3CETA

Crystal structure of the pantheonate kinase-like protein q6m145 at the resolution 1.8 a. northeast structural genomics consortium target mrr63
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
300
Chain Sequence
MILGIDIGNTKITELHENGEFKVHHLVSHVALVTTAETKKEGVDNILNAAESAFGSNISVFDSNGNFISLESAKTNNMKVSASNWCGTAKWVSKNIEENCILVDMGSTTTDIIPIVEGKVVAEKTDLERLMNHELLYVGTLRTPISHLGNTISFKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVAEKYGSKKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSFAVAELLKNELLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved archaeal protein
publication title Crystal structure of the pantheonate kinase-like protein Q6M145 at the resolution 1.8 A. Northeast Structural Genomics Consortium target MrR63.
rcsb
source organism Methanococcus maripaludis s2
total genus 97
structure length 300
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01968 Hydantoinase_A Hydantoinase/oxoprolinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cetA01
3.30.420.190 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 conserved archaeal protein q6m145 3cetA02
4AM6A 1QZ6A 3ATVA 4K43A 4IXCA 3VOVA 4CZIA 3CERA 3H46O 3WXLA 3M3ZA 3FZLA 5CE3A 3KHYA 4B1XB 4BR4A 5LY3A 3S41A 3DJCA 5AZIA 2HOEA 3QDKA 4FWRA 1BU6O 2HF3A 3B8AX 2V51B 3BF3A 5BPLA 1MDUB 5EXWA 4BG9A 1NGGA 3ULEB 3U4LA 2P9NA 4HTLA 2DPNA 1BA0A 3FLCO 3O6WA 4BC4A 5EOYA 2Q0RA 4BRFA 2QWRA 3L0QA 3FE1A 4BVOA 1BO5O 3CETA 3CJCA 4EHTA 5F2RA 3VETA 1LOTB 1IJJA 4FSVA 3RSEB 1KAXA 2Q1NA 1SZ2A 4FWSA 4PKGA 3ZX2A 5JLHA 5BN8A 4BVPA 2J4RA 3QFPA 1X3NA 4XH4A 3VERA 4BR0A 4ISEA 4H0TB 2Q97A 3LDPA 5AQIA 4PKHA 1TUUA 3VGKA 1LCUA 2D1KA 1HPMA 2YHWA 1WOQA 1TYQA 2I7PA 2P9UB 5AQSA 2CH5A 2QWNA 3CJAA 4BR7A 2A40A 3VEWA 5AQLA 4O5FA 3WT0A 3VENA 4A2AA 5JICA 2ZF5O 1HKGA 3EKUA 5AQUA 3QBWA 4H0VB 2FSKA 3FZFA 2FXUA 4BR2A 2QM1A 1HKCA 5EY4A 2E1ZA 4XH1A 5LJWA 3MDQA 3ULEA 2AP1A 2P9PA 4PL8A 1MA9B 2Q2RA 4K41A 5EVZA 1EQYA 4B9QA 4LC9B 5FPDA 4NB4A 4XEIA 1HJOA 2GEMA 3ENHA 4WQ4A 2GWKA 3DWLA 1JCGA 2QWOA 3DXKB 1HLUA 3DXMB 1XQSC 2NRHA 3CQXA 3GG4A 3D2FB 3IDHA 4H03B 3L4IA 5F0XA 3J8AA 3ID8A 1RFQA 4FL9A 3C0BA 4EIAA 4WQ4C 1GLBG 3M1FA 4NO7A 3QFUA 3JXUA 3CJ7A 3ZETB 1ATRA 5AQRA 1RDWX 1KXPA 3O1WA 5BRHA 1KAZA 1U6ZA 1ESVA 1U2VA 2E1YA 3QMLA 4DCHA 4BGAA 2BTFA 2E20A 1QQMA 2QWMA 1IG8A 4BC3A 2F9TA 5BPMA 3M6GA 3AAQA 4FPAA 3CHWA 3OHRA 4JD2A 1NGFA 4FOEA 3UKUA 1GLAG 1X3MA 3WEEB 2NLXA 3U9ZA 3A8YA 5AFUH 1YXQA 1Z05A 4M7XA 3CJ9A 5BREA 1S22A 3L6QA 2E2PA 4FWOA 4HWIA 4QS9A 3VF2A 1YVNA 1BA1A 1DEJA 2E2OA 3ZX3A 4BRQA 4FWLA 3D2EB 5I9EB 2HF4A 4GY2B 2V7YA 3CJBA 3UKRB 2GTDA 3G25A 1NGIA 3FFKB 4A2BA 1ATSA 1S3XA 4QS8A 4C23A 5FPMA 5AQXA 1HX1A 2EWSA 4H0XB 4J8FA 4CD1A 3WUHA 4H5VA 4Z94A 3H1VX 1X9JA 4JHDA 5AQQA 4M7YA 5AQNA 1NMDA 4A62A 2A42A 3GL1A 1C0GA 2YHXA 4RTFD 4E1JA 5KPTA 3CQYA 4WQ5C 4FOIA 1NM1A 2YCHA 3CJ1A 5AQVA 1ZBSA 1BDGA 3WEEA 5KQ8A 3R8EA 2E2QA 4PKIA 5AQHA 4IO8A 1K8KA 2FSJA 4RCHA 3A5NC 3C7NA 3CIPA 4B1WB 5AZJB 4BRDA 2KHOA 1P8ZA 2YI1A 5BRFA 2NZTA 4ISGA 2P9SA 4BR5A 2FF3B 1MWKA 4JN4A 5AQPA 5AR0A 5AQTA 5BPNA 1NGCA 1QHAA 1XUPO 2CGJA 3O8MA 5EX5A 2F9WA 2CH6A 3I33A 3IFRA 4FWNA 3TU5A 4CBXA 3GDQA 3O5BA 3W3DA 3A5MC 3EO3A 1ZXOA 1DKGD 3IUCA 4B1VA 2P9KB 3QB0A 5AFUA 1RGIA 3GOIA 3MCPA 3O08A 5F1XA 4O8KA 5JLFA 4BREA 1BOTO 3R9PA 3MN6A 4I6MB 3LM9A 4H0OA 1Y64A 4CZJA 1GLCG 1NGDA 1QZ5A 4CZKA 1BWFO 1NGBA 3F9MA 3WQTA 2ASMA 1Z6RA 3H1QA 2BUPA 2ASOA 4CI6A 1ATNA 2WUSA 3P4IA 2Q0UA 3O80A 1D4XA 2P9LB 2GWJA 3A0IX 1BG3A 2IIRA 5KPRA 3O1BA 2E88A 3RSEA 4BG8A 3FR0A 4BRMA 5AQFA 2V7ZA 5BRDA 4Y0WA 3A5OC 3EKSA 1YUWA 3AAPA 4BRLA 2UYTA 4IJNA 3AARA 4CZMA 2P9IB 1GLDG 5LJVA 4H0PA 3ZEUB 2OANA 2FSNA 2A5XA 4BRKA 2GELA 3KZBA 3AY9A 1SQKA 2W40A 3HTVA 3W0LA 2P9UA 2CGKA 3VEXA 3SMSA 3U9DA 1TUYA 4H5NA 3O4WA 1NGAA 4BC5A 2IVNA 4FWMA 5AQMA 4BRNA 3GE1A 5AZIB 3LDNA 3VF6A 1SAZA 2V52B 3FZHA 5AQOA 3IMXA 4H5WA 3WXJA 3LDQA 2P9NB 4MO5A 3VESA 3WXIA 1QQOA 4FO0A 1GLLO 2GUPA 1GLJO 3I8BA 4CZGA 3U8XA 5AQZA 2PBDA 3DXKA 4B1ZA 1HKBA 3DXMA 2ASPA 3H3OB 3D2FA 4JNEA 4DQ8A 2QXLA 1R59O 1BUPA 1QQNA 4MLHA 3ZETA 4M63C 4WQ5A 4BQLA 5TKYA 2ZGYA 2ZGZA 3HSCA 5AQKA 3QBXA 4CJ7A 2QWPA 3FGUA 3ATUA 2QWLA 3BUZB 2HMPA 3WXKA 1Q18A 2IVPA 1V4TA 4CBUA 1TYQB 4H0YB 4MO4A 2A41A 4BRAA 4YDUC 5KQDA 4K42A 1DGKN 4BQZA 3EZWA 4EFHA 1NWKA 2D4WA 2VCPA 1H1VA 5FPEA 1T44A 4ISFA 4IWVA 4BRHA 3VGLA 2A6AA 3MK6A 2W41A 2E2NA 5ELZA 4CZFA 2IVOA 2YJFA 2P9PB 4CZEA 1OKJA 3R6MA 4FPBA 4H5RA 3EL2A 2Q31A 3D2EA 5FPNA 2YHYA 4L3QA 3A5LC 5AQGA 5ADXA 1YAGA 4FWQA 3LDLA 4A61A 1GLEG 5E26A 3UKRA 3GBTA 1NLVA 3SK3A 4AM7A 1T6DA 1NGJA 3H6EA 3H3NO 2YJEA 3VEOA 4BRPA 1GLFO 5AQWA 4CZLA 1JCEA 4BC2A 3KVGA 1KAYA 1HUXA 2PAVA 5BN9A 4JAXA 4BRGA 2ITMA 4DB3A 3D7EO 3DAWA 5B8HA 1V4SA 3HZ6A 5BR9A 1U2VB 3H45C 4QS7A 2QW9A 2A3ZA 4RWTA 3BEXA 4BR9A 5JMVA 3MN7A 2FLOA 3HI0A 4JD2B 4EHUA 1ZC6A 3UKUB 2VYPA 4BGBA 3CI5A 3MMVA 4EAHD 3FZMA 4KBOA 3LDOA 4H5TA 1G99A 3QICA 1XC3A 3HBTA 4BRCA 5AZJA 3UB5A 4CBWA 1NGHA 3BF1A 1E4FT 1E4GT 1NGEA 1C0FA 3VEVA 3VEZA 3VGMA 4BROA 3VEYA 4CZHA 3LL3A 4B1YB 4MLEA 3TPQA 2FF6A 3MN9A 5ADXH 4K25A 4GNIA 5AQYA 3EN9A 2P9KA 1T6CA 1CZAN 3VF4A 3BP8A 3FZKA 2ZWHA 4I6MA 4XH5A 3UE5A 4JHDB 4WYBA 1J6ZA 4PL7A 4FWPA 4IZ9A 2H3GX 3SLCA 4F9OA 3VPZA 5E84A 2P9LA 3SJHA 2E8AA 2QWQA 3HM8A 2D0PA 2VWBA 2Q36A 3SMPA 3WQUA 2D0OA 4FWKA 1JCFA 1MWMA 3ENOA 1K8KB 1WUAA 4BRIA 5KPZA 3C7NB 3LM2A 3MN5A 2CGLA 5AQJA 2I7NA 4DHYA 2P9IA 1NBWA 2P9SB 4YDUA 3ZEUA 2AA4A 4B1UB 4IJAA 3ZX0A 3JS6A 4CD3A
chains in the Genus database with same CATH superfamily
2NRWA 4CHQA 4K43A 4IXCA 3WXLA 5HRNA 4AF1A 3K5LA 3M3ZA 3KHYA 4BR4A 3SI6A 3S41A 3P38A 1JLGA 1XI1A 1SKWA 2HF3A 3B8AX 5BPLA 3DMJA 2YNFA 4JKHA 1IO2A 3QETA 1VRTA 1NJYA 3TTFA 1BA0A 1NKCA 4JK7A 5EOYA 4FM2A 4CFBA 1RBTA 3SUPA 2QWRA 4Q5VA 4CJPA 4BVOA 2PYJA 5GADP 1HPZA 1LOTB 1IJJA 2HSTA 4F2RA 1HYSA 4B3SK 4CJVA 3RSEB 3SZ2A 1KAXA 4RW9A 3RMBA 1SZ2A 5M1PA 4M3YA 4M45A 3QFPA 1FK9A 1X3NA 2XO7A 4BR0A 1NJZA 5K14A 3N4PA 2XY5A 4A5BA 1DLOA 3J7YP 4YHHK 1LAWA 2ZJQL 2D1KA 2YHWA 3RRHA 1TYQA 1JLCA 2I7PA 3LDSA 3ZCMA 4DSIA 4CEAA 5AQSA 2A40A 1I39A 2IDOA 1S6QA 4DQRA 4WFAL 4JI6K 2Z1GA 3EKUA 3OS1A 3CXCM 3AGRA 3NF6A 4ILJA 2QM1A 1D9DA 5EY4A 3DLLL 4XH1A 3BDPA 3CQ8A 3VQDA 4PL8A 4G9ZA 3CG7A 4K41A 4B9QA 4IEEA 3V9UA 4LFAK 4N41A 4DG1A 4LF5K 3SUQA 2YKNA 2ETJA 2YV0X 1HJOA 3AO2A 5CHIA 4KH4A 4DTJA 3SPZA 2GWKA 4F3OA 4LF6K 1JCGA 4YOTA 4PHTX 4DFMA 3CQXA 2NRHA 3GG4A 5F0XA 4FM1A 3J8AA 3LZJA 1KLMA 4NO7A 2HHUA 3Q7BA 3CJ7A 3KJVA 1KXPA 1BIUA 3O9QA 5EU7A 4CJ5A 1VQPN 1U2VA 3QMLA 2QKKA 5DMRA 2E20A 2F9TA 1TV6A 3ZSYA 4FPAA 1HNZK 5C42A 1FKOA 3L2VA 4ELTA 4F8RA 4H4MA 3FFIA 3QNOA 1T7PA 4JI5K 3CMAN 1Q81O 4M7XA 3OYEA 3L6QA 2E2PA 4QS9A 1QS4A 4IFEA 3THWA 4J2AA 4FWLA 3TAPA 3D2EB 5I9EB 4B3RK 3VQ4A 3CJBA 4JKGA 3UKRB 3OYCA 1D8YA 1BISA 2GUIA 1S3XA 4JLHA 2F8SA 4QS8A 3KD5E 2A1SA 2IGIA 4FJMA 2EWSA 4J8FA 3MWPA 1ZBFA 3QIPA 3DM2A 4CK2A 2XY8A 3TAEA 5DM6L 1K6YA 5AQQA 4DR7K 1TK0A 3WNFA 4M42A 1S6PA 3C94A 4FZZA 4KB0A 3DLKA 1ZYQA 3S3MA 1BDGA 3NH1A 1YITN 5AQHA 3AVIA 3VQBA 2NRXA 3TSPA 4CHZA 4X66K 2KZZA 4CHYA 3C7NA 5AZJB 4BRDA 4CF8A 3VA3A 2G8FA 5BRFA 3CCQN 2NZTA 4W5RA 1LW2A 3MAQA 4ISGA 4GV3A 1WAJA 4IOXA 1MWKA 3CCJN 5AQTA 5T7BA 4NCBA 2CH6A 2FBVA 3IFRA 4CBXA 2PYLA 2NRRA 3V1OA 4B1VA 1TKZA 2WC9A 1ZBHA 3MCPA 3O08A 1BOTO 2BANA 3MN6A 1MU2A 1VQKN 4H0OA 4CZJA 1NGDA 4B3MK 1NGBA 4CEFA 2OYQA 3HPHA 3L2UA 1U49A 2BUPA 1ATNA 3P4IA 2Y1JA 3C6TA 4CW7B 3I8DA 1D4XA 4MDAA 3A0IX 4B08A 2WFBA 1IKVA 5KPRA 4BG8A 4BRMA 5KGXA 2D0AA 4EZ6A 1J9AA 4DQQA 1YJWN 4KI6A 2IAJA 1SL0A 4OPJA 3NVMA 4JKAA 3AARA 3OW2M 3HOSA 4H0PA 4HHTA 2O8CB 4FVUA 4CGHA 3AY9A 3NCIA 3HTVA 1WAFA 2CGKA 3ZT0A 3QIOA 4CEQA 3O9TA 1KVBA 1C0UA 4BRNA 1HNIA 1WB9A 3GE1A 3CPEA 3M8RA 4DFKA 3FZHA 4CHPA 5KTQA 1QE1A 3CCVN 1WSHA 2HNYA 2NRZA 4M3ZA 2GUPA 1S5JA 2PBDA 3DXKA 5I3UA 3RVCA 2UXBK 3D2FA 3T3FA 4DQ8A 1BCMA 3MCAB 1BUPA 1QQNA 4MLHA 1KQSM 3SV3A 3O9SA 4DV7K 2ZGZA 5AQKA 4CJ7A 2QWPA 3C65A 2P1JA 2QWLA 3VMFB 4FLVA 3CC2N 4DUYK 1TAQA 4H0YB 4BRAA 1CZBA 3RWUA 4FLXA 4LH5A 4MQ3A 4B9LA 1NK0A 3EZWA 1U45A 2F4VK 1XHXA 2VWJA 2HHVA 3AVLA 3VGLA 3MK6A 4OGCA 5KRTA 1XNRK 4JS4A 4CZEA 1RTHA 3K9JA 3DRRA 4Z0UA 4H5RA 2Q31A 5FPNA 3F9KA 4L3QA 1YAGA 4F3TA 4NLBA 5E26A 3OYKA 1NK8A 1NLVA 3OVNA 3SQ4A 1T6DA 3H3NO 2YJEA 3VEOA 4BRPA 2WOMA 3F5TA 3KVGA 2PAVA 5BN9A 5HRSA 1WSFA 3D7EO 3EEQA 4O55A 1NOYA 5TKWA 3K0SA 5LMNK 1RILA 4YOWA 5CYQA 4RWTA 5LL6Z 4FK2A 3BEXA 4B9SA 4DV6K 4DR3K 4EHUA 2HHTA 3AA4A 4OGEA 3OS0A 4H4OA 3VN5A 4KBOA 4W5OA 1G99A 3J81O 1EP4A 4BRCA 1U4BA 4O0IA 4DR1K 3AVKA 1E4FT 5C25A 1E4GT 1NGEA 2YNGA 5CR4A 2G8VA 1GOCA 4E7LA 2RKIA 5AJ3K 2VG5A 3U3YA 4B1YB 3TPQA 4WCEL 4LY7A 4K25A 4DTRA 4GNIA 3L4QA 4YFUA 4DU3A 4X62K 3V9SA 2F8TA 3CFOA 3EN9A 1P90A 3EYZA 3CFRA 1HNVA 4B8AB 3BP8A 4IFYA 1A5WA 4CEOA 2ZWHA 4XH5A 4KHYA 2EX3A 4K0KK 2B6AA 1J6ZA 3K57A 4DV3K 2HB5A 3AVNA 1VQ9N 2P9LA 1I94K 3SJHA 2QWQA 4CEZA 4KTWA 1BIZA 3HT3A 3G71N 4JI4K 1K8KB 1YF5L 1WUAA 4DWIA 3RMAA 3LM2A 4B9MA 3OYIA 1Q86O 4DHYA 3HJFA 5E41A 3ZEUA 4B1UB 4Y1DA 1OVQA 3JS6A 1QZ6A 3SAFA 3KLGA 1M1KO 1WN7A 1JL1A 4CVNE 4W5QA 4OPAA 2F96A 3THYA 3FZLA 5CE3A 4B1XB 2HNZA 3VQQA 4CEBA 4DV1K 1XMQK 3K5MA 3OYDA 1XC9A 3C6UA 2V51B 1MDUB 1NGGA 1C6VA 3Q7CA 1HQEA 4HTLA 2DPNA 2X6NA 4BC4A 3L0QA 2R7YA 1CZ9A 1BI4B 3R1XA 2AJQA 3ZX2A 4U7BA 5BN8A 4BVPA 1WSEA 4OKKA 4ID1A 2QA4N 4EP4A 4PY5A 4FW2A 2YNHA 5AQIA 1SV5A 4BE2A 4E7KA 3ZSWA 3NF9A 1RBVA 3NGIA 4E3SA 2P9UB 3PX4A 3PSFA 4O5FA 4M41A 3WT0A 4CFDA 2NNWA 4GV9A 3ZSOA 1ZBIA 3CC7N 1KD1O 1F21A 4BR2A 2E1ZA 2E6LA 5LJWA 3MDQA 2AP1A 4IDKA 3CCLN 3SYZA 1MA9B 2KTQA 4DV0K 4LC9B 4NB4A 4NYNA 2GEMA 1RDAA 4CIFA 4WQ4A 4AHRA 3WNEA 4N47A 2JGUA 1D9FA 2HBJA 4E7JA 1HLUA 3DXMB 4GKJK 1RDDA 4YORA 1RT2A 3C0BA 4KHWA 4BDYA 4JI1K 3NBPA 1T8EA 3M1FA 3QFUA 3ZSRA 5D3GA 3ZETB 1ATRA 5AQRA 1EKEA 3O1WA 5HROA 1ESVA 2E1YA 4BGAA 4PA1A 4DV4K 1XHZA 1QQMA 3WNGA 3AO1A 4BC3A 3NGZA 3E66A 2O8FB 5BPMA 4YOYA 3CCEN 4JD2A 3UKUA 3PX6A 4J2EA 3IG1A 3WEEB 1WNSA 3U9ZA 4DTOA 1VQMN 1Z05A 4JKCA 4CECA 4DR2K 5HLFA 5BREA 4FWOA 1E3MA 4HWIA 3D0PA 4OX9K 1T05A 1S9GA 2VQFK 4DTNA 4RW8A 1VSJA 1C1CA 2E6MA 1N5YA 1EXQA 4GY2B 1NMNA 1RDBA 2PZSA 2GTDA 4RW6A 1NGIA 4K8XA 3LP2A 1KFSA 3S3OA 5C2FA 5FPMA 4BDZA 4UY8O 4H0XB 3WUHA 4Z94A 2VG6A 1X9JA 3TTDA 4JHDA 2HW3A 1HJRA 2YHXA 5CY4A 4E1JA 5KPTA 4FOIA 1QSSA 2YCHA 4DSJA 5AQVA 3UIQA 3WEEA 4KB1A 3O4NA 3OYMA 4AHSA 3JAMO 4DUZK 3K59A 1RBSA 1YTUA 4DR5K 1Q9XA 2O8BB 3EY1A 3O3FA 3H08A 1NJXA 2P9SA 1HYZA 5C10A 4FK4A 3M8SA 2X6SA 2F9WA 3I33A 4DQPA 1K73O 3AVFA 3BZCA 1JKHA 3BY5A 3A5MC 2FBTA 3CC4N 3PV8A 1DKGD 3TANA 2JLEA 3HXMA 4DSFA 5JLFA 4BREA 1RDUA 4MDBA 3R9PA 1VSHA 1N33K 1Y64A 1IG9A 1GLCG 2HNDA 2ZD1A 4FJ8A 1VSEA 4CZKA 3WNHA 3NF7A 3WQTA 4JRQA 3TAGA 1OVYA 4CIEA 2Q0UA 3O80A 4JKBA 1NK5A 2GWJA 2QXFA 2IIRA 3T19A 2E88A 3PUFA 4K8ZA 3RSEA 3G6EN 3FR0A 3AVAA 1YJNN 5C24A 4Y0WA 3KK1A 3KTQA 3VQ6A 5GIPA 2VQEK 2UYTA 3OYLA 4CZMA 1RTJA 1FW6A 4IG0A 1J5OA 2IOCA 1QTMA 1VQON 5KI6A 3J80O 4FLYA 4FLTA 1VQ4N 3SMSA 4O5BA 5MLCQ 2KQ2A 1TL1A 2QKBA 1TKXA 3O4WA 4RW4A 3ZSXA 4AHCA 5AZIB 3OYAA 2V52B 4LD0A 3IMXA 4H5WA 4E19A 4CF0A 4MFBA 2HHWA 3WXJA 3LDQA 4RG8A 3B6PA 2P9NB 4MO5A 4C1NI 1QQOA 4FO0A 1L3UA 4LF8K 3I8BA 4BY9C 4OVLA 3T7ZA 2RN2A 1IBMK 1HKBA 2ASPA 3H3OB 3ITHA 2Z1JA 3LAMA 5FROA 3VQ5A 3RRGA 2UUCK 5FLXO 4CEDA 2QXLA 3KK7A 4NLCA 4FJJA 1T3VA 4KHUA 4M63C 4YOUA 2BDPA 2ZGYA 3OA9A 3HSCA 4CJUA 5C15A 2XRIA 1JL2A 2Z1HA 3BUZB 3WXKA 4DFJA 4CBUA 2HHSA 2A41A 3K5OA 3KD1E 5KQDA 4GV6A 4HTUA 1XNQK 1NKBA 3E9PA 3U3GA 3P39A 4IBNA 3AA5X 5FPEA 4ISFA 4DS5A 2A6AA 2HBKA 1X9WA 2B5JA 2VG7A 2P9PB 2YJFA 4KO0A 1RNHA 4CEEA 3QEXA 5CZ2A 3EL2A 3D2EA 2O8EB 5AQGA 3A5LC 1BCOA 4A61A 4A57A 1GLEG 3UKRA 1NG9A 1RBRA 4AM7A 4NXNK 4JI3K 4KTQA 2O4IA 1GLFO 1KAYA 4JAXA 3K58A 2XY6A 5SWMA 1IKXA 3PIOL 4I2PA 1ITGA 3DLRA 2RPIA 4CESA 1RCHA 4AQYK 3HZ6A 1C0MA 5BR9A 4JKFA 4ELVA 3MECA 3V81A 4DU1A 3HL8A 3HM9A 1HRHA 3LALA 1HQUA 3HI0A 4JI7K 2Z1IA 1S9EA 3MXJA 4BGBA 4NYFA 2JWKA 5FDLA 3FZMA 4OPHA 4OLAA 3SAGA 2W6LA 2G8IA 5AZJA 1QHTA 3UB5A 4CBWA 4C8KA 3L3UA 1C1BA 2KLAA 3LWLA 5LMUK 1NOZA 3VEZA 2YHBA 4BROA 4CZHA 3C6HA 2O8EA 3DI6A 1WLJA 1Y97A 3BZKA 3LL3A 4MLEA 2HHXA 3KKRA 1RDCA 4KHNA 2KKZA 4ELUA 4FJGA 2HVHA 5FRNA 1YVUA 1T6CA 5J2QA 3VF4A 1RT5A 3VQAA 5BR8K 5FRMA 2ZJRL 1J54A 4M3RA 4W5TA 3IAYA 4C8LA 4FWPA 4LF9K 5E84A 2HVIA 4GVEA 4AHVA 2D0PA 3CF5L 3LANA 2Q36A 3SMPA 3QO9A 2D0OA 4FWKA 3ENOA 1U04A 5KPZA 4CJWA 3C6AA 5AQJA 1A5VA 2RE2A 4W5NA 4YDUA 2O8CA 1A5XA 2AA4A 1XMOK 1TVRA 1OH7A 4IJAA 3ZX0A 4BR5A 4LSNA 2ATQA 3ALYA 3ATVA 4BE0A 2BH1A 5H1SQ 3SUOA 3CERA 3E01A 3H46O 4FJKA 2ZQBA 4I9LA 1W0HA 2HOEA 4JI0K 1Z26A 3QDKA 1BU6O 2NRTA 3BF3A 1S1WA 1NK9A 4CIGA 3L2RA 3LPUA 1JLEA 3DLEA 3ASMA 4IOAL 4KRFA 3U4LA 1VSMA 3AV9A 3FLCO 3O6WA 4DS4A 3QEWA 1VQNN 4BRFA 3FE1A 3CETA 4EHTA 3CJCA 4DKWA 4V19S 4HVJA 2PFUA 4WFBL 4FSVA 4GMJB 3ZT1A 4JV5K 1J53A 2Q1NA 4FWSA 2X78A 4J2DA 5JLHA 5HRRA 2NUBA 2J4RA 3U6FA 2RHKA 1VRUA 4H0TB 3LZIA 2G8KA 3S3NA 4LFBK 4DTMA 3LDPA 4Z4CA 2G8WA 4PKHA 4FLUA 3IKMA 1LCUA 3TI0A 1HPMA 1Z25A 3RMCA 1WOQA 4H8KA 1EO1A 4N5SA 4M3WA 4KHPK 2QWNA 3LAKA 3VEWA 1KFDA 3TWHA 5JICA 2E4LA 1IH7A 1WSJA 3QBWA 4FJ7A 4IO9L 1REVA 2FSKA 3FZFA 1HKCA 1N6QA 2Q2RA 1KSPA 5FPDA 2P5GA 4XEIA 3I55N 3NHGA 3J7ZO 3F73A 1VHXA 1EWRA 2QWOA 4HUEA 3LP3A 1XQSC 4H03B 3HP9A 3L4IA 2GX9A 4FL9A 3M8PA 3TAFA 1JLQA 2VGMA 2WTUA 3E9LA 4X64K 3JXUA 1RDWX 4YY3K 5BRHA 1KAZA 3G0ZA 2OCEA 3L2WA 1NK6A 3ZT3A 3I0RA 4B3OA 2QWMA 3CCMN 3M6GA 3CHWA 3OHRA 1M90O 1X3MA 4L8RB 2NLXA 1L3TA 3A8YA 3IRXA 2OZMA 4HCCA 4HUFA 4FJNA 1U47A 4WF9L 4CJSA 2KW4A 3CJ9A 1S22A 4ILGB 1VQ8N 5GAGP 3CPWM 4PQUA 3V9WA 3HO1A 5M1NA 1DEJA 5SZTA 2E2OA 2WBNA 4DLGA 3L3VA 3DYAA 4C8OA 3O9UA 2HF4A 4XIUA 1JXBA 1IKWA 2OPSA 3G25A 4IDHA 4A2BA 1ATSA 3E9OA 4C23A 1YIJN 2ITGA 1N32K 1HX1A 4BDPA 2OA8A 1DTQA 4H5VA 3TABA 4Z4IA 1KVAA 2QEXN 4KV8A 1VQ7N 3SPYA 4CGDA 4OO1J 3OYNA 2O4GA 1B92A 3DOLA 3CQYA 4CHOA 4KPYA 4JI2K 3CJ1A 3ZT2A 1SL2A 5KQ8A 2E2QA 1ZBLA 4QAGA 2ZE2A 1CLQA 3LP0A 4N76A 1K8KA 2FSJA 4CFCA 1EWQA 2D5RA 3VQCA 4Y1CA 1RT7A 2KHOA 1P8ZA 2YI1A 3N4QA 3SQ1A 1EX4A 4WFNL 3EZ5A 4FM0A 3QERA 5M1FA 1TGOA 2P51A 4CJTA 2FF3B 5AQPA 3SQ2A 5AR0A 5BPNA 2KFNA 1XUPO 2CGJA 4CHNA 5EX5A 2O8DB 1TAUA 3C95A 3GDQA 3ZSZA 3W3DA 3VQ8A 2P9KB 3QB0A 1RGIA 5F1XA 4O8KA 3RR8A 2G8UA 3OYGA 2FBYA 1X1PA 4A5AA 4I6MB 4JK8A 3LM9A 4B3TK 4AHUA 3P5JA 1QZ5A 1BWFO 2DFEA 3F9MA 4CJQA 1Z6RA 4O4GA 1K8AO 3HK2A 2WUSA 4ILHA 4DF8A 1BI4A 3M5RA 3ZT4A 1O1WA 1ASVA 1UA1A 2V7ZA 3BGRA 3A5OC 3EKSA 1YUWA 3AAPA 4IJNA 2P9IB 1GLDG 5LJVA 2OANA 1WBBA 2FSNA 4FCYA 4I9QA 2A5XA 3MWTA 3KZBA 4U67L 1IV0A 3SBTA 3PX0A 3PIPL 2W40A 3W0LA 2P9UA 3AA2A 3ENBA 3VEXA 3U9DA 3NF8A 3MEEA 2LSNA 1HNWK 1TUYA 4FWMA 4Z4GA 4KAZA 2OPRA 4NCGA 1SAZA 2WONA 4C8MA 5C12A 3OBYA 4B8CA 3VTIA 5AQOA 3VA0A 4FZXC 3I0SA 4CF1A 3RTVA 3VESA 1VQLN 2EHGA 5IT9O 1GLLO 2PY5A 3EE9A 3KIOA 4AILC 4CZGA 3U8XA 5AQZA 4B1ZA 2HBMA 3DXMA 3QESA 2X74A 4JNEA 4FVMA 3ID6A 3V9XA 5KRSA 1VSDA 1R59O 3ZETA 3O9RA 4WQ5A 5TKYA 5J1EA 3L8BA 4DV2K 2UXCK 3FGUA 3ATUA 3CM6A 4O44A 1Q18A 2IVPA 2IC3A 1V4TA 3E1YA 2O8FA 1LWFA 1TYQB 4MO4A 4YDUC 3MX5A 4K42A 1J5EK 4FJ5A 4BQZA 4O0JA 4ID5A 1Q9YA 4KH6A 4EFHA 1NWKA 3O3HA 2D4WA 1H1VA 5HRPA 4IWVA 4OLBA 3KK2A 2E2NA 5ELZA 2IVOA 3JYTA 3TR8A 1OKJA 4JKEA 4FPBA 1QSYA 3SJJA 5ADXA 3V4IA 4QOZB 4PWDA 3LDLA 4FJ9A 3TSQA 5GINA 1B9DA 3SK3A 1TKDA 3OY9A 1NGJA 5J2MA 3H6EA 3NFAA 4IFVA 1YTAA 4CZLA 3CM5A 2HBLA 4BRGA 2ITMA 4DB3A 1NK7A 4ZTFA 5B8HA 1W97L 5IWAK 3ZYYX 1T03A 3K9KA 4I2QA 3R3LA 2D0CA 1U2VB 4KREA 4FJLA 2QW9A 2A3ZA 4DTSA 1KVCA 4BR9A 3HVTA 2OZSA 4OKJA 2Q3SA 1LW0A 1ZC6A 4EZ9A 3CCUN 1YHQN 4CFAA 3HVRA 3CI5A 1YJ9N 3CCSN 2HHHK 4EAHD 4CF2A 3LDOA 3V9ZA 4CJLA 4H5TA 3M8QA 4FLWA 3QICA 1XC3A 3HBTA 2O8BA 4BE1A 1RTIA 3BF1A 3A2FA 3F2KA 4RW7A 3THWB 3CFPA 2DFHA 1C1AA 5KGWA 3OTOK 1L5UA 3VEYA 1KLNA 1S1TA 3HPGA 1LV5A 1WSGA 4JKGB 4DU4A 4OKEA 5AQYA 1FXXA 4N56A 1FJGK 1K9MO 3SBGA 4CJ3A 1VK0A 1CZAN 4FW1A 4FXDA 3KLEA 2OTLN 2GBZA 4JKDA 3TAQA 4CERA 3UE5A 4HCBA 4M3XA 2HMIA 1X9MA 4WYBA 2FBXA 4LF4K 1QVFM 4IZ9A 2H3GX 3T1YK 3SLCA 4F9OA 4CK1A 4DQSA 3VPZA 4DTUA 2E8AA 1S72N 3AVHA 1BQMA 4KHSA 1GOAA 4O8UA 1FKPA 1MWMA 4BRIA 3C7NB 5JVGL 4GVMA 4GKKK 3MN5A 2CGLA 1TK8A 2I7NA 3HOTA 4YNQA 4EP5A 1NBWA 2G8HA 3LWMA 4CD3A 4AM6A 3QEIA 1DT9A 3VOVA 1NK4A 4CZIA 4CJRA 1BL3A 1EETA 2I5JA 1W9HA 3AO3A 4E1MA 1BQNA 1S1VA 3AO5A 5LY3A 5HP1A 3DJCA 1HMVA 5AZIA 3WXMB 3MEDA 1IBKK 4AH9A 4FWRA 5EXWA 4BG9A 4CE9A 2KZMA 4M3TA 4JI8K 3ULEB 2P9NA 1HR0K 1O13A 4J2BA 1RTDA 1DTTA 2Q0RA 4QCLA 1BO5O 1KC8O 3KLIA 5F2RA 3VETA 3AVGA 3SQ0A 4NCAA 1S1XA 4PKGA 1N36K 3THXB 4XH4A 5CZ1A 3VERA 1UA0A 4ISEA 2Q97A 3OS2A 1TUUA 3MEGA 3VGKA 3NH0A 2JWLA 1VQ6N 1LWEA 1C0TA 2CH5A 3CJAA 1SS6A 4BR7A 5AQLA 4KTZA 3DLGA 4KHQA 3VENA 4A2AA 2ZF5O 1HKGA 3KK3A 3DRSA 5AQUA 3CD6N 4ICLA 4H0VB 1N8RO 2FXUA 1RT1A 2IS3A 1HNXK 3ULEA 2P9PA 3QLHA 5EVZA 4IKFA 1EQYA 3DOKA 2A1RA 4F2SA 2QTDA 4G1QA 3ENHA 3DWLA 3VQPA 3KWGA 3DXKB 4A59A 1RT3A 3IDHA 3D2FB 3THXA 5CYMA 5GAHP 3ID8A 1RFQA 3MXIA 4CJKA 4EIAA 4WQ4C 1GLBG 4E1NA 4R79A 3LPTA 3O3GA 1NJIO 3KLFA 3VQ7A 5M1OA 1RT6A 5HL7L 1U6ZA 4E7HA 2UU9K 1CXUA 4DCHA 4CGJA 3G4SN 2BTFA 4YOXA 1IG8A 3S9HA 3AAQA 1NGFA 4FOEA 4AHTA 1QQCA 3AVMA 1GLAG 3KLHA 1KRPA 3TARA 4ZHRA 3DRPA 5AFUH 1W7AA 1BGXT 2OTJN 1YXQA 3IS9A 3ZSVA 3OYBA 5J2NA 4M3UA 4NXMK 3KWIA 1I3AA 3VF2A 1YVNA 4CGIA 1BA1A 3HRGA 3OYJA 1ILYA 4FJHA 3ZX3A 4BRQA 4OPKA 1X9SA 3OJUA 4IEIA 1QVGM 1RBUA 1L3SA 2V7YA 3FFKB 5JS2A 3HYFA 2ZJPL 3I56N 4CGFA 3CYMA 1VSKA 4DQIA 4CCHA 5AQXA 4CD1A 4Q0BA 3H1VX 3O4QA 3SAHA 1LWCA 4KH5A 4M7YA 1NMDA 5AQNA 4A62A 2XY7A 4IG3A 2A42A 3DLBA 3GL1A 1C0GA 3HSTB 4RTFD 1VAZA 1NJWA 1WBDA 4DTXA 4WQ5C 3TTCA 1NKEA 1NM1A 1SKRA 5C0YA 2E5LK 4I7FA 1ZBSA 3NGYA 3EE8A 3R8EA 1S1UA 3VQ9A 3D45A 4PKIA 3NAEA 4IO8A 1VQ5N 3AVCA 4DV5K 1OH5A 1OH6A 4RCHA 1UOCA 3A5NC 4B1WB 3CIPA 2XHBA 3ULDA 4DFPA 5C2DA 1CXQA 3OJSA 1QSLA 1RT4A 4Z4EA 3AVBA 2UXDK 4ZTJA 4JN4A 1NGCA 1QHAA 3THVA 3O8MA 4FWNA 3TU5A 3SCXA 1BHLA 3V1RA 1N34K 3O5BA 3EO3A 5DM7L 1ZXOA 3IUCA 3SV4A 4TSXA 5AFUA 3GOIA 1YT3A 4JRPA 3AGKA 1KCFA 1JLAA 1L3VA 3G10A 2ASMA 3H1QA 5DK5A 3AA3A 2ASOA 4DTPA 3SUNA 4CI6A 2P9LB 4JK9A 3CMEN 1BG3A 3O1BA 3DLHA 1G15A 5A2QO 1SKSA 5AQFA 3ZSQA 3VQEA 5BRDA 1D5AA 4KKOA 3J7AP 1ASWA 4BRLA 4LH4A 3ISNC 3OYHA 3VTHA 1JJ2M 3T1HK 1ZBUA 3ZEUB 2QI2A 4BRKA 2GELA 3MX2A 1SUQA 4E89A 3OBWA 5J2PA 1SQKA 3K5NA 3CCRN 4FZYA 3TSUA 5JS1A 1WSIA 4JYAK 4GW6A 3THYB 1R0AA 1VSIA 4H5NA 1NGAA 4BC5A 2IVNA 5AQMA 3LDNA 3VF6A 4CJEA 4UQGA 2VGNA 4FJIA 3T1AA 3WXIA 1Q7YO 2OPQA 1OH8A 3TAMA 3T69A 3KKSA 5I42A 3QEPA 2DTUA 4LF7K 1GLJO 4HUGA 4CJ4A 4DMNA 3NH2A 1LAVA 3PO5A 3NMUA 3L2QA 1JLBA 1IKYA 2VWKA 3P83D 4DSKA 4BQLA 5HBMA 4Z4FA 3QBXA 2HHQA 2BGGA 3PY8A 2HMPA 4C8NA 4DR6K 3NDKA 1NNEA 4B9TA 1KTQA 1ASUA 1DGKN 3MXMA 4B9UA 3V6DA 3PSIA 4B9VA 2VCPA 1T44A 3OYFA 1Q82O 4BRHA 3JSMA 1B9FA 2W41A 4CZFA 2NRVA 1UAXA 4CJFA 2P5OA 2UUBK 3R6MA 4LFCK 1U48A 2YHYA 2YKMA 3NE6A 4FWQA 4FJXA 2QK9A 3GBTA 3QNNA 3PLAA 1GOBA 2D0BA 5GAEP 5JVHL 5AQWA 3ZLJA 1JCEA 4BC2A 1YI2N 2F7TA 2DFFA 4BWJA 1HUXA 4LSLA 3AVJA 4KFBA 3DAWA 2B4JA 4F4KA 1VSLA 1IBLK 3D6RA 1Q8IA 1V4SA 3B6OA 1VSFA 4FK0A 3H45C 4QS7A 3RR7A 4PUOA 5JMVA 3P1GA 3MN7A 1NU0A 2FLOA 4JD2B 3RMDA 3UKUB 2VYPA 5M1QA 2W6KA 2FC0A 3MMVA 4WE1A 4IOCL 4DLEA 5HOOA 4DSEA 2BE2A 1SL1A 1NGHA 3PO4A 3SNNA 5GIOA 2RF2A 1W2BM 3VEVA 1C0FA 3QEVA 3LP1A 3VGMA 4CGGA 3K2PA 1TL3A 3HP6A 1JXEA 2FF6A 3MN9A 5ADXH 2O8DA 4JEPA 4Z4HA 2DY4A 3HPOA 2YNIA 4E0DA 2P9KA 2ZM6K 5M1KA 4C1NK 4DF4A 3V1QA 3FZKA 1TK5A 4R5PA 4I6MA 2KFZA 4YOVA 4X65K 4FYDA 4JHDB 4E7IA 4PL7A 4BACA 2W42A 4KI4A 4DR4K 1TKTA 4B9NA 3QINA 3AO4A 2YX6A 4CF9A 3HM8A 2VWBA 1UWBA 4JS5A 4FLZA 3WQUA 2YHAA 1JCFA 1XWLA 4DSLA 2GV9A 4CK3A 2OPPA 2Y1IA 3NVKA 4OJRA 2P9IA 4BWMA 2P9SB 2UUAK 1JLFA 1HYVA 3P31A
chains in the Genus database with same CATH topology
4AM6A 1QZ6A 2NRWA 3SAFA 1DT9A 3ATVA 4K43A 2BH1A 4IXCA 3VOVA 5H1SQ 1M1KO 4CZIA 3CERA 3H46O 4OPAA 3WXLA 4AF1A 3M3ZA 3FZLA 5CE3A 3KHYA 4B1XB 4BR4A 5LY3A 3S41A 3DJCA 5AZIA 2HOEA 3WXMB 3P38A 3QDKA 4FWRA 1BU6O 2HF3A 2NRTA 2V51B 3B8AX 3BF3A 1MDUB 4JKHA 5BPLA 5EXWA 4BG9A 1NGGA 3ULEB 4IOAL 3Q7CA 3U4LA 2P9NA 4HTLA 3TTFA 2DPNA 1BA0A 3FLCO 3O6WA 1O13A 4JK7A 4BC4A 5EOYA 1VQNN 2Q0RA 4BRFA 2QWRA 3L0QA 3FE1A 4BVOA 1BO5O 3CETA 3CJCA 4EHTA 4DKWA 1KC8O 5GADP 5F2RA 2HSTA 1LOTB 1IJJA 3VETA 2PFUA 4WFBL 4FSVA 3RSEB 1KAXA 2Q1NA 1SZ2A 3R1XA 4FWSA 4PKGA 5M1PA 3ZX2A 5JLHA 4U7BA 5BN8A 4BVPA 2J4RA 2RHKA 3QFPA 1X3NA 4XH4A 3VERA 4BR0A 2QA4N 4ISEA 4H0TB 2Q97A 3N4PA 3LDPA 5AQIA 4A5BA 4PKHA 1TUUA 3VGKA 3IKMA 1LCUA 2D1KA 1HPMA 2YHWA 2ZJQL 1WOQA 1EO1A 1TYQA 2I7PA 2P9UB 5AQSA 2JWLA 1VQ6N 2CH5A 2QWNA 3CJAA 1SS6A 2A40A 4BR7A 3VEWA 5AQLA 4O5FA 3WT0A 4WFAL 3VENA 4A2AA 5JICA 2ZF5O 1HKGA 2NNWA 3EKUA 5AQUA 4GV9A 3CD6N 3QBWA 4IO9L 4H0VB 3CC7N 2FSKA 3FZFA 3CXCM 1N8RO 3AGRA 1KD1O 2FXUA 4ILJA 2QM1A 4BR2A 1HKCA 5EY4A 2E1ZA 4XH1A 3DLLL 5LJWA 3MDQA 3ULEA 2AP1A 2P9PA 3CCLN 4PL8A 4G9ZA 1MA9B 2Q2RA 4K41A 5EVZA 1EQYA 4IEEA 4B9QA 4LC9B 5FPDA 4NB4A 2QTDA 4XEIA 3I55N 1HJOA 2GEMA 5CHIA 3ENHA 4KH4A 3J7ZO 4WQ4A 2GWKA 3DWLA 1JCGA 2HBJA 4YOTA 2QWOA 3KWGA 3DXKB 1HLUA 4A59A 4PHTX 3DXMB 1XQSC 2NRHA 3CQXA 3GG4A 3D2FB 3IDHA 4H03B 3L4IA 5F0XA 3J8AA 5GAHP 4YORA 3ID8A 1RFQA 2GX9A 4FL9A 3C0BA 4EIAA 4WQ4C 2VGMA 1GLBG 3M1FA 4NO7A 3E9LA 3QFUA 4R79A 3Q7BA 3JXUA 1NJIO 3CJ7A 3ZETB 1ATRA 5AQRA 1RDWX 1KXPA 3O1WA 5BRHA 1KAZA 3O9QA 5M1OA 5HL7L 1U6ZA 1VQPN 1ESVA 1U2VA 2E1YA 3QMLA 4DCHA 4BGAA 3G4SN 2BTFA 2E20A 1QQMA 2QWMA 4YOXA 1IG8A 4BC3A 3CCMN 3E66A 2F9TA 5BPMA 3M6GA 4YOYA 3AAQA 4FPAA 3CHWA 3OHRA 4JD2A 1NGFA 3CCEN 4FOEA 3UKUA 1M90O 1GLAG 1X3MA 3WEEB 2NLXA 3U9ZA 3A8YA 5AFUH 2OTJN 1YXQA 1VQMN 4WF9L 3CMAN 1Q81O 1Z05A 4JKCA 4M7XA 3CJ9A 5BREA 3KWIA 1S22A 3L6QA 2E2PA 4FWOA 4HWIA 4QS9A 3VF2A 1YVNA 4ILGB 1BA1A 1VQ8N 5GAGP 3HRGA 3CPWM 1ILYA 5M1NA 1DEJA 4IFEA 2E2OA 2WBNA 3ZX3A 4BRQA 4FWLA 3D2EB 3O9UA 4IEIA 2HF4A 4GY2B 5I9EB 1QVGM 2V7YA 3CJBA 4JKGA 3UKRB 2GTDA 3G25A 1NGIA 3FFKB 4IDHA 4A2BA 1ATSA 1S3XA 2ZJPL 3E9OA 3I56N 4QS8A 4C23A 1YIJN 5C2FA 5FPMA 4UY8O 5AQXA 1HX1A 2EWSA 4H0XB 4J8FA 4CD1A 3WUHA 4H5VA 3MWPA 4Z94A 3H1VX 1X9JA 2QEXN 3TTDA 1VQ7N 4JHDA 5DM6L 5AQQA 3SAHA 4M7YA 4KH5A 5AQNA 1NMDA 4A62A 4OO1J 2A42A 3GL1A 1C0GA 2YHXA 4RTFD 4E1JA 1VAZA 5KPTA 3CQYA 4WQ5C 3TTCA 4FOIA 1NM1A 2YCHA 3CJ1A 5C0YA 5AQVA 1ZBSA 1BDGA 3WEEA 5KQ8A 3EE8A 3R8EA 1YITN 2E2QA 4PKIA 5AQHA 4IO8A 1VQ5N 2NRXA 3TSPA 1K8KA 2FSJA 4RCHA 3A5NC 3C7NA 3CIPA 4B1WB 5AZJB 4BRDA 5C2DA 2KHOA 1P8ZA 2YI1A 3N4QA 4WFNL 5BRFA 5M1FA 3CCQN 2NZTA 4ISGA 2P9SA 4GV3A 4IOXA 4BR5A 2FF3B 1MWKA 4JN4A 5AQPA 5AR0A 3CCJN 5AQTA 5BPNA 1NGCA 1QHAA 1XUPO 2CGJA 5C10A 3O8MA 5EX5A 2F9WA 2CH6A 3I33A 3IFRA 4FWNA 3TU5A 4CBXA 1K73O 2NRRA 3GDQA 3O5BA 3W3DA 3A5MC 3EO3A 5DM7L 1ZXOA 1DKGD 3IUCA 4B1VA 3CC4N 2P9KB 3QB0A 5AFUA 1RGIA 2WC9A 3GOIA 3MCPA 3O08A 5F1XA 4O8KA 5JLFA 4BREA 1BOTO 1RDUA 4MDBA 3AGKA 3MN6A 3R9PA 4A5AA 4I6MB 4JK8A 1VQKN 3LM9A 4H0OA 1Y64A 4CZJA 1GLCG 1NGDA 1QZ5A 4CZKA 1BWFO 1NGBA 3F9MA 3WQTA 2ASMA 1Z6RA 3H1QA 1K8AO 2BUPA 2ASOA 4CI6A 1ATNA 1OVYA 2WUSA 3P4IA 4ILHA 2Q0UA 3O80A 4JKBA 1D4XA 2P9LB 4MDAA 2GWJA 3A0IX 4JK9A 3M5RA 3CMEN 1BG3A 2IIRA 2WFBA 5KPRA 3O1BA 2E88A 3RSEA 4BG8A 3FR0A 4BRMA 3G6EN 5AQFA 1YJNN 2V7ZA 5BRDA 1YJWN 4Y0WA 3A5OC 3EKSA 1YUWA 5GIPA 3AAPA 4BRLA 2UYTA 3NVMA 4IJNA 4JKAA 3AARA 4CZMA 3OW2M 2P9IB 3HOSA 1GLDG 3VTHA 5LJVA 4H0PA 1JJ2M 3ZEUB 2OANA 2FSNA 4FVUA 2QI2A 2A5XA 3MWTA 4BRKA 2GELA 3KZBA 3MX2A 4U67L 3AY9A 1VQON 3SBTA 3OBWA 3PIPL 1SQKA 2W40A 3HTVA 3CCRN 3W0LA 2P9UA 3ENBA 2CGKA 3TSUA 3VEXA 3SMSA 3U9DA 1VQ4N 5MLCQ 3O9TA 1TUYA 4H5NA 3O4WA 1NGAA 4BC5A 2IVNA 4FWMA 5AQMA 4BRNA 3GE1A 5AZIB 3CPEA 3LDNA 3VF6A 1SAZA 2V52B 3OBYA 5C12A 3FZHA 3VTIA 5AQOA 3IMXA 4H5WA 2VGNA 3WXJA 3LDQA 3CCVN 4C1NI 2P9NB 4MO5A 3VESA 3WXIA 1Q7YO 1VQLN 1QQOA 4FO0A 3T69A 1GLLO 2NRZA 3EE9A 2GUPA 1GLJO 3I8BA 4CZGA 3U8XA 4BY9C 3T7ZA 5AQZA 2PBDA 3DXKA 4B1ZA 1HKBA 2HBMA 3DXMA 3RVCA 2ASPA 3H3OB 3D2FA 4JNEA 3ID6A 3NMUA 4DQ8A 2QXLA 3KK7A 4NLCA 1T3VA 3MCAB 1R59O 1BUPA 1QQNA 4MLHA 3ZETA 3O9RA 4M63C 4WQ5A 4YOUA 4BQLA 1KQSM 5TKYA 2ZGYA 3O9SA 3OA9A 2ZGZA 3HSCA 5AQKA 3QBXA 4CJ7A 2QWPA 5C15A 3C65A 3FGUA 3ATUA 2QWLA 3BUZB 2HMPA 3WXKA 3VMFB 3CC2N 1Q18A 2IVPA 1V4TA 4CBUA 3E1YA 1TYQB 4H0YB 4MO4A 2A41A 4BRAA 4YDUC 5KQDA 4GV6A 3MX5A 4K42A 1DGKN 4BQZA 3E9PA 4KH6A 3P39A 3EZWA 4EFHA 1NWKA 2D4WA 2VCPA 1H1VA 5FPEA 1T44A 4ISFA 4IWVA 4BRHA 3VGLA 1Q82O 2A6AA 3MK6A 2HBKA 2W41A 2E2NA 5ELZA 4CZFA 2NRVA 2IVOA 2YJFA 2P9PB 4CZEA 3K9JA 1OKJA 4JKEA 3R6MA 4FPBA 4H5RA 3EL2A 2Q31A 3D2EA 5FPNA 2YHYA 4L3QA 3A5LC 5AQGA 5ADXA 1YAGA 4FWQA 3LDLA 4A61A 4A57A 1GLEG 4NLBA 5E26A 3UKRA 3GBTA 3TSQA 5GINA 1NLVA 3SK3A 4AM7A 3PLAA 1T6DA 1NGJA 3H6EA 3H3NO 2YJEA 3VEOA 4BRPA 5GAEP 5JVHL 1GLFO 5AQWA 4CZLA 1JCEA 4BC2A 1YI2N 2F7TA 3F5TA 1KAYA 1HUXA 2PAVA 3KVGA 2HBLA 4JAXA 5BN9A 2ITMA 4BRGA 4DB3A 3PIOL 3D7EO 3DAWA 5B8HA 1W97L 3D6RA 3ZYYX 3K9KA 1V4SA 5TKWA 3R3LA 3HZ6A 5BR9A 1U2VB 4JKFA 4YOWA 3H45C 4QS7A 2QW9A 2A3ZA 4RWTA 3BEXA 4BR9A 5JMVA 3MN7A 2FLOA 3HI0A 4JD2B 4EHUA 1ZC6A 3UKUB 3CCUN 1YHQN 2VYPA 5M1QA 4BGBA 3CI5A 1YJ9N 3CCSN 3MMVA 4EAHD 2JWKA 3FZMA 4KBOA 3LDOA 4OPHA 4H5TA 3SAGA 1G99A 4IOCL 3QICA 1XC3A 3HBTA 4BRCA 5AZJA 5HOOA 3UB5A 4CBWA 1NGHA 5GIOA 1W2BM 2KLAA 3BF1A 3F2KA 1E4FT 1E4GT 1NGEA 1C0FA 5CR4A 3VEZA 3VEVA 3VGMA 4BROA 3VEYA 4CZHA 3C6HA 3LL3A 4B1YB 4MLEA 3TPQA 4WCEL 2FF6A 3MN9A 5ADXH 4JKGB 4K25A 4JEPA 4GNIA 3L4QA 2KKZA 5AQYA 3EN9A 2P9KA 1P90A 1K9MO 5M1KA 3SBGA 4C1NK 1T6CA 1CZAN 3VF4A 3BP8A 3FZKA 2OTLN 2ZWHA 4I6MA 4JKDA 4YOVA 4XH5A 3UE5A 4JHDB 2ZJRL 4WYBA 1J6ZA 4PL7A 1QVFM 4FWPA 4IZ9A 2H3GX 3SLCA 4F9OA 1VQ9N 3VPZA 5E84A 2YX6A 2P9LA 4GVEA 3SJHA 2E8AA 2QWQA 3HM8A 2D0PA 2VWBA 3CF5L 1S72N 2Q36A 3SMPA 3WQUA 2D0OA 4FWKA 1JCFA 1MWMA 4O8UA 3ENOA 3G71N 1K8KB 1YF5L 1WUAA 4BRIA 5KPZA 3C7NB 3LM2A 5JVGL 3MN5A 2CGLA 3C6AA 3NVKA 1Q86O 5AQJA 2I7NA 4DHYA 2P9IA 3HOTA 2RE2A 1NBWA 2P9SB 4YDUA 3ZEUA 2AA4A 4B1UB 4IJAA 3ZX0A 3JS6A 4CD3A 3P31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AM6 A;  1QZ6 A;  3ATV A;  4K43 A;  4IXC A;  3VOV A;  4CZI A;  3CER A;  3H46 O;  3WXL A;  3M3Z A;  3FZL A;  5CE3 A;  3KHY A;  4B1X B;  4BR4 A;  5LY3 A;  3S41 A;  3DJC A;  5AZI A;  2HOE A;  3QDK A;  4FWR A;  1BU6 O;  2HF3 A;  3B8A X;  2V51 B;  3BF3 A;  5BPL A;  1MDU B;  5EXW A;  4BG9 A;  1NGG A;  3ULE B;  3U4L A;  2P9N A;  4HTL A;  2DPN A;  1BA0 A;  3FLC O;  3O6W A;  4BC4 A;  5EOY A;  2Q0R A;  4BRF A;  2QWR A;  3L0Q A;  3FE1 A;  4BVO A;  1BO5 O;  3CET A;  3CJC A;  4EHT A;  5F2R A;  3VET A;  1LOT B;  1IJJ A;  4FSV A;  3RSE B;  1KAX A;  2Q1N A;  1SZ2 A;  4FWS A;  4PKG A;  3ZX2 A;  5JLH A;  5BN8 A;  4BVP A;  2J4R A;  3QFP A;  1X3N A;  4XH4 A;  3VER A;  4BR0 A;  4ISE A;  4H0T B;  2Q97 A;  3LDP A;  5AQI A;  4PKH A;  1TUU A;  3VGK A;  1LCU A;  2D1K A;  1HPM A;  2YHW A;  1WOQ A;  1TYQ A;  2I7P A;  2P9U B;  5AQS A;  2CH5 A;  2QWN A;  3CJA A;  4BR7 A;  2A40 A;  3VEW A;  5AQL A;  4O5F A;  3WT0 A;  3VEN A;  4A2A A;  5JIC A;  2ZF5 O;  1HKG A;  3EKU A;  5AQU A;  3QBW A;  4H0V B;  2FSK A;  3FZF A;  2FXU A;  4BR2 A;  2QM1 A;  1HKC A;  5EY4 A;  2E1Z A;  4XH1 A;  5LJW A;  3MDQ A;  3ULE A;  2AP1 A;  2P9P A;  4PL8 A;  1MA9 B;  2Q2R A;  4K41 A;  5EVZ A;  1EQY A;  4B9Q A;  4LC9 B;  5FPD A;  4NB4 A;  4XEI A;  1HJO A;  2GEM A;  3ENH A;  4WQ4 A;  2GWK A;  3DWL A;  1JCG A;  2QWO A;  3DXK B;  1HLU A;  3DXM B;  1XQS C;  2NRH A;  3CQX A;  3GG4 A;  3D2F B;  3IDH A;  4H03 B;  3L4I A;  5F0X A;  3J8A A;  3ID8 A;  1RFQ A;  4FL9 A;  3C0B A;  4EIA A;  4WQ4 C;  1GLB G;  3M1F A;  4NO7 A;  3QFU A;  3JXU A;  3CJ7 A;  3ZET B;  1ATR A;  5AQR A;  1RDW X;  1KXP A;  3O1W A;  5BRH A;  1KAZ A;  1U6Z A;  1ESV A;  1U2V A;  2E1Y A;  3QML A;  4DCH A;  4BGA A;  2BTF A;  2E20 A;  1QQM A;  2QWM A;  1IG8 A;  4BC3 A;  2F9T A;  5BPM A;  3M6G A;  3AAQ A;  4FPA A;  3CHW A;  3OHR A;  4JD2 A;  1NGF A;  4FOE A;  3UKU A;  1GLA G;  1X3M A;  3WEE B;  2NLX A;  3U9Z A;  3A8Y A;  5AFU H;  1YXQ A;  1Z05 A;  4M7X A;  3CJ9 A;  5BRE A;  1S22 A;  3L6Q A;  2E2P A;  4FWO A;  4HWI A;  4QS9 A;  3VF2 A;  1YVN A;  1BA1 A;  1DEJ A;  2E2O A;  3ZX3 A;  4BRQ A;  4FWL A;  3D2E B;  5I9E B;  2HF4 A;  4GY2 B;  2V7Y A;  3CJB A;  3UKR B;  2GTD A;  3G25 A;  1NGI A;  3FFK B;  4A2B A;  1ATS A;  1S3X A;  4QS8 A;  4C23 A;  5FPM A;  5AQX A;  1HX1 A;  2EWS A;  4H0X B;  4J8F A;  4CD1 A;  3WUH A;  4H5V A;  4Z94 A;  3H1V X;  1X9J A;  4JHD A;  5AQQ A;  4M7Y A;  5AQN A;  1NMD A;  4A62 A;  2A42 A;  3GL1 A;  1C0G A;  2YHX A;  4RTF D;  4E1J A;  5KPT A;  3CQY A;  4WQ5 C;  4FOI A;  1NM1 A;  2YCH A;  3CJ1 A;  5AQV A;  1ZBS A;  1BDG A;  3WEE A;  5KQ8 A;  3R8E A;  2E2Q A;  4PKI A;  5AQH A;  4IO8 A;  1K8K A;  2FSJ A;  4RCH A;  3A5N C;  3C7N A;  3CIP A;  4B1W B;  5AZJ B;  4BRD A;  2KHO A;  1P8Z A;  2YI1 A;  5BRF A;  2NZT A;  4ISG A;  2P9S A;  4BR5 A;  2FF3 B;  1MWK A;  4JN4 A;  5AQP A;  5AR0 A;  5AQT A;  5BPN A;  1NGC A;  1QHA A;  1XUP O;  2CGJ A;  3O8M A;  5EX5 A;  2F9W A;  2CH6 A;  3I33 A;  3IFR A;  4FWN A;  3TU5 A;  4CBX A;  3GDQ A;  3O5B A;  3W3D A;  3A5M C;  3EO3 A;  1ZXO A;  1DKG D;  3IUC A;  4B1V A;  2P9K B;  3QB0 A;  5AFU A;  1RGI A;  3GOI A;  3MCP A;  3O08 A;  5F1X A;  4O8K A;  5JLF A;  4BRE A;  1BOT O;  3R9P A;  3MN6 A;  4I6M B;  3LM9 A;  4H0O A;  1Y64 A;  4CZJ A;  1GLC G;  1NGD A;  1QZ5 A;  4CZK A;  1BWF O;  1NGB A;  3F9M A;  3WQT A;  2ASM A;  1Z6R A;  3H1Q A;  2BUP A;  2ASO A;  4CI6 A;  1ATN A;  2WUS A;  3P4I A;  2Q0U A;  3O80 A;  1D4X A;  2P9L B;  2GWJ A;  3A0I X;  1BG3 A;  2IIR A;  5KPR A;  3O1B A;  2E88 A;  3RSE A;  4BG8 A;  3FR0 A;  4BRM A;  5AQF A;  2V7Z A;  5BRD A;  4Y0W A;  3A5O C;  3EKS A;  1YUW A;  3AAP A;  4BRL A;  2UYT A;  4IJN A;  3AAR A;  4CZM A;  2P9I B;  1GLD G;  5LJV A;  4H0P A;  3ZEU B;  2OAN A;  2FSN A;  2A5X A;  4BRK A;  2GEL A;  3KZB A;  3AY9 A;  1SQK A;  2W40 A;  3HTV A;  3W0L A;  2P9U A;  2CGK A;  3VEX A;  3SMS A;  3U9D A;  1TUY A;  4H5N A;  3O4W A;  1NGA A;  4BC5 A;  2IVN A;  4FWM A;  5AQM A;  4BRN A;  3GE1 A;  5AZI B;  3LDN A;  3VF6 A;  1SAZ A;  2V52 B;  3FZH A;  5AQO A;  3IMX A;  4H5W A;  3WXJ A;  3LDQ A;  2P9N B;  4MO5 A;  3VES A;  3WXI A;  1QQO A;  4FO0 A;  1GLL O;  2GUP A;  1GLJ O;  3I8B A;  4CZG A;  3U8X A;  5AQZ A;  2PBD A;  3DXK A;  4B1Z A;  1HKB A;  3DXM A;  2ASP A;  3H3O B;  3D2F A;  4JNE A;  4DQ8 A;  2QXL A;  1R59 O;  1BUP A;  1QQN A;  4MLH A;  3ZET A;  4M63 C;  4WQ5 A;  4BQL A;  5TKY A;  2ZGY A;  2ZGZ A;  3HSC A;  5AQK A;  3QBX A;  4CJ7 A;  2QWP A;  3FGU A;  3ATU A;  2QWL A;  3BUZ B;  2HMP A;  3WXK A;  1Q18 A;  2IVP A;  1V4T A;  4CBU A;  1TYQ B;  4H0Y B;  4MO4 A;  2A41 A;  4BRA A;  4YDU C;  5KQD A;  4K42 A;  1DGK N;  4BQZ A;  3EZW A;  4EFH A;  1NWK A;  2D4W A;  2VCP A;  1H1V A;  5FPE A;  1T44 A;  4ISF A;  4IWV A;  4BRH A;  3VGL A;  2A6A A;  3MK6 A;  2W41 A;  2E2N A;  5ELZ A;  4CZF A;  2IVO A;  2YJF A;  2P9P B;  4CZE A;  1OKJ A;  3R6M A;  4FPB A;  4H5R A;  3EL2 A;  2Q31 A;  3D2E A;  5FPN A;  2YHY A;  4L3Q A;  3A5L C;  5AQG A;  5ADX A;  1YAG A;  4FWQ A;  3LDL A;  4A61 A;  1GLE G;  5E26 A;  3UKR A;  3GBT A;  1NLV A;  3SK3 A;  4AM7 A;  1T6D A;  1NGJ A;  3H6E A;  3H3N O;  2YJE A;  3VEO A;  4BRP A;  1GLF O;  5AQW A;  4CZL A;  1JCE A;  4BC2 A;  3KVG A;  1KAY A;  1HUX A;  2PAV A;  5BN9 A;  4JAX A;  4BRG A;  2ITM A;  4DB3 A;  3D7E O;  3DAW A;  5B8H A;  1V4S A;  3HZ6 A;  5BR9 A;  1U2V B;  3H45 C;  4QS7 A;  2QW9 A;  2A3Z A;  4RWT A;  3BEX A;  4BR9 A;  5JMV A;  3MN7 A;  2FLO A;  3HI0 A;  4JD2 B;  4EHU A;  1ZC6 A;  3UKU B;  2VYP A;  4BGB A;  3CI5 A;  3MMV A;  4EAH D;  3FZM A;  4KBO A;  3LDO A;  4H5T A;  1G99 A;  3QIC A;  1XC3 A;  3HBT A;  4BRC A;  5AZJ A;  3UB5 A;  4CBW A;  1NGH A;  3BF1 A;  1E4F T;  1E4G T;  1NGE A;  1C0F A;  3VEV A;  3VEZ A;  3VGM A;  4BRO A;  3VEY A;  4CZH A;  3LL3 A;  4B1Y B;  4MLE A;  3TPQ A;  2FF6 A;  3MN9 A;  5ADX H;  4K25 A;  4GNI A;  5AQY A;  3EN9 A;  2P9K A;  1T6C A;  1CZA N;  3VF4 A;  3BP8 A;  3FZK A;  2ZWH A;  4I6M A;  4XH5 A;  3UE5 A;  4JHD B;  4WYB A;  1J6Z A;  4PL7 A;  4FWP A;  4IZ9 A;  2H3G X;  3SLC A;  4F9O A;  3VPZ A;  5E84 A;  2P9L A;  3SJH A;  2E8A A;  2QWQ A;  3HM8 A;  2D0P A;  2VWB A;  2Q36 A;  3SMP A;  3WQU A;  2D0O A;  4FWK A;  1JCF A;  1MWM A;  3ENO A;  1K8K B;  1WUA A;  4BRI A;  5KPZ A;  3C7N B;  3LM2 A;  3MN5 A;  2CGL A;  5AQJ A;  2I7N A;  4DHY A;  2P9I A;  1NBW A;  2P9S B;  4YDU A;  3ZEU A;  2AA4 A;  4B1U B;  4IJA A;  3ZX0 A;  3JS6 A;  4CD3 A; 
#chains in the Genus database with same CATH topology
 2NRW A;  4CHQ A;  4K43 A;  4IXC A;  3WXL A;  5HRN A;  4AF1 A;  3K5L A;  3M3Z A;  3KHY A;  4BR4 A;  3SI6 A;  3S41 A;  3P38 A;  1JLG A;  1XI1 A;  1SKW A;  2HF3 A;  3B8A X;  5BPL A;  3DMJ A;  2YNF A;  4JKH A;  1IO2 A;  3QET A;  1VRT A;  1NJY A;  3TTF A;  1BA0 A;  1NKC A;  4JK7 A;  5EOY A;  4FM2 A;  4CFB A;  1RBT A;  3SUP A;  2QWR A;  4Q5V A;  4CJP A;  4BVO A;  2PYJ A;  5GAD P;  1HPZ A;  1LOT B;  1IJJ A;  2HST A;  4F2R A;  1HYS A;  4B3S K;  4CJV A;  3RSE B;  3SZ2 A;  1KAX A;  4RW9 A;  3RMB A;  1SZ2 A;  5M1P A;  4M3Y A;  4M45 A;  3QFP A;  1FK9 A;  1X3N A;  2XO7 A;  4BR0 A;  1NJZ A;  5K14 A;  3N4P A;  2XY5 A;  4A5B A;  1DLO A;  3J7Y P;  4YHH K;  1LAW A;  2ZJQ L;  2D1K A;  2YHW A;  3RRH A;  1TYQ A;  1JLC A;  2I7P A;  3LDS A;  3ZCM A;  4DSI A;  4CEA A;  5AQS A;  2A40 A;  1I39 A;  2IDO A;  1S6Q A;  4DQR A;  4WFA L;  4JI6 K;  2Z1G A;  3EKU A;  3OS1 A;  3CXC M;  3AGR A;  3NF6 A;  4ILJ A;  2QM1 A;  1D9D A;  5EY4 A;  3DLL L;  4XH1 A;  3BDP A;  3CQ8 A;  3VQD A;  4PL8 A;  4G9Z A;  3CG7 A;  4K41 A;  4B9Q A;  4IEE A;  3V9U A;  4LFA K;  4N41 A;  4DG1 A;  4LF5 K;  3SUQ A;  2YKN A;  2ETJ A;  2YV0 X;  1HJO A;  3AO2 A;  5CHI A;  4KH4 A;  4DTJ A;  3SPZ A;  2GWK A;  4F3O A;  4LF6 K;  1JCG A;  4YOT A;  4PHT X;  4DFM A;  3CQX A;  2NRH A;  3GG4 A;  5F0X A;  4FM1 A;  3J8A A;  3LZJ A;  1KLM A;  4NO7 A;  2HHU A;  3Q7B A;  3CJ7 A;  3KJV A;  1KXP A;  1BIU A;  3O9Q A;  5EU7 A;  4CJ5 A;  1VQP N;  1U2V A;  3QML A;  2QKK A;  5DMR A;  2E20 A;  2F9T A;  1TV6 A;  3ZSY A;  4FPA A;  1HNZ K;  5C42 A;  1FKO A;  3L2V A;  4ELT A;  4F8R A;  4H4M A;  3FFI A;  3QNO A;  1T7P A;  4JI5 K;  3CMA N;  1Q81 O;  4M7X A;  3OYE A;  3L6Q A;  2E2P A;  4QS9 A;  1QS4 A;  4IFE A;  3THW A;  4J2A A;  4FWL A;  3TAP A;  3D2E B;  5I9E B;  4B3R K;  3VQ4 A;  3CJB A;  4JKG A;  3UKR B;  3OYC A;  1D8Y A;  1BIS A;  2GUI A;  1S3X A;  4JLH A;  2F8S A;  4QS8 A;  3KD5 E;  2A1S A;  2IGI A;  4FJM A;  2EWS A;  4J8F A;  3MWP A;  1ZBF A;  3QIP A;  3DM2 A;  4CK2 A;  2XY8 A;  3TAE A;  5DM6 L;  1K6Y A;  5AQQ A;  4DR7 K;  1TK0 A;  3WNF A;  4M42 A;  1S6P A;  3C94 A;  4FZZ A;  4KB0 A;  3DLK A;  1ZYQ A;  3S3M A;  1BDG A;  3NH1 A;  1YIT N;  5AQH A;  3AVI A;  3VQB A;  2NRX A;  3TSP A;  4CHZ A;  4X66 K;  2KZZ A;  4CHY A;  3C7N A;  5AZJ B;  4BRD A;  4CF8 A;  3VA3 A;  2G8F A;  5BRF A;  3CCQ N;  2NZT A;  4W5R A;  1LW2 A;  3MAQ A;  4ISG A;  4GV3 A;  1WAJ A;  4IOX A;  1MWK A;  3CCJ N;  5AQT A;  5T7B A;  4NCB A;  2CH6 A;  2FBV A;  3IFR A;  4CBX A;  2PYL A;  2NRR A;  3V1O A;  4B1V A;  1TKZ A;  2WC9 A;  1ZBH A;  3MCP A;  3O08 A;  1BOT O;  2BAN A;  3MN6 A;  1MU2 A;  1VQK N;  4H0O A;  4CZJ A;  1NGD A;  4B3M K;  1NGB A;  4CEF A;  2OYQ A;  3HPH A;  3L2U A;  1U49 A;  2BUP A;  1ATN A;  3P4I A;  2Y1J A;  3C6T A;  4CW7 B;  3I8D A;  1D4X A;  4MDA A;  3A0I X;  4B08 A;  2WFB A;  1IKV A;  5KPR A;  4BG8 A;  4BRM A;  5KGX A;  2D0A A;  4EZ6 A;  1J9A A;  4DQQ A;  1YJW N;  4KI6 A;  2IAJ A;  1SL0 A;  4OPJ A;  3NVM A;  4JKA A;  3AAR A;  3OW2 M;  3HOS A;  4H0P A;  4HHT A;  2O8C B;  4FVU A;  4CGH A;  3AY9 A;  3NCI A;  3HTV A;  1WAF A;  2CGK A;  3ZT0 A;  3QIO A;  4CEQ A;  3O9T A;  1KVB A;  1C0U A;  4BRN A;  1HNI A;  1WB9 A;  3GE1 A;  3CPE A;  3M8R A;  4DFK A;  3FZH A;  4CHP A;  5KTQ A;  1QE1 A;  3CCV N;  1WSH A;  2HNY A;  2NRZ A;  4M3Z A;  2GUP A;  1S5J A;  2PBD A;  3DXK A;  5I3U A;  3RVC A;  2UXB K;  3D2F A;  3T3F A;  4DQ8 A;  1BCM A;  3MCA B;  1BUP A;  1QQN A;  4MLH A;  1KQS M;  3SV3 A;  3O9S A;  4DV7 K;  2ZGZ A;  5AQK A;  4CJ7 A;  2QWP A;  3C65 A;  2P1J A;  2QWL A;  3VMF B;  4FLV A;  3CC2 N;  4DUY K;  1TAQ A;  4H0Y B;  4BRA A;  1CZB A;  3RWU A;  4FLX A;  4LH5 A;  4MQ3 A;  4B9L A;  1NK0 A;  3EZW A;  1U45 A;  2F4V K;  1XHX A;  2VWJ A;  2HHV A;  3AVL A;  3VGL A;  3MK6 A;  4OGC A;  5KRT A;  1XNR K;  4JS4 A;  4CZE A;  1RTH A;  3K9J A;  3DRR A;  4Z0U A;  4H5R A;  2Q31 A;  5FPN A;  3F9K A;  4L3Q A;  1YAG A;  4F3T A;  4NLB A;  5E26 A;  3OYK A;  1NK8 A;  1NLV A;  3OVN A;  3SQ4 A;  1T6D A;  3H3N O;  2YJE A;  3VEO A;  4BRP A;  2WOM A;  3F5T A;  3KVG A;  2PAV A;  5BN9 A;  5HRS A;  1WSF A;  3D7E O;  3EEQ A;  4O55 A;  1NOY A;  5TKW A;  3K0S A;  5LMN K;  1RIL A;  4YOW A;  5CYQ A;  4RWT A;  5LL6 Z;  4FK2 A;  3BEX A;  4B9S A;  4DV6 K;  4DR3 K;  4EHU A;  2HHT A;  3AA4 A;  4OGE A;  3OS0 A;  4H4O A;  3VN5 A;  4KBO A;  4W5O A;  1G99 A;  3J81 O;  1EP4 A;  4BRC A;  1U4B A;  4O0I A;  4DR1 K;  3AVK A;  1E4F T;  5C25 A;  1E4G T;  1NGE A;  2YNG A;  5CR4 A;  2G8V A;  1GOC A;  4E7L A;  2RKI A;  5AJ3 K;  2VG5 A;  3U3Y A;  4B1Y B;  3TPQ A;  4WCE L;  4LY7 A;  4K25 A;  4DTR A;  4GNI A;  3L4Q A;  4YFU A;  4DU3 A;  4X62 K;  3V9S A;  2F8T A;  3CFO A;  3EN9 A;  1P90 A;  3EYZ A;  3CFR A;  1HNV A;  4B8A B;  3BP8 A;  4IFY A;  1A5W A;  4CEO A;  2ZWH A;  4XH5 A;  4KHY A;  2EX3 A;  4K0K K;  2B6A A;  1J6Z A;  3K57 A;  4DV3 K;  2HB5 A;  3AVN A;  1VQ9 N;  2P9L A;  1I94 K;  3SJH A;  2QWQ A;  4CEZ A;  4KTW A;  1BIZ A;  3HT3 A;  3G71 N;  4JI4 K;  1K8K B;  1YF5 L;  1WUA A;  4DWI A;  3RMA A;  3LM2 A;  4B9M A;  3OYI A;  1Q86 O;  4DHY A;  3HJF A;  5E41 A;  3ZEU A;  4B1U B;  4Y1D A;  1OVQ A;  3JS6 A;  1QZ6 A;  3SAF A;  3KLG A;  1M1K O;  1WN7 A;  1JL1 A;  4CVN E;  4W5Q A;  4OPA A;  2F96 A;  3THY A;  3FZL A;  5CE3 A;  4B1X B;  2HNZ A;  3VQQ A;  4CEB A;  4DV1 K;  1XMQ K;  3K5M A;  3OYD A;  1XC9 A;  3C6U A;  2V51 B;  1MDU B;  1NGG A;  1C6V A;  3Q7C A;  1HQE A;  4HTL A;  2DPN A;  2X6N A;  4BC4 A;  3L0Q A;  2R7Y A;  1CZ9 A;  1BI4 B;  3R1X A;  2AJQ A;  3ZX2 A;  4U7B A;  5BN8 A;  4BVP A;  1WSE A;  4OKK A;  4ID1 A;  2QA4 N;  4EP4 A;  4PY5 A;  4FW2 A;  2YNH A;  5AQI A;  1SV5 A;  4BE2 A;  4E7K A;  3ZSW A;  3NF9 A;  1RBV A;  3NGI A;  4E3S A;  2P9U B;  3PX4 A;  3PSF A;  4O5F A;  4M41 A;  3WT0 A;  4CFD A;  2NNW A;  4GV9 A;  3ZSO A;  1ZBI A;  3CC7 N;  1KD1 O;  1F21 A;  4BR2 A;  2E1Z A;  2E6L A;  5LJW A;  3MDQ A;  2AP1 A;  4IDK A;  3CCL N;  3SYZ A;  1MA9 B;  2KTQ A;  4DV0 K;  4LC9 B;  4NB4 A;  4NYN A;  2GEM A;  1RDA A;  4CIF A;  4WQ4 A;  4AHR A;  3WNE A;  4N47 A;  2JGU A;  1D9F A;  2HBJ A;  4E7J A;  1HLU A;  3DXM B;  4GKJ K;  1RDD A;  4YOR A;  1RT2 A;  3C0B A;  4KHW A;  4BDY A;  4JI1 K;  3NBP A;  1T8E A;  3M1F A;  3QFU A;  3ZSR A;  5D3G A;  3ZET B;  1ATR A;  5AQR A;  1EKE A;  3O1W A;  5HRO A;  1ESV A;  2E1Y A;  4BGA A;  4PA1 A;  4DV4 K;  1XHZ A;  1QQM A;  3WNG A;  3AO1 A;  4BC3 A;  3NGZ A;  3E66 A;  2O8F B;  5BPM A;  4YOY A;  3CCE N;  4JD2 A;  3UKU A;  3PX6 A;  4J2E A;  3IG1 A;  3WEE B;  1WNS A;  3U9Z A;  4DTO A;  1VQM N;  1Z05 A;  4JKC A;  4CEC A;  4DR2 K;  5HLF A;  5BRE A;  4FWO A;  1E3M A;  4HWI A;  3D0P A;  4OX9 K;  1T05 A;  1S9G A;  2VQF K;  4DTN A;  4RW8 A;  1VSJ A;  1C1C A;  2E6M A;  1N5Y A;  1EXQ A;  4GY2 B;  1NMN A;  1RDB A;  2PZS A;  2GTD A;  4RW6 A;  1NGI A;  4K8X A;  3LP2 A;  1KFS A;  3S3O A;  5C2F A;  5FPM A;  4BDZ A;  4UY8 O;  4H0X B;  3WUH A;  4Z94 A;  2VG6 A;  1X9J A;  3TTD A;  4JHD A;  2HW3 A;  1HJR A;  2YHX A;  5CY4 A;  4E1J A;  5KPT A;  4FOI A;  1QSS A;  2YCH A;  4DSJ A;  5AQV A;  3UIQ A;  3WEE A;  4KB1 A;  3O4N A;  3OYM A;  4AHS A;  3JAM O;  4DUZ K;  3K59 A;  1RBS A;  1YTU A;  4DR5 K;  1Q9X A;  2O8B B;  3EY1 A;  3O3F A;  3H08 A;  1NJX A;  2P9S A;  1HYZ A;  5C10 A;  4FK4 A;  3M8S A;  2X6S A;  2F9W A;  3I33 A;  4DQP A;  1K73 O;  3AVF A;  3BZC A;  1JKH A;  3BY5 A;  3A5M C;  2FBT A;  3CC4 N;  3PV8 A;  1DKG D;  3TAN A;  2JLE A;  3HXM A;  4DSF A;  5JLF A;  4BRE A;  1RDU A;  4MDB A;  3R9P A;  1VSH A;  1N33 K;  1Y64 A;  1IG9 A;  1GLC G;  2HND A;  2ZD1 A;  4FJ8 A;  1VSE A;  4CZK A;  3WNH A;  3NF7 A;  3WQT A;  4JRQ A;  3TAG A;  1OVY A;  4CIE A;  2Q0U A;  3O80 A;  4JKB A;  1NK5 A;  2GWJ A;  2QXF A;  2IIR A;  3T19 A;  2E88 A;  3PUF A;  4K8Z A;  3RSE A;  3G6E N;  3FR0 A;  3AVA A;  1YJN N;  5C24 A;  4Y0W A;  3KK1 A;  3KTQ A;  3VQ6 A;  5GIP A;  2VQE K;  2UYT A;  3OYL A;  4CZM A;  1RTJ A;  1FW6 A;  4IG0 A;  1J5O A;  2IOC A;  1QTM A;  1VQO N;  5KI6 A;  3J80 O;  4FLY A;  4FLT A;  1VQ4 N;  3SMS A;  4O5B A;  5MLC Q;  2KQ2 A;  1TL1 A;  2QKB A;  1TKX A;  3O4W A;  4RW4 A;  3ZSX A;  4AHC A;  5AZI B;  3OYA A;  2V52 B;  4LD0 A;  3IMX A;  4H5W A;  4E19 A;  4CF0 A;  4MFB A;  2HHW A;  3WXJ A;  3LDQ A;  4RG8 A;  3B6P A;  2P9N B;  4MO5 A;  4C1N I;  1QQO A;  4FO0 A;  1L3U A;  4LF8 K;  3I8B A;  4BY9 C;  4OVL A;  3T7Z A;  2RN2 A;  1IBM K;  1HKB A;  2ASP A;  3H3O B;  3ITH A;  2Z1J A;  3LAM A;  5FRO A;  3VQ5 A;  3RRG A;  2UUC K;  5FLX O;  4CED A;  2QXL A;  3KK7 A;  4NLC A;  4FJJ A;  1T3V A;  4KHU A;  4M63 C;  4YOU A;  2BDP A;  2ZGY A;  3OA9 A;  3HSC A;  4CJU A;  5C15 A;  2XRI A;  1JL2 A;  2Z1H A;  3BUZ B;  3WXK A;  4DFJ A;  4CBU A;  2HHS A;  2A41 A;  3K5O A;  3KD1 E;  5KQD A;  4GV6 A;  4HTU A;  1XNQ K;  1NKB A;  3E9P A;  3U3G A;  3P39 A;  4IBN A;  3AA5 X;  5FPE A;  4ISF A;  4DS5 A;  2A6A A;  2HBK A;  1X9W A;  2B5J A;  2VG7 A;  2P9P B;  2YJF A;  4KO0 A;  1RNH A;  4CEE A;  3QEX A;  5CZ2 A;  3EL2 A;  3D2E A;  2O8E B;  5AQG A;  3A5L C;  1BCO A;  4A61 A;  4A57 A;  1GLE G;  3UKR A;  1NG9 A;  1RBR A;  4AM7 A;  4NXN K;  4JI3 K;  4KTQ A;  2O4I A;  1GLF O;  1KAY A;  4JAX A;  3K58 A;  2XY6 A;  5SWM A;  1IKX A;  3PIO L;  4I2P A;  1ITG A;  3DLR A;  2RPI A;  4CES A;  1RCH A;  4AQY K;  3HZ6 A;  1C0M A;  5BR9 A;  4JKF A;  4ELV A;  3MEC A;  3V81 A;  4DU1 A;  3HL8 A;  3HM9 A;  1HRH A;  3LAL A;  1HQU A;  3HI0 A;  4JI7 K;  2Z1I A;  1S9E A;  3MXJ A;  4BGB A;  4NYF A;  2JWK A;  5FDL A;  3FZM A;  4OPH A;  4OLA A;  3SAG A;  2W6L A;  2G8I A;  5AZJ A;  1QHT A;  3UB5 A;  4CBW A;  4C8K A;  3L3U A;  1C1B A;  2KLA A;  3LWL A;  5LMU K;  1NOZ A;  3VEZ A;  2YHB A;  4BRO A;  4CZH A;  3C6H A;  2O8E A;  3DI6 A;  1WLJ A;  1Y97 A;  3BZK A;  3LL3 A;  4MLE A;  2HHX A;  3KKR A;  1RDC A;  4KHN A;  2KKZ A;  4ELU A;  4FJG A;  2HVH A;  5FRN A;  1YVU A;  1T6C A;  5J2Q A;  3VF4 A;  1RT5 A;  3VQA A;  5BR8 K;  5FRM A;  2ZJR L;  1J54 A;  4M3R A;  4W5T A;  3IAY A;  4C8L A;  4FWP A;  4LF9 K;  5E84 A;  2HVI A;  4GVE A;  4AHV A;  2D0P A;  3CF5 L;  3LAN A;  2Q36 A;  3SMP A;  3QO9 A;  2D0O A;  4FWK A;  3ENO A;  1U04 A;  5KPZ A;  4CJW A;  3C6A A;  5AQJ A;  1A5V A;  2RE2 A;  4W5N A;  4YDU A;  2O8C A;  1A5X A;  2AA4 A;  1XMO K;  1TVR A;  1OH7 A;  4IJA A;  3ZX0 A;  4BR5 A;  4LSN A;  2ATQ A;  3ALY A;  3ATV A;  4BE0 A;  2BH1 A;  5H1S Q;  3SUO A;  3CER A;  3E01 A;  3H46 O;  4FJK A;  2ZQB A;  4I9L A;  1W0H A;  2HOE A;  4JI0 K;  1Z26 A;  3QDK A;  1BU6 O;  2NRT A;  3BF3 A;  1S1W A;  1NK9 A;  4CIG A;  3L2R A;  3LPU A;  1JLE A;  3DLE A;  3ASM A;  4IOA L;  4KRF A;  3U4L A;  1VSM A;  3AV9 A;  3FLC O;  3O6W A;  4DS4 A;  3QEW A;  1VQN N;  4BRF A;  3FE1 A;  3CET A;  4EHT A;  3CJC A;  4DKW A;  4V19 S;  4HVJ A;  2PFU A;  4WFB L;  4FSV A;  4GMJ B;  3ZT1 A;  4JV5 K;  1J53 A;  2Q1N A;  4FWS A;  2X78 A;  4J2D A;  5JLH A;  5HRR A;  2NUB A;  2J4R A;  3U6F A;  2RHK A;  1VRU A;  4H0T B;  3LZI A;  2G8K A;  3S3N A;  4LFB K;  4DTM A;  3LDP A;  4Z4C A;  2G8W A;  4PKH A;  4FLU A;  3IKM A;  1LCU A;  3TI0 A;  1HPM A;  1Z25 A;  3RMC A;  1WOQ A;  4H8K A;  1EO1 A;  4N5S A;  4M3W A;  4KHP K;  2QWN A;  3LAK A;  3VEW A;  1KFD A;  3TWH A;  5JIC A;  2E4L A;  1IH7 A;  1WSJ A;  3QBW A;  4FJ7 A;  4IO9 L;  1REV A;  2FSK A;  3FZF A;  1HKC A;  1N6Q A;  2Q2R A;  1KSP A;  5FPD A;  2P5G A;  4XEI A;  3I55 N;  3NHG A;  3J7Z O;  3F73 A;  1VHX A;  1EWR A;  2QWO A;  4HUE A;  3LP3 A;  1XQS C;  4H03 B;  3HP9 A;  3L4I A;  2GX9 A;  4FL9 A;  3M8P A;  3TAF A;  1JLQ A;  2VGM A;  2WTU A;  3E9L A;  4X64 K;  3JXU A;  1RDW X;  4YY3 K;  5BRH A;  1KAZ A;  3G0Z A;  2OCE A;  3L2W A;  1NK6 A;  3ZT3 A;  3I0R A;  4B3O A;  2QWM A;  3CCM N;  3M6G A;  3CHW A;  3OHR A;  1M90 O;  1X3M A;  4L8R B;  2NLX A;  1L3T A;  3A8Y A;  3IRX A;  2OZM A;  4HCC A;  4HUF A;  4FJN A;  1U47 A;  4WF9 L;  4CJS A;  2KW4 A;  3CJ9 A;  1S22 A;  4ILG B;  1VQ8 N;  5GAG P;  3CPW M;  4PQU A;  3V9W A;  3HO1 A;  5M1N A;  1DEJ A;  5SZT A;  2E2O A;  2WBN A;  4DLG A;  3L3V A;  3DYA A;  4C8O A;  3O9U A;  2HF4 A;  4XIU A;  1JXB A;  1IKW A;  2OPS A;  3G25 A;  4IDH A;  4A2B A;  1ATS A;  3E9O A;  4C23 A;  1YIJ N;  2ITG A;  1N32 K;  1HX1 A;  4BDP A;  2OA8 A;  1DTQ A;  4H5V A;  3TAB A;  4Z4I A;  1KVA A;  2QEX N;  4KV8 A;  1VQ7 N;  3SPY A;  4CGD A;  4OO1 J;  3OYN A;  2O4G A;  1B92 A;  3DOL A;  3CQY A;  4CHO A;  4KPY A;  4JI2 K;  3CJ1 A;  3ZT2 A;  1SL2 A;  5KQ8 A;  2E2Q A;  1ZBL A;  4QAG A;  2ZE2 A;  1CLQ A;  3LP0 A;  4N76 A;  1K8K A;  2FSJ A;  4CFC A;  1EWQ A;  2D5R A;  3VQC A;  4Y1C A;  1RT7 A;  2KHO A;  1P8Z A;  2YI1 A;  3N4Q A;  3SQ1 A;  1EX4 A;  4WFN L;  3EZ5 A;  4FM0 A;  3QER A;  5M1F A;  1TGO A;  2P51 A;  4CJT A;  2FF3 B;  5AQP A;  3SQ2 A;  5AR0 A;  5BPN A;  2KFN A;  1XUP O;  2CGJ A;  4CHN A;  5EX5 A;  2O8D B;  1TAU A;  3C95 A;  3GDQ A;  3ZSZ A;  3W3D A;  3VQ8 A;  2P9K B;  3QB0 A;  1RGI A;  5F1X A;  4O8K A;  3RR8 A;  2G8U A;  3OYG A;  2FBY A;  1X1P A;  4A5A A;  4I6M B;  4JK8 A;  3LM9 A;  4B3T K;  4AHU A;  3P5J A;  1QZ5 A;  1BWF O;  2DFE A;  3F9M A;  4CJQ A;  1Z6R A;  4O4G A;  1K8A O;  3HK2 A;  2WUS A;  4ILH A;  4DF8 A;  1BI4 A;  3M5R A;  3ZT4 A;  1O1W A;  1ASV A;  1UA1 A;  2V7Z A;  3BGR A;  3A5O C;  3EKS A;  1YUW A;  3AAP A;  4IJN A;  2P9I B;  1GLD G;  5LJV A;  2OAN A;  1WBB A;  2FSN A;  4FCY A;  4I9Q A;  2A5X A;  3MWT A;  3KZB A;  4U67 L;  1IV0 A;  3SBT A;  3PX0 A;  3PIP L;  2W40 A;  3W0L A;  2P9U A;  3AA2 A;  3ENB A;  3VEX A;  3U9D A;  3NF8 A;  3MEE A;  2LSN A;  1HNW K;  1TUY A;  4FWM A;  4Z4G A;  4KAZ A;  2OPR A;  4NCG A;  1SAZ A;  2WON A;  4C8M A;  5C12 A;  3OBY A;  4B8C A;  3VTI A;  5AQO A;  3VA0 A;  4FZX C;  3I0S A;  4CF1 A;  3RTV A;  3VES A;  1VQL N;  2EHG A;  5IT9 O;  1GLL O;  2PY5 A;  3EE9 A;  3KIO A;  4AIL C;  4CZG A;  3U8X A;  5AQZ A;  4B1Z A;  2HBM A;  3DXM A;  3QES A;  2X74 A;  4JNE A;  4FVM A;  3ID6 A;  3V9X A;  5KRS A;  1VSD A;  1R59 O;  3ZET A;  3O9R A;  4WQ5 A;  5TKY A;  5J1E A;  3L8B A;  4DV2 K;  2UXC K;  3FGU A;  3ATU A;  3CM6 A;  4O44 A;  1Q18 A;  2IVP A;  2IC3 A;  1V4T A;  3E1Y A;  2O8F A;  1LWF A;  1TYQ B;  4MO4 A;  4YDU C;  3MX5 A;  4K42 A;  1J5E K;  4FJ5 A;  4BQZ A;  4O0J A;  4ID5 A;  1Q9Y A;  4KH6 A;  4EFH A;  1NWK A;  3O3H A;  2D4W A;  1H1V A;  5HRP A;  4IWV A;  4OLB A;  3KK2 A;  2E2N A;  5ELZ A;  2IVO A;  3JYT A;  3TR8 A;  1OKJ A;  4JKE A;  4FPB A;  1QSY A;  3SJJ A;  5ADX A;  3V4I A;  4QOZ B;  4PWD A;  3LDL A;  4FJ9 A;  3TSQ A;  5GIN A;  1B9D A;  3SK3 A;  1TKD A;  3OY9 A;  1NGJ A;  5J2M A;  3H6E A;  3NFA A;  4IFV A;  1YTA A;  4CZL A;  3CM5 A;  2HBL A;  4BRG A;  2ITM A;  4DB3 A;  1NK7 A;  4ZTF A;  5B8H A;  1W97 L;  5IWA K;  3ZYY X;  1T03 A;  3K9K A;  4I2Q A;  3R3L A;  2D0C A;  1U2V B;  4KRE A;  4FJL A;  2QW9 A;  2A3Z A;  4DTS A;  1KVC A;  4BR9 A;  3HVT A;  2OZS A;  4OKJ A;  2Q3S A;  1LW0 A;  1ZC6 A;  4EZ9 A;  3CCU N;  1YHQ N;  4CFA A;  3HVR A;  3CI5 A;  1YJ9 N;  3CCS N;  2HHH K;  4EAH D;  4CF2 A;  3LDO A;  3V9Z A;  4CJL A;  4H5T A;  3M8Q A;  4FLW A;  3QIC A;  1XC3 A;  3HBT A;  2O8B A;  4BE1 A;  1RTI A;  3BF1 A;  3A2F A;  3F2K A;  4RW7 A;  3THW B;  3CFP A;  2DFH A;  1C1A A;  5KGW A;  3OTO K;  1L5U A;  3VEY A;  1KLN A;  1S1T A;  3HPG A;  1LV5 A;  1WSG A;  4JKG B;  4DU4 A;  4OKE A;  5AQY A;  1FXX A;  4N56 A;  1FJG K;  1K9M O;  3SBG A;  4CJ3 A;  1VK0 A;  1CZA N;  4FW1 A;  4FXD A;  3KLE A;  2OTL N;  2GBZ A;  4JKD A;  3TAQ A;  4CER A;  3UE5 A;  4HCB A;  4M3X A;  2HMI A;  1X9M A;  4WYB A;  2FBX A;  4LF4 K;  1QVF M;  4IZ9 A;  2H3G X;  3T1Y K;  3SLC A;  4F9O A;  4CK1 A;  4DQS A;  3VPZ A;  4DTU A;  2E8A A;  1S72 N;  3AVH A;  1BQM A;  4KHS A;  1GOA A;  4O8U A;  1FKP A;  1MWM A;  4BRI A;  3C7N B;  5JVG L;  4GVM A;  4GKK K;  3MN5 A;  2CGL A;  1TK8 A;  2I7N A;  3HOT A;  4YNQ A;  4EP5 A;  1NBW A;  2G8H A;  3LWM A;  4CD3 A;  4AM6 A;  3QEI A;  1DT9 A;  3VOV A;  1NK4 A;  4CZI A;  4CJR A;  1BL3 A;  1EET A;  2I5J A;  1W9H A;  3AO3 A;  4E1M A;  1BQN A;  1S1V A;  3AO5 A;  5LY3 A;  5HP1 A;  3DJC A;  1HMV A;  5AZI A;  3WXM B;  3MED A;  1IBK K;  4AH9 A;  4FWR A;  5EXW A;  4BG9 A;  4CE9 A;  2KZM A;  4M3T A;  4JI8 K;  3ULE B;  2P9N A;  1HR0 K;  1O13 A;  4J2B A;  1RTD A;  1DTT A;  2Q0R A;  4QCL A;  1BO5 O;  1KC8 O;  3KLI A;  5F2R A;  3VET A;  3AVG A;  3SQ0 A;  4NCA A;  1S1X A;  4PKG A;  1N36 K;  3THX B;  4XH4 A;  5CZ1 A;  3VER A;  1UA0 A;  4ISE A;  2Q97 A;  3OS2 A;  1TUU A;  3MEG A;  3VGK A;  3NH0 A;  2JWL A;  1VQ6 N;  1LWE A;  1C0T A;  2CH5 A;  3CJA A;  1SS6 A;  4BR7 A;  5AQL A;  4KTZ A;  3DLG A;  4KHQ A;  3VEN A;  4A2A A;  2ZF5 O;  1HKG A;  3KK3 A;  3DRS A;  5AQU A;  3CD6 N;  4ICL A;  4H0V B;  1N8R O;  2FXU A;  1RT1 A;  2IS3 A;  1HNX K;  3ULE A;  2P9P A;  3QLH A;  5EVZ A;  4IKF A;  1EQY A;  3DOK A;  2A1R A;  4F2S A;  2QTD A;  4G1Q A;  3ENH A;  3DWL A;  3VQP A;  3KWG A;  3DXK B;  4A59 A;  1RT3 A;  3IDH A;  3D2F B;  3THX A;  5CYM A;  5GAH P;  3ID8 A;  1RFQ A;  3MXI A;  4CJK A;  4EIA A;  4WQ4 C;  1GLB G;  4E1N A;  4R79 A;  3LPT A;  3O3G A;  1NJI O;  3KLF A;  3VQ7 A;  5M1O A;  1RT6 A;  5HL7 L;  1U6Z A;  4E7H A;  2UU9 K;  1CXU A;  4DCH A;  4CGJ A;  3G4S N;  2BTF A;  4YOX A;  1IG8 A;  3S9H A;  3AAQ A;  1NGF A;  4FOE A;  4AHT A;  1QQC A;  3AVM A;  1GLA G;  3KLH A;  1KRP A;  3TAR A;  4ZHR A;  3DRP A;  5AFU H;  1W7A A;  1BGX T;  2OTJ N;  1YXQ A;  3IS9 A;  3ZSV A;  3OYB A;  5J2N A;  4M3U A;  4NXM K;  3KWI A;  1I3A A;  3VF2 A;  1YVN A;  4CGI A;  1BA1 A;  3HRG A;  3OYJ A;  1ILY A;  4FJH A;  3ZX3 A;  4BRQ A;  4OPK A;  1X9S A;  3OJU A;  4IEI A;  1QVG M;  1RBU A;  1L3S A;  2V7Y A;  3FFK B;  5JS2 A;  3HYF A;  2ZJP L;  3I56 N;  4CGF A;  3CYM A;  1VSK A;  4DQI A;  4CCH A;  5AQX A;  4CD1 A;  4Q0B A;  3H1V X;  3O4Q A;  3SAH A;  1LWC A;  4KH5 A;  4M7Y A;  1NMD A;  5AQN A;  4A62 A;  2XY7 A;  4IG3 A;  2A42 A;  3DLB A;  3GL1 A;  1C0G A;  3HST B;  4RTF D;  1VAZ A;  1NJW A;  1WBD A;  4DTX A;  4WQ5 C;  3TTC A;  1NKE A;  1NM1 A;  1SKR A;  5C0Y A;  2E5L K;  4I7F A;  1ZBS A;  3NGY A;  3EE8 A;  3R8E A;  1S1U A;  3VQ9 A;  3D45 A;  4PKI A;  3NAE A;  4IO8 A;  1VQ5 N;  3AVC A;  4DV5 K;  1OH5 A;  1OH6 A;  4RCH A;  1UOC A;  3A5N C;  4B1W B;  3CIP A;  2XHB A;  3ULD A;  4DFP A;  5C2D A;  1CXQ A;  3OJS A;  1QSL A;  1RT4 A;  4Z4E A;  3AVB A;  2UXD K;  4ZTJ A;  4JN4 A;  1NGC A;  1QHA A;  3THV A;  3O8M A;  4FWN A;  3TU5 A;  3SCX A;  1BHL A;  3V1R A;  1N34 K;  3O5B A;  3EO3 A;  5DM7 L;  1ZXO A;  3IUC A;  3SV4 A;  4TSX A;  5AFU A;  3GOI A;  1YT3 A;  4JRP A;  3AGK A;  1KCF A;  1JLA A;  1L3V A;  3G10 A;  2ASM A;  3H1Q A;  5DK5 A;  3AA3 A;  2ASO A;  4DTP A;  3SUN A;  4CI6 A;  2P9L B;  4JK9 A;  3CME N;  1BG3 A;  3O1B A;  3DLH A;  1G15 A;  5A2Q O;  1SKS A;  5AQF A;  3ZSQ A;  3VQE A;  5BRD A;  1D5A A;  4KKO A;  3J7A P;  1ASW A;  4BRL A;  4LH4 A;  3ISN C;  3OYH A;  3VTH A;  1JJ2 M;  3T1H K;  1ZBU A;  3ZEU B;  2QI2 A;  4BRK A;  2GEL A;  3MX2 A;  1SUQ A;  4E89 A;  3OBW A;  5J2P A;  1SQK A;  3K5N A;  3CCR N;  4FZY A;  3TSU A;  5JS1 A;  1WSI A;  4JYA K;  4GW6 A;  3THY B;  1R0A A;  1VSI A;  4H5N A;  1NGA A;  4BC5 A;  2IVN A;  5AQM A;  3LDN A;  3VF6 A;  4CJE A;  4UQG A;  2VGN A;  4FJI A;  3T1A A;  3WXI A;  1Q7Y O;  2OPQ A;  1OH8 A;  3TAM A;  3T69 A;  3KKS A;  5I42 A;  3QEP A;  2DTU A;  4LF7 K;  1GLJ O;  4HUG A;  4CJ4 A;  4DMN A;  3NH2 A;  1LAV A;  3PO5 A;  3NMU A;  3L2Q A;  1JLB A;  1IKY A;  2VWK A;  3P83 D;  4DSK A;  4BQL A;  5HBM A;  4Z4F A;  3QBX A;  2HHQ A;  2BGG A;  3PY8 A;  2HMP A;  4C8N A;  4DR6 K;  3NDK A;  1NNE A;  4B9T A;  1KTQ A;  1ASU A;  1DGK N;  3MXM A;  4B9U A;  3V6D A;  3PSI A;  4B9V A;  2VCP A;  1T44 A;  3OYF A;  1Q82 O;  4BRH A;  3JSM A;  1B9F A;  2W41 A;  4CZF A;  2NRV A;  1UAX A;  4CJF A;  2P5O A;  2UUB K;  3R6M A;  4LFC K;  1U48 A;  2YHY A;  2YKM A;  3NE6 A;  4FWQ A;  4FJX A;  2QK9 A;  3GBT A;  3QNN A;  3PLA A;  1GOB A;  2D0B A;  5GAE P;  5JVH L;  5AQW A;  3ZLJ A;  1JCE A;  4BC2 A;  1YI2 N;  2F7T A;  2DFF A;  4BWJ A;  1HUX A;  4LSL A;  3AVJ A;  4KFB A;  3DAW A;  2B4J A;  4F4K A;  1VSL A;  1IBL K;  3D6R A;  1Q8I A;  1V4S A;  3B6O A;  1VSF A;  4FK0 A;  3H45 C;  4QS7 A;  3RR7 A;  4PUO A;  5JMV A;  3P1G A;  3MN7 A;  1NU0 A;  2FLO A;  4JD2 B;  3RMD A;  3UKU B;  2VYP A;  5M1Q A;  2W6K A;  2FC0 A;  3MMV A;  4WE1 A;  4IOC L;  4DLE A;  5HOO A;  4DSE A;  2BE2 A;  1SL1 A;  1NGH A;  3PO4 A;  3SNN A;  5GIO A;  2RF2 A;  1W2B M;  3VEV A;  1C0F A;  3QEV A;  3LP1 A;  3VGM A;  4CGG A;  3K2P A;  1TL3 A;  3HP6 A;  1JXE A;  2FF6 A;  3MN9 A;  5ADX H;  2O8D A;  4JEP A;  4Z4H A;  2DY4 A;  3HPO A;  2YNI A;  4E0D A;  2P9K A;  2ZM6 K;  5M1K A;  4C1N K;  4DF4 A;  3V1Q A;  3FZK A;  1TK5 A;  4R5P A;  4I6M A;  2KFZ A;  4YOV A;  4X65 K;  4FYD A;  4JHD B;  4E7I A;  4PL7 A;  4BAC A;  2W42 A;  4KI4 A;  4DR4 K;  1TKT A;  4B9N A;  3QIN A;  3AO4 A;  2YX6 A;  4CF9 A;  3HM8 A;  2VWB A;  1UWB A;  4JS5 A;  4FLZ A;  3WQU A;  2YHA A;  1JCF A;  1XWL A;  4DSL A;  2GV9 A;  4CK3 A;  2OPP A;  2Y1I A;  3NVK A;  4OJR A;  2P9I A;  4BWM A;  2P9S B;  2UUA K;  1JLF A;  1HYV A;  3P31 A; 
#chains in the Genus database with same CATH homology
 4AM6 A;  1QZ6 A;  2NRW A;  3SAF A;  1DT9 A;  3ATV A;  4K43 A;  2BH1 A;  4IXC A;  3VOV A;  5H1S Q;  1M1K O;  4CZI A;  3CER A;  3H46 O;  4OPA A;  3WXL A;  4AF1 A;  3M3Z A;  3FZL A;  5CE3 A;  3KHY A;  4B1X B;  4BR4 A;  5LY3 A;  3S41 A;  3DJC A;  5AZI A;  2HOE A;  3WXM B;  3P38 A;  3QDK A;  4FWR A;  1BU6 O;  2HF3 A;  2NRT A;  2V51 B;  3B8A X;  3BF3 A;  1MDU B;  4JKH A;  5BPL A;  5EXW A;  4BG9 A;  1NGG A;  3ULE B;  4IOA L;  3Q7C A;  3U4L A;  2P9N A;  4HTL A;  3TTF A;  2DPN A;  1BA0 A;  3FLC O;  3O6W A;  1O13 A;  4JK7 A;  4BC4 A;  5EOY A;  1VQN N;  2Q0R A;  4BRF A;  2QWR A;  3L0Q A;  3FE1 A;  4BVO A;  1BO5 O;  3CET A;  3CJC A;  4EHT A;  4DKW A;  1KC8 O;  5GAD P;  5F2R A;  2HST A;  1LOT B;  1IJJ A;  3VET A;  2PFU A;  4WFB L;  4FSV A;  3RSE B;  1KAX A;  2Q1N A;  1SZ2 A;  3R1X A;  4FWS A;  4PKG A;  5M1P A;  3ZX2 A;  5JLH A;  4U7B A;  5BN8 A;  4BVP A;  2J4R A;  2RHK A;  3QFP A;  1X3N A;  4XH4 A;  3VER A;  4BR0 A;  2QA4 N;  4ISE A;  4H0T B;  2Q97 A;  3N4P A;  3LDP A;  5AQI A;  4A5B A;  4PKH A;  1TUU A;  3VGK A;  3IKM A;  1LCU A;  2D1K A;  1HPM A;  2YHW A;  2ZJQ L;  1WOQ A;  1EO1 A;  1TYQ A;  2I7P A;  2P9U B;  5AQS A;  2JWL A;  1VQ6 N;  2CH5 A;  2QWN A;  3CJA A;  1SS6 A;  2A40 A;  4BR7 A;  3VEW A;  5AQL A;  4O5F A;  3WT0 A;  4WFA L;  3VEN A;  4A2A A;  5JIC A;  2ZF5 O;  1HKG A;  2NNW A;  3EKU A;  5AQU A;  4GV9 A;  3CD6 N;  3QBW A;  4IO9 L;  4H0V B;  3CC7 N;  2FSK A;  3FZF A;  3CXC M;  1N8R O;  3AGR A;  1KD1 O;  2FXU A;  4ILJ A;  2QM1 A;  4BR2 A;  1HKC A;  5EY4 A;  2E1Z A;  4XH1 A;  3DLL L;  5LJW A;  3MDQ A;  3ULE A;  2AP1 A;  2P9P A;  3CCL N;  4PL8 A;  4G9Z A;  1MA9 B;  2Q2R A;  4K41 A;  5EVZ A;  1EQY A;  4IEE A;  4B9Q A;  4LC9 B;  5FPD A;  4NB4 A;  2QTD A;  4XEI A;  3I55 N;  1HJO A;  2GEM A;  5CHI A;  3ENH A;  4KH4 A;  3J7Z O;  4WQ4 A;  2GWK A;  3DWL A;  1JCG A;  2HBJ A;  4YOT A;  2QWO A;  3KWG A;  3DXK B;  1HLU A;  4A59 A;  4PHT X;  3DXM B;  1XQS C;  2NRH A;  3CQX A;  3GG4 A;  3D2F B;  3IDH A;  4H03 B;  3L4I A;  5F0X A;  3J8A A;  5GAH P;  4YOR A;  3ID8 A;  1RFQ A;  2GX9 A;  4FL9 A;  3C0B A;  4EIA A;  4WQ4 C;  2VGM A;  1GLB G;  3M1F A;  4NO7 A;  3E9L A;  3QFU A;  4R79 A;  3Q7B A;  3JXU A;  1NJI O;  3CJ7 A;  3ZET B;  1ATR A;  5AQR A;  1RDW X;  1KXP A;  3O1W A;  5BRH A;  1KAZ A;  3O9Q A;  5M1O A;  5HL7 L;  1U6Z A;  1VQP N;  1ESV A;  1U2V A;  2E1Y A;  3QML A;  4DCH A;  4BGA A;  3G4S N;  2BTF A;  2E20 A;  1QQM A;  2QWM A;  4YOX A;  1IG8 A;  4BC3 A;  3CCM N;  3E66 A;  2F9T A;  5BPM A;  3M6G A;  4YOY A;  3AAQ A;  4FPA A;  3CHW A;  3OHR A;  4JD2 A;  1NGF A;  3CCE N;  4FOE A;  3UKU A;  1M90 O;  1GLA G;  1X3M A;  3WEE B;  2NLX A;  3U9Z A;  3A8Y A;  5AFU H;  2OTJ N;  1YXQ A;  1VQM N;  4WF9 L;  3CMA N;  1Q81 O;  1Z05 A;  4JKC A;  4M7X A;  3CJ9 A;  5BRE A;  3KWI A;  1S22 A;  3L6Q A;  2E2P A;  4FWO A;  4HWI A;  4QS9 A;  3VF2 A;  1YVN A;  4ILG B;  1BA1 A;  1VQ8 N;  5GAG P;  3HRG A;  3CPW M;  1ILY A;  5M1N A;  1DEJ A;  4IFE A;  2E2O A;  2WBN A;  3ZX3 A;  4BRQ A;  4FWL A;  3D2E B;  3O9U A;  4IEI A;  2HF4 A;  4GY2 B;  5I9E B;  1QVG M;  2V7Y A;  3CJB A;  4JKG A;  3UKR B;  2GTD A;  3G25 A;  1NGI A;  3FFK B;  4IDH A;  4A2B A;  1ATS A;  1S3X A;  2ZJP L;  3E9O A;  3I56 N;  4QS8 A;  4C23 A;  1YIJ N;  5C2F A;  5FPM A;  4UY8 O;  5AQX A;  1HX1 A;  2EWS A;  4H0X B;  4J8F A;  4CD1 A;  3WUH A;  4H5V A;  3MWP A;  4Z94 A;  3H1V X;  1X9J A;  2QEX N;  3TTD A;  1VQ7 N;  4JHD A;  5DM6 L;  5AQQ A;  3SAH A;  4M7Y A;  4KH5 A;  5AQN A;  1NMD A;  4A62 A;  4OO1 J;  2A42 A;  3GL1 A;  1C0G A;  2YHX A;  4RTF D;  4E1J A;  1VAZ A;  5KPT A;  3CQY A;  4WQ5 C;  3TTC A;  4FOI A;  1NM1 A;  2YCH A;  3CJ1 A;  5C0Y A;  5AQV A;  1ZBS A;  1BDG A;  3WEE A;  5KQ8 A;  3EE8 A;  3R8E A;  1YIT N;  2E2Q A;  4PKI A;  5AQH A;  4IO8 A;  1VQ5 N;  2NRX A;  3TSP A;  1K8K A;  2FSJ A;  4RCH A;  3A5N C;  3C7N A;  3CIP A;  4B1W B;  5AZJ B;  4BRD A;  5C2D A;  2KHO A;  1P8Z A;  2YI1 A;  3N4Q A;  4WFN L;  5BRF A;  5M1F A;  3CCQ N;  2NZT A;  4ISG A;  2P9S A;  4GV3 A;  4IOX A;  4BR5 A;  2FF3 B;  1MWK A;  4JN4 A;  5AQP A;  5AR0 A;  3CCJ N;  5AQT A;  5BPN A;  1NGC A;  1QHA A;  1XUP O;  2CGJ A;  5C10 A;  3O8M A;  5EX5 A;  2F9W A;  2CH6 A;  3I33 A;  3IFR A;  4FWN A;  3TU5 A;  4CBX A;  1K73 O;  2NRR A;  3GDQ A;  3O5B A;  3W3D A;  3A5M C;  3EO3 A;  5DM7 L;  1ZXO A;  1DKG D;  3IUC A;  4B1V A;  3CC4 N;  2P9K B;  3QB0 A;  5AFU A;  1RGI A;  2WC9 A;  3GOI A;  3MCP A;  3O08 A;  5F1X A;  4O8K A;  5JLF A;  4BRE A;  1BOT O;  1RDU A;  4MDB A;  3AGK A;  3MN6 A;  3R9P A;  4A5A A;  4I6M B;  4JK8 A;  1VQK N;  3LM9 A;  4H0O A;  1Y64 A;  4CZJ A;  1GLC G;  1NGD A;  1QZ5 A;  4CZK A;  1BWF O;  1NGB A;  3F9M A;  3WQT A;  2ASM A;  1Z6R A;  3H1Q A;  1K8A O;  2BUP A;  2ASO A;  4CI6 A;  1ATN A;  1OVY A;  2WUS A;  3P4I A;  4ILH A;  2Q0U A;  3O80 A;  4JKB A;  1D4X A;  2P9L B;  4MDA A;  2GWJ A;  3A0I X;  4JK9 A;  3M5R A;  3CME N;  1BG3 A;  2IIR A;  2WFB A;  5KPR A;  3O1B A;  2E88 A;  3RSE A;  4BG8 A;  3FR0 A;  4BRM A;  3G6E N;  5AQF A;  1YJN N;  2V7Z A;  5BRD A;  1YJW N;  4Y0W A;  3A5O C;  3EKS A;  1YUW A;  5GIP A;  3AAP A;  4BRL A;  2UYT A;  3NVM A;  4IJN A;  4JKA A;  3AAR A;  4CZM A;  3OW2 M;  2P9I B;  3HOS A;  1GLD G;  3VTH A;  5LJV A;  4H0P A;  1JJ2 M;  3ZEU B;  2OAN A;  2FSN A;  4FVU A;  2QI2 A;  2A5X A;  3MWT A;  4BRK A;  2GEL A;  3KZB A;  3MX2 A;  4U67 L;  3AY9 A;  1VQO N;  3SBT A;  3OBW A;  3PIP L;  1SQK A;  2W40 A;  3HTV A;  3CCR N;  3W0L A;  2P9U A;  3ENB A;  2CGK A;  3TSU A;  3VEX A;  3SMS A;  3U9D A;  1VQ4 N;  5MLC Q;  3O9T A;  1TUY A;  4H5N A;  3O4W A;  1NGA A;  4BC5 A;  2IVN A;  4FWM A;  5AQM A;  4BRN A;  3GE1 A;  5AZI B;  3CPE A;  3LDN A;  3VF6 A;  1SAZ A;  2V52 B;  3OBY A;  5C12 A;  3FZH A;  3VTI A;  5AQO A;  3IMX A;  4H5W A;  2VGN A;  3WXJ A;  3LDQ A;  3CCV N;  4C1N I;  2P9N B;  4MO5 A;  3VES A;  3WXI A;  1Q7Y O;  1VQL N;  1QQO A;  4FO0 A;  3T69 A;  1GLL O;  2NRZ A;  3EE9 A;  2GUP A;  1GLJ O;  3I8B A;  4CZG A;  3U8X A;  4BY9 C;  3T7Z A;  5AQZ A;  2PBD A;  3DXK A;  4B1Z A;  1HKB A;  2HBM A;  3DXM A;  3RVC A;  2ASP A;  3H3O B;  3D2F A;  4JNE A;  3ID6 A;  3NMU A;  4DQ8 A;  2QXL A;  3KK7 A;  4NLC A;  1T3V A;  3MCA B;  1R59 O;  1BUP A;  1QQN A;  4MLH A;  3ZET A;  3O9R A;  4M63 C;  4WQ5 A;  4YOU A;  4BQL A;  1KQS M;  5TKY A;  2ZGY A;  3O9S A;  3OA9 A;  2ZGZ A;  3HSC A;  5AQK A;  3QBX A;  4CJ7 A;  2QWP A;  5C15 A;  3C65 A;  3FGU A;  3ATU A;  2QWL A;  3BUZ B;  2HMP A;  3WXK A;  3VMF B;  3CC2 N;  1Q18 A;  2IVP A;  1V4T A;  4CBU A;  3E1Y A;  1TYQ B;  4H0Y B;  4MO4 A;  2A41 A;  4BRA A;  4YDU C;  5KQD A;  4GV6 A;  3MX5 A;  4K42 A;  1DGK N;  4BQZ A;  3E9P A;  4KH6 A;  3P39 A;  3EZW A;  4EFH A;  1NWK A;  2D4W A;  2VCP A;  1H1V A;  5FPE A;  1T44 A;  4ISF A;  4IWV A;  4BRH A;  3VGL A;  1Q82 O;  2A6A A;  3MK6 A;  2HBK A;  2W41 A;  2E2N A;  5ELZ A;  4CZF A;  2NRV A;  2IVO A;  2YJF A;  2P9P B;  4CZE A;  3K9J A;  1OKJ A;  4JKE A;  3R6M A;  4FPB A;  4H5R A;  3EL2 A;  2Q31 A;  3D2E A;  5FPN A;  2YHY A;  4L3Q A;  3A5L C;  5AQG A;  5ADX A;  1YAG A;  4FWQ A;  3LDL A;  4A61 A;  4A57 A;  1GLE G;  4NLB A;  5E26 A;  3UKR A;  3GBT A;  3TSQ A;  5GIN A;  1NLV A;  3SK3 A;  4AM7 A;  3PLA A;  1T6D A;  1NGJ A;  3H6E A;  3H3N O;  2YJE A;  3VEO A;  4BRP A;  5GAE P;  5JVH L;  1GLF O;  5AQW A;  4CZL A;  1JCE A;  4BC2 A;  1YI2 N;  2F7T A;  3F5T A;  1KAY A;  1HUX A;  2PAV A;  3KVG A;  2HBL A;  4JAX A;  5BN9 A;  2ITM A;  4BRG A;  4DB3 A;  3PIO L;  3D7E O;  3DAW A;  5B8H A;  1W97 L;  3D6R A;  3ZYY X;  3K9K A;  1V4S A;  5TKW A;  3R3L A;  3HZ6 A;  5BR9 A;  1U2V B;  4JKF A;  4YOW A;  3H45 C;  4QS7 A;  2QW9 A;  2A3Z A;  4RWT A;  3BEX A;  4BR9 A;  5JMV A;  3MN7 A;  2FLO A;  3HI0 A;  4JD2 B;  4EHU A;  1ZC6 A;  3UKU B;  3CCU N;  1YHQ N;  2VYP A;  5M1Q A;  4BGB A;  3CI5 A;  1YJ9 N;  3CCS N;  3MMV A;  4EAH D;  2JWK A;  3FZM A;  4KBO A;  3LDO A;  4OPH A;  4H5T A;  3SAG A;  1G99 A;  4IOC L;  3QIC A;  1XC3 A;  3HBT A;  4BRC A;  5AZJ A;  5HOO A;  3UB5 A;  4CBW A;  1NGH A;  5GIO A;  1W2B M;  2KLA A;  3BF1 A;  3F2K A;  1E4F T;  1E4G T;  1NGE A;  1C0F A;  5CR4 A;  3VEZ A;  3VEV A;  3VGM A;  4BRO A;  3VEY A;  4CZH A;  3C6H A;  3LL3 A;  4B1Y B;  4MLE A;  3TPQ A;  4WCE L;  2FF6 A;  3MN9 A;  5ADX H;  4JKG B;  4K25 A;  4JEP A;  4GNI A;  3L4Q A;  2KKZ A;  5AQY A;  3EN9 A;  2P9K A;  1P90 A;  1K9M O;  5M1K A;  3SBG A;  4C1N K;  1T6C A;  1CZA N;  3VF4 A;  3BP8 A;  3FZK A;  2OTL N;  2ZWH A;  4I6M A;  4JKD A;  4YOV A;  4XH5 A;  3UE5 A;  4JHD B;  2ZJR L;  4WYB A;  1J6Z A;  4PL7 A;  1QVF M;  4FWP A;  4IZ9 A;  2H3G X;  3SLC A;  4F9O A;  1VQ9 N;  3VPZ A;  5E84 A;  2YX6 A;  2P9L A;  4GVE A;  3SJH A;  2E8A A;  2QWQ A;  3HM8 A;  2D0P A;  2VWB A;  3CF5 L;  1S72 N;  2Q36 A;  3SMP A;  3WQU A;  2D0O A;  4FWK A;  1JCF A;  1MWM A;  4O8U A;  3ENO A;  3G71 N;  1K8K B;  1YF5 L;  1WUA A;  4BRI A;  5KPZ A;  3C7N B;  3LM2 A;  5JVG L;  3MN5 A;  2CGL A;  3C6A A;  3NVK A;  1Q86 O;  5AQJ A;  2I7N A;  4DHY A;  2P9I A;  3HOT A;  2RE2 A;  1NBW A;  2P9S B;  4YDU A;  3ZEU A;  2AA4 A;  4B1U B;  4IJA A;  3ZX0 A;  3JS6 A;  4CD3 A;  3P31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...