1P90A

The three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
b'ERVPEGSIRVAIASNNGEQLDGHFGSCLRFLVYQVSAKDASLVDIRSTLDVALAEDKNAWRVEQIQDCQVLYVVSIGGPAAAKVVRAGIHPLKKPKGCAAQEAIAELQTVMAGSPPPWLAKLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
molecule tags Protein binding
source organism Azotobacter vinelandii
publication title The Three-dimensional Structure of the Core Domain of NafY from Azotobacter vinelandii determined at 1.8 A resolution
pubmed doi rcsb
total genus 40
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1p90A00
1RDUA 1P90A 2KLAA 1O13A 2QTDA 2RE2A 1EO1A 2YX6A 2WFBA 1T3VA
chains in the Genus database with same CATH superfamily
1ZXOA 1WSEA 3UE5A 4JD2B 3AO4A 2D0PA 3SYZA 3HL8A 3NMUA 3T3FA 4CZIA 2ASPA 4YOUA 4K42A 4BRMA 1OVYA 5M1OA 2PAVA 3OYIA 1QHTA 3HRGA 1YAGA 3ASMA 2O8EB 5EXWA 1JLFA 2HBMA 1IG8A 1VQMN 5I3UA 1RFQA 1VQ6N 1J5OA 3THYA 2IOCA 3P38A 3KKRA 2JLEA 2Z1GA 3O3FA 1NKBA 4IBNA 1A5XA 4CGFA 2XRIA 5EVZA 3HK2A 1SKWA 4OKKA 2HB5A 1JLGA 5AQUA 3CC2N 4YOTA 1IG9A 4LFCK 4B1UB 4C8MA 4H0PA 4KBOA 2OTJN 4CEDA 1EWQA 3RR7A 4FJNA 1KC8O 3C95A 2ZF5O 5GINA 1RT3A 3SUOA 3OYBA 4GV6A 2O8BA 1VHXA 3SQ2A 1HQUA 1TV6A 2YNIA 4UY8O 4B3RK 1NGDA 5GAHP 1J6ZA 1JLAA 2A5XA 1Z26A 1XUPO 1GOCA 1HKGA 4E7HA 3VEYA 4PA1A 1VQON 1BA1A 4BR2A 4CJPA 1BDGA 5M1KA 4M3ZA 5HOOA 1YITN 5GAEP 1XWLA 4MO5A 4A5BA 2P9UA 4I2PA 1TKXA 4JS5A 5I9EB 3I8BA 1XC3A 3OYHA 5AQKA 4CZEA 2O8FA 3AO1A 1NG9A 4PKGA 1HYSA 3BZCA 3NVKA 4YOYA 1CXQA 3KWIA 2QWOA 2HHVA 3SLCA 2P9SA 4JI0K 4IWVA 4M3WA 1EX4A 4DQSA 4Z4HA 1BCOA 2RHKA 3PX6A 2D0CA 3IFRA 1J54A 3CJBA 4FCYA 3L6QA 4DHYA 1BISA 4CIEA 5GAGP 4IOAL 3M8SA 3VA0A 2KLAA 4FK2A 1X3MA 4FZYA 2HBJA 1IKWA 3AY9A 4F9OA 5HROA 1E4GT 3R1XA 1VSEA 3OA9A 2GUIA 1WLJA 4BREA 2FF3B 2P9SB 4FLVA 1DLOA 3E9OA 1VQKN 2HHSA 4BRQA 2OPSA 3GG4A 4JKHA 1KLMA 4GKKK 1NJIO 1S9EA 3CM6A 4DR6K 3D7EO 3DLGA 4BRPA 1WSFA 2PYJA 4EZ6A 5EOYA 3O9UA 4NYNA 2QK9A 3MX5A 3KHYA 4IDKA 3MN5A 3BF1A 1NKCA 5AQXA 3LZIA 2HVIA 4BR0A 4CJSA 2HF4A 3CCSN 1EO1A 2FSNA 4B1YB 4BY9C 4KREA 3O1WA 3A5MC 4KFBA 4ZTFA 3QO9A 4RW4A 1TAQA 1WOQA 3L2QA 1SV5A 4GV9A 3LDSA 5SZTA 4IJNA 4KTWA 3ID8A 4LY7A 5C15A 3VF4A 2XY6A 1KFDA 1P8ZA 1R59O 3NF8A 2Q0RA 4DTJA 2JGUA 2ETJA 1SL0A 3MMVA 3VQCA 3CETA 3SK3A 3FFIA 2IS3A 3QNOA 1QZ6A 3MXMA 3DOLA 3AVLA 1TK0A 3ZCMA 4DSIA 1CXUA 1SS6A 3EZ5A 1Y64A 4CJ7A 4B1ZA 4NCBA 3VQDA 5FDLA 3CERA 4GY2B 4JEPA 2HBLA 4FXDA 5J2MA 3N4PA 3OHRA 1TGOA 3V4IA 2V7ZA 3NE6A 3O4QA 4EIAA 4BR4A 2QWNA 4CD3A 3CMEN 4NXMK 2D0BA 2IVOA 1WAJA 4FWLA 3KD5E 2LSNA 4M3YA 1ZBUA 4DS5A 5C12A 3HOSA 4DCHA 1S5JA 4RG8A 3G4SN 4IEIA 4CJTA 3AA2A 4LFBK 1JCFA 1NBWA 1I3AA 4LSNA 1DTQA 3KVGA 3LP2A 2NRZA 3D2FA 1S6PA 1T05A 3PIPL 4BVOA 2RE2A 1NGGA 3CXCM 1FKOA 4X66K 1ZBIA 3E66A 3QMLA 2HMIA 3I0RA 5BPMA 1D9DA 3P4IA 2P5OA 1H1VA 3KWGA 2W41A 1C0TA 3MN7A 4FJHA 1NMNA 1BUPA 3VQ7A 1BU6O 3CCEN 1LCUA 5BR9A 4DQIA 3SZ2A 3QDKA 3VENA 4H8KA 4WFNL 2P9KA 4GV3A 1EKEA 3ITHA 3WT0A 2OPRA 1KLNA 4E3SA 4FJKA 4MLHA 4DSLA 1V4SA 3NCIA 4PHTX 4L3QA 1YIJN 1MDUB 4RWTA 3P5JA 3AVJA 4CERA 3TPQA 2W6LA 3DRSA 3WQTA 1KFSA 4FJLA 2E2OA 1NK9A 4CFDA 3AGRA 4B9MA 3WXJA 3N4QA 5AQGA 3H45C 3U9DA 1Q9YA 2HNZA 5J2NA 2QWMA 2BDPA 3TSQA 2Q36A 3J8AA 1KVAA 2QWPA 4ISEA 1OVQA 2VQEK 1JJ2M 3LM9A 1BQNA 1JLEA 4PQUA 3VEXA 3DRRA 2ASMA 1UA1A 2HW3A 3WXIA 1C6VA 3DRPA 3ZSYA 3THYB 3ZSVA 4IG0A 4BC2A 4DTNA 1HMVA 3D45A 2ZWHA 3CIPA 2Z1IA 1RBTA 3O9QA 3V9ZA 1VQ5N 1V4TA 1BOTO 2QXFA 3F2KA 4H5TA 4JD2A 4K43A 5JLHA 1D9FA 3RSEA 3LANA 2QXLA 3WEEA 3G6EN 3LDQA 1NGBA 3IRXA 3VQ6A 4JRQA 1NU0A 1NGAA 2ZGYA 1X1PA 2OANA 3RWUA 3QICA 2QKKA 5BRDA 1U4BA 4HTUA 4WQ5C 1A5WA 3ENBA 4F4KA 1BA0A 3AA3A 4DF8A 3WUHA 2BANA 1QHAA 4FYDA 4CJ3A 3V81A 2XY7A 2HHQA 5AQWA 4DFPA 3GE1A 5AZIA 4B3TK 4BG8A 3BGRA 3BY5A 5HBMA 3O3HA 3LPTA 1IBLK 4Z0UA 3QERA 3NGIA 4EFHA 3WQUA 1NM1A 3RMAA 4O8KA 4M63C 4FWNA 4KHYA 3QIPA 4G9ZA 3E01A 4A61A 3T1HK 1JCGA 3H1QA 2X6SA 3F9MA 4BC4A 1RT7A 2GTDA 3MX2A 3C7NA 4CF8A 3TAGA 1HNWK 2UUAK 2UXBK 3IKMA 4LD0A 4YOWA 2QWQA 4DQQA 1SUQA 2E2PA 3HTVA 3QEVA 3FZKA 1NK0A 2NRVA 4HUFA 4E0DA 1O1WA 1I39A 2RKIA 5AQQA 4JV5K 1XI1A 1C0MA 1S1VA 3B8AX 1ZBLA 1HNZK 5BR8K 4FJIA 4PKIA 1XMOK 3QB0A 4OPHA 1RBRA 1ASVA 5C42A 1E3MA 4BRDA 4ZHRA 1RTHA 4WYBA 1BHLA 4C8NA 4B9VA 1FXXA 1UOCA 3LP1A 2FBTA 4IDHA 3P31A 3NFAA 4CEFA 5KGWA 3Q7BA 2FXUA 2BE2A 4FK0A 3CMAN 1M90O 1RBVA 4LH4A 3VQBA 4CFCA 1ILYA 4FWRA 4DV3K 1NJWA 2CH6A 3RRGA 3K5LA 5A2QO 1IO2A 4HWIA 1GLFO 4PL7A 3V9SA 4E7KA 2HOEA 2H3GX 5HRPA 3BF3A 3P1GA 4O4GA 4HHTA 2E6MA 4QS7A 1YJWN 2OZMA 1JLBA 3SQ1A 5CY4A 1EWRA 1VSHA 2P9LA 3FFKB 4DV7K 4FLXA 3SNNA 2O8EA 5AR0A 3DLLL 4IO8A 4PWDA 3UKUA 4DQ8A 3H08A 4I9QA 5J1EA 3L2WA 4MO4A 1S1XA 2YHBA 2EWSA 3P83D 5HRNA 3V9WA 1ESVA 4B8CA 2YHXA 5AFUA 3OYMA 5ADXA 4FPAA 4UQGA 5FRMA 4B3MK 2G8UA 3PY8A 1LV5A 5DM7L 1WAFA 5HRRA 4BROA 1NJZA 4ZTJA 1RT5A 2E6LA 3RR8A 2O8DB 4CZFA 2ZGZA 3VGKA 4BGBA 2VCPA 2VG6A 1B9DA 3QFPA 1BWFO 4F3OA 4CZGA 2QTDA 3FZMA 3L4QA 1BCMA 4DSKA 3V1QA 4O8UA 3CCQN 3OS2A 3IDHA 5AQNA 1S22A 3QBXA 1ATRA 1WN7A 5AQJA 3I55N 4F3TA 3SV3A 1NJXA 3K58A 4DQRA 2YHWA 3ATUA 1K8KA 1CZBA 2A42A 3K57A 2ASOA 3VGLA 3OJSA 2VG5A 3K2PA 4LSLA 3ZT0A 3THXA 3J80O 3ZT2A 4AHCA 4LF5K 2KZMA 4KH5A 4B9UA 4BVPA 4DTXA 3AARA 1D4XA 3BP8A 3CJAA 1HKBA 1FJGK 1NOZA 3LM2A 4BDPA 3C6TA 2E5LK 4JKEA 4MLEA 2HNDA 1P90A 2V51B 5JVHL 3CFRA 3JS6A 3C0BA 4C8OA 3IMXA 1NK8A 1KVCA 5LY3A 2GEMA 3RMBA 2P9PB 2VWKA 3EKUA 5CR4A 3VTHA 4CW7B 4YOXA 2G8FA 1RGIA 1QZ5A 1VRUA 1J5EK 5D3GA 3I8DA 1R0AA 3OYEA 3SUQA 2Q31A 3ZSQA 4E1NA 3GDQA 4FWKA 5KI6A 4K8XA 5E26A 4H5VA 4JRPA 2HMPA 3AAQA 4BRAA 5BREA 4BR5A 4JKAA 1TUYA 3LWMA 4O0JA 3SJHA 3A0IX 2P9IB 4CJRA 3B6PA 3OBWA 4DR2K 1TK5A 5M1QA 4WFAL 1VQLN 4FWQA 4CD1A 3TTFA 4OGCA 1X9JA 1HYVA 4N41A 3ZYYX 1QTMA 2QEXN 2ITGA 4NCAA 4JHDB 5F1XA 3VETA 3DJCA 1UAXA 4BGAA 1J9AA 4R5PA 3LP3A 4CF1A 1C1CA 4EP4A 4M3UA 2Y1IA 3K5OA 2NNWA 2IC3A 2QKBA 4H0OA 2KFZA 3OYGA 1ZYQA 2E2NA 1U2VB 1QQMA 1JLCA 1IKXA 4IZ9A 2GV9A 4JKGB 3PSIA 3ZX2A 4A62A 3SJJA 3PSFA 4FJ8A 3BUZB 1RDDA 1NKEA 4O44A 2FSKA 1UA0A 2HHWA 2O8CB 4WQ5A 4X65K 3FLCO 4Z94A 3ZX0A 5ELZA 3UKRB 3D2FB 3KKSA 4EAHD 1K9MO 4FOIA 3HP9A 4LF6K 2P9UB 2D1KA 5DK5A 3AA5X 1RBUA 3WNGA 4E1JA 4MFBA 1WNSA 5GADP 3M1FA 4KHPK 4CEBA 3V1RA 2HHXA 2F8SA 2G8IA 4B08A 3QFUA 5CYQA 1F21A 3KK1A 4FLZA 2VG7A 2YJEA 3DYAA 5KPZA 2HNYA 4FLUA 4H4MA 1E4FT 3QEWA 2O8BB 3AVBA 3LDOA 3U4LA 5C10A 1W7AA 2QI2A 4E1MA 2IVNA 4HCCA 3DAWA 4LFAK 1VQ7N 3M5RA 5KRSA 2XY8A 5LJVA 1YTUA 1SZ2A 3G10A 1IKYA 2IGIA 3V1OA 4DF4A 1Z25A 2F8TA 5KTQA 3DLKA 1C0UA 4H5RA 2D0OA 2FF6A 1YJ9N 2ZE2A 3A8YA 4NO7A 1IBMK 4ELTA 1YHQN 4CESA 3TAQA 2F4VK 5M1FA 4XIUA 4E7IA 2KTQA 4JI6K 1GLDG 1C0GA 3VESA 2F9WA 1X3NA 3LAKA 1XNQK 1ZC6A 3SMPA 1YUWA 3GBTA 4FWPA 3SV4A 4LC9B 1HYZA 1ZBHA 3KLGA 2RF2A 3WXLA 3ENHA 1S1UA 4HVJA 4BRFA 1RCHA 4YDUC 3DM2A 1KAZA 4DTMA 1U49A 4DSEA 3KK2A 3THWA 3CJ9A 1C1BA 2QW9A 3EY1A 4IFYA 4M45A 4WE1A 4DWIA 2YHAA 5SWMA 4Q0BA 3S9HA 3K0SA 4FJJA 4DSJA 1ZBFA 1Z6RA 1DTTA 3DXKA 2O8DA 2NRRA 4CHZA 3WXKA 3MAQA 4WFBL 3KLIA 2FBVA 3AVIA 1DEJA 1MA9B 3TTCA 3ULEB 4A2AA 3L2RA 2NRHA 4AHVA 3CCJN 4KTZA 1TL3A 4M7YA 4JAXA 1OH5A 2P51A 2QA4N 1U48A 3T1AA 4GKJK 4BWMA 5JS1A 1VQ8N 1WBBA 5T7BA 4CJKA 1VSDA 2GX9A 5C24A 3H1VX 1W0HA 3D6RA 4B3OA 1FKPA 3SAGA 3VEWA 4Q5VA 1B92A 1HLUA 2GELA 2ZQBA 1A5VA 3V9UA 4CEAA 4ISFA 4CGGA 4LF9K 1M1KO 1JKHA 4JI1K 4OJRA 1VSFA 5KRTA 3VQ4A 4CJQA 1NMDA 3QETA 2Q0UA 4XH5A 3ZETA 4KB1A 1W97L 3LDNA 1Q82O 4ISGA 1JCEA 4QS8A 4OGEA 1T44A 5EU7A 2KW4A 4W5TA 1U04A 1TK8A 4FJMA 2KQ2A 4E7LA 3AGKA 1T6DA 2YNHA 2WONA 3K59A 4J2EA 4M41A 4E19A 3LWLA 5KQ8A 2VGNA 3IAYA 1IH7A 2PYLA 3THVA 1HX1A 3ZETB 2AJQA 3AVMA 2OZSA 3QBWA 2W42A 1GLJO 5HL7L 2HHTA 1TVRA 3VMFB 3LPUA 1S1WA 1RNHA 4F2SA 4WQ4C 5M1NA 3SBTA 1LAVA 4A57A 4HCBA 1N6QA 5FPEA 1IJJA 1QE1A 4DR5K 4M42A 2PFUA 4HTLA 1D5AA 4AH9A 4EZ9A 3NF6A 2BTFA 4IXCA 3I33A 5ADXH 5JMVA 3SQ4A 2HHHK 1N33K 4GVEA 1JL1A 4FJ5A 1ITGA 1HNIA 3NGYA 2PY5A 1Q9XA 3CF5L 4CEQA 2VWBA 2CH5A 3TAEA 4DFJA 5M1PA 3EE9A 4DU3A 4M3XA 4JKBA 3QEPA 3H46O 3OY9A 4DTRA 3E1YA 4CZJA 2JWKA 1KAXA 2WC9A 3KLFA 4AQYK 4JK7A 3DXKB 2R7YA 1KTQA 1NNEA 2DFHA 3WEEB 3RSEB 4CIFA 3NHGA 1TYQB 4BRLA 1HR0K 4CJVA 1KD1O 1TAUA 4BRNA 1REVA 2A1RA 5K14A 2IAJA 4OX9K 5C2FA 4H0XB 4CGHA 1HRHA 1OH7A 3DXMB 3AA4A 1Q18A 5HRSA 1YT3A 4QS9A 2OTLN 3TU5A 2X78A 1QSYA 1W2BM 4XH4A 2GBZA 1YXQA 2WTUA 2I7NA 3R8EA 1KQSM 3NVMA 4X64K 4IFEA 2ZJPL 3MN6A 1ATSA 2WUSA 3OYFA 1XHXA 4FWOA 5HP1A 2Q97A 4JI5K 4JN4A 2F9TA 3IG1A 4W5RA 1LW0A 3WNEA 3MEDA 1HNVA 4CBWA 4CK3A 5FPNA 1HQEA 1BIUA 4B9TA 4CF9A 5AQTA 4N47A 2IIRA 5CYMA 4DB3A 5HLFA 4PY5A 3CC7N 4CJEA 4AM6A 4CZMA 4Z4CA 4DV0K 4KV8A 2VGMA 2P5GA 2HBKA 3L4IA 2FSJA 4BRKA 5AQPA 5MLCQ 5JLFA 3OBYA 1EXQA 5DMRA 3H6EA 3L0QA 3OS1A 4DV4K 3THXB 4BDZA 2AA4A 5AQOA 2EHGA 1YVNA 4PL8A 3I56N 5EY4A 2ZJRL 3PO5A 3NH2A 3O9RA 4CF2A 2P9NA 4CK2A 3CJCA 3PLAA 3C65A 2FBYA 2V7YA 3EKSA 2P9KB 4KHUA 4OPAA 3W3DA 2D4WA 3FGUA 3AVGA 3L3VA 4A2BA 4X62K 2G8HA 2ZJQL 4HUGA 5B8HA 1NGIA 2NRXA 3UB5A 3LDPA 4CVNE 3MXIA 1VAZA 2I7PA 3THWB 3O8MA 1RDWX 2B5JA 3A5NC 2G8KA 2YCHA 3SBGA 4KHSA 1LOTB 1BGXT 2GUPA 3OYAA 1L3VA 3DLHA 4MDBA 4DU1A 1OH8A 4RW8A 3DXMA 3BEXA 4F2RA 3R9PA 1WSGA 3I0SA 4NCGA 1GOAA 4YHHK 4KO0A 3S41A 3CC4N 2P9NB 5J2QA 1RTIA 3W0LA 1QQOA 4H5NA 4JK8A 4CHNA 4J8FA 3PIOL 3SPZA 4N5SA 3S3NA 3ZX3A 1FW6A 4LF7K 1ATNA 4I2QA 2QWLA 4BC3A 3ZEUA 4NYFA 3ZT4A 4B9NA 1BG3A 2YV0X 1SKSA 3HYFA 4YDUA 3CFPA 4B1VA 2HHUA 2FC0A 3LDLA 4OLAA 2KZZA 4W5QA 3AO3A 5AQIA 5AQLA 4N56A 1IKVA 4O0IA 4Z4EA 3EL2A 4CE9A 5JS2A 3ENOA 1QVFM 1EQYA 3O08A 4CBXA 2HF3A 4MDAA 1NGJA 4EP5A 3AO2A 4BRCA 4FZZA 4XH1A 2FLOA 3A2FA 4CEZA 4CHPA 1MWKA 4E89A 4LF8K 2WOMA 4JKFA 4BRGA 3UKUB 1BI4A 1NOYA 3SMSA 4KHWA 4ILHA 4CK1A 1DKGD 4BE0A 3EEQA 4ILGB 5DM6L 3HSTB 2YKMA 4JS4A 3BDPA 1WSIA 2YJFA 5BPLA 1SQKA 4PUOA 4CZKA 3KZBA 3G71N 2KKZA 1S6QA 1RDAA 1WSJA 3OVNA 4H0VB 1TUUA 4CGDA 4H0TB 5KPTA 4IOCL 1LWCA 4IG3A 4JI4K 3SCXA 4J2DA 4YY3K 1X9WA 4A59A 4DR1K 4FK4A 3CQ8A 1JL2A 4F8RA 4K0KK 4DR7K 1S9GA 2E88A 3T19A 2NRTA 1U6ZA 1UWBA 4G1QA 2WBNA 3CCMN 4H5WA 3V6DA 3OJUA 4E7JA 3TABA 1HPZA 1VSLA 4XEIA 1OKJA 4DTOA 4JI7K 3HJFA 2NZTA 3HOTA 4DUYK 4OO1J 5FROA 4Y1DA 1B9FA 4B1XB 4FM2A 4JNEA 3K5MA 4DTUA 4CBUA 5LJWA 3KJVA 4FL9A 4CJWA 3MCPA 4NLBA 2NRWA 1C0FA 2Z1HA 3GOIA 2OCEA 1QSLA 1L5UA 3O9SA 2AP1A 4AILC 4KB0A 3H3NO 2GWJA 3JAMO 3M6GA 3TTDA 1KRPA 3DLBA 3U8XA 4FLTA 4FLWA 4DV6K 3RRHA 4OPJA 3NH0A 5AJ3K 2YX6A 3HP6A 2XO7A 3MWPA 2B6AA 3SAHA 5FPDA 1WUAA 1VQPN 4OPKA 3GL1A 1S72N 3VQ5A 3AVFA 1W9HA 4KI4A 5JVGL 5AFUH 5LMUK 4BQZA 1OH6A 3VPZA 2UUCK 4JKDA 4CGIA 4FVUA 2P9IA 3MN9A 5C0YA 1C1AA 4YFUA 3CJ7A 3M8RA 1XMQK 3ZT3A 4KH4A 1S1TA 4FW1A 4V19S 1LWEA 1XC9A 1HKCA 2ITMA 2A1SA 5C25A 2DFEA 4JK9A 3WNFA 2BUPA 4RW7A 4BE2A 3AVKA 1BL3A 2DPNA 4J2BA 2PBDA 2X74A 3KK7A 4ID5A 3ID6A 4CZHA 2Q2RA 4DV2K 4FW2A 4K41A 2W40A 3TARA 2GWKA 4CEOA 3EE8A 3HXMA 4B9QA 3ZSOA 3CQXA 4AM7A 3M3ZA 4CHYA 1NGHA 1Q81O 1BO5O 3ALYA 3NF7A 3MWTA 4CFBA 2VWJA 4EHTA 3OS0A 1GLEG 2NLXA 3FZHA 4C8KA 1TKZA 3CPWM 4B9SA 3PO4A 4NB4A 4DR3K 1YVUA 3U3GA 4DFKA 1RT1A 1WSHA 1S3XA 4CJ4A 4R79A 4GVMA 3KIOA 2DFFA 4FSVA 3KTQA 3ZT1A 1JLQA 4CJ5A 4QOZB 3VF6A 4QCLA 2VYPA 3J7YP 5FLXO 5BN9A 4ICLA 1LW2A 4BE1A 5AQVA 1NGCA 4QAGA 1RDBA 3O4NA 3TANA 2A41A 3SPYA 4O5FA 1XQSC 4OKEA 3J7ZO 3U3YA 5E41A 1N32K 3RMCA 3OYDA 1L3TA 3M8QA 4WCEL 4H0YB 4DV1K 5AZJB 2KFNA 4PKHA 3HPGA 2F96A 4KPYA 4BDYA 1LAWA 1N34K 1SL2A 3JYTA 3AVNA 4DMNA 4ELUA 3MEEA 4KH6A 5AQRA 1Q86O 1NK5A 2D0AA 3JXUA 4JI3K 3PV8A 2O8CA 1CZ9A 1GLLO 5TKYA 2V52B 3T1YK 2A6AA 5FRNA 2RPIA 4WF9L 3UKRA 1Q7YO 1GLCG 2HVHA 1HJOA 3QINA 4DS4A 5I42A 1TYQA 5BN8A 5F2RA 1D8YA 4BG9A 4B1WB 4N76A 4IFVA 3TSUA 1VSJA 3RTVA 1T3VA 2E4LA 3LP0A 5EX5A 3CFOA 3EO3A 3HT3A 1Q8IA 3Q7CA 4FM0A 5JICA 4DLGA 1NJYA 3HVTA 5BRFA 2P9LB 4WQ4A 3V9XA 4BRIA 3A5OC 2OPQA 4K8ZA 2P1JA 1XNRK 3O9TA 1KVBA 4A5AA 4BRHA 4BR7A 1EP4A 4JKCA 2DY4A 3AVHA 4M3RA 3VA3A 4FJ7A 1NK4A 1IBKK 1NLVA 3P39A 3HVRA 1QQNA 1TKDA 3DWLA 2ZD1A 2YNGA 4DTPA 3D2EA 3U9ZA 2I5JA 4H4OA 3HSCA 4CI6A 5GIPA 3NF9A 3PUFA 4IO9L 1KXPA 3O80A 3FZFA 4C1NI 4LF4K 2JWLA 5AQFA 4J2AA 1RT4A 2UXDK 4GW6A 3WNHA 4CJFA 1RT6A 5KGXA 2E8AA 4DSFA 4RW6A 1Y97A 4O5BA 4OVLA 3MDQA 3HPHA 2Y1JA 3HPOA 4JLHA 4KKOA 4CF0A 1FK9A 3L3UA 5CE3A 1RDCA 1BI4B 3IS9A 3SAFA 2YI1A 2W6KA 2J4RA 3CCUN 4CIGA 3PX0A 3LAMA 3OW2M 3M8PA 1U47A 4AHUA 3RVCA 3F5TA 1K8AO 4IKFA 3NH1A 3AV9A 4IJAA 3E9PA 3NGZA 2B4JA 1HUXA 4Z4IA 2Q3SA 3R6MA 3OYLA 3SUNA 1NWKA 4YOVA 3QEXA 1RDUA 3CYMA 1MU2A 3VQAA 2UU9K 4B9LA 1VSIA 3G25A 1KCFA 3VN5A 2CGJA 2E2QA 4FJGA 4JHDA 1T7PA 3VQ9A 4KAZA 1T8EA 3SI6A 3KD1E 4FLYA 1YJNN 2ZM6K 5LL6Z 2UYTA 1HJRA 4YNQA 4I6MB 4Z4GA 4RCHA 2XHBA 1L3UA 5GIOA 4DFMA 4OKJA 3EN9A 4L8RB 3QIOA 3UIQA 2YNFA 3JSMA 3VEOA 3CI5A 3QESA 4DTSA 4B8AB 2BH1A 4JYAK 3CM5A 3VEVA 1O13A 3QEIA 3J81O 4C8LA 2O8FB 3O5BA 2CGLA 4CHQA 1SAZA 3ZSXA 1YI2N 2A40A 3SUPA 3AAPA 3WXMB 4U7BA 1SKRA 3VEZA 3T7ZA 3PX4A 4KRFA 3TAFA 3S3MA 5C2DA 2A3ZA 5AQSA 3A5LC 1N5YA 4DR4K 1SL1A 3C94A 2QWRA 2G8WA 1BIZA 3ULDA 3CD6N 4Y1CA 2XY5A 4CGJA 1GLBG 3VQQA 3AO5A 5KPRA 4FJXA 3HM9A 3R3LA 1Z05A 1ASWA 2UXCK 3FR0A 4BC5A 3VTIA 4FPBA 3NBPA 5CHIA 3VQPA 4IOXA 1NGFA 4DUZK 3T69A 3CG7A 4KTQA 2F7TA 4CJLA 1TL1A 1NK6A 3L2VA 2YHYA 2E1ZA 3C6HA 3EYZA 2OA8A 1K73O 5BPNA 4FO0A 1VRTA 1IV0A 3NDKA 4NXNK 2IDOA 2G8VA 4HUEA 1K8KB 3VQEA 3VQ8A 2E1YA 3CQYA 5AQZA 4H03B 5AQYA 1XHZA 4U67L 2VQFK 3C6UA 3LL3A 4OLBA 4DV5K 3HI0A 2KHOA 1KSPA 1T6CA 3L8BA 1G15A 3CCRN 4TSXA 3OYJA 4IEEA 3AVCA 3EZWA 2O4IA 2UUBK 1QQCA 1LWFA 4GMJB 3F9KA 1HNXK 3HM8A 3MXJA 1QSSA 4FWMA 4CCHA 3O6WA 4FZXC 3G0ZA 4CJUA 1KAYA 4FM1A 1YTAA 5IT9O 1VSMA 1X9SA 4EHUA 3C7NB 4C23A 4AF1A 3QLHA 3DLRA 3ZSWA 3TWHA 1RTJA 4JI2K 1GOBA 4Y0WA 4DLEA 4BACA 3O1BA 2CGKA 5BRHA 3ZEUB 3OYNA 1RBSA 3E9LA 4DG1A 3F73A 1U2VA 4FJ9A 4KI6A 4AHSA 1CZAN 4JKGA 5F0XA 2QM1A 5AQMA 1DGKN 2EX3A 3KLEA 3K9JA 1QVGM 3B6OA 4C1NK 3L2UA 4M7XA 4CZLA 4CECA 1J53A 1JXEA 4ELVA 3IUCA 1RILA 1G99A 3O3GA 2FBXA 3CCLN 3J7AP 1YF5L 4GNIA 4FVMA 4ILJA 1N8RO 1MWMA 3C6AA 1RTDA 5KQDA 3TR8A 2WFBA 3DI6A 4BR9A 4I9LA 3OYKA 2OPPA 4I7FA 3ATVA 2NUBA 4DU4A 2HSTA 3DMJA 3QNNA 4JI8K 3MCAB 4LH5A 4W5OA 4RTFD 1RT2A 4K25A 5CZ2A 1GLAG 3K5NA 3MK6A 1WBDA 1X9MA 3ZLJA 4Z4FA 3ISNC 3ZSRA 3TAMA 1TKTA 4O55A 4CFAA 3AVAA 1VQNN 3LALA 2P9PA 3D2EB 2Q1NA 2DTUA 3TSPA 4FWSA 4RW9A 3RMDA 5J2PA 4CHOA 2YKNA 4CEEA 4BWJA 1CLQA 2Z1JA 1DT9A 1K6YA 3VERA 1ASUA 5FPMA 5AQHA 3CPEA 4B3SK 1U45A 2E20A 1T03A 2D5RA 4KHQA 2ATQA 4YORA 2RN2A 2O4GA 4I6MA 3VGMA 1ZBSA 2BGGA 3TAPA 4W5NA 2IVPA 3HBTA 3MECA 1NGEA 3OTOK 3D0PA 3CHWA 3CJ1A 3VF2A 3S3OA 1N36K 3KLHA 5CZ1A 3VOVA 4M3TA 3LZJA 1BQMA 1NK7A 1VSKA 5AZIB 2OYQA 3O4WA 1HPMA 4DKWA 5H1SQ 1I94K 3MEGA 3ULEA 1JXBA 3FZLA 3U6FA 3OYCA 1QS4A 4DQPA 3HO1A 5LMNK 4AHTA 1EETA 5IWAK 3SQ0A 3DOKA 3BZKA 3FE1A 1VK0A 5AZJA 3ZSZA 3KK3A 3TI0A 4NLCA 1L3SA 1VQ9N 4ID1A 4MQ3A 3K9KA 4AHRA 3CCVN 4FOEA 2X6NA 4KHNA 5E84A 1WB9A 2PZSA 3NAEA 1VQ4N 3H3OB 3HZ6A 3DLEA 4BQLA 5TKWA
chains in the Genus database with same CATH topology
1ZXOA 3CMAN 1M90O 3JXUA 3UE5A 4JD2B 3QBWA 1GLJO 5HL7L 2D0PA 1GLLO 5TKYA 2V52B 3VMFB 1ILYA 2A6AA 3NMUA 4FWRA 4WF9L 3UKRA 4CZIA 2CH6A 1Q7YO 1GLCG 2ASPA 4YOUA 4WQ4C 4HWIA 5M1NA 1GLFO 1HJOA 4K42A 3SBTA 4BRMA 4PL7A 2HOEA 1OVYA 2H3GX 4A57A 3BF3A 5M1OA 2PAVA 5FPEA 1IJJA 3HRGA 1YAGA 2PFUA 4HTLA 5EXWA 4QS7A 1TYQA 2HBMA 1YJWN 5BN8A 1IG8A 1VQMN 1RFQA 5F2RA 1VQ6N 2BTFA 4BG9A 4IXCA 3I33A 3P38A 5ADXH 5JMVA 4GVEA 2P9LA 4B1WB 3FFKB 3CF5L 3TSUA 1T3VA 5AR0A 2VWBA 5EVZA 2CH5A 4IO8A 5EX5A 3DLLL 3EO3A 3UKUA 4DQ8A 3Q7CA 5M1PA 3EE9A 4JKBA 4MO4A 5AQUA 5JICA 3H46O 3CC2N 4YOTA 2EWSA 1ESVA 4B1UB 3E1YA 4CZJA 2JWKA 4H0PA 4KBOA 1KAXA 2OTJN 2WC9A 2YHXA 5AFUA 4JK7A 5BRFA 5ADXA 1KC8O 4FPAA 3DXKB 2P9LB 2ZF5O 5GINA 4WQ4A 4BRIA 3A5OC 4GV6A 3WEEB 3O9TA 4A5AA 3RSEB 5DM7L 1TYQB 4BRLA 4BRHA 4BR7A 1KD1O 4BRNA 4JKCA 4BROA 4UY8O 1NGDA 5GAHP 1J6ZA 2A5XA 5C2FA 4H0XB 1NLVA 3P39A 2ZGZA 4CZFA 1QQNA 3DXMB 1XUPO 3VGKA 3DWLA 4BGBA 2VCPA 1Q18A 4QS9A 2OTLN 1HKGA 3QFPA 3VEYA 3D2EA 3U9ZA 1BA1A 1VQON 3TU5A 1BWFO 4BR2A 3HSCA 1BDGA 4CI6A 5GIPA 4CZGA 2QTDA 1W2BM 4XH4A 5M1KA 1YXQA 5HOOA 3FZMA 2I7NA 3R8EA 3L4QA 1YITN 1KQSM 3NVMA 5GAEP 4IO9L 1KXPA 4IFEA 3O80A 3FZFA 4C1NI 2JWLA 2ZJPL 3MN6A 1ATSA 2P9UA 4MO5A 4O8UA 2WUSA 5AQFA 4A5BA 3CCQN 3IDHA 5AQNA 4FWOA 2E8AA 5I9EB 3I8BA 1XC3A 2Q97A 5AQKA 3MDQA 4CZEA 1S22A 3QBXA 4JN4A 2F9TA 1ATRA 5AQJA 3I55N 4PKGA 3NVKA 4YOYA 5CE3A 4CBWA 2YHWA 5FPNA 3ATUA 1K8KA 2A42A 3KWIA 2QWOA 3SAFA 2YI1A 3SLCA 2J4RA 5AQTA 3CCUN 2IIRA 2P9SA 3OW2M 2ASOA 4IWVA 4DB3A 3VGLA 3RVCA 3F5TA 1K8AO 3CC7N 2RHKA 4IJAA 3E9PA 3IFRA 3CJBA 3L6QA 4DHYA 4AM6A 4CZMA 5GAGP 2VGMA 4IOAL 1HUXA 2HBKA 3L4IA 4KH5A 2FSJA 4BRKA 4BVPA 5AQPA 2KLAA 1X3MA 3R6MA 5MLCQ 1NWKA 3AARA 4YOVA 5JLFA 1D4XA 2HBJA 3OBYA 3BP8A 1RDUA 3H6EA 3CJAA 3L0QA 3AY9A 4F9OA 2AA4A 1E4GT 1HKBA 3R1XA 3LM2A 3OA9A 5AQOA 4BREA 1YVNA 4PL8A 2FF3B 2P9SB 3G25A 4JKEA 4MLEA 2CGJA 3I56N 2E2QA 3E9OA 1VQKN 4JHDA 5EY4A 4BRQA 2ZJRL 1P90A 2V51B 3GG4A 3O9RA 4JKHA 5JVHL 1NJIO 1YJNN 2P9NA 2UYTA 3JS6A 3C0BA 4I6MB 3D7EO 3CJCA 4RCHA 3C65A 3IMXA 3PLAA 2V7YA 5LY3A 3EKSA 4BRPA 5GIOA 2P9KB 3EN9A 2GEMA 5EOYA 4OPAA 2P9PB 3O9UA 3W3DA 5CR4A 2D4WA 3EKUA 3FGUA 3VTHA 4YOXA 4A2BA 1RGIA 3VEOA 1QZ5A 3CI5A 3KHYA 3MX5A 3MN5A 3BF1A 2ZJQL 2BH1A 5AQXA 2Q31A 5B8HA 3VEVA 1O13A 4BR0A 1NGIA 3GDQA 4FWKA 2HF4A 2NRXA 3UB5A 3CCSN 3LDPA 3O5BA 4H5VA 1VAZA 2I7PA 2CGLA 5E26A 2HMPA 1RDWX 3O8MA 2FSNA 1EO1A 3AAQA 4B1YB 4BY9C 3A5NC 1SAZA 3O1WA 4BRAA 5BREA 2YCHA 3SBGA 2A40A 4BR5A 1YI2N 3AAPA 1LOTB 4JKAA 3WXMB 2GUPA 3A5MC 4U7BA 1TUYA 3VEZA 3SJHA 3T7ZA 3A0IX 2P9IB 4MDBA 1WOQA 3DXMA 3BEXA 3OBWA 5C2DA 2A3ZA 3R9PA 5AQSA 3A5LC 5M1QA 4WFAL 4GV9A 1VQLN 4IJNA 4FWQA 4CD1A 3ID8A 3TTFA 3S41A 3CC4N 1X9JA 2P9NB 2QWRA 5C15A 3VF4A 3ZYYX 1P8ZA 3W0LA 1QQOA 4H5NA 4JK8A 1R59O 2QEXN 2Q0RA 4J8FA 3PIOL 3CD6N 3ZX3A 3MMVA 4JHDB 3CETA 5F1XA 1ATNA 3SK3A 2QWLA 4BC3A 3ZEUA 5AQRA 1QZ6A 1GLBG 3VETA 5KPRA 3DJCA 4BGAA 1BG3A 3R3LA 1Z05A 3FR0A 1SS6A 4BC5A 3VTIA 4FPBA 4YDUA 1Y64A 2NNWA 4CJ7A 4H0OA 4B1ZA 5CHIA 4IOXA 4B1VA 1NGFA 3T69A 3CERA 3LDLA 2E2NA 1U2VB 4GY2B 1QQMA 5AQIA 5AQLA 4JEPA 2F7TA 3EL2A 2HBLA 3ENOA 1QVFM 1EQYA 3N4PA 3O08A 2HF3A 3OHRA 4IZ9A 4MDAA 4JKGB 4CBXA 1NGJA 2YHYA 2E1ZA 4BRCA 4XH1A 3C6HA 2FLOA 2V7ZA 4EIAA 4BR4A 2QWNA 3ZX2A 4A62A 4CD3A 1K73O 3CMEN 5BPNA 1MWKA 4FO0A 2IVOA 4JKFA 4BRGA 4FWLA 3UKUB 3BUZB 1K8KB 3SMSA 4ILHA 1DKGD 2E1YA 2FSKA 3CQYA 5C12A 5AQZA 4H03B 4DCHA 4ILGB 3HOSA 4WQ5A 5AQYA 4U67L 5DM6L 3G4SN 4IEIA 3FLCO 3LL3A 3ZX0A 4Z94A 5ELZA 1JCFA 3HI0A 1NBWA 2KHOA 2YJFA 5BPLA 1SQKA 3UKRB 4CZKA 1T6CA 3KVGA 3D2FB 3KZBA 3CCRN 4EAHD 2NRZA 3G71N 1K9MO 3D2FA 4IEEA 3EZWA 2KKZA 4FOIA 3PIPL 4H0VB 4BVOA 1TUUA 2P9UB 2D1KA 1NGGA 2RE2A 3CXCM 4H0TB 5KPTA 4IOCL 3E66A 3QMLA 3HM8A 4E1JA 5GADP 3M1FA 4FWMA 3O6WA 5BPMA 4A59A 3P4IA 1H1VA 3KWGA 2E88A 3QFUA 2W41A 1KAYA 2NRTA 3MN7A 1U6ZA 3CCMN 1BUPA 2WBNA 4H5WA 1BU6O 2YJEA 3CCEN 1LCUA 5BR9A 5KPZA 4EHUA 3QDKA 3C7NB 4C23A 4AF1A 3VENA 4XEIA 1OKJA 1E4FT 4WFNL 5C10A 3LDOA 3U4LA 2NZTA 2P9KA 2QI2A 3HOTA 4GV3A 4OO1J 3WT0A 4B1XB 4JNEA 4Y0WA 2IVNA 4MLHA 4CBUA 5LJWA 3DAWA 1V4SA 3O1BA 1VQ7N 3M5RA 2CGKA 4FL9A 4PHTX 4L3QA 5BRHA 1MDUB 3MCPA 4NLBA 3ZEUB 5LJVA 1YIJN 2NRWA 3E9LA 4RWTA 1C0FA 1SZ2A 1U2VA 3GOIA 3TPQA 3O9SA 2AP1A 3WQTA 3H3NO 2GWJA 3M6GA 3TTDA 2E2OA 1CZAN 4JKGA 3AGRA 3U8XA 5F0XA 3WXJA 3N4QA 2QM1A 5AQMA 1DGKN 3K9JA 5AQGA 1QVGM 4H5RA 4C1NK 3H45C 3U9DA 4M7XA 4CZLA 2D0OA 2FF6A 1YJ9N 3A8YA 4NO7A 3IUCA 1YHQN 2QWMA 2YX6A 2Q36A 3TSQA 5M1FA 3MWPA 3J8AA 1G99A 2QWPA 4ISEA 3SAHA 1GLDG 3CCLN 1JJ2M 1C0GA 1WUAA 1YF5L 3LM9A 2F9WA 1X3NA 3VESA 5FPDA 3GL1A 1VQPN 1ZC6A 4GNIA 1S72N 4ILJA 3SMPA 3VEXA 1YUWA 2ASMA 1N8RO 1MWMA 3WXIA 3GBTA 3C6AA 4FWPA 5JVGL 5AFUH 4BQZA 5KQDA 4FVUA 4LC9B 3VPZA 4JKDA 3WXLA 2P9IA 3ENHA 4BC2A 2WFBA 4BR9A 3MN9A 5C0YA 4BRFA 3CJ7A 4YDUC 2ZWHA 3CIPA 1KAZA 3ATVA 4KH4A 2HSTA 3O9QA 3CJ9A 2QW9A 1VQ5N 1V4TA 1HKCA 1BOTO 3MCAB 2ITMA 3F2KA 4RTFD 4K25A 4H5TA 4JD2A 4K43A 5JLHA 1GLAG 3RSEA 4JK9A 2QXLA 3MK6A 3WEEA 3G6EN 2BUPA 3LDQA 1NGBA 2DPNA 1NGAA 1Z6RA 2PBDA 2ZGYA 3DXKA 2NRRA 3KK7A 2OANA 3WXKA 3ID6A 4WFBL 3QICA 2Q2RA 4CZHA 1VQNN 4K41A 5BRDA 2P9PA 1DEJA 1MA9B 2W40A 3D2EB 4WQ5C 2GWKA 2Q1NA 3ENBA 3EE8A 3TSPA 4B9QA 4FWSA 1BA0A 3TTCA 3WUHA 1QHAA 3CQXA 3ULEB 1DT9A 3M3ZA 4A2AA 4AM7A 5AQWA 1NGHA 2NRHA 1BO5O 3VERA 3CCJN 1Q81O 4M7YA 5FPMA 3GE1A 5AQHA 4JAXA 5AZIA 3CPEA 4BG8A 3MWTA 2E20A 4EHTA 2QA4N 1GLEG 2NLXA 3FZHA 3CPWM 4NB4A 4YORA 1VQ8N 4I6MA 3VGMA 1S3XA 1ZBSA 4EFHA 2GX9A 2IVPA 3HBTA 1NM1A 3H1VX 3WQUA 3D6RA 4O8KA 4R79A 4M63C 4FWNA 4FSVA 1NGEA 3SAGA 3VEWA 3CHWA 3CJ1A 3VF2A 4G9ZA 1HLUA 4A61A 1JCGA 3H1QA 3VOVA 2GELA 3F9MA 3VF6A 2GTDA 2VYPA 3MX2A 3C7NA 5BN9A 4BC4A 4ISFA 5AZIB 1M1KO 3O4WA 1HPMA 3IKMA 4DKWA 5H1SQ 4YOWA 5AQVA 1NGCA 2QWQA 2E2PA 3HTVA 3FZKA 3ULEA 1NMDA 2A41A 2NRVA 2Q0UA 3FZLA 4XH5A 3ZETA 1W97L 4O5FA 1XQSC 5AQQA 3LDNA 3J7ZO 1Q82O 4ISGA 1JCEA 3B8AX 1Q86O 4QS8A 1T44A 4WCEL 4PKIA 3FE1A 3QB0A 4OPHA 4H0YB 5AZJA 5AZJB 4NLCA 1VQ9N 3AGKA 4PKHA 1T6DA 4BRDA 3K9KA 3CCVN 4WYBA 4FOEA 5KQ8A 2VGNA 5E84A 4IDHA 1VQ4N 3P31A 3H3OB 3HZ6A 1HX1A 4KH6A 3ZETB 5TKWA 3Q7BA 4BQLA 2FXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDU A;  1P90 A;  2KLA A;  1O13 A;  2QTD A;  2RE2 A;  1EO1 A;  2YX6 A;  2WFB A;  1T3V A; 
#chains in the Genus database with same CATH topology
 1ZXO A;  1WSE A;  3UE5 A;  4JD2 B;  3AO4 A;  2D0P A;  3SYZ A;  3HL8 A;  3NMU A;  3T3F A;  4CZI A;  2ASP A;  4YOU A;  4K42 A;  4BRM A;  1OVY A;  5M1O A;  2PAV A;  3OYI A;  1QHT A;  3HRG A;  1YAG A;  3ASM A;  2O8E B;  5EXW A;  1JLF A;  2HBM A;  1IG8 A;  1VQM N;  5I3U A;  1RFQ A;  1VQ6 N;  1J5O A;  3THY A;  2IOC A;  3P38 A;  3KKR A;  2JLE A;  2Z1G A;  3O3F A;  1NKB A;  4IBN A;  1A5X A;  4CGF A;  2XRI A;  5EVZ A;  3HK2 A;  1SKW A;  4OKK A;  2HB5 A;  1JLG A;  5AQU A;  3CC2 N;  4YOT A;  1IG9 A;  4LFC K;  4B1U B;  4C8M A;  4H0P A;  4KBO A;  2OTJ N;  4CED A;  1EWQ A;  3RR7 A;  4FJN A;  1KC8 O;  3C95 A;  2ZF5 O;  5GIN A;  1RT3 A;  3SUO A;  3OYB A;  4GV6 A;  2O8B A;  1VHX A;  3SQ2 A;  1HQU A;  1TV6 A;  2YNI A;  4UY8 O;  4B3R K;  1NGD A;  5GAH P;  1J6Z A;  1JLA A;  2A5X A;  1Z26 A;  1XUP O;  1GOC A;  1HKG A;  4E7H A;  3VEY A;  4PA1 A;  1VQO N;  1BA1 A;  4BR2 A;  4CJP A;  1BDG A;  5M1K A;  4M3Z A;  5HOO A;  1YIT N;  5GAE P;  1XWL A;  4MO5 A;  4A5B A;  2P9U A;  4I2P A;  1TKX A;  4JS5 A;  5I9E B;  3I8B A;  1XC3 A;  3OYH A;  5AQK A;  4CZE A;  2O8F A;  3AO1 A;  1NG9 A;  4PKG A;  1HYS A;  3BZC A;  3NVK A;  4YOY A;  1CXQ A;  3KWI A;  2QWO A;  2HHV A;  3SLC A;  2P9S A;  4JI0 K;  4IWV A;  4M3W A;  1EX4 A;  4DQS A;  4Z4H A;  1BCO A;  2RHK A;  3PX6 A;  2D0C A;  3IFR A;  1J54 A;  3CJB A;  4FCY A;  3L6Q A;  4DHY A;  1BIS A;  4CIE A;  5GAG P;  4IOA L;  3M8S A;  3VA0 A;  2KLA A;  4FK2 A;  1X3M A;  4FZY A;  2HBJ A;  1IKW A;  3AY9 A;  4F9O A;  5HRO A;  1E4G T;  3R1X A;  1VSE A;  3OA9 A;  2GUI A;  1WLJ A;  4BRE A;  2FF3 B;  2P9S B;  4FLV A;  1DLO A;  3E9O A;  1VQK N;  2HHS A;  4BRQ A;  2OPS A;  3GG4 A;  4JKH A;  1KLM A;  4GKK K;  1NJI O;  1S9E A;  3CM6 A;  4DR6 K;  3D7E O;  3DLG A;  4BRP A;  1WSF A;  2PYJ A;  4EZ6 A;  5EOY A;  3O9U A;  4NYN A;  2QK9 A;  3MX5 A;  3KHY A;  4IDK A;  3MN5 A;  3BF1 A;  1NKC A;  5AQX A;  3LZI A;  2HVI A;  4BR0 A;  4CJS A;  2HF4 A;  3CCS N;  1EO1 A;  2FSN A;  4B1Y B;  4BY9 C;  4KRE A;  3O1W A;  3A5M C;  4KFB A;  4ZTF A;  3QO9 A;  4RW4 A;  1TAQ A;  1WOQ A;  3L2Q A;  1SV5 A;  4GV9 A;  3LDS A;  5SZT A;  4IJN A;  4KTW A;  3ID8 A;  4LY7 A;  5C15 A;  3VF4 A;  2XY6 A;  1KFD A;  1P8Z A;  1R59 O;  3NF8 A;  2Q0R A;  4DTJ A;  2JGU A;  2ETJ A;  1SL0 A;  3MMV A;  3VQC A;  3CET A;  3SK3 A;  3FFI A;  2IS3 A;  3QNO A;  1QZ6 A;  3MXM A;  3DOL A;  3AVL A;  1TK0 A;  3ZCM A;  4DSI A;  1CXU A;  1SS6 A;  3EZ5 A;  1Y64 A;  4CJ7 A;  4B1Z A;  4NCB A;  3VQD A;  5FDL A;  3CER A;  4GY2 B;  4JEP A;  2HBL A;  4FXD A;  5J2M A;  3N4P A;  3OHR A;  1TGO A;  3V4I A;  2V7Z A;  3NE6 A;  3O4Q A;  4EIA A;  4BR4 A;  2QWN A;  4CD3 A;  3CME N;  4NXM K;  2D0B A;  2IVO A;  1WAJ A;  4FWL A;  3KD5 E;  2LSN A;  4M3Y A;  1ZBU A;  4DS5 A;  5C12 A;  3HOS A;  4DCH A;  1S5J A;  4RG8 A;  3G4S N;  4IEI A;  4CJT A;  3AA2 A;  4LFB K;  1JCF A;  1NBW A;  1I3A A;  4LSN A;  1DTQ A;  3KVG A;  3LP2 A;  2NRZ A;  3D2F A;  1S6P A;  1T05 A;  3PIP L;  4BVO A;  2RE2 A;  1NGG A;  3CXC M;  1FKO A;  4X66 K;  1ZBI A;  3E66 A;  3QML A;  2HMI A;  3I0R A;  5BPM A;  1D9D A;  3P4I A;  2P5O A;  1H1V A;  3KWG A;  2W41 A;  1C0T A;  3MN7 A;  4FJH A;  1NMN A;  1BUP A;  3VQ7 A;  1BU6 O;  3CCE N;  1LCU A;  5BR9 A;  4DQI A;  3SZ2 A;  3QDK A;  3VEN A;  4H8K A;  4WFN L;  2P9K A;  4GV3 A;  1EKE A;  3ITH A;  3WT0 A;  2OPR A;  1KLN A;  4E3S A;  4FJK A;  4MLH A;  4DSL A;  1V4S A;  3NCI A;  4PHT X;  4L3Q A;  1YIJ N;  1MDU B;  4RWT A;  3P5J A;  3AVJ A;  4CER A;  3TPQ A;  2W6L A;  3DRS A;  3WQT A;  1KFS A;  4FJL A;  2E2O A;  1NK9 A;  4CFD A;  3AGR A;  4B9M A;  3WXJ A;  3N4Q A;  5AQG A;  3H45 C;  3U9D A;  1Q9Y A;  2HNZ A;  5J2N A;  2QWM A;  2BDP A;  3TSQ A;  2Q36 A;  3J8A A;  1KVA A;  2QWP A;  4ISE A;  1OVQ A;  2VQE K;  1JJ2 M;  3LM9 A;  1BQN A;  1JLE A;  4PQU A;  3VEX A;  3DRR A;  2ASM A;  1UA1 A;  2HW3 A;  3WXI A;  1C6V A;  3DRP A;  3ZSY A;  3THY B;  3ZSV A;  4IG0 A;  4BC2 A;  4DTN A;  1HMV A;  3D45 A;  2ZWH A;  3CIP A;  2Z1I A;  1RBT A;  3O9Q A;  3V9Z A;  1VQ5 N;  1V4T A;  1BOT O;  2QXF A;  3F2K A;  4H5T A;  4JD2 A;  4K43 A;  5JLH A;  1D9F A;  3RSE A;  3LAN A;  2QXL A;  3WEE A;  3G6E N;  3LDQ A;  1NGB A;  3IRX A;  3VQ6 A;  4JRQ A;  1NU0 A;  1NGA A;  2ZGY A;  1X1P A;  2OAN A;  3RWU A;  3QIC A;  2QKK A;  5BRD A;  1U4B A;  4HTU A;  4WQ5 C;  1A5W A;  3ENB A;  4F4K A;  1BA0 A;  3AA3 A;  4DF8 A;  3WUH A;  2BAN A;  1QHA A;  4FYD A;  4CJ3 A;  3V81 A;  2XY7 A;  2HHQ A;  5AQW A;  4DFP A;  3GE1 A;  5AZI A;  4B3T K;  4BG8 A;  3BGR A;  3BY5 A;  5HBM A;  3O3H A;  3LPT A;  1IBL K;  4Z0U A;  3QER A;  3NGI A;  4EFH A;  3WQU A;  1NM1 A;  3RMA A;  4O8K A;  4M63 C;  4FWN A;  4KHY A;  3QIP A;  4G9Z A;  3E01 A;  4A61 A;  3T1H K;  1JCG A;  3H1Q A;  2X6S A;  3F9M A;  4BC4 A;  1RT7 A;  2GTD A;  3MX2 A;  3C7N A;  4CF8 A;  3TAG A;  1HNW K;  2UUA K;  2UXB K;  3IKM A;  4LD0 A;  4YOW A;  2QWQ A;  4DQQ A;  1SUQ A;  2E2P A;  3HTV A;  3QEV A;  3FZK A;  1NK0 A;  2NRV A;  4HUF A;  4E0D A;  1O1W A;  1I39 A;  2RKI A;  5AQQ A;  4JV5 K;  1XI1 A;  1C0M A;  1S1V A;  3B8A X;  1ZBL A;  1HNZ K;  5BR8 K;  4FJI A;  4PKI A;  1XMO K;  3QB0 A;  4OPH A;  1RBR A;  1ASV A;  5C42 A;  1E3M A;  4BRD A;  4ZHR A;  1RTH A;  4WYB A;  1BHL A;  4C8N A;  4B9V A;  1FXX A;  1UOC A;  3LP1 A;  2FBT A;  4IDH A;  3P31 A;  3NFA A;  4CEF A;  5KGW A;  3Q7B A;  2FXU A;  2BE2 A;  4FK0 A;  3CMA N;  1M90 O;  1RBV A;  4LH4 A;  3VQB A;  4CFC A;  1ILY A;  4FWR A;  4DV3 K;  1NJW A;  2CH6 A;  3RRG A;  3K5L A;  5A2Q O;  1IO2 A;  4HWI A;  1GLF O;  4PL7 A;  3V9S A;  4E7K A;  2HOE A;  2H3G X;  5HRP A;  3BF3 A;  3P1G A;  4O4G A;  4HHT A;  2E6M A;  4QS7 A;  1YJW N;  2OZM A;  1JLB A;  3SQ1 A;  5CY4 A;  1EWR A;  1VSH A;  2P9L A;  3FFK B;  4DV7 K;  4FLX A;  3SNN A;  2O8E A;  5AR0 A;  3DLL L;  4IO8 A;  4PWD A;  3UKU A;  4DQ8 A;  3H08 A;  4I9Q A;  5J1E A;  3L2W A;  4MO4 A;  1S1X A;  2YHB A;  2EWS A;  3P83 D;  5HRN A;  3V9W A;  1ESV A;  4B8C A;  2YHX A;  5AFU A;  3OYM A;  5ADX A;  4FPA A;  4UQG A;  5FRM A;  4B3M K;  2G8U A;  3PY8 A;  1LV5 A;  5DM7 L;  1WAF A;  5HRR A;  4BRO A;  1NJZ A;  4ZTJ A;  1RT5 A;  2E6L A;  3RR8 A;  2O8D B;  4CZF A;  2ZGZ A;  3VGK A;  4BGB A;  2VCP A;  2VG6 A;  1B9D A;  3QFP A;  1BWF O;  4F3O A;  4CZG A;  2QTD A;  3FZM A;  3L4Q A;  1BCM A;  4DSK A;  3V1Q A;  4O8U A;  3CCQ N;  3OS2 A;  3IDH A;  5AQN A;  1S22 A;  3QBX A;  1ATR A;  1WN7 A;  5AQJ A;  3I55 N;  4F3T A;  3SV3 A;  1NJX A;  3K58 A;  4DQR A;  2YHW A;  3ATU A;  1K8K A;  1CZB A;  2A42 A;  3K57 A;  2ASO A;  3VGL A;  3OJS A;  2VG5 A;  3K2P A;  4LSL A;  3ZT0 A;  3THX A;  3J80 O;  3ZT2 A;  4AHC A;  4LF5 K;  2KZM A;  4KH5 A;  4B9U A;  4BVP A;  4DTX A;  3AAR A;  1D4X A;  3BP8 A;  3CJA A;  1HKB A;  1FJG K;  1NOZ A;  3LM2 A;  4BDP A;  3C6T A;  2E5L K;  4JKE A;  4MLE A;  2HND A;  1P90 A;  2V51 B;  5JVH L;  3CFR A;  3JS6 A;  3C0B A;  4C8O A;  3IMX A;  1NK8 A;  1KVC A;  5LY3 A;  2GEM A;  3RMB A;  2P9P B;  2VWK A;  3EKU A;  5CR4 A;  3VTH A;  4CW7 B;  4YOX A;  2G8F A;  1RGI A;  1QZ5 A;  1VRU A;  1J5E K;  5D3G A;  3I8D A;  1R0A A;  3OYE A;  3SUQ A;  2Q31 A;  3ZSQ A;  4E1N A;  3GDQ A;  4FWK A;  5KI6 A;  4K8X A;  5E26 A;  4H5V A;  4JRP A;  2HMP A;  3AAQ A;  4BRA A;  5BRE A;  4BR5 A;  4JKA A;  1TUY A;  3LWM A;  4O0J A;  3SJH A;  3A0I X;  2P9I B;  4CJR A;  3B6P A;  3OBW A;  4DR2 K;  1TK5 A;  5M1Q A;  4WFA L;  1VQL N;  4FWQ A;  4CD1 A;  3TTF A;  4OGC A;  1X9J A;  1HYV A;  4N41 A;  3ZYY X;  1QTM A;  2QEX N;  2ITG A;  4NCA A;  4JHD B;  5F1X A;  3VET A;  3DJC A;  1UAX A;  4BGA A;  1J9A A;  4R5P A;  3LP3 A;  4CF1 A;  1C1C A;  4EP4 A;  4M3U A;  2Y1I A;  3K5O A;  2NNW A;  2IC3 A;  2QKB A;  4H0O A;  2KFZ A;  3OYG A;  1ZYQ A;  2E2N A;  1U2V B;  1QQM A;  1JLC A;  1IKX A;  4IZ9 A;  2GV9 A;  4JKG B;  3PSI A;  3ZX2 A;  4A62 A;  3SJJ A;  3PSF A;  4FJ8 A;  3BUZ B;  1RDD A;  1NKE A;  4O44 A;  2FSK A;  1UA0 A;  2HHW A;  2O8C B;  4WQ5 A;  4X65 K;  3FLC O;  4Z94 A;  3ZX0 A;  5ELZ A;  3UKR B;  3D2F B;  3KKS A;  4EAH D;  1K9M O;  4FOI A;  3HP9 A;  4LF6 K;  2P9U B;  2D1K A;  5DK5 A;  3AA5 X;  1RBU A;  3WNG A;  4E1J A;  4MFB A;  1WNS A;  5GAD P;  3M1F A;  4KHP K;  4CEB A;  3V1R A;  2HHX A;  2F8S A;  2G8I A;  4B08 A;  3QFU A;  5CYQ A;  1F21 A;  3KK1 A;  4FLZ A;  2VG7 A;  2YJE A;  3DYA A;  5KPZ A;  2HNY A;  4FLU A;  4H4M A;  1E4F T;  3QEW A;  2O8B B;  3AVB A;  3LDO A;  3U4L A;  5C10 A;  1W7A A;  2QI2 A;  4E1M A;  2IVN A;  4HCC A;  3DAW A;  4LFA K;  1VQ7 N;  3M5R A;  5KRS A;  2XY8 A;  5LJV A;  1YTU A;  1SZ2 A;  3G10 A;  1IKY A;  2IGI A;  3V1O A;  4DF4 A;  1Z25 A;  2F8T A;  5KTQ A;  3DLK A;  1C0U A;  4H5R A;  2D0O A;  2FF6 A;  1YJ9 N;  2ZE2 A;  3A8Y A;  4NO7 A;  1IBM K;  4ELT A;  1YHQ N;  4CES A;  3TAQ A;  2F4V K;  5M1F A;  4XIU A;  4E7I A;  2KTQ A;  4JI6 K;  1GLD G;  1C0G A;  3VES A;  2F9W A;  1X3N A;  3LAK A;  1XNQ K;  1ZC6 A;  3SMP A;  1YUW A;  3GBT A;  4FWP A;  3SV4 A;  4LC9 B;  1HYZ A;  1ZBH A;  3KLG A;  2RF2 A;  3WXL A;  3ENH A;  1S1U A;  4HVJ A;  4BRF A;  1RCH A;  4YDU C;  3DM2 A;  1KAZ A;  4DTM A;  1U49 A;  4DSE A;  3KK2 A;  3THW A;  3CJ9 A;  1C1B A;  2QW9 A;  3EY1 A;  4IFY A;  4M45 A;  4WE1 A;  4DWI A;  2YHA A;  5SWM A;  4Q0B A;  3S9H A;  3K0S A;  4FJJ A;  4DSJ A;  1ZBF A;  1Z6R A;  1DTT A;  3DXK A;  2O8D A;  2NRR A;  4CHZ A;  3WXK A;  3MAQ A;  4WFB L;  3KLI A;  2FBV A;  3AVI A;  1DEJ A;  1MA9 B;  3TTC A;  3ULE B;  4A2A A;  3L2R A;  2NRH A;  4AHV A;  3CCJ N;  4KTZ A;  1TL3 A;  4M7Y A;  4JAX A;  1OH5 A;  2P51 A;  2QA4 N;  1U48 A;  3T1A A;  4GKJ K;  4BWM A;  5JS1 A;  1VQ8 N;  1WBB A;  5T7B A;  4CJK A;  1VSD A;  2GX9 A;  5C24 A;  3H1V X;  1W0H A;  3D6R A;  4B3O A;  1FKP A;  3SAG A;  3VEW A;  4Q5V A;  1B92 A;  1HLU A;  2GEL A;  2ZQB A;  1A5V A;  3V9U A;  4CEA A;  4ISF A;  4CGG A;  4LF9 K;  1M1K O;  1JKH A;  4JI1 K;  4OJR A;  1VSF A;  5KRT A;  3VQ4 A;  4CJQ A;  1NMD A;  3QET A;  2Q0U A;  4XH5 A;  3ZET A;  4KB1 A;  1W97 L;  3LDN A;  1Q82 O;  4ISG A;  1JCE A;  4QS8 A;  4OGE A;  1T44 A;  5EU7 A;  2KW4 A;  4W5T A;  1U04 A;  1TK8 A;  4FJM A;  2KQ2 A;  4E7L A;  3AGK A;  1T6D A;  2YNH A;  2WON A;  3K59 A;  4J2E A;  4M41 A;  4E19 A;  3LWL A;  5KQ8 A;  2VGN A;  3IAY A;  1IH7 A;  2PYL A;  3THV A;  1HX1 A;  3ZET B;  2AJQ A;  3AVM A;  2OZS A;  3QBW A;  2W42 A;  1GLJ O;  5HL7 L;  2HHT A;  1TVR A;  3VMF B;  3LPU A;  1S1W A;  1RNH A;  4F2S A;  4WQ4 C;  5M1N A;  3SBT A;  1LAV A;  4A57 A;  4HCB A;  1N6Q A;  5FPE A;  1IJJ A;  1QE1 A;  4DR5 K;  4M42 A;  2PFU A;  4HTL A;  1D5A A;  4AH9 A;  4EZ9 A;  3NF6 A;  2BTF A;  4IXC A;  3I33 A;  5ADX H;  5JMV A;  3SQ4 A;  2HHH K;  1N33 K;  4GVE A;  1JL1 A;  4FJ5 A;  1ITG A;  1HNI A;  3NGY A;  2PY5 A;  1Q9X A;  3CF5 L;  4CEQ A;  2VWB A;  2CH5 A;  3TAE A;  4DFJ A;  5M1P A;  3EE9 A;  4DU3 A;  4M3X A;  4JKB A;  3QEP A;  3H46 O;  3OY9 A;  4DTR A;  3E1Y A;  4CZJ A;  2JWK A;  1KAX A;  2WC9 A;  3KLF A;  4AQY K;  4JK7 A;  3DXK B;  2R7Y A;  1KTQ A;  1NNE A;  2DFH A;  3WEE B;  3RSE B;  4CIF A;  3NHG A;  1TYQ B;  4BRL A;  1HR0 K;  4CJV A;  1KD1 O;  1TAU A;  4BRN A;  1REV A;  2A1R A;  5K14 A;  2IAJ A;  4OX9 K;  5C2F A;  4H0X B;  4CGH A;  1HRH A;  1OH7 A;  3DXM B;  3AA4 A;  1Q18 A;  5HRS A;  1YT3 A;  4QS9 A;  2OTL N;  3TU5 A;  2X78 A;  1QSY A;  1W2B M;  4XH4 A;  2GBZ A;  1YXQ A;  2WTU A;  2I7N A;  3R8E A;  1KQS M;  3NVM A;  4X64 K;  4IFE A;  2ZJP L;  3MN6 A;  1ATS A;  2WUS A;  3OYF A;  1XHX A;  4FWO A;  5HP1 A;  2Q97 A;  4JI5 K;  4JN4 A;  2F9T A;  3IG1 A;  4W5R A;  1LW0 A;  3WNE A;  3MED A;  1HNV A;  4CBW A;  4CK3 A;  5FPN A;  1HQE A;  1BIU A;  4B9T A;  4CF9 A;  5AQT A;  4N47 A;  2IIR A;  5CYM A;  4DB3 A;  5HLF A;  4PY5 A;  3CC7 N;  4CJE A;  4AM6 A;  4CZM A;  4Z4C A;  4DV0 K;  4KV8 A;  2VGM A;  2P5G A;  2HBK A;  3L4I A;  2FSJ A;  4BRK A;  5AQP A;  5MLC Q;  5JLF A;  3OBY A;  1EXQ A;  5DMR A;  3H6E A;  3L0Q A;  3OS1 A;  4DV4 K;  3THX B;  4BDZ A;  2AA4 A;  5AQO A;  2EHG A;  1YVN A;  4PL8 A;  3I56 N;  5EY4 A;  2ZJR L;  3PO5 A;  3NH2 A;  3O9R A;  4CF2 A;  2P9N A;  4CK2 A;  3CJC A;  3PLA A;  3C65 A;  2FBY A;  2V7Y A;  3EKS A;  2P9K B;  4KHU A;  4OPA A;  3W3D A;  2D4W A;  3FGU A;  3AVG A;  3L3V A;  4A2B A;  4X62 K;  2G8H A;  2ZJQ L;  4HUG A;  5B8H A;  1NGI A;  2NRX A;  3UB5 A;  3LDP A;  4CVN E;  3MXI A;  1VAZ A;  2I7P A;  3THW B;  3O8M A;  1RDW X;  2B5J A;  3A5N C;  2G8K A;  2YCH A;  3SBG A;  4KHS A;  1LOT B;  1BGX T;  2GUP A;  3OYA A;  1L3V A;  3DLH A;  4MDB A;  4DU1 A;  1OH8 A;  4RW8 A;  3DXM A;  3BEX A;  4F2R A;  3R9P A;  1WSG A;  3I0S A;  4NCG A;  1GOA A;  4YHH K;  4KO0 A;  3S41 A;  3CC4 N;  2P9N B;  5J2Q A;  1RTI A;  3W0L A;  1QQO A;  4H5N A;  4JK8 A;  4CHN A;  4J8F A;  3PIO L;  3SPZ A;  4N5S A;  3S3N A;  3ZX3 A;  1FW6 A;  4LF7 K;  1ATN A;  4I2Q A;  2QWL A;  4BC3 A;  3ZEU A;  4NYF A;  3ZT4 A;  4B9N A;  1BG3 A;  2YV0 X;  1SKS A;  3HYF A;  4YDU A;  3CFP A;  4B1V A;  2HHU A;  2FC0 A;  3LDL A;  4OLA A;  2KZZ A;  4W5Q A;  3AO3 A;  5AQI A;  5AQL A;  4N56 A;  1IKV A;  4O0I A;  4Z4E A;  3EL2 A;  4CE9 A;  5JS2 A;  3ENO A;  1QVF M;  1EQY A;  3O08 A;  4CBX A;  2HF3 A;  4MDA A;  1NGJ A;  4EP5 A;  3AO2 A;  4BRC A;  4FZZ A;  4XH1 A;  2FLO A;  3A2F A;  4CEZ A;  4CHP A;  1MWK A;  4E89 A;  4LF8 K;  2WOM A;  4JKF A;  4BRG A;  3UKU B;  1BI4 A;  1NOY A;  3SMS A;  4KHW A;  4ILH A;  4CK1 A;  1DKG D;  4BE0 A;  3EEQ A;  4ILG B;  5DM6 L;  3HST B;  2YKM A;  4JS4 A;  3BDP A;  1WSI A;  2YJF A;  5BPL A;  1SQK A;  4PUO A;  4CZK A;  3KZB A;  3G71 N;  2KKZ A;  1S6Q A;  1RDA A;  1WSJ A;  3OVN A;  4H0V B;  1TUU A;  4CGD A;  4H0T B;  5KPT A;  4IOC L;  1LWC A;  4IG3 A;  4JI4 K;  3SCX A;  4J2D A;  4YY3 K;  1X9W A;  4A59 A;  4DR1 K;  4FK4 A;  3CQ8 A;  1JL2 A;  4F8R A;  4K0K K;  4DR7 K;  1S9G A;  2E88 A;  3T19 A;  2NRT A;  1U6Z A;  1UWB A;  4G1Q A;  2WBN A;  3CCM N;  4H5W A;  3V6D A;  3OJU A;  4E7J A;  3TAB A;  1HPZ A;  1VSL A;  4XEI A;  1OKJ A;  4DTO A;  4JI7 K;  3HJF A;  2NZT A;  3HOT A;  4DUY K;  4OO1 J;  5FRO A;  4Y1D A;  1B9F A;  4B1X B;  4FM2 A;  4JNE A;  3K5M A;  4DTU A;  4CBU A;  5LJW A;  3KJV A;  4FL9 A;  4CJW A;  3MCP A;  4NLB A;  2NRW A;  1C0F A;  2Z1H A;  3GOI A;  2OCE A;  1QSL A;  1L5U A;  3O9S A;  2AP1 A;  4AIL C;  4KB0 A;  3H3N O;  2GWJ A;  3JAM O;  3M6G A;  3TTD A;  1KRP A;  3DLB A;  3U8X A;  4FLT A;  4FLW A;  4DV6 K;  3RRH A;  4OPJ A;  3NH0 A;  5AJ3 K;  2YX6 A;  3HP6 A;  2XO7 A;  3MWP A;  2B6A A;  3SAH A;  5FPD A;  1WUA A;  1VQP N;  4OPK A;  3GL1 A;  1S72 N;  3VQ5 A;  3AVF A;  1W9H A;  4KI4 A;  5JVG L;  5AFU H;  5LMU K;  4BQZ A;  1OH6 A;  3VPZ A;  2UUC K;  4JKD A;  4CGI A;  4FVU A;  2P9I A;  3MN9 A;  5C0Y A;  1C1A A;  4YFU A;  3CJ7 A;  3M8R A;  1XMQ K;  3ZT3 A;  4KH4 A;  1S1T A;  4FW1 A;  4V19 S;  1LWE A;  1XC9 A;  1HKC A;  2ITM A;  2A1S A;  5C25 A;  2DFE A;  4JK9 A;  3WNF A;  2BUP A;  4RW7 A;  4BE2 A;  3AVK A;  1BL3 A;  2DPN A;  4J2B A;  2PBD A;  2X74 A;  3KK7 A;  4ID5 A;  3ID6 A;  4CZH A;  2Q2R A;  4DV2 K;  4FW2 A;  4K41 A;  2W40 A;  3TAR A;  2GWK A;  4CEO A;  3EE8 A;  3HXM A;  4B9Q A;  3ZSO A;  3CQX A;  4AM7 A;  3M3Z A;  4CHY A;  1NGH A;  1Q81 O;  1BO5 O;  3ALY A;  3NF7 A;  3MWT A;  4CFB A;  2VWJ A;  4EHT A;  3OS0 A;  1GLE G;  2NLX A;  3FZH A;  4C8K A;  1TKZ A;  3CPW M;  4B9S A;  3PO4 A;  4NB4 A;  4DR3 K;  1YVU A;  3U3G A;  4DFK A;  1RT1 A;  1WSH A;  1S3X A;  4CJ4 A;  4R79 A;  4GVM A;  3KIO A;  2DFF A;  4FSV A;  3KTQ A;  3ZT1 A;  1JLQ A;  4CJ5 A;  4QOZ B;  3VF6 A;  4QCL A;  2VYP A;  3J7Y P;  5FLX O;  5BN9 A;  4ICL A;  1LW2 A;  4BE1 A;  5AQV A;  1NGC A;  4QAG A;  1RDB A;  3O4N A;  3TAN A;  2A41 A;  3SPY A;  4O5F A;  1XQS C;  4OKE A;  3J7Z O;  3U3Y A;  5E41 A;  1N32 K;  3RMC A;  3OYD A;  1L3T A;  3M8Q A;  4WCE L;  4H0Y B;  4DV1 K;  5AZJ B;  2KFN A;  4PKH A;  3HPG A;  2F96 A;  4KPY A;  4BDY A;  1LAW A;  1N34 K;  1SL2 A;  3JYT A;  3AVN A;  4DMN A;  4ELU A;  3MEE A;  4KH6 A;  5AQR A;  1Q86 O;  1NK5 A;  2D0A A;  3JXU A;  4JI3 K;  3PV8 A;  2O8C A;  1CZ9 A;  1GLL O;  5TKY A;  2V52 B;  3T1Y K;  2A6A A;  5FRN A;  2RPI A;  4WF9 L;  3UKR A;  1Q7Y O;  1GLC G;  2HVH A;  1HJO A;  3QIN A;  4DS4 A;  5I42 A;  1TYQ A;  5BN8 A;  5F2R A;  1D8Y A;  4BG9 A;  4B1W B;  4N76 A;  4IFV A;  3TSU A;  1VSJ A;  3RTV A;  1T3V A;  2E4L A;  3LP0 A;  5EX5 A;  3CFO A;  3EO3 A;  3HT3 A;  1Q8I A;  3Q7C A;  4FM0 A;  5JIC A;  4DLG A;  1NJY A;  3HVT A;  5BRF A;  2P9L B;  4WQ4 A;  3V9X A;  4BRI A;  3A5O C;  2OPQ A;  4K8Z A;  2P1J A;  1XNR K;  3O9T A;  1KVB A;  4A5A A;  4BRH A;  4BR7 A;  1EP4 A;  4JKC A;  2DY4 A;  3AVH A;  4M3R A;  3VA3 A;  4FJ7 A;  1NK4 A;  1IBK K;  1NLV A;  3P39 A;  3HVR A;  1QQN A;  1TKD A;  3DWL A;  2ZD1 A;  2YNG A;  4DTP A;  3D2E A;  3U9Z A;  2I5J A;  4H4O A;  3HSC A;  4CI6 A;  5GIP A;  3NF9 A;  3PUF A;  4IO9 L;  1KXP A;  3O80 A;  3FZF A;  4C1N I;  4LF4 K;  2JWL A;  5AQF A;  4J2A A;  1RT4 A;  2UXD K;  4GW6 A;  3WNH A;  4CJF A;  1RT6 A;  5KGX A;  2E8A A;  4DSF A;  4RW6 A;  1Y97 A;  4O5B A;  4OVL A;  3MDQ A;  3HPH A;  2Y1J A;  3HPO A;  4JLH A;  4KKO A;  4CF0 A;  1FK9 A;  3L3U A;  5CE3 A;  1RDC A;  1BI4 B;  3IS9 A;  3SAF A;  2YI1 A;  2W6K A;  2J4R A;  3CCU N;  4CIG A;  3PX0 A;  3LAM A;  3OW2 M;  3M8P A;  1U47 A;  4AHU A;  3RVC A;  3F5T A;  1K8A O;  4IKF A;  3NH1 A;  3AV9 A;  4IJA A;  3E9P A;  3NGZ A;  2B4J A;  1HUX A;  4Z4I A;  2Q3S A;  3R6M A;  3OYL A;  3SUN A;  1NWK A;  4YOV A;  3QEX A;  1RDU A;  3CYM A;  1MU2 A;  3VQA A;  2UU9 K;  4B9L A;  1VSI A;  3G25 A;  1KCF A;  3VN5 A;  2CGJ A;  2E2Q A;  4FJG A;  4JHD A;  1T7P A;  3VQ9 A;  4KAZ A;  1T8E A;  3SI6 A;  3KD1 E;  4FLY A;  1YJN N;  2ZM6 K;  5LL6 Z;  2UYT A;  1HJR A;  4YNQ A;  4I6M B;  4Z4G A;  4RCH A;  2XHB A;  1L3U A;  5GIO A;  4DFM A;  4OKJ A;  3EN9 A;  4L8R B;  3QIO A;  3UIQ A;  2YNF A;  3JSM A;  3VEO A;  3CI5 A;  3QES A;  4DTS A;  4B8A B;  2BH1 A;  4JYA K;  3CM5 A;  3VEV A;  1O13 A;  3QEI A;  3J81 O;  4C8L A;  2O8F B;  3O5B A;  2CGL A;  4CHQ A;  1SAZ A;  3ZSX A;  1YI2 N;  2A40 A;  3SUP A;  3AAP A;  3WXM B;  4U7B A;  1SKR A;  3VEZ A;  3T7Z A;  3PX4 A;  4KRF A;  3TAF A;  3S3M A;  5C2D A;  2A3Z A;  5AQS A;  3A5L C;  1N5Y A;  4DR4 K;  1SL1 A;  3C94 A;  2QWR A;  2G8W A;  1BIZ A;  3ULD A;  3CD6 N;  4Y1C A;  2XY5 A;  4CGJ A;  1GLB G;  3VQQ A;  3AO5 A;  5KPR A;  4FJX A;  3HM9 A;  3R3L A;  1Z05 A;  1ASW A;  2UXC K;  3FR0 A;  4BC5 A;  3VTI A;  4FPB A;  3NBP A;  5CHI A;  3VQP A;  4IOX A;  1NGF A;  4DUZ K;  3T69 A;  3CG7 A;  4KTQ A;  2F7T A;  4CJL A;  1TL1 A;  1NK6 A;  3L2V A;  2YHY A;  2E1Z A;  3C6H A;  3EYZ A;  2OA8 A;  1K73 O;  5BPN A;  4FO0 A;  1VRT A;  1IV0 A;  3NDK A;  4NXN K;  2IDO A;  2G8V A;  4HUE A;  1K8K B;  3VQE A;  3VQ8 A;  2E1Y A;  3CQY A;  5AQZ A;  4H03 B;  5AQY A;  1XHZ A;  4U67 L;  2VQF K;  3C6U A;  3LL3 A;  4OLB A;  4DV5 K;  3HI0 A;  2KHO A;  1KSP A;  1T6C A;  3L8B A;  1G15 A;  3CCR N;  4TSX A;  3OYJ A;  4IEE A;  3AVC A;  3EZW A;  2O4I A;  2UUB K;  1QQC A;  1LWF A;  4GMJ B;  3F9K A;  1HNX K;  3HM8 A;  3MXJ A;  1QSS A;  4FWM A;  4CCH A;  3O6W A;  4FZX C;  3G0Z A;  4CJU A;  1KAY A;  4FM1 A;  1YTA A;  5IT9 O;  1VSM A;  1X9S A;  4EHU A;  3C7N B;  4C23 A;  4AF1 A;  3QLH A;  3DLR A;  3ZSW A;  3TWH A;  1RTJ A;  4JI2 K;  1GOB A;  4Y0W A;  4DLE A;  4BAC A;  3O1B A;  2CGK A;  5BRH A;  3ZEU B;  3OYN A;  1RBS A;  3E9L A;  4DG1 A;  3F73 A;  1U2V A;  4FJ9 A;  4KI6 A;  4AHS A;  1CZA N;  4JKG A;  5F0X A;  2QM1 A;  5AQM A;  1DGK N;  2EX3 A;  3KLE A;  3K9J A;  1QVG M;  3B6O A;  4C1N K;  3L2U A;  4M7X A;  4CZL A;  4CEC A;  1J53 A;  1JXE A;  4ELV A;  3IUC A;  1RIL A;  1G99 A;  3O3G A;  2FBX A;  3CCL N;  3J7A P;  1YF5 L;  4GNI A;  4FVM A;  4ILJ A;  1N8R O;  1MWM A;  3C6A A;  1RTD A;  5KQD A;  3TR8 A;  2WFB A;  3DI6 A;  4BR9 A;  4I9L A;  3OYK A;  2OPP A;  4I7F A;  3ATV A;  2NUB A;  4DU4 A;  2HST A;  3DMJ A;  3QNN A;  4JI8 K;  3MCA B;  4LH5 A;  4W5O A;  4RTF D;  1RT2 A;  4K25 A;  5CZ2 A;  1GLA G;  3K5N A;  3MK6 A;  1WBD A;  1X9M A;  3ZLJ A;  4Z4F A;  3ISN C;  3ZSR A;  3TAM A;  1TKT A;  4O55 A;  4CFA A;  3AVA A;  1VQN N;  3LAL A;  2P9P A;  3D2E B;  2Q1N A;  2DTU A;  3TSP A;  4FWS A;  4RW9 A;  3RMD A;  5J2P A;  4CHO A;  2YKN A;  4CEE A;  4BWJ A;  1CLQ A;  2Z1J A;  1DT9 A;  1K6Y A;  3VER A;  1ASU A;  5FPM A;  5AQH A;  3CPE A;  4B3S K;  1U45 A;  2E20 A;  1T03 A;  2D5R A;  4KHQ A;  2ATQ A;  4YOR A;  2RN2 A;  2O4G A;  4I6M A;  3VGM A;  1ZBS A;  2BGG A;  3TAP A;  4W5N A;  2IVP A;  3HBT A;  3MEC A;  1NGE A;  3OTO K;  3D0P A;  3CHW A;  3CJ1 A;  3VF2 A;  3S3O A;  1N36 K;  3KLH A;  5CZ1 A;  3VOV A;  4M3T A;  3LZJ A;  1BQM A;  1NK7 A;  1VSK A;  5AZI B;  2OYQ A;  3O4W A;  1HPM A;  4DKW A;  5H1S Q;  1I94 K;  3MEG A;  3ULE A;  1JXB A;  3FZL A;  3U6F A;  3OYC A;  1QS4 A;  4DQP A;  3HO1 A;  5LMN K;  4AHT A;  1EET A;  5IWA K;  3SQ0 A;  3DOK A;  3BZK A;  3FE1 A;  1VK0 A;  5AZJ A;  3ZSZ A;  3KK3 A;  3TI0 A;  4NLC A;  1L3S A;  1VQ9 N;  4ID1 A;  4MQ3 A;  3K9K A;  4AHR A;  3CCV N;  4FOE A;  2X6N A;  4KHN A;  5E84 A;  1WB9 A;  2PZS A;  3NAE A;  1VQ4 N;  3H3O B;  3HZ6 A;  3DLE A;  4BQL A;  5TKW A; 
#chains in the Genus database with same CATH homology
 1ZXO A;  3CMA N;  1M90 O;  3JXU A;  3UE5 A;  4JD2 B;  3QBW A;  1GLJ O;  5HL7 L;  2D0P A;  1GLL O;  5TKY A;  2V52 B;  3VMF B;  1ILY A;  2A6A A;  3NMU A;  4FWR A;  4WF9 L;  3UKR A;  4CZI A;  2CH6 A;  1Q7Y O;  1GLC G;  2ASP A;  4YOU A;  4WQ4 C;  4HWI A;  5M1N A;  1GLF O;  1HJO A;  4K42 A;  3SBT A;  4BRM A;  4PL7 A;  2HOE A;  1OVY A;  2H3G X;  4A57 A;  3BF3 A;  5M1O A;  2PAV A;  5FPE A;  1IJJ A;  3HRG A;  1YAG A;  2PFU A;  4HTL A;  5EXW A;  4QS7 A;  1TYQ A;  2HBM A;  1YJW N;  5BN8 A;  1IG8 A;  1VQM N;  1RFQ A;  5F2R A;  1VQ6 N;  2BTF A;  4BG9 A;  4IXC A;  3I33 A;  3P38 A;  5ADX H;  5JMV A;  4GVE A;  2P9L A;  4B1W B;  3FFK B;  3CF5 L;  3TSU A;  1T3V A;  5AR0 A;  2VWB A;  5EVZ A;  2CH5 A;  4IO8 A;  5EX5 A;  3DLL L;  3EO3 A;  3UKU A;  4DQ8 A;  3Q7C A;  5M1P A;  3EE9 A;  4JKB A;  4MO4 A;  5AQU A;  5JIC A;  3H46 O;  3CC2 N;  4YOT A;  2EWS A;  1ESV A;  4B1U B;  3E1Y A;  4CZJ A;  2JWK A;  4H0P A;  4KBO A;  1KAX A;  2OTJ N;  2WC9 A;  2YHX A;  5AFU A;  4JK7 A;  5BRF A;  5ADX A;  1KC8 O;  4FPA A;  3DXK B;  2P9L B;  2ZF5 O;  5GIN A;  4WQ4 A;  4BRI A;  3A5O C;  4GV6 A;  3WEE B;  3O9T A;  4A5A A;  3RSE B;  5DM7 L;  1TYQ B;  4BRL A;  4BRH A;  4BR7 A;  1KD1 O;  4BRN A;  4JKC A;  4BRO A;  4UY8 O;  1NGD A;  5GAH P;  1J6Z A;  2A5X A;  5C2F A;  4H0X B;  1NLV A;  3P39 A;  2ZGZ A;  4CZF A;  1QQN A;  3DXM B;  1XUP O;  3VGK A;  3DWL A;  4BGB A;  2VCP A;  1Q18 A;  4QS9 A;  2OTL N;  1HKG A;  3QFP A;  3VEY A;  3D2E A;  3U9Z A;  1BA1 A;  1VQO N;  3TU5 A;  1BWF O;  4BR2 A;  3HSC A;  1BDG A;  4CI6 A;  5GIP A;  4CZG A;  2QTD A;  1W2B M;  4XH4 A;  5M1K A;  1YXQ A;  5HOO A;  3FZM A;  2I7N A;  3R8E A;  3L4Q A;  1YIT N;  1KQS M;  3NVM A;  5GAE P;  4IO9 L;  1KXP A;  4IFE A;  3O80 A;  3FZF A;  4C1N I;  2JWL A;  2ZJP L;  3MN6 A;  1ATS A;  2P9U A;  4MO5 A;  4O8U A;  2WUS A;  5AQF A;  4A5B A;  3CCQ N;  3IDH A;  5AQN A;  4FWO A;  2E8A A;  5I9E B;  3I8B A;  1XC3 A;  2Q97 A;  5AQK A;  3MDQ A;  4CZE A;  1S22 A;  3QBX A;  4JN4 A;  2F9T A;  1ATR A;  5AQJ A;  3I55 N;  4PKG A;  3NVK A;  4YOY A;  5CE3 A;  4CBW A;  2YHW A;  5FPN A;  3ATU A;  1K8K A;  2A42 A;  3KWI A;  2QWO A;  3SAF A;  2YI1 A;  3SLC A;  2J4R A;  5AQT A;  3CCU N;  2IIR A;  2P9S A;  3OW2 M;  2ASO A;  4IWV A;  4DB3 A;  3VGL A;  3RVC A;  3F5T A;  1K8A O;  3CC7 N;  2RHK A;  4IJA A;  3E9P A;  3IFR A;  3CJB A;  3L6Q A;  4DHY A;  4AM6 A;  4CZM A;  5GAG P;  2VGM A;  4IOA L;  1HUX A;  2HBK A;  3L4I A;  4KH5 A;  2FSJ A;  4BRK A;  4BVP A;  5AQP A;  2KLA A;  1X3M A;  3R6M A;  5MLC Q;  1NWK A;  3AAR A;  4YOV A;  5JLF A;  1D4X A;  2HBJ A;  3OBY A;  3BP8 A;  1RDU A;  3H6E A;  3CJA A;  3L0Q A;  3AY9 A;  4F9O A;  2AA4 A;  1E4G T;  1HKB A;  3R1X A;  3LM2 A;  3OA9 A;  5AQO A;  4BRE A;  1YVN A;  4PL8 A;  2FF3 B;  2P9S B;  3G25 A;  4JKE A;  4MLE A;  2CGJ A;  3I56 N;  2E2Q A;  3E9O A;  1VQK N;  4JHD A;  5EY4 A;  4BRQ A;  2ZJR L;  1P90 A;  2V51 B;  3GG4 A;  3O9R A;  4JKH A;  5JVH L;  1NJI O;  1YJN N;  2P9N A;  2UYT A;  3JS6 A;  3C0B A;  4I6M B;  3D7E O;  3CJC A;  4RCH A;  3C65 A;  3IMX A;  3PLA A;  2V7Y A;  5LY3 A;  3EKS A;  4BRP A;  5GIO A;  2P9K B;  3EN9 A;  2GEM A;  5EOY A;  4OPA A;  2P9P B;  3O9U A;  3W3D A;  5CR4 A;  2D4W A;  3EKU A;  3FGU A;  3VTH A;  4YOX A;  4A2B A;  1RGI A;  3VEO A;  1QZ5 A;  3CI5 A;  3KHY A;  3MX5 A;  3MN5 A;  3BF1 A;  2ZJQ L;  2BH1 A;  5AQX A;  2Q31 A;  5B8H A;  3VEV A;  1O13 A;  4BR0 A;  1NGI A;  3GDQ A;  4FWK A;  2HF4 A;  2NRX A;  3UB5 A;  3CCS N;  3LDP A;  3O5B A;  4H5V A;  1VAZ A;  2I7P A;  2CGL A;  5E26 A;  2HMP A;  1RDW X;  3O8M A;  2FSN A;  1EO1 A;  3AAQ A;  4B1Y B;  4BY9 C;  3A5N C;  1SAZ A;  3O1W A;  4BRA A;  5BRE A;  2YCH A;  3SBG A;  2A40 A;  4BR5 A;  1YI2 N;  3AAP A;  1LOT B;  4JKA A;  3WXM B;  2GUP A;  3A5M C;  4U7B A;  1TUY A;  3VEZ A;  3SJH A;  3T7Z A;  3A0I X;  2P9I B;  4MDB A;  1WOQ A;  3DXM A;  3BEX A;  3OBW A;  5C2D A;  2A3Z A;  3R9P A;  5AQS A;  3A5L C;  5M1Q A;  4WFA L;  4GV9 A;  1VQL N;  4IJN A;  4FWQ A;  4CD1 A;  3ID8 A;  3TTF A;  3S41 A;  3CC4 N;  1X9J A;  2P9N B;  2QWR A;  5C15 A;  3VF4 A;  3ZYY X;  1P8Z A;  3W0L A;  1QQO A;  4H5N A;  4JK8 A;  1R59 O;  2QEX N;  2Q0R A;  4J8F A;  3PIO L;  3CD6 N;  3ZX3 A;  3MMV A;  4JHD B;  3CET A;  5F1X A;  1ATN A;  3SK3 A;  2QWL A;  4BC3 A;  3ZEU A;  5AQR A;  1QZ6 A;  1GLB G;  3VET A;  5KPR A;  3DJC A;  4BGA A;  1BG3 A;  3R3L A;  1Z05 A;  3FR0 A;  1SS6 A;  4BC5 A;  3VTI A;  4FPB A;  4YDU A;  1Y64 A;  2NNW A;  4CJ7 A;  4H0O A;  4B1Z A;  5CHI A;  4IOX A;  4B1V A;  1NGF A;  3T69 A;  3CER A;  3LDL A;  2E2N A;  1U2V B;  4GY2 B;  1QQM A;  5AQI A;  5AQL A;  4JEP A;  2F7T A;  3EL2 A;  2HBL A;  3ENO A;  1QVF M;  1EQY A;  3N4P A;  3O08 A;  2HF3 A;  3OHR A;  4IZ9 A;  4MDA A;  4JKG B;  4CBX A;  1NGJ A;  2YHY A;  2E1Z A;  4BRC A;  4XH1 A;  3C6H A;  2FLO A;  2V7Z A;  4EIA A;  4BR4 A;  2QWN A;  3ZX2 A;  4A62 A;  4CD3 A;  1K73 O;  3CME N;  5BPN A;  1MWK A;  4FO0 A;  2IVO A;  4JKF A;  4BRG A;  4FWL A;  3UKU B;  3BUZ B;  1K8K B;  3SMS A;  4ILH A;  1DKG D;  2E1Y A;  2FSK A;  3CQY A;  5C12 A;  5AQZ A;  4H03 B;  4DCH A;  4ILG B;  3HOS A;  4WQ5 A;  5AQY A;  4U67 L;  5DM6 L;  3G4S N;  4IEI A;  3FLC O;  3LL3 A;  3ZX0 A;  4Z94 A;  5ELZ A;  1JCF A;  3HI0 A;  1NBW A;  2KHO A;  2YJF A;  5BPL A;  1SQK A;  3UKR B;  4CZK A;  1T6C A;  3KVG A;  3D2F B;  3KZB A;  3CCR N;  4EAH D;  2NRZ A;  3G71 N;  1K9M O;  3D2F A;  4IEE A;  3EZW A;  2KKZ A;  4FOI A;  3PIP L;  4H0V B;  4BVO A;  1TUU A;  2P9U B;  2D1K A;  1NGG A;  2RE2 A;  3CXC M;  4H0T B;  5KPT A;  4IOC L;  3E66 A;  3QML A;  3HM8 A;  4E1J A;  5GAD P;  3M1F A;  4FWM A;  3O6W A;  5BPM A;  4A59 A;  3P4I A;  1H1V A;  3KWG A;  2E88 A;  3QFU A;  2W41 A;  1KAY A;  2NRT A;  3MN7 A;  1U6Z A;  3CCM N;  1BUP A;  2WBN A;  4H5W A;  1BU6 O;  2YJE A;  3CCE N;  1LCU A;  5BR9 A;  5KPZ A;  4EHU A;  3QDK A;  3C7N B;  4C23 A;  4AF1 A;  3VEN A;  4XEI A;  1OKJ A;  1E4F T;  4WFN L;  5C10 A;  3LDO A;  3U4L A;  2NZT A;  2P9K A;  2QI2 A;  3HOT A;  4GV3 A;  4OO1 J;  3WT0 A;  4B1X B;  4JNE A;  4Y0W A;  2IVN A;  4MLH A;  4CBU A;  5LJW A;  3DAW A;  1V4S A;  3O1B A;  1VQ7 N;  3M5R A;  2CGK A;  4FL9 A;  4PHT X;  4L3Q A;  5BRH A;  1MDU B;  3MCP A;  4NLB A;  3ZEU B;  5LJV A;  1YIJ N;  2NRW A;  3E9L A;  4RWT A;  1C0F A;  1SZ2 A;  1U2V A;  3GOI A;  3TPQ A;  3O9S A;  2AP1 A;  3WQT A;  3H3N O;  2GWJ A;  3M6G A;  3TTD A;  2E2O A;  1CZA N;  4JKG A;  3AGR A;  3U8X A;  5F0X A;  3WXJ A;  3N4Q A;  2QM1 A;  5AQM A;  1DGK N;  3K9J A;  5AQG A;  1QVG M;  4H5R A;  4C1N K;  3H45 C;  3U9D A;  4M7X A;  4CZL A;  2D0O A;  2FF6 A;  1YJ9 N;  3A8Y A;  4NO7 A;  3IUC A;  1YHQ N;  2QWM A;  2YX6 A;  2Q36 A;  3TSQ A;  5M1F A;  3MWP A;  3J8A A;  1G99 A;  2QWP A;  4ISE A;  3SAH A;  1GLD G;  3CCL N;  1JJ2 M;  1C0G A;  1WUA A;  1YF5 L;  3LM9 A;  2F9W A;  1X3N A;  3VES A;  5FPD A;  3GL1 A;  1VQP N;  1ZC6 A;  4GNI A;  1S72 N;  4ILJ A;  3SMP A;  3VEX A;  1YUW A;  2ASM A;  1N8R O;  1MWM A;  3WXI A;  3GBT A;  3C6A A;  4FWP A;  5JVG L;  5AFU H;  4BQZ A;  5KQD A;  4FVU A;  4LC9 B;  3VPZ A;  4JKD A;  3WXL A;  2P9I A;  3ENH A;  4BC2 A;  2WFB A;  4BR9 A;  3MN9 A;  5C0Y A;  4BRF A;  3CJ7 A;  4YDU C;  2ZWH A;  3CIP A;  1KAZ A;  3ATV A;  4KH4 A;  2HST A;  3O9Q A;  3CJ9 A;  2QW9 A;  1VQ5 N;  1V4T A;  1HKC A;  1BOT O;  3MCA B;  2ITM A;  3F2K A;  4RTF D;  4K25 A;  4H5T A;  4JD2 A;  4K43 A;  5JLH A;  1GLA G;  3RSE A;  4JK9 A;  2QXL A;  3MK6 A;  3WEE A;  3G6E N;  2BUP A;  3LDQ A;  1NGB A;  2DPN A;  1NGA A;  1Z6R A;  2PBD A;  2ZGY A;  3DXK A;  2NRR A;  3KK7 A;  2OAN A;  3WXK A;  3ID6 A;  4WFB L;  3QIC A;  2Q2R A;  4CZH A;  1VQN N;  4K41 A;  5BRD A;  2P9P A;  1DEJ A;  1MA9 B;  2W40 A;  3D2E B;  4WQ5 C;  2GWK A;  2Q1N A;  3ENB A;  3EE8 A;  3TSP A;  4B9Q A;  4FWS A;  1BA0 A;  3TTC A;  3WUH A;  1QHA A;  3CQX A;  3ULE B;  1DT9 A;  3M3Z A;  4A2A A;  4AM7 A;  5AQW A;  1NGH A;  2NRH A;  1BO5 O;  3VER A;  3CCJ N;  1Q81 O;  4M7Y A;  5FPM A;  3GE1 A;  5AQH A;  4JAX A;  5AZI A;  3CPE A;  4BG8 A;  3MWT A;  2E20 A;  4EHT A;  2QA4 N;  1GLE G;  2NLX A;  3FZH A;  3CPW M;  4NB4 A;  4YOR A;  1VQ8 N;  4I6M A;  3VGM A;  1S3X A;  1ZBS A;  4EFH A;  2GX9 A;  2IVP A;  3HBT A;  1NM1 A;  3H1V X;  3WQU A;  3D6R A;  4O8K A;  4R79 A;  4M63 C;  4FWN A;  4FSV A;  1NGE A;  3SAG A;  3VEW A;  3CHW A;  3CJ1 A;  3VF2 A;  4G9Z A;  1HLU A;  4A61 A;  1JCG A;  3H1Q A;  3VOV A;  2GEL A;  3F9M A;  3VF6 A;  2GTD A;  2VYP A;  3MX2 A;  3C7N A;  5BN9 A;  4BC4 A;  4ISF A;  5AZI B;  1M1K O;  3O4W A;  1HPM A;  3IKM A;  4DKW A;  5H1S Q;  4YOW A;  5AQV A;  1NGC A;  2QWQ A;  2E2P A;  3HTV A;  3FZK A;  3ULE A;  1NMD A;  2A41 A;  2NRV A;  2Q0U A;  3FZL A;  4XH5 A;  3ZET A;  1W97 L;  4O5F A;  1XQS C;  5AQQ A;  3LDN A;  3J7Z O;  1Q82 O;  4ISG A;  1JCE A;  3B8A X;  1Q86 O;  4QS8 A;  1T44 A;  4WCE L;  4PKI A;  3FE1 A;  3QB0 A;  4OPH A;  4H0Y B;  5AZJ A;  5AZJ B;  4NLC A;  1VQ9 N;  3AGK A;  4PKH A;  1T6D A;  4BRD A;  3K9K A;  3CCV N;  4WYB A;  4FOE A;  5KQ8 A;  2VGN A;  5E84 A;  4IDH A;  1VQ4 N;  3P31 A;  3H3O B;  3HZ6 A;  1HX1 A;  4KH6 A;  3ZET B;  5TKW A;  3Q7B A;  4BQL A;  2FXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...