1P90A

The three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
ERVPEGSIRVAIASNNGEQLDGHFGSCLRFLVYQVSAKDASLVDIRSTLDVALAEDKNAWRVEQIQDCQVLYVVSIGGPAAAKVVRAGIHPLKKPKGCAAQEAIAELQTVMAGSPPPWLAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords hypothetical protein
publication title The Three-dimensional Structure of the Core Domain of NafY from Azotobacter vinelandii determined at 1.8 A resolution
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 40
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1p90A00
1P90A 2RE2A 1T3VA 1RDUA 2QTDA 2KLAA 1EO1A 2WFBA 2YX6A 1O13A
chains in the Genus database with same CATH superfamily
1WSEA 4FJHA 2E2OA 2Z1IA 3P5JA 1J5OA 3MN9A 3DLKA 1U4BA 1IV0A 1RDCA 1E4GT 4IFEA 1JXEA 4IFYA 2ZQBA 3V4IA 1HKGA 2D4WA 2ZWHA 2YNIA 3U9DA 2ZJRL 1C6VA 3NMUA 2D0BA 1RBVA 2HBMA 3IG1A 4A62A 3KK3A 2B4JA 3E1YA 3KVGA 4FK2A 4OLAA 3SV3A 2G8IA 5KGWA 1YTUA 4LF4K 1J53A 3LP0A 2IDOA 2BTFA 2VYPA 3DAWA 3ZX3A 5BR9A 1HNIA 4C23A 1EP4A 4CVNE 4DU1A 3KD1E 1X9WA 3E9OA 1G99A 4CJSA 1N6QA 3DLLL 3D6RA 1VSKA 5AFUH 2G8HA 4Z4GA 4O0IA 4FJ8A 1EXQA 3DMJA 5K14A 3LAKA 1NK5A 3DI6A 4B1YB 1VRTA 3CQ8A 1EKEA 1TK8A 4Z4EA 3CF5L 3AARA 3AO2A 1JXBA 3G71N 4DR5K 4Z4HA 3VEWA 2HHSA 3DRSA 2P9SA 4FWOA 3H08A 4GKJK 5AQHA 2OPRA 1TVRA 5AZJA 5C12A 4FZZA 1HPZA 1TUYA 3E9LA 3L2UA 1KAXA 2RE2A 2Z1HA 1CXUA 1U47A 3AVCA 1T6CA 3K2PA 1HPMA 1XMOK 3AVFA 1RCHA 2E1YA 3NH0A 4ELUA 1YAGA 4J2AA 4M3TA 4CHYA 5M1FA 4B8CA 3ISNC 2F4VK 4CZGA 1DTQA 4OPHA 1RT2A 5BPLA 4OKKA 4Z4FA 3NDKA 3EE8A 1BI4B 4CEAA 3QIOA 3J7ZO 3QESA 2GWJA 2P9IA 4PQUA 4JRPA 4H4OA 3QINA 3V1QA 1BQNA 4CF0A 4FM0A 1IH7A 2A40A 4FSVA 1RFQA 4CFCA 3CCUN 1RT6A 4DQRA 2HW3A 4PKGA 2R7YA 1BA0A 3HJFA 5FPNA 4DCHA 1K6YA 3VEVA 1BISA 4JI6K 5AJ3K 3THYA 2HHQA 1J54A 1JLEA 1NJXA 2HHVA 1N32K 4CEOA 1QZ6A 2QW9A 4FWMA 4RCHA 3M5RA 2E5LK 1VSDA 3VEYA 3MWTA 2O8DB 1TUUA 2RHKA 4BDYA 3JYTA 2YCHA 4JN4A 3AV9A 3ZT3A 4KHUA 4GVMA 4DV0K 3LZIA 1YVUA 2QEXN 1S3XA 5C25A 3ZSWA 4JKGA 3CCQN 3PY8A 3OVNA 1JCFA 4JYAK 3CETA 3LWMA 3PSIA 2FC0A 4BDZA 3WQTA 1QHTA 1KVCA 1GLAG 3H6EA 4ISEA 4PKHA 2DFHA 3ASMA 1KQSM 2NRZA 2Q31A 4DB3A 3RMAA 2F9TA 5M1KA 3OHRA 3QB0A 3MXIA 1RBTA 3HL8A 4CF8A 1YJ9N 2DFFA 3PUFA 5JLFA 2X6SA 5EU7A 3HVTA 1T8EA 4DSEA 5DM6L 4MFBA 4BR0A 1RT1A 4WQ5A 1E4FT 4YY3K 4M3UA 2FLOA 4M3WA 5M1PA 3VEOA 3O9QA 1KFDA 5T7BA 4MLHA 2IIRA 3CD6N 4CZKA 4WE1A 4BG9A 2OPPA 1NM1A 4CBWA 4BRQA 4ICLA 4DG1A 2NRXA 3R6MA 3AVMA 4KPYA 2IVPA 3FFKB 3IFRA 1ATNA 3UKUA 2W41A 4H4MA 3DLGA 4CW7B 1DKGD 5KPRA 4FM2A 4MDAA 1Q18A 4BRGA 2HHTA 1V4TA 3HZ6A 4BRLA 4FCYA 3H3NO 2WC9A 4DV4K 4FLYA 2V52B 3S3NA 3VEXA 1OH7A 4FJKA 4EFHA 2O4GA 3P39A 4CCHA 3AA4A 3UE5A 4CBUA 2OYQA 4GKKK 1Z6RA 3IAYA 3RRHA 4OKJA 1YIJN 1FXXA 5MLCQ 2P9LB 4LSNA 4KO0A 1IKWA 4F2SA 1BU6O 3O9TA 5AQLA 3AA5X 4NCAA 3PLAA 2P9PA 1S1VA 1MWKA 2W6KA 3D45A 2ZJQL 1HNXK 4CGHA 2KFZA 2Q1NA 4KI4A 3KHYA 4RTFD 3NE6A 3PSFA 3U4LA 3OYNA 3WNGA 1ZYQA 1XC9A 4WQ4A 1YVNA 4IJNA 3QNNA 3HVRA 2GTDA 3MWPA 4JI2K 1RTIA 3Q7CA 3IUCA 3HSTB 4BRFA 5BRDA 1LOTB 3WNHA 4JKHA 3ZETB 1J9AA 1JKHA 1ATRA 2XRIA 3THXA 2Y1JA 1L5UA 5AQFA 3DXKA 2NUBA 2CGKA 3MX5A 1KFSA 1XMQK 3D2FA 5FPMA 3T3FA 4HTLA 3QEWA 2A1RA 4W5TA 3WXLA 3THVA 3SBTA 2FF6A 3NF9A 3KD5E 1NU0A 2AJQA 4BG8A 4FWQA 3L2RA 2I7NA 3HPGA 4EIAA 2UUAK 4H5TA 1BIUA 4JHDA 1C0MA 1NMDA 1CZ9A 2YKMA 2VGNA 3SV4A 4BWMA 2BGGA 5AZIA 3OY9A 1OKJA 5SZTA 4IXCA 1KLMA 2UXCK 1RTJA 1T7PA 3CCMN 2DPNA 2F9WA 1WSHA 3T1HK 3S9HA 4CHOA 1YXQA 3MECA 4NO7A 4KAZA 2YJEA 3RR7A 1ILYA 4JNEA 4BC4A 1T03A 2KZMA 2P9SB 3IDHA 2V51B 4JKBA 4EP5A 3OYKA 3SUOA 5AZJB 4BWJA 4IOXA 4IZ9A 2P9KB 3V9XA 3L2QA 3L2WA 2WONA 2IGIA 3GG4A 1ESVA 4CGGA 4H0OA 1E3MA 3O9SA 4X64K 4IO8A 2P1JA 5AFUA 1QVFM 4IFVA 1GLCG 4LY7A 3OS0A 1JCEA 3CCLN 2ASOA 1QE1A 3EE9A 3JAMO 4OX9K 3J8AA 5HL7L 4NYNA 4XH4A 4B1UB 4DHYA 4JS5A 3C6AA 4KBOA 4F9OA 3CC7N 3J81O 2D0CA 2HOEA 3VQBA 2P9IB 2D0AA 1VSIA 4BE1A 4RG8A 4W5QA 4JLHA 1Q8IA 2PZSA 4Z4IA 3SAGA 3FGUA 5HRRA 4CFDA 4J2EA 1KLNA 4DFMA 1SS6A 3MXJA 1GOCA 5B8HA 3RSEA 3CERA 4H0TB 1RTHA 4HVJA 2GUIA 4CIEA 2FBTA 3THYB 4B9NA 4AM7A 3ZYYX 4HUFA 4DV1K 1KSPA 4W5OA 3AVNA 3BUZB 1KTQA 3RTVA 3M6GA 5CYMA 5AQKA 4K42A 4BREA 3VGLA 4H5VA 2NLXA 4DSLA 1OH6A 2Q0UA 3AY9A 4DTUA 3M8RA 3PO4A 1TK0A 4B9UA 3CM5A 5M1OA 3U3YA 2QWNA 4JKAA 3VTHA 4K41A 1LWFA 4RWTA 4A5BA 3ZX0A 4E7HA 3SQ4A 4JKGB 3UKRA 2VG5A 1RBSA 3LWLA 4FJIA 5AQXA 2XY8A 3AAPA 3OBWA 4YOYA 4KREA 3AAQA 4FJ9A 4W5NA 4R5PA 4GV6A 4A61A 1C1CA 1X3MA 2QKBA 4M63C 5HP1A 3V6DA 5E26A 2FSKA 3CC4N 1ASVA 4GVEA 1YJNN 1CXQA 3WXMB 1ASUA 3KIOA 3ZLJA 5KRTA 3VA0A 5FROA 3I8BA 4FLZA 1Q86O 4N76A 1OVQA 1LAVA 4CGDA 5I42A 4FZXC 4FVUA 1ZBIA 1TYQA 3KK1A 3ULDA 2QWLA 1Z26A 1XC3A 1VQ5N 2Z1JA 2A5XA 2A6AA 3KTQA 3C6TA 4K8ZA 1NGDA 2H3GX 3DOKA 3P38A 4IEIA 3UKUB 4XIUA 3P1GA 4XEIA 3AO3A 3P31A 4BC3A 1U6ZA 4CJ3A 3OYIA 2ATQA 3VQQA 4IOCL 5AQIA 2E8AA 1ZXOA 3O9UA 4WCEL 1IO2A 2A1SA 3KKSA 2UYTA 4O5FA 1HLUA 4FOIA 4CJPA 4DR6K 4CD1A 2AA4A 3K5MA 1QQNA 3QFUA 3IKMA 2YKNA 5EVZA 4CF2A 3JXUA 4FWRA 3CQXA 2GV9A 4M45A 1K8KA 5GAEP 4DQIA 3VQAA 3NGZA 3HPOA 1VSMA 3ZSRA 2VQEK 1Y64A 3CJ1A 4FLWA 3TAEA 2CGLA 4ILJA 5F1XA 2P9PB 4YFUA 4GV3A 2PAVA 1QSLA 1Y97A 3AVAA 2Z1GA 1JLFA 3HRGA 1U2VB 2E6MA 1VSHA 4DTXA 3K0SA 2VG6A 1RT4A 4JRQA 1Q9YA 2KLAA 1IG9A 1EO1A 3BF1A 5HOOA 3OTOK 3DOLA 3IRXA 4E7IA 3RMBA 1UA1A 3CFRA 3O5BA 3VQ5A 2KQ2A 1RT7A 3TARA 1SL1A 3LDSA 2HHUA 1WSFA 1GOAA 2E6LA 3M8SA 4IDHA 1LV5A 1QSSA 5FLXO 4DR1K 1X9SA 3THXB 1GLBG 4CFBA 2O8EA 1C0UA 1IKYA 1NNEA 2EWSA 4KHQA 2QKKA 3R3LA 2ZJPL 3CFOA 1KCFA 3J80O 3D2FB 2HVIA 4AM6A 1TV6A 4DR2K 3ZT1A 3LPUA 4B3SK 4FJLA 4K43A 4R79A 1N36K 2DTUA 5DK5A 2F8SA 2FBXA 4YOTA 5BN9A 1S6QA 4IO9L 5JS1A 1S5JA 4CIFA 2LSNA 5CZ1A 1IBLK 1BCOA 1HYVA 4BR9A 2QA4N 3MN5A 4B3MK 3EKUA 4G1QA 1BL3A 3MK6A 4L3QA 5JMVA 3NFAA 5LJWA 3EN9A 3MMVA 4EAHD 4DTPA 3VQ9A 3VENA 3EKSA 3C6UA 4ID5A 2JLEA 4DFKA 1NK0A 3ZT0A 4MO5A 2PBDA 3MX2A 1N5YA 1ZBUA 1HMVA 1L3TA 2VWKA 1YT3A 3FR0A 2DFEA 4M7XA 1T3VA 1DT9A 4ZHRA 5GIOA 2DY4A 3L3UA 4C1NK 1NLVA 2UXDK 3QBWA 4YDUC 1ZBFA 1QSYA 3G10A 3V9UA 4KHPK 5GINA 2E1ZA 3M1FA 3AO5A 1WB9A 2XY7A 4CK3A 3NVMA 2P5OA 2YHXA 3CPEA 4BRAA 4XH1A 2YV0X 2YNFA 3EYZA 3EY1A 5LMUK 2EHGA 3B6PA 3AVIA 1D8YA 1T05A 5FRNA 1BQMA 2KFNA 1B9DA 1I94K 4A2BA 2HHXA 4DTMA 1RDUA 4CJ4A 3KLFA 5BR8K 3OYMA 4AH9A 3KLHA 4PUOA 3QMLA 3NAEA 3KK2A 2ASMA 4KV8A 1BG3A 1NGCA 3DLBA 4M42A 4GNIA 5JICA 4IBNA 4LH5A 4FJNA 3HOTA 3BZCA 4FJGA 1XNQK 1NJIO 1D9DA 4E89A 3RSEB 5J2NA 1TK5A 2KZZA 3A5MC 5BN8A 1I39A 2E4LA 4DTNA 3MXMA 3O4QA 2QWQA 3TABA 1U48A 2KHOA 5C15A 4QS7A 1I3AA 3O08A 3ZSVA 4LD0A 4DFJA 1W0HA 3ZSOA 4F4KA 3AVGA 4JI7K 3WXKA 2BUPA 1NGBA 5KTQA 2Q0RA 1WOQA 3SUNA 3A5OC 1WSIA 1UWBA 2FBVA 1W2BM 4FJ5A 1LW0A 4FJXA 4IG3A 3AGKA 3BF3A 3SJJA 1NBWA 3TR8A 1A5XA 3MDQA 4CZLA 4KHWA 1A5VA 1RGIA 1J5EK 2JGUA 3UKRB 2X74A 2BE2A 4JEPA 4B1ZA 2Q2RA 4BVPA 1U04A 4FLUA 1W97L 4BRKA 3WNFA 4HCBA 1MDUB 1WNSA 1EETA 1NK7A 2P9UA 3LDPA 5FPDA 3CQYA 3SYZA 1JL2A 4M3RA 4B9MA 3OYHA 3K5OA 1W7AA 4AHRA 1KVAA 4AHTA 2WUSA 3LDQA 3ZT2A 4H5NA 1NKCA 4NXNK 2OPQA 1YTAA 4DQ8A 3O3HA 4BR7A 5TKWA 1FK9A 3LM2A 2NRTA 3HM8A 1VSEA 3H1QA 3TWHA 5E41A 1JLBA 2HBLA 4ILHA 4WQ4C 1TYQB 4HUEA 4YOVA 3E01A 4CZFA 4CI6A 3VTIA 3L8BA 3RVCA 2NRWA 3OA9A 4CEFA 4JI3K 1EX4A 4CJEA 4BR4A 1SQKA 4H8KA 2XY5A 4E7KA 2FSNA 2NRVA 3I56N 1BIZA 4H5WA 2CGJA 4KTZA 3VF4A 3Q7BA 1WSGA 4B1XB 3CCEN 1O1WA 1C0GA 4KHNA 1WUAA 2YJFA 2O8BA 3LZJA 4ZTFA 4LF6K 1BUPA 5LL6Z 1RTDA 4B9VA 2HF4A 2NRHA 4PL7A 1NKEA 1S9EA 4FLXA 3ALYA 1D9FA 3ULEA 3G6EN 1REVA 1QVGM 4AF1A 3LDLA 4JKDA 1Z05A 4IEEA 3CXCM 2HMIA 4N56A 1HUXA 1K8KB 4FO0A 4V19S 2KTQA 1BDGA 1ASWA 1LAWA 3SLCA 4N47A 1LW2A 4NXMK 3K5NA 2G8WA 2P9NA 4CIGA 1FKOA 3HOSA 5AQTA 1YF5L 4RW7A 5J2PA 4FK4A 3VF2A 5CZ2A 2W42A 4CJ7A 3CJ7A 2OTJN 3JS6A 4GY2B 4AILC 3DLHA 5C42A 2RN2A 3O9RA 5KQ8A 2Q36A 3DLRA 3THWA 4O0JA 3R1XA 4ILGB 3OYEA 1WAJA 4E3SA 3QEPA 1P90A 4FPBA 2IAJA 4KRFA 3HI0A 4JAXA 2UUBK 1XQSC 4JK7A 4JI1K 1EWQA 1ZC6A 4W5RA 3SMPA 3E9PA 5M1NA 4B9LA 3SQ0A 1P8ZA 5JVHL 5CYQA 3UB5A 2O8EB 1Z25A 4C1NI 5LMNK 1NK4A 4WFAL 3T1YK 4AHVA 3LDNA 4OJRA 2KKZA 5KRSA 4FJMA 3M8QA 3O3GA 3OW2M 1S9GA 4KH6A 3T1AA 5HRSA 2WBNA 4NB4A 4Z0UA 2D5RA 5HRPA 4FWPA 2VCPA 5GAGP 4F8RA 3QEXA 1GOBA 3T7ZA 3SUQA 4AQYK 4DTJA 4QCLA 1QQOA 2VQFK 4E1NA 4CHPA 4FK0A 4CZJA 5KPTA 4E7JA 2O4IA 4E0DA 3TI0A 3I55N 1Q9XA 2P51A 2NNWA 1KD1O 3SPYA 3OYBA 3U3GA 3F73A 1JLQA 5AQSA 4I9QA 4CEEA 4B3TK 4IOAL 2UUCK 3K5LA 3F5TA 2BH1A 5LY3A 4M7YA 3OJSA 1VQKN 4EZ6A 4PY5A 3ZEUA 4YOUA 4CF9A 3OYCA 4DF4A 4B1VA 1LWCA 4OO1J 1RILA 5AQMA 1ZBHA 1VAZA 4CJ5A 5EY4A 1NK8A 1GLLO 4AHCA 3QNOA 4O8UA 1K73O 1SKSA 4E19A 3MEDA 2OCEA 2QK9A 2ZGYA 3SI6A 5J1EA 5IT9O 1VQLN 4N5SA 1CLQA 5EX5A 3C65A 1IKVA 5F2RA 3FZMA 3HO1A 3F2KA 4B9SA 2QWRA 3HSCA 4CBXA 4N41A 3WEEA 3VERA 2HNZA 2HSTA 4KH4A 3TTFA 4ZTJA 1L3VA 2HF3A 5EXWA 1J6ZA 1RNHA 1XHXA 4FWKA 4O8KA 1TKZA 4EHUA 3F9MA 3W0LA 3WXJA 1TGOA 4FWSA 4FZYA 2X6NA 4KTQA 5C24A 4AHSA 4LFAK 4MQ3A 2IVNA 4CZEA 4CJUA 5BPNA 2YI1A 2X78A 3WXIA 2BDPA 1NGHA 4DV2K 3G25A 3H45C 1NWKA 3NBPA 4CEQA 4H03B 2OTLN 3QETA 1X9JA 3HBTA 1NJZA 3A2FA 3VGKA 4DU3A 4DV7K 4CERA 3ATVA 4NYFA 4BGBA 1D5AA 2YNGA 1XHZA 3TSPA 2A41A 1HX1A 1BWFO 1RT3A 1HYZA 3OYDA 4U7BA 4KI6A 5JS2A 3V9ZA 3BDPA 2OZMA 4DSIA 2V7ZA 2QM1A 3QLHA 3G4SN 4BR2A 3V1OA 4JK9A 4QS9A 4BR5A 1XNRK 3LP3A 3FZHA 2Q97A 1XI1A 3K59A 3CCJN 1IG8A 2P9UB 2YNHA 5BRHA 1SV5A 3SQ1A 3QO9A 3VEZA 4BRDA 4GV9A 3SAFA 1VQ4N 3CJAA 4BE2A 4PKIA 4JK8A 5C10A 1SAZA 5F0XA 4Z4CA 1F21A 4DKWA 1VQ8N 2QWOA 2CH5A 4PHTX 2HHWA 4JI4K 1SKWA 5DM7L 1FKPA 1RT5A 1OH8A 4RW6A 1TKXA 1U45A 3AVLA 4DSKA 3NCIA 3CIPA 1SUQA 3B6OA 3P83D 4XH5A 3BP8A 4CGJA 4ELVA 3KK7A 3CCSN 4LH4A 1YJWN 3TPQA 1BO5O 4PA1A 1NGJA 4IDKA 3VESA 2O8BB 4QS8A 3O80A 5C2FA 4CHQA 1RBRA 4OPAA 4CHNA 2YX6A 1BHLA 5KI6A 1M1KO 1LWEA 3OYJA 3KZBA 1OH5A 5TKYA 4C8LA 2QI2A 4BC2A 4CEDA 2ZF5O 3ULEB 2RKIA 4H0XB 3F9KA 2OPSA 3IS9A 1WBDA 5GIPA 2QWMA 4MO4A 1K8AO 4ELTA 4M3YA 4JD2A 5KPZA 4M3XA 4FLTA 2G8UA 1NGIA 1TL3A 3QIPA 3VQDA 2P9NB 4DU4A 2AP1A 4LFCK 2PFUA 1GLFO 4WFNL 3A0IX 3A5LC 2G8VA 4BC5A 4A57A 1MWMA 2ASPA 2GUPA 5GADP 3CMEN 2IOCA 1L3UA 4WYBA 3NVKA 1QHAA 1GLJO 1O13A 2KW4A 3NHGA 2XY6A 5D3GA 3THWB 3GL1A 1CZBA 1SZ2A 2RF2A 3AA3A 3VOVA 4K8XA 1R0AA 2B5JA 2Y1IA 3DXKB 4CJKA 4FJ7A 4UQGA 1NGEA 5JVGL 1S1WA 3V9SA 3L3VA 3H3OB 3TTDA 2E20A 5BPMA 2OANA 3MN7A 1C1BA 4WF9L 4DF8A 4ISFA 1N8RO 4BDPA 3TTCA 4LF8K 4CJTA 5HLFA 4OLBA 4CF1A 3WT0A 1K9MO 1JLGA 3HYFA 4J8FA 3OYLA 3PX0A 1H1VA 3QERA 4NCGA 2E2QA 4C8NA 3S3OA 1Q7YO 3CFPA 4DV5K 2VWBA 3LP1A 4O44A 4M41A 1TAQA 3BZKA 3TSUA 4KH5A 4J2BA 5M1QA 3C94A 4FL9A 4JHDB 1GLEG 2OA8A 4YNQA 5AZIB 3MAQA 3NH1A 1JLCA 5KQDA 1OVYA 3WQUA 1SL0A 4BY9C 3O8MA 1N33K 5FPEA 4B9QA 1HQUA 3JSMA 5AR0A 3C0BA 3OYFA 4DSFA 1DGKN 4E7LA 2IC3A 3U6FA 3AO4A 4E1JA 5ADXH 4CE9A 1UOCA 1M90O 1NGFA 1VRUA 2XHBA 4O4GA 2HNYA 5J2MA 3SBGA 4OPJA 1G15A 3ZEUB 3OYGA 1B9FA 4HUGA 4OKEA 4DWIA 1KAZA 4CJRA 1ZBLA 1NGGA 2P9KA 4J2DA 3CJBA 5AQJA 3FZKA 2IVOA 1MA9B 1NG9A 4CJWA 3KJVA 4IWVA 3DJCA 5AQPA 3ZX2A 4WFBL 4A2AA 3SZ2A 3TAFA 3BY5A 4KFBA 3NF7A 3DXMA 5BRFA 3D7EO 4BQLA 4DS5A 3VQCA 3OYAA 4DMNA 4DTRA 4H0VB 2BANA 3R8EA 3WEEB 3OBYA 1DTTA 2CH6A 4I9LA 4G9ZA 3TAQA 3QBXA 1ATSA 2HBKA 3ZSZA 4JI5K 3C7NA 5GAHP 1WLJA 3B8AX 3EZWA 5IWAK 4WQ5C 3P4IA 3VQ7A 1GLDG 3HT3A 4RW9A 3LDOA 4I6MA 4TSXA 2O8CA 1UA0A 3U8XA 3TAPA 1RDAA 3CM6A 1S6PA 2PYLA 1KVBA 1Q81O 2FBYA 1N34K 3ZSXA 2NZTA 4DLEA 5AQWA 2HBJA 4CEZA 3LM9A 1HR0K 3PO5A 1BCMA 1A5WA 4FW1A 3AVHA 3OJUA 3J7AP 2PY5A 3W3DA 3SUPA 4HWIA 1TL1A 2YHWA 1C0FA 4HCCA 3E66A 3CHWA 2ZGZA 4LF7K 4F3TA 3LALA 4Q5VA 2P5GA 3AVBA 4H0YB 4DV3K 3QFPA 5EOYA 4LC9B 5HROA 3LAMA 4YDUA 1W9HA 4YOWA 3C95A 3DRPA 3GOIA 3KLIA 4E1MA 1XWLA 3L2VA 1ITGA 1KC8O 4RW8A 4L8RB 4NCBA 2WOMA 3VQPA 3AGRA 2UU9K 4I2PA 3C6HA 3J7YP 2GELA 4BRIA 1L3SA 2J4RA 4CJVA 3QEVA 3O6WA 5LJVA 2OZSA 3BEXA 2E88A 1YI2N 2HB5A 4FXDA 1BA1A 4YORA 3K57A 3L0QA 4KHSA 4RW4A 1NOZA 3K9JA 4DTSA 4JI8K 3NF6A 5AQVA 2F96A 3MEGA 3ITHA 1HYSA 3DLEA 3U9ZA 2D0OA 3ATUA 1VQMN 3H1VX 3CMAN 1YITN 4FOEA 3D0PA 3GBTA 3NGIA 1D4XA 4F2RA 4EZ9A 2YHAA 3EL2A 1IJJA 1CZAN 3K9KA 3I8DA 3VGMA 3NF8A 4FVMA 2I7PA 3VQ4A 3V1RA 4BRCA 1C0TA 4B1WB 3CJ9A 5AQGA 2G8KA 3O1WA 3VQ8A 2FF3B 3K58A 1NJYA 4B08A 1S22A 3HK2A 4NLCA 4UY8O 3L4QA 3A8YA 3ID8A 1HKBA 4KTWA 1NOYA 4IJAA 3TU5A 1QQMA 1U49A 3CPWM 3VETA 1VQPN 4I2QA 4JS4A 4ISGA 4JD2B 3QDKA 5A2QO 4EHTA 5FDLA 3G0ZA 1HJRA 3MCAB 5BREA 1HNZK 4CZIA 1S72N 3HXMA 3ZCMA 3VPZA 2F8TA 4FYDA 1U2VA 1EQYA 3ENBA 1VQON 4CJFA 1JJ2M 2FXUA 2O8FA 3SJHA 3QEIA 3DYAA 5CHIA 3SNNA 1HNWK 3HPHA 3EO3A 1YHQN 3SPZA 4OVLA 1KXPA 3PIOL 3RMCA 1LCUA 2Q3SA 3D2EA 4LF5K 1UAXA 4C8OA 3R9PA 3CYMA 4CEBA 3MCPA 4YHHK 1KAYA 1NMNA 4O55A 4CK2A 5HBMA 2HHHK 4EP4A 4X66K 3VQEA 3KLGA 4PL8A 3SMSA 1ZBSA 4QOZB 1BOTO 3LANA 4CECA 1KRPA 4GMJB 3VA3A 4K0KK 4Y1CA 4BVOA 3LL3A 2E2PA 3RMDA 1NK9A 3V81A 4B9TA 3ZSQA 4CK1A 1HQEA 3VN5A 5J2QA 3WNEA 5AQZA 2V7YA 2ITMA 3HM9A 1V4SA 3KWGA 1B92A 2YHYA 3OS2A 1VQNN 4B3RK 2HNDA 2YHBA 2HVHA 3S3MA 1RDDA 3HP9A 3L6QA 3RR8A 3RWUA 3PV8A 3KWIA 1VSJA 5E84A 2VWJA 4JKFA 3L4IA 2GBZA 1FJGK 1MU2A 4BQZA 1VQ7N 4LF9K 1T6DA 2E2NA 3CI5A 1IBKK 3S41A 1YUWA 2FSJA 3CCVN 4FWLA 1JCGA 1RDBA 3SK3A 3HP6A 1S1XA 3AO1A 1TKDA 2JWLA 4CHZA 5AQNA 1HJOA 1NGAA 4H0PA 2D1KA 4HHTA 1NJWA 4FJJA 4A59A 2GWKA 3VF6A 1WN7A 4Z94A 1EWRA 1JLAA 3FLCO 2D0PA 1R59O 4CJLA 4OGEA 4BRNA 3CCRN 5I9EB 1VSLA 1QS4A 3H46O 3M3ZA 4FM1A 3SQ2A 3DXMB 3EEQA 4JV5K 1BGXT 5ELZA 4NLBA 3GDQA 5ADXA 5C2DA 4YOXA 4OPKA 3MEEA 1HKCA 2G8FA 3WUHA 2UXBK 3UIQA 1NK6A 4Q0BA 1BI4A 4BRPA 3AA2A 5FRMA 3C7NB 3O1BA 3RRGA 4KB1A 3FZLA 5KGXA 5H1SQ 1IBMK 2ZE2A 2A3ZA 3N4QA 4KKOA 4X65K 2I5JA 1S1UA 2W6LA 4FWNA 4DQQA 4I6MB 3PIPL 2O8CB 1C1AA 2WFBA 3FFIA 2ZM6K 4I7FA 2WTUA 2QXLA 4DV6K 3ZT4A 3KKRA 2W40A 4DLGA 4CGIA 1VHXA 3QICA 1FW6A 1VQ6N 4DSJA 3ENOA 3I0RA 1VSFA 2RPIA 3T19A 4MLEA 2O8DA 4FPAA 2GEMA 2QXFA 2EX3A 2QWPA 3NH2A 1X3NA 1VQ9N 3TAMA 5AQRA 5CE3A 5AQYA 3VMFB 3CC2N 3O3FA 1WSJA 1NKBA 3M8PA 3KLEA 3DWLA 3I0SA 4AHUA 3T69A 1DEJA 4DR3K 4JI0K 4K25A 4DS4A 1RBUA 4LSLA 4BROA 1HRHA 2PYJA 2ITGA 4B3OA 4CGFA 4BGAA 3LPTA 4CZHA 3GE1A 5DMRA 3NGYA 4IKFA 3CJCA 3TAGA 4PWDA 2VG7A 2XO7A 3BGRA 5CY4A 4BRHA 4F3OA 5AQQA 1T44A 1WAFA 4JKEA 4IG0A 1S1TA 3HTVA 4C8MA 1DLOA 4MDBA 3SAHA 4CJQA 4DQPA 4DUZK 4FLVA 1HNVA 5AQOA 4CZMA 3AVKA 3CG7A 3DM2A 1SKRA 4HTUA 3O4NA 2ETJA 4QAGA 4X62K 1QZ5A 3LP2A 4KB0A 5CR4A 2A42A 3V9WA 1TKTA 3IMXA 4DUYK 3FE1A 2ZD1A 2B6AA 4CD3A 3VQ6A 2GX9A 4GW6A 5AQUA 1WBBA 4BRMA 3FZFA 4Y1DA 5HRNA 1JL1A 4H5RA 4DTOA 1VK0A 4LFBK 4Y0WA 2JWKA 3ID6A 4JKCA 4KHYA 4DFPA 3AVJA 4A5AA 4M3ZA 3I33A 3DRRA 2NRRA 3OS1A 4BACA 2P9LA 1X1PA 3A5NC 1TAUA 1RDWX 3O4WA 4U67L 4C8KA 3N4PA 4O5BA 4CFAA 4FW2A 4CESA 5SWMA 1QQCA 2IS3A 3TANA 4BE0A 3TSQA 1Q82O 2QTDA 1XUPO 3EZ5A 3MN6A 3ENHA 5C0YA 5JLHA 4DR7K 5I3UA 4DQSA 3SCXA 4ID1A 1X9MA 4DR4K 1QTMA 4B8AB 3PX6A 2O8FB 2HMPA 1IKXA 4OGCA 2F7TA 2VGMA 3ZSYA 3PX4A 1SL2A 3D2EB 3ZETA
chains in the Genus database with same CATH topology
3E66A 2E2OA 3CHWA 2Q0UA 2ZGZA 3SMPA 3AY9A 3E9PA 5M1NA 4H0YB 5M1OA 3MN9A 3QFPA 1P8ZA 5EOYA 2QWNA 4LC9B 4JKAA 5JVHL 3VTHA 4K41A 3UB5A 4YDUA 4RWTA 4A5BA 3ZX0A 4C1NI 1E4GT 4YOWA 4JKGB 3UKRA 4IFEA 4WFAL 3GOIA 3LDNA 2KKZA 5AQXA 1HKGA 2D4WA 2ZWHA 3AAPA 1KC8O 3U9DA 2ZJRL 3OW2M 3OBWA 4KH6A 4YOYA 3AAQA 2WBNA 3NMUA 4NB4A 4A62A 2HBMA 3AGRA 4FWPA 2VCPA 3E1YA 4GV6A 4A61A 1X3MA 5GAGP 3KVGA 4M63C 3T7ZA 3C6HA 5E26A 2GELA 2FSKA 3CC4N 4BRIA 4GVEA 1YJNN 3ZX3A 2BTFA 2J4RA 2VYPA 3DAWA 3WXMB 4C23A 5BR9A 1QQOA 3O6WA 5LJVA 3E9OA 1G99A 3DLLL 3D6RA 3BEXA 5AFUH 2E88A 1YI2N 3I8BA 1Q86O 1BA1A 4CZJA 5KPTA 4YORA 4FVUA 3I55N 3L0QA 1TYQA 4B1YB 4BREA 2NNWA 1KD1O 3K9JA 3CF5L 5AQVA 3AARA 5AQSA 3G71N 2QWLA 1XC3A 4IOAL 1VQ5N 3VEWA 3F5TA 2BH1A 2A5XA 2P9SA 4FWOA 2A6AA 2D0OA 4M7YA 3U9ZA 5LY3A 3ATUA 5AQHA 3H1VX 1VQMN 1VQKN 3CMAN 3ZEUA 1YITN 5AZJA 1NGDA 4FOEA 4YOUA 5C12A 2H3GX 3GBTA 3P38A 4IEIA 3UKUB 4B1VA 1TUYA 1D4XA 4OO1J 3E9LA 5AQMA 1KAXA 3EL2A 1VAZA 1IJJA 1CZAN 2RE2A 3K9KA 5EY4A 4XEIA 3VGMA 3P31A 4BC3A 1GLLO 1U6ZA 2I7PA 1T6CA 4O8UA 1K73O 1HPMA 4BRCA 4IOCL 2ZGYA 5AQIA 2E8AA 4B1WB 1ZXOA 2E1YA 3CJ9A 3O9UA 5AQGA 1YAGA 4WCEL 1VQLN 3O1WA 2FF3B 5EX5A 5M1FA 1S22A 3C65A 4NLCA 4UY8O 3L4QA 2UYTA 3A8YA 5F2RA 3FZMA 4O5FA 4CZGA 1HLUA 1HKBA 3ID8A 4FOIA 4OPHA 3F2KA 4CD1A 2AA4A 2QWRA 3HSCA 4IJAA 4CBXA 3WEEA 1QQNA 3QFUA 3TU5A 1QQMA 3VERA 5BPLA 2HSTA 3IKMA 4KH4A 3TTFA 2HF3A 3CPWM 5EVZA 3JXUA 5EXWA 1J6ZA 4FWRA 3CQXA 4FWKA 4O8KA 3EE8A 1K8KA 3VETA 4EHUA 5GAEP 1VQPN 3F9MA 3J7ZO 4ISGA 3W0LA 2P9IA 2GWJA 3QDKA 4JD2B 4EHTA 1Y64A 3CJ1A 3WXJA 4FWSA 2A40A 4FSVA 1RFQA 2CGLA 3MCAB 4ILJA 5F1XA 3CCUN 2P9PB 4GV3A 2PAVA 5BREA 4PKGA 1BA0A 5FPNA 4DCHA 4CZIA 1S72N 3VEVA 2IVNA 4CZEA 3HRGA 1U2VB 5BPNA 2YI1A 3VPZA 1U2VA 3WXIA 1EQYA 3ENBA 2KLAA 1EO1A 1NGHA 1VQON 3BF1A 5HOOA 1JJ2M 2FXUA 1QZ6A 3G25A 3SJHA 3H45C 1NWKA 2QW9A 4FWMA 5CHIA 4RCHA 3M5RA 2OTLN 4H03B 3VEYA 3O5BA 3EO3A 1YHQN 1KXPA 3MWTA 1X9JA 3HBTA 3PIOL 1LCUA 1TUUA 2RHKA 3D2EA 2YCHA 3R9PA 3VGKA 4JN4A 3MCPA 3ATVA 1KAYA 4IDHA 4BGBA 3TSPA 1GLBG 2A41A 2QEXN 1S3XA 1HX1A 4PL8A 1BWFO 3SMSA 4U7BA 1ZBSA 2EWSA 1BOTO 4JKGA 3CCQN 3R3LA 2ZJPL 2V7ZA 3D2FB 1JCFA 4AM6A 2QM1A 3G4SN 4K43A 4BR2A 4R79A 4JK9A 4QS9A 4BR5A 1YJWN 3CETA 3FZHA 2Q97A 4BVOA 4YOTA 3LL3A 2E2PA 5BN9A 3CCJN 1IG8A 2P9UB 3WQTA 4IO9L 5BRHA 1GLAG 3H6EA 4ISEA 3VEZA 5AQZA 2V7YA 4PKHA 2ITMA 4BRDA 4GV9A 1V4SA 3KWGA 2YHYA 4BR9A 2QA4N 1KQSM 3MN5A 1VQNN 2NRZA 3EKUA 2Q31A 3SAFA 4DB3A 1VQ4N 3CJAA 3MK6A 2F9TA 3L6QA 4L3QA 5M1KA 3OHRA 3QB0A 4PKIA 1YJ9N 5JLFA 5JMVA 5LJWA 3EN9A 4JK8A 3MMVA 4EAHD 5C10A 3KWIA 1SAZA 3VENA 3EKSA 5F0XA 5DM6L 5E84A 4JKFA 3L4IA 4DKWA 4BR0A 4WQ5A 1E4FT 2FLOA 1VQ8N 2QWOA 4BQZA 5M1PA 1VQ7N 3VEOA 1T6DA 2CH5A 3O9QA 4PHTX 2E2NA 4MLHA 2IIRA 3CD6N 3CI5A 4MO5A 4CZKA 2PBDA 4BG9A 3MX2A 3S41A 1YUWA 2FSJA 3CCVN 4FWLA 1JCGA 1NM1A 4CBWA 4BRQA 3SK3A 3FR0A 4M7XA 2NRXA 3R6MA 5DM7L 1T3VA 1DT9A 2IVPA 3FFKB 5GIOA 3IFRA 2JWLA 1ATNA 1NLVA 3UKUA 4C1NK 3QBWA 5AQNA 1HJOA 4YDUC 1NGAA 3CIPA 4H0PA 2D1KA 2W41A 4XH5A 4A59A 1DKGD 3BP8A 5KPRA 5GINA 2GWKA 2E1ZA 3KK7A 1Q18A 3M1FA 4MDAA 3VF6A 4BRGA 4Z94A 1V4TA 3HZ6A 3TPQA 4BRLA 3H3NO 1BO5O 2WC9A 1NGJA 2V52B 3NVMA 2YHXA 2D0PA 3CPEA 3FLCO 4BRAA 3VEXA 1R59O 4XH1A 3VESA 4QS8A 3O80A 5C2FA 4EFHA 4BRNA 3P39A 3CCRN 4OPAA 5I9EB 2YX6A 1M1KO 3UE5A 3H46O 3M3ZA 3KZBA 4CBUA 3DXMB 5TKYA 1Z6RA 2QI2A 4A2BA 4BC2A 5ELZA 4NLBA 3GDQA 5ADXA 5C2DA 2ZF5O 3ULEB 4YOXA 1HKCA 1RDUA 4H0XB 3WUHA 1YIJN 5MLCQ 2P9LB 5GIPA 3QMLA 2ASMA 2QWMA 1BU6O 3O9TA 4MO4A 1BG3A 4JD2A 4BRPA 5AQLA 5KPZA 1K8AO 1NGCA 3C7NB 3O1BA 1NGIA 4GNIA 5JICA 3PLAA 2P9PA 2P9NB 1MWKA 3FZLA 5H1SQ 3N4QA 2A3ZA 3HOTA 2ZJQL 1NJIO 2AP1A 2PFUA 4FWNA 1GLFO 4I6MB 4WFNL 2Q1NA 3A0IX 3RSEB 3PIPL 3A5LC 3A5MC 2WFBA 4A57A 3KHYA 1MWMA 4RTFD 4BC5A 5BN8A 2ASPA 2GUPA 5GADP 3U4LA 3CMEN 2QXLA 2QWQA 4WYBA 2KHOA 5C15A 3NVKA 3CCSN 4QS7A 1QHAA 3O08A 1GLJO 1O13A 2W40A 1YVNA 4IJNA 4WQ4A 3QICA 2GTDA 3GL1A 3MWPA 1VQ6N 1SZ2A 3ENOA 3Q7CA 3WXKA 3IUCA 2BUPA 4MLEA 4FPAA 2GEMA 3VOVA 1NGBA 4BRFA 5BRDA 1LOTB 1WOQA 2Q0RA 3DXKB 3A5OC 2QWPA 4JKHA 3ZETB 1X3NA 1VQ9N 5AQRA 5CE3A 5AQYA 1W2BM 1ATRA 1NGEA 3VMFB 3CC2N 5AQFA 5JVGL 3DXKA 3AGKA 3H3OB 2E20A 3TTDA 5BPMA 3BF3A 2CGKA 1NBWA 2OANA 3MX5A 3MN7A 4WF9L 3DWLA 4ISFA 3MDQA 1N8RO 3TTCA 4CZLA 1RGIA 3D2FA 3T69A 1DEJA 3UKRB 4JEPA 4K25A 5FPMA 4B1ZA 3WT0A 1K9MO 2Q2RA 4HTLA 4BVPA 4BROA 4J8FA 1W97L 1H1VA 3WXLA 4BRKA 2E2QA 1MDUB 4BGAA 1Q7YO 2P9UA 3LDPA 5FPDA 3CQYA 2VWBA 3GE1A 3SBTA 2FF6A 4CZHA 3TSUA 4KH5A 4BG8A 3CJCA 4FWQA 5M1QA 2WUSA 4FL9A 2I7NA 3LDQA 4JHDB 4EIAA 1GLEG 4H5NA 5AZIB 4DQ8A 4BRHA 4BR7A 4H5TA 5TKWA 5AQQA 3LM2A 1T44A 4JKEA 4JHDA 1NMDA 5KQDA 1OVYA 2VGNA 3WQUA 4BY9C 3HTVA 5AZIA 2NRTA 3HM8A 1OKJA 3O8MA 4IXCA 3H1QA 4MDBA 5FPEA 3SAHA 3CCMN 4B9QA 2DPNA 2HBLA 2F9WA 4ILHA 5AQOA 4WQ4C 1TYQB 4CZMA 5AR0A 3C0BA 1DGKN 1YXQA 4NO7A 4YOVA 4CZFA 4CI6A 4E1JA 5ADXH 1M90O 1QZ5A 2YJEA 3VTIA 1ILYA 4JNEA 1NGFA 4BC4A 5CR4A 2A42A 2P9SB 3IMXA 3SBGA 3IDHA 2V51B 4JKBA 3RVCA 2NRWA 3FE1A 3OA9A 3ZEUB 5AZJB 4IOXA 4IZ9A 2P9KB 1SQKA 4BR4A 1KAZA 4CD3A 2FSNA 2NRVA 2GX9A 3GG4A 5AQUA 3I56N 1ESVA 1NGGA 4H5WA 2CGJA 2P9KA 3VF4A 3CJBA 3Q7BA 5AQJA 3FZKA 2IVOA 4H0OA 4B1XB 4BRMA 1C0GA 3CCEN 1MA9B 3FZFA 1WUAA 3O9SA 2YJFA 4IO8A 5AFUA 1QVFM 4H5RA 1GLCG 4IWVA 3DJCA 1BUPA 5AQPA 3ZX2A 4WFBL 4A2AA 1JCEA 3CCLN 2HF4A 2NRHA 2ASOA 2JWKA 4Y0WA 4PL7A 3DXMA 3ID6A 3D7EO 3EE9A 5BRFA 4BQLA 4JKCA 3J8AA 4H0VB 3ULEA 4A5AA 4XH4A 5HL7L 3G6EN 3R8EA 3I33A 3OBYA 3WEEB 1QVGM 2NRRA 4AF1A 4B1UB 3LDLA 4JKDA 4DHYA 1Z05A 2P9LA 3C6AA 4IEEA 3CXCM 2CH6A 4KBOA 4G9ZA 1HUXA 4F9OA 3QBXA 3A5NC 3CC7N 1K8KB 4FO0A 1RDWX 1ATSA 2HOEA 3O4WA 1BDGA 2HBKA 3C7NA 4U67L 2P9IB 3N4PA 3SLCA 5GAHP 3B8AX 3EZWA 4WQ5C 3P4IA 3SAGA 2P9NA 3FGUA 1GLDG 3HOSA 1SS6A 5AQTA 3LDOA 3TSQA 1Q82O 1YF5L 2QTDA 5B8HA 1XUPO 4I6MA 3RSEA 3CERA 3MN6A 4H0TB 1C0FA 3ENHA 3U8XA 3VF2A 5C0YA 4CJ7A 5JLHA 3CJ7A 2OTJN 3JS6A 4GY2B 1Q81O 3O9RA 2NZTA 4AM7A 5KQ8A 2Q36A 5AQWA 2HBJA 3ZYYX 3R1XA 2HMPA 3LM9A 4ILGB 3BUZB 1P90A 4FPBA 2F7TA 3M6GA 3HI0A 2VGMA 5AQKA 4K42A 4JAXA 3W3DA 4HWIA 1XQSC 2YHWA 4H5VA 4JK7A 1ZC6A 3VGLA 3D2EB 2NLXA 3ZETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P90 A;  2RE2 A;  1T3V A;  1RDU A;  2QTD A;  2KLA A;  1EO1 A;  2WFB A;  2YX6 A;  1O13 A; 
#chains in the Genus database with same CATH topology
 1WSE A;  4FJH A;  2E2O A;  2Z1I A;  3P5J A;  1J5O A;  3MN9 A;  3DLK A;  1U4B A;  1IV0 A;  1RDC A;  1E4G T;  4IFE A;  1JXE A;  4IFY A;  2ZQB A;  3V4I A;  1HKG A;  2D4W A;  2ZWH A;  2YNI A;  3U9D A;  2ZJR L;  1C6V A;  3NMU A;  2D0B A;  1RBV A;  2HBM A;  3IG1 A;  4A62 A;  3KK3 A;  2B4J A;  3E1Y A;  3KVG A;  4FK2 A;  4OLA A;  3SV3 A;  2G8I A;  5KGW A;  1YTU A;  4LF4 K;  1J53 A;  3LP0 A;  2IDO A;  2BTF A;  2VYP A;  3DAW A;  3ZX3 A;  5BR9 A;  1HNI A;  4C23 A;  1EP4 A;  4CVN E;  4DU1 A;  3KD1 E;  1X9W A;  3E9O A;  1G99 A;  4CJS A;  1N6Q A;  3DLL L;  3D6R A;  1VSK A;  5AFU H;  2G8H A;  4Z4G A;  4O0I A;  4FJ8 A;  1EXQ A;  3DMJ A;  5K14 A;  3LAK A;  1NK5 A;  3DI6 A;  4B1Y B;  1VRT A;  3CQ8 A;  1EKE A;  1TK8 A;  4Z4E A;  3CF5 L;  3AAR A;  3AO2 A;  1JXB A;  3G71 N;  4DR5 K;  4Z4H A;  3VEW A;  2HHS A;  3DRS A;  2P9S A;  4FWO A;  3H08 A;  4GKJ K;  5AQH A;  2OPR A;  1TVR A;  5AZJ A;  5C12 A;  4FZZ A;  1HPZ A;  1TUY A;  3E9L A;  3L2U A;  1KAX A;  2RE2 A;  2Z1H A;  1CXU A;  1U47 A;  3AVC A;  1T6C A;  3K2P A;  1HPM A;  1XMO K;  3AVF A;  1RCH A;  2E1Y A;  3NH0 A;  4ELU A;  1YAG A;  4J2A A;  4M3T A;  4CHY A;  5M1F A;  4B8C A;  3ISN C;  2F4V K;  4CZG A;  1DTQ A;  4OPH A;  1RT2 A;  5BPL A;  4OKK A;  4Z4F A;  3NDK A;  3EE8 A;  1BI4 B;  4CEA A;  3QIO A;  3J7Z O;  3QES A;  2GWJ A;  2P9I A;  4PQU A;  4JRP A;  4H4O A;  3QIN A;  3V1Q A;  1BQN A;  4CF0 A;  4FM0 A;  1IH7 A;  2A40 A;  4FSV A;  1RFQ A;  4CFC A;  3CCU N;  1RT6 A;  4DQR A;  2HW3 A;  4PKG A;  2R7Y A;  1BA0 A;  3HJF A;  5FPN A;  4DCH A;  1K6Y A;  3VEV A;  1BIS A;  4JI6 K;  5AJ3 K;  3THY A;  2HHQ A;  1J54 A;  1JLE A;  1NJX A;  2HHV A;  1N32 K;  4CEO A;  1QZ6 A;  2QW9 A;  4FWM A;  4RCH A;  3M5R A;  2E5L K;  1VSD A;  3VEY A;  3MWT A;  2O8D B;  1TUU A;  2RHK A;  4BDY A;  3JYT A;  2YCH A;  4JN4 A;  3AV9 A;  3ZT3 A;  4KHU A;  4GVM A;  4DV0 K;  3LZI A;  1YVU A;  2QEX N;  1S3X A;  5C25 A;  3ZSW A;  4JKG A;  3CCQ N;  3PY8 A;  3OVN A;  1JCF A;  4JYA K;  3CET A;  3LWM A;  3PSI A;  2FC0 A;  4BDZ A;  3WQT A;  1QHT A;  1KVC A;  1GLA G;  3H6E A;  4ISE A;  4PKH A;  2DFH A;  3ASM A;  1KQS M;  2NRZ A;  2Q31 A;  4DB3 A;  3RMA A;  2F9T A;  5M1K A;  3OHR A;  3QB0 A;  3MXI A;  1RBT A;  3HL8 A;  4CF8 A;  1YJ9 N;  2DFF A;  3PUF A;  5JLF A;  2X6S A;  5EU7 A;  3HVT A;  1T8E A;  4DSE A;  5DM6 L;  4MFB A;  4BR0 A;  1RT1 A;  4WQ5 A;  1E4F T;  4YY3 K;  4M3U A;  2FLO A;  4M3W A;  5M1P A;  3VEO A;  3O9Q A;  1KFD A;  5T7B A;  4MLH A;  2IIR A;  3CD6 N;  4CZK A;  4WE1 A;  4BG9 A;  2OPP A;  1NM1 A;  4CBW A;  4BRQ A;  4ICL A;  4DG1 A;  2NRX A;  3R6M A;  3AVM A;  4KPY A;  2IVP A;  3FFK B;  3IFR A;  1ATN A;  3UKU A;  2W41 A;  4H4M A;  3DLG A;  4CW7 B;  1DKG D;  5KPR A;  4FM2 A;  4MDA A;  1Q18 A;  4BRG A;  2HHT A;  1V4T A;  3HZ6 A;  4BRL A;  4FCY A;  3H3N O;  2WC9 A;  4DV4 K;  4FLY A;  2V52 B;  3S3N A;  3VEX A;  1OH7 A;  4FJK A;  4EFH A;  2O4G A;  3P39 A;  4CCH A;  3AA4 A;  3UE5 A;  4CBU A;  2OYQ A;  4GKK K;  1Z6R A;  3IAY A;  3RRH A;  4OKJ A;  1YIJ N;  1FXX A;  5MLC Q;  2P9L B;  4LSN A;  4KO0 A;  1IKW A;  4F2S A;  1BU6 O;  3O9T A;  5AQL A;  3AA5 X;  4NCA A;  3PLA A;  2P9P A;  1S1V A;  1MWK A;  2W6K A;  3D45 A;  2ZJQ L;  1HNX K;  4CGH A;  2KFZ A;  2Q1N A;  4KI4 A;  3KHY A;  4RTF D;  3NE6 A;  3PSF A;  3U4L A;  3OYN A;  3WNG A;  1ZYQ A;  1XC9 A;  4WQ4 A;  1YVN A;  4IJN A;  3QNN A;  3HVR A;  2GTD A;  3MWP A;  4JI2 K;  1RTI A;  3Q7C A;  3IUC A;  3HST B;  4BRF A;  5BRD A;  1LOT B;  3WNH A;  4JKH A;  3ZET B;  1J9A A;  1JKH A;  1ATR A;  2XRI A;  3THX A;  2Y1J A;  1L5U A;  5AQF A;  3DXK A;  2NUB A;  2CGK A;  3MX5 A;  1KFS A;  1XMQ K;  3D2F A;  5FPM A;  3T3F A;  4HTL A;  3QEW A;  2A1R A;  4W5T A;  3WXL A;  3THV A;  3SBT A;  2FF6 A;  3NF9 A;  3KD5 E;  1NU0 A;  2AJQ A;  4BG8 A;  4FWQ A;  3L2R A;  2I7N A;  3HPG A;  4EIA A;  2UUA K;  4H5T A;  1BIU A;  4JHD A;  1C0M A;  1NMD A;  1CZ9 A;  2YKM A;  2VGN A;  3SV4 A;  4BWM A;  2BGG A;  5AZI A;  3OY9 A;  1OKJ A;  5SZT A;  4IXC A;  1KLM A;  2UXC K;  1RTJ A;  1T7P A;  3CCM N;  2DPN A;  2F9W A;  1WSH A;  3T1H K;  3S9H A;  4CHO A;  1YXQ A;  3MEC A;  4NO7 A;  4KAZ A;  2YJE A;  3RR7 A;  1ILY A;  4JNE A;  4BC4 A;  1T03 A;  2KZM A;  2P9S B;  3IDH A;  2V51 B;  4JKB A;  4EP5 A;  3OYK A;  3SUO A;  5AZJ B;  4BWJ A;  4IOX A;  4IZ9 A;  2P9K B;  3V9X A;  3L2Q A;  3L2W A;  2WON A;  2IGI A;  3GG4 A;  1ESV A;  4CGG A;  4H0O A;  1E3M A;  3O9S A;  4X64 K;  4IO8 A;  2P1J A;  5AFU A;  1QVF M;  4IFV A;  1GLC G;  4LY7 A;  3OS0 A;  1JCE A;  3CCL N;  2ASO A;  1QE1 A;  3EE9 A;  3JAM O;  4OX9 K;  3J8A A;  5HL7 L;  4NYN A;  4XH4 A;  4B1U B;  4DHY A;  4JS5 A;  3C6A A;  4KBO A;  4F9O A;  3CC7 N;  3J81 O;  2D0C A;  2HOE A;  3VQB A;  2P9I B;  2D0A A;  1VSI A;  4BE1 A;  4RG8 A;  4W5Q A;  4JLH A;  1Q8I A;  2PZS A;  4Z4I A;  3SAG A;  3FGU A;  5HRR A;  4CFD A;  4J2E A;  1KLN A;  4DFM A;  1SS6 A;  3MXJ A;  1GOC A;  5B8H A;  3RSE A;  3CER A;  4H0T B;  1RTH A;  4HVJ A;  2GUI A;  4CIE A;  2FBT A;  3THY B;  4B9N A;  4AM7 A;  3ZYY X;  4HUF A;  4DV1 K;  1KSP A;  4W5O A;  3AVN A;  3BUZ B;  1KTQ A;  3RTV A;  3M6G A;  5CYM A;  5AQK A;  4K42 A;  4BRE A;  3VGL A;  4H5V A;  2NLX A;  4DSL A;  1OH6 A;  2Q0U A;  3AY9 A;  4DTU A;  3M8R A;  3PO4 A;  1TK0 A;  4B9U A;  3CM5 A;  5M1O A;  3U3Y A;  2QWN A;  4JKA A;  3VTH A;  4K41 A;  1LWF A;  4RWT A;  4A5B A;  3ZX0 A;  4E7H A;  3SQ4 A;  4JKG B;  3UKR A;  2VG5 A;  1RBS A;  3LWL A;  4FJI A;  5AQX A;  2XY8 A;  3AAP A;  3OBW A;  4YOY A;  4KRE A;  3AAQ A;  4FJ9 A;  4W5N A;  4R5P A;  4GV6 A;  4A61 A;  1C1C A;  1X3M A;  2QKB A;  4M63 C;  5HP1 A;  3V6D A;  5E26 A;  2FSK A;  3CC4 N;  1ASV A;  4GVE A;  1YJN N;  1CXQ A;  3WXM B;  1ASU A;  3KIO A;  3ZLJ A;  5KRT A;  3VA0 A;  5FRO A;  3I8B A;  4FLZ A;  1Q86 O;  4N76 A;  1OVQ A;  1LAV A;  4CGD A;  5I42 A;  4FZX C;  4FVU A;  1ZBI A;  1TYQ A;  3KK1 A;  3ULD A;  2QWL A;  1Z26 A;  1XC3 A;  1VQ5 N;  2Z1J A;  2A5X A;  2A6A A;  3KTQ A;  3C6T A;  4K8Z A;  1NGD A;  2H3G X;  3DOK A;  3P38 A;  4IEI A;  3UKU B;  4XIU A;  3P1G A;  4XEI A;  3AO3 A;  3P31 A;  4BC3 A;  1U6Z A;  4CJ3 A;  3OYI A;  2ATQ A;  3VQQ A;  4IOC L;  5AQI A;  2E8A A;  1ZXO A;  3O9U A;  4WCE L;  1IO2 A;  2A1S A;  3KKS A;  2UYT A;  4O5F A;  1HLU A;  4FOI A;  4CJP A;  4DR6 K;  4CD1 A;  2AA4 A;  3K5M A;  1QQN A;  3QFU A;  3IKM A;  2YKN A;  5EVZ A;  4CF2 A;  3JXU A;  4FWR A;  3CQX A;  2GV9 A;  4M45 A;  1K8K A;  5GAE P;  4DQI A;  3VQA A;  3NGZ A;  3HPO A;  1VSM A;  3ZSR A;  2VQE K;  1Y64 A;  3CJ1 A;  4FLW A;  3TAE A;  2CGL A;  4ILJ A;  5F1X A;  2P9P B;  4YFU A;  4GV3 A;  2PAV A;  1QSL A;  1Y97 A;  3AVA A;  2Z1G A;  1JLF A;  3HRG A;  1U2V B;  2E6M A;  1VSH A;  4DTX A;  3K0S A;  2VG6 A;  1RT4 A;  4JRQ A;  1Q9Y A;  2KLA A;  1IG9 A;  1EO1 A;  3BF1 A;  5HOO A;  3OTO K;  3DOL A;  3IRX A;  4E7I A;  3RMB A;  1UA1 A;  3CFR A;  3O5B A;  3VQ5 A;  2KQ2 A;  1RT7 A;  3TAR A;  1SL1 A;  3LDS A;  2HHU A;  1WSF A;  1GOA A;  2E6L A;  3M8S A;  4IDH A;  1LV5 A;  1QSS A;  5FLX O;  4DR1 K;  1X9S A;  3THX B;  1GLB G;  4CFB A;  2O8E A;  1C0U A;  1IKY A;  1NNE A;  2EWS A;  4KHQ A;  2QKK A;  3R3L A;  2ZJP L;  3CFO A;  1KCF A;  3J80 O;  3D2F B;  2HVI A;  4AM6 A;  1TV6 A;  4DR2 K;  3ZT1 A;  3LPU A;  4B3S K;  4FJL A;  4K43 A;  4R79 A;  1N36 K;  2DTU A;  5DK5 A;  2F8S A;  2FBX A;  4YOT A;  5BN9 A;  1S6Q A;  4IO9 L;  5JS1 A;  1S5J A;  4CIF A;  2LSN A;  5CZ1 A;  1IBL K;  1BCO A;  1HYV A;  4BR9 A;  2QA4 N;  3MN5 A;  4B3M K;  3EKU A;  4G1Q A;  1BL3 A;  3MK6 A;  4L3Q A;  5JMV A;  3NFA A;  5LJW A;  3EN9 A;  3MMV A;  4EAH D;  4DTP A;  3VQ9 A;  3VEN A;  3EKS A;  3C6U A;  4ID5 A;  2JLE A;  4DFK A;  1NK0 A;  3ZT0 A;  4MO5 A;  2PBD A;  3MX2 A;  1N5Y A;  1ZBU A;  1HMV A;  1L3T A;  2VWK A;  1YT3 A;  3FR0 A;  2DFE A;  4M7X A;  1T3V A;  1DT9 A;  4ZHR A;  5GIO A;  2DY4 A;  3L3U A;  4C1N K;  1NLV A;  2UXD K;  3QBW A;  4YDU C;  1ZBF A;  1QSY A;  3G10 A;  3V9U A;  4KHP K;  5GIN A;  2E1Z A;  3M1F A;  3AO5 A;  1WB9 A;  2XY7 A;  4CK3 A;  3NVM A;  2P5O A;  2YHX A;  3CPE A;  4BRA A;  4XH1 A;  2YV0 X;  2YNF A;  3EYZ A;  3EY1 A;  5LMU K;  2EHG A;  3B6P A;  3AVI A;  1D8Y A;  1T05 A;  5FRN A;  1BQM A;  2KFN A;  1B9D A;  1I94 K;  4A2B A;  2HHX A;  4DTM A;  1RDU A;  4CJ4 A;  3KLF A;  5BR8 K;  3OYM A;  4AH9 A;  3KLH A;  4PUO A;  3QML A;  3NAE A;  3KK2 A;  2ASM A;  4KV8 A;  1BG3 A;  1NGC A;  3DLB A;  4M42 A;  4GNI A;  5JIC A;  4IBN A;  4LH5 A;  4FJN A;  3HOT A;  3BZC A;  4FJG A;  1XNQ K;  1NJI O;  1D9D A;  4E89 A;  3RSE B;  5J2N A;  1TK5 A;  2KZZ A;  3A5M C;  5BN8 A;  1I39 A;  2E4L A;  4DTN A;  3MXM A;  3O4Q A;  2QWQ A;  3TAB A;  1U48 A;  2KHO A;  5C15 A;  4QS7 A;  1I3A A;  3O08 A;  3ZSV A;  4LD0 A;  4DFJ A;  1W0H A;  3ZSO A;  4F4K A;  3AVG A;  4JI7 K;  3WXK A;  2BUP A;  1NGB A;  5KTQ A;  2Q0R A;  1WOQ A;  3SUN A;  3A5O C;  1WSI A;  1UWB A;  2FBV A;  1W2B M;  4FJ5 A;  1LW0 A;  4FJX A;  4IG3 A;  3AGK A;  3BF3 A;  3SJJ A;  1NBW A;  3TR8 A;  1A5X A;  3MDQ A;  4CZL A;  4KHW A;  1A5V A;  1RGI A;  1J5E K;  2JGU A;  3UKR B;  2X74 A;  2BE2 A;  4JEP A;  4B1Z A;  2Q2R A;  4BVP A;  1U04 A;  4FLU A;  1W97 L;  4BRK A;  3WNF A;  4HCB A;  1MDU B;  1WNS A;  1EET A;  1NK7 A;  2P9U A;  3LDP A;  5FPD A;  3CQY A;  3SYZ A;  1JL2 A;  4M3R A;  4B9M A;  3OYH A;  3K5O A;  1W7A A;  4AHR A;  1KVA A;  4AHT A;  2WUS A;  3LDQ A;  3ZT2 A;  4H5N A;  1NKC A;  4NXN K;  2OPQ A;  1YTA A;  4DQ8 A;  3O3H A;  4BR7 A;  5TKW A;  1FK9 A;  3LM2 A;  2NRT A;  3HM8 A;  1VSE A;  3H1Q A;  3TWH A;  5E41 A;  1JLB A;  2HBL A;  4ILH A;  4WQ4 C;  1TYQ B;  4HUE A;  4YOV A;  3E01 A;  4CZF A;  4CI6 A;  3VTI A;  3L8B A;  3RVC A;  2NRW A;  3OA9 A;  4CEF A;  4JI3 K;  1EX4 A;  4CJE A;  4BR4 A;  1SQK A;  4H8K A;  2XY5 A;  4E7K A;  2FSN A;  2NRV A;  3I56 N;  1BIZ A;  4H5W A;  2CGJ A;  4KTZ A;  3VF4 A;  3Q7B A;  1WSG A;  4B1X B;  3CCE N;  1O1W A;  1C0G A;  4KHN A;  1WUA A;  2YJF A;  2O8B A;  3LZJ A;  4ZTF A;  4LF6 K;  1BUP A;  5LL6 Z;  1RTD A;  4B9V A;  2HF4 A;  2NRH A;  4PL7 A;  1NKE A;  1S9E A;  4FLX A;  3ALY A;  1D9F A;  3ULE A;  3G6E N;  1REV A;  1QVG M;  4AF1 A;  3LDL A;  4JKD A;  1Z05 A;  4IEE A;  3CXC M;  2HMI A;  4N56 A;  1HUX A;  1K8K B;  4FO0 A;  4V19 S;  2KTQ A;  1BDG A;  1ASW A;  1LAW A;  3SLC A;  4N47 A;  1LW2 A;  4NXM K;  3K5N A;  2G8W A;  2P9N A;  4CIG A;  1FKO A;  3HOS A;  5AQT A;  1YF5 L;  4RW7 A;  5J2P A;  4FK4 A;  3VF2 A;  5CZ2 A;  2W42 A;  4CJ7 A;  3CJ7 A;  2OTJ N;  3JS6 A;  4GY2 B;  4AIL C;  3DLH A;  5C42 A;  2RN2 A;  3O9R A;  5KQ8 A;  2Q36 A;  3DLR A;  3THW A;  4O0J A;  3R1X A;  4ILG B;  3OYE A;  1WAJ A;  4E3S A;  3QEP A;  1P90 A;  4FPB A;  2IAJ A;  4KRF A;  3HI0 A;  4JAX A;  2UUB K;  1XQS C;  4JK7 A;  4JI1 K;  1EWQ A;  1ZC6 A;  4W5R A;  3SMP A;  3E9P A;  5M1N A;  4B9L A;  3SQ0 A;  1P8Z A;  5JVH L;  5CYQ A;  3UB5 A;  2O8E B;  1Z25 A;  4C1N I;  5LMN K;  1NK4 A;  4WFA L;  3T1Y K;  4AHV A;  3LDN A;  4OJR A;  2KKZ A;  5KRS A;  4FJM A;  3M8Q A;  3O3G A;  3OW2 M;  1S9G A;  4KH6 A;  3T1A A;  5HRS A;  2WBN A;  4NB4 A;  4Z0U A;  2D5R A;  5HRP A;  4FWP A;  2VCP A;  5GAG P;  4F8R A;  3QEX A;  1GOB A;  3T7Z A;  3SUQ A;  4AQY K;  4DTJ A;  4QCL A;  1QQO A;  2VQF K;  4E1N A;  4CHP A;  4FK0 A;  4CZJ A;  5KPT A;  4E7J A;  2O4I A;  4E0D A;  3TI0 A;  3I55 N;  1Q9X A;  2P51 A;  2NNW A;  1KD1 O;  3SPY A;  3OYB A;  3U3G A;  3F73 A;  1JLQ A;  5AQS A;  4I9Q A;  4CEE A;  4B3T K;  4IOA L;  2UUC K;  3K5L A;  3F5T A;  2BH1 A;  5LY3 A;  4M7Y A;  3OJS A;  1VQK N;  4EZ6 A;  4PY5 A;  3ZEU A;  4YOU A;  4CF9 A;  3OYC A;  4DF4 A;  4B1V A;  1LWC A;  4OO1 J;  1RIL A;  5AQM A;  1ZBH A;  1VAZ A;  4CJ5 A;  5EY4 A;  1NK8 A;  1GLL O;  4AHC A;  3QNO A;  4O8U A;  1K73 O;  1SKS A;  4E19 A;  3MED A;  2OCE A;  2QK9 A;  2ZGY A;  3SI6 A;  5J1E A;  5IT9 O;  1VQL N;  4N5S A;  1CLQ A;  5EX5 A;  3C65 A;  1IKV A;  5F2R A;  3FZM A;  3HO1 A;  3F2K A;  4B9S A;  2QWR A;  3HSC A;  4CBX A;  4N41 A;  3WEE A;  3VER A;  2HNZ A;  2HST A;  4KH4 A;  3TTF A;  4ZTJ A;  1L3V A;  2HF3 A;  5EXW A;  1J6Z A;  1RNH A;  1XHX A;  4FWK A;  4O8K A;  1TKZ A;  4EHU A;  3F9M A;  3W0L A;  3WXJ A;  1TGO A;  4FWS A;  4FZY A;  2X6N A;  4KTQ A;  5C24 A;  4AHS A;  4LFA K;  4MQ3 A;  2IVN A;  4CZE A;  4CJU A;  5BPN A;  2YI1 A;  2X78 A;  3WXI A;  2BDP A;  1NGH A;  4DV2 K;  3G25 A;  3H45 C;  1NWK A;  3NBP A;  4CEQ A;  4H03 B;  2OTL N;  3QET A;  1X9J A;  3HBT A;  1NJZ A;  3A2F A;  3VGK A;  4DU3 A;  4DV7 K;  4CER A;  3ATV A;  4NYF A;  4BGB A;  1D5A A;  2YNG A;  1XHZ A;  3TSP A;  2A41 A;  1HX1 A;  1BWF O;  1RT3 A;  1HYZ A;  3OYD A;  4U7B A;  4KI6 A;  5JS2 A;  3V9Z A;  3BDP A;  2OZM A;  4DSI A;  2V7Z A;  2QM1 A;  3QLH A;  3G4S N;  4BR2 A;  3V1O A;  4JK9 A;  4QS9 A;  4BR5 A;  1XNR K;  3LP3 A;  3FZH A;  2Q97 A;  1XI1 A;  3K59 A;  3CCJ N;  1IG8 A;  2P9U B;  2YNH A;  5BRH A;  1SV5 A;  3SQ1 A;  3QO9 A;  3VEZ A;  4BRD A;  4GV9 A;  3SAF A;  1VQ4 N;  3CJA A;  4BE2 A;  4PKI A;  4JK8 A;  5C10 A;  1SAZ A;  5F0X A;  4Z4C A;  1F21 A;  4DKW A;  1VQ8 N;  2QWO A;  2CH5 A;  4PHT X;  2HHW A;  4JI4 K;  1SKW A;  5DM7 L;  1FKP A;  1RT5 A;  1OH8 A;  4RW6 A;  1TKX A;  1U45 A;  3AVL A;  4DSK A;  3NCI A;  3CIP A;  1SUQ A;  3B6O A;  3P83 D;  4XH5 A;  3BP8 A;  4CGJ A;  4ELV A;  3KK7 A;  3CCS N;  4LH4 A;  1YJW N;  3TPQ A;  1BO5 O;  4PA1 A;  1NGJ A;  4IDK A;  3VES A;  2O8B B;  4QS8 A;  3O80 A;  5C2F A;  4CHQ A;  1RBR A;  4OPA A;  4CHN A;  2YX6 A;  1BHL A;  5KI6 A;  1M1K O;  1LWE A;  3OYJ A;  3KZB A;  1OH5 A;  5TKY A;  4C8L A;  2QI2 A;  4BC2 A;  4CED A;  2ZF5 O;  3ULE B;  2RKI A;  4H0X B;  3F9K A;  2OPS A;  3IS9 A;  1WBD A;  5GIP A;  2QWM A;  4MO4 A;  1K8A O;  4ELT A;  4M3Y A;  4JD2 A;  5KPZ A;  4M3X A;  4FLT A;  2G8U A;  1NGI A;  1TL3 A;  3QIP A;  3VQD A;  2P9N B;  4DU4 A;  2AP1 A;  4LFC K;  2PFU A;  1GLF O;  4WFN L;  3A0I X;  3A5L C;  2G8V A;  4BC5 A;  4A57 A;  1MWM A;  2ASP A;  2GUP A;  5GAD P;  3CME N;  2IOC A;  1L3U A;  4WYB A;  3NVK A;  1QHA A;  1GLJ O;  1O13 A;  2KW4 A;  3NHG A;  2XY6 A;  5D3G A;  3THW B;  3GL1 A;  1CZB A;  1SZ2 A;  2RF2 A;  3AA3 A;  3VOV A;  4K8X A;  1R0A A;  2B5J A;  2Y1I A;  3DXK B;  4CJK A;  4FJ7 A;  4UQG A;  1NGE A;  5JVG L;  1S1W A;  3V9S A;  3L3V A;  3H3O B;  3TTD A;  2E20 A;  5BPM A;  2OAN A;  3MN7 A;  1C1B A;  4WF9 L;  4DF8 A;  4ISF A;  1N8R O;  4BDP A;  3TTC A;  4LF8 K;  4CJT A;  5HLF A;  4OLB A;  4CF1 A;  3WT0 A;  1K9M O;  1JLG A;  3HYF A;  4J8F A;  3OYL A;  3PX0 A;  1H1V A;  3QER A;  4NCG A;  2E2Q A;  4C8N A;  3S3O A;  1Q7Y O;  3CFP A;  4DV5 K;  2VWB A;  3LP1 A;  4O44 A;  4M41 A;  1TAQ A;  3BZK A;  3TSU A;  4KH5 A;  4J2B A;  5M1Q A;  3C94 A;  4FL9 A;  4JHD B;  1GLE G;  2OA8 A;  4YNQ A;  5AZI B;  3MAQ A;  3NH1 A;  1JLC A;  5KQD A;  1OVY A;  3WQU A;  1SL0 A;  4BY9 C;  3O8M A;  1N33 K;  5FPE A;  4B9Q A;  1HQU A;  3JSM A;  5AR0 A;  3C0B A;  3OYF A;  4DSF A;  1DGK N;  4E7L A;  2IC3 A;  3U6F A;  3AO4 A;  4E1J A;  5ADX H;  4CE9 A;  1UOC A;  1M90 O;  1NGF A;  1VRU A;  2XHB A;  4O4G A;  2HNY A;  5J2M A;  3SBG A;  4OPJ A;  1G15 A;  3ZEU B;  3OYG A;  1B9F A;  4HUG A;  4OKE A;  4DWI A;  1KAZ A;  4CJR A;  1ZBL A;  1NGG A;  2P9K A;  4J2D A;  3CJB A;  5AQJ A;  3FZK A;  2IVO A;  1MA9 B;  1NG9 A;  4CJW A;  3KJV A;  4IWV A;  3DJC A;  5AQP A;  3ZX2 A;  4WFB L;  4A2A A;  3SZ2 A;  3TAF A;  3BY5 A;  4KFB A;  3NF7 A;  3DXM A;  5BRF A;  3D7E O;  4BQL A;  4DS5 A;  3VQC A;  3OYA A;  4DMN A;  4DTR A;  4H0V B;  2BAN A;  3R8E A;  3WEE B;  3OBY A;  1DTT A;  2CH6 A;  4I9L A;  4G9Z A;  3TAQ A;  3QBX A;  1ATS A;  2HBK A;  3ZSZ A;  4JI5 K;  3C7N A;  5GAH P;  1WLJ A;  3B8A X;  3EZW A;  5IWA K;  4WQ5 C;  3P4I A;  3VQ7 A;  1GLD G;  3HT3 A;  4RW9 A;  3LDO A;  4I6M A;  4TSX A;  2O8C A;  1UA0 A;  3U8X A;  3TAP A;  1RDA A;  3CM6 A;  1S6P A;  2PYL A;  1KVB A;  1Q81 O;  2FBY A;  1N34 K;  3ZSX A;  2NZT A;  4DLE A;  5AQW A;  2HBJ A;  4CEZ A;  3LM9 A;  1HR0 K;  3PO5 A;  1BCM A;  1A5W A;  4FW1 A;  3AVH A;  3OJU A;  3J7A P;  2PY5 A;  3W3D A;  3SUP A;  4HWI A;  1TL1 A;  2YHW A;  1C0F A;  4HCC A;  3E66 A;  3CHW A;  2ZGZ A;  4LF7 K;  4F3T A;  3LAL A;  4Q5V A;  2P5G A;  3AVB A;  4H0Y B;  4DV3 K;  3QFP A;  5EOY A;  4LC9 B;  5HRO A;  3LAM A;  4YDU A;  1W9H A;  4YOW A;  3C95 A;  3DRP A;  3GOI A;  3KLI A;  4E1M A;  1XWL A;  3L2V A;  1ITG A;  1KC8 O;  4RW8 A;  4L8R B;  4NCB A;  2WOM A;  3VQP A;  3AGR A;  2UU9 K;  4I2P A;  3C6H A;  3J7Y P;  2GEL A;  4BRI A;  1L3S A;  2J4R A;  4CJV A;  3QEV A;  3O6W A;  5LJV A;  2OZS A;  3BEX A;  2E88 A;  1YI2 N;  2HB5 A;  4FXD A;  1BA1 A;  4YOR A;  3K57 A;  3L0Q A;  4KHS A;  4RW4 A;  1NOZ A;  3K9J A;  4DTS A;  4JI8 K;  3NF6 A;  5AQV A;  2F96 A;  3MEG A;  3ITH A;  1HYS A;  3DLE A;  3U9Z A;  2D0O A;  3ATU A;  1VQM N;  3H1V X;  3CMA N;  1YIT N;  4FOE A;  3D0P A;  3GBT A;  3NGI A;  1D4X A;  4F2R A;  4EZ9 A;  2YHA A;  3EL2 A;  1IJJ A;  1CZA N;  3K9K A;  3I8D A;  3VGM A;  3NF8 A;  4FVM A;  2I7P A;  3VQ4 A;  3V1R A;  4BRC A;  1C0T A;  4B1W B;  3CJ9 A;  5AQG A;  2G8K A;  3O1W A;  3VQ8 A;  2FF3 B;  3K58 A;  1NJY A;  4B08 A;  1S22 A;  3HK2 A;  4NLC A;  4UY8 O;  3L4Q A;  3A8Y A;  3ID8 A;  1HKB A;  4KTW A;  1NOY A;  4IJA A;  3TU5 A;  1QQM A;  1U49 A;  3CPW M;  3VET A;  1VQP N;  4I2Q A;  4JS4 A;  4ISG A;  4JD2 B;  3QDK A;  5A2Q O;  4EHT A;  5FDL A;  3G0Z A;  1HJR A;  3MCA B;  5BRE A;  1HNZ K;  4CZI A;  1S72 N;  3HXM A;  3ZCM A;  3VPZ A;  2F8T A;  4FYD A;  1U2V A;  1EQY A;  3ENB A;  1VQO N;  4CJF A;  1JJ2 M;  2FXU A;  2O8F A;  3SJH A;  3QEI A;  3DYA A;  5CHI A;  3SNN A;  1HNW K;  3HPH A;  3EO3 A;  1YHQ N;  3SPZ A;  4OVL A;  1KXP A;  3PIO L;  3RMC A;  1LCU A;  2Q3S A;  3D2E A;  4LF5 K;  1UAX A;  4C8O A;  3R9P A;  3CYM A;  4CEB A;  3MCP A;  4YHH K;  1KAY A;  1NMN A;  4O55 A;  4CK2 A;  5HBM A;  2HHH K;  4EP4 A;  4X66 K;  3VQE A;  3KLG A;  4PL8 A;  3SMS A;  1ZBS A;  4QOZ B;  1BOT O;  3LAN A;  4CEC A;  1KRP A;  4GMJ B;  3VA3 A;  4K0K K;  4Y1C A;  4BVO A;  3LL3 A;  2E2P A;  3RMD A;  1NK9 A;  3V81 A;  4B9T A;  3ZSQ A;  4CK1 A;  1HQE A;  3VN5 A;  5J2Q A;  3WNE A;  5AQZ A;  2V7Y A;  2ITM A;  3HM9 A;  1V4S A;  3KWG A;  1B92 A;  2YHY A;  3OS2 A;  1VQN N;  4B3R K;  2HND A;  2YHB A;  2HVH A;  3S3M A;  1RDD A;  3HP9 A;  3L6Q A;  3RR8 A;  3RWU A;  3PV8 A;  3KWI A;  1VSJ A;  5E84 A;  2VWJ A;  4JKF A;  3L4I A;  2GBZ A;  1FJG K;  1MU2 A;  4BQZ A;  1VQ7 N;  4LF9 K;  1T6D A;  2E2N A;  3CI5 A;  1IBK K;  3S41 A;  1YUW A;  2FSJ A;  3CCV N;  4FWL A;  1JCG A;  1RDB A;  3SK3 A;  3HP6 A;  1S1X A;  3AO1 A;  1TKD A;  2JWL A;  4CHZ A;  5AQN A;  1HJO A;  1NGA A;  4H0P A;  2D1K A;  4HHT A;  1NJW A;  4FJJ A;  4A59 A;  2GWK A;  3VF6 A;  1WN7 A;  4Z94 A;  1EWR A;  1JLA A;  3FLC O;  2D0P A;  1R59 O;  4CJL A;  4OGE A;  4BRN A;  3CCR N;  5I9E B;  1VSL A;  1QS4 A;  3H46 O;  3M3Z A;  4FM1 A;  3SQ2 A;  3DXM B;  3EEQ A;  4JV5 K;  1BGX T;  5ELZ A;  4NLB A;  3GDQ A;  5ADX A;  5C2D A;  4YOX A;  4OPK A;  3MEE A;  1HKC A;  2G8F A;  3WUH A;  2UXB K;  3UIQ A;  1NK6 A;  4Q0B A;  1BI4 A;  4BRP A;  3AA2 A;  5FRM A;  3C7N B;  3O1B A;  3RRG A;  4KB1 A;  3FZL A;  5KGX A;  5H1S Q;  1IBM K;  2ZE2 A;  2A3Z A;  3N4Q A;  4KKO A;  4X65 K;  2I5J A;  1S1U A;  2W6L A;  4FWN A;  4DQQ A;  4I6M B;  3PIP L;  2O8C B;  1C1A A;  2WFB A;  3FFI A;  2ZM6 K;  4I7F A;  2WTU A;  2QXL A;  4DV6 K;  3ZT4 A;  3KKR A;  2W40 A;  4DLG A;  4CGI A;  1VHX A;  3QIC A;  1FW6 A;  1VQ6 N;  4DSJ A;  3ENO A;  3I0R A;  1VSF A;  2RPI A;  3T19 A;  4MLE A;  2O8D A;  4FPA A;  2GEM A;  2QXF A;  2EX3 A;  2QWP A;  3NH2 A;  1X3N A;  1VQ9 N;  3TAM A;  5AQR A;  5CE3 A;  5AQY A;  3VMF B;  3CC2 N;  3O3F A;  1WSJ A;  1NKB A;  3M8P A;  3KLE A;  3DWL A;  3I0S A;  4AHU A;  3T69 A;  1DEJ A;  4DR3 K;  4JI0 K;  4K25 A;  4DS4 A;  1RBU A;  4LSL A;  4BRO A;  1HRH A;  2PYJ A;  2ITG A;  4B3O A;  4CGF A;  4BGA A;  3LPT A;  4CZH A;  3GE1 A;  5DMR A;  3NGY A;  4IKF A;  3CJC A;  3TAG A;  4PWD A;  2VG7 A;  2XO7 A;  3BGR A;  5CY4 A;  4BRH A;  4F3O A;  5AQQ A;  1T44 A;  1WAF A;  4JKE A;  4IG0 A;  1S1T A;  3HTV A;  4C8M A;  1DLO A;  4MDB A;  3SAH A;  4CJQ A;  4DQP A;  4DUZ K;  4FLV A;  1HNV A;  5AQO A;  4CZM A;  3AVK A;  3CG7 A;  3DM2 A;  1SKR A;  4HTU A;  3O4N A;  2ETJ A;  4QAG A;  4X62 K;  1QZ5 A;  3LP2 A;  4KB0 A;  5CR4 A;  2A42 A;  3V9W A;  1TKT A;  3IMX A;  4DUY K;  3FE1 A;  2ZD1 A;  2B6A A;  4CD3 A;  3VQ6 A;  2GX9 A;  4GW6 A;  5AQU A;  1WBB A;  4BRM A;  3FZF A;  4Y1D A;  5HRN A;  1JL1 A;  4H5R A;  4DTO A;  1VK0 A;  4LFB K;  4Y0W A;  2JWK A;  3ID6 A;  4JKC A;  4KHY A;  4DFP A;  3AVJ A;  4A5A A;  4M3Z A;  3I33 A;  3DRR A;  2NRR A;  3OS1 A;  4BAC A;  2P9L A;  1X1P A;  3A5N C;  1TAU A;  1RDW X;  3O4W A;  4U67 L;  4C8K A;  3N4P A;  4O5B A;  4CFA A;  4FW2 A;  4CES A;  5SWM A;  1QQC A;  2IS3 A;  3TAN A;  4BE0 A;  3TSQ A;  1Q82 O;  2QTD A;  1XUP O;  3EZ5 A;  3MN6 A;  3ENH A;  5C0Y A;  5JLH A;  4DR7 K;  5I3U A;  4DQS A;  3SCX A;  4ID1 A;  1X9M A;  4DR4 K;  1QTM A;  4B8A B;  3PX6 A;  2O8F B;  2HMP A;  1IKX A;  4OGC A;  2F7T A;  2VGM A;  3ZSY A;  3PX4 A;  1SL2 A;  3D2E B;  3ZET A; 
#chains in the Genus database with same CATH homology
 3E66 A;  2E2O A;  3CHW A;  2Q0U A;  2ZGZ A;  3SMP A;  3AY9 A;  3E9P A;  5M1N A;  4H0Y B;  5M1O A;  3MN9 A;  3QFP A;  1P8Z A;  5EOY A;  2QWN A;  4LC9 B;  4JKA A;  5JVH L;  3VTH A;  4K41 A;  3UB5 A;  4YDU A;  4RWT A;  4A5B A;  3ZX0 A;  4C1N I;  1E4G T;  4YOW A;  4JKG B;  3UKR A;  4IFE A;  4WFA L;  3GOI A;  3LDN A;  2KKZ A;  5AQX A;  1HKG A;  2D4W A;  2ZWH A;  3AAP A;  1KC8 O;  3U9D A;  2ZJR L;  3OW2 M;  3OBW A;  4KH6 A;  4YOY A;  3AAQ A;  2WBN A;  3NMU A;  4NB4 A;  4A62 A;  2HBM A;  3AGR A;  4FWP A;  2VCP A;  3E1Y A;  4GV6 A;  4A61 A;  1X3M A;  5GAG P;  3KVG A;  4M63 C;  3T7Z A;  3C6H A;  5E26 A;  2GEL A;  2FSK A;  3CC4 N;  4BRI A;  4GVE A;  1YJN N;  3ZX3 A;  2BTF A;  2J4R A;  2VYP A;  3DAW A;  3WXM B;  4C23 A;  5BR9 A;  1QQO A;  3O6W A;  5LJV A;  3E9O A;  1G99 A;  3DLL L;  3D6R A;  3BEX A;  5AFU H;  2E88 A;  1YI2 N;  3I8B A;  1Q86 O;  1BA1 A;  4CZJ A;  5KPT A;  4YOR A;  4FVU A;  3I55 N;  3L0Q A;  1TYQ A;  4B1Y B;  4BRE A;  2NNW A;  1KD1 O;  3K9J A;  3CF5 L;  5AQV A;  3AAR A;  5AQS A;  3G71 N;  2QWL A;  1XC3 A;  4IOA L;  1VQ5 N;  3VEW A;  3F5T A;  2BH1 A;  2A5X A;  2P9S A;  4FWO A;  2A6A A;  2D0O A;  4M7Y A;  3U9Z A;  5LY3 A;  3ATU A;  5AQH A;  3H1V X;  1VQM N;  1VQK N;  3CMA N;  3ZEU A;  1YIT N;  5AZJ A;  1NGD A;  4FOE A;  4YOU A;  5C12 A;  2H3G X;  3GBT A;  3P38 A;  4IEI A;  3UKU B;  4B1V A;  1TUY A;  1D4X A;  4OO1 J;  3E9L A;  5AQM A;  1KAX A;  3EL2 A;  1VAZ A;  1IJJ A;  1CZA N;  2RE2 A;  3K9K A;  5EY4 A;  4XEI A;  3VGM A;  3P31 A;  4BC3 A;  1GLL O;  1U6Z A;  2I7P A;  1T6C A;  4O8U A;  1K73 O;  1HPM A;  4BRC A;  4IOC L;  2ZGY A;  5AQI A;  2E8A A;  4B1W B;  1ZXO A;  2E1Y A;  3CJ9 A;  3O9U A;  5AQG A;  1YAG A;  4WCE L;  1VQL N;  3O1W A;  2FF3 B;  5EX5 A;  5M1F A;  1S22 A;  3C65 A;  4NLC A;  4UY8 O;  3L4Q A;  2UYT A;  3A8Y A;  5F2R A;  3FZM A;  4O5F A;  4CZG A;  1HLU A;  1HKB A;  3ID8 A;  4FOI A;  4OPH A;  3F2K A;  4CD1 A;  2AA4 A;  2QWR A;  3HSC A;  4IJA A;  4CBX A;  3WEE A;  1QQN A;  3QFU A;  3TU5 A;  1QQM A;  3VER A;  5BPL A;  2HST A;  3IKM A;  4KH4 A;  3TTF A;  2HF3 A;  3CPW M;  5EVZ A;  3JXU A;  5EXW A;  1J6Z A;  4FWR A;  3CQX A;  4FWK A;  4O8K A;  3EE8 A;  1K8K A;  3VET A;  4EHU A;  5GAE P;  1VQP N;  3F9M A;  3J7Z O;  4ISG A;  3W0L A;  2P9I A;  2GWJ A;  3QDK A;  4JD2 B;  4EHT A;  1Y64 A;  3CJ1 A;  3WXJ A;  4FWS A;  2A40 A;  4FSV A;  1RFQ A;  2CGL A;  3MCA B;  4ILJ A;  5F1X A;  3CCU N;  2P9P B;  4GV3 A;  2PAV A;  5BRE A;  4PKG A;  1BA0 A;  5FPN A;  4DCH A;  4CZI A;  1S72 N;  3VEV A;  2IVN A;  4CZE A;  3HRG A;  1U2V B;  5BPN A;  2YI1 A;  3VPZ A;  1U2V A;  3WXI A;  1EQY A;  3ENB A;  2KLA A;  1EO1 A;  1NGH A;  1VQO N;  3BF1 A;  5HOO A;  1JJ2 M;  2FXU A;  1QZ6 A;  3G25 A;  3SJH A;  3H45 C;  1NWK A;  2QW9 A;  4FWM A;  5CHI A;  4RCH A;  3M5R A;  2OTL N;  4H03 B;  3VEY A;  3O5B A;  3EO3 A;  1YHQ N;  1KXP A;  3MWT A;  1X9J A;  3HBT A;  3PIO L;  1LCU A;  1TUU A;  2RHK A;  3D2E A;  2YCH A;  3R9P A;  3VGK A;  4JN4 A;  3MCP A;  3ATV A;  1KAY A;  4IDH A;  4BGB A;  3TSP A;  1GLB G;  2A41 A;  2QEX N;  1S3X A;  1HX1 A;  4PL8 A;  1BWF O;  3SMS A;  4U7B A;  1ZBS A;  2EWS A;  1BOT O;  4JKG A;  3CCQ N;  3R3L A;  2ZJP L;  2V7Z A;  3D2F B;  1JCF A;  4AM6 A;  2QM1 A;  3G4S N;  4K43 A;  4BR2 A;  4R79 A;  4JK9 A;  4QS9 A;  4BR5 A;  1YJW N;  3CET A;  3FZH A;  2Q97 A;  4BVO A;  4YOT A;  3LL3 A;  2E2P A;  5BN9 A;  3CCJ N;  1IG8 A;  2P9U B;  3WQT A;  4IO9 L;  5BRH A;  1GLA G;  3H6E A;  4ISE A;  3VEZ A;  5AQZ A;  2V7Y A;  4PKH A;  2ITM A;  4BRD A;  4GV9 A;  1V4S A;  3KWG A;  2YHY A;  4BR9 A;  2QA4 N;  1KQS M;  3MN5 A;  1VQN N;  2NRZ A;  3EKU A;  2Q31 A;  3SAF A;  4DB3 A;  1VQ4 N;  3CJA A;  3MK6 A;  2F9T A;  3L6Q A;  4L3Q A;  5M1K A;  3OHR A;  3QB0 A;  4PKI A;  1YJ9 N;  5JLF A;  5JMV A;  5LJW A;  3EN9 A;  4JK8 A;  3MMV A;  4EAH D;  5C10 A;  3KWI A;  1SAZ A;  3VEN A;  3EKS A;  5F0X A;  5DM6 L;  5E84 A;  4JKF A;  3L4I A;  4DKW A;  4BR0 A;  4WQ5 A;  1E4F T;  2FLO A;  1VQ8 N;  2QWO A;  4BQZ A;  5M1P A;  1VQ7 N;  3VEO A;  1T6D A;  2CH5 A;  3O9Q A;  4PHT X;  2E2N A;  4MLH A;  2IIR A;  3CD6 N;  3CI5 A;  4MO5 A;  4CZK A;  2PBD A;  4BG9 A;  3MX2 A;  3S41 A;  1YUW A;  2FSJ A;  3CCV N;  4FWL A;  1JCG A;  1NM1 A;  4CBW A;  4BRQ A;  3SK3 A;  3FR0 A;  4M7X A;  2NRX A;  3R6M A;  5DM7 L;  1T3V A;  1DT9 A;  2IVP A;  3FFK B;  5GIO A;  3IFR A;  2JWL A;  1ATN A;  1NLV A;  3UKU A;  4C1N K;  3QBW A;  5AQN A;  1HJO A;  4YDU C;  1NGA A;  3CIP A;  4H0P A;  2D1K A;  2W41 A;  4XH5 A;  4A59 A;  1DKG D;  3BP8 A;  5KPR A;  5GIN A;  2GWK A;  2E1Z A;  3KK7 A;  1Q18 A;  3M1F A;  4MDA A;  3VF6 A;  4BRG A;  4Z94 A;  1V4T A;  3HZ6 A;  3TPQ A;  4BRL A;  3H3N O;  1BO5 O;  2WC9 A;  1NGJ A;  2V52 B;  3NVM A;  2YHX A;  2D0P A;  3CPE A;  3FLC O;  4BRA A;  3VEX A;  1R59 O;  4XH1 A;  3VES A;  4QS8 A;  3O80 A;  5C2F A;  4EFH A;  4BRN A;  3P39 A;  3CCR N;  4OPA A;  5I9E B;  2YX6 A;  1M1K O;  3UE5 A;  3H46 O;  3M3Z A;  3KZB A;  4CBU A;  3DXM B;  5TKY A;  1Z6R A;  2QI2 A;  4A2B A;  4BC2 A;  5ELZ A;  4NLB A;  3GDQ A;  5ADX A;  5C2D A;  2ZF5 O;  3ULE B;  4YOX A;  1HKC A;  1RDU A;  4H0X B;  3WUH A;  1YIJ N;  5MLC Q;  2P9L B;  5GIP A;  3QML A;  2ASM A;  2QWM A;  1BU6 O;  3O9T A;  4MO4 A;  1BG3 A;  4JD2 A;  4BRP A;  5AQL A;  5KPZ A;  1K8A O;  1NGC A;  3C7N B;  3O1B A;  1NGI A;  4GNI A;  5JIC A;  3PLA A;  2P9P A;  2P9N B;  1MWK A;  3FZL A;  5H1S Q;  3N4Q A;  2A3Z A;  3HOT A;  2ZJQ L;  1NJI O;  2AP1 A;  2PFU A;  4FWN A;  1GLF O;  4I6M B;  4WFN L;  2Q1N A;  3A0I X;  3RSE B;  3PIP L;  3A5L C;  3A5M C;  2WFB A;  4A57 A;  3KHY A;  1MWM A;  4RTF D;  4BC5 A;  5BN8 A;  2ASP A;  2GUP A;  5GAD P;  3U4L A;  3CME N;  2QXL A;  2QWQ A;  4WYB A;  2KHO A;  5C15 A;  3NVK A;  3CCS N;  4QS7 A;  1QHA A;  3O08 A;  1GLJ O;  1O13 A;  2W40 A;  1YVN A;  4IJN A;  4WQ4 A;  3QIC A;  2GTD A;  3GL1 A;  3MWP A;  1VQ6 N;  1SZ2 A;  3ENO A;  3Q7C A;  3WXK A;  3IUC A;  2BUP A;  4MLE A;  4FPA A;  2GEM A;  3VOV A;  1NGB A;  4BRF A;  5BRD A;  1LOT B;  1WOQ A;  2Q0R A;  3DXK B;  3A5O C;  2QWP A;  4JKH A;  3ZET B;  1X3N A;  1VQ9 N;  5AQR A;  5CE3 A;  5AQY A;  1W2B M;  1ATR A;  1NGE A;  3VMF B;  3CC2 N;  5AQF A;  5JVG L;  3DXK A;  3AGK A;  3H3O B;  2E20 A;  3TTD A;  5BPM A;  3BF3 A;  2CGK A;  1NBW A;  2OAN A;  3MX5 A;  3MN7 A;  4WF9 L;  3DWL A;  4ISF A;  3MDQ A;  1N8R O;  3TTC A;  4CZL A;  1RGI A;  3D2F A;  3T69 A;  1DEJ A;  3UKR B;  4JEP A;  4K25 A;  5FPM A;  4B1Z A;  3WT0 A;  1K9M O;  2Q2R A;  4HTL A;  4BVP A;  4BRO A;  4J8F A;  1W97 L;  1H1V A;  3WXL A;  4BRK A;  2E2Q A;  1MDU B;  4BGA A;  1Q7Y O;  2P9U A;  3LDP A;  5FPD A;  3CQY A;  2VWB A;  3GE1 A;  3SBT A;  2FF6 A;  4CZH A;  3TSU A;  4KH5 A;  4BG8 A;  3CJC A;  4FWQ A;  5M1Q A;  2WUS A;  4FL9 A;  2I7N A;  3LDQ A;  4JHD B;  4EIA A;  1GLE G;  4H5N A;  5AZI B;  4DQ8 A;  4BRH A;  4BR7 A;  4H5T A;  5TKW A;  5AQQ A;  3LM2 A;  1T44 A;  4JKE A;  4JHD A;  1NMD A;  5KQD A;  1OVY A;  2VGN A;  3WQU A;  4BY9 C;  3HTV A;  5AZI A;  2NRT A;  3HM8 A;  1OKJ A;  3O8M A;  4IXC A;  3H1Q A;  4MDB A;  5FPE A;  3SAH A;  3CCM N;  4B9Q A;  2DPN A;  2HBL A;  2F9W A;  4ILH A;  5AQO A;  4WQ4 C;  1TYQ B;  4CZM A;  5AR0 A;  3C0B A;  1DGK N;  1YXQ A;  4NO7 A;  4YOV A;  4CZF A;  4CI6 A;  4E1J A;  5ADX H;  1M90 O;  1QZ5 A;  2YJE A;  3VTI A;  1ILY A;  4JNE A;  1NGF A;  4BC4 A;  5CR4 A;  2A42 A;  2P9S B;  3IMX A;  3SBG A;  3IDH A;  2V51 B;  4JKB A;  3RVC A;  2NRW A;  3FE1 A;  3OA9 A;  3ZEU B;  5AZJ B;  4IOX A;  4IZ9 A;  2P9K B;  1SQK A;  4BR4 A;  1KAZ A;  4CD3 A;  2FSN A;  2NRV A;  2GX9 A;  3GG4 A;  5AQU A;  3I56 N;  1ESV A;  1NGG A;  4H5W A;  2CGJ A;  2P9K A;  3VF4 A;  3CJB A;  3Q7B A;  5AQJ A;  3FZK A;  2IVO A;  4H0O A;  4B1X B;  4BRM A;  1C0G A;  3CCE N;  1MA9 B;  3FZF A;  1WUA A;  3O9S A;  2YJF A;  4IO8 A;  5AFU A;  1QVF M;  4H5R A;  1GLC G;  4IWV A;  3DJC A;  1BUP A;  5AQP A;  3ZX2 A;  4WFB L;  4A2A A;  1JCE A;  3CCL N;  2HF4 A;  2NRH A;  2ASO A;  2JWK A;  4Y0W A;  4PL7 A;  3DXM A;  3ID6 A;  3D7E O;  3EE9 A;  5BRF A;  4BQL A;  4JKC A;  3J8A A;  4H0V B;  3ULE A;  4A5A A;  4XH4 A;  5HL7 L;  3G6E N;  3R8E A;  3I33 A;  3OBY A;  3WEE B;  1QVG M;  2NRR A;  4AF1 A;  4B1U B;  3LDL A;  4JKD A;  4DHY A;  1Z05 A;  2P9L A;  3C6A A;  4IEE A;  3CXC M;  2CH6 A;  4KBO A;  4G9Z A;  1HUX A;  4F9O A;  3QBX A;  3A5N C;  3CC7 N;  1K8K B;  4FO0 A;  1RDW X;  1ATS A;  2HOE A;  3O4W A;  1BDG A;  2HBK A;  3C7N A;  4U67 L;  2P9I B;  3N4P A;  3SLC A;  5GAH P;  3B8A X;  3EZW A;  4WQ5 C;  3P4I A;  3SAG A;  2P9N A;  3FGU A;  1GLD G;  3HOS A;  1SS6 A;  5AQT A;  3LDO A;  3TSQ A;  1Q82 O;  1YF5 L;  2QTD A;  5B8H A;  1XUP O;  4I6M A;  3RSE A;  3CER A;  3MN6 A;  4H0T B;  1C0F A;  3ENH A;  3U8X A;  3VF2 A;  5C0Y A;  4CJ7 A;  5JLH A;  3CJ7 A;  2OTJ N;  3JS6 A;  4GY2 B;  1Q81 O;  3O9R A;  2NZT A;  4AM7 A;  5KQ8 A;  2Q36 A;  5AQW A;  2HBJ A;  3ZYY X;  3R1X A;  2HMP A;  3LM9 A;  4ILG B;  3BUZ B;  1P90 A;  4FPB A;  2F7T A;  3M6G A;  3HI0 A;  2VGM A;  5AQK A;  4K42 A;  4JAX A;  3W3D A;  4HWI A;  1XQS C;  2YHW A;  4H5V A;  4JK7 A;  1ZC6 A;  3VGL A;  3D2E B;  2NLX A;  3ZET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...