2Z1JA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMKPKLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ribonuclease HI
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
total genus 48
structure length 151
sequence length 151
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1jA00
3G10A 3LANA 3RRHA 4Z0UA 3IG1A 3KKSA 4FLTA 5KI6A 3DLGA 4O55A 4Z4EA 3P1GA 4OLAA 3CYMA 1Y97A 3U3YA 2O4IA 4CHQA 4FJ8A 2HHQA 4K8XA 3NBPA 1TL1A 1HYZA 3VQ8A 3NH1A 4CF0A 3V9SA 1R0AA 2B6AA 3V1OA 4PQUA 5FROA 1BI4B 1S1VA 3LWLA 3OYAA 5CZ2A 1RT5A 4NYNA 1CZBA 4EP4A 3BGRA 3PUFA 2ITGA 4FLZA 1BGXT 2YHBA 1Z25A 4FCYA 4E7KA 5CZ1A 1S9EA 2YNHA 3K5MA 2DFFA 1JLGA 4DMNA 2Z1JA 4AHCA 4KHNA 4M3ZA 1RDAA 5EU7A 1RT7A 1KRPA 3LWMA 1W0HA 3VA3A 1U04A 3DLKA 3SZ2A 4IFYA 1EETA 2D5RA 3L2VA 3RMCA 2QK9A 4CERA 1UA0A 4Q5VA 4F3OA 4W5NA 4J2DA 3VQBA 3VQPA 3ZT1A 5J2PA 4EP5A 1ITGA 3HPGA 2O4GA 1KFSA 1RDBA 4DTMA 4KI4A 3MECA 3ZCMA 2HHUA 4CEFA 4CFBA 3M8RA 3MAQA 3DRRA 1LV5A 3L3VA 4FM2A 5FRMA 2F8TA 4FLWA 2KFNA 1LW2A 3SQ0A 5C25A 3PV8A 3NCIA 3DRPA 1L3UA 1JL2A 3EYZA 4RW8A 1JLFA 1WSHA 3SQ2A 4ZTJA 3LP1A 3QEIA 4F8RA 4K8ZA 3B6PA 4BDYA 4J2AA 4RW6A 4B9NA 3B6OA 1VSHA 3OYHA 3PO5A 3RWUA 4E19A 4WE1A 4F4KA 4CGGA 1XWLA 4DQIA 4H4OA 4KAZA 2HHXA 1Q9XA 3LPUA 2G8VA 1EXQA 4I9QA 3FFIA 1C6VA 2HB5A 3OYKA 4B08A 3NE6A 2HHSA 2VG6A 1D9DA 4KPYA 1T03A 4CK2A 4C8LA 4KB0A 4E3SA 3RMAA 4M3TA 4DG1A 3VQDA 3C94A 1DLOA 4CJPA 4AILC 4HCBA 4FK0A 1RT2A 3AA4A 4KKOA 1O1WA 1BQMA 4CJ3A 4CFAA 5HRPA 4DF4A 4PUOA 3NGIA 4CK3A 2XY8A 3PX0A 3OYBA 3OYFA 4DQQA 1NOZA 3KTQA 3DYAA 3HJFA 2IS3A 1IKWA 1ASWA 1KVBA 3QERA 5C24A 2ZD1A 3NGYA 1WAFA 1ZBIA 3VN5A 2DTUA 2Z1GA 2YV0X 5K14A 2VG7A 3NF9A 4N5SA 3QLHA 2XY7A 3KLHA 4B9MA 4FJMA 2Z1IA 3HM9A 1VSFA 4FJKA 3NAEA 3S3OA 1UOCA 1JLAA 1VSLA 1TVRA 3LZJA 4FJLA 4FXDA 4IKFA 3NF7A 2EHGA 3HP6A 5JS1A 3QIPA 3MEGA 3HXMA 3ZSXA 2DFEA 1KLMA 2X74A 3THVA 3WNHA 3IS9A 3SCXA 3HP9A 4KRFA 4LD0A 5HP1A 3TARA 1JXBA 4KFBA 1QTMA 5KGXA 4DTPA 3KJVA 3KD1E 1SL0A 1ZBLA 4CEAA 1XHXA 2XHBA 1JLBA 1NJXA 3AVAA 1LAVA 2IOCA 4PWDA 3UIQA 1SKSA 2DFHA 2IGIA 3OYIA 1YT3A 3OJUA 3SPYA 4FJ7A 4CGDA 4LY7A 3ZSVA 4FJXA 3F9KA 3AVHA 3TAQA 2G8WA 5FRNA 3O4QA 3SUPA 1C0TA 2P1JA 3VQCA 3HO1A 3VQ6A 5J2QA 4O44A 4FM0A 3C95A 3V81A 3LZIA 1U48A 3AVCA 3KLEA 4M41A 2WOMA 5C42A 1EP4A 3AVJA 4OKKA 4M3RA 1BL3A 3QESA 2ZE2A 3SQ1A 1X1PA 1QHTA 3DRSA 1C0UA 3V9WA 5I42A 2P5OA 4F2RA 4KI6A 4CEBA 1JLCA 2A1SA 4HVJA 1RTDA 3F73A 4DSKA 2FC0A 3M8PA 1TKXA 3CQ8A 1LW0A 1RDCA 1RTJA 4JRQA 2OYQA 5DK5A 2GV9A 2BGGA 3MXJA 2D0CA 2HHVA 4CIFA 1FXXA 4IFVA 2WONA 4Z4GA 3V9XA 5KGWA 3NF8A 4OGCA 3T3FA 1EKEA 1U45A 4BDPA 4FJIA 3L8BA 1I3AA 2GBZA 4FZXC 4CJ4A 3ZT3A 4DFJA 2A1RA 1RT4A 3OYDA 1NJWA 1NK9A 3RTVA 1TAUA 3OYJA 4FW2A 4FJGA 1HNIA 4M45A 3I0SA 3QO9A 1ZBUA 1F21A 5J2NA 3MXMA 4FZYA 2QKBA 5CYQA 1GOBA 3DM2A 3NFAA 3WNFA 4J2BA 4FK2A 3AO3A 2ZQBA 3MXIA 1J54A 3T1AA 1KLNA 4I2PA 4CJWA 4FJNA 1VK0A 2P51A 3VQQA 3OYNA 3TI0A 2OZSA 1HRHA 3AVIA 4OKJA 4FJ5A 1W9HA 4FJHA 4FLYA 4DTUA 2Y1JA 4CEQA 4FLUA 4E1NA 3OYGA 3TANA 5I3UA 4CF8A 2KTQA 4YNQA 1QE1A 4BE2A 4DTJA 3ZT4A 4E1MA 3V1QA 4BACA 1NK0A 3OY9A 3CFRA 2IAJA 4CEZA 1VRUA 3ZSOA 5HRNA 1XC9A 1TKDA 3DLRA 4M3YA 3HVRA 1T7PA 5D3GA 3H08A 4CGFA 1X9SA 4Q0BA 3LP3A 4CGIA 1U4BA 1T05A 2XRIA 1L3VA 1S1WA 3DMJA 4CJUA 4CK1A 4E7JA 3VQ4A 1HYVA 3LDSA 4DSJA 4DSIA 1SUQA 5HRSA 1U47A 3QEWA 2GUIA 2NUBA 2BDPA 1YVUA 3K2PA 1NOYA 2E4LA 2EX3A 1IKYA 3AO2A 4DSFA 2OA8A 2IC3A 2HW3A 1BCMA 3I0RA 1HMVA 5FDLA 4CF2A 1RTHA 3KD5E 3IRXA 1X9WA 4UQGA 1KTQA 3HVTA 1Q9YA 1RT1A 2D0BA 1L3TA 3QINA 4DLGA 2HVHA 2PY5A 1WSEA 4DSEA 2HMIA 4CHOA 1HQEA 2BE2A 1D9FA 1SL1A 1TK5A 1JXEA 3A2FA 2P5GA 1IO2A 2FBTA 3VQEA 1XI1A 1WSJA 4KV8A 3HPOA 2Y1IA 1XHZA 1NK6A 2HHTA 3AVBA 4ICLA 3K58A 1QSSA 4DTRA 1TK0A 1G15A 3JYTA 4N41A 2HNDA 1BQNA 3LP2A 4CF9A 3OS2A 3CG7A 4CJ5A 4OPKA 2VWJA 3V9ZA 1RBRA 4E7IA 1NK5A 3PY8A 1C1BA 3VA0A 1CZ9A 4OJRA 1YTUA 1YTAA 2YNIA 4ZHRA 3OVNA 4O4GA 3I8DA 4JS4A 4DWIA 4CIGA 2D0AA 3DLHA 1BHLA 1HPZA 4EZ6A 3QETA 1NKBA 3CM5A 2PYLA 3SYZA 1MU2A 2RN2A 3O3HA 2R7YA 4N47A 4N76A 4FLXA 4I7FA 3V6DA 1S5JA 3L3UA 4B9VA 1VSEA 3CFOA 3OS0A 4KHYA 4CGJA 1NK7A 1VSKA 4LSNA 4DFPA 4BE0A 4HUFA 4O5BA 3P5JA 3WNGA 1TL3A 3SNNA 4DSLA 1D8YA 3AA2A 1KVCA 3AO1A 4DU4A 3S3MA 1TKTA 4CEOA 2OPQA 1BI4A 2E6MA 3SI6A 4PA1A 4CHNA 2XO7A 2B5JA 1HNVA 3ULDA 1CXUA 1NK8A 2RF2A 1J5OA 1JL1A 3HYFA 4B8CA 2FBXA 4ELUA 3CM6A 3RMDA 4GVMA 4DU3A 4CJKA 3SV4A 3O3GA 5HROA 3KKRA 5T7BA 1S1UA 3AVNA 4ELTA 4AHSA 4E89A 3RR8A 3KK1A 5E41A 1FKOA 3HSTB 1REVA 4IBNA 3NGZA 1HQUA 4CJRA 4CJFA 4JRPA 3S3NA 1GOCA 2BANA 4O0JA 1TK8A 4EZ9A 4CFDA 3VQ5A 1C1CA 4DQRA 1JLQA 2KZMA 1A5VA 4DU1A 2F8SA 2B4JA 4B9TA 1HJRA 1B9FA 2XY6A 4AH9A 3DI6A 4M3UA 2VWKA 3V4IA 4TSXA 4B9SA 4E0DA 2G8HA 1CXQA 1RDDA 4DF8A 1LWFA 3P83D 3ZSQA 3S9HA 3BDPA 5SZTA 4CJEA 5HLFA 4F2SA 3L2QA 1SKWA 2VG5A 2JLEA 3KLFA 3SQ4A 1NKEA 4CF1A 4OKEA 3K5LA 2QKKA 1TGOA 1RBSA 4MQ3A 1UAXA 3DLBA 2F96A 3KK3A 1T8EA 3VQ9A 2FBYA 4HUEA 1BISA 4N56A 3LPTA 4KO0A 4Z4CA 3TAFA 3LALA 4G1QA 4AHTA 4DQSA 5J2MA 3HK2A 1ZBHA 1WNSA 3RRGA 3RMBA 3LAMA 4B9LA 3MEEA 1VSJA 3LAKA 4FZZA 3OS1A 1TV6A 5CY4A 3AV9A 4ZTFA 3OYMA 2KQ2A 3KK2A 1TAQA 1RT3A 1LWCA 4Y1DA 4R5PA 3OJSA 4KHUA 4CESA 3U6FA 3AVMA 3SV3A 4CCHA 4CEEA 4DTNA 4OLBA 3HL8A 1L3SA 1S1XA 3K5NA 4DS4A 4M42A 2I5JA 3SUNA 4LH5A 4RW7A 3TAMA 2KFZA 3ZSZA 3SUOA 4KTQA 4RG8A 1FK9A 3ZT2A 1J9AA 1N6QA 3TAPA 4FYDA 2HNYA 4XIUA 1ASUA 1I39A 4CJLA 3AVKA 3LP0A 5KRSA 1GOAA 4IDKA 3OYLA 4FW1A 4OGEA 2E6LA 1S1TA 2OPSA 1NKCA 4W5QA 3AVLA 4I9LA 2YKNA 4W5RA 4DQPA 2HNZA 3L2UA 4DLEA 1KFDA 1QQCA 4CHPA 4E7LA 4BE1A 1RT6A 1SV5A 4Z4FA 2DY4A 2OPRA 3PX6A 1DTQA 3EY1A 2G8KA 4CHZA 4CJVA 4FVMA 1UA1A 3RR7A 3KIOA 3JSMA 2G8IA 1KVAA 4E7HA 1BIUA 4F3TA 4Z4IA 2OPPA 1A5XA 5KTQA 1D5AA 1S6PA 1JLEA 4ID1A 2RPIA 4KHSA 3D0PA 1BCOA 2X6SA 4YFUA 1ZYQA 1RILA 1RTIA 1NJZA 4KREA 2LSNA 3ZSRA 4CEDA 3O4NA 4FM1A 1WAJA 3PO4A 4M3XA 4CECA 4FLVA 2X78A 4H4MA 3AO5A 4HCCA 4DTXA 4FK4A 1A5WA 3OYEA 3TR8A 1TKZA 2YNGA 3DLEA 4LH4A 5SWMA 5CYMA 4CFCA 3SUQA 2QXFA 4CJQA 3G0ZA 4KHWA 3D45A 1RBUA 4QCLA 2AJQA 4BDZA 3IAYA 4NCBA 1DTTA 1WSFA 1N5YA 4C8MA 4Z4HA 1VSMA 1RBVA 4CHYA 4JLHA 1S6QA 2ETJA 1JKHA 3NDKA 1WLJA 4NYFA 3K59A 4CIEA 3QEVA 1KCFA 2X6NA 3HPHA 2KW4A 4NCGA 1IG9A 4KHQA 3QEXA 1RCHA 1VSDA 4AHUA 3AVFA 1SL2A 4CE9A 1CLQA 2PZSA 2YNFA 2Q3SA 4I2QA 4MFBA 4DTOA 3V1RA 1QSLA 4OPJA 3NF6A 1S9GA 3KLGA 1BIZA 3L2WA 1C0MA 5HBMA 1EX4A 3M8SA 3V9UA 3TAEA 2PYJA 4C8NA 3QNNA 3ZT0A 3ZSYA 1ASVA 4KB1A 3QIOA 1WN7A 3AVGA 5KRTA 3C6UA 1B9DA 3VQAA 3ASMA 4H8KA 1L5UA 4M3WA 4CJSA 3AO4A 4JS5A 4B9UA 4DFMA 1SKRA 1KSPA 3TAGA 3KLIA 1B92A 2KZZA 2RKIA 3CFPA 3TABA 2YKMA 1WSGA 4W5OA 4B3OA 2Z1HA 2HVIA 4NCAA 4BWJA 4W5TA 3NH0A 5J1EA 3TWHA 1LWEA 3DOKA 1IKXA 4HHTA 4DFKA 4HUGA 3SPZA 2G8UA 4C8KA 1IH7A 4DS5A 2HHWA 3L2RA 3O3FA 4KTWA 4AHRA 4BWMA 1IKVA 4Y1CA 4C8OA 3M8QA 4QAGA 3QEPA 4GW6A 4GMJB 4ELVA 4J2EA 3ITHA 1HYSA 3ISNC 1VSIA 1J53A 1K6YA 3MEDA 1WSIA 3U3GA 4B8AB 3C6TA 3NHGA 4QOZB 2FBVA 3ALYA 4HTUA 3QNOA 1LAWA 1RNHA 2IDOA 3HT3A 4OVLA 1VRTA 2OZMA 4O0IA 1QSYA 1NK4A 3T19A 4FJJA 3AA5X 4CGHA 4KTZA 1FKPA 1X9MA 2JGUA 5DMRA 3K57A 2ATQA 4RW9A 5HRRA 4CJTA 1QS4A 1ZBFA 3DOLA 4ID5A 3VQ7A 3SJJA 2YHAA 3AA3A 4LSLA 1Q8IA 5JS2A 1UWBA 3ZSWA 2XY5A 1C1AA 3K5OA 2G8FA 1U49A 1NJYA 4RW4A 4PY5A 2W42A 3OYCA 4FJ9A 4AHVA 4L8RB 3WNEA 4IG3A 3E01A 3EZ5A 3PX4A 1Z26A 4DTSA 1RBTA 4IG0A 3NH2A
chains in the Genus database with same CATH superfamily
3LANA 3RRHA 4FLTA 4Z4EA 4PKIA 3DLLL 5F1XA 1VQ5N 2HHQA 1LOTB 1TL1A 4IOAL 1HPMA 4JK8A 3E9LA 2B6AA 3V1OA 3WT0A 3THYB 3LWLA 5AQRA 1CZBA 2NRTA 2ITGA 4FLZA 1MWKA 5DM7L 2ASOA 1Z25A 3R8EA 5CZ1A 3CCJN 2YNHA 2DFFA 4BRQA 1W0HA 1U04A 3BZCA 1EETA 2QI2A 4J2DA 1SS6A 3VQBA 1JCEA 3HPGA 1RDBA 4CEFA 3M8RA 3DRRA 3ZEUB 5FRMA 4H5TA 2F8TA 3PSIA 3SQ0A 5C25A 1L3UA 1KQSM 4H0XB 1JLFA 1WSHA 1T6CA 1MA9B 4K8ZA 5EOYA 4BDYA 4RW6A 4B9NA 3B6OA 1GLEG 4WE1A 3GBTA 4CGGA 4BGAA 4DQIA 5AQOA 1Q9XA 3LPUA 1KAYA 3FFIA 3NE6A 3OYKA 3P31A 2QWOA 4CVNE 3VENA 1VAZA 4C8LA 1BDGA 1KC8O 1DLOA 3M6GA 4HCBA 1RT2A 4CJ3A 4CFAA 3AY9A 4X66K 4DQQA 3W3DA 3WXKA 2VYPA 1IKWA 1WBDA 3GL1A 3NGYA 1WAFA 3E66A 2DTUA 2YV0X 2VG7A 1XC3A 3S3OA 1VSLA 1TVRA 3BP8A 4PHTX 3THWA 2GWKA 1BA1A 2DFEA 1U2VA 2OTJN 4DTPA 2O8FB 1ZBLA 4DV5K 1NJXA 2HBLA 3AVAA 4IDHA 4PWDA 1XUPO 3HBTA 1SKSA 2QTDA 3WXMB 2F9TA 1KD1O 3WXIA 2E8AA 3TAQA 1ILYA 5M1OA 5FRNA 3O4QA 1C0TA 2P1JA 3VQCA 2I7PA 3VQ6A 3V81A 4O44A 4PKHA 3DXMA 3ZX3A 3AGRA 3CCVN 4OKKA 2E2QA 1NGIA 4CZEA 3GG4A 4LF5K 2HOEA 2QW9A 2UXBK 1QHTA 4GKJK 3RSEB 4H5WA 2P5OA 4F2RA 4OX9K 2O8BB 4IFEA 1RTJA 3EKSA 2BGGA 2A5XA 2HHVA 1EQYA 4CIFA 4YDUA 1U45A 4BDPA 4FJIA 1QQMA 3L8BA 1YAGA 4B1WB 4FZXC 2A1RA 1RT4A 5AQZA 3MXMA 4FWNA 5CYQA 1GLCG 3WNFA 1XMOK 3AO3A 4A5AA 3T1AA 3CPWM 4I2PA 3E9OA 4J8FA 3OYNA 2OZSA 4FJHA 2UUCK 1E4GT 5I3UA 2RE2A 3BY5A 5B8HA 1NK0A 4M7YA 1NG9A 2IAJA 2P9IA 3ZSOA 5D3GA 4M3YA 3DLRA 2A41A 1N32K 4H0VB 4YDUC 3UKRA 5I9EB 2Q36A 3CJ1A 3QB0A 5AJ3K 1HYVA 1QQNA 1SUQA 4JI6K 2NUBA 1YVUA 1O13A 1NOYA 3T1YK 2IC3A 4H0OA 1HMVA 3OW2M 3CPEA 3WXLA 3QINA 5AQGA 4DLGA 4BRKA 4FWLA 4BR5A 1LCUA 1WSEA 1HQEA 3CCSN 1YVNA 4KHPK 3A2FA 2HHHK 1T6DA 1IO2A 2ZWHA 5E84A 1XHZA 1NK6A 2Y1IA 2UXDK 3AVBA 3BZKA 3K58A 1IV0A 1BA0A 3JAMO 4DUYK 4JKGA 3VESA 3LP2A 2NRRA 3CG7A 4A2BA 1C1BA 1CZ9A 2WC9A 4OJRA 3ENBA 1YTUA 4O4GA 4DWIA 3SBGA 4CIGA 2VQEK 1NGBA 3QETA 3CM5A 1TYQA 3Q7CA 2NZTA 4N47A 3V6DA 1H1VA 4B9VA 4FWSA 1VSEA 3CFOA 4EFHA 4O5BA 1D8YA 1KVCA 1TKTA 4AF1A 4CHNA 3ULDA 2CGJA 3TPQA 1HNVA 1CXUA 1YHQN 2RF2A 5AQFA 4DV0K 4NO7A 3RMDA 5HROA 5T7BA 4IOXA 4XH5A 4E89A 3S3NA 4IBNA 3NGZA 4JRPA 4QS8A 4CJFA 3D2FB 1TK8A 4EZ9A 1HNWK 3VQ5A 1C1CA 1NGDA 1JLQA 4DU1A 1NGJA 1B9FA 2XY6A 3S9HA 2E2PA 2JLEA 3KLFA 4A2AA 3VTHA 3K5LA 1UAXA 1NBWA 1RFQA 3KK3A 1T8EA 3VQ9A 2O8EB 2YJEA 4H03B 2P9UB 4AHTA 4DQSA 2P9LB 5C0YA 3MCAB 3LAKA 3MEEA 3CC2N 4FZZA 5CY4A 2O8CB 3AV9A 4R5PA 4Y1DA 4LFBK 1ZXOA 3VOVA 1W97L 1L3SA 4DS4A 4M42A 3SUNA 4LH5A 4RW7A 4KH5A 3TAMA 3SUOA 4KTQA 4RG8A 1I39A 2QXLA 3SLCA 3LP0A 4XEIA 2UXCK 3OYLA 1K8KA 4CI6A 2Q31A 2YKNA 4DLEA 4E7LA 1SV5A 1XNQK 4JEPA 3PX6A 2D1KA 4JI5K 4CHZA 1S22A 3JSMA 3RVCA 4BR7A 4Z4IA 3QBXA 1A5XA 4BRFA 5KTQA 4BRIA 4ID1A 4KHSA 1NWKA 4YFUA 1ZYQA 3VETA 4CEDA 1NLVA 3O9SA 1TKZA 3DLEA 5C15A 5MLCQ 4CFCA 5ADXA 4QCLA 4EAHD 1NJIO 2UUBK 1N5YA 4FSVA 4Z4HA 4IJAA 1VSMA 2HMPA 4JLHA 1JKHA 2VCPA 3CCMN 1KCFA 2X6NA 4NCGA 2PZSA 4MFBA 3V1RA 4OPJA 4JI4K 1I94K 5HBMA 1EX4A 5AZJB 3TAEA 2PYJA 3IUCA 3QNNA 2ZF5O 1QHAA 2Q0RA 1L5UA 4JS5A 3G4SN 3K9JA 4B1XB 1YJNN 3CFPA 4YOVA 3QFUA 1WSGA 4DV1K 2Z1HA 4W5TA 3NH0A 1IG9A 4KHQA 1IKXA 4DFKA 3SPZA 3C6HA 5BPLA 4BWMA 3AARA 4Y1CA 2F9WA 2OTLN 3TSUA 3PIOL 3U3GA 4QOZB 4HTUA 2OZMA 1LAWA 1VRTA 3SAHA 4KH4A 1QSYA 2OCEA 4MO4A 4FJJA 3AA5X 3DJCA 1ZBFA 3CQXA 4BY9C 5JS2A 2XY5A 3CF5L 4IZ9A 1NJYA 4BR2A 2W42A 4FJ9A 4AHVA 3WEEA 2ASMA 1VQ9N 4YY3K 3EZ5A 3SPYA 4DTSA 1RBTA 4CBWA 4IG0A 2V7YA 4B9QA 3KKSA 2GEMA 3CYMA 1Y97A 3U3YA 4I6MB 2O4IA 4K8XA 4YOUA 3MX2A 1HYZA 3NH1A 3SAGA 5FLXO 5FROA 4DTMA 5CZ2A 3QDKA 2YHBA 5BR8K 4LF4K 2KKZA 4FCYA 4E7KA 1S9EA 2QWNA 1JLGA 4DMNA 1RT7A 3IDHA 3VA3A 3DLKA 2QK9A 4BC2A 5ELZA 1J6ZA 2O4GA 1KFSA 4KI4A 4JKCA 4GV9A 4FLWA 2KFNA 1LW2A 3FZFA 3PV8A 3VPZA 3EYZA 4WYBA 3TSQA 4RW8A 3PLAA 4IOCL 3SQ2A 4WQ4A 4ZTJA 3QEIA 4DV3K 4LC9B 4YHHK 3VERA 1VSHA 2FSJA 4BVPA 2GTDA 3OYHA 3SK3A 2E1YA 4E19A 3J81O 1VQ4N 3CC4N 1D9DA 4KPYA 4E3SA 3RMAA 4M3TA 1Q82O 3VQDA 3C94A 4AILC 4RTFD 2WUSA 4DF4A 2Q2RA 2CGKA 5LJVA 2XY8A 4IO8A 3OYFA 3KHYA 4LF6K 1IBKK 3TTDA 1KVBA 1M90O 5C24A 4JI1K 3C65A 3VN5A 2Z1GA 3MMVA 3QLHA 4FJMA 3M5RA 4FJKA 2VGNA 3ULEB 2EHGA 3HP6A 5JS1A 4L3QA 3HXMA 1KLMA 2X74A 2E5LK 3IS9A 3HP9A 4BRCA 4KRFA 5LMUK 5BN9A 5HP1A 1QTMA 1JXBA 4KFBA 2P9PB 4HTLA 1SL0A 1XHXA 4IXCA 4X65K 5M1QA 4WFBL 1VQ7N 1VHXA 3VGKA 4BRLA 2BUPA 3OYIA 3OJUA 4CGDA 2Q0UA 4LY7A 1C0GA 3THXA 3N4QA 3F9KA 5GADP 3AVHA 1DKGD 2D0OA 2FF3B 4FM0A 3MWTA 3F2KA 5C42A 1EP4A 1P90A 4PKGA 5CHIA 3AAPA 4M3RA 3QESA 1HX1A 4BRAA 4CEBA 1RTDA 3BF3A 3CQ8A 4JRQA 1RDCA 5DK5A 2GV9A 5FPEA 3MXJA 4YOWA 2HBMA 2NRHA 3H46O 1GLLO 1HJOA 3NF8A 4NLBA 5AQUA 3J8AA 2ZGZA 1ATSA 5EY4A 3EO3A 3ZT3A 1NJWA 2P9NB 3OYJA 4FW2A 4FJGA 4M45A 3C7NB 3H3OB 1F21A 1HR0K 2FSKA 4B3RK 5TKWA 1GOBA 3DM2A 3NFAA 1P8ZA 4FK2A 4JHDB 2ZQBA 3FFKB 4JKDA 1J54A 4CJWA 3O9RA 4FJNA 4Z4GA 2P51A 3VQQA 2KTQA 5BREA 1WB9A 1HRHA 3AVIA 4FJ5A 4FLYA 2QA4N 4FWRA 4CEQA 3HOSA 2VWBA 3O9QA 2ASPA 3L6QA 4JI8K 4FVUA 3ZT4A 4DB3A 4HWIA 3OY9A 2E88A 5HRNA 4CZKA 1XC9A 1NGAA 1DT9A 2NRXA 3H08A 4K42A 4CGFA 3LP3A 1U4BA 1L3VA 4JD2B 3DMJA 3D2EA 3CCEN 2VQFK 1T3VA 1NGCA 2FF6A 1NGGA 4B1ZA 3LDSA 2O8DA 2YHXA 5HRSA 3A8YA 3QEWA 3CJ9A 4BQZA 3WQUA 5AQKA 2E4LA 4DSFA 2OA8A 3CJAA 3P4IA 5FDLA 4CF2A 3JXUA 3KD5E 1RDUA 1KTQA 1Q9YA 3CMAN 3OBYA 4X62K 2YHWA 3VEVA 3C0BA 2HVHA 4CHOA 1D9FA 3DXKA 1SL1A 1TK5A 3EEQA 3J7AP 2CGLA 2P5GA 4JKFA 3EZWA 1XI1A 4KV8A 2HHTA 1QSSA 3VEOA 1G15A 3JYTA 3V9ZA 1NK5A 1IG8A 1XNRK 3ZYYX 3CERA 3P39A 2FXUA 2YNIA 4DR7K 3HOTA 1Q86O 3DLHA 4CW7B 2RN2A 3O3HA 3MWPA 2P9SB 1QQOA 1KXPA 3OS0A 3CETA 4CGJA 4LSNA 4WQ5A 4BE0A 2WBNA 4HUFA 3WNGA 5LY3A 4DSLA 5KPTA 3CD6N 4LF8K 1ZC6A 3THYA 4PA1A 1NK8A 1TUYA 3SMPA 1Y64A 3HYFA 4OPAA 4B8CA 4ELUA 5AZIB 3G6EN 3SV4A 5C12A 1S1UA 3AVNA 3J7YP 3RR8A 5E41A 3HSTB 3MN5A 4CFDA 1FJGK 4GKKK 3A5OC 1A5VA 3MDQA 2F8SA 1W7AA 1T44A 3ZEUA 4NB4A 4B9SA 3I8BA 2G8HA 3FZHA 4CBXA 4EHUA 5HLFA 4F2SA 1X3MA 1SKWA 3O4WA 1NKEA 4CF1A 5JICA 4HUEA 4YORA 5M1PA 5TKYA 4KO0A 3TAFA 3LALA 4G1QA 3VEZA 1XQSC 3CJ7A 3RRGA 3RMBA 4B9LA 2JWKA 3OS1A 4ZTFA 3EKUA 3B8AX 2KQ2A 3OYMA 3KK2A 1TAQA 1LWCA 1QZ6A 4CCHA 4K43A 2GUPA 1QZ5A 1FK9A 3ZT2A 5BPMA 5LL6Z 4CJLA 3L0QA 3VF2A 4FW1A 1NKCA 3AVLA 4I9LA 4DQPA 2HSTA 2HNZA 3L2UA 4BE1A 2OPRA 1DTQA 3EN9A 4E7HA 4F3TA 1BIUA 2O8FA 2RPIA 1BCOA 2X6SA 4KREA 3H6EA 1WAJA 4CZFA 4CECA 4FLVA 2BH1A 2X78A 3AO5A 4DTXA 4DUZK 1CZAN 1A5WA 4B3TK 2YNGA 4UY8O 5SWMA 5DM6L 5CYMA 3SUQA 2QXFA 4CJQA 5C2DA 1RBUA 4BDZA 3IAYA 2AP1A 3R3LA 1Z05A 2P9KB 3UKUB 1RBVA 4CHYA 2ETJA 3NDKA 4NYFA 3K59A 4BRDA 1YJWN 2KW4A 4B3SK 1WOQA 3AVFA 1SL2A 4MO5A 3H1QA 3LM2A 1CLQA 3RSEA 2IVOA 4DTOA 4IJNA 2O8BA 3ID8A 1S9GA 3KLGA 3L2WA 1C0MA 1VQON 3FGUA 4WFAL 1ASVA 4KB1A 3QIOA 1KAXA 3AVGA 3C6UA 3VQAA 4CJSA 3AO4A 1KSPA 1B92A 4YOTA 2KZZA 3VEWA 2HVIA 2HBKA 3TWHA 1LWEA 3DOKA 4HHTA 2HHWA 2ZGYA 5IWAK 1IKVA 4J2EA 3M8QA 3QEPA 1HYSA 5AQWA 1VQKN 3MN9A 1J53A 4RWTA 1WSIA 3VTIA 4BROA 4B8AB 2W6KA 3QNOA 1RNHA 2IDOA 3LDQA 3HT3A 4O0IA 4BRHA 2QWLA 4BRGA 5AQXA 1BUPA 5HRRA 4ID5A 3DOLA 3G25A 3ID6A 3AA3A 4LSLA 1Q8IA 1ATNA 3ZSWA 4Z94A 3I56N 3TSPA 1C1AA 3K5OA 1U49A 3NVKA 3UE5A 5HOOA 2V52B 4IEIA 3E01A 3PX4A 1Z26A 3MK6A 3IG1A 1JCFA 3DLGA 5M1NA 1K9MO 3O1BA 5AQVA 3W0LA 2ZJQL 4CF0A 4PQUA 3D7EO 1BI4B 3H45C 1J5EK 4F8RA 4OO1J 1RT5A 3WXJA 4EP4A 3BGRA 4BR9A 3K5MA 3HZ6A 4KHNA 2Z1JA 3ZETB 4AHCA 3AGKA 4M3ZA 3T1HK 1KRPA 3LWMA 3CC7N 2DPNA 3L2VA 4CERA 4CZMA 4Q5VA 4F3OA 2PFUA 5J2PA 1KAZA 3ZT1A 4EP5A 4BG9A 1BOTO 4BGBA 2YX6A 2UU9K 3EL2A 3L3VA 4FM2A 4BREA 3QMLA 1N36K 3DRPA 4BQLA 1JL2A 3KVGA 3B6PA 2F7TA 4J2AA 3BF1A 2A40A 3PO5A 4BG8A 4F4KA 3GE1A 4KAZA 4K41A 2G8VA 4A5BA 1EXQA 4I9QA 4AQYK 1C6VA 2HB5A 2VG6A 1T03A 4CK2A 4B1VA 4DG1A 2W6LA 4CJPA 1OH6A 1DEJA 4KKOA 1O1WA 1SQKA 5HRPA 3NGIA 3OYBA 5BRDA 1BO5O 3D6RA 4JKBA 3HJFA 3QERA 2ZD1A 3D2FA 5AQHA 4QS9A 1ZBIA 2NRZA 5AFUH 4N5SA 1HKBA 2RHKA 3KLHA 4B9MA 2Z1IA 3HM9A 1VSFA 2YI1A 3HM8A 3NF7A 3QIPA 3MEGA 5JVGL 3THVA 3WNHA 3SCXA 4LD0A 3TARA 3FR0A 5KGXA 2V51B 1MWMA 1RGIA 1VQ6N 4DV2K 4DV7K 2XHBA 4BR0A 1JLBA 2O8EA 3DAWA 2P9UA 1LAVA 2IOCA 3UIQA 2DFHA 3VF6A 1YT3A 2P9LA 2CH5A 3F9MA 1EWQA 1E4FT 3ZSVA 2O8CA 3MN6A 2G8WA 1YXQA 2D0PA 5E26A 5J2QA 3C95A 1OH8A 3LZIA 1U48A 3AVCA 4M7XA 3EE9A 2WOMA 4CZHA 2WFBA 4JKHA 2ZE2A 1X1PA 3R9PA 1GLDG 4B3MK 3VMFB 3VEYA 1JLCA 4FWOA 3F73A 4DSKA 2FC0A 3M8PA 2ZJPL 1JJ2M 4BC3A 4LF9K 5AR0A 5H1SQ 2D0CA 3HTVA 3GOIA 3NVMA 4IFVA 3R1XA 5GINA 2WONA 1V4TA 3V9XA 3T3FA 3ENHA 1X3NA 5AQYA 2CH6A 3HRGA 4DFJA 1TAUA 5KQDA 3OYDA 2D4WA 1X9JA 4G9ZA 4CD3A 1NM1A 3QO9A 1OH5A 5J2NA 3LDOA 4FZYA 1HKCA 4J2BA 2AA4A 1KLNA 1IBMK 4FPAA 4OKJA 4JN4A 4DTUA 2Y1JA 4GV6A 4FLUA 4O8UA 4E1NA 3MCPA 4IO9L 1QE1A 3V1QA 4IEEA 3PSFA 1VRUA 1TKDA 4DR3K 4JI0K 3HVRA 4Q0BA 1T05A 4NXNK 3M3ZA 2XRIA 3CHWA 4WF9L 1HNZK 4H0TB 5AZJA 5JMVA 2PBDA 1OKJA 4JV5K 4E7JA 3LDLA 2KHOA 1IJJA 2IIRA 1U47A 2BDPA 2E1ZA 3K2PA 2EX3A 3AO2A 1Z6RA 1BCMA 4H5RA 3I0RA 1RTHA 4UQGA 3HVTA 1K73O 4JI7K 2D0BA 3BUZB 4ISFA 4BRNA 3O8MA 2HMIA 4A57A 3O6WA 1JXEA 4EHTA 2FBTA 3HPOA 3NMUA 2A6AA 4WQ4C 4DTRA 1GLAG 4N41A 2GELA 3HI0A 4CF9A 4ISGA 3PY8A 3VA0A 4KBOA 4FWKA 4O5FA 4ZHRA 3OVNA 4JS4A 2D0AA 1SAZA 1YJ9N 3CIPA 4EZ6A 4DHYA 5BR9A 5CE3A 3SYZA 2R7YA 2IVPA 4FLXA 4I7FA 4QS7A 4N76A 1S5JA 5AQJA 3LDPA 3L3UA 4A62A 4CZJA 4I6MA 4RCHA 3P5JA 2O8DB 3SNNA 3AA2A 5AQMA 4DU4A 4CEOA 2OPQA 4ILGB 2E6MA 2XO7A 3LL3A 3CM6A 4DU3A 4CJKA 4H5VA 3O3GA 4ELTA 2HBJA 2GWJA 1FKOA 1HQUA 4CJRA 1GOCA 2BANA 4BVOA 1QVGM 1WUAA 2KZMA 2B4JA 4DR6K 1HJRA 4AH9A 2VWKA 3V4IA 4E0DA 4JKAA 3THWB 1CXQA 1LWFA 3P83D 3ZSQA 3BDPA 4CJEA 2UYTA 2VG5A 1U2VB 2QKKA 1TGOA 4MQ3A 4DKWA 3DLBA 2F96A 2NRVA 4LFCK 2A42A 4N56A 3O5BA 1YI2N 3HK2A 3TU5A 3LAMA 2Q97A 3U4LA 3OJSA 3OA9A 5ADXH 4KHUA 3U6FA 3AVMA 3SV3A 1V4SA 3HL8A 4BRMA 1TUUA 1S1XA 3DXMB 3K5NA 2KFZA 4WFNL 1YUWA 1J9AA 4FYDA 2HNYA 1ASUA 5IT9O 3O1WA 2F4VK 4OGEA 2OPSA 4W5RA 5F2RA 4V19S 1QQCA 4CHPA 3ULEA 3L4IA 1RT6A 4Z4FA 2DY4A 4JAXA 4FOIA 4CJVA 1UA1A 5BRHA 3RR7A 3TTFA 1NMDA 5CR4A 1KVAA 2P9PA 3T69A 1S6PA 1NJZA 1RTIA 4FM1A 3PO4A 4H4MA 3OYEA 3TR8A 4LH4A 4FPBA 4BC4A 3G0ZA 1HUXA 3VEXA 2WTUA 4NCBA 1DTTA 1WSFA 3LDNA 4CZIA 4EIAA 3SJHA 1S6QA 5EVZA 5LMNK 4MDAA 3QEXA 1RCHA 4AHUA 5BRFA 5LJWA 4DR5K 4CE9A 2P9IB 2YNFA 3UKRB 3V9UA 4C8NA 3SAFA 4MDBA 3ASMA 4H8KA 4B9UA 1Q18A 1SKRA 2QEXN 3I55N 4OPHA 2RKIA 3TABA 3CI5A 2YKMA 4B3OA 4CZGA 1S3XA 4NCAA 4BWJA 4DR2K 2G8UA 4C8KA 2GX9A 2P9NA 4HUGA 2NRWA 3C7NA 4MLHA 3VGLA 5AQPA 1ZBSA 4QAGA 4K25A 4GW6A 4GMJB 3ITHA 4K0KK 3ISNC 1VSIA 1K6YA 2IVNA 4JHDA 3C6TA 4E1JA 2FBVA 4OVLA 5C2FA 1NK4A 4CGHA 4KTZA 1FKPA 4JKGB 1X9MA 1MDUB 1K8AO 5DMRA 5AQIA 1QS4A 3VQ7A 2BTFA 2YHAA 3ATUA 4C1NK 1R59O 3ZX2A 5GIPA 2G8FA 4WQ5C 4PY5A 4RW4A 3VF4A 3FLCO 5C10A 5KPRA 4L8RB 3WNEA 4IG3A 3WQTA 1TYQB 3D45A 2EWSA 4JD2A 3G10A 3N4PA 5AFUA 3TTCA 4Z0UA 4C1NI 4DCHA 5KI6A 5BN8A 4O55A 3T7ZA 4JI3K 3P1GA 4OLAA 1JCGA 4CHQA 4FJ8A 3NBPA 3V9SA 3VQ8A 1R0AA 2OANA 1IBLK 3QBWA 1S1VA 3OYAA 4CZLA 4NYNA 3ZLJA 3PUFA 1BGXT 3G71N 1RDAA 5EU7A 2E2OA 3SZ2A 4DV4K 4IFYA 2D5RA 3RMCA 4W5NA 1UA0A 4M63C 5HL7L 4PL7A 3VQPA 1ITGA 3FZMA 5FPMA 2HHUA 3MECA 3ZCMA 4CFBA 5GAEP 4YOYA 3MAQA 1LV5A 4FWPA 1SZ2A 4X64K 4NLCA 4AM7A 3NCIA 2QWQA 4NXMK 4IWVA 3LP1A 1C0FA 3KZBA 3RWUA 2VGMA 2P9SA 1XWLA 4H4OA 2HHXA 4MLEA 5JVHL 1Q7YO 3P38A 4LFAK 2HHSA 4B08A 4KB0A 1Q81O 1G99A 4H5NA 4FK0A 3AA4A 1BQMA 4DV6K 3CMEN 4PUOA 4CK3A 3A5MC 5AZIA 3PX0A 2J4RA 1NOZA 1HLUA 3KTQA 3DYAA 5AQSA 2IS3A 1ASWA 3IMXA 3FZKA 4A61A 3U9DA 5K14A 3NF9A 1K8KB 4Y0WA 2XY7A 3NAEA 1UOCA 1JLAA 3PIPL 3LZJA 4FJLA 4FXDA 3O80A 4IKFA 1OVQA 3ZSXA 3IFRA 3OBWA 1EO1A 3KD1E 4CEAA 5AQLA 4H0YB 1VQ8N 2IGIA 4FJ7A 3K0SA 4FJXA 3OTOK 3WUHA 2UUAK 3SUPA 3HO1A 2E20A 3ZX0A 4B1YB 4M41A 3KLEA 4U67L 3AVJA 3F5TA 1BL3A 1M1KO 1U6ZA 3SQ1A 2FSNA 4JKEA 3O08A 3DRSA 1C0UA 3V9WA 5I42A 1W2BM 4KI6A 2A1SA 4HVJA 5AQTA 1NGFA 1TKXA 2OYQA 1LW0A 4JYAK 1OVYA 4H0PA 1FXXA 3SMSA 5KGWA 4OGCA 3VGMA 1EKEA 3E9PA 5KPZA 1I3AA 2GBZA 1YIJN 4CJ4A 3O9TA 1NK9A 3RTVA 3A5NC 1WBBA 4O8KA 1HNIA 3I0SA 2QM1A 1ZBUA 1BG3A 2QKBA 4GV3A 2V7ZA 4LF7K 3UB5A 3MXIA 4GVEA 4R79A 5F0XA 1VK0A 3TI0A 2P9KA 1W9HA 3UKUA 4FWQA 3OYGA 4WCEL 3TANA 3CCQN 4CF8A 4YNQA 4BE2A 4DTJA 4E1MA 4BACA 3CFRA 3ENOA 4CEZA 3KWGA 3WEEB 1T7PA 1X9SA 2Q1NA 3S41A 4CGIA 1S1WA 3K9KA 4CJUA 4CK1A 5KQ8A 1OH7A 2YCHA 3VQ4A 4DSIA 3CCUN 3FE1A 4AM6A 2GUIA 3CQYA 4FO0A 4BRPA 5EXWA 1IKYA 2HW3A 1GLBG 3IRXA 4A59A 1X9WA 3MN7A 2ZM6K 1RT1A 1L3TA 5JLFA 3QFPA 1EWRA 4YOXA 4PL8A 2NLXA 2PY5A 4DSEA 1HNXK 2BE2A 1BWFO 4B1UB 3VQEA 1WSJA 3IKMA 4BC5A 4ICLA 3H1VX 1TK0A 2HNDA 1BQNA 3OS2A 2VWJA 4E7IA 4CJ5A 4OPKA 1RBRA 4ISEA 3QICA 1YTAA 3SBTA 3J7ZO 3I8DA 3BEXA 1BHLA 1HPZA 4JI2K 4BR4A 4KH6A 2QWMA 1NKBA 2PYLA 3C6AA 1MU2A 5M1FA 4GY2B 1ATRA 2KLAA 4KHYA 1NK7A 1VSKA 4DFPA 3O9UA 3J80O 1TL3A 1YITN 2ZJRL 1GLFO 3A5LC 3AO1A 3CCLN 3S3MA 1VQMN 1BI4A 5GIOA 3SI6A 2B5JA 2HF3A 3AAQA 5FPDA 1JL1A 2YHYA 5FPNA 1N8RO 1J5OA 2FBXA 4GNIA 5M1KA 4GVMA 3KK7A 3ZETA 1D4XA 5GAGP 3KKRA 1VQPN 4AHSA 3ATVA 3KK1A 2HF4A 1REVA 4O0JA 4DQRA 1VQNN 4B9TA 4M3UA 3DI6A 4TSXA 4JK7A 1E3MA 3KWIA 1RDDA 4DF8A 5SZTA 3L2QA 1RDWX 1YF5L 3SQ4A 4XH4A 5AQQA 4CBUA 4OKEA 1N34K 2YJFA 1RBSA 4JNEA 2FBYA 4C23A 1BISA 3U8XA 3LPTA 4Z4CA 5J2MA 1ZBHA 1WNSA 3GDQA 1VSJA 1TV6A 3THXB 4ILHA 1RT3A 2QWRA 4CESA 4DQ8A 4CEEA 4DTNA 4OLBA 2I5JA 2I7NA 2E2NA 3ZSZA 1N6QA 3TAPA 4F9OA 1FW6A 4XIUA 4DR1K 3AVKA 5KRSA 2JWLA 3M1FA 1VQLN 1GOAA 4IDKA 2E6LA 1S1TA 3I33A 3OHRA 4W5QA 1KFDA 3MX5A 3EY1A 2G8KA 4FOEA 4FVMA 4XH1A 3DWLA 3KIOA 2G8IA 4CD1A 2OPPA 2W40A 1D5AA 1JLEA 2PAVA 3D0PA 1RILA 2LSNA 3ZSRA 3O4NA 4M3XA 4HCCA 1NGEA 4FK4A 1S72N 1DGKN 3LM9A 2FLOA 5JLHA 2AJQA 4KHWA 1NMNA 4C8MA 3EE8A 4FWMA 2W41A 2QWPA 1WLJA 1BU6O 4CIEA 3U9ZA 3QEVA 3HPHA 1HKGA 3L4QA 1NU0A 1VSDA 4ILJA 1QVFM 5AQNA 3CJBA 2NNWA 3E1YA 2Q3SA 4I2QA 1QSLA 3A0IX 3NF6A 1BIZA 3M8SA 3D2EB 3ZT0A 3ZSYA 2H3GX 1WN7A 5KRTA 1ESVA 1B9DA 3H3NO 4M3WA 4DFMA 1NGHA 5A2QO 3TAGA 3KLIA 5BPNA 1XMQK 4FL9A 4W5OA 1NNEA 3JS6A 4DSJA 5J1EA 3Q7BA 2ITMA 1N33K 2A3ZA 1IH7A 4DS5A 3L2RA 3O3FA 4KTWA 4AHRA 4CJ7A 4C8OA 4ELVA 5EX5A 3DXKB 3MEDA 4JK9A 4DR4K 3NHGA 3ALYA 4U7BA 3T19A 2JGUA 3HSCA 3K57A 2ATQA 3CCRN 3FZLA 4RW9A 4CJTA 3CXCM 5GAHP 3SJJA 1UWBA 3CJCA 1GLJO 3OYCA 3R6MA 3KJVA 3NH2A
chains in the Genus database with same CATH topology
3G10A 3LANA 3RRHA 4Z0UA 3IG1A 3KKSA 4FLTA 5KI6A 3DLGA 4O55A 4Z4EA 3P1GA 4OLAA 3CYMA 1Y97A 3U3YA 2O4IA 4CHQA 4FJ8A 2HHQA 4K8XA 3NBPA 1TL1A 1HYZA 3VQ8A 3NH1A 4CF0A 3V9SA 1R0AA 2B6AA 3V1OA 4PQUA 5FROA 1BI4B 1S1VA 3LWLA 3OYAA 5CZ2A 1RT5A 4NYNA 1CZBA 4EP4A 3BGRA 3PUFA 2ITGA 4FLZA 1BGXT 2YHBA 1Z25A 4FCYA 4E7KA 5CZ1A 1S9EA 2YNHA 3K5MA 2DFFA 1JLGA 4DMNA 2Z1JA 4AHCA 4KHNA 4M3ZA 1RDAA 5EU7A 1RT7A 1KRPA 3LWMA 1W0HA 3VA3A 1U04A 3DLKA 3SZ2A 4IFYA 1EETA 2D5RA 3L2VA 3RMCA 2QK9A 4CERA 1UA0A 4Q5VA 4F3OA 4W5NA 4J2DA 3VQBA 3VQPA 3ZT1A 5J2PA 4EP5A 1ITGA 3HPGA 2O4GA 1KFSA 1RDBA 4DTMA 4KI4A 3MECA 3ZCMA 2HHUA 4CEFA 4CFBA 3M8RA 3MAQA 3DRRA 1LV5A 3L3VA 4FM2A 5FRMA 2F8TA 4FLWA 2KFNA 1LW2A 3SQ0A 5C25A 3PV8A 3NCIA 3DRPA 1L3UA 1JL2A 3EYZA 4RW8A 1JLFA 1WSHA 3SQ2A 4ZTJA 3LP1A 3QEIA 4F8RA 4K8ZA 3B6PA 4BDYA 4J2AA 4RW6A 4B9NA 3B6OA 1VSHA 3OYHA 3PO5A 3RWUA 4E19A 4WE1A 4F4KA 4CGGA 1XWLA 4DQIA 4H4OA 4KAZA 2HHXA 1Q9XA 3LPUA 2G8VA 1EXQA 4I9QA 3FFIA 1C6VA 2HB5A 3OYKA 4B08A 3NE6A 2HHSA 2VG6A 1D9DA 4KPYA 1T03A 4CK2A 4C8LA 4KB0A 4E3SA 3RMAA 4M3TA 4DG1A 3VQDA 3C94A 1DLOA 4CJPA 4AILC 4HCBA 4FK0A 1RT2A 3AA4A 4KKOA 1O1WA 1BQMA 4CJ3A 4CFAA 5HRPA 4DF4A 4PUOA 3NGIA 4CK3A 2XY8A 3PX0A 3OYBA 3OYFA 4DQQA 1NOZA 3KTQA 3DYAA 3HJFA 2IS3A 1IKWA 1ASWA 1KVBA 3QERA 5C24A 2ZD1A 3NGYA 1WAFA 1ZBIA 3VN5A 2DTUA 2Z1GA 2YV0X 5K14A 2VG7A 3NF9A 4N5SA 3QLHA 2XY7A 3KLHA 4B9MA 4FJMA 2Z1IA 3HM9A 1VSFA 4FJKA 3NAEA 3S3OA 1UOCA 1JLAA 1VSLA 1TVRA 3LZJA 4FJLA 4FXDA 4IKFA 3NF7A 2EHGA 3HP6A 5JS1A 3QIPA 3MEGA 3HXMA 3ZSXA 2DFEA 1KLMA 2X74A 3THVA 3WNHA 3IS9A 3SCXA 3HP9A 4KRFA 4LD0A 5HP1A 3TARA 1JXBA 4KFBA 1QTMA 5KGXA 4DTPA 3KJVA 3KD1E 1SL0A 1ZBLA 4CEAA 1XHXA 2XHBA 1JLBA 1NJXA 3AVAA 1LAVA 2IOCA 4PWDA 3UIQA 1SKSA 2DFHA 2IGIA 3OYIA 1YT3A 3OJUA 3SPYA 4FJ7A 4CGDA 4LY7A 3ZSVA 4FJXA 3F9KA 3AVHA 3TAQA 2G8WA 5FRNA 3O4QA 3SUPA 1C0TA 2P1JA 3VQCA 3HO1A 3VQ6A 5J2QA 4O44A 4FM0A 3C95A 3V81A 3LZIA 1U48A 3AVCA 3KLEA 4M41A 2WOMA 5C42A 1EP4A 3AVJA 4OKKA 4M3RA 1BL3A 3QESA 2ZE2A 3SQ1A 1X1PA 1QHTA 3DRSA 1C0UA 3V9WA 5I42A 2P5OA 4F2RA 4KI6A 4CEBA 1JLCA 2A1SA 4HVJA 1RTDA 3F73A 4DSKA 2FC0A 3M8PA 1TKXA 3CQ8A 1LW0A 1RDCA 1RTJA 4JRQA 2OYQA 5DK5A 2GV9A 2BGGA 3MXJA 2D0CA 2HHVA 4CIFA 1FXXA 4IFVA 2WONA 4Z4GA 3V9XA 5KGWA 3NF8A 4OGCA 3T3FA 1EKEA 1U45A 4BDPA 4FJIA 3L8BA 1I3AA 2GBZA 4FZXC 4CJ4A 3ZT3A 4DFJA 2A1RA 1RT4A 3OYDA 1NJWA 1NK9A 3RTVA 1TAUA 3OYJA 4FW2A 4FJGA 1HNIA 4M45A 3I0SA 3QO9A 1ZBUA 1F21A 5J2NA 3MXMA 4FZYA 2QKBA 5CYQA 1GOBA 3DM2A 3NFAA 3WNFA 4J2BA 4FK2A 3AO3A 2ZQBA 3MXIA 1J54A 3T1AA 1KLNA 4I2PA 4CJWA 4FJNA 1VK0A 2P51A 3VQQA 3OYNA 3TI0A 2OZSA 1HRHA 3AVIA 4OKJA 4FJ5A 1W9HA 4FJHA 4FLYA 4DTUA 2Y1JA 4CEQA 4FLUA 4E1NA 3OYGA 3TANA 5I3UA 4CF8A 2KTQA 4YNQA 1QE1A 4BE2A 4DTJA 3ZT4A 4E1MA 3V1QA 4BACA 1NK0A 3OY9A 3CFRA 2IAJA 4CEZA 1VRUA 3ZSOA 5HRNA 1XC9A 1TKDA 3DLRA 4M3YA 3HVRA 1T7PA 5D3GA 3H08A 4CGFA 1X9SA 4Q0BA 3LP3A 4CGIA 1U4BA 1T05A 2XRIA 1L3VA 1S1WA 3DMJA 4CJUA 4CK1A 4E7JA 3VQ4A 1HYVA 3LDSA 4DSJA 4DSIA 1SUQA 5HRSA 1U47A 3QEWA 2GUIA 2NUBA 2BDPA 1YVUA 3K2PA 1NOYA 2E4LA 2EX3A 1IKYA 3AO2A 4DSFA 2OA8A 2IC3A 2HW3A 1BCMA 3I0RA 1HMVA 5FDLA 4CF2A 1RTHA 3KD5E 3IRXA 1X9WA 4UQGA 1KTQA 3HVTA 1Q9YA 1RT1A 2D0BA 1L3TA 3QINA 4DLGA 2HVHA 2PY5A 1WSEA 4DSEA 2HMIA 4CHOA 1HQEA 2BE2A 1D9FA 1SL1A 1TK5A 1JXEA 3A2FA 2P5GA 1IO2A 2FBTA 3VQEA 1XI1A 1WSJA 4KV8A 3HPOA 2Y1IA 1XHZA 1NK6A 2HHTA 3AVBA 4ICLA 3K58A 1QSSA 4DTRA 1TK0A 1G15A 3JYTA 4N41A 2HNDA 1BQNA 3LP2A 4CF9A 3OS2A 3CG7A 4CJ5A 4OPKA 2VWJA 3V9ZA 1RBRA 4E7IA 1NK5A 3PY8A 1C1BA 3VA0A 1CZ9A 4OJRA 1YTUA 1YTAA 2YNIA 4ZHRA 3OVNA 4O4GA 3I8DA 4JS4A 4DWIA 4CIGA 2D0AA 3DLHA 1BHLA 1HPZA 4EZ6A 3QETA 1NKBA 3CM5A 2PYLA 3SYZA 1MU2A 2RN2A 3O3HA 2R7YA 4N47A 4N76A 4FLXA 4I7FA 3V6DA 1S5JA 3L3UA 4B9VA 1VSEA 3CFOA 3OS0A 4KHYA 4CGJA 1NK7A 1VSKA 4LSNA 4DFPA 4BE0A 4HUFA 4O5BA 3P5JA 3WNGA 1TL3A 3SNNA 4DSLA 1D8YA 3AA2A 1KVCA 3AO1A 4DU4A 3S3MA 1TKTA 4CEOA 2OPQA 1BI4A 2E6MA 3SI6A 4PA1A 4CHNA 2XO7A 2B5JA 1HNVA 3ULDA 1CXUA 1NK8A 2RF2A 1J5OA 1JL1A 3HYFA 4B8CA 2FBXA 4ELUA 3CM6A 3RMDA 4GVMA 4DU3A 4CJKA 3SV4A 3O3GA 5HROA 3KKRA 5T7BA 1S1UA 3AVNA 4ELTA 4AHSA 4E89A 3RR8A 3KK1A 5E41A 1FKOA 3HSTB 1REVA 4IBNA 3NGZA 1HQUA 4CJRA 4CJFA 4JRPA 3S3NA 1GOCA 2BANA 4O0JA 1TK8A 4EZ9A 4CFDA 3VQ5A 1C1CA 4DQRA 1JLQA 2KZMA 1A5VA 4DU1A 2F8SA 2B4JA 4B9TA 1HJRA 1B9FA 2XY6A 4AH9A 3DI6A 4M3UA 2VWKA 3V4IA 4TSXA 4B9SA 4E0DA 2G8HA 1CXQA 1RDDA 4DF8A 1LWFA 3P83D 3ZSQA 3S9HA 3BDPA 5SZTA 4CJEA 5HLFA 4F2SA 3L2QA 1SKWA 2VG5A 2JLEA 3KLFA 3SQ4A 1NKEA 4CF1A 4OKEA 3K5LA 2QKKA 1TGOA 1RBSA 4MQ3A 1UAXA 3DLBA 2F96A 3KK3A 1T8EA 3VQ9A 2FBYA 4HUEA 1BISA 4N56A 3LPTA 4KO0A 4Z4CA 3TAFA 3LALA 4G1QA 4AHTA 4DQSA 5J2MA 3HK2A 1ZBHA 1WNSA 3RRGA 3RMBA 3LAMA 4B9LA 3MEEA 1VSJA 3LAKA 4FZZA 3OS1A 1TV6A 5CY4A 3AV9A 4ZTFA 3OYMA 2KQ2A 3KK2A 1TAQA 1RT3A 1LWCA 4Y1DA 4R5PA 3OJSA 4KHUA 4CESA 3U6FA 3AVMA 3SV3A 4CCHA 4CEEA 4DTNA 4OLBA 3HL8A 1L3SA 1S1XA 3K5NA 4DS4A 4M42A 2I5JA 3SUNA 4LH5A 4RW7A 3TAMA 2KFZA 3ZSZA 3SUOA 4KTQA 4RG8A 1FK9A 3ZT2A 1J9AA 1N6QA 3TAPA 4FYDA 2HNYA 4XIUA 1ASUA 1I39A 4CJLA 3AVKA 3LP0A 5KRSA 1GOAA 4IDKA 3OYLA 4FW1A 4OGEA 2E6LA 1S1TA 2OPSA 1NKCA 4W5QA 3AVLA 4I9LA 2YKNA 4W5RA 4DQPA 2HNZA 3L2UA 4DLEA 1KFDA 1QQCA 4CHPA 4E7LA 4BE1A 1RT6A 1SV5A 4Z4FA 2DY4A 2OPRA 3PX6A 1DTQA 3EY1A 2G8KA 4CHZA 4CJVA 4FVMA 1UA1A 3RR7A 3KIOA 3JSMA 2G8IA 1KVAA 4E7HA 1BIUA 4F3TA 4Z4IA 2OPPA 1A5XA 5KTQA 1D5AA 1S6PA 1JLEA 4ID1A 2RPIA 4KHSA 3D0PA 1BCOA 2X6SA 4YFUA 1ZYQA 1RILA 1RTIA 1NJZA 4KREA 2LSNA 3ZSRA 4CEDA 3O4NA 4FM1A 1WAJA 3PO4A 4M3XA 4CECA 4FLVA 2X78A 4H4MA 3AO5A 4HCCA 4DTXA 4FK4A 1A5WA 3OYEA 3TR8A 1TKZA 2YNGA 3DLEA 4LH4A 5SWMA 5CYMA 4CFCA 3SUQA 2QXFA 4CJQA 3G0ZA 4KHWA 3D45A 1RBUA 4QCLA 2AJQA 4BDZA 3IAYA 4NCBA 1DTTA 1WSFA 1N5YA 4C8MA 4Z4HA 1VSMA 1RBVA 4CHYA 4JLHA 1S6QA 2ETJA 1JKHA 3NDKA 1WLJA 4NYFA 3K59A 4CIEA 3QEVA 1KCFA 2X6NA 3HPHA 2KW4A 4NCGA 1IG9A 4KHQA 3QEXA 1RCHA 1VSDA 4AHUA 3AVFA 1SL2A 4CE9A 1CLQA 2PZSA 2YNFA 2Q3SA 4I2QA 4MFBA 4DTOA 3V1RA 1QSLA 4OPJA 3NF6A 1S9GA 3KLGA 1BIZA 3L2WA 1C0MA 5HBMA 1EX4A 3M8SA 3V9UA 3TAEA 2PYJA 4C8NA 3QNNA 3ZT0A 3ZSYA 1ASVA 4KB1A 3QIOA 1WN7A 3AVGA 5KRTA 3C6UA 1B9DA 3VQAA 3ASMA 4H8KA 1L5UA 4M3WA 4CJSA 3AO4A 4JS5A 4B9UA 4DFMA 1SKRA 1KSPA 3TAGA 3KLIA 1B92A 2KZZA 2RKIA 3CFPA 3TABA 2YKMA 1WSGA 4W5OA 4B3OA 2Z1HA 2HVIA 4NCAA 4BWJA 4W5TA 3NH0A 5J1EA 3TWHA 1LWEA 3DOKA 1IKXA 4HHTA 4DFKA 4HUGA 3SPZA 2G8UA 4C8KA 1IH7A 4DS5A 2HHWA 3L2RA 3O3FA 4KTWA 4AHRA 4BWMA 1IKVA 4Y1CA 4C8OA 3M8QA 4QAGA 3QEPA 4GW6A 4GMJB 4ELVA 4J2EA 3ITHA 1HYSA 3ISNC 1VSIA 1J53A 1K6YA 3MEDA 1WSIA 3U3GA 4B8AB 3C6TA 3NHGA 4QOZB 2FBVA 3ALYA 4HTUA 3QNOA 1LAWA 1RNHA 2IDOA 3HT3A 4OVLA 1VRTA 2OZMA 4O0IA 1QSYA 1NK4A 3T19A 4FJJA 3AA5X 4CGHA 4KTZA 1FKPA 1X9MA 2JGUA 5DMRA 3K57A 2ATQA 4RW9A 5HRRA 4CJTA 1QS4A 1ZBFA 3DOLA 4ID5A 3VQ7A 3SJJA 2YHAA 3AA3A 4LSLA 1Q8IA 5JS2A 1UWBA 3ZSWA 2XY5A 1C1AA 3K5OA 2G8FA 1U49A 1NJYA 4RW4A 4PY5A 2W42A 3OYCA 4FJ9A 4AHVA 4L8RB 3WNEA 4IG3A 3E01A 3EZ5A 3PX4A 1Z26A 4DTSA 1RBTA 4IG0A 3NH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G10 A;  3LAN A;  3RRH A;  4Z0U A;  3IG1 A;  3KKS A;  4FLT A;  5KI6 A;  3DLG A;  4O55 A;  4Z4E A;  3P1G A;  4OLA A;  3CYM A;  1Y97 A;  3U3Y A;  2O4I A;  4CHQ A;  4FJ8 A;  2HHQ A;  4K8X A;  3NBP A;  1TL1 A;  1HYZ A;  3VQ8 A;  3NH1 A;  4CF0 A;  3V9S A;  1R0A A;  2B6A A;  3V1O A;  4PQU A;  5FRO A;  1BI4 B;  1S1V A;  3LWL A;  3OYA A;  5CZ2 A;  1RT5 A;  4NYN A;  1CZB A;  4EP4 A;  3BGR A;  3PUF A;  2ITG A;  4FLZ A;  1BGX T;  2YHB A;  1Z25 A;  4FCY A;  4E7K A;  5CZ1 A;  1S9E A;  2YNH A;  3K5M A;  2DFF A;  1JLG A;  4DMN A;  2Z1J A;  4AHC A;  4KHN A;  4M3Z A;  1RDA A;  5EU7 A;  1RT7 A;  1KRP A;  3LWM A;  1W0H A;  3VA3 A;  1U04 A;  3DLK A;  3SZ2 A;  4IFY A;  1EET A;  2D5R A;  3L2V A;  3RMC A;  2QK9 A;  4CER A;  1UA0 A;  4Q5V A;  4F3O A;  4W5N A;  4J2D A;  3VQB A;  3VQP A;  3ZT1 A;  5J2P A;  4EP5 A;  1ITG A;  3HPG A;  2O4G A;  1KFS A;  1RDB A;  4DTM A;  4KI4 A;  3MEC A;  3ZCM A;  2HHU A;  4CEF A;  4CFB A;  3M8R A;  3MAQ A;  3DRR A;  1LV5 A;  3L3V A;  4FM2 A;  5FRM A;  2F8T A;  4FLW A;  2KFN A;  1LW2 A;  3SQ0 A;  5C25 A;  3PV8 A;  3NCI A;  3DRP A;  1L3U A;  1JL2 A;  3EYZ A;  4RW8 A;  1JLF A;  1WSH A;  3SQ2 A;  4ZTJ A;  3LP1 A;  3QEI A;  4F8R A;  4K8Z A;  3B6P A;  4BDY A;  4J2A A;  4RW6 A;  4B9N A;  3B6O A;  1VSH A;  3OYH A;  3PO5 A;  3RWU A;  4E19 A;  4WE1 A;  4F4K A;  4CGG A;  1XWL A;  4DQI A;  4H4O A;  4KAZ A;  2HHX A;  1Q9X A;  3LPU A;  2G8V A;  1EXQ A;  4I9Q A;  3FFI A;  1C6V A;  2HB5 A;  3OYK A;  4B08 A;  3NE6 A;  2HHS A;  2VG6 A;  1D9D A;  4KPY A;  1T03 A;  4CK2 A;  4C8L A;  4KB0 A;  4E3S A;  3RMA A;  4M3T A;  4DG1 A;  3VQD A;  3C94 A;  1DLO A;  4CJP A;  4AIL C;  4HCB A;  4FK0 A;  1RT2 A;  3AA4 A;  4KKO A;  1O1W A;  1BQM A;  4CJ3 A;  4CFA A;  5HRP A;  4DF4 A;  4PUO A;  3NGI A;  4CK3 A;  2XY8 A;  3PX0 A;  3OYB A;  3OYF A;  4DQQ A;  1NOZ A;  3KTQ A;  3DYA A;  3HJF A;  2IS3 A;  1IKW A;  1ASW A;  1KVB A;  3QER A;  5C24 A;  2ZD1 A;  3NGY A;  1WAF A;  1ZBI A;  3VN5 A;  2DTU A;  2Z1G A;  2YV0 X;  5K14 A;  2VG7 A;  3NF9 A;  4N5S A;  3QLH A;  2XY7 A;  3KLH A;  4B9M A;  4FJM A;  2Z1I A;  3HM9 A;  1VSF A;  4FJK A;  3NAE A;  3S3O A;  1UOC A;  1JLA A;  1VSL A;  1TVR A;  3LZJ A;  4FJL A;  4FXD A;  4IKF A;  3NF7 A;  2EHG A;  3HP6 A;  5JS1 A;  3QIP A;  3MEG A;  3HXM A;  3ZSX A;  2DFE A;  1KLM A;  2X74 A;  3THV A;  3WNH A;  3IS9 A;  3SCX A;  3HP9 A;  4KRF A;  4LD0 A;  5HP1 A;  3TAR A;  1JXB A;  4KFB A;  1QTM A;  5KGX A;  4DTP A;  3KJV A;  3KD1 E;  1SL0 A;  1ZBL A;  4CEA A;  1XHX A;  2XHB A;  1JLB A;  1NJX A;  3AVA A;  1LAV A;  2IOC A;  4PWD A;  3UIQ A;  1SKS A;  2DFH A;  2IGI A;  3OYI A;  1YT3 A;  3OJU A;  3SPY A;  4FJ7 A;  4CGD A;  4LY7 A;  3ZSV A;  4FJX A;  3F9K A;  3AVH A;  3TAQ A;  2G8W A;  5FRN A;  3O4Q A;  3SUP A;  1C0T A;  2P1J A;  3VQC A;  3HO1 A;  3VQ6 A;  5J2Q A;  4O44 A;  4FM0 A;  3C95 A;  3V81 A;  3LZI A;  1U48 A;  3AVC A;  3KLE A;  4M41 A;  2WOM A;  5C42 A;  1EP4 A;  3AVJ A;  4OKK A;  4M3R A;  1BL3 A;  3QES A;  2ZE2 A;  3SQ1 A;  1X1P A;  1QHT A;  3DRS A;  1C0U A;  3V9W A;  5I42 A;  2P5O A;  4F2R A;  4KI6 A;  4CEB A;  1JLC A;  2A1S A;  4HVJ A;  1RTD A;  3F73 A;  4DSK A;  2FC0 A;  3M8P A;  1TKX A;  3CQ8 A;  1LW0 A;  1RDC A;  1RTJ A;  4JRQ A;  2OYQ A;  5DK5 A;  2GV9 A;  2BGG A;  3MXJ A;  2D0C A;  2HHV A;  4CIF A;  1FXX A;  4IFV A;  2WON A;  4Z4G A;  3V9X A;  5KGW A;  3NF8 A;  4OGC A;  3T3F A;  1EKE A;  1U45 A;  4BDP A;  4FJI A;  3L8B A;  1I3A A;  2GBZ A;  4FZX C;  4CJ4 A;  3ZT3 A;  4DFJ A;  2A1R A;  1RT4 A;  3OYD A;  1NJW A;  1NK9 A;  3RTV A;  1TAU A;  3OYJ A;  4FW2 A;  4FJG A;  1HNI A;  4M45 A;  3I0S A;  3QO9 A;  1ZBU A;  1F21 A;  5J2N A;  3MXM A;  4FZY A;  2QKB A;  5CYQ A;  1GOB A;  3DM2 A;  3NFA A;  3WNF A;  4J2B A;  4FK2 A;  3AO3 A;  2ZQB A;  3MXI A;  1J54 A;  3T1A A;  1KLN A;  4I2P A;  4CJW A;  4FJN A;  1VK0 A;  2P51 A;  3VQQ A;  3OYN A;  3TI0 A;  2OZS A;  1HRH A;  3AVI A;  4OKJ A;  4FJ5 A;  1W9H A;  4FJH A;  4FLY A;  4DTU A;  2Y1J A;  4CEQ A;  4FLU A;  4E1N A;  3OYG A;  3TAN A;  5I3U A;  4CF8 A;  2KTQ A;  4YNQ A;  1QE1 A;  4BE2 A;  4DTJ A;  3ZT4 A;  4E1M A;  3V1Q A;  4BAC A;  1NK0 A;  3OY9 A;  3CFR A;  2IAJ A;  4CEZ A;  1VRU A;  3ZSO A;  5HRN A;  1XC9 A;  1TKD A;  3DLR A;  4M3Y A;  3HVR A;  1T7P A;  5D3G A;  3H08 A;  4CGF A;  1X9S A;  4Q0B A;  3LP3 A;  4CGI A;  1U4B A;  1T05 A;  2XRI A;  1L3V A;  1S1W A;  3DMJ A;  4CJU A;  4CK1 A;  4E7J A;  3VQ4 A;  1HYV A;  3LDS A;  4DSJ A;  4DSI A;  1SUQ A;  5HRS A;  1U47 A;  3QEW A;  2GUI A;  2NUB A;  2BDP A;  1YVU A;  3K2P A;  1NOY A;  2E4L A;  2EX3 A;  1IKY A;  3AO2 A;  4DSF A;  2OA8 A;  2IC3 A;  2HW3 A;  1BCM A;  3I0R A;  1HMV A;  5FDL A;  4CF2 A;  1RTH A;  3KD5 E;  3IRX A;  1X9W A;  4UQG A;  1KTQ A;  3HVT A;  1Q9Y A;  1RT1 A;  2D0B A;  1L3T A;  3QIN A;  4DLG A;  2HVH A;  2PY5 A;  1WSE A;  4DSE A;  2HMI A;  4CHO A;  1HQE A;  2BE2 A;  1D9F A;  1SL1 A;  1TK5 A;  1JXE A;  3A2F A;  2P5G A;  1IO2 A;  2FBT A;  3VQE A;  1XI1 A;  1WSJ A;  4KV8 A;  3HPO A;  2Y1I A;  1XHZ A;  1NK6 A;  2HHT A;  3AVB A;  4ICL A;  3K58 A;  1QSS A;  4DTR A;  1TK0 A;  1G15 A;  3JYT A;  4N41 A;  2HND A;  1BQN A;  3LP2 A;  4CF9 A;  3OS2 A;  3CG7 A;  4CJ5 A;  4OPK A;  2VWJ A;  3V9Z A;  1RBR A;  4E7I A;  1NK5 A;  3PY8 A;  1C1B A;  3VA0 A;  1CZ9 A;  4OJR A;  1YTU A;  1YTA A;  2YNI A;  4ZHR A;  3OVN A;  4O4G A;  3I8D A;  4JS4 A;  4DWI A;  4CIG A;  2D0A A;  3DLH A;  1BHL A;  1HPZ A;  4EZ6 A;  3QET A;  1NKB A;  3CM5 A;  2PYL A;  3SYZ A;  1MU2 A;  2RN2 A;  3O3H A;  2R7Y A;  4N47 A;  4N76 A;  4FLX A;  4I7F A;  3V6D A;  1S5J A;  3L3U A;  4B9V A;  1VSE A;  3CFO A;  3OS0 A;  4KHY A;  4CGJ A;  1NK7 A;  1VSK A;  4LSN A;  4DFP A;  4BE0 A;  4HUF A;  4O5B A;  3P5J A;  3WNG A;  1TL3 A;  3SNN A;  4DSL A;  1D8Y A;  3AA2 A;  1KVC A;  3AO1 A;  4DU4 A;  3S3M A;  1TKT A;  4CEO A;  2OPQ A;  1BI4 A;  2E6M A;  3SI6 A;  4PA1 A;  4CHN A;  2XO7 A;  2B5J A;  1HNV A;  3ULD A;  1CXU A;  1NK8 A;  2RF2 A;  1J5O A;  1JL1 A;  3HYF A;  4B8C A;  2FBX A;  4ELU A;  3CM6 A;  3RMD A;  4GVM A;  4DU3 A;  4CJK A;  3SV4 A;  3O3G A;  5HRO A;  3KKR A;  5T7B A;  1S1U A;  3AVN A;  4ELT A;  4AHS A;  4E89 A;  3RR8 A;  3KK1 A;  5E41 A;  1FKO A;  3HST B;  1REV A;  4IBN A;  3NGZ A;  1HQU A;  4CJR A;  4CJF A;  4JRP A;  3S3N A;  1GOC A;  2BAN A;  4O0J A;  1TK8 A;  4EZ9 A;  4CFD A;  3VQ5 A;  1C1C A;  4DQR A;  1JLQ A;  2KZM A;  1A5V A;  4DU1 A;  2F8S A;  2B4J A;  4B9T A;  1HJR A;  1B9F A;  2XY6 A;  4AH9 A;  3DI6 A;  4M3U A;  2VWK A;  3V4I A;  4TSX A;  4B9S A;  4E0D A;  2G8H A;  1CXQ A;  1RDD A;  4DF8 A;  1LWF A;  3P83 D;  3ZSQ A;  3S9H A;  3BDP A;  5SZT A;  4CJE A;  5HLF A;  4F2S A;  3L2Q A;  1SKW A;  2VG5 A;  2JLE A;  3KLF A;  3SQ4 A;  1NKE A;  4CF1 A;  4OKE A;  3K5L A;  2QKK A;  1TGO A;  1RBS A;  4MQ3 A;  1UAX A;  3DLB A;  2F96 A;  3KK3 A;  1T8E A;  3VQ9 A;  2FBY A;  4HUE A;  1BIS A;  4N56 A;  3LPT A;  4KO0 A;  4Z4C A;  3TAF A;  3LAL A;  4G1Q A;  4AHT A;  4DQS A;  5J2M A;  3HK2 A;  1ZBH A;  1WNS A;  3RRG A;  3RMB A;  3LAM A;  4B9L A;  3MEE A;  1VSJ A;  3LAK A;  4FZZ A;  3OS1 A;  1TV6 A;  5CY4 A;  3AV9 A;  4ZTF A;  3OYM A;  2KQ2 A;  3KK2 A;  1TAQ A;  1RT3 A;  1LWC A;  4Y1D A;  4R5P A;  3OJS A;  4KHU A;  4CES A;  3U6F A;  3AVM A;  3SV3 A;  4CCH A;  4CEE A;  4DTN A;  4OLB A;  3HL8 A;  1L3S A;  1S1X A;  3K5N A;  4DS4 A;  4M42 A;  2I5J A;  3SUN A;  4LH5 A;  4RW7 A;  3TAM A;  2KFZ A;  3ZSZ A;  3SUO A;  4KTQ A;  4RG8 A;  1FK9 A;  3ZT2 A;  1J9A A;  1N6Q A;  3TAP A;  4FYD A;  2HNY A;  4XIU A;  1ASU A;  1I39 A;  4CJL A;  3AVK A;  3LP0 A;  5KRS A;  1GOA A;  4IDK A;  3OYL A;  4FW1 A;  4OGE A;  2E6L A;  1S1T A;  2OPS A;  1NKC A;  4W5Q A;  3AVL A;  4I9L A;  2YKN A;  4W5R A;  4DQP A;  2HNZ A;  3L2U A;  4DLE A;  1KFD A;  1QQC A;  4CHP A;  4E7L A;  4BE1 A;  1RT6 A;  1SV5 A;  4Z4F A;  2DY4 A;  2OPR A;  3PX6 A;  1DTQ A;  3EY1 A;  2G8K A;  4CHZ A;  4CJV A;  4FVM A;  1UA1 A;  3RR7 A;  3KIO A;  3JSM A;  2G8I A;  1KVA A;  4E7H A;  1BIU A;  4F3T A;  4Z4I A;  2OPP A;  1A5X A;  5KTQ A;  1D5A A;  1S6P A;  1JLE A;  4ID1 A;  2RPI A;  4KHS A;  3D0P A;  1BCO A;  2X6S A;  4YFU A;  1ZYQ A;  1RIL A;  1RTI A;  1NJZ A;  4KRE A;  2LSN A;  3ZSR A;  4CED A;  3O4N A;  4FM1 A;  1WAJ A;  3PO4 A;  4M3X A;  4CEC A;  4FLV A;  2X78 A;  4H4M A;  3AO5 A;  4HCC A;  4DTX A;  4FK4 A;  1A5W A;  3OYE A;  3TR8 A;  1TKZ A;  2YNG A;  3DLE A;  4LH4 A;  5SWM A;  5CYM A;  4CFC A;  3SUQ A;  2QXF A;  4CJQ A;  3G0Z A;  4KHW A;  3D45 A;  1RBU A;  4QCL A;  2AJQ A;  4BDZ A;  3IAY A;  4NCB A;  1DTT A;  1WSF A;  1N5Y A;  4C8M A;  4Z4H A;  1VSM A;  1RBV A;  4CHY A;  4JLH A;  1S6Q A;  2ETJ A;  1JKH A;  3NDK A;  1WLJ A;  4NYF A;  3K59 A;  4CIE A;  3QEV A;  1KCF A;  2X6N A;  3HPH A;  2KW4 A;  4NCG A;  1IG9 A;  4KHQ A;  3QEX A;  1RCH A;  1VSD A;  4AHU A;  3AVF A;  1SL2 A;  4CE9 A;  1CLQ A;  2PZS A;  2YNF A;  2Q3S A;  4I2Q A;  4MFB A;  4DTO A;  3V1R A;  1QSL A;  4OPJ A;  3NF6 A;  1S9G A;  3KLG A;  1BIZ A;  3L2W A;  1C0M A;  5HBM A;  1EX4 A;  3M8S A;  3V9U A;  3TAE A;  2PYJ A;  4C8N A;  3QNN A;  3ZT0 A;  3ZSY A;  1ASV A;  4KB1 A;  3QIO A;  1WN7 A;  3AVG A;  5KRT A;  3C6U A;  1B9D A;  3VQA A;  3ASM A;  4H8K A;  1L5U A;  4M3W A;  4CJS A;  3AO4 A;  4JS5 A;  4B9U A;  4DFM A;  1SKR A;  1KSP A;  3TAG A;  3KLI A;  1B92 A;  2KZZ A;  2RKI A;  3CFP A;  3TAB A;  2YKM A;  1WSG A;  4W5O A;  4B3O A;  2Z1H A;  2HVI A;  4NCA A;  4BWJ A;  4W5T A;  3NH0 A;  5J1E A;  3TWH A;  1LWE A;  3DOK A;  1IKX A;  4HHT A;  4DFK A;  4HUG A;  3SPZ A;  2G8U A;  4C8K A;  1IH7 A;  4DS5 A;  2HHW A;  3L2R A;  3O3F A;  4KTW A;  4AHR A;  4BWM A;  1IKV A;  4Y1C A;  4C8O A;  3M8Q A;  4QAG A;  3QEP A;  4GW6 A;  4GMJ B;  4ELV A;  4J2E A;  3ITH A;  1HYS A;  3ISN C;  1VSI A;  1J53 A;  1K6Y A;  3MED A;  1WSI A;  3U3G A;  4B8A B;  3C6T A;  3NHG A;  4QOZ B;  2FBV A;  3ALY A;  4HTU A;  3QNO A;  1LAW A;  1RNH A;  2IDO A;  3HT3 A;  4OVL A;  1VRT A;  2OZM A;  4O0I A;  1QSY A;  1NK4 A;  3T19 A;  4FJJ A;  3AA5 X;  4CGH A;  4KTZ A;  1FKP A;  1X9M A;  2JGU A;  5DMR A;  3K57 A;  2ATQ A;  4RW9 A;  5HRR A;  4CJT A;  1QS4 A;  1ZBF A;  3DOL A;  4ID5 A;  3VQ7 A;  3SJJ A;  2YHA A;  3AA3 A;  4LSL A;  1Q8I A;  5JS2 A;  1UWB A;  3ZSW A;  2XY5 A;  1C1A A;  3K5O A;  2G8F A;  1U49 A;  1NJY A;  4RW4 A;  4PY5 A;  2W42 A;  3OYC A;  4FJ9 A;  4AHV A;  4L8R B;  3WNE A;  4IG3 A;  3E01 A;  3EZ5 A;  3PX4 A;  1Z26 A;  4DTS A;  1RBT A;  4IG0 A;  3NH2 A; 
#chains in the Genus database with same CATH topology
 3LAN A;  3RRH A;  4FLT A;  4Z4E A;  4PKI A;  3DLL L;  5F1X A;  1VQ5 N;  2HHQ A;  1LOT B;  1TL1 A;  4IOA L;  1HPM A;  4JK8 A;  3E9L A;  2B6A A;  3V1O A;  3WT0 A;  3THY B;  3LWL A;  5AQR A;  1CZB A;  2NRT A;  2ITG A;  4FLZ A;  1MWK A;  5DM7 L;  2ASO A;  1Z25 A;  3R8E A;  5CZ1 A;  3CCJ N;  2YNH A;  2DFF A;  4BRQ A;  1W0H A;  1U04 A;  3BZC A;  1EET A;  2QI2 A;  4J2D A;  1SS6 A;  3VQB A;  1JCE A;  3HPG A;  1RDB A;  4CEF A;  3M8R A;  3DRR A;  3ZEU B;  5FRM A;  4H5T A;  2F8T A;  3PSI A;  3SQ0 A;  5C25 A;  1L3U A;  1KQS M;  4H0X B;  1JLF A;  1WSH A;  1T6C A;  1MA9 B;  4K8Z A;  5EOY A;  4BDY A;  4RW6 A;  4B9N A;  3B6O A;  1GLE G;  4WE1 A;  3GBT A;  4CGG A;  4BGA A;  4DQI A;  5AQO A;  1Q9X A;  3LPU A;  1KAY A;  3FFI A;  3NE6 A;  3OYK A;  3P31 A;  2QWO A;  4CVN E;  3VEN A;  1VAZ A;  4C8L A;  1BDG A;  1KC8 O;  1DLO A;  3M6G A;  4HCB A;  1RT2 A;  4CJ3 A;  4CFA A;  3AY9 A;  4X66 K;  4DQQ A;  3W3D A;  3WXK A;  2VYP A;  1IKW A;  1WBD A;  3GL1 A;  3NGY A;  1WAF A;  3E66 A;  2DTU A;  2YV0 X;  2VG7 A;  1XC3 A;  3S3O A;  1VSL A;  1TVR A;  3BP8 A;  4PHT X;  3THW A;  2GWK A;  1BA1 A;  2DFE A;  1U2V A;  2OTJ N;  4DTP A;  2O8F B;  1ZBL A;  4DV5 K;  1NJX A;  2HBL A;  3AVA A;  4IDH A;  4PWD A;  1XUP O;  3HBT A;  1SKS A;  2QTD A;  3WXM B;  2F9T A;  1KD1 O;  3WXI A;  2E8A A;  3TAQ A;  1ILY A;  5M1O A;  5FRN A;  3O4Q A;  1C0T A;  2P1J A;  3VQC A;  2I7P A;  3VQ6 A;  3V81 A;  4O44 A;  4PKH A;  3DXM A;  3ZX3 A;  3AGR A;  3CCV N;  4OKK A;  2E2Q A;  1NGI A;  4CZE A;  3GG4 A;  4LF5 K;  2HOE A;  2QW9 A;  2UXB K;  1QHT A;  4GKJ K;  3RSE B;  4H5W A;  2P5O A;  4F2R A;  4OX9 K;  2O8B B;  4IFE A;  1RTJ A;  3EKS A;  2BGG A;  2A5X A;  2HHV A;  1EQY A;  4CIF A;  4YDU A;  1U45 A;  4BDP A;  4FJI A;  1QQM A;  3L8B A;  1YAG A;  4B1W B;  4FZX C;  2A1R A;  1RT4 A;  5AQZ A;  3MXM A;  4FWN A;  5CYQ A;  1GLC G;  3WNF A;  1XMO K;  3AO3 A;  4A5A A;  3T1A A;  3CPW M;  4I2P A;  3E9O A;  4J8F A;  3OYN A;  2OZS A;  4FJH A;  2UUC K;  1E4G T;  5I3U A;  2RE2 A;  3BY5 A;  5B8H A;  1NK0 A;  4M7Y A;  1NG9 A;  2IAJ A;  2P9I A;  3ZSO A;  5D3G A;  4M3Y A;  3DLR A;  2A41 A;  1N32 K;  4H0V B;  4YDU C;  3UKR A;  5I9E B;  2Q36 A;  3CJ1 A;  3QB0 A;  5AJ3 K;  1HYV A;  1QQN A;  1SUQ A;  4JI6 K;  2NUB A;  1YVU A;  1O13 A;  1NOY A;  3T1Y K;  2IC3 A;  4H0O A;  1HMV A;  3OW2 M;  3CPE A;  3WXL A;  3QIN A;  5AQG A;  4DLG A;  4BRK A;  4FWL A;  4BR5 A;  1LCU A;  1WSE A;  1HQE A;  3CCS N;  1YVN A;  4KHP K;  3A2F A;  2HHH K;  1T6D A;  1IO2 A;  2ZWH A;  5E84 A;  1XHZ A;  1NK6 A;  2Y1I A;  2UXD K;  3AVB A;  3BZK A;  3K58 A;  1IV0 A;  1BA0 A;  3JAM O;  4DUY K;  4JKG A;  3VES A;  3LP2 A;  2NRR A;  3CG7 A;  4A2B A;  1C1B A;  1CZ9 A;  2WC9 A;  4OJR A;  3ENB A;  1YTU A;  4O4G A;  4DWI A;  3SBG A;  4CIG A;  2VQE K;  1NGB A;  3QET A;  3CM5 A;  1TYQ A;  3Q7C A;  2NZT A;  4N47 A;  3V6D A;  1H1V A;  4B9V A;  4FWS A;  1VSE A;  3CFO A;  4EFH A;  4O5B A;  1D8Y A;  1KVC A;  1TKT A;  4AF1 A;  4CHN A;  3ULD A;  2CGJ A;  3TPQ A;  1HNV A;  1CXU A;  1YHQ N;  2RF2 A;  5AQF A;  4DV0 K;  4NO7 A;  3RMD A;  5HRO A;  5T7B A;  4IOX A;  4XH5 A;  4E89 A;  3S3N A;  4IBN A;  3NGZ A;  4JRP A;  4QS8 A;  4CJF A;  3D2F B;  1TK8 A;  4EZ9 A;  1HNW K;  3VQ5 A;  1C1C A;  1NGD A;  1JLQ A;  4DU1 A;  1NGJ A;  1B9F A;  2XY6 A;  3S9H A;  2E2P A;  2JLE A;  3KLF A;  4A2A A;  3VTH A;  3K5L A;  1UAX A;  1NBW A;  1RFQ A;  3KK3 A;  1T8E A;  3VQ9 A;  2O8E B;  2YJE A;  4H03 B;  2P9U B;  4AHT A;  4DQS A;  2P9L B;  5C0Y A;  3MCA B;  3LAK A;  3MEE A;  3CC2 N;  4FZZ A;  5CY4 A;  2O8C B;  3AV9 A;  4R5P A;  4Y1D A;  4LFB K;  1ZXO A;  3VOV A;  1W97 L;  1L3S A;  4DS4 A;  4M42 A;  3SUN A;  4LH5 A;  4RW7 A;  4KH5 A;  3TAM A;  3SUO A;  4KTQ A;  4RG8 A;  1I39 A;  2QXL A;  3SLC A;  3LP0 A;  4XEI A;  2UXC K;  3OYL A;  1K8K A;  4CI6 A;  2Q31 A;  2YKN A;  4DLE A;  4E7L A;  1SV5 A;  1XNQ K;  4JEP A;  3PX6 A;  2D1K A;  4JI5 K;  4CHZ A;  1S22 A;  3JSM A;  3RVC A;  4BR7 A;  4Z4I A;  3QBX A;  1A5X A;  4BRF A;  5KTQ A;  4BRI A;  4ID1 A;  4KHS A;  1NWK A;  4YFU A;  1ZYQ A;  3VET A;  4CED A;  1NLV A;  3O9S A;  1TKZ A;  3DLE A;  5C15 A;  5MLC Q;  4CFC A;  5ADX A;  4QCL A;  4EAH D;  1NJI O;  2UUB K;  1N5Y A;  4FSV A;  4Z4H A;  4IJA A;  1VSM A;  2HMP A;  4JLH A;  1JKH A;  2VCP A;  3CCM N;  1KCF A;  2X6N A;  4NCG A;  2PZS A;  4MFB A;  3V1R A;  4OPJ A;  4JI4 K;  1I94 K;  5HBM A;  1EX4 A;  5AZJ B;  3TAE A;  2PYJ A;  3IUC A;  3QNN A;  2ZF5 O;  1QHA A;  2Q0R A;  1L5U A;  4JS5 A;  3G4S N;  3K9J A;  4B1X B;  1YJN N;  3CFP A;  4YOV A;  3QFU A;  1WSG A;  4DV1 K;  2Z1H A;  4W5T A;  3NH0 A;  1IG9 A;  4KHQ A;  1IKX A;  4DFK A;  3SPZ A;  3C6H A;  5BPL A;  4BWM A;  3AAR A;  4Y1C A;  2F9W A;  2OTL N;  3TSU A;  3PIO L;  3U3G A;  4QOZ B;  4HTU A;  2OZM A;  1LAW A;  1VRT A;  3SAH A;  4KH4 A;  1QSY A;  2OCE A;  4MO4 A;  4FJJ A;  3AA5 X;  3DJC A;  1ZBF A;  3CQX A;  4BY9 C;  5JS2 A;  2XY5 A;  3CF5 L;  4IZ9 A;  1NJY A;  4BR2 A;  2W42 A;  4FJ9 A;  4AHV A;  3WEE A;  2ASM A;  1VQ9 N;  4YY3 K;  3EZ5 A;  3SPY A;  4DTS A;  1RBT A;  4CBW A;  4IG0 A;  2V7Y A;  4B9Q A;  3KKS A;  2GEM A;  3CYM A;  1Y97 A;  3U3Y A;  4I6M B;  2O4I A;  4K8X A;  4YOU A;  3MX2 A;  1HYZ A;  3NH1 A;  3SAG A;  5FLX O;  5FRO A;  4DTM A;  5CZ2 A;  3QDK A;  2YHB A;  5BR8 K;  4LF4 K;  2KKZ A;  4FCY A;  4E7K A;  1S9E A;  2QWN A;  1JLG A;  4DMN A;  1RT7 A;  3IDH A;  3VA3 A;  3DLK A;  2QK9 A;  4BC2 A;  5ELZ A;  1J6Z A;  2O4G A;  1KFS A;  4KI4 A;  4JKC A;  4GV9 A;  4FLW A;  2KFN A;  1LW2 A;  3FZF A;  3PV8 A;  3VPZ A;  3EYZ A;  4WYB A;  3TSQ A;  4RW8 A;  3PLA A;  4IOC L;  3SQ2 A;  4WQ4 A;  4ZTJ A;  3QEI A;  4DV3 K;  4LC9 B;  4YHH K;  3VER A;  1VSH A;  2FSJ A;  4BVP A;  2GTD A;  3OYH A;  3SK3 A;  2E1Y A;  4E19 A;  3J81 O;  1VQ4 N;  3CC4 N;  1D9D A;  4KPY A;  4E3S A;  3RMA A;  4M3T A;  1Q82 O;  3VQD A;  3C94 A;  4AIL C;  4RTF D;  2WUS A;  4DF4 A;  2Q2R A;  2CGK A;  5LJV A;  2XY8 A;  4IO8 A;  3OYF A;  3KHY A;  4LF6 K;  1IBK K;  3TTD A;  1KVB A;  1M90 O;  5C24 A;  4JI1 K;  3C65 A;  3VN5 A;  2Z1G A;  3MMV A;  3QLH A;  4FJM A;  3M5R A;  4FJK A;  2VGN A;  3ULE B;  2EHG A;  3HP6 A;  5JS1 A;  4L3Q A;  3HXM A;  1KLM A;  2X74 A;  2E5L K;  3IS9 A;  3HP9 A;  4BRC A;  4KRF A;  5LMU K;  5BN9 A;  5HP1 A;  1QTM A;  1JXB A;  4KFB A;  2P9P B;  4HTL A;  1SL0 A;  1XHX A;  4IXC A;  4X65 K;  5M1Q A;  4WFB L;  1VQ7 N;  1VHX A;  3VGK A;  4BRL A;  2BUP A;  3OYI A;  3OJU A;  4CGD A;  2Q0U A;  4LY7 A;  1C0G A;  3THX A;  3N4Q A;  3F9K A;  5GAD P;  3AVH A;  1DKG D;  2D0O A;  2FF3 B;  4FM0 A;  3MWT A;  3F2K A;  5C42 A;  1EP4 A;  1P90 A;  4PKG A;  5CHI A;  3AAP A;  4M3R A;  3QES A;  1HX1 A;  4BRA A;  4CEB A;  1RTD A;  3BF3 A;  3CQ8 A;  4JRQ A;  1RDC A;  5DK5 A;  2GV9 A;  5FPE A;  3MXJ A;  4YOW A;  2HBM A;  2NRH A;  3H46 O;  1GLL O;  1HJO A;  3NF8 A;  4NLB A;  5AQU A;  3J8A A;  2ZGZ A;  1ATS A;  5EY4 A;  3EO3 A;  3ZT3 A;  1NJW A;  2P9N B;  3OYJ A;  4FW2 A;  4FJG A;  4M45 A;  3C7N B;  3H3O B;  1F21 A;  1HR0 K;  2FSK A;  4B3R K;  5TKW A;  1GOB A;  3DM2 A;  3NFA A;  1P8Z A;  4FK2 A;  4JHD B;  2ZQB A;  3FFK B;  4JKD A;  1J54 A;  4CJW A;  3O9R A;  4FJN A;  4Z4G A;  2P51 A;  3VQQ A;  2KTQ A;  5BRE A;  1WB9 A;  1HRH A;  3AVI A;  4FJ5 A;  4FLY A;  2QA4 N;  4FWR A;  4CEQ A;  3HOS A;  2VWB A;  3O9Q A;  2ASP A;  3L6Q A;  4JI8 K;  4FVU A;  3ZT4 A;  4DB3 A;  4HWI A;  3OY9 A;  2E88 A;  5HRN A;  4CZK A;  1XC9 A;  1NGA A;  1DT9 A;  2NRX A;  3H08 A;  4K42 A;  4CGF A;  3LP3 A;  1U4B A;  1L3V A;  4JD2 B;  3DMJ A;  3D2E A;  3CCE N;  2VQF K;  1T3V A;  1NGC A;  2FF6 A;  1NGG A;  4B1Z A;  3LDS A;  2O8D A;  2YHX A;  5HRS A;  3A8Y A;  3QEW A;  3CJ9 A;  4BQZ A;  3WQU A;  5AQK A;  2E4L A;  4DSF A;  2OA8 A;  3CJA A;  3P4I A;  5FDL A;  4CF2 A;  3JXU A;  3KD5 E;  1RDU A;  1KTQ A;  1Q9Y A;  3CMA N;  3OBY A;  4X62 K;  2YHW A;  3VEV A;  3C0B A;  2HVH A;  4CHO A;  1D9F A;  3DXK A;  1SL1 A;  1TK5 A;  3EEQ A;  3J7A P;  2CGL A;  2P5G A;  4JKF A;  3EZW A;  1XI1 A;  4KV8 A;  2HHT A;  1QSS A;  3VEO A;  1G15 A;  3JYT A;  3V9Z A;  1NK5 A;  1IG8 A;  1XNR K;  3ZYY X;  3CER A;  3P39 A;  2FXU A;  2YNI A;  4DR7 K;  3HOT A;  1Q86 O;  3DLH A;  4CW7 B;  2RN2 A;  3O3H A;  3MWP A;  2P9S B;  1QQO A;  1KXP A;  3OS0 A;  3CET A;  4CGJ A;  4LSN A;  4WQ5 A;  4BE0 A;  2WBN A;  4HUF A;  3WNG A;  5LY3 A;  4DSL A;  5KPT A;  3CD6 N;  4LF8 K;  1ZC6 A;  3THY A;  4PA1 A;  1NK8 A;  1TUY A;  3SMP A;  1Y64 A;  3HYF A;  4OPA A;  4B8C A;  4ELU A;  5AZI B;  3G6E N;  3SV4 A;  5C12 A;  1S1U A;  3AVN A;  3J7Y P;  3RR8 A;  5E41 A;  3HST B;  3MN5 A;  4CFD A;  1FJG K;  4GKK K;  3A5O C;  1A5V A;  3MDQ A;  2F8S A;  1W7A A;  1T44 A;  3ZEU A;  4NB4 A;  4B9S A;  3I8B A;  2G8H A;  3FZH A;  4CBX A;  4EHU A;  5HLF A;  4F2S A;  1X3M A;  1SKW A;  3O4W A;  1NKE A;  4CF1 A;  5JIC A;  4HUE A;  4YOR A;  5M1P A;  5TKY A;  4KO0 A;  3TAF A;  3LAL A;  4G1Q A;  3VEZ A;  1XQS C;  3CJ7 A;  3RRG A;  3RMB A;  4B9L A;  2JWK A;  3OS1 A;  4ZTF A;  3EKU A;  3B8A X;  2KQ2 A;  3OYM A;  3KK2 A;  1TAQ A;  1LWC A;  1QZ6 A;  4CCH A;  4K43 A;  2GUP A;  1QZ5 A;  1FK9 A;  3ZT2 A;  5BPM A;  5LL6 Z;  4CJL A;  3L0Q A;  3VF2 A;  4FW1 A;  1NKC A;  3AVL A;  4I9L A;  4DQP A;  2HST A;  2HNZ A;  3L2U A;  4BE1 A;  2OPR A;  1DTQ A;  3EN9 A;  4E7H A;  4F3T A;  1BIU A;  2O8F A;  2RPI A;  1BCO A;  2X6S A;  4KRE A;  3H6E A;  1WAJ A;  4CZF A;  4CEC A;  4FLV A;  2BH1 A;  2X78 A;  3AO5 A;  4DTX A;  4DUZ K;  1CZA N;  1A5W A;  4B3T K;  2YNG A;  4UY8 O;  5SWM A;  5DM6 L;  5CYM A;  3SUQ A;  2QXF A;  4CJQ A;  5C2D A;  1RBU A;  4BDZ A;  3IAY A;  2AP1 A;  3R3L A;  1Z05 A;  2P9K B;  3UKU B;  1RBV A;  4CHY A;  2ETJ A;  3NDK A;  4NYF A;  3K59 A;  4BRD A;  1YJW N;  2KW4 A;  4B3S K;  1WOQ A;  3AVF A;  1SL2 A;  4MO5 A;  3H1Q A;  3LM2 A;  1CLQ A;  3RSE A;  2IVO A;  4DTO A;  4IJN A;  2O8B A;  3ID8 A;  1S9G A;  3KLG A;  3L2W A;  1C0M A;  1VQO N;  3FGU A;  4WFA L;  1ASV A;  4KB1 A;  3QIO A;  1KAX A;  3AVG A;  3C6U A;  3VQA A;  4CJS A;  3AO4 A;  1KSP A;  1B92 A;  4YOT A;  2KZZ A;  3VEW A;  2HVI A;  2HBK A;  3TWH A;  1LWE A;  3DOK A;  4HHT A;  2HHW A;  2ZGY A;  5IWA K;  1IKV A;  4J2E A;  3M8Q A;  3QEP A;  1HYS A;  5AQW A;  1VQK N;  3MN9 A;  1J53 A;  4RWT A;  1WSI A;  3VTI A;  4BRO A;  4B8A B;  2W6K A;  3QNO A;  1RNH A;  2IDO A;  3LDQ A;  3HT3 A;  4O0I A;  4BRH A;  2QWL A;  4BRG A;  5AQX A;  1BUP A;  5HRR A;  4ID5 A;  3DOL A;  3G25 A;  3ID6 A;  3AA3 A;  4LSL A;  1Q8I A;  1ATN A;  3ZSW A;  4Z94 A;  3I56 N;  3TSP A;  1C1A A;  3K5O A;  1U49 A;  3NVK A;  3UE5 A;  5HOO A;  2V52 B;  4IEI A;  3E01 A;  3PX4 A;  1Z26 A;  3MK6 A;  3IG1 A;  1JCF A;  3DLG A;  5M1N A;  1K9M O;  3O1B A;  5AQV A;  3W0L A;  2ZJQ L;  4CF0 A;  4PQU A;  3D7E O;  1BI4 B;  3H45 C;  1J5E K;  4F8R A;  4OO1 J;  1RT5 A;  3WXJ A;  4EP4 A;  3BGR A;  4BR9 A;  3K5M A;  3HZ6 A;  4KHN A;  2Z1J A;  3ZET B;  4AHC A;  3AGK A;  4M3Z A;  3T1H K;  1KRP A;  3LWM A;  3CC7 N;  2DPN A;  3L2V A;  4CER A;  4CZM A;  4Q5V A;  4F3O A;  2PFU A;  5J2P A;  1KAZ A;  3ZT1 A;  4EP5 A;  4BG9 A;  1BOT O;  4BGB A;  2YX6 A;  2UU9 K;  3EL2 A;  3L3V A;  4FM2 A;  4BRE A;  3QML A;  1N36 K;  3DRP A;  4BQL A;  1JL2 A;  3KVG A;  3B6P A;  2F7T A;  4J2A A;  3BF1 A;  2A40 A;  3PO5 A;  4BG8 A;  4F4K A;  3GE1 A;  4KAZ A;  4K41 A;  2G8V A;  4A5B A;  1EXQ A;  4I9Q A;  4AQY K;  1C6V A;  2HB5 A;  2VG6 A;  1T03 A;  4CK2 A;  4B1V A;  4DG1 A;  2W6L A;  4CJP A;  1OH6 A;  1DEJ A;  4KKO A;  1O1W A;  1SQK A;  5HRP A;  3NGI A;  3OYB A;  5BRD A;  1BO5 O;  3D6R A;  4JKB A;  3HJF A;  3QER A;  2ZD1 A;  3D2F A;  5AQH A;  4QS9 A;  1ZBI A;  2NRZ A;  5AFU H;  4N5S A;  1HKB A;  2RHK A;  3KLH A;  4B9M A;  2Z1I A;  3HM9 A;  1VSF A;  2YI1 A;  3HM8 A;  3NF7 A;  3QIP A;  3MEG A;  5JVG L;  3THV A;  3WNH A;  3SCX A;  4LD0 A;  3TAR A;  3FR0 A;  5KGX A;  2V51 B;  1MWM A;  1RGI A;  1VQ6 N;  4DV2 K;  4DV7 K;  2XHB A;  4BR0 A;  1JLB A;  2O8E A;  3DAW A;  2P9U A;  1LAV A;  2IOC A;  3UIQ A;  2DFH A;  3VF6 A;  1YT3 A;  2P9L A;  2CH5 A;  3F9M A;  1EWQ A;  1E4F T;  3ZSV A;  2O8C A;  3MN6 A;  2G8W A;  1YXQ A;  2D0P A;  5E26 A;  5J2Q A;  3C95 A;  1OH8 A;  3LZI A;  1U48 A;  3AVC A;  4M7X A;  3EE9 A;  2WOM A;  4CZH A;  2WFB A;  4JKH A;  2ZE2 A;  1X1P A;  3R9P A;  1GLD G;  4B3M K;  3VMF B;  3VEY A;  1JLC A;  4FWO A;  3F73 A;  4DSK A;  2FC0 A;  3M8P A;  2ZJP L;  1JJ2 M;  4BC3 A;  4LF9 K;  5AR0 A;  5H1S Q;  2D0C A;  3HTV A;  3GOI A;  3NVM A;  4IFV A;  3R1X A;  5GIN A;  2WON A;  1V4T A;  3V9X A;  3T3F A;  3ENH A;  1X3N A;  5AQY A;  2CH6 A;  3HRG A;  4DFJ A;  1TAU A;  5KQD A;  3OYD A;  2D4W A;  1X9J A;  4G9Z A;  4CD3 A;  1NM1 A;  3QO9 A;  1OH5 A;  5J2N A;  3LDO A;  4FZY A;  1HKC A;  4J2B A;  2AA4 A;  1KLN A;  1IBM K;  4FPA A;  4OKJ A;  4JN4 A;  4DTU A;  2Y1J A;  4GV6 A;  4FLU A;  4O8U A;  4E1N A;  3MCP A;  4IO9 L;  1QE1 A;  3V1Q A;  4IEE A;  3PSF A;  1VRU A;  1TKD A;  4DR3 K;  4JI0 K;  3HVR A;  4Q0B A;  1T05 A;  4NXN K;  3M3Z A;  2XRI A;  3CHW A;  4WF9 L;  1HNZ K;  4H0T B;  5AZJ A;  5JMV A;  2PBD A;  1OKJ A;  4JV5 K;  4E7J A;  3LDL A;  2KHO A;  1IJJ A;  2IIR A;  1U47 A;  2BDP A;  2E1Z A;  3K2P A;  2EX3 A;  3AO2 A;  1Z6R A;  1BCM A;  4H5R A;  3I0R A;  1RTH A;  4UQG A;  3HVT A;  1K73 O;  4JI7 K;  2D0B A;  3BUZ B;  4ISF A;  4BRN A;  3O8M A;  2HMI A;  4A57 A;  3O6W A;  1JXE A;  4EHT A;  2FBT A;  3HPO A;  3NMU A;  2A6A A;  4WQ4 C;  4DTR A;  1GLA G;  4N41 A;  2GEL A;  3HI0 A;  4CF9 A;  4ISG A;  3PY8 A;  3VA0 A;  4KBO A;  4FWK A;  4O5F A;  4ZHR A;  3OVN A;  4JS4 A;  2D0A A;  1SAZ A;  1YJ9 N;  3CIP A;  4EZ6 A;  4DHY A;  5BR9 A;  5CE3 A;  3SYZ A;  2R7Y A;  2IVP A;  4FLX A;  4I7F A;  4QS7 A;  4N76 A;  1S5J A;  5AQJ A;  3LDP A;  3L3U A;  4A62 A;  4CZJ A;  4I6M A;  4RCH A;  3P5J A;  2O8D B;  3SNN A;  3AA2 A;  5AQM A;  4DU4 A;  4CEO A;  2OPQ A;  4ILG B;  2E6M A;  2XO7 A;  3LL3 A;  3CM6 A;  4DU3 A;  4CJK A;  4H5V A;  3O3G A;  4ELT A;  2HBJ A;  2GWJ A;  1FKO A;  1HQU A;  4CJR A;  1GOC A;  2BAN A;  4BVO A;  1QVG M;  1WUA A;  2KZM A;  2B4J A;  4DR6 K;  1HJR A;  4AH9 A;  2VWK A;  3V4I A;  4E0D A;  4JKA A;  3THW B;  1CXQ A;  1LWF A;  3P83 D;  3ZSQ A;  3BDP A;  4CJE A;  2UYT A;  2VG5 A;  1U2V B;  2QKK A;  1TGO A;  4MQ3 A;  4DKW A;  3DLB A;  2F96 A;  2NRV A;  4LFC K;  2A42 A;  4N56 A;  3O5B A;  1YI2 N;  3HK2 A;  3TU5 A;  3LAM A;  2Q97 A;  3U4L A;  3OJS A;  3OA9 A;  5ADX H;  4KHU A;  3U6F A;  3AVM A;  3SV3 A;  1V4S A;  3HL8 A;  4BRM A;  1TUU A;  1S1X A;  3DXM B;  3K5N A;  2KFZ A;  4WFN L;  1YUW A;  1J9A A;  4FYD A;  2HNY A;  1ASU A;  5IT9 O;  3O1W A;  2F4V K;  4OGE A;  2OPS A;  4W5R A;  5F2R A;  4V19 S;  1QQC A;  4CHP A;  3ULE A;  3L4I A;  1RT6 A;  4Z4F A;  2DY4 A;  4JAX A;  4FOI A;  4CJV A;  1UA1 A;  5BRH A;  3RR7 A;  3TTF A;  1NMD A;  5CR4 A;  1KVA A;  2P9P A;  3T69 A;  1S6P A;  1NJZ A;  1RTI A;  4FM1 A;  3PO4 A;  4H4M A;  3OYE A;  3TR8 A;  4LH4 A;  4FPB A;  4BC4 A;  3G0Z A;  1HUX A;  3VEX A;  2WTU A;  4NCB A;  1DTT A;  1WSF A;  3LDN A;  4CZI A;  4EIA A;  3SJH A;  1S6Q A;  5EVZ A;  5LMN K;  4MDA A;  3QEX A;  1RCH A;  4AHU A;  5BRF A;  5LJW A;  4DR5 K;  4CE9 A;  2P9I B;  2YNF A;  3UKR B;  3V9U A;  4C8N A;  3SAF A;  4MDB A;  3ASM A;  4H8K A;  4B9U A;  1Q18 A;  1SKR A;  2QEX N;  3I55 N;  4OPH A;  2RKI A;  3TAB A;  3CI5 A;  2YKM A;  4B3O A;  4CZG A;  1S3X A;  4NCA A;  4BWJ A;  4DR2 K;  2G8U A;  4C8K A;  2GX9 A;  2P9N A;  4HUG A;  2NRW A;  3C7N A;  4MLH A;  3VGL A;  5AQP A;  1ZBS A;  4QAG A;  4K25 A;  4GW6 A;  4GMJ B;  3ITH A;  4K0K K;  3ISN C;  1VSI A;  1K6Y A;  2IVN A;  4JHD A;  3C6T A;  4E1J A;  2FBV A;  4OVL A;  5C2F A;  1NK4 A;  4CGH A;  4KTZ A;  1FKP A;  4JKG B;  1X9M A;  1MDU B;  1K8A O;  5DMR A;  5AQI A;  1QS4 A;  3VQ7 A;  2BTF A;  2YHA A;  3ATU A;  4C1N K;  1R59 O;  3ZX2 A;  5GIP A;  2G8F A;  4WQ5 C;  4PY5 A;  4RW4 A;  3VF4 A;  3FLC O;  5C10 A;  5KPR A;  4L8R B;  3WNE A;  4IG3 A;  3WQT A;  1TYQ B;  3D45 A;  2EWS A;  4JD2 A;  3G10 A;  3N4P A;  5AFU A;  3TTC A;  4Z0U A;  4C1N I;  4DCH A;  5KI6 A;  5BN8 A;  4O55 A;  3T7Z A;  4JI3 K;  3P1G A;  4OLA A;  1JCG A;  4CHQ A;  4FJ8 A;  3NBP A;  3V9S A;  3VQ8 A;  1R0A A;  2OAN A;  1IBL K;  3QBW A;  1S1V A;  3OYA A;  4CZL A;  4NYN A;  3ZLJ A;  3PUF A;  1BGX T;  3G71 N;  1RDA A;  5EU7 A;  2E2O A;  3SZ2 A;  4DV4 K;  4IFY A;  2D5R A;  3RMC A;  4W5N A;  1UA0 A;  4M63 C;  5HL7 L;  4PL7 A;  3VQP A;  1ITG A;  3FZM A;  5FPM A;  2HHU A;  3MEC A;  3ZCM A;  4CFB A;  5GAE P;  4YOY A;  3MAQ A;  1LV5 A;  4FWP A;  1SZ2 A;  4X64 K;  4NLC A;  4AM7 A;  3NCI A;  2QWQ A;  4NXM K;  4IWV A;  3LP1 A;  1C0F A;  3KZB A;  3RWU A;  2VGM A;  2P9S A;  1XWL A;  4H4O A;  2HHX A;  4MLE A;  5JVH L;  1Q7Y O;  3P38 A;  4LFA K;  2HHS A;  4B08 A;  4KB0 A;  1Q81 O;  1G99 A;  4H5N A;  4FK0 A;  3AA4 A;  1BQM A;  4DV6 K;  3CME N;  4PUO A;  4CK3 A;  3A5M C;  5AZI A;  3PX0 A;  2J4R A;  1NOZ A;  1HLU A;  3KTQ A;  3DYA A;  5AQS A;  2IS3 A;  1ASW A;  3IMX A;  3FZK A;  4A61 A;  3U9D A;  5K14 A;  3NF9 A;  1K8K B;  4Y0W A;  2XY7 A;  3NAE A;  1UOC A;  1JLA A;  3PIP L;  3LZJ A;  4FJL A;  4FXD A;  3O80 A;  4IKF A;  1OVQ A;  3ZSX A;  3IFR A;  3OBW A;  1EO1 A;  3KD1 E;  4CEA A;  5AQL A;  4H0Y B;  1VQ8 N;  2IGI A;  4FJ7 A;  3K0S A;  4FJX A;  3OTO K;  3WUH A;  2UUA K;  3SUP A;  3HO1 A;  2E20 A;  3ZX0 A;  4B1Y B;  4M41 A;  3KLE A;  4U67 L;  3AVJ A;  3F5T A;  1BL3 A;  1M1K O;  1U6Z A;  3SQ1 A;  2FSN A;  4JKE A;  3O08 A;  3DRS A;  1C0U A;  3V9W A;  5I42 A;  1W2B M;  4KI6 A;  2A1S A;  4HVJ A;  5AQT A;  1NGF A;  1TKX A;  2OYQ A;  1LW0 A;  4JYA K;  1OVY A;  4H0P A;  1FXX A;  3SMS A;  5KGW A;  4OGC A;  3VGM A;  1EKE A;  3E9P A;  5KPZ A;  1I3A A;  2GBZ A;  1YIJ N;  4CJ4 A;  3O9T A;  1NK9 A;  3RTV A;  3A5N C;  1WBB A;  4O8K A;  1HNI A;  3I0S A;  2QM1 A;  1ZBU A;  1BG3 A;  2QKB A;  4GV3 A;  2V7Z A;  4LF7 K;  3UB5 A;  3MXI A;  4GVE A;  4R79 A;  5F0X A;  1VK0 A;  3TI0 A;  2P9K A;  1W9H A;  3UKU A;  4FWQ A;  3OYG A;  4WCE L;  3TAN A;  3CCQ N;  4CF8 A;  4YNQ A;  4BE2 A;  4DTJ A;  4E1M A;  4BAC A;  3CFR A;  3ENO A;  4CEZ A;  3KWG A;  3WEE B;  1T7P A;  1X9S A;  2Q1N A;  3S41 A;  4CGI A;  1S1W A;  3K9K A;  4CJU A;  4CK1 A;  5KQ8 A;  1OH7 A;  2YCH A;  3VQ4 A;  4DSI A;  3CCU N;  3FE1 A;  4AM6 A;  2GUI A;  3CQY A;  4FO0 A;  4BRP A;  5EXW A;  1IKY A;  2HW3 A;  1GLB G;  3IRX A;  4A59 A;  1X9W A;  3MN7 A;  2ZM6 K;  1RT1 A;  1L3T A;  5JLF A;  3QFP A;  1EWR A;  4YOX A;  4PL8 A;  2NLX A;  2PY5 A;  4DSE A;  1HNX K;  2BE2 A;  1BWF O;  4B1U B;  3VQE A;  1WSJ A;  3IKM A;  4BC5 A;  4ICL A;  3H1V X;  1TK0 A;  2HND A;  1BQN A;  3OS2 A;  2VWJ A;  4E7I A;  4CJ5 A;  4OPK A;  1RBR A;  4ISE A;  3QIC A;  1YTA A;  3SBT A;  3J7Z O;  3I8D A;  3BEX A;  1BHL A;  1HPZ A;  4JI2 K;  4BR4 A;  4KH6 A;  2QWM A;  1NKB A;  2PYL A;  3C6A A;  1MU2 A;  5M1F A;  4GY2 B;  1ATR A;  2KLA A;  4KHY A;  1NK7 A;  1VSK A;  4DFP A;  3O9U A;  3J80 O;  1TL3 A;  1YIT N;  2ZJR L;  1GLF O;  3A5L C;  3AO1 A;  3CCL N;  3S3M A;  1VQM N;  1BI4 A;  5GIO A;  3SI6 A;  2B5J A;  2HF3 A;  3AAQ A;  5FPD A;  1JL1 A;  2YHY A;  5FPN A;  1N8R O;  1J5O A;  2FBX A;  4GNI A;  5M1K A;  4GVM A;  3KK7 A;  3ZET A;  1D4X A;  5GAG P;  3KKR A;  1VQP N;  4AHS A;  3ATV A;  3KK1 A;  2HF4 A;  1REV A;  4O0J A;  4DQR A;  1VQN N;  4B9T A;  4M3U A;  3DI6 A;  4TSX A;  4JK7 A;  1E3M A;  3KWI A;  1RDD A;  4DF8 A;  5SZT A;  3L2Q A;  1RDW X;  1YF5 L;  3SQ4 A;  4XH4 A;  5AQQ A;  4CBU A;  4OKE A;  1N34 K;  2YJF A;  1RBS A;  4JNE A;  2FBY A;  4C23 A;  1BIS A;  3U8X A;  3LPT A;  4Z4C A;  5J2M A;  1ZBH A;  1WNS A;  3GDQ A;  1VSJ A;  1TV6 A;  3THX B;  4ILH A;  1RT3 A;  2QWR A;  4CES A;  4DQ8 A;  4CEE A;  4DTN A;  4OLB A;  2I5J A;  2I7N A;  2E2N A;  3ZSZ A;  1N6Q A;  3TAP A;  4F9O A;  1FW6 A;  4XIU A;  4DR1 K;  3AVK A;  5KRS A;  2JWL A;  3M1F A;  1VQL N;  1GOA A;  4IDK A;  2E6L A;  1S1T A;  3I33 A;  3OHR A;  4W5Q A;  1KFD A;  3MX5 A;  3EY1 A;  2G8K A;  4FOE A;  4FVM A;  4XH1 A;  3DWL A;  3KIO A;  2G8I A;  4CD1 A;  2OPP A;  2W40 A;  1D5A A;  1JLE A;  2PAV A;  3D0P A;  1RIL A;  2LSN A;  3ZSR A;  3O4N A;  4M3X A;  4HCC A;  1NGE A;  4FK4 A;  1S72 N;  1DGK N;  3LM9 A;  2FLO A;  5JLH A;  2AJQ A;  4KHW A;  1NMN A;  4C8M A;  3EE8 A;  4FWM A;  2W41 A;  2QWP A;  1WLJ A;  1BU6 O;  4CIE A;  3U9Z A;  3QEV A;  3HPH A;  1HKG A;  3L4Q A;  1NU0 A;  1VSD A;  4ILJ A;  1QVF M;  5AQN A;  3CJB A;  2NNW A;  3E1Y A;  2Q3S A;  4I2Q A;  1QSL A;  3A0I X;  3NF6 A;  1BIZ A;  3M8S A;  3D2E B;  3ZT0 A;  3ZSY A;  2H3G X;  1WN7 A;  5KRT A;  1ESV A;  1B9D A;  3H3N O;  4M3W A;  4DFM A;  1NGH A;  5A2Q O;  3TAG A;  3KLI A;  5BPN A;  1XMQ K;  4FL9 A;  4W5O A;  1NNE A;  3JS6 A;  4DSJ A;  5J1E A;  3Q7B A;  2ITM A;  1N33 K;  2A3Z A;  1IH7 A;  4DS5 A;  3L2R A;  3O3F A;  4KTW A;  4AHR A;  4CJ7 A;  4C8O A;  4ELV A;  5EX5 A;  3DXK B;  3MED A;  4JK9 A;  4DR4 K;  3NHG A;  3ALY A;  4U7B A;  3T19 A;  2JGU A;  3HSC A;  3K57 A;  2ATQ A;  3CCR N;  3FZL A;  4RW9 A;  4CJT A;  3CXC M;  5GAH P;  3SJJ A;  1UWB A;  3CJC A;  1GLJ O;  3OYC A;  3R6M A;  3KJV A;  3NH2 A; 
#chains in the Genus database with same CATH homology
 3G10 A;  3LAN A;  3RRH A;  4Z0U A;  3IG1 A;  3KKS A;  4FLT A;  5KI6 A;  3DLG A;  4O55 A;  4Z4E A;  3P1G A;  4OLA A;  3CYM A;  1Y97 A;  3U3Y A;  2O4I A;  4CHQ A;  4FJ8 A;  2HHQ A;  4K8X A;  3NBP A;  1TL1 A;  1HYZ A;  3VQ8 A;  3NH1 A;  4CF0 A;  3V9S A;  1R0A A;  2B6A A;  3V1O A;  4PQU A;  5FRO A;  1BI4 B;  1S1V A;  3LWL A;  3OYA A;  5CZ2 A;  1RT5 A;  4NYN A;  1CZB A;  4EP4 A;  3BGR A;  3PUF A;  2ITG A;  4FLZ A;  1BGX T;  2YHB A;  1Z25 A;  4FCY A;  4E7K A;  5CZ1 A;  1S9E A;  2YNH A;  3K5M A;  2DFF A;  1JLG A;  4DMN A;  2Z1J A;  4AHC A;  4KHN A;  4M3Z A;  1RDA A;  5EU7 A;  1RT7 A;  1KRP A;  3LWM A;  1W0H A;  3VA3 A;  1U04 A;  3DLK A;  3SZ2 A;  4IFY A;  1EET A;  2D5R A;  3L2V A;  3RMC A;  2QK9 A;  4CER A;  1UA0 A;  4Q5V A;  4F3O A;  4W5N A;  4J2D A;  3VQB A;  3VQP A;  3ZT1 A;  5J2P A;  4EP5 A;  1ITG A;  3HPG A;  2O4G A;  1KFS A;  1RDB A;  4DTM A;  4KI4 A;  3MEC A;  3ZCM A;  2HHU A;  4CEF A;  4CFB A;  3M8R A;  3MAQ A;  3DRR A;  1LV5 A;  3L3V A;  4FM2 A;  5FRM A;  2F8T A;  4FLW A;  2KFN A;  1LW2 A;  3SQ0 A;  5C25 A;  3PV8 A;  3NCI A;  3DRP A;  1L3U A;  1JL2 A;  3EYZ A;  4RW8 A;  1JLF A;  1WSH A;  3SQ2 A;  4ZTJ A;  3LP1 A;  3QEI A;  4F8R A;  4K8Z A;  3B6P A;  4BDY A;  4J2A A;  4RW6 A;  4B9N A;  3B6O A;  1VSH A;  3OYH A;  3PO5 A;  3RWU A;  4E19 A;  4WE1 A;  4F4K A;  4CGG A;  1XWL A;  4DQI A;  4H4O A;  4KAZ A;  2HHX A;  1Q9X A;  3LPU A;  2G8V A;  1EXQ A;  4I9Q A;  3FFI A;  1C6V A;  2HB5 A;  3OYK A;  4B08 A;  3NE6 A;  2HHS A;  2VG6 A;  1D9D A;  4KPY A;  1T03 A;  4CK2 A;  4C8L A;  4KB0 A;  4E3S A;  3RMA A;  4M3T A;  4DG1 A;  3VQD A;  3C94 A;  1DLO A;  4CJP A;  4AIL C;  4HCB A;  4FK0 A;  1RT2 A;  3AA4 A;  4KKO A;  1O1W A;  1BQM A;  4CJ3 A;  4CFA A;  5HRP A;  4DF4 A;  4PUO A;  3NGI A;  4CK3 A;  2XY8 A;  3PX0 A;  3OYB A;  3OYF A;  4DQQ A;  1NOZ A;  3KTQ A;  3DYA A;  3HJF A;  2IS3 A;  1IKW A;  1ASW A;  1KVB A;  3QER A;  5C24 A;  2ZD1 A;  3NGY A;  1WAF A;  1ZBI A;  3VN5 A;  2DTU A;  2Z1G A;  2YV0 X;  5K14 A;  2VG7 A;  3NF9 A;  4N5S A;  3QLH A;  2XY7 A;  3KLH A;  4B9M A;  4FJM A;  2Z1I A;  3HM9 A;  1VSF A;  4FJK A;  3NAE A;  3S3O A;  1UOC A;  1JLA A;  1VSL A;  1TVR A;  3LZJ A;  4FJL A;  4FXD A;  4IKF A;  3NF7 A;  2EHG A;  3HP6 A;  5JS1 A;  3QIP A;  3MEG A;  3HXM A;  3ZSX A;  2DFE A;  1KLM A;  2X74 A;  3THV A;  3WNH A;  3IS9 A;  3SCX A;  3HP9 A;  4KRF A;  4LD0 A;  5HP1 A;  3TAR A;  1JXB A;  4KFB A;  1QTM A;  5KGX A;  4DTP A;  3KJV A;  3KD1 E;  1SL0 A;  1ZBL A;  4CEA A;  1XHX A;  2XHB A;  1JLB A;  1NJX A;  3AVA A;  1LAV A;  2IOC A;  4PWD A;  3UIQ A;  1SKS A;  2DFH A;  2IGI A;  3OYI A;  1YT3 A;  3OJU A;  3SPY A;  4FJ7 A;  4CGD A;  4LY7 A;  3ZSV A;  4FJX A;  3F9K A;  3AVH A;  3TAQ A;  2G8W A;  5FRN A;  3O4Q A;  3SUP A;  1C0T A;  2P1J A;  3VQC A;  3HO1 A;  3VQ6 A;  5J2Q A;  4O44 A;  4FM0 A;  3C95 A;  3V81 A;  3LZI A;  1U48 A;  3AVC A;  3KLE A;  4M41 A;  2WOM A;  5C42 A;  1EP4 A;  3AVJ A;  4OKK A;  4M3R A;  1BL3 A;  3QES A;  2ZE2 A;  3SQ1 A;  1X1P A;  1QHT A;  3DRS A;  1C0U A;  3V9W A;  5I42 A;  2P5O A;  4F2R A;  4KI6 A;  4CEB A;  1JLC A;  2A1S A;  4HVJ A;  1RTD A;  3F73 A;  4DSK A;  2FC0 A;  3M8P A;  1TKX A;  3CQ8 A;  1LW0 A;  1RDC A;  1RTJ A;  4JRQ A;  2OYQ A;  5DK5 A;  2GV9 A;  2BGG A;  3MXJ A;  2D0C A;  2HHV A;  4CIF A;  1FXX A;  4IFV A;  2WON A;  4Z4G A;  3V9X A;  5KGW A;  3NF8 A;  4OGC A;  3T3F A;  1EKE A;  1U45 A;  4BDP A;  4FJI A;  3L8B A;  1I3A A;  2GBZ A;  4FZX C;  4CJ4 A;  3ZT3 A;  4DFJ A;  2A1R A;  1RT4 A;  3OYD A;  1NJW A;  1NK9 A;  3RTV A;  1TAU A;  3OYJ A;  4FW2 A;  4FJG A;  1HNI A;  4M45 A;  3I0S A;  3QO9 A;  1ZBU A;  1F21 A;  5J2N A;  3MXM A;  4FZY A;  2QKB A;  5CYQ A;  1GOB A;  3DM2 A;  3NFA A;  3WNF A;  4J2B A;  4FK2 A;  3AO3 A;  2ZQB A;  3MXI A;  1J54 A;  3T1A A;  1KLN A;  4I2P A;  4CJW A;  4FJN A;  1VK0 A;  2P51 A;  3VQQ A;  3OYN A;  3TI0 A;  2OZS A;  1HRH A;  3AVI A;  4OKJ A;  4FJ5 A;  1W9H A;  4FJH A;  4FLY A;  4DTU A;  2Y1J A;  4CEQ A;  4FLU A;  4E1N A;  3OYG A;  3TAN A;  5I3U A;  4CF8 A;  2KTQ A;  4YNQ A;  1QE1 A;  4BE2 A;  4DTJ A;  3ZT4 A;  4E1M A;  3V1Q A;  4BAC A;  1NK0 A;  3OY9 A;  3CFR A;  2IAJ A;  4CEZ A;  1VRU A;  3ZSO A;  5HRN A;  1XC9 A;  1TKD A;  3DLR A;  4M3Y A;  3HVR A;  1T7P A;  5D3G A;  3H08 A;  4CGF A;  1X9S A;  4Q0B A;  3LP3 A;  4CGI A;  1U4B A;  1T05 A;  2XRI A;  1L3V A;  1S1W A;  3DMJ A;  4CJU A;  4CK1 A;  4E7J A;  3VQ4 A;  1HYV A;  3LDS A;  4DSJ A;  4DSI A;  1SUQ A;  5HRS A;  1U47 A;  3QEW A;  2GUI A;  2NUB A;  2BDP A;  1YVU A;  3K2P A;  1NOY A;  2E4L A;  2EX3 A;  1IKY A;  3AO2 A;  4DSF A;  2OA8 A;  2IC3 A;  2HW3 A;  1BCM A;  3I0R A;  1HMV A;  5FDL A;  4CF2 A;  1RTH A;  3KD5 E;  3IRX A;  1X9W A;  4UQG A;  1KTQ A;  3HVT A;  1Q9Y A;  1RT1 A;  2D0B A;  1L3T A;  3QIN A;  4DLG A;  2HVH A;  2PY5 A;  1WSE A;  4DSE A;  2HMI A;  4CHO A;  1HQE A;  2BE2 A;  1D9F A;  1SL1 A;  1TK5 A;  1JXE A;  3A2F A;  2P5G A;  1IO2 A;  2FBT A;  3VQE A;  1XI1 A;  1WSJ A;  4KV8 A;  3HPO A;  2Y1I A;  1XHZ A;  1NK6 A;  2HHT A;  3AVB A;  4ICL A;  3K58 A;  1QSS A;  4DTR A;  1TK0 A;  1G15 A;  3JYT A;  4N41 A;  2HND A;  1BQN A;  3LP2 A;  4CF9 A;  3OS2 A;  3CG7 A;  4CJ5 A;  4OPK A;  2VWJ A;  3V9Z A;  1RBR A;  4E7I A;  1NK5 A;  3PY8 A;  1C1B A;  3VA0 A;  1CZ9 A;  4OJR A;  1YTU A;  1YTA A;  2YNI A;  4ZHR A;  3OVN A;  4O4G A;  3I8D A;  4JS4 A;  4DWI A;  4CIG A;  2D0A A;  3DLH A;  1BHL A;  1HPZ A;  4EZ6 A;  3QET A;  1NKB A;  3CM5 A;  2PYL A;  3SYZ A;  1MU2 A;  2RN2 A;  3O3H A;  2R7Y A;  4N47 A;  4N76 A;  4FLX A;  4I7F A;  3V6D A;  1S5J A;  3L3U A;  4B9V A;  1VSE A;  3CFO A;  3OS0 A;  4KHY A;  4CGJ A;  1NK7 A;  1VSK A;  4LSN A;  4DFP A;  4BE0 A;  4HUF A;  4O5B A;  3P5J A;  3WNG A;  1TL3 A;  3SNN A;  4DSL A;  1D8Y A;  3AA2 A;  1KVC A;  3AO1 A;  4DU4 A;  3S3M A;  1TKT A;  4CEO A;  2OPQ A;  1BI4 A;  2E6M A;  3SI6 A;  4PA1 A;  4CHN A;  2XO7 A;  2B5J A;  1HNV A;  3ULD A;  1CXU A;  1NK8 A;  2RF2 A;  1J5O A;  1JL1 A;  3HYF A;  4B8C A;  2FBX A;  4ELU A;  3CM6 A;  3RMD A;  4GVM A;  4DU3 A;  4CJK A;  3SV4 A;  3O3G A;  5HRO A;  3KKR A;  5T7B A;  1S1U A;  3AVN A;  4ELT A;  4AHS A;  4E89 A;  3RR8 A;  3KK1 A;  5E41 A;  1FKO A;  3HST B;  1REV A;  4IBN A;  3NGZ A;  1HQU A;  4CJR A;  4CJF A;  4JRP A;  3S3N A;  1GOC A;  2BAN A;  4O0J A;  1TK8 A;  4EZ9 A;  4CFD A;  3VQ5 A;  1C1C A;  4DQR A;  1JLQ A;  2KZM A;  1A5V A;  4DU1 A;  2F8S A;  2B4J A;  4B9T A;  1HJR A;  1B9F A;  2XY6 A;  4AH9 A;  3DI6 A;  4M3U A;  2VWK A;  3V4I A;  4TSX A;  4B9S A;  4E0D A;  2G8H A;  1CXQ A;  1RDD A;  4DF8 A;  1LWF A;  3P83 D;  3ZSQ A;  3S9H A;  3BDP A;  5SZT A;  4CJE A;  5HLF A;  4F2S A;  3L2Q A;  1SKW A;  2VG5 A;  2JLE A;  3KLF A;  3SQ4 A;  1NKE A;  4CF1 A;  4OKE A;  3K5L A;  2QKK A;  1TGO A;  1RBS A;  4MQ3 A;  1UAX A;  3DLB A;  2F96 A;  3KK3 A;  1T8E A;  3VQ9 A;  2FBY A;  4HUE A;  1BIS A;  4N56 A;  3LPT A;  4KO0 A;  4Z4C A;  3TAF A;  3LAL A;  4G1Q A;  4AHT A;  4DQS A;  5J2M A;  3HK2 A;  1ZBH A;  1WNS A;  3RRG A;  3RMB A;  3LAM A;  4B9L A;  3MEE A;  1VSJ A;  3LAK A;  4FZZ A;  3OS1 A;  1TV6 A;  5CY4 A;  3AV9 A;  4ZTF A;  3OYM A;  2KQ2 A;  3KK2 A;  1TAQ A;  1RT3 A;  1LWC A;  4Y1D A;  4R5P A;  3OJS A;  4KHU A;  4CES A;  3U6F A;  3AVM A;  3SV3 A;  4CCH A;  4CEE A;  4DTN A;  4OLB A;  3HL8 A;  1L3S A;  1S1X A;  3K5N A;  4DS4 A;  4M42 A;  2I5J A;  3SUN A;  4LH5 A;  4RW7 A;  3TAM A;  2KFZ A;  3ZSZ A;  3SUO A;  4KTQ A;  4RG8 A;  1FK9 A;  3ZT2 A;  1J9A A;  1N6Q A;  3TAP A;  4FYD A;  2HNY A;  4XIU A;  1ASU A;  1I39 A;  4CJL A;  3AVK A;  3LP0 A;  5KRS A;  1GOA A;  4IDK A;  3OYL A;  4FW1 A;  4OGE A;  2E6L A;  1S1T A;  2OPS A;  1NKC A;  4W5Q A;  3AVL A;  4I9L A;  2YKN A;  4W5R A;  4DQP A;  2HNZ A;  3L2U A;  4DLE A;  1KFD A;  1QQC A;  4CHP A;  4E7L A;  4BE1 A;  1RT6 A;  1SV5 A;  4Z4F A;  2DY4 A;  2OPR A;  3PX6 A;  1DTQ A;  3EY1 A;  2G8K A;  4CHZ A;  4CJV A;  4FVM A;  1UA1 A;  3RR7 A;  3KIO A;  3JSM A;  2G8I A;  1KVA A;  4E7H A;  1BIU A;  4F3T A;  4Z4I A;  2OPP A;  1A5X A;  5KTQ A;  1D5A A;  1S6P A;  1JLE A;  4ID1 A;  2RPI A;  4KHS A;  3D0P A;  1BCO A;  2X6S A;  4YFU A;  1ZYQ A;  1RIL A;  1RTI A;  1NJZ A;  4KRE A;  2LSN A;  3ZSR A;  4CED A;  3O4N A;  4FM1 A;  1WAJ A;  3PO4 A;  4M3X A;  4CEC A;  4FLV A;  2X78 A;  4H4M A;  3AO5 A;  4HCC A;  4DTX A;  4FK4 A;  1A5W A;  3OYE A;  3TR8 A;  1TKZ A;  2YNG A;  3DLE A;  4LH4 A;  5SWM A;  5CYM A;  4CFC A;  3SUQ A;  2QXF A;  4CJQ A;  3G0Z A;  4KHW A;  3D45 A;  1RBU A;  4QCL A;  2AJQ A;  4BDZ A;  3IAY A;  4NCB A;  1DTT A;  1WSF A;  1N5Y A;  4C8M A;  4Z4H A;  1VSM A;  1RBV A;  4CHY A;  4JLH A;  1S6Q A;  2ETJ A;  1JKH A;  3NDK A;  1WLJ A;  4NYF A;  3K59 A;  4CIE A;  3QEV A;  1KCF A;  2X6N A;  3HPH A;  2KW4 A;  4NCG A;  1IG9 A;  4KHQ A;  3QEX A;  1RCH A;  1VSD A;  4AHU A;  3AVF A;  1SL2 A;  4CE9 A;  1CLQ A;  2PZS A;  2YNF A;  2Q3S A;  4I2Q A;  4MFB A;  4DTO A;  3V1R A;  1QSL A;  4OPJ A;  3NF6 A;  1S9G A;  3KLG A;  1BIZ A;  3L2W A;  1C0M A;  5HBM A;  1EX4 A;  3M8S A;  3V9U A;  3TAE A;  2PYJ A;  4C8N A;  3QNN A;  3ZT0 A;  3ZSY A;  1ASV A;  4KB1 A;  3QIO A;  1WN7 A;  3AVG A;  5KRT A;  3C6U A;  1B9D A;  3VQA A;  3ASM A;  4H8K A;  1L5U A;  4M3W A;  4CJS A;  3AO4 A;  4JS5 A;  4B9U A;  4DFM A;  1SKR A;  1KSP A;  3TAG A;  3KLI A;  1B92 A;  2KZZ A;  2RKI A;  3CFP A;  3TAB A;  2YKM A;  1WSG A;  4W5O A;  4B3O A;  2Z1H A;  2HVI A;  4NCA A;  4BWJ A;  4W5T A;  3NH0 A;  5J1E A;  3TWH A;  1LWE A;  3DOK A;  1IKX A;  4HHT A;  4DFK A;  4HUG A;  3SPZ A;  2G8U A;  4C8K A;  1IH7 A;  4DS5 A;  2HHW A;  3L2R A;  3O3F A;  4KTW A;  4AHR A;  4BWM A;  1IKV A;  4Y1C A;  4C8O A;  3M8Q A;  4QAG A;  3QEP A;  4GW6 A;  4GMJ B;  4ELV A;  4J2E A;  3ITH A;  1HYS A;  3ISN C;  1VSI A;  1J53 A;  1K6Y A;  3MED A;  1WSI A;  3U3G A;  4B8A B;  3C6T A;  3NHG A;  4QOZ B;  2FBV A;  3ALY A;  4HTU A;  3QNO A;  1LAW A;  1RNH A;  2IDO A;  3HT3 A;  4OVL A;  1VRT A;  2OZM A;  4O0I A;  1QSY A;  1NK4 A;  3T19 A;  4FJJ A;  3AA5 X;  4CGH A;  4KTZ A;  1FKP A;  1X9M A;  2JGU A;  5DMR A;  3K57 A;  2ATQ A;  4RW9 A;  5HRR A;  4CJT A;  1QS4 A;  1ZBF A;  3DOL A;  4ID5 A;  3VQ7 A;  3SJJ A;  2YHA A;  3AA3 A;  4LSL A;  1Q8I A;  5JS2 A;  1UWB A;  3ZSW A;  2XY5 A;  1C1A A;  3K5O A;  2G8F A;  1U49 A;  1NJY A;  4RW4 A;  4PY5 A;  2W42 A;  3OYC A;  4FJ9 A;  4AHV A;  4L8R B;  3WNE A;  4IG3 A;  3E01 A;  3EZ5 A;  3PX4 A;  1Z26 A;  4DTS A;  1RBT A;  4IG0 A;  3NH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...