2BGGA

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt sirna duplex.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMEGTKVKLSSKRYLLTLLQPYVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Mrna Recognition from a Piwi Domain-Sirna Guide Complex
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna-binding protein/rna
molecule keywords PROTEIN AF1318
total genus 134
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2bggA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bggA01
1BQNA 3S99A 4FLUA 3CFRA 4ZHRA 4B9NA 1XWWA 4KB0A 3NHGA 1C6VA 3LP2A 4DF8A 4DTRA 3K5OA 5TQ2B 1SL1A 4MGEA 3KLGA 1RILA 2YKMA 4PY5A 3LKVA 2HHSA 2E4UA 2FLWA 2GKGA 4FM0A 3NGYA 3NCIA 3TX6A 1Z18A 1VRUA 4MQEB 2E4LA 1M5UA 4MPTA 4F3OA 2KYRA 3OLWA 3ITHA 5HRSA 4KFBA 3OLYA 1T8EA 4OG2A 3EULA 3IP6A 1P8AA 1FFGA 4M3YA 1JFSA 1A0OA 2OZSA 1RCHA 1ASUA 1HQUA 3VQ9A 1L3VA 4O4GA 3HEBA 5EWMB 5E41A 5CHYA 2JVJA 3QLHA 2HHQA 4HYEA 2ATQA 4FVMA 4CJPA 1VSFA 4MQFA 4DQPA 4S05A 1QHTA 2Z1GA 4CBVA 5JNRA 3T3FA 4DF4A 3KYJB 3FGZA 3C6UA 3H1EA 2GBZA 4ID1A 3MEEA 3AVCA 1KTQA 2DY4A 3KLNA 2RPIA 3KSMA 3VQ8A 4CJTA 4CHYA 4FLXA 3IPCA 1S1WA 2GI4A 1C0TA 4L85A 1S5JA 2R25B 2JCGA 4WZZA 3SAJA 2QXFA 2D0CA 3QEMA 4ZYLA 2M98A 5EWJA 1TGOA 2F8SA 1DCFA 1WSGA 3ZSXA 2FBVA 2ZWMA 3QLTA 3N0RA 1EWTA 1RT2A 4OGEA 5K14A 5HKOA 4XARA 4EZ6A 1C1AA 2O4IA 3RVJA 5KC9A 4KO0A 4N76A 3CFPA 2OPPA 2HNZA 4RXUA 4FJHA 3V9UA 1A5XA 2G8FA 1QO0A 3QNOA 2WY2D 1NOYA 4ZJPA 4BDPA 1TL3A 3L6UA 3LUCA 3L3VA 3LUHA 2W42A 1ABFA 3FMVA 2A1RA 4RW4A 1CHNA 2OA8A 3RVLA 2JRLA 3TAEA 4E7KA 1F21A 1DRJA 3OS0A 3PX0A 4DSJA 3FFIA 4F06A 2FQYA 4DTJA 4F11A 3CU5A 3EODA 4DFMA 3MYYA 5EWMA 3OYLA 1BCMA 3HZHA 4DTNA 2DTUA 4RZSA 3AVGA 2FQXA 1QSSA 1E6MA 3SV3A 3SG0A 2D0BA 1RZRA 3HO1A 5J2PA 2FLKA 2E6LA 4FJNA 1P2FA 4CF1A 3WNGA 1DTQA 1BAPA 2ZD1A 3O3GA 2QK9A 3Q7SA 3HT3A 1QQAA 4CFBA 3P83D 2B1JA 3Q9SA 3K4HA 4H3HB 5CNIA 3BRQA 4EP4A 1IG9A 2IS3A 3ILYA 1C4WA 3CS3A 1TKDA 4FJMA 1KVCA 5C42A 1U04A 1JLCA 5BR1A 4LY7A 4Q5VA 2WJWA 3NAEA 4E89A 1ZAYA 4I9LA 4MR9A 5JNUA 3PO5A 4RK7A 2HHXA 1Z17A 4NCAA 1KRPA 2JVKA 4PZ0A 3V1RA 4C8KA 3B6PA 4FE4A 4ICLA 5DCLA 4HNSA 3TAMA 5FWYA 1Z26A 2Y1JA 4H4OA 5HP1A 4IRXA 1B00A 3ZSZA 4CECA 4RXTA 2HB5A 4KV8A 2P51A 4EYKA 3TMYA 4WE1A 2E4YA 2PLNA 4KRFA 3SUNA 1Z12A 3N53A 4FJ9A 4C8NA 4B9SA 1KGSA 2PUCA 1VKRA 1J56A 4JRPA 2QKBA 4AHSA 3RVQA 5IEJA 2DFEA 1TKTA 3OS1A 2MYUA 2QU7A 3IPAA 2FBYA 1NK7A 3HPOA 3AVHA 4CFCA 4DG1A 3SPZA 1NJZA 4ELUA 1C0UA 2ITGA 3CM6A 1EX4A 3A10A 1G15A 4IGAA 3QLUA 4CHZA 3JYTA 3NH2A 5HRRA 4MR8B 4B9TA 1NY5A 5KRSA 2V0NA 1YMUA 3HVTA 5KQLA 1ZITA 3QERA 4DQDA 2VUIB 1IKYA 1YT3A 2B5JA 4CHOA 5EU7A 4F2SA 3SNKA 2G8VA 3EJWA 3OLXA 2HHVA 1BHLA 2HQBA 3MXJA 1L5UA 4RY8A 1Z13A 2PAFA 4Z4EA 3T19A 3ZT4A 3E3MA 3ZSYA 3FFWA 3TO5A 5IX8A 2IDOA 4CGFA 1C1BA 1P6QA 4CJ5A 3B2NA 5D2CA 4LE0A 5TQ0A 5CNKA 2ZE2A 1HYZA 1JHZA 3HDGA 3QLVA 2QKKA 3NNSA 4CJQA 1UDRA 4FJXA 1WSEA 3L2UA 5IBQA 4BE1A 4KVFA 3MQ4A 1DTTA 1RNHA 4DSKA 2D0AA 2HW3A 2OPQA 1NK4A 1HYSA 4MS1A 1LWCA 2KQ2A 3OQOA 3KD5E 2HVIA 3PUFA 3GRCA 3NNNA 3N0WA 1TAQA 3KLFA 4JRQA 4CJRA 2PUFA 3SJJA 1JDNA 3K5LA 3RR7A 4RK6A 4Z4IA 3DLHA 1ZBFA 2L19A 4KKOA 1BI4A 1SV5A 4KI6A 5F64A 3HL8A 3DOKA 4CE9A 1PEAA 4CJVA 4AHVA 2QSJA 4RDCA 1EXQA 2F96A 5TPZA 5TQJA 4IG3A 1NXPA 1KRXA 3GL9A 4KHYA 3AO2A 3CYMA 1T7PA 2PUDA 3A3KA 3QEWA 4CEOA 4B8AB 2R4QA 3ZSRA 4PWDA 3MA0A 3LDSA 1ISSA 4HUFA 1BQMA 1TK0A 2P1JA 2B6AA 1ZGZA 3GYBA 2HNYA 5TE9A 3VQ5A 2CD7A 2R7YA 4QICA 1XWLA 1KVAA 4E1NA 1RBSA 4IFVA 1NXWA 3H5VA 4DQRA 4DLEA 3CKMA 4RS3A 1E2BA 1NKBA 4FM1A 3O1IC 1MAVA 3HSTB 4RK0A 1JWLA 2HHTA 4LSNA 3DLKA 5FRNA 4CJEA 1XI1A 1ZH2A 3RVRA 2LUOA 4LX8A 6ABPA 4ZPJA 3L2RA 4MQ3A 1WSIA 5KQGA 1JX6A 4Z9AA 5KGWA 1NXSA 4H60A 1SRRA 4K8XA 4ZMSA 3OYJA 1FXXA 2X78A 3DRSA 4LH5A 1DBPA 4AH9A 2CHFA 2YNIA 1NK0A 4P98A 4KB1A 4KHWA 4M42A 4WUTA 2GUIA 3DGFC 2MYTA 1JXBA 1RTIA 3H5LA 3NF8A 4M3RA 3NDKA 3RR8A 1DZ3A 4YV7A 1TV6A 4F8JA 4HNRA 4KTWA 1ZBLA 2X6SA 1NATA 1D5WA 1EWVA 1NXXA 1U0SY 3O4NA 5CYMA 3AA4A 4YR7A 4CERA 4M3ZA 1MIHA 4TLMB 3IG1A 3DBIA 4XXHA 1UA0A 3B6OA 1JDPA 4DTPA 2PMCA 4KNYA 5ED4A 3CQ8A 2WONA 3U3GA 2XO7A 3Q41A 2RGYA 1K6YA 1WN7A 1JYEA 4FK2A 5FROA 3KTQA 3LAKA 3OYGA 3VQAA 1QMPA 1JL3A 3UIQA 4MQEA 3LUJA 4CGHA 3FFXA 3TAQA 4G0MA 2HVHA 4JA2A 4AHTA 4RSMA 4Z99A 2A9OA 1EWKA 1VRVA 1NK9A 1ZHHA 3W9SA 1D2AA 1GCAA 3GA5A 1GUBA 4KK4A 3BREA 1NJXA 3U3YA 4MRMA 1QS4A 2Q3SA 2LP4Y 4JS5A 5I3UA 3AO1A 4DSLA 2GX6A 1XC9A 1RBRA 3OJUA 1Z25A 4J2AA 1X9WA 3SQ1A 2KZZA 1C0EA 4H4MA 4KHUA 1ZBHA 4YLEA 3HP6A 3OS2A 2VG5A 2F8TA 4OBBA 3MXMA 1W25A 2D5RA 4IFYA 3LAMA 5DLEA 2X7XA 2FMIA 4KREA 2P5OA 2OENG 4EY3A 2LBPA 3HPGA 5HSGA 4E7PA 3D0PA 3M8PA 4FJ8A 1J5OA 1D5AA 4E0DA 3LMKA 3KTOA 3NGIA 3TANA 1NKEA 1D4ZA 2L2QA 2AJQA 4F4KA 1PNTA 4KZKA 2L18A 3F9KA 3H5TA 1VK0A 2QV0A 4RKRA 1JL1A 2FW0A 3BBLA 3V9WA 4M88A 4OLAA 4B08A 2QW1A 2YV0X 5B3JA 2HNDA 3OYAA 2CWDA 4CJLA 1TKXA 1A5WA 3F6PA 1LW0A 1RDCA 2N9UA 3QEPA 3EAFA 1SL0A 3AA5X 2IPMA 2B4AA 2E4ZA 4FJ7A 3ZT2A 3K57A 3KLEA 5I4CA 4BE0A 4CF9A 3K9CA 4LDAA 3E61A 1IKVA 3A0RB 2RN2A 3LPUA 4YGXB 3SY8A 1M2EA 1LWFA 4C8MA 1ZYQA 5BQ3A 3LUAA 4B9UA 4Y1DA 3M8RA 3EQ2A 4AHUA 3GV0A 4F12A 2HQOA 3O3FA 4HCCA 3A2FA 4W5RA 5FRMA 1T34A 5C5EA 1TAUA 1B9DA 3V81A 4NQRA 1S9EA 1BIUA 2WWVD 4DFPA 4RW7A 4LDZA 4K8ZA 2HSGA 3VQPA 4JB0A 1UAXA 1PHRA 4CJKA 1TVRA 2G8WA 4PUOA 4M3XA 3URMA 1S1VA 4FK0A 4OATA 3BRSA 3JTEA 1S1XA 1SXHA 3E01A 1BL3A 1EHCA 1GCGA 3SQ4A 1S1UA 3IS9A 4MYRA 1JLBA 4BDZA 3HXMA 3QNNA 4CGGA 3L2QA 4Z0NA 2RDMA 4I9QA 4CFAA 1GOAA 1SKWA 3C97A 3S3MA 3NHMA 1R0AA 3DI6A 1YMVA 2IPAB 1QKKA 4Z4HA 4OKKA 2LSNA 1TL1A 1RTDA 5CZ1A 4EVRA 1ISRA 1VSEA 3WNHA 4FJLA 5IUKC 2YHBA 4RXMA 3Q15C 3HV2A 4M3TA 4B9LA 4LD0A 1E6LA 4EVQA 3L2WA 3KS9A 4CJ4A 3LP1A 2KTQA 1NJWA 3OYKA 4CGDA 1WNSA 3M6MD 4G0ZA 5EWJB 3N8IA 3ZSVA 3O4QA 4QPJC 1LAWA 1D9FA 2PUAA 2IGIA 1W9HA 1YVUA 3MEGA 4YCSA 2A9RA 4OGCA 4TMYA 5GOTA 5TPWB 1W0HA 3DZDA 5B3JC 3SUQA 3KG2A 3NF9A 1T05A 3TARA 4ELVA 1QQBA 4OKJA 2FMKA 4PA1A 1R8JA 4XASA 4TN5A 4B8CA 1Z16A 4S04A 4OLBA 5KWSA 4YO7A 1GOCA 4CESA 3SYZA 1S1TA 4BDYA 1O1WA 5IUJC 1XHEA 1KFDA 1J9AA 2E4WA 5C5CA 1BDIA 3OMWA 3JPYA 3AVBA 4HNQA 3AVAA 4FYDA 5CY4A 2BANA 2IDMA 4DQSA 2BE2A 2P5GA 3OO0A 4FJJA 3ZSOA 4CEDA 3KKSA 9ABPA 4EGSA 3T95A 4MS4B 3OYDA 1TK5A 4KK3A 1QP0A 3AV9A 3T1AA 4FJKA 3HM9A 1VSKA 3HUTA 3OLZA 4O0JA 1IO2A 1QNLA 3QESA 4IDKA 1Z15A 4HVJA 2IYNA 1QP7A 3L49A 4G1QA 3U6FA 1RZRD 2IPLA 3I42A 1EAYA 1RNLA 4RW9A 4CJ3A 2QVGA 4I2PA 3H6GA 5IEBA 3KYIB 1LW2A 3NHZA 3NNDA 3HVRA 2A1SA 2Q5CA 1ZBUA 1L3SA 2YNGA 2WJAA 1HNIA 3KLIA 1BA2A 3VA3A 3O1JC 1IH7A 1DC8A 4NYFA 8ABPA 2GBPA 3M9XA 4GPAA 4JAVC 1YK1A 1QP4A 4Q0BA 1ASWA 4EYQA 1I39A 3VQEA 3OM1A 4PICA 4YRZA 4CK2A 4WT7A 1LAVA 5TPWA 3HP9A 2FMFA 5JNTA 3KHTA 4RY9A 1WSFA 2JGUA 2JK1A 2VG6A 1ZH4A 1BVHA 4DFJA 1USIA 4MS3A 1BI4B 3AO5A 2AYXA 1YS6A 1Y1LA 5BRAA 1TLFA 3L3UA 3ZT3A 4DQIA 4Z4GA 3G1WA 1QQCA 2AYZA 3CLKA 3V1QA 3RMBA 1DBWA 1DP4A 2GV9A 1VSHA 1U48A 4LE2A 4CCHA 4CEQA 3I45A 4G0PA 4ETNA 4Z0UA 1RT6A 5J2QA 4D6YA 3KKRA 3HJFA 3P9YA 3RMAA 2QXYA 2ZAYA 2LPMA 2JBAB 3TAPA 5I42A 4G0OA 4G86A 3IP5A 3JVDA 4KI4A 3JVIA 5SWMA 3SUOA 4DS5A 5C24A 2TMYA 1QSYA 3EGCA 1DCMA 1JLGA 4DU1A 5FWXA 1U4BA 5HBMA 1DJMA 2Z1IA 2FTKE 3SZ2A 4FLZA 4YFUA 3ASMA 3CHYA 3QIPA 3AVLA 1KCFA 4YS6A 4Y1CA 5DK5A 3NGZA 3JY6A 2XY8A 3MAQA 5D3GA 1XHXA 1NXTA 5JS1A 3CZ5A 3K2PA 1RTJA 4E7HA 4AHRA 5JNVA 1RT3A 1JYFA 4BWJA 4DU3A 4ELTA 3RMDA 3KKEA 3DLRA 5KI6A 1YS7A 4IG0A 1T03A 3QELB 1DLOA 2VYCA 3RVSA 4ID5A 4O0IA 3SUPA 3PY8A 3DYAA 1DC7A 3ISNC 4YNQA 1L5YA 5T7BA 2G8HA 3K5MA 1U2QA 4UHKA 3OYHA 4EZ9A 4CJWA 2Y1IA 1NOZA 4W5QA 3H1GA 4KMRA 4FJIA 3OYIA 3AO3A 4N03A 1YTUA 4KFCA 3SQ0A 4J2BA 4ETIA 3LKBA 1NK8A 3NH1A 4I7FA 4GW6A 4DWIA 3QX9A 3O2JA 4MLCA 1M5TA 3CG7A 1EP4A 4KV7A 1JBEA 1HEYA 1SKRA 4ML3A 2NUBA 4ZTFA 1X9MA 3QINA 1PNRA 1K68A 3P5JA 4HHTA 4LRQA 1TKZA 3Q7RA 4FW1A 2OZMA 2ID9A 4NV3A 2RF2A 1L3TA 1VSMA 4MR7B 1I3AA 2DFFA 3EQZA 4MS1B 2NT3A 2VUHB 1BCOA 4C8OA 2PYJA 2XDYA 4FJ5A 1GUDA 3C3KA 3SNNA 2XHBA 2OYQA 2BDPA 3OYNA 1MVOA 1RDBA 1NTRA 1F4VA 4Z9BA 1E6KA 2MSLA 2H0AA 3S3OA 3Q7TA 1TVMA 1ZGGA 3S3NA 3C6TA 1IKWA 4IMIB 2IC3A 5DGCA 2RJOA 4ETMA 1P6UA 2GWRA 2YNHA 3QEXA 4DU4A 3AVJA 3PX6A 4OPJA 3O3HA 3MMNA 3QO9A 4NCGA 1UOCA 1WSHA 4DTOA 4AILC 5CZ2A 1JF8A 2I6FA 4RKQA 1REVA 1ZDMA 3LUDA 2BGGA 1ZBIA 4BE2A 4NCBA 3HPHA 1J53A 2ETJA 3LWMA 4QYWA 4RV5A 2NZUG 2ZQBA 5TQ2A 2IAJA 3QLUC 3QEKA 2KFNA 3M9WA 1B92A 3LANA 3SV4A 2A9PA 2QR3A 2DRIA 1ZVVA 1ITGA 4RY0A 2FMHA 4UQGA 1EFAA 3VQQA 4GMJB 1RDDA 3D8UA 3KLOA 4OTZA 1FFWA 3ALYA 4FLYA 4FZYA 1HQEA 3GT7A 3S9HA 2FN9A 4DTSA 1WLJA 3RTVA 3KJVA 1PEYA 2M1ZA 1A04A 4FLTA 4H8KA 3HK2A 3N0XA 3TB6A 1RBVA 4G0QA 3V9ZA 4N41A 3N75A 1FK9A 3HSYA 2E4VA 3ROTA 2XY7A 1HYVA 3IP9A 4CGJA 1HPZA 1K66A 4N0QA 5IUNC 5FBKA 3KJXA 4J2EA 4FLWA 4PQUA 4DQQA 1UA1A 1NKCA 1HMVA 5KRTA 3RMCA 2WB4A 2FC0A 1RT4A 3KD1E 1LV5A 3F7NA 2MYNA 1JL2A 2I5JA 1KMIY 1RXIA 4OKEA 3PO4A 3SCXA 3NBMA 3R0JA 1IKXA 4DTXA 3HYFA 3DRRA 3AVMA 3QK7A 1XHFA 1JKHA 2OQRA 3N6VA 1NK6A 2MYPA 4M3UA 3TWHA 5CNMA 2FEPA 2H3HA 1UWBA 3DGEC 1USKA 4N47A 3LZIA 1S9GA 5DKFA 4DMNA 1N6QA 1EKEA 4OVLA 1RBTA 3G85A 1VPWA 3K59A 4OJRA 3RVKA 1LBIA 4FE7A 4MLDA 2PUGA 1CYEA 3DRPA 2EX3A 3G0ZA 3UKJA 4G97A 4TLLB 3CNBA 2HPHA 4E19A 3H5IA 1SXIA 2PE5A 2JLEA 3LP0A 1ZESA 4MAAA 5KC8A 3K58A 5JNWA 2PL9A 2FXIA 4M3WA 3LALA 4KTQA 2QVCA 4JOQA 1A2OA 3GBVA 4O55A 2QZJA 4RWEA 4C8LA 4P1ZA 1WAJA 3V9XA 1NK5A 4DS4A 4JB2A 1PUXA 1C0MA 4DTUA 1RT5A 1QSLA 1AB5A 3JS5A 3HUUA 2Z1HA 5FBHA 1VSLA 4N0PA 1JXEA 5C25A 1FSPA 1WSJA 4MQFB 2B4JA 1RDAA 4R5PA 4E7IA 3VA0A 2PUEA 4JS4A 3O75A 4N5SA 3BGRA 3EDCA 1LWEA 4CF2A 5HM6A 3PX4A 1DRKA 2E6MA 4RW6A 2J48A 4B3OA 3KK2A 4B9VA 4KHQA 5FDLA 3VNBA 5EWLA 1KFSA 2FEKA 3SQ2A 1NXOA 4CEZA 3EYZA 4RK1A 3F73A 2YNFA 4JASB 4G0YA 5TPZD 4FJGA 1BGXT 1RTHA 3H6HA 4E7JA 4Y9TA 3CRNA 3TABA 3VQBA 1YTAA 3JPWA 1NJYA 5J1EA 4CF8A 3OQNA 3OMXA 4CF0A 2HHUA 2X74A 3LTEA 2KFZA 3V4IA 4XFKA 1S8NA 1D1PA 3OYCA 5DMRA 1CLQA 4RK5A 1KLMA 3KK3A 1VLZA 4KQCA 2VWKA 1LJLA 4CIFA 4XAQA 5EWLB 1SD5A 1HNVA 3VQ4A 3RVOA 1BISA 3H5WA 1JFTA 1MB3A 4QYMA 3IDOA 1CEYA 4CJFA 2IOCA 4YWHA 2E4XA 4JLHA 2IOYA 5GQSA 4O5AA 1J54A 1HJRA 3O1HB 5E3JA 4F3TA 3CFYA 1VSJA 3OJSA 3LOPA 2L17A 1JLQA 2G8UA 3OQMA 4E3SA 4FK4A 3ZT1A 2PZSA 1OXBB 4CK1A 3O2SB 2JB9A 3I09A 1LJUA 3LFTA 3GBPA 1FQWA 1U2PA 1D9DA 3NFAA 2FQWA 4LH4A 1VSDA 1FKPA 4QCLA 2KW4A 3CG0A 1NXVA 4BWMA 2FN8A 2O4GA 1OXKB 1IIBA 4TSXA 5FWXB 4GVMA 4RG8A 2FSPA 1Z2DA 4YP9A 3V1OA 2G8KA 5HLFA 5JS2A 1JFVA 2P9HA 4HUEA 2PY5A 1SXGA 3H1FA 3CM5A 1MB0A 4MR9B 3TR8A 4FLVA 3OYEA 3T8YA 3BDPA 3WNFA 4D74A 4IILA 1D8YA 3I0RA 4E7LA 5TQ0B 4KPYA 1S6QA 3NF6A 4O1HA 3RVMA 1TMYA 1FFSA 1A5VA 1YK0A 1TM2A 6CHYA 3L2VA 3H75A 5T3YA 4I2QA 4RU1A 1HRHA 1H9CA 5HRNA 1U47A 3OYBA 3KLHA 2G8IA 3OYMA 4G0XA 3MF4A 3O21A 4MR7A 4MS4A 4IMJB 3M8QA 2P4UA 1WAFA 1CZBA 3AVFA 4CJSA 4W5NA 2FBXA 1S6PA 4E1MA 1JLEA 3LZJA 4QOZB 4LZLA 4DFKA 2RJNA 4KHNA 2FKAA 4Q7EA 2FVYA 3RVNA 1DCKA 4L8RB 3SPYA 5FWYB 2EHGA 1KLNA 4NICA 1N5YA 4HTUA 3L8BA 1RT7A 1MU2A 3UK0A 1M2FA 3DLEA 4LSLA 1YIOA 4IBNA 1GLGA 2JBAA 3LUFA 1Q9YA 1CXUA 4WXMA 2HQRA 5ABPA 3T38A 2PUBA 4EVSA 1AB6A 4RW8A 4FM2A 4FXDA 3G10A 2JVIA 1DG9A 3NE6A 1TJYA 1FKOA 3H5OA 1Y97A 1WETA 3JSMA 3DMJA 3C3WA 1QE1A 1ABEA 1QO0D 3CZCA 4Q6WA 3QETA 4LE1A 4RK4A 2FBTA 5KTQA 4PYRA 1BIZA 3MIZA 1SKSA 4E7OA 1Q8IA 3LWLA 3C94A 3I8DA 1TK8A 3K5NA 1L3UA 4UHJA 3P1GA 4IF4A 4HCBA 1SUQA 2A9QA 1EETA 3RRHA 4EUKA 1VSIA 4Z4FA 3O74A 3FDFA 3SM9A 4FB4A 1CXQA 4Q6BA 1B9FA 3VNAA 3RVPA 5HROA 1LBHA 4O44A 3D02A 3V6DA 1U45A 3ZSWA 3QIOA 5SZTA 5J2MA 3C3MA 2DFHA 4CEEA 4QAGA 4XIUA 3CFOA 3OLVA 3A0UA 3ZT0A 3OY9A 4DSIA 4M45A 2CHEA 4CGIA 4D6XA 1KVBA 1CZ9A 3OYFA 4CFDA 4O1IA 1QTMA 4FZZA 3KK1A 4CK3A 2KZMA 4WWHA 3ROFA 3AVIA 3VQ7A 2WOMA 1BDJA 1XHZA 4J2DA 4CEFA 3T6KA 5KGXA 2NZVG 4CHQA 4L4UA 3BILA 3ZCMA 3TAGA 3QEMB 2X6NA 4Z4CA 3IAYA 1Q9XA 1ZN2A 3MXIA 4W5OA 1F51E 4CIGA 4IKFA 3ILHA 5CYQA 3SQNA 4WXEA 3VQDA 3NF7A 5KQMA 4FW2A 1QPZA 4AHCA 4EP5A 1X9SA 3EZ5A 4CHPA 3VN5A 1URPA 2WRZA 3QEVA 3OO1A 2NT4A 2HMIA 1U8TA 3DLBA 3OVNA 4DLGA 3H08A 5J2NA 5IULC 1BDHA 3UUGA 4FZXC 3SI6A 2MSKA 2OPSA 3MEDA 2YHAA 4FCYA 2O20A 4ZMRA 3M8SA 1LK0A 4MRMB 3NBPA 3DOLA 3MECA 1KRWA 4DN6A 1DBQA 2R47A 4CIEA 2RKIA 1Z2EA 3TI0A 4DADA 2XRIA 2MSWA 3IRXA 3LUKA 1ASVA 5IC5A 3AO4A 3PV8A 3RQIA 2IKSA 3QELA 3FFTA 4HUGA 1L5ZA 3THVA 3VQCA 4EYOA 3LUGA 3QX8A 4W5TA 2Z1JA 1X1PA 3TAFA 3C95A 4XLTA 4B9MA 3ZSQA 3RWUA 2OPRA 1RT1A 4KQ9A 1USGA 3DLGA 1D1QA 4B09A 3KCNA 1I3CA 1RPJA 4GNRA 2IPNA 3GWGA 2LIVA 3LPTA 5HQJA 4BACA 3V9SA 2PYLA 2PKXA 4CEAA 3LP3A 3AVNA 3AA2A 3ULDA 3RRGA 3TD9A 3DM2A 1C1CA 4PEVA 4DTMA 1ZY2A 4MR8A 3WNEA 4NYNA 4CHNA 1JH9A 3HDVA 5DTEA 2XY5A 4O5BA 4KTZA 1JLFA 4H3KB 2PL1A 1VRTA 1SL2A 4N56A 4ZTJA 3AA3A 4KHSA 5KQPA 3D45A 3VQ6A 3CG4A 4DSEA 3C6QA 1JLAA 3AVKA 4M41A 3RH0A 2VK2A 5PNTA 2WMYA 2VG7A 4F2RA 2PJUA 3CTPA 2ID7A 3QEIA 4JP1A 1KSPA 4MFBA 3O2QB 2HJ9A 1GOBA 4EYGA 7ABPA 2FEWB 4CEBA 5BRJA 4CJUA 3IP7A 4KAZA 2HHWA 4F8RA 4MS3B 3KIOA 3QLVC 2R48A 2VWJA 3F6CA 1JLKA 2YKNA 5JNSA 1APBA 1RXEA 3NH0A 3EY1A 3I0SA 4PE5B 5CNJA 3I5AA 4OPKA 4DSFA 2XY6A 3OM0A 1RBUA 5HRPA 1U49A 3MM4A 3HCWA 3HS3A
chains in the Genus database with same CATH superfamily
2HRBA 1KHTA 2XNSA 5TPZA 3W6OA 2JJ8A 2C9YA 3AZOA 4CLOB 4XD7D 1JHXA 1T8UA 2QWXA 5AK4A 3NRJA 5B1HA 3RRZA 2GPAA 1Y7PA 2ST1A 3SBXA 3VR6D 4TTQA 2ZI9A 4DF8A 2UYYA 4TXHA 3QXCA 3K8ZA 3K5OA 1TECE 3EB9A 3GNLA 1SL1A 4HSGA 1OYWA 4KBFA 4LK3A 4MGEA 5T5QA 3S68A 1IZYA 2GZ2A 2LR0A 3L92A 4E33A 5D3KA 4PY5A 2R6CA 4JEHA 5IEBA 3ZCTA 3WGVA 5JXHA 2HHSA 2E4UA 4GI1A 3V4ZA 4WECA 5ALPA 3AIMA 3IHWA 3L7JA 5FV4A 4U2GA 4MWDA 2GGSA 4RD1A 2GKGA 5EIEA 2ZI4A 2EDCA 2A0WA 2G76A 3LHKA 5BW6B 3AJAA 2XRMA 1VRUA 4QTZA 1M5UA 1WW2A 5CH8A 3VZQA 4F3OA 2YUIA 1XTPA 3RUIA 3CETA 1ULTA 1L7MA 2HV8A 3Q6IA 1KDPA 1LW7A 3ITHA 2GEBA 3HYCA 1V43A 3K32A 1VQ5N 3O4HA 1GV0A 5AVQA 1H05A 4MDHA 1GQFA 3OLYA 4LDRA 1ZD4A 3GUZA 4S2UA 4MO9A 1XFDA 5BOSB 2P35A 4FQ8A 5DT9A 4E08A 2R8EA 1NUPA 1X7XA 1T8EA 4F8YA 1DKPA 1YQQA 3BSWA 1YKSA 2OPBA 1F1JA 1P8AA 3GDOA 3BGSA 3OQ1A 4DIKA 4R0VA 4XWKA 2WAMA 4M3YA 1S22A 1K7CA 4HUTA 3HB7A 3U56A 3K8YA 1Z83A 4U1RA 5A02A 4UUAA 2XW6A 4LF6K 1ASUA 1HQUA 1ZU4A 1UPXA 1QFYA 2R8BA 3KJFA 4NU0A 3WKAA 3ENVA 5E41A 3BE8A 5CHYA 5J2UF 1IJBA 1QHGA 1DKQA 3QLHA 1SBYA 2V96A 2HHQA 2Q6LA 3IE2A 3FCOA 5DHFA 4FVMA 2WABA 1DGKN 3R8EA 3HNOA 2FZ4A 4BNMA 2DBRA 2QA5A 5F76A 2WUFA 4EW1A 3KQTA 7MHTA 2OBYA 2YQZA 3OETA 2ATIA 2XKBA 3O1WA 3ZDEA 1WNTA 1WDTA 5GONB 2L69A 2B1QA 3HHEA 4TVSA 4CZIA 1QHTA 5FD8A 2Z1GA 2ZJFA 2FSVC 3PVZA 1YR7A 2R6HA 2POCA 5AVWA 3LRXA 2O52A 1E0JA 4EKIA 3DXKB 1R6UA 1LDGA 1POXA 3EW7A 3FGOA 4TKMA 2A1TR 4DCNA 5EFOA 3FSRA 5HGXA 4TYYA 1MB2A 3U40A 4UOZA 3ETEA 4JEMA 3D9QX 4NAHA 2GBGA 3QE9Y 1AK2A 1T2DA 1XMQB 3KSMA 3ZLUA 4JVLA 3TW6A 1EE9A 2EERA 2VZ9A 4QG7A 1TM7E 1JAIA 5B36A 1QZXA 3IOBA 4FLXA 2IOFA 4XDHA 4GKJB 2RHMA 1YULA 2ENWA 3VR4H 3OLQA 1XALA 2Z8ZA 3LV8A 4L85A 3T7DA 4E32A 3DOOA 3E5MA 5KNCA 1VRCA 4C7XA 2NOAA 2JCGA 3HLYA 4LGMA 4F38A 1B43A 5BXQC 1WY7A 1SC4A 2VBGA 1ZONA 5I8ZA 4G4IA 1ZGBA 2QXFA 2P6MA 4CLRB 2GFHA 1K9VF 5HOQA 3DLAA 4R81A 1T6ZA 4ZYLA 3GFBA 3NIFB 4L8GA 2GPWA 2ZIGA 3UGQA 5C1BA 1XVIA 4GLFA 1R0YA 3FHOA 3CVYA 2GVDC 3ZWPA 4FN4A 3QP9A 1EWTA 5M1FA 5FBZA 3T54A 1AQJA 1RXVA 2VQEK 1T4GA 1GZSA 3H7AA 5IDYA 4BMVA 1J2TA 3A6FA 3EXFA 4XGNA 4G8DA 3KEGA 5EEGA 4BVGA 1WF3A 5HKOA 3ENHA 2IHUA 4EZ6A 2NU6B 4DARA 4RVNA 1F20A 5JSKA 4TZKA 4JLVA 2J09A 3OZXA 4MLPA 3OCWA 3LQ4A 2VUUA 3HI4A 3R0QA 2H59A 2BOVA 3W2FA 5K7SA 3DVSX 1NE2A 4N76A 4BV3A 3CFPA 1QYVA 3ER9A 4BOYA 2AMVA 3JQ9A 3W7BA 2O3RA 4M8IA 2AG1A 2AOTB 1FTQA 4CE6A 4V02A 4YREA 4Z1MD 4GE3A 3RIGA 3T7TA 2CBZA 2C1XA 4KO1S 4X60A 5DWQA 5BV8A 1F6BA 3F6SA 4RPCA 1DXOA 2RHLA 4NBRA 5EZYF 2GRUA 3TVTA 4ZJPA 2XDAA 5H9VA 4KB5A 4AULA 3DFFA 1L4HA 1OXUA 1AE1A 1TIPA 4K0RA 3BGVA 4RAQA 3F71A 1ECFA 1JEYB 3K1YA 2B7CA 3OA2A 4CI0B 1YF3A 1IN5A 4HAIA 4PNHA 4IIVA 2A1RA 3OZWA 3LKZA 4RW4A 4Q1CA 2KBFA 3BFVA 4B3SK 3AZPA 5G3YA 2CHQA 1IY9A 5EIHA 4UPDA 3FNGA 4WN3A 1V0JA 5A3QA 1GDHA 4RZQA 3UK7A 3DEIA 3OKPA 1YITN 1I7DA 4OMUA 4F06A 4DDTA 1U1DA 2EFGA 3LP5A 3DP9A 3Q10A 2UUAK 2PX8A 3CSSA 4WJZA 2CDRA 3AJRA 3ZN2A 5DLYA 3SQXA 3P0JA 3OYLA 4MPRA 2XMPA 4JI0K 1DOAA 4K41A 2PG3A 1GGMA 1DKMA 1CF2O 1PJ3A 1ZINA 4I0WB 4DTNA 2NU6A 4DIBA 5EHNA 3H5AA 4JQOA 1P8ZA 1UZAA 2FQXA 2GPBA 4TS1A 5H4HA 2A42A 3W6PA 2F4VB 3FJOA 5EEHA 3HO1A 3C6KA 3FPHA 5J2PA 1R0WA 1THMA 3DW3X 3GLRA 3I30X 2E6LA 3R44A 4GPEA 1P4JA 1P2FA 2W2KB 3WNGA 5AD1A 1RR6A 4KN5A 2VSYA 2BKAA 3TQRA 1JMYA 1U0JA 2EG5A 4A2QA 1PVOA 4XQEA 2QK9A 1P9OA 4J49A 1RFQA 1F38A 2AZ4A 4KACA 1HDZA 1XV5A 1D03A 4YRQA 4C2UA 2PXXA 3HT3A 4DV5K 4LNAA 4WF9L 3L7KA 2QVBA 5D85A 4DXDA 2OILA 3P83D 1IB6A 3K5WA 4WLNA 5I5EA 2IYFA 1WBDA 1A9QA 4I2NA 1M90O 1IJKA 3BMOA 5HZKA 2ZYAA 1GXSB 1NBMA 3LK7A 3ND9A 3DQZA 3AF3A 3BB3A 5H02A 3S7TA 4OJQA 4O8ZA 4A6XA 4ZHQB 3OE1A 1UEXC 3WHKA 4DCMA 2DHEA 3AUYA 3ENOA 5IDWA 5JD6A 1E0DA 1ZAKA 3B6EA 4FJMA 4OAPA 2WD8A 3H42B 1NX9A 3VR5D 3VEWA 3FTEA 1JIJA 1ND6A 3DCJA 1FNMA 4FZVA 5LY3A 3H0KA 3STYA 1MRZA 1FMTA 4Q5VA 2RHWA 3ZOZA 4BNGA 4URXR 3G0HA 3CNHA 3PEWA 3CLSD 3D3WA 2ZLBA 1UAGA 2QENA 4PWZA 1F0KA 2NVUA 2QTAA 1WXDA 3PKJA 5K0CA 3SQMA 4WQ4A 4A8JA 3T7IA 2QN9A 3ZV4A 2P5TB 3U7IA 4PCLA 4ICLA 3BSYA 5A6SA 3A3YA 3F74A 3CJQA 4KWEA 3QI7A 2H92A 2COKA 2YL2A 5EMNA 5H5JA 2BKVA 1P1KA 4A0SA 5FWYA 1H0RA 2GX9A 1OC4A 3AUJB 3HNRA 4NF2A 4QOGA 5EHGA 1XZGA 4EI2A 3KR0A 3VKGA 2FCRA 5LP6B 2F1RA 4NHEA 4H4OA 1VQ4N 3E7FA 4EPVA 1OYOA 1Q84A 1X2EA 4IRXA 4PZCA 5MN6A 3U9ZA 1W75A 3GGSA 2XUGA 4Q3OA 2ZJYA 4RXTA 2H57A 1D3AA 2BEKA 5KMGA 5L3QB 2QP9X 3AIOA 2XE4A 3SE0A 4EYKA 3TMYA 3MRVA 5EFZA 4Y6RA 5KMGB 2FZKA 2PLNA 1CF4A 2IQ5A 1C5KA 3R23A 3LD9A 4ER7A 1AUXA 1TU0A 3AJ9A 4ZA2A 4HRXA 1E2IA 1ULBA 4NU8X 5JIBA 2PUCA 1P1JA 1J56A 2ANCA 4XVCA 2QKBA 1N7HA 1DAFA 1NUTA 4WA7A 2ZSBA 1MV8A 5K6TA 2G06A 2LW7A 3VR3D 3KWFA 3RIXA 4ABTA 5B12A 5EVJA 2IXFA 1QWSA 3A9TA 4WKBA 1UT6A 1V11A 2QTTA 3KAJA 4JQZA 4U0JA 4TSFD 4DR4B 3HE3A 4O0LA 3DP7A 1IOWA 2DTXA 4P2BA 2GZ3A 3ICEA 4N7MA 4OB7A 4HDCA 3HPOA 1KF0A 3TX2A 3QVJA 4B9EA 3AVHA 3D6RA 4DG1A 3PRKE 1NJZA 4FW9A 4NOJA 4R8VA 3ODGA 2XD4A 5SY9A 3CM6A 3DOJA 2JH8A 2QE7A 3KJGA 1CD5A 1ST2A 1IPFA 2ATXA 2ZJZA 3IB3A 5JSZB 3C1TA 2I2BA 4FEAA 1EX4A 2W6KA 1OWNA 5K3FA 3A10A 3RHFA 5A7FA 4D4KA 1GGNA 1XQ6A 2GEJA 3QLUA 4CHZA 3TLZA 3AU8A 2Z2KA 4BLQA 2A78A 3D5QA 4P58A 1H1LB 1PZFA 2FPIA 3MJCA 1W93A 4YJFA 5KVAA 3GZJA 1ZIPA 4B3GA 1PEKE 3QZUA 4GRDA 2H51A 4LY6A 4JKHA 1VG9B 2OLKA 3OHPA 3R20A 5CJJA 2Q2OA 3VTAA 4LNUB 3OCUA 1YJ5A 3EVZA 1FLAA 4BCCA 5C9ZA 4JKGB 1KK2A 5F1OA 5G0SA 3EXG1 2ECOA 4R1NA 2R8RA 4DMHA 2VPYA 2VZ8A 1GPWB 1UK9A 2YXBA 3UV6A 1NAIA 2B5JA 5HJ7A 3DAYA 2QK4A 2EFEB 1E9FA 5B5SA 5ES3A 2FF7A 2YICA 1P4SA 3UPTA 2A0KA 3SNKA 2Q5HA 2AMJA 3K8QA 1DRWA 3OPYA 5AVKA 4KPUA 3VH2A 3MXJA 2H1WA 5DHPA 3CLVA 4CLHA 2F90A 2I33A 3L0QA 1TQ2A 1ZRMA 1PG0A 4RY8A 5FORA 3WRYC 3WAGA 1W59A 1Z13A 3VR6H 5FHQA 4B3FX 4H5WA 3O92A 2BWJA 5KHOC 4YY3B 3IL2A 1TGYA 2Q2WA 3G9ZA 4HN9A 1VIDA 1XE3A 1SWWA 3PGKA 1ZCJA 1GTJ1 1XT6A 3ZSYA 4QC2A 4W5HA 4HGZA 2ISCA 1ZNZA 5HDQA 3T35A 3TYXA 3ONFA 1NN5A 3E1KA 4DIOA 5LDHA 1P6QA 4CJ5A 3B2NA 4QEZA 4BO1A 1ADCA 4TL8A 3D7RA 2HCTA 4A59A 4B8ZA 1NVWQ 1CR0A 1CSEE 1WSDA 2HNAA 4G3XA 4K88A 5CNKA 3PGA1 2Z3VA 5BURA 1G38A 5KVSA 1EG2A 3WK9A 2QUZA 2ZRAA 1FNNA 3BY5A 1FRFS 2GHRA 4B48A 1CYDA 1XKLA 2ZCVA 1R12A 3H2KA 3QLVA 3C3JA 3DV0A 2Y4NA 5SY6A 3SFVA 3DE0X 4FCWA 4CJQA 1RQ7A 1PR9A 2BH9A 4G1UC 4L15A 4RD3A 2OAQ1 3CZQA 2YXLA 4R5HA 3WFIA 4XUEA 3SBTA 4FJXA 2GBLA 2XNHA 1WSEA 3VESA 1V96A 1RGIA 2NYAA 4U8HA 5AKKA 4BE1A 3PXCX 3BFKA 4LK2A 3FRIA 1DTTA 1RNHA 5FBLB 2AOTA 3VHLB 2WTEA 3AFNA 3AEYA 2OPQA 1NK4A 4W1QA 4BVPA 3TFOA 1X9GA 5GPBA 4H0FA 3CH6A 3FE1A 2XE7A 4D25A 3LQ2A 3KD5E 5E2IA 5IXJA 1QVAA 1CUWA 3GRCA 2HA5A 1Z68A 1EK6A 1FP6A 4UM9D 2PH5A 2VJNA 3N0WA 2VF7A 3JW8A 3O7MA 5IT5A 3S8YA 3J81k 3K05A 2P40A 5A4IS 4KTVE 4CEIA 1IFXA 3OP4A 4IKOA 5EQDA 3RR7A 1QX4A 3HJNA 3CVWA 1E79A 2HN9A 4IHJF 5BT9A 5IK2D 4CIDA 3M3DA 4EA6A 1RBQA 1IPHA 1T1EA 3MJSA 2IKQA 5DX0A 4ZCIA 1YR8A 2C2ZA 2H1LA 3MCPA 1G64A 3W8RA 2AOWA 5F64A 3HL8A 2YUTA 3P7MA 4B34A 1SIUA 3LC7O 4FQ5A 4DR4K 4AHVA 2QTBA 1JKFA 4RDCA 1YOBA 1ZSNA 2FZ5A 3QGMA 4E15A 3D8NA 1LY1A 2IUFA 2ZS7A 3FZNA 1Y5NA 2YZ7A 3AM1A 3JQGA 2F9LA 2FUG6 4FHZA 1NXPA 4G5GA 4BZZA 2C2HA 1HRDA 2XQIA 5I7WA 4FUQA 4GI3A 2R60A 4X45A 2CNBA 3A3KA 4ZOLA 3IT1A 4DR1B 2EEPA 3R5FA 3QEWA 1G59A 3C5VA 3EPKA 1OZHA 1E5QA 2WIGA 4NMWA 5LJVA 5DHRA 1QHHB 5CEEA 4FYKA 3QY9A 4YO8A 5JDCC 5AQLA 5TQVA 3KIPA 3SQLA 2ZJQL 5BPLA 2BGKA 2CLMB 4CKBB 4EEZA 3AKDA 5FPEA 3KQWA 3CUYA 4Y3UA 3AGRA 3E5NA 2WWFA 3HJTA 5AJ3K 4C0KA 5BWBA 4C06A 5CFQA 3BE6A 5ELMA 3UJ3X 4GVEA 3D5TA 3B8EA 4IRUB 2P1JA 2QG6A 3Q3GE 1DOZA 4UPEA 4ESOA 2B6AA 1QCZA 2VHUA 3PVSA 1NW8A 2QL5A 4ME6A 4ZHQA 3AB3A 4Y2XA 4IV0A 3VQ5A 3THOA 1P5FA 4IVNA 3J7TA 4P53A 2R66A 2R7YA 1OIWA 2WF5A 3KQLA 1QG4A 1PEDA 1XWLA 4QICA 4AICA 3K71B 3HYRA 2HU7A 2VTVA 1KSFX 5JAQA 1SUWA 3NKLA 4E1NA 2AS0A 2RK4A 4JKEA 3BGIA 4UMFA 3HY3A 5ERYA 3SEZA 1K7SN 1O87A 4DQRA 2F43A 1RLTA 1XELA 2M6RA 3GFRA 3PU6A 4JC5A 4YMGA 1X14A 2PXAA 4NOLA 5D84A 5EKDA 5IWAB 1TK9A 3Q7QA 2WKPA 5CITA 4NO7A 3OFND 3O9VA 1E2BA 4FFMA 3WJ7A 4JBWA 1L6IA 2CL7X 3W9YA 1UMCB 3UXEA 4E5UA 2DTDA 2BI4A 3HM2A 3NHAA 4IUCS 5SICE 5F5XA 3VEOA 1PFWA 1RXCA 4BROA 2HHTA 4LSNA 1FPMA 1PL8A 1NI5A 1B4DA 1TZMA 1XI1A 1ZH2A 3A31A 3OWOA 2Z95A 5CX1B 5EL0A 1QONA 2V7TA 3W2IA 2LUOA 5HZGA 5J4LA 2E20A 3D4PA 3OZEA 5FAXA 4IH4A 5LP6A 5JROA 3F9RA 4D8YA 1P2DA 2WBLC 2WU0A 3F98A 4LX8A 4DXHA 2XITA 4KL8S 1ZG3A 4ZPJA 5KQGA 1WSIA 2CNDA 1BFKA 1Z47A 1Z45A 3JVUA 1OXXK 1C3VA 2AFHE 1ZUNA 2JIDA 4H60A 4PBTA 2YXNA 5U4QA 4K8XA 5GONF 2Y1CA 4NDNE 4B2PA 4N5DA 3OYJA 1D2CA 4H0PA 4HK4A 2PBZA 2BZ0A 3CCSN 5IKOA 4NLBA 3I04A 3ICVA 4YFYA 1QUEA 2V5UA 3SR0A 3RUHA 4WVLA 4DW8A 1H8EA 3P4IA 1UM9B 1LTHR 2BGLA 2YNIA 1NK0A 3EVFA 1JQDA 3LHDA 3UT6A 5C37A 1V45E 1KRHA 1W85B 5CHIA 2GOYA 2B8WA 3C70A 4OK3A 4Q24A 1GT91 4QOIA 3F90A 2ZBGA 3GJXC 4RGVA 1QYIA 3OPXA 2Q2NA 1U5AA 2GUIA 4R8RA 1UQTA 5H1SQ 1MA9B 5D3MB 3CB4A 5C46F 3CMEN 3KEFA 4JD5A 2QXTA 1L6RA 3E0QA 2V74B 3C43A 3CEPB 4MIOA 3GLKA 5YASA 3DLIA 3KQQA 4M3RA 3A6DA 1FYFA 3ECCA 3BBPA 5BN4A 1NM5A 1RRGA 1TJ5A 2JIOA 2PKRA 3CX4A 4IJQA 1IQRA 1A88A 1FYWA 4R41A 4YV7A 4HNRA 1ZBLA 2GZRA 3E15A 4KGVA 3PICA 3RU3A 1XXHA 3CISA 2UXBB 1EWVA 3NHBA 1JA9A 2PMWB 2FH5B 4JKCA 1YJAA 3SJ7A 1NKVA 3F5QA 4EUEA 2P4EA 2P41A 4DWVA 1Z2CA 3O4NA 3AUAA 1VBKA 3LZ6A 3TIVA 1AM4D 3EXFB 1E98A 1GPKA 4FX2A 4LXTA 2AJTA 4ON9A 1HNNA 3COJA 1EO1A 4Q4JB 5FPTA 5HRAA 4Z1OA 3IG1A 2V7GA 3DBIA 4XXHA 5JRDS 3A6PC 1K8YB 2KS6A 4ZVNA 4DTPA 2PMCA 4KNYA 4B2YA 1RC0A 3NTOA 2NRRA 1II9A 4BVHA 3D4OA 5JCOC 3V4VB 1M8JA 5K0LA 2RG1A 3ESAA 2DUWA 5LQCA 1YDWA 1XQWA 3GJSA 5JD4A 1LWOA 3DBRA 1M1NA 1T1RA 4PV7A 2IS1A 2V7QD 1OHHD 3L1JA 2X0IA 4PGFA 1T8WA 3CCQN 1K3FA 1UKEA 2J6IA 3KOMA 5GJWC 4AO8A 3JXEA 3H97A 1TI7A 2R00C 1TYQA 3F9IA 3MINA 3QVGA 4FYIA 3I83A 2XI4A 5HX7A 5DHSA 1QMPA 3WK5A 1IN1A 5CCDA 1FNBA 5FPQA 3HKCB 4DYVA 3TLXA 4EL0A 2HSEA 3K70B 4FWSA 2OE2A 3U7QB 4LFCK 1U6KA 1MX3A 2V03A 4CGHA 1G8AA 2WJPA 2RG7A 1YQEA 5DV9A 2B3TA 3ZCUA 3H0CA 1PL0A 3O1LA 2HU2A 1B0ZA 5FEUA 1TAGA 1E9DA 4KQGA 2I29A 4LXQA 1VKNA 4JKBA 4Q00A 1K0FA 4JA2A 4RHTA 4RH1A 5ETJA 3UMSA 4ENUA 4Q4CA 2UVQA 1UBJS 4RA9B 5I51A 3AKEA 2EGHA 4Z99A 1BMFA 3QKIA 1X87A 1Y6ZA 1ZHHA 4LJ6A 1NL3A 4DM4A 4PO8A 3EAGA 3QVVA 3EF0A 4OP2A 4CLEA 4CV1A 4KK4A 3BREA 3WWDA 2BI7A 3HGQA 1DIHA 1TF2A 1OC2A 1XMQK 1OLSB 2P9NA 4OFZA 4TKZA 2RARA 3GQBB 4AZSA 5JJ5A 1GNQA 3GEIA 4H18A 3DV9A 2CXPA 1FNDA 1L7OA 2GX6A 4H5TA 1V9SA 3P2OA 3PENA 2D4WA 5ER6A 5IAKA 4QOFA 3M6FA 3RFFA 2WTAA 2QPOA 4JEUA 3WYNA 1A2QA 2JJYA 4JAXA 1ZK1A 2JJQA 3CZ9A 3OZBA 1ZD2P 4IX1A 4MYHA 2WYUA 4UVDA 3ORSA 1U2GA 4UOQA 4J2AA 3OICA 1C0EA 4XIFA 3EH2A 1E9SA 3DT8A 3GI1A 3TJZA 4C3ZA 2M9MA 3GWZA 1P2GA 5GADl 3WT0A 3TKAA 5AQWA 3OS2A 3ELWA 4F72A 5JCJD 2QSUA 4JLAA 1LPOA 4GMGA 4ZIRB 3GRVA 2Z6QA 3M6VA 3GPLA 1E58A 2XBUA 2GCOB 4A27A 4BAZA 2P1ZA 1FQKA 4HH0A 3UHPA 1SKBA 1P9NA 1KPHA 1X7WB 3ZX2A 3L8YA 3IHKA 3WG9A 5L6LB 1P39A 4TLDA 3W5UA 4BREA 3FDIA 2DBYA 4LFAB 2Q1SA 2I4TA 2X7XA 3RIMA 4MDAA 1GAEO 1VQ1A 5T57A 1DGQA 2D7DA 4XLLA 3CB2A 2OENG 2RHCA 2ZUCA 3DM5A 3KXDA 3R5TA 3SXUB 3WLEA 4RTKA 1Y4DE 2IXTA 2CYAA 4E7PA 3D0PA 4GL4A 5JAOA 4HLUA 1IY1A 1QLHA 4TOIA 1ZCBA 4CMCA 1UDCA 3FCYA 1RBZA 4E0DA 2JGDB 3LMKA 1OI3A 3KTOA 1TF5A 2XDWA 3AAQA 4PANA 5KUTA 2WPDA 1G8GA 1ONOA 2PX6A 2L2QA 3I9FA 2DWCA 3NM5A 521PA 3A6EA 5B7NA 4D42A 4LOHA 4HFNA 4PG4A 1R18A 3V97A 5KSOA 4EB3A 2I9KA 2O7QA 2IELA 4JVNA 1ECCA 4MKRA 2X7JA 4FZ5A 2ADOA 3N8HA 4FD3A 4KNVA 4NZOA 2V52B 1R27A 2ZU6A 3EVTA 1VE1A 3IQGX 4P7JA 3V1LA 1R4AA 2VNKA 5F73A 1K8XB 2BMVA 1F17A 2P9JA 3T5AA 1IY0A 3U9SA 4Q4AA 4OLAA 4D0GA 2H4FA 1Z5GA 3CERA 5UKDA 2CXTA 2HA0A 2XGGA 2QW1A 3NH9A 5B3JA 2ZSEA 5K3DA 3LBNA 3ROZA 5FHRA 1JCFA 4OQPA 4ZT5A 2ASMA 2FR0A 4ZT4A 3M82A 4X1YB 3Q7PA 1T6CA 5HNKA 1CEEA 2OM6A 3L7AA 3F6PA 2B34A 3TU5A 1RWBA 3UAGA 3VPCA 2D0IA 3UT5A 1LW0A 2UUCK 1BXGB 2P30A 4ZJZA 1YS1X 1KAGA 2C8JA 4J90A 4Q9LA 3EASA 2UYGA 2E4ZA 3EY4A 3ZT2A 4YMLA 2D2XA 3EXIA 3K57A 1HFJA 4MCJA 2YJTD 4GH5A 2Y9MB 4P82A 5HILA 3KKNA 2QWLA 1SQGA 4HXEB 1IZ9A 5K0NA 3E9YA 5M1NA 3NTQA 3TGPA 5J40A 4WEOA 3CXRA 2BRUA 2P9EA 2Y1EA 3DAOA 4LDAA 5FPHA 1IKVA 3SM3A 2PZMA 1AS0A 4DLNA 1Z0SA 2RN2A 3ZX3A 3AGPA 1DEKA 1I4OA 1SAYA 3FTPA 3UEOA 1N3BA 4MP6A 3HCBA 1M2EA 3KFXA 4C8MA 2IYAA 3E9LA 2XVYA 4CM1A 3ZDYB 1G7TA 4C6TB 4UTVA 2A9VA 3C16C 2YWEA 4YBZA 4F12A 1FZTA 4CL0A 721PA 4MEJA 5EKXA 5E3IA 1OKJA 3A2FA 4M63C 4F4HA 1NP3A 5FRMA 3NCTA 1T34A 1XDBA 1XMPA 2I55A 1GKYA 4YT5A 1TYCA 3INNA 3QX7A 3C45A 4OHMA 1MEJA 1E6WA 2D3WA 4GEKA 1BVUA 4RACA 2PWBA 4GZ3A 3VH1A 1G8SA 1PUJA 5AWFC 1B9DA 4NQRA 2YJNA 4C7OA 4N0DA 2R86A 1BD3A 1CB7A 2ILTA 2ZR7A 4X97A 1GSOA 3HY6A 2V4ZA 3WB9A 4URZR 3TIGA 4K8ZA 2HR1A 1E89A 3GZ4A 5J43A 1E2QA 3VQPA 1E3WB 2P9ZA 2C5SA 1NUAA 1T0IA 2JLWA 2QOEA 1V7ZA 2GBCA 3VMFA 1P90A 4CL2A 1RPZA 1LV8A 1PHRA 1DBIA 3RKRA 3IAM6 3R4VA 1BZYA 1Y6JA 5EZ6B 3WBBA 4AT1A 4YJ2B 4PUOA 4QDTA 3TZ6A 3H3JA 1G4AE 3EMBA 1CRPA 4M0MA 1YD7A 3URMA 4FK0A 1PWEA 1ORTA 1T9DA 1GAQA 2BHRA 2IP1A 2OD7A 4ZOQI 1VQ6N 5IC4A 5E4JA 1H2HA 2XB6A 3HABA 2OBMA 3O94A 1FU4A 1AQYA 2GSWA 3CBGA 3G8BA 4MYUA 3K0FA 2Q1TA 5HKKD 3LP6A 1V2HE 4IOLA 3VETA 1IHPA 2OXTA 1ZOIA 2NXJA 5EPUA 1P1CA 3SYKA 5ALWA 4BRLA 2W00A 3MGKA 4ED9A 3IS9A 1Q0SA 4TXLA 3MRXA 1QRUA 1NXQA 4ARVA 3ICOA 4MYRA 4M7YA 3UANA 2Y76A 3DDSA 1R5NA 5LQSA 4ECAA 1WP9A 4BFTA 1PQ4A 2PMFA 1QHNA 5IDVA 5EVCA 3QEBZ 3UW3A 4LGCA 5J23A 1X7GA 1T4BA 4Z0NA 1FFXA 2LIPA 3G49A 3L01A 1R6DA 2FSUA 3TTFA 3UB3A 4B4VA 1RC1A 1A9XA 1CIVA 1XVLA 2RDMA 4WFNL 1N75A 3H1AA 4X9XA 2AG6A 3AYZB 1RQPA 3OJCA 3T7ZA 1BFDA 5B58C 4BMZA 3U4QB 4C88A 3FGUA 3CEMA 4NNPA 5AOVA 1GOAA 4N5LA 7MDHA 3PPIA 4AF8A 5EMJA 2QRNA 1E1CB 1DWQA 3C97A 4ZIRA 1R0AA 1FFEA 5BSFA 5L9AA 4BJ1A 3L0SA 4RCZA 3K0AA 4AB1A 1UBOS 2Y1WA 3UH1A 1YMVA 3DE3X 1RHMA 1TW2A 1QVGM 4WXYB 3DL2A 2V7UA 2YN2A 3E82A 5ALYA 1IN6A 2LSNA 5AKGA 1TL1A 1YUWA 1RTDA 1Y37A 3U3RA 1N2CA 1KI2A 4KMMA 3DBLB 3S0JA 3PJGA 2C9DA 3BA1A 2ZRPA 4FM9A 4A5OA 3HXOA 5GGXA 4KX3A 1WXQA 4PO9A 5A2GA 3MGCA 3PCXA 4N6GA 2ZKIA 4FJLA 2XA2A 3MZ0A 3SBEA 3UUFA 4JX9A 4BU1A 3O93A 4NS4A 1BEZA 4RHFA 3RRFA 2PPVA 3B70A 4QELA 2ODBA 2E55A 5IAAA 4LOLA 1QQMA 5EJAA 3FNRA 4JJ6A 1C1XA 1E6LA 3CRMA 4JUDX 3R7FA 3TLEA 2ZROA 5CE3A 2QW9A 2JIBA 5ALTA 3L2WA 2CVHA 2DT8A 4FO0A 1N4DA 4CJ4A 1L7PA 1AGNA 3N2YA 3PF8A 5LIRA 3ITKA 5DTRA 4BO0A 1HEUA 2CK3D 2Q5JA 2WEKA 3U81A 2HSDA 3EA0A 1M7BA 3MUFA 2OXRA 4PX2A 1P7PA 2PTGA 4G0ZA 4MVJA 5GWXA 3TQCA 3VJKA 3J7AC 4AJEA 2RGAA 2QN3A 2ZVJA 3VV2A 1KA9H 3AHIA 2IVPA 2VZLA 3QENA 5HF5A 3ETHA 4LKOA 2ZB8A 1W9HA 4QULA 1YVUA 5TGZA 3RK1A 2AV6A 1E60A 2Y71A 1MLDA 3BWVA 4BR9A 4W7HA 5EJEA 3RRNA 3RSSA 3TLBA 2A9RA 3ZDQA 2R97A 4AN1A 2FRDA 3DA8A 2AFIA 3Q1KA 5TPWB 4JD2B 1ZRSA 3OF5A 4RGBA 1E7YA 4Y0AA 2QLBA 4UFOA 3UMJA 3OJEA 1VMAA 1OB5A 1DTWA 2GO7A 4P7BA 1Z7GA 3NF9A 1GP2A 4BNTA 2QWOA 3TARA 1Q20A 3A6KA 2ZIFA 4DEVA 5IH7A 3GUHA 3NXSA 1QQBA 4TMZA 5AUPB 4UTNA 2Q4BA 4X6XA 5L4NA 2HMSA 2XOEA 1BYIA 1B8OA 1Q81O 2B5OA 3HZOA 2CD9A 5F5LA 3N9IA 2VUTA 2NQTA 4OQEA 3BGDA 5G1PA 1Z6TA 3MXOA 3N8NA 4PYIA 3T7SA 4F9TA 1I7NA 8OHMA 3R3UA 4YO7A 4EHKA 1B76A 1VI5A 4CESA 4B3DA 4QLBA 1FLDA 3KOWA 4TQAA 3UXYA 1Q6ZA 1XRRA 5JU6A 5TVGA 1NT4A 4BX8A 3DCNA 4JSRA 4LJLA 4M7WA 3C6HA 1VJTA 2J4RA 4NBLA 1YFKA 2MHCA 3TKYA 4BDSA 4CTKA 5IUJC 1KFDA 1KBZA 1IZ0A 2E4WA 1UK6A 1BDIA 1DAKA 4GC5A 3OMWA 4HZGA 3JPYA 3R9PA 3AVBA 4JS0A 4AW9A 1C1DB 4HNQA 4PXYA 5CEJA 4M55A 2XRZA 1AOXA 4OYHA 4YMSA 1E2MA 1RXYA 1Z5ZA 2CXXA 3LDPA 4B6JA 4BVFA 2P9QA 5CYPA 1YAJA 1V7CA 3L1UA 3G2JA 1I1OA 1O5OA 2IDMA 5MFPA 4CKBA 2Z2XA 1G9SA 3CINA 4O3FA 3WL7A 1JKJA 1ZXOA 1TLTA 5I8WA 2W6IA 1G3RA 1DUVG 3T95A 4YRLA 1NE7A 4DDMA 5M5BA 2FSHA 5AHRA 5EMMA 4ZEXA 4V1CA 4P36A 2FDCA 3I01M 5JCXA 3QEOA 3OYDA 1V5EA 4IVQA 3WNQA 1TIKA 3T1AA 4EF5A 1T9BA 3DOCA 4LCEA 1XG5A 3LHSA 3DZHA 4X8HA 3SHFA 1J09A 1Q2UA 2A57A 4CDNA 2ZIEA 4RS4A 1FW8A 2EFDB 3V8MA 4HQRA 4BNNA 5B4VA 1QCDA 1IO2A 1P7WA 5DM4A 2JGLA 4CODB 3OY2A 4M2LA 3K20A 4WY2A 2VTBA 4D1YA 2ZE8A 4HVJA 4WKCA 4PLTA 3K1ZA 3D2EB 2H9AA 1DC6A 1WQ4A 5FDFA 4KRXA 1VJ1A 2GESA 3FFAA 2ZUBA 1B74A 5B3AA 1SK8A 4B6PA 4XR9A 1EAYA 1XZFA 2QWPA 1GLLO 4RW9A 2Z30A 3BG5A 3ZYCA 5FXMA 5I7HA 2H0RA 1NBHA 1C4XA 2A3RA 1VQLN 7GPBA 5CA1B 1XRQA 2PKCA 2Z5VA 4NABA 1MMFB 1ORRA 2RCNA 3C48A 4L75A 5EUBA 4B0OA 5BWNA 4WY8A 4LQ4A 1Z6AA 1PS9A 2YRFA 4I5EA 3HVRA 1WDLA 2VTKA 1K7FB 1ZBUA 4KQ2A 4X7RA 5LZ5A 4E2FA 2WJAA 1JQLB 2VYVD 3GGJA 5GIOA 4BEWA 4MRSA 3UMFA 1DIBA 1S01A 3FZEA 4NJOA 2O5EA 1BA2A 3VA3A 1QB8A 4F71A 1IH7A 1R6BX 5EIOA 3QYPA 4ZGGA 3M9XA 4GOMD 1FDTA 4IRMA 4JAVC 3OQJA 4AMVA 4IJWA 3IMXA 5DM60 3DW1X 1BJTA 3FCCA 1CJSA 1V8DA 2BDUA 2PWPA 4WVFA 3VQEA 2JA1A 3OM1A 5G0VA 4KRYA 5E1BA 2NZTA 1IU9A 2DKOA 5BP7A 3EPJA 2X8LA 3U9DA 4CI6A 3PGVA 4W1SA 4WT7A 1CY2A 1HKUA 1W2GA 3OWXA 5TPWA 3WYEA 3O8CA 2P9LB 1T8PA 2B37A 4WERA 3B5IA 4KXXA 1KJNA 2Y67A 3TTSA 3U7QA 5B1YA 1X9HA 1Q92A 3EVAA 4NCJA 5COAA 1XEAA 2GAAA 1JQ5A 2VG6A 1IDOA 4JI6B 1Q7EA 4B7AA 1BVHA 2DKNA 3HY4A 3H6KA 5C32A 2GAIA 3T4UA 4FEGA 2JANA 2UDPA 3IPYA 4UNIA 4B33A 2CFOA 2CDAA 4BWYA 3D8RA 2C00A 3RNLA 2IYOA 2DUNA 4INZA 1ZXBA 1A9TA 1YS6A 2AYXA 3QWHA 3AF0A 4ZVQA 3RS8A 3IEMA 4M8LA 2AOVA 2PIDA 1JG3A 4Q4HA 5DGIA 3TSQA 3Q3JB 3TOCA 5GJBA 3ZT3A 1HWYA 3TPZA 3G6WA 4Z4GA 6REQB 5JW6A 2BONA 3G1WA 2Q1NA 4RTOA 4MGHA 1Q82O 3PSHA 4QJ4A 2M6LA 1K8RA 2C1EA 1OT5A 1C1XB 3CLKA 4GZMA 5GV7A 4QBFA 5P21A 5CYGA 2VRWA 4OKSA 2GV9A 3V42A 1V39A 1U48A 3PP8A 4IY1A 4A73A 3HN7A 2Q97A 2JH9A 3A4NA 1DTSA 3RODA 5J2QA 1PLLA 1WHSA 4XSGA 5D3ZA 5AQGA 2F3UA 2I6TA 4XD7A 2NO0A 4G0WA 1OBFO 1CUAA 1YRYE 3I6YA 4JY7A 2I3ZA 1FP4A 1JHOA 2YS6A 5CRIA 3HCPA 4H6VA 4A6EA 3R7WA 2ZAYA 1GAJA 3QFSA 1K73O 4C05A 1FUEA 1T0BA 1OE0A 2OZLA 2ZS9A 5G3ZA 5AZIB 4G86A 2EQAA 3PUJA 3IP5A 4CF6A 2BTQA 1UOOA 3L93A 3M0EA 5BR4A 1M2NA 3OQHA 2GZDA 3ZHCA 3PLAA 4XEUA 1A2BA 3AQ4A 4S1NA 2BISA 2EYUA 2W8BA 2JL1A 3A4LA 4QRHA 1E66A 1W73A 1X2BA 3SDSA 5FNZA 3WADA 3EGCA 1JLGA 1W85A 4OBEA 5HCIA 3P9RA 1NVGA 1TD1A 2F67A 1U4BA 2CDBA 3AF4A 5D5PA 4P7KA 3MK6A 3L82B 1VPLA 3SZ2A 3UMMA 5IASA 1CUIA 1W4LA 3L05A 2NZ8A 5E0OA 4PCAA 4QUHA 4AKEA 2HSJA 5IBCA 1P1FA 4QXPA 2ZATA 2C95A 4CUKA 1C7RA 1QDUA 1UBNA 4FWMA 1FQJA 5AVJA 3R7SA 5HJEA 4Y1CA 2HRRA 1BXZA 3JY6A 2N0SA 3KU1A 4O02B 1PYGA 3MN6A 2INGX 4UMVA 2XY8A 1WCV1 2QRHA 3HUDA 4IWYA 3VX3A 4QTTB 1KTVA 4R05A 2HTFA 2P9UA 1TZBA 2RI6A 4OP1A 4Y1RA 1NR1A 2O7VA 1RTJA 4ENTA 3DJYA 1X19A 3BL5A 3CXCM 4E7HA 1ISMA 2ZGYA 2I6SA 3L8HA 3QKSB 1JYFA 4CHGA 5JNVA 4BWJA 1D4AA 1SHLA 5CTAA 3VOSA 3AEKA 3SX0A 3KKEA 4CNQA 3DLRA 5KI6A 1T29A 1YS7A 3CC8A 4ZAXA 2J07A 1DLOA 3EMDA 5AXDA 5GJVC 3T99A 3ZIAA 1FFYA 1FE8A 4O4LF 2OBNA 4JV5K 4TLLB 4LJ5A 2VYCA 5JO9A 2Y0PA 4WZBA 3ZG6A 2W2TA 4IW3B 4ZYTA 5IVKA 2J67A 4XYEA 3R0ZA 3DYAA 1YB5A 3GDHA 2C9BA 1L9KA 1QZ3A 4OIMA 4BO3A 5FUVA 3ZJYA 4GXRA 3S70A 3ISNC 4TT3A 3ZVKA 2IZ5A 2FSIA 3G5LA 2FEOA 2RGNC 1AS2A 2IBMA 5T7BA 2PH7A 3PFWO 4TX1A 4XPIB 5G4LA 3T94A 1Q77A 4R9SA 4FNOA 2UU9B 1FSZA 3OI7A 1R0SA 1GD1O 4LOIA 3RSZA 1I7SB 4CF7A 4X8MA 1TPZA 2SKEA 4HDAA 3DMYA 4EFMA 1Q0PA 4KMRA 1H1TA 4I1RA 2ONCA 4MGKR 1ILEA 1KAZA 1YCFA 2HWWA 2C8LA 3SQ0A 4J2BA 2EG9A 3LKBA 4K86A 5FUBA 3VR2D 5K6AA 2C0CA 4DWIA 5DOZA 1F8UA 4B6SA 2XLBA 1JIQA 3UJ6A 4H31A 3BTUA 4F5WA 1EP4A 4KV7A 1JBEA 3M4XA 1SKRA 4GQBA 1FTNA 3BXPA 4I4NA 5C1IA 1R4MB 3V3KA 3MQFA 1KAQA 3R7LA 3RIHA 1QWOA 3AEUA 4ZKDA 3C3AA 3H86A 3P5JA 4OCZA 1QGZA 1K2VN 3KYDA 2VDKB 3LW7A 1XZ8A 4R7TA 1TKZA 5LDGA 5TGDA 3RUCA 1RRCA 4A2PA 1M34E 2Q0QA 4PLCA 1LRJA 3L0YA 2GA9A 5EIWA 4ISGA 3RJTA 1A27A 1CUZA 1J5XA 2VOEA 1KI6B 2FZEA 2W2KA 3ENKA 3Q9LA 4CR8A 3O5BA 4CV3A 6NULA 2EP7A 1PVDA 3D6HA 5B6PA 2WSSA 5LBIA 3I5YA 3A1FA 2DFTA 3VR0A 1EFDN 1VMKA 1M10A 5DI9A 5JARA 3MCWA 2DFFA 3EQZA 2FPGA 2O8CB 3F0TA 3GYGA 4RTLA 1JBKA 5AW4A 2Z8XA 3UVEA 1HYHA 4LTMA 2PYJA 3P9NA 3H2YA 3X1KA 2JCVA 2VQDA 1GUDA 1J1ZA 2AUNA 3V4PB 1DFGA 2XHBA 4YNBA 1GSAA 5LD2B 2HXSA 2O2XA 2IQIA 2GJ8A 2YV2A 3CUTA 1J4AA 1NTRA 3E2MA 3QJGA 2YMQA 1WTAA 2JLRA 3OM9A 3TE6A 4L6AA 3CKKA 1C41A 2B6NA 2GO1A 3CF4G 4NPAA 3REQB 4BNVA 2B8EA 3SNHA 1V8PA 1XJQA 1E6KA 4QJ3A 3S3OA 1L4YA 3Q7TA 3OQIB 1ZGGA 1XDZA 4JLBA 3UWSA 4G9GA 1JR6A 4WHMA 3VTIA 1YVPA 1IKWA 1I4DD 3H65A 2ZDGA 3FBTA 4S24A 4WBNB 2IC3A 3GJ5A 5FO1A 3THWA 4CU5A 2I7CA 2GWJA 3EEFA 3UWKA 3LHIA 5DGCA 5FLEX 2GRJA 2RJOA 4RZUA 4BRSA 1V25A 3EPLA 5EERA 3P39A 3AVJA 4DU4A 2AI2A 2GLTA 3PX6A 5SYNA 3V80A 4N5IX 1PR4A 2W6CX 3VU3A 6GPBA 4OPJA 3RT7A 4PTYA 4YJDA 1SVNA 1X9IA 1G41A 4DTOA 4AILC 4G4GA 1JF8A 2WFAA 4TV8A 5LBTA 4BKOA 1N6NA 5CEFA 2AZXA 4BMPB 3GGGA 5AW7A 2JASA 5FCDA 2ROQA 4HF7A 4JLUA 4UVGA 4NCBA 1JHDA 2Q62A 4OY3A 4TZ0A 1Z8NA 3ZDZB 2C78A 4BP3A 2HIHA 3IJPA 4DLWA 1E7WA 4BGVA 2IYTA 3JWJA 3ONDA 4X94A 1OJLA 5D3QA 4CZFA 3LWMA 3I39X 3BAZA 4QYWA 3OP1A 1RKVA 3U4CA 2VCYA 4O2BB 5TMBA 5LNK6 4FONA 1A8HA 1P61B 2I6QA 1E96A 2B8TA 2W9XA 3KZ1E 3P97A 4LQDA 3ENZA 3PXGA 2PR7A 2TMGA 3LANA 3EDRA 3G2MA 3M9WA 4OB8A 5EJFA 3TLAA 1SBQA 3AF2A 1ZVVA 2JHAA 3KQPA 1RRPA 5TDHA 4BC3A 1BX0A 2Q28A 3D6AA 1RJGA 4W8GA 4AZ3B 3UB5A 1EQ2A 1UDWA 4UQGA 1KY2A 2N1MA 3N8DA 3OZRA 5HCNA 1UPUA 1UMBA 2BN4A 4HWOA 2WP8J 3F49S 3AC0A 2A0UA 1WP4A 2VAXA 2FV8A 2XYGA 2HZ7A 3O0TA 1RPNA 1OBCA 3ZE6A 1Y80A 1EFAA 1BO6A 3Q8MA 1FFWA 5AW6A 4J7UA 3HEAA 4AKIA 1U0TA 2WA2A 4Y98A 3J7ZO 2Q9CA 2FF6A 4C0BA 4FLYA 1W4AA 3A7EA 3NR2A 1GFSA 3L0CA 5CM9C 4FKBA 1H8ED 1PTJA 2GBIA 1ZM4A 3F97A 3S9HA 4GGOA 3S2SA 4DRXB 1VAZA 3AG6A 1EVJA 4I55A 2XWJI 4G8CA 5KTNA 5FWNA 1IBMB 1OLOA 1SKUA 4R1LA 1QV7A 2KB0A 3WSTA 3BD8A 3JSAA 1A82A 2CYCA 1J5EK 3ISTA 4IR7A 1K97A 5AVYA 1XZKA 3C4JA 1DDGA 3UXHA 5ALJA 4PCUA 4G89A 4F3KA 1A1VA 1ESMA 5CURA 1NR5A 5E4YA 2Z6VA 3WMXA 3CH4B 3CVOA 3G2IA 4TMKA 3VR5H 3PXUA 1KMHA 4PSVA 2IP4A 4D80A 4D8UA 3AHDA 3PNQA 4PVCA 3VVCA 3GB9A 4U7WA 4LF5B 3T9CA 3A9CA 1VECA 3BDIA 2C61A 3CO5A 3QV2A 1IXKA 3F5TA 1EEHA 2WUWE 3IP9A 4BO4A 1Q1EA 1H2AS 2GN4A 4RZ2A 2BCGY 5FBKA 3VPFA 5K8LA 5B1SA 2BMJA 3AUXA 4EUFA 4HT3B 4BAUA 4PQUA 1Y3BE 3L02A 1UA1A 1VL1A 2O8EB 3IEPA 3FXAA 1GU7A 2APJA 1C9MA 2IEBA 4FE3A 2JG3A 1YFLA 3O8RA 1A9RA 1LPNA 4AMUA 2KPOA 1NKCA 1P1IA 5KRTA 5B58T 2WB4A 1WU8A 3VSCA 4EJSC 1TVKA 5I9NA 4EF4A 4HPWA 4OM7A 1W30A 2PJRA 1TM3E 1RRMA 4X64K 1GPYA 4G5QA 1JL2A 2ZGZA 1R4MA 4U9IS 4CEHB 1JHQA 1YR3A 2BZGA 2DSTA 3O8OA 4YCDA 2QJRA 3JRWA 1A98A 3V32A 3R0JA 3VOAA 4EITA 3AF6A 4TT3D 1KBQA 3V55A 3SK0A 1ZO8A 1DJLA 1FTSA 1QF7A 3H83A 4BZQA 3SS9X 4QKQA 1AO0A 4YAWA 4H1HA 5JD5A 2BM9A 4OXKA 1K7YA 3DRRA 1QSGA 5KO2A 5IJAA 4M9QA 4OQMA 2V1UA 3QK7A 3D3EA 1UPBA 4JJ4A 1H42A 1UFKA 3FX2A 2IOHA 3NJ4A 4I55B 3ZW9A 4DGQA 4JENA 1X70A 4B75A 3DV0B 4D3DA 4EELA 1F2UB 1K6IA 1ZWLA 5CH3A 2EIXA 3FNHA 4UM7A 3H7IA 5CG1A 2XCOA 1UXJA 1UWBA 4OO3A 5D6OA 1N4AA 2P68A 4IIFA 4Z0PA 5AVRA 5K8JB 1S9GA 5JFGA 4ZAVA 5DKFA 5D00A 3RYCA 1C9KA 2KW5A 1EKEA 2UUBK 4OVLA 4XPIA 4G9ZA 1GL9B 5AZIA 5MLCQ 3DKVA 1QH1A 4FEEA 4I50F 3DHNA 3MWPA 5EOYA 2IA5A 2Y05A 2H5JA 4PGGA 4IM7A 5ALQA 3G2LA 4FOTA 3EZXA 4JXXA 2PCLA 3Q5EA 1JG2A 3GR6A 1GQQA 4KKVA 4NZZA 3RVKA 3DEHA 3RS4A 2QVYX 3SVTA 4JN4A 2YZKA 3G2OA 2JGAA 4MWSA 1X80A 2IEDA 2WNIA 3TBKA 3KKZA 4AZ3A 3FOFC 2R751 3VSBA 4G97A 1DJQA 3PXDA 5BN5B 2HPHA 4GAEA 5H83A 3SYNA 1IYZA 4FWNA 5IBRA 1L7XA 3AONB 4EB8A 4W7IA 3UCEA 4MAAA 4BXOB 3NTLA 3EF1A 4RVSA 2FYTA 1H65A 4RPHA 3KEQA 3UM9A 2ZRLA 4ISEA 4R7ZA 2VGNA 1IV0A 1XTBA 4IIEA 4DNOA 1R16A 3S41A 1THTA 1OXMA 2FR8C 3B89A 5TSDA 4M3WA 2AOXA 2CSUA 1M2OA 1DQPA 4OI0A 5H9WA 4JOQA 1XI2A 1A2OA 2CHGA 4O55A 2PKWA 3GBVA 4GLOA 1WKVA 3HBLA 4OQYA 1F0NA 1KEVA 3LNCA 4RWEA 5KSYA 1Z7YA 1HA3A 3L5KA 4BMCA 4DS4A 1VQON 3KKQA 4JB2A 4YTEA 2B30A 3EZ2A 3QUBA 4PZZA 2CMDA 4AUKA 1DFIA 4C30A 4H27A 4U0KA 3A8TA 3RI3A 4UU1A 1QSLA 2MSNA 3AJ8A 1QHFA 3ETDA 4LOJA 1X8XA 2UVDA 2I67A 1BE6A 1U2VA 5EE5B 1E2UA 1SZJG 1ECPA 4DV2K 1XBTA 2P0AA 2P5YA 4AY4A 4D44A 5IXYA 4PXAA 2IIPA 4F9GA 2VHJA 4FR5A 1BDGA 5AVUA 4YP6A 5TX7A 1F2UA 3KTFA 5CVCA 1RDAA 2XF8A 3DEKA 3NVDA 4RIIA 1KJIA 1R1DA 4BQQA 1FDIA 1J1UA 3TL3A 2VWPA 5CVEA 3TM4A 2HV9A 4L2IA 1CVRA 2PKEA 4JS4A 1QORA 3TNLA 5THXA 3GH3A 5CIWA 4ZDJA 4X7PA 2I71A 3AIIA 1WVIA 2QR2A 1ZK0A 3O75A 3BGRA 2JFXA 3EDCA 3KYBA 3NALA 5TR9A 4BVKA 3ORHA 3SQWA 1QC5A 3PX4A 2RAFA 2IY9A 2DJIA 3WAKA 4AMGA 4NG4A 3I6IA 4XFDA 1PS8A 3CZPA 1T3HA 1PJBA 3SLGA 4E6PA 3TFQA 4OQLA 2FWPA 3ZIAD 4Y2RA 1AUOA 4BDTA 2G5TA 2RAUA 5BREA 2WZBA 1G3MA 2BBOA 3AB7A 1Y8CA 3K09A 3P9PA 1MA0A 1G21E 2P90A 4TYMA 3SDZA 4PSKA 4J6EA 4RK1A 4EENA 1IN7A 3TUZC 3MYRA 3L6QA 1V5WA 5GZ1A 4HZIA 2HH9A 3HWWA 4MVJE 4EGAA 4QS9A 2PHZA 3HM8A 4OGKA 5G1OA 4FJGA 2OO7A 3E81A 4LYEA 5BVHA 5CA0B 5DJ5A 2QRJA 1OR8A 2H7YA 4Y1RB 3VZBA 1TKCA 3H6HA 4I1PA 4L02A 3JQFA 1NVAA 2VF5X 5CDFA 1VJGA 4UDXX 1LH0A 1O4WA 3VQBA 1HT1E 4CLXA 3GAFA 2XH8A 4LVUA 1YTAA 3WSWA 3A6GA 2G1PA 1VIVA 4MQ5A 1NJYA 1MDUB 3JQPA 2IHTA 3EZ7A 1I0ZA 4MUHA 2J3HA 4CF8A 4A2AA 3NI2A 4ZO6A 4AKGA 5G02A 1GKIA 2OK8A 1KMNA 2PL5A 3G9TA 5ERXA 3ZJ4A 1ID8A 4CF0A 1QR6A 3M49A 4XUDA 4CZEA 1AIPA 3G3EA 4LJKA 4LNUA 3B1JA 3L40A 2J5QA 3NVKI 2VDOB 1B41A 1VBFA 3V4IA 4PN3A 4XFKA 2I2XB 2A14A 2L82A 2WWTA 3OYCA 4LMAA 5HRUA 4KR2A 2Y1XA 5JEDA 5G0WA 2EGUA 4L5IA 3DPUA 1N6PA 3UJBA 3V8NA 3VPXA 2B5VA 2B5WA 3ABQB 4BGEA 1LJLA 4UM5A 1MF7A 1ODTC 3AKYA 3D1VA 3F47A 3TKLA 3VQ4A 4A57A 1JBQA 3NHYA 5EJ2A 1NLFA 2VXOA 4YDUC 4XX0B 5CGZA 1G2IA 2F55A 1VMDA 4O2RA 1MO4A 2IF0A 4YH1A 1G8JA 2XT0A 3N07A 2HTEA 4YWHA 1Z73A 2E4XA 4N5NA 4MGZR 1KETA 5I7SA 3VC7A 3BWEA 4W5WA 1JHUA 3GO4A 1RJEA 3BXHA 4OXRA 3U6KA 2EC5A 4GP9A 5TJHA 3QUSA 1NNSA 2HHCA 4E1AA 2AR9A 1J54A 2ZPTX 2HI0A 4GPZA 3P27A 5EINA 5E3JA 4K40A 3H04A 1CJMA 2R8YA 3VPZA 2UZ0A 3ODPA 4XGQA 4LJ4A 1VSJA 5HK8A 3UENA 2H7XA 5KZMB 4KKXB 2OORA 1I36A 1WHSB 1JLLA 3LU1A 4L74A 1PN3A 4IDPA 3SHTA 4E4RA 1GLNA 2G82A 3B3FA 3N3AC 5ANRB 3VTFA 3ELBA 4BHTA 2J9YB 3AR3A 4KE9A 4TLBA 4XH4A 1GUZA 1P7VA 1YBHA 4FD2A 3ZKAA 1OX4B 3H2BA 2EYQA 2JIZD 3BHMA 2FK7A 1MXFA 1FJGK 3PHBE 4XVQA 2R2GA 3OQMA 4Q47A 4D9HA 3H2ZA 4EG8A 3A3NA 4XCVA 2AKAB 3ER6A 1EE2A 2ODEA 4OM8A 5IHPA 1IBLB 1LJUA 3VI3B 2H4ZA 3N6RA 4C43A 2V6MA 3OX2A 3GBPA 3PRJA 3HBNA 4CVNE 3HADA 3I33A 1KD1O 2UYOA 4ND2A 4FILA 4UEJA 2WC9A 1U2PA 1M7GA 4BMXA 5LZ4A 1P8JA 3CZRA 2ZEJA 4Z51A 4Z4QA 4LH4A 1P44A 1HOTA 2FFAA 2HMAA 4KGXA 4L4SA 1QK4A 5JSHA 3IUCA 1CQJB 1K3TA 2KW4A 1OU0A 2FGJA 3NGLA 2X86A 4NAVA 5E6SA 1CS0B 3C5WP 2O4GA 2BGRA 5KNDD 4PIMA 5E1MA 5BSMA 5TARA 1J9EA 4Y9DA 1ABBA 3W9BA 3T5BA 3V1OA 3WBFA 5AQPA 1WB9A 1HFKA 3BJIC 2G8KA 3CJRA 3PSIA 1VJRA 1DXQA 1JSRA 4YDSA 3RU9A 1CP2A 1ZSYA 2IEZA 3QE4A 4QBHA 2VJCA 2PY5A 3E8MA 4ZALA 4CEJA 1NVVR 3V46A 1SXGA 4V39A 1NDUA 4BFYA 2AHRA 2DBVO 1UADA 2O6LA 4NJMA 4E46A 4HV4A 4MR9B 1EINA 4DLXA 1PV4A 5BUSA 3OYEA 1WZ2A 2DPNA 1IBSA 1PKXA 3PNOA 3DOFA 4MV3A 2A59A 2EP5A 5A4DA 5JT1A 2NQ8A 3A1UA 4Z1MA 2OAGA 4IILA 3UHJA 1SU8A 4C76A 1UBCA 3EXAA 4GOJA 1S6QA 1XCJA 4MVWA 3BQ9A 1W36D 5JC8A 1TMYA 3PI6A 3HZ6A 4QGSA 1YK0A 2VNJA 3R6DA 6CHYA 5D5QA 3QE2A 1EJ6A 4TL6A 4LZOA 2CLKB 3FLBA 4F4FA 4K6KA 3GEPA 4REQB 4G5HA 3UATA 1VHTA 4D46A 2Q8QA 3NUQA 4ES6A 1WJGA 1HRHA 3H9QA 5DISB 2AQKA 3ET5A 3L2OB 4B3XA 2XQKA 3OYBA 1RMTA 3P20A 2G8IA 2FQ1A 4PG5A 2H2FA 2IUSA 4L73A 4MVJD 3A4MA 1O0CA 3O21A 1KPIA 3OT1A 3GBTA 4UM8B 1S72N 2GA8A 4MS4A 5CYOA 5JV5A 1HZZC 2WMDA 3ZGXA 1G42A 1CZBA 1YSCA 4WW0A 4CJSA 3JWGA 1UQRA 2YMPA 1E2KA 4DIEA 2NSYA 5JI3E 4CQJA 1KJYA 5KNCD 4RGYA 4Q3CA 1IMJA 4N40A 5JJKA 3MCUA 4HX9A 2ADMA 4IINA 1XZEA 5EKUA 1NN3A 4N3NA 2IE0A 4OJYA 3ZE2B 2QRUA 5J2TF 2RJNA 4KHNA 4KWIA 4UTZA 2IWHA 1DXHA 1JA0A 3FWNA 1GN8A 1NP7A 3TS1A 2VHYA 4Q7EA 1BG6A 2R8OA 1VLQA 3O9UA 3EUFA 3B1XA 4DRXA 2JLVA 2OCAA 2ZI5A 3BDAA 4M9UA 4BP1A 1DCKA 4L8RB 2FG5A 2HA2A 4NU5A 4TQ9A 4OXYA 3RTAA 1S3FA 1WBBA 1KLNA 2BR3A 2C31A 2P6OA 3R24A 1KVQA 4GM1A 4NICA 5ALMA 4HTUA 3MHTA 4BY9E 1RT7A 3DVLA 3HKBA 1VMEA 1WRBA 4GKAA 3V2IA 3PXEA 4RHUA 2P3LA 4DV3B 3DLEA 4JKDA 1YIOA 2HRZA 1GLGA 1ZBQA 2UZ1A 1Q9YA 3LUFA 1SXJE 4PIPA 4XB2A 4KFRA 3WR5A 2PEZA 3W0LA 3STHA