2BGGA

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt sirna duplex.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
417
structure length
395
Chain Sequence
b'LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMEGTKVKLSSKRYLLTLLQPYVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINRSLQTNPWFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN AF1318
publication title Structural Insights Into Mrna Recognition from a Piwi Domain-Sirna Guide Complex
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna-binding protein/rna
total genus 134
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2bggA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bggA01
3OYIA 3U3YA 2EX3A 3LUFA 3LWLA 1S8NA 4MS3A 2A9PA 1ZVVA 3OMXA 4IMJB 3TAFA 4LZLA 1PHRA 3QLUC 3B2NA 1BHLA 1ASWA 4DF4A 4HNRA 4MRMA 4FJ7A 3O74A 3HEBA 2R7YA 1ZYQA 1D9DA 4TMYA 3S3MA 1C6VA 4CJTA 4KPYA 3O2SB 4G0XA 3SZ2A 1F51E 5D2CA 1BDJA 2FBXA 5JNWA 2TMYA 3HZHA 2OPPA 4RW7A 5C42A 4Q5VA 3OYCA 3KLNA 4Z0NA 3ZT0A 5DGCA 5DCLA 1W0HA 3LMKA 3CZCA 4OLAA 4J2AA 4M41A 3N6VA 1SL2A 1Z26A 3NF7A 4ID5A 1GUBA 1L5ZA 3KKSA 3U3GA 2OYQA 1QS4A 4E7JA 1J54A 2LBPA 4KRFA 5HRNA 2YNHA 1Z2EA 6ABPA 4QYWA 5EU7A 3KTQA 1F4VA 4NCGA 2WB4A 2A1SA 4CEBA 4FVMA 2XO7A 1H9CA 1RDCA 5BQ3A 2G8VA 1IKVA 2QSJA 1LWFA 3HPGA 3MMNA 3DGFC 3HV2A 4DTNA 1EXQA 3TO5A 4DU1A 1NKBA 4M3WA 2MSWA 3JVIA 4LE2A 4CK3A 4CECA 4EYGA 1WAJA 3FFWA 3O21A 4KHQA 3ZT4A 2P5OA 4G0OA 3QETA 3F6PA 4L85A 3DMJA 4J2EA 5FRNA 4Y1DA 3SUOA 1GOCA 1QSYA 4IKFA 1SXGA 1ZDMA 1W25A 4FLWA 2QKBA 4CGGA 4DS5A 1DTQA 2HMIA 1HQUA 2QK9A 4CEFA 5I42A 3NGZA 5HSGA 5KRSA 1FFSA 4H8KA 3H5TA 1SUQA 4DQRA 1U47A 3AVAA 3SJJA 2ZE2A 4Z4HA 1ZGZA 1NOYA 4FJ5A 4DFKA 3QELA 1BQMA 1KFDA 1ZITA 2M98A 4LX8A 3ZSYA 1XHZA 4RY9A 4CCHA 4JRQA 3Q9SA 1P6UA 1DBPA 1S1VA 4E7PA 1X9MA 4NQRA 4KB0A 3CTPA 4RZSA 3MAQA 1B92A 3S3NA 3URMA 4E19A 2HB5A 1JKHA 4ZJPA 5BRJA 3ZT2A 3RVMA 3F9KA 4GNRA 3ALYA 3TAPA 2JRLA 4DTPA 4DSJA 3BBLA 1VRVA 4B9TA 3C3WA 4CJSA 2EHGA 1SXHA 1S1XA 4L4UA 1VPWA 1RBTA 2KW4A 1PUXA 5JNUA 5TQ2A 3I09A 3VA3A 2FN9A 3AVGA 3V9WA 2BANA 3TX6A 4IGAA 3VA0A 4RW4A 5HLFA 4CE9A 2DRIA 4EVSA 1RDBA 1RT7A 4H4OA 3DLGA 1ZAYA 3KK3A 3OS2A 3K59A 4ELVA 1UWBA 4LE0A 3T1AA 4FJ9A 4FE4A 4RXTA 2E6MA 2MYPA 1K6YA 3AVIA 4CEAA 1YS6A 1M2EA 3MEGA 2DFEA 4CGFA 1JDNA 4MLDA 4CF0A 5J2NA 4S05A 2GI4A 2JBAB 5C25A 2O4GA 2QXFA 5GOTA 1QP7A 3V1QA 4IFYA 2Y1IA 4FJ8A 1C1CA 3V81A 4RU1A 3MM4A 2ID9A 3ASMA 1JDPA 2GBZA 5TQ0B 2FBYA 5EWJB 2XY5A 5KC9A 1YT3A 2PLNA 3L3UA 5KQLA 1KVBA 4B3OA 4OPJA 3SUQA 3JS5A 2KQ2A 4KI6A 2HPHA 1GUDA 3CFPA 2FEWB 1DTTA 3SY8A 3OQNA 3LUAA 1CZ9A 4N0QA 3ZSXA 1CXQA 3I45A 3N8IA 2RN2A 2R48A 4FLTA 3SUPA 4XXHA 4IILA 1BDHA 3OYNA 3RVLA 1WNSA 2WONA 4LD0A 4DF8A 1A0OA 1NJWA 4OG2A 5CNMA 1UAXA 1JHZA 3KLGA 3LPUA 1JYEA 3V9SA 4PUOA 2XHBA 4KQCA 3OJSA 1LK0A 3UUGA 1JX6A 3IG1A 3HSTB 2PZSA 2XY7A 1ZY2A 3KLHA 5JNVA 3MF4A 3GBPA 1VSDA 3OYFA 1T8EA 4FJKA 3HL8A 1TL1A 3HO1A 1Z25A 4MQEB 2LIVA 1BISA 4CEOA 3V9XA 1U45A 5FWYB 4WWHA 2KZMA 4OATA 4Z4CA 3DLHA 1XI1A 4C8MA 1QHTA 4JA2A 3HT3A 3L2WA 4Y1CA 4KTWA 1Q9YA 3D45A 3OO0A 1HQEA 4RKQA 4DTUA 2PL1A 4E3SA 3LP3A 4CGDA 3CKMA 5FROA 1U4BA 1D5WA 2ID7A 4Q6WA 3OYLA 4XIUA 2RGYA 4CJ4A 2IPNA 4FLVA 1WSHA 1RDAA 1USIA 1YK0A 2MYNA 1NATA 4PWDA 1Y1LA 3ITHA 3RWUA 3DRSA 2L18A 3B6OA 1Z18A 4UHJA 3GWGA 3IP5A 3K4HA 3OYKA 3SAJA 4FXDA 4HNSA 3EZ5A 1JYFA 4KV8A 3VQ5A 1GOAA 1BAPA 3I0RA 1NY5A 1DLOA 4DLGA 1ABEA 3T8YA 4DQPA 4EYQA 3RRGA 3EULA 4FLXA 2A9QA 1P2FA 1B9FA 2Z1GA 4MR8B 3RVSA 5DTEA 2HQBA 1C0TA 1D2AA 1IKYA 4KK4A 3N0RA 4ZTJA 3F73A 4LY7A 4MFBA 3ZSVA 1KSPA 5CNKA 1KRWA 3A0RB 4KHUA 3A10A 2D0CA 4I9QA 2MSLA 3KLFA 4JAVC 3FDFA 4F8RA 1S1UA 4W5QA 3LWMA 3H5OA 5HQJA 3Q41A 4FK0A 2PUFA 4GVMA 4PY5A 1RZRA 5IBQA 3ULDA 4CJ5A 3G10A 3DRRA 5IUKC 1S9EA 5EWMB 4CEZA 3AVHA 2HHTA 3QEKA 2YHAA 1TGOA 2HJ9A 2ZAYA 4F11A 1XHFA 3QERA 3NHGA 4AHTA 4DADA 4FZYA 1FXXA 4E1NA 4WZZA 1B9DA 2E4WA 1RZRD 3SQ0A 3M8SA 1QPZA 4E1MA 4Z9BA 4IDKA 4CIGA 3TI0A 3RVOA 1Z13A 1FK9A 3P83D 2HNZA 3NGIA 1NXWA 3MQ4A 3O4QA 5E41A 1LW2A 1U49A 4KFBA 4YRZA 1JLEA 3KKEA 3CLKA 5EWLB 1TV6A 3DI6A 5J2PA 1CLQA 4MS1B 3EY1A 4DTRA 4E7KA 4KV7A 4B9UA 3CFOA 1OXBB 1ZGGA 1UOCA 2YNIA 1E6KA 1HNIA 3AO1A 4KHWA 3O1JC 3IAYA 2PYLA 4EZ9A 1TMYA 1A5XA 3FFIA 4DN6A 4AHUA 4CJEA 2PL9A 1EETA 2HHUA 3VNBA 4H60A 1J56A 5HRPA 1DRKA 4CESA 2GKGA 4Z4EA 2HHQA 2NT3A 1G15A 4FW1A 3OYGA 3DLKA 4B08A 2G8HA 4C8LA 3GBVA 3KJVA 2I5JA 3GL9A 2JBAA 5CNJA 4OPKA 4BE0A 1JF8A 1TM2A 2NZUG 3G85A 4YV7A 2PUGA 1NKCA 4CEQA 2ATQA 4OBBA 4W5TA 2PAFA 3I0SA 1TK5A 1RTHA 3AA3A 3AA4A 3NF8A 3IP6A 1Z17A 3C6QA 5TQ0A 4DQSA 4ZYLA 5EWJA 3CZ5A 1JL2A 3D0PA 3MA0A 1XHEA 2QR3A 2PKXA 4FJGA 4G0ZA 5FRMA 1A5VA 1TAQA 5IX8A 4AHSA 1JL1A 2Z1HA 1L3VA 2CHEA 2Q3SA 3N0WA 3RVKA 4YO7A 4HCCA 4RK5A 3H75A 4PZ0A 2IPAB 3VQ4A 3L2UA 3H1EA 3QEVA 4G0YA 3E01A 1QSSA 4FM1A 1SKWA 2IYNA 3M8RA 1SXIA 1L5YA 4OKKA 1L5UA 4AH9A 1PEAA 1D8YA 3RMAA 3PO4A 2Z1JA 2WY2D 3HP6A 3CM6A 3HK2A 3EDCA 1ISRA 3JYTA 2Q5CA 4XASA 4LSNA 1BCOA 2IPMA 1NK6A 2HNDA 4O55A 3VQEA 4MS4B 4KI4A 4YLEA 4CJPA 1SD5A 2FTKE 2P1JA 3LALA 4MQEA 3RVRA 5FBHA 3UKJA 4I9LA 5FWYA 1APBA 4D6XA 4B9MA 1T34A 3T6KA 1DBWA 3HVTA 2L19A 3M9WA 4EVQA 1CYEA 1JLFA 2QVCA 4KK3A 4EP4A 2FXIA 3JPYA 2E4YA 2ITGA 4OLBA 4MR7B 3RR8A 3FFXA 2PJUA 4RKRA 3DZDA 1NK7A 1NK8A 1RBRA 2L17A 1RT4A 3L6UA 2B6AA 4CK2A 2PUCA 3L2VA 3VQ6A 4DQDA 1WETA 4YGXB 4CFCA 2HSGA 2NUBA 1XC9A 4MYRA 1AB6A 3HPOA 1MU2A 2CD7A 3AO4A 1HJRA 3H5VA 4CHZA 1NXOA 1BA2A 2RJOA 2IDOA 4XARA 4KVFA 3CHYA 1IG9A 4BACA 4EUKA 2KZZA 3KYJB 5SZTA 1NJZA 3WNGA 1ISSA 1SKSA 3OLZA 1VSFA 1OXKB 4MR8A 3VQPA 2HVHA 3QINA 3K58A 1USGA 4FB4A 4IF4A 1SRRA 2GBPA 4RY8A 2HNYA 4F2SA 4CEEA 1U8TA 2FMIA 3LUCA 4AHCA 3QEWA 4OGCA 2M1ZA 2FC0A 2WJAA 2OPRA 5TPZA 3MEEA 3LOPA 2DTUA 4FJJA 3QO9A 4M3UA 5JNRA 2QXYA 2FN8A 3IPCA 2A1RA 5GQSA 3NHMA 1VRUA 1VRTA 4TLLB 5EWMA 1NXVA 4O44A 1TKTA 3VQAA 3LKBA 3RQIA 4B9SA 2HHXA 3O3FA 4DQIA 4CHYA 3DGEC 2ETJA 5TPZD 1XWWA 3DM2A 1CHNA 2PUEA 5KQMA 1ITGA 3ISNC 3RMCA 2VUHB 3EGCA 5CY4A 4CFBA 4MPTA 4D74A 4E7HA 2IOYA 3CU5A 3AVNA 4DU4A 1DCFA 3SM9A 4D6YA 4ZMRA 5KTQA 5HM6A 4O0JA 4XLTA 3AO5A 2XY8A 3OYMA 2G8KA 5IC5A 2LP4Y 2P4UA 3MXJA 3UIQA 3KLIA 4Z4FA 4KHSA 1A04A 1C0UA 2PMCA 3EAFA 1IH7A 5EWLA 5K14A 3SPZA 2PUBA 3FFTA 4MS1A 1GCGA 5HBMA 1VKRA 4FK2A 5T7BA 4MLCA 1L3TA 2JVIA 2IDMA 5JNSA 4CEDA 4J2DA 2LUOA 1U2PA 1RTIA 1NK5A 4G0PA 4KREA 2B5JA 3N53A 3NF6A 3A0UA 4OKJA 3A3KA 1QQBA 4ZTFA 2X6NA 3TABA 3NNDA 2IS3A 3KD1E 3QLVA 3IDOA 3MEDA 3NH1A 3FMVA 3DOLA 4NV3A 3RTVA 4BDPA 4P1ZA 4B9LA 3N0XA 3HSYA 3F7NA 3KTOA 5CZ1A 1IKXA 2PY5A 4M3XA 3DLBA 1VSIA 3QLVC 3BRSA 2VG5A 1E6MA 4ZHRA 3QIPA 2R47A 3H6GA 4JP1A 4IRXA 2QVGA 3SV4A 3IS9A 3DOKA 2X78A 1EP4A 5I3UA 3H5IA 3DRPA 4TSXA 3VQCA 1QMPA 3QEIA 1SL0A 3OYJA 1JH9A 4K8ZA 5C5EA 4IG0A 3ZSQA 3HDGA 2HHVA 3MXIA 3LPTA 1DC7A 4F2RA 1KMIY 3K9CA 3QLTA 1VSKA 4O5AA 1EWVA 3ZT3A 3SQ1A 4MAAA 2FQXA 1UA0A 1WSIA 4H3HB 5IUJC 4FE7A 1RTJA 4BE1A 4CFDA 2FBVA 3ZSWA 1ZN2A 1RXEA 3EQ2A 2HHSA 2OZMA 3PY8A 3CS3A 1JWLA 1Z15A 4MS4A 4YP9A 3QESA 3SYZA 1Z12A 1JXBA 2E4LA 4NYNA 3HM9A 1A2OA 1D9FA 3QEXA 5CYQA 3NNSA 2FLKA 4F3OA 4B8AB 3D8UA 4HTUA 4Z4IA 2OA8A 1W9HA 3F6CA 3SCXA 1FFWA 2JLEA 3JY6A 4OJRA 4EVRA 1BDIA 5IEJA 1NJYA 1RT1A 3T19A 3LUGA 2A9RA 4G1QA 4ELUA 4Y9TA 4MR7A 4YNQA 3OQMA 1NJXA 4PEVA 3M8QA 2CWDA 2E4UA 4DU3A 1IIBA 3VQ7A 2H0AA 1WSJA 4B9VA 3VQDA 3SQNA 3BREA 3BILA 1DC8A 4EYKA 3L49A 4N41A 3LUJA 4KMRA 1URPA 3OLVA 3HJFA 2YHBA 5HRRA 1DJMA 4UQGA 3PX6A 1RT3A 4FJHA 1R8JA 3T95A 4LRQA 4DFMA 1LW0A 3C6TA 4Z99A 4UHKA 1E6LA 1HNVA 2PUDA 2X74A 4YCSA 4P98A 3AO3A 4W5RA 3QLHA 3OM0A 3MXMA 1CEYA 2BE2A 4K8XA 3NH2A 1BCMA 1DBQA 3FGZA 3HS3A 3TMYA 3CG0A 4CF1A 2P5GA 4RK0A 4HVJA 2Z1IA 1S1TA 1D5AA 1RT2A 3QK7A 2WMYA 4CJFA 1IKWA 3KD5E 3K5OA 3SG0A 3LANA 2FLWA 2OQRA 1M5UA 4XAQA 1X9SA 5HRSA 5HP1A 3AVLA 3QEMB 1ABFA 4FLYA 2D5RA 1YTAA 3TARA 3QX8A 3AVCA 2HHWA 3LFTA 4LDAA 5PNTA 2F8TA 4R5PA 1YMVA 1REVA 4PQUA 3KSMA 1KGSA 3I5AA 1WSFA 4E0DA 4CHOA 5D3GA 3CYMA 2X6SA 1U0SY 1QP4A 5IEBA 1EWTA 1DRJA 3TR8A 2P51A 6CHYA 1TKXA 1LWCA 2ZQBA 4ICLA 1JLCA 3QIOA 1QKKA 4F12A 1VLZA 3BGRA 1BIUA 4CJUA 1YIOA 4AHVA 3NFAA 1UA1A 3A2FA 1MB3A 1ASVA 1JLKA 5KI6A 4FZZA 4RG8A 1KRXA 3LAMA 4M3RA 3K2PA 2OPQA 3RRHA 5IUNC 1FFGA 4CBVA 2WRZA 3OQOA 3GRCA 1LBIA 3RVJA 3OMWA 2IPLA 4F8JA 1LJLA 4BE2A 4JASB 3H1FA 2G8UA 5JS2A 3HPHA 1S1WA 3LZIA 3E3MA 3CRNA 3ROTA 1GOBA 4RW8A 3SNNA 1SL1A 1B00A 1QP0A 2QV0A 4FJXA 3E61A 3V4IA 4OVLA 5KWSA 1VSMA 3THVA 1TJYA 3NF9A 3PV8A 3H5LA 5FWXB 4GMJB 1RBUA 1BIZA 4JS5A 4HNQA 1RNLA 4G97A 4MQFB 3LP2A 3O3HA 3B6PA 1BI4B 3LUHA 3CM5A 3VQ8A 3LZJA 5CNIA 1HYZA 4XFKA 4ML3A 2D0AA 5TPWB 4CJVA 4KZKA 1NK0A 3CG7A 9ABPA 3HYFA 3LAKA 2E6LA 1F21A 4Q0BA 3C3MA 3P9YA 3TAMA 2H3HA 4M88A 3T38A 4DS4A 4JB0A 4CJ3A 1RCHA 3V1OA 1VSLA 3R0JA 4QPJC 1YTUA 3H1GA 1SKRA 4KB1A 1RT5A 4RY0A 3SNKA 3OM1A 1EX4A 1TKDA 3NNNA 3TD9A 4LH4A 5FBKA 4PYRA 2OZSA 1ZESA 3OLXA 2FKAA 3OYDA 4H3KB 5DLEA 4MQ3A 4Z4GA 1J53A 3MIZA 2JB9A 1BGXT 4N5SA 4QYMA 2JK1A 2RJNA 4N0PA 3KCNA 3WNEA 1TVMA 4RDCA 3IP7A 2JGUA 3AO2A 4FLZA 5IULC 2VWKA 4DSKA 3H08A 1K68A 4FYDA 3HVRA 1TLFA 4CF9A 2QKKA 4O1HA 4KAZA 1WSEA 4E89A 1K66A 3EJWA 4M3YA 3KIOA 4N76A 4EYOA 5J2QA 3NH0A 3LKVA 4NCBA 4ETMA 3QLUA 2E4ZA 4EY3A 3OS0A 5KC8A 4M42A 3KYIB 5CHYA 4FJLA 2YNGA 1FKOA 1HEYA 1JL3A 4OTZA 1T05A 4RS3A 3Q7SA 3ILHA 5BRAA 2XRIA 5JNTA 3KKRA 5ED4A 1Y97A 4WXEA 1C0EA 2GX6A 3QX9A 2MYTA 4NYFA 4O5BA 3EODA 2FSPA 1R0AA 4DWIA 1J9AA 1TK8A 1JLQA 5C24A 3H5WA 1VK0A 2QZJA 3LDSA 4YS6A 4N47A 3L2RA 1EAYA 4CJRA 3ZT1A 1KLNA 3OYAA 4HUEA 1RPJA 2FBTA 3W9SA 1XHXA 2OPSA 1O1WA 4N03A 3EYZA 1P6QA 2FMFA 3BRQA 4MR9B 3TAGA 1DCKA 1P8AA 1MIHA 2N9UA 5HKOA 4Z0UA 2IC3A 1N6QA 5TE9A 4KKOA 1LAWA 4EP5A 4CJQA 4RV5A 4Q6BA 4HUGA 1Q8IA 4DTMA 4B8CA 2ZD1A 3OY9A 2F8SA 3OLWA 4ETNA 3LTEA 4Q7EA 2YV0X 4CHPA 4CIFA 3LP0A 1U48A 2G8FA 4IBNA 4YFUA 1ZH4A 2FQWA 2RDMA 4JB2A 4Z9AA 4BWMA 4E7LA 4KQ9A 3JVDA 3CG4A 5FDLA 4RK4A 2O4IA 1NXTA 3ILYA 4DFJA 1S5JA 3QNNA 1LV5A 2J48A 2VK2A 3QEMA 4EGSA 4DFPA 1TKZA 3C94A 4WE1A 2BDPA 1HMVA 4C8KA 2HW3A 1FSPA 2DFHA 2IAJA 2IOCA 1MAVA 2XDYA 1S6PA 2RF2A 3M8PA 1RBSA 3IPAA 2OENG 1IO2A 2KTQA 4I2QA 1TAUA 2KYRA 3QNOA 4FJIA 4HHTA 2RPIA 2G8IA 4RW6A 1Z2DA 2JCGA 4DTOA 4TLMB 2FVYA 1USKA 1C1AA 2D0BA 1L3UA 1FKPA 2XY6A 3NBMA 1U04A 1ZBFA 3AA5X 4FJNA 1HRHA 2YKMA 2HQOA 4FCYA 4ZMSA 1FQWA 4MGEA 1D1PA 3OJUA 3RH0A 4RK1A 3VN5A 4NCAA 1X9WA 1CZBA 2R4QA 1QE1A 1MB0A 3JSMA 1QQCA 4CJKA 1E2BA 2KFZA 1C0MA 5J2MA 3DBIA 4LSLA 4YWHA 3HDVA 4KHYA 2X7XA 3PO5A 5FWXA 1GLGA 1EWKA 3EQZA 4MQFA 1YVUA 3ZSZA 4CGHA 2GV9A 1ZHHA 1BI4A 2AYXA 4JRPA 2YKNA 1KFSA 4RW9A 5TPWA 4DLEA 4CHNA 4J2BA 3AVKA 3QEPA 4WXMA 3K5NA 1DP4A 3D02A 1A5WA 3KLOA 3M6MD 3DLRA 4ID1A 4DTJA 1LJUA 1JLBA 3M9XA 3C95A 3KK1A 3TAEA 3NGYA 1D4ZA 4N56A 4DSLA 2MSKA 3L3VA 4QOZB 1PEYA 1ZBUA 3K5MA 3RVPA 1LBHA 8ABPA 4E7IA 4GW6A 3T3FA 2IGIA 1YMUA 5TQJA 4FW2A 1KVCA 3L8BA 3RMBA 1QNLA 1RTDA 1TL3A 5HROA 1WN7A 2PE5A 1RBVA 3SV3A 1ZH2A 4M3TA 2VUIB 1NK4A 1NOZA 2GWRA 4B09A 4WT7A 3VNAA 3U6FA 1NXPA 3LUDA 1I39A 4NICA 5KQPA 2R25B 3SQ2A 3C3KA 3V9UA 4WUTA 1QQAA 4I7FA 5J1EA 2Y1JA 5KGXA 1BVHA 1JLGA 3IP9A 3NCIA 4PICA 3I42A 4S04A 3Q7TA 4FZXC 1SV5A 2CHFA 2V0NA 1VSJA 1I3AA 1EKEA 1QO0A 2DFFA 5I4CA 2PUAA 1JBEA 3C6UA 1C1BA 3GYBA 4DSEA 1Z16A 3NE6A 4CF2A 1WAFA 4MS3B 4F06A 4CJWA 3Q15C 2MYUA 3LUKA 4LDZA 4LE1A 3SUNA 4MRMB 3MYYA 3VQBA 1LWEA 2YNFA 1RDDA 5CYMA 1ZBIA 3KLEA 3ROFA 4FLUA 1NXXA 1QO0D 3JPWA 1X1PA 4GPAA 3P5JA 4CJLA 1M5TA 5KGWA 2A9OA 1EHCA 3AVBA 1ZBHA 3TAQA 1JFTA 2I6FA 4QICA 1WSGA 4M45A 5SWMA 4DSIA 1MVOA 3OYHA 3CQ8A 4G86A 2GUIA 5E3JA 3G0ZA 4O1IA 4DG1A 4RSMA 4YR7A 3KK2A 1UDRA 2P9HA 3OO1A 1BQNA 3HUUA 4O4GA 4QCLA 3RMDA 3OLYA 3HUTA 4PE5B 5F64A 1HPZA 1NXSA 1GCAA 3BDPA 2AJQA 3OS1A 1S9GA 2HQRA 4OGEA 1HYSA 4MR9A 4CHQA 1ZBLA 3O3GA 4KNYA 3PUFA 1NKEA 1KLMA 2G8WA 4C8OA 4RXMA 1L3SA 2NZVG 3VQ9A 3PX4A 2O20A 1NK9A 2FMKA 1KCFA 1VSEA 2QU7A 4CGIA 3CFYA 3N75A 3AVFA 4BDZA 4G0QA 1DCMA 3TANA 3AV9A 4FK4A 1YK1A 3VQQA 4L8RB 4DTSA 3CNBA 2DY4A 4AHRA 1ASUA 3S99A 3ZCMA 5T3YA 5CZ2A 3LP1A 3CFRA 1BL3A 3AA2A 4RK6A 1TVRA 4HYEA 1AB5A 3ZSOA 2E4XA 3O2QB 4OKEA 1RILA 3S3OA 3WNFA 3NHZA 4JLHA 4B9NA 4M3ZA 3H6HA 4W5OA 3O1IC 4PA1A 3QELB 3KG2A 5KRTA 1KTQA 3KJXA 1KRPA 2VG6A 1TK0A 4BWJA 1EFAA 4CERA 4BDYA 2FQYA 4CIEA 4I2PA 2FEPA 4RXUA 3TB6A 3AVJA 1M2FA 3AVMA 1NTRA 4DMNA 3K57A 4IFVA 3PX0A 2E4VA 2IKSA 4C8NA 1PNTA 2WOMA 3L2QA 1CXUA 2B4AA 2WWVD 4KTQA 2HVIA 3DYAA 1QTMA 1D1QA 1Q9XA 1RNHA 3V9ZA 2RKIA 5TQ2B 1J5OA 1U2QA 4ZPJA 3O2JA 3HXMA 4FM0A 4DTXA 2WJWA 4F3TA 4F4KA 2ZWMA 4HCBA 3NBPA 3JTEA 2PYJA 1KVAA 4CK1A 1VSHA 1T7PA 4EZ6A 3MECA 4H4MA 4G0MA 3I8DA 2VWJA 4RWEA 4RK7A 3TWHA 2FW0A 5KQGA 3ZSRA 3NAEA 2QW1A 3RR7A 1HYVA 2B4JA 2VG7A 4DQQA 3SQ4A 4LH5A 2FMHA 4AILC 1DG9A 2L2QA 5B3JA 5DKFA 3K5LA 4FM2A 3O75A 1JLAA 3SPYA 4IG3A 3RVQA 3O1HB 1RT6A 2AYZA 1JFVA 3GA5A 2F96A 3HP9A 2LSNA 4TN5A 3S9HA 3SI6A 2LPMA 4O0IA 3Q7RA 5B3JC 1S6QA 3P1GA 4CF8A 4JOQA 2VYCA 3V1RA 4CGJA 3KHTA 1N5YA 5DMRA 2FEKA 3NDKA 4KTZA 3C97A 4KHNA 4E7OA 4ELTA 3RVNA 2BGGA 3WNHA 1XWLA 3DLEA 3G1WA 3GT7A 3KS9A 5BR1A 2W42A 3OVNA 1JFSA 1DZ3A 1I3CA 4CFAA 4ETIA 4QAGA 1QSLA 5C5CA 2B1JA 1C4WA 1LAVA 3IRXA 3UK0A 1YS7A 4HUFA 5DK5A 3GV0A 2JVKA 7ABPA 5JS1A 1JXEA 2KFNA 4FJMA 3HCWA 3V6DA 4KFCA 4W5NA 5ABPA 4JS4A 2NT4A 3OYBA 3OYEA 1T03A 1PNRA 4DSFA 4KO0A 1WLJA 2JVJA 1RXIA 4IMIB 3O4NA
chains in the Genus database with same CATH superfamily
1EK5A 2ZVPX 4J4HA 1Y6ZA 3TCNA 2A9PA 3EW7A 3TAFA 3M70A 1YRWA 4TTRA 5AQMA 1A88A 3B2NA 4IW3B 4RDXA 1D9XA 2H57A 4UARA 1NBOA 2ZSBA 3G9QA 1W30A 3GRFA 4KPYA 1O94D 4J07A 2FBXA 4B4DA 1B42A 4KTTE 3O4JA 3KE8A 2CZQA 2VP2A 3CCJN 3ZT0A 3E82A 3FKSA 2WTBA 4Y2SA 3UG6A 3KPYA 1GPJA 1C7JA 1H0RA 1GGVA 2OQVA 4UAUA 1VGQA 2Q3JA 2PNFA 3FIUA 2ZS9A 4E7JA 3FWHA 4C05A 5BN5B 4KRFA 4F71A 5GONB 4GXQA 1QX4A 3HZOA 1U6ZA 3VTKA 5BQ3A 1PJSA 4FJ1A 2RMKA 3D6AA 4EAAA 5T6BA 2WAYA 1XD9A 4G9ZA 4EUNA 4PKHA 3ASUA 3BK2A 3O3CA 3R4CA 3SUOA 2QN6A 2JGAA 2F64A 4J43A 4DIFA 2PZ8A 4A6XA 3NHJA 2WVGA 2C88A 5JXIA 1W25A 1DAFA 4JK8A 3TQSA 1S5PA 5CH3A 1C0GA 3HGMA 1U47A 3GEGA 1BYIA 4QTYA 2H5JA 3K4PA 3LNCA 4EB0A 1L7BA 3D43A 5ARBA 1KD1O 1X42A 2B5WA 3OEED 2E48A 1ZITA 3EVAA 1E9CA 1JG1A 3I30X 4RY9A 5AM1A 2V59A 1P6UA 2CKDA 5CFLA 5F7OA 4WL0A 1Z5WA 5IH7A 4B4VA 3URMA 1JB1A 1SCUB 5CJJA 1E4EB 4GNRA 3JQEA 4C7OB 1D2NA 3LCCA 1QBKC 3H65A 4GDFA 3C3WA 5FUWA 3LY5A 1YZFA 2EHGA 5IZ4A 1S1XA 1QGYA 3QSGA 3GN1A 4PG5A 3TX6A 3A32A 4EARA 2DWOA 4R1MA 4NFLA 3DDWA 4DSOA 1I3MA 4AJPA 3G5MA 3DBVO 4CZJA 3BFPA 4KMMA 2QLBA 1FNBA 3OTQA 3H3FA 1U2GC 4X1IA 3DE0X 1DLJA 4FBGA 2YRFA 4CT0A 2H4XA 1W36B 4OGWA 2O4GA 4AJ9A 5CDFE 2WJVA 1OWLA 4MVWA 2BFWA 1Y7TA 4E1BA 4RTRA 3NV7A 3U19A 4F85A 2NRTA 4HDKA 4JI3B 5JDIA 4QODA 3LP6A 3HR8A 2FWMX 4D9FA 1ESDA 2R8ZA 4EA6A 1H4SA 3ZK9A 5CRIA 4Q1BA 2BGRA 5CDSA 1OU0A 1A0OA 3R76A 2IYPA 3U3JA 1JU3A 2V0CA 1V43A 4BWFB 4DV3K 3FAKA 4DM7A 3G1TA 2BPOA 1DEHA 1DIGA 1WD7A 3HL8A 4K0KB 4AZ3A 1Z25A 2HHAA 3AKYA 4YREA 4WN9A 4M7OA 2WDZA 3MJSA 4L50A 1QWSA 1TO6A 2GBLC 2JFQA 1L5WA 3WWEA 4FT4A 2PZJA 3T7JA 3IQZA 5DTJA 1HPLA 4GGMX 1QFMA 4BO3A 1F12A 4JAXA 1UWCA 1GZ5A 3R5SA 5KAPA 3T4XA 5CDFA 3D7SA 5B3AA 4A1FA 4PZYA 1H1DA 5KX5B 4M1QA 4F9FA 6REQB 4J7UA 3V8VA 2VF8A 3PC8C 3R6LA 5F1PA 5HGJA 1EVKA 1UDXA 3O84A 4E21A 3OECA 3UFBA 4B79A 2H59A 2ZUUA 4RC9A 2IHBA 2Q5HA 1IBKB 5SY6A 1FFXB 4ZEOA 1UMDB 3BWVA 3VGLA 1I7LA 1T3TA 3QITA 4EYQA 3HB1A 4GLBA 2ZIXA 3RFUA 4FLXA 1ESZA 1BXRB 5U9CA 4L0QA 5CLJA 4MGHA 5E95A 1TK3A 4ZTJA 5IYZB 1PT5A 5D1HA 1E61A 1JP7A 3OPYB 1X38A 1YF3A 2LGJA 3ZHVA 3QW4B 3R2JA 1SPXA 2ZYSA 2IP2A 4YPFA 4BG8A 3NYIA 3DRRA 1XCBA 3PI7A 2R8RA 2X2PA 4F11A 1WU8A 5F1YA 4NK5A 3T3PB 1QOQB 3PD1A 5IAEA 4UE6A 3SQ0A 2CVHA 1JPUA 3IVXA 4E1MA 2WWRA 1IXSB 3TI0A 3UOGA 1X9GA 1YZNA 4MV8A 2FSHA 3MDQA 3PIPL 5FTNA 4QXQA 5T67A 4FSHA 3UAGA 5GOZA 2IYLD 1MRZA 2JI9A 2CJPA 4TYWA 2OXRA 4DILA 2IPXA 3TOZA 3M5CA 2QTNA 2YVUA 1MW9X 1QRTA 1HNIA 3JQAB 1KVUA 5JQGB 3BQ9A 4RCYA 4BO6A 1E3MA 4EZ9A 1TMYA 4P5DA 2XQKA 2JLCA 3SEZA 5HJ5A 2FLOA 2ZSAA 2W41A 2VTVA 1ZFNA 3ZTYA 2FSUA 2Q6OA 4A27A 4BEVA 2NGRA 4MAMA 3QJYA 2ATQA 4OBBA 4DKXA 2YC4C 4BX2A 3NHSA 2X2FA 4ZAGA 5TIIA 4DQSA 1XHEA 3ZXIA 4FJGA 5C0YA 4IIBA 1NBWB 1JL1A 3TEMA 4GX0A 1JW9B 4IO8A 3GRYA 3HCPA 2Z43A 3CUKA 1TCBA 2ZDHA 4B3CA 2CBXA 1TU0A 3ZXSA 1QSSA 5IKOA 4X7MA 1UPAA 4LW8A 1VQNN 4QATA 4OKKA 4UZSA 3OJOA 4YFVA 1FFAA 1GTVA 3QX7A 4M8SA 5IVDA 2AQHA 3EDCA 2V0GA 2V7XA 4XQGA 1K2WA 3ROGA 3GMDA 5E6UA 4W99A 1GY8A 3LALA 4MQEA 1V4BA 4DR6K 1N92A 2BJVA 4PGMA 4B9QA 1C41A 1BGVA 5KSWB 2QW0X 2OCGA 1MJ5A 2O2HA 1XNRB 4L9SA 3B51X 1CEXA 3QUSA 2IC5A 1UBFA 4D9JA 4ARZB 4QPDA 2CHGA 1N1MA 3I1JA 4QUHA 1NR7A 1HDGO 4D8YA 5K4GA 5IN4A 1T8RA 1F2UB 1MX9A 3WWCA 1IVNA 4FPXA 1BEEA 5L4SA 1J4AA 1AG9A 1Z2AA 3OC6A 1HO3A 4A8JC 5K99A 5G4LA 2JGDA 1GNLA 1VL8A 1QBGA 1IG9A 4BACA 5HIIA 1UAGA 2GPBA 2AG1A 2O6LA 4XVQA 2ZYTX 3G2NA 4HWSA 3AJ8A 4V0SA 1L3BA 1H2YA 1Z6YA 4RY8A 3I32A 3NVDA 2PS1A 5ITVA 5FBQB 1V3QE 3I04M 1MD9A 1AZWA 2FUNB 1ST3A 5H68A 4K1XA 4XTRA 2WJAA 4FM9A 1R2QA 4M3UA 2WIDA 1EHIA 4F2PA 5FPNA 4GLLA 1OFHA 3EMDA 1ZBSA 2BI4A 4RE5A 2GXQA 2DJ5A 3CJRA 4ZO6A 2FPOA 3OX3A 3E1GA 4E32A 3MCAB 2WF7A 1IK6A 5H3CA 2PANA 4PHTX 1ETUA 1WCIA 3NC4A 2KWIA 3AY9A 1C8BA 5C53B 4LUCA 4DDWA 1MJGA 3RRNA 5IC5A 1ZN7A 4B83A 4LFAB 4AJKA 4M9QA 2XWJI 3CZMA 1NVDA 5EEHA 5L3VA 5KWVA 3TFWA 2GARA 3DXMA 2G4LA 4RADA 3OZCA 4ENVA 4TROA 2QRVB 2ZUWA 3LXMA 2CY0A 1Y1TA 3ELUA 3N53A 2O48X 4OKJA 1FBTA 2ANCA 3CVJA 3LCVB 5IJ9B 1OJLA 2BDTA 1VYVA 3W78A 4R2HA 3ELDA 2NSJA 3F7NA 3RBAA 2QGFA 3DQZA 5FX2A 2YX1A 1VSIA 3JZAA 5KHOC 3NUGA 3LT5A 1GNRA 1E6MA 3C8HA 5EVCA 3EXFB 3W2TA 2QVGA 3M1LA 4EHJA 3BCSA 1NGJA 1XJ0A 4BNDA 3H5IA 1QMPA 3H3JA 3C6BA 1SK8A 3VZSA 2XCLA 4FNOA 2WE8A 2JFPA 4JP5A 4M0KA 1GZ3A 1RYHA 3EC1A 1JR4A 2VGMA 2HHSA 3MMPA 1HC7A 4RAOA 3PY8A 4EHIA 1JWLA 2AC2A 2AJTA 3BHJA 3B52X 2ILTA 3ZWCA 4H35A 3GH3A 4B8AB 2R6FA 1DDGA 3DUFB 3V42A 2OA8A 4IGKA 2AN5A 2EX1A 1NIPA 3T7IA 4B2IA 2FUG1 1MGOA 3CURA 4AJ4A 1NOKA 1NW8A 4GWGA 1F8UA 3UF0A 1N78A 3WWDA 1PP4A 4N6OA 3VQDA 4P4NA 3BREA 4C6HA 1OTXA 1TTTA 1T0UA 1W2BM 5LQDA 3BHIA 5KNDA 3SC2B 1C5KA 3GRRA 1KGDA 2RHWA 3GVXA 1T1RA 2O2DA 4FGUA 1JN0A 4FYKA 2HMYB 4AKGA 1V5FA 2IEIA 2P9KA 4S1WA 3FROA 3HA2A 4ZHQF 4KGDA 2FUEA 1CUEA 5TNXA 2ZJ4A 3DULA 3D6HA 4U8HA 3FHTA 1Q5PA 2JAUA 4JI0K 2O7RA 3PDWA 4L4YA 2O2ZA 4BWVA 1BQ4A 4XAQA 4MV9A 3C7NA 4UMDA 1ABFA 1RADA 3GFOA 4YRQA 4QS8A 3NB0A 4PQUA 3WO1A 2IYTA 3QUQA 4UVGA 3CJBA 1TJ4A 9LDBA 2QN8A 3C14C 2I1WA 3CRMA 1YJXA 1BIUA 2H1WA 1BA0A 3DZCA 2J3JA 4DUZB 1XNJA 1UKCA 2RSLA 3IJ5A 1F2VA 1VPLA 1LJLA 2CBGA 3TNYA 3E3MA 2P9LA 4Q93A 3IJRA 1PRYA 2QV0A 2QDKA 3VVCA 5DGTA 5LOVA 3VTHA 2JH8A 1IOWA 4LJ5A 4XCQA 1N5OX 3AF2A 1BI4B 5EZYB 1EM6A 4CDMA 4BDTA 2FE1A 4JS0A 3S2SA 5CNIA 3O8DA 2R4UA 3I62A 1TUYA 2R7MA 3ANMA 4YCLA 1P31A 3GWZA 1Y0BA 2J5QA 5CVVA 1YCHA 5CFQA 3V00A 1ZUD1 4U5QA 3QMLA 2A5XA 5K03A 1NF9A 3V1OA 2RFLA 4OI2A 4QPJC 1JR6A 5A06A 1Q14A 1XZKA 3SNKA 2I2WA 1W5BA 3ANLA 1PZMA 4PYRA 3B2EA 1G9SA 2B5OA 1UK8A 3BIFA 1KAOA 1PJAA 5HOQA 4B1FA 4RQBA 4U2CA 3VR6A 2D7CA 4YMTA 4QYMA 4W82A 4B3TK 3OZWA 1AN0A 4EUFA 1NUHA 5CUQA 5IASA 4AO6A 3NVMB 3QPBA 4FYDA 4U67L 2ZRHA 2QKKA 1WOMA 1R5JA 4JSYA 3VYVA 1Q6ZA 3R9WA 1GTSA 3GMSA 3IAS1 1V4NA 4M42A 1H1TA 5IVIA 1Z0DA 2YNGA 3RTAA 1JL3A 4X1KB 1LLCA 3KKRA 3DV0A 1MV8A 4PU0A 4TTAA 2Q2QA 3Q3HA 4UBOA 1VIVA 3T54A 4Q05A 1FSFA 2F1IA 1LVUA 3UMGA 1E2PA 4RVSA 1L1FA 4R9SA 4YRKA 2KMLA 4H7DA 4HUEA 1RPJA 5DBOA 4G5QA 3KUXA 3K0AB 2C2HA 1KDTA 4GL2A 2YWCA 4LPKA 4DA6A 3ECAA 3MD0A 3H0CA 5I7HA 3SEQA 3GLKA 5COAA 3OOJA 1LAWA 1Q0TA 2HMWA 2VT7A 5A4KA 1U02A 2YWBA 4CIFA 1RQGA 5GIPE 5KIAA 1IY9A 3IDQA 4HRVA 3GLGA 1LTHR 4I2NA 3GJ0A 3JVDA 4KDRA 4RK4A 3R9PA 3UV7A 2WOJA 1H66A 3UMJA 4DLPA 2BDPA 1UQRA 4C8KA 2CEAA 2ITMA 1OT5A 4ZYXA 5KEIA 4KIFA 4RHYA 2IVNA 4FMDF 5JW6A 2KW5A 4GBMA 1SBCA 4JNEA 1JHYA 3QU9A 4JROA 4MARA 3Q88A 3R3LA 3BYZA 4IEIA 5CDGA 2JEZA 3H4TA 4C7JA 1VSTA 2V7VA 2FVYA 1W35A 1HRHA 3CV3A 5E0OA 5GM1A 1R12A 1NJ2A 4WNYA 2MDTA 2W6NA 2WKQA 3IHTA 5B4VA 4BQLA 4OKIA 1H6DA 1G63A 1N2BA 3HDVA 2X42A 1XTTA 1EWYA 1KY3A 1ZRHA 3I12A 1X7YB 3TSQA 2OZLB 1FFCA 1OXXK 4JRPA 3DFIA 5MN6A 5NULA 2HDWA 3RC8A 1A5WA 4MKFA 1A7UA 3DLRA 2FPIA 3M5PA 1V8DA 1W8IA 3OCYA 1U1CA 4DSLA 2DKNA 4FOSA 1YUWA 2J7PD 1CYDA 3K73O 2W40A 3CT4A 5AM2A 2QMUA 4FMCF 1YMUA 1XI2A 4PLGA 1SKQA 1WN7A 1ZH2A 4PQEA 2DFTA 5BQFA 4WT7A 4Y2PA 4OSEA 2BWJA 3O5BA 4TTJA 4XIIA 5BQPA 3VV3A 4CV1A 4Q3EA 3FUUA 4PICA 4NB4A 3UICA 5L6MB 1ZK1A 3LDPA 1X7WB 3C6ZA 2E49A 4C23A 3EAQA 5E3HA 4M1OA 5IAJA 3GFPA 1R8XA 2LE0A 2MYUA 4MVCA 3TIFA 2H1VA 3ROFA 4L15A 3DL0A 1M1NB 5AFSA 2CW5A 4HAUA 2QROA 4M2LA 4GE0A 4S2EA 2FG7C 3O7WA 3DEAA 2Q0HA 3KUKA 1IWBB 4A5AA 3G0ZA 3E22B 1DAKA 2QYOA 4K03A 3K1YA 1ZN8A 5ALVA 1JSRA 5F64A 1XZAA 3TTXA 2AZMA 2CMFA 3GL1A 1ENOA 1OFTA 3BZUA 1QH8A 4CHQA 2H4ZA 3COVA 5FR1A 2IT1A 2HK9A 4H7HA 1WNFA 1CVRA 4JDUA 2OHIA 1TYAE 5A03A 2O19A 1A5AB 1Z2CA 2BGUA 4IHQA 5AWFC 2DC1A 4WASA 1CT9A 3AV9A 5C4MA 3G8BA 2P6PA 4LS3A 4CQMA 1M6HA 3PHCA 4AHRA 1JJVA 3ZCMA 2GAOA 4ABTA 3PWZA 4Q02A 1BL3A 2BY4A 4B3JA 1LRKA 1X0XA 4MVJG 4L7QA 5M1FA 5FR2A 3DTTA 4GGOA 4PF1A 4MUBA 2UYGA 1EGAA 3F4LA 5BV7A 3UCXA 1Z0AA 3SJ7A 2PWAA 4P4GA 3JWEA 4DLWA 5ICEA 2YDYA 3O9SA 1KEWA 4C8NA 1PNTA 2EJBA 2VRCA 1E7WA 1E58A 3OT4A 4OP3A 4RCVA 4LF7K 3FDZA 5DBHX 4EFKA 1LBSA 5E26A 4I5FA 1RRPA 5ALDA 4HVLA 1NRIA 1J2RA 1QIHA 2HLPA 4GSLA 3N7TA 1UBSB 1P3DA 5C5DA 3DEZA 2HK7A 2WUFA 2BH1A 1KFBB 2F43B 3B12A 1ND5A 3MNFA 1LPPA 2L2QA 4BECA 5HJ7A 4IV0A 3DAOA 3RVQA 1WZUA 1RT6A 1JFVA 1E89A 2LPMA 4BU0A 5EKUA 3EPPA 1Z0IA 3MT8A 1S6QA 1U3WA 1V0JA 1P8ZA 2HA0A 1G7TA 3KHTA 5CG2A 4M86A 1OAOA 3TDMA 3KS9A 3FJOA 5BR1A 4V1CI 3WWPA 3J7ZO 4KQIA 1RJGA 1MP0A 1DZ3A 4CUJA 4FS3A 1I3CA 4L78A 5HFAA 5TY0A 1W75A 2WJ3A 4HNHA 3LI2A 4DV1B 4MI9A 2OG1A 5K0JA 1JXEA 2KFNA 1Y98A 1NBAA 2EFEB 3P19A 2AN3A 3V6DA 5BR9A 5AR0A 2O2XA 3IP1A 1KL7A 3IPYA 5C35A 2AJCA 1BFUA 3UA4A 2G07A 3X44A 1OV6A 2DQKA 5CIYA 1ZD2P 3AHIA 1M0TA 4QNRA 1Q1ZA 1TT5A 1EDEA 2PR2A 3EDYA 5EYPA 4BNWA 4A4DA 2X5KO 3NWEA 4YMSA 3MWKA 5J2UB 2OPPA 1U0EA 1P4RA 4M7XA 4PS0A 3WGIA 3X2FA 4Y2GA 3CLUD 3SBDA 2HFKA 1RWVA 1IRXA 4D4LA 3EASA 1YF5L 3W8FA 2EKDA 3R7LA 1YASA 2G1KA 4ZJZA 3BRCA 3FCAA 1E3JA 4G2TA 2XMGA 3F2KA 4MVJH 4ES6A 1DC5A 4QYWA 3AJ9A 4GI1A 1ILWA 3FVWA 1UT8A 4I6GA 4XVUA 1Z8FA 2BELA 1GTZA 3STYA 2OPBA 2IW1A 5ECYA 5AQIA 4OJQA 1E99A 1Z74A 2H0QA 2B7CA 2UKDA 3EOAI 1D2GA 5BSFA 3B1ZA 3ZLJA 4URYR 2YWRA 4LV5B 1Q16A 4J49A 3DMJA 1W29A 1XCGB 3KD3A 4JI4K 4CV0A 3A3OA 4IKFA 1PR4A 1O13A 1TKAA 2X8BA 3PNMA 4BL5A 3PFCA 3KR1A 3UUWA 2QWRA 4MWOA 2QAGA 3ZD9A 4Z4HA 2YWGA 2IZOA 4GR9A 3Q3EA 4GECA 4DRXB 3WKAA 2G9NA 1KZGB 1TUGA 1ZK4A 3IUPA 2HPAA 5KYTA 5ALJA 3MUFA 5FADA 2YVKA 3ESXA 4J03A 3CEPB 2OM6A 3TPFA 5DTQA 2OT3B 2F90A 4R1TA 2XVZA 4A6DA 4RLQA 3SXUB 3RANA 3NASA 2Y1LA 3PIIA 2NNWB 1S7CA 5TQ2A 3EXEA 3VA3A 2V8OA 2R1VB 5HQ3B 3RTGA 1ZA1A 2O8EB 3T3OA 3VA0A 5JPIA 2OCDA 4CE9A 2DRIA 2BM0A 3ZGVA 3ZY3A 2ZW9A 5L3QA 3TZCA 3K59A 3GHYA 4ZYWA 1GPUA 4FJ9A 1N34K 5FNZA 2Q6TA 3MS4A 1T5OA 3TE7A 1IQUA 3MMZA 4E5DA 2HBYA 2YNMD 4E2WA 2JBAB 2FZ5A 1C1XB 1F2DA 3EFOA 5IJZA 2QTBA 4KU4A 5BWOA 5EY5B 5IK2A 2XNDA 1T13A 1HR0K 4WQ4C 3DFUA 4DR1B 4MOWA 4IXTA 3MWYW 5AHRA 1NZFA 2WWGA 2PFSA 3E03A 3CFPA 4CMIA 2B21A 5ALTA 1Z63A 3B5IA 1HYQA 3ESZA 4OFZA 2R4TA 3A2MA 4XXHA 2HU2A 1R9GA 1UPXA 1C8VB 2VP4A 4NS1A 2NP6A 4KXLA 3KB8A 2I0FA 1Q7CA 1LQ2A 3WQRA 4R68A 3KLGA 3V9SA 3EW9A 3GT4A 4NNJA 3ZWDA 2VJOA 5CX1B 5HKAA 1VI2A 3AIIA 1TL1A 4NCHA 4UU7A 5K8LA 2VJDA 1ZNWA 4FC7A 1E1YA 2P9TA 1U45A 2G5GX 3M2PA 4UHHA 2HCRA 2PGLA 3RREA 4JA2A 5LXTA 4XWOA 1X9JA 3I9NA 1SY7A 1P4SA 1Q9YA 4DR4B 3Q2KA 1HQEA 4LV6A 3QBJA 4I9GA 2FPGB 2G9QA 3JD1A 4AY3A 2JGKA 2QORA 2RGYA 4IUDS 2MYNA 5I9TA 4KR0A 4M98A 3ITHA 4TM7A 2WWHA 2VR1A 4F04A 2I7VA 2F4VB 4ZWNA 2Y1KA 3GWGA 4DV6B 1NQOA 4LCEA 3FXAA 2ATIA 4LF5B 3UB4A 5EJ2A 2P40A 3FUXA 4M0MA 2B35A 3LWDA 1QK4A 1NVMB 1AS2A 2JAPA 3UT5A 3UB3A 4DF3A 4NO7A 3OT1B 4MR8B 1GRRA 3B8AX 4MFBA 3ZWMA 3Q0EA 4AICA 4I9QA 1L5SA 4BE4A 4FIDA 3WIVA 3H5OA 4YOVA 5AQUA 2HKIA 4HY3A 4QRDA 4FD2A 3G5TA 3OUTA 1XEXB 4AB1A 2ZXFA 5EZ6B 2ZAYA 3SMQA 1LU9A 2Q6IA 1SBIA 2Z6VA 3NHGA 5F9MA 5AI8A 1VGRA 3RD5A 1SIWA 1NGBA 1AQLA 3CNHA 5DCUA 5JXHA 4Z9BA 5EVZA 3OKCA 4HNAA 2L0XA 1GXSA 4CV2A 1VGVA 5AQPA 1GAXA 1HBJA 1JEAA 7AT1A 2GF0A 4BBJA 1J8YF 3GY0A 1FX0B 1FVOA 4D25A 3WLQA 3U6KA 5G0VA 4C2AA 2BFCB 2A7XA 4KV7A 2H9YA 4XGQA 3V6MA 2E4AA 2VQEB 1EXDA 1KI2A 2F62A 4FINA 5DEIA 5K0FA 3SBXA 1BMQA 4YIKA 3PUKA 4AHUA 2J3LA 2NTNA 2PL3A 1TVKA 4CHGA 3M4ZA 3PXDA 3K09A 2IEYA 1O6CA 3L1JA 4EHTA 1JF8A 2JFNA 1XYVA 4LXQA 5JADA 1Y3IA 2HNBA 1ZRSA 2A5FA 3F97A 4QAQA 4QFCA 5JISA 2EZUA 1MF7A 4C0HA 2QTMA 3RDPA 3ADKA 2XGMA 3DZHA 4ZFNA 3QFHA 3V4FA 1RRGA 1II0A 5CXUA 2R11A 4G0ZA 5CURA 4J1QA 3AW8A 2Y6VA 4X66B 2WR8A 4ZI3A 4I1IA 3QMMA 1QVFM 1KFCB 1ZBQA 5KYYA 5LYJF 4OKSA 3DDOA 2FEAA 4HPJB 2EBHX 2ZYGA 5J4VA 3B9RA 2AFIB 1C9MA 4EY4A 1PEAA 2IZ6A 1D8YA 3PO4A 3I9FA 3EF1A 2VK4A 4RVHA 1GRVA 3TBFA 2AEEA 2ZSIA 4WXPA 3LDUA 3H11B 4QS9A 3EWNA 3G23A 1KJNA 13PKA 4UOQA 5LP6A 3VU0A 2B9VA 2VFAA 4QS7A 3PXCX 2GCGA 3FTQA 1EP9A 2FFHA 4CTMA 1FNCA 4OFBA 4CTOA 5G1OA 2GKSA 1O54A 3SFVA 4C1NI 4AF6A 4P7GA 1CUGA 3ZBQA 1EP2B 1L3CA 1W73A 2WD7A 4HJXA 2GCPA 4DJJA 4YRMA 2B6AA 1LI5A 3L2VA 1JTVA 1U7UA 2H4YA 2ASMA 2WVHA 3TJMA 1Q83A 5TGZA 5IAAA 3AI1A 4EX7A 2ZBUA 3T9DA 2K87A 2RARA 2CSXA 4XARA 1PR3A 4TUYB 2KZZA 1Z5VA 5HG0A 3E9EA 3QUTA 3MAGA 2C8VA 1OFUA 5EINA 3GRVA 3UT0A 5AQSA 2HJGA 3K58A 1JKMA 2RKOA 4INPA 3LCRA 4IF4A 1SRRA 3ER8A 1KFJB 4H4CA 3BHNA 4P4LA 4AHCA 1OILA 3CZQA 1T4BA 1AHNA 1Q0UA 3A9CA 3IUJA 2E55A 2FN8A 3HKBA 3N0VA 1EM8B 1Y3HA 2HBRA 3ER9A 3I5MA 1EFUA 1CJKC 4DQIA 5CA1F 2VJAA 4IIYA 2V6MA 4FSXA 1HT3A 1RCFA 4MKXA 2DPXA 1TYCA 3DW3X 1B0ZA 1CHNA 1GLBG 1TF7A 2VUHB 2WP0A 5AW5A 4G56A 1PJ8A 1U7DA 2ZG6A 2QWLA 4D6YA 3VENA 3LA8A 2BE9A 3ECSA 1JYSA 3LM8A 4XLTA 1EEHA 5AVUA 1KAGA 3W3AD 5B8HA 4YASA 3ENWA 3PUZA 4JEHA 2NUTA 2WFAA 3R5FA 1WL8A 1UM8A 4IDNA 4NMLA 1B8OA 2R86A 2Y92A 2C5EA 4N49A 1VHJA 4BNMA 2IDMA 3FZFA 3G0GA 4AF8A 4Q1AA 1TFRA 1Y5RA 3GEPA 1YHQN 1OYYA 2QY9A 5KNBD 3ESQA 1CUAA 1YVEI 4LRTB 3IC5A 4BKOA 4GR5A 3G6EN 3HXOA 3THXB 2CLIB 1CKEA 2AVNA 1IPEA 4NEQA 4BVJA 3GPDG 1IKXA 2LKDA 4O8ZA 3DLBA 1DQZA 3IEUA 5DHFA 1YHYA 1NT2A 1ZZEA 1P8JA 3ICOA 1JI0A 4W6ZA 2ZRAA 4CNQA 4IDCA 2OXCA 3C8DA 4KI0A 3TD2A 1D6JA 4PYLA 2R7NA 4YJFB 2A0KA 4RJTA 4KLRA 2DY1A 4MRVA 4ZT5A 3HCEA 2AK3A 2JATA 5IUJC 1KFKB 4ZYVA 3B1JA 4U3JA 1U2ZA 1RXEA 3CVUA 4QLOA 3TIIA 5DGXA 4OQNA 3F6EX 5BT9A 4YRGA 2HMSA 4HLUC 4EYSA 1SQFA 2YXBA 3SSMA 5GZ6A 2JFYA 4KLAA 1Z15A 4MS4A 1LQTA 4L51A 2DJIA 4BB6A 3ENNA 1EVEA 1I3NA 2ADFA 4DFDA 4YJ3B 3K8OE 4BNFA 2GXSA 1KY4A 1AGRA 3AKEA 2B4TO 4QELA 2QRGA 1E5VA 3F90A 5BSRA 2ZJ1A 2C95A 4FPAA 4MEJA 2Z6QA 3Q3IA 3VOBA 4HB4A 3I76A 2IU0A 3SQNA 4UCWA 3GJQA 5A5FA 3QE4A 4RMJA 2OXEA 3FSEA 3CBQA 2HMTA 3OLVA 3TKYA 2PX8A 3MJFA 2IV3A 4UTRA 3UAOA 2NXJA 2ZE8A 3L0DA 4HL6A 3F1KA 3G68A 1BSVA 3VR3D 3TLGA 1JEJA 1CJCA 1I0LA 4BTVA 4BGBA 5D3MB 3ZW9A 3ZHSA 3MXMA 2XD4A 3V33A 4K9DA 2Z57A 3TRJA 1BE8A 2ON6A 4R2IA 4D41A 4ZCRA 4K8XA 1DBQA 3FGZA 3CG0A 1LV8A 2P5GA 1DFGA 4OU5A 3QV2A 3VSEA 1XMPA 4I1YA 2PX0A 5CDYA 3E27A 1RYMA 3K3PA 3AQIA 2IBSA 4DLRA 4N7MA 2ZI7A 3C0BA 1KQNA 2C9OA 4BP1A 4GRDA 4Q3KA 3RQSA 1KP2A 2XSZD 4KJZA 1GNQA 5A7GA 5EC8A 3KSMA 4LHZA 4S1NA 5JNLA 2JK0A 3NUZA 4O8UA 4CHOA 3HCAA 5F76A 4DCVA 2RHOA 2BTQA 2VGNA 5JZMA 1QP4A 1K8KB 1EWTA 3V1UA 1V16B 3TR8A 2P51A 4Y7DA 4D9GA 1OC4A 4HQOA 1UEIA 2ZEJA 3V7FA 5FRDA 3IOEA 3U81A 1JWAB 4YRLA 4PBSA 4FWNA 5JXGA 3VSBA 2IPLA 3U7IA 4A82A 4DVGA 1S1WA 3I6QA 5B4UA 1RI2A 1N5DA 3ROTA 1Y7IA 2F1HA 2CV1A 3CW9A 4DEYA 5IPFA 5ESRA 2G6BA 5REQB 2Z56A 4E94A 2C4HA 3GEEA 5ILQA 2X3FA 1BD4A 4DT1B 3GDHA 3BT7A 4IXDA 2E89A 4ILGB 4FGSA 3PEVA 2DSTA 3BP8A 4KTVE 3ENQA 1SC6A 3MOSA 3UQYS 4WZAE 1IMOA 4K9NA 5BMVB 4MITA 3R0IA 1EG7A 2A94A 3MTAA 1PT6A 3JYNA 1N5IA 1GDDA 3CNLA 3TMAA 3TTDA 2NO9A 1VSLA 3OU2A 3HJAA 1P4AA 4F6LA 2BBTA 3H9JA 3O4HA 1CC1S 4FMPA 4Q1VA 5L8VA 2QGZA 3WMGA 3FPEA 4NAUA 1J53A 1FNMA 3H2HA 3KB2A 3TDKA 4OREX 3NIWA 1E6EA 3ATVA 4ZZIA 1AKUA 2JZOA 1T1EA 3WRYA 3FPLA 1G19A 1KRHA 1T3SA 1EESA 2ZUFA 2VN8A 5EKXA 3NH0A 3LKVA 4YOUA 4J6EA 4FYJA 1TCAA 2WYWA 3VGKA 2G82A 1HEYA 4GOOD 1P75A 1HFEL 4WZAA 2B4YA 4AI6A 4WXEA 3HXQA 5TEVA 5B1SA 1SCBA 2J9XB 4CIAA 1KAYA 2FSPA 3W4KA 1R0AA 3BFJA 5D86A 4MO9A 2DHRA 2QWPA 1UP4A 4Q3DA 3KPVA 4W1PA 1XV5A 3BSFA 5FYQA 2FFBA 2VNAA 3BRQA 2ZETA 4ZVNA 1MIHA 2YRXA 1K2VN 5F2KA 3FPKA 5D3ZA 4YDHB 2F8SA 3ANYB 3LTEA 1DJNA 1WZCA 3H16A 2G9VA 2XB8A 3V5NA 3MZ0A 1TTPB 3F9CA 3G0BA 4BRDA 4KFRA 5KTNA 4D96A 3ST7A 4WOCA 1SVNA 1OLSA 3KVOA 3CF4G 5AVVA 3D2EB 3ZEIA 1GUFA 1FSPA 2VYVA 4IDHA 1VP9A 5K3CA 4WAUA 3HKEB 2CGEA 2IEAA 2VTEA 3L9XA 2HBZA 4BRZA 4TYNA 1X7XB 1HKGA 2A0XA 3LYHA 4DMMA 3HY4A 1JDVA 2ZR7A 4HOYA 2PVCA 3GUUA 2Q9AA 4G1UC 3Q3CA 2XY6A 5JZOA 2CYBA 5CW1A 2Q3CA 2YKMA 2J6CA 1GTMA 3SYLA 3V2UA 1D1PA 4D26A 1P4HA 2RI0A 2AR0A 3C24A 5C37A 3IPLA 2E5LB 1MB0A 3AVPA 5BN3B 5KYXB 3DBIA 1DX9A 2HQ1A 5FPHA 4H0CA 2PWZA 4CGHA 3L0OA 3PIRA 4ZQFA 4IJWA 1WU7A 1PQWA 4RETA 5LXTF 2ZSUA 5LR6A 5LQUA 2IDKA 5HRCA 4FI3F 3HVJA 3QFUA 1SRQA 2IVOA 3C95A 3ANSA 1WDTA 1YZQA 3N2LA 2VRBA 4Q9LA 4NRDA 3RLIA 2PA3A 4RD4A 2D2FA 4CD3A 4HMOA 3GROA 3PNLA 1YI1A 3LF1A 4AM6A 4UNIA 1C7EA 1SCKA 2NU8B 2VJMA 3WMEA 1QGUB 4KAJA 4JYAK 2GD2A 3KJIA 4Z1MD 3IFRA 2HDHA 1Z34A 5TV2A 4YONB 4FLFA 1FYWA 4G8BA 1KYTA 1NP7A 2CD9A 3NE6A 5GV8A 4CF2A 2WMNB 4ZVUA 4F06A 3TYXA 4P3KA 1JAIA 4Y2VA 1PL6A 3LUKA 1W4RA 5ALMA 3HP7A 5EOYA 1JLLB 4GPAA 4XSHA 1H3EA 5KGWA 4IMPA 2A9OA 2IZ1A 2OL4A 5CD1A 3TAQA 1JFTA 3O8BA 4D4MA 1BYUA 2I3BA 4EIWA 4DSIA 1WVMA 3V6LA 1AQNA 4YP0A 4OBWA 2PQMA 4LFCK 4XB1A 1WB6A 2GJ9A 1SXJD 4MUHA 1QS0B 3HUTA 3C41J 3NU1A 1YNOA 3OD1A 2NW6A 3H45C 3J81O 1E7YA 1HNXB 1T35A 1N8TA 4RLFA 1Y5LA 3WSTA 3FHLA 3O3GA 1IB6A 4PZZA 3OQIA 4OB8A 4BMCA 1FX1A 3HDJA 5EA2A 1IY0A 4RXMA 1DQPA 2IYQA 4CLXA 3V8QA 5AICA 4NWIA 5F3RA 3WK5A 4AM7A 3SQDA 2YCBA 2D1TA 4M1EA 1U5BA 3ZVNA 2XCOA 4V24A 2HF2A 2DFKB 1I94K 2XOEA 3M4YA 5M1NA 3UIEA 3EGXB 3RS4A 3V1MA 1NW4A 4OHVA 4QTTB 2Q5EA 4HAIA 5A9RA 1RWWA 4M46A 5COBA 4QTUB 2E4XA 2PU5A 4BRQA 3GA0A 3NHZA 4AF7A 4UVHA 3LXUX 1M0EA 3BZKA 2IGBA 3KG2A 3PHIA 1XTVA 2GYVA 2BMAA 5E3IA 3KV3O 1KAEA 1U1EA 2J3DA 1IXZA 4CIEA 4B6GA 1M2FA 1ORDA 2DPNA 4GXRA 2RHKA 3SYNA 4UW9A 2RI1A 4P31A 4QGGA 5ARDA 1W2HA 2GLXA 2ONZA 1P2TA 3RRFA 4RPHA 4MW9A 1LDEA 4R5MA 1R9NA 3K1ZA 3AOEC 4CL0A 3ELBA 2ZJBA 4OHFA 3E35A 2IYYA 3Q5GA 2CNLA 3E2PA 2ZE7A 1X8JA 3IL2A 4XQCA 5G4KB 4N12A 2A4MA 2HF4A 3IUYA 5BREA 2NU9B 4GI3A 4R1PA 1BU5A 1OVGA 1C30A 4IAOA 1SUDA 1JLAA 4E1VA 1PL7A 1QZUA 3OCXA 3O1HB 3MTEA 4XD7D 3D3JA 3TH5A 4GWLA 3HP9A 1U4SA 4JK9A 2BFMA 1Y63A 1CZKA 4E13A 2AUNA 1HKUA 3UKUB 3WK9A 3A26A 4O5OA 3RVNA 2YWHA 5IAKA 1XJCA 2CVFA 2Q9BA 3TBHA 4Z54A 1K7XB 1Z6TA 4QAGA 4FK8A 3SC4A 3TS1A 1V1RB 4PRKA 10MHA 3MN5A 4IJMA 4NDAA 1CUYA 2RIPA 3BE4A 5FJIA 1KO4A 4QSMA 3WISA 2O7QA 1F8XA 1JR2A 3R8CA 4GKJK 4GBED 1IONA 4DF4A 4HNRA 5DULA 3FPFA 1M34B 1D9DA 4FFBB 3WEEA 2ERCA 1I36A 3T41A 4C0KA 3N8NA 4F2GA 4DV7B 2ID4A 3ETLA 3DKPA 1RKQA 4PNEA 5BQ5A 1E9AA 2IUEA 1QS4A 5AJZA 1JSLA 1VKHA 6ABPA 1EXWA 2X6TA 3T12A 1YL7A 5EU7A 4J0GA 1JHMA 4D3ZA 2OM2A 4JOBA 2O05A 4AJIA 2BISA 1X1CA 1SKBA 1XPRA 2VNSA 2GHRA 2C57A 5CB0A 4Y67A 3EGVA 1II8A 4XX0B 4CK3A 4EYGA 3FFWA 1KC3A 1Z5OA 3PC2A 3KEQA 3S0JA 1M5RA 3K1JA 1EGQA 1R10A 2C2MA 1VKZA 4LBWA 2GA8A 4MDEA 3RUDA 2P2LA 2ZJ7A 4EW2A 3P31A 2PSDA 4KXFB 2X23A 3TG8A 5LDDC 1FSSA 4OVKA 4H8KA 5A4DA 2GN0A 3D6UA 5FOUA 2ZE2A 3DWLA 1NOYA 3K7EA 1E0SA 1NMXA 4WINA 1C7RA 1R6XA 1VL2A 4LX8A 3DVRX 4PSUA 4POAA 3DBHA 2B2NA 2ODNA 1L5HA 3QEOA 4XSVA 5M1QA 5AM4A 1LKZA 1EFCA 2B99A 1GCUA 4NJEA 3OFVA 3RVMA 3EXHC 3C7TA 4WDRA 2WU8A 3PC7A 2ZF5O 3QSYA 5U4XA 1TK2A 4DSJA 3U8XA 4DWVA 3HC7A 2ZTMA 3FTCA 4M4SA 1V8FA 4BNNA 1U9IC 2I9KA 2QM0A 2H00A 5GINE 1KERA 1SG0A 2YINC 1XZIA 4MV0A 2EJWA 1AX9A 2W22A 4LBZA 1T43A 1ZAYA 3ECCA 3KK3A 2DBQA 1XCLA 5KPDA 4GQAA 2ZRJA 3FDJA 1QO9A 1BXGB 4ALIA 4H5RA 2GI4A 3DAGA 5F1OA 3IAXA 2NUPA 4PQRA 4X1YB 2Q8QA 1VCIA 4RVGA 2V55B 4YAIA 3RG2A 3CRVA 4RCHA 4HZUA 1ISMA 1N2CE 5BY2A 1G2PA 1DKGD 2XBUA 1QVWA 3P9QA 3Q8MA 2XMDA 4RTOA 4CHTA 4GBJA 3AK4A 3FTDA 1DTTA 4RVOA 3NHYA 2BFOA 3DONA 1IVSA 3Q10A 2ZTVA 1KEEB 3RFCA 3TOXA 4FIZA 4D3SA 1BDHA 1LVGA 1QE5A 5F78A 2P69A 2WC1A 4YAFA 4GM4A 4TSFA 3BXFA 5GINA 3KJGA 2ZM6B 4BFSA 4PUOA 4LC0A 5D5PA 3HSTB 4X6UA 2VZ0A 4A5OA 3W5BA 1E9VA 3IIMA 2EYUA 2WA1A 3IAUA 1QTNA 2ZJ5A 2JPDA 1ECCA 2KZMA 5CU7A 1N33B 3A1UA 4RQTA 2SCUA 1FP4B 3RVBA 4XIUA 3ZE0B 4NCJA 4IJQA 1N2CA 1K0FA 2HDOA 2G70A 4UHJA 4XIYA 3OYKA 1H2BA 1W94A 3IO3A 1KF0A 4LGYA 3P45A 2R7KA 4EF6A 4BQNA 1OUMA 4R4JA 4QNMA 3W8NA 2VJNA 3HNPA 3KV1A 1JWBB 5CT4A 1NVBA 4TXHA 5CNKA 1K8AO 2I87A 1O96A 1XXHB 2I2AA 1Y3CE 1TF2A 4DJEC 2J85A 4HC4A 1RZRA 3L4QA 2P6MA 2D2XA 3CLRD 2OAGA 2IW3A 3PJGA 4DBVO 4URHA 2IPOA 1VSQA 5HE9A 5FL7A 5AP9A 4QJ5A 4MJ3A 2KLBA 3T7SA 1XVAA 2HMUA 3BGVA 5J58A 1JG6A 4AUMA 2WDPA 1Y1RA 3MQ4A 4FSVA 3GZTB 2PUHA 2C2ZA 3H99A 4AG6A 3T1HK 1EIWA 4FCCA 3ZCTA 1NW6A 4DPMA 4CWAA 3TZ6A 2PBZA 5FB3A 1E6CA 4UEQA 2F1KA 1CEQA 2XB6A 4N1AA 1FP2A 2PL9A 4PRYA 2QYSA 4D0GA 3KQLA 3EE6A 3VNBA 1WXHA 1DRKA 2L42A 5ICMA 1IU9A 5EJFA 4Y0WA 1ODFA 4KKVA 3NYQA 3L0SA 2A0YA 1V5EA 3SM3A 3DDUA 1NKCA 3G82C 4UNNA 4W5TA 1UINA 3SR0A 5KTMA 4FX2A 4ZYLA 5EWJA 3BJZA 3UKRB 4ZVMA 2CDBA 2W6MA 3AM1A 4M7WA 3EXG2 5IX8A 3PFWO 1T1IA 3ENOA 3KELA 3GUZA 4WFAL 2CSUA 2RBGA 4UHFA 2HGZA 5L45A 1ZKMA 2B78A 4FM1A 1DNPA 3IX7A 4HZIA 3WJ1A 3BQMB 4N9WA 1Z39A 4YP1A 2YW9A 3RMAA 2XT6A 1VBNA 5IT0A 1PJ3A 1XAGA 2MMCA 1CXZA 3GLGE 2WB2A 1NK6A 4NXMK 1JDBC 4UASA 2Q8NA 5AM5A 1Z5UA 3WDKA 4ZOLA 1SK9A 2J3KA 1MGPA 2YXNA 1UBHS 4H03B 1RC0A 4PXAA 1JQLB 2EXXA 1EFKA 5IABA 2A78A 1SQ5A 5MGNA 4UQPA 3X1JA 2GZSA 4NDNE 4PPGA 3OQPA 4XB6B 3L5KA 2I6TA 4RTPA 2HSGA 2A9JA 1WDMA 2V5VA 3VR5A 1MU2A 2GQ0A 5CVUA 3IOYA 2RC5A 4QPZA 1VB3A 3NEPX 4EUKA 1XJQA 1NJZA 5DBIA 2GAFA 5B36A 4CIVA 3QKTA 3H87A 4OGFA 1PBNA 1NTOA 4XJXA 4BR7A 3K0HA 2OD2A 1SU8A 2PT9A 1VKNA 2QL7A 2AMJA 3B6ZA 4OYHA 1F6DA 4JH0A 3LOPA 4ZGWA 3RV3A 5KNCH 4QOGA 5JNRA 2OBYA 2UUPA 2WZDA 2ACEA 4BY9E 4FFWA 3CPHA 4B9SA 1GT91 2PR7A 3M4XA 1VA5A 5FLXA 3LPDA 1SFRA 2N1BA 3KOZA 1TYZA 3OEHA 2E1PA 4P58A 4HUQA 2WIAA 2OV4A 2OTCA 2R62A 4N65A 2Y9MB 4E5VA 3NKFA 3NTQA 4PQGA 1NPTO 3AVNA 4B71A 3CZ4A 1UZAA 4ZCSA 5F51A 4WFNL 4NCNA 2VCYA 4YVFA 2VK8A 1DL5A 4H4EA 1RXCA 5EWLA 1JAZA 4UFOA 1HYBA 5KOHA 3VU8A 1I6MA 1GQSA 1VKRA 3T1QA 4YJHA 3DCNA 1U2DA 4ESEA 3DXXA 2PRYA 5JNSA 2J6BA 5BSVA 4X62K 2FMUA 4OLFA 1U0NA 1WW3A 3NVKI 4WESB 5EFZA 3ZY2A 1G4HA 1QQBA 3RTCA 3H4MA 1UXIA 2IS3A 4HB2A 5TVGA 2BJHA 3FMVA 3N0XA 2DG2A 5CZ1A 2O2CA 3B7GA 3K05A 2VT6A 3C15C 2O0LA 4LDRA 2HBLA 2FN3A 2EERA 1R4ZA 3L8MA 2VCHA 4J3FA 1QB7A 1N9GB 1OC2A 2H7CA 1JI3A 1KZ6A 4GM1A 4H0NA 5JDIC 1UOPA 1PDOA 2O8CB 1JH9A 4DIUA 3ZSQA 2PRKA 2JL1A 2VA9A 1NJIO 2CJWB 1BG3A 3PDIA 5E7JA 1Q7YO 3CZAA 3A1CA 1DX4A 1WLSA 1C50A 2GK7A 4YO8A 1EPUA 3ZY4A 4I4TA 1Z05A 3A1EA 4LOKA 2HSWA 3SMSA 2E4LA 4NYNA 2BGLA 1ZXOA 3AVOA 3AKDA 4C30A 4F3OA 3BAFA 2AG8A 4DR5K 3QH4A 3VPAA 4DZTA 5D5QA 4XEIA 3AQ4A 1S9DA 5BYKA 3SIXA 4CM9A 3LUGA 4G1QA 2BCGY 3SYKA 3ZD7A 3EEOA 3GJ6A 4B9VA 1GZHB 3JRXA 3BILA 1DC8A 4D98A 3IMEA 4W1QA 4DYVA 4FKMA 2V1UA 4NP6A 1QRDA 3S27A 4DFMA 1LW0A 1UWLA 4O1MA 2A7QA 4Q4JB 4OJYA 4AS1A 1J0AA 2H7XA 4CZHA 1V48A 5JSKA 1V35A 1V5IA 3BMNA 1KNXA 3UV6A 2E82A 2P9UB 3C3EA 3GOHA 4YJDA 3VQTA 4QEZA 3TIXB 4ZA2A 2Z1IA 2JH9A 2Z1NA 1W0CA 1AU9A 4LY9A 4ZZ0A 4L5BA 2RG1A 3T06B 5HQTA 1X9SA 2H16A 1DIBA 3P0JA 3Q85A 2D5RA 5ULLA 3RS2A 3H1QA 3HCBA 2RAPA 1WBDA 2F8TA 2NQ8A 1QIIA 1V96A 5CBPB 1ODTC 2XUFA 1OLXB 4NF2A 5ES4B 5IEBA 3ZU3A 4K9QA 3N0TA 1KZ7B 1SVKA 2Y68A 4XCVA 1G3MA 3U09A 1RZVA 3QLJA 4D8UA 3D8TA 2HU8A 4AHVA 3EIQA 2Z1DA 4P22A 4CLEA 1F5NA 1IDN1 2WRZA 5DFAA 3Q5EA 4RZIA 4RHUA 3QI7A 1J7JA 1OR8A 4M0CA 4BE2A 3H1FA 4KN8A 2A5LA 2VBGA 4WA7A 4PV7A 2PMEA 3TUJC 3KR9A 3UMFA 3ZKWA 2XCQA 1TF5A 3T4EA 3SXPA 1U11A 2PFUA 1WX1A 3INYA 4IYJA 3J81k 4K6HA 4JUFA 2C7BA 1P33A 2WVAA 4OI4A 1GZ4A 1ANKA 1WXQA 5F1KA 3KDAA 3R5JA 1GSIA 2NN3C 5CIWA 5AQEA 3SDSA 3M6GA 3TAMA 5D87A 3HCCA 3T38A 5BYBA 1N2EA 1OSNA 2CXSA 4RNDB 3WWOA 2OY0A 2VWPA 3KK7A 3I73A 1YQXA 1GR1A 2ZWVA 4MHOA 1MHPA 2Z58A 3B1YA 2XYVA 2BFFA 3C6MA 5ADXA 3TD9A 3ICPA 3TQIA 4BRFA 1FUYB 3KPJA 421PA 3SMVA 3U44B 2P9CA 4JOCA 3OYDA 2CNWD 4OOFA 2V9PA 3EC2A 5ALSA 1P2GA 2OANA 5JG7A 2QVYX 5JCPA 1NOIA 2R5WA 3GLSA 6NULA 3M82A 5ADWA 5FWNA 1A8HA 3VV2A 3IMCA 4PKIA 4RKWA 1UMBA 1ZGAA 1W85A 3QIAA 3I6BA 3NFRA 4XGIA 1EK6A 1X77A 3F67A 1K66A 4M3YA 4TKMA 3C85A 1NXQA 3MSXA 3W1EA 1R0ZA 2F3TA 3I2KA 2J3HA 4IEEA 4HX5A 1GPLA 5KHAA 1HFKA 1DXYA 4OA8A 1OPXA 1FJXA 1OA1A 3R5HA 3S40A 1C1HA 1LZLA 1KZHA 4EIAA 1Q7EA 4L74A 3D5EA 2WLTA 1PW5A 3ZT1A 5G1PA 3AWDA 1TADA 1H2FA 1XLWA 3KTFA 3VPXA 1TKCA 2C20A 4CKWA 1IBSA 4MCIA 3QE0A 4D6PA 4KXUA 2GLTA 5TR9A 4NJOA 4XIJA 3TAGA 3LXRA 2G83A 5M2QA 4ZVLA 1AUXA 3WV4A 4KKOA 3CUTA 4HEA1 1Y4AE 2KE5A 4PZDA 1ESEA 2ATEA 5TMDA 4YDRA 1Z56C 4HUGA 3QPUA 4ETNA 2JAWA 3AVYA 4LG1A 4ALLA 3OHRA 4LC9A 4JB2A 2C1EA 3CW8X 5LDGA 5A05A 3P4YA 3T7TA 4QJBA 4KQ9A 2ZJ0A 4W1SA 2ZRDA 2Q27A 4IV5A 2CUTA 4DFJA 4OXXA 1EBUA 4WCFC 1ZHOA 4H6VA 3RSSA 4PIVA 3UJNA 1RKBA 2WVJA 2QI2A 1Q18A 4LCJA 3AMVA 4JFRA 2OGTA 1TAUA 1YA6A 2G8IA 3IULA 4IJ6A 8ATCA 2ZYIA 4P7JA 4KO1S 4L2IB 2H92A 1QGED 1ZBFA 2BHSA 2XTZA 2PDAA 3M6WA 1YDGA 1S72N 4W7IA 5EN4A 3S1AA 5DI9A 4Z3OA 1IY2A 3GLHE 1CSEE 1U6KA 3O0DA 1I01A 3QHQA 1M0WA 3TL2A 1FOEB 2AOUB 4JITA 2HCFA 4YMWA 3SHWA 3BERA 2EFCB 4PNZA 3EQZA 4YQZA 2IOFK 3EUFA 4MUJA 4V0LA 2IYRA 2Z4RA 3U7GA 4OM8A 4JLMA 4WXMA 3H2GA 3MB5A 5EE5B 3M6MD 4IL5A 4ZQEA 3L77A 5LB4A 4BR5A 3EDRA 2NU7B 5TSDA 5EMKA 1JDZA 2QENA 2WIBA 2H51A 2XUHA 4PO1A 3NHKA 2IGIA 2FCRA 3L8BA 3D3QA 4ND6A 2B7LA 4HKTA 1IH8A 3FH0A 1QV6A 4M3TA 5JFGA 4A10A 2DBVO 1U0FA 3VNAA 1GV0A 1FDIA 4PCAA 5FOWA 1L2TA 5LN1A 4C7BA 5HF5A 1JDJA 3IYLW 1L1RA 3GLHA 5H3HA 2PS9A 1G3UA 4BMZA 4GNIA 3IEPA 1BD3A 1GLJO 3IP9A 5MHTA 3N7AA 3N2YA 2NO0A 1WXEA 1CIPA 5GIOE 1RACA 2CHFA 1XDWA 1X39A 3S29A 3PTLA 4JB3A 3FWYA 3C6UA 4N7JA 4OD0A 4YT8A 5BRDA 1Z7WA 1DAEA 2C8JA 3QFFA 4CJWA 1OROA 3FTFA 3Q15C 1RC8A 1Y1SA 3NT2A 1SZ2A 4J0EA 2P90A 2BFAA 2NXNA 1QO0D 4Y2QA 3HQ4O 2ZI5A 5AESA 4YUYA 5A5GA 3UWSA 1NG9A 3EIEA 4NESA 5SWMA 3PP8A 3VBEA 2FP4A 1Z2NX 1HG1A 4B3MB 3GA7A 3OCCA 2F9WA 4ZCLA 3RMDA 3IQEA 3H0KA 5JCZA 3PUJA 4A8JB 4OYRA 1Q77A 5CEEA 1PFVA 2P9IB 2JIMA 4C0QC 1XR3A 3EMBA 1P1IA 4YK7A 1IBMK 5LOVF 5GIOA 4FNMA 3GDWA 3RYHB 3N75A 3AERB 4BDZA 5BN9A 3RWMB 2E0IA 3WNBA 1PNVA 5EPOA 4OM7A 3O8OB 3LDHA 1BX3A 1XVLA 3RI3A 5D3KA 2HO4A 3I64A 4HUJA 4M9RA 1W47A 4C08A 4GZ3A 5T3YA 1REQA 3LC7O 3K0SA 1DFIA 3V8PA 3OFND 1U2EA 4TKUA 3UWDA 4NBTA 4AUKA 1KI1A 2W6ZA 4UJ3A 4HEJA 3EXHB 2SECE 2ET6A 1KZ1A 3UMMA 1P77A 4DR2B 4RTMA 4RHTA 1OI4A 3OJ0A 2W6IA 3Q98A 5SY4A 2QTZA 4PANA 1Z5ZA 2C4KA 3BE8A 1CXUA 4J4TA 4FEGA 4LNHA 4KE9A 1CV2A 2NTJA 3I04A 1A8SA 1QYVA 3VM6A 3BTOA 4NZOA 1ZK0A 2I91A 3LQ2A 4N8SA 4D9HA 4HCBA 4CKCA 3VEVA 3OF3A 3SZ3A 1BHSA 3I52A 3EZFA 2O3QA 3T35A 4ZOLF 2GCOB 3K5IA 4KVAA 4XYBA 1ZH8A 3MWLA 1FJGB 2G77B 4HFNA 2WI8A 4UU0A 3VVMA 4Z2AA 2NG1A 1JCFA 4AILC 1TUIA 4M9SA 4TVOA 4LECA 3O9RA 4CDRA 1EUCB 5JEDA 3T7EA 3X43A 5CXSA 3G89A 5E2BA 4E3ZA 5FOVA 4B44A 1Y81A 4X85A 2YY7A 4PGGA 3Q7QA 3T9EA 1A96A 1FTQA 3GT7A 4MRNA 2W42A 3UK0A 4P3YA 3QKRA 2L69A 2JVKA 5JS1A 3DOEA 1LLFA 1N2OA 3KKLA 2W6JD 3I34X 4YRSA 4XUDA 5LUAA 2DB3A 3ZGZA 1SCJA 3BMQB 2OHFA 1RXIA 2XB9A 1TLTA 4M53A 4HQ0A 1G8SA 3C65A 1HOXA 2W4MA 3VX4A 1N7HA 5HZHA 1NYTA 4M9ZA 4TMYA 5AVWA 3L1IA 4O3FA 4MAFA 2B1QA 1QC5B 4GX2A 4EX6A 1HORA 2QRMA 3E2IA 4OLAA 1Q7RA 5D1NA 1SVMA 1KJIA 4KQ6A 5FPQA 1KYIA 1JG4A 2ZBRA 5T6MA 3OWXA 1D2EA 3LO8A 1Q57A 1J54A 2LBPA 4EHDA 3IR5A 4OQFA 2JLVA 1XQYA 2W2TA 2F3RA 1IZYA 3C3PA 3SBEA 3HPGA 2Z98A 4X24A 4QASA 4R2XA 2QTCA 1E96A 3GMTA 3QHAA 2OVFA 5BWBA 2NXCA 3O21A 2OHVA 2GBFA 3OCVA 1EX7A 2P5OA 2H7YA 3NAGA 4LNUA 3OWOA 4R2MA 2YMPA 5IJ0A 2CLDX 3CH5A 3OPNA 4DS5A 4INOA 1XTUA 4A0FA 4HMQA 2H1HA 2YQ5A 3DBRB 3PFFA 4G8CA 3L7LA 4IJ5A 2WP8J 2K5UA 4CZMA 1T3GA 4WBXC 3DVQX 3KU1A 1IHDA 1QF6A 1IBLK 1ZIYA 1L8AA 3OIFA 1ZJ5A 2XCUA 5H8WA 3IA2A 2VHCA 2XPCA 3MAQA 5TX7A 4DDVA 5A3JA 4BFTA 1XSEA 1Z4LA 3WYGA 1ZXXA 2BM9A 3ALYA 3WWYA 1A98A 5I7UA 2JRLA 4UCQA 2XAUA 4UOEA 3BBLA 3SC3A 2HSTA 1EH5A 4G37A 3QVLA 4L4UA 1VPWA 1RBTA 4O3MA 1RLJA 4LSMA 4DA8A 5ISMA 4XA8A 4IINA 1XQWA 3JASB 3FSGD 5K3AA 3FLCO 1C3EA 3CQ9A 1WPXA 1XZNA 2WWXA 3D5TA 5EXSA 4CIYA 1UBOS 4JI2B 1OOEA 1VMIA 2EKBA 3MMVA 1SKMA 3GMIA 3TQOA 3KBBA 3NUQA 3D4IA 1IHUA 4FGLA 4QFBA 4B6JA 3E5RA 4FJ8A 3CIOA 1C1CA 3HJUA 2AF4C 5LJVA 2ID9A 4V0QA 1RM0A 2XX3A 2ZBVA 5KC9A 3O90A 4JIGA 1GM5A 2Q5JA 4B3OA 2FOIA 4H59A 4XJVA 1BCRA 5EJ4A 4KI6A 1GFZA 3S70A 4HO1X 4HVCA 3I0NA 5LU8A 4WMLA 4N0QA 1WXIA 2O7VA 2H4WA 2D5CA 5DYGA 1MT3A 3NCHA 1P0IA 3FWKA 4CQJA 3H6EA 4E30A 2JJYA 1JDBB 3TRFA 4G5OA 4JJAA 2GN9A 4JL5A 4FR0A 2XHBA 1LK0A 2CV2A 2A9FA 1RXWA 2Z95A 3HO1A 1CS4C 4Q1FA 4AZ0B 4UNSA 4NK4A 1KI4A 1F0NA 4WWHA 2RHCA 2J4CA 1PVVA 1PYGA 3WFJA 3HT3A 3RADC 3V7YA 1XRRA 4FWTA 1D5WA 1J9EA 4DJFC 5CHEA 2CF6A 1QG6A 5L3RA 3GDOA 1YL6A 5AW8A 1NSYA 4IIXA 1U8CB 1BRTA 2PMKA 2CKMA 4RIGA 1Y33E 1SUCA 4JI5B 3C3DA 2ZUEA