4LF8K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf8K00
5LMNK 1XNQK 4V19S 4NXMK 4B3RK 5AJ3K 4DV4K 4DR3K 4DR6K 4DR1K 2F4VK 3T1HK 2UXDK 3JAMO 1IBMK 4K0KK 4LFAK 2UXBK 5IWAK 4LF5K 1HNWK 4KHPK 3T1YK 3J7YP 4DR7K 4LFCK 4JI1K 4DV5K 4DV2K 5LMUK 2ZM6K 1HNZK 4B3MK 4CVNE 1HNXK 1N34K 4DV7K 4LF9K 2UUBK 4JI2K 4JI3K 4DR2K 3J80O 3OTOK 1XMOK 2UXCK 4X62K 3J7AP 2UUAK 3J81O 4JI6K 1IBKK 4LF7K 4DUZK 4NXNK 4B3SK 4DUYK 1I94K 4LF8K 1IBLK 4X66K 4LFBK 4GKJK 5BR8K 4JV5K 1FJGK 2HHHK 4B3TK 4LF6K 2VQEK 4DR5K 1HR0K 4LF4K 5A2QO 4YY3K 4DR4K 1XNRK 5LL6Z 4DV3K 2VQFK 1N36K 2UU9K 4YHHK 1N33K 1J5EK 2UUCK 4DV0K 5FLXO 2E5LK 4CW7B 4DV1K 4OX9K 1N32K 4X65K 4AQYK 4JYAK 4JI0K 5IT9O 4JI5K 4X64K 4DV6K 4GKKK 4JI7K 4JI4K 1XMQK 4JI8K
chains in the Genus database with same CATH superfamily
4I9QA 3CJCA 3QESA 3AAQA 3PIPL 5C25A 1A5WA 4A57A 1Q82O 3KLFA 1SQKA 1SZ2A 3DOKA 3MEEA 1IBMK 3WT0A 4FWSA 3ENBA 2E1ZA 5IWAK 3D2FA 4W5QA 2HF4A 2ZWHA 3L8BA 3DYAA 5FRNA 3OYLA 3J7YP 1W2BM 1JL1A 3SQ4A 5HL7L 3RMAA 5C0YA 1U49A 2BE2A 3CJ7A 4FJ9A 3O9SA 2IAJA 2G8WA 3ITHA 4FLVA 1T6DA 2YV0X 1NWKA 1NGFA 2YHYA 3QIPA 3NCIA 4B9LA 2Z1GA 4CZMA 2YKMA 5AQQA 2UUAK 1MDUB 2PBDA 4PKIA 1SL0A 2QKBA 3SMPA 1WUAA 2E20A 3QBWA 3HJFA 3I8DA 3ZT2A 1BDGA 4LF8K 1WSJA 5EX5A 4GKJK 1W0HA 1NBWA 2OZMA 3O5BA 4FW1A 2YJFA 2E2NA 4BDPA 4A2AA 4BRIA 2X74A 4DR4K 1KAZA 1IKWA 4BVOA 4IEEA 5KPTA 2VQFK 1N36K 5BN8A 3TAEA 3T7ZA 4M3WA 2O8BA 1WAJA 4CZHA 4CI6A 1QZ6A 4ID5A 4FLUA 4CJRA 4MFBA 2E5LK 3MWPA 4O55A 1OKJA 4B9UA 3UKUA 3C65A 4DTXA 1KSPA 5M1OA 4JYAK 4ZHRA 5KQ8A 4OVLA 4PWDA 1RT2A 4CBXA 2FBTA 4KKOA 4R79A 1WSHA 2YNGA 2A1SA 5BN9A 3WEEB 4O4GA 1RCHA 4CK2A 3VERA 4GV3A 1JXBA 1VRTA 3DAWA 1WSIA 2Q97A 3VQDA 3DRSA 5KGWA 1VHXA 4B3OA 4FJIA 3KJVA 3CJAA 3MEGA 3CMAN 4DS5A 3AVIA 1VQNN 4IOXA 1YJNN 2CH5A 1IKXA 4BR0A 4FJKA 1GLEG 5KI6A 5I42A 3NF8A 4RTFD 4CGFA 4DSIA 3I0SA 3AVNA 4YDUA 3VQCA 4FWLA 4DG1A 4DTPA 5I9EB 3NGIA 3AV9A 3QFUA 4KBOA 2VWJA 1N5YA 1QQMA 4CJVA 4WQ5A 3BF1A 1BIZA 1MU2A 1NK9A 4KHSA 1EWQA 4ZTFA 1HRHA 4BR9A 1L5UA 4FCYA 3A5NC 3LWLA 1TAUA 4YDUC 4JKAA 1WN7A 1NMDA 2UXCK 3OYJA 4ILGB 3OJUA 3D2EB 4WQ5C 4WFNL 3E01A 2PAVA 1RILA 3THXB 1BA0A 4ILJA 3WXKA 1S22A 4F3OA 2G8KA 2JGUA 4J8FA 4NXNK 1ASWA 4K43A 3OBWA 5AQFA 3BF3A 3LWMA 3VQEA 4CF0A 2HHWA 4I2PA 3O9QA 3ZSYA 3CQ8A 5HP1A 4JK7A 1D9FA 3HT3A 2VQEK 3OVNA 1HR0K 2E2OA 3VGMA 4FW2A 4JKEA 1OH5A 1YXQA 1C6VA 3DI6A 1KVCA 3AVBA 3OYKA 4OJRA 3CCSN 3D6RA 1BQMA 1SKRA 1Z26A 3HP6A 3C95A 4PY5A 1G15A 5JLFA 2YNIA 4HTUA 1CZAN 2VCPA 2EX3A 5CHIA 3NH2A 2I5JA 3THWB 2FBXA 3KKRA 3A8YA 1NM1A 1RNHA 4KREA 4FPAA 5TKYA 4CGIA 1KTQA 4C1NK 1JLCA 2F8SA 5CY4A 1S1UA 4BQLA 1ZBIA 5BPNA 3ALYA 4EHUA 4DWIA 2IIRA 3MECA 3H45C 3QMLA 3KK1A 3DMJA 4FJJA 2H3GX 2P9SB 4YOYA 3LPUA 2DFFA 3KK3A 2YJEA 3ULEB 3G71N 1GLLO 2OCEA 4FLWA 3M3ZA 4ICLA 4DLGA 4J2BA 4FM1A 2BANA 3DLLL 2Z1IA 1RTDA 4DQIA 1T7PA 4I6MA 3AAPA 1D8YA 3CM6A 5SWMA 1D9DA 1YVUA 3V1RA 4H0PA 4BC4A 3DM2A 4FM0A 4DQ8A 3HO1A 4BRQA 3LAKA 2XY5A 3E9LA 5I3UA 3M8PA 4O8UA 3SUQA 4CEAA 2P1JA 4JI3K 4Y0WA 3MN7A 4HTLA 3LDSA 3AO3A 1ZC6A 3K5MA 1HKBA 3H3NO 3WUHA 3SK3A 4OGCA 1ZBSA 2D4WA 4FJ5A 3THYB 3TAGA 1JLQA 2HBJA 2D0CA 4MDBA 4IFYA 1XHXA 4IFVA 4FLTA 4GMJB 5J1EA 3NVMA 1D4XA 2V51B 1DGKN 2KLAA 3BUZB 1LAVA 1HQEA 1BOTO 2ETJA 4PL8A 3W3DA 4JS4A 3SAFA 2UU9K 3OYBA 3OYEA 2Q0UA 2ITGA 4DV0K 1VRUA 4F9OA 3LP3A 3FFIA 3AARA 5EXWA 3QERA 2UYTA 2VYPA 3P83D 4GVMA 5C42A 1KAXA 1ASVA 2HHQA 3RVCA 3OHRA 2GWKA 3VEWA 4AM7A 2O4IA 2Q1NA 5AQIA 4A2BA 1U2VA 3D0PA 4FJ8A 4OPKA 3O9TA 3ATUA 3MWTA 2BTFA 4FWMA 4NXMK 1TK8A 2O8DB 3PV8A 1E3MA 2QWPA 3OW2M 5KTQA 2UXDK 4C1NI 1OH8A 4M42A 3T19A 3LZJA 3VQ6A 4JKBA 3F9KA 4H0XB 1Q86O 3QETA 4H03B 1SL1A 3CC4N 4RW9A 2XHBA 4OKEA 3CCRN 2IC3A 3N4PA 1JKHA 3CC7N 2QXLA 4DFKA 3D7EO 4ISGA 4BWMA 2KFZA 4BG9A 5F2RA 3F5TA 3TAPA 4NCBA 2P9UA 2O4GA 4CHNA 4EP4A 1P8ZA 2FSNA 4JN4A 4FJLA 4OPHA 3WEEA 3J7AP 2KZZA 1S72N 3J81O 4FSVA 3KLGA 1M90O 1LCUA 4EFHA 4WF9L 3H46O 3Q7BA 5J2PA 1FJGK 3SV4A 3HI0A 4LH4A 5DM6L 5M1NA 1UA1A 5BPLA 1XC3A 1X9WA 3UKRB 5GADP 3MCPA 1NK5A 4IOCL 1NK8A 4BE2A 1IG9A 3MAQA 3K5NA 3EE9A 3U3GA 3JYTA 3NF9A 3S41A 1YIJN 5JS2A 3VF4A 2OPQA 3SJHA 3FZKA 1J54A 1X9MA 3OYMA 2ASMA 4AH9A 1RT7A 3FFKB 4O0JA 4O44A 3DLRA 4B1WB 3CIPA 4DSJA 4CZJA 2YHXA 4B9TA 3D2EA 3THXA 3DXKA 3HK2A 4CEQA 4BACA 1MWKA 3ZETB 3EL2A 1S9EA 1BI4B 2GELA 4OKJA 3E9OA 4M3YA 4JLHA 3MDQA 1CZ9A 2QWQA 1RTHA 3VGLA 2P51A 3MMVA 2YHAA 1S1VA 1VSJA 4LSLA 3ID8A 4AHUA 2D0PA 3O9UA 4B1YB 3ZT3A 2P9IB 2KQ2A 3QBXA 2PY5A 2CGJA 3P31A 3O4WA 1RT1A 3WNFA 3C6UA 4B3MK 3AVHA 1TK5A 3P1GA 5JLHA 1TV6A 4WFBL 3THWA 2F9WA 5AQVA 3EYZA 2P9LA 4H5VA 2ZF5O 1TYQB 3I33A 1SL2A 4CGJA 4YOVA 4HUGA 5E41A 3E66A 1HJOA 2P9SA 3AVLA 2YCHA 3MXJA 3R6MA 3HL8A 3OYIA 1QS4A 3J8AA 3TSQA 3QINA 3OS2A 3UE5A 1ATNA 3ZSZA 3TSPA 5M1KA 4AHTA 4Z4IA 1BWFO 2VG6A 2E6MA 3TTFA 1NJXA 1K6YA 3RSEB 3CM5A 3NGZA 4B1VA 1VSMA 4A61A 2E4LA 1B9FA 1O1WA 4FOIA 1GLJO 3CJ1A 3BZCA 3ZSXA 3VEXA 2FLOA 1REVA 3L3UA 4CHQA 4DQQA 3K59A 1YVNA 3AVCA 4QAGA 4CESA 4X65K 4C8LA 3SZ2A 4W5RA 3NDKA 3ZSWA 3SQ1A 1TVRA 2W6LA 4HVJA 2XY6A 2GUIA 3VEYA 1YTAA 3GOIA 5AQZA 4E7KA 3CCUN 3CCLN 1FW6A 1RDUA 5LMNK 2P9PB 3SAHA 1NOYA 2D5RA 4CJSA 4V19S 4CF8A 3VA3A 3U4LA 3CCQN 3IG1A 1NJIO 2W42A 3P5JA 3IDHA 3JAMO 4LFAK 4H5WA 4K8XA 1UOCA 3BDPA 4RCHA 2PFUA 3QO9A 4L8RB 5AZIB 4MLHA 3OYGA 4W5NA 2BDPA 4JKGA 4E89A 5LMUK 4CJPA 3AO4A 4LC9B 2NRXA 1YAGA 5JS1A 5KQDA 1S5JA 1N34K 1IV0A 3H6EA 3LZIA 3CPEA 1QE1A 4ELTA 3CC2N 2ATQA 3FGUA 4BE0A 2HHSA 3PLAA 1NGIA 3DRRA 4ISEA 3TU5A 4CJTA 4B9MA 3L0QA 5C12A 2I7PA 2RKIA 4GY2B 4LSNA 4DSEA 2VGMA 2O8DA 2HVHA 1RTJA 3WQUA 3OYCA 3AA4A 5FROA 2R7YA 2A41A 2NRTA 4JS5A 5KRSA 4BRKA 5AQKA 4YOXA 4CEEA 3I8BA 3TAQA 3S3NA 2G8VA 1VQ5N 4FO0A 3AVGA 3KLIA 4K25A 4XEIA 1NGBA 3TSUA 3CI5A 2QXFA 3PSIA 3LM9A 2RN2A 5LJWA 3OYNA 2HMIA 4IFEA 3ZX3A 3K5LA 1QSYA 4FWPA 3G10A 2WOMA 1RDDA 3DRPA 5F0XA 3M8RA 2HHTA 3V9UA 3HRGA 4E1NA 5F1XA 3OA9A 4Y1DA 3TAFA 1LWFA 3KWIA 1WSGA 4BGAA 1XMQK 4JI8K 1RBRA 2F96A 4JEPA 3ZEUB 1S1WA 2WBNA 4DTJA 3WXIA 4BRAA 3PO4A 1FKOA 5ADXA 5HROA 1YTUA 1EETA 3ID6A 1J53A 4DF4A 3NHGA 2QW9A 4FWRA 5HRRA 1FXXA 3MXIA 3UKRA 2WUSA 4KTWA 4Z4GA 1VSHA 4DS4A 2VG5A 4LF5K 1UAXA 4GV9A 5FPNA 2VWBA 4CCHA 3H1VX 4DV5K 4RW8A 3KK2A 1K8AO 4FWOA 1R0AA 2Q31A 5GAGP 2HNDA 2KW4A 3O8MA 3VMFB 3QEVA 2Y1JA 1HPMA 1I39A 4N47A 3A5OC 1KLMA 4DTUA 1T44A 4ISFA 1BUPA 4DTSA 3AO1A 1XMOK 2A1RA 4BC5A 4BDYA 4QS8A 1U04A 1VQ9N 4BC3A 4H0VB 2QWRA 2D0OA 2DFEA 3GBTA 3FR0A 3EY1A 4E3SA 1BI4A 4FWQA 3HVRA 1C0FA 3G4SN 5DMRA 4CFCA 4CEOA 2HHUA 2IVPA 2HBKA 4BDZA 1UA0A 2OA8A 1CXQA 3HBTA 4X66K 2VGNA 3CJBA 4K8ZA 3QNNA 1HYVA 4DR5K 1NGCA 1KFSA 4IEIA 1L3TA 2E8AA 2E2QA 2O8FA 3KLHA 2P9IA 1KC8O 4RW7A 2Q36A 1RDBA 1SKSA 3IS9A 4UY8O 3QNOA 2UUCK 4M3ZA 3LM2A 3MN9A 2A3ZA 4AQYK 1T05A 3HZ6A 3F2KA 3ASMA 1H1VA 5C10A 5KPZA 4BRCA 3TTCA 3ZSOA 5IT9O 5CZ1A 1ZYQA 4GKKK 2KFNA 2X78A 4M45A 3AVMA 4B8AB 4JHDB 3AA3A 3DXMB 4AHVA 2HNYA 2QEXN 4N5SA 1K9MO 4FJHA 3W0LA 4M3RA 4DV4K 3T69A 1JXEA 1S3XA 4JRPA 1V4SA 2F9TA 3T1HK 2NRRA 3HM8A 3MN6A 3V1OA 4KH5A 1RBSA 1U45A 3RSEA 2GEMA 4KHYA 2JWKA 2G8HA 4CHOA 1VAZA 2HSTA 1HNWK 5C2DA 4NCGA 4FOEA 3K57A 2O8EB 4CZGA 4MLEA 2OPSA 3L2VA 1NK6A 4BC2A 4WQ4A 2V52B 3NBPA 3LDNA 4KH6A 3O80A 4CVNE 2GBZA 4FZZA 3IUCA 3WXJA 1Q81O 5AQYA 1SUQA 2FSKA 2HW3A 4DFJA 1XI1A 3VQQA 4WQ4C 2P9KA 2HVIA 3JSMA 1L3VA 2P9PA 5EOYA 4FVUA 3V81A 3SUOA 3CQYA 5T7BA 3R8EA 1NK0A 2AA4A 4JK8A 4XH1A 5BR8K 1NKBA 4FJNA 3KLEA 3SCXA 4KHWA 2X6SA 4BG8A 3VF6A 5C15A 1DTTA 5FDLA 3SJJA 4BRDA 4DTRA 1DT9A 3AGRA 1XNRK 3HM9A 1UWBA 1KVAA 4HHTA 3LL3A 4M41A 4O8KA 1FK9A 4IXCA 3ATVA 2E1YA 3M1FA 4B9VA 1CLQA 2P5GA 3QB0A 1JL2A 4U7BA 4DU3A 1VSIA 3JS6A 1TUUA 1U6ZA 4LH5A 2YNFA 5D3GA 1N32K 1BQNA 3QEXA 1WSEA 2HMPA 2ZJQL 2HNZA 4JI7K 1DEJA 3U9ZA 4DMNA 1Y97A 3LDPA 1JLGA 5JVHL 1G99A 3EEQA 1TKTA 2ZQBA 1BHLA 3SMSA 5HOOA 1C1CA 3V1QA 3C7NB 1NGHA 1GLDG 1RT3A 4CEDA 4DSLA 1Q9XA 4M3UA 2QI2A 1D5AA 3L3VA 1U4BA 4JKCA 1B9DA 1L3SA 1T3VA 4M3TA 5DM7L 4IDKA 3IRXA 1LV5A 4FZYA 4DCHA 4NYFA 3VQ5A 4JRQA 3PO5A 1RT4A 4JI1K 3K9JA 3VQ9A 4IWVA 4ELUA 3I55N 4DF8A 3K58A 5CYMA 3SYZA 2OTJN 3PY8A 4E0DA 1RDWX 4O0IA 4UQGA 2Y1IA 5BR9A 4H4OA 2I7NA 1ZXOA 2D0BA 4M7XA 1C1BA 4DV7K 4LF9K 3THVA 4JI2K 4Z0UA 4Z94A 1WOQA 3LP2A 3LALA 1DTQA 3D2FB 2A42A 3ISNC 3OBYA 4H0YB 3PX0A 5J2QA 2IS3A 3O4NA 4DUYK 3EN9A 3QFPA 3R1XA 4JNEA 1IBLK 4FZXC 3FZLA 3P38A 2NRVA 4BRMA 1ILYA 2NRHA 4QCLA 4B3TK 4LF6K 4LF4K 2AP1A 4FLZA 4C8KA 2J4RA 3SAGA 3AVAA 3KZBA 4A5AA 3O08A 2QK9A 1WSFA 4EZ6A 4HCCA 1KCFA 3O1WA 1JJ2M 4CBWA 1A5VA 2ZGYA 4CJUA 2DFHA 3FE1A 1W9HA 1WLJA 1ZBHA 4BR2A 3SQ0A 2ZJPL 1ZBLA 3NGYA 1QSSA 5AQTA 1HKCA 2G8FA 2QWNA 1R59O 3LP0A 3RRHA 4KHUA 5JICA 1U48A 1SS6A 1U47A 3ZCMA 4JAXA 3KIOA 1Z05A 5AFUA 3OYDA 1YJ9N 1X1PA 2PYLA 3TI0A 4DQRA 4HWIA 2YX6A 3WNGA 5J2NA 4F8RA 3NMUA 3DOLA 2QKKA 4IG3A 2OPPA 4DQSA 4ILHA 4KO0A 3OS0A 5BREA 2JWLA 5AQHA 1NOZA 3SV3A 2EHGA 3IAYA 4A62A 2B6AA 3K5OA 3HOSA 1I3AA 3B6OA 3TABA 4KI4A 4KI6A 3QEIA 4OKKA 4K0KK 1IG8A 3KHYA 3G25A 4H5TA 1P90A 1TKXA 1IH7A 1DLOA 4DR7K 2V7ZA 3DLGA 4CZEA 4KTQA 4CHPA 4WYBA 1BA1A 2ZM6K 1T8EA 5BRHA 2NLXA 4B9QA 5HRSA 3RMBA 3MK6A 4GVEA 1EP4A 2BH1A 3VF2A 4CF2A 4JKDA 3QEWA 1ZBUA 2YHWA 3NF7A 3ULDA 3QDKA 4JHDA 1VSDA 2GV9A 1JLBA 3DXMA 3TAMA 1KXPA 2KZMA 1RDCA 3A5MC 3PX6A 5AZJB 1BIUA 4FJMA 3C6HA 3HSTB 4JV5K 3O4QA 4XIUA 2VWKA 3DJCA 4CFDA 2O8CB 3CQXA 4DU1A 2QWMA 1WBDA 3OYAA 4IG0A 1EWRA 1WAFA 4YY3K 4Q5VA 4FJGA 2O8EA 3LP1A 1HKGA 5E26A 3QLHA 1EQYA 1QHTA 1JLEA 4BE1A 1NJZA 4YHHK 1EO1A 2D0AA 4IJAA 1B92A 3ULEA 4DSKA 2QA4N 3C6AA 1YHQN 3P4IA 5HRPA 4DV1K 2XY7A 3UIQA 4OX9K 4KRFA 3VTHA 4FK0A 3CCMN 1S1TA 1F21A 4M3XA 4DU4A 4JD2B 3EO3A 1JCFA 4CJLA 3CD6N 1GLFO 4JKHA 1RTIA 4FWKA 4CEFA 3SPYA 4NCAA 1HYSA 3I0RA 1QQNA 1Z25A 1GLBG 1BISA 1NK7A 5H1SQ 1ZBFA 4DFMA 5GIOA 5JMVA 4IOAL 3VQPA 5LY3A 1HNVA 4E7IA 1YI2N 2KTQA 1HYZA 2Z1JA 2GUPA 4IO9L 4H4MA 4K41A 3BGRA 2IOCA 3LPTA 3ZT1A 4PL7A 3MXMA 1BG3A 1YF5L 1C0GA 1RGIA 3THYA 2GTDA 3ENHA 3OS1A 4CJKA 4DFPA 3BP8A 3K9KA 4F3TA 1W97L 4YOTA 3L2UA 1CZBA 5EY4A 3E1YA 1ATRA 4FJ7A 2P5OA 2HBLA 4BRFA 4RWTA 4QOZB 3AVJA 4PQUA 2A6AA 1JCEA 3VEVA 4CEZA 4L3QA 5C24A 4M7YA 3G0ZA 5HRNA 1QQCA 4H5RA 3B8AX 1C0MA 2LSNA 4DQPA 2KKZA 1IKYA 4C8NA 4AF1A 3KVGA 4I7FA 4Z4HA 2PYJA 4BRLA 4LFBK 4CD1A 1X9SA 1VQ4N 1O13A 4IBNA 3CXCM 5ADXH 4KTZA 4CJWA 5A2QO 3P39A 4W5TA 3SNNA 1VQ8N 2AJQA 1RBTA 3VQ8A 4C23A 1BL3A 4CJ4A 4B9NA 4HCBA 2E6LA 1CXUA 4AM6A 3L4QA 4N56A 5E84A 1S9GA 2OPRA 4OLBA 4FPBA 1LWEA 3CMEN 5AQRA 3KTQA 4E7LA 4NYNA 3WQTA 4PA1A 1X9JA 1TL3A 3CG7A 4OLAA 4W5OA 1L3UA 2XY8A 3RRGA 3TANA 4CZFA 1KD1O 2NRZA 3ZSQA 4CJEA 4X64K 4DV6K 2NUBA 1V4TA 4BY9C 4IZ9A 1NGEA 4YFUA 1QSLA 4CK3A 4OO1J 5BPMA 5K14A 4KV8A 1Z6RA 2P9NB 3VETA 4CHYA 3M8SA 1VQON 3SBGA 3EZ5A 3J7ZO 3K2PA 4IDHA 4CZLA 1EKEA 4DR1K 1Y64A 3NVKA 3VESA 3OYHA 4ID1A 2IGIA 5M1PA 3EKUA 4DTOA 1QZ5A 3EE8A 4RW4A 3N4QA 4EAHD 4CZKA 2QM1A 3HP9A 1WB9A 2OYQA 3VQAA 1RBUA 1U2VB 2B4JA 5ELZA 4FWNA 1IO2A 2FSJA 2FXUA 3GG4A 3GE1A 1VQ7N 3NF6A 3L4IA 3CF5L 5CE3A 2A40A 4C8MA 3VA0A 4E19A 3FLCO 3VGKA 4YORA 2GX9A 1LAWA 1A5XA 4B9SA 2Q3SA 4CF1A 4LF7K 4BRHA 3CCJN 3L2RA 3V4IA 1W7AA 4CEBA 3VQ4A 3CCVN 3LDQA 3BZKA 1HUXA 4CJ5A 2P9UB 4N41A 2VG7A 4IJNA 5TKWA 4G9ZA 5EVZA 4E7JA 2B5JA 2WONA 5LL6Z 4BQZA 4EHTA 3ZETA 3F9MA 4LD0A 4Q0BA 1N33K 1KVBA 3KWGA 4AILC 2W40A 4OPJA 3M5RA 2DPNA 4CW7B 4FJXA 1KLNA 5AQXA 3L2QA 5DK5A 2HBMA 4CECA 5KRTA 4Z4FA 3FZMA 4Z4EA 3A5LC 4H0OA 4JI5K 4I2QA 1JCGA 2NNWA 1YITN 1GOBA 3U9DA 2F7TA 4KFBA 2XO7A 1HMVA 4CD3A 3LDLA 4JKFA 1NLVA 1MWMA 5AZJA 3CHWA 3LAMA 5HBMA 5AQUA 4A5BA 2HB5A 3GL1A 4HUEA 4B8CA 3ZSVA 1OVYA 2O8CA 1C0UA 4BRGA 4J2EA 5AQGA 1NG9A 3EZWA 1TYQA 3O1BA 4PKHA 3KD5E 2UXBK 4B1ZA 2BGGA 4JK9A 3DXKB 1HX1A 3ENOA 4LFCK 3M6GA 5CR4A 1Q9YA 1HPZA 1ATSA 3VQBA 4DV2K 4BR7A 2YKNA 3LDOA 4NLBA 4YOUA 3HYFA 1XUPO 4XH5A 1HNXK 1J5OA 4MQ3A 4KB0A 4OGEA 4AHSA 4U67L 3VTIA 1QHAA 3AVFA 4JD2A 2HOEA 1VQMN 1TL1A 2NZTA 1VQLN 4X62K 3JXUA 2ASOA 4EIAA 1TGOA 3RWUA 5AQJA 4DHYA 2IVNA 5C2FA 3M8QA 1HLUA 3NH1A 5KPRA 3QEPA 4FL9A 4DTMA 4PKGA 1RDAA 5AQNA 2ITMA 4CFAA 1K8KB 3VEOA 3V6DA 1HJRA 2P9LB 1SKWA 3CYMA 3OY9A 1X3NA 2YNHA 4RW6A 3FZHA 1T6CA 3AA5X 3QIOA 1OVQA 3IFRA 3AO5A 4TSXA 4CIGA 1NJYA 5FLXO 2ZGZA 1GOAA 5AQPA 3CERA 4O5FA 1QTMA 4BRPA 3NAEA 3VEZA 2EWSA 2WC9A 1Q8IA 3ZX2A 5M1FA 1NNEA 3T1AA 4BVPA 4BR5A 4WE1A 5CZ2A 3AY9A 5AZIA 4JI4K 3I56N 4DTNA 4H8KA 1XQSC 5GAEP 2FF6A 3IMXA 2XRIA 1SAZA 1T03A 4C8OA 3IKMA 5FPDA 5AQLA 3SQ2A 1GLAG 5JVGL 1LWCA 3WNEA 1X3MA 4H0TB 1IKVA 3O9RA 1XWLA 2G8IA 3QICA 3OYFA 3TWHA 3H1QA 4FK2A 4O5BA 4AHCA 3RTVA 1NKEA 2RHKA 3V9ZA 1HQUA 4AHRA 1VSFA 4QS7A 1ITGA 1BU6O 2W6KA 2GWJA 1HNZK 3KD1E 1KFDA 3TR8A 3LANA 3C94A 3V9SA 3HVTA 3KK7A 4ZTJA 2OTLN 3PX4A 1JLFA 4DR2K 4EP5A 3VENA 3VOVA 4CE9A 4CERA 5SZTA 1NKCA 3S3OA 3C0BA 5AFUH 3CFRA 3VPZA 3DLEA 5HLFA 1IBKK 4NB4A 1MA9B 4HUFA 4B3SK 2P9NA 3L6QA 4JKGB 4CJFA 3Q7CA 2CH6A 3AO2A 3BY5A 1HNIA 3SI6A 2FC0A 4FLYA 3NE6A 3CETA 4GNIA 1VK0A 2RE2A 2IVOA 3L2WA 5M1QA 1NU0A 1ESVA 4NLCA 4CF9A 4E7HA 3S3MA 3OJSA 3HSCA 4J2AA 4CGHA 1Q18A 4KPYA 3C6TA 4CZIA 5BRDA 4FXDA 3ZEUA 4KH4A 4YOWA 1VSLA 5AR0A 1NK4A 4CBUA 2V7YA 3ZLJA 3ZX0A 3V9XA 1KQSM 3H08A 4LY7A 3NH0A 4KAZA 2FF3B 3RMDA 4XH4A 4JI0K 1SV5A 1EX4A 4G1QA 2WFBA 1RFQA 4CGDA 3PUFA 4J2DA 3RMCA 3G6EN 2RPIA 3WXLA 3WXMB 3NFAA 3A0IX 1XHZA 4F2RA 4DSFA 1XNQK 4WCEL 1TUYA 3H3OB 5J2MA 3ZT0A 2WTUA 4DR3K 3SLCA 2F4VK 1N8RO 1FKPA 1TKDA 5FPMA 4CJ7A 4WFAL 3GDQA 1NMNA 3HPOA 3U3YA 3VN5A 1NGGA 3MX5A 2Q0RA 3BEXA 1BCMA 3T1YK 1C0TA 3O3GA 4FYDA 1IJJA 1YJWN 1E4FT 3MX2A 1QVGM 2O8BB 3MCAB 5AQWA 2E2PA 4B08A 4DLEA 1RT6A 1S1XA 2HHVA 5AQMA 3UKUB 4RG8A 3OTOK 4MO4A 3ZSRA 4DB3A 3K0SA 4K42A 1YT3A 4B1UB 4E1JA 2IDOA 1RBVA 2QWLA 4R5PA 2HHXA 2NRWA 4ELVA 1LW2A 3AGKA 5FPEA 3DLKA 1M1KO 1J6ZA 5BRFA 1J9AA 2HHHK 4QS9A 5CYQA 2YHBA 3AA2A 3CFOA 3PIOL 3T3FA 3DLBA 4FK4A 1JLAA 3EKSA 4CIFA 4KHQA 2F8TA 2ZJRL 3MN5A 1VQPN 3HOTA 1WNSA 4YNQA 3U8XA 1OH7A 2QTDA 4GV6A 2ZE2A 3KKSA 3TPQA 1VQKN 3SUPA 3TTDA 2QWOA 3O6WA 2BUPA 3UB5A 5FRMA 1EXQA 5GINA 4PHTX 2DTUA 3AVKA 4BRNA 5GAHP 1BCOA 4CHZA 4Z4CA 5MLCQ 1ASUA 3DLHA 1NJWA 3PSFA 3F73A 3V9WA 2O8FB 4CK1A 1OH6A 4KHNA 1GOCA 2PZSA 1VSKA 4FM2A 3S9HA 1QQOA 4F2SA 3MEDA 2CGKA 3SUNA 2KHOA 4B3RK 2JLEA 3CJ9A 5AJ3K 4H5NA 3O3HA 1S6PA 4DR6K 4E1MA 5GIPA 1K8KA 3SBTA 1VQ6N 1RT5A 4A59A 4KB1A 4CGGA 5AQSA 3SPZA 4I9LA 4OPAA 4BGBA 4CFBA 1WBBA 2DY4A 4KHPK 4IO8A 1N6QA 2Z1HA 1BGXT 1YUWA 3HXMA 1DKGD 3CPWM 4M63C 1K73O 1KAYA 1NGAA 4Y1CA 5KGXA 1C1AA 2UUBK 5B8HA 4BR4A 3J80O 4N76A 4CJQA 2RF2A 4JI6K 3FZFA 1NGJA 4MO5A 1Q7YO 2D1KA 4DUZK 1TAQA 4IKFA 3VQ7A 3DWLA 4FVMA 1GLCG 1VSEA 1E4GT 2X6NA 1I94K 3TARA 2ZD1A 4MDAA 1LOTB 4B1XB 2FBYA 2ASPA 2OANA 4NO7A 5AQOA 3HPGA 3B6PA 1NGDA 4FLXA 4F4KA 2HF3A 5EU7A 3ZT4A 3CFPA 2FBVA 3U6FA 3ZYYX 4BREA 1XC9A 1S6QA 4DKWA 4DV3K 4I6MB 4CIEA 2OZSA 3O3FA 2YI1A 1BO5O 2P9KB 2E88A 2A5XA 3CCEN 4BWJA 3RR8A 3HPHA 1J5EK 3C7NA 3E9PA 4BROA 3D45A 2G8UA 3A2FA 1TKZA 3R9PA 3HTVA 4PUOA 1KRPA 2Q2RA 1TK0A 1QVFM 4GW6A 1LW0A 5LJVA 4EZ9A 2CGLA 3R3LA 4CJ3A 3WNHA 2W41A 3RR7A
chains in the Genus database with same CATH topology
5LMNK 1XNQK 4V19S 4NXMK 4B3RK 5AJ3K 4DV4K 4DR3K 4DR6K 4DR1K 2F4VK 3T1HK 2UXDK 3JAMO 1IBMK 4K0KK 4LFAK 2UXBK 5IWAK 4LF5K 1HNWK 4KHPK 3T1YK 3J7YP 4DR7K 4LFCK 4JI1K 4DV5K 4DV2K 5LMUK 2ZM6K 1HNZK 4B3MK 4CVNE 1HNXK 1N34K 4DV7K 4LF9K 2UUBK 4JI2K 4JI3K 4DR2K 3J80O 3OTOK 1XMOK 2UXCK 4X62K 3J7AP 2UUAK 3J81O 4JI6K 1IBKK 4LF7K 4DUZK 4NXNK 4B3SK 4DUYK 1I94K 4LF8K 1IBLK 4X66K 4LFBK 4GKJK 5BR8K 4JV5K 1FJGK 2HHHK 4B3TK 4LF6K 2VQEK 4DR5K 1HR0K 4LF4K 5A2QO 4YY3K 4DR4K 1XNRK 5LL6Z 4DV3K 2VQFK 1N36K 2UU9K 4YHHK 1N33K 1J5EK 2UUCK 4DV0K 5FLXO 2E5LK 4CW7B 4DV1K 4OX9K 1N32K 4X65K 4AQYK 4JYAK 4JI0K 5IT9O 4JI5K 4X64K 4DV6K 4GKKK 4JI7K 4JI4K 1XMQK 4JI8K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN K;  1XNQ K;  4V19 S;  4NXM K;  4B3R K;  5AJ3 K;  4DV4 K;  4DR3 K;  4DR6 K;  4DR1 K;  2F4V K;  3T1H K;  2UXD K;  3JAM O;  1IBM K;  4K0K K;  4LFA K;  2UXB K;  5IWA K;  4LF5 K;  1HNW K;  4KHP K;  3T1Y K;  3J7Y P;  4DR7 K;  4LFC K;  4JI1 K;  4DV5 K;  4DV2 K;  5LMU K;  2ZM6 K;  1HNZ K;  4B3M K;  4CVN E;  1HNX K;  1N34 K;  4DV7 K;  4LF9 K;  2UUB K;  4JI2 K;  4JI3 K;  4DR2 K;  3J80 O;  3OTO K;  1XMO K;  2UXC K;  4X62 K;  3J7A P;  2UUA K;  3J81 O;  4JI6 K;  1IBK K;  4LF7 K;  4DUZ K;  4NXN K;  4B3S K;  4DUY K;  1I94 K;  4LF8 K;  1IBL K;  4X66 K;  4LFB K;  4GKJ K;  5BR8 K;  4JV5 K;  1FJG K;  2HHH K;  4B3T K;  4LF6 K;  2VQE K;  4DR5 K;  1HR0 K;  4LF4 K;  5A2Q O;  4YY3 K;  4DR4 K;  1XNR K;  5LL6 Z;  4DV3 K;  2VQF K;  1N36 K;  2UU9 K;  4YHH K;  1N33 K;  1J5E K;  2UUC K;  4DV0 K;  5FLX O;  2E5L K;  4CW7 B;  4DV1 K;  4OX9 K;  1N32 K;  4X65 K;  4AQY K;  4JYA K;  4JI0 K;  5IT9 O;  4JI5 K;  4X64 K;  4DV6 K;  4GKK K;  4JI7 K;  4JI4 K;  1XMQ K;  4JI8 K; 
#chains in the Genus database with same CATH topology
 4I9Q A;  3CJC A;  3QES A;  3AAQ A;  3PIP L;  5C25 A;  1A5W A;  4A57 A;  1Q82 O;  3KLF A;  1SQK A;  1SZ2 A;  3DOK A;  3MEE A;  1IBM K;  3WT0 A;  4FWS A;  3ENB A;  2E1Z A;  5IWA K;  3D2F A;  4W5Q A;  2HF4 A;  2ZWH A;  3L8B A;  3DYA A;  5FRN A;  3OYL A;  3J7Y P;  1W2B M;  1JL1 A;  3SQ4 A;  5HL7 L;  3RMA A;  5C0Y A;  1U49 A;  2BE2 A;  3CJ7 A;  4FJ9 A;  3O9S A;  2IAJ A;  2G8W A;  3ITH A;  4FLV A;  1T6D A;  2YV0 X;  1NWK A;  1NGF A;  2YHY A;  3QIP A;  3NCI A;  4B9L A;  2Z1G A;  4CZM A;  2YKM A;  5AQQ A;  2UUA K;  1MDU B;  2PBD A;  4PKI A;  1SL0 A;  2QKB A;  3SMP A;  1WUA A;  2E20 A;  3QBW A;  3HJF A;  3I8D A;  3ZT2 A;  1BDG A;  4LF8 K;  1WSJ A;  5EX5 A;  4GKJ K;  1W0H A;  1NBW A;  2OZM A;  3O5B A;  4FW1 A;  2YJF A;  2E2N A;  4BDP A;  4A2A A;  4BRI A;  2X74 A;  4DR4 K;  1KAZ A;  1IKW A;  4BVO A;  4IEE A;  5KPT A;  2VQF K;  1N36 K;  5BN8 A;  3TAE A;  3T7Z A;  4M3W A;  2O8B A;  1WAJ A;  4CZH A;  4CI6 A;  1QZ6 A;  4ID5 A;  4FLU A;  4CJR A;  4MFB A;  2E5L K;  3MWP A;  4O55 A;  1OKJ A;  4B9U A;  3UKU A;  3C65 A;  4DTX A;  1KSP A;  5M1O A;  4JYA K;  4ZHR A;  5KQ8 A;  4OVL A;  4PWD A;  1RT2 A;  4CBX A;  2FBT A;  4KKO A;  4R79 A;  1WSH A;  2YNG A;  2A1S A;  5BN9 A;  3WEE B;  4O4G A;  1RCH A;  4CK2 A;  3VER A;  4GV3 A;  1JXB A;  1VRT A;  3DAW A;  1WSI A;  2Q97 A;  3VQD A;  3DRS A;  5KGW A;  1VHX A;  4B3O A;  4FJI A;  3KJV A;  3CJA A;  3MEG A;  3CMA N;  4DS5 A;  3AVI A;  1VQN N;  4IOX A;  1YJN N;  2CH5 A;  1IKX A;  4BR0 A;  4FJK A;  1GLE G;  5KI6 A;  5I42 A;  3NF8 A;  4RTF D;  4CGF A;  4DSI A;  3I0S A;  3AVN A;  4YDU A;  3VQC A;  4FWL A;  4DG1 A;  4DTP A;  5I9E B;  3NGI A;  3AV9 A;  3QFU A;  4KBO A;  2VWJ A;  1N5Y A;  1QQM A;  4CJV A;  4WQ5 A;  3BF1 A;  1BIZ A;  1MU2 A;  1NK9 A;  4KHS A;  1EWQ A;  4ZTF A;  1HRH A;  4BR9 A;  1L5U A;  4FCY A;  3A5N C;  3LWL A;  1TAU A;  4YDU C;  4JKA A;  1WN7 A;  1NMD A;  2UXC K;  3OYJ A;  4ILG B;  3OJU A;  3D2E B;  4WQ5 C;  4WFN L;  3E01 A;  2PAV A;  1RIL A;  3THX B;  1BA0 A;  4ILJ A;  3WXK A;  1S22 A;  4F3O A;  2G8K A;  2JGU A;  4J8F A;  4NXN K;  1ASW A;  4K43 A;  3OBW A;  5AQF A;  3BF3 A;  3LWM A;  3VQE A;  4CF0 A;  2HHW A;  4I2P A;  3O9Q A;  3ZSY A;  3CQ8 A;  5HP1 A;  4JK7 A;  1D9F A;  3HT3 A;  2VQE K;  3OVN A;  1HR0 K;  2E2O A;  3VGM A;  4FW2 A;  4JKE A;  1OH5 A;  1YXQ A;  1C6V A;  3DI6 A;  1KVC A;  3AVB A;  3OYK A;  4OJR A;  3CCS N;  3D6R A;  1BQM A;  1SKR A;  1Z26 A;  3HP6 A;  3C95 A;  4PY5 A;  1G15 A;  5JLF A;  2YNI A;  4HTU A;  1CZA N;  2VCP A;  2EX3 A;  5CHI A;  3NH2 A;  2I5J A;  3THW B;  2FBX A;  3KKR A;  3A8Y A;  1NM1 A;  1RNH A;  4KRE A;  4FPA A;  5TKY A;  4CGI A;  1KTQ A;  4C1N K;  1JLC A;  2F8S A;  5CY4 A;  1S1U A;  4BQL A;  1ZBI A;  5BPN A;  3ALY A;  4EHU A;  4DWI A;  2IIR A;  3MEC A;  3H45 C;  3QML A;  3KK1 A;  3DMJ A;  4FJJ A;  2H3G X;  2P9S B;  4YOY A;  3LPU A;  2DFF A;  3KK3 A;  2YJE A;  3ULE B;  3G71 N;  1GLL O;  2OCE A;  4FLW A;  3M3Z A;  4ICL A;  4DLG A;  4J2B A;  4FM1 A;  2BAN A;  3DLL L;  2Z1I A;  1RTD A;  4DQI A;  1T7P A;  4I6M A;  3AAP A;  1D8Y A;  3CM6 A;  5SWM A;  1D9D A;  1YVU A;  3V1R A;  4H0P A;  4BC4 A;  3DM2 A;  4FM0 A;  4DQ8 A;  3HO1 A;  4BRQ A;  3LAK A;  2XY5 A;  3E9L A;  5I3U A;  3M8P A;  4O8U A;  3SUQ A;  4CEA A;  2P1J A;  4JI3 K;  4Y0W A;  3MN7 A;  4HTL A;  3LDS A;  3AO3 A;  1ZC6 A;  3K5M A;  1HKB A;  3H3N O;  3WUH A;  3SK3 A;  4OGC A;  1ZBS A;  2D4W A;  4FJ5 A;  3THY B;  3TAG A;  1JLQ A;  2HBJ A;  2D0C A;  4MDB A;  4IFY A;  1XHX A;  4IFV A;  4FLT A;  4GMJ B;  5J1E A;  3NVM A;  1D4X A;  2V51 B;  1DGK N;  2KLA A;  3BUZ B;  1LAV A;  1HQE A;  1BOT O;  2ETJ A;  4PL8 A;  3W3D A;  4JS4 A;  3SAF A;  2UU9 K;  3OYB A;  3OYE A;  2Q0U A;  2ITG A;  4DV0 K;  1VRU A;  4F9O A;  3LP3 A;  3FFI A;  3AAR A;  5EXW A;  3QER A;  2UYT A;  2VYP A;  3P83 D;  4GVM A;  5C42 A;  1KAX A;  1ASV A;  2HHQ A;  3RVC A;  3OHR A;  2GWK A;  3VEW A;  4AM7 A;  2O4I A;  2Q1N A;  5AQI A;  4A2B A;  1U2V A;  3D0P A;  4FJ8 A;  4OPK A;  3O9T A;  3ATU A;  3MWT A;  2BTF A;  4FWM A;  4NXM K;  1TK8 A;  2O8D B;  3PV8 A;  1E3M A;  2QWP A;  3OW2 M;  5KTQ A;  2UXD K;  4C1N I;  1OH8 A;  4M42 A;  3T19 A;  3LZJ A;  3VQ6 A;  4JKB A;  3F9K A;  4H0X B;  1Q86 O;  3QET A;  4H03 B;  1SL1 A;  3CC4 N;  4RW9 A;  2XHB A;  4OKE A;  3CCR N;  2IC3 A;  3N4P A;  1JKH A;  3CC7 N;  2QXL A;  4DFK A;  3D7E O;  4ISG A;  4BWM A;  2KFZ A;  4BG9 A;  5F2R A;  3F5T A;  3TAP A;  4NCB A;  2P9U A;  2O4G A;  4CHN A;  4EP4 A;  1P8Z A;  2FSN A;  4JN4 A;  4FJL A;  4OPH A;  3WEE A;  3J7A P;  2KZZ A;  1S72 N;  3J81 O;  4FSV A;  3KLG A;  1M90 O;  1LCU A;  4EFH A;  4WF9 L;  3H46 O;  3Q7B A;  5J2P A;  1FJG K;  3SV4 A;  3HI0 A;  4LH4 A;  5DM6 L;  5M1N A;  1UA1 A;  5BPL A;  1XC3 A;  1X9W A;  3UKR B;  5GAD P;  3MCP A;  1NK5 A;  4IOC L;  1NK8 A;  4BE2 A;  1IG9 A;  3MAQ A;  3K5N A;  3EE9 A;  3U3G A;  3JYT A;  3NF9 A;  3S41 A;  1YIJ N;  5JS2 A;  3VF4 A;  2OPQ A;  3SJH A;  3FZK A;  1J54 A;  1X9M A;  3OYM A;  2ASM A;  4AH9 A;  1RT7 A;  3FFK B;  4O0J A;  4O44 A;  3DLR A;  4B1W B;  3CIP A;  4DSJ A;  4CZJ A;  2YHX A;  4B9T A;  3D2E A;  3THX A;  3DXK A;  3HK2 A;  4CEQ A;  4BAC A;  1MWK A;  3ZET B;  3EL2 A;  1S9E A;  1BI4 B;  2GEL A;  4OKJ A;  3E9O A;  4M3Y A;  4JLH A;  3MDQ A;  1CZ9 A;  2QWQ A;  1RTH A;  3VGL A;  2P51 A;  3MMV A;  2YHA A;  1S1V A;  1VSJ A;  4LSL A;  3ID8 A;  4AHU A;  2D0P A;  3O9U A;  4B1Y B;  3ZT3 A;  2P9I B;  2KQ2 A;  3QBX A;  2PY5 A;  2CGJ A;  3P31 A;  3O4W A;  1RT1 A;  3WNF A;  3C6U A;  4B3M K;  3AVH A;  1TK5 A;  3P1G A;  5JLH A;  1TV6 A;  4WFB L;  3THW A;  2F9W A;  5AQV A;  3EYZ A;  2P9L A;  4H5V A;  2ZF5 O;  1TYQ B;  3I33 A;  1SL2 A;  4CGJ A;  4YOV A;  4HUG A;  5E41 A;  3E66 A;  1HJO A;  2P9S A;  3AVL A;  2YCH A;  3MXJ A;  3R6M A;  3HL8 A;  3OYI A;  1QS4 A;  3J8A A;  3TSQ A;  3QIN A;  3OS2 A;  3UE5 A;  1ATN A;  3ZSZ A;  3TSP A;  5M1K A;  4AHT A;  4Z4I A;  1BWF O;  2VG6 A;  2E6M A;  3TTF A;  1NJX A;  1K6Y A;  3RSE B;  3CM5 A;  3NGZ A;  4B1V A;  1VSM A;  4A61 A;  2E4L A;  1B9F A;  1O1W A;  4FOI A;  1GLJ O;  3CJ1 A;  3BZC A;  3ZSX A;  3VEX A;  2FLO A;  1REV A;  3L3U A;  4CHQ A;  4DQQ A;  3K59 A;  1YVN A;  3AVC A;  4QAG A;  4CES A;  4X65 K;  4C8L A;  3SZ2 A;  4W5R A;  3NDK A;  3ZSW A;  3SQ1 A;  1TVR A;  2W6L A;  4HVJ A;  2XY6 A;  2GUI A;  3VEY A;  1YTA A;  3GOI A;  5AQZ A;  4E7K A;  3CCU N;  3CCL N;  1FW6 A;  1RDU A;  5LMN K;  2P9P B;  3SAH A;  1NOY A;  2D5R A;  4CJS A;  4V19 S;  4CF8 A;  3VA3 A;  3U4L A;  3CCQ N;  3IG1 A;  1NJI O;  2W42 A;  3P5J A;  3IDH A;  3JAM O;  4LFA K;  4H5W A;  4K8X A;  1UOC A;  3BDP A;  4RCH A;  2PFU A;  3QO9 A;  4L8R B;  5AZI B;  4MLH A;  3OYG A;  4W5N A;  2BDP A;  4JKG A;  4E89 A;  5LMU K;  4CJP A;  3AO4 A;  4LC9 B;  2NRX A;  1YAG A;  5JS1 A;  5KQD A;  1S5J A;  1N34 K;  1IV0 A;  3H6E A;  3LZI A;  3CPE A;  1QE1 A;  4ELT A;  3CC2 N;  2ATQ A;  3FGU A;  4BE0 A;  2HHS A;  3PLA A;  1NGI A;  3DRR A;  4ISE A;  3TU5 A;  4CJT A;  4B9M A;  3L0Q A;  5C12 A;  2I7P A;  2RKI A;  4GY2 B;  4LSN A;  4DSE A;  2VGM A;  2O8D A;  2HVH A;  1RTJ A;  3WQU A;  3OYC A;  3AA4 A;  5FRO A;  2R7Y A;  2A41 A;  2NRT A;  4JS5 A;  5KRS A;  4BRK A;  5AQK A;  4YOX A;  4CEE A;  3I8B A;  3TAQ A;  3S3N A;  2G8V A;  1VQ5 N;  4FO0 A;  3AVG A;  3KLI A;  4K25 A;  4XEI A;  1NGB A;  3TSU A;  3CI5 A;  2QXF A;  3PSI A;  3LM9 A;  2RN2 A;  5LJW A;  3OYN A;  2HMI A;  4IFE A;  3ZX3 A;  3K5L A;  1QSY A;  4FWP A;  3G10 A;  2WOM A;  1RDD A;  3DRP A;  5F0X A;  3M8R A;  2HHT A;  3V9U A;  3HRG A;  4E1N A;  5F1X A;  3OA9 A;  4Y1D A;  3TAF A;  1LWF A;  3KWI A;  1WSG A;  4BGA A;  1XMQ K;  4JI8 K;  1RBR A;  2F96 A;  4JEP A;  3ZEU B;  1S1W A;  2WBN A;  4DTJ A;  3WXI A;  4BRA A;  3PO4 A;  1FKO A;  5ADX A;  5HRO A;  1YTU A;  1EET A;  3ID6 A;  1J53 A;  4DF4 A;  3NHG A;  2QW9 A;  4FWR A;  5HRR A;  1FXX A;  3MXI A;  3UKR A;  2WUS A;  4KTW A;  4Z4G A;  1VSH A;  4DS4 A;  2VG5 A;  4LF5 K;  1UAX A;  4GV9 A;  5FPN A;  2VWB A;  4CCH A;  3H1V X;  4DV5 K;  4RW8 A;  3KK2 A;  1K8A O;  4FWO A;  1R0A A;  2Q31 A;  5GAG P;  2HND A;  2KW4 A;  3O8M A;  3VMF B;  3QEV A;  2Y1J A;  1HPM A;  1I39 A;  4N47 A;  3A5O C;  1KLM A;  4DTU A;  1T44 A;  4ISF A;  1BUP A;  4DTS A;  3AO1 A;  1XMO K;  2A1R A;  4BC5 A;  4BDY A;  4QS8 A;  1U04 A;  1VQ9 N;  4BC3 A;  4H0V B;  2QWR A;  2D0O A;  2DFE A;  3GBT A;  3FR0 A;  3EY1 A;  4E3S A;  1BI4 A;  4FWQ A;  3HVR A;  1C0F A;  3G4S N;  5DMR A;  4CFC A;  4CEO A;  2HHU A;  2IVP A;  2HBK A;  4BDZ A;  1UA0 A;  2OA8 A;  1CXQ A;  3HBT A;  4X66 K;  2VGN A;  3CJB A;  4K8Z A;  3QNN A;  1HYV A;  4DR5 K;  1NGC A;  1KFS A;  4IEI A;  1L3T A;  2E8A A;  2E2Q A;  2O8F A;  3KLH A;  2P9I A;  1KC8 O;  4RW7 A;  2Q36 A;  1RDB A;  1SKS A;  3IS9 A;  4UY8 O;  3QNO A;  2UUC K;  4M3Z A;  3LM2 A;  3MN9 A;  2A3Z A;  4AQY K;  1T05 A;  3HZ6 A;  3F2K A;  3ASM A;  1H1V A;  5C10 A;  5KPZ A;  4BRC A;  3TTC A;  3ZSO A;  5IT9 O;  5CZ1 A;  1ZYQ A;  4GKK K;  2KFN A;  2X78 A;  4M45 A;  3AVM A;  4B8A B;  4JHD B;  3AA3 A;  3DXM B;  4AHV A;  2HNY A;  2QEX N;  4N5S A;  1K9M O;  4FJH A;  3W0L A;  4M3R A;  4DV4 K;  3T69 A;  1JXE A;  1S3X A;  4JRP A;  1V4S A;  2F9T A;  3T1H K;  2NRR A;  3HM8 A;  3MN6 A;  3V1O A;  4KH5 A;  1RBS A;  1U45 A;  3RSE A;  2GEM A;  4KHY A;  2JWK A;  2G8H A;  4CHO A;  1VAZ A;  2HST A;  1HNW K;  5C2D A;  4NCG A;  4FOE A;  3K57 A;  2O8E B;  4CZG A;  4MLE A;  2OPS A;  3L2V A;  1NK6 A;  4BC2 A;  4WQ4 A;  2V52 B;  3NBP A;  3LDN A;  4KH6 A;  3O80 A;  4CVN E;  2GBZ A;  4FZZ A;  3IUC A;  3WXJ A;  1Q81 O;  5AQY A;  1SUQ A;  2FSK A;  2HW3 A;  4DFJ A;  1XI1 A;  3VQQ A;  4WQ4 C;  2P9K A;  2HVI A;  3JSM A;  1L3V A;  2P9P A;  5EOY A;  4FVU A;  3V81 A;  3SUO A;  3CQY A;  5T7B A;  3R8E A;  1NK0 A;  2AA4 A;  4JK8 A;  4XH1 A;  5BR8 K;  1NKB A;  4FJN A;  3KLE A;  3SCX A;  4KHW A;  2X6S A;  4BG8 A;  3VF6 A;  5C15 A;  1DTT A;  5FDL A;  3SJJ A;  4BRD A;  4DTR A;  1DT9 A;  3AGR A;  1XNR K;  3HM9 A;  1UWB A;  1KVA A;  4HHT A;  3LL3 A;  4M41 A;  4O8K A;  1FK9 A;  4IXC A;  3ATV A;  2E1Y A;  3M1F A;  4B9V A;  1CLQ A;  2P5G A;  3QB0 A;  1JL2 A;  4U7B A;  4DU3 A;  1VSI A;  3JS6 A;  1TUU A;  1U6Z A;  4LH5 A;  2YNF A;  5D3G A;  1N32 K;  1BQN A;  3QEX A;  1WSE A;  2HMP A;  2ZJQ L;  2HNZ A;  4JI7 K;  1DEJ A;  3U9Z A;  4DMN A;  1Y97 A;  3LDP A;  1JLG A;  5JVH L;  1G99 A;  3EEQ A;  1TKT A;  2ZQB A;  1BHL A;  3SMS A;  5HOO A;  1C1C A;  3V1Q A;  3C7N B;  1NGH A;  1GLD G;  1RT3 A;  4CED A;  4DSL A;  1Q9X A;  4M3U A;  2QI2 A;  1D5A A;  3L3V A;  1U4B A;  4JKC A;  1B9D A;  1L3S A;  1T3V A;  4M3T A;  5DM7 L;  4IDK A;  3IRX A;  1LV5 A;  4FZY A;  4DCH A;  4NYF A;  3VQ5 A;  4JRQ A;  3PO5 A;  1RT4 A;  4JI1 K;  3K9J A;  3VQ9 A;  4IWV A;  4ELU A;  3I55 N;  4DF8 A;  3K58 A;  5CYM A;  3SYZ A;  2OTJ N;  3PY8 A;  4E0D A;  1RDW X;  4O0I A;  4UQG A;  2Y1I A;  5BR9 A;  4H4O A;  2I7N A;  1ZXO A;  2D0B A;  4M7X A;  1C1B A;  4DV7 K;  4LF9 K;  3THV A;  4JI2 K;  4Z0U A;  4Z94 A;  1WOQ A;  3LP2 A;  3LAL A;  1DTQ A;  3D2F B;  2A42 A;  3ISN C;  3OBY A;  4H0Y B;  3PX0 A;  5J2Q A;  2IS3 A;  3O4N A;  4DUY K;  3EN9 A;  3QFP A;  3R1X A;  4JNE A;  1IBL K;  4FZX C;  3FZL A;  3P38 A;  2NRV A;  4BRM A;  1ILY A;  2NRH A;  4QCL A;  4B3T K;  4LF6 K;  4LF4 K;  2AP1 A;  4FLZ A;  4C8K A;  2J4R A;  3SAG A;  3AVA A;  3KZB A;  4A5A A;  3O08 A;  2QK9 A;  1WSF A;  4EZ6 A;  4HCC A;  1KCF A;  3O1W A;  1JJ2 M;  4CBW A;  1A5V A;  2ZGY A;  4CJU A;  2DFH A;  3FE1 A;  1W9H A;  1WLJ A;  1ZBH A;  4BR2 A;  3SQ0 A;  2ZJP L;  1ZBL A;  3NGY A;  1QSS A;  5AQT A;  1HKC A;  2G8F A;  2QWN A;  1R59 O;  3LP0 A;  3RRH A;  4KHU A;  5JIC A;  1U48 A;  1SS6 A;  1U47 A;  3ZCM A;  4JAX A;  3KIO A;  1Z05 A;  5AFU A;  3OYD A;  1YJ9 N;  1X1P A;  2PYL A;  3TI0 A;  4DQR A;  4HWI A;  2YX6 A;  3WNG A;  5J2N A;  4F8R A;  3NMU A;  3DOL A;  2QKK A;  4IG3 A;  2OPP A;  4DQS A;  4ILH A;  4KO0 A;  3OS0 A;  5BRE A;  2JWL A;  5AQH A;  1NOZ A;  3SV3 A;  2EHG A;  3IAY A;  4A62 A;  2B6A A;  3K5O A;  3HOS A;  1I3A A;  3B6O A;  3TAB A;  4KI4 A;  4KI6 A;  3QEI A;  4OKK A;  4K0K K;  1IG8 A;  3KHY A;  3G25 A;  4H5T A;  1P90 A;  1TKX A;  1IH7 A;  1DLO A;  4DR7 K;  2V7Z A;  3DLG A;  4CZE A;  4KTQ A;  4CHP A;  4WYB A;  1BA1 A;  2ZM6 K;  1T8E A;  5BRH A;  2NLX A;  4B9Q A;  5HRS A;  3RMB A;  3MK6 A;  4GVE A;  1EP4 A;  2BH1 A;  3VF2 A;  4CF2 A;  4JKD A;  3QEW A;  1ZBU A;  2YHW A;  3NF7 A;  3ULD A;  3QDK A;  4JHD A;  1VSD A;  2GV9 A;  1JLB A;  3DXM A;  3TAM A;  1KXP A;  2KZM A;  1RDC A;  3A5M C;  3PX6 A;  5AZJ B;  1BIU A;  4FJM A;  3C6H A;  3HST B;  4JV5 K;  3O4Q A;  4XIU A;  2VWK A;  3DJC A;  4CFD A;  2O8C B;  3CQX A;  4DU1 A;  2QWM A;  1WBD A;  3OYA A;  4IG0 A;  1EWR A;  1WAF A;  4YY3 K;  4Q5V A;  4FJG A;  2O8E A;  3LP1 A;  1HKG A;  5E26 A;  3QLH A;  1EQY A;  1QHT A;  1JLE A;  4BE1 A;  1NJZ A;  4YHH K;  1EO1 A;  2D0A A;  4IJA A;  1B92 A;  3ULE A;  4DSK A;  2QA4 N;  3C6A A;  1YHQ N;  3P4I A;  5HRP A;  4DV1 K;  2XY7 A;  3UIQ A;  4OX9 K;  4KRF A;  3VTH A;  4FK0 A;  3CCM N;  1S1T A;  1F21 A;  4M3X A;  4DU4 A;  4JD2 B;  3EO3 A;  1JCF A;  4CJL A;  3CD6 N;  1GLF O;  4JKH A;  1RTI A;  4FWK A;  4CEF A;  3SPY A;  4NCA A;  1HYS A;  3I0R A;  1QQN A;  1Z25 A;  1GLB G;  1BIS A;  1NK7 A;  5H1S Q;  1ZBF A;  4DFM A;  5GIO A;  5JMV A;  4IOA L;  3VQP A;  5LY3 A;  1HNV A;  4E7I A;  1YI2 N;  2KTQ A;  1HYZ A;  2Z1J A;  2GUP A;  4IO9 L;  4H4M A;  4K41 A;  3BGR A;  2IOC A;  3LPT A;  3ZT1 A;  4PL7 A;  3MXM A;  1BG3 A;  1YF5 L;  1C0G A;  1RGI A;  3THY A;  2GTD A;  3ENH A;  3OS1 A;  4CJK A;  4DFP A;  3BP8 A;  3K9K A;  4F3T A;  1W97 L;  4YOT A;  3L2U A;  1CZB A;  5EY4 A;  3E1Y A;  1ATR A;  4FJ7 A;  2P5O A;  2HBL A;  4BRF A;  4RWT A;  4QOZ B;  3AVJ A;  4PQU A;  2A6A A;  1JCE A;  3VEV A;  4CEZ A;  4L3Q A;  5C24 A;  4M7Y A;  3G0Z A;  5HRN A;  1QQC A;  4H5R A;  3B8A X;  1C0M A;  2LSN A;  4DQP A;  2KKZ A;  1IKY A;  4C8N A;  4AF1 A;  3KVG A;  4I7F A;  4Z4H A;  2PYJ A;  4BRL A;  4LFB K;  4CD1 A;  1X9S A;  1VQ4 N;  1O13 A;  4IBN A;  3CXC M;  5ADX H;  4KTZ A;  4CJW A;  5A2Q O;  3P39 A;  4W5T A;  3SNN A;  1VQ8 N;  2AJQ A;  1RBT A;  3VQ8 A;  4C23 A;  1BL3 A;  4CJ4 A;  4B9N A;  4HCB A;  2E6L A;  1CXU A;  4AM6 A;  3L4Q A;  4N56 A;  5E84 A;  1S9G A;  2OPR A;  4OLB A;  4FPB A;  1LWE A;  3CME N;  5AQR A;  3KTQ A;  4E7L A;  4NYN A;  3WQT A;  4PA1 A;  1X9J A;  1TL3 A;  3CG7 A;  4OLA A;  4W5O A;  1L3U A;  2XY8 A;  3RRG A;  3TAN A;  4CZF A;  1KD1 O;  2NRZ A;  3ZSQ A;  4CJE A;  4X64 K;  4DV6 K;  2NUB A;  1V4T A;  4BY9 C;  4IZ9 A;  1NGE A;  4YFU A;  1QSL A;  4CK3 A;  4OO1 J;  5BPM A;  5K14 A;  4KV8 A;  1Z6R A;  2P9N B;  3VET A;  4CHY A;  3M8S A;  1VQO N;  3SBG A;  3EZ5 A;  3J7Z O;  3K2P A;  4IDH A;  4CZL A;  1EKE A;  4DR1 K;  1Y64 A;  3NVK A;  3VES A;  3OYH A;  4ID1 A;  2IGI A;  5M1P A;  3EKU A;  4DTO A;  1QZ5 A;  3EE8 A;  4RW4 A;  3N4Q A;  4EAH D;  4CZK A;  2QM1 A;  3HP9 A;  1WB9 A;  2OYQ A;  3VQA A;  1RBU A;  1U2V B;  2B4J A;  5ELZ A;  4FWN A;  1IO2 A;  2FSJ A;  2FXU A;  3GG4 A;  3GE1 A;  1VQ7 N;  3NF6 A;  3L4I A;  3CF5 L;  5CE3 A;  2A40 A;  4C8M A;  3VA0 A;  4E19 A;  3FLC O;  3VGK A;  4YOR A;  2GX9 A;  1LAW A;  1A5X A;  4B9S A;  2Q3S A;  4CF1 A;  4LF7 K;  4BRH A;  3CCJ N;  3L2R A;  3V4I A;  1W7A A;  4CEB A;  3VQ4 A;  3CCV N;  3LDQ A;  3BZK A;  1HUX A;  4CJ5 A;  2P9U B;  4N41 A;  2VG7 A;  4IJN A;  5TKW A;  4G9Z A;  5EVZ A;  4E7J A;  2B5J A;  2WON A;  5LL6 Z;  4BQZ A;  4EHT A;  3ZET A;  3F9M A;  4LD0 A;  4Q0B A;  1N33 K;  1KVB A;  3KWG A;  4AIL C;  2W40 A;  4OPJ A;  3M5R A;  2DPN A;  4CW7 B;  4FJX A;  1KLN A;  5AQX A;  3L2Q A;  5DK5 A;  2HBM A;  4CEC A;  5KRT A;  4Z4F A;  3FZM A;  4Z4E A;  3A5L C;  4H0O A;  4JI5 K;  4I2Q A;  1JCG A;  2NNW A;  1YIT N;  1GOB A;  3U9D A;  2F7T A;  4KFB A;  2XO7 A;  1HMV A;  4CD3 A;  3LDL A;  4JKF A;  1NLV A;  1MWM A;  5AZJ A;  3CHW A;  3LAM A;  5HBM A;  5AQU A;  4A5B A;  2HB5 A;  3GL1 A;  4HUE A;  4B8C A;  3ZSV A;  1OVY A;  2O8C A;  1C0U A;  4BRG A;  4J2E A;  5AQG A;  1NG9 A;  3EZW A;  1TYQ A;  3O1B A;  4PKH A;  3KD5 E;  2UXB K;  4B1Z A;  2BGG A;  4JK9 A;  3DXK B;  1HX1 A;  3ENO A;  4LFC K;  3M6G A;  5CR4 A;  1Q9Y A;  1HPZ A;  1ATS A;  3VQB A;  4DV2 K;  4BR7 A;  2YKN A;  3LDO A;  4NLB A;  4YOU A;  3HYF A;  1XUP O;  4XH5 A;  1HNX K;  1J5O A;  4MQ3 A;  4KB0 A;  4OGE A;  4AHS A;  4U67 L;  3VTI A;  1QHA A;  3AVF A;  4JD2 A;  2HOE A;  1VQM N;  1TL1 A;  2NZT A;  1VQL N;  4X62 K;  3JXU A;  2ASO A;  4EIA A;  1TGO A;  3RWU A;  5AQJ A;  4DHY A;  2IVN A;  5C2F A;  3M8Q A;  1HLU A;  3NH1 A;  5KPR A;  3QEP A;  4FL9 A;  4DTM A;  4PKG A;  1RDA A;  5AQN A;  2ITM A;  4CFA A;  1K8K B;  3VEO A;  3V6D A;  1HJR A;  2P9L B;  1SKW A;  3CYM A;  3OY9 A;  1X3N A;  2YNH A;  4RW6 A;  3FZH A;  1T6C A;  3AA5 X;  3QIO A;  1OVQ A;  3IFR A;  3AO5 A;  4TSX A;  4CIG A;  1NJY A;  5FLX O;  2ZGZ A;  1GOA A;  5AQP A;  3CER A;  4O5F A;  1QTM A;  4BRP A;  3NAE A;  3VEZ A;  2EWS A;  2WC9 A;  1Q8I A;  3ZX2 A;  5M1F A;  1NNE A;  3T1A A;  4BVP A;  4BR5 A;  4WE1 A;  5CZ2 A;  3AY9 A;  5AZI A;  4JI4 K;  3I56 N;  4DTN A;  4H8K A;  1XQS C;  5GAE P;  2FF6 A;  3IMX A;  2XRI A;  1SAZ A;  1T03 A;  4C8O A;  3IKM A;  5FPD A;  5AQL A;  3SQ2 A;  1GLA G;  5JVG L;  1LWC A;  3WNE A;  1X3M A;  4H0T B;  1IKV A;  3O9R A;  1XWL A;  2G8I A;  3QIC A;  3OYF A;  3TWH A;  3H1Q A;  4FK2 A;  4O5B A;  4AHC A;  3RTV A;  1NKE A;  2RHK A;  3V9Z A;  1HQU A;  4AHR A;  1VSF A;  4QS7 A;  1ITG A;  1BU6 O;  2W6K A;  2GWJ A;  1HNZ K;  3KD1 E;  1KFD A;  3TR8 A;  3LAN A;  3C94 A;  3V9S A;  3HVT A;  3KK7 A;  4ZTJ A;  2OTL N;  3PX4 A;  1JLF A;  4DR2 K;  4EP5 A;  3VEN A;  3VOV A;  4CE9 A;  4CER A;  5SZT A;  1NKC A;  3S3O A;  3C0B A;  5AFU H;  3CFR A;  3VPZ A;  3DLE A;  5HLF A;  1IBK K;  4NB4 A;  1MA9 B;  4HUF A;  4B3S K;  2P9N A;  3L6Q A;  4JKG B;  4CJF A;  3Q7C A;  2CH6 A;  3AO2 A;  3BY5 A;  1HNI A;  3SI6 A;  2FC0 A;  4FLY A;  3NE6 A;  3CET A;  4GNI A;  1VK0 A;  2RE2 A;  2IVO A;  3L2W A;  5M1Q A;  1NU0 A;  1ESV A;  4NLC A;  4CF9 A;  4E7H A;  3S3M A;  3OJS A;  3HSC A;  4J2A A;  4CGH A;  1Q18 A;  4KPY A;  3C6T A;  4CZI A;  5BRD A;  4FXD A;  3ZEU A;  4KH4 A;  4YOW A;  1VSL A;  5AR0 A;  1NK4 A;  4CBU A;  2V7Y A;  3ZLJ A;  3ZX0 A;  3V9X A;  1KQS M;  3H08 A;  4LY7 A;  3NH0 A;  4KAZ A;  2FF3 B;  3RMD A;  4XH4 A;  4JI0 K;  1SV5 A;  1EX4 A;  4G1Q A;  2WFB A;  1RFQ A;  4CGD A;  3PUF A;  4J2D A;  3RMC A;  3G6E N;  2RPI A;  3WXL A;  3WXM B;  3NFA A;  3A0I X;  1XHZ A;  4F2R A;  4DSF A;  1XNQ K;  4WCE L;  1TUY A;  3H3O B;  5J2M A;  3ZT0 A;  2WTU A;  4DR3 K;  3SLC A;  2F4V K;  1N8R O;  1FKP A;  1TKD A;  5FPM A;  4CJ7 A;  4WFA L;  3GDQ A;  1NMN A;  3HPO A;  3U3Y A;  3VN5 A;  1NGG A;  3MX5 A;  2Q0R A;  3BEX A;  1BCM A;  3T1Y K;  1C0T A;  3O3G A;  4FYD A;  1IJJ A;  1YJW N;  1E4F T;  3MX2 A;  1QVG M;  2O8B B;  3MCA B;  5AQW A;  2E2P A;  4B08 A;  4DLE A;  1RT6 A;  1S1X A;  2HHV A;  5AQM A;  3UKU B;  4RG8 A;  3OTO K;  4MO4 A;  3ZSR A;  4DB3 A;  3K0S A;  4K42 A;  1YT3 A;  4B1U B;  4E1J A;  2IDO A;  1RBV A;  2QWL A;  4R5P A;  2HHX A;  2NRW A;  4ELV A;  1LW2 A;  3AGK A;  5FPE A;  3DLK A;  1M1K O;  1J6Z A;  5BRF A;  1J9A A;  2HHH K;  4QS9 A;  5CYQ A;  2YHB A;  3AA2 A;  3CFO A;  3PIO L;  3T3F A;  3DLB A;  4FK4 A;  1JLA A;  3EKS A;  4CIF A;  4KHQ A;  2F8T A;  2ZJR L;  3MN5 A;  1VQP N;  3HOT A;  1WNS A;  4YNQ A;  3U8X A;  1OH7 A;  2QTD A;  4GV6 A;  2ZE2 A;  3KKS A;  3TPQ A;  1VQK N;  3SUP A;  3TTD A;  2QWO A;  3O6W A;  2BUP A;  3UB5 A;  5FRM A;  1EXQ A;  5GIN A;  4PHT X;  2DTU A;  3AVK A;  4BRN A;  5GAH P;  1BCO A;  4CHZ A;  4Z4C A;  5MLC Q;  1ASU A;  3DLH A;  1NJW A;  3PSF A;  3F73 A;  3V9W A;  2O8F B;  4CK1 A;  1OH6 A;  4KHN A;  1GOC A;  2PZS A;  1VSK A;  4FM2 A;  3S9H A;  1QQO A;  4F2S A;  3MED A;  2CGK A;  3SUN A;  2KHO A;  4B3R K;  2JLE A;  3CJ9 A;  5AJ3 K;  4H5N A;  3O3H A;  1S6P A;  4DR6 K;  4E1M A;  5GIP A;  1K8K A;  3SBT A;  1VQ6 N;  1RT5 A;  4A59 A;  4KB1 A;  4CGG A;  5AQS A;  3SPZ A;  4I9L A;  4OPA A;  4BGB A;  4CFB A;  1WBB A;  2DY4 A;  4KHP K;  4IO8 A;  1N6Q A;  2Z1H A;  1BGX T;  1YUW A;  3HXM A;  1DKG D;  3CPW M;  4M63 C;  1K73 O;  1KAY A;  1NGA A;  4Y1C A;  5KGX A;  1C1A A;  2UUB K;  5B8H A;  4BR4 A;  3J80 O;  4N76 A;  4CJQ A;  2RF2 A;  4JI6 K;  3FZF A;  1NGJ A;  4MO5 A;  1Q7Y O;  2D1K A;  4DUZ K;  1TAQ A;  4IKF A;  3VQ7 A;  3DWL A;  4FVM A;  1GLC G;  1VSE A;  1E4G T;  2X6N A;  1I94 K;  3TAR A;  2ZD1 A;  4MDA A;  1LOT B;  4B1X B;  2FBY A;  2ASP A;  2OAN A;  4NO7 A;  5AQO A;  3HPG A;  3B6P A;  1NGD A;  4FLX A;  4F4K A;  2HF3 A;  5EU7 A;  3ZT4 A;  3CFP A;  2FBV A;  3U6F A;  3ZYY X;  4BRE A;  1XC9 A;  1S6Q A;  4DKW A;  4DV3 K;  4I6M B;  4CIE A;  2OZS A;  3O3F A;  2YI1 A;  1BO5 O;  2P9K B;  2E88 A;  2A5X A;  3CCE N;  4BWJ A;  3RR8 A;  3HPH A;  1J5E K;  3C7N A;  3E9P A;  4BRO A;  3D45 A;  2G8U A;  3A2F A;  1TKZ A;  3R9P A;  3HTV A;  4PUO A;  1KRP A;  2Q2R A;  1TK0 A;  1QVF M;  4GW6 A;  1LW0 A;  5LJV A;  4EZ9 A;  2CGL A;  3R3L A;  4CJ3 A;  3WNH A;  2W41 A;  3RR7 A; 
#chains in the Genus database with same CATH homology
 5LMN K;  1XNQ K;  4V19 S;  4NXM K;  4B3R K;  5AJ3 K;  4DV4 K;  4DR3 K;  4DR6 K;  4DR1 K;  2F4V K;  3T1H K;  2UXD K;  3JAM O;  1IBM K;  4K0K K;  4LFA K;  2UXB K;  5IWA K;  4LF5 K;  1HNW K;  4KHP K;  3T1Y K;  3J7Y P;  4DR7 K;  4LFC K;  4JI1 K;  4DV5 K;  4DV2 K;  5LMU K;  2ZM6 K;  1HNZ K;  4B3M K;  4CVN E;  1HNX K;  1N34 K;  4DV7 K;  4LF9 K;  2UUB K;  4JI2 K;  4JI3 K;  4DR2 K;  3J80 O;  3OTO K;  1XMO K;  2UXC K;  4X62 K;  3J7A P;  2UUA K;  3J81 O;  4JI6 K;  1IBK K;  4LF7 K;  4DUZ K;  4NXN K;  4B3S K;  4DUY K;  1I94 K;  4LF8 K;  1IBL K;  4X66 K;  4LFB K;  4GKJ K;  5BR8 K;  4JV5 K;  1FJG K;  2HHH K;  4B3T K;  4LF6 K;  2VQE K;  4DR5 K;  1HR0 K;  4LF4 K;  5A2Q O;  4YY3 K;  4DR4 K;  1XNR K;  5LL6 Z;  4DV3 K;  2VQF K;  1N36 K;  2UU9 K;  4YHH K;  1N33 K;  1J5E K;  2UUC K;  4DV0 K;  5FLX O;  2E5L K;  4CW7 B;  4DV1 K;  4OX9 K;  1N32 K;  4X65 K;  4AQY K;  4JYA K;  4JI0 K;  5IT9 O;  4JI5 K;  4X64 K;  4DV6 K;  4GKK K;  4JI7 K;  4JI4 K;  1XMQ K;  4JI8 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...