2Z1JA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMKPKLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Ribonuclease HI
total genus 48
structure length 151
sequence length 151
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1jA00
1BQNA 1EX4A 1W9HA 3LP0A 4AHCA 1MU2A 2DFFA 1BCOA 3AVJA 4FXDA 4HUGA 3AVFA 4IG3A 4HVJA 3QEWA 4B9VA 1QE1A 3L2WA 1FKPA 3QEPA 3ULDA 3AVKA 4FJGA 2Z1JA 4BDYA 4KI4A 4DTOA 2HHXA 4B9LA 3O3GA 3NDKA 1JLGA 3V9ZA 4DQSA 4W5OA 4AHVA 1S1XA 2HHWA 4CFCA 4HTUA 1BHLA 4ELVA 3HJFA 2NUBA 2RN2A 3DRSA 1SUQA 4LSLA 4C8MA 4HUFA 1IG9A 1TK5A 3AVHA 2G8UA 4FJMA 4CJ3A 5HRRA 3V9UA 2HHTA 4KPYA 3QEVA 2Y1IA 2YHAA 2Z1IA 4M3WA 3KLGA 4KV8A 4FJHA 4Y1CA 4CJUA 1ZBFA 4Q0BA 1UA0A 1Q9YA 2BANA 3ZT1A 3MEDA 4BE0A 1L3VA 1IKVA 1JLEA 3NF8A 4CF1A 2D0AA 3MXJA 4LH4A 1UAXA 1VRUA 3F73A 3TAMA 3U3YA 4E3SA 4BDPA 4NCAA 3C95A 1XWLA 2O4IA 1GOBA 1NKCA 4CCHA 1W0HA 4CK2A 3SZ2A 4EP5A 1RT3A 3D45A 4H4OA 2OZSA 4Z4FA 3ASMA 3AO4A 3AV9A 3CM6A 2FBXA 4FM0A 1BI4B 1HPZA 3LAKA 3O3FA 2PYLA 1GOCA 3QLHA 3KLFA 2R7YA 4FLXA 4PA1A 4PY5A 3LDSA 1YTUA 4FJ8A 1REVA 4IG0A 1NKBA 1RBTA 3I0RA 4PQUA 3OYAA 4FJKA 2P1JA 3OYKA 3DOLA 3ZT3A 5C24A 3DLEA 3QIOA 1LW2A 1ASWA 4CGIA 1JL1A 3KKRA 4I2PA 3AA5X 3MEEA 4CF2A 1KFDA 4EP4A 3LANA 2D5RA 1S1TA 5EU7A 4GVMA 4Y1DA 3SUNA 4LSNA 3TAQA 1L3TA 3RR7A 4M3YA 4PUOA 3ZSZA 3VN5A 1NKEA 4BDZA 1YTAA 1VSHA 1RBSA 4Z4HA 3IAYA 4FLUA 3QINA 4EZ9A 5J2MA 1RTIA 1NK6A 3BDPA 4FJIA 4IFVA 2DFEA 1S5JA 4KHQA 3OYIA 3NFAA 3QIPA 4FLZA 3D0PA 3JSMA 3VA0A 3SI6A 4IDKA 3TABA 3SNNA 3JYTA 3RMBA 1TAQA 4B9SA 4FVMA 3VQBA 4F4KA 1Z25A 1U45A 4RW4A 4CGDA 4OGEA 4YFUA 1NJYA 1L3SA 2ETJA 1TK0A 4B9MA 2YV0X 4CJ5A 3KIOA 4DFMA 3HPGA 3VQCA 1CZ9A 2E6MA 4AHRA 4JRQA 4CK1A 3V9WA 1WSIA 1GOAA 3CG7A 4O5BA 4F2SA 4IFYA 2YNHA 3V81A 4DSFA 2P51A 5HROA 4DF8A 4CHZA 2WONA 3NF7A 1C0TA 1S1WA 4C8KA 2PY5A 1LWEA 4DTSA 4OGCA 3CFPA 4BWMA 4DQQA 2YKNA 1YT3A 4CJQA 4I9LA 3S3NA 2X74A 5CZ2A 1DLOA 1JLQA 4DLGA 4ELUA 3PX6A 2X78A 3CFOA 3PUFA 1J5OA 4K8XA 3LWMA 5FRNA 3NHGA 1LAVA 3LPUA 3LPTA 1ASVA 1TL1A 3O4QA 3PX0A 4ZHRA 4YNQA 4OKKA 1JXBA 4B9UA 3DYAA 2D0BA 4DU3A 4I9QA 1VRTA 2IOCA 4CE9A 4DQRA 5K14A 4ID1A 2G8HA 5JS1A 4E1NA 1YVUA 4CGGA 5HRPA 3LZIA 4DF4A 4FCYA 4DTNA 1IKXA 2HW3A 2Z1GA 1LW0A 3ZT2A 2RKIA 3K5OA 3V1OA 1SL2A 3OJUA 4QCLA 2GUIA 2DY4A 1C1BA 1T7PA 1HQEA 1O1WA 1IH7A 4FM1A 2PYJA 4KTQA 2QKKA 3NGIA 1RT7A 1WAFA 3I0SA 5DMRA 1T05A 1DTTA 4CJSA 1UOCA 4W5QA 4DSEA 4M42A 2ZE2A 1Q9XA 3VQEA 4CJEA 3DLGA 1QS4A 3LP1A 3OYJA 5I42A 4CHQA 4E0DA 1RT6A 3A2FA 2VG5A 1FKOA 4CGJA 4EZ6A 1G15A 2EHGA 1WAJA 3ZSOA 4JS4A 1Q8IA 4JLHA 3KK3A 4OVLA 4FJ9A 3HP6A 1S9GA 4OLAA 3V9SA 1JLBA 4AHSA 4FLVA 1QTMA 3K2PA 1BIZA 1KLMA 2A1SA 4KAZA 4IKFA 1BISA 2HNYA 1QSYA 1BIUA 2IS3A 2VG7A 1N5YA 3M8RA 3AA4A 4DTUA 3SYZA 3WNEA 2OPSA 2B4JA 4M3ZA 2KW4A 1TKXA 4B8CA 1HNIA 5DK5A 5KRTA 1S6PA 3VQ7A 1VSFA 3QERA 1KRPA 2BDPA 1VSDA 3PO4A 3AO2A 4CEZA 2OYQA 3QNNA 2XRIA 4E89A 1C0MA 4RW6A 1HYSA 3F9KA 4OKEA 2I5JA 3TR8A 3OYGA 3PX4A 4LH5A 4CGFA 1SL1A 1NK9A 4HCBA 2FBTA 1HYVA 1RDBA 2IC3A 3OYFA 4AILC 4Q5VA 1CZBA 1QSLA 2Z1HA 2KZMA 4CJRA 1U47A 2G8KA 3LP3A 2GBZA 2VG6A 3SQ1A 1WSFA 4FLYA 3KK2A 1X9SA 5FDLA 4NYNA 3AVMA 1WSGA 3NAEA 4FK2A 4C8LA 1CXQA 3HSTB 4RW7A 4DS5A 3QETA 2HHSA 4KFBA 2P5OA 4FZXC 4NCBA 4KREA 2BGGA 3TANA 3LALA 1T03A 2HB5A 1I3AA 4CIGA 3SUOA 4NCGA 3AA2A 1EXQA 3TAPA 3S3OA 3P5JA 3OS1A 4FM2A 1IKYA 1WNSA 4CESA 1WSJA 2JLEA 2E4LA 2XY6A 3E01A 4MQ3A 4ELTA 4KB0A 1TGOA 2KZZA 3DMJA 1WLJA 4DTRA 1JLAA 3VQDA 3NF9A 3ZSQA 4CEEA 1BGXT 1RCHA 4CJLA 5J2PA 1N6QA 3RRGA 1RTHA 3VA3A 3SJJA 1RILA 2P5GA 1RT2A 3B6OA 4DSKA 1SKSA 1KVAA 1NOYA 1ZBUA 3UIQA 3ZSVA 1BI4A 3WNGA 3K58A 2F96A 1SV5A 3IRXA 3P83D 3NBPA 3AO3A 3IS9A 3K57A 4O44A 3AVAA 3NGZA 1TL3A 4MFBA 1I39A 3WNHA 4O0IA 4E7KA 2RF2A 3VQ4A 4CEAA 1WSHA 4QAGA 4RG8A 4FZYA 4CJPA 2KQ2A 1A5VA 4KHWA 4B8AB 3NGYA 3NH1A 3QESA 4FJLA 1CLQA 4W5NA 1VSJA 1HNVA 1RNHA 2HVHA 4C8NA 4RW8A 3KD5E 3KLEA 3MECA 4AHTA 2KTQA 4DTJA 3OYMA 3SPZA 2HHQA 3PO5A 1C0UA 4CHOA 3V6DA 3NF6A 1HRHA 5E41A 4CF8A 4KHYA 1TKTA 3AO5A 2A1RA 1D9DA 3T19A 1EETA 4CECA 3NH2A 4CEOA 4OPKA 4W5RA 1RT1A 3ZCMA 1B9DA 2W42A 4BACA 1QHTA 3DLKA 4FLWA 2G8FA 2PZSA 1UWBA 1EKEA 5SWMA 3KLIA 1LWFA 4OJRA 4J2DA 3AA3A 2HVIA 3AVIA 4KO0A 2YKMA 4KHNA 3SQ0A 3OYLA 1XHZA 1NOZA 4O55A 3AVCA 3C94A 2IDOA 3DRRA 4CEQA 4H4MA 5T7BA 1SL0A 4DTMA 2ITGA 1JXEA 1D9FA 1KCFA 2Q3SA 3RRHA 4CK3A 4KHSA 1S9EA 3H08A 1XI1A 4CFBA 3VQAA 4DLEA 1SKRA 2KFZA 1TV6A 4KTZA 3KLHA 3OVNA 1NJWA 4KKOA 3VQ6A 1JKHA 4E1MA 4DQPA 2XO7A 4DSLA 3RTVA 3VQ9A 4FYDA 5CYQA 3C6UA 4CJWA 3VQ8A 1HYZA 2O4GA 3VQQA 4WE1A 3L2VA 1C1AA 3L2UA 4M3TA 5KGXA 1Z26A 3FFIA 3HPHA 4LY7A 1RT5A 2OPQA 1KVBA 5JS2A 5J1EA 3HXMA 3EYZA 3ZSXA 4BE1A 4AHUA 4CJFA 5CYMA 4Z4CA 2OPPA 1J53A 3OYEA 3BGRA 4DQIA 1CXUA 1KTQA 4TSXA 4N56A 2ZD1A 3U3GA 1BCMA 4F3OA 1U48A 4DS4A 5KGWA 4OPJA 4KTWA 4N47A 3B6PA 3CYMA 5SZTA 4BE2A 3QEIA 3MXIA 1KLNA 3TI0A 4W5TA 4CJ4A 3AVGA 2HHVA 1TVRA 3SPYA 3K5MA 1BQMA 5J2QA 2QKBA 4FJ7A 2KFNA 3EZ5A 3MEGA 4IBNA 3G10A 1SKWA 2LSNA 1B92A 3DRPA 3V9XA 3AO1A 3OYNA 1S1UA 4FW1A 3PY8A 4B3OA 2FBVA 4FJXA 2RPIA 2XY5A 1U4BA 2QXFA 3DOKA 3ITHA 3ZSYA 3OYBA 4BWJA 4ZTJA 1S6QA 4QOZB 3ZSWA 3TAGA 3C6TA 5HP1A 3DLBA 2G8WA 1ZBLA 4J2BA 3M8QA 5KTQA 1VK0A 3RMAA 3T1AA 1RBUA 3KK1A 4JS5A 2VWKA 3I8DA 3K5NA 3EY1A 1JLCA 4N41A 4M45A 4DTPA 5CY4A 1KFSA 2HMIA 3S3MA 2OZMA 3SV3A 1FK9A 3HPOA 1ZYQA 3G0ZA 4CFAA 3HVRA 3OYHA 3O4NA 2D0CA 3TAFA 1A5XA 2X6NA 5C25A 3DLHA 3SV4A 4DTXA 3RR8A 5I3UA 1T8EA 2B6AA 3DLRA 4NYFA 4F2RA 4C8OA 4FJ5A 4M3UA 2DTUA 3DM2A 2FC0A 3L3VA 4CF0A 3HK2A 4CERA 3LAMA 3QO9A 1X9MA 1NK7A 4K8ZA 4CHYA 3MXMA 4Z4IA 1NK5A 1LWCA 4J2AA 4RW9A 3O3HA 4E19A 3ALYA 3LP2A 2DFHA 4E7LA 1VSIA 1WN7A 2XHBA 4JRPA 3CQ8A 3OS0A 3U6FA 1HQUA 1JL2A 5J2NA 3SUPA 1QSSA 5HRSA 3ZSRA 3NH0A 1EP4A 3KD1E 4CEDA 2E6LA 1K6YA 1IO2A 1RDAA 1RBVA 1VSLA 2IAJA 1VSMA 3ISNC 3K5LA 4DWIA 2G8IA 2XY8A 4CHPA 4CFDA 3OYDA 3CFRA 4CIFA 4HHTA 3TARA 3THVA 1D8YA 4FK0A 2AJQA 1C6VA 4DMNA 4KRFA 3HL8A 2G8VA 3L2RA 3SUQA 1L5UA 4CGHA 1RTDA 2OPRA 4FK4A 3QNOA 1ZBHA 4CIEA 1KVCA 3LZJA 1S1VA 2WOMA 3V1RA 1RT4A 1NK8A 4E7IA 3OS2A 3L2QA 3HYFA 2VWJA 1NK4A 3WNFA 1D5AA 2F8TA 4HUEA 4OKJA 3ZT4A 4KB1A 4HCCA 3TWHA 2B5JA 1BL3A 2HNDA 4DFPA 1RTJA 1NJXA 4ZTFA 5D3GA 4Z4EA 3L8BA 2OA8A 2QK9A 3KTQA 1IKWA 4E7HA 4Z4GA 3LWLA 1U04A 1DTQA 1VSEA 4XIUA 1FXXA 3HVTA 4CJVA 4FLTA 4O4GA 2IGIA 2YNFA 1TKDA 4DFKA 3M8SA 3CM5A 3NCIA 3TAEA 3VQ5A 3VQPA 3T3FA 4KI6A 3HO1A 3V4IA 4E7JA 4OLBA 3DI6A 4M3RA 4DG1A 4CHNA 2YHBA 2F8SA 4ID5A 4CEBA 5FROA 4H8KA 3RMDA 2YNIA 3IG1A 4L8RB 4O0JA 3HP9A 4Z0UA 1R0AA 3M8PA 1U49A 1RDDA 1XHXA 1Y97A 4I2QA 5KI6A 5CZ1A 1ASUA 1J9AA 5C42A 4CF9A 4M3XA 5HRNA 3OY9A 1NK0A 1TK8A 4CEFA 3SCXA 1L3UA 4FJJA 1RBRA 3ZT0A 3SQ4A 1C1CA 4DU4A 2BE2A 4FW2A 1F21A 4GMJB 1HJRA 3RMCA 5KRSA 1LV5A 4ICLA 4KHUA 4B9NA 4M41A 3AVBA 2JGUA 2Y1JA 4J2EA 2YNGA 4R5PA 1J54A 1RDCA 3HM9A 3MAQA 4B9TA 1TKZA 5HLFA 2ATQA 5FRMA 3PV8A 4AH9A 4I7FA 3S9HA 1NJZA 3NE6A 1XC9A 4B08A 3KKSA 4FJNA 1B9FA 2ZQBA 3OYCA 4LD0A 4UQGA 4CJKA 1VSKA 2FBYA 1HMVA 2HNZA 3KJVA 1JLFA 1WSEA 4DU1A 1A5WA 3L3UA 3OJSA 3HT3A 2EX3A 4CJTA 1KSPA 1QQCA 3AVLA 3V1QA 4DSIA 3K59A 1ZBIA 5HBMA 4GW6A 1UA1A 1LAWA 4N76A 4PWDA 3AVNA 1TAUA 3QEXA 3RWUA 4F8RA 4FZZA 4F3TA 4DSJA 2GV9A 1X9WA 4DFJA 3SQ2A 4N5SA 2HHUA 4G1QA 1ITGA 2XY7A 1X1PA 3P1GA 2X6SA
chains in the Genus database with same CATH superfamily
1X3NA 1YJ9N 4AHCA 3P4IA 5JICA 1N36K 5MLCQ 5EY4A 3AVJA 5F0XA 2V51B 4IOAL 2HBKA 3O9TA 2ZJPL 1TYQA 3L2WA 2W6LA 3QEPA 1BDGA 2AP1A 3ULDA 3AVKA 3T69A 3VENA 2Z1JA 3AARA 4FJGA 2HHXA 3O3GA 4HTUA 1BHLA 4LF9K 1CZAN 3S41A 3HJFA 4C8MA 2RN2A 5E26A 4YHHK 4HUFA 3TPQA 1IG9A 4FJMA 2O8BB 3J8AA 4B1WB 4KPYA 2Y1IA 3LM9A 4KV8A 4H5TA 1NGDA 4Q0BA 1ZBFA 1UA0A 2VGMA 1Q9YA 1L3VA 4KH6A 1UAXA 4NCAA 3TAMA 4E3SA 3C95A 5C12A 3DLLL 1GOBA 4EP5A 3D45A 3ID8A 4Z4FA 3AO4A 1GLAG 4FM0A 1V4TA 2PYLA 3QLHA 4FLXA 3JS6A 2OANA 1REVA 4IG0A 5B8HA 4XH5A 1I94K 3DOLA 4FVUA 2HBMA 4I2PA 3AA5X 4EP4A 1S1TA 5EU7A 2FSNA 5AQSA 1L3TA 2KLAA 1NKEA 1T3VA 1VSHA 4Z4HA 3QINA 1RTIA 3EKSA 3VGLA 4FLZA 1NGFA 3A5MC 3D0PA 3JSMA 3SNNA 3TABA 4B9SA 4FVMA 3VQBA 1U45A 4OGEA 2O8CB 1QHAA 4M7YA 3THYA 3KIOA 3CJ7A 5AQGA 2CGJA 3HPGA 3LDNA 3QMLA 4JRQA 4DV1K 2P9NA 3M6GA 2KKZA 3V81A 2P51A 3UB5A 3HOSA 3JXUA 3KWIA 2GWJA 4C8KA 4DQQA 2YKNA 3E1YA 1JLQA 4O5FA 3SBTA 1WBDA 4ELUA 1J5OA 5FRNA 3LWMA 4OX9K 1ESVA 2IOCA 3F2KA 4ID1A 1SS6A 2ZGZA 4E1NA 5HRPA 4OO1J 1IKXA 3ZT2A 2RKIA 3D2EA 3OJUA 1HQEA 5AQXA 4I6MA 2QKKA 1UOCA 4L3QA 3R8EA 3DLGA 1QS4A 1RT6A 3F5TA 1WAJA 3OTOK 3MDQA 3ZSOA 1Q8IA 4JS4A 4YOVA 3HP6A 1DT9A 4BGBA 1FJGK 2QWRA 1KLMA 1YIJN 3CETA 2Q0UA 2HNYA 4BC4A 1BIUA 4LFAK 3T1YK 3AA4A 3O9RA 2B4JA 4M3ZA 2KW4A 4B8CA 1KRPA 1HNIA 4BY9C 4X66K 1YVNA 3AGRA 2OYQA 4RW6A 1HYSA 3TR8A 4A2AA 1OKJA 4CGFA 2FBTA 3R9PA 1QSLA 4CJRA 3B8AX 1U47A 1TUUA 4Y0WA 2G8KA 3LP3A 3MN9A 2VG6A 1NBWA 4OPAA 5BREA 5FPNA 3D2FB 4NYNA 4FK2A 4WQ4A 4CD1A 4FZXC 1N33K 2PFUA 3HI0A 3SK3A 3SUOA 1EXQA 1KQSM 3P5JA 1IKYA 4CESA 4A61A 1J5EK 1WSJA 3G6EN 2XY6A 4KB0A 2NRTA 2KZZA 3DMJA 3PIOL 3AAPA 3RRGA 1RTHA 3SAHA 3LDOA 3VA3A 2V52B 3SJJA 2P5GA 1RT2A 4K25A 4LC9B 4DR1K 1BI4A 3K58A 5BR9A 3IRXA 1BUPA 4R79A 4O44A 3WNHA 4QS7A 4E7KA 2NRRA 4YOWA 4RG8A 4FZYA 2GUPA 1A5VA 4U67L 3NH1A 1CLQA 1Q7YO 4W5NA 1HNVA 4RW8A 4BRLA 4JKGA 3MCPA 3OYMA 3N4QA 3SPZA 2YI1A 3NF6A 3T7ZA 4CF8A 4KHYA 1TKTA 3VF2A 4OPKA 3VPZA 4FSVA 2PZSA 1UWBA 3LDPA 4GKKK 3KLIA 1YUWA 4OJRA 4DB3A 4WFNL 3I55N 2E2PA 1DKGD 3SQ0A 2IDOA 5T7BA 2GX9A 4H4MA 4JHDA 3M5RA 3NVKA 1XQSC 1GLCG 4DV7K 3G4SN 1S9EA 5BR8K 4IWVA 5AQVA 1SKRA 1TV6A 3T1HK 3VQ6A 1OVYA 1JKHA 2XO7A 3RTVA 3VQ9A 4JKCA 3VEZA 3VQ8A 1C1AA 4M7XA 5KGXA 5JLFA 3HPHA 1RT5A 5J1EA 4GV3A 1YI2N 1NGAA 4NO7A 4BE1A 2OPPA 1J53A 2VWBA 3OYEA 2E88A 1T6DA 4TSXA 2BUPA 3CPEA 4F3OA 1U48A 4DS4A 2YHXA 4KTWA 1KLNA 3QEIA 1HR0K 4JKEA 3TI0A 4W5TA 3QBWA 3FE1A 2KFNA 3ENOA 3EZ5A 3MEGA 4IBNA 4JK8A 3G10A 4G9ZA 1B92A 3TSQA 3NVMA 4QS8A 2QXFA 3ZSYA 1U4BA 4QOZB 5HP1A 3VERA 1OH5A 1ZC6A 4J2BA 3H1QA 5KTQA 2O8BA 1NU0A 2VWKA 4BQLA 4DTPA 5CY4A 1KFSA 2OZMA 4E1JA 1JJ2M 1FK9A 3G0ZA 1P90A 3O08A 4BRFA 3O4NA 3QICA 3P38A 1EWRA 5I9EB 4CZFA 5C25A 3SV4A 3RR8A 3WQTA 2B6AA 5EXWA 2QWLA 4BR2A 4C8OA 5AR0A 5FPEA 1JCEA 4CERA 1HNXK 3ZEUA 4CHYA 3O9SA 4CZLA 3CMAN 2QWMA 4J2AA 4FO0A 2P9LA 4RW9A 3O3HA 3LP2A 1K8KA 3A5OC 4JRPA 3L4IA 1NGGA 3SUPA 5TKWA 1QSSA 1EP4A 1VSMA 2E6LA 3WXJA 3D2EB 1D8YA 4CHPA 4FK0A 3THVA 3HL8A 3L2RA 4DUYK 1RTDA 3LDQA 3OBWA 3QNOA 1KVCA 3CMEN 2WOMA 4FPBA 4E7IA 4BRMA 2F8TA 3ZT4A 3CI5A 3TWHA 3C7NB 2B5JA 3WXKA 1BL3A 1RDWX 4Z4EA 3OHRA 5TKYA 1QVFM 2J4RA 3UKRB 2YNFA 1TKDA 4M63C 3CM5A 3NCIA 4BRIA 4EAHD 3TAEA 3VQPA 4DR2K 1R59O 1HKCA 2UUBK 4E7JA 2VQFK 2YHBA 2F8SA 3SBGA 4CEBA 5FROA 1ILYA 5KPZA 1KC8O 1DGKN 4O0JA 2PBDA 1W7AA 2ASMA 3OW2M 4I2QA 1L3UA 4FJJA 1TK8A 4CEFA 1V4SA 4DU4A 1NLVA 1F21A 5KRSA 3D2FA 3NMUA 4J2EA 3HM9A 1J54A 2F9TA 3S9HA 4BRHA 4B08A 3KKSA 3FZLA 4FJNA 2ZQBA 1VSKA 1WSEA 4YOXA 5AQRA 4KH4A 3L3UA 1OVQA 2EX3A 4O8KA 4CJTA 1ZBIA 3K59A 4DV6K 1UA1A 3QEXA 4F3TA 4FZZA 4H0XB 4DFJA 3P39A 3ZYYX 4N5SA 1ITGA 3P1GA 4CZGA 2X6SA 3MN5A 3LP0A 5CHIA 2DFFA 3FZHA 5JMVA 1Q82O 1KAYA 3CCRN 3F9MA 4DTOA 4B9LA 3NDKA 3V9ZA 4AHVA 1S1XA 2NUBA 3DRSA 5AQKA 1TK5A 3AVHA 2HBJA 1GLFO 3CD6N 2P9PA 3FZMA 3QEVA 2YHAA 4FJHA 4B1XB 1ATSA 1C0GA 2BH1A 2ZM6K 4H0VB 3NF8A 2ZJQL 2D0AA 3MXJA 4LH4A 4NLBA 3F73A 4H5VA 4IXCA 3G71N 3QBXA 3SZ2A 2W6KA 2HF3A 3ASMA 3AV9A 2FBXA 2QWQA 2UYTA 2IVPA 5E84A 4PY5A 4FWSA 3LDSA 1NKBA 3VGKA 1RBTA 3U9ZA 3OYAA 2YX6A 5BPNA 3DWLA 4BGAA 3QIOA 4CGIA 1SZ2A 1JL1A 3MEEA 2F7TA 1K73O 3LANA 3TAQA 4M3YA 4LSNA 4MO5A 3RR7A 3U9DA 5ELZA 3ZSZA 4BDZA 1YTAA 5M1KA 3IAYA 5J2MA 1NK6A 4A2BA 4FJIA 4IFVA 1XC3A 3WXMB 3OYIA 3NFAA 3QIPA 3CC2N 3VA0A 3OBYA 1TAQA 4WQ4C 4CJ7A 1QQOA 1NJYA 4YFUA 3UKUA 2E2QA 1L3SA 2ETJA 3A5NC 4H0YB 1TK0A 3EN9A 5JVHL 1YF5L 1CZ9A 4CK1A 3V9WA 1WSIA 2ASPA 5M1FA 2YNHA 4DF8A 2WONA 1C0TA 1S1WA 4IEEA 2PY5A 3LM2A 3O80A 4OGCA 3CFPA 4CJQA 1YT3A 3S3NA 2NRWA 2X74A 5CZ2A 1DLOA 4DLGA 4DR5K 1Q18A 3CFOA 3PUFA 4FWRA 1ASVA 4DV0K 4YNQA 5AQLA 1JXBA 4FWLA 4B9UA 3DYAA 1BG3A 2D0BA 1XUPO 1WBBA 4CZJA 2G8HA 4YDUA 2A42A 3QB0A 4CGGA 4DF4A 1FW6A 2E2OA 1VQPN 1OH6A 1LW0A 2OCEA 3EE8A 3TTCA 3V1OA 2DY4A 2GUIA 1IH7A 4FM1A 3NGIA 1T05A 4W5QA 4M42A 1C0FA 2ZE2A 3VQEA 4CJEA 4EZ6A 1ZBSA 1G15A 5AQOA 1VQ6N 3IFRA 3J7ZO 1S22A 4CD3A 3V9SA 4DV5K 4AHSA 3K2PA 5DM6L 1BIZA 4IKFA 5AZJA 1QSYA 2VG7A 1N5YA 2OPSA 5IT9O 4JKDA 2BDPA 3AO2A 4FPAA 3QNNA 4OKEA 2FSJA 1SL1A 1NK9A 1QVGM 2IC3A 4IZ9A 1CZBA 3SMSA 3SQ1A 2W41A 3WXIA 2P5OA 4GV9A 4KREA 3C65A 4JI5K 2YJFA 2BGGA 3LALA 1I3AA 3CJ1A 3CF5L 3VGMA 3RSEA 2Q36A 4BRGA 3E01A 4MQ3A 2UXCK 4XH1A 4PHTX 1Z6RA 1WLJA 3QFPA 1N6QA 3NF9A 4CEEA 1K9MO 1W2BM 3UE5A 4IJAA 1VQMN 1RILA 4JEPA 4DSKA 1SKSA 1KVAA 1ZBUA 5M1QA 3WNGA 5AQZA 4WQ5C 1TL3A 4K43A 3EZWA 3SAFA 3VMFB 3THXB 3MWPA 3GBTA 2EWSA 3VEVA 3BY5A 2KQ2A 1D4XA 3QESA 4FJLA 2UXBK 4IO8A 1VSJA 1RNHA 4OPHA 3O4WA 2KTQA 4DV4K 1W97L 1C0UA 5KPTA 3V6DA 1HRHA 5AFUA 3CCLN 1EETA 4BG8A 4W5RA 1HX1A 4FLWA 2G8FA 4QS9A 1EKEA 3K9KA 5SWMA 3WXLA 4J2DA 2HVIA 1GLLO 3AVIA 2YKMA 3TU5A 4B3RK 3N4PA 3OYLA 1XHZA 4O55A 4CEQA 3Q7CA 1BOTO 1D9FA 3RRHA 3MK6A 4KHSA 1NGEA 4CFBA 4DLEA 3FGUA 3ZX0A 3KLHA 2WC9A 3CXCM 4DSLA 4H0OA 4DQPA 3ZX3A 5CYQA 4YY3K 3C6UA 1S72N 3THYB 4WE1A 3L2VA 3L2UA 3GDQA 1Z26A 1VQON 4LY7A 2OPQA 4RWTA 5AQIA 2HSTA 4AHUA 4CJFA 4GNIA 3BGRA 3ZX2A 2ZD1A 4H5RA 3U3GA 4OPJA 3B6PA 4BE2A 5SZTA 4ILHA 4DR7K 4BREA 1VQKN 3K5MA 1BQMA 5J2QA 4BR4A 2QKBA 2NRZA 1VHXA 3BF1A 3H1VX 3PY8A 4FJXA 3O9UA 3DOKA 3KK7A 3O8MA 3TSUA 1JCFA 2HBLA 1VK0A 4J8FA 5GIOA 3RMAA 1RBUA 3KK1A 1BO5O 2NLXA 3SJHA 3EY1A 4M45A 3S3MA 3SAGA 3SV3A 1MWMA 4CFAA 1IG8A 4IEIA 4WFAL 2I7PA 2WUSA 3W0LA 1RDUA 3DLRA 4NYFA 5GAHP 4FJ5A 2FF6A 1X9MA 4GKJK 3ULEB 1LWCA 3KWGA 3CCEN 1VSIA 1WN7A 1NGBA 4DV2K 4BQZA 4MLHA 2Q31A 5HRSA 3LDLA 5JVGL 4FOIA 2A5XA 5KQ8A 1K6YA 1IO2A 1EO1A 1RBVA 4DWIA 4ILGB 1NMDA 4CFDA 4DUZK 1KD1O 4V19S 3SUQA 3CCQN 4CIEA 2D0OA 3FZFA 1S1VA 3VETA 4LFBK 1RT4A 4JD2A 1DEJA 3FFKB 3HTVA 4OKJA 4KB1A 4PL7A 1RTJA 1NJXA 3L8BA 3ENHA 3IKMA 1FXXA 4FLTA 4O4GA 4IFEA 3J7AP 1EWQA 5EVZA 1U2VB 3PSFA 3HO1A 2OTJN 3V4IA 4M3RA 1X3MA 4CHNA 4YOTA 1NJIO 2YNIA 4MDAA 4L8RB 4Z0UA 2V7YA 1RDDA 1XHXA 4CF9A 3OY9A 3SQ4A 4FW2A 4GMJB 1LV5A 3QFUA 2E2NA 4B9NA 4AM7A 2D1KA 1TKZA 5KQDA 4JI0K 4I7FA 5JLHA 2YHYA 4AF1A 4LD0A 4CJKA 3CCUN 2FBYA 2HNZA 2P9PB 1A5WA 3HT3A 3EE9A 2WFBA 1Q81O 1RGIA 3L4QA 3HOTA 3VOVA 4MDBA 1KSPA 1QQCA 4JI3K 3AVLA 1P8ZA 3EKUA 4BRKA 3THXA 3AVNA 4PWDA 4ISGA 4F8RA 2GV9A 1ATNA 3FR0A 3WUHA 3SQ2A 4O8UA 1MU2A 2FF3B 5BPMA 4FXDA 1VQLN 4B3SK 3AVFA 5AZJB 4IG3A 2HHHK 3QEWA 2QTDA 2A6AA 3H46O 1FKPA 1LOTB 3DXKB 1JLGA 4BR7A 4DQSA 4W5OA 2HHWA 4WF9L 5C10A 4CFCA 4F9OA 2YCHA 1OH8A 2E1ZA 4ELVA 4LSLA 2G8UA 1HJOA 4CJ3A 5HRRA 3V9UA 2CGKA 2HHTA 1MA9B 5BRDA 3KLGA 1NGIA 4Y1CA 1N8RO 3MEDA 3IDHA 2YJEA 2WTUA 4BE0A 1IKVA 1SQKA 3QDKA 5CE3A 4CF1A 3BEXA 4CZKA 3U3YA 4BDPA 2O4IA 1XWLA 1NKCA 4CCHA 4CK2A 1RT3A 4H4OA 2OZSA 1BWFO 4FWOA 3C6AA 5C15A 1BI4B 1M1KO 3O3FA 1GOCA 3KLFA 4YOYA 4FJ8A 4B9QA 4PQUA 3I0RA 3E66A 2F4VK 4FJKA 2GTDA 2QWPA 3ZT3A 3ENBA 3DLEA 1ASWA 2QWOA 3KKRA 4IOXA 4CF2A 4BROA 2D5RA 4BC5A 4Y1DA 1BA1A 4A62A 5GAGP 4PUOA 4H5WA 3VF4A 5C2FA 1RBSA 3Q7BA 3J80O 3MX2A 2DFEA 5ADXA 3J81O 3SI6A 4IDKA 4F4KA 1Z25A 4RW4A 4CGDA 2YV0X 4CJ5A 4DFMA 1J6ZA 3VQCA 1LCUA 2E6MA 4AHRA 1WUAA 4O5BA 2CH5A 4IFYA 4BVPA 4CHZA 3NF7A 3P31A 3JAMO 4DTSA 4I9LA 3WEEA 4CW7B 1HLUA 2HOEA 4IJNA 2X78A 4K8XA 3ZETB 1HNZK 1LAVA 3LPUA 3PX0A 2GELA 4ZHRA 2DPNA 4OKKA 2UUCK 4DR4K 4DU3A 4CE9A 1IV0A 4DQRA 5K14A 5AQJA 3LZIA 3CQYA 2O8FB 4FCYA 5BPLA 4DTNA 2Z1GA 1SL2A 1T7PA 2KHOA 2PYJA 5AJ3K 1RT7A 1WAFA 5DMRA 1DTTA 4CJSA 1Q9XA 5AQMA 1Z05A 3OYJA 2VG5A 2EHGA 2FLOA 4DQ8A 3KK3A 4JAXA 4FJ9A 4XH4A 1E4GT 1S9GA 4OLAA 1QTMA 2A1SA 1U6ZA 4KAZA 3RVCA 1BISA 2IS3A 4JI6K 3M8RA 3OA9A 3SYZA 4NXMK 5DK5A 5LMUK 1S6PA 3VQ7A 1VSFA 1VSDA 3CCVN 2GEMA 4E89A 1C0MA 5DM7L 2Q2RA 3U8XA 4LH5A 2QI2A 3OYFA 4Q5VA 2Z1HA 4B3MK 5F2RA 3KK2A 2P9KA 5FDLA 1WSGA 4C8LA 3HSTB 3QETA 2HHSA 4KFBA 4EHUA 1NWKA 1T03A 1Y64A 4CIGA 4NCGA 3AA2A 3TAPA 2ZF5O 3H45C 3OS1A 4FM2A 4NXNK 2ZGYA 2WBNA 3E9OA 4C1NI 3VEYA 4CJLA 3ZSQA 1BGXT 1MWKA 3UKUB 3B6OA 1NOYA 3ZSVA 1SV5A 4ILJA 2NRXA 3NBPA 3K57A 3NGZA 5LJWA 4UY8O 4O0IA 4IDHA 2RF2A 4CEAA 1IBMK 4QAGA 4CZIA 2D0PA 4KHWA 5ADXH 4B8AB 3NGYA 4BRDA 4C8NA 3KD5E 4BRAA 3MECA 3VEWA 4AHTA 3DJCA 4DTJA 3D7EO 4GVEA 4AQYK 2A1RA 3T19A 3NH2A 4CEOA 3H3OB 3ID6A 5AQYA 3CC7N 1LWFA 4KO0A 4KHNA 4JI7K 1NOZA 4KBOA 3AVCA 4EFHA 3DXMA 4DTMA 2ITGA 1KCFA 4CK3A 1RFQA 1XI1A 1IBLK 5M1NA 3CCMN 2KFZA 3OVNA 1N34K 4FYDA 1H1VA 1HYZA 2O4GA 3VQQA 4M3TA 4JHDB 3FFIA 3HXMA 5JS2A 4GV6A 3I33A 4BC3A 2FXUA 4DQIA 2P9SB 1CXUA 5M1OA 3MN6A 1NMNA 1YJWN 2CGLA 3KHYA 3UKRA 4N47A 4EIAA 3CYMA 3TTDA 2ITMA 2HHVA 1TVRA 4CBUA 2HMPA 4FJ7A 3HM8A 5AQFA 5FLXO 4BRNA 1SKWA 3DRPA 3AO1A 4B3OA 5GIPA 2FBVA 2V7ZA 2XY5A 4DR3K 3RSEB 3VTIA 4B1UB 3OYBA 3G25A 4BWJA 4ZTJA 4FOEA 3TAGA 3C6TA 1NGJA 2G8WA 3T1AA 2NRHA 4JI1K 1JLCA 3E9PA 2HMIA 3O1BA 1O13A 3OYHA 4DCHA 1EQYA 2D0CA 3W3DA 1A5XA 2X6NA 3DLHA 4DTXA 1E3MA 5I3UA 4JI2K 5C2DA 2FC0A 3L3VA 4CF0A 3A5LC 3K0SA 3LAMA 1U2VA 3QO9A 4K8ZA 3MXMA 4H5NA 4Z4IA 3I8BA 4JK9A 1NK5A 4CBXA 3ALYA 4E19A 2DFHA 4E7LA 2XHBA 3CQ8A 3OS0A 1XMOK 4YORA 3U6FA 5J2NA 3ZSRA 3ISNC 3VESA 3K5LA 2G8IA 2XY8A 3OYDA 4HHTA 3CFRA 4CIFA 3CC4N 3TARA 4K41A 5EX5A 5GAEP 1NGHA 2G8VA 1L5UA 2OPRA 1ZBHA 4C23A 3GOIA 1NNEA 4BVOA 3L2QA 3HYFA 3WT0A 1NK4A 4HUEA 4YDUC 5FPMA 2E1YA 1YJNN 4ZTFA 2QK9A 3KTQA 1BU6O 4H03B 4Z4GA 1ATRA 2O8DA 3LWLA 4PKGA 4XIUA 1DTQA 1VSEA 3VEOA 4KI6A 2PAVA 4DG1A 4ID5A 3CCSN 1ZXOA 4H8KA 3L0QA 2W40A 3O1WA 1R0AA 1Y97A 5HL7L 4HTLA 4B1ZA 1S3XA 5HRNA 4M3XA 1C1CA 3RMCA 2NZTA 4DKWA 4KHUA 4DR6K 3AVBA 2JGUA 4JKAA 4R5PA 1RDCA 4ISEA 1KAXA 4BR5A 5FRMA 3PV8A 3NE6A 1B9FA 3OYCA 1HMVA 3KJVA 2UXDK 1JLFA 1YXQA 4CBWA 3CJ9A 4DSIA 3V1QA 4A5AA 1LAWA 1T6CA 1TAUA 4DSJA 1X1PA 4U7BA 1BQNA 1EX4A 1W9HA 5GADP 1BCOA 3CJAA 2NNWA 1NGCA 4HUGA 4B1VA 4BR0A 4HVJA 4B9VA 1QE1A 3CIPA 2BTFA 4A57A 4BDYA 4KI4A 4JNEA 4MO4A 2I7NA 5F1XA 5LMNK 2RE2A 3PLAA 1SUQA 2A41A 3H3NO 4M3WA 2Z1IA 3GL1A 1GLDG 4CJUA 2BANA 3ZT1A 1HPMA 1JLEA 3ATVA 1BA0A 1VRUA 4PL8A 3IMXA 1W0HA 1YHQN 5AFUH 4BRCA 1E4FT 4JKGB 3CM6A 1HKGA 5EOYA 1HPZA 3LAKA 3EEQA 2R7YA 4PA1A 4WCEL 1YTUA 3LL3A 2O8DB 3CCJN 3WEEB 5AQNA 2P1JA 2P9IB 2JWKA 2UUAK 4K0KK 3OYKA 3BZKA 2P9UB 3ZETA 3THWB 5C24A 3O6WA 1LW2A 3MMVA 4NB4A 5LL6Z 1KFDA 3SUNA 4GVMA 3VN5A 1KXPA 1NM1A 4EZ9A 4FLUA 3BDPA 2FSKA 1S5JA 4KHQA 3ZEUB 3CERA 3JYTA 3RMBA 1VQ4N 2VGNA 4CZEA 1K8KB 4B9MA 1GLBG 3VF6A 1GLEG 2RHKA 2VCPA 1GOAA 3CG7A 3L6QA 4F2SA 4DSFA 5HROA 2QM1A 5GINA 2VQEK 1LWEA 2E20A 3VEXA 4BWMA 5BRFA 3A0IX 3D6RA 2VYPA 4HWIA 5LJVA 3FLCO 3PX6A 1QZ6A 3HSCA 1SAZA 3NHGA 4WQ5A 3LPTA 1TL1A 3O4QA 2ZJRL 4IOCL 1GLJO 3R6MA 2QA4N 4I9QA 1VQ8N 1VRTA 5LY3A 3BP8A 3O5BA 5JS1A 1YVUA 2P9SA 4RTFD 2HW3A 4K42A 3K5OA 3M3ZA 4QCLA 1C1BA 1O1WA 3BF3A 4KTQA 3DXKA 3I0SA 1HNWK 4DSEA 3ATUA 4PKIA 4IO9L 4C1NK 5I42A 3AY9A 3LP1A 4E0DA 2AJQA 4CHQA 3A2FA 1FKOA 4CGJA 1XNQK 4JLHA 4OVLA 1JLBA 3EL2A 4FLVA 2E8AA 4BG9A 5AQWA 4KH5A 4DTUA 3WNEA 4BRPA 2P9LB 1TKXA 3FZKA 5KRTA 3QERA 4CZMA 3PO4A 3PSIA 4CEZA 2XRIA 3F9KA 4FWQA 2I5JA 3OYGA 4JN4A 2AA4A 2H3GX 3PX4A 4HCBA 3CJBA 1HYVA 3E9LA 1RDBA 4AILC 2GBZA 3J7YP 1T44A 1WSFA 4FLYA 1X9SA 3AVMA 4NLCA 3NAEA 2QW9A 1CXQA 4RW7A 4DS5A 4NCBA 5A2QO 3TANA 2HB5A 2Q97A 3S3OA 2IIRA 4CI6A 1M90O 1WNSA 4DHYA 3R3LA 1NG9A 2JLEA 2E4LA 3HRGA 1VQ7N 4ELTA 1TGOA 1OH7A 4DTRA 1JLAA 3VQDA 3VTHA 1RCHA 5J2PA 4A5BA 4H0PA 2A40A 4LF8K 3BUZB 1X9JA 3UIQA 1KAZA 1IJJA 4BC2A 3MCAB 5HOOA 2F96A 4GY2B 4CVNE 5AQQA 3P83D 3AO3A 3IS9A 3AVAA 4LFCK 4MFBA 4CZHA 1I39A 3HBTA 3CPWM 3HZ6A 3VQ4A 1WSHA 3EO3A 2UU9K 4WFBL 4CJPA 5KPRA 5IWAK 1TYQB 1YAGA 4EHTA 4PKHA 1XNRK 5BN9A 3A8YA 3CHWA 3R1XA 4XEIA 3TSPA 4B1YB 2HVHA 3KLEA 4Z94A 5BN8A 2HHQA 3PO5A 1WB9A 4CHOA 5E41A 1N32K 3AO5A 1D9DA 4CECA 3KVGA 1RT1A 3ZCMA 1B9DA 2F9WA 2W42A 4BACA 1QHTA 3DLKA 1HUXA 3AA3A 1Q86O 5C0YA 2P9NB 3C94A 3DRRA 1SL0A 3C7NA 4JKHA 5AQUA 3C0BA 4A59A 1JXEA 2Q3SA 4JI4K 3H08A 2IVNA 3VQAA 3AAQA 4KTZA 1NJWA 4LF5K 4KKOA 4E1MA 4X64K 2P9KB 2O8EB 4CJWA 2A3ZA 1QQMA 1KVBA 3EYZA 3ZSXA 2JWLA 5CYMA 4Z4CA 3I56N 1WOQA 4B3TK 4BR9A 1KTQA 4RCHA 4N56A 2IVOA 1BCMA 5KGWA 4ISFA 1VQ9N 3MXIA 1K8AO 4CJ4A 3AVGA 3CQXA 3IUCA 3SPYA 2YHWA 4JK7A 2LSNA 3V9XA 3OYNA 1S1UA 4FW1A 2RPIA 3DAWA 3ITHA 1S6QA 3GE1A 3ZSWA 3DLBA 1ZBLA 3M8QA 4FWMA 4AM6A 4JS5A 3K5NA 3I8DA 4N41A 1XMQK 3ULEA 4JKBA 3HPOA 1ZYQA 2Q1NA 3HVRA 2HF4A 5CR4A 4JI8K 3KZBA 3K9JA 3TAFA 4LF7K 3BZCA 3MWTA 2Q0RA 5AQHA 4JYAK 1T8EA 4F2RA 4M3UA 2OTLN 2DTUA 3DM2A 5H1SQ 4JKFA 3HK2A 3MX5A 1NK7A 2CH6A 3ZLJA 2P9UA 3THWA 1JCGA 3O9QA 5BRHA 2E5LK 1HQUA 1JL2A 3CJCA 3WQUA 3H6EA 3NH0A 3KD1E 2P9IA 1HKBA 4CEDA 1RDAA 1VSLA 2IAJA 4X62K 2KZMA 4I6MB 1MDUB 1C6VA 4DMNA 4KRFA 1VQ5N 4CGHA 4FK4A 2ASOA 4YOUA 3LZJA 3V1RA 1NK8A 5AQPA 3OS2A 2VWJA 3WNFA 1D5AA 4HCCA 4FWNA 3DXMB 3PIPL 2HNDA 4DFPA 5D3GA 5AZIA 5AQTA 2OA8A 1IKWA 4E7HA 3SLCA 4MLEA 2O8FA 1U04A 4X65K 1G99A 1TUYA 3HVTA 4CJVA 2IGIA 4DFKA 3M8SA 4JD2B 3VQ5A 3T3FA 4KHPK 2ZWHA 2O8EA 4OLBA 3DI6A 4FL9A 3RMDA 3IG1A 4FWKA 1VAZA 3HP9A 1U49A 3M8PA 3SMPA 5KI6A 4LF6K 5CZ1A 1ASUA 1J9AA 5C42A 4BRQA 1NK0A 3SCXA 1RBRA 3ZT0A 2BE2A 1HJRA 4ICLA 4M41A 2Y1JA 2YNGA 1QZ5A 3AGKA 3MAQA 4B9TA 5HLFA 2O8CA 2ATQA 3C6HA 2QWNA 3U4LA 4AH9A 1NJZA 1QQNA 1XC9A 4UQGA 2QXLA 4H0TB 4DU1A 3MN7A 5M1PA 5FPDA 5AZIB 3OJSA 4DV3K 3TTFA 4FWPA 4WYBA 3M1FA 5HBMA 4GW6A 1VQNN 4N76A 3GG4A 3RWUA 4LF4K 1X9WA 2QEXN 4JV5K 1YITN 2HHUA 4G1QA 2XY7A 2D4WA 2NRVA 1IBKK 2GWKA
chains in the Genus database with same CATH topology
1BQNA 1EX4A 1W9HA 3LP0A 4AHCA 1MU2A 2DFFA 1BCOA 3AVJA 4FXDA 4HUGA 3AVFA 4IG3A 4HVJA 3QEWA 4B9VA 1QE1A 3L2WA 1FKPA 3QEPA 3ULDA 3AVKA 4FJGA 2Z1JA 4BDYA 4KI4A 4DTOA 2HHXA 4B9LA 3O3GA 3NDKA 1JLGA 3V9ZA 4DQSA 4W5OA 4AHVA 1S1XA 2HHWA 4CFCA 4HTUA 1BHLA 4ELVA 3HJFA 2NUBA 2RN2A 3DRSA 1SUQA 4LSLA 4C8MA 4HUFA 1IG9A 1TK5A 3AVHA 2G8UA 4FJMA 4CJ3A 5HRRA 3V9UA 2HHTA 4KPYA 3QEVA 2Y1IA 2YHAA 2Z1IA 4M3WA 3KLGA 4KV8A 4FJHA 4Y1CA 4CJUA 1ZBFA 4Q0BA 1UA0A 1Q9YA 2BANA 3ZT1A 3MEDA 4BE0A 1L3VA 1IKVA 1JLEA 3NF8A 4CF1A 2D0AA 3MXJA 4LH4A 1UAXA 1VRUA 3F73A 3TAMA 3U3YA 4E3SA 4BDPA 4NCAA 3C95A 1XWLA 2O4IA 1GOBA 1NKCA 4CCHA 1W0HA 4CK2A 3SZ2A 4EP5A 1RT3A 3D45A 4H4OA 2OZSA 4Z4FA 3ASMA 3AO4A 3AV9A 3CM6A 2FBXA 4FM0A 1BI4B 1HPZA 3LAKA 3O3FA 2PYLA 1GOCA 3QLHA 3KLFA 2R7YA 4FLXA 4PA1A 4PY5A 3LDSA 1YTUA 4FJ8A 1REVA 4IG0A 1NKBA 1RBTA 3I0RA 4PQUA 3OYAA 4FJKA 2P1JA 3OYKA 3DOLA 3ZT3A 5C24A 3DLEA 3QIOA 1LW2A 1ASWA 4CGIA 1JL1A 3KKRA 4I2PA 3AA5X 3MEEA 4CF2A 1KFDA 4EP4A 3LANA 2D5RA 1S1TA 5EU7A 4GVMA 4Y1DA 3SUNA 4LSNA 3TAQA 1L3TA 3RR7A 4M3YA 4PUOA 3ZSZA 3VN5A 1NKEA 4BDZA 1YTAA 1VSHA 1RBSA 4Z4HA 3IAYA 4FLUA 3QINA 4EZ9A 5J2MA 1RTIA 1NK6A 3BDPA 4FJIA 4IFVA 2DFEA 1S5JA 4KHQA 3OYIA 3NFAA 3QIPA 4FLZA 3D0PA 3JSMA 3VA0A 3SI6A 4IDKA 3TABA 3SNNA 3JYTA 3RMBA 1TAQA 4B9SA 4FVMA 3VQBA 4F4KA 1Z25A 1U45A 4RW4A 4CGDA 4OGEA 4YFUA 1NJYA 1L3SA 2ETJA 1TK0A 4B9MA 2YV0X 4CJ5A 3KIOA 4DFMA 3HPGA 3VQCA 1CZ9A 2E6MA 4AHRA 4JRQA 4CK1A 3V9WA 1WSIA 1GOAA 3CG7A 4O5BA 4F2SA 4IFYA 2YNHA 3V81A 4DSFA 2P51A 5HROA 4DF8A 4CHZA 2WONA 3NF7A 1C0TA 1S1WA 4C8KA 2PY5A 1LWEA 4DTSA 4OGCA 3CFPA 4BWMA 4DQQA 2YKNA 1YT3A 4CJQA 4I9LA 3S3NA 2X74A 5CZ2A 1DLOA 1JLQA 4DLGA 4ELUA 3PX6A 2X78A 3CFOA 3PUFA 1J5OA 4K8XA 3LWMA 5FRNA 3NHGA 1LAVA 3LPUA 3LPTA 1ASVA 1TL1A 3O4QA 3PX0A 4ZHRA 4YNQA 4OKKA 1JXBA 4B9UA 3DYAA 2D0BA 4DU3A 4I9QA 1VRTA 2IOCA 4CE9A 4DQRA 5K14A 4ID1A 2G8HA 5JS1A 4E1NA 1YVUA 4CGGA 5HRPA 3LZIA 4DF4A 4FCYA 4DTNA 1IKXA 2HW3A 2Z1GA 1LW0A 3ZT2A 2RKIA 3K5OA 3V1OA 1SL2A 3OJUA 4QCLA 2GUIA 2DY4A 1C1BA 1T7PA 1HQEA 1O1WA 1IH7A 4FM1A 2PYJA 4KTQA 2QKKA 3NGIA 1RT7A 1WAFA 3I0SA 5DMRA 1T05A 1DTTA 4CJSA 1UOCA 4W5QA 4DSEA 4M42A 2ZE2A 1Q9XA 3VQEA 4CJEA 3DLGA 1QS4A 3LP1A 3OYJA 5I42A 4CHQA 4E0DA 1RT6A 3A2FA 2VG5A 1FKOA 4CGJA 4EZ6A 1G15A 2EHGA 1WAJA 3ZSOA 4JS4A 1Q8IA 4JLHA 3KK3A 4OVLA 4FJ9A 3HP6A 1S9GA 4OLAA 3V9SA 1JLBA 4AHSA 4FLVA 1QTMA 3K2PA 1BIZA 1KLMA 2A1SA 4KAZA 4IKFA 1BISA 2HNYA 1QSYA 1BIUA 2IS3A 2VG7A 1N5YA 3M8RA 3AA4A 4DTUA 3SYZA 3WNEA 2OPSA 2B4JA 4M3ZA 2KW4A 1TKXA 4B8CA 1HNIA 5DK5A 5KRTA 1S6PA 3VQ7A 1VSFA 3QERA 1KRPA 2BDPA 1VSDA 3PO4A 3AO2A 4CEZA 2OYQA 3QNNA 2XRIA 4E89A 1C0MA 4RW6A 1HYSA 3F9KA 4OKEA 2I5JA 3TR8A 3OYGA 3PX4A 4LH5A 4CGFA 1SL1A 1NK9A 4HCBA 2FBTA 1HYVA 1RDBA 2IC3A 3OYFA 4AILC 4Q5VA 1CZBA 1QSLA 2Z1HA 2KZMA 4CJRA 1U47A 2G8KA 3LP3A 2GBZA 2VG6A 3SQ1A 1WSFA 4FLYA 3KK2A 1X9SA 5FDLA 4NYNA 3AVMA 1WSGA 3NAEA 4FK2A 4C8LA 1CXQA 3HSTB 4RW7A 4DS5A 3QETA 2HHSA 4KFBA 2P5OA 4FZXC 4NCBA 4KREA 2BGGA 3TANA 3LALA 1T03A 2HB5A 1I3AA 4CIGA 3SUOA 4NCGA 3AA2A 1EXQA 3TAPA 3S3OA 3P5JA 3OS1A 4FM2A 1IKYA 1WNSA 4CESA 1WSJA 2JLEA 2E4LA 2XY6A 3E01A 4MQ3A 4ELTA 4KB0A 1TGOA 2KZZA 3DMJA 1WLJA 4DTRA 1JLAA 3VQDA 3NF9A 3ZSQA 4CEEA 1BGXT 1RCHA 4CJLA 5J2PA 1N6QA 3RRGA 1RTHA 3VA3A 3SJJA 1RILA 2P5GA 1RT2A 3B6OA 4DSKA 1SKSA 1KVAA 1NOYA 1ZBUA 3UIQA 3ZSVA 1BI4A 3WNGA 3K58A 2F96A 1SV5A 3IRXA 3P83D 3NBPA 3AO3A 3IS9A 3K57A 4O44A 3AVAA 3NGZA 1TL3A 4MFBA 1I39A 3WNHA 4O0IA 4E7KA 2RF2A 3VQ4A 4CEAA 1WSHA 4QAGA 4RG8A 4FZYA 4CJPA 2KQ2A 1A5VA 4KHWA 4B8AB 3NGYA 3NH1A 3QESA 4FJLA 1CLQA 4W5NA 1VSJA 1HNVA 1RNHA 2HVHA 4C8NA 4RW8A 3KD5E 3KLEA 3MECA 4AHTA 2KTQA 4DTJA 3OYMA 3SPZA 2HHQA 3PO5A 1C0UA 4CHOA 3V6DA 3NF6A 1HRHA 5E41A 4CF8A 4KHYA 1TKTA 3AO5A 2A1RA 1D9DA 3T19A 1EETA 4CECA 3NH2A 4CEOA 4OPKA 4W5RA 1RT1A 3ZCMA 1B9DA 2W42A 4BACA 1QHTA 3DLKA 4FLWA 2G8FA 2PZSA 1UWBA 1EKEA 5SWMA 3KLIA 1LWFA 4OJRA 4J2DA 3AA3A 2HVIA 3AVIA 4KO0A 2YKMA 4KHNA 3SQ0A 3OYLA 1XHZA 1NOZA 4O55A 3AVCA 3C94A 2IDOA 3DRRA 4CEQA 4H4MA 5T7BA 1SL0A 4DTMA 2ITGA 1JXEA 1D9FA 1KCFA 2Q3SA 3RRHA 4CK3A 4KHSA 1S9EA 3H08A 1XI1A 4CFBA 3VQAA 4DLEA 1SKRA 2KFZA 1TV6A 4KTZA 3KLHA 3OVNA 1NJWA 4KKOA 3VQ6A 1JKHA 4E1MA 4DQPA 2XO7A 4DSLA 3RTVA 3VQ9A 4FYDA 5CYQA 3C6UA 4CJWA 3VQ8A 1HYZA 2O4GA 3VQQA 4WE1A 3L2VA 1C1AA 3L2UA 4M3TA 5KGXA 1Z26A 3FFIA 3HPHA 4LY7A 1RT5A 2OPQA 1KVBA 5JS2A 5J1EA 3HXMA 3EYZA 3ZSXA 4BE1A 4AHUA 4CJFA 5CYMA 4Z4CA 2OPPA 1J53A 3OYEA 3BGRA 4DQIA 1CXUA 1KTQA 4TSXA 4N56A 2ZD1A 3U3GA 1BCMA 4F3OA 1U48A 4DS4A 5KGWA 4OPJA 4KTWA 4N47A 3B6PA 3CYMA 5SZTA 4BE2A 3QEIA 3MXIA 1KLNA 3TI0A 4W5TA 4CJ4A 3AVGA 2HHVA 1TVRA 3SPYA 3K5MA 1BQMA 5J2QA 2QKBA 4FJ7A 2KFNA 3EZ5A 3MEGA 4IBNA 3G10A 1SKWA 2LSNA 1B92A 3DRPA 3V9XA 3AO1A 3OYNA 1S1UA 4FW1A 3PY8A 4B3OA 2FBVA 4FJXA 2RPIA 2XY5A 1U4BA 2QXFA 3DOKA 3ITHA 3ZSYA 3OYBA 4BWJA 4ZTJA 1S6QA 4QOZB 3ZSWA 3TAGA 3C6TA 5HP1A 3DLBA 2G8WA 1ZBLA 4J2BA 3M8QA 5KTQA 1VK0A 3RMAA 3T1AA 1RBUA 3KK1A 4JS5A 2VWKA 3I8DA 3K5NA 3EY1A 1JLCA 4N41A 4M45A 4DTPA 5CY4A 1KFSA 2HMIA 3S3MA 2OZMA 3SV3A 1FK9A 3HPOA 1ZYQA 3G0ZA 4CFAA 3HVRA 3OYHA 3O4NA 2D0CA 3TAFA 1A5XA 2X6NA 5C25A 3DLHA 3SV4A 4DTXA 3RR8A 5I3UA 1T8EA 2B6AA 3DLRA 4NYFA 4F2RA 4C8OA 4FJ5A 4M3UA 2DTUA 3DM2A 2FC0A 3L3VA 4CF0A 3HK2A 4CERA 3LAMA 3QO9A 1X9MA 1NK7A 4K8ZA 4CHYA 3MXMA 4Z4IA 1NK5A 1LWCA 4J2AA 4RW9A 3O3HA 4E19A 3ALYA 3LP2A 2DFHA 4E7LA 1VSIA 1WN7A 2XHBA 4JRPA 3CQ8A 3OS0A 3U6FA 1HQUA 1JL2A 5J2NA 3SUPA 1QSSA 5HRSA 3ZSRA 3NH0A 1EP4A 3KD1E 4CEDA 2E6LA 1K6YA 1IO2A 1RDAA 1RBVA 1VSLA 2IAJA 1VSMA 3ISNC 3K5LA 4DWIA 2G8IA 2XY8A 4CHPA 4CFDA 3OYDA 3CFRA 4CIFA 4HHTA 3TARA 3THVA 1D8YA 4FK0A 2AJQA 1C6VA 4DMNA 4KRFA 3HL8A 2G8VA 3L2RA 3SUQA 1L5UA 4CGHA 1RTDA 2OPRA 4FK4A 3QNOA 1ZBHA 4CIEA 1KVCA 3LZJA 1S1VA 2WOMA 3V1RA 1RT4A 1NK8A 4E7IA 3OS2A 3L2QA 3HYFA 2VWJA 1NK4A 3WNFA 1D5AA 2F8TA 4HUEA 4OKJA 3ZT4A 4KB1A 4HCCA 3TWHA 2B5JA 1BL3A 2HNDA 4DFPA 1RTJA 1NJXA 4ZTFA 5D3GA 4Z4EA 3L8BA 2OA8A 2QK9A 3KTQA 1IKWA 4E7HA 4Z4GA 3LWLA 1U04A 1DTQA 1VSEA 4XIUA 1FXXA 3HVTA 4CJVA 4FLTA 4O4GA 2IGIA 2YNFA 1TKDA 4DFKA 3M8SA 3CM5A 3NCIA 3TAEA 3VQ5A 3VQPA 3T3FA 4KI6A 3HO1A 3V4IA 4E7JA 4OLBA 3DI6A 4M3RA 4DG1A 4CHNA 2YHBA 2F8SA 4ID5A 4CEBA 5FROA 4H8KA 3RMDA 2YNIA 3IG1A 4L8RB 4O0JA 3HP9A 4Z0UA 1R0AA 3M8PA 1U49A 1RDDA 1XHXA 1Y97A 4I2QA 5KI6A 5CZ1A 1ASUA 1J9AA 5C42A 4CF9A 4M3XA 5HRNA 3OY9A 1NK0A 1TK8A 4CEFA 3SCXA 1L3UA 4FJJA 1RBRA 3ZT0A 3SQ4A 1C1CA 4DU4A 2BE2A 4FW2A 1F21A 4GMJB 1HJRA 3RMCA 5KRSA 1LV5A 4ICLA 4KHUA 4B9NA 4M41A 3AVBA 2JGUA 2Y1JA 4J2EA 2YNGA 4R5PA 1J54A 1RDCA 3HM9A 3MAQA 4B9TA 1TKZA 5HLFA 2ATQA 5FRMA 3PV8A 4AH9A 4I7FA 3S9HA 1NJZA 3NE6A 1XC9A 4B08A 3KKSA 4FJNA 1B9FA 2ZQBA 3OYCA 4LD0A 4UQGA 4CJKA 1VSKA 2FBYA 1HMVA 2HNZA 3KJVA 1JLFA 1WSEA 4DU1A 1A5WA 3L3UA 3OJSA 3HT3A 2EX3A 4CJTA 1KSPA 1QQCA 3AVLA 3V1QA 4DSIA 3K59A 1ZBIA 5HBMA 4GW6A 1UA1A 1LAWA 4N76A 4PWDA 3AVNA 1TAUA 3QEXA 3RWUA 4F8RA 4FZZA 4F3TA 4DSJA 2GV9A 1X9WA 4DFJA 3SQ2A 4N5SA 2HHUA 4G1QA 1ITGA 2XY7A 1X1PA 3P1GA 2X6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BQN A;  1EX4 A;  1W9H A;  3LP0 A;  4AHC A;  1MU2 A;  2DFF A;  1BCO A;  3AVJ A;  4FXD A;  4HUG A;  3AVF A;  4IG3 A;  4HVJ A;  3QEW A;  4B9V A;  1QE1 A;  3L2W A;  1FKP A;  3QEP A;  3ULD A;  3AVK A;  4FJG A;  2Z1J A;  4BDY A;  4KI4 A;  4DTO A;  2HHX A;  4B9L A;  3O3G A;  3NDK A;  1JLG A;  3V9Z A;  4DQS A;  4W5O A;  4AHV A;  1S1X A;  2HHW A;  4CFC A;  4HTU A;  1BHL A;  4ELV A;  3HJF A;  2NUB A;  2RN2 A;  3DRS A;  1SUQ A;  4LSL A;  4C8M A;  4HUF A;  1IG9 A;  1TK5 A;  3AVH A;  2G8U A;  4FJM A;  4CJ3 A;  5HRR A;  3V9U A;  2HHT A;  4KPY A;  3QEV A;  2Y1I A;  2YHA A;  2Z1I A;  4M3W A;  3KLG A;  4KV8 A;  4FJH A;  4Y1C A;  4CJU A;  1ZBF A;  4Q0B A;  1UA0 A;  1Q9Y A;  2BAN A;  3ZT1 A;  3MED A;  4BE0 A;  1L3V A;  1IKV A;  1JLE A;  3NF8 A;  4CF1 A;  2D0A A;  3MXJ A;  4LH4 A;  1UAX A;  1VRU A;  3F73 A;  3TAM A;  3U3Y A;  4E3S A;  4BDP A;  4NCA A;  3C95 A;  1XWL A;  2O4I A;  1GOB A;  1NKC A;  4CCH A;  1W0H A;  4CK2 A;  3SZ2 A;  4EP5 A;  1RT3 A;  3D45 A;  4H4O A;  2OZS A;  4Z4F A;  3ASM A;  3AO4 A;  3AV9 A;  3CM6 A;  2FBX A;  4FM0 A;  1BI4 B;  1HPZ A;  3LAK A;  3O3F A;  2PYL A;  1GOC A;  3QLH A;  3KLF A;  2R7Y A;  4FLX A;  4PA1 A;  4PY5 A;  3LDS A;  1YTU A;  4FJ8 A;  1REV A;  4IG0 A;  1NKB A;  1RBT A;  3I0R A;  4PQU A;  3OYA A;  4FJK A;  2P1J A;  3OYK A;  3DOL A;  3ZT3 A;  5C24 A;  3DLE A;  3QIO A;  1LW2 A;  1ASW A;  4CGI A;  1JL1 A;  3KKR A;  4I2P A;  3AA5 X;  3MEE A;  4CF2 A;  1KFD A;  4EP4 A;  3LAN A;  2D5R A;  1S1T A;  5EU7 A;  4GVM A;  4Y1D A;  3SUN A;  4LSN A;  3TAQ A;  1L3T A;  3RR7 A;  4M3Y A;  4PUO A;  3ZSZ A;  3VN5 A;  1NKE A;  4BDZ A;  1YTA A;  1VSH A;  1RBS A;  4Z4H A;  3IAY A;  4FLU A;  3QIN A;  4EZ9 A;  5J2M A;  1RTI A;  1NK6 A;  3BDP A;  4FJI A;  4IFV A;  2DFE A;  1S5J A;  4KHQ A;  3OYI A;  3NFA A;  3QIP A;  4FLZ A;  3D0P A;  3JSM A;  3VA0 A;  3SI6 A;  4IDK A;  3TAB A;  3SNN A;  3JYT A;  3RMB A;  1TAQ A;  4B9S A;  4FVM A;  3VQB A;  4F4K A;  1Z25 A;  1U45 A;  4RW4 A;  4CGD A;  4OGE A;  4YFU A;  1NJY A;  1L3S A;  2ETJ A;  1TK0 A;  4B9M A;  2YV0 X;  4CJ5 A;  3KIO A;  4DFM A;  3HPG A;  3VQC A;  1CZ9 A;  2E6M A;  4AHR A;  4JRQ A;  4CK1 A;  3V9W A;  1WSI A;  1GOA A;  3CG7 A;  4O5B A;  4F2S A;  4IFY A;  2YNH A;  3V81 A;  4DSF A;  2P51 A;  5HRO A;  4DF8 A;  4CHZ A;  2WON A;  3NF7 A;  1C0T A;  1S1W A;  4C8K A;  2PY5 A;  1LWE A;  4DTS A;  4OGC A;  3CFP A;  4BWM A;  4DQQ A;  2YKN A;  1YT3 A;  4CJQ A;  4I9L A;  3S3N A;  2X74 A;  5CZ2 A;  1DLO A;  1JLQ A;  4DLG A;  4ELU A;  3PX6 A;  2X78 A;  3CFO A;  3PUF A;  1J5O A;  4K8X A;  3LWM A;  5FRN A;  3NHG A;  1LAV A;  3LPU A;  3LPT A;  1ASV A;  1TL1 A;  3O4Q A;  3PX0 A;  4ZHR A;  4YNQ A;  4OKK A;  1JXB A;  4B9U A;  3DYA A;  2D0B A;  4DU3 A;  4I9Q A;  1VRT A;  2IOC A;  4CE9 A;  4DQR A;  5K14 A;  4ID1 A;  2G8H A;  5JS1 A;  4E1N A;  1YVU A;  4CGG A;  5HRP A;  3LZI A;  4DF4 A;  4FCY A;  4DTN A;  1IKX A;  2HW3 A;  2Z1G A;  1LW0 A;  3ZT2 A;  2RKI A;  3K5O A;  3V1O A;  1SL2 A;  3OJU A;  4QCL A;  2GUI A;  2DY4 A;  1C1B A;  1T7P A;  1HQE A;  1O1W A;  1IH7 A;  4FM1 A;  2PYJ A;  4KTQ A;  2QKK A;  3NGI A;  1RT7 A;  1WAF A;  3I0S A;  5DMR A;  1T05 A;  1DTT A;  4CJS A;  1UOC A;  4W5Q A;  4DSE A;  4M42 A;  2ZE2 A;  1Q9X A;  3VQE A;  4CJE A;  3DLG A;  1QS4 A;  3LP1 A;  3OYJ A;  5I42 A;  4CHQ A;  4E0D A;  1RT6 A;  3A2F A;  2VG5 A;  1FKO A;  4CGJ A;  4EZ6 A;  1G15 A;  2EHG A;  1WAJ A;  3ZSO A;  4JS4 A;  1Q8I A;  4JLH A;  3KK3 A;  4OVL A;  4FJ9 A;  3HP6 A;  1S9G A;  4OLA A;  3V9S A;  1JLB A;  4AHS A;  4FLV A;  1QTM A;  3K2P A;  1BIZ A;  1KLM A;  2A1S A;  4KAZ A;  4IKF A;  1BIS A;  2HNY A;  1QSY A;  1BIU A;  2IS3 A;  2VG7 A;  1N5Y A;  3M8R A;  3AA4 A;  4DTU A;  3SYZ A;  3WNE A;  2OPS A;  2B4J A;  4M3Z A;  2KW4 A;  1TKX A;  4B8C A;  1HNI A;  5DK5 A;  5KRT A;  1S6P A;  3VQ7 A;  1VSF A;  3QER A;  1KRP A;  2BDP A;  1VSD A;  3PO4 A;  3AO2 A;  4CEZ A;  2OYQ A;  3QNN A;  2XRI A;  4E89 A;  1C0M A;  4RW6 A;  1HYS A;  3F9K A;  4OKE A;  2I5J A;  3TR8 A;  3OYG A;  3PX4 A;  4LH5 A;  4CGF A;  1SL1 A;  1NK9 A;  4HCB A;  2FBT A;  1HYV A;  1RDB A;  2IC3 A;  3OYF A;  4AIL C;  4Q5V A;  1CZB A;  1QSL A;  2Z1H A;  2KZM A;  4CJR A;  1U47 A;  2G8K A;  3LP3 A;  2GBZ A;  2VG6 A;  3SQ1 A;  1WSF A;  4FLY A;  3KK2 A;  1X9S A;  5FDL A;  4NYN A;  3AVM A;  1WSG A;  3NAE A;  4FK2 A;  4C8L A;  1CXQ A;  3HST B;  4RW7 A;  4DS5 A;  3QET A;  2HHS A;  4KFB A;  2P5O A;  4FZX C;  4NCB A;  4KRE A;  2BGG A;  3TAN A;  3LAL A;  1T03 A;  2HB5 A;  1I3A A;  4CIG A;  3SUO A;  4NCG A;  3AA2 A;  1EXQ A;  3TAP A;  3S3O A;  3P5J A;  3OS1 A;  4FM2 A;  1IKY A;  1WNS A;  4CES A;  1WSJ A;  2JLE A;  2E4L A;  2XY6 A;  3E01 A;  4MQ3 A;  4ELT A;  4KB0 A;  1TGO A;  2KZZ A;  3DMJ A;  1WLJ A;  4DTR A;  1JLA A;  3VQD A;  3NF9 A;  3ZSQ A;  4CEE A;  1BGX T;  1RCH A;  4CJL A;  5J2P A;  1N6Q A;  3RRG A;  1RTH A;  3VA3 A;  3SJJ A;  1RIL A;  2P5G A;  1RT2 A;  3B6O A;  4DSK A;  1SKS A;  1KVA A;  1NOY A;  1ZBU A;  3UIQ A;  3ZSV A;  1BI4 A;  3WNG A;  3K58 A;  2F96 A;  1SV5 A;  3IRX A;  3P83 D;  3NBP A;  3AO3 A;  3IS9 A;  3K57 A;  4O44 A;  3AVA A;  3NGZ A;  1TL3 A;  4MFB A;  1I39 A;  3WNH A;  4O0I A;  4E7K A;  2RF2 A;  3VQ4 A;  4CEA A;  1WSH A;  4QAG A;  4RG8 A;  4FZY A;  4CJP A;  2KQ2 A;  1A5V A;  4KHW A;  4B8A B;  3NGY A;  3NH1 A;  3QES A;  4FJL A;  1CLQ A;  4W5N A;  1VSJ A;  1HNV A;  1RNH A;  2HVH A;  4C8N A;  4RW8 A;  3KD5 E;  3KLE A;  3MEC A;  4AHT A;  2KTQ A;  4DTJ A;  3OYM A;  3SPZ A;  2HHQ A;  3PO5 A;  1C0U A;  4CHO A;  3V6D A;  3NF6 A;  1HRH A;  5E41 A;  4CF8 A;  4KHY A;  1TKT A;  3AO5 A;  2A1R A;  1D9D A;  3T19 A;  1EET A;  4CEC A;  3NH2 A;  4CEO A;  4OPK A;  4W5R A;  1RT1 A;  3ZCM A;  1B9D A;  2W42 A;  4BAC A;  1QHT A;  3DLK A;  4FLW A;  2G8F A;  2PZS A;  1UWB A;  1EKE A;  5SWM A;  3KLI A;  1LWF A;  4OJR A;  4J2D A;  3AA3 A;  2HVI A;  3AVI A;  4KO0 A;  2YKM A;  4KHN A;  3SQ0 A;  3OYL A;  1XHZ A;  1NOZ A;  4O55 A;  3AVC A;  3C94 A;  2IDO A;  3DRR A;  4CEQ A;  4H4M A;  5T7B A;  1SL0 A;  4DTM A;  2ITG A;  1JXE A;  1D9F A;  1KCF A;  2Q3S A;  3RRH A;  4CK3 A;  4KHS A;  1S9E A;  3H08 A;  1XI1 A;  4CFB A;  3VQA A;  4DLE A;  1SKR A;  2KFZ A;  1TV6 A;  4KTZ A;  3KLH A;  3OVN A;  1NJW A;  4KKO A;  3VQ6 A;  1JKH A;  4E1M A;  4DQP A;  2XO7 A;  4DSL A;  3RTV A;  3VQ9 A;  4FYD A;  5CYQ A;  3C6U A;  4CJW A;  3VQ8 A;  1HYZ A;  2O4G A;  3VQQ A;  4WE1 A;  3L2V A;  1C1A A;  3L2U A;  4M3T A;  5KGX A;  1Z26 A;  3FFI A;  3HPH A;  4LY7 A;  1RT5 A;  2OPQ A;  1KVB A;  5JS2 A;  5J1E A;  3HXM A;  3EYZ A;  3ZSX A;  4BE1 A;  4AHU A;  4CJF A;  5CYM A;  4Z4C A;  2OPP A;  1J53 A;  3OYE A;  3BGR A;  4DQI A;  1CXU A;  1KTQ A;  4TSX A;  4N56 A;  2ZD1 A;  3U3G A;  1BCM A;  4F3O A;  1U48 A;  4DS4 A;  5KGW A;  4OPJ A;  4KTW A;  4N47 A;  3B6P A;  3CYM A;  5SZT A;  4BE2 A;  3QEI A;  3MXI A;  1KLN A;  3TI0 A;  4W5T A;  4CJ4 A;  3AVG A;  2HHV A;  1TVR A;  3SPY A;  3K5M A;  1BQM A;  5J2Q A;  2QKB A;  4FJ7 A;  2KFN A;  3EZ5 A;  3MEG A;  4IBN A;  3G10 A;  1SKW A;  2LSN A;  1B92 A;  3DRP A;  3V9X A;  3AO1 A;  3OYN A;  1S1U A;  4FW1 A;  3PY8 A;  4B3O A;  2FBV A;  4FJX A;  2RPI A;  2XY5 A;  1U4B A;  2QXF A;  3DOK A;  3ITH A;  3ZSY A;  3OYB A;  4BWJ A;  4ZTJ A;  1S6Q A;  4QOZ B;  3ZSW A;  3TAG A;  3C6T A;  5HP1 A;  3DLB A;  2G8W A;  1ZBL A;  4J2B A;  3M8Q A;  5KTQ A;  1VK0 A;  3RMA A;  3T1A A;  1RBU A;  3KK1 A;  4JS5 A;  2VWK A;  3I8D A;  3K5N A;  3EY1 A;  1JLC A;  4N41 A;  4M45 A;  4DTP A;  5CY4 A;  1KFS A;  2HMI A;  3S3M A;  2OZM A;  3SV3 A;  1FK9 A;  3HPO A;  1ZYQ A;  3G0Z A;  4CFA A;  3HVR A;  3OYH A;  3O4N A;  2D0C A;  3TAF A;  1A5X A;  2X6N A;  5C25 A;  3DLH A;  3SV4 A;  4DTX A;  3RR8 A;  5I3U A;  1T8E A;  2B6A A;  3DLR A;  4NYF A;  4F2R A;  4C8O A;  4FJ5 A;  4M3U A;  2DTU A;  3DM2 A;  2FC0 A;  3L3V A;  4CF0 A;  3HK2 A;  4CER A;  3LAM A;  3QO9 A;  1X9M A;  1NK7 A;  4K8Z A;  4CHY A;  3MXM A;  4Z4I A;  1NK5 A;  1LWC A;  4J2A A;  4RW9 A;  3O3H A;  4E19 A;  3ALY A;  3LP2 A;  2DFH A;  4E7L A;  1VSI A;  1WN7 A;  2XHB A;  4JRP A;  3CQ8 A;  3OS0 A;  3U6F A;  1HQU A;  1JL2 A;  5J2N A;  3SUP A;  1QSS A;  5HRS A;  3ZSR A;  3NH0 A;  1EP4 A;  3KD1 E;  4CED A;  2E6L A;  1K6Y A;  1IO2 A;  1RDA A;  1RBV A;  1VSL A;  2IAJ A;  1VSM A;  3ISN C;  3K5L A;  4DWI A;  2G8I A;  2XY8 A;  4CHP A;  4CFD A;  3OYD A;  3CFR A;  4CIF A;  4HHT A;  3TAR A;  3THV A;  1D8Y A;  4FK0 A;  2AJQ A;  1C6V A;  4DMN A;  4KRF A;  3HL8 A;  2G8V A;  3L2R A;  3SUQ A;  1L5U A;  4CGH A;  1RTD A;  2OPR A;  4FK4 A;  3QNO A;  1ZBH A;  4CIE A;  1KVC A;  3LZJ A;  1S1V A;  2WOM A;  3V1R A;  1RT4 A;  1NK8 A;  4E7I A;  3OS2 A;  3L2Q A;  3HYF A;  2VWJ A;  1NK4 A;  3WNF A;  1D5A A;  2F8T A;  4HUE A;  4OKJ A;  3ZT4 A;  4KB1 A;  4HCC A;  3TWH A;  2B5J A;  1BL3 A;  2HND A;  4DFP A;  1RTJ A;  1NJX A;  4ZTF A;  5D3G A;  4Z4E A;  3L8B A;  2OA8 A;  2QK9 A;  3KTQ A;  1IKW A;  4E7H A;  4Z4G A;  3LWL A;  1U04 A;  1DTQ A;  1VSE A;  4XIU A;  1FXX A;  3HVT A;  4CJV A;  4FLT A;  4O4G A;  2IGI A;  2YNF A;  1TKD A;  4DFK A;  3M8S A;  3CM5 A;  3NCI A;  3TAE A;  3VQ5 A;  3VQP A;  3T3F A;  4KI6 A;  3HO1 A;  3V4I A;  4E7J A;  4OLB A;  3DI6 A;  4M3R A;  4DG1 A;  4CHN A;  2YHB A;  2F8S A;  4ID5 A;  4CEB A;  5FRO A;  4H8K A;  3RMD A;  2YNI A;  3IG1 A;  4L8R B;  4O0J A;  3HP9 A;  4Z0U A;  1R0A A;  3M8P A;  1U49 A;  1RDD A;  1XHX A;  1Y97 A;  4I2Q A;  5KI6 A;  5CZ1 A;  1ASU A;  1J9A A;  5C42 A;  4CF9 A;  4M3X A;  5HRN A;  3OY9 A;  1NK0 A;  1TK8 A;  4CEF A;  3SCX A;  1L3U A;  4FJJ A;  1RBR A;  3ZT0 A;  3SQ4 A;  1C1C A;  4DU4 A;  2BE2 A;  4FW2 A;  1F21 A;  4GMJ B;  1HJR A;  3RMC A;  5KRS A;  1LV5 A;  4ICL A;  4KHU A;  4B9N A;  4M41 A;  3AVB A;  2JGU A;  2Y1J A;  4J2E A;  2YNG A;  4R5P A;  1J54 A;  1RDC A;  3HM9 A;  3MAQ A;  4B9T A;  1TKZ A;  5HLF A;  2ATQ A;  5FRM A;  3PV8 A;  4AH9 A;  4I7F A;  3S9H A;  1NJZ A;  3NE6 A;  1XC9 A;  4B08 A;  3KKS A;  4FJN A;  1B9F A;  2ZQB A;  3OYC A;  4LD0 A;  4UQG A;  4CJK A;  1VSK A;  2FBY A;  1HMV A;  2HNZ A;  3KJV A;  1JLF A;  1WSE A;  4DU1 A;  1A5W A;  3L3U A;  3OJS A;  3HT3 A;  2EX3 A;  4CJT A;  1KSP A;  1QQC A;  3AVL A;  3V1Q A;  4DSI A;  3K59 A;  1ZBI A;  5HBM A;  4GW6 A;  1UA1 A;  1LAW A;  4N76 A;  4PWD A;  3AVN A;  1TAU A;  3QEX A;  3RWU A;  4F8R A;  4FZZ A;  4F3T A;  4DSJ A;  2GV9 A;  1X9W A;  4DFJ A;  3SQ2 A;  4N5S A;  2HHU A;  4G1Q A;  1ITG A;  2XY7 A;  1X1P A;  3P1G A;  2X6S A; 
#chains in the Genus database with same CATH topology
 1X3N A;  1YJ9 N;  4AHC A;  3P4I A;  5JIC A;  1N36 K;  5MLC Q;  5EY4 A;  3AVJ A;  5F0X A;  2V51 B;  4IOA L;  2HBK A;  3O9T A;  2ZJP L;  1TYQ A;  3L2W A;  2W6L A;  3QEP A;  1BDG A;  2AP1 A;  3ULD A;  3AVK A;  3T69 A;  3VEN A;  2Z1J A;  3AAR A;  4FJG A;  2HHX A;  3O3G A;  4HTU A;  1BHL A;  4LF9 K;  1CZA N;  3S41 A;  3HJF A;  4C8M A;  2RN2 A;  5E26 A;  4YHH K;  4HUF A;  3TPQ A;  1IG9 A;  4FJM A;  2O8B B;  3J8A A;  4B1W B;  4KPY A;  2Y1I A;  3LM9 A;  4KV8 A;  4H5T A;  1NGD A;  4Q0B A;  1ZBF A;  1UA0 A;  2VGM A;  1Q9Y A;  1L3V A;  4KH6 A;  1UAX A;  4NCA A;  3TAM A;  4E3S A;  3C95 A;  5C12 A;  3DLL L;  1GOB A;  4EP5 A;  3D45 A;  3ID8 A;  4Z4F A;  3AO4 A;  1GLA G;  4FM0 A;  1V4T A;  2PYL A;  3QLH A;  4FLX A;  3JS6 A;  2OAN A;  1REV A;  4IG0 A;  5B8H A;  4XH5 A;  1I94 K;  3DOL A;  4FVU A;  2HBM A;  4I2P A;  3AA5 X;  4EP4 A;  1S1T A;  5EU7 A;  2FSN A;  5AQS A;  1L3T A;  2KLA A;  1NKE A;  1T3V A;  1VSH A;  4Z4H A;  3QIN A;  1RTI A;  3EKS A;  3VGL A;  4FLZ A;  1NGF A;  3A5M C;  3D0P A;  3JSM A;  3SNN A;  3TAB A;  4B9S A;  4FVM A;  3VQB A;  1U45 A;  4OGE A;  2O8C B;  1QHA A;  4M7Y A;  3THY A;  3KIO A;  3CJ7 A;  5AQG A;  2CGJ A;  3HPG A;  3LDN A;  3QML A;  4JRQ A;  4DV1 K;  2P9N A;  3M6G A;  2KKZ A;  3V81 A;  2P51 A;  3UB5 A;  3HOS A;  3JXU A;  3KWI A;  2GWJ A;  4C8K A;  4DQQ A;  2YKN A;  3E1Y A;  1JLQ A;  4O5F A;  3SBT A;  1WBD A;  4ELU A;  1J5O A;  5FRN A;  3LWM A;  4OX9 K;  1ESV A;  2IOC A;  3F2K A;  4ID1 A;  1SS6 A;  2ZGZ A;  4E1N A;  5HRP A;  4OO1 J;  1IKX A;  3ZT2 A;  2RKI A;  3D2E A;  3OJU A;  1HQE A;  5AQX A;  4I6M A;  2QKK A;  1UOC A;  4L3Q A;  3R8E A;  3DLG A;  1QS4 A;  1RT6 A;  3F5T A;  1WAJ A;  3OTO K;  3MDQ A;  3ZSO A;  1Q8I A;  4JS4 A;  4YOV A;  3HP6 A;  1DT9 A;  4BGB A;  1FJG K;  2QWR A;  1KLM A;  1YIJ N;  3CET A;  2Q0U A;  2HNY A;  4BC4 A;  1BIU A;  4LFA K;  3T1Y K;  3AA4 A;  3O9R A;  2B4J A;  4M3Z A;  2KW4 A;  4B8C A;  1KRP A;  1HNI A;  4BY9 C;  4X66 K;  1YVN A;  3AGR A;  2OYQ A;  4RW6 A;  1HYS A;  3TR8 A;  4A2A A;  1OKJ A;  4CGF A;  2FBT A;  3R9P A;  1QSL A;  4CJR A;  3B8A X;  1U47 A;  1TUU A;  4Y0W A;  2G8K A;  3LP3 A;  3MN9 A;  2VG6 A;  1NBW A;  4OPA A;  5BRE A;  5FPN A;  3D2F B;  4NYN A;  4FK2 A;  4WQ4 A;  4CD1 A;  4FZX C;  1N33 K;  2PFU A;  3HI0 A;  3SK3 A;  3SUO A;  1EXQ A;  1KQS M;  3P5J A;  1IKY A;  4CES A;  4A61 A;  1J5E K;  1WSJ A;  3G6E N;  2XY6 A;  4KB0 A;  2NRT A;  2KZZ A;  3DMJ A;  3PIO L;  3AAP A;  3RRG A;  1RTH A;  3SAH A;  3LDO A;  3VA3 A;  2V52 B;  3SJJ A;  2P5G A;  1RT2 A;  4K25 A;  4LC9 B;  4DR1 K;  1BI4 A;  3K58 A;  5BR9 A;  3IRX A;  1BUP A;  4R79 A;  4O44 A;  3WNH A;  4QS7 A;  4E7K A;  2NRR A;  4YOW A;  4RG8 A;  4FZY A;  2GUP A;  1A5V A;  4U67 L;  3NH1 A;  1CLQ A;  1Q7Y O;  4W5N A;  1HNV A;  4RW8 A;  4BRL A;  4JKG A;  3MCP A;  3OYM A;  3N4Q A;  3SPZ A;  2YI1 A;  3NF6 A;  3T7Z A;  4CF8 A;  4KHY A;  1TKT A;  3VF2 A;  4OPK A;  3VPZ A;  4FSV A;  2PZS A;  1UWB A;  3LDP A;  4GKK K;  3KLI A;  1YUW A;  4OJR A;  4DB3 A;  4WFN L;  3I55 N;  2E2P A;  1DKG D;  3SQ0 A;  2IDO A;  5T7B A;  2GX9 A;  4H4M A;  4JHD A;  3M5R A;  3NVK A;  1XQS C;  1GLC G;  4DV7 K;  3G4S N;  1S9E A;  5BR8 K;  4IWV A;  5AQV A;  1SKR A;  1TV6 A;  3T1H K;  3VQ6 A;  1OVY A;  1JKH A;  2XO7 A;  3RTV A;  3VQ9 A;  4JKC A;  3VEZ A;  3VQ8 A;  1C1A A;  4M7X A;  5KGX A;  5JLF A;  3HPH A;  1RT5 A;  5J1E A;  4GV3 A;  1YI2 N;  1NGA A;  4NO7 A;  4BE1 A;  2OPP A;  1J53 A;  2VWB A;  3OYE A;  2E88 A;  1T6D A;  4TSX A;  2BUP A;  3CPE A;  4F3O A;  1U48 A;  4DS4 A;  2YHX A;  4KTW A;  1KLN A;  3QEI A;  1HR0 K;  4JKE A;  3TI0 A;  4W5T A;  3QBW A;  3FE1 A;  2KFN A;  3ENO A;  3EZ5 A;  3MEG A;  4IBN A;  4JK8 A;  3G10 A;  4G9Z A;  1B92 A;  3TSQ A;  3NVM A;  4QS8 A;  2QXF A;  3ZSY A;  1U4B A;  4QOZ B;  5HP1 A;  3VER A;  1OH5 A;  1ZC6 A;  4J2B A;  3H1Q A;  5KTQ A;  2O8B A;  1NU0 A;  2VWK A;  4BQL A;  4DTP A;  5CY4 A;  1KFS A;  2OZM A;  4E1J A;  1JJ2 M;  1FK9 A;  3G0Z A;  1P90 A;  3O08 A;  4BRF A;  3O4N A;  3QIC A;  3P38 A;  1EWR A;  5I9E B;  4CZF A;  5C25 A;  3SV4 A;  3RR8 A;  3WQT A;  2B6A A;  5EXW A;  2QWL A;  4BR2 A;  4C8O A;  5AR0 A;  5FPE A;  1JCE A;  4CER A;  1HNX K;  3ZEU A;  4CHY A;  3O9S A;  4CZL A;  3CMA N;  2QWM A;  4J2A A;  4FO0 A;  2P9L A;  4RW9 A;  3O3H A;  3LP2 A;  1K8K A;  3A5O C;  4JRP A;  3L4I A;  1NGG A;  3SUP A;  5TKW A;  1QSS A;  1EP4 A;  1VSM A;  2E6L A;  3WXJ A;  3D2E B;  1D8Y A;  4CHP A;  4FK0 A;  3THV A;  3HL8 A;  3L2R A;  4DUY K;  1RTD A;  3LDQ A;  3OBW A;  3QNO A;  1KVC A;  3CME N;  2WOM A;  4FPB A;  4E7I A;  4BRM A;  2F8T A;  3ZT4 A;  3CI5 A;  3TWH A;  3C7N B;  2B5J A;  3WXK A;  1BL3 A;  1RDW X;  4Z4E A;  3OHR A;  5TKY A;  1QVF M;  2J4R A;  3UKR B;  2YNF A;  1TKD A;  4M63 C;  3CM5 A;  3NCI A;  4BRI A;  4EAH D;  3TAE A;  3VQP A;  4DR2 K;  1R59 O;  1HKC A;  2UUB K;  4E7J A;  2VQF K;  2YHB A;  2F8S A;  3SBG A;  4CEB A;  5FRO A;  1ILY A;  5KPZ A;  1KC8 O;  1DGK N;  4O0J A;  2PBD A;  1W7A A;  2ASM A;  3OW2 M;  4I2Q A;  1L3U A;  4FJJ A;  1TK8 A;  4CEF A;  1V4S A;  4DU4 A;  1NLV A;  1F21 A;  5KRS A;  3D2F A;  3NMU A;  4J2E A;  3HM9 A;  1J54 A;  2F9T A;  3S9H A;  4BRH A;  4B08 A;  3KKS A;  3FZL A;  4FJN A;  2ZQB A;  1VSK A;  1WSE A;  4YOX A;  5AQR A;  4KH4 A;  3L3U A;  1OVQ A;  2EX3 A;  4O8K A;  4CJT A;  1ZBI A;  3K59 A;  4DV6 K;  1UA1 A;  3QEX A;  4F3T A;  4FZZ A;  4H0X B;  4DFJ A;  3P39 A;  3ZYY X;  4N5S A;  1ITG A;  3P1G A;  4CZG A;  2X6S A;  3MN5 A;  3LP0 A;  5CHI A;  2DFF A;  3FZH A;  5JMV A;  1Q82 O;  1KAY A;  3CCR N;  3F9M A;  4DTO A;  4B9L A;  3NDK A;  3V9Z A;  4AHV A;  1S1X A;  2NUB A;  3DRS A;  5AQK A;  1TK5 A;  3AVH A;  2HBJ A;  1GLF O;  3CD6 N;  2P9P A;  3FZM A;  3QEV A;  2YHA A;  4FJH A;  4B1X B;  1ATS A;  1C0G A;  2BH1 A;  2ZM6 K;  4H0V B;  3NF8 A;  2ZJQ L;  2D0A A;  3MXJ A;  4LH4 A;  4NLB A;  3F73 A;  4H5V A;  4IXC A;  3G71 N;  3QBX A;  3SZ2 A;  2W6K A;  2HF3 A;  3ASM A;  3AV9 A;  2FBX A;  2QWQ A;  2UYT A;  2IVP A;  5E84 A;  4PY5 A;  4FWS A;  3LDS A;  1NKB A;  3VGK A;  1RBT A;  3U9Z A;  3OYA A;  2YX6 A;  5BPN A;  3DWL A;  4BGA A;  3QIO A;  4CGI A;  1SZ2 A;  1JL1 A;  3MEE A;  2F7T A;  1K73 O;  3LAN A;  3TAQ A;  4M3Y A;  4LSN A;  4MO5 A;  3RR7 A;  3U9D A;  5ELZ A;  3ZSZ A;  4BDZ A;  1YTA A;  5M1K A;  3IAY A;  5J2M A;  1NK6 A;  4A2B A;  4FJI A;  4IFV A;  1XC3 A;  3WXM B;  3OYI A;  3NFA A;  3QIP A;  3CC2 N;  3VA0 A;  3OBY A;  1TAQ A;  4WQ4 C;  4CJ7 A;  1QQO A;  1NJY A;  4YFU A;  3UKU A;  2E2Q A;  1L3S A;  2ETJ A;  3A5N C;  4H0Y B;  1TK0 A;  3EN9 A;  5JVH L;  1YF5 L;  1CZ9 A;  4CK1 A;  3V9W A;  1WSI A;  2ASP A;  5M1F A;  2YNH A;  4DF8 A;  2WON A;  1C0T A;  1S1W A;  4IEE A;  2PY5 A;  3LM2 A;  3O80 A;  4OGC A;  3CFP A;  4CJQ A;  1YT3 A;  3S3N A;  2NRW A;  2X74 A;  5CZ2 A;  1DLO A;  4DLG A;  4DR5 K;  1Q18 A;  3CFO A;  3PUF A;  4FWR A;  1ASV A;  4DV0 K;  4YNQ A;  5AQL A;  1JXB A;  4FWL A;  4B9U A;  3DYA A;  1BG3 A;  2D0B A;  1XUP O;  1WBB A;  4CZJ A;  2G8H A;  4YDU A;  2A42 A;  3QB0 A;  4CGG A;  4DF4 A;  1FW6 A;  2E2O A;  1VQP N;  1OH6 A;  1LW0 A;  2OCE A;  3EE8 A;  3TTC A;  3V1O A;  2DY4 A;  2GUI A;  1IH7 A;  4FM1 A;  3NGI A;  1T05 A;  4W5Q A;  4M42 A;  1C0F A;  2ZE2 A;  3VQE A;  4CJE A;  4EZ6 A;  1ZBS A;  1G15 A;  5AQO A;  1VQ6 N;  3IFR A;  3J7Z O;  1S22 A;  4CD3 A;  3V9S A;  4DV5 K;  4AHS A;  3K2P A;  5DM6 L;  1BIZ A;  4IKF A;  5AZJ A;  1QSY A;  2VG7 A;  1N5Y A;  2OPS A;  5IT9 O;  4JKD A;  2BDP A;  3AO2 A;  4FPA A;  3QNN A;  4OKE A;  2FSJ A;  1SL1 A;  1NK9 A;  1QVG M;  2IC3 A;  4IZ9 A;  1CZB A;  3SMS A;  3SQ1 A;  2W41 A;  3WXI A;  2P5O A;  4GV9 A;  4KRE A;  3C65 A;  4JI5 K;  2YJF A;  2BGG A;  3LAL A;  1I3A A;  3CJ1 A;  3CF5 L;  3VGM A;  3RSE A;  2Q36 A;  4BRG A;  3E01 A;  4MQ3 A;  2UXC K;  4XH1 A;  4PHT X;  1Z6R A;  1WLJ A;  3QFP A;  1N6Q A;  3NF9 A;  4CEE A;  1K9M O;  1W2B M;  3UE5 A;  4IJA A;  1VQM N;  1RIL A;  4JEP A;  4DSK A;  1SKS A;  1KVA A;  1ZBU A;  5M1Q A;  3WNG A;  5AQZ A;  4WQ5 C;  1TL3 A;  4K43 A;  3EZW A;  3SAF A;  3VMF B;  3THX B;  3MWP A;  3GBT A;  2EWS A;  3VEV A;  3BY5 A;  2KQ2 A;  1D4X A;  3QES A;  4FJL A;  2UXB K;  4IO8 A;  1VSJ A;  1RNH A;  4OPH A;  3O4W A;  2KTQ A;  4DV4 K;  1W97 L;  1C0U A;  5KPT A;  3V6D A;  1HRH A;  5AFU A;  3CCL N;  1EET A;  4BG8 A;  4W5R A;  1HX1 A;  4FLW A;  2G8F A;  4QS9 A;  1EKE A;  3K9K A;  5SWM A;  3WXL A;  4J2D A;  2HVI A;  1GLL O;  3AVI A;  2YKM A;  3TU5 A;  4B3R K;  3N4P A;  3OYL A;  1XHZ A;  4O55 A;  4CEQ A;  3Q7C A;  1BOT O;  1D9F A;  3RRH A;  3MK6 A;  4KHS A;  1NGE A;  4CFB A;  4DLE A;  3FGU A;  3ZX0 A;  3KLH A;  2WC9 A;  3CXC M;  4DSL A;  4H0O A;  4DQP A;  3ZX3 A;  5CYQ A;  4YY3 K;  3C6U A;  1S72 N;  3THY B;  4WE1 A;  3L2V A;  3L2U A;  3GDQ A;  1Z26 A;  1VQO N;  4LY7 A;  2OPQ A;  4RWT A;  5AQI A;  2HST A;  4AHU A;  4CJF A;  4GNI A;  3BGR A;  3ZX2 A;  2ZD1 A;  4H5R A;  3U3G A;  4OPJ A;  3B6P A;  4BE2 A;  5SZT A;  4ILH A;  4DR7 K;  4BRE A;  1VQK N;  3K5M A;  1BQM A;  5J2Q A;  4BR4 A;  2QKB A;  2NRZ A;  1VHX A;  3BF1 A;  3H1V X;  3PY8 A;  4FJX A;  3O9U A;  3DOK A;  3KK7 A;  3O8M A;  3TSU A;  1JCF A;  2HBL A;  1VK0 A;  4J8F A;  5GIO A;  3RMA A;  1RBU A;  3KK1 A;  1BO5 O;  2NLX A;  3SJH A;  3EY1 A;  4M45 A;  3S3M A;  3SAG A;  3SV3 A;  1MWM A;  4CFA A;  1IG8 A;  4IEI A;  4WFA L;  2I7P A;  2WUS A;  3W0L A;  1RDU A;  3DLR A;  4NYF A;  5GAH P;  4FJ5 A;  2FF6 A;  1X9M A;  4GKJ K;  3ULE B;  1LWC A;  3KWG A;  3CCE N;  1VSI A;  1WN7 A;  1NGB A;  4DV2 K;  4BQZ A;  4MLH A;  2Q31 A;  5HRS A;  3LDL A;  5JVG L;  4FOI A;  2A5X A;  5KQ8 A;  1K6Y A;  1IO2 A;  1EO1 A;  1RBV A;  4DWI A;  4ILG B;  1NMD A;  4CFD A;  4DUZ K;  1KD1 O;  4V19 S;  3SUQ A;  3CCQ N;  4CIE A;  2D0O A;  3FZF A;  1S1V A;  3VET A;  4LFB K;  1RT4 A;  4JD2 A;  1DEJ A;  3FFK B;  3HTV A;  4OKJ A;  4KB1 A;  4PL7 A;  1RTJ A;  1NJX A;  3L8B A;  3ENH A;  3IKM A;  1FXX A;  4FLT A;  4O4G A;  4IFE A;  3J7A P;  1EWQ A;  5EVZ A;  1U2V B;  3PSF A;  3HO1 A;  2OTJ N;  3V4I A;  4M3R A;  1X3M A;  4CHN A;  4YOT A;  1NJI O;  2YNI A;  4MDA A;  4L8R B;  4Z0U A;  2V7Y A;  1RDD A;  1XHX A;  4CF9 A;  3OY9 A;  3SQ4 A;  4FW2 A;  4GMJ B;  1LV5 A;  3QFU A;  2E2N A;  4B9N A;  4AM7 A;  2D1K A;  1TKZ A;  5KQD A;  4JI0 K;  4I7F A;  5JLH A;  2YHY A;  4AF1 A;  4LD0 A;  4CJK A;  3CCU N;  2FBY A;  2HNZ A;  2P9P B;  1A5W A;  3HT3 A;  3EE9 A;  2WFB A;  1Q81 O;  1RGI A;  3L4Q A;  3HOT A;  3VOV A;  4MDB A;  1KSP A;  1QQC A;  4JI3 K;  3AVL A;  1P8Z A;  3EKU A;  4BRK A;  3THX A;  3AVN A;  4PWD A;  4ISG A;  4F8R A;  2GV9 A;  1ATN A;  3FR0 A;  3WUH A;  3SQ2 A;  4O8U A;  1MU2 A;  2FF3 B;  5BPM A;  4FXD A;  1VQL N;  4B3S K;  3AVF A;  5AZJ B;  4IG3 A;  2HHH K;  3QEW A;  2QTD A;  2A6A A;  3H46 O;  1FKP A;  1LOT B;  3DXK B;  1JLG A;  4BR7 A;  4DQS A;  4W5O A;  2HHW A;  4WF9 L;  5C10 A;  4CFC A;  4F9O A;  2YCH A;  1OH8 A;  2E1Z A;  4ELV A;  4LSL A;  2G8U A;  1HJO A;  4CJ3 A;  5HRR A;  3V9U A;  2CGK A;  2HHT A;  1MA9 B;  5BRD A;  3KLG A;  1NGI A;  4Y1C A;  1N8R O;  3MED A;  3IDH A;  2YJE A;  2WTU A;  4BE0 A;  1IKV A;  1SQK A;  3QDK A;  5CE3 A;  4CF1 A;  3BEX A;  4CZK A;  3U3Y A;  4BDP A;  2O4I A;  1XWL A;  1NKC A;  4CCH A;  4CK2 A;  1RT3 A;  4H4O A;  2OZS A;  1BWF O;  4FWO A;  3C6A A;  5C15 A;  1BI4 B;  1M1K O;  3O3F A;  1GOC A;  3KLF A;  4YOY A;  4FJ8 A;  4B9Q A;  4PQU A;  3I0R A;  3E66 A;  2F4V K;  4FJK A;  2GTD A;  2QWP A;  3ZT3 A;  3ENB A;  3DLE A;  1ASW A;  2QWO A;  3KKR A;  4IOX A;  4CF2 A;  4BRO A;  2D5R A;  4BC5 A;  4Y1D A;  1BA1 A;  4A62 A;  5GAG P;  4PUO A;  4H5W A;  3VF4 A;  5C2F A;  1RBS A;  3Q7B A;  3J80 O;  3MX2 A;  2DFE A;  5ADX A;  3J81 O;  3SI6 A;  4IDK A;  4F4K A;  1Z25 A;  4RW4 A;  4CGD A;  2YV0 X;  4CJ5 A;  4DFM A;  1J6Z A;  3VQC A;  1LCU A;  2E6M A;  4AHR A;  1WUA A;  4O5B A;  2CH5 A;  4IFY A;  4BVP A;  4CHZ A;  3NF7 A;  3P31 A;  3JAM O;  4DTS A;  4I9L A;  3WEE A;  4CW7 B;  1HLU A;  2HOE A;  4IJN A;  2X78 A;  4K8X A;  3ZET B;  1HNZ K;  1LAV A;  3LPU A;  3PX0 A;  2GEL A;  4ZHR A;  2DPN A;  4OKK A;  2UUC K;  4DR4 K;  4DU3 A;  4CE9 A;  1IV0 A;  4DQR A;  5K14 A;  5AQJ A;  3LZI A;  3CQY A;  2O8F B;  4FCY A;  5BPL A;  4DTN A;  2Z1G A;  1SL2 A;  1T7P A;  2KHO A;  2PYJ A;  5AJ3 K;  1RT7 A;  1WAF A;  5DMR A;  1DTT A;  4CJS A;  1Q9X A;  5AQM A;  1Z05 A;  3OYJ A;  2VG5 A;  2EHG A;  2FLO A;  4DQ8 A;  3KK3 A;  4JAX A;  4FJ9 A;  4XH4 A;  1E4G T;  1S9G A;  4OLA A;  1QTM A;  2A1S A;  1U6Z A;  4KAZ A;  3RVC A;  1BIS A;  2IS3 A;  4JI6 K;  3M8R A;  3OA9 A;  3SYZ A;  4NXM K;  5DK5 A;  5LMU K;  1S6P A;  3VQ7 A;  1VSF A;  1VSD A;  3CCV N;  2GEM A;  4E89 A;  1C0M A;  5DM7 L;  2Q2R A;  3U8X A;  4LH5 A;  2QI2 A;  3OYF A;  4Q5V A;  2Z1H A;  4B3M K;  5F2R A;  3KK2 A;  2P9K A;  5FDL A;  1WSG A;  4C8L A;  3HST B;  3QET A;  2HHS A;  4KFB A;  4EHU A;  1NWK A;  1T03 A;  1Y64 A;  4CIG A;  4NCG A;  3AA2 A;  3TAP A;  2ZF5 O;  3H45 C;  3OS1 A;  4FM2 A;  4NXN K;  2ZGY A;  2WBN A;  3E9O A;  4C1N I;  3VEY A;  4CJL A;  3ZSQ A;  1BGX T;  1MWK A;  3UKU B;  3B6O A;  1NOY A;  3ZSV A;  1SV5 A;  4ILJ A;  2NRX A;  3NBP A;  3K57 A;  3NGZ A;  5LJW A;  4UY8 O;  4O0I A;  4IDH A;  2RF2 A;  4CEA A;  1IBM K;  4QAG A;  4CZI A;  2D0P A;  4KHW A;  5ADX H;  4B8A B;  3NGY A;  4BRD A;  4C8N A;  3KD5 E;  4BRA A;  3MEC A;  3VEW A;  4AHT A;  3DJC A;  4DTJ A;  3D7E O;  4GVE A;  4AQY K;  2A1R A;  3T19 A;  3NH2 A;  4CEO A;  3H3O B;  3ID6 A;  5AQY A;  3CC7 N;  1LWF A;  4KO0 A;  4KHN A;  4JI7 K;  1NOZ A;  4KBO A;  3AVC A;  4EFH A;  3DXM A;  4DTM A;  2ITG A;  1KCF A;  4CK3 A;  1RFQ A;  1XI1 A;  1IBL K;  5M1N A;  3CCM N;  2KFZ A;  3OVN A;  1N34 K;  4FYD A;  1H1V A;  1HYZ A;  2O4G A;  3VQQ A;  4M3T A;  4JHD B;  3FFI A;  3HXM A;  5JS2 A;  4GV6 A;  3I33 A;  4BC3 A;  2FXU A;  4DQI A;  2P9S B;  1CXU A;  5M1O A;  3MN6 A;  1NMN A;  1YJW N;  2CGL A;  3KHY A;  3UKR A;  4N47 A;  4EIA A;  3CYM A;  3TTD A;  2ITM A;  2HHV A;  1TVR A;  4CBU A;  2HMP A;  4FJ7 A;  3HM8 A;  5AQF A;  5FLX O;  4BRN A;  1SKW A;  3DRP A;  3AO1 A;  4B3O A;  5GIP A;  2FBV A;  2V7Z A;  2XY5 A;  4DR3 K;  3RSE B;  3VTI A;  4B1U B;  3OYB A;  3G25 A;  4BWJ A;  4ZTJ A;  4FOE A;  3TAG A;  3C6T A;  1NGJ A;  2G8W A;  3T1A A;  2NRH A;  4JI1 K;  1JLC A;  3E9P A;  2HMI A;  3O1B A;  1O13 A;  3OYH A;  4DCH A;  1EQY A;  2D0C A;  3W3D A;  1A5X A;  2X6N A;  3DLH A;  4DTX A;  1E3M A;  5I3U A;  4JI2 K;  5C2D A;  2FC0 A;  3L3V A;  4CF0 A;  3A5L C;  3K0S A;  3LAM A;  1U2V A;  3QO9 A;  4K8Z A;  3MXM A;  4H5N A;  4Z4I A;  3I8B A;  4JK9 A;  1NK5 A;  4CBX A;  3ALY A;  4E19 A;  2DFH A;  4E7L A;  2XHB A;  3CQ8 A;  3OS0 A;  1XMO K;  4YOR A;  3U6F A;  5J2N A;  3ZSR A;  3ISN C;  3VES A;  3K5L A;  2G8I A;  2XY8 A;  3OYD A;  4HHT A;  3CFR A;  4CIF A;  3CC4 N;  3TAR A;  4K41 A;  5EX5 A;  5GAE P;  1NGH A;  2G8V A;  1L5U A;  2OPR A;  1ZBH A;  4C23 A;  3GOI A;  1NNE A;  4BVO A;  3L2Q A;  3HYF A;  3WT0 A;  1NK4 A;  4HUE A;  4YDU C;  5FPM A;  2E1Y A;  1YJN N;  4ZTF A;  2QK9 A;  3KTQ A;  1BU6 O;  4H03 B;  4Z4G A;  1ATR A;  2O8D A;  3LWL A;  4PKG A;  4XIU A;  1DTQ A;  1VSE A;  3VEO A;  4KI6 A;  2PAV A;  4DG1 A;  4ID5 A;  3CCS N;  1ZXO A;  4H8K A;  3L0Q A;  2W40 A;  3O1W A;  1R0A A;  1Y97 A;  5HL7 L;  4HTL A;  4B1Z A;  1S3X A;  5HRN A;  4M3X A;  1C1C A;  3RMC A;  2NZT A;  4DKW A;  4KHU A;  4DR6 K;  3AVB A;  2JGU A;  4JKA A;  4R5P A;  1RDC A;  4ISE A;  1KAX A;  4BR5 A;  5FRM A;  3PV8 A;  3NE6 A;  1B9F A;  3OYC A;  1HMV A;  3KJV A;  2UXD K;  1JLF A;  1YXQ A;  4CBW A;  3CJ9 A;  4DSI A;  3V1Q A;  4A5A A;  1LAW A;  1T6C A;  1TAU A;  4DSJ A;  1X1P A;  4U7B A;  1BQN A;  1EX4 A;  1W9H A;  5GAD P;  1BCO A;  3CJA A;  2NNW A;  1NGC A;  4HUG A;  4B1V A;  4BR0 A;  4HVJ A;  4B9V A;  1QE1 A;  3CIP A;  2BTF A;  4A57 A;  4BDY A;  4KI4 A;  4JNE A;  4MO4 A;  2I7N A;  5F1X A;  5LMN K;  2RE2 A;  3PLA A;  1SUQ A;  2A41 A;  3H3N O;  4M3W A;  2Z1I A;  3GL1 A;  1GLD G;  4CJU A;  2BAN A;  3ZT1 A;  1HPM A;  1JLE A;  3ATV A;  1BA0 A;  1VRU A;  4PL8 A;  3IMX A;  1W0H A;  1YHQ N;  5AFU H;  4BRC A;  1E4F T;  4JKG B;  3CM6 A;  1HKG A;  5EOY A;  1HPZ A;  3LAK A;  3EEQ A;  2R7Y A;  4PA1 A;  4WCE L;  1YTU A;  3LL3 A;  2O8D B;  3CCJ N;  3WEE B;  5AQN A;  2P1J A;  2P9I B;  2JWK A;  2UUA K;  4K0K K;  3OYK A;  3BZK A;  2P9U B;  3ZET A;  3THW B;  5C24 A;  3O6W A;  1LW2 A;  3MMV A;  4NB4 A;  5LL6 Z;  1KFD A;  3SUN A;  4GVM A;  3VN5 A;  1KXP A;  1NM1 A;  4EZ9 A;  4FLU A;  3BDP A;  2FSK A;  1S5J A;  4KHQ A;  3ZEU B;  3CER A;  3JYT A;  3RMB A;  1VQ4 N;  2VGN A;  4CZE A;  1K8K B;  4B9M A;  1GLB G;  3VF6 A;  1GLE G;  2RHK A;  2VCP A;  1GOA A;  3CG7 A;  3L6Q A;  4F2S A;  4DSF A;  5HRO A;  2QM1 A;  5GIN A;  2VQE K;  1LWE A;  2E20 A;  3VEX A;  4BWM A;  5BRF A;  3A0I X;  3D6R A;  2VYP A;  4HWI A;  5LJV A;  3FLC O;  3PX6 A;  1QZ6 A;  3HSC A;  1SAZ A;  3NHG A;  4WQ5 A;  3LPT A;  1TL1 A;  3O4Q A;  2ZJR L;  4IOC L;  1GLJ O;  3R6M A;  2QA4 N;  4I9Q A;  1VQ8 N;  1VRT A;  5LY3 A;  3BP8 A;  3O5B A;  5JS1 A;  1YVU A;  2P9S A;  4RTF D;  2HW3 A;  4K42 A;  3K5O A;  3M3Z A;  4QCL A;  1C1B A;  1O1W A;  3BF3 A;  4KTQ A;  3DXK A;  3I0S A;  1HNW K;  4DSE A;  3ATU A;  4PKI A;  4IO9 L;  4C1N K;  5I42 A;  3AY9 A;  3LP1 A;  4E0D A;  2AJQ A;  4CHQ A;  3A2F A;  1FKO A;  4CGJ A;  1XNQ K;  4JLH A;  4OVL A;  1JLB A;  3EL2 A;  4FLV A;  2E8A A;  4BG9 A;  5AQW A;  4KH5 A;  4DTU A;  3WNE A;  4BRP A;  2P9L B;  1TKX A;  3FZK A;  5KRT A;  3QER A;  4CZM A;  3PO4 A;  3PSI A;  4CEZ A;  2XRI A;  3F9K A;  4FWQ A;  2I5J A;  3OYG A;  4JN4 A;  2AA4 A;  2H3G X;  3PX4 A;  4HCB A;  3CJB A;  1HYV A;  3E9L A;  1RDB A;  4AIL C;  2GBZ A;  3J7Y P;  1T44 A;  1WSF A;  4FLY A;  1X9S A;  3AVM A;  4NLC A;  3NAE A;  2QW9 A;  1CXQ A;  4RW7 A;  4DS5 A;  4NCB A;  5A2Q O;  3TAN A;  2HB5 A;  2Q97 A;  3S3O A;  2IIR A;  4CI6 A;  1M90 O;  1WNS A;  4DHY A;  3R3L A;  1NG9 A;  2JLE A;  2E4L A;  3HRG A;  1VQ7 N;  4ELT A;  1TGO A;  1OH7 A;  4DTR A;  1JLA A;  3VQD A;  3VTH A;  1RCH A;  5J2P A;  4A5B A;  4H0P A;  2A40 A;  4LF8 K;  3BUZ B;  1X9J A;  3UIQ A;  1KAZ A;  1IJJ A;  4BC2 A;  3MCA B;  5HOO A;  2F96 A;  4GY2 B;  4CVN E;  5AQQ A;  3P83 D;  3AO3 A;  3IS9 A;  3AVA A;  4LFC K;  4MFB A;  4CZH A;  1I39 A;  3HBT A;  3CPW M;  3HZ6 A;  3VQ4 A;  1WSH A;  3EO3 A;  2UU9 K;  4WFB L;  4CJP A;  5KPR A;  5IWA K;  1TYQ B;  1YAG A;  4EHT A;  4PKH A;  1XNR K;  5BN9 A;  3A8Y A;  3CHW A;  3R1X A;  4XEI A;  3TSP A;  4B1Y B;  2HVH A;  3KLE A;  4Z94 A;  5BN8 A;  2HHQ A;  3PO5 A;  1WB9 A;  4CHO A;  5E41 A;  1N32 K;  3AO5 A;  1D9D A;  4CEC A;  3KVG A;  1RT1 A;  3ZCM A;  1B9D A;  2F9W A;  2W42 A;  4BAC A;  1QHT A;  3DLK A;  1HUX A;  3AA3 A;  1Q86 O;  5C0Y A;  2P9N B;  3C94 A;  3DRR A;  1SL0 A;  3C7N A;  4JKH A;  5AQU A;  3C0B A;  4A59 A;  1JXE A;  2Q3S A;  4JI4 K;  3H08 A;  2IVN A;  3VQA A;  3AAQ A;  4KTZ A;  1NJW A;  4LF5 K;  4KKO A;  4E1M A;  4X64 K;  2P9K B;  2O8E B;  4CJW A;  2A3Z A;  1QQM A;  1KVB A;  3EYZ A;  3ZSX A;  2JWL A;  5CYM A;  4Z4C A;  3I56 N;  1WOQ A;  4B3T K;  4BR9 A;  1KTQ A;  4RCH A;  4N56 A;  2IVO A;  1BCM A;  5KGW A;  4ISF A;  1VQ9 N;  3MXI A;  1K8A O;  4CJ4 A;  3AVG A;  3CQX A;  3IUC A;  3SPY A;  2YHW A;  4JK7 A;  2LSN A;  3V9X A;  3OYN A;  1S1U A;  4FW1 A;  2RPI A;  3DAW A;  3ITH A;  1S6Q A;  3GE1 A;  3ZSW A;  3DLB A;  1ZBL A;  3M8Q A;  4FWM A;  4AM6 A;  4JS5 A;  3K5N A;  3I8D A;  4N41 A;  1XMQ K;  3ULE A;  4JKB A;  3HPO A;  1ZYQ A;  2Q1N A;  3HVR A;  2HF4 A;  5CR4 A;  4JI8 K;  3KZB A;  3K9J A;  3TAF A;  4LF7 K;  3BZC A;  3MWT A;  2Q0R A;  5AQH A;  4JYA K;  1T8E A;  4F2R A;  4M3U A;  2OTL N;  2DTU A;  3DM2 A;  5H1S Q;  4JKF A;  3HK2 A;  3MX5 A;  1NK7 A;  2CH6 A;  3ZLJ A;  2P9U A;  3THW A;  1JCG A;  3O9Q A;  5BRH A;  2E5L K;  1HQU A;  1JL2 A;  3CJC A;  3WQU A;  3H6E A;  3NH0 A;  3KD1 E;  2P9I A;  1HKB A;  4CED A;  1RDA A;  1VSL A;  2IAJ A;  4X62 K;  2KZM A;  4I6M B;  1MDU B;  1C6V A;  4DMN A;  4KRF A;  1VQ5 N;  4CGH A;  4FK4 A;  2ASO A;  4YOU A;  3LZJ A;  3V1R A;  1NK8 A;  5AQP A;  3OS2 A;  2VWJ A;  3WNF A;  1D5A A;  4HCC A;  4FWN A;  3DXM B;  3PIP L;  2HND A;  4DFP A;  5D3G A;  5AZI A;  5AQT A;  2OA8 A;  1IKW A;  4E7H A;  3SLC A;  4MLE A;  2O8F A;  1U04 A;  4X65 K;  1G99 A;  1TUY A;  3HVT A;  4CJV A;  2IGI A;  4DFK A;  3M8S A;  4JD2 B;  3VQ5 A;  3T3F A;  4KHP K;  2ZWH A;  2O8E A;  4OLB A;  3DI6 A;  4FL9 A;  3RMD A;  3IG1 A;  4FWK A;  1VAZ A;  3HP9 A;  1U49 A;  3M8P A;  3SMP A;  5KI6 A;  4LF6 K;  5CZ1 A;  1ASU A;  1J9A A;  5C42 A;  4BRQ A;  1NK0 A;  3SCX A;  1RBR A;  3ZT0 A;  2BE2 A;  1HJR A;  4ICL A;  4M41 A;  2Y1J A;  2YNG A;  1QZ5 A;  3AGK A;  3MAQ A;  4B9T A;  5HLF A;  2O8C A;  2ATQ A;  3C6H A;  2QWN A;  3U4L A;  4AH9 A;  1NJZ A;  1QQN A;  1XC9 A;  4UQG A;  2QXL A;  4H0T B;  4DU1 A;  3MN7 A;  5M1P A;  5FPD A;  5AZI B;  3OJS A;  4DV3 K;  3TTF A;  4FWP A;  4WYB A;  3M1F A;  5HBM A;  4GW6 A;  1VQN N;  4N76 A;  3GG4 A;  3RWU A;  4LF4 K;  1X9W A;  2QEX N;  4JV5 K;  1YIT N;  2HHU A;  4G1Q A;  2XY7 A;  2D4W A;  2NRV A;  1IBK K;  2GWK A; 
#chains in the Genus database with same CATH homology
 1BQN A;  1EX4 A;  1W9H A;  3LP0 A;  4AHC A;  1MU2 A;  2DFF A;  1BCO A;  3AVJ A;  4FXD A;  4HUG A;  3AVF A;  4IG3 A;  4HVJ A;  3QEW A;  4B9V A;  1QE1 A;  3L2W A;  1FKP A;  3QEP A;  3ULD A;  3AVK A;  4FJG A;  2Z1J A;  4BDY A;  4KI4 A;  4DTO A;  2HHX A;  4B9L A;  3O3G A;  3NDK A;  1JLG A;  3V9Z A;  4DQS A;  4W5O A;  4AHV A;  1S1X A;  2HHW A;  4CFC A;  4HTU A;  1BHL A;  4ELV A;  3HJF A;  2NUB A;  2RN2 A;  3DRS A;  1SUQ A;  4LSL A;  4C8M A;  4HUF A;  1IG9 A;  1TK5 A;  3AVH A;  2G8U A;  4FJM A;  4CJ3 A;  5HRR A;  3V9U A;  2HHT A;  4KPY A;  3QEV A;  2Y1I A;  2YHA A;  2Z1I A;  4M3W A;  3KLG A;  4KV8 A;  4FJH A;  4Y1C A;  4CJU A;  1ZBF A;  4Q0B A;  1UA0 A;  1Q9Y A;  2BAN A;  3ZT1 A;  3MED A;  4BE0 A;  1L3V A;  1IKV A;  1JLE A;  3NF8 A;  4CF1 A;  2D0A A;  3MXJ A;  4LH4 A;  1UAX A;  1VRU A;  3F73 A;  3TAM A;  3U3Y A;  4E3S A;  4BDP A;  4NCA A;  3C95 A;  1XWL A;  2O4I A;  1GOB A;  1NKC A;  4CCH A;  1W0H A;  4CK2 A;  3SZ2 A;  4EP5 A;  1RT3 A;  3D45 A;  4H4O A;  2OZS A;  4Z4F A;  3ASM A;  3AO4 A;  3AV9 A;  3CM6 A;  2FBX A;  4FM0 A;  1BI4 B;  1HPZ A;  3LAK A;  3O3F A;  2PYL A;  1GOC A;  3QLH A;  3KLF A;  2R7Y A;  4FLX A;  4PA1 A;  4PY5 A;  3LDS A;  1YTU A;  4FJ8 A;  1REV A;  4IG0 A;  1NKB A;  1RBT A;  3I0R A;  4PQU A;  3OYA A;  4FJK A;  2P1J A;  3OYK A;  3DOL A;  3ZT3 A;  5C24 A;  3DLE A;  3QIO A;  1LW2 A;  1ASW A;  4CGI A;  1JL1 A;  3KKR A;  4I2P A;  3AA5 X;  3MEE A;  4CF2 A;  1KFD A;  4EP4 A;  3LAN A;  2D5R A;  1S1T A;  5EU7 A;  4GVM A;  4Y1D A;  3SUN A;  4LSN A;  3TAQ A;  1L3T A;  3RR7 A;  4M3Y A;  4PUO A;  3ZSZ A;  3VN5 A;  1NKE A;  4BDZ A;  1YTA A;  1VSH A;  1RBS A;  4Z4H A;  3IAY A;  4FLU A;  3QIN A;  4EZ9 A;  5J2M A;  1RTI A;  1NK6 A;  3BDP A;  4FJI A;  4IFV A;  2DFE A;  1S5J A;  4KHQ A;  3OYI A;  3NFA A;  3QIP A;  4FLZ A;  3D0P A;  3JSM A;  3VA0 A;  3SI6 A;  4IDK A;  3TAB A;  3SNN A;  3JYT A;  3RMB A;  1TAQ A;  4B9S A;  4FVM A;  3VQB A;  4F4K A;  1Z25 A;  1U45 A;  4RW4 A;  4CGD A;  4OGE A;  4YFU A;  1NJY A;  1L3S A;  2ETJ A;  1TK0 A;  4B9M A;  2YV0 X;  4CJ5 A;  3KIO A;  4DFM A;  3HPG A;  3VQC A;  1CZ9 A;  2E6M A;  4AHR A;  4JRQ A;  4CK1 A;  3V9W A;  1WSI A;  1GOA A;  3CG7 A;  4O5B A;  4F2S A;  4IFY A;  2YNH A;  3V81 A;  4DSF A;  2P51 A;  5HRO A;  4DF8 A;  4CHZ A;  2WON A;  3NF7 A;  1C0T A;  1S1W A;  4C8K A;  2PY5 A;  1LWE A;  4DTS A;  4OGC A;  3CFP A;  4BWM A;  4DQQ A;  2YKN A;  1YT3 A;  4CJQ A;  4I9L A;  3S3N A;  2X74 A;  5CZ2 A;  1DLO A;  1JLQ A;  4DLG A;  4ELU A;  3PX6 A;  2X78 A;  3CFO A;  3PUF A;  1J5O A;  4K8X A;  3LWM A;  5FRN A;  3NHG A;  1LAV A;  3LPU A;  3LPT A;  1ASV A;  1TL1 A;  3O4Q A;  3PX0 A;  4ZHR A;  4YNQ A;  4OKK A;  1JXB A;  4B9U A;  3DYA A;  2D0B A;  4DU3 A;  4I9Q A;  1VRT A;  2IOC A;  4CE9 A;  4DQR A;  5K14 A;  4ID1 A;  2G8H A;  5JS1 A;  4E1N A;  1YVU A;  4CGG A;  5HRP A;  3LZI A;  4DF4 A;  4FCY A;  4DTN A;  1IKX A;  2HW3 A;  2Z1G A;  1LW0 A;  3ZT2 A;  2RKI A;  3K5O A;  3V1O A;  1SL2 A;  3OJU A;  4QCL A;  2GUI A;  2DY4 A;  1C1B A;  1T7P A;  1HQE A;  1O1W A;  1IH7 A;  4FM1 A;  2PYJ A;  4KTQ A;  2QKK A;  3NGI A;  1RT7 A;  1WAF A;  3I0S A;  5DMR A;  1T05 A;  1DTT A;  4CJS A;  1UOC A;  4W5Q A;  4DSE A;  4M42 A;  2ZE2 A;  1Q9X A;  3VQE A;  4CJE A;  3DLG A;  1QS4 A;  3LP1 A;  3OYJ A;  5I42 A;  4CHQ A;  4E0D A;  1RT6 A;  3A2F A;  2VG5 A;  1FKO A;  4CGJ A;  4EZ6 A;  1G15 A;  2EHG A;  1WAJ A;  3ZSO A;  4JS4 A;  1Q8I A;  4JLH A;  3KK3 A;  4OVL A;  4FJ9 A;  3HP6 A;  1S9G A;  4OLA A;  3V9S A;  1JLB A;  4AHS A;  4FLV A;  1QTM A;  3K2P A;  1BIZ A;  1KLM A;  2A1S A;  4KAZ A;  4IKF A;  1BIS A;  2HNY A;  1QSY A;  1BIU A;  2IS3 A;  2VG7 A;  1N5Y A;  3M8R A;  3AA4 A;  4DTU A;  3SYZ A;  3WNE A;  2OPS A;  2B4J A;  4M3Z A;  2KW4 A;  1TKX A;  4B8C A;  1HNI A;  5DK5 A;  5KRT A;  1S6P A;  3VQ7 A;  1VSF A;  3QER A;  1KRP A;  2BDP A;  1VSD A;  3PO4 A;  3AO2 A;  4CEZ A;  2OYQ A;  3QNN A;  2XRI A;  4E89 A;  1C0M A;  4RW6 A;  1HYS A;  3F9K A;  4OKE A;  2I5J A;  3TR8 A;  3OYG A;  3PX4 A;  4LH5 A;  4CGF A;  1SL1 A;  1NK9 A;  4HCB A;  2FBT A;  1HYV A;  1RDB A;  2IC3 A;  3OYF A;  4AIL C;  4Q5V A;  1CZB A;  1QSL A;  2Z1H A;  2KZM A;  4CJR A;  1U47 A;  2G8K A;  3LP3 A;  2GBZ A;  2VG6 A;  3SQ1 A;  1WSF A;  4FLY A;  3KK2 A;  1X9S A;  5FDL A;  4NYN A;  3AVM A;  1WSG A;  3NAE A;  4FK2 A;  4C8L A;  1CXQ A;  3HST B;  4RW7 A;  4DS5 A;  3QET A;  2HHS A;  4KFB A;  2P5O A;  4FZX C;  4NCB A;  4KRE A;  2BGG A;  3TAN A;  3LAL A;  1T03 A;  2HB5 A;  1I3A A;  4CIG A;  3SUO A;  4NCG A;  3AA2 A;  1EXQ A;  3TAP A;  3S3O A;  3P5J A;  3OS1 A;  4FM2 A;  1IKY A;  1WNS A;  4CES A;  1WSJ A;  2JLE A;  2E4L A;  2XY6 A;  3E01 A;  4MQ3 A;  4ELT A;  4KB0 A;  1TGO A;  2KZZ A;  3DMJ A;  1WLJ A;  4DTR A;  1JLA A;  3VQD A;  3NF9 A;  3ZSQ A;  4CEE A;  1BGX T;  1RCH A;  4CJL A;  5J2P A;  1N6Q A;  3RRG A;  1RTH A;  3VA3 A;  3SJJ A;  1RIL A;  2P5G A;  1RT2 A;  3B6O A;  4DSK A;  1SKS A;  1KVA A;  1NOY A;  1ZBU A;  3UIQ A;  3ZSV A;  1BI4 A;  3WNG A;  3K58 A;  2F96 A;  1SV5 A;  3IRX A;  3P83 D;  3NBP A;  3AO3 A;  3IS9 A;  3K57 A;  4O44 A;  3AVA A;  3NGZ A;  1TL3 A;  4MFB A;  1I39 A;  3WNH A;  4O0I A;  4E7K A;  2RF2 A;  3VQ4 A;  4CEA A;  1WSH A;  4QAG A;  4RG8 A;  4FZY A;  4CJP A;  2KQ2 A;  1A5V A;  4KHW A;  4B8A B;  3NGY A;  3NH1 A;  3QES A;  4FJL A;  1CLQ A;  4W5N A;  1VSJ A;  1HNV A;  1RNH A;  2HVH A;  4C8N A;  4RW8 A;  3KD5 E;  3KLE A;  3MEC A;  4AHT A;  2KTQ A;  4DTJ A;  3OYM A;  3SPZ A;  2HHQ A;  3PO5 A;  1C0U A;  4CHO A;  3V6D A;  3NF6 A;  1HRH A;  5E41 A;  4CF8 A;  4KHY A;  1TKT A;  3AO5 A;  2A1R A;  1D9D A;  3T19 A;  1EET A;  4CEC A;  3NH2 A;  4CEO A;  4OPK A;  4W5R A;  1RT1 A;  3ZCM A;  1B9D A;  2W42 A;  4BAC A;  1QHT A;  3DLK A;  4FLW A;  2G8F A;  2PZS A;  1UWB A;  1EKE A;  5SWM A;  3KLI A;  1LWF A;  4OJR A;  4J2D A;  3AA3 A;  2HVI A;  3AVI A;  4KO0 A;  2YKM A;  4KHN A;  3SQ0 A;  3OYL A;  1XHZ A;  1NOZ A;  4O55 A;  3AVC A;  3C94 A;  2IDO A;  3DRR A;  4CEQ A;  4H4M A;  5T7B A;  1SL0 A;  4DTM A;  2ITG A;  1JXE A;  1D9F A;  1KCF A;  2Q3S A;  3RRH A;  4CK3 A;  4KHS A;  1S9E A;  3H08 A;  1XI1 A;  4CFB A;  3VQA A;  4DLE A;  1SKR A;  2KFZ A;  1TV6 A;  4KTZ A;  3KLH A;  3OVN A;  1NJW A;  4KKO A;  3VQ6 A;  1JKH A;  4E1M A;  4DQP A;  2XO7 A;  4DSL A;  3RTV A;  3VQ9 A;  4FYD A;  5CYQ A;  3C6U A;  4CJW A;  3VQ8 A;  1HYZ A;  2O4G A;  3VQQ A;  4WE1 A;  3L2V A;  1C1A A;  3L2U A;  4M3T A;  5KGX A;  1Z26 A;  3FFI A;  3HPH A;  4LY7 A;  1RT5 A;  2OPQ A;  1KVB A;  5JS2 A;  5J1E A;  3HXM A;  3EYZ A;  3ZSX A;  4BE1 A;  4AHU A;  4CJF A;  5CYM A;  4Z4C A;  2OPP A;  1J53 A;  3OYE A;  3BGR A;  4DQI A;  1CXU A;  1KTQ A;  4TSX A;  4N56 A;  2ZD1 A;  3U3G A;  1BCM A;  4F3O A;  1U48 A;  4DS4 A;  5KGW A;  4OPJ A;  4KTW A;  4N47 A;  3B6P A;  3CYM A;  5SZT A;  4BE2 A;  3QEI A;  3MXI A;  1KLN A;  3TI0 A;  4W5T A;  4CJ4 A;  3AVG A;  2HHV A;  1TVR A;  3SPY A;  3K5M A;  1BQM A;  5J2Q A;  2QKB A;  4FJ7 A;  2KFN A;  3EZ5 A;  3MEG A;  4IBN A;  3G10 A;  1SKW A;  2LSN A;  1B92 A;  3DRP A;  3V9X A;  3AO1 A;  3OYN A;  1S1U A;  4FW1 A;  3PY8 A;  4B3O A;  2FBV A;  4FJX A;  2RPI A;  2XY5 A;  1U4B A;  2QXF A;  3DOK A;  3ITH A;  3ZSY A;  3OYB A;  4BWJ A;  4ZTJ A;  1S6Q A;  4QOZ B;  3ZSW A;  3TAG A;  3C6T A;  5HP1 A;  3DLB A;  2G8W A;  1ZBL A;  4J2B A;  3M8Q A;  5KTQ A;  1VK0 A;  3RMA A;  3T1A A;  1RBU A;  3KK1 A;  4JS5 A;  2VWK A;  3I8D A;  3K5N A;  3EY1 A;  1JLC A;  4N41 A;  4M45 A;  4DTP A;  5CY4 A;  1KFS A;  2HMI A;  3S3M A;  2OZM A;  3SV3 A;  1FK9 A;  3HPO A;  1ZYQ A;  3G0Z A;  4CFA A;  3HVR A;  3OYH A;  3O4N A;  2D0C A;  3TAF A;  1A5X A;  2X6N A;  5C25 A;  3DLH A;  3SV4 A;  4DTX A;  3RR8 A;  5I3U A;  1T8E A;  2B6A A;  3DLR A;  4NYF A;  4F2R A;  4C8O A;  4FJ5 A;  4M3U A;  2DTU A;  3DM2 A;  2FC0 A;  3L3V A;  4CF0 A;  3HK2 A;  4CER A;  3LAM A;  3QO9 A;  1X9M A;  1NK7 A;  4K8Z A;  4CHY A;  3MXM A;  4Z4I A;  1NK5 A;  1LWC A;  4J2A A;  4RW9 A;  3O3H A;  4E19 A;  3ALY A;  3LP2 A;  2DFH A;  4E7L A;  1VSI A;  1WN7 A;  2XHB A;  4JRP A;  3CQ8 A;  3OS0 A;  3U6F A;  1HQU A;  1JL2 A;  5J2N A;  3SUP A;  1QSS A;  5HRS A;  3ZSR A;  3NH0 A;  1EP4 A;  3KD1 E;  4CED A;  2E6L A;  1K6Y A;  1IO2 A;  1RDA A;  1RBV A;  1VSL A;  2IAJ A;  1VSM A;  3ISN C;  3K5L A;  4DWI A;  2G8I A;  2XY8 A;  4CHP A;  4CFD A;  3OYD A;  3CFR A;  4CIF A;  4HHT A;  3TAR A;  3THV A;  1D8Y A;  4FK0 A;  2AJQ A;  1C6V A;  4DMN A;  4KRF A;  3HL8 A;  2G8V A;  3L2R A;  3SUQ A;  1L5U A;  4CGH A;  1RTD A;  2OPR A;  4FK4 A;  3QNO A;  1ZBH A;  4CIE A;  1KVC A;  3LZJ A;  1S1V A;  2WOM A;  3V1R A;  1RT4 A;  1NK8 A;  4E7I A;  3OS2 A;  3L2Q A;  3HYF A;  2VWJ A;  1NK4 A;  3WNF A;  1D5A A;  2F8T A;  4HUE A;  4OKJ A;  3ZT4 A;  4KB1 A;  4HCC A;  3TWH A;  2B5J A;  1BL3 A;  2HND A;  4DFP A;  1RTJ A;  1NJX A;  4ZTF A;  5D3G A;  4Z4E A;  3L8B A;  2OA8 A;  2QK9 A;  3KTQ A;  1IKW A;  4E7H A;  4Z4G A;  3LWL A;  1U04 A;  1DTQ A;  1VSE A;  4XIU A;  1FXX A;  3HVT A;  4CJV A;  4FLT A;  4O4G A;  2IGI A;  2YNF A;  1TKD A;  4DFK A;  3M8S A;  3CM5 A;  3NCI A;  3TAE A;  3VQ5 A;  3VQP A;  3T3F A;  4KI6 A;  3HO1 A;  3V4I A;  4E7J A;  4OLB A;  3DI6 A;  4M3R A;  4DG1 A;  4CHN A;  2YHB A;  2F8S A;  4ID5 A;  4CEB A;  5FRO A;  4H8K A;  3RMD A;  2YNI A;  3IG1 A;  4L8R B;  4O0J A;  3HP9 A;  4Z0U A;  1R0A A;  3M8P A;  1U49 A;  1RDD A;  1XHX A;  1Y97 A;  4I2Q A;  5KI6 A;  5CZ1 A;  1ASU A;  1J9A A;  5C42 A;  4CF9 A;  4M3X A;  5HRN A;  3OY9 A;  1NK0 A;  1TK8 A;  4CEF A;  3SCX A;  1L3U A;  4FJJ A;  1RBR A;  3ZT0 A;  3SQ4 A;  1C1C A;  4DU4 A;  2BE2 A;  4FW2 A;  1F21 A;  4GMJ B;  1HJR A;  3RMC A;  5KRS A;  1LV5 A;  4ICL A;  4KHU A;  4B9N A;  4M41 A;  3AVB A;  2JGU A;  2Y1J A;  4J2E A;  2YNG A;  4R5P A;  1J54 A;  1RDC A;  3HM9 A;  3MAQ A;  4B9T A;  1TKZ A;  5HLF A;  2ATQ A;  5FRM A;  3PV8 A;  4AH9 A;  4I7F A;  3S9H A;  1NJZ A;  3NE6 A;  1XC9 A;  4B08 A;  3KKS A;  4FJN A;  1B9F A;  2ZQB A;  3OYC A;  4LD0 A;  4UQG A;  4CJK A;  1VSK A;  2FBY A;  1HMV A;  2HNZ A;  3KJV A;  1JLF A;  1WSE A;  4DU1 A;  1A5W A;  3L3U A;  3OJS A;  3HT3 A;  2EX3 A;  4CJT A;  1KSP A;  1QQC A;  3AVL A;  3V1Q A;  4DSI A;  3K59 A;  1ZBI A;  5HBM A;  4GW6 A;  1UA1 A;  1LAW A;  4N76 A;  4PWD A;  3AVN A;  1TAU A;  3QEX A;  3RWU A;  4F8R A;  4FZZ A;  4F3T A;  4DSJ A;  2GV9 A;  1X9W A;  4DFJ A;  3SQ2 A;  4N5S A;  2HHU A;  4G1Q A;  1ITG A;  2XY7 A;  1X1P A;  3P1G A;  2X6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...