2Z1JA

Crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
151
structure length
151
Chain Sequence
MLKRVEIFTDGSCLGNPGPGGYGAILRYRGREKTFSAGYERTTNNRMELMAAIVALEALKEHCEVILSTDSHYVRKGITEWIHNWKKRGWKKADKKPVKNVDLWKRLDAALGRHKIKWEWVKGHAGHPENERCDELARAAAMKPKLEDTGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HI
publication title Protein Thermostabilization Requires a Fine-tuned Placement of Surface-charged Residues
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 48
structure length 151
sequence length 151
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2007-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2z1jA00
1EXQA 4CEDA 3SPYA 4CJWA 3G0ZA 4CJPA 3NGYA 1NK5A 4DU4A 4F8RA 1EETA 3TAGA 3C94A 4CEAA 4XIUA 4RW6A 4CHQA 1RBSA 3OS0A 3SQ4A 3I0RA 4EZ6A 3HO1A 2HHQA 4M3XA 3HSTB 2A1SA 4CK3A 1Q9XA 3SNNA 1RDAA 3OYEA 4KRFA 2HHUA 1J5OA 4FM1A 4OLBA 4IDKA 3RR8A 5JS2A 1S1XA 3HT3A 1T7PA 4KHNA 1F21A 1NJXA 3CFOA 2ATQA 2YKMA 1JL1A 1LAVA 2B5JA 3HM9A 4FLZA 1WSFA 3TARA 4Z4GA 2HB5A 1WSJA 2AJQA 4B9LA 2QKBA 4DU1A 2WOMA 1JLBA 4CF2A 1BQMA 2YNHA 3AVIA 3VA3A 3TAQA 1L3TA 1L3UA 3DRSA 3DMJA 3NH2A 4FCYA 3F9KA 3MXMA 1HYSA 4OKEA 3PUFA 3L2WA 3ZT1A 4CFBA 3EYZA 5KTQA 3DYAA 4M3WA 3K58A 4B08A 1KLMA 1XI1A 3NF7A 4ZTJA 4PA1A 1KFDA 1L3SA 1WNSA 3HVRA 1S1TA 2FC0A 1X9MA 2KW4A 3PY8A 4KFBA 3AVMA 5E41A 4M41A 1U4BA 3DI6A 3VQBA 2E6LA 4AILC 3V1QA 2Z1IA 2X6SA 3HPGA 3HP9A 2Q3SA 3EZ5A 4DTJA 3VQQA 4FYDA 3ZSRA 5KRSA 4AHUA 4F2RA 1RT2A 1C1AA 1G15A 3QNOA 2DFFA 4IBNA 4FK0A 4CEZA 1SL2A 4F4KA 5DK5A 4DSFA 3QLHA 4B9TA 3VQ7A 1SL1A 4KB1A 4L8RB 1U45A 1LV5A 4J2BA 1SKSA 4K8XA 3O3GA 2Y1IA 1NK6A 4JS4A 1C1BA 4W5TA 1UA1A 5CYQA 5KRTA 3L8BA 1XHXA 2R7YA 4B9NA 1RBVA 4Z4FA 3V9XA 1TK8A 4E7IA 4DFMA 1Z26A 3LAKA 4FZZA 1VSKA 4OGEA 1RT6A 3SPZA 2FBVA 3RMDA 3P5JA 4CIGA 5I3UA 4OGCA 3MXJA 4EP5A 1WAFA 2QKKA 3IG1A 5J2QA 4ZTFA 1BIUA 3TAEA 3K2PA 4IG3A 1NKBA 4MFBA 4FJLA 4B8CA 4NCBA 3AO1A 3HPOA 4DTNA 1J9AA 2JLEA 2OPSA 1EKEA 1QE1A 3K59A 2DY4A 2EX3A 4WE1A 4F2SA 5EU7A 1WSEA 1BISA 3LP0A 4DQIA 4KTZA 1VSHA 3NGIA 4E0DA 4FJIA 3AVCA 1JLFA 3NE6A 1EP4A 3OY9A 3L3VA 4HHTA 3ISNC 2Y1JA 5HP1A 3V9SA 3OYFA 2KTQA 3SUOA 1NK8A 2YNFA 2LSNA 3L2RA 4E89A 4DF4A 1RTJA 3B6PA 4H4OA 4KV8A 1DTTA 2P1JA 4DLEA 4C8OA 1YTUA 2QK9A 3HK2A 3VQ5A 1NK9A 3V1RA 4AHCA 2XY8A 4BWJA 4FJKA 3L2QA 4CEFA 3KJVA 1C0TA 1JXEA 3DLHA 4I2PA 3NH0A 1IH7A 1KRPA 4OVLA 4H8KA 1VSJA 1A5WA 3S3NA 4I9QA 4R5PA 4CJTA 4CJEA 2X6NA 2HNDA 3ZT4A 2XHBA 1C1CA 3OYNA 4EZ9A 4FJ8A 4CGDA 5CZ1A 4KHSA 3AA2A 4B3OA 1YT3A 4RW4A 2IOCA 4M3TA 3KKRA 3VQ6A 3HVTA 4LH5A 2P5OA 3MAQA 4RW8A 1TVRA 4MQ3A 4KI4A 1GOBA 1SKWA 4DTMA 4UQGA 3CG7A 1TL1A 2B6AA 4CERA 1W9HA 3L2UA 1EX4A 3SZ2A 1JXBA 4CEOA 1T05A 1L5UA 4NYFA 3AVBA 1A5VA 3ZSOA 3OS2A 2EHGA 4FK4A 1D8YA 1RDCA 5KI6A 1S6QA 1Z25A 4CHPA 4FVMA 2XY7A 2Z1GA 1S1WA 3BGRA 3KD5E 1WN7A 4B9SA 4KB0A 3QETA 1NOYA 1HRHA 3PO4A 4CECA 4IG0A 4FJ7A 1RILA 1ZBLA 3AVGA 4ELUA 3IRXA 3U6FA 4KTWA 2YHAA 3B6OA 3O3HA 4J2DA 1BHLA 3LDSA 4CF0A 1VSDA 3V6DA 1BCMA 1O1WA 3AO3A 4G1QA 4AHVA 4CJFA 3NDKA 4DF8A 2G8WA 2WONA 4M42A 4JLHA 4RW9A 1J54A 1NK0A 3P83D 1Q8IA 4FLWA 4KAZA 4DSJA 1T03A 2DFEA 4W5QA 3VQ8A 4RG8A 3V81A 4RW7A 2A1RA 4BE2A 1U48A 4CCHA 3KLHA 1C6VA 4O55A 5K14A 2XY6A 2VG7A 3P1GA 1WSIA 5C24A 4DSLA 3LANA 4C8MA 2ZD1A 3K5LA 1MU2A 5C25A 2GBZA 2OPRA 3L3UA 2HHWA 1LAWA 3IS9A 4Z0UA 3V9ZA 1KFSA 2VWKA 1HYVA 4FLXA 3PX4A 3D0PA 2D0AA 2DFHA 1HQUA 1QS4A 4LY7A 4CIFA 4CJKA 4E7KA 2XY5A 1NK7A 3C95A 1IKWA 3L2VA 4BDZA 3QEWA 1X9SA 2RKIA 3AO4A 4LH4A 5HRPA 1XC9A 2D0CA 3S3OA 4I9LA 1N6QA 3MEGA 4NCGA 4KTQA 3ZT0A 2B4JA 3LWMA 4YNQA 2PY5A 1LWEA 3MXIA 5HRSA 4C8NA 3QEXA 1RT5A 3AVHA 4KHQA 1RBTA 4FJMA 4DSIA 3UIQA 3WNHA 1VSIA 4CESA 4CK1A 3OJUA 3KLIA 2ETJA 2G8HA 3LZJA 2G8VA 1D5AA 1QSYA 4NCAA 4O44A 3NAEA 1ZBUA 1U49A 4FJ5A 4CK2A 3DOKA 5FRNA 3CFPA 2E4LA 3CYMA 4FW1A 3NF9A 1S1VA 3QEPA 3ITHA 4DS4A 1BGXT 4CE9A 2HVHA 2IC3A 3AA5X 3HYFA 4BWMA 4JRPA 3S9HA 3PO5A 1RCHA 4DS5A 4M3UA 4PWDA 3JYTA 4OPJA 2HW3A 5J2PA 3SCXA 3OVNA 3VQEA 4ID5A 1C0UA 4N5SA 1W0HA 1FK9A 3SUQA 3HL8A 4E1NA 3LZIA 5SZTA 1REVA 3TAFA 3ZSYA 4Z4CA 2X74A 3OYIA 3OYJA 1ZYQA 1Q9YA 1TL3A 1UOCA 3ZSXA 1NOZA 3OYDA 3ULDA 2RN2A 4FM0A 4B9UA 4CJ4A 1DLOA 1S6PA 1S1UA 2OPPA 3AVFA 3V1OA 2PYJA 4CJLA 1BI4A 2IDOA 4AHSA 5J2MA 1IKXA 1YTAA 3AVKA 2OZMA 4KPYA 3QERA 3QNNA 3MEDA 5FROA 4NYNA 1I3AA 4KO0A 3O4QA 1GOAA 4CHNA 1KCFA 3M8QA 5J1EA 2YV0X 1RT1A 5HBMA 3KIOA 4N41A 1VRTA 2KQ2A 5JS1A 3LWLA 3OYKA 2P51A 1IG9A 1FKOA 2IS3A 3SYZA 3M8SA 1WSGA 3DLGA 3AO2A 5HRRA 4O0IA 3HJFA 3CQ8A 3QO9A 1KVAA 1JKHA 2YNGA 1XWLA 3TAMA 2RF2A 3CM6A 1T8EA 1QSSA 3SV3A 3NBPA 3AVAA 3VA0A 4CF9A 1SUQA 4CJVA 1NK4A 3MECA 4CHZA 4W5OA 3OYAA 1HYZA 3TABA 3C6TA 2F8TA 1D9DA 1RT7A 2Z1JA 2OPQA 4PUOA 1U04A 3D45A 1LW2A 1BCOA 3M8PA 4E7HA 1BIZA 3WNEA 5J2NA 4FJHA 1Y97A 3KK2A 4GMJB 4PQUA 2KZMA 1ZBHA 3RMBA 4IFYA 4C8KA 2OA8A 4E7LA 1ZBIA 3ZSVA 4J2AA 4FJXA 4CEEA 1RDBA 4CIEA 3OYLA 1N5YA 3KD1E 2GUIA 1DTQA 4DQSA 4DQPA 2HHVA 5SWMA 3SI6A 2PYLA 2HHTA 2D5RA 4BDPA 3CM5A 4KREA 4CJUA 4M3ZA 1UAXA 4DTRA 1JLGA 1CXQA 4OJRA 3PV8A 2HNZA 3TI0A 1NJZA 4FM2A 4CHYA 3QEIA 2OZSA 1HMVA 3DLEA 2IGIA 1ASWA 3QINA 3LP2A 1D9FA 3PX0A 1JL2A 1RDDA 3AVJA 4H4MA 4CGGA 1RBRA 2FBXA 3QIPA 4DMNA 3HPHA 4E19A 4BACA 4DQRA 4IKFA 3A2FA 3ZT3A 4I7FA 4QAGA 1JLAA 3TR8A 4IFVA 4DSEA 3VQ4A 4LSLA 1JLCA 2W42A 3QESA 2XRIA 4DWIA 2X78A 1HNVA 1CZ9A 4EP4A 3KLFA 4ID1A 4HCCA 2O4IA 3C6UA 4DTOA 4FZXC 3K5NA 3SQ1A 1RT3A 4BDYA 1K6YA 1QSLA 1RTDA 2HHXA 4HVJA 4AH9A 4CEBA 3I8DA 4DSKA 3I0SA 4YFUA 3SQ0A 1YVUA 4FXDA 4CGIA 3U3YA 4CJ3A 3OYCA 4E3SA 3V9UA 1NKEA 2G8KA 1WAJA 4Q5VA 4AHTA 1R0AA 1J53A 4M45A 2YKNA 4AHRA 3K57A 4FK2A 1IKVA 1ZBFA 4CHOA 1TAQA 2HMIA 3VQPA 1BI4B 3DLBA 3NGZA 1TKXA 3LP1A 2BANA 1JLEA 4TSXA 3RWUA 2KZZA 3AO5A 2F8SA 3SUNA 4K8ZA 1QQCA 4N76A 1VSMA 4E1MA 1UWBA 1C0MA 3DM2A 3FFIA 1KVBA 5KGWA 5T7BA 4FLYA 4FLTA 3SJJA 2Z1HA 4FJJA 3MEEA 3AV9A 4FJGA 1TAUA 3DLRA 3RMCA 4DFKA 4CGHA 2BE2A 3RMAA 4KHYA 3THVA 3E01A 3AA3A 3OYMA 1U47A 3AVNA 2HNYA 1RT4A 3T19A 3LPTA 4N47A 2G8IA 1B9DA 3VQAA 2VG6A 2O4GA 4JS5A 1X9WA 4CF8A 4KHUA 1TGOA 4O0JA 4CEQA 4M3RA 1TKDA 5FDLA 2G8FA 4FLVA 4BE0A 5HROA 1TK5A 4CJ5A 3F73A 1KVCA 2NUBA 3ZSWA 4DTUA 3TANA 1I39A 3V9WA 4ELTA 3T1AA 1JLQA 3O4NA 1NJWA 1VK0A 4QOZB 3RTVA 1X1PA 4KKOA 3TWHA 4QCLA 1HPZA 4Y1DA 5C42A 1S9GA 2D0BA 1NKCA 4CF1A 4KHWA 1KSPA 4JRQA 3OYGA 3LP3A 3VQCA 4HTUA 2HVIA 5HRNA 1HQEA 4DQQA 3NH1A 2VWJA 3WNGA 4CFCA 1RNHA 1HNIA 4Z4HA 4Q0BA 3DRPA 3KKSA 3PX6A 1SV5A 3U3GA 1RTIA 3NF8A 3T3FA 1TKTA 3SQ2A 4O4GA 1WSHA 1SKRA 1RBUA 3LPUA 4C8LA 3ALYA 4DG1A 4F3TA 1HJRA 3KK3A 3HP6A 1VSEA 3ZSQA 3NFAA 1NJYA 5CZ2A 1FKPA 2ZE2A 2YHBA 4E7JA 1ASUA 3IAYA 1LWCA 4CFDA 2I5JA 1TV6A 4GVMA 3VQDA 3EY1A 4PY5A 4HUGA 3ZCMA 2E6MA 1GOCA 2YNIA 4OLAA 3AVLA 3HXMA 1ITGA 3SV4A 2ZQBA 3VQ9A 5CY4A 1IKYA 1VSFA 4ICLA 4O5BA 1BQNA 1ASVA 4FW2A 4DFJA 5D3GA 1TK0A 1SL0A 3RR7A 3ZSZA 3OS1A 4DTSA 1QTMA 1B92A 1LW0A 3K5OA 4FJNA 4I2QA 3QIOA 4CFAA 3CFRA 4CJSA 4CJRA 3QEVA 4FJ9A 4FLUA 4B9MA 4Z4IA 2DTUA 4J2EA 1RTHA 3G10A 3WNFA 1QHTA 3AA4A 3V4IA 4DFPA 3S3MA 1VSLA 4LD0A 4ELVA 4BE1A 4Y1CA 1S9EA 3RRGA 3ASMA 3RRHA 1B9FA 4CGFA 5FRMA 2FBYA 1TKZA 3JSMA 4OKJA 4OPKA 3KTQA 4CJQA 4Z4EA 2G8UA 2VG5A 3DOLA 3O3FA 3ZT2A 1IO2A 2BGGA 1S5JA 1LWFA 1UA0A 3KK1A 4OKKA 1KTQA 4B9VA 3OJSA 2OYQA 4FZYA 3K5MA 3TAPA 2F96A 4DTPA 1FXXA 1CXUA 3DRRA 5KGXA 4DU3A 4HUEA 1WLJA 2QXFA 4LSNA 3SUPA 4KI6A 4W5NA 1CZBA 4W5RA 4DLGA 4B8AB 2BDPA 3OYBA 4GW6A 2ITGA 3OYHA 2XO7A 4HCBA 2KFZA 4HUFA 3VN5A 3BDPA 5CYMA 4N56A 1BL3A 5I42A 3NF6A 2GV9A 4CGJA 2RPIA 3KLEA 3LAMA 5HLFA 2P5GA 4F3OA 1VRUA 3KLGA 2FBTA 2JGUA 3LALA 2PZSA 1A5XA 4ZHRA 1L3VA 1KLNA 3NCIA 2KFNA 4M3YA 3NHGA 2HHSA 3DLKA 1XHZA 3H08A 1CLQA 3M8RA 5DMRA 4DTXA 2IAJA
chains in the Genus database with same CATH superfamily
1EXQA 4JKGB 4BRKA 4CJWA 1NK5A 4F8RA 1EETA 3TAGA 3C94A 2VGMA 4RW6A 4GV9A 5LMNK 3W3DA 3OYEA 2HHUA 5MLCQ 4OLBA 1YVNA 1S1XA 3GBTA 1F21A 4FSVA 1M1KO 4PWDA 1JL1A 1LAVA 2B5JA 5M1QA 3TARA 1WSFA 2RHKA 1WSJA 2Q1NA 3CJ9A 4B9LA 2VGNA 1T44A 3MN5A 4BRQA 4I6MB 4KHPK 4B1VA 4FCYA 4OPHA 4B3SK 1E3MA 2BUPA 5BR8K 3EYZA 4M3WA 3K58A 3VF6A 4A59A 2P9UA 3NVMA 3BUZB 4KH4A 1WNSA 3HVRA 5LY3A 3C0BA 3PY8A 4WF9L 3IDHA 1QZ6A 3VQBA 5M1FA 5TKYA 2Z1IA 2IVNA 3HP9A 3VEYA 4DTJA 1NGCA 3VQQA 1VQPN 1O13A 4BR7A 4A61A 1W2BM 4L8RB 5IWAK 2Y1IA 1NK6A 2QEXN 1HJOA 1XHXA 4B9NA 1TK8A 3G4SN 4FZZA 1VSKA 4LF8K 1RT6A 3SPZA 2FBVA 5I3UA 4EHTA 4EP5A 4DHYA 3K2PA 4KBOA 5CHIA 2QXLA 2DY4A 3MN9A 3T7ZA 4E1JA 1WSEA 4E0DA 4FJIA 3NGIA 1JLFA 1EP4A 2HSTA 5HP1A 3SAHA 4GNIA 3OYFA 4MO5A 5FPDA 3L2RA 1Q81O 1RTJA 4KV8A 4DLEA 3HK2A 3E9PA 5JLHA 3L2QA 4CEFA 3KJVA 1C0TA 1JXEA 4X65K 4JI7K 4H8KA 1VQ9N 4CJTA 3CQYA 4BREA 4BRNA 2CH5A 2HNDA 3ZT4A 2Q2RA 4CI6A 1C1CA 5CZ1A 1YT3A 4RW4A 3VQ6A 4RW8A 4B1UB 3I56N 4DTMA 3L2UA 1W9HA 1T05A 3VF2A 4AM7A 2P9IA 1A5VA 3OS2A 5KI6A 3CJBA 2Z1GA 3BGRA 2F9WA 4MO4A 1NOYA 4BRDA 4BC3A 4KTWA 2YHAA 4J2DA 3TTDA 1VSDA 3V6DA 2G8WA 2WONA 4RW9A 1NK0A 3P83D 1C0GA 1Q8IA 4KAZA 4DSJA 2DFEA 3VQ8A 2A1RA 4RW7A 4YOVA 4V19S 5K14A 2VG7A 5C24A 1NGEA 3LANA 4C8MA 4EAHD 1HNXK 4JKBA 3EL2A 2KKZA 1SAZA 2OPRA 3L3UA 4FPAA 2OTLN 2VWKA 2P9KA 3D0PA 4CIFA 4LY7A 1YXQA 1IG9A 4E7KA 3C95A 3DXMB 3AO4A 3J7AP 3VEZA 3ZT0A 4M63C 4C8NA 4KHQA 2YI1A 3UIQA 3QFUA 4CK1A 3J80O 3KLIA 1BG3A 2G8VA 1QSYA 2E5LK 3CFPA 2E4LA 3CYMA 3NF9A 4FO0A 3ITHA 4CE9A 4JRPA 1KD1O 2NZTA 1HR0K 3R6MA 4MDAA 3SCXA 3OVNA 4ID5A 3SUQA 4DR6K 1U2VA 3LZIA 1VQ6N 4Z4CA 4CVNE 1C0FA 4YOTA 4WQ5C 5C12A 1DEJA 1WB9A 1OH8A 3QERA 3MEDA 1QVGM 4EFHA 4NYNA 2P9NA 3O4QA 4KO0A 2V7ZA 3DXKB 4QS9A 3WXIA 3K9JA 5FLXO 4LFAK 5HBMA 4C1NK 2KQ2A 2UXCK 5JS1A 3THYB 2IS3A 3A5NC 1N34K 1WSGA 3AGRA 1GLEG 2QTDA 4O0IA 3THXA 3ID8A 3MWPA 4B1XB 4IEIA 2YNGA 1T8EA 4OPAA 5AQPA 3R1XA 3KK7A 3TABA 4WQ4C 4BRLA 2Z1JA 4BRMA 2HHHK 1U04A 5J2NA 4FJHA 2QWOA 5KQDA 1Y97A 1XNRK 4LF6K 4IFYA 4C8KA 2OA8A 4J2AA 3ZX0A 2GUIA 1DTQA 4DQPA 3UKUB 5SWMA 3SI6A 2PYLA 2FLOA 2D5RA 3O4WA 3VEOA 2V51B 1NJZA 4H0OA 1YUWA 2NRVA 3ZT3A 4QAGA 3KHYA 2W42A 5TKWA 3QESA 4DWIA 2X78A 1VQ7N 1CZ9A 1NLVA 1U6ZA 3HZ6A 4ID1A 3KLFA 4G9ZA 3K5NA 1Z05A 1RT3A 3MX5A 2HHXA 2Q36A 1RTDA 2QWNA 4NO7A 4HVJA 3M5RA 1KQSM 4CJ3A 3V9UA 4AHTA 1HKBA 1IKVA 1NG9A 3ENBA 2HMIA 3B8AX 5C0YA 1EQYA 1VAZA 5BRFA 2E1YA 4E1MA 3FFIA 5KGWA 4FWRA 3VEWA 4BG8A 1YHQN 3AV9A 1TAUA 3RMCA 4DFKA 4CGHA 3AA3A 1U47A 4BRHA 2HNYA 5AZIA 3T19A 1IJJA 4OX9K 5BPMA 1X9WA 4CF8A 2QWRA 5FDLA 3VERA 1TKDA 4FLVA 4BE0A 3ZSWA 4ELTA 1I39A 1VK0A 3SJHA 3SAFA 4QCLA 3CHWA 4KKOA 4KH5A 1HPZA 4Y1DA 1S9GA 4KHWA 3FLCO 3OYGA 3VQCA 1RGIA 3AY9A 1HLUA 3WNGA 3H6EA 1RNHA 3E1YA 4IEEA 1HNIA 4Z4HA 4Q0BA 3WXLA 3U3GA 5AQHA 2KHOA 3ENOA 3U4LA 4BRCA 4O4GA 1WSHA 4ILJA 2ZF5O 4LF7K 4F3TA 3HP6A 1VSEA 2O8DB 4IO8A 5CZ2A 3SAGA 2GX9A 1T6DA 4CBUA 3VQDA 4PY5A 3ZCMA 5KPRA 2YNIA 4OLAA 3HXMA 1ITGA 5E84A 1W7AA 1NMDA 2ZQBA 1IKYA 1ASVA 1NGJA 5D3GA 3RR7A 4DR2K 3OS1A 3PIOL 4I2QA 3QIOA 4CFAA 3CFRA 1KAYA 3G10A 3AA4A 5GIOA 4DFPA 1Q18A 2EWSA 4X66K 4B1YB 3ASMA 4DB3A 1K8AO 2W6LA 3ZLJA 1XMQK 2VCPA 4JV5K 3ZT2A 1S5JA 2PFUA 3KK1A 4OKKA 1BA1A 4MLEA 1TYQA 3OJSA 4FZYA 3K5MA 4HUEA 3HTVA 4LSNA 3O1BA 4W5NA 3H1VX 3OYBA 5F1XA 4HCBA 4HUFA 1DKGD 4H0VB 2W40A 4LC9B 3A8YA 2RPIA 3E9OA 2P5GA 2JGUA 2CGJA 3CCEN 3DLKA 1Q7YO 1YJNN 5KQ8A 3FZLA 2O8EB 3GE1A 4CEDA 4WFAL 3G0ZA 4CJPA 3SQ4A 3IKMA 3K0SA 2HHQA 3QICA 3HSTB 3QDKA 4JAXA 4CK3A 1RDAA 4KRFA 1VQ5N 4IDKA 3C6HA 2WFBA 4BR5A 1NJXA 3CFOA 2HOEA 4FLZA 3HM9A 4Z4GA 5BR9A 4DV2K 4JD2B 4B3MK 2QKBA 4DU1A 1JLBA 4IOCL 4BGAA 5C2DA 3CI5A 3NH2A 2Q0RA 3F9KA 4GKKK 3PUFA 3CC7N 4DUZK 2NRRA 1XUPO 5IT9O 4JNEA 4B08A 3SBGA 1XI1A 2UUAK 4BRIA 1KFDA 1L3SA 3H46O 3THWA 2FC0A 2GTDA 3WUHA 3EKSA 3EO3A 4XH5A 3V1QA 1RDWX 2KLAA 2OANA 3K9KA 2QM1A 3BP8A 5EX5A 3GOIA 3KWIA 4AHUA 4FWMA 2GELA 3P31A 3QNOA 2DFFA 4IBNA 5EOYA 4PHTX 4CEZA 1NGBA 4YORA 3W0LA 2HBLA 4F4KA 4DSFA 1ATSA 3VQ7A 3AAQA 1NGIA 2YHWA 4J2BA 1NGDA 1UA1A 5CYQA 5KRTA 4Z4FA 4DFMA 4OGEA 3O9RA 4CIGA 4OGCA 2UYTA 2WBNA 4NB4A 1BIUA 1QQOA 2P9SB 4FJLA 3HPOA 4DTNA 4MLHA 2JLEA 2OPSA 3U9DA 1QE1A 4WQ5A 3K59A 4DR3K 1K8KA 3LDLA 3MMVA 4KTZA 1R59O 4HHTA 2Y1JA 2BTFA 1IBLK 3SUOA 1NK8A 4L3QA 2KTQA 4E89A 3B6PA 4H4OA 2P1JA 1YTUA 4AHCA 4BWJA 4FJKA 3ULEA 3DLHA 3NH0A 4OVLA 1FJGK 1VSJA 1A5WA 3CJ7A 3ZEUB 1IV0A 2D4WA 3VESA 1NGAA 3UKRA 3KKRA 2E8AA 2P5OA 5EY4A 2KZZA 3TPQA 4CERA 1EX4A 1N36K 2A41A 2XY7A 3KD5E 3EN9A 3VGLA 4B9SA 3QETA 1HRHA 4CECA 1WUAA 2WUSA 4JI4K 4CZEA 1ZBLA 3AVGA 4ELUA 3IRXA 2RE2A 3SMSA 4IO9L 3B6OA 1IG8A 4CZFA 4CF0A 3D2FA 1O1WA 3A5OC 4JLHA 3D2EB 2VWBA 4BE2A 1WSIA 3I33A 4FWKA 1U2VB 2ZD1A 4WFBL 3K5LA 1BO5O 3CC2N 2HHWA 4Z0UA 2IVOA 1T6CA 3BEXA 3L2VA 1X9SA 4BDZA 2RKIA 4X62K 4BR9A 5HRPA 4XH1A 1N6QA 3MEGA 5AZJA 3LWMA 4ILGB 2PY5A 2YX6A 5AQIA 1WBDA 1QHAA 1RT5A 3QEXA 2F4VK 1RBTA 4FJMA 3ZETA 3WNHA 4BY9C 2G8HA 1D5AA 3NAEA 5FRNA 1GLLO 4DS4A 2HVHA 3AA5X 4BWMA 3SMPA 4M3UA 1TUUA 3LM2A 4DS5A 2HW3A 4OPJA 1OH6A 5AQXA 3VENA 1P8ZA 2NLXA 1W0HA 3VTIA 3HL8A 4E1NA 3U9ZA 2D1KA 3OYIA 3OYJA 2O8FB 1Q9YA 1UOCA 1NOZA 2RN2A 4B1ZA 1DLOA 3CCUN 4R79A 3DAWA 3AVFA 4LF4K 2V52B 5M1NA 2OZMA 3AVKA 2FF6A 5FROA 3TTFA 3L6QA 4DR4K 5AQWA 1KCFA 2YV0X 2A40A 4N41A 1ZC6A 2YJFA 3VOVA 3OYKA 2E1ZA 2P51A 3DLGA 5HRRA 4BRAA 3IMXA 1KVAA 1JKHA 3TAMA 1QSSA 3SV3A 3NBPA 4BGBA 4CJVA 3OYAA 5CR4A 1SZ2A 3O1WA 2OPQA 4F9OA 3D45A 4B3RK 1BCOA 3M8PA 3P39A 4GKJK 5AQVA 3R8EA 3MDQA 1QVFM 1IBMK 4H0PA 3MCPA 4CEEA 4CIEA 3OYLA 3KD1E 4PL7A 4DQSA 2O8BA 4DR1K 5BN8A 3CM5A 1E4FT 4XEIA 4KREA 1UAXA 4JKDA 2FSJA 2HNZA 4FM2A 1TUYA 4CHYA 2O8CA 4O8UA 1ASWA 3LP2A 3LDQA 1D9FA 4J8FA 4H4MA 4DMNA 3WT0A 3EZWA 4E19A 4AQYK 5BRDA 2QWPA 3BF3A 3TR8A 4IFVA 4LF9K 4DSEA 2E88A 4LSLA 1JLCA 1HNVA 2O4IA 3C6UA 1S3XA 3L0QA 1GLJO 1M90O 1QSLA 4YFUA 5HL7L 3OYCA 5FPMA 1WAJA 4M45A 3K57A 4CHOA 4IDHA 1BI4B 1TKXA 5AQMA 3AO5A 1RDUA 3L4QA 3SUNA 4M7YA 4HTLA 4K8ZA 5AQFA 1UWBA 3DM2A 5T7BA 3NMUA 4FJJA 5AQGA 3NVKA 3E01A 1NGFA 5H1SQ 4N47A 2G8IA 1B9DA 2O4GA 4KHUA 1TGOA 3QB0A 5HROA 4CJ5A 3F73A 2NUBA 4H0TB 4H5WA 1NJWA 2D0BA 4CZJA 3CCRN 1KSPA 4HTUA 2HVIA 2FF3B 5HRNA 4JKGA 2VWJA 3KWGA 4H5NA 1EWRA 4JI2K 1SV5A 4K43A 1OVQA 5HOOA 1TKTA 3T3FA 3SQ2A 1TYQB 3VGMA 3LPUA 3VEXA 4C8LA 3ZSQA 1ATRA 2YHBA 4E7JA 1ASUA 4BQLA 2I5JA 1TV6A 2FSKA 1GOCA 5M1OA 2ZJQL 2ASMA 3VQ9A 3O9TA 1BQNA 5KPTA 1TK0A 4DTSA 1QTMA 1LW0A 4JKAA 4FJ9A 4Z4IA 4J2EA 1RTHA 3WNFA 1VQLN 4X64K 4U67L 3P38A 5BN9A 3RRGA 3ID6A 2UXBK 2FBYA 3CCVN 3KTQA 3A0IX 4Z4EA 3DOLA 3O3FA 2IVPA 1IO2A 4BC4A 4B9VA 2OYQA 3VPZA 4JI8K 4OO1J 1EO1A 4DU3A 3UE5A 4KI6A 3SUPA 4W5RA 3QBXA 3MK6A 3T1HK 4QS8A 4BR0A 3CIPA 2D0OA 3NF6A 3KLEA 3LAMA 1VQ4N 4FWLA 1VRUA 1GLAG 3LALA 4ZHRA 3RSEA 1L3VA 1KLNA 4ILHA 3NHGA 1CLQA 3H08A 2QA4N 3AGKA 1UA0A 4RCHA 1FXXA 3SPYA 4YOWA 1NGGA 4DU4A 4XIUA 4CHQA 3CCLN 5AQRA 2HBMA 3I0RA 3AAPA 1MWMA 3O9QA 2A6AA 1J5OA 4JK9A 3RR8A 5JS2A 3HT3A 1T7PA 4A2BA 4CZIA 2ATQA 2YKMA 1ESVA 3HRGA 2HB5A 1BOTO 2ASPA 2ASOA 1BQMA 2YNHA 3VA3A 5JICA 3FE1A 1L3UA 3DMJA 1HYSA 3E66A 2Q0UA 3C7NB 3CMAN 2P9LB 3L2WA 4CFBA 4DV0K 5KTQA 2UUBK 3DYAA 5ELZA 1KLMA 3PSFA 4PA1A 1S1TA 3ZX3A 1X9MA 4CZKA 1E4GT 4AILC 2HF3A 1J5EK 3R3LA 4NXNK 3ZX2A 3EZ5A 1NMNA 1BDGA 3ZSRA 5KRSA 4JYAK 4GV6A 1RT2A 1C1AA 3ULEB 1G15A 1SL2A 5DK5A 5BPNA 1U45A 4CBXA 1SKSA 4K8XA 3O3GA 3UKRB 1C1BA 2UXDK 1QQNA 4K41A 1Q82O 3V9XA 4E7IA 1Z26A 3C65A 3LAKA 3SK3A 2QWQA 3Q7BA 3DXMA 3MXJA 5EVZA 1WAFA 2QKKA 5J2QA 4ZTFA 3WEEB 4IG3A 1NKBA 3HM8A 1NU0A 4MFBA 4B8CA 1J9AA 4BC5A 2EX3A 4WE1A 4F2SA 5EU7A 1BISA 4DQIA 3OY9A 3L3VA 3H45C 3ISNC 3V9SA 2YNFA 2LSNA 2A5XA 3O5BA 4DF4A 4C8OA 3VQ5A 4C1NI 3V1RA 1GLFO 2XY8A 2F9TA 3T69A 4DV4K 1V4SA 4H03B 1IH7A 4YOUA 4CJEA 2X6NA 2XHBA 4FJ8A 4CGDA 3AA2A 2IOCA 3N4QA 4M3TA 3MAQA 1TVRA 4MQ3A 4KI4A 1GOBA 1SKWA 3G25A 3CG7A 1TL1A 3SZ2A 1L5UA 1JXBA 4CEOA 3DLLL 3ZSOA 3AVBA 3MWTA 3WXKA 2EHGA 1D8YA 1Z25A 2P9UB 4CHPA 5JVHL 1S1WA 1WN7A 4YY3K 4KB0A 3DXKA 3PO4A 4IG0A 1RILA 4B1WB 3VMFB 3MCAB 3U6FA 1LOTB 3O3HA 1BHLA 3LDSA 3ATVA 4BVOA 4CJFA 3AO3A 4G1QA 4DF8A 3NDKA 5FPEA 4M42A 1J54A 3BY5A 4FLWA 1T03A 4W5QA 2AA4A 1GLBG 1U48A 4CCHA 3KLHA 3EE9A 1ILYA 4O55A 4NXMK 3P1GA 1K73O 1OH5A 5AR0A 3UB5A 3RVCA 1VQKN 1MU2A 3DJCA 3H3NO 4CZGA 4PKGA 2HBJA 3FZFA 4FLXA 2D0AA 1HQUA 4CBWA 4CJKA 2XY5A 1NK7A 1IKWA 3QEWA 4FWSA 4LH4A 3ZYYX 4I9LA 4KTQA 4NCGA 2B4JA 5AQNA 4YNQA 1DT9A 3MXIA 3D6RA 3SBTA 3AVHA 1VHXA 3CJ1A 4O8KA 2E20A 4EHUA 4DSIA 4CESA 3OJUA 3LZJA 1I94K 1MDUB 4JKCA 2WC9A 4O44A 1ZBUA 4FJ5A 4LF5K 3DOKA 4FW1A 1S1VA 3J7YP 1EWQA 3CJCA 3PO5A 3S9HA 3JYTA 1Q86O 4CZHA 3VQEA 1C0UA 1FK9A 4CZMA 5SZTA 1REVA 3ZSYA 3OHRA 3QFPA 4A2AA 1ZYQA 1TL3A 3OYDA 1H1VA 3ULDA 4B9UA 4CJ4A 3CC4N 1VQON 1S1UA 1Z6RA 2O8BB 2IDOA 2P9IB 1IKXA 1YTAA 5J2MA 1I3AA 4H0XB 2O8CB 4JHDA 4CHNA 4FWQA 3J7ZO 5J1EA 5DM7L 1HKCA 4H5TA 5B8HA 5AQTA 4DR7K 1RT1A 3KIOA 1VRTA 1FKOA 3SYZA 3M8SA 4GY2B 1XWLA 4XH4A 2E2PA 5BREA 3AVAA 4FL9A 3MX2A 3MN6A 1SUQA 4BR2A 4CHZA 2A42A 2F8TA 1HYZA 1SQKA 1RT7A 1BIZA 5FPNA 1ZBHA 2P9KB 3ENHA 1ZBIA 3ZSVA 1RDBA 4AM6A 1N5YA 4WQ4A 4K0KK 2HHTA 1HX1A 4JI1K 4C23A 5JMVA 1JLGA 1CXQA 4OJRA 4YOXA 4MDBA 1VQNN 2OZSA 3DLEA 2W41A 3QINA 1N32K 3PX0A 4DQRA 1RBRA 4IKFA 2O8DA 3HPHA 3L4IA 3A2FA 1JLAA 3JXUA 3VQ4A 4YDUC 2XRIA 4CZLA 4BG9A 4JK7A 3O9UA 3CCJN 4FZXC 5AQKA 4BDYA 1K6YA 1S22A 1OVYA 4CEBA 3I8DA 3I0SA 4YOYA 1YVUA 2Q31A 3FGUA 3VGKA 4FXDA 4E3SA 1NKEA 2G8KA 1JJ2M 1R0AA 1J53A 4AHRA 3WXJA 4DV6K 3VQPA 1RFQA 3LP1A 3KVGA 1NGHA 2BANA 3RWUA 4TSXA 4A62A 2CGKA 3BF1A 3EE8A 4JN4A 2P9NB 4FLYA 4FLTA 1NWKA 2ZWHA 4FJGA 3DLRA 1W97L 1LCUA 1S72N 4JI5K 4IJAA 3RMAA 3THVA 3OYMA 5GAGP 3AVNA 3J8AA 4DCHA 3LPTA 3THXB 3HBTA 2VG6A 2VYPA 5ADXA 3F5TA 3HSCA 2E2NA 5EXWA 5ADXH 4DTUA 4O5FA 3V9WA 1JLQA 3O4NA 4Y0WA 2V7YA 2QWMA 4BR4A 5AQOA 4B9QA 3O8MA 1NKCA 4CF1A 3VEVA 4BROA 4JRQA 2ZGZA 2O8EA 1HQEA 3NH1A 4CFCA 4JI3K 4BC2A 3DRPA 3KKSA 5F2RA 4A5AA 3A5MC 1Y64A 1SKRA 5AQLA 1RBUA 2ZM6K 4CD1A 1WBBA 3ALYA 4ISGA 5LL6Z 1BA0A 3KK3A 4FOEA 3NFAA 1NJYA 3TSQA 4JD2A 3QBWA 4GVMA 4CFDA 3CERA 4HUGA 1HUXA 2E6MA 1YI2N 3AVLA 1N8RO 2QWLA 3SV4A 5CY4A 1VSFA 4ICLA 4O5BA 4DFJA 4FW2A 1SL0A 3VF4A 5AQQA 2VQFK 3ZSZA 3RSEB 1B92A 4FJNA 4DKWA 5GIPA 4CJSA 4CJRA 3QEVA 2DTUA 3GL1A 2NRTA 3O6WA 1HNWK 5F0XA 4LD0A 3PSIA 4ELVA 4Y1CA 3T1YK 5DM6L 3RRHA 1B9FA 4CGFA 5FRMA 3JSMA 4OKJA 4OPKA 4CJQA 2G8UA 1ATNA 3IUCA 1LWFA 1KTQA 3TSPA 2YJEA 3TAPA 2F96A 3KZBA 3DRRA 4K42A 3TU5A 3CETA 5AZIB 2H3GX 5C2FA 2QXFA 1YITN 5AJ3K 2BDPA 1ZXOA 4A57A 4LFBK 4GW6A 3OYHA 2XO7A 3BDPA 5CYMA 1BL3A 5HLFA 4F3OA 4CGJA 3OTOK 2PBDA 2W6KA 3KLGA 2FBTA 4ISEA 2PZSA 5GINA 1A5XA 3WXMB 2KFNA 2P9SA 4IOXA 1NBWA 1XHZA 3O9SA 2HMPA 2E2OA 3BZKA 3O80A 4DTXA 3OW2M 3OBYA 5BPLA 3NGYA 3FZMA 4CEAA 3CF5L 3TTCA 3OS0A 1RBSA 4EZ6A 3HO1A 2P9PA 4M3XA 2A1SA 1OKJA 1Q9XA 3SNNA 2GUPA 4FM1A 4BRFA 4KHNA 4NLCA 3F9MA 3CCMN 3ZEUA 2AJQA 2WOMA 2HBKA 4CF2A 2QW9A 1JCGA 3TAQA 1L3TA 3AVIA 5CE3A 3DRSA 3FR0A 1N33K 3MXMA 4RTFD 5GAEP 3N4PA 4OKEA 5KPZA 3ZT1A 3HOTA 2CGLA 2D0PA 1GLDG 2FSNA 2QI2A 3NF7A 4ZTJA 3LDPA 1YAGA 3EEQA 1FW6A 2KW4A 4KFBA 3AVMA 5E41A 4M41A 1U4BA 3DI6A 2E6LA 3GG4A 2X6SA 3CD6N 1KAXA 3HPGA 3G71N 1T3VA 2Q3SA 4FYDA 3D2EA 4F2RA 4KH6A 4FK0A 2CH6A 2WTUA 4B9TA 3QLHA 4CW7B 1SL1A 4KB1A 1LV5A 4JS4A 4W5TA 4I6MA 3JS6A 3L8BA 2R7YA 3PLAA 3J81O 1RBVA 2OTJN 4FVUA 3LM9A 3RMDA 1YF5L 3P5JA 4FOIA 5A2QO 1MWKA 4B3TK 3IG1A 2YCHA 2PAVA 5LJWA 3TAEA 1K9MO 2FXUA 4JI6K 3QMLA 5GAHP 4NCBA 3AO1A 1EKEA 3LDNA 3VTHA 5C15A 2IIRA 3LP0A 1VSHA 3AVCA 3NE6A 1QQMA 1NJIO 4PL8A 2QK9A 1DTTA 1NK9A 3OBWA 1P90A 4I2PA 1KRPA 3S3NA 4I9QA 4R5PA 4WCEL 2YHYA 4EZ9A 3OYNA 4KHSA 4B3OA 2O8FA 4H5VA 3HVTA 4LH5A 1YIJN 4FPBA 3O08A 1J6ZA 4UQGA 2B6AA 4QOZB 1IBKK 1XC3A 4NYFA 4FK4A 1RDCA 1S6QA 4FVMA 4PKIA 3THWB 2GEMA 4FJ7A 5AQJA 1XMOK 4WFNL 4NLBA 4Z94A 2I7PA 1BCMA 4AHVA 4IOAL 4BVPA 5AQYA 1KAZA 3I55N 4RG8A 3V81A 1V4TA 1C6VA 3Q7CA 2XY6A 4U7BA 4DSLA 3GDQA 4YDUA 5C25A 2GBZA 3VETA 4M7XA 2YHXA 1LAWA 3IS9A 3V9ZA 1KFSA 1HYVA 1BWFO 3PX4A 2DFHA 3EKUA 1QS4A 3D7EO 4DV1K 1XC9A 2D0CA 4A5BA 3S3OA 4IFEA 5LJVA 4JHDB 1LWEA 1GLCG 5HRSA 1K8KB 3S41A 4IZ9A 1VSIA 2ETJA 4NCAA 1U49A 4CK2A 3JAMO 3TSUA 3CMEN 3E9LA 1X3NA 3QEPA 1BGXT 2IC3A 3HYFA 3M1FA 1RCHA 5J2PA 1BUPA 1MA9B 4N5SA 3TAFA 5E26A 2X74A 3ZSXA 4FM0A 1HKGA 1S6PA 2OPPA 3V1OA 2PYJA 4CJLA 1BI4A 5AQSA 4AHSA 3M3ZA 4KPYA 4FWOA 3QNNA 2JWLA 1GOAA 3M8QA 1KC8O 2ZJPL 3LWLA 3FZHA 3D2FB 3AO2A 3HJFA 5JVGL 3CQ8A 3QO9A 2ZJRL 3ATUA 1ZBSA 4FWPA 2RF2A 3CM6A 5GADP 2BH1A 4BRPA 3VA0A 2HF4A 4PKHA 4CF9A 3MECA 4W5OA 3C6TA 1D9DA 4EIAA 4JKHA 1YJWN 4PUOA 4BQZA 1LW2A 4E7HA 2GWJA 3WNEA 2VQEK 5AFUA 4GMJB 3KK2A 4PQUA 1X9JA 2KZMA 3RMBA 4E7LA 4ISFA 3R9PA 1NM1A 4FJXA 2ZGYA 3CPEA 5AFUH 2HHVA 2JWKA 4BDPA 5AZJB 3DWLA 4CJUA 4M3ZA 1DGKN 4DTRA 3PV8A 3TI0A 3F2KA 5LMUK 1HPMA 3QEIA 1HMVA 4DQ8A 3ZETB 2IGIA 5M1KA 4DUYK 1JL2A 1RDDA 3AVJA 3M6GA 4HWIA 2FBXA 4CGGA 3QIPA 4BACA 1HNZK 1KXPA 4I7FA 3THYA 4EP4A 3PIPL 3P4IA 4HCCA 4DTOA 4LFCK 4GV3A 3SQ1A 1VQMN 4RWTA 4AH9A 4DSKA 3SQ0A 4K25A 4CGIA 3U3YA 2OCEA 3SLCA 5AQZA 4Q5VA 2YKNA 4FK2A 5BRHA 1ZBFA 1TAQA 3DLBA 3NGZA 3HI0A 1JLEA 2F8SA 3UKUA 4N76A 1QQCA 3U8XA 3HOSA 1VSMA 3SJJA 1C0MA 1NK4A 1KVBA 2AP1A 2I7NA 2Q97A 2Z1HA 3MEEA 3I8BA 1YJ9N 4KHYA 2BE2A 2NRHA 2DPNA 3C6AA 1JCFA 3WQUA 1RT4A 3WQTA 1WOQA 3FZKA 3VQAA 4JS5A 4O0JA 4CEQA 4M3RA 2G8FA 3MN7A 3CQXA 4YHHK 1TK5A 1KVCA 3TANA 4WYBA 3T1AA 5C10A 3RTVA 1X1PA 4CD3A 3TWHA 3CPWM 5C42A 4H0YB 1G99A 3BZCA 3IFRA 4QS7A 5AQUA 3LP3A 4DQQA 2GWKA 4DV7K 4DV5K 4DR5K 4IWVA 3PX6A 1RTIA 1JCEA 3NF8A 4JKEA 1CZAN 3G6EN 1XQSC 1QZ5A 4DG1A 3FFKB 1HJRA 4BRGA 1OH7A 1XNQK 1FKPA 2ZE2A 3IAYA 1LWCA 2UUCK 3EY1A 1D4XA 3OA9A 4UY8O 3C7NA 2P9LA 3H3OB 3K5OA 3H1QA 3CCSN 3A5LC 4FLUA 4B9MA 2NRXA 4JI0K 1QHTA 3V4IA 3S3MA 1VSLA 4H5RA 4BE1A 1S9EA 4DV3K 2NNWA 1TKZA 2P9PB 3CJAA 2VG5A 4CJ7A 2BGGA 2A3ZA 1VQ8N 5I9EB 2E2QA 4JEPA 2ITMA 4DTPA 2NRWA 1CXUA 4AF1A 5M1PA 1NNEA 5KGXA 2F7TA 1BU6O 1WLJA 4IJNA 2UU9K 1CZBA 4DLGA 4B8AB 4FWNA 2ITGA 2KFZA 4JKFA 3VN5A 5JLFA 4N56A 5I42A 2NRZA 2GV9A 3CXCM 4JK8A 1SS6A 3LDOA 3LL3A 3NCIA 3WEEA 4M3YA 2HHSA 3M8RA 4IXCA 5DMRA 1X3MA 4GVEA 3CCQN 2J4RA 3AARA 2IAJA
chains in the Genus database with same CATH topology
1EXQA 4CEDA 3SPYA 4CJWA 3G0ZA 4CJPA 3NGYA 1NK5A 4DU4A 4F8RA 1EETA 3TAGA 3C94A 4CEAA 4XIUA 4RW6A 4CHQA 1RBSA 3OS0A 3SQ4A 3I0RA 4EZ6A 3HO1A 2HHQA 4M3XA 3HSTB 2A1SA 4CK3A 1Q9XA 3SNNA 1RDAA 3OYEA 4KRFA 2HHUA 1J5OA 4FM1A 4OLBA 4IDKA 3RR8A 5JS2A 1S1XA 3HT3A 1T7PA 4KHNA 1F21A 1NJXA 3CFOA 2ATQA 2YKMA 1JL1A 1LAVA 2B5JA 3HM9A 4FLZA 1WSFA 3TARA 4Z4GA 2HB5A 1WSJA 2AJQA 4B9LA 2QKBA 4DU1A 2WOMA 1JLBA 4CF2A 1BQMA 2YNHA 3AVIA 3VA3A 3TAQA 1L3TA 1L3UA 3DRSA 3DMJA 3NH2A 4FCYA 3F9KA 3MXMA 1HYSA 4OKEA 3PUFA 3L2WA 3ZT1A 4CFBA 3EYZA 5KTQA 3DYAA 4M3WA 3K58A 4B08A 1KLMA 1XI1A 3NF7A 4ZTJA 4PA1A 1KFDA 1L3SA 1WNSA 3HVRA 1S1TA 2FC0A 1X9MA 2KW4A 3PY8A 4KFBA 3AVMA 5E41A 4M41A 1U4BA 3DI6A 3VQBA 2E6LA 4AILC 3V1QA 2Z1IA 2X6SA 3HPGA 3HP9A 2Q3SA 3EZ5A 4DTJA 3VQQA 4FYDA 3ZSRA 5KRSA 4AHUA 4F2RA 1RT2A 1C1AA 1G15A 3QNOA 2DFFA 4IBNA 4FK0A 4CEZA 1SL2A 4F4KA 5DK5A 4DSFA 3QLHA 4B9TA 3VQ7A 1SL1A 4KB1A 4L8RB 1U45A 1LV5A 4J2BA 1SKSA 4K8XA 3O3GA 2Y1IA 1NK6A 4JS4A 1C1BA 4W5TA 1UA1A 5CYQA 5KRTA 3L8BA 1XHXA 2R7YA 4B9NA 1RBVA 4Z4FA 3V9XA 1TK8A 4E7IA 4DFMA 1Z26A 3LAKA 4FZZA 1VSKA 4OGEA 1RT6A 3SPZA 2FBVA 3RMDA 3P5JA 4CIGA 5I3UA 4OGCA 3MXJA 4EP5A 1WAFA 2QKKA 3IG1A 5J2QA 4ZTFA 1BIUA 3TAEA 3K2PA 4IG3A 1NKBA 4MFBA 4FJLA 4B8CA 4NCBA 3AO1A 3HPOA 4DTNA 1J9AA 2JLEA 2OPSA 1EKEA 1QE1A 3K59A 2DY4A 2EX3A 4WE1A 4F2SA 5EU7A 1WSEA 1BISA 3LP0A 4DQIA 4KTZA 1VSHA 3NGIA 4E0DA 4FJIA 3AVCA 1JLFA 3NE6A 1EP4A 3OY9A 3L3VA 4HHTA 3ISNC 2Y1JA 5HP1A 3V9SA 3OYFA 2KTQA 3SUOA 1NK8A 2YNFA 2LSNA 3L2RA 4E89A 4DF4A 1RTJA 3B6PA 4H4OA 4KV8A 1DTTA 2P1JA 4DLEA 4C8OA 1YTUA 2QK9A 3HK2A 3VQ5A 1NK9A 3V1RA 4AHCA 2XY8A 4BWJA 4FJKA 3L2QA 4CEFA 3KJVA 1C0TA 1JXEA 3DLHA 4I2PA 3NH0A 1IH7A 1KRPA 4OVLA 4H8KA 1VSJA 1A5WA 3S3NA 4I9QA 4R5PA 4CJTA 4CJEA 2X6NA 2HNDA 3ZT4A 2XHBA 1C1CA 3OYNA 4EZ9A 4FJ8A 4CGDA 5CZ1A 4KHSA 3AA2A 4B3OA 1YT3A 4RW4A 2IOCA 4M3TA 3KKRA 3VQ6A 3HVTA 4LH5A 2P5OA 3MAQA 4RW8A 1TVRA 4MQ3A 4KI4A 1GOBA 1SKWA 4DTMA 4UQGA 3CG7A 1TL1A 2B6AA 4CERA 1W9HA 3L2UA 1EX4A 3SZ2A 1JXBA 4CEOA 1T05A 1L5UA 4NYFA 3AVBA 1A5VA 3ZSOA 3OS2A 2EHGA 4FK4A 1D8YA 1RDCA 5KI6A 1S6QA 1Z25A 4CHPA 4FVMA 2XY7A 2Z1GA 1S1WA 3BGRA 3KD5E 1WN7A 4B9SA 4KB0A 3QETA 1NOYA 1HRHA 3PO4A 4CECA 4IG0A 4FJ7A 1RILA 1ZBLA 3AVGA 4ELUA 3IRXA 3U6FA 4KTWA 2YHAA 3B6OA 3O3HA 4J2DA 1BHLA 3LDSA 4CF0A 1VSDA 3V6DA 1BCMA 1O1WA 3AO3A 4G1QA 4AHVA 4CJFA 3NDKA 4DF8A 2G8WA 2WONA 4M42A 4JLHA 4RW9A 1J54A 1NK0A 3P83D 1Q8IA 4FLWA 4KAZA 4DSJA 1T03A 2DFEA 4W5QA 3VQ8A 4RG8A 3V81A 4RW7A 2A1RA 4BE2A 1U48A 4CCHA 3KLHA 1C6VA 4O55A 5K14A 2XY6A 2VG7A 3P1GA 1WSIA 5C24A 4DSLA 3LANA 4C8MA 2ZD1A 3K5LA 1MU2A 5C25A 2GBZA 2OPRA 3L3UA 2HHWA 1LAWA 3IS9A 4Z0UA 3V9ZA 1KFSA 2VWKA 1HYVA 4FLXA 3PX4A 3D0PA 2D0AA 2DFHA 1HQUA 1QS4A 4LY7A 4CIFA 4CJKA 4E7KA 2XY5A 1NK7A 3C95A 1IKWA 3L2VA 4BDZA 3QEWA 1X9SA 2RKIA 3AO4A 4LH4A 5HRPA 1XC9A 2D0CA 3S3OA 4I9LA 1N6QA 3MEGA 4NCGA 4KTQA 3ZT0A 2B4JA 3LWMA 4YNQA 2PY5A 1LWEA 3MXIA 5HRSA 4C8NA 3QEXA 1RT5A 3AVHA 4KHQA 1RBTA 4FJMA 4DSIA 3UIQA 3WNHA 1VSIA 4CESA 4CK1A 3OJUA 3KLIA 2ETJA 2G8HA 3LZJA 2G8VA 1D5AA 1QSYA 4NCAA 4O44A 3NAEA 1ZBUA 1U49A 4FJ5A 4CK2A 3DOKA 5FRNA 3CFPA 2E4LA 3CYMA 4FW1A 3NF9A 1S1VA 3QEPA 3ITHA 4DS4A 1BGXT 4CE9A 2HVHA 2IC3A 3AA5X 3HYFA 4BWMA 4JRPA 3S9HA 3PO5A 1RCHA 4DS5A 4M3UA 4PWDA 3JYTA 4OPJA 2HW3A 5J2PA 3SCXA 3OVNA 3VQEA 4ID5A 1C0UA 4N5SA 1W0HA 1FK9A 3SUQA 3HL8A 4E1NA 3LZIA 5SZTA 1REVA 3TAFA 3ZSYA 4Z4CA 2X74A 3OYIA 3OYJA 1ZYQA 1Q9YA 1TL3A 1UOCA 3ZSXA 1NOZA 3OYDA 3ULDA 2RN2A 4FM0A 4B9UA 4CJ4A 1DLOA 1S6PA 1S1UA 2OPPA 3AVFA 3V1OA 2PYJA 4CJLA 1BI4A 2IDOA 4AHSA 5J2MA 1IKXA 1YTAA 3AVKA 2OZMA 4KPYA 3QERA 3QNNA 3MEDA 5FROA 4NYNA 1I3AA 4KO0A 3O4QA 1GOAA 4CHNA 1KCFA 3M8QA 5J1EA 2YV0X 1RT1A 5HBMA 3KIOA 4N41A 1VRTA 2KQ2A 5JS1A 3LWLA 3OYKA 2P51A 1IG9A 1FKOA 2IS3A 3SYZA 3M8SA 1WSGA 3DLGA 3AO2A 5HRRA 4O0IA 3HJFA 3CQ8A 3QO9A 1KVAA 1JKHA 2YNGA 1XWLA 3TAMA 2RF2A 3CM6A 1T8EA 1QSSA 3SV3A 3NBPA 3AVAA 3VA0A 4CF9A 1SUQA 4CJVA 1NK4A 3MECA 4CHZA 4W5OA 3OYAA 1HYZA 3TABA 3C6TA 2F8TA 1D9DA 1RT7A 2Z1JA 2OPQA 4PUOA 1U04A 3D45A 1LW2A 1BCOA 3M8PA 4E7HA 1BIZA 3WNEA 5J2NA 4FJHA 1Y97A 3KK2A 4GMJB 4PQUA 2KZMA 1ZBHA 3RMBA 4IFYA 4C8KA 2OA8A 4E7LA 1ZBIA 3ZSVA 4J2AA 4FJXA 4CEEA 1RDBA 4CIEA 3OYLA 1N5YA 3KD1E 2GUIA 1DTQA 4DQSA 4DQPA 2HHVA 5SWMA 3SI6A 2PYLA 2HHTA 2D5RA 4BDPA 3CM5A 4KREA 4CJUA 4M3ZA 1UAXA 4DTRA 1JLGA 1CXQA 4OJRA 3PV8A 2HNZA 3TI0A 1NJZA 4FM2A 4CHYA 3QEIA 2OZSA 1HMVA 3DLEA 2IGIA 1ASWA 3QINA 3LP2A 1D9FA 3PX0A 1JL2A 1RDDA 3AVJA 4H4MA 4CGGA 1RBRA 2FBXA 3QIPA 4DMNA 3HPHA 4E19A 4BACA 4DQRA 4IKFA 3A2FA 3ZT3A 4I7FA 4QAGA 1JLAA 3TR8A 4IFVA 4DSEA 3VQ4A 4LSLA 1JLCA 2W42A 3QESA 2XRIA 4DWIA 2X78A 1HNVA 1CZ9A 4EP4A 3KLFA 4ID1A 4HCCA 2O4IA 3C6UA 4DTOA 4FZXC 3K5NA 3SQ1A 1RT3A 4BDYA 1K6YA 1QSLA 1RTDA 2HHXA 4HVJA 4AH9A 4CEBA 3I8DA 4DSKA 3I0SA 4YFUA 3SQ0A 1YVUA 4FXDA 4CGIA 3U3YA 4CJ3A 3OYCA 4E3SA 3V9UA 1NKEA 2G8KA 1WAJA 4Q5VA 4AHTA 1R0AA 1J53A 4M45A 2YKNA 4AHRA 3K57A 4FK2A 1IKVA 1ZBFA 4CHOA 1TAQA 2HMIA 3VQPA 1BI4B 3DLBA 3NGZA 1TKXA 3LP1A 2BANA 1JLEA 4TSXA 3RWUA 2KZZA 3AO5A 2F8SA 3SUNA 4K8ZA 1QQCA 4N76A 1VSMA 4E1MA 1UWBA 1C0MA 3DM2A 3FFIA 1KVBA 5KGWA 5T7BA 4FLYA 4FLTA 3SJJA 2Z1HA 4FJJA 3MEEA 3AV9A 4FJGA 1TAUA 3DLRA 3RMCA 4DFKA 4CGHA 2BE2A 3RMAA 4KHYA 3THVA 3E01A 3AA3A 3OYMA 1U47A 3AVNA 2HNYA 1RT4A 3T19A 3LPTA 4N47A 2G8IA 1B9DA 3VQAA 2VG6A 2O4GA 4JS5A 1X9WA 4CF8A 4KHUA 1TGOA 4O0JA 4CEQA 4M3RA 1TKDA 5FDLA 2G8FA 4FLVA 4BE0A 5HROA 1TK5A 4CJ5A 3F73A 1KVCA 2NUBA 3ZSWA 4DTUA 3TANA 1I39A 3V9WA 4ELTA 3T1AA 1JLQA 3O4NA 1NJWA 1VK0A 4QOZB 3RTVA 1X1PA 4KKOA 3TWHA 4QCLA 1HPZA 4Y1DA 5C42A 1S9GA 2D0BA 1NKCA 4CF1A 4KHWA 1KSPA 4JRQA 3OYGA 3LP3A 3VQCA 4HTUA 2HVIA 5HRNA 1HQEA 4DQQA 3NH1A 2VWJA 3WNGA 4CFCA 1RNHA 1HNIA 4Z4HA 4Q0BA 3DRPA 3KKSA 3PX6A 1SV5A 3U3GA 1RTIA 3NF8A 3T3FA 1TKTA 3SQ2A 4O4GA 1WSHA 1SKRA 1RBUA 3LPUA 4C8LA 3ALYA 4DG1A 4F3TA 1HJRA 3KK3A 3HP6A 1VSEA 3ZSQA 3NFAA 1NJYA 5CZ2A 1FKPA 2ZE2A 2YHBA 4E7JA 1ASUA 3IAYA 1LWCA 4CFDA 2I5JA 1TV6A 4GVMA 3VQDA 3EY1A 4PY5A 4HUGA 3ZCMA 2E6MA 1GOCA 2YNIA 4OLAA 3AVLA 3HXMA 1ITGA 3SV4A 2ZQBA 3VQ9A 5CY4A 1IKYA 1VSFA 4ICLA 4O5BA 1BQNA 1ASVA 4FW2A 4DFJA 5D3GA 1TK0A 1SL0A 3RR7A 3ZSZA 3OS1A 4DTSA 1QTMA 1B92A 1LW0A 3K5OA 4FJNA 4I2QA 3QIOA 4CFAA 3CFRA 4CJSA 4CJRA 3QEVA 4FJ9A 4FLUA 4B9MA 4Z4IA 2DTUA 4J2EA 1RTHA 3G10A 3WNFA 1QHTA 3AA4A 3V4IA 4DFPA 3S3MA 1VSLA 4LD0A 4ELVA 4BE1A 4Y1CA 1S9EA 3RRGA 3ASMA 3RRHA 1B9FA 4CGFA 5FRMA 2FBYA 1TKZA 3JSMA 4OKJA 4OPKA 3KTQA 4CJQA 4Z4EA 2G8UA 2VG5A 3DOLA 3O3FA 3ZT2A 1IO2A 2BGGA 1S5JA 1LWFA 1UA0A 3KK1A 4OKKA 1KTQA 4B9VA 3OJSA 2OYQA 4FZYA 3K5MA 3TAPA 2F96A 4DTPA 1FXXA 1CXUA 3DRRA 5KGXA 4DU3A 4HUEA 1WLJA 2QXFA 4LSNA 3SUPA 4KI6A 4W5NA 1CZBA 4W5RA 4DLGA 4B8AB 2BDPA 3OYBA 4GW6A 2ITGA 3OYHA 2XO7A 4HCBA 2KFZA 4HUFA 3VN5A 3BDPA 5CYMA 4N56A 1BL3A 5I42A 3NF6A 2GV9A 4CGJA 2RPIA 3KLEA 3LAMA 5HLFA 2P5GA 4F3OA 1VRUA 3KLGA 2FBTA 2JGUA 3LALA 2PZSA 1A5XA 4ZHRA 1L3VA 1KLNA 3NCIA 2KFNA 4M3YA 3NHGA 2HHSA 3DLKA 1XHZA 3H08A 1CLQA 3M8RA 5DMRA 4DTXA 2IAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EXQ A;  4CED A;  3SPY A;  4CJW A;  3G0Z A;  4CJP A;  3NGY A;  1NK5 A;  4DU4 A;  4F8R A;  1EET A;  3TAG A;  3C94 A;  4CEA A;  4XIU A;  4RW6 A;  4CHQ A;  1RBS A;  3OS0 A;  3SQ4 A;  3I0R A;  4EZ6 A;  3HO1 A;  2HHQ A;  4M3X A;  3HST B;  2A1S A;  4CK3 A;  1Q9X A;  3SNN A;  1RDA A;  3OYE A;  4KRF A;  2HHU A;  1J5O A;  4FM1 A;  4OLB A;  4IDK A;  3RR8 A;  5JS2 A;  1S1X A;  3HT3 A;  1T7P A;  4KHN A;  1F21 A;  1NJX A;  3CFO A;  2ATQ A;  2YKM A;  1JL1 A;  1LAV A;  2B5J A;  3HM9 A;  4FLZ A;  1WSF A;  3TAR A;  4Z4G A;  2HB5 A;  1WSJ A;  2AJQ A;  4B9L A;  2QKB A;  4DU1 A;  2WOM A;  1JLB A;  4CF2 A;  1BQM A;  2YNH A;  3AVI A;  3VA3 A;  3TAQ A;  1L3T A;  1L3U A;  3DRS A;  3DMJ A;  3NH2 A;  4FCY A;  3F9K A;  3MXM A;  1HYS A;  4OKE A;  3PUF A;  3L2W A;  3ZT1 A;  4CFB A;  3EYZ A;  5KTQ A;  3DYA A;  4M3W A;  3K58 A;  4B08 A;  1KLM A;  1XI1 A;  3NF7 A;  4ZTJ A;  4PA1 A;  1KFD A;  1L3S A;  1WNS A;  3HVR A;  1S1T A;  2FC0 A;  1X9M A;  2KW4 A;  3PY8 A;  4KFB A;  3AVM A;  5E41 A;  4M41 A;  1U4B A;  3DI6 A;  3VQB A;  2E6L A;  4AIL C;  3V1Q A;  2Z1I A;  2X6S A;  3HPG A;  3HP9 A;  2Q3S A;  3EZ5 A;  4DTJ A;  3VQQ A;  4FYD A;  3ZSR A;  5KRS A;  4AHU A;  4F2R A;  1RT2 A;  1C1A A;  1G15 A;  3QNO A;  2DFF A;  4IBN A;  4FK0 A;  4CEZ A;  1SL2 A;  4F4K A;  5DK5 A;  4DSF A;  3QLH A;  4B9T A;  3VQ7 A;  1SL1 A;  4KB1 A;  4L8R B;  1U45 A;  1LV5 A;  4J2B A;  1SKS A;  4K8X A;  3O3G A;  2Y1I A;  1NK6 A;  4JS4 A;  1C1B A;  4W5T A;  1UA1 A;  5CYQ A;  5KRT A;  3L8B A;  1XHX A;  2R7Y A;  4B9N A;  1RBV A;  4Z4F A;  3V9X A;  1TK8 A;  4E7I A;  4DFM A;  1Z26 A;  3LAK A;  4FZZ A;  1VSK A;  4OGE A;  1RT6 A;  3SPZ A;  2FBV A;  3RMD A;  3P5J A;  4CIG A;  5I3U A;  4OGC A;  3MXJ A;  4EP5 A;  1WAF A;  2QKK A;  3IG1 A;  5J2Q A;  4ZTF A;  1BIU A;  3TAE A;  3K2P A;  4IG3 A;  1NKB A;  4MFB A;  4FJL A;  4B8C A;  4NCB A;  3AO1 A;  3HPO A;  4DTN A;  1J9A A;  2JLE A;  2OPS A;  1EKE A;  1QE1 A;  3K59 A;  2DY4 A;  2EX3 A;  4WE1 A;  4F2S A;  5EU7 A;  1WSE A;  1BIS A;  3LP0 A;  4DQI A;  4KTZ A;  1VSH A;  3NGI A;  4E0D A;  4FJI A;  3AVC A;  1JLF A;  3NE6 A;  1EP4 A;  3OY9 A;  3L3V A;  4HHT A;  3ISN C;  2Y1J A;  5HP1 A;  3V9S A;  3OYF A;  2KTQ A;  3SUO A;  1NK8 A;  2YNF A;  2LSN A;  3L2R A;  4E89 A;  4DF4 A;  1RTJ A;  3B6P A;  4H4O A;  4KV8 A;  1DTT A;  2P1J A;  4DLE A;  4C8O A;  1YTU A;  2QK9 A;  3HK2 A;  3VQ5 A;  1NK9 A;  3V1R A;  4AHC A;  2XY8 A;  4BWJ A;  4FJK A;  3L2Q A;  4CEF A;  3KJV A;  1C0T A;  1JXE A;  3DLH A;  4I2P A;  3NH0 A;  1IH7 A;  1KRP A;  4OVL A;  4H8K A;  1VSJ A;  1A5W A;  3S3N A;  4I9Q A;  4R5P A;  4CJT A;  4CJE A;  2X6N A;  2HND A;  3ZT4 A;  2XHB A;  1C1C A;  3OYN A;  4EZ9 A;  4FJ8 A;  4CGD A;  5CZ1 A;  4KHS A;  3AA2 A;  4B3O A;  1YT3 A;  4RW4 A;  2IOC A;  4M3T A;  3KKR A;  3VQ6 A;  3HVT A;  4LH5 A;  2P5O A;  3MAQ A;  4RW8 A;  1TVR A;  4MQ3 A;  4KI4 A;  1GOB A;  1SKW A;  4DTM A;  4UQG A;  3CG7 A;  1TL1 A;  2B6A A;  4CER A;  1W9H A;  3L2U A;  1EX4 A;  3SZ2 A;  1JXB A;  4CEO A;  1T05 A;  1L5U A;  4NYF A;  3AVB A;  1A5V A;  3ZSO A;  3OS2 A;  2EHG A;  4FK4 A;  1D8Y A;  1RDC A;  5KI6 A;  1S6Q A;  1Z25 A;  4CHP A;  4FVM A;  2XY7 A;  2Z1G A;  1S1W A;  3BGR A;  3KD5 E;  1WN7 A;  4B9S A;  4KB0 A;  3QET A;  1NOY A;  1HRH A;  3PO4 A;  4CEC A;  4IG0 A;  4FJ7 A;  1RIL A;  1ZBL A;  3AVG A;  4ELU A;  3IRX A;  3U6F A;  4KTW A;  2YHA A;  3B6O A;  3O3H A;  4J2D A;  1BHL A;  3LDS A;  4CF0 A;  1VSD A;  3V6D A;  1BCM A;  1O1W A;  3AO3 A;  4G1Q A;  4AHV A;  4CJF A;  3NDK A;  4DF8 A;  2G8W A;  2WON A;  4M42 A;  4JLH A;  4RW9 A;  1J54 A;  1NK0 A;  3P83 D;  1Q8I A;  4FLW A;  4KAZ A;  4DSJ A;  1T03 A;  2DFE A;  4W5Q A;  3VQ8 A;  4RG8 A;  3V81 A;  4RW7 A;  2A1R A;  4BE2 A;  1U48 A;  4CCH A;  3KLH A;  1C6V A;  4O55 A;  5K14 A;  2XY6 A;  2VG7 A;  3P1G A;  1WSI A;  5C24 A;  4DSL A;  3LAN A;  4C8M A;  2ZD1 A;  3K5L A;  1MU2 A;  5C25 A;  2GBZ A;  2OPR A;  3L3U A;  2HHW A;  1LAW A;  3IS9 A;  4Z0U A;  3V9Z A;  1KFS A;  2VWK A;  1HYV A;  4FLX A;  3PX4 A;  3D0P A;  2D0A A;  2DFH A;  1HQU A;  1QS4 A;  4LY7 A;  4CIF A;  4CJK A;  4E7K A;  2XY5 A;  1NK7 A;  3C95 A;  1IKW A;  3L2V A;  4BDZ A;  3QEW A;  1X9S A;  2RKI A;  3AO4 A;  4LH4 A;  5HRP A;  1XC9 A;  2D0C A;  3S3O A;  4I9L A;  1N6Q A;  3MEG A;  4NCG A;  4KTQ A;  3ZT0 A;  2B4J A;  3LWM A;  4YNQ A;  2PY5 A;  1LWE A;  3MXI A;  5HRS A;  4C8N A;  3QEX A;  1RT5 A;  3AVH A;  4KHQ A;  1RBT A;  4FJM A;  4DSI A;  3UIQ A;  3WNH A;  1VSI A;  4CES A;  4CK1 A;  3OJU A;  3KLI A;  2ETJ A;  2G8H A;  3LZJ A;  2G8V A;  1D5A A;  1QSY A;  4NCA A;  4O44 A;  3NAE A;  1ZBU A;  1U49 A;  4FJ5 A;  4CK2 A;  3DOK A;  5FRN A;  3CFP A;  2E4L A;  3CYM A;  4FW1 A;  3NF9 A;  1S1V A;  3QEP A;  3ITH A;  4DS4 A;  1BGX T;  4CE9 A;  2HVH A;  2IC3 A;  3AA5 X;  3HYF A;  4BWM A;  4JRP A;  3S9H A;  3PO5 A;  1RCH A;  4DS5 A;  4M3U A;  4PWD A;  3JYT A;  4OPJ A;  2HW3 A;  5J2P A;  3SCX A;  3OVN A;  3VQE A;  4ID5 A;  1C0U A;  4N5S A;  1W0H A;  1FK9 A;  3SUQ A;  3HL8 A;  4E1N A;  3LZI A;  5SZT A;  1REV A;  3TAF A;  3ZSY A;  4Z4C A;  2X74 A;  3OYI A;  3OYJ A;  1ZYQ A;  1Q9Y A;  1TL3 A;  1UOC A;  3ZSX A;  1NOZ A;  3OYD A;  3ULD A;  2RN2 A;  4FM0 A;  4B9U A;  4CJ4 A;  1DLO A;  1S6P A;  1S1U A;  2OPP A;  3AVF A;  3V1O A;  2PYJ A;  4CJL A;  1BI4 A;  2IDO A;  4AHS A;  5J2M A;  1IKX A;  1YTA A;  3AVK A;  2OZM A;  4KPY A;  3QER A;  3QNN A;  3MED A;  5FRO A;  4NYN A;  1I3A A;  4KO0 A;  3O4Q A;  1GOA A;  4CHN A;  1KCF A;  3M8Q A;  5J1E A;  2YV0 X;  1RT1 A;  5HBM A;  3KIO A;  4N41 A;  1VRT A;  2KQ2 A;  5JS1 A;  3LWL A;  3OYK A;  2P51 A;  1IG9 A;  1FKO A;  2IS3 A;  3SYZ A;  3M8S A;  1WSG A;  3DLG A;  3AO2 A;  5HRR A;  4O0I A;  3HJF A;  3CQ8 A;  3QO9 A;  1KVA A;  1JKH A;  2YNG A;  1XWL A;  3TAM A;  2RF2 A;  3CM6 A;  1T8E A;  1QSS A;  3SV3 A;  3NBP A;  3AVA A;  3VA0 A;  4CF9 A;  1SUQ A;  4CJV A;  1NK4 A;  3MEC A;  4CHZ A;  4W5O A;  3OYA A;  1HYZ A;  3TAB A;  3C6T A;  2F8T A;  1D9D A;  1RT7 A;  2Z1J A;  2OPQ A;  4PUO A;  1U04 A;  3D45 A;  1LW2 A;  1BCO A;  3M8P A;  4E7H A;  1BIZ A;  3WNE A;  5J2N A;  4FJH A;  1Y97 A;  3KK2 A;  4GMJ B;  4PQU A;  2KZM A;  1ZBH A;  3RMB A;  4IFY A;  4C8K A;  2OA8 A;  4E7L A;  1ZBI A;  3ZSV A;  4J2A A;  4FJX A;  4CEE A;  1RDB A;  4CIE A;  3OYL A;  1N5Y A;  3KD1 E;  2GUI A;  1DTQ A;  4DQS A;  4DQP A;  2HHV A;  5SWM A;  3SI6 A;  2PYL A;  2HHT A;  2D5R A;  4BDP A;  3CM5 A;  4KRE A;  4CJU A;  4M3Z A;  1UAX A;  4DTR A;  1JLG A;  1CXQ A;  4OJR A;  3PV8 A;  2HNZ A;  3TI0 A;  1NJZ A;  4FM2 A;  4CHY A;  3QEI A;  2OZS A;  1HMV A;  3DLE A;  2IGI A;  1ASW A;  3QIN A;  3LP2 A;  1D9F A;  3PX0 A;  1JL2 A;  1RDD A;  3AVJ A;  4H4M A;  4CGG A;  1RBR A;  2FBX A;  3QIP A;  4DMN A;  3HPH A;  4E19 A;  4BAC A;  4DQR A;  4IKF A;  3A2F A;  3ZT3 A;  4I7F A;  4QAG A;  1JLA A;  3TR8 A;  4IFV A;  4DSE A;  3VQ4 A;  4LSL A;  1JLC A;  2W42 A;  3QES A;  2XRI A;  4DWI A;  2X78 A;  1HNV A;  1CZ9 A;  4EP4 A;  3KLF A;  4ID1 A;  4HCC A;  2O4I A;  3C6U A;  4DTO A;  4FZX C;  3K5N A;  3SQ1 A;  1RT3 A;  4BDY A;  1K6Y A;  1QSL A;  1RTD A;  2HHX A;  4HVJ A;  4AH9 A;  4CEB A;  3I8D A;  4DSK A;  3I0S A;  4YFU A;  3SQ0 A;  1YVU A;  4FXD A;  4CGI A;  3U3Y A;  4CJ3 A;  3OYC A;  4E3S A;  3V9U A;  1NKE A;  2G8K A;  1WAJ A;  4Q5V A;  4AHT A;  1R0A A;  1J53 A;  4M45 A;  2YKN A;  4AHR A;  3K57 A;  4FK2 A;  1IKV A;  1ZBF A;  4CHO A;  1TAQ A;  2HMI A;  3VQP A;  1BI4 B;  3DLB A;  3NGZ A;  1TKX A;  3LP1 A;  2BAN A;  1JLE A;  4TSX A;  3RWU A;  2KZZ A;  3AO5 A;  2F8S A;  3SUN A;  4K8Z A;  1QQC A;  4N76 A;  1VSM A;  4E1M A;  1UWB A;  1C0M A;  3DM2 A;  3FFI A;  1KVB A;  5KGW A;  5T7B A;  4FLY A;  4FLT A;  3SJJ A;  2Z1H A;  4FJJ A;  3MEE A;  3AV9 A;  4FJG A;  1TAU A;  3DLR A;  3RMC A;  4DFK A;  4CGH A;  2BE2 A;  3RMA A;  4KHY A;  3THV A;  3E01 A;  3AA3 A;  3OYM A;  1U47 A;  3AVN A;  2HNY A;  1RT4 A;  3T19 A;  3LPT A;  4N47 A;  2G8I A;  1B9D A;  3VQA A;  2VG6 A;  2O4G A;  4JS5 A;  1X9W A;  4CF8 A;  4KHU A;  1TGO A;  4O0J A;  4CEQ A;  4M3R A;  1TKD A;  5FDL A;  2G8F A;  4FLV A;  4BE0 A;  5HRO A;  1TK5 A;  4CJ5 A;  3F73 A;  1KVC A;  2NUB A;  3ZSW A;  4DTU A;  3TAN A;  1I39 A;  3V9W A;  4ELT A;  3T1A A;  1JLQ A;  3O4N A;  1NJW A;  1VK0 A;  4QOZ B;  3RTV A;  1X1P A;  4KKO A;  3TWH A;  4QCL A;  1HPZ A;  4Y1D A;  5C42 A;  1S9G A;  2D0B A;  1NKC A;  4CF1 A;  4KHW A;  1KSP A;  4JRQ A;  3OYG A;  3LP3 A;  3VQC A;  4HTU A;  2HVI A;  5HRN A;  1HQE A;  4DQQ A;  3NH1 A;  2VWJ A;  3WNG A;  4CFC A;  1RNH A;  1HNI A;  4Z4H A;  4Q0B A;  3DRP A;  3KKS A;  3PX6 A;  1SV5 A;  3U3G A;  1RTI A;  3NF8 A;  3T3F A;  1TKT A;  3SQ2 A;  4O4G A;  1WSH A;  1SKR A;  1RBU A;  3LPU A;  4C8L A;  3ALY A;  4DG1 A;  4F3T A;  1HJR A;  3KK3 A;  3HP6 A;  1VSE A;  3ZSQ A;  3NFA A;  1NJY A;  5CZ2 A;  1FKP A;  2ZE2 A;  2YHB A;  4E7J A;  1ASU A;  3IAY A;  1LWC A;  4CFD A;  2I5J A;  1TV6 A;  4GVM A;  3VQD A;  3EY1 A;  4PY5 A;  4HUG A;  3ZCM A;  2E6M A;  1GOC A;  2YNI A;  4OLA A;  3AVL A;  3HXM A;  1ITG A;  3SV4 A;  2ZQB A;  3VQ9 A;  5CY4 A;  1IKY A;  1VSF A;  4ICL A;  4O5B A;  1BQN A;  1ASV A;  4FW2 A;  4DFJ A;  5D3G A;  1TK0 A;  1SL0 A;  3RR7 A;  3ZSZ A;  3OS1 A;  4DTS A;  1QTM A;  1B92 A;  1LW0 A;  3K5O A;  4FJN A;  4I2Q A;  3QIO A;  4CFA A;  3CFR A;  4CJS A;  4CJR A;  3QEV A;  4FJ9 A;  4FLU A;  4B9M A;  4Z4I A;  2DTU A;  4J2E A;  1RTH A;  3G10 A;  3WNF A;  1QHT A;  3AA4 A;  3V4I A;  4DFP A;  3S3M A;  1VSL A;  4LD0 A;  4ELV A;  4BE1 A;  4Y1C A;  1S9E A;  3RRG A;  3ASM A;  3RRH A;  1B9F A;  4CGF A;  5FRM A;  2FBY A;  1TKZ A;  3JSM A;  4OKJ A;  4OPK A;  3KTQ A;  4CJQ A;  4Z4E A;  2G8U A;  2VG5 A;  3DOL A;  3O3F A;  3ZT2 A;  1IO2 A;  2BGG A;  1S5J A;  1LWF A;  1UA0 A;  3KK1 A;  4OKK A;  1KTQ A;  4B9V A;  3OJS A;  2OYQ A;  4FZY A;  3K5M A;  3TAP A;  2F96 A;  4DTP A;  1FXX A;  1CXU A;  3DRR A;  5KGX A;  4DU3 A;  4HUE A;  1WLJ A;  2QXF A;  4LSN A;  3SUP A;  4KI6 A;  4W5N A;  1CZB A;  4W5R A;  4DLG A;  4B8A B;  2BDP A;  3OYB A;  4GW6 A;  2ITG A;  3OYH A;  2XO7 A;  4HCB A;  2KFZ A;  4HUF A;  3VN5 A;  3BDP A;  5CYM A;  4N56 A;  1BL3 A;  5I42 A;  3NF6 A;  2GV9 A;  4CGJ A;  2RPI A;  3KLE A;  3LAM A;  5HLF A;  2P5G A;  4F3O A;  1VRU A;  3KLG A;  2FBT A;  2JGU A;  3LAL A;  2PZS A;  1A5X A;  4ZHR A;  1L3V A;  1KLN A;  3NCI A;  2KFN A;  4M3Y A;  3NHG A;  2HHS A;  3DLK A;  1XHZ A;  3H08 A;  1CLQ A;  3M8R A;  5DMR A;  4DTX A;  2IAJ A; 
#chains in the Genus database with same CATH topology
 1EXQ A;  4JKG B;  4BRK A;  4CJW A;  1NK5 A;  4F8R A;  1EET A;  3TAG A;  3C94 A;  2VGM A;  4RW6 A;  4GV9 A;  5LMN K;  3W3D A;  3OYE A;  2HHU A;  5MLC Q;  4OLB A;  1YVN A;  1S1X A;  3GBT A;  1F21 A;  4FSV A;  1M1K O;  4PWD A;  1JL1 A;  1LAV A;  2B5J A;  5M1Q A;  3TAR A;  1WSF A;  2RHK A;  1WSJ A;  2Q1N A;  3CJ9 A;  4B9L A;  2VGN A;  1T44 A;  3MN5 A;  4BRQ A;  4I6M B;  4KHP K;  4B1V A;  4FCY A;  4OPH A;  4B3S K;  1E3M A;  2BUP A;  5BR8 K;  3EYZ A;  4M3W A;  3K58 A;  3VF6 A;  4A59 A;  2P9U A;  3NVM A;  3BUZ B;  4KH4 A;  1WNS A;  3HVR A;  5LY3 A;  3C0B A;  3PY8 A;  4WF9 L;  3IDH A;  1QZ6 A;  3VQB A;  5M1F A;  5TKY A;  2Z1I A;  2IVN A;  3HP9 A;  3VEY A;  4DTJ A;  1NGC A;  3VQQ A;  1VQP N;  1O13 A;  4BR7 A;  4A61 A;  1W2B M;  4L8R B;  5IWA K;  2Y1I A;  1NK6 A;  2QEX N;  1HJO A;  1XHX A;  4B9N A;  1TK8 A;  3G4S N;  4FZZ A;  1VSK A;  4LF8 K;  1RT6 A;  3SPZ A;  2FBV A;  5I3U A;  4EHT A;  4EP5 A;  4DHY A;  3K2P A;  4KBO A;  5CHI A;  2QXL A;  2DY4 A;  3MN9 A;  3T7Z A;  4E1J A;  1WSE A;  4E0D A;  4FJI A;  3NGI A;  1JLF A;  1EP4 A;  2HST A;  5HP1 A;  3SAH A;  4GNI A;  3OYF A;  4MO5 A;  5FPD A;  3L2R A;  1Q81 O;  1RTJ A;  4KV8 A;  4DLE A;  3HK2 A;  3E9P A;  5JLH A;  3L2Q A;  4CEF A;  3KJV A;  1C0T A;  1JXE A;  4X65 K;  4JI7 K;  4H8K A;  1VQ9 N;  4CJT A;  3CQY A;  4BRE A;  4BRN A;  2CH5 A;  2HND A;  3ZT4 A;  2Q2R A;  4CI6 A;  1C1C A;  5CZ1 A;  1YT3 A;  4RW4 A;  3VQ6 A;  4RW8 A;  4B1U B;  3I56 N;  4DTM A;  3L2U A;  1W9H A;  1T05 A;  3VF2 A;  4AM7 A;  2P9I A;  1A5V A;  3OS2 A;  5KI6 A;  3CJB A;  2Z1G A;  3BGR A;  2F9W A;  4MO4 A;  1NOY A;  4BRD A;  4BC3 A;  4KTW A;  2YHA A;  4J2D A;  3TTD A;  1VSD A;  3V6D A;  2G8W A;  2WON A;  4RW9 A;  1NK0 A;  3P83 D;  1C0G A;  1Q8I A;  4KAZ A;  4DSJ A;  2DFE A;  3VQ8 A;  2A1R A;  4RW7 A;  4YOV A;  4V19 S;  5K14 A;  2VG7 A;  5C24 A;  1NGE A;  3LAN A;  4C8M A;  4EAH D;  1HNX K;  4JKB A;  3EL2 A;  2KKZ A;  1SAZ A;  2OPR A;  3L3U A;  4FPA A;  2OTL N;  2VWK A;  2P9K A;  3D0P A;  4CIF A;  4LY7 A;  1YXQ A;  1IG9 A;  4E7K A;  3C95 A;  3DXM B;  3AO4 A;  3J7A P;  3VEZ A;  3ZT0 A;  4M63 C;  4C8N A;  4KHQ A;  2YI1 A;  3UIQ A;  3QFU A;  4CK1 A;  3J80 O;  3KLI A;  1BG3 A;  2G8V A;  1QSY A;  2E5L K;  3CFP A;  2E4L A;  3CYM A;  3NF9 A;  4FO0 A;  3ITH A;  4CE9 A;  4JRP A;  1KD1 O;  2NZT A;  1HR0 K;  3R6M A;  4MDA A;  3SCX A;  3OVN A;  4ID5 A;  3SUQ A;  4DR6 K;  1U2V A;  3LZI A;  1VQ6 N;  4Z4C A;  4CVN E;  1C0F A;  4YOT A;  4WQ5 C;  5C12 A;  1DEJ A;  1WB9 A;  1OH8 A;  3QER A;  3MED A;  1QVG M;  4EFH A;  4NYN A;  2P9N A;  3O4Q A;  4KO0 A;  2V7Z A;  3DXK B;  4QS9 A;  3WXI A;  3K9J A;  5FLX O;  4LFA K;  5HBM A;  4C1N K;  2KQ2 A;  2UXC K;  5JS1 A;  3THY B;  2IS3 A;  3A5N C;  1N34 K;  1WSG A;  3AGR A;  1GLE G;  2QTD A;  4O0I A;  3THX A;  3ID8 A;  3MWP A;  4B1X B;  4IEI A;  2YNG A;  1T8E A;  4OPA A;  5AQP A;  3R1X A;  3KK7 A;  3TAB A;  4WQ4 C;  4BRL A;  2Z1J A;  4BRM A;  2HHH K;  1U04 A;  5J2N A;  4FJH A;  2QWO A;  5KQD A;  1Y97 A;  1XNR K;  4LF6 K;  4IFY A;  4C8K A;  2OA8 A;  4J2A A;  3ZX0 A;  2GUI A;  1DTQ A;  4DQP A;  3UKU B;  5SWM A;  3SI6 A;  2PYL A;  2FLO A;  2D5R A;  3O4W A;  3VEO A;  2V51 B;  1NJZ A;  4H0O A;  1YUW A;  2NRV A;  3ZT3 A;  4QAG A;  3KHY A;  2W42 A;  5TKW A;  3QES A;  4DWI A;  2X78 A;  1VQ7 N;  1CZ9 A;  1NLV A;  1U6Z A;  3HZ6 A;  4ID1 A;  3KLF A;  4G9Z A;  3K5N A;  1Z05 A;  1RT3 A;  3MX5 A;  2HHX A;  2Q36 A;  1RTD A;  2QWN A;  4NO7 A;  4HVJ A;  3M5R A;  1KQS M;  4CJ3 A;  3V9U A;  4AHT A;  1HKB A;  1IKV A;  1NG9 A;  3ENB A;  2HMI A;  3B8A X;  5C0Y A;  1EQY A;  1VAZ A;  5BRF A;  2E1Y A;  4E1M A;  3FFI A;  5KGW A;  4FWR A;  3VEW A;  4BG8 A;  1YHQ N;  3AV9 A;  1TAU A;  3RMC A;  4DFK A;  4CGH A;  3AA3 A;  1U47 A;  4BRH A;  2HNY A;  5AZI A;  3T19 A;  1IJJ A;  4OX9 K;  5BPM A;  1X9W A;  4CF8 A;  2QWR A;  5FDL A;  3VER A;  1TKD A;  4FLV A;  4BE0 A;  3ZSW A;  4ELT A;  1I39 A;  1VK0 A;  3SJH A;  3SAF A;  4QCL A;  3CHW A;  4KKO A;  4KH5 A;  1HPZ A;  4Y1D A;  1S9G A;  4KHW A;  3FLC O;  3OYG A;  3VQC A;  1RGI A;  3AY9 A;  1HLU A;  3WNG A;  3H6E A;  1RNH A;  3E1Y A;  4IEE A;  1HNI A;  4Z4H A;  4Q0B A;  3WXL A;  3U3G A;  5AQH A;  2KHO A;  3ENO A;  3U4L A;  4BRC A;  4O4G A;  1WSH A;  4ILJ A;  2ZF5 O;  4LF7 K;  4F3T A;  3HP6 A;  1VSE A;  2O8D B;  4IO8 A;  5CZ2 A;  3SAG A;  2GX9 A;  1T6D A;  4CBU A;  3VQD A;  4PY5 A;  3ZCM A;  5KPR A;  2YNI A;  4OLA A;  3HXM A;  1ITG A;  5E84 A;  1W7A A;  1NMD A;  2ZQB A;  1IKY A;  1ASV A;  1NGJ A;  5D3G A;  3RR7 A;  4DR2 K;  3OS1 A;  3PIO L;  4I2Q A;  3QIO A;  4CFA A;  3CFR A;  1KAY A;  3G10 A;  3AA4 A;  5GIO A;  4DFP A;  1Q18 A;  2EWS A;  4X66 K;  4B1Y B;  3ASM A;  4DB3 A;  1K8A O;  2W6L A;  3ZLJ A;  1XMQ K;  2VCP A;  4JV5 K;  3ZT2 A;  1S5J A;  2PFU A;  3KK1 A;  4OKK A;  1BA1 A;  4MLE A;  1TYQ A;  3OJS A;  4FZY A;  3K5M A;  4HUE A;  3HTV A;  4LSN A;  3O1B A;  4W5N A;  3H1V X;  3OYB A;  5F1X A;  4HCB A;  4HUF A;  1DKG D;  4H0V B;  2W40 A;  4LC9 B;  3A8Y A;  2RPI A;  3E9O A;  2P5G A;  2JGU A;  2CGJ A;  3CCE N;  3DLK A;  1Q7Y O;  1YJN N;  5KQ8 A;  3FZL A;  2O8E B;  3GE1 A;  4CED A;  4WFA L;  3G0Z A;  4CJP A;  3SQ4 A;  3IKM A;  3K0S A;  2HHQ A;  3QIC A;  3HST B;  3QDK A;  4JAX A;  4CK3 A;  1RDA A;  4KRF A;  1VQ5 N;  4IDK A;  3C6H A;  2WFB A;  4BR5 A;  1NJX A;  3CFO A;  2HOE A;  4FLZ A;  3HM9 A;  4Z4G A;  5BR9 A;  4DV2 K;  4JD2 B;  4B3M K;  2QKB A;  4DU1 A;  1JLB A;  4IOC L;  4BGA A;  5C2D A;  3CI5 A;  3NH2 A;  2Q0R A;  3F9K A;  4GKK K;  3PUF A;  3CC7 N;  4DUZ K;  2NRR A;  1XUP O;  5IT9 O;  4JNE A;  4B08 A;  3SBG A;  1XI1 A;  2UUA K;  4BRI A;  1KFD A;  1L3S A;  3H46 O;  3THW A;  2FC0 A;  2GTD A;  3WUH A;  3EKS A;  3EO3 A;  4XH5 A;  3V1Q A;  1RDW X;  2KLA A;  2OAN A;  3K9K A;  2QM1 A;  3BP8 A;  5EX5 A;  3GOI A;  3KWI A;  4AHU A;  4FWM A;  2GEL A;  3P31 A;  3QNO A;  2DFF A;  4IBN A;  5EOY A;  4PHT X;  4CEZ A;  1NGB A;  4YOR A;  3W0L A;  2HBL A;  4F4K A;  4DSF A;  1ATS A;  3VQ7 A;  3AAQ A;  1NGI A;  2YHW A;  4J2B A;  1NGD A;  1UA1 A;  5CYQ A;  5KRT A;  4Z4F A;  4DFM A;  4OGE A;  3O9R A;  4CIG A;  4OGC A;  2UYT A;  2WBN A;  4NB4 A;  1BIU A;  1QQO A;  2P9S B;  4FJL A;  3HPO A;  4DTN A;  4MLH A;  2JLE A;  2OPS A;  3U9D A;  1QE1 A;  4WQ5 A;  3K59 A;  4DR3 K;  1K8K A;  3LDL A;  3MMV A;  4KTZ A;  1R59 O;  4HHT A;  2Y1J A;  2BTF A;  1IBL K;  3SUO A;  1NK8 A;  4L3Q A;  2KTQ A;  4E89 A;  3B6P A;  4H4O A;  2P1J A;  1YTU A;  4AHC A;  4BWJ A;  4FJK A;  3ULE A;  3DLH A;  3NH0 A;  4OVL A;  1FJG K;  1VSJ A;  1A5W A;  3CJ7 A;  3ZEU B;  1IV0 A;  2D4W A;  3VES A;  1NGA A;  3UKR A;  3KKR A;  2E8A A;  2P5O A;  5EY4 A;  2KZZ A;  3TPQ A;  4CER A;  1EX4 A;  1N36 K;  2A41 A;  2XY7 A;  3KD5 E;  3EN9 A;  3VGL A;  4B9S A;  3QET A;  1HRH A;  4CEC A;  1WUA A;  2WUS A;  4JI4 K;  4CZE A;  1ZBL A;  3AVG A;  4ELU A;  3IRX A;  2RE2 A;  3SMS A;  4IO9 L;  3B6O A;  1IG8 A;  4CZF A;  4CF0 A;  3D2F A;  1O1W A;  3A5O C;  4JLH A;  3D2E B;  2VWB A;  4BE2 A;  1WSI A;  3I33 A;  4FWK A;  1U2V B;  2ZD1 A;  4WFB L;  3K5L A;  1BO5 O;  3CC2 N;  2HHW A;  4Z0U A;  2IVO A;  1T6C A;  3BEX A;  3L2V A;  1X9S A;  4BDZ A;  2RKI A;  4X62 K;  4BR9 A;  5HRP A;  4XH1 A;  1N6Q A;  3MEG A;  5AZJ A;  3LWM A;  4ILG B;  2PY5 A;  2YX6 A;  5AQI A;  1WBD A;  1QHA A;  1RT5 A;  3QEX A;  2F4V K;  1RBT A;  4FJM A;  3ZET A;  3WNH A;  4BY9 C;  2G8H A;  1D5A A;  3NAE A;  5FRN A;  1GLL O;  4DS4 A;  2HVH A;  3AA5 X;  4BWM A;  3SMP A;  4M3U A;  1TUU A;  3LM2 A;  4DS5 A;  2HW3 A;  4OPJ A;  1OH6 A;  5AQX A;  3VEN A;  1P8Z A;  2NLX A;  1W0H A;  3VTI A;  3HL8 A;  4E1N A;  3U9Z A;  2D1K A;  3OYI A;  3OYJ A;  2O8F B;  1Q9Y A;  1UOC A;  1NOZ A;  2RN2 A;  4B1Z A;  1DLO A;  3CCU N;  4R79 A;  3DAW A;  3AVF A;  4LF4 K;  2V52 B;  5M1N A;  2OZM A;  3AVK A;  2FF6 A;  5FRO A;  3TTF A;  3L6Q A;  4DR4 K;  5AQW A;  1KCF A;  2YV0 X;  2A40 A;  4N41 A;  1ZC6 A;  2YJF A;  3VOV A;  3OYK A;  2E1Z A;  2P51 A;  3DLG A;  5HRR A;  4BRA A;  3IMX A;  1KVA A;  1JKH A;  3TAM A;  1QSS A;  3SV3 A;  3NBP A;  4BGB A;  4CJV A;  3OYA A;  5CR4 A;  1SZ2 A;  3O1W A;  2OPQ A;  4F9O A;  3D45 A;  4B3R K;  1BCO A;  3M8P A;  3P39 A;  4GKJ K;  5AQV A;  3R8E A;  3MDQ A;  1QVF M;  1IBM K;  4H0P A;  3MCP A;  4CEE A;  4CIE A;  3OYL A;  3KD1 E;  4PL7 A;  4DQS A;  2O8B A;  4DR1 K;  5BN8 A;  3CM5 A;  1E4F T;  4XEI A;  4KRE A;  1UAX A;  4JKD A;  2FSJ A;  2HNZ A;  4FM2 A;  1TUY A;  4CHY A;  2O8C A;  4O8U A;  1ASW A;  3LP2 A;  3LDQ A;  1D9F A;  4J8F A;  4H4M A;  4DMN A;  3WT0 A;  3EZW A;  4E19 A;  4AQY K;  5BRD A;  2QWP A;  3BF3 A;  3TR8 A;  4IFV A;  4LF9 K;  4DSE A;  2E88 A;  4LSL A;  1JLC A;  1HNV A;  2O4I A;  3C6U A;  1S3X A;  3L0Q A;  1GLJ O;  1M90 O;  1QSL A;  4YFU A;  5HL7 L;  3OYC A;  5FPM A;  1WAJ A;  4M45 A;  3K57 A;  4CHO A;  4IDH A;  1BI4 B;  1TKX A;  5AQM A;  3AO5 A;  1RDU A;  3L4Q A;  3SUN A;  4M7Y A;  4HTL A;  4K8Z A;  5AQF A;  1UWB A;  3DM2 A;  5T7B A;  3NMU A;  4FJJ A;  5AQG A;  3NVK A;  3E01 A;  1NGF A;  5H1S Q;  4N47 A;  2G8I A;  1B9D A;  2O4G A;  4KHU A;  1TGO A;  3QB0 A;  5HRO A;  4CJ5 A;  3F73 A;  2NUB A;  4H0T B;  4H5W A;  1NJW A;  2D0B A;  4CZJ A;  3CCR N;  1KSP A;  4HTU A;  2HVI A;  2FF3 B;  5HRN A;  4JKG A;  2VWJ A;  3KWG A;  4H5N A;  1EWR A;  4JI2 K;  1SV5 A;  4K43 A;  1OVQ A;  5HOO A;  1TKT A;  3T3F A;  3SQ2 A;  1TYQ B;  3VGM A;  3LPU A;  3VEX A;  4C8L A;  3ZSQ A;  1ATR A;  2YHB A;  4E7J A;  1ASU A;  4BQL A;  2I5J A;  1TV6 A;  2FSK A;  1GOC A;  5M1O A;  2ZJQ L;  2ASM A;  3VQ9 A;  3O9T A;  1BQN A;  5KPT A;  1TK0 A;  4DTS A;  1QTM A;  1LW0 A;  4JKA A;  4FJ9 A;  4Z4I A;  4J2E A;  1RTH A;  3WNF A;  1VQL N;  4X64 K;  4U67 L;  3P38 A;  5BN9 A;  3RRG A;  3ID6 A;  2UXB K;  2FBY A;  3CCV N;  3KTQ A;  3A0I X;  4Z4E A;  3DOL A;  3O3F A;  2IVP A;  1IO2 A;  4BC4 A;  4B9V A;  2OYQ A;  3VPZ A;  4JI8 K;  4OO1 J;  1EO1 A;  4DU3 A;  3UE5 A;  4KI6 A;  3SUP A;  4W5R A;  3QBX A;  3MK6 A;  3T1H K;  4QS8 A;  4BR0 A;  3CIP A;  2D0O A;  3NF6 A;  3KLE A;  3LAM A;  1VQ4 N;  4FWL A;  1VRU A;  1GLA G;  3LAL A;  4ZHR A;  3RSE A;  1L3V A;  1KLN A;  4ILH A;  3NHG A;  1CLQ A;  3H08 A;  2QA4 N;  3AGK A;  1UA0 A;  4RCH A;  1FXX A;  3SPY A;  4YOW A;  1NGG A;  4DU4 A;  4XIU A;  4CHQ A;  3CCL N;  5AQR A;  2HBM A;  3I0R A;  3AAP A;  1MWM A;  3O9Q A;  2A6A A;  1J5O A;  4JK9 A;  3RR8 A;  5JS2 A;  3HT3 A;  1T7P A;  4A2B A;  4CZI A;  2ATQ A;  2YKM A;  1ESV A;  3HRG A;  2HB5 A;  1BOT O;  2ASP A;  2ASO A;  1BQM A;  2YNH A;  3VA3 A;  5JIC A;  3FE1 A;  1L3U A;  3DMJ A;  1HYS A;  3E66 A;  2Q0U A;  3C7N B;  3CMA N;  2P9L B;  3L2W A;  4CFB A;  4DV0 K;  5KTQ A;  2UUB K;  3DYA A;  5ELZ A;  1KLM A;  3PSF A;  4PA1 A;  1S1T A;  3ZX3 A;  1X9M A;  4CZK A;  1E4G T;  4AIL C;  2HF3 A;  1J5E K;  3R3L A;  4NXN K;  3ZX2 A;  3EZ5 A;  1NMN A;  1BDG A;  3ZSR A;  5KRS A;  4JYA K;  4GV6 A;  1RT2 A;  1C1A A;  3ULE B;  1G15 A;  1SL2 A;  5DK5 A;  5BPN A;  1U45 A;  4CBX A;  1SKS A;  4K8X A;  3O3G A;  3UKR B;  1C1B A;  2UXD K;  1QQN A;  4K41 A;  1Q82 O;  3V9X A;  4E7I A;  1Z26 A;  3C65 A;  3LAK A;  3SK3 A;  2QWQ A;  3Q7B A;  3DXM A;  3MXJ A;  5EVZ A;  1WAF A;  2QKK A;  5J2Q A;  4ZTF A;  3WEE B;  4IG3 A;  1NKB A;  3HM8 A;  1NU0 A;  4MFB A;  4B8C A;  1J9A A;  4BC5 A;  2EX3 A;  4WE1 A;  4F2S A;  5EU7 A;  1BIS A;  4DQI A;  3OY9 A;  3L3V A;  3H45 C;  3ISN C;  3V9S A;  2YNF A;  2LSN A;  2A5X A;  3O5B A;  4DF4 A;  4C8O A;  3VQ5 A;  4C1N I;  3V1R A;  1GLF O;  2XY8 A;  2F9T A;  3T69 A;  4DV4 K;  1V4S A;  4H03 B;  1IH7 A;  4YOU A;  4CJE A;  2X6N A;  2XHB A;  4FJ8 A;  4CGD A;  3AA2 A;  2IOC A;  3N4Q A;  4M3T A;  3MAQ A;  1TVR A;  4MQ3 A;  4KI4 A;  1GOB A;  1SKW A;  3G25 A;  3CG7 A;  1TL1 A;  3SZ2 A;  1L5U A;  1JXB A;  4CEO A;  3DLL L;  3ZSO A;  3AVB A;  3MWT A;  3WXK A;  2EHG A;  1D8Y A;  1Z25 A;  2P9U B;  4CHP A;  5JVH L;  1S1W A;  1WN7 A;  4YY3 K;  4KB0 A;  3DXK A;  3PO4 A;  4IG0 A;  1RIL A;  4B1W B;  3VMF B;  3MCA B;  3U6F A;  1LOT B;  3O3H A;  1BHL A;  3LDS A;  3ATV A;  4BVO A;  4CJF A;  3AO3 A;  4G1Q A;  4DF8 A;  3NDK A;  5FPE A;  4M42 A;  1J54 A;  3BY5 A;  4FLW A;  1T03 A;  4W5Q A;  2AA4 A;  1GLB G;  1U48 A;  4CCH A;  3KLH A;  3EE9 A;  1ILY A;  4O55 A;  4NXM K;  3P1G A;  1K73 O;  1OH5 A;  5AR0 A;  3UB5 A;  3RVC A;  1VQK N;  1MU2 A;  3DJC A;  3H3N O;  4CZG A;  4PKG A;  2HBJ A;  3FZF A;  4FLX A;  2D0A A;  1HQU A;  4CBW A;  4CJK A;  2XY5 A;  1NK7 A;  1IKW A;  3QEW A;  4FWS A;  4LH4 A;  3ZYY X;  4I9L A;  4KTQ A;  4NCG A;  2B4J A;  5AQN A;  4YNQ A;  1DT9 A;  3MXI A;  3D6R A;  3SBT A;  3AVH A;  1VHX A;  3CJ1 A;  4O8K A;  2E20 A;  4EHU A;  4DSI A;  4CES A;  3OJU A;  3LZJ A;  1I94 K;  1MDU B;  4JKC A;  2WC9 A;  4O44 A;  1ZBU A;  4FJ5 A;  4LF5 K;  3DOK A;  4FW1 A;  1S1V A;  3J7Y P;  1EWQ A;  3CJC A;  3PO5 A;  3S9H A;  3JYT A;  1Q86 O;  4CZH A;  3VQE A;  1C0U A;  1FK9 A;  4CZM A;  5SZT A;  1REV A;  3ZSY A;  3OHR A;  3QFP A;  4A2A A;  1ZYQ A;  1TL3 A;  3OYD A;  1H1V A;  3ULD A;  4B9U A;  4CJ4 A;  3CC4 N;  1VQO N;  1S1U A;  1Z6R A;  2O8B B;  2IDO A;  2P9I B;  1IKX A;  1YTA A;  5J2M A;  1I3A A;  4H0X B;  2O8C B;  4JHD A;  4CHN A;  4FWQ A;  3J7Z O;  5J1E A;  5DM7 L;  1HKC A;  4H5T A;  5B8H A;  5AQT A;  4DR7 K;  1RT1 A;  3KIO A;  1VRT A;  1FKO A;  3SYZ A;  3M8S A;  4GY2 B;  1XWL A;  4XH4 A;  2E2P A;  5BRE A;  3AVA A;  4FL9 A;  3MX2 A;  3MN6 A;  1SUQ A;  4BR2 A;  4CHZ A;  2A42 A;  2F8T A;  1HYZ A;  1SQK A;  1RT7 A;  1BIZ A;  5FPN A;  1ZBH A;  2P9K B;  3ENH A;  1ZBI A;  3ZSV A;  1RDB A;  4AM6 A;  1N5Y A;  4WQ4 A;  4K0K K;  2HHT A;  1HX1 A;  4JI1 K;  4C23 A;  5JMV A;  1JLG A;  1CXQ A;  4OJR A;  4YOX A;  4MDB A;  1VQN N;  2OZS A;  3DLE A;  2W41 A;  3QIN A;  1N32 K;  3PX0 A;  4DQR A;  1RBR A;  4IKF A;  2O8D A;  3HPH A;  3L4I A;  3A2F A;  1JLA A;  3JXU A;  3VQ4 A;  4YDU C;  2XRI A;  4CZL A;  4BG9 A;  4JK7 A;  3O9U A;  3CCJ N;  4FZX C;  5AQK A;  4BDY A;  1K6Y A;  1S22 A;  1OVY A;  4CEB A;  3I8D A;  3I0S A;  4YOY A;  1YVU A;  2Q31 A;  3FGU A;  3VGK A;  4FXD A;  4E3S A;  1NKE A;  2G8K A;  1JJ2 M;  1R0A A;  1J53 A;  4AHR A;  3WXJ A;  4DV6 K;  3VQP A;  1RFQ A;  3LP1 A;  3KVG A;  1NGH A;  2BAN A;  3RWU A;  4TSX A;  4A62 A;  2CGK A;  3BF1 A;  3EE8 A;  4JN4 A;  2P9N B;  4FLY A;  4FLT A;  1NWK A;  2ZWH A;  4FJG A;  3DLR A;  1W97 L;  1LCU A;  1S72 N;  4JI5 K;  4IJA A;  3RMA A;  3THV A;  3OYM A;  5GAG P;  3AVN A;  3J8A A;  4DCH A;  3LPT A;  3THX B;  3HBT A;  2VG6 A;  2VYP A;  5ADX A;  3F5T A;  3HSC A;  2E2N A;  5EXW A;  5ADX H;  4DTU A;  4O5F A;  3V9W A;  1JLQ A;  3O4N A;  4Y0W A;  2V7Y A;  2QWM A;  4BR4 A;  5AQO A;  4B9Q A;  3O8M A;  1NKC A;  4CF1 A;  3VEV A;  4BRO A;  4JRQ A;  2ZGZ A;  2O8E A;  1HQE A;  3NH1 A;  4CFC A;  4JI3 K;  4BC2 A;  3DRP A;  3KKS A;  5F2R A;  4A5A A;  3A5M C;  1Y64 A;  1SKR A;  5AQL A;  1RBU A;  2ZM6 K;  4CD1 A;  1WBB A;  3ALY A;  4ISG A;  5LL6 Z;  1BA0 A;  3KK3 A;  4FOE A;  3NFA A;  1NJY A;  3TSQ A;  4JD2 A;  3QBW A;  4GVM A;  4CFD A;  3CER A;  4HUG A;  1HUX A;  2E6M A;  1YI2 N;  3AVL A;  1N8R O;  2QWL A;  3SV4 A;  5CY4 A;  1VSF A;  4ICL A;  4O5B A;  4DFJ A;  4FW2 A;  1SL0 A;  3VF4 A;  5AQQ A;  2VQF K;  3ZSZ A;  3RSE B;  1B92 A;  4FJN A;  4DKW A;  5GIP A;  4CJS A;  4CJR A;  3QEV A;  2DTU A;  3GL1 A;  2NRT A;  3O6W A;  1HNW K;  5F0X A;  4LD0 A;  3PSI A;  4ELV A;  4Y1C A;  3T1Y K;  5DM6 L;  3RRH A;  1B9F A;  4CGF A;  5FRM A;  3JSM A;  4OKJ A;  4OPK A;  4CJQ A;  2G8U A;  1ATN A;  3IUC A;  1LWF A;  1KTQ A;  3TSP A;  2YJE A;  3TAP A;  2F96 A;  3KZB A;  3DRR A;  4K42 A;  3TU5 A;  3CET A;  5AZI B;  2H3G X;  5C2F A;  2QXF A;  1YIT N;  5AJ3 K;  2BDP A;  1ZXO A;  4A57 A;  4LFB K;  4GW6 A;  3OYH A;  2XO7 A;  3BDP A;  5CYM A;  1BL3 A;  5HLF A;  4F3O A;  4CGJ A;  3OTO K;  2PBD A;  2W6K A;  3KLG A;  2FBT A;  4ISE A;  2PZS A;  5GIN A;  1A5X A;  3WXM B;  2KFN A;  2P9S A;  4IOX A;  1NBW A;  1XHZ A;  3O9S A;  2HMP A;  2E2O A;  3BZK A;  3O80 A;  4DTX A;  3OW2 M;  3OBY A;  5BPL A;  3NGY A;  3FZM A;  4CEA A;  3CF5 L;  3TTC A;  3OS0 A;  1RBS A;  4EZ6 A;  3HO1 A;  2P9P A;  4M3X A;  2A1S A;  1OKJ A;  1Q9X A;  3SNN A;  2GUP A;  4FM1 A;  4BRF A;  4KHN A;  4NLC A;  3F9M A;  3CCM N;  3ZEU A;  2AJQ A;  2WOM A;  2HBK A;  4CF2 A;  2QW9 A;  1JCG A;  3TAQ A;  1L3T A;  3AVI A;  5CE3 A;  3DRS A;  3FR0 A;  1N33 K;  3MXM A;  4RTF D;  5GAE P;  3N4P A;  4OKE A;  5KPZ A;  3ZT1 A;  3HOT A;  2CGL A;  2D0P A;  1GLD G;  2FSN A;  2QI2 A;  3NF7 A;  4ZTJ A;  3LDP A;  1YAG A;  3EEQ A;  1FW6 A;  2KW4 A;  4KFB A;  3AVM A;  5E41 A;  4M41 A;  1U4B A;  3DI6 A;  2E6L A;  3GG4 A;  2X6S A;  3CD6 N;  1KAX A;  3HPG A;  3G71 N;  1T3V A;  2Q3S A;  4FYD A;  3D2E A;  4F2R A;  4KH6 A;  4FK0 A;  2CH6 A;  2WTU A;  4B9T A;  3QLH A;  4CW7 B;  1SL1 A;  4KB1 A;  1LV5 A;  4JS4 A;  4W5T A;  4I6M A;  3JS6 A;  3L8B A;  2R7Y A;  3PLA A;  3J81 O;  1RBV A;  2OTJ N;  4FVU A;  3LM9 A;  3RMD A;  1YF5 L;  3P5J A;  4FOI A;  5A2Q O;  1MWK A;  4B3T K;  3IG1 A;  2YCH A;  2PAV A;  5LJW A;  3TAE A;  1K9M O;  2FXU A;  4JI6 K;  3QML A;  5GAH P;  4NCB A;  3AO1 A;  1EKE A;  3LDN A;  3VTH A;  5C15 A;  2IIR A;  3LP0 A;  1VSH A;  3AVC A;  3NE6 A;  1QQM A;  1NJI O;  4PL8 A;  2QK9 A;  1DTT A;  1NK9 A;  3OBW A;  1P90 A;  4I2P A;  1KRP A;  3S3N A;  4I9Q A;  4R5P A;  4WCE L;  2YHY A;  4EZ9 A;  3OYN A;  4KHS A;  4B3O A;  2O8F A;  4H5V A;  3HVT A;  4LH5 A;  1YIJ N;  4FPB A;  3O08 A;  1J6Z A;  4UQG A;  2B6A A;  4QOZ B;  1IBK K;  1XC3 A;  4NYF A;  4FK4 A;  1RDC A;  1S6Q A;  4FVM A;  4PKI A;  3THW B;  2GEM A;  4FJ7 A;  5AQJ A;  1XMO K;  4WFN L;  4NLB A;  4Z94 A;  2I7P A;  1BCM A;  4AHV A;  4IOA L;  4BVP A;  5AQY A;  1KAZ A;  3I55 N;  4RG8 A;  3V81 A;  1V4T A;  1C6V A;  3Q7C A;  2XY6 A;  4U7B A;  4DSL A;  3GDQ A;  4YDU A;  5C25 A;  2GBZ A;  3VET A;  4M7X A;  2YHX A;  1LAW A;  3IS9 A;  3V9Z A;  1KFS A;  1HYV A;  1BWF O;  3PX4 A;  2DFH A;  3EKU A;  1QS4 A;  3D7E O;  4DV1 K;  1XC9 A;  2D0C A;  4A5B A;  3S3O A;  4IFE A;  5LJV A;  4JHD B;  1LWE A;  1GLC G;  5HRS A;  1K8K B;  3S41 A;  4IZ9 A;  1VSI A;  2ETJ A;  4NCA A;  1U49 A;  4CK2 A;  3JAM O;  3TSU A;  3CME N;  3E9L A;  1X3N A;  3QEP A;  1BGX T;  2IC3 A;  3HYF A;  3M1F A;  1RCH A;  5J2P A;  1BUP A;  1MA9 B;  4N5S A;  3TAF A;  5E26 A;  2X74 A;  3ZSX A;  4FM0 A;  1HKG A;  1S6P A;  2OPP A;  3V1O A;  2PYJ A;  4CJL A;  1BI4 A;  5AQS A;  4AHS A;  3M3Z A;  4KPY A;  4FWO A;  3QNN A;  2JWL A;  1GOA A;  3M8Q A;  1KC8 O;  2ZJP L;  3LWL A;  3FZH A;  3D2F B;  3AO2 A;  3HJF A;  5JVG L;  3CQ8 A;  3QO9 A;  2ZJR L;  3ATU A;  1ZBS A;  4FWP A;  2RF2 A;  3CM6 A;  5GAD P;  2BH1 A;  4BRP A;  3VA0 A;  2HF4 A;  4PKH A;  4CF9 A;  3MEC A;  4W5O A;  3C6T A;  1D9D A;  4EIA A;  4JKH A;  1YJW N;  4PUO A;  4BQZ A;  1LW2 A;  4E7H A;  2GWJ A;  3WNE A;  2VQE K;  5AFU A;  4GMJ B;  3KK2 A;  4PQU A;  1X9J A;  2KZM A;  3RMB A;  4E7L A;  4ISF A;  3R9P A;  1NM1 A;  4FJX A;  2ZGY A;  3CPE A;  5AFU H;  2HHV A;  2JWK A;  4BDP A;  5AZJ B;  3DWL A;  4CJU A;  4M3Z A;  1DGK N;  4DTR A;  3PV8 A;  3TI0 A;  3F2K A;  5LMU K;  1HPM A;  3QEI A;  1HMV A;  4DQ8 A;  3ZET B;  2IGI A;  5M1K A;  4DUY K;  1JL2 A;  1RDD A;  3AVJ A;  3M6G A;  4HWI A;  2FBX A;  4CGG A;  3QIP A;  4BAC A;  1HNZ K;  1KXP A;  4I7F A;  3THY A;  4EP4 A;  3PIP L;  3P4I A;  4HCC A;  4DTO A;  4LFC K;  4GV3 A;  3SQ1 A;  1VQM N;  4RWT A;  4AH9 A;  4DSK A;  3SQ0 A;  4K25 A;  4CGI A;  3U3Y A;  2OCE A;  3SLC A;  5AQZ A;  4Q5V A;  2YKN A;  4FK2 A;  5BRH A;  1ZBF A;  1TAQ A;  3DLB A;  3NGZ A;  3HI0 A;  1JLE A;  2F8S A;  3UKU A;  4N76 A;  1QQC A;  3U8X A;  3HOS A;  1VSM A;  3SJJ A;  1C0M A;  1NK4 A;  1KVB A;  2AP1 A;  2I7N A;  2Q97 A;  2Z1H A;  3MEE A;  3I8B A;  1YJ9 N;  4KHY A;  2BE2 A;  2NRH A;  2DPN A;  3C6A A;  1JCF A;  3WQU A;  1RT4 A;  3WQT A;  1WOQ A;  3FZK A;  3VQA A;  4JS5 A;  4O0J A;  4CEQ A;  4M3R A;  2G8F A;  3MN7 A;  3CQX A;  4YHH K;  1TK5 A;  1KVC A;  3TAN A;  4WYB A;  3T1A A;  5C10 A;  3RTV A;  1X1P A;  4CD3 A;  3TWH A;  3CPW M;  5C42 A;  4H0Y B;  1G99 A;  3BZC A;  3IFR A;  4QS7 A;  5AQU A;  3LP3 A;  4DQQ A;  2GWK A;  4DV7 K;  4DV5 K;  4DR5 K;  4IWV A;  3PX6 A;  1RTI A;  1JCE A;  3NF8 A;  4JKE A;  1CZA N;  3G6E N;  1XQS C;  1QZ5 A;  4DG1 A;  3FFK B;  1HJR A;  4BRG A;  1OH7 A;  1XNQ K;  1FKP A;  2ZE2 A;  3IAY A;  1LWC A;  2UUC K;  3EY1 A;  1D4X A;  3OA9 A;  4UY8 O;  3C7N A;  2P9L A;  3H3O B;  3K5O A;  3H1Q A;  3CCS N;  3A5L C;  4FLU A;  4B9M A;  2NRX A;  4JI0 K;  1QHT A;  3V4I A;  3S3M A;  1VSL A;  4H5R A;  4BE1 A;  1S9E A;  4DV3 K;  2NNW A;  1TKZ A;  2P9P B;  3CJA A;  2VG5 A;  4CJ7 A;  2BGG A;  2A3Z A;  1VQ8 N;  5I9E B;  2E2Q A;  4JEP A;  2ITM A;  4DTP A;  2NRW A;  1CXU A;  4AF1 A;  5M1P A;  1NNE A;  5KGX A;  2F7T A;  1BU6 O;  1WLJ A;  4IJN A;  2UU9 K;  1CZB A;  4DLG A;  4B8A B;  4FWN A;  2ITG A;  2KFZ A;  4JKF A;  3VN5 A;  5JLF A;  4N56 A;  5I42 A;  2NRZ A;  2GV9 A;  3CXC M;  4JK8 A;  1SS6 A;  3LDO A;  3LL3 A;  3NCI A;  3WEE A;  4M3Y A;  2HHS A;  3M8R A;  4IXC A;  5DMR A;  1X3M A;  4GVE A;  3CCQ N;  2J4R A;  3AAR A;  2IAJ A; 
#chains in the Genus database with same CATH homology
 1EXQ A;  4CED A;  3SPY A;  4CJW A;  3G0Z A;  4CJP A;  3NGY A;  1NK5 A;  4DU4 A;  4F8R A;  1EET A;  3TAG A;  3C94 A;  4CEA A;  4XIU A;  4RW6 A;  4CHQ A;  1RBS A;  3OS0 A;  3SQ4 A;  3I0R A;  4EZ6 A;  3HO1 A;  2HHQ A;  4M3X A;  3HST B;  2A1S A;  4CK3 A;  1Q9X A;  3SNN A;  1RDA A;  3OYE A;  4KRF A;  2HHU A;  1J5O A;  4FM1 A;  4OLB A;  4IDK A;  3RR8 A;  5JS2 A;  1S1X A;  3HT3 A;  1T7P A;  4KHN A;  1F21 A;  1NJX A;  3CFO A;  2ATQ A;  2YKM A;  1JL1 A;  1LAV A;  2B5J A;  3HM9 A;  4FLZ A;  1WSF A;  3TAR A;  4Z4G A;  2HB5 A;  1WSJ A;  2AJQ A;  4B9L A;  2QKB A;  4DU1 A;  2WOM A;  1JLB A;  4CF2 A;  1BQM A;  2YNH A;  3AVI A;  3VA3 A;  3TAQ A;  1L3T A;  1L3U A;  3DRS A;  3DMJ A;  3NH2 A;  4FCY A;  3F9K A;  3MXM A;  1HYS A;  4OKE A;  3PUF A;  3L2W A;  3ZT1 A;  4CFB A;  3EYZ A;  5KTQ A;  3DYA A;  4M3W A;  3K58 A;  4B08 A;  1KLM A;  1XI1 A;  3NF7 A;  4ZTJ A;  4PA1 A;  1KFD A;  1L3S A;  1WNS A;  3HVR A;  1S1T A;  2FC0 A;  1X9M A;  2KW4 A;  3PY8 A;  4KFB A;  3AVM A;  5E41 A;  4M41 A;  1U4B A;  3DI6 A;  3VQB A;  2E6L A;  4AIL C;  3V1Q A;  2Z1I A;  2X6S A;  3HPG A;  3HP9 A;  2Q3S A;  3EZ5 A;  4DTJ A;  3VQQ A;  4FYD A;  3ZSR A;  5KRS A;  4AHU A;  4F2R A;  1RT2 A;  1C1A A;  1G15 A;  3QNO A;  2DFF A;  4IBN A;  4FK0 A;  4CEZ A;  1SL2 A;  4F4K A;  5DK5 A;  4DSF A;  3QLH A;  4B9T A;  3VQ7 A;  1SL1 A;  4KB1 A;  4L8R B;  1U45 A;  1LV5 A;  4J2B A;  1SKS A;  4K8X A;  3O3G A;  2Y1I A;  1NK6 A;  4JS4 A;  1C1B A;  4W5T A;  1UA1 A;  5CYQ A;  5KRT A;  3L8B A;  1XHX A;  2R7Y A;  4B9N A;  1RBV A;  4Z4F A;  3V9X A;  1TK8 A;  4E7I A;  4DFM A;  1Z26 A;  3LAK A;  4FZZ A;  1VSK A;  4OGE A;  1RT6 A;  3SPZ A;  2FBV A;  3RMD A;  3P5J A;  4CIG A;  5I3U A;  4OGC A;  3MXJ A;  4EP5 A;  1WAF A;  2QKK A;  3IG1 A;  5J2Q A;  4ZTF A;  1BIU A;  3TAE A;  3K2P A;  4IG3 A;  1NKB A;  4MFB A;  4FJL A;  4B8C A;  4NCB A;  3AO1 A;  3HPO A;  4DTN A;  1J9A A;  2JLE A;  2OPS A;  1EKE A;  1QE1 A;  3K59 A;  2DY4 A;  2EX3 A;  4WE1 A;  4F2S A;  5EU7 A;  1WSE A;  1BIS A;  3LP0 A;  4DQI A;  4KTZ A;  1VSH A;  3NGI A;  4E0D A;  4FJI A;  3AVC A;  1JLF A;  3NE6 A;  1EP4 A;  3OY9 A;  3L3V A;  4HHT A;  3ISN C;  2Y1J A;  5HP1 A;  3V9S A;  3OYF A;  2KTQ A;  3SUO A;  1NK8 A;  2YNF A;  2LSN A;  3L2R A;  4E89 A;  4DF4 A;  1RTJ A;  3B6P A;  4H4O A;  4KV8 A;  1DTT A;  2P1J A;  4DLE A;  4C8O A;  1YTU A;  2QK9 A;  3HK2 A;  3VQ5 A;  1NK9 A;  3V1R A;  4AHC A;  2XY8 A;  4BWJ A;  4FJK A;  3L2Q A;  4CEF A;  3KJV A;  1C0T A;  1JXE A;  3DLH A;  4I2P A;  3NH0 A;  1IH7 A;  1KRP A;  4OVL A;  4H8K A;  1VSJ A;  1A5W A;  3S3N A;  4I9Q A;  4R5P A;  4CJT A;  4CJE A;  2X6N A;  2HND A;  3ZT4 A;  2XHB A;  1C1C A;  3OYN A;  4EZ9 A;  4FJ8 A;  4CGD A;  5CZ1 A;  4KHS A;  3AA2 A;  4B3O A;  1YT3 A;  4RW4 A;  2IOC A;  4M3T A;  3KKR A;  3VQ6 A;  3HVT A;  4LH5 A;  2P5O A;  3MAQ A;  4RW8 A;  1TVR A;  4MQ3 A;  4KI4 A;  1GOB A;  1SKW A;  4DTM A;  4UQG A;  3CG7 A;  1TL1 A;  2B6A A;  4CER A;  1W9H A;  3L2U A;  1EX4 A;  3SZ2 A;  1JXB A;  4CEO A;  1T05 A;  1L5U A;  4NYF A;  3AVB A;  1A5V A;  3ZSO A;  3OS2 A;  2EHG A;  4FK4 A;  1D8Y A;  1RDC A;  5KI6 A;  1S6Q A;  1Z25 A;  4CHP A;  4FVM A;  2XY7 A;  2Z1G A;  1S1W A;  3BGR A;  3KD5 E;  1WN7 A;  4B9S A;  4KB0 A;  3QET A;  1NOY A;  1HRH A;  3PO4 A;  4CEC A;  4IG0 A;  4FJ7 A;  1RIL A;  1ZBL A;  3AVG A;  4ELU A;  3IRX A;  3U6F A;  4KTW A;  2YHA A;  3B6O A;  3O3H A;  4J2D A;  1BHL A;  3LDS A;  4CF0 A;  1VSD A;  3V6D A;  1BCM A;  1O1W A;  3AO3 A;  4G1Q A;  4AHV A;  4CJF A;  3NDK A;  4DF8 A;  2G8W A;  2WON A;  4M42 A;  4JLH A;  4RW9 A;  1J54 A;  1NK0 A;  3P83 D;  1Q8I A;  4FLW A;  4KAZ A;  4DSJ A;  1T03 A;  2DFE A;  4W5Q A;  3VQ8 A;  4RG8 A;  3V81 A;  4RW7 A;  2A1R A;  4BE2 A;  1U48 A;  4CCH A;  3KLH A;  1C6V A;  4O55 A;  5K14 A;  2XY6 A;  2VG7 A;  3P1G A;  1WSI A;  5C24 A;  4DSL A;  3LAN A;  4C8M A;  2ZD1 A;  3K5L A;  1MU2 A;  5C25 A;  2GBZ A;  2OPR A;  3L3U A;  2HHW A;  1LAW A;  3IS9 A;  4Z0U A;  3V9Z A;  1KFS A;  2VWK A;  1HYV A;  4FLX A;  3PX4 A;  3D0P A;  2D0A A;  2DFH A;  1HQU A;  1QS4 A;  4LY7 A;  4CIF A;  4CJK A;  4E7K A;  2XY5 A;  1NK7 A;  3C95 A;  1IKW A;  3L2V A;  4BDZ A;  3QEW A;  1X9S A;  2RKI A;  3AO4 A;  4LH4 A;  5HRP A;  1XC9 A;  2D0C A;  3S3O A;  4I9L A;  1N6Q A;  3MEG A;  4NCG A;  4KTQ A;  3ZT0 A;  2B4J A;  3LWM A;  4YNQ A;  2PY5 A;  1LWE A;  3MXI A;  5HRS A;  4C8N A;  3QEX A;  1RT5 A;  3AVH A;  4KHQ A;  1RBT A;  4FJM A;  4DSI A;  3UIQ A;  3WNH A;  1VSI A;  4CES A;  4CK1 A;  3OJU A;  3KLI A;  2ETJ A;  2G8H A;  3LZJ A;  2G8V A;  1D5A A;  1QSY A;  4NCA A;  4O44 A;  3NAE A;  1ZBU A;  1U49 A;  4FJ5 A;  4CK2 A;  3DOK A;  5FRN A;  3CFP A;  2E4L A;  3CYM A;  4FW1 A;  3NF9 A;  1S1V A;  3QEP A;  3ITH A;  4DS4 A;  1BGX T;  4CE9 A;  2HVH A;  2IC3 A;  3AA5 X;  3HYF A;  4BWM A;  4JRP A;  3S9H A;  3PO5 A;  1RCH A;  4DS5 A;  4M3U A;  4PWD A;  3JYT A;  4OPJ A;  2HW3 A;  5J2P A;  3SCX A;  3OVN A;  3VQE A;  4ID5 A;  1C0U A;  4N5S A;  1W0H A;  1FK9 A;  3SUQ A;  3HL8 A;  4E1N A;  3LZI A;  5SZT A;  1REV A;  3TAF A;  3ZSY A;  4Z4C A;  2X74 A;  3OYI A;  3OYJ A;  1ZYQ A;  1Q9Y A;  1TL3 A;  1UOC A;  3ZSX A;  1NOZ A;  3OYD A;  3ULD A;  2RN2 A;  4FM0 A;  4B9U A;  4CJ4 A;  1DLO A;  1S6P A;  1S1U A;  2OPP A;  3AVF A;  3V1O A;  2PYJ A;  4CJL A;  1BI4 A;  2IDO A;  4AHS A;  5J2M A;  1IKX A;  1YTA A;  3AVK A;  2OZM A;  4KPY A;  3QER A;  3QNN A;  3MED A;  5FRO A;  4NYN A;  1I3A A;  4KO0 A;  3O4Q A;  1GOA A;  4CHN A;  1KCF A;  3M8Q A;  5J1E A;  2YV0 X;  1RT1 A;  5HBM A;  3KIO A;  4N41 A;  1VRT A;  2KQ2 A;  5JS1 A;  3LWL A;  3OYK A;  2P51 A;  1IG9 A;  1FKO A;  2IS3 A;  3SYZ A;  3M8S A;  1WSG A;  3DLG A;  3AO2 A;  5HRR A;  4O0I A;  3HJF A;  3CQ8 A;  3QO9 A;  1KVA A;  1JKH A;  2YNG A;  1XWL A;  3TAM A;  2RF2 A;  3CM6 A;  1T8E A;  1QSS A;  3SV3 A;  3NBP A;  3AVA A;  3VA0 A;  4CF9 A;  1SUQ A;  4CJV A;  1NK4 A;  3MEC A;  4CHZ A;  4W5O A;  3OYA A;  1HYZ A;  3TAB A;  3C6T A;  2F8T A;  1D9D A;  1RT7 A;  2Z1J A;  2OPQ A;  4PUO A;  1U04 A;  3D45 A;  1LW2 A;  1BCO A;  3M8P A;  4E7H A;  1BIZ A;  3WNE A;  5J2N A;  4FJH A;  1Y97 A;  3KK2 A;  4GMJ B;  4PQU A;  2KZM A;  1ZBH A;  3RMB A;  4IFY A;  4C8K A;  2OA8 A;  4E7L A;  1ZBI A;  3ZSV A;  4J2A A;  4FJX A;  4CEE A;  1RDB A;  4CIE A;  3OYL A;  1N5Y A;  3KD1 E;  2GUI A;  1DTQ A;  4DQS A;  4DQP A;  2HHV A;  5SWM A;  3SI6 A;  2PYL A;  2HHT A;  2D5R A;  4BDP A;  3CM5 A;  4KRE A;  4CJU A;  4M3Z A;  1UAX A;  4DTR A;  1JLG A;  1CXQ A;  4OJR A;  3PV8 A;  2HNZ A;  3TI0 A;  1NJZ A;  4FM2 A;  4CHY A;  3QEI A;  2OZS A;  1HMV A;  3DLE A;  2IGI A;  1ASW A;  3QIN A;  3LP2 A;  1D9F A;  3PX0 A;  1JL2 A;  1RDD A;  3AVJ A;  4H4M A;  4CGG A;  1RBR A;  2FBX A;  3QIP A;  4DMN A;  3HPH A;  4E19 A;  4BAC A;  4DQR A;  4IKF A;  3A2F A;  3ZT3 A;  4I7F A;  4QAG A;  1JLA A;  3TR8 A;  4IFV A;  4DSE A;  3VQ4 A;  4LSL A;  1JLC A;  2W42 A;  3QES A;  2XRI A;  4DWI A;  2X78 A;  1HNV A;  1CZ9 A;  4EP4 A;  3KLF A;  4ID1 A;  4HCC A;  2O4I A;  3C6U A;  4DTO A;  4FZX C;  3K5N A;  3SQ1 A;  1RT3 A;  4BDY A;  1K6Y A;  1QSL A;  1RTD A;  2HHX A;  4HVJ A;  4AH9 A;  4CEB A;  3I8D A;  4DSK A;  3I0S A;  4YFU A;  3SQ0 A;  1YVU A;  4FXD A;  4CGI A;  3U3Y A;  4CJ3 A;  3OYC A;  4E3S A;  3V9U A;  1NKE A;  2G8K A;  1WAJ A;  4Q5V A;  4AHT A;  1R0A A;  1J53 A;  4M45 A;  2YKN A;  4AHR A;  3K57 A;  4FK2 A;  1IKV A;  1ZBF A;  4CHO A;  1TAQ A;  2HMI A;  3VQP A;  1BI4 B;  3DLB A;  3NGZ A;  1TKX A;  3LP1 A;  2BAN A;  1JLE A;  4TSX A;  3RWU A;  2KZZ A;  3AO5 A;  2F8S A;  3SUN A;  4K8Z A;  1QQC A;  4N76 A;  1VSM A;  4E1M A;  1UWB A;  1C0M A;  3DM2 A;  3FFI A;  1KVB A;  5KGW A;  5T7B A;  4FLY A;  4FLT A;  3SJJ A;  2Z1H A;  4FJJ A;  3MEE A;  3AV9 A;  4FJG A;  1TAU A;  3DLR A;  3RMC A;  4DFK A;  4CGH A;  2BE2 A;  3RMA A;  4KHY A;  3THV A;  3E01 A;  3AA3 A;  3OYM A;  1U47 A;  3AVN A;  2HNY A;  1RT4 A;  3T19 A;  3LPT A;  4N47 A;  2G8I A;  1B9D A;  3VQA A;  2VG6 A;  2O4G A;  4JS5 A;  1X9W A;  4CF8 A;  4KHU A;  1TGO A;  4O0J A;  4CEQ A;  4M3R A;  1TKD A;  5FDL A;  2G8F A;  4FLV A;  4BE0 A;  5HRO A;  1TK5 A;  4CJ5 A;  3F73 A;  1KVC A;  2NUB A;  3ZSW A;  4DTU A;  3TAN A;  1I39 A;  3V9W A;  4ELT A;  3T1A A;  1JLQ A;  3O4N A;  1NJW A;  1VK0 A;  4QOZ B;  3RTV A;  1X1P A;  4KKO A;  3TWH A;  4QCL A;  1HPZ A;  4Y1D A;  5C42 A;  1S9G A;  2D0B A;  1NKC A;  4CF1 A;  4KHW A;  1KSP A;  4JRQ A;  3OYG A;  3LP3 A;  3VQC A;  4HTU A;  2HVI A;  5HRN A;  1HQE A;  4DQQ A;  3NH1 A;  2VWJ A;  3WNG A;  4CFC A;  1RNH A;  1HNI A;  4Z4H A;  4Q0B A;  3DRP A;  3KKS A;  3PX6 A;  1SV5 A;  3U3G A;  1RTI A;  3NF8 A;  3T3F A;  1TKT A;  3SQ2 A;  4O4G A;  1WSH A;  1SKR A;  1RBU A;  3LPU A;  4C8L A;  3ALY A;  4DG1 A;  4F3T A;  1HJR A;  3KK3 A;  3HP6 A;  1VSE A;  3ZSQ A;  3NFA A;  1NJY A;  5CZ2 A;  1FKP A;  2ZE2 A;  2YHB A;  4E7J A;  1ASU A;  3IAY A;  1LWC A;  4CFD A;  2I5J A;  1TV6 A;  4GVM A;  3VQD A;  3EY1 A;  4PY5 A;  4HUG A;  3ZCM A;  2E6M A;  1GOC A;  2YNI A;  4OLA A;  3AVL A;  3HXM A;  1ITG A;  3SV4 A;  2ZQB A;  3VQ9 A;  5CY4 A;  1IKY A;  1VSF A;  4ICL A;  4O5B A;  1BQN A;  1ASV A;  4FW2 A;  4DFJ A;  5D3G A;  1TK0 A;  1SL0 A;  3RR7 A;  3ZSZ A;  3OS1 A;  4DTS A;  1QTM A;  1B92 A;  1LW0 A;  3K5O A;  4FJN A;  4I2Q A;  3QIO A;  4CFA A;  3CFR A;  4CJS A;  4CJR A;  3QEV A;  4FJ9 A;  4FLU A;  4B9M A;  4Z4I A;  2DTU A;  4J2E A;  1RTH A;  3G10 A;  3WNF A;  1QHT A;  3AA4 A;  3V4I A;  4DFP A;  3S3M A;  1VSL A;  4LD0 A;  4ELV A;  4BE1 A;  4Y1C A;  1S9E A;  3RRG A;  3ASM A;  3RRH A;  1B9F A;  4CGF A;  5FRM A;  2FBY A;  1TKZ A;  3JSM A;  4OKJ A;  4OPK A;  3KTQ A;  4CJQ A;  4Z4E A;  2G8U A;  2VG5 A;  3DOL A;  3O3F A;  3ZT2 A;  1IO2 A;  2BGG A;  1S5J A;  1LWF A;  1UA0 A;  3KK1 A;  4OKK A;  1KTQ A;  4B9V A;  3OJS A;  2OYQ A;  4FZY A;  3K5M A;  3TAP A;  2F96 A;  4DTP A;  1FXX A;  1CXU A;  3DRR A;  5KGX A;  4DU3 A;  4HUE A;  1WLJ A;  2QXF A;  4LSN A;  3SUP A;  4KI6 A;  4W5N A;  1CZB A;  4W5R A;  4DLG A;  4B8A B;  2BDP A;  3OYB A;  4GW6 A;  2ITG A;  3OYH A;  2XO7 A;  4HCB A;  2KFZ A;  4HUF A;  3VN5 A;  3BDP A;  5CYM A;  4N56 A;  1BL3 A;  5I42 A;  3NF6 A;  2GV9 A;  4CGJ A;  2RPI A;  3KLE A;  3LAM A;  5HLF A;  2P5G A;  4F3O A;  1VRU A;  3KLG A;  2FBT A;  2JGU A;  3LAL A;  2PZS A;  1A5X A;  4ZHR A;  1L3V A;  1KLN A;  3NCI A;  2KFN A;  4M3Y A;  3NHG A;  2HHS A;  3DLK A;  1XHZ A;  3H08 A;  1CLQ A;  3M8R A;  5DMR A;  4DTX A;  2IAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...