1P90A

The three-dimensional structure of the core domain of nafy from azotobacter vinelandii determined at 1.8 resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
ERVPEGSIRVAIASNNGEQLDGHFGSCLRFLVYQVSAKDASLVDIRSTLDVALAEDKNAWRVEQIQDCQVLYVVSIGGPAAAKVVRAGIHPLKKPKGCAAQEAIAELQTVMAGSPPPWLAKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Three-dimensional Structure of the Core Domain of NafY from Azotobacter vinelandii determined at 1.8 A resolution
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Protein binding
molecule keywords hypothetical protein
total genus 40
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02579 Nitro_FeMo-Co Dinitrogenase iron-molybdenum cofactor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.130 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 1p90A00
2RE2A 1RDUA 1EO1A 2KLAA 2WFBA 1O13A 2YX6A 2QTDA 1T3VA 1P90A
chains in the Genus database with same CATH superfamily
5C10A 4NYNA 1K8KB 3L2QA 2YHXA 2Z1HA 3SQ0A 1RTHA 5C42A 4QAGA 3DJCA 3EE8A 5AQWA 2V52B 2XO7A 1I3AA 4FJJA 4PKIA 5AQRA 3CPEA 1MA9B 2HMPA 1YTUA 3WQTA 3D6RA 3TR8A 2ITGA 4BQLA 2YNFA 1NGCA 2D1KA 3P5JA 4CZLA 5HOOA 2YNGA 3P39A 5JMVA 4JI0K 4H0YB 4I6MB 1S22A 3S3MA 4DQPA 5KPZA 4CHNA 2ZM6K 4DQIA 3L6QA 4DSIA 2O4IA 3O4NA 1U4BA 2YV0X 3THYB 2KFNA 4NYFA 2D4WA 2QEXN 1VSDA 1IV0A 1DTTA 1VSHA 2D0OA 3DOLA 1D8YA 1BQMA 3QIPA 2QKKA 4LH5A 4H0OA 1VQPN 4JHDB 3CCVN 3RRGA 2HHSA 3C0BA 3A8YA 1UA0A 2X74A 1BGXT 4JKEA 4FJIA 3TABA 4EHTA 1HLUA 1IH7A 3TAMA 3VQAA 3D7EO 5KPRA 3CYMA 1OH6A 2HHWA 3ULEB 4CJTA 3EO3A 4BRPA 4GY2B 4OKKA 3KKRA 2VG7A 5C12A 4JI7K 1RBTA 4BRQA 1ZBHA 4HTLA 4XH5A 1TL1A 3LPTA 3FLCO 3LM9A 2RKIA 2PYJA 3ULDA 4LD0A 4FLZA 3R3LA 3AA4A 4YORA 4ELVA 4KBOA 2NRXA 5AZJB 3WT0A 1FKPA 5CE3A 4O0IA 3OYGA 2E1YA 2F9TA 3VA3A 1QSYA 3ZCMA 3NAEA 2PZSA 2QM1A 4CGDA 4C23A 4DQRA 3GDQA 3UB5A 4G1QA 3DXMA 1T3VA 4UY8O 2NUBA 4OLBA 1HNVA 3RMBA 1QZ5A 3EL2A 3CFRA 4N56A 3CD6N 2QWNA 2P9NA 1GLBG 3T69A 2XY6A 3WNHA 1SZ2A 3LAKA 4FPAA 2UYTA 2HB5A 4IG0A 3CMEN 3LZJA 3VQCA 1GOCA 2Q0UA 4M3UA 5FPMA 3SUPA 1YVUA 2KHOA 3VF2A 4AHSA 3B6OA 5SZTA 1GLEG 1OVQA 1OH8A 2ASPA 4FM1A 3T19A 1FXXA 1CZ9A 3CJ1A 3ZX0A 1XMQK 1RT3A 4CGFA 4BDPA 1S72N 4J8FA 1TKDA 4CHOA 4HUGA 1GOBA 4JK8A 3I0RA 5BRHA 2KTQA 4EZ6A 4WQ5C 5B8HA 4CJEA 3O9QA 2P9KB 2FBTA 4LFAK 1Q81O 1QVGM 3C7NB 1E4FT 3OYIA 3EKUA 3SBTA 2ZF5O 1NK7A 5JICA 5AQSA 3AAPA 1QQNA 1RT2A 1QE1A 2OCEA 1HR0K 1ZBSA 2KLAA 4OGEA 3FZLA 4K42A 3U3YA 4CHZA 2F4VK 3KLGA 3MN6A 1TK5A 1W2BM 4AH9A 3IDHA 3MEDA 4XH4A 4LF5K 4O4GA 4DS5A 4JKCA 2P9IA 4KHWA 4BGBA 3VGKA 3TAGA 2BUPA 3WXJA 4IXCA 2E6LA 3M8QA 4CHPA 3C95A 1GLJO 4M45A 3V9ZA 5AQTA 1NKEA 4JI3K 1VQ6N 4DR5K 2Q36A 4OPHA 3M5RA 3O8MA 1HNXK 4JD2A 3AVBA 3O9SA 1M90O 4FO0A 4DR3K 1XC3A 5MLCQ 1TL3A 1XHZA 3OBYA 4JLHA 4QS9A 4JK7A 4DFJA 4BROA 2BGGA 2A1RA 1T8EA 1U2VA 3OYBA 3WEEB 4X65K 4IFVA 2HHUA 2QK9A 4NO7A 1LWFA 1QHAA 4H03B 1UWBA 3AGRA 4GV3A 5IT9O 3ZETA 4CJLA 1QTMA 3NVKA 5AQMA 4B1ZA 2ATQA 1S9EA 3CI5A 3DXKA 3M3ZA 2D0PA 1KTQA 1ZC6A 1DTQA 3OA9A 2UUAK 4KHQA 3HSTB 4Z4CA 4DV4K 3EYZA 4RWTA 1Z26A 5FPEA 4YOWA 3OYMA 2WBNA 1VQ9N 4IDKA 3TSPA 4BRGA 2HHXA 3VESA 3A5NC 3QINA 4FJ5A 3GOIA 3O08A 1NJYA 4FCYA 4B9MA 3SNNA 3J7YP 1EETA 5AQKA 1OH5A 3A5MC 2DFEA 1U49A 4CZHA 3SMSA 4FOIA 4FJNA 3SBGA 2G8UA 3P1GA 3LAMA 5J2PA 3CPWM 3LP3A 1C1AA 4FOEA 1C0TA 5CYQA 5J2MA 5BRFA 1T6CA 3O4QA 2E8AA 5DMRA 2QA4N 4KB1A 4B9VA 4GKJK 1YTAA 4RCHA 4DR7K 3H3NO 1VSLA 2OZSA 4CGJA 5LMNK 5TKWA 1LWEA 4CZIA 4KH6A 4CFAA 4RW6A 2YHYA 1RDWX 2XY5A 4JAXA 1V4SA 4FSVA 4DV0K 2VWKA 4CHQA 5BR9A 1FK9A 2RPIA 1HNIA 4KO0A 1N34K 3HJFA 4FLWA 5BR8K 3AA2A 4I2PA 4FLTA 1WAFA 3D0PA 4YOXA 1N8RO 3C6AA 4PL8A 3E1YA 1CXUA 2OTLN 3CJ7A 2P1JA 4W5QA 1VSEA 5CY4A 3K0SA 4BR2A 3H08A 1EX4A 5CZ2A 4BACA 4KAZA 4M3XA 2O8CA 3AGKA 3ZSRA 1KRPA 3K2PA 3AVKA 2YNHA 4NXMK 4I9QA 2JLEA 3OVNA 2GWKA 4DUZK 4B3RK 4YOVA 2NZTA 1MWKA 4BR7A 4JKGB 1NNEA 1KVAA 2AJQA 5HRRA 2CGKA 3GE1A 4PHTX 1I94K 1WBBA 1JCGA 2FBXA 3ZT3A 5C15A 1WOQA 4DR6K 5F2RA 4JYAK 4B9SA 3QEIA 3VQ7A 4GW6A 2BTFA 1J53A 2ETJA 4I6MA 3I0SA 3PIPL 4ISEA 5EX5A 2WUSA 1RBSA 3SYZA 2FBYA 3QICA 1J6ZA 2Q3SA 1NU0A 4CEAA 4DTSA 4H4MA 3TPQA 4C1NK 4ISGA 1ITGA 3BF3A 1HKCA 2ZD1A 1DKGD 1T05A 2IS3A 3THXA 3RMCA 4K43A 4BRIA 3LWMA 5EVZA 3O3GA 1T6DA 5CZ1A 4X64K 3FZFA 3CFOA 4CK1A 3KWGA 2O4GA 4OLAA 4B3SK 5KQDA 4W5NA 2BE2A 3KHYA 3HM8A 3J80O 4YFUA 3G0ZA 1JLGA 4FZZA 3G25A 4FJ9A 1ATSA 1XNQK 3SQ4A 1JJ2M 2HHTA 4H0XB 3K58A 4AHTA 1HPMA 1HNWK 3ZSXA 3HSCA 2CGLA 3QB0A 4BGAA 3OTOK 3CC7N 3EN9A 3I56N 3CJBA 2FSKA 3AVGA 4AM6A 3U8XA 3DMJA 5AQGA 2I7PA 4C8KA 3AARA 2P9IB 3E9LA 5CYMA 5M1NA 3I8DA 4DU3A 1LW2A 1JL1A 4DMNA 1Z25A 3OW2M 4KTQA 3ENOA 1W9HA 1NGGA 3HP6A 2VG5A 2QXFA 4N76A 2PAVA 5AQQA 4FJMA 1U6ZA 3SV4A 1VRUA 5ADXA 1A5WA 4JHDA 3L4IA 3MN9A 2YKNA 3TI0A 1HYZA 3TAFA 1TGOA 3KVGA 4DR4K 3FZMA 4BY9C 2JWLA 1N5YA 5BPLA 4E1NA 2XY8A 2CGJA 4J2DA 3C6UA 2YHWA 2PBDA 3MEEA 4BREA 1WSIA 3TWHA 3VGMA 3V9WA 1SKRA 1YUWA 3S41A 3MK6A 1RT1A 1UAXA 1J5OA 4EAHD 2IVNA 3B8AX 4BQZA 3HBTA 4EHUA 3TAPA 3LDOA 1LWCA 1S1WA 3VGLA 3RR7A 4YOUA 3WXMB 3FFIA 1QHTA 4IBNA 5HL7L 3LZIA 4ID1A 3SUNA 3OYFA 3NF6A 3CIPA 1NGBA 4BVPA 5J2NA 4I7FA 3U4LA 3C6HA 4J2EA 4M3YA 4LH4A 1S1VA 1U04A 4OX9K 4WQ5A 1P8ZA 4E1JA 2BH1A 3VETA 2V7YA 1TAQA 4ISFA 4HWIA 1WUAA 1Z6RA 3MX2A 3J8AA 4MQ3A 1CLQA 4CFDA 4GMJB 5M1KA 4E7LA 4KH5A 1VSFA 3M8PA 4CGHA 5F0XA 1Q9XA 1XNRK 3OS0A 3WUHA 2VWBA 2B5JA 1RTIA 3ID6A 3ZSZA 1XI1A 4ICLA 1VK0A 1NJXA 1WSGA 1RT7A 5AQHA 3G71N 4AM7A 4EFHA 5AQIA 3BGRA 3NDKA 4E7HA 3HTVA 1IKXA 1S1UA 5I3UA 4V19S 4FWKA 3NF7A 3ENHA 3AVHA 4BWMA 1U48A 4B8AB 2W40A 2NRTA 1X9MA 3HZ6A 2NRVA 3ITHA 1M1KO 1NGEA 4BDZA 3WEEA 2Z1GA 3ZX2A 3OBWA 3DRRA 2HNDA 3RVCA 3MAQA 2P51A 3HO1A 5M1PA 4DTXA 4CF9A 1YHQN 3ENBA 4CF8A 4C8OA 1YF5L 1HNZK 4CIEA 1BCOA 4BC5A 3E66A 3UKRA 1Y97A 3ISNC 5KQ8A 3S3OA 5GIPA 3TAQA 3L2RA 1U45A 3CM6A 4BR5A 5EU7A 2FBVA 2QW9A 4KB0A 2Q31A 2W41A 3Q7BA 1XQSC 4JRPA 2ZGZA 2E1ZA 4LF6K 4FVMA 1BDGA 3R6MA 5AQZA 2I5JA 1RILA 4U7BA 3F2KA 4HUEA 3NH2A 1N36K 3ZX3A 4LF9K 3OJUA 4H5VA 4O5FA 1IKWA 2OYQA 4DSFA 1JCEA 1S1TA 4F2RA 2JWKA 5HRPA 1BUPA 1YVNA 3ZETB 4O0JA 1KCFA 4GKKK 3DYAA 3SQ1A 2F96A 2YNIA 3WNFA 5M1QA 1R0AA 1HKGA 1VQNN 4QOZB 3RR8A 3JXUA 2IVPA 3NVMA 4CW7B 2V7ZA 4ZTJA 1LOTB 2OANA 4CJUA 1QZ6A 1J54A 3DI6A 2XY7A 5KTQA 4FK4A 5C2DA 3CQYA 2FLOA 4J2BA 4ILGB 3FZKA 3R1XA 3NGIA 4CJSA 3VQ4A 1K8KA 4CEDA 1S5JA 5HBMA 4FK2A 1TVRA 2WOMA 2ZJQL 5H1SQ 4U67L 2FF3B 4DTPA 5C0YA 4XEIA 5TKYA 3ZSVA 1BG3A 4FWRA 1Q82O 3TU5A 3KLEA 1L3UA 4DU4A 2O8DA 1BA0A 3CJ9A 5JVGL 4NCBA 5AFUA 3UE5A 4JKGA 1ATNA 2G8KA 4H5WA 4DF4A 5GAHP 4C8MA 2EX3A 3L8BA 1NKCA 4O44A 4EZ9A 3PX6A 4CZKA 1KQSM 4IEEA 3JYTA 4CJ5A 3WXKA 4FWPA 1T7PA 3OYJA 4DV1K 4DG1A 2F9WA 2X6SA 3I33A 4DV7K 3NBPA 4Y1DA 3CETA 3E01A 3HOTA 3J7ZO 2UXDK 2KZZA 4Z4IA 3QETA 4BE2A 4KHNA 4AQYK 4E19A 4M7YA 3JS6A 3KLHA 3NCIA 2HBJA 2CH6A 4GNIA 4DSEA 1HJOA 4IJNA 3VQ5A 4I9LA 1RTDA 1DLOA 1QS4A 5C24A 3WXIA 5BPNA 3V1RA 3OHRA 3AV9A 2WFBA 4GVMA 5AQLA 2DPNA 3SUQA 3CF5L 5IWAK 1NJZA 3KD1E 2HW3A 4KHSA 3TSUA 2ASMA 5FLXO 2O8BB 3IMXA 4JK9A 3NGYA 3WNGA 5M1OA 3O3FA 1J5EK 4FL9A 4B9LA 5KGXA 3K57A 2RF2A 4IOXA 4C8NA 3F73A 1SKWA 3SZ2A 4JN4A 5ADXH 3V9SA 3K5NA 3KZBA 3NFAA 3KTQA 5KI6A 1L3VA 3O9TA 3K5MA 3KKSA 3VN5A 1QQMA 3AO3A 4Z94A 4Y0WA 3HXMA 4DLGA 2P9NB 4WYBA 1JCFA 2QWOA 3MWTA 4LF7K 3T1AA 4E7JA 5DK5A 4M3TA 4FXDA 5SWMA 2E2OA 2IIRA 5ELZA 4IOCL 1K6YA 3MEGA 4OPJA 1DGKN 2DFFA 4CESA 4WFNL 1C1CA 3O6WA 4CK3A 1SL1A 1C0UA 3CCSN 3Q7CA 1X3MA 3MCPA 3SLCA 4CEOA 4FWMA 1XHXA 5K14A 3BDPA 3ZT1A 5AQVA 4W5TA 2H3GX 3CCRN 3THVA 5JLFA 3SAFA 2CH5A 3BEXA 5AJ3K 3M8RA 5JVHL 4DF8A 1P90A 1NGIA 4YOTA 3W3DA 5HROA 3KJVA 4YDUC 1VQ4N 3CM5A 4JI6K 3OYLA 3EEQA 4FLUA 4OJRA 1EQYA 3VQ6A 1OH7A 2X78A 4CEZA 3SPYA 3HVRA 3KLIA 3NF8A 2VGMA 3EY1A 4M63C 3THWA 1JLEA 4K8ZA 3DXMB 2QWRA 4JI5K 4Q0BA 4IJAA 5LJWA 4OGCA 4CBWA 2XRIA 3TANA 4IDHA 3SAHA 3T7ZA 2QWLA 1S3XA 4JD2B 4BC2A 1VQKN 4QCLA 5J2QA 1X9JA 1BCMA 2P5GA 2HVHA 1ZBFA 3MWPA 4O5BA 1KC8O 2Z1JA 2A3ZA 3QERA 3N4PA 2BDPA 4E89A 4R79A 2G8WA 2OPRA 3SMPA 3EZ5A 1T03A 3LL3A 4DB3A 3OS1A 4HUFA 3HK2A 3LDLA 1TV6A 1WNSA 1KAXA 3QIOA 4DUYK 4DFMA 4BRCA 4K41A 4IEIA 2ZQBA 2IDOA 3WNEA 2ZWHA 4WQ4A 4AF1A 4WFAL 2D0BA 4Q5VA 4FM0A 4GVEA 4CJ4A 2P5OA 2P9KA 2NRZA 4CIGA 1VSIA 4DV2K 1JXEA 1NLVA 1Q8IA 1NJWA 2AA4A 3MCAB 3ZT2A 4FZXC 2OPPA 3IG1A 2NNWA 3QBWA 2GUIA 4FWSA 3TTFA 2GUPA 2YX6A 3FGUA 2JGUA 3H6EA 4EP4A 3AO2A 3DLHA 4DTRA 3ALYA 4NB4A 1R59O 2P9LB 4FPBA 3SAGA 4NCGA 1W0HA 4FLYA 1GLDG 1KLMA 1LCUA 1VQ8N 3ZT0A 2E5LK 1X9SA 1RT4A 1X1PA 5BREA 2G8IA 4H5RA 1C0MA 4B08A 5FRMA 3K5LA 4B1YB 4LC9B 1JLBA 1VSKA 4B9NA 2A5XA 4AILC 4PY5A 1QQCA 1S6QA 2W6LA 3F9KA 4CJVA 4OKEA 4JI8K 3PO5A 4NLCA 1MU2A 2B6AA 3UKRB 1IKYA 1TKTA 4H5TA 1YXQA 3P31A 1X3NA 3LWLA 1ATRA 3MX5A 3KK2A 3DWLA 2I7NA 3VOVA 4HTUA 3IKMA 5CR4A 5M1FA 4DSKA 1IKVA 5I9EB 1K73O 3B6PA 3VQDA 2XHBA 3CCQN 3SCXA 4LFBK 4RG8A 1ESVA 4CFBA 4BDYA 3CCLN 2GEMA 1G15A 3HL8A 2OZMA 3UKUB 4DQSA 5GADP 3ID8A 2UUCK 1YIJN 4LFCK 3RTVA 3AA3A 4H0PA 1UOCA 5GAEP 2F8TA 2G8FA 1JLFA 1KVBA 4BVOA 3BP8A 4KPYA 1EO1A 3CCEN 2VCPA 2WONA 1ZYQA 1SKSA 4B3TK 1WB9A 4B1XB 1VAZA 4E0DA 4EP5A 4DTUA 1NK5A 2O8BA 1FKOA 4DR1K 1D9FA 1KD1O 2NRHA 3AVMA 5GINA 1NOZA 4WE1A 4F3TA 4GV6A 4CZGA 4DFPA 4DLEA 1KSPA 4W5OA 1WSJA 1SUQA 3CCJN 1ASUA 4Y1CA 4MO5A 4CJWA 3D2EB 4WCEL 1Q86O 4M3RA 3KLFA 2E2QA 1TKXA 2W42A 4B3MK 1VQ5N 2VGNA 1C1BA 3O80A 4CCHA 2A41A 4WQ4C 1HJRA 3BY5A 4X62K 3KK3A 1XWLA 3SI6A 3OJSA 4A5AA 1GLAG 5AQJA 4G9ZA 1GOAA 4CJKA 3DRPA 1S6PA 2GBZA 2E6MA 3L3VA 2A40A 3FFKB 4KHYA 2P9UB 3EE9A 4A61A 3A2FA 3ZYYX 3VTHA 3RSEA 3QFUA 4BRFA 5GAGP 1C0GA 3C94A 4KH4A 3U6FA 3FE1A 4CJPA 3DLLL 1BIUA 1RTJA 2FXUA 2HNZA 3QEWA 1IBMK 4B8CA 1BIZA 1BISA 3TTCA 1Q18A 2HNYA 2OPSA 2ZGYA 3M8SA 4NXNK 4PUOA 3H1QA 3J7AP 1X9WA 3EZWA 2YJEA 4CK2A 4YY3K 3CMAN 4RW8A 4ILJA 1Q9YA 4DTOA 3ZSQA 3L2VA 4BG8A 1VQLN 4Z4FA 4FWNA 3NHGA 3LDQA 4R5PA 1BOTO 5AQPA 3U9ZA 4CFCA 4JRQA 4HVJA 2DFHA 3IS9A 5T7BA 1SAZA 2HBMA 2HF3A 3O4WA 4BRLA 3AA5X 3SV3A 1NGFA 2YCHA 2Q0RA 2DTUA 5BN8A 4BRNA 3O3HA 2O8CB 1IG8A 4EIAA 3PSIA 3ULEA 2ZE2A 1VQ7N 4M42A 3VQBA 3DLKA 4DKWA 2O8EA 1KAYA 2IVOA 1J9AA 1E4GT 1WSFA 5FRNA 4YHHK 4B9UA 4JI4K 1EP4A 2E2NA 5J1EA 1JXBA 1RBVA 3HRGA 4DR2K 3MN5A 4DV5K 1NK0A 1VHXA 2E20A 3CC2N 1KVCA 1ZXOA 2HOEA 5HLFA 1WBDA 2RE2A 4KREA 2UXCK 3LP2A 3LP1A 4Z4EA 1O13A 1Y64A 2P9PB 3G6EN 4DQQA 5AZIB 4OPKA 1NM1A 4DFKA 3CCMN 4FJLA 3BUZB 1TYQB 4L3QA 1ASVA 5LMUK 4M7XA 4FWLA 1BHLA 5HP1A 4XH1A 3HM9A 2QWPA 1HYVA 4CEFA 3HI0A 1QQOA 4JKDA 2YI1A 3H45C 1D9DA 4E7KA 3AVLA 3VMFB 3UIQA 3PSFA 2OTJN 4CERA 1GLLO 3CFPA 1TYQA 4CIFA 2ITMA 3NGZA 3O5BA 4KTZA 3PLAA 2VG6A 2J4RA 5EOYA 1EXQA 4BWJA 3P38A 1E3MA 1Q7YO 4CZEA 4CF1A 4QS8A 4FK0A 1S9GA 2WTUA 4DHYA 4XIUA 4BR9A 3KK1A 2A42A 2PY5A 3C7NA 3H3OB 3MXJA 2W6KA 2VWJA 3GBTA 3LDPA 4KKOA 4ELTA 3HPHA 1YITN 2GWJA 3K9KA 3KK7A 1C6VA 2NLXA 1YAGA 4H8KA 4CHYA 1L3SA 4MDAA 4N5SA 3U3GA 2HBLA 5E84A 3VF6A 2Y1IA 2GTDA 5C25A 3V9UA 1NMDA 3G10A 1HUXA 2VQFK 4ID5A 5AFUH 1YJNN 4BC4A 3AVJA 3FR0A 1H1VA 3VQ8A 4AHVA 3HOSA 3MXIA 1G99A 4FYDA 1GLCG 3AVNA 5JS1A 3DLGA 3CCUN 1ZBLA 3TAEA 1ASWA 5GIOA 4IO9L 1SL2A 2UXBK 3K59A 4CJ3A 4W5RA 2HMIA 3LANA 1HMVA 4BG9A 1L3TA 1LV5A 4FJ7A 2P9SB 1BA1A 2UU9K 3GG4A 2YKMA 3L2UA 2VQEK 4B9TA 2YJFA 3VQQA 2ASOA 4BE1A 3HP9A 2GELA 3QESA 1NMNA 1U2VB 1YT3A 3IUCA 5F1XA 2F8SA 3K9JA 4CJ7A 5BN9A 3LDSA 2LSNA 1DT9A 4YOYA 2EHGA 2Q1NA 4FM2A 3KD5E 2YHBA 3LP0A 2E4LA 4B1UB 3EKSA 3OYEA 3V9XA 3ZSYA 4FLXA 3DLRA 2D0AA 3RSEB 4FW1A 5KPTA 3PX4A 2R7YA 4RTFD 3AVIA 4FJ8A 4A62A 3P83D 4M41A 2A1SA 1ZBUA 3N4QA 4HCBA 1RBRA 4CEQA 4IWVA 1DEJA 3D2FA 4ZHRA 4A59A 3QFPA 1RT6A 1YJ9N 1N32K 2HBKA 4KRFA 3DRSA 3QO9A 1RGIA 3KIOA 2RHKA 3ZT4A 3BZKA 4M3ZA 3DM2A 3IFRA 4MLEA 1D4XA 1HRHA 3AO1A 4RW7A 3QNNA 1FW6A 2QKBA 1VSMA 2E2PA 1BQNA 4WF9L 4JS5A 2O8FA 4LY7A 3DLEA 1RDCA 3V1OA 1RDAA 5C2FA 5EXWA 4H4OA 3V1QA 3SUOA 1IO2A 3D2EA 1IBLK 3ATVA 3AVCA 2NRRA 3VEXA 1RNHA 3QMLA 3V6DA 3NE6A 1NKBA 3ZEUB 3C6TA 1MDUB 4B9QA 3HVTA 2EWSA 3UKUA 4KI6A 3I8BA 4GV9A 3RWUA 1FJGK 4IOAL 2QWMA 5FROA 2P9UA 1B9DA 3MECA 4PQUA 1TKZA 3U9DA 3THXB 4BRAA 1SQKA 2IAJA 5LJVA 2GX9A 4BRHA 1HYSA 4CF0A 3VQPA 4DTMA 1NGAA 4Z4GA 4DTNA 5AR0A 2HHQA 2OA8A 1T44A 4PWDA 1WN7A 3CHWA 2DY4A 2GV9A 3L2WA 3E9PA 4CD3A 4A2BA 2O8DB 5AZIA 3DAWA 1JLQA 3SPZA 1CZBA 3T3FA 4J2AA 3S3NA 4WFBL 4DQ8A 1UA1A 2D5RA 2QI2A 2Q2RA 3A5LC 3CJAA 4A2AA 3L4QA 3V81A 1QSLA 4FJXA 3VA0A 4YDUA 4PL7A 2VYPA 5KRSA 3OYDA 1V4TA 1D5AA 4FW2A 1LW0A 3HT3A 3TSQA 4H0VB 3VEZA 2A6AA 1NBWA 4KHPK 3T1HK 4FVUA 4FLVA 1A5XA 4IKFA 1VQMN 5AQNA 1KFDA 3PV8A 3PY8A 4E7IA 3O1BA 4E3SA 1Z05A 3JAMO 3I55N 3ZSOA 3FZHA 1CZAN 3T1YK 2KZMA 3AO4A 4DSJA 4DV3K 2FF6A 4CJRA 5KGWA 4B1WB 3OS2A 4CF2A 2QTDA 3WXLA 4O8KA 4CZJA 1TK0A 4ELUA 3PUFA 1L5UA 3LALA 3QLHA 5FDLA 4F4KA 1RFQA 2ZJRL 3G4SN 1B92A 1NWKA 4BR4A 5FPNA 1RT5A 4CBXA 3TTDA 4F2SA 4FJHA 1RDDA 3LPUA 4CEEA 4N47A 3CC4N 4DV6K 4MLHA 3DLBA 2O8EB 1EWRA 4AHCA 4K8XA 3L3UA 3MMVA 5BPMA 3HPGA 4CE9A 4CECA 3QEVA 3QEXA 2F7TA 4PKHA 4JI1K 3HYFA 4DCHA 4DTJA 1OKJA 3VEVA 4CVNE 1IJJA 3H1VX 3K5OA 4H5NA 3CXCM 2KW4A 1W7AA 4CZMA 1EWQA 4JNEA 2HHHK 3VQEA 1NG9A 1QVFM 3QDKA 4LF8K 3KWIA 1CXQA 3NH1A 4B1VA 4LF4K 5E26A 3D45A 1VSJA 3F9MA 3P4IA 5AZJA 3A5OC 4TSXA 3VTIA 3OYCA 3QEPA 1JLAA 3ASMA 1XMOK 1WLJA 2UUBK 4OKJA 4FJGA 4ZTFA 1SS6A 2IC3A 4HCCA 3M1FA 3MXMA 5HRSA 1N6QA 1NGHA 2P9LA 4Z0UA 3CG7A 4CD1A 5KRTA 4BRMA 4FWOA 4JV5K 5JLHA 1F21A 4KFBA 4BE0A 4C8LA 3RMDA 3BZCA 1ZBIA 3CQXA 4JI2K 1RBUA 5EY4A 2P9PA 4KHUA 4MFBA 4ILHA 1O1WA 3PX0A 3NH0A 3THYA 2X6NA 4OPAA 1TUUA 1WSHA 1TUYA 4I2QA 1IBKK 3HPOA 4IO8A 4AHRA 4IFYA 1REVA 1ILYA 2ZJPL 3R9PA 4PKGA 3C65A 1WAJA 4DWIA 3S9HA 1LAWA 3DXKB 3SK3A 2FSJA 4KV8A 4DSLA 4KTWA 3VQ9A 1C0FA 3VENA 4RW9A 3A0IX 5LL6Z 2AP1A 1KLNA 3THWB 1HQEA 3H46O 1HX1A 4IZ9A 1BO5O 2HSTA 3MDQA 3VEOA 1NOYA 1XC9A 4JEPA 3W0LA 3OY9A 5AQYA 5E41A 4LSLA 1VRTA 1VQON 5AQOA 1QSSA 3IAYA 3SJHA 1NGDA 5AQUA 4OO1J 4N41A 5CHIA 2P9SA 4F8RA 4F9OA 3D2FB 4JKAA 4BRKA 3OYNA 3OYHA 1BL3A 1S1XA 3PIOL 4JKHA 2PYLA 4UQGA 1NK4A 3VPZA 1KXPA 4A5BA 3GL1A 2KKZA 4CEBA 3F5TA 3OYKA 2RN2A 4DS4A 4O55A 4KI4A 1KAZA 3V4IA 3AO5A 5DM7L 4NCAA 4HHTA 3IRXA 4JKBA 1A5VA 4FWQA 3RRHA 2G8HA 3SJJA 2FSNA 3O1WA 4BC3A 1NK6A 4DU1A 4FJKA 3QNOA 2QXLA 3VEYA 1BI4A 3AY9A 1K9MO 2HHVA 3LDNA 3E9OA 4NLBA 4K25A 3O9UA 1SL0A 4CGGA 1WSEA 4MO4A 3WQUA 4JS4A 5LY3A 1HKBA 4O8UA 1SV5A 2FC0A 2IGIA 4RW4A 3AAQA 4E1MA 1NK8A 1EKEA 3R8EA 1BI4B 4F3OA 2IOCA 3CERA 1KFSA 4FZYA 5A2QO 2V51B 5BRDA 4CJFA 4CJQA 2E88A 4QS7A 1LAVA 5JS2A 2KFZA 3ZLJA 3L0QA 2G8VA 2D0CA 3SQ2A 4IFEA 3CQ8A 4LSNA 1NJIO 4A57A 1MWMA 4AHUA 4PA1A 3LM2A 1W97L 4B3OA 4H0TB 2Y1JA 3PO4A 2OPQA 2O8FB 2HF4A 1RCHA 5AQXA 1NGJA 2B4JA 3NMUA 3RMAA 1YJWN 3VF4A 1JKHA 3ATUA 3BF1A 3TARA 5AQFA 2Q97A 1YI2N 1K8AO 2YHAA 2KQ2A 3J81O 4BR0A 3ZEUA 3AVAA 1U47A 3AVFA 4CGIA 3QBXA 4YNQA 1GLFO 2HVIA 3CJCA 5D3GA 1JL2A 4M3WA 2Z1IA 1XUPO 4JKFA 2WC9A 5FPDA 3VEWA 4IG3A 3M6GA 1BU6O 3O9RA 1TK8A 1HPZA 2NRWA 2PFUA 5HRNA 1NK9A 4CBUA 4X66K 4OVLA 3ZSWA 4Z4HA 4C1NI 5I42A 1BWFO 1I39A 2BANA 4MDBA 1RDBA 2QWQA 1IG9A 4BRDA 3DOKA 3NF9A 5DM6L 1B9FA 3VERA 4CZFA 1RDUA 3JSMA 4L8RB 4CI6A 3MN7A 1JLCA 4K0KK 1TAUA 3OYAA 1HQUA 1N33K 1OVYA
chains in the Genus database with same CATH topology
5C10A 3QBWA 1K8KB 2YHXA 2YHWA 2PBDA 4FWSA 4BREA 5C2FA 5EXWA 3TTFA 3DJCA 3EE8A 3VGMA 2GUPA 2YX6A 5AQWA 1YUWA 3D2EA 3FGUA 2V52B 3ATVA 3H6EA 3S41A 2NRRA 3MK6A 4PKIA 3VEXA 5AQRA 3CPEA 1MA9B 2HMPA 3QMLA 3WQTA 3ZEUB 4EAHD 3D6RA 2IVNA 4BQLA 3B8AX 4BQZA 3HBTA 1MDUB 4EHUA 4B9QA 1NGCA 2D1KA 3LDOA 4NB4A 1R59O 2EWSA 4CZLA 2P9LB 5HOOA 3UKUA 3VGLA 3I8BA 4YOUA 4FPBA 3WXMB 3SAGA 4GV9A 3P39A 5JMVA 4H0YB 4I6MB 1GLDG 1S22A 5HL7L 1LCUA 4IOAL 2QWMA 5KPZA 1VQ8N 2P9UA 3L6QA 3U9DA 3CIPA 1NGBA 4BRAA 4BVPA 1SQKA 5LJVA 2D4WA 2GX9A 3C6HA 3U4LA 2QEXN 4BRHA 5BREA 4WQ5A 4H5RA 2D0OA 1P8ZA 4E1JA 1NGAA 5AR0A 2BH1A 3VETA 4H0OA 1T44A 2V7YA 4LC9B 4ISFA 4B1YB 1VQPN 3CHWA 4HWIA 1WUAA 4JHDB 3CCVN 2A5XA 1Z6RA 3C0BA 3A8YA 3E9PA 4JKEA 4NLCA 4A2BA 3UKRB 4CD3A 4H5TA 3MX2A 5AZIA 1YXQA 3J8AA 3P31A 3DAWA 4EHTA 1X3NA 1HLUA 1ATRA 3MX5A 3D7EO 5KPRA 5M1KA 3ULEB 4KH5A 5F0XA 3DWLA 3EO3A 4BRPA 2I7NA 3VOVA 3IKMA 4GY2B 3WUHA 2VWBA 5CR4A 5M1FA 5C12A 5I9EB 3ID6A 4BRQA 4WFBL 4HTLA 4DQ8A 2QI2A 4XH5A 1K73O 2Q2RA 3A5LC 3CJAA 3FLCO 3L4QA 5AQHA 4A2AA 3G71N 4AM7A 3CCQN 3LM9A 4EFHA 3R3LA 5AQIA 3HTVA 4YORA 4KBOA 1ESVA 2NRXA 4YDUA 5AZJB 3WT0A 2VYPA 4PL7A 3CCLN 4FWKA 1V4TA 2GEMA 3ENHA 3UKUB 5GADP 5CE3A 2E1YA 2F9TA 2W40A 3ID8A 2NRTA 3TSQA 4H0VB 1YIJN 2QM1A 3HZ6A 3VEZA 4C23A 2NRVA 4H0PA 1M1KO 3GDQA 2A6AA 1NBWA 3UB5A 5GAEP 3DXMA 1NGEA 1T3VA 4UY8O 4FVUA 4BVOA 3BP8A 1EO1A 3CCEN 3WEEA 2VCPA 3ZX2A 3OBWA 1QZ5A 1VQMN 3EL2A 4B1XB 1VAZA 5AQNA 3CD6N 3RVCA 2QWNA 3O1BA 2NRHA 2P9NA 5GINA 1KD1O 5M1PA 1GLBG 1Z05A 3T69A 4GV6A 1SZ2A 4CZGA 3I55N 4FPAA 2UYTA 1YHQN 3ENBA 3CMEN 3FZHA 1CZAN 1YF5L 3CCJN 4BC5A 3E66A 3UKRA 2Q0UA 5KQ8A 4MO5A 5FPMA 5GIPA 3D2EB 4WCEL 2KHOA 2FF6A 3VF2A 1Q86O 4B1WB 4BR5A 2E2QA 1GLEG 2QTDA 3WXLA 2ASPA 2QW9A 4O8KA 1VQ5N 2VGNA 3O80A 3CJ1A 3ZX0A 4CZJA 2Q31A 2A41A 4WQ4C 1S72N 4J8FA 2W41A 3Q7BA 1XQSC 2ZGZA 4JK8A 4A5AA 2E1ZA 1GLAG 5BRHA 1BDGA 3R6MA 5AQJA 4WQ5C 5AQZA 5B8HA 1RFQA 2ZJRL 4U7BA 3O9QA 3G4SN 4G9ZA 2P9KB 1NWKA 3F2KA 4BR4A 2A40A 3FFKB 5FPNA 3ZX3A 2P9UB 4CBXA 1Q81O 3TTDA 3EE9A 3C7NB 1E4FT 1QVGM 4A61A 4H5VA 4O5FA 3EKUA 3ZYYX 3SBTA 1JCEA 2ZF5O 5JICA 2JWKA 5AQSA 3AAPA 3VTHA 3CC4N 1QQNA 3RSEA 3QFUA 4MLHA 4BRFA 5GAGP 1BUPA 1C0GA 1YVNA 1ZBSA 2KLAA 3ZETB 3MMVA 4KH4A 3FZLA 5BPMA 3FE1A 4K42A 3DLLL 2FXUA 2F7TA 3MN6A 4PKHA 4DCHA 1W2BM 3IDHA 1OKJA 4XH4A 3VEVA 4JKCA 5M1QA 3TTCA 1IJJA 1Q18A 1HKGA 2P9IA 3H1VX 1VQNN 2ZGYA 3JXUA 2IVPA 3NVMA 4H5NA 4BGBA 3H1QA 2V7ZA 3VGKA 3EZWA 1LOTB 2OANA 3CXCM 1QZ6A 2BUPA 2YJEA 3WXJA 4CZMA 4IXCA 3CMAN 4ILJA 4JNEA 4BG8A 1QVFM 1GLJO 3QDKA 1VQLN 5AQTA 3KWIA 1VQ6N 4FWNA 5C2DA 3LDQA 2Q36A 3CQYA 3M5RA 4OPHA 4B1VA 2FLOA 3O8MA 5E26A 4ILGB 4JD2A 3FZKA 3O9SA 3R1XA 1BOTO 5AQPA 3F9MA 1M90O 4FO0A 3P4IA 5AZJA 3U9ZA 1K8KA 1XC3A 3A5OC 5MLCQ 3VTIA 2ZJQL 5H1SQ 4U67L 2FF3B 3OBYA 5C0YA 1SAZA 4XEIA 5TKYA 4QS9A 2HBMA 1BG3A 4FWRA 2HF3A 3O4WA 4JK7A 4BROA 3TU5A 4BRLA 1Q82O 1NGFA 1U2VA 2Q0RA 2YCHA 3WEEB 1BA0A 3CJ9A 5JVGL 5BN8A 1SS6A 4NO7A 3M1FA 4BRNA 1QHAA 1IG8A 4EIAA 3UE5A 4JKGA 3ULEA 5AFUA 4H03B 1VQ7N 1NGHA 2P9LA 3AGRA 4DKWA 1ATNA 4GV3A 1KAYA 2IVOA 3ZETA 4CD1A 1E4GT 4H5WA 5GAHP 4BRMA 4FWOA 3NVKA 5AQMA 4B1ZA 5JLHA 2E2NA 3HRGA 3CQXA 3CI5A 3MN5A 3DXKA 4CZKA 5EY4A 2P9PA 1KQSM 4ILHA 4IEEA 3M3ZA 2E20A 3CC2N 2D0PA 3WXKA 1ZXOA 2HOEA 4FWPA 4OPAA 1ZC6A 3OA9A 1TUUA 2RE2A 2F9WA 1TUYA 3I33A 4IO8A 4RWTA 5FPEA 4YOWA 1ILYA 3CETA 3HOTA 2WBNA 2ZJPL 3R9PA 1VQ9N 4PKGA 3TSPA 3J7ZO 3C65A 4BRGA 3VESA 1O13A 3DXKB 1Y64A 2P9PB 3A5NC 3G6EN 3GOIA 4M7YA 3O08A 3JS6A 3SK3A 2FSJA 5AZIB 1NM1A 2HBJA 3CCMN 2CH6A 4GNIA 1HJOA 4IJNA 5AQKA 1C0FA 3A5MC 3VENA 3BUZB 1TYQB 4CZHA 3A0IX 4L3QA 2AP1A 3WXIA 3SMSA 4M7XA 4FWLA 4FOIA 5BPNA 3SBGA 3OHRA 4XH1A 2QWPA 2WFBA 5AQLA 2DPNA 3H46O 3CPWM 3HI0A 3CF5L 4FOEA 1QQOA 4JKDA 2YI1A 1HX1A 3H45C 4IZ9A 1BO5O 5BRFA 1T6CA 3TSUA 2E8AA 3VMFB 2OTJN 2HSTA 2ASMA 3MDQA 3VEOA 2QA4N 4RCHA 3IMXA 4JK9A 4JEPA 3H3NO 3W0LA 5AQYA 5M1OA 1GLLO 5TKWA 1TYQA 1VQON 4CZIA 4KH6A 2ITMA 2YHYA 5AQOA 1RDWX 3O5BA 4FL9A 3PLAA 3SJHA 1NGDA 4JAXA 1V4SA 2J4RA 5EOYA 5AQUA 4OO1J 4FSVA 4IOXA 3P38A 5CHIA 5BR9A 2P9SA 1Q7YO 4JN4A 5ADXH 4CZEA 4F9OA 4QS8A 3KZBA 3D2FB 3O9TA 4JKAA 4BRKA 4DHYA 1QQMA 4Z94A 4BR9A 4JKHA 4Y0WA 3PIOL 2A42A 2P9NB 4WYBA 3C7NA 3H3OB 4YOXA 1JCFA 3VPZA 1N8RO 2QWOA 3GBTA 3LDPA 3MWTA 3C6AA 1KXPA 4A5BA 3GL1A 4WF9L 2KKZA 4PL8A 3F5TA 1YITN 3E1YA 2GWJA 2OTLN 3CJ7A 3K9KA 3KK7A 1KAZA 2NLXA 1YAGA 4BR2A 2E2OA 5DM7L 4JKBA 4MDAA 4FWQA 3AGKA 2IIRA 5ELZA 2FSNA 4IOCL 3O1WA 1DGKN 4BC3A 4WFNL 3O6WA 2HBLA 5E84A 3VF6A 2GWKA 3CCSN 2QXLA 3VEYA 4YOVA 2NZTA 2GTDA 1MWKA 1NMDA 3AY9A 3Q7CA 4BR7A 1K9MO 4JKGB 3LDNA 1HUXA 1X3MA 3MCPA 3E9OA 4NLBA 4K25A 5AFUH 3SLCA 3O9UA 1YJNN 4FWMA 2CGKA 3GE1A 4BC4A 4MO4A 4PHTX 3WQUA 3FR0A 1H1VA 1JCGA 3HOSA 5C15A 1WOQA 5AQVA 5LY3A 2H3GX 1G99A 1HKBA 4O8UA 5F2RA 3CCRN 1GLCG 5JLFA 3SAFA 2CH5A 3CCUN 3BEXA 3AAQA 5GIOA 5JVHL 2BTFA 4IO9L 4I6MA 3PIPL 4ISEA 5EX5A 3R8EA 4BG9A 2WUSA 3CERA 3QICA 1P90A 1J6ZA 2P9SB 1NGIA 1BA1A 2V51B 5BRDA 3GG4A 4YOTA 3W3DA 3I56N 2E88A 2YJFA 3TPQA 4QS7A 2ASOA 4C1NK 4ISGA 4YDUC 1VQ4N 3L0QA 3BF3A 1EQYA 1HKCA 2GELA 4IFEA 1DKGD 1U2VB 1NJIO 3IUCA 1MWMA 4A57A 5F1XA 3LM2A 1W97L 3K9JA 2VGMA 4CJ7A 4M63C 4H0TB 4K43A 4BRIA 2HF4A 5EVZA 5AQXA 5BN9A 1NGJA 3DXMB 2QWRA 1DT9A 1T6DA 3FZFA 4YOYA 3NMUA 2Q1NA 1YJWN 3VF4A 4IJAA 5LJWA 3ATUA 3KWGA 4CBWA 5KQDA 3BF1A 4B1UB 3EKSA 4IDHA 2Q97A 5AQFA 1YI2N 3SAHA 1K8AO 4BR0A 3KHYA 3T7ZA 3ZEUA 2QWLA 1S3XA 3HM8A 4JD2B 4BC2A 1VQKN 1X9JA 3RSEB 3G25A 3MWPA 5KPTA 3QBXA 1ATSA 4RTFD 1GLFO 1KC8O 4A62A 3CJCA 2A3ZA 3N4PA 3N4QA 1JJ2M 4R79A 4H0XB 1XUPO 1HPMA 4JKFA 3HSCA 2CGLA 3QB0A 3SMPA 4BGAA 3LL3A 4IWVA 2WC9A 3CC7N 3EN9A 3VEWA 3CJBA 5FPDA 2FSKA 5AQGA 4AM6A 3U8XA 4DB3A 1DEJA 2I7PA 3M6GA 3LDLA 3AARA 2P9IB 1KAXA 3E9LA 5M1NA 3D2FA 1BU6O 3O9RA 2NRWA 3QFPA 2PFUA 4A59A 1YJ9N 4BRCA 4K41A 2HBKA 3ENOA 3OW2M 1NGGA 4IEIA 4WFAL 4CBUA 2ZWHA 4WQ4A 4AF1A 1RGIA 2PAVA 5AQQA 2RHKA 1U6ZA 4GVEA 5ADXA 3IFRA 4JHDA 4C1NI 2P9KA 3L4IA 1BWFO 3MN9A 4MLEA 1D4XA 4MDBA 2NRZA 3KVGA 2QWQA 4BRDA 5DM6L 1NLVA 3VERA 4CZFA 1RDUA 3FZMA 4CI6A 2AA4A 3MCAB 3MN7A 4BY9C 2JWLA 2E2PA 5BPLA 2CGJA 2NNWA 1OVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RE2 A;  1RDU A;  1EO1 A;  2KLA A;  2WFB A;  1O13 A;  2YX6 A;  2QTD A;  1T3V A;  1P90 A; 
#chains in the Genus database with same CATH topology
 5C10 A;  4NYN A;  1K8K B;  3L2Q A;  2YHX A;  2Z1H A;  3SQ0 A;  1RTH A;  5C42 A;  4QAG A;  3DJC A;  3EE8 A;  5AQW A;  2V52 B;  2XO7 A;  1I3A A;  4FJJ A;  4PKI A;  5AQR A;  3CPE A;  1MA9 B;  2HMP A;  1YTU A;  3WQT A;  3D6R A;  3TR8 A;  2ITG A;  4BQL A;  2YNF A;  1NGC A;  2D1K A;  3P5J A;  4CZL A;  5HOO A;  2YNG A;  3P39 A;  5JMV A;  4JI0 K;  4H0Y B;  4I6M B;  1S22 A;  3S3M A;  4DQP A;  5KPZ A;  4CHN A;  2ZM6 K;  4DQI A;  3L6Q A;  4DSI A;  2O4I A;  3O4N A;  1U4B A;  2YV0 X;  3THY B;  2KFN A;  4NYF A;  2D4W A;  2QEX N;  1VSD A;  1IV0 A;  1DTT A;  1VSH A;  2D0O A;  3DOL A;  1D8Y A;  1BQM A;  3QIP A;  2QKK A;  4LH5 A;  4H0O A;  1VQP N;  4JHD B;  3CCV N;  3RRG A;  2HHS A;  3C0B A;  3A8Y A;  1UA0 A;  2X74 A;  1BGX T;  4JKE A;  4FJI A;  3TAB A;  4EHT A;  1HLU A;  1IH7 A;  3TAM A;  3VQA A;  3D7E O;  5KPR A;  3CYM A;  1OH6 A;  2HHW A;  3ULE B;  4CJT A;  3EO3 A;  4BRP A;  4GY2 B;  4OKK A;  3KKR A;  2VG7 A;  5C12 A;  4JI7 K;  1RBT A;  4BRQ A;  1ZBH A;  4HTL A;  4XH5 A;  1TL1 A;  3LPT A;  3FLC O;  3LM9 A;  2RKI A;  2PYJ A;  3ULD A;  4LD0 A;  4FLZ A;  3R3L A;  3AA4 A;  4YOR A;  4ELV A;  4KBO A;  2NRX A;  5AZJ B;  3WT0 A;  1FKP A;  5CE3 A;  4O0I A;  3OYG A;  2E1Y A;  2F9T A;  3VA3 A;  1QSY A;  3ZCM A;  3NAE A;  2PZS A;  2QM1 A;  4CGD A;  4C23 A;  4DQR A;  3GDQ A;  3UB5 A;  4G1Q A;  3DXM A;  1T3V A;  4UY8 O;  2NUB A;  4OLB A;  1HNV A;  3RMB A;  1QZ5 A;  3EL2 A;  3CFR A;  4N56 A;  3CD6 N;  2QWN A;  2P9N A;  1GLB G;  3T69 A;  2XY6 A;  3WNH A;  1SZ2 A;  3LAK A;  4FPA A;  2UYT A;  2HB5 A;  4IG0 A;  3CME N;  3LZJ A;  3VQC A;  1GOC A;  2Q0U A;  4M3U A;  5FPM A;  3SUP A;  1YVU A;  2KHO A;  3VF2 A;  4AHS A;  3B6O A;  5SZT A;  1GLE G;  1OVQ A;  1OH8 A;  2ASP A;  4FM1 A;  3T19 A;  1FXX A;  1CZ9 A;  3CJ1 A;  3ZX0 A;  1XMQ K;  1RT3 A;  4CGF A;  4BDP A;  1S72 N;  4J8F A;  1TKD A;  4CHO A;  4HUG A;  1GOB A;  4JK8 A;  3I0R A;  5BRH A;  2KTQ A;  4EZ6 A;  4WQ5 C;  5B8H A;  4CJE A;  3O9Q A;  2P9K B;  2FBT A;  4LFA K;  1Q81 O;  1QVG M;  3C7N B;  1E4F T;  3OYI A;  3EKU A;  3SBT A;  2ZF5 O;  1NK7 A;  5JIC A;  5AQS A;  3AAP A;  1QQN A;  1RT2 A;  1QE1 A;  2OCE A;  1HR0 K;  1ZBS A;  2KLA A;  4OGE A;  3FZL A;  4K42 A;  3U3Y A;  4CHZ A;  2F4V K;  3KLG A;  3MN6 A;  1TK5 A;  1W2B M;  4AH9 A;  3IDH A;  3MED A;  4XH4 A;  4LF5 K;  4O4G A;  4DS5 A;  4JKC A;  2P9I A;  4KHW A;  4BGB A;  3VGK A;  3TAG A;  2BUP A;  3WXJ A;  4IXC A;  2E6L A;  3M8Q A;  4CHP A;  3C95 A;  1GLJ O;  4M45 A;  3V9Z A;  5AQT A;  1NKE A;  4JI3 K;  1VQ6 N;  4DR5 K;  2Q36 A;  4OPH A;  3M5R A;  3O8M A;  1HNX K;  4JD2 A;  3AVB A;  3O9S A;  1M90 O;  4FO0 A;  4DR3 K;  1XC3 A;  5MLC Q;  1TL3 A;  1XHZ A;  3OBY A;  4JLH A;  4QS9 A;  4JK7 A;  4DFJ A;  4BRO A;  2BGG A;  2A1R A;  1T8E A;  1U2V A;  3OYB A;  3WEE B;  4X65 K;  4IFV A;  2HHU A;  2QK9 A;  4NO7 A;  1LWF A;  1QHA A;  4H03 B;  1UWB A;  3AGR A;  4GV3 A;  5IT9 O;  3ZET A;  4CJL A;  1QTM A;  3NVK A;  5AQM A;  4B1Z A;  2ATQ A;  1S9E A;  3CI5 A;  3DXK A;  3M3Z A;  2D0P A;  1KTQ A;  1ZC6 A;  1DTQ A;  3OA9 A;  2UUA K;  4KHQ A;  3HST B;  4Z4C A;  4DV4 K;  3EYZ A;  4RWT A;  1Z26 A;  5FPE A;  4YOW A;  3OYM A;  2WBN A;  1VQ9 N;  4IDK A;  3TSP A;  4BRG A;  2HHX A;  3VES A;  3A5N C;  3QIN A;  4FJ5 A;  3GOI A;  3O08 A;  1NJY A;  4FCY A;  4B9M A;  3SNN A;  3J7Y P;  1EET A;  5AQK A;  1OH5 A;  3A5M C;  2DFE A;  1U49 A;  4CZH A;  3SMS A;  4FOI A;  4FJN A;  3SBG A;  2G8U A;  3P1G A;  3LAM A;  5J2P A;  3CPW M;  3LP3 A;  1C1A A;  4FOE A;  1C0T A;  5CYQ A;  5J2M A;  5BRF A;  1T6C A;  3O4Q A;  2E8A A;  5DMR A;  2QA4 N;  4KB1 A;  4B9V A;  4GKJ K;  1YTA A;  4RCH A;  4DR7 K;  3H3N O;  1VSL A;  2OZS A;  4CGJ A;  5LMN K;  5TKW A;  1LWE A;  4CZI A;  4KH6 A;  4CFA A;  4RW6 A;  2YHY A;  1RDW X;  2XY5 A;  4JAX A;  1V4S A;  4FSV A;  4DV0 K;  2VWK A;  4CHQ A;  5BR9 A;  1FK9 A;  2RPI A;  1HNI A;  4KO0 A;  1N34 K;  3HJF A;  4FLW A;  5BR8 K;  3AA2 A;  4I2P A;  4FLT A;  1WAF A;  3D0P A;  4YOX A;  1N8R O;  3C6A A;  4PL8 A;  3E1Y A;  1CXU A;  2OTL N;  3CJ7 A;  2P1J A;  4W5Q A;  1VSE A;  5CY4 A;  3K0S A;  4BR2 A;  3H08 A;  1EX4 A;  5CZ2 A;  4BAC A;  4KAZ A;  4M3X A;  2O8C A;  3AGK A;  3ZSR A;  1KRP A;  3K2P A;  3AVK A;  2YNH A;  4NXM K;  4I9Q A;  2JLE A;  3OVN A;  2GWK A;  4DUZ K;  4B3R K;  4YOV A;  2NZT A;  1MWK A;  4BR7 A;  4JKG B;  1NNE A;  1KVA A;  2AJQ A;  5HRR A;  2CGK A;  3GE1 A;  4PHT X;  1I94 K;  1WBB A;  1JCG A;  2FBX A;  3ZT3 A;  5C15 A;  1WOQ A;  4DR6 K;  5F2R A;  4JYA K;  4B9S A;  3QEI A;  3VQ7 A;  4GW6 A;  2BTF A;  1J53 A;  2ETJ A;  4I6M A;  3I0S A;  3PIP L;  4ISE A;  5EX5 A;  2WUS A;  1RBS A;  3SYZ A;  2FBY A;  3QIC A;  1J6Z A;  2Q3S A;  1NU0 A;  4CEA A;  4DTS A;  4H4M A;  3TPQ A;  4C1N K;  4ISG A;  1ITG A;  3BF3 A;  1HKC A;  2ZD1 A;  1DKG D;  1T05 A;  2IS3 A;  3THX A;  3RMC A;  4K43 A;  4BRI A;  3LWM A;  5EVZ A;  3O3G A;  1T6D A;  5CZ1 A;  4X64 K;  3FZF A;  3CFO A;  4CK1 A;  3KWG A;  2O4G A;  4OLA A;  4B3S K;  5KQD A;  4W5N A;  2BE2 A;  3KHY A;  3HM8 A;  3J80 O;  4YFU A;  3G0Z A;  1JLG A;  4FZZ A;  3G25 A;  4FJ9 A;  1ATS A;  1XNQ K;  3SQ4 A;  1JJ2 M;  2HHT A;  4H0X B;  3K58 A;  4AHT A;  1HPM A;  1HNW K;  3ZSX A;  3HSC A;  2CGL A;  3QB0 A;  4BGA A;  3OTO K;  3CC7 N;  3EN9 A;  3I56 N;  3CJB A;  2FSK A;  3AVG A;  4AM6 A;  3U8X A;  3DMJ A;  5AQG A;  2I7P A;  4C8K A;  3AAR A;  2P9I B;  3E9L A;  5CYM A;  5M1N A;  3I8D A;  4DU3 A;  1LW2 A;  1JL1 A;  4DMN A;  1Z25 A;  3OW2 M;  4KTQ A;  3ENO A;  1W9H A;  1NGG A;  3HP6 A;  2VG5 A;  2QXF A;  4N76 A;  2PAV A;  5AQQ A;  4FJM A;  1U6Z A;  3SV4 A;  1VRU A;  5ADX A;  1A5W A;  4JHD A;  3L4I A;  3MN9 A;  2YKN A;  3TI0 A;  1HYZ A;  3TAF A;  1TGO A;  3KVG A;  4DR4 K;  3FZM A;  4BY9 C;  2JWL A;  1N5Y A;  5BPL A;  4E1N A;  2XY8 A;  2CGJ A;  4J2D A;  3C6U A;  2YHW A;  2PBD A;  3MEE A;  4BRE A;  1WSI A;  3TWH A;  3VGM A;  3V9W A;  1SKR A;  1YUW A;  3S41 A;  3MK6 A;  1RT1 A;  1UAX A;  1J5O A;  4EAH D;  2IVN A;  3B8A X;  4BQZ A;  3HBT A;  4EHU A;  3TAP A;  3LDO A;  1LWC A;  1S1W A;  3VGL A;  3RR7 A;  4YOU A;  3WXM B;  3FFI A;  1QHT A;  4IBN A;  5HL7 L;  3LZI A;  4ID1 A;  3SUN A;  3OYF A;  3NF6 A;  3CIP A;  1NGB A;  4BVP A;  5J2N A;  4I7F A;  3U4L A;  3C6H A;  4J2E A;  4M3Y A;  4LH4 A;  1S1V A;  1U04 A;  4OX9 K;  4WQ5 A;  1P8Z A;  4E1J A;  2BH1 A;  3VET A;  2V7Y A;  1TAQ A;  4ISF A;  4HWI A;  1WUA A;  1Z6R A;  3MX2 A;  3J8A A;  4MQ3 A;  1CLQ A;  4CFD A;  4GMJ B;  5M1K A;  4E7L A;  4KH5 A;  1VSF A;  3M8P A;  4CGH A;  5F0X A;  1Q9X A;  1XNR K;  3OS0 A;  3WUH A;  2VWB A;  2B5J A;  1RTI A;  3ID6 A;  3ZSZ A;  1XI1 A;  4ICL A;  1VK0 A;  1NJX A;  1WSG A;  1RT7 A;  5AQH A;  3G71 N;  4AM7 A;  4EFH A;  5AQI A;  3BGR A;  3NDK A;  4E7H A;  3HTV A;  1IKX A;  1S1U A;  5I3U A;  4V19 S;  4FWK A;  3NF7 A;  3ENH A;  3AVH A;  4BWM A;  1U48 A;  4B8A B;  2W40 A;  2NRT A;  1X9M A;  3HZ6 A;  2NRV A;  3ITH A;  1M1K O;  1NGE A;  4BDZ A;  3WEE A;  2Z1G A;  3ZX2 A;  3OBW A;  3DRR A;  2HND A;  3RVC A;  3MAQ A;  2P51 A;  3HO1 A;  5M1P A;  4DTX A;  4CF9 A;  1YHQ N;  3ENB A;  4CF8 A;  4C8O A;  1YF5 L;  1HNZ K;  4CIE A;  1BCO A;  4BC5 A;  3E66 A;  3UKR A;  1Y97 A;  3ISN C;  5KQ8 A;  3S3O A;  5GIP A;  3TAQ A;  3L2R A;  1U45 A;  3CM6 A;  4BR5 A;  5EU7 A;  2FBV A;  2QW9 A;  4KB0 A;  2Q31 A;  2W41 A;  3Q7B A;  1XQS C;  4JRP A;  2ZGZ A;  2E1Z A;  4LF6 K;  4FVM A;  1BDG A;  3R6M A;  5AQZ A;  2I5J A;  1RIL A;  4U7B A;  3F2K A;  4HUE A;  3NH2 A;  1N36 K;  3ZX3 A;  4LF9 K;  3OJU A;  4H5V A;  4O5F A;  1IKW A;  2OYQ A;  4DSF A;  1JCE A;  1S1T A;  4F2R A;  2JWK A;  5HRP A;  1BUP A;  1YVN A;  3ZET B;  4O0J A;  1KCF A;  4GKK K;  3DYA A;  3SQ1 A;  2F96 A;  2YNI A;  3WNF A;  5M1Q A;  1R0A A;  1HKG A;  1VQN N;  4QOZ B;  3RR8 A;  3JXU A;  2IVP A;  3NVM A;  4CW7 B;  2V7Z A;  4ZTJ A;  1LOT B;  2OAN A;  4CJU A;  1QZ6 A;  1J54 A;  3DI6 A;  2XY7 A;  5KTQ A;  4FK4 A;  5C2D A;  3CQY A;  2FLO A;  4J2B A;  4ILG B;  3FZK A;  3R1X A;  3NGI A;  4CJS A;  3VQ4 A;  1K8K A;  4CED A;  1S5J A;  5HBM A;  4FK2 A;  1TVR A;  2WOM A;  2ZJQ L;  5H1S Q;  4U67 L;  2FF3 B;  4DTP A;  5C0Y A;  4XEI A;  5TKY A;  3ZSV A;  1BG3 A;  4FWR A;  1Q82 O;  3TU5 A;  3KLE A;  1L3U A;  4DU4 A;  2O8D A;  1BA0 A;  3CJ9 A;  5JVG L;  4NCB A;  5AFU A;  3UE5 A;  4JKG A;  1ATN A;  2G8K A;  4H5W A;  4DF4 A;  5GAH P;  4C8M A;  2EX3 A;  3L8B A;  1NKC A;  4O44 A;  4EZ9 A;  3PX6 A;  4CZK A;  1KQS M;  4IEE A;  3JYT A;  4CJ5 A;  3WXK A;  4FWP A;  1T7P A;  3OYJ A;  4DV1 K;  4DG1 A;  2F9W A;  2X6S A;  3I33 A;  4DV7 K;  3NBP A;  4Y1D A;  3CET A;  3E01 A;  3HOT A;  3J7Z O;  2UXD K;  2KZZ A;  4Z4I A;  3QET A;  4BE2 A;  4KHN A;  4AQY K;  4E19 A;  4M7Y A;  3JS6 A;  3KLH A;  3NCI A;  2HBJ A;  2CH6 A;  4GNI A;  4DSE A;  1HJO A;  4IJN A;  3VQ5 A;  4I9L A;  1RTD A;  1DLO A;  1QS4 A;  5C24 A;  3WXI A;  5BPN A;  3V1R A;  3OHR A;  3AV9 A;  2WFB A;  4GVM A;  5AQL A;  2DPN A;  3SUQ A;  3CF5 L;  5IWA K;  1NJZ A;  3KD1 E;  2HW3 A;  4KHS A;  3TSU A;  2ASM A;  5FLX O;  2O8B B;  3IMX A;  4JK9 A;  3NGY A;  3WNG A;  5M1O A;  3O3F A;  1J5E K;  4FL9 A;  4B9L A;  5KGX A;  3K57 A;  2RF2 A;  4IOX A;  4C8N A;  3F73 A;  1SKW A;  3SZ2 A;  4JN4 A;  5ADX H;  3V9S A;  3K5N A;  3KZB A;  3NFA A;  3KTQ A;  5KI6 A;  1L3V A;  3O9T A;  3K5M A;  3KKS A;  3VN5 A;  1QQM A;  3AO3 A;  4Z94 A;  4Y0W A;  3HXM A;  4DLG A;  2P9N B;  4WYB A;  1JCF A;  2QWO A;  3MWT A;  4LF7 K;  3T1A A;  4E7J A;  5DK5 A;  4M3T A;  4FXD A;  5SWM A;  2E2O A;  2IIR A;  5ELZ A;  4IOC L;  1K6Y A;  3MEG A;  4OPJ A;  1DGK N;  2DFF A;  4CES A;  4WFN L;  1C1C A;  3O6W A;  4CK3 A;  1SL1 A;  1C0U A;  3CCS N;  3Q7C A;  1X3M A;  3MCP A;  3SLC A;  4CEO A;  4FWM A;  1XHX A;  5K14 A;  3BDP A;  3ZT1 A;  5AQV A;  4W5T A;  2H3G X;  3CCR N;  3THV A;  5JLF A;  3SAF A;  2CH5 A;  3BEX A;  5AJ3 K;  3M8R A;  5JVH L;  4DF8 A;  1P90 A;  1NGI A;  4YOT A;  3W3D A;  5HRO A;  3KJV A;  4YDU C;  1VQ4 N;  3CM5 A;  4JI6 K;  3OYL A;  3EEQ A;  4FLU A;  4OJR A;  1EQY A;  3VQ6 A;  1OH7 A;  2X78 A;  4CEZ A;  3SPY A;  3HVR A;  3KLI A;  3NF8 A;  2VGM A;  3EY1 A;  4M63 C;  3THW A;  1JLE A;  4K8Z A;  3DXM B;  2QWR A;  4JI5 K;  4Q0B A;  4IJA A;  5LJW A;  4OGC A;  4CBW A;  2XRI A;  3TAN A;  4IDH A;  3SAH A;  3T7Z A;  2QWL A;  1S3X A;  4JD2 B;  4BC2 A;  1VQK N;  4QCL A;  5J2Q A;  1X9J A;  1BCM A;  2P5G A;  2HVH A;  1ZBF A;  3MWP A;  4O5B A;  1KC8 O;  2Z1J A;  2A3Z A;  3QER A;  3N4P A;  2BDP A;  4E89 A;  4R79 A;  2G8W A;  2OPR A;  3SMP A;  3EZ5 A;  1T03 A;  3LL3 A;  4DB3 A;  3OS1 A;  4HUF A;  3HK2 A;  3LDL A;  1TV6 A;  1WNS A;  1KAX A;  3QIO A;  4DUY K;  4DFM A;  4BRC A;  4K41 A;  4IEI A;  2ZQB A;  2IDO A;  3WNE A;  2ZWH A;  4WQ4 A;  4AF1 A;  4WFA L;  2D0B A;  4Q5V A;  4FM0 A;  4GVE A;  4CJ4 A;  2P5O A;  2P9K A;  2NRZ A;  4CIG A;  1VSI A;  4DV2 K;  1JXE A;  1NLV A;  1Q8I A;  1NJW A;  2AA4 A;  3MCA B;  3ZT2 A;  4FZX C;  2OPP A;  3IG1 A;  2NNW A;  3QBW A;  2GUI A;  4FWS A;  3TTF A;  2GUP A;  2YX6 A;  3FGU A;  2JGU A;  3H6E A;  4EP4 A;  3AO2 A;  3DLH A;  4DTR A;  3ALY A;  4NB4 A;  1R59 O;  2P9L B;  4FPB A;  3SAG A;  4NCG A;  1W0H A;  4FLY A;  1GLD G;  1KLM A;  1LCU A;  1VQ8 N;  3ZT0 A;  2E5L K;  1X9S A;  1RT4 A;  1X1P A;  5BRE A;  2G8I A;  4H5R A;  1C0M A;  4B08 A;  5FRM A;  3K5L A;  4B1Y B;  4LC9 B;  1JLB A;  1VSK A;  4B9N A;  2A5X A;  4AIL C;  4PY5 A;  1QQC A;  1S6Q A;  2W6L A;  3F9K A;  4CJV A;  4OKE A;  4JI8 K;  3PO5 A;  4NLC A;  1MU2 A;  2B6A A;  3UKR B;  1IKY A;  1TKT A;  4H5T A;  1YXQ A;  3P31 A;  1X3N A;  3LWL A;  1ATR A;  3MX5 A;  3KK2 A;  3DWL A;  2I7N A;  3VOV A;  4HTU A;  3IKM A;  5CR4 A;  5M1F A;  4DSK A;  1IKV A;  5I9E B;  1K73 O;  3B6P A;  3VQD A;  2XHB A;  3CCQ N;  3SCX A;  4LFB K;  4RG8 A;  1ESV A;  4CFB A;  4BDY A;  3CCL N;  2GEM A;  1G15 A;  3HL8 A;  2OZM A;  3UKU B;  4DQS A;  5GAD P;  3ID8 A;  2UUC K;  1YIJ N;  4LFC K;  3RTV A;  3AA3 A;  4H0P A;  1UOC A;  5GAE P;  2F8T A;  2G8F A;  1JLF A;  1KVB A;  4BVO A;  3BP8 A;  4KPY A;  1EO1 A;  3CCE N;  2VCP A;  2WON A;  1ZYQ A;  1SKS A;  4B3T K;  1WB9 A;  4B1X B;  1VAZ A;  4E0D A;  4EP5 A;  4DTU A;  1NK5 A;  2O8B A;  1FKO A;  4DR1 K;  1D9F A;  1KD1 O;  2NRH A;  3AVM A;  5GIN A;  1NOZ A;  4WE1 A;  4F3T A;  4GV6 A;  4CZG A;  4DFP A;  4DLE A;  1KSP A;  4W5O A;  1WSJ A;  1SUQ A;  3CCJ N;  1ASU A;  4Y1C A;  4MO5 A;  4CJW A;  3D2E B;  4WCE L;  1Q86 O;  4M3R A;  3KLF A;  2E2Q A;  1TKX A;  2W42 A;  4B3M K;  1VQ5 N;  2VGN A;  1C1B A;  3O80 A;  4CCH A;  2A41 A;  4WQ4 C;  1HJR A;  3BY5 A;  4X62 K;  3KK3 A;  1XWL A;  3SI6 A;  3OJS A;  4A5A A;  1GLA G;  5AQJ A;  4G9Z A;  1GOA A;  4CJK A;  3DRP A;  1S6P A;  2GBZ A;  2E6M A;  3L3V A;  2A40 A;  3FFK B;  4KHY A;  2P9U B;  3EE9 A;  4A61 A;  3A2F A;  3ZYY X;  3VTH A;  3RSE A;  3QFU A;  4BRF A;  5GAG P;  1C0G A;  3C94 A;  4KH4 A;  3U6F A;  3FE1 A;  4CJP A;  3DLL L;  1BIU A;  1RTJ A;  2FXU A;  2HNZ A;  3QEW A;  1IBM K;  4B8C A;  1BIZ A;  1BIS A;  3TTC A;  1Q18 A;  2HNY A;  2OPS A;  2ZGY A;  3M8S A;  4NXN K;  4PUO A;  3H1Q A;  3J7A P;  1X9W A;  3EZW A;  2YJE A;  4CK2 A;  4YY3 K;  3CMA N;  4RW8 A;  4ILJ A;  1Q9Y A;  4DTO A;  3ZSQ A;  3L2V A;  4BG8 A;  1VQL N;  4Z4F A;  4FWN A;  3NHG A;  3LDQ A;  4R5P A;  1BOT O;  5AQP A;  3U9Z A;  4CFC A;  4JRQ A;  4HVJ A;  2DFH A;  3IS9 A;  5T7B A;  1SAZ A;  2HBM A;  2HF3 A;  3O4W A;  4BRL A;  3AA5 X;  3SV3 A;  1NGF A;  2YCH A;  2Q0R A;  2DTU A;  5BN8 A;  4BRN A;  3O3H A;  2O8C B;  1IG8 A;  4EIA A;  3PSI A;  3ULE A;  2ZE2 A;  1VQ7 N;  4M42 A;  3VQB A;  3DLK A;  4DKW A;  2O8E A;  1KAY A;  2IVO A;  1J9A A;  1E4G T;  1WSF A;  5FRN A;  4YHH K;  4B9U A;  4JI4 K;  1EP4 A;  2E2N A;  5J1E A;  1JXB A;  1RBV A;  3HRG A;  4DR2 K;  3MN5 A;  4DV5 K;  1NK0 A;  1VHX A;  2E20 A;  3CC2 N;  1KVC A;  1ZXO A;  2HOE A;  5HLF A;  1WBD A;  2RE2 A;  4KRE A;  2UXC K;  3LP2 A;  3LP1 A;  4Z4E A;  1O13 A;  1Y64 A;  2P9P B;  3G6E N;  4DQQ A;  5AZI B;  4OPK A;  1NM1 A;  4DFK A;  3CCM N;  4FJL A;  3BUZ B;  1TYQ B;  4L3Q A;  1ASV A;  5LMU K;  4M7X A;  4FWL A;  1BHL A;  5HP1 A;  4XH1 A;  3HM9 A;  2QWP A;  1HYV A;  4CEF A;  3HI0 A;  1QQO A;  4JKD A;  2YI1 A;  3H45 C;  1D9D A;  4E7K A;  3AVL A;  3VMF B;  3UIQ A;  3PSF A;  2OTJ N;  4CER A;  1GLL O;  3CFP A;  1TYQ A;  4CIF A;  2ITM A;  3NGZ A;  3O5B A;  4KTZ A;  3PLA A;  2VG6 A;  2J4R A;  5EOY A;  1EXQ A;  4BWJ A;  3P38 A;  1E3M A;  1Q7Y O;  4CZE A;  4CF1 A;  4QS8 A;  4FK0 A;  1S9G A;  2WTU A;  4DHY A;  4XIU A;  4BR9 A;  3KK1 A;  2A42 A;  2PY5 A;  3C7N A;  3H3O B;  3MXJ A;  2W6K A;  2VWJ A;  3GBT A;  3LDP A;  4KKO A;  4ELT A;  3HPH A;  1YIT N;  2GWJ A;  3K9K A;  3KK7 A;  1C6V A;  2NLX A;  1YAG A;  4H8K A;  4CHY A;  1L3S A;  4MDA A;  4N5S A;  3U3G A;  2HBL A;  5E84 A;  3VF6 A;  2Y1I A;  2GTD A;  5C25 A;  3V9U A;  1NMD A;  3G10 A;  1HUX A;  2VQF K;  4ID5 A;  5AFU H;  1YJN N;  4BC4 A;  3AVJ A;  3FR0 A;  1H1V A;  3VQ8 A;  4AHV A;  3HOS A;  3MXI A;  1G99 A;  4FYD A;  1GLC G;  3AVN A;  5JS1 A;  3DLG A;  3CCU N;  1ZBL A;  3TAE A;  1ASW A;  5GIO A;  4IO9 L;  1SL2 A;  2UXB K;  3K59 A;  4CJ3 A;  4W5R A;  2HMI A;  3LAN A;  1HMV A;  4BG9 A;  1L3T A;  1LV5 A;  4FJ7 A;  2P9S B;  1BA1 A;  2UU9 K;  3GG4 A;  2YKM A;  3L2U A;  2VQE K;  4B9T A;  2YJF A;  3VQQ A;  2ASO A;  4BE1 A;  3HP9 A;  2GEL A;  3QES A;  1NMN A;  1U2V B;  1YT3 A;  3IUC A;  5F1X A;  2F8S A;  3K9J A;  4CJ7 A;  5BN9 A;  3LDS A;  2LSN A;  1DT9 A;  4YOY A;  2EHG A;  2Q1N A;  4FM2 A;  3KD5 E;  2YHB A;  3LP0 A;  2E4L A;  4B1U B;  3EKS A;  3OYE A;  3V9X A;  3ZSY A;  4FLX A;  3DLR A;  2D0A A;  3RSE B;  4FW1 A;  5KPT A;  3PX4 A;  2R7Y A;  4RTF D;  3AVI A;  4FJ8 A;  4A62 A;  3P83 D;  4M41 A;  2A1S A;  1ZBU A;  3N4Q A;  4HCB A;  1RBR A;  4CEQ A;  4IWV A;  1DEJ A;  3D2F A;  4ZHR A;  4A59 A;  3QFP A;  1RT6 A;  1YJ9 N;  1N32 K;  2HBK A;  4KRF A;  3DRS A;  3QO9 A;  1RGI A;  3KIO A;  2RHK A;  3ZT4 A;  3BZK A;  4M3Z A;  3DM2 A;  3IFR A;  4MLE A;  1D4X A;  1HRH A;  3AO1 A;  4RW7 A;  3QNN A;  1FW6 A;  2QKB A;  1VSM A;  2E2P A;  1BQN A;  4WF9 L;  4JS5 A;  2O8F A;  4LY7 A;  3DLE A;  1RDC A;  3V1O A;  1RDA A;  5C2F A;  5EXW A;  4H4O A;  3V1Q A;  3SUO A;  1IO2 A;  3D2E A;  1IBL K;  3ATV A;  3AVC A;  2NRR A;  3VEX A;  1RNH A;  3QML A;  3V6D A;  3NE6 A;  1NKB A;  3ZEU B;  3C6T A;  1MDU B;  4B9Q A;  3HVT A;  2EWS A;  3UKU A;  4KI6 A;  3I8B A;  4GV9 A;  3RWU A;  1FJG K;  4IOA L;  2QWM A;  5FRO A;  2P9U A;  1B9D A;  3MEC A;  4PQU A;  1TKZ A;  3U9D A;  3THX B;  4BRA A;  1SQK A;  2IAJ A;  5LJV A;  2GX9 A;  4BRH A;  1HYS A;  4CF0 A;  3VQP A;  4DTM A;  1NGA A;  4Z4G A;  4DTN A;  5AR0 A;  2HHQ A;  2OA8 A;  1T44 A;  4PWD A;  1WN7 A;  3CHW A;  2DY4 A;  2GV9 A;  3L2W A;  3E9P A;  4CD3 A;  4A2B A;  2O8D B;  5AZI A;  3DAW A;  1JLQ A;  3SPZ A;  1CZB A;  3T3F A;  4J2A A;  3S3N A;  4WFB L;  4DQ8 A;  1UA1 A;  2D5R A;  2QI2 A;  2Q2R A;  3A5L C;  3CJA A;  4A2A A;  3L4Q A;  3V81 A;  1QSL A;  4FJX A;  3VA0 A;  4YDU A;  4PL7 A;  2VYP A;  5KRS A;  3OYD A;  1V4T A;  1D5A A;  4FW2 A;  1LW0 A;  3HT3 A;  3TSQ A;  4H0V B;  3VEZ A;  2A6A A;  1NBW A;  4KHP K;  3T1H K;  4FVU A;  4FLV A;  1A5X A;  4IKF A;  1VQM N;  5AQN A;  1KFD A;  3PV8 A;  3PY8 A;  4E7I A;  3O1B A;  4E3S A;  1Z05 A;  3JAM O;  3I55 N;  3ZSO A;  3FZH A;  1CZA N;  3T1Y K;  2KZM A;  3AO4 A;  4DSJ A;  4DV3 K;  2FF6 A;  4CJR A;  5KGW A;  4B1W B;  3OS2 A;  4CF2 A;  2QTD A;  3WXL A;  4O8K A;  4CZJ A;  1TK0 A;  4ELU A;  3PUF A;  1L5U A;  3LAL A;  3QLH A;  5FDL A;  4F4K A;  1RFQ A;  2ZJR L;  3G4S N;  1B92 A;  1NWK A;  4BR4 A;  5FPN A;  1RT5 A;  4CBX A;  3TTD A;  4F2S A;  4FJH A;  1RDD A;  3LPU A;  4CEE A;  4N47 A;  3CC4 N;  4DV6 K;  4MLH A;  3DLB A;  2O8E B;  1EWR A;  4AHC A;  4K8X A;  3L3U A;  3MMV A;  5BPM A;  3HPG A;  4CE9 A;  4CEC A;  3QEV A;  3QEX A;  2F7T A;  4PKH A;  4JI1 K;  3HYF A;  4DCH A;  4DTJ A;  1OKJ A;  3VEV A;  4CVN E;  1IJJ A;  3H1V X;  3K5O A;  4H5N A;  3CXC M;  2KW4 A;  1W7A A;  4CZM A;  1EWQ A;  4JNE A;  2HHH K;  3VQE A;  1NG9 A;  1QVF M;  3QDK A;  4LF8 K;  3KWI A;  1CXQ A;  3NH1 A;  4B1V A;  4LF4 K;  5E26 A;  3D45 A;  1VSJ A;  3F9M A;  3P4I A;  5AZJ A;  3A5O C;  4TSX A;  3VTI A;  3OYC A;  3QEP A;  1JLA A;  3ASM A;  1XMO K;  1WLJ A;  2UUB K;  4OKJ A;  4FJG A;  4ZTF A;  1SS6 A;  2IC3 A;  4HCC A;  3M1F A;  3MXM A;  5HRS A;  1N6Q A;  1NGH A;  2P9L A;  4Z0U A;  3CG7 A;  4CD1 A;  5KRT A;  4BRM A;  4FWO A;  4JV5 K;  5JLH A;  1F21 A;  4KFB A;  4BE0 A;  4C8L A;  3RMD A;  3BZC A;  1ZBI A;  3CQX A;  4JI2 K;  1RBU A;  5EY4 A;  2P9P A;  4KHU A;  4MFB A;  4ILH A;  1O1W A;  3PX0 A;  3NH0 A;  3THY A;  2X6N A;  4OPA A;  1TUU A;  1WSH A;  1TUY A;  4I2Q A;  1IBK K;  3HPO A;  4IO8 A;  4AHR A;  4IFY A;  1REV A;  1ILY A;  2ZJP L;  3R9P A;  4PKG A;  3C65 A;  1WAJ A;  4DWI A;  3S9H A;  1LAW A;  3DXK B;  3SK3 A;  2FSJ A;  4KV8 A;  4DSL A;  4KTW A;  3VQ9 A;  1C0F A;  3VEN A;  4RW9 A;  3A0I X;  5LL6 Z;  2AP1 A;  1KLN A;  3THW B;  1HQE A;  3H46 O;  1HX1 A;  4IZ9 A;  1BO5 O;  2HST A;  3MDQ A;  3VEO A;  1NOY A;  1XC9 A;  4JEP A;  3W0L A;  3OY9 A;  5AQY A;  5E41 A;  4LSL A;  1VRT A;  1VQO N;  5AQO A;  1QSS A;  3IAY A;  3SJH A;  1NGD A;  5AQU A;  4OO1 J;  4N41 A;  5CHI A;  2P9S A;  4F8R A;  4F9O A;  3D2F B;  4JKA A;  4BRK A;  3OYN A;  3OYH A;  1BL3 A;  1S1X A;  3PIO L;  4JKH A;  2PYL A;  4UQG A;  1NK4 A;  3VPZ A;  1KXP A;  4A5B A;  3GL1 A;  2KKZ A;  4CEB A;  3F5T A;  3OYK A;  2RN2 A;  4DS4 A;  4O55 A;  4KI4 A;  1KAZ A;  3V4I A;  3AO5 A;  5DM7 L;  4NCA A;  4HHT A;  3IRX A;  4JKB A;  1A5V A;  4FWQ A;  3RRH A;  2G8H A;  3SJJ A;  2FSN A;  3O1W A;  4BC3 A;  1NK6 A;  4DU1 A;  4FJK A;  3QNO A;  2QXL A;  3VEY A;  1BI4 A;  3AY9 A;  1K9M O;  2HHV A;  3LDN A;  3E9O A;  4NLB A;  4K25 A;  3O9U A;  1SL0 A;  4CGG A;  1WSE A;  4MO4 A;  3WQU A;  4JS4 A;  5LY3 A;  1HKB A;  4O8U A;  1SV5 A;  2FC0 A;  2IGI A;  4RW4 A;  3AAQ A;  4E1M A;  1NK8 A;  1EKE A;  3R8E A;  1BI4 B;  4F3O A;  2IOC A;  3CER A;  1KFS A;  4FZY A;  5A2Q O;  2V51 B;  5BRD A;  4CJF A;  4CJQ A;  2E88 A;  4QS7 A;  1LAV A;  5JS2 A;  2KFZ A;  3ZLJ A;  3L0Q A;  2G8V A;  2D0C A;  3SQ2 A;  4IFE A;  3CQ8 A;  4LSN A;  1NJI O;  4A57 A;  1MWM A;  4AHU A;  4PA1 A;  3LM2 A;  1W97 L;  4B3O A;  4H0T B;  2Y1J A;  3PO4 A;  2OPQ A;  2O8F B;  2HF4 A;  1RCH A;  5AQX A;  1NGJ A;  2B4J A;  3NMU A;  3RMA A;  1YJW N;  3VF4 A;  1JKH A;  3ATU A;  3BF1 A;  3TAR A;  5AQF A;  2Q97 A;  1YI2 N;  1K8A O;  2YHA A;  2KQ2 A;  3J81 O;  4BR0 A;  3ZEU A;  3AVA A;  1U47 A;  3AVF A;  4CGI A;  3QBX A;  4YNQ A;  1GLF O;  2HVI A;  3CJC A;  5D3G A;  1JL2 A;  4M3W A;  2Z1I A;  1XUP O;  4JKF A;  2WC9 A;  5FPD A;  3VEW A;  4IG3 A;  3M6G A;  1BU6 O;  3O9R A;  1TK8 A;  1HPZ A;  2NRW A;  2PFU A;  5HRN A;  1NK9 A;  4CBU A;  4X66 K;  4OVL A;  3ZSW A;  4Z4H A;  4C1N I;  5I42 A;  1BWF O;  1I39 A;  2BAN A;  4MDB A;  1RDB A;  2QWQ A;  1IG9 A;  4BRD A;  3DOK A;  3NF9 A;  5DM6 L;  1B9F A;  3VER A;  4CZF A;  1RDU A;  3JSM A;  4L8R B;  4CI6 A;  3MN7 A;  1JLC A;  4K0K K;  1TAU A;  3OYA A;  1HQU A;  1N33 K;  1OVY A; 
#chains in the Genus database with same CATH homology
 5C10 A;  3QBW A;  1K8K B;  2YHX A;  2YHW A;  2PBD A;  4FWS A;  4BRE A;  5C2F A;  5EXW A;  3TTF A;  3DJC A;  3EE8 A;  3VGM A;  2GUP A;  2YX6 A;  5AQW A;  1YUW A;  3D2E A;  3FGU A;  2V52 B;  3ATV A;  3H6E A;  3S41 A;  2NRR A;  3MK6 A;  4PKI A;  3VEX A;  5AQR A;  3CPE A;  1MA9 B;  2HMP A;  3QML A;  3WQT A;  3ZEU B;  4EAH D;  3D6R A;  2IVN A;  4BQL A;  3B8A X;  4BQZ A;  3HBT A;  1MDU B;  4EHU A;  4B9Q A;  1NGC A;  2D1K A;  3LDO A;  4NB4 A;  1R59 O;  2EWS A;  4CZL A;  2P9L B;  5HOO A;  3UKU A;  3VGL A;  3I8B A;  4YOU A;  4FPB A;  3WXM B;  3SAG A;  4GV9 A;  3P39 A;  5JMV A;  4H0Y B;  4I6M B;  1GLD G;  1S22 A;  5HL7 L;  1LCU A;  4IOA L;  2QWM A;  5KPZ A;  1VQ8 N;  2P9U A;  3L6Q A;  3U9D A;  3CIP A;  1NGB A;  4BRA A;  4BVP A;  1SQK A;  5LJV A;  2D4W A;  2GX9 A;  3C6H A;  3U4L A;  2QEX N;  4BRH A;  5BRE A;  4WQ5 A;  4H5R A;  2D0O A;  1P8Z A;  4E1J A;  1NGA A;  5AR0 A;  2BH1 A;  3VET A;  4H0O A;  1T44 A;  2V7Y A;  4LC9 B;  4ISF A;  4B1Y B;  1VQP N;  3CHW A;  4HWI A;  1WUA A;  4JHD B;  3CCV N;  2A5X A;  1Z6R A;  3C0B A;  3A8Y A;  3E9P A;  4JKE A;  4NLC A;  4A2B A;  3UKR B;  4CD3 A;  4H5T A;  3MX2 A;  5AZI A;  1YXQ A;  3J8A A;  3P31 A;  3DAW A;  4EHT A;  1X3N A;  1HLU A;  1ATR A;  3MX5 A;  3D7E O;  5KPR A;  5M1K A;  3ULE B;  4KH5 A;  5F0X A;  3DWL A;  3EO3 A;  4BRP A;  2I7N A;  3VOV A;  3IKM A;  4GY2 B;  3WUH A;  2VWB A;  5CR4 A;  5M1F A;  5C12 A;  5I9E B;  3ID6 A;  4BRQ A;  4WFB L;  4HTL A;  4DQ8 A;  2QI2 A;  4XH5 A;  1K73 O;  2Q2R A;  3A5L C;  3CJA A;  3FLC O;  3L4Q A;  5AQH A;  4A2A A;  3G71 N;  4AM7 A;  3CCQ N;  3LM9 A;  4EFH A;  3R3L A;  5AQI A;  3HTV A;  4YOR A;  4KBO A;  1ESV A;  2NRX A;  4YDU A;  5AZJ B;  3WT0 A;  2VYP A;  4PL7 A;  3CCL N;  4FWK A;  1V4T A;  2GEM A;  3ENH A;  3UKU B;  5GAD P;  5CE3 A;  2E1Y A;  2F9T A;  2W40 A;  3ID8 A;  2NRT A;  3TSQ A;  4H0V B;  1YIJ N;  2QM1 A;  3HZ6 A;  3VEZ A;  4C23 A;  2NRV A;  4H0P A;  1M1K O;  3GDQ A;  2A6A A;  1NBW A;  3UB5 A;  5GAE P;  3DXM A;  1NGE A;  1T3V A;  4UY8 O;  4FVU A;  4BVO A;  3BP8 A;  1EO1 A;  3CCE N;  3WEE A;  2VCP A;  3ZX2 A;  3OBW A;  1QZ5 A;  1VQM N;  3EL2 A;  4B1X B;  1VAZ A;  5AQN A;  3CD6 N;  3RVC A;  2QWN A;  3O1B A;  2NRH A;  2P9N A;  5GIN A;  1KD1 O;  5M1P A;  1GLB G;  1Z05 A;  3T69 A;  4GV6 A;  1SZ2 A;  4CZG A;  3I55 N;  4FPA A;  2UYT A;  1YHQ N;  3ENB A;  3CME N;  3FZH A;  1CZA N;  1YF5 L;  3CCJ N;  4BC5 A;  3E66 A;  3UKR A;  2Q0U A;  5KQ8 A;  4MO5 A;  5FPM A;  5GIP A;  3D2E B;  4WCE L;  2KHO A;  2FF6 A;  3VF2 A;  1Q86 O;  4B1W B;  4BR5 A;  2E2Q A;  1GLE G;  2QTD A;  3WXL A;  2ASP A;  2QW9 A;  4O8K A;  1VQ5 N;  2VGN A;  3O80 A;  3CJ1 A;  3ZX0 A;  4CZJ A;  2Q31 A;  2A41 A;  4WQ4 C;  1S72 N;  4J8F A;  2W41 A;  3Q7B A;  1XQS C;  2ZGZ A;  4JK8 A;  4A5A A;  2E1Z A;  1GLA G;  5BRH A;  1BDG A;  3R6M A;  5AQJ A;  4WQ5 C;  5AQZ A;  5B8H A;  1RFQ A;  2ZJR L;  4U7B A;  3O9Q A;  3G4S N;  4G9Z A;  2P9K B;  1NWK A;  3F2K A;  4BR4 A;  2A40 A;  3FFK B;  5FPN A;  3ZX3 A;  2P9U B;  4CBX A;  1Q81 O;  3TTD A;  3EE9 A;  3C7N B;  1E4F T;  1QVG M;  4A61 A;  4H5V A;  4O5F A;  3EKU A;  3ZYY X;  3SBT A;  1JCE A;  2ZF5 O;  5JIC A;  2JWK A;  5AQS A;  3AAP A;  3VTH A;  3CC4 N;  1QQN A;  3RSE A;  3QFU A;  4MLH A;  4BRF A;  5GAG P;  1BUP A;  1C0G A;  1YVN A;  1ZBS A;  2KLA A;  3ZET B;  3MMV A;  4KH4 A;  3FZL A;  5BPM A;  3FE1 A;  4K42 A;  3DLL L;  2FXU A;  2F7T A;  3MN6 A;  4PKH A;  4DCH A;  1W2B M;  3IDH A;  1OKJ A;  4XH4 A;  3VEV A;  4JKC A;  5M1Q A;  3TTC A;  1IJJ A;  1Q18 A;  1HKG A;  2P9I A;  3H1V X;  1VQN N;  2ZGY A;  3JXU A;  2IVP A;  3NVM A;  4H5N A;  4BGB A;  3H1Q A;  2V7Z A;  3VGK A;  3EZW A;  1LOT B;  2OAN A;  3CXC M;  1QZ6 A;  2BUP A;  2YJE A;  3WXJ A;  4CZM A;  4IXC A;  3CMA N;  4ILJ A;  4JNE A;  4BG8 A;  1QVF M;  1GLJ O;  3QDK A;  1VQL N;  5AQT A;  3KWI A;  1VQ6 N;  4FWN A;  5C2D A;  3LDQ A;  2Q36 A;  3CQY A;  3M5R A;  4OPH A;  4B1V A;  2FLO A;  3O8M A;  5E26 A;  4ILG B;  4JD2 A;  3FZK A;  3O9S A;  3R1X A;  1BOT O;  5AQP A;  3F9M A;  1M90 O;  4FO0 A;  3P4I A;  5AZJ A;  3U9Z A;  1K8K A;  1XC3 A;  3A5O C;  5MLC Q;  3VTI A;  2ZJQ L;  5H1S Q;  4U67 L;  2FF3 B;  3OBY A;  5C0Y A;  1SAZ A;  4XEI A;  5TKY A;  4QS9 A;  2HBM A;  1BG3 A;  4FWR A;  2HF3 A;  3O4W A;  4JK7 A;  4BRO A;  3TU5 A;  4BRL A;  1Q82 O;  1NGF A;  1U2V A;  2Q0R A;  2YCH A;  3WEE B;  1BA0 A;  3CJ9 A;  5JVG L;  5BN8 A;  1SS6 A;  4NO7 A;  3M1F A;  4BRN A;  1QHA A;  1IG8 A;  4EIA A;  3UE5 A;  4JKG A;  3ULE A;  5AFU A;  4H03 B;  1VQ7 N;  1NGH A;  2P9L A;  3AGR A;  4DKW A;  1ATN A;  4GV3 A;  1KAY A;  2IVO A;  3ZET A;  4CD1 A;  1E4G T;  4H5W A;  5GAH P;  4BRM A;  4FWO A;  3NVK A;  5AQM A;  4B1Z A;  5JLH A;  2E2N A;  3HRG A;  3CQX A;  3CI5 A;  3MN5 A;  3DXK A;  4CZK A;  5EY4 A;  2P9P A;  1KQS M;  4ILH A;  4IEE A;  3M3Z A;  2E20 A;  3CC2 N;  2D0P A;  3WXK A;  1ZXO A;  2HOE A;  4FWP A;  4OPA A;  1ZC6 A;  3OA9 A;  1TUU A;  2RE2 A;  2F9W A;  1TUY A;  3I33 A;  4IO8 A;  4RWT A;  5FPE A;  4YOW A;  1ILY A;  3CET A;  3HOT A;  2WBN A;  2ZJP L;  3R9P A;  1VQ9 N;  4PKG A;  3TSP A;  3J7Z O;  3C65 A;  4BRG A;  3VES A;  1O13 A;  3DXK B;  1Y64 A;  2P9P B;  3A5N C;  3G6E N;  3GOI A;  4M7Y A;  3O08 A;  3JS6 A;  3SK3 A;  2FSJ A;  5AZI B;  1NM1 A;  2HBJ A;  3CCM N;  2CH6 A;  4GNI A;  1HJO A;  4IJN A;  5AQK A;  1C0F A;  3A5M C;  3VEN A;  3BUZ B;  1TYQ B;  4CZH A;  3A0I X;  4L3Q A;  2AP1 A;  3WXI A;  3SMS A;  4M7X A;  4FWL A;  4FOI A;  5BPN A;  3SBG A;  3OHR A;  4XH1 A;  2QWP A;  2WFB A;  5AQL A;  2DPN A;  3H46 O;  3CPW M;  3HI0 A;  3CF5 L;  4FOE A;  1QQO A;  4JKD A;  2YI1 A;  1HX1 A;  3H45 C;  4IZ9 A;  1BO5 O;  5BRF A;  1T6C A;  3TSU A;  2E8A A;  3VMF B;  2OTJ N;  2HST A;  2ASM A;  3MDQ A;  3VEO A;  2QA4 N;  4RCH A;  3IMX A;  4JK9 A;  4JEP A;  3H3N O;  3W0L A;  5AQY A;  5M1O A;  1GLL O;  5TKW A;  1TYQ A;  1VQO N;  4CZI A;  4KH6 A;  2ITM A;  2YHY A;  5AQO A;  1RDW X;  3O5B A;  4FL9 A;  3PLA A;  3SJH A;  1NGD A;  4JAX A;  1V4S A;  2J4R A;  5EOY A;  5AQU A;  4OO1 J;  4FSV A;  4IOX A;  3P38 A;  5CHI A;  5BR9 A;  2P9S A;  1Q7Y O;  4JN4 A;  5ADX H;  4CZE A;  4F9O A;  4QS8 A;  3KZB A;  3D2F B;  3O9T A;  4JKA A;  4BRK A;  4DHY A;  1QQM A;  4Z94 A;  4BR9 A;  4JKH A;  4Y0W A;  3PIO L;  2A42 A;  2P9N B;  4WYB A;  3C7N A;  3H3O B;  4YOX A;  1JCF A;  3VPZ A;  1N8R O;  2QWO A;  3GBT A;  3LDP A;  3MWT A;  3C6A A;  1KXP A;  4A5B A;  3GL1 A;  4WF9 L;  2KKZ A;  4PL8 A;  3F5T A;  1YIT N;  3E1Y A;  2GWJ A;  2OTL N;  3CJ7 A;  3K9K A;  3KK7 A;  1KAZ A;  2NLX A;  1YAG A;  4BR2 A;  2E2O A;  5DM7 L;  4JKB A;  4MDA A;  4FWQ A;  3AGK A;  2IIR A;  5ELZ A;  2FSN A;  4IOC L;  3O1W A;  1DGK N;  4BC3 A;  4WFN L;  3O6W A;  2HBL A;  5E84 A;  3VF6 A;  2GWK A;  3CCS N;  2QXL A;  3VEY A;  4YOV A;  2NZT A;  2GTD A;  1MWK A;  1NMD A;  3AY9 A;  3Q7C A;  4BR7 A;  1K9M O;  4JKG B;  3LDN A;  1HUX A;  1X3M A;  3MCP A;  3E9O A;  4NLB A;  4K25 A;  5AFU H;  3SLC A;  3O9U A;  1YJN N;  4FWM A;  2CGK A;  3GE1 A;  4BC4 A;  4MO4 A;  4PHT X;  3WQU A;  3FR0 A;  1H1V A;  1JCG A;  3HOS A;  5C15 A;  1WOQ A;  5AQV A;  5LY3 A;  2H3G X;  1G99 A;  1HKB A;  4O8U A;  5F2R A;  3CCR N;  1GLC G;  5JLF A;  3SAF A;  2CH5 A;  3CCU N;  3BEX A;  3AAQ A;  5GIO A;  5JVH L;  2BTF A;  4IO9 L;  4I6M A;  3PIP L;  4ISE A;  5EX5 A;  3R8E A;  4BG9 A;  2WUS A;  3CER A;  3QIC A;  1P90 A;  1J6Z A;  2P9S B;  1NGI A;  1BA1 A;  2V51 B;  5BRD A;  3GG4 A;  4YOT A;  3W3D A;  3I56 N;  2E88 A;  2YJF A;  3TPQ A;  4QS7 A;  2ASO A;  4C1N K;  4ISG A;  4YDU C;  1VQ4 N;  3L0Q A;  3BF3 A;  1EQY A;  1HKC A;  2GEL A;  4IFE A;  1DKG D;  1U2V B;  1NJI O;  3IUC A;  1MWM A;  4A57 A;  5F1X A;  3LM2 A;  1W97 L;  3K9J A;  2VGM A;  4CJ7 A;  4M63 C;  4H0T B;  4K43 A;  4BRI A;  2HF4 A;  5EVZ A;  5AQX A;  5BN9 A;  1NGJ A;  3DXM B;  2QWR A;  1DT9 A;  1T6D A;  3FZF A;  4YOY A;  3NMU A;  2Q1N A;  1YJW N;  3VF4 A;  4IJA A;  5LJW A;  3ATU A;  3KWG A;  4CBW A;  5KQD A;  3BF1 A;  4B1U B;  3EKS A;  4IDH A;  2Q97 A;  5AQF A;  1YI2 N;  3SAH A;  1K8A O;  4BR0 A;  3KHY A;  3T7Z A;  3ZEU A;  2QWL A;  1S3X A;  3HM8 A;  4JD2 B;  4BC2 A;  1VQK N;  1X9J A;  3RSE B;  3G25 A;  3MWP A;  5KPT A;  3QBX A;  1ATS A;  4RTF D;  1GLF O;  1KC8 O;  4A62 A;  3CJC A;  2A3Z A;  3N4P A;  3N4Q A;  1JJ2 M;  4R79 A;  4H0X B;  1XUP O;  1HPM A;  4JKF A;  3HSC A;  2CGL A;  3QB0 A;  3SMP A;  4BGA A;  3LL3 A;  4IWV A;  2WC9 A;  3CC7 N;  3EN9 A;  3VEW A;  3CJB A;  5FPD A;  2FSK A;  5AQG A;  4AM6 A;  3U8X A;  4DB3 A;  1DEJ A;  2I7P A;  3M6G A;  3LDL A;  3AAR A;  2P9I B;  1KAX A;  3E9L A;  5M1N A;  3D2F A;  1BU6 O;  3O9R A;  2NRW A;  3QFP A;  2PFU A;  4A59 A;  1YJ9 N;  4BRC A;  4K41 A;  2HBK A;  3ENO A;  3OW2 M;  1NGG A;  4IEI A;  4WFA L;  4CBU A;  2ZWH A;  4WQ4 A;  4AF1 A;  1RGI A;  2PAV A;  5AQQ A;  2RHK A;  1U6Z A;  4GVE A;  5ADX A;  3IFR A;  4JHD A;  4C1N I;  2P9K A;  3L4I A;  1BWF O;  3MN9 A;  4MLE A;  1D4X A;  4MDB A;  2NRZ A;  3KVG A;  2QWQ A;  4BRD A;  5DM6 L;  1NLV A;  3VER A;  4CZF A;  1RDU A;  3FZM A;  4CI6 A;  2AA4 A;  3MCA B;  3MN7 A;  4BY9 C;  2JWL A;  2E2P A;  5BPL A;  2CGJ A;  2NNW A;  1OVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...