3CETA

Crystal structure of the pantheonate kinase-like protein q6m145 at the resolution 1.8 a. northeast structural genomics consortium target mrr63
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
300
Chain Sequence
MILGIDIGNTKITELHENGEFKVHHLVSHVALVTTAETKKEGVDNILNAAESAFGSNISVFDSNGNFISLESAKTNNMKVSASNWCGTAKWVSKNIEENCILVDMGSTTTDIIPIVEGKVVAEKTDLERLMNHELLYVGTLRTPISHLGNTISFKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVAEKYGSKKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSFAVAELLKNELLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved archaeal protein
publication title Crystal structure of the pantheonate kinase-like protein Q6M145 at the resolution 1.8 A. Northeast Structural Genomics Consortium target MrR63.
rcsb
source organism Methanococcus maripaludis s2
molecule tags Structural genomics, unknown function
total genus 97
structure length 300
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01968 Hydantoinase_A Hydantoinase/oxoprolinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cetA01
3.30.420.190 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 conserved archaeal protein q6m145 3cetA02
1QZ5A 3WQUA 4QS8A 4J8FA 2P9SB 5EOYA 3ULEB 4MO4A 3BP8A 3CJ1A 4BROA 4BR7A 4FSVA 2GELA 5ADXA 4PKHA 1GLCG 4A2BA 3ZEUA 4BR5A 3ID8A 3UB5A 2VYPA 4BRGA 3RSEA 2Q31A 2GUPA 4BRNA 4E1JA 1NMDA 5KPRA 3H3NO 5AQYA 4CZKA 3EN9A 4Z94A 2YJFA 1YUWA 3D7EO 1J6ZA 3DAWA 4WQ5A 2UYTA 3QMLA 2P9UA 1QHAA 1T6CA 2PBDA 4BREA 3MN5A 4BC3A 1CZAN 3HTVA 4XH4A 2V52B 1KAZA 5AQTA 4CZMA 2QWNA 3A0IX 2A40A 2QWPA 1BA0A 5LJVA 4BRLA 4JHDA 1DGKN 1LCUA 2IVPA 1S3XA 4BG8A 1MWMA 3LM9A 2E2QA 1V4SA 2FLOA 1YXQA 4BRHA 2GWJA 1D4XA 4BQLA 1NGBA 3ZX0A 4H5VA 3CJCA 3UKUA 2HMPA 5AQVA 1NGDA 2QW9A 3S41A 3DWLA 3FZHA 2Q36A 5CE3A 3H46O 2V51B 3GBTA 4WQ4C 3U9ZA 4BRFA 1HX1A 2J4RA 5AQXA 3GE1A 3ZETB 2A5XA 3BEXA 1ZC6A 3C0BA 3R8EA 3CQXA 2FXUA 2F9WA 4H03B 2P9NA 2HF3A 3FR0A 3FZMA 4BQZA 3QBWA 3ENHA 2DPNA 4FOIA 1DKGD 3BF3A 3FZFA 3LDNA 2IVNA 4I6MA 2E2OA 2FF3B 1QQMA 2ZGZA 4YDUA 2H3GX 5AQSA 3R9PA 2AP1A 2YHYA 3I8BA 2F9TA 4JD2B 3SMSA 4B1WB 3QICA 5BRFA 2QXLA 3ATUA 3VENA 1H1VA 3CI5A 3M3ZA 5AZJB 3R6MA 2P9PA 3WEEB 4IZ9A 2Q1NA 2YHXA 2E2NA 1OKJA 1Q18A 3BUZB 4KBOA 5AQRA 1LOTB 4H5RA 4BRKA 4NB4A 3QBXA 2P9LA 3DXKA 3HI0A 4FWLA 3VF6A 4EAHD 2CGKA 1X3MA 5F2RA 2D0OA 3L0QA 3I33A 1IG8A 4CD3A 1ZXOA 1G99A 1HKBA 5BN9A 4BRIA 3AAPA 1SAZA 1BG3A 5F0XA 3H1VX 2P9KB 4K43A 2E2PA 4BGBA 3D2FA 4QS7A 4BRMA 2KHOA 1EQYA 2GWKA 5BPLA 3U8XA 5KPTA 1NLVA 5BPMA 3HBTA 2GTDA 3CJ7A 1MDUB 2V7YA 3O8MA 3VEYA 5JMVA 4GY2B 1TYQB 5EY4A 4BVPA 4BRCA 4EFHA 3SK3A 3H6EA 3LDQA 1JCGA 4RCHA 4NO7A 2QWMA 1GLEG 5AZIA 3P4IA 5BN8A 3TU5A 5BRHA 4FWSA 3LM2A 3J8AA 1MWKA 4BR9A 1QQOA 1NM1A 1X3NA 4WQ5C 2P9IA 2ASOA 1XC3A 4IXCA 4FPBA 4BR4A 3IMXA 3ZEUB 4H0VB 1ZBSA 3RSEB 3GL1A 4BC5A 4BRPA 5ADXH 2HF4A 1WUAA 2E1YA 3FFKB 1Y64A 3WXLA 3VETA 4LC9B 4BRDA 4A2AA 3ZX2A 3FGUA 3FZKA 1X9JA 4CBUA 4JN4A 2V7ZA 3AARA 3IFRA 4F9OA 4GNIA 5AQNA 1HJOA 2D0PA 1K8KA 3VESA 1MA9B 4K42A 2P9UB 3IDHA 3O4WA 3A5MC 4BVOA 1RGIA 3ZX3A 4M63C 4CZLA 4XH1A 2Q2RA 3ZETA 4H0XB 4A62A 1U2VA 3D2EA 5AQWA 4CBWA 4PKGA 1T6DA 2YJEA 5FPNA 4MLHA 3W0LA 3VEOA 3UKRA 3EZWA 1DEJA 3VEVA 3A8YA 4CZHA 3KHYA 3L6QA 2YCHA 2QM1A 5FPDA 3W3DA 3DXMA 4CD1A 3CJBA 5F1XA 1NGAA 4FWPA 5AQGA 3A5NC 4BGAA 4PKIA 2VCPA 4DHYA 1BO5O 3JXUA 5EXWA 4M7XA 3JS6A 5B8HA 3O1WA 3UKUB 3U4LA 4ISFA 3WXIA 2A6AA 1QQNA 1E4FT 1XUPO 3LL3A 5EX5A 3MN9A 4B1YB 4K25A 2ASMA 4MO5A 2YI1A 4YDUC 1KXPA 1NWKA 3LDOA 3CQYA 2NLXA 4FWKA 1S22A 1C0FA 4M7YA 3WQTA 2P9NB 3GG4A 2I7PA 5AQFA 2NZTA 5JLHA 4O5FA 4PL7A 4L3QA 1Z6RA 4I6MB 4H0TB 2NRHA 5I9EB 4H0OA 2BUPA 4XEIA 1QZ6A 3C7NA 1BU6O 1NBWA 2QWQA 3LDPA 4CZGA 2A42A 3H45C 4ISEA 5AQLA 4HTLA 4FPAA 3CJ9A 5KPZA 1NGHA 2P9KA 2P9SA 1GLFO 2D1KA 4FL9A 5LY3A 3ULEA 1HKCA 1GLAG 5AR0A 1KAXA 1NGIA 5AQUA 3VEZA 2P9PB 4BRAA 3EL2A 2FF6A 3ATVA 4JAXA 3VPZA 2FSJA 3GDQA 5AQPA 1HKGA 5ELZA 1BWFO 3O5BA 4HWIA 3WXKA 3VERA 4B1UB 4Y0WA 4RTFD 4CI6A 4CZFA 3HZ6A 2P9LB 3DXKB 1SZ2A 2Q0UA 4O8KA 1ATNA 5FPMA 3VGLA 3WUHA 3VEXA 1TYQA 3CETA 1RDWX 4FOEA 4C23A 4EHUA 3SJHA 5E84A 3CERA 5AQQA 4B1ZA 3DJCA 4BG9A 3LDLA 4H5WA 1ATRA 4FWOA 1NGJA 4K41A 4BR2A 4DCHA 1HLUA 3KZBA 1ATSA 2CH5A 2FSKA 3CIPA 3D2FB 2QWRA 3U9DA 4H0PA 4EIAA 4ISGA 2YHWA 2GEMA 1NGCA 3SMPA 4CZJA 5E26A 1Z05A 1P8ZA 1E4GT 1XQSC 2EWSA 2OANA 3QFPA 3H1QA 4QS9A 4B9QA 4FWQA 3OHRA 3AY9A 3L4IA 4AM7A 3A5OC 3FLCO 4CZIA 4CJ7A 2Q0RA 3B8AX 4IO8A 3VEWA 4MLEA 5AZIB 1TUYA 3MK6A 2A41A 2IVOA 2Q97A 2FSNA 4B1VA 3FZLA 4WYBA 5EVZA 3MN7A 5JICA 3MDQA 5BRDA 3GOIA 1BUPA 2QWOA 1JCEA 1YAGA 3F9MA 3HSCA 4FWNA 1GLLO 2P9IB 1R59O 5BREA 3M6GA 2QWLA 2VWBA 5AQOA 3MCPA 2IIRA 3EKUA 1GLDG 2A3ZA 4JHDB 1BA1A 4DB3A 4BR0A 5JLFA 4BRQA 3VGMA 3MN6A 3KVGA 5AFUA 5AQJA 4WQ4A 4H5TA 5AQKA 2W40A 1HPMA 1K8KB 2D4WA 5BPNA 1RFQA 3HM8A 1U6ZA 3VF4A 3IUCA 1TUUA 4FWMA 4EHTA 3VOVA 4BC4A 4IWVA 3VF2A 4CZEA 1NGEA 4BC2A 3BF1A 2W41A 4JD2A 4JNEA 4FWRA 5AQIA 5AZJA 3O08A 1U2VB 5TKYA 2ZGYA 3VGKA 3D2EB 4H5NA 3WEEA 4IJNA 3QFUA 2PAVA 3H3OB 3WXJA 4FO0A 1GLBG 4DQ8A 3UKRB 2AA4A 5AQZA 3UE5A 3TPQA 2CH6A 3SLCA 2HOEA 4AM6A 4CBXA 5FPEA 3DXMB 3G25A 3CJAA 5AQHA 3ENOA 1KAYA 2BTFA 5AFUH 2WUSA 2E88A 1NGGA 3AAQA 4PL8A 3QDKA 4XH5A 1T44A 1V4TA 2ITMA 4H0YB 4RWTA 1ESVA 3EO3A 1BOTO 3FE1A 1IJJA 2E1ZA 1NGFA 3M1FA 2E20A 1GLJO 1WOQA 1C0GA 1SQKA 3O6WA 1BDGA 3WT0A 2ZF5O 1YVNA 5LJWA 3QB0A 4A61A 5KQ8A 3O80A 1HUXA 5AQMA 2CGLA 2CGJA 3MMVA 3CHWA 2I7NA 4B1XB 3A5LC 1JCFA 5KQDA 3O1BA 3EKSA 4IJAA 2ZWHA 3C7NB 2ASPA 5BR9A 2E8AA
chains in the Genus database with same CATH superfamily
3PO5A 4QS8A 1I94K 1KFDA 3NMUA 5TKWA 1XWLA 3PLAA 1LAWA 4MO4A 3RMBA 1NU0A 3CJ1A 3V1QA 4BR7A 2GELA 3KIOA 3O9RA 5ADXA 1GLCG 4Q5VA 1YJWN 1HNZK 1EO1A 3ID8A 2VYPA 4E1JA 4BRNA 1NMDA 3EN9A 1YUWA 4QCLA 1J6ZA 4DWIA 2VG6A 4E0DA 3QMLA 4LSNA 1JXEA 4FM1A 1RT7A 3M5RA 1OH5A 1NKEA 4IOCL 4BREA 1CZAN 3RMDA 2V52B 1ZBLA 5A2QO 2QWPA 3DOLA 4KTZA 3SCXA 3HRGA 3L2RA 3SQ0A 4DUYK 1RTIA 4CF2A 1WAJA 1C0MA 2E2QA 4CIGA 1YXQA 3SBGA 1D4XA 1NGBA 1NK9A 3NFAA 1Q7YO 1HQUA 4GV9A 2HMPA 5AQVA 4B9SA 4WCEL 3C95A 3FZHA 3ENBA 5CE3A 3KK3A 3H46O 2V51B 4WQ4C 3U9ZA 4DV3K 3O4NA 1N6QA 3AVFA 4K8XA 4KKOA 3BEXA 1WSJA 5I3UA 4H03B 3QBWA 2DPNA 3ENHA 4FOIA 1IBLK 3EYZA 3KWIA 2IVNA 4FJXA 2D0BA 5HRPA 2KTQA 1VQLN 4YDUA 4DFPA 1NJZA 1U48A 3I8BA 4W5OA 1K8AO 4DS5A 2F9TA 3KD1E 4JD2B 3CQ8A 3DLEA 2A1RA 2QXLA 1H1VA 1KRPA 3O9QA 2A1SA 4I7FA 2E2NA 2ETJA 4DTRA 3E9OA 4OX9K 1LOTB 4NCBA 3A2FA 2QEXN 2KZMA 2W6KA 3HI0A 1XHZA 3Q7BA 4BE0A 1QQCA 4N5SA 4DR7K 2D0OA 3L0QA 3TTDA 3P31A 4IG0A 4CD3A 3NGYA 4CEZA 4L8RB 5BN9A 4K8ZA 4BRIA 1SAZA 3CC4N 1BG3A 4K43A 1CZ9A 3HYFA 4DR4K 1RBRA 2E2PA 4BGBA 4FM0A 3QNNA 1RBSA 2PY5A 3O9UA 3ZSYA 1UA1A 4KHUA 3V9ZA 2LSNA 1EQYA 2GWKA 3OYKA 2HNZA 3AVKA 5BPMA 2GTDA 1REVA 1HPZA 1CXUA 1ZBFA 4BRCA 3C6UA 1L3VA 3SK3A 2HNYA 3LDQA 4YORA 1KCFA 5J2NA 2QWMA 2UUBK 4E1NA 1VQPN 1UA0A 1VQ9N 2E6LA 5LL6Z 1HNXK 3T19A 5BRHA 1L3TA 1MWKA 1TL3A 1YVUA 5J2QA 4NXMK 5CZ2A 4KH4A 3KWGA 1QQOA 4C1NK 3PO4A 4WQ5C 2ASOA 2DFEA 1BQNA 4FJ9A 4FPBA 4BR4A 5HOOA 4NLCA 1SL2A 3E1YA 4BC5A 5HP1A 3KD5E 4FLZA 1BCMA 1Y64A 4A2AA 3BY5A 4I2PA 3ZX2A 2FBVA 3CC7N 3FZKA 2IDOA 2D0PA 4CGFA 1RT1A 3SV3A 3VESA 4GVMA 4A5BA 1J53A 1SL1A 3A5MC 3N4PA 4M63C 1SL0A 3QNOA 2Q2RA 3ZETA 3LP2A 2PYLA 4A62A 4JS5A 1U2VA 4O0JA 3CCRN 4CBWA 2FBXA 3SI6A 5SZTA 2Q3SA 3B6PA 5FPNA 1W9HA 3DYAA 1DEJA 4FCYA 4GKKK 2YCHA 4FJIA 3DXMA 3CJBA 4FWPA 4PKIA 1TK8A 3NF7A 3ZT1A 3EEQA 3O1WA 1VQ7N 4KHSA 1VSEA 4R5PA 4ISFA 3E66A 3WXIA 1KTQA 3KLEA 4B9TA 3CM6A 1WSFA 4CERA 4H8KA 1J5EK 2NRXA 4MO5A 1NWKA 3LDOA 3CQYA 4AHUA 5C25A 4CJTA 4FWKA 3SAHA 2G8WA 4M7YA 1Q86O 1EP4A 3AO1A 4L3QA 4AH9A 2NRHA 5DM6L 2BUPA 1QZ6A 3C7NA 1NBWA 1YITN 4GVEA 4DLEA 2DFFA 5KPZA 1ASWA 3OS0A 2KZZA 2YNFA 3SUOA 4YOYA 4KB1A 4TSXA 5M1FA 4E7KA 4Q0BA 3I0RA 5C10A 1C0UA 1NGIA 2WONA 2O8DA 2JWLA 4BRAA 4ILHA 2FSJA 3RRGA 2NRZA 5ELZA 1BWFO 3AO2A 4DFKA 2FC0A 3VERA 4Y0WA 4N47A 4AHRA 4CI6A 1VSJA 4A57A 1SZ2A 4ELVA 3CETA 1WBDA 1RDWX 4EHUA 1BIUA 3EE9A 1NOYA 4FLVA 4FWOA 4K41A 4DV0K 1VHXA 3DM2A 3HPHA 3T1YK 1HLUA 3SZ2A 4HUEA 3AO4A 4U67L 2XHBA 4IFVA 2OZSA 1YJ9N 3DRSA 3U9DA 3G10A 4EIAA 4ISGA 5GAHP 3TAEA 3SJJA 4Z4EA 3ID6A 3TSQA 3VQ9A 1NK5A 3NH2A 1P8ZA 2EWSA 2OANA 2Z1IA 2HB5A 1MU2A 1VAZA 3OJUA 4CGHA 3CPWM 1KSPA 3L4IA 4RW4A 1ITGA 3NBPA 4CZIA 1NK7A 1L5UA 4JRQA 1IH7A 4ILJA 3VEWA 4MLEA 1TUYA 2HBMA 1A5VA 1Q82O 4DR3K 3VQCA 1RT4A 4RG8A 1JLFA 3V4IA 4DR6K 1LWEA 3UIQA 1JCEA 3KJVA 4ICLA 4DFMA 1YJNN 2QWLA 4KTWA 5HL7L 3CCJN 1HQEA 4M3UA 4BY9C 2ZJQL 3N4QA 4BR0A 4JYAK 2GV9A 4ELTA 2ATQA 2D4WA 4C8LA 3PX6A 3HSTB 4CECA 3IUCA 4JKHA 4FXDA 3OA9A 5JS2A 1ZBIA 3VOVA 2HBJA 2WC9A 3VF2A 2UXDK 4PQUA 4CZEA 1S72N 4BC2A 3ZT0A 4JNEA 4GV3A 4FJ7A 4WFBL 2F96A 3AA4A 5AZJA 4OPJA 3O08A 1U2VB 4DR1K 1VRTA 3H3OB 5MLCQ 3WXJA 1GLBG 4JI5K 4HCBA 5J2MA 2AA4A 4FYDA 4Z4FA 4AM6A 4CK2A 1F21A 3DXMB 4CHYA 1S9EA 2BTFA 5AFUH 1HYZA 3NF8A 4CF9A 5HRSA 3QDKA 3OW2M 1HRHA 1T44A 3EZ5A 2ZE2A 1ESVA 3EO3A 4RW9A 1GOCA 3WNGA 4KHWA 2ZJPL 3ZT2A 2O4IA 1C0GA 1SQKA 2G8KA 5IT9O 2X6NA 3WT0A 4CHNA 4O4GA 3QB0A 1JKHA 4A61A 5KQ8A 3WXMB 3OYNA 4DV1K 2I7NA 3A5LC 3RMCA 3SAFA 4UY8O 5KQDA 2O8BA 3T69A 3EKSA 3CCUN 1FW6A 2ZWHA 2B4JA 3C7NB 4E7IA 3O9SA 3I56N 3WQUA 3Q7CA 3NVKA 4MFBA 4J8FA 1Q9XA 3TR8A 1VSDA 2PYJA 4E7JA 1UWBA 2O8DB 3P1GA 4CK1A 4BROA 4JI3K 3D0PA 2XO7A 1B92A 5CYMA 1NNEA 3UB5A 4FVMA 3RSEA 2GUPA 4PHTX 1QHTA 3NF6A 4FW2A 4OJRA 4CZKA 4Z94A 1NKCA 1K9MO 1QSYA 2JLEA 2YJFA 1NJXA 3D7EO 2G8IA 4FJ5A 1C1AA 4BDPA 1TV6A 3OYMA 1QTMA 3AGKA 3KLHA 5M1PA 3P38A 2OTLN 1KAZA 2B6AA 5AQTA 3F5TA 1BQMA 2QWNA 3A0IX 2HVIA 1IKVA 4CF8A 3TAQA 3WNHA 2G8FA 2O8EA 5KTQA 4JHDA 4CJFA 1Y97A 3O4QA 4DU3A 4KTQA 2UU9K 2JGUA 4CK3A 3PX0A 3K5LA 2HVHA 1I39A 4DQPA 4H5VA 1D9DA 3UKUA 1NGDA 1YIJN 3S41A 3DWLA 5DM7L 3OYAA 2Q36A 4CFBA 4JI7K 3I8DA 3RVCA 3MX2A 1ZC6A 3V9SA 2B5JA 4OVLA 3C6HA 1UAXA 2F9WA 2P9NA 3L2UA 3FZMA 4BQZA 1XNQK 3QEXA 3BF3A 4DTNA 4LF9K 3LDNA 3KK1A 2YKNA 4I6MA 1RTDA 3CD6N 1VQ6N 4CVNE 2FF3B 1WN7A 2D0CA 4JKBA 4YY3K 4B9VA 2AP1A 5C2FA 3ZLJA 3SQ2A 1LWCA 2KFZA 3LALA 3ATUA 5AZJB 5C15A 5GIOA 2P9PA 4JK7A 5JVHL 4CEBA 1GOAA 2Q1NA 4QOZB 3O9TA 5AQRA 4H5RA 3J7AP 3VF6A 5GAEP 1T05A 4B3TK 1X3MA 4E7LA 1X1PA 4WFNL 3L3VA 3I33A 3F2KA 4O5BA 4Z4GA 1C6VA 3DMJA 3VQ5A 3QEIA 2P9KB 3V81A 4YOXA 3LZIA 4BRMA 2BDPA 2F7TA 3ALYA 4FJ8A 2O8FA 1XI1A 2FBYA 2V7YA 4GY2B 2O8BB 2NRTA 1DTQA 3HOSA 4LF7K 3HM9A 1JCGA 4JK8A 1D5AA 3P4IA 5CZ1A 5SWMA 4NCGA 2OPSA 4I9LA 4DSJA 1NM1A 2WBNA 4IXCA 3AV9A 4CGDA 1ILYA 2BE2A 3K0SA 1ZBSA 2HNDA 3SQ1A 4JKAA 3ZT4A 3RSEB 4BRPA 4KV8A 3CCSN 2HF4A 1WUAA 3FGUA 4CBUA 4JN4A 2V7ZA 3AARA 5CYQA 1FKPA 1IKYA 5AQNA 4F9OA 4CE9A 3VMFB 1K8KA 2VGNA 4K42A 1N32K 3O4WA 5KI6A 4GKJK 1RGIA 3ZX3A 4CZLA 4XH1A 4XIUA 1RDCA 3BDPA 3BZCA 4CJKA 2P5OA 4KREA 3AO5A 3D2EA 5AQWA 1IBMK 2W6LA 2KLAA 4MLHA 1ZBHA 4BDZA 5GIPA 3T3FA 1T7PA 2RN2A 3VTIA 4IEIA 4BE1A 4N76A 3KLFA 5AQGA 4O55A 3LP3A 1BO5O 3DLLL 4FLWA 2D5RA 3NVMA 5B8HA 1SKRA 3UKUB 3CMAN 3U4LA 3CPEA 1QQNA 1HNIA 4M3XA 1XUPO 3LL3A 2X78A 1T03A 2YI1A 2YNIA 3TWHA 3LDSA 1S6PA 3WQTA 4FLUA 2P9NB 3J7ZO 4FZXC 3V6DA 4M3RA 3CC2N 3QINA 2NZTA 4B9UA 4O44A 4PL7A 4E1MA 4I6MB 2HMIA 4H0TB 3NH0A 1VSLA 2QI2A 1BU6O 2QWQA 2JWKA 4X65K 3ULDA 1NGHA 2VWKA 3PX4A 1OVQA 2P9SA 1W2BM 2D1KA 1I3AA 3KK7A 3ULEA 1HKCA 4DLGA 4KB0A 4I9QA 1GLAG 3AVAA 2P9PB 3G6EN 3EL2A 3ATVA 3VN5A 5C2DA 3GDQA 5AQPA 4CJ3A 1EETA 1NK8A 3DRPA 3F73A 4B1UB 3CG7A 4EZ6A 4RTFD 3DLBA 4ELUA 2Q0UA 4JI2K 3VGLA 3AGRA 3K2PA 4O8KA 3WUHA 1TYQA 3R3LA 4PUOA 3T7ZA 5J2PA 4HUFA 3BZKA 1TKDA 3VQAA 2Y1IA 5E84A 5AQQA 1KQSM 4BG9A 3L2VA 4MDAA 1EXQA 4ZTJA 4H5WA 1ATRA 3OYJA 2P5GA 5KGWA 3MEDA 4JEPA 3VQ8A 3QLHA 3CMEN 4JI6K 4DCHA 3R1XA 3KZBA 3SYZA 1ATSA 3ZYYX 1JLBA 2CH5A 2FSKA 3K58A 1EWQA 1UOCA 1TKTA 1VQMN 2O8FB 4CJ5A 3OY9A 4CZJA 1XQSC 1JLQA 3DLRA 5M1OA 3T1AA 4B9QA 4BE2A 1TK0A 4Z4IA 4AM7A 3BGRA 4MDBA 4IEEA 4GW6A 4IFYA 4CF0A 4IO8A 1HNWK 4DSKA 3M8PA 4CEQA 3G4SN 4FZYA 2FSNA 3FZLA 4WYBA 5EVZA 3MN7A 3HK2A 3AVHA 2QWOA 1TVRA 2HHQA 1GLLO 5BREA 4Y1DA 3MCPA 3NGIA 1RDUA 2A3ZA 3SV4A 4DB3A 1N36K 4BRQA 4CEAA 3MN6A 2BH1A 1VQKN 4WQ4A 5AQKA 3TAGA 1K8KB 4B8CA 5BPNA 4DQSA 3V1RA 3HL8A 5H1SQ 4A5AA 4FWMA 4IWVA 5E41A 4HTUA 4LH4A 3MX5A 3BF1A 3M8SA 3DLHA 5AQIA 4MQ3A 4CEFA 4DQQA 3D2EB 3LPUA 3WEEA 4K0KK 1BI4A 4IJNA 2YKMA 4DSFA 4M3ZA 1OH7A 5KRTA 1XMQK 2KKZA 4CJQA 3TPQA 3QEVA 5FPEA 1VK0A 3G25A 5AQHA 4M3YA 3THVA 1NGGA 4F2SA 4F3OA 3AAQA 4XH5A 4J2BA 3K9JA 2D0AA 1BOTO 3OYIA 2E1ZA 4CW7B 1NGFA 2E20A 2G8UA 2BGGA 1GLJO 3C94A 2IGIA 1YVNA 3QO9A 4FJKA 1BHLA 3IKMA 1HUXA 3CYMA 5AQMA 2CGJA 3JAMO 3MMVA 2G8HA 4F8RA 4FZZA 3MWTA 4B1XB 1JCFA 3VQPA 3O1BA 4J2EA 4IJAA 2YNGA 4KAZA 2E8AA 1QZ5A 1HR0K 4JK9A 4F3TA 4WF9L 4LFCK 3RMAA 2P9SB 5EOYA 4U7BA 3TTCA 3ULEB 4AQYK 3L8BA 2WTUA 1N5YA 3JYTA 1ZYQA 1VQ8N 3BP8A 5LMNK 2F8SA 1VQNN 4A2BA 2VGMA 2XY8A 2OYQA 4BRGA 4B3RK 5AQYA 3ZSZA 2FBTA 2UUCK 3OYHA 2X6SA 3DAWA 3U3GA 4OKEA 4WQ5A 1QHAA 3V9WA 4GMJB 2PBDA 5T7BA 3HTVA 4XH4A 5D3GA 4CEDA 4CZMA 3S3OA 3KKSA 2A40A 2QTDA 4UQGA 4BRLA 2WOMA 1DGKN 2IVPA 1X9SA 4BG8A 1MWMA 4WE1A 2ZM6K 4FVUA 1RDBA 2OZMA 1K6YA 4BQLA 2VWJA 3TABA 3SPZA 2HHUA 2QW9A 2I5JA 3QIOA 3OJSA 3NH1A 2PFUA 2E4LA 4ILGB 4OKKA 3OYFA 5AQXA 1U4BA 3GE1A 3ISNC 3ZETB 1KVAA 1EWRA 2A5XA 2IAJA 3C0BA 3ZCMA 3VQEA 2IC3A 1SS6A 2FXUA 4IDHA 4DTXA 4CJVA 2HSTA 3AVMA 3RWUA 1RILA 1IG9A 1S1XA 3NHGA 4FJHA 1RDDA 4B9MA 3C6AA 1JLAA 4B9NA 3MWPA 2ZGZA 2QXFA 4DSEA 5AQSA 5HLFA 1BCOA 1NJWA 1WAFA 3T1HK 3SMSA 5BRFA 1YTUA 3QICA 5M1KA 2F8TA 4KRFA 3FFIA 4A59A 3VENA 3CI5A 3M3ZA 2DFHA 4DUZK 3QETA 4J2AA 1WSEA 3R6MA 3WEEB 1BI4B 4IZ9A 2YHXA 4LF4K 1OKJA 1Q18A 3BUZB 1A5WA 2OPQA 1QVGM 4BRKA 3AVJA 3QBXA 4BWMA 4HCCA 1S1VA 2P9LA 2Z1GA 3E9PA 4FWLA 3HJFA 2YX6A 4EAHD 1TK5A 2CGKA 1QE1A 5F2RA 1KVCA 3V1OA 1IG8A 2XRIA 1RDAA 4RW6A 1G99A 1YTAA 1HKBA 4CF1A 5GADP 4KO0A 1YHQN 2O8CA 3AAPA 3EY1A 1T8EA 5F0XA 4FJLA 5FRNA 4C8NA 2HHVA 3D2FA 3AVCA 4QS7A 2KHOA 1S9GA 4DQIA 2F4VK 4E3SA 3QIPA 1JJ2M 5BPLA 3U8XA 4LD0A 5KPTA 2QA4N 3HBTA 3CJ7A 3O8MA 1MDUB 4ZHRA 4KI4A 1NOZA 4NLBA 3VQBA 5EY4A 4YFUA 4BVPA 4EFHA 3H6EA 3HOTA 3LPTA 4FJMA 1TAQA 2EHGA 2P1JA 1N8RO 1W97L 4B9LA 4OPKA 4DV5K 1NK0A 1QVFM 3TU5A 4B3OA 4FWSA 3LM2A 4KH5A 4CCHA 3DRRA 1X9MA 2KW4A 4CJRA 2UXBK 3OYLA 3KK2A 2P9IA 1XC3A 3IMXA 4IOAL 3NF9A 4DF8A 4AHCA 4AF1A 3SQ4A 4DS4A 3TSPA 3FFKB 3SUQA 3WXLA 3VETA 4LC9B 4CEOA 4X66K 2YHBA 1X9JA 1LAVA 4YNQA 1FK9A 2KFNA 2WFBA 3CM5A 5GAGP 4CHOA 4C8OA 3IDHA 3ZSRA 3TANA 1SUQA 5M1NA 2RE2A 4BVOA 3CCQN 3THYA 3P5JA 1KC8O 2RKIA 4N41A 4CJUA 4H0XB 3WNEA 4KHQA 3G0ZA 1TKZA 4CJLA 4Z4CA 3CFPA 3DOKA 4IBNA 4PKGA 1T6DA 4HHTA 4HUGA 2YJEA 4FK2A 1RTHA 4DR5K 4DTPA 3W0LA 2NUBA 1XHXA 3E01A 3VEOA 2XY6A 4M3TA 3KLIA 4CZHA 3KHYA 5EU7A 5KRSA 2QM1A 4AILC 4BGAA 4CJPA 2VCPA 5EXWA 3OYEA 1Z25A 3OBWA 2A6AA 4E89A 1E4FT 4DF4A 4OLAA 3P39A 3QERA 4B08A 1IV0A 1LV5A 4B1YB 4K25A 4OGEA 4JKFA 4YDUC 1KXPA 1O13A 2NLXA 4E7HA 4FK4A 1S22A 4LY7A 3TSUA 3TI0A 3GG4A 2I7PA 5AQFA 5JLHA 3I55N 2QK9A 1Z6RA 1LW0A 3VQQA 4FM2A 5I9EB 2VQFK 4H0OA 3AVBA 4XEIA 2NRVA 3LDPA 1QS4A 4CZGA 4HTLA 4FPAA 3CJ9A 4M3WA 5DK5A 4IG3A 3L2WA 2OTJN 1GLFO 5I42A 4EP4A 3AA3A 4IFEA 1KAXA 1RT6A 2OPRA 1KD1O 5KGXA 3VPZA 4KHYA 1BGXT 4CJEA 1HKGA 4CFDA 1RTJA 4HWIA 4OLBA 4CZFA 1TL1A 2P9LB 3F9KA 3VEXA 1OH6A 1HYSA 1S1UA 4PY5A 3NDKA 3V9UA 3SJHA 4DU4A 3OBYA 4YOVA 1WBBA 1NGJA 4FK0A 2ZD1A 4BR2A 2X74A 2O8CB 3JSMA 3M8RA 4G1QA 3P83D 3TAFA 3CIPA 1OVYA 3D2FB 2QWRA 4DV4K 4H4MA 2YHWA 1SV5A 2GEMA 1NGCA 3U3YA 3THWA 3AVNA 4Z4HA 1XNRK 3VA3A 1U49A 3QFPA 2Z1HA 4FWQA 3OHRA 3AY9A 4NYFA 4NCAA 3A5OC 3FLCO 1E3MA 4CJWA 4RW8A 4FJNA 4CJ7A 1FJGK 2Q0RA 3B8AX 3NE6A 1JLGA 3CXCM 4PWDA 3MK6A 2A41A 1VSFA 5K14A 3LAKA 4DKWA 3E9LA 1CXQA 4DG1A 4LF8K 4OPAA 3GOIA 1BUPA 1W7AA 1YAGA 4FWNA 3HSCA 2NNWA 2P9IB 1R59O 3G71N 4DTSA 2O8EB 4B8AB 2VWBA 2IIRA 3K57A 4DV2K 1GLDG 1HYVA 4JHDB 2G8VA 4V19S 4DSLA 3VGMA 4FJJA 5JVGL 5FLXO 2DTUA 5AFUA 4I2QA 4H5TA 2GBZA 1GOBA 3S9HA 1HPMA 3ZT3A 1JLEA 1U47A 3PUFA 3VF4A 1TUUA 4YHHK 4M41A 3I0SA 4BC4A 3THYB 2ITGA 1NGEA 2RF2A 3PY8A 4FWRA 2IS3A 1DTTA 4LF5K 1VRUA 2YNHA 2VG7A 1ZBUA 2PAVA 1KFSA 4CFCA 3QEWA 4DQ8A 3LP1A 1C0TA 2CH6A 3SLCA 2HOEA 4CBXA 4JLHA 4DV6K 5FRMA 2WUSA 4C8MA 3V9XA 1RBTA 1YI2N 4ZTFA 2ITMA 4RWTA 1IJJA 4IDKA 4JS4A 1WOQA 3O6WA 2HBLA 3C65A 2IOCA 5LJWA 2HW3A 4OKJA 3O80A 4JI1K 4E19A 1NKBA 4ID1A 2CGLA 5CR4A 4YOWA 1YT3A 4O8UA 1DT9A 5C24A 2KQ2A 3DI6A 4CGJA 3L3UA 5M1QA 4JKGA 5BR9A 3OYCA 1FKOA 3ASMA 1X9WA 3O3HA 3MAQA 3MXMA 1ASUA 3RR7A 4IKFA 3VQ7A 3DLKA 3PV8A 4FSVA 5GINA 4PA1A 4B3MK 2O4GA 4KHNA 1JL1A 1G15A 4PKHA 3ZEUA 3ZSWA 4BR5A 4H4OA 2Q31A 5KPRA 3H3NO 4LSLA 4QAGA 2BANA 1SKWA 3IRXA 4C8KA 4DMNA 1HMVA 3K5MA 1VQ5N 3S3NA 2UYTA 3VQDA 2P9UA 3NCIA 4JI8K 1T6CA 3MN5A 4BC3A 4KHPK 3OS2A 2XY5A 3AA2A 3THWB 1S1WA 4DR2K 1NG9A 4IO9L 1BIZA 3K5OA 1BA0A 5LJVA 1O1WA 1LCUA 3AO3A 3LWMA 1S3XA 3LM9A 3OYDA 3HVRA 1T3VA 1V4SA 1WSHA 2FLOA 5HRRA 4YOTA 4DTUA 1B9DA 2Y1JA 3PIOL 4BRHA 2GWJA 4JI4K 3ZX0A 1P90A 1BISA 3CJCA 4AHVA 4O0IA 4KH6A 2GUIA 1CLQA 3GBTA 4BRFA 1HX1A 2J4RA 1VSKA 4X64K 1XC9A 4FLTA 1VQ4N 5BR8K 3R8EA 3CQXA 3D6RA 2HF3A 3FR0A 2HHTA 4LFBK 2NRRA 1DKGD 1HJRA 3C6TA 3FZFA 4CHZA 3TARA 1NK4A 2E2OA 4CEEA 2E6MA 3RR8A 1QQMA 3IS9A 2PZSA 1RT3A 3CCLN 4JV5K 1KLMA 2H3GX 3R9PA 5DMRA 1YF5L 2YHYA 3SBTA 4B1WB 5C42A 3RRHA 4AHTA 3DLGA 4FLXA 3NAEA 3LAMA 4KPYA 4KI6A 4KBOA 4NB4A 4G9ZA 1S1TA 3DXKA 3IAYA 1U04A 2W42A 3J7YP 3MCAB 3NGZA 2ZJRL 4CHPA 4W5RA 5JS1A 1ZXOA 3O3FA 4DFJA 4RW7A 3H1VX 3K59A 3SUNA 4CFAA 1LW2A 2YHAA 3THXA 4BDYA 4HVJA 4M42A 1NLVA 3VEYA 5JMVA 4BACA 2E5LK 1C1BA 2HBKA 1TYQB 4DV7K 5AJ3K 3MXJA 4JKGB 5HROA 1RT2A 4RCHA 4NO7A 2R7YA 1GLEG 5AZIA 4FJGA 5BN8A 4DU1A 3AVIA 4F4KA 3J8AA 2YV0X 4BR9A 3OYBA 4JRPA 3HPOA 1D9FA 2GX9A 2VG5A 1K73O 1DLOA 1X3NA 3SUPA 2RPIA 3ZEUB 3ZSOA 4H0VB 4DTOA 1IKXA 1NK6A 3GL1A 3AVLA 5ADXH 2E1YA 1N33K 4BRDA 1VSMA 1QSSA 3L2QA 4NYNA 1BL3A 4FLYA 3H08A 3IFRA 4GNIA 1NJIO 1HJOA 4LH5A 3SAGA 1MA9B 3MEGA 2P9UB 1SKSA 3EE8A 3K9KA 1IO2A 1VSHA 4CESA 2UXCK 3VQ6A 1S6QA 3HVTA 2OCEA 3WNFA 3HO1A 4EP5A 4CIFA 4F2RA 3S3MA 4N56A 1S5JA 3UKRA 3EZWA 3VEVA 3A8YA 2VQEK 4OPHA 3L6QA 1NMNA 3TTFA 5FPDA 1B9FA 3W3DA 5FROA 4CD1A 5F1XA 1NGAA 3A5NC 4DHYA 4DSIA 3JXUA 4M7XA 3JS6A 4Y1CA 1WLJA 3OTOK 4M45A 3ZSXA 4ID5A 5HBMA 2HHXA 3LANA 5J1EA 3K5NA 5EX5A 3MN9A 1RT5A 2ASMA 4CJ4A 1C0FA 1CZBA 4OGCA 4NXNK 1VSIA 4CGGA 1JXBA 4O5FA 5CHIA 3SNNA 1A5XA 2UUAK 3VA0A 2A42A 3TAPA 3H45C 4ISEA 5AQLA 1FXXA 3L4QA 4JKCA 3LP0A 1W0HA 3KKRA 4LFAK 2P9KA 1J9AA 2RHKA 3AA5X 3CFOA 4FL9A 5LY3A 1TAUA 5AR0A 5AQUA 3VEZA 2FF6A 4JAXA 4JKEA 2HHWA 3OS1A 3PIPL 1EX4A 3O5BA 2OA8A 3WXKA 1Q9YA 3HZ6A 3DXKB 1ATNA 5FPMA 1QSLA 4GV6A 2XY7A 4FOEA 4C23A 1TGOA 2HHSA 5IWAK 1VQON 3CERA 4B1ZA 3DJCA 3HXMA 1WB9A 3LDLA 3VQ4A 1OH8A 3HP9A 5LMUK 3M8QA 1Z26A 3MEEA 5FDLA 3ZSQA 1Q8IA 3PSFA 1KLNA 3ZSVA 3MECA 3THXB 4H0PA 3LWLA 1EKEA 3CCVN 3CFRA 4LF6K 2NRWA 3SMPA 1U45A 5E26A 1Z05A 1E4GT 3D45A 3H1QA 4WFAL 4QS9A 1TKXA 1C1CA 1WSGA 4IOXA 1WSIA 3QEPA 3B6OA 5AZIB 2AJQA 4DTMA 2IVOA 2EX3A 2Q97A 4J2DA 2ZQBA 4B1VA 3IG1A 3U6FA 4JI0K 5JICA 4X62K 3MDQA 5BRDA 1R0AA 5CY4A 3MXIA 4OO1J 3F9MA 1L3UA 1L3SA 4JKDA 5C0YA 3M6GA 4FW1A 4B3SK 5AQOA 1KVBA 1IBKK 3HP6A 3OYGA 3EKUA 4DQRA 1BA1A 2HHHK 5JLFA 3KTQA 3KVGA 1JLCA 2QKBA 5AQJA 2W40A 3ITHA 1ASVA 1RFQA 3HM8A 1U6ZA 4CHQA 1Q81O 4EHTA 3PSIA 3KLGA 3HT3A 1RNHA 2W41A 4JD2A 1J54A 1NJYA 2Z1JA 3RTVA 4CJSA 5TKYA 4KFBA 2ZGYA 4Z0UA 3VGKA 4R79A 4H5NA 1RBVA 3QFUA 4YOUA 4FO0A 3SPYA 3O3GA 1JL2A 1M90O 3UKRB 5AQZA 1M1KO 3UE5A 3CF5L 3AVGA 3CJAA 3ENOA 1J5OA 1KAYA 3J81O 2E88A 3CCEN 4PL8A 1WNSA 3HPGA 1V4TA 3LZJA 4EZ9A 4H0YB 3J80O 2OPPA 3FE1A 3M1FA 1LWFA 3TAMA 1HNVA 5HRNA 4DTJA 2QKKA 2P51A 1BDGA 4CGIA 1XMOK 5C12A 2ZF5O 4BWJA 1RBUA 4W5TA 4AHSA 4C1NI 3CCMN 2DY4A 4CIEA 3CHWA 4W5QA 1RCHA 3QESA 3VTHA 1D8YA 3OVNA 1N34K 2ASPA 4W5NA 1IKWA
chains in the Genus database with same CATH topology
1QZ5A 3WQUA 3Q7CA 4JK9A 4QS8A 3NVKA 4J8FA 4WF9L 2P9SB 5EOYA 3NMUA 4U7BA 3TTCA 3ULEB 5TKWA 3G6EN 3O9SA 1VQ8N 3PLAA 4MO4A 3BP8A 3CJ1A 4BROA 4BR7A 4FSVA 2GELA 5GINA 1VQNN 3O9RA 5ADXA 4PKHA 1GLCG 4A2BA 1YJWN 1EO1A 3ZEUA 2VGMA 4BR5A 3ID8A 3UB5A 2VYPA 4BRGA 3RSEA 2Q31A 2GUPA 4BRNA 4E1JA 1NMDA 4PHTX 5KPRA 3H3NO 5AQYA 4CZKA 3EN9A 4Z94A 1K9MO 2YJFA 1YUWA 3D7EO 1J6ZA 3DAWA 1VQ5N 4WQ5A 2UYTA 3QMLA 3M5RA 3AGKA 2P9UA 5M1PA 1QHAA 1T6CA 4IOCL 2PBDA 4BREA 3MN5A 3P38A 4BC3A 1CZAN 3HTVA 2OTLN 4XH4A 2V52B 1KAZA 5AQTA 3F5TA 4CZMA 2QWNA 3A0IX 2A40A 2QWPA 4IO9L 2QTDA 3HRGA 1BA0A 5LJVA 4BRLA 4JHDA 1DGKN 1LCUA 2IVPA 1S3XA 4BG8A 1MWMA 3LM9A 2E2QA 1T3VA 1V4SA 2FLOA 4FVUA 4YOTA 1YXQA 3PIOL 4BRHA 3SBGA 2GWJA 1D4XA 4BQLA 1NGBA 3ZX0A 4H5VA 1P90A 1Q7YO 3CJCA 3UKUA 4GV9A 2HMPA 5AQVA 1NGDA 1YIJN 2QW9A 3S41A 3DWLA 4WCEL 4KH6A 5DM7L 3FZHA 2Q36A 2PFUA 3ENBA 4ILGB 5CE3A 3H46O 2V51B 3GBTA 4WQ4C 3U9ZA 4BRFA 1HX1A 2J4RA 5AQXA 3GE1A 3ZETB 2A5XA 3RVCA 3BEXA 3MX2A 1ZC6A 3C0BA 1VQ4N 3C6HA 1SS6A 3R8EA 3CQXA 2FXUA 2F9WA 4H03B 3D6RA 2P9NA 4IDHA 2HF3A 3FR0A 3FZMA 4BQZA 2HSTA 3QBWA 2DPNA 3ENHA 2NRRA 4FOIA 1DKGD 3BF3A 3FZFA 3KWIA 3LDNA 2IVNA 4I6MA 2E2OA 3CD6N 3C6AA 1VQ6N 2FF3B 3MWPA 1QQMA 2ZGZA 1VQLN 4JKBA 3CCLN 4YDUA 2H3GX 5AQSA 3R9PA 1YF5L 2AP1A 2YHYA 3I8BA 5C2FA 1K8AO 2F9TA 4JD2B 3SBTA 3SMSA 3QICA 4B1WB 5BRFA 5M1KA 2QXLA 4A59A 3ATUA 3VENA 1H1VA 3CI5A 3M3ZA 5AZJB 5C15A 3R6MA 5GIOA 2P9PA 4JK7A 3WEEB 5JVHL 4IZ9A 3O9QA 2Q1NA 2YHXA 2E2NA 1OKJA 1Q18A 3BUZB 3O9TA 4KBOA 3E9OA 5AQRA 1QVGM 1LOTB 4H5RA 4BRKA 2QEXN 4NB4A 3QBXA 4G9ZA 2P9LA 3DXKA 3E9PA 3HI0A 4FWLA 3VF6A 2YX6A 4EAHD 5GAEP 3Q7BA 2CGKA 1X3MA 5F2RA 4WFNL 2D0OA 3L0QA 3MCAB 2ZJRL 3I33A 3F2KA 1IG8A 3TTDA 3P31A 4CD3A 1ZXOA 1G99A 1HKBA 5BN9A 5GADP 1YHQN 4BRIA 3AAPA 1SAZA 3CC4N 1BG3A 5F0XA 3H1VX 2P9KB 4K43A 4YOXA 2E2PA 4BGBA 3D2FA 4QS7A 4BRMA 2KHOA 3O9UA 2F7TA 1JJ2M 1EQYA 2GWKA 5BPLA 3U8XA 5KPTA 1NLVA 5BPMA 2QA4N 3HBTA 2GTDA 3CJ7A 1MDUB 2V7YA 3O8MA 3VEYA 5JMVA 2HBKA 4NLBA 4GY2B 1TYQB 5EY4A 4BVPA 4BRCA 2NRTA 4EFHA 3SK3A 4JKGB 3H6EA 3HOSA 3LDQA 4YORA 1JCGA 3HOTA 4JK8A 4NO7A 4RCHA 1N8RO 2QWMA 1W97L 1GLEG 5AZIA 3P4IA 1VQPN 5BN8A 1VQ9N 1QVFM 3TU5A 5BRHA 4FWSA 3LM2A 3J8AA 4KH5A 1MWKA 4BR9A 2GX9A 4KH4A 3KWGA 1QQOA 4C1NK 1K73O 1NM1A 1X3NA 2WBNA 2P9IA 2ASOA 1XC3A 4IXCA 4WQ5C 4FPBA 4BR4A 3IMXA 3ZEUB 4IOAL 1ILYA 4H0VB 1ZBSA 4NLCA 5HOOA 4JKAA 3E1YA 3RSEB 3GL1A 4AF1A 4BC5A 4BRPA 5ADXH 3TSPA 3CCSN 2HF4A 1WUAA 2E1YA 3FFKB 1Y64A 3WXLA 3VETA 4LC9B 4BRDA 4A2AA 3ZX2A 3FGUA 3CC7N 3FZKA 1X9JA 4CBUA 4JN4A 2V7ZA 3AARA 3IFRA 4F9OA 4GNIA 5AQNA 2WFBA 1HJOA 2D0PA 1NJIO 3VMFB 5GAGP 1K8KA 3VESA 3SAGA 1MA9B 2VGNA 4K42A 4A5BA 2P9UB 3IDHA 3O4WA 5M1NA 3EE8A 3A5MC 2RE2A 4BVOA 1RGIA 3N4PA 4M63C 3ZX3A 4CZLA 3CCQN 1KC8O 3K9KA 4XH1A 2Q2RA 3ZETA 4H0XB 4A62A 1U2VA 3D2EA 5AQWA 3CCRN 4CBWA 4PKGA 1T6DA 2YJEA 5FPNA 2KLAA 4MLHA 3W0LA 3VEOA 3UKRA 3EZWA 5GIPA 1DEJA 3VEVA 3A8YA 4OPHA 4CZHA 3KHYA 3L6QA 2YCHA 3VTIA 4IEIA 2QM1A 3TTFA 5FPDA 3W3DA 3DXMA 4CD1A 3CJBA 5F1XA 1NGAA 4FWPA 5AQGA 3A5NC 4BGAA 4PKIA 2VCPA 4DHYA 1BO5O 3JXUA 5EXWA 4M7XA 3DLLL 3JS6A 3NVMA 5B8HA 3O1WA 1VQ7N 3UKUB 3CMAN 3U4LA 4ISFA 3E66A 3OBWA 3WXIA 2A6AA 3CPEA 1QQNA 1E4FT 1XUPO 3P39A 3LL3A 5EX5A 3MN9A 4B1YB 4K25A 2NRXA 4JKFA 2ASMA 4MO5A 2YI1A 4YDUC 1KXPA 1NWKA 1O13A 3CQYA 2NLXA 3LDOA 4FWKA 3SAHA 1S22A 1C0FA 4M7YA 3WQTA 2P9NB 3J7ZO 1Q86O 3TSUA 3GG4A 2I7PA 3CC2N 5AQFA 2NZTA 5JLHA 4O5FA 3I55N 4PL7A 4L3QA 1Z6RA 4I6MB 4H0TB 2NRHA 5I9EB 4H0OA 5DM6L 5CHIA 2BUPA 4XEIA 1QZ6A 2QI2A 1BU6O 1NBWA 2NRVA 2QWQA 3C7NA 2A42A 2JWKA 3LDPA 3H45C 4ISEA 5AQLA 4GVEA 4CZGA 3L4QA 4HTLA 4JKCA 1YITN 4FPAA 3CJ9A 5KPZA 1NGHA 2P9KA 2RHKA 2P9SA 2OTJN 1GLFO 1W2BM 4YOYA 2D1KA 5M1FA 4FL9A 5LY3A 3ULEA 3KK7A 4IFEA 1HKCA 5C10A 1GLAG 5AR0A 1KAXA 1NGIA 5AQUA 3VEZA 2P9PB 2JWLA 3EL2A 2FF6A 3ATVA 4JAXA 4BRAA 5C2DA 4ILHA 4JKEA 2FSJA 3VPZA 1KD1O 3GDQA 5AQPA 2NRZA 1HKGA 5ELZA 3PIPL 1BWFO 3O5BA 4HWIA 3WXKA 3VERA 4B1UB 4Y0WA 4RTFD 4CI6A 4CZFA 3HZ6A 4A57A 2P9LB 3DXKB 3AGRA 1SZ2A 2Q0UA 1ATNA 4O8KA 5FPMA 3VGLA 3VEXA 1TYQA 3CETA 3WUHA 3R3LA 3T7ZA 4GV6A 1RDWX 4FOEA 4C23A 4EHUA 3EE9A 3SJHA 5E84A 3CERA 5AQQA 4B1ZA 1VQON 1KQSM 3DJCA 4BG9A 4MDAA 3LDLA 3OBYA 4YOVA 4H5WA 1ATRA 4FWOA 1NGJA 4K41A 4JEPA 4BR2A 3CMEN 4DCHA 3R1XA 1HLUA 3KZBA 1ATSA 3ZYYX 4U67L 2CH5A 2FSKA 3CIPA 1YJ9N 1OVYA 3D2FB 2QWRA 3U9DA 4H0PA 4EIAA 4ISGA 5GAHP 2YHWA 3CCVN 1VQMN 2GEMA 1NGCA 2NRWA 3ID6A 3SMPA 3TSQA 4CZJA 5E26A 1Z05A 1P8ZA 1E4GT 1XQSC 2EWSA 2OANA 3QFPA 3H1QA 5M1OA 4WFAL 1VAZA 4QS9A 4FWQA 4B9QA 3OHRA 3CPWM 3AY9A 3L4IA 4AM7A 3A5OC 3FLCO 4CZIA 4IOXA 4MDBA 4IEEA 4CJ7A 2Q0RA 3B8AX 4IO8A 4ILJA 3VEWA 4MLEA 5AZIB 1TUYA 3CXCM 2HBMA 3G4SN 3MK6A 1Q82O 2A41A 2IVOA 4DKWA 3I56N 3E9LA 2Q97A 2FSNA 4B1VA 3FZLA 4WYBA 5EVZA 3MN7A 5JICA 3MDQA 5BRDA 4OPAA 3GOIA 1BUPA 2QWOA 1JCEA 4OO1J 1YAGA 3F9MA 3HSCA 4FWNA 2NNWA 1GLLO 2P9IB 1R59O 3G71N 1YJNN 5BREA 4JKDA 5C0YA 3M6GA 2QWLA 2VWBA 5HL7L 3CCJN 5AQOA 3MCPA 4BY9C 2IIRA 2ZJQL 1RDUA 3EKUA 1GLDG 2A3ZA 4JHDB 1BA1A 4DB3A 3N4QA 4BR0A 5JLFA 4BRQA 3VGMA 3MN6A 5JVGL 3KVGA 5AFUA 2BH1A 5AQJA 4WQ4A 4H5TA 5AQKA 1VQKN 2W40A 1HPMA 1K8KB 2D4WA 5BPNA 1RFQA 3HM8A 1U6ZA 3VF4A 3IUCA 4JKHA 1TUUA 4A5AA 3OA9A 5H1SQ 1Q81O 4FWMA 4EHTA 3VOVA 2HBJA 2WC9A 4BC4A 4IWVA 3VF2A 4CZEA 1S72N 1NGEA 3MX5A 3BF1A 2W41A 4JD2A 4BC2A 4JNEA 4FWRA 4GV3A 4WFBL 5AQIA 5AZJA 3O08A 1U2VB 5TKYA 2ZGYA 3VGKA 3D2EB 4R79A 4H5NA 3WEEA 4IJNA 3QFUA 2PAVA 3H3OB 4YOUA 3WXJA 4FO0A 5MLCQ 1GLBG 1M90O 4DQ8A 3UKRB 2AA4A 2KKZA 5AQZA 1M1KO 3UE5A 3TPQA 2CH6A 3SLCA 2HOEA 4AM6A 4CBXA 3CF5L 5FPEA 3DXMB 3G25A 3CJAA 5AQHA 3ENOA 1KAYA 2BTFA 5AFUH 2WUSA 2E88A 1NGGA 3CCEN 1YI2N 3AAQA 4PL8A 3QDKA 4XH5A 3OW2M 1T44A 3K9JA 1V4TA 2ITMA 4H0YB 4RWTA 1ESVA 1BOTO 3EO3A 3FE1A 1IJJA 2E1ZA 1NGFA 3M1FA 2E20A 1GLJO 1WOQA 2ZJPL 1C0GA 1SQKA 3O6WA 1BDGA 5C12A 3WT0A 2HBLA 2ZF5O 3C65A 1YVNA 5LJWA 3QB0A 4A61A 4C1NI 5KQ8A 3CCMN 3O80A 3WXMB 3IKMA 1HUXA 5AQMA 2CGLA 5CR4A 2CGJA 4YOWA 3MMVA 4O8UA 1DT9A 3CHWA 2I7NA 3MWTA 4B1XB 3A5LC 1JCFA 3SAFA 4UY8O 5KQDA 3T69A 3O1BA 3EKSA 3CCUN 3VTHA 4IJAA 2ZWHA 5M1QA 3C7NB 4JKGA 2ASPA 5BR9A 2E8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ5 A;  3WQU A;  4QS8 A;  4J8F A;  2P9S B;  5EOY A;  3ULE B;  4MO4 A;  3BP8 A;  3CJ1 A;  4BRO A;  4BR7 A;  4FSV A;  2GEL A;  5ADX A;  4PKH A;  1GLC G;  4A2B A;  3ZEU A;  4BR5 A;  3ID8 A;  3UB5 A;  2VYP A;  4BRG A;  3RSE A;  2Q31 A;  2GUP A;  4BRN A;  4E1J A;  1NMD A;  5KPR A;  3H3N O;  5AQY A;  4CZK A;  3EN9 A;  4Z94 A;  2YJF A;  1YUW A;  3D7E O;  1J6Z A;  3DAW A;  4WQ5 A;  2UYT A;  3QML A;  2P9U A;  1QHA A;  1T6C A;  2PBD A;  4BRE A;  3MN5 A;  4BC3 A;  1CZA N;  3HTV A;  4XH4 A;  2V52 B;  1KAZ A;  5AQT A;  4CZM A;  2QWN A;  3A0I X;  2A40 A;  2QWP A;  1BA0 A;  5LJV A;  4BRL A;  4JHD A;  1DGK N;  1LCU A;  2IVP A;  1S3X A;  4BG8 A;  1MWM A;  3LM9 A;  2E2Q A;  1V4S A;  2FLO A;  1YXQ A;  4BRH A;  2GWJ A;  1D4X A;  4BQL A;  1NGB A;  3ZX0 A;  4H5V A;  3CJC A;  3UKU A;  2HMP A;  5AQV A;  1NGD A;  2QW9 A;  3S41 A;  3DWL A;  3FZH A;  2Q36 A;  5CE3 A;  3H46 O;  2V51 B;  3GBT A;  4WQ4 C;  3U9Z A;  4BRF A;  1HX1 A;  2J4R A;  5AQX A;  3GE1 A;  3ZET B;  2A5X A;  3BEX A;  1ZC6 A;  3C0B A;  3R8E A;  3CQX A;  2FXU A;  2F9W A;  4H03 B;  2P9N A;  2HF3 A;  3FR0 A;  3FZM A;  4BQZ A;  3QBW A;  3ENH A;  2DPN A;  4FOI A;  1DKG D;  3BF3 A;  3FZF A;  3LDN A;  2IVN A;  4I6M A;  2E2O A;  2FF3 B;  1QQM A;  2ZGZ A;  4YDU A;  2H3G X;  5AQS A;  3R9P A;  2AP1 A;  2YHY A;  3I8B A;  2F9T A;  4JD2 B;  3SMS A;  4B1W B;  3QIC A;  5BRF A;  2QXL A;  3ATU A;  3VEN A;  1H1V A;  3CI5 A;  3M3Z A;  5AZJ B;  3R6M A;  2P9P A;  3WEE B;  4IZ9 A;  2Q1N A;  2YHX A;  2E2N A;  1OKJ A;  1Q18 A;  3BUZ B;  4KBO A;  5AQR A;  1LOT B;  4H5R A;  4BRK A;  4NB4 A;  3QBX A;  2P9L A;  3DXK A;  3HI0 A;  4FWL A;  3VF6 A;  4EAH D;  2CGK A;  1X3M A;  5F2R A;  2D0O A;  3L0Q A;  3I33 A;  1IG8 A;  4CD3 A;  1ZXO A;  1G99 A;  1HKB A;  5BN9 A;  4BRI A;  3AAP A;  1SAZ A;  1BG3 A;  5F0X A;  3H1V X;  2P9K B;  4K43 A;  2E2P A;  4BGB A;  3D2F A;  4QS7 A;  4BRM A;  2KHO A;  1EQY A;  2GWK A;  5BPL A;  3U8X A;  5KPT A;  1NLV A;  5BPM A;  3HBT A;  2GTD A;  3CJ7 A;  1MDU B;  2V7Y A;  3O8M A;  3VEY A;  5JMV A;  4GY2 B;  1TYQ B;  5EY4 A;  4BVP A;  4BRC A;  4EFH A;  3SK3 A;  3H6E A;  3LDQ A;  1JCG A;  4RCH A;  4NO7 A;  2QWM A;  1GLE G;  5AZI A;  3P4I A;  5BN8 A;  3TU5 A;  5BRH A;  4FWS A;  3LM2 A;  3J8A A;  1MWK A;  4BR9 A;  1QQO A;  1NM1 A;  1X3N A;  4WQ5 C;  2P9I A;  2ASO A;  1XC3 A;  4IXC A;  4FPB A;  4BR4 A;  3IMX A;  3ZEU B;  4H0V B;  1ZBS A;  3RSE B;  3GL1 A;  4BC5 A;  4BRP A;  5ADX H;  2HF4 A;  1WUA A;  2E1Y A;  3FFK B;  1Y64 A;  3WXL A;  3VET A;  4LC9 B;  4BRD A;  4A2A A;  3ZX2 A;  3FGU A;  3FZK A;  1X9J A;  4CBU A;  4JN4 A;  2V7Z A;  3AAR A;  3IFR A;  4F9O A;  4GNI A;  5AQN A;  1HJO A;  2D0P A;  1K8K A;  3VES A;  1MA9 B;  4K42 A;  2P9U B;  3IDH A;  3O4W A;  3A5M C;  4BVO A;  1RGI A;  3ZX3 A;  4M63 C;  4CZL A;  4XH1 A;  2Q2R A;  3ZET A;  4H0X B;  4A62 A;  1U2V A;  3D2E A;  5AQW A;  4CBW A;  4PKG A;  1T6D A;  2YJE A;  5FPN A;  4MLH A;  3W0L A;  3VEO A;  3UKR A;  3EZW A;  1DEJ A;  3VEV A;  3A8Y A;  4CZH A;  3KHY A;  3L6Q A;  2YCH A;  2QM1 A;  5FPD A;  3W3D A;  3DXM A;  4CD1 A;  3CJB A;  5F1X A;  1NGA A;  4FWP A;  5AQG A;  3A5N C;  4BGA A;  4PKI A;  2VCP A;  4DHY A;  1BO5 O;  3JXU A;  5EXW A;  4M7X A;  3JS6 A;  5B8H A;  3O1W A;  3UKU B;  3U4L A;  4ISF A;  3WXI A;  2A6A A;  1QQN A;  1E4F T;  1XUP O;  3LL3 A;  5EX5 A;  3MN9 A;  4B1Y B;  4K25 A;  2ASM A;  4MO5 A;  2YI1 A;  4YDU C;  1KXP A;  1NWK A;  3LDO A;  3CQY A;  2NLX A;  4FWK A;  1S22 A;  1C0F A;  4M7Y A;  3WQT A;  2P9N B;  3GG4 A;  2I7P A;  5AQF A;  2NZT A;  5JLH A;  4O5F A;  4PL7 A;  4L3Q A;  1Z6R A;  4I6M B;  4H0T B;  2NRH A;  5I9E B;  4H0O A;  2BUP A;  4XEI A;  1QZ6 A;  3C7N A;  1BU6 O;  1NBW A;  2QWQ A;  3LDP A;  4CZG A;  2A42 A;  3H45 C;  4ISE A;  5AQL A;  4HTL A;  4FPA A;  3CJ9 A;  5KPZ A;  1NGH A;  2P9K A;  2P9S A;  1GLF O;  2D1K A;  4FL9 A;  5LY3 A;  3ULE A;  1HKC A;  1GLA G;  5AR0 A;  1KAX A;  1NGI A;  5AQU A;  3VEZ A;  2P9P B;  4BRA A;  3EL2 A;  2FF6 A;  3ATV A;  4JAX A;  3VPZ A;  2FSJ A;  3GDQ A;  5AQP A;  1HKG A;  5ELZ A;  1BWF O;  3O5B A;  4HWI A;  3WXK A;  3VER A;  4B1U B;  4Y0W A;  4RTF D;  4CI6 A;  4CZF A;  3HZ6 A;  2P9L B;  3DXK B;  1SZ2 A;  2Q0U A;  4O8K A;  1ATN A;  5FPM A;  3VGL A;  3WUH A;  3VEX A;  1TYQ A;  3CET A;  1RDW X;  4FOE A;  4C23 A;  4EHU A;  3SJH A;  5E84 A;  3CER A;  5AQQ A;  4B1Z A;  3DJC A;  4BG9 A;  3LDL A;  4H5W A;  1ATR A;  4FWO A;  1NGJ A;  4K41 A;  4BR2 A;  4DCH A;  1HLU A;  3KZB A;  1ATS A;  2CH5 A;  2FSK A;  3CIP A;  3D2F B;  2QWR A;  3U9D A;  4H0P A;  4EIA A;  4ISG A;  2YHW A;  2GEM A;  1NGC A;  3SMP A;  4CZJ A;  5E26 A;  1Z05 A;  1P8Z A;  1E4G T;  1XQS C;  2EWS A;  2OAN A;  3QFP A;  3H1Q A;  4QS9 A;  4B9Q A;  4FWQ A;  3OHR A;  3AY9 A;  3L4I A;  4AM7 A;  3A5O C;  3FLC O;  4CZI A;  4CJ7 A;  2Q0R A;  3B8A X;  4IO8 A;  3VEW A;  4MLE A;  5AZI B;  1TUY A;  3MK6 A;  2A41 A;  2IVO A;  2Q97 A;  2FSN A;  4B1V A;  3FZL A;  4WYB A;  5EVZ A;  3MN7 A;  5JIC A;  3MDQ A;  5BRD A;  3GOI A;  1BUP A;  2QWO A;  1JCE A;  1YAG A;  3F9M A;  3HSC A;  4FWN A;  1GLL O;  2P9I B;  1R59 O;  5BRE A;  3M6G A;  2QWL A;  2VWB A;  5AQO A;  3MCP A;  2IIR A;  3EKU A;  1GLD G;  2A3Z A;  4JHD B;  1BA1 A;  4DB3 A;  4BR0 A;  5JLF A;  4BRQ A;  3VGM A;  3MN6 A;  3KVG A;  5AFU A;  5AQJ A;  4WQ4 A;  4H5T A;  5AQK A;  2W40 A;  1HPM A;  1K8K B;  2D4W A;  5BPN A;  1RFQ A;  3HM8 A;  1U6Z A;  3VF4 A;  3IUC A;  1TUU A;  4FWM A;  4EHT A;  3VOV A;  4BC4 A;  4IWV A;  3VF2 A;  4CZE A;  1NGE A;  4BC2 A;  3BF1 A;  2W41 A;  4JD2 A;  4JNE A;  4FWR A;  5AQI A;  5AZJ A;  3O08 A;  1U2V B;  5TKY A;  2ZGY A;  3VGK A;  3D2E B;  4H5N A;  3WEE A;  4IJN A;  3QFU A;  2PAV A;  3H3O B;  3WXJ A;  4FO0 A;  1GLB G;  4DQ8 A;  3UKR B;  2AA4 A;  5AQZ A;  3UE5 A;  3TPQ A;  2CH6 A;  3SLC A;  2HOE A;  4AM6 A;  4CBX A;  5FPE A;  3DXM B;  3G25 A;  3CJA A;  5AQH A;  3ENO A;  1KAY A;  2BTF A;  5AFU H;  2WUS A;  2E88 A;  1NGG A;  3AAQ A;  4PL8 A;  3QDK A;  4XH5 A;  1T44 A;  1V4T A;  2ITM A;  4H0Y B;  4RWT A;  1ESV A;  3EO3 A;  1BOT O;  3FE1 A;  1IJJ A;  2E1Z A;  1NGF A;  3M1F A;  2E20 A;  1GLJ O;  1WOQ A;  1C0G A;  1SQK A;  3O6W A;  1BDG A;  3WT0 A;  2ZF5 O;  1YVN A;  5LJW A;  3QB0 A;  4A61 A;  5KQ8 A;  3O80 A;  1HUX A;  5AQM A;  2CGL A;  2CGJ A;  3MMV A;  3CHW A;  2I7N A;  4B1X B;  3A5L C;  1JCF A;  5KQD A;  3O1B A;  3EKS A;  4IJA A;  2ZWH A;  3C7N B;  2ASP A;  5BR9 A;  2E8A A; 
#chains in the Genus database with same CATH topology
 3PO5 A;  4QS8 A;  1I94 K;  1KFD A;  3NMU A;  5TKW A;  1XWL A;  3PLA A;  1LAW A;  4MO4 A;  3RMB A;  1NU0 A;  3CJ1 A;  3V1Q A;  4BR7 A;  2GEL A;  3KIO A;  3O9R A;  5ADX A;  1GLC G;  4Q5V A;  1YJW N;  1HNZ K;  1EO1 A;  3ID8 A;  2VYP A;  4E1J A;  4BRN A;  1NMD A;  3EN9 A;  1YUW A;  4QCL A;  1J6Z A;  4DWI A;  2VG6 A;  4E0D A;  3QML A;  4LSN A;  1JXE A;  4FM1 A;  1RT7 A;  3M5R A;  1OH5 A;  1NKE A;  4IOC L;  4BRE A;  1CZA N;  3RMD A;  2V52 B;  1ZBL A;  5A2Q O;  2QWP A;  3DOL A;  4KTZ A;  3SCX A;  3HRG A;  3L2R A;  3SQ0 A;  4DUY K;  1RTI A;  4CF2 A;  1WAJ A;  1C0M A;  2E2Q A;  4CIG A;  1YXQ A;  3SBG A;  1D4X A;  1NGB A;  1NK9 A;  3NFA A;  1Q7Y O;  1HQU A;  4GV9 A;  2HMP A;  5AQV A;  4B9S A;  4WCE L;  3C95 A;  3FZH A;  3ENB A;  5CE3 A;  3KK3 A;  3H46 O;  2V51 B;  4WQ4 C;  3U9Z A;  4DV3 K;  3O4N A;  1N6Q A;  3AVF A;  4K8X A;  4KKO A;  3BEX A;  1WSJ A;  5I3U A;  4H03 B;  3QBW A;  2DPN A;  3ENH A;  4FOI A;  1IBL K;  3EYZ A;  3KWI A;  2IVN A;  4FJX A;  2D0B A;  5HRP A;  2KTQ A;  1VQL N;  4YDU A;  4DFP A;  1NJZ A;  1U48 A;  3I8B A;  4W5O A;  1K8A O;  4DS5 A;  2F9T A;  3KD1 E;  4JD2 B;  3CQ8 A;  3DLE A;  2A1R A;  2QXL A;  1H1V A;  1KRP A;  3O9Q A;  2A1S A;  4I7F A;  2E2N A;  2ETJ A;  4DTR A;  3E9O A;  4OX9 K;  1LOT B;  4NCB A;  3A2F A;  2QEX N;  2KZM A;  2W6K A;  3HI0 A;  1XHZ A;  3Q7B A;  4BE0 A;  1QQC A;  4N5S A;  4DR7 K;  2D0O A;  3L0Q A;  3TTD A;  3P31 A;  4IG0 A;  4CD3 A;  3NGY A;  4CEZ A;  4L8R B;  5BN9 A;  4K8Z A;  4BRI A;  1SAZ A;  3CC4 N;  1BG3 A;  4K43 A;  1CZ9 A;  3HYF A;  4DR4 K;  1RBR A;  2E2P A;  4BGB A;  4FM0 A;  3QNN A;  1RBS A;  2PY5 A;  3O9U A;  3ZSY A;  1UA1 A;  4KHU A;  3V9Z A;  2LSN A;  1EQY A;  2GWK A;  3OYK A;  2HNZ A;  3AVK A;  5BPM A;  2GTD A;  1REV A;  1HPZ A;  1CXU A;  1ZBF A;  4BRC A;  3C6U A;  1L3V A;  3SK3 A;  2HNY A;  3LDQ A;  4YOR A;  1KCF A;  5J2N A;  2QWM A;  2UUB K;  4E1N A;  1VQP N;  1UA0 A;  1VQ9 N;  2E6L A;  5LL6 Z;  1HNX K;  3T19 A;  5BRH A;  1L3T A;  1MWK A;  1TL3 A;  1YVU A;  5J2Q A;  4NXM K;  5CZ2 A;  4KH4 A;  3KWG A;  1QQO A;  4C1N K;  3PO4 A;  4WQ5 C;  2ASO A;  2DFE A;  1BQN A;  4FJ9 A;  4FPB A;  4BR4 A;  5HOO A;  4NLC A;  1SL2 A;  3E1Y A;  4BC5 A;  5HP1 A;  3KD5 E;  4FLZ A;  1BCM A;  1Y64 A;  4A2A A;  3BY5 A;  4I2P A;  3ZX2 A;  2FBV A;  3CC7 N;  3FZK A;  2IDO A;  2D0P A;  4CGF A;  1RT1 A;  3SV3 A;  3VES A;  4GVM A;  4A5B A;  1J53 A;  1SL1 A;  3A5M C;  3N4P A;  4M63 C;  1SL0 A;  3QNO A;  2Q2R A;  3ZET A;  3LP2 A;  2PYL A;  4A62 A;  4JS5 A;  1U2V A;  4O0J A;  3CCR N;  4CBW A;  2FBX A;  3SI6 A;  5SZT A;  2Q3S A;  3B6P A;  5FPN A;  1W9H A;  3DYA A;  1DEJ A;  4FCY A;  4GKK K;  2YCH A;  4FJI A;  3DXM A;  3CJB A;  4FWP A;  4PKI A;  1TK8 A;  3NF7 A;  3ZT1 A;  3EEQ A;  3O1W A;  1VQ7 N;  4KHS A;  1VSE A;  4R5P A;  4ISF A;  3E66 A;  3WXI A;  1KTQ A;  3KLE A;  4B9T A;  3CM6 A;  1WSF A;  4CER A;  4H8K A;  1J5E K;  2NRX A;  4MO5 A;  1NWK A;  3LDO A;  3CQY A;  4AHU A;  5C25 A;  4CJT A;  4FWK A;  3SAH A;  2G8W A;  4M7Y A;  1Q86 O;  1EP4 A;  3AO1 A;  4L3Q A;  4AH9 A;  2NRH A;  5DM6 L;  2BUP A;  1QZ6 A;  3C7N A;  1NBW A;  1YIT N;  4GVE A;  4DLE A;  2DFF A;  5KPZ A;  1ASW A;  3OS0 A;  2KZZ A;  2YNF A;  3SUO A;  4YOY A;  4KB1 A;  4TSX A;  5M1F A;  4E7K A;  4Q0B A;  3I0R A;  5C10 A;  1C0U A;  1NGI A;  2WON A;  2O8D A;  2JWL A;  4BRA A;  4ILH A;  2FSJ A;  3RRG A;  2NRZ A;  5ELZ A;  1BWF O;  3AO2 A;  4DFK A;  2FC0 A;  3VER A;  4Y0W A;  4N47 A;  4AHR A;  4CI6 A;  1VSJ A;  4A57 A;  1SZ2 A;  4ELV A;  3CET A;  1WBD A;  1RDW X;  4EHU A;  1BIU A;  3EE9 A;  1NOY A;  4FLV A;  4FWO A;  4K41 A;  4DV0 K;  1VHX A;  3DM2 A;  3HPH A;  3T1Y K;  1HLU A;  3SZ2 A;  4HUE A;  3AO4 A;  4U67 L;  2XHB A;  4IFV A;  2OZS A;  1YJ9 N;  3DRS A;  3U9D A;  3G10 A;  4EIA A;  4ISG A;  5GAH P;  3TAE A;  3SJJ A;  4Z4E A;  3ID6 A;  3TSQ A;  3VQ9 A;  1NK5 A;  3NH2 A;  1P8Z A;  2EWS A;  2OAN A;  2Z1I A;  2HB5 A;  1MU2 A;  1VAZ A;  3OJU A;  4CGH A;  3CPW M;  1KSP A;  3L4I A;  4RW4 A;  1ITG A;  3NBP A;  4CZI A;  1NK7 A;  1L5U A;  4JRQ A;  1IH7 A;  4ILJ A;  3VEW A;  4MLE A;  1TUY A;  2HBM A;  1A5V A;  1Q82 O;  4DR3 K;  3VQC A;  1RT4 A;  4RG8 A;  1JLF A;  3V4I A;  4DR6 K;  1LWE A;  3UIQ A;  1JCE A;  3KJV A;  4ICL A;  4DFM A;  1YJN N;  2QWL A;  4KTW A;  5HL7 L;  3CCJ N;  1HQE A;  4M3U A;  4BY9 C;  2ZJQ L;  3N4Q A;  4BR0 A;  4JYA K;  2GV9 A;  4ELT A;  2ATQ A;  2D4W A;  4C8L A;  3PX6 A;  3HST B;  4CEC A;  3IUC A;  4JKH A;  4FXD A;  3OA9 A;  5JS2 A;  1ZBI A;  3VOV A;  2HBJ A;  2WC9 A;  3VF2 A;  2UXD K;  4PQU A;  4CZE A;  1S72 N;  4BC2 A;  3ZT0 A;  4JNE A;  4GV3 A;  4FJ7 A;  4WFB L;  2F96 A;  3AA4 A;  5AZJ A;  4OPJ A;  3O08 A;  1U2V B;  4DR1 K;  1VRT A;  3H3O B;  5MLC Q;  3WXJ A;  1GLB G;  4JI5 K;  4HCB A;  5J2M A;  2AA4 A;  4FYD A;  4Z4F A;  4AM6 A;  4CK2 A;  1F21 A;  3DXM B;  4CHY A;  1S9E A;  2BTF A;  5AFU H;  1HYZ A;  3NF8 A;  4CF9 A;  5HRS A;  3QDK A;  3OW2 M;  1HRH A;  1T44 A;  3EZ5 A;  2ZE2 A;  1ESV A;  3EO3 A;  4RW9 A;  1GOC A;  3WNG A;  4KHW A;  2ZJP L;  3ZT2 A;  2O4I A;  1C0G A;  1SQK A;  2G8K A;  5IT9 O;  2X6N A;  3WT0 A;  4CHN A;  4O4G A;  3QB0 A;  1JKH A;  4A61 A;  5KQ8 A;  3WXM B;  3OYN A;  4DV1 K;  2I7N A;  3A5L C;  3RMC A;  3SAF A;  4UY8 O;  5KQD A;  2O8B A;  3T69 A;  3EKS A;  3CCU N;  1FW6 A;  2ZWH A;  2B4J A;  3C7N B;  4E7I A;  3O9S A;  3I56 N;  3WQU A;  3Q7C A;  3NVK A;  4MFB A;  4J8F A;  1Q9X A;  3TR8 A;  1VSD A;  2PYJ A;  4E7J A;  1UWB A;  2O8D B;  3P1G A;  4CK1 A;  4BRO A;  4JI3 K;  3D0P A;  2XO7 A;  1B92 A;  5CYM A;  1NNE A;  3UB5 A;  4FVM A;  3RSE A;  2GUP A;  4PHT X;  1QHT A;  3NF6 A;  4FW2 A;  4OJR A;  4CZK A;  4Z94 A;  1NKC A;  1K9M O;  1QSY A;  2JLE A;  2YJF A;  1NJX A;  3D7E O;  2G8I A;  4FJ5 A;  1C1A A;  4BDP A;  1TV6 A;  3OYM A;  1QTM A;  3AGK A;  3KLH A;  5M1P A;  3P38 A;  2OTL N;  1KAZ A;  2B6A A;  5AQT A;  3F5T A;  1BQM A;  2QWN A;  3A0I X;  2HVI A;  1IKV A;  4CF8 A;  3TAQ A;  3WNH A;  2G8F A;  2O8E A;  5KTQ A;  4JHD A;  4CJF A;  1Y97 A;  3O4Q A;  4DU3 A;  4KTQ A;  2UU9 K;  2JGU A;  4CK3 A;  3PX0 A;  3K5L A;  2HVH A;  1I39 A;  4DQP A;  4H5V A;  1D9D A;  3UKU A;  1NGD A;  1YIJ N;  3S41 A;  3DWL A;  5DM7 L;  3OYA A;  2Q36 A;  4CFB A;  4JI7 K;  3I8D A;  3RVC A;  3MX2 A;  1ZC6 A;  3V9S A;  2B5J A;  4OVL A;  3C6H A;  1UAX A;  2F9W A;  2P9N A;  3L2U A;  3FZM A;  4BQZ A;  1XNQ K;  3QEX A;  3BF3 A;  4DTN A;  4LF9 K;  3LDN A;  3KK1 A;  2YKN A;  4I6M A;  1RTD A;  3CD6 N;  1VQ6 N;  4CVN E;  2FF3 B;  1WN7 A;  2D0C A;  4JKB A;  4YY3 K;  4B9V A;  2AP1 A;  5C2F A;  3ZLJ A;  3SQ2 A;  1LWC A;  2KFZ A;  3LAL A;  3ATU A;  5AZJ B;  5C15 A;  5GIO A;  2P9P A;  4JK7 A;  5JVH L;  4CEB A;  1GOA A;  2Q1N A;  4QOZ B;  3O9T A;  5AQR A;  4H5R A;  3J7A P;  3VF6 A;  5GAE P;  1T05 A;  4B3T K;  1X3M A;  4E7L A;  1X1P A;  4WFN L;  3L3V A;  3I33 A;  3F2K A;  4O5B A;  4Z4G A;  1C6V A;  3DMJ A;  3VQ5 A;  3QEI A;  2P9K B;  3V81 A;  4YOX A;  3LZI A;  4BRM A;  2BDP A;  2F7T A;  3ALY A;  4FJ8 A;  2O8F A;  1XI1 A;  2FBY A;  2V7Y A;  4GY2 B;  2O8B B;  2NRT A;  1DTQ A;  3HOS A;  4LF7 K;  3HM9 A;  1JCG A;  4JK8 A;  1D5A A;  3P4I A;  5CZ1 A;  5SWM A;  4NCG A;  2OPS A;  4I9L A;  4DSJ A;  1NM1 A;  2WBN A;  4IXC A;  3AV9 A;  4CGD A;  1ILY A;  2BE2 A;  3K0S A;  1ZBS A;  2HND A;  3SQ1 A;  4JKA A;  3ZT4 A;  3RSE B;  4BRP A;  4KV8 A;  3CCS N;  2HF4 A;  1WUA A;  3FGU A;  4CBU A;  4JN4 A;  2V7Z A;  3AAR A;  5CYQ A;  1FKP A;  1IKY A;  5AQN A;  4F9O A;  4CE9 A;  3VMF B;  1K8K A;  2VGN A;  4K42 A;  1N32 K;  3O4W A;  5KI6 A;  4GKJ K;  1RGI A;  3ZX3 A;  4CZL A;  4XH1 A;  4XIU A;  1RDC A;  3BDP A;  3BZC A;  4CJK A;  2P5O A;  4KRE A;  3AO5 A;  3D2E A;  5AQW A;  1IBM K;  2W6L A;  2KLA A;  4MLH A;  1ZBH A;  4BDZ A;  5GIP A;  3T3F A;  1T7P A;  2RN2 A;  3VTI A;  4IEI A;  4BE1 A;  4N76 A;  3KLF A;  5AQG A;  4O55 A;  3LP3 A;  1BO5 O;  3DLL L;  4FLW A;  2D5R A;  3NVM A;  5B8H A;  1SKR A;  3UKU B;  3CMA N;  3U4L A;  3CPE A;  1QQN A;  1HNI A;  4M3X A;  1XUP O;  3LL3 A;  2X78 A;  1T03 A;  2YI1 A;  2YNI A;  3TWH A;  3LDS A;  1S6P A;  3WQT A;  4FLU A;  2P9N B;  3J7Z O;  4FZX C;  3V6D A;  4M3R A;  3CC2 N;  3QIN A;  2NZT A;  4B9U A;  4O44 A;  4PL7 A;  4E1M A;  4I6M B;  2HMI A;  4H0T B;  3NH0 A;  1VSL A;  2QI2 A;  1BU6 O;  2QWQ A;  2JWK A;  4X65 K;  3ULD A;  1NGH A;  2VWK A;  3PX4 A;  1OVQ A;  2P9S A;  1W2B M;  2D1K A;  1I3A A;  3KK7 A;  3ULE A;  1HKC A;  4DLG A;  4KB0 A;  4I9Q A;  1GLA G;  3AVA A;  2P9P B;  3G6E N;  3EL2 A;  3ATV A;  3VN5 A;  5C2D A;  3GDQ A;  5AQP A;  4CJ3 A;  1EET A;  1NK8 A;  3DRP A;  3F73 A;  4B1U B;  3CG7 A;  4EZ6 A;  4RTF D;  3DLB A;  4ELU A;  2Q0U A;  4JI2 K;  3VGL A;  3AGR A;  3K2P A;  4O8K A;  3WUH A;  1TYQ A;  3R3L A;  4PUO A;  3T7Z A;  5J2P A;  4HUF A;  3BZK A;  1TKD A;  3VQA A;  2Y1I A;  5E84 A;  5AQQ A;  1KQS M;  4BG9 A;  3L2V A;  4MDA A;  1EXQ A;  4ZTJ A;  4H5W A;  1ATR A;  3OYJ A;  2P5G A;  5KGW A;  3MED A;  4JEP A;  3VQ8 A;  3QLH A;  3CME N;  4JI6 K;  4DCH A;  3R1X A;  3KZB A;  3SYZ A;  1ATS A;  3ZYY X;  1JLB A;  2CH5 A;  2FSK A;  3K58 A;  1EWQ A;  1UOC A;  1TKT A;  1VQM N;  2O8F B;  4CJ5 A;  3OY9 A;  4CZJ A;  1XQS C;  1JLQ A;  3DLR A;  5M1O A;  3T1A A;  4B9Q A;  4BE2 A;  1TK0 A;  4Z4I A;  4AM7 A;  3BGR A;  4MDB A;  4IEE A;  4GW6 A;  4IFY A;  4CF0 A;  4IO8 A;  1HNW K;  4DSK A;  3M8P A;  4CEQ A;  3G4S N;  4FZY A;  2FSN A;  3FZL A;  4WYB A;  5EVZ A;  3MN7 A;  3HK2 A;  3AVH A;  2QWO A;  1TVR A;  2HHQ A;  1GLL O;  5BRE A;  4Y1D A;  3MCP A;  3NGI A;  1RDU A;  2A3Z A;  3SV4 A;  4DB3 A;  1N36 K;  4BRQ A;  4CEA A;  3MN6 A;  2BH1 A;  1VQK N;  4WQ4 A;  5AQK A;  3TAG A;  1K8K B;  4B8C A;  5BPN A;  4DQS A;  3V1R A;  3HL8 A;  5H1S Q;  4A5A A;  4FWM A;  4IWV A;  5E41 A;  4HTU A;  4LH4 A;  3MX5 A;  3BF1 A;  3M8S A;  3DLH A;  5AQI A;  4MQ3 A;  4CEF A;  4DQQ A;  3D2E B;  3LPU A;  3WEE A;  4K0K K;  1BI4 A;  4IJN A;  2YKM A;  4DSF A;  4M3Z A;  1OH7 A;  5KRT A;  1XMQ K;  2KKZ A;  4CJQ A;  3TPQ A;  3QEV A;  5FPE A;  1VK0 A;  3G25 A;  5AQH A;  4M3Y A;  3THV A;  1NGG A;  4F2S A;  4F3O A;  3AAQ A;  4XH5 A;  4J2B A;  3K9J A;  2D0A A;  1BOT O;  3OYI A;  2E1Z A;  4CW7 B;  1NGF A;  2E20 A;  2G8U A;  2BGG A;  1GLJ O;  3C94 A;  2IGI A;  1YVN A;  3QO9 A;  4FJK A;  1BHL A;  3IKM A;  1HUX A;  3CYM A;  5AQM A;  2CGJ A;  3JAM O;  3MMV A;  2G8H A;  4F8R A;  4FZZ A;  3MWT A;  4B1X B;  1JCF A;  3VQP A;  3O1B A;  4J2E A;  4IJA A;  2YNG A;  4KAZ A;  2E8A A;  1QZ5 A;  1HR0 K;  4JK9 A;  4F3T A;  4WF9 L;  4LFC K;  3RMA A;  2P9S B;  5EOY A;  4U7B A;  3TTC A;  3ULE B;  4AQY K;  3L8B A;  2WTU A;  1N5Y A;  3JYT A;  1ZYQ A;  1VQ8 N;  3BP8 A;  5LMN K;  2F8S A;  1VQN N;  4A2B A;  2VGM A;  2XY8 A;  2OYQ A;  4BRG A;  4B3R K;  5AQY A;  3ZSZ A;  2FBT A;  2UUC K;  3OYH A;  2X6S A;  3DAW A;  3U3G A;  4OKE A;  4WQ5 A;  1QHA A;  3V9W A;  4GMJ B;  2PBD A;  5T7B A;  3HTV A;  4XH4 A;  5D3G A;  4CED A;  4CZM A;  3S3O A;  3KKS A;  2A40 A;  2QTD A;  4UQG A;  4BRL A;  2WOM A;  1DGK N;  2IVP A;  1X9S A;  4BG8 A;  1MWM A;  4WE1 A;  2ZM6 K;  4FVU A;  1RDB A;  2OZM A;  1K6Y A;  4BQL A;  2VWJ A;  3TAB A;  3SPZ A;  2HHU A;  2QW9 A;  2I5J A;  3QIO A;  3OJS A;  3NH1 A;  2PFU A;  2E4L A;  4ILG B;  4OKK A;  3OYF A;  5AQX A;  1U4B A;  3GE1 A;  3ISN C;  3ZET B;  1KVA A;  1EWR A;  2A5X A;  2IAJ A;  3C0B A;  3ZCM A;  3VQE A;  2IC3 A;  1SS6 A;  2FXU A;  4IDH A;  4DTX A;  4CJV A;  2HST A;  3AVM A;  3RWU A;  1RIL A;  1IG9 A;  1S1X A;  3NHG A;  4FJH A;  1RDD A;  4B9M A;  3C6A A;  1JLA A;  4B9N A;  3MWP A;  2ZGZ A;  2QXF A;  4DSE A;  5AQS A;  5HLF A;  1BCO A;  1NJW A;  1WAF A;  3T1H K;  3SMS A;  5BRF A;  1YTU A;  3QIC A;  5M1K A;  2F8T A;  4KRF A;  3FFI A;  4A59 A;  3VEN A;  3CI5 A;  3M3Z A;  2DFH A;  4DUZ K;  3QET A;  4J2A A;  1WSE A;  3R6M A;  3WEE B;  1BI4 B;  4IZ9 A;  2YHX A;  4LF4 K;  1OKJ A;  1Q18 A;  3BUZ B;  1A5W A;  2OPQ A;  1QVG M;  4BRK A;  3AVJ A;  3QBX A;  4BWM A;  4HCC A;  1S1V A;  2P9L A;  2Z1G A;  3E9P A;  4FWL A;  3HJF A;  2YX6 A;  4EAH D;  1TK5 A;  2CGK A;  1QE1 A;  5F2R A;  1KVC A;  3V1O A;  1IG8 A;  2XRI A;  1RDA A;  4RW6 A;  1G99 A;  1YTA A;  1HKB A;  4CF1 A;  5GAD P;  4KO0 A;  1YHQ N;  2O8C A;  3AAP A;  3EY1 A;  1T8E A;  5F0X A;  4FJL A;  5FRN A;  4C8N A;  2HHV A;  3D2F A;  3AVC A;  4QS7 A;  2KHO A;  1S9G A;  4DQI A;  2F4V K;  4E3S A;  3QIP A;  1JJ2 M;  5BPL A;  3U8X A;  4LD0 A;  5KPT A;  2QA4 N;  3HBT A;  3CJ7 A;  3O8M A;  1MDU B;  4ZHR A;  4KI4 A;  1NOZ A;  4NLB A;  3VQB A;  5EY4 A;  4YFU A;  4BVP A;  4EFH A;  3H6E A;  3HOT A;  3LPT A;  4FJM A;  1TAQ A;  2EHG A;  2P1J A;  1N8R O;  1W97 L;  4B9L A;  4OPK A;  4DV5 K;  1NK0 A;  1QVF M;  3TU5 A;  4B3O A;  4FWS A;  3LM2 A;  4KH5 A;  4CCH A;  3DRR A;  1X9M A;  2KW4 A;  4CJR A;  2UXB K;  3OYL A;  3KK2 A;  2P9I A;  1XC3 A;  3IMX A;  4IOA L;  3NF9 A;  4DF8 A;  4AHC A;  4AF1 A;  3SQ4 A;  4DS4 A;  3TSP A;  3FFK B;  3SUQ A;  3WXL A;  3VET A;  4LC9 B;  4CEO A;  4X66 K;  2YHB A;  1X9J A;  1LAV A;  4YNQ A;  1FK9 A;  2KFN A;  2WFB A;  3CM5 A;  5GAG P;  4CHO A;  4C8O A;  3IDH A;  3ZSR A;  3TAN A;  1SUQ A;  5M1N A;  2RE2 A;  4BVO A;  3CCQ N;  3THY A;  3P5J A;  1KC8 O;  2RKI A;  4N41 A;  4CJU A;  4H0X B;  3WNE A;  4KHQ A;  3G0Z A;  1TKZ A;  4CJL A;  4Z4C A;  3CFP A;  3DOK A;  4IBN A;  4PKG A;  1T6D A;  4HHT A;  4HUG A;  2YJE A;  4FK2 A;  1RTH A;  4DR5 K;  4DTP A;  3W0L A;  2NUB A;  1XHX A;  3E01 A;  3VEO A;  2XY6 A;  4M3T A;  3KLI A;  4CZH A;  3KHY A;  5EU7 A;  5KRS A;  2QM1 A;  4AIL C;  4BGA A;  4CJP A;  2VCP A;  5EXW A;  3OYE A;  1Z25 A;  3OBW A;  2A6A A;  4E89 A;  1E4F T;  4DF4 A;  4OLA A;  3P39 A;  3QER A;  4B08 A;  1IV0 A;  1LV5 A;  4B1Y B;  4K25 A;  4OGE A;  4JKF A;  4YDU C;  1KXP A;  1O13 A;  2NLX A;  4E7H A;  4FK4 A;  1S22 A;  4LY7 A;  3TSU A;  3TI0 A;  3GG4 A;  2I7P A;  5AQF A;  5JLH A;  3I55 N;  2QK9 A;  1Z6R A;  1LW0 A;  3VQQ A;  4FM2 A;  5I9E B;  2VQF K;  4H0O A;  3AVB A;  4XEI A;  2NRV A;  3LDP A;  1QS4 A;  4CZG A;  4HTL A;  4FPA A;  3CJ9 A;  4M3W A;  5DK5 A;  4IG3 A;  3L2W A;  2OTJ N;  1GLF O;  5I42 A;  4EP4 A;  3AA3 A;  4IFE A;  1KAX A;  1RT6 A;  2OPR A;  1KD1 O;  5KGX A;  3VPZ A;  4KHY A;  1BGX T;  4CJE A;  1HKG A;  4CFD A;  1RTJ A;  4HWI A;  4OLB A;  4CZF A;  1TL1 A;  2P9L B;  3F9K A;  3VEX A;  1OH6 A;  1HYS A;  1S1U A;  4PY5 A;  3NDK A;  3V9U A;  3SJH A;  4DU4 A;  3OBY A;  4YOV A;  1WBB A;  1NGJ A;  4FK0 A;  2ZD1 A;  4BR2 A;  2X74 A;  2O8C B;  3JSM A;  3M8R A;  4G1Q A;  3P83 D;  3TAF A;  3CIP A;  1OVY A;  3D2F B;  2QWR A;  4DV4 K;  4H4M A;  2YHW A;  1SV5 A;  2GEM A;  1NGC A;  3U3Y A;  3THW A;  3AVN A;  4Z4H A;  1XNR K;  3VA3 A;  1U49 A;  3QFP A;  2Z1H A;  4FWQ A;  3OHR A;  3AY9 A;  4NYF A;  4NCA A;  3A5O C;  3FLC O;  1E3M A;  4CJW A;  4RW8 A;  4FJN A;  4CJ7 A;  1FJG K;  2Q0R A;  3B8A X;  3NE6 A;  1JLG A;  3CXC M;  4PWD A;  3MK6 A;  2A41 A;  1VSF A;  5K14 A;  3LAK A;  4DKW A;  3E9L A;  1CXQ A;  4DG1 A;  4LF8 K;  4OPA A;  3GOI A;  1BUP A;  1W7A A;  1YAG A;  4FWN A;  3HSC A;  2NNW A;  2P9I B;  1R59 O;  3G71 N;  4DTS A;  2O8E B;  4B8A B;  2VWB A;  2IIR A;  3K57 A;  4DV2 K;  1GLD G;  1HYV A;  4JHD B;  2G8V A;  4V19 S;  4DSL A;  3VGM A;  4FJJ A;  5JVG L;  5FLX O;  2DTU A;  5AFU A;  4I2Q A;  4H5T A;  2GBZ A;  1GOB A;  3S9H A;  1HPM A;  3ZT3 A;  1JLE A;  1U47 A;  3PUF A;  3VF4 A;  1TUU A;  4YHH K;  4M41 A;  3I0S A;  4BC4 A;  3THY B;  2ITG A;  1NGE A;  2RF2 A;  3PY8 A;  4FWR A;  2IS3 A;  1DTT A;  4LF5 K;  1VRU A;  2YNH A;  2VG7 A;  1ZBU A;  2PAV A;  1KFS A;  4CFC A;  3QEW A;  4DQ8 A;  3LP1 A;  1C0T A;  2CH6 A;  3SLC A;  2HOE A;  4CBX A;  4JLH A;  4DV6 K;  5FRM A;  2WUS A;  4C8M A;  3V9X A;  1RBT A;  1YI2 N;  4ZTF A;  2ITM A;  4RWT A;  1IJJ A;  4IDK A;  4JS4 A;  1WOQ A;  3O6W A;  2HBL A;  3C65 A;  2IOC A;  5LJW A;  2HW3 A;  4OKJ A;  3O80 A;  4JI1 K;  4E19 A;  1NKB A;  4ID1 A;  2CGL A;  5CR4 A;  4YOW A;  1YT3 A;  4O8U A;  1DT9 A;  5C24 A;  2KQ2 A;  3DI6 A;  4CGJ A;  3L3U A;  5M1Q A;  4JKG A;  5BR9 A;  3OYC A;  1FKO A;  3ASM A;  1X9W A;  3O3H A;  3MAQ A;  3MXM A;  1ASU A;  3RR7 A;  4IKF A;  3VQ7 A;  3DLK A;  3PV8 A;  4FSV A;  5GIN A;  4PA1 A;  4B3M K;  2O4G A;  4KHN A;  1JL1 A;  1G15 A;  4PKH A;  3ZEU A;  3ZSW A;  4BR5 A;  4H4O A;  2Q31 A;  5KPR A;  3H3N O;  4LSL A;  4QAG A;  2BAN A;  1SKW A;  3IRX A;  4C8K A;  4DMN A;  1HMV A;  3K5M A;  1VQ5 N;  3S3N A;  2UYT A;  3VQD A;  2P9U A;  3NCI A;  4JI8 K;  1T6C A;  3MN5 A;  4BC3 A;  4KHP K;  3OS2 A;  2XY5 A;  3AA2 A;  3THW B;  1S1W A;  4DR2 K;  1NG9 A;  4IO9 L;  1BIZ A;  3K5O A;  1BA0 A;  5LJV A;  1O1W A;  1LCU A;  3AO3 A;  3LWM A;  1S3X A;  3LM9 A;  3OYD A;  3HVR A;  1T3V A;  1V4S A;  1WSH A;  2FLO A;  5HRR A;  4YOT A;  4DTU A;  1B9D A;  2Y1J A;  3PIO L;  4BRH A;  2GWJ A;  4JI4 K;  3ZX0 A;  1P90 A;  1BIS A;  3CJC A;  4AHV A;  4O0I A;  4KH6 A;  2GUI A;  1CLQ A;  3GBT A;  4BRF A;  1HX1 A;  2J4R A;  1VSK A;  4X64 K;  1XC9 A;  4FLT A;  1VQ4 N;  5BR8 K;  3R8E A;  3CQX A;  3D6R A;  2HF3 A;  3FR0 A;  2HHT A;  4LFB K;  2NRR A;  1DKG D;  1HJR A;  3C6T A;  3FZF A;  4CHZ A;  3TAR A;  1NK4 A;  2E2O A;  4CEE A;  2E6M A;  3RR8 A;  1QQM A;  3IS9 A;  2PZS A;  1RT3 A;  3CCL N;  4JV5 K;  1KLM A;  2H3G X;  3R9P A;  5DMR A;  1YF5 L;  2YHY A;  3SBT A;  4B1W B;  5C42 A;  3RRH A;  4AHT A;  3DLG A;  4FLX A;  3NAE A;  3LAM A;  4KPY A;  4KI6 A;  4KBO A;  4NB4 A;  4G9Z A;  1S1T A;  3DXK A;  3IAY A;  1U04 A;  2W42 A;  3J7Y P;  3MCA B;  3NGZ A;  2ZJR L;  4CHP A;  4W5R A;  5JS1 A;  1ZXO A;  3O3F A;  4DFJ A;  4RW7 A;  3H1V X;  3K59 A;  3SUN A;  4CFA A;  1LW2 A;  2YHA A;  3THX A;  4BDY A;  4HVJ A;  4M42 A;  1NLV A;  3VEY A;  5JMV A;  4BAC A;  2E5L K;  1C1B A;  2HBK A;  1TYQ B;  4DV7 K;  5AJ3 K;  3MXJ A;  4JKG B;  5HRO A;  1RT2 A;  4RCH A;  4NO7 A;  2R7Y A;  1GLE G;  5AZI A;  4FJG A;  5BN8 A;  4DU1 A;  3AVI A;  4F4K A;  3J8A A;  2YV0 X;  4BR9 A;  3OYB A;  4JRP A;  3HPO A;  1D9F A;  2GX9 A;  2VG5 A;  1K73 O;  1DLO A;  1X3N A;  3SUP A;  2RPI A;  3ZEU B;  3ZSO A;  4H0V B;  4DTO A;  1IKX A;  1NK6 A;  3GL1 A;  3AVL A;  5ADX H;  2E1Y A;  1N33 K;  4BRD A;  1VSM A;  1QSS A;  3L2Q A;  4NYN A;  1BL3 A;  4FLY A;  3H08 A;  3IFR A;  4GNI A;  1NJI O;  1HJO A;  4LH5 A;  3SAG A;  1MA9 B;  3MEG A;  2P9U B;  1SKS A;  3EE8 A;  3K9K A;  1IO2 A;  1VSH A;  4CES A;  2UXC K;  3VQ6 A;  1S6Q A;  3HVT A;  2OCE A;  3WNF A;  3HO1 A;  4EP5 A;  4CIF A;  4F2R A;  3S3M A;  4N56 A;  1S5J A;  3UKR A;  3EZW A;  3VEV A;  3A8Y A;  2VQE K;  4OPH A;  3L6Q A;  1NMN A;  3TTF A;  5FPD A;  1B9F A;  3W3D A;  5FRO A;  4CD1 A;  5F1X A;  1NGA A;  3A5N C;  4DHY A;  4DSI A;  3JXU A;  4M7X A;  3JS6 A;  4Y1C A;  1WLJ A;  3OTO K;  4M45 A;  3ZSX A;  4ID5 A;  5HBM A;  2HHX A;  3LAN A;  5J1E A;  3K5N A;  5EX5 A;  3MN9 A;  1RT5 A;  2ASM A;  4CJ4 A;  1C0F A;  1CZB A;  4OGC A;  4NXN K;  1VSI A;  4CGG A;  1JXB A;  4O5F A;  5CHI A;  3SNN A;  1A5X A;  2UUA K;  3VA0 A;  2A42 A;  3TAP A;  3H45 C;  4ISE A;  5AQL A;  1FXX A;  3L4Q A;  4JKC A;  3LP0 A;  1W0H A;  3KKR A;  4LFA K;  2P9K A;  1J9A A;  2RHK A;  3AA5 X;  3CFO A;  4FL9 A;  5LY3 A;  1TAU A;  5AR0 A;  5AQU A;  3VEZ A;  2FF6 A;  4JAX A;  4JKE A;  2HHW A;  3OS1 A;  3PIP L;  1EX4 A;  3O5B A;  2OA8 A;  3WXK A;  1Q9Y A;  3HZ6 A;  3DXK B;  1ATN A;  5FPM A;  1QSL A;  4GV6 A;  2XY7 A;  4FOE A;  4C23 A;  1TGO A;  2HHS A;  5IWA K;  1VQO N;  3CER A;  4B1Z A;  3DJC A;  3HXM A;  1WB9 A;  3LDL A;  3VQ4 A;  1OH8 A;  3HP9 A;  5LMU K;  3M8Q A;  1Z26 A;  3MEE A;  5FDL A;  3ZSQ A;  1Q8I A;  3PSF A;  1KLN A;  3ZSV A;  3MEC A;  3THX B;  4H0P A;  3LWL A;  1EKE A;  3CCV N;  3CFR A;  4LF6 K;  2NRW A;  3SMP A;  1U45 A;  5E26 A;  1Z05 A;  1E4G T;  3D45 A;  3H1Q A;  4WFA L;  4QS9 A;  1TKX A;  1C1C A;  1WSG A;  4IOX A;  1WSI A;  3QEP A;  3B6O A;  5AZI B;  2AJQ A;  4DTM A;  2IVO A;  2EX3 A;  2Q97 A;  4J2D A;  2ZQB A;  4B1V A;  3IG1 A;  3U6F A;  4JI0 K;  5JIC A;  4X62 K;  3MDQ A;  5BRD A;  1R0A A;  5CY4 A;  3MXI A;  4OO1 J;  3F9M A;  1L3U A;  1L3S A;  4JKD A;  5C0Y A;  3M6G A;  4FW1 A;  4B3S K;  5AQO A;  1KVB A;  1IBK K;  3HP6 A;  3OYG A;  3EKU A;  4DQR A;  1BA1 A;  2HHH K;  5JLF A;  3KTQ A;  3KVG A;  1JLC A;  2QKB A;  5AQJ A;  2W40 A;  3ITH A;  1ASV A;  1RFQ A;  3HM8 A;  1U6Z A;  4CHQ A;  1Q81 O;  4EHT A;  3PSI A;  3KLG A;  3HT3 A;  1RNH A;  2W41 A;  4JD2 A;  1J54 A;  1NJY A;  2Z1J A;  3RTV A;  4CJS A;  5TKY A;  4KFB A;  2ZGY A;  4Z0U A;  3VGK A;  4R79 A;  4H5N A;  1RBV A;  3QFU A;  4YOU A;  4FO0 A;  3SPY A;  3O3G A;  1JL2 A;  1M90 O;  3UKR B;  5AQZ A;  1M1K O;  3UE5 A;  3CF5 L;  3AVG A;  3CJA A;  3ENO A;  1J5O A;  1KAY A;  3J81 O;  2E88 A;  3CCE N;  4PL8 A;  1WNS A;  3HPG A;  1V4T A;  3LZJ A;  4EZ9 A;  4H0Y B;  3J80 O;  2OPP A;  3FE1 A;  3M1F A;  1LWF A;  3TAM A;  1HNV A;  5HRN A;  4DTJ A;  2QKK A;  2P51 A;  1BDG A;  4CGI A;  1XMO K;  5C12 A;  2ZF5 O;  4BWJ A;  1RBU A;  4W5T A;  4AHS A;  4C1N I;  3CCM N;  2DY4 A;  4CIE A;  3CHW A;  4W5Q A;  1RCH A;  3QES A;  3VTH A;  1D8Y A;  3OVN A;  1N34 K;  2ASP A;  4W5N A;  1IKW A; 
#chains in the Genus database with same CATH homology
 1QZ5 A;  3WQU A;  3Q7C A;  4JK9 A;  4QS8 A;  3NVK A;  4J8F A;  4WF9 L;  2P9S B;  5EOY A;  3NMU A;  4U7B A;  3TTC A;  3ULE B;  5TKW A;  3G6E N;  3O9S A;  1VQ8 N;  3PLA A;  4MO4 A;  3BP8 A;  3CJ1 A;  4BRO A;  4BR7 A;  4FSV A;  2GEL A;  5GIN A;  1VQN N;  3O9R A;  5ADX A;  4PKH A;  1GLC G;  4A2B A;  1YJW N;  1EO1 A;  3ZEU A;  2VGM A;  4BR5 A;  3ID8 A;  3UB5 A;  2VYP A;  4BRG A;  3RSE A;  2Q31 A;  2GUP A;  4BRN A;  4E1J A;  1NMD A;  4PHT X;  5KPR A;  3H3N O;  5AQY A;  4CZK A;  3EN9 A;  4Z94 A;  1K9M O;  2YJF A;  1YUW A;  3D7E O;  1J6Z A;  3DAW A;  1VQ5 N;  4WQ5 A;  2UYT A;  3QML A;  3M5R A;  3AGK A;  2P9U A;  5M1P A;  1QHA A;  1T6C A;  4IOC L;  2PBD A;  4BRE A;  3MN5 A;  3P38 A;  4BC3 A;  1CZA N;  3HTV A;  2OTL N;  4XH4 A;  2V52 B;  1KAZ A;  5AQT A;  3F5T A;  4CZM A;  2QWN A;  3A0I X;  2A40 A;  2QWP A;  4IO9 L;  2QTD A;  3HRG A;  1BA0 A;  5LJV A;  4BRL A;  4JHD A;  1DGK N;  1LCU A;  2IVP A;  1S3X A;  4BG8 A;  1MWM A;  3LM9 A;  2E2Q A;  1T3V A;  1V4S A;  2FLO A;  4FVU A;  4YOT A;  1YXQ A;  3PIO L;  4BRH A;  3SBG A;  2GWJ A;  1D4X A;  4BQL A;  1NGB A;  3ZX0 A;  4H5V A;  1P90 A;  1Q7Y O;  3CJC A;  3UKU A;  4GV9 A;  2HMP A;  5AQV A;  1NGD A;  1YIJ N;  2QW9 A;  3S41 A;  3DWL A;  4WCE L;  4KH6 A;  5DM7 L;  3FZH A;  2Q36 A;  2PFU A;  3ENB A;  4ILG B;  5CE3 A;  3H46 O;  2V51 B;  3GBT A;  4WQ4 C;  3U9Z A;  4BRF A;  1HX1 A;  2J4R A;  5AQX A;  3GE1 A;  3ZET B;  2A5X A;  3RVC A;  3BEX A;  3MX2 A;  1ZC6 A;  3C0B A;  1VQ4 N;  3C6H A;  1SS6 A;  3R8E A;  3CQX A;  2FXU A;  2F9W A;  4H03 B;  3D6R A;  2P9N A;  4IDH A;  2HF3 A;  3FR0 A;  3FZM A;  4BQZ A;  2HST A;  3QBW A;  2DPN A;  3ENH A;  2NRR A;  4FOI A;  1DKG D;  3BF3 A;  3FZF A;  3KWI A;  3LDN A;  2IVN A;  4I6M A;  2E2O A;  3CD6 N;  3C6A A;  1VQ6 N;  2FF3 B;  3MWP A;  1QQM A;  2ZGZ A;  1VQL N;  4JKB A;  3CCL N;  4YDU A;  2H3G X;  5AQS A;  3R9P A;  1YF5 L;  2AP1 A;  2YHY A;  3I8B A;  5C2F A;  1K8A O;  2F9T A;  4JD2 B;  3SBT A;  3SMS A;  3QIC A;  4B1W B;  5BRF A;  5M1K A;  2QXL A;  4A59 A;  3ATU A;  3VEN A;  1H1V A;  3CI5 A;  3M3Z A;  5AZJ B;  5C15 A;  3R6M A;  5GIO A;  2P9P A;  4JK7 A;  3WEE B;  5JVH L;  4IZ9 A;  3O9Q A;  2Q1N A;  2YHX A;  2E2N A;  1OKJ A;  1Q18 A;  3BUZ B;  3O9T A;  4KBO A;  3E9O A;  5AQR A;  1QVG M;  1LOT B;  4H5R A;  4BRK A;  2QEX N;  4NB4 A;  3QBX A;  4G9Z A;  2P9L A;  3DXK A;  3E9P A;  3HI0 A;  4FWL A;  3VF6 A;  2YX6 A;  4EAH D;  5GAE P;  3Q7B A;  2CGK A;  1X3M A;  5F2R A;  4WFN L;  2D0O A;  3L0Q A;  3MCA B;  2ZJR L;  3I33 A;  3F2K A;  1IG8 A;  3TTD A;  3P31 A;  4CD3 A;  1ZXO A;  1G99 A;  1HKB A;  5BN9 A;  5GAD P;  1YHQ N;  4BRI A;  3AAP A;  1SAZ A;  3CC4 N;  1BG3 A;  5F0X A;  3H1V X;  2P9K B;  4K43 A;  4YOX A;  2E2P A;  4BGB A;  3D2F A;  4QS7 A;  4BRM A;  2KHO A;  3O9U A;  2F7T A;  1JJ2 M;  1EQY A;  2GWK A;  5BPL A;  3U8X A;  5KPT A;  1NLV A;  5BPM A;  2QA4 N;  3HBT A;  2GTD A;  3CJ7 A;  1MDU B;  2V7Y A;  3O8M A;  3VEY A;  5JMV A;  2HBK A;  4NLB A;  4GY2 B;  1TYQ B;  5EY4 A;  4BVP A;  4BRC A;  2NRT A;  4EFH A;  3SK3 A;  4JKG B;  3H6E A;  3HOS A;  3LDQ A;  4YOR A;  1JCG A;  3HOT A;  4JK8 A;  4NO7 A;  4RCH A;  1N8R O;  2QWM A;  1W97 L;  1GLE G;  5AZI A;  3P4I A;  1VQP N;  5BN8 A;  1VQ9 N;  1QVF M;  3TU5 A;  5BRH A;  4FWS A;  3LM2 A;  3J8A A;  4KH5 A;  1MWK A;  4BR9 A;  2GX9 A;  4KH4 A;  3KWG A;  1QQO A;  4C1N K;  1K73 O;  1NM1 A;  1X3N A;  2WBN A;  2P9I A;  2ASO A;  1XC3 A;  4IXC A;  4WQ5 C;  4FPB A;  4BR4 A;  3IMX A;  3ZEU B;  4IOA L;  1ILY A;  4H0V B;  1ZBS A;  4NLC A;  5HOO A;  4JKA A;  3E1Y A;  3RSE B;  3GL1 A;  4AF1 A;  4BC5 A;  4BRP A;  5ADX H;  3TSP A;  3CCS N;  2HF4 A;  1WUA A;  2E1Y A;  3FFK B;  1Y64 A;  3WXL A;  3VET A;  4LC9 B;  4BRD A;  4A2A A;  3ZX2 A;  3FGU A;  3CC7 N;  3FZK A;  1X9J A;  4CBU A;  4JN4 A;  2V7Z A;  3AAR A;  3IFR A;  4F9O A;  4GNI A;  5AQN A;  2WFB A;  1HJO A;  2D0P A;  1NJI O;  3VMF B;  5GAG P;  1K8K A;  3VES A;  3SAG A;  1MA9 B;  2VGN A;  4K42 A;  4A5B A;  2P9U B;  3IDH A;  3O4W A;  5M1N A;  3EE8 A;  3A5M C;  2RE2 A;  4BVO A;  1RGI A;  3N4P A;  4M63 C;  3ZX3 A;  4CZL A;  3CCQ N;  1KC8 O;  3K9K A;  4XH1 A;  2Q2R A;  3ZET A;  4H0X B;  4A62 A;  1U2V A;  3D2E A;  5AQW A;  3CCR N;  4CBW A;  4PKG A;  1T6D A;  2YJE A;  5FPN A;  2KLA A;  4MLH A;  3W0L A;  3VEO A;  3UKR A;  3EZW A;  5GIP A;  1DEJ A;  3VEV A;  3A8Y A;  4OPH A;  4CZH A;  3KHY A;  3L6Q A;  2YCH A;  3VTI A;  4IEI A;  2QM1 A;  3TTF A;  5FPD A;  3W3D A;  3DXM A;  4CD1 A;  3CJB A;  5F1X A;  1NGA A;  4FWP A;  5AQG A;  3A5N C;  4BGA A;  4PKI A;  2VCP A;  4DHY A;  1BO5 O;  3JXU A;  5EXW A;  4M7X A;  3DLL L;  3JS6 A;  3NVM A;  5B8H A;  3O1W A;  1VQ7 N;  3UKU B;  3CMA N;  3U4L A;  4ISF A;  3E66 A;  3OBW A;  3WXI A;  2A6A A;  3CPE A;  1QQN A;  1E4F T;  1XUP O;  3P39 A;  3LL3 A;  5EX5 A;  3MN9 A;  4B1Y B;  4K25 A;  2NRX A;  4JKF A;  2ASM A;  4MO5 A;  2YI1 A;  4YDU C;  1KXP A;  1NWK A;  1O13 A;  3CQY A;  2NLX A;  3LDO A;  4FWK A;  3SAH A;  1S22 A;  1C0F A;  4M7Y A;  3WQT A;  2P9N B;  3J7Z O;  1Q86 O;  3TSU A;  3GG4 A;  2I7P A;  3CC2 N;  5AQF A;  2NZT A;  5JLH A;  4O5F A;  3I55 N;  4PL7 A;  4L3Q A;  1Z6R A;  4I6M B;  4H0T B;  2NRH A;  5I9E B;  4H0O A;  5DM6 L;  5CHI A;  2BUP A;  4XEI A;  1QZ6 A;  2QI2 A;  1BU6 O;  1NBW A;  2NRV A;  2QWQ A;  3C7N A;  2A42 A;  2JWK A;  3LDP A;  3H45 C;  4ISE A;  5AQL A;  4GVE A;  4CZG A;  3L4Q A;  4HTL A;  4JKC A;  1YIT N;  4FPA A;  3CJ9 A;  5KPZ A;  1NGH A;  2P9K A;  2RHK A;  2P9S A;  2OTJ N;  1GLF O;  1W2B M;  4YOY A;  2D1K A;  5M1F A;  4FL9 A;  5LY3 A;  3ULE A;  3KK7 A;  4IFE A;  1HKC A;  5C10 A;  1GLA G;  5AR0 A;  1KAX A;  1NGI A;  5AQU A;  3VEZ A;  2P9P B;  2JWL A;  3EL2 A;  2FF6 A;  3ATV A;  4JAX A;  4BRA A;  5C2D A;  4ILH A;  4JKE A;  2FSJ A;  3VPZ A;  1KD1 O;  3GDQ A;  5AQP A;  2NRZ A;  1HKG A;  5ELZ A;  3PIP L;  1BWF O;  3O5B A;  4HWI A;  3WXK A;  3VER A;  4B1U B;  4Y0W A;  4RTF D;  4CI6 A;  4CZF A;  3HZ6 A;  4A57 A;  2P9L B;  3DXK B;  3AGR A;  1SZ2 A;  2Q0U A;  1ATN A;  4O8K A;  5FPM A;  3VGL A;  3VEX A;  1TYQ A;  3CET A;  3WUH A;  3R3L A;  3T7Z A;  4GV6 A;  1RDW X;  4FOE A;  4C23 A;  4EHU A;  3EE9 A;  3SJH A;  5E84 A;  3CER A;  5AQQ A;  4B1Z A;  1VQO N;  1KQS M;  3DJC A;  4BG9 A;  4MDA A;  3LDL A;  3OBY A;  4YOV A;  4H5W A;  1ATR A;  4FWO A;  1NGJ A;  4K41 A;  4JEP A;  4BR2 A;  3CME N;  4DCH A;  3R1X A;  1HLU A;  3KZB A;  1ATS A;  3ZYY X;  4U67 L;  2CH5 A;  2FSK A;  3CIP A;  1YJ9 N;  1OVY A;  3D2F B;  2QWR A;  3U9D A;  4H0P A;  4EIA A;  4ISG A;  5GAH P;  2YHW A;  3CCV N;  1VQM N;  2GEM A;  1NGC A;  2NRW A;  3ID6 A;  3SMP A;  3TSQ A;  4CZJ A;  5E26 A;  1Z05 A;  1P8Z A;  1E4G T;  1XQS C;  2EWS A;  2OAN A;  3QFP A;  3H1Q A;  5M1O A;  4WFA L;  1VAZ A;  4QS9 A;  4FWQ A;  4B9Q A;  3OHR A;  3CPW M;  3AY9 A;  3L4I A;  4AM7 A;  3A5O C;  3FLC O;  4CZI A;  4IOX A;  4MDB A;  4IEE A;  4CJ7 A;  2Q0R A;  3B8A X;  4IO8 A;  4ILJ A;  3VEW A;  4MLE A;  5AZI B;  1TUY A;  3CXC M;  2HBM A;  3G4S N;  3MK6 A;  1Q82 O;  2A41 A;  2IVO A;  4DKW A;  3I56 N;  3E9L A;  2Q97 A;  2FSN A;  4B1V A;  3FZL A;  4WYB A;  5EVZ A;  3MN7 A;  5JIC A;  3MDQ A;  5BRD A;  4OPA A;  3GOI A;  1BUP A;  2QWO A;  1JCE A;  4OO1 J;  1YAG A;  3F9M A;  3HSC A;  4FWN A;  2NNW A;  1GLL O;  2P9I B;  1R59 O;  3G71 N;  1YJN N;  5BRE A;  4JKD A;  5C0Y A;  3M6G A;  2QWL A;  2VWB A;  5HL7 L;  3CCJ N;  5AQO A;  3MCP A;  4BY9 C;  2IIR A;  2ZJQ L;  1RDU A;  3EKU A;  1GLD G;  2A3Z A;  4JHD B;  1BA1 A;  4DB3 A;  3N4Q A;  4BR0 A;  5JLF A;  4BRQ A;  3VGM A;  3MN6 A;  5JVG L;  3KVG A;  5AFU A;  2BH1 A;  5AQJ A;  4WQ4 A;  4H5T A;  5AQK A;  1VQK N;  2W40 A;  1HPM A;  1K8K B;  2D4W A;  5BPN A;  1RFQ A;  3HM8 A;  1U6Z A;  3VF4 A;  3IUC A;  4JKH A;  1TUU A;  4A5A A;  3OA9 A;  5H1S Q;  1Q81 O;  4FWM A;  4EHT A;  3VOV A;  2HBJ A;  2WC9 A;  4BC4 A;  4IWV A;  3VF2 A;  4CZE A;  1S72 N;  1NGE A;  3MX5 A;  3BF1 A;  2W41 A;  4JD2 A;  4BC2 A;  4JNE A;  4FWR A;  4GV3 A;  4WFB L;  5AQI A;  5AZJ A;  3O08 A;  1U2V B;  5TKY A;  2ZGY A;  3VGK A;  3D2E B;  4R79 A;  4H5N A;  3WEE A;  4IJN A;  3QFU A;  2PAV A;  3H3O B;  4YOU A;  3WXJ A;  4FO0 A;  5MLC Q;  1GLB G;  1M90 O;  4DQ8 A;  3UKR B;  2AA4 A;  2KKZ A;  5AQZ A;  1M1K O;  3UE5 A;  3TPQ A;  2CH6 A;  3SLC A;  2HOE A;  4AM6 A;  4CBX A;  3CF5 L;  5FPE A;  3DXM B;  3G25 A;  3CJA A;  5AQH A;  3ENO A;  1KAY A;  2BTF A;  5AFU H;  2WUS A;  2E88 A;  1NGG A;  3CCE N;  1YI2 N;  3AAQ A;  4PL8 A;  3QDK A;  4XH5 A;  3OW2 M;  1T44 A;  3K9J A;  1V4T A;  2ITM A;  4H0Y B;  4RWT A;  1ESV A;  1BOT O;  3EO3 A;  3FE1 A;  1IJJ A;  2E1Z A;  1NGF A;  3M1F A;  2E20 A;  1GLJ O;  1WOQ A;  2ZJP L;  1C0G A;  1SQK A;  3O6W A;  1BDG A;  5C12 A;  3WT0 A;  2HBL A;  2ZF5 O;  3C65 A;  1YVN A;  5LJW A;  3QB0 A;  4A61 A;  4C1N I;  5KQ8 A;  3CCM N;  3O80 A;  3WXM B;  3IKM A;  1HUX A;  5AQM A;  2CGL A;  5CR4 A;  2CGJ A;  4YOW A;  3MMV A;  4O8U A;  1DT9 A;  3CHW A;  2I7N A;  3MWT A;  4B1X B;  3A5L C;  1JCF A;  3SAF A;  4UY8 O;  5KQD A;  3T69 A;  3O1B A;  3EKS A;  3CCU N;  3VTH A;  4IJA A;  2ZWH A;  5M1Q A;  3C7N B;  4JKG A;  2ASP A;  5BR9 A;  2E8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...