2Z1JA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMKPKLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 48
structure length 151
sequence length 151
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1jA00
3E01A 2OPQA 4KV8A 4CK3A 1WN7A 3DI6A 5KGXA 1S1WA 4N5SA 4M3RA 3IS9A 3JSMA 1GOAA 5HRRA 3P1GA 2WOMA 3PUFA 2G8UA 1LWCA 3RRGA 3HP9A 1RBUA 4RW7A 3TABA 2QK9A 3OYDA 1GOBA 1TV6A 3B6PA 1VSLA 5JS2A 2XY6A 3KIOA 4AHSA 3AA2A 3VQBA 3D45A 1HPZA 3SQ0A 1U45A 3AA4A 3AVAA 1SL1A 4YNQA 3M8QA 4DTMA 4C8KA 1EXQA 2Z1GA 4CEOA 4KTQA 4DTNA 4NCBA 4Q5VA 3I8DA 1RT5A 1J9AA 4CEQA 1REVA 4OJRA 3KLIA 2RPIA 1T8EA 4Z4FA 5SZTA 3T19A 3OYNA 3RTVA 3AVBA 2OYQA 3SI6A 3OYGA 4DWIA 4F8RA 1RT6A 2D0AA 4FJKA 1K6YA 2FBTA 3NGIA 4CE9A 4M3ZA 4ZTFA 2JGUA 1ZBFA 4AH9A 2ZD1A 4LSLA 3V9UA 3TAMA 1TGOA 4IG3A 3ZT4A 4CHZA 3K5NA 1KRPA 5D3GA 3S3MA 3K5MA 3QINA 3LDSA 1S1VA 3M8SA 4E7KA 1YTUA 5KRSA 1CLQA 3JYTA 3K2PA 4B8AB 4M45A 3LWMA 1SUQA 3TR8A 4DTOA 3PV8A 4DS4A 1C1BA 3QESA 1RDBA 4N41A 3LZJA 3L2VA 3C94A 1WAJA 4I2PA 3ALYA 3DM2A 4JRQA 4CGGA 3KLEA 2QKKA 5C42A 2G8FA 3PY8A 4NYFA 4ELTA 2R7YA 4KKOA 4JS4A 1RBSA 4JLHA 4HUEA 3DLGA 4CHYA 4E3SA 1KSPA 3AVFA 4OGCA 4KB0A 1NKCA 3PX6A 3V81A 3O3HA 4BWMA 4NCGA 3L8BA 1C6VA 2FBVA 4M3UA 4RG8A 3HO1A 1J54A 1RT2A 3V9WA 3RMCA 2JLEA 1KLNA 3OY9A 4FLZA 3LAMA 3BDPA 1UA0A 3ULDA 1LV5A 1KVCA 3LP1A 5KGWA 5SWMA 2IS3A 1WSFA 2FC0A 3H08A 3V1OA 3PO5A 2A1SA 4FLYA 1JLGA 1TL3A 4FK0A 4KREA 2HHTA 3ZT3A 3AV9A 1KVBA 3C95A 1HQEA 3NH0A 3CQ8A 3QEXA 4DTSA 3SPYA 3THVA 4KTWA 4DQIA 2KFZA 1O1WA 3KK2A 3DLHA 3AVNA 1HYZA 4OLAA 3HJFA 1S1UA 4E7JA 4DTPA 1S1XA 1FK9A 4N47A 1U48A 1FXXA 1BI4B 4CJ5A 1HQUA 2XO7A 3EZ5A 1C1AA 1VSDA 4BE2A 1IO2A 4CGJA 5FRMA 1UA1A 3KK1A 1BQMA 4EZ9A 1JXEA 3NCIA 4O0JA 5CY4A 4C8OA 1KVAA 2F96A 1LWEA 2BE2A 4O5BA 4FLUA 1NK0A 3VQ9A 1B9DA 2DFHA 3T1AA 1SL0A 4W5TA 3QNNA 4QAGA 4DFKA 4C8MA 1HYVA 3AA5X 4CHNA 1ASWA 3K5OA 1T03A 3G10A 4CF8A 2PZSA 4QOZB 1IH7A 1RT1A 5CZ1A 5DK5A 3SYZA 3S9HA 3K5LA 4GW6A 4AHVA 1T7PA 3RR7A 2F8SA 1LWFA 4CERA 4DQSA 1EX4A 1S1TA 5CYQA 2AJQA 4H4MA 2BDPA 3ZSWA 2HNYA 3VQ7A 5HLFA 4ID5A 4FM0A 3QEIA 4CJ4A 1VSJA 3QETA 4NYNA 3RMAA 3ZSRA 4CJPA 1UOCA 4HUGA 5I42A 4C8LA 3AVGA 4AHRA 5T7BA 4OPKA 1L3TA 4DF4A 4IKFA 4E1MA 4J2BA 3U3GA 2IC3A 1QQCA 3LPTA 3RRHA 4MQ3A 3QEWA 2QKBA 4LD0A 1JLAA 3ZSVA 4XIUA 4GMJB 3V6DA 4Z4GA 3AO1A 4FJXA 1TAUA 4IG0A 1TK5A 2A1RA 2RF2A 4OPJA 4FLWA 3MECA 4M3TA 4OKJA 5KI6A 1TKXA 1BISA 4E7IA 4KHYA 1BCOA 4FVMA 3ZSOA 2XY5A 4FZXC 4FJ9A 3NF8A 4FXDA 1VSMA 1SKWA 3HL8A 2YKNA 1UAXA 3NE6A 3WNHA 4CFDA 3QEVA 1UWBA 3VN5A 4FLXA 3DOLA 1IG9A 4JS5A 2ATQA 1NK6A 3QEPA 1U47A 4DTRA 4CGIA 2XHBA 1B92A 4ID1A 4AHTA 3O4QA 4LSNA 4CHOA 1JLBA 3ZSXA 3HXMA 4HHTA 1L5UA 3LWLA 1A5WA 1R0AA 3AVKA 1BQNA 4FJ7A 4N56A 1FKOA 1TKTA 1WNSA 3VQCA 3DLEA 4OKEA 2RKIA 5JS1A 1S6PA 4DMNA 4BE0A 3QERA 2G8HA 4FK4A 2KTQA 1DLOA 1NJXA 1HYSA 2KFNA 2HHWA 2YNGA 4DSKA 4FZZA 3NGZA 1JLEA 1HNIA 1JLFA 3TWHA 2E6LA 3TAQA 1QS4A 1ITGA 4DS5A 4KTZA 4J2AA 2VG6A 3DLRA 4YFUA 4FM2A 4N76A 2DFEA 5FROA 5C25A 4KHNA 4CJWA 3VQDA 1GOCA 1VRTA 4ELVA 1FKPA 2E6MA 3KJVA 4B3OA 2ETJA 1BI4A 2HVHA 4FJJA 3CFOA 3V9SA 1IKYA 3C6UA 4DSJA 4E0DA 4LH5A 4E19A 3CFPA 3HSTB 2OZSA 3PO4A 4I2QA 2E4LA 2HHXA 1Q9XA 3AO2A 3O4NA 4RW8A 3RMBA 3MXIA 1ZYQA 1RTDA 4KHSA 3DLKA 1CXQA 4CJSA 3HVRA 1D9DA 1EP4A 1LW0A 1YTAA 3VQ6A 3OYFA 2XY8A 4PA1A 4KHQA 2HMIA 5HBMA 3AVIA 4CF1A 3OYBA 4FCYA 1RCHA 3F9KA 4CF0A 3OYIA 4DQQA 3TAFA 4CIEA 4IDKA 3SQ2A 3TI0A 2BANA 1NK5A 3AVCA 1U4BA 1NJWA 3AVLA 4CF9A 3RWUA 2EHGA 2XRIA 4OKKA 5CZ2A 1KFSA 2G8IA 1TVRA 4CIGA 4KHWA 5C24A 3VQAA 4CEDA 4CCHA 4CEZA 4HCCA 3L2RA 3PX4A 4HVJA 2I5JA 1SV5A 4EP5A 1N6QA 1WSEA 5J1EA 3S3NA 1RDAA 1X9WA 3LAKA 1LAVA 1RTHA 1ZBUA 2IOCA 3LALA 4B9SA 4K8XA 4Z0UA 2YHBA 2OPPA 4QCLA 4CJEA 2QXFA 2YNIA 1D8YA 3LANA 3HPOA 4B9LA 4L8RB 3RR8A 2GUIA 4B9VA 3KLGA 1A5VA 1DTQA 1RT3A 3MEEA 4F2RA 2FBXA 3KLHA 4DG1A 1NK7A 1CXUA 1YT3A 2O4GA 3NF7A 4DLGA 1RT7A 2ZQBA 1Z25A 2P1JA 3LP3A 4CJQA 4BE1A 1MU2A 1RNHA 3L2QA 3ZCMA 4DLEA 4Q0BA 4CJRA 2X6NA 3L2UA 3TAEA 4FZYA 4W5NA 3DMJA 3NAEA 2VWJA 5HRPA 4B9MA 2D5RA 3TARA 2HNDA 1CZBA 3HP6A 4J2EA 1NOZA 4GVMA 3CM6A 2W42A 2P5OA 4Z4IA 2HVIA 3KLFA 3SV4A 2P51A 4B9TA 4Y1DA 4O4GA 4DU4A 3OJUA 4DU3A 4KRFA 3CM5A 1NKEA 4DSIA 1BIZA 3M8PA 3K59A 3VA0A 4NCAA 3LP2A 4F4KA 1VSIA 5E41A 3MEGA 3SUPA 3P5JA 5CYMA 1SKRA 3DRRA 3NF9A 4FLVA 3EYZA 1XHZA 3C6TA 1WSGA 1WSIA 4FW1A 5HRSA 4FM1A 3L3VA 4DSEA 2Y1IA 3SUQA 1L3VA 1JKHA 2X74A 5HRNA 4CF2A 2YHAA 4CJFA 3G0ZA 3TAPA 4CGFA 3QO9A 4FK2A 4RW4A 4CJTA 3OS0A 1BCMA 2KQ2A 3KD1E 3OYMA 4UQGA 3M8RA 4O44A 4B8CA 4F2SA 3QNOA 1LAWA 1CZ9A 3QIPA 5DMRA 3NBPA 1Y97A 4H4OA 4MFBA 2DFFA 3FFIA 5FDLA 4K8ZA 2YNHA 1QSYA 4ICLA 1ZBHA 4KO0A 5J2MA 4CGDA 3U6FA 1C1CA 1G15A 4B9UA 1WAFA 4W5RA 3S3OA 1SL2A 4CESA 1J5OA 2IAJA 1N5YA 2HNZA 4OLBA 3EY1A 4F3TA 4DQPA 1JLCA 4LY7A 5KRTA 3OYCA 1VRUA 4Z4CA 1KLMA 4KI4A 4C8NA 1JLQA 3NFAA 1TK8A 1NKBA 3B6OA 4HUFA 3SNNA 4I9LA 1VSKA 2YNFA 1I3AA 1ASVA 3SQ1A 2X78A 4DFPA 2DY4A 3VQ5A 1D5AA 4ZHRA 4O55A 3ZSQA 1BIUA 4E7HA 1LW2A 1I39A 4AHCA 2G8VA 2HW3A 4J2DA 2PYJA 1B9FA 1S9GA 5EU7A 2OZMA 1XHXA 2Q3SA 3TAGA 2Z1JA 1NK9A 2YKMA 2HHSA 1QTMA 4AHUA 1ASUA 1NK8A 4DTUA 3SZ2A 4HTUA 4RW9A 1SKSA 1L3SA 1RBRA 4PY5A 1T05A 2RN2A 1QE1A 3OYAA 1ZBLA 4Z4EA 1QHTA 1WSHA 3ASMA 3IG1A 2GBZA 3SUNA 1RTJA 4BACA 3HVTA 3ZSZA 4CHQA 3QLHA 2PYLA 3V9ZA 3NDKA 3VQ8A 3OYEA 3DOKA 1QSLA 1EETA 3DRPA 3A2FA 4FJ8A 3DLBA 1HMVA 1RDDA 3T3FA 3VQEA 3CFRA 3I0RA 2Z1IA 3OJSA 4CEFA 4FW2A 2BGGA 1VSHA 3LZIA 1W9HA 3AO3A 1RBVA 3I0SA 4DTXA 5J2PA 4EP4A 3UIQA 2KZMA 4LH4A 1VK0A 3AVJA 4CJ3A 3K58A 3P83D 1EKEA 1YVUA 4KI6A 3LP0A 3K57A 3HPHA 4BDPA 3ZT1A 2XY7A 2OPSA 4W5QA 2B4JA 1TAQA 4FJLA 4FLTA 5HP1A 3U3YA 1NJYA 3MEDA 2D0BA 3VQPA 1TL1A 4E89A 2NUBA 2Y1JA 3HM9A 4CECA 5J2QA 4TSXA 4FJGA 4WE1A 3PX0A 2VG5A 4I7FA 3OYLA 3KD5E 4DSFA 1S5JA 4PUOA 3WNFA 3RMDA 1JL2A 2IGIA 2HB5A 2KW4A 1KTQA 3SCXA 4KB1A 3HPGA 3AO5A 3L2WA 1Q9YA 4B08A 1NOYA 4FJ5A 4AILC 4PQUA 3HYFA 1RBTA 2EX3A 1RDCA 1D9FA 1JL1A 3L3UA 4FJMA 4BWJA 3NH1A 3ITHA 3D0PA 4IBNA 4JRPA 2HHQA 3AO4A 3KKRA 4OVLA 3MXJA 4BDZA 1QSSA 3ZT0A 2HHUA 3OYKA 1J53A 1NK4A 2VG7A 4FJNA 1TKZA 3HT3A 4ELUA 2O4IA 1TKDA 4F3OA 5FRNA 3AA3A 4CFBA 2PY5A 1Q8IA 1S6QA 3CG7A 3O3FA 3O3GA 4H8KA 5J2NA 4M3WA 3IAYA 2KZZA 1RT4A 1U04A 3QIOA 2P5GA 4HCBA 3SJJA 3V1QA 1IKXA 4DSLA 3OYJA 5K14A 2B5JA 1BL3A 1XWLA 4G1QA 1C0UA 4CJVA 4W5OA 4DQRA 1DTTA 2FBYA 4Y1CA 4E7LA 4M3YA 1RTIA 5I3UA 1KFDA 4CEBA 1A5XA 3ZT2A 4CHPA 4R5PA 1U49A 4DFJA 3V4IA 2DTUA 3KKSA 4PWDA 1XI1A 3KTQA 3OS1A 3VQ4A 1VSFA 1WSJA 2ITGA 3NGYA 1F21A 2Z1HA 2G8WA 1KCFA 2F8TA 4BDYA 3OVNA 1ZBIA 3AVMA 3SPZA 4FJIA 3WNEA 4KFBA 3F73A 4OGEA 3SV3A 2GV9A 2ZE2A 4CFCA 5KTQA 1L3UA 4FJHA 1IKVA 1VSEA 3DYAA 3WNGA 4Z4HA 3OYHA 2VWKA 4CJKA 3MAQA 2HHVA 2D0CA 1HRHA 1JXBA 3V9XA 3MXMA 2LSNA 1W0HA 2OA8A 4DFMA 2B6AA 4M3XA 3DRSA 3OS2A 4CEEA 4CK2A 1XC9A 1BGXT 3SQ4A 3HK2A 1RILA 2YV0X 3NF6A 3SUOA 1HJRA 2OPRA 4ZTJA 4CGHA 4IFYA 1X9MA 1TK0A 4KPYA 3CYMA 4DU1A 4CIFA 4M42A 3KK3A 3V1RA 4RW6A 4IFVA 3TANA 2WONA 4EZ6A 4CFAA 3LPUA 1HNVA 1WLJA 4DTJA 4CK1A 4DF8A 4CJLA 3ZSYA 1C0TA 2X6SA 1Z26A 2IDOA 4FYDA 3ISNC 1BHLA 3VQQA 5HROA 3AVHA 4CEAA 3VA3A 3BGRA 4I9QA 4E1NA 3NHGA 4KHUA 3IRXA 4O0IA 1S9EA 4M41A 4CJUA 2G8KA 1C0MA 4KAZA 1NJZA 1IKWA 3NH2A 4B9NA 1X1PA 1X9SA
chains in the Genus database with same CATH superfamily
3VPZA 1GLJO 4KV8A 3DI6A 4FWNA 5KGXA 4N5SA 4JI5K 4M3RA 3IS9A 3A5LC 4JHDB 2WOMA 4CZLA 2QEXN 3VF4A 3MCPA 3AA2A 1HPZA 2QWPA 3DWLA 3ID6A 1VHXA 1M90O 3AA4A 4C8KA 1EXQA 3MWTA 3WEEA 4C1NK 2GTDA 3IMXA 4CEQA 3HOTA 4O5FA 3KLIA 3CCMN 5SZTA 2OYQA 4DWIA 4F8RA 1RT6A 2I7PA 4DV7K 4K0KK 3NGIA 1IG8A 3S3MA 3LDSA 3L4QA 4H0TB 5DM6L 3PV8A 5GIPA 5BRDA 2ZJPL 4DS4A 3QESA 3CJAA 3H3NO 3C94A 1YJWN 4JRQA 3ALYA 4CGGA 3KLEA 2QKKA 4QS9A 4NYFA 3O4WA 4E3SA 1RBSA 1KSPA 3AVFA 5A2QO 3PX6A 4B3RK 4NCGA 1C6VA 4M3UA 4Y0WA 5AQRA 2JLEA 2YI1A 4LFAK 3ULDA 1GLAG 1T6DA 3LP1A 2HF3A 1GLCG 3V1OA 3H08A 4FLYA 4HWIA 1RGIA 3QEXA 3NH0A 1NGEA 4CZHA 1HYZA 4BR0A 1S1UA 4E7JA 1U48A 3MN9A 2XO7A 4B1UB 1UA1A 3KK1A 3KWGA 4MDAA 4O5BA 1B9DA 4DV1K 4QS8A 3SAHA 3VGLA 3ENOA 1ASWA 1IH7A 2BTFA 5CZ1A 1NGAA 5DK5A 3K5LA 1T7PA 1EX4A 1S1TA 2P9PA 5ADXH 2BDPA 3HI0A 3CCLN 3HBTA 3VQ7A 3QETA 4HUGA 1UOCA 3CMEN 1KC8O 4C8LA 3L0QA 5T7BA 5FPNA 1VQLN 2PBDA 1NGFA 3RRHA 3QEWA 1QQCA 3MWPA 4LD0A 4XIUA 4GMJB 1SZ2A 3BF1A 3C0BA 1TAUA 2A1RA 4FLWA 4OPJA 4YORA 3UB5A 4OKJA 2FSKA 5KI6A 1BISA 1NM1A 3ZLJA 2XY5A 4FZXC 4FXDA 1VSMA 3CCRN 3NE6A 3O8MA 3TSUA 4CFDA 3DOLA 4JS5A 1NK6A 4DTRA 1VQ6N 1VQ9N 5AQJA 1VQKN 4FWLA 4HHTA 4CHOA 1L5UA 3LWLA 4BRCA 2UU9K 5C12A 1HJOA 4FJ7A 3VQCA 1S3XA 2KTQA 2KFNA 2HHWA 3NGZA 3TWHA 5LJVA 4DS5A 4KTZA 1I94K 4DR2K 2DFEA 4BRIA 5C25A 4KHNA 3ATVA 5BN9A 3M3ZA 2HBKA 2NLXA 1FKPA 2E6MA 3K9JA 4B3OA 2F4VK 1BA1A 1OH7A 3TSQA 3CC4N 2QM1A 2OZSA 1X9JA 2E2NA 5AQFA 1Q9XA 1IBMK 3MXIA 1ZYQA 3QICA 3J80O 4LF4K 4CJSA 4I6MB 3HVRA 1LW0A 2XY8A 4PA1A 4DV5K 5HBMA 3VF6A 4PKHA 4DR1K 1C0GA 4DQQA 4CIEA 3SQ2A 4O8UA 3TI0A 3AVCA 1U4BA 4MLEA 3AVLA 3MCAB 5LMNK 5C24A 3L2RA 3TTCA 4HVJA 1SV5A 4B1VA 1WSEA 3CD6N 4LC9B 4B9SA 2OPPA 2QXFA 2YNIA 3LANA 4B9VA 1GLFO 3CETA 3TSPA 4YY3K 4F2RA 2FBXA 3KLHA 3WXMB 4YOTA 3BUZB 1EWQA 4IJAA 1RT7A 3LP3A 3L2UA 2O8FA 3WEEB 2HNDA 3VGMA 3HP6A 4J2EA 1WBBA 1P8ZA 3LDOA 4Z4IA 2HVIA 3KLFA 3SV4A 4FO0A 4Y1DA 4DR7K 2Q36A 3I33A 1TYQB 3H6EA 4KRFA 4A57A 4MDBA 3K59A 3VA0A 4FWPA 4B9QA 3LP2A 4PHTX 1YF5L 1VSIA 1OH8A 3SMSA 3THYB 1WSGA 1WSIA 2PZSA 3SUQA 3U9DA 1L3VA 5IT9O 4CF2A 4JI0K 1DEJA 4RW4A 3OS0A 4JKDA 3D6RA 4BC5A 4O44A 4AQYK 3LM9A 3G4SN 5JVHL 1LAWA 4YOXA 2E5LK 3QMLA 1Y97A 4B1ZA 4MFBA 4K8ZA 4ICLA 4KO0A 4X62K 1V4TA 4GKJK 4EFHA 1WAFA 2QWQA 4W5RA 3S3OA 4BC3A 4MLHA 2IAJA 4BG8A 4OPHA 1JLCA 3SK3A 1VRUA 4XEIA 4Z4CA 2UYTA 4KI4A 1JLQA 3I56N 4HUFA 4DUZK 1VSKA 2YNFA 1I3AA 3SQ1A 2X78A 2DY4A 4ZHRA 4CZIA 5AQHA 4KH5A 1LW2A 3A5NC 4BR5A 2NRRA 4KHPK 1SQKA 2Z1JA 1NK9A 1NK8A 1YI2N 2P9PB 3SAFA 4RW9A 4HTUA 1HX1A 4JI7K 4EIAA 2RN2A 3BP8A 4CHQA 3QBXA 3V9ZA 3VQ8A 3PLAA 2UUCK 1HMVA 3T3FA 3OJSA 4JKGB 1RDWX 5FPMA 3LZIA 1RBVA 3HOSA 5J2PA 2VWBA 4U7BA 3P83D 4BRAA 3J8AA 3LP0A 3VEYA 2B4JA 2YHXA 4FJLA 4FLTA 1NJYA 3U3YA 3D7EO 4E89A 5GAEP 1K8AO 5M1KA 2P9IA 2NRVA 2QXLA 4FWKA 5E84A 3OA9A 1U6ZA 3SLCA 4OPAA 3PX0A 3WXKA 3WNFA 3RMDA 3FE1A 3SCXA 2P9LA 3VOVA 3L2WA 1TUYA 3HYFA 4BWJA 3NH1A 3ITHA 2HHQA 5C2FA 5IWAK 1QSSA 5AQNA 1NMNA 2O8DA 1TKZA 4F9OA 3CPEA 1VQ4N 3O5BA 4CFBA 2PY5A 5FRNA 3T69A 1IKXA 3OYJA 4G1QA 4W5OA 2CGJA 4G9ZA 3O80A 4CEBA 3ZETB 4R5PA 4OX9K 3V4IA 3KTQA 1KAXA 1XMQK 2Q2RA 3NGYA 2Z1HA 4CZMA 5EVZA 1ZBIA 4KFBA 3W0LA 3F73A 4CFCA 1L3UA 2E1YA 1VSEA 4Z4HA 1HLUA 2VWKA 4Z94A 4CJKA 4ISEA 3EZWA 3OW2M 2HHVA 4ILGB 3J7ZO 4WQ4A 1D4XA 4H0PA 3HK2A 3NF6A 1EWRA 2YV0X 3SUOA 4IFYA 1X9MA 5FLXO 1Q86O 4M42A 4CFAA 3CCSN 1Z26A 5AQUA 2UXBK 1XNQK 4B3MK 2QWNA 4CEAA 4CJUA 4KAZA 1NJZA 3ULEB 3NH2A 1KAZA 4CK3A 1WN7A 5AQKA 1QVFM 3JSMA 1ZXOA 5ADXA 2G8UA 4B3TK 3TABA 3P38A 2NRTA 1VSLA 2XY6A 4YHHK 2KHOA 5AFUH 3SQ0A 4RTFD 4RWTA 2Z1GA 3GBTA 3TTFA 4DTNA 1RT5A 2E2PA 3UKUA 4FJ8A 4YDUA 4K25A 2RE2A 4FJKA 1MA9B 2P9SB 4ZTFA 1NLVA 2ZD1A 4LSLA 3V9UA 1TGOA 4IG3A 3ZT4A 4CHZA 1KRPA 3K5MA 3QINA 2E1ZA 2ASPA 1YTUA 3CJ7A 5KRSA 5TKWA 3JYTA 3K2PA 4B8AB 3LWMA 3TR8A 4DTOA 1C1BA 1BDGA 5BPMA 4UY8O 3L2VA 1WAJA 4I2PA 4BREA 2G8FA 2H3GX 5C15A 2WFBA 2R7YA 4JS4A 4JLHA 4HUEA 4CHYA 4KB0A 3T7ZA 3V81A 3WUHA 4RG8A 1YAGA 3HO1A 1RT2A 1KLNA 4CJ7A 3LAMA 3PIPL 1BOTO 1LV5A 3H45C 5KGWA 3DXMA 4H5RA 1HR0K 2IS3A 1WSFA 2FC0A 4ILJA 3PO5A 4KBOA 3ZT3A 4WFAL 1KVBA 3T1HK 2Q0RA 3CQ8A 3THVA 4DQIA 4KTWA 3M1FA 2KFZA 1O1WA 4R79A 3HJFA 1FXXA 1BI4B 1HQUA 1VSDA 3IKMA 1IO2A 1BQMA 1JXEA 4C8OA 1LWEA 2BE2A 3O9SA 3RSEA 3T1AA 1SL0A 4DFKA 1YIJN 2GUPA 3AA5X 3HM8A 4CHNA 3K5OA 4CF8A 1RT1A 4WFBL 1HKCA 3GG4A 4CERA 1LWFA 3WQUA 4LF8K 3DJCA 3CQXA 4FWRA 3ZSWA 2HNYA 3KZBA 5HLFA 1VSJA 2QTDA 5I42A 1KQSM 3NMUA 3CI5A 4C23A 3LPTA 3UKRA 1NNEA 1JLAA 2YHYA 3AO1A 5JICA 1TK5A 2RF2A 3MN6A 4KHYA 1BCOA 2P9NB 4FJ9A 3VF2A 1SKWA 3HL8A 2YKNA 4IEEA 3WNHA 2YJFA 2ATQA 5AJ3K 4CGIA 2A5XA 4YDUC 2XHBA 1LOTB 1S72N 5C2DA 3ZSXA 1A5WA 3H1QA 1R0AA 1T3VA 4CZEA 4N56A 5JS1A 4JKGA 5BPLA 4BE0A 2Q97A 3QERA 3CC2N 3O9RA 4L3QA 4BRDA 4FZZA 2O8FB 2HF4A 1H1VA 1YVNA 3IDHA 1QS4A 4JI2K 4FM2A 5FROA 3VTIA 4CJWA 3VQDA 2HOEA 3DXKB 1VQ5N 1GOCA 5AQPA 3MMVA 2ETJA 1BI4A 1E3MA 4WF9L 4DSJA 3D2EA 4E19A 3D2FB 3CFPA 3PO4A 4I2QA 4GY2B 2HHXA 3AO2A 4KHSA 4RW8A 5AR0A 1CXQA 4NO7A 1U2VB 4NLCA 3VQ6A 1EO1A 3HZ6A 3MK6A 3AVIA 4FCYA 1RCHA 3AGKA 3EEQA 3H3OB 2FXUA 3CIPA 4JD2A 5BR8K 4CZFA 1KFSA 2G8IA 4H5VA 4JI6K 3VQAA 4BRMA 4CW7B 1GLBG 4CEDA 4HCCA 3AGRA 5DM7L 2I5JA 2O8BA 2HBMA 3LALA 3OHRA 2YHBA 4BRQA 1D8YA 4L8RB 4WQ5A 4BVPA 4YOUA 2V7ZA 3MN5A 3IUCA 1XNRK 3KLGA 2ITMA 1A5VA 4WFNL 4DG1A 5JLHA 2O4GA 3VERA 5C10A 4DLGA 2P1JA 1MU2A 1RNHA 4DLEA 3ZCMA 4Q0BA 4DR5K 4BRNA 3UE5A 3DMJA 4JKEA 4B9MA 5HRPA 2NRHA 4JK8A 1V4SA 3TARA 3CC7N 3P39A 3SBTA 3AAPA 3CM6A 4NLBA 1SS6A 1M1KO 4B9TA 3FFKB 5JMVA 1W7AA 4DU4A 3OJUA 4JK7A 1O13A 2F9WA 3CM5A 2UXDK 4DSIA 1E4GT 3M8PA 4F4KA 3CCVN 3MEGA 1SKRA 5CYMA 4DV4K 3DRRA 3NF9A 2QWRA 4FLVA 5HRSA 4DSEA 4FM1A 3L3VA 1NGCA 2Y1IA 1DGKN 4CJFA 2BH1A 4FK2A 4CGFA 3QO9A 4CJTA 1BCMA 2KQ2A 3KD1E 3OYMA 3M6GA 3CCJN 3ZEUA 1K8KB 4B8CA 3CJCA 4KH4A 3QIPA 5DMRA 4H4OA 5FDLA 1NJIO 1QSYA 1ZBHA 1X3MA 3CQYA 4KH6A 1G15A 4CESA 2HNZA 5F2RA 3AY9A 4F3TA 4IEIA 4DQPA 3OYCA 2W6KA 4C8NA 1TK8A 1NKBA 2CGLA 3SNNA 2NZTA 5GAGP 2FSJA 4DFPA 3F2KA 4O55A 3ZSQA 4AHCA 4J2DA 2GX9A 1XHXA 2Q3SA 2HHSA 1QTMA 4AHUA 2IIRA 2DPNA 3OBYA 5M1QA 1L3SA 5JLFA 1RBRA 1T05A 3LDNA 1ZBLA 1WSHA 3IG1A 3SUNA 4BACA 5KPZA 2PYLA 3NDKA 2CH5A 3A2FA 3I0RA 2Z1IA 3O1BA 1ESVA 5M1FA 1OH5A 4FW2A 2AA4A 3AO3A 4IJNA 2W41A 3I0SA 3CJ9A 4LF6K 5C0YA 4DUYK 4IZ9A 3K57A 2E2QA 2XY7A 4W5QA 5HP1A 3MEDA 2D0BA 1NGDA 2Y1JA 3HM9A 4FJGA 1BUPA 1QQMA 4WE1A 2OANA 4I7FA 3SAGA 2HB5A 4ISFA 2VCPA 3AO5A 3BZKA 4XH4A 5AQXA 2EX3A 2W6LA 1D9FA 1JL1A 3L3UA 4FJMA 4IBNA 3AO4A 2WUSA 5FPDA 3ZT0A 3QB0A 1NK4A 2VG7A 3HT3A 4ELUA 1GLDG 4F3OA 3T1YK 1S6QA 3CG7A 3O3FA 2UUBK 1WOQA 3ENHA 4JKCA 3QIOA 2P5GA 3SJJA 2B5JA 3VEXA 3PSFA 4Y1CA 1KFDA 1DKGD 1A5XA 1U49A 3G71N 1C0FA 3CMAN 4DFJA 3P4IA 4PWDA 3OS1A 3VQ4A 4WQ5C 3A5MC 2HBJA 2F8TA 5AQVA 4FJIA 4FJHA 4OGEA 2O8EA 2ZE2A 4K41A 1IKVA 3DYAA 4BRFA 5H1SQ 3MAQA 2LSNA 1W0HA 4GVEA 3OS2A 2D1KA 1BGXT 2GWJA 1RILA 2E8AA 2OPRA 2UXCK 3SJHA 2NRZA 3SBGA 3KK3A 2P9IB 4I6MA 1WLJA 4DTJA 4DF8A 4CK1A 4CJLA 2IDOA 1BHLA 1YHQN 5HROA 2CH6A 4FOEA 3BGRA 4I9QA 3NHGA 3IRXA 4O0IA 1HNWK 4M41A 2Q31A 1T44A 4IOXA 1NOZA 3EO3A 3E01A 3THXB 1S1WA 4CZKA 1GOAA 5HRRA 4YOYA 3KHYA 1LWCA 4BVOA 3OYDA 1GOBA 1TV6A 4DV6K 1Q81O 2A42A 3BY5A 3KIOA 4AHSA 3D45A 4DTMA 1SAZA 3BF3A 4CEOA 2YCHA 4KTQA 4Q5VA 3I8DA 5F0XA 3K9KA 3CJ1A 4OJRA 1T8EA 3U4LA 3A5OC 3R1XA 4Z4FA 1S22A 3RTVA 3SI6A 3OYGA 1YJ9N 2FBTA 4CE9A 4M3ZA 3VESA 1ZBFA 4AH9A 2HSTA 3VEVA 3K5NA 3M8SA 4E7KA 4NXMK 2P9UA 2P9KB 1SUQA 5AZJB 1NGGA 4N41A 3LZJA 2ZJQL 5EX5A 3H46O 1XMOK 3O9TA 3PY8A 1NBWA 4KKOA 4EAHD 3DLGA 1NKCA 1OH6A 3CXCM 3O3HA 5CE3A 4BWMA 2OTLN 1Y64A 2O8CB 2FBVA 4GV6A 1J54A 2QI2A 3V9WA 3RMCA 4RCHA 3F5TA 3OY9A 3J7YP 3JAMO 1UA0A 2A1SA 1JLGA 1TL3A 3JS6A 3CF5L 2HHTA 3AV9A 4FPAA 5M1PA 4H0VB 4OLAA 2NNWA 1TYQA 3L6QA 4DTPA 1S1XA 1FK9A 4N47A 4JK9A 1C1AA 4BE2A 5FRMA 1NGJA 5AQIA 1MDUB 1OVYA 2QWMA 1Z05A 3P31A 3NCIA 4EZ9A 4CVNE 3C65A 4IWVA 2V51B 1HPMA 3R6MA 4FLUA 1NK0A 4EHUA 2D0OA 1QZ5A 3E9OA 4QAGA 4CZGA 4GV3A 1HYVA 4JN4A 3A8YA 1T03A 1HKGA 4QOZB 2F8SA 3RR7A 2WC9A 5CYQA 2AJQA 4H4MA 1Q7YO 1WB9A 1N34K 4ID5A 4FM0A 4H0XB 3QEIA 3ZSRA 1ATNA 4CJPA 1XQSC 3TU5A 3AVGA 2D0PA 4AHRA 4IKFA 3VEOA 1EQYA 1NGHA 3U3GA 4LF5K 2QKBA 4MQ3A 3V6DA 3HRGA 4CD1A 4FJXA 4A5AA 3MECA 1TKXA 4E7IA 4FVMA 3ZSOA 5AZJA 2P9KA 5BPNA 4OO1J 1UAXA 3VGKA 3NVKA 1ILYA 3VN5A 3Q7CA 4DR4K 1U47A 3SMPA 3TPQA 5LL6Z 1B92A 3O4QA 4LSNA 1JLBA 1E4FT 3AVKA 1TKTA 4OKEA 4YOWA 4DMNA 4FK4A 2G8HA 1VQPN 5GINA 1JLFA 3DLRA 3IFRA 5BRHA 4N76A 3J7AP 3C6HA 4IO9L 2UUAK 1NU0A 4WCEL 3KJVA 1MWMA 4IO8A 1HNXK 3NVMA 4FJJA 3CFOA 2AP1A 1IKYA 3C6UA 4E0DA 4LH5A 4JKAA 1QZ6A 1WUAA 3O4NA 5TKYA 2HMPA 3DLKA 2WTUA 1D9DA 1EP4A 1YTAA 3QFUA 3GE1A 2HMIA 2YX6A 4CF1A 3OYBA 5AQOA 4BR4A 4IDKA 2BANA 1NJWA 4CF9A 3RWUA 2EHGA 4FOIA 4OKKA 4CIGA 4KHWA 1BA0A 4CEZA 3PX4A 1N6QA 3M5RA 3ID8A 3D2FA 3CERA 1RDAA 3LAKA 1LAVA 1ZBUA 4C1NI 3Q7BA 4QCLA 4CJEA 3HPOA 4B9LA 1G99A 1DTQA 1RT3A 4BR9A 5AQZA 1IBKK 1NK7A 1YT3A 4AM6A 3NF7A 2ZQBA 3MX5A 3L2QA 4CJRA 1VQNN 4X65K 3MX2A 2VWJA 2D5RA 4IXCA 2NRWA 3E66A 4BY9C 4A2BA 4GVMA 5AQSA 1MWKA 2P5OA 3FZLA 2P51A 1GLEG 3ZETA 4XH5A 2A40A 3PIOL 2ZWHA 1ZC6A 1NGIA 5E41A 2RHKA 3VMFB 3THXA 3EYZA 1XHZA 4B1YB 2I7NA 2X74A 3G0ZA 2ASMA 4UQGA 4IOCL 1WBDA 3QNOA 1CZ9A 2DFFA 3FZFA 2P9LB 4CGDA 3U6FA 1C1CA 2WBNA 4B9UA 1SL2A 4BC2A 1J5OA 5ELZA 4X66K 4PKGA 4BQZA 3WQTA 3FR0A 1K73O 3NFAA 4QS7A 3PSIA 4JAXA 4JNEA 3B6OA 1ATSA 4I9LA 3CJBA 1ASVA 2VYPA 4HTLA 3VQ5A 4EHTA 1D5AA 1W2BM 4E7HA 3ATUA 2G8VA 4O8KA 3C6AA 4CBXA 2PYJA 2E2OA 1B9FA 1S9GA 2A6AA 5EU7A 2OZMA 5AQMA 3TAGA 3EE9A 2YKMA 1XC3A 2NRXA 3SZ2A 4PY5A 3KVGA 1QE1A 3OYAA 4Z4EA 1QHTA 3HVTA 4PL7A 1QSLA 3ENBA 4NXNK 1JCFA 3E9LA 3VQEA 3CFRA 4K42A 2BGGA 1VSHA 1W9HA 2KZMA 4LH4A 3AVJA 3K58A 4KI6A 2HBLA 3HPHA 4BDPA 3O9UA 1TL1A 2NUBA 4K43A 2W40A 3KWIA 2KKZA 5J2QA 2ZF5O 2BUPA 3CPWM 3KD5E 1S5JA 3CCEN 1JL2A 2O8CA 4FJ5A 4JKHA 4PQUA 1DT9A 4MO4A 1RBTA 1HNZK 4AF1A 3D0PA 3LDPA 2GWKA 1YITN 3OYKA 3GDQA 3VENA 4A59A 5HL7L 4FJNA 2O8EB 2O4IA 1N36K 5AFUA 4M3WA 2KZZA 2Q0UA 1QQNA 5J2NA 3WXIA 1U04A 5AQYA 4HCBA 4BRGA 4LF7K 4DQRA 1XWLA 1C0UA 3RVCA 5AQTA 4JV5K 1N8RO 2E20A 2D4WA 4CHPA 2YHWA 2GELA 3ZT2A 5GADP 3U8XA 4GV9A 2PAVA 1TUUA 2DTUA 4LFBK 5I9EB 1XI1A 2FLOA 3B8AX 3O9QA 1VSFA 2Q1NA 1F21A 1KCFA 3AVMA 3SV3A 5KTQA 1NG9A 3OYHA 1FW6A 2JWLA 3KK7A 2D0CA 4E1JA 1N32K 3V9XA 5GAHP 2OA8A 3LM2A 3DRSA 3EKUA 4JI8K 2IVOA 1XUPO 4BRHA 4FWOA 4CEEA 4B1WB 3HTVA 4ZTJA 1HJRA 4DQ8A 1BU6O 4CIFA 3V1RA 4IFVA 3HSCA 1C0TA 2X6SA 4FYDA 3VQQA 1VQON 1NWKA 3AVHA 3VA3A 4E1NA 1CZAN 4B9NA 2CGKA 1X1PA 2OPQA 3BEXA 3G6EN 1JJ2M 3OBWA 3P1GA 3DXKA 4WQ4C 3PUFA 2P9SA 3RRGA 3HP9A 1RBUA 4RW7A 1VQ7N 2QK9A 4A2AA 3B6PA 5JS2A 4FVUA 3VQBA 1U45A 3QFPA 3AVAA 1SL1A 4YNQA 3M8QA 4JYAK 3OTOK 5AQQA 4NCBA 1J9AA 1REVA 4BGAA 2RPIA 3VETA 3T19A 3OYNA 3AVBA 2D0AA 5KQ8A 1K6YA 1JCGA 1CLQA 2JGUA 5D3GA 3TAMA 3LDLA 3TTDA 1S1VA 4BC4A 3C7NB 5AQWA 4DCHA 5BN8A 4M45A 5CR4A 1W97L 2ZGZA 1RDBA 1OKJA 3DM2A 4DR6K 4ELTA 5C42A 1NGBA 4OGCA 4AM7A 3U9ZA 4JKBA 1KXPA 2V52B 4JD2B 3L8BA 3R8EA 3MN7A 3FZHA 4H03B 3J81O 3ZEUB 4FLZA 4XH1A 1X3NA 3BDPA 1KVCA 4FSVA 3W3DA 1U2VA 5SWMA 2F7TA 2V7YA 5E26A 4FK0A 1IJJA 3N4PA 3C95A 1HQEA 4M7XA 5LY3A 3SPYA 4DTSA 2VGMA 3KK2A 3DLHA 3AVNA 3D2EB 3WT0A 3EZ5A 4CJ5A 3WXLA 4CGJA 1P90A 3VEWA 3FGUA 3F9MA 4O0JA 4FL9A 1IBLK 5CY4A 1KVAA 2F96A 3VQ9A 2DFHA 4M7YA 4W5TA 3QNNA 4C8MA 3G10A 3FZMA 1HUXA 3SYZA 4B3SK 4FWQA 3S9HA 4GW6A 4AHVA 3O6WA 3GL1A 4JHDA 1VAZA 4DQSA 4LFCK 5BR9A 1FJGK 3DXMB 5KQDA 4CJ4A 4NYNA 3RMAA 2EWSA 4BRPA 4OPKA 3R9PA 1L3TA 4DF4A 2ZGYA 3O08A 4JI4K 4H5NA 4E1MA 4J2BA 2IC3A 4IDHA 3EKSA 1ATRA 3ZSVA 4Z4GA 4IG0A 4PL8A 1BWFO 4M3TA 4DV0K 1J5EK 4ILHA 1ZBSA 3NF8A 1VQMN 4BR7A 4YOVA 3C7NA 5BREA 3QEVA 1HKBA 1UWBA 4FLXA 1IG9A 3QEPA 5AZIB 3THWA 2JWKA 1K8KA 1BG3A 4ID1A 4AHTA 3HXMA 1QQOA 3FLCO 1BQNA 1FKOA 1WNSA 3DLEA 2RKIA 4J8FA 1S6PA 3CCUN 3I55N 1DLOA 1NJXA 1Z6RA 1HYSA 3CCQN 5AQGA 3K0SA 2YNGA 5LJWA 4DSKA 1JLEA 1HNIA 2E6LA 3TAQA 1ITGA 4FWMA 4J2AA 2VG6A 3A0IX 4JI1K 5M1NA 4YFUA 3AAQA 2QA4N 1GLLO 3QBWA 1VRTA 4FPBA 4ELVA 2HVHA 3V9SA 1RFQA 3QDKA 3HSTB 4CD3A 4JEPA 2E4LA 5KPRA 5BRFA 3RMBA 1RTDA 5LMUK 5GIOA 4DR3K 3H1VX 3DLLL 3OYFA 4KHQA 4M63C 1IV0A 3F9KA 4CF0A 3OYIA 3TAFA 5KPTA 2FF6A 3VTHA 4WYBA 4MO5A 1NK5A 3E9PA 5CZ2A 2XRIA 4JI3K 1TVRA 1YUWA 4CCHA 2ZJRL 2A41A 1T6CA 4EP5A 1KD1O 4LF9K 5HOOA 1QVGM 5J1EA 3S3NA 1X9WA 1RTHA 2IOCA 1KAYA 4K8XA 4X64K 1BO5O 4Z0UA 3THYA 3EN9A 1K9MO 5AQLA 3FZKA 3RR8A 2GUIA 1VQ8N 1N33K 3MEEA 1CXUA 4BE1A 1Z25A 4CJQA 2X6NA 3TAEA 4FZYA 4W5NA 3NAEA 3O1WA 3RSEB 2ZM6K 4DKWA 1NMDA 1CZBA 4IFEA 4H5TA 1R59O 2W42A 5FPEA 1YJNN 4O4GA 4DU3A 5F1XA 1NKEA 1BIZA 3LDQA 4NCAA 1RDUA 3SUPA 3P5JA 3C6TA 4FW1A 1JKHA 3AARA 5HRNA 2YHAA 5EXWA 3VEZA 3TAPA 3N4QA 3M8RA 4H0YB 4F2SA 4A62A 3NBPA 4A61A 3FFIA 2YNHA 5J2MA 3CHWA 2FSNA 2P9NA 3S41A 2ASOA 1N5YA 1Q18A 4OLBA 3EY1A 4CI6A 4LY7A 5KRTA 4BROA 1KLMA 3UKRB 3BZCA 1BIUA 1I39A 2HW3A 4A5BA 1JCEA 3LL3A 3UKUB 5M1OA 1SKSA 1ASUA 1LCUA 4DTUA 2FF3B 2IVPA 1Q82O 3ASMA 2GBZA 1RTJA 3ZSZA 3QLHA 4B1XB 3OYEA 3DOKA 1EETA 3DRPA 3DLBA 1RDDA 4CZJA 5MLCQ 4DV3K 4NB4A 1YXQA 4CEFA 3ZX3A 3E1YA 4IOAL 4DTXA 4EP4A 3UIQA 4BGBA 4CBWA 3ULEA 1VK0A 4CJ3A 2F9TA 4PKIA 2O8DB 1EKEA 1YVUA 4BR2A 3I8BA 3ZT1A 4BRLA 2OPSA 2QWLA 1TAQA 2VGNA 3VQPA 4DHYA 4DB3A 4CECA 4TSXA 1J6ZA 2VG5A 3OYLA 4DSFA 4BRKA 4PUOA 2QWOA 2IGIA 2KW4A 4KREA 1KTQA 2P9UB 4KB1A 3HPGA 4GKKK 1Q9YA 4B08A 2IVNA 1NOYA 4AILC 1RDCA 1QHAA 2QW9A 3G25A 5EY4A 4JRPA 3KKRA 4OVLA 3MXJA 3ZYYX 4BDZA 2HHUA 1J53A 3EL2A 1TKDA 3AA3A 1Q8IA 3O3GA 4BG9A 4H8KA 3IAYA 1RT4A 3V1QA 2YJEA 4DSLA 5K14A 1BL3A 4CJVA 1DTTA 2FBYA 4E7LA 4M3YA 3R3LA 4FWSA 1RTIA 5I3UA 2A3ZA 3DAWA 3ZX0A 4CBUA 3KKSA 2GEMA 4ISGA 1OVQA 4V19S 1WSJA 2ITGA 2J4RA 4H5WA 2E88A 2G8WA 4BDYA 3OVNA 3SPZA 2OTJN 3WNEA 2GV9A 3JXUA 4H0OA 4BQLA 3WNGA 2OCEA 2KLAA 1HRHA 5AZIA 3THWB 1JXBA 3MXMA 4DV2K 3EE8A 4DFMA 2B6AA 4M3XA 3L4IA 4U67L 4CK2A 1XC9A 3SQ4A 5JVGL 2PFUA 4JKFA 5EOYA 2O8BB 4CGHA 1TK0A 4KPYA 2VQEK 3CYMA 4DU1A 2HHHK 5B8HA 4RW6A 3TANA 4EZ6A 2WONA 3LPUA 1HNVA 3ZSYA 3ZX2A 3ISNC 3WXJA 5CHIA 4KHUA 1S9EA 4GNIA 2VQFK 2G8KA 1C0MA 3GOIA 3MDQA 1IKWA 1X9SA
chains in the Genus database with same CATH topology
3E01A 2OPQA 4KV8A 4CK3A 1WN7A 3DI6A 5KGXA 1S1WA 4N5SA 4M3RA 3IS9A 3JSMA 1GOAA 5HRRA 3P1GA 2WOMA 3PUFA 2G8UA 1LWCA 3RRGA 3HP9A 1RBUA 4RW7A 3TABA 2QK9A 3OYDA 1GOBA 1TV6A 3B6PA 1VSLA 5JS2A 2XY6A 3KIOA 4AHSA 3AA2A 3VQBA 3D45A 1HPZA 3SQ0A 1U45A 3AA4A 3AVAA 1SL1A 4YNQA 3M8QA 4DTMA 4C8KA 1EXQA 2Z1GA 4CEOA 4KTQA 4DTNA 4NCBA 4Q5VA 3I8DA 1RT5A 1J9AA 4CEQA 1REVA 4OJRA 3KLIA 2RPIA 1T8EA 4Z4FA 5SZTA 3T19A 3OYNA 3RTVA 3AVBA 2OYQA 3SI6A 3OYGA 4DWIA 4F8RA 1RT6A 2D0AA 4FJKA 1K6YA 2FBTA 3NGIA 4CE9A 4M3ZA 4ZTFA 2JGUA 1ZBFA 4AH9A 2ZD1A 4LSLA 3V9UA 3TAMA 1TGOA 4IG3A 3ZT4A 4CHZA 3K5NA 1KRPA 5D3GA 3S3MA 3K5MA 3QINA 3LDSA 1S1VA 3M8SA 4E7KA 1YTUA 5KRSA 1CLQA 3JYTA 3K2PA 4B8AB 4M45A 3LWMA 1SUQA 3TR8A 4DTOA 3PV8A 4DS4A 1C1BA 3QESA 1RDBA 4N41A 3LZJA 3L2VA 3C94A 1WAJA 4I2PA 3ALYA 3DM2A 4JRQA 4CGGA 3KLEA 2QKKA 5C42A 2G8FA 3PY8A 4NYFA 4ELTA 2R7YA 4KKOA 4JS4A 1RBSA 4JLHA 4HUEA 3DLGA 4CHYA 4E3SA 1KSPA 3AVFA 4OGCA 4KB0A 1NKCA 3PX6A 3V81A 3O3HA 4BWMA 4NCGA 3L8BA 1C6VA 2FBVA 4M3UA 4RG8A 3HO1A 1J54A 1RT2A 3V9WA 3RMCA 2JLEA 1KLNA 3OY9A 4FLZA 3LAMA 3BDPA 1UA0A 3ULDA 1LV5A 1KVCA 3LP1A 5KGWA 5SWMA 2IS3A 1WSFA 2FC0A 3H08A 3V1OA 3PO5A 2A1SA 4FLYA 1JLGA 1TL3A 4FK0A 4KREA 2HHTA 3ZT3A 3AV9A 1KVBA 3C95A 1HQEA 3NH0A 3CQ8A 3QEXA 4DTSA 3SPYA 3THVA 4KTWA 4DQIA 2KFZA 1O1WA 3KK2A 3DLHA 3AVNA 1HYZA 4OLAA 3HJFA 1S1UA 4E7JA 4DTPA 1S1XA 1FK9A 4N47A 1U48A 1FXXA 1BI4B 4CJ5A 1HQUA 2XO7A 3EZ5A 1C1AA 1VSDA 4BE2A 1IO2A 4CGJA 5FRMA 1UA1A 3KK1A 1BQMA 4EZ9A 1JXEA 3NCIA 4O0JA 5CY4A 4C8OA 1KVAA 2F96A 1LWEA 2BE2A 4O5BA 4FLUA 1NK0A 3VQ9A 1B9DA 2DFHA 3T1AA 1SL0A 4W5TA 3QNNA 4QAGA 4DFKA 4C8MA 1HYVA 3AA5X 4CHNA 1ASWA 3K5OA 1T03A 3G10A 4CF8A 2PZSA 4QOZB 1IH7A 1RT1A 5CZ1A 5DK5A 3SYZA 3S9HA 3K5LA 4GW6A 4AHVA 1T7PA 3RR7A 2F8SA 1LWFA 4CERA 4DQSA 1EX4A 1S1TA 5CYQA 2AJQA 4H4MA 2BDPA 3ZSWA 2HNYA 3VQ7A 5HLFA 4ID5A 4FM0A 3QEIA 4CJ4A 1VSJA 3QETA 4NYNA 3RMAA 3ZSRA 4CJPA 1UOCA 4HUGA 5I42A 4C8LA 3AVGA 4AHRA 5T7BA 4OPKA 1L3TA 4DF4A 4IKFA 4E1MA 4J2BA 3U3GA 2IC3A 1QQCA 3LPTA 3RRHA 4MQ3A 3QEWA 2QKBA 4LD0A 1JLAA 3ZSVA 4XIUA 4GMJB 3V6DA 4Z4GA 3AO1A 4FJXA 1TAUA 4IG0A 1TK5A 2A1RA 2RF2A 4OPJA 4FLWA 3MECA 4M3TA 4OKJA 5KI6A 1TKXA 1BISA 4E7IA 4KHYA 1BCOA 4FVMA 3ZSOA 2XY5A 4FZXC 4FJ9A 3NF8A 4FXDA 1VSMA 1SKWA 3HL8A 2YKNA 1UAXA 3NE6A 3WNHA 4CFDA 3QEVA 1UWBA 3VN5A 4FLXA 3DOLA 1IG9A 4JS5A 2ATQA 1NK6A 3QEPA 1U47A 4DTRA 4CGIA 2XHBA 1B92A 4ID1A 4AHTA 3O4QA 4LSNA 4CHOA 1JLBA 3ZSXA 3HXMA 4HHTA 1L5UA 3LWLA 1A5WA 1R0AA 3AVKA 1BQNA 4FJ7A 4N56A 1FKOA 1TKTA 1WNSA 3VQCA 3DLEA 4OKEA 2RKIA 5JS1A 1S6PA 4DMNA 4BE0A 3QERA 2G8HA 4FK4A 2KTQA 1DLOA 1NJXA 1HYSA 2KFNA 2HHWA 2YNGA 4DSKA 4FZZA 3NGZA 1JLEA 1HNIA 1JLFA 3TWHA 2E6LA 3TAQA 1QS4A 1ITGA 4DS5A 4KTZA 4J2AA 2VG6A 3DLRA 4YFUA 4FM2A 4N76A 2DFEA 5FROA 5C25A 4KHNA 4CJWA 3VQDA 1GOCA 1VRTA 4ELVA 1FKPA 2E6MA 3KJVA 4B3OA 2ETJA 1BI4A 2HVHA 4FJJA 3CFOA 3V9SA 1IKYA 3C6UA 4DSJA 4E0DA 4LH5A 4E19A 3CFPA 3HSTB 2OZSA 3PO4A 4I2QA 2E4LA 2HHXA 1Q9XA 3AO2A 3O4NA 4RW8A 3RMBA 3MXIA 1ZYQA 1RTDA 4KHSA 3DLKA 1CXQA 4CJSA 3HVRA 1D9DA 1EP4A 1LW0A 1YTAA 3VQ6A 3OYFA 2XY8A 4PA1A 4KHQA 2HMIA 5HBMA 3AVIA 4CF1A 3OYBA 4FCYA 1RCHA 3F9KA 4CF0A 3OYIA 4DQQA 3TAFA 4CIEA 4IDKA 3SQ2A 3TI0A 2BANA 1NK5A 3AVCA 1U4BA 1NJWA 3AVLA 4CF9A 3RWUA 2EHGA 2XRIA 4OKKA 5CZ2A 1KFSA 2G8IA 1TVRA 4CIGA 4KHWA 5C24A 3VQAA 4CEDA 4CCHA 4CEZA 4HCCA 3L2RA 3PX4A 4HVJA 2I5JA 1SV5A 4EP5A 1N6QA 1WSEA 5J1EA 3S3NA 1RDAA 1X9WA 3LAKA 1LAVA 1RTHA 1ZBUA 2IOCA 3LALA 4B9SA 4K8XA 4Z0UA 2YHBA 2OPPA 4QCLA 4CJEA 2QXFA 2YNIA 1D8YA 3LANA 3HPOA 4B9LA 4L8RB 3RR8A 2GUIA 4B9VA 3KLGA 1A5VA 1DTQA 1RT3A 3MEEA 4F2RA 2FBXA 3KLHA 4DG1A 1NK7A 1CXUA 1YT3A 2O4GA 3NF7A 4DLGA 1RT7A 2ZQBA 1Z25A 2P1JA 3LP3A 4CJQA 4BE1A 1MU2A 1RNHA 3L2QA 3ZCMA 4DLEA 4Q0BA 4CJRA 2X6NA 3L2UA 3TAEA 4FZYA 4W5NA 3DMJA 3NAEA 2VWJA 5HRPA 4B9MA 2D5RA 3TARA 2HNDA 1CZBA 3HP6A 4J2EA 1NOZA 4GVMA 3CM6A 2W42A 2P5OA 4Z4IA 2HVIA 3KLFA 3SV4A 2P51A 4B9TA 4Y1DA 4O4GA 4DU4A 3OJUA 4DU3A 4KRFA 3CM5A 1NKEA 4DSIA 1BIZA 3M8PA 3K59A 3VA0A 4NCAA 3LP2A 4F4KA 1VSIA 5E41A 3MEGA 3SUPA 3P5JA 5CYMA 1SKRA 3DRRA 3NF9A 4FLVA 3EYZA 1XHZA 3C6TA 1WSGA 1WSIA 4FW1A 5HRSA 4FM1A 3L3VA 4DSEA 2Y1IA 3SUQA 1L3VA 1JKHA 2X74A 5HRNA 4CF2A 2YHAA 4CJFA 3G0ZA 3TAPA 4CGFA 3QO9A 4FK2A 4RW4A 4CJTA 3OS0A 1BCMA 2KQ2A 3KD1E 3OYMA 4UQGA 3M8RA 4O44A 4B8CA 4F2SA 3QNOA 1LAWA 1CZ9A 3QIPA 5DMRA 3NBPA 1Y97A 4H4OA 4MFBA 2DFFA 3FFIA 5FDLA 4K8ZA 2YNHA 1QSYA 4ICLA 1ZBHA 4KO0A 5J2MA 4CGDA 3U6FA 1C1CA 1G15A 4B9UA 1WAFA 4W5RA 3S3OA 1SL2A 4CESA 1J5OA 2IAJA 1N5YA 2HNZA 4OLBA 3EY1A 4F3TA 4DQPA 1JLCA 4LY7A 5KRTA 3OYCA 1VRUA 4Z4CA 1KLMA 4KI4A 4C8NA 1JLQA 3NFAA 1TK8A 1NKBA 3B6OA 4HUFA 3SNNA 4I9LA 1VSKA 2YNFA 1I3AA 1ASVA 3SQ1A 2X78A 4DFPA 2DY4A 3VQ5A 1D5AA 4ZHRA 4O55A 3ZSQA 1BIUA 4E7HA 1LW2A 1I39A 4AHCA 2G8VA 2HW3A 4J2DA 2PYJA 1B9FA 1S9GA 5EU7A 2OZMA 1XHXA 2Q3SA 3TAGA 2Z1JA 1NK9A 2YKMA 2HHSA 1QTMA 4AHUA 1ASUA 1NK8A 4DTUA 3SZ2A 4HTUA 4RW9A 1SKSA 1L3SA 1RBRA 4PY5A 1T05A 2RN2A 1QE1A 3OYAA 1ZBLA 4Z4EA 1QHTA 1WSHA 3ASMA 3IG1A 2GBZA 3SUNA 1RTJA 4BACA 3HVTA 3ZSZA 4CHQA 3QLHA 2PYLA 3V9ZA 3NDKA 3VQ8A 3OYEA 3DOKA 1QSLA 1EETA 3DRPA 3A2FA 4FJ8A 3DLBA 1HMVA 1RDDA 3T3FA 3VQEA 3CFRA 3I0RA 2Z1IA 3OJSA 4CEFA 4FW2A 2BGGA 1VSHA 3LZIA 1W9HA 3AO3A 1RBVA 3I0SA 4DTXA 5J2PA 4EP4A 3UIQA 2KZMA 4LH4A 1VK0A 3AVJA 4CJ3A 3K58A 3P83D 1EKEA 1YVUA 4KI6A 3LP0A 3K57A 3HPHA 4BDPA 3ZT1A 2XY7A 2OPSA 4W5QA 2B4JA 1TAQA 4FJLA 4FLTA 5HP1A 3U3YA 1NJYA 3MEDA 2D0BA 3VQPA 1TL1A 4E89A 2NUBA 2Y1JA 3HM9A 4CECA 5J2QA 4TSXA 4FJGA 4WE1A 3PX0A 2VG5A 4I7FA 3OYLA 3KD5E 4DSFA 1S5JA 4PUOA 3WNFA 3RMDA 1JL2A 2IGIA 2HB5A 2KW4A 1KTQA 3SCXA 4KB1A 3HPGA 3AO5A 3L2WA 1Q9YA 4B08A 1NOYA 4FJ5A 4AILC 4PQUA 3HYFA 1RBTA 2EX3A 1RDCA 1D9FA 1JL1A 3L3UA 4FJMA 4BWJA 3NH1A 3ITHA 3D0PA 4IBNA 4JRPA 2HHQA 3AO4A 3KKRA 4OVLA 3MXJA 4BDZA 1QSSA 3ZT0A 2HHUA 3OYKA 1J53A 1NK4A 2VG7A 4FJNA 1TKZA 3HT3A 4ELUA 2O4IA 1TKDA 4F3OA 5FRNA 3AA3A 4CFBA 2PY5A 1Q8IA 1S6QA 3CG7A 3O3FA 3O3GA 4H8KA 5J2NA 4M3WA 3IAYA 2KZZA 1RT4A 1U04A 3QIOA 2P5GA 4HCBA 3SJJA 3V1QA 1IKXA 4DSLA 3OYJA 5K14A 2B5JA 1BL3A 1XWLA 4G1QA 1C0UA 4CJVA 4W5OA 4DQRA 1DTTA 2FBYA 4Y1CA 4E7LA 4M3YA 1RTIA 5I3UA 1KFDA 4CEBA 1A5XA 3ZT2A 4CHPA 4R5PA 1U49A 4DFJA 3V4IA 2DTUA 3KKSA 4PWDA 1XI1A 3KTQA 3OS1A 3VQ4A 1VSFA 1WSJA 2ITGA 3NGYA 1F21A 2Z1HA 2G8WA 1KCFA 2F8TA 4BDYA 3OVNA 1ZBIA 3AVMA 3SPZA 4FJIA 3WNEA 4KFBA 3F73A 4OGEA 3SV3A 2GV9A 2ZE2A 4CFCA 5KTQA 1L3UA 4FJHA 1IKVA 1VSEA 3DYAA 3WNGA 4Z4HA 3OYHA 2VWKA 4CJKA 3MAQA 2HHVA 2D0CA 1HRHA 1JXBA 3V9XA 3MXMA 2LSNA 1W0HA 2OA8A 4DFMA 2B6AA 4M3XA 3DRSA 3OS2A 4CEEA 4CK2A 1XC9A 1BGXT 3SQ4A 3HK2A 1RILA 2YV0X 3NF6A 3SUOA 1HJRA 2OPRA 4ZTJA 4CGHA 4IFYA 1X9MA 1TK0A 4KPYA 3CYMA 4DU1A 4CIFA 4M42A 3KK3A 3V1RA 4RW6A 4IFVA 3TANA 2WONA 4EZ6A 4CFAA 3LPUA 1HNVA 1WLJA 4DTJA 4CK1A 4DF8A 4CJLA 3ZSYA 1C0TA 2X6SA 1Z26A 2IDOA 4FYDA 3ISNC 1BHLA 3VQQA 5HROA 3AVHA 4CEAA 3VA3A 3BGRA 4I9QA 4E1NA 3NHGA 4KHUA 3IRXA 4O0IA 1S9EA 4M41A 4CJUA 2G8KA 1C0MA 4KAZA 1NJZA 1IKWA 3NH2A 4B9NA 1X1PA 1X9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E01 A;  2OPQ A;  4KV8 A;  4CK3 A;  1WN7 A;  3DI6 A;  5KGX A;  1S1W A;  4N5S A;  4M3R A;  3IS9 A;  3JSM A;  1GOA A;  5HRR A;  3P1G A;  2WOM A;  3PUF A;  2G8U A;  1LWC A;  3RRG A;  3HP9 A;  1RBU A;  4RW7 A;  3TAB A;  2QK9 A;  3OYD A;  1GOB A;  1TV6 A;  3B6P A;  1VSL A;  5JS2 A;  2XY6 A;  3KIO A;  4AHS A;  3AA2 A;  3VQB A;  3D45 A;  1HPZ A;  3SQ0 A;  1U45 A;  3AA4 A;  3AVA A;  1SL1 A;  4YNQ A;  3M8Q A;  4DTM A;  4C8K A;  1EXQ A;  2Z1G A;  4CEO A;  4KTQ A;  4DTN A;  4NCB A;  4Q5V A;  3I8D A;  1RT5 A;  1J9A A;  4CEQ A;  1REV A;  4OJR A;  3KLI A;  2RPI A;  1T8E A;  4Z4F A;  5SZT A;  3T19 A;  3OYN A;  3RTV A;  3AVB A;  2OYQ A;  3SI6 A;  3OYG A;  4DWI A;  4F8R A;  1RT6 A;  2D0A A;  4FJK A;  1K6Y A;  2FBT A;  3NGI A;  4CE9 A;  4M3Z A;  4ZTF A;  2JGU A;  1ZBF A;  4AH9 A;  2ZD1 A;  4LSL A;  3V9U A;  3TAM A;  1TGO A;  4IG3 A;  3ZT4 A;  4CHZ A;  3K5N A;  1KRP A;  5D3G A;  3S3M A;  3K5M A;  3QIN A;  3LDS A;  1S1V A;  3M8S A;  4E7K A;  1YTU A;  5KRS A;  1CLQ A;  3JYT A;  3K2P A;  4B8A B;  4M45 A;  3LWM A;  1SUQ A;  3TR8 A;  4DTO A;  3PV8 A;  4DS4 A;  1C1B A;  3QES A;  1RDB A;  4N41 A;  3LZJ A;  3L2V A;  3C94 A;  1WAJ A;  4I2P A;  3ALY A;  3DM2 A;  4JRQ A;  4CGG A;  3KLE A;  2QKK A;  5C42 A;  2G8F A;  3PY8 A;  4NYF A;  4ELT A;  2R7Y A;  4KKO A;  4JS4 A;  1RBS A;  4JLH A;  4HUE A;  3DLG A;  4CHY A;  4E3S A;  1KSP A;  3AVF A;  4OGC A;  4KB0 A;  1NKC A;  3PX6 A;  3V81 A;  3O3H A;  4BWM A;  4NCG A;  3L8B A;  1C6V A;  2FBV A;  4M3U A;  4RG8 A;  3HO1 A;  1J54 A;  1RT2 A;  3V9W A;  3RMC A;  2JLE A;  1KLN A;  3OY9 A;  4FLZ A;  3LAM A;  3BDP A;  1UA0 A;  3ULD A;  1LV5 A;  1KVC A;  3LP1 A;  5KGW A;  5SWM A;  2IS3 A;  1WSF A;  2FC0 A;  3H08 A;  3V1O A;  3PO5 A;  2A1S A;  4FLY A;  1JLG A;  1TL3 A;  4FK0 A;  4KRE A;  2HHT A;  3ZT3 A;  3AV9 A;  1KVB A;  3C95 A;  1HQE A;  3NH0 A;  3CQ8 A;  3QEX A;  4DTS A;  3SPY A;  3THV A;  4KTW A;  4DQI A;  2KFZ A;  1O1W A;  3KK2 A;  3DLH A;  3AVN A;  1HYZ A;  4OLA A;  3HJF A;  1S1U A;  4E7J A;  4DTP A;  1S1X A;  1FK9 A;  4N47 A;  1U48 A;  1FXX A;  1BI4 B;  4CJ5 A;  1HQU A;  2XO7 A;  3EZ5 A;  1C1A A;  1VSD A;  4BE2 A;  1IO2 A;  4CGJ A;  5FRM A;  1UA1 A;  3KK1 A;  1BQM A;  4EZ9 A;  1JXE A;  3NCI A;  4O0J A;  5CY4 A;  4C8O A;  1KVA A;  2F96 A;  1LWE A;  2BE2 A;  4O5B A;  4FLU A;  1NK0 A;  3VQ9 A;  1B9D A;  2DFH A;  3T1A A;  1SL0 A;  4W5T A;  3QNN A;  4QAG A;  4DFK A;  4C8M A;  1HYV A;  3AA5 X;  4CHN A;  1ASW A;  3K5O A;  1T03 A;  3G10 A;  4CF8 A;  2PZS A;  4QOZ B;  1IH7 A;  1RT1 A;  5CZ1 A;  5DK5 A;  3SYZ A;  3S9H A;  3K5L A;  4GW6 A;  4AHV A;  1T7P A;  3RR7 A;  2F8S A;  1LWF A;  4CER A;  4DQS A;  1EX4 A;  1S1T A;  5CYQ A;  2AJQ A;  4H4M A;  2BDP A;  3ZSW A;  2HNY A;  3VQ7 A;  5HLF A;  4ID5 A;  4FM0 A;  3QEI A;  4CJ4 A;  1VSJ A;  3QET A;  4NYN A;  3RMA A;  3ZSR A;  4CJP A;  1UOC A;  4HUG A;  5I42 A;  4C8L A;  3AVG A;  4AHR A;  5T7B A;  4OPK A;  1L3T A;  4DF4 A;  4IKF A;  4E1M A;  4J2B A;  3U3G A;  2IC3 A;  1QQC A;  3LPT A;  3RRH A;  4MQ3 A;  3QEW A;  2QKB A;  4LD0 A;  1JLA A;  3ZSV A;  4XIU A;  4GMJ B;  3V6D A;  4Z4G A;  3AO1 A;  4FJX A;  1TAU A;  4IG0 A;  1TK5 A;  2A1R A;  2RF2 A;  4OPJ A;  4FLW A;  3MEC A;  4M3T A;  4OKJ A;  5KI6 A;  1TKX A;  1BIS A;  4E7I A;  4KHY A;  1BCO A;  4FVM A;  3ZSO A;  2XY5 A;  4FZX C;  4FJ9 A;  3NF8 A;  4FXD A;  1VSM A;  1SKW A;  3HL8 A;  2YKN A;  1UAX A;  3NE6 A;  3WNH A;  4CFD A;  3QEV A;  1UWB A;  3VN5 A;  4FLX A;  3DOL A;  1IG9 A;  4JS5 A;  2ATQ A;  1NK6 A;  3QEP A;  1U47 A;  4DTR A;  4CGI A;  2XHB A;  1B92 A;  4ID1 A;  4AHT A;  3O4Q A;  4LSN A;  4CHO A;  1JLB A;  3ZSX A;  3HXM A;  4HHT A;  1L5U A;  3LWL A;  1A5W A;  1R0A A;  3AVK A;  1BQN A;  4FJ7 A;  4N56 A;  1FKO A;  1TKT A;  1WNS A;  3VQC A;  3DLE A;  4OKE A;  2RKI A;  5JS1 A;  1S6P A;  4DMN A;  4BE0 A;  3QER A;  2G8H A;  4FK4 A;  2KTQ A;  1DLO A;  1NJX A;  1HYS A;  2KFN A;  2HHW A;  2YNG A;  4DSK A;  4FZZ A;  3NGZ A;  1JLE A;  1HNI A;  1JLF A;  3TWH A;  2E6L A;  3TAQ A;  1QS4 A;  1ITG A;  4DS5 A;  4KTZ A;  4J2A A;  2VG6 A;  3DLR A;  4YFU A;  4FM2 A;  4N76 A;  2DFE A;  5FRO A;  5C25 A;  4KHN A;  4CJW A;  3VQD A;  1GOC A;  1VRT A;  4ELV A;  1FKP A;  2E6M A;  3KJV A;  4B3O A;  2ETJ A;  1BI4 A;  2HVH A;  4FJJ A;  3CFO A;  3V9S A;  1IKY A;  3C6U A;  4DSJ A;  4E0D A;  4LH5 A;  4E19 A;  3CFP A;  3HST B;  2OZS A;  3PO4 A;  4I2Q A;  2E4L A;  2HHX A;  1Q9X A;  3AO2 A;  3O4N A;  4RW8 A;  3RMB A;  3MXI A;  1ZYQ A;  1RTD A;  4KHS A;  3DLK A;  1CXQ A;  4CJS A;  3HVR A;  1D9D A;  1EP4 A;  1LW0 A;  1YTA A;  3VQ6 A;  3OYF A;  2XY8 A;  4PA1 A;  4KHQ A;  2HMI A;  5HBM A;  3AVI A;  4CF1 A;  3OYB A;  4FCY A;  1RCH A;  3F9K A;  4CF0 A;  3OYI A;  4DQQ A;  3TAF A;  4CIE A;  4IDK A;  3SQ2 A;  3TI0 A;  2BAN A;  1NK5 A;  3AVC A;  1U4B A;  1NJW A;  3AVL A;  4CF9 A;  3RWU A;  2EHG A;  2XRI A;  4OKK A;  5CZ2 A;  1KFS A;  2G8I A;  1TVR A;  4CIG A;  4KHW A;  5C24 A;  3VQA A;  4CED A;  4CCH A;  4CEZ A;  4HCC A;  3L2R A;  3PX4 A;  4HVJ A;  2I5J A;  1SV5 A;  4EP5 A;  1N6Q A;  1WSE A;  5J1E A;  3S3N A;  1RDA A;  1X9W A;  3LAK A;  1LAV A;  1RTH A;  1ZBU A;  2IOC A;  3LAL A;  4B9S A;  4K8X A;  4Z0U A;  2YHB A;  2OPP A;  4QCL A;  4CJE A;  2QXF A;  2YNI A;  1D8Y A;  3LAN A;  3HPO A;  4B9L A;  4L8R B;  3RR8 A;  2GUI A;  4B9V A;  3KLG A;  1A5V A;  1DTQ A;  1RT3 A;  3MEE A;  4F2R A;  2FBX A;  3KLH A;  4DG1 A;  1NK7 A;  1CXU A;  1YT3 A;  2O4G A;  3NF7 A;  4DLG A;  1RT7 A;  2ZQB A;  1Z25 A;  2P1J A;  3LP3 A;  4CJQ A;  4BE1 A;  1MU2 A;  1RNH A;  3L2Q A;  3ZCM A;  4DLE A;  4Q0B A;  4CJR A;  2X6N A;  3L2U A;  3TAE A;  4FZY A;  4W5N A;  3DMJ A;  3NAE A;  2VWJ A;  5HRP A;  4B9M A;  2D5R A;  3TAR A;  2HND A;  1CZB A;  3HP6 A;  4J2E A;  1NOZ A;  4GVM A;  3CM6 A;  2W42 A;  2P5O A;  4Z4I A;  2HVI A;  3KLF A;  3SV4 A;  2P51 A;  4B9T A;  4Y1D A;  4O4G A;  4DU4 A;  3OJU A;  4DU3 A;  4KRF A;  3CM5 A;  1NKE A;  4DSI A;  1BIZ A;  3M8P A;  3K59 A;  3VA0 A;  4NCA A;  3LP2 A;  4F4K A;  1VSI A;  5E41 A;  3MEG A;  3SUP A;  3P5J A;  5CYM A;  1SKR A;  3DRR A;  3NF9 A;  4FLV A;  3EYZ A;  1XHZ A;  3C6T A;  1WSG A;  1WSI A;  4FW1 A;  5HRS A;  4FM1 A;  3L3V A;  4DSE A;  2Y1I A;  3SUQ A;  1L3V A;  1JKH A;  2X74 A;  5HRN A;  4CF2 A;  2YHA A;  4CJF A;  3G0Z A;  3TAP A;  4CGF A;  3QO9 A;  4FK2 A;  4RW4 A;  4CJT A;  3OS0 A;  1BCM A;  2KQ2 A;  3KD1 E;  3OYM A;  4UQG A;  3M8R A;  4O44 A;  4B8C A;  4F2S A;  3QNO A;  1LAW A;  1CZ9 A;  3QIP A;  5DMR A;  3NBP A;  1Y97 A;  4H4O A;  4MFB A;  2DFF A;  3FFI A;  5FDL A;  4K8Z A;  2YNH A;  1QSY A;  4ICL A;  1ZBH A;  4KO0 A;  5J2M A;  4CGD A;  3U6F A;  1C1C A;  1G15 A;  4B9U A;  1WAF A;  4W5R A;  3S3O A;  1SL2 A;  4CES A;  1J5O A;  2IAJ A;  1N5Y A;  2HNZ A;  4OLB A;  3EY1 A;  4F3T A;  4DQP A;  1JLC A;  4LY7 A;  5KRT A;  3OYC A;  1VRU A;  4Z4C A;  1KLM A;  4KI4 A;  4C8N A;  1JLQ A;  3NFA A;  1TK8 A;  1NKB A;  3B6O A;  4HUF A;  3SNN A;  4I9L A;  1VSK A;  2YNF A;  1I3A A;  1ASV A;  3SQ1 A;  2X78 A;  4DFP A;  2DY4 A;  3VQ5 A;  1D5A A;  4ZHR A;  4O55 A;  3ZSQ A;  1BIU A;  4E7H A;  1LW2 A;  1I39 A;  4AHC A;  2G8V A;  2HW3 A;  4J2D A;  2PYJ A;  1B9F A;  1S9G A;  5EU7 A;  2OZM A;  1XHX A;  2Q3S A;  3TAG A;  2Z1J A;  1NK9 A;  2YKM A;  2HHS A;  1QTM A;  4AHU A;  1ASU A;  1NK8 A;  4DTU A;  3SZ2 A;  4HTU A;  4RW9 A;  1SKS A;  1L3S A;  1RBR A;  4PY5 A;  1T05 A;  2RN2 A;  1QE1 A;  3OYA A;  1ZBL A;  4Z4E A;  1QHT A;  1WSH A;  3ASM A;  3IG1 A;  2GBZ A;  3SUN A;  1RTJ A;  4BAC A;  3HVT A;  3ZSZ A;  4CHQ A;  3QLH A;  2PYL A;  3V9Z A;  3NDK A;  3VQ8 A;  3OYE A;  3DOK A;  1QSL A;  1EET A;  3DRP A;  3A2F A;  4FJ8 A;  3DLB A;  1HMV A;  1RDD A;  3T3F A;  3VQE A;  3CFR A;  3I0R A;  2Z1I A;  3OJS A;  4CEF A;  4FW2 A;  2BGG A;  1VSH A;  3LZI A;  1W9H A;  3AO3 A;  1RBV A;  3I0S A;  4DTX A;  5J2P A;  4EP4 A;  3UIQ A;  2KZM A;  4LH4 A;  1VK0 A;  3AVJ A;  4CJ3 A;  3K58 A;  3P83 D;  1EKE A;  1YVU A;  4KI6 A;  3LP0 A;  3K57 A;  3HPH A;  4BDP A;  3ZT1 A;  2XY7 A;  2OPS A;  4W5Q A;  2B4J A;  1TAQ A;  4FJL A;  4FLT A;  5HP1 A;  3U3Y A;  1NJY A;  3MED A;  2D0B A;  3VQP A;  1TL1 A;  4E89 A;  2NUB A;  2Y1J A;  3HM9 A;  4CEC A;  5J2Q A;  4TSX A;  4FJG A;  4WE1 A;  3PX0 A;  2VG5 A;  4I7F A;  3OYL A;  3KD5 E;  4DSF A;  1S5J A;  4PUO A;  3WNF A;  3RMD A;  1JL2 A;  2IGI A;  2HB5 A;  2KW4 A;  1KTQ A;  3SCX A;  4KB1 A;  3HPG A;  3AO5 A;  3L2W A;  1Q9Y A;  4B08 A;  1NOY A;  4FJ5 A;  4AIL C;  4PQU A;  3HYF A;  1RBT A;  2EX3 A;  1RDC A;  1D9F A;  1JL1 A;  3L3U A;  4FJM A;  4BWJ A;  3NH1 A;  3ITH A;  3D0P A;  4IBN A;  4JRP A;  2HHQ A;  3AO4 A;  3KKR A;  4OVL A;  3MXJ A;  4BDZ A;  1QSS A;  3ZT0 A;  2HHU A;  3OYK A;  1J53 A;  1NK4 A;  2VG7 A;  4FJN A;  1TKZ A;  3HT3 A;  4ELU A;  2O4I A;  1TKD A;  4F3O A;  5FRN A;  3AA3 A;  4CFB A;  2PY5 A;  1Q8I A;  1S6Q A;  3CG7 A;  3O3F A;  3O3G A;  4H8K A;  5J2N A;  4M3W A;  3IAY A;  2KZZ A;  1RT4 A;  1U04 A;  3QIO A;  2P5G A;  4HCB A;  3SJJ A;  3V1Q A;  1IKX A;  4DSL A;  3OYJ A;  5K14 A;  2B5J A;  1BL3 A;  1XWL A;  4G1Q A;  1C0U A;  4CJV A;  4W5O A;  4DQR A;  1DTT A;  2FBY A;  4Y1C A;  4E7L A;  4M3Y A;  1RTI A;  5I3U A;  1KFD A;  4CEB A;  1A5X A;  3ZT2 A;  4CHP A;  4R5P A;  1U49 A;  4DFJ A;  3V4I A;  2DTU A;  3KKS A;  4PWD A;  1XI1 A;  3KTQ A;  3OS1 A;  3VQ4 A;  1VSF A;  1WSJ A;  2ITG A;  3NGY A;  1F21 A;  2Z1H A;  2G8W A;  1KCF A;  2F8T A;  4BDY A;  3OVN A;  1ZBI A;  3AVM A;  3SPZ A;  4FJI A;  3WNE A;  4KFB A;  3F73 A;  4OGE A;  3SV3 A;  2GV9 A;  2ZE2 A;  4CFC A;  5KTQ A;  1L3U A;  4FJH A;  1IKV A;  1VSE A;  3DYA A;  3WNG A;  4Z4H A;  3OYH A;  2VWK A;  4CJK A;  3MAQ A;  2HHV A;  2D0C A;  1HRH A;  1JXB A;  3V9X A;  3MXM A;  2LSN A;  1W0H A;  2OA8 A;  4DFM A;  2B6A A;  4M3X A;  3DRS A;  3OS2 A;  4CEE A;  4CK2 A;  1XC9 A;  1BGX T;  3SQ4 A;  3HK2 A;  1RIL A;  2YV0 X;  3NF6 A;  3SUO A;  1HJR A;  2OPR A;  4ZTJ A;  4CGH A;  4IFY A;  1X9M A;  1TK0 A;  4KPY A;  3CYM A;  4DU1 A;  4CIF A;  4M42 A;  3KK3 A;  3V1R A;  4RW6 A;  4IFV A;  3TAN A;  2WON A;  4EZ6 A;  4CFA A;  3LPU A;  1HNV A;  1WLJ A;  4DTJ A;  4CK1 A;  4DF8 A;  4CJL A;  3ZSY A;  1C0T A;  2X6S A;  1Z26 A;  2IDO A;  4FYD A;  3ISN C;  1BHL A;  3VQQ A;  5HRO A;  3AVH A;  4CEA A;  3VA3 A;  3BGR A;  4I9Q A;  4E1N A;  3NHG A;  4KHU A;  3IRX A;  4O0I A;  1S9E A;  4M41 A;  4CJU A;  2G8K A;  1C0M A;  4KAZ A;  1NJZ A;  1IKW A;  3NH2 A;  4B9N A;  1X1P A;  1X9S A; 
#chains in the Genus database with same CATH topology
 3VPZ A;  1GLJ O;  4KV8 A;  3DI6 A;  4FWN A;  5KGX A;  4N5S A;  4JI5 K;  4M3R A;  3IS9 A;  3A5L C;  4JHD B;  2WOM A;  4CZL A;  2QEX N;  3VF4 A;  3MCP A;  3AA2 A;  1HPZ A;  2QWP A;  3DWL A;  3ID6 A;  1VHX A;  1M90 O;  3AA4 A;  4C8K A;  1EXQ A;  3MWT A;  3WEE A;  4C1N K;  2GTD A;  3IMX A;  4CEQ A;  3HOT A;  4O5F A;  3KLI A;  3CCM N;  5SZT A;  2OYQ A;  4DWI A;  4F8R A;  1RT6 A;  2I7P A;  4DV7 K;  4K0K K;  3NGI A;  1IG8 A;  3S3M A;  3LDS A;  3L4Q A;  4H0T B;  5DM6 L;  3PV8 A;  5GIP A;  5BRD A;  2ZJP L;  4DS4 A;  3QES A;  3CJA A;  3H3N O;  3C94 A;  1YJW N;  4JRQ A;  3ALY A;  4CGG A;  3KLE A;  2QKK A;  4QS9 A;  4NYF A;  3O4W A;  4E3S A;  1RBS A;  1KSP A;  3AVF A;  5A2Q O;  3PX6 A;  4B3R K;  4NCG A;  1C6V A;  4M3U A;  4Y0W A;  5AQR A;  2JLE A;  2YI1 A;  4LFA K;  3ULD A;  1GLA G;  1T6D A;  3LP1 A;  2HF3 A;  1GLC G;  3V1O A;  3H08 A;  4FLY A;  4HWI A;  1RGI A;  3QEX A;  3NH0 A;  1NGE A;  4CZH A;  1HYZ A;  4BR0 A;  1S1U A;  4E7J A;  1U48 A;  3MN9 A;  2XO7 A;  4B1U B;  1UA1 A;  3KK1 A;  3KWG A;  4MDA A;  4O5B A;  1B9D A;  4DV1 K;  4QS8 A;  3SAH A;  3VGL A;  3ENO A;  1ASW A;  1IH7 A;  2BTF A;  5CZ1 A;  1NGA A;  5DK5 A;  3K5L A;  1T7P A;  1EX4 A;  1S1T A;  2P9P A;  5ADX H;  2BDP A;  3HI0 A;  3CCL N;  3HBT A;  3VQ7 A;  3QET A;  4HUG A;  1UOC A;  3CME N;  1KC8 O;  4C8L A;  3L0Q A;  5T7B A;  5FPN A;  1VQL N;  2PBD A;  1NGF A;  3RRH A;  3QEW A;  1QQC A;  3MWP A;  4LD0 A;  4XIU A;  4GMJ B;  1SZ2 A;  3BF1 A;  3C0B A;  1TAU A;  2A1R A;  4FLW A;  4OPJ A;  4YOR A;  3UB5 A;  4OKJ A;  2FSK A;  5KI6 A;  1BIS A;  1NM1 A;  3ZLJ A;  2XY5 A;  4FZX C;  4FXD A;  1VSM A;  3CCR N;  3NE6 A;  3O8M A;  3TSU A;  4CFD A;  3DOL A;  4JS5 A;  1NK6 A;  4DTR A;  1VQ6 N;  1VQ9 N;  5AQJ A;  1VQK N;  4FWL A;  4HHT A;  4CHO A;  1L5U A;  3LWL A;  4BRC A;  2UU9 K;  5C12 A;  1HJO A;  4FJ7 A;  3VQC A;  1S3X A;  2KTQ A;  2KFN A;  2HHW A;  3NGZ A;  3TWH A;  5LJV A;  4DS5 A;  4KTZ A;  1I94 K;  4DR2 K;  2DFE A;  4BRI A;  5C25 A;  4KHN A;  3ATV A;  5BN9 A;  3M3Z A;  2HBK A;  2NLX A;  1FKP A;  2E6M A;  3K9J A;  4B3O A;  2F4V K;  1BA1 A;  1OH7 A;  3TSQ A;  3CC4 N;  2QM1 A;  2OZS A;  1X9J A;  2E2N A;  5AQF A;  1Q9X A;  1IBM K;  3MXI A;  1ZYQ A;  3QIC A;  3J80 O;  4LF4 K;  4CJS A;  4I6M B;  3HVR A;  1LW0 A;  2XY8 A;  4PA1 A;  4DV5 K;  5HBM A;  3VF6 A;  4PKH A;  4DR1 K;  1C0G A;  4DQQ A;  4CIE A;  3SQ2 A;  4O8U A;  3TI0 A;  3AVC A;  1U4B A;  4MLE A;  3AVL A;  3MCA B;  5LMN K;  5C24 A;  3L2R A;  3TTC A;  4HVJ A;  1SV5 A;  4B1V A;  1WSE A;  3CD6 N;  4LC9 B;  4B9S A;  2OPP A;  2QXF A;  2YNI A;  3LAN A;  4B9V A;  1GLF O;  3CET A;  3TSP A;  4YY3 K;  4F2R A;  2FBX A;  3KLH A;  3WXM B;  4YOT A;  3BUZ B;  1EWQ A;  4IJA A;  1RT7 A;  3LP3 A;  3L2U A;  2O8F A;  3WEE B;  2HND A;  3VGM A;  3HP6 A;  4J2E A;  1WBB A;  1P8Z A;  3LDO A;  4Z4I A;  2HVI A;  3KLF A;  3SV4 A;  4FO0 A;  4Y1D A;  4DR7 K;  2Q36 A;  3I33 A;  1TYQ B;  3H6E A;  4KRF A;  4A57 A;  4MDB A;  3K59 A;  3VA0 A;  4FWP A;  4B9Q A;  3LP2 A;  4PHT X;  1YF5 L;  1VSI A;  1OH8 A;  3SMS A;  3THY B;  1WSG A;  1WSI A;  2PZS A;  3SUQ A;  3U9D A;  1L3V A;  5IT9 O;  4CF2 A;  4JI0 K;  1DEJ A;  4RW4 A;  3OS0 A;  4JKD A;  3D6R A;  4BC5 A;  4O44 A;  4AQY K;  3LM9 A;  3G4S N;  5JVH L;  1LAW A;  4YOX A;  2E5L K;  3QML A;  1Y97 A;  4B1Z A;  4MFB A;  4K8Z A;  4ICL A;  4KO0 A;  4X62 K;  1V4T A;  4GKJ K;  4EFH A;  1WAF A;  2QWQ A;  4W5R A;  3S3O A;  4BC3 A;  4MLH A;  2IAJ A;  4BG8 A;  4OPH A;  1JLC A;  3SK3 A;  1VRU A;  4XEI A;  4Z4C A;  2UYT A;  4KI4 A;  1JLQ A;  3I56 N;  4HUF A;  4DUZ K;  1VSK A;  2YNF A;  1I3A A;  3SQ1 A;  2X78 A;  2DY4 A;  4ZHR A;  4CZI A;  5AQH A;  4KH5 A;  1LW2 A;  3A5N C;  4BR5 A;  2NRR A;  4KHP K;  1SQK A;  2Z1J A;  1NK9 A;  1NK8 A;  1YI2 N;  2P9P B;  3SAF A;  4RW9 A;  4HTU A;  1HX1 A;  4JI7 K;  4EIA A;  2RN2 A;  3BP8 A;  4CHQ A;  3QBX A;  3V9Z A;  3VQ8 A;  3PLA A;  2UUC K;  1HMV A;  3T3F A;  3OJS A;  4JKG B;  1RDW X;  5FPM A;  3LZI A;  1RBV A;  3HOS A;  5J2P A;  2VWB A;  4U7B A;  3P83 D;  4BRA A;  3J8A A;  3LP0 A;  3VEY A;  2B4J A;  2YHX A;  4FJL A;  4FLT A;  1NJY A;  3U3Y A;  3D7E O;  4E89 A;  5GAE P;  1K8A O;  5M1K A;  2P9I A;  2NRV A;  2QXL A;  4FWK A;  5E84 A;  3OA9 A;  1U6Z A;  3SLC A;  4OPA A;  3PX0 A;  3WXK A;  3WNF A;  3RMD A;  3FE1 A;  3SCX A;  2P9L A;  3VOV A;  3L2W A;  1TUY A;  3HYF A;  4BWJ A;  3NH1 A;  3ITH A;  2HHQ A;  5C2F A;  5IWA K;  1QSS A;  5AQN A;  1NMN A;  2O8D A;  1TKZ A;  4F9O A;  3CPE A;  1VQ4 N;  3O5B A;  4CFB A;  2PY5 A;  5FRN A;  3T69 A;  1IKX A;  3OYJ A;  4G1Q A;  4W5O A;  2CGJ A;  4G9Z A;  3O80 A;  4CEB A;  3ZET B;  4R5P A;  4OX9 K;  3V4I A;  3KTQ A;  1KAX A;  1XMQ K;  2Q2R A;  3NGY A;  2Z1H A;  4CZM A;  5EVZ A;  1ZBI A;  4KFB A;  3W0L A;  3F73 A;  4CFC A;  1L3U A;  2E1Y A;  1VSE A;  4Z4H A;  1HLU A;  2VWK A;  4Z94 A;  4CJK A;  4ISE A;  3EZW A;  3OW2 M;  2HHV A;  4ILG B;  3J7Z O;  4WQ4 A;  1D4X A;  4H0P A;  3HK2 A;  3NF6 A;  1EWR A;  2YV0 X;  3SUO A;  4IFY A;  1X9M A;  5FLX O;  1Q86 O;  4M42 A;  4CFA A;  3CCS N;  1Z26 A;  5AQU A;  2UXB K;  1XNQ K;  4B3M K;  2QWN A;  4CEA A;  4CJU A;  4KAZ A;  1NJZ A;  3ULE B;  3NH2 A;  1KAZ A;  4CK3 A;  1WN7 A;  5AQK A;  1QVF M;  3JSM A;  1ZXO A;  5ADX A;  2G8U A;  4B3T K;  3TAB A;  3P38 A;  2NRT A;  1VSL A;  2XY6 A;  4YHH K;  2KHO A;  5AFU H;  3SQ0 A;  4RTF D;  4RWT A;  2Z1G A;  3GBT A;  3TTF A;  4DTN A;  1RT5 A;  2E2P A;  3UKU A;  4FJ8 A;  4YDU A;  4K25 A;  2RE2 A;  4FJK A;  1MA9 B;  2P9S B;  4ZTF A;  1NLV A;  2ZD1 A;  4LSL A;  3V9U A;  1TGO A;  4IG3 A;  3ZT4 A;  4CHZ A;  1KRP A;  3K5M A;  3QIN A;  2E1Z A;  2ASP A;  1YTU A;  3CJ7 A;  5KRS A;  5TKW A;  3JYT A;  3K2P A;  4B8A B;  3LWM A;  3TR8 A;  4DTO A;  1C1B A;  1BDG A;  5BPM A;  4UY8 O;  3L2V A;  1WAJ A;  4I2P A;  4BRE A;  2G8F A;  2H3G X;  5C15 A;  2WFB A;  2R7Y A;  4JS4 A;  4JLH A;  4HUE A;  4CHY A;  4KB0 A;  3T7Z A;  3V81 A;  3WUH A;  4RG8 A;  1YAG A;  3HO1 A;  1RT2 A;  1KLN A;  4CJ7 A;  3LAM A;  3PIP L;  1BOT O;  1LV5 A;  3H45 C;  5KGW A;  3DXM A;  4H5R A;  1HR0 K;  2IS3 A;  1WSF A;  2FC0 A;  4ILJ A;  3PO5 A;  4KBO A;  3ZT3 A;  4WFA L;  1KVB A;  3T1H K;  2Q0R A;  3CQ8 A;  3THV A;  4DQI A;  4KTW A;  3M1F A;  2KFZ A;  1O1W A;  4R79 A;  3HJF A;  1FXX A;  1BI4 B;  1HQU A;  1VSD A;  3IKM A;  1IO2 A;  1BQM A;  1JXE A;  4C8O A;  1LWE A;  2BE2 A;  3O9S A;  3RSE A;  3T1A A;  1SL0 A;  4DFK A;  1YIJ N;  2GUP A;  3AA5 X;  3HM8 A;  4CHN A;  3K5O A;  4CF8 A;  1RT1 A;  4WFB L;  1HKC A;  3GG4 A;  4CER A;  1LWF A;  3WQU A;  4LF8 K;  3DJC A;  3CQX A;  4FWR A;  3ZSW A;  2HNY A;  3KZB A;  5HLF A;  1VSJ A;  2QTD A;  5I42 A;  1KQS M;  3NMU A;  3CI5 A;  4C23 A;  3LPT A;  3UKR A;  1NNE A;  1JLA A;  2YHY A;  3AO1 A;  5JIC A;  1TK5 A;  2RF2 A;  3MN6 A;  4KHY A;  1BCO A;  2P9N B;  4FJ9 A;  3VF2 A;  1SKW A;  3HL8 A;  2YKN A;  4IEE A;  3WNH A;  2YJF A;  2ATQ A;  5AJ3 K;  4CGI A;  2A5X A;  4YDU C;  2XHB A;  1LOT B;  1S72 N;  5C2D A;  3ZSX A;  1A5W A;  3H1Q A;  1R0A A;  1T3V A;  4CZE A;  4N56 A;  5JS1 A;  4JKG A;  5BPL A;  4BE0 A;  2Q97 A;  3QER A;  3CC2 N;  3O9R A;  4L3Q A;  4BRD A;  4FZZ A;  2O8F B;  2HF4 A;  1H1V A;  1YVN A;  3IDH A;  1QS4 A;  4JI2 K;  4FM2 A;  5FRO A;  3VTI A;  4CJW A;  3VQD A;  2HOE A;  3DXK B;  1VQ5 N;  1GOC A;  5AQP A;  3MMV A;  2ETJ A;  1BI4 A;  1E3M A;  4WF9 L;  4DSJ A;  3D2E A;  4E19 A;  3D2F B;  3CFP A;  3PO4 A;  4I2Q A;  4GY2 B;  2HHX A;  3AO2 A;  4KHS A;  4RW8 A;  5AR0 A;  1CXQ A;  4NO7 A;  1U2V B;  4NLC A;  3VQ6 A;  1EO1 A;  3HZ6 A;  3MK6 A;  3AVI A;  4FCY A;  1RCH A;  3AGK A;  3EEQ A;  3H3O B;  2FXU A;  3CIP A;  4JD2 A;  5BR8 K;  4CZF A;  1KFS A;  2G8I A;  4H5V A;  4JI6 K;  3VQA A;  4BRM A;  4CW7 B;  1GLB G;  4CED A;  4HCC A;  3AGR A;  5DM7 L;  2I5J A;  2O8B A;  2HBM A;  3LAL A;  3OHR A;  2YHB A;  4BRQ A;  1D8Y A;  4L8R B;  4WQ5 A;  4BVP A;  4YOU A;  2V7Z A;  3MN5 A;  3IUC A;  1XNR K;  3KLG A;  2ITM A;  1A5V A;  4WFN L;  4DG1 A;  5JLH A;  2O4G A;  3VER A;  5C10 A;  4DLG A;  2P1J A;  1MU2 A;  1RNH A;  4DLE A;  3ZCM A;  4Q0B A;  4DR5 K;  4BRN A;  3UE5 A;  3DMJ A;  4JKE A;  4B9M A;  5HRP A;  2NRH A;  4JK8 A;  1V4S A;  3TAR A;  3CC7 N;  3P39 A;  3SBT A;  3AAP A;  3CM6 A;  4NLB A;  1SS6 A;  1M1K O;  4B9T A;  3FFK B;  5JMV A;  1W7A A;  4DU4 A;  3OJU A;  4JK7 A;  1O13 A;  2F9W A;  3CM5 A;  2UXD K;  4DSI A;  1E4G T;  3M8P A;  4F4K A;  3CCV N;  3MEG A;  1SKR A;  5CYM A;  4DV4 K;  3DRR A;  3NF9 A;  2QWR A;  4FLV A;  5HRS A;  4DSE A;  4FM1 A;  3L3V A;  1NGC A;  2Y1I A;  1DGK N;  4CJF A;  2BH1 A;  4FK2 A;  4CGF A;  3QO9 A;  4CJT A;  1BCM A;  2KQ2 A;  3KD1 E;  3OYM A;  3M6G A;  3CCJ N;  3ZEU A;  1K8K B;  4B8C A;  3CJC A;  4KH4 A;  3QIP A;  5DMR A;  4H4O A;  5FDL A;  1NJI O;  1QSY A;  1ZBH A;  1X3M A;  3CQY A;  4KH6 A;  1G15 A;  4CES A;  2HNZ A;  5F2R A;  3AY9 A;  4F3T A;  4IEI A;  4DQP A;  3OYC A;  2W6K A;  4C8N A;  1TK8 A;  1NKB A;  2CGL A;  3SNN A;  2NZT A;  5GAG P;  2FSJ A;  4DFP A;  3F2K A;  4O55 A;  3ZSQ A;  4AHC A;  4J2D A;  2GX9 A;  1XHX A;  2Q3S A;  2HHS A;  1QTM A;  4AHU A;  2IIR A;  2DPN A;  3OBY A;  5M1Q A;  1L3S A;  5JLF A;  1RBR A;  1T05 A;  3LDN A;  1ZBL A;  1WSH A;  3IG1 A;  3SUN A;  4BAC A;  5KPZ A;  2PYL A;  3NDK A;  2CH5 A;  3A2F A;  3I0R A;  2Z1I A;  3O1B A;  1ESV A;  5M1F A;  1OH5 A;  4FW2 A;  2AA4 A;  3AO3 A;  4IJN A;  2W41 A;  3I0S A;  3CJ9 A;  4LF6 K;  5C0Y A;  4DUY K;  4IZ9 A;  3K57 A;  2E2Q A;  2XY7 A;  4W5Q A;  5HP1 A;  3MED A;  2D0B A;  1NGD A;  2Y1J A;  3HM9 A;  4FJG A;  1BUP A;  1QQM A;  4WE1 A;  2OAN A;  4I7F A;  3SAG A;  2HB5 A;  4ISF A;  2VCP A;  3AO5 A;  3BZK A;  4XH4 A;  5AQX A;  2EX3 A;  2W6L A;  1D9F A;  1JL1 A;  3L3U A;  4FJM A;  4IBN A;  3AO4 A;  2WUS A;  5FPD A;  3ZT0 A;  3QB0 A;  1NK4 A;  2VG7 A;  3HT3 A;  4ELU A;  1GLD G;  4F3O A;  3T1Y K;  1S6Q A;  3CG7 A;  3O3F A;  2UUB K;  1WOQ A;  3ENH A;  4JKC A;  3QIO A;  2P5G A;  3SJJ A;  2B5J A;  3VEX A;  3PSF A;  4Y1C A;  1KFD A;  1DKG D;  1A5X A;  1U49 A;  3G71 N;  1C0F A;  3CMA N;  4DFJ A;  3P4I A;  4PWD A;  3OS1 A;  3VQ4 A;  4WQ5 C;  3A5M C;  2HBJ A;  2F8T A;  5AQV A;  4FJI A;  4FJH A;  4OGE A;  2O8E A;  2ZE2 A;  4K41 A;  1IKV A;  3DYA A;  4BRF A;  5H1S Q;  3MAQ A;  2LSN A;  1W0H A;  4GVE A;  3OS2 A;  2D1K A;  1BGX T;  2GWJ A;  1RIL A;  2E8A A;  2OPR A;  2UXC K;  3SJH A;  2NRZ A;  3SBG A;  3KK3 A;  2P9I B;  4I6M A;  1WLJ A;  4DTJ A;  4DF8 A;  4CK1 A;  4CJL A;  2IDO A;  1BHL A;  1YHQ N;  5HRO A;  2CH6 A;  4FOE A;  3BGR A;  4I9Q A;  3NHG A;  3IRX A;  4O0I A;  1HNW K;  4M41 A;  2Q31 A;  1T44 A;  4IOX A;  1NOZ A;  3EO3 A;  3E01 A;  3THX B;  1S1W A;  4CZK A;  1GOA A;  5HRR A;  4YOY A;  3KHY A;  1LWC A;  4BVO A;  3OYD A;  1GOB A;  1TV6 A;  4DV6 K;  1Q81 O;  2A42 A;  3BY5 A;  3KIO A;  4AHS A;  3D45 A;  4DTM A;  1SAZ A;  3BF3 A;  4CEO A;  2YCH A;  4KTQ A;  4Q5V A;  3I8D A;  5F0X A;  3K9K A;  3CJ1 A;  4OJR A;  1T8E A;  3U4L A;  3A5O C;  3R1X A;  4Z4F A;  1S22 A;  3RTV A;  3SI6 A;  3OYG A;  1YJ9 N;  2FBT A;  4CE9 A;  4M3Z A;  3VES A;  1ZBF A;  4AH9 A;  2HST A;  3VEV A;  3K5N A;  3M8S A;  4E7K A;  4NXM K;  2P9U A;  2P9K B;  1SUQ A;  5AZJ B;  1NGG A;  4N41 A;  3LZJ A;  2ZJQ L;  5EX5 A;  3H46 O;  1XMO K;  3O9T A;  3PY8 A;  1NBW A;  4KKO A;  4EAH D;  3DLG A;  1NKC A;  1OH6 A;  3CXC M;  3O3H A;  5CE3 A;  4BWM A;  2OTL N;  1Y64 A;  2O8C B;  2FBV A;  4GV6 A;  1J54 A;  2QI2 A;  3V9W A;  3RMC A;  4RCH A;  3F5T A;  3OY9 A;  3J7Y P;  3JAM O;  1UA0 A;  2A1S A;  1JLG A;  1TL3 A;  3JS6 A;  3CF5 L;  2HHT A;  3AV9 A;  4FPA A;  5M1P A;  4H0V B;  4OLA A;  2NNW A;  1TYQ A;  3L6Q A;  4DTP A;  1S1X A;  1FK9 A;  4N47 A;  4JK9 A;  1C1A A;  4BE2 A;  5FRM A;  1NGJ A;  5AQI A;  1MDU B;  1OVY A;  2QWM A;  1Z05 A;  3P31 A;  3NCI A;  4EZ9 A;  4CVN E;  3C65 A;  4IWV A;  2V51 B;  1HPM A;  3R6M A;  4FLU A;  1NK0 A;  4EHU A;  2D0O A;  1QZ5 A;  3E9O A;  4QAG A;  4CZG A;  4GV3 A;  1HYV A;  4JN4 A;  3A8Y A;  1T03 A;  1HKG A;  4QOZ B;  2F8S A;  3RR7 A;  2WC9 A;  5CYQ A;  2AJQ A;  4H4M A;  1Q7Y O;  1WB9 A;  1N34 K;  4ID5 A;  4FM0 A;  4H0X B;  3QEI A;  3ZSR A;  1ATN A;  4CJP A;  1XQS C;  3TU5 A;  3AVG A;  2D0P A;  4AHR A;  4IKF A;  3VEO A;  1EQY A;  1NGH A;  3U3G A;  4LF5 K;  2QKB A;  4MQ3 A;  3V6D A;  3HRG A;  4CD1 A;  4FJX A;  4A5A A;  3MEC A;  1TKX A;  4E7I A;  4FVM A;  3ZSO A;  5AZJ A;  2P9K A;  5BPN A;  4OO1 J;  1UAX A;  3VGK A;  3NVK A;  1ILY A;  3VN5 A;  3Q7C A;  4DR4 K;  1U47 A;  3SMP A;  3TPQ A;  5LL6 Z;  1B92 A;  3O4Q A;  4LSN A;  1JLB A;  1E4F T;  3AVK A;  1TKT A;  4OKE A;  4YOW A;  4DMN A;  4FK4 A;  2G8H A;  1VQP N;  5GIN A;  1JLF A;  3DLR A;  3IFR A;  5BRH A;  4N76 A;  3J7A P;  3C6H A;  4IO9 L;  2UUA K;  1NU0 A;  4WCE L;  3KJV A;  1MWM A;  4IO8 A;  1HNX K;  3NVM A;  4FJJ A;  3CFO A;  2AP1 A;  1IKY A;  3C6U A;  4E0D A;  4LH5 A;  4JKA A;  1QZ6 A;  1WUA A;  3O4N A;  5TKY A;  2HMP A;  3DLK A;  2WTU A;  1D9D A;  1EP4 A;  1YTA A;  3QFU A;  3GE1 A;  2HMI A;  2YX6 A;  4CF1 A;  3OYB A;  5AQO A;  4BR4 A;  4IDK A;  2BAN A;  1NJW A;  4CF9 A;  3RWU A;  2EHG A;  4FOI A;  4OKK A;  4CIG A;  4KHW A;  1BA0 A;  4CEZ A;  3PX4 A;  1N6Q A;  3M5R A;  3ID8 A;  3D2F A;  3CER A;  1RDA A;  3LAK A;  1LAV A;  1ZBU A;  4C1N I;  3Q7B A;  4QCL A;  4CJE A;  3HPO A;  4B9L A;  1G99 A;  1DTQ A;  1RT3 A;  4BR9 A;  5AQZ A;  1IBK K;  1NK7 A;  1YT3 A;  4AM6 A;  3NF7 A;  2ZQB A;  3MX5 A;  3L2Q A;  4CJR A;  1VQN N;  4X65 K;  3MX2 A;  2VWJ A;  2D5R A;  4IXC A;  2NRW A;  3E66 A;  4BY9 C;  4A2B A;  4GVM A;  5AQS A;  1MWK A;  2P5O A;  3FZL A;  2P51 A;  1GLE G;  3ZET A;  4XH5 A;  2A40 A;  3PIO L;  2ZWH A;  1ZC6 A;  1NGI A;  5E41 A;  2RHK A;  3VMF B;  3THX A;  3EYZ A;  1XHZ A;  4B1Y B;  2I7N A;  2X74 A;  3G0Z A;  2ASM A;  4UQG A;  4IOC L;  1WBD A;  3QNO A;  1CZ9 A;  2DFF A;  3FZF A;  2P9L B;  4CGD A;  3U6F A;  1C1C A;  2WBN A;  4B9U A;  1SL2 A;  4BC2 A;  1J5O A;  5ELZ A;  4X66 K;  4PKG A;  4BQZ A;  3WQT A;  3FR0 A;  1K73 O;  3NFA A;  4QS7 A;  3PSI A;  4JAX A;  4JNE A;  3B6O A;  1ATS A;  4I9L A;  3CJB A;  1ASV A;  2VYP A;  4HTL A;  3VQ5 A;  4EHT A;  1D5A A;  1W2B M;  4E7H A;  3ATU A;  2G8V A;  4O8K A;  3C6A A;  4CBX A;  2PYJ A;  2E2O A;  1B9F A;  1S9G A;  2A6A A;  5EU7 A;  2OZM A;  5AQM A;  3TAG A;  3EE9 A;  2YKM A;  1XC3 A;  2NRX A;  3SZ2 A;  4PY5 A;  3KVG A;  1QE1 A;  3OYA A;  4Z4E A;  1QHT A;  3HVT A;  4PL7 A;  1QSL A;  3ENB A;  4NXN K;  1JCF A;  3E9L A;  3VQE A;  3CFR A;  4K42 A;  2BGG A;  1VSH A;  1W9H A;  2KZM A;  4LH4 A;  3AVJ A;  3K58 A;  4KI6 A;  2HBL A;  3HPH A;  4BDP A;  3O9U A;  1TL1 A;  2NUB A;  4K43 A;  2W40 A;  3KWI A;  2KKZ A;  5J2Q A;  2ZF5 O;  2BUP A;  3CPW M;  3KD5 E;  1S5J A;  3CCE N;  1JL2 A;  2O8C A;  4FJ5 A;  4JKH A;  4PQU A;  1DT9 A;  4MO4 A;  1RBT A;  1HNZ K;  4AF1 A;  3D0P A;  3LDP A;  2GWK A;  1YIT N;  3OYK A;  3GDQ A;  3VEN A;  4A59 A;  5HL7 L;  4FJN A;  2O8E B;  2O4I A;  1N36 K;  5AFU A;  4M3W A;  2KZZ A;  2Q0U A;  1QQN A;  5J2N A;  3WXI A;  1U04 A;  5AQY A;  4HCB A;  4BRG A;  4LF7 K;  4DQR A;  1XWL A;  1C0U A;  3RVC A;  5AQT A;  4JV5 K;  1N8R O;  2E20 A;  2D4W A;  4CHP A;  2YHW A;  2GEL A;  3ZT2 A;  5GAD P;  3U8X A;  4GV9 A;  2PAV A;  1TUU A;  2DTU A;  4LFB K;  5I9E B;  1XI1 A;  2FLO A;  3B8A X;  3O9Q A;  1VSF A;  2Q1N A;  1F21 A;  1KCF A;  3AVM A;  3SV3 A;  5KTQ A;  1NG9 A;  3OYH A;  1FW6 A;  2JWL A;  3KK7 A;  2D0C A;  4E1J A;  1N32 K;  3V9X A;  5GAH P;  2OA8 A;  3LM2 A;  3DRS A;  3EKU A;  4JI8 K;  2IVO A;  1XUP O;  4BRH A;  4FWO A;  4CEE A;  4B1W B;  3HTV A;  4ZTJ A;  1HJR A;  4DQ8 A;  1BU6 O;  4CIF A;  3V1R A;  4IFV A;  3HSC A;  1C0T A;  2X6S A;  4FYD A;  3VQQ A;  1VQO N;  1NWK A;  3AVH A;  3VA3 A;  4E1N A;  1CZA N;  4B9N A;  2CGK A;  1X1P A;  2OPQ A;  3BEX A;  3G6E N;  1JJ2 M;  3OBW A;  3P1G A;  3DXK A;  4WQ4 C;  3PUF A;  2P9S A;  3RRG A;  3HP9 A;  1RBU A;  4RW7 A;  1VQ7 N;  2QK9 A;  4A2A A;  3B6P A;  5JS2 A;  4FVU A;  3VQB A;  1U45 A;  3QFP A;  3AVA A;  1SL1 A;  4YNQ A;  3M8Q A;  4JYA K;  3OTO K;  5AQQ A;  4NCB A;  1J9A A;  1REV A;  4BGA A;  2RPI A;  3VET A;  3T19 A;  3OYN A;  3AVB A;  2D0A A;  5KQ8 A;  1K6Y A;  1JCG A;  1CLQ A;  2JGU A;  5D3G A;  3TAM A;  3LDL A;  3TTD A;  1S1V A;  4BC4 A;  3C7N B;  5AQW A;  4DCH A;  5BN8 A;  4M45 A;  5CR4 A;  1W97 L;  2ZGZ A;  1RDB A;  1OKJ A;  3DM2 A;  4DR6 K;  4ELT A;  5C42 A;  1NGB A;  4OGC A;  4AM7 A;  3U9Z A;  4JKB A;  1KXP A;  2V52 B;  4JD2 B;  3L8B A;  3R8E A;  3MN7 A;  3FZH A;  4H03 B;  3J81 O;  3ZEU B;  4FLZ A;  4XH1 A;  1X3N A;  3BDP A;  1KVC A;  4FSV A;  3W3D A;  1U2V A;  5SWM A;  2F7T A;  2V7Y A;  5E26 A;  4FK0 A;  1IJJ A;  3N4P A;  3C95 A;  1HQE A;  4M7X A;  5LY3 A;  3SPY A;  4DTS A;  2VGM A;  3KK2 A;  3DLH A;  3AVN A;  3D2E B;  3WT0 A;  3EZ5 A;  4CJ5 A;  3WXL A;  4CGJ A;  1P90 A;  3VEW A;  3FGU A;  3F9M A;  4O0J A;  4FL9 A;  1IBL K;  5CY4 A;  1KVA A;  2F96 A;  3VQ9 A;  2DFH A;  4M7Y A;  4W5T A;  3QNN A;  4C8M A;  3G10 A;  3FZM A;  1HUX A;  3SYZ A;  4B3S K;  4FWQ A;  3S9H A;  4GW6 A;  4AHV A;  3O6W A;  3GL1 A;  4JHD A;  1VAZ A;  4DQS A;  4LFC K;  5BR9 A;  1FJG K;  3DXM B;  5KQD A;  4CJ4 A;  4NYN A;  3RMA A;  2EWS A;  4BRP A;  4OPK A;  3R9P A;  1L3T A;  4DF4 A;  2ZGY A;  3O08 A;  4JI4 K;  4H5N A;  4E1M A;  4J2B A;  2IC3 A;  4IDH A;  3EKS A;  1ATR A;  3ZSV A;  4Z4G A;  4IG0 A;  4PL8 A;  1BWF O;  4M3T A;  4DV0 K;  1J5E K;  4ILH A;  1ZBS A;  3NF8 A;  1VQM N;  4BR7 A;  4YOV A;  3C7N A;  5BRE A;  3QEV A;  1HKB A;  1UWB A;  4FLX A;  1IG9 A;  3QEP A;  5AZI B;  3THW A;  2JWK A;  1K8K A;  1BG3 A;  4ID1 A;  4AHT A;  3HXM A;  1QQO A;  3FLC O;  1BQN A;  1FKO A;  1WNS A;  3DLE A;  2RKI A;  4J8F A;  1S6P A;  3CCU N;  3I55 N;  1DLO A;  1NJX A;  1Z6R A;  1HYS A;  3CCQ N;  5AQG A;  3K0S A;  2YNG A;  5LJW A;  4DSK A;  1JLE A;  1HNI A;  2E6L A;  3TAQ A;  1ITG A;  4FWM A;  4J2A A;  2VG6 A;  3A0I X;  4JI1 K;  5M1N A;  4YFU A;  3AAQ A;  2QA4 N;  1GLL O;  3QBW A;  1VRT A;  4FPB A;  4ELV A;  2HVH A;  3V9S A;  1RFQ A;  3QDK A;  3HST B;  4CD3 A;  4JEP A;  2E4L A;  5KPR A;  5BRF A;  3RMB A;  1RTD A;  5LMU K;  5GIO A;  4DR3 K;  3H1V X;  3DLL L;  3OYF A;  4KHQ A;  4M63 C;  1IV0 A;  3F9K A;  4CF0 A;  3OYI A;  3TAF A;  5KPT A;  2FF6 A;  3VTH A;  4WYB A;  4MO5 A;  1NK5 A;  3E9P A;  5CZ2 A;  2XRI A;  4JI3 K;  1TVR A;  1YUW A;  4CCH A;  2ZJR L;  2A41 A;  1T6C A;  4EP5 A;  1KD1 O;  4LF9 K;  5HOO A;  1QVG M;  5J1E A;  3S3N A;  1X9W A;  1RTH A;  2IOC A;  1KAY A;  4K8X A;  4X64 K;  1BO5 O;  4Z0U A;  3THY A;  3EN9 A;  1K9M O;  5AQL A;  3FZK A;  3RR8 A;  2GUI A;  1VQ8 N;  1N33 K;  3MEE A;  1CXU A;  4BE1 A;  1Z25 A;  4CJQ A;  2X6N A;  3TAE A;  4FZY A;  4W5N A;  3NAE A;  3O1W A;  3RSE B;  2ZM6 K;  4DKW A;  1NMD A;  1CZB A;  4IFE A;  4H5T A;  1R59 O;  2W42 A;  5FPE A;  1YJN N;  4O4G A;  4DU3 A;  5F1X A;  1NKE A;  1BIZ A;  3LDQ A;  4NCA A;  1RDU A;  3SUP A;  3P5J A;  3C6T A;  4FW1 A;  1JKH A;  3AAR A;  5HRN A;  2YHA A;  5EXW A;  3VEZ A;  3TAP A;  3N4Q A;  3M8R A;  4H0Y B;  4F2S A;  4A62 A;  3NBP A;  4A61 A;  3FFI A;  2YNH A;  5J2M A;  3CHW A;  2FSN A;  2P9N A;  3S41 A;  2ASO A;  1N5Y A;  1Q18 A;  4OLB A;  3EY1 A;  4CI6 A;  4LY7 A;  5KRT A;  4BRO A;  1KLM A;  3UKR B;  3BZC A;  1BIU A;  1I39 A;  2HW3 A;  4A5B A;  1JCE A;  3LL3 A;  3UKU B;  5M1O A;  1SKS A;  1ASU A;  1LCU A;  4DTU A;  2FF3 B;  2IVP A;  1Q82 O;  3ASM A;  2GBZ A;  1RTJ A;  3ZSZ A;  3QLH A;  4B1X B;  3OYE A;  3DOK A;  1EET A;  3DRP A;  3DLB A;  1RDD A;  4CZJ A;  5MLC Q;  4DV3 K;  4NB4 A;  1YXQ A;  4CEF A;  3ZX3 A;  3E1Y A;  4IOA L;  4DTX A;  4EP4 A;  3UIQ A;  4BGB A;  4CBW A;  3ULE A;  1VK0 A;  4CJ3 A;  2F9T A;  4PKI A;  2O8D B;  1EKE A;  1YVU A;  4BR2 A;  3I8B A;  3ZT1 A;  4BRL A;  2OPS A;  2QWL A;  1TAQ A;  2VGN A;  3VQP A;  4DHY A;  4DB3 A;  4CEC A;  4TSX A;  1J6Z A;  2VG5 A;  3OYL A;  4DSF A;  4BRK A;  4PUO A;  2QWO A;  2IGI A;  2KW4 A;  4KRE A;  1KTQ A;  2P9U B;  4KB1 A;  3HPG A;  4GKK K;  1Q9Y A;  4B08 A;  2IVN A;  1NOY A;  4AIL C;  1RDC A;  1QHA A;  2QW9 A;  3G25 A;  5EY4 A;  4JRP A;  3KKR A;  4OVL A;  3MXJ A;  3ZYY X;  4BDZ A;  2HHU A;  1J53 A;  3EL2 A;  1TKD A;  3AA3 A;  1Q8I A;  3O3G A;  4BG9 A;  4H8K A;  3IAY A;  1RT4 A;  3V1Q A;  2YJE A;  4DSL A;  5K14 A;  1BL3 A;  4CJV A;  1DTT A;  2FBY A;  4E7L A;  4M3Y A;  3R3L A;  4FWS A;  1RTI A;  5I3U A;  2A3Z A;  3DAW A;  3ZX0 A;  4CBU A;  3KKS A;  2GEM A;  4ISG A;  1OVQ A;  4V19 S;  1WSJ A;  2ITG A;  2J4R A;  4H5W A;  2E88 A;  2G8W A;  4BDY A;  3OVN A;  3SPZ A;  2OTJ N;  3WNE A;  2GV9 A;  3JXU A;  4H0O A;  4BQL A;  3WNG A;  2OCE A;  2KLA A;  1HRH A;  5AZI A;  3THW B;  1JXB A;  3MXM A;  4DV2 K;  3EE8 A;  4DFM A;  2B6A A;  4M3X A;  3L4I A;  4U67 L;  4CK2 A;  1XC9 A;  3SQ4 A;  5JVG L;  2PFU A;  4JKF A;  5EOY A;  2O8B B;  4CGH A;  1TK0 A;  4KPY A;  2VQE K;  3CYM A;  4DU1 A;  2HHH K;  5B8H A;  4RW6 A;  3TAN A;  4EZ6 A;  2WON A;  3LPU A;  1HNV A;  3ZSY A;  3ZX2 A;  3ISN C;  3WXJ A;  5CHI A;  4KHU A;  1S9E A;  4GNI A;  2VQF K;  2G8K A;  1C0M A;  3GOI A;  3MDQ A;  1IKW A;  1X9S A; 
#chains in the Genus database with same CATH homology
 3E01 A;  2OPQ A;  4KV8 A;  4CK3 A;  1WN7 A;  3DI6 A;  5KGX A;  1S1W A;  4N5S A;  4M3R A;  3IS9 A;  3JSM A;  1GOA A;  5HRR A;  3P1G A;  2WOM A;  3PUF A;  2G8U A;  1LWC A;  3RRG A;  3HP9 A;  1RBU A;  4RW7 A;  3TAB A;  2QK9 A;  3OYD A;  1GOB A;  1TV6 A;  3B6P A;  1VSL A;  5JS2 A;  2XY6 A;  3KIO A;  4AHS A;  3AA2 A;  3VQB A;  3D45 A;  1HPZ A;  3SQ0 A;  1U45 A;  3AA4 A;  3AVA A;  1SL1 A;  4YNQ A;  3M8Q A;  4DTM A;  4C8K A;  1EXQ A;  2Z1G A;  4CEO A;  4KTQ A;  4DTN A;  4NCB A;  4Q5V A;  3I8D A;  1RT5 A;  1J9A A;  4CEQ A;  1REV A;  4OJR A;  3KLI A;  2RPI A;  1T8E A;  4Z4F A;  5SZT A;  3T19 A;  3OYN A;  3RTV A;  3AVB A;  2OYQ A;  3SI6 A;  3OYG A;  4DWI A;  4F8R A;  1RT6 A;  2D0A A;  4FJK A;  1K6Y A;  2FBT A;  3NGI A;  4CE9 A;  4M3Z A;  4ZTF A;  2JGU A;  1ZBF A;  4AH9 A;  2ZD1 A;  4LSL A;  3V9U A;  3TAM A;  1TGO A;  4IG3 A;  3ZT4 A;  4CHZ A;  3K5N A;  1KRP A;  5D3G A;  3S3M A;  3K5M A;  3QIN A;  3LDS A;  1S1V A;  3M8S A;  4E7K A;  1YTU A;  5KRS A;  1CLQ A;  3JYT A;  3K2P A;  4B8A B;  4M45 A;  3LWM A;  1SUQ A;  3TR8 A;  4DTO A;  3PV8 A;  4DS4 A;  1C1B A;  3QES A;  1RDB A;  4N41 A;  3LZJ A;  3L2V A;  3C94 A;  1WAJ A;  4I2P A;  3ALY A;  3DM2 A;  4JRQ A;  4CGG A;  3KLE A;  2QKK A;  5C42 A;  2G8F A;  3PY8 A;  4NYF A;  4ELT A;  2R7Y A;  4KKO A;  4JS4 A;  1RBS A;  4JLH A;  4HUE A;  3DLG A;  4CHY A;  4E3S A;  1KSP A;  3AVF A;  4OGC A;  4KB0 A;  1NKC A;  3PX6 A;  3V81 A;  3O3H A;  4BWM A;  4NCG A;  3L8B A;  1C6V A;  2FBV A;  4M3U A;  4RG8 A;  3HO1 A;  1J54 A;  1RT2 A;  3V9W A;  3RMC A;  2JLE A;  1KLN A;  3OY9 A;  4FLZ A;  3LAM A;  3BDP A;  1UA0 A;  3ULD A;  1LV5 A;  1KVC A;  3LP1 A;  5KGW A;  5SWM A;  2IS3 A;  1WSF A;  2FC0 A;  3H08 A;  3V1O A;  3PO5 A;  2A1S A;  4FLY A;  1JLG A;  1TL3 A;  4FK0 A;  4KRE A;  2HHT A;  3ZT3 A;  3AV9 A;  1KVB A;  3C95 A;  1HQE A;  3NH0 A;  3CQ8 A;  3QEX A;  4DTS A;  3SPY A;  3THV A;  4KTW A;  4DQI A;  2KFZ A;  1O1W A;  3KK2 A;  3DLH A;  3AVN A;  1HYZ A;  4OLA A;  3HJF A;  1S1U A;  4E7J A;  4DTP A;  1S1X A;  1FK9 A;  4N47 A;  1U48 A;  1FXX A;  1BI4 B;  4CJ5 A;  1HQU A;  2XO7 A;  3EZ5 A;  1C1A A;  1VSD A;  4BE2 A;  1IO2 A;  4CGJ A;  5FRM A;  1UA1 A;  3KK1 A;  1BQM A;  4EZ9 A;  1JXE A;  3NCI A;  4O0J A;  5CY4 A;  4C8O A;  1KVA A;  2F96 A;  1LWE A;  2BE2 A;  4O5B A;  4FLU A;  1NK0 A;  3VQ9 A;  1B9D A;  2DFH A;  3T1A A;  1SL0 A;  4W5T A;  3QNN A;  4QAG A;  4DFK A;  4C8M A;  1HYV A;  3AA5 X;  4CHN A;  1ASW A;  3K5O A;  1T03 A;  3G10 A;  4CF8 A;  2PZS A;  4QOZ B;  1IH7 A;  1RT1 A;  5CZ1 A;  5DK5 A;  3SYZ A;  3S9H A;  3K5L A;  4GW6 A;  4AHV A;  1T7P A;  3RR7 A;  2F8S A;  1LWF A;  4CER A;  4DQS A;  1EX4 A;  1S1T A;  5CYQ A;  2AJQ A;  4H4M A;  2BDP A;  3ZSW A;  2HNY A;  3VQ7 A;  5HLF A;  4ID5 A;  4FM0 A;  3QEI A;  4CJ4 A;  1VSJ A;  3QET A;  4NYN A;  3RMA A;  3ZSR A;  4CJP A;  1UOC A;  4HUG A;  5I42 A;  4C8L A;  3AVG A;  4AHR A;  5T7B A;  4OPK A;  1L3T A;  4DF4 A;  4IKF A;  4E1M A;  4J2B A;  3U3G A;  2IC3 A;  1QQC A;  3LPT A;  3RRH A;  4MQ3 A;  3QEW A;  2QKB A;  4LD0 A;  1JLA A;  3ZSV A;  4XIU A;  4GMJ B;  3V6D A;  4Z4G A;  3AO1 A;  4FJX A;  1TAU A;  4IG0 A;  1TK5 A;  2A1R A;  2RF2 A;  4OPJ A;  4FLW A;  3MEC A;  4M3T A;  4OKJ A;  5KI6 A;  1TKX A;  1BIS A;  4E7I A;  4KHY A;  1BCO A;  4FVM A;  3ZSO A;  2XY5 A;  4FZX C;  4FJ9 A;  3NF8 A;  4FXD A;  1VSM A;  1SKW A;  3HL8 A;  2YKN A;  1UAX A;  3NE6 A;  3WNH A;  4CFD A;  3QEV A;  1UWB A;  3VN5 A;  4FLX A;  3DOL A;  1IG9 A;  4JS5 A;  2ATQ A;  1NK6 A;  3QEP A;  1U47 A;  4DTR A;  4CGI A;  2XHB A;  1B92 A;  4ID1 A;  4AHT A;  3O4Q A;  4LSN A;  4CHO A;  1JLB A;  3ZSX A;  3HXM A;  4HHT A;  1L5U A;  3LWL A;  1A5W A;  1R0A A;  3AVK A;  1BQN A;  4FJ7 A;  4N56 A;  1FKO A;  1TKT A;  1WNS A;  3VQC A;  3DLE A;  4OKE A;  2RKI A;  5JS1 A;  1S6P A;  4DMN A;  4BE0 A;  3QER A;  2G8H A;  4FK4 A;  2KTQ A;  1DLO A;  1NJX A;  1HYS A;  2KFN A;  2HHW A;  2YNG A;  4DSK A;  4FZZ A;  3NGZ A;  1JLE A;  1HNI A;  1JLF A;  3TWH A;  2E6L A;  3TAQ A;  1QS4 A;  1ITG A;  4DS5 A;  4KTZ A;  4J2A A;  2VG6 A;  3DLR A;  4YFU A;  4FM2 A;  4N76 A;  2DFE A;  5FRO A;  5C25 A;  4KHN A;  4CJW A;  3VQD A;  1GOC A;  1VRT A;  4ELV A;  1FKP A;  2E6M A;  3KJV A;  4B3O A;  2ETJ A;  1BI4 A;  2HVH A;  4FJJ A;  3CFO A;  3V9S A;  1IKY A;  3C6U A;  4DSJ A;  4E0D A;  4LH5 A;  4E19 A;  3CFP A;  3HST B;  2OZS A;  3PO4 A;  4I2Q A;  2E4L A;  2HHX A;  1Q9X A;  3AO2 A;  3O4N A;  4RW8 A;  3RMB A;  3MXI A;  1ZYQ A;  1RTD A;  4KHS A;  3DLK A;  1CXQ A;  4CJS A;  3HVR A;  1D9D A;  1EP4 A;  1LW0 A;  1YTA A;  3VQ6 A;  3OYF A;  2XY8 A;  4PA1 A;  4KHQ A;  2HMI A;  5HBM A;  3AVI A;  4CF1 A;  3OYB A;  4FCY A;  1RCH A;  3F9K A;  4CF0 A;  3OYI A;  4DQQ A;  3TAF A;  4CIE A;  4IDK A;  3SQ2 A;  3TI0 A;  2BAN A;  1NK5 A;  3AVC A;  1U4B A;  1NJW A;  3AVL A;  4CF9 A;  3RWU A;  2EHG A;  2XRI A;  4OKK A;  5CZ2 A;  1KFS A;  2G8I A;  1TVR A;  4CIG A;  4KHW A;  5C24 A;  3VQA A;  4CED A;  4CCH A;  4CEZ A;  4HCC A;  3L2R A;  3PX4 A;  4HVJ A;  2I5J A;  1SV5 A;  4EP5 A;  1N6Q A;  1WSE A;  5J1E A;  3S3N A;  1RDA A;  1X9W A;  3LAK A;  1LAV A;  1RTH A;  1ZBU A;  2IOC A;  3LAL A;  4B9S A;  4K8X A;  4Z0U A;  2YHB A;  2OPP A;  4QCL A;  4CJE A;  2QXF A;  2YNI A;  1D8Y A;  3LAN A;  3HPO A;  4B9L A;  4L8R B;  3RR8 A;  2GUI A;  4B9V A;  3KLG A;  1A5V A;  1DTQ A;  1RT3 A;  3MEE A;  4F2R A;  2FBX A;  3KLH A;  4DG1 A;  1NK7 A;  1CXU A;  1YT3 A;  2O4G A;  3NF7 A;  4DLG A;  1RT7 A;  2ZQB A;  1Z25 A;  2P1J A;  3LP3 A;  4CJQ A;  4BE1 A;  1MU2 A;  1RNH A;  3L2Q A;  3ZCM A;  4DLE A;  4Q0B A;  4CJR A;  2X6N A;  3L2U A;  3TAE A;  4FZY A;  4W5N A;  3DMJ A;  3NAE A;  2VWJ A;  5HRP A;  4B9M A;  2D5R A;  3TAR A;  2HND A;  1CZB A;  3HP6 A;  4J2E A;  1NOZ A;  4GVM A;  3CM6 A;  2W42 A;  2P5O A;  4Z4I A;  2HVI A;  3KLF A;  3SV4 A;  2P51 A;  4B9T A;  4Y1D A;  4O4G A;  4DU4 A;  3OJU A;  4DU3 A;  4KRF A;  3CM5 A;  1NKE A;  4DSI A;  1BIZ A;  3M8P A;  3K59 A;  3VA0 A;  4NCA A;  3LP2 A;  4F4K A;  1VSI A;  5E41 A;  3MEG A;  3SUP A;  3P5J A;  5CYM A;  1SKR A;  3DRR A;  3NF9 A;  4FLV A;  3EYZ A;  1XHZ A;  3C6T A;  1WSG A;  1WSI A;  4FW1 A;  5HRS A;  4FM1 A;  3L3V A;  4DSE A;  2Y1I A;  3SUQ A;  1L3V A;  1JKH A;  2X74 A;  5HRN A;  4CF2 A;  2YHA A;  4CJF A;  3G0Z A;  3TAP A;  4CGF A;  3QO9 A;  4FK2 A;  4RW4 A;  4CJT A;  3OS0 A;  1BCM A;  2KQ2 A;  3KD1 E;  3OYM A;  4UQG A;  3M8R A;  4O44 A;  4B8C A;  4F2S A;  3QNO A;  1LAW A;  1CZ9 A;  3QIP A;  5DMR A;  3NBP A;  1Y97 A;  4H4O A;  4MFB A;  2DFF A;  3FFI A;  5FDL A;  4K8Z A;  2YNH A;  1QSY A;  4ICL A;  1ZBH A;  4KO0 A;  5J2M A;  4CGD A;  3U6F A;  1C1C A;  1G15 A;  4B9U A;  1WAF A;  4W5R A;  3S3O A;  1SL2 A;  4CES A;  1J5O A;  2IAJ A;  1N5Y A;  2HNZ A;  4OLB A;  3EY1 A;  4F3T A;  4DQP A;  1JLC A;  4LY7 A;  5KRT A;  3OYC A;  1VRU A;  4Z4C A;  1KLM A;  4KI4 A;  4C8N A;  1JLQ A;  3NFA A;  1TK8 A;  1NKB A;  3B6O A;  4HUF A;  3SNN A;  4I9L A;  1VSK A;  2YNF A;  1I3A A;  1ASV A;  3SQ1 A;  2X78 A;  4DFP A;  2DY4 A;  3VQ5 A;  1D5A A;  4ZHR A;  4O55 A;  3ZSQ A;  1BIU A;  4E7H A;  1LW2 A;  1I39 A;  4AHC A;  2G8V A;  2HW3 A;  4J2D A;  2PYJ A;  1B9F A;  1S9G A;  5EU7 A;  2OZM A;  1XHX A;  2Q3S A;  3TAG A;  2Z1J A;  1NK9 A;  2YKM A;  2HHS A;  1QTM A;  4AHU A;  1ASU A;  1NK8 A;  4DTU A;  3SZ2 A;  4HTU A;  4RW9 A;  1SKS A;  1L3S A;  1RBR A;  4PY5 A;  1T05 A;  2RN2 A;  1QE1 A;  3OYA A;  1ZBL A;  4Z4E A;  1QHT A;  1WSH A;  3ASM A;  3IG1 A;  2GBZ A;  3SUN A;  1RTJ A;  4BAC A;  3HVT A;  3ZSZ A;  4CHQ A;  3QLH A;  2PYL A;  3V9Z A;  3NDK A;  3VQ8 A;  3OYE A;  3DOK A;  1QSL A;  1EET A;  3DRP A;  3A2F A;  4FJ8 A;  3DLB A;  1HMV A;  1RDD A;  3T3F A;  3VQE A;  3CFR A;  3I0R A;  2Z1I A;  3OJS A;  4CEF A;  4FW2 A;  2BGG A;  1VSH A;  3LZI A;  1W9H A;  3AO3 A;  1RBV A;  3I0S A;  4DTX A;  5J2P A;  4EP4 A;  3UIQ A;  2KZM A;  4LH4 A;  1VK0 A;  3AVJ A;  4CJ3 A;  3K58 A;  3P83 D;  1EKE A;  1YVU A;  4KI6 A;  3LP0 A;  3K57 A;  3HPH A;  4BDP A;  3ZT1 A;  2XY7 A;  2OPS A;  4W5Q A;  2B4J A;  1TAQ A;  4FJL A;  4FLT A;  5HP1 A;  3U3Y A;  1NJY A;  3MED A;  2D0B A;  3VQP A;  1TL1 A;  4E89 A;  2NUB A;  2Y1J A;  3HM9 A;  4CEC A;  5J2Q A;  4TSX A;  4FJG A;  4WE1 A;  3PX0 A;  2VG5 A;  4I7F A;  3OYL A;  3KD5 E;  4DSF A;  1S5J A;  4PUO A;  3WNF A;  3RMD A;  1JL2 A;  2IGI A;  2HB5 A;  2KW4 A;  1KTQ A;  3SCX A;  4KB1 A;  3HPG A;  3AO5 A;  3L2W A;  1Q9Y A;  4B08 A;  1NOY A;  4FJ5 A;  4AIL C;  4PQU A;  3HYF A;  1RBT A;  2EX3 A;  1RDC A;  1D9F A;  1JL1 A;  3L3U A;  4FJM A;  4BWJ A;  3NH1 A;  3ITH A;  3D0P A;  4IBN A;  4JRP A;  2HHQ A;  3AO4 A;  3KKR A;  4OVL A;  3MXJ A;  4BDZ A;  1QSS A;  3ZT0 A;  2HHU A;  3OYK A;  1J53 A;  1NK4 A;  2VG7 A;  4FJN A;  1TKZ A;  3HT3 A;  4ELU A;  2O4I A;  1TKD A;  4F3O A;  5FRN A;  3AA3 A;  4CFB A;  2PY5 A;  1Q8I A;  1S6Q A;  3CG7 A;  3O3F A;  3O3G A;  4H8K A;  5J2N A;  4M3W A;  3IAY A;  2KZZ A;  1RT4 A;  1U04 A;  3QIO A;  2P5G A;  4HCB A;  3SJJ A;  3V1Q A;  1IKX A;  4DSL A;  3OYJ A;  5K14 A;  2B5J A;  1BL3 A;  1XWL A;  4G1Q A;  1C0U A;  4CJV A;  4W5O A;  4DQR A;  1DTT A;  2FBY A;  4Y1C A;  4E7L A;  4M3Y A;  1RTI A;  5I3U A;  1KFD A;  4CEB A;  1A5X A;  3ZT2 A;  4CHP A;  4R5P A;  1U49 A;  4DFJ A;  3V4I A;  2DTU A;  3KKS A;  4PWD A;  1XI1 A;  3KTQ A;  3OS1 A;  3VQ4 A;  1VSF A;  1WSJ A;  2ITG A;  3NGY A;  1F21 A;  2Z1H A;  2G8W A;  1KCF A;  2F8T A;  4BDY A;  3OVN A;  1ZBI A;  3AVM A;  3SPZ A;  4FJI A;  3WNE A;  4KFB A;  3F73 A;  4OGE A;  3SV3 A;  2GV9 A;  2ZE2 A;  4CFC A;  5KTQ A;  1L3U A;  4FJH A;  1IKV A;  1VSE A;  3DYA A;  3WNG A;  4Z4H A;  3OYH A;  2VWK A;  4CJK A;  3MAQ A;  2HHV A;  2D0C A;  1HRH A;  1JXB A;  3V9X A;  3MXM A;  2LSN A;  1W0H A;  2OA8 A;  4DFM A;  2B6A A;  4M3X A;  3DRS A;  3OS2 A;  4CEE A;  4CK2 A;  1XC9 A;  1BGX T;  3SQ4 A;  3HK2 A;  1RIL A;  2YV0 X;  3NF6 A;  3SUO A;  1HJR A;  2OPR A;  4ZTJ A;  4CGH A;  4IFY A;  1X9M A;  1TK0 A;  4KPY A;  3CYM A;  4DU1 A;  4CIF A;  4M42 A;  3KK3 A;  3V1R A;  4RW6 A;  4IFV A;  3TAN A;  2WON A;  4EZ6 A;  4CFA A;  3LPU A;  1HNV A;  1WLJ A;  4DTJ A;  4CK1 A;  4DF8 A;  4CJL A;  3ZSY A;  1C0T A;  2X6S A;  1Z26 A;  2IDO A;  4FYD A;  3ISN C;  1BHL A;  3VQQ A;  5HRO A;  3AVH A;  4CEA A;  3VA3 A;  3BGR A;  4I9Q A;  4E1N A;  3NHG A;  4KHU A;  3IRX A;  4O0I A;  1S9E A;  4M41 A;  4CJU A;  2G8K A;  1C0M A;  4KAZ A;  1NJZ A;  1IKW A;  3NH2 A;  4B9N A;  1X1P A;  1X9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...