3CETA

Crystal structure of the pantheonate kinase-like protein q6m145 at the resolution 1.8 a. northeast structural genomics consortium target mrr63
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
300
Chain Sequence
MILGIDIGNTKITELHENGEFKVHHLVSHVALVTTAETKKEGVDNILNAAESAFGSNISVFDSNGNFISLESAKTNNMKVSASNWCGTAKWVSKNIEENCILVDMGSTTTDIIPIVEGKVVAEKTDLERLMNHELLYVGTLRTPISHLGNTISFKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVAEKYGSKKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSFAVAELLKNELLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the pantheonate kinase-like protein Q6M145 at the resolution 1.8 A. Northeast Structural Genomics Consortium target MrR63.
rcsb
source organism Methanococcus maripaludis s2
molecule tags Structural genomics, unknown function
molecule keywords Conserved archaeal protein
total genus 97
structure length 300
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01968 Hydantoinase_A Hydantoinase/oxoprolinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cetA01
3.30.420.190 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 conserved archaeal protein q6m145 3cetA02
4H5TA 2ASMA 5AQTA 3R6MA 5AQWA 1ATSA 2PAVA 2QXLA 3ENHA 3EKUA 4RWTA 1BUPA 1IG8A 2D0OA 4H0OA 3FZMA 4HTLA 2YI1A 3ZX0A 4BR4A 2CH6A 2E1YA 3HBTA 5JICA 1EQYA 1TUYA 3LDNA 1S3XA 1NGJA 3FR0A 1NGAA 3O4WA 4YDUC 3BF1A 3FE1A 3P4IA 1K8KB 5ADXH 2YJEA 2E2QA 5BN8A 1T6DA 4GNIA 1QQNA 5E84A 3J8AA 4FSVA 1E4FT 1WUAA 2AP1A 4BR7A 3VF4A 5CE3A 4PL8A 4ISFA 3MN9A 3R9PA 4CD1A 3C7NA 3H45C 2FSJA 5AZIB 3LDQA 4ISGA 5TKYA 1BA1A 4DCHA 1KAZA 2A40A 1GLEG 1BA0A 3SMSA 2E1ZA 3O6WA 2A42A 4BRKA 4E1JA 1HLUA 1X9JA 2A5XA 3FZHA 3OHRA 3EO3A 5ELZA 5LJVA 5AR0A 4RTFD 2E2PA 5JLFA 4PKGA 3UKRB 4B1WB 3WXJA 3HI0A 5LJWA 3TPQA 1CZAN 3B8AX 2CGJA 2E2NA 3VEWA 2Q97A 1NGGA 3MMVA 4A61A 4H0XB 4B9QA 2F9TA 4JNEA 4PKHA 2GUPA 3ENOA 3TU5A 4BC5A 3EL2A 2P9LB 3UB5A 4A2BA 4BR9A 3U9DA 5BR9A 3O08A 3C7NB 4I6MB 1HX1A 4WQ4C 3CIPA 3WEEA 3RSEA 2Q31A 2F9WA 5AFUH 3CQYA 4FWQA 4BVPA 2ITMA 2P9NB 5AQRA 1V4TA 3C0BA 2KHOA 5F2RA 4YDUA 5AQJA 1DKGD 4DHYA 3H3NO 3UKRA 4H03B 3HSCA 4O5FA 4EFHA 1TYQA 5AQVA 5F0XA 4JD2A 4A2AA 5AQUA 1LCUA 1Z6RA 1X3NA 4RCHA 2GELA 4KBOA 1KAYA 2H3GX 5AQOA 3D7EO 1G99A 4J8FA 4FWPA 3EN9A 3D2EA 3A5LC 3H1VX 1QHAA 4L3QA 5KPTA 3SK3A 5BPMA 3W0LA 5ADXA 1ZXOA 1NLVA 4BGAA 4NO7A 2QWNA 4CZGA 3DWLA 2P9NA 5AQZA 3SJHA 3FFKB 3GDQA 2CH5A 4BRFA 4FPAA 2QWOA 4FL9A 4BRMA 3CERA 3M1FA 2P9UB 3DXMB 1NGCA 2QW9A 2P9KA 4EHTA 5AQIA 4BG9A 3IUCA 2D1KA 3GG4A 3VETA 5AQKA 3I8BA 3VPZA 3D2EB 1GLCG 2J4RA 4IO8A 4BC2A 4BRQA 4PL7A 2YHYA 3SMPA 3W3DA 4B1XB 3ULEB 4BR5A 3WQUA 4BG8A 3MN6A 2HF4A 3CJ9A 5AZJB 1RFQA 1RDWX 4M63C 3HZ6A 4BVOA 2PBDA 2YHXA 1LOTB 4EHUA 5BRFA 2V7YA 3HTVA 1SAZA 4K43A 3U4LA 3AAQA 1D4XA 3QMLA 3QDKA 1C0GA 5BRDA 4CBXA 2P9KB 5BN9A 4QS7A 4XEIA 5AQHA 1ATRA 1HJOA 4WQ5C 2Q36A 2QM1A 4DQ8A 5BPLA 4H0PA 3O1BA 1Y64A 4LC9B 2CGKA 3M6GA 2E8AA 1YVNA 2P9LA 1QQMA 2A41A 2WUSA 1K8KA 5BRHA 1HKCA 1NBWA 1KAXA 2IIRA 4BRGA 5AQNA 4XH1A 2NLXA 3WEEB 3IMXA 3ZX3A 1GLJO 1R59O 3KVGA 4JN4A 3O8MA 5KPRA 3IFRA 1RGIA 1BWFO 2YJFA 3FZKA 2GWKA 4BGBA 4FWRA 4Y0WA 4BC3A 5BPNA 3A5OC 5FPEA 4A62A 3WXIA 4BRIA 1TYQB 5AQPA 2EWSA 2HF3A 3LDPA 4NB4A 3MCPA 2GEMA 1YAGA 3G25A 5I9EB 1GLAG 2IVNA 1C0FA 1NGFA 5AQYA 3AY9A 4IWVA 4K41A 3O80A 2CGLA 3MN7A 3U9ZA 3F9MA 3BUZB 4FO0A 3CJ1A 5FPDA 2VWBA 4I6MA 3DXKB 4FWSA 5AQMA 3QFPA 3BF3A 3ZEUA 2P9SB 2P9PB 2ZGYA 4CBUA 3AARA 3LL3A 3LDOA 4CI6A 5AQFA 3VF2A 4K42A 4HWIA 1HKGA 3WQTA 2QWRA 3VOVA 2DPNA 1NGIA 1JCGA 3VESA 5AQSA 1P8ZA 3I33A 3VEZA 1WOQA 4GY2B 4JD2B 1NM1A 3A5NC 3GBTA 1YUWA 1E4GT 3CQXA 5FPMA 3ULEA 1Z05A 2QWPA 1NMDA 4FWMA 4CZLA 4JAXA 1XQSC 1NGHA 2E20A 4BRLA 3QBXA 4BRDA 3VEYA 3CJCA 3QBWA 4B1ZA 3AAPA 5F1XA 5AZIA 2BUPA 2P9PA 3EKSA 1DGKN 3QFUA 4BR2A 5KQDA 4CZFA 1ZBSA 3QICA 3KZBA 3LM9A 1HKBA 3CHWA 4CZJA 3R8EA 4IJAA 4EAHD 2P9IA 3GOIA 2P9UA 3DXMA 3VEVA 4ISEA 2FF3B 5EVZA 5EX5A 2E2OA 5AQLA 4MO5A 2I7NA 3JXUA 1T44A 4BREA 1XC3A 4QS8A 1U2VB 3ATVA 3MDQA 3WXLA 3ZETB 3EZWA 4K25A 4CBWA 4XH4A 2YCHA 4H5VA 4BRCA 4XH5A 1GLBG 5E26A 1Q18A 3VERA 3WT0A 5EXWA 3BEXA 2VYPA 2UYTA 1NWKA 4WQ5A 3UE5A 1MA9B 1SZ2A 4IJNA 4IXCA 2QWLA 3ZX2A 3D2FB 1BO5O 4CZIA 3SLCA 5FPNA 2W41A 3WXKA 3BP8A 5JMVA 1X3MA 1OKJA 1BG3A 2A3ZA 4FWNA 3MN5A 1MWKA 3RSEB 3FLCO 2NZTA 4M7XA 1V4SA 2E88A 3ID8A 4EIAA 1HPMA 3FZFA 1JCEA 3VENA 3ZEUB 4FOEA 2ZGZA 4DB3A 3UKUA 2ASOA 3QB0A 3FZLA 4CZMA 3LM2A 1TUUA 3GE1A 3L4IA 3CJAA 3CJ7A 2VCPA 2OANA 2ZWHA 4JHDA 3A5MC 4H5WA 4BRPA 3HM8A 3CI5A 1QZ5A 3CETA 3O5BA 4MO4A 1NGBA 2Q2RA 1ESVA 1GLFO 5JLHA 1U6ZA 3MK6A 3O1WA 4M7YA 4CZHA 2GWJA 4H0YB 2V7ZA 4O8KA 4BR0A 5KQ8A 1QQOA 4AM6A 1IJJA 1NGEA 2FLOA 3JS6A 3UKUB 5KPZA 2BTFA 3VEXA 2YHWA 4BQLA 2W40A 4F9OA 1NGDA 4IZ9A 2AA4A 4MLEA 4C23A 5EY4A 1KXPA 2FSNA 4H0VB 4CZEA 1T6CA 2P9SA 3LDLA 3H3OB 4FPBA 4MLHA 5BREA 2HOEA 4B1UB 1QZ6A 2A6AA 3VGKA 3DAWA 2QWMA 4BQZA 1SQKA 3H6EA 1XUPO 4B1VA 1U2VA 4QS9A 3KHYA 3VEOA 3WUHA 3A0IX 4FWKA 3L6QA 2QWQA 3A8YA 3GL1A 4B1YB 1MWMA 4Z94A 3VGLA 4H5RA 3U8XA 5AQQA 5LY3A 1ATNA 3ATUA 5AQGA 3H1QA 2Q0RA 2D4WA 4FOIA 3IDHA 3H46O 2P9IB 4FWLA 1GLLO 2ASPA 3VF6A 4FWOA 2V51B 4CD3A 5B8HA 2IVOA 3CJBA 1GLDG 3ZETA 4AM7A 4PKIA 2Q0UA 2FXUA 5AQXA 1BDGA 4BROA 3M3ZA 4CZKA 2IVPA 1BOTO 1MDUB 3L0QA 4BRHA 4WQ4A 1H1VA 1S22A 1DEJA 2FF6A 2ZF5O 3DXKA 2FSKA 4H0TB 1J6ZA 1BU6O 2D0PA 1ZC6A 2NRHA 1HUXA 4JHDB 3S41A 1YXQA 4WYBA 2GTDA 2V52B 5EOYA 4BC4A 3VGMA 3D2FA 4CJ7A 4BRNA 2Q1NA 1JCFA 3DJCA 4H5NA 5AFUA 4BRAA 2HMPA 2I7PA 5AZJA 3FGUA
chains in the Genus database with same CATH superfamily
1VQPN 2BANA 5AQTA 2ASMA 3AO4A 2QXLA 2KZMA 3LP0A 3EKUA 4F3TA 4FW1A 5M1NA 2D0OA 2FC0A 5J2PA 2YI1A 3ZX0A 2CH6A 3NH0A 3TAQA 1EQYA 1TUYA 3AVKA 1NGJA 3FR0A 3O4WA 3ENBA 3RMCA 3KLGA 1WSEA 1KQSM 3SBTA 4JLHA 1YHQN 3P4IA 4J2DA 3L4QA 5ADXH 2HHWA 2JLEA 3HRGA 4DSLA 4GNIA 1QQNA 5E84A 5HP1A 3NVKA 1SL1A 2AP1A 5CE3A 3K5OA 3M8SA 1CXQA 3C7NA 3HPHA 5JS1A 4CEBA 4DCHA 4CF0A 1UWBA 1GLEG 2A42A 4E1JA 2D5RA 3OHRA 5ELZA 1X1PA 3EO3A 4FW2A 4HUFA 4Y1DA 1LAVA 5JLFA 4PKGA 4PA1A 3M5RA 3WXJA 3HI0A 2CGJA 4CJKA 2Q97A 1NGGA 4H0XB 3HVTA 1VSFA 2GUPA 2JGUA 4BC5A 2P9LB 4BR9A 4M45A 3MCAB 4C8OA 1TAQA 1KCFA 3AVLA 3CIPA 2RE2A 5C2FA 4FJHA 3AA4A 4C8MA 2ITMA 4AHSA 1FXXA 2G8VA 3QO9A 4W5OA 3CC2N 4M3YA 2Z1IA 3H3NO 4JK9A 3UKRA 1JLEA 4EFHA 2UU9K 4DSEA 1TYQA 1VRTA 4RCHA 4KB1A 1Y97A 3AVMA 4KBOA 3D7EO 4J8FA 3EN9A 3A5LC 3H1VX 2O8EB 5BPMA 4LF6K 3V9WA 4DUZK 1K6YA 3T1YK 4E3SA 2QKKA 3LP2A 3DWLA 1DT9A 2ZE2A 1TL1A 3O4NA 4F3OA 3SJHA 3GDQA 1N5YA 2CH5A 4BRMA 4LF9K 2FBXA 4CEQA 2ZM6K 4EHTA 2G8UA 3HXMA 3IUCA 4CJTA 2D1KA 4DR5K 1B9FA 4O55A 3OYJA 3HOTA 3P1GA 3VQ8A 3G10A 4B3RK 2OPPA 3VA3A 4B1XB 4DTUA 4WFAL 4LF7K 4CIGA 2XO7A 1WN7A 3HZ6A 3ZT1A 4FZYA 1CZ9A 4F2RA 3L2RA 1VAZA 5C42A 3THWB 2RKIA 1T7PA 1S1XA 4WQ5C 2Q36A 2QM1A 4DU4A 1M1KO 4JI7K 4LC9B 2CGKA 4KHQA 1YVNA 2P9LA 3D0PA 2HW3A 3KK7A 5BRHA 3TABA 4CJ3A 3I0SA 3S3NA 4BRGA 1RCHA 1FKPA 5AQNA 2DY4A 3VQ6A 3P5JA 1C1AA 3K5NA 1WBDA 3KLHA 3ZX3A 4X66K 1GLJO 4JKGB 3SUPA 3O8MA 5KPRA 3IFRA 3ZSZA 2O8DA 1BWFO 4BGBA 2A1SA 4FWRA 4Y0WA 4DFMA 1OVQA 3DOLA 3WXIA 1KC8O 4BRIA 3TANA 2EWSA 4CEOA 3LDPA 3CM5A 2GEMA 4DQIA 1RDDA 4DFJA 4I9LA 2IVNA 4KI6A 3AY9A 4DS5A 1BCMA 1RTIA 1ASVA 1YTAA 4K41A 1RT6A 1NNEA 3O80A 3MN7A 3U9ZA 3DRRA 5HL7L 3F5TA 2P51A 3KLIA 3DXKB 3KTQA 1Q82O 3QFPA 5M1PA 2ZQBA 2P9PB 4CJSA 2UXBK 4CBUA 4CI6A 2VG7A 3VF2A 1WSGA 4HWIA 1HKGA 1J54A 4JKFA 3VOVA 1RT4A 2O8BB 3NF6A 1JCGA 3OYCA 3NH1A 3VESA 1RDUA 2G8HA 1IKYA 1HMVA 4OLBA 4JKBA 1HNIA 1S5JA 1E4GT 1WB9A 3ULEA 2QWPA 4FWMA 5DK5A 4KTWA 4GW6A 1F21A 4DV7K 2QEXN 3K2PA 4DSFA 1RBSA 3E66A 5KTQA 3MX2A 3VEYA 3MEGA 4KV8A 4I2PA 3NVMA 4W5RA 3AVHA 4JI8K 5F1XA 4O4GA 5AZIA 2BUPA 3QFUA 3V1RA 4BR2A 3KK1A 1ZBSA 3QICA 5HRNA 5KGWA 4YY3K 4N47A 4IJAA 4J2AA 2P9IA 5FLXO 2KLAA 1J9AA 4FJKA 1T03A 3VEVA 2P9UA 5EVZA 1VSIA 5AQLA 4MO5A 1W2BM 1YIJN 4BE2A 4BY9C 4ILGB 4QS8A 4YOYA 3ATVA 3HO1A 4IBNA 4GKKK 4N5SA 3EZWA 3UIQA 4KPYA 3J81O 4C8KA 4CEDA 3RTVA 2YCHA 3DI6A 3VMFB 2Z1GA 1HQEA 4CGHA 2P5GA 3BEXA 4WQ5A 2QXFA 1T8EA 1MA9B 4OPHA 1SZ2A 4B8AB 3AO3A 4C1NI 3ZX2A 3K59A 1RT3A 3I8DA 1IV0A 3BP8A 5JMVA 4AQYK 4FWNA 1Q81O 3CPEA 1VQ7N 2Z1HA 1MWKA 3QESA 2NZTA 4M7XA 4EIAA 3KD1E 1BGXT 4FJMA 1HPMA 4JI4K 2A1RA 3UKUA 1Q9YA 3RMDA 3DRSA 1FW6A 2ZJRL 3OYGA 3LM2A 4OPKA 4FM0A 4JRQA 4ELVA 4B9TA 4FLXA 2WTUA 3OYHA 3DRPA 2VCPA 4TSXA 1JLFA 2UUBK 4H5WA 4BRPA 2G8KA 1QZ5A 1ZBHA 3CETA 4IFVA 4MO4A 3V6DA 1NGBA 1ESVA 3OYLA 1NK8A 5JLHA 5M1QA 4MFBA 4DG1A 3F2KA 5KQ8A 4AM6A 4Y1CA 1IJJA 3C6TA 5KPZA 3SQ2A 3VEXA 2YHWA 2YNHA 3NMUA 2W40A 4IZ9A 3CC7N 3K9KA 3EE8A 1HNXK 3P38A 5HLFA 2XHBA 4NCAA 4CECA 5C0YA 3KWGA 1WLJA 3RMBA 3VGKA 1U48A 4WE1A 1Q8IA 4B1VA 1GOCA 3KHYA 3TSQA 2EX3A 2IAJA 3CMAN 1RBTA 3VN5A 4OJRA 5KRSA 3GL1A 4B1YB 1D5AA 1HPZA 4H5RA 4EP5A 3JYTA 4JK7A 3THWA 2WBNA 3EZ5A 3KKRA 1HR0K 4GMJB 3AO1A 2E6LA 4CJQA 4EZ9A 4Z4EA 1BHLA 4FWLA 4AHRA 3PSFA 4CD3A 2IVOA 2O8DB 3ZETA 2HBJA 4AM7A 3N4PA 5AQXA 4JYAK 1QTMA 4OKJA 5J2MA 5SWMA 3THYB 4YOXA 4DSKA 4LY7A 2HBMA 3NF7A 3L2WA 4DFKA 4C1NK 3S41A 4NLBA 2QTDA 2BE2A 2DFFA 1Q86O 3C6HA 5EOYA 4QCLA 3VGMA 3NAEA 4H5NA 1YTUA 1N36K 4BRAA 2I7PA 2NNWA 3V1QA 3V1OA 2F8SA 4FZZA 5C15A 5AQWA 1IBLK 2HHXA 3L8BA 1KFSA 1BUPA 1IG8A 1S9EA 3CC4N 2GBZA 2E1YA 3O9SA 3JAMO 3PO5A 4NLCA 4YDUC 4FLYA 3FE1A 3OA9A 1EWQA 1KSPA 4YHHK 1BISA 1QQCA 2E2QA 2YJEA 3AVJA 1VQLN 3IKMA 3J8AA 1BL3A 1WUAA 4KREA 4CD1A 1CZBA 4ISGA 1BA1A 2ATQA 4IO9L 2A40A 1BA0A 4DQPA 3O6WA 4A5BA 3E9PA 4DTJA 4BRKA 1HLUA 2YHAA 3FZHA 4KTZA 4HUEA 1LWCA 5AR0A 4RTFD 4B3OA 3UKRB 5HBMA 1CZAN 2E2NA 3M8RA 1N34K 3O9TA 5M1KA 3TU5A 1EETA 3SI6A 2OYQA 2PY5A 3DLHA 2Q31A 2F9WA 4FWQA 2WONA 4BVPA 3CM6A 4RW7A 5AQRA 3L2VA 1O1WA 3C0BA 3IS9A 4N56A 3D6RA 3KK3A 4YDUA 2HVIA 3HSCA 3E9OA 5AQVA 5AQUA 2HHHK 1Z6RA 3QEPA 1YJNN 4JS5A 4UQGA 2GELA 5AQOA 1KAYA 2OZMA 4E7JA 1JLAA 4FWPA 3D2EA 3L3UA 1VQKN 5KPTA 3SK3A 3W0LA 1NLVA 4ZTFA 3T19A 4BGAA 4NO7A 4CZGA 1JLGA 3AA2A 3CFOA 5AQZA 4CGJA 4X64K 1BI4B 2XY8A 4IKFA 2QWOA 4DV5K 4OGEA 4CIEA 2YV0X 1NGCA 1S1VA 2QW9A 4LF5K 2P9KA 3K57A 5AQIA 1VQ8N 1EKEA 1UA1A 1NJZA 2FBYA 5HOOA 1JLBA 5I42A 4O0JA 2E5LK 3ULEB 4FVUA 3EE9A 3WQUA 3LPTA 3RR7A 3IRXA 4JKGA 1T3VA 3ZLJA 3HTVA 3NBPA 1ASWA 1D4XA 3NE6A 3HOSA 3QEVA 4K8ZA 5BRDA 3ZSVA 3RR8A 2VG6A 5AQHA 1QSSA 1C6VA 1HJOA 4FLVA 3SUOA 1MU2A 4BDPA 3T7ZA 4DQ8A 4H0PA 1Y64A 3PY8A 3R1XA 4H4OA 3PO4A 1ZBIA 4AHCA 3LANA 4YORA 2A41A 1NKCA 1N32K 3VQ5A 2NLXA 3WEEB 3IMXA 3KWIA 4CF8A 3O3FA 2O4IA 4B9MA 1RGIA 2GWKA 4OPAA 3VQAA 4BC3A 5BPNA 4B9LA 5FPEA 4A62A 3MAQA 1M90O 4IDHA 1BCOA 1YAGA 2O4GA 1NGFA 3TI0A 1NKBA 1L3SA 3AV9A 1HYVA 4IWVA 4HCCA 2OPQA 4H8KA 2WOMA 3AVFA 3BUZB 4FO0A 2YNIA 5FPDA 2VWBA 2FBTA 4FJLA 3KD5E 4DSIA 3L2UA 3ZEUA 2P9SB 4HVJA 1WAJA 4E7HA 3HT3A 2PYJA 3E01A 3LP3A 1NGIA 4MDAA 2GV9A 1L3UA 2XY6A 5AQSA 5CZ1A 3I33A 3VEZA 1WOQA 4JD2B 1HNWK 3A5NC 3GBTA 2OTLN 4DTPA 5FPMA 1Z05A 3WNEA 4CZLA 4JAXA 1NOYA 5C10A 1NGHA 3SQ4A 1QS4A 4BRLA 3QBXA 4BRDA 5HROA 1ZBLA 3QBWA 4B8CA 2ZD1A 1JXEA 4RW9A 4AHVA 4DV4K 1TK8A 1KVCA 5J2QA 3NDKA 4KHNA 3VQQA 4LFBK 1NK4A 3LM9A 1HKBA 4E7KA 4EAHD 1A5XA 3GOIA 1I39A 1BIUA 1WSHA 3RVCA 1KRPA 4RW4A 4CGDA 3JXUA 2HMIA 4CJLA 4ID5A 4CERA 2HNZA 1ZBUA 4CBWA 2QKBA 2RHKA 3K58A 1CXUA 4BRCA 1YVUA 1GLBG 5E26A 1FK9A 3TAGA 3WNGA 4DR1K 4EZ6A 3PIPL 2UYTA 4IEEA 5HRSA 4FLUA 2W42A 1SKSA 4IJNA 1LW0A 3D2FB 3DM2A 4JI2K 2W41A 2E6MA 4DS4A 1X3MA 1HQUA 2EHGA 2RN2A 4FLTA 4O0IA 3OJSA 1N33K 2A3ZA 4Z4CA 3FLCO 1RT2A 2E88A 5D3GA 3ID8A 3FZFA 3ZEUB 4FJJA 3DLGA 4AHTA 1QHTA 2ZGZA 4DB3A 2ASOA 2BGGA 1VSMA 1ITGA 1TUUA 4I7FA 3JSMA 3SAGA 3L4IA 3CJAA 4DQSA 4ID1A 5CR4A 1RDBA 2FBVA 3J7ZO 2ZWHA 1DTQA 3KIOA 3OYIA 2P5OA 1XC9A 4AH9A 1QVFM 4FJXA 2Y1IA 3OVNA 4DR7K 3AVIA 3HYFA 4NXNK 3V9XA 3TAPA 1NJXA 3O5BA 4C8NA 2YKMA 4PHTX 1E3MA 1SKRA 3DLEA 1U6ZA 3MK6A 3R3LA 3OYKA 1U4BA 2V7ZA 4BR0A 3JS6A 1LAWA 1WNSA 2BTFA 3C94A 1XNQK 4BQLA 4F9OA 1BQMA 2AA4A 4ILJA 3I0RA 4MLEA 5EY4A 1J5EK 1KXPA 1RT7A 4CZEA 5BREA 3LDLA 3H3OB 4FPBA 4MLHA 2HOEA 4E19A 5K14A 4B1UB 3OS0A 5KGXA 1NK5A 4BQZA 4CJWA 3G0ZA 2O8BA 3NF9A 1VSHA 4I2QA 2NRVA 3VEOA 1VHXA 3CCSN 1OH5A 2X6NA 1XHXA 3A0IX 3L6QA 4G1QA 2AJQA 2G8IA 5DM6L 3LZJA 2ETJA 1MWMA 2VGMA 2XY7A 4Z94A 3VGLA 3U8XA 3OYNA 3ZSQA 4OGCA 1VSKA 3DMJA 2KTQA 3AA5X 1LV5A 5GAGP 2HHSA 1ATNA 3ATUA 4QAGA 2HHUA 1YJ9N 5AQGA 3VQEA 3H1QA 3AVGA 1NMNA 4FOIA 3LDSA 3H46O 3H08A 4NXMK 4CEEA 3VF6A 3QIPA 2V51B 4HHTA 3KLFA 3PX6A 5BR8K 3TAMA 4A57A 2FXUA 3HP6A 2I5JA 4CZKA 5KI6A 3AO5A 1BOTO 1HYZA 5LMNK 4BRHA 2B5JA 4CFAA 2FF6A 2ZF5O 3F9KA 3CQ8A 2NRHA 4CHYA 3TR8A 4WYBA 3ZT4A 4BC4A 4LFAK 1JCFA 1SV5A 3O9QA 4OVLA 1VQ6N 5AZJA 3SAFA 2X6SA 1KLNA 2BDPA 5SZTA 2YNGA 1ATSA 2PAVA 4CCHA 2KFNA 1VK0A 3ENHA 4BWJA 4RWTA 4KTQA 3SUNA 4HTLA 4BR4A 2Y1JA 4E0DA 5JICA 3HBTA 3IG1A 1S3XA 3SJJA 4KHPK 4KFBA 1NGAA 2F8TA 3LWLA 4BE0A 3BF1A 3NH2A 2YNFA 1L3TA 4OKEA 1K8KB 1RBVA 5BN8A 3T3FA 4IEIA 1E4FT 2PZSA 4PL8A 4DUYK 2HNDA 4ISFA 4CF2A 3MN9A 3H45C 5AZIB 4Z4FA 3LDQA 2DFEA 4RW8A 3HK2A 5AJ3K 4ILHA 3C6AA 2E1ZA 4X62K 1TVRA 2VWJA 2IS3A 3DLKA 1RDCA 5LJVA 4E7LA 3RMAA 1IO2A 1VSLA 3PSIA 2E2PA 1YI2N 4B1WB 2LSNA 3LWMA 3TPQA 2JWKA 4CFBA 3OYAA 3MMVA 4A61A 4JS4A 4KHUA 4PKHA 4DQQA 4RG8A 5CHIA 3UB5A 1TL3A 4YOWA 1XWLA 3U9DA 3VQ4A 5BR9A 3O3HA 3O9UA 4I6MB 1HX1A 1C0TA 2NRWA 3DOKA 3MWPA 3RSEA 3WEEA 5AFUH 1QE1A 3CQYA 3CFPA 1I94K 2KW4A 1UA0A 4DKWA 1YF5L 4Z4IA 2ITGA 1V4TA 4DV6K 2VWKA 2KHOA 5CY4A 5AQJA 1NK9A 1XNRK 1TGOA 4GVMA 1L5UA 4CHNA 4O5FA 1W0HA 1X3NA 4CK3A 2X74A 3SPYA 2HNYA 1QVGM 4KH6A 4L3QA 3C65A 4HUGA 4WF9L 2W6KA 5ADXA 5FDLA 2Q3SA 3TTDA 2QWNA 3CCMN 2P9NA 4JKHA 1S9GA 1S1WA 3FFKB 1L3VA 3O9RA 3PLAA 3C6UA 4BRFA 4FM1A 1JKHA 3ZSYA 1RILA 4FPAA 2IGIA 3OYDA 3CERA 3DXMB 1DTTA 4KH5A 4BG9A 1VSJA 3GG4A 3Q7CA 2NRZA 4CJ4A 3OYBA 4CJEA 1BIZA 3SQ0A 2J4RA 3O3GA 4IO8A 4BRQA 2YHYA 4WFNL 4LFCK 3KJVA 5H1SQ 2RF2A 4BR5A 4BG8A 3MN6A 3CJ9A 1X9SA 3MXIA 1D8YA 4BVOA 2YHXA 1Z26A 1LOTB 4IG0A 5BRFA 4IOAL 1SAZA 3U4LA 3QLHA 3QMLA 4AILC 1C0GA 3V9SA 4CBXA 4Z4GA 4BDZA 4H4MA 5T7BA 4QS7A 1TAUA 4XEIA 1ATRA 3MECA 3G71N 1U45A 5BPLA 4L8RB 4DR6K 3CF5L 3O1BA 2VQFK 3QEXA 2OA8A 4OX9K 2E8AA 4UY8O 1GOAA 4XIUA 1QQMA 3SPZA 2WUSA 2UXCK 1HKCA 3FFIA 1K9MO 2IIRA 2ZJPL 2HHVA 1SUQA 3C95A 4O8UA 4ELUA 5C24A 4Q0BA 1VSDA 3NHGA 3MXMA 4DWIA 4DTSA 1LW2A 3MEEA 4LH5A 4NB4A 4JKAA 5I9EB 1NOZA 5GADP 4LSLA 1EXQA 3CG7A 1BQNA 1OVYA 3ZSRA 4CE9A 3V9ZA 2VGNA 4LF8K 3F9MA 3V9UA 3P31A 4JEPA 2BH1A 2KQ2A 3OS1A 3HM9A 3VTHA 1IKWA 4FWSA 5AQMA 3G4SN 1IBKK 1JJ2M 1N8RO 4CJRA 3V4IA 2ZGYA 3AARA 3BZKA 3LL3A 5EU7A 4JV5K 5AQFA 2XY5A 5GAHP 3IAYA 2W6LA 4IFEA 3WQTA 1NKEA 3OYFA 4OPJA 3WNHA 1JL1A 4B3TK 4FK4A 1A5VA 4GY2B 1WBBA 1NM1A 4JI3K 3S9HA 3EYZA 1YUWA 4W5QA 1TK0A 4GV9A 1NMDA 4DU3A 2NRTA 4ICLA 1EX4A 4FJ5A 4DR4K 2E20A 1XHZA 4FJIA 3AVAA 3BY5A 3CCVN 1HYSA 1C0MA 4B1ZA 3AAPA 5KRTA 4KHWA 1D9DA 2G8FA 2P9PA 2IC3A 3EKSA 4CZFA 4E89A 2O8CA 3KZBA 3U3YA 1C0UA 3CHWA 4CZJA 3R8EA 1KTQA 3SZ2A 3VQPA 3LPUA 3DYAA 5EX5A 3TARA 2E2OA 1T44A 3E1YA 4BREA 1CLQA 1XC3A 3TAFA 1U2VB 3ZETB 4B9VA 5LL6Z 3WXMB 3K5LA 2NRRA 4XH4A 2YX6A 4H5VA 4XH5A 4R79A 4BACA 3AGRA 3TTCA 5M1OA 3P39A 3KKSA 3LAKA 1IBMK 1S1TA 5EXWA 4DFPA 1NWKA 3WNFA 2D0BA 5CZ2A 2PYLA 1BO5O 4CZIA 1TV6A 5FPNA 2B6AA 3TSPA 4DTMA 1HJRA 2R7YA 2QK9A 1S72N 4CEFA 3AA3A 3T69A 1UOCA 2VQEK 3N4QA 2HBLA 3VENA 4FOEA 1JLQA 1WSJA 3FZLA 4JI5K 3GE1A 5MLCQ 3T1AA 4OLAA 3F73A 4FVMA 1JXBA 4C8LA 2OANA 2WFBA 1LWFA 3A5MC 4GV3A 1SKWA 3HM8A 3CI5A 4KKOA 3S3MA 4Z0UA 4CK2A 1Q7YO 4CEZA 4GKJK 1YITN 3SV4A 2Q2RA 3O4QA 1GLFO 4KHSA 4M7YA 4CZHA 4ELTA 4O8KA 1NGEA 3UKUB 3ZCMA 1NJWA 3U6FA 1HNVA 4IOXA 4BE1A 3SBGA 1WSFA 3RWUA 3VQBA 1T6CA 4DV3K 4DTXA 4DF8A 3DAWA 1QSYA 2QWMA 1RT1A 3LAMA 1U2VA 4A5AA 3K0SA 4IFYA 1ASUA 1RTJA 4Z4HA 2WC9A 2RPIA 2QWQA 3A8YA 3CFRA 1I3AA 3NGIA 4CJPA 4M41A 5AQQA 4JK8A 5LY3A 3VQ7A 1NG9A 4LF4K 2D0CA 2JWLA 3SCXA 4Q5VA 1C1BA 1SS6A 2P9IB 4HTUA 1P90A 2ASPA 3ID6A 3OYMA 5J1EA 4CF9A 5B8HA 1U47A 3CCEN 3CJBA 3OYEA 3SUQA 2Q0UA 4E7IA 1BDGA 5A2QO 4WCEL 3HP9A 1W9HA 2IVPA 3L0QA 4F2SA 4M3ZA 1S22A 1DEJA 3DXKA 4H0TB 1BU6O 1B92A 1ZC6A 4F8RA 1HUXA 3T1HK 1FKOA 1J5OA 2GTDA 4CJ5A 1RTHA 2V52B 3D2FA 2HBKA 2Q1NA 1JLCA 3DJCA 1UAXA 4M3WA 2O8FB 3SAHA 4H5TA 3R6MA 3AVNA 1S6QA 1RBRA 3HSTB 2HHTA 4CVNE 3QEWA 3TAEA 3VA0A 4CHOA 3BDPA 4H0OA 3ZT2A 3FZMA 4DU1A 4DV0K 2IOCA 3B6OA 3LDNA 3PX4A 2KZZA 3VQDA 4GV6A 4K0KK 4DF4A 1VQ9N 4NYFA 4AHUA 4JKDA 1IKVA 1T6DA 4CHPA 1B9DA 4FSVA 4B9NA 4FK2A 4NCGA 4BR7A 3VF4A 1NK6A 1S6PA 1SL2A 4FK0A 3ZT0A 3DLRA 3R9PA 2FSJA 1OH6A 4CHQA 1X9WA 5TKYA 1W97L 1KAZA 3ITHA 2O8CB 3SMSA 1X9JA 2A5XA 2GUIA 4MQ3A 4K8XA 5LMUK 1NK7A 5LJWA 4FLZA 4DSJA 3B8AX 4JKEA 3VEWA 4U7BA 3PV8A 2E4LA 1KVBA 4B9QA 2F9TA 4JNEA 4CFCA 3THXA 4J2EA 3ENOA 3EL2A 2Z1JA 3EEQA 4A2BA 3O08A 2QA4N 3C7NB 4WQ4C 1K8AO 2P9NB 5DM7L 5GAEP 3ASMA 1KLMA 1QSLA 5F2RA 1DKGD 3Q7BA 4DHYA 3VQCA 4H03B 4MDBA 5F0XA 3OS2A 3NFAA 4JD2A 4A2AA 1LCUA 4NYNA 4LSNA 1TK5A 2D0AA 1U49A 4J2BA 5TKWA 4DMNA 5FRNA 2H3GX 4O5BA 1G99A 3MXJA 3ZSOA 1RT5A 1QHAA 2X78A 2OTJN 2O8FA 1ZXOA 5CYMA 5CYQA 4B3MK 1EP4A 1RNHA 2P1JA 5J2NA 3MEDA 3L3VA 4A59A 1W7AA 4CJVA 4CGFA 3THYA 4FL9A 3M1FA 2P9UB 1ZBFA 4YOTA 3QINA 1A5WA 3VETA 5AQKA 2OZSA 3I8BA 1YT3A 3VPZA 4KH4A 3D2EB 1GLCG 4IOCL 4F4KA 4BC2A 4PL7A 4QOZB 4B08A 4DTNA 1VQ5N 1NU0A 1REVA 3SMPA 1Q9XA 4JI1K 3W3DA 5GINA 3DLLL 3CMEN 2IDOA 3NCIA 2HF4A 4RW6A 1TKXA 4JKCA 5AZJB 1RFQA 1RDWX 4M63C 4JI6K 2PBDA 4EHUA 4KRFA 3AGKA 4FLWA 3CCQN 4DR3K 1T05A 3TWHA 2V7YA 4K43A 4CGGA 3AAQA 2OPRA 3U3GA 3QDKA 3I55N 2P9KB 5BN9A 5IWAK 3OW2M 1XMOK 4CF1A 2KKZA 3A2FA 4R5PA 4ZHRA 3M6GA 2DTUA 2G8WA 1FJGK 3QETA 1K8KA 4YOVA 1NBWA 1KAXA 3QERA 1OH8A 2UXDK 3K5MA 4XH1A 3QNNA 1WSIA 1R59O 2HHQA 3KVGA 4JN4A 2YJFA 3FZKA 4YOUA 1EWRA 3RRGA 3A5OC 2VG5A 5C12A 4CIFA 1TYQB 5AQPA 1KFDA 2HF3A 3QEIA 3KK2A 3MWTA 3M8QA 3MCPA 4KB0A 3VQ9A 3G25A 1GLAG 3CPWM 1C0FA 5AQYA 2OCEA 3ALYA 4M3RA 3OBWA 1TKZA 3PIOL 4JI0K 4HCBA 3ZYYX 3PX0A 2CGLA 2HB5A 1VRUA 3ZSXA 3HL8A 3S3OA 3CJ1A 3SQ1A 4I6MA 4E1NA 3BF3A 2HVHA 4IG3A 4FYDA 3LDOA 1VQON 1VQMN 4K42A 4DR2K 1U04A 2QWRA 1TKDA 2DPNA 3SNNA 3CCLN 4CFDA 3SYZA 1R0AA 1P8ZA 1NJYA 4KHYA 3AVCA 2GX9A 1HNZK 3CQXA 4WFBL 1XQSC 5E41A 4JRPA 2F4VK 4IDKA 4BWMA 2NRXA 1Z25A 3SV3A 4DTRA 4I9QA 3CJCA 4CW7B 4DQRA 1VQNN 3AVBA 1SL0A 3LP1A 1DGKN 5KQDA 4CHZA 4DV1K 4DV2K 4M3UA 1ZYQA 1BI4A 1O13A 4CGIA 5GIPA 1X9MA 3DXMA 2HSTA 2FF3B 4ISEA 3THVA 5I3UA 4KAZA 4PUOA 4DTOA 2I7NA 4NCBA 1JL2A 1KVAA 3BZCA 3MDQA 3WXLA 5M1FA 4B9UA 4DLEA 1GOBA 3J7YP 5JVHL 4K25A 2B4JA 1IKXA 3CYMA 3HJFA 4LH4A 5GIOA 1Q18A 3VERA 3ISNC 3HPOA 4B9SA 3WT0A 3OBYA 4X65K 4U67L 1RDAA 1WAFA 4CK1A 2VYPA 3ZT3A 3UE5A 4FJ7A 1NJIO 4AF1A 4IXCA 2QWLA 3BGRA 3THXB 3SLCA 4FJGA 1XI1A 3WXKA 1N6QA 4ZTJA 2F7TA 2UUAK 1OKJA 1BG3A 4W5TA 1TKTA 3MN5A 4GVEA 5HRRA 4YNQA 3NGYA 5HRPA 3RSEB 3QNOA 4PQUA 1LWEA 1V4SA 1IG9A 3B6PA 4OKKA 1HRHA 3KLEA 3OTOK 4FM2A 1JCEA 4O44A 3HVRA 4FJNA 4CZMA 3QB0A 3EY1A 4G9ZA 3CD6N 4PY5A 3CJ7A 5FRMA 4V19S 4JHDA 4N76A 2UUCK 1VQ4N 3TSUA 4KO0A 3NGZA 3LZIA 2DFHA 3PUFA 2F96A 5C2DA 3O1WA 2GWJA 1KD1O 4H0YB 1QQOA 3AO2A 1OH7A 1ILYA 2YHBA 2FLOA 1C1CA 2NUBA 3L2QA 4DLGA 1NGDA 3P83D 4CJUA 3D45A 4C23A 2FSNA 4H0VB 2P9SA 3E9LA 1QZ6A 2A6AA 5DMRA 1SQKA 4M42A 3H6EA 1XUPO 1RTDA 4M3TA 4E1MA 2YKNA 4QS9A 1G15A 3CCRN 3WUHA 4BDYA 3I56N 3M8PA 4FWKA 4FXDA 1VSEA 3K9JA 1NK0A 2KFZA 5FROA 3RRHA 4M3XA 1S1UA 4FCYA 3MX5A 3J7AP 3CCUN 3QIOA 3CCJN 1J53A 4CESA 4FJ9A 3V81A 3DLBA 2Q0RA 2D4WA 3J80O 4CEAA 3IDHA 3CXCM 1GLLO 3NF8A 4OO1J 4YFUA 4W5NA 3ULDA 4FWOA 5JS2A 2OPSA 1DLOA 3OJUA 1D9FA 1GLDG 2ZJQL 4PKIA 5C25A 5IT9O 4N41A 5JVGL 1XMQK 4BROA 3M3ZA 1RBUA 1YJWN 4FJ8A 1MDUB 3OY9A 4B3SK 2QI2A 4WQ4A 1H1VA 3VTIA 2PFUA 3HPGA 2FSKA 4FZXC 4EP4A 1J6ZA 2D0PA 3ZSWA 4JHDB 1YXQA 3G6EN 4PWDA 4KI4A 4LD0A 1K73O 4CJ7A 4BRNA 3TTFA 4CJFA 5AFUA 1IH7A 2HMPA 2O8EA 1EO1A 3LALA 2XRIA 3FGUA
chains in the Genus database with same CATH topology
2NNWA 3SAHA 1VQPN 4H5TA 2ASMA 5AQTA 3R6MA 5C15A 5AQWA 1ATSA 2PAVA 2QXLA 3ENHA 3EKUA 4RWTA 1BUPA 1IG8A 5M1NA 3CC4N 2D0OA 4H0OA 3FZMA 4HTLA 2YI1A 3ZX0A 4BR4A 2CH6A 2E1YA 3HBTA 3O9SA 5JICA 1EQYA 1TUYA 3LDNA 1S3XA 1NGJA 3FR0A 4NLCA 1NGAA 3O4WA 4GV6A 3ENBA 4YDUC 3BF1A 3FE1A 3OA9A 1VQ9N 1KQSM 3SBTA 1YHQN 3P4IA 1K8KB 3L4QA 5ADXH 2YJEA 2E2QA 5BN8A 4JKDA 3HRGA 1T6DA 4GNIA 1QQNA 5E84A 1VQLN 3IKMA 3J8AA 4IEIA 4FSVA 3NVKA 1E4FT 1WUAA 2AP1A 4BR7A 3VF4A 5CE3A 4PL8A 4ISFA 3MN9A 3R9PA 4CD1A 3C7NA 3H45C 2FSJA 5AZIB 3LDQA 4ISGA 5TKYA 1BA1A 1W97L 4DCHA 4IO9L 1KAZA 2A40A 1GLEG 4ILHA 1BA0A 3C6AA 3SMSA 2E1ZA 3O6WA 4A5BA 3E9PA 2A42A 4BRKA 4E1JA 1HLUA 1X9JA 2A5XA 3FZHA 3OHRA 3EO3A 5ELZA 5LJVA 5AR0A 4RTFD 2E2PA 1YI2N 5JLFA 4PKGA 3UKRB 3M5RA 4B1WB 3WXJA 3HI0A 5LJWA 3TPQA 3B8AX 1CZAN 4JKEA 2CGJA 2E2NA 2JWKA 2Q97A 3VEWA 4U7BA 1NGGA 3MMVA 4A61A 4H0XB 4B9QA 2F9TA 4JNEA 4PKHA 3O9TA 5M1KA 2GUPA 5CHIA 3ENOA 3TU5A 4BC5A 3EL2A 2P9LB 3UB5A 4A2BA 4BR9A 4YOWA 3U9DA 5BR9A 3O08A 2QA4N 3O9UA 3MCAB 3C7NB 4I6MB 1HX1A 4WQ4C 1K8AO 3CIPA 2NRWA 2RE2A 3MWPA 3RSEA 3WEEA 5C2FA 2Q31A 2F9WA 5AFUH 3CQYA 4FWQA 4BVPA 2ITMA 2P9NB 5AQRA 4DKWA 1YF5L 5DM7L 5GAEP 1V4TA 3C0BA 2KHOA 3D6RA 3CC2N 5F2RA 4YDUA 5AQJA 1DKGD 3Q7BA 4DHYA 3H3NO 4JK9A 3UKRA 4H03B 3HSCA 4MDBA 4O5FA 1TYQA 3E9OA 5AQVA 4JD2A 4A2AA 4EFHA 5AQUA 1LCUA 1Z6RA 1YJNN 1X3NA 4RCHA 5TKWA 2GELA 4KBOA 1KAYA 2H3GX 5AQOA 3D7EO 1G99A 4J8FA 1QVGM 4FWPA 3EN9A 3D2EA 4KH6A 3A5LC 3H1VX 1QHAA 4L3QA 3C65A 1VQKN 5KPTA 3SK3A 4WF9L 5BPMA 2OTJN 3W0LA 5ADXA 1ZXOA 1NLVA 4BGAA 4NO7A 3TTDA 2QWNA 4CZGA 3DWLA 2P9NA 1DT9A 4JKHA 3CCMN 5AQZA 4A59A 3SJHA 3FFKB 3GDQA 3O9RA 3PLAA 2CH5A 4BRFA 4FPAA 2QWOA 4FL9A 4BRMA 3CERA 3M1FA 2P9UB 3DXMB 1NGCA 2QW9A 2P9KA 4YOTA 4EHTA 4KH5A 5AQIA 4BG9A 3IUCA 2D1KA 3GG4A 3Q7CA 2NRZA 5AQKA 3VETA 3I8BA 3VPZA 1VQ8N 4KH4A 3HOTA 3D2EB 1GLCG 2J4RA 4IOCL 4IO8A 4BC2A 5HOOA 4BRQA 4PL7A 2YHYA 1VQ5N 4WFNL 3SMPA 5H1SQ 3W3DA 5GINA 3DLLL 3CMEN 4B1XB 3ULEB 4BR5A 4IOAL 4FVUA 3EE9A 3WQUA 4WFAL 4BG8A 3MN6A 5F0XA 2HF4A 3CJ9A 4JKCA 5AZJB 1RFQA 1RDWX 4M63C 3HZ6A 4BVOA 2PBDA 2YHXA 1LOTB 1T3VA 4JKGA 3AGKA 4EHUA 5BRFA 3CCQN 2V7YA 3HTVA 1SAZA 4K43A 3U4LA 3AAQA 1D4XA 3QMLA 3HOSA 3QDKA 1C0GA 5BRDA 4CBXA 3I55N 2P9KB 5BN9A 1VAZA 3OW2M 4QS7A 4XEIA 5AQHA 1ATRA 1HJOA 1EO1A 4WQ5C 2Q36A 2QM1A 1M1KO 2KKZA 3T7ZA 4DQ8A 5BPLA 3G71N 4H0PA 3O1BA 1Y64A 4LC9B 3CF5L 2CGKA 3M6GA 3R1XA 2E8AA 4UY8O 1YVNA 2P9LA 1QQMA 4YORA 2A41A 2WUSA 1K8KA 3KK7A 1HKCA 1NBWA 5BRHA 1KAXA 2IIRA 4BRGA 4YOVA 1K9MO 5AQNA 2ZJPL 4XH1A 2NLXA 3WEEB 3IMXA 3ZX3A 3KWIA 1GLJO 4JKGB 1R59O 3KVGA 4JN4A 3O8MA 4O8UA 5KPRA 3IFRA 1RGIA 1BWFO 2YJFA 3FZKA 2GWKA 4OPAA 4BGBA 4YOUA 4FWRA 4Y0WA 4BC3A 5BPNA 3A5OC 5FPEA 4A62A 3WXIA 1KC8O 4BRIA 1M90O 5C12A 4IDHA 1TYQB 5AQPA 2EWSA 2HF3A 3LDPA 4NB4A 3MWTA 4JKAA 3MCPA 2GEMA 1YAGA 3G25A 5I9EB 1GLAG 3CPWM 2IVNA 1C0FA 1NGFA 5AQYA 3AY9A 5GADP 3OBWA 1OVYA 3PIOL 4IWVA 4K41A 3ZYYX 3O80A 2VGNA 2CGLA 3MN7A 3U9ZA 3F9MA 5HL7L 3P31A 3BUZB 4FO0A 4JEPA 3F5TA 3CJ1A 5FPDA 2BH1A 2VWBA 4I6MA 3DXKB 3VTHA 3G4SN 4FWSA 5AQMA 1Q82O 3QFPA 1JJ2M 3BF3A 5M1PA 3ZEUA 1N8RO 2P9SB 2P9PB 2ZGYA 4CBUA 3AARA 3LL3A 3LDOA 4CI6A 1VQON 5AQFA 3VF2A 5GAHP 4K42A 1VQMN 4HWIA 1HKGA 4IFEA 3WQTA 2QWRA 4JKFA 3VOVA 2DPNA 1NGIA 4MDAA 3CCLN 1JCGA 3VESA 1RDUA 5AQSA 1P8ZA 3I33A 3VEZA 1WOQA 4GY2B 4JD2B 1NM1A 3A5NC 3GBTA 4JKBA 2OTLN 2GX9A 1YUWA 1E4GT 3CQXA 5FPMA 3ULEA 1Z05A 2QWPA 1NMDA 4FWMA 4CZLA 4GV9A 4JAXA 4WFBL 2NRTA 1XQSC 5C10A 1NGHA 2E20A 2QEXN 4BRLA 3QBXA 3E66A 4BRDA 2NRXA 3MX2A 3VEYA 3CCVN 3CJCA 3QBWA 4B1ZA 3AAPA 1VQNN 3NVMA 5F1XA 5AZIA 2BUPA 2P9PA 3EKSA 1DGKN 3QFUA 4BR2A 5KQDA 4CZFA 1ZBSA 3QICA 3KZBA 3LM9A 1HKBA 3CHWA 1O13A 4CZJA 3R8EA 4IJAA 4EAHD 2P9IA 3GOIA 5GIPA 2KLAA 2P9UA 3DXMA 3RVCA 2HSTA 2FF3B 4ISEA 5EVZA 5EX5A 3VEVA 2E2OA 5AQLA 4MO5A 1W2BM 2I7NA 3JXUA 1YIJN 1T44A 4BY9C 3E1YA 4BREA 4ILGB 1XC3A 4QS8A 1U2VB 3ATVA 3MDQA 3WXLA 3ZETB 5M1FA 4YOYA 3WXMB 3EZWA 5JVHL 4K25A 2NRRA 4CBWA 4XH4A 2RHKA 2YX6A 2YCHA 4H5VA 3VMFB 4BRCA 4XH5A 4R79A 3AGRA 1GLBG 5GIOA 5E26A 1Q18A 5M1OA 3TTCA 3VERA 3P39A 3WT0A 3OBYA 4U67L 3PIPL 5EXWA 3BEXA 2VYPA 2UYTA 4IEEA 1NWKA 4WQ5A 3UE5A 1NJIO 1MA9B 4AF1A 4OPHA 1SZ2A 4IJNA 4IXCA 2QWLA 4C1NI 3ZX2A 3D2FB 1BO5O 4CZIA 3SLCA 5FPNA 2W41A 3TSPA 3WXKA 3BP8A 5JMVA 1X3MA 2F7TA 1OKJA 1BG3A 2A3ZA 4FWNA 3MN5A 3CPEA 4GVEA 1Q81O 1VQ7N 1MWKA 3RSEB 3FLCO 2NZTA 1S72N 4M7XA 1V4SA 3T69A 2E88A 3ID8A 4EIAA 3N4QA 2HBLA 1HPMA 3FZFA 1JCEA 3VENA 3ZEUB 4FOEA 2ZGZA 4DB3A 3UKUA 2ASOA 3QB0A 3FZLA 4CZMA 2ZJRL 4G9ZA 3LM2A 1TUUA 3GE1A 5MLCQ 3CD6N 3SAGA 3L4IA 3CJAA 5CR4A 3CJ7A 3J7ZO 2VCPA 2OANA 2WFBA 2ZWHA 4JHDA 1QVFM 3A5MC 4GV3A 4H5WA 4BRPA 3HM8A 3CI5A 1QZ5A 1Q7YO 3CETA 1VQ4N 1YITN 3TSUA 3O5BA 4MO4A 4PHTX 1NGBA 2Q2RA 1ESVA 1GLFO 5C2DA 5JLHA 1U6ZA 3MK6A 3O1WA 5M1QA 4M7YA 4CZHA 2GWJA 3R3LA 1KD1O 4H0YB 2V7ZA 4O8KA 3F2KA 4BR0A 5KQ8A 1QQOA 4AM6A 1IJJA 1ILYA 1NGEA 2FLOA 3JS6A 3UKUB 5KPZA 2BTFA 3VEXA 2YHWA 4BQLA 3NMUA 2W40A 4F9OA 1NGDA 4IZ9A 2AA4A 4IOXA 3CC7N 4ILJA 3K9KA 4MLEA 5EY4A 3EE8A 3SBGA 1KXPA 2FSNA 3P38A 4C23A 4H0VB 4CZEA 1T6CA 2P9SA 3E9LA 3H3OB 3LDLA 3KWGA 4FPBA 4MLHA 2HOEA 5BREA 5C0YA 4B1UB 1QZ6A 2A6AA 3VGKA 3DAWA 2QWMA 4BQZA 1SQKA 3H6EA 1XUPO 4B1VA 1U2VA 4QS9A 3KHYA 3TSQA 4A5AA 2NRVA 3VEOA 3CCRN 3CCSN 3WUHA 3I56N 3CMAN 2WC9A 3A0IX 4FWKA 3L6QA 2QWQA 3A8YA 3K9JA 3GL1A 4B1YB 5DM6L 1MWMA 2VGMA 3MX5A 4Z94A 3VGLA 4H5RA 3U8XA 3CCUN 3CCJN 4JK7A 5AQQA 4JK8A 5LY3A 5GAGP 2WBNA 2JWLA 1ATNA 3ATUA 1YJ9N 5AQGA 3H1QA 2Q0RA 2D4WA 4FOIA 3IDHA 1SS6A 3H46O 2P9IB 3CXCM 4FWLA 1GLLO 1P90A 2ASPA 3ID6A 3VF6A 4OO1J 4FWOA 2V51B 4CD3A 5B8HA 3CCEN 2IVOA 3CJBA 1GLDG 2ZJQL 3ZETA 2HBJA 4A57A 4PKIA 4AM7A 2Q0UA 3N4PA 2FXUA 5AQXA 1BDGA 4WCEL 5JVGL 4BROA 3M3ZA 4CZKA 2IVPA 4YOXA 1YJWN 1BOTO 1MDUB 3L0QA 4BRHA 2QI2A 4WQ4A 1H1VA 1S22A 2HBMA 1DEJA 2FF6A 2PFUA 2ZF5O 2FSKA 3DXKA 4H0TB 3VTIA 1J6ZA 1BU6O 2D0PA 1ZC6A 2NRHA 1HUXA 4JHDB 4C1NK 3S41A 1YXQA 4NLBA 4WYBA 3G6EN 2QTDA 2GTDA 1Q86O 3C6HA 2V52B 5EOYA 4BC4A 3VGMA 1K73O 3D2FA 2HBKA 4CJ7A 4BRNA 2Q1NA 1JCFA 3DJCA 4H5NA 3TTFA 3O9QA 5AFUA 4BRAA 1VQ6N 2HMPA 2I7PA 5AZJA 3SAFA 3FGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H5T A;  2ASM A;  5AQT A;  3R6M A;  5AQW A;  1ATS A;  2PAV A;  2QXL A;  3ENH A;  3EKU A;  4RWT A;  1BUP A;  1IG8 A;  2D0O A;  4H0O A;  3FZM A;  4HTL A;  2YI1 A;  3ZX0 A;  4BR4 A;  2CH6 A;  2E1Y A;  3HBT A;  5JIC A;  1EQY A;  1TUY A;  3LDN A;  1S3X A;  1NGJ A;  3FR0 A;  1NGA A;  3O4W A;  4YDU C;  3BF1 A;  3FE1 A;  3P4I A;  1K8K B;  5ADX H;  2YJE A;  2E2Q A;  5BN8 A;  1T6D A;  4GNI A;  1QQN A;  5E84 A;  3J8A A;  4FSV A;  1E4F T;  1WUA A;  2AP1 A;  4BR7 A;  3VF4 A;  5CE3 A;  4PL8 A;  4ISF A;  3MN9 A;  3R9P A;  4CD1 A;  3C7N A;  3H45 C;  2FSJ A;  5AZI B;  3LDQ A;  4ISG A;  5TKY A;  1BA1 A;  4DCH A;  1KAZ A;  2A40 A;  1GLE G;  1BA0 A;  3SMS A;  2E1Z A;  3O6W A;  2A42 A;  4BRK A;  4E1J A;  1HLU A;  1X9J A;  2A5X A;  3FZH A;  3OHR A;  3EO3 A;  5ELZ A;  5LJV A;  5AR0 A;  4RTF D;  2E2P A;  5JLF A;  4PKG A;  3UKR B;  4B1W B;  3WXJ A;  3HI0 A;  5LJW A;  3TPQ A;  1CZA N;  3B8A X;  2CGJ A;  2E2N A;  3VEW A;  2Q97 A;  1NGG A;  3MMV A;  4A61 A;  4H0X B;  4B9Q A;  2F9T A;  4JNE A;  4PKH A;  2GUP A;  3ENO A;  3TU5 A;  4BC5 A;  3EL2 A;  2P9L B;  3UB5 A;  4A2B A;  4BR9 A;  3U9D A;  5BR9 A;  3O08 A;  3C7N B;  4I6M B;  1HX1 A;  4WQ4 C;  3CIP A;  3WEE A;  3RSE A;  2Q31 A;  2F9W A;  5AFU H;  3CQY A;  4FWQ A;  4BVP A;  2ITM A;  2P9N B;  5AQR A;  1V4T A;  3C0B A;  2KHO A;  5F2R A;  4YDU A;  5AQJ A;  1DKG D;  4DHY A;  3H3N O;  3UKR A;  4H03 B;  3HSC A;  4O5F A;  4EFH A;  1TYQ A;  5AQV A;  5F0X A;  4JD2 A;  4A2A A;  5AQU A;  1LCU A;  1Z6R A;  1X3N A;  4RCH A;  2GEL A;  4KBO A;  1KAY A;  2H3G X;  5AQO A;  3D7E O;  1G99 A;  4J8F A;  4FWP A;  3EN9 A;  3D2E A;  3A5L C;  3H1V X;  1QHA A;  4L3Q A;  5KPT A;  3SK3 A;  5BPM A;  3W0L A;  5ADX A;  1ZXO A;  1NLV A;  4BGA A;  4NO7 A;  2QWN A;  4CZG A;  3DWL A;  2P9N A;  5AQZ A;  3SJH A;  3FFK B;  3GDQ A;  2CH5 A;  4BRF A;  4FPA A;  2QWO A;  4FL9 A;  4BRM A;  3CER A;  3M1F A;  2P9U B;  3DXM B;  1NGC A;  2QW9 A;  2P9K A;  4EHT A;  5AQI A;  4BG9 A;  3IUC A;  2D1K A;  3GG4 A;  3VET A;  5AQK A;  3I8B A;  3VPZ A;  3D2E B;  1GLC G;  2J4R A;  4IO8 A;  4BC2 A;  4BRQ A;  4PL7 A;  2YHY A;  3SMP A;  3W3D A;  4B1X B;  3ULE B;  4BR5 A;  3WQU A;  4BG8 A;  3MN6 A;  2HF4 A;  3CJ9 A;  5AZJ B;  1RFQ A;  1RDW X;  4M63 C;  3HZ6 A;  4BVO A;  2PBD A;  2YHX A;  1LOT B;  4EHU A;  5BRF A;  2V7Y A;  3HTV A;  1SAZ A;  4K43 A;  3U4L A;  3AAQ A;  1D4X A;  3QML A;  3QDK A;  1C0G A;  5BRD A;  4CBX A;  2P9K B;  5BN9 A;  4QS7 A;  4XEI A;  5AQH A;  1ATR A;  1HJO A;  4WQ5 C;  2Q36 A;  2QM1 A;  4DQ8 A;  5BPL A;  4H0P A;  3O1B A;  1Y64 A;  4LC9 B;  2CGK A;  3M6G A;  2E8A A;  1YVN A;  2P9L A;  1QQM A;  2A41 A;  2WUS A;  1K8K A;  5BRH A;  1HKC A;  1NBW A;  1KAX A;  2IIR A;  4BRG A;  5AQN A;  4XH1 A;  2NLX A;  3WEE B;  3IMX A;  3ZX3 A;  1GLJ O;  1R59 O;  3KVG A;  4JN4 A;  3O8M A;  5KPR A;  3IFR A;  1RGI A;  1BWF O;  2YJF A;  3FZK A;  2GWK A;  4BGB A;  4FWR A;  4Y0W A;  4BC3 A;  5BPN A;  3A5O C;  5FPE A;  4A62 A;  3WXI A;  4BRI A;  1TYQ B;  5AQP A;  2EWS A;  2HF3 A;  3LDP A;  4NB4 A;  3MCP A;  2GEM A;  1YAG A;  3G25 A;  5I9E B;  1GLA G;  2IVN A;  1C0F A;  1NGF A;  5AQY A;  3AY9 A;  4IWV A;  4K41 A;  3O80 A;  2CGL A;  3MN7 A;  3U9Z A;  3F9M A;  3BUZ B;  4FO0 A;  3CJ1 A;  5FPD A;  2VWB A;  4I6M A;  3DXK B;  4FWS A;  5AQM A;  3QFP A;  3BF3 A;  3ZEU A;  2P9S B;  2P9P B;  2ZGY A;  4CBU A;  3AAR A;  3LL3 A;  3LDO A;  4CI6 A;  5AQF A;  3VF2 A;  4K42 A;  4HWI A;  1HKG A;  3WQT A;  2QWR A;  3VOV A;  2DPN A;  1NGI A;  1JCG A;  3VES A;  5AQS A;  1P8Z A;  3I33 A;  3VEZ A;  1WOQ A;  4GY2 B;  4JD2 B;  1NM1 A;  3A5N C;  3GBT A;  1YUW A;  1E4G T;  3CQX A;  5FPM A;  3ULE A;  1Z05 A;  2QWP A;  1NMD A;  4FWM A;  4CZL A;  4JAX A;  1XQS C;  1NGH A;  2E20 A;  4BRL A;  3QBX A;  4BRD A;  3VEY A;  3CJC A;  3QBW A;  4B1Z A;  3AAP A;  5F1X A;  5AZI A;  2BUP A;  2P9P A;  3EKS A;  1DGK N;  3QFU A;  4BR2 A;  5KQD A;  4CZF A;  1ZBS A;  3QIC A;  3KZB A;  3LM9 A;  1HKB A;  3CHW A;  4CZJ A;  3R8E A;  4IJA A;  4EAH D;  2P9I A;  3GOI A;  2P9U A;  3DXM A;  3VEV A;  4ISE A;  2FF3 B;  5EVZ A;  5EX5 A;  2E2O A;  5AQL A;  4MO5 A;  2I7N A;  3JXU A;  1T44 A;  4BRE A;  1XC3 A;  4QS8 A;  1U2V B;  3ATV A;  3MDQ A;  3WXL A;  3ZET B;  3EZW A;  4K25 A;  4CBW A;  4XH4 A;  2YCH A;  4H5V A;  4BRC A;  4XH5 A;  1GLB G;  5E26 A;  1Q18 A;  3VER A;  3WT0 A;  5EXW A;  3BEX A;  2VYP A;  2UYT A;  1NWK A;  4WQ5 A;  3UE5 A;  1MA9 B;  1SZ2 A;  4IJN A;  4IXC A;  2QWL A;  3ZX2 A;  3D2F B;  1BO5 O;  4CZI A;  3SLC A;  5FPN A;  2W41 A;  3WXK A;  3BP8 A;  5JMV A;  1X3M A;  1OKJ A;  1BG3 A;  2A3Z A;  4FWN A;  3MN5 A;  1MWK A;  3RSE B;  3FLC O;  2NZT A;  4M7X A;  1V4S A;  2E88 A;  3ID8 A;  4EIA A;  1HPM A;  3FZF A;  1JCE A;  3VEN A;  3ZEU B;  4FOE A;  2ZGZ A;  4DB3 A;  3UKU A;  2ASO A;  3QB0 A;  3FZL A;  4CZM A;  3LM2 A;  1TUU A;  3GE1 A;  3L4I A;  3CJA A;  3CJ7 A;  2VCP A;  2OAN A;  2ZWH A;  4JHD A;  3A5M C;  4H5W A;  4BRP A;  3HM8 A;  3CI5 A;  1QZ5 A;  3CET A;  3O5B A;  4MO4 A;  1NGB A;  2Q2R A;  1ESV A;  1GLF O;  5JLH A;  1U6Z A;  3MK6 A;  3O1W A;  4M7Y A;  4CZH A;  2GWJ A;  4H0Y B;  2V7Z A;  4O8K A;  4BR0 A;  5KQ8 A;  1QQO A;  4AM6 A;  1IJJ A;  1NGE A;  2FLO A;  3JS6 A;  3UKU B;  5KPZ A;  2BTF A;  3VEX A;  2YHW A;  4BQL A;  2W40 A;  4F9O A;  1NGD A;  4IZ9 A;  2AA4 A;  4MLE A;  4C23 A;  5EY4 A;  1KXP A;  2FSN A;  4H0V B;  4CZE A;  1T6C A;  2P9S A;  3LDL A;  3H3O B;  4FPB A;  4MLH A;  5BRE A;  2HOE A;  4B1U B;  1QZ6 A;  2A6A A;  3VGK A;  3DAW A;  2QWM A;  4BQZ A;  1SQK A;  3H6E A;  1XUP O;  4B1V A;  1U2V A;  4QS9 A;  3KHY A;  3VEO A;  3WUH A;  3A0I X;  4FWK A;  3L6Q A;  2QWQ A;  3A8Y A;  3GL1 A;  4B1Y B;  1MWM A;  4Z94 A;  3VGL A;  4H5R A;  3U8X A;  5AQQ A;  5LY3 A;  1ATN A;  3ATU A;  5AQG A;  3H1Q A;  2Q0R A;  2D4W A;  4FOI A;  3IDH A;  3H46 O;  2P9I B;  4FWL A;  1GLL O;  2ASP A;  3VF6 A;  4FWO A;  2V51 B;  4CD3 A;  5B8H A;  2IVO A;  3CJB A;  1GLD G;  3ZET A;  4AM7 A;  4PKI A;  2Q0U A;  2FXU A;  5AQX A;  1BDG A;  4BRO A;  3M3Z A;  4CZK A;  2IVP A;  1BOT O;  1MDU B;  3L0Q A;  4BRH A;  4WQ4 A;  1H1V A;  1S22 A;  1DEJ A;  2FF6 A;  2ZF5 O;  3DXK A;  2FSK A;  4H0T B;  1J6Z A;  1BU6 O;  2D0P A;  1ZC6 A;  2NRH A;  1HUX A;  4JHD B;  3S41 A;  1YXQ A;  4WYB A;  2GTD A;  2V52 B;  5EOY A;  4BC4 A;  3VGM A;  3D2F A;  4CJ7 A;  4BRN A;  2Q1N A;  1JCF A;  3DJC A;  4H5N A;  5AFU A;  4BRA A;  2HMP A;  2I7P A;  5AZJ A;  3FGU A; 
#chains in the Genus database with same CATH topology
 1VQP N;  2BAN A;  5AQT A;  2ASM A;  3AO4 A;  2QXL A;  2KZM A;  3LP0 A;  3EKU A;  4F3T A;  4FW1 A;  5M1N A;  2D0O A;  2FC0 A;  5J2P A;  2YI1 A;  3ZX0 A;  2CH6 A;  3NH0 A;  3TAQ A;  1EQY A;  1TUY A;  3AVK A;  1NGJ A;  3FR0 A;  3O4W A;  3ENB A;  3RMC A;  3KLG A;  1WSE A;  1KQS M;  3SBT A;  4JLH A;  1YHQ N;  3P4I A;  4J2D A;  3L4Q A;  5ADX H;  2HHW A;  2JLE A;  3HRG A;  4DSL A;  4GNI A;  1QQN A;  5E84 A;  5HP1 A;  3NVK A;  1SL1 A;  2AP1 A;  5CE3 A;  3K5O A;  3M8S A;  1CXQ A;  3C7N A;  3HPH A;  5JS1 A;  4CEB A;  4DCH A;  4CF0 A;  1UWB A;  1GLE G;  2A42 A;  4E1J A;  2D5R A;  3OHR A;  5ELZ A;  1X1P A;  3EO3 A;  4FW2 A;  4HUF A;  4Y1D A;  1LAV A;  5JLF A;  4PKG A;  4PA1 A;  3M5R A;  3WXJ A;  3HI0 A;  2CGJ A;  4CJK A;  2Q97 A;  1NGG A;  4H0X B;  3HVT A;  1VSF A;  2GUP A;  2JGU A;  4BC5 A;  2P9L B;  4BR9 A;  4M45 A;  3MCA B;  4C8O A;  1TAQ A;  1KCF A;  3AVL A;  3CIP A;  2RE2 A;  5C2F A;  4FJH A;  3AA4 A;  4C8M A;  2ITM A;  4AHS A;  1FXX A;  2G8V A;  3QO9 A;  4W5O A;  3CC2 N;  4M3Y A;  2Z1I A;  3H3N O;  4JK9 A;  3UKR A;  1JLE A;  4EFH A;  2UU9 K;  4DSE A;  1TYQ A;  1VRT A;  4RCH A;  4KB1 A;  1Y97 A;  3AVM A;  4KBO A;  3D7E O;  4J8F A;  3EN9 A;  3A5L C;  3H1V X;  2O8E B;  5BPM A;  4LF6 K;  3V9W A;  4DUZ K;  1K6Y A;  3T1Y K;  4E3S A;  2QKK A;  3LP2 A;  3DWL A;  1DT9 A;  2ZE2 A;  1TL1 A;  3O4N A;  4F3O A;  3SJH A;  3GDQ A;  1N5Y A;  2CH5 A;  4BRM A;  4LF9 K;  2FBX A;  4CEQ A;  2ZM6 K;  4EHT A;  2G8U A;  3HXM A;  3IUC A;  4CJT A;  2D1K A;  4DR5 K;  1B9F A;  4O55 A;  3OYJ A;  3HOT A;  3P1G A;  3VQ8 A;  3G10 A;  4B3R K;  2OPP A;  3VA3 A;  4B1X B;  4DTU A;  4WFA L;  4LF7 K;  4CIG A;  2XO7 A;  1WN7 A;  3HZ6 A;  3ZT1 A;  4FZY A;  1CZ9 A;  4F2R A;  3L2R A;  1VAZ A;  5C42 A;  3THW B;  2RKI A;  1T7P A;  1S1X A;  4WQ5 C;  2Q36 A;  2QM1 A;  4DU4 A;  1M1K O;  4JI7 K;  4LC9 B;  2CGK A;  4KHQ A;  1YVN A;  2P9L A;  3D0P A;  2HW3 A;  3KK7 A;  5BRH A;  3TAB A;  4CJ3 A;  3I0S A;  3S3N A;  4BRG A;  1RCH A;  1FKP A;  5AQN A;  2DY4 A;  3VQ6 A;  3P5J A;  1C1A A;  3K5N A;  1WBD A;  3KLH A;  3ZX3 A;  4X66 K;  1GLJ O;  4JKG B;  3SUP A;  3O8M A;  5KPR A;  3IFR A;  3ZSZ A;  2O8D A;  1BWF O;  4BGB A;  2A1S A;  4FWR A;  4Y0W A;  4DFM A;  1OVQ A;  3DOL A;  3WXI A;  1KC8 O;  4BRI A;  3TAN A;  2EWS A;  4CEO A;  3LDP A;  3CM5 A;  2GEM A;  4DQI A;  1RDD A;  4DFJ A;  4I9L A;  2IVN A;  4KI6 A;  3AY9 A;  4DS5 A;  1BCM A;  1RTI A;  1ASV A;  1YTA A;  4K41 A;  1RT6 A;  1NNE A;  3O80 A;  3MN7 A;  3U9Z A;  3DRR A;  5HL7 L;  3F5T A;  2P51 A;  3KLI A;  3DXK B;  3KTQ A;  1Q82 O;  3QFP A;  5M1P A;  2ZQB A;  2P9P B;  4CJS A;  2UXB K;  4CBU A;  4CI6 A;  2VG7 A;  3VF2 A;  1WSG A;  4HWI A;  1HKG A;  1J54 A;  4JKF A;  3VOV A;  1RT4 A;  2O8B B;  3NF6 A;  1JCG A;  3OYC A;  3NH1 A;  3VES A;  1RDU A;  2G8H A;  1IKY A;  1HMV A;  4OLB A;  4JKB A;  1HNI A;  1S5J A;  1E4G T;  1WB9 A;  3ULE A;  2QWP A;  4FWM A;  5DK5 A;  4KTW A;  4GW6 A;  1F21 A;  4DV7 K;  2QEX N;  3K2P A;  4DSF A;  1RBS A;  3E66 A;  5KTQ A;  3MX2 A;  3VEY A;  3MEG A;  4KV8 A;  4I2P A;  3NVM A;  4W5R A;  3AVH A;  4JI8 K;  5F1X A;  4O4G A;  5AZI A;  2BUP A;  3QFU A;  3V1R A;  4BR2 A;  3KK1 A;  1ZBS A;  3QIC A;  5HRN A;  5KGW A;  4YY3 K;  4N47 A;  4IJA A;  4J2A A;  2P9I A;  5FLX O;  2KLA A;  1J9A A;  4FJK A;  1T03 A;  3VEV A;  2P9U A;  5EVZ A;  1VSI A;  5AQL A;  4MO5 A;  1W2B M;  1YIJ N;  4BE2 A;  4BY9 C;  4ILG B;  4QS8 A;  4YOY A;  3ATV A;  3HO1 A;  4IBN A;  4GKK K;  4N5S A;  3EZW A;  3UIQ A;  4KPY A;  3J81 O;  4C8K A;  4CED A;  3RTV A;  2YCH A;  3DI6 A;  3VMF B;  2Z1G A;  1HQE A;  4CGH A;  2P5G A;  3BEX A;  4WQ5 A;  2QXF A;  1T8E A;  1MA9 B;  4OPH A;  1SZ2 A;  4B8A B;  3AO3 A;  4C1N I;  3ZX2 A;  3K59 A;  1RT3 A;  3I8D A;  1IV0 A;  3BP8 A;  5JMV A;  4AQY K;  4FWN A;  1Q81 O;  3CPE A;  1VQ7 N;  2Z1H A;  1MWK A;  3QES A;  2NZT A;  4M7X A;  4EIA A;  3KD1 E;  1BGX T;  4FJM A;  1HPM A;  4JI4 K;  2A1R A;  3UKU A;  1Q9Y A;  3RMD A;  3DRS A;  1FW6 A;  2ZJR L;  3OYG A;  3LM2 A;  4OPK A;  4FM0 A;  4JRQ A;  4ELV A;  4B9T A;  4FLX A;  2WTU A;  3OYH A;  3DRP A;  2VCP A;  4TSX A;  1JLF A;  2UUB K;  4H5W A;  4BRP A;  2G8K A;  1QZ5 A;  1ZBH A;  3CET A;  4IFV A;  4MO4 A;  3V6D A;  1NGB A;  1ESV A;  3OYL A;  1NK8 A;  5JLH A;  5M1Q A;  4MFB A;  4DG1 A;  3F2K A;  5KQ8 A;  4AM6 A;  4Y1C A;  1IJJ A;  3C6T A;  5KPZ A;  3SQ2 A;  3VEX A;  2YHW A;  2YNH A;  3NMU A;  2W40 A;  4IZ9 A;  3CC7 N;  3K9K A;  3EE8 A;  1HNX K;  3P38 A;  5HLF A;  2XHB A;  4NCA A;  4CEC A;  5C0Y A;  3KWG A;  1WLJ A;  3RMB A;  3VGK A;  1U48 A;  4WE1 A;  1Q8I A;  4B1V A;  1GOC A;  3KHY A;  3TSQ A;  2EX3 A;  2IAJ A;  3CMA N;  1RBT A;  3VN5 A;  4OJR A;  5KRS A;  3GL1 A;  4B1Y B;  1D5A A;  1HPZ A;  4H5R A;  4EP5 A;  3JYT A;  4JK7 A;  3THW A;  2WBN A;  3EZ5 A;  3KKR A;  1HR0 K;  4GMJ B;  3AO1 A;  2E6L A;  4CJQ A;  4EZ9 A;  4Z4E A;  1BHL A;  4FWL A;  4AHR A;  3PSF A;  4CD3 A;  2IVO A;  2O8D B;  3ZET A;  2HBJ A;  4AM7 A;  3N4P A;  5AQX A;  4JYA K;  1QTM A;  4OKJ A;  5J2M A;  5SWM A;  3THY B;  4YOX A;  4DSK A;  4LY7 A;  2HBM A;  3NF7 A;  3L2W A;  4DFK A;  4C1N K;  3S41 A;  4NLB A;  2QTD A;  2BE2 A;  2DFF A;  1Q86 O;  3C6H A;  5EOY A;  4QCL A;  3VGM A;  3NAE A;  4H5N A;  1YTU A;  1N36 K;  4BRA A;  2I7P A;  2NNW A;  3V1Q A;  3V1O A;  2F8S A;  4FZZ A;  5C15 A;  5AQW A;  1IBL K;  2HHX A;  3L8B A;  1KFS A;  1BUP A;  1IG8 A;  1S9E A;  3CC4 N;  2GBZ A;  2E1Y A;  3O9S A;  3JAM O;  3PO5 A;  4NLC A;  4YDU C;  4FLY A;  3FE1 A;  3OA9 A;  1EWQ A;  1KSP A;  4YHH K;  1BIS A;  1QQC A;  2E2Q A;  2YJE A;  3AVJ A;  1VQL N;  3IKM A;  3J8A A;  1BL3 A;  1WUA A;  4KRE A;  4CD1 A;  1CZB A;  4ISG A;  1BA1 A;  2ATQ A;  4IO9 L;  2A40 A;  1BA0 A;  4DQP A;  3O6W A;  4A5B A;  3E9P A;  4DTJ A;  4BRK A;  1HLU A;  2YHA A;  3FZH A;  4KTZ A;  4HUE A;  1LWC A;  5AR0 A;  4RTF D;  4B3O A;  3UKR B;  5HBM A;  1CZA N;  2E2N A;  3M8R A;  1N34 K;  3O9T A;  5M1K A;  3TU5 A;  1EET A;  3SI6 A;  2OYQ A;  2PY5 A;  3DLH A;  2Q31 A;  2F9W A;  4FWQ A;  2WON A;  4BVP A;  3CM6 A;  4RW7 A;  5AQR A;  3L2V A;  1O1W A;  3C0B A;  3IS9 A;  4N56 A;  3D6R A;  3KK3 A;  4YDU A;  2HVI A;  3HSC A;  3E9O A;  5AQV A;  5AQU A;  2HHH K;  1Z6R A;  3QEP A;  1YJN N;  4JS5 A;  4UQG A;  2GEL A;  5AQO A;  1KAY A;  2OZM A;  4E7J A;  1JLA A;  4FWP A;  3D2E A;  3L3U A;  1VQK N;  5KPT A;  3SK3 A;  3W0L A;  1NLV A;  4ZTF A;  3T19 A;  4BGA A;  4NO7 A;  4CZG A;  1JLG A;  3AA2 A;  3CFO A;  5AQZ A;  4CGJ A;  4X64 K;  1BI4 B;  2XY8 A;  4IKF A;  2QWO A;  4DV5 K;  4OGE A;  4CIE A;  2YV0 X;  1NGC A;  1S1V A;  2QW9 A;  4LF5 K;  2P9K A;  3K57 A;  5AQI A;  1VQ8 N;  1EKE A;  1UA1 A;  1NJZ A;  2FBY A;  5HOO A;  1JLB A;  5I42 A;  4O0J A;  2E5L K;  3ULE B;  4FVU A;  3EE9 A;  3WQU A;  3LPT A;  3RR7 A;  3IRX A;  4JKG A;  1T3V A;  3ZLJ A;  3HTV A;  3NBP A;  1ASW A;  1D4X A;  3NE6 A;  3HOS A;  3QEV A;  4K8Z A;  5BRD A;  3ZSV A;  3RR8 A;  2VG6 A;  5AQH A;  1QSS A;  1C6V A;  1HJO A;  4FLV A;  3SUO A;  1MU2 A;  4BDP A;  3T7Z A;  4DQ8 A;  4H0P A;  1Y64 A;  3PY8 A;  3R1X A;  4H4O A;  3PO4 A;  1ZBI A;  4AHC A;  3LAN A;  4YOR A;  2A41 A;  1NKC A;  1N32 K;  3VQ5 A;  2NLX A;  3WEE B;  3IMX A;  3KWI A;  4CF8 A;  3O3F A;  2O4I A;  4B9M A;  1RGI A;  2GWK A;  4OPA A;  3VQA A;  4BC3 A;  5BPN A;  4B9L A;  5FPE A;  4A62 A;  3MAQ A;  1M90 O;  4IDH A;  1BCO A;  1YAG A;  2O4G A;  1NGF A;  3TI0 A;  1NKB A;  1L3S A;  3AV9 A;  1HYV A;  4IWV A;  4HCC A;  2OPQ A;  4H8K A;  2WOM A;  3AVF A;  3BUZ B;  4FO0 A;  2YNI A;  5FPD A;  2VWB A;  2FBT A;  4FJL A;  3KD5 E;  4DSI A;  3L2U A;  3ZEU A;  2P9S B;  4HVJ A;  1WAJ A;  4E7H A;  3HT3 A;  2PYJ A;  3E01 A;  3LP3 A;  1NGI A;  4MDA A;  2GV9 A;  1L3U A;  2XY6 A;  5AQS A;  5CZ1 A;  3I33 A;  3VEZ A;  1WOQ A;  4JD2 B;  1HNW K;  3A5N C;  3GBT A;  2OTL N;  4DTP A;  5FPM A;  1Z05 A;  3WNE A;  4CZL A;  4JAX A;  1NOY A;  5C10 A;  1NGH A;  3SQ4 A;  1QS4 A;  4BRL A;  3QBX A;  4BRD A;  5HRO A;  1ZBL A;  3QBW A;  4B8C A;  2ZD1 A;  1JXE A;  4RW9 A;  4AHV A;  4DV4 K;  1TK8 A;  1KVC A;  5J2Q A;  3NDK A;  4KHN A;  3VQQ A;  4LFB K;  1NK4 A;  3LM9 A;  1HKB A;  4E7K A;  4EAH D;  1A5X A;  3GOI A;  1I39 A;  1BIU A;  1WSH A;  3RVC A;  1KRP A;  4RW4 A;  4CGD A;  3JXU A;  2HMI A;  4CJL A;  4ID5 A;  4CER A;  2HNZ A;  1ZBU A;  4CBW A;  2QKB A;  2RHK A;  3K58 A;  1CXU A;  4BRC A;  1YVU A;  1GLB G;  5E26 A;  1FK9 A;  3TAG A;  3WNG A;  4DR1 K;  4EZ6 A;  3PIP L;  2UYT A;  4IEE A;  5HRS A;  4FLU A;  2W42 A;  1SKS A;  4IJN A;  1LW0 A;  3D2F B;  3DM2 A;  4JI2 K;  2W41 A;  2E6M A;  4DS4 A;  1X3M A;  1HQU A;  2EHG A;  2RN2 A;  4FLT A;  4O0I A;  3OJS A;  1N33 K;  2A3Z A;  4Z4C A;  3FLC O;  1RT2 A;  2E88 A;  5D3G A;  3ID8 A;  3FZF A;  3ZEU B;  4FJJ A;  3DLG A;  4AHT A;  1QHT A;  2ZGZ A;  4DB3 A;  2ASO A;  2BGG A;  1VSM A;  1ITG A;  1TUU A;  4I7F A;  3JSM A;  3SAG A;  3L4I A;  3CJA A;  4DQS A;  4ID1 A;  5CR4 A;  1RDB A;  2FBV A;  3J7Z O;  2ZWH A;  1DTQ A;  3KIO A;  3OYI A;  2P5O A;  1XC9 A;  4AH9 A;  1QVF M;  4FJX A;  2Y1I A;  3OVN A;  4DR7 K;  3AVI A;  3HYF A;  4NXN K;  3V9X A;  3TAP A;  1NJX A;  3O5B A;  4C8N A;  2YKM A;  4PHT X;  1E3M A;  1SKR A;  3DLE A;  1U6Z A;  3MK6 A;  3R3L A;  3OYK A;  1U4B A;  2V7Z A;  4BR0 A;  3JS6 A;  1LAW A;  1WNS A;  2BTF A;  3C94 A;  1XNQ K;  4BQL A;  4F9O A;  1BQM A;  2AA4 A;  4ILJ A;  3I0R A;  4MLE A;  5EY4 A;  1J5E K;  1KXP A;  1RT7 A;  4CZE A;  5BRE A;  3LDL A;  3H3O B;  4FPB A;  4MLH A;  2HOE A;  4E19 A;  5K14 A;  4B1U B;  3OS0 A;  5KGX A;  1NK5 A;  4BQZ A;  4CJW A;  3G0Z A;  2O8B A;  3NF9 A;  1VSH A;  4I2Q A;  2NRV A;  3VEO A;  1VHX A;  3CCS N;  1OH5 A;  2X6N A;  1XHX A;  3A0I X;  3L6Q A;  4G1Q A;  2AJQ A;  2G8I A;  5DM6 L;  3LZJ A;  2ETJ A;  1MWM A;  2VGM A;  2XY7 A;  4Z94 A;  3VGL A;  3U8X A;  3OYN A;  3ZSQ A;  4OGC A;  1VSK A;  3DMJ A;  2KTQ A;  3AA5 X;  1LV5 A;  5GAG P;  2HHS A;  1ATN A;  3ATU A;  4QAG A;  2HHU A;  1YJ9 N;  5AQG A;  3VQE A;  3H1Q A;  3AVG A;  1NMN A;  4FOI A;  3LDS A;  3H46 O;  3H08 A;  4NXM K;  4CEE A;  3VF6 A;  3QIP A;  2V51 B;  4HHT A;  3KLF A;  3PX6 A;  5BR8 K;  3TAM A;  4A57 A;  2FXU A;  3HP6 A;  2I5J A;  4CZK A;  5KI6 A;  3AO5 A;  1BOT O;  1HYZ A;  5LMN K;  4BRH A;  2B5J A;  4CFA A;  2FF6 A;  2ZF5 O;  3F9K A;  3CQ8 A;  2NRH A;  4CHY A;  3TR8 A;  4WYB A;  3ZT4 A;  4BC4 A;  4LFA K;  1JCF A;  1SV5 A;  3O9Q A;  4OVL A;  1VQ6 N;  5AZJ A;  3SAF A;  2X6S A;  1KLN A;  2BDP A;  5SZT A;  2YNG A;  1ATS A;  2PAV A;  4CCH A;  2KFN A;  1VK0 A;  3ENH A;  4BWJ A;  4RWT A;  4KTQ A;  3SUN A;  4HTL A;  4BR4 A;  2Y1J A;  4E0D A;  5JIC A;  3HBT A;  3IG1 A;  1S3X A;  3SJJ A;  4KHP K;  4KFB A;  1NGA A;  2F8T A;  3LWL A;  4BE0 A;  3BF1 A;  3NH2 A;  2YNF A;  1L3T A;  4OKE A;  1K8K B;  1RBV A;  5BN8 A;  3T3F A;  4IEI A;  1E4F T;  2PZS A;  4PL8 A;  4DUY K;  2HND A;  4ISF A;  4CF2 A;  3MN9 A;  3H45 C;  5AZI B;  4Z4F A;  3LDQ A;  2DFE A;  4RW8 A;  3HK2 A;  5AJ3 K;  4ILH A;  3C6A A;  2E1Z A;  4X62 K;  1TVR A;  2VWJ A;  2IS3 A;  3DLK A;  1RDC A;  5LJV A;  4E7L A;  3RMA A;  1IO2 A;  1VSL A;  3PSI A;  2E2P A;  1YI2 N;  4B1W B;  2LSN A;  3LWM A;  3TPQ A;  2JWK A;  4CFB A;  3OYA A;  3MMV A;  4A61 A;  4JS4 A;  4KHU A;  4PKH A;  4DQQ A;  4RG8 A;  5CHI A;  3UB5 A;  1TL3 A;  4YOW A;  1XWL A;  3U9D A;  3VQ4 A;  5BR9 A;  3O3H A;  3O9U A;  4I6M B;  1HX1 A;  1C0T A;  2NRW A;  3DOK A;  3MWP A;  3RSE A;  3WEE A;  5AFU H;  1QE1 A;  3CQY A;  3CFP A;  1I94 K;  2KW4 A;  1UA0 A;  4DKW A;  1YF5 L;  4Z4I A;  2ITG A;  1V4T A;  4DV6 K;  2VWK A;  2KHO A;  5CY4 A;  5AQJ A;  1NK9 A;  1XNR K;  1TGO A;  4GVM A;  1L5U A;  4CHN A;  4O5F A;  1W0H A;  1X3N A;  4CK3 A;  2X74 A;  3SPY A;  2HNY A;  1QVG M;  4KH6 A;  4L3Q A;  3C65 A;  4HUG A;  4WF9 L;  2W6K A;  5ADX A;  5FDL A;  2Q3S A;  3TTD A;  2QWN A;  3CCM N;  2P9N A;  4JKH A;  1S9G A;  1S1W A;  3FFK B;  1L3V A;  3O9R A;  3PLA A;  3C6U A;  4BRF A;  4FM1 A;  1JKH A;  3ZSY A;  1RIL A;  4FPA A;  2IGI A;  3OYD A;  3CER A;  3DXM B;  1DTT A;  4KH5 A;  4BG9 A;  1VSJ A;  3GG4 A;  3Q7C A;  2NRZ A;  4CJ4 A;  3OYB A;  4CJE A;  1BIZ A;  3SQ0 A;  2J4R A;  3O3G A;  4IO8 A;  4BRQ A;  2YHY A;  4WFN L;  4LFC K;  3KJV A;  5H1S Q;  2RF2 A;  4BR5 A;  4BG8 A;  3MN6 A;  3CJ9 A;  1X9S A;  3MXI A;  1D8Y A;  4BVO A;  2YHX A;  1Z26 A;  1LOT B;  4IG0 A;  5BRF A;  4IOA L;  1SAZ A;  3U4L A;  3QLH A;  3QML A;  4AIL C;  1C0G A;  3V9S A;  4CBX A;  4Z4G A;  4BDZ A;  4H4M A;  5T7B A;  4QS7 A;  1TAU A;  4XEI A;  1ATR A;  3MEC A;  3G71 N;  1U45 A;  5BPL A;  4L8R B;  4DR6 K;  3CF5 L;  3O1B A;  2VQF K;  3QEX A;  2OA8 A;  4OX9 K;  2E8A A;  4UY8 O;  1GOA A;  4XIU A;  1QQM A;  3SPZ A;  2WUS A;  2UXC K;  1HKC A;  3FFI A;  1K9M O;  2IIR A;  2ZJP L;  2HHV A;  1SUQ A;  3C95 A;  4O8U A;  4ELU A;  5C24 A;  4Q0B A;  1VSD A;  3NHG A;  3MXM A;  4DWI A;  4DTS A;  1LW2 A;  3MEE A;  4LH5 A;  4NB4 A;  4JKA A;  5I9E B;  1NOZ A;  5GAD P;  4LSL A;  1EXQ A;  3CG7 A;  1BQN A;  1OVY A;  3ZSR A;  4CE9 A;  3V9Z A;  2VGN A;  4LF8 K;  3F9M A;  3V9U A;  3P31 A;  4JEP A;  2BH1 A;  2KQ2 A;  3OS1 A;  3HM9 A;  3VTH A;  1IKW A;  4FWS A;  5AQM A;  3G4S N;  1IBK K;  1JJ2 M;  1N8R O;  4CJR A;  3V4I A;  2ZGY A;  3AAR A;  3BZK A;  3LL3 A;  5EU7 A;  4JV5 K;  5AQF A;  2XY5 A;  5GAH P;  3IAY A;  2W6L A;  4IFE A;  3WQT A;  1NKE A;  3OYF A;  4OPJ A;  3WNH A;  1JL1 A;  4B3T K;  4FK4 A;  1A5V A;  4GY2 B;  1WBB A;  1NM1 A;  4JI3 K;  3S9H A;  3EYZ A;  1YUW A;  4W5Q A;  1TK0 A;  4GV9 A;  1NMD A;  4DU3 A;  2NRT A;  4ICL A;  1EX4 A;  4FJ5 A;  4DR4 K;  2E20 A;  1XHZ A;  4FJI A;  3AVA A;  3BY5 A;  3CCV N;  1HYS A;  1C0M A;  4B1Z A;  3AAP A;  5KRT A;  4KHW A;  1D9D A;  2G8F A;  2P9P A;  2IC3 A;  3EKS A;  4CZF A;  4E89 A;  2O8C A;  3KZB A;  3U3Y A;  1C0U A;  3CHW A;  4CZJ A;  3R8E A;  1KTQ A;  3SZ2 A;  3VQP A;  3LPU A;  3DYA A;  5EX5 A;  3TAR A;  2E2O A;  1T44 A;  3E1Y A;  4BRE A;  1CLQ A;  1XC3 A;  3TAF A;  1U2V B;  3ZET B;  4B9V A;  5LL6 Z;  3WXM B;  3K5L A;  2NRR A;  4XH4 A;  2YX6 A;  4H5V A;  4XH5 A;  4R79 A;  4BAC A;  3AGR A;  3TTC A;  5M1O A;  3P39 A;  3KKS A;  3LAK A;  1IBM K;  1S1T A;  5EXW A;  4DFP A;  1NWK A;  3WNF A;  2D0B A;  5CZ2 A;  2PYL A;  1BO5 O;  4CZI A;  1TV6 A;  5FPN A;  2B6A A;  3TSP A;  4DTM A;  1HJR A;  2R7Y A;  2QK9 A;  1S72 N;  4CEF A;  3AA3 A;  3T69 A;  1UOC A;  2VQE K;  3N4Q A;  2HBL A;  3VEN A;  4FOE A;  1JLQ A;  1WSJ A;  3FZL A;  4JI5 K;  3GE1 A;  5MLC Q;  3T1A A;  4OLA A;  3F73 A;  4FVM A;  1JXB A;  4C8L A;  2OAN A;  2WFB A;  1LWF A;  3A5M C;  4GV3 A;  1SKW A;  3HM8 A;  3CI5 A;  4KKO A;  3S3M A;  4Z0U A;  4CK2 A;  1Q7Y O;  4CEZ A;  4GKJ K;  1YIT N;  3SV4 A;  2Q2R A;  3O4Q A;  1GLF O;  4KHS A;  4M7Y A;  4CZH A;  4ELT A;  4O8K A;  1NGE A;  3UKU B;  3ZCM A;  1NJW A;  3U6F A;  1HNV A;  4IOX A;  4BE1 A;  3SBG A;  1WSF A;  3RWU A;  3VQB A;  1T6C A;  4DV3 K;  4DTX A;  4DF8 A;  3DAW A;  1QSY A;  2QWM A;  1RT1 A;  3LAM A;  1U2V A;  4A5A A;  3K0S A;  4IFY A;  1ASU A;  1RTJ A;  4Z4H A;  2WC9 A;  2RPI A;  2QWQ A;  3A8Y A;  3CFR A;  1I3A A;  3NGI A;  4CJP A;  4M41 A;  5AQQ A;  4JK8 A;  5LY3 A;  3VQ7 A;  1NG9 A;  4LF4 K;  2D0C A;  2JWL A;  3SCX A;  4Q5V A;  1C1B A;  1SS6 A;  2P9I B;  4HTU A;  1P90 A;  2ASP A;  3ID6 A;  3OYM A;  5J1E A;  4CF9 A;  5B8H A;  1U47 A;  3CCE N;  3CJB A;  3OYE A;  3SUQ A;  2Q0U A;  4E7I A;  1BDG A;  5A2Q O;  4WCE L;  3HP9 A;  1W9H A;  2IVP A;  3L0Q A;  4F2S A;  4M3Z A;  1S22 A;  1DEJ A;  3DXK A;  4H0T B;  1BU6 O;  1B92 A;  1ZC6 A;  4F8R A;  1HUX A;  3T1H K;  1FKO A;  1J5O A;  2GTD A;  4CJ5 A;  1RTH A;  2V52 B;  3D2F A;  2HBK A;  2Q1N A;  1JLC A;  3DJC A;  1UAX A;  4M3W A;  2O8F B;  3SAH A;  4H5T A;  3R6M A;  3AVN A;  1S6Q A;  1RBR A;  3HST B;  2HHT A;  4CVN E;  3QEW A;  3TAE A;  3VA0 A;  4CHO A;  3BDP A;  4H0O A;  3ZT2 A;  3FZM A;  4DU1 A;  4DV0 K;  2IOC A;  3B6O A;  3LDN A;  3PX4 A;  2KZZ A;  3VQD A;  4GV6 A;  4K0K K;  4DF4 A;  1VQ9 N;  4NYF A;  4AHU A;  4JKD A;  1IKV A;  1T6D A;  4CHP A;  1B9D A;  4FSV A;  4B9N A;  4FK2 A;  4NCG A;  4BR7 A;  3VF4 A;  1NK6 A;  1S6P A;  1SL2 A;  4FK0 A;  3ZT0 A;  3DLR A;  3R9P A;  2FSJ A;  1OH6 A;  4CHQ A;  1X9W A;  5TKY A;  1W97 L;  1KAZ A;  3ITH A;  2O8C B;  3SMS A;  1X9J A;  2A5X A;  2GUI A;  4MQ3 A;  4K8X A;  5LMU K;  1NK7 A;  5LJW A;  4FLZ A;  4DSJ A;  3B8A X;  4JKE A;  3VEW A;  4U7B A;  3PV8 A;  2E4L A;  1KVB A;  4B9Q A;  2F9T A;  4JNE A;  4CFC A;  3THX A;  4J2E A;  3ENO A;  3EL2 A;  2Z1J A;  3EEQ A;  4A2B A;  3O08 A;  2QA4 N;  3C7N B;  4WQ4 C;  1K8A O;  2P9N B;  5DM7 L;  5GAE P;  3ASM A;  1KLM A;  1QSL A;  5F2R A;  1DKG D;  3Q7B A;  4DHY A;  3VQC A;  4H03 B;  4MDB A;  5F0X A;  3OS2 A;  3NFA A;  4JD2 A;  4A2A A;  1LCU A;  4NYN A;  4LSN A;  1TK5 A;  2D0A A;  1U49 A;  4J2B A;  5TKW A;  4DMN A;  5FRN A;  2H3G X;  4O5B A;  1G99 A;  3MXJ A;  3ZSO A;  1RT5 A;  1QHA A;  2X78 A;  2OTJ N;  2O8F A;  1ZXO A;  5CYM A;  5CYQ A;  4B3M K;  1EP4 A;  1RNH A;  2P1J A;  5J2N A;  3MED A;  3L3V A;  4A59 A;  1W7A A;  4CJV A;  4CGF A;  3THY A;  4FL9 A;  3M1F A;  2P9U B;  1ZBF A;  4YOT A;  3QIN A;  1A5W A;  3VET A;  5AQK A;  2OZS A;  3I8B A;  1YT3 A;  3VPZ A;  4KH4 A;  3D2E B;  1GLC G;  4IOC L;  4F4K A;  4BC2 A;  4PL7 A;  4QOZ B;  4B08 A;  4DTN A;  1VQ5 N;  1NU0 A;  1REV A;  3SMP A;  1Q9X A;  4JI1 K;  3W3D A;  5GIN A;  3DLL L;  3CME N;  2IDO A;  3NCI A;  2HF4 A;  4RW6 A;  1TKX A;  4JKC A;  5AZJ B;  1RFQ A;  1RDW X;  4M63 C;  4JI6 K;  2PBD A;  4EHU A;  4KRF A;  3AGK A;  4FLW A;  3CCQ N;  4DR3 K;  1T05 A;  3TWH A;  2V7Y A;  4K43 A;  4CGG A;  3AAQ A;  2OPR A;  3U3G A;  3QDK A;  3I55 N;  2P9K B;  5BN9 A;  5IWA K;  3OW2 M;  1XMO K;  4CF1 A;  2KKZ A;  3A2F A;  4R5P A;  4ZHR A;  3M6G A;  2DTU A;  2G8W A;  1FJG K;  3QET A;  1K8K A;  4YOV A;  1NBW A;  1KAX A;  3QER A;  1OH8 A;  2UXD K;  3K5M A;  4XH1 A;  3QNN A;  1WSI A;  1R59 O;  2HHQ A;  3KVG A;  4JN4 A;  2YJF A;  3FZK A;  4YOU A;  1EWR A;  3RRG A;  3A5O C;  2VG5 A;  5C12 A;  4CIF A;  1TYQ B;  5AQP A;  1KFD A;  2HF3 A;  3QEI A;  3KK2 A;  3MWT A;  3M8Q A;  3MCP A;  4KB0 A;  3VQ9 A;  3G25 A;  1GLA G;  3CPW M;  1C0F A;  5AQY A;  2OCE A;  3ALY A;  4M3R A;  3OBW A;  1TKZ A;  3PIO L;  4JI0 K;  4HCB A;  3ZYY X;  3PX0 A;  2CGL A;  2HB5 A;  1VRU A;  3ZSX A;  3HL8 A;  3S3O A;  3CJ1 A;  3SQ1 A;  4I6M A;  4E1N A;  3BF3 A;  2HVH A;  4IG3 A;  4FYD A;  3LDO A;  1VQO N;  1VQM N;  4K42 A;  4DR2 K;  1U04 A;  2QWR A;  1TKD A;  2DPN A;  3SNN A;  3CCL N;  4CFD A;  3SYZ A;  1R0A A;  1P8Z A;  1NJY A;  4KHY A;  3AVC A;  2GX9 A;  1HNZ K;  3CQX A;  4WFB L;  1XQS C;  5E41 A;  4JRP A;  2F4V K;  4IDK A;  4BWM A;  2NRX A;  1Z25 A;  3SV3 A;  4DTR A;  4I9Q A;  3CJC A;  4CW7 B;  4DQR A;  1VQN N;  3AVB A;  1SL0 A;  3LP1 A;  1DGK N;  5KQD A;  4CHZ A;  4DV1 K;  4DV2 K;  4M3U A;  1ZYQ A;  1BI4 A;  1O13 A;  4CGI A;  5GIP A;  1X9M A;  3DXM A;  2HST A;  2FF3 B;  4ISE A;  3THV A;  5I3U A;  4KAZ A;  4PUO A;  4DTO A;  2I7N A;  4NCB A;  1JL2 A;  1KVA A;  3BZC A;  3MDQ A;  3WXL A;  5M1F A;  4B9U A;  4DLE A;  1GOB A;  3J7Y P;  5JVH L;  4K25 A;  2B4J A;  1IKX A;  3CYM A;  3HJF A;  4LH4 A;  5GIO A;  1Q18 A;  3VER A;  3ISN C;  3HPO A;  4B9S A;  3WT0 A;  3OBY A;  4X65 K;  4U67 L;  1RDA A;  1WAF A;  4CK1 A;  2VYP A;  3ZT3 A;  3UE5 A;  4FJ7 A;  1NJI O;  4AF1 A;  4IXC A;  2QWL A;  3BGR A;  3THX B;  3SLC A;  4FJG A;  1XI1 A;  3WXK A;  1N6Q A;  4ZTJ A;  2F7T A;  2UUA K;  1OKJ A;  1BG3 A;  4W5T A;  1TKT A;  3MN5 A;  4GVE A;  5HRR A;  4YNQ A;  3NGY A;  5HRP A;  3RSE B;  3QNO A;  4PQU A;  1LWE A;  1V4S A;  1IG9 A;  3B6P A;  4OKK A;  1HRH A;  3KLE A;  3OTO K;  4FM2 A;  1JCE A;  4O44 A;  3HVR A;  4FJN A;  4CZM A;  3QB0 A;  3EY1 A;  4G9Z A;  3CD6 N;  4PY5 A;  3CJ7 A;  5FRM A;  4V19 S;  4JHD A;  4N76 A;  2UUC K;  1VQ4 N;  3TSU A;  4KO0 A;  3NGZ A;  3LZI A;  2DFH A;  3PUF A;  2F96 A;  5C2D A;  3O1W A;  2GWJ A;  1KD1 O;  4H0Y B;  1QQO A;  3AO2 A;  1OH7 A;  1ILY A;  2YHB A;  2FLO A;  1C1C A;  2NUB A;  3L2Q A;  4DLG A;  1NGD A;  3P83 D;  4CJU A;  3D45 A;  4C23 A;  2FSN A;  4H0V B;  2P9S A;  3E9L A;  1QZ6 A;  2A6A A;  5DMR A;  1SQK A;  4M42 A;  3H6E A;  1XUP O;  1RTD A;  4M3T A;  4E1M A;  2YKN A;  4QS9 A;  1G15 A;  3CCR N;  3WUH A;  4BDY A;  3I56 N;  3M8P A;  4FWK A;  4FXD A;  1VSE A;  3K9J A;  1NK0 A;  2KFZ A;  5FRO A;  3RRH A;  4M3X A;  1S1U A;  4FCY A;  3MX5 A;  3J7A P;  3CCU N;  3QIO A;  3CCJ N;  1J53 A;  4CES A;  4FJ9 A;  3V81 A;  3DLB A;  2Q0R A;  2D4W A;  3J80 O;  4CEA A;  3IDH A;  3CXC M;  1GLL O;  3NF8 A;  4OO1 J;  4YFU A;  4W5N A;  3ULD A;  4FWO A;  5JS2 A;  2OPS A;  1DLO A;  3OJU A;  1D9F A;  1GLD G;  2ZJQ L;  4PKI A;  5C25 A;  5IT9 O;  4N41 A;  5JVG L;  1XMQ K;  4BRO A;  3M3Z A;  1RBU A;  1YJW N;  4FJ8 A;  1MDU B;  3OY9 A;  4B3S K;  2QI2 A;  4WQ4 A;  1H1V A;  3VTI A;  2PFU A;  3HPG A;  2FSK A;  4FZX C;  4EP4 A;  1J6Z A;  2D0P A;  3ZSW A;  4JHD B;  1YXQ A;  3G6E N;  4PWD A;  4KI4 A;  4LD0 A;  1K73 O;  4CJ7 A;  4BRN A;  3TTF A;  4CJF A;  5AFU A;  1IH7 A;  2HMP A;  2O8E A;  1EO1 A;  3LAL A;  2XRI A;  3FGU A; 
#chains in the Genus database with same CATH homology
 2NNW A;  3SAH A;  1VQP N;  4H5T A;  2ASM A;  5AQT A;  3R6M A;  5C15 A;  5AQW A;  1ATS A;  2PAV A;  2QXL A;  3ENH A;  3EKU A;  4RWT A;  1BUP A;  1IG8 A;  5M1N A;  3CC4 N;  2D0O A;  4H0O A;  3FZM A;  4HTL A;  2YI1 A;  3ZX0 A;  4BR4 A;  2CH6 A;  2E1Y A;  3HBT A;  3O9S A;  5JIC A;  1EQY A;  1TUY A;  3LDN A;  1S3X A;  1NGJ A;  3FR0 A;  4NLC A;  1NGA A;  3O4W A;  4GV6 A;  3ENB A;  4YDU C;  3BF1 A;  3FE1 A;  3OA9 A;  1VQ9 N;  1KQS M;  3SBT A;  1YHQ N;  3P4I A;  1K8K B;  3L4Q A;  5ADX H;  2YJE A;  2E2Q A;  5BN8 A;  4JKD A;  3HRG A;  1T6D A;  4GNI A;  1QQN A;  5E84 A;  1VQL N;  3IKM A;  3J8A A;  4IEI A;  4FSV A;  3NVK A;  1E4F T;  1WUA A;  2AP1 A;  4BR7 A;  3VF4 A;  5CE3 A;  4PL8 A;  4ISF A;  3MN9 A;  3R9P A;  4CD1 A;  3C7N A;  3H45 C;  2FSJ A;  5AZI B;  3LDQ A;  4ISG A;  5TKY A;  1BA1 A;  1W97 L;  4DCH A;  4IO9 L;  1KAZ A;  2A40 A;  1GLE G;  4ILH A;  1BA0 A;  3C6A A;  3SMS A;  2E1Z A;  3O6W A;  4A5B A;  3E9P A;  2A42 A;  4BRK A;  4E1J A;  1HLU A;  1X9J A;  2A5X A;  3FZH A;  3OHR A;  3EO3 A;  5ELZ A;  5LJV A;  5AR0 A;  4RTF D;  2E2P A;  1YI2 N;  5JLF A;  4PKG A;  3UKR B;  3M5R A;  4B1W B;  3WXJ A;  3HI0 A;  5LJW A;  3TPQ A;  3B8A X;  1CZA N;  4JKE A;  2CGJ A;  2E2N A;  2JWK A;  2Q97 A;  3VEW A;  4U7B A;  1NGG A;  3MMV A;  4A61 A;  4H0X B;  4B9Q A;  2F9T A;  4JNE A;  4PKH A;  3O9T A;  5M1K A;  2GUP A;  5CHI A;  3ENO A;  3TU5 A;  4BC5 A;  3EL2 A;  2P9L B;  3UB5 A;  4A2B A;  4BR9 A;  4YOW A;  3U9D A;  5BR9 A;  3O08 A;  2QA4 N;  3O9U A;  3MCA B;  3C7N B;  4I6M B;  1HX1 A;  4WQ4 C;  1K8A O;  3CIP A;  2NRW A;  2RE2 A;  3MWP A;  3RSE A;  3WEE A;  5C2F A;  2Q31 A;  2F9W A;  5AFU H;  3CQY A;  4FWQ A;  4BVP A;  2ITM A;  2P9N B;  5AQR A;  4DKW A;  1YF5 L;  5DM7 L;  5GAE P;  1V4T A;  3C0B A;  2KHO A;  3D6R A;  3CC2 N;  5F2R A;  4YDU A;  5AQJ A;  1DKG D;  3Q7B A;  4DHY A;  3H3N O;  4JK9 A;  3UKR A;  4H03 B;  3HSC A;  4MDB A;  4O5F A;  1TYQ A;  3E9O A;  5AQV A;  4JD2 A;  4A2A A;  4EFH A;  5AQU A;  1LCU A;  1Z6R A;  1YJN N;  1X3N A;  4RCH A;  5TKW A;  2GEL A;  4KBO A;  1KAY A;  2H3G X;  5AQO A;  3D7E O;  1G99 A;  4J8F A;  1QVG M;  4FWP A;  3EN9 A;  3D2E A;  4KH6 A;  3A5L C;  3H1V X;  1QHA A;  4L3Q A;  3C65 A;  1VQK N;  5KPT A;  3SK3 A;  4WF9 L;  5BPM A;  2OTJ N;  3W0L A;  5ADX A;  1ZXO A;  1NLV A;  4BGA A;  4NO7 A;  3TTD A;  2QWN A;  4CZG A;  3DWL A;  2P9N A;  1DT9 A;  4JKH A;  3CCM N;  5AQZ A;  4A59 A;  3SJH A;  3FFK B;  3GDQ A;  3O9R A;  3PLA A;  2CH5 A;  4BRF A;  4FPA A;  2QWO A;  4FL9 A;  4BRM A;  3CER A;  3M1F A;  2P9U B;  3DXM B;  1NGC A;  2QW9 A;  2P9K A;  4YOT A;  4EHT A;  4KH5 A;  5AQI A;  4BG9 A;  3IUC A;  2D1K A;  3GG4 A;  3Q7C A;  2NRZ A;  5AQK A;  3VET A;  3I8B A;  3VPZ A;  1VQ8 N;  4KH4 A;  3HOT A;  3D2E B;  1GLC G;  2J4R A;  4IOC L;  4IO8 A;  4BC2 A;  5HOO A;  4BRQ A;  4PL7 A;  2YHY A;  1VQ5 N;  4WFN L;  3SMP A;  5H1S Q;  3W3D A;  5GIN A;  3DLL L;  3CME N;  4B1X B;  3ULE B;  4BR5 A;  4IOA L;  4FVU A;  3EE9 A;  3WQU A;  4WFA L;  4BG8 A;  3MN6 A;  5F0X A;  2HF4 A;  3CJ9 A;  4JKC A;  5AZJ B;  1RFQ A;  1RDW X;  4M63 C;  3HZ6 A;  4BVO A;  2PBD A;  2YHX A;  1LOT B;  1T3V A;  4JKG A;  3AGK A;  4EHU A;  5BRF A;  3CCQ N;  2V7Y A;  3HTV A;  1SAZ A;  4K43 A;  3U4L A;  3AAQ A;  1D4X A;  3QML A;  3HOS A;  3QDK A;  1C0G A;  5BRD A;  4CBX A;  3I55 N;  2P9K B;  5BN9 A;  1VAZ A;  3OW2 M;  4QS7 A;  4XEI A;  5AQH A;  1ATR A;  1HJO A;  1EO1 A;  4WQ5 C;  2Q36 A;  2QM1 A;  1M1K O;  2KKZ A;  3T7Z A;  4DQ8 A;  5BPL A;  3G71 N;  4H0P A;  3O1B A;  1Y64 A;  4LC9 B;  3CF5 L;  2CGK A;  3M6G A;  3R1X A;  2E8A A;  4UY8 O;  1YVN A;  2P9L A;  1QQM A;  4YOR A;  2A41 A;  2WUS A;  1K8K A;  3KK7 A;  1HKC A;  1NBW A;  5BRH A;  1KAX A;  2IIR A;  4BRG A;  4YOV A;  1K9M O;  5AQN A;  2ZJP L;  4XH1 A;  2NLX A;  3WEE B;  3IMX A;  3ZX3 A;  3KWI A;  1GLJ O;  4JKG B;  1R59 O;  3KVG A;  4JN4 A;  3O8M A;  4O8U A;  5KPR A;  3IFR A;  1RGI A;  1BWF O;  2YJF A;  3FZK A;  2GWK A;  4OPA A;  4BGB A;  4YOU A;  4FWR A;  4Y0W A;  4BC3 A;  5BPN A;  3A5O C;  5FPE A;  4A62 A;  3WXI A;  1KC8 O;  4BRI A;  1M90 O;  5C12 A;  4IDH A;  1TYQ B;  5AQP A;  2EWS A;  2HF3 A;  3LDP A;  4NB4 A;  3MWT A;  4JKA A;  3MCP A;  2GEM A;  1YAG A;  3G25 A;  5I9E B;  1GLA G;  3CPW M;  2IVN A;  1C0F A;  1NGF A;  5AQY A;  3AY9 A;  5GAD P;  3OBW A;  1OVY A;  3PIO L;  4IWV A;  4K41 A;  3ZYY X;  3O80 A;  2VGN A;  2CGL A;  3MN7 A;  3U9Z A;  3F9M A;  5HL7 L;  3P31 A;  3BUZ B;  4FO0 A;  4JEP A;  3F5T A;  3CJ1 A;  5FPD A;  2BH1 A;  2VWB A;  4I6M A;  3DXK B;  3VTH A;  3G4S N;  4FWS A;  5AQM A;  1Q82 O;  3QFP A;  1JJ2 M;  3BF3 A;  5M1P A;  3ZEU A;  1N8R O;  2P9S B;  2P9P B;  2ZGY A;  4CBU A;  3AAR A;  3LL3 A;  3LDO A;  4CI6 A;  1VQO N;  5AQF A;  3VF2 A;  5GAH P;  4K42 A;  1VQM N;  4HWI A;  1HKG A;  4IFE A;  3WQT A;  2QWR A;  4JKF A;  3VOV A;  2DPN A;  1NGI A;  4MDA A;  3CCL N;  1JCG A;  3VES A;  1RDU A;  5AQS A;  1P8Z A;  3I33 A;  3VEZ A;  1WOQ A;  4GY2 B;  4JD2 B;  1NM1 A;  3A5N C;  3GBT A;  4JKB A;  2OTL N;  2GX9 A;  1YUW A;  1E4G T;  3CQX A;  5FPM A;  3ULE A;  1Z05 A;  2QWP A;  1NMD A;  4FWM A;  4CZL A;  4GV9 A;  4JAX A;  4WFB L;  2NRT A;  1XQS C;  5C10 A;  1NGH A;  2E20 A;  2QEX N;  4BRL A;  3QBX A;  3E66 A;  4BRD A;  2NRX A;  3MX2 A;  3VEY A;  3CCV N;  3CJC A;  3QBW A;  4B1Z A;  3AAP A;  1VQN N;  3NVM A;  5F1X A;  5AZI A;  2BUP A;  2P9P A;  3EKS A;  1DGK N;  3QFU A;  4BR2 A;  5KQD A;  4CZF A;  1ZBS A;  3QIC A;  3KZB A;  3LM9 A;  1HKB A;  3CHW A;  1O13 A;  4CZJ A;  3R8E A;  4IJA A;  4EAH D;  2P9I A;  3GOI A;  5GIP A;  2KLA A;  2P9U A;  3DXM A;  3RVC A;  2HST A;  2FF3 B;  4ISE A;  5EVZ A;  5EX5 A;  3VEV A;  2E2O A;  5AQL A;  4MO5 A;  1W2B M;  2I7N A;  3JXU A;  1YIJ N;  1T44 A;  4BY9 C;  3E1Y A;  4BRE A;  4ILG B;  1XC3 A;  4QS8 A;  1U2V B;  3ATV A;  3MDQ A;  3WXL A;  3ZET B;  5M1F A;  4YOY A;  3WXM B;  3EZW A;  5JVH L;  4K25 A;  2NRR A;  4CBW A;  4XH4 A;  2RHK A;  2YX6 A;  2YCH A;  4H5V A;  3VMF B;  4BRC A;  4XH5 A;  4R79 A;  3AGR A;  1GLB G;  5GIO A;  5E26 A;  1Q18 A;  5M1O A;  3TTC A;  3VER A;  3P39 A;  3WT0 A;  3OBY A;  4U67 L;  3PIP L;  5EXW A;  3BEX A;  2VYP A;  2UYT A;  4IEE A;  1NWK A;  4WQ5 A;  3UE5 A;  1NJI O;  1MA9 B;  4AF1 A;  4OPH A;  1SZ2 A;  4IJN A;  4IXC A;  2QWL A;  4C1N I;  3ZX2 A;  3D2F B;  1BO5 O;  4CZI A;  3SLC A;  5FPN A;  2W41 A;  3TSP A;  3WXK A;  3BP8 A;  5JMV A;  1X3M A;  2F7T A;  1OKJ A;  1BG3 A;  2A3Z A;  4FWN A;  3MN5 A;  3CPE A;  4GVE A;  1Q81 O;  1VQ7 N;  1MWK A;  3RSE B;  3FLC O;  2NZT A;  1S72 N;  4M7X A;  1V4S A;  3T69 A;  2E88 A;  3ID8 A;  4EIA A;  3N4Q A;  2HBL A;  1HPM A;  3FZF A;  1JCE A;  3VEN A;  3ZEU B;  4FOE A;  2ZGZ A;  4DB3 A;  3UKU A;  2ASO A;  3QB0 A;  3FZL A;  4CZM A;  2ZJR L;  4G9Z A;  3LM2 A;  1TUU A;  3GE1 A;  5MLC Q;  3CD6 N;  3SAG A;  3L4I A;  3CJA A;  5CR4 A;  3CJ7 A;  3J7Z O;  2VCP A;  2OAN A;  2WFB A;  2ZWH A;  4JHD A;  1QVF M;  3A5M C;  4GV3 A;  4H5W A;  4BRP A;  3HM8 A;  3CI5 A;  1QZ5 A;  1Q7Y O;  3CET A;  1VQ4 N;  1YIT N;  3TSU A;  3O5B A;  4MO4 A;  4PHT X;  1NGB A;  2Q2R A;  1ESV A;  1GLF O;  5C2D A;  5JLH A;  1U6Z A;  3MK6 A;  3O1W A;  5M1Q A;  4M7Y A;  4CZH A;  2GWJ A;  3R3L A;  1KD1 O;  4H0Y B;  2V7Z A;  4O8K A;  3F2K A;  4BR0 A;  5KQ8 A;  1QQO A;  4AM6 A;  1IJJ A;  1ILY A;  1NGE A;  2FLO A;  3JS6 A;  3UKU B;  5KPZ A;  2BTF A;  3VEX A;  2YHW A;  4BQL A;  3NMU A;  2W40 A;  4F9O A;  1NGD A;  4IZ9 A;  2AA4 A;  4IOX A;  3CC7 N;  4ILJ A;  3K9K A;  4MLE A;  5EY4 A;  3EE8 A;  3SBG A;  1KXP A;  2FSN A;  3P38 A;  4C23 A;  4H0V B;  4CZE A;  1T6C A;  2P9S A;  3E9L A;  3H3O B;  3LDL A;  3KWG A;  4FPB A;  4MLH A;  2HOE A;  5BRE A;  5C0Y A;  4B1U B;  1QZ6 A;  2A6A A;  3VGK A;  3DAW A;  2QWM A;  4BQZ A;  1SQK A;  3H6E A;  1XUP O;  4B1V A;  1U2V A;  4QS9 A;  3KHY A;  3TSQ A;  4A5A A;  2NRV A;  3VEO A;  3CCR N;  3CCS N;  3WUH A;  3I56 N;  3CMA N;  2WC9 A;  3A0I X;  4FWK A;  3L6Q A;  2QWQ A;  3A8Y A;  3K9J A;  3GL1 A;  4B1Y B;  5DM6 L;  1MWM A;  2VGM A;  3MX5 A;  4Z94 A;  3VGL A;  4H5R A;  3U8X A;  3CCU N;  3CCJ N;  4JK7 A;  5AQQ A;  4JK8 A;  5LY3 A;  5GAG P;  2WBN A;  2JWL A;  1ATN A;  3ATU A;  1YJ9 N;  5AQG A;  3H1Q A;  2Q0R A;  2D4W A;  4FOI A;  3IDH A;  1SS6 A;  3H46 O;  2P9I B;  3CXC M;  4FWL A;  1GLL O;  1P90 A;  2ASP A;  3ID6 A;  3VF6 A;  4OO1 J;  4FWO A;  2V51 B;  4CD3 A;  5B8H A;  3CCE N;  2IVO A;  3CJB A;  1GLD G;  2ZJQ L;  3ZET A;  2HBJ A;  4A57 A;  4PKI A;  4AM7 A;  2Q0U A;  3N4P A;  2FXU A;  5AQX A;  1BDG A;  4WCE L;  5JVG L;  4BRO A;  3M3Z A;  4CZK A;  2IVP A;  4YOX A;  1YJW N;  1BOT O;  1MDU B;  3L0Q A;  4BRH A;  2QI2 A;  4WQ4 A;  1H1V A;  1S22 A;  2HBM A;  1DEJ A;  2FF6 A;  2PFU A;  2ZF5 O;  2FSK A;  3DXK A;  4H0T B;  3VTI A;  1J6Z A;  1BU6 O;  2D0P A;  1ZC6 A;  2NRH A;  1HUX A;  4JHD B;  4C1N K;  3S41 A;  1YXQ A;  4NLB A;  4WYB A;  3G6E N;  2QTD A;  2GTD A;  1Q86 O;  3C6H A;  2V52 B;  5EOY A;  4BC4 A;  3VGM A;  1K73 O;  3D2F A;  2HBK A;  4CJ7 A;  4BRN A;  2Q1N A;  1JCF A;  3DJC A;  4H5N A;  3TTF A;  3O9Q A;  5AFU A;  4BRA A;  1VQ6 N;  2HMP A;  2I7P A;  5AZJ A;  3SAF A;  3FGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...