2BGGA

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt sirna duplex.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMEGTKVKLSSKRYLLTLLQPYVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN AF1318
publication title Structural Insights Into Mrna Recognition from a Piwi Domain-Sirna Guide Complex
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna-binding protein/rna
total genus 134
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2bggA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bggA01
1AB6A 1FKPA 3S3OA 1SKSA 4FLXA 3OYLA 2ITGA 3K57A 1JX6A 1TM2A 3NF6A 4JS5A 4B9TA 3JVIA 2IS3A 4NICA 5BRJA 3ZSQA 4QICA 1VRTA 3L8BA 3H08A 4HYEA 1A0OA 3DBIA 4HNQA 4M45A 3SPZA 1L3VA 3T1AA 1LK0A 1LV5A 3QLVC 4FJ8A 2WWVD 3QO9A 3RMCA 4CHNA 3KLFA 4Q7EA 3NBPA 4DS5A 2JVJA 3L2RA 2EX3A 3MXIA 2R25B 2CHEA 3FGZA 4JP1A 3F9KA 5CNKA 1SRRA 1KVCA 1BI4B 3IPCA 1EETA 4J2AA 3HDGA 1S9EA 3MQ4A 2VWKA 3G10A 1HRHA 3LP0A 4RK6A 2HHTA 4EVRA 1DRKA 4CGGA 3KJXA 3CRNA 3HPHA 2IKSA 4EUKA 4LX8A 4IMJB 2OZMA 1M2FA 4CJ5A 2Q3SA 3OS1A 4XFKA 4RZSA 4AHUA 1ISRA 3KLNA 4DSFA 3OS0A 1P6UA 3RRHA 4DQPA 2ZAYA 1DCKA 3K59A 1NOYA 4D74A 4H60A 1Z26A 4H4OA 2R47A 2IC3A 2VK2A 3PX0A 3GRCA 4CJEA 1HPZA 4CHYA 3DM2A 3G1WA 4TLMB 1WSGA 1JLKA 2H3HA 3I0SA 3VQ8A 4ETMA 4KFBA 1NXOA 2ZD1A 2PUAA 3NCIA 2YNHA 4KV8A 4PUOA 5FWXA 4DQRA 3LPUA 1VSHA 2A9RA 4O4GA 2FKAA 3CHYA 4DQIA 2X78A 4M3RA 4OPKA 1J54A 3RVNA 3KD5E 1S1UA 3AVKA 4KTWA 4RW7A 3O3FA 3DRPA 3IP7A 4MS1A 4CHPA 5KC9A 1BI4A 1J53A 3L49A 2VWJA 4IILA 4YCSA 4M41A 5FDLA 2FBYA 5J1EA 4OKEA 3SNKA 2VG6A 1REVA 4MQFA 1GUBA 5EWJB 1NK0A 4KTZA 4WE1A 5KRTA 4IFVA 3K4HA 2NUBA 2RPIA 4MR9B 4CJSA 1FQWA 1RXIA 4PQUA 5C42A 4I7FA 3EY1A 1VRVA 4DTMA 3HCWA 1JBEA 1S1WA 3OYMA 3DYAA 3VQEA 4AH9A 4E7OA 1RILA 1LJUA 4EP5A 3LUCA 3V1QA 4JA2A 2AJQA 1ZDMA 4CJKA 1C0EA 3TAPA 5T7BA 1Z16A 4L85A 4OG2A 5TPWA 4F3TA 3PX6A 5CNMA 3SAJA 4ZTJA 3QLUC 1FKOA 5DCLA 3NH2A 3I42A 1NJWA 3IP9A 5ED4A 3TO5A 3KIOA 5J2QA 1UAXA 4KO0A 3QX9A 5DKFA 1BVHA 4FJJA 2A9QA 2GV9A 3SG0A 1USKA 3DOLA 3SCXA 1YIOA 3VNAA 3AA3A 3KLGA 3NFAA 3HK2A 4RY9A 3JSMA 1RCHA 2P1JA 3LUFA 4NQRA 1EWVA 4TMYA 4CFBA 3H5IA 4QYWA 3KLOA 2R4QA 1TKDA 3C97A 2JBAB 3HZHA 4CERA 3OJSA 3HV2A 4OGCA 4NYFA 3O74A 4E7LA 1D2AA 4FE4A 4WUTA 4Z9AA 4CEAA 3ROTA 3V9SA 4FJ5A 4O1IA 4MS3B 3ZSVA 4DTXA 4N0PA 2OPPA 3MXMA 4CJPA 2H0AA 2IPAB 3QELB 1U49A 2OPSA 4S05A 2JK1A 4B09A 3WNEA 4MR7B 5KI6A 4FZYA 3CZ5A 2R48A 3K9CA 4FLVA 3B2NA 4IMIB 4PICA 2PE5A 3ZT2A 2PZSA 4FK0A 1CLQA 5TQJA 3K5MA 1LWFA 3TAEA 1TVRA 5EWLA 1JLQA 4LRQA 1KRWA 1MIHA 3O1HB 1D1PA 4JASB 5KQLA 4KHQA 3RR8A 2FSPA 3HO1A 4AHCA 3S3MA 2ZWMA 3KYJB 1ZBHA 2HNDA 4C8LA 1SD5A 2HJ9A 4PE5B 2YV0X 3BDPA 1RT6A 2IGIA 1N6QA 2VYCA 4W5TA 4CEEA 3VNBA 1E6MA 4QCLA 3KKEA 1Z18A 4WT7A 3EQZA 4HNRA 3M9XA 4JOQA 3I45A 3DOKA 5HSGA 3B6OA 3FFTA 3K5OA 1P6QA 2QKBA 4H3KB 1DP4A 3T8YA 4KHYA 3RMDA 1PUXA 1C1CA 1JXBA 4M42A 1WN7A 4O1HA 4B9SA 3ISNC 3TAGA 3KD1E 1UWBA 4G0XA 3O21A 4F8JA 2WJWA 2LPMA 3OM0A 3QELA 2HMIA 3GYBA 3RVLA 2LBPA 1VRUA 4KREA 1NKCA 3MXJA 1HYZA 1GOCA 4CJ3A 3L3UA 3P83D 3LMKA 4E7JA 3LUJA 4J2EA 1JDNA 4LSNA 4E7IA 3PY8A 5BQ3A 3L2VA 5KQMA 3AVMA 1P2FA 3H6HA 5CZ1A 3SUOA 5HROA 1NK5A 2XDYA 3CM6A 5KQGA 3M8SA 4P98A 4G0ZA 1LAVA 3HSTB 2FEKA 4EVQA 1VSFA 1Q9YA 4XARA 5FBHA 3VA3A 1VSLA 3E3MA 5HRSA 3ZSOA 1RBVA 4Y1CA 3NF9A 1CZBA 1HQUA 1LW2A 3HVRA 1I3CA 1BISA 1DBQA 2RDMA 4CJFA 4NCGA 4BDYA 4DWIA 3LKBA 1TMYA 1RT2A 4QAGA 1U4BA 3DRSA 4CHZA 2Z1IA 2MYTA 1JL1A 2FMKA 2OA8A 4CE9A 5HM6A 1QQAA 2I6FA 1S6QA 5TQ2B 1KCFA 3TI0A 2FN9A 3QK7A 3MF4A 1DBWA 3QNNA 1JHZA 2FLWA 1CZ9A 2E4YA 3LOPA 4XAQA 4DU4A 1KFSA 1IH7A 4DTNA 2HVIA 2FMFA 5IUJC 3AO4A 5DLEA 3AO1A 3F6PA 4W5RA 4M3XA 3G85A 4I2PA 4IG0A 4N0QA 4DSIA 3IDOA 3T95A 2NZVG 3MECA 1L3TA 4CBVA 4O44A 4CGJA 2PUCA 1ZGGA 1T8EA 3OYKA 5CHYA 4CIEA 1TK0A 3FFWA 3ITHA 1T34A 4DG1A 2X7XA 3O1IC 3SY8A 4BE1A 3JTEA 4EZ9A 1QP7A 4KZKA 4RKQA 4ZPJA 3TMYA 3DI6A 2PY5A 3TX6A 4RW8A 1BAPA 1QSYA 3KSMA 1GOAA 4RW9A 1UA0A 1ZESA 4FJKA 2PJUA 2E4VA 4OLBA 3CM5A 4O5BA 2FBXA 1R0AA 4MAAA 3OY9A 3VN5A 2QV0A 3AVGA 1ZN2A 4GNRA 4C8KA 2Z1JA 3IAYA 4PEVA 1VK0A 3H1FA 3RWUA 4DU1A 3DLRA 3CS3A 4M3ZA 1HNIA 4N47A 2X74A 2PYJA 3RVOA 3TABA 2BANA 2KTQA 1GOBA 4NYNA 4RXTA 1WSFA 3H5WA 3N0XA 2G8WA 1FFGA 3SZ2A 2GI4A 1QQCA 4KQCA 1DG9A 4CF2A 1KSPA 4ELTA 3NBMA 1NK4A 2XY5A 2HHSA 3CG0A 2G8FA 2FQWA 1ZYQA 1WAJA 1XHEA 1OXKB 5JNRA 3KK1A 1TL3A 3HPOA 4B8AB 4KB0A 1VSKA 1FK9A 3PO5A 4LH5A 1K66A 3OLVA 1QP0A 5FRMA 4FK2A 3AA5X 2P9HA 2B1JA 5IC5A 3SI6A 1S8NA 3AVNA 3O3GA 4BWJA 1NJXA 1C1BA 3CFOA 3LP2A 4DLGA 3G0ZA 4CF0A 4O0JA 3TB6A 3LUDA 1A2OA 1S1TA 4KAZA 3CTPA 3CLKA 1RT3A 1MVOA 5C5EA 4CHOA 3VQBA 4FJ7A 3EZ5A 4BDPA 4RDCA 3C3KA 3OQMA 2L2QA 2GWRA 4MRMB 4YS6A 3QEVA 3UKJA 4GPAA 2IPMA 3U6FA 3AO2A 2FBVA 3E01A 3AVFA 4XXHA 2E4UA 5IEBA 2FMHA 3OYNA 3OM1A 2RKIA 4ELVA 5EWMB 1NXWA 2HNZA 1IKYA 4HVJA 4F4KA 2QR3A 4FJ9A 3BGRA 4FZZA 2G8HA 2P5OA 4LDZA 3WNHA 4F3OA 4G0OA 1YMVA 3NGYA 2BGGA 4G0YA 2DTUA 4BACA 4DFJA 1TLFA 4LD0A 1T03A 5JNTA 3DLGA 4MYRA 1D4ZA 4FLYA 3FMVA 3NGZA 4HUFA 3QERA 4Z99A 3V81A 5KC8A 1JLEA 4OVLA 1NOZA 1SL0A 3LUAA 2ATQA 1RBTA 3ULDA 4CK1A 1U45A 4O0IA 1QSSA 3RRGA 5CYMA 2MYNA 3HP6A 1A5XA 5KGWA 2LSNA 4MLDA 1Z2DA 3SM9A 1BQMA 1XC9A 2MSKA 1JL2A 1L5UA 2FEWB 3TAMA 5J2PA 4M3TA 3O4NA 2OQRA 4MRMA 1KTQA 4RXUA 2P4UA 1D9FA 5ABPA 1LBIA 3V9XA 4KPYA 4H8KA 3SYZA 2Y1IA 1U2PA 4PZ0A 4CIFA 2G8VA 4Q0BA 4RSMA 1EHCA 3C6TA 2GUIA 1ZBIA 3BBLA 1HJRA 3NNDA 3HYFA 1QO0D 1X9MA 3AO5A 4NCAA 2HB5A 2RJNA 4L4UA 1BIUA 4NV3A 5B3JC 4CIGA 4ICLA 2FN8A 1RDCA 1RZRD 1KGSA 1C0UA 1APBA 4JAVC 3ZSWA 3MM4A 3O2SB 3RH0A 3H5TA 1EP4A 4Z0NA 5BRAA 2GBZA 4CF8A 4TSXA 1CXUA 2OPQA 2XY6A 1BL3A 1EXQA 3KJVA 4HCCA 2JVKA 1XWWA 4CEQA 4W5OA 2KFZA 4KRFA 3AA2A 3KKRA 1C4WA 3VQ6A 1ITGA 4M3WA 3M9WA 3C95A 5DTEA 3QIOA 3VQAA 4PYRA 4W5NA 2P5GA 3OLYA 2KW4A 1IKXA 5CZ2A 1L3SA 5T3YA 3VQCA 4HCBA 4BE0A 3OYCA 4CCHA 1PEAA 3KG2A 4GW6A 1RNHA 3IP5A 1NATA 1XHXA 3AVAA 3L2UA 5PNTA 1U8TA 4DTRA 3HPGA 2WRZA 1WNSA 4OBBA 4F12A 1DBPA 4MPTA 3PUFA 1W25A 3KLEA 1VSMA 4FE7A 5HKOA 1P8AA 4KMRA 1CHNA 2Z1GA 4FJNA 3NAEA 3NHMA 3LUHA 5DMRA 3ZSXA 3TANA 4YV7A 4KNYA 1IG9A 3JYTA 1JYEA 3AV9A 2WOMA 3K2PA 2A1SA 1JL3A 3AVLA 4KK4A 2FLKA 2IPNA 3QINA 3SUNA 1RT1A 2B4AA 1UA1A 2HHQA 3LWMA 1TKZA 1VLZA 3A3KA 4JRPA 2XRIA 3LP3A 3KK2A 1YMUA 2M98A 1SUQA 1JLGA 8ABPA 3LP1A 1ZITA 1ISSA 1BIZA 2F8SA 3N75A 2LP4Y 4FW1A 3E61A 5EWJA 3HJFA 3K5NA 1BHLA 4OLAA 2PUBA 1QO0A 3HUTA 4MR9A 3EULA 3OMXA 1KRXA 4RV5A 3VQDA 1BQNA 3I0RA 4DQQA 4D6XA 4CGFA 1RZRA 4YGXB 2HHUA 1O1WA 1K6YA 2QZJA 4B08A 3OJUA 1Z13A 3H5OA 4YRZA 2PKXA 4IBNA 4LZLA 3U3YA 5DGCA 4F06A 2JB9A 1DCMA 3T6KA 4B9UA 3EYZA 4TN5A 5JNSA 1JFVA 4IRXA 1FXXA 3KYIB 2DFFA 5CNJA 4N56A 3QEWA 2IOYA 4NCBA 2MYUA 3GBVA 2E6MA 4OGEA 1NY5A 4LSLA 4M3UA 3RQIA 1QS4A 5KTQA 3LWLA 4G97A 3NHGA 1HNVA 4ZMRA 5FBKA 3KHTA 1RT7A 4ETIA 4Z0UA 1X1PA 4EYQA 3L6UA 1D8YA 1CXQA 2YHBA 2FVYA 4Q6WA 1T05A 2BE2A 2JBAA 4E89A 1NK6A 2E4XA 4KHSA 4F2SA 4DN6A 1I39A 1RDBA 4E1NA 3KLHA 4ID1A 5F64A 1Z17A 4MFBA 4FJIA 4DSLA 3L2QA 1ZH2A 1GCAA 4RG8A 2DRIA 4L8RB 3N0RA 4MS3A 4RK7A 1E6KA 4EYKA 4OATA 3Q7RA 1NK7A 1BA2A 1TKTA 4LE2A 4FB4A 4MR7A 3URMA 3SPYA 3DGEC 1JLBA 2ZQBA 2DY4A 2R7YA 1QPZA 5D2CA 1KLNA 4YNQA 1QMPA 1BCOA 3NGIA 1B9FA 3H1EA 3OLZA 1ZGZA 4DADA 5FROA 2JCGA 2IOCA 4EP4A 4D6YA 3IP6A 2PUDA 1RDDA 4R5PA 4RK0A 4YFUA 4FJGA 4OPJA 4N41A 2QU7A 2BDPA 4EGSA 1X9SA 3P5JA 2D5RA 3SUQA 1JFSA 2YNFA 1PHRA 3HL8A 2QVCA 2CHFA 3EODA 1TJYA 3O1JC 4CK2A 3NH0A 4KV7A 4CEFA 4HHTA 1RBSA 2QXFA 1DC8A 3N53A 4DQDA 1KVBA 1U48A 3RVPA 4DSKA 4CEZA 2FTKE 1XI1A 3V4IA 4F2RA 3T38A 4WZZA 1JH9A 4XASA 2P51A 1NKEA 4DTOA 4JLHA 1C6VA 4J2BA 4MQEB 2WY2D 1JLCA 1XHZA 1YS7A 2KQ2A 4P1ZA 4CFCA 1MU2A 3CKMA 4G0MA 3V6DA 5E3JA 4AILC 1DC7A 5C5CA 4CJQA 3UUGA 1JLAA 1SKRA 5TPZD 2D0BA 1TAQA 1J5OA 1UOCA 4N76A 4EYGA 1D1QA 1JYFA 3H75A 4G0QA 3DGFC 4O5AA 1IKWA 1TL1A 4CJ4A 1NXVA 1SL1A 3ZSYA 1BGXT 1VPWA 1A04A 5JNVA 3JPYA 1JFTA 2FMIA 3U3GA 3OYAA 3D45A 2FQYA 1Z2EA 2HPHA 4EVSA 2XY7A 4F8RA 3CQ8A 1MB3A 3IS9A 3C3MA 2XY8A 4H3HB 3JPWA 3FFIA 2W42A 3SV4A 1AB5A 2VUIB 3HUUA 1C0MA 5TQ0B 1NXTA 4DF4A 2RN2A 4MLCA 1U2QA 3VQPA 4CGDA 3TR8A 5JS1A 4DSJA 1BCMA 1LJLA 5KWSA 1MB0A 1ABFA 9ABPA 5TQ2A 4LE1A 1A5WA 4TLLB 2EHGA 2QKKA 2VUHB 1SV5A 2RGYA 3HVTA 3FFXA 3DLKA 2L19A 1YT3A 3AO3A 1S1XA 5HRRA 2G8UA 4Z4FA 1S9GA 1RBRA 4CGIA 4WXEA 3NNNA 4MR8B 4FW2A 4CECA 1TGOA 3SQ0A 2NT4A 1CYEA 1HYVA 2N9UA 3LAMA 1L3UA 1ZAYA 3V1RA 1SXIA 4KTQA 3LKVA 4FLUA 3CG4A 5I42A 4MS4B 3QEMB 1BDIA 4MQ3A 1DZ3A 4K8ZA 1C1AA 4JRQA 1Y1LA 2HHXA 3TAQA 2HQOA 4QYMA 4K8XA 4FLWA 1WSIA 3P1GA 4AHTA 4ETNA 3SQ4A 2PMCA 3OLXA 1B9DA 1S1VA 4DFKA 4CESA 1NK8A 2NZUG 3BRSA 4CK3A 3ILYA 3OLWA 3HXMA 4CJUA 4CF1A 1XHFA 2D0AA 5HQJA 4QPJC 5IUNC 1UDRA 3QNOA 3H1GA 2IYNA 1TKXA 1JLFA 2B6AA 1S6PA 1RBUA 3VQ9A 1DRJA 3KLIA 1K68A 3WNGA 2GKGA 3ZSZA 3AVBA 1VSIA 5TPZA 4ELUA 3C6UA 1TK5A 3O2JA 4FM1A 1SXHA 1SKWA 4FZXC 2B4JA 4DTSA 4DF8A 3SQNA 4CJVA 4ZHRA 5KRSA 3MYYA 3GT7A 4KFCA 1RDAA 2QK9A 4YR7A 1JF8A 2QSJA 1ZY2A 4H4MA 3SQ2A 4MS4A 4AHVA 3SNNA 3QEMA 4GMJB 3AVHA 1D5WA 5DK5A 3KS9A 5HRPA 2GBPA 3RR7A 3GA5A 4KQ9A 3TARA 2TMYA 3DZDA 1FSPA 2OYQA 2QW1A 3MEDA 1QNLA 1JKHA 4KHUA 4CF9A 4DSEA 2IPLA 4B9NA 2Q5CA 3VQ7A 3ASMA 3OQNA 1C0TA 4PWDA 3LTEA 2OENG 3S3NA 5FWXB 2MSLA 4HNSA 1RTIA 4LDAA 1NTRA 2F8TA 1TK8A 2PAFA 2HNYA 3OO0A 4Z9BA 3MEEA 4E3SA 4CGHA 5EWMA 4C8NA 4JS4A 4MS1B 2PLNA 5FRNA 1Z15A 2MSWA 4Z4HA 7ABPA 3LAKA 3ZT0A 3OYBA 2WJAA 3THVA 5HLFA 1USGA 3V9ZA 2KYRA 4RWEA 1F51E 4MQFB 3A0UA 1HMVA 3IRXA 2LIVA 4FJXA 3KTQA 4DMNA 3RMAA 4I9QA 4IFYA 4IG3A 3NH1A 1DCFA 4W5QA 3ALYA 2PYLA 4KB1A 5CNIA 2O20A 4DQSA 1ZBLA 4FJLA 1QTMA 3NF7A 1EAYA 1JDPA 3K5LA 5CY4A 3OO1A 3F7NA 4ID5A 1SL2A 3V9WA 2YHAA 3MAQA 3OMWA 5SZTA 4E7HA 2PUGA 3ROFA 5TPWB 4N03A 3ZT1A 3N8IA 1W0HA 3CFRA 4ZYLA 3B6PA 3A10A 5J2NA 1QE1A 2ZE2A 2AYZA 1USIA 1Z25A 3D0PA 4S04A 4FYDA 4CFAA 2FQXA 2RF2A 1NXXA 5SWMA 3JY6A 4HTUA 1RT4A 2IAJA 4KK3A 3V9UA 3BREA 3O2QB 1PNRA 5I3UA 4WWHA 3RMBA 3VQ4A 3CZCA 2E4ZA 1X9WA 4E7PA 1DTTA 1HQEA 3CYMA 4Q5VA 2AYXA 4LE0A 1RTHA 3NDKA 2A9PA 2YKNA 5KGXA 1ZH4A 4OKJA 3QEXA 4CEOA 1U04A 2HQBA 1U47A 2HHVA 4Z4IA 1R8JA 1XWLA 3M8PA 4HUGA 1ASWA 3QIPA 3Q7TA 1ZVVA 1Z12A 2IDOA 4KHNA 3W9SA 3LZJA 5GOTA 2PL9A 3C94A 1DJMA 2IDMA 4Y1DA 4CJRA 1N5YA 1QKKA 4RKRA 3HEBA 2NT3A 3UK0A 4DFPA 1YTUA 2FC0A 2ETJA 3T19A 3A0RB 5EWLB 4YP9A 1ZBUA 2FEPA 4AHRA 3PX4A 5JS2A 1ZHHA 4OTZA 1WSHA 2JVIA 3HP9A 4RS3A 6ABPA 2QVGA 3EAFA 3NE6A 1LAWA 1JXEA 1NXPA 1IIBA 3F6CA 1ABEA 3M8QA 4XLTA 3QEIA 4M88A 2V0NA 2QXYA 4IKFA 2GX6A 4RY0A 3LDSA 5HP1A 2YNIA 3LUKA 5IULC 1G15A 1RXEA 1EWTA 4ZMSA 4KHWA 3Q7SA 2M1ZA 4ML3A 2Z1HA 4RK1A 1JWLA 1W9HA 3TAFA 1VKRA 2RJOA 2DFEA 3OYHA 4O55A 2I5JA 4KI4A 3F73A 1GUDA 2YNGA 2PUEA 1YK0A 4FJHA 4FJMA 1KRPA 2A1RA 3VQQA 4FLTA 4DTJA 3BRQA 5KQPA 4FLZA 4UHJA 1IKVA 3OYDA 3QLHA 4B8CA 4CFDA 3LANA 3QLVA 1LWEA 1VSDA 1ASUA 1QQBA 2O4IA 4HUEA 1EFAA 3EGCA 1FFWA 3KCNA 1L5ZA 3D8UA 1Q9XA 3LFTA 4E1MA 3MEGA 4FM0A 3EDCA 1LWCA 1M2EA 1DTQA 1FFSA 1EWKA 5D3GA 1WSEA 3MA0A 2B5JA 1LW0A 3Q41A 5I4CA 3S9HA 1QP4A 4Z4GA 4OJRA 3AVIA 5FWYB 1SXGA 3LZIA 3SQ1A 4N5SA 3RTVA 3VA0A 1MAVA 2J48A 2JRLA 4IF4A 2VG7A 1U0SY 1ASVA 2A9OA 1PNTA 4CJLA 3TD9A 1S5JA 1RTDA 1M5TA 4B3OA 1YS6A 3O75A 4CEDA 2OPRA 5B3JA 2Y1JA 3AVCA 4G0PA 4J2DA 3LALA 3OS2A 1VSJA 4C8MA 3H6GA 1Q8IA 3H5LA 5HRNA 3DLEA 4JB2A 2PUFA 3OYGA 3V1OA 4E19A 3RVQA 1BDHA 2HVHA 3ILHA 1YVUA 3IPAA 2ID9A 3C6QA 3TWHA 2FXIA 4Z4CA 3RVMA 4OKKA 1EX4A 4AHSA 4RY8A 3IG1A 4JB0A 1WSJA 4UQGA 3GV0A 3CFYA 5JNWA 3KK3A 1KLMA 4FK4A 4G86A 3SJJA 3I8DA 1J56A 3H5VA 3RVJA 4EY3A 1TVMA 1ZBFA 1L5YA 3CFPA 4RK5A 1CEYA 2G8KA 1TAUA 4XIUA 5FWYA 1D9DA 3O4QA 4Z4EA 4KKOA 2YKMA 1URPA 3NHZA 3CU5A 5C24A 3R0JA 4DS4A 1BDJA 4LY7A 5IUKC 1KFDA 3PO4A 2G8IA 3L2WA 1RTJA 5J2MA 2WMYA 3QX8A 5IX8A 5EU7A 2WB4A 6CHYA 1DLOA 3DRRA 3HT3A 1H9CA 3DLHA 3K58A 3Q9SA 4BWMA 4CEBA 3CG7A 1HEYA 3MIZA 4BE2A 4FM2A 5HBMA 3WNFA 3JVDA 3I09A 3CNBA 4YLEA 4FVMA 1NK9A 4DU3A 2CWDA 3QEKA 4Y9TA 4UHKA 5C25A 5JNUA 3QLUA 5BR1A 2E6LA 2F96A 1EKEA 1A5VA 4B9VA 3LUGA 1HYSA 1J9AA 2KFNA 3C3WA 5E41A 2D0CA 2KZZA 2L18A 2JGUA 1LBHA 4MQEA 3P9YA 3PV8A 3N0WA 5CYQA 4B9MA 3OVNA 1NKBA 3ZSRA 3QETA 1GCGA 3FDFA 4DLEA 2XO7A 3OQOA 1RNLA 2XHBA 2HHWA 4B9LA 3DLBA 1QHTA 3OYFA 4RW4A 5IEJA 4I9LA 4G1QA 3RVSA 3O3HA 3NF8A 4WXMA 2E4WA 1KVAA 3RVRA 1VSEA 2PL1A 3JS5A 2VG5A 4KVFA 4CJTA 3GWGA 2FBTA 1B92A 2HQRA 1GLGA 1F4VA 4RXMA 4E0DA 3I5AA 3KKSA 1WAFA 2OZSA 2CD7A 4CHQA 3SUPA 1E6LA 4KI6A 3A2FA 1YK1A 1NJZA 4MGEA 1NJYA 4FXDA 4IDKA 4RU1A 1E2BA 3LPTA 2FW0A 3HS3A 3OYEA 4ZTFA 4LH4A 1OXBB 3N6VA 4FCYA 3ZCMA 2X6NA 1TV6A 3GL9A 2HSGA 2JLEA 1M5UA 1RPJA 4QOZB 2L17A 3MMNA 3Q15C 4RW6A 5TQ0A 3NNSA 1I3AA 3ZT4A 3T3FA 3EJWA 3QESA 2MYPA 3L3VA 3HSYA 1D5AA 5IBQA 3M8RA 1WLJA 4M3YA 4CJWA 4EZ6A 1RT5A 3DMJA 4E7KA 4EYOA 2DFHA 3QEPA 1Y97A 4YWHA 4F11A 2X6SA 1IO2A 4C8OA 1F21A 3AA4A 3UIQA 3QLTA 3D02A 4RK4A 4PA1A 3RVKA 4Q6BA 3GBPA 5K14A 3HDVA 3KTOA 1YTAA 2ID7A 3BILA 2HW3A 4MR8A 2E4LA 3S99A 3OYIA 3AVJA 4DTPA 3ZT3A 1B00A 1KMIY 4BDZA 5TE9A 4ZJPA 3M6MD 1T7PA 1NXSA 4DFMA 3SV3A 1WETA 1PEYA 4GVMA 3HM9A 4YO7A 1QSLA 3VQ5A 2KZMA 4PY5A 2O4GA 4IGAA 2LUOA 4I2QA 2WONA 3OYJA 5GQSA 4DTUA 3EQ2A
chains in the Genus database with same CATH superfamily
3DZFA 1FW8A 2FE4A 1T2CA 1GLCG 1AQJA 3JVIA 3M7IA 2AF4C 4EOGA 5B1SA 1NHWA 4QFMA 1V7QA 4WECA 1AKQA 1GRNA 4QIHA 3H84A 3VHXB 2OBLA 4QTYA 3KR1A 1A9RA 5LZ5A 2V7BA 2ZR8A 2OBXA 1E5XA 4UNRA 1WV0A 3N2ZB 3G10A 1HRHA 3N5CA 3QPVA 4GQIA 5CA0A 3LP0A 3FCSB 4CGGA 2WJ6A 3JQRA 5ALJA 3TZEA 4KQIA 2OVFA 3QVKA 4WESB 1O5OA 5JC1A 3OEWA 2TSYB 1NXQA 4CZLA 2BH9A 4IR7A 5K0ZA 3LYLA 1FDIA 4O59O 4CUKA 3G1WA 1XMVA 4OO1J 2V96A 3L1UA 1JE1A 4N9WA 5AVUA 4AY2A 1AQLA 4GMKA 1H42A 4N5IX 5C8XA 4DQIA 4BKUA 3A58B 1W8DA 5HK8A 2FOXA 4EAHD 4B3IA 5KC9A 4CNQA 4R05A 2RK6A 1IY9A 5TLSA 1ZEJA 4YIHA 5KEIA 1NJ1A 2WYOA 3BWCA 2VG6A 5DX0A 3DZIA 3IAEA 2AFVA 2YN0A 3BRCA 4MDFA 2Z56A 3DO8A 4B9AA 1E2NA 5ULLA 3UH0A 4DTMA 5KU1A 5ALLA 1ZONA 3TIGA 4PSVA 3R5JA 5SZIA 2B20A 4L85A 2EZ8A 1UJCA 5DMHA 1GNQA 3ZWQA 5GP1A 4OF4A 4CIDA 2PKQP 5EAIA 1RJDA 1RT9A 4ZVLA 2E2WA 3B9RA 1SKAA 1Z6PA 1NN1A 4ALNA 1EDZA 4I4NA 1L5QA 4XX1A 3B5IA 3K0AB 4ZA2A 4J7XA 3AA3A 3U39A 4M7YA 1LTQA 2B8TA 2OAEA 4QT0A 5LP6C 1TTHA 1XAGA 2G88A 2F8LA 2XLCA 4EHAA 2OGTA 3BE5A 1W59A 1QG0A 2DTXA 4DLLA 2F9LA 3RRBA 1TUBB 5AW7A 3KEFA 4NMLA 2P79A 3DS8A 4MS3B 1EGMB 4DTXA 5K0JA 2H0AA 2YW9A 1U49A 2QMHA 3WNEA 3P94A 3MXTA 1TVKB 3ENZA 3IUPA 1WQ3A 5AVZA 5TQJA 2Y1EA 3TZQA 3SK0A 4D3DA 5HGXA 1T13A 5BR8K 2HJ9A 4H35A 2YV0X 1MJ5A 4L16A 3VR2D 1UDXA 4D5GA 5AVQA 2VYCA 1PUJA 2VATA 3UCEA 3IOEA 2H16A 1NBHA 3SWWA 3N76A 3VSCA 3I45A 5BQ5A 3KQPA 2CNDA 2Z2KA 4O1HA 3TI9A 2B83A 3BSSA 3EB9A 4KAXA 5TR9A 4K9RA 3SC6A 1JVSA 1XCLA 2Y6UA 1KDRA 2P0AA 5BSRA 2Z1NA 2HTEA 1BGWA 5IT0A 1P9NA 3MXJA 3K92A 3WSTA 1Y8QB 4A6EA 1X1QA 4CBUA 4C0JA 4N5MA 5KQMA 2HIMA 3SNHA 4QRHA 1K6EA 1GL6A 3OP4A 2JIDA 3BHMA 1E3WA 1FP6A 2FG5A 4YV2A 2B1GA 4HYQA 4NB4A 2AEMA 2QENA 4Q47A 2VPQA 4NTZA 3SXJA 3FPCA 2J3IA 4QAGA 2G72A 5AFUA 5H7XA 4CHZA 3KFLA 2JHCA 1UF9A 1M0TA 2XRZA 1H69A 5DCUA 3CTMA 3UJAA 1Z29A 1YU9A 2BM8A 3KPVA 1G7RA 3DLIA 3FSJX 3NT4A 2FUEA 1KAGA 3CGWA 3U62A 3TEJA 2GVZC 4LV8B 1U4SA 5GADP 4NOKA 2IXAA 1W5SA 3UOGA 2Q2RA 2XMSA 1HYBA 4MUYA 4I2PA 5BQXA 3W3ZB 2FF7A 2K7ZA 4IHQA 2P6OA 4CF4A 3ITHA 3SZRA 1T34A 3KUKA 4CLRA 4YAKA 1H6AA 4B4UA 4BWFB 4RL4A 3DI6A 3VKHA 3H18A 3FYTA 1QG2A 2Y1XA 1V1MA 5AD1A 3II6X 1JDZA 3IAYA 3H8SA 1TF7A 4M8SA 4H4DA 3B1FA 3AEUB 3FKJA 5IFKA 5DYNA 4AO7A 1P5FA 3L8ZA 3RVOA 4RHUA 5KMGB 1WSFA 3RRZA 2JJ2D 2IDKA 4C7JA 3LCRA 2LKCA 3L4IA 3F3YA 3FHLA 3IT0A 3D6RA 4FJ2A 4IV8A 4A15A 4HX9A 1IWPB 1V8OA 1ADCA 3VPFA 3VEVA 1QP0A 1ZOOA 2FGJA 1P8ZA 4O4JB 5IC5A 4CCYB 3NP9A 5KKAA 3P38A 1C1BA 1ORDA 3CFOA 5LQUA 1NR7A 3BSWA 4RENA 2A94A 4Q9KA 2D4AA 3X1XA 3GLFB 1N2BA 2F1RA 4B2LA 3CETA 2XZOA 3WK7A 2JLUA 3DOJA 4BZWA 3E01A 3QRWA 1PGNA 3PNLA 1WZCA 3QXGA 4Q21A 3MWPA 3VPBA 2OD7A 1X19A 1YO6A 2PYIA 2D59A 3HP7A 4CNBA 3T1YB 3O4JA 2IHTA 3I55N 1F8YA 3NGZA 2EQAA 5KC8A 3LUAA 3E9RA 2WHYA 2BD0A 3HXTA 2FWBA 2GZ1A 2LSNA 2Z5FA 5CBKA 5F2NA 1TYZA 2JARA 2FEWB 2X7JA 2P6NA 3O4NA 3TSPA 3RTBA 2X3UA 3QMVA 2OBMA 4YUAA 3RK1A 1PNVA 1UP7A 1G291 2TMGA 5J43A 1E2DA 4NX2A 3EE9A 1E8NA 2JDIA 2XVZA 3EL2A 2R60A 3NXKA 1JR2A 1QQ6A 1IDN1 5KTTA 3JAWA 1NRJB 3AIOA 1JJ7A 2AUTA 3X2SA 2ZI4A 3COZA 1D2MA 4WFQA 3W1EA 3W4IA 3L92A 1BU8A 1N6OA 4L8LA 3UT5B 3FGOA 4X0EA 1MVLA 2Q5OA 4GH5A 1NBMA 1MP0A 4Y67A 4DUYK 1Q0QA 2P1RA 1QO9A 3ZNNA 2OILA 5JVHL 4YMWA 1IUOA 2Z8XA 4YBRA 3O9QA 1KXZA 4WOBA 5BUCA 4CKXA 3EOZA 1KP9A 1ATSA 1UK7A 1OKJA 3OHPA 3L2UA 2BLLA 1U8TA 5CDTA 4QG3A 1U2VA 3NRJA 3QOFA 4C30A 3JVVA 1OYVA 4JYBA 1PX0A 5HUHA 3NDIA 3ZHUA 4DT1B 2AOUA 1V37A 1P17A 3O9VA 3BGVA 1KPHA 2YX1A 3TNFA 1IB0A 4ZVTA 5BUQA 3EEBA 2GPBA 2FWPA 3PNQA 3KXLA 2YYYA 2A9FA 1NP3A 1JH8A 1UA1A 3MCAB 3A37A 1ZPDA 4G1VA 4B32A 1QJ4A 4I5FA 2I4MA 5I51A 5SZKB 4HAOA 3U49A 5K3CA 2G09A 2FFQA 1ZO8A 2LP4Y 1SZDA 4TKZA 5K8TA 1O94D 4ENTA 2QYSA 3DZJA 1K7EB 2PT7A 5H82A 1IOVA 1Q15A 2B94A 1XIVA 4Y1RB 3HJUA 4ZODA 5JFTA 4MQ6A 3H5OA 2R7AA 3AF4A 5HCNA 1E3JA 2X9QA 4B9UA 2JGDB 5IASA 3DDHA 3QM1A 2DFLA 2NLXA 3QKTA 3QW4B 1C1DA 2RHTA 3WLPA 4FPBA 1C0GA 3PDJA 3LCJA 5CB4A 4M3UA 1TX4B 1Q57A 3SJHA 2DR3A 4ZMRA 3EASA 4NY1A 1T05A 1P1BA 3BCRA 2V7ZA 2XQKA 2Z2ZA 4XIGS 4HXEB 3FTDA 1Y9JA 1UADA 1SC9A 2DRIA 4L8RB 2QGZA 5IAKA 1C7RA 3ASZA 3LPCA 4OXRA 3WBKA 4R7TA 3Q98A 3D81A 1JFRA 4LE2A 4MKXA 5B4UA 1L5WA 3SPYA 2DY4A 1M2KA 4FR0A 5EEGA 3BF1A 3NGIA 4H6VA 4DADA 2JCGA 4Y1FA 1GPJA 1WDMA 1J49A 3P9KA 4YT4A 1JFSA 2GLXA 3BCUA 3BB1A 3EODA 1YCGA 2J6CA 2KKZA 2QXFA 4EF5A 2BFEA 1NULA 2OCYC 2QBYA 4WINA 4GKJK 3AW8A 4O3MA 2ZKIA 1T3TA 5LLDA 3GFGA 4MQEB 4NDAA 2RHMA 4DV3B 1YDWA 2XUZA 3NWEA 4WZBB 3WP0A 1T9KA 2UVQA 1QAOA 1XJWA 4MH0R 4Q3LA 3RYTC 1C3LA 1TIKA 1WMSA 4B1VA 2W11A 1EXMA 2R5FA 3PC2A 1U7HA 5FWAA 2JZCA 4IUDS 4V0RA 3SVZA 1P1FA 4JLUA 1NLMA 4MRRA 3U6KA 3VDRA 2GM5A 2QQ0A 3PRHA 2EBHX 2QL9A 2FMIA 2ZJ8A 3L79A 2DC1A 2H7CA 3LS2A 2W8ZA 5CG2A 2XY7A 1Z2AA 4AF6A 2QWLA 5ICMA 4ZYXA 3Q0EA 1KZ7B 3C3EA 3RYFB 2AOTA 1NUHA 2AZ4A 2DPHA 1EFRD 3VQPA 1BCMA 3BWYA 3KRTA 4M1OA 1JZTA 3UMBA 1A5WA 2OFOA 4ZKDA 2EHGA 3UXMA 4YMHA 3PNKA 1X92A 4TTRA 3CUKA 1BHSA 2KX7A 3WWCA 1ZR2A 2RI1A 2P9IA 3PC8C 2GXQA 2ZRIA 1GG9A 4YRNA 4LJRA 3QKSB 1CY8A 4MI6A 3LDQA 2NT4A 2NGRA 2VKQA 3DAGA 5EY5B 1L3UA 2XE4A 3V1RA 4NATA 4FLUA 1EX9A 3D7MA 1BDIA 3QHQA 2VGMA 3HU5A 4TQUS 2DBRA 1LQTA 4C4SA 3HB9A 2AJLI 1HLUA 1ZD2P 4ETNA 5EXWA 1PJ8A 4TTSA 1JW9B 4RTFD 2EF0A 4IDNA 2Y27A 3ZCQA 4OJNA 2WSSD 3PUKA 1BSVA 4D6PA 2PRSA 1NR5A 2J8ZA 3CUWA 1UDRA 4TXHA 1IZYA 2ZULA 3ZYZA 5KYYB 3CRZA 5T4BA 2WHRA 1HT1E 2J32A 1VSIA 4RFSB 4BWVA 1TK5A 4BCBA 3AVTA 1P4HA 4OIFA 1L7NA 4M0MA 1R0CA 4JVSB 1Z74A 4R2IA 3VMFB 3Q7EA 2J9RA 1JF8A 5ALSA 1U3UA 3OIGA 3OE7A 4S2EA 1U1GA 4QNMA 3BZBA 2NIPA 2TMYA 4LOAA 1IK4A 3PL1A 4NENB 1KFBB 1TECE 2QW1A 1DBVO 4A82A 4G41A 2AN3A 4RNDB 1QNLA 3VDQA 1PBTA 4JAXA 1F2DA 2XNJA 4Q3BA 3V4ZA 3RUAA 2H1FA 3ZIDA 1XDSA 3U26A 3WDMA 3ASMA 1NVGA 4L6CA 1MU0A 4AZVA 1FLAA 4N9QA 1YQQA 1M76A 3UFXA 1T2VA 3L6EA 4LRWA 3CJ9A 1XEAA 1OV6A 3IAS1 3CR8A 4Z9BA 3K9NA 2NG1A 1RBYA 1GKLA 3VTIA 1AKVA 1D4AA 1C3VA 4I1OA 4IOXA 3TLAA 3AR3A 5EUQB 3THVA 4Y6GB 2QW9A 2W2KA 4RMHA 4B79A 1OLXB 3LYAA 4INZA 2XJ9A 2Q6KA 5TSDA 5B2ZA 1JLLB 1AT1A 3PU6A 1CIPA 2W2TA 1P44A 3IQGX 3OJCA 2CJFA 2BBOA 3I01M 2NQ8A 5FOQA 2AQKA 4HS9A 3ICQB 1CE8B 3LHFA 2E2OA 3HP1A 1UOQA 1UEIA 1DX4A 3GK3A 2BBWA 5JRZA 2C7OA 2ZI5A 5DRYA 3K0FA 4R7ZA 4ARAA 3ORFA 3T5TA 2EFDB 1VIAA 2WHXA 4HTUA 4B43A 4I3HA 5DTIA 4KK3A 3RNOA 4A3SA 1V1JA 1HT2E 5H3LA 1YKFA 1E2JA 3EZ6A 2V3CC 4E7PA 3CYMA 5G1NA 2EKQA 3FOFC 2C8VA 3QVGA 2IEZA 1ZH4A 2C9DA 5LWHA 3A6EA 3JQBA 2O2HA 1L4KA 2C5SA 3MJFA 2J59A 4WLOA 5CW2A 1UM9A 2ZRCA 4DB2A 2YVUA 3HVKA 3JAMO 3GARA 2VTEA 1SC3A 4P4TA 2B35A 2V98A 4PKHA 3TW0A 3EZNA 3D4IA 2H1LA 2HPAA 5IBRA 3NIFB 2O7NA 3T19A 4L5BA 1ZBUA 3PX4A 2OV3A 5EOVA 1Y8ZA 4LRTB 5A4IS 3OX4A 6ABPA 2QZ4A 3TW8B 2C9CA 3NBQA 1IDOA 3IAXA 4A9AA 4IKFA 4C7MA 2Q3DA 3LDSA 2LCFA 4M98A 3LJKA 1RXEA 4I55F 3ENVA 3NX4A 1W9HA 1T9ZA 4QZVA 1PFGA 4MLZA 3N05A 4YXWA 1YK0A 1PLJA 1IBLB 4J1TA 2G08A 3KU1A 2PU7A 2ORYA 2Z09A 4DTJA 4UUQA 1GT6A 3ZCXA 1YRAA 4LTDA 4UASA 3LANA 3QLVA 1L5ZA 3GJXC 4MRVA 3FWNA 1FFSA 3DDUA 4MV7A 5MN6A 3OTOB 2D4HA 3PXGA 4YV0A 4Z7OB 4WBNB 4H0TB 4US1R 3UWSA 1J2YA 3CX6A 4G5QA 3HG7A 1KDPA 3L0SA 1R27A 2GNAA 4LWQA 5T4EA 5JDCC 2PANA 2OCPA 3H5LA 2PYZA 5DYWA 3P26A 3UWOA 1ZJZA 3G2QA 3T1VA 1W76A 4AHSA 4LSWA 1NI4A 3PR2B 4MUGA 3UMMA 2DSNA 1H4SA 4GZLA 2QRGA 4B81A 5AQZA 1KEWA 4NBLA 3KZCA 3KOWA 1HDYA 1RPTA 3SHQA 1SKYB 2F3RA 5CW1A 1CUWA 4RF5A 4F9TA 4JK7A 1P7CA 3C98A 5I7VA 2NO0A 2PBDA 1CR0A 1WB5A 3RFCA 1H6BA 5M34A 2OSVA 4BFYA 3EIXA 3QF7A 3JVDA 4QBFA 1BCSB 2DPGA 1X14A 5AQFA 1K5DA 3CC8A 1OIXA 4G36A 3AHCA 3O6WA 4CL3A 5KO2A 2P9BA 2KFNA 3L7OA 8ADHA 3EC7A 2E89A 3G8AA 4K2HA 2CNWA 5AW3A 5JVGL 3OT1B 3QETA 3FDFA 2WWYA 2GBLC 3W5JA 3KE8A 4KN6A 3VKUA 3WIEA 4WV3A 3OCZA 3HZOA 1YFKA 4IGKA 2ID8A 1I2AA 4B6PA 5TRTA 4CHQA 3PLRA 4DR3B 4OI0A 1GTVA 1GKIA 4WA8A 2ETXA 4UVDA 4QXRA 3HS3A 4LH4A 3DE5X 4XWWA 3N6VA 4YASA 3GL9A 1M5UA 4TS3A 4NR0A 4JHLA 3EJWA 4JQSA 4CJWA 3KCQA 3EEIA 2BH2A 5J4VA 4E7KA 3BCSA 3PTZA 1Q7YO 1U8EA 4EYOA 4N6OA 2OORA 5CCBA 1GSOA 2XE8A 4Q66C 2AOVA 2R7KA 2OESA 3R7NA 4Y6LA 3QLTA 2E18A 3NHSA 5T57A 2UXBB 4M4SA 2X76A 4YHHK 2Q8PA 4BMCA 3S99A 2GO1A 1U0HC 5ADXA 4J0EA 3FLBA 4AZ3A 3FPSA 1QVWA 3NKFA 4KQ6A 2EJWA 3RSGA 1D9XA 3LC0A 4KDRA 4I2QA 1U3WA 3EW7A 3EQ2A 1Q50A 1FB5A 1UK8A 3NF6A 2G25A 1VRTA 4P7FA 3CW2A 3EDOA 4DLVA 2W5UA 1L7MA 3K6KA 4ZT4A 5LQKA 2A9VA 1W6RA 1IEVA 4HQRA 3C45A 2AK2A 3TR0A 4ZV9A 3TSWA 5LBUA 1MVNA 5ADUS 3U61B 1KVCA 3IPCA 3VNUA 2O8FA 1JIKA 3I92A 4D9GA 3QZUA 4DDVA 3PDCA 5AZJA 4Y2SA 5I7FA 3MWFA 1KERA 1BN6A 3DBRB 3L6QA 1IWOA 3KSDO 1SKMA 4IMJB 2D7CA 2W2NA 4RZSA 5LYJA 4FMDF 2PWAA 5A62A 4WL0A 5ITZB 4JYAK 3B89A 5DYTA 2I22A 2ZJFA 4IO1A 3ORSA 3UXHA 4J2TA 1XX6A 1ESCA 2H4YA 2V45A 3MRXA 5E6RB 2DLDA 4IQ0A 4BBPA 3ZHVA 1XCOA 4ISCA 1WX1A 3NHUA 3ND7A 4L2IB 1ZEMA 3A28A 1SOWA 1YXQA 4M3RA 3AV0B 3AP1A 5KBYA 3HDHA 1V39A 4CHPA 4H17A 1E2HA 3ACDA 1HEIA 3M83A 1G8JA 4Q1DA 2KW5A 3TNDA 1SG0A 5TX7A 1W0JD 1LI5A 2UXDB 5BNIA 3ADCA 2IHVA 1T3GA 4CJSA 1FX1A 1K8KB 2EJUA 1TB4A 4H4CA 3BP8A 1M66A 2HOQA 3HJBA 2HW8A 1P75A 4QAQA 2HR1A 3L7BA 1CIJA 5D51S 5FF9A 3VHRA 3NAMA 3QVWA 2VWBA 1RP7A 4NYIR 4HGOA 1M2VA 2FG6C 2GARA 3KIOA 1Q84A 2MMCA 2I6XA 1XU4A 2RBEA 5LZ8A 4C6HA 2DY0A 2C0QA 4EY4A 3TW6A 3WDKA 5M3BA 3V9PA 4NMHA 1HT0A 1LV8A 5CT5A 3KKZA 1JIJA 2GK7A 4EHFA 3THYB 2R4QA 1SUBA 3N8KA 3FN4A 1VL0A 4X63A 4B8YA 2BGNA 2JAOA 3PSIA 5ALFA 2IPAB 3CMCO 3QELB 4RESA 2JK1A 4B09A 5FOTA 3C6ZA 5AJHA 5DP2A 4OHKA 4PHGA 5FORA 5LNK1 3ZT2A 4I1RA 4B6EA 2ZRJA 4CRWB 3FVVA 4X7BA 5KNCA 1S2GA 1E5LA 4GZ6A 4DBLC 2PSFA 1RDWX 2OCGA 1X7HA 1IE3A 1F2UA 1G5TA 4QHYA 1L5HA 3QX7A 3F98A 2I7DA 5AO9A 2DU8A 4B6RA 4U39A 3RYHA 3L1JA 2NAPA 2BEWB 1YGPA 2OZVA 3F4BA 4NL4H 3G13A 3QNMA 3EOAI 1B0AA 5KYTA 2W6PA 3LMKA 1JS1X 1XB2A 4NE9A 3S27A 1NQTA 2QPAA 4LSNA 4ZTBA 1Q2XA 1ZGCA 1Y82A 3EGVA 3C70A 1CFZA 3IYLW 4G5YA 3M4NA 3EBPA 4C4OA 3WNDA 2NM0A 3GJSA 4MVJF 1PFWA 2FEKA 4I1SA 4I9FA 5B6IA 5FBHA 5HBRA 3ZHTA 2E2PA 3IKJA 4EX6A 2VUUA 1DBQA 1NWCA 1BIFA 2FHSA 4XJXA 4DARA 1L5OA 4BG9A 4BMSA 4CM9A 1MG5A 4TRJA 3AT1A 3NMUF 4HQKA 3C74A 5L8VA 2I6FA 1KCFA 3RIEA 2HV8A 1E9FA 1LSSA 2JH8A 2EW1A 1MZVA 2V6FA 1UFOA 3RRFA 3LHSA 3U3XA 1TU0A 3VESA 4Y30A 3TQIA 1KOGA 1UMKA 1IQPA 1TK0A 1S9HA 3B7GA 3ZV6A 3R7WB 2Q3CA 1ZH8A 1IM2A 3NC0C 2R8RA 1WZEA 1CUCA 5F5NA 3IUJA 4CW7B 4KVGA 2CBXA 1A71A 4JR2A 2H5EA 5IFLA 3LBHA 2QQEA 2HBRA 3DKKA 1T1GA 4TSRA 1CR6A 4RSRA 3KTAA 5J23A 1Z45A 3HBFA 5KHAA 1QCCA 1E5QA 5MFPA 3TZHA 5KVSA 2X5JO 1LZKA 2UUAK 2BFWA 4R1QA 1KAXA 2PX5A 3HLTA 4RGYA 4BLPA 1LFAA 2VHJA 1CK4A 1Z05A 4OSEA 3GLTA 5B58C 1VRCA 3BK1A 4ZOLA 4NP6A 3J8AA 3LK7A 4EB8A 2XWQA 4DMKA 5BWLA 2BGTA 2FW6A 1EB8A 2BFMA 4R2LA 4L8FA 1XN4A 3P0RA 3ITDA 2C9MA 3N70A 2E4UA 3KLBA 3LIIA 1AMNA 1WP4A 2NQ2C 4FDTA 4ELVA 1UFRA 4EW3A 2YVLA 2ZRPA 1FQJA 4WLVA 3BICA 2C94A 4KV9A 1GPMA 4LA4A 4F3OA 4MQ4A 4FYMA 3WIOA 2RK3A 4LD0A 1JQDA 3R6LA 2BMEA 3Q72A 1JLEA 5JV5A 1D3AA 2E0IA 1G5QA 3K20A 1FFXA 3NGLA 2F48A 2YCLA 4O5FA 4CIYA 1TKBA 4D3YA 3N3BC 5K8UA 1WSBA 1Y9AA 4KBOA 5AVWA 4U6QA 2DSTA 3LPLA 5HS6A 4KPYA 3PXDA 3GQBB 2ZR0A 3GBSA 4EY7A 4EA6A 4JGIA 3G02A 2ZS9A 1XR3A 1JQJC 1VE6A 2JCXA 1K4YA 1YIDA 4KQGA 3RYCA 4JBIA 2CLHB 3HI4A 3U7RA 3ER6A 4A0FA 1M34E 3I76A 2I78A 5DGHA 4NZMA 5BRAA 4MYCA 3MTIA 3WS7A 3QW2A 3IVMA 1XDUA 3AJEA 2VNIA 2JVKA 1OJ7A 2ODEA 1QHYA 3KKRA 4RCHA 3VQ6A 3IVGA 3M9WA 2F4VK 2FB9A 3ZNQA 4KITB 3E22A 2EKBA 4Z9FA 2GM9A 4DMMA 5FLXO 2QRZA 2OZPA 3NGMA 4ZTZB 4MROA 1T5SA 5D00A 4HMPA 1RNHA 4CMCA 3K09C 1UBGA 5FT9A 2QD3A 2JGRA 1BX0A 3H8VA 4CKWB 5ESWA 1K7SN 2ZSDA 3LUHA 5CYGA 3R1IA 3AV9A 4KPFC 1C1YA 1OX4B 3TL3A 1RQ7A 4H1TA 4RTMA 3TE7A 5F1OA 3FZYA 2C2MA 2JGJA 1VLZA 1G19A 4WXYB 1VIMA 3P9PA 3U9TA 3AF2A 3F47A 3MTAA 2JGKA 5CFNA 3ANYB 3F3SA 1GV1A 1QYRA 1JLGA 1L1QA 3FTCA 2QRVB 1CPYA 2D0OB 1DQNA 1S3XA 1RW4A 3P9XA 4BKQA 4A61A 4JENA 4DM3A 1SHLA 4H0VB 3NBFA 3RNLA 1E3MA 1YASA 2SHKA 3SMVA 4LFAK 1CVRA 3M3DA 4MQ5A 5CDFE 1K6YA 3OX1A 3IRUA 3EZGA 4PNHA 4BR7A 3PIIA 4XQ0A 4OFBA 2BKEA 1Y42X 2IL1A 4FWPA 2CXUA 1HQDA 4XGIA 2YWHA 1C8LA 2CNOA 4ESOA 3KALA 5HTKA 1H2FA 3AFOA 2J08A 1XD2A 1DHTA 4M6WB 3L77A 5DM60 4BV9A 4RACA 1ZX1A 2BMJA 3K05A 2XGOA 1PHPA 4IFTA 2VEOA 4G1BA 4OU4A 1IUPA 4E21A 4DTIA 5AUNB 4W99A 1RJFA 4I8IA 4BC0A 3Q7RA 3RABA 5KHLB 3MGCA 2H48A 2WG1A 3KPYA 3G5UA 2IP4A 2VK4A 3IPXA 4P22A 3FAZA 2NW6A 2PS3A 1QPZA 4K6KA 3L6OO 4DPLA 2A6PA 1ZBDA 5KTNA 3PNPA 1UC9A 5DV9A 1G8AA 4FMBB 3O8OB 3B8HA 3KLPX 3NKLA 1EUZA 3JQEA 4EG5A 1FJXA 3LBIA 1BMFD 2CZCA 5CDHA 1E3IA 4BFUA 4PANA 4WDRA 1HTBA 2HC9A 1GU7A 4HH4A 1PFKA 4F72A 1NDQA 1FSGA 2CLKB 1U65A 4QBGB 1GSAA 4TLBA 3PK0A 5K7SA 5CEEA 3NWJA 2ZYAA 4JL6A 4PYNA 2IHJA 3CT4A 3PYXA 2NRRA 3ORRA 3GGPA 3RKUA 4JLSA 2ALJA 1TAQA 2Q3JA 4V2UA 1FVFA 2RH8A 4U2EA 1FJ2A 1QF7A 1ZM4A 4HS4A 3R0QA 3D7LA 4H77A 2C2KA 4I81A 5LWQA 3WFZA 5C9ZA 3CZ9A 1YVRA 1WLYA 3E3NA 1A04A 3I8XA 3O83A 4EVSA 1SVIA 4F8RA 1EM8B 4H18A 4ECAA 2FSVC 3NBKA 5TQ0B 3G3EA 2Z6VA 2M32A 2YVQA 2D54A 5FV7A 3BXGA 3FIUA 5JH7F 4PO9A 4HOYA 2IHYA 4LDNA 1ABFA 1E1RD 1RWXA 2OV4A 1P1KA 5CAEA 1Y8RB 3DZCA 4J3NA 4RVHA 1N2HA 3AY7A 5KPZA 1DKMA 1IRXA 3AO3A 1FNMA 3K0HA 4G5XA 2F3QA 1RYEA 3N7AA 3VR3A 1GILA 4E1BA 1CIVA 3FZGA 3SC4A 4MS4B 3R8CA 2P77A 5JUWA 4HRYA 1KU0A 4IDAA 4LYJA 3RWMB 4D92A 3MS4A 1X13A 1VTKA 2DLNA 1S1VA 4IDCA 1XQ9A 2F1KA 1KI3A 2GWJA 5BSGA 4IQ4A 1SG6A 5A2QO 3M49A 3HXMA 4B1ZA 1DDOA 1W49A 2GD6A 3QNOA 4YAFA 2VPTA 3VQ9A 1BRTA 1Z0AA 2Y9MB 3PDUA 2JH9A 1C14A 1V43A 3FZNA 1KQGA 1EYZA 1KWKA 1V8FA 4DTSA 4DIBA 1N78A 1GAEO 5L40A 1IJFA 4JX8A 4BNGA 2OLKA 1XCBA 2H00A 4RQBA 1KZ1A 2M6KA 4AHVA 1NW3A 3AVHA 2ZIWB 4P84A 2CB9A 2WG2A 1GCOA 3JYNA 3P0HA 2GEBA 2K87A 3IKLA 1PEKE 2FSHA 4MARA 5AP9A 4O5OA 1A7AA 2DUNA 3E2MA 4BLSA 2BJWA 5FEMA 1OBHA 1IJJA 3Q8MA 3QKWA 4HNSA 4KXVA 2AV6A 5ERXA 2D1QA 4NU0A 3LT5A 4CGHA 2Z9CA 4WZ6A 4U8GA 2PFUA 2BMVA 1KI4A 5FH9A 2QJOA 3WWDA 4YPVA 1UBJS 2GPAA 2WDPA 4B3BA 2OZLA 1M2OB 2KYRA 2OPBA 1KH3A 4PVDA 3WGVA 4BO6A 1FSSA 1JAIA 4AY5A 3DVAB 3CZ4A 2QVBA 3E05A 5FCDA 4HDNA 3L4BA 4UKDA 2DHCA 4EIAA 4FTWA 5IKEA 3OFVA 3K8QA 2DVMA 1E9SA 3MAQA 3TZKA 4YCNA 2X0DA 2BBSA 2ZROA 1CLEA 4PRZA 1JR4A 5F76A 1O94C 3O90A 2GCPA 1I13A 2AI1A 2XB4A 2HF4A 2RFLA 3IAAA 2C57A 4EHNA 4UCFA 3ZDXB 1UBFA 3P2JA 1CUDA 5L3ZA 1CY0A 4BHTA 2OZEA 3OQ6A 4GVXA 4DWJA 3TINA 2GLTA 3NALA 2GEVA 4IJKA 3K9QO 3N58A 2P35A 5L7YA 3AHJA 4E5PA 1PTJA 1AN9A 1ZD3A 3OE1A 3S0JA 4CDRA 3EIWA 1M74A 4CMKA 1BKDR 5HIMA 3THWB 1VKZA 4Y1DA 3RI3A 3GOHA 1WUYA 3SIPA 4ILKA 2C9BA 1R4NB 2NT3A 3DE1X 4RTPA 3AVYA 3R4CA 3LGXA 5IKPA 1R7RA 4N7BA 1WSHA 2QTTA 1IM5A 3L7LA 4LNHA 3JYHA 3DXKA 3VZRA 3MSCA 3LUKA 4JWTA 1RKQA 5AW0A 2REOA 3ASVA 3Q7SA 1GARA 5BT9A 3TECE 1D2NA 4QHTA 1GEGA 4O55A 4JFAA 3NAQA 1FPMA 3ZCPA 4HX5A 2AQIA 2QR5A 2DR2A 1CRZA 3ELWA 5L3VA 3VQQA 3NHJA 1IKVA 4MWGA 5EG5A 2X22A 5CHEA 4XYMA 2HPZA 5DGXA 4ZK2A 1BMTA 3ZEIA 1L1FA 4JT9A 1OF1A 1X3MA 3CH5A 3ET4A 3CE6A 3ZEUB 1NRXA 2AHRA 3C1OA 2AD1A 5B1YA 1WSEA 3I28A 1QP4A 4Z4GA 4QA9A 1SXGA 5GOZA 3FX2A 3L7YA 3UT6A 3WLOA 4F71A 1XNRK 4BC2A 4MYHA 1M1YE 1T9AA 2R1TA 1XD8A 4J2DA 2P9QA 5A7GA 3VKFA 4KP7A 5GIOA 1EP3B 1BQ3A 4W7IA 4JBGA 4CPDA 3UWPA 2XOKA 3V1OA 1RR6A 3ER8A 4BRCA 2QR2A 3QBVA 1MX9A 2WT8A 5FLKA 3OPYI 3CZRA 3RVMA 2ZIAA 4MDBA 3CSDA 1DAIA 1X1CA 4RHCA 4D82A 4G25A 3HBTA 1FX0A 1T0JB 2CVOA 5EA2A 4CMHA 1XRSB 1L5YA 221PA 1TAUA 4FFBA 3O4QA 1URPA 4I6EA 1CS0A 3NHZA 1MOSA 4LF9K 5TF0A 5IUKC 3VAZA 4B1XB 1YR7A 3QX8A 1TO1E 3NEJA 4MP3A 5IZCC 2ERCA 1MENA 2VIIA 3QUCA 2WB4A 3IAM1 4UTRA 3DEZA 1A5ZA 4QLOA 2YC2C 5JROA 5EFZA 1Z4OA 2O52A 4HZUB 2EERA 3CNBA 4YLEA 1WE2A 4G65A 2QB5A 4PFKA 4NG4A 4YJGB 3NVKA 3PIDA 3WLSA 2HRQA 3ACCA 4TGLA 3BK2A 2L18A 1UH5A 4ZRNA 1NBAA 3MWGA 2C96A 2YBEA 2WHQA 4Q7LA 3AVPA 4P7JA 4UDXX 1NYTA 1AQUA 1QHTA 1PT8A 1PR2A 3V1YA 4DMHA 2ZITA 1E3SA 3H4MA 1VSEA 2PN1A 2VG5A 2RGCA 2XI4A 4FE3A 1KYQA 1X42A 1TAHA 1YIAA 4NMMA 2PVCA 1G18A 2GTHA 1HQYE 2HX1A 3DAOA 4Z1MD 3PNYA 3DB2A 5E6SA 4DLPA 1OFVA 1NJYA 4FXDA 4HLUC 1LU9A 1QHFA 5B64A 3UBTA 3KJGA 3HKEB 1OGIA 4DFDA 1S8OA 2XQJA 2AJ8A 1GGJA 3DBLA 4YJHB 3NNSA 1I4DD 2GUPA 5JD5A 5JU6A 1MBZA 2XB2A 2YHIB 3LFUA 2JCVA 4WFKA 4M3YA 3DHNA 3MGAA 1HC7A 1UBSB 3N1UA 3BF3A 1OOEA 3K30A 3UIQA 3WNVA 1JAHA 4YCAA 1XEFA 1MEEA 1PWYE 1OWNA 2XEXA 2ZZKA 1NMEA 3RIMA 2E4LA 3AVJA 2X9NA 1U2DA 2GN1A 3SU8A 4MO4A 2NU8A 4BQPA 3TB4A 4E5UA 1TYDE 3VKVA 1LCIA 4PY5A 3RUHA 3OY7A 2Q8NA 4U2GA 1AB6A 3WXKA 1XTQA 2XQFA 4UVGA 1UZAA 1EUDB 1QO7A 4FLXA 5JAHA 3VKWA 3NHAA 3EXIB 1KZGB 1TT5B 4R9NA 1M34B 4DTCA 4WGFA 5JSQA 4EKNB 4DEXA 3RMCA 2CLDX 3IE0A 4QBTA 1PCXA 3QUSA 5IMSA 2HLDD 5FPNA 1VGQA 2CHEA 2OLJA 4KBYA 3A8YA 2Y92A 2NUTA 1SBYA 1BVRA 4LCJA 1UMCB 3O95A 3FD8A 5EUCA 2Y0CA 5KYXB 2PWZA 3IHKA 1TYAE 5THQA 4MZDA 2XSZA 1IJEA 1G6KA 1LW6E 4H6XA 3WHLA 4F84A 2V3WA 4HBZA 3WYDA 3OVMA 1CYDA 2KPOA 2EP8A 4PF1A 1P2SA 5DHRA 4JEUA 4ROTA 2FZWA 1DJNA 1WJGA 3OUUA 3TLJA 4LJ4A 2H3HA 3WL6A 4KFBA 1NN5A 1NXOA 2XUHA 2YNHA 3IR5A 4FQ8A 2BFCA 1UJBA 2QTAA 2E5LB 1OBCA 3EDMA 1LS6A 3LT0A 2WJ4A 5BXQC 2C20A 3F6RA 5G4KA 1WY7A 4J8FA 1BI4A 2CDBA 1ZN9A 3PNOA 4HFMA 3L2OB 5MN4A 5DTMA 4CIXA 3KWIA 1E4EA 4WLFA 4RPCA 1YB2A 1M9NA 4FI3F 4J16C 4ZQFA 1M75A 2YZMA 4IIDA 1Q7EA 1SNYA 3EO3A 2C4UA 4QJIA 4FDVA 2OCXA 3AGQA 4H1WA 3PR3A 5C81A 4GY2B 4E7OA 5KWIA 4D9FA 5LLSA 1P1RA 3B9QA 4HAZA 4BO8A 1R0ZA 1ZDMA 1IBKK 2O6HA 2YNMD 3T7CA 3OEYA 2XUFA 4RM3A 3H4VA 1W1UA 1LLDA 5TPWA 5KPTA 2VJNA 2FV8A 2PHZA 3QLUC 3ZY6A 1CUJA 3I9LA 2WWIA 2VDUE 1KI7A 5LXTB 3K71B 1M8KA 2Q7XA 3SCXA 2BTQB 3PNSA 3PHCA 3HU2A 2C5EA 2P8SA 1NZDA 4CFBA 3ZDFA 1D04A 4JKYA 1PL0A 3H0KA 1U1DA 3OJSA 1FVXA 2I03A 4FE4A 1Z0KA 3ROTA 4C89A 1ECJA 4B33A 3RV3A 1Z0DA 4L28A 2MU1A 3L7NA 3MXMA 4ZQEA 5IJWA 1G20E 5E2AA 3TAHA 4YRIA 4C0SA 4HK4A 4MUBA 2QXTA 2IU4A 2PE5A 1UPUA 1PZMA 2WJVA 3F2VA 2X40A 1GLBG 4IZ9A 3ZKWA 4HRXA 1F6DA 2ZYDA 4FR5A 1AZTA 4QVGA 2XCUA 2YZKA 1E92A 5TC4A 3BYZA 4QUEA 1P6QA 2I76A 1LNSA 1PUXA 2YHYA 5SYNA 2R0QC 2AT1A 3DXYA 1BVUA 1J5XA 3EIQA 2QWQA 4D96A 3BFJA 3V7UA 4BRPA 4WCFC 3MJSA 3GYBA 3RVLA 1G2QA 1MABA 1A50B 4AMVA 2HH9A 4OLHA 4K6CA 3CRQA 2XA1A 5P21A 2Z4SA 5CIWA 1US8A 3M8SA 4MINA 4RZQA 1ADBA 1VZ3A 2CGLA 1AY0A 3BL8A 2WSBA 4H2DA 4M0EA 3VA3A 1GTRA 1OI4A 4M1SA 3VVMA 2BPOA 4ZAZA 3H16A 2ZBDA 3CRMA 1S1MA 3VKGA 3SBXA 4EHDA 1MJNA 1N5MA 1CQZA 1UJMA 2XTMA 2J3KA 1QYDA 2HXYA 5TJ9A 4N3CA 6REQB 3TI0A 3MF4A 2ZAMA 1CZ9A 4DKJA 1OVMA 3EN0A 1YDHA 5DLEA 1T15A 5DM1A 3KAKA 1N2XA 2D1SA 1N2GA 4WX2B 1BXRA 4IG0A 3HDYA 4HQNA 1WXXA 2D5LA 1ZD1A 4CMIA 3I0NA 4DV6K 3JWGA 1HNXB 1V5EA 2ABWA 4JLWA 3RTEA 1L5GB 4PBTA 3WC4A 2AKAB 3PFBA 3WIUA 3QE0A 1UA0A 2H92A 3DZ8A 1R50A 5ECWA 5DM70 3RBAA 2FBXA 4HNVA 1ZN2A 4H5TA 1Z7EA 1TO6A 5ARDA 4RQUA 3DLRA 4DY4A 2YN2A 4KH6A 3EMKA 1Q7RA 1I1HA 3PFIA 4NYNA 2WUGA 4LZPA 5FI1B 5SICE 2JIZD 1JQAA 2QD1A 3U2QA 3NBMA 3DPSA 2FQWA 3MAJA 4U2BA 3FTPA 5CA1A 1X1RA 3EFBA 1USUA 4E11A 4RDIA 1JVBA 1GYRA 5TMBA 2BKAA 5EI5A 3FZEA 2VJLA 3O3GA 3E5NA 1NJXA 4UTZA 6PFKA 3ZDRA 2ZVJA 2HJWA 2D2XA 1A2OA 4HWTA 2WTUA 2GZ3A 3V4SA 4FJ7A 3GZJA 1YNSA 4MRMB 2O7RA 4ZI7A 2RGWA 1QHIA 4AN0A 3FLAA 3RC7A 1UC4B 3A7EA 4LMRA 4X66K 4HWOA 1FBTA 3Q6IA 4X1KB 4JOBA 4F4KA 2JA1A 2LVBA 3EG5A 1ONSA 3BKXA 4X20B 2FUG1 4MEJA 2YHXA 2UVDA 1V11A 5HYVA 4Z99A 3VZDA 1LDGA 1QZTA 2D5IA 2B2NA 4KX5A 5IK2D 4AZTA 2P5TB 4IF6A 4C7BA 2XGJA 4JLMA 4WOJA 3N2LA 2MSKA 1OI2A 4YAJA 2ZUBA 3SQXA 3HB5X 1FTGA 2P27A 2J0UA 2PMEA 4JV5B 2I7CA 1S0UA 1BE1A 2PNJA 4KDCA 3UGTA 1NMZA 3UA4A 4PZ0A 3BIXA 5DULA 5IABA 2FK7A 1J00A 1PWXA 3MN6A 3A3PA 1AMUA 1GU0A 4BFVA 4ZMBA 2NRVA 4DV7B 3IR6A 5ECDA 5L9AA 5U9CA 4YOYA 3EKUA 3ZSWA 4BKRA 4CU2A 1P90A 3I6IA 2HDHA 1II0A 1U28A 2CJWA 2BR4A 1SBTA 2JPDA 4HDQB 4LRUA 5KYKA 5K3EA 3LDUA 1AMOA 2QX7A 5DSZA 4UY8O 2ZRLA 2ZE8A 2XDQA 2B8EA 5J2UA 3DMNA 4MVWA 1U4NA 2E37A 4UE6A 2GHIA 3L01A 4R0VA 4D3ZA 2IU6A 3DKVA 5GJVC 2G0AA 4GICA 4YCCA 3GMTA 2WC9A 3IUMA 4I1UA 2P2DA 3ZY3A 5AHRA 4EMUA 4J43A 1TNDA 2J33A 3CZQA 4JEHA 3C7CB 4MX8A 1WKBA 3O9TA 4ZT3A 4NCIA 4R54A 5FI0B 1PZNA 4ZHQA 2D1YA 1JKJA 3GR6A 1VA4A 4MV5A 1Y33E 1RLIA 3GRFA 2QM3A 1BCRA 3G82C 4IFIA 2VF8A 4OK6A 4IWNA 3CEPB 5JJCA 3PDHA 4OHVA 2PSEA 3LZDA 5JQWA 4KQMA 5H3CA 4RTSA 4CLOA 4RDXA 5FO1A 4CM5A 4EGAA 4K9LA 1V2GA 1X9GA 2JGEA 2LIPA 1N32K 1MO3A 8ABPA 1ZITA 2AC4A 3C8HA 1EHYA 3D64A 4X45A 1A8SA 4RQAA 2SECE 3QSGA 4RX1A 4DJ5X 3X1ZA 4X1YA 1QO0A 3GFTA 2ZJ1A 3EULA 4C3VA 5KUTA 4JSRA 1FNNA 4ITRC 5JEDA 1Z5PA 3F1LA 4ISEA 3KT6A 1MXHA 1FP7A 2Z04A 2JB9A 1FFEA 5F7OA 1BS2A 2DFPA 2HBQA 1M1YB 3F90A 1JFVA 2DFFA 5CNJA 3PWSA 1MIOA 3FZKA 4MW1A 4FYHA 1ZS9A 1LQ2A 3PI7A 2O5CA 2FVYA 3SSMA 3WOHA 1CW2B 3FOWA 1ZJ6A 3GNLA 4G8BA 4F2SA 4CF7A 1K3TA 4FJIA 4QYIA 3WICA 1THTA 4HZIA 3RBZA 2NO6A 3ZLTA 3UXYA 4CETA 5U4XA 2FWIA 2RHRA 2D7DA 4GYWA 2WF9A 2QVZX 2YICA 4QODA 1QLHA 3LZCA 4GPBA 3C3AA 4Y2HA 1N6HA 4BQRA 3IKVA 3CF6R 3GMDA 2HD4A 2XZPA 5EE1A 2QYOA 3TW4A 4D57A 1QQ5A 1N0WA 5JDIC 4YDUC 3PPIA 1EFLA 3O1JC 1C3OA 1XXLA 4Q01A 2EHDA 5TVKA 3E27A 4L72A 5J59A 3X1WA 4Y0WA 3LP5A 1XP8A 4LFBK 1KI6A 2NYRA 1JH9A 2W37A 4QS7A 3DH0A 2GNPA 3VVCA 2O5VA 2MR5A 5IXYA 1DMRA 4AG5A 2QL5A 5DEIA 4UNIA 1WEHA 2ZK7A 2C7PA 3DAWA 4I2VA 1VBFA 2CN1A 1VP3A 2D0BA 1QH8A 1REQA 4BLQA 4LOLA 1FUKA 5KS2A 1JJIA 5HBGA 1D1QA 4CZHA 1Q0TA 2PSDA 4YCDA 1RQRA 1IKWA 5K0LA 2LNDA 1TL1A 1ZUNA 1QTQA 1NXVA 2UKDA 3ZLUA 2PLRA 1VLVA 2NWQA 4X44A 4QFCA 2JFXA 2HF8A 1YAJA 4Q12A 2UVPB 4ER3A 4UBLA 4RPKA 2JGLA 3O73A 2XY8A 3HRGA 3WV5A 3JPWA 2KHZA 5B53A 5AKJA 1JI0A 4H1HA 4QXQA 3N07A 4MGIR 2B9EA 5JFOA 4OREX 4RIGA 2RKWA 3ZX4A 1YV9A 1WDWB 3IDZA 3AJ8A 4QUJA 2E4AA 3FPBA 3L0QA 2HWYA 2GWKA 4Z4FA 1GGKA 5FNVA 4K5QA 4YUWA 3I5YA 1M1NB 1DAOA 3FCOA 4M53A 1Q83A 1C2YA 1DZ3A 1L4FA 3PD0A 1XZPA 4D43A 1ORIA 2QTRA 1Q1QA 2WU8A 5JQGA 2E8AA 2H2HA 4RJ2A 3SQ4A 1EXDA 3PLNA 4TMFA 3OM9A 1G99A 3HYRA 2NZUG 5AICA 4JUCA 1JEEA 2XGMA 3ILYA 2AR7A 3BCHA 4O63O 4YLGA 3UHJA 1HURA 4ME6A 3CVWA 4Z94A 4MPPA 1Q3KA 4TZ6A 1JLFA 1RBUA 5TDHA 1ZSNA 1QDLB 1NQAO 2FMTA 2YZ7A 4IIJA 4FZXC 4BR5A 3V80A 5DXAA 5F1KA 3K1JA 3W2TA 2JLSA 4I1YA 4REQB 2QK9A 3WADA 4IDOA 3SZMA 5DOVA 4NRDA 3DDZX 1M0SA 1WHSA 1MDFA 5IH3A 3KS9A 1J25A 2VKTA 3SIXA 1TM5E 4PAWA 1V8PA 3QFCA 4F3NA 4AJKA 1E7WA 1KFJB 2Q1NA 1GDDA 3ANLA 2O3TA 3MS2A 2ACWA 3H6EA 3KYBA 5JECA 4ZI2A 3UC5A 2GB4A 4Z7NB 3TLEA 4U3JA 4C1NI 2FPGB 1YT5A 4KDFA 3ETDA 2CXTA 4QQKA 2X2EA 3IIJA 1VJTA 3I5UA 5AVVA 3I6ZA 1WSDA 4GLLA 3V9ZA 1HMVA 4PGGA 3ER9A 1S89A 2I2FA 4IXNA 4W5QA 1WOMA 5EJFA 1KMNA 4EB0A 1BDMA 3NF7A 1EAYA 2QM8A 4M9UA 5DT2A 3LPNA 2DKNA 1VPDA 1EWYA 3B6MA 4PZLA 4UFOA 3L3BA 1HTTA 2BDTA 1RYZA 3QPUA 2ZAOA 2D13A 2HLNA 2LXNA 5J2NA 1PU2A 3BHJA 1N3YA 4QEDA 4CEHB 4G9BA 4M8NE 2GM4A 1USIA 5I5GA 3OX3A 3QPBA 4NNJA 4IDGA 2ZQ5A 1W0KA 3DD5A 2JJ1A 4YVFA 3UK7A 5J4KA 5FTMA 4IPTA 4LBZA 4Y6RA 3U1BA 2BVNA 4KQ2A 4DR1K 1T10A 3GNSA 4RYDA 4G23A 4J0GA 4J7AA 4CEOA 1K73O 3B3GA 3TFWA 3GY0A 2EBUA 1ADYA 1U98A 1WXHA 3QIPA 1I7LA 4KHNA 3DCJA 3F74A 3U7IA 2IGTA 3H42B 2FRVA 2I2WA 1G20B 1ZSVA 3CKKA 4RJLA 1EFVA 1XTPA 5EWLB 5DTJA 5G40A 2IV2X 1ZHHA 3DCIA 1N33B 5KSYA 3V2IA 4YJ3B 1NXPA 1DKNA 3KOUA 1NQOA 5F73A 3RC3A 1D7AA 1UMBA 1NBWA 3BH6A 2BFNA 2CH6A 4CE6A 1NTOA 5D7BA 5L4SA 3OJFA 2NU6B 1RACA 2CT8A 1W94A 4K6HA 3NHKA 4UZFA 4KI4A 4KO1S 1ITZA 4DVGA 1H8HA 1XU7A 3R3XA 1H3FA 2YWRA 2CFIA 3AWIA 3SVTA 3WXMA 1TRHA 4QD3A 3O1WA 1YULA 3OWOA 3S41A 3IAHA 5LR6A 4OUDB 1R6XA 1M2EA 2YMMA 1ZHOA 4EUNA 4JKEA 4IXDA 4FO0A 3AVIA 4EI9A 2Q7OE 3TMAA 1KJIA 3I8BA 1IXYA 1S5JA 1XZAA 2BFOA 1M5TA 3L0DA 1QQMA 4CDNA 1YS6A 4KFSA 4CEDA 4WN9B 5B3JA 4XH4A 3KPUA 3AVCA 1CVIA 2BFFB 1OASA 4PO3X 4AK9A 2IPXA 3AILA 4TKVA 4AKTA 1J9EA 5LB4A 3H6GA 3CVVA 3IHWA 4FJ0A 1GVNB 5CX4A 3IUEA 3WAJA 1IY8A 4JB2A 5IT9A 3C6QA 3TWHA 1U0LA 5DLPA 1GNVA 5I45A 9MHTA 2H4HA 1B8OA 3VOBA 1DO2A 1YJAA 2X0IA 4JWKA 2ADOA 2Q1XA 3I05A 3T9BA 1CLUA 3H5VA 2C7BA 1DJQA 1TVMA 3HY4A 4FX5A 4A26A 1QHSA 2O8EA 1E9RA 1LJ8A 2ZATA 3TQTA 1B8VA 4YP0A 5CYPA 3WZ2A 3GAMA 3U44B 5EIEA 1I30A 3T1HB 4RWZA 3OLCX 4N49A 1W34A 2R7MA 1FYEA 3JYQA 4ZEVA 3NRCA 1PJSA 1W36B 3FYCA 4BP9A 3VTZA 1ILEA 2QN9A 1ZISA 3CCQN 5HF5A 2ZANA 5HBMA 2VYVA 1YUNA 4FVMA 4FVUA 5JBNA 1KMMA 2OM6A 2P9UB 2RGNC 3W77A 2YXLA 1NMDA 4QU5A 3MWEA 3LUGA 4EBFA 4F96A 1J9AA 2JCYA 4B31A 1Z37A 2JGUA 3DTNA 1ICIA 5EIBD 2WIBA 4B9MA 2OFFA 1I1QB 4P2GA 1D0VA 3LO5A 3C6YA 3HL4A 3IP8A 1M8GA 4DLEA 2AG5A 4AROA 5BNTA 1Q7GA 1OUMA 2QQ5A 3H65A 4AD8A 3PYMA 4IGEA 1IJKA 2BR5A 1IAQA 1FFDA 3E0QA 1Y7PA 3KQNA 2X4IA 1XQVA 3DHWC 2P9LB 4RXMA 1PZFA 4QWWA 3I5AA 4JHDB 2G5TA 2Q5QA 3KD3A 4LBYA 5AW9A 4LY0A 4QFDA 2AL7A 2P2NA 5KOIA 1OXBB 1OKKD 4H59A 3R9XA 1P4GA 4QOZB 4NBSA 3S3TA 5C4MA 2AOWA 3DKPA 1T4GA 2AUNA 1TK3A 2RIRA 3AFIA 3A3OA 5KHOC 3REGA 2OXIA 4DB4A 3D6NB 1Y97A 5KYNA 2Y99A 4C8OA 2IJGX 5I9TA 5A3SA 3WL5A 3PENA 821PA 4YCLA 2XMDA 3GBPA 4V02A 4U7PB 5E8RA 3RVBA 4AXXA 4M7WA 1DU4A 5JHHB 1JAZA 3ZWPA 5CA0B 3R5FA 3I9NA 2AJCA 1B00A 4AQYK 1VJCA 5BMOA 2EFGA 2J9ZB 2JLRA 3SV3A 4OHWA 3HM9A 1K7CA 1NPYA 3VQ5A 3QVTA 1YA6A 2LUOA 4OQZA 4DCGA 3MGKA 1SKSA 1QIKA 2VC2B 3OD5A 2HIGA 3H4IA 1MMFB 2JAPA 4M45A 2PCJA 1G6Q1 4U2FA 2MIIA 1CZLA 1FDVA 2ZRBA 3M6WA 2WWVD 4GWKA 1JG6A 5AK3A 3GEBA 3MXIA 4RMJA 1P29A 5C5DA 5EJIA 2EBWA 4BU1A 2AD5A 1K5PA 4BP8A 1FNSA 2ZCVA 2XAUA 2JKZA 3BS4A 4JL8A 1FE8A 3U3RA 4EPVA 2QMOA 1Q0ZA 1R5JA 3UJ8A 4CJ5A 2Q3SA 2DFVA 4G1CA 1W96A 1U8FO 3UJ6A 4JUFA 1MH1A 3A26A 2XUJA 1DCKA 1I0IA 1OWPA 1XQ1A 1PVVA 5H3HA 3VXKA 4DSUA 1AUOA 1BH2A 3B1JA 1U81A 4UEKA 3G0GA 1MX5A 1CY7A 4ETMA 1AQYA 4NU8X 2BGMA 5J1SB 3LPUA 4BMVA 4AY3A 3B9PA 1KQFA 1R2QA 1WEKA 3QNUA 5IJ9B 3CPWM 3RVNA 2QWOA 1PJAA 3WTCA 4ND1A 4KTWA 4BP3A 4NULA 4JI8B 3QXXA 5HQ3A 4IOJA 5FDLA 3M4JA 1R66A 3FY4A 3LL3A 1SQSA 4NCXA 1WMDA 3ZOZA 4Y2PA 1A69A 3E03A 3CRW1 1V6AA 1Y5MA 5BV7A 2G1JA 1YS2X 2QEXN 4PQUA 1RLMA 1SCNE 2Z3ZA 5KYWB 3G9XA 2WIAA 3UMGA 1KAMA 2HNAA 2WZBA 1I94B 1OTHA 4B3DA 2BM9A 3BZWA 2XCOA 2GD0A 3PX6A 1I2BA 5DCLA 3MRSA 1CY1A 5ED4A 3WIDA 2BGRA 1QFYA 3ZS9A 2CD9A 4C0AC 1USKA 2XQGA 2G1UA 5HKKA 3WV4A 4B1YB 5E84A 3JAKB 1N2SA 1TDJA 4AURA 4UEJA 4Z0TA 3HZHA 4KYIB 1GYPA 1ULTA 3KUDA 1U6ZA 1X7YA 3ROGA 3TM5A 3OFNA 1XRLA 1UQUA 3TL2A 1ZA2A 1VLMA 3ZSVA 1YHZA 4KN5A 3NGXA 4S05A 4IV5A 4I9HA 2H1SA 2GHTA 2R48A 1R9JA 1WKVA 3K9CA 2CW5A 1WXDA 2YOHA 5COQA 1E0DA 4Z1OA 3DPUA 2QZ9A 4K43A 3TNLA 3NHPA 3O1HB 2YJ4A 2X5OA 2GJKA 4FS8A 2A59A 1IZZA 5EJ4A 3ANNA 2CNLA 5ALXA 4C8LA 4OQPA 4PE5B 1E3WB 3DDSA 4B3RK 2ZJRL 3K1ZA 3HCAA 3NTQA 4C0BA 1M8FA 1HDIA 4GXQA 3HI6A 4B3TK 1LI4A 4OQDA 3AP3A 1JR3A 5ILOA 1WY5A 1VL2A 2WAAA 3GIDA 3SYKA 3ZY4A 2LPMA 4QAJA 2XH8A 1A4UA 3JASA 1GCIA 3EPHA 4CJ3A 1MCZA 4BNKA 3EEYA 9LDBA 2D2EA 3K53A 2XKJE 4C0HA 3I2HA 2NU7A 1WOYA 5CZ1A 1NK5A 4U5QA 4MSUA 1GLJO 5KQGA 2XCQA 1WL8A 1ULHA 5A9RA 4NJEA 3IJPA 3MT8A 1U7OA 5J4YA 4RH3A 5BVHB 3HFRA 5FHQA 3IQWA 4JYZA 3VC1A 2G70A 4AY6A 2AX3A 2PCLA 3I62A 4UUPA 4YRLA 1ISGA 1OX5A 3IXQA 3JZIA 1Y37A 1QGZA 3W4JA 3LKBA 3PL5A 3T9FA 2W6ID 3F6BX 2P9YA 1SBNE 4U7GA 3DRSA 1V1MB 3G1TA 1YC5A 3K15A 2O14A 1E62A 2OA8A 1RMTA 4FK8A 4Q1BA 3F5TA 2WG0A 4GM4A 2VK8A 4L9AA 4BJHB 4HDAA 4D9NA 3GRAA 3OCVA 1NN0A 2BM0A 1KJ9A 3FUWA 3G2JA 3KOZA 3LM2A 5DHAA 2VHYA 1EX1A 3TTVA 3G85A 4AJ9A 2OXFA 5DIFA 2VSFA 2R5NA 1ZGGA 1E79A 3DDOA 1X7WA 2QT0A 1EBBA 3P45A 3REQB 1FDSA 1TOAA 2AKYA 4PL7A 5KCZA 3S2GA 5CLLA 4NYJQ 3DWLA 3F49S 3S1LA 2O23A 1GA1A 4E4YA 4EKEA 3IEUA 3AEQB 2YV4A 4IXMA 2XTZA 1JWAB 4DU1A 3H45C 1BD4A 5A4AA 5MGBA 1NLUA 3SAGA 2V7QD 4YOVA 4D1YA 4KU4A 3IOMA 3AKYA 3N0XA 1JSLA 4GVEA 2GI4A 5H70A 1NMYA 4Q93A 2Q3LA 2XY5A 3VAYA 1GKUB 5B7GA 5K0GA 2E1PA 4N7RA 2BJHA 3MAGA 3PO5A 1IU9A 4M0PA 1KZHA 5IVPA 5TKYA 1WHTA 2C4VA 1S8NA 3AVNA 5IN4A 4TRRA 3U4IA 4AP6A 2MTBA 4JI7B 3HZRA 3I2IA 3I1YA 1NQXA 1W75A 3LC2O 5CK4A 3U80A 2FWMX 3WYGA 3MS7A 4IG4A 3NG1A 4GPAA 2XNDA 3WWEA 5FUXA 4YJDA 4BLTA 4I3GA 5DPMA 1JQLB 3FHTA 1RM0A 4P83A 1DO8A 3OUTA 2JHGA 1GZHB 2RG7A 3RS8A 4RADA 4N5NA 4TWAA 1IKYA 3EVCA 1KARA 1WD5A 2Q2WA 5KKNB 4ENVA 2F9WA 4FGKA