3CETA

Crystal structure of the pantheonate kinase-like protein q6m145 at the resolution 1.8 a. northeast structural genomics consortium target mrr63
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
329
structure length
300
Chain Sequence
b'MILGIDIGNTKITELHENGEFKVHHLVSHVALVTTAETKKEGVDNILNAAESAFGSNISVFDSNGNFISLESAKTNNMKVSASNWCGTAKWVSKNIEENCILVDMGSTTTDIIPIVEGKVVAEKTDLERLMNHELLYVGTLRTPISHLGNTISFKGVDTNVSSEYFAITADISVVLEKVTTEEYTCDTPDGKGTDKRSSLVRISKVLCSDLDQISEIDAENIAKNYYELWKELILENVENVAEKYGSKKVVITGLGENILKDALADFEVISVAERYGKDVSLATPSFAVAELLKNELLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved archaeal protein
publication title Crystal structure of the pantheonate kinase-like protein Q6M145 at the resolution 1.8 A. Northeast Structural Genomics Consortium target MrR63.
rcsb
source organism Methanococcus maripaludis s2
molecule tags Structural genomics, unknown function
total genus 97
structure length 300
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01968 Hydantoinase_A Hydantoinase/oxoprolinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3cetA01
3.30.420.190 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 conserved archaeal protein q6m145 3cetA02
5FPEA 5LJWA 1QQNA 1X3MA 4CZEA 3VETA 3I8BA 3VESA 5AQJA 3VEXA 4I6MA 5EY4A 4IXCA 4CBUA 4BRGA 3ENHA 4C23A 3EKUA 2A5XA 2Q36A 4PKIA 1HLUA 4A2BA 1WOQA 3MCPA 2FSKA 5AQIA 4XH4A 3H6EA 4CZFA 4B1ZA 3LDLA 1S3XA 3MN7A 3VPZA 5BPLA 1QQOA 5EX5A 1JCEA 4WQ4A 5AQWA 3MMVA 2CH5A 1XUPO 3CQXA 3GG4A 4DCHA 2J4RA 4MLEA 4DB3A 1TUUA 3QICA 1G99A 3F9MA 5AQZA 3ZX0A 4FWOA 1K8KB 3D7EO 3AARA 4H03B 2IVNA 1DEJA 4PKHA 4JHDB 1GLDG 3CJ9A 3CQYA 2HOEA 4XH5A 4O8KA 3UKUB 2F9TA 1HUXA 1T44A 4KBOA 1NMDA 3W0LA 3H3NO 2E2QA 1K8KA 4K41A 4HWIA 4DHYA 3QFUA 1X3NA 2GTDA 1NGGA 4FPAA 1BO5O 1LCUA 4BRFA 4BQLA 1BDGA 4JHDA 4QS9A 3ENOA 3UKUA 3ATVA 5LY3A 2WUSA 2CGJA 2Q97A 2ITMA 2FSNA 3BUZB 2ZGZA 3GDQA 3DAWA 4BVPA 3WEEB 3MK6A 2KHOA 3A5OC 3DXMB 2FF6A 1NGDA 3O8MA 2QWQA 2GUPA 1OKJA 5JICA 3CJAA 1BA1A 5E84A 2OANA 4NO7A 2FXUA 2QWNA 1P8ZA 5BN8A 4FSVA 4FWLA 3CJ1A 4PKGA 4BRAA 3FFKB 2P9PB 5KQ8A 3WEEA 3DXKB 4H5TA 3FE1A 3DXMA 4FOIA 5JLHA 4BC4A 2ZWHA 4QS8A 1HKCA 3ZETA 3FZKA 4IJNA 5E26A 4EFHA 1BUPA 1CZAN 1V4TA 2A6AA 3M6GA 2QWMA 4FWMA 4BG8A 3A8YA 4QS7A 2I7PA 2V51B 3FR0A 3HTVA 3L4IA 4IWVA 3TU5A 4K25A 2P9SA 4B1YB 1RFQA 4BROA 5JMVA 5AR0A 4BQZA 5AQSA 2BUPA 5AFUH 2Q1NA 5AQTA 3QBXA 3MN5A 2YJEA 4J8FA 4BG9A 1QHAA 5BPMA 3C7NB 2GEMA 1U2VB 2FLOA 4A62A 2E1YA 4BR9A 3BEXA 3HBTA 1GLAG 5CE3A 3JS6A 3QMLA 4CZJA 1KAXA 3ZEUB 5I9EB 4FPBA 2CH6A 3S41A 3L0QA 2D4WA 3J8AA 5AQXA 4BR0A 5TKYA 2W40A 3AY9A 2Q31A 2NLXA 4H0PA 4BRIA 4BRKA 1U2VA 4EIAA 2DPNA 4FWNA 3UKRB 3ULEB 1SAZA 5ADXH 4JD2B 4H5VA 1V4SA 2AP1A 1ESVA 2P9KB 2AA4A 3P4IA 3ZEUA 3QDKA 2P9NB 1NLVA 2P9UB 1E4GT 3R9PA 4IO8A 4RWTA 4CD3A 3VGKA 3D2FB 3CETA 5AZJB 4BRCA 4BC3A 4YDUC 2W41A 3UKRA 4XH1A 4M63C 1NGEA 4JD2A 2ASPA 5AQHA 5AQKA 4FOEA 1YVNA 1QZ5A 2P9KA 2NZTA 3VF6A 2QWOA 2P9NA 3M3ZA 2P9UA 1SQKA 4F9OA 3D2EB 1D4XA 4A2AA 1Q18A 3UB5A 1YAGA 3D2FA 2F9WA 5AZJA 5AZIB 1HKBA 1ZBSA 3TPQA 3WXLA 5BRFA 5KQDA 4K42A 3VGLA 3WQUA 2HF4A 5BREA 3WXKA 3R8EA 3R6MA 3KHYA 2E1ZA 3A5MC 2P9IB 1GLJO 5F1XA 2HF3A 3QB0A 4L3QA 3ATUA 1BA0A 3DWLA 3CHWA 1GLLO 5EVZA 4GY2B 5FPDA 1HX1A 4FO0A 3WXIA 4BR7A 1RGIA 1SZ2A 3O4WA 1NGCA 2YJFA 5AQRA 3QFPA 5FPNA 1DKGD 2V52B 2A41A 1MWMA 1MA9B 4BRNA 1KXPA 2QWRA 3O5BA 4WQ5C 2P9IA 5AQQA 4CZKA 1Z6RA 3OHRA 4H0TB 4ISGA 5BN9A 4XEIA 5AFUA 4H0YB 5KPZA 3CJBA 2D1KA 2VCPA 5BPNA 3UE5A 4BR2A 4ISFA 4CD1A 4H0OA 2H3GX 2Q0UA 2YI1A 3O80A 2ZGYA 2CGKA 1ATRA 1XC3A 2UYTA 1JCGA 4JN4A 1X9JA 3FGUA 3EN9A 3AAPA 2QWLA 3SMSA 4M7YA 2E20A 2QWPA 3LM2A 4MO5A 1ATSA 5EOYA 5F2RA 3VF4A 2YHXA 2P9PA 3DXKA 1QZ6A 1XQSC 3U4LA 1RDWX 4H5WA 1NGJA 3AAQA 1NGAA 4M7XA 4EHUA 1GLCG 5AQLA 3H45C 5LJVA 1IG8A 1BWFO 2A40A 3CI5A 1GLFO 2E2OA 3H3OB 3IUCA 4B1XB 4CZMA 4FL9A 3O08A 3ZX2A 3GE1A 3VERA 3ZX3A 1KAYA 3WXJA 5AQGA 4JAXA 3BF1A 2YHYA 5F0XA 2IVPA 3CIPA 4H0XB 1TUYA 4Z94A 2GWKA 4FWSA 3VF2A 4RTFD 3U9ZA 4PL8A 2D0PA 3C7NA 2QW9A 5AQVA 5AQUA 4BC5A 2GWJA 4WYBA 1ZC6A 1HKGA 3DJCA 4MLHA 3BF3A 4BRDA 4EHTA 2Q0RA 3WQTA 4FWKA 1U6ZA 3FZFA 3CJ7A 4EAHD 3IMXA 3U9DA 3VEVA 1Z05A 1T6CA 1BG3A 5AQOA 3LM9A 1R59O 3GBTA 1Y64A 3WT0A 5BRHA 2Q2RA 2GELA 3ULEA 4BRMA 4CJ7A 1ZXOA 2E2PA 2YCHA 2VYPA 1TYQB 3H46O 4E1JA 3LDQA 4CZIA 2YHWA 3QBWA 4FWPA 4JNEA 4A61A 1NGIA 3KZBA 1NGFA 2BTFA 1IJJA 3EO3A 3EKSA 3A5NC 1J6ZA 2IVOA 4B1UB 4BVOA 3H1QA 4BRPA 4CI6A 5KPRA 3H1VX 4K43A 1JCFA 1KAZA 1BU6O 3VEWA 1TYQA 2D0OA 2V7YA 4NB4A 3VEYA 4BREA 1GLBG 4MO4A 3CERA 3JXUA 3FZHA 2PBDA 3FLCO 3D2EA 5AQYA 4HTLA 4BGAA 3EL2A 4CZHA 3IFRA 4AM7A 5AZIA 4CZLA 4IZ9A 3FZLA 4H5RA 4BR4A 3EZWA 1MWKA 3W3DA 2EWSA 4CZGA 2PAVA 3GOIA 3KVGA 3L6QA 1T6DA 3C0BA 2I7NA 3U8XA 3VENA 2FF3B 4RCHA 4BRQA 4PL7A 1YUWA 2QXLA 4YDUA 3MN6A 2P9LB 2A3ZA 1HJOA 3IDHA 3VOVA 3HI0A 1NBWA 1NWKA 3O1BA 5FPMA 2ASOA 4AM6A 4IJAA 4O5FA 3LDOA 1NM1A 3SMPA 3M1FA 3HSCA 4CBXA 5EXWA 1NGBA 3LL3A 5ELZA 2IIRA 3SLCA 1QQMA 2NRHA 5JLFA 2P9LA 5BR9A 4Y0WA 1WUAA 1ATNA 3RSEB 3ZETB 5BRDA 3GL1A 2HMPA 2A42A 4H5NA 1E4FT 2V7ZA 5AQFA 4FWQA 4BRHA 3I33A 3O1WA 3VEOA 3SK3A 4BC2A 3CJCA 2E8AA 5B8HA 5KPTA 1LOTB 3A0IX 2E2NA 1GLEG 3MN9A 1YXQA 5ADXA 2P9SB 4FWRA 4ISEA 2CGLA 3RSEA 4B9QA 1EQYA 2ASMA 4GNIA 5AQNA 3SJHA 5AQPA 4BGBA 1C0GA 4B1VA 4DQ8A 4WQ5A 1C0FA 3VGMA 3FZMA 4WQ4C 5AQMA 4H0VB 1DGKN 1H1VA 3MDQA 3BP8A 4CBWA 1S22A 3A5LC 3B8AX 3LDPA 4B1WB 1MDUB 2FSJA 3VEZA 3O6WA 4BR5A 3G25A 1NGHA 4LC9B 4BRLA 3HZ6A 4I6MB 3ID8A 1HPMA 2E88A 2VWBA 2ZF5O 3HM8A 3WUHA 1BOTO 2QM1A 3LDNA
chains in the Genus database with same CATH superfamily
5LJWA 2PYJA 3K2PA 2OZMA 1S5JA 1X3MA 4CZEA 5GINA 2YNGA 3VESA 3OYFA 3OJUA 2WONA 2OTJN 4I6MA 4KI6A 4DV0K 2G8IA 4WFAL 3OVNA 4QCLA 4MFBA 2Q36A 3HYFA 4PKIA 1HLUA 2D0CA 3C95A 3MCPA 4CZFA 4B1ZA 3LDLA 4DR3K 3BY5A 4K0KK 3MN7A 3IKMA 4DTRA 1QQOA 5EX5A 1K73O 3P1GA 3TAMA 5AQWA 4DV7K 1XUPO 1RTIA 3IG1A 3VQ4A 1VRTA 1HMVA 2G8HA 4YY3K 5AQZA 3F9MA 3ZX0A 4M3XA 4O8UA 1K8KB 3D7EO 2IVNA 3ISNC 2XO7A 4I7FA 2O8CB 2HOEA 4DTJA 3HP6A 1GOBA 2UXCK 1EO1A 3AVMA 4O8KA 3NMUA 2F9TA 1HUXA 3W0LA 1WBBA 1K8KA 3KLGA 4DHYA 3LP1A 3M8PA 4NYNA 1NGGA 4FPAA 2KZZA 1C6VA 4YOYA 1WSJA 2O8CA 2O8EA 3UIQA 3J80O 3VQ6A 3RMCA 1X9WA 1S1TA 1W7AA 4IO9L 3P38A 1TK8A 3G71N 4W5OA 2WUSA 3MXIA 3JSMA 1UAXA 4KHWA 2FSNA 3U6FA 5CY4A 4OLBA 3CCMN 3WEEB 4IG3A 3DXMB 4IKFA 3KKSA 1NGDA 3O8MA 5M1OA 3VQ5A 1NJYA 4B3SK 4B9UA 4GV3A 5E84A 1RTHA 2QEXN 4Z4FA 1P8ZA 4FYDA 3CJ1A 3G10A 3DOKA 4BRAA 4JRPA 2P9PB 1RT2A 5KQ8A 3WEEA 3SPYA 3FE1A 3DXMA 3A2FA 2ZWHA 3V9UA 1HKCA 3FZKA 2ZJPL 1O1WA 4IJNA 1BUPA 3CD6N 3A8YA 2I7PA 3CCQN 4B3OA 2VQEK 4IWVA 3L4IA 5M1NA 4OX9K 4K25A 2P9SA 4EZ6A 3K0SA 4FM1A 3SYZA 5AQSA 2BUPA 3L2WA 4DR7K 2QK9A 2HSTA 4J8FA 4JS4A 1SL2A 3QIPA 2ZJRL 3C7NB 4DFPA 2FLOA 4A62A 5LMNK 3VTIA 4BR9A 3BEXA 2YNFA 1A5WA 3ZSVA 5KRTA 1YJNN 3JS6A 4CZJA 3D45A 1YIJN 3VQDA 4IOXA 4DV3K 3LALA 5FROA 5E41A 3L0QA 3J8AA 2WBNA 4WE1A 4DTOA 2Q31A 3HP9A 1TK5A 4OO1J 4OPJA 1HQUA 4JI5K 1XNQK 4H8KA 4CEBA 1EKEA 3TAFA 1SAZA 1HNZK 4JD2B 1VAZA 4NLCA 4Q0BA 1J5EK 1JL1A 3SAFA 1M1KO 1RILA 3DOLA 2P9UB 3R9PA 4RWTA 1VQ6N 1B9DA 3D2FB 5AZJB 4BRCA 1Z25A 3BZCA 4Y1DA 4XH1A 4JD2A 2KZMA 2HNYA 4A5BA 4DV4K 4CVNE 2P9UA 4UQGA 1RT7A 4NCGA 2OPRA 1XMOK 3DRSA 4FK4A 4FZXC 3TSQA 4PY5A 1YAGA 5J2NA 3D2FA 2VQFK 5AZJA 1ZBSA 5TKWA 4DU4A 3IAYA 2F4VK 5HRSA 4CJKA 3VGLA 2HF4A 2ZJQL 4GW6A 1YT3A 5J2MA 4EZ9A 2VGNA 3I56N 3THXA 1VQ5N 2HMIA 5F1XA 3QB0A 1KD1O 1BA0A 4BE0A 4FJXA 5EVZA 4GY2B 4O0IA 1YHQN 4CJ5A 4FO0A 2V52B 4YOUA 1MA9B 4LSLA 2NRZA 1W0HA 4CFDA 4LF9K 4CZKA 3K5OA 2B4JA 4H0TB 5BN9A 4O5BA 5J2QA 4N56A 1Q81O 3D6RA 4RW9A 4CD1A 2H3GX 3O80A 2ZGYA 5CYQA 3HSTB 3CCUN 4KTQA 4I9LA 1BCOA 1NKBA 1XC3A 2WTUA 1JXBA 3EN9A 3AAPA 2O8DB 1T03A 3LM2A 4CIEA 4IFEA 3WNFA 4CFBA 1QZ6A 3O3HA 3U4LA 3S3MA 4H5WA 1VQON 3G0ZA 4EHUA 4B9VA 1NG9A 1GLCG 2O8DA 3LWMA 3M5RA 2A40A 2E2OA 3ZSXA 4JKDA 1BGXT 5GIOA 3VERA 3ZX3A 4Z4IA 1RBTA 3NVKA 4JAXA 5F0XA 1C1BA 1IKXA 4JI3K 1UA0A 4ID5A 3VQ7A 2GWKA 4FWSA 1S9EA 4RTFD 2GV9A 3AO3A 4PL8A 4CFAA 5C0YA 3C6TA 3F73A 4E7HA 4GMJB 5M1FA 1TGOA 4CGHA 4M42A 3DJCA 5C10A 3WQTA 4FWKA 5AJ3K 3CJ7A 3IMXA 1FK9A 3U9DA 3HOTA 3VEVA 1Z05A 4CEQA 2E6MA 5AQOA 3I55N 1R59O 3V1OA 2I5JA 1TKTA 4OGEA 3TTDA 3WT0A 2GELA 3RTVA 2UU9K 4CEEA 4CJ7A 2R7YA 3H46O 3LDQA 4A61A 5T7BA 4E19A 4JKGB 5CZ1A 1TKZA 2BTFA 1CZ9A 1RDAA 1K8AO 3K5MA 1S9GA 1WB9A 3KD5E 1BL3A 4CW7B 4X62K 1ASVA 3T1YK 1RDUA 3H1QA 4BVOA 5KPRA 4BWJA 1JLAA 4LFAK 4CJPA 1BU6O 3TI0A 1JLBA 3CERA 3TAEA 4AQYK 4HTLA 4BGAA 3EL2A 3IFRA 3JAMO 3DRPA 2HBKA 3HO1A 4CZLA 4H5RA 4LFBK 1MWKA 3PV8A 3L6QA 4LF8K 4FJ9A 3C0BA 3U8XA 1U48A 3E9LA 1RBUA 4FJ5A 4BRQA 2KQ2A 3MN6A 4KB1A 5M1KA 2PY5A 4O5FA 3QEXA 3ULDA 4B9LA 1CXUA 4G1QA 3M1FA 4CBXA 1BIZA 1C0MA 3LL3A 1X1PA 4E3SA 2D0BA 4BACA 2A42A 1E4FT 5AQFA 1P90A 4BRHA 3O1WA 3OYJA 3ZCMA 3SK3A 3CC7N 4B9MA 4E89A 3RRHA 2PYLA 1LW0A 2VGMA 2E2NA 4CHQA 4CF0A 3S3OA 3H08A 3QO9A 1NK7A 1GLEG 4DUZK 3CC2N 4ISEA 2CGLA 1HYZA 3OS0A 1R0AA 2F8TA 5J2PA 4B9QA 1EQYA 2ASMA 1KVAA 4CE9A 4KHNA 4BGBA 1C0GA 1WN7A 4DQ8A 3DLLL 4WQ5A 4LF4K 3VGMA 3FZMA 4AH9A 4H0VB 2XRIA 3MDQA 3BP8A 3B8AX 3KJVA 4CEZA 4E1MA 1VQNN 2A1RA 2OPPA 1NGHA 4LC9B 5FLXO 3HZ6A 4CECA 3CFPA 2E88A 3HM8A 3WUHA 4B3RK 2F96A 4CJQA 1W97L 1N33K 3LZIA 4DTMA 1HNVA 3OBWA 1IKYA 3SUQA 3ZSZA 4CHOA 5JVGL 1XC9A 3CFRA 3M8SA 3U3YA 5EY4A 4CGJA 3AO1A 4BRGA 3EKUA 2A5XA 4J2DA 4A2BA 1CLQA 1WSIA 5AQIA 1X9SA 2BGGA 1TKXA 3T1HK 2XY5A 4CJWA 3L8BA 4FM2A 1S3XA 3NCIA 4DTNA 4NXNK 1VQ8N 4DLGA 3SJJA 4RW6A 3ZLJA 1JCEA 2ZQBA 5CYMA 1KFSA 2O8BB 3B6OA 4I2QA 4W5QA 3GG4A 4WFNL 3V6DA 4HCCA 4DSLA 3EY1A 2HBJA 4MLEA 4AHVA 1DTQA 4DB3A 1TUUA 1G99A 3KWGA 4FWOA 3RMDA 5DM7L 1RDBA 1VSJA 4H03B 4GKJK 3OYIA 1NOZA 3C6UA 5I42A 2O8BA 1FJGK 4PKHA 5JVHL 2F7TA 3CQYA 1VSHA 3RMBA 4FZYA 3OY9A 4AILC 1RT3A 4KBOA 3C94A 4DV5K 3CCJN 1NMDA 3K57A 4HWIA 1OVQA 4LH5A 4F4KA 1BDGA 4BDYA 3OS2A 2NRTA 4HUFA 3AO5A 4ILGB 3ATVA 3SQ1A 2ZM6K 4CCHA 2CGJA 2KKZA 3F5TA 1KRPA 3M8QA 3BUZB 4LD0A 4MQ3A 3ZSYA 5HROA 2KHOA 3A5OC 4C1NK 4CJSA 3J7ZO 1IG9A 1RT4A 2QWQA 2NRVA 5JICA 4MDAA 3TTCA 4CJUA 4NO7A 4FJJA 3OYNA 2QWNA 2X6NA 4FSVA 4CF8A 3QNOA 4LF6K 4PKGA 4DMNA 2Z1JA 3DXKB 4H5TA 3MXMA 4FOIA 5JLHA 1ZYQA 1VQ7N 4EFHA 4E7LA 4CFCA 4CJ4A 1L3UA 3M6GA 4DF8A 2QWMA 4FWMA 3M8RA 4KB0A 2HHSA 1D9DA 5A2QO 1RFQA 1OVYA 4CF1A 4KH6A 4E7KA 4BQZA 1N32K 4AF1A 2G8VA 5AQTA 3QBXA 3TAPA 3MN5A 3EZ5A 2XY8A 4BG9A 4CGGA 4IDKA 4AHCA 2GEMA 4B08A 1U2VB 2E1YA 4CJRA 5CE3A 4ZTJA 1Q86O 1N5YA 3HPHA 3MCAB 1KQSM 4CEOA 2BH1A 2A1SA 4FPBA 4X64K 4F8RA 4FLWA 5TKYA 4BRIA 2NLXA 4H0PA 2OTLN 1U2VA 4FJLA 4EIAA 2DPNA 4YOXA 4CK1A 4JYAK 1UA1A 3ULEB 1OH5A 2P5GA 2AP1A 1QSSA 1J54A 1CXQA 1JLEA 1NLVA 4FK0A 1E4GT 4IO8A 4CD3A 3VGKA 5HRNA 1XNRK 3CETA 1XHZA 1U45A 1JXEA 3CC4N 3LPUA 4BC3A 5GAEP 2W41A 3RRGA 4NCAA 5AQHA 5AQKA 2WOMA 4ILHA 1QZ5A 3THYB 3M3ZA 2YNHA 1SQKA 5M1PA 4F9OA 3D2EB 1RNHA 1D4XA 2FBTA 4F3OA 3UB5A 4JI7K 1S1VA 3TPQA 1HKBA 4JLHA 1NKCA 2YKMA 4K42A 4KAZA 5BREA 2BDPA 1NK8A 3WXKA 3R8EA 1NK5A 4EP5A 3K5LA 4OKJA 3THYA 1LWCA 2X6SA 2E1ZA 1TV6A 1GLJO 3JYTA 3DWLA 2RN2A 3TAQA 1VQ4N 4RW4A 4BR7A 1RGIA 3O4WA 1NGCA 2YJFA 3WNGA 1BQNA 2VG7A 4BRNA 4JS5A 1KXPA 1Q9XA 2QWRA 3SI6A 3OHRA 2FC0A 4ISGA 4IOAL 1VQ9N 1SL1A 4C8LA 4JEPA 5KPZA 1D9FA 5BPNA 1FW6A 3AVCA 4OGCA 4BR2A 2LSNA 4H0OA 4CHPA 4KV8A 1QVFM 1ATRA 2RPIA 4FVUA 4DS5A 1XHXA 3LPTA 1NJIO 3SMSA 4CGDA 1BIUA 4M7YA 1EWRA 2E20A 2QWPA 2VWKA 1ATSA 3PSIA 4M45A 3PO4A 5F2RA 2P9PA 3NVMA 3L4QA 2OPQA 4EP4A 4FJMA 1FKOA 1FKPA 1KCFA 2HNDA 3VA0A 5AQLA 3HPGA 3H45C 3HJFA 1SV5A 3PUFA 1S1XA 1IG8A 3CI5A 1SS6A 5LMUK 1VQPN 4ID1A 2HHHK 4C8MA 3O08A 3AVFA 4O0JA 1LWFA 4Z4EA 2EHGA 3O9UA 3AVKA 3BF1A 1TUYA 2NUBA 1U49A 4NXMK 3C7NA 2QW9A 4F2RA 4B8CA 3L2UA 4IEIA 2JLEA 1EETA 4GVEA 3IS9A 2Z1IA 3LDSA 4BRDA 2XY6A 4AHRA 2Q0RA 3FZFA 5KTQA 4N5SA 3OA9A 2DFEA 2WFBA 2UUBK 2G8WA 3QEPA 1O13A 2HBMA 1T6CA 3C6AA 1BG3A 4J2BA 1BI4B 3CPWM 3T3FA 1GOAA 1HNXK 3KTQA 2E2PA 1RT1A 1XMQK 1U4BA 3SV3A 3DLRA 4Z0UA 4DKWA 3VN5A 3E1YA 1HJRA 1L3TA 4YORA 1RBRA 3A5NC 1BI4A 3EKSA 1JLQA 3ZT0A 4DQIA 1C0TA 3H1VX 2B5JA 1JCFA 1HQEA 1KAZA 4X66K 4BREA 3CFOA 1GLBG 3AGRA 4GV6A 1VQKN 4MO4A 4GKKK 1KVBA 3FZHA 2PBDA 3FLCO 1T8EA 5AQYA 4RW7A 1LW2A 3HVRA 1KTQA 2HHXA 3OYDA 3FZLA 4BR4A 2NNWA 4CZGA 2PAVA 3KVGA 4FJ8A 1IBLK 2KLAA 4RCHA 4J2AA 4PL7A 2GUIA 2P9LB 3CMAN 1NBWA 1NWKA 3O1BA 5FPMA 2ASOA 4IJAA 4AHUA 4DR6K 3AA4A 4XIUA 3TABA 3CYMA 4IEEA 4O44A 5KRSA 2XY7A 4DLEA 1QQMA 3D0PA 2P9LA 1S6PA 3ZETB 5BRDA 4H5NA 4C8NA 2NRRA 4J2EA 4BC2A 3CJCA 3P31A 4CJTA 4KHSA 4CGIA 5B8HA 1LOTB 1HNIA 4BDZA 4YOVA 2XHBA 1IO2A 2ZE2A 1IKWA 1E3MA 3IRXA 1QQCA 2Z1GA 4Z4HA 4GNIA 3SAHA 5C2FA 4FM0A 3AVGA 1J9AA 2YKNA 3O9TA 3K9JA 4WQ4C 4LY7A 4HUGA 2YHBA 1S72N 1H1VA 1S22A 2OCEA 2ITGA 1Q82O 3R1XA 1BOTO 1ZBFA 2QM1A 5KPTA 4FJKA 4BDPA 4M3WA 5FPEA 3DLGA 4HUEA 3SV4A 4CHYA 2O8FB 3HL8A 4JRQA 1OH7A 5J1EA 3VETA 3DI6A 3I8BA 1B92A 5AQJA 3VEXA 5HOOA 1ASWA 3SUPA 1NKEA 1QVGM 4E1NA 4DFKA 1DLOA 2QI2A 1WLJA 1HPZA 2FSKA 1SL0A 1SKRA 5M1QA 1LWEA 3AVBA 4KHUA 4TSXA 4JI4K 3QIOA 4WQ4A 2CH5A 5HRRA 3OYAA 4Z4GA 4DCHA 1XI1A 3AVAA 3QICA 3VA3A 1NJWA 1NJXA 4KHYA 3NF8A 3AARA 3NF9A 2HVIA 3DLHA 1DT9A 1DEJA 4JKGA 1I39A 4JHDB 4H4MA 3O9SA 2UUAK 3CJ9A 4Z4CA 3QERA 4DQSA 1ZBLA 4N41A 3LAKA 3H3NO 1VRUA 4KH5A 1X3NA 2GTDA 5GADP 1BO5O 2W42A 2BE2A 4JHDA 4KTZA 3ENOA 3SBGA 1Z26A 2DTUA 3T1AA 4K8XA 4DS4A 3ENBA 2Q97A 1TKDA 2ZGZA 3GDQA 1BQMA 3DAWA 4DSKA 3PLAA 4FJ7A 3ZYYX 1KLNA 4CHNA 2FF6A 3TR8A 1OKJA 4DWIA 2G8UA 4M3TA 3CJAA 1L3VA 4KRFA 1BA1A 2E6LA 4DSIA 4FWLA 4B3TK 3FFKB 3KLEA 3ZT3A 3V4IA 1NK4A 4BC4A 4QS8A 3DLKA 2YNIA 1A5VA 3AVIA 1CZAN 2RKIA 3SQ4A 2A6AA 1XWLA 3OW2M 4ZHRA 2ATQA 4PHTX 3MWTA 3OJSA 2V51B 3PX4A 4F2SA 2DY4A 4F3TA 4DQPA 3QEIA 1HNWK 1N6QA 2O4IA 1FXXA 4B1YB 2BANA 2Q3SA 4NYFA 5AR0A 5JMVA 3C65A 5AFUH 3ZSWA 4KH4A 2YJEA 3NGYA 1QHAA 5BPMA 3I8DA 4BY9C 1GLAG 3HXMA 1EP4A 4DFJA 3QMLA 5IWAK 4LF7K 1WAJA 5LL6Z 1KAXA 5I9EB 3S41A 2D4WA 3OYBA 3OYGA 3AY9A 1QSYA 5SWMA 1VSFA 3RR8A 1LAVA 5I3UA 3TWHA 3TAGA 1IKVA 5ADXH 3QESA 4H5VA 3NDKA 3ZSQA 3P4IA 4YFUA 2P9NB 3OS1A 5JS1A 3HK2A 3DLEA 3WNHA 1S6QA 3E66A 4M3RA 4AHTA 4IFYA 5GAHP 1QHTA 4IFVA 4CEFA 4YDUC 1NGEA 2E4LA 3Q7BA 2ASPA 3K5NA 4JKEA 3TSUA 4DFMA 3SQ0A 3MX5A 1ZBHA 2P9NA 3HRGA 4JI8K 3THWB 1T05A 4CK2A 4LFCK 3AVNA 1NK0A 1ZBUA 4KREA 5AZIB 3WXLA 5BRFA 4JV5K 3LZJA 4ELVA 2X78A 2QKKA 2NRWA 3R6MA 3VMFB 3KHYA 1VSKA 3THWA 2HF3A 4PWDA 3VQ8A 3VQQA 5DM6L 3CHWA 5KGWA 1U04A 5FPDA 3WXIA 4JKBA 3T69A 1C1CA 1S1UA 5FPNA 2OZSA 3KLIA 1DKGD 2A41A 3CM5A 1RBSA 4U7BA 2VWJA 4PUOA 3DRRA 3P5JA 2P5OA 3O5BA 3OYMA 1NOYA 4LSNA 5AQQA 4YOTA 4DV2K 4DV6K 4B9SA 1N8RO 3N4QA 5AFUA 4DUYK 4H0YB 1SKWA 1TAQA 4Y1CA 2D1KA 3V81A 2VCPA 3LP0A 3UE5A 1LAWA 4ISFA 3O9QA 2O4GA 3TANA 4FJGA 2KW4A 2UYTA 1X9JA 1K9MO 3FGUA 1VSEA 4R79A 3ID6A 3AA5X 2QWLA 4JI0K 1CZBA 1VHXA 4OPKA 4FJIA 1G15A 2FBXA 1IH7A 3VTHA 4FLUA 2VG5A 5GAGP 5CHIA 3VF4A 4FLYA 3DXKA 1XQSC 1RDWX 3VQBA 1WAFA 4QAGA 1NGJA 3DLBA 3AVHA 1NGAA 4M7XA 5C24A 4QOZB 3SQ2A 1YI2N 4JI6K 5LJVA 1UOCA 3E9PA 1BWFO 4GV9A 1WSHA 2GX9A 4FL9A 1EXQA 3GE1A 4DU1A 2HVHA 3MWPA 3WXJA 5AQGA 4DSEA 3ZSRA 3EE8A 3CIPA 3CM6A 1JLGA 4AHSA 4DG1A 2JGUA 3K58A 1BCMA 1NK6A 3MEEA 2IGIA 2D0PA 2IS3A 5HP1A 3LAMA 2UXDK 4DTUA 5AQVA 5AQUA 1ZC6A 2PFUA 1HKGA 1RBVA 4MLHA 3BF3A 4JI2K 3J7YP 1U6ZA 4LH4A 3OBYA 3ZSOA 2Y1JA 1JLCA 3SPZA 3CPEA 3GBTA 4NLBA 1NK9A 3KKRA 1JKHA 3ULEA 2VYPA 4CJFA 2YHWA 2FBYA 4FWPA 4JNEA 3NH0A 1U47A 3KZBA 1C1AA 1NGFA 1IJJA 3EO3A 2KTQA 3EEQA 1DTTA 4RG8A 1L3SA 4E7JA 2X74A 2IVOA 4B8AB 4BRPA 4CI6A 4K43A 1T7PA 2IDOA 2D0OA 3KK1A 3VEYA 4BE1A 2KFZA 1F21A 4FLVA 2ZD1A 2O8EB 3KLHA 4JI1K 3P39A 3D2EA 1I94K 4CZHA 4I2PA 4AM7A 4CEDA 1ILYA 4YHHK 3C6HA 3P83D 4N47A 2Y1IA 3W3DA 2HHUA 3PO5A 4OKEA 3K59A 2I7NA 3VENA 2FF3B 1YUWA 3QETA 2A3ZA 1HJOA 1KVCA 4E0DA 2P51A 3HI0A 5KGXA 3KK3A 5FRNA 4AM6A 3LDOA 5MLCQ 2JWLA 3PX0A 3PY8A 1RDCA 4Q5VA 5C25A 2OYQA 1QS4A 5K14A 4JKFA 4KHPK 3CQ8A 5D3GA 1JLFA 5JLFA 4DTPA 4DR4K 3GL1A 1YITN 2HMPA 3HT3A 1K6YA 2V7ZA 4FWQA 1MU2A 3BZKA 3VEOA 3V9WA 3E01A 2E8AA 5HBMA 1BHLA 1TL3A 3A0IX 3MN9A 1YXQA 4FVMA 3V9SA 2P9SB 4FWRA 2HHVA 5HRPA 3WNEA 1NNEA 5CR4A 3KIOA 3ALYA 4LF5K 3SUOA 2UXBK 3NH2A 3DYAA 3LP3A 1OH6A 2VG6A 4KKOA 4B1WB 1MDUB 3VEZA 3OTOK 3O6WA 4BR5A 1HRHA 4E7IA 2ZF5O 4MDBA 5CZ2A 4K8ZA 1YTUA 4DU3A 3N4PA 3AO2A 2IC3A 4DQRA 1QQNA 3EE9A 4JKCA 4C1NI 2HHWA 2DFFA 1EWQA 3NAEA 3BGRA 4W5RA 3OYHA 2PZSA 4IXCA 4CBUA 3HM9A 3L2RA 1ASUA 3ENHA 4FZZA 4C23A 2HNZA 1WOQA 3T7ZA 4CHZA 4XH4A 1YVUA 3H6EA 3VPZA 3MXJA 5BPLA 2OA8A 4ILJA 3WXMB 3RR7A 3VQCA 3MMVA 4CK3A 3CQXA 2J4RA 3L2QA 4CF2A 3TSPA 1VQLN 1KC8O 4JK7A 3TARA 4CIGA 3PSFA 3G6EN 1GLDG 1VSIA 2G8KA 4JKHA 4NCBA 3THXB 4XH5A 3UKUB 3MECA 3CCSN 1T44A 2GBZA 2NRXA 5FRMA 3MEGA 3HPOA 3KD1E 4KHQA 2E2QA 4K41A 3SBTA 4H4OA 3QFUA 2IAJA 3NGZA 4IDHA 5DK5A 1LCUA 4BRFA 4BQLA 4QS9A 3CCRN 5IT9O 1NMNA 3QINA 4IBNA 3VQ9A 1NU0A 3UKUA 2QKBA 5C2DA 1OH8A 1TVRA 5LY3A 1HYVA 2ITMA 4BVPA 1TK0A 3ZT1A 3LANA 3MK6A 2D0AA 3J7AP 4YOWA 3VQEA 2GUPA 2RF2A 4IG0A 2YV0X 2OANA 2FXUA 1RT5A 5BN8A 4FCYA 3CXCM 3V9ZA 3PIOL 1S1WA 1Y97A 3RWUA 4OJRA 4FK2A 4G9ZA 3ZETA 2DFHA 1WNSA 5E26A 4JK8A 1WBDA 1V4TA 1IBKK 2P1JA 5C15A 4BG8A 3MX2A 4QS7A 4ELUA 3RMAA 1RTJA 4I9QA 3FR0A 3HTVA 2HHQA 3TU5A 3QEVA 3Q7CA 3K9KA 3NF7A 4O55A 4DR1K 1YTAA 3NBPA 4B3MK 2KFNA 3F9KA 4BROA 2RHKA 2Q1NA 4W5TA 4ICLA 4JK9A 4DSJA 5BR8K 5H1SQ 5DMRA 3LP2A 3VQPA 3CCVN 3HBTA 1NJZA 2JWKA 4OKKA 3KK2A 3ZEUB 2CH6A 4CESA 2RE2A 5AQXA 3T19A 4BR0A 2W40A 4BRKA 4CF9A 3F2KA 2O8FA 1EX4A 4FW1A 4FWNA 3UKRB 3KWIA 4X65K 3NHGA 1V4SA 2QA4N 1ESVA 2P9KB 2AA4A 3ZEUA 3QDKA 4C8OA 4DV1K 3FFIA 1I3AA 3ZT4A 2IOCA 3CG7A 4HVJA 3S3NA 1L5UA 1N36K 3UKRA 1W9HA 3ASMA 4OPHA 4CGFA 4M63C 3V1RA 1J5OA 4FOEA 1YVNA 4L8RB 2P9KA 2NZTA 1QE1A 3VF6A 2QWOA 2F8SA 1B9FA 4A2AA 1Q18A 1TL1A 1Q9YA 2W6KA 3ITHA 2F9WA 4JKAA 4HTUA 4O4GA 5KQDA 3WQUA 2QTDA 4KPYA 4HCBA 1VK0A 3LWLA 1ITGA 3AGKA 3CCEN 3A5MC 2P9IB 5HL7L 4L3QA 4A5AA 3ATUA 4CERA 1BISA 1HYSA 4W5NA 1GLLO 3THVA 1HX1A 3SZ2A 3TTFA 3NGIA 5KI6A 1SZ2A 4C8KA 5AQRA 3QFPA 4DSFA 1W2BM 1JL2A 1MWMA 4FXDA 3AO4A 4WQ5C 4DTSA 4V19S 2P9IA 4CJVA 1Z6RA 4OLAA 3NE6A 4CEAA 4XEIA 3L3UA 3KK7A 4DR2K 3CJBA 3AV9A 4BWMA 5HLFA 4N76A 2Q0UA 2YI1A 1D5AA 2CGKA 4UY8O 1JCGA 4JN4A 4M3UA 1Q8IA 4PA1A 5SZTA 1RDDA 3AA3A 3OYEA 1LV5A 3DMJA 4MO5A 2B6AA 3U3GA 4M3YA 3J81O 5EOYA 2YHXA 1UWBA 3O4NA 4DTXA 4KTWA 2QXFA 3AAQA 2E5LK 1HR0K 3QNNA 3BDPA 1YJ9N 4CJLA 1RT6A 3OYKA 3V1QA 3SUNA 1A5XA 1GLFO 3H3OB 4RW8A 3IUCA 4B1XB 4CZMA 3ZX2A 1ZBIA 4FLXA 3O3GA 1YJWN 1KAYA 1Q7YO 4KI4A 2YHYA 3O9RA 2IVPA 4H0XB 2W6LA 4OPAA 3NH1A 1KLMA 1QSLA 3VQAA 4Z94A 3VF2A 3HOSA 3CF5L 3U9ZA 3OYCA 1SKSA 3I0SA 3MAQA 4BC5A 4FLTA 2GWJA 4WYBA 5C12A 4CJEA 1T3VA 4EHTA 4WFBL 4FLZA 2G8FA 4EAHD 1REVA 5FDLA 2YX6A 3QEWA 3RVCA 3O3FA 2Z1HA 1RCHA 3CMEN 3LM9A 4FJNA 1KSPA 1Y64A 5BRHA 2Q2RA 3SAGA 4HHTA 2D5RA 4BRMA 1ZXOA 4R5PA 2YCHA 2HW3A 1TYQB 4CJ3A 4E1JA 4CZIA 3QBWA 1VQMN 1NGIA 2WC9A 3AA2A 3MEDA 4YNQA 4IOCL 3R3LA 1J6ZA 1M90O 3V9XA 4DR5K 1D8YA 2AJQA 4B1UB 3G4SN 3KLFA 3NFAA 2HB5A 4WF9L 3VEWA 1TYQA 1N34K 4B9TA 2V7YA 4NB4A 4CIFA 4FJHA 4BE2A 5JS2A 3JXUA 4PQUA 3QLHA 3I0RA 3SNNA 5EU7A 4OVLA 3AVJA 1RTDA 1WSEA 5AZIA 4IZ9A 4M3ZA 2EX3A 4DF4A 3EZWA 3HVTA 1C0UA 2EWSA 3GOIA 1T6DA 3OYLA 3L2VA 3S9HA 1X9MA 2QXLA 4YDUA 3IDHA 1GOCA 3VOVA 3PIPL 1VSLA 4FW2A 2HHTA 1KFDA 3DM2A 4U67L 1IV0A 1NM1A 4GVMA 3AVLA 3SMPA 3HSCA 5EXWA 3EYZA 1NGBA 4M41A 1J53A 3L3VA 3O4QA 3E9OA 4A57A 5ELZA 2IIRA 4KFBA 3SLCA 2NRHA 4KO0A 3NF6A 5BR9A 4Y0WA 1WUAA 4WCEL 2UUCK 1ATNA 3RSEB 1WSFA 1VSMA 1TAUA 2YHAA 3I33A 1IBMK 3ZT2A 2OPSA 2FBVA 3PX6A 1WSGA 5ADXA 3RSEA 1JJ2M 5AQNA 2HBLA 3SJHA 1YF5L 3CCLN 4B9NA 2ETJA 5AQPA 4A59A 4B1VA 4ZTFA 5GIPA 3B6PA 1VSDA 5C42A 1C0FA 5AQMA 1SUQA 1DGKN 4CBWA 3A5LC 3LDPA 2FSJA 1QTMA 3G25A 3SCXA 4BRLA 4I6MB 3ID8A 1HPMA 2VWBA 4ELTA 4DQQA 3LDNA
chains in the Genus database with same CATH topology
3OBWA 5FPEA 5LJWA 1QQNA 1X3MA 3EE9A 4JKCA 4C1NI 4CZEA 5JVGL 5GINA 3VETA 3I8BA 3VESA 5AQJA 3VEXA 5HOOA 2OTJN 4I6MA 5EY4A 4IXCA 4CBUA 4BRGA 1QVGM 3ENHA 4WFAL 4C23A 2QI2A 2A5XA 3EKUA 2Q36A 4PKIA 1HLUA 4A2BA 1WOQA 3T7ZA 3MCPA 2FSKA 5AQIA 4XH4A 3H6EA 4CZFA 4B1ZA 3LDLA 5M1QA 1S3XA 3MN7A 3VPZA 3IKMA 5BPLA 1VQ8N 4ILJA 1QQOA 5EX5A 3WXMB 1K73O 1JCEA 4WQ4A 5AQWA 3MMVA 2CH5A 1XUPO 3CQXA 3GG4A 4DCHA 2J4RA 4WFNL 2HBJA 4MLEA 4DB3A 1TUUA 3QICA 1G99A 3F9MA 3KWGA 5AQZA 4FWOA 4O8UA 3ZX0A 1K8KB 3D7EO 5DM7L 3TSPA 1VQLN 3AARA 4H03B 2IVNA 1KC8O 4JK7A 1DT9A 1DEJA 4JKGA 3G6EN 4PKHA 4JHDB 5JVHL 1GLDG 3O9SA 3CJ9A 2F7TA 2HOEA 3CQYA 4JKHA 4XH5A 1EO1A 4O8KA 3NMUA 3UKUB 2F9TA 1HUXA 3CCSN 1T44A 4KBOA 2NRXA 3CCJN 1NMDA 3W0LA 3H3NO 2E2QA 1K8KA 4K41A 3SBTA 4HWIA 4KH5A 4DHYA 3QFUA 1X3NA 2GTDA 5GADP 1NGGA 4FPAA 4IDHA 1BO5O 1LCUA 4YOYA 4BRFA 4BQLA 1BDGA 4JHDA 4QS9A 3CCRN 3ENOA 3SBGA 2NRTA 3UKUA 4IO9L 3P38A 5C2DA 3G71N 4ILGB 3ATVA 5LY3A 2WUSA 3ENBA 2CGJA 2Q97A 2KKZA 3F5TA 2ITMA 2FSNA 3BUZB 2ZGZA 3GDQA 3DAWA 4BVPA 3PLAA 3CCMN 3WEEB 3MK6A 3ZYYX 2KHOA 3A5OC 4C1NK 3DXMB 3J7ZO 2FF6A 4YOWA 1NGDA 3O8MA 5M1OA 2QWQA 2NRVA 2GUPA 1OKJA 5JICA 3CJAA 4GV3A 1BA1A 4MDAA 5E84A 3TTCA 2QEXN 2OANA 4NO7A 2FXUA 2QWNA 1P8ZA 5BN8A 4FSVA 4FWLA 3CJ1A 3CXCM 4PKGA 3PIOL 4BRAA 3FFKB 2P9PB 5KQ8A 3WEEA 3DXKB 4H5TA 3FE1A 3DXMA 4FOIA 5JLHA 4BC4A 2ZWHA 4QS8A 1HKCA 4G9ZA 3ZETA 3FZKA 2ZJPL 1VQ7N 4IJNA 5E26A 4EFHA 1BUPA 1CZAN 3CD6N 4JK8A 1V4TA 2A6AA 3M6GA 5C15A 2QWMA 4FWMA 3MX2A 4BG8A 3A8YA 3OW2M 4QS7A 4PHTX 3MWTA 2I7PA 3CCQN 2V51B 3FR0A 3HTVA 3L4IA 4IWVA 5M1NA 3TU5A 3Q7CA 4K25A 3K9KA 2P9SA 4B1YB 1RFQA 1OVYA 4BROA 4KH6A 5AR0A 4BQZA 5JMVA 5AQSA 3C65A 2BUPA 5AFUH 4AF1A 2RHKA 4KH4A 2Q1NA 5AQTA 3QBXA 2HSTA 2YJEA 3MN5A 4JK9A 4J8FA 4BG9A 5H1SQ 1QHAA 5BPMA 2ZJRL 3C7NB 2GEMA 1U2VB 2FLOA 4A62A 3VTIA 2E1YA 4BY9C 4BR9A 3CCVN 3BEXA 3HBTA 1GLAG 5CE3A 1Q86O 3MCAB 2JWKA 1KQSM 1YJNN 3JS6A 3QMLA 4CZJA 1YIJN 1KAXA 2BH1A 4IOXA 3ZEUB 5I9EB 4FPBA 2CH6A 3S41A 2RE2A 2D4WA 3J8AA 3L0QA 2WBNA 5AQXA 4BR0A 5TKYA 2W40A 3AY9A 2Q31A 2NLXA 4H0PA 4BRIA 4OO1J 4BRKA 2OTLN 1U2VA 3F2KA 4EIAA 2DPNA 4YOXA 4FWNA 3UKRB 3KWIA 3ULEB 1SAZA 5ADXH 4JD2B 4H5VA 1V4SA 2QA4N 1VAZA 4NLCA 2AP1A 1ESVA 2P9KB 2AA4A 3P4IA 3ZEUA 3SAFA 3QDKA 1M1KO 2P9NB 1NLVA 2P9UB 1E4GT 3R9PA 4IO8A 4RWTA 4CD3A 3E66A 3VGKA 1VQ6N 3D2FB 3CETA 5AZJB 4BRCA 3CC4N 4BC3A 5GAHP 5GAEP 4YDUC 2W41A 3UKRA 4XH1A 4OPHA 4M63C 1NGEA 3Q7BA 4JD2A 2ASPA 5AQHA 5AQKA 4FOEA 4JKEA 1YVNA 4A5BA 4ILHA 3TSUA 1QZ5A 2P9KA 2NZTA 3MX5A 3VF6A 2QWOA 2P9NA 3M3ZA 2P9UA 3HRGA 1SQKA 5M1PA 4F9OA 3D2EB 1D4XA 4A2AA 1Q18A 3TSQA 3UB5A 1YAGA 3D2FA 2F9WA 4JKAA 5AZJA 5AZIB 1HKBA 1ZBSA 5TKWA 3TPQA 3WXLA 5BRFA 5KQDA 4K42A 3VGLA 2QTDA 3WQUA 2HF4A 5BREA 2ZJQL 3WXKA 3R8EA 2NRWA 3AGKA 3R6MA 3KHYA 3VMFB 3CCEN 2VGNA 2E1ZA 3I56N 3A5MC 2P9IB 5HL7L 1VQ5N 1GLJO 5F1XA 2HF3A 3QB0A 4L3QA 4A5AA 3ATUA 1KD1O 1BA0A 3DWLA 5DM6L 3CHWA 1GLLO 1VQ4N 5EVZA 4GY2B 5FPDA 1HX1A 1YHQN 4FO0A 3TTFA 3WXIA 4BR7A 1RGIA 4JKBA 1SZ2A 3O4WA 1NGCA 3T69A 2YJFA 5AQRA 3QFPA 5FPNA 1DKGD 2V52B 2A41A 4YOUA 4U7BA 1W2BM 1MWMA 1MA9B 4BRNA 2NRZA 1KXPA 2QWRA 3O5BA 4WQ5C 2P9IA 5AQQA 4CZKA 4YOTA 1Z6RA 3OHRA 4H0TB 4ISGA 4IOAL 5BN9A 1N8RO 3N4QA 1VQ9N 4XEIA 5AFUA 4JEPA 3KK7A 4H0YB 5KPZA 3CJBA 2D1KA 1Q81O 2VCPA 5BPNA 3D6RA 3UE5A 4BR2A 4ISFA 4CD1A 4H0OA 3O9QA 2H3GX 2Q0UA 2YI1A 3O80A 1JJ2M 2ZGYA 2CGKA 3CCUN 1QVFM 1ATRA 4FVUA 1XC3A 2UYTA 4UY8O 1JCGA 4JN4A 1X9JA 1K9MO 3FGUA 3EN9A 4R79A 3AAPA 3ID6A 2QWLA 1NJIO 3SMSA 4M7YA 2E20A 2QWPA 3LM2A 4MO5A 1ATSA 3VTHA 4IFEA 5GAGP 5EOYA 5F2RA 3VF4A 2YHXA 5CHIA 2P9PA 3DXKA 1QZ6A 3NVMA 1XQSC 3L4QA 3U4LA 1RDWX 4H5WA 1NGJA 1VQON 3AAQA 1NGAA 4M7XA 4EHUA 1GLCG 1YI2N 5AQLA 3H45C 1YJ9N 5LJVA 3E9PA 3M5RA 1IG8A 1BWFO 2A40A 3CI5A 1GLFO 2E2OA 3H3OB 1SS6A 4GV9A 3IUCA 4B1XB 4CZMA 1VQPN 2GX9A 4FL9A 3O08A 4JKDA 3ZX2A 3GE1A 5GIOA 3VERA 3ZX3A 1YJWN 3MWPA 3O9UA 1KAYA 3WXJA 5AQGA 3NVKA 4JAXA 1Q7YO 3BF1A 2YHYA 3O9RA 3EE8A 5F0XA 2IVPA 3CIPA 4H0XB 1TUYA 4OPAA 4Z94A 2GWKA 4FWSA 3VF2A 3HOSA 4RTFD 3U9ZA 4PL8A 3CF5L 2D0PA 3C7NA 2QW9A 5C0YA 5AQVA 5AQUA 4BC5A 2GWJA 4IEIA 4GVEA 4WYBA 5M1FA 1ZC6A 2PFUA 1HKGA 5C12A 3DJCA 4MLHA 3BF3A 4BRDA 1T3VA 4EHTA 4WFBL 5C10A 2Q0RA 3WQTA 4FWKA 1U6ZA 3FZFA 3CJ7A 4EAHD 3OA9A 2WFBA 3IMXA 2YX6A 3OBYA 3U9DA 3HOTA 3VEVA 1Z05A 3RVCA 3C6AA 1O13A 1T6CA 2HBMA 1BG3A 3CPEA 3I55N 5AQOA 3LM9A 1R59O 3CMEN 3GBTA 3CPWM 4NLBA 1Y64A 3TTDA 3WT0A 5BRHA 2Q2RA 2GELA 3SAGA 3ULEA 4BRMA 4CJ7A 1ZXOA 2E2PA 2YCHA 2VYPA 1TYQB 3H46O 4E1JA 3LDQA 4CZIA 2YHWA 3QBWA 4FWPA 4JNEA 4A61A 1VQMN 1NGIA 3KZBA 2WC9A 4JKGB 1NGFA 4DKWA 2BTFA 1IJJA 3EO3A 3E1YA 1K8AO 4YORA 3EKSA 3A5NC 4IOCL 3R3LA 1J6ZA 1M90O 2IVOA 4B1UB 1RDUA 3H1QA 4BRPA 4BVOA 4CI6A 5KPRA 3G4SN 3H1VX 4K43A 1JCFA 1KAZA 1BU6O 3VEWA 4WF9L 1TYQA 2D0OA 2V7YA 4NB4A 3VEYA 4BREA 1GLBG 3AGRA 4GV6A 1VQKN 4MO4A 3CERA 3JXUA 3FZHA 2PBDA 3P39A 3FLCO 3D2EA 5AQYA 4HTLA 4BGAA 3EL2A 4CZHA 3IFRA 4AM7A 1ILYA 2HBKA 5AZIA 3C6HA 4CZLA 4IZ9A 3FZLA 4H5RA 4BR4A 3EZWA 2NNWA 1MWKA 3W3DA 2EWSA 4CZGA 2PAVA 3GOIA 3KVGA 3L6QA 1T6DA 3C0BA 2I7NA 3U8XA 3E9LA 2FF3B 3VENA 2KLAA 4RCHA 4BRQA 4PL7A 1YUWA 2QXLA 4YDUA 3MN6A 2P9LB 2A3ZA 1HJOA 3IDHA 3VOVA 3PIPL 5M1KA 3CMAN 3HI0A 1NBWA 1NWKA 3O1BA 5FPMA 4U67L 2ASOA 4AM6A 4IJAA 4O5FA 3LDOA 5MLCQ 1NM1A 2JWLA 3SMPA 3M1FA 3HSCA 4CBXA 5EXWA 1NGBA 4IEEA 4A57A 3E9OA 3LL3A 5ELZA 2IIRA 4JKFA 3SLCA 1QQMA 2NRHA 5JLFA 2P9LA 5BR9A 4Y0WA 1WUAA 4WCEL 1ATNA 3RSEB 3ZETB 5BRDA 3GL1A 1YITN 2HMPA 2A42A 4H5NA 1E4FT 2V7ZA 5AQFA 4FWQA 1P90A 2NRRA 4BRHA 3I33A 3O1WA 3VEOA 3SK3A 4BC2A 3CJCA 2E8AA 3P31A 3CC7N 5B8HA 5KPTA 1LOTB 3A0IX 2VGMA 2E2NA 4YOVA 3CC2N 1GLEG 3MN9A 1YXQA 5ADXA 2P9SB 4FWRA 4ISEA 2CGLA 3RSEA 4B9QA 5CR4A 1EQYA 2ASMA 4GNIA 2HBLA 5AQNA 1YF5L 3SJHA 5C2FA 3SAHA 3CCLN 5AQPA 4A59A 4BGBA 1C0GA 4B1VA 4DQ8A 3DLLL 4WQ5A 5GIPA 3O9TA 1C0FA 3VGMA 3FZMA 3K9JA 4WQ4C 5AQMA 4H0VB 1DGKN 1S72N 1H1VA 3MDQA 3BP8A 4CBWA 1S22A 3A5LC 3B8AX 1VQNN 3LDPA 4B1WB 1MDUB 2FSJA 3VEZA 3O6WA 1Q82O 4BR5A 3G25A 1NGHA 4LC9B 4BRLA 3HZ6A 4I6MB 3ID8A 1HPMA 2E88A 2VWBA 2ZF5O 4MDBA 3HM8A 3R1XA 3WUHA 1BOTO 2QM1A 3LDNA 1W97L 3N4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPE A;  5LJW A;  1QQN A;  1X3M A;  4CZE A;  3VET A;  3I8B A;  3VES A;  5AQJ A;  3VEX A;  4I6M A;  5EY4 A;  4IXC A;  4CBU A;  4BRG A;  3ENH A;  4C23 A;  3EKU A;  2A5X A;  2Q36 A;  4PKI A;  1HLU A;  4A2B A;  1WOQ A;  3MCP A;  2FSK A;  5AQI A;  4XH4 A;  3H6E A;  4CZF A;  4B1Z A;  3LDL A;  1S3X A;  3MN7 A;  3VPZ A;  5BPL A;  1QQO A;  5EX5 A;  1JCE A;  4WQ4 A;  5AQW A;  3MMV A;  2CH5 A;  1XUP O;  3CQX A;  3GG4 A;  4DCH A;  2J4R A;  4MLE A;  4DB3 A;  1TUU A;  3QIC A;  1G99 A;  3F9M A;  5AQZ A;  3ZX0 A;  4FWO A;  1K8K B;  3D7E O;  3AAR A;  4H03 B;  2IVN A;  1DEJ A;  4PKH A;  4JHD B;  1GLD G;  3CJ9 A;  3CQY A;  2HOE A;  4XH5 A;  4O8K A;  3UKU B;  2F9T A;  1HUX A;  1T44 A;  4KBO A;  1NMD A;  3W0L A;  3H3N O;  2E2Q A;  1K8K A;  4K41 A;  4HWI A;  4DHY A;  3QFU A;  1X3N A;  2GTD A;  1NGG A;  4FPA A;  1BO5 O;  1LCU A;  4BRF A;  4BQL A;  1BDG A;  4JHD A;  4QS9 A;  3ENO A;  3UKU A;  3ATV A;  5LY3 A;  2WUS A;  2CGJ A;  2Q97 A;  2ITM A;  2FSN A;  3BUZ B;  2ZGZ A;  3GDQ A;  3DAW A;  4BVP A;  3WEE B;  3MK6 A;  2KHO A;  3A5O C;  3DXM B;  2FF6 A;  1NGD A;  3O8M A;  2QWQ A;  2GUP A;  1OKJ A;  5JIC A;  3CJA A;  1BA1 A;  5E84 A;  2OAN A;  4NO7 A;  2FXU A;  2QWN A;  1P8Z A;  5BN8 A;  4FSV A;  4FWL A;  3CJ1 A;  4PKG A;  4BRA A;  3FFK B;  2P9P B;  5KQ8 A;  3WEE A;  3DXK B;  4H5T A;  3FE1 A;  3DXM A;  4FOI A;  5JLH A;  4BC4 A;  2ZWH A;  4QS8 A;  1HKC A;  3ZET A;  3FZK A;  4IJN A;  5E26 A;  4EFH A;  1BUP A;  1CZA N;  1V4T A;  2A6A A;  3M6G A;  2QWM A;  4FWM A;  4BG8 A;  3A8Y A;  4QS7 A;  2I7P A;  2V51 B;  3FR0 A;  3HTV A;  3L4I A;  4IWV A;  3TU5 A;  4K25 A;  2P9S A;  4B1Y B;  1RFQ A;  4BRO A;  5JMV A;  5AR0 A;  4BQZ A;  5AQS A;  2BUP A;  5AFU H;  2Q1N A;  5AQT A;  3QBX A;  3MN5 A;  2YJE A;  4J8F A;  4BG9 A;  1QHA A;  5BPM A;  3C7N B;  2GEM A;  1U2V B;  2FLO A;  4A62 A;  2E1Y A;  4BR9 A;  3BEX A;  3HBT A;  1GLA G;  5CE3 A;  3JS6 A;  3QML A;  4CZJ A;  1KAX A;  3ZEU B;  5I9E B;  4FPB A;  2CH6 A;  3S41 A;  3L0Q A;  2D4W A;  3J8A A;  5AQX A;  4BR0 A;  5TKY A;  2W40 A;  3AY9 A;  2Q31 A;  2NLX A;  4H0P A;  4BRI A;  4BRK A;  1U2V A;  4EIA A;  2DPN A;  4FWN A;  3UKR B;  3ULE B;  1SAZ A;  5ADX H;  4JD2 B;  4H5V A;  1V4S A;  2AP1 A;  1ESV A;  2P9K B;  2AA4 A;  3P4I A;  3ZEU A;  3QDK A;  2P9N B;  1NLV A;  2P9U B;  1E4G T;  3R9P A;  4IO8 A;  4RWT A;  4CD3 A;  3VGK A;  3D2F B;  3CET A;  5AZJ B;  4BRC A;  4BC3 A;  4YDU C;  2W41 A;  3UKR A;  4XH1 A;  4M63 C;  1NGE A;  4JD2 A;  2ASP A;  5AQH A;  5AQK A;  4FOE A;  1YVN A;  1QZ5 A;  2P9K A;  2NZT A;  3VF6 A;  2QWO A;  2P9N A;  3M3Z A;  2P9U A;  1SQK A;  4F9O A;  3D2E B;  1D4X A;  4A2A A;  1Q18 A;  3UB5 A;  1YAG A;  3D2F A;  2F9W A;  5AZJ A;  5AZI B;  1HKB A;  1ZBS A;  3TPQ A;  3WXL A;  5BRF A;  5KQD A;  4K42 A;  3VGL A;  3WQU A;  2HF4 A;  5BRE A;  3WXK A;  3R8E A;  3R6M A;  3KHY A;  2E1Z A;  3A5M C;  2P9I B;  1GLJ O;  5F1X A;  2HF3 A;  3QB0 A;  4L3Q A;  3ATU A;  1BA0 A;  3DWL A;  3CHW A;  1GLL O;  5EVZ A;  4GY2 B;  5FPD A;  1HX1 A;  4FO0 A;  3WXI A;  4BR7 A;  1RGI A;  1SZ2 A;  3O4W A;  1NGC A;  2YJF A;  5AQR A;  3QFP A;  5FPN A;  1DKG D;  2V52 B;  2A41 A;  1MWM A;  1MA9 B;  4BRN A;  1KXP A;  2QWR A;  3O5B A;  4WQ5 C;  2P9I A;  5AQQ A;  4CZK A;  1Z6R A;  3OHR A;  4H0T B;  4ISG A;  5BN9 A;  4XEI A;  5AFU A;  4H0Y B;  5KPZ A;  3CJB A;  2D1K A;  2VCP A;  5BPN A;  3UE5 A;  4BR2 A;  4ISF A;  4CD1 A;  4H0O A;  2H3G X;  2Q0U A;  2YI1 A;  3O80 A;  2ZGY A;  2CGK A;  1ATR A;  1XC3 A;  2UYT A;  1JCG A;  4JN4 A;  1X9J A;  3FGU A;  3EN9 A;  3AAP A;  2QWL A;  3SMS A;  4M7Y A;  2E20 A;  2QWP A;  3LM2 A;  4MO5 A;  1ATS A;  5EOY A;  5F2R A;  3VF4 A;  2YHX A;  2P9P A;  3DXK A;  1QZ6 A;  1XQS C;  3U4L A;  1RDW X;  4H5W A;  1NGJ A;  3AAQ A;  1NGA A;  4M7X A;  4EHU A;  1GLC G;  5AQL A;  3H45 C;  5LJV A;  1IG8 A;  1BWF O;  2A40 A;  3CI5 A;  1GLF O;  2E2O A;  3H3O B;  3IUC A;  4B1X B;  4CZM A;  4FL9 A;  3O08 A;  3ZX2 A;  3GE1 A;  3VER A;  3ZX3 A;  1KAY A;  3WXJ A;  5AQG A;  4JAX A;  3BF1 A;  2YHY A;  5F0X A;  2IVP A;  3CIP A;  4H0X B;  1TUY A;  4Z94 A;  2GWK A;  4FWS A;  3VF2 A;  4RTF D;  3U9Z A;  4PL8 A;  2D0P A;  3C7N A;  2QW9 A;  5AQV A;  5AQU A;  4BC5 A;  2GWJ A;  4WYB A;  1ZC6 A;  1HKG A;  3DJC A;  4MLH A;  3BF3 A;  4BRD A;  4EHT A;  2Q0R A;  3WQT A;  4FWK A;  1U6Z A;  3FZF A;  3CJ7 A;  4EAH D;  3IMX A;  3U9D A;  3VEV A;  1Z05 A;  1T6C A;  1BG3 A;  5AQO A;  3LM9 A;  1R59 O;  3GBT A;  1Y64 A;  3WT0 A;  5BRH A;  2Q2R A;  2GEL A;  3ULE A;  4BRM A;  4CJ7 A;  1ZXO A;  2E2P A;  2YCH A;  2VYP A;  1TYQ B;  3H46 O;  4E1J A;  3LDQ A;  4CZI A;  2YHW A;  3QBW A;  4FWP A;  4JNE A;  4A61 A;  1NGI A;  3KZB A;  1NGF A;  2BTF A;  1IJJ A;  3EO3 A;  3EKS A;  3A5N C;  1J6Z A;  2IVO A;  4B1U B;  4BVO A;  3H1Q A;  4BRP A;  4CI6 A;  5KPR A;  3H1V X;  4K43 A;  1JCF A;  1KAZ A;  1BU6 O;  3VEW A;  1TYQ A;  2D0O A;  2V7Y A;  4NB4 A;  3VEY A;  4BRE A;  1GLB G;  4MO4 A;  3CER A;  3JXU A;  3FZH A;  2PBD A;  3FLC O;  3D2E A;  5AQY A;  4HTL A;  4BGA A;  3EL2 A;  4CZH A;  3IFR A;  4AM7 A;  5AZI A;  4CZL A;  4IZ9 A;  3FZL A;  4H5R A;  4BR4 A;  3EZW A;  1MWK A;  3W3D A;  2EWS A;  4CZG A;  2PAV A;  3GOI A;  3KVG A;  3L6Q A;  1T6D A;  3C0B A;  2I7N A;  3U8X A;  3VEN A;  2FF3 B;  4RCH A;  4BRQ A;  4PL7 A;  1YUW A;  2QXL A;  4YDU A;  3MN6 A;  2P9L B;  2A3Z A;  1HJO A;  3IDH A;  3VOV A;  3HI0 A;  1NBW A;  1NWK A;  3O1B A;  5FPM A;  2ASO A;  4AM6 A;  4IJA A;  4O5F A;  3LDO A;  1NM1 A;  3SMP A;  3M1F A;  3HSC A;  4CBX A;  5EXW A;  1NGB A;  3LL3 A;  5ELZ A;  2IIR A;  3SLC A;  1QQM A;  2NRH A;  5JLF A;  2P9L A;  5BR9 A;  4Y0W A;  1WUA A;  1ATN A;  3RSE B;  3ZET B;  5BRD A;  3GL1 A;  2HMP A;  2A42 A;  4H5N A;  1E4F T;  2V7Z A;  5AQF A;  4FWQ A;  4BRH A;  3I33 A;  3O1W A;  3VEO A;  3SK3 A;  4BC2 A;  3CJC A;  2E8A A;  5B8H A;  5KPT A;  1LOT B;  3A0I X;  2E2N A;  1GLE G;  3MN9 A;  1YXQ A;  5ADX A;  2P9S B;  4FWR A;  4ISE A;  2CGL A;  3RSE A;  4B9Q A;  1EQY A;  2ASM A;  4GNI A;  5AQN A;  3SJH A;  5AQP A;  4BGB A;  1C0G A;  4B1V A;  4DQ8 A;  4WQ5 A;  1C0F A;  3VGM A;  3FZM A;  4WQ4 C;  5AQM A;  4H0V B;  1DGK N;  1H1V A;  3MDQ A;  3BP8 A;  4CBW A;  1S22 A;  3A5L C;  3B8A X;  3LDP A;  4B1W B;  1MDU B;  2FSJ A;  3VEZ A;  3O6W A;  4BR5 A;  3G25 A;  1NGH A;  4LC9 B;  4BRL A;  3HZ6 A;  4I6M B;  3ID8 A;  1HPM A;  2E88 A;  2VWB A;  2ZF5 O;  3HM8 A;  3WUH A;  1BOT O;  2QM1 A;  3LDN A; 
#chains in the Genus database with same CATH topology
 5LJW A;  2PYJ A;  3K2P A;  2OZM A;  1S5J A;  1X3M A;  4CZE A;  5GIN A;  2YNG A;  3VES A;  3OYF A;  3OJU A;  2WON A;  2OTJ N;  4I6M A;  4KI6 A;  4DV0 K;  2G8I A;  4WFA L;  3OVN A;  4QCL A;  4MFB A;  2Q36 A;  3HYF A;  4PKI A;  1HLU A;  2D0C A;  3C95 A;  3MCP A;  4CZF A;  4B1Z A;  3LDL A;  4DR3 K;  3BY5 A;  4K0K K;  3MN7 A;  3IKM A;  4DTR A;  1QQO A;  5EX5 A;  1K73 O;  3P1G A;  3TAM A;  5AQW A;  4DV7 K;  1XUP O;  1RTI A;  3IG1 A;  3VQ4 A;  1VRT A;  1HMV A;  2G8H A;  4YY3 K;  5AQZ A;  3F9M A;  3ZX0 A;  4M3X A;  4O8U A;  1K8K B;  3D7E O;  2IVN A;  3ISN C;  2XO7 A;  4I7F A;  2O8C B;  2HOE A;  4DTJ A;  3HP6 A;  1GOB A;  2UXC K;  1EO1 A;  3AVM A;  4O8K A;  3NMU A;  2F9T A;  1HUX A;  3W0L A;  1WBB A;  1K8K A;  3KLG A;  4DHY A;  3LP1 A;  3M8P A;  4NYN A;  1NGG A;  4FPA A;  2KZZ A;  1C6V A;  4YOY A;  1WSJ A;  2O8C A;  2O8E A;  3UIQ A;  3J80 O;  3VQ6 A;  3RMC A;  1X9W A;  1S1T A;  1W7A A;  4IO9 L;  3P38 A;  1TK8 A;  3G71 N;  4W5O A;  2WUS A;  3MXI A;  3JSM A;  1UAX A;  4KHW A;  2FSN A;  3U6F A;  5CY4 A;  4OLB A;  3CCM N;  3WEE B;  4IG3 A;  3DXM B;  4IKF A;  3KKS A;  1NGD A;  3O8M A;  5M1O A;  3VQ5 A;  1NJY A;  4B3S K;  4B9U A;  4GV3 A;  5E84 A;  1RTH A;  2QEX N;  4Z4F A;  1P8Z A;  4FYD A;  3CJ1 A;  3G10 A;  3DOK A;  4BRA A;  4JRP A;  2P9P B;  1RT2 A;  5KQ8 A;  3WEE A;  3SPY A;  3FE1 A;  3DXM A;  3A2F A;  2ZWH A;  3V9U A;  1HKC A;  3FZK A;  2ZJP L;  1O1W A;  4IJN A;  1BUP A;  3CD6 N;  3A8Y A;  2I7P A;  3CCQ N;  4B3O A;  2VQE K;  4IWV A;  3L4I A;  5M1N A;  4OX9 K;  4K25 A;  2P9S A;  4EZ6 A;  3K0S A;  4FM1 A;  3SYZ A;  5AQS A;  2BUP A;  3L2W A;  4DR7 K;  2QK9 A;  2HST A;  4J8F A;  4JS4 A;  1SL2 A;  3QIP A;  2ZJR L;  3C7N B;  4DFP A;  2FLO A;  4A62 A;  5LMN K;  3VTI A;  4BR9 A;  3BEX A;  2YNF A;  1A5W A;  3ZSV A;  5KRT A;  1YJN N;  3JS6 A;  4CZJ A;  3D45 A;  1YIJ N;  3VQD A;  4IOX A;  4DV3 K;  3LAL A;  5FRO A;  5E41 A;  3L0Q A;  3J8A A;  2WBN A;  4WE1 A;  4DTO A;  2Q31 A;  3HP9 A;  1TK5 A;  4OO1 J;  4OPJ A;  1HQU A;  4JI5 K;  1XNQ K;  4H8K A;  4CEB A;  1EKE A;  3TAF A;  1SAZ A;  1HNZ K;  4JD2 B;  1VAZ A;  4NLC A;  4Q0B A;  1J5E K;  1JL1 A;  3SAF A;  1M1K O;  1RIL A;  3DOL A;  2P9U B;  3R9P A;  4RWT A;  1VQ6 N;  1B9D A;  3D2F B;  5AZJ B;  4BRC A;  1Z25 A;  3BZC A;  4Y1D A;  4XH1 A;  4JD2 A;  2KZM A;  2HNY A;  4A5B A;  4DV4 K;  4CVN E;  2P9U A;  4UQG A;  1RT7 A;  4NCG A;  2OPR A;  1XMO K;  3DRS A;  4FK4 A;  4FZX C;  3TSQ A;  4PY5 A;  1YAG A;  5J2N A;  3D2F A;  2VQF K;  5AZJ A;  1ZBS A;  5TKW A;  4DU4 A;  3IAY A;  2F4V K;  5HRS A;  4CJK A;  3VGL A;  2HF4 A;  2ZJQ L;  4GW6 A;  1YT3 A;  5J2M A;  4EZ9 A;  2VGN A;  3I56 N;  3THX A;  1VQ5 N;  2HMI A;  5F1X A;  3QB0 A;  1KD1 O;  1BA0 A;  4BE0 A;  4FJX A;  5EVZ A;  4GY2 B;  4O0I A;  1YHQ N;  4CJ5 A;  4FO0 A;  2V52 B;  4YOU A;  1MA9 B;  4LSL A;  2NRZ A;  1W0H A;  4CFD A;  4LF9 K;  4CZK A;  3K5O A;  2B4J A;  4H0T B;  5BN9 A;  4O5B A;  5J2Q A;  4N56 A;  1Q81 O;  3D6R A;  4RW9 A;  4CD1 A;  2H3G X;  3O80 A;  2ZGY A;  5CYQ A;  3HST B;  3CCU N;  4KTQ A;  4I9L A;  1BCO A;  1NKB A;  1XC3 A;  2WTU A;  1JXB A;  3EN9 A;  3AAP A;  2O8D B;  1T03 A;  3LM2 A;  4CIE A;  4IFE A;  3WNF A;  4CFB A;  1QZ6 A;  3O3H A;  3U4L A;  3S3M A;  4H5W A;  1VQO N;  3G0Z A;  4EHU A;  4B9V A;  1NG9 A;  1GLC G;  2O8D A;  3LWM A;  3M5R A;  2A40 A;  2E2O A;  3ZSX A;  4JKD A;  1BGX T;  5GIO A;  3VER A;  3ZX3 A;  4Z4I A;  1RBT A;  3NVK A;  4JAX A;  5F0X A;  1C1B A;  1IKX A;  4JI3 K;  1UA0 A;  4ID5 A;  3VQ7 A;  2GWK A;  4FWS A;  1S9E A;  4RTF D;  2GV9 A;  3AO3 A;  4PL8 A;  4CFA A;  5C0Y A;  3C6T A;  3F73 A;  4E7H A;  4GMJ B;  5M1F A;  1TGO A;  4CGH A;  4M42 A;  3DJC A;  5C10 A;  3WQT A;  4FWK A;  5AJ3 K;  3CJ7 A;  3IMX A;  1FK9 A;  3U9D A;  3HOT A;  3VEV A;  1Z05 A;  4CEQ A;  2E6M A;  5AQO A;  3I55 N;  1R59 O;  3V1O A;  2I5J A;  1TKT A;  4OGE A;  3TTD A;  3WT0 A;  2GEL A;  3RTV A;  2UU9 K;  4CEE A;  4CJ7 A;  2R7Y A;  3H46 O;  3LDQ A;  4A61 A;  5T7B A;  4E19 A;  4JKG B;  5CZ1 A;  1TKZ A;  2BTF A;  1CZ9 A;  1RDA A;  1K8A O;  3K5M A;  1S9G A;  1WB9 A;  3KD5 E;  1BL3 A;  4CW7 B;  4X62 K;  1ASV A;  3T1Y K;  1RDU A;  3H1Q A;  4BVO A;  5KPR A;  4BWJ A;  1JLA A;  4LFA K;  4CJP A;  1BU6 O;  3TI0 A;  1JLB A;  3CER A;  3TAE A;  4AQY K;  4HTL A;  4BGA A;  3EL2 A;  3IFR A;  3JAM O;  3DRP A;  2HBK A;  3HO1 A;  4CZL A;  4H5R A;  4LFB K;  1MWK A;  3PV8 A;  3L6Q A;  4LF8 K;  4FJ9 A;  3C0B A;  3U8X A;  1U48 A;  3E9L A;  1RBU A;  4FJ5 A;  4BRQ A;  2KQ2 A;  3MN6 A;  4KB1 A;  5M1K A;  2PY5 A;  4O5F A;  3QEX A;  3ULD A;  4B9L A;  1CXU A;  4G1Q A;  3M1F A;  4CBX A;  1BIZ A;  1C0M A;  3LL3 A;  1X1P A;  4E3S A;  2D0B A;  4BAC A;  2A42 A;  1E4F T;  5AQF A;  1P90 A;  4BRH A;  3O1W A;  3OYJ A;  3ZCM A;  3SK3 A;  3CC7 N;  4B9M A;  4E89 A;  3RRH A;  2PYL A;  1LW0 A;  2VGM A;  2E2N A;  4CHQ A;  4CF0 A;  3S3O A;  3H08 A;  3QO9 A;  1NK7 A;  1GLE G;  4DUZ K;  3CC2 N;  4ISE A;  2CGL A;  1HYZ A;  3OS0 A;  1R0A A;  2F8T A;  5J2P A;  4B9Q A;  1EQY A;  2ASM A;  1KVA A;  4CE9 A;  4KHN A;  4BGB A;  1C0G A;  1WN7 A;  4DQ8 A;  3DLL L;  4WQ5 A;  4LF4 K;  3VGM A;  3FZM A;  4AH9 A;  4H0V B;  2XRI A;  3MDQ A;  3BP8 A;  3B8A X;  3KJV A;  4CEZ A;  4E1M A;  1VQN N;  2A1R A;  2OPP A;  1NGH A;  4LC9 B;  5FLX O;  3HZ6 A;  4CEC A;  3CFP A;  2E88 A;  3HM8 A;  3WUH A;  4B3R K;  2F96 A;  4CJQ A;  1W97 L;  1N33 K;  3LZI A;  4DTM A;  1HNV A;  3OBW A;  1IKY A;  3SUQ A;  3ZSZ A;  4CHO A;  5JVG L;  1XC9 A;  3CFR A;  3M8S A;  3U3Y A;  5EY4 A;  4CGJ A;  3AO1 A;  4BRG A;  3EKU A;  2A5X A;  4J2D A;  4A2B A;  1CLQ A;  1WSI A;  5AQI A;  1X9S A;  2BGG A;  1TKX A;  3T1H K;  2XY5 A;  4CJW A;  3L8B A;  4FM2 A;  1S3X A;  3NCI A;  4DTN A;  4NXN K;  1VQ8 N;  4DLG A;  3SJJ A;  4RW6 A;  3ZLJ A;  1JCE A;  2ZQB A;  5CYM A;  1KFS A;  2O8B B;  3B6O A;  4I2Q A;  4W5Q A;  3GG4 A;  4WFN L;  3V6D A;  4HCC A;  4DSL A;  3EY1 A;  2HBJ A;  4MLE A;  4AHV A;  1DTQ A;  4DB3 A;  1TUU A;  1G99 A;  3KWG A;  4FWO A;  3RMD A;  5DM7 L;  1RDB A;  1VSJ A;  4H03 B;  4GKJ K;  3OYI A;  1NOZ A;  3C6U A;  5I42 A;  2O8B A;  1FJG K;  4PKH A;  5JVH L;  2F7T A;  3CQY A;  1VSH A;  3RMB A;  4FZY A;  3OY9 A;  4AIL C;  1RT3 A;  4KBO A;  3C94 A;  4DV5 K;  3CCJ N;  1NMD A;  3K57 A;  4HWI A;  1OVQ A;  4LH5 A;  4F4K A;  1BDG A;  4BDY A;  3OS2 A;  2NRT A;  4HUF A;  3AO5 A;  4ILG B;  3ATV A;  3SQ1 A;  2ZM6 K;  4CCH A;  2CGJ A;  2KKZ A;  3F5T A;  1KRP A;  3M8Q A;  3BUZ B;  4LD0 A;  4MQ3 A;  3ZSY A;  5HRO A;  2KHO A;  3A5O C;  4C1N K;  4CJS A;  3J7Z O;  1IG9 A;  1RT4 A;  2QWQ A;  2NRV A;  5JIC A;  4MDA A;  3TTC A;  4CJU A;  4NO7 A;  4FJJ A;  3OYN A;  2QWN A;  2X6N A;  4FSV A;  4CF8 A;  3QNO A;  4LF6 K;  4PKG A;  4DMN A;  2Z1J A;  3DXK B;  4H5T A;  3MXM A;  4FOI A;  5JLH A;  1ZYQ A;  1VQ7 N;  4EFH A;  4E7L A;  4CFC A;  4CJ4 A;  1L3U A;  3M6G A;  4DF8 A;  2QWM A;  4FWM A;  3M8R A;  4KB0 A;  2HHS A;  1D9D A;  5A2Q O;  1RFQ A;  1OVY A;  4CF1 A;  4KH6 A;  4E7K A;  4BQZ A;  1N32 K;  4AF1 A;  2G8V A;  5AQT A;  3QBX A;  3TAP A;  3MN5 A;  3EZ5 A;  2XY8 A;  4BG9 A;  4CGG A;  4IDK A;  4AHC A;  2GEM A;  4B08 A;  1U2V B;  2E1Y A;  4CJR A;  5CE3 A;  4ZTJ A;  1Q86 O;  1N5Y A;  3HPH A;  3MCA B;  1KQS M;  4CEO A;  2BH1 A;  2A1S A;  4FPB A;  4X64 K;  4F8R A;  4FLW A;  5TKY A;  4BRI A;  2NLX A;  4H0P A;  2OTL N;  1U2V A;  4FJL A;  4EIA A;  2DPN A;  4YOX A;  4CK1 A;  4JYA K;  1UA1 A;  3ULE B;  1OH5 A;  2P5G A;  2AP1 A;  1QSS A;  1J54 A;  1CXQ A;  1JLE A;  1NLV A;  4FK0 A;  1E4G T;  4IO8 A;  4CD3 A;  3VGK A;  5HRN A;  1XNR K;  3CET A;  1XHZ A;  1U45 A;  1JXE A;  3CC4 N;  3LPU A;  4BC3 A;  5GAE P;  2W41 A;  3RRG A;  4NCA A;  5AQH A;  5AQK A;  2WOM A;  4ILH A;  1QZ5 A;  3THY B;  3M3Z A;  2YNH A;  1SQK A;  5M1P A;  4F9O A;  3D2E B;  1RNH A;  1D4X A;  2FBT A;  4F3O A;  3UB5 A;  4JI7 K;  1S1V A;  3TPQ A;  1HKB A;  4JLH A;  1NKC A;  2YKM A;  4K42 A;  4KAZ A;  5BRE A;  2BDP A;  1NK8 A;  3WXK A;  3R8E A;  1NK5 A;  4EP5 A;  3K5L A;  4OKJ A;  3THY A;  1LWC A;  2X6S A;  2E1Z A;  1TV6 A;  1GLJ O;  3JYT A;  3DWL A;  2RN2 A;  3TAQ A;  1VQ4 N;  4RW4 A;  4BR7 A;  1RGI A;  3O4W A;  1NGC A;  2YJF A;  3WNG A;  1BQN A;  2VG7 A;  4BRN A;  4JS5 A;  1KXP A;  1Q9X A;  2QWR A;  3SI6 A;  3OHR A;  2FC0 A;  4ISG A;  4IOA L;  1VQ9 N;  1SL1 A;  4C8L A;  4JEP A;  5KPZ A;  1D9F A;  5BPN A;  1FW6 A;  3AVC A;  4OGC A;  4BR2 A;  2LSN A;  4H0O A;  4CHP A;  4KV8 A;  1QVF M;  1ATR A;  2RPI A;  4FVU A;  4DS5 A;  1XHX A;  3LPT A;  1NJI O;  3SMS A;  4CGD A;  1BIU A;  4M7Y A;  1EWR A;  2E20 A;  2QWP A;  2VWK A;  1ATS A;  3PSI A;  4M45 A;  3PO4 A;  5F2R A;  2P9P A;  3NVM A;  3L4Q A;  2OPQ A;  4EP4 A;  4FJM A;  1FKO A;  1FKP A;  1KCF A;  2HND A;  3VA0 A;  5AQL A;  3HPG A;  3H45 C;  3HJF A;  1SV5 A;  3PUF A;  1S1X A;  1IG8 A;  3CI5 A;  1SS6 A;  5LMU K;  1VQP N;  4ID1 A;  2HHH K;  4C8M A;  3O08 A;  3AVF A;  4O0J A;  1LWF A;  4Z4E A;  2EHG A;  3O9U A;  3AVK A;  3BF1 A;  1TUY A;  2NUB A;  1U49 A;  4NXM K;  3C7N A;  2QW9 A;  4F2R A;  4B8C A;  3L2U A;  4IEI A;  2JLE A;  1EET A;  4GVE A;  3IS9 A;  2Z1I A;  3LDS A;  4BRD A;  2XY6 A;  4AHR A;  2Q0R A;  3FZF A;  5KTQ A;  4N5S A;  3OA9 A;  2DFE A;  2WFB A;  2UUB K;  2G8W A;  3QEP A;  1O13 A;  2HBM A;  1T6C A;  3C6A A;  1BG3 A;  4J2B A;  1BI4 B;  3CPW M;  3T3F A;  1GOA A;  1HNX K;  3KTQ A;  2E2P A;  1RT1 A;  1XMQ K;  1U4B A;  3SV3 A;  3DLR A;  4Z0U A;  4DKW A;  3VN5 A;  3E1Y A;  1HJR A;  1L3T A;  4YOR A;  1RBR A;  3A5N C;  1BI4 A;  3EKS A;  1JLQ A;  3ZT0 A;  4DQI A;  1C0T A;  3H1V X;  2B5J A;  1JCF A;  1HQE A;  1KAZ A;  4X66 K;  4BRE A;  3CFO A;  1GLB G;  3AGR A;  4GV6 A;  1VQK N;  4MO4 A;  4GKK K;  1KVB A;  3FZH A;  2PBD A;  3FLC O;  1T8E A;  5AQY A;  4RW7 A;  1LW2 A;  3HVR A;  1KTQ A;  2HHX A;  3OYD A;  3FZL A;  4BR4 A;  2NNW A;  4CZG A;  2PAV A;  3KVG A;  4FJ8 A;  1IBL K;  2KLA A;  4RCH A;  4J2A A;  4PL7 A;  2GUI A;  2P9L B;  3CMA N;  1NBW A;  1NWK A;  3O1B A;  5FPM A;  2ASO A;  4IJA A;  4AHU A;  4DR6 K;  3AA4 A;  4XIU A;  3TAB A;  3CYM A;  4IEE A;  4O44 A;  5KRS A;  2XY7 A;  4DLE A;  1QQM A;  3D0P A;  2P9L A;  1S6P A;  3ZET B;  5BRD A;  4H5N A;  4C8N A;  2NRR A;  4J2E A;  4BC2 A;  3CJC A;  3P31 A;  4CJT A;  4KHS A;  4CGI A;  5B8H A;  1LOT B;  1HNI A;  4BDZ A;  4YOV A;  2XHB A;  1IO2 A;  2ZE2 A;  1IKW A;  1E3M A;  3IRX A;  1QQC A;  2Z1G A;  4Z4H A;  4GNI A;  3SAH A;  5C2F A;  4FM0 A;  3AVG A;  1J9A A;  2YKN A;  3O9T A;  3K9J A;  4WQ4 C;  4LY7 A;  4HUG A;  2YHB A;  1S72 N;  1H1V A;  1S22 A;  2OCE A;  2ITG A;  1Q82 O;  3R1X A;  1BOT O;  1ZBF A;  2QM1 A;  5KPT A;  4FJK A;  4BDP A;  4M3W A;  5FPE A;  3DLG A;  4HUE A;  3SV4 A;  4CHY A;  2O8F B;  3HL8 A;  4JRQ A;  1OH7 A;  5J1E A;  3VET A;  3DI6 A;  3I8B A;  1B92 A;  5AQJ A;  3VEX A;  5HOO A;  1ASW A;  3SUP A;  1NKE A;  1QVG M;  4E1N A;  4DFK A;  1DLO A;  2QI2 A;  1WLJ A;  1HPZ A;  2FSK A;  1SL0 A;  1SKR A;  5M1Q A;  1LWE A;  3AVB A;  4KHU A;  4TSX A;  4JI4 K;  3QIO A;  4WQ4 A;  2CH5 A;  5HRR A;  3OYA A;  4Z4G A;  4DCH A;  1XI1 A;  3AVA A;  3QIC A;  3VA3 A;  1NJW A;  1NJX A;  4KHY A;  3NF8 A;  3AAR A;  3NF9 A;  2HVI A;  3DLH A;  1DT9 A;  1DEJ A;  4JKG A;  1I39 A;  4JHD B;  4H4M A;  3O9S A;  2UUA K;  3CJ9 A;  4Z4C A;  3QER A;  4DQS A;  1ZBL A;  4N41 A;  3LAK A;  3H3N O;  1VRU A;  4KH5 A;  1X3N A;  2GTD A;  5GAD P;  1BO5 O;  2W42 A;  2BE2 A;  4JHD A;  4KTZ A;  3ENO A;  3SBG A;  1Z26 A;  2DTU A;  3T1A A;  4K8X A;  4DS4 A;  3ENB A;  2Q97 A;  1TKD A;  2ZGZ A;  3GDQ A;  1BQM A;  3DAW A;  4DSK A;  3PLA A;  4FJ7 A;  3ZYY X;  1KLN A;  4CHN A;  2FF6 A;  3TR8 A;  1OKJ A;  4DWI A;  2G8U A;  4M3T A;  3CJA A;  1L3V A;  4KRF A;  1BA1 A;  2E6L A;  4DSI A;  4FWL A;  4B3T K;  3FFK B;  3KLE A;  3ZT3 A;  3V4I A;  1NK4 A;  4BC4 A;  4QS8 A;  3DLK A;  2YNI A;  1A5V A;  3AVI A;  1CZA N;  2RKI A;  3SQ4 A;  2A6A A;  1XWL A;  3OW2 M;  4ZHR A;  2ATQ A;  4PHT X;  3MWT A;  3OJS A;  2V51 B;  3PX4 A;  4F2S A;  2DY4 A;  4F3T A;  4DQP A;  3QEI A;  1HNW K;  1N6Q A;  2O4I A;  1FXX A;  4B1Y B;  2BAN A;  2Q3S A;  4NYF A;  5AR0 A;  5JMV A;  3C65 A;  5AFU H;  3ZSW A;  4KH4 A;  2YJE A;  3NGY A;  1QHA A;  5BPM A;  3I8D A;  4BY9 C;  1GLA G;  3HXM A;  1EP4 A;  4DFJ A;  3QML A;  5IWA K;  4LF7 K;  1WAJ A;  5LL6 Z;  1KAX A;  5I9E B;  3S41 A;  2D4W A;  3OYB A;  3OYG A;  3AY9 A;  1QSY A;  5SWM A;  1VSF A;  3RR8 A;  1LAV A;  5I3U A;  3TWH A;  3TAG A;  1IKV A;  5ADX H;  3QES A;  4H5V A;  3NDK A;  3ZSQ A;  3P4I A;  4YFU A;  2P9N B;  3OS1 A;  5JS1 A;  3HK2 A;  3DLE A;  3WNH A;  1S6Q A;  3E66 A;  4M3R A;  4AHT A;  4IFY A;  5GAH P;  1QHT A;  4IFV A;  4CEF A;  4YDU C;  1NGE A;  2E4L A;  3Q7B A;  2ASP A;  3K5N A;  4JKE A;  3TSU A;  4DFM A;  3SQ0 A;  3MX5 A;  1ZBH A;  2P9N A;  3HRG A;  4JI8 K;  3THW B;  1T05 A;  4CK2 A;  4LFC K;  3AVN A;  1NK0 A;  1ZBU A;  4KRE A;  5AZI B;  3WXL A;  5BRF A;  4JV5 K;  3LZJ A;  4ELV A;  2X78 A;  2QKK A;  2NRW A;  3R6M A;  3VMF B;  3KHY A;  1VSK A;  3THW A;  2HF3 A;  4PWD A;  3VQ8 A;  3VQQ A;  5DM6 L;  3CHW A;  5KGW A;  1U04 A;  5FPD A;  3WXI A;  4JKB A;  3T69 A;  1C1C A;  1S1U A;  5FPN A;  2OZS A;  3KLI A;  1DKG D;  2A41 A;  3CM5 A;  1RBS A;  4U7B A;  2VWJ A;  4PUO A;  3DRR A;  3P5J A;  2P5O A;  3O5B A;  3OYM A;  1NOY A;  4LSN A;  5AQQ A;  4YOT A;  4DV2 K;  4DV6 K;  4B9S A;  1N8R O;  3N4Q A;  5AFU A;  4DUY K;  4H0Y B;  1SKW A;  1TAQ A;  4Y1C A;  2D1K A;  3V81 A;  2VCP A;  3LP0 A;  3UE5 A;  1LAW A;  4ISF A;  3O9Q A;  2O4G A;  3TAN A;  4FJG A;  2KW4 A;  2UYT A;  1X9J A;  1K9M O;  3FGU A;  1VSE A;  4R79 A;  3ID6 A;  3AA5 X;  2QWL A;  4JI0 K;  1CZB A;  1VHX A;  4OPK A;  4FJI A;  1G15 A;  2FBX A;  1IH7 A;  3VTH A;  4FLU A;  2VG5 A;  5GAG P;  5CHI A;  3VF4 A;  4FLY A;  3DXK A;  1XQS C;  1RDW X;  3VQB A;  1WAF A;  4QAG A;  1NGJ A;  3DLB A;  3AVH A;  1NGA A;  4M7X A;  5C24 A;  4QOZ B;  3SQ2 A;  1YI2 N;  4JI6 K;  5LJV A;  1UOC A;  3E9P A;  1BWF O;  4GV9 A;  1WSH A;  2GX9 A;  4FL9 A;  1EXQ A;  3GE1 A;  4DU1 A;  2HVH A;  3MWP A;  3WXJ A;  5AQG A;  4DSE A;  3ZSR A;  3EE8 A;  3CIP A;  3CM6 A;  1JLG A;  4AHS A;  4DG1 A;  2JGU A;  3K58 A;  1BCM A;  1NK6 A;  3MEE A;  2IGI A;  2D0P A;  2IS3 A;  5HP1 A;  3LAM A;  2UXD K;  4DTU A;  5AQV A;  5AQU A;  1ZC6 A;  2PFU A;  1HKG A;  1RBV A;  4MLH A;  3BF3 A;  4JI2 K;  3J7Y P;  1U6Z A;  4LH4 A;  3OBY A;  3ZSO A;  2Y1J A;  1JLC A;  3SPZ A;  3CPE A;  3GBT A;  4NLB A;  1NK9 A;  3KKR A;  1JKH A;  3ULE A;  2VYP A;  4CJF A;  2YHW A;  2FBY A;  4FWP A;  4JNE A;  3NH0 A;  1U47 A;  3KZB A;  1C1A A;  1NGF A;  1IJJ A;  3EO3 A;  2KTQ A;  3EEQ A;  1DTT A;  4RG8 A;  1L3S A;  4E7J A;  2X74 A;  2IVO A;  4B8A B;  4BRP A;  4CI6 A;  4K43 A;  1T7P A;  2IDO A;  2D0O A;  3KK1 A;  3VEY A;  4BE1 A;  2KFZ A;  1F21 A;  4FLV A;  2ZD1 A;  2O8E B;  3KLH A;  4JI1 K;  3P39 A;  3D2E A;  1I94 K;  4CZH A;  4I2P A;  4AM7 A;  4CED A;  1ILY A;  4YHH K;  3C6H A;  3P83 D;  4N47 A;  2Y1I A;  3W3D A;  2HHU A;  3PO5 A;  4OKE A;  3K59 A;  2I7N A;  3VEN A;  2FF3 B;  1YUW A;  3QET A;  2A3Z A;  1HJO A;  1KVC A;  4E0D A;  2P51 A;  3HI0 A;  5KGX A;  3KK3 A;  5FRN A;  4AM6 A;  3LDO A;  5MLC Q;  2JWL A;  3PX0 A;  3PY8 A;  1RDC A;  4Q5V A;  5C25 A;  2OYQ A;  1QS4 A;  5K14 A;  4JKF A;  4KHP K;  3CQ8 A;  5D3G A;  1JLF A;  5JLF A;  4DTP A;  4DR4 K;  3GL1 A;  1YIT N;  2HMP A;  3HT3 A;  1K6Y A;  2V7Z A;  4FWQ A;  1MU2 A;  3BZK A;  3VEO A;  3V9W A;  3E01 A;  2E8A A;  5HBM A;  1BHL A;  1TL3 A;  3A0I X;  3MN9 A;  1YXQ A;  4FVM A;  3V9S A;  2P9S B;  4FWR A;  2HHV A;  5HRP A;  3WNE A;  1NNE A;  5CR4 A;  3KIO A;  3ALY A;  4LF5 K;  3SUO A;  2UXB K;  3NH2 A;  3DYA A;  3LP3 A;  1OH6 A;  2VG6 A;  4KKO A;  4B1W B;  1MDU B;  3VEZ A;  3OTO K;  3O6W A;  4BR5 A;  1HRH A;  4E7I A;  2ZF5 O;  4MDB A;  5CZ2 A;  4K8Z A;  1YTU A;  4DU3 A;  3N4P A;  3AO2 A;  2IC3 A;  4DQR A;  1QQN A;  3EE9 A;  4JKC A;  4C1N I;  2HHW A;  2DFF A;  1EWQ A;  3NAE A;  3BGR A;  4W5R A;  3OYH A;  2PZS A;  4IXC A;  4CBU A;  3HM9 A;  3L2R A;  1ASU A;  3ENH A;  4FZZ A;  4C23 A;  2HNZ A;  1WOQ A;  3T7Z A;  4CHZ A;  4XH4 A;  1YVU A;  3H6E A;  3VPZ A;  3MXJ A;  5BPL A;  2OA8 A;  4ILJ A;  3WXM B;  3RR7 A;  3VQC A;  3MMV A;  4CK3 A;  3CQX A;  2J4R A;  3L2Q A;  4CF2 A;  3TSP A;  1VQL N;  1KC8 O;  4JK7 A;  3TAR A;  4CIG A;  3PSF A;  3G6E N;  1GLD G;  1VSI A;  2G8K A;  4JKH A;  4NCB A;  3THX B;  4XH5 A;  3UKU B;  3MEC A;  3CCS N;  1T44 A;  2GBZ A;  2NRX A;  5FRM A;  3MEG A;  3HPO A;  3KD1 E;  4KHQ A;  2E2Q A;  4K41 A;  3SBT A;  4H4O A;  3QFU A;  2IAJ A;  3NGZ A;  4IDH A;  5DK5 A;  1LCU A;  4BRF A;  4BQL A;  4QS9 A;  3CCR N;  5IT9 O;  1NMN A;  3QIN A;  4IBN A;  3VQ9 A;  1NU0 A;  3UKU A;  2QKB A;  5C2D A;  1OH8 A;  1TVR A;  5LY3 A;  1HYV A;  2ITM A;  4BVP A;  1TK0 A;  3ZT1 A;  3LAN A;  3MK6 A;  2D0A A;  3J7A P;  4YOW A;  3VQE A;  2GUP A;  2RF2 A;  4IG0 A;  2YV0 X;  2OAN A;  2FXU A;  1RT5 A;  5BN8 A;  4FCY A;  3CXC M;  3V9Z A;  3PIO L;  1S1W A;  1Y97 A;  3RWU A;  4OJR A;  4FK2 A;  4G9Z A;  3ZET A;  2DFH A;  1WNS A;  5E26 A;  4JK8 A;  1WBD A;  1V4T A;  1IBK K;  2P1J A;  5C15 A;  4BG8 A;  3MX2 A;  4QS7 A;  4ELU A;  3RMA A;  1RTJ A;  4I9Q A;  3FR0 A;  3HTV A;  2HHQ A;  3TU5 A;  3QEV A;  3Q7C A;  3K9K A;  3NF7 A;  4O55 A;  4DR1 K;  1YTA A;  3NBP A;  4B3M K;  2KFN A;  3F9K A;  4BRO A;  2RHK A;  2Q1N A;  4W5T A;  4ICL A;  4JK9 A;  4DSJ A;  5BR8 K;  5H1S Q;  5DMR A;  3LP2 A;  3VQP A;  3CCV N;  3HBT A;  1NJZ A;  2JWK A;  4OKK A;  3KK2 A;  3ZEU B;  2CH6 A;  4CES A;  2RE2 A;  5AQX A;  3T19 A;  4BR0 A;  2W40 A;  4BRK A;  4CF9 A;  3F2K A;  2O8F A;  1EX4 A;  4FW1 A;  4FWN A;  3UKR B;  3KWI A;  4X65 K;  3NHG A;  1V4S A;  2QA4 N;  1ESV A;  2P9K B;  2AA4 A;  3ZEU A;  3QDK A;  4C8O A;  4DV1 K;  3FFI A;  1I3A A;  3ZT4 A;  2IOC A;  3CG7 A;  4HVJ A;  3S3N A;  1L5U A;  1N36 K;  3UKR A;  1W9H A;  3ASM A;  4OPH A;  4CGF A;  4M63 C;  3V1R A;  1J5O A;  4FOE A;  1YVN A;  4L8R B;  2P9K A;  2NZT A;  1QE1 A;  3VF6 A;  2QWO A;  2F8S A;  1B9F A;  4A2A A;  1Q18 A;  1TL1 A;  1Q9Y A;  2W6K A;  3ITH A;  2F9W A;  4JKA A;  4HTU A;  4O4G A;  5KQD A;  3WQU A;  2QTD A;  4KPY A;  4HCB A;  1VK0 A;  3LWL A;  1ITG A;  3AGK A;  3CCE N;  3A5M C;  2P9I B;  5HL7 L;  4L3Q A;  4A5A A;  3ATU A;  4CER A;  1BIS A;  1HYS A;  4W5N A;  1GLL O;  3THV A;  1HX1 A;  3SZ2 A;  3TTF A;  3NGI A;  5KI6 A;  1SZ2 A;  4C8K A;  5AQR A;  3QFP A;  4DSF A;  1W2B M;  1JL2 A;  1MWM A;  4FXD A;  3AO4 A;  4WQ5 C;  4DTS A;  4V19 S;  2P9I A;  4CJV A;  1Z6R A;  4OLA A;  3NE6 A;  4CEA A;  4XEI A;  3L3U A;  3KK7 A;  4DR2 K;  3CJB A;  3AV9 A;  4BWM A;  5HLF A;  4N76 A;  2Q0U A;  2YI1 A;  1D5A A;  2CGK A;  4UY8 O;  1JCG A;  4JN4 A;  4M3U A;  1Q8I A;  4PA1 A;  5SZT A;  1RDD A;  3AA3 A;  3OYE A;  1LV5 A;  3DMJ A;  4MO5 A;  2B6A A;  3U3G A;  4M3Y A;  3J81 O;  5EOY A;  2YHX A;  1UWB A;  3O4N A;  4DTX A;  4KTW A;  2QXF A;  3AAQ A;  2E5L K;  1HR0 K;  3QNN A;  3BDP A;  1YJ9 N;  4CJL A;  1RT6 A;  3OYK A;  3V1Q A;  3SUN A;  1A5X A;  1GLF O;  3H3O B;  4RW8 A;  3IUC A;  4B1X B;  4CZM A;  3ZX2 A;  1ZBI A;  4FLX A;  3O3G A;  1YJW N;  1KAY A;  1Q7Y O;  4KI4 A;  2YHY A;  3O9R A;  2IVP A;  4H0X B;  2W6L A;  4OPA A;  3NH1 A;  1KLM A;  1QSL A;  3VQA A;  4Z94 A;  3VF2 A;  3HOS A;  3CF5 L;  3U9Z A;  3OYC A;  1SKS A;  3I0S A;  3MAQ A;  4BC5 A;  4FLT A;  2GWJ A;  4WYB A;  5C12 A;  4CJE A;  1T3V A;  4EHT A;  4WFB L;  4FLZ A;  2G8F A;  4EAH D;  1REV A;  5FDL A;  2YX6 A;  3QEW A;  3RVC A;  3O3F A;  2Z1H A;  1RCH A;  3CME N;  3LM9 A;  4FJN A;  1KSP A;  1Y64 A;  5BRH A;  2Q2R A;  3SAG A;  4HHT A;  2D5R A;  4BRM A;  1ZXO A;  4R5P A;  2YCH A;  2HW3 A;  1TYQ B;  4CJ3 A;  4E1J A;  4CZI A;  3QBW A;  1VQM N;  1NGI A;  2WC9 A;  3AA2 A;  3MED A;  4YNQ A;  4IOC L;  3R3L A;  1J6Z A;  1M90 O;  3V9X A;  4DR5 K;  1D8Y A;  2AJQ A;  4B1U B;  3G4S N;  3KLF A;  3NFA A;  2HB5 A;  4WF9 L;  3VEW A;  1TYQ A;  1N34 K;  4B9T A;  2V7Y A;  4NB4 A;  4CIF A;  4FJH A;  4BE2 A;  5JS2 A;  3JXU A;  4PQU A;  3QLH A;  3I0R A;  3SNN A;  5EU7 A;  4OVL A;  3AVJ A;  1RTD A;  1WSE A;  5AZI A;  4IZ9 A;  4M3Z A;  2EX3 A;  4DF4 A;  3EZW A;  3HVT A;  1C0U A;  2EWS A;  3GOI A;  1T6D A;  3OYL A;  3L2V A;  3S9H A;  1X9M A;  2QXL A;  4YDU A;  3IDH A;  1GOC A;  3VOV A;  3PIP L;  1VSL A;  4FW2 A;  2HHT A;  1KFD A;  3DM2 A;  4U67 L;  1IV0 A;  1NM1 A;  4GVM A;  3AVL A;  3SMP A;  3HSC A;  5EXW A;  3EYZ A;  1NGB A;  4M41 A;  1J53 A;  3L3V A;  3O4Q A;  3E9O A;  4A57 A;  5ELZ A;  2IIR A;  4KFB A;  3SLC A;  2NRH A;  4KO0 A;  3NF6 A;  5BR9 A;  4Y0W A;  1WUA A;  4WCE L;  2UUC K;  1ATN A;  3RSE B;  1WSF A;  1VSM A;  1TAU A;  2YHA A;  3I33 A;  1IBM K;  3ZT2 A;  2OPS A;  2FBV A;  3PX6 A;  1WSG A;  5ADX A;  3RSE A;  1JJ2 M;  5AQN A;  2HBL A;  3SJH A;  1YF5 L;  3CCL N;  4B9N A;  2ETJ A;  5AQP A;  4A59 A;  4B1V A;  4ZTF A;  5GIP A;  3B6P A;  1VSD A;  5C42 A;  1C0F A;  5AQM A;  1SUQ A;  1DGK N;  4CBW A;  3A5L C;  3LDP A;  2FSJ A;  1QTM A;  3G25 A;  3SCX A;  4BRL A;  4I6M B;  3ID8 A;  1HPM A;  2VWB A;  4ELT A;  4DQQ A;  3LDN A; 
#chains in the Genus database with same CATH homology
 3OBW A;  5FPE A;  5LJW A;  1QQN A;  1X3M A;  3EE9 A;  4JKC A;  4C1N I;  4CZE A;  5JVG L;  5GIN A;  3VET A;  3I8B A;  3VES A;  5AQJ A;  3VEX A;  5HOO A;  2OTJ N;  4I6M A;  5EY4 A;  4IXC A;  4CBU A;  4BRG A;  1QVG M;  3ENH A;  4WFA L;  4C23 A;  2QI2 A;  2A5X A;  3EKU A;  2Q36 A;  4PKI A;  1HLU A;  4A2B A;  1WOQ A;  3T7Z A;  3MCP A;  2FSK A;  5AQI A;  4XH4 A;  3H6E A;  4CZF A;  4B1Z A;  3LDL A;  5M1Q A;  1S3X A;  3MN7 A;  3VPZ A;  3IKM A;  5BPL A;  1VQ8 N;  4ILJ A;  1QQO A;  5EX5 A;  3WXM B;  1K73 O;  1JCE A;  4WQ4 A;  5AQW A;  3MMV A;  2CH5 A;  1XUP O;  3CQX A;  3GG4 A;  4DCH A;  2J4R A;  4WFN L;  2HBJ A;  4MLE A;  4DB3 A;  1TUU A;  3QIC A;  1G99 A;  3F9M A;  3KWG A;  5AQZ A;  4FWO A;  4O8U A;  3ZX0 A;  1K8K B;  3D7E O;  5DM7 L;  3TSP A;  1VQL N;  3AAR A;  4H03 B;  2IVN A;  1KC8 O;  4JK7 A;  1DT9 A;  1DEJ A;  4JKG A;  3G6E N;  4PKH A;  4JHD B;  5JVH L;  1GLD G;  3O9S A;  3CJ9 A;  2F7T A;  2HOE A;  3CQY A;  4JKH A;  4XH5 A;  1EO1 A;  4O8K A;  3NMU A;  3UKU B;  2F9T A;  1HUX A;  3CCS N;  1T44 A;  4KBO A;  2NRX A;  3CCJ N;  1NMD A;  3W0L A;  3H3N O;  2E2Q A;  1K8K A;  4K41 A;  3SBT A;  4HWI A;  4KH5 A;  4DHY A;  3QFU A;  1X3N A;  2GTD A;  5GAD P;  1NGG A;  4FPA A;  4IDH A;  1BO5 O;  1LCU A;  4YOY A;  4BRF A;  4BQL A;  1BDG A;  4JHD A;  4QS9 A;  3CCR N;  3ENO A;  3SBG A;  2NRT A;  3UKU A;  4IO9 L;  3P38 A;  5C2D A;  3G71 N;  4ILG B;  3ATV A;  5LY3 A;  2WUS A;  3ENB A;  2CGJ A;  2Q97 A;  2KKZ A;  3F5T A;  2ITM A;  2FSN A;  3BUZ B;  2ZGZ A;  3GDQ A;  3DAW A;  4BVP A;  3PLA A;  3CCM N;  3WEE B;  3MK6 A;  3ZYY X;  2KHO A;  3A5O C;  4C1N K;  3DXM B;  3J7Z O;  2FF6 A;  4YOW A;  1NGD A;  3O8M A;  5M1O A;  2QWQ A;  2NRV A;  2GUP A;  1OKJ A;  5JIC A;  3CJA A;  4GV3 A;  1BA1 A;  4MDA A;  5E84 A;  3TTC A;  2QEX N;  2OAN A;  4NO7 A;  2FXU A;  2QWN A;  1P8Z A;  5BN8 A;  4FSV A;  4FWL A;  3CJ1 A;  3CXC M;  4PKG A;  3PIO L;  4BRA A;  3FFK B;  2P9P B;  5KQ8 A;  3WEE A;  3DXK B;  4H5T A;  3FE1 A;  3DXM A;  4FOI A;  5JLH A;  4BC4 A;  2ZWH A;  4QS8 A;  1HKC A;  4G9Z A;  3ZET A;  3FZK A;  2ZJP L;  1VQ7 N;  4IJN A;  5E26 A;  4EFH A;  1BUP A;  1CZA N;  3CD6 N;  4JK8 A;  1V4T A;  2A6A A;  3M6G A;  5C15 A;  2QWM A;  4FWM A;  3MX2 A;  4BG8 A;  3A8Y A;  3OW2 M;  4QS7 A;  4PHT X;  3MWT A;  2I7P A;  3CCQ N;  2V51 B;  3FR0 A;  3HTV A;  3L4I A;  4IWV A;  5M1N A;  3TU5 A;  3Q7C A;  4K25 A;  3K9K A;  2P9S A;  4B1Y B;  1RFQ A;  1OVY A;  4BRO A;  4KH6 A;  5AR0 A;  4BQZ A;  5JMV A;  5AQS A;  3C65 A;  2BUP A;  5AFU H;  4AF1 A;  2RHK A;  4KH4 A;  2Q1N A;  5AQT A;  3QBX A;  2HST A;  2YJE A;  3MN5 A;  4JK9 A;  4J8F A;  4BG9 A;  5H1S Q;  1QHA A;  5BPM A;  2ZJR L;  3C7N B;  2GEM A;  1U2V B;  2FLO A;  4A62 A;  3VTI A;  2E1Y A;  4BY9 C;  4BR9 A;  3CCV N;  3BEX A;  3HBT A;  1GLA G;  5CE3 A;  1Q86 O;  3MCA B;  2JWK A;  1KQS M;  1YJN N;  3JS6 A;  3QML A;  4CZJ A;  1YIJ N;  1KAX A;  2BH1 A;  4IOX A;  3ZEU B;  5I9E B;  4FPB A;  2CH6 A;  3S41 A;  2RE2 A;  2D4W A;  3J8A A;  3L0Q A;  2WBN A;  5AQX A;  4BR0 A;  5TKY A;  2W40 A;  3AY9 A;  2Q31 A;  2NLX A;  4H0P A;  4BRI A;  4OO1 J;  4BRK A;  2OTL N;  1U2V A;  3F2K A;  4EIA A;  2DPN A;  4YOX A;  4FWN A;  3UKR B;  3KWI A;  3ULE B;  1SAZ A;  5ADX H;  4JD2 B;  4H5V A;  1V4S A;  2QA4 N;  1VAZ A;  4NLC A;  2AP1 A;  1ESV A;  2P9K B;  2AA4 A;  3P4I A;  3ZEU A;  3SAF A;  3QDK A;  1M1K O;  2P9N B;  1NLV A;  2P9U B;  1E4G T;  3R9P A;  4IO8 A;  4RWT A;  4CD3 A;  3E66 A;  3VGK A;  1VQ6 N;  3D2F B;  3CET A;  5AZJ B;  4BRC A;  3CC4 N;  4BC3 A;  5GAH P;  5GAE P;  4YDU C;  2W41 A;  3UKR A;  4XH1 A;  4OPH A;  4M63 C;  1NGE A;  3Q7B A;  4JD2 A;  2ASP A;  5AQH A;  5AQK A;  4FOE A;  4JKE A;  1YVN A;  4A5B A;  4ILH A;  3TSU A;  1QZ5 A;  2P9K A;  2NZT A;  3MX5 A;  3VF6 A;  2QWO A;  2P9N A;  3M3Z A;  2P9U A;  3HRG A;  1SQK A;  5M1P A;  4F9O A;  3D2E B;  1D4X A;  4A2A A;  1Q18 A;  3TSQ A;  3UB5 A;  1YAG A;  3D2F A;  2F9W A;  4JKA A;  5AZJ A;  5AZI B;  1HKB A;  1ZBS A;  5TKW A;  3TPQ A;  3WXL A;  5BRF A;  5KQD A;  4K42 A;  3VGL A;  2QTD A;  3WQU A;  2HF4 A;  5BRE A;  2ZJQ L;  3WXK A;  3R8E A;  2NRW A;  3AGK A;  3R6M A;  3KHY A;  3VMF B;  3CCE N;  2VGN A;  2E1Z A;  3I56 N;  3A5M C;  2P9I B;  5HL7 L;  1VQ5 N;  1GLJ O;  5F1X A;  2HF3 A;  3QB0 A;  4L3Q A;  4A5A A;  3ATU A;  1KD1 O;  1BA0 A;  3DWL A;  5DM6 L;  3CHW A;  1GLL O;  1VQ4 N;  5EVZ A;  4GY2 B;  5FPD A;  1HX1 A;  1YHQ N;  4FO0 A;  3TTF A;  3WXI A;  4BR7 A;  1RGI A;  4JKB A;  1SZ2 A;  3O4W A;  1NGC A;  3T69 A;  2YJF A;  5AQR A;  3QFP A;  5FPN A;  1DKG D;  2V52 B;  2A41 A;  4YOU A;  4U7B A;  1W2B M;  1MWM A;  1MA9 B;  4BRN A;  2NRZ A;  1KXP A;  2QWR A;  3O5B A;  4WQ5 C;  2P9I A;  5AQQ A;  4CZK A;  4YOT A;  1Z6R A;  3OHR A;  4H0T B;  4ISG A;  4IOA L;  5BN9 A;  1N8R O;  3N4Q A;  1VQ9 N;  4XEI A;  5AFU A;  4JEP A;  3KK7 A;  4H0Y B;  5KPZ A;  3CJB A;  2D1K A;  1Q81 O;  2VCP A;  5BPN A;  3D6R A;  3UE5 A;  4BR2 A;  4ISF A;  4CD1 A;  4H0O A;  3O9Q A;  2H3G X;  2Q0U A;  2YI1 A;  3O80 A;  1JJ2 M;  2ZGY A;  2CGK A;  3CCU N;  1QVF M;  1ATR A;  4FVU A;  1XC3 A;  2UYT A;  4UY8 O;  1JCG A;  4JN4 A;  1X9J A;  1K9M O;  3FGU A;  3EN9 A;  4R79 A;  3AAP A;  3ID6 A;  2QWL A;  1NJI O;  3SMS A;  4M7Y A;  2E20 A;  2QWP A;  3LM2 A;  4MO5 A;  1ATS A;  3VTH A;  4IFE A;  5GAG P;  5EOY A;  5F2R A;  3VF4 A;  2YHX A;  5CHI A;  2P9P A;  3DXK A;  1QZ6 A;  3NVM A;  1XQS C;  3L4Q A;  3U4L A;  1RDW X;  4H5W A;  1NGJ A;  1VQO N;  3AAQ A;  1NGA A;  4M7X A;  4EHU A;  1GLC G;  1YI2 N;  5AQL A;  3H45 C;  1YJ9 N;  5LJV A;  3E9P A;  3M5R A;  1IG8 A;  1BWF O;  2A40 A;  3CI5 A;  1GLF O;  2E2O A;  3H3O B;  1SS6 A;  4GV9 A;  3IUC A;  4B1X B;  4CZM A;  1VQP N;  2GX9 A;  4FL9 A;  3O08 A;  4JKD A;  3ZX2 A;  3GE1 A;  5GIO A;  3VER A;  3ZX3 A;  1YJW N;  3MWP A;  3O9U A;  1KAY A;  3WXJ A;  5AQG A;  3NVK A;  4JAX A;  1Q7Y O;  3BF1 A;  2YHY A;  3O9R A;  3EE8 A;  5F0X A;  2IVP A;  3CIP A;  4H0X B;  1TUY A;  4OPA A;  4Z94 A;  2GWK A;  4FWS A;  3VF2 A;  3HOS A;  4RTF D;  3U9Z A;  4PL8 A;  3CF5 L;  2D0P A;  3C7N A;  2QW9 A;  5C0Y A;  5AQV A;  5AQU A;  4BC5 A;  2GWJ A;  4IEI A;  4GVE A;  4WYB A;  5M1F A;  1ZC6 A;  2PFU A;  1HKG A;  5C12 A;  3DJC A;  4MLH A;  3BF3 A;  4BRD A;  1T3V A;  4EHT A;  4WFB L;  5C10 A;  2Q0R A;  3WQT A;  4FWK A;  1U6Z A;  3FZF A;  3CJ7 A;  4EAH D;  3OA9 A;  2WFB A;  3IMX A;  2YX6 A;  3OBY A;  3U9D A;  3HOT A;  3VEV A;  1Z05 A;  3RVC A;  3C6A A;  1O13 A;  1T6C A;  2HBM A;  1BG3 A;  3CPE A;  3I55 N;  5AQO A;  3LM9 A;  1R59 O;  3CME N;  3GBT A;  3CPW M;  4NLB A;  1Y64 A;  3TTD A;  3WT0 A;  5BRH A;  2Q2R A;  2GEL A;  3SAG A;  3ULE A;  4BRM A;  4CJ7 A;  1ZXO A;  2E2P A;  2YCH A;  2VYP A;  1TYQ B;  3H46 O;  4E1J A;  3LDQ A;  4CZI A;  2YHW A;  3QBW A;  4FWP A;  4JNE A;  4A61 A;  1VQM N;  1NGI A;  3KZB A;  2WC9 A;  4JKG B;  1NGF A;  4DKW A;  2BTF A;  1IJJ A;  3EO3 A;  3E1Y A;  1K8A O;  4YOR A;  3EKS A;  3A5N C;  4IOC L;  3R3L A;  1J6Z A;  1M90 O;  2IVO A;  4B1U B;  1RDU A;  3H1Q A;  4BRP A;  4BVO A;  4CI6 A;  5KPR A;  3G4S N;  3H1V X;  4K43 A;  1JCF A;  1KAZ A;  1BU6 O;  3VEW A;  4WF9 L;  1TYQ A;  2D0O A;  2V7Y A;  4NB4 A;  3VEY A;  4BRE A;  1GLB G;  3AGR A;  4GV6 A;  1VQK N;  4MO4 A;  3CER A;  3JXU A;  3FZH A;  2PBD A;  3P39 A;  3FLC O;  3D2E A;  5AQY A;  4HTL A;  4BGA A;  3EL2 A;  4CZH A;  3IFR A;  4AM7 A;  1ILY A;  2HBK A;  5AZI A;  3C6H A;  4CZL A;  4IZ9 A;  3FZL A;  4H5R A;  4BR4 A;  3EZW A;  2NNW A;  1MWK A;  3W3D A;  2EWS A;  4CZG A;  2PAV A;  3GOI A;  3KVG A;  3L6Q A;  1T6D A;  3C0B A;  2I7N A;  3U8X A;  3E9L A;  2FF3 B;  3VEN A;  2KLA A;  4RCH A;  4BRQ A;  4PL7 A;  1YUW A;  2QXL A;  4YDU A;  3MN6 A;  2P9L B;  2A3Z A;  1HJO A;  3IDH A;  3VOV A;  3PIP L;  5M1K A;  3CMA N;  3HI0 A;  1NBW A;  1NWK A;  3O1B A;  5FPM A;  4U67 L;  2ASO A;  4AM6 A;  4IJA A;  4O5F A;  3LDO A;  5MLC Q;  1NM1 A;  2JWL A;  3SMP A;  3M1F A;  3HSC A;  4CBX A;  5EXW A;  1NGB A;  4IEE A;  4A57 A;  3E9O A;  3LL3 A;  5ELZ A;  2IIR A;  4JKF A;  3SLC A;  1QQM A;  2NRH A;  5JLF A;  2P9L A;  5BR9 A;  4Y0W A;  1WUA A;  4WCE L;  1ATN A;  3RSE B;  3ZET B;  5BRD A;  3GL1 A;  1YIT N;  2HMP A;  2A42 A;  4H5N A;  1E4F T;  2V7Z A;  5AQF A;  4FWQ A;  1P90 A;  2NRR A;  4BRH A;  3I33 A;  3O1W A;  3VEO A;  3SK3 A;  4BC2 A;  3CJC A;  2E8A A;  3P31 A;  3CC7 N;  5B8H A;  5KPT A;  1LOT B;  3A0I X;  2VGM A;  2E2N A;  4YOV A;  3CC2 N;  1GLE G;  3MN9 A;  1YXQ A;  5ADX A;  2P9S B;  4FWR A;  4ISE A;  2CGL A;  3RSE A;  4B9Q A;  5CR4 A;  1EQY A;  2ASM A;  4GNI A;  2HBL A;  5AQN A;  1YF5 L;  3SJH A;  5C2F A;  3SAH A;  3CCL N;  5AQP A;  4A59 A;  4BGB A;  1C0G A;  4B1V A;  4DQ8 A;  3DLL L;  4WQ5 A;  5GIP A;  3O9T A;  1C0F A;  3VGM A;  3FZM A;  3K9J A;  4WQ4 C;  5AQM A;  4H0V B;  1DGK N;  1S72 N;  1H1V A;  3MDQ A;  3BP8 A;  4CBW A;  1S22 A;  3A5L C;  3B8A X;  1VQN N;  3LDP A;  4B1W B;  1MDU B;  2FSJ A;  3VEZ A;  3O6W A;  1Q82 O;  4BR5 A;  3G25 A;  1NGH A;  4LC9 B;  4BRL A;  3HZ6 A;  4I6M B;  3ID8 A;  1HPM A;  2E88 A;  2VWB A;  2ZF5 O;  4MDB A;  3HM8 A;  3R1X A;  3WUH A;  1BOT O;  2QM1 A;  3LDN A;  1W97 L;  3N4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...