2BGGA

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt sirna duplex.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMEGTKVKLSSKRYLLTLLQPYVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna-binding protein/rna
molecule keywords PROTEIN AF1318
publication title Structural Insights Into Mrna Recognition from a Piwi Domain-Sirna Guide Complex
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 134
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2bggA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bggA01
5J2MA 5EWMB 1DC8A 4D6XA 3RRHA 3DLGA 1CXUA 2ZWMA 3DRRA 4JAVC 2YHAA 4DQDA 4ICLA 2L17A 1IKVA 3KS9A 3IP9A 3OJSA 5IX8A 4J2DA 2B5JA 1BCOA 3JPYA 3HT3A 4DFKA 3IS9A 2JBAB 2PYJA 3AVMA 3M8QA 4RG8A 4CCHA 4CF0A 4L8RB 4CJ3A 3GA5A 1Z2EA 3AVNA 5KQGA 1MB3A 3MIZA 2GBPA 3T8YA 1N5YA 1IG9A 4M42A 2OPRA 4PE5B 1GLGA 1R0AA 3AA5X 1EETA 1QNLA 1DCKA 4L4UA 1OXKB 1PEYA 3DLEA 3C6UA 4N76A 3QEMA 4DTPA 3E3MA 2VG5A 4AILC 5KWSA 4G97A 2FC0A 2R25B 2MYNA 4GMJB 2G8WA 3RMDA 4KTZA 2XY6A 3H5TA 2Q3SA 1DBQA 6CHYA 1R8JA 4DF8A 1RCHA 1LK0A 4N5SA 3NAEA 4FJGA 3EGCA 3MXJA 1ZH4A 4FB4A 3KK1A 2XY7A 4CEAA 3UUGA 2DY4A 3GYBA 1FKPA 5TPWA 4HUGA 2ATQA 3QELB 1K6YA 1QQCA 4E19A 2F8TA 1MAVA 4FJMA 4GPAA 4CGDA 4MR9A 4RWEA 4MPTA 4CGIA 4CHPA 3DGEC 4B9VA 3RMCA 4DF4A 3EODA 4DTJA 1T8EA 3VQBA 1SXIA 3OVNA 4E3SA 4EYQA 3M6MD 4MS3B 3MEGA 4RY9A 3W9SA 2RJNA 4RSMA 4MGEA 3AVCA 4CGHA 4RZSA 4YNQA 2KQ2A 2J48A 3AVFA 1N6QA 4LY7A 4RY0A 4DMNA 3DLKA 4YLEA 4JLHA 1C1AA 1YTAA 5CNIA 2Q5CA 4K8XA 3ZT1A 1P8AA 2V0NA 3EY1A 4N47A 2VWJA 1BL3A 3KTOA 3ZSQA 4W5QA 3U6FA 5HQJA 5KGWA 5ABPA 4Z4GA 1LW2A 2EHGA 1VPWA 2FMFA 1FFSA 4QYMA 4KTWA 2HHXA 4HNQA 3VQ4A 1KLMA 1Z13A 3M8SA 2P5GA 1EX4A 5B3JC 4FZYA 2LPMA 2HNYA 3F6PA 1LW0A 1Z26A 1OXBB 3T1AA 3OYDA 4RK6A 2HVHA 2F96A 1NOZA 1KCFA 2E4UA 1X9WA 3LFTA 3HSYA 3QX8A 1FK9A 3JTEA 4LE0A 1RBTA 2QU7A 4ID1A 3ZT3A 4DSFA 2HHUA 5T7BA 2JCGA 5BR1A 1GUBA 4M3RA 3VQEA 3IPCA 4MLCA 1ZHHA 2IKSA 3TANA 1U47A 5JNVA 4O4GA 1X9MA 5GOTA 3LP1A 5EWLA 2KZMA 3SG0A 3OQMA 3Q41A 3OYKA 3K9CA 5HRNA 3KG2A 3OS2A 4W5RA 2L18A 8ABPA 2VYCA 4YR7A 4MS4A 1WAJA 4ZJPA 1DLOA 4G1QA 4M41A 1QO0D 2GX6A 2OYQA 2ID9A 3OLZA 5J2NA 1TK5A 3T19A 1KVCA 4O1IA 1VKRA 3CHYA 1BDHA 3EZ5A 3CFPA 3S3NA 2WJWA 1KVAA 4F11A 3RVOA 1A5VA 4OGEA 5JNRA 4IMJB 3L6UA 3O3GA 4RW6A 1JLAA 3KKRA 4QOZB 3ZSWA 3K59A 4H4OA 4JRPA 3HZHA 2YNFA 2PY5A 4MQEB 2PZSA 3KLEA 3EDCA 1BVHA 4H3KB 1QE1A 3O1HB 4Z0NA 3MAQA 4E7PA 4CIGA 1RBVA 4H3HB 2ZQBA 3K5OA 3V1QA 1NK5A 2G8UA 3GRCA 4F3TA 2WJAA 4F12A 4MFBA 5D3GA 1JLEA 3QNOA 4KREA 3DZDA 4MR7B 4F8JA 1RT3A 4B9NA 3U3YA 3D0PA 4BACA 3DOKA 1VSMA 2YNGA 3MXIA 2MSWA 1XHFA 1JXEA 1X1PA 1BDJA 3N6VA 1Z12A 4KFCA 4EP5A 2NUBA 1Q8IA 3KYIB 1BIUA 5BRJA 5C42A 4CGFA 1B00A 1S6PA 4DFPA 3QETA 3KTQA 2LP4Y 5E41A 4RK5A 3OQNA 3JSMA 4FM0A 4EUKA 1Z2DA 5DMRA 5TQ0A 1RTJA 1KRXA 1M2EA 1TKDA 3Q15C 2KW4A 4HUFA 4AH9A 4KAZA 3ZCMA 4Z4FA 3KD1E 2PUEA 1QO0A 3H5VA 3KLNA 3NF8A 2FQWA 3Q7RA 1NTRA 3DLHA 1BA2A 3QESA 5CNJA 3LP3A 1ZBUA 4DFMA 3JPWA 2A9RA 3TB6A 3QLVA 4YV7A 1BIZA 3S9HA 4EY3A 1NXTA 2FN8A 2JK1A 5DGCA 4FJLA 1ABEA 1KFSA 3KLHA 3PO5A 3C6QA 4CEBA 1L5UA 3MXMA 1Q9XA 1IO2A 1LBIA 1USGA 5HM6A 1JF8A 3OMWA 2VG6A 3OYMA 1W9HA 1UAXA 3LWLA 3KIOA 4G86A 3CQ8A 1H9CA 5DLEA 1CZ9A 4RK1A 4Z4EA 1GUDA 4JASB 4MQ3A 3CNBA 4M3UA 1VRTA 4MS1A 5CY4A 2HW3A 3SZ2A 1HYVA 4ZTJA 2KYRA 1S1XA 3NNDA 2FMIA 1RXIA 3KK2A 3U3GA 2FKAA 4AHCA 4LSLA 3VNBA 2PKXA 1CYEA 1VSHA 1RDCA 3PV8A 4EVQA 1YTUA 1KMIY 2JBAA 4QYWA 3TX6A 3M9XA 4HCCA 3RVPA 3GL9A 1P2FA 4E89A 9ABPA 4OLBA 2FBVA 4H4MA 1JFTA 4DTSA 5JNSA 1Q9YA 2GV9A 1NJWA 5C24A 5E3JA 3LWMA 1LWEA 3VQDA 3SQ0A 3O2SB 3KKSA 4G0YA 4EGSA 2E6LA 1QSYA 1M2FA 3VQ7A 2BE2A 1TMYA 4KNYA 3WNHA 3ILYA 5KC9A 2P5OA 2VWKA 5DK5A 2FBYA 3HDGA 3WNGA 3JVDA 3ASMA 3SYZA 3ALYA 2XHBA 1TK8A 3OYJA 4IBNA 3HPGA 1HPZA 4N56A 3MQ4A 1C1CA 2NT3A 4P1ZA 3H1GA 1RNHA 4RV5A 1SV5A 2MSKA 3NGZA 2IPNA 3OYAA 5FDLA 1I39A 3AA3A 2WONA 1GCAA 1Z17A 2JVJA 1NY5A 3QELA 4RK7A 2RN2A 1LBHA 3QINA 3C3KA 1KLNA 1NXOA 1ASUA 1JYFA 4FJ5A 3T6KA 1B9FA 4W5TA 3RVKA 3OYCA 4FLWA 4WT7A 3CFRA 4CESA 3AO2A 2Z1GA 4B9UA 5CNKA 3DYAA 3SY8A 5DCLA 2E4YA 4M45A 1BI4A 4F06A 1B92A 3LUKA 1NXSA 2FBTA 1FFWA 1PUXA 2WRZA 4G0MA 5KQPA 3PX6A 3ZSOA 2FQYA 4JP1A 3SQ4A 4IG3A 4MS3A 4MRMB 3DRSA 3FDFA 5IUKC 3HEBA 1WLJA 3JVIA 3HM9A 3HL8A 1Y97A 4M3WA 3VA0A 4IRXA 4EVRA 4AHSA 1USKA 2FMKA 1T34A 3CFYA 3AA4A 3KCNA 4FVMA 4JS5A 5FWYB 1VSKA 4EP4A 1VRVA 2QR3A 1IKWA 5HKOA 3MECA 4B8AB 1DJMA 2L2QA 3JY6A 1DBWA 4QPJC 2YKMA 4CEFA 2RGYA 5I3UA 4YS6A 4EZ9A 3RVNA 1YS7A 1LWFA 4RKRA 3TAMA 3QEPA 3ZSRA 4CHNA 1SXGA 4CJLA 1ASVA 4OLAA 3D8UA 3IP7A 2HNZA 4FM2A 2PUFA 2Y1IA 3RMAA 1KSPA 4GNRA 2B6AA 3N0WA 2L19A 4D6YA 3RMBA 3CTPA 1S5JA 5BRAA 3HUUA 4M3TA 3VN5A 2R4QA 4KFBA 3SJJA 3OS1A 1HNIA 1ASWA 3AVAA 3I0RA 3QLUA 1VLZA 4WUTA 2OPQA 4LD0A 3RVRA 2DTUA 4PUOA 5F64A 4LSNA 2KZZA 4E0DA 2E4VA 3SM9A 2I5JA 2AYXA 1L3UA 3FFWA 1NKCA 4KHSA 4Z4IA 4KTQA 3QK7A 2A1SA 3CYMA 3NF9A 3BBLA 5TQ2A 4TSXA 4WWHA 1TKZA 3RQIA 3A2FA 4E1MA 3RVMA 4E7KA 1TM2A 4B8CA 1C4WA 2YHBA 1SXHA 3OLVA 4IFYA 4Z0UA 1IIBA 1HQEA 1WETA 1C6VA 4MQFA 2IGIA 1S9EA 2XRIA 3DGFC 2OPSA 1WSHA 3LAMA 4FJJA 1EHCA 4KV7A 5ED4A 1O1WA 4KO0A 4BWMA 4KQCA 4RXMA 1MVOA 5IULC 2PAFA 1I3CA 1S6QA 1D2AA 2FTKE 3C3MA 1VSJA 3HCWA 4WZZA 3O74A 1D5WA 1Z25A 1IKXA 4FJHA 3OM0A 1EWVA 3V9UA 4YP9A 3KK3A 3Q7SA 2QVGA 4FK4A 4F2SA 4Z9BA 1CXQA 3VQPA 4G0PA 2HVIA 3O4QA 2B1JA 2X6NA 2PUDA 4FM1A 4MR8B 1QHTA 4CFCA 5IBQA 3OYEA 1RILA 2FVYA 2PLNA 4FJNA 4IDKA 3H6HA 1ZBLA 4HYEA 1QQAA 1SL1A 4RXTA 1HNVA 2JRLA 3OLYA 4KHYA 4IILA 4FW2A 4C8MA 4ZPJA 1QTMA 4C8KA 5SZTA 2LBPA 4W5OA 3VQQA 1TGOA 1NK6A 4LE1A 3DOLA 4NCGA 3LKVA 1YMUA 3CU5A 4M88A 1C0EA 2D0BA 1BCMA 3WNEA 2G8IA 1TAQA 2IS3A 3NCIA 4DQQA 1WSIA 2LSNA 4DU1A 2NZUG 3GV0A 1FXXA 3IP6A 3A0UA 4KK4A 3RVSA 3EJWA 1ZBHA 1XC9A 1BDIA 2E6MA 4DTRA 1JH9A 3VA3A 3GBVA 3IAYA 2VUIB 2RJOA 4YGXB 2GI4A 4XAQA 4O5BA 1QPZA 1KTQA 3JS5A 2B4AA 4FW1A 4FJIA 3VNAA 1RDAA 3SUPA 2IYNA 1CHNA 1DG9A 5GQSA 4IG0A 1NKBA 1MU2A 2FLKA 1VSDA 4RKQA 1VSEA 3K57A 3OS0A 1BAPA 4CJ5A 2QXYA 3KHTA 1RDDA 3AV9A 3OO1A 2R48A 3R0JA 2IPLA 4E7OA 3N8IA 2E4WA 5PNTA 1RT2A 1RXEA 4LE2A 1GOCA 1F51E 3CRNA 3KKEA 4S04A 4B08A 2NT4A 1ZAYA 4CJUA 4D74A 3OM1A 1WSGA 1RT7A 3LALA 1ZGGA 3NE6A 2BDPA 4CJTA 2YNHA 4P98A 5JS2A 3NFAA 4B9LA 3O1IC 3LAKA 4PEVA 1BQMA 3HXMA 1EWKA 2FQXA 1SRRA 3URMA 3V4IA 3K5MA 3VQAA 3FMVA 1A0OA 4CGGA 4ETNA 2QKKA 1LJLA 2GUIA 1PNRA 1QSLA 1ITGA 4DQIA 4CEEA 4F4KA 1EFAA 5D2CA 2DFEA 3EQZA 5JNUA 3THVA 4GVMA 1Z18A 5KTQA 2IPMA 1APBA 4HHTA 1NOYA 4AHVA 2ITGA 1ZY2A 4CJRA 4JB2A 4QAGA 2G8KA 3AVGA 3NGIA 2RPIA 3PY8A 4KPYA 3OMXA 3LUAA 4HTUA 1RBSA 3KLIA 4KV8A 3O75A 3HPHA 3TAPA 3CG0A 3BDPA 3SPYA 2CD7A 1D1PA 2HHQA 3TAFA 4DTXA 5KQMA 5TPWB 4PQUA 2IC3A 4DSKA 1Z15A 1NK9A 4FZZA 3ROFA 2HMIA 3LDSA 2OA8A 1D4ZA 1Z16A 4MR9B 1ZESA 4FK0A 4RU1A 1RT6A 4GW6A 4B9MA 1U48A 1JL3A 2P51A 4K8ZA 3LUJA 3N75A 3VQ9A 1MIHA 4IFVA 3M8PA 4TLLB 1JWLA 4KRFA 4FYDA 2IOCA 1QSSA 4WXMA 3EYZA 4IF4A 3PO4A 5EWJB 2D0AA 1KVBA 3BILA 4XXHA 1KGSA 1RBUA 1CZBA 2WY2D 1T7PA 4ZYLA 1URPA 2FXIA 2D5RA 3HSTB 3QLTA 4DN6A 2X74A 3MMNA 3K5LA 1D1QA 3A3KA 1TJYA 3H6GA 4BDYA 2D0CA 5CHYA 4CK1A 4CJVA 2FLWA 4OGCA 2OZMA 1UA1A 2PUCA 4DTNA 3EULA 3LPUA 4PYRA 3CM5A 3SNKA 3PUFA 5KI6A 5FBHA 3RVQA 2FBXA 2MYTA 1W25A 4CFDA 1D8YA 3PX4A 3OYFA 3H1FA 3O3FA 3DRPA 3VQCA 1UA0A 1RPJA 4CEZA 1GCGA 1DRKA 4KZKA 3GBPA 1JXBA 4B3OA 5IUJC 2DFHA 1IH7A 4DU3A 5EWMA 4BDZA 4JB0A 3T95A 2IAJA 1NK0A 4CJSA 2CWDA 3TMYA 1NK8A 1HYSA 1I3AA 2IPAB 3V9SA 3S99A 1DTTA 1HMVA 2RDMA 3LZIA 3GT7A 5EWLB 3OJUA 1A2OA 1L3VA 4RW8A 2LUOA 4DLGA 4TLMB 1XHEA 7ABPA 3OO0A 3FFIA 2PE5A 2MSLA 4MS4B 5J2PA 3RVJA 2W42A 4CBVA 3L2RA 4RDCA 5J2QA 1TL3A 3O2QB 2AJQA 4YRZA 3SV4A 4FE7A 4DSEA 3BREA 1ZITA 3HK2A 1FQWA 3QNNA 4XASA 2HB5A 4RW7A 4ZTFA 1S8NA 1HJRA 5HLFA 3KYJB 4DTUA 3E61A 1S9GA 1YT3A 3F73A 3AVHA 4PY5A 3ZSXA 1RZRD 4BE2A 2R47A 4F8RA 3SNNA 3TD9A 2OPPA 1JLFA 1DC7A 3D02A 4LDAA 1J56A 2E4LA 2QK9A 5JS1A 1JL1A 3C3WA 4LRQA 1K66A 4EZ6A 4ETIA 3CZ5A 3HP9A 5KRTA 4KVFA 4OKJA 3QLHA 3UIQA 1JFVA 3LP0A 3SUOA 1SL2A 4J2EA 1PEAA 5TE9A 1EKEA 3Q9SA 3OQOA 1L3TA 2PYLA 3IPAA 1T05A 3P1GA 4RK0A 2MYUA 4HNSA 2QV0A 2YNIA 1USIA 3KLOA 3ZSVA 1XWWA 2FEPA 4JOQA 4AHTA 3QERA 5C5CA 3ILHA 4H60A 1KFDA 3V6DA 3SUQA 5FWXB 3H5OA 4CERA 5C5EA 5HP1A 3FFTA 3AVJA 3TI0A 3NF7A 4JS4A 2ID7A 3LOPA 4J2AA 1XI1A 1RTDA 5B3JA 1YMVA 4I9LA 4C8LA 1TL1A 3ZSYA 4CJKA 4JA2A 1NXWA 2JVKA 4QCLA 3LUGA 3OYNA 4FLZA 1KRPA 2BGGA 1ISRA 4OPJA 4DQSA 2QVCA 4NYNA 4L85A 3AO1A 1DP4A 2P9HA 3N0RA 3HJFA 1YVUA 3O2JA 1Y1LA 1TVMA 5KQLA 1RZRA 1GOAA 1JDPA 4KB1A 2DFFA 3LUCA 4MYRA 3G0ZA 4RK4A 4CF2A 3I5AA 3TWHA 4I9QA 2HQRA 4FLTA 4KHUA 1BGXT 3NGYA 1TLFA 2JVIA 4Y1CA 2I6FA 1NJXA 3QEVA 5HRSA 2WWVD 2CHFA 3LUDA 3TAQA 3UKJA 2DRIA 4FZXC 2WB4A 4M3YA 4E7LA 1JDNA 2GBZA 1BHLA 4CECA 2BANA 2EX3A 3LUFA 4MS1B 5T3YA 1ZN2A 2HNDA 1HQUA 4OKEA 5FRNA 4I7FA 4IMIB 3HUTA 3AO4A 1SKRA 3NH2A 4ELVA 3QLVC 4CJ4A 2PMCA 2QSJA 1NATA 3I09A 1ZBFA 3AVLA 2G8VA 4PWDA 3M8RA 3V9ZA 3I8DA 4OPKA 4Z9AA 3KJXA 2A1RA 1YK1A 5I42A 3L49A 1LAWA 1UWBA 3QIPA 1U8TA 3IP5A 3V9XA 4B09A 1YK0A 1J53A 1EP4A 4CJQA 1QQBA 4DFJA 1HYZA 3SQ2A 2JLEA 2OENG 3QEKA 2XY8A 3CG4A 2A9QA 2LIVA 5FRMA 4DWIA 3CS3A 1E6LA 4N41A 2HQOA 2YV0X 5BQ3A 1TKTA 3BRSA 3HP6A 3C94A 2FW0A 1WSFA 1D9DA 1K68A 1C0UA 3RRGA 3RH0A 1JFSA 3NH0A 3F9KA 1DRJA 1XHZA 4O44A 1F4VA 1ZH2A 4YO7A 5TQJA 4NYFA 1SD5A 4E7HA 5I4CA 4MQEA 4G0XA 4CEDA 3NHMA 4C8OA 4Q5VA 3OYLA 5HBMA 1ZBIA 4OKKA 4O0JA 4ZMSA 3TR8A 3HV2A 1IKYA 1VRUA 3HO1A 5HSGA 1L5ZA 3QO9A 3I42A 1AB6A 4FLUA 3EAFA 3F7NA 1JL2A 4MR7A 2ZAYA 1E6KA 5J1EA 1U2PA 1TVRA 3HPOA 1BI4B 1D5AA 4CJWA 1PHRA 2F8SA 3VQ5A 4NV3A 3NNNA 4CGJA 5IEJA 3P9YA 3NF6A 3L2WA 1P6QA 4MLDA 1LV5A 1VK0A 1TK0A 1EWTA 4CHZA 3VQ6A 5SWMA 1NKEA 3MF4A 1KRWA 4NICA 5FBKA 4FJ7A 3B6OA 1LWCA 3H75A 4CJPA 4BE0A 3G85A 3SCXA 4W5NA 5EWJA 4NCBA 1M5UA 1YS6A 5K14A 4QICA 1JLQA 3TAGA 1NXPA 4EVSA 2Z1IA 4E1NA 1S1UA 3AVBA 4ETMA 4KI6A 3QEIA 4CJFA 3V1OA 3AO3A 2IOYA 3SUNA 3O21A 2VG7A 4CHOA 3OYHA 4S05A 1U49A 1L5YA 4UHJA 1JLGA 4BDPA 2B4JA 3HDVA 1REVA 1HRHA 2PL1A 3V81A 1QP0A 1WSEA 3ZT4A 3QX9A 3LP2A 3H5WA 6ABPA 4ZMRA 1C0TA 2FN9A 3RR8A 4O1HA 1HEYA 4Y1DA 4DADA 2Z1HA 3RWUA 1T03A 2PL9A 3MM4A 4KHQA 3E01A 1P6UA 4RY8A 4Q0BA 3DMJA 2O4GA 4N0PA 2CHEA 3OY9A 3OYGA 4YCSA 4O5AA 1NK7A 1QP7A 2GKGA 3N53A 3RTVA 4EYKA 3QIOA 4H8KA 4MAAA 3LMKA 5CNMA 1J5OA 3SAJA 3ULDA 1WN7A 1CLQA 1WSJA 3B2NA 3P5JA 3MA0A 1ZGZA 4DS5A 5IUNC 2HHSA 3CLKA 2P1JA 3RR7A 3IDOA 3O4NA 4NQRA 5TQ2B 4DTMA 4BE1A 3QEMB 2IDOA 1XWLA 1J54A 5HRRA 4XFKA 1M5TA 1VSLA 3SQNA 3MEDA 4CF1A 3LZJA 4Z99A 4G0OA 4MQFB 4CF8A 1JLBA 4FE4A 2ZD1A 4DU4A 3CKMA 4CIFA 2PUBA 2P4UA 3QLUC 1NK4A 1WNSA 4CEOA 2OQRA 4IGAA 3L2UA 1SL0A 3NHGA 4YFUA 4LZLA 3DM2A 1JBEA 1FSPA 1DBPA 4CJEA 3ZSZA 3F6CA 5TPZD 1X9SA 3TAEA 1JKHA 3H1EA 2WOMA 2HSGA 2M98A 4BWJA 3NDKA 4DTOA 3P83D 4FJKA 4FXDA 2ZE2A 1YIOA 1UDRA 4OTZA 3HS3A 3NBMA 3K58A 4RW4A 3LPTA 3WNFA 4KMRA 3LANA 4DLEA 4CE9A 3S3MA 4EYOA 1EXQA 4CFBA 4O0IA 3BRQA 3I45A 1C0MA 3M9WA 5HRPA 4E7IA 2KFZA 4ID5A 1VSFA 3T38A 1ISSA 3MYYA 5CYQA 5KRSA 3QEWA 4RW9A 1S1TA 2FEWB 3B6PA 1NJZA 4N0QA 4HNRA 4WE1A 4CHYA 2FMHA 4HCBA 2VUHB 4FJ9A 4B9SA 1SUQA 2H3HA 3DBIA 5FWXA 1TKXA 3L2QA 3DI6A 3IG1A 1JLCA 4TMYA 3JYTA 4RXUA 5JNWA 5KC8A 1S1WA 2HHTA 4PZ0A 3OYBA 4ZHRA 2E4ZA 4MRMA 4CFAA 5C25A 2O4IA 5KGXA 3ZT0A 3K4HA 4OJRA 3H5LA 1QS4A 4KHNA 2PUAA 3TABA 3NBPA 2FSPA 1ZYQA 4Q6WA 2YKNA 2JGUA 3L2VA 3HVTA 4AHRA 5FWYA 4CIEA 5DKFA 3KJVA 2R7YA 3CFOA 4KI4A 1DCMA 2GWRA 4KHWA 3L8BA 2A9PA 2TMYA 1W0HA 2M1ZA 2PJUA 1SKWA 4O55A 3A10A 4G0ZA 5TPZA 3TO5A 2QXFA 3DLRA 3VQ8A 4FLYA 4HVJA 4PICA 2N9UA 1ABFA 3OLWA 4Q7EA 4F2RA 4J2BA 1UOCA 3SQ1A 2HQBA 4XARA 1RDBA 3CG7A 2AYZA 2Z1JA 3UK0A 2HHVA 1RT5A 4ELUA 1A04A 1U0SY 4FLVA 4FJ8A 1ZVVA 1WAFA 3KLFA 2XO7A 4CEQA 1RNLA 2JB9A 4YWHA 3DLBA 1GOBA 2FEKA 1RTIA 3IRXA 4AHUA 3V9WA 2KFNA 3LKBA 4EYGA 4RS3A 2G8FA 1VSIA 2OZSA 1G15A 3NHZA 4DSLA 3HYFA 3KLGA 3ROTA 1LAVA 5IEBA 1QP4A 4Y9TA 1J9AA 2XDYA 4WXEA 4NCAA 3AVIA 1U2QA 3L3UA 4OG2A 5HROA 2HPHA 4HUEA 4F3OA 1DTQA 1E6MA 2QW1A 1SKSA 5DTEA 3OLXA 4UHKA 2IDMA 1ZDMA 4DQPA 2A9OA 4FCYA 2G8HA 3MEEA 2MYPA 4FJXA 4OBBA 1EAYA 1JX6A 3C6TA 3C95A 3LUHA 1QKKA 4KK3A 5JNTA 3LTEA 1TAUA 2H0AA 4Q6BA 3CZCA 3FFXA 1QMPA 3O1JC 3SI6A 4LX8A 1A5WA 3C97A 3AO5A 3ITHA 1BISA 1MB0A 4DSJA 4DQRA 3CM6A 2KTQA 3EQ2A 4PA1A 2ETJA 3K2PA 3I0SA 1TV6A 1S1VA 4Z4HA 1DCFA 4XLTA 3O3HA 1FFGA 3G1WA 1AB5A 3H08A 2NZVG 3KSMA 3N0XA 2O20A 4IKFA 1RT1A 3AVKA 2XY5A 1C1BA 1U45A 3FGZA 3Q7TA 4M3ZA 2X78A 4R5PA 4Z4CA 3OYIA 1DZ3A 4B9TA 3A0RB 4MR8A 4N03A 2QZJA 3D45A 2E4XA 4FLXA 4CHQA 3BGRA 4ML3A 5CZ1A 1RBRA 4E7JA 4M3XA 2HJ9A 3H5IA 1RT4A 3ISNC 2VK2A 4CK2A 4DG1A 3TARA 1JHZA 4TN5A 1F21A 4KB0A 4OATA 4I2QA 4ELTA 2WMYA 1A5XA 4CK3A 5IC5A 3KD5E 5TQ0B 3HVRA 1BQNA 4DSIA 2X7XA 2RKIA 1CEYA 2RF2A 4OVLA 4XIUA 1E2BA 1NXXA 5CZ2A 4LH5A 5EU7A 1XHXA 3RVLA 3AA2A 1NXVA 4I2PA 4UQGA 3SV3A 1U4BA 4CF9A 1PNTA 2Y1JA 3K5NA 3QEXA 5FROA 1U04A 3GWGA 4FK2A 1NJYA 2PUGA 4KQ9A 3NNSA 1JYEA 4JRQA 3ZT2A 3L3VA 4LDZA 3NH1A 1B9DA 2X6SA 1FKOA 3SPZA 5CYMA 1JLKA 2HHWA 4LH4A 3S3OA 1LJUA 3PX0A 4DS4A 4C8NA 3T3FA 1RTHA 3G10A 3V1RA 2QKBA 4G0QA 4KKOA 1D9FA 1L3SA
chains in the Genus database with same CATH superfamily
4HMOA 2DF8A 1SOAA 5EWMB 4D6XA 3B1ZA 3ZQUA 2YJ4A 5IKEA 5K7SA 1GQYA 4ICLA 1IKVA 1E60A 1KZ4A 3F74A 3SZUA 2C3MA 4ZHQB 4G5QA 1GYPA 1IB0A 3CF4G 4MVJE 2POQX 3UT6A 5A6SA 4UEKA 3T0FA 3UOWA 3ICWA 3RYCA 2ZQ5A 5LSAA 2O52A 2R8YA 2DPHA 1L4MA 3SAFA 2OPRA 2O54A 5TRTA 1A96A 4RVFA 5EXDA 4MDHA 3DLPX 1QNLA 2XBLA 2O07A 3ITKA 3U19A 1OXKB 4N76A 4QGSA 1NV9A 4PVCA 1VG0B 1UXHA 3WGUA 1WB6A 4CG2A 1MLDA 4G97A 3KK0A 4NOKA 3CEJA 2XY6A 2VAXA 6CHYA 4JEPA 4B7ZA 4I55F 3EVAA 4FJGA 3NTRA 3KK1A 1TQ8A 3ZWOA 4YV0A 4C6RA 2XW6A 4M7OA 4I9HA 4MH0R 4Z86A 3UFXA 4PV7A 5COQA 4CGIA 1YC2A 1H42A 1XCJA 4PG5A 1DKUA 2HI0A 3PR3A 2CB0A 2XX3A 1D2CA 3VQBA 3F71A 1W96A 1P77A 4OX9Y 4EG4A 1EGVB 3K92A 3K0CC 3EVGA 1O13A 5FOXA 2IEGA 4GBMA 1OR8A 4C3UA 1N7HA 4RZSA 1G3IA 3B60A 1JKXA 5AW6A 5A1TA 1V1MB 4RY0A 3BL8A 2GZSA 4B87A 4CMEA 2TRSB 3RYHB 1Z0FA 3NCTA 4QX6A 2YIMA 5KGWA 3KLMX 1IQPA 2BH1A 1K6JA 3AGKA 3GR6A 4E46A 2FMFA 1XDUA 5DNAA 1MQSA 4NS4A 4XGNA 2PKEA 4QATA 3OYDA 1K5GA 4X65B 2E4UA 2G07A 1VLVA 3WTCA 4PPFA 2IZ6A 1L5LA 3MJFA 4RVOA 4PPYA 2IZ0A 2FRDA 2J0UB 1L4EA 3F1KA 3TTYA 5A05A 3TTFA 4LRYA 1GUBA 2NUPB 3NT2A 3VQEA 3DCIA 1ZJ5A 2C2WA 2JHGA 3BSFA 5EWLA 1KAHA 4RV9A 3EA0A 1OZAA 4NULA 1L5MA 5HRNA 4P82A 3OS2A 3QJ5A 1RI2A 5SV2A 3DYBA 3DFKA 3DMTC 3SFVA 1WAJA 3LM2A 4G1QA 2OPHA 4GOXA 4D41A 4J0HA 3CHYA 3UMCA 2D0IA 5KZMB 2BGKA 1T43A 1YIJN 2PRYA 3L6UA 1EUDA 5KTPA 2Z9CA 1M2NA 4MP3A 5LP6F 3DXKA 5I47A 4CMIA 2BLLA 1QE3A 4QM7A 4KWTA 4WA7A 2JGAA 1JBQA 3OKCA 1ACLA 3ZQ6A 4O2LA 2HCFA 2EG5A 2X6TA 4AG3A 4CIGA 1RBVA 4NMMA 5I7EA 1HKCA 5ALIA 4FYYA 1K98A 1Q84A 1JR6A 5ERXA 4DCUA 4YCLA 4M9CA 1XHFA 1XYGA 1RJDA 3FUVA 3MWTA 2IZ1A 3HU2A 2PH5A 2VDPB 5CA0A 4EX6A 3KTQA 4DV2K 5C37A 3VJRA 2BI4A 2PR2A 4L15A 3OX2A 3B53X 1M2EA 3ZCTA 2CDCA 1Q81O 4N6OA 5GAHP 3H5VA 1K7EB 5KMGB 2FQWA 4RLFA 2NYRA 2PS9A 3FPEA 2AW3A 2QTRA 4MV7A 5LNK1 4F4DA 3GJ4A 3WHKA 1FW8A 5T4HA 3VERA 4GKKB 1JSRA 3BZBA 2TMGA 4RM3A 4ENRA 1Z2NX 3EUEA 3OOYA 3D4IA 3PWTA 1WF6A 3K09C 3UN1A 4H35A 3QG1A 1P39A 4XH5A 4CNQA 1EFLA 2R6CA 2ZBVA 3JYNA 3PYXA 1O8BA 1V37A 1TW2A 3X1ZA 3W2HA 3KEOA 1I0ZA 1CUUA 1KEUA 4RZHA 1VHWA 2ZIZA 3M7IA 4CBUA 3VH2A 5B1EA 1KKUA 2FBVA 1ZH0A 4LQ4A 5AHXA 4PNZA 4X7MA 1NVFA 1NN0A 3NH9A 5E3JA 3CLRC 1XCGB 4TROA 4PR3A 4Q3OA 5M7EA 5KKAA 3BK2A 2P9QA 5DNDA 3ASMA 3JARB 1WXWA 2G9NA 1FTSA 3FLBA 1GFIA 1OHHA 1K06A 4QDZA 2W2OA 3WK6A 3UHJA 3TR5A 1N0IA 1HFEL 3I1IA 1TW3A 2HUPA 1H4VB 3P4XA 3IUPA 3I5UA 1NIJA 2CJWA 2W6QA 1QU2A 3DE0X 5C12A 1GLNA 4UEQA 4WT7A 7AT1A 1P0CA 4BZWA 1U81A 2FBTA 1B8VA 2EZ9A 5E9QA 5AWFC 5IUKC 3ZPXA 3T7RA 3C6YA 5IAGA 3LXUX 1L1RA 5F12A 4INZA 1TNDA 1PZNA 5DBGA 5B1SA 2YHWA 3NANA 1T34A 3KP1A 2YRWA 2JCVA 1ZRMA 1XWFA 4JS5A 5FWYB 1G5PA 2Y3IA 2QDKA 5I3UA 1T0IA 2KLBA 10MHA 2XDQA 2Q46A 2HAEA 2P1DA 2XXAB 1Z47A 4UMDA 1FZTA 1OLUB 4OLAA 4BFXA 3RFCA 5LR6A 4TXJA 3UJ9A 4UE6A 5KHAA 4W9NC 5B6IA 4IRUB 5C9ZA 4AURA 1YJ9N 3SJJA 3ZIAD 3OZTA 4F91B 1V11A 3IVRA 4L8WB 1NTOA 3G7SA 3FGUA 1QCCA 5E26A 1W5EA 3CRZA 5B3KA 3QPUA 3SVZA 3SM9A 3O3CA 3WWZA 1I6KA 1JQKA 1YBHA 2XJ9A 2FZ4A 4WWHA 5KWJA 1OWNA 3TQQA 2GX9A 3V9PA 1C4WA 4WFQA 5B4UA 5DM7L 1E77A 4E15A 2ZJRL 1R0YA 2EV9A 2HO4A 1A88A 4MSUA 3K6SA 3PXXA 1MVOA 1HFKA 2ZDQA 1HG1A 4EB0A 2XI4A 3RTDA 2GXUA 1ATIA 2E2NA 1D5WA 4LUCA 3MS2A 1IKXA 3F5SA 3OM0A 1G7CA 2C92A 4O4LF 3KK3A 3EE6A 4RPKA 2ZBGA 3G9TA 2X5KO 1SHLA 1M2GA 1K0FA 2X6NA 2H63A 3H9CA 3AVOA 4AECA 4HX2A 1IOVA 1PN3A 2FQQA 4JOBA 2A6AA 3ZXSA 3H6HA 3OIGA 4Q16A 2WB2A 4HGOA 3S28A 1JQJC 3BXOA 3E9CA 5HMMA 4HDRA 1OPRA 4IM7A 1J6ZA 1TGOA 1DX9A 4J1NA 4EGJA 4BV3A 4ITRC 4PYQA 2NZUG 1DWUA 2IE0A 1XDSA 2ZWVA 2G76A 3IP6A 2I3GA 3UGKA 2PUJA 2YZGA 3JYHA 3T9FA 3RNOA 5A6VA 5CYFA 3QVOA 1VLJA 4NBWA 2RJOA 4Q34A 3S1AB 4B1YB 2DWQA 3I61A 3TM5A 1MZVA 3T3NA 4TV8F 1KAQA 1YA4A 4Q4AA 1QH1B 4X24A 5GTDA 2HPZA 1COZA 3H5AA 2WEKA 3HXPA 2Q4TA 3HJTA 4FR5A 4CJ5A 5GONF 5BV2P 4LJKA 4U6QA 4A2CA 3R9XB 1XROA 3IKMA 3KKEA 4ZZ3A 5SY4A 5CD9A 3ZHZA 1A7KA 4HYYA 4JU8A 1ETHA 3OA2A 4ROSA 3LAKA 1G5IA 3SDBA 1I24A 1OXTA 4H7PA 2L82A 1RP1A 4TV9B 4DSAA 4REQB 1LDMA 2YQ5A 4RIFA 3ELUA 3UE5A 3CF4A 1DKRA 4FZ3A 1WSDA 1ZY2A 4ABTA 1U0EA 5ICMA 1GGEA 5JAMA 2X2EA 3AXSA 1T3SA 4OLJA 3OMXA 1NGFA 3CUWA 3CG0A 3B6IA 4PCLA 3RYIA 3D3KA 1EP2B 2C83A 3OFKA 3WIEA 3VUEA 1YVPA 5TPWB 3JXEA 2P8JA 4M9ZA 1SXJC 4QEZA 4MR9B 1IRIA 1U0FA 3K7EA 4Q0MA 4JUIA 3UMSA 1QDLB 1OGIA 2YVUA 3MWEB 1Y82A 1TGYA 5GWXA 3U13A 1JJ2M 3HKCB 3OZUA 5L3SB 2AG0A 3GJQA 1BCSB 5ADUS 4IDFA 5AVVA 5JD6A 3CR7A 2QTDA 3V2UA 3D43A 1S2OA 3GUVA 2JPDA 2AWOA 4IF4A 4DV1K 3R5JA 3O9TA 3NMUF 1FVOA 2G88A 1PCXA 1EJ0A 4JUAA 4N3BA 3C8MA 1XMQB 3WXIA 1NPYA 1M34B 1OV6A 2ES4A 2Q0XA 2XOKA 1JECA 2VNJA 4PYRA 2A4MA 4N0EA 5CXUA 4KXUA 1P7ZA 2RGRA 2NTJA 2V7PA 4XQCA 5E6RB 4FKBA 3CTMA 1Q0TA 2J07A 3M3ZA 4WCEL 1TCUA 4BB6A 4CJSA 1GDTA 4ND5A 2P1RA 2A9JA 3GFSA 1BVUA 2PRKA 2P9BA 3TWOA 3GDWA 1BXKA 4YDHB 1POWA 1J8MF 2DERA 1J5PA 2BGJA 4YT2A 1H5QA 2H18A 2YWGA 3OO0A 1OGJA 3GDGA 2V5UA 4N3AA 3SLGA 4CQLA 2VQ6A 3H16A 5EHZA 5AQVA 4TLEA 4NZMA 1E1LA 1I0LA 1QIDA 2GFQA 3BREA 2Q8QA 3MQ2A 1T4MA 4CCYA 4BE9A 5ALDA 1NBWA 3ZLBA 2PPVA 4PY5A 1KQOA 1ZICA 3ASZA 3PRHA 4YROA 4I08A 4LBYA 3OJWA 1JLFA 1T2FA 1H1TA 1K9VF 5DTJA 1MCZA 1PKXA 3OBWA 3SUOA 1PEAA 2MYUA 3KB1A 3COJA 4F8EA 2HXGA 4PHFA 2FEPA 2ZTUA 5G41A 1GN8A 3GRPA 1VAZA 3IA2A 3FOAA 1K97A 4UBIA 3P0FA 2YJZA 2O23A 4HS9A 2JGDB 1IOWA 1TYAE 1SOMA 1D2MA 1NMZA 2GBCA 3ZSYA 1U0TA 4EB8A 1N9GA 5KU1A 2WUEA 2QHXA 4DT1A 2WD8A 2BMEA 2G25A 3LNCA 1OX5A 1QF6A 1D03A 4GNKA 3LQKA 3O2JA 3I37X 4TKZA 4LJSA 4DR7B 2MINB 2BTQA 4MYRA 1ISPA 2ILTA 4IHKA 2JIRA 3TWHA 3DBOB 2EFDB 4EPXA 4B44A 2JFZA 3O47A 3TQIA 4DGQA 1JMYA 5DNUA 5EIHA 4CN8A 4DNQA 1YRHA 4K86A 4I7FA 2Q1UA 2CLOB 1VQ7N 2H2HA 1NATA 1EK1A 1G20B 1NW9B 2CF6A 2JAUA 1UH5A 2HF4A 2Z3ZA 1YIDA 3F98A 1DG3A 2FN4A 3UICA 5GVSA 2YZNA 1LAWA 4AVYA 3ICEA 2QUHA 3IEPA 4HS4A 5M04A 1X7YA 2ZIXB 3E03A 4B09A 1E7RA 1YZQA 2VP5A 5DVZA 3WBFA 4ND4A 3CG4A 4HUQB 4JT2A 3F0TA 1OUMA 3DJCA 1JZTA 3QEOA 2NM0A 5DM1A 3NBFA 4GM1A 4AQYB 1YSCA 3BRSA 3OE7D 3W7AA 1XC7A 3QTBA 2OKCA 4E2ZA 1D9DA 4R7GA 1U2TA 3X1WA 1XHZA 4REMA 1Y9JA 3FGPA 1N5MA 3VZBA 4FW9A 1TMOA 4KOEC 3O4HA 2E8AA 1ONSA 3GQBB 3RV4A 3U4QA 5BOSB 2I65A 4RIEA 1VRUA 5K3CA 2G8NA 2YVQA 2DMRA 4OI0A 5KOJB 4J7UA 4BVHA 4ZYTA 3MT7A 4AJHA 3IAS6 4CTJA 4YRJA 4B3SK 1NE7A 3ZD9A 3JR3A 2B83A 2FK7A 5HGJA 3I9OA 3TTUA 1K63A 2GXSA 4BG9A 4KC0A 3NF6A 1PW5A 5HQ3B 1PLLA 3BD9A 1MT3A 1GNVA 1RYFA 2FWJA 2J3MA 3SCXA 3EVEA 4OO1J 4QPZA 3GZTB 1I4EB 2A3NA 4AN0A 1RW4A 1ZD9A 1S02A 3I6QA 3AVBA 1KFEB 3U0VA 2Z6AA 4Z51A 1E59A 3HDJA 3QWFA 4YUAA 3VU1A 3AO3A 3R0XA 3SUNA 1D9ZA 4BDPA 1QP0A 1YZNA 4YHBA 4RA6B 6ABPA 3D6UA 4ZMRA 3VSDA 5AOVA 3HC7A 1Y37A 3QVLA 1H9AA 5JQGA 5HZHA 2VKQA 4L0MA 5EKDA 3MM4A 3QU7A 1P6UA 3SHVA 1NF9A 3ZIDA 3OYGA 4PPNA 3IVCA 3NORA 5HUQA 2Y4NA 2O2CA 4IYRA 4E12A 1U28A 3QFUA 1QYVA 4MAAA 4QQRA 2JGMA 2PVPA 2WAAA 3PGXA 2W4QA 2I4RA 2P1JA 1NSYA 4CETA 5BSEA 4WX2B 4IIJB 4B81A 2IDOA 1OU0A 3EOBI 3SX2A 1AQNA 2B2CA 3NR2A 4OQFA 3ZU6A 3R3YA 4PO3X 3H9GA 3OWXA 3P94A 4QU9A 5SZIA 2WWYA 1G3RA 2OGTA 5EIBC 3X1YA 2CJXA 2DR2A 2ILVA 4MO2A 4EPYA 5JQWA 4C05A 2ZPTX 2WOMA 4S1NA 1SWVA 3F9IA 5LVAA 2Q6KA 3D31A 1B26A 3DBHB 3G8YA 2ZR9A 4RW4A 3GY0A 1G291 4WQ5C 2ORIA 4JY7A 4JAXA 2L42A 1U0HC 1P29A 4KXFB 3ESDA 4YJ3B 4KRXA 2FPGA 4MNTA 4CCWA 4RF3A 1HZZA 4YLYA 4RKEA 4MYDA 3LBFA 2P9SA 1AHIA 3PJDA 2QDXA 4WFBL 1NONA 4B4OA 2DQYA 2HBMA 5JYCA 4I1IA 3N87A 4KWEA 2UV8A 2HT6A 4F6LA 3VR6A 2GB4A 3JAKB 2F3PA 1J4AA 3QA3E 1WXFA 1EFTA 1R8YA 4BLOA 2QSUA 1CP2A 4FIDA 2UXDK 4DRZA 3VTHA 3L2VA 5J2UB 3W3AH 4GE3A 1KY2A 1KEEA 2F3TA 1WAMA 3SI7A 1LY1A 1LPNA 1UP6A 4IYJA 4M6WB 1EUYA 4NK4A 2W43A 3VQ8A 2WHEA 2ZWPA 4KN6A 3HKBB 2PFGA 4JLWA 3RFVA 5GAGP 4D1YA 3LXMA 3ZLTA 4R2XA 2Y1KA 2M6LA 1UMBB 1PR1A 4TWRA 4U7GA 2R1ZA 4IQ8A 5BSMA 3RYFB 1TGVA 3INGA 1KC1A 4OG2A 1M2OA 3BHMA 5DYNA 1WL8A 1VHJA 1HKGA 4BO7A 5M1QA 5ITZA 3EZ2A 3NTUA 3EJ6A 4BV2A 3ABQB 1SVLA 3ZGZA 2UZAA 2HBKA 3TMKA 5K0LA 3PJRA 3NEAA 3PQ6A 4AFNA 5KKNB 3TQFA 3QBWA 1JAHA 3DZBA 3K72B 3PUVA 1NZJA 4CI6A 4I2NA 3IH5A 4JLMA 4ZC8A 3ACCA 3KAJA 2WHYA 1N2CA 2Y1FA 1DCFA 1DXOA 3MVEA 4MUKA 1R0LA 4GLOA 4OU4A 3H08A 1EVYA 1XQYA 1YJCA 5F21A 1U45A 3CLUC 3K70D 3SVTA 2EIXA 1NY6A 3OTWA 3F3MA 2NV2B 2V74B 1CUWA 1E18A 3PYLA 4MB2A 4E7JA 2GR9A 2R11A 3AU8A 1P7CA 4AJIA 1RT4A 2P4HX 3T99A 1MFZA 1F21A 4CTKA 2YR0A 1C80A 4I2QA 4P3XA 4AJEA 1QBKC 3GEPA 2N0SA 1Y8RA 5IC5A 3BXPA 1W35A 3U7RA 4GOLD 3C0KA 4OVLA 1M1ZA 1T4GA 2CWWA 3RVLA 1B3RA 1Y6RA 1ZSNA 2XHZA 1I4LD 1UPCA 3KOWA 4KBYA 3VVMA 4WAUA 2NNLD 2X8BA 5SZKB 4ZGWA 2YJ3A 3RWBA 3CE6A 1L8XA 4MX8A 3LIIA 3G10A 3PQ3A 1Z22A 1K8KA 2I7VA 4CW7B 2GT1A 1Q7TA 2BMDA 4E11A 2O8DB 1YHNA 1XQVA 4FHFA 5AXAA 1HWYA 3QVGA 1X7GA 1V7PC 1DC8A 4HGRA 4WE3A 2GJAA 3TTCA 2Q0UA 2JNWA 1OFGA 1BCRA 3VEYA 3H9UA 5IX8A 1XZLA 3AL0C 3MBIA 2HA4A 3H8JA 4KDEA 1AUXA 2YYZA 1EUZA 1QTQA 4F45A 1IY1A 1KDVA 1TTHA 4I1YA 5CVEA 2HLNA 3SYTA 5LIPA 1WCV1 2FPOA 1RI3A 4GX1A 2WJYA 1XIVA 2AEEA 1NBHA 1MDBA 1BXRA 4RE5A 5EZYA 2BSXA 4QUEA 1P4JA 2VPIA 1ODLA 3RMDA 2CCJA 4ISGA 1WMFA 4HQNA 3AEQA 5I8PA 4PKGA 3Q11A 2JDIA 1ZVMA 3EGCA 1YJ5A 4FB4A 2Z5VA 1TMGE 2GZMA 3GUCA 3FB1A 4GQBA 3PPVA 4BMPB 4HUGA 2ATQA 1WKVA 1Y9DA 4XJSA 3IR5A 3ABSB 5HQTA 1Q0ZA 3I73A 4X3PA 2UZ1A 2OCGA 5B36A 4QGFA 4GZ3A 2QMUA 3EODA 1RCTE 3WBKA 3PIDA 2IY9A 4JELA 3ZDZB 1MA9B 4DQ0A 3ZCXA 5IFLA 2RJNA 4YV1A 1SU7A 2B2XA 1ZI6A 2FGKA 2VI5A 1C4KA 3BM5A 3AB7A 5AUQA 3MBOA 2Z3WA 3S3TA 4INOA 3E1SA 1U0NA 1RFGE 2FN7A 4UMVA 4QNNA 2P9KB 4CFZA 3P45A 4NSNA 4QTTB 1IK6A 3PQCA 4LQDA 3UBTA 4UNNA 2NQ2C 1M73E 2IYAA 1EX4A 1XEXB 2HNYA 1OXBB 1JQEA 3W1EA 3W06A 4ZAYA 1JLLA 1P9NA 3O5AA 2KSQA 1NR5A 3JTEA 4YHHB 4JI6B 2DWOA 4E5KA 3BHJA 2WDPA 4FGZA 3P9ZA 3RU9A 4IFBA 1PK7A 2PGIA 1C50A 2XVYA 2RFLA 4D9KA 2FZLA 1U47A 4PGMA 3W0LB 4S2EA 3ZWYA 1JCGA 2WTEA 3OYKA 4B6FA 4KGZA 4QARA 2L18A 8ABPA 3AEXA 1RKQA 5JAPA 2F1RA 1XFDA 2F00A 5JS6A 1FRNA 4BFUA 3R3UA 4CZKA 4NX2A 2PT6A 2JA2A 3HWWA 2ZIUB 2GJKA 4G9ZA 4QOHA 4O25A 5AW4A 5I5GA 2HSDA 4LIPD 3CVVA 5HFJA 3FYTA 3WNZA 1IEQA 1T25A 6ADHA 4UARA 4D80A 5E3HA 1SIUA 4YAWA 3K59A 2IVZA 1YR3A 2CE7A 3IV6A 1KIAA 4JRPA 4CTOA 7REQA 1CDZA 1HE4A 1KEPA 4D5GA 1ZBDA 3GVPA 1VPDA 4EBBA 4ARVA 2XOEA 3BUSA 1QK5A 5A9TA 2XVMA 3GFBA 1UOPA 1XMVA 2CXSA 4LVUA 2N1MA 5D3GA 4POAA 3SBXA 2QRUA 3IAAA 1DPFA 4E13A 4HLDA 3A6KA 1DMSA 2GHRA 4MVYA 1Z33A 5CM8B 1FUYB 1JXEA 3N6VA 3TLCA 3ZWDA 3U44A 1OH6A 1Q8IA 4I81A 1T6ZA 5BRJA 3KBOA 1YUBA 3D2EA 1ILEA 4RK5A 3KYDA 1Z2DA 3O8NA 2E1ZA 3ISJA 5AMXA 1KRXA 4OYRA 4IFEA 4GGPA 4MUGA 3VPBA 1QKIA 1NTRA 3BDAA 4JOCA 1JYSA 2XNKA 3TIVA 3AETB 4ER0A 3EPPA 5E1OA 3PQ8A 1VECA 2AFRA 2IP2A 4ALMA 2XE6A 1DINA 2WI8A 4CM4B 1PFGA 1LBIA 2D74A 3BL6A 3OFVA 3DV0A 3UB4A 3P0IA 2JGKA 1AE1A 4MYCA 1BD3A 4PO9A 1J2RA 4J0DA 2QF7A 1EIWA 4GC5A 1DGQA 3PHIA 4O33A 1M6VA 4MMXB 3L7NA 1QO7A 3PIPL 4EKIA 3L43A 1T36B 1GILA 4DSZA 1U3DA 5GIPE 4QXRA 5G4KB 2PK3A 3TW6A 1IH8A 1KNXA 3R0ZA 3I4CA 3T1HB 4EKNB 3UMMA 2AFIB 3VPGA 4GKAA 3WNGA 3QV1A 1KHTA 3SYZA 1B8PA 4RMJA 1DHTA 2DKOA 1KYQA 1NVUQ 2XQIA 3AUXA 4W63A 4DJDC 5K45A 2O9JA 1HPZA 4DUZK 4XM1A 1GYQA 1O1YA 1YQEA 3RC2A 1EGQA 1AY0A 3H1GA 4WSOA 3UVEA 3O93A 4E94A 4QDOA 4HB0A 4MDEA 1Z17A 2OUIA 3R9IA 3QINA 4N7MA 3SMVA 2H1OA 1HH4A 4C01A 2HRRA 3GUUA 2O2JA 5BSGA 2NAFA 5F9MA 3UXEA 1IBRA 4ZCSA 4S12A 4NO7A 4QG7A 3DRSA 3FDFA 2OVBA 2YJ5A 1RQXA 3H2BA 3R4CA 3HM9A 3G0IA 1X19A 3D7KA 4IJ6A 1I01A 4FDLA 3PQ5A 4BKMA 4YONB 1R6VA 5DV9A 2J0VA 5IHPA 2PJZA 2XTMA 1DDOA 3RVNA 3QEJA 3CC4N 5BYBA 4D3SA 1Y9ZA 3ZSRA 4KR3A 1ASVA 3BGDA 1EXNA 1LPOA 2FSHA 4EATA 4FFOA 1QFZA 1KMHB 8OHMA 2WWXA 3D7MA 3PEWA 4L0CA 1YR6A 2ZROA 4WUTA 4DIFA 3CKYA 4Y7CA 1PIWA 2DTUA 2IC5A 2HRBA 2W2PA 3FUXA 4UTNA 3KFXA 2WM3A 3FR0A 1NJ8A 3FZGA 4H4EA 4Z4IA 4AMGA 3CYMA 1PR4A 4FLEA 1YZVA 3D7LA 1I3KA 4JI1B 1IIBA 2HMVA 4YJFA 3MYRA 4QPPA 2ZWAA 1VKZA 3RBVA 4TTTS 2R79A 4PS1A 1GEGA 4C7OA 4O8CA 3X1DA 2VT2A 2V54A 4QUAA 4G85A 1FVXA 4KH0A 2QVGA 1I1NA 3MUFA 3TCNA 4EJSB 1R8QA 3IIKA 3C7DB 2W41A 2RBEA 3SK3A 1GAWA 3O94A 4DPLA 4O08A 1GU0A 3J7AC 5F51A 1DEOA 5TT1A 2YY7A 3AR6A 1T3LA 3HKEA 3Q3IA 3W34A 4WRRA 1KOJA 2BFCB 4GU5A 1DT3A 4GBJA 4WFAL 4ZPJA 1HNXK 3KKPA 2F4NA 3Q40A 4YFYA 3B7GA 3CUKA 3MB5A 2ZJQL 5HM8A 1RLUA 3GE1A 1K08A 1CJCA 5FYQA 1HT3A 2G8IA 1G4UR 3IHWA 1N5DA 5CA1F 3A6JA 1WZEA 1KWGA 2CGJA 1XXHA 2FDRA 2QXLA 3KSZO 3U4MA 3WWCA 3DB2A 1WU7A 3JU3A 4OL0A 2HSTA 2VHZA 1P1IA 2BJHA 4C2AA 4YVFA 3C6AA 2QWOA 1SUCA 1RLIA 3KHKA 2B4AA 1I2DA 2B5WA 3KELA 2HTEA 2JG3A 2FLKA 4ZVMA 4PL8A 4MO4A 2JWKA 1U8FO 4CD1A 4ESOA 1BJTA 4S0XA 1TUGA 5AVSA 4FSVA 4B1WB 1SULA 2ZCVA 4MUNA 4JENA 3PUZA 4BLVA 2OHJA 4LE2A 1GOCA 3BMCA 4WI1A 3MMPA 1XNQB 2CV2A 1OWMA 1XNRB 2Z1DA 1ZGGA 1R1DA 3LQ1A 2YXNA 5D3QA 5KSPA 4IIGA 1Q77A 3NATA 5BN1A 1MQ9A 3WDLA 2R1UA 4WASA 4MUBA 3ZJYA 3SJCA 1WMEA 2GUIA 4U2DA 1P44A 4FSHA 1Y9AA 2OESA 3K5WA 3W3DA 5JNUA 3OZFA 5K4HA 3EAGA 4LF7B 5DHUA 4CG3A 2G8KA 2XA1A 3NGIA 4J9UE 5K1ZA 4O4IA 2QJRA 3TAFA 2WIKA 1X7WB 1WUIS 3DOUA 2XLCA 1NK9A 1S3IA 3LDSA 4YOTA 1JAZA 3R1XA 3ST7A 1HDZA 1ZESA 2IQ5A 1H8EA 5KNBH 3LC0A 1RLTA 3H5RA 3JATB 3K2BA 4KLNA 1LPSA 1XZIA 4Z0PA 4A0SA 3HB9A 2O59A 2O8CA 2CYCA 3JYLA 3KAPA 4MCJA 4O8ZA 4GXQA 2IOCA 1G8AA 1FY2A 2D0AA 1UBGA 2R1TB 1H0SA 2QQ0A 2EX0A 2X74A 2XR1A 3D3JA 4KLCA 4KXYA 4F9FA 3IEVA 4KGXA 4LFAK 2KWIA 1OW3B 2OZMA 4NOJA 2B99A 3N58A 1W5BA 4DTNA 4ND6A 1P31A 2VJQA 2JLRA 3T5DA 2FBXA 3K96A 3KX2A 1VJ0A 4EEXA 2UXCB 2CLKB 2ZB7A 1JIIA 3SZ3A 3ENVA 4DWJA 4RETA 2OGZA 1NK0A 5K3AA 2IPAB 3X1MA 5AI8A 4OYYA 3DFUA 1HMVA 2H9AA 4BVAA 3WNBA 5LZ2A 2EHJA 4IUBS 4F3KA 1MJ5A 3K1ZA 1V3TA 3AVTA 3N05A 3DE1X 1SVWA 5HIKA 4V3BA 1E3DA 3LWBA 1J7JA 4PC2A 4HEHA 3WMGA 2C9OA 4CHTA 4CCAA 5FYDA 3QHAA 2DSTA 4XASA 1QC5A 2QLNA 5GINA 3TLZA 2UVPA 4UD6A 4FFVA 5JISA 3PEUA 3DBLB 4TKUA 3BWDD 5HW0A 5K8LA 1J0DA 3SJAA 2APJA 3QWIA 3N2KB 1JFVA 1SL2A 3WYFA 2PYLA 4MINA 3KZ1E 4FWRA 1Y34E 3AZOA 2Q7XA 3CWCA 2VXBA 4QJ5A 1L4GA 1NT2A 4LGVA 4WJKB 4G4JA 1JQAA 2FHPA 2ZYTX 5C5EA 4YYZA 1U0RA 5TKWA 2EFJA 1QO9A 2XT0A 1HX7A 5EOYA 4XGQA 2F3SA 2DQKA 4NS1A 2HIAA 3SC2B 3KV3O 1FJHA 1TEVA 3TRJA 5T6BA 2P3SA 4AF8A 2QX4A 1T2UA 4M0PA 2B4KA 1W4LA 1K4MA 1A5AB 3P32A 4PLPA 1R3UA 1Q14A 1PWZA 1E2FA 2ZYDA 1EDDA 1F2TA 1QR6A 4KB1A 1TIBA 2DGDA 3BXEA 5JADA 1CT9A 3NGYA 5CXXA 2C97A 3MTDA 3QEVA 4AG6A 1E8DA 3ADKA 1M2JA 3U4IA 4AZ3B 3GZNB 1DZIA 1NULA 3K4QA 4R5MA 2VBFA 4CECA 3FSEA 3GRKA 3QW2A 2Q3CA 1DRVA 1EUQA 4NPHA 2DCMA 3F6RA 5FRNA 1E5QA 4TRMA 4UHBA 2AZTA 3NH2A 1EH5A 1GL6A 1ZGBA 2O8EB 5EJ6A 3WK9A 4EB6B 4CM8A 1VQLN 3SLCA 3V9ZA 4BWVA 2BHLA 2NVUB 4GKJK 2D1KA 2A1RA 4JC4A 4R01A 1CQIB 4IGIA 4GWKA 2CCGA 4RY2A 3EVNA 5H70A 5C8YA 1P72A 4KIJA 4CUKA 3K4PA 1Q1BA 3ID6C 3S2IA 3VU8A 1SZCA 5DP2A 2LIVA 3CONA 1O0BA 2TMKA 1W7AA 2HDOA 4B3BA 5G1NA 3K1AA 5JDIA 3LRTA 3TTTA 4YAIA 3RSZA 3IKTA 1VGRA 1X1TA 5E9AA 1C3LA 1U8XX 5I4CA 3E2MA 4CEDA 3GO4A 1QH8A 2YY5A 3V8VA 2TSYB 3V32A 3LXRA 3RASA 3NXKA 1DFHA 1RFLA 5JVDF 4MOWA 3TQRA 3QO9A 1QG4A 4J29A 2NUTB 3FRHA 4C07A 4YGYA 1TYCA 4KNVA 3ODPA 1II8B 4WOPA 3AR3A 3FUWA 3STHA 4TL6A 1P6QA 1VK0A 1JXAA 3VQ6A 3O8OB 1KRWA 2QJWA 3CJCA 3PG5A 1M5UA 4M1OA 5DTMA 3TAGA 1VBFA 5DNWA 3MGGA 4DBLC 1LW6E 3LPAA 1KDOA 1VCIA 3A26A 5IAEA 1IK4A 1THTA 3L1KA 2D0OA 4O2RA 4I3FA 1N5OX 4JZYA 3NALA 3B1FA 1YDHA 3PXEA 4II3A 1UFRA 2FF3B 4OY3A 1SY7A 3F7MA 5J5CA 1E2PA 1KXZA 4CU2A 4UQOA 2VDQB 1BH2A 1ZKMA 2GJ9A 1O6FA 3O3OB 4DLTA 4PRYA 4O5AA 2DX7A 1VBKA 1UBCA 2C9CA 1E4GT 4XIFA 4G8BA 2PMEA 4IJAA 1KI9A 5HMLA 1M2HA 3P39A 3HJGA 1NNSA 2FFQA 5CX1A 3ULDA 2P1ZA 4WESB 2QX7A 4WNCA 3CPSA 1L7EA 4EJ0A 2GD1O 2JI4A 3Q5DA 1DAGA 4F3RA 1IN5A 4L73A 3QEMB 3U48A 3QOXA 4LFBB 1XWLA 4GXNA 2G77B 3WYBA 2GYYA 5EPUA 1VQ9N 3K20A 4C4PA 3QLUC 5PGMA 2H17A 4LZLA 3TKLA 3DM2A 3KTAB 1TKCA 5I7AA 4P8RA 3L0QA 5K09A 2B9VA 3HS3A 4G4SO 1CUAA 4EDHA 2EW1A 3ADDA 4H0TB 2R60A 4JI8K 9LDBA 1ZXBA 1UJBA 4Q9IA 1LVHA 3IULA 5K20A 4J3NA 2CNNA 4RE6A 4H15A 4IQ0A 1CRPA 2YN0A 1I36A 2WICA 1DAPA 3KSDO 1AKRA 5L8VA 5HCIA 4MKXA 1B6RA 1YD7A 2GNAA 4L8FA 2P4SA 3AM5A 3V4VB 5A9SB 2N75A 4Y1RA 4JITA 4KHNA 3FCSB 3RYTC 3FB4A 4HFNA 1ZYQA 3HBNA 4AHRA 3WL3A 4CIEA 4D8YA 4KI4A 2PLWA 1MC5A 3AV0B 1A9RA 1NUUA 3A10A 1GGJA 4RZXA 5C46F 1XDZA 4RHFA 4HWGA 4CKBA 4UBNA 1YDEA 2I78A 3NHUA 1M6NA 3WMFA 4BAZA 3OMLA 1A04A 4WQMA 2RG1A 4EKDA 1BGWA 1DIRA 4HN4B 2G8FA 2OZSA 2C84A 1SVSA 3EIQA 2ZJ4A 3V1MA 1NQ5A 2JGRA 3N4QA 4KODA 2OBYA 1FYEA 2HDWA 1J9AA 2ZCUA 4WXEA 3ICCA 2ZQYA 4EHHA 2DUJA 3VQTA 3IPLA 4BTVA 1MAWA 4UHKA 4B35A 3J80O 5K0SA 3WL8A 1AV6A 2WT9A 5T4EA 3C95A 1QBGA 1TAUA 3D2BA 3LKDA 1WXIA 5DX1A 5JDCA 3SI6A 1U7OA 4HTFB 3ZBTA 2A35A 5J63A 1PJ2A 4DSJA 3H0EA 4DV5B 4L27A 1A69A 3BH6A 1X14A 2PUHA 3U09A 4EO7A 3WLFA 1A2KC 5BNWA 3U9DA 4FWSA 4BFLA 1XVTA 3N0XA 4XYGA 2O0MA 3KQSA 2QXUA 1T8YA 5NULA 1ICEA 2OV2A 1EVKA 4WXYB 2JLUA 4UJ3A 2CFCA 4FZRA 1FF9A 2Q3FA 2P78A 5FH9A 2ZS9A 2F1OA 4XWTA 3ENKA 3CKLA 4KVGA 4WK6A 3AVPA 4PXYA 1O94D 2BGTA 1RPTA 1Q83A 4MUFA 1UZNA 5BYKA 2JCSA 5TQ0B 2Y76A 1Z35A 1M1YA 3TZHA 4FFSA 4F56A 2RKIA 1CEYA 3IVGA 2GAIA 3PZBA 1E3MA 1SKMA 2LDXA 3EXFB 2AKYA 3AA2A 4TKMA 4I8IA 2P77A 1PG5A 3AXTA 1DIBA 3WZMA 3QUAA 1I3MA 1UL1X 3L7CA 1NJYA 2PUGA 3L3VA 2ICAA 3C6XA 3H65A 2QN9A 3SPZA 3MINB 4QDUA 1V35A 5LB2A 4EMBA 1X94A 5ALGA 1N2GA 1H22A 1D9FA 4UOQA 5J2MA 3RRHA 4PQEA 3EPLA 4JAVC 3CX6A 9LDTA 3M34A 4CM1A 2VJYA 2ZE6A 2O2YA 4CBWA 3AVMA 4CCHA 2JEOA 3WHPA 4MVJH 2PNFA 4TTVA 5AVUA 2XYGA 1EWQA 1YT5A 3OE1A 4ZYUA 5BWBA 2BEUB 2G1UA 3SF0A 3QPCA 3G2NA 3I30X 4JFAA 2AR9A 1LI5A 4JHDA 4PQGA 4P7BA 4DMFA 3DLEA 5CJ2A 1NLYA 5L51A 1E1RA 4YCBA 5CM2Z 3D2FA 1NVMB 4GMJB 2HMAA 2POCA 3ADOA 3H5TA 3M83A 3FCYA 4M1MA 1B76A 3D3WA 4D79A 5C32A 4IV8A 4EF6A 2OK8A 5LQUA 2WJJA 1NIPA 3TE7A 3ATUA 2WP8J 2QE6A 4MWSA 2W2NA 3NWOA 2VSYA 1YOVA 3LIPA 1IC6A 3EASA 4CHPA 2B30A 3HI6A 4LYHA 3DKIA 5JICA 2WD7B 4FOSA 2Q3EA 2F3RA 2QLFA 1WZCA 4EYQA 1LZLA 2IF0A 2LKDA 5E2BA 3GFGA 2VA8A 1AF4A 5HZKA 3ZYZA 2DHRA 2OYSA 2G67A 2DY1A 1G9TA 4C76A 4LY7A 3GJZA 4URHA 4BQFA 3S5UA 3ZT1A 1I7QB 2V0NA 1QRDA 3FMPB 1ORWA 1IWBB 1YA8A 2VQFK 4A6PA 4W5QA 1HLGA 4YAOA 3VJLA 3I8BA 1JHAA 5EP1A 1HORA 3ND8A 1W2BM 1BX1A 1XVUA 1JIJA 2OCBA 3LPDA 5DN6D 5B1IA 5ECGC 2BMJA 2VDOB 1G66A 5B3JC 5JFGA 3B8EA 1XXHE 4W5HA 5BXQC 3TPQA 1VSTA 1LTQA 2P3QA 1KZYC 1E7SA 4X91A 2PRIA 3RSQA 2V3VA 1ZJZA 4JBYA 1KL7A 4I6JA 4YR9A 2BRUA 2BBOA 5T57A 3W5BA 3OICA 4QOFA 5CGZA 1HT1E 1JJVA 5AVJA 4DA0A 3H1PA 1RM5A 1T8UA 1ZO8A 1CJUC 1BDHA 5C2FA 4NENB 4XIYA 3S3NA 4DZZA 5HRCA 5KPJA 2FG7C 1P2DA 4FB5A 1KOFA 3WIBA 4XJVA 3I5MA 1NE2A 2F1IA 5D3MA 2YNFA 1WVGA 4DCOA 3ESBA 4AQDA 4CKWA 3BCHA 3MAQA 3P2YA 2WKPA 5IDYA 4QOSA 3ZZ0A 3V1QA 3JCZA 3UAGA 5EZSA 4NBLA 4MFBA 3IJRA 1CK4A 4YFVA 1H6AA 5EYPB 5DHRA 1GPH1 1ZCFA 5JO9A 4KFCA 4GMGA 2QRMA 2HW8A 1CEEA 4S0ZA 5AM3A 4CKZA 2A33A 1BIUA 2CBGA 2B1RA 1M2VA 4A61A 2Y9PB 1UBKS 6NULA 1QE0A 3SVLA 3DLHA 3LF1A 4HRAA 1AKYA 3LP3A 4BRWA 3H1QA 3RT7A 5AH0A 4LXQA 2WSIA 4FYHA 1J24A 3QVXA 1CETA 2JK1A 1BH6A 1WBJB 3RK4A 3QP9A 3PO5A 1FNMA 4Z3KA 3MXMA 1DHRA 1KQSM 3OMWA 1I2AA 3HI0A 4DV3B 1D5CA 3LWLA 4H0NA 4QFCA 3BB1A 4M3UA 5GIPA 1LV8A 4MS1A 1F2UA 2XUFA 4I4TB 4IOXA 1Z34A 2O7SA 4IKPA 2RI1A 4G0NA 4D3XA 1UBHS 4GICA 2Y1OA 4N8DA 1TFRA 1O8CA 5DYYA 1CYEA 1U3TA 1PQPA 2HWUA 1SUDA 3K15A 4BY9C 1UWKA 3TSYA 2C9BA 1P4SA 2CL5A 1RAFA 4B3RB 2M1XA 3DT6A 4H08A 5FWNA 3QE2A 1TCCA 4M7WA 5EN4A 3JV7A 3TVDA 4HD8A 1NJWA 1VB3A 3ZU5A 4X60A 4KNWA 1XP5A 3U7EB 2JARA 4JKGA 2E6LA 1ZM3A 1FUIA 3GRVA 4E1BA 3ZVRA 4GOMD 3IQGX 1IHDA 2G5PA 1FP2A 2XHBA 4IXDA 3V4ZA 5DGIA 4ZQEA 1XK6A 4P4SA 4FPAA 4G8JA 2MSKA 5GINE 4ZYZA 3EXIA 1FPQA 3RSSA 3U7FB 4W5TA 3U17A 3KXLA 2Z1GA 3MWYW 1CNEA 4BR0A 1KJNA 1JTVA 2IXTA 3LUKA 1OC2A 1FFWA 4QJBA 5DPMA 1ID8A 4F46A 2JJ1A 3ZSOA 5HS4A 2RONA 1ORHA 4A92A 2WWHA 4NBSA 5HIMA 4O4JF 5KB3A 3G71N 1GYRA 4AHSA 5K3FA 5L3QA 4XX0A 1QQ7A 4YRAA 4ESVA 3A4IA 4YCCA 2WPNA 1T13A 3VR5A 1VRVA 1YNSA 3SXPA 4FYJA 2WV7A 2OZEA 1M76A 3O84A 4BNDA 3L7KA 1HDCA 3RSHA 1FEZA 2DUNA 3TAMA 3FLCO 3VENA 2C3UA 3D8UA 4BVOA 4KQWA 2IXFA 2Y1IA 4GNRA 5BRAA 4B32A 1H94A 3HUUA 2D3TA 4RJLA 4KFBA 4KXNA 5GMOA 2QNIA 3HCRA 1F5SA 4AQ7A 1Q18A 1U6IA 3D4NA 2GWJA 2FWPA 4JJGA 3ASVA 4KE9A 5CFNA 5F64A 1PSZA 1LDNA 3GT0A 3ZJUA 4C6HA 3T7ZA 3EWSA 3OU2A 1XUOA 2I67A 1KU0A 4NOMA 2WBLC 2YHBA 5C35A 1GTL1 1Z4JA 3CVYA 1IEVA 2W22A 5LMUK 2IUYA 4IHJA 4ZQBA 1M0SA 4K1XA 1A95A 3LAMA 1BW9B 4LC9A 2HC9A 3C3PA 3UJDA 1GTSA 3TRIA 4TLCA 3K0FB 4UXIA 4WZAA 3O74A 2P65A 4TMTA 4J75A 4L57A 5HOOA 5AD1A 2GN2A 2J0SA 2CL0X 3I28A 3BXXA 3EQ6A 5GZ6A 4XFJA 1CULC 2PX8A 5AM4A 3BFXA 4EHLA 1EFRD 3T9DA 1VPVA 4ILEA 3VNSA 3UF0A 3D6RA 4FOPA 1VI5A 1L7PA 1HSZA 4RAOA 5DP1A 3CMMA 2BE9A 2X4IA 5ICSA 4X3CA 1SL1A 4RXTA 3L8MA 5EX5A 4MCHA 3H2ZA 2CH5A 3MRVA 4WD3A 1PLKA 1DKPA 2LBPA 1CY2A 2UZ3A 2A57A 1P5JA 1K86A 2ERCA 1IMOA 2GPTA 3S1LA 3NDIA 2J45A 3SN6A 4C7VA 1VG8A 1FMJA 4UXHA 1DAKA 1P0QA 3CPHA 1FXXA 4ZWNA 3RRJA 1Q91A 2YWJA 2E6MA 1V8OA 3U3DA 2EYQA 3DOHA 4MV6A 2REQB 4N40A 5MFZA 3V1KA 4F5DA 3JS5A 4RX1A 3KTDA 3QWHA 2P8SA 2BEVB 2IYNA 4ZZ2A 1FW6A 3OX3A 3MEQA 3SFZA 2D5AA 5ALYA 3OT5A 1VE9A 1Z75A 1BAPA 4R1LA 1SZJG 4XVCA 2HY7A 4WCFB 3SZRA 3H45C 1RVV1 3M5CA 2WTNA 5PNTA 3K3PA 4WY2A 2WWFA 4I9UA 5DFAA 5KNDH 5KDOA 5F7JA 4YPVA 4JX9A 2R00C 2P9IB 1BQMA 3HXMA 4Y6LA 4NMXB 5TMBA 2I3DA 4ENTA 1QM5A 3FMVA 1I1OA 3EZXA 3G25A 4CL8A 2OAEA 3U0BA 3P9PA 4Q3EA 4FR0A 4Y9UA 2M6KA 2X5OA 4MRPA 5DWQA 4GR9A 3O8CA 1PJLA 3HPHA 5JMPA 4LOKA 3B13B 3MMVA 1H2AS 1HLFA 2V8OA 3HDYA 3C15C 4ZARA 2OA8A 1YS9A 2GPSA 2ZUDA 3HOSA 2QM8A 1RXUA 3MK31 2H1LA 2EIHA 1Z6AA 2E9SA 4TXMA 3TLGA 5IM4A 4NYJR 3OTOK 4NV1A 2G40A 3GJXC 4IOMA 5GPBA 5JAQA 3D0QA 4Q05A 1RBUA 2DKNA 1FRVA 3QYAA 5C7OO 2D5RA 5HXAA 3HSTB 2COUA 2JFVA 5LUAA 4XB1A 3EIHA 3HR7A 2CLFB 3UXHA 2A5LA 1RQGA 1C0KA 1L5QA 1UZAA 4YAJA 3ED1A 2Z2XA 2ZYGA 1N0VC 3OJLA 3CM5A 4B7AA 4PZAA 1W88A 4FJ1A 5DCUA 3L1HA 5LXTA 4TGLA 1RWWA 1YJXA 1NUSA 5DM6L 3CCSN 4XEIA 1U1EA 4JROA 1KYYA 3EEFA 2ZYIA 2LGJA 4CMEC 1NM5A 3JQQA 2FX5A 4JSTA 1QCDA 1G1AA 5B12A 5JAIA 3PDJA 2IYFA 3NO4A 5EJMA 3GP5A 3RUPA 1OZHA 3DT9A 4TLMB 1ZI9A 5IRCD 3LQRA 4PX3A 3I2IA 2PA0A 1RDUA 2Z2ZA 2JCXA 1EVEA 4IXCA 3CLSC 2FRDC 4EHDA 2X3UA 4RKYA 3QQPA 2P11A 2HB5A 3HNPA 4IIEA 2CLSA 1I6MA 1Y1PA 2X3FA 4B6RA 2XOXA 3ENOA 1RZRD 1XA4A 2YIVX 1QE5A 3AKEA 4WNIA 3D02A 2PSSA 3HDHA 3IDQA 1Z0AA 1K66A 4DCPA 2K2WA 3ADBA 4OUKX 3FSGA 3FWYA 1EVIA 2QRPA 2Y0EA 2H4FA 1U6JA 5AIAA 1T05A 4JLJA 1IRXA 2CLCX 3M6XA 4L02A 1NYRA 4AHTA 3B82A 5AVWA 1TUBA 1XAJA 2A94A 4H60A 1CRWG 3ENBA 1RMQA 2RGUA 2GK3A 1FPMA 2HYIC 1MC1A 1SZ2A 1QVRA 4MB0A 3G2PA 2ZETA 5EJ5A 4M0UA 4DLWA 3X1XA 1DWPA 3RROA 1TL1A 1HKUA 4ZCIA 4JA2A 4ETWA 3PBKA 2IHTA 2NTVA 1K88A 3SQOA 3MCAA 2W90A 2B78A 1JFFB 4JI5B 3LUCA 2DFFA 4KSYA 1M1YE 4I9QA 2WWTA 2G9RA 2X0DA 2QI9C 3VAYA 4TUYB 4DB3A 3HFSA 1DTEA 3ZOKA 4LDJA 3T61A 3WXMA 1NNI1 2OTCA 4NXNB 5KNCD 2CFIA 2Z5LA 3U7QB 2RHCA 5HTKA 3GLTA 3NOQA 5IT9O 1KPGA 3HWSA 1IDN1 1SKRA 4CJ4A 3I09A 1GPUA 3WLQA 5FA6A 1QGUA 3BB4A 4WBNA 2JJ2A 1E6CA 1XRMA 4NJEB 1LH0A 4R5HA 3IP5A 2ZOSA 4GYKA 1YK0A 3ELDA 2B61A 2ZB3A 3STUA 4EFMA 3OIVA 3W8DA 1L7DA 3L7LA 4FCTA 1UC9A 1LK5A 1XMJA 4ZVRA 1C0UA 3TZQA 4PAWA 3NH0A 1U6ZA 2VK8A 3I62A 4O44A 2CNBA 3JSAA 4NYFA 3Q3GE 3UGJA 1KP3A 3X44A 1PFQA 1JE1A 3TZBA 4MWBA 2A1TR 2XUKA 3MAJA 3EMVA 4FLUA 3F7NA 4IVRA 4LHSA 3GLVA 1U2PA 3WJ1A 3RS0A 1QLWA 3DZFA 1BI4B 1OLXA 1PHRA 3VQ5A 5KVQA 5D8DA 1ZWLA 3KOUA 1M6EX 1HNWK 3ANLA 2C8JA 4MLDA 1RRFA 4B6JA 2AFVA 2JHFA 3TW8A 4A27A 2P9CA 5EWJA 5EE5B 5LJIA 5G1PA 4C7MA 3NOOA 3Q12A 4XGIA 2VTEA 4XGRA 5EL0A 5JS8A 2NX2A 4A0HA 4K8RB 2EWWA 1G5HA 4HLUA 5GOZA 1NAHA 3PGKA 4CUJA 4ZO8A 2D0PA 3MS4A 4OFZA 1F8XA 2EG9A 2EF0A 1MJHA 3H5WA 4EHFA 1M74A 2ZUSA 4BRNA 1RXWA 1EXMA 1XEAA 1TM3E 3RWUA 4CBXA 3B51X 2CY0A 2NYUA 1Y89A 3HNOA 4FONA 4W1QA 1SVMA 1NVXQ 3RJTA 4H8KA 3D4OA 1V41E 3JZFA 4I19A 2D59A 1J5OA 1HM5A 5GJVC 2I3BA 5IUNC 4ILHA 3VZSA 3P27A 1LD3A 3KAKA 3ZWQA 3EN0A 5JYEA 5H3LA 1QRUA 1IUOA 2UKDA 3EO3A 2VYPA 3DO6A 1UBFA 1YS4A 2ODEA 5BNFA 3AWDA 4Z54A 4DM4A 4IXWA 1DBPA 3ZSZA 5DTQA 1G0OA 4MVJI 2HSGA 5IZCA 4CEHA 3G0BA 4DTOA 4BMVA 4FJKA 4PHGA 1YIOA 2YUTA 2W6NA 3KXKA 5JY1A 3CSDA 2V7WA 5LQDA 2DE0X 4O0IA 4GVPA 2ZBQA 1Z4NA 3VNUA 5HRPA 1INLA 3R20A 3PPIA 1ISSA 2Y0DA 4U39A 4PL7A 2X13A 4CLOB 3HTXA 1RSZA 1BO5O 4JBHA 3QMPA 4HCBA 4W1PA 1SUQA 3ZDYB 4AI6A 3RREA 2Q5JA 4CFAA 3IQIX 1NF2A 3PUYA 1H1LB 1Y1TA 4BQQA 4HAWA 2PUVA 4K2HA 1OAOA 1ZL2A 3CF5L 1IQRA 3UK1A 1T15A 1RP7A 5P21A 2PJUA 1FOEB 4NARA 5TSDA 4M1ZA 3ZQKA 3PD0A 1BEEA 2O2GA 4CJXA 4JJ7A 1KP9A 2OBXA 3PUWA 4O4HF 2IITA 5EJ9A 4Q4HB 2VLBA 5FTMA 2AXEA 1ZVVA 1ENYA 2V6JA 2GLUA 3DLBA 2PZ8A 3A4TA 1SHKA 4RS3A 2YHXA 3GEEA 1LAVA 4Y9TA 1KJQA 2XXBA 1BXGA 5BW5A 3G3EA 1ZXOA 3EEBA 3SAHA 2VSQA 1H6CA 1DTQA 2IL1A 5DTEA 4ID3A 2YS7A 2HOEA 1PR0A 4DCHA 4DQPA 2BFMA 3WO1A 3O4IA 3WB9A 2ZSBA 1SC9A 2IS1A 3T7AA 4Q18A 4GGOA 2XUZA 3C97A 1JEOA 4DOMA 2NO5A 4L6AA 2WP0A 4PA1A 4LI0A 1W36B 1D1TA 4RENA 4JLOA 1A4RA 1LC0A 4Z4HA 1E7WA 2P90A 4Z3DA 2Z4SA 4L28A 3AO0B 3EH2A 2RHHA 2D06A 1AKWA 3HN6A 2CFOA 1NUTA 3HSKA 2X78A 4WZ6A 1OYOA 3V1TC 1L5KA 3UENA 2IYTA 3C1TA 3H04A 5F5LA 2BR4A 2E4XA 1T3GA 4KHPB 2LIPA 3VF2A 4DLSA 3M4ZA 1B41A 4H0PA 3OWHA 1THZA 2Q45A 3UAYA 3LK7A 3L06A 5SYAA 4IEEA 1RE0A 1BQNA 2WTUA 1DJLA 4MWGA 4JJEA 5EFZA 2ESRA 1OQAA 2CGEA 1DKLA 3O4WA 2P2ZA 4JBNA 1NXVA 3L8FA 4OXXA 4UUMA 4UQGA 1IFXA 1PAUA 4R0NA 3P2KA 4PPGA 2FPIB 4M8LA 1WMBA 3EXHA 1J0CA 4RGBA 3QMLA 4JNEA 4ZT3A 2W6OA 2QKBA 3S40A 1BHO1 3GEIA 3OZWA 2OHIA 4KWIA 3O7MA 3CEMA 3PDHA 1QHHA 3JWIA 2ZREA 2W11A 1M1UA 4GMXA 1N3BA 2YX1A 3HT3A 1MAUA 1IEWA 4KUGA 1QIJA 1PWXA 1NNUA 5D3KA 4CF0A 3TIXB 4EH1A 3W5IA 5FTWA 5B4TA 2JC3A 4QSMA 2GQ0A 3HLYA 2YMPA 1NLZA 5JSUA 3C7TA 2J5BA 3T1VA 4M0CA 4KYVA 1ZNYA 3TTDA 1H6BA 5DEOA 4P54A 5EEHA 1P1FA 3P71T 1K8XB 1DEHA 5KTTA 1SAZA 2MYNA 5IT0A 3VF6A 2I66A 2WTBA 3LUPA 1RCHA 3LCVB 1B6TA 4OBXA 4QLBA 3UOAB 2JLYA 4YRBA 3PGA1 5LPNA 1Y7IA 1K6YA 1ZM4A 1M54A 2PTHA 2GEUA 4LS3A 5JMTA 2PWPA 3KJQA 1LLCA 4HR7A 2WYWA 4WZAE 1XQWA 1P3Y1 3G9ZA 5CLQA 5BV8A 1V16B 4MIKA 2CGLA 1WULS 1S8FA 3BMOA 3T41A 3UT5B 3NHKA 3MWDB 3QF7A 3IT2A 1QS0B 1UF9A 4NYMR 4U1RA 2P91A 3G2OA 4RY9A 3V2IA 3ONDA 2C94A 2A9KA 1L8QA 4G07A 4FCWA 5E3IA 1P7WA 1JSCA 1WY5A 1ABBA 1MTZA 1PFWA 5TNXA 1QZZA 3SS7X 4CIAA 1FIUA 2FPKA 1G8JA 4P3YA 2H1SA 3AM1A 4Q7LA 1E1KA 3TUJC 4N47A 3A4LA 5IJWA 3ZSQA 2W6ID 3UAZA 3N8HA 1S3GA 3UKUB 1IZ7A 2ZXFA 3I0MA 1W5AA 4C1NK 4OM7A 4NBKA 2QUKA 4YT8A 3KQMA 1F4PA 4V2IA 3UWDA 4F3YA 4C21A 4FJ0A 4RK6A 1L5SA 2VNHA 1DO2A 2B4QA 3NRBA 1C7EA 2WLTA 3RF6A 1IBLK 1PR9A 2V7QD 1S9DA 1EX7A 2ZRLA 3NT5A 2XTJA 3ZT3A 2HHUA 1ORDA 2CNKA 2ZLBA 1GV1A 3R7WB 5GY7A 5ELLA 1BWSA 1GUFA 5H59A 4YT4A 5BR1A 1JGTA 3TANA 4M0KA 1B23P 5C0OE 4IDOA 3OQMA 4PFKA 1SCJA 3WFIA 4Y30A 3CVXA 1K5PA 5IASA 1H2BA 1JBKA 5BN9A 4EG1A 3T19A 5LMNB 3FKSA 1L4FA 4RD1A 1PE0A 4EO4A 5KYKA 3V7FA 2IYEA 2V7TA 5CT9A 4KI7A 2FP3A 4IMJB 2ZDHA 1VSVA 5FEMA 1DG1G 1JLAA 1IVYA 2XAAA 4ILGB 1Q86O 1GR0A 4R7TA 4ARIA 3C5WP 1YS2X 3KLEA 5P8WA 4QBHA 4E7PA 1SXPA 1UKBA 1II9A 2ZBUA 3P9KA 4C0LA 3CVJA 4WJLA 3A9RA 3GRCA 4F3TA 3EG9A 5K0EA 1AXGA 1K27A 3R7DA 3MXIA 2MSWA 3ZWVA 4DLBA 3NAMA 1V6AA 4QQKA 1X86B 4LJ5A 4EFHA 3LDNA 1BWQA 3DUFB 1GO2A 3ZCMA 2AXPA 4GM0A 4ZYYA 2PUEA 2XVXA 1M67A 3U3KA 5HG0A 4Y8VA 4B4WA 3GA0A 4DFMA 5E7QA 3ULEB 2A9RA 3T1YK 1EGMB 2B0CA 1GA4A 4UU8A 5T64A 4CEBA 3VHQA 4DARA 1SBTA 3TOCA 3LX6A 1XA3A 3HXLA 2JKVA 4Q4JA 3OYMA 3ZCUA 1CZ9A 1B2LA 1OH8A 5DE3A 4HDMB 3T3HA 4FC6A 1VRTA 4DUGA 1HT2E 1A8UA 2FMIA 2VF7A 1XVVA 4LSLA 4G41A 3FR7A 1MNAA 3SCZA 3RKSA 1VIMA 1Q11A 3GMDA 3RVPA 1U2VB 4BVPA 1P2FA 5ERYA 9ABPA 5JZSA 4F5ZA 1JFTA 4PXSA 1XMOB 2NSYA 2B8EA 3A7EA 4AKIA 1U28C 2Q41A 2FPWA 1CJVC 2X2OA 1K73O 4KQXA 1B14A 3C3JA 4WQ4C 5TARA 3OYJA 3AUTA 4JKIA 3Q8MA 1U3FA 1M1XB 2QX6A 3IEXA 4P22A 1VB5A 1BYUA 3JWEA 1RXVA 3H46O 1UKEA 4AD8A 2DPLA 5TF0A 1CZHA 1LBHA 1WLYA 2RBGA 1B16A 3FPLA 3PGVA 4FL9A 5FUQA 1UPFA 4RVNA