4CGHA

Interrogating hiv integrase for compounds that bind- a sampl challenge
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interrogating HIV Integrase for Compounds that Bind- a Sampl Challenge.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords INTEGRASE
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4cghA00
1BCOA 5CYMA 2YNIA 3OYIA 4FZXC 2P51A 3LALA 4CIEA 2HW3A 3AA4A 4HCBA 4CESA 3VQ6A 1YTUA 1EXQA 1BHLA 2KFZA 3TARA 3P83D 1RTIA 4DWIA 3VQ4A 5HROA 4K8XA 2RF2A 4OPJA 3JSMA 3THVA 1D9DA 1DTQA 4J2BA 3VA3A 1IKYA 4M3UA 3FFIA 3HSTB 1X9SA 4IBNA 4DTRA 1TL1A 3KKRA 4GW6A 3KLGA 4FCYA 3OYCA 1TV6A 1TK0A 4CJFA 3G10A 1S9EA 3JYTA 3QEVA 5I3UA 1C0MA 3PUFA 4O44A 2VG5A 4LSLA 3HVRA 3QETA 2HMIA 4FJHA 3HT3A 4CE9A 4ID5A 4AHCA 3KK1A 4YNQA 4B9LA 1S1VA 4E1NA 1JLGA 1JLEA 4E7KA 1U45A 1RNHA 3MXMA 4J2EA 4JS5A 1A5XA 3C95A 3HM9A 1S1WA 2FBYA 3MEEA 3RMAA 4CGGA 1U47A 4FXDA 1JXEA 1RDBA 3RTVA 3AA3A 3SI6A 1WSIA 3NF8A 1QSSA 4B3OA 1RBTA 4QAGA 5HRNA 1F21A 3M8SA 1B9DA 4CJTA 4N41A 3M8PA 1RT5A 3MEDA 4K8ZA 2KZZA 1TKDA 2YHAA 4B9TA 1QQCA 2DFFA 4CEOA 1C1BA 4EP4A 4LD0A 1NOZA 1BI4A 1GOCA 2X6NA 1KTQA 3ZT4A 2KQ2A 2NUBA 3ZCMA 2W42A 1Q9YA 4KTWA 5K14A 1U49A 2OYQA 4HCCA 3ZSYA 2XY8A 4OLBA 3LP0A 1CLQA 1NK6A 4CEZA 2YNFA 1EETA 4FYDA 3KIOA 3NGYA 4CF0A 4F2RA 4KI4A 3VQAA 1YVUA 3QO9A 4C8MA 3NH0A 1UA1A 4CJ3A 4ELTA 3TR8A 2DFHA 3AO2A 2KTQA 3ZSWA 2G8HA 3VQ5A 4DQPA 4FK4A 1WSEA 3AA2A 3ITHA 4M42A 4CJSA 4CHPA 1EX4A 2EHGA 3RWUA 1L3SA 5FRMA 1W9HA 3OY9A 4CECA 3KK3A 4Z4HA 4B9UA 3BGRA 2OPQA 4CEAA 4FJNA 5E41A 3V9ZA 1A5VA 4ELUA 5FDLA 5HRRA 3ZSXA 4DTOA 4OLAA 3LAMA 4CK2A 4CIFA 3L2WA 4CGFA 3C6TA 2VWKA 2Y1IA 1X1PA 2DFEA 3NBPA 4E19A 3PO5A 2JLEA 3MXJA 5KRTA 2G8IA 4KO0A 3QNNA 3LZJA 3AVAA 3NCIA 1XWLA 1S6QA 5CZ2A 3VQ7A 1HYZA 4CEDA 3NH2A 5FROA 3V9UA 1JLQA 1RT2A 2ZE2A 3AO5A 3V1RA 1RT6A 1VSFA 1EP4A 3OYFA 1D5AA 3HP6A 4CF2A 4DSLA 1Y97A 2BGGA 2O4IA 3AVJA 4ZHRA 4DSFA 1JL2A 3IG1A 4O55A 4WE1A 1IKVA 3SQ4A 2RPIA 4ELVA 1JL1A 4I7FA 3CQ8A 3LP2A 3SPYA 1BI4B 4E0DA 1B9FA 1C6VA 1LV5A 2YNGA 1HPZA 4DF4A 2Z1IA 4FM1A 5J2MA 1IKWA 3UIQA 3TANA 1I3AA 3M8RA 2O4GA 1R0AA 3RRHA 3RMDA 1TKTA 4M3TA 3U6FA 2KFNA 3LPUA 2FBXA 4JRPA 4RW7A 3SCXA 1S6PA 1G15A 2QXFA 4BWMA 4CEQA 4FK2A 2XO7A 1UWBA 3HO1A 2G8KA 3DLKA 1IH7A 4CGJA 4Z4CA 3OYMA 1N5YA 4CJQA 1HYSA 4CK1A 4IFYA 4CF8A 1RTDA 4E7LA 4FJKA 4KI6A 3DLEA 2P5GA 5CY4A 3SQ0A 4JRQA 1WSGA 4M45A 4KHYA 4IDKA 3QESA 3HYFA 4W5OA 2XY6A 3ISNC 2E4LA 4B9MA 1WSFA 2FBTA 3CFRA 3A2FA 2HHVA 3MEGA 4N47A 2G8WA 2D0CA 1FKOA 3NFAA 4CFAA 4R5PA 2OZMA 3SPZA 2QKBA 3S3NA 1T8EA 4E89A 3OVNA 3SNNA 3LANA 1QSYA 1HMVA 2D0BA 2RN2A 1NOYA 3PX4A 2A1SA 3DI6A 4KFBA 1KFDA 4DU1A 4HVJA 1BCMA 4PA1A 4DTNA 2OPRA 3L3VA 3HPHA 1ZBLA 2XRIA 4PWDA 4KKOA 4FLUA 4LH4A 4H8KA 1TVRA 3EY1A 4E1MA 3SUOA 4DSKA 4C8LA 2R7YA 4DQQA 1MU2A 1RTJA 2KW4A 2HNZA 3OYGA 5J2PA 1VSKA 1TAUA 1T03A 3LP1A 1CZ9A 2E6LA 1UOCA 3HVTA 3IS9A 1ASVA 1BISA 3V9WA 1C0TA 1RBSA 3LWLA 3LPTA 1GOBA 4RW9A 3DLHA 3I0RA 4FJXA 4ICLA 1DLOA 3C6UA 4CGIA 3S3OA 3K2PA 4QCLA 4FJ5A 4IG3A 3AO3A 3KLIA 1SKRA 1WAFA 3MECA 3OJUA 2XY5A 3ULDA 4CJUA 3U3YA 1Q9XA 1W0HA 2B4JA 1T7PA 3O3HA 4KAZA 4BWJA 2OPPA 1NK4A 1I39A 4DTUA 4BACA 1ZBIA 4FJLA 4MQ3A 4DU4A 2YNHA 3ZSVA 3KTQA 1T05A 4KHQA 3TI0A 4M3WA 1IKXA 4LH5A 2BANA 3U3GA 5KTQA 2PYJA 1RT3A 1QHTA 4CJ5A 1NK0A 4M41A 5KGWA 2GV9A 3ZSZA 5HRPA 4N56A 1SKWA 3NF7A 3NH1A 2YKNA 1VSDA 3TAFA 1BIUA 1CZBA 4JLHA 3F9KA 2IAJA 4O0JA 2HVHA 1UA0A 1JKHA 3LAKA 1LWFA 1BL3A 3ZSRA 1NK9A 4F8RA 1VRTA 5HRSA 3P5JA 4CHZA 1NK5A 1NJZA 3OS0A 1FXXA 3PY8A 4HHTA 4CK3A 3MAQA 3VQEA 3ZT1A 2P5OA 4QOZB 4FLTA 2D5RA 3ZT0A 1VRUA 3OS1A 2I5JA 4UQGA 1Z25A 3VA0A 4AILC 3PX0A 4J2AA 5C42A 2HHWA 1RTHA 3K5OA 3O4NA 5EU7A 4ZTFA 1XI1A 4CEEA 4MFBA 4DG1A 4FZZA 3TABA 1QSLA 1ASUA 3OYAA 3I0SA 4FLWA 2YKMA 5HBMA 4O4GA 3ZT2A 3QINA 2IC3A 4CHYA 3NGZA 3O3GA 3PX6A 1TK5A 5J1EA 1WAJA 5T7BA 3SZ2A 1RDDA 3DLRA 3WNHA 4DFPA 4TSXA 3DOKA 3SUQA 1YTAA 4KB1A 3NGIA 4I9QA 1GOAA 4CFBA 1LW2A 4CHOA 4FW1A 4O0IA 1O1WA 5CZ1A 4AHSA 4M3XA 3QLHA 3TWHA 4M3ZA 1TK8A 1HQUA 4E7HA 2IDOA 2RKIA 4OGEA 5KGXA 4RW4A 2D0AA 4C8KA 5D3GA 5C25A 1SUQA 4F3OA 4BDZA 1X9MA 2Z1HA 3M8QA 3QEWA 3OYNA 3ALYA 2X78A 4CF1A 4FJ9A 2HVIA 3CM5A 1C1CA 1RT7A 3ASMA 3DLGA 1UAXA 2ITGA 3WNGA 4W5RA 3BDPA 4KPYA 4FW2A 4N76A 1SL0A 3KD5E 4HUEA 2ATQA 4FLXA 4DMNA 3AVFA 5J2QA 4E3SA 3SUNA 3OYKA 5JS1A 4AHUA 5CYQA 2Q3SA 4CCHA 4DSIA 2HNDA 3WNEA 4DTXA 2PYLA 4CEBA 4YFUA 1CXQA 4ID1A 3SUPA 2E6MA 4KHSA 4LSNA 4M3RA 1S9GA 4RG8A 3RRGA 3OS2A 3KLEA 4I2PA 4W5QA 3ZSOA 1TAQA 1JLAA 4DS5A 2EX3A 3CM6A 1KVAA 1KLNA 4FM0A 4FK0A 1X9WA 4CJVA 3L2VA 4H4MA 4FVMA 3T19A 1KSPA 3KJVA 3K58A 2HHQA 1C0UA 1S1UA 3QERA 1RBUA 3S9HA 4L8RB 1LAVA 1RILA 4F3TA 2PY5A 3K57A 2Y1JA 1S1TA 4I9LA 2HNYA 5HP1A 3TAPA 3CG7A 1SKSA 3DOLA 4B9SA 2XHBA 3L8BA 5KRSA 3OYDA 3RR8A 3AA5X 3OYLA 3KK2A 2HB5A 4DQIA 4KHWA 4CJ4A 3KKSA 1NJYA 3V1OA 1ZBHA 4HUGA 1KLMA 4KRFA 3AVIA 3F73A 3NHGA 1LWEA 2Z1JA 4CHQA 3AVBA 1XC9A 2XY7A 4LY7A 4GMJB 3D0PA 4BDPA 3AVMA 3LZIA 4AHVA 1L5UA 2HHTA 3QNOA 1RBRA 1QS4A 4FLZA 1KVBA 3NAEA 3V9XA 4E7JA 3PV8A 3P1GA 4BE1A 1CXUA 3T3FA 3V4IA 3K5NA 3S3MA 1DTTA 1KRPA 1KVCA 1ZBUA 3AO1A 3LDSA 3DMJA 1WLJA 3NF9A 1L3UA 1RDAA 4BE2A 2P1JA 3OYJA 4BE0A 3DYAA 1Q8IA 4M3YA 3DLBA 4CJRA 3SQ1A 2QKKA 4DLEA 3K5LA 2DTUA 4FJMA 1KCFA 2VWJA 3CFPA 3HP9A 3TAGA 5I42A 3AVCA 4RW6A 3TAQA 1N6QA 2QK9A 1HNVA 4F2SA 2IGIA 1JXBA 3B6OA 1IG9A 4CEFA 4B9VA 1TKXA 3AVGA 1U48A 2G8VA 2A1RA 4NCGA 3H08A 4CGDA 4GVMA 3RMBA 3AVHA 4DU3A 5DK5A 3RR7A 4CERA 4DFMA 1TKZA 3O3FA 3QEIA 1HJRA 2OZSA 3AV9A 1BIZA 4AHTA 2YV0X 4DTSA 4IKFA 3IRXA 4B08A 1VSHA 3VQBA 3VQCA 3I8DA 4KHNA 2KZMA 4B8CA 4OPKA 2GBZA 1NJWA 4I2QA 1NKCA 1TGOA 1IO2A 4B8AB 4CFDA 3VQQA 3AO4A 4FZYA 3ZT3A 3DRSA 3OYHA 3QIPA 2B5JA 2GUIA 3HPOA 4C8OA 3L2QA 3ZSQA 1FK9A 3AVKA 4W5NA 4FJ8A 1ASWA 3RMCA 1ZYQA 1HNIA 3L3UA 4E7IA 3B6PA 3PO4A 3VQPA 1D9FA 1NJXA 4OJRA 1ITGA 1NKBA 2VG6A 2WOMA 5SZTA 4DQRA 1J5OA 4OKEA 3CYMA 1HRHA 5KI6A 1WN7A 4XIUA 1SL2A 1LW0A 1VSEA 3G0ZA 1A5WA 1L3VA 4DSJA 1TL3A 1XHXA 5JS2A 1RDCA 4CF9A 4CIGA 1BQNA 3OYEA 2G8FA 3KD1E 3AVNA 4Z4GA 4KHUA 3NF6A 4DS4A 5J2NA 1WSHA 3QEXA 4CJPA 4KREA 3SQ2A 5C24A 1C1AA 3E01A 2X74A 4IG0A 3EZ5A 3HPGA 4DQSA 5SWMA 4DFKA 4CHNA 2HHUA 4Q5VA 3V1QA 4AH9A 2BDPA 3IAYA 4Z4IA 2B6AA 4N5SA 3CFOA 3C94A 2ZQBA 4DTMA 4JS4A 3QEPA 1ZBFA 1B92A 1VSJA 4OKJA 2WONA 4RW8A 3SJJA 1HQEA 1U4BA 4FJIA 1VSMA 3DRRA 1JLBA 4FJGA 3EYZA 3DM2A 5FRNA 3D45A 4OKKA 4Y1DA 3K59A 4CJKA 1XHZA 4PUOA 4Y1CA 2VG7A 4DFJA 4KB0A 4CJWA 4KV8A 4NCAA 3HL8A 1REVA 4KTZA 4KTQA 4OVLA 3O4QA 4CJLA 1J9AA 4B9NA 1QE1A 2YHBA 4NYNA 4EP5A 2IS3A 1RT1A 1U04A 4DTJA 1VK0A 4BDYA 4EZ9A 3SYZA 1K6YA 3WNFA 4CJEA 4DLGA 4DSEA 3OJSA 2BE2A 3V81A 2FC0A 1VSIA 3VQDA 1NKEA 3T1AA 2HHXA 3VQ8A 3L2RA 2Z1GA 4PY5A 4HUFA 2G8UA 4HTUA 1Z26A 3LP3A 3SV3A 3VN5A 4DF8A 4F4KA 4H4OA 4W5TA 1S1XA 3NE6A 1S5JA 4Q0BA 2PZSA 1WSJA 1QTMA 1RCHA 2OA8A 3HXMA 4OGCA 4EZ6A 3K5MA 3NDKA 4O5BA 1VSLA 3V9SA 1RBVA 2LSNA 1J54A 2X6SA 3DRPA 3LWMA 4FJJA 1JLCA 1FKPA 3AVLA 1D8YA 1BGXT 2HHSA 5HLFA 3QIOA 3HJFA 3HK2A 2ETJA 1KFSA 4NYFA 5DMRA 1SV5A 2F8SA 1LAWA 2DY4A 3SV4A 1SL1A 2ZD1A 3KLHA 1HYVA 4Z0UA 2JGUA 1WNSA 1LWCA 4AHRA 1BQMA 3KLFA 3VQ9A 4J2DA 3L2UA 4FLYA 1NK8A 3TAMA 3V6DA 4PQUA 4FLVA 2FBVA 2IOCA 4Z4EA 1J53A 1NK7A 1YT3A 4G1QA 2F96A 4CGHA 2AJQA 4IFVA 1JLFA 4CFCA 4FM2A 3TAEA 2F8TA 4FJ7A 4DTPA 2OPSA 4NCBA 1EKEA 4C8NA 3OYBA 1RT4A 4ZTJA 1L3TA 3MXIA 4Z4FA
chains in the Genus database with same CATH superfamily
1BCOA 5CYMA 1Z05A 3LALA 2E5LK 2HW3A 3HTVA 4CESA 3VQ4A 3JSMA 3THVA 4J2BA 1EWQA 1X9SA 4GW6A 3KKRA 2WTUA 1VQNN 4C1NK 3OYCA 3P4IA 4B3TK 3F5TA 2A5XA 4BRAA 3HT3A 4ID5A 4DR1K 1JLEA 1U45A 2A6AA 3MXMA 4ISFA 4CW7B 4F9OA 4B1UB 5F1XA 3CJAA 3E9PA 3VEVA 1U47A 5KPZA 4CJ7A 2QA4N 1O13A 1QSSA 3CCMN 1B9DA 1BU6O 2UYTA 4IEIA 3EKUA 5AQVA 1TKDA 3W3DA 5EX5A 3VF4A 3M1FA 1KC8O 2ZJQL 1C1BA 3QICA 3ZT4A 2X6NA 4YORA 1U49A 4RWTA 2F9TA 4HCCA 3ZSYA 5EXWA 3LP0A 4CEZA 2YNFA 3NGYA 4F2RA 3E66A 3CC2N 3QO9A 4BR2A 3AO2A 3ZSWA 4ILGB 4FK4A 3ITHA 4CJSA 5M1FA 2OPQA 3MN6A 4CEAA 1A5VA 5FDLA 5AQYA 5HRRA 4DTOA 4OLAA 4CIFA 5AQOA 3NBPA 2QM1A 3MXJA 4K25A 4DV4K 1M1KO 1XWLA 2FF6A 3NH2A 5FROA 5AFUA 1DEJA 2O4IA 4DSLA 1Y97A 1NGEA 4FWKA 4ELVA 2NLXA 2D1KA 1C6VA 1LV5A 1YIJN 1HPZA 4DF4A 5AQNA 4FM1A 3QMLA 3TANA 1I3AA 3M8RA 4BRDA 3RMDA 1TKTA 2P9UA 4CVNE 1FJGK 4RW7A 4BWMA 4CEQA 2XO7A 3U4LA 2NRVA 3H45C 4Z4CA 4IFYA 4MLEA 1RTDA 3OTOK 3HZ6A 3EEQA 1VQ4N 4JRQA 5GIPA 2VCPA 2GWJA 3HYFA 3QESA 2P9LA 3ISNC 2UUBK 3CERA 2G8WA 3QBWA 1DGKN 4R5PA 2HBMA 2RE2A 4CFAA 2QKBA 3CCRN 4E89A 3OVNA 4YOTA 3LANA 2O8BB 1HMVA 2E88A 1KFDA 4KFBA 3VGLA 4DU1A 1BCMA 4DTNA 3AGKA 4IZ9A 3L4IA 4PWDA 4M63C 4H8KA 3EY1A 4WQ5C 2HF4A 3QFPA 3QFUA 1VQPN 3DWLA 1CZ9A 2E6LA 1UOCA 3SK3A 3J81O 1HKCA 1C0TA 1RBSA 1S22A 3LPTA 4RW9A 4H5RA 3S3OA 3WEEB 1Q7YO 3AO3A 3GE1A 4FWQA 5LJVA 1WAFA 1TUYA 1Q9XA 1W0HA 2B4JA 3Q7CA 1T7PA 1JJ2M 4BC3A 4KAZA 4DTUA 4MQ3A 1GLJO 3ZSVA 4YY3K 1T05A 4OX9K 4KHQA 5KTQA 2PYJA 1NK0A 5HRPA 4N56A 1SKWA 4KH4A 3NF7A 2O8CA 4RTFD 1BIUA 3BUZB 1CZBA 3N4PA 3F9KA 4IFEA 2IAJA 4O0JA 1UA0A 3LAKA 4F8RA 3P5JA 4CHZA 3O9UA 5B8HA 1N33K 3VQEA 4UQGA 2YCHA 3G25A 3A5NC 5EU7A 1XI1A 4DHYA 2NRRA 1GLDG 1JCGA 1ASUA 2YKMA 3QINA 1TK5A 1WAJA 2A40A 1RDDA 4DFPA 1OH7A 3NVMA 3I8BA 4I9QA 2A41A 3R8EA 3CCSN 3IKMA 4JHDA 4CFBA 2FSJA 3DXMA 4AHSA 4M3ZA 3QLHA 1HQUA 2IDOA 2RKIA 2QTDA 5C25A 1N8RO 1SUQA 3M8QA 3ZEUA 2X78A 4FJ9A 2HVIA 1V4SA 1C1CA 3BDPA 3ASMA 1UAXA 4B1YB 4XH4A 4N76A 4C1NI 2KLAA 4FLXA 4DMNA 1VQ5N 5CYQA 4BRHA 2Q3SA 3IDHA 4CCHA 2PYLA 4CEBA 1HNXK 1CXQA 3O9TA 3RRGA 4I2PA 3FGUA 4X62K 4DS5A 3CCJN 1RFQA 1WB9A 3T19A 2O8EB 3PLAA 2V52B 4L8RB 2ITMA 1LAVA 2PY5A 2P9NA 3TAPA 3DOLA 4WCEL 2XHBA 3L8BA 4XH5A 3RR8A 3OYLA 3KK2A 4DQIA 1NJYA 2WBNA 3V1OA 3P31A 2ASMA 4CHQA 4CZMA 4E1JA 4GMJB 4BDPA 2HHTA 4FLZA 4JKAA 2FSNA 2ZGYA 1KRPA 3WXKA 1DTTA 3OW2M 3NF9A 1MWMA 5F2RA 5ELZA 4BE0A 1WBDA 1Q86O 3O1WA 4DLEA 4FJMA 3CFPA 3HP9A 5I42A 4RW6A 3K9JA 3TAQA 2IGIA 3P39A 2P9KA 3CC4N 3AVGA 3AGRA 4H5WA 3W0LA 3QEIA 5DM7L 4IKFA 1BIZA 3IRXA 1VSHA 3VQCA 4KHNA 4DB3A 1NJWA 4UY8O 4I2QA 4QS9A 4CFDA 3J8AA 3K0SA 4FZYA 5FPNA 2GUIA 3EE9A 3L2QA 3ZSQA 1MDUB 4FJ8A 1ASWA 2E2PA 3GG4A 4E7IA 3B6PA 3CCQN 3VQPA 1D9FA 1NKBA 4DQRA 2O8DA 4DKWA 3CYMA 1HRHA 4OPAA 2ZJPL 1VSEA 4B1WB 1A5WA 2QWMA 5IT9O 1TL3A 1XHXA 4CIGA 3KD1E 3AVNA 4Z4GA 3NF6A 5J2NA 1WSHA 3QEXA 4CJPA 1NBWA 4X66K 3F2KA 3BEXA 3E9OA 3HPGA 2H3GX 3UKRA 4CHNA 1E4GT 4LF5K 2B6AA 3CFOA 1MWKA 2ZQBA 3QEPA 3HI0A 5FPEA 4G9ZA 1U4BA 3M6GA 4DQ8A 5LMNK 3PSIA 4CJWA 4OPHA 4CJLA 1J9AA 4LFAK 3CXCM 4YHHK 1IG8A 1U04A 3VTIA 1VK0A 3WT0A 4CJEA 4X64K 3TSQA 5AQQA 3EN9A 2VQEK 1VSIA 3H3OB 1YF5L 3VQDA 2Q1NA 5FPDA 1ZC6A 3A5MC 4DF8A 3L6QA 4W5TA 1S5JA 4Z94A 1WSJA 3HXMA 4OGCA 4EZ6A 4O5BA 5GADP 3DRPA 3GOIA 4DR3K 4DV5K 5HL7L 3H6EA 5LY3A 1QQMA 1LAWA 4IEEA 5LJWA 2FSKA 4CZIA 1SL1A 3GL1A 2JGUA 3FR0A 3VQ9A 4FLYA 3L4QA 2IOCA 1J53A 4BRMA 3ID8A 4A2BA 1YT3A 4IFVA 1JLFA 1RDUA 1EKEA 3M5RA 1IBKK 1VQ7N 3F9MA 2NRZA 3SMSA 4K0KK 4CI6A 2P51A 3THYB 1YTUA 1EXQA 2KFZA 3P83D 4DUZK 1NGIA 4BR7A 2HBLA 5AQWA 3FFIA 4WF9L 2CGLA 4IO9L 1S9EA 1Z6RA 3H46O 3U9ZA 2QWNA 1C0MA 3PUFA 3THXA 3CJBA 2P9PB 4LSLA 3HVRA 3QETA 4FJHA 1J6ZA 3HOSA 4YNQA 1S1VA 4E1NA 5GINA 4DR4K 1RNHA 1ATNA 4J2EA 2FXUA 1VQON 3QBXA 5LL6Z 4FXDA 1JXEA 4IJAA 3CI5A 4CZFA 5BR8K 2E1YA 1WSIA 3NF8A 2O8BA 2QI2A 3J80O 4QAGA 3BZKA 3M8SA 4N41A 3G4SN 4JKGB 3O4WA 1RT5A 2YHAA 4B9TA 2DFFA 4CEOA 5BN8A 4EFHA 1BI4A 1GOCA 3N4QA 2W42A 1Q9YA 4KTWA 5K14A 4A57A 1VQMN 2VWBA 1CLQA 2XY8A 1OH5A 3E9LA 3ZETA 4B1XB 3KIOA 3NH0A 5C0YA 1D4XA 3TR8A 2NRXA 4JI7K 1WSEA 4CD3A 4M42A 4CHPA 1EX4A 1L3SA 5FRMA 3DLLL 3OY9A 1N34K 5M1OA 1KXPA 3FZKA 4FJNA 5E41A 4AQYK 3V9ZA 4ELUA 4I6MA 2Q97A 4CK2A 3C6TA 2VWKA 4BRQA 2Y1IA 3O8MA 4E19A 2G8IA 3ENHA 2PBDA 3LZJA 1V4TA 1G99A 3AVAA 1S6QA 5CZ2A 3NCIA 2NNWA 1RT6A 4M7YA 1EP4A 4B3MK 4ZHRA 1GLEG 3U8XA 3CIPA 4IOCL 1JL2A 5BR9A 4DSFA 1IKVA 3O9QA 3SQ4A 4I7FA 3SPYA 2A42A 1XMOK 4LF4K 4DCHA 4CZKA 1IKWA 3UIQA 1YXQA 4WQ5A 1LCUA 4JI8K 2KFNA 3LPUA 4JRPA 3KHYA 4CJQA 4CK1A 1XUPO 4FJKA 3DLEA 4JHDB 5CY4A 4FPAA 3SQ0A 3J7AP 4M45A 3C6HA 4W5OA 4MO5A 2HBKA 4B9MA 3CFRA 3A2FA 2HHVA 4N47A 2FF3B 3FFKB 3CQYA 2F4VK 1FKOA 1NU0A 3O5BA 1NOYA 4FOEA 2A1SA 1C0FA 3D2FA 5I9EB 1HJOA 3HPHA 1HKBA 3MMVA 4DR6K 2XRIA 4LH4A 4E1MA 3LDPA 2R7YA 1MU2A 2BUPA 3MX5A 1VSKA 1T03A 1IBLK 1K8KA 3V9WA 1VQ8N 1BISA 1T6CA 3LWLA 1GOBA 4FJXA 1HNWK 4ICLA 4QCLA 4IG3A 3OJUA 3OHRA 2P9IA 2XY5A 4X65K 1VQ9N 2OPPA 4ISEA 1I39A 3CQXA 3LM9A 4BRNA 3KTQA 3TI0A 1RT3A 1QHTA 2UXBK 1NK9A 4GKKK 3Q7BA 1BL3A 4JI1K 4A62A 4LFCK 5HRSA 1NM1A 1NK5A 1NJZA 5AQUA 1Q81O 3MAQA 4I6MB 3ZT1A 4FLTA 3TTCA 3OS1A 1E3MA 2I5JA 4FOIA 3PX0A 4AILC 1K8AO 3K5OA 3O4NA 4JI5K 4DG1A 3SJHA 1QSLA 3OYAA 4FLWA 5HBMA 3JS6A 3PX6A 3FZFA 2IC3A 4ILHA 3CPEA 2P9SB 5T7BA 1SAZA 3DLRA 2HBJA 3SUQA 5M1QA 3ZETB 4KB1A 4OO1J 1ILYA 3MDQA 5AQLA 1HX1A 1T6DA 1GLLO 4FW1A 1O1WA 4O0IA 3MWTA 3TWHA 4M3XA 3RSEB 4E7HA 5DM6L 2V7YA 4RW4A 4F3OA 1X9MA 4PKIA 3OBWA 4CF1A 3UE5A 4W5RA 2ITGA 2QEXN 4H0YB 5BN9A 1U6ZA 4DV6K 4JN4A 3SUNA 3OYKA 3SMPA 1QQOA 2HNDA 3WNEA 4LF9K 5CHIA 4KBOA 1ATSA 3SUPA 2E6MA 4LSNA 4BY9C 1S9GA 1BA0A 5BRDA 3BZCA 5GAHP 1TAQA 4FM0A 1X9WA 4CBUA 1VQKN 3FZHA 4JI0K 2W6LA 3CJ9A 2HHQA 1C0UA 1S1UA 3QERA 1RBUA 1S3XA 1NGCA 1RILA 3S9HA 4LF8K 3K57A 1S1TA 4CBWA 4I9LA 5HP1A 2UUCK 4FWMA 3LDNA 5KRSA 1NGHA 3AA5X 4BRLA 2HB5A 1WUAA 1ZBHA 4GVEA 1HR0K 4H0PA 3F73A 3NHGA 1LWEA 3AVBA 1NMDA 1RDWX 3LZIA 5TKYA 4GV9A 4E7JA 4B3SK 3P1GA 3K5NA 3LDSA 3DMJA 1WLJA 1SQKA 3SAFA 4BE2A 3NVKA 3OYJA 1Q8IA 3DLBA 5E84A 3ATVA 3CC7N 2VWJA 4PL8A 4JKFA 5BRFA 1HUXA 3VF6A 1JXBA 3B6OA 5AQJA 4MDBA 2WC9A 2ZJRL 4CEFA 1U48A 4CD1A 4YOXA 4NCGA 3RR7A 4GVMA 1RGIA 2OZSA 4AHTA 2YV0X 4DTSA 4CBXA 1DKGD 3T69A 2KZMA 2YHXA 4B8CA 5CR4A 4B8AB 2E2QA 4K43A 5GIOA 2YJEA 3DRSA 3QIPA 1E4FT 3R6MA 5E26A 5BPLA 1ZYQA 1HNIA 2ZWHA 1OH6A 1NJXA 4IJNA 1ITGA 2VG6A 2WOMA 2VGNA 1J5OA 4OKEA 1SL2A 5KI6A 1L3VA 2BGGA 3VF2A 1N32K 3OYEA 1YJ9N 1BQNA 4JD2B 3FZMA 4DS4A 3SQ2A 5C24A 3E01A 5JICA 4DQSA 5SWMA 4DFKA 3ZLJA 3V1QA 3IAYA 5M1PA 1SS6A 4Z4IA 4DTMA 4JS4A 3MCPA 2O8FB 1B92A 4ISGA 4RW8A 2WONA 4FJIA 3DRRA 4FJGA 5FRNA 3D45A 3ATUA 1X3NA 4KB0A 2QWPA 4NCAA 4KV8A 3HL8A 3WXLA 1YJNN 5BPNA 4KTQA 3O4QA 4B9NA 1QE1A 4NYNA 4IDHA 4DTJA 2P9SA 4BDYA 2CH6A 4EZ9A 3DAWA 2GTDA 5AQMA 4JEPA 2HHXA 3H1QA 2Z1GA 1KAZA 4HUFA 2O8DB 1HLUA 4CZHA 3I55N 1S1XA 3G71N 2UXCK 5KPRA 4M7XA 4FJJA 2X6SA 1J54A 3LWMA 4O5FA 5AQPA 2D0PA 2HHSA 5HLFA 3HK2A 1CZAN 2I7PA 2P9KB 4JI3K 3A5OC 3KLHA 3EZWA 1HYVA 1BQMA 3H1VX 2Q0UA 3RSEA 3L2UA 2UXDK 1BDGA 4FVUA 2BTFA 5AQZA 3ZX0A 1NK7A 4IOXA 4LC9B 4FJ7A 4DTPA 2OPSA 2UUAK 3OYBA 4ZTJA 1L3TA 4Z4FA 2E8AA 3OYIA 4JV5K 1VQLN 3VQ6A 3I33A 3TARA 1BO5O 1ZXOA 4QS8A 5HROA 4K8XA 4GY2B 4OPJA 4A2AA 3VA3A 4M3UA 3FLCO 4IBNA 4DTRA 3KLGA 4FCYA 1TV6A 4A5AA 1TK0A 3QEVA 3G10A 3JYTA 5I3UA 2ZM6K 2HMIA 2IIRA 4EHTA 2W6KA 1JLGA 4E7KA 3C95A 4L3QA 3MEEA 3RMAA 4FWOA 2QW9A 3RTVA 3AA3A 4A59A 3UKUA 3SI6A 4AM7A 4B3OA 1BG3A 1F21A 3M8PA 5M1KA 5IWAK 4KH5A 4NO7A 4EP4A 1NOZA 2OANA 1KTQA 2KQ2A 3ZCMA 4EIAA 2OYQA 1NK6A 3M3ZA 2D4WA 4YDUA 5LMUK 4BG8A 3VQAA 1YVUA 1GLAG 3I56N 1UA1A 2V51B 3DXMB 3MWPA 4ELTA 3KK7A 1Q18A 2DFHA 2HSTA 3VENA 1K73O 3VQ5A 2E1ZA 3AA2A 4DV3K 2EHGA 3RWUA 3KK3A 4EHUA 5AQFA 3ID6A 2YJFA 3ZSXA 3CCLN 1X1PA 2DFEA 4BVOA 3PO5A 2JLEA 3QNNA 1SZ2A 4FO0A 4K41A 3VETA 1JLQA 3AO5A 3V1RA 1EQYA 3HP6A 4CF2A 3AVJA 5HOOA 2QWOA 3CCEN 4O55A 1JL1A 2I7NA 4QS7A 3ZX3A 3LP2A 1BI4B 2YNGA 3VEZA 4JKEA 4BR5A 4BRFA 1QHAA 3U6FA 1YAGA 1S6PA 2UU9K 1UWBA 3HO1A 2G8KA 3OYMA 4DV0K 1HYSA 1BWFO 4KI6A 1TUUA 1QVFM 1OVQA 4IDKA 3C7NA 2YHWA 2ZF5O 2FBTA 2F9WA 3MEGA 1TYQB 3D2FB 2D0CA 2OZMA 1YITN 3S3NA 1T8EA 2KKZA 3C0BA 3PSFA 4XEIA 3PX4A 3DI6A 3CHWA 4PA1A 3L3VA 1ZBLA 3WQUA 1OH8A 1TVRA 2D0OA 4BR4A 4DSKA 5AQHA 4C8LA 4DQQA 1RTJA 2HNZA 3MN9A 4NXNK 1TAUA 5CE3A 3G6EN 3IS9A 3C6UA 3K2PA 4FJ5A 1KQSM 3KLIA 3MECA 5TKWA 3ULDA 4CJUA 3U3YA 3O3HA 4BWJA 1X9JA 4PHTX 4BRGA 4DU4A 2YNHA 1IKXA 3U3GA 2BANA 5KGWA 3VMFB 2YKNA 3TSPA 1VSDA 1WOQA 3TAFA 2HVHA 2CH5A 3ZSRA 1LWFA 1VRTA 5C15A 4WFBL 3BF3A 3PY8A 4HHTA 3QDKA 4CK3A 3B8AX 1HKGA 5JLFA 3J7ZO 3D6RA 4BC2A 3VA0A 1Z25A 2ASOA 4J2AA 4YOYA 3A0IX 1XC3A 3ULEA 2HHHK 2EWSA 4ZTFA 1VQ6N 4CEEA 1H1VA 2AP1A 3T1YK 4FZZA 4JK9A 5KQDA 4O4GA 3NGZA 3O3GA 4U67L 5FLXO 2E2OA 1X3MA 3NGIA 4JKBA 3UKUB 4CHOA 5F0XA 1NG9A 5CZ1A 1NGBA 3R1XA 3CJCA 2KHOA 4RCHA 1U2VA 1YI2N 1WBBA 3SBTA 2D0AA 4C8KA 1S72N 4BDZA 2Z1HA 3QEWA 3VERA 4DR2K 4FPBA 3DLGA 3WNGA 1RT7A 1GLFO 4KPYA 1FW6A 2IVPA 2YHYA 1NJIO 2CGKA 3JXUA 4BVPA 2VGMA 3KD5E 3VEYA 4FL9A 2O8CB 3AVFA 5M1NA 3KVGA 2RHKA 4NXMK 3T1HK 1QZ5A 3UB5A 4J8FA 4KHSA 3HSCA 4RG8A 1Q82O 3CJ7A 3KLEA 4W5QA 3LDLA 5EVZA 1JLAA 5A2QO 2EX3A 3CM6A 1KVAA 5C2FA 4CJVA 3L2VA 4H4MA 4KH6A 1KSPA 4H5NA 1QVGM 4F3TA 1SKSA 3LL3A 3CG7A 3CD6N 4FWNA 3LDOA 4CJ4A 3KKSA 4JK8A 2Z1JA 2Q31A 2XY7A 4YOWA 3D0PA 1L5UA 3QNOA 1RBRA 1QS4A 1KVBA 4MO4A 3V9XA 3THXB 5AQTA 3T3FA 1CXUA 1IV0A 1ZBUA 3AO1A 1L3UA 3AAQA 3C7NB 1BA1A 1RDAA 4M3YA 3DYAA 5BPMA 4CJRA 3SQ1A 2DTUA 3K5LA 5FPMA 3TAGA 2OTJN 2QK9A 1HNVA 4F2SA 1QZ6A 4B9VA 1YUWA 2A1RA 4CGDA 3CCUN 3AVHA 4DU3A 4CERA 4DFMA 1TKZA 4XH1A 3WXIA 1HJRA 2HOEA 2IVOA 3AV9A 5JLHA 4B08A 3VQBA 3I8DA 4YOUA 2GWKA 3ULEB 1TGOA 2NRWA 1IO2A 3AO4A 4NB4A 2B5JA 4JKCA 4C8OA 3AVKA 4W5NA 3VTHA 5EOYA 4WFNL 5C2DA 4OJRA 5SZTA 4H0OA 3CMAN 1LW0A 4PY5A 4DSJA 4CF9A 2OCEA 4KHUA 4KREA 3IUCA 4BC5A 1C1AA 1OVYA 2X74A 4B1VA 4BREA 3EZ5A 2VYPA 4DR5K 2BDPA 4AH9A 3IFRA 4N5SA 3C94A 1KAYA 1ZBFA 1HQEA 1JLBA 2F7TA 2OTLN 4V19S 4MDAA 3VEXA 4OKKA 3K59A 1XHZA 4PUOA 4Y1CA 2VG7A 5AZJA 4OVLA 3TTFA 4B9QA 2YHBA 3VGKA 2IS3A 1RT1A 3SYZA 4NLCA 4DSEA 3V81A 2Q36A 3MN5A 3VQ8A 4A61A 3L2RA 4R79A 4ILJA 2G8UA 4HTUA 1Z26A 3LP3A 3SV3A 3VN5A 4B1ZA 1W2BM 4H4OA 3WEEA 4U7BA 1QTMA 2OA8A 4BGAA 2V7ZA 1VSLA 2JWKA 1DT9A 2P9PA 1JLCA 1FKPA 3QIOA 3HJFA 4HWIA 4JKDA 1KFSA 4NYFA 1T44A 4Z0UA 1WNSA 4FWLA 1LWCA 4AHRA 4AM6A 5JVGL 3AARA 3S41A 1NK8A 3TAMA 3V6DA 3BF1A 4Z4EA 2FBVA 4PQUA 3AAPA 5BRHA 3KZBA 5MLCQ 5EY4A 2F96A 4CGHA 2AJQA 4BC4A 4LF6K 4CFCA 4FM2A 4H03B 2F8TA 3VEWA 4C8NA 1W7AA 1M90O 2CGJA 4WYBA 5AQKA 1BUPA 2YNIA 3P38A 4FZXC 4O8UA 1P90A 4CIEA 3AA4A 4HCBA 1BHLA 2BH1A 4JD2A 1RTIA 2GELA 4DWIA 2HMPA 2RF2A 1D9DA 5AJ3K 3L0QA 1DTQA 5AQGA 1IKYA 1IJJA 3HSTB 3O9RA 3OBYA 1TL1A 1R59O 4YDUC 4CJFA 3CPWM 1LOTB 4O44A 2VG5A 1QQNA 4EAHD 4CE9A 4AHCA 4FWSA 4WQ4C 3KK1A 3CJ1A 4B9LA 3WQTA 3ZEUB 3O1BA 4JS5A 1A5XA 3HM9A 2IVNA 1S1WA 2FBYA 3RVCA 4CGGA 5AZIB 3CCVN 1RDBA 4H0XB 1NNEA 3IMXA 2JWLA 3O08A 1HPMA 1RBTA 3VEOA 5HRNA 4CJTA 1GLCG 5JMVA 3MEDA 4K8ZA 2E20A 2ZGZA 4LF7K 1QQCA 4LD0A 2NUBA 4OLBA 3QB0A 1EETA 1C0GA 2WFBA 4CF0A 1IBMK 2Q2RA 4FYDA 4H0TB 4KI4A 4C8MA 4BGBA 4CJ3A 2KTQA 2G8HA 4DQPA 3R3LA 4PKGA 1OKJA 3KWIA 1W9HA 4CECA 3C65A 5AZJB 4NLBA 4BR9A 4Z4HA 3BGRA 4B9UA 1EO1A 2P9LB 2GEMA 3LAMA 3L2WA 4KHPK 4CGFA 4JI2K 5KRTA 4KO0A 4JNEA 3HM8A 3VQ7A 1HYZA 4CEDA 3O80A 5AZIA 3V9UA 1RT2A 2ZE2A 1VSFA 3OYFA 1D5AA 1K9MO 3HOTA 5AFUH 3IG1A 4WE1A 2RPIA 3K9KA 3CQ8A 4E0DA 1B9FA 4DUYK 4CZJA 2Z1IA 3BP8A 3R9PA 5J2MA 5GAEP 4BQLA 3D7EO 3CF5L 2O4GA 2QXLA 1R0AA 5GAGP 3RRHA 3SAGA 4M3TA 1NGDA 1KAXA 2FBXA 2NRTA 3SCXA 1NGAA 1G15A 2QXFA 4FK2A 5H1SQ 3DLKA 1IH7A 4CGJA 1N5YA 3WXMB 2NRHA 4CF8A 2QWLA 4E7LA 5AQIA 3MCAB 2P5GA 1VAZA 1WSGA 3E1YA 1MA9B 1YJWN 4KHYA 2XY6A 2WUSA 4DV1K 5ADXH 2E4LA 1WSFA 2PFUA 2QWRA 5KQ8A 3NFAA 5ADXA 3SPZA 3GBTA 2P9IB 3KWGA 3SNNA 1QSYA 2D0BA 2RN2A 3SLCA 2A3ZA 4HVJA 4JI4K 2OPRA 2DPNA 1K8KB 4KKOA 4FLUA 3SUOA 4IWVA 3J7YP 3JAMO 1JCFA 2KW4A 1NLVA 3OYGA 5J2PA 2VQFK 3LP1A 3HVTA 1ASVA 3EL2A 3DLHA 3I0RA 1DLOA 4CGIA 1YHQN 4GV6A 1SKRA 4GKJK 5KPTA 4CZGA 1NK4A 1ZBSA 2J4RA 4A5BA 4BACA 1ZBIA 4FJLA 4M3WA 3O9SA 4LH5A 3ZX2A 4CJ5A 4M41A 2GV9A 3ZSZA 3FE1A 4BRCA 3NH1A 5AQRA 3OA9A 4K42A 4B3RK 4JLHA 3PIOL 1JKHA 4H5TA 5AR0A 2NZTA 4PKHA 1NWKA 3OS0A 3THWA 1FXXA 1T3VA 2QWQA 4QOZB 2P5OA 2D5RA 3ZT0A 1VRUA 4FSVA 2HHWA 5C42A 4JK7A 1RTHA 1XNQK 4MFBA 3TABA 4IXCA 3FZLA 3I0SA 3VOVA 4BG9A 3VESA 3ZT2A 4CHYA 5J1EA 3MK6A 2O8EA 4DV7K 3SZ2A 3TU5A 3WNHA 3DXKB 4TSXA 3DOKA 1YTAA 1GOAA 4BR0A 4JAXA 1LW2A 4WFAL 3O6WA 4BRIA 1TK8A 3DXKA 4JKHA 4OGEA 5KGXA 3VPZA 5D3GA 3EKSA 3A8YA 3OYNA 3ALYA 3SBGA 3CM5A 4BRPA 4FW2A 1SL0A 1J5EK 4HUEA 2ATQA 5J2QA 4E3SA 4BQZA 5JS1A 4AHUA 4YOVA 4DSIA 4DTXA 3THWB 4YFUA 4ID1A 4M3RA 4CZEA 1XQSC 1JCEA 5AQXA 3OS2A 5JVHL 5C12A 3NMUA 3ZSOA 3HRGA 1KLNA 4FK0A 1Y64A 4FVMA 2AA4A 3KJVA 3K58A 1W97L 3H3NO 4BROA 2Y1JA 4C23A 2HNYA 4B9SA 1EWRA 3CMEN 2FLOA 3VGMA 3OYDA 2E2NA 4KHWA 4HUGA 1KLMA 4KRFA 3AVIA 3MX2A 1XMQK 1XC9A 4LY7A 3AVMA 4AHVA 4IO8A 3PV8A 3NAEA 3S3MA 4BE1A 3V4IA 1KVCA 4H0VB 3U9DA 3HBTA 2P1JA 3D2EA 5AQSA 2QKKA 4Y0WA 4JYAK 3PIPL 1KCFA 3BY5A 3UKRB 3AVCA 1N6QA 1ATRA 3AY9A 1HNZK 1IG9A 1TKXA 2G8VA 3GDQA 4AF1A 4O8KA 3H08A 3RMBA 2KZZA 5DK5A 2W41A 3EE8A 3O3FA 4OPKA 2GBZA 2P9NB 1NKCA 5C10A 3T7ZA 3VQQA 3ZT3A 3OYHA 1N36K 3HPOA 1U2VB 1FK9A 1BOTO 3RMCA 2Q0RA 3L3UA 3MN7A 3PO4A 3WXJA 4MLHA 4WQ4A 4BRKA 4XIUA 1WN7A 3G0ZA 2G8FA 5JS2A 1RDCA 4HTLA 2YX6A 3SAHA 4IG0A 3ZYYX 4CZLA 3C6AA 2HHUA 4Q5VA 3DJCA 1YVNA 3WUHA 1ESVA 3ENBA 3THYA 3TTDA 4DV2K 1VSJA 4OKJA 2P9UB 3SJJA 1NMNA 1VSMA 1I94K 3EYZA 3DM2A 4Y1DA 4CJKA 4DFJA 2GUPA 3TSUA 1REVA 4KTZA 3A5LC 4EP5A 3LM2A 1KD1O 1GLBG 1K6YA 3WNFA 4DLGA 4JKGA 3OJSA 2BE2A 1XNRK 1NGFA 2FC0A 4GNIA 1NKEA 4FWRA 3T1AA 3ENOA 4IOAL 2YI1A 4PL7A 4F4KA 3NE6A 3EO3A 4Q0BA 2PZSA 1RCHA 2W40A 2GX9A 3K5MA 4JI6K 3NDKA 4H5VA 1RBVA 2LSNA 3V9SA 3AVLA 1D8YA 1BGXT 2ETJA 5DMRA 1SV5A 2F8SA 2DY4A 1NGJA 2PAVA 3SV4A 2ZD1A 3CETA 1NGGA 4DR7K 3KLFA 4J2DA 3TPQA 1VHXA 3D2EB 2ASPA 2O8FA 4FLVA 2HF3A 4GV3A 4G1QA 4LFBK 3TAEA 5BREA 4FWPA 4NCBA 1TYQA 1RT4A 3LDQA 1P8ZA 3MXIA
chains in the Genus database with same CATH topology
1BCOA 5CYMA 2YNIA 3OYIA 4FZXC 2P51A 3LALA 4CIEA 2HW3A 3AA4A 4HCBA 4CESA 3VQ6A 1YTUA 1EXQA 1BHLA 2KFZA 3TARA 3P83D 1RTIA 4DWIA 3VQ4A 5HROA 4K8XA 2RF2A 4OPJA 3JSMA 3THVA 1D9DA 1DTQA 4J2BA 3VA3A 1IKYA 4M3UA 3FFIA 3HSTB 1X9SA 4IBNA 4DTRA 1TL1A 3KKRA 4GW6A 3KLGA 4FCYA 3OYCA 1TV6A 1TK0A 4CJFA 3G10A 1S9EA 3JYTA 3QEVA 5I3UA 1C0MA 3PUFA 4O44A 2VG5A 4LSLA 3HVRA 3QETA 2HMIA 4FJHA 3HT3A 4CE9A 4ID5A 4AHCA 3KK1A 4YNQA 4B9LA 1S1VA 4E1NA 1JLGA 1JLEA 4E7KA 1U45A 1RNHA 3MXMA 4J2EA 4JS5A 1A5XA 3C95A 3HM9A 1S1WA 2FBYA 3MEEA 3RMAA 4CGGA 1U47A 4FXDA 1JXEA 1RDBA 3RTVA 3AA3A 3SI6A 1WSIA 3NF8A 1QSSA 4B3OA 1RBTA 4QAGA 5HRNA 1F21A 3M8SA 1B9DA 4CJTA 4N41A 3M8PA 1RT5A 3MEDA 4K8ZA 2KZZA 1TKDA 2YHAA 4B9TA 1QQCA 2DFFA 4CEOA 1C1BA 4EP4A 4LD0A 1NOZA 1BI4A 1GOCA 2X6NA 1KTQA 3ZT4A 2KQ2A 2NUBA 3ZCMA 2W42A 1Q9YA 4KTWA 5K14A 1U49A 2OYQA 4HCCA 3ZSYA 2XY8A 4OLBA 3LP0A 1CLQA 1NK6A 4CEZA 2YNFA 1EETA 4FYDA 3KIOA 3NGYA 4CF0A 4F2RA 4KI4A 3VQAA 1YVUA 3QO9A 4C8MA 3NH0A 1UA1A 4CJ3A 4ELTA 3TR8A 2DFHA 3AO2A 2KTQA 3ZSWA 2G8HA 3VQ5A 4DQPA 4FK4A 1WSEA 3AA2A 3ITHA 4M42A 4CJSA 4CHPA 1EX4A 2EHGA 3RWUA 1L3SA 5FRMA 1W9HA 3OY9A 4CECA 3KK3A 4Z4HA 4B9UA 3BGRA 2OPQA 4CEAA 4FJNA 5E41A 3V9ZA 1A5VA 4ELUA 5FDLA 5HRRA 3ZSXA 4DTOA 4OLAA 3LAMA 4CK2A 4CIFA 3L2WA 4CGFA 3C6TA 2VWKA 2Y1IA 1X1PA 2DFEA 3NBPA 4E19A 3PO5A 2JLEA 3MXJA 5KRTA 2G8IA 4KO0A 3QNNA 3LZJA 3AVAA 3NCIA 1XWLA 1S6QA 5CZ2A 3VQ7A 1HYZA 4CEDA 3NH2A 5FROA 3V9UA 1JLQA 1RT2A 2ZE2A 3AO5A 3V1RA 1RT6A 1VSFA 1EP4A 3OYFA 1D5AA 3HP6A 4CF2A 4DSLA 1Y97A 2BGGA 2O4IA 3AVJA 4ZHRA 4DSFA 1JL2A 3IG1A 4O55A 4WE1A 1IKVA 3SQ4A 2RPIA 4ELVA 1JL1A 4I7FA 3CQ8A 3LP2A 3SPYA 1BI4B 4E0DA 1B9FA 1C6VA 1LV5A 2YNGA 1HPZA 4DF4A 2Z1IA 4FM1A 5J2MA 1IKWA 3UIQA 3TANA 1I3AA 3M8RA 2O4GA 1R0AA 3RRHA 3RMDA 1TKTA 4M3TA 3U6FA 2KFNA 3LPUA 2FBXA 4JRPA 4RW7A 3SCXA 1S6PA 1G15A 2QXFA 4BWMA 4CEQA 4FK2A 2XO7A 1UWBA 3HO1A 2G8KA 3DLKA 1IH7A 4CGJA 4Z4CA 3OYMA 1N5YA 4CJQA 1HYSA 4CK1A 4IFYA 4CF8A 1RTDA 4E7LA 4FJKA 4KI6A 3DLEA 2P5GA 5CY4A 3SQ0A 4JRQA 1WSGA 4M45A 4KHYA 4IDKA 3QESA 3HYFA 4W5OA 2XY6A 3ISNC 2E4LA 4B9MA 1WSFA 2FBTA 3CFRA 3A2FA 2HHVA 3MEGA 4N47A 2G8WA 2D0CA 1FKOA 3NFAA 4CFAA 4R5PA 2OZMA 3SPZA 2QKBA 3S3NA 1T8EA 4E89A 3OVNA 3SNNA 3LANA 1QSYA 1HMVA 2D0BA 2RN2A 1NOYA 3PX4A 2A1SA 3DI6A 4KFBA 1KFDA 4DU1A 4HVJA 1BCMA 4PA1A 4DTNA 2OPRA 3L3VA 3HPHA 1ZBLA 2XRIA 4PWDA 4KKOA 4FLUA 4LH4A 4H8KA 1TVRA 3EY1A 4E1MA 3SUOA 4DSKA 4C8LA 2R7YA 4DQQA 1MU2A 1RTJA 2KW4A 2HNZA 3OYGA 5J2PA 1VSKA 1TAUA 1T03A 3LP1A 1CZ9A 2E6LA 1UOCA 3HVTA 3IS9A 1ASVA 1BISA 3V9WA 1C0TA 1RBSA 3LWLA 3LPTA 1GOBA 4RW9A 3DLHA 3I0RA 4FJXA 4ICLA 1DLOA 3C6UA 4CGIA 3S3OA 3K2PA 4QCLA 4FJ5A 4IG3A 3AO3A 3KLIA 1SKRA 1WAFA 3MECA 3OJUA 2XY5A 3ULDA 4CJUA 3U3YA 1Q9XA 1W0HA 2B4JA 1T7PA 3O3HA 4KAZA 4BWJA 2OPPA 1NK4A 1I39A 4DTUA 4BACA 1ZBIA 4FJLA 4MQ3A 4DU4A 2YNHA 3ZSVA 3KTQA 1T05A 4KHQA 3TI0A 4M3WA 1IKXA 4LH5A 2BANA 3U3GA 5KTQA 2PYJA 1RT3A 1QHTA 4CJ5A 1NK0A 4M41A 5KGWA 2GV9A 3ZSZA 5HRPA 4N56A 1SKWA 3NF7A 3NH1A 2YKNA 1VSDA 3TAFA 1BIUA 1CZBA 4JLHA 3F9KA 2IAJA 4O0JA 2HVHA 1UA0A 1JKHA 3LAKA 1LWFA 1BL3A 3ZSRA 1NK9A 4F8RA 1VRTA 5HRSA 3P5JA 4CHZA 1NK5A 1NJZA 3OS0A 1FXXA 3PY8A 4HHTA 4CK3A 3MAQA 3VQEA 3ZT1A 2P5OA 4QOZB 4FLTA 2D5RA 3ZT0A 1VRUA 3OS1A 2I5JA 4UQGA 1Z25A 3VA0A 4AILC 3PX0A 4J2AA 5C42A 2HHWA 1RTHA 3K5OA 3O4NA 5EU7A 4ZTFA 1XI1A 4CEEA 4MFBA 4DG1A 4FZZA 3TABA 1QSLA 1ASUA 3OYAA 3I0SA 4FLWA 2YKMA 5HBMA 4O4GA 3ZT2A 3QINA 2IC3A 4CHYA 3NGZA 3O3GA 3PX6A 1TK5A 5J1EA 1WAJA 5T7BA 3SZ2A 1RDDA 3DLRA 3WNHA 4DFPA 4TSXA 3DOKA 3SUQA 1YTAA 4KB1A 3NGIA 4I9QA 1GOAA 4CFBA 1LW2A 4CHOA 4FW1A 4O0IA 1O1WA 5CZ1A 4AHSA 4M3XA 3QLHA 3TWHA 4M3ZA 1TK8A 1HQUA 4E7HA 2IDOA 2RKIA 4OGEA 5KGXA 4RW4A 2D0AA 4C8KA 5D3GA 5C25A 1SUQA 4F3OA 4BDZA 1X9MA 2Z1HA 3M8QA 3QEWA 3OYNA 3ALYA 2X78A 4CF1A 4FJ9A 2HVIA 3CM5A 1C1CA 1RT7A 3ASMA 3DLGA 1UAXA 2ITGA 3WNGA 4W5RA 3BDPA 4KPYA 4FW2A 4N76A 1SL0A 3KD5E 4HUEA 2ATQA 4FLXA 4DMNA 3AVFA 5J2QA 4E3SA 3SUNA 3OYKA 5JS1A 4AHUA 5CYQA 2Q3SA 4CCHA 4DSIA 2HNDA 3WNEA 4DTXA 2PYLA 4CEBA 4YFUA 1CXQA 4ID1A 3SUPA 2E6MA 4KHSA 4LSNA 4M3RA 1S9GA 4RG8A 3RRGA 3OS2A 3KLEA 4I2PA 4W5QA 3ZSOA 1TAQA 1JLAA 4DS5A 2EX3A 3CM6A 1KVAA 1KLNA 4FM0A 4FK0A 1X9WA 4CJVA 3L2VA 4H4MA 4FVMA 3T19A 1KSPA 3KJVA 3K58A 2HHQA 1C0UA 1S1UA 3QERA 1RBUA 3S9HA 4L8RB 1LAVA 1RILA 4F3TA 2PY5A 3K57A 2Y1JA 1S1TA 4I9LA 2HNYA 5HP1A 3TAPA 3CG7A 1SKSA 3DOLA 4B9SA 2XHBA 3L8BA 5KRSA 3OYDA 3RR8A 3AA5X 3OYLA 3KK2A 2HB5A 4DQIA 4KHWA 4CJ4A 3KKSA 1NJYA 3V1OA 1ZBHA 4HUGA 1KLMA 4KRFA 3AVIA 3F73A 3NHGA 1LWEA 2Z1JA 4CHQA 3AVBA 1XC9A 2XY7A 4LY7A 4GMJB 3D0PA 4BDPA 3AVMA 3LZIA 4AHVA 1L5UA 2HHTA 3QNOA 1RBRA 1QS4A 4FLZA 1KVBA 3NAEA 3V9XA 4E7JA 3PV8A 3P1GA 4BE1A 1CXUA 3T3FA 3V4IA 3K5NA 3S3MA 1DTTA 1KRPA 1KVCA 1ZBUA 3AO1A 3LDSA 3DMJA 1WLJA 3NF9A 1L3UA 1RDAA 4BE2A 2P1JA 3OYJA 4BE0A 3DYAA 1Q8IA 4M3YA 3DLBA 4CJRA 3SQ1A 2QKKA 4DLEA 3K5LA 2DTUA 4FJMA 1KCFA 2VWJA 3CFPA 3HP9A 3TAGA 5I42A 3AVCA 4RW6A 3TAQA 1N6QA 2QK9A 1HNVA 4F2SA 2IGIA 1JXBA 3B6OA 1IG9A 4CEFA 4B9VA 1TKXA 3AVGA 1U48A 2G8VA 2A1RA 4NCGA 3H08A 4CGDA 4GVMA 3RMBA 3AVHA 4DU3A 5DK5A 3RR7A 4CERA 4DFMA 1TKZA 3O3FA 3QEIA 1HJRA 2OZSA 3AV9A 1BIZA 4AHTA 2YV0X 4DTSA 4IKFA 3IRXA 4B08A 1VSHA 3VQBA 3VQCA 3I8DA 4KHNA 2KZMA 4B8CA 4OPKA 2GBZA 1NJWA 4I2QA 1NKCA 1TGOA 1IO2A 4B8AB 4CFDA 3VQQA 3AO4A 4FZYA 3ZT3A 3DRSA 3OYHA 3QIPA 2B5JA 2GUIA 3HPOA 4C8OA 3L2QA 3ZSQA 1FK9A 3AVKA 4W5NA 4FJ8A 1ASWA 3RMCA 1ZYQA 1HNIA 3L3UA 4E7IA 3B6PA 3PO4A 3VQPA 1D9FA 1NJXA 4OJRA 1ITGA 1NKBA 2VG6A 2WOMA 5SZTA 4DQRA 1J5OA 4OKEA 3CYMA 1HRHA 5KI6A 1WN7A 4XIUA 1SL2A 1LW0A 1VSEA 3G0ZA 1A5WA 1L3VA 4DSJA 1TL3A 1XHXA 5JS2A 1RDCA 4CF9A 4CIGA 1BQNA 3OYEA 2G8FA 3KD1E 3AVNA 4Z4GA 4KHUA 3NF6A 4DS4A 5J2NA 1WSHA 3QEXA 4CJPA 4KREA 3SQ2A 5C24A 1C1AA 3E01A 2X74A 4IG0A 3EZ5A 3HPGA 4DQSA 5SWMA 4DFKA 4CHNA 2HHUA 4Q5VA 3V1QA 4AH9A 2BDPA 3IAYA 4Z4IA 2B6AA 4N5SA 3CFOA 3C94A 2ZQBA 4DTMA 4JS4A 3QEPA 1ZBFA 1B92A 1VSJA 4OKJA 2WONA 4RW8A 3SJJA 1HQEA 1U4BA 4FJIA 1VSMA 3DRRA 1JLBA 4FJGA 3EYZA 3DM2A 5FRNA 3D45A 4OKKA 4Y1DA 3K59A 4CJKA 1XHZA 4PUOA 4Y1CA 2VG7A 4DFJA 4KB0A 4CJWA 4KV8A 4NCAA 3HL8A 1REVA 4KTZA 4KTQA 4OVLA 3O4QA 4CJLA 1J9AA 4B9NA 1QE1A 2YHBA 4NYNA 4EP5A 2IS3A 1RT1A 1U04A 4DTJA 1VK0A 4BDYA 4EZ9A 3SYZA 1K6YA 3WNFA 4CJEA 4DLGA 4DSEA 3OJSA 2BE2A 3V81A 2FC0A 1VSIA 3VQDA 1NKEA 3T1AA 2HHXA 3VQ8A 3L2RA 2Z1GA 4PY5A 4HUFA 2G8UA 4HTUA 1Z26A 3LP3A 3SV3A 3VN5A 4DF8A 4F4KA 4H4OA 4W5TA 1S1XA 3NE6A 1S5JA 4Q0BA 2PZSA 1WSJA 1QTMA 1RCHA 2OA8A 3HXMA 4OGCA 4EZ6A 3K5MA 3NDKA 4O5BA 1VSLA 3V9SA 1RBVA 2LSNA 1J54A 2X6SA 3DRPA 3LWMA 4FJJA 1JLCA 1FKPA 3AVLA 1D8YA 1BGXT 2HHSA 5HLFA 3QIOA 3HJFA 3HK2A 2ETJA 1KFSA 4NYFA 5DMRA 1SV5A 2F8SA 1LAWA 2DY4A 3SV4A 1SL1A 2ZD1A 3KLHA 1HYVA 4Z0UA 2JGUA 1WNSA 1LWCA 4AHRA 1BQMA 3KLFA 3VQ9A 4J2DA 3L2UA 4FLYA 1NK8A 3TAMA 3V6DA 4PQUA 4FLVA 2FBVA 2IOCA 4Z4EA 1J53A 1NK7A 1YT3A 4G1QA 2F96A 4CGHA 2AJQA 4IFVA 1JLFA 4CFCA 4FM2A 3TAEA 2F8TA 4FJ7A 4DTPA 2OPSA 4NCBA 1EKEA 4C8NA 3OYBA 1RT4A 4ZTJA 1L3TA 3MXIA 4Z4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCO A;  5CYM A;  2YNI A;  3OYI A;  4FZX C;  2P51 A;  3LAL A;  4CIE A;  2HW3 A;  3AA4 A;  4HCB A;  4CES A;  3VQ6 A;  1YTU A;  1EXQ A;  1BHL A;  2KFZ A;  3TAR A;  3P83 D;  1RTI A;  4DWI A;  3VQ4 A;  5HRO A;  4K8X A;  2RF2 A;  4OPJ A;  3JSM A;  3THV A;  1D9D A;  1DTQ A;  4J2B A;  3VA3 A;  1IKY A;  4M3U A;  3FFI A;  3HST B;  1X9S A;  4IBN A;  4DTR A;  1TL1 A;  3KKR A;  4GW6 A;  3KLG A;  4FCY A;  3OYC A;  1TV6 A;  1TK0 A;  4CJF A;  3G10 A;  1S9E A;  3JYT A;  3QEV A;  5I3U A;  1C0M A;  3PUF A;  4O44 A;  2VG5 A;  4LSL A;  3HVR A;  3QET A;  2HMI A;  4FJH A;  3HT3 A;  4CE9 A;  4ID5 A;  4AHC A;  3KK1 A;  4YNQ A;  4B9L A;  1S1V A;  4E1N A;  1JLG A;  1JLE A;  4E7K A;  1U45 A;  1RNH A;  3MXM A;  4J2E A;  4JS5 A;  1A5X A;  3C95 A;  3HM9 A;  1S1W A;  2FBY A;  3MEE A;  3RMA A;  4CGG A;  1U47 A;  4FXD A;  1JXE A;  1RDB A;  3RTV A;  3AA3 A;  3SI6 A;  1WSI A;  3NF8 A;  1QSS A;  4B3O A;  1RBT A;  4QAG A;  5HRN A;  1F21 A;  3M8S A;  1B9D A;  4CJT A;  4N41 A;  3M8P A;  1RT5 A;  3MED A;  4K8Z A;  2KZZ A;  1TKD A;  2YHA A;  4B9T A;  1QQC A;  2DFF A;  4CEO A;  1C1B A;  4EP4 A;  4LD0 A;  1NOZ A;  1BI4 A;  1GOC A;  2X6N A;  1KTQ A;  3ZT4 A;  2KQ2 A;  2NUB A;  3ZCM A;  2W42 A;  1Q9Y A;  4KTW A;  5K14 A;  1U49 A;  2OYQ A;  4HCC A;  3ZSY A;  2XY8 A;  4OLB A;  3LP0 A;  1CLQ A;  1NK6 A;  4CEZ A;  2YNF A;  1EET A;  4FYD A;  3KIO A;  3NGY A;  4CF0 A;  4F2R A;  4KI4 A;  3VQA A;  1YVU A;  3QO9 A;  4C8M A;  3NH0 A;  1UA1 A;  4CJ3 A;  4ELT A;  3TR8 A;  2DFH A;  3AO2 A;  2KTQ A;  3ZSW A;  2G8H A;  3VQ5 A;  4DQP A;  4FK4 A;  1WSE A;  3AA2 A;  3ITH A;  4M42 A;  4CJS A;  4CHP A;  1EX4 A;  2EHG A;  3RWU A;  1L3S A;  5FRM A;  1W9H A;  3OY9 A;  4CEC A;  3KK3 A;  4Z4H A;  4B9U A;  3BGR A;  2OPQ A;  4CEA A;  4FJN A;  5E41 A;  3V9Z A;  1A5V A;  4ELU A;  5FDL A;  5HRR A;  3ZSX A;  4DTO A;  4OLA A;  3LAM A;  4CK2 A;  4CIF A;  3L2W A;  4CGF A;  3C6T A;  2VWK A;  2Y1I A;  1X1P A;  2DFE A;  3NBP A;  4E19 A;  3PO5 A;  2JLE A;  3MXJ A;  5KRT A;  2G8I A;  4KO0 A;  3QNN A;  3LZJ A;  3AVA A;  3NCI A;  1XWL A;  1S6Q A;  5CZ2 A;  3VQ7 A;  1HYZ A;  4CED A;  3NH2 A;  5FRO A;  3V9U A;  1JLQ A;  1RT2 A;  2ZE2 A;  3AO5 A;  3V1R A;  1RT6 A;  1VSF A;  1EP4 A;  3OYF A;  1D5A A;  3HP6 A;  4CF2 A;  4DSL A;  1Y97 A;  2BGG A;  2O4I A;  3AVJ A;  4ZHR A;  4DSF A;  1JL2 A;  3IG1 A;  4O55 A;  4WE1 A;  1IKV A;  3SQ4 A;  2RPI A;  4ELV A;  1JL1 A;  4I7F A;  3CQ8 A;  3LP2 A;  3SPY A;  1BI4 B;  4E0D A;  1B9F A;  1C6V A;  1LV5 A;  2YNG A;  1HPZ A;  4DF4 A;  2Z1I A;  4FM1 A;  5J2M A;  1IKW A;  3UIQ A;  3TAN A;  1I3A A;  3M8R A;  2O4G A;  1R0A A;  3RRH A;  3RMD A;  1TKT A;  4M3T A;  3U6F A;  2KFN A;  3LPU A;  2FBX A;  4JRP A;  4RW7 A;  3SCX A;  1S6P A;  1G15 A;  2QXF A;  4BWM A;  4CEQ A;  4FK2 A;  2XO7 A;  1UWB A;  3HO1 A;  2G8K A;  3DLK A;  1IH7 A;  4CGJ A;  4Z4C A;  3OYM A;  1N5Y A;  4CJQ A;  1HYS A;  4CK1 A;  4IFY A;  4CF8 A;  1RTD A;  4E7L A;  4FJK A;  4KI6 A;  3DLE A;  2P5G A;  5CY4 A;  3SQ0 A;  4JRQ A;  1WSG A;  4M45 A;  4KHY A;  4IDK A;  3QES A;  3HYF A;  4W5O A;  2XY6 A;  3ISN C;  2E4L A;  4B9M A;  1WSF A;  2FBT A;  3CFR A;  3A2F A;  2HHV A;  3MEG A;  4N47 A;  2G8W A;  2D0C A;  1FKO A;  3NFA A;  4CFA A;  4R5P A;  2OZM A;  3SPZ A;  2QKB A;  3S3N A;  1T8E A;  4E89 A;  3OVN A;  3SNN A;  3LAN A;  1QSY A;  1HMV A;  2D0B A;  2RN2 A;  1NOY A;  3PX4 A;  2A1S A;  3DI6 A;  4KFB A;  1KFD A;  4DU1 A;  4HVJ A;  1BCM A;  4PA1 A;  4DTN A;  2OPR A;  3L3V A;  3HPH A;  1ZBL A;  2XRI A;  4PWD A;  4KKO A;  4FLU A;  4LH4 A;  4H8K A;  1TVR A;  3EY1 A;  4E1M A;  3SUO A;  4DSK A;  4C8L A;  2R7Y A;  4DQQ A;  1MU2 A;  1RTJ A;  2KW4 A;  2HNZ A;  3OYG A;  5J2P A;  1VSK A;  1TAU A;  1T03 A;  3LP1 A;  1CZ9 A;  2E6L A;  1UOC A;  3HVT A;  3IS9 A;  1ASV A;  1BIS A;  3V9W A;  1C0T A;  1RBS A;  3LWL A;  3LPT A;  1GOB A;  4RW9 A;  3DLH A;  3I0R A;  4FJX A;  4ICL A;  1DLO A;  3C6U A;  4CGI A;  3S3O A;  3K2P A;  4QCL A;  4FJ5 A;  4IG3 A;  3AO3 A;  3KLI A;  1SKR A;  1WAF A;  3MEC A;  3OJU A;  2XY5 A;  3ULD A;  4CJU A;  3U3Y A;  1Q9X A;  1W0H A;  2B4J A;  1T7P A;  3O3H A;  4KAZ A;  4BWJ A;  2OPP A;  1NK4 A;  1I39 A;  4DTU A;  4BAC A;  1ZBI A;  4FJL A;  4MQ3 A;  4DU4 A;  2YNH A;  3ZSV A;  3KTQ A;  1T05 A;  4KHQ A;  3TI0 A;  4M3W A;  1IKX A;  4LH5 A;  2BAN A;  3U3G A;  5KTQ A;  2PYJ A;  1RT3 A;  1QHT A;  4CJ5 A;  1NK0 A;  4M41 A;  5KGW A;  2GV9 A;  3ZSZ A;  5HRP A;  4N56 A;  1SKW A;  3NF7 A;  3NH1 A;  2YKN A;  1VSD A;  3TAF A;  1BIU A;  1CZB A;  4JLH A;  3F9K A;  2IAJ A;  4O0J A;  2HVH A;  1UA0 A;  1JKH A;  3LAK A;  1LWF A;  1BL3 A;  3ZSR A;  1NK9 A;  4F8R A;  1VRT A;  5HRS A;  3P5J A;  4CHZ A;  1NK5 A;  1NJZ A;  3OS0 A;  1FXX A;  3PY8 A;  4HHT A;  4CK3 A;  3MAQ A;  3VQE A;  3ZT1 A;  2P5O A;  4QOZ B;  4FLT A;  2D5R A;  3ZT0 A;  1VRU A;  3OS1 A;  2I5J A;  4UQG A;  1Z25 A;  3VA0 A;  4AIL C;  3PX0 A;  4J2A A;  5C42 A;  2HHW A;  1RTH A;  3K5O A;  3O4N A;  5EU7 A;  4ZTF A;  1XI1 A;  4CEE A;  4MFB A;  4DG1 A;  4FZZ A;  3TAB A;  1QSL A;  1ASU A;  3OYA A;  3I0S A;  4FLW A;  2YKM A;  5HBM A;  4O4G A;  3ZT2 A;  3QIN A;  2IC3 A;  4CHY A;  3NGZ A;  3O3G A;  3PX6 A;  1TK5 A;  5J1E A;  1WAJ A;  5T7B A;  3SZ2 A;  1RDD A;  3DLR A;  3WNH A;  4DFP A;  4TSX A;  3DOK A;  3SUQ A;  1YTA A;  4KB1 A;  3NGI A;  4I9Q A;  1GOA A;  4CFB A;  1LW2 A;  4CHO A;  4FW1 A;  4O0I A;  1O1W A;  5CZ1 A;  4AHS A;  4M3X A;  3QLH A;  3TWH A;  4M3Z A;  1TK8 A;  1HQU A;  4E7H A;  2IDO A;  2RKI A;  4OGE A;  5KGX A;  4RW4 A;  2D0A A;  4C8K A;  5D3G A;  5C25 A;  1SUQ A;  4F3O A;  4BDZ A;  1X9M A;  2Z1H A;  3M8Q A;  3QEW A;  3OYN A;  3ALY A;  2X78 A;  4CF1 A;  4FJ9 A;  2HVI A;  3CM5 A;  1C1C A;  1RT7 A;  3ASM A;  3DLG A;  1UAX A;  2ITG A;  3WNG A;  4W5R A;  3BDP A;  4KPY A;  4FW2 A;  4N76 A;  1SL0 A;  3KD5 E;  4HUE A;  2ATQ A;  4FLX A;  4DMN A;  3AVF A;  5J2Q A;  4E3S A;  3SUN A;  3OYK A;  5JS1 A;  4AHU A;  5CYQ A;  2Q3S A;  4CCH A;  4DSI A;  2HND A;  3WNE A;  4DTX A;  2PYL A;  4CEB A;  4YFU A;  1CXQ A;  4ID1 A;  3SUP A;  2E6M A;  4KHS A;  4LSN A;  4M3R A;  1S9G A;  4RG8 A;  3RRG A;  3OS2 A;  3KLE A;  4I2P A;  4W5Q A;  3ZSO A;  1TAQ A;  1JLA A;  4DS5 A;  2EX3 A;  3CM6 A;  1KVA A;  1KLN A;  4FM0 A;  4FK0 A;  1X9W A;  4CJV A;  3L2V A;  4H4M A;  4FVM A;  3T19 A;  1KSP A;  3KJV A;  3K58 A;  2HHQ A;  1C0U A;  1S1U A;  3QER A;  1RBU A;  3S9H A;  4L8R B;  1LAV A;  1RIL A;  4F3T A;  2PY5 A;  3K57 A;  2Y1J A;  1S1T A;  4I9L A;  2HNY A;  5HP1 A;  3TAP A;  3CG7 A;  1SKS A;  3DOL A;  4B9S A;  2XHB A;  3L8B A;  5KRS A;  3OYD A;  3RR8 A;  3AA5 X;  3OYL A;  3KK2 A;  2HB5 A;  4DQI A;  4KHW A;  4CJ4 A;  3KKS A;  1NJY A;  3V1O A;  1ZBH A;  4HUG A;  1KLM A;  4KRF A;  3AVI A;  3F73 A;  3NHG A;  1LWE A;  2Z1J A;  4CHQ A;  3AVB A;  1XC9 A;  2XY7 A;  4LY7 A;  4GMJ B;  3D0P A;  4BDP A;  3AVM A;  3LZI A;  4AHV A;  1L5U A;  2HHT A;  3QNO A;  1RBR A;  1QS4 A;  4FLZ A;  1KVB A;  3NAE A;  3V9X A;  4E7J A;  3PV8 A;  3P1G A;  4BE1 A;  1CXU A;  3T3F A;  3V4I A;  3K5N A;  3S3M A;  1DTT A;  1KRP A;  1KVC A;  1ZBU A;  3AO1 A;  3LDS A;  3DMJ A;  1WLJ A;  3NF9 A;  1L3U A;  1RDA A;  4BE2 A;  2P1J A;  3OYJ A;  4BE0 A;  3DYA A;  1Q8I A;  4M3Y A;  3DLB A;  4CJR A;  3SQ1 A;  2QKK A;  4DLE A;  3K5L A;  2DTU A;  4FJM A;  1KCF A;  2VWJ A;  3CFP A;  3HP9 A;  3TAG A;  5I42 A;  3AVC A;  4RW6 A;  3TAQ A;  1N6Q A;  2QK9 A;  1HNV A;  4F2S A;  2IGI A;  1JXB A;  3B6O A;  1IG9 A;  4CEF A;  4B9V A;  1TKX A;  3AVG A;  1U48 A;  2G8V A;  2A1R A;  4NCG A;  3H08 A;  4CGD A;  4GVM A;  3RMB A;  3AVH A;  4DU3 A;  5DK5 A;  3RR7 A;  4CER A;  4DFM A;  1TKZ A;  3O3F A;  3QEI A;  1HJR A;  2OZS A;  3AV9 A;  1BIZ A;  4AHT A;  2YV0 X;  4DTS A;  4IKF A;  3IRX A;  4B08 A;  1VSH A;  3VQB A;  3VQC A;  3I8D A;  4KHN A;  2KZM A;  4B8C A;  4OPK A;  2GBZ A;  1NJW A;  4I2Q A;  1NKC A;  1TGO A;  1IO2 A;  4B8A B;  4CFD A;  3VQQ A;  3AO4 A;  4FZY A;  3ZT3 A;  3DRS A;  3OYH A;  3QIP A;  2B5J A;  2GUI A;  3HPO A;  4C8O A;  3L2Q A;  3ZSQ A;  1FK9 A;  3AVK A;  4W5N A;  4FJ8 A;  1ASW A;  3RMC A;  1ZYQ A;  1HNI A;  3L3U A;  4E7I A;  3B6P A;  3PO4 A;  3VQP A;  1D9F A;  1NJX A;  4OJR A;  1ITG A;  1NKB A;  2VG6 A;  2WOM A;  5SZT A;  4DQR A;  1J5O A;  4OKE A;  3CYM A;  1HRH A;  5KI6 A;  1WN7 A;  4XIU A;  1SL2 A;  1LW0 A;  1VSE A;  3G0Z A;  1A5W A;  1L3V A;  4DSJ A;  1TL3 A;  1XHX A;  5JS2 A;  1RDC A;  4CF9 A;  4CIG A;  1BQN A;  3OYE A;  2G8F A;  3KD1 E;  3AVN A;  4Z4G A;  4KHU A;  3NF6 A;  4DS4 A;  5J2N A;  1WSH A;  3QEX A;  4CJP A;  4KRE A;  3SQ2 A;  5C24 A;  1C1A A;  3E01 A;  2X74 A;  4IG0 A;  3EZ5 A;  3HPG A;  4DQS A;  5SWM A;  4DFK A;  4CHN A;  2HHU A;  4Q5V A;  3V1Q A;  4AH9 A;  2BDP A;  3IAY A;  4Z4I A;  2B6A A;  4N5S A;  3CFO A;  3C94 A;  2ZQB A;  4DTM A;  4JS4 A;  3QEP A;  1ZBF A;  1B92 A;  1VSJ A;  4OKJ A;  2WON A;  4RW8 A;  3SJJ A;  1HQE A;  1U4B A;  4FJI A;  1VSM A;  3DRR A;  1JLB A;  4FJG A;  3EYZ A;  3DM2 A;  5FRN A;  3D45 A;  4OKK A;  4Y1D A;  3K59 A;  4CJK A;  1XHZ A;  4PUO A;  4Y1C A;  2VG7 A;  4DFJ A;  4KB0 A;  4CJW A;  4KV8 A;  4NCA A;  3HL8 A;  1REV A;  4KTZ A;  4KTQ A;  4OVL A;  3O4Q A;  4CJL A;  1J9A A;  4B9N A;  1QE1 A;  2YHB A;  4NYN A;  4EP5 A;  2IS3 A;  1RT1 A;  1U04 A;  4DTJ A;  1VK0 A;  4BDY A;  4EZ9 A;  3SYZ A;  1K6Y A;  3WNF A;  4CJE A;  4DLG A;  4DSE A;  3OJS A;  2BE2 A;  3V81 A;  2FC0 A;  1VSI A;  3VQD A;  1NKE A;  3T1A A;  2HHX A;  3VQ8 A;  3L2R A;  2Z1G A;  4PY5 A;  4HUF A;  2G8U A;  4HTU A;  1Z26 A;  3LP3 A;  3SV3 A;  3VN5 A;  4DF8 A;  4F4K A;  4H4O A;  4W5T A;  1S1X A;  3NE6 A;  1S5J A;  4Q0B A;  2PZS A;  1WSJ A;  1QTM A;  1RCH A;  2OA8 A;  3HXM A;  4OGC A;  4EZ6 A;  3K5M A;  3NDK A;  4O5B A;  1VSL A;  3V9S A;  1RBV A;  2LSN A;  1J54 A;  2X6S A;  3DRP A;  3LWM A;  4FJJ A;  1JLC A;  1FKP A;  3AVL A;  1D8Y A;  1BGX T;  2HHS A;  5HLF A;  3QIO A;  3HJF A;  3HK2 A;  2ETJ A;  1KFS A;  4NYF A;  5DMR A;  1SV5 A;  2F8S A;  1LAW A;  2DY4 A;  3SV4 A;  1SL1 A;  2ZD1 A;  3KLH A;  1HYV A;  4Z0U A;  2JGU A;  1WNS A;  1LWC A;  4AHR A;  1BQM A;  3KLF A;  3VQ9 A;  4J2D A;  3L2U A;  4FLY A;  1NK8 A;  3TAM A;  3V6D A;  4PQU A;  4FLV A;  2FBV A;  2IOC A;  4Z4E A;  1J53 A;  1NK7 A;  1YT3 A;  4G1Q A;  2F96 A;  4CGH A;  2AJQ A;  4IFV A;  1JLF A;  4CFC A;  4FM2 A;  3TAE A;  2F8T A;  4FJ7 A;  4DTP A;  2OPS A;  4NCB A;  1EKE A;  4C8N A;  3OYB A;  1RT4 A;  4ZTJ A;  1L3T A;  3MXI A;  4Z4F A; 
#chains in the Genus database with same CATH topology
 1BCO A;  5CYM A;  1Z05 A;  3LAL A;  2E5L K;  2HW3 A;  3HTV A;  4CES A;  3VQ4 A;  3JSM A;  3THV A;  4J2B A;  1EWQ A;  1X9S A;  4GW6 A;  3KKR A;  2WTU A;  1VQN N;  4C1N K;  3OYC A;  3P4I A;  4B3T K;  3F5T A;  2A5X A;  4BRA A;  3HT3 A;  4ID5 A;  4DR1 K;  1JLE A;  1U45 A;  2A6A A;  3MXM A;  4ISF A;  4CW7 B;  4F9O A;  4B1U B;  5F1X A;  3CJA A;  3E9P A;  3VEV A;  1U47 A;  5KPZ A;  4CJ7 A;  2QA4 N;  1O13 A;  1QSS A;  3CCM N;  1B9D A;  1BU6 O;  2UYT A;  4IEI A;  3EKU A;  5AQV A;  1TKD A;  3W3D A;  5EX5 A;  3VF4 A;  3M1F A;  1KC8 O;  2ZJQ L;  1C1B A;  3QIC A;  3ZT4 A;  2X6N A;  4YOR A;  1U49 A;  4RWT A;  2F9T A;  4HCC A;  3ZSY A;  5EXW A;  3LP0 A;  4CEZ A;  2YNF A;  3NGY A;  4F2R A;  3E66 A;  3CC2 N;  3QO9 A;  4BR2 A;  3AO2 A;  3ZSW A;  4ILG B;  4FK4 A;  3ITH A;  4CJS A;  5M1F A;  2OPQ A;  3MN6 A;  4CEA A;  1A5V A;  5FDL A;  5AQY A;  5HRR A;  4DTO A;  4OLA A;  4CIF A;  5AQO A;  3NBP A;  2QM1 A;  3MXJ A;  4K25 A;  4DV4 K;  1M1K O;  1XWL A;  2FF6 A;  3NH2 A;  5FRO A;  5AFU A;  1DEJ A;  2O4I A;  4DSL A;  1Y97 A;  1NGE A;  4FWK A;  4ELV A;  2NLX A;  2D1K A;  1C6V A;  1LV5 A;  1YIJ N;  1HPZ A;  4DF4 A;  5AQN A;  4FM1 A;  3QML A;  3TAN A;  1I3A A;  3M8R A;  4BRD A;  3RMD A;  1TKT A;  2P9U A;  4CVN E;  1FJG K;  4RW7 A;  4BWM A;  4CEQ A;  2XO7 A;  3U4L A;  2NRV A;  3H45 C;  4Z4C A;  4IFY A;  4MLE A;  1RTD A;  3OTO K;  3HZ6 A;  3EEQ A;  1VQ4 N;  4JRQ A;  5GIP A;  2VCP A;  2GWJ A;  3HYF A;  3QES A;  2P9L A;  3ISN C;  2UUB K;  3CER A;  2G8W A;  3QBW A;  1DGK N;  4R5P A;  2HBM A;  2RE2 A;  4CFA A;  2QKB A;  3CCR N;  4E89 A;  3OVN A;  4YOT A;  3LAN A;  2O8B B;  1HMV A;  2E88 A;  1KFD A;  4KFB A;  3VGL A;  4DU1 A;  1BCM A;  4DTN A;  3AGK A;  4IZ9 A;  3L4I A;  4PWD A;  4M63 C;  4H8K A;  3EY1 A;  4WQ5 C;  2HF4 A;  3QFP A;  3QFU A;  1VQP N;  3DWL A;  1CZ9 A;  2E6L A;  1UOC A;  3SK3 A;  3J81 O;  1HKC A;  1C0T A;  1RBS A;  1S22 A;  3LPT A;  4RW9 A;  4H5R A;  3S3O A;  3WEE B;  1Q7Y O;  3AO3 A;  3GE1 A;  4FWQ A;  5LJV A;  1WAF A;  1TUY A;  1Q9X A;  1W0H A;  2B4J A;  3Q7C A;  1T7P A;  1JJ2 M;  4BC3 A;  4KAZ A;  4DTU A;  4MQ3 A;  1GLJ O;  3ZSV A;  4YY3 K;  1T05 A;  4OX9 K;  4KHQ A;  5KTQ A;  2PYJ A;  1NK0 A;  5HRP A;  4N56 A;  1SKW A;  4KH4 A;  3NF7 A;  2O8C A;  4RTF D;  1BIU A;  3BUZ B;  1CZB A;  3N4P A;  3F9K A;  4IFE A;  2IAJ A;  4O0J A;  1UA0 A;  3LAK A;  4F8R A;  3P5J A;  4CHZ A;  3O9U A;  5B8H A;  1N33 K;  3VQE A;  4UQG A;  2YCH A;  3G25 A;  3A5N C;  5EU7 A;  1XI1 A;  4DHY A;  2NRR A;  1GLD G;  1JCG A;  1ASU A;  2YKM A;  3QIN A;  1TK5 A;  1WAJ A;  2A40 A;  1RDD A;  4DFP A;  1OH7 A;  3NVM A;  3I8B A;  4I9Q A;  2A41 A;  3R8E A;  3CCS N;  3IKM A;  4JHD A;  4CFB A;  2FSJ A;  3DXM A;  4AHS A;  4M3Z A;  3QLH A;  1HQU A;  2IDO A;  2RKI A;  2QTD A;  5C25 A;  1N8R O;  1SUQ A;  3M8Q A;  3ZEU A;  2X78 A;  4FJ9 A;  2HVI A;  1V4S A;  1C1C A;  3BDP A;  3ASM A;  1UAX A;  4B1Y B;  4XH4 A;  4N76 A;  4C1N I;  2KLA A;  4FLX A;  4DMN A;  1VQ5 N;  5CYQ A;  4BRH A;  2Q3S A;  3IDH A;  4CCH A;  2PYL A;  4CEB A;  1HNX K;  1CXQ A;  3O9T A;  3RRG A;  4I2P A;  3FGU A;  4X62 K;  4DS5 A;  3CCJ N;  1RFQ A;  1WB9 A;  3T19 A;  2O8E B;  3PLA A;  2V52 B;  4L8R B;  2ITM A;  1LAV A;  2PY5 A;  2P9N A;  3TAP A;  3DOL A;  4WCE L;  2XHB A;  3L8B A;  4XH5 A;  3RR8 A;  3OYL A;  3KK2 A;  4DQI A;  1NJY A;  2WBN A;  3V1O A;  3P31 A;  2ASM A;  4CHQ A;  4CZM A;  4E1J A;  4GMJ B;  4BDP A;  2HHT A;  4FLZ A;  4JKA A;  2FSN A;  2ZGY A;  1KRP A;  3WXK A;  1DTT A;  3OW2 M;  3NF9 A;  1MWM A;  5F2R A;  5ELZ A;  4BE0 A;  1WBD A;  1Q86 O;  3O1W A;  4DLE A;  4FJM A;  3CFP A;  3HP9 A;  5I42 A;  4RW6 A;  3K9J A;  3TAQ A;  2IGI A;  3P39 A;  2P9K A;  3CC4 N;  3AVG A;  3AGR A;  4H5W A;  3W0L A;  3QEI A;  5DM7 L;  4IKF A;  1BIZ A;  3IRX A;  1VSH A;  3VQC A;  4KHN A;  4DB3 A;  1NJW A;  4UY8 O;  4I2Q A;  4QS9 A;  4CFD A;  3J8A A;  3K0S A;  4FZY A;  5FPN A;  2GUI A;  3EE9 A;  3L2Q A;  3ZSQ A;  1MDU B;  4FJ8 A;  1ASW A;  2E2P A;  3GG4 A;  4E7I A;  3B6P A;  3CCQ N;  3VQP A;  1D9F A;  1NKB A;  4DQR A;  2O8D A;  4DKW A;  3CYM A;  1HRH A;  4OPA A;  2ZJP L;  1VSE A;  4B1W B;  1A5W A;  2QWM A;  5IT9 O;  1TL3 A;  1XHX A;  4CIG A;  3KD1 E;  3AVN A;  4Z4G A;  3NF6 A;  5J2N A;  1WSH A;  3QEX A;  4CJP A;  1NBW A;  4X66 K;  3F2K A;  3BEX A;  3E9O A;  3HPG A;  2H3G X;  3UKR A;  4CHN A;  1E4G T;  4LF5 K;  2B6A A;  3CFO A;  1MWK A;  2ZQB A;  3QEP A;  3HI0 A;  5FPE A;  4G9Z A;  1U4B A;  3M6G A;  4DQ8 A;  5LMN K;  3PSI A;  4CJW A;  4OPH A;  4CJL A;  1J9A A;  4LFA K;  3CXC M;  4YHH K;  1IG8 A;  1U04 A;  3VTI A;  1VK0 A;  3WT0 A;  4CJE A;  4X64 K;  3TSQ A;  5AQQ A;  3EN9 A;  2VQE K;  1VSI A;  3H3O B;  1YF5 L;  3VQD A;  2Q1N A;  5FPD A;  1ZC6 A;  3A5M C;  4DF8 A;  3L6Q A;  4W5T A;  1S5J A;  4Z94 A;  1WSJ A;  3HXM A;  4OGC A;  4EZ6 A;  4O5B A;  5GAD P;  3DRP A;  3GOI A;  4DR3 K;  4DV5 K;  5HL7 L;  3H6E A;  5LY3 A;  1QQM A;  1LAW A;  4IEE A;  5LJW A;  2FSK A;  4CZI A;  1SL1 A;  3GL1 A;  2JGU A;  3FR0 A;  3VQ9 A;  4FLY A;  3L4Q A;  2IOC A;  1J53 A;  4BRM A;  3ID8 A;  4A2B A;  1YT3 A;  4IFV A;  1JLF A;  1RDU A;  1EKE A;  3M5R A;  1IBK K;  1VQ7 N;  3F9M A;  2NRZ A;  3SMS A;  4K0K K;  4CI6 A;  2P51 A;  3THY B;  1YTU A;  1EXQ A;  2KFZ A;  3P83 D;  4DUZ K;  1NGI A;  4BR7 A;  2HBL A;  5AQW A;  3FFI A;  4WF9 L;  2CGL A;  4IO9 L;  1S9E A;  1Z6R A;  3H46 O;  3U9Z A;  2QWN A;  1C0M A;  3PUF A;  3THX A;  3CJB A;  2P9P B;  4LSL A;  3HVR A;  3QET A;  4FJH A;  1J6Z A;  3HOS A;  4YNQ A;  1S1V A;  4E1N A;  5GIN A;  4DR4 K;  1RNH A;  1ATN A;  4J2E A;  2FXU A;  1VQO N;  3QBX A;  5LL6 Z;  4FXD A;  1JXE A;  4IJA A;  3CI5 A;  4CZF A;  5BR8 K;  2E1Y A;  1WSI A;  3NF8 A;  2O8B A;  2QI2 A;  3J80 O;  4QAG A;  3BZK A;  3M8S A;  4N41 A;  3G4S N;  4JKG B;  3O4W A;  1RT5 A;  2YHA A;  4B9T A;  2DFF A;  4CEO A;  5BN8 A;  4EFH A;  1BI4 A;  1GOC A;  3N4Q A;  2W42 A;  1Q9Y A;  4KTW A;  5K14 A;  4A57 A;  1VQM N;  2VWB A;  1CLQ A;  2XY8 A;  1OH5 A;  3E9L A;  3ZET A;  4B1X B;  3KIO A;  3NH0 A;  5C0Y A;  1D4X A;  3TR8 A;  2NRX A;  4JI7 K;  1WSE A;  4CD3 A;  4M42 A;  4CHP A;  1EX4 A;  1L3S A;  5FRM A;  3DLL L;  3OY9 A;  1N34 K;  5M1O A;  1KXP A;  3FZK A;  4FJN A;  5E41 A;  4AQY K;  3V9Z A;  4ELU A;  4I6M A;  2Q97 A;  4CK2 A;  3C6T A;  2VWK A;  4BRQ A;  2Y1I A;  3O8M A;  4E19 A;  2G8I A;  3ENH A;  2PBD A;  3LZJ A;  1V4T A;  1G99 A;  3AVA A;  1S6Q A;  5CZ2 A;  3NCI A;  2NNW A;  1RT6 A;  4M7Y A;  1EP4 A;  4B3M K;  4ZHR A;  1GLE G;  3U8X A;  3CIP A;  4IOC L;  1JL2 A;  5BR9 A;  4DSF A;  1IKV A;  3O9Q A;  3SQ4 A;  4I7F A;  3SPY A;  2A42 A;  1XMO K;  4LF4 K;  4DCH A;  4CZK A;  1IKW A;  3UIQ A;  1YXQ A;  4WQ5 A;  1LCU A;  4JI8 K;  2KFN A;  3LPU A;  4JRP A;  3KHY A;  4CJQ A;  4CK1 A;  1XUP O;  4FJK A;  3DLE A;  4JHD B;  5CY4 A;  4FPA A;  3SQ0 A;  3J7A P;  4M45 A;  3C6H A;  4W5O A;  4MO5 A;  2HBK A;  4B9M A;  3CFR A;  3A2F A;  2HHV A;  4N47 A;  2FF3 B;  3FFK B;  3CQY A;  2F4V K;  1FKO A;  1NU0 A;  3O5B A;  1NOY A;  4FOE A;  2A1S A;  1C0F A;  3D2F A;  5I9E B;  1HJO A;  3HPH A;  1HKB A;  3MMV A;  4DR6 K;  2XRI A;  4LH4 A;  4E1M A;  3LDP A;  2R7Y A;  1MU2 A;  2BUP A;  3MX5 A;  1VSK A;  1T03 A;  1IBL K;  1K8K A;  3V9W A;  1VQ8 N;  1BIS A;  1T6C A;  3LWL A;  1GOB A;  4FJX A;  1HNW K;  4ICL A;  4QCL A;  4IG3 A;  3OJU A;  3OHR A;  2P9I A;  2XY5 A;  4X65 K;  1VQ9 N;  2OPP A;  4ISE A;  1I39 A;  3CQX A;  3LM9 A;  4BRN A;  3KTQ A;  3TI0 A;  1RT3 A;  1QHT A;  2UXB K;  1NK9 A;  4GKK K;  3Q7B A;  1BL3 A;  4JI1 K;  4A62 A;  4LFC K;  5HRS A;  1NM1 A;  1NK5 A;  1NJZ A;  5AQU A;  1Q81 O;  3MAQ A;  4I6M B;  3ZT1 A;  4FLT A;  3TTC A;  3OS1 A;  1E3M A;  2I5J A;  4FOI A;  3PX0 A;  4AIL C;  1K8A O;  3K5O A;  3O4N A;  4JI5 K;  4DG1 A;  3SJH A;  1QSL A;  3OYA A;  4FLW A;  5HBM A;  3JS6 A;  3PX6 A;  3FZF A;  2IC3 A;  4ILH A;  3CPE A;  2P9S B;  5T7B A;  1SAZ A;  3DLR A;  2HBJ A;  3SUQ A;  5M1Q A;  3ZET B;  4KB1 A;  4OO1 J;  1ILY A;  3MDQ A;  5AQL A;  1HX1 A;  1T6D A;  1GLL O;  4FW1 A;  1O1W A;  4O0I A;  3MWT A;  3TWH A;  4M3X A;  3RSE B;  4E7H A;  5DM6 L;  2V7Y A;  4RW4 A;  4F3O A;  1X9M A;  4PKI A;  3OBW A;  4CF1 A;  3UE5 A;  4W5R A;  2ITG A;  2QEX N;  4H0Y B;  5BN9 A;  1U6Z A;  4DV6 K;  4JN4 A;  3SUN A;  3OYK A;  3SMP A;  1QQO A;  2HND A;  3WNE A;  4LF9 K;  5CHI A;  4KBO A;  1ATS A;  3SUP A;  2E6M A;  4LSN A;  4BY9 C;  1S9G A;  1BA0 A;  5BRD A;  3BZC A;  5GAH P;  1TAQ A;  4FM0 A;  1X9W A;  4CBU A;  1VQK N;  3FZH A;  4JI0 K;  2W6L A;  3CJ9 A;  2HHQ A;  1C0U A;  1S1U A;  3QER A;  1RBU A;  1S3X A;  1NGC A;  1RIL A;  3S9H A;  4LF8 K;  3K57 A;  1S1T A;  4CBW A;  4I9L A;  5HP1 A;  2UUC K;  4FWM A;  3LDN A;  5KRS A;  1NGH A;  3AA5 X;  4BRL A;  2HB5 A;  1WUA A;  1ZBH A;  4GVE A;  1HR0 K;  4H0P A;  3F73 A;  3NHG A;  1LWE A;  3AVB A;  1NMD A;  1RDW X;  3LZI A;  5TKY A;  4GV9 A;  4E7J A;  4B3S K;  3P1G A;  3K5N A;  3LDS A;  3DMJ A;  1WLJ A;  1SQK A;  3SAF A;  4BE2 A;  3NVK A;  3OYJ A;  1Q8I A;  3DLB A;  5E84 A;  3ATV A;  3CC7 N;  2VWJ A;  4PL8 A;  4JKF A;  5BRF A;  1HUX A;  3VF6 A;  1JXB A;  3B6O A;  5AQJ A;  4MDB A;  2WC9 A;  2ZJR L;  4CEF A;  1U48 A;  4CD1 A;  4YOX A;  4NCG A;  3RR7 A;  4GVM A;  1RGI A;  2OZS A;  4AHT A;  2YV0 X;  4DTS A;  4CBX A;  1DKG D;  3T69 A;  2KZM A;  2YHX A;  4B8C A;  5CR4 A;  4B8A B;  2E2Q A;  4K43 A;  5GIO A;  2YJE A;  3DRS A;  3QIP A;  1E4F T;  3R6M A;  5E26 A;  5BPL A;  1ZYQ A;  1HNI A;  2ZWH A;  1OH6 A;  1NJX A;  4IJN A;  1ITG A;  2VG6 A;  2WOM A;  2VGN A;  1J5O A;  4OKE A;  1SL2 A;  5KI6 A;  1L3V A;  2BGG A;  3VF2 A;  1N32 K;  3OYE A;  1YJ9 N;  1BQN A;  4JD2 B;  3FZM A;  4DS4 A;  3SQ2 A;  5C24 A;  3E01 A;  5JIC A;  4DQS A;  5SWM A;  4DFK A;  3ZLJ A;  3V1Q A;  3IAY A;  5M1P A;  1SS6 A;  4Z4I A;  4DTM A;  4JS4 A;  3MCP A;  2O8F B;  1B92 A;  4ISG A;  4RW8 A;  2WON A;  4FJI A;  3DRR A;  4FJG A;  5FRN A;  3D45 A;  3ATU A;  1X3N A;  4KB0 A;  2QWP A;  4NCA A;  4KV8 A;  3HL8 A;  3WXL A;  1YJN N;  5BPN A;  4KTQ A;  3O4Q A;  4B9N A;  1QE1 A;  4NYN A;  4IDH A;  4DTJ A;  2P9S A;  4BDY A;  2CH6 A;  4EZ9 A;  3DAW A;  2GTD A;  5AQM A;  4JEP A;  2HHX A;  3H1Q A;  2Z1G A;  1KAZ A;  4HUF A;  2O8D B;  1HLU A;  4CZH A;  3I55 N;  1S1X A;  3G71 N;  2UXC K;  5KPR A;  4M7X A;  4FJJ A;  2X6S A;  1J54 A;  3LWM A;  4O5F A;  5AQP A;  2D0P A;  2HHS A;  5HLF A;  3HK2 A;  1CZA N;  2I7P A;  2P9K B;  4JI3 K;  3A5O C;  3KLH A;  3EZW A;  1HYV A;  1BQM A;  3H1V X;  2Q0U A;  3RSE A;  3L2U A;  2UXD K;  1BDG A;  4FVU A;  2BTF A;  5AQZ A;  3ZX0 A;  1NK7 A;  4IOX A;  4LC9 B;  4FJ7 A;  4DTP A;  2OPS A;  2UUA K;  3OYB A;  4ZTJ A;  1L3T A;  4Z4F A;  2E8A A;  3OYI A;  4JV5 K;  1VQL N;  3VQ6 A;  3I33 A;  3TAR A;  1BO5 O;  1ZXO A;  4QS8 A;  5HRO A;  4K8X A;  4GY2 B;  4OPJ A;  4A2A A;  3VA3 A;  4M3U A;  3FLC O;  4IBN A;  4DTR A;  3KLG A;  4FCY A;  1TV6 A;  4A5A A;  1TK0 A;  3QEV A;  3G10 A;  3JYT A;  5I3U A;  2ZM6 K;  2HMI A;  2IIR A;  4EHT A;  2W6K A;  1JLG A;  4E7K A;  3C95 A;  4L3Q A;  3MEE A;  3RMA A;  4FWO A;  2QW9 A;  3RTV A;  3AA3 A;  4A59 A;  3UKU A;  3SI6 A;  4AM7 A;  4B3O A;  1BG3 A;  1F21 A;  3M8P A;  5M1K A;  5IWA K;  4KH5 A;  4NO7 A;  4EP4 A;  1NOZ A;  2OAN A;  1KTQ A;  2KQ2 A;  3ZCM A;  4EIA A;  2OYQ A;  1NK6 A;  3M3Z A;  2D4W A;  4YDU A;  5LMU K;  4BG8 A;  3VQA A;  1YVU A;  1GLA G;  3I56 N;  1UA1 A;  2V51 B;  3DXM B;  3MWP A;  4ELT A;  3KK7 A;  1Q18 A;  2DFH A;  2HST A;  3VEN A;  1K73 O;  3VQ5 A;  2E1Z A;  3AA2 A;  4DV3 K;  2EHG A;  3RWU A;  3KK3 A;  4EHU A;  5AQF A;  3ID6 A;  2YJF A;  3ZSX A;  3CCL N;  1X1P A;  2DFE A;  4BVO A;  3PO5 A;  2JLE A;  3QNN A;  1SZ2 A;  4FO0 A;  4K41 A;  3VET A;  1JLQ A;  3AO5 A;  3V1R A;  1EQY A;  3HP6 A;  4CF2 A;  3AVJ A;  5HOO A;  2QWO A;  3CCE N;  4O55 A;  1JL1 A;  2I7N A;  4QS7 A;  3ZX3 A;  3LP2 A;  1BI4 B;  2YNG A;  3VEZ A;  4JKE A;  4BR5 A;  4BRF A;  1QHA A;  3U6F A;  1YAG A;  1S6P A;  2UU9 K;  1UWB A;  3HO1 A;  2G8K A;  3OYM A;  4DV0 K;  1HYS A;  1BWF O;  4KI6 A;  1TUU A;  1QVF M;  1OVQ A;  4IDK A;  3C7N A;  2YHW A;  2ZF5 O;  2FBT A;  2F9W A;  3MEG A;  1TYQ B;  3D2F B;  2D0C A;  2OZM A;  1YIT N;  3S3N A;  1T8E A;  2KKZ A;  3C0B A;  3PSF A;  4XEI A;  3PX4 A;  3DI6 A;  3CHW A;  4PA1 A;  3L3V A;  1ZBL A;  3WQU A;  1OH8 A;  1TVR A;  2D0O A;  4BR4 A;  4DSK A;  5AQH A;  4C8L A;  4DQQ A;  1RTJ A;  2HNZ A;  3MN9 A;  4NXN K;  1TAU A;  5CE3 A;  3G6E N;  3IS9 A;  3C6U A;  3K2P A;  4FJ5 A;  1KQS M;  3KLI A;  3MEC A;  5TKW A;  3ULD A;  4CJU A;  3U3Y A;  3O3H A;  4BWJ A;  1X9J A;  4PHT X;  4BRG A;  4DU4 A;  2YNH A;  1IKX A;  3U3G A;  2BAN A;  5KGW A;  3VMF B;  2YKN A;  3TSP A;  1VSD A;  1WOQ A;  3TAF A;  2HVH A;  2CH5 A;  3ZSR A;  1LWF A;  1VRT A;  5C15 A;  4WFB L;  3BF3 A;  3PY8 A;  4HHT A;  3QDK A;  4CK3 A;  3B8A X;  1HKG A;  5JLF A;  3J7Z O;  3D6R A;  4BC2 A;  3VA0 A;  1Z25 A;  2ASO A;  4J2A A;  4YOY A;  3A0I X;  1XC3 A;  3ULE A;  2HHH K;  2EWS A;  4ZTF A;  1VQ6 N;  4CEE A;  1H1V A;  2AP1 A;  3T1Y K;  4FZZ A;  4JK9 A;  5KQD A;  4O4G A;  3NGZ A;  3O3G A;  4U67 L;  5FLX O;  2E2O A;  1X3M A;  3NGI A;  4JKB A;  3UKU B;  4CHO A;  5F0X A;  1NG9 A;  5CZ1 A;  1NGB A;  3R1X A;  3CJC A;  2KHO A;  4RCH A;  1U2V A;  1YI2 N;  1WBB A;  3SBT A;  2D0A A;  4C8K A;  1S72 N;  4BDZ A;  2Z1H A;  3QEW A;  3VER A;  4DR2 K;  4FPB A;  3DLG A;  3WNG A;  1RT7 A;  1GLF O;  4KPY A;  1FW6 A;  2IVP A;  2YHY A;  1NJI O;  2CGK A;  3JXU A;  4BVP A;  2VGM A;  3KD5 E;  3VEY A;  4FL9 A;  2O8C B;  3AVF A;  5M1N A;  3KVG A;  2RHK A;  4NXM K;  3T1H K;  1QZ5 A;  3UB5 A;  4J8F A;  4KHS A;  3HSC A;  4RG8 A;  1Q82 O;  3CJ7 A;  3KLE A;  4W5Q A;  3LDL A;  5EVZ A;  1JLA A;  5A2Q O;  2EX3 A;  3CM6 A;  1KVA A;  5C2F A;  4CJV A;  3L2V A;  4H4M A;  4KH6 A;  1KSP A;  4H5N A;  1QVG M;  4F3T A;  1SKS A;  3LL3 A;  3CG7 A;  3CD6 N;  4FWN A;  3LDO A;  4CJ4 A;  3KKS A;  4JK8 A;  2Z1J A;  2Q31 A;  2XY7 A;  4YOW A;  3D0P A;  1L5U A;  3QNO A;  1RBR A;  1QS4 A;  1KVB A;  4MO4 A;  3V9X A;  3THX B;  5AQT A;  3T3F A;  1CXU A;  1IV0 A;  1ZBU A;  3AO1 A;  1L3U A;  3AAQ A;  3C7N B;  1BA1 A;  1RDA A;  4M3Y A;  3DYA A;  5BPM A;  4CJR A;  3SQ1 A;  2DTU A;  3K5L A;  5FPM A;  3TAG A;  2OTJ N;  2QK9 A;  1HNV A;  4F2S A;  1QZ6 A;  4B9V A;  1YUW A;  2A1R A;  4CGD A;  3CCU N;  3AVH A;  4DU3 A;  4CER A;  4DFM A;  1TKZ A;  4XH1 A;  3WXI A;  1HJR A;  2HOE A;  2IVO A;  3AV9 A;  5JLH A;  4B08 A;  3VQB A;  3I8D A;  4YOU A;  2GWK A;  3ULE B;  1TGO A;  2NRW A;  1IO2 A;  3AO4 A;  4NB4 A;  2B5J A;  4JKC A;  4C8O A;  3AVK A;  4W5N A;  3VTH A;  5EOY A;  4WFN L;  5C2D A;  4OJR A;  5SZT A;  4H0O A;  3CMA N;  1LW0 A;  4PY5 A;  4DSJ A;  4CF9 A;  2OCE A;  4KHU A;  4KRE A;  3IUC A;  4BC5 A;  1C1A A;  1OVY A;  2X74 A;  4B1V A;  4BRE A;  3EZ5 A;  2VYP A;  4DR5 K;  2BDP A;  4AH9 A;  3IFR A;  4N5S A;  3C94 A;  1KAY A;  1ZBF A;  1HQE A;  1JLB A;  2F7T A;  2OTL N;  4V19 S;  4MDA A;  3VEX A;  4OKK A;  3K59 A;  1XHZ A;  4PUO A;  4Y1C A;  2VG7 A;  5AZJ A;  4OVL A;  3TTF A;  4B9Q A;  2YHB A;  3VGK A;  2IS3 A;  1RT1 A;  3SYZ A;  4NLC A;  4DSE A;  3V81 A;  2Q36 A;  3MN5 A;  3VQ8 A;  4A61 A;  3L2R A;  4R79 A;  4ILJ A;  2G8U A;  4HTU A;  1Z26 A;  3LP3 A;  3SV3 A;  3VN5 A;  4B1Z A;  1W2B M;  4H4O A;  3WEE A;  4U7B A;  1QTM A;  2OA8 A;  4BGA A;  2V7Z A;  1VSL A;  2JWK A;  1DT9 A;  2P9P A;  1JLC A;  1FKP A;  3QIO A;  3HJF A;  4HWI A;  4JKD A;  1KFS A;  4NYF A;  1T44 A;  4Z0U A;  1WNS A;  4FWL A;  1LWC A;  4AHR A;  4AM6 A;  5JVG L;  3AAR A;  3S41 A;  1NK8 A;  3TAM A;  3V6D A;  3BF1 A;  4Z4E A;  2FBV A;  4PQU A;  3AAP A;  5BRH A;  3KZB A;  5MLC Q;  5EY4 A;  2F96 A;  4CGH A;  2AJQ A;  4BC4 A;  4LF6 K;  4CFC A;  4FM2 A;  4H03 B;  2F8T A;  3VEW A;  4C8N A;  1W7A A;  1M90 O;  2CGJ A;  4WYB A;  5AQK A;  1BUP A;  2YNI A;  3P38 A;  4FZX C;  4O8U A;  1P90 A;  4CIE A;  3AA4 A;  4HCB A;  1BHL A;  2BH1 A;  4JD2 A;  1RTI A;  2GEL A;  4DWI A;  2HMP A;  2RF2 A;  1D9D A;  5AJ3 K;  3L0Q A;  1DTQ A;  5AQG A;  1IKY A;  1IJJ A;  3HST B;  3O9R A;  3OBY A;  1TL1 A;  1R59 O;  4YDU C;  4CJF A;  3CPW M;  1LOT B;  4O44 A;  2VG5 A;  1QQN A;  4EAH D;  4CE9 A;  4AHC A;  4FWS A;  4WQ4 C;  3KK1 A;  3CJ1 A;  4B9L A;  3WQT A;  3ZEU B;  3O1B A;  4JS5 A;  1A5X A;  3HM9 A;  2IVN A;  1S1W A;  2FBY A;  3RVC A;  4CGG A;  5AZI B;  3CCV N;  1RDB A;  4H0X B;  1NNE A;  3IMX A;  2JWL A;  3O08 A;  1HPM A;  1RBT A;  3VEO A;  5HRN A;  4CJT A;  1GLC G;  5JMV A;  3MED A;  4K8Z A;  2E20 A;  2ZGZ A;  4LF7 K;  1QQC A;  4LD0 A;  2NUB A;  4OLB A;  3QB0 A;  1EET A;  1C0G A;  2WFB A;  4CF0 A;  1IBM K;  2Q2R A;  4FYD A;  4H0T B;  4KI4 A;  4C8M A;  4BGB A;  4CJ3 A;  2KTQ A;  2G8H A;  4DQP A;  3R3L A;  4PKG A;  1OKJ A;  3KWI A;  1W9H A;  4CEC A;  3C65 A;  5AZJ B;  4NLB A;  4BR9 A;  4Z4H A;  3BGR A;  4B9U A;  1EO1 A;  2P9L B;  2GEM A;  3LAM A;  3L2W A;  4KHP K;  4CGF A;  4JI2 K;  5KRT A;  4KO0 A;  4JNE A;  3HM8 A;  3VQ7 A;  1HYZ A;  4CED A;  3O80 A;  5AZI A;  3V9U A;  1RT2 A;  2ZE2 A;  1VSF A;  3OYF A;  1D5A A;  1K9M O;  3HOT A;  5AFU H;  3IG1 A;  4WE1 A;  2RPI A;  3K9K A;  3CQ8 A;  4E0D A;  1B9F A;  4DUY K;  4CZJ A;  2Z1I A;  3BP8 A;  3R9P A;  5J2M A;  5GAE P;  4BQL A;  3D7E O;  3CF5 L;  2O4G A;  2QXL A;  1R0A A;  5GAG P;  3RRH A;  3SAG A;  4M3T A;  1NGD A;  1KAX A;  2FBX A;  2NRT A;  3SCX A;  1NGA A;  1G15 A;  2QXF A;  4FK2 A;  5H1S Q;  3DLK A;  1IH7 A;  4CGJ A;  1N5Y A;  3WXM B;  2NRH A;  4CF8 A;  2QWL A;  4E7L A;  5AQI A;  3MCA B;  2P5G A;  1VAZ A;  1WSG A;  3E1Y A;  1MA9 B;  1YJW N;  4KHY A;  2XY6 A;  2WUS A;  4DV1 K;  5ADX H;  2E4L A;  1WSF A;  2PFU A;  2QWR A;  5KQ8 A;  3NFA A;  5ADX A;  3SPZ A;  3GBT A;  2P9I B;  3KWG A;  3SNN A;  1QSY A;  2D0B A;  2RN2 A;  3SLC A;  2A3Z A;  4HVJ A;  4JI4 K;  2OPR A;  2DPN A;  1K8K B;  4KKO A;  4FLU A;  3SUO A;  4IWV A;  3J7Y P;  3JAM O;  1JCF A;  2KW4 A;  1NLV A;  3OYG A;  5J2P A;  2VQF K;  3LP1 A;  3HVT A;  1ASV A;  3EL2 A;  3DLH A;  3I0R A;  1DLO A;  4CGI A;  1YHQ N;  4GV6 A;  1SKR A;  4GKJ K;  5KPT A;  4CZG A;  1NK4 A;  1ZBS A;  2J4R A;  4A5B A;  4BAC A;  1ZBI A;  4FJL A;  4M3W A;  3O9S A;  4LH5 A;  3ZX2 A;  4CJ5 A;  4M41 A;  2GV9 A;  3ZSZ A;  3FE1 A;  4BRC A;  3NH1 A;  5AQR A;  3OA9 A;  4K42 A;  4B3R K;  4JLH A;  3PIO L;  1JKH A;  4H5T A;  5AR0 A;  2NZT A;  4PKH A;  1NWK A;  3OS0 A;  3THW A;  1FXX A;  1T3V A;  2QWQ A;  4QOZ B;  2P5O A;  2D5R A;  3ZT0 A;  1VRU A;  4FSV A;  2HHW A;  5C42 A;  4JK7 A;  1RTH A;  1XNQ K;  4MFB A;  3TAB A;  4IXC A;  3FZL A;  3I0S A;  3VOV A;  4BG9 A;  3VES A;  3ZT2 A;  4CHY A;  5J1E A;  3MK6 A;  2O8E A;  4DV7 K;  3SZ2 A;  3TU5 A;  3WNH A;  3DXK B;  4TSX A;  3DOK A;  1YTA A;  1GOA A;  4BR0 A;  4JAX A;  1LW2 A;  4WFA L;  3O6W A;  4BRI A;  1TK8 A;  3DXK A;  4JKH A;  4OGE A;  5KGX A;  3VPZ A;  5D3G A;  3EKS A;  3A8Y A;  3OYN A;  3ALY A;  3SBG A;  3CM5 A;  4BRP A;  4FW2 A;  1SL0 A;  1J5E K;  4HUE A;  2ATQ A;  5J2Q A;  4E3S A;  4BQZ A;  5JS1 A;  4AHU A;  4YOV A;  4DSI A;  4DTX A;  3THW B;  4YFU A;  4ID1 A;  4M3R A;  4CZE A;  1XQS C;  1JCE A;  5AQX A;  3OS2 A;  5JVH L;  5C12 A;  3NMU A;  3ZSO A;  3HRG A;  1KLN A;  4FK0 A;  1Y64 A;  4FVM A;  2AA4 A;  3KJV A;  3K58 A;  1W97 L;  3H3N O;  4BRO A;  2Y1J A;  4C23 A;  2HNY A;  4B9S A;  1EWR A;  3CME N;  2FLO A;  3VGM A;  3OYD A;  2E2N A;  4KHW A;  4HUG A;  1KLM A;  4KRF A;  3AVI A;  3MX2 A;  1XMQ K;  1XC9 A;  4LY7 A;  3AVM A;  4AHV A;  4IO8 A;  3PV8 A;  3NAE A;  3S3M A;  4BE1 A;  3V4I A;  1KVC A;  4H0V B;  3U9D A;  3HBT A;  2P1J A;  3D2E A;  5AQS A;  2QKK A;  4Y0W A;  4JYA K;  3PIP L;  1KCF A;  3BY5 A;  3UKR B;  3AVC A;  1N6Q A;  1ATR A;  3AY9 A;  1HNZ K;  1IG9 A;  1TKX A;  2G8V A;  3GDQ A;  4AF1 A;  4O8K A;  3H08 A;  3RMB A;  2KZZ A;  5DK5 A;  2W41 A;  3EE8 A;  3O3F A;  4OPK A;  2GBZ A;  2P9N B;  1NKC A;  5C10 A;  3T7Z A;  3VQQ A;  3ZT3 A;  3OYH A;  1N36 K;  3HPO A;  1U2V B;  1FK9 A;  1BOT O;  3RMC A;  2Q0R A;  3L3U A;  3MN7 A;  3PO4 A;  3WXJ A;  4MLH A;  4WQ4 A;  4BRK A;  4XIU A;  1WN7 A;  3G0Z A;  2G8F A;  5JS2 A;  1RDC A;  4HTL A;  2YX6 A;  3SAH A;  4IG0 A;  3ZYY X;  4CZL A;  3C6A A;  2HHU A;  4Q5V A;  3DJC A;  1YVN A;  3WUH A;  1ESV A;  3ENB A;  3THY A;  3TTD A;  4DV2 K;  1VSJ A;  4OKJ A;  2P9U B;  3SJJ A;  1NMN A;  1VSM A;  1I94 K;  3EYZ A;  3DM2 A;  4Y1D A;  4CJK A;  4DFJ A;  2GUP A;  3TSU A;  1REV A;  4KTZ A;  3A5L C;  4EP5 A;  3LM2 A;  1KD1 O;  1GLB G;  1K6Y A;  3WNF A;  4DLG A;  4JKG A;  3OJS A;  2BE2 A;  1XNR K;  1NGF A;  2FC0 A;  4GNI A;  1NKE A;  4FWR A;  3T1A A;  3ENO A;  4IOA L;  2YI1 A;  4PL7 A;  4F4K A;  3NE6 A;  3EO3 A;  4Q0B A;  2PZS A;  1RCH A;  2W40 A;  2GX9 A;  3K5M A;  4JI6 K;  3NDK A;  4H5V A;  1RBV A;  2LSN A;  3V9S A;  3AVL A;  1D8Y A;  1BGX T;  2ETJ A;  5DMR A;  1SV5 A;  2F8S A;  2DY4 A;  1NGJ A;  2PAV A;  3SV4 A;  2ZD1 A;  3CET A;  1NGG A;  4DR7 K;  3KLF A;  4J2D A;  3TPQ A;  1VHX A;  3D2E B;  2ASP A;  2O8F A;  4FLV A;  2HF3 A;  4GV3 A;  4G1Q A;  4LFB K;  3TAE A;  5BRE A;  4FWP A;  4NCB A;  1TYQ A;  1RT4 A;  3LDQ A;  1P8Z A;  3MXI A; 
#chains in the Genus database with same CATH homology
 1BCO A;  5CYM A;  2YNI A;  3OYI A;  4FZX C;  2P51 A;  3LAL A;  4CIE A;  2HW3 A;  3AA4 A;  4HCB A;  4CES A;  3VQ6 A;  1YTU A;  1EXQ A;  1BHL A;  2KFZ A;  3TAR A;  3P83 D;  1RTI A;  4DWI A;  3VQ4 A;  5HRO A;  4K8X A;  2RF2 A;  4OPJ A;  3JSM A;  3THV A;  1D9D A;  1DTQ A;  4J2B A;  3VA3 A;  1IKY A;  4M3U A;  3FFI A;  3HST B;  1X9S A;  4IBN A;  4DTR A;  1TL1 A;  3KKR A;  4GW6 A;  3KLG A;  4FCY A;  3OYC A;  1TV6 A;  1TK0 A;  4CJF A;  3G10 A;  1S9E A;  3JYT A;  3QEV A;  5I3U A;  1C0M A;  3PUF A;  4O44 A;  2VG5 A;  4LSL A;  3HVR A;  3QET A;  2HMI A;  4FJH A;  3HT3 A;  4CE9 A;  4ID5 A;  4AHC A;  3KK1 A;  4YNQ A;  4B9L A;  1S1V A;  4E1N A;  1JLG A;  1JLE A;  4E7K A;  1U45 A;  1RNH A;  3MXM A;  4J2E A;  4JS5 A;  1A5X A;  3C95 A;  3HM9 A;  1S1W A;  2FBY A;  3MEE A;  3RMA A;  4CGG A;  1U47 A;  4FXD A;  1JXE A;  1RDB A;  3RTV A;  3AA3 A;  3SI6 A;  1WSI A;  3NF8 A;  1QSS A;  4B3O A;  1RBT A;  4QAG A;  5HRN A;  1F21 A;  3M8S A;  1B9D A;  4CJT A;  4N41 A;  3M8P A;  1RT5 A;  3MED A;  4K8Z A;  2KZZ A;  1TKD A;  2YHA A;  4B9T A;  1QQC A;  2DFF A;  4CEO A;  1C1B A;  4EP4 A;  4LD0 A;  1NOZ A;  1BI4 A;  1GOC A;  2X6N A;  1KTQ A;  3ZT4 A;  2KQ2 A;  2NUB A;  3ZCM A;  2W42 A;  1Q9Y A;  4KTW A;  5K14 A;  1U49 A;  2OYQ A;  4HCC A;  3ZSY A;  2XY8 A;  4OLB A;  3LP0 A;  1CLQ A;  1NK6 A;  4CEZ A;  2YNF A;  1EET A;  4FYD A;  3KIO A;  3NGY A;  4CF0 A;  4F2R A;  4KI4 A;  3VQA A;  1YVU A;  3QO9 A;  4C8M A;  3NH0 A;  1UA1 A;  4CJ3 A;  4ELT A;  3TR8 A;  2DFH A;  3AO2 A;  2KTQ A;  3ZSW A;  2G8H A;  3VQ5 A;  4DQP A;  4FK4 A;  1WSE A;  3AA2 A;  3ITH A;  4M42 A;  4CJS A;  4CHP A;  1EX4 A;  2EHG A;  3RWU A;  1L3S A;  5FRM A;  1W9H A;  3OY9 A;  4CEC A;  3KK3 A;  4Z4H A;  4B9U A;  3BGR A;  2OPQ A;  4CEA A;  4FJN A;  5E41 A;  3V9Z A;  1A5V A;  4ELU A;  5FDL A;  5HRR A;  3ZSX A;  4DTO A;  4OLA A;  3LAM A;  4CK2 A;  4CIF A;  3L2W A;  4CGF A;  3C6T A;  2VWK A;  2Y1I A;  1X1P A;  2DFE A;  3NBP A;  4E19 A;  3PO5 A;  2JLE A;  3MXJ A;  5KRT A;  2G8I A;  4KO0 A;  3QNN A;  3LZJ A;  3AVA A;  3NCI A;  1XWL A;  1S6Q A;  5CZ2 A;  3VQ7 A;  1HYZ A;  4CED A;  3NH2 A;  5FRO A;  3V9U A;  1JLQ A;  1RT2 A;  2ZE2 A;  3AO5 A;  3V1R A;  1RT6 A;  1VSF A;  1EP4 A;  3OYF A;  1D5A A;  3HP6 A;  4CF2 A;  4DSL A;  1Y97 A;  2BGG A;  2O4I A;  3AVJ A;  4ZHR A;  4DSF A;  1JL2 A;  3IG1 A;  4O55 A;  4WE1 A;  1IKV A;  3SQ4 A;  2RPI A;  4ELV A;  1JL1 A;  4I7F A;  3CQ8 A;  3LP2 A;  3SPY A;  1BI4 B;  4E0D A;  1B9F A;  1C6V A;  1LV5 A;  2YNG A;  1HPZ A;  4DF4 A;  2Z1I A;  4FM1 A;  5J2M A;  1IKW A;  3UIQ A;  3TAN A;  1I3A A;  3M8R A;  2O4G A;  1R0A A;  3RRH A;  3RMD A;  1TKT A;  4M3T A;  3U6F A;  2KFN A;  3LPU A;  2FBX A;  4JRP A;  4RW7 A;  3SCX A;  1S6P A;  1G15 A;  2QXF A;  4BWM A;  4CEQ A;  4FK2 A;  2XO7 A;  1UWB A;  3HO1 A;  2G8K A;  3DLK A;  1IH7 A;  4CGJ A;  4Z4C A;  3OYM A;  1N5Y A;  4CJQ A;  1HYS A;  4CK1 A;  4IFY A;  4CF8 A;  1RTD A;  4E7L A;  4FJK A;  4KI6 A;  3DLE A;  2P5G A;  5CY4 A;  3SQ0 A;  4JRQ A;  1WSG A;  4M45 A;  4KHY A;  4IDK A;  3QES A;  3HYF A;  4W5O A;  2XY6 A;  3ISN C;  2E4L A;  4B9M A;  1WSF A;  2FBT A;  3CFR A;  3A2F A;  2HHV A;  3MEG A;  4N47 A;  2G8W A;  2D0C A;  1FKO A;  3NFA A;  4CFA A;  4R5P A;  2OZM A;  3SPZ A;  2QKB A;  3S3N A;  1T8E A;  4E89 A;  3OVN A;  3SNN A;  3LAN A;  1QSY A;  1HMV A;  2D0B A;  2RN2 A;  1NOY A;  3PX4 A;  2A1S A;  3DI6 A;  4KFB A;  1KFD A;  4DU1 A;  4HVJ A;  1BCM A;  4PA1 A;  4DTN A;  2OPR A;  3L3V A;  3HPH A;  1ZBL A;  2XRI A;  4PWD A;  4KKO A;  4FLU A;  4LH4 A;  4H8K A;  1TVR A;  3EY1 A;  4E1M A;  3SUO A;  4DSK A;  4C8L A;  2R7Y A;  4DQQ A;  1MU2 A;  1RTJ A;  2KW4 A;  2HNZ A;  3OYG A;  5J2P A;  1VSK A;  1TAU A;  1T03 A;  3LP1 A;  1CZ9 A;  2E6L A;  1UOC A;  3HVT A;  3IS9 A;  1ASV A;  1BIS A;  3V9W A;  1C0T A;  1RBS A;  3LWL A;  3LPT A;  1GOB A;  4RW9 A;  3DLH A;  3I0R A;  4FJX A;  4ICL A;  1DLO A;  3C6U A;  4CGI A;  3S3O A;  3K2P A;  4QCL A;  4FJ5 A;  4IG3 A;  3AO3 A;  3KLI A;  1SKR A;  1WAF A;  3MEC A;  3OJU A;  2XY5 A;  3ULD A;  4CJU A;  3U3Y A;  1Q9X A;  1W0H A;  2B4J A;  1T7P A;  3O3H A;  4KAZ A;  4BWJ A;  2OPP A;  1NK4 A;  1I39 A;  4DTU A;  4BAC A;  1ZBI A;  4FJL A;  4MQ3 A;  4DU4 A;  2YNH A;  3ZSV A;  3KTQ A;  1T05 A;  4KHQ A;  3TI0 A;  4M3W A;  1IKX A;  4LH5 A;  2BAN A;  3U3G A;  5KTQ A;  2PYJ A;  1RT3 A;  1QHT A;  4CJ5 A;  1NK0 A;  4M41 A;  5KGW A;  2GV9 A;  3ZSZ A;  5HRP A;  4N56 A;  1SKW A;  3NF7 A;  3NH1 A;  2YKN A;  1VSD A;  3TAF A;  1BIU A;  1CZB A;  4JLH A;  3F9K A;  2IAJ A;  4O0J A;  2HVH A;  1UA0 A;  1JKH A;  3LAK A;  1LWF A;  1BL3 A;  3ZSR A;  1NK9 A;  4F8R A;  1VRT A;  5HRS A;  3P5J A;  4CHZ A;  1NK5 A;  1NJZ A;  3OS0 A;  1FXX A;  3PY8 A;  4HHT A;  4CK3 A;  3MAQ A;  3VQE A;  3ZT1 A;  2P5O A;  4QOZ B;  4FLT A;  2D5R A;  3ZT0 A;  1VRU A;  3OS1 A;  2I5J A;  4UQG A;  1Z25 A;  3VA0 A;  4AIL C;  3PX0 A;  4J2A A;  5C42 A;  2HHW A;  1RTH A;  3K5O A;  3O4N A;  5EU7 A;  4ZTF A;  1XI1 A;  4CEE A;  4MFB A;  4DG1 A;  4FZZ A;  3TAB A;  1QSL A;  1ASU A;  3OYA A;  3I0S A;  4FLW A;  2YKM A;  5HBM A;  4O4G A;  3ZT2 A;  3QIN A;  2IC3 A;  4CHY A;  3NGZ A;  3O3G A;  3PX6 A;  1TK5 A;  5J1E A;  1WAJ A;  5T7B A;  3SZ2 A;  1RDD A;  3DLR A;  3WNH A;  4DFP A;  4TSX A;  3DOK A;  3SUQ A;  1YTA A;  4KB1 A;  3NGI A;  4I9Q A;  1GOA A;  4CFB A;  1LW2 A;  4CHO A;  4FW1 A;  4O0I A;  1O1W A;  5CZ1 A;  4AHS A;  4M3X A;  3QLH A;  3TWH A;  4M3Z A;  1TK8 A;  1HQU A;  4E7H A;  2IDO A;  2RKI A;  4OGE A;  5KGX A;  4RW4 A;  2D0A A;  4C8K A;  5D3G A;  5C25 A;  1SUQ A;  4F3O A;  4BDZ A;  1X9M A;  2Z1H A;  3M8Q A;  3QEW A;  3OYN A;  3ALY A;  2X78 A;  4CF1 A;  4FJ9 A;  2HVI A;  3CM5 A;  1C1C A;  1RT7 A;  3ASM A;  3DLG A;  1UAX A;  2ITG A;  3WNG A;  4W5R A;  3BDP A;  4KPY A;  4FW2 A;  4N76 A;  1SL0 A;  3KD5 E;  4HUE A;  2ATQ A;  4FLX A;  4DMN A;  3AVF A;  5J2Q A;  4E3S A;  3SUN A;  3OYK A;  5JS1 A;  4AHU A;  5CYQ A;  2Q3S A;  4CCH A;  4DSI A;  2HND A;  3WNE A;  4DTX A;  2PYL A;  4CEB A;  4YFU A;  1CXQ A;  4ID1 A;  3SUP A;  2E6M A;  4KHS A;  4LSN A;  4M3R A;  1S9G A;  4RG8 A;  3RRG A;  3OS2 A;  3KLE A;  4I2P A;  4W5Q A;  3ZSO A;  1TAQ A;  1JLA A;  4DS5 A;  2EX3 A;  3CM6 A;  1KVA A;  1KLN A;  4FM0 A;  4FK0 A;  1X9W A;  4CJV A;  3L2V A;  4H4M A;  4FVM A;  3T19 A;  1KSP A;  3KJV A;  3K58 A;  2HHQ A;  1C0U A;  1S1U A;  3QER A;  1RBU A;  3S9H A;  4L8R B;  1LAV A;  1RIL A;  4F3T A;  2PY5 A;  3K57 A;  2Y1J A;  1S1T A;  4I9L A;  2HNY A;  5HP1 A;  3TAP A;  3CG7 A;  1SKS A;  3DOL A;  4B9S A;  2XHB A;  3L8B A;  5KRS A;  3OYD A;  3RR8 A;  3AA5 X;  3OYL A;  3KK2 A;  2HB5 A;  4DQI A;  4KHW A;  4CJ4 A;  3KKS A;  1NJY A;  3V1O A;  1ZBH A;  4HUG A;  1KLM A;  4KRF A;  3AVI A;  3F73 A;  3NHG A;  1LWE A;  2Z1J A;  4CHQ A;  3AVB A;  1XC9 A;  2XY7 A;  4LY7 A;  4GMJ B;  3D0P A;  4BDP A;  3AVM A;  3LZI A;  4AHV A;  1L5U A;  2HHT A;  3QNO A;  1RBR A;  1QS4 A;  4FLZ A;  1KVB A;  3NAE A;  3V9X A;  4E7J A;  3PV8 A;  3P1G A;  4BE1 A;  1CXU A;  3T3F A;  3V4I A;  3K5N A;  3S3M A;  1DTT A;  1KRP A;  1KVC A;  1ZBU A;  3AO1 A;  3LDS A;  3DMJ A;  1WLJ A;  3NF9 A;  1L3U A;  1RDA A;  4BE2 A;  2P1J A;  3OYJ A;  4BE0 A;  3DYA A;  1Q8I A;  4M3Y A;  3DLB A;  4CJR A;  3SQ1 A;  2QKK A;  4DLE A;  3K5L A;  2DTU A;  4FJM A;  1KCF A;  2VWJ A;  3CFP A;  3HP9 A;  3TAG A;  5I42 A;  3AVC A;  4RW6 A;  3TAQ A;  1N6Q A;  2QK9 A;  1HNV A;  4F2S A;  2IGI A;  1JXB A;  3B6O A;  1IG9 A;  4CEF A;  4B9V A;  1TKX A;  3AVG A;  1U48 A;  2G8V A;  2A1R A;  4NCG A;  3H08 A;  4CGD A;  4GVM A;  3RMB A;  3AVH A;  4DU3 A;  5DK5 A;  3RR7 A;  4CER A;  4DFM A;  1TKZ A;  3O3F A;  3QEI A;  1HJR A;  2OZS A;  3AV9 A;  1BIZ A;  4AHT A;  2YV0 X;  4DTS A;  4IKF A;  3IRX A;  4B08 A;  1VSH A;  3VQB A;  3VQC A;  3I8D A;  4KHN A;  2KZM A;  4B8C A;  4OPK A;  2GBZ A;  1NJW A;  4I2Q A;  1NKC A;  1TGO A;  1IO2 A;  4B8A B;  4CFD A;  3VQQ A;  3AO4 A;  4FZY A;  3ZT3 A;  3DRS A;  3OYH A;  3QIP A;  2B5J A;  2GUI A;  3HPO A;  4C8O A;  3L2Q A;  3ZSQ A;  1FK9 A;  3AVK A;  4W5N A;  4FJ8 A;  1ASW A;  3RMC A;  1ZYQ A;  1HNI A;  3L3U A;  4E7I A;  3B6P A;  3PO4 A;  3VQP A;  1D9F A;  1NJX A;  4OJR A;  1ITG A;  1NKB A;  2VG6 A;  2WOM A;  5SZT A;  4DQR A;  1J5O A;  4OKE A;  3CYM A;  1HRH A;  5KI6 A;  1WN7 A;  4XIU A;  1SL2 A;  1LW0 A;  1VSE A;  3G0Z A;  1A5W A;  1L3V A;  4DSJ A;  1TL3 A;  1XHX A;  5JS2 A;  1RDC A;  4CF9 A;  4CIG A;  1BQN A;  3OYE A;  2G8F A;  3KD1 E;  3AVN A;  4Z4G A;  4KHU A;  3NF6 A;  4DS4 A;  5J2N A;  1WSH A;  3QEX A;  4CJP A;  4KRE A;  3SQ2 A;  5C24 A;  1C1A A;  3E01 A;  2X74 A;  4IG0 A;  3EZ5 A;  3HPG A;  4DQS A;  5SWM A;  4DFK A;  4CHN A;  2HHU A;  4Q5V A;  3V1Q A;  4AH9 A;  2BDP A;  3IAY A;  4Z4I A;  2B6A A;  4N5S A;  3CFO A;  3C94 A;  2ZQB A;  4DTM A;  4JS4 A;  3QEP A;  1ZBF A;  1B92 A;  1VSJ A;  4OKJ A;  2WON A;  4RW8 A;  3SJJ A;  1HQE A;  1U4B A;  4FJI A;  1VSM A;  3DRR A;  1JLB A;  4FJG A;  3EYZ A;  3DM2 A;  5FRN A;  3D45 A;  4OKK A;  4Y1D A;  3K59 A;  4CJK A;  1XHZ A;  4PUO A;  4Y1C A;  2VG7 A;  4DFJ A;  4KB0 A;  4CJW A;  4KV8 A;  4NCA A;  3HL8 A;  1REV A;  4KTZ A;  4KTQ A;  4OVL A;  3O4Q A;  4CJL A;  1J9A A;  4B9N A;  1QE1 A;  2YHB A;  4NYN A;  4EP5 A;  2IS3 A;  1RT1 A;  1U04 A;  4DTJ A;  1VK0 A;  4BDY A;  4EZ9 A;  3SYZ A;  1K6Y A;  3WNF A;  4CJE A;  4DLG A;  4DSE A;  3OJS A;  2BE2 A;  3V81 A;  2FC0 A;  1VSI A;  3VQD A;  1NKE A;  3T1A A;  2HHX A;  3VQ8 A;  3L2R A;  2Z1G A;  4PY5 A;  4HUF A;  2G8U A;  4HTU A;  1Z26 A;  3LP3 A;  3SV3 A;  3VN5 A;  4DF8 A;  4F4K A;  4H4O A;  4W5T A;  1S1X A;  3NE6 A;  1S5J A;  4Q0B A;  2PZS A;  1WSJ A;  1QTM A;  1RCH A;  2OA8 A;  3HXM A;  4OGC A;  4EZ6 A;  3K5M A;  3NDK A;  4O5B A;  1VSL A;  3V9S A;  1RBV A;  2LSN A;  1J54 A;  2X6S A;  3DRP A;  3LWM A;  4FJJ A;  1JLC A;  1FKP A;  3AVL A;  1D8Y A;  1BGX T;  2HHS A;  5HLF A;  3QIO A;  3HJF A;  3HK2 A;  2ETJ A;  1KFS A;  4NYF A;  5DMR A;  1SV5 A;  2F8S A;  1LAW A;  2DY4 A;  3SV4 A;  1SL1 A;  2ZD1 A;  3KLH A;  1HYV A;  4Z0U A;  2JGU A;  1WNS A;  1LWC A;  4AHR A;  1BQM A;  3KLF A;  3VQ9 A;  4J2D A;  3L2U A;  4FLY A;  1NK8 A;  3TAM A;  3V6D A;  4PQU A;  4FLV A;  2FBV A;  2IOC A;  4Z4E A;  1J53 A;  1NK7 A;  1YT3 A;  4G1Q A;  2F96 A;  4CGH A;  2AJQ A;  4IFV A;  1JLF A;  4CFC A;  4FM2 A;  3TAE A;  2F8T A;  4FJ7 A;  4DTP A;  2OPS A;  4NCB A;  1EKE A;  4C8N A;  3OYB A;  1RT4 A;  4ZTJ A;  1L3T A;  3MXI A;  4Z4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...