2Z1JA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMKPKLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 151
sequence length 151
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1jA00
1SL2A 1WSIA 1WLJA 4OKJA 1BI4A 3QEIA 3M8QA 1LAVA 1QTMA 3V1RA 2VG6A 2A1RA 2B5JA 2YHBA 2RN2A 2YNGA 5EU7A 5SWMA 1RT4A 2P1JA 3U3GA 2KW4A 4HTUA 1U47A 3OYJA 4CJPA 1C0UA 3V81A 4B8AB 5T7BA 4ZTJA 3K5NA 3JYTA 1RBRA 1KTQA 1RT2A 1VSLA 1HYZA 1VSMA 3O4QA 3VQ5A 3ZT2A 4M45A 3SUPA 5FRNA 1VSEA 3UIQA 4XIUA 4J2AA 4ID5A 4CHZA 2ZE2A 4LH5A 4DFMA 1L3TA 4YNQA 3V6DA 3S3OA 3AO2A 4DU4A 4LH4A 1HYVA 4FZXC 3IAYA 1N5YA 2KFZA 4Z0UA 3LAMA 2XY8A 1TGOA 3AVFA 4CJ5A 5KI6A 4I7FA 4KRFA 3V1OA 4UQGA 1TK5A 2F8SA 3CYMA 4CJTA 4GW6A 4DMNA 3DOKA 3QINA 2Q3SA 3L2UA 4TSXA 1I3AA 3HVRA 3LZJA 4DTRA 1FKPA 1U49A 1IKXA 3DLHA 4RW6A 4DSJA 1YVUA 3QETA 3TAPA 1LAWA 4J2BA 3JSMA 4W5OA 1L3VA 1CXQA 1SL1A 4KI6A 2HNDA 1GOCA 1IKVA 2G8VA 2EHGA 3AO4A 3ISNC 5SZTA 4EZ9A 4M3ZA 1WAJA 1TL3A 3QERA 4KO0A 5J2QA 4CF2A 3SUNA 3AVBA 4Q0BA 4KV8A 1KLMA 2HHUA 1RNHA 4DLEA 3SPYA 1WSJA 3O3GA 4OVLA 3NGIA 3V9WA 1KSPA 4DU1A 4DTSA 3L3UA 4O0JA 3SNNA 4B9TA 1UA1A 4NYNA 2RF2A 3OYCA 1Z25A 1Z26A 4KHYA 1SV5A 3P5JA 3LPUA 3RR7A 4M3TA 4FZYA 3HP9A 3AVHA 3LP0A 3DOLA 3A2FA 4DFKA 3OYDA 1WAFA 3NF6A 2GV9A 4DU3A 4FW2A 4DQIA 4IFVA 3MAQA 4CEQA 3S3NA 3CG7A 4N56A 1ZBLA 1TKXA 2HNZA 4CHOA 4R5PA 2KQ2A 1N6QA 4FJNA 1KLNA 3D45A 1WSGA 3LANA 1S9EA 1VSFA 1QHTA 3HVTA 4WE1A 4ELVA 1Y97A 3QO9A 3EY1A 2KZMA 3KD1E 4Q5VA 3SI6A 4GVMA 4DSLA 3M8RA 4PQUA 4CJFA 3SZ2A 4FM2A 3SQ2A 3ZCMA 1CXUA 2LSNA 1ZYQA 4DQSA 4KB0A 1EXQA 1FKOA 4GMJB 4W5QA 3KK1A 4E89A 4DTMA 3L2VA 3QEWA 3HPHA 2PZSA 1JLGA 3RRGA 4EZ6A 4FYDA 1O1WA 4C8KA 2Z1HA 5FROA 3HSTB 4CK1A 3QEVA 1T8EA 3LPTA 4DSIA 2HHSA 3L2WA 3VA3A 4FJMA 1QSLA 1RTJA 2AJQA 5FRMA 5CYMA 3SQ0A 4KFBA 4YFUA 3HPOA 1S6PA 4AHSA 1RDCA 2HMIA 4ELUA 4BWJA 4FJJA 3VQDA 3SJJA 2E6LA 2IDOA 1B92A 4PA1A 4CGJA 3M8SA 3CFPA 5DK5A 1NK8A 4E7HA 1ZBIA 5K14A 4CFDA 4KHSA 4RW4A 3DRRA 4E3SA 3HPGA 4K8ZA 4L8RB 2XY6A 1F21A 4FCYA 4N76A 4FM0A 3OVNA 2I5JA 3M8PA 2HVIA 1L3SA 1SUQA 1ZBUA 1HYSA 1G15A 3P1GA 3NH0A 4DQPA 1XC9A 2HHXA 3TAFA 2OA8A 1TV6A 2G8WA 5J2PA 4CESA 1RDDA 4AHRA 4JS4A 2HNYA 1HMVA 1QQCA 4I2QA 3VQ9A 1TKTA 3VQ4A 3AVGA 2FBYA 1RILA 3LP2A 3HK2A 2VG5A 1TL1A 1LWCA 1IKWA 1BHLA 3ASMA 4LY7A 1BIZA 4FM1A 1IG9A 4B9VA 3H08A 1NK4A 4J2DA 1ITGA 2D5RA 1BISA 4DTUA 3AA4A 4IG0A 1U48A 3VQCA 4DFJA 4MQ3A 4W5NA 1RBSA 4E19A 4M41A 3NCIA 4F2SA 1HPZA 4FJGA 3NF9A 1QE1A 1T7PA 2X78A 1LW2A 3O3FA 2DTUA 3AA2A 1RTHA 3OYNA 3T3FA 2FBTA 3K5LA 3V9UA 1RTIA 4DTOA 4O4GA 1SKWA 3RMAA 1RBUA 1NOZA 1SKRA 4I2PA 2P5GA 2KZZA 2Z1JA 3HL8A 5C25A 2D0AA 5E41A 1D8YA 3KLFA 4B8CA 1RT1A 3VQPA 4FZZA 4O5BA 4E7JA 3LDSA 1UA0A 2BANA 1JXEA 3I8DA 4FJHA 4E7KA 2HHTA 3SCXA 4FLUA 1B9FA 1D9DA 3AO3A 2WOMA 2HW3A 4C8LA 4CF0A 1RT6A 4KHNA 4CFCA 4KAZA 3NH1A 4M3YA 3TABA 3OJSA 2G8FA 1S1VA 3I0RA 5CZ2A 3O3HA 3KJVA 1X9WA 2Y1IA 1KFSA 4PY5A 1JLBA 2OPPA 5KRTA 4AHVA 1K6YA 4DTJA 4OLBA 1S1TA 2ZD1A 1DTTA 1YTAA 1Q9XA 2BGGA 3IG1A 3SQ1A 4CIEA 2GUIA 1GOAA 4FJXA 4HHTA 3U6FA 3K2PA 3T1AA 3ZSQA 1NK7A 4ID1A 5HRNA 3PX6A 4B9SA 2Z1GA 3DLEA 4FLTA 3K5OA 4N47A 4DSKA 4BDPA 3TAGA 3KKRA 2DFFA 2OPRA 1BIUA 2YKNA 4OKKA 4W5TA 3QNOA 4PWDA 4CEEA 5HP1A 3ULDA 4FJLA 3DYAA 1DTQA 4CIGA 2JGUA 4CF9A 1C0MA 4CEAA 3OYLA 2X74A 2QKBA 1BQNA 3VN5A 5D3GA 3MEEA 1C6VA 3OYHA 4O44A 1VRTA 3IS9A 4O55A 2QK9A 1BCMA 4CF1A 4CK2A 1T05A 5KTQA 3MXMA 3TR8A 3TAQA 1U45A 1TK8A 5HLFA 4FW1A 4KHWA 1WNSA 3WNGA 3CFOA 4RW9A 3ITHA 1LWFA 3RMDA 4FLXA 3ZSVA 1ZBHA 1BI4B 3TAMA 4AILC 3AVKA 3NAEA 3K58A 3ZT1A 4CHPA 3AVNA 2O4IA 3L2QA 4CJQA 4FK4A 3LALA 3SYZA 4FJ5A 3OYKA 3DLKA 1RDBA 3NF8A 4BE1A 1X1PA 3C95A 4ZHRA 4MFBA 4KKOA 2P5OA 4NYFA 2G8IA 1RBTA 5J2MA 2QKKA 1RCHA 3CQ8A 1LWEA 1VSKA 2ITGA 1LW0A 4OKEA 2YKMA 2A1SA 2P51A 4KI4A 1QS4A 1JLFA 3ALYA 4Z4HA 3KLEA 1W9HA 3EZ5A 3ZSXA 5I42A 4EP5A 4DTPA 1NKBA 3L3VA 1MU2A 1NJYA 3IRXA 3HJFA 1NJWA 4Z4EA 1JLAA 2RPIA 1BGXT 3AA5X 4HUGA 5HRPA 2HB5A 4CCHA 4CHYA 4CHQA 1S5JA 4DLGA 4FJIA 2YNIA 3AVMA 3PX4A 4F4KA 4CJ3A 2NUBA 4DSFA 4CJVA 2KTQA 4OJRA 4QAGA 3VQ8A 4IDKA 4M3UA 1L3UA 1JKHA 4E7IA 4CJ4A 3KKSA 3D0PA 4N5SA 1WSFA 3BDPA 2G8UA 4LD0A 4B9NA 2JLEA 2G8HA 3OYFA 1KRPA 3O4NA 1IH7A 1C1CA 1IO2A 4AHCA 3LWMA 3DM2A 1NJZA 1ASWA 4BDYA 5J2NA 1UAXA 3DLGA 3OYEA 1T03A 1TAQA 3BGRA 2W42A 1VSJA 1WN7A 2IS3A 4CEDA 4JLHA 4OGCA 4DTXA 4ELTA 4J2EA 3THVA 3VQEA 1FK9A 4FK2A 4IBNA 2PYJA 2PYLA 3MEDA 3L8BA 3OYGA 4CK3A 4FJ8A 4AH9A 3DI6A 4LSLA 3AA3A 3DLRA 2FBVA 1B9DA 5KGXA 1TKZA 4DS4A 4DTNA 4IKFA 4B08A 1NK6A 3S9HA 2X6NA 1D5AA 3KLIA 3OYAA 3OY9A 3C6TA 1KVBA 2EX3A 1NKEA 1IKYA 3HXMA 4HUFA 3B6OA 3HP6A 2YNHA 1CLQA 3RTVA 3K57A 5FDLA 3VQQA 3ZSZA 1R0AA 1RT7A 4CGHA 2YHAA 2DY4A 4CE9A 4DS5A 1HNVA 1KVCA 4CFAA 3QESA 3AVCA 1RT5A 1CZ9A 2QXFA 4CEFA 1WSHA 3OS2A 4O0IA 4LSNA 1NOYA 2XO7A 4BE0A 4B9UA 3RWUA 4F3OA 3CFRA 2OZSA 4CJKA 4HCBA 1U4BA 4FLYA 4HCCA 1WSEA 3U3YA 1VRUA 3VQ7A 5HBMA 3HO1A 2O4GA 5CZ1A 2IOCA 5HRRA 1RBVA 1A5WA 5JS2A 4H4OA 4E1MA 1S1UA 3SV4A 2B6AA 2XRIA 1NKCA 3MECA 4FVMA 3F9KA 3ZSOA 1TAUA 1I39A 4BACA 2HHQA 3LAKA 3MEGA 1JL1A 2E6MA 3NBPA 4CJLA 4BE2A 3V9SA 1NJXA 4H4MA 1Q9YA 2OPSA 4CEOA 3VA0A 1XHZA 3QIOA 3KLGA 3CM6A 3PO5A 4FLVA 3LP3A 2B4JA 1VK0A 2E4LA 4G1QA 5C24A 4IFYA 3KLHA 3QEPA 2IC3A 4FJ7A 1QSSA 2F96A 4NCAA 4W5RA 3TI0A 4Z4CA 4Z4IA 4ICLA 3TWHA 3VQ6A 1JLQA 4DQQA 3SPZA 3TARA 1XHXA 1S1XA 3NE6A 2XY5A 3LWLA 1XWLA 4FJ9A 2D0CA 1J54A 1RDAA 3V9ZA 4BWMA 1YTUA 3PY8A 2HHVA 1QSYA 2R7YA 2RKIA 1EP4A 3NF7A 3ZT0A 3SV3A 4RW8A 3AV9A 4E0DA 4FXDA 4CHNA 3PX0A 4B3OA 3AO1A 2FBXA 1J5OA 4CEBA 4OLAA 4CIFA 5CYQA 3PV8A 5I3UA 4CF8A 1JLEA 1C1BA 2X6SA 3NGZA 3QLHA 3WNHA 4JRQA 4Z4FA 2HHWA 4CJRA 3WNEA 3SUOA 4K8XA 3FFIA 4Y1CA 3ZSYA 1C0TA 2XHBA 3MXJA 3ZSRA 4OPKA 3HT3A 4DFPA 1SKSA 2G8KA 4KTZA 2BE2A 3VQBA 3WNFA 2IGIA 1C1AA 3K5MA 1HQUA 1VSHA 3OS1A 4DF4A 1HJRA 4Y1DA 3QIPA 3OS0A 2OZMA 4M42A 2HVHA 3RMBA 3DRSA 3AVAA 4FLWA 1KFDA 1NK5A 5JS1A 1TKDA 4NCBA 4CJEA 4QOZB 4E7LA 4KTQA 1JXBA 5DMRA 3NHGA 4DQRA 1KVAA 3EYZA 4JS5A 4NCGA 1S9GA 1NK9A 1TK0A 3OYMA 4KHUA 2ATQA 3KK2A 1ASVA 3TAEA 4CJSA 3V9XA 1VSIA 4QCLA 3LP1A 4FJKA 4BDZA 4ZTFA 1X9SA 4FK0A 4CGDA 4B9LA 1HNIA 4CECA 2FC0A 3C94A 2KFNA 1BL3A 2DFHA 3SUQA 3RMCA 5HROA 4F2RA 2F8TA 1U04A 3OYIA 1S6QA 3OJUA 4I9QA 1DLOA 3I0SA 1XI1A 1ZBFA 4OGEA 4AHTA 1D9FA 3AVJA 1KCFA 3P83D 1J53A 4CGFA 3V4IA 4CEZA 4CGIA 4IG3A 2VWJA 4DG1A 2IAJA 3DRPA 4KREA 4KPYA 2ZQBA 1J9AA 2BDPA 1YT3A 1HQEA 2GBZA 1JL2A 1RTDA 3NDKA 3RR8A 4N41A 3PO4A 3K59A 4M3XA 4M3RA 3G0ZA 3T19A 5KGWA 5HRSA 1CZBA 1GOBA 4H8KA 4CERA 4I9LA 3SQ4A 2VG7A 3CM5A 2YV0X 4KB1A 4Z4GA 1REVA 1EX4A 3KIOA 1VSDA 3DMJA 1BQMA 4CGGA 3F73A 3B6PA 1Q8IA 1UOCA 2OPQA 4FLZA 3RRHA 3G10A 4F3TA 3AVLA 4HVJA 1W0HA 3LZIA 3V1QA 4JRPA 2XY7A 4M3WA 2YNFA 5KRSA 4OPJA 3NH2A 1X9MA 3KK3A 4EP4A 1RT3A 4E1NA 4RW7A 3QEXA 1LV5A 4CJUA 3HM9A 1A5XA 4CJWA 3DLBA 5J1EA 3OYBA 2VWKA 3NGYA 1BCOA 4RG8A 4PUOA 3TANA 1HRHA 1S1WA 1JLCA 4AHUA 1SL0A 4DF8A 3KTQA 4KTWA 3E01A 3VQAA 3ZT3A 3NFAA 3AO5A 1L5UA 3KD5E 3HYFA 3ZSWA 1UWBA 4C8OA 2ETJA 2DFEA 4CFBA 4C8NA 3S3MA 3L2RA 3QNNA 2PY5A 4HUEA 4B9MA 2WONA 3C6UA 4DSEA 2Y1JA 4F8RA 3MXIA 3PUFA 1TVRA 1EKEA 1FXXA 5CY4A 1A5VA 4C8MA 1NK0A 2OYQA 4KHQA 2Z1IA 4DWIA 1ASUA 2D0BA 1EETA 5C42A 3AVIA 3ZT4A
chains in the Genus database with same CATH superfamily
1YAGA 1WSIA 1WLJA 4KH5A 3QEIA 3M8QA 1QTMA 4E1JA 5GAGP 1LOTB 5EU7A 1N8RO 2P1JA 3C65A 3OHRA 3R1XA 4Y0WA 4DV5K 3PIPL 3JYTA 1RBRA 1HYZA 4M45A 2QW9A 4LH5A 5BPMA 1L3TA 1MDUB 1I94K 3MX2A 1CZAN 4KRFA 4UQGA 1TK5A 2F8SA 4DQ8A 3DOKA 1KXPA 3VTHA 3L2UA 4CZIA 1YVUA 4J2BA 4HTLA 3JSMA 4GV3A 2KKZA 4BRHA 4KI6A 1GOCA 3N4PA 5J2QA 1GLDG 3SUNA 2NRVA 1BDGA 3AVBA 3LDPA 3ZETA 1RNHA 2RE2A 3M5RA 3SPYA 5GAHP 2ZWHA 2PFUA 4B9TA 4JKGB 2QWNA 3U4LA 2RF2A 3EZWA 3OYCA 2NRTA 4M3TA 2P9LA 3HP9A 3AVHA 4BRIA 1WAFA 3NF6A 2GV9A 4DU3A 4FW2A 3T69A 3MAQA 1NGHA 2O8FA 3THWB 1N6QA 1QHTA 4WE1A 2KZMA 1Y97A 1TYQB 4GVMA 5JVGL 1CXUA 3UKRA 1ZYQA 5AQOA 1FKOA 1KAZA 4W5QA 4V19S 4E89A 4PHTX 3E1YA 1O1WA 2AA4A 4HWIA 4JI6K 2QWMA 5LMUK 4CK1A 1T8EA 3R3LA 2VWBA 2AJQA 5FRMA 5CYMA 1S6PA 5M1OA 2HMIA 4ELUA 3QFPA 4FJJA 3VQDA 4PA1A 4H5WA 3NVKA 1NK8A 4K25A 5K14A 4H0VB 2QTDA 3VGLA 4L8RB 2XY6A 1GLFO 3CJ9A 1XNQK 1ZBUA 3ZX3A 5KPZA 3HRGA 3NH0A 4DQPA 1ATSA 5H1SQ 1RDDA 2HNYA 5GADP 1RDWX 2VG5A 1TL1A 4PKGA 3SK3A 3P31A 1BISA 4DTUA 3AA4A 4IG0A 3VQCA 1YXQA 4MQ3A 1RBSA 4B3MK 1K8KA 2YHWA 3NF9A 3VEZA 1T7PA 4BRMA 3AA2A 3O6WA 4RCHA 5AZJA 2GELA 4BRCA 2Z1JA 2KZZA 4FOEA 4F9OA 4E7JA 3LDSA 4JK9A 1B9FA 3SBTA 4JKAA 1XMOK 1D9DA 2HW3A 4CF0A 1WB9A 2GUPA 1T3VA 2ZJPL 2CGJA 1S1VA 3O3HA 2EWSA 3J8AA 1KFSA 3FGUA 3CC4N 2P9SB 5KRTA 1Q82O 1TUYA 3IG1A 2PBDA 2GTDA 4BC5A 4BR0A 4HHTA 3LM2A 3K5OA 3TAGA 4OKKA 3DXMA 5HP1A 3ULDA 1VQPN 2WBNA 3VN5A 3ULEA 5D3GA 1C6VA 4O44A 1VRTA 3IS9A 3MN6A 1E3MA 4EAHD 5FPEA 2IVPA 1WNSA 4RW9A 3RMDA 3ZSVA 1ZBHA 3TAMA 2P9UA 3A5NC 3AVKA 3OBWA 4IDHA 4CHPA 2UXDK 4FK4A 3LALA 3SYZA 4FJ5A 3DLKA 1T44A 5I9EB 4MFBA 2OANA 3VETA 4CW7B 2G8IA 3VEXA 1VSKA 5TKYA 1QS4A 3ALYA 1W9HA 3ZSXA 3LM9A 4AF1A 3IRXA 1JLAA 2A6AA 1VHXA 2P9IA 2ZF5O 4DLGA 4FJIA 2E2NA 3I8BA 3G71N 4CJ3A 3EN9A 4CJVA 3EEQA 3VQ8A 4IDKA 4DV7K 1OH7A 3MMVA 5AFUH 1L3UA 4E7IA 3KKSA 1YJ9N 5LJVA 2I7PA 3OYFA 4O5FA 4CZLA 3ZETB 3VMFB 2NRXA 3U8XA 1VQ5N 1NJZA 4I6MA 1TAQA 3BGRA 1YUWA 2ASPA 1J6ZA 2P9LB 1S72N 3JAMO 2QWRA 3HTVA 3CC7N 3QBXA 4NLBA 3CQXA 4IKFA 4B08A 1D5AA 3OYAA 5EVZA 2O8FB 3O1WA 5JLHA 1OKJA 3HXMA 3HP6A 3BUZB 3F5TA 3VQQA 3ZSZA 1RT7A 3UKRB 2YHAA 4A57A 3CHWA 4CE9A 4DS5A 3QESA 1KD1O 2QXFA 1WSHA 2QEXN 4DV0K 1SS6A 3KZBA 2Q1NA 4B3SK 4HCCA 1HJOA 3VQ7A 5HBMA 5CZ1A 3BZCA 3TTFA 1EWQA 1A5WA 2E8AA 3QMLA 1S1UA 3OW2M 3F9KA 2V51B 2FSJA 4MO4A 1JL1A 1NJXA 4H5TA 4BR7A 1NWKA 1JJ2M 3CCVN 3QIOA 4BRKA 1KAYA 5DM6L 1VK0A 4G1QA 2F96A 5AQQA 4NCAA 3C6AA 1S3XA 3VF4A 4FWPA 2AP1A 3VQ6A 4DQQA 4NO7A 2XY5A 1HPMA 2QWLA 4FJ9A 1VAZA 1K8KB 3V9ZA 2NRHA 1YTUA 2V7ZA 3SV3A 4BRFA 3AO1A 3M1FA 4OLAA 1RFQA 5AQYA 5AZJB 3PV8A 3FR0A 5IT9O 1JLEA 2X6SA 3CCEN 4DKWA 4JRQA 3WNEA 3BF1A 5F1XA 2KHOA 2G8KA 2BE2A 1JCGA 2IGIA 1HQUA 4DF4A 1NNEA 3CIPA 1YHQN 4M42A 3RMBA 4DR1K 1NGBA 4KTQA 4CZHA 3I33A 4DQRA 1KVAA 3EYZA 3IDHA 4JS5A 4NCGA 4KHUA 4CVNE 3KK2A 1K73O 5AQIA 1VSIA 3PLAA 4WFBL 4BDZA 4JI7K 4YOXA 2D0OA 3DXMB 4IXCA 3SUQA 3RMCA 1U04A 4WCEL 1ZBFA 4OGEA 2ZM6K 3ULEB 1D9FA 4H5NA 1W2BM 3VGMA 4IG3A 5JLFA 1NM1A 4XH1A 3NDKA 4N41A 3LDOA 4M3XA 4M3RA 3EKSA 2P9UB 5HRSA 4LF5K 2W6KA 1IG8A 2YV0X 4KB1A 1EX4A 3KIOA 3DMJA 4ELVA 3RRHA 3B6PA 4FLZA 3LZIA 3O9UA 4OO1J 3V1QA 4JRPA 4OPJA 4IFEA 4B1XB 3KK3A 3MN5A 4RW7A 3NGYA 4WFNL 1JLCA 3W3DA 1SL0A 1YF5L 4JYAK 1L5UA 2UXBK 2P9IB 3ZSWA 2ETJA 4MLHA 3IUCA 4C8NA 2E2OA 5AQGA 3L2RA 4B9MA 3RSEA 3WUHA 1FXXA 2OYQA 4C8MA 4DWIA 1ILYA 2D0BA 5C42A 3MWTA 3AVIA 4JD2A 3NVMA 3WXLA 2YHBA 2RN2A 2F9TA 1QQOA 4CJPA 2HF3A 3K5NA 4I6MB 1KTQA 1RT2A 3O4QA 3VQ5A 2W41A 4H5VA 4BREA 1VSEA 4J2AA 1U6ZA 4M63C 4BR4A 2Q97A 1G99A 2CGKA 3AO2A 1N5YA 4MLEA 4LF9K 4B1VA 5KI6A 5AQKA 4CZGA 1OH5A 3CYMA 2F7TA 4CJTA 3SLCA 1U49A 1FKPA 3DLHA 1IBMK 1L3VA 4BROA 2HNDA 4M3ZA 3AO4A 3ISNC 4KO0A 3CCUN 2FSNA 4CF2A 3V9WA 1GLAG 3NGIA 4DU1A 2YX6A 3L3UA 3IFRA 3K0SA 1UA1A 4JKCA 5EY4A 4KHYA 1SV5A 3LPUA 2NZTA 3QDKA 3A2FA 2W40A 3CMAN 3CJAA 3S3NA 5C2DA 1BOTO 4N56A 1ZBLA 1TKXA 3WQUA 2KQ2A 3QO9A 4CJ7A 3KD1E 3D2FA 4PQUA 3GE1A 4CJFA 4C1NI 3ZYYX 1VQ7N 1EXQA 4DTMA 1KSPA 4KB0A 4LC9B 4K8ZA 3L2VA 3HPHA 4C1NK 3WQTA 5M1FA 3SQ0A 4KFBA 3SMSA 4AHSA 2W6LA 5AQLA 4U67L 4BWJA 3UE5A 4WQ4C 3S41A 3CFPA 1SZ2A 4KHSA 1XQSC 2QM1A 3HPGA 1X3MA 3OVNA 3M8PA 1SUQA 4R79A 3VF6A 3BP8A 2HHXA 1BA0A 1MWMA 5ELZA 1NGCA 4AHRA 4H0OA 1HMVA 4JKBA 3VQ9A 1VQ4N 4PKIA 1DEJA 4MDAA 4JI2K 1IKWA 3ASMA 3UB5A 4FM1A 5M1QA 1ITGA 2FSKA 2O8BA 3C0BA 4DFJA 3EE9A 4W5NA 2IIRA 1E4GT 1HPZA 4FJGA 2X78A 1LW2A 3CCJN 2DTUA 2E1YA 3H3NO 1N36K 3K5LA 5AQJA 4BRQA 3O1BA 4CZMA 1SKWA 3CXCM 3O9SA 2P5GA 3HL8A 2D0AA 5E41A 3KLFA 2YCHA 5AQFA 3VQPA 4O5BA 4FJHA 2HHTA 4E7KA 1TUUA 2QWQA 5B8HA 4C8LA 3ZX2A 1XUPO 5M1KA 3D2EA 4CFCA 1X3NA 3TABA 3PSFA 3OJSA 2G8FA 3MWPA 5CZ2A 2FLOA 3KJVA 5C2FA 2ZGYA 4AHVA 4DTJA 1S1TA 1Q9XA 1DTTA 1QZ5A 3U9DA 1NK7A 3U6FA 1Q18A 2Q0RA 3GDQA 1ATNA 2YKNA 3DYAA 1DTQA 2Q0UA 3P4IA 4CEAA 1WOQA 5KPTA 5FPDA 3OYHA 5EX5A 1Q7YO 4O55A 4IWVA 4CK2A 2HSTA 3RSEB 3CC2N 5KTQA 3MXMA 3TAQA 4JKHA 4FSVA 3THYA 4FW1A 1NLVA 1WBDA 2H3GX 3ITHA 1ZXOA 4JD2B 3NAEA 4PL7A 3AVNA 1NG9A 4KKOA 4A2AA 1RBTA 5J2MA 1EQYA 1LW0A 3FE1A 3NMUA 1DGKN 1JLFA 1XMQK 2QA4N 5I42A 3O9QA 2E2QA 2ZJQL 4DTPA 1NKBA 3F9MA 3HJFA 3A5LC 2RPIA 4LFBK 3AA5X 3AARA 3MCAB 1S5JA 3CPEA 2BH1A 2NUBA 4QS9A 4OJRA 3CMEN 2VQEK 2CGLA 1JKHA 3O80A 4CJ4A 5F0XA 4LD0A 2JLEA 1KRPA 1BA1A 3PSIA 5LMNK 1C1CA 1IO2A 4L3QA 3DM2A 4DV1K 4OPAA 1VSJA 4YORA 4JLHA 4OGCA 1XNRK 4DR2K 3THVA 3VQEA 5AQTA 2PYLA 3MEDA 3ID8A 4CK3A 4F3TA 3DI6A 5KGXA 3AA3A 1B9DA 3TTCA 1TKZA 3KLIA 4CD1A 3C6TA 5AFUA 2NRRA 4IO9L 2IVNA 3D2FB 1ZBSA 5HL7L 4WQ4A 2DY4A 4B1YB 1NU0A 1HNVA 1KVCA 3C7NA 3CPWM 4XEIA 3LL3A 4DR7K 4AQYK 4BE0A 3THXA 3RWUA 3TU5A 2OZSA 4DR4K 1XC3A 3CERA 4CJKA 4FOIA 4WYBA 3B8AX 4FWKA 2O4GA 5FPNA 2IOCA 4H4OA 5C0YA 4JKFA 2B6AA 3E66A 4G9ZA 3M3ZA 5AQXA 3ZSOA 4BC2A 1I39A 4CZEA 1K9MO 2HHQA 2E2PA 2E6MA 3V9SA 4B1ZA 1NMNA 1IBKK 2O8EA 3KLGA 3CM6A 3LP3A 4DUZK 1EETA 3VTIA 4W5RA 3EE8A 4ICLA 3SPZA 1JLQA 3TARA 1XHXA 4NLCA 2O8BB 2D0CA 3WT0A 5A2QO 4BWMA 2HHVA 1QSYA 2RKIA 1OH6A 1EP4A 3NF7A 3ZT0A 4RW8A 4FXDA 4CHNA 4FWLA 4B3OA 4BRAA 1J5OA 3EKUA 4CIFA 5CYQA 4CF8A 1C1BA 5EOYA 3QLHA 3R8EA 3WNHA 2HHWA 4K8XA 3FFIA 1C0TA 2XHBA 3MXJA 4OPKA 4DFPA 3D2EB 3WNFA 1C1AA 1VSHA 3N4QA 4JNEA 4Y1DA 3OS0A 2OZMA 3DXKA 4CJEA 4E7LA 1KC8O 1JXBA 5CR4A 4Z94A 1NK9A 3OYMA 4WFAL 3V9XA 3J7AP 3GG4A 4JV5K 5BRDA 4FK0A 4CGDA 2KFNA 4CECA 1BL3A 4F2RA 4BGBA 2F8TA 1S6QA 1NMDA 3I0SA 1VQ8N 4BVPA 5GINA 1KCFA 3LDQA 3V4IA 4CGIA 1HNWK 3SBGA 3TTDA 3THYB 4KREA 2NLXA 2BDPA 1YT3A 3HBTA 2GBZA 3K59A 5KGWA 1CZBA 3SQ4A 4CGGA 3RMAA 1Q9YA 1S22A 2P9PA 5AQWA 2OTJN 2XY7A 5LL6Z 5KRSA 4EP4A 1RT3A 4E1NA 1LV5A 3DLBA 2NRWA 4CJUA 2VWKA 3A5MC 4PUOA 3TANA 1S1WA 1HRHA 1QQMA 4KTWA 3KVGA 3ZT3A 5JMVA 3KD5E 3HYFA 3T7ZA 1NGJA 4CFBA 3S3MA 5DM7L 3QNNA 3FZKA 2PY5A 2WONA 4DSEA 1H1VA 2Y1JA 1EKEA 5CY4A 1NK0A 2Z1IA 4GV6A 3ZT4A 1SL2A 5BRFA 1BI4A 4ILHA 4QS8A 2Q36A 2D0PA 3V1RA 2B5JA 2YNGA 5SWMA 4HTUA 5GIPA 2KW4A 3OYJA 1C0UA 3V81A 4B8AB 5T7BA 1VSLA 3SUPA 5FRNA 4XIUA 4BC4A 4CHZA 4O8KA 4DFMA 5AZIA 3V6DA 3S3OA 1HR0K 2KFZA 5AQMA 4Z0UA 3LAMA 2XY8A 3AVFA 3FZHA 4DUYK 4IJAA 4TSXA 4DTRA 1SAZA 1IKXA 4DSJA 4RW6A 3QETA 1DKGD 3TAPA 1LAWA 1K8AO 4W5OA 1SL1A 5GAEP 1NBWA 2G8VA 2EHGA 3C7NB 3L4IA 1IV0A 4QS7A 4IEEA 2JWLA 3H46O 4Q0BA 2UUBK 4KV8A 3THXB 1KLMA 2HHUA 4BVOA 4OVLA 3SNNA 4MO5A 5JVHL 1Z25A 3P5JA 4C23A 3RR7A 4H0TB 3DOLA 3OYDA 3A0IX 1R59O 4CEQA 3CG7A 2HNZA 5AR0A 1WSGA 1VSFA 3W0LA 3BEXA 3EY1A 3ENHA 4DSLA 3M8RA 2HBKA 2I7NA 3ZCMA 3SAFA 3SQ2A 1YJNN 2E5LK 2P9KA 2PZSA 4GMJB 4RWTA 3QEWA 1ZC6A 5FROA 3HSTB 3QEVA 3LPTA 4JI5K 4NB4A 1VQMN 1QSLA 1RTJA 3HPOA 3RVCA 1YI2N 1MA9B 3SJJA 1VQLN 2IDOA 2IVOA 5AQZA 3M8SA 4CGJA 3H6EA 3JS6A 5DK5A 4E7HA 4CFDA 3J7ZO 3DRRA 5E26A 1F21A 2UUAK 4FCYA 4N76A 4FM0A 4CZJA 3T1YK 1VQKN 1XC9A 3TAFA 3JXUA 4YHHK 4JS4A 1GLLO 1QQCA 4I2QA 2VCPA 1P90A 1TKTA 3VQ4A 2HMPA 3DXKB 2FBYA 1RILA 3LP2A 1BHLA 4LY7A 3HI0A 4OPHA 4J2DA 3WXKA 2QWPA 3FZMA 1NGFA 5C10A 4FWMA 1HLUA 4BG8A 4M41A 4DCHA 1Q81O 4F2SA 4KHPK 1QE1A 1HUXA 2VYPA 5BPLA 3OYNA 2FBTA 2Q2RA 3V9UA 4DTOA 2BTFA 2HOEA 3VEWA 3PIOL 1NOZA 5AQUA 5C25A 1D8YA 1HNXK 4B8CA 1RT1A 4FZZA 3R6MA 2A40A 3O08A 3I8DA 1JXEA 4FLUA 2WOMA 4IJNA 4KHNA 4FWQA 4FPBA 4JI8K 4M3YA 4H03B 1X9WA 4PY5A 2OPPA 1GLBG 2P9PB 4IOXA 4K0KK 1GOAA 4FJXA 3CCLN 1FJGK 2P9NA 3M6GA 5HRNA 4B9SA 3DLEA 3ZEUA 3OA9A 3O8MA 4N47A 4FLTA 3CF5L 4EHUA 2ZGZA 4PWDA 3QFUA 2YI1A 3QNOA 2QI2A 1OH8A 2HHHK 1BO5O 4CIGA 4CF9A 1C0MA 3OYLA 3D6RA 4BR2A 4EIAA 2QKBA 4IOAL 2Q31A 3QBWA 4CF1A 1T05A 1VQNN 1U45A 1TK8A 5HLFA 4PKHA 4DV6K 1HKCA 3DLLL 1QVGM 4YOVA 2E20A 4FLXA 1BI4B 4LF8K 1C0GA 1HX1A 2J4RA 3ZT1A 2O4IA 3L2QA 4EFHA 3NF8A 4BE1A 4JI0K 1X1PA 3C95A 4YOUA 2P5OA 4NYFA 5AQNA 2QKKA 1RCHA 5FLXO 4FPAA 4OKEA 5AZIB 2YKMA 4KI4A 3L6QA 3KLEA 3EZ5A 4DV2K 3ZX0A 1V4TA 3VEOA 1NJWA 4Z4EA 5F2RA 4HUGA 5HRPA 3TSQA 4CCHA 4CHYA 1KQSM 4CHQA 4FL9A 3L4QA 4H0YB 2KTQA 4QAGA 4M3UA 1JCEA 3D0PA 4BRNA 1WSFA 3BDPA 4B9NA 4FWRA 3J81O 3O4NA 3LWMA 1X9JA 1ASWA 4BDYA 5J2NA 1UAXA 3DLGA 3OYEA 2O8DA 1T03A 2W42A 1WN7A 4CEDA 3G25A 4LF6K 4ELTA 2HBMA 4J2EA 1FK9A 3HOTA 4ILJA 3L8BA 3OYGA 4FJ8A 3AY9A 4LSLA 4DTNA 2FBVA 1W7AA 2X6NA 1P8ZA 3HSCA 5CHIA 3OY9A 3VF2A 3I56N 4DV4K 5BR8K 1CLQA 3RTVA 3K57A 3A5OC 2RHKA 2P9KB 3AVCA 1MWKA 4CEFA 3VGKA 3OS2A 1NOYA 4LSNA 4BC3A 2XO7A 4B9UA 4BR9A 4F3OA 4HCBA 5BN9A 1U4BA 5AQPA 2GEMA 1WSEA 3A8YA 3HO1A 5HRRA 1M90O 5BPNA 4E1MA 3E9OA 5HOOA 4X65K 5LY3A 3H1VX 1NKCA 1LCUA 4FVMA 4CJLA 3MX5A 3MDQA 3KK7A 3ZLJA 4H4MA 5AJ3K 4NXNK 1RGIA 2FXUA 4CEOA 3VERA 4CBWA 3PO5A 3CCSN 5CE3A 4FLVA 4GKJK 2B4JA 5C24A 4YOTA 3KLHA 1NGDA 4FJ7A 2WFBA 2V7YA 3TWHA 4FWSA 3OBYA 1S1XA 3NE6A 1M1KO 4AM6A 1BG3A 1XWLA 5M1PA 1J54A 1RDAA 3PY8A 3VOVA 2UXCK 4CZKA 4A5BA 2R7YA 3SMPA 4E0DA 3WEEA 3CCMN 4B3TK 3ID6A 1C0FA 5I3UA 4CJRA 3SUOA 3ZSYA 1NGEA 5AQRA 3ZSRA 3HT3A 1SKSA 4KTZA 4ISGA 4BG9A 3OS1A 3QIPA 3DRSA 4FLWA 1N33K 1KFDA 1WUAA 5JS1A 4NCBA 4IOCL 1Z6RA 1NGAA 1S9GA 1GLCG 1TK0A 3CCRN 2FF6A 1ASVA 4QCLA 2P9NB 4CJSA 3LP1A 4FJKA 1O13A 3ZEUB 4ZTFA 4CD3A 4B9LA 1HNIA 2FC0A 3C94A 2V52B 2HBJA 2DFHA 4PL8A 4CBUA 4DV3K 3F2KA 3QB0A 3OYIA 1HKGA 3OJUA 2F9WA 1DLOA 4EHTA 3CD6N 3AVJA 3P83D 3CJBA 4CGFA 3BZKA 2IAJA 2JWKA 4X62K 4KPYA 3U9ZA 4A2BA 4A62A 1HQEA 1J5EK 2UYTA 4DR6K 3PO4A 3T19A 2QWOA 1GOBA 3KWIA 3QICA 5IWAK 4I9LA 3CM5A 1NJIO 5BN8A 1REVA 1BQMA 1Q8IA 3G10A 4HVJA 1W0HA 4B1WB 2YNFA 4X66K 1X9MA 5C15A 1NGGA 3QEXA 3HM9A 1A5XA 3OYBA 4GV9A 3CJCA 1BCOA 4RG8A 4DB3A 4ISEA 4AHUA 1NGIA 4DF8A 3KTQA 3E01A 3AO5A 4C8OA 3EL2A 4M7XA 3MXIA 1TVRA 3Q7CA 1FW6A 4OKJA 1LAVA 2VG6A 3K9KA 1RT4A 3U3GA 3OTOK 1U47A 3BF3A 4JI4K 4BRDA 4ZTJA 4FWNA 4FWOA 2O8DB 1VSMA 3ZT2A 3UIQA 4ID5A 2CH6A 2ZE2A 4YNQA 4DU4A 4LH4A 1HYVA 3FZLA 4FZXC 3IAYA 1TGOA 4CJ5A 4I7FA 3V1OA 4GW6A 4DMNA 3QINA 2Q3SA 1I3AA 3HVRA 3LZJA 4KAZA 4KBOA 4BRLA 4DR5K 2A5XA 2A41A 4BR5A 1CXQA 1KAXA 3ATUA 5KQ8A 1IKVA 4EZ9A 5SZTA 1WAJA 3P39A 1TL3A 1YJWN 3QERA 1QZ6A 3HM8A 3VEYA 3AGRA 2D1KA 3UKUA 3HZ6A 4LF4K 5GIOA 4DLEA 1WSJA 3O3GA 4DTSA 5JICA 4O0JA 3H1QA 4NYNA 1Z26A 3WXMB 4FZYA 3LP0A 4CI6A 4DFKA 3G6EN 4JI3K 4DQIA 4IFVA 3GBTA 4CHOA 4R5PA 4FJNA 1KLNA 3D45A 3LANA 1EWRA 1S9EA 4M3WA 4BQLA 3HVTA 4Q5VA 3SI6A 5AQHA 3SZ2A 4FM2A 3K9JA 1W97L 2LSNA 3D7EO 4DQSA 3KK1A 1T6CA 1JLGA 3RRGA 4EZ6A 4FYDA 5BRHA 4C8KA 2Z1HA 2WC9A 3AGKA 4JK8A 4DSIA 3KWGA 2HHSA 3L2WA 3VA3A 4FJMA 4O8UA 2WTUA 4YFUA 5BR9A 1RDCA 3DWLA 3WEEB 1N34K 2E6LA 4RTFD 1B92A 1ZBIA 2HF4A 4RW4A 4LFCK 4E3SA 2F4VK 2I5JA 2HVIA 1L3SA 1HYSA 1G15A 3P1GA 4B3RK 2OA8A 1TV6A 2G8WA 5J2PA 4CESA 4K43A 3R9PA 1QVFM 4GKKK 3AVGA 4DHYA 3HK2A 4JN4A 1LWCA 4WF9L 1BIZA 1IG9A 3SAHA 1IBLK 4B9VA 3H08A 4IEIA 1NK4A 1U2VA 2D5RA 1U48A 5AQSA 4E19A 5M1NA 4BY9C 3NCIA 4A59A 1YITN 3CETA 3O3FA 3BY5A 1RTHA 3IKMA 3T3FA 1ATRA 1GLJO 1RTIA 4O4GA 2VQFK 1RBUA 2YJEA 4DR3K 1SKRA 4I2PA 1VQON 3T1HK 4GVEA 3P38A 3LDLA 1UA0A 2BANA 1OVQA 1RDUA 3SCXA 3AO3A 3CJ1A 3VESA 1RT6A 3L0QA 3NH1A 4J8FA 3I0RA 5TKWA 3E9PA 2GX9A 2Y1IA 4BRPA 1JLBA 1K6YA 4OLBA 1VQ6N 2ZD1A 1YTAA 2WUSA 2BGGA 3ATVA 4XH4A 4CIEA 3SQ1A 4B1UB 2GUIA 4YOWA 2HBLA 3K2PA 3T1AA 5FPMA 3ZSQA 4ID1A 3PX6A 3G4SN 2ASOA 2Z1GA 2YHXA 1Y64A 3C6HA 4K41A 4BDPA 4DSKA 4KH6A 3KKRA 2DFFA 2OPRA 1BIUA 3IMXA 4W5TA 4CEEA 4FJLA 2JGUA 2X74A 5AQVA 4JHDA 1BQNA 2GWKA 3MEEA 2QK9A 1BCMA 3MK6A 3TR8A 4WQ5C 4KHWA 1OVYA 1BU6O 3WNGA 3CFOA 1IJJA 1LWFA 4GY2B 3TSUA 4AILC 4ILGB 3K58A 4NXMK 1V4SA 4CJQA 3OYKA 4KH4A 1RDBA 4JK7A 4BQZA 4ZHRA 4IZ9A 2O8CA 2O8EB 3CQ8A 1LWEA 2ITGA 2A1SA 2P51A 3VPZA 1BUPA 2ITMA 4Z4HA 4BRGA 4EP5A 3L3VA 4YDUC 1MU2A 1NJYA 4FO0A 2OTLN 1BGXT 5EXWA 4YOYA 2HB5A 2A3ZA 3Q7BA 4X64K 2YNIA 2VGNA 3AVMA 3PX4A 4F4KA 4DSFA 4IO8A 4JI1K 2KLAA 2E1ZA 3LDNA 4N5SA 2YHYA 2G8UA 3UKUB 2G8HA 3MCPA 1IH7A 4AHCA 2ASMA 5BREA 4H5RA 2BUPA 2IS3A 4DTXA 3VEVA 4FK2A 4GNIA 4IBNA 2PYJA 4AH9A 3DLRA 4DS4A 1NK6A 3S9HA 5C12A 3DJCA 1QQNA 1KVBA 3WXJA 2EX3A 1NKEA 1IKYA 4HUFA 3B6OA 2YNHA 1EO1A 3FLCO 3ENOA 5FDLA 1HKBA 1R0AA 2CH5A 4CGHA 4CFAA 1RT5A 1CZ9A 4UY8O 3MN9A 2NNWA 4CZFA 4O0IA 3CFRA 3ENBA 4FLYA 3U3YA 2NRZA 1VRUA 3H3OB 4JKGA 1RBVA 5JS2A 3DAWA 3SV4A 3FFKB 1SQKA 1T6DA 2XRIA 3MECA 1TAUA 4BACA 5ADXA 3LAKA 3MEGA 3O5BA 4BE2A 3NBPA 3J7YP 2A42A 4B9QA 3TSPA 3GOIA 2YJFA 2OPSA 5LJWA 3VA0A 3THWA 1VQ9N 1XHZA 3CI5A 4CBXA 1TYQA 2E4LA 3O9RA 2VGMA 4IFYA 3QEPA 2IC3A 1QHAA 1QSSA 3TI0A 2PAVA 4Z4CA 2FF3B 4Z4IA 3WXIA 1U2VB 2D4WA 4U7BA 3LWLA 3MN7A 3TPQA 1WBBA 3GL1A 3AV9A 1HNZK 3KHYA 3CQYA 3PX0A 2FBXA 4CEBA 1GLEG 1JCFA 3NGZA 4JEPA 3EO3A 4LF7K 4Z4FA 5E84A 4Y1CA 1N32K 3E9LA 3VQBA 3K5MA 3I55N 4BGAA 1HJRA 2OCEA 4JKDA 2HVHA 3AVAA 3O9TA 1YIJN 1NK5A 4K42A 1TKDA 4QOZB 1ESVA 4ISFA 5DMRA 3NHGA 4M7YA 4WQ5A 2ATQA 3TAEA 1BWFO 1X9SA 3AAQA 4LFAK 5KPRA 5HROA 4I9QA 2GWJA 1XI1A 3O4WA 4JHDB 1Q86O 4AHTA 5KQDA 2ZJRL 4AM7A 1E4FT 1D4XA 1J53A 4CEZA 2VWJA 4DG1A 3DRPA 4YY3K 1Z05A 2ZQBA 1J9AA 1YVNA 4JAXA 3SJHA 3RR8A 1JL2A 1RTDA 3G0ZA 4A5AA 4YDUA 4MDBA 4H8KA 4CERA 4FVUA 2VG7A 2P9SA 3H45C 4Z4GA 3F73A 2A1RA 1VSDA 4H0PA 1UOCA 2OPQA 3AVLA 5ADXH 2O8CB 1DT9A 2UU9K 2QXLA 3CCQN 3VENA 3NH2A 3CJ7A 3J80O 4H0XB 3FZFA 4CJWA 2UUCK 5J1EA 5MLCQ 4A61A 3VQAA 3NFAA 3SAGA 1UWBA 3HOSA 2DFEA 3AAPA 4HUEA 3C6UA 4OX9K 4F8RA 2E88A 3PUFA 4KHQA 1A5VA 4XH5A 2DPNA 4JKEA 1ASUA
chains in the Genus database with same CATH topology
1SL2A 1WSIA 1WLJA 4OKJA 1BI4A 3QEIA 3M8QA 1LAVA 1QTMA 3V1RA 2VG6A 2A1RA 2B5JA 2YHBA 2RN2A 2YNGA 5EU7A 5SWMA 1RT4A 2P1JA 3U3GA 2KW4A 4HTUA 1U47A 3OYJA 4CJPA 1C0UA 3V81A 4B8AB 5T7BA 4ZTJA 3K5NA 3JYTA 1RBRA 1KTQA 1RT2A 1VSLA 1HYZA 1VSMA 3O4QA 3VQ5A 3ZT2A 4M45A 3SUPA 5FRNA 1VSEA 3UIQA 4XIUA 4J2AA 4ID5A 4CHZA 2ZE2A 4LH5A 4DFMA 1L3TA 4YNQA 3V6DA 3S3OA 3AO2A 4DU4A 4LH4A 1HYVA 4FZXC 3IAYA 1N5YA 2KFZA 4Z0UA 3LAMA 2XY8A 1TGOA 3AVFA 4CJ5A 5KI6A 4I7FA 4KRFA 3V1OA 4UQGA 1TK5A 2F8SA 3CYMA 4CJTA 4GW6A 4DMNA 3DOKA 3QINA 2Q3SA 3L2UA 4TSXA 1I3AA 3HVRA 3LZJA 4DTRA 1FKPA 1U49A 1IKXA 3DLHA 4RW6A 4DSJA 1YVUA 3QETA 3TAPA 1LAWA 4J2BA 3JSMA 4W5OA 1L3VA 1CXQA 1SL1A 4KI6A 2HNDA 1GOCA 1IKVA 2G8VA 2EHGA 3AO4A 3ISNC 5SZTA 4EZ9A 4M3ZA 1WAJA 1TL3A 3QERA 4KO0A 5J2QA 4CF2A 3SUNA 3AVBA 4Q0BA 4KV8A 1KLMA 2HHUA 1RNHA 4DLEA 3SPYA 1WSJA 3O3GA 4OVLA 3NGIA 3V9WA 1KSPA 4DU1A 4DTSA 3L3UA 4O0JA 3SNNA 4B9TA 1UA1A 4NYNA 2RF2A 3OYCA 1Z25A 1Z26A 4KHYA 1SV5A 3P5JA 3LPUA 3RR7A 4M3TA 4FZYA 3HP9A 3AVHA 3LP0A 3DOLA 3A2FA 4DFKA 3OYDA 1WAFA 3NF6A 2GV9A 4DU3A 4FW2A 4DQIA 4IFVA 3MAQA 4CEQA 3S3NA 3CG7A 4N56A 1ZBLA 1TKXA 2HNZA 4CHOA 4R5PA 2KQ2A 1N6QA 4FJNA 1KLNA 3D45A 1WSGA 3LANA 1S9EA 1VSFA 1QHTA 3HVTA 4WE1A 4ELVA 1Y97A 3QO9A 3EY1A 2KZMA 3KD1E 4Q5VA 3SI6A 4GVMA 4DSLA 3M8RA 4PQUA 4CJFA 3SZ2A 4FM2A 3SQ2A 3ZCMA 1CXUA 2LSNA 1ZYQA 4DQSA 4KB0A 1EXQA 1FKOA 4GMJB 4W5QA 3KK1A 4E89A 4DTMA 3L2VA 3QEWA 3HPHA 2PZSA 1JLGA 3RRGA 4EZ6A 4FYDA 1O1WA 4C8KA 2Z1HA 5FROA 3HSTB 4CK1A 3QEVA 1T8EA 3LPTA 4DSIA 2HHSA 3L2WA 3VA3A 4FJMA 1QSLA 1RTJA 2AJQA 5FRMA 5CYMA 3SQ0A 4KFBA 4YFUA 3HPOA 1S6PA 4AHSA 1RDCA 2HMIA 4ELUA 4BWJA 4FJJA 3VQDA 3SJJA 2E6LA 2IDOA 1B92A 4PA1A 4CGJA 3M8SA 3CFPA 5DK5A 1NK8A 4E7HA 1ZBIA 5K14A 4CFDA 4KHSA 4RW4A 3DRRA 4E3SA 3HPGA 4K8ZA 4L8RB 2XY6A 1F21A 4FCYA 4N76A 4FM0A 3OVNA 2I5JA 3M8PA 2HVIA 1L3SA 1SUQA 1ZBUA 1HYSA 1G15A 3P1GA 3NH0A 4DQPA 1XC9A 2HHXA 3TAFA 2OA8A 1TV6A 2G8WA 5J2PA 4CESA 1RDDA 4AHRA 4JS4A 2HNYA 1HMVA 1QQCA 4I2QA 3VQ9A 1TKTA 3VQ4A 3AVGA 2FBYA 1RILA 3LP2A 3HK2A 2VG5A 1TL1A 1LWCA 1IKWA 1BHLA 3ASMA 4LY7A 1BIZA 4FM1A 1IG9A 4B9VA 3H08A 1NK4A 4J2DA 1ITGA 2D5RA 1BISA 4DTUA 3AA4A 4IG0A 1U48A 3VQCA 4DFJA 4MQ3A 4W5NA 1RBSA 4E19A 4M41A 3NCIA 4F2SA 1HPZA 4FJGA 3NF9A 1QE1A 1T7PA 2X78A 1LW2A 3O3FA 2DTUA 3AA2A 1RTHA 3OYNA 3T3FA 2FBTA 3K5LA 3V9UA 1RTIA 4DTOA 4O4GA 1SKWA 3RMAA 1RBUA 1NOZA 1SKRA 4I2PA 2P5GA 2KZZA 2Z1JA 3HL8A 5C25A 2D0AA 5E41A 1D8YA 3KLFA 4B8CA 1RT1A 3VQPA 4FZZA 4O5BA 4E7JA 3LDSA 1UA0A 2BANA 1JXEA 3I8DA 4FJHA 4E7KA 2HHTA 3SCXA 4FLUA 1B9FA 1D9DA 3AO3A 2WOMA 2HW3A 4C8LA 4CF0A 1RT6A 4KHNA 4CFCA 4KAZA 3NH1A 4M3YA 3TABA 3OJSA 2G8FA 1S1VA 3I0RA 5CZ2A 3O3HA 3KJVA 1X9WA 2Y1IA 1KFSA 4PY5A 1JLBA 2OPPA 5KRTA 4AHVA 1K6YA 4DTJA 4OLBA 1S1TA 2ZD1A 1DTTA 1YTAA 1Q9XA 2BGGA 3IG1A 3SQ1A 4CIEA 2GUIA 1GOAA 4FJXA 4HHTA 3U6FA 3K2PA 3T1AA 3ZSQA 1NK7A 4ID1A 5HRNA 3PX6A 4B9SA 2Z1GA 3DLEA 4FLTA 3K5OA 4N47A 4DSKA 4BDPA 3TAGA 3KKRA 2DFFA 2OPRA 1BIUA 2YKNA 4OKKA 4W5TA 3QNOA 4PWDA 4CEEA 5HP1A 3ULDA 4FJLA 3DYAA 1DTQA 4CIGA 2JGUA 4CF9A 1C0MA 4CEAA 3OYLA 2X74A 2QKBA 1BQNA 3VN5A 5D3GA 3MEEA 1C6VA 3OYHA 4O44A 1VRTA 3IS9A 4O55A 2QK9A 1BCMA 4CF1A 4CK2A 1T05A 5KTQA 3MXMA 3TR8A 3TAQA 1U45A 1TK8A 5HLFA 4FW1A 4KHWA 1WNSA 3WNGA 3CFOA 4RW9A 3ITHA 1LWFA 3RMDA 4FLXA 3ZSVA 1ZBHA 1BI4B 3TAMA 4AILC 3AVKA 3NAEA 3K58A 3ZT1A 4CHPA 3AVNA 2O4IA 3L2QA 4CJQA 4FK4A 3LALA 3SYZA 4FJ5A 3OYKA 3DLKA 1RDBA 3NF8A 4BE1A 1X1PA 3C95A 4ZHRA 4MFBA 4KKOA 2P5OA 4NYFA 2G8IA 1RBTA 5J2MA 2QKKA 1RCHA 3CQ8A 1LWEA 1VSKA 2ITGA 1LW0A 4OKEA 2YKMA 2A1SA 2P51A 4KI4A 1QS4A 1JLFA 3ALYA 4Z4HA 3KLEA 1W9HA 3EZ5A 3ZSXA 5I42A 4EP5A 4DTPA 1NKBA 3L3VA 1MU2A 1NJYA 3IRXA 3HJFA 1NJWA 4Z4EA 1JLAA 2RPIA 1BGXT 3AA5X 4HUGA 5HRPA 2HB5A 4CCHA 4CHYA 4CHQA 1S5JA 4DLGA 4FJIA 2YNIA 3AVMA 3PX4A 4F4KA 4CJ3A 2NUBA 4DSFA 4CJVA 2KTQA 4OJRA 4QAGA 3VQ8A 4IDKA 4M3UA 1L3UA 1JKHA 4E7IA 4CJ4A 3KKSA 3D0PA 4N5SA 1WSFA 3BDPA 2G8UA 4LD0A 4B9NA 2JLEA 2G8HA 3OYFA 1KRPA 3O4NA 1IH7A 1C1CA 1IO2A 4AHCA 3LWMA 3DM2A 1NJZA 1ASWA 4BDYA 5J2NA 1UAXA 3DLGA 3OYEA 1T03A 1TAQA 3BGRA 2W42A 1VSJA 1WN7A 2IS3A 4CEDA 4JLHA 4OGCA 4DTXA 4ELTA 4J2EA 3THVA 3VQEA 1FK9A 4FK2A 4IBNA 2PYJA 2PYLA 3MEDA 3L8BA 3OYGA 4CK3A 4FJ8A 4AH9A 3DI6A 4LSLA 3AA3A 3DLRA 2FBVA 1B9DA 5KGXA 1TKZA 4DS4A 4DTNA 4IKFA 4B08A 1NK6A 3S9HA 2X6NA 1D5AA 3KLIA 3OYAA 3OY9A 3C6TA 1KVBA 2EX3A 1NKEA 1IKYA 3HXMA 4HUFA 3B6OA 3HP6A 2YNHA 1CLQA 3RTVA 3K57A 5FDLA 3VQQA 3ZSZA 1R0AA 1RT7A 4CGHA 2YHAA 2DY4A 4CE9A 4DS5A 1HNVA 1KVCA 4CFAA 3QESA 3AVCA 1RT5A 1CZ9A 2QXFA 4CEFA 1WSHA 3OS2A 4O0IA 4LSNA 1NOYA 2XO7A 4BE0A 4B9UA 3RWUA 4F3OA 3CFRA 2OZSA 4CJKA 4HCBA 1U4BA 4FLYA 4HCCA 1WSEA 3U3YA 1VRUA 3VQ7A 5HBMA 3HO1A 2O4GA 5CZ1A 2IOCA 5HRRA 1RBVA 1A5WA 5JS2A 4H4OA 4E1MA 1S1UA 3SV4A 2B6AA 2XRIA 1NKCA 3MECA 4FVMA 3F9KA 3ZSOA 1TAUA 1I39A 4BACA 2HHQA 3LAKA 3MEGA 1JL1A 2E6MA 3NBPA 4CJLA 4BE2A 3V9SA 1NJXA 4H4MA 1Q9YA 2OPSA 4CEOA 3VA0A 1XHZA 3QIOA 3KLGA 3CM6A 3PO5A 4FLVA 3LP3A 2B4JA 1VK0A 2E4LA 4G1QA 5C24A 4IFYA 3KLHA 3QEPA 2IC3A 4FJ7A 1QSSA 2F96A 4NCAA 4W5RA 3TI0A 4Z4CA 4Z4IA 4ICLA 3TWHA 3VQ6A 1JLQA 4DQQA 3SPZA 3TARA 1XHXA 1S1XA 3NE6A 2XY5A 3LWLA 1XWLA 4FJ9A 2D0CA 1J54A 1RDAA 3V9ZA 4BWMA 1YTUA 3PY8A 2HHVA 1QSYA 2R7YA 2RKIA 1EP4A 3NF7A 3ZT0A 3SV3A 4RW8A 3AV9A 4E0DA 4FXDA 4CHNA 3PX0A 4B3OA 3AO1A 2FBXA 1J5OA 4CEBA 4OLAA 4CIFA 5CYQA 3PV8A 5I3UA 4CF8A 1JLEA 1C1BA 2X6SA 3NGZA 3QLHA 3WNHA 4JRQA 4Z4FA 2HHWA 4CJRA 3WNEA 3SUOA 4K8XA 3FFIA 4Y1CA 3ZSYA 1C0TA 2XHBA 3MXJA 3ZSRA 4OPKA 3HT3A 4DFPA 1SKSA 2G8KA 4KTZA 2BE2A 3VQBA 3WNFA 2IGIA 1C1AA 3K5MA 1HQUA 1VSHA 3OS1A 4DF4A 1HJRA 4Y1DA 3QIPA 3OS0A 2OZMA 4M42A 2HVHA 3RMBA 3DRSA 3AVAA 4FLWA 1KFDA 1NK5A 5JS1A 1TKDA 4NCBA 4CJEA 4QOZB 4E7LA 4KTQA 1JXBA 5DMRA 3NHGA 4DQRA 1KVAA 3EYZA 4JS5A 4NCGA 1S9GA 1NK9A 1TK0A 3OYMA 4KHUA 2ATQA 3KK2A 1ASVA 3TAEA 4CJSA 3V9XA 1VSIA 4QCLA 3LP1A 4FJKA 4BDZA 4ZTFA 1X9SA 4FK0A 4CGDA 4B9LA 1HNIA 4CECA 2FC0A 3C94A 2KFNA 1BL3A 2DFHA 3SUQA 3RMCA 5HROA 4F2RA 2F8TA 1U04A 3OYIA 1S6QA 3OJUA 4I9QA 1DLOA 3I0SA 1XI1A 1ZBFA 4OGEA 4AHTA 1D9FA 3AVJA 1KCFA 3P83D 1J53A 4CGFA 3V4IA 4CEZA 4CGIA 4IG3A 2VWJA 4DG1A 2IAJA 3DRPA 4KREA 4KPYA 2ZQBA 1J9AA 2BDPA 1YT3A 1HQEA 2GBZA 1JL2A 1RTDA 3NDKA 3RR8A 4N41A 3PO4A 3K59A 4M3XA 4M3RA 3G0ZA 3T19A 5KGWA 5HRSA 1CZBA 1GOBA 4H8KA 4CERA 4I9LA 3SQ4A 2VG7A 3CM5A 2YV0X 4KB1A 4Z4GA 1REVA 1EX4A 3KIOA 1VSDA 3DMJA 1BQMA 4CGGA 3F73A 3B6PA 1Q8IA 1UOCA 2OPQA 4FLZA 3RRHA 3G10A 4F3TA 3AVLA 4HVJA 1W0HA 3LZIA 3V1QA 4JRPA 2XY7A 4M3WA 2YNFA 5KRSA 4OPJA 3NH2A 1X9MA 3KK3A 4EP4A 1RT3A 4E1NA 4RW7A 3QEXA 1LV5A 4CJUA 3HM9A 1A5XA 4CJWA 3DLBA 5J1EA 3OYBA 2VWKA 3NGYA 1BCOA 4RG8A 4PUOA 3TANA 1HRHA 1S1WA 1JLCA 4AHUA 1SL0A 4DF8A 3KTQA 4KTWA 3E01A 3VQAA 3ZT3A 3NFAA 3AO5A 1L5UA 3KD5E 3HYFA 3ZSWA 1UWBA 4C8OA 2ETJA 2DFEA 4CFBA 4C8NA 3S3MA 3L2RA 3QNNA 2PY5A 4HUEA 4B9MA 2WONA 3C6UA 4DSEA 2Y1JA 4F8RA 3MXIA 3PUFA 1TVRA 1EKEA 1FXXA 5CY4A 1A5VA 4C8MA 1NK0A 2OYQA 4KHQA 2Z1IA 4DWIA 1ASUA 2D0BA 1EETA 5C42A 3AVIA 3ZT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL2 A;  1WSI A;  1WLJ A;  4OKJ A;  1BI4 A;  3QEI A;  3M8Q A;  1LAV A;  1QTM A;  3V1R A;  2VG6 A;  2A1R A;  2B5J A;  2YHB A;  2RN2 A;  2YNG A;  5EU7 A;  5SWM A;  1RT4 A;  2P1J A;  3U3G A;  2KW4 A;  4HTU A;  1U47 A;  3OYJ A;  4CJP A;  1C0U A;  3V81 A;  4B8A B;  5T7B A;  4ZTJ A;  3K5N A;  3JYT A;  1RBR A;  1KTQ A;  1RT2 A;  1VSL A;  1HYZ A;  1VSM A;  3O4Q A;  3VQ5 A;  3ZT2 A;  4M45 A;  3SUP A;  5FRN A;  1VSE A;  3UIQ A;  4XIU A;  4J2A A;  4ID5 A;  4CHZ A;  2ZE2 A;  4LH5 A;  4DFM A;  1L3T A;  4YNQ A;  3V6D A;  3S3O A;  3AO2 A;  4DU4 A;  4LH4 A;  1HYV A;  4FZX C;  3IAY A;  1N5Y A;  2KFZ A;  4Z0U A;  3LAM A;  2XY8 A;  1TGO A;  3AVF A;  4CJ5 A;  5KI6 A;  4I7F A;  4KRF A;  3V1O A;  4UQG A;  1TK5 A;  2F8S A;  3CYM A;  4CJT A;  4GW6 A;  4DMN A;  3DOK A;  3QIN A;  2Q3S A;  3L2U A;  4TSX A;  1I3A A;  3HVR A;  3LZJ A;  4DTR A;  1FKP A;  1U49 A;  1IKX A;  3DLH A;  4RW6 A;  4DSJ A;  1YVU A;  3QET A;  3TAP A;  1LAW A;  4J2B A;  3JSM A;  4W5O A;  1L3V A;  1CXQ A;  1SL1 A;  4KI6 A;  2HND A;  1GOC A;  1IKV A;  2G8V A;  2EHG A;  3AO4 A;  3ISN C;  5SZT A;  4EZ9 A;  4M3Z A;  1WAJ A;  1TL3 A;  3QER A;  4KO0 A;  5J2Q A;  4CF2 A;  3SUN A;  3AVB A;  4Q0B A;  4KV8 A;  1KLM A;  2HHU A;  1RNH A;  4DLE A;  3SPY A;  1WSJ A;  3O3G A;  4OVL A;  3NGI A;  3V9W A;  1KSP A;  4DU1 A;  4DTS A;  3L3U A;  4O0J A;  3SNN A;  4B9T A;  1UA1 A;  4NYN A;  2RF2 A;  3OYC A;  1Z25 A;  1Z26 A;  4KHY A;  1SV5 A;  3P5J A;  3LPU A;  3RR7 A;  4M3T A;  4FZY A;  3HP9 A;  3AVH A;  3LP0 A;  3DOL A;  3A2F A;  4DFK A;  3OYD A;  1WAF A;  3NF6 A;  2GV9 A;  4DU3 A;  4FW2 A;  4DQI A;  4IFV A;  3MAQ A;  4CEQ A;  3S3N A;  3CG7 A;  4N56 A;  1ZBL A;  1TKX A;  2HNZ A;  4CHO A;  4R5P A;  2KQ2 A;  1N6Q A;  4FJN A;  1KLN A;  3D45 A;  1WSG A;  3LAN A;  1S9E A;  1VSF A;  1QHT A;  3HVT A;  4WE1 A;  4ELV A;  1Y97 A;  3QO9 A;  3EY1 A;  2KZM A;  3KD1 E;  4Q5V A;  3SI6 A;  4GVM A;  4DSL A;  3M8R A;  4PQU A;  4CJF A;  3SZ2 A;  4FM2 A;  3SQ2 A;  3ZCM A;  1CXU A;  2LSN A;  1ZYQ A;  4DQS A;  4KB0 A;  1EXQ A;  1FKO A;  4GMJ B;  4W5Q A;  3KK1 A;  4E89 A;  4DTM A;  3L2V A;  3QEW A;  3HPH A;  2PZS A;  1JLG A;  3RRG A;  4EZ6 A;  4FYD A;  1O1W A;  4C8K A;  2Z1H A;  5FRO A;  3HST B;  4CK1 A;  3QEV A;  1T8E A;  3LPT A;  4DSI A;  2HHS A;  3L2W A;  3VA3 A;  4FJM A;  1QSL A;  1RTJ A;  2AJQ A;  5FRM A;  5CYM A;  3SQ0 A;  4KFB A;  4YFU A;  3HPO A;  1S6P A;  4AHS A;  1RDC A;  2HMI A;  4ELU A;  4BWJ A;  4FJJ A;  3VQD A;  3SJJ A;  2E6L A;  2IDO A;  1B92 A;  4PA1 A;  4CGJ A;  3M8S A;  3CFP A;  5DK5 A;  1NK8 A;  4E7H A;  1ZBI A;  5K14 A;  4CFD A;  4KHS A;  4RW4 A;  3DRR A;  4E3S A;  3HPG A;  4K8Z A;  4L8R B;  2XY6 A;  1F21 A;  4FCY A;  4N76 A;  4FM0 A;  3OVN A;  2I5J A;  3M8P A;  2HVI A;  1L3S A;  1SUQ A;  1ZBU A;  1HYS A;  1G15 A;  3P1G A;  3NH0 A;  4DQP A;  1XC9 A;  2HHX A;  3TAF A;  2OA8 A;  1TV6 A;  2G8W A;  5J2P A;  4CES A;  1RDD A;  4AHR A;  4JS4 A;  2HNY A;  1HMV A;  1QQC A;  4I2Q A;  3VQ9 A;  1TKT A;  3VQ4 A;  3AVG A;  2FBY A;  1RIL A;  3LP2 A;  3HK2 A;  2VG5 A;  1TL1 A;  1LWC A;  1IKW A;  1BHL A;  3ASM A;  4LY7 A;  1BIZ A;  4FM1 A;  1IG9 A;  4B9V A;  3H08 A;  1NK4 A;  4J2D A;  1ITG A;  2D5R A;  1BIS A;  4DTU A;  3AA4 A;  4IG0 A;  1U48 A;  3VQC A;  4DFJ A;  4MQ3 A;  4W5N A;  1RBS A;  4E19 A;  4M41 A;  3NCI A;  4F2S A;  1HPZ A;  4FJG A;  3NF9 A;  1QE1 A;  1T7P A;  2X78 A;  1LW2 A;  3O3F A;  2DTU A;  3AA2 A;  1RTH A;  3OYN A;  3T3F A;  2FBT A;  3K5L A;  3V9U A;  1RTI A;  4DTO A;  4O4G A;  1SKW A;  3RMA A;  1RBU A;  1NOZ A;  1SKR A;  4I2P A;  2P5G A;  2KZZ A;  2Z1J A;  3HL8 A;  5C25 A;  2D0A A;  5E41 A;  1D8Y A;  3KLF A;  4B8C A;  1RT1 A;  3VQP A;  4FZZ A;  4O5B A;  4E7J A;  3LDS A;  1UA0 A;  2BAN A;  1JXE A;  3I8D A;  4FJH A;  4E7K A;  2HHT A;  3SCX A;  4FLU A;  1B9F A;  1D9D A;  3AO3 A;  2WOM A;  2HW3 A;  4C8L A;  4CF0 A;  1RT6 A;  4KHN A;  4CFC A;  4KAZ A;  3NH1 A;  4M3Y A;  3TAB A;  3OJS A;  2G8F A;  1S1V A;  3I0R A;  5CZ2 A;  3O3H A;  3KJV A;  1X9W A;  2Y1I A;  1KFS A;  4PY5 A;  1JLB A;  2OPP A;  5KRT A;  4AHV A;  1K6Y A;  4DTJ A;  4OLB A;  1S1T A;  2ZD1 A;  1DTT A;  1YTA A;  1Q9X A;  2BGG A;  3IG1 A;  3SQ1 A;  4CIE A;  2GUI A;  1GOA A;  4FJX A;  4HHT A;  3U6F A;  3K2P A;  3T1A A;  3ZSQ A;  1NK7 A;  4ID1 A;  5HRN A;  3PX6 A;  4B9S A;  2Z1G A;  3DLE A;  4FLT A;  3K5O A;  4N47 A;  4DSK A;  4BDP A;  3TAG A;  3KKR A;  2DFF A;  2OPR A;  1BIU A;  2YKN A;  4OKK A;  4W5T A;  3QNO A;  4PWD A;  4CEE A;  5HP1 A;  3ULD A;  4FJL A;  3DYA A;  1DTQ A;  4CIG A;  2JGU A;  4CF9 A;  1C0M A;  4CEA A;  3OYL A;  2X74 A;  2QKB A;  1BQN A;  3VN5 A;  5D3G A;  3MEE A;  1C6V A;  3OYH A;  4O44 A;  1VRT A;  3IS9 A;  4O55 A;  2QK9 A;  1BCM A;  4CF1 A;  4CK2 A;  1T05 A;  5KTQ A;  3MXM A;  3TR8 A;  3TAQ A;  1U45 A;  1TK8 A;  5HLF A;  4FW1 A;  4KHW A;  1WNS A;  3WNG A;  3CFO A;  4RW9 A;  3ITH A;  1LWF A;  3RMD A;  4FLX A;  3ZSV A;  1ZBH A;  1BI4 B;  3TAM A;  4AIL C;  3AVK A;  3NAE A;  3K58 A;  3ZT1 A;  4CHP A;  3AVN A;  2O4I A;  3L2Q A;  4CJQ A;  4FK4 A;  3LAL A;  3SYZ A;  4FJ5 A;  3OYK A;  3DLK A;  1RDB A;  3NF8 A;  4BE1 A;  1X1P A;  3C95 A;  4ZHR A;  4MFB A;  4KKO A;  2P5O A;  4NYF A;  2G8I A;  1RBT A;  5J2M A;  2QKK A;  1RCH A;  3CQ8 A;  1LWE A;  1VSK A;  2ITG A;  1LW0 A;  4OKE A;  2YKM A;  2A1S A;  2P51 A;  4KI4 A;  1QS4 A;  1JLF A;  3ALY A;  4Z4H A;  3KLE A;  1W9H A;  3EZ5 A;  3ZSX A;  5I42 A;  4EP5 A;  4DTP A;  1NKB A;  3L3V A;  1MU2 A;  1NJY A;  3IRX A;  3HJF A;  1NJW A;  4Z4E A;  1JLA A;  2RPI A;  1BGX T;  3AA5 X;  4HUG A;  5HRP A;  2HB5 A;  4CCH A;  4CHY A;  4CHQ A;  1S5J A;  4DLG A;  4FJI A;  2YNI A;  3AVM A;  3PX4 A;  4F4K A;  4CJ3 A;  2NUB A;  4DSF A;  4CJV A;  2KTQ A;  4OJR A;  4QAG A;  3VQ8 A;  4IDK A;  4M3U A;  1L3U A;  1JKH A;  4E7I A;  4CJ4 A;  3KKS A;  3D0P A;  4N5S A;  1WSF A;  3BDP A;  2G8U A;  4LD0 A;  4B9N A;  2JLE A;  2G8H A;  3OYF A;  1KRP A;  3O4N A;  1IH7 A;  1C1C A;  1IO2 A;  4AHC A;  3LWM A;  3DM2 A;  1NJZ A;  1ASW A;  4BDY A;  5J2N A;  1UAX A;  3DLG A;  3OYE A;  1T03 A;  1TAQ A;  3BGR A;  2W42 A;  1VSJ A;  1WN7 A;  2IS3 A;  4CED A;  4JLH A;  4OGC A;  4DTX A;  4ELT A;  4J2E A;  3THV A;  3VQE A;  1FK9 A;  4FK2 A;  4IBN A;  2PYJ A;  2PYL A;  3MED A;  3L8B A;  3OYG A;  4CK3 A;  4FJ8 A;  4AH9 A;  3DI6 A;  4LSL A;  3AA3 A;  3DLR A;  2FBV A;  1B9D A;  5KGX A;  1TKZ A;  4DS4 A;  4DTN A;  4IKF A;  4B08 A;  1NK6 A;  3S9H A;  2X6N A;  1D5A A;  3KLI A;  3OYA A;  3OY9 A;  3C6T A;  1KVB A;  2EX3 A;  1NKE A;  1IKY A;  3HXM A;  4HUF A;  3B6O A;  3HP6 A;  2YNH A;  1CLQ A;  3RTV A;  3K57 A;  5FDL A;  3VQQ A;  3ZSZ A;  1R0A A;  1RT7 A;  4CGH A;  2YHA A;  2DY4 A;  4CE9 A;  4DS5 A;  1HNV A;  1KVC A;  4CFA A;  3QES A;  3AVC A;  1RT5 A;  1CZ9 A;  2QXF A;  4CEF A;  1WSH A;  3OS2 A;  4O0I A;  4LSN A;  1NOY A;  2XO7 A;  4BE0 A;  4B9U A;  3RWU A;  4F3O A;  3CFR A;  2OZS A;  4CJK A;  4HCB A;  1U4B A;  4FLY A;  4HCC A;  1WSE A;  3U3Y A;  1VRU A;  3VQ7 A;  5HBM A;  3HO1 A;  2O4G A;  5CZ1 A;  2IOC A;  5HRR A;  1RBV A;  1A5W A;  5JS2 A;  4H4O A;  4E1M A;  1S1U A;  3SV4 A;  2B6A A;  2XRI A;  1NKC A;  3MEC A;  4FVM A;  3F9K A;  3ZSO A;  1TAU A;  1I39 A;  4BAC A;  2HHQ A;  3LAK A;  3MEG A;  1JL1 A;  2E6M A;  3NBP A;  4CJL A;  4BE2 A;  3V9S A;  1NJX A;  4H4M A;  1Q9Y A;  2OPS A;  4CEO A;  3VA0 A;  1XHZ A;  3QIO A;  3KLG A;  3CM6 A;  3PO5 A;  4FLV A;  3LP3 A;  2B4J A;  1VK0 A;  2E4L A;  4G1Q A;  5C24 A;  4IFY A;  3KLH A;  3QEP A;  2IC3 A;  4FJ7 A;  1QSS A;  2F96 A;  4NCA A;  4W5R A;  3TI0 A;  4Z4C A;  4Z4I A;  4ICL A;  3TWH A;  3VQ6 A;  1JLQ A;  4DQQ A;  3SPZ A;  3TAR A;  1XHX A;  1S1X A;  3NE6 A;  2XY5 A;  3LWL A;  1XWL A;  4FJ9 A;  2D0C A;  1J54 A;  1RDA A;  3V9Z A;  4BWM A;  1YTU A;  3PY8 A;  2HHV A;  1QSY A;  2R7Y A;  2RKI A;  1EP4 A;  3NF7 A;  3ZT0 A;  3SV3 A;  4RW8 A;  3AV9 A;  4E0D A;  4FXD A;  4CHN A;  3PX0 A;  4B3O A;  3AO1 A;  2FBX A;  1J5O A;  4CEB A;  4OLA A;  4CIF A;  5CYQ A;  3PV8 A;  5I3U A;  4CF8 A;  1JLE A;  1C1B A;  2X6S A;  3NGZ A;  3QLH A;  3WNH A;  4JRQ A;  4Z4F A;  2HHW A;  4CJR A;  3WNE A;  3SUO A;  4K8X A;  3FFI A;  4Y1C A;  3ZSY A;  1C0T A;  2XHB A;  3MXJ A;  3ZSR A;  4OPK A;  3HT3 A;  4DFP A;  1SKS A;  2G8K A;  4KTZ A;  2BE2 A;  3VQB A;  3WNF A;  2IGI A;  1C1A A;  3K5M A;  1HQU A;  1VSH A;  3OS1 A;  4DF4 A;  1HJR A;  4Y1D A;  3QIP A;  3OS0 A;  2OZM A;  4M42 A;  2HVH A;  3RMB A;  3DRS A;  3AVA A;  4FLW A;  1KFD A;  1NK5 A;  5JS1 A;  1TKD A;  4NCB A;  4CJE A;  4QOZ B;  4E7L A;  4KTQ A;  1JXB A;  5DMR A;  3NHG A;  4DQR A;  1KVA A;  3EYZ A;  4JS5 A;  4NCG A;  1S9G A;  1NK9 A;  1TK0 A;  3OYM A;  4KHU A;  2ATQ A;  3KK2 A;  1ASV A;  3TAE A;  4CJS A;  3V9X A;  1VSI A;  4QCL A;  3LP1 A;  4FJK A;  4BDZ A;  4ZTF A;  1X9S A;  4FK0 A;  4CGD A;  4B9L A;  1HNI A;  4CEC A;  2FC0 A;  3C94 A;  2KFN A;  1BL3 A;  2DFH A;  3SUQ A;  3RMC A;  5HRO A;  4F2R A;  2F8T A;  1U04 A;  3OYI A;  1S6Q A;  3OJU A;  4I9Q A;  1DLO A;  3I0S A;  1XI1 A;  1ZBF A;  4OGE A;  4AHT A;  1D9F A;  3AVJ A;  1KCF A;  3P83 D;  1J53 A;  4CGF A;  3V4I A;  4CEZ A;  4CGI A;  4IG3 A;  2VWJ A;  4DG1 A;  2IAJ A;  3DRP A;  4KRE A;  4KPY A;  2ZQB A;  1J9A A;  2BDP A;  1YT3 A;  1HQE A;  2GBZ A;  1JL2 A;  1RTD A;  3NDK A;  3RR8 A;  4N41 A;  3PO4 A;  3K59 A;  4M3X A;  4M3R A;  3G0Z A;  3T19 A;  5KGW A;  5HRS A;  1CZB A;  1GOB A;  4H8K A;  4CER A;  4I9L A;  3SQ4 A;  2VG7 A;  3CM5 A;  2YV0 X;  4KB1 A;  4Z4G A;  1REV A;  1EX4 A;  3KIO A;  1VSD A;  3DMJ A;  1BQM A;  4CGG A;  3F73 A;  3B6P A;  1Q8I A;  1UOC A;  2OPQ A;  4FLZ A;  3RRH A;  3G10 A;  4F3T A;  3AVL A;  4HVJ A;  1W0H A;  3LZI A;  3V1Q A;  4JRP A;  2XY7 A;  4M3W A;  2YNF A;  5KRS A;  4OPJ A;  3NH2 A;  1X9M A;  3KK3 A;  4EP4 A;  1RT3 A;  4E1N A;  4RW7 A;  3QEX A;  1LV5 A;  4CJU A;  3HM9 A;  1A5X A;  4CJW A;  3DLB A;  5J1E A;  3OYB A;  2VWK A;  3NGY A;  1BCO A;  4RG8 A;  4PUO A;  3TAN A;  1HRH A;  1S1W A;  1JLC A;  4AHU A;  1SL0 A;  4DF8 A;  3KTQ A;  4KTW A;  3E01 A;  3VQA A;  3ZT3 A;  3NFA A;  3AO5 A;  1L5U A;  3KD5 E;  3HYF A;  3ZSW A;  1UWB A;  4C8O A;  2ETJ A;  2DFE A;  4CFB A;  4C8N A;  3S3M A;  3L2R A;  3QNN A;  2PY5 A;  4HUE A;  4B9M A;  2WON A;  3C6U A;  4DSE A;  2Y1J A;  4F8R A;  3MXI A;  3PUF A;  1TVR A;  1EKE A;  1FXX A;  5CY4 A;  1A5V A;  4C8M A;  1NK0 A;  2OYQ A;  4KHQ A;  2Z1I A;  4DWI A;  1ASU A;  2D0B A;  1EET A;  5C42 A;  3AVI A;  3ZT4 A; 
#chains in the Genus database with same CATH topology
 1YAG A;  1WSI A;  1WLJ A;  4KH5 A;  3QEI A;  3M8Q A;  1QTM A;  4E1J A;  5GAG P;  1LOT B;  5EU7 A;  1N8R O;  2P1J A;  3C65 A;  3OHR A;  3R1X A;  4Y0W A;  4DV5 K;  3PIP L;  3JYT A;  1RBR A;  1HYZ A;  4M45 A;  2QW9 A;  4LH5 A;  5BPM A;  1L3T A;  1MDU B;  1I94 K;  3MX2 A;  1CZA N;  4KRF A;  4UQG A;  1TK5 A;  2F8S A;  4DQ8 A;  3DOK A;  1KXP A;  3VTH A;  3L2U A;  4CZI A;  1YVU A;  4J2B A;  4HTL A;  3JSM A;  4GV3 A;  2KKZ A;  4BRH A;  4KI6 A;  1GOC A;  3N4P A;  5J2Q A;  1GLD G;  3SUN A;  2NRV A;  1BDG A;  3AVB A;  3LDP A;  3ZET A;  1RNH A;  2RE2 A;  3M5R A;  3SPY A;  5GAH P;  2ZWH A;  2PFU A;  4B9T A;  4JKG B;  2QWN A;  3U4L A;  2RF2 A;  3EZW A;  3OYC A;  2NRT A;  4M3T A;  2P9L A;  3HP9 A;  3AVH A;  4BRI A;  1WAF A;  3NF6 A;  2GV9 A;  4DU3 A;  4FW2 A;  3T69 A;  3MAQ A;  1NGH A;  2O8F A;  3THW B;  1N6Q A;  1QHT A;  4WE1 A;  2KZM A;  1Y97 A;  1TYQ B;  4GVM A;  5JVG L;  1CXU A;  3UKR A;  1ZYQ A;  5AQO A;  1FKO A;  1KAZ A;  4W5Q A;  4V19 S;  4E89 A;  4PHT X;  3E1Y A;  1O1W A;  2AA4 A;  4HWI A;  4JI6 K;  2QWM A;  5LMU K;  4CK1 A;  1T8E A;  3R3L A;  2VWB A;  2AJQ A;  5FRM A;  5CYM A;  1S6P A;  5M1O A;  2HMI A;  4ELU A;  3QFP A;  4FJJ A;  3VQD A;  4PA1 A;  4H5W A;  3NVK A;  1NK8 A;  4K25 A;  5K14 A;  4H0V B;  2QTD A;  3VGL A;  4L8R B;  2XY6 A;  1GLF O;  3CJ9 A;  1XNQ K;  1ZBU A;  3ZX3 A;  5KPZ A;  3HRG A;  3NH0 A;  4DQP A;  1ATS A;  5H1S Q;  1RDD A;  2HNY A;  5GAD P;  1RDW X;  2VG5 A;  1TL1 A;  4PKG A;  3SK3 A;  3P31 A;  1BIS A;  4DTU A;  3AA4 A;  4IG0 A;  3VQC A;  1YXQ A;  4MQ3 A;  1RBS A;  4B3M K;  1K8K A;  2YHW A;  3NF9 A;  3VEZ A;  1T7P A;  4BRM A;  3AA2 A;  3O6W A;  4RCH A;  5AZJ A;  2GEL A;  4BRC A;  2Z1J A;  2KZZ A;  4FOE A;  4F9O A;  4E7J A;  3LDS A;  4JK9 A;  1B9F A;  3SBT A;  4JKA A;  1XMO K;  1D9D A;  2HW3 A;  4CF0 A;  1WB9 A;  2GUP A;  1T3V A;  2ZJP L;  2CGJ A;  1S1V A;  3O3H A;  2EWS A;  3J8A A;  1KFS A;  3FGU A;  3CC4 N;  2P9S B;  5KRT A;  1Q82 O;  1TUY A;  3IG1 A;  2PBD A;  2GTD A;  4BC5 A;  4BR0 A;  4HHT A;  3LM2 A;  3K5O A;  3TAG A;  4OKK A;  3DXM A;  5HP1 A;  3ULD A;  1VQP N;  2WBN A;  3VN5 A;  3ULE A;  5D3G A;  1C6V A;  4O44 A;  1VRT A;  3IS9 A;  3MN6 A;  1E3M A;  4EAH D;  5FPE A;  2IVP A;  1WNS A;  4RW9 A;  3RMD A;  3ZSV A;  1ZBH A;  3TAM A;  2P9U A;  3A5N C;  3AVK A;  3OBW A;  4IDH A;  4CHP A;  2UXD K;  4FK4 A;  3LAL A;  3SYZ A;  4FJ5 A;  3DLK A;  1T44 A;  5I9E B;  4MFB A;  2OAN A;  3VET A;  4CW7 B;  2G8I A;  3VEX A;  1VSK A;  5TKY A;  1QS4 A;  3ALY A;  1W9H A;  3ZSX A;  3LM9 A;  4AF1 A;  3IRX A;  1JLA A;  2A6A A;  1VHX A;  2P9I A;  2ZF5 O;  4DLG A;  4FJI A;  2E2N A;  3I8B A;  3G71 N;  4CJ3 A;  3EN9 A;  4CJV A;  3EEQ A;  3VQ8 A;  4IDK A;  4DV7 K;  1OH7 A;  3MMV A;  5AFU H;  1L3U A;  4E7I A;  3KKS A;  1YJ9 N;  5LJV A;  2I7P A;  3OYF A;  4O5F A;  4CZL A;  3ZET B;  3VMF B;  2NRX A;  3U8X A;  1VQ5 N;  1NJZ A;  4I6M A;  1TAQ A;  3BGR A;  1YUW A;  2ASP A;  1J6Z A;  2P9L B;  1S72 N;  3JAM O;  2QWR A;  3HTV A;  3CC7 N;  3QBX A;  4NLB A;  3CQX A;  4IKF A;  4B08 A;  1D5A A;  3OYA A;  5EVZ A;  2O8F B;  3O1W A;  5JLH A;  1OKJ A;  3HXM A;  3HP6 A;  3BUZ B;  3F5T A;  3VQQ A;  3ZSZ A;  1RT7 A;  3UKR B;  2YHA A;  4A57 A;  3CHW A;  4CE9 A;  4DS5 A;  3QES A;  1KD1 O;  2QXF A;  1WSH A;  2QEX N;  4DV0 K;  1SS6 A;  3KZB A;  2Q1N A;  4B3S K;  4HCC A;  1HJO A;  3VQ7 A;  5HBM A;  5CZ1 A;  3BZC A;  3TTF A;  1EWQ A;  1A5W A;  2E8A A;  3QML A;  1S1U A;  3OW2 M;  3F9K A;  2V51 B;  2FSJ A;  4MO4 A;  1JL1 A;  1NJX A;  4H5T A;  4BR7 A;  1NWK A;  1JJ2 M;  3CCV N;  3QIO A;  4BRK A;  1KAY A;  5DM6 L;  1VK0 A;  4G1Q A;  2F96 A;  5AQQ A;  4NCA A;  3C6A A;  1S3X A;  3VF4 A;  4FWP A;  2AP1 A;  3VQ6 A;  4DQQ A;  4NO7 A;  2XY5 A;  1HPM A;  2QWL A;  4FJ9 A;  1VAZ A;  1K8K B;  3V9Z A;  2NRH A;  1YTU A;  2V7Z A;  3SV3 A;  4BRF A;  3AO1 A;  3M1F A;  4OLA A;  1RFQ A;  5AQY A;  5AZJ B;  3PV8 A;  3FR0 A;  5IT9 O;  1JLE A;  2X6S A;  3CCE N;  4DKW A;  4JRQ A;  3WNE A;  3BF1 A;  5F1X A;  2KHO A;  2G8K A;  2BE2 A;  1JCG A;  2IGI A;  1HQU A;  4DF4 A;  1NNE A;  3CIP A;  1YHQ N;  4M42 A;  3RMB A;  4DR1 K;  1NGB A;  4KTQ A;  4CZH A;  3I33 A;  4DQR A;  1KVA A;  3EYZ A;  3IDH A;  4JS5 A;  4NCG A;  4KHU A;  4CVN E;  3KK2 A;  1K73 O;  5AQI A;  1VSI A;  3PLA A;  4WFB L;  4BDZ A;  4JI7 K;  4YOX A;  2D0O A;  3DXM B;  4IXC A;  3SUQ A;  3RMC A;  1U04 A;  4WCE L;  1ZBF A;  4OGE A;  2ZM6 K;  3ULE B;  1D9F A;  4H5N A;  1W2B M;  3VGM A;  4IG3 A;  5JLF A;  1NM1 A;  4XH1 A;  3NDK A;  4N41 A;  3LDO A;  4M3X A;  4M3R A;  3EKS A;  2P9U B;  5HRS A;  4LF5 K;  2W6K A;  1IG8 A;  2YV0 X;  4KB1 A;  1EX4 A;  3KIO A;  3DMJ A;  4ELV A;  3RRH A;  3B6P A;  4FLZ A;  3LZI A;  3O9U A;  4OO1 J;  3V1Q A;  4JRP A;  4OPJ A;  4IFE A;  4B1X B;  3KK3 A;  3MN5 A;  4RW7 A;  3NGY A;  4WFN L;  1JLC A;  3W3D A;  1SL0 A;  1YF5 L;  4JYA K;  1L5U A;  2UXB K;  2P9I B;  3ZSW A;  2ETJ A;  4MLH A;  3IUC A;  4C8N A;  2E2O A;  5AQG A;  3L2R A;  4B9M A;  3RSE A;  3WUH A;  1FXX A;  2OYQ A;  4C8M A;  4DWI A;  1ILY A;  2D0B A;  5C42 A;  3MWT A;  3AVI A;  4JD2 A;  3NVM A;  3WXL A;  2YHB A;  2RN2 A;  2F9T A;  1QQO A;  4CJP A;  2HF3 A;  3K5N A;  4I6M B;  1KTQ A;  1RT2 A;  3O4Q A;  3VQ5 A;  2W41 A;  4H5V A;  4BRE A;  1VSE A;  4J2A A;  1U6Z A;  4M63 C;  4BR4 A;  2Q97 A;  1G99 A;  2CGK A;  3AO2 A;  1N5Y A;  4MLE A;  4LF9 K;  4B1V A;  5KI6 A;  5AQK A;  4CZG A;  1OH5 A;  3CYM A;  2F7T A;  4CJT A;  3SLC A;  1U49 A;  1FKP A;  3DLH A;  1IBM K;  1L3V A;  4BRO A;  2HND A;  4M3Z A;  3AO4 A;  3ISN C;  4KO0 A;  3CCU N;  2FSN A;  4CF2 A;  3V9W A;  1GLA G;  3NGI A;  4DU1 A;  2YX6 A;  3L3U A;  3IFR A;  3K0S A;  1UA1 A;  4JKC A;  5EY4 A;  4KHY A;  1SV5 A;  3LPU A;  2NZT A;  3QDK A;  3A2F A;  2W40 A;  3CMA N;  3CJA A;  3S3N A;  5C2D A;  1BOT O;  4N56 A;  1ZBL A;  1TKX A;  3WQU A;  2KQ2 A;  3QO9 A;  4CJ7 A;  3KD1 E;  3D2F A;  4PQU A;  3GE1 A;  4CJF A;  4C1N I;  3ZYY X;  1VQ7 N;  1EXQ A;  4DTM A;  1KSP A;  4KB0 A;  4LC9 B;  4K8Z A;  3L2V A;  3HPH A;  4C1N K;  3WQT A;  5M1F A;  3SQ0 A;  4KFB A;  3SMS A;  4AHS A;  2W6L A;  5AQL A;  4U67 L;  4BWJ A;  3UE5 A;  4WQ4 C;  3S41 A;  3CFP A;  1SZ2 A;  4KHS A;  1XQS C;  2QM1 A;  3HPG A;  1X3M A;  3OVN A;  3M8P A;  1SUQ A;  4R79 A;  3VF6 A;  3BP8 A;  2HHX A;  1BA0 A;  1MWM A;  5ELZ A;  1NGC A;  4AHR A;  4H0O A;  1HMV A;  4JKB A;  3VQ9 A;  1VQ4 N;  4PKI A;  1DEJ A;  4MDA A;  4JI2 K;  1IKW A;  3ASM A;  3UB5 A;  4FM1 A;  5M1Q A;  1ITG A;  2FSK A;  2O8B A;  3C0B A;  4DFJ A;  3EE9 A;  4W5N A;  2IIR A;  1E4G T;  1HPZ A;  4FJG A;  2X78 A;  1LW2 A;  3CCJ N;  2DTU A;  2E1Y A;  3H3N O;  1N36 K;  3K5L A;  5AQJ A;  4BRQ A;  3O1B A;  4CZM A;  1SKW A;  3CXC M;  3O9S A;  2P5G A;  3HL8 A;  2D0A A;  5E41 A;  3KLF A;  2YCH A;  5AQF A;  3VQP A;  4O5B A;  4FJH A;  2HHT A;  4E7K A;  1TUU A;  2QWQ A;  5B8H A;  4C8L A;  3ZX2 A;  1XUP O;  5M1K A;  3D2E A;  4CFC A;  1X3N A;  3TAB A;  3PSF A;  3OJS A;  2G8F A;  3MWP A;  5CZ2 A;  2FLO A;  3KJV A;  5C2F A;  2ZGY A;  4AHV A;  4DTJ A;  1S1T A;  1Q9X A;  1DTT A;  1QZ5 A;  3U9D A;  1NK7 A;  3U6F A;  1Q18 A;  2Q0R A;  3GDQ A;  1ATN A;  2YKN A;  3DYA A;  1DTQ A;  2Q0U A;  3P4I A;  4CEA A;  1WOQ A;  5KPT A;  5FPD A;  3OYH A;  5EX5 A;  1Q7Y O;  4O55 A;  4IWV A;  4CK2 A;  2HST A;  3RSE B;  3CC2 N;  5KTQ A;  3MXM A;  3TAQ A;  4JKH A;  4FSV A;  3THY A;  4FW1 A;  1NLV A;  1WBD A;  2H3G X;  3ITH A;  1ZXO A;  4JD2 B;  3NAE A;  4PL7 A;  3AVN A;  1NG9 A;  4KKO A;  4A2A A;  1RBT A;  5J2M A;  1EQY A;  1LW0 A;  3FE1 A;  3NMU A;  1DGK N;  1JLF A;  1XMQ K;  2QA4 N;  5I42 A;  3O9Q A;  2E2Q A;  2ZJQ L;  4DTP A;  1NKB A;  3F9M A;  3HJF A;  3A5L C;  2RPI A;  4LFB K;  3AA5 X;  3AAR A;  3MCA B;  1S5J A;  3CPE A;  2BH1 A;  2NUB A;  4QS9 A;  4OJR A;  3CME N;  2VQE K;  2CGL A;  1JKH A;  3O80 A;  4CJ4 A;  5F0X A;  4LD0 A;  2JLE A;  1KRP A;  1BA1 A;  3PSI A;  5LMN K;  1C1C A;  1IO2 A;  4L3Q A;  3DM2 A;  4DV1 K;  4OPA A;  1VSJ A;  4YOR A;  4JLH A;  4OGC A;  1XNR K;  4DR2 K;  3THV A;  3VQE A;  5AQT A;  2PYL A;  3MED A;  3ID8 A;  4CK3 A;  4F3T A;  3DI6 A;  5KGX A;  3AA3 A;  1B9D A;  3TTC A;  1TKZ A;  3KLI A;  4CD1 A;  3C6T A;  5AFU A;  2NRR A;  4IO9 L;  2IVN A;  3D2F B;  1ZBS A;  5HL7 L;  4WQ4 A;  2DY4 A;  4B1Y B;  1NU0 A;  1HNV A;  1KVC A;  3C7N A;  3CPW M;  4XEI A;  3LL3 A;  4DR7 K;  4AQY K;  4BE0 A;  3THX A;  3RWU A;  3TU5 A;  2OZS A;  4DR4 K;  1XC3 A;  3CER A;  4CJK A;  4FOI A;  4WYB A;  3B8A X;  4FWK A;  2O4G A;  5FPN A;  2IOC A;  4H4O A;  5C0Y A;  4JKF A;  2B6A A;  3E66 A;  4G9Z A;  3M3Z A;  5AQX A;  3ZSO A;  4BC2 A;  1I39 A;  4CZE A;  1K9M O;  2HHQ A;  2E2P A;  2E6M A;  3V9S A;  4B1Z A;  1NMN A;  1IBK K;  2O8E A;  3KLG A;  3CM6 A;  3LP3 A;  4DUZ K;  1EET A;  3VTI A;  4W5R A;  3EE8 A;  4ICL A;  3SPZ A;  1JLQ A;  3TAR A;  1XHX A;  4NLC A;  2O8B B;  2D0C A;  3WT0 A;  5A2Q O;  4BWM A;  2HHV A;  1QSY A;  2RKI A;  1OH6 A;  1EP4 A;  3NF7 A;  3ZT0 A;  4RW8 A;  4FXD A;  4CHN A;  4FWL A;  4B3O A;  4BRA A;  1J5O A;  3EKU A;  4CIF A;  5CYQ A;  4CF8 A;  1C1B A;  5EOY A;  3QLH A;  3R8E A;  3WNH A;  2HHW A;  4K8X A;  3FFI A;  1C0T A;  2XHB A;  3MXJ A;  4OPK A;  4DFP A;  3D2E B;  3WNF A;  1C1A A;  1VSH A;  3N4Q A;  4JNE A;  4Y1D A;  3OS0 A;  2OZM A;  3DXK A;  4CJE A;  4E7L A;  1KC8 O;  1JXB A;  5CR4 A;  4Z94 A;  1NK9 A;  3OYM A;  4WFA L;  3V9X A;  3J7A P;  3GG4 A;  4JV5 K;  5BRD A;  4FK0 A;  4CGD A;  2KFN A;  4CEC A;  1BL3 A;  4F2R A;  4BGB A;  2F8T A;  1S6Q A;  1NMD A;  3I0S A;  1VQ8 N;  4BVP A;  5GIN A;  1KCF A;  3LDQ A;  3V4I A;  4CGI A;  1HNW K;  3SBG A;  3TTD A;  3THY B;  4KRE A;  2NLX A;  2BDP A;  1YT3 A;  3HBT A;  2GBZ A;  3K59 A;  5KGW A;  1CZB A;  3SQ4 A;  4CGG A;  3RMA A;  1Q9Y A;  1S22 A;  2P9P A;  5AQW A;  2OTJ N;  2XY7 A;  5LL6 Z;  5KRS A;  4EP4 A;  1RT3 A;  4E1N A;  1LV5 A;  3DLB A;  2NRW A;  4CJU A;  2VWK A;  3A5M C;  4PUO A;  3TAN A;  1S1W A;  1HRH A;  1QQM A;  4KTW A;  3KVG A;  3ZT3 A;  5JMV A;  3KD5 E;  3HYF A;  3T7Z A;  1NGJ A;  4CFB A;  3S3M A;  5DM7 L;  3QNN A;  3FZK A;  2PY5 A;  2WON A;  4DSE A;  1H1V A;  2Y1J A;  1EKE A;  5CY4 A;  1NK0 A;  2Z1I A;  4GV6 A;  3ZT4 A;  1SL2 A;  5BRF A;  1BI4 A;  4ILH A;  4QS8 A;  2Q36 A;  2D0P A;  3V1R A;  2B5J A;  2YNG A;  5SWM A;  4HTU A;  5GIP A;  2KW4 A;  3OYJ A;  1C0U A;  3V81 A;  4B8A B;  5T7B A;  1VSL A;  3SUP A;  5FRN A;  4XIU A;  4BC4 A;  4CHZ A;  4O8K A;  4DFM A;  5AZI A;  3V6D A;  3S3O A;  1HR0 K;  2KFZ A;  5AQM A;  4Z0U A;  3LAM A;  2XY8 A;  3AVF A;  3FZH A;  4DUY K;  4IJA A;  4TSX A;  4DTR A;  1SAZ A;  1IKX A;  4DSJ A;  4RW6 A;  3QET A;  1DKG D;  3TAP A;  1LAW A;  1K8A O;  4W5O A;  1SL1 A;  5GAE P;  1NBW A;  2G8V A;  2EHG A;  3C7N B;  3L4I A;  1IV0 A;  4QS7 A;  4IEE A;  2JWL A;  3H46 O;  4Q0B A;  2UUB K;  4KV8 A;  3THX B;  1KLM A;  2HHU A;  4BVO A;  4OVL A;  3SNN A;  4MO5 A;  5JVH L;  1Z25 A;  3P5J A;  4C23 A;  3RR7 A;  4H0T B;  3DOL A;  3OYD A;  3A0I X;  1R59 O;  4CEQ A;  3CG7 A;  2HNZ A;  5AR0 A;  1WSG A;  1VSF A;  3W0L A;  3BEX A;  3EY1 A;  3ENH A;  4DSL A;  3M8R A;  2HBK A;  2I7N A;  3ZCM A;  3SAF A;  3SQ2 A;  1YJN N;  2E5L K;  2P9K A;  2PZS A;  4GMJ B;  4RWT A;  3QEW A;  1ZC6 A;  5FRO A;  3HST B;  3QEV A;  3LPT A;  4JI5 K;  4NB4 A;  1VQM N;  1QSL A;  1RTJ A;  3HPO A;  3RVC A;  1YI2 N;  1MA9 B;  3SJJ A;  1VQL N;  2IDO A;  2IVO A;  5AQZ A;  3M8S A;  4CGJ A;  3H6E A;  3JS6 A;  5DK5 A;  4E7H A;  4CFD A;  3J7Z O;  3DRR A;  5E26 A;  1F21 A;  2UUA K;  4FCY A;  4N76 A;  4FM0 A;  4CZJ A;  3T1Y K;  1VQK N;  1XC9 A;  3TAF A;  3JXU A;  4YHH K;  4JS4 A;  1GLL O;  1QQC A;  4I2Q A;  2VCP A;  1P90 A;  1TKT A;  3VQ4 A;  2HMP A;  3DXK B;  2FBY A;  1RIL A;  3LP2 A;  1BHL A;  4LY7 A;  3HI0 A;  4OPH A;  4J2D A;  3WXK A;  2QWP A;  3FZM A;  1NGF A;  5C10 A;  4FWM A;  1HLU A;  4BG8 A;  4M41 A;  4DCH A;  1Q81 O;  4F2S A;  4KHP K;  1QE1 A;  1HUX A;  2VYP A;  5BPL A;  3OYN A;  2FBT A;  2Q2R A;  3V9U A;  4DTO A;  2BTF A;  2HOE A;  3VEW A;  3PIO L;  1NOZ A;  5AQU A;  5C25 A;  1D8Y A;  1HNX K;  4B8C A;  1RT1 A;  4FZZ A;  3R6M A;  2A40 A;  3O08 A;  3I8D A;  1JXE A;  4FLU A;  2WOM A;  4IJN A;  4KHN A;  4FWQ A;  4FPB A;  4JI8 K;  4M3Y A;  4H03 B;  1X9W A;  4PY5 A;  2OPP A;  1GLB G;  2P9P B;  4IOX A;  4K0K K;  1GOA A;  4FJX A;  3CCL N;  1FJG K;  2P9N A;  3M6G A;  5HRN A;  4B9S A;  3DLE A;  3ZEU A;  3OA9 A;  3O8M A;  4N47 A;  4FLT A;  3CF5 L;  4EHU A;  2ZGZ A;  4PWD A;  3QFU A;  2YI1 A;  3QNO A;  2QI2 A;  1OH8 A;  2HHH K;  1BO5 O;  4CIG A;  4CF9 A;  1C0M A;  3OYL A;  3D6R A;  4BR2 A;  4EIA A;  2QKB A;  4IOA L;  2Q31 A;  3QBW A;  4CF1 A;  1T05 A;  1VQN N;  1U45 A;  1TK8 A;  5HLF A;  4PKH A;  4DV6 K;  1HKC A;  3DLL L;  1QVG M;  4YOV A;  2E20 A;  4FLX A;  1BI4 B;  4LF8 K;  1C0G A;  1HX1 A;  2J4R A;  3ZT1 A;  2O4I A;  3L2Q A;  4EFH A;  3NF8 A;  4BE1 A;  4JI0 K;  1X1P A;  3C95 A;  4YOU A;  2P5O A;  4NYF A;  5AQN A;  2QKK A;  1RCH A;  5FLX O;  4FPA A;  4OKE A;  5AZI B;  2YKM A;  4KI4 A;  3L6Q A;  3KLE A;  3EZ5 A;  4DV2 K;  3ZX0 A;  1V4T A;  3VEO A;  1NJW A;  4Z4E A;  5F2R A;  4HUG A;  5HRP A;  3TSQ A;  4CCH A;  4CHY A;  1KQS M;  4CHQ A;  4FL9 A;  3L4Q A;  4H0Y B;  2KTQ A;  4QAG A;  4M3U A;  1JCE A;  3D0P A;  4BRN A;  1WSF A;  3BDP A;  4B9N A;  4FWR A;  3J81 O;  3O4N A;  3LWM A;  1X9J A;  1ASW A;  4BDY A;  5J2N A;  1UAX A;  3DLG A;  3OYE A;  2O8D A;  1T03 A;  2W42 A;  1WN7 A;  4CED A;  3G25 A;  4LF6 K;  4ELT A;  2HBM A;  4J2E A;  1FK9 A;  3HOT A;  4ILJ A;  3L8B A;  3OYG A;  4FJ8 A;  3AY9 A;  4LSL A;  4DTN A;  2FBV A;  1W7A A;  2X6N A;  1P8Z A;  3HSC A;  5CHI A;  3OY9 A;  3VF2 A;  3I56 N;  4DV4 K;  5BR8 K;  1CLQ A;  3RTV A;  3K57 A;  3A5O C;  2RHK A;  2P9K B;  3AVC A;  1MWK A;  4CEF A;  3VGK A;  3OS2 A;  1NOY A;  4LSN A;  4BC3 A;  2XO7 A;  4B9U A;  4BR9 A;  4F3O A;  4HCB A;  5BN9 A;  1U4B A;  5AQP A;  2GEM A;  1WSE A;  3A8Y A;  3HO1 A;  5HRR A;  1M90 O;  5BPN A;  4E1M A;  3E9O A;  5HOO A;  4X65 K;  5LY3 A;  3H1V X;  1NKC A;  1LCU A;  4FVM A;  4CJL A;  3MX5 A;  3MDQ A;  3KK7 A;  3ZLJ A;  4H4M A;  5AJ3 K;  4NXN K;  1RGI A;  2FXU A;  4CEO A;  3VER A;  4CBW A;  3PO5 A;  3CCS N;  5CE3 A;  4FLV A;  4GKJ K;  2B4J A;  5C24 A;  4YOT A;  3KLH A;  1NGD A;  4FJ7 A;  2WFB A;  2V7Y A;  3TWH A;  4FWS A;  3OBY A;  1S1X A;  3NE6 A;  1M1K O;  4AM6 A;  1BG3 A;  1XWL A;  5M1P A;  1J54 A;  1RDA A;  3PY8 A;  3VOV A;  2UXC K;  4CZK A;  4A5B A;  2R7Y A;  3SMP A;  4E0D A;  3WEE A;  3CCM N;  4B3T K;  3ID6 A;  1C0F A;  5I3U A;  4CJR A;  3SUO A;  3ZSY A;  1NGE A;  5AQR A;  3ZSR A;  3HT3 A;  1SKS A;  4KTZ A;  4ISG A;  4BG9 A;  3OS1 A;  3QIP A;  3DRS A;  4FLW A;  1N33 K;  1KFD A;  1WUA A;  5JS1 A;  4NCB A;  4IOC L;  1Z6R A;  1NGA A;  1S9G A;  1GLC G;  1TK0 A;  3CCR N;  2FF6 A;  1ASV A;  4QCL A;  2P9N B;  4CJS A;  3LP1 A;  4FJK A;  1O13 A;  3ZEU B;  4ZTF A;  4CD3 A;  4B9L A;  1HNI A;  2FC0 A;  3C94 A;  2V52 B;  2HBJ A;  2DFH A;  4PL8 A;  4CBU A;  4DV3 K;  3F2K A;  3QB0 A;  3OYI A;  1HKG A;  3OJU A;  2F9W A;  1DLO A;  4EHT A;  3CD6 N;  3AVJ A;  3P83 D;  3CJB A;  4CGF A;  3BZK A;  2IAJ A;  2JWK A;  4X62 K;  4KPY A;  3U9Z A;  4A2B A;  4A62 A;  1HQE A;  1J5E K;  2UYT A;  4DR6 K;  3PO4 A;  3T19 A;  2QWO A;  1GOB A;  3KWI A;  3QIC A;  5IWA K;  4I9L A;  3CM5 A;  1NJI O;  5BN8 A;  1REV A;  1BQM A;  1Q8I A;  3G10 A;  4HVJ A;  1W0H A;  4B1W B;  2YNF A;  4X66 K;  1X9M A;  5C15 A;  1NGG A;  3QEX A;  3HM9 A;  1A5X A;  3OYB A;  4GV9 A;  3CJC A;  1BCO A;  4RG8 A;  4DB3 A;  4ISE A;  4AHU A;  1NGI A;  4DF8 A;  3KTQ A;  3E01 A;  3AO5 A;  4C8O A;  3EL2 A;  4M7X A;  3MXI A;  1TVR A;  3Q7C A;  1FW6 A;  4OKJ A;  1LAV A;  2VG6 A;  3K9K A;  1RT4 A;  3U3G A;  3OTO K;  1U47 A;  3BF3 A;  4JI4 K;  4BRD A;  4ZTJ A;  4FWN A;  4FWO A;  2O8D B;  1VSM A;  3ZT2 A;  3UIQ A;  4ID5 A;  2CH6 A;  2ZE2 A;  4YNQ A;  4DU4 A;  4LH4 A;  1HYV A;  3FZL A;  4FZX C;  3IAY A;  1TGO A;  4CJ5 A;  4I7F A;  3V1O A;  4GW6 A;  4DMN A;  3QIN A;  2Q3S A;  1I3A A;  3HVR A;  3LZJ A;  4KAZ A;  4KBO A;  4BRL A;  4DR5 K;  2A5X A;  2A41 A;  4BR5 A;  1CXQ A;  1KAX A;  3ATU A;  5KQ8 A;  1IKV A;  4EZ9 A;  5SZT A;  1WAJ A;  3P39 A;  1TL3 A;  1YJW N;  3QER A;  1QZ6 A;  3HM8 A;  3VEY A;  3AGR A;  2D1K A;  3UKU A;  3HZ6 A;  4LF4 K;  5GIO A;  4DLE A;  1WSJ A;  3O3G A;  4DTS A;  5JIC A;  4O0J A;  3H1Q A;  4NYN A;  1Z26 A;  3WXM B;  4FZY A;  3LP0 A;  4CI6 A;  4DFK A;  3G6E N;  4JI3 K;  4DQI A;  4IFV A;  3GBT A;  4CHO A;  4R5P A;  4FJN A;  1KLN A;  3D45 A;  3LAN A;  1EWR A;  1S9E A;  4M3W A;  4BQL A;  3HVT A;  4Q5V A;  3SI6 A;  5AQH A;  3SZ2 A;  4FM2 A;  3K9J A;  1W97 L;  2LSN A;  3D7E O;  4DQS A;  3KK1 A;  1T6C A;  1JLG A;  3RRG A;  4EZ6 A;  4FYD A;  5BRH A;  4C8K A;  2Z1H A;  2WC9 A;  3AGK A;  4JK8 A;  4DSI A;  3KWG A;  2HHS A;  3L2W A;  3VA3 A;  4FJM A;  4O8U A;  2WTU A;  4YFU A;  5BR9 A;  1RDC A;  3DWL A;  3WEE B;  1N34 K;  2E6L A;  4RTF D;  1B92 A;  1ZBI A;  2HF4 A;  4RW4 A;  4LFC K;  4E3S A;  2F4V K;  2I5J A;  2HVI A;  1L3S A;  1HYS A;  1G15 A;  3P1G A;  4B3R K;  2OA8 A;  1TV6 A;  2G8W A;  5J2P A;  4CES A;  4K43 A;  3R9P A;  1QVF M;  4GKK K;  3AVG A;  4DHY A;  3HK2 A;  4JN4 A;  1LWC A;  4WF9 L;  1BIZ A;  1IG9 A;  3SAH A;  1IBL K;  4B9V A;  3H08 A;  4IEI A;  1NK4 A;  1U2V A;  2D5R A;  1U48 A;  5AQS A;  4E19 A;  5M1N A;  4BY9 C;  3NCI A;  4A59 A;  1YIT N;  3CET A;  3O3F A;  3BY5 A;  1RTH A;  3IKM A;  3T3F A;  1ATR A;  1GLJ O;  1RTI A;  4O4G A;  2VQF K;  1RBU A;  2YJE A;  4DR3 K;  1SKR A;  4I2P A;  1VQO N;  3T1H K;  4GVE A;  3P38 A;  3LDL A;  1UA0 A;  2BAN A;  1OVQ A;  1RDU A;  3SCX A;  3AO3 A;  3CJ1 A;  3VES A;  1RT6 A;  3L0Q A;  3NH1 A;  4J8F A;  3I0R A;  5TKW A;  3E9P A;  2GX9 A;  2Y1I A;  4BRP A;  1JLB A;  1K6Y A;  4OLB A;  1VQ6 N;  2ZD1 A;  1YTA A;  2WUS A;  2BGG A;  3ATV A;  4XH4 A;  4CIE A;  3SQ1 A;  4B1U B;  2GUI A;  4YOW A;  2HBL A;  3K2P A;  3T1A A;  5FPM A;  3ZSQ A;  4ID1 A;  3PX6 A;  3G4S N;  2ASO A;  2Z1G A;  2YHX A;  1Y64 A;  3C6H A;  4K41 A;  4BDP A;  4DSK A;  4KH6 A;  3KKR A;  2DFF A;  2OPR A;  1BIU A;  3IMX A;  4W5T A;  4CEE A;  4FJL A;  2JGU A;  2X74 A;  5AQV A;  4JHD A;  1BQN A;  2GWK A;  3MEE A;  2QK9 A;  1BCM A;  3MK6 A;  3TR8 A;  4WQ5 C;  4KHW A;  1OVY A;  1BU6 O;  3WNG A;  3CFO A;  1IJJ A;  1LWF A;  4GY2 B;  3TSU A;  4AIL C;  4ILG B;  3K58 A;  4NXM K;  1V4S A;  4CJQ A;  3OYK A;  4KH4 A;  1RDB A;  4JK7 A;  4BQZ A;  4ZHR A;  4IZ9 A;  2O8C A;  2O8E B;  3CQ8 A;  1LWE A;  2ITG A;  2A1S A;  2P51 A;  3VPZ A;  1BUP A;  2ITM A;  4Z4H A;  4BRG A;  4EP5 A;  3L3V A;  4YDU C;  1MU2 A;  1NJY A;  4FO0 A;  2OTL N;  1BGX T;  5EXW A;  4YOY A;  2HB5 A;  2A3Z A;  3Q7B A;  4X64 K;  2YNI A;  2VGN A;  3AVM A;  3PX4 A;  4F4K A;  4DSF A;  4IO8 A;  4JI1 K;  2KLA A;  2E1Z A;  3LDN A;  4N5S A;  2YHY A;  2G8U A;  3UKU B;  2G8H A;  3MCP A;  1IH7 A;  4AHC A;  2ASM A;  5BRE A;  4H5R A;  2BUP A;  2IS3 A;  4DTX A;  3VEV A;  4FK2 A;  4GNI A;  4IBN A;  2PYJ A;  4AH9 A;  3DLR A;  4DS4 A;  1NK6 A;  3S9H A;  5C12 A;  3DJC A;  1QQN A;  1KVB A;  3WXJ A;  2EX3 A;  1NKE A;  1IKY A;  4HUF A;  3B6O A;  2YNH A;  1EO1 A;  3FLC O;  3ENO A;  5FDL A;  1HKB A;  1R0A A;  2CH5 A;  4CGH A;  4CFA A;  1RT5 A;  1CZ9 A;  4UY8 O;  3MN9 A;  2NNW A;  4CZF A;  4O0I A;  3CFR A;  3ENB A;  4FLY A;  3U3Y A;  2NRZ A;  1VRU A;  3H3O B;  4JKG A;  1RBV A;  5JS2 A;  3DAW A;  3SV4 A;  3FFK B;  1SQK A;  1T6D A;  2XRI A;  3MEC A;  1TAU A;  4BAC A;  5ADX A;  3LAK A;  3MEG A;  3O5B A;  4BE2 A;  3NBP A;  3J7Y P;  2A42 A;  4B9Q A;  3TSP A;  3GOI A;  2YJF A;  2OPS A;  5LJW A;  3VA0 A;  3THW A;  1VQ9 N;  1XHZ A;  3CI5 A;  4CBX A;  1TYQ A;  2E4L A;  3O9R A;  2VGM A;  4IFY A;  3QEP A;  2IC3 A;  1QHA A;  1QSS A;  3TI0 A;  2PAV A;  4Z4C A;  2FF3 B;  4Z4I A;  3WXI A;  1U2V B;  2D4W A;  4U7B A;  3LWL A;  3MN7 A;  3TPQ A;  1WBB A;  3GL1 A;  3AV9 A;  1HNZ K;  3KHY A;  3CQY A;  3PX0 A;  2FBX A;  4CEB A;  1GLE G;  1JCF A;  3NGZ A;  4JEP A;  3EO3 A;  4LF7 K;  4Z4F A;  5E84 A;  4Y1C A;  1N32 K;  3E9L A;  3VQB A;  3K5M A;  3I55 N;  4BGA A;  1HJR A;  2OCE A;  4JKD A;  2HVH A;  3AVA A;  3O9T A;  1YIJ N;  1NK5 A;  4K42 A;  1TKD A;  4QOZ B;  1ESV A;  4ISF A;  5DMR A;  3NHG A;  4M7Y A;  4WQ5 A;  2ATQ A;  3TAE A;  1BWF O;  1X9S A;  3AAQ A;  4LFA K;  5KPR A;  5HRO A;  4I9Q A;  2GWJ A;  1XI1 A;  3O4W A;  4JHD B;  1Q86 O;  4AHT A;  5KQD A;  2ZJR L;  4AM7 A;  1E4F T;  1D4X A;  1J53 A;  4CEZ A;  2VWJ A;  4DG1 A;  3DRP A;  4YY3 K;  1Z05 A;  2ZQB A;  1J9A A;  1YVN A;  4JAX A;  3SJH A;  3RR8 A;  1JL2 A;  1RTD A;  3G0Z A;  4A5A A;  4YDU A;  4MDB A;  4H8K A;  4CER A;  4FVU A;  2VG7 A;  2P9S A;  3H45 C;  4Z4G A;  3F73 A;  2A1R A;  1VSD A;  4H0P A;  1UOC A;  2OPQ A;  3AVL A;  5ADX H;  2O8C B;  1DT9 A;  2UU9 K;  2QXL A;  3CCQ N;  3VEN A;  3NH2 A;  3CJ7 A;  3J80 O;  4H0X B;  3FZF A;  4CJW A;  2UUC K;  5J1E A;  5MLC Q;  4A61 A;  3VQA A;  3NFA A;  3SAG A;  1UWB A;  3HOS A;  2DFE A;  3AAP A;  4HUE A;  3C6U A;  4OX9 K;  4F8R A;  2E88 A;  3PUF A;  4KHQ A;  1A5V A;  4XH5 A;  2DPN A;  4JKE A;  1ASU A; 
#chains in the Genus database with same CATH homology
 1SL2 A;  1WSI A;  1WLJ A;  4OKJ A;  1BI4 A;  3QEI A;  3M8Q A;  1LAV A;  1QTM A;  3V1R A;  2VG6 A;  2A1R A;  2B5J A;  2YHB A;  2RN2 A;  2YNG A;  5EU7 A;  5SWM A;  1RT4 A;  2P1J A;  3U3G A;  2KW4 A;  4HTU A;  1U47 A;  3OYJ A;  4CJP A;  1C0U A;  3V81 A;  4B8A B;  5T7B A;  4ZTJ A;  3K5N A;  3JYT A;  1RBR A;  1KTQ A;  1RT2 A;  1VSL A;  1HYZ A;  1VSM A;  3O4Q A;  3VQ5 A;  3ZT2 A;  4M45 A;  3SUP A;  5FRN A;  1VSE A;  3UIQ A;  4XIU A;  4J2A A;  4ID5 A;  4CHZ A;  2ZE2 A;  4LH5 A;  4DFM A;  1L3T A;  4YNQ A;  3V6D A;  3S3O A;  3AO2 A;  4DU4 A;  4LH4 A;  1HYV A;  4FZX C;  3IAY A;  1N5Y A;  2KFZ A;  4Z0U A;  3LAM A;  2XY8 A;  1TGO A;  3AVF A;  4CJ5 A;  5KI6 A;  4I7F A;  4KRF A;  3V1O A;  4UQG A;  1TK5 A;  2F8S A;  3CYM A;  4CJT A;  4GW6 A;  4DMN A;  3DOK A;  3QIN A;  2Q3S A;  3L2U A;  4TSX A;  1I3A A;  3HVR A;  3LZJ A;  4DTR A;  1FKP A;  1U49 A;  1IKX A;  3DLH A;  4RW6 A;  4DSJ A;  1YVU A;  3QET A;  3TAP A;  1LAW A;  4J2B A;  3JSM A;  4W5O A;  1L3V A;  1CXQ A;  1SL1 A;  4KI6 A;  2HND A;  1GOC A;  1IKV A;  2G8V A;  2EHG A;  3AO4 A;  3ISN C;  5SZT A;  4EZ9 A;  4M3Z A;  1WAJ A;  1TL3 A;  3QER A;  4KO0 A;  5J2Q A;  4CF2 A;  3SUN A;  3AVB A;  4Q0B A;  4KV8 A;  1KLM A;  2HHU A;  1RNH A;  4DLE A;  3SPY A;  1WSJ A;  3O3G A;  4OVL A;  3NGI A;  3V9W A;  1KSP A;  4DU1 A;  4DTS A;  3L3U A;  4O0J A;  3SNN A;  4B9T A;  1UA1 A;  4NYN A;  2RF2 A;  3OYC A;  1Z25 A;  1Z26 A;  4KHY A;  1SV5 A;  3P5J A;  3LPU A;  3RR7 A;  4M3T A;  4FZY A;  3HP9 A;  3AVH A;  3LP0 A;  3DOL A;  3A2F A;  4DFK A;  3OYD A;  1WAF A;  3NF6 A;  2GV9 A;  4DU3 A;  4FW2 A;  4DQI A;  4IFV A;  3MAQ A;  4CEQ A;  3S3N A;  3CG7 A;  4N56 A;  1ZBL A;  1TKX A;  2HNZ A;  4CHO A;  4R5P A;  2KQ2 A;  1N6Q A;  4FJN A;  1KLN A;  3D45 A;  1WSG A;  3LAN A;  1S9E A;  1VSF A;  1QHT A;  3HVT A;  4WE1 A;  4ELV A;  1Y97 A;  3QO9 A;  3EY1 A;  2KZM A;  3KD1 E;  4Q5V A;  3SI6 A;  4GVM A;  4DSL A;  3M8R A;  4PQU A;  4CJF A;  3SZ2 A;  4FM2 A;  3SQ2 A;  3ZCM A;  1CXU A;  2LSN A;  1ZYQ A;  4DQS A;  4KB0 A;  1EXQ A;  1FKO A;  4GMJ B;  4W5Q A;  3KK1 A;  4E89 A;  4DTM A;  3L2V A;  3QEW A;  3HPH A;  2PZS A;  1JLG A;  3RRG A;  4EZ6 A;  4FYD A;  1O1W A;  4C8K A;  2Z1H A;  5FRO A;  3HST B;  4CK1 A;  3QEV A;  1T8E A;  3LPT A;  4DSI A;  2HHS A;  3L2W A;  3VA3 A;  4FJM A;  1QSL A;  1RTJ A;  2AJQ A;  5FRM A;  5CYM A;  3SQ0 A;  4KFB A;  4YFU A;  3HPO A;  1S6P A;  4AHS A;  1RDC A;  2HMI A;  4ELU A;  4BWJ A;  4FJJ A;  3VQD A;  3SJJ A;  2E6L A;  2IDO A;  1B92 A;  4PA1 A;  4CGJ A;  3M8S A;  3CFP A;  5DK5 A;  1NK8 A;  4E7H A;  1ZBI A;  5K14 A;  4CFD A;  4KHS A;  4RW4 A;  3DRR A;  4E3S A;  3HPG A;  4K8Z A;  4L8R B;  2XY6 A;  1F21 A;  4FCY A;  4N76 A;  4FM0 A;  3OVN A;  2I5J A;  3M8P A;  2HVI A;  1L3S A;  1SUQ A;  1ZBU A;  1HYS A;  1G15 A;  3P1G A;  3NH0 A;  4DQP A;  1XC9 A;  2HHX A;  3TAF A;  2OA8 A;  1TV6 A;  2G8W A;  5J2P A;  4CES A;  1RDD A;  4AHR A;  4JS4 A;  2HNY A;  1HMV A;  1QQC A;  4I2Q A;  3VQ9 A;  1TKT A;  3VQ4 A;  3AVG A;  2FBY A;  1RIL A;  3LP2 A;  3HK2 A;  2VG5 A;  1TL1 A;  1LWC A;  1IKW A;  1BHL A;  3ASM A;  4LY7 A;  1BIZ A;  4FM1 A;  1IG9 A;  4B9V A;  3H08 A;  1NK4 A;  4J2D A;  1ITG A;  2D5R A;  1BIS A;  4DTU A;  3AA4 A;  4IG0 A;  1U48 A;  3VQC A;  4DFJ A;  4MQ3 A;  4W5N A;  1RBS A;  4E19 A;  4M41 A;  3NCI A;  4F2S A;  1HPZ A;  4FJG A;  3NF9 A;  1QE1 A;  1T7P A;  2X78 A;  1LW2 A;  3O3F A;  2DTU A;  3AA2 A;  1RTH A;  3OYN A;  3T3F A;  2FBT A;  3K5L A;  3V9U A;  1RTI A;  4DTO A;  4O4G A;  1SKW A;  3RMA A;  1RBU A;  1NOZ A;  1SKR A;  4I2P A;  2P5G A;  2KZZ A;  2Z1J A;  3HL8 A;  5C25 A;  2D0A A;  5E41 A;  1D8Y A;  3KLF A;  4B8C A;  1RT1 A;  3VQP A;  4FZZ A;  4O5B A;  4E7J A;  3LDS A;  1UA0 A;  2BAN A;  1JXE A;  3I8D A;  4FJH A;  4E7K A;  2HHT A;  3SCX A;  4FLU A;  1B9F A;  1D9D A;  3AO3 A;  2WOM A;  2HW3 A;  4C8L A;  4CF0 A;  1RT6 A;  4KHN A;  4CFC A;  4KAZ A;  3NH1 A;  4M3Y A;  3TAB A;  3OJS A;  2G8F A;  1S1V A;  3I0R A;  5CZ2 A;  3O3H A;  3KJV A;  1X9W A;  2Y1I A;  1KFS A;  4PY5 A;  1JLB A;  2OPP A;  5KRT A;  4AHV A;  1K6Y A;  4DTJ A;  4OLB A;  1S1T A;  2ZD1 A;  1DTT A;  1YTA A;  1Q9X A;  2BGG A;  3IG1 A;  3SQ1 A;  4CIE A;  2GUI A;  1GOA A;  4FJX A;  4HHT A;  3U6F A;  3K2P A;  3T1A A;  3ZSQ A;  1NK7 A;  4ID1 A;  5HRN A;  3PX6 A;  4B9S A;  2Z1G A;  3DLE A;  4FLT A;  3K5O A;  4N47 A;  4DSK A;  4BDP A;  3TAG A;  3KKR A;  2DFF A;  2OPR A;  1BIU A;  2YKN A;  4OKK A;  4W5T A;  3QNO A;  4PWD A;  4CEE A;  5HP1 A;  3ULD A;  4FJL A;  3DYA A;  1DTQ A;  4CIG A;  2JGU A;  4CF9 A;  1C0M A;  4CEA A;  3OYL A;  2X74 A;  2QKB A;  1BQN A;  3VN5 A;  5D3G A;  3MEE A;  1C6V A;  3OYH A;  4O44 A;  1VRT A;  3IS9 A;  4O55 A;  2QK9 A;  1BCM A;  4CF1 A;  4CK2 A;  1T05 A;  5KTQ A;  3MXM A;  3TR8 A;  3TAQ A;  1U45 A;  1TK8 A;  5HLF A;  4FW1 A;  4KHW A;  1WNS A;  3WNG A;  3CFO A;  4RW9 A;  3ITH A;  1LWF A;  3RMD A;  4FLX A;  3ZSV A;  1ZBH A;  1BI4 B;  3TAM A;  4AIL C;  3AVK A;  3NAE A;  3K58 A;  3ZT1 A;  4CHP A;  3AVN A;  2O4I A;  3L2Q A;  4CJQ A;  4FK4 A;  3LAL A;  3SYZ A;  4FJ5 A;  3OYK A;  3DLK A;  1RDB A;  3NF8 A;  4BE1 A;  1X1P A;  3C95 A;  4ZHR A;  4MFB A;  4KKO A;  2P5O A;  4NYF A;  2G8I A;  1RBT A;  5J2M A;  2QKK A;  1RCH A;  3CQ8 A;  1LWE A;  1VSK A;  2ITG A;  1LW0 A;  4OKE A;  2YKM A;  2A1S A;  2P51 A;  4KI4 A;  1QS4 A;  1JLF A;  3ALY A;  4Z4H A;  3KLE A;  1W9H A;  3EZ5 A;  3ZSX A;  5I42 A;  4EP5 A;  4DTP A;  1NKB A;  3L3V A;  1MU2 A;  1NJY A;  3IRX A;  3HJF A;  1NJW A;  4Z4E A;  1JLA A;  2RPI A;  1BGX T;  3AA5 X;  4HUG A;  5HRP A;  2HB5 A;  4CCH A;  4CHY A;  4CHQ A;  1S5J A;  4DLG A;  4FJI A;  2YNI A;  3AVM A;  3PX4 A;  4F4K A;  4CJ3 A;  2NUB A;  4DSF A;  4CJV A;  2KTQ A;  4OJR A;  4QAG A;  3VQ8 A;  4IDK A;  4M3U A;  1L3U A;  1JKH A;  4E7I A;  4CJ4 A;  3KKS A;  3D0P A;  4N5S A;  1WSF A;  3BDP A;  2G8U A;  4LD0 A;  4B9N A;  2JLE A;  2G8H A;  3OYF A;  1KRP A;  3O4N A;  1IH7 A;  1C1C A;  1IO2 A;  4AHC A;  3LWM A;  3DM2 A;  1NJZ A;  1ASW A;  4BDY A;  5J2N A;  1UAX A;  3DLG A;  3OYE A;  1T03 A;  1TAQ A;  3BGR A;  2W42 A;  1VSJ A;  1WN7 A;  2IS3 A;  4CED A;  4JLH A;  4OGC A;  4DTX A;  4ELT A;  4J2E A;  3THV A;  3VQE A;  1FK9 A;  4FK2 A;  4IBN A;  2PYJ A;  2PYL A;  3MED A;  3L8B A;  3OYG A;  4CK3 A;  4FJ8 A;  4AH9 A;  3DI6 A;  4LSL A;  3AA3 A;  3DLR A;  2FBV A;  1B9D A;  5KGX A;  1TKZ A;  4DS4 A;  4DTN A;  4IKF A;  4B08 A;  1NK6 A;  3S9H A;  2X6N A;  1D5A A;  3KLI A;  3OYA A;  3OY9 A;  3C6T A;  1KVB A;  2EX3 A;  1NKE A;  1IKY A;  3HXM A;  4HUF A;  3B6O A;  3HP6 A;  2YNH A;  1CLQ A;  3RTV A;  3K57 A;  5FDL A;  3VQQ A;  3ZSZ A;  1R0A A;  1RT7 A;  4CGH A;  2YHA A;  2DY4 A;  4CE9 A;  4DS5 A;  1HNV A;  1KVC A;  4CFA A;  3QES A;  3AVC A;  1RT5 A;  1CZ9 A;  2QXF A;  4CEF A;  1WSH A;  3OS2 A;  4O0I A;  4LSN A;  1NOY A;  2XO7 A;  4BE0 A;  4B9U A;  3RWU A;  4F3O A;  3CFR A;  2OZS A;  4CJK A;  4HCB A;  1U4B A;  4FLY A;  4HCC A;  1WSE A;  3U3Y A;  1VRU A;  3VQ7 A;  5HBM A;  3HO1 A;  2O4G A;  5CZ1 A;  2IOC A;  5HRR A;  1RBV A;  1A5W A;  5JS2 A;  4H4O A;  4E1M A;  1S1U A;  3SV4 A;  2B6A A;  2XRI A;  1NKC A;  3MEC A;  4FVM A;  3F9K A;  3ZSO A;  1TAU A;  1I39 A;  4BAC A;  2HHQ A;  3LAK A;  3MEG A;  1JL1 A;  2E6M A;  3NBP A;  4CJL A;  4BE2 A;  3V9S A;  1NJX A;  4H4M A;  1Q9Y A;  2OPS A;  4CEO A;  3VA0 A;  1XHZ A;  3QIO A;  3KLG A;  3CM6 A;  3PO5 A;  4FLV A;  3LP3 A;  2B4J A;  1VK0 A;  2E4L A;  4G1Q A;  5C24 A;  4IFY A;  3KLH A;  3QEP A;  2IC3 A;  4FJ7 A;  1QSS A;  2F96 A;  4NCA A;  4W5R A;  3TI0 A;  4Z4C A;  4Z4I A;  4ICL A;  3TWH A;  3VQ6 A;  1JLQ A;  4DQQ A;  3SPZ A;  3TAR A;  1XHX A;  1S1X A;  3NE6 A;  2XY5 A;  3LWL A;  1XWL A;  4FJ9 A;  2D0C A;  1J54 A;  1RDA A;  3V9Z A;  4BWM A;  1YTU A;  3PY8 A;  2HHV A;  1QSY A;  2R7Y A;  2RKI A;  1EP4 A;  3NF7 A;  3ZT0 A;  3SV3 A;  4RW8 A;  3AV9 A;  4E0D A;  4FXD A;  4CHN A;  3PX0 A;  4B3O A;  3AO1 A;  2FBX A;  1J5O A;  4CEB A;  4OLA A;  4CIF A;  5CYQ A;  3PV8 A;  5I3U A;  4CF8 A;  1JLE A;  1C1B A;  2X6S A;  3NGZ A;  3QLH A;  3WNH A;  4JRQ A;  4Z4F A;  2HHW A;  4CJR A;  3WNE A;  3SUO A;  4K8X A;  3FFI A;  4Y1C A;  3ZSY A;  1C0T A;  2XHB A;  3MXJ A;  3ZSR A;  4OPK A;  3HT3 A;  4DFP A;  1SKS A;  2G8K A;  4KTZ A;  2BE2 A;  3VQB A;  3WNF A;  2IGI A;  1C1A A;  3K5M A;  1HQU A;  1VSH A;  3OS1 A;  4DF4 A;  1HJR A;  4Y1D A;  3QIP A;  3OS0 A;  2OZM A;  4M42 A;  2HVH A;  3RMB A;  3DRS A;  3AVA A;  4FLW A;  1KFD A;  1NK5 A;  5JS1 A;  1TKD A;  4NCB A;  4CJE A;  4QOZ B;  4E7L A;  4KTQ A;  1JXB A;  5DMR A;  3NHG A;  4DQR A;  1KVA A;  3EYZ A;  4JS5 A;  4NCG A;  1S9G A;  1NK9 A;  1TK0 A;  3OYM A;  4KHU A;  2ATQ A;  3KK2 A;  1ASV A;  3TAE A;  4CJS A;  3V9X A;  1VSI A;  4QCL A;  3LP1 A;  4FJK A;  4BDZ A;  4ZTF A;  1X9S A;  4FK0 A;  4CGD A;  4B9L A;  1HNI A;  4CEC A;  2FC0 A;  3C94 A;  2KFN A;  1BL3 A;  2DFH A;  3SUQ A;  3RMC A;  5HRO A;  4F2R A;  2F8T A;  1U04 A;  3OYI A;  1S6Q A;  3OJU A;  4I9Q A;  1DLO A;  3I0S A;  1XI1 A;  1ZBF A;  4OGE A;  4AHT A;  1D9F A;  3AVJ A;  1KCF A;  3P83 D;  1J53 A;  4CGF A;  3V4I A;  4CEZ A;  4CGI A;  4IG3 A;  2VWJ A;  4DG1 A;  2IAJ A;  3DRP A;  4KRE A;  4KPY A;  2ZQB A;  1J9A A;  2BDP A;  1YT3 A;  1HQE A;  2GBZ A;  1JL2 A;  1RTD A;  3NDK A;  3RR8 A;  4N41 A;  3PO4 A;  3K59 A;  4M3X A;  4M3R A;  3G0Z A;  3T19 A;  5KGW A;  5HRS A;  1CZB A;  1GOB A;  4H8K A;  4CER A;  4I9L A;  3SQ4 A;  2VG7 A;  3CM5 A;  2YV0 X;  4KB1 A;  4Z4G A;  1REV A;  1EX4 A;  3KIO A;  1VSD A;  3DMJ A;  1BQM A;  4CGG A;  3F73 A;  3B6P A;  1Q8I A;  1UOC A;  2OPQ A;  4FLZ A;  3RRH A;  3G10 A;  4F3T A;  3AVL A;  4HVJ A;  1W0H A;  3LZI A;  3V1Q A;  4JRP A;  2XY7 A;  4M3W A;  2YNF A;  5KRS A;  4OPJ A;  3NH2 A;  1X9M A;  3KK3 A;  4EP4 A;  1RT3 A;  4E1N A;  4RW7 A;  3QEX A;  1LV5 A;  4CJU A;  3HM9 A;  1A5X A;  4CJW A;  3DLB A;  5J1E A;  3OYB A;  2VWK A;  3NGY A;  1BCO A;  4RG8 A;  4PUO A;  3TAN A;  1HRH A;  1S1W A;  1JLC A;  4AHU A;  1SL0 A;  4DF8 A;  3KTQ A;  4KTW A;  3E01 A;  3VQA A;  3ZT3 A;  3NFA A;  3AO5 A;  1L5U A;  3KD5 E;  3HYF A;  3ZSW A;  1UWB A;  4C8O A;  2ETJ A;  2DFE A;  4CFB A;  4C8N A;  3S3M A;  3L2R A;  3QNN A;  2PY5 A;  4HUE A;  4B9M A;  2WON A;  3C6U A;  4DSE A;  2Y1J A;  4F8R A;  3MXI A;  3PUF A;  1TVR A;  1EKE A;  1FXX A;  5CY4 A;  1A5V A;  4C8M A;  1NK0 A;  2OYQ A;  4KHQ A;  2Z1I A;  4DWI A;  1ASU A;  2D0B A;  1EET A;  5C42 A;  3AVI A;  3ZT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...