2BGGA

The structure of a piwi protein from archaeoglobus fulgidus complexed with a 16nt sirna duplex.
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
417
structure length
395
Chain Sequence
LTYRIGNGASVPISNTGELIKGLRNYGPYEVPSLKYNQIALIHNNQFSSLINQLKSQISSKIDEVWHIHNINISEFIYDSPHFDSIKSQVDNAIDTGVDGIMLVLPEYNTPLYYKLKSYLINSIPSQFMRYDILSNRNLTFYVDNLLVQFVSKLGGKPWILNVDPEKGSDIIIGTGATRIDNVNLFCFAMVFKKDGTMLWNEISPIVTSSEYLTYLKSTIKKVVYGFKKSNPDWDVEKLTLHVSGKRPKMKDGETKILKETVEELKKQEMVSRDVKYAILHLNETHPFWVMEGTKVKLSSKRYLLTLLQPYVTPIKPLSVEIVSDNWTSEEYYHNVHEILDEIYYLSKMNWRGFRSRNLPVTVNYPKLVAGIIANVNRYGGYPINRSLQTNPWFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Mrna Recognition from a Piwi Domain-Sirna Guide Complex
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Rna-binding protein/rna
molecule keywords PROTEIN AF1318
total genus 134
structure length 395
sequence length 417
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02171 Piwi Piwi domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2bggA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2bggA01
4N03A 2I6FA 3IPAA 4HVJA 3IP5A 5E3JA 3DLEA 3K4HA 1XHXA 2N9UA 3GL9A 3QO9A 2HHUA 3SNKA 4EP5A 1KGSA 4B8CA 1EP4A 1D5AA 2OA8A 4KFBA 4DLEA 4WT7A 3KJXA 4GPAA 3U3YA 1RT4A 4MYRA 1QNLA 3AA2A 1DC7A 2LUOA 4EVQA 5CNKA 1ZDMA 1BVHA 1NJWA 4KNYA 3QETA 3TMYA 2ID7A 1VSIA 3V9WA 1MB3A 3HEBA 1Y1LA 3RMCA 1JH9A 4QOZB 2R25B 5BRAA 5DTEA 1CZBA 4RW4A 1QSSA 7ABPA 1S1XA 4PQUA 4BE1A 2G8FA 2LP4Y 4PWDA 3CG0A 1L5YA 4E89A 1ZH2A 1RXIA 4LH5A 4AHRA 1GCAA 2OENG 3DBIA 1KSPA 3BILA 4C8LA 3NCIA 2MYNA 2JVIA 3OYGA 5FBHA 3MM4A 1U0SY 5CNIA 2GX6A 5JNSA 3PUFA 1FQWA 2KQ2A 4FJLA 4M88A 2DRIA 2HB5A 4YCSA 1EWVA 4UQGA 4ICLA 1YS6A 3QEKA 1EWKA 4CF2A 4CEAA 1VPWA 3T19A 1VSLA 4N56A 1UOCA 4O0JA 3G0ZA 3ZSYA 2R7YA 3UIQA 1X9WA 4WZZA 2XDYA 5JS2A 3OS1A 4CECA 1DTTA 2IKSA 4ZMRA 1RBVA 1UWBA 4CHNA 3CFOA 1SKSA 4RK7A 3V1OA 4CJTA 3LTEA 4JS5A 4JLHA 3OLZA 2PAFA 4OATA 4RDCA 1BIZA 4RW7A 3LPTA 4ETMA 3VNAA 4Q7EA 4ZMSA 2QU7A 3ZSWA 3V4IA 1OXKB 1IKWA 1QHTA 3C6TA 3PV8A 3GBVA 3OLXA 4M3TA 4OKJA 3EULA 4CJLA 1IKYA 3NGIA 4RV5A 4TN5A 4W5TA 2GBZA 2HMIA 1R8JA 2OZSA 2XY7A 3B6OA 4CIGA 4M3WA 3NNDA 2QR3A 5JNUA 2QZJA 4RW6A 1YIOA 3LUKA 1VSFA 5JNVA 4OG2A 4D74A 4HUEA 3EQ2A 2IOCA 2FVYA 3DGFC 3L49A 4DSEA 1BI4B 3O3FA 3DRRA 1KLMA 2AYZA 4FLZA 3IPCA 3JY6A 3ZT3A 3H5LA 1JBEA 2WJWA 2B4JA 1A2OA 1ZAYA 5DMRA 1YS7A 2FEPA 5KI6A 4ETNA 1Z26A 3KKSA 1T8EA 1L3UA 3M6MD 2PKXA 2FBXA 1DCKA 2L2QA 1Z25A 3ULDA 1ASUA 4OLAA 3CLKA 3L2WA 3OS0A 3C3KA 1WSGA 3F7NA 2FBYA 3N8IA 1U2QA 4FCYA 4N0QA 3VQ5A 1BISA 1TK8A 3LFTA 3HL8A 4HUFA 2Y1IA 2FSPA 3RQIA 2JVJA 1M2EA 4YV7A 3F6PA 1RT3A 3NH2A 1VSDA 4CGDA 1BL3A 4MLCA 3A0RB 3AVCA 1NXTA 4KO0A 1VKRA 4PE5B 5SZTA 3CM5A 4FJMA 5IEJA 3MXJA 3L2VA 2P5GA 3LAKA 4RKRA 3C6UA 3HO1A 4PICA 4CJ5A 6CHYA 2DFEA 3BREA 2FTKE 4JASB 1S5JA 2FC0A 4DADA 4CF9A 1WNSA 4ZPJA 1JXEA 4RS3A 3GYBA 4EVSA 1CYEA 3SUOA 5EWLB 2E4WA 1LV5A 1GOCA 1SXIA 5CYMA 1WLJA 1S1VA 3BRSA 2FMIA 3CRNA 2HHQA 2MSWA 4CF8A 2M98A 3V1RA 1YMVA 1LW0A 3AVGA 3OO0A 1FSPA 4XASA 4E7PA 1JL2A 4DLGA 3VQ4A 1E2BA 3VQQA 4MR7A 1L3VA 1WSJA 4B9LA 3KD1E 4IILA 1RZRA 4KI4A 3RH0A 1JLKA 4CHYA 2MSKA 3OLVA 5HRSA 2FN8A 1NXSA 5KC8A 3KTQA 4IG0A 4CJVA 5DGCA 5KGXA 3KKEA 4CJKA 3ISNC 1OXBB 2CD7A 4DF8A 4CEBA 3O2QB 3HPGA 3SG0A 2NZVG 1ZH4A 2IYNA 2JGUA 3DLRA 1N5YA 1PEAA 3RVOA 2XO7A 2GV9A 2PUDA 4DQPA 4MLDA 2L17A 4G97A 1MIHA 4CFBA 1AB5A 1TV6A 4O4GA 3IP7A 3S3OA 3N0RA 4J2BA 4E7HA 3P5JA 1EHCA 4MS3B 3LUGA 4PZ0A 1QQBA 3RVPA 2YNFA 4FE4A 1K6YA 3AA4A 3S9HA 2F8TA 4YS6A 4O44A 3EJWA 4KQ9A 2RPIA 4CIEA 2QVCA 4LE2A 4DFMA 4DQIA 5KC9A 3HV2A 3SV4A 3C3WA 3QK7A 2OQRA 3OJUA 5TPWB 2E4XA 4LDZA 3AVJA 4OJRA 1HYZA 2BANA 1O1WA 4FJGA 1ZHHA 4MGEA 1LAVA 1D4ZA 3O4QA 1FXXA 3NGYA 2HHWA 4RK6A 3HVRA 2HW3A 1J56A 4QAGA 4RWEA 4B9SA 3KCNA 5TPZA 1ZITA 4FVMA 1NKCA 3Q7SA 4KMRA 5KQLA 3M9WA 2QSJA 2ZAYA 1E6MA 3QEPA 5BRJA 1RT2A 1CEYA 2YHAA 3OQNA 3VQ7A 3CFRA 3V81A 3MXIA 4E19A 4KV7A 4MR9B 1QQAA 1JL1A 1B9FA 4QYMA 3HUUA 2KZMA 4GVMA 2HSGA 1YVUA 3AVKA 3SQ4A 2BDPA 1A5WA 3C95A 3KD5E 3MEGA 1ABFA 1F51E 1HMVA 3CM6A 1QKKA 3DOLA 4CEOA 4KK4A 4PEVA 3AA3A 3LOPA 5HRRA 3LP2A 2A9QA 1E6KA 4CK2A 4CJWA 1QMPA 2D0BA 3E3MA 1U8TA 4PY5A 4L8RB 2OPPA 5KQPA 4DSKA 2CWDA 1EAYA 2O4IA 4CJEA 1CXUA 1LWFA 1SKRA 4O1IA 3LZJA 4CJPA 3OJSA 3G1WA 4JRQA 4FLWA 4CJQA 1DG9A 2LIVA 2HNDA 3KS9A 4M3ZA 4XAQA 3MEEA 1HNIA 1TLFA 4MR8A 2L18A 1TKZA 1KVCA 4KFCA 3HSYA 1A0OA 1YMUA 3N53A 1ASVA 1JDPA 3VQ6A 4Z0NA 2ZE2A 3C94A 1TVMA 2FKAA 4G0MA 1JLBA 2D5RA 1ZBHA 4KQCA 1EETA 4QYWA 3S3NA 1HRHA 1ISRA 3CYMA 4W5OA 2ATQA 3JYTA 4FM1A 4I9LA 1DBQA 5E41A 1ZBIA 1YK1A 5CY4A 1WSHA 4I2QA 1Q8IA 1RCHA 3SQ0A 3IP6A 1ZVVA 2PUAA 4J2AA 1R0AA 3K5LA 4E0DA 4Z4EA 1BCMA 4D6XA 3FFWA 3ILHA 1Z13A 5DLEA 3KLEA 5FRMA 3CG4A 1SRRA 1NK4A 3I42A 4OVLA 3I8DA 4RY9A 3P83D 2IC3A 1JLAA 1C4WA 4MQFA 4LSLA 4JP1A 1ASWA 3SJJA 2XRIA 3LUAA 4GW6A 1U04A 5IULC 1BIUA 4CGFA 5KTQA 5HLFA 1RT1A 4EYQA 1WN7A 3KJVA 1JLCA 4DQRA 3ALYA 4J2EA 1FK9A 3GT7A 3CG7A 2X78A 3H75A 3MYYA 3A0UA 2HPHA 3M8RA 3NF9A 3D8UA 9ABPA 3AVHA 2NUBA 4RK0A 3I09A 3TABA 3AO5A 1QTMA 4RKQA 3K59A 1ISSA 4BE2A 2FW0A 3DGEC 4O5AA 3L2QA 3OYLA 5D2CA 2ITGA 2I5JA 2WB4A 1DBWA 2XY8A 5HSGA 3ZT2A 5KQGA 1VRUA 2PY5A 4CEZA 1YTUA 3EY1A 4IGAA 3MECA 3NH0A 4ZTFA 1M5TA 4KRFA 1D5WA 5CZ1A 3VQAA 2H0AA 5DKFA 3V9SA 1VSEA 4NCGA 4KKOA 2IS3A 1JDNA 3VQEA 4OBBA 2LSNA 1EWTA 5TQ0A 3O21A 4DSFA 2B4AA 2G8VA 1CLQA 2A1RA 1XI1A 4LDAA 2IAJA 3QEXA 4AHUA 4LZLA 4UHJA 5PNTA 4KTZA 4G0ZA 4DTMA 3RVJA 1JWLA 4DTNA 2ETJA 4ID1A 1NXWA 4DS5A 3EAFA 3AO1A 1LBHA 1J9AA 3TI0A 2A9PA 5CYQA 2LBPA 4AHSA 1USKA 1Z12A 3QESA 1HNVA 2G8HA 1BA2A 3QELA 3LZIA 4DTPA 4ID5A 4NCAA 3GV0A 3KLGA 3JPYA 1QPZA 2PUEA 2IPLA 1JLEA 5KWSA 2EX3A 1Z15A 4EP4A 2E4VA 2R48A 1FKPA 1J5OA 1NOYA 2VG6A 5I3UA 4EYOA 1G15A 2E6LA 4EZ6A 5D3GA 1D1QA 5J2MA 2HQRA 3QELB 1DCMA 3H5WA 1WAJA 4PA1A 5DCLA 3M8SA 3TWHA 2WJAA 4HUGA 3JVDA 4BDYA 3SUNA 4MRMB 2PMCA 3ZT0A 3DLHA 3AVNA 4CEDA 2E6MA 2D0CA 4EYKA 1RT5A 2VUIB 2R47A 4FJ8A 2PZSA 2WONA 2MSLA 4B9VA 2QK9A 2E4LA 1SL2A 4JAVC 4DG1A 2RDMA 2FMHA 2FBTA 1FKOA 3KLOA 4DFJA 1NK8A 3O1IC 2HHVA 3OYAA 3TAMA 3H6GA 3VA0A 2JBAA 3VQDA 3PX4A 5HP1A 4IKFA 4O1HA 2VK2A 3L6UA 2BGGA 1U45A 4TLMB 4OPJA 2L19A 1BI4A 2IGIA 4IBNA 1IH7A 1Z2DA 3ITHA 2A9RA 2Z1HA 3K5NA 4IFVA 1CZ9A 2RGYA 1NTRA 1C0MA 3HYFA 3NF8A 2H3HA 3LAMA 4CGIA 3CTPA 4YP9A 1MVOA 3C3MA 4Y9TA 5IC5A 4HCBA 2JRLA 4E7LA 4FW1A 5CZ2A 4CEQA 3CFPA 3PY8A 1Z2EA 1TGOA 4NV3A 2VG7A 1VSHA 2PLNA 1IKVA 1EXQA 4YWHA 4MQEA 1NK0A 5IUNC 3AO4A 1TKDA 1ZYQA 1I3AA 2MYPA 4E3SA 3PX6A 3H5VA 4GMJB 1C0UA 3ZT4A 2DFHA 3ZSXA 1L3TA 4ELUA 2YNHA 1JL3A 4OGCA 4FM2A 3MF4A 4DFKA 4AHCA 1KRXA 8ABPA 4MQEB 3NE6A 2BE2A 3MIZA 5B3JC 3OO1A 2QW1A 1DRJA 4BDPA 1ZY2A 4I2PA 5EU7A 5EWMA 4FE7A 4Q6WA 3V9UA 2GBPA 3O1JC 4YR7A 4KHQA 4NQRA 3KYIB 5IUJC 5GOTA 3FFXA 3ASMA 4MPTA 1T7PA 3SCXA 1NXVA 2FMFA 3KK3A 5TQ0B 2IOYA 4KZKA 1A5VA 1ABEA 1LWCA 3SI6A 4Z0UA 3QNNA 4YO7A 3UK0A 4NCBA 4EYGA 4FZXC 4W5NA 2IPMA 1QS4A 5T3YA 3HM9A 2GWRA 3B2NA 1NK5A 4M3YA 4J2DA 2IPAB 4CK3A 4TMYA 3JTEA 1HQEA 3Q41A 3QLHA 4WWHA 2FBVA 1JLFA 1NATA 1SUQA 1FFGA 2G8UA 1ZN2A 3N6VA 4NYFA 1P2FA 2JBAB 4RW8A 3QLUC 4KHUA 4DWIA 2IDOA 4S04A 1VRTA 1QO0A 3OLYA 4RW9A 5ABPA 2WRZA 1BAPA 4Y1DA 4FJ7A 4CHQA 4FK2A 4IF4A 1NJZA 4MR9A 6ABPA 2IPNA 1TMYA 3OM0A 3RMBA 4MQFB 5I4CA 1HYSA 4YFUA 1TVRA 3LUDA 3CZCA 4EGSA 1E6LA 3AVLA 1VLZA 5KGWA 2Z1GA 3BBLA 4RK4A 4DTJA 1VSMA 1Q9YA 3VNBA 4LX8A 4FJNA 4AILC 3LUCA 2FN9A 1GLGA 4KTQA 2RKIA 2FQXA 1SV5A 1NK7A 3RVRA 1QP4A 1S6QA 1KLNA 1WSEA 5TQ2B 3W9SA 5KRSA 1X9SA 2GUIA 4H3KB 4F12A 2NZUG 1Z18A 1EFAA 1QP0A 5HBMA 3Q9SA 4IRXA 1GOBA 4RG8A 3VN5A 3JVIA 1X9MA 3SNNA 3SAJA 2WMYA 3TAGA 4DSLA 3RR7A 3N0XA 3AVBA 2X6SA 3QLTA 2PE5A 4H4MA 3OY9A 3KK2A 1UAXA 5HM6A 4FLXA 3KLFA 4DTUA 3SUPA 5EWJA 4CF0A 5HQJA 3LALA 3K5MA 1JYEA 3H1FA 3OMWA 1Q9XA 4B9TA 3RVSA 4CFAA 1QE1A 1JXBA 3HK2A 1RT6A 4CFCA 1C1CA 5B3JA 4LRQA 1L5UA 3ILYA 4E7JA 4KAZA 1L5ZA 3LMKA 4JB0A 1RPJA 5FWXA 3HPHA 1H9CA 3KLHA 4M41A 2KFNA 5GQSA 4KB0A 1ZBUA 3MMNA 1B00A 1U48A 2RN2A 3EYZA 3G10A 3KK1A 3KLIA 3HDGA 3SYZA 2FXIA 2RJOA 1ZBFA 3HVTA 4IDKA 4FK0A 2M1ZA 2QXYA 1X1PA 3LUJA 4XIUA 4OKKA 4KB1A 4C8OA 4CHPA 3T3FA 4G0XA 3IAYA 1WSFA 1RNHA 1IG9A 2O20A 3RRHA 3IG1A 4G0YA 4DMNA 1KCFA 1K66A 3KIOA 1Z17A 4KV8A 3LP1A 4FJXA 4DTSA 3ZSOA 3GWGA 3HJFA 1NY5A 3FMVA 2HVHA 2J48A 4FLTA 4H4OA 4BACA 2FMKA 4C8NA 1KRPA 4G0OA 1KMIY 1U2PA 4Q0BA 3S3MA 1JLGA 4JRPA 1SL1A 3QEMB 4KHYA 2QXFA 3VA3A 3UUGA 3E01A 3FGZA 4CJUA 1BQNA 1XHFA 3OM1A 4Z4FA 3FFTA 4YNQA 3HP9A 4HNSA 3UKJA 2QKKA 5HRPA 3VQBA 2YNGA 4MS1A 4CF1A 3OYNA 4DSIA 3LKBA 3PX0A 2AYXA 1A5XA 2HHSA 4G0PA 4FK4A 3HSTB 3JS5A 3TANA 2E4YA 2PL9A 3WNFA 5IBQA 1YK0A 2KW4A 3TD9A 4K8XA 3BDPA 4PYRA 5JNTA 3NHZA 2F8SA 1SXGA 4B08A 2G8WA 1SL0A 1LW2A 1RBSA 4F3TA 1REVA 2PUBA 3QX9A 1T34A 3LKVA 2YV0X 2E4ZA 4YRZA 2DTUA 4CFDA 4AH9A 5CHYA 2G8IA 2GKGA 3ZSQA 1DCFA 4WE1A 3V9ZA 1JLQA 4CHZA 2FEKA 3QLUA 3NBPA 1S9EA 4Z4IA 3CZ5A 3R0JA 1LBIA 1XC9A 3N0WA 3D0PA 4DQDA 4KHSA 3HP6A 4JS4A 3OYDA 1QSLA 1UDRA 3MQ4A 4Z4GA 4EZ9A 3MEDA 4M3UA 1JYFA 2HHTA 4LY7A 4UHKA 3OYFA 2JCGA 1PNRA 1XWWA 1KFDA 4R5PA 3I0RA 3MAQA 1QO0D 4MRMA 3PO5A 1TAUA 2Z1JA 1NKEA 4IMIB 1TJYA 5J2QA 3SPYA 4RSMA 4MR8B 3F73A 4DFPA 2E4UA 5T7BA 4FLUA 2PUCA 5FROA 1RZRD 3RVNA 4KHWA 1TAQA 2VWJA 1RDCA 4B8AB 4RY8A 2W42A 1P6QA 4E1MA 1USIA 3QLVC 3RMDA 1S6PA 4E7KA 2XHBA 1LK0A 4Z9BA 3SY8A 1C6VA 4JB2A 3O3HA 5EWJB 3AVFA 4CK1A 1JHZA 2QVGA 4LE0A 2OYQA 1W25A 3E61A 1S1WA 5FDLA 3H1EA 3CU5A 2WWVD 1VSJA 3LP3A 3L8BA 4QCLA 1GUBA 5ED4A 1K68A 4MS4A 3LPUA 2FEWB 1C1AA 2KTQA 1A04A 4KVFA 4MR7B 2HQOA 3OVNA 4B9UA 4L4UA 1PHRA 1U49A 3U6FA 2YKNA 4HYEA 5I42A 3L3UA 1W9HA 1ITGA 4DF4A 1SKWA 2YNIA 3VQCA 2WY2D 1BHLA 1M2FA 3T6KA 3AVAA 3NHGA 4FYDA 3OYEA 2DFFA 1PUXA 4FB4A 3Q7TA 4OGEA 3RVMA 3V6DA 2HJ9A 3NHMA 4G1QA 3SQ1A 4DTXA 2A9OA 4XXHA 2WOMA 1USGA 3QEWA 4LSNA 5C5CA 4EY3A 3O4NA 1NOZA 3LANA 4F8JA 3FDFA 1RDBA 3K57A 2DY4A 2O4GA 4XLTA 4KHNA 3I45A 3PO4A 4WXEA 3SZ2A 1F21A 5J2NA 4MS4B 1TL3A 1IKXA 2PYJA 4F06A 1DP4A 5JNWA 3DLKA 2NT3A 1DRKA 4DU1A 3A2FA 1KVBA 3QIOA 3RWUA 4ZJPA 2IDMA 4FZZA 3AV9A 4BE0A 4CESA 4YLEA 1MU2A 1RBTA 4FJIA 1HEYA 3DOKA 2VWKA 1T03A 3QEMA 3KHTA 2CHEA 2HNYA 4FXDA 3QNOA 3RVQA 3SV3A 4MQ3A 1RBUA 3OYKA 4Z4CA 4DTRA 1PNTA 4RU1A 4MS3A 2ZQBA 4TSXA 3NNSA 1M5UA 4H60A 4XARA 3DLGA 3OYJA 2X6NA 1U47A 1RT7A 4YGXB 1C1BA 1F4VA 5SWMA 3EQZA 3M8PA 1DC8A 1L3SA 3EDCA 4NYNA 4FZYA 1JFSA 4CGHA 2JLEA 1BGXT 4FJHA 4B3OA 1RILA 2MYTA 4CGJA 1JX6A 4G0QA 3KKRA 1FFSA 4HNQA 4DU3A 3EZ5A 4E1NA 3ROFA 1Y97A 3OLWA 4LE1A 4PUOA 1BCOA 4KTWA 4M42A 1NXOA 3DM2A 4LH4A 1MB0A 1AB6A 1ZGGA 2VUHB 1TK0A 3NGZA 1LJUA 3MA0A 1BQMA 1RNLA 3GBPA 1NKBA 1HPZA 4F8RA 1RXEA 3H5IA 1WETA 2B5JA 3NNNA 2D0AA 4WXMA 1IO2A 4WUTA 3AA5X 3LWLA 3HT3A 3WNEA 4CJ3A 1B9DA 3C6QA 1VRVA 2EHGA 2XY5A 1RDAA 3T1AA 4FJ9A 3NF6A 5FBKA 4BWJA 4NICA 2P5OA 4LD0A 4F3OA 3OMXA 2Q5CA 1S8NA 2TMYA 4OKEA 3EGCA 5EWMB 3SQNA 1TKTA 2PUFA 1ZGZA 3T8YA 3I5AA 4B9NA 1DBPA 3TARA 5C42A 3NF7A 4JA2A 3NAEA 1XHEA 1PEYA 4H8KA 2A1SA 2ID9A 4TLLB 3NFAA 1QSYA 4CEFA 1U4BA 3O2JA 4RZSA 3TB6A 4CJSA 4Z9AA 4RXMA 2NT4A 4FLYA 2OPQA 3TAFA 1XHZA 4C8KA 2QV0A 4DQSA 4E7OA 2PYLA 3LUFA 3O74A 3SM9A 1DLOA 3K9CA 1C0EA 3CKMA 4DTOA 2JK1A 3DI6A 2F96A 1NJXA 1SD5A 3RVLA 2R4QA 3K2PA 1BDHA 1APBA 4HHTA 5C25A 1KVAA 4ZYLA 3TR8A 1NXXA 4BDZA 4FW2A 2HQBA 2X74A 3CFYA 4OTZA 4N76A 2OPRA 5CNMA 1RBRA 2B6AA 1I3CA 4OPKA 2CHFA 1NK9A 4BWMA 4AHTA 3IRXA 1EKEA 3I0SA 1NK6A 3WNHA 5EWLA 3IDOA 5K14A 1WAFA 2OZMA 3AO2A 4QPJC 3LP0A 2Q3SA 4N0PA 3K5OA 2AJQA 4HCCA 5BQ3A 2Y1JA 4N5SA 5FRNA 3B6PA 4DSJA 3KYJB 2FQWA 1NXPA 3P1GA 1TKXA 4KPYA 3L2UA 4RXTA 5TQ2A 4KREA 4G86A 2P9HA 2VG5A 1KTQA 3TAEA 5JS1A 2FLWA 4RK5A 4FJ5A 4DN6A 1B92A 2V0NA 1KRWA 2FQYA 4CJ4A 3JPWA 1RDDA 4HTUA 3FFIA 4JOQA 3T38A 3CHYA 3THVA 3QEIA 3H08A 4O55A 3U3GA 3LWMA 3CQ8A 3OQMA 3QERA 3OYBA 5J2PA 1URPA 1QP7A 1SXHA 5HKOA 3HPOA 4CJFA 3RVKA 4Z99A 1ZESA 1P6UA 1UA0A 2KFZA 3HUTA 4N47A 3H5TA 3AVIA 3QX8A 5HROA 5TE9A 1S9GA 1TM2A 3H6HA 3EODA 1D1PA 2PL1A 2HHXA 2HNZA 4L85A 3V9XA 3SPZA 5FWYB 4ZTJA 4IMJB 4EVRA 1VK0A 4E7IA 3QLVA 4KK3A 3O3GA 1TK5A 4Z4HA 4M3XA 1I39A 4CGGA 3D45A 1RTIA 2P51A 3WNGA 4P1ZA 1VSKA 4W5RA 2FLKA 3IS9A 2Z1IA 4Q5VA 3M8QA 2VYCA 4I9QA 4DS4A 3HZHA 4RK1A 3LUHA 3DYAA 1IIBA 4B9MA 2GI4A 4M3RA 4D6YA 3VQ8A 3O75A 3CS3A 2XY6A 1S1TA 1S1UA 3BRQA 2MYUA 1HJRA 4FLVA 3IP9A 3Q15C 4MS1B 4CE9A 1J53A 1YT3A 3OYCA 2RJNA 4AHVA 1EX4A 4XFKA 3TAQA 4N41A 4IFYA 4FM0A 3DZDA 3LDSA 5J1EA 4O0IA 5BR1A 1XWLA 3ROTA 4F11A 3ZCMA 5C24A 4MAAA 1JFTA 1ZBLA 3DLBA 2KZZA 4H3HB 1RTHA 4Q6BA 3O1HB 2LPMA 3TO5A 3K58A 1NJYA 1MAVA 1RTJA 2YKMA 1LJLA 1DTQA 4ETIA 4CHOA 3HDVA 4S05A 4DQQA 4F2RA 4P98A 3TAPA 4B09A 1Z16A 4F4KA 2JVKA 3N75A 2P4UA 3RRGA 1D9DA 1N6QA 4F2SA 2ZD1A 3GRCA 3A10A 3KG2A 5FWXB 4M45A 3OYMA 1BDIA 1RTDA 4ML3A 5F64A 3F9KA 2HVIA 1UA1A 3DRSA 4ELTA 1CHNA 1HYVA 1TL1A 4IG3A 3OYIA 3G85A 3VQ9A 3C97A 3KTOA 3URMA 4C8MA 5CNJA 2QKBA 3AVMA 1JFVA 2G8KA 3KSMA 3L3VA 1D2AA 3DRPA 1FFWA 1C0TA 1HQUA 4O5BA 1JF8A 4QICA 3L2RA 1D8YA 5KQMA 1WSIA 3NH1A 1YTAA 3OYHA 3ZSVA 4CIFA 3SQ2A 2P1JA 3CNBA 3S99A 5C5EA 5IX8A 1BDJA 1D9FA 3QEVA 1KFSA 4CERA 4RY0A 4CBVA 3HS3A 3F6CA 3OQOA 3TX6A 3ZSRA 3AO3A 4KI6A 4CJRA 3A3KA 4FJKA 4MFBA 5IUKC 5TPZD 5TPWA 1LWEA 5FWYA 3JSMA 3NBMA 3QINA 3P9YA 3H1GA 4W5QA 3V1QA 2B1JA 1T05A 3O2SB 4EUKA 4K8ZA 5JNRA 1DZ3A 4GNRA 4CEEA 3ZT1A 4OLBA 2OPSA 3NDKA 3BGRA 4DU4A 1GCGA 1P8AA 1GUDA 5TQJA 3RMAA 1QQCA 3D02A 2RF2A 4Y1CA 5DK5A 5KRTA 1LAWA 3KLNA 2ZWMA 1DJMA 3OS2A 4ZHRA 3SUQA 3VQPA 3RTVA 1GOAA 1W0HA 3QIPA 4HNRA 2PJUA 2JB9A 4I7FA 1JKHA 4ELVA 1CXQA 4RXUA 3T95A 5HRNA 5IEBA 1J54A 2X7XA 3HXMA 3HCWA 3GA5A 4CCHA 2KYRA 3H5OA 3M9XA 4FJJA 3MXMA 3Q7RA 3ZSZA 2YHBA 2PUGA 3RR8A 3DMJA
chains in the Genus database with same CATH superfamily
2RHLA 1W4AA 2FWBA 3IPAA 4EF4A 4HVJA 1DXOA 1DQSA 4QS8A 3KAQA 3ZU6A 2ZRHA 4BU0A 1RQNA 3PR2B 4QQFA 3DLEA 3THYB 2B20A 2OV4A 2IEDA 2I87A 2N9UA 4H0YB 2FSHA 4D0GA 3GL9A 3IUEA 5CM9C 3G2OA 1KSGA 4F2PA 5EY5B 2HHUA 2OHOA 2W43A 3JYPA 1VQ7N 4EP5A 3LHIA 2NTVA 1E3MA 1KGSA 4BR2A 4B8CA 2JHAA 2VXYA 5COQA 5GM1A 5I7WA 4ZCTA 2XDQB 3C6HA 3CXCM 1NNUA 2H2FA 5JJBA 4QASA 1UR5A 2CLIB 2ZWHA 5ELZA 1R0WA 3E0XA 2EXXA 5AXBA 3FMIA 4BKOA 2XZLA 1E0JA 1TCVA 4R2WA 5AM0A 1XMJA 2AN5A 3D8RA 3O9TA 2H2DA 5GVRA 2ZPAA 3IQFA 4B6SA 3AA2A 2IVOA 2LUOA 2AJBA 3N6RA 3W2HA 3SXPA 2CLOB 1WZCA 2FGJA 4EVQA 5EJEA 4Z8XA 5E7JA 1ZX1A 2RBEA 3V7WA 2NTJA 2V54A 5CIQA 5K4GA 2XT6A 1ZH0A 1E60A 1TK2A 1FS5A 3PLAA 1EFCA 2M32A 4KDFA 3D7LA 5BMVA 2W93A 1VSIA 4OOFA 5A7HA 2HAEA 4ZRMA 2F64A 4LJ4A 3DAGA 3IURA 1ZRMA 4DTCA 4ZGGA 5AQZA 3GT3A 3MBIA 5CT8A 4B4DA 1FJ2A 2PU5A 3ICEA 1DQZA 3HEBA 2FGKA 1CX9B 1PG0A 1QHEA 2ZJ2A 2G9UA 3UV7A 1JJ7A 1RQPA 3TEMA 1P77A 3VTKA 9LDTA 3CVXA 4ZI7A 3PXAA 1JH9A 5TVGA 1FU7A 1RWVA 1VQ4N 1KAQA 2D06A 1E7MA 4U7HA 1OREA 5LJIA 1XR3A 4WY5A 2JG3A 2R25B 5BRAA 1T3ZA 1G42A 1UKVY 1PYDA 4PC3A 2W48A 2FSKA 2O14A 1LDEA 4IXCA 1V4BA 2H9AA 3HUDA 5AQQA 3FZEA 4BVOA 4IXDA 4QECA 1N0UA 5DSTA 4BE1A 3FCYA 2G8FA 4M2LA 5FUVA 3AARA 4AJ1A 4BFCA 1F8YA 4G5HA 2Y1FA 3OJWA 4X6XA 4RA9A 4ZQGA 2CXUA 4LH5A 4HJXA 4WV3A 3HYTA 2XD9A 4BNXA 2R8XA 2VTBA 1UM9B 3PS9A 1ONPA 3DBIA 2ZR8A 4HVTA 3UT6A 1P80A 2QWLA 3RRJA 4WQ4C 1RM0A 3T52A 1ZR2A 3CJAA 2J9XB 5H0IA 4I50F 3NCIA 3P4XA 1WHSA 1X3MA 1IZZA 5AT1A 2OV6A 2YFKA 4D8UA 4EIAA 4TVOA 1AHIA 3SF8A 2PLRA 3ZS8A 4BC3A 4M1EA 1EVJA 4LXGA 4ZOCA 1ZNZA 5GONB 4GDMA 4BYGA 4FOTA 4FJLA 2VR1A 1E79A 3OHPA 1NM5A 2DRIA 2R8RA 4FWPA 2D59A 3ZQUA 4YCSA 4E6PA 1TPYA 3KLBA 1HZJA 4KQFA 3PXXA 1I3KA 1IIRA 3KZMA 5TGZA 4OQ4A 1EG2A 5TGDA 1JBQA 2J9ZB 2WW8A 3IULA 2B8EA 3PQ6A 1T13A 4BNGA 4E11A 4I4IA 1YS6A 3CURA 1G2QA 5CGZA 3CW9A 4HTAA 3D3JA 3WNQA 1JDJA 3QEKA 2DH6A 4KE6A 1VYUA 5IM4F 1V71A 4XWKA 1HUQA 3T19A 3Q8LA 4QGAA 1ZUHA 4YT5A 4V1CI 1J21A 1WBJB 1ISPA 2C59A 5FUWA 5HG0A 3W05A 4L4ZA 5K8CA 3QWBA 5BNTA 2R7YA 1Z8NA 2YIMA 3LRTA 5T5QA 2K4MA 1Q19A 1YI2N 2XGSA 3P97A 3TGWA 1YAHA 3SKYA 1OILA 4LIPD 1U0RA 1S3IA 3U62A 3CINA 1BXZA 4R1MA 2O4CA 1WCV1 3ZZNA 4FVUA 2RARA 1DTTA 2QMEA 1A9RA 1VI6A 2WT4A 1VCIA 2ECQA 3EDQA 4PVCA 3RT7A 1NI5A 4GRIA 5EYPA 3ZD8A 4QFDA 2V7BA 4CHNA 1P5HA 1W47A 1N4AA 4CQMD 3PWZA 1G5PA 3FVWA 3K4PA 5K8VA 4JHDB 1SKSA 1T8WA 3AWDA 1GN9A 3L8FA 4KIGA 2Z3WA 1S2GA 3R7FA 3LTEA 2MSDB 2WIAA 3OIGA 4JLHA 1SC3A 1MH9A 2R6GA 2XAUA 1R4MB 2AJ8A 3SZ3A 3RC8A 4IQ4A 4RW7A 3T0FA 1BU6O 3LPTA 4ETMA 3MTDA 1W2GA 5JSUA 2ZSDA 1RGIA 2CH5A 4E3ZA 1WB6A 5CHIA 4XVQA 4E08A 1YZYA 4LNUA 4JXXA 3PT9A 5YASA 1B8NA 1OXKB 1QHTA 1Z8FA 1L4NA 3LT5A 1L8LA 4TTTS 5AW9A 4R9SA 4YHHB 1EKXA 3V8RA 2A0KA 4UASA 2VPWA 5SYNA 1Z4QA 4H7KA 4B43A 3AM3A 3IP8A 5DTQA 3C5CA 5I9IA 4CJLA 2PYDA 3GA0A 3IUCA 3N8DA 1NLZA 1MOQA 1V2GA 2F8MA 4KH0A 3HI0A 3WBKA 1DAIA 4MLHA 2YWDA 4H6XA 1NGFA 2W40A 2QX7A 4UVIA 4ALNA 3KQPA 4P36A 5G4KA 3NRCA 3IAFA 3EFEA 1O95C 2YJEA 3BDAA 4HAVA 3RFCA 5D85A 1R8JA 3WWDA 5ADVA 1Z2NX 3QUBA 2LWIA 1E32A 1X1CA 4JENA 4OQNA 2XY7A 1YIDA 1NDUA 3L0CA 4P82A 4CIGA 1K8KB 4F60A 2Y05A 1K6MA 5EZ6B 5T8KC 1XRQA 3NATA 1HSZA 2QZJA 3JAKB 4XM1A 3HTVA 1O95D 2XTAA 3GQBB 4RW6A 5HVNA 3VYRB 1WOMA 4CDNA 1DJPA 4RTFD 1VSFA 2EW2A 5JNVA 1VGRA 2P0EA 1GZHB 1PWXA 1OYVA 1YZFA 3PNQA 3TINA 1TM5E 3WWOA 1XXLA 4DNQA 5DCWA 2I33A 3BG5A 3ZDYB 2RC6A 3CI5A 3JQRA 4G1CA 2CFOA 1PD1A 2O3QA 1S89A 3GUZA 3R3WA 4UATA 4ZDWA 1OASA 3DGFC 2QMUA 1EP3B 2G4LA 2WFLB 4EI2A 1FA9A 4Y0NA 4KODA 1VQ5N 1H69A 2X5JO 2QL5A 1ZGJA 4DW8A 1HFKA 4U7TB 2XMGA 1WUAA 1N6KA 1CQIA 3GEPA 5LU9A 1CVIA 2OC4A 2PVCA 1XDGA 1M1XB 1TZMA 2G04A 2Z98A 4MCHA 3JY6A 2OHIA 2VQ6A 3RLFA 4DIUA 2OLJA 5CLLA 2XMCA 1A97A 3R3UA 5FYDA 1ZNXA 1JLLB 2MJLA 1W75A 4UQLA 4TVSA 4X24A 3TGLA 5DM0A 3FOWA 1T9KA 1V3UA 2PWAA 3NM5A 4C21A 3BHIA 1KVUA 5DIZA 3S55A 3S28A 2M6RA 3VSDA 1XIVA 3WYGA 5DMRA 1CULC 2NZTA 4ZAXA 3CSUA 1XV5A 3ICVA 3B78A 1R6DA 4MMYB 4ETNA 1VL8A 5HM8A 3ZN2A 1L3UA 2A5YB 5FBZA 1O77A 5BVGA 4QYXA 4TS3A 2W58A 2PEZA 2VJLA 4FWSA 4UW9A 2ZI7A 4EA6A 4PV7A 1SXJE 3ROGA 3VX4A 4EECA 2FBXA 3ZETB 1Z25A 4LV8B 1UDCA 2ZBQA 3GRAA 1G7RA 3PSAA 2BMAA 3LRXA 3O2NA 4JX9A 3QEOA 4BNVA 1C50A 4L74A 4P35A 4Y6OA 1L9XA 1HE1C 1G16A 4LF4K 1YJBA 2PH3A 3N28A 5HQTA 3L05A 2WYWA 5U4XA 4AULA 1PJ3A 4FCYA 4N0QA 4PLFA 1BISA 1TYEB 3OZIA 1KJ8A 1NMNA 2Y1IA 2W8BB 5AJHA 4AN4A 2FSPA 3CLUC 4LJ8A 3EVEA 1SUIA 1LS6A 2HJRA 2VA8A 4IO1A 5HRCA 5KIAA 2VDUE 1TM7E 3HVKA 3AOGA 3BCSA 4ZOLF 3TF5A 1LCUA 3H19A 3OTQA 1RTTA 4TQAA 1E20A 1M2EA 2PL3A 3OP4A 3EC2A 3F97A 4KEAA 1OX5A 1W4LA 1RT3A 3KVVA 4WXHA 3U49A 2B4QA 1UPXA 4XI9A 1HYGA 1TU3A 3IC5A 4BFZA 1NDQA 3B53X 5JT1A 1C8LA 1NXTA 1M2GA 5JD3A 4WBNF 1W49A 3CLVA 5AJZA 4YTEA 5A4DA 5JAHA 3URKA 3O90A 2VT3A 2PS3A 4PE5B 4A2WA 4QNMA 1FZTA 2RHOA 1YR8A 2X8JB 2W2PA 5IP5A 4B71A 3MXJA 1M2JA 3V55A 4X84A 4ALJA 2AMLA 2WSBA 4LW8A 1NSYA 3ZY3A 4EFDA 3C6UA 4G23A 4JUIA 2BMFA 4U9IS 3D6VA 1N32K 4UREA 3M6GA 3FY4A 1NC3A 3MAGA 4QOHA 1BFKA 2BEWB 4CM4A 2DEUA 3FPAA 1S5JA 1E4YA 1KK2A 2UVPB 2E20A 5KTOA 3IBYA 1OVGA 2A6AA 4UU0A 4ZPJA 3RC7A 5JXWA 2Q29A 1XMQB 2Q3MA 3B9QA 3ZKWA 1ZYUA 1JXEA 1A5AB 3HSCA 1KY4A 3KEGA 4OP1A 2NTNA 3P1JA 4RS3A 1VZ2A 4IIUA 2RGCA 2XMRA 3D1LA 4P93A 2EZUA 2WU1A 4EVSA 3UMSA 1CY7A 5CXQA 5A0TA 4TTJA 1IN6A 4DV0B 4F9OA 1NGGA 1AS3A 2EW1A 1S02A 4Y9SA 3SUOA 5BYBA 1ZOIA 2B8TA 2WUDA 3W2EA 2FZEA 1XP8A 3EC1A 1GOCA 1SXIA 2QRJA 4KXUA 3GCGA 4U2EA 5J2TB 3QSYA 3UG7A 5CDYA 3ENBA 3AFHA 3CRNA 2BEVA 4BATA 2HHQA 1TDJA 2I2BA 3FTEA 1UPUA 4FSDA 3V1RA 3DQZA 4R5MA 5FOQA 4Q5IA 2GB4A 1RWKA 4C4TA 1G17A 1Y8QA 4KPUB 4XASA 1LTQA 1M90O 2WUEA 3IILA 3R5FA 1JL2A 1HTWA 2QIPA 1JR2A 3IKMB 3KTDA 4O2AF 4MI3A 4EARA 4EHHA 3HMKA 5K20A 5BQ5A 1RHJA 2PVSA 3VH4A 2QX9A 1G0NA 2OGUA 1M3SA 3R9XB 3VQQA 2J3EA 2O0MA 3P96A 1Z05A 3R8FA 5KSYA 2ECPA 2CNDA 3BQNB 5JADA 4KR7A 5CA1A 1LQTA 1WSJA 2O8VA 3T9DA 3QVGB 1Y9AA 1QORA 4UUQA 5FWAA 1G8MA 3VBEA 3WO0A 4C4PA 2VTVA 4EEZA 1XPOA 3G2JA 3LW7A 1VA5A 1ACJA 1NUTA 2EF1A 2YBDA 3RIGA 4BUCA 2JI8A 2BTEA 3AU8A 1YTLA 4NKRA 2COEA 3IEUA 4HDKA 1T25A 1YDFA 1MBZA 4DJEC 4CIWA 3D6NB 4HDNA 1D9ZA 1JLKA 3ND7A 4JS0A 2ZUFA 3PSHA 4N6GA 3LZDA 5A3VA 4D7AA 1W1UA 2VNHA 3ZC3A 4NPHA 3ROXA 1HLUA 3UWKA 4Z7QB 2H00A 1KK0A 2Z3VA 3TLKA 2RI0A 1KF0A 3ASUA 3KJZA 3T3OA 4ILGB 4Y6SA 4Y9UA 5KC8A 4MVXA 5THKA 3WWCA 4AX4A 3D1VA 1XKQA 4CG2A 1A5ZA 1S0UA 3KKEA 3L02A 4CJKA 2PJDA 2ANCA 1NVVR 1V6CA 1A8QA 4PLPA 3NG1A 2FSUA 1I6KA 5AHWA 4LOIA 1KYZA 1BH2A 2PS1A 1X9HA 3JVVA 2AFRA 5DP1A 3DM9B 1U7XA 3WADA 4TV9A 3WLPA 2VUSA 4H0PA 5IASA 2GV9A 1S72N 2GWJA 3B6JA 5FUQA 4HVCA 4OU5A 3B1KA 4FGWA 2FWPA 2ASVA 3P26A 4WNYA 3P39A 4G97A 2WHEA 1E3JA 5BOSB 2IEZA 4BFLA 4H0NA 1YWGO 1IHPA 1JDUA 1VE9A 4H9GA 2J4CA 1N7HA 3IP7A 4C6TA 1L8QA 4J16A 1GKYA 4MITA 4LV5B 4E7HA 2Q49A 4HQKA 1BE0A 1Q3KA 3DNFA 1AKQA 2VRWA 2PGIA 4X64K 1JSCA 1RHUA 2ZI9A 2YINC 3NV9A 3VETA 1B14A 3LUGA 3OPYB 4CYMA 4J0FA 1GQRA 1M67A 5TMDA 1QHNA 1HE5A 1NBWA 1AGXA 3D7SA 1IBKB 4FOPA 3ZHZA 3LLVA 1QQBA 3RVPA 4RORA 1O6CA 1Q6ZA 2C9YA 2I67A 3GD5A 3PWSA 2FFJA 3ML1A 1K6YA 3S9HA 4LBWA 2IS2A 4YS6A 1B42A 1RCFA 1EDBA 2PFGA 4ES6A 5FJJA 5BYAA 2REXB 1DSSG 1CR4A 2X0EA 4KQ9A 1QH9A 5ESRA 1I6WA 2P4QA 2QJFA 4LI0A 4ZODA 2W6NA 3MGBA 1GG2A 4LE2A 4ZK2A 1ENYA 5A5EA 4S1VA 3EDYA 4IWYA 5DT2A 3P0FA 2FN4A 2ZYGA 1GTSA 2QG9A 3A70A 2W2NA 3TLZA 5KC9A 5C4IA 4JZYA 2DLCX 2GH1A 3GLHE 3C3WA 1EB8A 3AVQA 1YFLA 1EVQA 3OJUA 4EJ2A 2FZCA 1Y8QB 4FIZA 4BCBA 4RA6B 3N87A 1Z08A 2W2KB 2XE7A 3VTHA 3DL7A 5A02A 1MT0A 1M2NA 2CZCA 1UOPA 5FUBA 3AVJA 1O5OA 2CB9A 3IIJA 2QK4A 4OJRA 1HYZA 2GK3A 3DVSX 3ETJA 4KLNA 4OQMA 4YDRA 5KMGB 2WMOB 3B1FA 4MLEA 4MWSA 4MGEA 1HZZC 5K2OA 4CKWB 3WRYA 1YBMA 2ZT5A 3RUDA 4G81A 1R1DA 4EELA 4UBLA 4FO0A 3JXUA 4CBWA 1WVIA 2QTCA 2XOXA 4JMPA 4WX2B 3VZPA 4TTSA 1CERA 2W6ID 3Q3GE 4Q12A 2QUIA 4ZVVA 3W6PA 3PXDA 4X66K 2I03A 3LY8A 1E89A 4FUQA 4HPJB 4RK6A 1WDLA 3MJTA 2C5FA 2IVZA 4R8KA 2EKPA 4F2HA 2HW3A 2P6OA 2P9YA 4AAYA 5HQ3B 3CVYA 1U5AA 2Q3LA 1KFJB 4HDNB 1DUIA 4N3BA 5TPZA 3UWMA 2VC2B 2XOKA 3ORFA 3TIVA 1KEWA 3CEJA 3DYBA 4X20B 1PZFA 5DLQC 4JP5A 2JJ8A 1F7VA 4GM1A 3VF4A 3FMOB 3VAAA 2QTVA 3PA8A 5CVCA 3OFNA 5MFZA 2ZAYA 5KHAA 3WGQA 1WP9A 4FHGA 4Q3EA 4BBJA 3KL2A 2WWYA 2XY4A 1BGVA 1KAOA 5ALUA 1CEYA 1C3OA 1CVLA 1OLOA 2EKDA 1AV7A 2OGZA 2W11A 3SK3A 3B8EA 3CFRA 3VGLA 2BP7A 4HQLA 3MXIA 2O23A 1NL3A 4KX3A 4BRWA 2O8DA 2MHCA 1M33A 2IGTA 4GV3A 4FX2A 4MR9B 1M8FA 1NJ5A 4BMSA 2CMGA 1JQDA 4EPTA 2NZ2A 1XEWY 4K3UA 4KR0A 3U4DA 4LRYA 2XUZA 1KBQA 1Y3FE 2IYWA 4IIBA 1QC5B 2PL5A 2FDCA 2FPIB 1AGPA 1SIWA 2HSGA 4TKZA 4E88A 2BDPA 3P9XA 3CCMN 1ABFA 1ZU4A 2ZS7A 3AFGA 5A7FA 4PC7A 1ELOA 3WK7A 2R1TA 1ZHOA 3IAS6 3N7AA 5DO9A 4C1NK 2VSXA 1KJ9A 4PLTA 4L8YA 3LP2A 5IZCA 3NEYA 4CJWA 3IUBA 5IZCC 4CM8B 4FWRA 1XVIA 2D0BA 4PY5A 4QOFA 5FJIA 3A26A 4F3NA 1P3DA 1B26A 2EKLA 2VDLB 4UBMA 4EFHA 1S3FA 2BMWA 5KQPA 3LDAA 1R4AA 4ASUD 4DSKA 1XVAA 2V3VA 3LGAA 1EAYA 4ZAZA 2C2KA 2HA2A 4M60A 2Z0MA 1CXUA 3L0ZA 1XZBA 1QVZA 2EARA 1O97C 4PGHA 4R7GA 4GG1A 2J87A 3L06A 5BW5A 1SKRA 5FUXA 2WQ6A 2I91A 5LB4A 4QUJA 4YMIA 4G8BA 4YRKA 4EENA 1DCTA 3CWQA 3GROA 1COZA 4M37A 2H1WA 4Q1CA 3G1WA 4PSCA 4DDHA 1DG9A 4FLWA 4CJQA 1G55A 2LIVA 1Y9ZA 4OHCA 5H81A 5JY1A 3LLMA 4B3MB 5CR4A 3QPVA 5EG5A 5KX5B 5EKDA 3G89A 3ME5A 3RS8A 4XAQA 5IAAA 2HMWA 3Q3EA 3PUIA 1TLFA 3WYDA 5AW1A 5BSUA 4EW6A 4WINA 1KZ6A 3VDQA 4YXWD 5CDSA 3KOWA 4I1YA 1E98A 4KFCA 3MD9A 5FD8A 3WLQA 3NWEA 4Y1RB 1YMUA 3N53A 4J94A 1K7FB 4LPKA 2C57A 1ZRSA 2J6HA 1JDPA 3E4CA 4J29A 4JH0A 4PONA 3WK6A 4AKHA 1TVMA 5IKOA 4TKUB 1JLBA 4NULA 5K0EA 2VATA 1ZBHA 3D1JA 4URZR 2AG8A 3UWDA 4B6JA 4HMQA 3CYMA 4CW7B 2OCXA 4N7RA 1OI3A 4XJTA 2V6FA 2X0KA 4PHFA 5AUPB 4XEIA 3Q12A 4LF8B 2XGOA 4I6GA 2HD4A 1N1GA 5E41A 4NS1A 5TLSA 4E6EA 1GRQA 1Y37A 2BMJA 2ZJRL 2FSNA 2XSZD 1WSHA 2QLLA 4YUYA 1QCYA 4DQ0A 3B9PA 4HNHA 1KE1A 2JD1A 3OM8A 1RCHA 3MWJA 3SX4A 4UM8B 4LZJA 1YJ8A 5F4ZA 3RJ9A 5A4FS 1IMOA 4KG7A 1SB8A 2DHRA 1EGHA 3C7TA 1ZVVA 4PXSA 1G5RA 1PX2A 1V48A 2Z8ZA 2ZSFA 4PRZA 4EKYA 2J9FB 4ND1A 2PUAA 4BLQA 1R0AA 2XA2A 4X91A 2P2GA 3LYHA 1XLVA 4E0DA 4XR4A 3MWFA 4REQB 1XZKA 1P29A 1BCMA 3NASA 3W0LA 3TBKA 4DXHA 2JHGA 3AF3A 4AY2A 5KTYA 1CDZA 2P1RA 2F67A 2HIHA 2J7PD 1YRQA 1YZLA 1WABA 1X1RA 4G1MB 4BZQA 2GM4A 1K0UA 1XJWA 4GAEA 3GP5A 5FPPA 3I42A 3I8DA 3CPJB 4S0ZA 5I9BA 2H4XA 1TQ4A 3K5PA 3R3ZA 2Q1WA 5KYXB 3DCNA 4AO7A 4DNPA 4CU2A 5AQGA 3P8ZA 2CJWB 1JLAA 5D1NA 1E4EA 5A2QO 1FTYA 3HKCB 1L5NA 4D9GA 1ASWA 3AY9A 1QPGA 4N3GA 4HYQA 5HK8A 2A92A 3HFJA 1U04A 4HEHA 1IPEA 4EABA 1EJBA 1U9IC 4CGFA 1SCDA 5EX5A 5KTQA 4IO9L 4A0HA 1WN7A 1P1BA 2FWRA 3BTSA 4Y1GA 3LP5A 3GGCA 4AIIA 4DV4B 3IKMA 4UDYX 1FK9A 3DV9A 2WYVA 1U5BA 1V45E 2AVNA 3AJAA 3CG7A 4LCBA 5E1DA 3GGDA 4UJ5A 4KHZA 3H75A 1NOIA 1FQKA 4ENRA 5FORA 2P2LA 2HPHA 1ESEA 1WPRA 3LXMA 2ISQA 2ZSIA 1VMKA 4UEWA 1W4BA 4TRJA 4GNIA 1MT3A 2YMMA 1HTTA 2PTGA 3EXHC 3AVHA 3MTAA 3QP9A 2NUBA 1FDUA 4BNWA 3I09A 5FI3A 2F4VB 2GBIA 5FTWA 1PGJA 4M49A 2ZCVA 3K59A 5FI0B 3C3AA 5IWCA 4N4AA 4QAQA 3DGEC 4O5AA 3VFDA 2HX1A 3T5TA 3ZE0B 1G291 4U7WA 4F9GA 1V3QE 4C6HA 2OY0A 1YI0A 2IYYA 2WINI 1HLDA 3NHSA 2BTQB 2ZWAA 1E9VA 1A2BA 3LWDA 4JT9A 4Q0MA 1DBWA 1BXRA 2XY8A 4QQNA 5HSGA 1OUMA 1ZW6A 1USVA 2JW5A 1EE9A 5KAMA 4CIYA 1YTUA 3OZBA 3NH0A 2WVHA 5AQIA 2DH5A 2C9MA 3OE1A 5HJ2A 3WBBA 2YQZA 3FBGA 4C7JA 4QFCA 3CNEA 5KKNB 2ASMA 5CZ1A 1R88A 1IXYA 4L15A 4EY6A 4NCGA 1ZR4A 3J80O 1ZP6A 4ZMBA 2IDZA 3VQEA 2QGNA 1EWTA 4L51A 5HJEA 1XK7A 4GOLD 3MK31 3O21A 4NATA 1EWYA 2WJGA 3OX2A 2I54A 4DSFA 2RJ3A 3K8OE 3WYNA 2Z2XA 3K2BA 4OI0A 3CCFA 3T4XA 3AR6A 4ZTBA 1FBNA 4F2GA 3EVGA 4JJ8A 3ZG6A 2A1RA 2ZE8A 4AYWA 3QUTA 4V19S 3F5TA 2A33A 4RE5A 2IAJA 3OEEA 4PQRA 5BVHB 4ILEA 2ZRCA 2OLEA 4JLMA 2AUMA 1OBFO 4KTZA 1NUSA 2ZYAA 3L4IA 4KFRA 4Y67A 4QULA 5I9NA 2B82A 4GYWA 2G3YA 4Y7DA 4DTNA 1YDGA 1R8QA 4BASA 1OLSA 1Q6YA 1L4BA 1M6VA 2ENWA 3QU5A 3HKDA 4JLBA 2E1YA 1NXWA 1T8PA 3DB1A 4DMFA 1QFZA 3MTBA 1UAYA 1XKTA 3W5JA 2V7VA 1F2DA 1T2EA 3JQ6A 5CPFA 4DGQA 4LF6B 2VH1A 1JLLA 2MR5A 3B5JA 5EIFA 1F6DA 1XD2A 4O4JB 3ED1A 1G99A 3VAYA 3WB1A 5AZIA 1LBHA 1PQPA 1E1NA 1N5DA 1Q16A 2GEDA 3TI0A 2NQ2C 3CUEF 3PXBA 3QPAA 4R84A 4EJFA 5BMVB 4KXFB 3SBTA 1E9BA 1LPBB 1NV9A 1QG0A 2HCTA 2AOXA 3UFBA 3CSDA 3U6KA 3QESA 4D8VA 5AI6A 3UN1A 3KJQA 1QGOA 1BA2A 3QELA 2B4YA 3STHA 2P9IA 1MC1A 4ID5A 1SG9A 3JPYA 3KLGA 5AI8A 5E9WA 2IUUA 2EOAA 3JW8A 2AXNA 4JBNA 5FL7D 3U80A 4D45A 4PN3A 4MGYR 4ZQFA 3TSYA 1L8XA 4EP4A 1EBUA 2OM2A 4BN0A 4EB6B 3KKQA 4YCNA 2KE5A 3M1FA 2FJ0A 3L0DA 4NV1A 2QMOA 4QBGB 2IZ1A 3FSGA 3W6ZA 3HCOA 4MTLA 5LDDC 2CZQA 2R7KA 4HQFA 4D6PA 2L69A 1OH8A 3E9QA 5D3GA 2QF7A 3FUTA 4HQ0A 1WPGA 3RUAA 4CT5A 1L7RA 5J2MA 1WF3A 4I4CA 4Z1OA 2W2LA 2W6JA 1XL1A 1ZVKA 1PUJA 2BGUA 1H1LB 3QELB 1GFIA 1TC1A 1VGQA 1WAJA 4PA1A 2BUAA 2QRLA 3ITDA 4NZOA 4Z0PA 3M8SA 3RIMA 1I4OA 2DQYA 5DTRA 2V74B 1VQLN 2JFPA 3TWHA 3MCVA 5LYJA 5TC4A 2GPJA 2RHDA 3K9KA 4B0OA 2JFBA 3FZYA 2W2MA 3HVHA 4G09A 3N2KA 4L50A 1PFUA 4AKEA 5ALWA 3J8AA 3L82B 5CFPA 3ZT0A 2L82A 2QMYA 3D4PA 4LVUA 3EVTA 4PAOA 4RJLA 1LV8A 3ZE9A 4BP1A 2FAXA 3BHNA 1YU9A 2H07A 3F96A 2E6MA 2XVMA 1SOWA 4LZPA 4BP8A 1H8HA 3GN1A 4L72A 4ALMA 2RE8A 3RUHA 1JALA 4BGBA 2FCAA 3AI3A 2M6KA 5C8ZA 4CKCB 1DAOA 2YWHA 4GLBA 1Y8CA 1DT5A 1I24A 1E2IA 1YOVA 5JFGA 5KYTA 1YVDA 5ARDA 4X8MA 1SL2A 2JAOA 3OFKA 3OOSA 1XTBA 2YQ5A 1I36A 1R5BA 4OQLA 1XQVA 2P9NA 2FMHA 5ADXA 1AA9A 4J07A 1ULBA 2TS1A 2QYHA 1O95A 3P9ZA 2O7RA 1AUVA 4AKSA 4BFYA 3TS1A 3BUSA 2A3NA 5B2FA 5INTA 2CNOA 1FVXA 2HHVA 3O1IC 3QXGA 3ADBA 2A3ZA 1EP9A 3TAMA 3H5RA 3R77A 3K9FC 1N78A 3RTCA 2GERA 3H6GA 1HY3A 3VYSB 4RCHA 1Q0HA 4GKVA 4DREA 2GD0A 3PWKA 3EIFA 4B6QA 4ZYXA 3VQDA 3TM5A 2KLAA 4EYEA 1R0LA 5DM70 1X7ZB 4CM7A 2JFNA 1M66A 2QLMA 4JJEA 4TSFD 4WN3A 2ACWA 1AQLA 4ZVQA 2H4JA 1Y64A 4CFYA 1JILA 4XWYA 5DASA 3L6UA 5F51A 3PFGA 2HW8A 5EUBA 4TLMB 2I3ZA 4OPJA 4Q1AA 7MHTA 2L19A 4KAFA 2ZB3A 1J23A 3L4BA 4X71A 1TO1E 2PZFA 2MMGA 4G9BA 3QEAZ 1E61A 3I4FA 1CIJA 3ZVLA 5BN4A 2OTCA 4DEYA 5EE5B 1IH7A 4U7FA 5ALPA 3K20A 1UKEA 1MO6A 2IIVA 3ITHA 3CRQA 3RSOA 1NMZA 2JLQA 4LRXA 3SFTA 4UTPA 5KTNA 1UXIA 3HU1A 3LX6A 2Z1HA 3FZMA 2CDBA 4I5DA 2PQ2A 4IFVA 5GGYA 1FYVA 5DYTA 1ZG3A 4HUQB 3AL2A 1I32A 4WXRA 5EIAA 2QTFA 4Y1EA 2XUHA 3VENA 4K6KA 4L8GA 2NO0A 1L9KA 4TLBA 3TRFA 2JLZA 4O3MA 1F0YA 2VHTA 1YDEA 2RHJA 3TTWA 1XNQB 3HCPA 2IZZA 3ZLJA 1OVQA 3UXEA 4KBFA 4Y9TA 5IJZA 1O4VA 2GZHA 4DV2B 1E1RA 1JJFA 1ZZEA 3Q8MA 1N0IA 4CR7A 1S2MA 2OWEA 3H0EA 3I92A 1BKSB 2VPXA 1HG1A 1QV9A 2DCMA 4XDGA 2H8KA 4JT8A 1UBGA 2ZUWA 4YAEA 1TKCA 4E7LA 2IOFK 2WE7A 2SCUB 3O4IA 3X3HA 3ZNOA 2CFTA 3UYKA 1UBKS 1UMDA 2PH1A 3KJNA 4ESHA 3EKSA 3QKTA 4DB3A 1VLVA 1TGOA 4LBVA 4QATA 2GKSA 3ENHA 1S6YA 1U0OC 2PSEA 2VG7A 4FILA 1VSHA 4G5FA 4E5YA 4BECA 3S40A 2RE2A 2PAAA 3D4NA 5IUNC 1BMDA 4P81A 4NEQA 1PIWA 4IDGA 2A1TS 5IDWA 3DONA 4JI3B 1P5RA 2QM0A 3KPJA 4C14A 1JVBA 2H1VA 3OZCA 1SZCA 4YP6A 1RFGE 3RAGA 2FRDA 4J0GA 4FLMA 1WOYA 1K88A 1OAOC 3DBRB 2EKQA 1Z4KA 1GKUB 3K0KA 5ED0A 4S0XA 2HEGA 1ETUA 1R6XA 1JL3A 4OGCA 3MF4A 4C2TA 2B78A 4DBZA 3HYSA 4TL8A 5LBIA 4PN7A 4UTNA 2J4FA 2Z6VA 4XQ9A 2VQEB 3FHJA 1EGVB 1I0ZA 1N2JA 4AM7A 5G4LA 4NXNB 4KVGA 1RJDA 5FNVB 2BE2A 3NC4A 3C65A 2CXOA 3A2MA 3EGWA 3RSEA 1O6GA 3OO1A 1VZ3A 2QD1A 4YRAA 3OC0A 5LNK6 1TW3A 1PT8A 3P9SA 3QF4A 4JI6K 2ZR9A 3HL4A 4ZV9A 3OJFA 4FDVA 1AT1A 1VRWA 1OX4B 2IYRA 5J5VA 3SBXA 3OBYA 2EWMA 2I7NA 2VNAA 2Q45A 3L01A 3A3NA 4V0SA 4WLEA 4BNFA 4D4IA 4I4TA 1MU0A 1Z6QA 3QITA 4G4SO 1F20A 4TQUS 3V9UA 3O1JC 4UE3S 3PQDA 3UC9A 4DSUA 5ITSA 4WQ5C 1CDDA 5FO1A 3CXUA 4BMYA 2OAQ1 3I28A 3ZJ5A 3RJZA 3G0OA 5M04A 2J5KA 3A4MA 5CT9A 2AOVA 4FNGA 1RMQA 2B94A 1LPMA 1IJEA 1LLDA 3C5VA 3JVUA 5SYAA 2HQSA 1M1NA 1CUIA 4O8KA 4QHSA 2EU8A 4JC4A 2AHOA 3HXTA 4L6AA 4KZKA 2ZRMA 4DCGA 4A2QA 4I1SA 4I2NA 4XH9B 2OCIA 1LWCA 3H9JA 4FJ2A 1U3CA 1BIFA 4G5QA 4R1TA 4YO7A 1O0SA 1Q3TA 2QJTA 4MVJH 4W7IA 4ALLA 3NDPA 8ATCA 4R1OA 3LTNC 1FRQA 4KRXA 4FZXC 5E9AA 1NLVA 1P3Y1 1RKQA 1Y3AA 2X7HA 2RCNA 1YE8A 1M83A 3C70A 3G8DA 1H05A 1Z28A 3O8QA 3HM9A 4L5JA 4DCHA 2PBRA 2R8EA 2AFHB 2IPAB 4CK3A 2E5FA 5AVXA 2FE1A 4TMYA 5AHRA 1V37A 2IZ0A 3QLHA 2ZIXB 5KX5F 3Q5GA 3FPHA 3WE7A 3X43A 2DMRA 3COSA 1FFGA 2G8UA 1QFMA 2HO5A 1N6RA 3Q9UA 5ITZB 3QRWA 5FNVF 4OO1J 2EBUA 2ID4A 2JBAB 7GPBA 4COOA 2ORED 2H1LA 3QWHA 3PFIA 5SZKB 4DWIA 2IDOA 5HCUA 3U7GA 1FCJA 2YY6A 1LNQA 1WHTA 5E2BA 2BGRA 3V1TC 5AFUH 3HBMA 4CHQA 3E7XA 4FK2A 1RP7A 1VFNA 2VAVA 4KN6A 4GI5A 3L8GA 4MR9A 3H3NO 2GAIA 3JQBA 2VEOA 3E1SA 2Q0XA 1VSBA 2WU0A 5T64A 1GGFA 1JU4A 4PZPA 4Q9LA 1KMCA 1JG1A 3ESCA 1BJRE 1TMYA 1CKEA 1OX6A 3RMBA 4MQFB 2ZJ0A 1M1UA 3ONFA 3BWMA 3MD0A 4JUBA 4RGBA 5K3SA 3X2FA 1B8OA 1FE8A 1GJRA 2UVQA 1M0WA 3PK0A 3V00A 4TZTA 5K4HA 4DV2K 2G25A 2NO7A 4TUYB 3RJ5A 3TLCA 4AUNA 4BNYA 4DLWA 3K6SB 3C6BA 3AVLA 1E69A 2ODBA 2ATCA 3D3NA 4DV0K 3HCBA 4YCBA 2WF6A 3UO8B 2Z1GA 2B0CA 3W3AA 4O4LA 4CF3A 1A9TA 1LI7A 2Z9DA 3MWEB 2W6OA 1RM4A 3AY7A 1WDMA 4R4JA 1RKBA 5DYWA 4WCDA 3DYVA 1NMDA 1VSMA 1PJZA 3JQGB 1Q9YA 1T10A 2CGLA 2DQSA 4P7GA 4GV6A 3D3KA 4KLZA 4B44A 5AKEA 4DQVA 1E2PA 1CY2A 1NF8A 2XI4A 2FN9A 4GMHA 3RRBA 3IV6A 4FZJA 3VZQA 4JSRA 5IG2A 2WVAA 1MO5A 5JUWA 1U6JA 4WOCA 2NUTB 2RKIA 3IPYA 4BE7B 3WS7A 4UU1A 3FVVA 4YJFB 1A8PA 1TCUA 3S1AA 1SZPA 1X74A 1I5OA 2CJPA 5JJLA 3A8YA 2CC2A 4BRQA 3L6CA 4A6DA 2ROQA 3WA6A 3ZGNA 1CY8A 1Z0DA 2MMCA 1PF7E 4XUDA 1RRGA 4H15A 4TSFA 5KRSA 5BREA 1QG4A 3HYCA 3RYHB 3E1YA 1NFRA 1WSAA 1D4OA 3FOBA 4DR1K 4Z49A 2JWKA 3F67A 4MUIA 3M1AA 4EX7A 2UUCK 1P4JA 2WWGA 3T9FA 4A2PA 5JISA 3L0YA 3N7TA 1KQGA 1QDEA 4NBUA 3EA0A 4K6HA 2O5VA 1YC5A 2ZXEA 5HBMA 3QXSA 5HPYB 1U5CA 4MP8A 3O8QB 1LF5A 3V1KA 3BMCA 3WQTA 4A2BA 1GAWA 4EY8A 4GZ5A 4CL8A 1RR6A 2ISSD 1Z5GA 2YYSA 4RPLA 4XD7A 4Y2VA 3TAGA 5L8VA 4NO7A 4D3FA 4B3FX 4W5WA 2I9KA 4B3JA 4HWKA 3N4PA 4RVHA 3OY9A 4EMTA 2CY0A 4FBLA 3EOZA 1RWQA 4LFCB 1N8SA 1PZEA 5F3DA 4FEYA 4A73A 3AETA 5BSGA 4CCWA 3CZAA 4JKOA 5HM6A 1R64A 3RU9A 2JAQA 3KLFA 1R9NA 1RXYA 3L5KA 3C85A 3TQCA 4BFTA 1Q1BA 4DR3K 3SUPA 3G3EA 5EWJA 1E7YA 4B9QA 3X1JA 3TLGB 5KQDA 3LS2A 3LALA 5FPNA 3IVXA 3FYSA 3GELA 3VPHA 4DLTA 3CLRD 1Q9XA 4B9TA 4L5YA 3SEQA 3IOEA 1DKPA 3FCUB 4H7JA 1RT6A 2HMYB 2VIIA 3IRUA 5CGQB 3UB2A 1C1CA 1OKJA 2OK8A 5EP1A 4NZZA 1YJAA 1L5UA 5B3JA 3S68A 4RZHA 3ZI7A 5JS8A 2QPLA 1SG6A 3BL8A 3LPAA 3MWEA 1TUYA 1UWLA 3LVBA 3P45A 3AG5A 5DK6A 1RPJA 1KNQA 5H9WA 1TYCA 3E22B 3MB5A 4JV5B 3HPHA 1GU0A 1ULHA 2KFNA 1TW2A 4Q4HA 1VP9A 3EDOA 3MWDA 5FTJA 1ADBA 1YACA 3OW2M 2X9QA 4ER7A 3PGLA 1JBKA 2Q5JA 3VR5H 4EGCB 1T6XA 1AXRA 2E2QA 4IQFA 3PKIA 3A2NA 4V2UA 3RJMA 2OZKA 4CMJA 4GWKA 2KBFA 3G10A 2FHPA 4B75A 4OX9Y 3KLIA 1E2EA 4MV4A 2HBYA 3QI2A 1N9ZA 2H8GA 4D9MA 1XDDA 2JWLA 1FXSA 2RJOA 1ZBFA 4KFSA 3W5BA 4AVYA 4AC9A 1PV1A 2M1ZA 1YV9A 1X1PA 2W4MA 2GHQA 5FRDA 5AUNB 4KB1A 3F4LA 4C8OA 3H1PA 4DL9A 4HEQA 2CB0A 5EHXA 4Z51A 3T3FA 1WMBA 2R86A 1WCIB 1XDUA 4BCCA 1AO3A 2VHYA 1PV4A 2FMTA 3N2ZB 3SZGA 2HIGA 4Z0TA 1AF7A 1E9DA 4ZP1A 4IJVA 1FFXA 5KBYA 1KCFA 1K66A 3BXPA 5KHOC 5AJUA 1Z82A 1UADA 1B0AA 4P4LA 1DKQA 4UM7A 3EY4A 5KNBD 1T5IA 4FXOA 3ZJUA 1X7DA 4H35A 2ZQYA 5B4TA 1JI0A 1SK9A 4BEWA 3ZWCA 5AQOA 4DJ5X 4DTSA 2ZUUA 3IQGX 5FHRA 1EUZA 3CRW1 3VH1A 2WSSD 3ILVA 3GWGA 2CK3A 5CURA 5F1YA 5KNCH 2VYVA 4HS9A 3FJYA 1PLLA 1KC8O 1CUWA 4ILJA 1XTVA 2R8OA 4X3CA 1QHXA 3OQJA 4H4OA 4BACA 1H2XA 3O80A 4C8NA 1KRPA 2E9SA 3DTTA 5BR8K 5I9LA 3WGIA 1YJXA 3SQDA 1Y89A 1BFDA 4Q0BA 3E3LA 1Y8RA 1GAQA 4MDYA 4Y6RA 3RTAA 4LHZA 3O4RA 1RKXA 4JRPA 3AEUA 2KHZA 3K5HA 4UDOA 5E8JA 2Q3DA 1OROA 2Y2UA 3RVBA 3TAUA 1E1CA 4QPNA 3G2MA 2D0PA 4NOKA 2YHYA 1ES9A 3DT6A 3DVQX 1OVMA 4IG4A 3RAPR 2GZ2A 3RUIA 4WDRA 2JAUA 3MEQA 3PLRA 5KVSA 4RMNA 2XUAA 5T4BA 2JA1A 3U9TA 4YCLA 1SUCA 4GKAA 1XWIA 1NU8A 3VDNB 1JQ3A 4LVOA 1ZMXA 2CEAA 3CGWA 1SUAA 3NYWA 3T61A 2GXUA 2IDKA 1G9TA 1D8AA 1ZN7A 1KVQA 3ZWXA 2J0QA 1BQNA 1GPAA 1XHFA 3OM1A 1Q2XA 3M4YA 1CB7A 3C5HA 1NP3A 3FFTA 1NBEA 4KAXA 3HP9A 1VBFA 1SRQA 1W5FA 3L9WA 1TFRA 4AU1A 5CH3A 4B1FA 1DRVA 3TFWA 3MC1A 3TOXA 2B1GA 3M0EA 3TNYA 1M9NA 1H0HA 3M3PA 2OYRA 1JEAA 4OFWA 4BPRA 1YDMA 3SC4A 4CV1A 2C4WA 2JAPA 4LV6A 2YMQA 1E2UA 5IAGA 2YRXA 5SV2A 2NU8A 2ASPA 2ORVA 3K96A 4BRIA 3VPZA 4FP9A 5HIMA 5LZ5A 4EHUA 4FK4A 3KKOA 4BTEA 3TANA 4GPD1 2J3KA 2XKJE 3DLPX 4TWIA 5JSKA 5ELMA 4UFPA 5IBQA 3LFHA 3WYBA 1PW7A 4ZU3A 1DOAA 3PA6A 3QTLA 3KWLA 4O5OA 3P2IA 5E6RA 4BR7A 3VTIA 3BDPA 4BTVA 4PYRA 2P1DA 4RBNA 5JNTA 4Q7QA 3DZFA 3DFFA 3KXKA 1NVVQ 1SXGA 1RJWA 1X8JA 4HDMA 4IGFA 5CBPB 1US8A 5AQXA 1WP4A 3RYFB 3HJHA 1HNZB 4B08A 2IEYA 5EKSA 3EZYA 1O8BA 1MDFA 2WIFA 5AQHA 1TEXA 4DM4A 4HQNA 3RE1A 2PUBA 1YB1A 4NLLA 3TUJC 4ERXA 4R1UA 1KXZA 3UH1A 2X41A 1R9MA 3WEEB 1NG1A 3D6AA 4YRZA 3P4IA 2DTUA 2OAGA 3L1JA 2W22A 4XSGA 2BZ1A 2G8IA 1XEXA 4OYHA 4B85A 2BEVB 2C98A 5AQJA 3DWEX 1M0SA 4C4XA 5B36A 2GKGA 3L07A 4WE1A 1A88A 4Y98A 4JBWA 3KQOA 4MGHA 1GRRA 3HJUA 1IAVA 4YUVA 2QENA 2I9PA 2OQVA 1U3GA 5JAUA 3JATA 4RD6A 1T2VA 3O26A 3KJHA 5EIEA 4ZEOA 1YONA 4FJ0A 3G9TA 3WB9A 3I72A 1N6HA 2OM6A 2YCLA 4DQDA 1CJTC 4W5JA 4KHSA 4GE3A 1HK7A 3W5VA 4JS4A 4GKKK 2FOLA 4LHYA 4ZVTA 1X0VA 2HRCA 1ENPA 3A9RA 3SQXA 4QU9A 2WFLA 2HTEA 2DSTA 2ALJA 3R4VA 4G5OA 1EZ4A 4BRUA 2NMVA 4IWNA 3EE6A 4BX9A 4WUVA 2D1FA 3HZ6A 4Z54A 2Y92A 5A5GA 1SKYB 2LDBA 1L5RA 2P9BA 4A91A 2ZYUX 4G84A 2V7YA 3KCQA 4U8HA 5G2OA 1PRYA 3WKCA 2CVQA 3RTBA 1QGZA 4XYMA 3ZWDA 1HTBA 1A7AA 1OLUA 1I13A 4R5PA 3RARA 5AW3A 5CAEA 1YCHA 3MAQA 2ZOSA 4ZHQA 1XRPA 1PZXA 1YR3A 2PM8A 2QROA 2HA0A 3MBKA 3FWHA 3UJHA 1JWAB 2IKQA 1H2HA 2Z6QA 4CQMA 4Q39A 4LYYA 4RYDA 1YRAA 1GYPA 1P5JA 1V16B 2JFVA 2X4DA 4A8JB 4GR5A 1MVNA 3BC1A 4IMIB 2WEKA 1O7JA 3ZV5A 1M2HA 3B7PA 4RDXA 1Y6GA 4OX9K 1PJCA 5J2QA 3SPYA 1QWSA 4KE7A 1N5LA 3AONB 5H5JA 1PNOA 3H6KA 2VHCA 3KR1A 4H18A 2EZ9A 4E2FA 4KQ6A 2EQBA 2G0TA 2XEDA 3BORA 1NBAA 3KZOA 4YJHA 2XOEA 4ZXFA 3RV4A 4DQKA 1QTNA 1TAQA 3RFXA 4A03A 1KAEA 2A40A 4X7PA 1N5OX 4M9RA 2DUJA 4S2EA 4C0LA 2J4RA 1RDCA 1JDBB 3B60A 2EC5A 3BMNA 1QAQA 3A6HA 2JGMA 3K70B 5BN5A 1USUA 2UU9B 4CM9D 2OVBA 3IDFA 3BKWA 2FZ5A 1USIA 2H4WA 5HGJA 5P8WA 1FS4A 5DJ5A 4B3SB 1S6PA 4E7KA 4MZDA 3AQ4A 2XHBA 4EDFA 1LK0A 1U80A 2SCUA 5DN6D 6GPBA 4LMRA 4RV4A 3PP8A 3BWXA 4C08A 2JHCA 4Y2SA 5EP2A 1S2NA 3V6LA 1Z4OA 3BJRA 3G82C 4CK1A 1UKZA 1LC3A 4LMBA 2JJ1D 2QVGA 4W7SA 4AWAA 2PX3A 2OYQA 1O9HA 2I80A 2P9JA 1VBNA 1U6ZA 1R8YA 3FUUA 5BR4A 5BWCA 3ACBA 2D62A 2O7SA 4LXYA 4DS3A 1CR1A 4E30A 4IRUB 4U8GA 4OM7A 1UP7A 4G41A 1A98A 7REQA 3LPLA 2I2XB 4LHEA 1PR0A 4M99A 1VSJA 4EQ6B 3LP3A 4QCLA 2H7VA 5NULA 3BFVA 2X9LA 4JWTA 4UVDA 2Q7OE 1K68A 2FF7A 3AR3A 3IE0A 4MWOA 4WADA 2Z6UA 2FEWB 2IEBA 4JLJA 4N01A 1VJ1A 1UOQA 1CDEA 4JLSA 1U9IA 3VSAA 1DNPA 4H5TA 4W7HA 4BV9A 4YI5A 3RS5A 4YCCA 1GLLO 4NFYA 5KNDD 1OBOA 5KNBA 4JEHA 1JG6A 3L1UA 2HQOA 3FPJA 4PC2A 4B9UA 3BT7A 1S9HA 2QMZA 4M8SA 2SKCA 3IBCA 2XOKD 4L4UA 3T7CA 3GW8A 4HDQB 3U6FA 521PA 2JEOA 2HA7A 3HCRA 3R8XA 4HN9A 2OHVA 3TLBA 4OHOA 2QZPA 1JTVA 3FMFA 3L0SA 4WVLA 2GPNA 2DPMA 3ABIA 4QELA 5I42A 5AK3A 1J90A 2LD4A 2YZMA 2NO9A 3R0QA 5FA6A 10MHA 4MRAA 4K41A 3OIWA 3IIMA 4KWIA 4DV5B 3RWMB 2J9RA 1U2VB 1KZ1A 3AJDA 4C5CA 3QE2A 2WPNA 5KNDH 5FTMA 3OZSA 2M9MA 1II0A 3BCHA 3LK6A 2QN1A 2B6HA 2XUKA 4ROSA 5JCZA 4URVR 4KIUA 3CJTA 4FYDA 4Z9XA 1OH5A 1VTKA 2RKBA 1AKUA 4L9SA 4FB4A 5COAA 1CWUA 2RGRA 3Q7TA 4FDAA 4JBXA 4OGEA 2C7GA 5LM3A 4L9WA 1JVSA 4W1RA 3V6DA 3VNQA 2HJ9A 3NHMA 4DXDA 3DBRA 1NGHA 3GFPA 1OLUB 2EDCA 2GOYA 3S29A 1GIAA 4AY3A 2HF3A 2IXEA 2WJJA 1RC8A 1IWPB 1XTQA 1WD7A 5CEEA 5HUHA 4XXHA 5EJ5A 5I9TA 1KQFA 1K5HA 4JI2K 2OT3B 2W8ZA 4EY3A 1Q44A 5BN9A 3QVJA 4ZREA 4A0SA 1F4PA 4HEJA 3RSHA 1IUKA 5JSQA 2UUBK 4XFDA 2Q7DA 2TSYB 3WI7A 3D3EA 4AS3A 3KUUA 3HXPA 2ZIFA 2BKLA 3K57A 2NRXA 2DY4A 1KDRA 2C9DA 3ZKAA 4K6FA 1HNWB 4C89A 2O4GA 3H1AA 5AQTA 3H3OB 4QNNA 4REOA 1ST2A 4MA0A 4H03B 3U56A 3DEIA 1MTZA 1T2UA 2X2OA 4KYTA 4M7XA 5CUQA 3GJ7A 3GX1A 3HB9A 3LRPA 4YJ3B 1SUFA 1ZI6A 4QTXA 4CCSA 3Q6MA 3ASVA 3FPBA 4RJIA 3BWDD 2CZGA 2JGAA 2X0DA 2P9UA 3KPVA 2OSVA 2RK3A 3KV1A 1PR1A 4FJ1A 4J3FA 3ZTYA 4RPKA 1NA5A 3VNRA 2FSIA 5KX5A 2YJFA 4JD2A 3IAUA 3W8FA 1N36B 1VQ9N 1YS4A 2UZIR 3S2FA 3TQFA 4QRIA 1DRKA 2ZUDA 1T2NA 3AAQA 2IF0A 1AK2A 1AK1A 3A2FA 3HV0A 2HL6A 4HG2A 5EJ9A 2IDMA 4HDSA 3AV9A 2P67A 3BZWA 4BE0A 3G8AA 3NBYC 4Z5XA 4YLEA 5KPDA 4CD3A 2DT8A 3ROMA 5HTOA 1KERA 3AZPA 4DUYK 3IXMA 2BHSA 1P0CA 4MIKA 5BUQA 2D0PB 3THRA 2CHEA 5BN5B 2QW0X 4HVLA 4KPFC 3G8BA 4C4SA 2HRDA 4I9HA 2HMVA 4URYR 2BONA 2YVQA 4JJAA 3V7YA 4ARCA 2V03A 4RIIA 1N7JA 4DCUA 1Q0SA 1HDOA 1Z4NA 3PC3A 3W90A 4ARZB 5I4CA 3AVYA 1WUJS 4Z4CA 3I12A 4J1QA 1Y3HA 4DTRA 1I33A 3F90A 4R2IA 4ZK6A 3I6MA 2QY9A 4DANA 1NN1A 5IDYA 2WOJA 2QTDA 2VAXA 3LGXA 2ZI6A 2ZJ5A 5DGXA 2JCBA 1ZBDA 2BN4A 3DCYA 3I58A 3HCCA 1JQ5A 3OE7D 1MEEA 2QPTA 2WE8A 1KAXA 2YS7A 4EGAA 2J31A 3DLGA 3KRTA 1JZSA 3OYJA 1U47A 4TWBA 4M0CA 4NG4A 2VL7A 1JI3A 2OHFA 5TRTA 4YB8A 4BX0A 1MB9A 1J0EA 4YRBA 1H3EA 4WYBA 1V5EA 4TT3A 5K0LA 4X66B 2AG6A 1CR0A 4AMGA 4CGHA 2ZWPA 4QDUA 4EBBA 1NVKA 4WY8A 3P9NA 4BGAA 1HORA 2GZRA 2MYTA 4UARA 5KSWB 4EFKA 5K0FA 2Y71A 4JP3A 3I0NA 1WCWA 1VECA 1Z36A 1XLTA 2I8AA 3HFRA 4K0RA 1HH4A 2CBZA 4PCVA 4F56A 3SHTA 4O0MA 5H83A 4HNQA 4KXLA 5F21A 5BO5A 1J0AA 3EZ5A 2MU1A 4UHBA 1XDSA 1Y97A 2GN2A 5A5FA 2FSVC 3BD7A 3G9XA 4LE1A 4Q16A 2FV8A 3DDUA 4WJZA 4P2GA 3OOWA 9ATCA 2WDZA 5AXDA 1G2IA 1YA8A 2H17A 2JANA 3ZLUA 5GINA 1OXXK 1NXOA 2C00A 3BGDA 4HXFB 4JR0A 2YHSA 4G0UA 2VCPA 1H3FA 1RI3A 1YB5A 2DFDA 3T1HK 3IMCA 4WZAE 1XZGA 4B40A 2VYFA 4DR1B 4HK4A 4MWBA 1FVHA 4PYMA 1A77A 5ALDA 5KNCD 5D3KA 2AN1A 2K7FA 1F8UA 1NKBA 1G3UA 4F8RA 5AHXA 1WAMA 3V9PA 3G0IA 1T3LA 1RXEA 4XPZA 5EMNA 2WNHA 4Z7OB 3H5IA 5ERYA 2GDZA 1U11A 1PZMA 2E82A 1TJNA 2A4KA 4Q4JA 1RRVA 2ERYA 3AUYA 4I36A 4INAA 4GWGA 4N0DA 4G36A 2GCOB 1N2BA 3NNNA 1HLFA 1P1HA 2PMBA 1IO2A 5EVZA 4WUTA 1EO1A 4ZAWA 2DSNA 1SQKA 2A1UA 2Z4TA 3M89A 4J2HA 4KWTA 4UZFA 5DNUA 1U2EA 1VG9B 5K6AC 4E03A 4G07A 2GSDA 2I4NA 1KJWA 2NQTA 3C6QA 3TQTA 2NACA 3UKUB 2WDPA 3ZVNA 1LB1B 1QVFM 3P0JA 3KT6A 4I9GA 4LZAA 1BE8A 4MA4A 4OY3A 2QTLA 3FR8A 2XCRB 2EHGA 1FXWA 1T9AA 4MW6A 2A5LA 3T1AA 4OHKA 1RC1A 4FJ9A 5DI3B 3VF2A 3KZVA 2HOEA 3UNXA 3L92A 1D0SA 2FUG6 3OAAA 4JU8A 5E1OA 5K7SA 3U60B 4LD0A 1QRUA 4HATA 4PZUA 2AT1A 3P4UA 2WVGA 4TTVA 4UPEA 3RSQA 4XB1A 4QOIA 5ERGB 4YRGA 4KYIB 1XZDA 4QBTA 3CH4B 1V16A 1RYBA 3A1EA 3SQNA 3L0BA 1P2DA 1DIHA 3I5XA 4XUGB 4DIDA 2E49A 5AW4A 4GLLA 3IUPA 3I5AA 2HSDA 1Y82A 4ZOLB 1T0HB 2RI1A 2CDRA 1B0ZA 3K32A 3PXUA 4JA2A 4RF5A 3RG2A 3NAEA 2AV6A 4UBIA 3PCXA 4XTCS 3RS4A 1NW9B 1WXGA 1LDNA 3D0OA 3MT9A 4CG3A 1UZLA 4P7BA 1XZPA 5DNAA 1CPYA 5T4EA 1QSYA 1H1VA 2BEUB 3BDIA 1QRRA 3P94A 4PPGA 4LRSB 3V7UA 4CW7A 1Y7PA 3GGSA 4RZSA 1TA9A 1UP4A 4AS1A 2DWQA 1JFFA 3TB6A 5K09A 2ZJAA 1DI0A 3ENNA 1NKTA 1TJ3A 3FWNA 2WUGA 5BSEA 4V0KA 3RR2A 1AQ6A 2A86A 1H93A 3O7MA 7MDHA 3FDIA 1GT91 5AW6A 4K43A 1I0LA 3HLTA 4FLYA 1E2DA 1E2NA 2GESA 3JWJA 2RGGA 4L3WA 3HEAA 4U7PB 4YRMA 3EEOA 5IKPA 1P75A 1XHZA 1KO8A 1GRCA 1Z63A 4K28A 1VJRA 4PHTA 2PYLA 2V3WA 4WPGA 3ADCA 4WACA 3U4MA 5AI4A 1DLOA 1C0EA 2MR6A 4F84A 3FYCA 1KEVA 1XSEA 3QXCA 3ESZA 1NVEA 1T26A 3GNTA 4Q7MB 4PX9A 3V4SA 3U4QA 2PZMA 1KZ9A 5M1PA 2CMDA 3UAWA 2PBFA 1LI5A 2R4QA 1RWXA 1WMSA 3K2PA 2WHRA 2GHIA 3IHKA 3PC8A 4RJJA 3HJCA 4DQXA 5IJ9B 1BDHA 3QENA 5CT4A 5AO9A 4N54A 5AWFC 4F8YA 4H3SA 3ROEA 1AGYA 4DHYA 2ZJ8A 1APBA 3D2FB 3BXOA 5C25A 1F2UA 2ZXFA 1QIMA 4OGKA 5J59A 3W9SA 2BUBA 4TLEA 3B6KA 4U2CA 1LD3A 4OHZA 5LXTB 3FTFA 2GN8A 1MPTA 2LNDA 4C0WA 5DV9A 1U8CB 3E18A 5KTTA 4B45A 3BVPA 4NG5A 3NOQA 3VI3B 1WIWA 1ZWLA 3K9JA 1C9MA 2HIAA 2HQBA 3LK7A 1G1AA 3KDSE 4Q9JA 2OBFA 4KX5A 2VP6A 3FF1A 3LLUA 1ONNA 4L02A 4QC2A 4B0PA 2VP4A 5HJ7A 3U81A 4JKFA 1YRBA 2B6AA 2P6NA 4YRDA 5DWVA 2GXSA 4O02B 3FKSD 1NK9A 4UEOA 4AHTA 3IRXA 3BIFA 1EKEA 5EXWA 4PGGA 2XMZA 5AQMA 4OYLA 2CLFB 4M8IA 4Y9RA 3AM5A 4CM1A 4DQLA 2BELA 1WAFA 5EJMA 3AO2A 4C1NA 4WNIA 2ET6A