  2W42 A;  1T7P A;  1WN7 A;  4FVM A;  4B9T A;  4B9N A;  4C8N A;  2ZD1 A;  3NF8 A;  1TK8 A;  1L3T A;  4DS5 A;  1KFS A;  1TAQ A;  3ZSY A;  1BCM A;  4CJV A;  4CEC A;  4KHS A;  3HPH A;  3K2P A;  3E01 A;  4BWJ A;  3HP6 A;  4RW7 A;  3THV A;  1U49 A;  1J53 A;  4CJF A;  2ZE2 A;  3OYA A;  4FM1 A;  2Q3S A;  3RR7 A;  3QET A;  1BHL A;  1NK8 A;  2ITG A;  3JSM A;  2ZQB A;  4C8L A;  1TL1 A;  4CHP A;  4CJK A;  3S3N A;  4Q5V A;  4Y1D A;  4BDP A;  1RBS A;  3PY8 A;  4FJM A;  4ICL A;  3C6U A;  3AVK A;  4CJE A;  4DLE A;  3OJS A;  1XHZ A;  1L3U A;  1KSP A;  5EU7 A;  3AVJ A;  3QIP A;  1VSM A;  3KD5 E;  3TWH A;  3NE6 A;  3TAP A;  1U47 A;  3I0R A;  1JLE A;  1RDC A;  4DMN A;  4DTS A;  4FJI A;  3RTV A;  1NK0 A;  2G8V A;  4F2R A;  3ZSO A;  1Q9X A;  4CJ5 A;  2B5J A;  1S1T A;  1NK9 A;  2X78 A;  1NJY A;  2IGI A;  1WSH A;  3ZT1 A;  5E41 A;  3VN5 A;  1BCO A;  2DFH A;  3HXM A;  4AIL C;  1Q8I A;  2R7Y A;  1JLG A;  1O1W A;  4C8O A;  4HUE A;  3TAG A;  1C0U A;  2BAN A;  1TV6 A;  1RTI A;  1LW2 A;  2IDO A;  4FJJ A;  3IS9 A;  1U45 A;  1TVR A;  1REV A;  4CJU A;  2Z1J A;  3AA4 A;  3D45 A;  3RRG A;  4OLB A;  4NYN A;  1Z26 A;  2VWJ A;  3B6P A;  1WSI A;  4FLZ A;  1QQC A;  2G8I A;  5T7B A;  2DFE A;  3HVR A;  3ULD A;  4DTP A;  3MED A;  5DMR A;  3VQP A;  3AVA A;  2AJQ A;  3O3H A;  4F2S A;  3KD1 E;  2JLE A;  3B6O A;  4HCB A;  4QAG A;  3CFP A;  4KB1 A;  1K6Y A;  5HRN A;  3ZT3 A;  3IRX A;  4OGC A;  2BE2 A;  2IOC A;  1DLO A;  2Z1I A;  4Z4C A;  1QSY A;  4I9Q A;  3O4Q A;  5D3G A;  3SI6 A;  2YV0 X;  4DQI A;  2O4I A;  1HJR A;  1RT4 A;  1SKS A;  3ZSV A;  4AHS A;  1UAX A;  1SL0 A;  2OZS A;  3U3G A;  4O44 A;  2EHG A;  4CK3 A;  1G15 A;  3NDK A;  4DQR A;  1D9F A;  4DTO A;  2D0C A;  4CED A;  4RW6 A;  4DSI A;  4QCL A;  3VQA A;  4CFD A;  4IFV A;  3JYT A;  4O4G A;  2G8U A;  4LY7 A;  1TKX A;  2OPP A;  4M45 A;  3AO2 A;  1S1U A;  5J2P A;  2RPI A;  4BWM A;  4DU4 A;  3KIO A;  4B8C A;  1RCH A;  4FLX A;  3P5J A;  4N41 A;  1B9F A;  3NBP A;  1CZ9 A;  1NJX A;  2P5O A;  1RBU A;  2FBT A;  1C1B A;  4BE2 A;  3LZI A;  3QEI A;  4DSJ A;  4C8K A;  1JXE A;  1NOZ A;  4KHW A;  1BIU A;  1WNS A;  2HND A;  4JRQ A;  1QSS A;  4W5T A;  3EYZ A;  3MAQ A;  3VQ7 A;  4HCC A;  4Z4F A;  2FBV A;  4I7F A;  3SV4 A;  1HYS A;  2HHU A;  1IKY A;  3VQE A;  3HYF A;  4IDK A;  3V9Z A;  2PYL A;  1S1X A;  4IFY A;  5KTQ A;  3L2U A;  4GMJ B;  3M8S A;  2OYQ A;  3DI6 A;  3ZSW A;  4KO0 A;  4OJR A;  4CF8 A;  4CGF A;  3HK2 A;  1HYZ A;  1HNI A;  1S1V A;  1SKW A;  4DTM A;  3ZSQ A;  1YVU A;  4CGH A;  2BGG A;  1T03 A;  1I39 A;  2FC0 A;  3AV9 A;  1GOC A;  4GW6 A;  3VQ8 A;  3KLG A;  3T3F A;  5C25 A;  2KTQ A;  3SV3 A;  1TKZ A;  3L3V A;  4KTZ A;  5CYQ A;  1GOB A;  4C8M A;  3AO1 A;  4YFU A;  3OYJ A;  1RT1 A;  1CXQ A;  3DLK A;  3QLH A;  3QNO A;  2HHS A;  2KZZ A;  4KHQ A;  1ZBH A;  4E7L A;  1BQN A;  3MEC A;  1HQE A;  5JS1 A;  1SV5 A;  2KW4 A;  1KFD A;  2GV9 A;  5HBM A;  4DFP A;  4CFB A;  4RW4 A;  3AVN A;  4JS4 A;  4L8R B;  3RMA A;  4KTQ A;  2YNF A;  3K5O A;  4CF0 A;  1IH7 A;  3VQ6 A;  3LWM A;  3D0P A;  4DTN A;  4BE1 A;  1JLF A;  2D5R A;  4J2A A;  4FLV A;  4FJ7 A;  4DSL A;  4DFK A;  3CFR A;  1SKR A;  3DLE A;  1XHX A;  1EX4 A;  1JKH A;  3ASM A;  4ZHR A;  3NGI A;  2HHT A;  3KKS A;  1X1P A;  3ZT4 A;  3DOL A;  3V1R A;  3HM9 A;  4DF4 A;  4FLW A;  3K57 A;  4UQG A;  4MFB A;  2HB5 A; 
#chains in the Genus database with same CATH topology
 1M1K O;  2VG5 A;  4BR9 A;  4K8X A;  5C24 A;  1HMV A;  4W5Q A;  5J1E A;  3FZM A;  1JCF A;  2RN2 A;  4ID5 A;  3NF6 A;  3KJV A;  1C0T A;  3ATU A;  4KRF A;  1J5E K;  4LF5 K;  4O0J A;  3LP0 A;  3VA3 A;  5AQJ A;  1VSH A;  1WAJ A;  3GG4 A;  3VGM A;  4BR4 A;  2HMI A;  3FZF A;  3NAE A;  4DV1 K;  3U3Y A;  3DMJ A;  4JKE A;  4H5N A;  4AHV A;  3LAL A;  3O1W A;  4I2P A;  1WSJ A;  2Q2R A;  2YNG A;  5BRE A;  4FJX A;  5HLF A;  4KHU A;  2V52 B;  1QSL A;  4ISG A;  3SQ4 A;  4YOU A;  1HKG A;  1S1W A;  5JMV A;  3GE1 A;  4J2D A;  4OVL A;  4LD0 A;  3ALY A;  4B1Z A;  4FVU A;  5J2N A;  3OA9 A;  4FWR A;  2JWK A;  4LC9 B;  2O8C B;  3CC2 N;  3QFP A;  3NGY A;  3BEX A;  2JGU A;  3DLB A;  4CIG A;  5FDL A;  1VSF A;  5HRO A;  3AVH A;  4RG8 A;  5GAD P;  1QHA A;  5AZJ B;  3VA0 A;  5AQS A;  3QEW A;  4CGG A;  2G8H A;  3QIC A;  2UUB K;  5AQF A;  1MU2 A;  1VRT A;  3DXK B;  3JAM O;  3VF2 A;  1JXB A;  4DTX A;  3CJC A;  4E7H A;  3H6E A;  5HRP A;  3OYD A;  2OTJ N;  1QVF M;  1YI2 N;  2Z1G A;  4DR5 K;  2WOM A;  3CJA A;  4Z4I A;  1BI4 A;  3VQ9 A;  3WT0 A;  3ZEU B;  4IDH A;  2O8B A;  4M3R A;  4IOC L;  3THY A;  3HT3 A;  3LDL A;  1WBD A;  2P9N B;  3CXC M;  2PY5 A;  3AO4 A;  3C94 A;  2NRZ A;  5AQU A;  1WLJ A;  2QI2 A;  1GLD G;  4C1N K;  4BQL A;  4FJN A;  3UKU A;  5AQM A;  1NNE A;  2P5G A;  4DLG A;  4OPJ A;  4FK2 A;  1JL1 A;  4FLY A;  3AA5 X;  3AVM A;  1HX1 A;  3CG7 A;  3OHR A;  3DYA A;  1DT9 A;  1UWB A;  3D6R A;  3SNN A;  2YNH A;  5M1N A;  5HRR A;  2UXD K;  3EE9 A;  4NXM K;  2Q97 A;  5CHI A;  1QTM A;  4LFA K;  4DFM A;  1D8Y A;  5F2R A;  3V6D A;  3K58 A;  4B1X B;  4C1N I;  2G8F A;  4BC5 A;  3LAN A;  1IKW A;  1YUW A;  2P9S B;  3TR8 A;  3BP8 A;  4CEQ A;  4DU3 A;  2F8S A;  2O8D B;  1HKB A;  2H3G X;  3ISN C;  2P51 A;  3SQ1 A;  3EO3 A;  4Z4G A;  1ITG A;  2Y1J A;  5M1P A;  3ZET A;  1T3V A;  4JEP A;  3AVI A;  3OBW A;  4YOR A;  2ZJP L;  1BQM A;  4BDZ A;  4DTR A;  2XHB A;  3MX5 A;  2WFB A;  3L6Q A;  4OPK A;  1ZBS A;  4CJ7 A;  1RT3 A;  2RE2 A;  4OO1 J;  4BR5 A;  1YTU A;  4DQQ A;  4JYA K;  1Q81 O;  5H1S Q;  3LL3 A;  4FL9 A;  3VF4 A;  1XUP O;  1YT3 A;  5JS2 A;  3TAE A;  4BRQ A;  4CJW A;  3TTF A;  4Q0B A;  1KVA A;  5ADX H;  2W40 A;  3SMS A;  2YKM A;  3OYG A;  4BR0 A;  4W5N A;  1A5W A;  3MXM A;  4GY2 B;  1Z25 A;  2VG6 A;  3MEE A;  4PA1 A;  1T6D A;  5C42 A;  3UKR B;  3OYM A;  4LSL A;  4NCB A;  3DM2 A;  1B9D A;  4CGJ A;  3VF6 A;  4JKC A;  3V9X A;  2OPQ A;  2NZT A;  3FFK B;  4CFC A;  1HNZ K;  4CJT A;  4DR4 K;  4DR6 K;  1XWL A;  1W9H A;  1NGE A;  3Q7C A;  5LMN K;  4Z4E A;  4MO4 A;  1LV5 A;  1W0H A;  3AVC A;  2E2P A;  1TKD A;  4H5V A;  1VQ4 N;  1HPM A;  3J80 O;  2E20 A;  1XMO K;  1IG9 A;  3SUP A;  1OVQ A;  1JJ2 M;  1L3S A;  1YJW N;  2KFZ A;  4CJQ A;  1HJO A;  4AF1 A;  4CHN A;  5HOO A;  3VQC A;  4K43 A;  4JI7 K;  1M90 O;  4EIA A;  2UU9 K;  4CEO A;  2CGK A;  2OPR A;  5J2Q A;  1BI4 B;  3CJ7 A;  3VEN A;  3ULE A;  4E1N A;  3K5M A;  2VGM A;  3CYM A;  1NKE A;  2O8B B;  2IAJ A;  3SQ2 A;  3THY B;  1ZC6 A;  4H0O A;  3OBY A;  4I6M B;  1Q82 O;  3ZSZ A;  3M3Z A;  5BPM A;  4DF8 A;  4CZH A;  3CCE N;  3BDP A;  4BRN A;  3OW2 M;  4KHN A;  4FJH A;  5EY4 A;  2QXF A;  3AGK A;  2QWM A;  2CH5 A;  4JAX A;  3GBT A;  1KLN A;  4KHP K;  1TK0 A;  3KK3 A;  4X66 K;  1BWF O;  2KHO A;  3R1X A;  3K5L A;  2D1K A;  3LDQ A;  3PUF A;  4FWS A;  5GAG P;  1T05 A;  1EWQ A;  5CYM A;  3P39 A;  2E1Z A;  3LAM A;  2KLA A;  3O9U A;  3MCP A;  1VSK A;  4LFC K;  3NF9 A;  4X65 K;  4F4K A;  4CJV A;  1BCM A;  3HPH A;  3K2P A;  4IO9 L;  5EX5 A;  3ZET B;  4FM1 A;  2Q3S A;  1NGI A;  2ITG A;  2ZQB A;  4BRP A;  2UUA K;  4LF7 K;  1NWK A;  3IMX A;  2E5L K;  1RBS A;  3LM9 A;  3CJ9 A;  1NGD A;  1KQS M;  1XMQ K;  1L3U A;  1KSP A;  4BRD A;  1VSM A;  2P9L A;  3KD5 E;  3TWH A;  5KPT A;  4DTS A;  5LJV A;  4BRC A;  4DCH A;  2P9K B;  1NK9 A;  2X78 A;  2IGI A;  5E41 A;  3HXM A;  1BCO A;  3MWP A;  5C12 A;  2BAN A;  1TV6 A;  4GV3 A;  2QWN A;  3A0I X;  1REV A;  4CJU A;  3RRG A;  4NYN A;  1H1V A;  1WSI A;  3C6H A;  2DFE A;  3MDQ A;  5DMR A;  3VQP A;  5KQ8 A;  3AVA A;  2JLE A;  4QAG A;  4BRM A;  3ZT3 A;  3IRX A;  4OGC A;  2BE2 A;  4CZG A;  1KAX A;  4A2B A;  1ESV A;  2UYT A;  2HHH K;  4AHS A;  4FZZ A;  1EWR A;  1VQ6 N;  2EHG A;  1QZ5 A;  1RGI A;  4QCL A;  4CFD A;  4CI6 A;  1ATS A;  1HKC A;  4O4G A;  5TKW A;  2OCE A;  4DU4 A;  3P38 A;  3CCJ N;  4FLX A;  2EWS A;  2FBT A;  5M1K A;  3O80 A;  2E2N A;  1GLC G;  1V4T A;  4OPA A;  1BIU A;  4B3R K;  2HND A;  4BC4 A;  1QSS A;  1QQN A;  3O9T A;  2YHY A;  5AQQ A;  3VQ7 A;  3U9D A;  4Z4F A;  2FBV A;  1VQP N;  4DV7 K;  2FSK A;  1HYS A;  4IDK A;  1S1X A;  4IFY A;  5KTQ A;  1NU0 A;  4JI6 K;  4EHT A;  1SKW A;  3ZSQ A;  2WTU A;  3ZYY X;  3I33 A;  4KBO A;  3T3F A;  2RHK A;  5CYQ A;  1GOB A;  1RT1 A;  1CXQ A;  3DLK A;  3U4L A;  1BQN A;  3ID6 A;  4WQ5 C;  2PBD A;  1BA0 A;  3DAW A;  4DFP A;  4YHH K;  3AVN A;  3VQ6 A;  4C23 A;  4DTN A;  1RDU A;  4BE1 A;  2D5R A;  2IVO A;  4DSL A;  3DLE A;  4FOE A;  1XHX A;  1X3M A;  3NGI A;  3ATV A;  5M1O A;  2HHT A;  1X1P A;  4FLW A;  4IZ9 A;  3ULD A;  1YJN N;  4GVM A;  1IG8 A;  1SQK A;  2PFU A;  2UXB K;  3S9H A;  2F96 A;  4CHY A;  4M42 A;  3WNF A;  3EKS A;  3CPE A;  4B3O A;  1X3N A;  2LSN A;  2VGN A;  3HRG A;  4H4M A;  1HPZ A;  4FJ8 A;  1C1C A;  4DS4 A;  4Y1C A;  1NK6 A;  3A5N C;  5CY4 A;  4PY5 A;  4TSX A;  5BPL A;  3UIQ A;  2YHW A;  3O08 A;  3TAN A;  1EET A;  3VGL A;  1SUQ A;  2HVH A;  3DRS A;  2XY8 A;  1NKB A;  3KLI A;  3ZX3 A;  1CXU A;  1KVB A;  3BZK A;  1QQM A;  4NO7 A;  3VEY A;  4AQY K;  2P9L B;  4NYF A;  1IKV A;  2ZJQ L;  4L3Q A;  3C7N A;  1IV0 A;  4CK1 A;  3FZH A;  1RDW X;  1RT7 A;  1XC9 A;  2O8C A;  2GX9 A;  4KH4 A;  3PX0 A;  4FZX C;  1VQ9 N;  1BO5 O;  5AZJ A;  3NF7 A;  3WXM B;  4YOV A;  3LDS A;  4E19 A;  1BA1 A;  2F7T A;  3PO4 A;  5FLX O;  1QS4 A;  2W41 A;  3QEV A;  1HLU A;  4BC2 A;  4M3U A;  1IKX A;  1F21 A;  2GEM A;  3CPW M;  2VG7 A;  3K5N A;  2IIR A;  1BIZ A;  4K25 A;  3CCS N;  4JLH A;  3IDH A;  5IWA K;  1RT2 A;  4E89 A;  4M3X A;  3HO1 A;  2JWL A;  1FKP A;  2X74 A;  4RTF D;  1GLB G;  1X9W A;  3GDQ A;  4KPY A;  4IEE A;  1JCG A;  4CIF A;  4YOW A;  5BN9 A;  2P9N A;  5KQD A;  4BAC A;  3SJJ A;  3L2Q A;  4W5O A;  1TK5 A;  2HW3 A;  3SZ2 A;  4CJS A;  1NGG A;  3RVC A;  2ZM6 K;  4QOZ B;  3E9O A;  4PKG A;  3LPU A;  3SJH A;  4KTW A;  4CBU A;  3U8X A;  4YOX A;  3WNE A;  1A5X A;  1FK9 A;  4IG3 A;  4CBX A;  4AHC A;  4CGD A;  1L5U A;  4X64 K;  4JI0 K;  3TSP A;  3VQ5 A;  2QWQ A;  3THW B;  4ZTF A;  1KAZ A;  2PZS A;  5FRM A;  3V9S A;  3ZCM A;  4CJL A;  4RCH A;  1VSL A;  1Q9Y A;  1D9D A;  1KCF A;  4BGB A;  2YJF A;  2P9U B;  3R9P A;  4LSN A;  2O8D A;  3AVG A;  1KRP A;  4XH4 A;  1RIL A;  1MDU B;  3WNH A;  4ELT A;  4DSE A;  3BZC A;  4JKD A;  3CCR N;  5JVG L;  2VWK A;  3C0B A;  4DSF A;  2E2Q A;  1TKT A;  1GOA A;  4WQ4 A;  5DK5 A;  5LY3 A;  3C6T A;  4K0K K;  2HOE A;  4KV8 A;  3LP3 A;  1S72 N;  4JI1 K;  1N6Q A;  4JRP A;  4LF6 K;  1QE1 A;  2B4J A;  3L2R A;  1K9M O;  1LAV A;  4KFB A;  2OPS A;  1XI1 A;  3TSQ A;  2G8W A;  4CJR A;  3CM5 A;  2X6N A;  3O1B A;  4A5B A;  4PHT X;  3VER A;  4PUO A;  4DHY A;  4O55 A;  4H5W A;  3CC7 N;  4CVN E;  3DXM A;  4Y0W A;  3SUN A;  4JK7 A;  4CGI A;  1QQO A;  4O5B A;  1T44 A;  3UKR A;  3L4I A;  4KRE A;  4DU1 A;  3SPY A;  3OJU A;  3V1O A;  2A1S A;  1OVY A;  1QZ6 A;  2Z1H A;  2P9I A;  4DR2 K;  2PYJ A;  1YVN A;  1IBM K;  3P31 A;  4N56 A;  1X9M A;  1B92 A;  3C7N B;  4YNQ A;  1IO2 A;  4IFE A;  2HHQ A;  3I8B A;  1J5O A;  4JS5 A;  4JI5 K;  5I3U A;  3C65 A;  4NCG A;  4B08 A;  5C10 A;  4Z0U A;  5SZT A;  1VQM N;  5AFU A;  3F5T A;  1LWE A;  4I9L A;  1ASW A;  3MN7 A;  1BIS A;  5AJ3 K;  4YOY A;  3A5M C;  4CJ3 A;  3OY9 A;  5M1F A;  1EKE A;  4NXN K;  2HHX A;  3UE5 A;  4H4O A;  4FM0 A;  3DOK A;  5A2Q O;  1RNH A;  3HOT A;  1HQU A;  3TTD A;  3S3M A;  4GV6 A;  1KAY A;  3A5L C;  3HP9 A;  3T1H K;  2HBJ A;  2GTD A;  3AO3 A;  4FXD A;  3VEV A;  4FM2 A;  1J6Z A;  4I6M A;  5KI6 A;  3KLE A;  3GOI A;  3OYH A;  1U4B A;  1E4F T;  4DR1 K;  1ZBU A;  3FZK A;  4BE0 A;  4CEB A;  4WE1 A;  5BRF A;  3PO5 A;  4X62 K;  4OLA A;  3T69 A;  1NGC A;  2X6S A;  1RDA A;  4LF8 K;  1VSD A;  3KLH A;  4CF1 A;  1GLL O;  2FBX A;  1VSJ A;  4QS8 A;  3L8B A;  2WUS A;  1JLC A;  2HHV A;  4EP4 A;  2NLX A;  4GNI A;  3DLL L;  4CEF A;  1C1A A;  2GEL A;  3AA3 A;  1YJ9 N;  4ZTJ A;  2BTF A;  2E6M A;  3TAM A;  4E1M A;  2ATQ A;  5I42 A;  3I56 N;  4B8A B;  3ENO A;  4B9Q A;  3EZ5 A;  4HTU A;  3PX6 A;  3M6G A;  3OYB A;  1S9G A;  3MEG A;  4DQS A;  1E3M A;  3VET A;  1NJI O;  2DY4 A;  2YHB A;  3T1Y K;  1WSF A;  3CCQ N;  4F3T A;  4B1W B;  2BDP A;  2NRR A;  3PV8 A;  3EKU A;  5FRO A;  1Z6R A;  3AVF A;  2CH6 A;  4B1U B;  4OKE A;  3DLH A;  3NVK A;  1T7P A;  3CQY A;  4FVM A;  4BGA A;  4B9N A;  1L3T A;  3NF8 A;  1KFS A;  4DSK A;  4KHS A;  3THV A;  4A57 A;  4CJF A;  3RR7 A;  1NBW A;  3MK6 A;  1BHL A;  3JSM A;  4IOX A;  5KPR A;  4CHP A;  2P9K A;  1Q7Y O;  1R59 O;  4CJK A;  3S3N A;  1XQS C;  3AVK A;  3I55 N;  3VTI A;  1XHZ A;  3SAG A;  4PKH A;  2W6K A;  3NE6 A;  4FJI A;  2YCH A;  3RTV A;  2G8V A;  3ZSO A;  3DXM B;  3A5O C;  1S1T A;  4O8U A;  3VN5 A;  1Q8I A;  4C8O A;  1JLG A;  4HUE A;  4B1Y B;  3J7A P;  1LW2 A;  2P9I B;  4FJJ A;  3IS9 A;  4JN4 A;  1TVR A;  5MLC Q;  1K8A O;  4A59 A;  3D45 A;  4OLB A;  1KD1 O;  2VWJ A;  4FLZ A;  1QQC A;  3IUC A;  3MED A;  1LCU A;  4HCB A;  3R8E A;  4KB1 A;  5HRN A;  2QWL A;  4I9Q A;  3F9M A;  3O4Q A;  3PIP L;  3CD6 N;  2YV0 X;  5BR8 K;  4FJM A;  4O44 A;  1G15 A;  4RW6 A;  3CJ1 A;  3VQA A;  4QS7 A;  1YXQ A;  3H1V X;  5AQX A;  2A40 A;  2WC9 A;  3QFU A;  4IFV A;  1NMN A;  2G8U A;  3VGK A;  4B3S K;  3B8A X;  5AQW A;  4BRE A;  1TKX A;  3AO2 A;  1S1U A;  4MDB A;  2QW9 A;  4GKK K;  4CZL A;  2Q0U A;  1RCH A;  3P5J A;  2P5O A;  3TSU A;  1RBU A;  5FPD A;  1Y64 A;  4B3M K;  1JXE A;  4PL8 A;  1NOZ A;  5FPE A;  3J81 O;  4W5T A;  3EYZ A;  3SK3 A;  3ENH A;  3VES A;  4I7F A;  2HHU A;  3V9Z A;  3HYF A;  3L2U A;  5AQL A;  4CGF A;  4OJR A;  1S1V A;  1SS6 A;  2BGG A;  1KC8 O;  1GOC A;  3J7Y P;  5C25 A;  4MLH A;  4JKG A;  3L3V A;  3TU5 A;  4YFU A;  3OYJ A;  1C0G A;  1ZBH A;  3MEC A;  5JS1 A;  1SV5 A;  1KFD A;  5HBM A;  3M1F A;  1IH7 A;  3VOV A;  3FZL A;  4IXC A;  3LWM A;  4AM6 A;  1JLF A;  3VEX A;  4DR7 K;  2E8A A;  1EX4 A;  4ZHR A;  3ZT4 A;  3DOL A;  4JI4 K;  2QTD A;  2QWP A;  4UQG A;  2HB5 A;  1WAF A;  1CLQ A;  1KVC A;  1BGX T;  5FRN A;  3TTC A;  2QK9 A;  3VPZ A;  3TAQ A;  2QKB A;  1Q18 A;  4UY8 O;  4I2Q A;  4M63 C;  5KRS A;  4H0X B;  1N36 K;  4H5T A;  3KVG A;  1K8K A;  4DR3 K;  3P83 D;  2E6L A;  1RBR A;  4N76 A;  5C0Y A;  4G9Z A;  1WSE A;  3V9U A;  2ETJ A;  3O4N A;  4K41 A;  1UA0 A;  3O9Q A;  3QDK A;  4ILJ A;  3PSF A;  4CES A;  3S3O A;  1S5J A;  3WXJ A;  3WQU A;  2XY6 A;  1D5A A;  3MN6 A;  5KRT A;  3UB5 A;  2HNY A;  3CCV N;  4FWN A;  4OGE A;  2HMP A;  4N47 A;  3SAF A;  3G0Z A;  4DFJ A;  1RT5 A;  4RW8 A;  1VQ5 N;  1FW6 A;  3QBW A;  4KAZ A;  4MQ3 A;  2A3Z A;  4IJA A;  3QER A;  5HP1 A;  2AA4 A;  2F9T A;  3SQ0 A;  3O3G A;  4B9M A;  2FF3 B;  2ZGY A;  1DGK N;  4KKO A;  3ZT2 A;  4A5A A;  1T6C A;  3O9S A;  4H03 B;  1N32 K;  3OYE A;  4B9U A;  1S9E A;  4K42 A;  3M8Q A;  3CQX A;  4J2B A;  1JLQ A;  1U04 A;  1O13 A;  4Z94 A;  2D0A A;  3KK7 A;  3OVN A;  3SLC A;  1U48 A;  2F8T A;  4A61 A;  3RMD A;  4H0Y B;  4CEZ A;  4CE9 A;  2UXC K;  3PIO L;  2CGJ A;  1NGH A;  3HBT A;  1ZBL A;  3BF3 A;  1MA9 B;  4FJK A;  3L2W A;  4KI4 A;  4A2A A;  4BQZ A;  4CF2 A;  3THW A;  3M8P A;  5AFU H;  4F3O A;  2QA4 N;  2XY5 A;  3AAR A;  3R3L A;  1IJJ A;  3M8R A;  3SUO A;  3CF5 L;  2WON A;  2P9U A;  4E7K A;  4E0D A;  2CGL A;  1ZBI A;  3AVB A;  4DUY K;  2O8F A;  3IG1 A;  4B1V A;  3FE1 A;  3MXI A;  1JCE A;  4FSV A;  1W2B M;  3EN9 A;  4WFN L;  4JKG B;  3BGR A;  3KK2 A;  2DPN A;  4RW9 A;  5K14 A;  1ZBF A;  3LM2 A;  4DV5 K;  4OX9 K;  1NGA A;  2P9P A;  5GAH P;  3SMP A;  3J7Z O;  3NH1 A;  3T19 A;  4EZ9 A;  1R0A A;  5AQP A;  4CZJ A;  3MN5 A;  3OS1 A;  3MCA B;  3LP2 A;  2I5J A;  4O8K A;  4MDA A;  2NNW A;  4FWP A;  5KPZ A;  3O5B A;  3OS2 A;  1DTT A;  2Q31 A;  4M3Y A;  4CJP A;  1J54 A;  4DKW A;  4ELU A;  1UA1 A;  1Y97 A;  2DFF A;  3O3F A;  2HBK A;  1UOC A;  4DV6 K;  4K8Z A;  1NLV A;  1E4G T;  4M3W A;  1N5Y A;  3HPO A;  1JLB A;  5AQH A;  3TAR A;  5E26 A;  3QIO A;  1LOT B;  5AQV A;  4HUG A;  1K8K B;  4FJ5 A;  3K0S A;  4A62 A;  4KHY A;  5J2M A;  2HVI A;  5E84 A;  4KH5 A;  3HL8 A;  3QES A;  5FPM A;  5AQY A;  3AO5 A;  2YKN A;  2XY7 A;  1RBT A;  4WFB L;  3MXJ A;  4JHD A;  2O4G A;  1HUX A;  1FXX A;  1ZXO A;  3HSC A;  4H0V B;  2VQF K;  5BRH A;  1OH7 A;  3SBT A;  1JL2 A;  4U67 L;  3SUQ A;  3RRH A;  1LWF A;  1WSG A;  5EOY A;  3KLF A;  4FCY A;  3VEZ A;  3OYN A;  4NCA A;  4CEE A;  1TAU A;  3BF1 A;  3FLC O;  4OKK A;  4JKF A;  3V4I A;  4JD2 B;  5TKY A;  4QS9 A;  3DLR A;  5LMU K;  1TUU A;  2NRV A;  2NUB A;  5GIO A;  3NH0 A;  3E66 A;  2IS3 A;  1SL2 A;  1RTD A;  3BY5 A;  3LAK A;  3V9W A;  1NKC A;  2PAV A;  3T1A A;  4W5R A;  4BRL A;  2OA8 A;  3H08 A;  3OTO K;  1NM1 A;  2HF3 A;  1KLM A;  5F1X A;  5BR9 A;  1HYV A;  3CMA N;  4AHU A;  4M3Z A;  1VK0 A;  3CIP A;  1TUY A;  1JLA A;  3A8Y A;  1C0M A;  1OKJ A;  4R79 A;  3H3O B;  2F9W A;  3QEX A;  3J8A A;  3OYC A;  3C95 A;  3KWI A;  3H1Q A;  4JNE A;  4PL7 A;  1RDD A;  4NLB A;  2D0P A;  1YF5 L;  4PQU A;  4Z4H A;  4EAH D;  3QBX A;  4IWV A;  3FFI A;  3A2F A;  3CCU N;  4DUZ K;  4F9O A;  4BRG A;  1LWC A;  2QWR A;  1MWK A;  1TL3 A;  1S6P A;  4AM7 A;  5F0X A;  3DRR A;  3VQ4 A;  4CD3 A;  3OYL A;  4DWI A;  2FSJ A;  3EL2 A;  2VWB A;  4CHZ A;  3V1Q A;  1HRH A;  2O8F B;  3VEO A;  1VSI A;  3ZSR A;  5AQO A;  3OS0 A;  5C2D A;  4FWL A;  3V81 A;  1EP4 A;  3TAB A;  1LW0 A;  3L2V A;  5C2F A;  1WOQ A;  1LAW A;  4HTL A;  4ID1 A;  3CET A;  1BUP A;  3P1G A;  1DTQ A;  2P9P B;  4HVJ A;  4EZ6 A;  1NJW A;  5HRS A;  1RBV A;  3RMC A;  4FJ9 A;  3G4S N;  4FW2 A;  1WN7 A;  4WQ4 C;  4C8N A;  2W6L A;  1EO1 A;  4FK4 A;  4DS5 A;  1NG9 A;  2HHW A;  4CEC A;  3HZ6 A;  2NRH A;  3LDO A;  4BWJ A;  4WF9 L;  4RW7 A;  3HP6 A;  3ID8 A;  4DB3 A;  1NK8 A;  3VTH A;  4Q5V A;  4WCE L;  4BDP A;  3TPQ A;  3C6U A;  3HM8 A;  3OJS A;  1IBL K;  5EU7 A;  2A5X A;  3TAP A;  3HI0 A;  3I0R A;  1U47 A;  4DMN A;  1NMD A;  1Q9X A;  2B5J A;  4B3T K;  3KZB A;  4J8F A;  1WSH A;  4OPH A;  3ZT1 A;  2DFH A;  4KH6 A;  4AIL C;  1DEJ A;  1O1W A;  5AQG A;  3CI5 A;  3TAG A;  2QEX N;  2E88 A;  4V19 S;  1C0U A;  1TYQ A;  4DQ8 A;  4JHD B;  1U45 A;  2VCP A;  4XH1 A;  3B6P A;  3W3D A;  5T7B A;  4DTP A;  2AJQ A;  4F2S A;  3KD1 E;  4O5F A;  3NMU A;  3THX B;  3CFP A;  1K6Y A;  3DWL A;  3P4I A;  3ZX0 A;  2IOC A;  2QWO A;  2NRT A;  1DLO A;  4Z4C A;  3QML A;  5D3G A;  3SI6 A;  4DQI A;  1SL0 A;  1UAX A;  3U3G A;  3NDK A;  4CK3 A;  4DQR A;  1ATN A;  4DTO A;  2D0C A;  3Q7B A;  2V7Z A;  4BRO A;  2FF6 A;  1S3X A;  2E1Y A;  4M45 A;  2BH1 A;  5J2P A;  1N33 K;  4BWM A;  4CZM A;  3KIO A;  4B8C A;  1B9F A;  2FSN A;  2OTL N;  3NBP A;  1CZ9 A;  1NJX A;  2E2O A;  5CR4 A;  3LZI A;  4DSJ A;  4C8K A;  1WNS A;  3F2K A;  4JRQ A;  2V7Y A;  4FOI A;  3MAQ A;  4HCC A;  3LDP A;  3SV4 A;  1SZ2 A;  3VQE A;  1Z05 A;  3AAQ A;  4GMJ B;  3M8S A;  3DI6 A;  3HK2 A;  4KO0 A;  4CF8 A;  1ILY A;  1GLJ O;  1GLF O;  1OH6 A;  1T03 A;  2FC0 A;  3AV9 A;  4M7Y A;  3FGU A;  4GW6 A;  3CCM N;  3GL1 A;  4BR2 A;  2KTQ A;  1TKZ A;  4FWK A;  3HOS A;  4KTZ A;  4C8M A;  4JK9 A;  3AO1 A;  5C15 A;  3QNO A;  2D0O A;  5AQK A;  4E7L A;  1HQE A;  2AP1 A;  2ITM A;  4BRI A;  1XNR K;  3AGR A;  3H45 C;  4JS4 A;  3E9P A;  4CF0 A;  2WBN A;  1VAZ A;  4ILG B;  3E9L A;  4YOT A;  4FJ7 A;  3CJB A;  4DFK A;  3CFR A;  4U7B A;  3ASM A;  4MO5 A;  1VQK N;  3KKS A;  1ATR A;  3HM9 A;  4FO0 A;  3K57 A;  4MFB A;  3CFO A;  2DTU A;  4M41 A;  4JI8 K;  4FYD A;  4BRH A;  4N5S A;  1NK5 A;  2BUP A;  1U2V A;  3EZW A;  3NFA A;  3O6W A;  4EP5 A;  3RR8 A;  4CZI A;  1NOY A;  1HR0 K;  1VQ7 N;  1IBK K;  5M1Q A;  3HTV A;  3CHW A;  3W0L A;  3H46 O;  3L3U A;  1HNX K;  4IO8 A;  4CZK A;  4O0I A;  4CBW A;  2D0B A;  3SPZ A;  1X9S A;  2HNZ A;  3VEW A;  2HF4 A;  3LZJ A;  2A1R A;  3CQ8 A;  5JVH L;  3N4P A;  1I3A A;  4IEI A;  3AY9 A;  2A41 A;  3M5R A;  5KGW A;  1L3V A;  3AAP A;  3TI0 A;  4LFB K;  3RSE A;  5LJW A;  1VSE A;  1EXQ A;  4DTU A;  1WB9 A;  1HNV A;  3D2E A;  1TYQ B;  3I8D A;  2ZJR L;  2P1J A;  3AVL A;  3DLG A;  2NRX A;  3JXU A;  4CK2 A;  3RWU A;  3VQQ A;  3MX2 A;  5AQN A;  4CHO A;  3VQD A;  2YNI A;  3IFR A;  4E7I A;  2E4L A;  4B9S A;  3O4W A;  2IVP A;  3DJC A;  4F8R A;  4JKA A;  1X9J A;  3SCX A;  3IKM A;  2UUC K;  5IT9 O;  4HHT A;  1J9A A;  4CCH A;  2A42 A;  2FXU A;  4H8K A;  1TGO A;  1I94 K;  1ASV A;  2QKK A;  4FJG A;  4IJN A;  1CZB A;  3I0S A;  5JLF A;  3L0Q A;  4CIE A;  4CW7 B;  3QEP A;  1OH8 A;  2Q0R A;  3OYF A;  2A6A A;  2VYP A;  2GUI A;  2ZGZ A;  2I7P A;  3NGZ A;  4MLE A;  2IC3 A;  4E7J A;  4B9L A;  1VQ8 N;  2FLO A;  3K9J A;  3HJF A;  3WEE A;  2NRW A;  1VQL N;  1BG3 A;  3WNG A;  2XO7 A;  2YX6 A;  4B9V A;  4LF4 K;  4FZY A;  5AQZ A;  2Y1I A;  4HUF A;  2YI1 A;  3AA2 A;  1T8E A;  2KZM A;  4IBN A;  5BN8 A;  1RFQ A;  4FWO A;  3BUZ B;  4M7X A;  5EVZ A;  2ASM A;  2XRI A;  5ELZ A;  3K59 A;  3NHG A;  1RTJ A;  3KKR A;  4LH5 A;  3KK1 A;  4FK0 A;  3NH2 A;  3KTQ A;  2OZM A;  2G8K A;  5EXW A;  3UKU B;  3HVT A;  1D4X A;  3OYI A;  1ZYQ A;  3D2F A;  4ELV A;  1YTA A;  1NK7 A;  2Q1N A;  5AR0 A;  2QXL A;  4G1Q A;  3ZSX A;  1RTH A;  1YIT N;  3DRP A;  2YHA A;  5KGX A;  1QHT A;  4CJ4 A;  1BU6 O;  4JI3 K;  4GVE A;  2RF2 A;  3FR0 A;  3PX4 A;  1ASU A;  4E3S A;  3SYZ A;  1RDB A;  2HBM A;  5GIP A;  3RMB A;  4H0P A;  2ZF5 O;  3K9K A;  1NGB A;  1W97 L;  3CCL N;  1U2V B;  1GLE G;  4IKF A;  3QB0 A;  4M3T A;  1NJZ A;  4R5P A;  4CZF A;  4CZE A;  1SL1 A;  2D4W A;  2B6A A;  4XEI A;  1NGF A;  2KFN A;  5I9E B;  3OYK A;  3CC4 N;  1HNW K;  4CFA A;  3C6A A;  4XIU A;  3ZLJ A;  1VQN N;  4JD2 A;  3TAF A;  1QVG M;  2RKI A;  4NLC A;  1FKO A;  3MN9 A;  5B8H A;  5DM7 L;  4DG1 A;  4AH9 A;  5CE3 A;  2ZWH A;  1YHQ N;  1BL3 A;  1KTQ A;  1WBB A;  3RSE B;  3F73 A;  1CZA N;  3D2E B;  4DQP A;  4BDY A;  2KQ2 A;  3ZT0 A;  1C6V A;  2IVN A;  4XH5 A;  4NB4 A;  3CM6 A;  3QIN A;  3T7Z A;  3G6E N;  1S6Q A;  5GAE P;  3ITH A;  3E1Y A;  3U6F A;  3G25 A;  2V51 B;  5JIC A;  3D7E O;  1XNQ K;  5AZI A;  4PWD A;  1VRU A;  1NGJ A;  3VQB A;  4IG0 A;  1KXP A;  4CF9 A;  4DV4 K;  3KWG A;  2FBY A;  1K73 O;  3SAH A;  3WQT A;  4JKB A;  1A5V A;  1Q86 O;  4EFH A;  3H3N O;  3F9K A;  3LWL A;  3G10 A;  3G71 N;  4OKJ A;  2OAN A;  3WEE B;  1U6Z A;  3MWT A;  4WFA L;  3ZX2 A;  1C0F A;  4BC3 A;  4FLU A;  3IAY A;  1YIJ N;  4J2E A;  4WQ5 A;  4CHQ A;  4HWI A;  3ULE B;  4CEA A;  4AHT A;  3HST B;  3LP1 A;  1NK4 A;  3LPT A;  1N8R O;  4DTJ A;  1OH5 A;  3CER A;  2EX3 A;  4FLT A;  4FW1 A;  4CER A;  3QNN A;  4JI2 K;  5DM6 L;  5CZ2 A;  1EQY A;  1GLA G;  4FJL A;  4IOA L;  4GKJ K;  1P8Z A;  3U9Z A;  4AHR A;  3HPG A;  3D2F B;  5JLH A;  5CZ1 A;  4BY9 C;  3EY1 A;  4JK8 A;  5ADX A;  3NCI A;  4KB0 A;  2O8E A;  5SWM A;  3QO9 A;  4LH4 A;  4KI6 A;  2GBZ A;  4BVP A;  1RT6 A;  4GV9 A;  2W42 A;  4BVO A;  5AQR A;  4B9T A;  2ZD1 A;  1TK8 A;  1TAQ A;  3ZSY A;  3JS6 A;  3E01 A;  1U49 A;  1J53 A;  3OYA A;  2ZE2 A;  3WXK A;  3QET A;  3O8M A;  5LL6 Z;  4C8L A;  4DV3 K;  1TL1 A;  2HST A;  4Y1D A;  3PY8 A;  4ICL A;  4RWT A;  1DKG D;  4CJE A;  4DLE A;  4BR7 A;  4FPB A;  3AVJ A;  3QIP A;  4BG8 A;  2YJE A;  1JLE A;  1RDC A;  1NK0 A;  4F2R A;  4CJ5 A;  4FWM A;  1NJY A;  2YHX A;  3CME N;  3MMV A;  1WUA A;  3SBG A;  2R7Y A;  3NVM A;  3VMF B;  3THX A;  5AQI A;  1RTI A;  2IDO A;  1P90 A;  1VHX A;  2Z1J A;  3AA4 A;  1Z26 A;  4H0T B;  2G8I A;  4YDU A;  3HVR A;  3O3H A;  3B6O A;  1MWM A;  4DV0 K;  1FJG K;  2Z1I A;  1QSY A;  4EHU A;  2O4I A;  1HJR A;  1RT4 A;  5FPN A;  3ZSV A;  1SKS A;  2OZS A;  1SAZ A;  4YDU C;  1D9F A;  4BRF A;  4JKH A;  4CED A;  4DSI A;  3DXK A;  2ASP A;  4BRA A;  3LDN A;  4CD1 A;  1G99 A;  3EEQ A;  2HBL A;  3JYT A;  3R6M A;  4LY7 A;  2OPP A;  4JV5 K;  2RPI A;  2QM1 A;  4N41 A;  4LF9 K;  1C1B A;  3S41 A;  3WXI A;  4BE2 A;  3QEI A;  3ZEU A;  1BOT O;  4KHW A;  5HL7 L;  4PKI A;  5AZI B;  4ILH A;  4BRK A;  3WUH A;  1N34 K;  3L4Q A;  4BG9 A;  1IKY A;  1BDG A;  4E1J A;  2PYL A;  4DV2 K;  1S22 A;  2Q36 A;  3ENB A;  2OYQ A;  3ZSW A;  3O9R A;  1HYZ A;  1HNI A;  4ISE A;  4DTM A;  1YVU A;  4WYB A;  4CGH A;  1I39 A;  1V4S A;  3VQ8 A;  3KLG A;  2KKZ A;  3SV3 A;  2ASO A;  2HHS A;  2F4V K;  3QLH A;  2VQE K;  1W7A A;  2KZZ A;  4KHQ A;  2GWK A;  2I7N A;  4FPA A;  2KW4 A;  2GV9 A;  2J4R A;  4H5R A;  1YAG A;  3EE8 A;  3PLA A;  4CFB A;  4RW4 A;  1XC3 A;  5BRD A;  4L8R B;  3RMA A;  4KTQ A;  2YNF A;  3K5O A;  2P9S A;  3PSI A;  3D0P A;  4YY3 K;  3KHY A;  3WXL A;  4FLV A;  4J2A A;  4FWQ A;  1VQO N;  3N4Q A;  4ISF A;  5AQT A;  5GIN A;  1SKR A;  1JKH A;  5BPN A;  3V1R A;  4DF4 A;  2GUP A;  2GWJ A;  2O8E B; 
#chains in the Genus database with same CATH homology
 1WAF A;  3CFO A;  4GVM A;  2VG5 A;  1CLQ A;  2DTU A;  4K8X A;  3S9H A;  1KVC A;  1BGX T;  4M41 A;  5C24 A;  4FYD A;  5FRN A;  2F96 A;  4CHY A;  2QK9 A;  4M42 A;  1HMV A;  4W5Q A;  5J1E A;  3WNF A;  4N5S A;  2RN2 A;  3TAQ A;  4I2Q A;  4ID5 A;  1NK5 A;  2QKB A;  3NF6 A;  4B3O A;  4EP5 A;  2LSN A;  3NFA A;  5KRS A;  3KJV A;  1C0T A;  4H4M A;  3RR8 A;  1HPZ A;  4FJ8 A;  1C1C A;  1NOY A;  4DS4 A;  4Y1C A;  1NK6 A;  4KRF A;  3P83 D;  2E6L A;  1RBR A;  5CY4 A;  4PY5 A;  4O0J A;  4TSX A;  4N76 A;  3LP0 A;  3UIQ A;  3VA3 A;  1VSH A;  3TAN A;  1WSE A;  1WAJ A;  1EET A;  3V9U A;  2ETJ A;  3O4N A;  1UA0 A;  1SUQ A;  3L3U A;  2HVH A;  3DRS A;  2XY8 A;  4O0I A;  2HMI A;  1NKB A;  3KLI A;  2D0B A;  3NAE A;  3SPZ A;  1X9S A;  2HNZ A;  4CES A;  1CXU A;  1KVB A;  1S5J A;  3S3O A;  3LZJ A;  3U3Y A;  3DMJ A;  2A1R A;  3CQ8 A;  4AHV A;  1I3A A;  3LAL A;  4I2P A;  1WSJ A;  4NYF A;  1IKV A;  2XY6 A;  1D5A A;  5KGW A;  5KRT A;  2YNG A;  2HNY A;  4CK1 A;  1L3V A;  4FJX A;  5HLF A;  4OGE A;  3TI0 A;  4KHU A;  1RT7 A;  1XC9 A;  1QSL A;  4N47 A;  3G0Z A;  1VSE A;  1EXQ A;  4DFJ A;  3SQ4 A;  1RT5 A;  4RW8 A;  4DTU A;  1HNV A;  1S1W A;  3PX0 A;  4KAZ A;  4MQ3 A;  3I8D A;  4FZX C;  3QER A;  2P1J A;  3AVL A;  3DLG A;  5HP1 A;  4CK2 A;  4OVL A;  3RWU A;  4LD0 A;  3ALY A;  3VQQ A;  4J2D A;  3NF7 A;  4CHO A;  5J2N A;  3VQD A;  3LDS A;  4E19 A;  2YNI A;  4E7I A;  2E4L A;  3O3G A;  3SQ0 A;  4B9S A;  4B9M A;  3PO4 A;  4KKO A;  3ZT2 A;  3NGY A;  1QS4 A;  3QEV A;  2JGU A;  3DLB A;  4CIG A;  3OYE A;  1S9E A;  1IKX A;  1VSF A;  5FDL A;  1F21 A;  3AVH A;  4RG8 A;  5HRO A;  4F8R A;  4M3U A;  3M8Q A;  4J2B A;  2VG7 A;  1JLQ A;  3K5N A;  3SCX A;  3VA0 A;  1BIZ A;  1U04 A;  3QEW A;  4JLH A;  4CGG A;  4HHT A;  2D0A A;  1RT2 A;  4E89 A;  2G8H A;  3OVN A;  1U48 A;  2F8T A;  1J9A A;  4M3X A;  4CCH A;  3RMD A;  1MU2 A;  3HO1 A;  4H8K A;  1VRT A;  1TGO A;  4CEZ A;  4CE9 A;  1FKP A;  2X74 A;  1ASV A;  1JXB A;  4DTX A;  2QKK A;  4FJG A;  4FZZ A;  1X9W A;  1CZB A;  3I0S A;  4KPY A;  4E7H A;  4CIF A;  5HRP A;  3OYD A;  1ZBL A;  4BAC A;  4CIE A;  3QEP A;  3SJJ A;  2Z1G A;  3L2Q A;  3OYF A;  2GUI A;  4FJK A;  4W5O A;  2WOM A;  3L2W A;  1TK5 A;  4Z4I A;  1BI4 A;  4KI4 A;  3SZ2 A;  3NGZ A;  2HW3 A;  4CJS A;  4CF2 A;  2IC3 A;  3VQ9 A;  4E7J A;  4B9L A;  4QOZ B;  3M8P A;  4M3R A;  4F3O A;  3HJF A;  3LPU A;  2XY5 A;  3HT3 A;  4KTW A;  3WNG A;  2XO7 A;  3WNE A;  1A5X A;  1FK9 A;  4B9V A;  2PY5 A;  3M8R A;  3SUO A;  4IG3 A;  3AO4 A;  3C94 A;  4FZY A;  2WON A;  4AHC A;  4E7K A;  2Y1I A;  1WLJ A;  4E0D A;  4CGD A;  4HUF A;  1L5U A;  4FJN A;  1ZBI A;  3AA2 A;  3AVB A;  1T8E A;  4IBN A;  2P5G A;  2KZM A;  3VQ5 A;  4DLG A;  4OPJ A;  3IG1 A;  4ZTF A;  4FK2 A;  3MXI A;  1JL1 A;  2PZS A;  4FLY A;  4B9U A;  5FRM A;  3V9S A;  3AA5 X;  3AVM A;  3ZCM A;  4CJL A;  2XRI A;  3K59 A;  1VSL A;  1Q9Y A;  3NHG A;  1RTJ A;  1D9D A;  1KCF A;  3KKR A;  3CG7 A;  4LH5 A;  3DYA A;  3KK1 A;  1UWB A;  2HHW A;  3SNN A;  4FK0 A;  3BGR A;  2YNH A;  3NH2 A;  5HRR A;  4LSN A;  3KK2 A;  2G8K A;  3KTQ A;  2OZM A;  4RW9 A;  5K14 A;  1ZBF A;  3HVT A;  3AVG A;  3OYI A;  1ZYQ A;  1QTM A;  1KRP A;  4DFM A;  1X9M A;  1RIL A;  4ELV A;  3NH1 A;  3T19 A;  1D8Y A;  4DSK A;  4EZ9 A;  1R0A A;  3WNH A;  3V6D A;  1YTA A;  3K58 A;  4ELT A;  1NK7 A;  4DSE A;  3OS1 A;  2VWK A;  2G8F A;  3LP2 A;  4G1Q A;  4DSF A;  3LAN A;  2I5J A;  3ZSX A;  1IKW A;  3TR8 A;  1TKT A;  4CEQ A;  4DU3 A;  1GOA A;  2F8S A;  3OS2 A;  1RTH A;  1DTT A;  5DK5 A;  3ISN C;  3C6T A;  4M3Y A;  2P51 A;  3SQ1 A;  4CJP A;  1J54 A;  4ELU A;  4KV8 A;  3LP3 A;  4Z4G A;  3DRP A;  1ITG A;  2Y1J A;  1Y97 A;  1UA1 A;  2DFF A;  2YHA A;  5KGX A;  3O3F A;  1N6Q A;  4JRP A;  1QHT A;  1UOC A;  4CJ4 A;  3AVI A;  1QE1 A;  2B4J A;  3L2R A;  4K8Z A;  2RF2 A;  1LAV A;  3PX4 A;  1ASU A;  4KFB A;  4E3S A;  4M3W A;  2OPS A;  1XI1 A;  4BDZ A;  1BQM A;  3SYZ A;  4CJR A;  4DTR A;  1N5Y A;  1RDB A;  3HPO A;  2XHB A;  2G8W A;  1JLB A;  3CM5 A;  2X6N A;  3TAR A;  4OPK A;  3RMB A;  3QIO A;  1RT3 A;  4PUO A;  4O55 A;  1YTU A;  4DQQ A;  4IKF A;  4M3T A;  4HUG A;  3SUN A;  4FJ5 A;  1NJZ A;  4CGI A;  4O5B A;  1YT3 A;  5JS2 A;  4R5P A;  4KHY A;  5J2M A;  1SL1 A;  2HVI A;  3TAE A;  2B6A A;  3HL8 A;  4KRE A;  4CJW A;  4DU1 A;  3QES A;  3AO5 A;  3SPY A;  3OJU A;  1KVA A;  2YKN A;  2XY7 A;  4Q0B A;  2KFN A;  3V1O A;  1RBT A;  2A1S A;  3OYK A;  2Z1H A;  3MXJ A;  2YKM A;  2O4G A;  2PYJ A;  3OYG A;  1FXX A;  4CFA A;  4W5N A;  1A5W A;  4XIU A;  3MXM A;  1JL2 A;  3TAF A;  3SUQ A;  1Z25 A;  2RKI A;  2VG6 A;  3MEE A;  4PA1 A;  5C42 A;  1FKO A;  1LWF A;  4N56 A;  3RRH A;  1B92 A;  1WSG A;  3KLF A;  3OYM A;  4FCY A;  4LSL A;  4YNQ A;  4NCB A;  1IO2 A;  4DG1 A;  3OYN A;  3DM2 A;  4AH9 A;  2HHQ A;  4NCA A;  4CEE A;  1J5O A;  1B9D A;  1BL3 A;  1KTQ A;  4CGJ A;  4JS5 A;  3V9X A;  1TAU A;  5I3U A;  2OPQ A;  3F73 A;  4CFC A;  4OKK A;  3V4I A;  4NCG A;  4B08 A;  4CJT A;  4DQP A;  4Z0U A;  3DLR A;  5SZT A;  4BDY A;  2KQ2 A;  1LWE A;  3ZT0 A;  4I9L A;  1ASW A;  2NUB A;  1BIS A;  3NH0 A;  1C6V A;  2IS3 A;  1SL2 A;  1XWL A;  1W9H A;  4CJ3 A;  1RTD A;  3LAK A;  3OY9 A;  1EKE A;  3CM6 A;  3V9W A;  1NKC A;  4Z4E A;  2HHX A;  1LV5 A;  1W0H A;  3AVC A;  4H4O A;  3DOK A;  3QIN A;  3T1A A;  1RNH A;  4FM0 A;  1S6Q A;  4W5R A;  1TKD A;  2OA8 A;  3ITH A;  3H08 A;  1HQU A;  3U6F A;  1KLM A;  1HYV A;  4AHU A;  3S3M A;  1IG9 A;  4M3Z A;  1VK0 A;  3SUP A;  4PWD A;  1VRU A;  3VQB A;  3HP9 A;  1JLA A;  4IG0 A;  4CF9 A;  2FBY A;  3AO3 A;  4FXD A;  1C0M A;  1L3S A;  2KFZ A;  4CJQ A;  4CHN A;  4FM2 A;  3VQC A;  3QEX A;  3OYC A;  3KLE A;  5KI6 A;  3C95 A;  3OYH A;  1U4B A;  4CEO A;  1A5V A;  1ZBU A;  2OPR A;  3F9K A;  4BE0 A;  1BI4 B;  1RDD A;  4CEB A;  5J2Q A;  4WE1 A;  3LWL A;  4PQU A;  3G10 A;  4Z4H A;  3PO5 A;  4OKJ A;  4E1N A;  4OLA A;  3K5M A;  2X6S A;  3FFI A;  1RDA A;  3CYM A;  1NKE A;  3A2F A;  1VSD A;  2IAJ A;  3SQ2 A;  3KLH A;  4CF1 A;  2FBX A;  1VSJ A;  3L8B A;  3ZSZ A;  1LWC A;  1TL3 A;  4FLU A;  1JLC A;  4DF8 A;  3IAY A;  4EP4 A;  2HHV A;  1S6P A;  3BDP A;  4J2E A;  4FK4 A;  3DRR A;  4CHQ A;  3VQ4 A;  4KHN A;  3OYL A;  4FJH A;  4DWI A;  2QXF A;  4CEA A;  4CHZ A;  3V1Q A;  4CEF A;  4AHT A;  1HRH A;  3HST B;  3LP1 A;  1NK4 A;  3LPT A;  1C1A A;  4DTJ A;  1VSI A;  3AA3 A;  1KLN A;  4ZTJ A;  2E6M A;  2EX3 A;  4FLT A;  4FW1 A;  1TK0 A;  3TAM A;  4CER A;  3ZSR A;  3KK3 A;  3OS0 A;  3QNN A;  4E1M A;  2ATQ A;  5CZ2 A;  5I42 A;  3V81 A;  1EP4 A;  3TAB A;  1LW0 A;  4B8A B;  3L2V A;  4FJL A;  4HTU A;  1LAW A;  3EZ5 A;  4ID1 A;  3K5L A;  3PX6 A;  3PUF A;  3OYB A;  1T05 A;  1S9G A;  3P1G A;  4AHR A;  3MEG A;  4DQS A;  5CYM A;  1DTQ A;  2DY4 A;  3HPG A;  2YHB A;  4HVJ A;  1WSF A;  5CZ1 A;  3LAM A;  4EZ6 A;  3EY1 A;  3NCI A;  4F3T A;  1NJW A;  4KB0 A;  5SWM A;  3QO9 A;  4LH4 A;  2BDP A;  1VSK A;  5HRS A;  2GBZ A;  1RBV A;  3PV8 A;  4KI6 A;  3RMC A;  5FRO A;  3NF9 A;  3AVF A;  4FJ9 A;  4F4K A;  4OKE A;  1RT6 A;  3DLH A;  4FW2 A;  2W42 A;  1T7P A;  1WN7 A;  4FVM A;  4B9T A;  4B9N A;  4C8N A;  2ZD1 A;  3NF8 A;  1TK8 A;  1L3T A;  4DS5 A;  1KFS A;  1TAQ A;  3ZSY A;  1BCM A;  4CJV A;  4CEC A;  4KHS A;  3HPH A;  3K2P A;  3E01 A;  4BWJ A;  3HP6 A;  4RW7 A;  3THV A;  1U49 A;  1J53 A;  4CJF A;  2ZE2 A;  3OYA A;  4FM1 A;  2Q3S A;  3RR7 A;  3QET A;  1BHL A;  1NK8 A;  2ITG A;  3JSM A;  2ZQB A;  4C8L A;  1TL1 A;  4CHP A;  4CJK A;  3S3N A;  4Q5V A;  4Y1D A;  4BDP A;  1RBS A;  3PY8 A;  4FJM A;  4ICL A;  3C6U A;  3AVK A;  4CJE A;  4DLE A;  3OJS A;  1XHZ A;  1L3U A;  1KSP A;  5EU7 A;  3AVJ A;  3QIP A;  1VSM A;  3KD5 E;  3TWH A;  3NE6 A;  3TAP A;  1U47 A;  3I0R A;  1JLE A;  1RDC A;  4DMN A;  4DTS A;  4FJI A;  3RTV A;  1NK0 A;  2G8V A;  4F2R A;  3ZSO A;  1Q9X A;  4CJ5 A;  2B5J A;  1S1T A;  1NK9 A;  2X78 A;  1NJY A;  2IGI A;  1WSH A;  3ZT1 A;  5E41 A;  3VN5 A;  1BCO A;  2DFH A;  3HXM A;  4AIL C;  1Q8I A;  2R7Y A;  1JLG A;  1O1W A;  4C8O A;  4HUE A;  3TAG A;  1C0U A;  2BAN A;  1TV6 A;  1RTI A;  1LW2 A;  2IDO A;  4FJJ A;  3IS9 A;  1U45 A;  1TVR A;  1REV A;  4CJU A;  2Z1J A;  3AA4 A;  3D45 A;  3RRG A;  4OLB A;  4NYN A;  1Z26 A;  2VWJ A;  3B6P A;  1WSI A;  4FLZ A;  1QQC A;  2G8I A;  5T7B A;  2DFE A;  3HVR A;  3ULD A;  4DTP A;  3MED A;  5DMR A;  3VQP A;  3AVA A;  2AJQ A;  3O3H A;  4F2S A;  3KD1 E;  2JLE A;  3B6O A;  4HCB A;  4QAG A;  3CFP A;  4KB1 A;  1K6Y A;  5HRN A;  3ZT3 A;  3IRX A;  4OGC A;  2BE2 A;  2IOC A;  1DLO A;  2Z1I A;  4Z4C A;  1QSY A;  4I9Q A;  3O4Q A;  5D3G A;  3SI6 A;  2YV0 X;  4DQI A;  2O4I A;  1HJR A;  1RT4 A;  1SKS A;  3ZSV A;  4AHS A;  1UAX A;  1SL0 A;  2OZS A;  3U3G A;  4O44 A;  2EHG A;  4CK3 A;  1G15 A;  3NDK A;  4DQR A;  1D9F A;  4DTO A;  2D0C A;  4CED A;  4RW6 A;  4DSI A;  4QCL A;  3VQA A;  4CFD A;  4IFV A;  3JYT A;  4O4G A;  2G8U A;  4LY7 A;  1TKX A;  2OPP A;  4M45 A;  3AO2 A;  1S1U A;  5J2P A;  2RPI A;  4BWM A;  4DU4 A;  3KIO A;  4B8C A;  1RCH A;  4FLX A;  3P5J A;  4N41 A;  1B9F A;  3NBP A;  1CZ9 A;  1NJX A;  2P5O A;  1RBU A;  2FBT A;  1C1B A;  4BE2 A;  3LZI A;  3QEI A;  4DSJ A;  4C8K A;  1JXE A;  1NOZ A;  4KHW A;  1BIU A;  1WNS A;  2HND A;  4JRQ A;  1QSS A;  4W5T A;  3EYZ A;  3MAQ A;  3VQ7 A;  4HCC A;  4Z4F A;  2FBV A;  4I7F A;  3SV4 A;  1HYS A;  2HHU A;  1IKY A;  3VQE A;  3HYF A;  4IDK A;  3V9Z A;  2PYL A;  1S1X A;  4IFY A;  5KTQ A;  3L2U A;  4GMJ B;  3M8S A;  2OYQ A;  3DI6 A;  3ZSW A;  4KO0 A;  4OJR A;  4CF8 A;  4CGF A;  3HK2 A;  1HYZ A;  1HNI A;  1S1V A;  1SKW A;  4DTM A;  3ZSQ A;  1YVU A;  4CGH A;  2BGG A;  1T03 A;  1I39 A;  2FC0 A;  3AV9 A;  1GOC A;  4GW6 A;  3VQ8 A;  3KLG A;  3T3F A;  5C25 A;  2KTQ A;  3SV3 A;  1TKZ A;  3L3V A;  4KTZ A;  5CYQ A;  1GOB A;  4C8M A;  3AO1 A;  4YFU A;  3OYJ A;  1RT1 A;  1CXQ A;  3DLK A;  3QLH A;  3QNO A;  2HHS A;  2KZZ A;  4KHQ A;  1ZBH A;  4E7L A;  1BQN A;  3MEC A;  1HQE A;  5JS1 A;  1SV5 A;  2KW4 A;  1KFD A;  2GV9 A;  5HBM A;  4DFP A;  4CFB A;  4RW4 A;  3AVN A;  4JS4 A;  4L8R B;  3RMA A;  4KTQ A;  2YNF A;  3K5O A;  4CF0 A;  1IH7 A;  3VQ6 A;  3LWM A;  3D0P A;  4DTN A;  4BE1 A;  1JLF A;  2D5R A;  4J2A A;  4FLV A;  4FJ7 A;  4DSL A;  4DFK A;  3CFR A;  1SKR A;  3DLE A;  1XHX A;  1EX4 A;  1JKH A;  3ASM A;  4ZHR A;  3NGI A;  2HHT A;  3KKS A;  1X1P A;  3ZT4 A;  3DOL A;  3V1R A;  3HM9 A;  4DF4 A;  4FLW A;  3K57 A;  4UQG A;  4MFB A;  2HB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...