4LF8K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf8K00
2UXCK 4V19S 1XNQK 4CW7B 5FLXO 1HNWK 4X62K 2F4VK 2VQEK 2UXDK 4B3SK 4LFBK 1N36K 4DV2K 2UUBK 1N34K 5LL6Z 4JI5K 4YHHK 4K0KK 2UUAK 3JAMO 3OTOK 4JI3K 1N33K 2UUCK 1HNXK 3J81O 4DR4K 2HHHK 3J7YP 1FJGK 5BR8K 5LMUK 4JI0K 2VQFK 4DV5K 2E5LK 4CVNE 5IWAK 4X65K 4DV7K 4OX9K 4JV5K 5IT9O 4DR3K 4LFCK 4GKJK 1J5EK 1IBLK 5LMNK 5A2QO 4LF7K 4DR1K 1I94K 4DR2K 4AQYK 4NXNK 3T1YK 1IBMK 4NXMK 4JI1K 1XNRK 4X64K 3J7AP 1HR0K 4LF8K 4DR7K 4DV1K 4KHPK 4B3RK 2UU9K 4JI4K 4DV0K 4LFAK 1IBKK 4DV4K 4GKKK 4DR6K 2UXBK 4DR5K 4B3TK 4JI7K 4LF9K 4DV3K 3T1HK 5AJ3K 4JI6K 1XMQK 4B3MK 4LF4K 4DUZK 4LF6K 1XMOK 1N32K 4JI2K 4X66K 4JI8K 3J80O 4LF5K 1HNZK 4DV6K 4JYAK 4YY3K 4DUYK 2ZM6K
chains in the Genus database with same CATH superfamily
3SBGA 2HHXA 1QZ6A 2PYJA 4C23A 3DLBA 4W5RA 2Q3SA 3IS9A 4ISGA 1SZ2A 3QDKA 4XEIA 3ZT4A 3CCSN 4JD2B 1FW6A 4C8NA 1VK0A 3EZ5A 1LV5A 3HVTA 4LH5A 4MFBA 3F5TA 3N4PA 2QK9A 4DV2K 4FJ8A 1A5VA 4Z4GA 1SL2A 2IGIA 2E8AA 3G71N 3PSIA 3K5LA 5K14A 3HPOA 3V9UA 4DR4K 5EX5A 4H5RA 4FZYA 3WNHA 1VQ6N 3V1QA 3Q7BA 4X65K 4FJHA 4BRPA 4IEIA 4E7LA 2X6NA 1HJOA 5F1XA 3KHYA 4ILGB 1QTMA 3CFRA 3D2EA 1S1WA 1T3VA 4KI6A 3MAQA 1BIZA 3DYAA 4CBUA 3HOSA 2OCEA 2D5RA 3J7ZO 3LDSA 4NXMK 4AH9A 3LAMA 2FBXA 4IG0A 3A8YA 3SNNA 2V7ZA 3P83D 5C10A 4AM6A 4KHPK 5CZ1A 4CZMA 3SZ2A 2YNIA 4J2EA 3WNEA 3KKRA 1KAYA 3CF5L 2P9IB 3K5NA 2B5JA 3EO3A 3KLGA 3ZT2A 3KK7A 4Q5VA 2QKBA 3ENBA 4CHPA 4BR9A 4NYFA 3MDQA 3EZWA 4DQRA 2GUIA 5E84A 3VQ7A 1X3NA 2E6MA 5GINA 4JNEA 4JS4A 3D0PA 1T03A 3F2KA 4EZ6A 1RDCA 4CI6A 4BRAA 1JLCA 3OYAA 4JHDA 5EXWA 4FM0A 1YJWN 3NE6A 1WSEA 4FVMA 3B6PA 4HCBA 4KBOA 4E1NA 1LWCA 4DFMA 2A6AA 3RSEB 1U45A 3WNGA 4F2RA 1KD1O 3UKUB 4EAHD 4QCLA 4WE1A 1JL2A 1NGEA 4LC9B 1VAZA 4FCYA 1S1XA 1U2VB 4BRMA 1Y64A 2VYPA 4IFVA 4O8UA 3O8MA 4IO8A 4Y0WA 1S9GA 5EOYA 4IOXA 3W0LA 3S9HA 3GOIA 3A5LC 3M8SA 3QEXA 2UUCK 4JRQA 3G0ZA 3O3FA 3NHGA 5AQFA 3CC2N 4FLXA 4BQLA 1KFDA 4ID1A 1C0GA 4CK2A 1NOZA 3QIPA 4DLEA 3HPGA 3S41A 4CESA 3NVMA 3RRGA 2OZSA 4OPKA 4FJ5A 2V51B 1WNSA 1D9DA 4O4GA 1TK0A 3RWUA 5J2QA 1JLQA 3WXKA 3QETA 2O8FB 1BDGA 1YT3A 2D0BA 4I7FA 5J1EA 4ILJA 3MN5A 3ULEB 2KZZA 4DV1K 3OYKA 2ZGYA 5KQ8A 1W2BM 3LANA 3NH1A 3JSMA 4DV0K 1QHTA 1HX1A 3AA3A 3Q7CA 1EP4A 2BTFA 3MWPA 2W40A 2FBVA 1B92A 3VENA 5KTQA 4E7HA 1X9JA 3I56N 3TWHA 4IFEA 2YHAA 4MQ3A 3VF2A 3HJFA 2P9KA 4ICLA 4I9LA 4PHTX 3TAQA 2O4IA 3HP9A 1GOAA 4FWSA 4DF4A 3ZSRA 2OZMA 4KHQA 3AAQA 1S1VA 5F2RA 1NGAA 4DQQA 4B9NA 5HROA 1K8KB 4DUYK 4L3QA 2ZM6K 3MN9A 4XH4A 4DTJA 3LWLA 1HKGA 1WAFA 1HPMA 3I8BA 2HBMA 1SKSA 3HL8A 4BRLA 2HMPA 2HNZA 2IS3A 5AQXA 4BC2A 1EWRA 1SL1A 4DTUA 4AHUA 4CZFA 3VQ6A 1N36K 1QQOA 3HRGA 2D1KA 4BR7A 1RNHA 3O9UA 3LZIA 2UUAK 4DLGA 2YX6A 4C8MA 1C1CA 2ZQBA 3J81O 4FJ9A 2VG6A 4DTPA 1DGKN 2OPPA 3NF8A 2DPNA 3ZETA 4FW2A 5LMUK 3EYZA 1XWLA 3K2PA 1HKBA 3QEPA 3ZX2A 1IKVA 2W41A 1LWEA 3QESA 3EKSA 4LFCK 3K58A 2BANA 1J5EK 5LMNK 5BN8A 4E1JA 2O8CB 4PA1A 1MWKA 4F8RA 4GVMA 1VQ8N 3L6QA 4CBWA 5ADXA 2ZJPL 4BDPA 3LDPA 1XNRK 4X64K 4M3TA 4FLUA 5AFUH 1SAZA 4F4KA 3VA3A 3OJUA 5E26A 3D2FB 4BE2A 1ATSA 1T7PA 1WSJA 4HUGA 1BG3A 3T3FA 2KHOA 4AHVA 3TABA 1QZ5A 4KTZA 3THYB 4A62A 3I33A 1WOQA 3P4IA 5CR4A 4DR6K 3TAGA 1FKPA 4FM2A 3QEIA 4XIUA 4KV8A 1VSLA 2QKKA 3DXMB 3JXUA 1W9HA 2IOCA 4RW4A 1VSJA 1NGHA 1VSHA 1GLJO 2HBLA 2HSTA 4IXCA 4CK1A 4JS5A 1U4BA 3R8EA 3OS1A 4RWTA 4JI2K 4JI8K 5TKYA 2WONA 4KH4A 5LJVA 1M90O 3DI6A 3DWLA 4CEOA 3VQCA 4O8KA 1CZAN 5AQQA 3F9KA 4BR5A 3HM9A 1XNQK 1XQSC 4QOZB 3VQ9A 1XC3A 5EVZA 3ZEUB 1U47A 2HBKA 3PLAA 2FSJA 2DFHA 3NDKA 1QQNA 2V52B 3RR8A 3HPHA 4B8AB 2XY7A 4DSFA 3EY1A 4N41A 1MA9B 2ITGA 4YOWA 1JXEA 4OGEA 4KHWA 4CJLA 5LL6Z 1QQMA 3ENHA 4K0KK 2OA8A 4GY2B 3TR8A 5JLHA 4AM7A 3OA9A 4BC4A 3TAPA 4PWDA 2VQFK 5IWAK 3CJAA 4WQ5A 1HNVA 2E2PA 3DLLL 1X3MA 3UKRA 4QS7A 3H45C 2QM1A 3AGRA 4H5NA 3NGYA 1VQ5N 3MX2A 4CD3A 4E89A 4FJLA 3SBTA 4DR1K 4DR2K 3KLFA 4BRCA 2P9LA 4AQYK 1U48A 4QAGA 1ZXOA 3RMBA 4W5NA 1BOTO 4CFBA 4CEEA 4CJ3A 4CJ5A 4MLHA 5BRDA 1RT4A 1U6ZA 2XO7A 2RF2A 4QS9A 3W3DA 4B9MA 4H0XB 4OJRA 3TTDA 3V1RA 4B3RK 3OYJA 3E9OA 5GAGP 4FJ7A 1XHZA 1SQKA 2XY5A 2UXBK 4CEQA 1B9FA 4BRNA 4H0TB 4PKHA 1C0UA 3OS0A 3FZLA 1O1WA 5T7BA 3AVJA 3PIPL 1Q82O 3WQUA 4Z0UA 2F96A 5HBMA 2ATQA 1UWBA 1Q9YA 3CERA 3C94A 1Q7YO 5AQPA 1ASVA 4H4OA 2ASMA 3LALA 2QEXN 4AHCA 4JKAA 5JVGL 4H5WA 3VQEA 1HNZK 4DV6K 3U3YA 3O80A 5GAEP 1JCEA 3THXA 5AQGA 4M3ZA 3VQ4A 3G10A 1S1TA 4MDAA 4C8KA 3AVHA 4CJTA 2OTLN 4CW7B 4B9VA 4MLEA 3R1XA 3QNOA 3O4NA 2CGKA 3NH0A 4PUOA 4YNQA 4WYBA 2WFBA 2VQEK 4N5SA 4CJPA 3B6OA 2YNGA 4FWRA 3MXIA 1G15A 2W42A 5AR0A 2R7YA 5AQOA 3HYFA 4DSKA 3O9QA 5CHIA 3CXCM 1ATRA 2NRVA 4QS8A 2D0AA 1V4TA 3OS2A 3LM9A 4NLBA 2FXUA 2RPIA 4DB3A 4JI0K 3TTFA 4O55A 5C0YA 3VQQA 3WT0A 3SPZA 3F9MA 4EIAA 5HRPA 4FLTA 1S6PA 3PX4A 4FK4A 3MXMA 3LP3A 4NXNK 3ZSOA 2EX3A 3KLEA 3HSTB 4JI1K 4BR4A 2YNHA 2F8TA 5AZIA 3CQ8A 3N4QA 1D9FA 2PBDA 4CJVA 3P5JA 2B4JA 1YIJN 3M1FA 3BF1A 4M3RA 4Z4IA 4YOYA 4Z4EA 3RVCA 2KFNA 2F7TA 4M45A 2DY4A 3K5OA 4DFJA 2WBNA 5TKWA 2RE2A 3TTCA 1S72N 3C6AA 2VG7A 5BPLA 2FBYA 4CF9A 2FF6A 5M1OA 1TAUA 5KQDA 1NLVA 4LH4A 3VERA 1C6VA 4O5BA 5LY3A 2HB5A 5AQSA 4KI4A 4M7XA 3DRPA 3OYEA 3AVCA 3UIQA 4KRFA 5GIOA 3O9SA 1NGGA 1RDBA 1R0AA 1A5XA 4Y1DA 2QWMA 1UA0A 3HO1A 4I2PA 2Q2RA 4BG9A 1RTHA 2DFFA 3VQ8A 4CIGA 4C1NI 2KFZA 3BZKA 2E4LA 4DU4A 1YJ9N 1I39A 5BPMA 3L2RA 3NF7A 1ASUA 4FOEA 4F9OA 1YHQN 3IFRA 4G9ZA 1WAJA 3OYNA 1QE1A 5AQJA 1L5UA 4LSNA 4KH5A 1C1BA 3VQ5A 3GL1A 3OBYA 2NRWA 4G1QA 1N34K 1KFSA 1Q86O 3DLHA 1ATNA 5H1SQ 3CCQN 1RCHA 2O8EA 2V7YA 4IDKA 4CGFA 4IG3A 4YORA 1KRPA 4KHYA 2X78A 4B08A 3K9JA 4I9QA 3FFIA 1IJJA 3G25A 4B9LA 4CHOA 1DTTA 1ZBSA 1Z25A 3R3LA 1T8EA 3CCMN 4ELTA 1T44A 3VQBA 4BQZA 3IMXA 2G8KA 4KREA 3AA2A 4B1YB 1OVQA 4FXDA 3OY9A 3PO4A 4J2BA 2NNWA 1TAQA 1QVFM 1NK9A 4CEBA 3SQ0A 1JCFA 3S3NA 3SUNA 3V1OA 3L4QA 1NJZA 5CZ2A 3WEEB 4DTSA 3OHRA 5BREA 3H6EA 2GWJA 4K43A 1RGIA 5CYMA 1QHAA 4B9UA 2HF4A 3VTIA 2P9SA 1IH7A 4KFBA 1QQCA 4OLBA 3WXLA 4M3UA 4BRDA 4CZLA 3CC4N 4M42A 3DM2A 4CEZA 4IZ9A 1S5JA 1L3UA 2F8SA 3AARA 3OJSA 1IV0A 3D45A 3VTHA 1RBUA 4H0YB 4LF4K 1BU6O 3AVNA 3MEGA 4LF6K 1K6YA 1EETA 4JN4A 4B9TA 3GE1A 2BH1A 3OBWA 3QBWA 3J80O 1EWQA 4KAZA 2VGMA 4OKJA 1UA1A 4CGIA 4IKFA 1E4GT 3H1QA 2E2NA 3ASMA 4DKWA 3KVGA 5M1NA 1VSEA 1S9EA 1HNWK 3L3UA 1YVNA 4O5FA 4FK0A 4I6MA 4RW9A 4EP4A 4M3YA 2HF3A 5C42A 5GADP 4PL8A 1TKXA 4AHSA 2JWLA 2IVNA 4FWMA 2LSNA 2P1JA 3C7NB 1KCFA 4CZIA 4Y1CA 4BR2A 2E1YA 4JI3K 2HHHK 3U6FA 3LM2A 2KTQA 2J4RA 3VESA 2PZSA 5KRTA 2O4GA 2QW9A 3AVKA 1F21A 4JV5K 4YOVA 3L0QA 4DR3K 3U8XA 4FZXC 1HYVA 3IG1A 3THVA 2WOMA 1TK5A 3WUHA 3RR7A 1RTIA 3L3VA 3DRRA 2A5XA 1BIUA 2GX9A 1WB9A 4YOUA 4JKDA 4GVEA 1YITN 1KXPA 4A5BA 4JI4K 3PIOL 1XUPO 3VPZA 1REVA 3L2WA 5AQLA 4FWPA 1EXQA 3D2EB 3AVFA 1VRUA 3HBTA 1EKEA 1EO1A 3A5NC 4FVUA 2A42A 3I55N 3LDNA 4Q0BA 2JWKA 4NYNA 1YTUA 2I7NA 5LJWA 2CGJA 3KJVA 1YVUA 4HHTA 3P39A 3TAMA 1BISA 1VQNN 1X9MA 2QXFA 3T1AA 5FROA 1J53A 3NMUA 2NRHA 1VQMN 4N47A 4BDYA 2GV9A 1RDUA 1BQNA 2VGNA 3VEOA 2P9PA 1GLEG 1RT5A 1YXQA 5AQZA 2D0CA 2Q31A 2HNYA 3ZSZA 4IFYA 3VEXA 3SV4A 3IAYA 1UOCA 3LDLA 1O13A 3SK3A 3H3NO 1W97L 4A2AA 4AHRA 1QSYA 3SLCA 2X74A 3DLKA 4CHYA 2ASOA 1P90A 2KW4A 1RT7A 1DTQA 2FBTA 4JHDB 3M5RA 1LAWA 4FJMA 2GEMA 4JK7A 5M1PA 3ZSWA 4IO9L 4FWNA 3KKSA 1J54A 4M7YA 3HZ6A 4CF2A 3OYCA 1U49A 1QS4A 4BGAA 4DU1A 3BEXA 5AQYA 3WXIA 3QFUA 5AQHA 3DOKA 5AQWA 4BG8A 1OH5A 3M8QA 3AO2A 3VGLA 4CZKA 4OO1J 2G8WA 1TL3A 1HPZA 1LWFA 3KK1A 2Q0RA 3ZSVA 3EL2A 1OH6A 2P5GA 2GTDA 2VWBA 4HTLA 4RG8A 4ISFA 2E88A 5C24A 1Q18A 4BC5A 1RBSA 5C15A 2ITMA 2RHKA 1IG9A 1IBKK 4DSJA 4BE0A 4B1WB 2X6SA 1EX4A 3B8AX 3LZJA 4Z94A 3CJCA 1NK7A 3M8PA 1BUPA 4BRFA 5AQIA 3FZHA 4CGDA 3VA0A 1K73O 1KVCA 4FLVA 2NZTA 1VSKA 4IEEA 4A2BA 3M8RA 1N32K 5DK5A 1NJXA 3VEZA 3NAEA 1WSIA 3LP2A 3NF9A 2CGLA 5CY4A 1VSMA 3TSQA 3HM8A 1SKRA 4CJFA 4BROA 4FM1A 3CJ1A 4WQ4A 1L3TA 3DOLA 3EN9A 4KB1A 3BGRA 3CHWA 4CD1A 2QWPA 2YKNA 2P9KB 2F9WA 4HUFA 4NO7A 1V4SA 3IKMA 2BE2A 4KHNA 2XY6A 3AVAA 4DQSA 4JK8A 4CJWA 1TKZA 4BREA 1I3AA 3WXMB 3H08A 3FZKA 2Z1GA 1NKCA 1R59O 3CM6A 4M41A 5HLFA 2BGGA 3C6UA 4FL9A 4CFDA 2HW3A 4OPAA 5C2DA 3E01A 1DEJA 2E2OA 2YHXA 5IT9O 3KWIA 3V81A 5EU7A 3THWA 4CHZA 4H0PA 1TYQA 2E6LA 4FLZA 5I9EB 1TK8A 4GV6A 4KPYA 1B9DA 3DXKA 1JL1A 3BP8A 4FO0A 2YKMA 3H3OB 4F2SA 2GUPA 5C2FA 1DKGD 1RT3A 4ZTJA 4CZJA 2P51A 2ETJA 3DLRA 3U9ZA 1ZBLA 2QTDA 3ZETB 4DR7K 4IOCL 2P9UA 1LCUA 3SAGA 4DFKA 1QSSA 1NM1A 4FJJA 3AA5X 3DAWA 2XY8A 4Z4CA 4LFAK 1NK6A 3AY9A 4DR5K 3ZT0A 4FJIA 1YTAA 3E9LA 3KK3A 1KLNA 2P9NA 2YNFA 3VF6A 1NK5A 5AZJA 2HHQA 4JKGA 3FZMA 1YI2N 3QMLA 3SJHA 3ZT3A 1JLEA 3AO4A 1D5AA 1GOBA 3BUZB 3F73A 3ULDA 3KLHA 2I7PA 1S3XA 4BRQA 3OYFA 1NGIA 2VCPA 1NOYA 4CJRA 5J2PA 3RMCA 4DSIA 1VQON 2KLAA 1YUWA 4V19S 4DG1A 2W6KA 3MEEA 3HVRA 5MLCQ 1M1KO 1C0TA 3C6HA 4GV3A 4FYDA 1C0FA 2Q97A 4CGGA 1D8YA 1ASWA 3CCLN 4B1VA 4BRIA 2FF3B 4BVPA 4CJ4A 1Y97A 1P8ZA 4FJNA 1ZBIA 4DQPA 1Q9XA 4N56A 2UUBK 1VRTA 1NWKA 4NLCA 4JI5K 3IUCA 3C95A 3JAMO 2F9TA 4JKHA 1HJRA 3CM5A 4CF8A 4JRPA 4HWIA 4CZEA 4HUEA 1NKEA 4EZ9A 3O3GA 3LP1A 1TKTA 1VQLN 2A41A 3NBPA 1JKHA 2DTUA 3DJCA 4BWMA 4DTNA 1IBLK 5AQUA 4ELVA 4H0OA 3THWB 5AFUA 3V6DA 2Y1JA 4JKCA 1HRHA 3CCVN 3KTQA 4FPAA 4BY9C 2O8BA 4C1NK 4E7IA 3T19A 3CPWM 3J7AP 2ZF5O 3RMDA 4NCBA 3KK2A 3GDQA 3WXJA 2JGUA 4DQIA 1X9SA 1CZ9A 5I3UA 1VSDA 2GELA 2HOEA 1NMNA 3UKRB 3OYHA 2IVOA 4CBXA 5AQRA 3CMAN 1NGJA 4B3TK 5SZTA 2HVIA 3BF3A 4JI6K 3T1HK 1LW2A 2P9LB 5AQNA 4B1UB 4Z4FA 2AP1A 2E20A 3VEYA 3ZX3A 4YOXA 3BY5A 3HXMA 4JD2A 3G6EN 3R9PA 4DSEA 4FLYA 1KSPA 2O8DA 3A5OC 3OYMA 2G8UA 4KTWA 5C25A 3AO3A 4CECA 4B9SA 2YHBA 3E66A 3HSCA 5FRMA 3UE5A 3ID6A 4FSVA 1RTJA 4C8LA 3CFOA 5FLXO 4HCCA 4PKGA 4R5PA 3OYLA 4CFAA 4UQGA 3MK6A 4X62K 4CJEA 1IKWA 3T7ZA 3L2QA 1Q81O 5EY4A 2VWJA 4ELUA 1NU0A 3R6MA 3GG4A 4MO4A 3MCPA 3KZBA 3K5MA 1QVGM 4CGHA 4DMNA 5BRFA 3THXB 1SV5A 2GBZA 3ISNC 4K25A 1NJWA 4O44A 4FJXA 3A0IX 2OANA 2OYQA 1FK9A 1RTDA 4RW8A 3AV9A 3CMEN 1KQSM 5F0XA 3LDOA 4DV5K 1JLAA 1W0HA 4BRHA 4CVNE 1ZYQA 3EE9A 1BGXT 1XI1A 1VQKN 4OX9K 3QLHA 4BE1A 2P9IA 1Z05A 1GLLO 2QWNA 2YI1A 4CIFA 5FPEA 4H0VB 1D4XA 1C0MA 1OH8A 1RFQA 4WF9L 3CCUN 3FLCO 3TANA 2O8BB 1TL1A 2IAJA 1KAXA 3ALYA 2HNDA 3DMJA 1FXXA 4AHTA 4DU3A 1NKBA 4JEPA 4EFHA 3ATUA 2OPSA 3ZYYX 5SWMA 4BRKA 2G8FA 1YAGA 4B8CA 2KQ2A 4GKKK 2W6LA 1WUAA 4W5OA 3K9KA 2A40A 5M1FA 3QO9A 4RW6A 3VEWA 4M3WA 3FFKB 4FWLA 2WTUA 4KB0A 3RSEA 4LD0A 4E7KA 3UKUA 4HVJA 1GLDG 1NGFA 4YOTA 1KAZA 1U2VA 3MN7A 2O8DB 5AZIB 4EHUA 4CJ7A 3KD5E 3M6GA 3ZT1A 4WQ5C 2G8VA 3SUQA 4YY3K 2A1SA 4DTMA 3LAKA 4IDHA 2FSKA 3CYMA 1X9WA 4CJQA 3IDHA 4OPJA 1K9MO 2UXCK 1ZBUA 3O6WA 3QEWA 3A2FA 4CCHA 1BL3A 2IIRA 1MU2A 5B8HA 3ZSXA 2F4VK 3TI0A 3CI5A 3HI0A 3CCJN 3PX0A 4B3SK 5HRSA 3H46O 5JLFA 4WFNL 5HOOA 2YJFA 1JXBA 1WLJA 1RT1A 2BDPA 1Z6RA 3OYDA 3ID8A 3OTOK 4H4MA 1LOTB 3QB0A 3C65A 4CF1A 4DF8A 3SI6A 2XHBA 3O1WA 2O8FA 5BN9A 3BZCA 5AQKA 3NF6A 3ULEA 1GLAG 3M3ZA 3HP6A 3SAFA 1K8AO 1TUYA 2HHWA 3O4QA 4GKJK 4WFBL 2NLXA 1X1PA 3L2VA 1WSGA 3HT3A 4ZHRA 3QINA 1NNEA 3UB5A 3AA4A 4RCHA 3V4IA 2HHTA 4JKFA 3E1YA 1TKDA 1RT2A 5FPDA 2O8EB 2Q1NA 1EQYA 3K59A 1L3VA 4LF8K 4CHQA 4R79A 5ADXH 5CYQA 3ATVA 5KPTA 1GOCA 1BA1A 3OW2M 3SQ2A 4IJNA 3MWTA 4BGBA 5HL7L 1K8KA 3AAPA 3PSFA 1KTQA 4DFPA 3ZLJA 4GMJB 4JI7K 4DV3K 2Z1JA 3AO5A 1XMQK 1JLFA 2QWOA 1VSIA 3HTVA 3FR0A 3LL3A 4CF0A 4KHUA 4DUZK 1WSHA 2ZE2A 3AVGA 4AF1A 3I0RA 3O1BA 4B1XB 2FLOA 3LWMA 2IVPA 3J8AA 1FKOA 1HNIA 1BHLA 5GIPA 3OVNA 2A3ZA 2IDOA 2P9SB 3KLIA 1RT6A 3C6TA 3TARA 4K42A 3I8DA 1G99A 1JLGA 5HRRA 4RW7A 4UY8O 3AVIA 1NGDA 3EEQA 3HK2A 3V9SA 1KC8O 4YDUC 1TUUA 2O8CA 1IKXA 3TAFA 1WBBA 3C0BA 1L3SA 1VQ7N 4IBNA 4ZTFA 1N33K 2QWQA 3U9DA 3FZFA 3NCIA 4AILC 3D2FA 3P1GA 3HOTA 3OYIA 3QNNA 4DV7K 1N6QA 3QBXA 3TPQA 1E3MA 3THYA 1RBRA 3ZCMA 1JLBA 4I6MB 4DSLA 5FPNA 2JLEA 4FWKA 4E1MA 1RDAA 5DM6L 4KTQA 3AGKA 3SAHA 1I94K 3DXMA 2P5OA 4FPBA 3V9WA 1WSFA 4XH1A 2HVHA 1IBMK 2UYTA 2YHWA 4A5AA 1IG8A 4FLWA 4PKIA 3CQYA 3IRXA 2D0PA 3SPYA 4DHYA 1BQMA 2Z1IA 1KLMA 3SCXA 3WQTA 4F3TA 1SL0A 2RKIA 2KKZA 3K0SA 3VEVA 4CJKA 3PO5A 1RDDA 3O5BA 4B9QA 5CE3A 3V9XA 4JKEA 3H1VX 5I42A 3OYGA 1T05A 3ZEUA 4CERA 3AO1A 3DRSA 4O0JA 4GNIA 3SMSA 2E1ZA 4W5QA 4CHNA 1KVBA 2ZGZA 1BA0A 2FSNA 1YF5L 3O08A 4OLAA 1QSLA 4J2AA 1VQPN 3ZSYA 3P38A 1CXUA 4OGCA 4CIEA 3U3GA 5FPMA 5AQMA 3JYTA 3QEVA 2ASPA 4ISEA 3AVBA 3PY8A 4FJGA 3DLEA 2OTJN 2H3GX 1KVAA 4ID5A 3TSUA 4N76A 2UXDK 2VG5A 3CETA 3TU5A 2Q36A 1WN7A 3LPUA 4JAXA 1DLOA 1NJIO 2DFEA 4MDBA 1HLUA 5JS1A 4H5TA 4I2QA 1NG9A 3CJ9A 3DLGA 2P9PB 2KZMA 3SUPA 3CJBA 2WUSA 2EWSA 1NBWA 1JJ2M 1ZC6A 2AA4A 3MECA 5D3GA 5JS2A 1ZBHA 1C1AA 3LDQA 4FWQA 5ELZA 4BDZA 3G4SN 1N5YA 4PQUA 3NH2A 1S6QA 2WC9A 3T1YK 3O4WA 4CZGA 4BWJA 2PAVA 1MDUB 1GLFO 5AQTA 1SUQA 4IJAA 1HR0K 2G8HA 5FRNA 3VF4A 5KRSA 3CC7N 4C8OA 3MCAB 2PY5A 4YFUA 3LP0A 4ILHA 3VOVA 4A61A 1NMDA 1E4FT 4H5VA 3O3HA 4DV4K 1TGOA 1JCGA 4EP5A 2ZWHA 4DS4A 3NVKA 1S22A 5M1QA 1VHXA 4CJUA 1VQ4N 1TVRA 3D6RA 4RTFD 4H8KA 3PX6A 1SKWA 4CJSA 4E3SA 1XMOK 1GLCG 4X66K 3S3MA 2NUBA 4CFCA 3L4IA 2BUPA 3VQDA 1HQUA 1J6ZA 5KGWA 1LAVA 4E0DA 4KO0A 1W7AA 2D0OA 2NRXA 3O9TA 4H03B 4FK2A 3MN6A 3CPEA 3D7EO 1ZBFA 4NB4A 5KGXA 1BO5O 3MEDA 3ENOA 3KWGA 4K8ZA 1ITGA 1NGBA 4M63C 3SUOA 2VWKA 3MXJA 3QERA 1S1UA 1IO2A 5JMVA 4E19A 4WCEL 3LPTA 3RRHA 4LFBK 3QICA 1BI4A 2YV0X 1T6DA 3K57A 1TV6A 4IOAL 2CH5A 4B3OA 2PFUA 3EE8A 1RBTA 2E2QA 4IWVA 1NK8A 3VGMA 3L8BA 1HNXK 5JICA 2CH6A 1FJGK 5C12A 4MO5A 4E7JA 5BR9A 1WBDA 4HTUA 4NCAA 3JS6A 3OYBA 4FW1A 2E5LK 3AVMA 1OH7A 4KKOA 3MX5A 4BRGA 1NJYA 3SQ4A 3MMVA 4PL7A 2IC3A 3I0SA 5BPNA 5GAHP 3S3OA 4W5TA 3VMFB 2NRZA 3U4LA 4DS5A 1J9AA 4DTRA 4L8RB 1LW0A 4CEDA 4CE9A 3T69A 3CCRN 3SYZA 3KD1E 3VETA 4J2DA 4B1ZA 2ZD1A 2YJEA 3L2UA 2Q0UA 3V9ZA 1RILA 2UU9K 2XRIA 5DM7L 4CGJA 1RBVA 3EKUA 1TYQB 2GWKA 2EHGA 2OPQA 1NK4A 4BC3A 2I5JA 2Y1IA 2D4WA 5AJ3K 4LF9K 3E9PA 3DXKB 4KH6A 4B3MK 5BRHA 1HKCA 4J8FA 2ZJRL 4CZHA 1NGCA 2HBJA 4A57A 1VSFA 1CZBA 1HQEA 1H1VA 4WFAL 4O0IA 3PV8A 2P9UB 5HP1A 4LF5K 4U67L 4JYAK 3P31A 3CFPA 1T6CA 4A59A 1SS6A 1IKYA 2NRTA 5HRNA 3NGZA 2HMIA 3QFPA 3BDPA 3A5MC 1YJNN 2P9NB 1BWFO 4DQ8A 3TSPA 3NFAA 4DTXA 5AZJB 3WNFA 4JLHA 3FGUA 4FJKA 3CQXA 2NRRA 3CD6N 4JKGB 1OKJA 3GBTA 2AJQA 5J2NA 1HYZA 1VQ9N 2YCHA 3VQPA 4FZZA 1RDWX 1UAXA 1BI4B 1A5WA 3RTVA 2QWRA 5M1KA 1XC9A 4YHHK 1ESVA 3NGIA 5DMRA 4TSXA 3WEEA 4YDUA 3ZSQA 4CEFA 2FC0A 4DTOA 3J7YP 4OPHA 2Z1HA 5BR8K 3PUFA 4LSLA 2QXLA 4BACA 4M3XA 1J5OA 3VN5A 3ZX0A 1CXQA 2G8IA 1HMVA 1XHXA 5A2QO 5J2MA 4LF7K 4FWOA 2QI2A 3AVLA 2HHUA 1BCMA 3QIOA 3SMPA 5E41A 1NK0A 1HYSA 4OVLA 1HUXA 1U04A 3CG7A 1N8RO 4KHSA 4Z4HA 3SQ1A 4DCHA 3CJ7A 3O9RA 4K41A 4BR0A 2QWLA 4F3OA 3CIPA 2PYLA 4PY5A 2QA4N 4DWIA 1BCOA 4WQ4C 3RMAA 4LY7A 2HHVA 4CEAA 4EHTA 1OVYA 5KPRA 3VQAA 3ITHA 2RN2A 4GW6A 5KI6A 3FE1A 4CK3A 1DT9A 3TAEA 4BVOA 2OPRA 4U7BA 2B6AA 4FOIA 2ZJQL 5AQVA 3SJJA 1Z26A 1Q8IA 4GV9A 1ILYA 5KPZA 4OKKA 4XH5A 2HHSA 5JVHL 3SV3A 4JKBA 3CCEN 1CLQA 3C7NA 1GLBG 4NCGA 4JK9A 3VGKA 4K8XA 2A1RA 1MWMA 4OKEA 5FDLA 2YHYA 3KIOA
chains in the Genus database with same CATH topology
2UXCK 4V19S 1XNQK 4CW7B 5FLXO 1HNWK 4X62K 2F4VK 2VQEK 2UXDK 4B3SK 4LFBK 1N36K 4DV2K 2UUBK 1N34K 5LL6Z 4JI5K 4YHHK 4K0KK 2UUAK 3JAMO 3OTOK 4JI3K 1N33K 2UUCK 1HNXK 3J81O 4DR4K 2HHHK 3J7YP 1FJGK 5BR8K 5LMUK 4JI0K 2VQFK 4DV5K 2E5LK 4CVNE 5IWAK 4X65K 4DV7K 4OX9K 4JV5K 5IT9O 4DR3K 4LFCK 4GKJK 1J5EK 1IBLK 5LMNK 5A2QO 4LF7K 4DR1K 1I94K 4DR2K 4AQYK 4NXNK 3T1YK 1IBMK 4NXMK 4JI1K 1XNRK 4X64K 3J7AP 1HR0K 4LF8K 4DR7K 4DV1K 4KHPK 4B3RK 2UU9K 4JI4K 4DV0K 4LFAK 1IBKK 4DV4K 4GKKK 4DR6K 2UXBK 4DR5K 4B3TK 4JI7K 4LF9K 4DV3K 3T1HK 5AJ3K 4JI6K 1XMQK 4B3MK 4LF4K 4DUZK 4LF6K 1XMOK 1N32K 4JI2K 4X66K 4JI8K 3J80O 4LF5K 1HNZK 4DV6K 4JYAK 4YY3K 4DUYK 2ZM6K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC K;  4V19 S;  1XNQ K;  4CW7 B;  5FLX O;  1HNW K;  4X62 K;  2F4V K;  2VQE K;  2UXD K;  4B3S K;  4LFB K;  1N36 K;  4DV2 K;  2UUB K;  1N34 K;  5LL6 Z;  4JI5 K;  4YHH K;  4K0K K;  2UUA K;  3JAM O;  3OTO K;  4JI3 K;  1N33 K;  2UUC K;  1HNX K;  3J81 O;  4DR4 K;  2HHH K;  3J7Y P;  1FJG K;  5BR8 K;  5LMU K;  4JI0 K;  2VQF K;  4DV5 K;  2E5L K;  4CVN E;  5IWA K;  4X65 K;  4DV7 K;  4OX9 K;  4JV5 K;  5IT9 O;  4DR3 K;  4LFC K;  4GKJ K;  1J5E K;  1IBL K;  5LMN K;  5A2Q O;  4LF7 K;  4DR1 K;  1I94 K;  4DR2 K;  4AQY K;  4NXN K;  3T1Y K;  1IBM K;  4NXM K;  4JI1 K;  1XNR K;  4X64 K;  3J7A P;  1HR0 K;  4LF8 K;  4DR7 K;  4DV1 K;  4KHP K;  4B3R K;  2UU9 K;  4JI4 K;  4DV0 K;  4LFA K;  1IBK K;  4DV4 K;  4GKK K;  4DR6 K;  2UXB K;  4DR5 K;  4B3T K;  4JI7 K;  4LF9 K;  4DV3 K;  3T1H K;  5AJ3 K;  4JI6 K;  1XMQ K;  4B3M K;  4LF4 K;  4DUZ K;  4LF6 K;  1XMO K;  1N32 K;  4JI2 K;  4X66 K;  4JI8 K;  3J80 O;  4LF5 K;  1HNZ K;  4DV6 K;  4JYA K;  4YY3 K;  4DUY K;  2ZM6 K; 
#chains in the Genus database with same CATH topology
 3SBG A;  2HHX A;  1QZ6 A;  2PYJ A;  4C23 A;  3DLB A;  4W5R A;  2Q3S A;  3IS9 A;  4ISG A;  1SZ2 A;  3QDK A;  4XEI A;  3ZT4 A;  3CCS N;  4JD2 B;  1FW6 A;  4C8N A;  1VK0 A;  3EZ5 A;  1LV5 A;  3HVT A;  4LH5 A;  4MFB A;  3F5T A;  3N4P A;  2QK9 A;  4DV2 K;  4FJ8 A;  1A5V A;  4Z4G A;  1SL2 A;  2IGI A;  2E8A A;  3G71 N;  3PSI A;  3K5L A;  5K14 A;  3HPO A;  3V9U A;  4DR4 K;  5EX5 A;  4H5R A;  4FZY A;  3WNH A;  1VQ6 N;  3V1Q A;  3Q7B A;  4X65 K;  4FJH A;  4BRP A;  4IEI A;  4E7L A;  2X6N A;  1HJO A;  5F1X A;  3KHY A;  4ILG B;  1QTM A;  3CFR A;  3D2E A;  1S1W A;  1T3V A;  4KI6 A;  3MAQ A;  1BIZ A;  3DYA A;  4CBU A;  3HOS A;  2OCE A;  2D5R A;  3J7Z O;  3LDS A;  4NXM K;  4AH9 A;  3LAM A;  2FBX A;  4IG0 A;  3A8Y A;  3SNN A;  2V7Z A;  3P83 D;  5C10 A;  4AM6 A;  4KHP K;  5CZ1 A;  4CZM A;  3SZ2 A;  2YNI A;  4J2E A;  3WNE A;  3KKR A;  1KAY A;  3CF5 L;  2P9I B;  3K5N A;  2B5J A;  3EO3 A;  3KLG A;  3ZT2 A;  3KK7 A;  4Q5V A;  2QKB A;  3ENB A;  4CHP A;  4BR9 A;  4NYF A;  3MDQ A;  3EZW A;  4DQR A;  2GUI A;  5E84 A;  3VQ7 A;  1X3N A;  2E6M A;  5GIN A;  4JNE A;  4JS4 A;  3D0P A;  1T03 A;  3F2K A;  4EZ6 A;  1RDC A;  4CI6 A;  4BRA A;  1JLC A;  3OYA A;  4JHD A;  5EXW A;  4FM0 A;  1YJW N;  3NE6 A;  1WSE A;  4FVM A;  3B6P A;  4HCB A;  4KBO A;  4E1N A;  1LWC A;  4DFM A;  2A6A A;  3RSE B;  1U45 A;  3WNG A;  4F2R A;  1KD1 O;  3UKU B;  4EAH D;  4QCL A;  4WE1 A;  1JL2 A;  1NGE A;  4LC9 B;  1VAZ A;  4FCY A;  1S1X A;  1U2V B;  4BRM A;  1Y64 A;  2VYP A;  4IFV A;  4O8U A;  3O8M A;  4IO8 A;  4Y0W A;  1S9G A;  5EOY A;  4IOX A;  3W0L A;  3S9H A;  3GOI A;  3A5L C;  3M8S A;  3QEX A;  2UUC K;  4JRQ A;  3G0Z A;  3O3F A;  3NHG A;  5AQF A;  3CC2 N;  4FLX A;  4BQL A;  1KFD A;  4ID1 A;  1C0G A;  4CK2 A;  1NOZ A;  3QIP A;  4DLE A;  3HPG A;  3S41 A;  4CES A;  3NVM A;  3RRG A;  2OZS A;  4OPK A;  4FJ5 A;  2V51 B;  1WNS A;  1D9D A;  4O4G A;  1TK0 A;  3RWU A;  5J2Q A;  1JLQ A;  3WXK A;  3QET A;  2O8F B;  1BDG A;  1YT3 A;  2D0B A;  4I7F A;  5J1E A;  4ILJ A;  3MN5 A;  3ULE B;  2KZZ A;  4DV1 K;  3OYK A;  2ZGY A;  5KQ8 A;  1W2B M;  3LAN A;  3NH1 A;  3JSM A;  4DV0 K;  1QHT A;  1HX1 A;  3AA3 A;  3Q7C A;  1EP4 A;  2BTF A;  3MWP A;  2W40 A;  2FBV A;  1B92 A;  3VEN A;  5KTQ A;  4E7H A;  1X9J A;  3I56 N;  3TWH A;  4IFE A;  2YHA A;  4MQ3 A;  3VF2 A;  3HJF A;  2P9K A;  4ICL A;  4I9L A;  4PHT X;  3TAQ A;  2O4I A;  3HP9 A;  1GOA A;  4FWS A;  4DF4 A;  3ZSR A;  2OZM A;  4KHQ A;  3AAQ A;  1S1V A;  5F2R A;  1NGA A;  4DQQ A;  4B9N A;  5HRO A;  1K8K B;  4DUY K;  4L3Q A;  2ZM6 K;  3MN9 A;  4XH4 A;  4DTJ A;  3LWL A;  1HKG A;  1WAF A;  1HPM A;  3I8B A;  2HBM A;  1SKS A;  3HL8 A;  4BRL A;  2HMP A;  2HNZ A;  2IS3 A;  5AQX A;  4BC2 A;  1EWR A;  1SL1 A;  4DTU A;  4AHU A;  4CZF A;  3VQ6 A;  1N36 K;  1QQO A;  3HRG A;  2D1K A;  4BR7 A;  1RNH A;  3O9U A;  3LZI A;  2UUA K;  4DLG A;  2YX6 A;  4C8M A;  1C1C A;  2ZQB A;  3J81 O;  4FJ9 A;  2VG6 A;  4DTP A;  1DGK N;  2OPP A;  3NF8 A;  2DPN A;  3ZET A;  4FW2 A;  5LMU K;  3EYZ A;  1XWL A;  3K2P A;  1HKB A;  3QEP A;  3ZX2 A;  1IKV A;  2W41 A;  1LWE A;  3QES A;  3EKS A;  4LFC K;  3K58 A;  2BAN A;  1J5E K;  5LMN K;  5BN8 A;  4E1J A;  2O8C B;  4PA1 A;  1MWK A;  4F8R A;  4GVM A;  1VQ8 N;  3L6Q A;  4CBW A;  5ADX A;  2ZJP L;  4BDP A;  3LDP A;  1XNR K;  4X64 K;  4M3T A;  4FLU A;  5AFU H;  1SAZ A;  4F4K A;  3VA3 A;  3OJU A;  5E26 A;  3D2F B;  4BE2 A;  1ATS A;  1T7P A;  1WSJ A;  4HUG A;  1BG3 A;  3T3F A;  2KHO A;  4AHV A;  3TAB A;  1QZ5 A;  4KTZ A;  3THY B;  4A62 A;  3I33 A;  1WOQ A;  3P4I A;  5CR4 A;  4DR6 K;  3TAG A;  1FKP A;  4FM2 A;  3QEI A;  4XIU A;  4KV8 A;  1VSL A;  2QKK A;  3DXM B;  3JXU A;  1W9H A;  2IOC A;  4RW4 A;  1VSJ A;  1NGH A;  1VSH A;  1GLJ O;  2HBL A;  2HST A;  4IXC A;  4CK1 A;  4JS5 A;  1U4B A;  3R8E A;  3OS1 A;  4RWT A;  4JI2 K;  4JI8 K;  5TKY A;  2WON A;  4KH4 A;  5LJV A;  1M90 O;  3DI6 A;  3DWL A;  4CEO A;  3VQC A;  4O8K A;  1CZA N;  5AQQ A;  3F9K A;  4BR5 A;  3HM9 A;  1XNQ K;  1XQS C;  4QOZ B;  3VQ9 A;  1XC3 A;  5EVZ A;  3ZEU B;  1U47 A;  2HBK A;  3PLA A;  2FSJ A;  2DFH A;  3NDK A;  1QQN A;  2V52 B;  3RR8 A;  3HPH A;  4B8A B;  2XY7 A;  4DSF A;  3EY1 A;  4N41 A;  1MA9 B;  2ITG A;  4YOW A;  1JXE A;  4OGE A;  4KHW A;  4CJL A;  5LL6 Z;  1QQM A;  3ENH A;  4K0K K;  2OA8 A;  4GY2 B;  3TR8 A;  5JLH A;  4AM7 A;  3OA9 A;  4BC4 A;  3TAP A;  4PWD A;  2VQF K;  5IWA K;  3CJA A;  4WQ5 A;  1HNV A;  2E2P A;  3DLL L;  1X3M A;  3UKR A;  4QS7 A;  3H45 C;  2QM1 A;  3AGR A;  4H5N A;  3NGY A;  1VQ5 N;  3MX2 A;  4CD3 A;  4E89 A;  4FJL A;  3SBT A;  4DR1 K;  4DR2 K;  3KLF A;  4BRC A;  2P9L A;  4AQY K;  1U48 A;  4QAG A;  1ZXO A;  3RMB A;  4W5N A;  1BOT O;  4CFB A;  4CEE A;  4CJ3 A;  4CJ5 A;  4MLH A;  5BRD A;  1RT4 A;  1U6Z A;  2XO7 A;  2RF2 A;  4QS9 A;  3W3D A;  4B9M A;  4H0X B;  4OJR A;  3TTD A;  3V1R A;  4B3R K;  3OYJ A;  3E9O A;  5GAG P;  4FJ7 A;  1XHZ A;  1SQK A;  2XY5 A;  2UXB K;  4CEQ A;  1B9F A;  4BRN A;  4H0T B;  4PKH A;  1C0U A;  3OS0 A;  3FZL A;  1O1W A;  5T7B A;  3AVJ A;  3PIP L;  1Q82 O;  3WQU A;  4Z0U A;  2F96 A;  5HBM A;  2ATQ A;  1UWB A;  1Q9Y A;  3CER A;  3C94 A;  1Q7Y O;  5AQP A;  1ASV A;  4H4O A;  2ASM A;  3LAL A;  2QEX N;  4AHC A;  4JKA A;  5JVG L;  4H5W A;  3VQE A;  1HNZ K;  4DV6 K;  3U3Y A;  3O80 A;  5GAE P;  1JCE A;  3THX A;  5AQG A;  4M3Z A;  3VQ4 A;  3G10 A;  1S1T A;  4MDA A;  4C8K A;  3AVH A;  4CJT A;  2OTL N;  4CW7 B;  4B9V A;  4MLE A;  3R1X A;  3QNO A;  3O4N A;  2CGK A;  3NH0 A;  4PUO A;  4YNQ A;  4WYB A;  2WFB A;  2VQE K;  4N5S A;  4CJP A;  3B6O A;  2YNG A;  4FWR A;  3MXI A;  1G15 A;  2W42 A;  5AR0 A;  2R7Y A;  5AQO A;  3HYF A;  4DSK A;  3O9Q A;  5CHI A;  3CXC M;  1ATR A;  2NRV A;  4QS8 A;  2D0A A;  1V4T A;  3OS2 A;  3LM9 A;  4NLB A;  2FXU A;  2RPI A;  4DB3 A;  4JI0 K;  3TTF A;  4O55 A;  5C0Y A;  3VQQ A;  3WT0 A;  3SPZ A;  3F9M A;  4EIA A;  5HRP A;  4FLT A;  1S6P A;  3PX4 A;  4FK4 A;  3MXM A;  3LP3 A;  4NXN K;  3ZSO A;  2EX3 A;  3KLE A;  3HST B;  4JI1 K;  4BR4 A;  2YNH A;  2F8T A;  5AZI A;  3CQ8 A;  3N4Q A;  1D9F A;  2PBD A;  4CJV A;  3P5J A;  2B4J A;  1YIJ N;  3M1F A;  3BF1 A;  4M3R A;  4Z4I A;  4YOY A;  4Z4E A;  3RVC A;  2KFN A;  2F7T A;  4M45 A;  2DY4 A;  3K5O A;  4DFJ A;  2WBN A;  5TKW A;  2RE2 A;  3TTC A;  1S72 N;  3C6A A;  2VG7 A;  5BPL A;  2FBY A;  4CF9 A;  2FF6 A;  5M1O A;  1TAU A;  5KQD A;  1NLV A;  4LH4 A;  3VER A;  1C6V A;  4O5B A;  5LY3 A;  2HB5 A;  5AQS A;  4KI4 A;  4M7X A;  3DRP A;  3OYE A;  3AVC A;  3UIQ A;  4KRF A;  5GIO A;  3O9S A;  1NGG A;  1RDB A;  1R0A A;  1A5X A;  4Y1D A;  2QWM A;  1UA0 A;  3HO1 A;  4I2P A;  2Q2R A;  4BG9 A;  1RTH A;  2DFF A;  3VQ8 A;  4CIG A;  4C1N I;  2KFZ A;  3BZK A;  2E4L A;  4DU4 A;  1YJ9 N;  1I39 A;  5BPM A;  3L2R A;  3NF7 A;  1ASU A;  4FOE A;  4F9O A;  1YHQ N;  3IFR A;  4G9Z A;  1WAJ A;  3OYN A;  1QE1 A;  5AQJ A;  1L5U A;  4LSN A;  4KH5 A;  1C1B A;  3VQ5 A;  3GL1 A;  3OBY A;  2NRW A;  4G1Q A;  1N34 K;  1KFS A;  1Q86 O;  3DLH A;  1ATN A;  5H1S Q;  3CCQ N;  1RCH A;  2O8E A;  2V7Y A;  4IDK A;  4CGF A;  4IG3 A;  4YOR A;  1KRP A;  4KHY A;  2X78 A;  4B08 A;  3K9J A;  4I9Q A;  3FFI A;  1IJJ A;  3G25 A;  4B9L A;  4CHO A;  1DTT A;  1ZBS A;  1Z25 A;  3R3L A;  1T8E A;  3CCM N;  4ELT A;  1T44 A;  3VQB A;  4BQZ A;  3IMX A;  2G8K A;  4KRE A;  3AA2 A;  4B1Y B;  1OVQ A;  4FXD A;  3OY9 A;  3PO4 A;  4J2B A;  2NNW A;  1TAQ A;  1QVF M;  1NK9 A;  4CEB A;  3SQ0 A;  1JCF A;  3S3N A;  3SUN A;  3V1O A;  3L4Q A;  1NJZ A;  5CZ2 A;  3WEE B;  4DTS A;  3OHR A;  5BRE A;  3H6E A;  2GWJ A;  4K43 A;  1RGI A;  5CYM A;  1QHA A;  4B9U A;  2HF4 A;  3VTI A;  2P9S A;  1IH7 A;  4KFB A;  1QQC A;  4OLB A;  3WXL A;  4M3U A;  4BRD A;  4CZL A;  3CC4 N;  4M42 A;  3DM2 A;  4CEZ A;  4IZ9 A;  1S5J A;  1L3U A;  2F8S A;  3AAR A;  3OJS A;  1IV0 A;  3D45 A;  3VTH A;  1RBU A;  4H0Y B;  4LF4 K;  1BU6 O;  3AVN A;  3MEG A;  4LF6 K;  1K6Y A;  1EET A;  4JN4 A;  4B9T A;  3GE1 A;  2BH1 A;  3OBW A;  3QBW A;  3J80 O;  1EWQ A;  4KAZ A;  2VGM A;  4OKJ A;  1UA1 A;  4CGI A;  4IKF A;  1E4G T;  3H1Q A;  2E2N A;  3ASM A;  4DKW A;  3KVG A;  5M1N A;  1VSE A;  1S9E A;  1HNW K;  3L3U A;  1YVN A;  4O5F A;  4FK0 A;  4I6M A;  4RW9 A;  4EP4 A;  4M3Y A;  2HF3 A;  5C42 A;  5GAD P;  4PL8 A;  1TKX A;  4AHS A;  2JWL A;  2IVN A;  4FWM A;  2LSN A;  2P1J A;  3C7N B;  1KCF A;  4CZI A;  4Y1C A;  4BR2 A;  2E1Y A;  4JI3 K;  2HHH K;  3U6F A;  3LM2 A;  2KTQ A;  2J4R A;  3VES A;  2PZS A;  5KRT A;  2O4G A;  2QW9 A;  3AVK A;  1F21 A;  4JV5 K;  4YOV A;  3L0Q A;  4DR3 K;  3U8X A;  4FZX C;  1HYV A;  3IG1 A;  3THV A;  2WOM A;  1TK5 A;  3WUH A;  3RR7 A;  1RTI A;  3L3V A;  3DRR A;  2A5X A;  1BIU A;  2GX9 A;  1WB9 A;  4YOU A;  4JKD A;  4GVE A;  1YIT N;  1KXP A;  4A5B A;  4JI4 K;  3PIO L;  1XUP O;  3VPZ A;  1REV A;  3L2W A;  5AQL A;  4FWP A;  1EXQ A;  3D2E B;  3AVF A;  1VRU A;  3HBT A;  1EKE A;  1EO1 A;  3A5N C;  4FVU A;  2A42 A;  3I55 N;  3LDN A;  4Q0B A;  2JWK A;  4NYN A;  1YTU A;  2I7N A;  5LJW A;  2CGJ A;  3KJV A;  1YVU A;  4HHT A;  3P39 A;  3TAM A;  1BIS A;  1VQN N;  1X9M A;  2QXF A;  3T1A A;  5FRO A;  1J53 A;  3NMU A;  2NRH A;  1VQM N;  4N47 A;  4BDY A;  2GV9 A;  1RDU A;  1BQN A;  2VGN A;  3VEO A;  2P9P A;  1GLE G;  1RT5 A;  1YXQ A;  5AQZ A;  2D0C A;  2Q31 A;  2HNY A;  3ZSZ A;  4IFY A;  3VEX A;  3SV4 A;  3IAY A;  1UOC A;  3LDL A;  1O13 A;  3SK3 A;  3H3N O;  1W97 L;  4A2A A;  4AHR A;  1QSY A;  3SLC A;  2X74 A;  3DLK A;  4CHY A;  2ASO A;  1P90 A;  2KW4 A;  1RT7 A;  1DTQ A;  2FBT A;  4JHD B;  3M5R A;  1LAW A;  4FJM A;  2GEM A;  4JK7 A;  5M1P A;  3ZSW A;  4IO9 L;  4FWN A;  3KKS A;  1J54 A;  4M7Y A;  3HZ6 A;  4CF2 A;  3OYC A;  1U49 A;  1QS4 A;  4BGA A;  4DU1 A;  3BEX A;  5AQY A;  3WXI A;  3QFU A;  5AQH A;  3DOK A;  5AQW A;  4BG8 A;  1OH5 A;  3M8Q A;  3AO2 A;  3VGL A;  4CZK A;  4OO1 J;  2G8W A;  1TL3 A;  1HPZ A;  1LWF A;  3KK1 A;  2Q0R A;  3ZSV A;  3EL2 A;  1OH6 A;  2P5G A;  2GTD A;  2VWB A;  4HTL A;  4RG8 A;  4ISF A;  2E88 A;  5C24 A;  1Q18 A;  4BC5 A;  1RBS A;  5C15 A;  2ITM A;  2RHK A;  1IG9 A;  1IBK K;  4DSJ A;  4BE0 A;  4B1W B;  2X6S A;  1EX4 A;  3B8A X;  3LZJ A;  4Z94 A;  3CJC A;  1NK7 A;  3M8P A;  1BUP A;  4BRF A;  5AQI A;  3FZH A;  4CGD A;  3VA0 A;  1K73 O;  1KVC A;  4FLV A;  2NZT A;  1VSK A;  4IEE A;  4A2B A;  3M8R A;  1N32 K;  5DK5 A;  1NJX A;  3VEZ A;  3NAE A;  1WSI A;  3LP2 A;  3NF9 A;  2CGL A;  5CY4 A;  1VSM A;  3TSQ A;  3HM8 A;  1SKR A;  4CJF A;  4BRO A;  4FM1 A;  3CJ1 A;  4WQ4 A;  1L3T A;  3DOL A;  3EN9 A;  4KB1 A;  3BGR A;  3CHW A;  4CD1 A;  2QWP A;  2YKN A;  2P9K B;  2F9W A;  4HUF A;  4NO7 A;  1V4S A;  3IKM A;  2BE2 A;  4KHN A;  2XY6 A;  3AVA A;  4DQS A;  4JK8 A;  4CJW A;  1TKZ A;  4BRE A;  1I3A A;  3WXM B;  3H08 A;  3FZK A;  2Z1G A;  1NKC A;  1R59 O;  3CM6 A;  4M41 A;  5HLF A;  2BGG A;  3C6U A;  4FL9 A;  4CFD A;  2HW3 A;  4OPA A;  5C2D A;  3E01 A;  1DEJ A;  2E2O A;  2YHX A;  5IT9 O;  3KWI A;  3V81 A;  5EU7 A;  3THW A;  4CHZ A;  4H0P A;  1TYQ A;  2E6L A;  4FLZ A;  5I9E B;  1TK8 A;  4GV6 A;  4KPY A;  1B9D A;  3DXK A;  1JL1 A;  3BP8 A;  4FO0 A;  2YKM A;  3H3O B;  4F2S A;  2GUP A;  5C2F A;  1DKG D;  1RT3 A;  4ZTJ A;  4CZJ A;  2P51 A;  2ETJ A;  3DLR A;  3U9Z A;  1ZBL A;  2QTD A;  3ZET B;  4DR7 K;  4IOC L;  2P9U A;  1LCU A;  3SAG A;  4DFK A;  1QSS A;  1NM1 A;  4FJJ A;  3AA5 X;  3DAW A;  2XY8 A;  4Z4C A;  4LFA K;  1NK6 A;  3AY9 A;  4DR5 K;  3ZT0 A;  4FJI A;  1YTA A;  3E9L A;  3KK3 A;  1KLN A;  2P9N A;  2YNF A;  3VF6 A;  1NK5 A;  5AZJ A;  2HHQ A;  4JKG A;  3FZM A;  1YI2 N;  3QML A;  3SJH A;  3ZT3 A;  1JLE A;  3AO4 A;  1D5A A;  1GOB A;  3BUZ B;  3F73 A;  3ULD A;  3KLH A;  2I7P A;  1S3X A;  4BRQ A;  3OYF A;  1NGI A;  2VCP A;  1NOY A;  4CJR A;  5J2P A;  3RMC A;  4DSI A;  1VQO N;  2KLA A;  1YUW A;  4V19 S;  4DG1 A;  2W6K A;  3MEE A;  3HVR A;  5MLC Q;  1M1K O;  1C0T A;  3C6H A;  4GV3 A;  4FYD A;  1C0F A;  2Q97 A;  4CGG A;  1D8Y A;  1ASW A;  3CCL N;  4B1V A;  4BRI A;  2FF3 B;  4BVP A;  4CJ4 A;  1Y97 A;  1P8Z A;  4FJN A;  1ZBI A;  4DQP A;  1Q9X A;  4N56 A;  2UUB K;  1VRT A;  1NWK A;  4NLC A;  4JI5 K;  3IUC A;  3C95 A;  3JAM O;  2F9T A;  4JKH A;  1HJR A;  3CM5 A;  4CF8 A;  4JRP A;  4HWI A;  4CZE A;  4HUE A;  1NKE A;  4EZ9 A;  3O3G A;  3LP1 A;  1TKT A;  1VQL N;  2A41 A;  3NBP A;  1JKH A;  2DTU A;  3DJC A;  4BWM A;  4DTN A;  1IBL K;  5AQU A;  4ELV A;  4H0O A;  3THW B;  5AFU A;  3V6D A;  2Y1J A;  4JKC A;  1HRH A;  3CCV N;  3KTQ A;  4FPA A;  4BY9 C;  2O8B A;  4C1N K;  4E7I A;  3T19 A;  3CPW M;  3J7A P;  2ZF5 O;  3RMD A;  4NCB A;  3KK2 A;  3GDQ A;  3WXJ A;  2JGU A;  4DQI A;  1X9S A;  1CZ9 A;  5I3U A;  1VSD A;  2GEL A;  2HOE A;  1NMN A;  3UKR B;  3OYH A;  2IVO A;  4CBX A;  5AQR A;  3CMA N;  1NGJ A;  4B3T K;  5SZT A;  2HVI A;  3BF3 A;  4JI6 K;  3T1H K;  1LW2 A;  2P9L B;  5AQN A;  4B1U B;  4Z4F A;  2AP1 A;  2E20 A;  3VEY A;  3ZX3 A;  4YOX A;  3BY5 A;  3HXM A;  4JD2 A;  3G6E N;  3R9P A;  4DSE A;  4FLY A;  1KSP A;  2O8D A;  3A5O C;  3OYM A;  2G8U A;  4KTW A;  5C25 A;  3AO3 A;  4CEC A;  4B9S A;  2YHB A;  3E66 A;  3HSC A;  5FRM A;  3UE5 A;  3ID6 A;  4FSV A;  1RTJ A;  4C8L A;  3CFO A;  5FLX O;  4HCC A;  4PKG A;  4R5P A;  3OYL A;  4CFA A;  4UQG A;  3MK6 A;  4X62 K;  4CJE A;  1IKW A;  3T7Z A;  3L2Q A;  1Q81 O;  5EY4 A;  2VWJ A;  4ELU A;  1NU0 A;  3R6M A;  3GG4 A;  4MO4 A;  3MCP A;  3KZB A;  3K5M A;  1QVG M;  4CGH A;  4DMN A;  5BRF A;  3THX B;  1SV5 A;  2GBZ A;  3ISN C;  4K25 A;  1NJW A;  4O44 A;  4FJX A;  3A0I X;  2OAN A;  2OYQ A;  1FK9 A;  1RTD A;  4RW8 A;  3AV9 A;  3CME N;  1KQS M;  5F0X A;  3LDO A;  4DV5 K;  1JLA A;  1W0H A;  4BRH A;  4CVN E;  1ZYQ A;  3EE9 A;  1BGX T;  1XI1 A;  1VQK N;  4OX9 K;  3QLH A;  4BE1 A;  2P9I A;  1Z05 A;  1GLL O;  2QWN A;  2YI1 A;  4CIF A;  5FPE A;  4H0V B;  1D4X A;  1C0M A;  1OH8 A;  1RFQ A;  4WF9 L;  3CCU N;  3FLC O;  3TAN A;  2O8B B;  1TL1 A;  2IAJ A;  1KAX A;  3ALY A;  2HND A;  3DMJ A;  1FXX A;  4AHT A;  4DU3 A;  1NKB A;  4JEP A;  4EFH A;  3ATU A;  2OPS A;  3ZYY X;  5SWM A;  4BRK A;  2G8F A;  1YAG A;  4B8C A;  2KQ2 A;  4GKK K;  2W6L A;  1WUA A;  4W5O A;  3K9K A;  2A40 A;  5M1F A;  3QO9 A;  4RW6 A;  3VEW A;  4M3W A;  3FFK B;  4FWL A;  2WTU A;  4KB0 A;  3RSE A;  4LD0 A;  4E7K A;  3UKU A;  4HVJ A;  1GLD G;  1NGF A;  4YOT A;  1KAZ A;  1U2V A;  3MN7 A;  2O8D B;  5AZI B;  4EHU A;  4CJ7 A;  3KD5 E;  3M6G A;  3ZT1 A;  4WQ5 C;  2G8V A;  3SUQ A;  4YY3 K;  2A1S A;  4DTM A;  3LAK A;  4IDH A;  2FSK A;  3CYM A;  1X9W A;  4CJQ A;  3IDH A;  4OPJ A;  1K9M O;  2UXC K;  1ZBU A;  3O6W A;  3QEW A;  3A2F A;  4CCH A;  1BL3 A;  2IIR A;  1MU2 A;  5B8H A;  3ZSX A;  2F4V K;  3TI0 A;  3CI5 A;  3HI0 A;  3CCJ N;  3PX0 A;  4B3S K;  5HRS A;  3H46 O;  5JLF A;  4WFN L;  5HOO A;  2YJF A;  1JXB A;  1WLJ A;  1RT1 A;  2BDP A;  1Z6R A;  3OYD A;  3ID8 A;  3OTO K;  4H4M A;  1LOT B;  3QB0 A;  3C65 A;  4CF1 A;  4DF8 A;  3SI6 A;  2XHB A;  3O1W A;  2O8F A;  5BN9 A;  3BZC A;  5AQK A;  3NF6 A;  3ULE A;  1GLA G;  3M3Z A;  3HP6 A;  3SAF A;  1K8A O;  1TUY A;  2HHW A;  3O4Q A;  4GKJ K;  4WFB L;  2NLX A;  1X1P A;  3L2V A;  1WSG A;  3HT3 A;  4ZHR A;  3QIN A;  1NNE A;  3UB5 A;  3AA4 A;  4RCH A;  3V4I A;  2HHT A;  4JKF A;  3E1Y A;  1TKD A;  1RT2 A;  5FPD A;  2O8E B;  2Q1N A;  1EQY A;  3K59 A;  1L3V A;  4LF8 K;  4CHQ A;  4R79 A;  5ADX H;  5CYQ A;  3ATV A;  5KPT A;  1GOC A;  1BA1 A;  3OW2 M;  3SQ2 A;  4IJN A;  3MWT A;  4BGB A;  5HL7 L;  1K8K A;  3AAP A;  3PSF A;  1KTQ A;  4DFP A;  3ZLJ A;  4GMJ B;  4JI7 K;  4DV3 K;  2Z1J A;  3AO5 A;  1XMQ K;  1JLF A;  2QWO A;  1VSI A;  3HTV A;  3FR0 A;  3LL3 A;  4CF0 A;  4KHU A;  4DUZ K;  1WSH A;  2ZE2 A;  3AVG A;  4AF1 A;  3I0R A;  3O1B A;  4B1X B;  2FLO A;  3LWM A;  2IVP A;  3J8A A;  1FKO A;  1HNI A;  1BHL A;  5GIP A;  3OVN A;  2A3Z A;  2IDO A;  2P9S B;  3KLI A;  1RT6 A;  3C6T A;  3TAR A;  4K42 A;  3I8D A;  1G99 A;  1JLG A;  5HRR A;  4RW7 A;  4UY8 O;  3AVI A;  1NGD A;  3EEQ A;  3HK2 A;  3V9S A;  1KC8 O;  4YDU C;  1TUU A;  2O8C A;  1IKX A;  3TAF A;  1WBB A;  3C0B A;  1L3S A;  1VQ7 N;  4IBN A;  4ZTF A;  1N33 K;  2QWQ A;  3U9D A;  3FZF A;  3NCI A;  4AIL C;  3D2F A;  3P1G A;  3HOT A;  3OYI A;  3QNN A;  4DV7 K;  1N6Q A;  3QBX A;  3TPQ A;  1E3M A;  3THY A;  1RBR A;  3ZCM A;  1JLB A;  4I6M B;  4DSL A;  5FPN A;  2JLE A;  4FWK A;  4E1M A;  1RDA A;  5DM6 L;  4KTQ A;  3AGK A;  3SAH A;  1I94 K;  3DXM A;  2P5O A;  4FPB A;  3V9W A;  1WSF A;  4XH1 A;  2HVH A;  1IBM K;  2UYT A;  2YHW A;  4A5A A;  1IG8 A;  4FLW A;  4PKI A;  3CQY A;  3IRX A;  2D0P A;  3SPY A;  4DHY A;  1BQM A;  2Z1I A;  1KLM A;  3SCX A;  3WQT A;  4F3T A;  1SL0 A;  2RKI A;  2KKZ A;  3K0S A;  3VEV A;  4CJK A;  3PO5 A;  1RDD A;  3O5B A;  4B9Q A;  5CE3 A;  3V9X A;  4JKE A;  3H1V X;  5I42 A;  3OYG A;  1T05 A;  3ZEU A;  4CER A;  3AO1 A;  3DRS A;  4O0J A;  4GNI A;  3SMS A;  2E1Z A;  4W5Q A;  4CHN A;  1KVB A;  2ZGZ A;  1BA0 A;  2FSN A;  1YF5 L;  3O08 A;  4OLA A;  1QSL A;  4J2A A;  1VQP N;  3ZSY A;  3P38 A;  1CXU A;  4OGC A;  4CIE A;  3U3G A;  5FPM A;  5AQM A;  3JYT A;  3QEV A;  2ASP A;  4ISE A;  3AVB A;  3PY8 A;  4FJG A;  3DLE A;  2OTJ N;  2H3G X;  1KVA A;  4ID5 A;  3TSU A;  4N76 A;  2UXD K;  2VG5 A;  3CET A;  3TU5 A;  2Q36 A;  1WN7 A;  3LPU A;  4JAX A;  1DLO A;  1NJI O;  2DFE A;  4MDB A;  1HLU A;  5JS1 A;  4H5T A;  4I2Q A;  1NG9 A;  3CJ9 A;  3DLG A;  2P9P B;  2KZM A;  3SUP A;  3CJB A;  2WUS A;  2EWS A;  1NBW A;  1JJ2 M;  1ZC6 A;  2AA4 A;  3MEC A;  5D3G A;  5JS2 A;  1ZBH A;  1C1A A;  3LDQ A;  4FWQ A;  5ELZ A;  4BDZ A;  3G4S N;  1N5Y A;  4PQU A;  3NH2 A;  1S6Q A;  2WC9 A;  3T1Y K;  3O4W A;  4CZG A;  4BWJ A;  2PAV A;  1MDU B;  1GLF O;  5AQT A;  1SUQ A;  4IJA A;  1HR0 K;  2G8H A;  5FRN A;  3VF4 A;  5KRS A;  3CC7 N;  4C8O A;  3MCA B;  2PY5 A;  4YFU A;  3LP0 A;  4ILH A;  3VOV A;  4A61 A;  1NMD A;  1E4F T;  4H5V A;  3O3H A;  4DV4 K;  1TGO A;  1JCG A;  4EP5 A;  2ZWH A;  4DS4 A;  3NVK A;  1S22 A;  5M1Q A;  1VHX A;  4CJU A;  1VQ4 N;  1TVR A;  3D6R A;  4RTF D;  4H8K A;  3PX6 A;  1SKW A;  4CJS A;  4E3S A;  1XMO K;  1GLC G;  4X66 K;  3S3M A;  2NUB A;  4CFC A;  3L4I A;  2BUP A;  3VQD A;  1HQU A;  1J6Z A;  5KGW A;  1LAV A;  4E0D A;  4KO0 A;  1W7A A;  2D0O A;  2NRX A;  3O9T A;  4H03 B;  4FK2 A;  3MN6 A;  3CPE A;  3D7E O;  1ZBF A;  4NB4 A;  5KGX A;  1BO5 O;  3MED A;  3ENO A;  3KWG A;  4K8Z A;  1ITG A;  1NGB A;  4M63 C;  3SUO A;  2VWK A;  3MXJ A;  3QER A;  1S1U A;  1IO2 A;  5JMV A;  4E19 A;  4WCE L;  3LPT A;  3RRH A;  4LFB K;  3QIC A;  1BI4 A;  2YV0 X;  1T6D A;  3K57 A;  1TV6 A;  4IOA L;  2CH5 A;  4B3O A;  2PFU A;  3EE8 A;  1RBT A;  2E2Q A;  4IWV A;  1NK8 A;  3VGM A;  3L8B A;  1HNX K;  5JIC A;  2CH6 A;  1FJG K;  5C12 A;  4MO5 A;  4E7J A;  5BR9 A;  1WBD A;  4HTU A;  4NCA A;  3JS6 A;  3OYB A;  4FW1 A;  2E5L K;  3AVM A;  1OH7 A;  4KKO A;  3MX5 A;  4BRG A;  1NJY A;  3SQ4 A;  3MMV A;  4PL7 A;  2IC3 A;  3I0S A;  5BPN A;  5GAH P;  3S3O A;  4W5T A;  3VMF B;  2NRZ A;  3U4L A;  4DS5 A;  1J9A A;  4DTR A;  4L8R B;  1LW0 A;  4CED A;  4CE9 A;  3T69 A;  3CCR N;  3SYZ A;  3KD1 E;  3VET A;  4J2D A;  4B1Z A;  2ZD1 A;  2YJE A;  3L2U A;  2Q0U A;  3V9Z A;  1RIL A;  2UU9 K;  2XRI A;  5DM7 L;  4CGJ A;  1RBV A;  3EKU A;  1TYQ B;  2GWK A;  2EHG A;  2OPQ A;  1NK4 A;  4BC3 A;  2I5J A;  2Y1I A;  2D4W A;  5AJ3 K;  4LF9 K;  3E9P A;  3DXK B;  4KH6 A;  4B3M K;  5BRH A;  1HKC A;  4J8F A;  2ZJR L;  4CZH A;  1NGC A;  2HBJ A;  4A57 A;  1VSF A;  1CZB A;  1HQE A;  1H1V A;  4WFA L;  4O0I A;  3PV8 A;  2P9U B;  5HP1 A;  4LF5 K;  4U67 L;  4JYA K;  3P31 A;  3CFP A;  1T6C A;  4A59 A;  1SS6 A;  1IKY A;  2NRT A;  5HRN A;  3NGZ A;  2HMI A;  3QFP A;  3BDP A;  3A5M C;  1YJN N;  2P9N B;  1BWF O;  4DQ8 A;  3TSP A;  3NFA A;  4DTX A;  5AZJ B;  3WNF A;  4JLH A;  3FGU A;  4FJK A;  3CQX A;  2NRR A;  3CD6 N;  4JKG B;  1OKJ A;  3GBT A;  2AJQ A;  5J2N A;  1HYZ A;  1VQ9 N;  2YCH A;  3VQP A;  4FZZ A;  1RDW X;  1UAX A;  1BI4 B;  1A5W A;  3RTV A;  2QWR A;  5M1K A;  1XC9 A;  4YHH K;  1ESV A;  3NGI A;  5DMR A;  4TSX A;  3WEE A;  4YDU A;  3ZSQ A;  4CEF A;  2FC0 A;  4DTO A;  3J7Y P;  4OPH A;  2Z1H A;  5BR8 K;  3PUF A;  4LSL A;  2QXL A;  4BAC A;  4M3X A;  1J5O A;  3VN5 A;  3ZX0 A;  1CXQ A;  2G8I A;  1HMV A;  1XHX A;  5A2Q O;  5J2M A;  4LF7 K;  4FWO A;  2QI2 A;  3AVL A;  2HHU A;  1BCM A;  3QIO A;  3SMP A;  5E41 A;  1NK0 A;  1HYS A;  4OVL A;  1HUX A;  1U04 A;  3CG7 A;  1N8R O;  4KHS A;  4Z4H A;  3SQ1 A;  4DCH A;  3CJ7 A;  3O9R A;  4K41 A;  4BR0 A;  2QWL A;  4F3O A;  3CIP A;  2PYL A;  4PY5 A;  2QA4 N;  4DWI A;  1BCO A;  4WQ4 C;  3RMA A;  4LY7 A;  2HHV A;  4CEA A;  4EHT A;  1OVY A;  5KPR A;  3VQA A;  3ITH A;  2RN2 A;  4GW6 A;  5KI6 A;  3FE1 A;  4CK3 A;  1DT9 A;  3TAE A;  4BVO A;  2OPR A;  4U7B A;  2B6A A;  4FOI A;  2ZJQ L;  5AQV A;  3SJJ A;  1Z26 A;  1Q8I A;  4GV9 A;  1ILY A;  5KPZ A;  4OKK A;  4XH5 A;  2HHS A;  5JVH L;  3SV3 A;  4JKB A;  3CCE N;  1CLQ A;  3C7N A;  1GLB G;  4NCG A;  4JK9 A;  3VGK A;  4K8X A;  2A1R A;  1MWM A;  4OKE A;  5FDL A;  2YHY A;  3KIO A; 
#chains in the Genus database with same CATH homology
 2UXC K;  4V19 S;  1XNQ K;  4CW7 B;  5FLX O;  1HNW K;  4X62 K;  2F4V K;  2VQE K;  2UXD K;  4B3S K;  4LFB K;  1N36 K;  4DV2 K;  2UUB K;  1N34 K;  5LL6 Z;  4JI5 K;  4YHH K;  4K0K K;  2UUA K;  3JAM O;  3OTO K;  4JI3 K;  1N33 K;  2UUC K;  1HNX K;  3J81 O;  4DR4 K;  2HHH K;  3J7Y P;  1FJG K;  5BR8 K;  5LMU K;  4JI0 K;  2VQF K;  4DV5 K;  2E5L K;  4CVN E;  5IWA K;  4X65 K;  4DV7 K;  4OX9 K;  4JV5 K;  5IT9 O;  4DR3 K;  4LFC K;  4GKJ K;  1J5E K;  1IBL K;  5LMN K;  5A2Q O;  4LF7 K;  4DR1 K;  1I94 K;  4DR2 K;  4AQY K;  4NXN K;  3T1Y K;  1IBM K;  4NXM K;  4JI1 K;  1XNR K;  4X64 K;  3J7A P;  1HR0 K;  4LF8 K;  4DR7 K;  4DV1 K;  4KHP K;  4B3R K;  2UU9 K;  4JI4 K;  4DV0 K;  4LFA K;  1IBK K;  4DV4 K;  4GKK K;  4DR6 K;  2UXB K;  4DR5 K;  4B3T K;  4JI7 K;  4LF9 K;  4DV3 K;  3T1H K;  5AJ3 K;  4JI6 K;  1XMQ K;  4B3M K;  4LF4 K;  4DUZ K;  4LF6 K;  1XMO K;  1N32 K;  4JI2 K;  4X66 K;  4JI8 K;  3J80 O;  4LF5 K;  1HNZ K;  4DV6 K;  4JYA K;  4YY3 K;  4DUY K;  2ZM6 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...