4CGHA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cghA00
4NCAA 4CJSA 4W5RA 3OYKA 1HJRA 1YVUA 3AVGA 4IDKA 1QS4A 3QNOA 1UWBA 4CJPA 1KFDA 4I9QA 1HQUA 4Z4IA 5HROA 2OPPA 4EZ6A 1XHZA 3TAMA 4B9SA 2YNGA 3ZT1A 2DFHA 1B9FA 4AILC 1NKEA 3DI6A 1RNHA 1A5XA 2WONA 2E4LA 3LANA 1LAWA 3PX6A 1WAJA 4KKOA 3V1OA 5J2QA 1TGOA 2XY7A 5DMRA 1UA1A 3OJSA 1CXUA 4CERA 4W5OA 4K8ZA 1J53A 2AJQA 2GV9A 3V9XA 1ZYQA 3EYZA 4FJJA 1RT5A 3NH0A 4DSJA 1HNVA 3VQDA 4B8AB 2X78A 5KI6A 4J2BA 1NJYA 1SKRA 3SV4A 3LWLA 4DSFA 4Z4EA 2YHBA 3LP2A 3ZSVA 5J1EA 4CIGA 4Z4HA 1YT3A 2YKNA 3AO2A 3LAMA 2RPIA 1SV5A 3M8PA 4DG1A 4B9NA 3ZT3A 4K8XA 2BANA 3CFPA 4M42A 3KJVA 4CJFA 2IS3A 1J9AA 3QEXA 3KLHA 5CZ2A 2G8WA 4CJUA 3MAQA 3QESA 1ASUA 3TAGA 1UA0A 4B9VA 1IKVA 3QIOA 1KVAA 1L5UA 1JLBA 4E0DA 4M3XA 2G8VA 1ITGA 4FJ7A 2I5JA 3MXIA 4DQPA 3SQ4A 2KZZA 4ELTA 2HMIA 1TAUA 1WSHA 1B9DA 1NK9A 2YNHA 1RT7A 2D0CA 2P5GA 2D0BA 3L2WA 2P51A 3K5NA 1X9MA 3RTVA 2G8KA 3CYMA 1WNSA 1VSEA 3NE6A 4MQ3A 3CFRA 1TL3A 3DRSA 3NF6A 4C8MA 4LD0A 3CM5A 2F8TA 5KTQA 4RW6A 4CHPA 4DTNA 4G1QA 4FZYA 3I0SA 2XO7A 1NK7A 3ASMA 2HHQA 4IBNA 3V9UA 1QHTA 4OKKA 4B08A 1BIUA 3DOKA 3KKSA 2QKKA 4FJMA 1HNIA 1VSDA 4N41A 4KHUA 1RT1A 3DLBA 4UQGA 3V9SA 4DS4A 4C8KA 4CHZA 3ZT2A 4M45A 4CGFA 2HVHA 2R7YA 2HB5A 4DMNA 1GOCA 1RBSA 2ETJA 4NYFA 3SYZA 4BE2A 4CJLA 3S3MA 4DTUA 4CK3A 3QO9A 1YTUA 3OYAA 4JRQA 4DQSA 4CCHA 3DMJA 4CGHA 2JLEA 3ITHA 1LV5A 4Z4CA 3VQ5A 4CEEA 3LP1A 4H8KA 1TV6A 3OYHA 2XY5A 1X1PA 1G15A 1IG9A 2X6NA 3S9HA 4ELUA 3EY1A 2PYLA 4ELVA 4AHTA 1DTQA 4CJEA 3V9WA 1ASVA 1LWEA 3SI6A 2Z1HA 3OYIA 5HLFA 3MECA 4FJGA 3V1QA 5E41A 4EP5A 2G8HA 3NF8A 4OKJA 3AVFA 3HVTA 1WSEA 3SNNA 1TKDA 4DLGA 3VQQA 3NCIA 1FK9A 2BE2A 4PWDA 3S3OA 1EKEA 1RT4A 5J2MA 1WLJA 3PV8A 3LZJA 1HMVA 3DRRA 4DTOA 4CK2A 1CLQA 1RBTA 2VWJA 1HQEA 3SV3A 3SQ0A 2F8SA 4FXDA 4E1NA 5JS2A 5FRMA 3VQPA 4E7LA 3V4IA 1TKXA 2HNYA 5CYQA 4CJ4A 5SZTA 2KTQA 1X9SA 4O4GA 4CHOA 4OPJA 4M3UA 3ZSZA 1VSIA 4FJXA 1JXEA 1JLFA 4H4OA 3RWUA 3NH1A 4IG0A 4CIEA 5HBMA 4DS5A 2GBZA 1D9DA 3BGRA 2QKBA 1FXXA 2XRIA 3FFIA 5J2NA 4F3TA 3PX0A 3VA0A 4DQRA 4BWJA 3I0RA 3O4QA 3OS0A 1S1WA 1D5AA 2Q3SA 4R5PA 5FRNA 1NKCA 4J2DA 3G0ZA 5J2PA 3WNFA 4GMJB 1RDBA 3RRGA 2RKIA 3QEWA 3KKRA 3LALA 3VQAA 2G8FA 3VQ7A 4CFDA 4J2AA 4LH5A 3O3HA 3QERA 1S6QA 3VQCA 3L2VA 3HM9A 3LZIA 1WSGA 1KSPA 3OYLA 1T8EA 3NF7A 4CGIA 3SQ2A 4FJ5A 4OLAA 2XY8A 1JLEA 3WNEA 3HL8A 3PY8A 1BCMA 2BGGA 1L3TA 4DFPA 3HSTB 4B9TA 3DLEA 4E19A 4J2EA 1RTIA 3PUFA 1I39A 4FJKA 4PQUA 5JS1A 3UIQA 4CHYA 1WSIA 3RR7A 3L3VA 3JSMA 4FK4A 2A1SA 2D0AA 4GW6A 1EETA 1S5JA 1T7PA 3IRXA 3ISNC 3HO1A 3F9KA 3MEGA 3LP0A 3PO5A 1KVBA 2RF2A 3HVRA 2HNDA 1TAQA 1NOZA 1U45A 1HRHA 3C6UA 4RW7A 1TK5A 4F2RA 4LSLA 3NFAA 4CGGA 4O55A 2FBVA 4OPKA 3RMAA 3TR8A 1C1AA 4CESA 4CF0A 2OYQA 3KIOA 3D0PA 4JRPA 5KGXA 3HYFA 1ZBUA 3WNHA 4CEAA 3TABA 1S1UA 4ZHRA 3TAPA 3LPUA 4KAZA 2WOMA 3NGZA 5FDLA 3V6DA 4Y1DA 3DRPA 1S1TA 3AVHA 4TSXA 2FC0A 2YKMA 4OKEA 3OYEA 3HJFA 4AHVA 4CHNA 3OYMA 3L2UA 4BDPA 4CJ5A 4DTJA 2ZQBA 1JLGA 3PO4A 1WSFA 4OLBA 3LP3A 4FM1A 1KTQA 4AHUA 2IDOA 3HPHA 3ZT4A 3NH2A 3SUOA 1WSJA 1BHLA 2OPRA 5HRPA 2KFNA 3NGIA 2ITGA 4B8CA 2GUIA 3O3FA 3VQEA 1BQMA 4FLZA 5T7BA 4LH4A 1BIZA 1A5VA 4DFKA 3OYJA 3RR8A 1QTMA 2ATQA 1N6QA 2XHBA 4HUEA 4CEBA 4KHSA 4MFBA 3K2PA 1RDAA 3NHGA 5HRSA 3AVKA 4CF9A 1S1VA 1F21A 4CF2A 3V9ZA 4CJ3A 4Z4FA 3ZCMA 2KQ2A 4B9UA 2Z1IA 1VSKA 4CJKA 4ZTJA 1L3SA 2Y1JA 4QCLA 3RMCA 2PZSA 1IKYA 3AVAA 2Y1IA 4NYNA 2IGIA 1C6VA 3QLHA 2PY5A 1RDDA 4I7FA 3U3GA 1CXQA 1Q8IA 2HHXA 3KD5E 2B6AA 4F2SA 1JKHA 4B9LA 1RTJA 2VG6A 4CECA 3IS9A 3KD1E 4BDZA 4ID5A 4AHSA 2HNZA 3TANA 4KHWA 1VRUA 1LWFA 1NJZA 3MEDA 4E7JA 4L8RB 3T1AA 3SUPA 5KRSA 1J54A 1VSFA 4H4MA 4CGJA 1DLOA 1RCHA 4FW1A 3OY9A 4FVMA 4I2QA 3K5OA 5I3UA 3M8RA 2Z1GA 1RT2A 2YNIA 2FBTA 3CQ8A 2A1RA 1KLNA 3QNNA 1N5YA 4DTRA 4CEOA 1TKZA 3KLFA 4DQQA 3TI0A 3ZSOA 4DU1A 1SL2A 1LW2A 3TAFA 3V81A 4O5BA 4LY7A 2O4GA 4ID1A 1T05A 4HCCA 3SUNA 3HP6A 3RMBA 1U04A 1U47A 3TARA 5KRTA 4BWMA 3HT3A 1NK0A 3U3YA 1U48A 3KK2A 1XI1A 2HHTA 2OZSA 1XC9A 4CJRA 3CG7A 4Y1CA 1IH7A 3SJJA 4PY5A 4BACA 4O0IA 1SKSA 2ZD1A 4DSKA 3A2FA 3AVLA 1TL1A 4FM2A 1NKBA 3NF9A 1C1BA 4KV8A 4I2PA 4CJVA 4FLWA 2OZMA 5DK5A 1VSJA 3I8DA 4Z4GA 4DTSA 3AVJA 1WN7A 1BL3A 2NUBA 2B4JA 2YHAA 3ZSYA 4DSEA 4DSIA 1X9WA 1Q9YA 1UAXA 3TAQA 3OYBA 1QSYA 4KTWA 2KW4A 4CEFA 1VRTA 3AA5X 3MXJA 4CHQA 3K57A 3SQ1A 2E6MA 1REVA 2BDPA 4FJHA 4FYDA 1JL1A 2P1JA 4BE1A 1KVCA 1RTDA 4B3OA 1Z26A 3P5JA 1RBUA 2OPSA 1HYVA 1R0AA 4KB0A 3CFOA 4JS5A 4OGCA 4IFVA 3D45A 1UOCA 2YV0X 2G8UA 2Z1JA 4FLYA 4FLTA 4E3SA 2EX3A 4IG3A 3HPGA 3M8QA 1EP4A 3TWHA 1ZBIA 1FKOA 3OYGA 1JL2A 2LSNA 3ULDA 3VQ6A 4CF8A 5D3GA 2G8IA 1MU2A 4CFBA 5SWMA 1HYZA 3ZSWA 4CK1A 1L3UA 1FKPA 3AO1A 4FCYA 1YTAA 4O44A 4F4KA 4CFAA 2W42A 2FBYA 2HW3A 4DFMA 3O3GA 4AHRA 1LW0A 4KHQA 1C0MA 1S9GA 2X74A 3P1GA 4CEQA 4IKFA 1ZBFA 4CF1A 4CJQA 3T3FA 4B9MA 4HVJA 4C8LA 4FK2A 1SUQA 3B6OA 5CYMA 1D9FA 3QEVA 4FJ9A 1RBRA 3E01A 4LSNA 4W5TA 4DU4A 3LPTA 5KGWA 1JLQA 2B5JA 3AO3A 2RN2A 2DTUA 3L3UA 4OJRA 3LDSA 4HUFA 3H08A 3IAYA 4PA1A 3VQ4A 3THVA 1SKWA 1QE1A 4I9LA 4FK0A 4WE1A 5C24A 3WNGA 1IKXA 2QK9A 2QXFA 2HHVA 2KFZA 5I42A 4KI6A 4N56A 3SZ2A 4F8RA 3SPZA 5HRNA 4KHYA 3HP9A 2DY4A 4OGEA 1NOYA 4HTUA 4CIFA 4DLEA 4YFUA 4E7HA 1ASWA 5HP1A 1KRPA 2P5OA 4HCBA 1JLCA 3IG1A 4YNQA 1GOAA 1CZ9A 4OVLA 4C8NA 4IFYA 4AHCA 3OJUA 4Q5VA 4DWIA 2HHUA 1JXBA 1XHXA 5CY4A 3L2QA 1JLAA 3K59A 1KFSA 4PUOA 1S9EA 1BI4B 3AVIA 2E6LA 3DLGA 4KTZA 3AA2A 4Z0UA 4AH9A 3OVNA 4DU3A 4KFBA 4DTXA 3NAEA 2XY6A 3KTQA 4C8OA 3VQ9A 3B6PA 3QETA 2IAJA 2HVIA 3CM6A 1W9HA 1LAVA 5HRRA 4DF4A 1SL1A 3OYNA 5EU7A 3ZSQA 3AVMA 3F73A 3SCXA 1KLMA 1RT3A 1WAFA 1XWLA 2D5RA 4E7IA 1RT6A 1T03A 3DLKA 4DSLA 1C0UA 3OYCA 3AV9A 4NCBA 1A5WA 1J5OA 4KB1A 3ZSXA 2VWKA 1ZBLA 3AA4A 4NCGA 1NK8A 4KRFA 1NK5A 3DLHA 2IC3A 4DTMA 1NK6A 2HHWA 4FJ8A 4KI4A 4M41A 4W5QA 1S1XA 2FBXA 4HHTA 4DF8A 1VSLA 1BI4A 4M3RA 4N76A 1VSHA 1EX4A 3MEEA 3NGYA 4E1MA 3JYTA 3HK2A 4M3YA 3G10A 3BDPA 3KK1A 4M3ZA 1VK0A 1RTHA 4F3OA 3AVBA 3ZSRA 2JGUA 3DLRA 3VQ8A 4EZ9A 1C1CA 1BQNA 3VQBA 4DTPA 2O4IA 4CEDA 1BISA 4RW9A 4M3TA 4CJTA 3TAEA 1NK4A 2VG7A 5K14A 1RBVA 4JLHA 4BE0A 4Q0BA 2HHSA 4XIUA 3EZ5A 3K5MA 4BDYA 4GVMA 1U49A 3RMDA 2PYJA 1ZBHA 1GOBA 3O4NA 2YNFA 3QEIA 4FZZA 1RDCA 1W0HA 3HPOA 1D8YA 4E89A 3ZT0A 3K58A 3QIPA 3VA3A 1DTTA 1CZBA 3KLIA 4FLUA 1QSSA 1I3AA 1HYSA 1HPZA 4O0JA 4QOZB 3T19A 1QSLA 2KZMA 2F96A 1KCFA 2OA8A 4FZXC 3NBPA 3OS1A 3U6FA 3AA3A 1EXQA 4CGDA 4FLXA 4KREA 1LWCA 2X6SA 4QAGA 2DFFA 3K5LA 3M8SA 4CFCA 4FM0A 4ZTFA 1Z25A 4FW2A 1O1WA 4HUGA 3VN5A 4KTQA 4RW8A 3DM2A 3AO5A 3KK3A 4FJIA 1NJWA 1NJXA 3SUQA 1IO2A 1U4BA 4N5SA 1VSMA 1C0TA 4FLVA 1K6YA 2OPQA 4ICLA 4W5NA 1TVRA 4CEZA 4EP4A 4RG8A 2VG5A 3RRHA 1SL0A 3P83D 5C42A 1QQCA 3MXMA 3C94A 5CZ1A 3LWMA 1RILA 3QINA 4CE9A 2ZE2A 3LAKA 4E7KA 1BGXT 3AVCA 4N47A 3AVNA 3OS2A 4KHNA 4DFJA 3HXMA 3DOLA 3DYAA 4RW4A 1IKWA 1TKTA 4JS4A 4KPYA 3AO4A 1TK8A 1B92A 3L8BA 2IOCA 3NDKA 3L2RA 5FROA 3PX4A 3SPYA 4M3WA 4KO0A 4FJLA 5C25A 3C6TA 4DQIA 1Y97A 3OYFA 2DFEA 1Q9XA 3S3NA 3KLEA 1L3VA 3KLGA 4FJNA 1BCOA 2EHGA 3ALYA 3V1RA 3QEPA 1TK0A 4CJWA 3C95A 3OYDA 1S6PA
chains in the Genus database with same CATH superfamily
4LF7K 1HJRA 1YVUA 3HOTA 2RHKA 1HQUA 5HROA 2OPPA 3CCJN 1YVNA 3TAMA 2YNGA 3ZT1A 3C6AA 4AILC 1RNHA 2E4LA 1KAYA 4WQ5C 1WAJA 5C0YA 4KKOA 5J2QA 1TGOA 2XY7A 5JMVA 3A5MC 4BRDA 1WOQA 3EYZA 3O6WA 4B8AB 2X78A 3VF6A 1NJYA 3ZSVA 4CIGA 4Z4HA 1VQ7N 4K8XA 4Z94A 3H45C 4CJUA 3QESA 1L5UA 1ITGA 4FJ7A 1HUXA 2YHYA 3W3DA 2P9SA 2I7PA 2OTLN 1B9DA 1NK9A 2D0CA 2P5GA 4WYBA 3NE6A 4IO9L 4LD0A 2F8TA 4RW6A 3KHYA 3D2FB 3TTFA 1EQYA 3DJCA 3I0SA 1NK7A 2O8EA 2HHQA 1VQMN 3V9UA 1QHTA 1YAGA 4A2BA 3MCAB 4KHUA 3SJHA 1TYQA 3ZT2A 2HVHA 4JKBA 4DMNA 4NYFA 2PBDA 4BE2A 1QZ6A 4BRCA 4DQSA 3DMJA 4CGHA 3WXJA 5M1NA 2IVPA 3CJ1A 4ELUA 3QB0A 2PYLA 3JXUA 4AHTA 1DTQA 5HLFA 3ZX0A 2G8HA 3NF8A 2P9NB 3SNNA 3VQQA 1FK9A 2BE2A 4PWDA 4XH1A 2ZJQL 1RT4A 3PV8A 4NLCA 3LZJA 4CK2A 1HQEA 2F8SA 3O4WA 4E1NA 4L3QA 5DM7L 3IUCA 5SZTA 4O4GA 3ULEA 3HSCA 4OPJA 4DV0K 3ZSZA 1JXEA 1JLFA 1ZBSA 3RWUA 4IG0A 1YI2N 1J5EK 2QKBA 2XRIA 4BRKA 2YX6A 5C2FA 4CBWA 1NGFA 4J2DA 5AZIA 4A59A 4GY2B 2RKIA 3QEWA 3WXIA 4LH5A 3QERA 4DV4K 3VQCA 3L2VA 3LZIA 1WSGA 1KSPA 3OYLA 1BOTO 3SQ2A 4OLAA 3WNEA 2BGGA 3HSTB 4J2EA 2A42A 4PQUA 4K41A 1GLFO 3C65A 3L3VA 2VQEK 3JSMA 2A1SA 3SK3A 1T7PA 4BQZA 3HO1A 4EFHA 2RE2A 3WEEB 1U45A 2FF3B 2UXBK 5GAGP 3L0QA 3TABA 1S1UA 4KAZA 3DRPA 1IG8A 3O9QA 2YKMA 3HJFA 4NO7A 4AHVA 4KBOA 3OYMA 4H0YB 3L2UA 4BDPA 1U2VA 3PO4A 4OLBA 1KTQA 4JEPA 5HL7L 5C2DA 2OPRA 4WFNL 3O3FA 5BRHA 3GL1A 3OYJA 3G25A 4CEBA 4BC2A 2Q0UA 3K2PA 3H1QA 3NHGA 4CF2A 2VWBA 4B9UA 4ZTJA 4GKKK 5M1PA 4QCLA 4FWMA 3AVAA 3EKUA 4KH4A 3MX5A 3VEZA 3QLHA 3H1VX 1Q8IA 3EEQA 2D4WA 4JNEA 3IS9A 4LF4K 4BDZA 4FWSA 1VQ9N 4BRIA 3MEDA 1GLAG 4WQ5A 3SUPA 5KRSA 4I2QA 2FBTA 3QNNA 3ZETA 3IKMA 1WBDA 1LW2A 3TAFA 3V81A 4O5BA 1NMNA 4LY7A 4HCCA 3SUNA 2BH1A 4BGAA 1R59O 3HT3A 2OZSA 1XC9A 4PY5A 4BACA 2IVNA 1M90O 2ZD1A 3A2FA 1TL1A 3WXMB 1C1BA 3NVKA 4FLWA 1VSJA 1K73O 2FSNA 1GLDG 2NNWA 4Z4GA 3AVJA 3ZSYA 4DV5K 1X9WA 3CCEN 5C15A 2BDPA 2IVOA 1E3MA 1HYVA 2W6KA 2D0OA 3KWGA 2WFBA 5AFUA 4JS5A 2HF4A 4OGCA 4GV3A 3CMAN 4FLTA 4E3SA 4JI2K 4DR2K 5AQTA 4CZLA 3M8QA 4A57A 3TWHA 5I9EB 3ULDA 3K0SA 2KKZA 2G8IA 1KXPA 5SWMA 3O1BA 4JV5K 4JI7K 4CFAA 2HBJA 3UKUA 2YCHA 3C7NB 4DR4K 1C0MA 2X74A 4IKFA 3T3FA 3BF1A 5CYMA 3QEVA 3T1YK 4BRGA 4FJ9A 4H5VA 4LSNA 1Q81O 3L3UA 3H08A 1QQOA 5BPMA 3VQ4A 3J7YP 3TTCA 3THWA 2FSJA 3F2KA 1YIJN 4YOYA 2QK9A 2KFZA 3ATUA 5ADXH 5I42A 1KD1O 3SAHA 1J6ZA 4HTUA 4DLEA 4YFUA 4E7HA 5HP1A 3TPQA 4HCBA 1RFQA 3IG1A 2QWRA 5AQVA 1E4FT 4FOIA 4C8NA 3GE1A 1HJOA 3L2QA 1JLAA 1KFSA 4PUOA 3AVIA 1U49A 2E6LA 5BN9A 2XY6A 2QTDA 3VQ9A 3B6PA 2KLAA 2GUPA 4DF4A 4U7BA 1SL1A 3SCXA 3F73A 3G71N 4NCBA 2VWKA 1ZBLA 1U6ZA 1NK8A 3GOIA 5AZJB 4BVOA 1NK5A 3DLHA 4FJ8A 3THXB 2FBXA 4HHTA 4GV6A 4XH4A 1VSHA 3MEEA 2D0PA 3HK2A 3VESA 1VK0A 1NGBA 4C1NK 4FWOA 4EZ9A 1NLVA 3VQBA 1BISA 1QVFM 4JLHA 4CW7B 4Q0BA 2HHSA 4XIUA 5KQDA 3E9OA 3LL3A 3BZKA 5GIOA 1HNZK 3D2EB 2E20A 3D2FA 3QEIA 1HNWK 3K58A 2HBKA 4JI0K 3KLIA 1I3AA 3I56N 4BR9A 4QOZB 1QSLA 2QA4N 2OA8A 3OS1A 1K8KB 2VGMA 3AA3A 4A61A 4CGDA 1LWCA 4X64K 2DFFA 3K5LA 4BR2A 4NB4A 3VN5A 4KTQA 3LM2A 1NJXA 1U4BA 4ISGA 2WBNA 2OPQA 3O80A 4RG8A 4WFBL 2VG5A 3VEYA 3LWMA 3E9LA 3QINA 4CE9A 3A8YA 1GLLO 4CZFA 5AQXA 2ASOA 3EKSA 4RW4A 1IKWA 5AQZA 4JS4A 1MWMA 4MLEA 1B92A 3LDLA 3L8BA 4X66K 2IOCA 3L2RA 2VYPA 4M3WA 2V7YA 4KH5A 2P9PA 2DFEA 3OYFA 2HSTA 2P9LB 1YJ9N 1L3VA 3QEPA 3LDOA 4BREA 3EE9A 1XMOK 4EAHD 4CJPA 1KFDA 1Q86O 4I9QA 2JWKA 1HPMA 4Z4IA 4QS7A 2DPNA 3MMVA 2WONA 5FPMA 4LFAK 5DMRA 4B1WB 2WTUA 4JI5K 4U67L 4YOXA 4CERA 4K8ZA 4H5WA 3AAPA 2GV9A 3A5OC 5KI6A 4J2BA 4Z4EA 2YHBA 3LP2A 2BTFA 1HLUA 4DG1A 4B9NA 1BA1A 3ZT3A 3CFPA 4CJFA 1J9AA 3QEXA 1VQNN 1DGKN 3MAQA 4FWPA 3H46O 1ASUA 3CHWA 4JKGA 1KVAA 1JLBA 3WT0A 4M3XA 2G8VA 1M1KO 3CCQN 2KZZA 4ELTA 2HMIA 3CPWM 3M3ZA 1X9MA 2G8KA 1WNSA 1DKGD 1VHXA 5GAHP 5E26A 5KTQA 1HKGA 4FZYA 3OA9A 4YOUA 3ZEUA 3ASMA 3EE8A 3P38A 4B08A 1BIUA 4EHTA 4FJMA 1VSDA 1RT1A 4BRMA 4M7YA 4UQGA 1VQLN 4FWQA 4M45A 1W2BM 4CGFA 2ETJA 3SYZA 5EY4A 4CJLA 4CK3A 1YTUA 4JRQA 4LF8K 5GIPA 2E2PA 3VQ5A 4Z4CA 4CEEA 3OYHA 2QWLA 1X1PA 1G15A 3N4PA 4JKCA 3J80O 3S9HA 2ZF5O 3N4QA 3TU5A 3ENHA 1LWEA 2F9TA 1XC3A 2Z1HA 3OYIA 4FJGA 4EP5A 1NM1A 4BRNA 2P9IA 5TKWA 4NLBA 4ILHA 4XEIA 4MDAA 3S3OA 4BRAA 5J2MA 1WLJA 1CLQA 4BG9A 3UB5A 1BA0A 4E7LA 2NRXA 2HNYA 3CJ9A 1QQMA 1NGJA 4M3UA 3MWPA 1VSIA 1VAZA 2GBZA 5BPLA 4KHPK 4F3TA 1GLEG 4BWJA 3I0RA 3VEXA 3O4QA 3OS0A 1S1WA 1D5AA 5FRNA 3WNFA 3RRGA 1NWKA 3LALA 3VQAA 3VQ7A 4J2AA 3DLLL 1T8EA 4CGIA 2Q0RA 4BC4A 1QVGM 3PY8A 1L3TA 4B9TA 3DLEA 3O5BA 4JKDA 1RTIA 4E19A 1I39A 4FJKA 4FVUA 1WSIA 3BY5A 2UU9K 3G4SN 3HBTA 4LFCK 4GW6A 1EETA 2O8FA 4H0TB 3IRXA 1X3MA 5B8HA 3PO5A 1KVBA 2RF2A 3HVRA 4RW7A 2CH5A 2YJEA 4JKHA 4CGGA 1MWKA 3RMAA 2QWPA 3KIOA 4AM7A 4XH5A 5JICA 3NGZA 4TSXA 4K42A 2ZQBA 4PL8A 4FOEA 1N33K 5HRPA 5BRDA 2ITGA 1BDGA 3L6QA 1BQMA 4LH4A 1BIZA 1A5VA 2ZM6K 2ATQA 4KHSA 4M7XA 5DM6L 1S1VA 3MDQA 3V9ZA 2JWLA 4Z4FA 3E9PA 2KQ2A 1L3SA 2Y1JA 3RMCA 2HF3A 1EWQA 1IKYA 4NYNA 2IGIA 1SAZA 3U3GA 3UKRB 1RDDA 2NRZA 1CXQA 2NRTA 2YJFA 2HHXA 2O8BB 4F2SA 4ISEA 1RTJA 4AHSA 3CCVN 3TANA 4KHWA 1VRUA 2ASPA 2YHXA 3MX2A 3VF2A 3THYB 5LMNK 4L8RB 3T1AA 1VSFA 5AQHA 4CGJA 4FW1A 1RDWX 5FLXO 3K5OA 5I3UA 2A1RA 1KLNA 2CH6A 1N5YA 5AQRA 3I33A 4DQQA 3TI0A 4Y0WA 3KLFA 3WXKA 3ZSOA 4K0KK 1W97L 2O4GA 1T05A 3HP6A 1Q18A 2P9UB 3R1XA 2HHTA 3KK2A 1XI1A 3DXMB 4H0VB 4CJRA 4M63C 3BEXA 4O0IA 3ZYYX 1TUUA 3J81O 2NLXA 1NKBA 3VTIA 3EN9A 4LF5K 3T1HK 3I8DA 4BR0A 3EL2A 3AGKA 4BY9C 1BO5O 1UAXA 3TAQA 4YDUC 3VETA 3MXJA 4CHQA 3LDNA 1REVA 4FYDA 4X65K 1I94K 1Z26A 1YXQA 4KB0A 2QM1A 4J8FA 1Z6RA 3CFOA 4IFVA 2YV0X 4BR4A 2EX3A 2O8DA 5KPTA 1EP4A 1K8KA 4DUZK 4EIAA 5D3GA 4NXMK 1QQNA 3NVMA 2Q97A 1HYZA 1L3UA 2UXCK 3IMXA 4FCYA 4CZIA 1ZC6A 4F4KA 2W42A 3ENOA 3O08A 4MLHA 3HTVA 2NRHA 2OCEA 3RSEA 4CF1A 1H1VA 2VCPA 4GVEA 4JD2B 1SUQA 4DR6K 3QFUA 1RBRA 3E01A 4YOVA 3IFRA 1N36K 2DTUA 3LDSA 4HUFA 3THVA 4JI4K 1QE1A 3FGUA 3M1FA 4I6MA 2I7NA 1S3XA 5LMUK 2AP1A 2PAVA 4N56A 1IBLK 1QZ5A 3ZX2A 3SZ2A 5ADXA 3SPZA 5HRNA 4KHYA 1FJGK 4OGEA 2W40A 1ASWA 3M6GA 3FR0A 1JLCA 1EO1A 1GOAA 1CZ9A 2WUSA 2QXLA 4JHDB 4OVLA 4RWTA 4AHCA 1X3NA 1K9MO 1JXBA 4GNIA 3O9SA 1S9EA 4Z0UA 4KTZA 3VPZA 4KFBA 3ATVA 3NAEA 2P9KA 2NRVA 2HVIA 2IAJA 2WC9A 1OH8A 4IXCA 3ZSQA 4YHHK 3AVMA 1RT3A 1T03A 2D5RA 3K9KA 4DSLA 1C0UA 3AV9A 1SQKA 1J5OA 4KB1A 4KRFA 5AJ3K 5GINA 1VSLA 1BI4A 4M3RA 4G9ZA 3NGYA 3G10A 3BDPA 4M3ZA 4DR7K 2O8CB 3VQ8A 1YUWA 1C1CA 3CJ7A 3TAEA 2VG7A 1NGIA 3O1WA 3EZ5A 3K5MA 3CC2N 4GVMA 4CZJA 4A5BA 3O4NA 4BR5A 1W0HA 5BR8K 3HPOA 5AQGA 3FZMA 1DTTA 3VA3A 2CGJA 1HPZA 1HX1A 4O0JA 1KCFA 4K43A 4QAGA 2ZWHA 3DXKA 4FW2A 4HUGA 4RW8A 4BR7A 1IO2A 1WB9A 1VSMA 4W5NA 1TVRA 3BUZB 3RRHA 4H0PA 4WQ4C 3GBTA 5EX5A 2ZE2A 2FSKA 3LAKA 3VENA 1XQSC 4KHNA 4DFJA 3HXMA 3DOLA 1TK8A 3VGKA 5FROA 4KO0A 4FJLA 4DQIA 3C6TA 1Y97A 2A3ZA 3S3NA 4MDBA 3KLGA 4FJNA 1BCOA 2EHGA 4GV9A 3C95A 4NCAA 4CJSA 4W5RA 3OYKA 3AVGA 4IDKA 2OANA 1QS4A 4DR1K 1ATSA 2QWQA 3EO3A 4B1VA 4B9SA 2DFHA 1B9FA 3DI6A 1YJNN 1A5XA 3LANA 3SLCA 3PX6A 3SAFA 4OX9K 3V1OA 4FPBA 1CXUA 4W5OA 2AJQA 2V52B 4A2AA 3V9XA 4FJJA 2E88A 3NH0A 3WQUA 2P9SB 1HNVA 4YDUA 4DSFA 5J1EA 3AO2A 3M8PA 2RPIA 4M42A 1KAZA 4B3SK 4DR3K 1UA0A 3VEVA 4IFEA 4FPAA 3MXIA 4DQPA 2ZGYA 3F5TA 1TYQB 4BRLA 1RT7A 3K5NA 3RTVA 4BGBA 2HBMA 4MQ3A 1TL3A 2ITMA 4MO4A 3CM5A 4DTNA 2XO7A 4MO5A 4QS8A 2NRWA 3DOKA 1LCUA 1HNIA 4OPHA 5AQLA 3KVGA 4N41A 1XNRK 3Q7BA 3DLBA 4CBXA 3V9SA 4H5RA 4CHZA 3CC4N 3PIPL 4C23A 2R7YA 1RBSA 3A5LC 3S3MA 5H1SQ 1Q7YO 4DTUA 1KQSM 3OYAA 4PL7A 2JLEA 3ITHA 1LV5A 5TKYA 1TV6A 1IG9A 1HNXK 4K25A 1GLCG 4CJEA 3V9WA 1ASVA 3GG4A 5M1OA 5E41A 1P90A 5FPNA 2A41A 4O8KA 3AVFA 3HVTA 3THYA 1WSEA 4DLGA 3NCIA 2A40A 1NJIO 4CZKA 1EKEA 3CXCM 1HMVA 3DRRA 4OPAA 1TUYA 1RDUA 1RBTA 4X62K 4DTOA 4GKJK 3SV3A 3SQ0A 4FXDA 5JS2A 4C1NI 3VQPA 3E1YA 3V4IA 5CYQA 2KTQA 1MDUB 2E2OA 4YOWA 4JK7A 3FZKA 3PSFA 4DS5A 2P9NA 2UXDK 3E66A 3VF4A 1D9DA 4AF1A 1FXXA 5J2NA 1WBBA 3F9MA 3VA0A 3HOSA 4DQRA 1OVQA 3H3OB 4R5PA 2Q3SA 4GMJB 3OBWA 2G8FA 3FLCO 3O3HA 2ZJRL 1S6QA 5BR9A 1JCEA 2XY8A 1JLEA 3HL8A 1BCMA 5KPZA 3PUFA 3PLAA 2D0AA 1RGIA 3ISNC 3AY9A 3F9KA 3LP0A 2HNDA 4PKHA 1TK5A 5KPRA 2Q36A 3HI0A 4IO8A 1N8RO 3NFAA 1KAXA 4OPKA 2FBVA 5AQUA 3TR8A 1C1AA 4IOAL 2GTDA 4JRPA 5KGXA 4CEAA 1NGAA 3V6DA 1S1TA 4IZ9A 2FC0A 3OYEA 4FWNA 3VGLA 1BUPA 3TSQA 3O8MA 4CJ5A 4DTJA 4WQ4A 4JD2A 5AQKA 4FM1A 3WEEA 3HPHA 3NH2A 1P8ZA 4B9QA 2QW9A 3VQEA 4FLZA 5T7BA 1QTMA 1N6QA 4DV1K 4HUEA 4MFBA 5AQNA 5HRSA 1NGHA 3AVKA 1VQ5N 5BN8A 2PZSA 2Y1IA 3MCPA 3R6MA 3ZETB 3SAGA 1C6VA 3J7AP 5AQSA 4LFBK 2QI2A 3KD5E 3W0LA 1JKHA 4HTLA 4B9LA 4ID5A 3CCMN 1LWFA 3MWTA 1NJZA 5AQFA 1J54A 4H4MA 1O13A 5M1KA 1DLOA 4FVMA 3CQ8A 3SMPA 5HOOA 2OTJN 4CBUA 1T6DA 4CEOA 1BWFO 5LJWA 1Z05A 1SL2A 2UUCK 1GLJO 5KRTA 4BWMA 3U3YA 1U48A 4DV7K 3MN9A 3T69A 4Y1CA 1IH7A 3SBTA 3SJJA 1SKSA 2E2NA 3AVLA 4FM2A 2VGNA 3VOVA 1VQ8N 1BL3A 2B4JA 4DSIA 1QSYA 3WXLA 1S72N 1Y64A 3P4IA 3K57A 3SQ1A 5AQOA 5AR0A 5F0XA 4FJHA 1JL1A 2P1JA 3UKUB 1XMQK 4BE1A 1KVCA 1RTDA 1R0AA 1RBUA 2OPSA 1CZAN 4DUYK 3D6RA 3D45A 4BC3A 1GLBG 2Z1JA 4IG3A 1IBKK 3O9TA 1ZBIA 1FKOA 1JL2A 1MU2A 4CFBA 4DV2K 1FKPA 3THWB 2FBYA 2HW3A 2FF6A 3O3GA 1C0FA 3CI5A 4AHRA 1LW0A 4CEQA 2E1YA 2CGLA 4CJQA 3CJBA 4AQYK 4B9MA 1D9FA 3GDQA 4CI6A 3AAQA 3FZLA 3A5NC 4W5TA 4CJ7A 1DT9A 2RN2A 3PIOL 3IAYA 4PA1A 4BRHA 4I9LA 3AGRA 2E2QA 4WE1A 5C24A 3WNGA 2VQFK 1NMDA 2HHVA 3C7NA 1SZ2A 4CD1A 3ZLJA 1S22A 3TSPA 4F8RA 3HP9A 2DY4A 3CJAA 2P5OA 4YNQA 3FZFA 4JYAK 4IFYA 3OJUA 3CF5L 2HHUA 1XHXA 3K59A 4FWRA 3DLGA 4AH9A 4DSKA 1BU6O 4DU3A 3KTQA 4C8OA 4KH6A 3QETA 2NZTA 4YY3K 1LAVA 5HRRA 1DEJA 1D4XA 1NGCA 3KWIA 1XWLA 4E7IA 3DLKA 4JK8A 3OYCA 3WQTA 1A5WA 4H5NA 2IC3A 4DTMA 1NK6A 2HHWA 1QHAA 4M41A 3U9ZA 4W5QA 1S1XA 4DF8A 1FW6A 4IWVA 4H0XB 4N76A 4O5FA 4IJAA 1EX4A 5AQQA 4E1MA 2E1ZA 3O9UA 4M3YA 4FWKA 3KK1A 2Q31A 1RTHA 3ZSRA 3QBWA 2JGUA 2ZJPL 1BQNA 3LM9A 4M3TA 4CJTA 5JLFA 4LF9K 1NK4A 5K14A 3I55N 1RBVA 4BE0A 5AZJA 4BDYA 3THXA 3RMDA 2PYJA 1GOBA 5FPEA 2YNFA 4FZZA 3CPEA 3ZT0A 3QIPA 4FLUA 1T44A 3QBXA 3Q7CA 4A62A 3CD6N 2F96A 2KZMA 3NBPA 3U6FA 3MN6A 4JI8K 1E4GT 3M8SA 1JCFA 4ZTFA 1Z25A 2GELA 3DM2A 3AO5A 3KK3A 4FJIA 3SUQA 3D2EA 4N5SA 5C12A 4ICLA 2P9PB 3A0IX 4EP4A 1OH6A 1QQCA 3C94A 5CZ1A 3ZX3A 3CQYA 1BGXT 4N47A 1NGDA 3AVNA 3DWLA 4FSVA 3T7ZA 1TKTA 1OH7A 4KPYA 1NGEA 3AO4A 4CZHA 3NDKA 3U8XA 2A6AA 3PX4A 3SPYA 4FO0A 1NBWA 3CQXA 1Q9XA 3KLEA 3ALYA 3V1RA 4B3TK 4CZGA 4CJWA 2BUPA 3OYDA 4PKIA 4YOTA 3QNOA 1UWBA 2ZGZA 3EZWA 3WUHA 4EZ6A 4DV3K 1XHZA 1NU0A 1ATNA 5AQWA 1NKEA 4JN4A 4HWIA 1LAWA 2QEXN 3CIPA 2P9LA 3L4IA 1UA1A 3I8BA 4BG8A 4JKGB 3OJSA 1J53A 5GAEP 1ZYQA 1RT5A 3OHRA 2W6LA 4DSJA 3VQDA 1ESVA 3JAMO 3H3NO 4IEEA 1SKRA 3SV4A 3LWLA 1YT3A 2YKNA 3LAMA 1SV5A 3ID6A 2BANA 3KJVA 2IS3A 3KLHA 5CZ2A 2G8WA 4DB3A 3ZEUB 3TAGA 5AQIA 1VQON 4B9VA 1IKVA 2YI1A 3QIOA 5M1FA 4E0DA 4ILGB 2QWNA 3C0BA 5AQJA 1NG9A 2I5JA 3SQ4A 4LC9B 4IOXA 1TAUA 1WSHA 2YNHA 2D0BA 4NXNK 3L2WA 2P51A 3CYMA 1VSEA 3CFRA 4IDHA 2CGKA 3DRSA 1SS6A 3NF6A 5EXWA 4C8MA 3CCSN 2A5XA 4IEIA 4CHPA 4DQ8A 4G1QA 4IBNA 5BPNA 4OKKA 3QICA 3KKSA 2QKKA 4OO1J 4DS4A 4C8KA 2HBLA 3M5RA 2HB5A 1VQ4N 1GOCA 3FZHA 4ISFA 2P9IB 3QO9A 5ELZA 2HHHK 4B1ZA 2E5LK 4ILJA 4CCHA 4B1UB 3R3LA 3LP1A 4H8KA 3R9PA 2XY5A 3U9DA 2X6NA 3UE5A 3EY1A 4ELVA 1IJJA 3KK7A 1T6CA 1OKJA 3SI6A 1VQKN 3MECA 3V1QA 4OKJA 3C6HA 1TKDA 5FPDA 2VWJA 4BRFA 3CC7N 2YHWA 2V7ZA 3QDKA 5JLHA 5FRMA 1TKXA 2GX9A 5AQMA 4CJ4A 1X9SA 1XNQK 3VEWA 4UY8O 1LOTB 4CHOA 1G99A 3R8EA 4FJXA 4H4OA 3NH1A 1HR0K 4CIEA 5HBMA 3BGRA 3FFIA 3PX0A 1K8AO 2O8FB 4LF6K 1NKCA 3OW2M 5KQ8A 3G0ZA 5J2PA 1RDBA 3KKRA 4CFDA 4JKAA 3HM9A 4EHUA 1NGGA 4QS9A 2Q1NA 3NF7A 4FJ5A 1ATRA 3O9RA 4WCEL 4DFPA 2QWMA 5JS1A 1V4SA 4CHYA 3RR7A 3UIQA 2F9WA 4FK4A 3VGMA 4IOCL 2GWJA 1W7AA 1S5JA 3H6EA 3MEGA 3LDPA 1TAQA 1NOZA 1HRHA 3C6UA 4F2RA 4B3MK 4LSLA 4O55A 2OYQA 3D7EO 4CESA 4CF0A 1HKCA 5F1XA 3D0PA 1HKBA 3HYFA 1ZBUA 3WNHA 4B3RK 3VEOA 4ZHRA 5MLCQ 3TAPA 3LPUA 2WOMA 5FDLA 3L4QA 3FFKB 4Y1DA 3S41A 2H3GX 3AVHA 3K9JA 3TSUA 4OKEA 4H03B 4CHNA 2O8EB 4BQLA 1JLGA 1WSFA 3LP3A 3BF3A 4AHUA 2IDOA 3ZT4A 4BC5A 3SUOA 2HMPA 1WSJA 1BHLA 4CD3A 2KFNA 3CCLN 3NGIA 4B8CA 2GUIA 3CCRN 3MK6A 4DCHA 4DFKA 3RR8A 2XHBA 3HRGA 1RDAA 4CF9A 2Q2RA 1F21A 4CJ3A 4JI6K 1YF5L 3ZCMA 2Z1IA 1VSKA 5GADP 4CJKA 3JS6A 4CZMA 3SMSA 2QWOA 2PY5A 4I7FA 2B6AA 4H5TA 2VG6A 4CECA 3KD1E 4BRQA 2HNZA 3DAWA 1JJ2M 4E7JA 1YITN 3PSIA 3HM8A 1RCHA 3OY9A 1WUAA 2AA4A 2ASMA 3QFPA 3M8RA 2Z1GA 1RT2A 2YNIA 1IBMK 4DR5K 4DTRA 1TKZA 1YHQN 4DU1A 2O8BA 3UKRA 3ULEB 2UUAK 3TTDA 3U4LA 4ID1A 4IJNA 3VERA 3RMBA 1U04A 4JI1K 3TARA 1U47A 1EWRA 1NK0A 1C0GA 3CG7A 1ZXOA 3CJCA 5A2QO 1XUPO 4E1JA 5AZIB 3NF9A 4KV8A 4CJVA 4I2PA 2OZMA 5DK5A 3KZBA 2O8DB 4DTSA 1WN7A 2NUBA 2YHAA 4DSEA 1Q9YA 3RVCA 4BVPA 5IWAK 3OYBA 4KTWA 2KW4A 4CEFA 5LJVA 1VRTA 2P9UA 3AA5X 5E84A 2E6MA 2FXUA 3DXMA 2F4VK 5AFUH 4B3OA 3P5JA 1Q82O 2FLOA 4JI3K 3RSEB 2NRRA 1UOCA 2G8UA 1YJWN 2IIRA 4FLYA 2KHOA 3HPGA 1T3VA 3OYGA 2LSNA 3VQ6A 4CF8A 3G6EN 2EWSA 3B8AX 2F7TA 3ZSWA 4CK1A 3AO1A 1YTAA 4O44A 4I6MB 4DFMA 1VQ6N 4KHQA 4AM6A 1S9GA 4B1XB 3P1GA 1U2VB 1ZBFA 4JKEA 4DV6K 3J7ZO 4C8LA 4HVJA 4FK2A 3B6OA 4V19S 3OBYA 4DU4A 3LPTA 5KGWA 1JLQA 2B5JA 3FE1A 3AO3A 1X9JA 3P39A 4OJRA 2UUBK 4R79A 4JK9A 1SKWA 4RTFD 4H0OA 4FK0A 5EOYA 1IKXA 2QXFA 3IDHA 5BRFA 4KI6A 5CE3A 2E8AA 2P9KB 5JVHL 1NOYA 4RCHA 4CIFA 1IV0A 3VTHA 5M1QA 1KRPA 3BZCA 5LY3A 3OTOK 1OVYA 5AQPA 1ILYA 3SBGA 4Q5VA 4DWIA 5CY4A 3J8AA 4FL9A 4PHTX 1BI4B 3AA2A 4BROA 3CCUN 3OVNA 4DTXA 4CVNE 4PKGA 4BRPA 5CHIA 3CM6A 1W9HA 1OH5A 1BG3A 3OYNA 5EU7A 1KLMA 1MA9B 1WAFA 3MN5A 1RT6A 4JHDA 4JKFA 3ZSXA 3AA4A 4NCGA 3ID8A 5LL6Z 4KI4A 1JCGA 4WF9L 3MN7A 3JYTA 4F3OA 3AVBA 5IT9O 3DLRA 2O4IA 4B1YB 3CERA 5CR4A 4DTPA 4CEDA 5C10A 1N32K 4RW9A 3BP8A 5F2RA 1VQPN 3P31A 5BREA 3DXKB 4A5AA 3ENBA 1ZBHA 2GWKA 1RDCA 1D8YA 4E89A 4O8UA 4JAXA 1CZBA 2D1KA 1QSSA 3CMEN 1HYSA 4F9OA 2O8CA 3T19A 4FZXC 4WFAL 1EXQA 3VMFB 4FLXA 4KREA 4DHYA 2X6SA 2UYTA 2HOEA 4CFCA 4FM0A 1O1WA 3LDQA 4DKWA 1N34K 4FWLA 4CZEA 5EVZA 1NJWA 2W41A 4FLVA 1C0TA 1K6YA 1NNEA 4CEZA 2J4RA 3NMUA 3HZ6A 5AQYA 1SL0A 3P83D 5C42A 3MXMA 2GEMA 2PFUA 1RILA 4YORA 4E7KA 1V4TA 3AVCA 3OS2A 3QMLA 3AARA 3DYAA 2V51B 1KC8O 3CETA 5C25A 5JVGL 1TK0A 1S6PA
chains in the Genus database with same CATH topology
4NCAA 4CJSA 4W5RA 3OYKA 1HJRA 1YVUA 3AVGA 4IDKA 1QS4A 3QNOA 1UWBA 4CJPA 1KFDA 4I9QA 1HQUA 4Z4IA 5HROA 2OPPA 4EZ6A 1XHZA 3TAMA 4B9SA 2YNGA 3ZT1A 2DFHA 1B9FA 4AILC 1NKEA 3DI6A 1RNHA 1A5XA 2WONA 2E4LA 3LANA 1LAWA 3PX6A 1WAJA 4KKOA 3V1OA 5J2QA 1TGOA 2XY7A 5DMRA 1UA1A 3OJSA 1CXUA 4CERA 4W5OA 4K8ZA 1J53A 2AJQA 2GV9A 3V9XA 1ZYQA 3EYZA 4FJJA 1RT5A 3NH0A 4DSJA 1HNVA 3VQDA 4B8AB 2X78A 5KI6A 4J2BA 1NJYA 1SKRA 3SV4A 3LWLA 4DSFA 4Z4EA 2YHBA 3LP2A 3ZSVA 5J1EA 4CIGA 4Z4HA 1YT3A 2YKNA 3AO2A 3LAMA 2RPIA 1SV5A 3M8PA 4DG1A 4B9NA 3ZT3A 4K8XA 2BANA 3CFPA 4M42A 3KJVA 4CJFA 2IS3A 1J9AA 3QEXA 3KLHA 5CZ2A 2G8WA 4CJUA 3MAQA 3QESA 1ASUA 3TAGA 1UA0A 4B9VA 1IKVA 3QIOA 1KVAA 1L5UA 1JLBA 4E0DA 4M3XA 2G8VA 1ITGA 4FJ7A 2I5JA 3MXIA 4DQPA 3SQ4A 2KZZA 4ELTA 2HMIA 1TAUA 1WSHA 1B9DA 1NK9A 2YNHA 1RT7A 2D0CA 2P5GA 2D0BA 3L2WA 2P51A 3K5NA 1X9MA 3RTVA 2G8KA 3CYMA 1WNSA 1VSEA 3NE6A 4MQ3A 3CFRA 1TL3A 3DRSA 3NF6A 4C8MA 4LD0A 3CM5A 2F8TA 5KTQA 4RW6A 4CHPA 4DTNA 4G1QA 4FZYA 3I0SA 2XO7A 1NK7A 3ASMA 2HHQA 4IBNA 3V9UA 1QHTA 4OKKA 4B08A 1BIUA 3DOKA 3KKSA 2QKKA 4FJMA 1HNIA 1VSDA 4N41A 4KHUA 1RT1A 3DLBA 4UQGA 3V9SA 4DS4A 4C8KA 4CHZA 3ZT2A 4M45A 4CGFA 2HVHA 2R7YA 2HB5A 4DMNA 1GOCA 1RBSA 2ETJA 4NYFA 3SYZA 4BE2A 4CJLA 3S3MA 4DTUA 4CK3A 3QO9A 1YTUA 3OYAA 4JRQA 4DQSA 4CCHA 3DMJA 4CGHA 2JLEA 3ITHA 1LV5A 4Z4CA 3VQ5A 4CEEA 3LP1A 4H8KA 1TV6A 3OYHA 2XY5A 1X1PA 1G15A 1IG9A 2X6NA 3S9HA 4ELUA 3EY1A 2PYLA 4ELVA 4AHTA 1DTQA 4CJEA 3V9WA 1ASVA 1LWEA 3SI6A 2Z1HA 3OYIA 5HLFA 3MECA 4FJGA 3V1QA 5E41A 4EP5A 2G8HA 3NF8A 4OKJA 3AVFA 3HVTA 1WSEA 3SNNA 1TKDA 4DLGA 3VQQA 3NCIA 1FK9A 2BE2A 4PWDA 3S3OA 1EKEA 1RT4A 5J2MA 1WLJA 3PV8A 3LZJA 1HMVA 3DRRA 4DTOA 4CK2A 1CLQA 1RBTA 2VWJA 1HQEA 3SV3A 3SQ0A 2F8SA 4FXDA 4E1NA 5JS2A 5FRMA 3VQPA 4E7LA 3V4IA 1TKXA 2HNYA 5CYQA 4CJ4A 5SZTA 2KTQA 1X9SA 4O4GA 4CHOA 4OPJA 4M3UA 3ZSZA 1VSIA 4FJXA 1JXEA 1JLFA 4H4OA 3RWUA 3NH1A 4IG0A 4CIEA 5HBMA 4DS5A 2GBZA 1D9DA 3BGRA 2QKBA 1FXXA 2XRIA 3FFIA 5J2NA 4F3TA 3PX0A 3VA0A 4DQRA 4BWJA 3I0RA 3O4QA 3OS0A 1S1WA 1D5AA 2Q3SA 4R5PA 5FRNA 1NKCA 4J2DA 3G0ZA 5J2PA 3WNFA 4GMJB 1RDBA 3RRGA 2RKIA 3QEWA 3KKRA 3LALA 3VQAA 2G8FA 3VQ7A 4CFDA 4J2AA 4LH5A 3O3HA 3QERA 1S6QA 3VQCA 3L2VA 3HM9A 3LZIA 1WSGA 1KSPA 3OYLA 1T8EA 3NF7A 4CGIA 3SQ2A 4FJ5A 4OLAA 2XY8A 1JLEA 3WNEA 3HL8A 3PY8A 1BCMA 2BGGA 1L3TA 4DFPA 3HSTB 4B9TA 3DLEA 4E19A 4J2EA 1RTIA 3PUFA 1I39A 4FJKA 4PQUA 5JS1A 3UIQA 4CHYA 1WSIA 3RR7A 3L3VA 3JSMA 4FK4A 2A1SA 2D0AA 4GW6A 1EETA 1S5JA 1T7PA 3IRXA 3ISNC 3HO1A 3F9KA 3MEGA 3LP0A 3PO5A 1KVBA 2RF2A 3HVRA 2HNDA 1TAQA 1NOZA 1U45A 1HRHA 3C6UA 4RW7A 1TK5A 4F2RA 4LSLA 3NFAA 4CGGA 4O55A 2FBVA 4OPKA 3RMAA 3TR8A 1C1AA 4CESA 4CF0A 2OYQA 3KIOA 3D0PA 4JRPA 5KGXA 3HYFA 1ZBUA 3WNHA 4CEAA 3TABA 1S1UA 4ZHRA 3TAPA 3LPUA 4KAZA 2WOMA 3NGZA 5FDLA 3V6DA 4Y1DA 3DRPA 1S1TA 3AVHA 4TSXA 2FC0A 2YKMA 4OKEA 3OYEA 3HJFA 4AHVA 4CHNA 3OYMA 3L2UA 4BDPA 4CJ5A 4DTJA 2ZQBA 1JLGA 3PO4A 1WSFA 4OLBA 3LP3A 4FM1A 1KTQA 4AHUA 2IDOA 3HPHA 3ZT4A 3NH2A 3SUOA 1WSJA 1BHLA 2OPRA 5HRPA 2KFNA 3NGIA 2ITGA 4B8CA 2GUIA 3O3FA 3VQEA 1BQMA 4FLZA 5T7BA 4LH4A 1BIZA 1A5VA 4DFKA 3OYJA 3RR8A 1QTMA 2ATQA 1N6QA 2XHBA 4HUEA 4CEBA 4KHSA 4MFBA 3K2PA 1RDAA 3NHGA 5HRSA 3AVKA 4CF9A 1S1VA 1F21A 4CF2A 3V9ZA 4CJ3A 4Z4FA 3ZCMA 2KQ2A 4B9UA 2Z1IA 1VSKA 4CJKA 4ZTJA 1L3SA 2Y1JA 4QCLA 3RMCA 2PZSA 1IKYA 3AVAA 2Y1IA 4NYNA 2IGIA 1C6VA 3QLHA 2PY5A 1RDDA 4I7FA 3U3GA 1CXQA 1Q8IA 2HHXA 3KD5E 2B6AA 4F2SA 1JKHA 4B9LA 1RTJA 2VG6A 4CECA 3IS9A 3KD1E 4BDZA 4ID5A 4AHSA 2HNZA 3TANA 4KHWA 1VRUA 1LWFA 1NJZA 3MEDA 4E7JA 4L8RB 3T1AA 3SUPA 5KRSA 1J54A 1VSFA 4H4MA 4CGJA 1DLOA 1RCHA 4FW1A 3OY9A 4FVMA 4I2QA 3K5OA 5I3UA 3M8RA 2Z1GA 1RT2A 2YNIA 2FBTA 3CQ8A 2A1RA 1KLNA 3QNNA 1N5YA 4DTRA 4CEOA 1TKZA 3KLFA 4DQQA 3TI0A 3ZSOA 4DU1A 1SL2A 1LW2A 3TAFA 3V81A 4O5BA 4LY7A 2O4GA 4ID1A 1T05A 4HCCA 3SUNA 3HP6A 3RMBA 1U04A 1U47A 3TARA 5KRTA 4BWMA 3HT3A 1NK0A 3U3YA 1U48A 3KK2A 1XI1A 2HHTA 2OZSA 1XC9A 4CJRA 3CG7A 4Y1CA 1IH7A 3SJJA 4PY5A 4BACA 4O0IA 1SKSA 2ZD1A 4DSKA 3A2FA 3AVLA 1TL1A 4FM2A 1NKBA 3NF9A 1C1BA 4KV8A 4I2PA 4CJVA 4FLWA 2OZMA 5DK5A 1VSJA 3I8DA 4Z4GA 4DTSA 3AVJA 1WN7A 1BL3A 2NUBA 2B4JA 2YHAA 3ZSYA 4DSEA 4DSIA 1X9WA 1Q9YA 1UAXA 3TAQA 3OYBA 1QSYA 4KTWA 2KW4A 4CEFA 1VRTA 3AA5X 3MXJA 4CHQA 3K57A 3SQ1A 2E6MA 1REVA 2BDPA 4FJHA 4FYDA 1JL1A 2P1JA 4BE1A 1KVCA 1RTDA 4B3OA 1Z26A 3P5JA 1RBUA 2OPSA 1HYVA 1R0AA 4KB0A 3CFOA 4JS5A 4OGCA 4IFVA 3D45A 1UOCA 2YV0X 2G8UA 2Z1JA 4FLYA 4FLTA 4E3SA 2EX3A 4IG3A 3HPGA 3M8QA 1EP4A 3TWHA 1ZBIA 1FKOA 3OYGA 1JL2A 2LSNA 3ULDA 3VQ6A 4CF8A 5D3GA 2G8IA 1MU2A 4CFBA 5SWMA 1HYZA 3ZSWA 4CK1A 1L3UA 1FKPA 3AO1A 4FCYA 1YTAA 4O44A 4F4KA 4CFAA 2W42A 2FBYA 2HW3A 4DFMA 3O3GA 4AHRA 1LW0A 4KHQA 1C0MA 1S9GA 2X74A 3P1GA 4CEQA 4IKFA 1ZBFA 4CF1A 4CJQA 3T3FA 4B9MA 4HVJA 4C8LA 4FK2A 1SUQA 3B6OA 5CYMA 1D9FA 3QEVA 4FJ9A 1RBRA 3E01A 4LSNA 4W5TA 4DU4A 3LPTA 5KGWA 1JLQA 2B5JA 3AO3A 2RN2A 2DTUA 3L3UA 4OJRA 3LDSA 4HUFA 3H08A 3IAYA 4PA1A 3VQ4A 3THVA 1SKWA 1QE1A 4I9LA 4FK0A 4WE1A 5C24A 3WNGA 1IKXA 2QK9A 2QXFA 2HHVA 2KFZA 5I42A 4KI6A 4N56A 3SZ2A 4F8RA 3SPZA 5HRNA 4KHYA 3HP9A 2DY4A 4OGEA 1NOYA 4HTUA 4CIFA 4DLEA 4YFUA 4E7HA 1ASWA 5HP1A 1KRPA 2P5OA 4HCBA 1JLCA 3IG1A 4YNQA 1GOAA 1CZ9A 4OVLA 4C8NA 4IFYA 4AHCA 3OJUA 4Q5VA 4DWIA 2HHUA 1JXBA 1XHXA 5CY4A 3L2QA 1JLAA 3K59A 1KFSA 4PUOA 1S9EA 1BI4B 3AVIA 2E6LA 3DLGA 4KTZA 3AA2A 4Z0UA 4AH9A 3OVNA 4DU3A 4KFBA 4DTXA 3NAEA 2XY6A 3KTQA 4C8OA 3VQ9A 3B6PA 3QETA 2IAJA 2HVIA 3CM6A 1W9HA 1LAVA 5HRRA 4DF4A 1SL1A 3OYNA 5EU7A 3ZSQA 3AVMA 3F73A 3SCXA 1KLMA 1RT3A 1WAFA 1XWLA 2D5RA 4E7IA 1RT6A 1T03A 3DLKA 4DSLA 1C0UA 3OYCA 3AV9A 4NCBA 1A5WA 1J5OA 4KB1A 3ZSXA 2VWKA 1ZBLA 3AA4A 4NCGA 1NK8A 4KRFA 1NK5A 3DLHA 2IC3A 4DTMA 1NK6A 2HHWA 4FJ8A 4KI4A 4M41A 4W5QA 1S1XA 2FBXA 4HHTA 4DF8A 1VSLA 1BI4A 4M3RA 4N76A 1VSHA 1EX4A 3MEEA 3NGYA 4E1MA 3JYTA 3HK2A 4M3YA 3G10A 3BDPA 3KK1A 4M3ZA 1VK0A 1RTHA 4F3OA 3AVBA 3ZSRA 2JGUA 3DLRA 3VQ8A 4EZ9A 1C1CA 1BQNA 3VQBA 4DTPA 2O4IA 4CEDA 1BISA 4RW9A 4M3TA 4CJTA 3TAEA 1NK4A 2VG7A 5K14A 1RBVA 4JLHA 4BE0A 4Q0BA 2HHSA 4XIUA 3EZ5A 3K5MA 4BDYA 4GVMA 1U49A 3RMDA 2PYJA 1ZBHA 1GOBA 3O4NA 2YNFA 3QEIA 4FZZA 1RDCA 1W0HA 3HPOA 1D8YA 4E89A 3ZT0A 3K58A 3QIPA 3VA3A 1DTTA 1CZBA 3KLIA 4FLUA 1QSSA 1I3AA 1HYSA 1HPZA 4O0JA 4QOZB 3T19A 1QSLA 2KZMA 2F96A 1KCFA 2OA8A 4FZXC 3NBPA 3OS1A 3U6FA 3AA3A 1EXQA 4CGDA 4FLXA 4KREA 1LWCA 2X6SA 4QAGA 2DFFA 3K5LA 3M8SA 4CFCA 4FM0A 4ZTFA 1Z25A 4FW2A 1O1WA 4HUGA 3VN5A 4KTQA 4RW8A 3DM2A 3AO5A 3KK3A 4FJIA 1NJWA 1NJXA 3SUQA 1IO2A 1U4BA 4N5SA 1VSMA 1C0TA 4FLVA 1K6YA 2OPQA 4ICLA 4W5NA 1TVRA 4CEZA 4EP4A 4RG8A 2VG5A 3RRHA 1SL0A 3P83D 5C42A 1QQCA 3MXMA 3C94A 5CZ1A 3LWMA 1RILA 3QINA 4CE9A 2ZE2A 3LAKA 4E7KA 1BGXT 3AVCA 4N47A 3AVNA 3OS2A 4KHNA 4DFJA 3HXMA 3DOLA 3DYAA 4RW4A 1IKWA 1TKTA 4JS4A 4KPYA 3AO4A 1TK8A 1B92A 3L8BA 2IOCA 3NDKA 3L2RA 5FROA 3PX4A 3SPYA 4M3WA 4KO0A 4FJLA 5C25A 3C6TA 4DQIA 1Y97A 3OYFA 2DFEA 1Q9XA 3S3NA 3KLEA 1L3VA 3KLGA 4FJNA 1BCOA 2EHGA 3ALYA 3V1RA 3QEPA 1TK0A 4CJWA 3C95A 3OYDA 1S6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCA A;  4CJS A;  4W5R A;  3OYK A;  1HJR A;  1YVU A;  3AVG A;  4IDK A;  1QS4 A;  3QNO A;  1UWB A;  4CJP A;  1KFD A;  4I9Q A;  1HQU A;  4Z4I A;  5HRO A;  2OPP A;  4EZ6 A;  1XHZ A;  3TAM A;  4B9S A;  2YNG A;  3ZT1 A;  2DFH A;  1B9F A;  4AIL C;  1NKE A;  3DI6 A;  1RNH A;  1A5X A;  2WON A;  2E4L A;  3LAN A;  1LAW A;  3PX6 A;  1WAJ A;  4KKO A;  3V1O A;  5J2Q A;  1TGO A;  2XY7 A;  5DMR A;  1UA1 A;  3OJS A;  1CXU A;  4CER A;  4W5O A;  4K8Z A;  1J53 A;  2AJQ A;  2GV9 A;  3V9X A;  1ZYQ A;  3EYZ A;  4FJJ A;  1RT5 A;  3NH0 A;  4DSJ A;  1HNV A;  3VQD A;  4B8A B;  2X78 A;  5KI6 A;  4J2B A;  1NJY A;  1SKR A;  3SV4 A;  3LWL A;  4DSF A;  4Z4E A;  2YHB A;  3LP2 A;  3ZSV A;  5J1E A;  4CIG A;  4Z4H A;  1YT3 A;  2YKN A;  3AO2 A;  3LAM A;  2RPI A;  1SV5 A;  3M8P A;  4DG1 A;  4B9N A;  3ZT3 A;  4K8X A;  2BAN A;  3CFP A;  4M42 A;  3KJV A;  4CJF A;  2IS3 A;  1J9A A;  3QEX A;  3KLH A;  5CZ2 A;  2G8W A;  4CJU A;  3MAQ A;  3QES A;  1ASU A;  3TAG A;  1UA0 A;  4B9V A;  1IKV A;  3QIO A;  1KVA A;  1L5U A;  1JLB A;  4E0D A;  4M3X A;  2G8V A;  1ITG A;  4FJ7 A;  2I5J A;  3MXI A;  4DQP A;  3SQ4 A;  2KZZ A;  4ELT A;  2HMI A;  1TAU A;  1WSH A;  1B9D A;  1NK9 A;  2YNH A;  1RT7 A;  2D0C A;  2P5G A;  2D0B A;  3L2W A;  2P51 A;  3K5N A;  1X9M A;  3RTV A;  2G8K A;  3CYM A;  1WNS A;  1VSE A;  3NE6 A;  4MQ3 A;  3CFR A;  1TL3 A;  3DRS A;  3NF6 A;  4C8M A;  4LD0 A;  3CM5 A;  2F8T A;  5KTQ A;  4RW6 A;  4CHP A;  4DTN A;  4G1Q A;  4FZY A;  3I0S A;  2XO7 A;  1NK7 A;  3ASM A;  2HHQ A;  4IBN A;  3V9U A;  1QHT A;  4OKK A;  4B08 A;  1BIU A;  3DOK A;  3KKS A;  2QKK A;  4FJM A;  1HNI A;  1VSD A;  4N41 A;  4KHU A;  1RT1 A;  3DLB A;  4UQG A;  3V9S A;  4DS4 A;  4C8K A;  4CHZ A;  3ZT2 A;  4M45 A;  4CGF A;  2HVH A;  2R7Y A;  2HB5 A;  4DMN A;  1GOC A;  1RBS A;  2ETJ A;  4NYF A;  3SYZ A;  4BE2 A;  4CJL A;  3S3M A;  4DTU A;  4CK3 A;  3QO9 A;  1YTU A;  3OYA A;  4JRQ A;  4DQS A;  4CCH A;  3DMJ A;  4CGH A;  2JLE A;  3ITH A;  1LV5 A;  4Z4C A;  3VQ5 A;  4CEE A;  3LP1 A;  4H8K A;  1TV6 A;  3OYH A;  2XY5 A;  1X1P A;  1G15 A;  1IG9 A;  2X6N A;  3S9H A;  4ELU A;  3EY1 A;  2PYL A;  4ELV A;  4AHT A;  1DTQ A;  4CJE A;  3V9W A;  1ASV A;  1LWE A;  3SI6 A;  2Z1H A;  3OYI A;  5HLF A;  3MEC A;  4FJG A;  3V1Q A;  5E41 A;  4EP5 A;  2G8H A;  3NF8 A;  4OKJ A;  3AVF A;  3HVT A;  1WSE A;  3SNN A;  1TKD A;  4DLG A;  3VQQ A;  3NCI A;  1FK9 A;  2BE2 A;  4PWD A;  3S3O A;  1EKE A;  1RT4 A;  5J2M A;  1WLJ A;  3PV8 A;  3LZJ A;  1HMV A;  3DRR A;  4DTO A;  4CK2 A;  1CLQ A;  1RBT A;  2VWJ A;  1HQE A;  3SV3 A;  3SQ0 A;  2F8S A;  4FXD A;  4E1N A;  5JS2 A;  5FRM A;  3VQP A;  4E7L A;  3V4I A;  1TKX A;  2HNY A;  5CYQ A;  4CJ4 A;  5SZT A;  2KTQ A;  1X9S A;  4O4G A;  4CHO A;  4OPJ A;  4M3U A;  3ZSZ A;  1VSI A;  4FJX A;  1JXE A;  1JLF A;  4H4O A;  3RWU A;  3NH1 A;  4IG0 A;  4CIE A;  5HBM A;  4DS5 A;  2GBZ A;  1D9D A;  3BGR A;  2QKB A;  1FXX A;  2XRI A;  3FFI A;  5J2N A;  4F3T A;  3PX0 A;  3VA0 A;  4DQR A;  4BWJ A;  3I0R A;  3O4Q A;  3OS0 A;  1S1W A;  1D5A A;  2Q3S A;  4R5P A;  5FRN A;  1NKC A;  4J2D A;  3G0Z A;  5J2P A;  3WNF A;  4GMJ B;  1RDB A;  3RRG A;  2RKI A;  3QEW A;  3KKR A;  3LAL A;  3VQA A;  2G8F A;  3VQ7 A;  4CFD A;  4J2A A;  4LH5 A;  3O3H A;  3QER A;  1S6Q A;  3VQC A;  3L2V A;  3HM9 A;  3LZI A;  1WSG A;  1KSP A;  3OYL A;  1T8E A;  3NF7 A;  4CGI A;  3SQ2 A;  4FJ5 A;  4OLA A;  2XY8 A;  1JLE A;  3WNE A;  3HL8 A;  3PY8 A;  1BCM A;  2BGG A;  1L3T A;  4DFP A;  3HST B;  4B9T A;  3DLE A;  4E19 A;  4J2E A;  1RTI A;  3PUF A;  1I39 A;  4FJK A;  4PQU A;  5JS1 A;  3UIQ A;  4CHY A;  1WSI A;  3RR7 A;  3L3V A;  3JSM A;  4FK4 A;  2A1S A;  2D0A A;  4GW6 A;  1EET A;  1S5J A;  1T7P A;  3IRX A;  3ISN C;  3HO1 A;  3F9K A;  3MEG A;  3LP0 A;  3PO5 A;  1KVB A;  2RF2 A;  3HVR A;  2HND A;  1TAQ A;  1NOZ A;  1U45 A;  1HRH A;  3C6U A;  4RW7 A;  1TK5 A;  4F2R A;  4LSL A;  3NFA A;  4CGG A;  4O55 A;  2FBV A;  4OPK A;  3RMA A;  3TR8 A;  1C1A A;  4CES A;  4CF0 A;  2OYQ A;  3KIO A;  3D0P A;  4JRP A;  5KGX A;  3HYF A;  1ZBU A;  3WNH A;  4CEA A;  3TAB A;  1S1U A;  4ZHR A;  3TAP A;  3LPU A;  4KAZ A;  2WOM A;  3NGZ A;  5FDL A;  3V6D A;  4Y1D A;  3DRP A;  1S1T A;  3AVH A;  4TSX A;  2FC0 A;  2YKM A;  4OKE A;  3OYE A;  3HJF A;  4AHV A;  4CHN A;  3OYM A;  3L2U A;  4BDP A;  4CJ5 A;  4DTJ A;  2ZQB A;  1JLG A;  3PO4 A;  1WSF A;  4OLB A;  3LP3 A;  4FM1 A;  1KTQ A;  4AHU A;  2IDO A;  3HPH A;  3ZT4 A;  3NH2 A;  3SUO A;  1WSJ A;  1BHL A;  2OPR A;  5HRP A;  2KFN A;  3NGI A;  2ITG A;  4B8C A;  2GUI A;  3O3F A;  3VQE A;  1BQM A;  4FLZ A;  5T7B A;  4LH4 A;  1BIZ A;  1A5V A;  4DFK A;  3OYJ A;  3RR8 A;  1QTM A;  2ATQ A;  1N6Q A;  2XHB A;  4HUE A;  4CEB A;  4KHS A;  4MFB A;  3K2P A;  1RDA A;  3NHG A;  5HRS A;  3AVK A;  4CF9 A;  1S1V A;  1F21 A;  4CF2 A;  3V9Z A;  4CJ3 A;  4Z4F A;  3ZCM A;  2KQ2 A;  4B9U A;  2Z1I A;  1VSK A;  4CJK A;  4ZTJ A;  1L3S A;  2Y1J A;  4QCL A;  3RMC A;  2PZS A;  1IKY A;  3AVA A;  2Y1I A;  4NYN A;  2IGI A;  1C6V A;  3QLH A;  2PY5 A;  1RDD A;  4I7F A;  3U3G A;  1CXQ A;  1Q8I A;  2HHX A;  3KD5 E;  2B6A A;  4F2S A;  1JKH A;  4B9L A;  1RTJ A;  2VG6 A;  4CEC A;  3IS9 A;  3KD1 E;  4BDZ A;  4ID5 A;  4AHS A;  2HNZ A;  3TAN A;  4KHW A;  1VRU A;  1LWF A;  1NJZ A;  3MED A;  4E7J A;  4L8R B;  3T1A A;  3SUP A;  5KRS A;  1J54 A;  1VSF A;  4H4M A;  4CGJ A;  1DLO A;  1RCH A;  4FW1 A;  3OY9 A;  4FVM A;  4I2Q A;  3K5O A;  5I3U A;  3M8R A;  2Z1G A;  1RT2 A;  2YNI A;  2FBT A;  3CQ8 A;  2A1R A;  1KLN A;  3QNN A;  1N5Y A;  4DTR A;  4CEO A;  1TKZ A;  3KLF A;  4DQQ A;  3TI0 A;  3ZSO A;  4DU1 A;  1SL2 A;  1LW2 A;  3TAF A;  3V81 A;  4O5B A;  4LY7 A;  2O4G A;  4ID1 A;  1T05 A;  4HCC A;  3SUN A;  3HP6 A;  3RMB A;  1U04 A;  1U47 A;  3TAR A;  5KRT A;  4BWM A;  3HT3 A;  1NK0 A;  3U3Y A;  1U48 A;  3KK2 A;  1XI1 A;  2HHT A;  2OZS A;  1XC9 A;  4CJR A;  3CG7 A;  4Y1C A;  1IH7 A;  3SJJ A;  4PY5 A;  4BAC A;  4O0I A;  1SKS A;  2ZD1 A;  4DSK A;  3A2F A;  3AVL A;  1TL1 A;  4FM2 A;  1NKB A;  3NF9 A;  1C1B A;  4KV8 A;  4I2P A;  4CJV A;  4FLW A;  2OZM A;  5DK5 A;  1VSJ A;  3I8D A;  4Z4G A;  4DTS A;  3AVJ A;  1WN7 A;  1BL3 A;  2NUB A;  2B4J A;  2YHA A;  3ZSY A;  4DSE A;  4DSI A;  1X9W A;  1Q9Y A;  1UAX A;  3TAQ A;  3OYB A;  1QSY A;  4KTW A;  2KW4 A;  4CEF A;  1VRT A;  3AA5 X;  3MXJ A;  4CHQ A;  3K57 A;  3SQ1 A;  2E6M A;  1REV A;  2BDP A;  4FJH A;  4FYD A;  1JL1 A;  2P1J A;  4BE1 A;  1KVC A;  1RTD A;  4B3O A;  1Z26 A;  3P5J A;  1RBU A;  2OPS A;  1HYV A;  1R0A A;  4KB0 A;  3CFO A;  4JS5 A;  4OGC A;  4IFV A;  3D45 A;  1UOC A;  2YV0 X;  2G8U A;  2Z1J A;  4FLY A;  4FLT A;  4E3S A;  2EX3 A;  4IG3 A;  3HPG A;  3M8Q A;  1EP4 A;  3TWH A;  1ZBI A;  1FKO A;  3OYG A;  1JL2 A;  2LSN A;  3ULD A;  3VQ6 A;  4CF8 A;  5D3G A;  2G8I A;  1MU2 A;  4CFB A;  5SWM A;  1HYZ A;  3ZSW A;  4CK1 A;  1L3U A;  1FKP A;  3AO1 A;  4FCY A;  1YTA A;  4O44 A;  4F4K A;  4CFA A;  2W42 A;  2FBY A;  2HW3 A;  4DFM A;  3O3G A;  4AHR A;  1LW0 A;  4KHQ A;  1C0M A;  1S9G A;  2X74 A;  3P1G A;  4CEQ A;  4IKF A;  1ZBF A;  4CF1 A;  4CJQ A;  3T3F A;  4B9M A;  4HVJ A;  4C8L A;  4FK2 A;  1SUQ A;  3B6O A;  5CYM A;  1D9F A;  3QEV A;  4FJ9 A;  1RBR A;  3E01 A;  4LSN A;  4W5T A;  4DU4 A;  3LPT A;  5KGW A;  1JLQ A;  2B5J A;  3AO3 A;  2RN2 A;  2DTU A;  3L3U A;  4OJR A;  3LDS A;  4HUF A;  3H08 A;  3IAY A;  4PA1 A;  3VQ4 A;  3THV A;  1SKW A;  1QE1 A;  4I9L A;  4FK0 A;  4WE1 A;  5C24 A;  3WNG A;  1IKX A;  2QK9 A;  2QXF A;  2HHV A;  2KFZ A;  5I42 A;  4KI6 A;  4N56 A;  3SZ2 A;  4F8R A;  3SPZ A;  5HRN A;  4KHY A;  3HP9 A;  2DY4 A;  4OGE A;  1NOY A;  4HTU A;  4CIF A;  4DLE A;  4YFU A;  4E7H A;  1ASW A;  5HP1 A;  1KRP A;  2P5O A;  4HCB A;  1JLC A;  3IG1 A;  4YNQ A;  1GOA A;  1CZ9 A;  4OVL A;  4C8N A;  4IFY A;  4AHC A;  3OJU A;  4Q5V A;  4DWI A;  2HHU A;  1JXB A;  1XHX A;  5CY4 A;  3L2Q A;  1JLA A;  3K59 A;  1KFS A;  4PUO A;  1S9E A;  1BI4 B;  3AVI A;  2E6L A;  3DLG A;  4KTZ A;  3AA2 A;  4Z0U A;  4AH9 A;  3OVN A;  4DU3 A;  4KFB A;  4DTX A;  3NAE A;  2XY6 A;  3KTQ A;  4C8O A;  3VQ9 A;  3B6P A;  3QET A;  2IAJ A;  2HVI A;  3CM6 A;  1W9H A;  1LAV A;  5HRR A;  4DF4 A;  1SL1 A;  3OYN A;  5EU7 A;  3ZSQ A;  3AVM A;  3F73 A;  3SCX A;  1KLM A;  1RT3 A;  1WAF A;  1XWL A;  2D5R A;  4E7I A;  1RT6 A;  1T03 A;  3DLK A;  4DSL A;  1C0U A;  3OYC A;  3AV9 A;  4NCB A;  1A5W A;  1J5O A;  4KB1 A;  3ZSX A;  2VWK A;  1ZBL A;  3AA4 A;  4NCG A;  1NK8 A;  4KRF A;  1NK5 A;  3DLH A;  2IC3 A;  4DTM A;  1NK6 A;  2HHW A;  4FJ8 A;  4KI4 A;  4M41 A;  4W5Q A;  1S1X A;  2FBX A;  4HHT A;  4DF8 A;  1VSL A;  1BI4 A;  4M3R A;  4N76 A;  1VSH A;  1EX4 A;  3MEE A;  3NGY A;  4E1M A;  3JYT A;  3HK2 A;  4M3Y A;  3G10 A;  3BDP A;  3KK1 A;  4M3Z A;  1VK0 A;  1RTH A;  4F3O A;  3AVB A;  3ZSR A;  2JGU A;  3DLR A;  3VQ8 A;  4EZ9 A;  1C1C A;  1BQN A;  3VQB A;  4DTP A;  2O4I A;  4CED A;  1BIS A;  4RW9 A;  4M3T A;  4CJT A;  3TAE A;  1NK4 A;  2VG7 A;  5K14 A;  1RBV A;  4JLH A;  4BE0 A;  4Q0B A;  2HHS A;  4XIU A;  3EZ5 A;  3K5M A;  4BDY A;  4GVM A;  1U49 A;  3RMD A;  2PYJ A;  1ZBH A;  1GOB A;  3O4N A;  2YNF A;  3QEI A;  4FZZ A;  1RDC A;  1W0H A;  3HPO A;  1D8Y A;  4E89 A;  3ZT0 A;  3K58 A;  3QIP A;  3VA3 A;  1DTT A;  1CZB A;  3KLI A;  4FLU A;  1QSS A;  1I3A A;  1HYS A;  1HPZ A;  4O0J A;  4QOZ B;  3T19 A;  1QSL A;  2KZM A;  2F96 A;  1KCF A;  2OA8 A;  4FZX C;  3NBP A;  3OS1 A;  3U6F A;  3AA3 A;  1EXQ A;  4CGD A;  4FLX A;  4KRE A;  1LWC A;  2X6S A;  4QAG A;  2DFF A;  3K5L A;  3M8S A;  4CFC A;  4FM0 A;  4ZTF A;  1Z25 A;  4FW2 A;  1O1W A;  4HUG A;  3VN5 A;  4KTQ A;  4RW8 A;  3DM2 A;  3AO5 A;  3KK3 A;  4FJI A;  1NJW A;  1NJX A;  3SUQ A;  1IO2 A;  1U4B A;  4N5S A;  1VSM A;  1C0T A;  4FLV A;  1K6Y A;  2OPQ A;  4ICL A;  4W5N A;  1TVR A;  4CEZ A;  4EP4 A;  4RG8 A;  2VG5 A;  3RRH A;  1SL0 A;  3P83 D;  5C42 A;  1QQC A;  3MXM A;  3C94 A;  5CZ1 A;  3LWM A;  1RIL A;  3QIN A;  4CE9 A;  2ZE2 A;  3LAK A;  4E7K A;  1BGX T;  3AVC A;  4N47 A;  3AVN A;  3OS2 A;  4KHN A;  4DFJ A;  3HXM A;  3DOL A;  3DYA A;  4RW4 A;  1IKW A;  1TKT A;  4JS4 A;  4KPY A;  3AO4 A;  1TK8 A;  1B92 A;  3L8B A;  2IOC A;  3NDK A;  3L2R A;  5FRO A;  3PX4 A;  3SPY A;  4M3W A;  4KO0 A;  4FJL A;  5C25 A;  3C6T A;  4DQI A;  1Y97 A;  3OYF A;  2DFE A;  1Q9X A;  3S3N A;  3KLE A;  1L3V A;  3KLG A;  4FJN A;  1BCO A;  2EHG A;  3ALY A;  3V1R A;  3QEP A;  1TK0 A;  4CJW A;  3C95 A;  3OYD A;  1S6P A; 
#chains in the Genus database with same CATH topology
 4LF7 K;  1HJR A;  1YVU A;  3HOT A;  2RHK A;  1HQU A;  5HRO A;  2OPP A;  3CCJ N;  1YVN A;  3TAM A;  2YNG A;  3ZT1 A;  3C6A A;  4AIL C;  1RNH A;  2E4L A;  1KAY A;  4WQ5 C;  1WAJ A;  5C0Y A;  4KKO A;  5J2Q A;  1TGO A;  2XY7 A;  5JMV A;  3A5M C;  4BRD A;  1WOQ A;  3EYZ A;  3O6W A;  4B8A B;  2X78 A;  3VF6 A;  1NJY A;  3ZSV A;  4CIG A;  4Z4H A;  1VQ7 N;  4K8X A;  4Z94 A;  3H45 C;  4CJU A;  3QES A;  1L5U A;  1ITG A;  4FJ7 A;  1HUX A;  2YHY A;  3W3D A;  2P9S A;  2I7P A;  2OTL N;  1B9D A;  1NK9 A;  2D0C A;  2P5G A;  4WYB A;  3NE6 A;  4IO9 L;  4LD0 A;  2F8T A;  4RW6 A;  3KHY A;  3D2F B;  3TTF A;  1EQY A;  3DJC A;  3I0S A;  1NK7 A;  2O8E A;  2HHQ A;  1VQM N;  3V9U A;  1QHT A;  1YAG A;  4A2B A;  3MCA B;  4KHU A;  3SJH A;  1TYQ A;  3ZT2 A;  2HVH A;  4JKB A;  4DMN A;  4NYF A;  2PBD A;  4BE2 A;  1QZ6 A;  4BRC A;  4DQS A;  3DMJ A;  4CGH A;  3WXJ A;  5M1N A;  2IVP A;  3CJ1 A;  4ELU A;  3QB0 A;  2PYL A;  3JXU A;  4AHT A;  1DTQ A;  5HLF A;  3ZX0 A;  2G8H A;  3NF8 A;  2P9N B;  3SNN A;  3VQQ A;  1FK9 A;  2BE2 A;  4PWD A;  4XH1 A;  2ZJQ L;  1RT4 A;  3PV8 A;  4NLC A;  3LZJ A;  4CK2 A;  1HQE A;  2F8S A;  3O4W A;  4E1N A;  4L3Q A;  5DM7 L;  3IUC A;  5SZT A;  4O4G A;  3ULE A;  3HSC A;  4OPJ A;  4DV0 K;  3ZSZ A;  1JXE A;  1JLF A;  1ZBS A;  3RWU A;  4IG0 A;  1YI2 N;  1J5E K;  2QKB A;  2XRI A;  4BRK A;  2YX6 A;  5C2F A;  4CBW A;  1NGF A;  4J2D A;  5AZI A;  4A59 A;  4GY2 B;  2RKI A;  3QEW A;  3WXI A;  4LH5 A;  3QER A;  4DV4 K;  3VQC A;  3L2V A;  3LZI A;  1WSG A;  1KSP A;  3OYL A;  1BOT O;  3SQ2 A;  4OLA A;  3WNE A;  2BGG A;  3HST B;  4J2E A;  2A42 A;  4PQU A;  4K41 A;  1GLF O;  3C65 A;  3L3V A;  2VQE K;  3JSM A;  2A1S A;  3SK3 A;  1T7P A;  4BQZ A;  3HO1 A;  4EFH A;  2RE2 A;  3WEE B;  1U45 A;  2FF3 B;  2UXB K;  5GAG P;  3L0Q A;  3TAB A;  1S1U A;  4KAZ A;  3DRP A;  1IG8 A;  3O9Q A;  2YKM A;  3HJF A;  4NO7 A;  4AHV A;  4KBO A;  3OYM A;  4H0Y B;  3L2U A;  4BDP A;  1U2V A;  3PO4 A;  4OLB A;  1KTQ A;  4JEP A;  5HL7 L;  5C2D A;  2OPR A;  4WFN L;  3O3F A;  5BRH A;  3GL1 A;  3OYJ A;  3G25 A;  4CEB A;  4BC2 A;  2Q0U A;  3K2P A;  3H1Q A;  3NHG A;  4CF2 A;  2VWB A;  4B9U A;  4ZTJ A;  4GKK K;  5M1P A;  4QCL A;  4FWM A;  3AVA A;  3EKU A;  4KH4 A;  3MX5 A;  3VEZ A;  3QLH A;  3H1V X;  1Q8I A;  3EEQ A;  2D4W A;  4JNE A;  3IS9 A;  4LF4 K;  4BDZ A;  4FWS A;  1VQ9 N;  4BRI A;  3MED A;  1GLA G;  4WQ5 A;  3SUP A;  5KRS A;  4I2Q A;  2FBT A;  3QNN A;  3ZET A;  3IKM A;  1WBD A;  1LW2 A;  3TAF A;  3V81 A;  4O5B A;  1NMN A;  4LY7 A;  4HCC A;  3SUN A;  2BH1 A;  4BGA A;  1R59 O;  3HT3 A;  2OZS A;  1XC9 A;  4PY5 A;  4BAC A;  2IVN A;  1M90 O;  2ZD1 A;  3A2F A;  1TL1 A;  3WXM B;  1C1B A;  3NVK A;  4FLW A;  1VSJ A;  1K73 O;  2FSN A;  1GLD G;  2NNW A;  4Z4G A;  3AVJ A;  3ZSY A;  4DV5 K;  1X9W A;  3CCE N;  5C15 A;  2BDP A;  2IVO A;  1E3M A;  1HYV A;  2W6K A;  2D0O A;  3KWG A;  2WFB A;  5AFU A;  4JS5 A;  2HF4 A;  4OGC A;  4GV3 A;  3CMA N;  4FLT A;  4E3S A;  4JI2 K;  4DR2 K;  5AQT A;  4CZL A;  3M8Q A;  4A57 A;  3TWH A;  5I9E B;  3ULD A;  3K0S A;  2KKZ A;  2G8I A;  1KXP A;  5SWM A;  3O1B A;  4JV5 K;  4JI7 K;  4CFA A;  2HBJ A;  3UKU A;  2YCH A;  3C7N B;  4DR4 K;  1C0M A;  2X74 A;  4IKF A;  3T3F A;  3BF1 A;  5CYM A;  3QEV A;  3T1Y K;  4BRG A;  4FJ9 A;  4H5V A;  4LSN A;  1Q81 O;  3L3U A;  3H08 A;  1QQO A;  5BPM A;  3VQ4 A;  3J7Y P;  3TTC A;  3THW A;  2FSJ A;  3F2K A;  1YIJ N;  4YOY A;  2QK9 A;  2KFZ A;  3ATU A;  5ADX H;  5I42 A;  1KD1 O;  3SAH A;  1J6Z A;  4HTU A;  4DLE A;  4YFU A;  4E7H A;  5HP1 A;  3TPQ A;  4HCB A;  1RFQ A;  3IG1 A;  2QWR A;  5AQV A;  1E4F T;  4FOI A;  4C8N A;  3GE1 A;  1HJO A;  3L2Q A;  1JLA A;  1KFS A;  4PUO A;  3AVI A;  1U49 A;  2E6L A;  5BN9 A;  2XY6 A;  2QTD A;  3VQ9 A;  3B6P A;  2KLA A;  2GUP A;  4DF4 A;  4U7B A;  1SL1 A;  3SCX A;  3F73 A;  3G71 N;  4NCB A;  2VWK A;  1ZBL A;  1U6Z A;  1NK8 A;  3GOI A;  5AZJ B;  4BVO A;  1NK5 A;  3DLH A;  4FJ8 A;  3THX B;  2FBX A;  4HHT A;  4GV6 A;  4XH4 A;  1VSH A;  3MEE A;  2D0P A;  3HK2 A;  3VES A;  1VK0 A;  1NGB A;  4C1N K;  4FWO A;  4EZ9 A;  1NLV A;  3VQB A;  1BIS A;  1QVF M;  4JLH A;  4CW7 B;  4Q0B A;  2HHS A;  4XIU A;  5KQD A;  3E9O A;  3LL3 A;  3BZK A;  5GIO A;  1HNZ K;  3D2E B;  2E20 A;  3D2F A;  3QEI A;  1HNW K;  3K58 A;  2HBK A;  4JI0 K;  3KLI A;  1I3A A;  3I56 N;  4BR9 A;  4QOZ B;  1QSL A;  2QA4 N;  2OA8 A;  3OS1 A;  1K8K B;  2VGM A;  3AA3 A;  4A61 A;  4CGD A;  1LWC A;  4X64 K;  2DFF A;  3K5L A;  4BR2 A;  4NB4 A;  3VN5 A;  4KTQ A;  3LM2 A;  1NJX A;  1U4B A;  4ISG A;  2WBN A;  2OPQ A;  3O80 A;  4RG8 A;  4WFB L;  2VG5 A;  3VEY A;  3LWM A;  3E9L A;  3QIN A;  4CE9 A;  3A8Y A;  1GLL O;  4CZF A;  5AQX A;  2ASO A;  3EKS A;  4RW4 A;  1IKW A;  5AQZ A;  4JS4 A;  1MWM A;  4MLE A;  1B92 A;  3LDL A;  3L8B A;  4X66 K;  2IOC A;  3L2R A;  2VYP A;  4M3W A;  2V7Y A;  4KH5 A;  2P9P A;  2DFE A;  3OYF A;  2HST A;  2P9L B;  1YJ9 N;  1L3V A;  3QEP A;  3LDO A;  4BRE A;  3EE9 A;  1XMO K;  4EAH D;  4CJP A;  1KFD A;  1Q86 O;  4I9Q A;  2JWK A;  1HPM A;  4Z4I A;  4QS7 A;  2DPN A;  3MMV A;  2WON A;  5FPM A;  4LFA K;  5DMR A;  4B1W B;  2WTU A;  4JI5 K;  4U67 L;  4YOX A;  4CER A;  4K8Z A;  4H5W A;  3AAP A;  2GV9 A;  3A5O C;  5KI6 A;  4J2B A;  4Z4E A;  2YHB A;  3LP2 A;  2BTF A;  1HLU A;  4DG1 A;  4B9N A;  1BA1 A;  3ZT3 A;  3CFP A;  4CJF A;  1J9A A;  3QEX A;  1VQN N;  1DGK N;  3MAQ A;  4FWP A;  3H46 O;  1ASU A;  3CHW A;  4JKG A;  1KVA A;  1JLB A;  3WT0 A;  4M3X A;  2G8V A;  1M1K O;  3CCQ N;  2KZZ A;  4ELT A;  2HMI A;  3CPW M;  3M3Z A;  1X9M A;  2G8K A;  1WNS A;  1DKG D;  1VHX A;  5GAH P;  5E26 A;  5KTQ A;  1HKG A;  4FZY A;  3OA9 A;  4YOU A;  3ZEU A;  3ASM A;  3EE8 A;  3P38 A;  4B08 A;  1BIU A;  4EHT A;  4FJM A;  1VSD A;  1RT1 A;  4BRM A;  4M7Y A;  4UQG A;  1VQL N;  4FWQ A;  4M45 A;  1W2B M;  4CGF A;  2ETJ A;  3SYZ A;  5EY4 A;  4CJL A;  4CK3 A;  1YTU A;  4JRQ A;  4LF8 K;  5GIP A;  2E2P A;  3VQ5 A;  4Z4C A;  4CEE A;  3OYH A;  2QWL A;  1X1P A;  1G15 A;  3N4P A;  4JKC A;  3J80 O;  3S9H A;  2ZF5 O;  3N4Q A;  3TU5 A;  3ENH A;  1LWE A;  2F9T A;  1XC3 A;  2Z1H A;  3OYI A;  4FJG A;  4EP5 A;  1NM1 A;  4BRN A;  2P9I A;  5TKW A;  4NLB A;  4ILH A;  4XEI A;  4MDA A;  3S3O A;  4BRA A;  5J2M A;  1WLJ A;  1CLQ A;  4BG9 A;  3UB5 A;  1BA0 A;  4E7L A;  2NRX A;  2HNY A;  3CJ9 A;  1QQM A;  1NGJ A;  4M3U A;  3MWP A;  1VSI A;  1VAZ A;  2GBZ A;  5BPL A;  4KHP K;  4F3T A;  1GLE G;  4BWJ A;  3I0R A;  3VEX A;  3O4Q A;  3OS0 A;  1S1W A;  1D5A A;  5FRN A;  3WNF A;  3RRG A;  1NWK A;  3LAL A;  3VQA A;  3VQ7 A;  4J2A A;  3DLL L;  1T8E A;  4CGI A;  2Q0R A;  4BC4 A;  1QVG M;  3PY8 A;  1L3T A;  4B9T A;  3DLE A;  3O5B A;  4JKD A;  1RTI A;  4E19 A;  1I39 A;  4FJK A;  4FVU A;  1WSI A;  3BY5 A;  2UU9 K;  3G4S N;  3HBT A;  4LFC K;  4GW6 A;  1EET A;  2O8F A;  4H0T B;  3IRX A;  1X3M A;  5B8H A;  3PO5 A;  1KVB A;  2RF2 A;  3HVR A;  4RW7 A;  2CH5 A;  2YJE A;  4JKH A;  4CGG A;  1MWK A;  3RMA A;  2QWP A;  3KIO A;  4AM7 A;  4XH5 A;  5JIC A;  3NGZ A;  4TSX A;  4K42 A;  2ZQB A;  4PL8 A;  4FOE A;  1N33 K;  5HRP A;  5BRD A;  2ITG A;  1BDG A;  3L6Q A;  1BQM A;  4LH4 A;  1BIZ A;  1A5V A;  2ZM6 K;  2ATQ A;  4KHS A;  4M7X A;  5DM6 L;  1S1V A;  3MDQ A;  3V9Z A;  2JWL A;  4Z4F A;  3E9P A;  2KQ2 A;  1L3S A;  2Y1J A;  3RMC A;  2HF3 A;  1EWQ A;  1IKY A;  4NYN A;  2IGI A;  1SAZ A;  3U3G A;  3UKR B;  1RDD A;  2NRZ A;  1CXQ A;  2NRT A;  2YJF A;  2HHX A;  2O8B B;  4F2S A;  4ISE A;  1RTJ A;  4AHS A;  3CCV N;  3TAN A;  4KHW A;  1VRU A;  2ASP A;  2YHX A;  3MX2 A;  3VF2 A;  3THY B;  5LMN K;  4L8R B;  3T1A A;  1VSF A;  5AQH A;  4CGJ A;  4FW1 A;  1RDW X;  5FLX O;  3K5O A;  5I3U A;  2A1R A;  1KLN A;  2CH6 A;  1N5Y A;  5AQR A;  3I33 A;  4DQQ A;  3TI0 A;  4Y0W A;  3KLF A;  3WXK A;  3ZSO A;  4K0K K;  1W97 L;  2O4G A;  1T05 A;  3HP6 A;  1Q18 A;  2P9U B;  3R1X A;  2HHT A;  3KK2 A;  1XI1 A;  3DXM B;  4H0V B;  4CJR A;  4M63 C;  3BEX A;  4O0I A;  3ZYY X;  1TUU A;  3J81 O;  2NLX A;  1NKB A;  3VTI A;  3EN9 A;  4LF5 K;  3T1H K;  3I8D A;  4BR0 A;  3EL2 A;  3AGK A;  4BY9 C;  1BO5 O;  1UAX A;  3TAQ A;  4YDU C;  3VET A;  3MXJ A;  4CHQ A;  3LDN A;  1REV A;  4FYD A;  4X65 K;  1I94 K;  1Z26 A;  1YXQ A;  4KB0 A;  2QM1 A;  4J8F A;  1Z6R A;  3CFO A;  4IFV A;  2YV0 X;  4BR4 A;  2EX3 A;  2O8D A;  5KPT A;  1EP4 A;  1K8K A;  4DUZ K;  4EIA A;  5D3G A;  4NXM K;  1QQN A;  3NVM A;  2Q97 A;  1HYZ A;  1L3U A;  2UXC K;  3IMX A;  4FCY A;  4CZI A;  1ZC6 A;  4F4K A;  2W42 A;  3ENO A;  3O08 A;  4MLH A;  3HTV A;  2NRH A;  2OCE A;  3RSE A;  4CF1 A;  1H1V A;  2VCP A;  4GVE A;  4JD2 B;  1SUQ A;  4DR6 K;  3QFU A;  1RBR A;  3E01 A;  4YOV A;  3IFR A;  1N36 K;  2DTU A;  3LDS A;  4HUF A;  3THV A;  4JI4 K;  1QE1 A;  3FGU A;  3M1F A;  4I6M A;  2I7N A;  1S3X A;  5LMU K;  2AP1 A;  2PAV A;  4N56 A;  1IBL K;  1QZ5 A;  3ZX2 A;  3SZ2 A;  5ADX A;  3SPZ A;  5HRN A;  4KHY A;  1FJG K;  4OGE A;  2W40 A;  1ASW A;  3M6G A;  3FR0 A;  1JLC A;  1EO1 A;  1GOA A;  1CZ9 A;  2WUS A;  2QXL A;  4JHD B;  4OVL A;  4RWT A;  4AHC A;  1X3N A;  1K9M O;  1JXB A;  4GNI A;  3O9S A;  1S9E A;  4Z0U A;  4KTZ A;  3VPZ A;  4KFB A;  3ATV A;  3NAE A;  2P9K A;  2NRV A;  2HVI A;  2IAJ A;  2WC9 A;  1OH8 A;  4IXC A;  3ZSQ A;  4YHH K;  3AVM A;  1RT3 A;  1T03 A;  2D5R A;  3K9K A;  4DSL A;  1C0U A;  3AV9 A;  1SQK A;  1J5O A;  4KB1 A;  4KRF A;  5AJ3 K;  5GIN A;  1VSL A;  1BI4 A;  4M3R A;  4G9Z A;  3NGY A;  3G10 A;  3BDP A;  4M3Z A;  4DR7 K;  2O8C B;  3VQ8 A;  1YUW A;  1C1C A;  3CJ7 A;  3TAE A;  2VG7 A;  1NGI A;  3O1W A;  3EZ5 A;  3K5M A;  3CC2 N;  4GVM A;  4CZJ A;  4A5B A;  3O4N A;  4BR5 A;  1W0H A;  5BR8 K;  3HPO A;  5AQG A;  3FZM A;  1DTT A;  3VA3 A;  2CGJ A;  1HPZ A;  1HX1 A;  4O0J A;  1KCF A;  4K43 A;  4QAG A;  2ZWH A;  3DXK A;  4FW2 A;  4HUG A;  4RW8 A;  4BR7 A;  1IO2 A;  1WB9 A;  1VSM A;  4W5N A;  1TVR A;  3BUZ B;  3RRH A;  4H0P A;  4WQ4 C;  3GBT A;  5EX5 A;  2ZE2 A;  2FSK A;  3LAK A;  3VEN A;  1XQS C;  4KHN A;  4DFJ A;  3HXM A;  3DOL A;  1TK8 A;  3VGK A;  5FRO A;  4KO0 A;  4FJL A;  4DQI A;  3C6T A;  1Y97 A;  2A3Z A;  3S3N A;  4MDB A;  3KLG A;  4FJN A;  1BCO A;  2EHG A;  4GV9 A;  3C95 A;  4NCA A;  4CJS A;  4W5R A;  3OYK A;  3AVG A;  4IDK A;  2OAN A;  1QS4 A;  4DR1 K;  1ATS A;  2QWQ A;  3EO3 A;  4B1V A;  4B9S A;  2DFH A;  1B9F A;  3DI6 A;  1YJN N;  1A5X A;  3LAN A;  3SLC A;  3PX6 A;  3SAF A;  4OX9 K;  3V1O A;  4FPB A;  1CXU A;  4W5O A;  2AJQ A;  2V52 B;  4A2A A;  3V9X A;  4FJJ A;  2E88 A;  3NH0 A;  3WQU A;  2P9S B;  1HNV A;  4YDU A;  4DSF A;  5J1E A;  3AO2 A;  3M8P A;  2RPI A;  4M42 A;  1KAZ A;  4B3S K;  4DR3 K;  1UA0 A;  3VEV A;  4IFE A;  4FPA A;  3MXI A;  4DQP A;  2ZGY A;  3F5T A;  1TYQ B;  4BRL A;  1RT7 A;  3K5N A;  3RTV A;  4BGB A;  2HBM A;  4MQ3 A;  1TL3 A;  2ITM A;  4MO4 A;  3CM5 A;  4DTN A;  2XO7 A;  4MO5 A;  4QS8 A;  2NRW A;  3DOK A;  1LCU A;  1HNI A;  4OPH A;  5AQL A;  3KVG A;  4N41 A;  1XNR K;  3Q7B A;  3DLB A;  4CBX A;  3V9S A;  4H5R A;  4CHZ A;  3CC4 N;  3PIP L;  4C23 A;  2R7Y A;  1RBS A;  3A5L C;  3S3M A;  5H1S Q;  1Q7Y O;  4DTU A;  1KQS M;  3OYA A;  4PL7 A;  2JLE A;  3ITH A;  1LV5 A;  5TKY A;  1TV6 A;  1IG9 A;  1HNX K;  4K25 A;  1GLC G;  4CJE A;  3V9W A;  1ASV A;  3GG4 A;  5M1O A;  5E41 A;  1P90 A;  5FPN A;  2A41 A;  4O8K A;  3AVF A;  3HVT A;  3THY A;  1WSE A;  4DLG A;  3NCI A;  2A40 A;  1NJI O;  4CZK A;  1EKE A;  3CXC M;  1HMV A;  3DRR A;  4OPA A;  1TUY A;  1RDU A;  1RBT A;  4X62 K;  4DTO A;  4GKJ K;  3SV3 A;  3SQ0 A;  4FXD A;  5JS2 A;  4C1N I;  3VQP A;  3E1Y A;  3V4I A;  5CYQ A;  2KTQ A;  1MDU B;  2E2O A;  4YOW A;  4JK7 A;  3FZK A;  3PSF A;  4DS5 A;  2P9N A;  2UXD K;  3E66 A;  3VF4 A;  1D9D A;  4AF1 A;  1FXX A;  5J2N A;  1WBB A;  3F9M A;  3VA0 A;  3HOS A;  4DQR A;  1OVQ A;  3H3O B;  4R5P A;  2Q3S A;  4GMJ B;  3OBW A;  2G8F A;  3FLC O;  3O3H A;  2ZJR L;  1S6Q A;  5BR9 A;  1JCE A;  2XY8 A;  1JLE A;  3HL8 A;  1BCM A;  5KPZ A;  3PUF A;  3PLA A;  2D0A A;  1RGI A;  3ISN C;  3AY9 A;  3F9K A;  3LP0 A;  2HND A;  4PKH A;  1TK5 A;  5KPR A;  2Q36 A;  3HI0 A;  4IO8 A;  1N8R O;  3NFA A;  1KAX A;  4OPK A;  2FBV A;  5AQU A;  3TR8 A;  1C1A A;  4IOA L;  2GTD A;  4JRP A;  5KGX A;  4CEA A;  1NGA A;  3V6D A;  1S1T A;  4IZ9 A;  2FC0 A;  3OYE A;  4FWN A;  3VGL A;  1BUP A;  3TSQ A;  3O8M A;  4CJ5 A;  4DTJ A;  4WQ4 A;  4JD2 A;  5AQK A;  4FM1 A;  3WEE A;  3HPH A;  3NH2 A;  1P8Z A;  4B9Q A;  2QW9 A;  3VQE A;  4FLZ A;  5T7B A;  1QTM A;  1N6Q A;  4DV1 K;  4HUE A;  4MFB A;  5AQN A;  5HRS A;  1NGH A;  3AVK A;  1VQ5 N;  5BN8 A;  2PZS A;  2Y1I A;  3MCP A;  3R6M A;  3ZET B;  3SAG A;  1C6V A;  3J7A P;  5AQS A;  4LFB K;  2QI2 A;  3KD5 E;  3W0L A;  1JKH A;  4HTL A;  4B9L A;  4ID5 A;  3CCM N;  1LWF A;  3MWT A;  1NJZ A;  5AQF A;  1J54 A;  4H4M A;  1O13 A;  5M1K A;  1DLO A;  4FVM A;  3CQ8 A;  3SMP A;  5HOO A;  2OTJ N;  4CBU A;  1T6D A;  4CEO A;  1BWF O;  5LJW A;  1Z05 A;  1SL2 A;  2UUC K;  1GLJ O;  5KRT A;  4BWM A;  3U3Y A;  1U48 A;  4DV7 K;  3MN9 A;  3T69 A;  4Y1C A;  1IH7 A;  3SBT A;  3SJJ A;  1SKS A;  2E2N A;  3AVL A;  4FM2 A;  2VGN A;  3VOV A;  1VQ8 N;  1BL3 A;  2B4J A;  4DSI A;  1QSY A;  3WXL A;  1S72 N;  1Y64 A;  3P4I A;  3K57 A;  3SQ1 A;  5AQO A;  5AR0 A;  5F0X A;  4FJH A;  1JL1 A;  2P1J A;  3UKU B;  1XMQ K;  4BE1 A;  1KVC A;  1RTD A;  1R0A A;  1RBU A;  2OPS A;  1CZA N;  4DUY K;  3D6R A;  3D45 A;  4BC3 A;  1GLB G;  2Z1J A;  4IG3 A;  1IBK K;  3O9T A;  1ZBI A;  1FKO A;  1JL2 A;  1MU2 A;  4CFB A;  4DV2 K;  1FKP A;  3THW B;  2FBY A;  2HW3 A;  2FF6 A;  3O3G A;  1C0F A;  3CI5 A;  4AHR A;  1LW0 A;  4CEQ A;  2E1Y A;  2CGL A;  4CJQ A;  3CJB A;  4AQY K;  4B9M A;  1D9F A;  3GDQ A;  4CI6 A;  3AAQ A;  3FZL A;  3A5N C;  4W5T A;  4CJ7 A;  1DT9 A;  2RN2 A;  3PIO L;  3IAY A;  4PA1 A;  4BRH A;  4I9L A;  3AGR A;  2E2Q A;  4WE1 A;  5C24 A;  3WNG A;  2VQF K;  1NMD A;  2HHV A;  3C7N A;  1SZ2 A;  4CD1 A;  3ZLJ A;  1S22 A;  3TSP A;  4F8R A;  3HP9 A;  2DY4 A;  3CJA A;  2P5O A;  4YNQ A;  3FZF A;  4JYA K;  4IFY A;  3OJU A;  3CF5 L;  2HHU A;  1XHX A;  3K59 A;  4FWR A;  3DLG A;  4AH9 A;  4DSK A;  1BU6 O;  4DU3 A;  3KTQ A;  4C8O A;  4KH6 A;  3QET A;  2NZT A;  4YY3 K;  1LAV A;  5HRR A;  1DEJ A;  1D4X A;  1NGC A;  3KWI A;  1XWL A;  4E7I A;  3DLK A;  4JK8 A;  3OYC A;  3WQT A;  1A5W A;  4H5N A;  2IC3 A;  4DTM A;  1NK6 A;  2HHW A;  1QHA A;  4M41 A;  3U9Z A;  4W5Q A;  1S1X A;  4DF8 A;  1FW6 A;  4IWV A;  4H0X B;  4N76 A;  4O5F A;  4IJA A;  1EX4 A;  5AQQ A;  4E1M A;  2E1Z A;  3O9U A;  4M3Y A;  4FWK A;  3KK1 A;  2Q31 A;  1RTH A;  3ZSR A;  3QBW A;  2JGU A;  2ZJP L;  1BQN A;  3LM9 A;  4M3T A;  4CJT A;  5JLF A;  4LF9 K;  1NK4 A;  5K14 A;  3I55 N;  1RBV A;  4BE0 A;  5AZJ A;  4BDY A;  3THX A;  3RMD A;  2PYJ A;  1GOB A;  5FPE A;  2YNF A;  4FZZ A;  3CPE A;  3ZT0 A;  3QIP A;  4FLU A;  1T44 A;  3QBX A;  3Q7C A;  4A62 A;  3CD6 N;  2F96 A;  2KZM A;  3NBP A;  3U6F A;  3MN6 A;  4JI8 K;  1E4G T;  3M8S A;  1JCF A;  4ZTF A;  1Z25 A;  2GEL A;  3DM2 A;  3AO5 A;  3KK3 A;  4FJI A;  3SUQ A;  3D2E A;  4N5S A;  5C12 A;  4ICL A;  2P9P B;  3A0I X;  4EP4 A;  1OH6 A;  1QQC A;  3C94 A;  5CZ1 A;  3ZX3 A;  3CQY A;  1BGX T;  4N47 A;  1NGD A;  3AVN A;  3DWL A;  4FSV A;  3T7Z A;  1TKT A;  1OH7 A;  4KPY A;  1NGE A;  3AO4 A;  4CZH A;  3NDK A;  3U8X A;  2A6A A;  3PX4 A;  3SPY A;  4FO0 A;  1NBW A;  3CQX A;  1Q9X A;  3KLE A;  3ALY A;  3V1R A;  4B3T K;  4CZG A;  4CJW A;  2BUP A;  3OYD A;  4PKI A;  4YOT A;  3QNO A;  1UWB A;  2ZGZ A;  3EZW A;  3WUH A;  4EZ6 A;  4DV3 K;  1XHZ A;  1NU0 A;  1ATN A;  5AQW A;  1NKE A;  4JN4 A;  4HWI A;  1LAW A;  2QEX N;  3CIP A;  2P9L A;  3L4I A;  1UA1 A;  3I8B A;  4BG8 A;  4JKG B;  3OJS A;  1J53 A;  5GAE P;  1ZYQ A;  1RT5 A;  3OHR A;  2W6L A;  4DSJ A;  3VQD A;  1ESV A;  3JAM O;  3H3N O;  4IEE A;  1SKR A;  3SV4 A;  3LWL A;  1YT3 A;  2YKN A;  3LAM A;  1SV5 A;  3ID6 A;  2BAN A;  3KJV A;  2IS3 A;  3KLH A;  5CZ2 A;  2G8W A;  4DB3 A;  3ZEU B;  3TAG A;  5AQI A;  1VQO N;  4B9V A;  1IKV A;  2YI1 A;  3QIO A;  5M1F A;  4E0D A;  4ILG B;  2QWN A;  3C0B A;  5AQJ A;  1NG9 A;  2I5J A;  3SQ4 A;  4LC9 B;  4IOX A;  1TAU A;  1WSH A;  2YNH A;  2D0B A;  4NXN K;  3L2W A;  2P51 A;  3CYM A;  1VSE A;  3CFR A;  4IDH A;  2CGK A;  3DRS A;  1SS6 A;  3NF6 A;  5EXW A;  4C8M A;  3CCS N;  2A5X A;  4IEI A;  4CHP A;  4DQ8 A;  4G1Q A;  4IBN A;  5BPN A;  4OKK A;  3QIC A;  3KKS A;  2QKK A;  4OO1 J;  4DS4 A;  4C8K A;  2HBL A;  3M5R A;  2HB5 A;  1VQ4 N;  1GOC A;  3FZH A;  4ISF A;  2P9I B;  3QO9 A;  5ELZ A;  2HHH K;  4B1Z A;  2E5L K;  4ILJ A;  4CCH A;  4B1U B;  3R3L A;  3LP1 A;  4H8K A;  3R9P A;  2XY5 A;  3U9D A;  2X6N A;  3UE5 A;  3EY1 A;  4ELV A;  1IJJ A;  3KK7 A;  1T6C A;  1OKJ A;  3SI6 A;  1VQK N;  3MEC A;  3V1Q A;  4OKJ A;  3C6H A;  1TKD A;  5FPD A;  2VWJ A;  4BRF A;  3CC7 N;  2YHW A;  2V7Z A;  3QDK A;  5JLH A;  5FRM A;  1TKX A;  2GX9 A;  5AQM A;  4CJ4 A;  1X9S A;  1XNQ K;  3VEW A;  4UY8 O;  1LOT B;  4CHO A;  1G99 A;  3R8E A;  4FJX A;  4H4O A;  3NH1 A;  1HR0 K;  4CIE A;  5HBM A;  3BGR A;  3FFI A;  3PX0 A;  1K8A O;  2O8F B;  4LF6 K;  1NKC A;  3OW2 M;  5KQ8 A;  3G0Z A;  5J2P A;  1RDB A;  3KKR A;  4CFD A;  4JKA A;  3HM9 A;  4EHU A;  1NGG A;  4QS9 A;  2Q1N A;  3NF7 A;  4FJ5 A;  1ATR A;  3O9R A;  4WCE L;  4DFP A;  2QWM A;  5JS1 A;  1V4S A;  4CHY A;  3RR7 A;  3UIQ A;  2F9W A;  4FK4 A;  3VGM A;  4IOC L;  2GWJ A;  1W7A A;  1S5J A;  3H6E A;  3MEG A;  3LDP A;  1TAQ A;  1NOZ A;  1HRH A;  3C6U A;  4F2R A;  4B3M K;  4LSL A;  4O55 A;  2OYQ A;  3D7E O;  4CES A;  4CF0 A;  1HKC A;  5F1X A;  3D0P A;  1HKB A;  3HYF A;  1ZBU A;  3WNH A;  4B3R K;  3VEO A;  4ZHR A;  5MLC Q;  3TAP A;  3LPU A;  2WOM A;  5FDL A;  3L4Q A;  3FFK B;  4Y1D A;  3S41 A;  2H3G X;  3AVH A;  3K9J A;  3TSU A;  4OKE A;  4H03 B;  4CHN A;  2O8E B;  4BQL A;  1JLG A;  1WSF A;  3LP3 A;  3BF3 A;  4AHU A;  2IDO A;  3ZT4 A;  4BC5 A;  3SUO A;  2HMP A;  1WSJ A;  1BHL A;  4CD3 A;  2KFN A;  3CCL N;  3NGI A;  4B8C A;  2GUI A;  3CCR N;  3MK6 A;  4DCH A;  4DFK A;  3RR8 A;  2XHB A;  3HRG A;  1RDA A;  4CF9 A;  2Q2R A;  1F21 A;  4CJ3 A;  4JI6 K;  1YF5 L;  3ZCM A;  2Z1I A;  1VSK A;  5GAD P;  4CJK A;  3JS6 A;  4CZM A;  3SMS A;  2QWO A;  2PY5 A;  4I7F A;  2B6A A;  4H5T A;  2VG6 A;  4CEC A;  3KD1 E;  4BRQ A;  2HNZ A;  3DAW A;  1JJ2 M;  4E7J A;  1YIT N;  3PSI A;  3HM8 A;  1RCH A;  3OY9 A;  1WUA A;  2AA4 A;  2ASM A;  3QFP A;  3M8R A;  2Z1G A;  1RT2 A;  2YNI A;  1IBM K;  4DR5 K;  4DTR A;  1TKZ A;  1YHQ N;  4DU1 A;  2O8B A;  3UKR A;  3ULE B;  2UUA K;  3TTD A;  3U4L A;  4ID1 A;  4IJN A;  3VER A;  3RMB A;  1U04 A;  4JI1 K;  3TAR A;  1U47 A;  1EWR A;  1NK0 A;  1C0G A;  3CG7 A;  1ZXO A;  3CJC A;  5A2Q O;  1XUP O;  4E1J A;  5AZI B;  3NF9 A;  4KV8 A;  4CJV A;  4I2P A;  2OZM A;  5DK5 A;  3KZB A;  2O8D B;  4DTS A;  1WN7 A;  2NUB A;  2YHA A;  4DSE A;  1Q9Y A;  3RVC A;  4BVP A;  5IWA K;  3OYB A;  4KTW A;  2KW4 A;  4CEF A;  5LJV A;  1VRT A;  2P9U A;  3AA5 X;  5E84 A;  2E6M A;  2FXU A;  3DXM A;  2F4V K;  5AFU H;  4B3O A;  3P5J A;  1Q82 O;  2FLO A;  4JI3 K;  3RSE B;  2NRR A;  1UOC A;  2G8U A;  1YJW N;  2IIR A;  4FLY A;  2KHO A;  3HPG A;  1T3V A;  3OYG A;  2LSN A;  3VQ6 A;  4CF8 A;  3G6E N;  2EWS A;  3B8A X;  2F7T A;  3ZSW A;  4CK1 A;  3AO1 A;  1YTA A;  4O44 A;  4I6M B;  4DFM A;  1VQ6 N;  4KHQ A;  4AM6 A;  1S9G A;  4B1X B;  3P1G A;  1U2V B;  1ZBF A;  4JKE A;  4DV6 K;  3J7Z O;  4C8L A;  4HVJ A;  4FK2 A;  3B6O A;  4V19 S;  3OBY A;  4DU4 A;  3LPT A;  5KGW A;  1JLQ A;  2B5J A;  3FE1 A;  3AO3 A;  1X9J A;  3P39 A;  4OJR A;  2UUB K;  4R79 A;  4JK9 A;  1SKW A;  4RTF D;  4H0O A;  4FK0 A;  5EOY A;  1IKX A;  2QXF A;  3IDH A;  5BRF A;  4KI6 A;  5CE3 A;  2E8A A;  2P9K B;  5JVH L;  1NOY A;  4RCH A;  4CIF A;  1IV0 A;  3VTH A;  5M1Q A;  1KRP A;  3BZC A;  5LY3 A;  3OTO K;  1OVY A;  5AQP A;  1ILY A;  3SBG A;  4Q5V A;  4DWI A;  5CY4 A;  3J8A A;  4FL9 A;  4PHT X;  1BI4 B;  3AA2 A;  4BRO A;  3CCU N;  3OVN A;  4DTX A;  4CVN E;  4PKG A;  4BRP A;  5CHI A;  3CM6 A;  1W9H A;  1OH5 A;  1BG3 A;  3OYN A;  5EU7 A;  1KLM A;  1MA9 B;  1WAF A;  3MN5 A;  1RT6 A;  4JHD A;  4JKF A;  3ZSX A;  3AA4 A;  4NCG A;  3ID8 A;  5LL6 Z;  4KI4 A;  1JCG A;  4WF9 L;  3MN7 A;  3JYT A;  4F3O A;  3AVB A;  5IT9 O;  3DLR A;  2O4I A;  4B1Y B;  3CER A;  5CR4 A;  4DTP A;  4CED A;  5C10 A;  1N32 K;  4RW9 A;  3BP8 A;  5F2R A;  1VQP N;  3P31 A;  5BRE A;  3DXK B;  4A5A A;  3ENB A;  1ZBH A;  2GWK A;  1RDC A;  1D8Y A;  4E89 A;  4O8U A;  4JAX A;  1CZB A;  2D1K A;  1QSS A;  3CME N;  1HYS A;  4F9O A;  2O8C A;  3T19 A;  4FZX C;  4WFA L;  1EXQ A;  3VMF B;  4FLX A;  4KRE A;  4DHY A;  2X6S A;  2UYT A;  2HOE A;  4CFC A;  4FM0 A;  1O1W A;  3LDQ A;  4DKW A;  1N34 K;  4FWL A;  4CZE A;  5EVZ A;  1NJW A;  2W41 A;  4FLV A;  1C0T A;  1K6Y A;  1NNE A;  4CEZ A;  2J4R A;  3NMU A;  3HZ6 A;  5AQY A;  1SL0 A;  3P83 D;  5C42 A;  3MXM A;  2GEM A;  2PFU A;  1RIL A;  4YOR A;  4E7K A;  1V4T A;  3AVC A;  3OS2 A;  3QML A;  3AAR A;  3DYA A;  2V51 B;  1KC8 O;  3CET A;  5C25 A;  5JVG L;  1TK0 A;  1S6P A; 
#chains in the Genus database with same CATH homology
 4NCA A;  4CJS A;  4W5R A;  3OYK A;  1HJR A;  1YVU A;  3AVG A;  4IDK A;  1QS4 A;  3QNO A;  1UWB A;  4CJP A;  1KFD A;  4I9Q A;  1HQU A;  4Z4I A;  5HRO A;  2OPP A;  4EZ6 A;  1XHZ A;  3TAM A;  4B9S A;  2YNG A;  3ZT1 A;  2DFH A;  1B9F A;  4AIL C;  1NKE A;  3DI6 A;  1RNH A;  1A5X A;  2WON A;  2E4L A;  3LAN A;  1LAW A;  3PX6 A;  1WAJ A;  4KKO A;  3V1O A;  5J2Q A;  1TGO A;  2XY7 A;  5DMR A;  1UA1 A;  3OJS A;  1CXU A;  4CER A;  4W5O A;  4K8Z A;  1J53 A;  2AJQ A;  2GV9 A;  3V9X A;  1ZYQ A;  3EYZ A;  4FJJ A;  1RT5 A;  3NH0 A;  4DSJ A;  1HNV A;  3VQD A;  4B8A B;  2X78 A;  5KI6 A;  4J2B A;  1NJY A;  1SKR A;  3SV4 A;  3LWL A;  4DSF A;  4Z4E A;  2YHB A;  3LP2 A;  3ZSV A;  5J1E A;  4CIG A;  4Z4H A;  1YT3 A;  2YKN A;  3AO2 A;  3LAM A;  2RPI A;  1SV5 A;  3M8P A;  4DG1 A;  4B9N A;  3ZT3 A;  4K8X A;  2BAN A;  3CFP A;  4M42 A;  3KJV A;  4CJF A;  2IS3 A;  1J9A A;  3QEX A;  3KLH A;  5CZ2 A;  2G8W A;  4CJU A;  3MAQ A;  3QES A;  1ASU A;  3TAG A;  1UA0 A;  4B9V A;  1IKV A;  3QIO A;  1KVA A;  1L5U A;  1JLB A;  4E0D A;  4M3X A;  2G8V A;  1ITG A;  4FJ7 A;  2I5J A;  3MXI A;  4DQP A;  3SQ4 A;  2KZZ A;  4ELT A;  2HMI A;  1TAU A;  1WSH A;  1B9D A;  1NK9 A;  2YNH A;  1RT7 A;  2D0C A;  2P5G A;  2D0B A;  3L2W A;  2P51 A;  3K5N A;  1X9M A;  3RTV A;  2G8K A;  3CYM A;  1WNS A;  1VSE A;  3NE6 A;  4MQ3 A;  3CFR A;  1TL3 A;  3DRS A;  3NF6 A;  4C8M A;  4LD0 A;  3CM5 A;  2F8T A;  5KTQ A;  4RW6 A;  4CHP A;  4DTN A;  4G1Q A;  4FZY A;  3I0S A;  2XO7 A;  1NK7 A;  3ASM A;  2HHQ A;  4IBN A;  3V9U A;  1QHT A;  4OKK A;  4B08 A;  1BIU A;  3DOK A;  3KKS A;  2QKK A;  4FJM A;  1HNI A;  1VSD A;  4N41 A;  4KHU A;  1RT1 A;  3DLB A;  4UQG A;  3V9S A;  4DS4 A;  4C8K A;  4CHZ A;  3ZT2 A;  4M45 A;  4CGF A;  2HVH A;  2R7Y A;  2HB5 A;  4DMN A;  1GOC A;  1RBS A;  2ETJ A;  4NYF A;  3SYZ A;  4BE2 A;  4CJL A;  3S3M A;  4DTU A;  4CK3 A;  3QO9 A;  1YTU A;  3OYA A;  4JRQ A;  4DQS A;  4CCH A;  3DMJ A;  4CGH A;  2JLE A;  3ITH A;  1LV5 A;  4Z4C A;  3VQ5 A;  4CEE A;  3LP1 A;  4H8K A;  1TV6 A;  3OYH A;  2XY5 A;  1X1P A;  1G15 A;  1IG9 A;  2X6N A;  3S9H A;  4ELU A;  3EY1 A;  2PYL A;  4ELV A;  4AHT A;  1DTQ A;  4CJE A;  3V9W A;  1ASV A;  1LWE A;  3SI6 A;  2Z1H A;  3OYI A;  5HLF A;  3MEC A;  4FJG A;  3V1Q A;  5E41 A;  4EP5 A;  2G8H A;  3NF8 A;  4OKJ A;  3AVF A;  3HVT A;  1WSE A;  3SNN A;  1TKD A;  4DLG A;  3VQQ A;  3NCI A;  1FK9 A;  2BE2 A;  4PWD A;  3S3O A;  1EKE A;  1RT4 A;  5J2M A;  1WLJ A;  3PV8 A;  3LZJ A;  1HMV A;  3DRR A;  4DTO A;  4CK2 A;  1CLQ A;  1RBT A;  2VWJ A;  1HQE A;  3SV3 A;  3SQ0 A;  2F8S A;  4FXD A;  4E1N A;  5JS2 A;  5FRM A;  3VQP A;  4E7L A;  3V4I A;  1TKX A;  2HNY A;  5CYQ A;  4CJ4 A;  5SZT A;  2KTQ A;  1X9S A;  4O4G A;  4CHO A;  4OPJ A;  4M3U A;  3ZSZ A;  1VSI A;  4FJX A;  1JXE A;  1JLF A;  4H4O A;  3RWU A;  3NH1 A;  4IG0 A;  4CIE A;  5HBM A;  4DS5 A;  2GBZ A;  1D9D A;  3BGR A;  2QKB A;  1FXX A;  2XRI A;  3FFI A;  5J2N A;  4F3T A;  3PX0 A;  3VA0 A;  4DQR A;  4BWJ A;  3I0R A;  3O4Q A;  3OS0 A;  1S1W A;  1D5A A;  2Q3S A;  4R5P A;  5FRN A;  1NKC A;  4J2D A;  3G0Z A;  5J2P A;  3WNF A;  4GMJ B;  1RDB A;  3RRG A;  2RKI A;  3QEW A;  3KKR A;  3LAL A;  3VQA A;  2G8F A;  3VQ7 A;  4CFD A;  4J2A A;  4LH5 A;  3O3H A;  3QER A;  1S6Q A;  3VQC A;  3L2V A;  3HM9 A;  3LZI A;  1WSG A;  1KSP A;  3OYL A;  1T8E A;  3NF7 A;  4CGI A;  3SQ2 A;  4FJ5 A;  4OLA A;  2XY8 A;  1JLE A;  3WNE A;  3HL8 A;  3PY8 A;  1BCM A;  2BGG A;  1L3T A;  4DFP A;  3HST B;  4B9T A;  3DLE A;  4E19 A;  4J2E A;  1RTI A;  3PUF A;  1I39 A;  4FJK A;  4PQU A;  5JS1 A;  3UIQ A;  4CHY A;  1WSI A;  3RR7 A;  3L3V A;  3JSM A;  4FK4 A;  2A1S A;  2D0A A;  4GW6 A;  1EET A;  1S5J A;  1T7P A;  3IRX A;  3ISN C;  3HO1 A;  3F9K A;  3MEG A;  3LP0 A;  3PO5 A;  1KVB A;  2RF2 A;  3HVR A;  2HND A;  1TAQ A;  1NOZ A;  1U45 A;  1HRH A;  3C6U A;  4RW7 A;  1TK5 A;  4F2R A;  4LSL A;  3NFA A;  4CGG A;  4O55 A;  2FBV A;  4OPK A;  3RMA A;  3TR8 A;  1C1A A;  4CES A;  4CF0 A;  2OYQ A;  3KIO A;  3D0P A;  4JRP A;  5KGX A;  3HYF A;  1ZBU A;  3WNH A;  4CEA A;  3TAB A;  1S1U A;  4ZHR A;  3TAP A;  3LPU A;  4KAZ A;  2WOM A;  3NGZ A;  5FDL A;  3V6D A;  4Y1D A;  3DRP A;  1S1T A;  3AVH A;  4TSX A;  2FC0 A;  2YKM A;  4OKE A;  3OYE A;  3HJF A;  4AHV A;  4CHN A;  3OYM A;  3L2U A;  4BDP A;  4CJ5 A;  4DTJ A;  2ZQB A;  1JLG A;  3PO4 A;  1WSF A;  4OLB A;  3LP3 A;  4FM1 A;  1KTQ A;  4AHU A;  2IDO A;  3HPH A;  3ZT4 A;  3NH2 A;  3SUO A;  1WSJ A;  1BHL A;  2OPR A;  5HRP A;  2KFN A;  3NGI A;  2ITG A;  4B8C A;  2GUI A;  3O3F A;  3VQE A;  1BQM A;  4FLZ A;  5T7B A;  4LH4 A;  1BIZ A;  1A5V A;  4DFK A;  3OYJ A;  3RR8 A;  1QTM A;  2ATQ A;  1N6Q A;  2XHB A;  4HUE A;  4CEB A;  4KHS A;  4MFB A;  3K2P A;  1RDA A;  3NHG A;  5HRS A;  3AVK A;  4CF9 A;  1S1V A;  1F21 A;  4CF2 A;  3V9Z A;  4CJ3 A;  4Z4F A;  3ZCM A;  2KQ2 A;  4B9U A;  2Z1I A;  1VSK A;  4CJK A;  4ZTJ A;  1L3S A;  2Y1J A;  4QCL A;  3RMC A;  2PZS A;  1IKY A;  3AVA A;  2Y1I A;  4NYN A;  2IGI A;  1C6V A;  3QLH A;  2PY5 A;  1RDD A;  4I7F A;  3U3G A;  1CXQ A;  1Q8I A;  2HHX A;  3KD5 E;  2B6A A;  4F2S A;  1JKH A;  4B9L A;  1RTJ A;  2VG6 A;  4CEC A;  3IS9 A;  3KD1 E;  4BDZ A;  4ID5 A;  4AHS A;  2HNZ A;  3TAN A;  4KHW A;  1VRU A;  1LWF A;  1NJZ A;  3MED A;  4E7J A;  4L8R B;  3T1A A;  3SUP A;  5KRS A;  1J54 A;  1VSF A;  4H4M A;  4CGJ A;  1DLO A;  1RCH A;  4FW1 A;  3OY9 A;  4FVM A;  4I2Q A;  3K5O A;  5I3U A;  3M8R A;  2Z1G A;  1RT2 A;  2YNI A;  2FBT A;  3CQ8 A;  2A1R A;  1KLN A;  3QNN A;  1N5Y A;  4DTR A;  4CEO A;  1TKZ A;  3KLF A;  4DQQ A;  3TI0 A;  3ZSO A;  4DU1 A;  1SL2 A;  1LW2 A;  3TAF A;  3V81 A;  4O5B A;  4LY7 A;  2O4G A;  4ID1 A;  1T05 A;  4HCC A;  3SUN A;  3HP6 A;  3RMB A;  1U04 A;  1U47 A;  3TAR A;  5KRT A;  4BWM A;  3HT3 A;  1NK0 A;  3U3Y A;  1U48 A;  3KK2 A;  1XI1 A;  2HHT A;  2OZS A;  1XC9 A;  4CJR A;  3CG7 A;  4Y1C A;  1IH7 A;  3SJJ A;  4PY5 A;  4BAC A;  4O0I A;  1SKS A;  2ZD1 A;  4DSK A;  3A2F A;  3AVL A;  1TL1 A;  4FM2 A;  1NKB A;  3NF9 A;  1C1B A;  4KV8 A;  4I2P A;  4CJV A;  4FLW A;  2OZM A;  5DK5 A;  1VSJ A;  3I8D A;  4Z4G A;  4DTS A;  3AVJ A;  1WN7 A;  1BL3 A;  2NUB A;  2B4J A;  2YHA A;  3ZSY A;  4DSE A;  4DSI A;  1X9W A;  1Q9Y A;  1UAX A;  3TAQ A;  3OYB A;  1QSY A;  4KTW A;  2KW4 A;  4CEF A;  1VRT A;  3AA5 X;  3MXJ A;  4CHQ A;  3K57 A;  3SQ1 A;  2E6M A;  1REV A;  2BDP A;  4FJH A;  4FYD A;  1JL1 A;  2P1J A;  4BE1 A;  1KVC A;  1RTD A;  4B3O A;  1Z26 A;  3P5J A;  1RBU A;  2OPS A;  1HYV A;  1R0A A;  4KB0 A;  3CFO A;  4JS5 A;  4OGC A;  4IFV A;  3D45 A;  1UOC A;  2YV0 X;  2G8U A;  2Z1J A;  4FLY A;  4FLT A;  4E3S A;  2EX3 A;  4IG3 A;  3HPG A;  3M8Q A;  1EP4 A;  3TWH A;  1ZBI A;  1FKO A;  3OYG A;  1JL2 A;  2LSN A;  3ULD A;  3VQ6 A;  4CF8 A;  5D3G A;  2G8I A;  1MU2 A;  4CFB A;  5SWM A;  1HYZ A;  3ZSW A;  4CK1 A;  1L3U A;  1FKP A;  3AO1 A;  4FCY A;  1YTA A;  4O44 A;  4F4K A;  4CFA A;  2W42 A;  2FBY A;  2HW3 A;  4DFM A;  3O3G A;  4AHR A;  1LW0 A;  4KHQ A;  1C0M A;  1S9G A;  2X74 A;  3P1G A;  4CEQ A;  4IKF A;  1ZBF A;  4CF1 A;  4CJQ A;  3T3F A;  4B9M A;  4HVJ A;  4C8L A;  4FK2 A;  1SUQ A;  3B6O A;  5CYM A;  1D9F A;  3QEV A;  4FJ9 A;  1RBR A;  3E01 A;  4LSN A;  4W5T A;  4DU4 A;  3LPT A;  5KGW A;  1JLQ A;  2B5J A;  3AO3 A;  2RN2 A;  2DTU A;  3L3U A;  4OJR A;  3LDS A;  4HUF A;  3H08 A;  3IAY A;  4PA1 A;  3VQ4 A;  3THV A;  1SKW A;  1QE1 A;  4I9L A;  4FK0 A;  4WE1 A;  5C24 A;  3WNG A;  1IKX A;  2QK9 A;  2QXF A;  2HHV A;  2KFZ A;  5I42 A;  4KI6 A;  4N56 A;  3SZ2 A;  4F8R A;  3SPZ A;  5HRN A;  4KHY A;  3HP9 A;  2DY4 A;  4OGE A;  1NOY A;  4HTU A;  4CIF A;  4DLE A;  4YFU A;  4E7H A;  1ASW A;  5HP1 A;  1KRP A;  2P5O A;  4HCB A;  1JLC A;  3IG1 A;  4YNQ A;  1GOA A;  1CZ9 A;  4OVL A;  4C8N A;  4IFY A;  4AHC A;  3OJU A;  4Q5V A;  4DWI A;  2HHU A;  1JXB A;  1XHX A;  5CY4 A;  3L2Q A;  1JLA A;  3K59 A;  1KFS A;  4PUO A;  1S9E A;  1BI4 B;  3AVI A;  2E6L A;  3DLG A;  4KTZ A;  3AA2 A;  4Z0U A;  4AH9 A;  3OVN A;  4DU3 A;  4KFB A;  4DTX A;  3NAE A;  2XY6 A;  3KTQ A;  4C8O A;  3VQ9 A;  3B6P A;  3QET A;  2IAJ A;  2HVI A;  3CM6 A;  1W9H A;  1LAV A;  5HRR A;  4DF4 A;  1SL1 A;  3OYN A;  5EU7 A;  3ZSQ A;  3AVM A;  3F73 A;  3SCX A;  1KLM A;  1RT3 A;  1WAF A;  1XWL A;  2D5R A;  4E7I A;  1RT6 A;  1T03 A;  3DLK A;  4DSL A;  1C0U A;  3OYC A;  3AV9 A;  4NCB A;  1A5W A;  1J5O A;  4KB1 A;  3ZSX A;  2VWK A;  1ZBL A;  3AA4 A;  4NCG A;  1NK8 A;  4KRF A;  1NK5 A;  3DLH A;  2IC3 A;  4DTM A;  1NK6 A;  2HHW A;  4FJ8 A;  4KI4 A;  4M41 A;  4W5Q A;  1S1X A;  2FBX A;  4HHT A;  4DF8 A;  1VSL A;  1BI4 A;  4M3R A;  4N76 A;  1VSH A;  1EX4 A;  3MEE A;  3NGY A;  4E1M A;  3JYT A;  3HK2 A;  4M3Y A;  3G10 A;  3BDP A;  3KK1 A;  4M3Z A;  1VK0 A;  1RTH A;  4F3O A;  3AVB A;  3ZSR A;  2JGU A;  3DLR A;  3VQ8 A;  4EZ9 A;  1C1C A;  1BQN A;  3VQB A;  4DTP A;  2O4I A;  4CED A;  1BIS A;  4RW9 A;  4M3T A;  4CJT A;  3TAE A;  1NK4 A;  2VG7 A;  5K14 A;  1RBV A;  4JLH A;  4BE0 A;  4Q0B A;  2HHS A;  4XIU A;  3EZ5 A;  3K5M A;  4BDY A;  4GVM A;  1U49 A;  3RMD A;  2PYJ A;  1ZBH A;  1GOB A;  3O4N A;  2YNF A;  3QEI A;  4FZZ A;  1RDC A;  1W0H A;  3HPO A;  1D8Y A;  4E89 A;  3ZT0 A;  3K58 A;  3QIP A;  3VA3 A;  1DTT A;  1CZB A;  3KLI A;  4FLU A;  1QSS A;  1I3A A;  1HYS A;  1HPZ A;  4O0J A;  4QOZ B;  3T19 A;  1QSL A;  2KZM A;  2F96 A;  1KCF A;  2OA8 A;  4FZX C;  3NBP A;  3OS1 A;  3U6F A;  3AA3 A;  1EXQ A;  4CGD A;  4FLX A;  4KRE A;  1LWC A;  2X6S A;  4QAG A;  2DFF A;  3K5L A;  3M8S A;  4CFC A;  4FM0 A;  4ZTF A;  1Z25 A;  4FW2 A;  1O1W A;  4HUG A;  3VN5 A;  4KTQ A;  4RW8 A;  3DM2 A;  3AO5 A;  3KK3 A;  4FJI A;  1NJW A;  1NJX A;  3SUQ A;  1IO2 A;  1U4B A;  4N5S A;  1VSM A;  1C0T A;  4FLV A;  1K6Y A;  2OPQ A;  4ICL A;  4W5N A;  1TVR A;  4CEZ A;  4EP4 A;  4RG8 A;  2VG5 A;  3RRH A;  1SL0 A;  3P83 D;  5C42 A;  1QQC A;  3MXM A;  3C94 A;  5CZ1 A;  3LWM A;  1RIL A;  3QIN A;  4CE9 A;  2ZE2 A;  3LAK A;  4E7K A;  1BGX T;  3AVC A;  4N47 A;  3AVN A;  3OS2 A;  4KHN A;  4DFJ A;  3HXM A;  3DOL A;  3DYA A;  4RW4 A;  1IKW A;  1TKT A;  4JS4 A;  4KPY A;  3AO4 A;  1TK8 A;  1B92 A;  3L8B A;  2IOC A;  3NDK A;  3L2R A;  5FRO A;  3PX4 A;  3SPY A;  4M3W A;  4KO0 A;  4FJL A;  5C25 A;  3C6T A;  4DQI A;  1Y97 A;  3OYF A;  2DFE A;  1Q9X A;  3S3N A;  3KLE A;  1L3V A;  3KLG A;  4FJN A;  1BCO A;  2EHG A;  3ALY A;  3V1R A;  3QEP A;  1TK0 A;  4CJW A;  3C95 A;  3OYD A;  1S6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...