2BGGA

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt sirna duplex.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMEGTKVKLSSKRYLLTLLQPYVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN AF1318
publication title Structural Insights Into Mrna Recognition from a Piwi Domain-Sirna Guide Complex
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna-binding protein/rna
total genus 134
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2bggA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bggA01
5C24A 4PEVA 2RF2A 3CS3A 1VSFA 1VSDA 4XXHA 1ZESA 1AB5A 3DRRA 4WWHA 1L5YA 1DCKA 3KCNA 5EU7A 4FW1A 3MAQA 2RJOA 3RVPA 5I3UA 1E2BA 3RR7A 3MECA 3CQ8A 1EXQA 1RT1A 2X6SA 4CF2A 3KS9A 4RV5A 2PKXA 4DSJA 3H75A 2QVCA 3QEMA 1IKVA 1ITGA 3QEIA 2YNIA 4RZSA 1C0UA 4FZZA 3EGCA 1RTDA 3OVNA 3KD1E 1P2FA 2XHBA 4KHSA 1BGXT 2GUIA 3HP9A 1S5JA 1VSLA 1NXSA 4PYRA 3TMYA 2GKGA 3CZCA 2PZSA 1B00A 2O4GA 8ABPA 1VLZA 4CCHA 4CIFA 2Z1HA 3LP1A 2HMIA 4MR7A 2FQXA 1ASVA 2G8HA 1E6KA 3C6TA 5CNIA 4TN5A 4CJSA 1ZY2A 1ABEA 3O2QB 2WOMA 3PUFA 4DLGA 3KLIA 5FWXB 1EWKA 4CJKA 2G8UA 4TLMB 2KQ2A 3DLGA 4KVFA 3OLVA 4D6XA 1DBQA 3CFYA 1SKSA 1MAVA 1W25A 4DTRA 4MS4A 3S99A 1KFDA 2IPMA 3A3KA 2WJAA 4EVSA 1D5WA 2R7YA 1U47A 2V0NA 1TL3A 2D5RA 3LFTA 3VQCA 4CFDA 2JVKA 3SY8A 3UUGA 5HKOA 4IF4A 1W9HA 4J2EA 5TQ0A 1APBA 4RK7A 3P1GA 4J2DA 3NH2A 3SNNA 3DZDA 2R47A 4G0MA 1QKKA 3C3MA 1QO0D 4XFKA 4WT7A 2FMIA 1GUDA 3JPYA 2EHGA 3JYTA 4DLEA 1W0HA 4EGSA 3JVDA 2VWJA 3SQ4A 2XY8A 4Z4EA 3EDCA 3OYEA 4D6YA 2HQOA 5JS2A 4FJHA 4M3YA 2B1JA 2IPNA 4MQFA 4L8RB 4O5BA 4JP1A 3F7NA 4CGFA 1D1PA 2DTUA 3UK0A 3OQOA 3NFAA 3HO1A 4E1MA 4DSKA 2VG6A 4KHNA 3EJWA 5ED4A 3SM9A 1QP0A 2DFFA 1TK5A 1NXPA 3NGYA 2N9UA 3ZSXA 1FKPA 4OG2A 4Z4HA 3M9WA 1XWWA 3NNSA 2P5OA 4ID1A 1WSGA 3I0SA 4I7FA 4AILC 3PO5A 2X6NA 1SXGA 4Z99A 4H60A 1QQAA 3AVJA 4KZKA 4MFBA 1N6QA 3C95A 1T7PA 5CZ1A 4FVMA 2X7XA 1YTUA 1A04A 2KTQA 3HPGA 5KI6A 5B3JC 4LE0A 4DMNA 2HVIA 3S9HA 1XWLA 4CHPA 2MSKA 3QESA 4ZMSA 1A0OA 2OPPA 2QK9A 4CJ4A 5BRAA 4CE9A 4FE4A 5DLEA 3E61A 1L3SA 4ELUA 4DQDA 3NAEA 4BDYA 4YV7A 3NE6A 5EWJA 4H4MA 4OGEA 4Y1CA 2GWRA 3H1FA 2FLKA 3JVIA 1C4WA 4CJTA 4B9MA 3ULDA 2NUBA 3KTOA 2JBAB 4M41A 1DRJA 1EP4A 3O3HA 1ZBIA 4MR9A 1PEAA 1DLOA 1F4VA 5ABPA 1UAXA 3S3MA 2A9OA 4Q0BA 1QO0A 3O75A 2LUOA 4HUFA 3H1EA 4HNQA 2HNZA 1U2QA 4CJRA 1NKBA 2L2QA 5KQLA 1TKZA 4CHQA 4FCYA 3KIOA 5CZ2A 5B3JA 1RT7A 4LDZA 3IS9A 3HEBA 1WSIA 1ZYQA 3RMBA 1Z26A 2NZUG 2YHBA 3LDSA 3HXMA 4W5OA 3ILHA 1QSSA 4DFKA 4FW2A 3JTEA 3SNKA 3DLHA 3KHTA 4QYWA 3OYCA 4FLWA 1KLMA 1E6LA 4IG0A 1USKA 3VQBA 4N03A 3T19A 3OS1A 3U6FA 3N75A 3VQ8A 3PY8A 2PUAA 3CFRA 3KKEA 1VRTA 2OYQA 3LUDA 1EHCA 2IDOA 1Q8IA 2PUEA 2E4ZA 2BANA 4YR7A 4O0JA 4JS4A 5HQJA 4BDZA 4FJLA 1LWCA 4CGIA 4L4UA 4B9NA 1LJUA 3HL8A 3HCWA 3BGRA 3O21A 2FQWA 4CESA 4FJ5A 3FFWA 4XAQA 4FJJA 1RBVA 2ZE2A 3O74A 4OATA 4G1QA 1RTIA 9ABPA 1PNRA 1A5XA 2L17A 3TAEA 2FC0A 3ZT3A 1LAWA 3OY9A 3L2UA 1S1VA 4M42A 1TKDA 3G10A 4PZ0A 3RVJA 1X9WA 1Z25A 3E3MA 4LY7A 2FN8A 3MF4A 3ZSVA 3VA3A 3K9CA 5JNTA 4F3OA 3EZ5A 5J2MA 4C8NA 3GYBA 3AA2A 3GBVA 5FRNA 2A9RA 4DTNA 1NJZA 1TV6A 2PUCA 1K68A 4QCLA 3HPOA 2R25B 4CJUA 4OKKA 3CNBA 1BDJA 1NXXA 5D3GA 1LK0A 1MVOA 1LJLA 3OJUA 5JNUA 3K2PA 4AHCA 3BBLA 3FDFA 2JVIA 3QLHA 2HHWA 3IP7A 1A2OA 5BRJA 5KC9A 4O5AA 3HPHA 1IKYA 3QNOA 2HHSA 4F8JA 3LANA 4CEDA 4F4KA 4P98A 4C8MA 4N76A 1F21A 1G15A 1S6QA 4G0XA 4OVLA 3O1IC 4ZTFA 3MXMA 1WN7A 1E6MA 1FQWA 2AYZA 2JB9A 1GOCA 3VQ4A 2OPSA 4YS6A 3DRSA 1JFVA 1DTTA 4MLCA 4NYFA 2IOYA 2VYCA 2IC3A 3KG2A 1BCMA 1I39A 1JDPA 3CLKA 1JKHA 3V1QA 3F73A 3DLEA 5KTQA 4LE1A 1HJRA 3FFTA 3QEWA 4DQPA 5FWYB 4DTPA 2ZD1A 3RMAA 4PQUA 1ZH2A 4LH5A 2DFHA 3O2SB 3H5VA 4JOQA 4KNYA 1Z12A 2ZQBA 2JGUA 4PE5B 4HTUA 2GBPA 4F12A 3MQ4A 3OYJA 3N0RA 4MQ3A 3K5MA 1U8TA 3I8DA 2H3HA 4DQRA 3JPWA 1CLQA 1Z18A 4CEBA 1BDHA 3K58A 4HUGA 4OLBA 1IG9A 1DP4A 3DGFC 1LW2A 4CJPA 4RK4A 4OGCA 4RS3A 4FJ7A 4MS1A 2G8VA 3TAGA 1HRHA 1SKWA 4CEZA 1DCMA 3NGIA 1QNLA 2ATQA 3QIOA 3D0PA 2QVGA 2H0AA 2FEWB 1HPZA 1CXQA 3ZT4A 2PAFA 4CJVA 4ML3A 5FWXA 1KRXA 3N0XA 4G0QA 3B2NA 6ABPA 1HEYA 1D4ZA 3R0JA 6CHYA 4O1HA 1BI4B 1BISA 3RVOA 3AA4A 3OYDA 3CM6A 4S04A 4CGGA 1MB3A 5CNJA 3SQ2A 4DQQA 1NJXA 1NK6A 2A9QA 1I3AA 4DF4A 3KD5E 2ID7A 3LPTA 3DOKA 2ETJA 2P1JA 3M6MD 4E7PA 4H3KB 3TWHA 2KFZA 2M98A 3EODA 4R5PA 4EVRA 3SQ0A 3SV3A 4CJFA 3QX8A 4DU3A 4DTMA 2AYXA 5FDLA 2HNDA 4CF1A 4OJRA 3QERA 1P8AA 1UWBA 4TSXA 1D9FA 4KV7A 4ETMA 1MB0A 1RDAA 3GT7A 1FK9A 1L5ZA 3KLFA 4DS5A 3NF9A 3WNFA 3WNEA 1C1CA 1JYEA 4JA2A 4RY9A 2WY2D 4KHYA 4DWIA 4KTZA 5CHYA 4N0PA 2PLNA 1URPA 1VSIA 5TE9A 1VRVA 2FBTA 1NXTA 4HNRA 4UHJA 2F8SA 4B8CA 1KVAA 3GA5A 3LMKA 1I3CA 4BE0A 4F2SA 1JDNA 3V9XA 3EYZA 1KCFA 3LPUA 5C42A 3V9SA 1JFSA 1NXVA 4DTXA 5KQMA 4E19A 1TKTA 3SV4A 5DTEA 3TD9A 3HP6A 1UDRA 3MEEA 1NK0A 3P5JA 4OTZA 4LE2A 3ROFA 5I42A 4Y9TA 3M8SA 2RGYA 1XHZA 1LWEA 3I45A 3MEDA 2KZZA 1USGA 1BVHA 2YHAA 3HVTA 1WLJA 2JK1A 1ZH4A 4DSLA 1Z17A 1L3UA 3O3GA 1BIZA 5TPWB 5EWMA 4RW4A 4NCGA 3LWLA 1YK0A 4L85A 4KV8A 3RVQA 3NH0A 5CYQA 2E4WA 4I2QA 4I9QA 1GCGA 3HSTB 5SZTA 1NKCA 2WRZA 4KQ9A 4EVQA 2CWDA 2FQYA 4OBBA 3VQPA 1HNIA 1RT3A 3G0ZA 1HNVA 2BDPA 4ELVA 1T34A 3KLHA 4CJQA 4KMRA 4DSIA 3IDOA 1Z2EA 3NHMA 1VSEA 1Z13A 3CYMA 5HLFA 2E4LA 2BGGA 1YIOA 4NV3A 1L3VA 4WXMA 1JFTA 2JBAA 2PY5A 4F06A 1WETA 2OZSA 3OMWA 4IILA 1ZDMA 4ZHRA 4ZYLA 2VK2A 3O4QA 3IPCA 3TI0A 3QLTA 4MR8B 4HUEA 4JAVC 4DFJA 3AVMA 2RJNA 3NGZA 4O44A 4E7KA 1NTRA 3GBPA 3H6GA 5E3JA 2YKMA 3OMXA 4DG1A 4HVJA 3AVCA 1RT2A 4W5RA 3Q7TA 4UHKA 3LUFA 3K5OA 3AO2A 1TLFA 2QKKA 2HHQA 1SUQA 2FW0A 1C0TA 3QX9A 2Z1GA 3C94A 1BQNA 3QEVA 1ZN2A 1DBWA 3OLYA 4YWHA 3FFIA 1YMUA 4LX8A 2ID9A 5IEJA 3MA0A 2KW4A 4BE2A 2G8IA 3FMVA 2HB5A 3NCIA 4N5SA 3Q7RA 3OYFA 4Z9AA 2NT4A 4KQCA 4JLHA 4DTSA 3I09A 1BCOA 4KHWA 1NK4A 2E4XA 3RVLA 2PUDA 1DG9A 4RW9A 4CEEA 1XC9A 5JNVA 3CG0A 3SAJA 3HDGA 5DKFA 2PUFA 4HCBA 1KRPA 4CFCA 4KK3A 3RRHA 1KVCA 3LUCA 4RU1A 2DY4A 3JSMA 4XARA 1RDDA 3KKRA 4CF9A 1Y1LA 1RXIA 5KRSA 3L6UA 4AHTA 2FMFA 1QHTA 1KGSA 2FBVA 1ZHHA 3U3GA 1T03A 4AHSA 1U4BA 4M45A 5K14A 4KO0A 4G86A 2ITGA 4E1NA 4MGEA 5IC5A 3BDPA 3W9SA 1JXBA 2OA8A 3DLKA 3LP3A 1WSFA 1RDBA 3ITHA 3H5IA 1NKEA 5FBKA 4ZPJA 3ZSOA 4F3TA 2WJWA 1KLNA 2A1SA 2DFEA 2I6FA 3SYZA 4N41A 3NBPA 1RBRA 3V6DA 4M3ZA 4N56A 3SUQA 4FK4A 4UQGA 3C6QA 1X9SA 3MMNA 3ZSRA 3O1JC 3H1GA 1B9FA 2E4YA 4FLZA 3CG4A 2G8KA 4KI4A 1SD5A 2GX6A 3LUGA 4MYRA 4XLTA 3TAMA 3AVIA 4FJ8A 1NXOA 1DJMA 3ZSYA 4YNQA 1GLGA 2FSPA 3OM0A 5J2NA 1NXWA 1KFSA 1PNTA 4MR7B 1HQEA 1K6YA 4EZ9A 1DC8A 4FJGA 3L2RA 1SRRA 4BWJA 2G8FA 4B9VA 1HYZA 3EQ2A 3I5AA 3IP6A 3C3KA 3OLWA 4KKOA 1MIHA 4DSFA 4FLYA 4LZLA 2XO7A 2PYJA 1D8YA 3UKJA 1JLFA 5EWLA 3F9KA 1UOCA 4MAAA 4IGAA 1FFGA 1JYFA 5I4CA 4FJ9A 4IMIB 5GOTA 4I9LA 4Z4FA 1BI4A 3LUKA 3QK7A 1RTJA 2DRIA 2IS3A 1S1XA 5GQSA 5IEBA 3IPAA 3N0WA 4CGDA 4FM1A 5TQ2B 5TQ0B 4DQSA 1BDIA 3KSMA 2FVYA 3CKMA 4FJMA 4CJ3A 3O2JA 2WB4A 4PUOA 2OQRA 5IULC 1ZITA 1U48A 4DFMA 2HHUA 3ISNC 4RY8A 4QAGA 3A0RB 4N0QA 4LH4A 3FFXA 1DC7A 4E7HA 3MXJA 3IAYA 3AVHA 4MQFB 2F96A 3K5LA 3VQ9A 4OPKA 2A1RA 3ZSZA 2HPHA 3AV9A 4CBVA 2P51A 1OXBB 1X1PA 3LWMA 3TR8A 1JF8A 5D2CA 4OLAA 3DM2A 3V9UA 3LZJA 3NNNA 4F2RA 3HUTA 4CHNA 4DU4A 2PL9A 3LKVA 3VQEA 3H5WA 2HSGA 4CJ5A 5FBHA 2LP4Y 1Q9YA 3SPZA 3EQZA 3HJFA 3NHGA 1LWFA 4KHUA 3Q7SA 3OYHA 3SZ2A 3AA5X 4CECA 4J2BA 2KYRA 3WNHA 4W5NA 4CFAA 1QMPA 1PEYA 3PX6A 4Y1DA 2OPRA 2X74A 1TK0A 4CERA 4D74A 2P5GA 2G8WA 4FM2A 3AVAA 1CYEA 1M5TA 1JLGA 1LW0A 1U04A 3DLBA 3NHZA 3C3WA 1USIA 5EWJB 3EAFA 2BE2A 3OS2A 4MRMB 4MQEB 3CFPA 3N53A 3LKBA 1RCHA 1U0SY 1ASWA 2FKAA 3DBIA 3F6PA 3H6HA 4DN6A 4MPTA 3AVFA 3VQ6A 1DTQA 1NOYA 5HRNA 2PL1A 4DTUA 3CFOA 1B92A 3CU5A 4PWDA 4Q7EA 1QTMA 1B9DA 2PJUA 3TO5A 3O4NA 3AVLA 1A5WA 3KK1A 4DS4A 4KRFA 3ZT1A 3RQIA 1WSHA 3AO5A 4Z0UA 1BHLA 2R4QA 3TABA 4LDAA 1JLEA 3HVRA 3V9WA 1NK5A 1RILA 2OENG 4JB2A 2VUIB 4E7OA 4H4OA 2R48A 2QW1A 1TJYA 4Z4GA 4PY5A 1TK8A 1NOZA 3OS0A 3V9ZA 3G85A 3AVKA 2GBZA 1RNLA 3F6CA 2FEPA 3RVKA 3L49A 4KI6A 3THVA 1D2AA 3RRGA 4NCBA 4DQIA 2NT3A 3RVMA 3TX6A 1PUXA 2XY7A 4E7IA 2HVHA 3QLUA 1SL0A 2HHTA 4NICA 5JNSA 4OKEA 4IG3A 1F51E 4RXMA 3S3NA 4FLTA 3SG0A 1U2PA 4M3UA 3I0RA 3L3UA 3QLVC 4CEOA 1DBPA 3QEKA 3C97A 4CEAA 3QINA 3NF7A 4FJXA 1SV5A 1T8EA 2YKNA 4PA1A 4JB0A 4M3WA 4C8LA 4BE1A 4CIEA 4M3RA 3DYAA 4QYMA 4C8OA 1TVMA 1Z16A 3V4IA 1P6UA 3DRPA 3IP5A 2IOCA 3CTPA 1NK9A 3L2WA 4IFVA 4FLUA 2HW3A 3DGEC 1LBHA 3LUHA 2IAJA 3RTVA 3O1HB 4DSEA 1EWTA 2O4IA 5J2QA 3RMCA 4JS5A 2FMKA 2Q5CA 1QS4A 4KB1A 4FXDA 2PMCA 4PICA 3SUOA 2LIVA 3TAPA 1RT6A 2MSWA 1S6PA 5KGXA 5KWSA 3HDVA 2VG5A 3M8QA 3OJSA 1RZRD 1J9AA 4EZ6A 2HHVA 3TB6A 3QLVA 1QP4A 3OM1A 1S9EA 4FM0A 4Z4IA 4Q6WA 1SKRA 1BQMA 3T8YA 1REVA 1RTHA 3AVBA 4FLXA 2J48A 1ZVVA 2FXIA 1IH7A 4O0IA 4EYOA 4C8KA 1VK0A 3OQNA 1FKOA 2IGIA 4FJKA 3KLEA 2QR3A 3TAQA 3KK3A 1CXUA 1L3TA 2NZVG 3G1WA 4KFCA 1IO2A 3SPYA 1ZAYA 1JH9A 4MS3B 4LSNA 2WMYA 3ZT2A 4CFBA 2LBPA 2M1ZA 4JRPA 2HHXA 1YS6A 1KRWA 4HNSA 4O1IA 3O3FA 4IFYA 4KHQA 3C6UA 1VSMA 2HNYA 5IBQA 4DADA 4BWMA 1Z2DA 4NCAA 2IYNA 1OXKB 1IIBA 2YNHA 3KK2A 4Z4CA 1JL3A 4XASA 2P9HA 4EYKA 2E6LA 1LAVA 1J53A 4O4GA 3MIZA 4RK1A 3P83D 4CGJA 1M2EA 3T38A 4IMJB 1ABFA 4OKJA 4B3OA 3QEPA 1VPWA 4YLEA 4WE1A 4ETIA 1QQCA 4CGHA 3HK2A 5HSGA 1S1UA 5FRMA 4ZTJA 2IPAB 3AO1A 3M8RA 4RSMA 4MS1B 5BR1A 2W42A 3EY1A 3D02A 2YNFA 3TAFA 4RG8A 4K8XA 1CZBA 4JRQA 7ABPA 1KMIY 4LRQA 4CK2A 1EKEA 1M5UA 1WAFA 1XHXA 1RXEA 3OLXA 4N47A 1CEYA 1RZRA 3BRQA 4Z0NA 2RDMA 3GRCA 2TMYA 3P9YA 1T05A 2QSJA 4DF8A 4AHVA 4LD0A 1TGOA 4CIGA 1WSEA 3RVSA 1SL2A 4FK2A 3U3YA 2JCGA 3BRSA 4Q6BA 3KJXA 1IKXA 1NJWA 3WNGA 3TANA 4GPAA 4QPJC 5DGCA 4AH9A 3OO0A 2IDMA 2LSNA 4CEQA 3OYIA 3B6OA 4EP5A 5TPZD 3N6VA 3V1OA 3KYJB 3LUAA 5KQPA 3KKSA 4GMJB 1D9DA 2E4VA 1RBSA 5CNKA 5TQ2A 1TVRA 4IKFA 4RWEA 1IKWA 3HT3A 4RK0A 5CY4A 1ZBFA 4RDCA 1XHFA 4FJIA 3KYIB 2ZAYA 3JY6A 5FROA 3K59A 4Z9BA 1WAJA 4QICA 1LBIA 1BL3A 4CK3A 2E4UA 4KTQA 2FMHA 3LUJA 1YS7A 3QELB 2FBXA 1JLAA 5TQJA 2Q3SA 2X78A 3A0UA 1RT5A 5JNWA 5KRTA 1C0MA 4KPYA 4NQRA 1DZ3A 3QO9A 1RBTA 2Z1JA 1L5UA 3VN5A 1MU2A 3KLNA 3S3OA 3IG1A 2E6MA 3E01A 3M9XA 3K4HA 4KFBA 5KGWA 4CJEA 4JASB 3T3FA 4BDPA 4S05A 3NDKA 3VA0A 4CJLA 3HZHA 3A10A 5JNRA 3V81A 2D0AA 4GW6A 2F8TA 4RKQA 1JWLA 1KTQA 4LSLA 2MYNA 3DOLA 4M88A 4RW7A 4YO7A 5CYMA 5IUKC 1FSPA 2L19A 1RNHA 1YT3A 2JLEA 4E0DA 2LPMA 2B5JA 3VQ5A 2IPLA 4KTWA 2I5JA 1C1BA 4P1ZA 5HRSA 5EWMB 4RKRA 5DCLA 1S1WA 3OO1A 1N5YA 3AO4A 3QEXA 5J2PA 1YTAA 2PE5A 1ZBUA 4DFPA 4CHYA 3MYYA 4FYDA 4QOZB 1SL1A 1DCFA 3HYFA 4TMYA 3QEMB 1HMVA 1X9MA 3GV0A 4FB4A 5HRPA 3OYLA 1ZGZA 3KTQA 1TMYA 3H08A 1M2FA 1BA2A 3DMJA 2QV0A 4MRMA 3LP0A 2HQBA 4MQEA 2GI4A 1ASUA 5CNMA 3DI6A 3K5NA 5TPZA 1TL1A 3KLGA 1TKXA 3LOPA 5DK5A 5FWYA 2VG7A 2QU7A 1QP7A 4KB0A 1YMVA 3OQMA 3I42A 3M8PA 1D5AA 1JLKA 4RK5A 1VSJA 1EFAA 3AO3A 5IUNC 3L3VA 3NH1A 2MYUA 3ZSWA 4IBNA 1FFSA 3UIQA 1JBEA 4RW6A 4FJNA 1JLBA 1RDCA 1S9GA 3RR8A 3JS5A 4MS4B 4GNRA 1GOBA 1AB6A 2CHEA 3OYGA 2XY5A 3HUUA 2QZJA 3NBMA 1KSPA 2XDYA 5HROA 3Q41A 1D1QA 4YRZA 1NJYA 1ISSA 5HRRA 1DRKA 1QSYA 3VNBA 3H5LA 1EWVA 2FN9A 4H8KA 2HJ9A 3FGZA 2FTKE 2WONA 1JX6A 4ZJPA 1NATA 2YV0X 4OPJA 2Y1JA 3NNDA 2FBYA 4B9LA 4F8RA 3SJJA 3H5OA 3LTEA 1RPJA 4G0OA 5F64A 5HM6A 4CF0A 3AVGA 4BACA 3PO4A 1JL2A 4HYEA 4KREA 1YVUA 1U49A 3RH0A 3QETA 4YGXB 1K66A 4B09A 4B08A 4I2PA 5T3YA 1VSKA 4E7LA 5KC8A 1ISRA 2B4JA 4F11A 3ALYA 4NYNA 1C1AA 4EY3A 4G0PA 5HP1A 3PV8A 1HYVA 1GOAA 2XRIA 3OYNA 3GWGA 1QSLA 4W5QA 3SI6A 4FK0A 1SXIA 2RKIA 1HYSA 2HQRA 3LAKA 1QQBA 1S1TA 4EP4A 2IKSA 4W5TA 2PUBA 1NK8A 3RWUA 3MXIA 3T6KA 3D45A 4ID5A 1EAYA 3OLZA 3IP9A 4E89A 3SCXA 3URMA 1RT4A 3L2VA 3MEGA 2PUGA 3LZIA 4ETNA 4HHTA 2JVJA 5BQ3A 1XI1A 1LV5A 3HS3A 1QE1A 3OYMA 1YK1A 3CZ5A 3DLRA 1TAUA 4RY0A 3SUNA 2GV9A 3ILYA 5IUJC 3RMDA 3EULA 3LALA 4HCCA 1JLCA 3OYAA 1WNSA 2JRLA 1C6VA 3NF8A 2B4AA 4CK1A 3K57A 3V1RA 3H5TA 4KK4A 3VNAA 2EX3A 1ZGGA 4AHRA 3QNNA 4WZZA 5C25A 3VQQA 3A2FA 5IX8A 1ZBLA 5JS1A 3Q15C 3T95A 3VQDA 3VQ7A 2P4UA 5TPWA 3B6PA 2A9PA 4E7JA 3HV2A 4GVMA 1XHEA 2FEKA 3GL9A 2PYLA 3QLUC 4MS3A 3BILA 3D8UA 1FFWA 1J54A 2D0BA 1JXEA 2B6AA 5DMRA 4XIUA 4EUKA 4WUTA 4MR9B 4B9UA 4YP9A 3LP2A 2CD7A 2YNGA 3KLOA 4YFUA 3NF6A 3L2QA 4G0YA 5PNTA 4FZXC 1JLQA 3BREA 1Y97A 2KZMA 4IDKA 5KQGA 3PX0A 4DTOA 2VWKA 5E41A 2Y1IA 4WXEA 1PHRA 3RVNA 4KAZA 1U45A 1GCAA 2CHFA 1GUBA 2MYPA 4FLVA 1H9CA 1EX4A 3CRNA 2QXYA 1UA1A 3Q9SA 3KJVA 4B8AB 4MLDA 1VKRA 4CHOA 2L18A 4O55A 3SQ1A 4FZYA 4MR8A 4ELTA 2MSLA 4CHZA 3CG7A 3CHYA 2D0CA 4M3XA 4YCSA 3ZSQA 1CZ9A 1O1WA 4G97A 2RPIA 4EYQA 5J1EA 5EWLB 3AA3A 2OZMA 1J5OA 3VQAA 1TM2A 3ZT0A 1R8JA 1SXHA 3PX4A 2XY6A 3IRXA 3TARA 2ZWMA 4EYGA 4K8ZA 1FXXA 4CF8A 4H3HB 4AHUA 1NK7A 3HSYA 1P6QA 2QKBA 5C5CA 1UA0A 4DTJA 1KVBA 2O20A 1CHNA 2FLWA 3ASMA 5C5EA 3OYKA 3RVRA 5T7BA 4RK6A 4DU1A 3MM4A 2KFNA 1C0EA 3SQNA 4J2AA 1J56A 4ICLA 1TAQA 1QPZA 2Z1IA 2VUHB 4RW8A 1Z15A 3T1AA 4Q5VA 3L8BA 2AJQA 3QIPA 5SWMA 3OYBA 4IRXA 1Q9XA 4B9TA 3SUPA 3ROTA 1NY5A 1JL1A 3QELA 4RXUA 4CEFA 4M3TA 2WWVD 1WSJA 3AVNA 4TLLB 4FE7A 3ZCMA 2QXFA 1R0AA 4ZMRA 1S8NA 3N8IA 4RXTA 1VSHA 3LAMA 4G0ZA 2OPQA 2RN2A 1BAPA 1A5VA 1JHZA 4CJWA 1ZBHA 1HQUA 3CM5A 4B9SA 3HM9A 4E3SA 1VRUA 1BIUA 1EETA 2MYTA 5HBMA 1RBUA
chains in the Genus database with same CATH superfamily
3VGMA 5C24A 2HR1A 1XBTA 5AQNA 1C2TA 2HBQA 4KAAA 3T41A 1JG6A 3WDMA 1YJNN 1KMCA 4BFVA 3VEWA 3Q1LA 3VNRA 3RABA 2R0QC 2RJOA 1F2UB 5I3UA 5AVRA 2QRQA 1PQUA 1H2YA 2HK6A 1WLYA 1E8DA 5IM4F 5BORA 3DHEA 3LGSA 1FRNA 1IKVA 4A92A 1RTDA 4PGAA 3UANA 4KHSA 3DZ8A 2Q0SA 2I76A 4DDVA 3LP1A 4JJKA 1QZ5A 3CBGA 1WPQA 3B3JA 2JLXA 2D7JA 1YR3A 4J0GA 4B7CA 1ABEA 3IXQA 4PHTA 3Q7QA 3AHFA 2VZ9A 2B8TA 1DBQA 1R8QA 4KUEA 3OQPA 5AI8A 5ICFA 1RJFA 2E87A 4IDQA 1OLOA 3A3KA 4FILA 2G9UA 3TVDA 2GCPA 4WCFA 4PL8A 2CMDA 2XPCA 1Q17A 5CFQA 2ZLBA 2ZRHA 2D0PA 4JLKA 3K30A 3UUGA 1W9HA 1O6ZA 1H22A 5DIZA 1APBA 4JI7B 4R7ZA 4EGQA 1JWBB 2IXDA 2R47A 1UKYA 4B7AA 4EPVA 1FDWA 5TGZA 4JI5K 1QWOA 3BEXA 2X1LA 3KQTA 3SC3A 1NVFA 4BFWA 1BO5O 2HBYA 2BBSA 3UMYA 1IQ0A 4L27A 3RSHA 1JJVA 1XMPA 4CLEA 3VZPA 3WFZA 1TLTA 3PEUA 4KHNA 1ZINA 1BKDR 4K0KB 5JJ5A 2UZ4A 3IH5A 3FYUC 3QA3E 4XX1A 1N7GA 3JD4A 5ITSA 3RHTA 4I7FA 4KO4S 4NZMA 4AO8A 3RFXA 3HRHA 1HY3A 2KTQA 4KNWA 3K53A 3H17A 1GU7A 5L7TA 3VV2A 4GOJA 1YOBA 2YQ4A 4YP7A 2QVBA 4ZJUA 2GD2A 1ZNWA 2VP3A 4EKDA 1YRAA 1P7PA 3CX7A 1VQ7N 2A0WA 4AKTA 4CCWA 4A16A 3P7MA 3H1FA 5AJYA 5EMHA 1VPTA 5EE3A 4KKVA 5IH3A 4DR3K 3ZLTA 4M41A 1J70A 1TYBE 5BPHA 1G5TA 5COQA 4PAOA 5EIBC 4W9NA 4TWZA 1UAXA 5CEJA 2UAGA 5KNBH 4HR7A 3AHEA 5GM2A 1TKZA 4B34A 2BEKA 5ADXA 4YAIA 3IS9A 2VQ6A 4BQZA 3LDSA 4MW1A 1DDOA 4A8JA 4LZOA 1KERA 5ENZA 3FZQA 3CZAA 3L8ZA 5F9HA 3ZBUA 1HWYA 3PFKA 3T5MA 4KE6A 2QTCA 4NOKA 2YYZA 1CUUA 3A4TA 2EJVA 1C1DB 1Y6FA 4RA9A 1W8IA 3N4PA 5CDSA 2B61A 5ARBA 1SH7A 1IY8A 3JR3A 4LJRA 1YJXA 3ZETB 3E5MA 1PG2A 3H9GA 1JUDA 2YMQA 3ZY4A 4IOMA 4LKRA 2JASA 2IBTA 4KFUA 3QA9A 2P8JA 1C9EA 2O6HA 3T3IA 3MCAA 5AQIA 3T7AA 1Z25A 5JNTA 2VPYA 3EGXB 1QE3A 3GBVA 4X62B 3GY0A 3U7GA 3LX5A 2C8VA 1YE3A 3IUYA 3PX3A 3TTVA 4EECA 1FP7A 4R9SA 5FTNA 4OMFG 3AHIA 4QEKA 4AHCA 2ESRA 3CPEA 3I4CA 4OXNA 3ZWAA 1G8GA 3M6FA 1P8ZA 4D5GA 2CCGA 4F4KA 5IMBA 1E18A 4C8MA 1QCDA 1Z08A 3WLMA 4LXTA 2JLVA 1E66A 2CLOB 4Q9KA 4ZEXA 4JODA 1TCBA 1QFJA 3BBPA 3DRSA 1V4SA 3WDKA 1U0OC 4M7XA 2IPXA 1F2UA 3HJNA 1E2MA 4ANFA 3DQPA 1P0PA 4PFJA 4PQUA 1HRKA 3V9AA 3LVFO 4ZT3A 3N0RA 4A3SA 2QN7A 1BOTO 1VB5A 4S1OA 2DSTA 5C53B 1PLLA 4MV1A 4CMEA 1EZ4A 4JJFA 1WS6A 1I3OA 3OURA 1KY4A 3GLSA 4XTCS 2FHPA 3NGIA 3ZD6A 2ATQA 4LJ6A 5IN5A 1RAAA 1M8GA 3FOCA 5KOHB 3AARA 3R7DA 4IXWA 2Y8EA 4B6SA 4JBYA 2FQ1A 1Z0JA 3ZWYA 1AZWA 3LBFA 3WGKA 4CBUA 2GF0A 2AJDA 1XF1A 2A9QA 3ZHXA 1IFXA 3K6SB 2PN1A 4X9XA 1DKOA 4QXMA 2Q5IA 4GPZA 3WAKA 2YOFA 4R16A 4J16C 1T8SA 2AYXA 4YJ2B 4C7BA 2E18A 3TJRA 2GJAA 3MHPA 2IU6A 3KLFA 2COKA 3LLMA 3EAQA 4IM7A 2XQKA 4QVKA 1SURA 1E3LA 1URPA 1VSIA 5DGXA 1XDWA 3SJBA 4S35A 4FFLA 3EZXA 1I3CA 5AUNB 4E2XA 1D0SA 5C42A 1EB9A 3S4YA 1REQB 1AGRA 4M2LA 3MSXA 3KO8A 2RGYA 4FYKA 3RUFA 4R2WA 1U7ZA 1UL1X 3A6JA 1QFYA 1XVIA 2OHGA 3EHDA 1N1EA 4D8VA 5KTSA 3A8YA 4EA6A 3QXHA 3D5QA 5T6MA 4AICA 2PIDA 5JALA 3LDAA 4L85A 1KL7A 4KV8A 2GUWA 4MVJD 5B3AA 4I2QA 5IDYA 2Y71A 4RZ3A 3G89A 2NIPA 3HI4A 5ALSA 1V9CA 1PNQA 2GYVA 5LJLA 4OHYA 2UYOA 3PSIA 2XSZD 1X1QA 1IEVA 1YIOA 4RJTA 1Z4LA 1L3VA 4BDSA 4F06A 1RI1A 3OWHA 1EDZA 4QT4A 3OPNA 1A5TA 4YIKA 2V9CA 2OBBA 3RUAA 2XCQA 2J7PD 2GZ2A 3H42B 1ZMOA 3QWIA 1IK4A 4IVRA 5JY6A 3D4OA 1WAMA 1BCSB 3F9CA 1LZKA 3DWGA 1LRLA 3WXIA 4J7AA 3N87A 1RT2A 1QIGA 4G4SP 3LP5A 2FW0A 1SHTX 5HX7A 1H0HA 3DKPA 4V0NA 3WLRA 4A0FA 4BLQA 1C1DA 2WTAA 5GGXA 4X93A 2BHNA 5IXJA 1NW6A 4BN4A 3UAWA 2G5PA 2XBMA 3P19A 1ETHA 3ZETA 2I7DA 4MKZA 4DTSA 4MVJA 4FEYA 2BMFA 4C5CA 4ITRC 1BYIA 2R97A 3FJ1A 4E32A 2EDAA 4BY9E 5DKFA 1S89A 2HRBA 4XWKA 2X2OA 4QO8A 1KVCA 2XSZA 3IA2A 4UFNA 1SM4A 1WB6A 4NATA 3GZJA 3EGXA 1AS3A 3M6XA 1YNSA 2IHZA 2O8FB 5KVQA 2P6RA 1F9EA 5F21A 2FBVA 1G5PA 4D4MA 4G2TA 4KO0A 2J7PA 1L8QA 4U67L 1ZVKA 1O03A 4AIIA 2BBTA 2XY4A 3BMCB 1V7QA 7AT1A 3IEMA 2JH8A 3OD5A 2P5SA 3DAGA 1AG9A 2DKFA 1LLFA 1CUXA 5M1FA 1PU2A 5SZJA 4YRNA 1RBRA 4EUNA 3SUQA 2ZAGA 2BKVA 4Z0HO 2G1AA 3HEMA 4YNBA 4XLTA 2RH8A 2QWLA 3TAMA 2ZITA 5K03A 3VR3D 4BC2A 1EQAA 3ESRA 2QXUA 4O8CA 1OVMA 2CLKB 4B45A 3CTMA 4HD8A 2IP2A 3CXCM 1KDRA 4BWJA 2Q2WA 1VCNA 3I9V1 5KTYA 3TS1A 1RWNA 4B3MB 3C3KA 3I6IA 3OLWA 4I55F 3P2JA 2I3AA 1KHHA 5KCMA 5KOHA 1BVYF 3OIYA 3BH0A 3I9NA 3R5XA 4EAAA 4OH1A 1T3HA 4RD6A 1PZFA 3EG5A 3HNOA 1QHAA 5IEBA 3V4SA 3N0WA 4ZOLF 5AQQA 4N5HX 4DQSA 4LI3X 3C5WP 3K6SA 3DEJA 5SZKB 2FSSA 3OOJA 1F1BA 4NCNA 4YJ2A 3WNVA 4V38A 3PC3A 2XMDA 5M3BA 1H1VA 1XTJA 5LY3A 1VE1A 4I4TF 1G60A 3AR5A 2Y99A 3MMVA 1RZVA 1PBNA 2P51A 4JKEA 4CKEB 3AFGA 3AJEA 1W1UA 3VR3A 1AMUA 2HHHB 2WWXA 2ZSKA 2I4IA 4AULA 3HTXA 3H5WA 3MOGA 3PZRA 4Q34A 1M6HA 1RM3A 3R77A 4KHUA 1REQA 3SZ2A 5AQRA 4Y2YA 3NVMA 4WYBA 3LRPA 2OR3A 1EUDB 4H1TA 1KBZA 3HYRA 4R71A 4KMMA 2WF5A 1A9SA 3KUKA 1OXXK 4C3UA 3GFPA 1EM8B 4BGAA 5CVDA 1ZWKA 3S2ZA 4EQ6B 3N76A 1KETA 4GLOA 1NRIA 3AF4A 4LXYA 3FXAA 1DOZA 4FOTA 3X0DA 1OUMA 1QTMA 1Z7BA 5CA1A 4K3UA 4RJLA 3KR9A 2PV7A 2OBLA 4BB0A 1NSFA 4Z0UA 2J41A 3DCIA 3E7FA 4JNEA 3V9WA 3ZYYX 3ZKAA 4RFSB 5T8KC 3ZJVA 1F38A 1XRQA 1NL3A 2AG1A 4PC6A 3AVKA 4H0CA 4KI6A 3TXYA 4NTZA 3DEIA 2I2XB 3MAJA 3TX6A 4ND1A 4CYMA 4XJTA 3EMBA 4WZBB 4NICA 2HYDA 3WLOA 3R7BA 4LPKA 4KGZA 1LLCA 2PWZA 1JB1A 3FIJA 1MX5A 1RJEA 2WNSA 3GGCA 2NQ2C 4JX8A 2QJRA 5HKLA 4ZQIA 2FZEA 4YAEA 3ID6A 3BCHA 1E7RA 3IJRA 3IAM6 4KPEC 4LF4B 2JIBA 4IDBA 4X91A 3QX3A 4GECA 1PF7E 4DUZB 4J90A 4ND4A 3WHIA 2QX9A 1N2ZA 1FYWA 3R23A 3L4EA 4MKXA 2ZXUA 3CE9A 1COZA 3BVPA 3RRFA 3WOHA 3VU3A 1NJGA 2ZJBA 3QLVA 3RUCA 2JIZD 2A41A 2GAOA 2O8FA 2F7TA 1Z6QA 4LF8K 4IGFA 1ORHA 2FUKA 1BOOA 2QR3A 3VNUA 2H92A 5JAOA 4Y6GB 4NBNA 4DCGA 5FWAA 1T2DA 2XUFA 3H65A 2I6UA 1T2VA 4R41A 4GH5A 1NNSA 2LBPA 1U2GC 3V2GA 1HT0A 2NAFA 3WB1A 1RYDA 2ZDQA 3R7WA 4IFYA 2PNFA 3R3JA 2WJ3A 1YSCA 2ZUFA 1NOJA 3L6QA 3SVLA 4N18A 3KQNA 2VJAA 2GERA 4U3JB 4IMJB 4I5IA 4B3OA 1YACA 1CZOA 1Y0BA 3IO5A 3RT7A 3K4PA 2RFLA 1J6UA 1S1UA 5LIRA 3BD7A 3CM0A 2A6AA 1UXKA 2GFQA 1OFGA 2UXCK 1ID8A 3H8VA 2P9YA 2O2XA 2QZZA 4GVPA 3TOZA 2CLFB 5B1YA 1CP3A 5TC4A 2CUTA 3RIEA 1JG4A 4NWIA 2TRSB 3HLYA 4XVCA 1Z4PX 2GBIA 2TMYA 4LRYA 2JIZA 4AQ7A 3OA2A 4ZO7A 2OILA 3L04A 2RBKA 1MNQA 3WE7A 1RBSA 2HHAA 1BG6A 1OSNA 1JR4A 3CW2A 3LY9A 5IVPA 3CJTA 3VPDA 3KALA 2B30A 4UM9B 1ML3A 3C98A 2QRKA 4QRDA 3PHHA 2KHZA 1OWPA 2G83A 1HI9A 1T0UA 1A4IA 4CIAA 1NVVR 1YRWA 1JDBB 3TM5A 1IY2A 1FTNA 5KYVA 4F4FA 5I5EA 1MR3F 3QOYA 2ZJFA 3TSCA 2CFIA 4BIMA 3Q3HA 2BIFA 3IG1A 3LX4A 4CKEA 4AQDA 1OZFA 1SOUA 2YIJA 3ILSA 4YRTA 4JC4A 4RTRA 2F8TA 2D1YA 1ZOOA 1GKYA 3DV9A 1J39A 4YO7A 5AQTA 4KMOA 1VM6A 1JGTA 4K9SA 2OZVA 4QECA 4P1ZA 3ZU6A 1UH5A 1SAZA 3ZQ4A 4CMAA 1EVZA 3JD0A 1J09A 4E5UA 1EUDA 3CGWA 1DCFA 2QZSA 1T0IA 4H0YB 4LYDA 5HRPA 1CW2B 5HF9A 1EM8A 2AWNA 3H9QA 3VR5H 3IOYA 3AKZA 4I99A 3QWAA 4HGNA 1NFQA 4EQ6A 2F1KA 1WUKS 1YJBA 4YMGA 2PX6A 2CMHA 2QJOA 3IBSA 4C3OB 1I3KA 5CPFA 2PXAA 5COAA 3UJNA 2YXLA 1W85B 3VPZA 4XM0A 1CUBA 1IOVA 1GGEA 4RBNA 1CUZA 1YULA 2GPYA 1NVKA 1RDCA 3H97A 4RFSA 4D5EA 4IJ5A 2VRNA 3M1AA 5I4BA 1UZUA 2I54A 8GPBA 2DPGA 4R2IA 3OKCA 4MIYA 3R0QA 3KRTA 3OZDA 2VJNA 4B9LA 3DR3A 1NMXA 3GPLA 3H5OA 2CXHA 1KI8A 2AUMA 3I4FA 4M9SA 1XU4A 4UQPA 2AUNA 4IFTA 3FZMA 2WG2A 3RR2A 3C8HA 1PFYA 2HJVA 5F2EA 2B4JA 4RLFA 5GIOA 1E7YA 5AW4A 1YZYA 1PW5A 3SFVA 4UNRA 4RYDA 1QSLA 3SI6A 4MVCA 4L50A 4M86A 1II9A 2P0EA 2Q0UA 3O4HA 2P3SA 1L7DA 3P94A 3T6KA 1UJ6A 4OD0A 3FG9A 4E89A 1VPEA 2O54A 4JENA 1Q22A 5BQ3A 4B4KA 5LD2B 5JHHB 1ULHA 3GEIA 4KDCA 3FUXA 3RMDA 1I0LA 3EULA 1W9MA 2JRLA 1C6VA 3NF8A 2OGSA 3H5TA 2VTDA 4XDYA 3BIWA 2D74A 2YV3A 4GWLA 3ZG6A 3RROA 1XD9A 1PDOA 4WH0A 5SZHB 2IXBA 2M6KA 1R7RA 1W93A 3LKDA 4DJJA 3F5QA 2X5XA 4U63A 4LYAA 2O57A 4DR4K 4UM9D 4H1VA 2X4GA 2H6EA 5IS2A 1V47A 1PHRA 4IOKA 3RVNA 2ZWVA 4FBMA 1DIRA 3ZDRA 2D5BA 1CR4A 1YHYA 3PPVA 5LQMA 4JB3A 4U3JA 4MIKA 3VHQA 2JARA 2BMDA 2DP4E 4MZDA 4CI6A 1LUAA 2A4MA 4TKLA 4LUCA 3DBOB 2GJSA 1P1RA 3WYBA 4ZAWA 2E1RA 3AA3A 3WWDA 3ZT0A 1MIOB 3BK7A 2QN9A 3WJ7A 4KFRA 3VEVA 5I9SA 1L8XA 3A0IX 2O20A 3LK6A 1N0HA 4RHYA 1QK3A 4ICLA 4EJSC 4D02A 1AX9A 4LAFA 2XKBA 2Q41A 5JJKA 4TWRA 1ICEA 1TM3E 4UVIA 2D5CA 1UC9A 4F5WA 3LWDA 1IL0A 4XUDA 2NUAB 3AVNA 3PJEA 2IWRA 1N5RA 1MORA 4HN4B 4E30A 4B7UA 1BVUA 1CVLA 4Y6SA 1N8SA 1H6DA 2OQVA 1FFYA 2H65A 1A5VA 4DV5K 3W6UA 5JECA 4TT3D 3SJUA 2IYFA 1VRUA 1BIUA 5HFNA 1HH4A 5HBMA 1RBUA 4Y67A 2LZ0A 3QUSA 4OYLA 4B6EA 2RF2A 1CDEA 1A2BA 1T3GA 1TW3A 1G5FA 4O3MA 4TL8A 2IZ7A 3FHCB 8MHTA 3MN9A 4PSAA 1HNWK 4ZVQA 3P0HA 4PTYA 3PXAA 4FPXA 3AOEA 3MECA 4R31A 4FSHA 1QVWA 4PCUA 4D42A 2JFUA 2YCBA 4WINA 2VHUA 4N3CA 4WD3A 3F4KA 3U6BA 3AEKB 1C0UA 2XQGA 3PSFA 4HXGA 2Z8YM 1YJ5A 5C52B 2ZIAA 1U9ZA 2NSJA 1O57A 4CIFA 1J8YF 4BX0A 3R3UA 2X15A 3O8QB 4OXYA 4ZZ1A 1YVRA 3WK8A 5LBTA 1GPJA 1Q0ZA 2PEYA 3RANA 2QRPA 3AUKA 5EGNA 1Y3IA 4BMNA 4MQUA 3Q87B 1Q5PA 3F9MA 2FZLA 4IDAA 1CZKA 4EVSA 2R84A 5JOQA 4WK4B 4TT3A 4O4IF 3PJGA 3OJLA 4NYMR 4Q48A 5F9MA 1W0JD 1LXCA 3NH2A 1OTXA 2F59A 3RS7A 2DEUA 3JYTA 1W0HA 1WDTA 4DWVA 1QQ5A 5A0TA 4P4NA 3EDCA 4WFNL 2LTAA 4QULA 4X60A 4ZDJA 4NV0A 3LDHA 5DHSA 3S2EA 3HCAA 2PMBA 2D2IA 3EVBA 4D8XA 1UR5A 5DASA 3Q7IA 3FTFA 1DS6A 3W1WA 3SM9A 3FOZA 1WG8A 4JJ7A 2J1LA 3PUXA 4BPBA 5CLHA 3EDYA 3I32A 4OJMX 4TKUA 3P27A 2AC4A 4D43A 2EIHA 2X6NA 2JGDB 2FE1A 1YJ9N 4BIIA 3HA3A 2OL4A 1R6DA 1L4GA 4KBGA 5TMBA 3L41A 5BNTA 2VAMA 3MWJA 1PR1A 4PC2A 4AP5A 4J0CA 1Z28A 4JITA 4F04A 4CZJA 2QSUA 3NE6A 4OGEA 2WJ4A 1XZCA 3OZTA 2PBFA 5CA0A 5C32A 4YTEA 2IHUA 3QPWA 3T7RA 1PS0A 3O3HA 1W0JA 2BSXA 4CV1A 3D6TB 4KN9S 5HYVA 4A6DA 2IIQA 3QUAA 1RYMA 3RSZA 3MJCA 2L2QA 3CJ1A 4DV7B 3U31A 2V03A 4D9BA 4W5OA 3QKRA 3LPMA 4GVXA 1OXVA 3NC0C 3BF3A 1E6LA 3QI2A 3WK6A 2EFYA 1JXMA 5LL6Z 1E1CA 2FF5A 2YHUA 2PUEA 1MIOA 2QL6A 5K45A 3B12A 2PD6A 3ZHCA 2OGZA 1KA9H 3N9IA 4IXTA 3NBUA 4A73A 5DMXA 1DJPA 4DCVA 5E26A 5AVYA 4JLDA 2ZR0A 3S8YA 3PXBA 4WBNF 4E5PA 4NXMB 1M1KO 1I80A 4M42A 4PZ0A 3B3QA 1G1MA 3NTXA 4HEA6 4I6MB 4XIYA 1A5SB 4FYWA 5DFAA 3DDCA 3HXPA 5FOQA 2NUAA 5FHRA 2XQJA 4N40A 3O1BA 2PKYX 1TJPB 1FYXA 4ZAGA 2BW0A 3DYVA 2ZYHA 3AGKA 1LDGA 4I19A 2Y0DA 4ZVUA 4DTIA 1VGVA 1NF3A 2F3UA 3C3EA 4AWXA 3PEVA 4JUBA 4EARA 4EUSA 2GN0A 1NW5A 2AYZA 4KVZA 3PJDA 1CLUA 1QHSA 5DX0A 5ES3A 2I87A 1T1GA 3I30X 3KXKA 2YH2A 4FGUA 4FVUA 4P31A 4Q16A 1YITN 2AG0A 3DLEA 5KTQA 4O2BA 4EF4A 2FSFA 3B5JA 1SKUA 2VRWA 1KYTA 2GBPA 5HG0A 2NTYC 2P7IA 3OE1A 3E23A 5JSQA 4I1OA 3CQYA 1IG3A 1IUOA 1JG3A 3GD5A 5JS8A 3EG9B 4PX5A 3UM9A 3RUDA 1IEXA 2RGDA 3DYIA 1U94A 2KJQA 3O9RA 1V1MB 2X0JA 3SJAA 1X74A 2G71A 4I1RA 2PX4A 2BZ0A 2V3WA 6ABPA 5H0IA 2J9YB 3M34A 3ETJA 2EERA 3ORHA 4C3VA 4S04A 4A0RA 2B6NA 4GFDA 2ID7A 3BMQB 4QZVA 2C8LA 3QMVA 3Q10A 2RKWA 3ORRA 4JBHA 3ELDA 2RD2A 4ZWNA 2HNDA 4KQIA 2RMKA 1T1EA 1L2TA 4INAA 5C37A 2IUUA 3N0TA 2D3TA 1JYEA 2CC2A 1AKRA 2C3MA 4KHYA 2O14A 5CCDA 1JV2B 2JWKA 2WIAA 3SK3A 5KDLA 5EJ9A 2I78A 4H15A 4HNRA 5FEMA 3ATVA 3DT6A 4B75A 3CVYA 4YCCA 3KXPA 3BEDA 3ZJ4A 1NFRA 4OHZA 2J5BA 3C16C 4D9FA 1F2VA 1F5NA 2PZJA 3J7YP 3TLZA 4J0DA 1XUOA 3I45A 4NMMA 2KZZA 1USGA 1IY1A 2BEVB 2WOOA 1WXHA 3W1VA 4PZ9A 1ZH4A 2JGDA 2CUNA 5CT9A 2XA1A 3X1KA 5H7XA 1C0FA 1E94E 3L84A 3H13A 3OA9A 3A06A 5F7JA 4Y1GA 3C3DA 4DMLA 4LQCA 5JADA 1E7WA 3ZHVA 4XOUA 4RABA 1XZBA 5DBOA 4FDTA 4QE3A 3TFWA 3IDAA 1SXJE 1W44A 3WI7A 5HLFA 2J45A 4P84A 1HR0B 4IPTA 4NV3A 3ZE6A 4EHKA 3ILXA 2DMRA 4OJKA 1QLWA 3ZHYA 3MWDB 3UBMA 1QQ6A 4M0CA 1IG8A 1M1NB 3QE2A 1ADCA 3VO9A 3NGZA 3HC7A 3ZQKA 3WNCA 2MCFA 3Q40A 1RIIA 4MVJI 3DL2A 5CYPA 4IHJB 4IRUB 4Q3AA 2FSVC 2WFZA 1XMQK 3AVCA 1HSZA 2AC7A 4UHKA 3W2TA 1TLFA 5CT4A 1NVTA 2FZKA 2JD1A 4KXLA 1CV2A 4KBFA 4IQFA 1ZN2A 5BR9A 3OW2M 4NNJA 2GTHA 1YMUA 1E92A 3MN7A 4BKQA 4MJ7A 4R54A 5I3ZA 3D8TA 4P7BA 1YRBA 5B58C 2W83A 5JC1A 4PHHA 3ROEA 2NT4A 3ENNA 2FMXA 5EHZA 1AT1A 4Q7JB 1GO2A 4F4HA 4BZXA 4XIJA 3NU1A 4BMPB 2HRRA 4KLCA 4RW9A 4BNMA 3EC7A 3GBTA 3ZHTA 2DT5A 4AWAA 4B3BA 1L9XA 3N6RA 5BPMA 2DUMA 2ZIEA 3DBRB 4XARA 5T64A 1M2HA 4I6MA 2ZRMA 3TFQA 1E62A 3K5WA 4U5QA 3A3PA 3P52A 4DR7B 4LK3A 4HDQB 3GLGB 2WUFA 1O96B 1P4HA 4CFZA 3SS8A 2ZRJA 4KE9A 3B51X 1O95D 1Q1GA 3THSA 1DTSA 4BRSA 4NR0A 1N3IA 3EEFA 2OGTA 3ZDZB 1Y8QB 2Q21A 1NVXQ 2CFTA 1K27A 3IBTA 4WLVA 1G17A 1G5RA 3VHLB 3VTAA 1AOXA 3RASA 2FNAA 4YP5A 2GA8A 3F6YA 2WJWA 2ODAA 3CRRA 4R01A 4MI9A 2J8ZA 3ZW9A 1T8TA 3O1JC 3ZDYB 3SYTA 4FLZA 5JRDS 1XTTA 1AV6A 2GX6A 4D9GA 1OX5A 2ZULA 1NBME 3BRCA 1XD2B 3HXQA 4AKSA 3R5HA 3CLTD 1H3EA 4ZHQA 1QYCA 3IB6A 2VUTA 1FDSA 4EZ9A 2WW8A 5HNKA 3KKZA 4FCWA 2JK0A 1FMFA 4LF9B 3PQ5A 3JQBC 2VL7A 3CR7A 1OI2A 4OGKA 1H0KA 4KKOA 2SHKA 4Q21A 1V1MA 5LP1A 2NMVA 4X3CA 4R7TA 3CIPA 1XE3A 4E5DA 4K9OA 4FJ9A 1EP9A 4BJ6A 1O95A 2NZ2A 2QJFA 2CNBA 2IS3A 2WVHA 3IPAA 4Y18A 3DXFA 2VHWA 3BG5A 3A5LC 1AUQA 1M76A 3BMQA 2G1PA 1AKEA 4OA8A 4RM3A 3B82A 5K20A 2FF3B 2WC1A 1OLSA 1ZBQA 4UCQA 2H4WA 2NV2B 1BH6A 3WIBA 2A3NA 1WZEA 3WGLA 3TDNA 4HV4A 3PI7A 3GQVA 2CWWA 4W5HA 3VC2A 4G4GA 5TVKA 4X1KB 4CKBA 3B3FA 3C7DB 4YUXA 1N57A 1J07A 2YWGA 3I9KA 4Q93A 5DLYA 1QQTA 1XELA 4F4UA 3OX2A 1XVVA 1DPGA 3KD3A 3FB1A 5IDVA 3AA5X 5FTLA 1QIHA 4CFAA 3LLVA 4IKOA 1EHYA 4O8ZA 2O7VA 4K0RA 4ENRA 2BEVA 4JKAA 4KWTA 3U3RA 1G20B 1QV7A 2QTFA 4QGBA 1ATIA 5LZ7A 3GGOA 5LDHA 4KN8A 5G3ZA 3A9TA 1FNNA 4PV7A 1SQ5A 1XCPA 3FR8A 4JP8A 4QNMA 2PS9A 1U8YA 1DTQA 3MCPA 5DN9A 1JFLA 1I13A 1JAHA 3L7NA 5BXYA 4Y9UA 2YTZA 3BZUA 2QRGA 3KJFA 4LCBA 3FIUA 3ZUGA 1W47A 4QRHA 3MTEA 5BPLA 4II2A 5JXJA 4WQ5A 1PK9A 2TYSB 3WTBA 2X76A 3MWDA 4G4SO 3OJCA 3RU9A 1N33B 5JBNA 4Y8VA 5TIIA 1T0PA 4MROA 3DDUA 4BO2A 3BFKA 1M1NA 3B1KA 4XEIA 1ISHA 2IDZA 1FY2A 2HVHA 3QJYA 1QR2A 4IHJA 3VTFA 3WGMA 2XTAA 3Q9NA 2HCJB 4ROTA 1C7JA 3BL5A 1Z4QA 4ZT4A 2QX7A 4S3MA 1RKXA 3EL2A 2XWBF 4EEZA 2YKNA 4DMUB 3IQEA 1X3MA 4OB7A 2ZSDA 3AGRA 4IJKA 1C9MA 5F2RA 1PT9A 1EZZA 1BDGA 2JIRA 4YHHK 3BEOA 1JMKC 3A37A 1CB7A 1KQGA 2QTDA 2WYUA 4ITVA 2RK3A 3UMVA 2NO9A 3MWKA 4CM1A 3BWBA 4RD3A 2C0QA 3AL3A 5EA2A 2C5GA 4EW3A 5CW1A 1G4UR 5KREA 3DW3X 4KB1A 3JZFA 1BIFA 2JEOA 5BMVA 4IH1A 1IQUA 3D0OA 2GDJA 4ZICA 2WIDA 3IELA 3DBRA 2F8LA 3I1YA 5CDFE 3ENVA 3KU1A 1E3SA 2AV6A 4ALMA 5E84A 1NVDA 2IUTA 1O96A 2GTIA 1XMSA 5KKAA 4C8KA 4JWTA 2WIKA 3TAQA 4ZZIA 3UAZA 2QD4A 1IO2A 1Q18A 1KFJB 4LSNA 1MA3A 1Y8QA 4G8CA 4NYIQ 1JB9A 4JRPA 3F96A 4M7OA 3P9NA 1LB1B 4KHQA 2Z08A 2XUJA 4BWMA 2ATIA 3C3BA 2ZTLA 5ENVA 5L3ZA 3OTHA 1J53A 4NBUA 3K1YA 4Q1EA 4Q1CA 4K43A 1KH1A 1NV9A 4W1PA 4DLKA 1KOGA 4NDNE 1HMPA 1XD2A 3SN6A 3F74A 3D8SA 1OY1A 1BCRB 5KQRA 3COWA 1KFBB 2VSFA 1IDOA 3D02A 4YY3B 3SI7A 3SWWA 4QDKA 1CZBA 3DE1X 3UWDA 3IDZA 3TZKA 1KTIA 3LF1A 1KVUA 1M5RA 3PQ7A 2JFNA 1DJLA 3CINA 1EKEA 4M8NE 3JWEA 4C3ZA 1RKVA 3SZMA 2MIIA 3OLXA 5IF9A 1CEYA 3ZOZA 2QU8A 4C6RA 2IHJA 4EF6A 3ORFA 5BUZA 3BP8A 3T7JA 4BNKA 1CD5A 2FW1A 2WT4A 4DA0A 4QPJC 2D5LA 4CEQA 5KZMB 5F5LA 2B7CA 1MC4A 1XHFA 1VP3A 2QTTA 4KB5A 3R6MA 1JT2A 3U6KA 4E88A 4GM0A 2CHUA 4YRCA 2NPIA 2PPLA 3G59A 2JAHA 3GI1A 1L4NA 2Z1JA 4IDDA 4X1KA 1MAWA 5AQMA 2PBZA 4R4JA 2PGJA 5EXEA 2JLBA 4FFMA 1ZH6A 5DGHA 1M8KA 3O95A 4M55A 2FWMX 4Y0WA 1XEFA 1IJKA 4JV5B 2H54A 3EFEA 3DP9A 3KT3A 1ODCA 3ELWA 5A03A 1H2WA 3U7QB 4GO1A 1XCLA 1IBKK 5AKXA 4U4AA 2AG8A 1GLCG 1XRLA 4BQRA 5J2PA 2Z5GA 4Z3DA 1FVOA 5K3SA 3STVA 5JV5A 5BN8A 4QBFA 2C5HA 4BHTA 1YD7A 4G63A 2BJVA 1NAHA 1G20A 3RAPR 2CW5A 2QD3A 5K51A 2I2FA 2YBDA 4I3FA 2QV0A 3LP0A 1AK1A 1DXQA 1JDUA 4GXQA 5F3RA 2NO7A 4QXRA 2IODA 1EA5A 3UA3A 3GJYA 2ZVQX 3T3DA 3OQMA 3M8PA 1NKSA 2HTEA 4RK5A 3KEGA 3FPGA 1G98A 1WV0A 3PA6A 1XL1A 1A8PA 3L3VA 2Q6LA 1MDFA 5BYAA 4IBNA 5TRTA 2OCBA 5F3WB 4RW6A 3EDRA 2XUQA 1K8ZB 2PZFA 1MJHA 2ECKA 3W5VA 2FX2A 1RWXA 2QNBA 1LX7A 4ILEA 3Q41A 2ONZA 3PC8A 4G25A 3V4LA 1JJBA 2FB9A 3SFTA 3EFHA 4Y6LA 2Y1JA 3MVEA 2C4HA 2Y1OA 3NIBA 2JJMA 3FHOA 3PE4A 3LTEA 3IEUA 3L77A 3MJVA 1TD1A 4Q47A 2FPIA 1XO1A 3R5FA 3G17A 5T3YA 5BWLA 2JHPA 1IHUA 3U81A 2O3JA 3JYOA 4NONA 1YF3A 4ZU1X 4QGFA 2I5PO 3R9KA 2XB6A 1Y4SA 3VH2A 2BMEA 1UBLS 3QFHA 2OVBA 3AHDA 5J5VA 3MXIA 4ID5A 2PZ8A 3ZCUA 2E1YA 2A5XA 2WI8A 1HNXK 3FBTA 1XI1A 3THXA 1DIGA 1ZU4A 2E5LB 1XZFA 2C07A 1HLPA 3USES 3V5NA 4NBWA 3C7NB 3GYGA 2VH2A 4DUYK 4DV3K 5L7WA 1N6RA 1DARA 3VQ7A 3NANA 5H81A 4CETA 2I6GA 1IM5A 3SSOA 2PYLA 2BI8A 5SZIA 1XCBA 3IQHX 5B53A 2QA4N 3U7JA 1RRFA 1DRVA 2LV8A 3OM8A 1M6NA 1YUWA 1PDVA 4L3QA 2HMAA 3P4XA 2BPOA 1HBJA 3TNDA 2PHZA 2JAQA 1SK8A 2NNWA 4KAZA 2Y05A 3QTLA 5D5HA 3JCZA 3QBWA 2QG4A 3MCTA 1T36B 5E9AA 2L18A 1F06A 3P96A 5E7JA 4GEKA 1BCRA 4Q4LA 1Q0HA 4BLSA 3T7DA 1VE9A 2PS1A 1IONA 4I2NA 3LDUA 2OD9A 3B60A 4KXFB 2BM0A 2GEMA 2ZS9A 3FVQA 3ZE9A 4H3HB 4AHUA 1R0LA 5BWBA 4DOMA 2ID8A 4HOYA 1GLEG 1XZIA 1UA0A 4LSWA 1PZNA 2EKBA 1XPUA 2FLWA 2ZCVA 2AOVA 3SBGA 1SUPA 5DBHX 3AZQA 2KFNA 2Q3HA 4M53A 2FSGA 4R5MA 5L7YA 4V0MA 1G2PA 3P2YA 3IC5A 2Q49A 4QNNA 5JD4A 3OYBA 2P6UA 2V65A 1E1MA 3D8NA 1P90A 4U6SA 4DVJA 5FHQA 2P4EA 3L0IB 3EGEA 1U2DC 2YYSA 2GZSA 3QG5A 1XRMA 2QM8A 5JDIC 3MRVA 1VQLN 4EENA 4UCXA 4KRXA 3HHEA 2YNMC 3NVMB 3HFRA 3PLAA 4WOBA 5KQDA 4QDJA 3D8RA 4IGEA 3OG9A 4NNPA 1TTPB 4W5WA 2ZTMA 3UWOA 1KAOA 3U7QA 2HJWA 4HEQA 2WYHA 5LA6F 4TQUS 2ZIWB 1D8AA 2ZJ2A 1XZEA 3TGLA 1EXQA 1BQEA 3PPIA 5LQRA 1DEKA 1HKUA 4HQLA 2KBFA 1BSVA 2UUAB 1S0UA 1J99A 2VAVA 4AJPA 4ZPXA 3CIFA 4QD3A 1U1CA 3EGCA 2H7XA 4CUZA 2O19A 1Q15A 5CA1B 1W48A 2FY8A 3TMYA 1JHRA 1GZVA 4L5YA 2VDQB 4YMWA 2GN4A 2ZS7A 1Y4UA 2Y76A 2WOMA 1TCVA 1C81A 2O7RA 3SBDA 1H66A 3WV4A 3GP5A 3MJFA 2C83A 4B9AA 3ZUPA 4C0WA 4O4LF 2V5UA 4FWIB 2ZM6B 1TL3A 3E3OA 2WZCA 3ZWPA 3K7EA 4ARIA 2JVKA 3DZDA 3O4JA 4G0MA 2GEDA 2OB2A 4C0QC 1DXHA 1JP7A 4EY4A 1BNCA 4C08A 1TQ2A 4B76A 3OYEA 5AUOB 2A5YB 4ECAA 1ZN9A 4MQFA 1MJGA 3FRJA 2VG6A 1YQEA 3G8YA 1UADA 4J4BA 2O7NA 1A8SA 4BYGA 3BXPA 4QUKA 4IEEA 4EMSA 3NPAA 3OCYA 3OZEA 5FQOA 2V96A 4HG2A 3CW8X 5K3FB 2YWXA 5I7WA 2XYPA 3GOIA 1JNXX 2G9QA 3CJRA 1A04A 3HPGA 4E5YA 4WECA 1DOHA 1HE2A 5LZ9A 1XDZA 3C7NA 1A0OA 2QK9A 1X6VA 3RBXA 1K7SN 2KBEA 4ABTA 4DQDA 3R7WB 3SYNA 1GZUA 4GI7A 3OIDA 4PIPA 3PUYA 5A3RA 4QRIA 5HDQA 3KZMA 5FBWB 5BV2P 3ZVRA 4M38A 1IXRC 1TJ4A 2X2FA 3UV7A 3U37A 4N7JA 1NKBA 5B3JA 1RT7A 2C9MA 4F5EA 4PPYA 1T36A 3ZVKA 1ZHOA 1XRPA 4FKZA 4CU5A 3IIMA 1YQGA 5EXWA 2YX1A 3HB0A 3Q2IA 3HCFA 4IG0A 2QWQA 4OGGA 3T19A 5LYJB 3QE9Y 1P6XA 5G53C 3UG6A 2UZAA 4CCAA 2C03A 2VHXA 3C5VA 5AVJA 2Q2RA 6ADHA 2QPLA 1YDEA 4V03A 4XFDA 3CKLA 1Q8IA 3NBAA 2ZRBA 1NT4A 2H7YA 3Q1KA 4FJLA 1CY1A 1VJCA 4B9NA 3OE4A 1OIXA 3WO1A 3V4OA 3H04A 2FQWA 4O2AF 1F12A 2CT8A 2XMPA 2QP9X 1TC1A 4WV3A 5DYIA 5FL3A 2AOWA 3WKDA 2P6NA 3I2GA 3ONNA 3ZT3A 4WJLA 1DAIA 3JQDA 3NI2A 4YGYA 5JYDA 4GP6A 4ISBA 3IKTA 3WHKA 2E1PA 3CE6A 4KQXA 3CCJN 4TVKA 2CGJA 4NV1A 4YAUA 4PZDA 4NZYA 4HZGA 4ZYVA 4BO7A 4QCLA 5K99A 3W6ZA 2W2PA 3LD9A 1NXXA 2RSLA 4XLLA 3LPLA 4QGAA 3OJUA 3DMYA 2BRUA 4QFDA 1A2OA 2GXSA 2OXFA 1IKYA 3QNOA 1DKLA 2EWSA 4F8JA 1AMOA 1VL5A 4UOZA 3ENHA 1V2GA 3ZWOA 3O1IC 5MGBA 5KYUA 1TIPA 2I03A 2W58A 1H6CA 2OPSA 3B78A 2IOYA 4XQ0A 4F9GA 1CLEA 4YBZA 3G25A 5DM7L 2DX7A 3GH1A 4Z7QB 4PINA 4KXYA 1Z4OA 1HJRA 4NCJA 2VI5A 5LQJA 3WDSA 4KNYA 3UZUA 2QWOA 2QWRA 5JNLA 3AHJA 1TL7C 3N8NA 1LNSA 3CZQA 4FR0A 3RM3A 1KI2A 1WKCA 4CWAA 3WNBA 2LCQA 4HNTA 5EMLA 5HFAA 3FYCA 5AVZA 2CFSA 4DV2B 2I2AA 4KLZA 1GV0A 3WXJA 3E5RA 1TE2A 4MKRA 2OHXA 4M83A 4G0QA 4BMSA 4ZCPA 2ZYVX 1SKYB 4FTWA 4RVOA 5THKA 4KGDA 4UC0A 1NJXA 1GXSA 4B6QA 3LPTA 2P1JA 4H1HA 3KZBA 4Y9SA 3JWPA 3EEYA 3BZKA 2VNSA 2QZ9A 2P41A 3ICEA 5JR3A 1D9FA 4Q4HB 3JYPA 4ROSA 3PNPA 3WNEA 1C1CA 1U8XX 1XA0A 4BR2A 2OQ2A 2OZEA 1F14A 5JSKA 1QV9A 1MB2A 1CZAN 4N49A 1GG5A 1EA7A 1JDNA 1KFKB 2VDMB 2VDJA 1YRQA 3BPSA 1CIJA 5HZKA 2QNRA 3TD9A 5EMKA 3QMLA 4BE7B 1KYIA 4JLPA 5EC8A 4IX1A 2N75A 5ALYA 2JI7A 3NDBB 5IP5A 5F73A 1N6KA 1BE6A 5D3QA 5K3FA 2BYTA 4HB4A 3PKIA 3HRKA 2UXBK 1C3XA 1GY8A 4JLMA 3T7CA 4DMCA 1HNIA 2FSUA 3ZE7A 1DEHA 2Q50A 2W2XA 4BAZA 3L6BA 4DEYA 2H1HA 4J3FA 4KIWA 1KYXA 4DSTA 3WLHA 2X0DA 3WGVA 1QIMA 2CE7A 2WF9A 4OU4A 1KAXA 1L3CA 2B4YA 3AIMA 4LJAA 1E8NA 2YVKA 1GAXA 5J4HA 4BC1A 1CY8A 1JKXA 4OGWA 1XC7A 5L51A 5I47A 3LYLA 2G28A 3FNFA 4NU8X 1SUIA 4L5BA 2DTXA 4JAVC 3KAJA 1GAEO 2M6RA 2VJLA 4BUZA 4QJBA 3DD1A 3H6GA 3FOAA 4E94A 1EBUA 4WKOA 3A1DA 4JOBA 5G41A 5C4MA 5LYJA 2QMYA 5FQNA 2OLKA 1E9VA 1GR0A 5FUYA 4QOHA 5CP8A 1DBWA 3AAQA 1QG0A 3MA0A 4KX5A 4GVLA 3DV2A 1PVOA 4EIAA 1M8JA 5J43A 3WYAA 5G0UA 3LT0A 5GIPE 2OO5A 4N7RA 4OREX 4KHWA 5BW5A 3AKYA 3WYGA 2D1QA 5BSTA 5CVCA 3SAJA 4AP6A 2GD1O 5CVTA 4YXWD 2VJBA 1Q7RA 2PS3A 1FP1D 2DPYA 4N9QA 5IKEA 3H3JA 2H57A 3ODPA 5KRSA 1BE0A 4DMMA 4C06A 1S8FA 3PRHA 4ZGWA 2BUPA 1T03A 5ILGA 4MWSA 2Q2VA 3VA7A 2MR6A 5L9AA 4GLLA 1T4CA 5TV2A 2YY7A 4TROA 4H7KA 2ZYGA 3PSAA 3VR0A 4JUAA 3VX3A 2P2NA 1WSFA 4UBJA 1Z6ZA 4UOQA 1AGYA 3IURA 3EGIA 3ETGA 3CXUA 3EOZA 1SOAA 5LZ2A 1YC2A 3ETHA 2A0YA 1KLNA 3D8HA 3I04A 3ZSRA 4OSEA 2HCBA 1OV4A 1C7FA 2C00A 1C3OB 3A4MA 4KTVE 2RKOA 1PYOA 2ORYA 1L8LA 1LNQA 5DBGA 4LHZA 1E1DA 2GASA 3MWEB 2A5JA 4WZAA 4JVMA 4AJNA 3VENA 4BR4A 1CZUA 3Q72A 2G4LA 1V6SA 5ITWA 4AKHA 1HGXA 1NULA 2OANA 4OAPA 2YFKA 1N2IA 4PYQA 4AJKA 2GCIA 3BGIA 4YXWA 3UT6A 3A26A 1XK6A 3IP6A 3D2EB 3V8MA 3G1TA 4U5XA 2AN9A 4BGUA 4RPCA 3BD9A 3WMWA 2PYJA 1PL0A 1Z33A 3H9UA 5H70A 3TG2A 3VH3A 1M7GA 4CFSA 4JYBA 1YBHA 1LW7A 5HRUA 3LDGA 1OH7A 1GKUB 3LCJA 5GWXA 3QE3A 5AM2A 4OJNA 3ZK7A 2IELA 2D2VA 3ZN2A 1J9ZA 4O25A 1VI2A 3ISNC 3AF2A 5ADHA 4Q4HA 5D51S 1JQ5A 2YHIB 1FE8A 2X8JB 4MRPA 2WYIA 2UZ0A 3IV6A 2D1FA 1KI9A 3ONFA 2RHJA 4D7AA 1H2EA 2YYYA 4LFCB 3QHQA 4V02A 4TKUB 4CJ5A 1N7HA 2H1OA 2XZOA 3HJFA 5KWJA 5A0VA 2DU8A 1E5QA 3L0OA 4KN6A 3I55N 2Z8ZA 3WT0A 2ZDHA 4C03A 5LOVF 1HNZK 3KQMA 5AH0A 3JAKB 2IS1A 1YHZA 2G70A 3DXMB 4LSMA 3DVLA 4Z3OA 2F43B 1IDN1 3NHZA 3CO0S 3QEOA 4TRMA 2C5BA 2VBIA 3TZBA 3P97A 3PV0A 5CA0B 2AKEA 4JAXA 3H6HA 4FFVA 1GPUA 4QKQA 3I2YX 3FCAA 1SKBA 3VQ6A 1OCEA 3T0GA 3RS4A 1IUPA 1A77A 3PHJA 1NHWA 1Z2NX 3GLHA 2IU4A 4HDMB 2JFZA 3BTSA 4KWIA 1FJGK 4DM7A 4ZEMA 4N6OA 4E7OA 4QU8A 2J5QA 1F8GA 2E89A 3QKRB 4JA0A 3PFWO 1YI8A 3SPXA 3P9RA 3LU1A 5K4AA 5JPCA 2FEPA 2YWBA 3L49A 4E07A 1FLDA 4YK7A 3T12A 3R7AA 4C2AA 1R5JA 4DSAA 1E79D 2DY1A 4BMZA 3WQQA 5EE1A 1E1CB 4IG3A 2XGJA 1YA4A 2NNLD 5AHXA 3UVEA 3EZLA 4QJ3A 3ZYZA 2ODEA 1CNMA 4CEOA 4RCZA 5JFTA 4DE5A 1IUNA 3EUEA 4KXNA 1C29B 3HSCA 2FUG6 4QG7A 4CZKA 4R1MA 1YL5A 2NRHA 4PNHA 1SUWA 2ETVA 1GFIA 3ZXSA 4QYMA 3KPWA 3B5IA 4H16A 1E0DA 1E96A 3MBOA 4RJJA 4LY3A 1E3MA 4CG1A 4NS4A 2QR2A 4KH6A 1G8HA 4YFYA 2AB0A 3DJCA 3NONA 3O1HB 2Y1LA 5CLGA 4ISGA 3M49A 2PMCA 3OPMA 3IQWA 2CYCA 3R41A 3T3NA 2GJKA 1NMSA 2MSWA 4QXOA 4LNUA 1EXMA 5CIYA 2AHRA 1S7CA 4EZ6A 1JEYB 5HIJA 2WVJA 1P2TA 3K35A 3QENA 2G6TA 2PFGA 1REVA 1PX2A 5BVGB 4QX6A 3IEPA 1ZVVA 4QWWA 3AVTA 1GUYA 3LECA 4NS1A 4B43A 2CFOA 1DIBA 1LSOA 3ZXYA 1AUPA 2M1ZA 2J3IA 1E79A 2XWJI 4HNSA 1BFUA 1GYRA 5J4YA 4OQFA 1AKWA 1GU1A 3HP4A 1GA6A 3C6UA 3A1UA 2HNYA 3AVUA 2Q3FA 4F86A 3A14A 1ISJA 4O2BB 5CFLA 3PFHA 3KK2A 3KUXA 4TYYA 1C0GA 1NKVA 1P4JA 2VTVA 1C3OA 4CGJA 4IUYA 3JZDA 3J80A 4OKJA 1PFUA 2K2WA 2IEZA 1FU7A 4D3FA 4QUGA 4CGHA 1T4BA 1U7TA 4BXOA 3FWNA 3MWEA 5IKMA 3BCRA 1Q20A 2ZBUA 1EE9A 3CNNA 4C05A 2QT1A 4DR2B 3O8RA 3UPTA 3VOTA 2FMTA 4K8OA 2G0NA 3M1FA 3T1YK 3E9OA 2AHOA 4MKGA 4HQ6A 2OO3A 1M5UA 2G1UA 3OJEA 2W2LD 4FFSA 4EYEA 1D8TA 3D2EA 1H0SA 1YDHA 1CRWG 1KWKA 2RDMA 2R8EA 4GX0A 1UKEA 1CUJA 3N8GA 2JCGA 1RFLA 1MOPA 2ONJA 4WL0A 4RO0A 3TANA 2QW9A 3ETCA 1EPUA 3U4AA 2AG6A 3TLEA 5TPZD 4K3VA 3REOA 1NM5C 5JZ9A 5EHXA 1XAHA 1KSGA 3CCSN 2DFVA 5TNXA 3QXJA 5FROA 3EA4A 2YRWA 2G06A 3IFSA 4OP1A 4QICA 4JZYA 1UODA 1HDEA 3T99A 2D0OB 4KTQA 4F9EA 3QELB 2VWGA 3A0UA 2HF7A 5EQJB 4TTAA 1YAJA 3DKRA 2E2NA 4FEAA 4QQ8A 1DZ3A 3QFPA 2YHIA 2X8JA 5ARDA 1KOFA 1P7VA 2Q0HA 1MU2A 2WBLC 3UMGA 1RYEA 2QG6A 5AM5A 3A6PC 3GJ3A 4G5SA 4CZ2A 5LWQA 1TZMA 4AMGA 5BUCA 1QONA 4GW6A 4CXMA 3IPRA 1GLFO 4L8VA 2FUNB 5IUKC 5KYTA 3LDFA 3OOSA 4DR1B 1H4SA 2HLPA 2ZJRL 1UPUA 4CEHB 1W34A 1WDMA 5JH7F 3DLCA 4AAYA 2HSWA 2W2LA 3RPEA 1Q57A 1HYEA 1XLUA 4PZLA 1AM4D 3JAKA 1JR3E 2ZRPA 3DXMA 2IYYA 4L3WA 3JRWA 1U28A 3W9UA 3H1AA 3OYLA 1ZGZA 3KTQA 2F43A 4MDAA 2BFBB 1KKUA 2O7SA 5LQUA 1SZ2A 5KSYA 1CJBA 5TPZA 3PC7A 2P9PA 3LDPA 4Y9DA 5DK5A 1YZKA 1VG1A 3L9XA 5L4SA 4B1ZA 2H85A 1VSJA 3MFQA 2G8NA 1JBEA 4HDMA 4ZOEA 5TS3A 2QLBA 5CX4A 2JZOA 1W35A 2GEJA 2HFJA 2IHNA 3OYGA 3VPAA 4YMSA 4QDXA 1KSPA 3EVDA 2PD4A 4LC0A 1XLTC 3ZX3A 2I6SA 3H2SA 4C0HA 1Z0FA 4M99A 4UQLA 2LE0A 2ZGZA 4CZLA 3ACDA 1ZVMA 2Q0QA 4KREA 1U49A 2KE5A 1K66A 1EZ1A 1TTHA 3EVGA 1KQSM 2WR8A 2JH3A 1FEZA 3HKBB 2O2ZA 3A8TA 1E64A 1E3IA 1U0FA 4J94A 1YI1A 2XTJA 3GG2A 4PVDA 1ZLXA 1QQBA 2OZKA 1UPAA 3CF4A 4NYJQ 1JFFA 3HU2A 4DIFA 2JIMA 1S2MA 4C6HA 2XYVA 3ZLJA 3WGQA 3IBCA 4IFIA 4KXQA 3I01A 3AK4A 4XYEA 2FXUA 5EXPA 5JVDB 2GAIA 4MAFA 1JEYA 5TX7A 3DEHA 3WMGA 1OU0A 4IWNA 5AICA 2OM2A 5BVGA 3QNNA 4P4UA 1OXTA 4TQAA 3VQQA 4BNYA 2JHCA 1QHIA 2XE8A 4V24A 2MSNA 3LHIA 3L8FA 2FEKA 1K2WA 2A1IA 4HAVA 3S2IA 3B1ZA 4MR9B 3ZJUA 5L3SB 3LP2A 4FPAA 3TZ6A 1BMFD 4MO5A 3NFRA 2GPTA 3QVOA 3ONDA 4CN9A 2ODPA 2VWQA 2VWKA 3L7OA 4HF7A 2RGXA 2Y1IA 2Q4BA 4ZHQB 3OQJA 4JL6A 3L7BA 4GQAA 4BVBA 4E21A 1ESMA 5DBEX 1UA1A 2Q5QA 5MHTA 2G77B 2FWAA 2R8OA 2MSLA 1KC3A 4R5HA 3FFAA 1VCIA 1KHTA 3ZS9A 2XE7A 1XAIA 1K73O 2EW2A 1CUGA 4DBVO 1SXQA 2OAEA 1GUZA 1TX4B 5IHPA 1FRVA 1B3BA 2REQB 3T9AA 1DKQA 1ZRHA 3RRJA 4W4TA 4LYYA 3NOOA 1HX7A 4P54A 3RTEA 5C8DA 4C1BA 4NBSA 1OLSB 3E82A 4HN9A 1G7SA 3B1YA 5A2QO 4QNRA 3UH0A 2GEBA 4OXQA 1VSUA 3QMWA 2QQEA 4CKBB 1KI1A 2GVZC 2D0OA 1BMFA 3QELA 1GQQA 1AHIA 2OPQA 1NRXA 1RAEA 3NJ8A 1GZ7A 2E1ZA 1W19A 5CLIA 1ACLA 1E61A 5CH5A 1XDDA 1CY6A 3HCPA 4MWGA 3B85A 2I7PA 2LVBA 1VLVA 5CJJA 5FA5A 3DL7A 3O5BA 3AP3A 4RF2A 3M3DA 3LPNA 4W82A 4OQLA 2D2FA 1XROA 5EU7A 4O4HF 4CEHA 4ZVMA 5FNVB 3TRHA 2ZRCA 4HAWA 1LSUA 2CXRA 2IDJA 3F9RA 2PKXA 3NPMA 1J4AA 3T15A 3G82C 1F8YA 2D4HA 2ODQA 5EJ5A 5BWCA 4HLCA 2BFBA 4D9HA 2J9RA 4ZQGA 4XX0A 2C7PA 3D2FB 4ACAA 4L4ZA 2G8HA 5B1EA 2IYTA 4K46A 3V2IA 4ABYA 2GX9A 3ESYA 1H2FA 1I94B 3BE6A 1NKTA 1TOAA 2OC4A 1GD1O 3G2NA 1SIWA 4JQZA 1MAVA 1I33A 3IPXA 2VAPA 1W25A 4JBGA 4MWEA 3ZDXB 1U6IA 3EWAA 3WOVA 4WCVA 3AM4A 4R9UC 1XX6A 2ZANA 1ISGA 2V0NA 1TLLA 4X0EA 5LYYA 4CV0A 1V71A 2YBEA 1OWLA 1CVRA 4RKWA 4A0SA 3INRA 5TQ0A 5IKXA 1V26A 4PYOA 2Y2UA 4S1WA 2DGDA 3GUUA 3FCEA 3HLTA 2PX0A 4TV9A 2OHFA 3T5BA 2Z8XA 1C7QA 3HCEA 2W98A 1UBEA 3HKBA 1TUUA 1KZGB 4B3TB 1FB5A 2P9IB 4N8DA 2X4IA 3B9BA 4CGFA 2DTUA 5BMVB 4UE3S 2AA4A 2JI9A 3EJWA 2ZR7A 4C4XA 3H83A 3MTDA 2VK8A 3NKLA 1FKPA 3CJBA 4KR6A 2ITMA 2ZI5A 3NNSA 3AILA 1MJNA 2G67A 1JDSA 1S01A 2J4DA 1AA9A 4B33A 5JVDA 2EW8A 1WXEA 1U9IC 2JLSA 1OFUA 1HDRA 4C76A 4CMHA 5DYWA 4F7WA 3SXJA 1ZVQA 5CLFA 2BTEA 4F38A 5FLXO 4YASA 2JAUA 2XUGA 3AY7A 3CVJA 1SKQA 3T7SA 5GTDA 1GTJ1 4DM3A 4P82A 3WP0A 3WLNA 4MR9A 5L3SA 3FYUA 1VKHA 4X7BA 2QRHA 4EHLA 3DMTC 1RT9A 1KFEB 3O75A 4RCVA 2FFJA 1ZH8A 1HZZA 1D6NA 1XVLA 3E2PA 4LDNA 3BWYA 3RMBA 1R6XA 3K72B 5IJ0B 4M9UA 1TMOA 1H9BA 2VHZA 1USKA 3OS1A 3QUCA 1Z83A 4HVTA 2O48X 1FDRA 3Q6MA 2CJFA 2XLBA 4TL6A 2FZCA 2YY5A 4OMUA 3H2IA 1PW7A 2REQA 2WPNA 1U4NA 2B83A 5BR4A 5B58T 2PSSA 4DYHA 1XNRK 5JLFA 1TFUA 3OEHD 4XH5A 2R6HA 3OCXA 4B74A 4WVFA 3D2AA 3ID8A 3I5MA 3CRW1 1BS1A 2GHRA 1T8UA 2GEKA 1CQWA 5J2MA 1KIMA 1I01A 4Y2UA 4NJEA 2ZROA 4NFLA 3PWZA 2PV0A 3BE5A 3HKDA 1K68A 2W40A 2NO5A 1R59O 3K2BA 2YQZA 3RU3A 1Z73A 1LK0A 3PUJA 3ET4A 2RB4A 1JIXA 3QBVA 1NURA 2V4MA 5BRJA 2WOJA 2XIJA 2I4TA 2WE8A 4O02B 3RLIA 1O8CA 3LANA 4I9NA 4CTKA 3WXKA 4LMRA 2Q5HA 2J09A 2R7AA 1WN7A 1QRAA 1FU4A 1E2IA 3HJBA 1DTTA 3W3ZB 4I7EA 4AZ0B 4K26A 5FNVA 2H06A 1R6AA 3OU7A 2DBZA 4ZALA 3CQXA 3CZ4A 1E6EA 2R2GA 1PWZA 4DTPA 2ZD1A 1I10A 2DFHA 3VTKA 3O2SB 1YWGO 4O4JF 1KFCB 3KFLA 1QPBA 4DA4A 2AQKA 3QVSA 4JYAB 1G2QA 3MQ4A 3OEHA 2Y68A 2XUZA 3NHWA 4BVAA 1CLQA 1I8TA 3G9UA 1OI7A 4OGCA 3D2FA 4XM1A 2O2IA 5BN4B 5SY4A 3QIOA 3D0PA 1PYGA 4DMGA 4QA9A 3G5LA 1CXQA 3PUHA 4MYCA 3M4YA 2V6IA 1RQGA 3IJPA 4FBLA 2TS1A 3R0JA 1J1ZA 2GKSA 1BI4B 2ZAOA 3OYDA 4ZAYA 2CBZA 5A5GA 1Z0DA 2KFZA 2I3BA 3SQ0A 4ZZ2A 3FE1A 2BH1A 2FPIB 2O2DA 3CNQS 2V54A 2IOQA 4J43A 2GPBA 1JR2A 5EMMA