3CETA

Crystal structure of the pantheonate kinase-like protein q6m145 at the resolution 1.8 a. northeast structural genomics consortium target mrr63
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
300
Chain Sequence
b'MILGIDIGNTKITELHENGEFKVHHLVSHVALVTTAETKKEGVDNILNAAESAFGSNISVFDSNGNFISLESAKTNNMKVSASNWCGTAKWVSKNIEENCILVDMGSTTTDIIPIVEGKVVAEKTDLERLMNHELLYVGTLRTPISHLGNTISFKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVAEKYGSKKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSFAVAELLKNELLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved archaeal protein
publication title Crystal structure of the pantheonate kinase-like protein Q6M145 at the resolution 1.8 A. Northeast Structural Genomics Consortium target MrR63.
rcsb
source organism Methanococcus maripaludis s2
molecule tags Structural genomics, unknown function
total genus 97
structure length 300
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01968 Hydantoinase_A Hydantoinase/oxoprolinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cetA01
3.30.420.190 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 conserved archaeal protein q6m145 3cetA02
5LJWA 3VEVA 1BU6O 3GOIA 4PKHA 4H5NA 4B1YB 3R6MA 1CZAN 1BUPA 1T6CA 5AQWA 3CJCA 4MO5A 3EL2A 3O4WA 5BN9A 4YDUC 4PL7A 3HM8A 3AAQA 3A5OC 3LDOA 4QS7A 5AQNA 1BA0A 1HUXA 4IJNA 3H45C 5AQRA 4IWVA 3O8MA 1ATNA 2NLXA 2P9PB 3HBTA 3BP8A 5AQPA 3ZX3A 2ASMA 4IZ9A 3ZX0A 3H46O 2VYPA 2E2PA 4FWPA 2Q31A 4FWLA 3CJ9A 4BGBA 5LY3A 4NO7A 1BO5O 2Q0RA 3FFKB 2D0PA 1RFQA 3I33A 4O5FA 2E2NA 2P9KA 2BTFA 3C0BA 5AZJB 3UB5A 5AQVA 4BG8A 3AY9A 3HTVA 2FSNA 5AQKA 3VEOA 4BG9A 4RCHA 1GLAG 3VEWA 2YJFA 3CETA 1XC3A 1Z6RA 1GLLO 4GY2B 3WQTA 1DKGD 2A40A 3M1FA 4GNIA 3M6GA 3H3OB 4B1WB 3DXKA 3WXIA 3U9ZA 4O8KA 2YHWA 4H0VB 3HSCA 4CZGA 5BRDA 3C7NA 4DQ8A 4JAXA 4YDUA 3MN5A 3R9PA 5AR0A 2GTDA 3H1QA 1X3NA 1HKCA 3VPZA 4XH5A 1NGAA 2A5XA 4BRAA 1KXPA 3DXMA 1ZXOA 3B8AX 3J8AA 3MN6A 1GLEG 1T6DA 2Q36A 2Q1NA 3MN9A 2QWRA 3D7EO 4WQ5C 4ISFA 3A5NC 3W0LA 2CH6A 2I7NA 4RTFD 1G99A 2FLOA 2CGJA 2GWKA 2D4WA 4BRCA 3EKSA 5E84A 3ULEB 4CZFA 3O80A 1E4GT 1BG3A 3A5MC 2HF3A 3UKUA 3U4LA 3WEEA 4DHYA 3L6QA 2A42A 2IVPA 5E26A 3IMXA 1XQSC 4H0TB 4BR0A 3L0QA 1SQKA 3DXMB 4M63C 2AP1A 4BR7A 4BRQA 2Q97A 1HPMA 4RWTA 5FPEA 3UKRB 1HKBA 3UE5A 1QZ6A 4L3QA 4FWQA 2YI1A 4BQZA 3TPQA 4FO0A 3MDQA 4M7YA 2D0OA 1RGIA 1MDUB 4BRDA 4CI6A 4CZEA 4Z94A 3FZFA 5AQHA 1EQYA 1NGIA 3VESA 4I6MB 3VEXA 1RDWX 4JN4A 4XEIA 3GDQA 2P9PA 2QWMA 3P4IA 5AQFA 1BDGA 3WQUA 4K41A 2CGKA 4WQ5A 3LDQA 2GUPA 2HOEA 3EKUA 2CH5A 4WQ4C 3S41A 1X9JA 4EAHD 1H1VA 3FLCO 2QXLA 3U8XA 3VEZA 5AZJA 3L4IA 4JNEA 3CJ1A 3BUZB 4AM7A 5ADXH 3DWLA 3JXUA 4QS9A 1P8ZA 3IDHA 3CJBA 2CGLA 3KHYA 4B9QA 4CZHA 3LL3A 3QDKA 3SLCA 1IJJA 3LM9A 1C0GA 1NGEA 3FZLA 3JS6A 2V7ZA 1GLBG 5AFUH 1KAZA 1ZBSA 4JHDB 1ATRA 5AQOA 5BREA 4ISEA 1IG8A 3OHRA 5AQTA 4BROA 2FXUA 4XH1A 4CD3A 3AAPA 3VGMA 4BVPA 5EOYA 5AQMA 5JMVA 1HX1A 4H5WA 5FPMA 5BRHA 3SMPA 2Q0UA 5EVZA 2IVNA 2P9LB 3FZHA 3HZ6A 4B1XB 3VF4A 4FWMA 4FWRA 3VERA 3MK6A 4Y0WA 1GLJO 3EO3A 4F9OA 4EHTA 4A2BA 1YAGA 3CERA 4FPAA 2D1KA 2HMPA 4J8FA 1K8KB 1NWKA 4WYBA 2GELA 3D2FB 3VF6A 4WQ4A 4H0XB 2E1YA 4BGAA 4FOIA 4C23A 3D2EB 2QWNA 4JD2B 3ULEA 4FWSA 1NGCA 4NB4A 1GLDG 2BUPA 3LDPA 1X3MA 3VENA 3CI5A 5FPDA 1NGBA 1DEJA 2V51B 4BRHA 5CE3A 3QFPA 1NLVA 1S3XA 1Z05A 1C0FA 1NGGA 1U2VB 4BRLA 1ZC6A 3G25A 4K43A 4BREA 1TUYA 1NGJA 5I9EB 4CZJA 4FWNA 1MA9B 4KBOA 3UKRA 4K25A 3U9DA 4BR2A 3DJCA 1JCGA 4PL8A 5KPTA 1WOQA 3GE1A 3O1BA 1R59O 3R8EA 3CJ7A 1V4TA 3DAWA 3FE1A 5AQJA 4BR9A 1GLFO 3MN7A 3SK3A 4BRIA 2IVOA 2QM1A 3AARA 3FZKA 2H3GX 1YVNA 3HI0A 2I7PA 3O5BA 4FPBA 2ZGZA 3W3DA 3GBTA 1NGDA 4I6MA 1QQNA 4CZKA 1HJOA 4BRFA 2ASPA 3LDNA 3LM2A 4CZIA 1YUWA 3BF3A 2A6AA 2E20A 4H5VA 4H5TA 5AQLA 1NM1A 5B8HA 3FR0A 4H5RA 3H1VX 4DB3A 5JLFA 5TKYA 2V7YA 3ATVA 4FWKA 1HLUA 1LCUA 2YCHA 4MLHA 3KVGA 5EY4A 5F2RA 5ELZA 4BRGA 2F9TA 5BPMA 2QWOA 5AZIB 3SMSA 4M7XA 4PKIA 5AQXA 2P9NA 3A0IX 3O08A 5JLHA 5BPLA 1QQMA 1BA1A 1QZ5A 2QWLA 2AA4A 4FSVA 4K42A 3VGKA 4H0OA 1U6ZA 2YJEA 3ZETB 3H3NO 3A8YA 3QBWA 4CZMA 5KQ8A 2W41A 3RSEB 3FZMA 3ATUA 2ZWHA 1D4XA 2P9SB 4BRNA 3QFUA 2NRHA 5AQUA 4BRMA 3CQYA 3H6EA 4JHDA 4IXCA 2J4RA 4E1JA 2YHYA 2P9NB 2ZGYA 3IFRA 3O1WA 2P9IB 5BPNA 3WXLA 4BC5A 1T44A 4H0YB 4BR4A 2PAVA 1KAYA 2P9UA 2P9LA 3QBXA 1TYQB 2Q2RA 1BOTO 4MLEA 3QMLA 3GL1A 1S22A 2QW9A 5EX5A 2UYTA 5EXWA 1E4FT 2A3ZA 5BRFA 1LOTB 1HKGA 2GEMA 1K8KA 2YHXA 3D2FA 1Q18A 4EHUA 5F1XA 5KPRA 1WUAA 1KAXA 1NGFA 1JCEA 4LC9B 3D2EA 4JD2A 3WUHA 5KPZA 4QS8A 3CJAA 4EIAA 2P9UB 4CZLA 1JCFA 2FSJA 2KHOA 4XH4A 5AQGA 3VETA 2QWPA 3CIPA 1U2VA 2ASOA 2W40A 1QHAA 4ISGA 3EN9A 2E2QA 3LDLA 3WXKA 3MMVA 1OKJA 2HF4A 1NBWA 1TUUA 1MWMA 2QWQA 3GG4A 3ID8A 2ITMA 4DCHA 5AQYA 2E8AA 4CJ7A 2PBDA 4A61A 1J6ZA 1NMDA 4HTLA 2P9KB 3O6WA 4PKGA 5ADXA 2V52B 2E2OA 1DGKN 2A41A 3F9MA 4IO8A 4BRKA 3CQXA 2DPNA 3IUCA 4CBUA 2IIRA 3ENOA 1MWKA 3KZBA 5AFUA 3WXJA 4BC4A 2E1ZA 4EFHA 4HWIA 3A5LC 4BVOA 4H0PA 5F0XA 1V4SA 3DXKB 5AQIA 4BQLA 2FSKA 5AZIA 3VEYA 4FOEA 3C7NB 4CD1A 4H03B 1ATSA 3ZEUA 4BC3A 4FWOA 3TU5A 5FPNA 2NZTA 3ZETA 4B1VA 3BEXA 5KQDA 3RSEA 3VF2A 4BRPA 4BC2A 2WUSA 1SZ2A 2ZF5O 1ESVA 3EZWA 2P9SA 2EWSA 4AM6A 4MO4A 1SAZA 3M3ZA 3SJHA 4CBWA 4A2AA 3ZX2A 5AQZA 3ENHA 3QICA 4BR5A 1BWFO 3CHWA 3ZEUB 2P9IA 3FGUA 4CBXA 3WT0A 4A62A 2E88A 3BF1A 1NGHA 4B1UB 1GLCG 5AQSA 5BR9A 3QB0A 5AQQA 3VGLA 4FL9A 4B1ZA 5LJVA 2OANA 3UKUB 1Y64A 2F9WA 2FF3B 3WEEB 2VWBA 3I8BA 3MCPA 3VOVA 1QQOA 2VCPA 2FF6A 1TYQA 1YXQA 5BN8A 4IJAA 1XUPO 5JICA 2GWJA
chains in the Genus database with same CATH superfamily
3VQ4A 4KH6A 1TK5A 2XY6A 1BUPA 5CR4A 1BIUA 4FJNA 4DV4K 3CXCM 1JLQA 4E7HA 1RBRA 1SKRA 2JWKA 3EL2A 1RNHA 1OH7A 4M3ZA 4B3MK 3MWTA 1LW2A 3AVNA 3HM8A 1VSHA 1O1WA 3VTIA 4C1NI 3VQAA 1KTQA 5LL6Z 1X1PA 4F8RA 3PIOL 4O5BA 4CHZA 4JI5K 5AQPA 3THYA 4YOVA 4IZ9A 3ZX0A 4FW1A 2VYPA 3NF8A 4A5BA 1IBLK 4CJ3A 5LY3A 4NO7A 2WONA 1TK0A 1RFQA 4DV5K 1ITGA 3T69A 1L3UA 1U04A 3HTVA 2VWJA 1LAWA 4BG9A 1GLAG 4CFCA 3OYDA 4DTPA 3CM6A 1B9FA 1QSSA 5MLCQ 3I8DA 1D5AA 1GLLO 4GY2B 1W9HA 3ZSVA 1NJIO 4X65K 2FBYA 4YORA 3M6GA 3VQPA 3C95A 3DXKA 4B1WB 1RBUA 4CHOA 3AVIA 3HT3A 4IOAL 4JKGA 1TKTA 3HSCA 5BRDA 4KREA 1SKSA 4DQ8A 2QKBA 4G9ZA 4YDUA 5M1QA 3MN5A 1XNRK 3H1QA 5CZ1A 1X3NA 5FRNA 5BR8K 1HKCA 3VPZA 1TVRA 4DFMA 2A5XA 4N47A 3DXMA 4DFKA 4IKFA 4GV6A 1GLEG 2Q36A 3LZIA 4WQ5C 4FJ5A 1VQPN 3A5NC 3SUOA 4RTFD 4K0KK 1OH5A 2FLOA 1YITN 2GWKA 2VGNA 4B9SA 3NCIA 4I9QA 4I7FA 4FLWA 3ULEB 4CZFA 1S6QA 1VQNN 2HF3A 2W6KA 3U4LA 3L6QA 3IG1A 2WOMA 2KFZA 3BY5A 4H0TB 5KI6A 2HHSA 2Z1JA 3QETA 4CIFA 2IOCA 1X9SA 4FW2A 3UKRB 1BHLA 1HKBA 4O0JA 4RG8A 4CECA 1EX4A 4HUFA 3ITHA 3DI6A 2YI1A 5C12A 5M1FA 2NRXA 4KO0A 3ZYYX 3SUQA 1BIZA 3MDQA 2YKMA 1RGIA 1MDUB 3G71N 3SI6A 5AQHA 1EQYA 1NK9A 3VESA 4AHUA 1RTIA 1ASVA 4XEIA 4FCYA 3L3VA 1VAZA 4ZTFA 4FK4A 4K41A 2CGKA 3K58A 2X6NA 4LFAK 3I0RA 3LDQA 5KGWA 2HOEA 2HHTA 4GV3A 3EKUA 4EAHD 3OYKA 1H1VA 1QSYA 1QHTA 1HNZK 4UQGA 3U8XA 5AZJA 1BL3A 3QNNA 3CJ1A 4NXNK 1JXEA 1I94K 3DWLA 3JXUA 3IDHA 1QE1A 2CGLA 4CZHA 3QDKA 3SLCA 1C0GA 3FZLA 1KRPA 2KTQA 3CYMA 1ATRA 5JVHL 1VSFA 1W2BM 5EU7A 2JWLA 5C0YA 4ISEA 1IG8A 2FXUA 3ZT2A 4HTUA 3V9SA 3THWB 5EOYA 3KLFA 1IKXA 1OVYA 2I5JA 3QERA 2P9LB 3HZ6A 4FWMA 4DMNA 3F5TA 3EO3A 1KVBA 4F9OA 4A2BA 1YAGA 3TAMA 4J8FA 3AVKA 4C8KA 2DFFA 3HOTA 4BGAA 4FOIA 4JD2B 2QWNA 4N76A 3QO9A 3O9SA 2BH1A 4KPYA 4NCAA 1S72N 1Z05A 2ATQA 4CW7B 1C0FA 1NGGA 1U2VB 4BRLA 3NVKA 4ID1A 3VQEA 1YHQN 4KBOA 3SYZA 4CCHA 3KD5E 2E6MA 1J5OA 3CJ7A 1V4TA 1HYZA 4GW6A 4A59A 2QM1A 3FZKA 4BE2A 3HI0A 2O4IA 4NXMK 3O5BA 4JV5K 2NRVA 4CGJA 1U47A 1NGDA 3M8PA 2EHGA 5C2FA 4BDYA 1RTJA 2E20A 3OBWA 4H5TA 3DLKA 3FR0A 4WCEL 2V7YA 2G8VA 4LY7A 4DLEA 4FWKA 1S5JA 4MLHA 4BRGA 5BPMA 1NKEA 4M3YA 2P9NA 3A0IX 3O08A 5JLHA 5BPLA 1QQMA 4FLUA 5HROA 2QWLA 1NOZA 3WNGA 4E7KA 4OGEA 3ZETB 3ZT0A 3H3NO 4CZMA 3QBWA 1QTMA 1TKZA 2HB5A 3SPZA 3FZMA 4CERA 1UA1A 3ATUA 3SCXA 1IG9A 1NJWA 3QFUA 4ELTA 2NRHA 4BRMA 4DR1K 4E7LA 4ZHRA 1A5XA 3AO4A 4J2AA 2ZGYA 3PSFA 3O1WA 4DFJA 4DUZK 1NKCA 4DR4K 1YT3A 1RDUA 3MXJA 2WFBA 3BGRA 4N56A 2P9UA 2HBKA 3QBXA 2Q2RA 3B6PA 1C0MA 2O8EA 1P90A 1LOTB 4BACA 3CG7A 3IAYA 1K8KA 4EHUA 5F1XA 4YOUA 5KPRA 5CZ2A 1JCEA 3AA5X 4LC9B 3D2EA 4F3TA 3QIOA 4EIAA 4CZLA 4DSFA 5AQGA 2KHOA 5GIPA 3DLBA 4K8ZA 1KLNA 1XI1A 3CIPA 1S9GA 3DRSA 3OYCA 5TKWA 4AQYK 4Z4CA 4Z4IA 1LW0A 3O3FA 4X64K 2E2QA 1OKJA 1A5VA 4KHPK 1EO1A 2QWQA 5HP1A 4IG3A 1NKBA 4IDHA 4AHVA 2KZZA 3MX5A 4WFBL 3P83D 1NMDA 2W6LA 3DOKA 4CF2A 5ADXA 3QNOA 3PY8A 3ENBA 3C94A 3MECA 4CJEA 2A41A 3F9MA 4IO8A 4BRKA 2DPNA 3IUCA 2YNFA 2IIRA 4KHYA 2PFUA 3KZBA 5AFUA 5C25A 1XMQK 4EFHA 5C10A 3HP9A 4BVOA 3KLEA 4CJ4A 3DXKB 4DQIA 4RW9A 4BQLA 2VQFK 3KWIA 5AZIA 4LSLA 4JKGB 2Y1IA 4CFDA 3Q7CA 1GOBA 3ZEUA 2Z1HA 4KAZA 3S3NA 1ZYQA 2E5LK 4CFBA 3RRGA 1VQ9N 3AVAA 2OZSA 2HHVA 4BE0A 2KZMA 1LWFA 4C8OA 3VN5A 3SJHA 3CM5A 4CBWA 1SS6A 4A2AA 2RKIA 3ZSXA 3WNFA 3ENHA 4AHRA 2YX6A 4NCGA 4EP4A 4DTSA 3SQ0A 3BF1A 4KKOA 3C6TA 5BR9A 4OKEA 3QB0A 4BE1A 5AQQA 3HPOA 5LJVA 2OANA 2F9WA 2FF3B 1VQ4N 2VWBA 3I8BA 5IWAK 1Z25A 3NGYA 3QIPA 4DR2K 1TYQA 1NJZA 5BN8A 1HR0K 4JI4K 4FK0A 2IGIA 5K14A 1Q8IA 2VG7A 3GOIA 3K5LA 4FLZA 5HLFA 1VQKN 1T6CA 1XC9A 4DU4A 2ITGA 4YDUC 2WBNA 3AAQA 3E66A 4X62K 1FW6A 4HCBA 2VGMA 3HPGA 4IJNA 2O4GA 5AQRA 1M90O 1ATNA 4KTWA 3SQ2A 3BP8A 3KLHA 1HMVA 3H46O 4CFAA 2Q31A 4B9UA 3L3UA 4IG0A 4BGBA 4WF9L 3HVRA 3BZKA 2P5OA 4FZZA 2O8CA 3I33A 2BTFA 5AZJB 3V9XA 3UB5A 3AGRA 4FJ7A 3AY9A 3E9PA 2QI2A 3K9KA 4RCHA 2YJFA 1C0TA 1JLGA 1HQUA 3CETA 3DLHA 3H3OB 3WXIA 3CQ8A 4YY3K 2HHUA 3HO1A 3C6AA 1C6VA 4H0VB 4CZGA 4JAXA 1QQCA 3OJSA 2GTDA 2RN2A 3NHGA 3I55N 1WSJA 4A5AA 1JLFA 4BY9C 1NGAA 3T3FA 4FJ9A 4TSXA 4KHWA 4BRAA 3KJVA 1KXPA 4ILJA 3B8AX 3ZLJA 5HBMA 2Q1NA 4YOTA 2A1RA 5GAHP 4I2PA 3F2KA 2QWRA 2YKNA 3D7EO 3OYFA 2PYJA 2CH6A 2I7NA 1G99A 4FYDA 4FM2A 1EWRA 1OVQA 5E84A 3O80A 3RR8A 3VQ8A 4DSLA 3LPUA 1W0HA 1VHXA 1VQ6N 3IMXA 3ZSRA 1XQSC 4BR0A 4Z4EA 4M63C 1S1XA 1SUQA 2Q97A 4LH5A 2HVHA 3HSTB 1RTDA 2P5GA 3MEGA 1ASWA 4CGIA 3VA0A 3DLRA 4EP5A 4B9VA 4FJHA 4DQQA 3UE5A 3CC2N 1N33K 3DOLA 4JKDA 3ZSOA 1WN7A 3WXMB 3ZCMA 3TWHA 5I3UA 4FK2A 3V9WA 3NH0A 1RILA 3TPQA 3DRRA 4CZEA 1L3VA 1NGIA 4RW7A 1ASUA 3VEXA 1KVCA 1RDAA 1VQ8N 4JN4A 3NH1A 2P9PA 5HRRA 1HRHA 3G10A 3JAMO 3AO5A 4Z4FA 2G8UA 4J2EA 1BDGA 3E9OA 1JLBA 5DM6L 4LF7K 3VQQA 3NBPA 2YV0X 4ILGB 3FLCO 4KHNA 1J9AA 2QXLA 3THXA 1NU0A 1NK4A 3CMAN 3CJBA 3KHYA 3PX4A 4CF0A 1N32K 4JI7K 4UY8O 4XIUA 3LM9A 3D0PA 1KLMA 3OYMA 3PLAA 4BDPA 3P38A 3NDKA 2XRIA 1ZBSA 1FKOA 1D9FA 5BREA 4BROA 4KV8A 4XH1A 3AAPA 3QINA 4KH5A 3CFPA 1KVAA 4CF9A 5AQMA 5JMVA 4H5WA 3TAGA 1JL2A 3FZHA 3OYJA 3VQ7A 4DTJA 3SBTA 3VERA 4CEDA 3OYLA 2IAJA 4EZ9A 3D45A 1GLJO 2O8EB 4FJLA 4DV6K 4AH9A 4GKJK 1G15A 3CERA 2OTLN 3OY9A 1K8KB 1NWKA 4WYBA 1Z26A 4NLBA 1NMNA 1RDBA 1QS4A 4CJUA 3D2EB 3CCEN 3LDPA 3VENA 1LWCA 1NGBA 1DEJA 1HNIA 4OJRA 2V51B 3NAEA 3OYHA 4FLXA 3SUNA 4V19S 4HUEA 3G25A 4K43A 4CK1A 3NGZA 3OYIA 1TUYA 5I9EB 4FWNA 3VQBA 1WSGA 3V1RA 4QOZB 1M1KO 1IBKK 3VQ5A 3SK3A 4DS5A 3TSUA 2H3GX 2X6SA 2I7PA 2OA8A 2HHXA 2ZGZA 3W3DA 1SKWA 1RCHA 4DLGA 4E3SA 1QQNA 1T7PA 4YFUA 4BRFA 3LDNA 3LM2A 2OPRA 1Q81O 4AF1A 4FM1A 1Q86O 1TAQA 4H5VA 4H5RA 3H1VX 5TKYA 4DTOA 2YCHA 1KD1O 1BCOA 4GKKK 2W42A 5F2RA 1BI4A 2F9TA 3HM9A 2QWOA 5AZIB 1SL0A 4M7XA 4PKIA 3JSMA 1BA1A 4DU3A 3SNNA 4FSVA 1S9EA 4H0OA 1U6ZA 3L4QA 1REVA 3A8YA 1C1BA 1XHXA 2G8IA 5HOOA 1S1TA 4PQUA 5M1PA 4DS4A 4JI6K 1KC8O 4CGGA 4BRNA 1TV6A 1W7AA 3PUFA 3CQYA 3H6EA 5J2PA 4E1JA 4CGHA 3CCMN 4DF4A 5BPNA 3WXLA 4YOYA 3NF6A 1T44A 5JS2A 4CEBA 1WBDA 1TAUA 4BR4A 2PAVA 2XO7A 1YJ9N 3ULDA 4DTRA 4JI8K 2Y1JA 1TYQB 4N5SA 2UXCK 2HNZA 5GADP 1IKWA 3OYEA 3QMLA 3GL1A 1S22A 1S1VA 4JKEA 3U3YA 5EXWA 1E4FT 3IS9A 2A3ZA 4IEIA 3M8RA 2HHWA 3D2FA 3SV3A 1FK9A 4Z4GA 2O8DA 1NGFA 4CF8A 2HNDA 5KPZA 3WUHA 4B9NA 4CHYA 1U49A 4KTZA 2FSJA 3EEQA 1UWBA 1HNWK 4IFVA 4YHHK 3BDPA 2ASOA 4MQ3A 4CJRA 1SL1A 4DV2K 1I39A 2B6AA 2VG6A 1QHAA 4CJTA 4OLBA 1NBWA 2UUAK 3U6FA 1MWMA 1E3MA 5GAGP 4W5TA 4FJJA 5SZTA 2PBDA 3HXMA 1XHZA 2O8CB 1J6ZA 1QVGM 2G8WA 4PKGA 1TGOA 2V52B 2E2OA 1B9DA 1DGKN 2VG5A 1HQEA 2YNGA 3M8SA 3AVGA 1C1CA 5FRMA 3SAHA 4CBUA 3CF5L 3ENOA 4M41A 5J2MA 1BGXT 3WXJA 4M3XA 3KK2A 3KLGA 5HRNA 5SWMA 4H0PA 5F0XA 4IFYA 3NFAA 4KHUA 1YTUA 5CHIA 4DV3K 3K9JA 4H03B 1ATSA 1XWLA 3RRHA 1Q82O 4E89A 3BEXA 3OYBA 4F4KA 3LAMA 4JK7A 4FJGA 3T7ZA 3RSEA 3VF2A 3DLEA 4CHPA 4BC2A 2WUSA 3ISNC 1ESVA 2P9SA 2VWKA 3G4SN 4AM6A 3TTFA 4RW4A 1YI2N 1VSKA 1BWFO 2X78A 3CHWA 4LF8K 1NGHA 4ILHA 3TABA 4BWJA 3VGLA 4FL9A 4B1ZA 2P51A 2RPIA 4JKCA 3F9KA 1L5UA 3VOVA 1JJ2M 2VCPA 2BANA 4IJAA 3I56N 1YTAA 3VA3A 1BU6O 1UOCA 3TTCA 4H5NA 3R6MA 3QEPA 1CZAN 4IBNA 4OPAA 3RVCA 3CJCA 5FDLA 5BN9A 1UAXA 3EE8A 3LP2A 2XY8A 3A5OC 3K5MA 4DQRA 4LF4K 1ZBUA 3LDOA 1WNSA 4CJSA 3H45C 4OO1J 4IWVA 4DSIA 3T1YK 2P9PB 3HBTA 3I0SA 2E2PA 3KWGA 3CJ9A 3HL8A 2QTDA 4CIGA 2NNWA 4CEEA 3AVMA 3FFKB 4CJFA 2P9KA 3THXB 3L2RA 3CCVN 3EY1A 1T03A 3VEWA 3THYB 4B9LA 1XC3A 5H1SQ 1Z6RA 1ZBIA 1DKGD 1RTHA 3L2VA 3QEWA 4B3SK 3MXIA 4CK2A 1S1WA 1ZBHA 3J7ZO 4O8KA 2QK9A 2YHWA 3OYAA 3MXMA 4JKAA 3C7NA 4JRPA 3P31A 1Q9XA 1KFSA 3T19A 4CK3A 3V9ZA 1QSLA 3R9PA 4E19A 4H4MA 3OS1A 3LPTA 4BDZA 5CYQA 2ZE2A 3AVJA 4CJPA 3AO1A 1ZXOA 3MN6A 3QESA 3O3GA 3RR7A 3MN9A 3LWLA 4ISFA 3W0LA 4GVEA 4Y1DA 2UXDK 4OPKA 4HHTA 1TK8A 5A2QO 4K8XA 2D4WA 3OTOK 3MEEA 1E4GT 3A5MC 3E1YA 5IT9O 4DHYA 3WEEA 5GAEP 4WFAL 5HRSA 3OW2M 2KKZA 3L0QA 3IRXA 3DXMB 4M45A 3O4QA 4BRQA 2OZMA 1HPMA 3O9QA 4B9TA 3S3MA 5FPEA 5FROA 1EKEA 2OYQA 2KFNA 3P39A 1QZ6A 2D5RA 4L3QA 2RF2A 4IFEA 4DTXA 2D0CA 4BQZA 4F2RA 2O8BA 1VQ7N 2D0OA 3H08A 4G1QA 2YNIA 4BRDA 4Z94A 1NK7A 3C6HA 1RBTA 2YNHA 1RDCA 1RDWX 3GDQA 2D0BA 2QWMA 1B92A 3P4IA 2BGGA 3K59A 3OS2A 1VQMN 3PX0A 3EZ5A 3TARA 4DV1K 2OPQA 1BISA 2CH5A 2UU9K 1X9JA 4DV7K 4AHCA 4M3WA 1BI4B 2ZJQL 3VEZA 3C65A 3L4IA 1QVFM 1Q7YO 1EP4A 3LANA 4QS9A 4KB1A 1P8ZA 3AVCA 4YNQA 3AO3A 5C2DA 3LL3A 2ZM6K 1NGEA 3V6DA 3SPYA 4F2SA 5GINA 5M1OA 5LMNK 3KKSA 2ETJA 4M3TA 1RDDA 4Z0UA 1WSIA 3CFRA 2ZQBA 1YF5L 1X9MA 3VGMA 2NRWA 1RBVA 4OKJA 4PHTX 1VSMA 5FPMA 5CY4A 3AO2A 5EVZA 1N34K 2IVNA 4B1XB 1W97L 3VF4A 3L2QA 3RMCA 4FWRA 2RHKA 3MK6A 4Y0WA 4FXDA 3NVMA 3K57A 4EHTA 2D1KA 1ZBLA 4OGCA 3OYGA 2QA4N 4B3RK 3D2FB 4O8UA 2Z1IA 4WQ4A 2O8DB 3CPEA 4C23A 5KTQA 2KQ2A 3CCLN 4NB4A 2BUPA 1U48A 3CI5A 5FPDA 3UIQA 2GV9A 4M3UA 5CE3A 3QFPA 4Q0BA 1NLVA 2VQEK 3HRGA 1ZC6A 4DR5K 4BREA 1HYSA 2PZSA 1NGJA 4DR3K 1NK6A 3U9DA 4BR2A 1JCGA 4PL8A 3B6OA 1S1UA 3GE1A 3AGKA 4LFCK 1IKYA 1TL3A 3FE1A 5AQJA 4BR9A 3SUPA 1GLFO 3MN7A 4DFPA 5J2QA 1YVNA 2NRRA 3AA2A 5KRSA 1XNQK 3AVFA 2F8TA 5KGXA 3HOSA 4I6MA 2HBMA 2ASPA 3PIPL 3L2WA 3VQ9A 1YUWA 1KFDA 2A6AA 1KCFA 3OJUA 1RT7A 2F7TA 1J53A 3VQ6A 5JLFA 4DR6K 5DM7L 4HVJA 1LCUA 3KVGA 4I2QA 5EY4A 5JVGL 5ELZA 1HPZA 4B9MA 3SMSA 5AQXA 1WSFA 2LSNA 1QZ5A 3THVA 2AA4A 4K42A 3VGKA 4KB0A 2YJEA 3RSEB 4CJQA 2EX3A 2DTUA 4J2DA 2ZWHA 1D4XA 2ZD1A 1EETA 2P9SB 4FJXA 5AQUA 1N8RO 3LAKA 4JHDA 4IXCA 1VRTA 1ZBFA 4JI3K 2P9NB 3ZSWA 3K5OA 4AHTA 2UUBK 2G8FA 4DTMA 4LF9K 4HUGA 3F73A 4OKKA 3KKRA 3KK1A 3HJFA 4YOXA 3KD1E 1N5YA 3G6EN 1JXBA 4DSJA 1BOTO 1DTTA 4MLEA 3J81O 3M8QA 2QW9A 5GIOA 4JI2K 3VMFB 1YIJN 4ICLA 3ZT3A 1Q18A 1TL1A 4CGDA 4DKWA 1GOAA 1WUAA 3SQ1A 4CEZA 4LSNA 2P9UB 1JCFA 3MX2A 3OBYA 4BWMA 4XH4A 3K2PA 2HNYA 3KK3A 5CYMA 2R7YA 1F21A 1J54A 4FVUA 1GOCA 5J2NA 4OPJA 2HF4A 1TUUA 3J7YP 3P1GA 4JK9A 3V1QA 1FJGK 4DCHA 2E8AA 1JLAA 4CJ7A 2D0AA 4A61A 2B4JA 4IEEA 4NYFA 2P9KB 3O6WA 1R0AA 4FZYA 1NJYA 2E6LA 4JLHA 3OVNA 4CEOA 4O4GA 4KHQA 3CD6N 3KK7A 1XMOK 2O8FA 1MWKA 3KIOA 1HYVA 2DY4A 4BC4A 2F96A 2E1ZA 2UUCK 4HWIA 3EYZA 1NK0A 4DWIA 4KFBA 1J5EK 5E41A 3ZSYA 5HRPA 5AQIA 1T3VA 2DFHA 2FSKA 3VEYA 3O9RA 4C8NA 3ID6A 3C7NB 4CD1A 4BC3A 4PWDA 3TU5A 2NZTA 4B1VA 2FBXA 3ZSZA 1DLOA 5KQDA 1UA0A 3AVHA 2JGUA 3AVBA 1SL2A 3VQCA 2Z1GA 3TAPA 3QLHA 3VQDA 1OH6A 4MO4A 3M3ZA 1VSDA 3O3HA 1K73O 4DG1A 1NOYA 3ZEUB 3JYTA 2P9IA 3FGUA 4A62A 4PUOA 1X9WA 4RW8A 1GLCG 5AQSA 2GBZA 3RWUA 4CVNE 1NK8A 4OLAA 1Y64A 3V4IA 3WEEB 3TAFA 3MCPA 3ZT4A 1VQON 4CJWA 4R79A 2FF6A 2QXFA 1YXQA 4DF8A 4W5OA 4PY5A 3LWMA 4ELUA 2GWJA 5LJWA 1KQSM 3VEVA 1RT1A 5C42A 4M3RA 3TAEA 3CCQN 1Y97A 2HBJA 4PKHA 3RMAA 3FFIA 1JLCA 4B1YB 1A5WA 4NCBA 1DT9A 4DTNA 5AQWA 4MO5A 3VTHA 2BE2A 1IH7A 2O8BB 1I3AA 3O4WA 1WLJA 4PL7A 2HW3A 3D6RA 4X66K 1JLEA 5KRTA 4MDAA 4QS7A 5AQNA 1BA0A 2UXBK 1HUXA 3LP3A 3O8MA 3TANA 2NLXA 3NE6A 3ZX3A 2ASMA 3DYAA 3LP1A 4JKBA 3V9UA 1VSIA 4FWPA 4CJKA 4FWLA 1YJNN 2YHAA 2F4VK 3HVTA 1RT2A 1IBMK 1BO5O 3HPHA 4FJMA 4CEAA 2Q0RA 2P1JA 2D0PA 4O55A 4O5FA 3N4QA 3HP6A 2E2NA 3C0BA 1NJXA 4NYNA 3K0SA 4ELVA 1U45A 5AQVA 4BG8A 3VEOA 5AQKA 2FSNA 1T8EA 2HHHK 3T1HK 4LF5K 2KW4A 4IDKA 4B8CA 1CXQA 2QEXN 4CEFA 3QEXA 1C1AA 3WQTA 4DTUA 2A40A 3NF9A 3M1FA 1HNVA 4GNIA 3SAFA 4FLTA 2HHQA 4IOCL 1NNEA 4NLCA 3U9ZA 4YOWA 3K5NA 3SAGA 5I42A 4FJ8A 3T1AA 5AR0A 1BQMA 1JL1A 3N4PA 4XH5A 1VQ5N 3QEVA 3J8AA 3O9TA 1T6DA 4QCLA 3TAQA 3KLIA 1FKPA 4KRFA 3L2UA 2IS3A 2CGJA 1WAJA 4BRCA 1WAFA 3EKSA 4O0IA 1BG3A 3UKUA 4DSEA 3MCAB 3CMEN 4GVMA 3LZJA 4J2BA 4CIEA 2A42A 2GUIA 2IVPA 1IKVA 4OPHA 5E26A 1SQKA 4R5PA 2AP1A 4BR7A 3AA3A 4U67L 4RWTA 4B08A 4FWQA 3SZ2A 3SQ4A 4DSKA 5T7BA 3PV8A 5D3GA 5J1EA 1MU2A 1VRUA 2HVIA 1RBSA 4FO0A 4CJLA 4M7YA 5M1KA 4KI6A 2NRZA 4FVMA 1N36K 4DUYK 4CI6A 2RE2A 3FZFA 1CZ9A 4CEQA 1VQLN 2F8SA 4JI0K 4I6MB 4Y1CA 4FM0A 1RT3A 4ID5A 1K9MO 3LP0A 5AQFA 3J7AP 3SJJA 3WQUA 4PA1A 4WQ5A 2GUPA 4WQ4C 3S41A 1LAVA 1RT4A 4M42A 3J80O 1VSEA 2JLEA 4WFNL 4JNEA 4FJIA 3BUZB 4AM7A 4B3OA 5ADXH 3MAQA 3ASMA 4B9QA 3DM2A 3KTQA 4ZTJA 1IJJA 1TKXA 3JS6A 2V7ZA 1GLBG 5C24A 4KH4A 5AFUH 2HSTA 4CF1A 4F3OA 1KAZA 4JHDB 4HCCA 5AQOA 4CJVA 3R1XA 1WSEA 2E4LA 1ILYA 4LD0A 4RW6A 5AQTA 3OHRA 4C8MA 4CD3A 1HNXK 4AILC 3WNHA 4BVPA 5FLXO 1HX1A 1LWEA 1BQNA 3CC4N 4OX9K 5BRHA 3SMPA 2Q0UA 2B5JA 4JKHA 3SBGA 4FPAA 4E0DA 3TTDA 3NMUA 1D8YA 2HMPA 2HBLA 3CCJN 2GELA 3VF6A 2WTUA 4H0XB 3PX6A 2E1YA 3PO5A 1VSJA 3TI0A 3ULEA 4FWSA 1NGCA 2NUBA 1GLDG 2PYLA 2IDOA 1N6QA 1X3MA 2PY5A 3TSPA 3EE9A 4BRHA 3R3LA 4O44A 4H4OA 1S3XA 1WB9A 4CJ5A 3E9LA 2OCEA 4CZJA 1MA9B 1VK0A 3UKRA 4K25A 3DJCA 3O4NA 5KPTA 1IV0A 1WOQA 3OS0A 3O1BA 1R59O 4I9LA 4MDBA 3R8EA 3ZT1A 3CCRN 3DAWA 3LALA 3S3OA 2G8HA 2YHBA 3NF7A 4BRIA 3DLGA 2IVOA 3AARA 4DR7K 1WBBA 3RTVA 1LV5A 1U4BA 2IC3A 4FPBA 3NH2A 3MEDA 3GBTA 4IOXA 4L8RB 5M1NA 4FZXC 4B3TK 4CZKA 1HJOA 4CZIA 1L3TA 2FBVA 3L8BA 2O8FB 4WE1A 3BF3A 3G0ZA 5AQLA 1NM1A 4EZ6A 3ZSQA 5B8HA 4DB3A 3ATVA 4C1NK 1HLUA 3DMJA 4CE9A 4FLVA 2OPSA 4KHSA 3C6UA 3CCSN 4C8LA 1OH8A 4FLYA 3V81A 2AJQA 5LMUK 1CXUA 2XY7A 4LF6K 3CCUN 4E7IA 3HYFA 5KQ8A 3LDSA 2W41A 1CLQA 2Q3SA 1Q9YA 1EXQA 5JS1A 1IO2A 1RT5A 2XHBA 3V1OA 2A1SA 3U3GA 2J4RA 1NK5A 1NG9A 3E01A 2YHYA 1DTQA 3IFRA 1K6YA 2OPPA 1CZBA 2P9IB 3DRPA 3O9UA 4BC5A 3Q7BA 4JS4A 3CC7N 3THWA 5HL7L 4KTQA 1VSLA 4DQPA 4H0YB 1KSPA 4LFBK 1YJWN 1KAYA 2P9LA 1TKDA 4QAGA 3P5JA 3ALYA 4JS5A 4OVLA 1EWQA 3TSQA 5EX5A 2QKKA 2UYTA 5BRFA 1T05A 1HKGA 1JKHA 2GEMA 2YHXA 3CPWM 1RT6A 1KAXA 1C0UA 2ZJPL 4JD2A 4IO9L 1FXXA 2FC0A 4QS8A 3CJAA 5DMRA 1K8AO 5AJ3K 3VETA 4Q5VA 4JKFA 3WNEA 2QWPA 4N41A 4E1MA 1U2VA 3PO4A 2KLAA 2W40A 2BDPA 3HK2A 4ISGA 4JYAK 4CESA 2OTJN 3M5RA 4FJKA 3EN9A 3AA4A 3LDLA 3WXKA 3MMVA 4KI4A 1WSHA 4E1NA 3GG4A 3ID8A 2ITMA 4Z4HA 5AQYA 2FBTA 1L3SA 4HTLA 3RMDA 4AHSA 4A57A 4DV0K 4JRQA 4DU1A 4MFBA 4GV9A 1YVUA 5C15A 3TR8A 3CQXA 4GMJB 3QEIA 3MWPA 1SV5A 3OA9A 3A5LC 1BCMA 4B8AB 2DFEA 3CFOA 1V4SA 2WC9A 4W5QA 4H8KA 4FOEA 3SV4A 1O13A 1S6PA 3RMBA 4FWOA 5FPNA 3PSIA 3ZETA 4JEPA 3NGIA 4BRPA 4JI1K 4CHNA 3DLLL 1SZ2A 2ZF5O 3EZWA 2EWSA 1SAZA 3AV9A 3AVLA 1D9DA 3ZX2A 5AQZA 3OYNA 3QICA 4BR5A 4CGFA 3A2FA 4CBXA 4CHQA 3WT0A 2E88A 4W5NA 5DK5A 2NRTA 4B1UB 2X74A 2ZJRL 3IKMA 3UKUB 3S9HA 1HJRA 2XY5A 1QQOA 3BZCA 4W5RA 4DQSA 4E7JA 4JK8A 2GX9A 2HMIA 1XUPO 5JICA 4U7BA 4LH4A 2G8KA
chains in the Genus database with same CATH topology
5LJWA 3I56N 1KQSM 3VEVA 1BU6O 3GOIA 3CCQN 3TTCA 2HBJA 4PKHA 4H5NA 4KH6A 4B1YB 3R6MA 1CZAN 1BUPA 5CR4A 1VQKN 1DT9A 3CXCM 1T6CA 5AQWA 4OPAA 3RVCA 3CJCA 4MO5A 3VTHA 2JWKA 3EL2A 3O4WA 5BN9A 4YDUC 4PL7A 3MWTA 3D6RA 3HM8A 2WBNA 3AAQA 3E66A 3EE8A 3VTIA 4C1NI 3A5OC 2VGMA 3LDOA 4MDAA 4QS7A 5AQNA 1BA0A 1HUXA 4IJNA 3H45C 5AQRA 4OO1J 4IWVA 3O8MA 1M90O 1ATNA 2NLXA 2P9PB 3PIOL 3HBTA 3BP8A 5AQPA 3ZX3A 4YOVA 2ASMA 4IZ9A 3ZX0A 4JKBA 3H46O 2VYPA 2E2PA 4FWPA 2Q31A 4A5BA 3KWGA 4FWLA 3CJ9A 4BGBA 4WF9L 1YJNN 2QTDA 2NNWA 5LY3A 4NO7A 1BO5O 2Q0RA 3FFKB 2D0PA 3N4QA 1RFQA 3I33A 4O5FA 2E2NA 2P9KA 2BTFA 3C0BA 5AZJB 3T69A 3UB5A 3AGRA 5AQVA 4BG8A 3AY9A 3HTVA 2FSNA 3E9PA 5AQKA 3VEOA 3CCVN 4BG9A 2QI2A 1GLAG 3K9KA 4RCHA 3VEWA 2YJFA 2QEXN 5MLCQ 3CETA 1XC3A 5H1SQ 1Z6RA 1GLLO 4GY2B 3WQTA 1DKGD 2A40A 3M1FA 1NJIO 4GNIA 3SAFA 4YORA 3M6GA 3J7ZO 3H3OB 4IOCL 4B1WB 3DXKA 3WXIA 4NLCA 3U9ZA 4YOWA 4O8KA 4IOAL 2YHWA 3C6AA 4JKGA 4JKAA 4H0VB 3HSCA 4CZGA 5BRDA 3C7NA 3P31A 4DQ8A 3SAGA 4G9ZA 4JAXA 4YDUA 5M1QA 3MN5A 3R9PA 5AR0A 2GTDA 3H1QA 1X3NA 1HKCA 3I55N 4A5AA 3VPZA 3N4PA 4XH5A 4BY9C 1VQ5N 1NGAA 2A5XA 4BRAA 1KXPA 4ILJA 3DXMA 1ZXOA 3B8AX 3J8AA 3MN6A 3O9TA 4GV6A 1GLEG 1T6DA 2Q36A 2Q1NA 4YOTA 5GAHP 3MN9A 3F2KA 2QWRA 3D7EO 4WQ5C 1VQPN 4ISFA 3A5NC 4GVEA 3W0LA 2CH6A 2I7NA 4RTFD 1G99A 2FLOA 2CGJA 1YITN 2GWKA 2D4WA 2VGNA 4BRCA 3EKSA 5E84A 3ULEB 4CZFA 3O80A 1E4GT 1VQNN 1BG3A 3A5MC 2HF3A 3UKUA 3E1YA 3MCAB 3CMEN 3U4LA 3WEEA 4DHYA 3L6QA 5GAEP 2A42A 4OPHA 2IVPA 5E26A 3IMXA 4WFAL 3OW2M 1VQ6N 1XQSC 4H0TB 2KKZA 4BR0A 3L0QA 1SQKA 3DXMB 4M63C 2AP1A 4BR7A 4BRQA 2Q97A 4U67L 1HPMA 3O9QA 4RWTA 5FPEA 3UKRB 3P39A 1HKBA 3UE5A 1QZ6A 3CC2N 4L3QA 4FWQA 4JKDA 3WXMB 4IFEA 2YI1A 5C12A 5M1FA 2NRXA 3ZYYX 4BQZA 3TPQA 4FO0A 3MDQA 4M7YA 2D0OA 5M1KA 1VQ7N 2NRZA 1RGIA 1MDUB 3G71N 4BRDA 4CI6A 4CZEA 4Z94A 2RE2A 3FZFA 5AQHA 1EQYA 1VQLN 1NGIA 3C6HA 3VESA 4I6MB 3VEXA 1RDWX 1VQ8N 4JN4A 4XEIA 3GDQA 2P9PA 1K9MO 2QWMA 3P4IA 5AQFA 1BDGA 1VAZA 3E9OA 3WQUA 4K41A 1VQMN 2CGKA 5DM6L 4WQ5A 3LDQA 2GUPA 2HOEA 4GV3A 3EKUA 2CH5A 4WQ4C 4ILGB 3S41A 1X9JA 4EAHD 1H1VA 2ZJQL 3FLCO 2QXLA 3U8XA 3VEZA 3C65A 5AZJA 3L4IA 4WFNL 4JNEA 3CJ1A 1Q7YO 1QVFM 3BUZB 4AM7A 5ADXH 3DWLA 3JXUA 3CMAN 4QS9A 1P8ZA 3IDHA 3CJBA 2CGLA 3KHYA 4B9QA 4CZHA 5C2DA 3LL3A 3QDKA 3SLCA 1IJJA 4UY8O 3LM9A 1C0GA 1NGEA 3FZLA 3JS6A 2V7ZA 3PLAA 1GLBG 3P38A 4KH4A 5GINA 5M1OA 5AFUH 2HSTA 1KAZA 1ZBSA 4JHDB 1ATRA 5JVHL 5AQOA 1W2BM 5BREA 2JWLA 5C0YA 3R1XA 4ISEA 1ILYA 1IG8A 3OHRA 1YF5L 5AQTA 2FXUA 4BROA 4XH1A 4CD3A 3AAPA 4KH5A 3VGMA 2NRWA 4BVPA 4PHTX 5EOYA 5AQMA 5JMVA 1HX1A 4H5WA 3CC4N 1OVYA 5FPMA 5BRHA 3SMPA 2Q0UA 5EVZA 2IVNA 2P9LB 3FZHA 3HZ6A 4B1XB 1W97L 3SBTA 4FWMA 3VF4A 4FWRA 2RHKA 3F5TA 3VERA 3MK6A 4Y0WA 3NVMA 1GLJO 3EO3A 4JKHA 4F9OA 3SBGA 4EHTA 4A2BA 1YAGA 3CERA 4FPAA 3TTDA 2D1KA 2OTLN 3NMUA 2HMPA 2HBLA 1K8KB 1NWKA 4J8FA 4WYBA 2GELA 3D2FB 3CCJN 2QA4N 3HOTA 4NLBA 3VF6A 4O8UA 4WQ4A 4H0XB 3CPEA 2E1YA 4BGAA 4FOIA 4C23A 3D2EB 2QWNA 4JD2B 3ULEA 3CCLN 4FWSA 3CCEN 1NGCA 4NB4A 3O9SA 2BH1A 1GLDG 2BUPA 3LDPA 1X3MA 3VENA 3CI5A 5FPDA 1NGBA 1DEJA 3TSPA 3EE9A 2V51B 4BRHA 3R3LA 5CE3A 1S72N 3QFPA 1NLVA 1S3XA 1Z05A 1C0FA 1NGGA 1U2VB 3HRGA 4BRLA 1ZC6A 3G25A 4K43A 3E9LA 3NVKA 4BREA 1TUYA 1NGJA 5I9EB 4CZJA 4FWNA 1MA9B 1YHQN 4KBOA 3UKRA 4K25A 3U9DA 4BR2A 3DJCA 1JCGA 4PL8A 5KPTA 1WOQA 1M1KO 3GE1A 3AGKA 1R59O 3O1BA 4MDBA 3R8EA 3CJ7A 3CCRN 1V4TA 3DAWA 3FE1A 5AQJA 4A59A 4BR9A 1GLFO 3MN7A 3SK3A 4BRIA 2IVOA 2QM1A 3AARA 3FZKA 2H3GX 1YVNA 3HI0A 3TSUA 2I7PA 2NRRA 3O5BA 4FPBA 2ZGZA 3W3DA 2NRVA 3GBTA 4IOXA 1NGDA 5M1NA 3HOSA 4I6MA 1QQNA 4CZKA 1HJOA 2HBMA 2ASPA 4BRFA 3LDNA 3LM2A 3PIPL 4CZIA 1YUWA 5C2FA 1Q81O 4AF1A 3BF3A 2A6AA 2E20A 1Q86O 3OBWA 4H5VA 4H5TA 2F7TA 5AQLA 1NM1A 5B8HA 3FR0A 4H5RA 3H1VX 4DB3A 4WCEL 5JLFA 5TKYA 2V7YA 3ATVA 4C1NK 5DM7L 4FWKA 1HLUA 1LCUA 2YCHA 4MLHA 3KVGA 5EY4A 1KD1O 5JVGL 5F2RA 5ELZA 4BRGA 2F9TA 5BPMA 2QWOA 5AZIB 3CCSN 3SMSA 4M7XA 4PKIA 5AQXA 2P9NA 3A0IX 3O08A 5JLHA 5BPLA 1QQMA 1BA1A 1QZ5A 2QWLA 2AA4A 4FSVA 4K42A 3VGKA 3CCUN 4H0OA 1U6ZA 2YJEA 3L4QA 3ZETB 3H3NO 3A8YA 3QBWA 4CZMA 5KQ8A 2W41A 3RSEB 3FZMA 5HOOA 5M1PA 3ATUA 2ZWHA 1KC8O 1D4XA 2P9SB 4BRNA 3QFUA 2NRHA 5AQUA 4BRMA 1N8RO 3CQYA 3H6EA 4JHDA 4IXCA 2J4RA 4E1JA 2YHYA 2P9NB 2ZGYA 3CCMN 3IFRA 3O1WA 2P9IB 5BPNA 3O9UA 3WXLA 4YOYA 4BC5A 1T44A 3Q7BA 1RDUA 3CC7N 5HL7L 2WFBA 4H0YB 4BR4A 2PAVA 1YJWN 1YJ9N 4YOXA 1KAYA 2P9UA 2HBKA 2P9LA 3QBXA 3G6EN 1TYQB 2Q2RA 5GADP 1BOTO 4MLEA 3QMLA 3TSQA 3GL1A 1S22A 4JKEA 2QW9A 5EX5A 2UYTA 5EXWA 1E4FT 1P90A 2A3ZA 5GIOA 4IEIA 3VMFB 5BRFA 1YIJN 1LOTB 1HKGA 2GEMA 1K8KA 2YHXA 1Q18A 3D2FA 3CPWM 4EHUA 5F1XA 4YOUA 5KPRA 4DKWA 1WUAA 1KAXA 1NGFA 1JCEA 4LC9B 2ZJPL 3D2EA 4JD2A 3WUHA 5KPZA 4IO9L 4QS8A 3CJAA 4EIAA 1K8AO 2P9UB 4CZLA 1JCFA 3MX2A 3OBYA 2FSJA 2KHOA 4XH4A 5AQGA 3VETA 5GIPA 4JKFA 2QWPA 3CIPA 1U2VA 2ASOA 2KLAA 2W40A 5TKWA 4FVUA 1QHAA 4ISGA 2OTJN 3M5RA 3EN9A 2E2QA 3LDLA 3WXKA 3MMVA 1OKJA 2HF4A 1NBWA 1TUUA 1MWMA 1EO1A 2QWQA 5GAGP 4JK9A 3GG4A 3ID8A 4IDHA 2ITMA 3MX5A 4DCHA 5AQYA 4WFBL 2E8AA 4CJ7A 2PBDA 4A61A 1J6ZA 1QVGM 4IEEA 1NMDA 4HTLA 2P9KB 3O6WA 4PKGA 5ADXA 4A57A 3ENBA 2V52B 2E2OA 4GV9A 1DGKN 5C15A 2A41A 3F9MA 4IO8A 4BRKA 3CD6N 3CQXA 2DPNA 3KK7A 3SAHA 3IUCA 3MWPA 2IIRA 4CBUA 3CF5L 3ENOA 2PFUA 1MWKA 3KZBA 5AFUA 3WXJA 4BC4A 3OA9A 2E1ZA 4EFHA 4HWIA 5C10A 3A5LC 4BVOA 4H0PA 5F0XA 1V4SA 3DXKB 5AQIA 1T3VA 2WC9A 4BQLA 2FSKA 3KWIA 5AZIA 3O9RA 3VEYA 4FOEA 4JKGB 3ID6A 5CHIA 1O13A 3C7NB 3K9JA 4CD1A 4H03B 3Q7CA 1ATSA 3ZEUA 4BC3A 1Q82O 4FWOA 3TU5A 5FPNA 2NZTA 3ZETA 4B1VA 4JEPA 3BEXA 4JK7A 3T7ZA 5KQDA 3RSEA 3VF2A 4BRPA 1VQ9N 4BC2A 2WUSA 3DLLL 1SZ2A 2ZF5O 1ESVA 3EZWA 2P9SA 3G4SN 2EWSA 4AM6A 4MO4A 1SAZA 3M3ZA 3SJHA 1K73O 4CBWA 1SS6A 4A2AA 3ZX2A 5AQZA 3ENHA 3QICA 3TTFA 4BR5A 1YI2N 2YX6A 1BWFO 3CHWA 3ZEUB 2P9IA 3FGUA 4CBXA 3WT0A 4A62A 2E88A 3BF1A 1NGHA 4ILHA 4B1UB 1GLCG 2NRTA 5AQSA 5BR9A 3QB0A 5AQQA 3VGLA 4FL9A 4B1ZA 3IKMA 5LJVA 2ZJRL 2OANA 3UKUB 4JKCA 1Y64A 2F9WA 2FF3B 3WEEB 2VWBA 3I8BA 1VQ4N 3MCPA 3VOVA 1QQOA 1VQON 1JJ2M 2VCPA 4R79A 2FF6A 1TYQA 4JK8A 2GX9A 1YXQA 5BN8A 4IJAA 1XUPO 5JICA 4U7BA 2GWJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LJW A;  3VEV A;  1BU6 O;  3GOI A;  4PKH A;  4H5N A;  4B1Y B;  3R6M A;  1CZA N;  1BUP A;  1T6C A;  5AQW A;  3CJC A;  4MO5 A;  3EL2 A;  3O4W A;  5BN9 A;  4YDU C;  4PL7 A;  3HM8 A;  3AAQ A;  3A5O C;  3LDO A;  4QS7 A;  5AQN A;  1BA0 A;  1HUX A;  4IJN A;  3H45 C;  5AQR A;  4IWV A;  3O8M A;  1ATN A;  2NLX A;  2P9P B;  3HBT A;  3BP8 A;  5AQP A;  3ZX3 A;  2ASM A;  4IZ9 A;  3ZX0 A;  3H46 O;  2VYP A;  2E2P A;  4FWP A;  2Q31 A;  4FWL A;  3CJ9 A;  4BGB A;  5LY3 A;  4NO7 A;  1BO5 O;  2Q0R A;  3FFK B;  2D0P A;  1RFQ A;  3I33 A;  4O5F A;  2E2N A;  2P9K A;  2BTF A;  3C0B A;  5AZJ B;  3UB5 A;  5AQV A;  4BG8 A;  3AY9 A;  3HTV A;  2FSN A;  5AQK A;  3VEO A;  4BG9 A;  4RCH A;  1GLA G;  3VEW A;  2YJF A;  3CET A;  1XC3 A;  1Z6R A;  1GLL O;  4GY2 B;  3WQT A;  1DKG D;  2A40 A;  3M1F A;  4GNI A;  3M6G A;  3H3O B;  4B1W B;  3DXK A;  3WXI A;  3U9Z A;  4O8K A;  2YHW A;  4H0V B;  3HSC A;  4CZG A;  5BRD A;  3C7N A;  4DQ8 A;  4JAX A;  4YDU A;  3MN5 A;  3R9P A;  5AR0 A;  2GTD A;  3H1Q A;  1X3N A;  1HKC A;  3VPZ A;  4XH5 A;  1NGA A;  2A5X A;  4BRA A;  1KXP A;  3DXM A;  1ZXO A;  3B8A X;  3J8A A;  3MN6 A;  1GLE G;  1T6D A;  2Q36 A;  2Q1N A;  3MN9 A;  2QWR A;  3D7E O;  4WQ5 C;  4ISF A;  3A5N C;  3W0L A;  2CH6 A;  2I7N A;  4RTF D;  1G99 A;  2FLO A;  2CGJ A;  2GWK A;  2D4W A;  4BRC A;  3EKS A;  5E84 A;  3ULE B;  4CZF A;  3O80 A;  1E4G T;  1BG3 A;  3A5M C;  2HF3 A;  3UKU A;  3U4L A;  3WEE A;  4DHY A;  3L6Q A;  2A42 A;  2IVP A;  5E26 A;  3IMX A;  1XQS C;  4H0T B;  4BR0 A;  3L0Q A;  1SQK A;  3DXM B;  4M63 C;  2AP1 A;  4BR7 A;  4BRQ A;  2Q97 A;  1HPM A;  4RWT A;  5FPE A;  3UKR B;  1HKB A;  3UE5 A;  1QZ6 A;  4L3Q A;  4FWQ A;  2YI1 A;  4BQZ A;  3TPQ A;  4FO0 A;  3MDQ A;  4M7Y A;  2D0O A;  1RGI A;  1MDU B;  4BRD A;  4CI6 A;  4CZE A;  4Z94 A;  3FZF A;  5AQH A;  1EQY A;  1NGI A;  3VES A;  4I6M B;  3VEX A;  1RDW X;  4JN4 A;  4XEI A;  3GDQ A;  2P9P A;  2QWM A;  3P4I A;  5AQF A;  1BDG A;  3WQU A;  4K41 A;  2CGK A;  4WQ5 A;  3LDQ A;  2GUP A;  2HOE A;  3EKU A;  2CH5 A;  4WQ4 C;  3S41 A;  1X9J A;  4EAH D;  1H1V A;  3FLC O;  2QXL A;  3U8X A;  3VEZ A;  5AZJ A;  3L4I A;  4JNE A;  3CJ1 A;  3BUZ B;  4AM7 A;  5ADX H;  3DWL A;  3JXU A;  4QS9 A;  1P8Z A;  3IDH A;  3CJB A;  2CGL A;  3KHY A;  4B9Q A;  4CZH A;  3LL3 A;  3QDK A;  3SLC A;  1IJJ A;  3LM9 A;  1C0G A;  1NGE A;  3FZL A;  3JS6 A;  2V7Z A;  1GLB G;  5AFU H;  1KAZ A;  1ZBS A;  4JHD B;  1ATR A;  5AQO A;  5BRE A;  4ISE A;  1IG8 A;  3OHR A;  5AQT A;  4BRO A;  2FXU A;  4XH1 A;  4CD3 A;  3AAP A;  3VGM A;  4BVP A;  5EOY A;  5AQM A;  5JMV A;  1HX1 A;  4H5W A;  5FPM A;  5BRH A;  3SMP A;  2Q0U A;  5EVZ A;  2IVN A;  2P9L B;  3FZH A;  3HZ6 A;  4B1X B;  3VF4 A;  4FWM A;  4FWR A;  3VER A;  3MK6 A;  4Y0W A;  1GLJ O;  3EO3 A;  4F9O A;  4EHT A;  4A2B A;  1YAG A;  3CER A;  4FPA A;  2D1K A;  2HMP A;  4J8F A;  1K8K B;  1NWK A;  4WYB A;  2GEL A;  3D2F B;  3VF6 A;  4WQ4 A;  4H0X B;  2E1Y A;  4BGA A;  4FOI A;  4C23 A;  3D2E B;  2QWN A;  4JD2 B;  3ULE A;  4FWS A;  1NGC A;  4NB4 A;  1GLD G;  2BUP A;  3LDP A;  1X3M A;  3VEN A;  3CI5 A;  5FPD A;  1NGB A;  1DEJ A;  2V51 B;  4BRH A;  5CE3 A;  3QFP A;  1NLV A;  1S3X A;  1Z05 A;  1C0F A;  1NGG A;  1U2V B;  4BRL A;  1ZC6 A;  3G25 A;  4K43 A;  4BRE A;  1TUY A;  1NGJ A;  5I9E B;  4CZJ A;  4FWN A;  1MA9 B;  4KBO A;  3UKR A;  4K25 A;  3U9D A;  4BR2 A;  3DJC A;  1JCG A;  4PL8 A;  5KPT A;  1WOQ A;  3GE1 A;  3O1B A;  1R59 O;  3R8E A;  3CJ7 A;  1V4T A;  3DAW A;  3FE1 A;  5AQJ A;  4BR9 A;  1GLF O;  3MN7 A;  3SK3 A;  4BRI A;  2IVO A;  2QM1 A;  3AAR A;  3FZK A;  2H3G X;  1YVN A;  3HI0 A;  2I7P A;  3O5B A;  4FPB A;  2ZGZ A;  3W3D A;  3GBT A;  1NGD A;  4I6M A;  1QQN A;  4CZK A;  1HJO A;  4BRF A;  2ASP A;  3LDN A;  3LM2 A;  4CZI A;  1YUW A;  3BF3 A;  2A6A A;  2E20 A;  4H5V A;  4H5T A;  5AQL A;  1NM1 A;  5B8H A;  3FR0 A;  4H5R A;  3H1V X;  4DB3 A;  5JLF A;  5TKY A;  2V7Y A;  3ATV A;  4FWK A;  1HLU A;  1LCU A;  2YCH A;  4MLH A;  3KVG A;  5EY4 A;  5F2R A;  5ELZ A;  4BRG A;  2F9T A;  5BPM A;  2QWO A;  5AZI B;  3SMS A;  4M7X A;  4PKI A;  5AQX A;  2P9N A;  3A0I X;  3O08 A;  5JLH A;  5BPL A;  1QQM A;  1BA1 A;  1QZ5 A;  2QWL A;  2AA4 A;  4FSV A;  4K42 A;  3VGK A;  4H0O A;  1U6Z A;  2YJE A;  3ZET B;  3H3N O;  3A8Y A;  3QBW A;  4CZM A;  5KQ8 A;  2W41 A;  3RSE B;  3FZM A;  3ATU A;  2ZWH A;  1D4X A;  2P9S B;  4BRN A;  3QFU A;  2NRH A;  5AQU A;  4BRM A;  3CQY A;  3H6E A;  4JHD A;  4IXC A;  2J4R A;  4E1J A;  2YHY A;  2P9N B;  2ZGY A;  3IFR A;  3O1W A;  2P9I B;  5BPN A;  3WXL A;  4BC5 A;  1T44 A;  4H0Y B;  4BR4 A;  2PAV A;  1KAY A;  2P9U A;  2P9L A;  3QBX A;  1TYQ B;  2Q2R A;  1BOT O;  4MLE A;  3QML A;  3GL1 A;  1S22 A;  2QW9 A;  5EX5 A;  2UYT A;  5EXW A;  1E4F T;  2A3Z A;  5BRF A;  1LOT B;  1HKG A;  2GEM A;  1K8K A;  2YHX A;  3D2F A;  1Q18 A;  4EHU A;  5F1X A;  5KPR A;  1WUA A;  1KAX A;  1NGF A;  1JCE A;  4LC9 B;  3D2E A;  4JD2 A;  3WUH A;  5KPZ A;  4QS8 A;  3CJA A;  4EIA A;  2P9U B;  4CZL A;  1JCF A;  2FSJ A;  2KHO A;  4XH4 A;  5AQG A;  3VET A;  2QWP A;  3CIP A;  1U2V A;  2ASO A;  2W40 A;  1QHA A;  4ISG A;  3EN9 A;  2E2Q A;  3LDL A;  3WXK A;  3MMV A;  1OKJ A;  2HF4 A;  1NBW A;  1TUU A;  1MWM A;  2QWQ A;  3GG4 A;  3ID8 A;  2ITM A;  4DCH A;  5AQY A;  2E8A A;  4CJ7 A;  2PBD A;  4A61 A;  1J6Z A;  1NMD A;  4HTL A;  2P9K B;  3O6W A;  4PKG A;  5ADX A;  2V52 B;  2E2O A;  1DGK N;  2A41 A;  3F9M A;  4IO8 A;  4BRK A;  3CQX A;  2DPN A;  3IUC A;  4CBU A;  2IIR A;  3ENO A;  1MWK A;  3KZB A;  5AFU A;  3WXJ A;  4BC4 A;  2E1Z A;  4EFH A;  4HWI A;  3A5L C;  4BVO A;  4H0P A;  5F0X A;  1V4S A;  3DXK B;  5AQI A;  4BQL A;  2FSK A;  5AZI A;  3VEY A;  4FOE A;  3C7N B;  4CD1 A;  4H03 B;  1ATS A;  3ZEU A;  4BC3 A;  4FWO A;  3TU5 A;  5FPN A;  2NZT A;  3ZET A;  4B1V A;  3BEX A;  5KQD A;  3RSE A;  3VF2 A;  4BRP A;  4BC2 A;  2WUS A;  1SZ2 A;  2ZF5 O;  1ESV A;  3EZW A;  2P9S A;  2EWS A;  4AM6 A;  4MO4 A;  1SAZ A;  3M3Z A;  3SJH A;  4CBW A;  4A2A A;  3ZX2 A;  5AQZ A;  3ENH A;  3QIC A;  4BR5 A;  1BWF O;  3CHW A;  3ZEU B;  2P9I A;  3FGU A;  4CBX A;  3WT0 A;  4A62 A;  2E88 A;  3BF1 A;  1NGH A;  4B1U B;  1GLC G;  5AQS A;  5BR9 A;  3QB0 A;  5AQQ A;  3VGL A;  4FL9 A;  4B1Z A;  5LJV A;  2OAN A;  3UKU B;  1Y64 A;  2F9W A;  2FF3 B;  3WEE B;  2VWB A;  3I8B A;  3MCP A;  3VOV A;  1QQO A;  2VCP A;  2FF6 A;  1TYQ A;  1YXQ A;  5BN8 A;  4IJA A;  1XUP O;  5JIC A;  2GWJ A; 
#chains in the Genus database with same CATH topology
 3VQ4 A;  4KH6 A;  1TK5 A;  2XY6 A;  1BUP A;  5CR4 A;  1BIU A;  4FJN A;  4DV4 K;  3CXC M;  1JLQ A;  4E7H A;  1RBR A;  1SKR A;  2JWK A;  3EL2 A;  1RNH A;  1OH7 A;  4M3Z A;  4B3M K;  3MWT A;  1LW2 A;  3AVN A;  3HM8 A;  1VSH A;  1O1W A;  3VTI A;  4C1N I;  3VQA A;  1KTQ A;  5LL6 Z;  1X1P A;  4F8R A;  3PIO L;  4O5B A;  4CHZ A;  4JI5 K;  5AQP A;  3THY A;  4YOV A;  4IZ9 A;  3ZX0 A;  4FW1 A;  2VYP A;  3NF8 A;  4A5B A;  1IBL K;  4CJ3 A;  5LY3 A;  4NO7 A;  2WON A;  1TK0 A;  1RFQ A;  4DV5 K;  1ITG A;  3T69 A;  1L3U A;  1U04 A;  3HTV A;  2VWJ A;  1LAW A;  4BG9 A;  1GLA G;  4CFC A;  3OYD A;  4DTP A;  3CM6 A;  1B9F A;  1QSS A;  5MLC Q;  3I8D A;  1D5A A;  1GLL O;  4GY2 B;  1W9H A;  3ZSV A;  1NJI O;  4X65 K;  2FBY A;  4YOR A;  3M6G A;  3VQP A;  3C95 A;  3DXK A;  4B1W B;  1RBU A;  4CHO A;  3AVI A;  3HT3 A;  4IOA L;  4JKG A;  1TKT A;  3HSC A;  5BRD A;  4KRE A;  1SKS A;  4DQ8 A;  2QKB A;  4G9Z A;  4YDU A;  5M1Q A;  3MN5 A;  1XNR K;  3H1Q A;  5CZ1 A;  1X3N A;  5FRN A;  5BR8 K;  1HKC A;  3VPZ A;  1TVR A;  4DFM A;  2A5X A;  4N47 A;  3DXM A;  4DFK A;  4IKF A;  4GV6 A;  1GLE G;  2Q36 A;  3LZI A;  4WQ5 C;  4FJ5 A;  1VQP N;  3A5N C;  3SUO A;  4RTF D;  4K0K K;  1OH5 A;  2FLO A;  1YIT N;  2GWK A;  2VGN A;  4B9S A;  3NCI A;  4I9Q A;  4I7F A;  4FLW A;  3ULE B;  4CZF A;  1S6Q A;  1VQN N;  2HF3 A;  2W6K A;  3U4L A;  3L6Q A;  3IG1 A;  2WOM A;  2KFZ A;  3BY5 A;  4H0T B;  5KI6 A;  2HHS A;  2Z1J A;  3QET A;  4CIF A;  2IOC A;  1X9S A;  4FW2 A;  3UKR B;  1BHL A;  1HKB A;  4O0J A;  4RG8 A;  4CEC A;  1EX4 A;  4HUF A;  3ITH A;  3DI6 A;  2YI1 A;  5C12 A;  5M1F A;  2NRX A;  4KO0 A;  3ZYY X;  3SUQ A;  1BIZ A;  3MDQ A;  2YKM A;  1RGI A;  1MDU B;  3G71 N;  3SI6 A;  5AQH A;  1EQY A;  1NK9 A;  3VES A;  4AHU A;  1RTI A;  1ASV A;  4XEI A;  4FCY A;  3L3V A;  1VAZ A;  4ZTF A;  4FK4 A;  4K41 A;  2CGK A;  3K58 A;  2X6N A;  4LFA K;  3I0R A;  3LDQ A;  5KGW A;  2HOE A;  2HHT A;  4GV3 A;  3EKU A;  4EAH D;  3OYK A;  1H1V A;  1QSY A;  1QHT A;  1HNZ K;  4UQG A;  3U8X A;  5AZJ A;  1BL3 A;  3QNN A;  3CJ1 A;  4NXN K;  1JXE A;  1I94 K;  3DWL A;  3JXU A;  3IDH A;  1QE1 A;  2CGL A;  4CZH A;  3QDK A;  3SLC A;  1C0G A;  3FZL A;  1KRP A;  2KTQ A;  3CYM A;  1ATR A;  5JVH L;  1VSF A;  1W2B M;  5EU7 A;  2JWL A;  5C0Y A;  4ISE A;  1IG8 A;  2FXU A;  3ZT2 A;  4HTU A;  3V9S A;  3THW B;  5EOY A;  3KLF A;  1IKX A;  1OVY A;  2I5J A;  3QER A;  2P9L B;  3HZ6 A;  4FWM A;  4DMN A;  3F5T A;  3EO3 A;  1KVB A;  4F9O A;  4A2B A;  1YAG A;  3TAM A;  4J8F A;  3AVK A;  4C8K A;  2DFF A;  3HOT A;  4BGA A;  4FOI A;  4JD2 B;  2QWN A;  4N76 A;  3QO9 A;  3O9S A;  2BH1 A;  4KPY A;  4NCA A;  1S72 N;  1Z05 A;  2ATQ A;  4CW7 B;  1C0F A;  1NGG A;  1U2V B;  4BRL A;  3NVK A;  4ID1 A;  3VQE A;  1YHQ N;  4KBO A;  3SYZ A;  4CCH A;  3KD5 E;  2E6M A;  1J5O A;  3CJ7 A;  1V4T A;  1HYZ A;  4GW6 A;  4A59 A;  2QM1 A;  3FZK A;  4BE2 A;  3HI0 A;  2O4I A;  4NXM K;  3O5B A;  4JV5 K;  2NRV A;  4CGJ A;  1U47 A;  1NGD A;  3M8P A;  2EHG A;  5C2F A;  4BDY A;  1RTJ A;  2E20 A;  3OBW A;  4H5T A;  3DLK A;  3FR0 A;  4WCE L;  2V7Y A;  2G8V A;  4LY7 A;  4DLE A;  4FWK A;  1S5J A;  4MLH A;  4BRG A;  5BPM A;  1NKE A;  4M3Y A;  2P9N A;  3A0I X;  3O08 A;  5JLH A;  5BPL A;  1QQM A;  4FLU A;  5HRO A;  2QWL A;  1NOZ A;  3WNG A;  4E7K A;  4OGE A;  3ZET B;  3ZT0 A;  3H3N O;  4CZM A;  3QBW A;  1QTM A;  1TKZ A;  2HB5 A;  3SPZ A;  3FZM A;  4CER A;  1UA1 A;  3ATU A;  3SCX A;  1IG9 A;  1NJW A;  3QFU A;  4ELT A;  2NRH A;  4BRM A;  4DR1 K;  4E7L A;  4ZHR A;  1A5X A;  3AO4 A;  4J2A A;  2ZGY A;  3PSF A;  3O1W A;  4DFJ A;  4DUZ K;  1NKC A;  4DR4 K;  1YT3 A;  1RDU A;  3MXJ A;  2WFB A;  3BGR A;  4N56 A;  2P9U A;  2HBK A;  3QBX A;  2Q2R A;  3B6P A;  1C0M A;  2O8E A;  1P90 A;  1LOT B;  4BAC A;  3CG7 A;  3IAY A;  1K8K A;  4EHU A;  5F1X A;  4YOU A;  5KPR A;  5CZ2 A;  1JCE A;  3AA5 X;  4LC9 B;  3D2E A;  4F3T A;  3QIO A;  4EIA A;  4CZL A;  4DSF A;  5AQG A;  2KHO A;  5GIP A;  3DLB A;  4K8Z A;  1KLN A;  1XI1 A;  3CIP A;  1S9G A;  3DRS A;  3OYC A;  5TKW A;  4AQY K;  4Z4C A;  4Z4I A;  1LW0 A;  3O3F A;  4X64 K;  2E2Q A;  1OKJ A;  1A5V A;  4KHP K;  1EO1 A;  2QWQ A;  5HP1 A;  4IG3 A;  1NKB A;  4IDH A;  4AHV A;  2KZZ A;  3MX5 A;  4WFB L;  3P83 D;  1NMD A;  2W6L A;  3DOK A;  4CF2 A;  5ADX A;  3QNO A;  3PY8 A;  3ENB A;  3C94 A;  3MEC A;  4CJE A;  2A41 A;  3F9M A;  4IO8 A;  4BRK A;  2DPN A;  3IUC A;  2YNF A;  2IIR A;  4KHY A;  2PFU A;  3KZB A;  5AFU A;  5C25 A;  1XMQ K;  4EFH A;  5C10 A;  3HP9 A;  4BVO A;  3KLE A;  4CJ4 A;  3DXK B;  4DQI A;  4RW9 A;  4BQL A;  2VQF K;  3KWI A;  5AZI A;  4LSL A;  4JKG B;  2Y1I A;  4CFD A;  3Q7C A;  1GOB A;  3ZEU A;  2Z1H A;  4KAZ A;  3S3N A;  1ZYQ A;  2E5L K;  4CFB A;  3RRG A;  1VQ9 N;  3AVA A;  2OZS A;  2HHV A;  4BE0 A;  2KZM A;  1LWF A;  4C8O A;  3VN5 A;  3SJH A;  3CM5 A;  4CBW A;  1SS6 A;  4A2A A;  2RKI A;  3ZSX A;  3WNF A;  3ENH A;  4AHR A;  2YX6 A;  4NCG A;  4EP4 A;  4DTS A;  3SQ0 A;  3BF1 A;  4KKO A;  3C6T A;  5BR9 A;  4OKE A;  3QB0 A;  4BE1 A;  5AQQ A;  3HPO A;  5LJV A;  2OAN A;  2F9W A;  2FF3 B;  1VQ4 N;  2VWB A;  3I8B A;  5IWA K;  1Z25 A;  3NGY A;  3QIP A;  4DR2 K;  1TYQ A;  1NJZ A;  5BN8 A;  1HR0 K;  4JI4 K;  4FK0 A;  2IGI A;  5K14 A;  1Q8I A;  2VG7 A;  3GOI A;  3K5L A;  4FLZ A;  5HLF A;  1VQK N;  1T6C A;  1XC9 A;  4DU4 A;  2ITG A;  4YDU C;  2WBN A;  3AAQ A;  3E66 A;  4X62 K;  1FW6 A;  4HCB A;  2VGM A;  3HPG A;  4IJN A;  2O4G A;  5AQR A;  1M90 O;  1ATN A;  4KTW A;  3SQ2 A;  3BP8 A;  3KLH A;  1HMV A;  3H46 O;  4CFA A;  2Q31 A;  4B9U A;  3L3U A;  4IG0 A;  4BGB A;  4WF9 L;  3HVR A;  3BZK A;  2P5O A;  4FZZ A;  2O8C A;  3I33 A;  2BTF A;  5AZJ B;  3V9X A;  3UB5 A;  3AGR A;  4FJ7 A;  3AY9 A;  3E9P A;  2QI2 A;  3K9K A;  4RCH A;  2YJF A;  1C0T A;  1JLG A;  1HQU A;  3CET A;  3DLH A;  3H3O B;  3WXI A;  3CQ8 A;  4YY3 K;  2HHU A;  3HO1 A;  3C6A A;  1C6V A;  4H0V B;  4CZG A;  4JAX A;  1QQC A;  3OJS A;  2GTD A;  2RN2 A;  3NHG A;  3I55 N;  1WSJ A;  4A5A A;  1JLF A;  4BY9 C;  1NGA A;  3T3F A;  4FJ9 A;  4TSX A;  4KHW A;  4BRA A;  3KJV A;  1KXP A;  4ILJ A;  3B8A X;  3ZLJ A;  5HBM A;  2Q1N A;  4YOT A;  2A1R A;  5GAH P;  4I2P A;  3F2K A;  2QWR A;  2YKN A;  3D7E O;  3OYF A;  2PYJ A;  2CH6 A;  2I7N A;  1G99 A;  4FYD A;  4FM2 A;  1EWR A;  1OVQ A;  5E84 A;  3O80 A;  3RR8 A;  3VQ8 A;  4DSL A;  3LPU A;  1W0H A;  1VHX A;  1VQ6 N;  3IMX A;  3ZSR A;  1XQS C;  4BR0 A;  4Z4E A;  4M63 C;  1S1X A;  1SUQ A;  2Q97 A;  4LH5 A;  2HVH A;  3HST B;  1RTD A;  2P5G A;  3MEG A;  1ASW A;  4CGI A;  3VA0 A;  3DLR A;  4EP5 A;  4B9V A;  4FJH A;  4DQQ A;  3UE5 A;  3CC2 N;  1N33 K;  3DOL A;  4JKD A;  3ZSO A;  1WN7 A;  3WXM B;  3ZCM A;  3TWH A;  5I3U A;  4FK2 A;  3V9W A;  3NH0 A;  1RIL A;  3TPQ A;  3DRR A;  4CZE A;  1L3V A;  1NGI A;  4RW7 A;  1ASU A;  3VEX A;  1KVC A;  1RDA A;  1VQ8 N;  4JN4 A;  3NH1 A;  2P9P A;  5HRR A;  1HRH A;  3G10 A;  3JAM O;  3AO5 A;  4Z4F A;  2G8U A;  4J2E A;  1BDG A;  3E9O A;  1JLB A;  5DM6 L;  4LF7 K;  3VQQ A;  3NBP A;  2YV0 X;  4ILG B;  3FLC O;  4KHN A;  1J9A A;  2QXL A;  3THX A;  1NU0 A;  1NK4 A;  3CMA N;  3CJB A;  3KHY A;  3PX4 A;  4CF0 A;  1N32 K;  4JI7 K;  4UY8 O;  4XIU A;  3LM9 A;  3D0P A;  1KLM A;  3OYM A;  3PLA A;  4BDP A;  3P38 A;  3NDK A;  2XRI A;  1ZBS A;  1FKO A;  1D9F A;  5BRE A;  4BRO A;  4KV8 A;  4XH1 A;  3AAP A;  3QIN A;  4KH5 A;  3CFP A;  1KVA A;  4CF9 A;  5AQM A;  5JMV A;  4H5W A;  3TAG A;  1JL2 A;  3FZH A;  3OYJ A;  3VQ7 A;  4DTJ A;  3SBT A;  3VER A;  4CED A;  3OYL A;  2IAJ A;  4EZ9 A;  3D45 A;  1GLJ O;  2O8E B;  4FJL A;  4DV6 K;  4AH9 A;  4GKJ K;  1G15 A;  3CER A;  2OTL N;  3OY9 A;  1K8K B;  1NWK A;  4WYB A;  1Z26 A;  4NLB A;  1NMN A;  1RDB A;  1QS4 A;  4CJU A;  3D2E B;  3CCE N;  3LDP A;  3VEN A;  1LWC A;  1NGB A;  1DEJ A;  1HNI A;  4OJR A;  2V51 B;  3NAE A;  3OYH A;  4FLX A;  3SUN A;  4V19 S;  4HUE A;  3G25 A;  4K43 A;  4CK1 A;  3NGZ A;  3OYI A;  1TUY A;  5I9E B;  4FWN A;  3VQB A;  1WSG A;  3V1R A;  4QOZ B;  1M1K O;  1IBK K;  3VQ5 A;  3SK3 A;  4DS5 A;  3TSU A;  2H3G X;  2X6S A;  2I7P A;  2OA8 A;  2HHX A;  2ZGZ A;  3W3D A;  1SKW A;  1RCH A;  4DLG A;  4E3S A;  1QQN A;  1T7P A;  4YFU A;  4BRF A;  3LDN A;  3LM2 A;  2OPR A;  1Q81 O;  4AF1 A;  4FM1 A;  1Q86 O;  1TAQ A;  4H5V A;  4H5R A;  3H1V X;  5TKY A;  4DTO A;  2YCH A;  1KD1 O;  1BCO A;  4GKK K;  2W42 A;  5F2R A;  1BI4 A;  2F9T A;  3HM9 A;  2QWO A;  5AZI B;  1SL0 A;  4M7X A;  4PKI A;  3JSM A;  1BA1 A;  4DU3 A;  3SNN A;  4FSV A;  1S9E A;  4H0O A;  1U6Z A;  3L4Q A;  1REV A;  3A8Y A;  1C1B A;  1XHX A;  2G8I A;  5HOO A;  1S1T A;  4PQU A;  5M1P A;  4DS4 A;  4JI6 K;  1KC8 O;  4CGG A;  4BRN A;  1TV6 A;  1W7A A;  3PUF A;  3CQY A;  3H6E A;  5J2P A;  4E1J A;  4CGH A;  3CCM N;  4DF4 A;  5BPN A;  3WXL A;  4YOY A;  3NF6 A;  1T44 A;  5JS2 A;  4CEB A;  1WBD A;  1TAU A;  4BR4 A;  2PAV A;  2XO7 A;  1YJ9 N;  3ULD A;  4DTR A;  4JI8 K;  2Y1J A;  1TYQ B;  4N5S A;  2UXC K;  2HNZ A;  5GAD P;  1IKW A;  3OYE A;  3QML A;  3GL1 A;  1S22 A;  1S1V A;  4JKE A;  3U3Y A;  5EXW A;  1E4F T;  3IS9 A;  2A3Z A;  4IEI A;  3M8R A;  2HHW A;  3D2F A;  3SV3 A;  1FK9 A;  4Z4G A;  2O8D A;  1NGF A;  4CF8 A;  2HND A;  5KPZ A;  3WUH A;  4B9N A;  4CHY A;  1U49 A;  4KTZ A;  2FSJ A;  3EEQ A;  1UWB A;  1HNW K;  4IFV A;  4YHH K;  3BDP A;  2ASO A;  4MQ3 A;  4CJR A;  1SL1 A;  4DV2 K;  1I39 A;  2B6A A;  2VG6 A;  1QHA A;  4CJT A;  4OLB A;  1NBW A;  2UUA K;  3U6F A;  1MWM A;  1E3M A;  5GAG P;  4W5T A;  4FJJ A;  5SZT A;  2PBD A;  3HXM A;  1XHZ A;  2O8C B;  1J6Z A;  1QVG M;  2G8W A;  4PKG A;  1TGO A;  2V52 B;  2E2O A;  1B9D A;  1DGK N;  2VG5 A;  1HQE A;  2YNG A;  3M8S A;  3AVG A;  1C1C A;  5FRM A;  3SAH A;  4CBU A;  3CF5 L;  3ENO A;  4M41 A;  5J2M A;  1BGX T;  3WXJ A;  4M3X A;  3KK2 A;  3KLG A;  5HRN A;  5SWM A;  4H0P A;  5F0X A;  4IFY A;  3NFA A;  4KHU A;  1YTU A;  5CHI A;  4DV3 K;  3K9J A;  4H03 B;  1ATS A;  1XWL A;  3RRH A;  1Q82 O;  4E89 A;  3BEX A;  3OYB A;  4F4K A;  3LAM A;  4JK7 A;  4FJG A;  3T7Z A;  3RSE A;  3VF2 A;  3DLE A;  4CHP A;  4BC2 A;  2WUS A;  3ISN C;  1ESV A;  2P9S A;  2VWK A;  3G4S N;  4AM6 A;  3TTF A;  4RW4 A;  1YI2 N;  1VSK A;  1BWF O;  2X78 A;  3CHW A;  4LF8 K;  1NGH A;  4ILH A;  3TAB A;  4BWJ A;  3VGL A;  4FL9 A;  4B1Z A;  2P51 A;  2RPI A;  4JKC A;  3F9K A;  1L5U A;  3VOV A;  1JJ2 M;  2VCP A;  2BAN A;  4IJA A;  3I56 N;  1YTA A;  3VA3 A;  1BU6 O;  1UOC A;  3TTC A;  4H5N A;  3R6M A;  3QEP A;  1CZA N;  4IBN A;  4OPA A;  3RVC A;  3CJC A;  5FDL A;  5BN9 A;  1UAX A;  3EE8 A;  3LP2 A;  2XY8 A;  3A5O C;  3K5M A;  4DQR A;  4LF4 K;  1ZBU A;  3LDO A;  1WNS A;  4CJS A;  3H45 C;  4OO1 J;  4IWV A;  4DSI A;  3T1Y K;  2P9P B;  3HBT A;  3I0S A;  2E2P A;  3KWG A;  3CJ9 A;  3HL8 A;  2QTD A;  4CIG A;  2NNW A;  4CEE A;  3AVM A;  3FFK B;  4CJF A;  2P9K A;  3THX B;  3L2R A;  3CCV N;  3EY1 A;  1T03 A;  3VEW A;  3THY B;  4B9L A;  1XC3 A;  5H1S Q;  1Z6R A;  1ZBI A;  1DKG D;  1RTH A;  3L2V A;  3QEW A;  4B3S K;  3MXI A;  4CK2 A;  1S1W A;  1ZBH A;  3J7Z O;  4O8K A;  2QK9 A;  2YHW A;  3OYA A;  3MXM A;  4JKA A;  3C7N A;  4JRP A;  3P31 A;  1Q9X A;  1KFS A;  3T19 A;  4CK3 A;  3V9Z A;  1QSL A;  3R9P A;  4E19 A;  4H4M A;  3OS1 A;  3LPT A;  4BDZ A;  5CYQ A;  2ZE2 A;  3AVJ A;  4CJP A;  3AO1 A;  1ZXO A;  3MN6 A;  3QES A;  3O3G A;  3RR7 A;  3MN9 A;  3LWL A;  4ISF A;  3W0L A;  4GVE A;  4Y1D A;  2UXD K;  4OPK A;  4HHT A;  1TK8 A;  5A2Q O;  4K8X A;  2D4W A;  3OTO K;  3MEE A;  1E4G T;  3A5M C;  3E1Y A;  5IT9 O;  4DHY A;  3WEE A;  5GAE P;  4WFA L;  5HRS A;  3OW2 M;  2KKZ A;  3L0Q A;  3IRX A;  3DXM B;  4M45 A;  3O4Q A;  4BRQ A;  2OZM A;  1HPM A;  3O9Q A;  4B9T A;  3S3M A;  5FPE A;  5FRO A;  1EKE A;  2OYQ A;  2KFN A;  3P39 A;  1QZ6 A;  2D5R A;  4L3Q A;  2RF2 A;  4IFE A;  4DTX A;  2D0C A;  4BQZ A;  4F2R A;  2O8B A;  1VQ7 N;  2D0O A;  3H08 A;  4G1Q A;  2YNI A;  4BRD A;  4Z94 A;  1NK7 A;  3C6H A;  1RBT A;  2YNH A;  1RDC A;  1RDW X;  3GDQ A;  2D0B A;  2QWM A;  1B92 A;  3P4I A;  2BGG A;  3K59 A;  3OS2 A;  1VQM N;  3PX0 A;  3EZ5 A;  3TAR A;  4DV1 K;  2OPQ A;  1BIS A;  2CH5 A;  2UU9 K;  1X9J A;  4DV7 K;  4AHC A;  4M3W A;  1BI4 B;  2ZJQ L;  3VEZ A;  3C65 A;  3L4I A;  1QVF M;  1Q7Y O;  1EP4 A;  3LAN A;  4QS9 A;  4KB1 A;  1P8Z A;  3AVC A;  4YNQ A;  3AO3 A;  5C2D A;  3LL3 A;  2ZM6 K;  1NGE A;  3V6D A;  3SPY A;  4F2S A;  5GIN A;  5M1O A;  5LMN K;  3KKS A;  2ETJ A;  4M3T A;  1RDD A;  4Z0U A;  1WSI A;  3CFR A;  2ZQB A;  1YF5 L;  1X9M A;  3VGM A;  2NRW A;  1RBV A;  4OKJ A;  4PHT X;  1VSM A;  5FPM A;  5CY4 A;  3AO2 A;  5EVZ A;  1N34 K;  2IVN A;  4B1X B;  1W97 L;  3VF4 A;  3L2Q A;  3RMC A;  4FWR A;  2RHK A;  3MK6 A;  4Y0W A;  4FXD A;  3NVM A;  3K57 A;  4EHT A;  2D1K A;  1ZBL A;  4OGC A;  3OYG A;  2QA4 N;  4B3R K;  3D2F B;  4O8U A;  2Z1I A;  4WQ4 A;  2O8D B;  3CPE A;  4C23 A;  5KTQ A;  2KQ2 A;  3CCL N;  4NB4 A;  2BUP A;  1U48 A;  3CI5 A;  5FPD A;  3UIQ A;  2GV9 A;  4M3U A;  5CE3 A;  3QFP A;  4Q0B A;  1NLV A;  2VQE K;  3HRG A;  1ZC6 A;  4DR5 K;  4BRE A;  1HYS A;  2PZS A;  1NGJ A;  4DR3 K;  1NK6 A;  3U9D A;  4BR2 A;  1JCG A;  4PL8 A;  3B6O A;  1S1U A;  3GE1 A;  3AGK A;  4LFC K;  1IKY A;  1TL3 A;  3FE1 A;  5AQJ A;  4BR9 A;  3SUP A;  1GLF O;  3MN7 A;  4DFP A;  5J2Q A;  1YVN A;  2NRR A;  3AA2 A;  5KRS A;  1XNQ K;  3AVF A;  2F8T A;  5KGX A;  3HOS A;  4I6M A;  2HBM A;  2ASP A;  3PIP L;  3L2W A;  3VQ9 A;  1YUW A;  1KFD A;  2A6A A;  1KCF A;  3OJU A;  1RT7 A;  2F7T A;  1J53 A;  3VQ6 A;  5JLF A;  4DR6 K;  5DM7 L;  4HVJ A;  1LCU A;  3KVG A;  4I2Q A;  5EY4 A;  5JVG L;  5ELZ A;  1HPZ A;  4B9M A;  3SMS A;  5AQX A;  1WSF A;  2LSN A;  1QZ5 A;  3THV A;  2AA4 A;  4K42 A;  3VGK A;  4KB0 A;  2YJE A;  3RSE B;  4CJQ A;  2EX3 A;  2DTU A;  4J2D A;  2ZWH A;  1D4X A;  2ZD1 A;  1EET A;  2P9S B;  4FJX A;  5AQU A;  1N8R O;  3LAK A;  4JHD A;  4IXC A;  1VRT A;  1ZBF A;  4JI3 K;  2P9N B;  3ZSW A;  3K5O A;  4AHT A;  2UUB K;  2G8F A;  4DTM A;  4LF9 K;  4HUG A;  3F73 A;  4OKK A;  3KKR A;  3KK1 A;  3HJF A;  4YOX A;  3KD1 E;  1N5Y A;  3G6E N;  1JXB A;  4DSJ A;  1BOT O;  1DTT A;  4MLE A;  3J81 O;  3M8Q A;  2QW9 A;  5GIO A;  4JI2 K;  3VMF B;  1YIJ N;  4ICL A;  3ZT3 A;  1Q18 A;  1TL1 A;  4CGD A;  4DKW A;  1GOA A;  1WUA A;  3SQ1 A;  4CEZ A;  4LSN A;  2P9U B;  1JCF A;  3MX2 A;  3OBY A;  4BWM A;  4XH4 A;  3K2P A;  2HNY A;  3KK3 A;  5CYM A;  2R7Y A;  1F21 A;  1J54 A;  4FVU A;  1GOC A;  5J2N A;  4OPJ A;  2HF4 A;  1TUU A;  3J7Y P;  3P1G A;  4JK9 A;  3V1Q A;  1FJG K;  4DCH A;  2E8A A;  1JLA A;  4CJ7 A;  2D0A A;  4A61 A;  2B4J A;  4IEE A;  4NYF A;  2P9K B;  3O6W A;  1R0A A;  4FZY A;  1NJY A;  2E6L A;  4JLH A;  3OVN A;  4CEO A;  4O4G A;  4KHQ A;  3CD6 N;  3KK7 A;  1XMO K;  2O8F A;  1MWK A;  3KIO A;  1HYV A;  2DY4 A;  4BC4 A;  2F96 A;  2E1Z A;  2UUC K;  4HWI A;  3EYZ A;  1NK0 A;  4DWI A;  4KFB A;  1J5E K;  5E41 A;  3ZSY A;  5HRP A;  5AQI A;  1T3V A;  2DFH A;  2FSK A;  3VEY A;  3O9R A;  4C8N A;  3ID6 A;  3C7N B;  4CD1 A;  4BC3 A;  4PWD A;  3TU5 A;  2NZT A;  4B1V A;  2FBX A;  3ZSZ A;  1DLO A;  5KQD A;  1UA0 A;  3AVH A;  2JGU A;  3AVB A;  1SL2 A;  3VQC A;  2Z1G A;  3TAP A;  3QLH A;  3VQD A;  1OH6 A;  4MO4 A;  3M3Z A;  1VSD A;  3O3H A;  1K73 O;  4DG1 A;  1NOY A;  3ZEU B;  3JYT A;  2P9I A;  3FGU A;  4A62 A;  4PUO A;  1X9W A;  4RW8 A;  1GLC G;  5AQS A;  2GBZ A;  3RWU A;  4CVN E;  1NK8 A;  4OLA A;  1Y64 A;  3V4I A;  3WEE B;  3TAF A;  3MCP A;  3ZT4 A;  1VQO N;  4CJW A;  4R79 A;  2FF6 A;  2QXF A;  1YXQ A;  4DF8 A;  4W5O A;  4PY5 A;  3LWM A;  4ELU A;  2GWJ A;  5LJW A;  1KQS M;  3VEV A;  1RT1 A;  5C42 A;  4M3R A;  3TAE A;  3CCQ N;  1Y97 A;  2HBJ A;  4PKH A;  3RMA A;  3FFI A;  1JLC A;  4B1Y B;  1A5W A;  4NCB A;  1DT9 A;  4DTN A;  5AQW A;  4MO5 A;  3VTH A;  2BE2 A;  1IH7 A;  2O8B B;  1I3A A;  3O4W A;  1WLJ A;  4PL7 A;  2HW3 A;  3D6R A;  4X66 K;  1JLE A;  5KRT A;  4MDA A;  4QS7 A;  5AQN A;  1BA0 A;  2UXB K;  1HUX A;  3LP3 A;  3O8M A;  3TAN A;  2NLX A;  3NE6 A;  3ZX3 A;  2ASM A;  3DYA A;  3LP1 A;  4JKB A;  3V9U A;  1VSI A;  4FWP A;  4CJK A;  4FWL A;  1YJN N;  2YHA A;  2F4V K;  3HVT A;  1RT2 A;  1IBM K;  1BO5 O;  3HPH A;  4FJM A;  4CEA A;  2Q0R A;  2P1J A;  2D0P A;  4O55 A;  4O5F A;  3N4Q A;  3HP6 A;  2E2N A;  3C0B A;  1NJX A;  4NYN A;  3K0S A;  4ELV A;  1U45 A;  5AQV A;  4BG8 A;  3VEO A;  5AQK A;  2FSN A;  1T8E A;  2HHH K;  3T1H K;  4LF5 K;  2KW4 A;  4IDK A;  4B8C A;  1CXQ A;  2QEX N;  4CEF A;  3QEX A;  1C1A A;  3WQT A;  4DTU A;  2A40 A;  3NF9 A;  3M1F A;  1HNV A;  4GNI A;  3SAF A;  4FLT A;  2HHQ A;  4IOC L;  1NNE A;  4NLC A;  3U9Z A;  4YOW A;  3K5N A;  3SAG A;  5I42 A;  4FJ8 A;  3T1A A;  5AR0 A;  1BQM A;  1JL1 A;  3N4P A;  4XH5 A;  1VQ5 N;  3QEV A;  3J8A A;  3O9T A;  1T6D A;  4QCL A;  3TAQ A;  3KLI A;  1FKP A;  4KRF A;  3L2U A;  2IS3 A;  2CGJ A;  1WAJ A;  4BRC A;  1WAF A;  3EKS A;  4O0I A;  1BG3 A;  3UKU A;  4DSE A;  3MCA B;  3CME N;  4GVM A;  3LZJ A;  4J2B A;  4CIE A;  2A42 A;  2GUI A;  2IVP A;  1IKV A;  4OPH A;  5E26 A;  1SQK A;  4R5P A;  2AP1 A;  4BR7 A;  3AA3 A;  4U67 L;  4RWT A;  4B08 A;  4FWQ A;  3SZ2 A;  3SQ4 A;  4DSK A;  5T7B A;  3PV8 A;  5D3G A;  5J1E A;  1MU2 A;  1VRU A;  2HVI A;  1RBS A;  4FO0 A;  4CJL A;  4M7Y A;  5M1K A;  4KI6 A;  2NRZ A;  4FVM A;  1N36 K;  4DUY K;  4CI6 A;  2RE2 A;  3FZF A;  1CZ9 A;  4CEQ A;  1VQL N;  2F8S A;  4JI0 K;  4I6M B;  4Y1C A;  4FM0 A;  1RT3 A;  4ID5 A;  1K9M O;  3LP0 A;  5AQF A;  3J7A P;  3SJJ A;  3WQU A;  4PA1 A;  4WQ5 A;  2GUP A;  4WQ4 C;  3S41 A;  1LAV A;  1RT4 A;  4M42 A;  3J80 O;  1VSE A;  2JLE A;  4WFN L;  4JNE A;  4FJI A;  3BUZ B;  4AM7 A;  4B3O A;  5ADX H;  3MAQ A;  3ASM A;  4B9Q A;  3DM2 A;  3KTQ A;  4ZTJ A;  1IJJ A;  1TKX A;  3JS6 A;  2V7Z A;  1GLB G;  5C24 A;  4KH4 A;  5AFU H;  2HST A;  4CF1 A;  4F3O A;  1KAZ A;  4JHD B;  4HCC A;  5AQO A;  4CJV A;  3R1X A;  1WSE A;  2E4L A;  1ILY A;  4LD0 A;  4RW6 A;  5AQT A;  3OHR A;  4C8M A;  4CD3 A;  1HNX K;  4AIL C;  3WNH A;  4BVP A;  5FLX O;  1HX1 A;  1LWE A;  1BQN A;  3CC4 N;  4OX9 K;  5BRH A;  3SMP A;  2Q0U A;  2B5J A;  4JKH A;  3SBG A;  4FPA A;  4E0D A;  3TTD A;  3NMU A;  1D8Y A;  2HMP A;  2HBL A;  3CCJ N;  2GEL A;  3VF6 A;  2WTU A;  4H0X B;  3PX6 A;  2E1Y A;  3PO5 A;  1VSJ A;  3TI0 A;  3ULE A;  4FWS A;  1NGC A;  2NUB A;  1GLD G;  2PYL A;  2IDO A;  1N6Q A;  1X3M A;  2PY5 A;  3TSP A;  3EE9 A;  4BRH A;  3R3L A;  4O44 A;  4H4O A;  1S3X A;  1WB9 A;  4CJ5 A;  3E9L A;  2OCE A;  4CZJ A;  1MA9 B;  1VK0 A;  3UKR A;  4K25 A;  3DJC A;  3O4N A;  5KPT A;  1IV0 A;  1WOQ A;  3OS0 A;  3O1B A;  1R59 O;  4I9L A;  4MDB A;  3R8E A;  3ZT1 A;  3CCR N;  3DAW A;  3LAL A;  3S3O A;  2G8H A;  2YHB A;  3NF7 A;  4BRI A;  3DLG A;  2IVO A;  3AAR A;  4DR7 K;  1WBB A;  3RTV A;  1LV5 A;  1U4B A;  2IC3 A;  4FPB A;  3NH2 A;  3MED A;  3GBT A;  4IOX A;  4L8R B;  5M1N A;  4FZX C;  4B3T K;  4CZK A;  1HJO A;  4CZI A;  1L3T A;  2FBV A;  3L8B A;  2O8F B;  4WE1 A;  3BF3 A;  3G0Z A;  5AQL A;  1NM1 A;  4EZ6 A;  3ZSQ A;  5B8H A;  4DB3 A;  3ATV A;  4C1N K;  1HLU A;  3DMJ A;  4CE9 A;  4FLV A;  2OPS A;  4KHS A;  3C6U A;  3CCS N;  4C8L A;  1OH8 A;  4FLY A;  3V81 A;  2AJQ A;  5LMU K;  1CXU A;  2XY7 A;  4LF6 K;  3CCU N;  4E7I A;  3HYF A;  5KQ8 A;  3LDS A;  2W41 A;  1CLQ A;  2Q3S A;  1Q9Y A;  1EXQ A;  5JS1 A;  1IO2 A;  1RT5 A;  2XHB A;  3V1O A;  2A1S A;  3U3G A;  2J4R A;  1NK5 A;  1NG9 A;  3E01 A;  2YHY A;  1DTQ A;  3IFR A;  1K6Y A;  2OPP A;  1CZB A;  2P9I B;  3DRP A;  3O9U A;  4BC5 A;  3Q7B A;  4JS4 A;  3CC7 N;  3THW A;  5HL7 L;  4KTQ A;  1VSL A;  4DQP A;  4H0Y B;  1KSP A;  4LFB K;  1YJW N;  1KAY A;  2P9L A;  1TKD A;  4QAG A;  3P5J A;  3ALY A;  4JS5 A;  4OVL A;  1EWQ A;  3TSQ A;  5EX5 A;  2QKK A;  2UYT A;  5BRF A;  1T05 A;  1HKG A;  1JKH A;  2GEM A;  2YHX A;  3CPW M;  1RT6 A;  1KAX A;  1C0U A;  2ZJP L;  4JD2 A;  4IO9 L;  1FXX A;  2FC0 A;  4QS8 A;  3CJA A;  5DMR A;  1K8A O;  5AJ3 K;  3VET A;  4Q5V A;  4JKF A;  3WNE A;  2QWP A;  4N41 A;  4E1M A;  1U2V A;  3PO4 A;  2KLA A;  2W40 A;  2BDP A;  3HK2 A;  4ISG A;  4JYA K;  4CES A;  2OTJ N;  3M5R A;  4FJK A;  3EN9 A;  3AA4 A;  3LDL A;  3WXK A;  3MMV A;  4KI4 A;  1WSH A;  4E1N A;  3GG4 A;  3ID8 A;  2ITM A;  4Z4H A;  5AQY A;  2FBT A;  1L3S A;  4HTL A;  3RMD A;  4AHS A;  4A57 A;  4DV0 K;  4JRQ A;  4DU1 A;  4MFB A;  4GV9 A;  1YVU A;  5C15 A;  3TR8 A;  3CQX A;  4GMJ B;  3QEI A;  3MWP A;  1SV5 A;  3OA9 A;  3A5L C;  1BCM A;  4B8A B;  2DFE A;  3CFO A;  1V4S A;  2WC9 A;  4W5Q A;  4H8K A;  4FOE A;  3SV4 A;  1O13 A;  1S6P A;  3RMB A;  4FWO A;  5FPN A;  3PSI A;  3ZET A;  4JEP A;  3NGI A;  4BRP A;  4JI1 K;  4CHN A;  3DLL L;  1SZ2 A;  2ZF5 O;  3EZW A;  2EWS A;  1SAZ A;  3AV9 A;  3AVL A;  1D9D A;  3ZX2 A;  5AQZ A;  3OYN A;  3QIC A;  4BR5 A;  4CGF A;  3A2F A;  4CBX A;  4CHQ A;  3WT0 A;  2E88 A;  4W5N A;  5DK5 A;  2NRT A;  4B1U B;  2X74 A;  2ZJR L;  3IKM A;  3UKU B;  3S9H A;  1HJR A;  2XY5 A;  1QQO A;  3BZC A;  4W5R A;  4DQS A;  4E7J A;  4JK8 A;  2GX9 A;  2HMI A;  1XUP O;  5JIC A;  4U7B A;  4LH4 A;  2G8K A; 
#chains in the Genus database with same CATH homology
 5LJW A;  3I56 N;  1KQS M;  3VEV A;  1BU6 O;  3GOI A;  3CCQ N;  3TTC A;  2HBJ A;  4PKH A;  4H5N A;  4KH6 A;  4B1Y B;  3R6M A;  1CZA N;  1BUP A;  5CR4 A;  1VQK N;  1DT9 A;  3CXC M;  1T6C A;  5AQW A;  4OPA A;  3RVC A;  3CJC A;  4MO5 A;  3VTH A;  2JWK A;  3EL2 A;  3O4W A;  5BN9 A;  4YDU C;  4PL7 A;  3MWT A;  3D6R A;  3HM8 A;  2WBN A;  3AAQ A;  3E66 A;  3EE8 A;  3VTI A;  4C1N I;  3A5O C;  2VGM A;  3LDO A;  4MDA A;  4QS7 A;  5AQN A;  1BA0 A;  1HUX A;  4IJN A;  3H45 C;  5AQR A;  4OO1 J;  4IWV A;  3O8M A;  1M90 O;  1ATN A;  2NLX A;  2P9P B;  3PIO L;  3HBT A;  3BP8 A;  5AQP A;  3ZX3 A;  4YOV A;  2ASM A;  4IZ9 A;  3ZX0 A;  4JKB A;  3H46 O;  2VYP A;  2E2P A;  4FWP A;  2Q31 A;  4A5B A;  3KWG A;  4FWL A;  3CJ9 A;  4BGB A;  4WF9 L;  1YJN N;  2QTD A;  2NNW A;  5LY3 A;  4NO7 A;  1BO5 O;  2Q0R A;  3FFK B;  2D0P A;  3N4Q A;  1RFQ A;  3I33 A;  4O5F A;  2E2N A;  2P9K A;  2BTF A;  3C0B A;  5AZJ B;  3T69 A;  3UB5 A;  3AGR A;  5AQV A;  4BG8 A;  3AY9 A;  3HTV A;  2FSN A;  3E9P A;  5AQK A;  3VEO A;  3CCV N;  4BG9 A;  2QI2 A;  1GLA G;  3K9K A;  4RCH A;  3VEW A;  2YJF A;  2QEX N;  5MLC Q;  3CET A;  1XC3 A;  5H1S Q;  1Z6R A;  1GLL O;  4GY2 B;  3WQT A;  1DKG D;  2A40 A;  3M1F A;  1NJI O;  4GNI A;  3SAF A;  4YOR A;  3M6G A;  3J7Z O;  3H3O B;  4IOC L;  4B1W B;  3DXK A;  3WXI A;  4NLC A;  3U9Z A;  4YOW A;  4O8K A;  4IOA L;  2YHW A;  3C6A A;  4JKG A;  4JKA A;  4H0V B;  3HSC A;  4CZG A;  5BRD A;  3C7N A;  3P31 A;  4DQ8 A;  3SAG A;  4G9Z A;  4JAX A;  4YDU A;  5M1Q A;  3MN5 A;  3R9P A;  5AR0 A;  2GTD A;  3H1Q A;  1X3N A;  1HKC A;  3I55 N;  4A5A A;  3VPZ A;  3N4P A;  4XH5 A;  4BY9 C;  1VQ5 N;  1NGA A;  2A5X A;  4BRA A;  1KXP A;  4ILJ A;  3DXM A;  1ZXO A;  3B8A X;  3J8A A;  3MN6 A;  3O9T A;  4GV6 A;  1GLE G;  1T6D A;  2Q36 A;  2Q1N A;  4YOT A;  5GAH P;  3MN9 A;  3F2K A;  2QWR A;  3D7E O;  4WQ5 C;  1VQP N;  4ISF A;  3A5N C;  4GVE A;  3W0L A;  2CH6 A;  2I7N A;  4RTF D;  1G99 A;  2FLO A;  2CGJ A;  1YIT N;  2GWK A;  2D4W A;  2VGN A;  4BRC A;  3EKS A;  5E84 A;  3ULE B;  4CZF A;  3O80 A;  1E4G T;  1VQN N;  1BG3 A;  3A5M C;  2HF3 A;  3UKU A;  3E1Y A;  3MCA B;  3CME N;  3U4L A;  3WEE A;  4DHY A;  3L6Q A;  5GAE P;  2A42 A;  4OPH A;  2IVP A;  5E26 A;  3IMX A;  4WFA L;  3OW2 M;  1VQ6 N;  1XQS C;  4H0T B;  2KKZ A;  4BR0 A;  3L0Q A;  1SQK A;  3DXM B;  4M63 C;  2AP1 A;  4BR7 A;  4BRQ A;  2Q97 A;  4U67 L;  1HPM A;  3O9Q A;  4RWT A;  5FPE A;  3UKR B;  3P39 A;  1HKB A;  3UE5 A;  1QZ6 A;  3CC2 N;  4L3Q A;  4FWQ A;  4JKD A;  3WXM B;  4IFE A;  2YI1 A;  5C12 A;  5M1F A;  2NRX A;  3ZYY X;  4BQZ A;  3TPQ A;  4FO0 A;  3MDQ A;  4M7Y A;  2D0O A;  5M1K A;  1VQ7 N;  2NRZ A;  1RGI A;  1MDU B;  3G71 N;  4BRD A;  4CI6 A;  4CZE A;  4Z94 A;  2RE2 A;  3FZF A;  5AQH A;  1EQY A;  1VQL N;  1NGI A;  3C6H A;  3VES A;  4I6M B;  3VEX A;  1RDW X;  1VQ8 N;  4JN4 A;  4XEI A;  3GDQ A;  2P9P A;  1K9M O;  2QWM A;  3P4I A;  5AQF A;  1BDG A;  1VAZ A;  3E9O A;  3WQU A;  4K41 A;  1VQM N;  2CGK A;  5DM6 L;  4WQ5 A;  3LDQ A;  2GUP A;  2HOE A;  4GV3 A;  3EKU A;  2CH5 A;  4WQ4 C;  4ILG B;  3S41 A;  1X9J A;  4EAH D;  1H1V A;  2ZJQ L;  3FLC O;  2QXL A;  3U8X A;  3VEZ A;  3C65 A;  5AZJ A;  3L4I A;  4WFN L;  4JNE A;  3CJ1 A;  1Q7Y O;  1QVF M;  3BUZ B;  4AM7 A;  5ADX H;  3DWL A;  3JXU A;  3CMA N;  4QS9 A;  1P8Z A;  3IDH A;  3CJB A;  2CGL A;  3KHY A;  4B9Q A;  4CZH A;  5C2D A;  3LL3 A;  3QDK A;  3SLC A;  1IJJ A;  4UY8 O;  3LM9 A;  1C0G A;  1NGE A;  3FZL A;  3JS6 A;  2V7Z A;  3PLA A;  1GLB G;  3P38 A;  4KH4 A;  5GIN A;  5M1O A;  5AFU H;  2HST A;  1KAZ A;  1ZBS A;  4JHD B;  1ATR A;  5JVH L;  5AQO A;  1W2B M;  5BRE A;  2JWL A;  5C0Y A;  3R1X A;  4ISE A;  1ILY A;  1IG8 A;  3OHR A;  1YF5 L;  5AQT A;  2FXU A;  4BRO A;  4XH1 A;  4CD3 A;  3AAP A;  4KH5 A;  3VGM A;  2NRW A;  4BVP A;  4PHT X;  5EOY A;  5AQM A;  5JMV A;  1HX1 A;  4H5W A;  3CC4 N;  1OVY A;  5FPM A;  5BRH A;  3SMP A;  2Q0U A;  5EVZ A;  2IVN A;  2P9L B;  3FZH A;  3HZ6 A;  4B1X B;  1W97 L;  3SBT A;  4FWM A;  3VF4 A;  4FWR A;  2RHK A;  3F5T A;  3VER A;  3MK6 A;  4Y0W A;  3NVM A;  1GLJ O;  3EO3 A;  4JKH A;  4F9O A;  3SBG A;  4EHT A;  4A2B A;  1YAG A;  3CER A;  4FPA A;  3TTD A;  2D1K A;  2OTL N;  3NMU A;  2HMP A;  2HBL A;  1K8K B;  1NWK A;  4J8F A;  4WYB A;  2GEL A;  3D2F B;  3CCJ N;  2QA4 N;  3HOT A;  4NLB A;  3VF6 A;  4O8U A;  4WQ4 A;  4H0X B;  3CPE A;  2E1Y A;  4BGA A;  4FOI A;  4C23 A;  3D2E B;  2QWN A;  4JD2 B;  3ULE A;  3CCL N;  4FWS A;  3CCE N;  1NGC A;  4NB4 A;  3O9S A;  2BH1 A;  1GLD G;  2BUP A;  3LDP A;  1X3M A;  3VEN A;  3CI5 A;  5FPD A;  1NGB A;  1DEJ A;  3TSP A;  3EE9 A;  2V51 B;  4BRH A;  3R3L A;  5CE3 A;  1S72 N;  3QFP A;  1NLV A;  1S3X A;  1Z05 A;  1C0F A;  1NGG A;  1U2V B;  3HRG A;  4BRL A;  1ZC6 A;  3G25 A;  4K43 A;  3E9L A;  3NVK A;  4BRE A;  1TUY A;  1NGJ A;  5I9E B;  4CZJ A;  4FWN A;  1MA9 B;  1YHQ N;  4KBO A;  3UKR A;  4K25 A;  3U9D A;  4BR2 A;  3DJC A;  1JCG A;  4PL8 A;  5KPT A;  1WOQ A;  1M1K O;  3GE1 A;  3AGK A;  1R59 O;  3O1B A;  4MDB A;  3R8E A;  3CJ7 A;  3CCR N;  1V4T A;  3DAW A;  3FE1 A;  5AQJ A;  4A59 A;  4BR9 A;  1GLF O;  3MN7 A;  3SK3 A;  4BRI A;  2IVO A;  2QM1 A;  3AAR A;  3FZK A;  2H3G X;  1YVN A;  3HI0 A;  3TSU A;  2I7P A;  2NRR A;  3O5B A;  4FPB A;  2ZGZ A;  3W3D A;  2NRV A;  3GBT A;  4IOX A;  1NGD A;  5M1N A;  3HOS A;  4I6M A;  1QQN A;  4CZK A;  1HJO A;  2HBM A;  2ASP A;  4BRF A;  3LDN A;  3LM2 A;  3PIP L;  4CZI A;  1YUW A;  5C2F A;  1Q81 O;  4AF1 A;  3BF3 A;  2A6A A;  2E20 A;  1Q86 O;  3OBW A;  4H5V A;  4H5T A;  2F7T A;  5AQL A;  1NM1 A;  5B8H A;  3FR0 A;  4H5R A;  3H1V X;  4DB3 A;  4WCE L;  5JLF A;  5TKY A;  2V7Y A;  3ATV A;  4C1N K;  5DM7 L;  4FWK A;  1HLU A;  1LCU A;  2YCH A;  4MLH A;  3KVG A;  5EY4 A;  1KD1 O;  5JVG L;  5F2R A;  5ELZ A;  4BRG A;  2F9T A;  5BPM A;  2QWO A;  5AZI B;  3CCS N;  3SMS A;  4M7X A;  4PKI A;  5AQX A;  2P9N A;  3A0I X;  3O08 A;  5JLH A;  5BPL A;  1QQM A;  1BA1 A;  1QZ5 A;  2QWL A;  2AA4 A;  4FSV A;  4K42 A;  3VGK A;  3CCU N;  4H0O A;  1U6Z A;  2YJE A;  3L4Q A;  3ZET B;  3H3N O;  3A8Y A;  3QBW A;  4CZM A;  5KQ8 A;  2W41 A;  3RSE B;  3FZM A;  5HOO A;  5M1P A;  3ATU A;  2ZWH A;  1KC8 O;  1D4X A;  2P9S B;  4BRN A;  3QFU A;  2NRH A;  5AQU A;  4BRM A;  1N8R O;  3CQY A;  3H6E A;  4JHD A;  4IXC A;  2J4R A;  4E1J A;  2YHY A;  2P9N B;  2ZGY A;  3CCM N;  3IFR A;  3O1W A;  2P9I B;  5BPN A;  3O9U A;  3WXL A;  4YOY A;  4BC5 A;  1T44 A;  3Q7B A;  1RDU A;  3CC7 N;  5HL7 L;  2WFB A;  4H0Y B;  4BR4 A;  2PAV A;  1YJW N;  1YJ9 N;  4YOX A;  1KAY A;  2P9U A;  2HBK A;  2P9L A;  3QBX A;  3G6E N;  1TYQ B;  2Q2R A;  5GAD P;  1BOT O;  4MLE A;  3QML A;  3TSQ A;  3GL1 A;  1S22 A;  4JKE A;  2QW9 A;  5EX5 A;  2UYT A;  5EXW A;  1E4F T;  1P90 A;  2A3Z A;  5GIO A;  4IEI A;  3VMF B;  5BRF A;  1YIJ N;  1LOT B;  1HKG A;  2GEM A;  1K8K A;  2YHX A;  1Q18 A;  3D2F A;  3CPW M;  4EHU A;  5F1X A;  4YOU A;  5KPR A;  4DKW A;  1WUA A;  1KAX A;  1NGF A;  1JCE A;  4LC9 B;  2ZJP L;  3D2E A;  4JD2 A;  3WUH A;  5KPZ A;  4IO9 L;  4QS8 A;  3CJA A;  4EIA A;  1K8A O;  2P9U B;  4CZL A;  1JCF A;  3MX2 A;  3OBY A;  2FSJ A;  2KHO A;  4XH4 A;  5AQG A;  3VET A;  5GIP A;  4JKF A;  2QWP A;  3CIP A;  1U2V A;  2ASO A;  2KLA A;  2W40 A;  5TKW A;  4FVU A;  1QHA A;  4ISG A;  2OTJ N;  3M5R A;  3EN9 A;  2E2Q A;  3LDL A;  3WXK A;  3MMV A;  1OKJ A;  2HF4 A;  1NBW A;  1TUU A;  1MWM A;  1EO1 A;  2QWQ A;  5GAG P;  4JK9 A;  3GG4 A;  3ID8 A;  4IDH A;  2ITM A;  3MX5 A;  4DCH A;  5AQY A;  4WFB L;  2E8A A;  4CJ7 A;  2PBD A;  4A61 A;  1J6Z A;  1QVG M;  4IEE A;  1NMD A;  4HTL A;  2P9K B;  3O6W A;  4PKG A;  5ADX A;  4A57 A;  3ENB A;  2V52 B;  2E2O A;  4GV9 A;  1DGK N;  5C15 A;  2A41 A;  3F9M A;  4IO8 A;  4BRK A;  3CD6 N;  3CQX A;  2DPN A;  3KK7 A;  3SAH A;  3IUC A;  3MWP A;  2IIR A;  4CBU A;  3CF5 L;  3ENO A;  2PFU A;  1MWK A;  3KZB A;  5AFU A;  3WXJ A;  4BC4 A;  3OA9 A;  2E1Z A;  4EFH A;  4HWI A;  5C10 A;  3A5L C;  4BVO A;  4H0P A;  5F0X A;  1V4S A;  3DXK B;  5AQI A;  1T3V A;  2WC9 A;  4BQL A;  2FSK A;  3KWI A;  5AZI A;  3O9R A;  3VEY A;  4FOE A;  4JKG B;  3ID6 A;  5CHI A;  1O13 A;  3C7N B;  3K9J A;  4CD1 A;  4H03 B;  3Q7C A;  1ATS A;  3ZEU A;  4BC3 A;  1Q82 O;  4FWO A;  3TU5 A;  5FPN A;  2NZT A;  3ZET A;  4B1V A;  4JEP A;  3BEX A;  4JK7 A;  3T7Z A;  5KQD A;  3RSE A;  3VF2 A;  4BRP A;  1VQ9 N;  4BC2 A;  2WUS A;  3DLL L;  1SZ2 A;  2ZF5 O;  1ESV A;  3EZW A;  2P9S A;  3G4S N;  2EWS A;  4AM6 A;  4MO4 A;  1SAZ A;  3M3Z A;  3SJH A;  1K73 O;  4CBW A;  1SS6 A;  4A2A A;  3ZX2 A;  5AQZ A;  3ENH A;  3QIC A;  3TTF A;  4BR5 A;  1YI2 N;  2YX6 A;  1BWF O;  3CHW A;  3ZEU B;  2P9I A;  3FGU A;  4CBX A;  3WT0 A;  4A62 A;  2E88 A;  3BF1 A;  1NGH A;  4ILH A;  4B1U B;  1GLC G;  2NRT A;  5AQS A;  5BR9 A;  3QB0 A;  5AQQ A;  3VGL A;  4FL9 A;  4B1Z A;  3IKM A;  5LJV A;  2ZJR L;  2OAN A;  3UKU B;  4JKC A;  1Y64 A;  2F9W A;  2FF3 B;  3WEE B;  2VWB A;  3I8B A;  1VQ4 N;  3MCP A;  3VOV A;  1QQO A;  1VQO N;  1JJ2 M;  2VCP A;  4R79 A;  2FF6 A;  1TYQ A;  4JK8 A;  2GX9 A;  1YXQ A;  5BN8 A;  4IJA A;  1XUP O;  5JIC A;  4U7B A;  2GWJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...