3CETA

Crystal structure of the pantheonate kinase-like protein q6m145 at the resolution 1.8 a. northeast structural genomics consortium target mrr63
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
300
Chain Sequence
MILGIDIGNTKITELHENGEFKVHHLVSHVALVTTAETKKEGVDNILNAAESAFGSNISVFDSNGNFISLESAKTNNMKVSASNWCGTAKWVSKNIEENCILVDMGSTTTDIIPIVEGKVVAEKTDLERLMNHELLYVGTLRTPISHLGNTISFKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVAEKYGSKKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSFAVAELLKNELLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the pantheonate kinase-like protein Q6M145 at the resolution 1.8 A. Northeast Structural Genomics Consortium target MrR63.
rcsb
source organism Methanococcus maripaludis s2
molecule tags Structural genomics, unknown function
molecule keywords Conserved archaeal protein
total genus 97
structure length 300
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01968 Hydantoinase_A Hydantoinase/oxoprolinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cetA01
3.30.420.190 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 conserved archaeal protein q6m145 3cetA02
3LM9A 1GLEG 4H0YB 4K41A 4ISGA 1X3NA 4CZIA 3CJBA 3FGUA 5F1XA 2IIRA 5LJWA 3A5OC 2IVOA 3I33A 5E26A 4A2BA 2A41A 3FR0A 4FWQA 1QZ5A 3D2EB 4H0OA 1Z05A 1TUYA 1IJJA 4FOIA 4ISEA 1OKJA 3DAWA 3DXKB 1BDGA 1TUUA 1GLLO 1HUXA 4CD1A 4B1YB 3O4WA 3DXMB 4JD2A 2E88A 5AQZA 3R6MA 3VEVA 4BC4A 5KQDA 3JXUA 4FWNA 3A5LC 3KZBA 3RSEB 3W3DA 1GLFO 2J4RA 2PAVA 5JMVA 3H1VX 1Y64A 3QBXA 2QM1A 3HI0A 2QXLA 3M1FA 3WXJA 4BRLA 1SZ2A 4BRDA 5EVZA 1RGIA 3CJ7A 3R9PA 1ATSA 1QQOA 4EHTA 3U4LA 4MLEA 3VEZA 5BN8A 2A5XA 3CJ1A 4BG8A 4DQ8A 2HOEA 3VGLA 2QWMA 1XC3A 2GTDA 2W40A 5BPLA 1QHAA 2YHXA 1RFQA 1BU6O 1T6CA 4FOEA 5ADXH 1MWMA 2CGLA 2FSJA 5F2RA 2P9LA 5AQLA 1R59O 3FZLA 1MDUB 1DKGD 2FXUA 3UB5A 3W0LA 3MN6A 1NLVA 1Z6RA 2I7PA 4CZFA 3EKSA 4H5RA 1V4SA 3M6GA 3SMPA 4HTLA 3IUCA 4PKHA 5AQPA 3C0BA 4IWVA 2ZF5O 3WT0A 4B1WB 4BR9A 2YI1A 1HKGA 1NGAA 4HWIA 3VEYA 1HKCA 3B8AX 4FWKA 1U2VA 2NZTA 3WQTA 1YXQA 2GEMA 2DPNA 4PKGA 4B1ZA 4GY2B 3UKRA 3HZ6A 4JAXA 5BREA 4BQLA 4IZ9A 3TPQA 1LOTB 2FF3B 4QS8A 2P9IB 1U6ZA 4H0TB 4GNIA 3SK3A 4MO5A 4BR4A 5BPMA 3O6WA 3A0IX 4BC5A 5AQOA 4CJ7A 4FWSA 1GLAG 1HLUA 1KAYA 1NGDA 5AZJA 4AM7A 5CE3A 5AQVA 3L0QA 4BC3A 4BQZA 2D1KA 2ZWHA 4CD3A 4WQ5C 1KAZA 5I9EB 1G99A 1WUAA 4A62A 1TYQA 4FO0A 2FSNA 4BC2A 5LY3A 3A8YA 3GOIA 5AQGA 2E1ZA 3L6QA 3ULEA 1NM1A 1V4TA 2ASMA 3AARA 4FWMA 4XEIA 5JLHA 3D2FA 3J8AA 3MK6A 4K42A 1WOQA 1BA1A 4Y0WA 1ZXOA 2YHWA 2CH5A 4M7YA 2P9KA 3MCPA 3P4IA 2IVNA 3VESA 1NGEA 3D2EA 3KHYA 1BWFO 4IXCA 5TKYA 4H5TA 2NRHA 3DJCA 3VENA 2FLOA 2GWJA 3FLCO 3VOVA 4EHUA 2HF3A 3ENHA 3DXMA 4JD2B 4QS7A 3WEEB 2V51B 1T6DA 2P9PA 3HSCA 1KAXA 5AQNA 3ID8A 4MO4A 3WXIA 3AAPA 1NGJA 2CGJA 4JNEA 1U2VB 4L3QA 1BUPA 3VF4A 3ZETA 4CZKA 2YJFA 2NLXA 4F9OA 4WYBA 2D4WA 1ESVA 5AZIB 1NGGA 1NWKA 3ZX3A 3VPZA 1XQSC 3FE1A 1YVNA 3ZX2A 4CZHA 3BUZB 4BREA 1H1VA 4H5VA 3WUHA 3AAQA 2ASPA 3A5NC 4MLHA 2P9LB 3QBWA 1BO5O 3H1QA 1EQYA 4NB4A 4WQ4C 4RTFD 4H03B 1JCGA 2CGKA 5FPMA 3MDQA 5AQMA 3UE5A 4JHDB 2YHYA 3GBTA 1Q18A 2D0PA 2AA4A 4Z94A 4IJAA 5EX5A 5ADXA 4A2AA 1HPMA 1X9JA 3C7NA 4J8FA 2QWQA 2Q0UA 3CHWA 2F9WA 1GLDG 3LDOA 4RCHA 3CJAA 4IJNA 3ZEUB 2A42A 4AM6A 5LJVA 4B1XB 4DCHA 3SJHA 4BROA 3LDPA 4EAHD 4BG9A 4CI6A 3FZFA 4XH5A 2E8AA 3VGKA 5AQWA 3WQUA 3CQXA 3S41A 3D7EO 1XUPO 3HTVA 2E20A 3UKUB 3FZMA 4BR2A 2P9UB 3U8XA 3UKRB 3G25A 2GELA 2Q1NA 1E4FT 2P9KB 5BPNA 1T44A 5B8HA 5JICA 3FFKB 4O8KA 3L4IA 4XH1A 3TU5A 4FL9A 3A5MC 5EOYA 2P9IA 4CBXA 3D2FB 4CBUA 5AZIA 1BA0A 2AP1A 2E1YA 4BRFA 4WQ4A 3KVGA 3GDQA 3MN5A 3O1WA 3EN9A 3DXKA 5AQXA 4BVPA 1QQNA 2E2PA 2FF6A 5AQFA 4A61A 4BRCA 3UKUA 5AQSA 1LCUA 2Q31A 4IO8A 3BP8A 1NMDA 2D0OA 2P9SB 3VGMA 4BRPA 5FPNA 5FPEA 2Q97A 4BRKA 4FSVA 3WEEA 1RDWX 1BOTO 1NGBA 2H3GX 2ZGYA 2V7ZA 4K25A 2W41A 4KBOA 4BRIA 4BR5A 5BRDA 4FWRA 3WXKA 2HMPA 1HKBA 2E2QA 2QWLA 2QW9A 3F9MA 1QZ6A 5AFUH 4CZGA 3SLCA 4DHYA 3GL1A 3VF2A 3O80A 3M3ZA 4BGAA 2KHOA 4QS9A 2V7YA 2GUPA 2BTFA 2CH6A 3I8BA 4C23A 2YJEA 3FZHA 1CZAN 2VWBA 1S22A 4CBWA 4M7XA 3HBTA 1JCEA 5AQKA 2BUPA 2FSKA 1X3MA 2ZGZA 4CZLA 3H3OB 5BRHA 2ASOA 4M63C 2PBDA 3VETA 2A40A 3BF1A 3H3NO 1GLJO 3IFRA 3C7NB 3CI5A 1J6ZA 4BR7A 4FPAA 1C0GA 2P9SA 3VERA 3EO3A 3H45C 5FPDA 1NGFA 3LDLA 4CZJA 5AQRA 5BR9A 3EKUA 1D4XA 1NGIA 4BRNA 2QWNA 5KPZA 3VEWA 2Q36A 3OHRA 3CJ9A 3CIPA 2IVPA 1QQMA 3ZEUA 4JHDA 5JLFA 2I7NA 1HJOA 2Q2RA 4YDUC 4H0XB 1MA9B 5F0XA 1JCFA 4E1JA 5E84A 3SMSA 1GLCG 5KPTA 2V52B 4H5NA 3EZWA 3WXLA 4BRQA 3CJCA 3O08A 4BRMA 2F9TA 4B9QA 3IDHA 5AR0A 1C0FA 3AY9A 3ENOA 3ZETB 2GWKA 3EL2A 5EY4A 3O1BA 1K8KB 1YAGA 3QICA 3ATUA 4H0PA 3CERA 2QWPA 1NGHA 4BRHA 1ATRA 4K43A 1IG8A 2P9PB 1DEJA 1YUWA 4FWLA 1ZC6A 2ITMA 2HF4A 4PKIA 3HM8A 5KPRA 2VCPA 2EWSA 3LL3A 5BRFA 4BR0A 3ATVA 3QFUA 5EXWA 5BN9A 1NBWA 4BRAA 3LDNA 4EIAA 3RSEA 4PL7A 2YCHA 5AQTA 3O5BA 4WQ5A 3MN9A 4FWPA 1S3XA 1BG3A 4I6MB 2Q0RA 2QWOA 4LC9B 4YDUA 4O5FA 3QMLA 4XH4A 3ULEB 2A6AA 3H6EA 4FWOA 2WUSA 5AQIA 4B1UB 5AFUA 2E2NA 4H5WA 5AQJA 4BRGA 2P9NB 1NGCA 5AQUA 3BF3A 1TYQB 1SAZA 4JN4A 1GLBG 4FPBA 4NO7A 5ELZA 3MMVA 3GG4A 3JS6A 1KXPA 3GE1A 1DGKN 1SQKA 1HX1A 2P9NA 4CZMA 1ZBSA 3IMXA 5AQHA 2OANA 3LM2A 2A3ZA 4H0VB 4PL8A 3QB0A 4CZEA 1P8ZA 4EFHA 4RWTA 5AZJB 5AQYA 3U9ZA 3U9DA 3ZX0A 3CQYA 4ISFA 3VF6A 5KQ8A 3MN7A 3H46O 3VEXA 3O8MA 3FZKA 3BEXA 2P9UA 2UYTA 3LDQA 3CETA 3QFPA 1K8KA 1ATNA 1MWKA 5AQQA 3QDKA 3VEOA 4B1VA 4DB3A 2E2OA 2VYPA 2QWRA 4BGBA 3DWLA 4I6MA 3R8EA 4BVOA 1E4GT
chains in the Genus database with same CATH superfamily
1UOCA 1TL1A 4H0YB 4O55A 4JK8A 3CJBA 3A5OC 4E19A 3I33A 4A2BA 3JAMO 2A41A 4CF8A 2DTUA 1Z05A 4G1QA 3ZT3A 1VQ6N 1IJJA 1VSEA 1BDGA 4IOXA 1TAUA 3OYEA 2G8IA 2E88A 4K8XA 3R6MA 3VEVA 3NE6A 3ID6A 4FWNA 1NJIO 3A5LC 3CPEA 3W3DA 2J4RA 2PAVA 1XMQK 5M1KA 3H1VX 4EZ9A 4I7FA 4FJGA 3QBXA 1F21A 4M3TA 4JV5K 3SQ1A 3I55N 1RGIA 3RR8A 3R9PA 4CHOA 1QQOA 1S1WA 2GX9A 3U4LA 4EHTA 4MLEA 2A5XA 4FJ9A 3CJ1A 2WOMA 4DTSA 1RBVA 3AO1A 1RT2A 4X62K 4JRPA 4X66K 4FJ7A 4JI1K 2QK9A 2YHXA 1RFQA 1T6CA 4NLBA 2CGLA 3PIPL 1SUQA 3UB5A 3IS9A 5GAHP 1FXXA 1OH6A 1Z6RA 3CPWM 4CZFA 3NF8A 3O9RA 3EKSA 1KFSA 2HHHK 4KH4A 4OPAA 2O8CB 4BR9A 4B1WB 2YI1A 2B4JA 4HWIA 4ELVA 3THXB 4CJPA 4CHNA 3Q7CA 1IKWA 1RBTA 4K8ZA 5HRNA 1Q8IA 4FYDA 4GY2B 1XHZA 3TAPA 4LSLA 4ICLA 5BREA 2IGIA 4IZ9A 3VQ4A 1LOTB 4BQLA 1IBKK 1ZBIA 2ZE2A 4QS8A 2P9IB 4OLBA 3TAEA 1YJWN 4CVNE 3KJVA 5KI6A 4BR4A 1L3UA 1CLQA 5AQOA 3KK1A 3MWTA 3NGYA 4R79A 1NU0A 4NXMK 4AM7A 4OKEA 2ZWHA 4LF7K 1WUAA 4YFUA 4A62A 1TYQA 1C1BA 2W6LA 2E1ZA 2O4IA 3ULEA 1V4TA 3D2FA 3J8AA 3MK6A 1WSFA 4DU4A 4Z4EA 2HNYA 3V9SA 3RVCA 3O4NA 3MCPA 2IVNA 4H5TA 3NBPA 1VQ4N 2KFNA 3ENBA 2E6LA 3FLCO 1YHQN 4EHUA 3ZSXA 4IFEA 1XC9A 1KAXA 2ATQA 4V19S 4DR6K 3WXIA 3AAPA 3VF4A 4CZKA 1QQCA 5C24A 3D45A 3C6UA 2D4WA 1EKEA 5JS2A 1C6VA 1NWKA 1XQSC 2NRRA 5IT9O 4BREA 3WUHA 1VSLA 3AAQA 4ZTJA 3QBWA 4ZTFA 5DM7L 3RRGA 4KHYA 1BO5O 4DUYK 3V9UA 4FJLA 5A2QO 5J1EA 5FRMA 1JCGA 2KQ2A 3MDQA 4KHQA 3TARA 2JGUA 3RMBA 5CY4A 4RW7A 4KTQA 1Q18A 3IAYA 5HRSA 4IEEA 3CCRN 5GAGP 1WAFA 3VQPA 4HUEA 1HPMA 1VSDA 1X9JA 4FK0A 3DI6A 4AQYK 2F9WA 4RCHA 1QVGM 4CJTA 3EYZA 1RCHA 3OYGA 4LF9K 4AM6A 5LJVA 1CZBA 4DQPA 1N8RO 3LDPA 4TSXA 3ITHA 1REVA 3AVNA 2OTLN 5LMNK 2OPPA 4BG9A 4CI6A 4GKJK 4GV9A 3KKRA 2WBNA 4NYNA 4FW1A 3CFOA 4RW4A 1M1KO 3ZT2A 1Q86O 1HYZA 3S41A 1RT7A 4FJNA 2E20A 3KWGA 2YKMA 4DTRA 4JI4K 4GV6A 3U8XA 4I2QA 3UKRB 1WSJA 4JI5K 2GELA 2RKIA 3SAGA 4O8UA 5BPNA 4M41A 2HB5A 3MWPA 3CFPA 4N41A 3L4IA 3CQ8A 1CZ9A 3VQCA 4JEPA 2D0BA 4XIUA 4DV4K 3CM5A 2PZSA 1I39A 4CJRA 4BRFA 4O5BA 4WQ4A 1B9FA 4BVPA 3OJSA 2E2PA 3DRPA 5AQFA 1WSGA 1N33K 4CK3A 4IO8A 3NH1A 5J2MA 4FK2A 3IRXA 4OGEA 1X1PA 5M1OA 1BCOA 3AO2A 5HRPA 3DM2A 2HNDA 4BRPA 1WB9A 3LWLA 3PY8A 3AGKA 2Q97A 1WNSA 1BQMA 2D5RA 3IG1A 1BOTO 1NK6A 3MXMA 3O3FA 4BRIA 1LWFA 2E2QA 2XY7A 1B92A 1QZ6A 5AFUH 3FFIA 3CMEN 4DHYA 4DLGA 4J2AA 3VF2A 3OTOK 1VQMN 4N56A 1IV0A 4YNQA 2GUPA 1XHXA 4CBWA 4CEQA 5AQKA 1C1AA 1YVUA 4NYFA 4B3MK 4CZLA 5BRHA 2ASOA 2B5JA 1C1CA 3OW2M 3VETA 2HHUA 4B8AB 3ZSRA 1ZBUA 3CG7A 4LH5A 4FJMA 4I2PA 4E89A 4FLWA 1C0GA 1WAJA 2NRVA 2W6KA 2P9SA 1HJRA 4NCAA 1RDUA 3OYBA 1NGIA 4OGCA 3VEWA 3SQ4A 4JKBA 1VQPN 3PLAA 3CCUN 1YTUA 3OS0A 1NKEA 4H0XB 5F0XA 1JCFA 3SMSA 4I9LA 3P38A 5KPTA 2PYLA 3DYAA 1RT3A 3IDHA 3PIOL 3E9PA 1WSHA 4FVUA 3VN5A 3SZ2A 1K8KB 3L2VA 2NRZA 3QICA 3HVRA 3CERA 3V9WA 3PSIA 4DR2K 3SI6A 4M3XA 3HM8A 2EWSA 4WFNL 4B9TA 4BR0A 1S9GA 5BN9A 4JK7A 2IC3A 3MXIA 3LDNA 1EO1A 1S72N 4PL7A 1U45A 5AQTA 3O5BA 4WQ5A 4FWPA 2D0CA 1BG3A 4G9ZA 1TKTA 2FBVA 1HNIA 4FWOA 3G6EN 4HCCA 2X6NA 4CGHA 5AQJA 1QSYA 1DLOA 4RW9A 3ZYYX 1GLBG 4FPBA 5C2DA 1NK7A 4DV5K 1KXPA 3GE1A 4CE9A 3AVHA 1KLMA 1HX1A 4CZMA 3VQQA 3HOSA 1KSPA 5AQHA 3HP6A 3QIPA 4PL8A 1YIJN 4HHTA 4DU3A 5HROA 1SL2A 3NMUA 3U9DA 2ZQBA 4ISFA 4IEIA 3H46O 2UXBK 3O8MA 3SUPA 3RTVA 4KHWA 3QFPA 1ZBHA 3QDKA 2E2OA 1ASVA 3M8PA 5I3UA 2VYPA 2QWRA 3AVIA 4BGBA 4Q5VA 4JI7K 3QIOA 2OZMA 4I6MA 3BY5A 2WONA 2F7TA 4KH6A 3PSFA 3PX0A 4K41A 3T1HK 4ISGA 1X3NA 4CZIA 3SCXA 4C8OA 5F1XA 4BDYA 5LJWA 2XHBA 3WNFA 4JRQA 5E26A 3SQ0A 1S5JA 1A5VA 4FJXA 4FWQA 4Z0UA 4CEDA 1Q9XA 3TAFA 3TTFA 1TUYA 5HL7L 3DLKA 5CYQA 4W5OA 3CFRA 1HUXA 1DTTA 3RMDA 4CFBA 3TABA 2O8FB 4BWMA 2HHWA 5KQDA 2HHXA 3SPZA 3KZBA 1K6YA 4CJKA 1GLFO 4AHRA 3U3YA 1S6PA 4JI8K 3A2FA 1Y64A 4UQGA 2YX6A 2QM1A 4CIGA 1T3VA 1SZ2A 2YV0X 1BI4B 3CJ7A 3R3LA 3HPOA 2P51A 2HHQA 1QVFM 2AJQA 4C8KA 4E0DA 3CCQN 3CCVN 2HOEA 4JKAA 4HUFA 1GOAA 2OPRA 2QTDA 3AA4A 1XWLA 1QHAA 3AVCA 4ELTA 3AVJA 1BU6O 3WNHA 4FOEA 1MWMA 3VTHA 1R59O 2EX3A 4CF2A 3W0LA 4ELUA 1EX4A 1D9FA 2GUIA 1T7PA 1RDBA 2BGGA 3MAQA 1HNWK 4CJWA 3CCEN 5HBMA 2IDOA 3SMPA 3M6GA 4JI3K 4HTLA 3IUCA 1TKXA 2DFHA 1TVRA 3C95A 2Z1IA 3TSUA 1S1XA 1HKCA 4DTPA 4CF9A 2VWJA 3WQTA 3LZJA 3DLRA 4DSLA 4LFCK 1YT3A 1HQEA 4IKFA 3HZ6A 3TPQA 4JKEA 3J7AP 1TKDA 3PO5A 3SK3A 5K14A 3SQ2A 1B9DA 4EP4A 3OYKA 1GOCA 3CMAN 3S9HA 3O6WA 4LF4K 4OPKA 3D6RA 3CD6N 1UWBA 1Z26A 4FLZA 4FWSA 1KAYA 1JLAA 1S1VA 1ZBFA 5CE3A 1IKYA 4BC3A 4FCYA 4FXDA 4WQ5C 1R0AA 1KAZA 1W97L 5CHIA 4FO0A 2Y1IA 3OA9A 3A8YA 3GOIA 5AQGA 3SPYA 5C15A 4BACA 3AARA 4FWMA 1KVCA 3MEDA 4DSKA 4K42A 1WOQA 2QA4N 4Y0WA 1ZXOA 2VWKA 2CH5A 2YHWA 3OVNA 2UUAK 1K73O 1BWFO 3CC4N 1YJNN 2NRHA 2NRTA 3VENA 4LFBK 4DV2K 4QAGA 2GWJA 2BH1A 3VOVA 2HF3A 3HOTA 3ENHA 4JD2B 4QS7A 2V51B 1T6DA 3VQEA 1VSJA 1D9DA 1NGJA 4L3QA 2NLXA 4F9OA 3O9UA 4OKJA 2GV9A 1N36K 1NGGA 4B3OA 1KVAA 2FC0A 4B9UA 1I3AA 3VPZA 1YVNA 3FE1A 3QERA 3HRGA 1N5YA 3NCIA 1H1VA 5SZTA 4YOUA 3I8DA 1EP4A 4Z4FA 4C8MA 2VG5A 3WNEA 2XY6A 3Q7BA 3H1QA 4MDAA 2HHVA 1EQYA 4RTFD 2CGKA 5FPMA 4AHSA 3WNGA 4B9SA 5D3GA 3ZT0A 3C65A 3T1AA 2AA4A 4Z94A 4CGJA 1HRHA 2X74A 4CIFA 1D5AA 3C7NA 3RMCA 3BZKA 4J8FA 1CXUA 2IAJA 3V9XA 3LZIA 1WSIA 4DFKA 3TSPA 4YHHK 4IJNA 4CEOA 4CJVA 3VA3A 1J5EK 3OYNA 1Q81O 4EAHD 3G0ZA 2HVIA 1A5XA 3OY9A 4E7HA 3VGKA 5AQWA 3SBTA 3CQXA 4YOWA 1QSSA 4AHVA 3G4SN 3BGRA 3KLGA 4DTUA 3AVFA 4EZ6A 2PYJA 3FZMA 4BR2A 2ZJPL 3CCMN 1NK8A 2W42A 3G25A 3BZCA 2Q1NA 3AVGA 5B8HA 3CYMA 4O8KA 3OJUA 4DTXA 4XH1A 3TU5A 4FJ5A 5C0YA 2P9IA 3V6DA 2HHSA 1RBSA 3D2FB 5GADP 2WC9A 3HSTB 1K9MO 2F8TA 3VQAA 1VHXA 4AILC 3GDQA 4OPJA 3KIOA 2NUBA 1JLFA 4DQRA 2FF6A 4M3WA 2Q31A 1X9SA 3NF9A 5LL6Z 4OJRA 4OVLA 3TAQA 3RMAA 2P9SB 1LV5A 4KTZA 4W5QA 1J54A 5FPEA 1YI2N 4BRKA 3WEEA 1JLQA 1NGBA 2H3GX 2ZGYA 4K0KK 3E66A 4KBOA 4LSNA 1C0TA 1BL3A 4M3ZA 4M45A 4LD0A 4BR5A 3ZSOA 1FJGK 4AH9A 4CECA 3DLBA 3M3ZA 4FJHA 3NFAA 3E01A 4QS9A 2V7YA 3P39A 4MQ3A 2BTFA 3P83D 4C23A 4ILHA 1UAXA 2YJEA 3LP1A 1S22A 4M7XA 1HYVA 2G8UA 2BUPA 4KO0A 5HRRA 1JL2A 2PBDA 4QOZB 1U4BA 3BF1A 3H3NO 3T69A 3O9SA 4PHTX 1J6ZA 4FPAA 2PY5A 4IBNA 1T8EA 3VERA 3NGZA 4O0JA 5FPDA 3LDLA 5BR9A 2RHKA 2WFBA 2QWNA 4AHTA 1NG9A 3CJ9A 2BDPA 1U49A 1QQMA 3ZEUA 3F9KA 4JHDA 2OA8A 2I7NA 1LW2A 1OH5A 1P90A 4CGDA 2OPQA 3DMJA 4HVJA 4IDHA 5E84A 4FK4A 1GLCG 4KB0A 1RTHA 4BRQA 3P5JA 3CJCA 3O08A 1ZYQA 4B9QA 1VQON 4IOAL 5AR0A 1C0FA 3AY9A 3ENOA 3L2RA 2GWKA 3MCAB 5KRTA 1YAGA 1W2BM 3ATUA 4H0PA 2HBLA 2QWPA 4BRHA 1ATRA 1L5UA 4DQIA 2JWKA 1IG8A 1HNXK 4FWLA 1YUWA 4WFBL 2F96A 2RPIA 1HQUA 2HF4A 4PKIA 4O4GA 4CJFA 1JLGA 1Z25A 5EXWA 3OYIA 3THWB 1NBWA 4CGGA 4BRAA 3VQ7A 4CJ4A 4EIAA 4CFAA 2G8FA 2KTQA 2Y1JA 3RSEA 4CF0A 3I0RA 1IKXA 4DR4K 3HPHA 4LC9B 4O5FA 3QEWA 3QMLA 5CZ2A 3OS2A 4XH4A 4FM1A 2E5LK 2WUSA 1RTDA 4EP5A 5H1SQ 4H5WA 1S1TA 3HK2A 4YOXA 4OO1J 4BRGA 1RNHA 3T19A 4FLXA 1TYQB 4NO7A 3KTQA 3GG4A 4UY8O 1FW6A 1EWRA 4IG0A 5T7BA 2OANA 2R7YA 4KH5A 3K5MA 1P8ZA 4Z4HA 3CXCM 2P5GA 2O8BA 1WLJA 3ZX0A 4Z4GA 4W5TA 1MU2A 4CFDA 4YORA 3B6PA 4KHNA 1Y97A 1QTMA 2FBXA 4CGFA 1EXQA 4AF1A 4B1VA 2DFFA 5GAEP 3DWLA 1SV5A 1HNZK 2KFZA 1TAQA 3ALYA 4BVOA 5KRSA 4BDZA 3EE8A 1FKOA 4CEFA 1RTIA 3L2UA 4DR5K 1IBLK 5E41A 4FZYA 3TAGA 3ZSYA 4CGIA 3FR0A 4E1NA 2O8DA 3DOKA 2KW4A 4H0OA 1ASUA 3S3OA 3DXKB 1TUUA 3TANA 1GLLO 1C0MA 1IH7A 4CD1A 2F4VK 3O4WA 4JD2A 5AQZA 3EY1A 3JXUA 1L3SA 3PO4A 1VSKA 2FBYA 1RT5A 3OYFA 2KZZA 1IKVA 4CIEA 5C2FA 3HI0A 3VQ5A 4BRLA 5I42A 4CJ5A 3CC7N 1ATSA 2UXDK 4JKHA 1VQ5N 3AV9A 5BN8A 4F8RA 1SKRA 4HCBA 4DQ8A 4R5PA 3M8SA 3THWA 3VGLA 1OH7A 2QWMA 1WBDA 2P1JA 1LAWA 3LP3A 3QNOA 2W40A 1J9AA 4DSFA 4CEBA 5ADXH 5F2RA 3FZLA 1MDUB 2FXUA 5M1NA 4DMNA 3ZT4A 4PKHA 5AQPA 1KLNA 2ZF5O 3WT0A 3KLEA 3VMFB 1HYSA 4J2EA 5J2NA 1HKGA 1NGAA 3VEYA 4FWKA 1U2VA 4O0IA 2NZTA 1TL3A 1LWCA 4DU1A 1YXQA 5FROA 5FRNA 2OYQA 4IDKA 2DPNA 3V1QA 4GKKK 4PKGA 4B1ZA 3LP2A 3UKRA 2YNGA 1FK9A 3O3GA 3ASMA 2FF3B 1SKWA 4Z4IA 4H0TB 3SNNA 4MO5A 4BWJA 3AVLA 4F3TA 4BC5A 3CM6A 3NAEA 4KAZA 2YHBA 1HLUA 1NGDA 5AZJA 5KGWA 2IS3A 3OBWA 3DLGA 5AQVA 3DLLL 3I56N 2Z1GA 1KCFA 3AA5X 4BQZA 5I9EB 2NRXA 1G99A 5J2PA 1O1WA 4DS5A 3JYTA 4BC2A 5LY3A 5SWMA 3OYJA 1ILYA 4FZZA 5BR8K 1NM1A 4XEIA 3HJFA 5JLHA 4CEAA 1BA1A 4M7YA 1UA0A 2P9KA 4W5RA 3P4IA 2O8FA 1TV6A 3VESA 1NGEA 5TKYA 3L4QA 3DJCA 1VQLN 1JKHA 4N47A 2O4GA 2ETJA 4PUOA 3DXMA 4PA1A 3WEEB 2OPSA 3MEGA 4KB1A 4KHUA 4JKFA 5AQNA 3LDSA 5GINA 3ID8A 4MDBA 4DFPA 1U2VB 3ZETA 3WXMB 1Q9YA 4WYBA 4KHSA 4CHYA 1NJWA 3BDPA 3U3GA 3ZX3A 4CZHA 3ZX2A 3EE9A 3LALA 4H5VA 2ZJRL 1YF5L 4C1NK 5CYMA 4NB4A 2YKNA 3KD1E 3VQDA 3SUQA 4JYAK 2YHYA 1BIZA 3E9OA 3P31A 3TAMA 1NJYA 2D0PA 3L8BA 4B9NA 5J2QA 4IJAA 4DR1K 5EX5A 2YNFA 5ADXA 3LPUA 1HNVA 4A2AA 1Q7YO 4B9LA 2Q0UA 3CHWA 1GLDG 1YITN 4PY5A 1NKBA 3CJAA 1RT1A 3AVAA 3ZEUB 5GIOA 2A42A 2Q3SA 1HMVA 4B1XB 4DCHA 4CCHA 4Y1CA 4FLUA 5DMRA 3FZFA 2E8AA 3WQUA 4C8LA 3QO9A 3DOLA 1XUPO 3SBGA 3HTVA 3UKUB 1QS4A 5CR4A 3K57A 2KZMA 3C6HA 5HLFA 3T7ZA 1E4FT 1HR0K 1T44A 1RT6A 4JS5A 1XI1A 4DKWA 2BANA 4DV3K 1SKSA 1EETA 3A5MC 4CBXA 4FJ8A 5DK5A 4A57A 5AZIA 1BA0A 2AP1A 2E1YA 3OS1A 4M3YA 3KVGA 4FLVA 3T3FA 1U47A 3O1WA 3DXKA 5AQXA 4IFVA 5CZ1A 3O4QA 3DRSA 2YHAA 3K5NA 4BRCA 1KFDA 3ZT1A 3UKUA 5AQSA 1LCUA 4NXNK 1BCMA 3VQ6A 2E4LA 4CESA 4X65K 4BDPA 1WN7A 1RBRA 2D0OA 1KTQA 3SAHA 5FPNA 2O8BB 4F2SA 3TTDA 4HUGA 1N6QA 1X9WA 1G15A 1RDWX 4B9MA 3T1YK 2V7ZA 2W41A 1CXQA 1TK8A 5BRDA 3O3HA 4E7KA 4FWRA 2QI2A 3WXKA 1HKBA 3CCSN 2QWLA 2QW9A 4C8NA 4CZGA 3SLCA 4JI6K 1NJZA 2OZSA 3O80A 1RDAA 4OKKA 2KHOA 1SS6A 3AVBA 1T03A 3PUFA 2CH6A 4CJSA 4KV8A 1VAZA 1A5WA 3FZHA 1CZAN 5JVGL 2VWBA 3TR8A 4MFBA 3HBTA 1LAVA 2OCEA 3J81O 2ZGZA 4DUZK 4DTOA 4LY7A 3AO4A 4X64K 4CJUA 1TK0A 4DR7K 2ZD1A 4LF6K 4CK2A 4B8CA 3C7NB 4CJLA 4BR7A 1LW0A 5M1PA 4DS4A 5EU7A 4A5AA 2IOCA 1NGFA 4U7BA 4CZJA 3J7YP 3KK2A 3EKUA 3MECA 4NLCA 1BISA 1JXEA 3O9QA 3NVMA 3CIPA 3TSQA 4CK1A 5JLFA 1JLBA 1X9MA 3LANA 1HJOA 4CHQA 3KK3A 4ID5A 2QEXN 4E1JA 4FLTA 1U04A 2VG6A 4B08A 4DTNA 3EZWA 3HO1A 3WXLA 4KI4A 4BRMA 2F9TA 3QLHA 1VQ9N 1NK5A 4DSJA 1W9HA 3ZETB 3NGIA 2ZJQL 3O1BA 4FZXC 3MX2A 4CJ3A 1NGHA 4FM2A 2ITGA 4ILJA 1VSHA 1RBUA 4ZHRA 2P9PB 1RILA 3O9TA 2ITMA 5KPRA 2VCPA 4NCGA 4KKOA 3G71N 4DF8A 2B6AA 5BRFA 4W5NA 3NHGA 4FW2A 3ATVA 3QFUA 3QESA 4YY3K 1RDDA 5AJ3K 1EWQA 2FBTA 3MN9A 4I6MB 1S3XA 2HSTA 2Q0RA 4JI2K 3AO3A 4DG1A 4WF9L 2E6MA 3ULEB 3H6EA 3LPTA 4GMJB 3VTIA 4N5SA 3J7ZO 4OX9K 1VK0A 4B1UB 2ZM6K 2E2NA 2NNWA 2QXFA 4U67L 3TWHA 5AQUA 3BF3A 4E7LA 4JN4A 4DQSA 2XO7A 3MMVA 4NCBA 2OTJN 1SQKA 2XY8A 2P9NA 3J80O 2QKKA 2G8KA 4CW7B 3LM2A 2A3ZA 4H0VB 3AA2A 3QB0A 4CZEA 4EFHA 5AZJB 5AQYA 2O8CA 1BI4A 3CQYA 4CEEA 5KQ8A 1XMOK 3MN7A 2UUBK 1VRUA 2Z1JA 3NDKA 4LFAK 3VEXA 3R1XA 4DSIA 3FZKA 1NK0A 3KD5E 4DV0K 2HBKA 4FM0A 3CETA 1K8KA 1MWKA 4WFAL 3VEOA 4DB3A 3JSMA 1ASWA 4Z4CA 3P1GA 3SJJA 1OVQA 3ULDA 4IOCL 3EEQA 3LM9A 1GLEG 3ZSVA 4KI6A 4GW6A 4DTJA 2EHGA 4F2RA 5C25A 2HBMA 3FGUA 2IIRA 2XRIA 5KGXA 2IVOA 5JS1A 1KRPA 2PFUA 1OH8A 3L3VA 1QZ5A 3D2EB 2A1RA 4O44A 3D0PA 1VSMA 4FOIA 4B3SK 4ISEA 1OKJA 2Z1HA 3DAWA 4B1YB 3DXMB 2VGMA 4BC4A 2O8EB 3RSEB 3LAMA 3PV8A 3VQBA 5JMVA 2P5OA 4BE0A 1NK9A 2HMIA 4FVMA 2KKZA 3M1FA 2QXLA 3K9KA 3WXJA 3SV4A 2G8HA 4BRDA 5EVZA 3M5RA 3MX5A 3VQ8A 4KTWA 3VEZA 3QEPA 4BG8A 1XNRK 3L2QA 1JL1A 2RN2A 1XC3A 3AA3A 2GTDA 5BPLA 4IO9L 1N34K 3KWIA 3ZCMA 3F73A 3HYFA 3CCLN 3N4QA 1OVYA 2UXCK 2FSJA 2P9LA 5AQLA 3LWMA 1DKGD 3H08A 3MN6A 4YOTA 1DT9A 1NLVA 1O13A 4PWDA 2I7PA 1KVBA 2X78A 3KLHA 3V1RA 4H5RA 1V4SA 3MXJA 3B6OA 1SL1A 3M8QA 3C0BA 4IWVA 3THYB 2HBJA 1KQSM 3B8AX 3TI0A 2G8VA 4F3OA 2GEMA 3VA0A 3DLHA 4JAXA 4JLHA 3DLEA 4KREA 1U6ZA 4JKGA 1VQ8N 1KC8O 3C6TA 4GNIA 3OYLA 3SUOA 1IG9A 1RTJA 2A1SA 2UU9K 4A5BA 5BPMA 3KLFA 1VSFA 3G10A 4I9QA 3A0IX 3AVKA 4BE1A 3VQ9A 4CJ7A 3DRRA 3K9JA 1GLAG 3L0QA 1GOBA 1DTQA 2D1KA 4CD3A 3CF5L 1SL0A 1S1UA 4E3SA 4GVEA 4AHUA 2FSNA 3QEVA 3HP9A 3N4PA 2XY5A 3L6QA 1VQ7N 2ASMA 5C12A 1NJXA 1XNQK 1S6QA 3D2EA 3KHYA 4IXCA 2UUCK 4YOYA 1QE1A 2FLOA 3SYZA 1RT4A 3I0SA 4DFJA 4DTMA 2O8EA 2P9PA 3HSCA 4BY9C 1VSIA 3E1YA 4MO4A 1VQKN 2CGJA 4JNEA 1BUPA 4E1MA 3SV3A 2YJFA 4WCEL 4LF5K 2DFEA 3SAFA 1ESVA 4DQQA 5AZIB 2G8WA 1J5OA 3BUZB 1WBBA 4YOVA 4MLHA 2ASPA 3A5NC 5GIPA 2P9LB 1NOYA 1FKPA 2NRWA 4IFYA 4CJQA 1J53A 4WQ4C 4FJIA 4H03B 4JKCA 4JK9A 3EZ5A 2YNHA 5M1FA 3K59A 5LMUK 5AQMA 3MEEA 3UE5A 4JHDB 3GBTA 3ZLJA 3HT3A 4M3RA 1IBMK 3SUNA 2HVHA 3CC2N 4JKDA 4FLYA 4DWIA 4CERA 3QINA 2QWQA 2BE2A 2YNIA 3LDOA 4M3UA 2LSNA 3HL8A 2GBZA 4M42A 4GVMA 2I5JA 3SJHA 1BHLA 4BROA 5TKWA 4XH5A 3RR7A 3K58A 3S3NA 1VRTA 4H4OA 1U48A 3D7EO 4PQUA 2VQEK 1M90O 3V9ZA 5FDLA 2P9UB 2JWLA 1Q82O 2HNZA 4KFBA 5C10A 3AGRA 3IKMA 1TK5A 1K8AO 2P9KB 5JICA 4QCLA 3FFKB 4L8RB 3OYHA 4FL9A 5EOYA 2JLEA 4CBUA 4CHZA 4DV7K 2VQFK 3MN5A 3EN9A 4RW8A 1QQNA 5DM6L 3PX6A 4A61A 3K0SA 1TGOA 5M1QA 3V1OA 4Q0BA 4ID1A 3OYDA 1T05A 3AVMA 3TTCA 1BGXT 3RRHA 3BP8A 1NMDA 4F4KA 3NH0A 4C1NI 3L2WA 2VG7A 3VGMA 4A59A 3NVKA 3THYA 3ZSWA 4E7JA 4IG3A 1NNEA 3ISNC 4FSVA 3HXMA 3K5OA 1HPZA 4KPYA 4RW6A 3OYCA 1NK4A 3L3UA 4K25A 3M8RA 4DR3K 4B3RK 4KRFA 2HMPA 1BQNA 3NF6A 3F9MA 4DFMA 2KLAA 3GL1A 3KK7A 1JLEA 1S9EA 3THXA 4BGAA 3U6FA 1VQNN 1JJ2M 3CCJN 3I8BA 2HW3A 4H8KA 3RWUA 4B9VA 1YJ9N 1JCEA 4JS4A 2FSKA 5C42A 1X3MA 4HTUA 4DLEA 3H3OB 2VGNA 2RF2A 1YTAA 4M63C 1N32K 3K2PA 2HHTA 2A40A 2X6SA 1GLJO 3IFRA 2O8DB 1L3VA 3CI5A 4WE1A 4LH4A 4RG8A 4FJKA 1NKCA 5HOOA 3EO3A 3H45C 3ZSQA 5AQRA 4J2BA 1D4XA 4BRNA 1JLCA 3ZSZA 4ILGB 5KPZA 4CJEA 2F8SA 2Q36A 3F2KA 3OHRA 2IVPA 4CEZA 5MLCQ 1IO2A 4B3TK 1NOZA 2Q2RA 4YDUC 1D8YA 1MA9B 3E9LA 3NH2A 2V52B 1W0HA 4H5NA 3QNNA 5HP1A 1QHTA 1JXBA 4H4MA 1ZBLA 4N76A 3HPGA 3EL2A 5EY4A 3NF7A 3V4IA 4K43A 2D0AA 3OBYA 1I94K 3THVA 4CF1A 3K5LA 1DEJA 3V81A 1ZC6A 4OPHA 3S3MA 3PX4A 3C94A 3LL3A 4LF8K 4OLAA 2WTUA 4DV1K 3KKSA 3HM9A 3LP0A 5JVHL 1L3TA 1ITGA 5FLXO 2YCHA 3QEXA 4YDUA 2QWOA 4DV6K 3OYAA 2A6AA 4JI0K 5AQIA 1QSLA 4FJJA 1BIUA 5AFUA 3F5TA 1RDCA 4E7IA 2P9NB 1NGCA 3QETA 1KD1O 1UA1A 1SAZA 4AHCA 3KLIA 5ELZA 3C6AA 3QEIA 4CFCA 1WSEA 1W7AA 4KHPK 3JS6A 1DGKN 3AO5A 1C0UA 4DF4A 1ZBSA 3IMXA 3UIQA 2RE2A 4RWTA 3U9ZA 4CHPA 3VF6A 2DY4A 3HVTA 4JKGB 4BE2A 4DSEA 3BEXA 1E3MA 2P9UA 2UYTA 1NMNA 3LDQA 1LWEA 1ATNA 5AQQA 4J2DA 5KTQA 3OYMA 2QKBA 1TKZA 4GV3A 3R8EA 4Y1DA 5IWAK 1E4GT 3LAKA
chains in the Genus database with same CATH topology
4IOCL 3LM9A 1GLEG 4H0YB 4K41A 4ISGA 1X3NA 4CZIA 4JK8A 2HBMA 3CJBA 3FGUA 5F1XA 2IIRA 5LJWA 3A5OC 2IVOA 3I33A 5E26A 4A2BA 2A41A 3FR0A 2PFUA 4FWQA 1QZ5A 3D2EB 4H0OA 3TTFA 1Z05A 1TUYA 1VQ6N 1IJJA 4FOIA 5HL7L 4ISEA 1OKJA 3DAWA 3DXKB 1BDGA 4IOXA 1TUUA 1GLLO 1HUXA 4CD1A 4B1YB 3O4WA 3DXMB 2VGMA 2E88A 4JD2A 3R6MA 5AQZA 3VEVA 4BC4A 5KQDA 3ID6A 3JXUA 4FWNA 1NJIO 3A5LC 3KZBA 3CPEA 3RSEB 3W3DA 1GLFO 2J4RA 2PAVA 5JMVA 3H1VX 5M1KA 1Y64A 3QBXA 2YX6A 2QM1A 5C2FA 2KKZA 1T3VA 3HI0A 2QXLA 3K9KA 3M1FA 3WXJA 4BRLA 1SZ2A 4BRDA 5EVZA 3M5RA 1RGIA 3I55N 3CJ7A 3MX5A 1ATSA 1QQOA 3R3LA 3R9PA 3CC7N 4JKHA 1VQ5N 2GX9A 4EHTA 3U4LA 1QVFM 4MLEA 3VEZA 5BN8A 2A5XA 3CJ1A 4BG8A 3CCQN 4DQ8A 3CCVN 2HOEA 4JKAA 3VGLA 2QWMA 1XC3A 2QTDA 2GTDA 2W40A 5BPLA 4IO9L 1QHAA 2YHXA 3KWIA 1RFQA 1BU6O 1T6CA 3CCLN 3N4QA 4FOEA 5ADXH 1MWMA 1OVYA 2CGLA 4NLBA 3VTHA 2FSJA 5F2RA 3PIPL 2P9LA 5AQLA 1R59O 3FZLA 1MDUB 1DKGD 2FXUA 3UB5A 3W0LA 3MN6A 4YOTA 5M1NA 5GAHP 1DT9A 1NLVA 1O13A 1Z6RA 2I7PA 3CPWM 3CCEN 4CZFA 3O9RA 3EKSA 4H5RA 1V4SA 3M6GA 3SMPA 4HTLA 3IUCA 4PKHA 5AQPA 3C0BA 4IWVA 4KH4A 4OPAA 2ZF5O 3WT0A 3VMFB 4B1WB 4BR9A 2YI1A 3TSUA 1HKGA 1NGAA 2HBJA 4HWIA 3VEYA 1HKCA 1KQSM 3B8AX 4FWKA 1U2VA 2NZTA 3WQTA 1YXQA 2GEMA 3Q7CA 2DPNA 4PKGA 4B1ZA 4GY2B 3UKRA 3HZ6A 4JAXA 5BREA 4BQLA 4IZ9A 3TPQA 1LOTB 4JKEA 2FF3B 4QS8A 2P9IB 1U6ZA 4H0TB 4JKGA 1VQ8N 1KC8O 4GNIA 3SK3A 1YJWN 4MO5A 4A5BA 4BR4A 5BPMA 3CMAN 3O6WA 3A0IX 4BC5A 5AQOA 3D6RA 3CD6N 3MWTA 4CJ7A 3K9JA 4FWSA 1GLAG 4R79A 1HLUA 1KAYA 1NGDA 5AZJA 3OBWA 4AM7A 5CE3A 5AQVA 3DLLL 3L0QA 4BC3A 3I56N 4BQZA 2D1KA 2ZWHA 4CD3A 4WQ5C 1KAZA 3CF5L 5I9EB 2NRXA 1G99A 1W97L 1WUAA 4A62A 1TYQA 5CHIA 4FO0A 3OA9A 4GVEA 2FSNA 4BC2A 5LY3A 3A8YA 3GOIA 5AQGA 2E1ZA 1ILYA 3N4PA 3L6QA 3ULEA 1VQ7N 5C15A 1NM1A 1V4TA 2ASMA 3AARA 4FWMA 4XEIA 5JLHA 3D2FA 3J8AA 3MK6A 5C12A 4K42A 1WOQA 2QA4N 1BA1A 4Y0WA 1ZXOA 2YHWA 2CH5A 4M7YA 3RVCA 2P9KA 3MCPA 3P4IA 2IVNA 3VESA 1NGEA 3D2EA 3KHYA 1BWFO 4IXCA 3L4QA 4H5TA 5TKYA 2NRHA 2NRTA 3DJCA 3VENA 4YOYA 2FLOA 3CC4N 1YJNN 1VQ4N 1VQLN 3ENBA 2GWJA 2BH1A 3FLCO 3VOVA 4EHUA 2HF3A 1YHQN 4IFEA 3HOTA 3ENHA 3DXMA 4JD2B 4QS7A 3WEEB 2V51B 1T6DA 4JKFA 2P9PA 3HSCA 4BY9C 1KAXA 5AQNA 5GINA 3ID8A 3E1YA 4MO4A 4MDBA 3WXIA 1VQKN 3AAPA 1NGJA 2CGJA 4JNEA 1U2VB 4L3QA 1BUPA 3VF4A 3ZETA 4CZKA 2YJFA 2NLXA 3WXMB 4WCEL 4F9OA 3O9UA 4WYBA 3SAFA 2D4WA 1ESVA 5AZIB 1NGGA 1NWKA 3ZX3A 3VPZA 1XQSC 1YVNA 2NRRA 3FE1A 3ZX2A 3HRGA 3BUZB 4BREA 1H1VA 3EE9A 4H5VA 4CZHA 3WUHA 4YOUA 4YOVA 3AAQA 2ASPA 3A5NC 4MLHA 5GIPA 2ZJRL 2P9LB 1YF5L 3QBWA 5DM7L 2NRWA 3Q7BA 1BO5O 3H1QA 4MDAA 4C1NK 1EQYA 4NB4A 4WQ4C 4RTFD 4H03B 1JCGA 4JKCA 2CGKA 5FPMA 4JK9A 3MDQA 5M1FA 5AQMA 3UE5A 4JHDB 2YHYA 3E9OA 3GBTA 1Q18A 3C65A 3P31A 2D0PA 4IEEA 2AA4A 3CCRN 4Z94A 4IJAA 5GAGP 5EX5A 5ADXA 4A2AA 3CC2N 1HPMA 1X9JA 3C7NA 4JKDA 1Q7YO 4J8FA 2QWQA 2Q0UA 3CHWA 2F9WA 1GLDG 3LDOA 4RCHA 3TSPA 1YITN 1QVGM 3CJAA 4IJNA 3ZEUB 5GIOA 2A42A 4AM6A 5LJVA 4B1XB 4DCHA 3SJHA 1N8RO 4BROA 3LDPA 1Q81O 4EAHD 2OTLN 5TKWA 4BG9A 4CI6A 3FZFA 4XH5A 4GV9A 2WBNA 2E8AA 3VGKA 5AQWA 3WQUA 3SBTA 3CQXA 4YOWA 1M1KO 3G4SN 1Q86O 3S41A 3D7EO 1XUPO 3SBGA 3HTVA 2E20A 1M90O 3KWGA 3UKUB 3FZMA 4BR2A 2ZJPL 4GV6A 2P9UB 5CR4A 3U8XA 2JWLA 3UKRB 3CCMN 1Q82O 5C10A 3G25A 3AGRA 2GELA 3C6HA 3IKMA 1K8AO 3T7ZA 2Q1NA 4O8UA 1E4FT 2P9KB 5BPNA 3SAGA 1T44A 5B8HA 5JICA 3MWPA 4DKWA 3FFKB 4O8KA 3L4IA 4XH1A 3TU5A 5C0YA 4JEPA 4FL9A 3A5MC 5EOYA 2P9IA 4CBXA 3D2FB 4A57A 4CBUA 5GADP 2WC9A 1BA0A 5AZIA 1K9MO 2AP1A 2E1YA 4BRFA 4WQ4A 3KVGA 3GDQA 3MN5A 3O1WA 3EN9A 3DXKA 5AQXA 4BVPA 1QQNA 2E2PA 5DM6L 2FF6A 5AQFA 4A61A 4BRCA 5M1QA 3UKUA 5AQSA 1LCUA 2Q31A 4IO8A 3TTCA 3BP8A 1NMDA 4C1NI 2D0OA 5M1OA 2P9SB 3VGMA 4A59A 4BRPA 3NVKA 3SAHA 5FPNA 5FPEA 3AGKA 2Q97A 3TTDA 1YI2N 4BRKA 4FSVA 3WEEA 1RDWX 1BOTO 1NGBA 2H3GX 2ZGYA 2V7ZA 4K25A 2W41A 3E66A 4KBOA 4BRIA 4BR5A 5BRDA 4FWRA 2QI2A 3WXKA 2HMPA 1HKBA 2E2QA 3CCSN 1K73O 2QWLA 2QW9A 3F9MA 1QZ6A 5AFUH 4CZGA 3SLCA 2KLAA 3CMEN 4DHYA 3GL1A 3KK7A 3VF2A 1VQMN 3O80A 3M3ZA 4BGAA 2KHOA 1SS6A 1VQNN 4QS9A 2V7YA 2GUPA 3P39A 3CCJN 1JJ2M 2BTFA 2CH6A 3I8BA 4C23A 4ILHA 1VAZA 2YJEA 3FZHA 1CZAN 5JVGL 2VWBA 1YJ9N 1S22A 4CBWA 4M7XA 3HBTA 1JCEA 5AQKA 2BUPA 2FSKA 1X3MA 2ZGZA 4CZLA 3H3OB 5BRHA 2VGNA 2ASOA 4M63C 3OW2M 2PBDA 3VETA 2A40A 3BF1A 3H3NO 1GLJO 3IFRA 3C7NB 3CI5A 3T69A 3O9SA 4PHTX 1J6ZA 4BR7A 5M1PA 4FPAA 1C0GA 2NRVA 4A5AA 5HOOA 2P9SA 3VERA 3EO3A 3H45C 5FPDA 1NGFA 3LDLA 4CZJA 4U7BA 5AQRA 5BR9A 3EKUA 2RHKA 4NLCA 1RDUA 1D4XA 1NGIA 3O9QA 4BRNA 2WFBA 2QWNA 4ILGB 5KPZA 3VEWA 3NVMA 2Q36A 4JKBA 3F2KA 3OHRA 3CJ9A 3CIPA 2IVPA 3TSQA 1VQPN 1QQMA 3ZEUA 4JHDA 5JLFA 5MLCQ 3PLAA 2I7NA 3CCUN 1P90A 1HJOA 2Q2RA 4YDUC 4H0XB 1MA9B 3E9LA 5F0XA 2QEXN 1JCFA 4E1JA 4IDHA 5E84A 3SMSA 1GLCG 3P38A 2V52B 4H5NA 5KPTA 3EZWA 3WXLA 4BRQA 3CJCA 3O08A 4BRMA 2F9TA 4B9QA 1VQON 1VQ9N 3IDHA 4IOAL 5AR0A 3PIOL 1C0FA 3AY9A 3E9PA 3ENOA 4FVUA 3ZETB 2ZJQL 2GWKA 3EL2A 3MCAB 5EY4A 3O1BA 1K8KB 1YAGA 1W2BM 2NRZA 3QICA 3ATUA 4H0PA 3MX2A 2HBLA 3CERA 2QWPA 1NGHA 4BRHA 1ATRA 4K43A 3OBYA 4ILJA 2JWKA 1IG8A 2P9PB 1DEJA 1YUWA 4FWLA 1ZC6A 3O9TA 4OPHA 2ITMA 2HF4A 4PKIA 3HM8A 5KPRA 2VCPA 4WFBL 2EWSA 3G71N 4WFNL 3LL3A 5BRFA 4BR0A 3ATVA 3QFUA 5EXWA 5BN9A 1NBWA 4JK7A 4BRAA 3LDNA 5JVHL 4EIAA 3RSEA 1S72N 4PL7A 1EO1A 2YCHA 5AQTA 3O5BA 4WQ5A 3MN9A 4FWPA 1S3XA 1BG3A 2HSTA 2Q0RA 2QWOA 4I6MB 4LC9B 4O5FA 4YDUA 4G9ZA 3QMLA 4WF9L 4XH4A 3ULEB 2A6AA 3H6EA 3J7ZO 4FWOA 3VTIA 2WUSA 5AQIA 4B1UB 5AFUA 3G6EN 5H1SQ 3F5TA 2E2NA 2NNWA 4H5WA 5AQJA 4U67L 4YOXA 4OO1J 4BRGA 2P9NB 1NGCA 1KD1O 5AQUA 3BF3A 1TYQB 1SAZA 4JN4A 1GLBG 4FPBA 4NO7A 3ZYYX 5C2DA 5ELZA 3C6AA 3MMVA 3GG4A 4UY8O 3JS6A 1KXPA 3GE1A 1DGKN 2OTJN 1SQKA 1HX1A 2P9NA 4CZMA 1ZBSA 3IMXA 5AQHA 3HOSA 2RE2A 2OANA 3LM2A 2A3ZA 4H0VB 4KH5A 4PL8A 3QB0A 4CZEA 1P8ZA 3CXCM 1YIJN 4EFHA 4RWTA 5AZJB 5AQYA 3U9ZA 3NMUA 3U9DA 3ZX0A 3CQYA 4ISFA 3VF6A 4JKGB 5KQ8A 4YORA 3MN7A 3H46O 4IEIA 3VEXA 3O8MA 3R1XA 3FZKA 3BEXA 2P9UA 2UYTA 2HBKA 3LDQA 3CETA 3QFPA 1K8KA 1ATNA 1MWKA 5AQQA 3QDKA 4WFAL 3VEOA 4AF1A 4B1VA 4DB3A 2E2OA 2VYPA 2QWRA 4BGBA 5GAEP 3DWLA 4GV3A 4I6MA 3R8EA 4BVOA 1E4GT 3EE8A 2F7TA 4KH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LM9 A;  1GLE G;  4H0Y B;  4K41 A;  4ISG A;  1X3N A;  4CZI A;  3CJB A;  3FGU A;  5F1X A;  2IIR A;  5LJW A;  3A5O C;  2IVO A;  3I33 A;  5E26 A;  4A2B A;  2A41 A;  3FR0 A;  4FWQ A;  1QZ5 A;  3D2E B;  4H0O A;  1Z05 A;  1TUY A;  1IJJ A;  4FOI A;  4ISE A;  1OKJ A;  3DAW A;  3DXK B;  1BDG A;  1TUU A;  1GLL O;  1HUX A;  4CD1 A;  4B1Y B;  3O4W A;  3DXM B;  4JD2 A;  2E88 A;  5AQZ A;  3R6M A;  3VEV A;  4BC4 A;  5KQD A;  3JXU A;  4FWN A;  3A5L C;  3KZB A;  3RSE B;  3W3D A;  1GLF O;  2J4R A;  2PAV A;  5JMV A;  3H1V X;  1Y64 A;  3QBX A;  2QM1 A;  3HI0 A;  2QXL A;  3M1F A;  3WXJ A;  4BRL A;  1SZ2 A;  4BRD A;  5EVZ A;  1RGI A;  3CJ7 A;  3R9P A;  1ATS A;  1QQO A;  4EHT A;  3U4L A;  4MLE A;  3VEZ A;  5BN8 A;  2A5X A;  3CJ1 A;  4BG8 A;  4DQ8 A;  2HOE A;  3VGL A;  2QWM A;  1XC3 A;  2GTD A;  2W40 A;  5BPL A;  1QHA A;  2YHX A;  1RFQ A;  1BU6 O;  1T6C A;  4FOE A;  5ADX H;  1MWM A;  2CGL A;  2FSJ A;  5F2R A;  2P9L A;  5AQL A;  1R59 O;  3FZL A;  1MDU B;  1DKG D;  2FXU A;  3UB5 A;  3W0L A;  3MN6 A;  1NLV A;  1Z6R A;  2I7P A;  4CZF A;  3EKS A;  4H5R A;  1V4S A;  3M6G A;  3SMP A;  4HTL A;  3IUC A;  4PKH A;  5AQP A;  3C0B A;  4IWV A;  2ZF5 O;  3WT0 A;  4B1W B;  4BR9 A;  2YI1 A;  1HKG A;  1NGA A;  4HWI A;  3VEY A;  1HKC A;  3B8A X;  4FWK A;  1U2V A;  2NZT A;  3WQT A;  1YXQ A;  2GEM A;  2DPN A;  4PKG A;  4B1Z A;  4GY2 B;  3UKR A;  3HZ6 A;  4JAX A;  5BRE A;  4BQL A;  4IZ9 A;  3TPQ A;  1LOT B;  2FF3 B;  4QS8 A;  2P9I B;  1U6Z A;  4H0T B;  4GNI A;  3SK3 A;  4MO5 A;  4BR4 A;  5BPM A;  3O6W A;  3A0I X;  4BC5 A;  5AQO A;  4CJ7 A;  4FWS A;  1GLA G;  1HLU A;  1KAY A;  1NGD A;  5AZJ A;  4AM7 A;  5CE3 A;  5AQV A;  3L0Q A;  4BC3 A;  4BQZ A;  2D1K A;  2ZWH A;  4CD3 A;  4WQ5 C;  1KAZ A;  5I9E B;  1G99 A;  1WUA A;  4A62 A;  1TYQ A;  4FO0 A;  2FSN A;  4BC2 A;  5LY3 A;  3A8Y A;  3GOI A;  5AQG A;  2E1Z A;  3L6Q A;  3ULE A;  1NM1 A;  1V4T A;  2ASM A;  3AAR A;  4FWM A;  4XEI A;  5JLH A;  3D2F A;  3J8A A;  3MK6 A;  4K42 A;  1WOQ A;  1BA1 A;  4Y0W A;  1ZXO A;  2YHW A;  2CH5 A;  4M7Y A;  2P9K A;  3MCP A;  3P4I A;  2IVN A;  3VES A;  1NGE A;  3D2E A;  3KHY A;  1BWF O;  4IXC A;  5TKY A;  4H5T A;  2NRH A;  3DJC A;  3VEN A;  2FLO A;  2GWJ A;  3FLC O;  3VOV A;  4EHU A;  2HF3 A;  3ENH A;  3DXM A;  4JD2 B;  4QS7 A;  3WEE B;  2V51 B;  1T6D A;  2P9P A;  3HSC A;  1KAX A;  5AQN A;  3ID8 A;  4MO4 A;  3WXI A;  3AAP A;  1NGJ A;  2CGJ A;  4JNE A;  1U2V B;  4L3Q A;  1BUP A;  3VF4 A;  3ZET A;  4CZK A;  2YJF A;  2NLX A;  4F9O A;  4WYB A;  2D4W A;  1ESV A;  5AZI B;  1NGG A;  1NWK A;  3ZX3 A;  3VPZ A;  1XQS C;  3FE1 A;  1YVN A;  3ZX2 A;  4CZH A;  3BUZ B;  4BRE A;  1H1V A;  4H5V A;  3WUH A;  3AAQ A;  2ASP A;  3A5N C;  4MLH A;  2P9L B;  3QBW A;  1BO5 O;  3H1Q A;  1EQY A;  4NB4 A;  4WQ4 C;  4RTF D;  4H03 B;  1JCG A;  2CGK A;  5FPM A;  3MDQ A;  5AQM A;  3UE5 A;  4JHD B;  2YHY A;  3GBT A;  1Q18 A;  2D0P A;  2AA4 A;  4Z94 A;  4IJA A;  5EX5 A;  5ADX A;  4A2A A;  1HPM A;  1X9J A;  3C7N A;  4J8F A;  2QWQ A;  2Q0U A;  3CHW A;  2F9W A;  1GLD G;  3LDO A;  4RCH A;  3CJA A;  4IJN A;  3ZEU B;  2A42 A;  4AM6 A;  5LJV A;  4B1X B;  4DCH A;  3SJH A;  4BRO A;  3LDP A;  4EAH D;  4BG9 A;  4CI6 A;  3FZF A;  4XH5 A;  2E8A A;  3VGK A;  5AQW A;  3WQU A;  3CQX A;  3S41 A;  3D7E O;  1XUP O;  3HTV A;  2E20 A;  3UKU B;  3FZM A;  4BR2 A;  2P9U B;  3U8X A;  3UKR B;  3G25 A;  2GEL A;  2Q1N A;  1E4F T;  2P9K B;  5BPN A;  1T44 A;  5B8H A;  5JIC A;  3FFK B;  4O8K A;  3L4I A;  4XH1 A;  3TU5 A;  4FL9 A;  3A5M C;  5EOY A;  2P9I A;  4CBX A;  3D2F B;  4CBU A;  5AZI A;  1BA0 A;  2AP1 A;  2E1Y A;  4BRF A;  4WQ4 A;  3KVG A;  3GDQ A;  3MN5 A;  3O1W A;  3EN9 A;  3DXK A;  5AQX A;  4BVP A;  1QQN A;  2E2P A;  2FF6 A;  5AQF A;  4A61 A;  4BRC A;  3UKU A;  5AQS A;  1LCU A;  2Q31 A;  4IO8 A;  3BP8 A;  1NMD A;  2D0O A;  2P9S B;  3VGM A;  4BRP A;  5FPN A;  5FPE A;  2Q97 A;  4BRK A;  4FSV A;  3WEE A;  1RDW X;  1BOT O;  1NGB A;  2H3G X;  2ZGY A;  2V7Z A;  4K25 A;  2W41 A;  4KBO A;  4BRI A;  4BR5 A;  5BRD A;  4FWR A;  3WXK A;  2HMP A;  1HKB A;  2E2Q A;  2QWL A;  2QW9 A;  3F9M A;  1QZ6 A;  5AFU H;  4CZG A;  3SLC A;  4DHY A;  3GL1 A;  3VF2 A;  3O80 A;  3M3Z A;  4BGA A;  2KHO A;  4QS9 A;  2V7Y A;  2GUP A;  2BTF A;  2CH6 A;  3I8B A;  4C23 A;  2YJE A;  3FZH A;  1CZA N;  2VWB A;  1S22 A;  4CBW A;  4M7X A;  3HBT A;  1JCE A;  5AQK A;  2BUP A;  2FSK A;  1X3M A;  2ZGZ A;  4CZL A;  3H3O B;  5BRH A;  2ASO A;  4M63 C;  2PBD A;  3VET A;  2A40 A;  3BF1 A;  3H3N O;  1GLJ O;  3IFR A;  3C7N B;  3CI5 A;  1J6Z A;  4BR7 A;  4FPA A;  1C0G A;  2P9S A;  3VER A;  3EO3 A;  3H45 C;  5FPD A;  1NGF A;  3LDL A;  4CZJ A;  5AQR A;  5BR9 A;  3EKU A;  1D4X A;  1NGI A;  4BRN A;  2QWN A;  5KPZ A;  3VEW A;  2Q36 A;  3OHR A;  3CJ9 A;  3CIP A;  2IVP A;  1QQM A;  3ZEU A;  4JHD A;  5JLF A;  2I7N A;  1HJO A;  2Q2R A;  4YDU C;  4H0X B;  1MA9 B;  5F0X A;  1JCF A;  4E1J A;  5E84 A;  3SMS A;  1GLC G;  5KPT A;  2V52 B;  4H5N A;  3EZW A;  3WXL A;  4BRQ A;  3CJC A;  3O08 A;  4BRM A;  2F9T A;  4B9Q A;  3IDH A;  5AR0 A;  1C0F A;  3AY9 A;  3ENO A;  3ZET B;  2GWK A;  3EL2 A;  5EY4 A;  3O1B A;  1K8K B;  1YAG A;  3QIC A;  3ATU A;  4H0P A;  3CER A;  2QWP A;  1NGH A;  4BRH A;  1ATR A;  4K43 A;  1IG8 A;  2P9P B;  1DEJ A;  1YUW A;  4FWL A;  1ZC6 A;  2ITM A;  2HF4 A;  4PKI A;  3HM8 A;  5KPR A;  2VCP A;  2EWS A;  3LL3 A;  5BRF A;  4BR0 A;  3ATV A;  3QFU A;  5EXW A;  5BN9 A;  1NBW A;  4BRA A;  3LDN A;  4EIA A;  3RSE A;  4PL7 A;  2YCH A;  5AQT A;  3O5B A;  4WQ5 A;  3MN9 A;  4FWP A;  1S3X A;  1BG3 A;  4I6M B;  2Q0R A;  2QWO A;  4LC9 B;  4YDU A;  4O5F A;  3QML A;  4XH4 A;  3ULE B;  2A6A A;  3H6E A;  4FWO A;  2WUS A;  5AQI A;  4B1U B;  5AFU A;  2E2N A;  4H5W A;  5AQJ A;  4BRG A;  2P9N B;  1NGC A;  5AQU A;  3BF3 A;  1TYQ B;  1SAZ A;  4JN4 A;  1GLB G;  4FPB A;  4NO7 A;  5ELZ A;  3MMV A;  3GG4 A;  3JS6 A;  1KXP A;  3GE1 A;  1DGK N;  1SQK A;  1HX1 A;  2P9N A;  4CZM A;  1ZBS A;  3IMX A;  5AQH A;  2OAN A;  3LM2 A;  2A3Z A;  4H0V B;  4PL8 A;  3QB0 A;  4CZE A;  1P8Z A;  4EFH A;  4RWT A;  5AZJ B;  5AQY A;  3U9Z A;  3U9D A;  3ZX0 A;  3CQY A;  4ISF A;  3VF6 A;  5KQ8 A;  3MN7 A;  3H46 O;  3VEX A;  3O8M A;  3FZK A;  3BEX A;  2P9U A;  2UYT A;  3LDQ A;  3CET A;  3QFP A;  1K8K A;  1ATN A;  1MWK A;  5AQQ A;  3QDK A;  3VEO A;  4B1V A;  4DB3 A;  2E2O A;  2VYP A;  2QWR A;  4BGB A;  3DWL A;  4I6M A;  3R8E A;  4BVO A;  1E4G T; 
#chains in the Genus database with same CATH topology
 1UOC A;  1TL1 A;  4H0Y B;  4O55 A;  4JK8 A;  3CJB A;  3A5O C;  4E19 A;  3I33 A;  4A2B A;  3JAM O;  2A41 A;  4CF8 A;  2DTU A;  1Z05 A;  4G1Q A;  3ZT3 A;  1VQ6 N;  1IJJ A;  1VSE A;  1BDG A;  4IOX A;  1TAU A;  3OYE A;  2G8I A;  2E88 A;  4K8X A;  3R6M A;  3VEV A;  3NE6 A;  3ID6 A;  4FWN A;  1NJI O;  3A5L C;  3CPE A;  3W3D A;  2J4R A;  2PAV A;  1XMQ K;  5M1K A;  3H1V X;  4EZ9 A;  4I7F A;  4FJG A;  3QBX A;  1F21 A;  4M3T A;  4JV5 K;  3SQ1 A;  3I55 N;  1RGI A;  3RR8 A;  3R9P A;  4CHO A;  1QQO A;  1S1W A;  2GX9 A;  3U4L A;  4EHT A;  4MLE A;  2A5X A;  4FJ9 A;  3CJ1 A;  2WOM A;  4DTS A;  1RBV A;  3AO1 A;  1RT2 A;  4X62 K;  4JRP A;  4X66 K;  4FJ7 A;  4JI1 K;  2QK9 A;  2YHX A;  1RFQ A;  1T6C A;  4NLB A;  2CGL A;  3PIP L;  1SUQ A;  3UB5 A;  3IS9 A;  5GAH P;  1FXX A;  1OH6 A;  1Z6R A;  3CPW M;  4CZF A;  3NF8 A;  3O9R A;  3EKS A;  1KFS A;  2HHH K;  4KH4 A;  4OPA A;  2O8C B;  4BR9 A;  4B1W B;  2YI1 A;  2B4J A;  4HWI A;  4ELV A;  3THX B;  4CJP A;  4CHN A;  3Q7C A;  1IKW A;  1RBT A;  4K8Z A;  5HRN A;  1Q8I A;  4FYD A;  4GY2 B;  1XHZ A;  3TAP A;  4LSL A;  4ICL A;  5BRE A;  2IGI A;  4IZ9 A;  3VQ4 A;  1LOT B;  4BQL A;  1IBK K;  1ZBI A;  2ZE2 A;  4QS8 A;  2P9I B;  4OLB A;  3TAE A;  1YJW N;  4CVN E;  3KJV A;  5KI6 A;  4BR4 A;  1L3U A;  1CLQ A;  5AQO A;  3KK1 A;  3MWT A;  3NGY A;  4R79 A;  1NU0 A;  4NXM K;  4AM7 A;  4OKE A;  2ZWH A;  4LF7 K;  1WUA A;  4YFU A;  4A62 A;  1TYQ A;  1C1B A;  2W6L A;  2E1Z A;  2O4I A;  3ULE A;  1V4T A;  3D2F A;  3J8A A;  3MK6 A;  1WSF A;  4DU4 A;  4Z4E A;  2HNY A;  3V9S A;  3RVC A;  3O4N A;  3MCP A;  2IVN A;  4H5T A;  3NBP A;  1VQ4 N;  2KFN A;  3ENB A;  2E6L A;  3FLC O;  1YHQ N;  4EHU A;  3ZSX A;  4IFE A;  1XC9 A;  1KAX A;  2ATQ A;  4V19 S;  4DR6 K;  3WXI A;  3AAP A;  3VF4 A;  4CZK A;  1QQC A;  5C24 A;  3D45 A;  3C6U A;  2D4W A;  1EKE A;  5JS2 A;  1C6V A;  1NWK A;  1XQS C;  2NRR A;  5IT9 O;  4BRE A;  3WUH A;  1VSL A;  3AAQ A;  4ZTJ A;  3QBW A;  4ZTF A;  5DM7 L;  3RRG A;  4KHY A;  1BO5 O;  4DUY K;  3V9U A;  4FJL A;  5A2Q O;  5J1E A;  5FRM A;  1JCG A;  2KQ2 A;  3MDQ A;  4KHQ A;  3TAR A;  2JGU A;  3RMB A;  5CY4 A;  4RW7 A;  4KTQ A;  1Q18 A;  3IAY A;  5HRS A;  4IEE A;  3CCR N;  5GAG P;  1WAF A;  3VQP A;  4HUE A;  1HPM A;  1VSD A;  1X9J A;  4FK0 A;  3DI6 A;  4AQY K;  2F9W A;  4RCH A;  1QVG M;  4CJT A;  3EYZ A;  1RCH A;  3OYG A;  4LF9 K;  4AM6 A;  5LJV A;  1CZB A;  4DQP A;  1N8R O;  3LDP A;  4TSX A;  3ITH A;  1REV A;  3AVN A;  2OTL N;  5LMN K;  2OPP A;  4BG9 A;  4CI6 A;  4GKJ K;  4GV9 A;  3KKR A;  2WBN A;  4NYN A;  4FW1 A;  3CFO A;  4RW4 A;  1M1K O;  3ZT2 A;  1Q86 O;  1HYZ A;  3S41 A;  1RT7 A;  4FJN A;  2E20 A;  3KWG A;  2YKM A;  4DTR A;  4JI4 K;  4GV6 A;  3U8X A;  4I2Q A;  3UKR B;  1WSJ A;  4JI5 K;  2GEL A;  2RKI A;  3SAG A;  4O8U A;  5BPN A;  4M41 A;  2HB5 A;  3MWP A;  3CFP A;  4N41 A;  3L4I A;  3CQ8 A;  1CZ9 A;  3VQC A;  4JEP A;  2D0B A;  4XIU A;  4DV4 K;  3CM5 A;  2PZS A;  1I39 A;  4CJR A;  4BRF A;  4O5B A;  4WQ4 A;  1B9F A;  4BVP A;  3OJS A;  2E2P A;  3DRP A;  5AQF A;  1WSG A;  1N33 K;  4CK3 A;  4IO8 A;  3NH1 A;  5J2M A;  4FK2 A;  3IRX A;  4OGE A;  1X1P A;  5M1O A;  1BCO A;  3AO2 A;  5HRP A;  3DM2 A;  2HND A;  4BRP A;  1WB9 A;  3LWL A;  3PY8 A;  3AGK A;  2Q97 A;  1WNS A;  1BQM A;  2D5R A;  3IG1 A;  1BOT O;  1NK6 A;  3MXM A;  3O3F A;  4BRI A;  1LWF A;  2E2Q A;  2XY7 A;  1B92 A;  1QZ6 A;  5AFU H;  3FFI A;  3CME N;  4DHY A;  4DLG A;  4J2A A;  3VF2 A;  3OTO K;  1VQM N;  4N56 A;  1IV0 A;  4YNQ A;  2GUP A;  1XHX A;  4CBW A;  4CEQ A;  5AQK A;  1C1A A;  1YVU A;  4NYF A;  4B3M K;  4CZL A;  5BRH A;  2ASO A;  2B5J A;  1C1C A;  3OW2 M;  3VET A;  2HHU A;  4B8A B;  3ZSR A;  1ZBU A;  3CG7 A;  4LH5 A;  4FJM A;  4I2P A;  4E89 A;  4FLW A;  1C0G A;  1WAJ A;  2NRV A;  2W6K A;  2P9S A;  1HJR A;  4NCA A;  1RDU A;  3OYB A;  1NGI A;  4OGC A;  3VEW A;  3SQ4 A;  4JKB A;  1VQP N;  3PLA A;  3CCU N;  1YTU A;  3OS0 A;  1NKE A;  4H0X B;  5F0X A;  1JCF A;  3SMS A;  4I9L A;  3P38 A;  5KPT A;  2PYL A;  3DYA A;  1RT3 A;  3IDH A;  3PIO L;  3E9P A;  1WSH A;  4FVU A;  3VN5 A;  3SZ2 A;  1K8K B;  3L2V A;  2NRZ A;  3QIC A;  3HVR A;  3CER A;  3V9W A;  3PSI A;  4DR2 K;  3SI6 A;  4M3X A;  3HM8 A;  2EWS A;  4WFN L;  4B9T A;  4BR0 A;  1S9G A;  5BN9 A;  4JK7 A;  2IC3 A;  3MXI A;  3LDN A;  1EO1 A;  1S72 N;  4PL7 A;  1U45 A;  5AQT A;  3O5B A;  4WQ5 A;  4FWP A;  2D0C A;  1BG3 A;  4G9Z A;  1TKT A;  2FBV A;  1HNI A;  4FWO A;  3G6E N;  4HCC A;  2X6N A;  4CGH A;  5AQJ A;  1QSY A;  1DLO A;  4RW9 A;  3ZYY X;  1GLB G;  4FPB A;  5C2D A;  1NK7 A;  4DV5 K;  1KXP A;  3GE1 A;  4CE9 A;  3AVH A;  1KLM A;  1HX1 A;  4CZM A;  3VQQ A;  3HOS A;  1KSP A;  5AQH A;  3HP6 A;  3QIP A;  4PL8 A;  1YIJ N;  4HHT A;  4DU3 A;  5HRO A;  1SL2 A;  3NMU A;  3U9D A;  2ZQB A;  4ISF A;  4IEI A;  3H46 O;  2UXB K;  3O8M A;  3SUP A;  3RTV A;  4KHW A;  3QFP A;  1ZBH A;  3QDK A;  2E2O A;  1ASV A;  3M8P A;  5I3U A;  2VYP A;  2QWR A;  3AVI A;  4BGB A;  4Q5V A;  4JI7 K;  3QIO A;  2OZM A;  4I6M A;  3BY5 A;  2WON A;  2F7T A;  4KH6 A;  3PSF A;  3PX0 A;  4K41 A;  3T1H K;  4ISG A;  1X3N A;  4CZI A;  3SCX A;  4C8O A;  5F1X A;  4BDY A;  5LJW A;  2XHB A;  3WNF A;  4JRQ A;  5E26 A;  3SQ0 A;  1S5J A;  1A5V A;  4FJX A;  4FWQ A;  4Z0U A;  4CED A;  1Q9X A;  3TAF A;  3TTF A;  1TUY A;  5HL7 L;  3DLK A;  5CYQ A;  4W5O A;  3CFR A;  1HUX A;  1DTT A;  3RMD A;  4CFB A;  3TAB A;  2O8F B;  4BWM A;  2HHW A;  5KQD A;  2HHX A;  3SPZ A;  3KZB A;  1K6Y A;  4CJK A;  1GLF O;  4AHR A;  3U3Y A;  1S6P A;  4JI8 K;  3A2F A;  1Y64 A;  4UQG A;  2YX6 A;  2QM1 A;  4CIG A;  1T3V A;  1SZ2 A;  2YV0 X;  1BI4 B;  3CJ7 A;  3R3L A;  3HPO A;  2P51 A;  2HHQ A;  1QVF M;  2AJQ A;  4C8K A;  4E0D A;  3CCQ N;  3CCV N;  2HOE A;  4JKA A;  4HUF A;  1GOA A;  2OPR A;  2QTD A;  3AA4 A;  1XWL A;  1QHA A;  3AVC A;  4ELT A;  3AVJ A;  1BU6 O;  3WNH A;  4FOE A;  1MWM A;  3VTH A;  1R59 O;  2EX3 A;  4CF2 A;  3W0L A;  4ELU A;  1EX4 A;  1D9F A;  2GUI A;  1T7P A;  1RDB A;  2BGG A;  3MAQ A;  1HNW K;  4CJW A;  3CCE N;  5HBM A;  2IDO A;  3SMP A;  3M6G A;  4JI3 K;  4HTL A;  3IUC A;  1TKX A;  2DFH A;  1TVR A;  3C95 A;  2Z1I A;  3TSU A;  1S1X A;  1HKC A;  4DTP A;  4CF9 A;  2VWJ A;  3WQT A;  3LZJ A;  3DLR A;  4DSL A;  4LFC K;  1YT3 A;  1HQE A;  4IKF A;  3HZ6 A;  3TPQ A;  4JKE A;  3J7A P;  1TKD A;  3PO5 A;  3SK3 A;  5K14 A;  3SQ2 A;  1B9D A;  4EP4 A;  3OYK A;  1GOC A;  3CMA N;  3S9H A;  3O6W A;  4LF4 K;  4OPK A;  3D6R A;  3CD6 N;  1UWB A;  1Z26 A;  4FLZ A;  4FWS A;  1KAY A;  1JLA A;  1S1V A;  1ZBF A;  5CE3 A;  1IKY A;  4BC3 A;  4FCY A;  4FXD A;  4WQ5 C;  1R0A A;  1KAZ A;  1W97 L;  5CHI A;  4FO0 A;  2Y1I A;  3OA9 A;  3A8Y A;  3GOI A;  5AQG A;  3SPY A;  5C15 A;  4BAC A;  3AAR A;  4FWM A;  1KVC A;  3MED A;  4DSK A;  4K42 A;  1WOQ A;  2QA4 N;  4Y0W A;  1ZXO A;  2VWK A;  2CH5 A;  2YHW A;  3OVN A;  2UUA K;  1K73 O;  1BWF O;  3CC4 N;  1YJN N;  2NRH A;  2NRT A;  3VEN A;  4LFB K;  4DV2 K;  4QAG A;  2GWJ A;  2BH1 A;  3VOV A;  2HF3 A;  3HOT A;  3ENH A;  4JD2 B;  4QS7 A;  2V51 B;  1T6D A;  3VQE A;  1VSJ A;  1D9D A;  1NGJ A;  4L3Q A;  2NLX A;  4F9O A;  3O9U A;  4OKJ A;  2GV9 A;  1N36 K;  1NGG A;  4B3O A;  1KVA A;  2FC0 A;  4B9U A;  1I3A A;  3VPZ A;  1YVN A;  3FE1 A;  3QER A;  3HRG A;  1N5Y A;  3NCI A;  1H1V A;  5SZT A;  4YOU A;  3I8D A;  1EP4 A;  4Z4F A;  4C8M A;  2VG5 A;  3WNE A;  2XY6 A;  3Q7B A;  3H1Q A;  4MDA A;  2HHV A;  1EQY A;  4RTF D;  2CGK A;  5FPM A;  4AHS A;  3WNG A;  4B9S A;  5D3G A;  3ZT0 A;  3C65 A;  3T1A A;  2AA4 A;  4Z94 A;  4CGJ A;  1HRH A;  2X74 A;  4CIF A;  1D5A A;  3C7N A;  3RMC A;  3BZK A;  4J8F A;  1CXU A;  2IAJ A;  3V9X A;  3LZI A;  1WSI A;  4DFK A;  3TSP A;  4YHH K;  4IJN A;  4CEO A;  4CJV A;  3VA3 A;  1J5E K;  3OYN A;  1Q81 O;  4EAH D;  3G0Z A;  2HVI A;  1A5X A;  3OY9 A;  4E7H A;  3VGK A;  5AQW A;  3SBT A;  3CQX A;  4YOW A;  1QSS A;  4AHV A;  3G4S N;  3BGR A;  3KLG A;  4DTU A;  3AVF A;  4EZ6 A;  2PYJ A;  3FZM A;  4BR2 A;  2ZJP L;  3CCM N;  1NK8 A;  2W42 A;  3G25 A;  3BZC A;  2Q1N A;  3AVG A;  5B8H A;  3CYM A;  4O8K A;  3OJU A;  4DTX A;  4XH1 A;  3TU5 A;  4FJ5 A;  5C0Y A;  2P9I A;  3V6D A;  2HHS A;  1RBS A;  3D2F B;  5GAD P;  2WC9 A;  3HST B;  1K9M O;  2F8T A;  3VQA A;  1VHX A;  4AIL C;  3GDQ A;  4OPJ A;  3KIO A;  2NUB A;  1JLF A;  4DQR A;  2FF6 A;  4M3W A;  2Q31 A;  1X9S A;  3NF9 A;  5LL6 Z;  4OJR A;  4OVL A;  3TAQ A;  3RMA A;  2P9S B;  1LV5 A;  4KTZ A;  4W5Q A;  1J54 A;  5FPE A;  1YI2 N;  4BRK A;  3WEE A;  1JLQ A;  1NGB A;  2H3G X;  2ZGY A;  4K0K K;  3E66 A;  4KBO A;  4LSN A;  1C0T A;  1BL3 A;  4M3Z A;  4M45 A;  4LD0 A;  4BR5 A;  3ZSO A;  1FJG K;  4AH9 A;  4CEC A;  3DLB A;  3M3Z A;  4FJH A;  3NFA A;  3E01 A;  4QS9 A;  2V7Y A;  3P39 A;  4MQ3 A;  2BTF A;  3P83 D;  4C23 A;  4ILH A;  1UAX A;  2YJE A;  3LP1 A;  1S22 A;  4M7X A;  1HYV A;  2G8U A;  2BUP A;  4KO0 A;  5HRR A;  1JL2 A;  2PBD A;  4QOZ B;  1U4B A;  3BF1 A;  3H3N O;  3T69 A;  3O9S A;  4PHT X;  1J6Z A;  4FPA A;  2PY5 A;  4IBN A;  1T8E A;  3VER A;  3NGZ A;  4O0J A;  5FPD A;  3LDL A;  5BR9 A;  2RHK A;  2WFB A;  2QWN A;  4AHT A;  1NG9 A;  3CJ9 A;  2BDP A;  1U49 A;  1QQM A;  3ZEU A;  3F9K A;  4JHD A;  2OA8 A;  2I7N A;  1LW2 A;  1OH5 A;  1P90 A;  4CGD A;  2OPQ A;  3DMJ A;  4HVJ A;  4IDH A;  5E84 A;  4FK4 A;  1GLC G;  4KB0 A;  1RTH A;  4BRQ A;  3P5J A;  3CJC A;  3O08 A;  1ZYQ A;  4B9Q A;  1VQO N;  4IOA L;  5AR0 A;  1C0F A;  3AY9 A;  3ENO A;  3L2R A;  2GWK A;  3MCA B;  5KRT A;  1YAG A;  1W2B M;  3ATU A;  4H0P A;  2HBL A;  2QWP A;  4BRH A;  1ATR A;  1L5U A;  4DQI A;  2JWK A;  1IG8 A;  1HNX K;  4FWL A;  1YUW A;  4WFB L;  2F96 A;  2RPI A;  1HQU A;  2HF4 A;  4PKI A;  4O4G A;  4CJF A;  1JLG A;  1Z25 A;  5EXW A;  3OYI A;  3THW B;  1NBW A;  4CGG A;  4BRA A;  3VQ7 A;  4CJ4 A;  4EIA A;  4CFA A;  2G8F A;  2KTQ A;  2Y1J A;  3RSE A;  4CF0 A;  3I0R A;  1IKX A;  4DR4 K;  3HPH A;  4LC9 B;  4O5F A;  3QEW A;  3QML A;  5CZ2 A;  3OS2 A;  4XH4 A;  4FM1 A;  2E5L K;  2WUS A;  1RTD A;  4EP5 A;  5H1S Q;  4H5W A;  1S1T A;  3HK2 A;  4YOX A;  4OO1 J;  4BRG A;  1RNH A;  3T19 A;  4FLX A;  1TYQ B;  4NO7 A;  3KTQ A;  3GG4 A;  4UY8 O;  1FW6 A;  1EWR A;  4IG0 A;  5T7B A;  2OAN A;  2R7Y A;  4KH5 A;  3K5M A;  1P8Z A;  4Z4H A;  3CXC M;  2P5G A;  2O8B A;  1WLJ A;  3ZX0 A;  4Z4G A;  4W5T A;  1MU2 A;  4CFD A;  4YOR A;  3B6P A;  4KHN A;  1Y97 A;  1QTM A;  2FBX A;  4CGF A;  1EXQ A;  4AF1 A;  4B1V A;  2DFF A;  5GAE P;  3DWL A;  1SV5 A;  1HNZ K;  2KFZ A;  1TAQ A;  3ALY A;  4BVO A;  5KRS A;  4BDZ A;  3EE8 A;  1FKO A;  4CEF A;  1RTI A;  3L2U A;  4DR5 K;  1IBL K;  5E41 A;  4FZY A;  3TAG A;  3ZSY A;  4CGI A;  3FR0 A;  4E1N A;  2O8D A;  3DOK A;  2KW4 A;  4H0O A;  1ASU A;  3S3O A;  3DXK B;  1TUU A;  3TAN A;  1GLL O;  1C0M A;  1IH7 A;  4CD1 A;  2F4V K;  3O4W A;  4JD2 A;  5AQZ A;  3EY1 A;  3JXU A;  1L3S A;  3PO4 A;  1VSK A;  2FBY A;  1RT5 A;  3OYF A;  2KZZ A;  1IKV A;  4CIE A;  5C2F A;  3HI0 A;  3VQ5 A;  4BRL A;  5I42 A;  4CJ5 A;  3CC7 N;  1ATS A;  2UXD K;  4JKH A;  1VQ5 N;  3AV9 A;  5BN8 A;  4F8R A;  1SKR A;  4HCB A;  4DQ8 A;  4R5P A;  3M8S A;  3THW A;  3VGL A;  1OH7 A;  2QWM A;  1WBD A;  2P1J A;  1LAW A;  3LP3 A;  3QNO A;  2W40 A;  1J9A A;  4DSF A;  4CEB A;  5ADX H;  5F2R A;  3FZL A;  1MDU B;  2FXU A;  5M1N A;  4DMN A;  3ZT4 A;  4PKH A;  5AQP A;  1KLN A;  2ZF5 O;  3WT0 A;  3KLE A;  3VMF B;  1HYS A;  4J2E A;  5J2N A;  1HKG A;  1NGA A;  3VEY A;  4FWK A;  1U2V A;  4O0I A;  2NZT A;  1TL3 A;  1LWC A;  4DU1 A;  1YXQ A;  5FRO A;  5FRN A;  2OYQ A;  4IDK A;  2DPN A;  3V1Q A;  4GKK K;  4PKG A;  4B1Z A;  3LP2 A;  3UKR A;  2YNG A;  1FK9 A;  3O3G A;  3ASM A;  2FF3 B;  1SKW A;  4Z4I A;  4H0T B;  3SNN A;  4MO5 A;  4BWJ A;  3AVL A;  4F3T A;  4BC5 A;  3CM6 A;  3NAE A;  4KAZ A;  2YHB A;  1HLU A;  1NGD A;  5AZJ A;  5KGW A;  2IS3 A;  3OBW A;  3DLG A;  5AQV A;  3DLL L;  3I56 N;  2Z1G A;  1KCF A;  3AA5 X;  4BQZ A;  5I9E B;  2NRX A;  1G99 A;  5J2P A;  1O1W A;  4DS5 A;  3JYT A;  4BC2 A;  5LY3 A;  5SWM A;  3OYJ A;  1ILY A;  4FZZ A;  5BR8 K;  1NM1 A;  4XEI A;  3HJF A;  5JLH A;  4CEA A;  1BA1 A;  4M7Y A;  1UA0 A;  2P9K A;  4W5R A;  3P4I A;  2O8F A;  1TV6 A;  3VES A;  1NGE A;  5TKY A;  3L4Q A;  3DJC A;  1VQL N;  1JKH A;  4N47 A;  2O4G A;  2ETJ A;  4PUO A;  3DXM A;  4PA1 A;  3WEE B;  2OPS A;  3MEG A;  4KB1 A;  4KHU A;  4JKF A;  5AQN A;  3LDS A;  5GIN A;  3ID8 A;  4MDB A;  4DFP A;  1U2V B;  3ZET A;  3WXM B;  1Q9Y A;  4WYB A;  4KHS A;  4CHY A;  1NJW A;  3BDP A;  3U3G A;  3ZX3 A;  4CZH A;  3ZX2 A;  3EE9 A;  3LAL A;  4H5V A;  2ZJR L;  1YF5 L;  4C1N K;  5CYM A;  4NB4 A;  2YKN A;  3KD1 E;  3VQD A;  3SUQ A;  4JYA K;  2YHY A;  1BIZ A;  3E9O A;  3P31 A;  3TAM A;  1NJY A;  2D0P A;  3L8B A;  4B9N A;  5J2Q A;  4IJA A;  4DR1 K;  5EX5 A;  2YNF A;  5ADX A;  3LPU A;  1HNV A;  4A2A A;  1Q7Y O;  4B9L A;  2Q0U A;  3CHW A;  1GLD G;  1YIT N;  4PY5 A;  1NKB A;  3CJA A;  1RT1 A;  3AVA A;  3ZEU B;  5GIO A;  2A42 A;  2Q3S A;  1HMV A;  4B1X B;  4DCH A;  4CCH A;  4Y1C A;  4FLU A;  5DMR A;  3FZF A;  2E8A A;  3WQU A;  4C8L A;  3QO9 A;  3DOL A;  1XUP O;  3SBG A;  3HTV A;  3UKU B;  1QS4 A;  5CR4 A;  3K57 A;  2KZM A;  3C6H A;  5HLF A;  3T7Z A;  1E4F T;  1HR0 K;  1T44 A;  1RT6 A;  4JS5 A;  1XI1 A;  4DKW A;  2BAN A;  4DV3 K;  1SKS A;  1EET A;  3A5M C;  4CBX A;  4FJ8 A;  5DK5 A;  4A57 A;  5AZI A;  1BA0 A;  2AP1 A;  2E1Y A;  3OS1 A;  4M3Y A;  3KVG A;  4FLV A;  3T3F A;  1U47 A;  3O1W A;  3DXK A;  5AQX A;  4IFV A;  5CZ1 A;  3O4Q A;  3DRS A;  2YHA A;  3K5N A;  4BRC A;  1KFD A;  3ZT1 A;  3UKU A;  5AQS A;  1LCU A;  4NXN K;  1BCM A;  3VQ6 A;  2E4L A;  4CES A;  4X65 K;  4BDP A;  1WN7 A;  1RBR A;  2D0O A;  1KTQ A;  3SAH A;  5FPN A;  2O8B B;  4F2S A;  3TTD A;  4HUG A;  1N6Q A;  1X9W A;  1G15 A;  1RDW X;  4B9M A;  3T1Y K;  2V7Z A;  2W41 A;  1CXQ A;  1TK8 A;  5BRD A;  3O3H A;  4E7K A;  4FWR A;  2QI2 A;  3WXK A;  1HKB A;  3CCS N;  2QWL A;  2QW9 A;  4C8N A;  4CZG A;  3SLC A;  4JI6 K;  1NJZ A;  2OZS A;  3O80 A;  1RDA A;  4OKK A;  2KHO A;  1SS6 A;  3AVB A;  1T03 A;  3PUF A;  2CH6 A;  4CJS A;  4KV8 A;  1VAZ A;  1A5W A;  3FZH A;  1CZA N;  5JVG L;  2VWB A;  3TR8 A;  4MFB A;  3HBT A;  1LAV A;  2OCE A;  3J81 O;  2ZGZ A;  4DUZ K;  4DTO A;  4LY7 A;  3AO4 A;  4X64 K;  4CJU A;  1TK0 A;  4DR7 K;  2ZD1 A;  4LF6 K;  4CK2 A;  4B8C A;  3C7N B;  4CJL A;  4BR7 A;  1LW0 A;  5M1P A;  4DS4 A;  5EU7 A;  4A5A A;  2IOC A;  1NGF A;  4U7B A;  4CZJ A;  3J7Y P;  3KK2 A;  3EKU A;  3MEC A;  4NLC A;  1BIS A;  1JXE A;  3O9Q A;  3NVM A;  3CIP A;  3TSQ A;  4CK1 A;  5JLF A;  1JLB A;  1X9M A;  3LAN A;  1HJO A;  4CHQ A;  3KK3 A;  4ID5 A;  2QEX N;  4E1J A;  4FLT A;  1U04 A;  2VG6 A;  4B08 A;  4DTN A;  3EZW A;  3HO1 A;  3WXL A;  4KI4 A;  4BRM A;  2F9T A;  3QLH A;  1VQ9 N;  1NK5 A;  4DSJ A;  1W9H A;  3ZET B;  3NGI A;  2ZJQ L;  3O1B A;  4FZX C;  3MX2 A;  4CJ3 A;  1NGH A;  4FM2 A;  2ITG A;  4ILJ A;  1VSH A;  1RBU A;  4ZHR A;  2P9P B;  1RIL A;  3O9T A;  2ITM A;  5KPR A;  2VCP A;  4NCG A;  4KKO A;  3G71 N;  4DF8 A;  2B6A A;  5BRF A;  4W5N A;  3NHG A;  4FW2 A;  3ATV A;  3QFU A;  3QES A;  4YY3 K;  1RDD A;  5AJ3 K;  1EWQ A;  2FBT A;  3MN9 A;  4I6M B;  1S3X A;  2HST A;  2Q0R A;  4JI2 K;  3AO3 A;  4DG1 A;  4WF9 L;  2E6M A;  3ULE B;  3H6E A;  3LPT A;  4GMJ B;  3VTI A;  4N5S A;  3J7Z O;  4OX9 K;  1VK0 A;  4B1U B;  2ZM6 K;  2E2N A;  2NNW A;  2QXF A;  4U67 L;  3TWH A;  5AQU A;  3BF3 A;  4E7L A;  4JN4 A;  4DQS A;  2XO7 A;  3MMV A;  4NCB A;  2OTJ N;  1SQK A;  2XY8 A;  2P9N A;  3J80 O;  2QKK A;  2G8K A;  4CW7 B;  3LM2 A;  2A3Z A;  4H0V B;  3AA2 A;  3QB0 A;  4CZE A;  4EFH A;  5AZJ B;  5AQY A;  2O8C A;  1BI4 A;  3CQY A;  4CEE A;  5KQ8 A;  1XMO K;  3MN7 A;  2UUB K;  1VRU A;  2Z1J A;  3NDK A;  4LFA K;  3VEX A;  3R1X A;  4DSI A;  3FZK A;  1NK0 A;  3KD5 E;  4DV0 K;  2HBK A;  4FM0 A;  3CET A;  1K8K A;  1MWK A;  4WFA L;  3VEO A;  4DB3 A;  3JSM A;  1ASW A;  4Z4C A;  3P1G A;  3SJJ A;  1OVQ A;  3ULD A;  4IOC L;  3EEQ A;  3LM9 A;  1GLE G;  3ZSV A;  4KI6 A;  4GW6 A;  4DTJ A;  2EHG A;  4F2R A;  5C25 A;  2HBM A;  3FGU A;  2IIR A;  2XRI A;  5KGX A;  2IVO A;  5JS1 A;  1KRP A;  2PFU A;  1OH8 A;  3L3V A;  1QZ5 A;  3D2E B;  2A1R A;  4O44 A;  3D0P A;  1VSM A;  4FOI A;  4B3S K;  4ISE A;  1OKJ A;  2Z1H A;  3DAW A;  4B1Y B;  3DXM B;  2VGM A;  4BC4 A;  2O8E B;  3RSE B;  3LAM A;  3PV8 A;  3VQB A;  5JMV A;  2P5O A;  4BE0 A;  1NK9 A;  2HMI A;  4FVM A;  2KKZ A;  3M1F A;  2QXL A;  3K9K A;  3WXJ A;  3SV4 A;  2G8H A;  4BRD A;  5EVZ A;  3M5R A;  3MX5 A;  3VQ8 A;  4KTW A;  3VEZ A;  3QEP A;  4BG8 A;  1XNR K;  3L2Q A;  1JL1 A;  2RN2 A;  1XC3 A;  3AA3 A;  2GTD A;  5BPL A;  4IO9 L;  1N34 K;  3KWI A;  3ZCM A;  3F73 A;  3HYF A;  3CCL N;  3N4Q A;  1OVY A;  2UXC K;  2FSJ A;  2P9L A;  5AQL A;  3LWM A;  1DKG D;  3H08 A;  3MN6 A;  4YOT A;  1DT9 A;  1NLV A;  1O13 A;  4PWD A;  2I7P A;  1KVB A;  2X78 A;  3KLH A;  3V1R A;  4H5R A;  1V4S A;  3MXJ A;  3B6O A;  1SL1 A;  3M8Q A;  3C0B A;  4IWV A;  3THY B;  2HBJ A;  1KQS M;  3B8A X;  3TI0 A;  2G8V A;  4F3O A;  2GEM A;  3VA0 A;  3DLH A;  4JAX A;  4JLH A;  3DLE A;  4KRE A;  1U6Z A;  4JKG A;  1VQ8 N;  1KC8 O;  3C6T A;  4GNI A;  3OYL A;  3SUO A;  1IG9 A;  1RTJ A;  2A1S A;  2UU9 K;  4A5B A;  5BPM A;  3KLF A;  1VSF A;  3G10 A;  4I9Q A;  3A0I X;  3AVK A;  4BE1 A;  3VQ9 A;  4CJ7 A;  3DRR A;  3K9J A;  1GLA G;  3L0Q A;  1GOB A;  1DTQ A;  2D1K A;  4CD3 A;  3CF5 L;  1SL0 A;  1S1U A;  4E3S A;  4GVE A;  4AHU A;  2FSN A;  3QEV A;  3HP9 A;  3N4P A;  2XY5 A;  3L6Q A;  1VQ7 N;  2ASM A;  5C12 A;  1NJX A;  1XNQ K;  1S6Q A;  3D2E A;  3KHY A;  4IXC A;  2UUC K;  4YOY A;  1QE1 A;  2FLO A;  3SYZ A;  1RT4 A;  3I0S A;  4DFJ A;  4DTM A;  2O8E A;  2P9P A;  3HSC A;  4BY9 C;  1VSI A;  3E1Y A;  4MO4 A;  1VQK N;  2CGJ A;  4JNE A;  1BUP A;  4E1M A;  3SV3 A;  2YJF A;  4WCE L;  4LF5 K;  2DFE A;  3SAF A;  1ESV A;  4DQQ A;  5AZI B;  2G8W A;  1J5O A;  3BUZ B;  1WBB A;  4YOV A;  4MLH A;  2ASP A;  3A5N C;  5GIP A;  2P9L B;  1NOY A;  1FKP A;  2NRW A;  4IFY A;  4CJQ A;  1J53 A;  4WQ4 C;  4FJI A;  4H03 B;  4JKC A;  4JK9 A;  3EZ5 A;  2YNH A;  5M1F A;  3K59 A;  5LMU K;  5AQM A;  3MEE A;  3UE5 A;  4JHD B;  3GBT A;  3ZLJ A;  3HT3 A;  4M3R A;  1IBM K;  3SUN A;  2HVH A;  3CC2 N;  4JKD A;  4FLY A;  4DWI A;  4CER A;  3QIN A;  2QWQ A;  2BE2 A;  2YNI A;  3LDO A;  4M3U A;  2LSN A;  3HL8 A;  2GBZ A;  4M42 A;  4GVM A;  2I5J A;  3SJH A;  1BHL A;  4BRO A;  5TKW A;  4XH5 A;  3RR7 A;  3K58 A;  3S3N A;  1VRT A;  4H4O A;  1U48 A;  3D7E O;  4PQU A;  2VQE K;  1M90 O;  3V9Z A;  5FDL A;  2P9U B;  2JWL A;  1Q82 O;  2HNZ A;  4KFB A;  5C10 A;  3AGR A;  3IKM A;  1TK5 A;  1K8A O;  2P9K B;  5JIC A;  4QCL A;  3FFK B;  4L8R B;  3OYH A;  4FL9 A;  5EOY A;  2JLE A;  4CBU A;  4CHZ A;  4DV7 K;  2VQF K;  3MN5 A;  3EN9 A;  4RW8 A;  1QQN A;  5DM6 L;  3PX6 A;  4A61 A;  3K0S A;  1TGO A;  5M1Q A;  3V1O A;  4Q0B A;  4ID1 A;  3OYD A;  1T05 A;  3AVM A;  3TTC A;  1BGX T;  3RRH A;  3BP8 A;  1NMD A;  4F4K A;  3NH0 A;  4C1N I;  3L2W A;  2VG7 A;  3VGM A;  4A59 A;  3NVK A;  3THY A;  3ZSW A;  4E7J A;  4IG3 A;  1NNE A;  3ISN C;  4FSV A;  3HXM A;  3K5O A;  1HPZ A;  4KPY A;  4RW6 A;  3OYC A;  1NK4 A;  3L3U A;  4K25 A;  3M8R A;  4DR3 K;  4B3R K;  4KRF A;  2HMP A;  1BQN A;  3NF6 A;  3F9M A;  4DFM A;  2KLA A;  3GL1 A;  3KK7 A;  1JLE A;  1S9E A;  3THX A;  4BGA A;  3U6F A;  1VQN N;  1JJ2 M;  3CCJ N;  3I8B A;  2HW3 A;  4H8K A;  3RWU A;  4B9V A;  1YJ9 N;  1JCE A;  4JS4 A;  2FSK A;  5C42 A;  1X3M A;  4HTU A;  4DLE A;  3H3O B;  2VGN A;  2RF2 A;  1YTA A;  4M63 C;  1N32 K;  3K2P A;  2HHT A;  2A40 A;  2X6S A;  1GLJ O;  3IFR A;  2O8D B;  1L3V A;  3CI5 A;  4WE1 A;  4LH4 A;  4RG8 A;  4FJK A;  1NKC A;  5HOO A;  3EO3 A;  3H45 C;  3ZSQ A;  5AQR A;  4J2B A;  1D4X A;  4BRN A;  1JLC A;  3ZSZ A;  4ILG B;  5KPZ A;  4CJE A;  2F8S A;  2Q36 A;  3F2K A;  3OHR A;  2IVP A;  4CEZ A;  5MLC Q;  1IO2 A;  4B3T K;  1NOZ A;  2Q2R A;  4YDU C;  1D8Y A;  1MA9 B;  3E9L A;  3NH2 A;  2V52 B;  1W0H A;  4H5N A;  3QNN A;  5HP1 A;  1QHT A;  1JXB A;  4H4M A;  1ZBL A;  4N76 A;  3HPG A;  3EL2 A;  5EY4 A;  3NF7 A;  3V4I A;  4K43 A;  2D0A A;  3OBY A;  1I94 K;  3THV A;  4CF1 A;  3K5L A;  1DEJ A;  3V81 A;  1ZC6 A;  4OPH A;  3S3M A;  3PX4 A;  3C94 A;  3LL3 A;  4LF8 K;  4OLA A;  2WTU A;  4DV1 K;  3KKS A;  3HM9 A;  3LP0 A;  5JVH L;  1L3T A;  1ITG A;  5FLX O;  2YCH A;  3QEX A;  4YDU A;  2QWO A;  4DV6 K;  3OYA A;  2A6A A;  4JI0 K;  5AQI A;  1QSL A;  4FJJ A;  1BIU A;  5AFU A;  3F5T A;  1RDC A;  4E7I A;  2P9N B;  1NGC A;  3QET A;  1KD1 O;  1UA1 A;  1SAZ A;  4AHC A;  3KLI A;  5ELZ A;  3C6A A;  3QEI A;  4CFC A;  1WSE A;  1W7A A;  4KHP K;  3JS6 A;  1DGK N;  3AO5 A;  1C0U A;  4DF4 A;  1ZBS A;  3IMX A;  3UIQ A;  2RE2 A;  4RWT A;  3U9Z A;  4CHP A;  3VF6 A;  2DY4 A;  3HVT A;  4JKG B;  4BE2 A;  4DSE A;  3BEX A;  1E3M A;  2P9U A;  2UYT A;  1NMN A;  3LDQ A;  1LWE A;  1ATN A;  5AQQ A;  4J2D A;  5KTQ A;  3OYM A;  2QKB A;  1TKZ A;  4GV3 A;  3R8E A;  4Y1D A;  5IWA K;  1E4G T;  3LAK A; 
#chains in the Genus database with same CATH homology
 4IOC L;  3LM9 A;  1GLE G;  4H0Y B;  4K41 A;  4ISG A;  1X3N A;  4CZI A;  4JK8 A;  2HBM A;  3CJB A;  3FGU A;  5F1X A;  2IIR A;  5LJW A;  3A5O C;  2IVO A;  3I33 A;  5E26 A;  4A2B A;  2A41 A;  3FR0 A;  2PFU A;  4FWQ A;  1QZ5 A;  3D2E B;  4H0O A;  3TTF A;  1Z05 A;  1TUY A;  1VQ6 N;  1IJJ A;  4FOI A;  5HL7 L;  4ISE A;  1OKJ A;  3DAW A;  3DXK B;  1BDG A;  4IOX A;  1TUU A;  1GLL O;  1HUX A;  4CD1 A;  4B1Y B;  3O4W A;  3DXM B;  2VGM A;  2E88 A;  4JD2 A;  3R6M A;  5AQZ A;  3VEV A;  4BC4 A;  5KQD A;  3ID6 A;  3JXU A;  4FWN A;  1NJI O;  3A5L C;  3KZB A;  3CPE A;  3RSE B;  3W3D A;  1GLF O;  2J4R A;  2PAV A;  5JMV A;  3H1V X;  5M1K A;  1Y64 A;  3QBX A;  2YX6 A;  2QM1 A;  5C2F A;  2KKZ A;  1T3V A;  3HI0 A;  2QXL A;  3K9K A;  3M1F A;  3WXJ A;  4BRL A;  1SZ2 A;  4BRD A;  5EVZ A;  3M5R A;  1RGI A;  3I55 N;  3CJ7 A;  3MX5 A;  1ATS A;  1QQO A;  3R3L A;  3R9P A;  3CC7 N;  4JKH A;  1VQ5 N;  2GX9 A;  4EHT A;  3U4L A;  1QVF M;  4MLE A;  3VEZ A;  5BN8 A;  2A5X A;  3CJ1 A;  4BG8 A;  3CCQ N;  4DQ8 A;  3CCV N;  2HOE A;  4JKA A;  3VGL A;  2QWM A;  1XC3 A;  2QTD A;  2GTD A;  2W40 A;  5BPL A;  4IO9 L;  1QHA A;  2YHX A;  3KWI A;  1RFQ A;  1BU6 O;  1T6C A;  3CCL N;  3N4Q A;  4FOE A;  5ADX H;  1MWM A;  1OVY A;  2CGL A;  4NLB A;  3VTH A;  2FSJ A;  5F2R A;  3PIP L;  2P9L A;  5AQL A;  1R59 O;  3FZL A;  1MDU B;  1DKG D;  2FXU A;  3UB5 A;  3W0L A;  3MN6 A;  4YOT A;  5M1N A;  5GAH P;  1DT9 A;  1NLV A;  1O13 A;  1Z6R A;  2I7P A;  3CPW M;  3CCE N;  4CZF A;  3O9R A;  3EKS A;  4H5R A;  1V4S A;  3M6G A;  3SMP A;  4HTL A;  3IUC A;  4PKH A;  5AQP A;  3C0B A;  4IWV A;  4KH4 A;  4OPA A;  2ZF5 O;  3WT0 A;  3VMF B;  4B1W B;  4BR9 A;  2YI1 A;  3TSU A;  1HKG A;  1NGA A;  2HBJ A;  4HWI A;  3VEY A;  1HKC A;  1KQS M;  3B8A X;  4FWK A;  1U2V A;  2NZT A;  3WQT A;  1YXQ A;  2GEM A;  3Q7C A;  2DPN A;  4PKG A;  4B1Z A;  4GY2 B;  3UKR A;  3HZ6 A;  4JAX A;  5BRE A;  4BQL A;  4IZ9 A;  3TPQ A;  1LOT B;  4JKE A;  2FF3 B;  4QS8 A;  2P9I B;  1U6Z A;  4H0T B;  4JKG A;  1VQ8 N;  1KC8 O;  4GNI A;  3SK3 A;  1YJW N;  4MO5 A;  4A5B A;  4BR4 A;  5BPM A;  3CMA N;  3O6W A;  3A0I X;  4BC5 A;  5AQO A;  3D6R A;  3CD6 N;  3MWT A;  4CJ7 A;  3K9J A;  4FWS A;  1GLA G;  4R79 A;  1HLU A;  1KAY A;  1NGD A;  5AZJ A;  3OBW A;  4AM7 A;  5CE3 A;  5AQV A;  3DLL L;  3L0Q A;  4BC3 A;  3I56 N;  4BQZ A;  2D1K A;  2ZWH A;  4CD3 A;  4WQ5 C;  1KAZ A;  3CF5 L;  5I9E B;  2NRX A;  1G99 A;  1W97 L;  1WUA A;  4A62 A;  1TYQ A;  5CHI A;  4FO0 A;  3OA9 A;  4GVE A;  2FSN A;  4BC2 A;  5LY3 A;  3A8Y A;  3GOI A;  5AQG A;  2E1Z A;  1ILY A;  3N4P A;  3L6Q A;  3ULE A;  1VQ7 N;  5C15 A;  1NM1 A;  1V4T A;  2ASM A;  3AAR A;  4FWM A;  4XEI A;  5JLH A;  3D2F A;  3J8A A;  3MK6 A;  5C12 A;  4K42 A;  1WOQ A;  2QA4 N;  1BA1 A;  4Y0W A;  1ZXO A;  2YHW A;  2CH5 A;  4M7Y A;  3RVC A;  2P9K A;  3MCP A;  3P4I A;  2IVN A;  3VES A;  1NGE A;  3D2E A;  3KHY A;  1BWF O;  4IXC A;  3L4Q A;  4H5T A;  5TKY A;  2NRH A;  2NRT A;  3DJC A;  3VEN A;  4YOY A;  2FLO A;  3CC4 N;  1YJN N;  1VQ4 N;  1VQL N;  3ENB A;  2GWJ A;  2BH1 A;  3FLC O;  3VOV A;  4EHU A;  2HF3 A;  1YHQ N;  4IFE A;  3HOT A;  3ENH A;  3DXM A;  4JD2 B;  4QS7 A;  3WEE B;  2V51 B;  1T6D A;  4JKF A;  2P9P A;  3HSC A;  4BY9 C;  1KAX A;  5AQN A;  5GIN A;  3ID8 A;  3E1Y A;  4MO4 A;  4MDB A;  3WXI A;  1VQK N;  3AAP A;  1NGJ A;  2CGJ A;  4JNE A;  1U2V B;  4L3Q A;  1BUP A;  3VF4 A;  3ZET A;  4CZK A;  2YJF A;  2NLX A;  3WXM B;  4WCE L;  4F9O A;  3O9U A;  4WYB A;  3SAF A;  2D4W A;  1ESV A;  5AZI B;  1NGG A;  1NWK A;  3ZX3 A;  3VPZ A;  1XQS C;  1YVN A;  2NRR A;  3FE1 A;  3ZX2 A;  3HRG A;  3BUZ B;  4BRE A;  1H1V A;  3EE9 A;  4H5V A;  4CZH A;  3WUH A;  4YOU A;  4YOV A;  3AAQ A;  2ASP A;  3A5N C;  4MLH A;  5GIP A;  2ZJR L;  2P9L B;  1YF5 L;  3QBW A;  5DM7 L;  2NRW A;  3Q7B A;  1BO5 O;  3H1Q A;  4MDA A;  4C1N K;  1EQY A;  4NB4 A;  4WQ4 C;  4RTF D;  4H03 B;  1JCG A;  4JKC A;  2CGK A;  5FPM A;  4JK9 A;  3MDQ A;  5M1F A;  5AQM A;  3UE5 A;  4JHD B;  2YHY A;  3E9O A;  3GBT A;  1Q18 A;  3C65 A;  3P31 A;  2D0P A;  4IEE A;  2AA4 A;  3CCR N;  4Z94 A;  4IJA A;  5GAG P;  5EX5 A;  5ADX A;  4A2A A;  3CC2 N;  1HPM A;  1X9J A;  3C7N A;  4JKD A;  1Q7Y O;  4J8F A;  2QWQ A;  2Q0U A;  3CHW A;  2F9W A;  1GLD G;  3LDO A;  4RCH A;  3TSP A;  1YIT N;  1QVG M;  3CJA A;  4IJN A;  3ZEU B;  5GIO A;  2A42 A;  4AM6 A;  5LJV A;  4B1X B;  4DCH A;  3SJH A;  1N8R O;  4BRO A;  3LDP A;  1Q81 O;  4EAH D;  2OTL N;  5TKW A;  4BG9 A;  4CI6 A;  3FZF A;  4XH5 A;  4GV9 A;  2WBN A;  2E8A A;  3VGK A;  5AQW A;  3WQU A;  3SBT A;  3CQX A;  4YOW A;  1M1K O;  3G4S N;  1Q86 O;  3S41 A;  3D7E O;  1XUP O;  3SBG A;  3HTV A;  2E20 A;  1M90 O;  3KWG A;  3UKU B;  3FZM A;  4BR2 A;  2ZJP L;  4GV6 A;  2P9U B;  5CR4 A;  3U8X A;  2JWL A;  3UKR B;  3CCM N;  1Q82 O;  5C10 A;  3G25 A;  3AGR A;  2GEL A;  3C6H A;  3IKM A;  1K8A O;  3T7Z A;  2Q1N A;  4O8U A;  1E4F T;  2P9K B;  5BPN A;  3SAG A;  1T44 A;  5B8H A;  5JIC A;  3MWP A;  4DKW A;  3FFK B;  4O8K A;  3L4I A;  4XH1 A;  3TU5 A;  5C0Y A;  4JEP A;  4FL9 A;  3A5M C;  5EOY A;  2P9I A;  4CBX A;  3D2F B;  4A57 A;  4CBU A;  5GAD P;  2WC9 A;  1BA0 A;  5AZI A;  1K9M O;  2AP1 A;  2E1Y A;  4BRF A;  4WQ4 A;  3KVG A;  3GDQ A;  3MN5 A;  3O1W A;  3EN9 A;  3DXK A;  5AQX A;  4BVP A;  1QQN A;  2E2P A;  5DM6 L;  2FF6 A;  5AQF A;  4A61 A;  4BRC A;  5M1Q A;  3UKU A;  5AQS A;  1LCU A;  2Q31 A;  4IO8 A;  3TTC A;  3BP8 A;  1NMD A;  4C1N I;  2D0O A;  5M1O A;  2P9S B;  3VGM A;  4A59 A;  4BRP A;  3NVK A;  3SAH A;  5FPN A;  5FPE A;  3AGK A;  2Q97 A;  3TTD A;  1YI2 N;  4BRK A;  4FSV A;  3WEE A;  1RDW X;  1BOT O;  1NGB A;  2H3G X;  2ZGY A;  2V7Z A;  4K25 A;  2W41 A;  3E66 A;  4KBO A;  4BRI A;  4BR5 A;  5BRD A;  4FWR A;  2QI2 A;  3WXK A;  2HMP A;  1HKB A;  2E2Q A;  3CCS N;  1K73 O;  2QWL A;  2QW9 A;  3F9M A;  1QZ6 A;  5AFU H;  4CZG A;  3SLC A;  2KLA A;  3CME N;  4DHY A;  3GL1 A;  3KK7 A;  3VF2 A;  1VQM N;  3O80 A;  3M3Z A;  4BGA A;  2KHO A;  1SS6 A;  1VQN N;  4QS9 A;  2V7Y A;  2GUP A;  3P39 A;  3CCJ N;  1JJ2 M;  2BTF A;  2CH6 A;  3I8B A;  4C23 A;  4ILH A;  1VAZ A;  2YJE A;  3FZH A;  1CZA N;  5JVG L;  2VWB A;  1YJ9 N;  1S22 A;  4CBW A;  4M7X A;  3HBT A;  1JCE A;  5AQK A;  2BUP A;  2FSK A;  1X3M A;  2ZGZ A;  4CZL A;  3H3O B;  5BRH A;  2VGN A;  2ASO A;  4M63 C;  3OW2 M;  2PBD A;  3VET A;  2A40 A;  3BF1 A;  3H3N O;  1GLJ O;  3IFR A;  3C7N B;  3CI5 A;  3T69 A;  3O9S A;  4PHT X;  1J6Z A;  4BR7 A;  5M1P A;  4FPA A;  1C0G A;  2NRV A;  4A5A A;  5HOO A;  2P9S A;  3VER A;  3EO3 A;  3H45 C;  5FPD A;  1NGF A;  3LDL A;  4CZJ A;  4U7B A;  5AQR A;  5BR9 A;  3EKU A;  2RHK A;  4NLC A;  1RDU A;  1D4X A;  1NGI A;  3O9Q A;  4BRN A;  2WFB A;  2QWN A;  4ILG B;  5KPZ A;  3VEW A;  3NVM A;  2Q36 A;  4JKB A;  3F2K A;  3OHR A;  3CJ9 A;  3CIP A;  2IVP A;  3TSQ A;  1VQP N;  1QQM A;  3ZEU A;  4JHD A;  5JLF A;  5MLC Q;  3PLA A;  2I7N A;  3CCU N;  1P90 A;  1HJO A;  2Q2R A;  4YDU C;  4H0X B;  1MA9 B;  3E9L A;  5F0X A;  2QEX N;  1JCF A;  4E1J A;  4IDH A;  5E84 A;  3SMS A;  1GLC G;  3P38 A;  2V52 B;  4H5N A;  5KPT A;  3EZW A;  3WXL A;  4BRQ A;  3CJC A;  3O08 A;  4BRM A;  2F9T A;  4B9Q A;  1VQO N;  1VQ9 N;  3IDH A;  4IOA L;  5AR0 A;  3PIO L;  1C0F A;  3AY9 A;  3E9P A;  3ENO A;  4FVU A;  3ZET B;  2ZJQ L;  2GWK A;  3EL2 A;  3MCA B;  5EY4 A;  3O1B A;  1K8K B;  1YAG A;  1W2B M;  2NRZ A;  3QIC A;  3ATU A;  4H0P A;  3MX2 A;  2HBL A;  3CER A;  2QWP A;  1NGH A;  4BRH A;  1ATR A;  4K43 A;  3OBY A;  4ILJ A;  2JWK A;  1IG8 A;  2P9P B;  1DEJ A;  1YUW A;  4FWL A;  1ZC6 A;  3O9T A;  4OPH A;  2ITM A;  2HF4 A;  4PKI A;  3HM8 A;  5KPR A;  2VCP A;  4WFB L;  2EWS A;  3G71 N;  4WFN L;  3LL3 A;  5BRF A;  4BR0 A;  3ATV A;  3QFU A;  5EXW A;  5BN9 A;  1NBW A;  4JK7 A;  4BRA A;  3LDN A;  5JVH L;  4EIA A;  3RSE A;  1S72 N;  4PL7 A;  1EO1 A;  2YCH A;  5AQT A;  3O5B A;  4WQ5 A;  3MN9 A;  4FWP A;  1S3X A;  1BG3 A;  2HST A;  2Q0R A;  2QWO A;  4I6M B;  4LC9 B;  4O5F A;  4YDU A;  4G9Z A;  3QML A;  4WF9 L;  4XH4 A;  3ULE B;  2A6A A;  3H6E A;  3J7Z O;  4FWO A;  3VTI A;  2WUS A;  5AQI A;  4B1U B;  5AFU A;  3G6E N;  5H1S Q;  3F5T A;  2E2N A;  2NNW A;  4H5W A;  5AQJ A;  4U67 L;  4YOX A;  4OO1 J;  4BRG A;  2P9N B;  1NGC A;  1KD1 O;  5AQU A;  3BF3 A;  1TYQ B;  1SAZ A;  4JN4 A;  1GLB G;  4FPB A;  4NO7 A;  3ZYY X;  5C2D A;  5ELZ A;  3C6A A;  3MMV A;  3GG4 A;  4UY8 O;  3JS6 A;  1KXP A;  3GE1 A;  1DGK N;  2OTJ N;  1SQK A;  1HX1 A;  2P9N A;  4CZM A;  1ZBS A;  3IMX A;  5AQH A;  3HOS A;  2RE2 A;  2OAN A;  3LM2 A;  2A3Z A;  4H0V B;  4KH5 A;  4PL8 A;  3QB0 A;  4CZE A;  1P8Z A;  3CXC M;  1YIJ N;  4EFH A;  4RWT A;  5AZJ B;  5AQY A;  3U9Z A;  3NMU A;  3U9D A;  3ZX0 A;  3CQY A;  4ISF A;  3VF6 A;  4JKG B;  5KQ8 A;  4YOR A;  3MN7 A;  3H46 O;  4IEI A;  3VEX A;  3O8M A;  3R1X A;  3FZK A;  3BEX A;  2P9U A;  2UYT A;  2HBK A;  3LDQ A;  3CET A;  3QFP A;  1K8K A;  1ATN A;  1MWK A;  5AQQ A;  3QDK A;  4WFA L;  3VEO A;  4AF1 A;  4B1V A;  4DB3 A;  2E2O A;  2VYP A;  2QWR A;  4BGB A;  5GAE P;  3DWL A;  4GV3 A;  4I6M A;  3R8E A;  4BVO A;  1E4G T;  3EE8 A;  2F7T A;  4KH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...