1JLGA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
538
structure length
529
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 132
structure length 529
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlgA05
5DLGA 4CJEA 4CGJA 3OYKA 4DU1A 1DTQB 3KLVA 1WLJA 4OKKA 5J2MB 2C2DA 4WXOA 3SFGA 1JLFA 4G3IA 1JXEA 4W5NA 2DFFA 1U47A 3HVTA 2KQ2A 3WNFA 2UVUA 4J9MA 4DFMA 4IQXA 2DFHA 3CFPA 1JLFB 2X6NA 1LW0A 4FJIA 2HB5A 1BGXT 2B4JA 2BANA 2A1SA 3CJ2A 3HVTB 1C1CA 5HRRA 3NAHA 4ECXA 1VSIA 5KGXA 2F8EX 4FJ5A 4FYDA 3ZT4A 3EZ5A 3DLHA 1LW0B 3VQ7A 3UR0A 2BANB 3HL8A 1Z4UA 1C1CB 4M3UA 4IG0A 1RTJA 5EWGA 5KFKA 4I9LA 3AVKA 2P5GA 1NJWA 4BE1A 4BWMA 1T05A 3FQLA 3AVNA 3P83D 3TI0A 1SKWA 4KPYA 1KSPA 3CDEA 5KFGA 4CFAA 1RNHA 1WNSA 4QCLA 2ATQA 4IG0B 4ZP9A 1RTJB 4M94A 3MEEA 4O4GA 1G15A 1UAXA 1JLEA 5HRNA 4DTSA 1T05B 1RBUA 3QIDA 5I42A 3NL0A 4NYZA 3G6VA 4AHRA 3PW7A 1L3TA 2RN2A 3MEEB 4O4GB 1JLEB 5L9XA 3OL8A 4DL7A 5F8NA 3OYFA 5KFFA 1RT2A 4K4VA 3RRGA 4MQ3A 5C42A 4DL2A 5I42B 1YTAA 4F3OA 2I5JB 3HVWA 3G10A 2OYQA 2W42A 3HO1A 5KFHA 4O3NA 5DG7A 2E4LA 3CDUA 5KG3A 3B6PA 3H5UA 3OLBA 1RT2B 2BRKA 2FVCA 4O3QA 3KHHA 1UWBA 3SI6A 2GIQA 1KVAA 3O3HA 5C42B 4NYFA 5F8MA 2D3ZA 1F21A 5F8GA 3AVGA 2V9WA 4OVLA 3RB0A 1L5UA 4DG1A 1N56A 3FFIA 4ELTA 1TQLA 3Q8SB 3TAMA 3F73A 1NK4A 4OGCA 1RT5A 3D5MA 3NGDA 4DTUA 1TAQA 3TWHA 1BISA 4KFBA 1FK9A 4HTUA 4ECQA 4ED2A 4DG1B 4Z4CA 4Z4IA 3FFIB 4WZQA 3D45A 3TAMB 1DTTA 1C0UA 4DQQA 3OL9A 3CJ3A 2F96A 4CEZA 1LAWA 3ISND 4QW8A 2XCPA 3V1OA 4KFBB 1FK9B 4M3YA 2AWZA 5KFTA 5FRMA 4ED3A 4E19A 1DTTB 2PYJA 1NK9A 4LQ9A 1VRUA 1XR6A 3HXMA 4CJSA 3M8PA 4ED1A 4FK0A 2FLPA 4NCGA 3H5SA 5L1JA 1QAJA 1QTMA 2WTFA 3LWLA 2E9ZA 1D9DA 4TSXA 2FVPA 3QNNA 3CDWA 3GQCA 4MFBA 3P5JA 1VRUB 3VQAA 3HPHA 3OSPA 3KKSA 2D41A 3M8PB 5KG0A 1JLAA 4NCGB 1SH2A 1VSLA 4CERA 3I0RA 2GIRA 2Z1HA 4MFBB 1RT6A 1WSJA 1NK7A 5KRTA 3OYIA 1L3VA 3DYAA 3V6KA 1SL0A 1JLAB 4PUOA 4CEDA 4H4MA 4DF4A 1RBVA 1S1UA 3KLHA 2XGQA 4AHTA 4I9QA 3NHGA 3MR6A 4CHOA 3I0RB 1A5XA 4B9UA 1RT6B 4F8RA 1N48A 4UQGA 3F9KA 1RT3A 3DYAB 4OJRA 4Q0BA 4CGFA 4PUOB 3DLEA 4H4MB 1S1UB 3KLHB 4KRFA 3OYBA 3BREA 2VA2A 4CF1A 4BE2A 1X9WA 2CJQA 1WSGA 3ZT3A 3NH1A 3AVLA 4AH9A 1RT3B 4EZ6A 4Q0BB 4YR2A 2AJQA 4LY7A 3ZSYA 3DLEB 4EBDA 4OPJA 4B8CA 3UIQA 4ZTJA 4E7HA 4IKFA 4GVMA 2RF2A 3H59A 2QV6A 3L2VA 2ALZA 2W9BA 1S0OA 4IR9A 2R2UA 3OJUA 4DU4A 3VQ4A 4FJHA 3SI8A 4YFUA 2RF2B 3DRPA 3AA4A 4EBEA 1LW2A 3VQSA 4LSNA 3KLFA 4NLWA 4IG3A 2E9TA 1GX6A 2W9BB 1Z25A 1L3UA 4CGDA 3M9NB 4HYKA 4FZYA 1TVRA 5KT6A 5F8LA 2HNDA 2Q3SA 4Y2CA 3DRPB 1LW2B 2G8KA 4LSNB 2JEJA 3KLFB 4IG3B 3GV7B 5HRSA 3QNOA 4W5TA 3AVCA 3LP3A 1S6PA 1TVRB 3LZIA 3QZ7A 2HNDB 5T14A 4J9PA 3VQ8A 5HBMB 4TQRA 4J2BA 3SPYA 4EP5A 3EPGA 4DLEA 4DS5A 4JV0A 4E0DA 2UUWA 1D1UA 3KMSA 3QEPA 3DLRA 4JS5A 4Q45A 1S6PB 2ASDA 1RDBA 4M3TA 3HYFA 2ZKUA 4TY8A 1TKZA 2FBXA 3WNEA 4CEOA 3SCXA 3SV4A 1ZBLA 5KFYA 5J2NA 2G8FA 4Q8EA 4QW9A 3DLBA 2WRMA 3TAQA 3HHKA 4TY8B 1TKZB 4O3RA 1NK8A 4M3RA 4IFYA 4QWEA 4EEYA 1SKRA 4ID1A 3K5MA 4GMJB 5J2NB 4J9SA 3VQQA 3L8BA 2P5OA 3SUNA 1XC9A 2JC1A 4CJFA 4TLRA 3T3FA 2XWYA 4HKQA 5KFVA 3MEDA 1HYVA 3OHAA 2OH2A 4IFYB 4ECVA 1VSMA 4AHSA 4RW8A 3RB3A 3GIMA 2HHXA 5J2QA 1SV5A 3V1RA 2AU0A 1RTIA 3RMBA 2C28A 2HVIA 3MEDB 3M9MB 3NE6A 3NGIA 1TGOA 4CJPA 1A5VA 2YKMA 1C0MA 1T3NA 2CKWA 3H4DA 4RW8B 2B43A 2OPQA 1SV5B 5J2QB 3FSIA 2AX1A 5CZ1A 1RTIB 1NJYA 4K50A 3FQKA 3L3UA 2YKNA 5CYQA 4KB7A 1VK0A 1K6YA 1XHXA 4HVJA 5F9NA 4B08A 1S10A 4DL4A 3JSMA 2YKMB 4CJTA 4DMNA 3RMAA 1S1TA 4TY9A 3NBPA 3H08A 2EHGA 1R0AA 1OS5A 2OPQB 3G86A 4TYBA 2WHOA 4QOZB 3MXJA 2YKNB 2YNFA 5CYQB 5FRNA 4WYWA 2LSNA 2PZSA 3JSMB 1S1TB 4CK1A 5KFNA 3NBPB 5KG4A 2OPSA 4B9MA 4FJJA 1R0AB 4BDPA 5D3GA 1WSFA 4CJKA 2YNFB 4DWIA 1A5WA 3RWUA 3K2PA 2P1JA 2R8KA 1JX4A 3KK1A 2XY6A 1S9FA 2OPSB 3TVKA 3DDKA 5D3GB 1HNVA 3BSAA 1TL1A 4IRCA 3AO1A 5KRSA 3ZT1A 4ZPAA 1WSIA 3MEGA 1B9DA 5JUMA 4R5PA 3KK1B 1IH7A 4HUGA 4CIEA 4CJWA 1RA7A 4DQPA 3U3GA 1T94A 3LALA 1Q9YA 4IRDA 4OPKA 4CCHA 3VQCA 1HNVB 1TL1B 2HMIA 3AVFA 4KTWA 3HVRA 4ECTA 3MEGB 2XY5A 3PX0A 3LWMA 3OYDA 4R5PB 2X74A 2QXFA 4H4OA 5DLFA 1JLBA 4EO6A 3OSNA 2HMIB 4K8XA 4KHUA 3FRZA 3CVKA 1MMLA 2BRLA 3AVJA 4CIGA 1GOCA 1U48A 4H4OB 5SWMA 1JLBB 4YMEA 1C0TA 2WK4A 1SH0A 3AVIA 1N5YA 4WYLA 1SL1A 3KK3A 1REVA 3RB6A 4E7JA 1TK0A 4JUZA 2W7OA 3BQ1A 3HM9A 1TL3A 1IKVA 1NJXA 3VQEA 4FZXC 1C0TB 2RPIA 4AHVA 3RB4A 1IKXA 3KHLA 1N5YB 3KK3B 2FJVA 1ASWA 1NOZA 1REVB 1TL3B 4YR0A 3TANA 2PYLA 1IKVB 1Y97A 4FVMA 4HCCA 5KT5A 5L1LA 4DSIA 1NKCA 1IKXB 3QIOA 4CEBA 2PY5A 1BQNA 4JS4A 1JIHA 3DI6A 4H54A 2W7PA 3HP9A 4CEEA 4KHQA 2Y1JA 3JYTA 4CE9A 2E6MA 4O3OA 1S5JA 2WOMA 4KV8A 3QGIA 3KMQA 1W9HA 4FLWA 4Q8FA 1NJZA 3LPUA 1BQNB 2D3UA 3GILA 3DI6B 4FBTA 2UUTA 3MFIA 4NRUA 4HUFA 4KB0A 3JYTB 2X78A 2XI3A 2FVSA 4CJLA 4JRPA 4E1NA 2WOMB 4KV8B 4E7KA 1CZ9A 3D28A 3KLEA 1FKOA 1WSEA 4NLSA 2AGQA 4FLXA 3H5YA 4B9VA 1VSKA 4K4YA 3G6YA 2FLNA 5KFJA 1YVFA 2ZD1A 4CGHA 4DTJA 4WE1A 3PW4A 3CFRA 3KLEB 1FKOB 3H2LA 3H4BA 2R8HA 5SZTA 1XI1A 4NCBA 3TABA 1RBRA 3RTVA 1N6QB 2B6AA 4FLTA 2HWHA 2I5JA 1TK5A 3OS0A 4KHMA 2Y1IA 3PR5B 2ZD1B 5K14A 5CZ2A 4CJ3A 4WFYA 4WE1B 2GC8A 3SFUA 4J2EA 4TXSA 1KVBA 4URGA 4O44A 3ICLA 2DY4A 4CK2A 2B6AB 4IH7A 2V4QA 3HKWA 3C94A 3MXIA 3OYGA 1DLOA 5K14B 2DTUA 1XWLA 5KGWA 4O4RA 4KO0A 3MECA 4URQU 4O44B 4JV1A 3DLKA 4CFBA 3KOAA 3NKYA 3ULDA 5EWEA 4EO8A 3NDKA 1HNIA 4FK2A 3M8SA 1DLOB 4DFKA 4FM2A 4E3SA 4KE5A 4IDKA 1SH3A 4KO0B 3MECB 3CG7A 2IM3A 2R8IA 5KT2A 1RCHA 3KKRA 4KSEB 3VN5A 5DGAA 3V81A 3DLKB 3KNAA 1XR7A 4MK9A 4AILC 1HNIB 2VA3A 4FM0A 1S9GA 1JXLA 1CSJA 4IDKB 3IRXA 5KFRA 4ED8A 2C22A 2RDJA 3CJ0A 3S9HA 3V81B 3UDLA 1QUVA 1JL2A 3OY9A 3MF5A 3QZ8A 1S9GB 3PR4A 4O5BA 1TK8A 5T7BA 2KW4A 2AGOA 3IRXB 2IMWP 1B92A 3C6TA 1IO2A 4Z4FA 3PJXA 4EP4A 1VSDA 3V4IA 2G8IA 1WN7A 4ZPCA 3AA3A 3PO5A 1N4LA 3O4QA 3MFHA 1RBTA 4Z0UA 2UVVA 3I8DA 5C24A 3I5CA 3C6TB 3V4IB 4FS1A 2D7SA 4CHPA 2O4GA 3OS2A 1VSFA 3TQ1A 4ZTFA 3K5NA 5C24B 4BE0A 1S9EA 1EETA 3SNNA 1ZTWA 4M3WA 4KKOA 3MR2A 4FJXA 2HHQA 3KHRA 2RDIA 3T5LA 4RUAA 4NLQA 3SQ0A 1T7PA 2VWKA 3AA2A 3SYZA 1K1SA 3ITHA 4OLBA 1S9EB 5CY4A 1EETB 4FJMA 1HQEA 2Z1GA 3GIKA 2F8TA 2HHWA 4KKOB 4NLXA 3ALYA 3IN5A 3L2QA 1EKEA 1HYZA 1TKXA 1QSLA 1Z26A 4I2QA 4M45A 3DM2A 2IBKA 4YP3A 3TAFA 4KTQA 3ITHB 4NYNA 4DL5A 4QWDA 4G1QA 4F3TA 3PZPA 1BCMA 1HQEB 4F2RA 5KFIA 3SJJA 1SKSA 1JXBA 4RNHA 2IS3A 1TKXB 3D0PA 4I2QB 2QK9A 1FKPA 3DM2B 1CZBA 5DQIA 2FBYA 3P1GA 4J9RA 4B8AB 4FM1A 2FVRA 4G1QB 3LP0A 4ECRA 2ETJA 4J2DA 3H5XA 5DQGA 4KTZA 4ZVGA 4AHUA 4OKEA 4RUCA 1FKPB 4IBNA 4R8UA 2UVWA 1T03A 3LP0B 1S97A 4DTOA 1S49A 3CIZA 4NLOA 3OYMA 3KLIA 4QWBA 3CO9A 1NKEA 4B9TA 3BSNA 5KG2A 3GV8B 2G8WA 4R8UB 3VQBA 3V9WA 4PY5A 1T03B 4YNQA 2AX0A 1YT3A 3WNHA 4B9NA 3LP1A 3Q8PB 3S3NA 4CF9A 3KLIB 4DTMA 4RW9A 4ELUA 4DTPA 5HBMA 4OL8A 5KFMA 4XIUA 4LH4A 1T8EA 4ICLA 1Q9XA 4DF8A 4M42A 1KCFA 3QESA 3QGGA 2E9RX 1IG9A 4NLPA 4IKAA 2R2TA 3LP1B 4O3SA 2IGIA 3HK2A 4JLHA 4MIBA 4RW9B 5KFEA 4ED7A 4R0EA 4YQWA 3NH2A 1ITGA 4FJ9A 4MKAA 2EX3A 4ICLB 4K4XA 3CQ8A 3AO4A 5I3UA 4FCYA 2Z1JA 4GC6A 1JLGA 4OKJA 5KFSA 1S48A 3DOLA 1S1WA 2W9CA 1ZTTA 5KFLA 3ZSWA 4EZ9A 4FBUA 5I3UB 4ECSA 3V9ZA 3DOKA 4E89A 3V6JA 4NLDA 2D5RA 2Z1IA 3PV8A 1JLGB 1ZBFA 1WAFA 3CM6A 3DOLB 1S1WB 2W9CB 5DG8A 5KI6A 2BE2A 4FJLA 2ATLA 1BIUA 3E51A 3DOKB 1NNDA 2GV9A 2EC0A 1RAJA 5FDLA 1X9SA 3ZCMA 1Q8IA 1WAJA 4NLUA 1QSSA 2BE2B 2ZQBA 3GV5B 4M41A 3HP6A 4IFVA 3QGHA 4KAZA 4CESA 4GC7A 4CHNA 3OYJA 4F50A 5FDLB 4Y2AA 4J9OA 1QS4A 3Q8RB 3C6UB 4HUEA 4KHNA 4E1MA 3G0ZA 2HWIA 3NF9A 1GX5A 4IFVB 4DSJA 1RBSA 2IM0A 2R8JA 3AVBA 4ED0A 4ZHRA 2XO7A 2AGPA 2XY8A 3OYAA 1K1QA 3OYNA 4FJKA 4E7IA 3TAPA 1RA6A 4PQUA 1NK0A 3AV9A 5HRPA 4K8ZA 4ZHRB 3BSOA 5KG1A 4Y34A 5KFAA 1BCOA 1EP4A 3BQ2A 3KD5E 2O4IA 4PQUB 1C2PA 3VQ9A 4AHCA 3M8QA 2WB4A 2R8GA 4DQIA 3ZSQA 3QIPA 2W9AA 1RT7A 2ZE2A 1LWEA 1CLQA 1EP4B 2IJFA 3PHEA 2KFNA 3T5KA 4Q44A 1GOAA 4Q43A 2J6SA 3QLHA 4RW6A 3PVXA 5KFOA 1KFSA 3M8QB 1SUQA 2YNIA 3ASMA 3QIPB 1RT7B 2ZE2B 1LWEB 4FXDA 1ASUA 1C1BA 3NCIA 3SZ2A 4ZP6A 4LH5A 3QLHB 4F4WA 4DSEA 4RW6B 1BHLA 5F8IA 3AO2A 1ZBUA 1TKDA 4H8KA 3RRHA 1SUQB 2YNIB 3M9OB 3RMCA 1I6JA 3OVNA 2VG5A 1C1BB 1KTQA 2BGGA 4J9QA 1S0MA 5KFXA 3KHGA 4JRQA 4MIAA 4K4WA 3LZJA 4IH6A 3VQPA 1UOCA 3LP2A 3CFOA 4B3OA 2YHBA 4ZP7A 1JL1A 5EU7A 3HT3A 1EX4A 4RU9A 4GW6A 1ZETA 2VG5B 4FJNA 4EYIB 4KAIA 1BQMA 3HVAA 4FLVA 2QE5A 1D9FA 3LP2B 3OL7A 4B3OB 4CF2A 1S6QA 2VG6A 2G8VA 3BDPA 2D0AA 4ED6A 2R7YA 3IG1A 2BR0A 1NK5A 1BQMB 4M95A 4B9LA 1D0EA 4MH8A 4CIFA 4C8NA 4CJRA 2XY7A 1RDCA 4QPXA 1L3SA 1BL3A 4HHTA 3C95A 3NH0A 1S6QB 2VG6B 1WSHA 3AVMA 2FBTA 4O3PA 3N6NA 3IG1B 4FLZA 4CGIA 4OGEA 4CHZA 4URSA 4IRKA 1TV6A 1EXQA 1SL2A 4CJ5A 4BWJA 5HLFB 4MK7A 2FJXA 3HJFA 5C25A 4FJ7A 4BACA 2O5DA 2ILZA 1D8YA 1HPZA 2VWJA 3RAXA 4N41A 3QYYA 1HQUA 3BJYA 2OZMA 1RT4A 2AQ4A 3OYLA 1TV6B 4K4UA 3PX6A 5C25B 4NLGA 5KG7A 3LANA 2HHTA 1HPZB 3V9SA 3MXMA 1HQUB 1U49A 2GBZA 1RT4B 4ELVA 4ZPDA 2HHVA 1B9FA 4M3XA 5KTQA 1HJRA 2QKBA 3QINA 3VQ5A 4F4XA 3ZT2A 4ID5A 1W0HA 4XPCA 1N6QA 5F8HA 4Z4EA 1X9MA 4O0IA 4ZVFA 4DL3A 1IM4A 3EPIA 1NOYA 3OYEA 4FZZA 4F4ZA 3U6FA 5KT7A 2XRIA 4ID5B 1HMVA 3LDSA 4C8MA 3A2FA 4RNOA 1LAVA 4FW1A 2YHAA 2V4RA 3OYHA 3THVA 3K5LA 2DPJA 1VSJA 2HHSA 2HNZA 1RYRA 5J2PA 4CECA 3L3VA 1HMVB 1O1WA 3L2UA 5J1EA 3K59A 5EDWA 2HVHA 3MTKA 4EBCA 3QEXA 4KI6A 1X1PA 3UQSA 2HNZB 2HHUA 4J9KA 4DQRA 5J2PB 1I3AA 3NAEA 1RTHA 3ISNC 4FW2A 5J1EB 3SUOA 1KFDA 5KFCA 3VQ6A 2X6SA 3IAYA 4TYAA 2JEFA 3VQDA 4WZMA 1GOBA 2A1RA 1QE1A 4N76A 2YV0X 1YTUA 1RTHB 4NLTA 3QEWA 3KTQA 3MR3A 1VSEA 3M8RA 1J9AA 3SV3A 3QETA 4YR3A 3AO3A 5KFZA 4TQSA 4NZ0A 1QE1B 2IAJA 3V9XA 4XPEA 2G8UA 1CXUA 1UWBB 2OZSA 4PA1A 1VRTA 2C2RA 1TAUA 3RBEA 4NLVA 4PWDA 4DTXA 1I39A 3PUFA 4BDYA 4KBIA 4CK3A 2BQUA 2XHBA 2C2EA 2KZMA 2IAJB 4RW4A 3KLGA 4N56A 5KFDA 4MK8A 3VA3A 1VRTB 3AVAA 4QWCA 4ECYA 3H98A 4PWDB 2IJNA 5KT4A 4KHYA 4TN2A 3S3OA 1RT5B 1NHUA 3PW2A 2FBVA 3H40A 1UA1A 4CJQA 4RW4B 3KLGB 4ECUA 4LSLA 4U6PA 3SQ2A 1C0UB 3AA5X 2VG7A 1S4FA 1KHWA 5KG6A 3V9UA 4DL6A 4CJVA 2ASJA 3KD1E 3NFAA 3BSCA 5KFBA 3O3FA 4RW7A 1YVUA 4LSLB 2P51A 4BDZA 1XHZA 2KZZA 4IH5A 3VA0A 1RDAA 1VSHA 2VG7B 5CYMA 3I0SA 4JV2A 3L2WA 5C5JA 1HARA 4DLGA 3TR8A 4RNMA 3I5BA 1ZBHA 4RW7B 2XCAA 1IKWA 3OL6A 3G6XA 3CWJA 3CYMA 4ZVHA 5CYMB 1S1VA 2IDOA 3I0SB 1TP7A 2B5JA 4DTRA 3KK2A 4ECWA 2IM2A 2JC0A 1KLNA 3OLAA 1NK6A 4J9NA 3S3MA 1J53A 3B6OA 1IKWB 1WNEA 1NHVA 2D0BA 1S1VB 5EUHA 2B5JB 3OYCA 4CFDA 3KK2B 5KG5A 4KHRA 1J5OA 3NGZA 1QAIA 4N5SA 3LPTA 4XO0A 1C6VA 2FLLA 3I5AA 4MKBA 3Q8QB 5L1KA 1QSYA 1J5OB 3MAQA 4Y1CA 2V0NA 2YNHA 1RYSA 1HRHA 3L2RA 3NF8A 4LD0A 4DFJA 4FLUA 2GUIA 3GYNA 5KFPA 3RMDA 4CEFA 3T19A 4OLAA 4IOBA 4Y1DA 1RILA 3O4NA 1HYSA 2YNHB 4K4ZA 1D5AA 2DFEA 3CJ5A 2JEIA 1BI4A 1CXQA 4ECZA 4FJGA 2D0CA 1IKYA 4Q5VA 4W5OA 4QWAA 3EY1A 2YNGA 1S0NA 1HYSB 3ZSVA 4RZRA 2RKIA 2R2RA 1BI4B 5F9LA 5DG9A 1FXXA 3T5HA 1U45A 1IKYB 4K4SA 3ZSRA 1KRPA 2ITGA 2YNGB 4CHQA 3BGRA 4O55A 2IM1A 2FVQA 5HP1A 2RKIB 5KFQA 5JS2A 5EWFA 4CJUA 4FS2A 2KFZA 4WFZA 4WXWA 4CGGA 2HAIA 3SUQA 3DMJA 2F8SA 4LQ3A 3U3YA 3AVHA 1ZBIA 4B9SA 3K5OA 5F8JA 3RR8A 1KLMA 3CJ4A 4RNNA 2BDPA 3BGRB 5HP1B 4RG8A 3T5JA 4Z4HA 3O3GA 2DPIA 4KHWA 3DMJB 4F4YA 3NF6A 3ZSOA 3GIIA 2OA8A 2ILYA 4QAGA 4J2AA 1KLMB 3V6DA 3C6UA 4M3ZA 5DGBA 1C1AA 3QEVA 3N6MA 3UPFA 4DSFA 4CEQA 2FJWA 3DLGA 4CEAA 4NLRA 3K57A 2WONA 1TKTA 2J6TA 1U04A 4KI4A 3CM5A 2KTQA 3FDSA 5JS1A 3PO4A 1KHVA 4C8KA 2XGPA 3V6HA 4DS4A 4F2SA 3V6DB 3SUPA 3HPOA 1NKBA 3DLGB 5KFWA 3NMAA 4DSKA 2WONB 1TKTB 4IR1A 4CF0A 2JLEA 3EZUA 5DQHA 2IA6A 3TAEA 3SPZA 3N6LA 2HNYA 4DSLA 3OJSA 1S1XA 4DTNA 4I7FA 3BQ0A 4KHSA 1RTDA 3IGNA 3ZT0A 3AO5A 3SQ4A 2G8HA 4E7LA 1U4BA 1BIZA 2IC3A 4FJ8A 3E01A 3LAKA 1LWFA 3IGVA 4NCAA 3NAIA 3TARA 2HNYB 4FLYA 3QEIA 1S1XB 3RAQA 4I7FB 2NUBA 1LWCA 5FROA 3ZSZA 1RTDB 3HSTB 2BQ3A 3NGYA 4ZP8A 4I2PA 1KVCA 2W8KA 4CF8A 2IC3B 4WFXA 3E01B 3EYZA 4W5QA 1LWFB 4Z4GA 4C8OA 4CHYA 2WCXA 4NLYA 3RR7A 1JKHA 5E41A 4DQSA 4ZVEA 1QQCA 5DMRA 3MR5A 2IOCA 1LWCB 2XC9A 3PX4A 1RT1A 3WNGA 2ASLA 4I2PB 5KT3A 2XI2A 3OHBA 3PW5A 4ZMMA 2JEGA 1JKHB 3DRRA 3QO9A 4Y3CA 4EYHB 2UVRA 2OPRA 1ZYQA 3RBDA 3PJWA 4CFCA 1RT1B 2JGUA 4C8LA 1JLCA 4RNFA 1QHTA 3QERA 4W5RA 3T1AA 4U7CA 2I1RA 3NF7A 2E6LA 3DRRB 3QO9B 4KREA 1RDRA 3SQ1A 2OPRB 4DEZA 3GIJA 3PY8A 3OS1A 1JLCB 3HPGA 2BQRA 1W25A 4KB1A 2OPPA 2HW3A 4K4TA 4NRTA 5JXSA 1RDDA 2QKKA 3IS9A 4DU3A 4HCBA 5KFUA 4N47A 1LV5A 3KJVA 2J6UA 2OPPB 3DRSA 4CJ4A 3K58A 5DK5A 3BR9A 1MU2A 3IS9B 4L8RB 1JLQA 3PW0A 1UA0A 3TAGA 1U09A 1J54A 5HROA 3LAMA 4FK4A 2R2SA 1XR5A 2W8LA 4X2BA 4ZPBA 3KJVB 4O0JA 1DTQA 4F4KA 1ASVA 5L1IA 3DRSB 5J2MA 4DFPA 2FC0A 1MU2B 3ZSXA 5HLFA 1JLQB 3V1QA 4J9LA 5HROB 3KIOA
chains in the Genus database with same CATH superfamily
3UKUA 5ETPA 3ULHA 4CGJA 1WLJA 2VF3A 3BF3A 4I6WA 1VQON 1YTYA 3EICA 3TJAA 4JKBA 3SFGA 3UKUB 3K8WA 3TUJC 5B7WA 4FWRA 2DFFA 1N52B 3HVTA 3ILOA 2WSCC 3WNFA 2UVUA 3T1HJ 1RUSA 4J9MA 2LVWA 3CFPA 2X6NA 3R2DJ 4U96A 4FJIA 2HB5A 2B4JA 4ZPWR 3HVTB 1ZH5A 1C1CA 2RS8A 1VSIA 4CZJA 2DGQA 1K0VA 4BY9C 3ZT4A 1C0GA 3GCWP 3UR0A 1B99A 3D6HB 4L75A 3NRBA 1C1CB 1W2BR 3BBFA 3G96A 3GFYA 1RTJA 4IUFA 4V19S 1XUPO 5GAHI 4BWMA 4DPYA 3AVNA 3P83D 3TI0A 5KFGA 2XM3A 1RAIB 4FDFA 4JI4K 2ATQA 4RTFD 4ZP9A 1RTJB 4M94A 4O4GA 1FFSB 2L08A 3ZX2A 4DTSA 3ZLJA 2IDEA 2KHOA 3MWTA 1RBUA 1VQ6N 3QIDA 4RO0A 3WDOA 3NWGA 2PMWA 1FRKA 2P9EA 3EE8A 4O4GB 3P8BB 2ZBIA 3OYFA 3OQ2A 4K4VA 4UTGA 1NG9A 1YGYA 3D4JA 1GMWA 5C42A 1ROFA 4F3OA 3RW6A 4KBOA 4FPIA 4BRPA 2W42A 2XYGB 3FCVA 5AQXA 3A8YA 2UUBK 1FDNA 2A2CA 1S3XA 3R9PA 2BRKA 2FVCA 1UWBA 2KXFA 5C42B 3NNCA 5AQPA 3UD5A 3IFRA 2C3MA 1WSVA 4OZLA 1WF0A 3TA2A 2V9WA 4OVLA 2KT2A 3RB0A 1S77D 1RSCA 2B51A 3H2UB 1VOMA 3W3DA 1RWMB 3TAMA 1NK4A 5H9EK 2HBRB 2CJYB 2KG0A 1MWMA 4WWSA 3OBYA 1N36K 3H8YA 2F8MA 1K0TA 3MGJA 3TAMB 4DQQA 3OL9A 1FRXA 2HBQB 2MZTA 4FF4A 3VVUA 3MHYA 2F63A 4I68A 3CCVN 2GX8A 3QJPA 2DHHA 5ETTA 4ED3A 2PFDA 4X65K 1XR6A 3ID6A 3TUIC 4CJSA 2QN6B 3I56S 4ZVSB 2ZH5A 3BM7A 4FK0A 4NCGA 5E7OB 5ITHA 4HTJA 2WTFA 2HS0A 4L3KA 1UFWA 3GQCA 2HHPA 3HPHA 3FCHA 2Y8YA 4EIAA 1Q7YO 1M1KT 2WVDA 3R1LA 4NCGB 1SH2A 4ETZA 3K2YA 4ANCA 2XHWA 4CERA 3GLJA 2CPDA 4NXNK 4DR4K 2Z1HA 1RT6A 4DV6J 4DR2F 5E5NA 1AZSA 2XG8A 2ZBPA 2MY8A 1Y9OA 2CFXA 1ZM4A 2XGQA 1PO6A 4I9QA 3A5OC 4CHOA 3US5A 3TP2A 4B9UA 1RT6B 2FD2A 1VQMN 4UQGA 3W7BA 1AZSB 1RT3A 4JN4A 3ETMA 3DLEA 4CZLA 1KQGB 1NZAA 3OYBA 2NYHA 2VA2A 1X9WA 2CQDA 2GUPA 4JI0J 1YJUA 2D0PA 2HG4A 1RT3B 1HNWK 2PFFB 3ZSYA 3DLEB 4EBDA 2J76E 3C6HA 2N4DA 3MUVP 4C8YA 4IKFA 3ATVA 2E1AA 3H59A 1YHQS 4JK9A 3CGIA 3VESA 4YB5A 1S0OA 1QZ5A 3C8YA 2XB2D 3RJMB 5CABA 2MPUA 3EZOA 1NBWA 3VQ4A 4FJHA 1FTRA 3M2VA 3D9BA 1LW2A 4TKTA 4RLEA 4X66F 4FYWB 4NLWA 2E9TA 2VQEJ 3PSFA 2G13A 4FZYA 5HOOA 4K25A 4PRFA 3JB9k 2HNDA 3ZEUA 4PPDA 3AA9A 4NLCA 1SJQA 3M2VB 3TA1A 1LW2B 1I51B 2G8KA 2IVYA 2DNHA 1VCTA 3QNOA 3AVCA 3MDFA 3FSYA 2HNDB 3ZEUB 4J9PA 3HMJG 3VQ8A 4BGAA 5HBMB 4TQRA 2A5XA 1RWOB 1FWKA 2OFHX 3SPYA 4EP5A 5JVHQ 4NX9A 3IC1A 3GJSB 1CJTA 3PJ9A 1S59A 1RDBA 4M3TA 2HZAA 2DYAA 3WNEA 3QRRA 3L9ZA 1X4DA 3C46A 4JP8A 2F9DA 3SCXA 1CJTB 3AOBA 2QRRA 1T6CA 2FGOA 2UUCF 3JAMU 3HHKA 4O3RA 4YY3J 4IFYA 4M8LA 4RCHA 5J1NA 5D6GA 3BO2A 3OW2M 3L8BA 4AXJA 5GAEU 2P5OA 1XC9A 2JC1A 3GSIA 1X5OA 1QUPA 4KH0B 3LUYA 4BREA 1UETA 2I0XA 3MEDA 2V8GA 1HYVA 3OHAA 1HWUA 5B0EA 4DJBA 4F02A 4IFYB 1PILA 1IJEB 1SV5A 4CO5A 3V1RA 2AU0A 5AE1A 2C28A 2XMWA 4PWUA 3MEDB 3M9MB 4C1NI 4CJPA 4I64A 2K1RA 4QBUA 4A8KA 1T3NA 1HWJA 4O8UA 5ADXA 4DOZA 4LF6K 3ZTRA 1SV5B 3R2CJ 4MAKA 3FSIA 1U1QA 4HH1A 1NJYA 2E2NA 4K50A 4KB7A 1X7VA 1VK0A 1K6YA 2YJEA 3BZKA 1XHXA 1X31C 3CHWA 4B08A 1S10A 1DRZA 3PG9A 4USVA 4DL4A 2YBVA 2Z0GA 3TEHB 1NSAA 4A4JA 2K1RB 1S1TA 2AJ2A 2K3IA 2VZ9A 3NBPA 3H08A 1YWXA 4OJ3A 2IVPA 1WOOA 2J8AA 2NXNA 1YKWA 2M9KA 3SMZA 2DRDA 2DH8A 1S1TB 3U8XA 3NBPB 1VBKA 2OPSA 4LIRA 5B0BA 4B9MA 4BDPA 5D3GA 1WHYA 4NMLA 2ERRA 3ILIA 2MZRA 3BY5A 1U1PA 2VD3A 3WC2A 4RUHA 4U8VA 3CE8A 5AJ3J 4C0BA 2GVZA 2B9XA 4CBXA 1N34K 3UCZP 4UY85 1EWRA 3SSRA 3VF0B 1Z2LA 2OPSB 3DDKA 5D3GB 3AO1A 4MKVA 2NRVA 3RGIA 3MEGA 5B0DA 1S57A 3MCMA 2GVZB 2DGWA 4CIEA 2P9CA 2Y9HA 1Q9YA 5B09A 3AVFA 2P2CB 3QFHA 5M2PA 3MEGB 2XY5A 3PX0A 3LWMA 3UN3A 2MEWA 4LF2A 1HR0F 1JLBA 4BRLA 4EO6A 3MTJA 2J5AA 3I32A 4CIGA 4C2MA 5IWAJ 2FTRA 3BZCA 3GOIA 1JLBB 4YMEA 3AVIA 1N5YA 3C19A 2YWEA 1EAYC 3CNQP 3CJTA 5BR8F 1UJ5A 1REVA 4X4QA 3RB6A 3S8SA 1SJ3P 4M1KA 3DXMA 1VI7A 1VMBA 4YOUA 2OAUA 3ET6B 4NASA 3HM9A 1TL3A 1KNZA 2FXUA 4AHVA 1VK8A 3RB4A 3KHLA 1N5YB 4J90A 3BEXA 1GTEA 4LIWA 1FF2A 1REVB 3DXMB 3FGUA 1TL3B 3H3OB 2CNNB 4G65A 1T44A 3PRDA 2J9DA 5BPMA 5HVHA 4BHQA 5HVGA 5K8NA 4JS4A 2CYYA 2Y1JA 2MKIA 3T6JA 4CE9A 4PKHA 2CGKA 2C2KB 4KV8A 2DR7A 4FLWA 4PG8A 4KGMA 5A8RA 4Q8FA 1NJZA 3ZZZA 2EXUA 3K89A 4FBTA 1PAUB 4HDGA 9ATCB 4JRPA 5G0RA 2DNYA 4KV8B 1FRIA 1PGZA 4Z7YA 3HCXA 3MM6A 3OUYA 5A8RB 4B3RJ 4GKJK 4E7KA 4DZDA 1U7LA 1UWAA 5BN8A 4FLXA 3D0IE 3I31A 3V4MA 5LMUF 5JICA 3IM8A 5G0RB 3K9JA 2R42A 2NPIA 3MM6B 3OUYB 1YVFA 2LU1A 5HANA 4WE1A 4JHDA 2D3O1 4UUXA 4KH5A 1ZM9A 3RTVA 4ZVTB 3JQMA 3CIMA 4B3SF 2I5JA 4KHMA 4P9SA 4JKFA 4CJ3A 4QYZJ 4WE1B 2GC8A 3SFUA 4JHDB 4BVOA 4LF9F 5HQMA 4O44A 4B3MK 2DY4A 4CK2A 5M1PA 3ENVA 4UOFA 3UN2A 3HKWA 2JDJA 3R6MA 1RWWB 1XWLA 4IOAQ 2F9TA 4O44B 3WQUA 3THTA 4RKUC 5AE2A 2OJ3A 3ULDA 1UEVA 4OX9J 5EWEA 1WG5A 1RCXB 3J8AA 1HNIA 3CPWM 3M8SA 4E3SA 1RCHA 3KVGA 1Q8BA 2YH0A 2CH5A 2H3EB 4MK9A 1VQPS 1HNIB 2VPWB 1R3NA 2VA3A 2KLAA 1XQSC 1GTHA 1RWVB 2C22A 2HMPA 2V52B 2VOOA 3UDLA 1JL2A 3PR4A 1QZ6A 4O5BA 5L39A 2J9CA 1Q81O 1FTCA 1PYSB 1B92A 3C6TA 2QXLA 1XERA 1H1VA 2G8IA 1YJWS 3FLCO 4ZPCA 4OLOA 3J7Z5 5HJXA 3MFHA 2YVSA 5GAEI 2WVCA 4ILHA 3I8DA 3R97A 1Q16B 3I5CA 3C6TB 1OYEA 2PT0A 5LJVA 1N32J 2LLZA 4FS1A 4USMA 4I67A 2VC0A 3A3OB 3TQ1A 4ZTFA 2CZVC 4H03B 3HZGA 2N4CA 1HI8A 1S9EA 3SNNA 1SZ2A 4FJXA 4NA2A 4HI2A 4HVZA 2RDIA 5E33A 1SBRA 3UW1A 1TZ0A 4NA1A 4B9QA 1S9EB 4DV2J 3TNVA 1HQEA 4G1IA 1XNQJ 3L2QA 1WG4A 4DXLA 4F9OA 3A8IA 2V6AA 4M45A 2OTJN 3ZTSA 2F3JA 1PC5A 2KT3A 4G6VB 3E2EA 4DR3F 3PZPA 3AA8A 1HQEB 3QGPA 3VGTA 2IVFB 4H5VA 2MKYA 1CZBA 1HBMA 4FWQA 3R7SB 4FWMA 3KDNA 1VC0A 1J5EK 4J2DA 4CDIA 5DQGA 4C4WA 4ALZA 4R0JA 4GVLA 1QVFR 1HBMB 5AQVA 3D7SB 4JV5K 1SKUB 4DTOA 5T41A 4NLOA 2E5LK 3KLIA 2UXDK 1NKEA 3PYDA 2IMOA 5KG2A 5KOXA 2RUGA 1NMNA 3OA9A 3VQBA 1KS2A 1YI2N 3Q8PB 3S3NA 3KLIB 4CTAA 3FBCA 2HURA 3TZZA 2DH7A 1FXLA 5F0UA 2CQPA 1NO8A 3QESA 2B7CB 3QGGA 2GW8A 3IAS9 3HK2A 4CTAB 4MIBA 5I9EB 1R31A 3GWCA 3NH2A 3FNNA 5HQ8A 5GAGU 4FJ9A 4QIWD 4K4XA 3CQ8A 3KG1A 4BR7A 2CGLA 5KFSA 2R7VA 5F3TA 2E5HA 2MQNA 3ZSWA 1G4CA 2Z1IA 2NXUA 4JI6F 1Q5VA 4OYIA 2M8DB 4P72A 3S1TA 1CS4A 4FPBA 2IDLA 2BE2A 1IBLK 2ATLA 2F65A 3E51A 1SC3B 3OTOJ 2YX6A 2PMZD 2EC0A 2Z57B 1RAJA 1XC3A 4QPTA 1CS4B 2HBYB 4O23A 1X9SA 1WUAA 5B0CA 3U1MA 1RKJA 1XK8A 2FJBB 2BE2B 3CCMN 2ZQBA 3N4WA 2H54B 4M41A 3HP6A 4IFVA 3W3SA 3TSUA 4GV3A 1V4TA 3IMQJ 1JJHA 4CESA 4F50A 3ZZTA 2QLFB 3DRXA 5JVGQ 3H1VX 2PIIA 3NF9A 1GX5A 4IFVB 2QIFA 3P96A 4P71A 4DSJA 4AF1A 5LY3A 3AVBA 2HFSA 2VQEF 1G2EA 2AGPA 2J7KA 5LXRA 2XY8A 1PJ6A 1FVSA 4LF4K 2DGUA 4UOCA 4QS7A 3E8OA 2KYXA 3TAPA 2WFBA 4PWWA 1SIZA 1WC5A 1IBMK 4I6YA 4PG5A 2A6MA 1HUXA 3VQTA 2BZ2A 1RAGB 1B64A 5KG1A 1XIQA 4Y34A 2BE9B 1EP4A 3MD3A 2W1BA 2GX9A 4NEZA 1GFWB 5M2UA 2O4IA 1RK8A 4QIFA 1C2PA 1GEHA 3VQ9A 2P9IB 2WB4A 4DQIA 3ZSQA 3UI3A 1CLQA 1EP4B 2PDAA 2NXJA 4IJNA 4EHUA 3U02A 2ZJPL 3U4LA 2MQQA 1ZA2B 1H72C 2YNIA 3E1YA 3MMCA 2ADCA 1HNZJ 1KR4A 2KHDA 3BF1A 2AA4A 3NCIA 3M05A 4F4WA 2DGVA 3NMUA 3TJ9A 3RRHA 2YNIB 1NLVA 1HKAA 1W2IA 2Z2YB 2IA0A 3MMCB 3RMCA 3THYA 1JCEA 4C97A 2QA4N 4JNEA 2GVDA 1Q53A 1S0MA 3QRQA 2KB2A 3IWLA 3LZJA 2DHGA 3GB0A 4L3NA 2E20A 5K8PA 1PYOB 3CC4N 2YHBA 3HT3A 3THYB 1YI2S 4RU9A 2BJ8A 3CO0P 4GW6A 2IPOB 3CT9A 1Y11A 2GVDB 4KAIA 3AY9A 2E5GA 4IOCQ 4DR1J 3MI7X 2V67A 4FLVA 1D9FA 3KDOA 3OL7A 4Z2XA 1KWMA 2VG6A 1RAFB 2D0AA 4CI0B 3IG1A 2VBYA 4M95A 1AYEA 3DGVA 2B9EA 4C8NA 3K8VA 2XY7A 3MR7A 2MLZA 1RDCA 3C95A 2G2YA 2AJ0A 4QQBA 2VG6B 1WSHA 2QWPA 2PI5A 2EK1A 5B0AA 1H7WA 3IG1B 2N3OA 4OGEA 4CHZA 1RWUA 4BWJA 3QAEA 7AT1B 5C25A 1U2FA 2AKWB 2BH1A 2O5DA 1ESVA 2ILZA 1O51A 1D8YA 2HQGA 2IRUA 1QLNA 4HR2A 1HQUA 4WK1A 3BJYA 2PEHA 2AQ4A 3BYPA 5E3PA 3PX6A 4YDUC 1Q79A 5K8MA 5C25B 2F9JA 1N33F 4LFCK 4EMDA 5KG7A 2HGNA 3CCTA 4M5IA 1DURA 2KXHA 1HQUB 1BE4A 1BG3A 1KD1O 4ZPDA 3CCMS 5E84A 2GWKA 3EN9A 1AFIA 3D67A 5CCLA 2LEBA 3FBEA 1V5IB 3IMXA 3VQ5A 3ZZPA 2R7XA 2CRLA 3ZT2A 4ATNA 4AM7A 1UW4A 1N6QA 3HD2A 4Z4EA 4BG8A 1CULA 2E7WA 3QRPA 2JX2A 1K8AO 2X3DA 4FZZA 1NLKL 2RIJA 4ZCKA 3CXCR 4NLBA 5KT7A 4JI3F 2A6OA 1IVZA 2XRIA 1HMVA 3CCWA 3LDSA 4C8MA 3A2FA 1LAVA 2V4RA 4AL6A 1CULB 4CM2A 2XEXA 3OYHA 2RT3A 1GXUA 2DPJA 2HHSA 2HNZA 2BW7A 2FHOB 5J2PA 3TO8A 2WVEA 1CPZA 1EARA 1FE0A 1HMVB 1XN9A 2GA7A 2HVHA 2V2VA 3D68A 1LKZA 5AQGA 2RQ4A 3DXBA 1Z6RA 3UQSA 5BREA 1X4CA 2HNZB 5C12A 4C98A 5J2PB 2G0CA 1NWKA 3ISNC 2XMKA 3Q2SC 4FW2A 3LDLA 2JVRA 3BR8A 3LM9A 1KFDA 4JK7A 2X6SA 3D6RA 3IAYA 4TYAA 3VQDA 1S5ZA 2DY1A 3D0GE 3SIPB 1UTAA 4N76A 1ZXOA 1K73O 2YV0X 3PYEA 2N3LA 5GAGI 4XH1A 2BACA 2DRBA 1VSEA 4DR7K 1E6YA 2VQFJ 5KFZA 4RX6A 4NZ0A 2IAJA 1IG8A 2LCWA 1J6ZA 2R7SA 3OVSA 3ZTOA 1CXUA 4K8RA 2OZSA 2KKHA 4PPZA 4M7YA 2DNZA 1E6YB 3Q8VA 2WAQD 2CWKA 3W0LA 1RAOA 1DZ5A 3CUNA 1NDKA 2DGXA 1Q4RA 2MKJA 2QA4S 2NRWA 2KZMA 3THXA 2IAJB 2HKEA 4OV6A 3KLGA 4N56A 3MWPA 1JK9B 4MK8A 3MAAA 3DLJA 3B8HA 5AQRA 4BR0A 3AVAA 4QWCA 3CC4S 2CGJA 4KHYA 3S3OA 2FBVA 3THXB 3KLGB 3TW0A 3KHYA 4P75A 3LQVA 3MAAB 3VAIA 3P4UB 3TX0A 2HLTA 4M5NA 2UXCJ 1S4FA 5KG6A 3MOZA 1YVUA 4BDZA 1OWXA 1XHZA 3VA0A 3SMPA 4O5FA 1VSHA 2G4BA 4LSZB 2QA4G 2ASPA 4RNMA 2ROPA 4DUYK 3IBWA 3ZZ0A 3WT0A 4DCJB 3GJQB 1IKWA 1LXJA 4LF8J 1TP7A 2B5JA 1UEKA 2JC0A 3OLAA 4A61A 2V9KA 4R79A 2J0XA 2B3TB 2W2QP 4BRQA 1IKWB 3HZ6A 2XSJA 1PBAA 2WVBA 4FYXB 5EUHA 2B5JB 4KHRA 5HAOA 2OEKA 3CCEN 1QAIA 2KU7A 4OPHA 2XSJB 2Z56B 2AHOB 1I94F 3BB5A 3MAQA 1ATNA 5DETA 2V0NA 2YNHA 1RYSA 1RDUA 1DHMA 1SAZA 3NF8A 1YJRA 4JI7K 5LL6d 1P9YA 3T19A 4Y1DA 2ZKTA 1TYQA 4OHWA 2YNHB 3M6UA 1D5AA 3J7YU 3L4IA 1FJ7A 1CXQA 4OIXA 3NGKA 2Y0SD 4FJGA 2D0CA 4A8MP 5FPMA 2C2NA 2LQJA 1TYQB 4Q5VA 2MLYA 3EY1A 2YNGA 3ZSVA 2RKIA 2DNGA 4F0MA 2VASA 5GADI 1X3MA 5LOQA 1FXXA 3T5HA 3X1LB 1U45A 2MTLA 4AT1B 3WXMB 4JI1K 2ITGA 2YNGB 3BGRA 4O55A 2IM1A 2EEYA 2RKIB 2AP6A 5FIIA 5FD1A 1T0TV 3RR8A 4YB7A 3CJ4A 4RNNA 4DV0K 3BGRB 2ZVSA 3MWBA 1Q81T 2X51A 1UVKA 2NXEA 4Z4HA 4USHA 5GINA 2CPIA 2UXBF 2OD6A 3NF6A 4GRSA 3ZSOA 2HS4A 2OA8A 4QAGA 3PYGA 1WKLA 3V6DA 5CD4H 2I8EA 2FC9A 2W6LA 3QEVA 3F0NA 2CQ3A 4X62J 3P38A 4CEQA 3DLGA 3FZ2A 3K57A 3UE2A 2WONA 1TKTA 3A4TA 1EWQA 5F0WA 5GAHP 3CM5A 3FDSA 3PO4A 2XGPA 2A3ZA 3V6HA 4CZMA 2BV3A 3V6DB 2OUGA 4RWWA 3JS6A 3HZEA 2QFJA 3AARA 3DLGB 3NMAA 2V34A 2MZJA 2XLIA 2WONB 1TKTB 2QI2A 4J9UE 5C0YA 3EZUA 5DQHA 2DJWA 6FD1A 2YQ0A 2R7WA 4DZ6A 4RR5A 4ER8A 1O0PA 4FL9A 4I7FA 2VFRA 3IGNA 3B4MA 4E7LA 4LRFA 1U4BA 2IC3A 4CO3A 1LWFA 3ENHA 2DISA 1UMJA 4I7FB 5AXLA 3D66A 3EVOA 4RBUA 4ZP8A 4I2PA 4CF8A 3I55N 2IC3B 1LWFB 4C8OA 4CHYA 2F4VK 2PE8A 3MM8A 3SAGA 4J37A 3NG8A 4LF7K 4RBTA 4I2PB 3O44A 1LK5A 2BKPA 1WBBA 4JYAJ 4DR5K 3MM8B 3KJFB 2JEGA 3DRRA 1U02A 1OY6A 1NDLA 4GV6A 2YHYA 1ZYQA 4ZITA 1PAEX 4CFCA 2JGUA 5D0HA 2AD9A 2IHR1 2V2QA 3VENA 2I1RA 4PZVA 2AEMA 2XMTA 3DRRB 3JSBA 1RDRA 4OZNA 1IBKF 2PFUA 4MMOA 4KB1A 2U2FA 1IQZA 5C2GA 5CH7B 4OX8A 1VFJA 4NL5A 2QWQA 1FJGJ 1V5VA 4DCPB 2CZ9A 4DN9A 3ELHA 5KFUA 2MQLA 3KJVA 2CPHA 3SBTA 4JI5K 4GNIA 1MU2A 4KC5A 3TAGA 3NP5A 1H7XA 4USJC 5CXTA 2R2SA 2ZWHA 2UZAA 2WC9A 4KHPK 4X2BA 4ZPBA 3KJVB 1XNRF 1HLWA 1ASVA 1RE1B 5L1IA 2QTDA 1FRHA 4QIVA 3CJKA 1RABB 5J2MA 3HF5A 3I82A 1MU2B 4QR1A 4NXMJ 1Y3KA 4DU1A 2GZOA 4WQ4C 1RHQB 3CJKB 4OKKA 5J2MB 2C2DA 4HEA9 3H25A 2KT5A 2DHAA 1JXEA 3NWRA 4G3IA 1KN6A 4Q7AA 4AFFA 2MDAA 4EWTA 2HQ3A 4QU6A 2MY7A 2WTUA 1UPMB 2HAFA 2M0GB 4OJGA 4DFMA 4IQXA 3BO3A 3J7A1 4WTOB 1EQYA 2A41A 2PC6A 3AAWB 2JFDA 3D1OA 4EUVA 2A1SA 2P9GA 3CCQS 5HRRA 4DV3J 1A9NB 2F8EX 2FZCB 2RDDA 3DLHA 3VAGA 3ZFVA 1OVYA 4CD3A 1WUUA 5GMEA 1ATSA 1Z4UA 4M3UA 3R8YA 2XULA 3RZAA 4I9LA 2B4PA 1PJ5A 1RGVA 1HHTP 1KXPA 3FQLA 4HT5A 2CADA 1SKWA 4KPYA 1KSPA 5FLXO 1XMBA 3CDEA 1YDLA 1NB2A 1NGAA 2GHWA 1OYDA 2UUAJ 3K5PA 1R8AA 1JLEA 3KUEA 2OANA 2ZBRA 4CP5A 4PKDB 4NYZA 4AHRA 3PW7A 1L3TA 2RN2A 2YKAA 1JLEB 1RHUB 2LQBA 1RT2A 3RRGA 2EC2A 4DL2A 1YTAA 3W1YC 1VAZA 3QNWB 1P1TA 1HKGA 4JI8K 4OI4A 4CLYA 4F26A 4USKA 3CDUA 5DG7A 3H5UA 3GTYX 1RT2B 2DXEA 2MQOA 5H9EJ 1ZPWX 5BPNA 2KI2A 1IWAA 1WD6A 4OZ2A 1N88A 2E1YA 2LDIA 1FHTA 2VPZB 1PKUA 2D3ZA 2BKNA 1RWXB 3AVGA 2GWJA 1WWHA 4DG1A 2AF6A 3HI0A 4ELTA 3DDIA 3Q8SB 3F73A 4ID8A 3D5MA 3CQYA 2FC8A 3O9UA 5E3RA 3JQKA 1BISA 1UCNA 3LO3A 4HTUA 4DG1B 3O8MA 4Z4CA 4Z4IA 4C48A 2H3GX 2FB0A 2GTDA 2GELA 2N7CA 4WCEQ 3FC9A 3CJ3A 3E66A 3QAUA 2KL8A 2CG8A 4USTA 3H45C 4HHHA 1F5AA 3F44A 3ISND 4QW8A 4YOVA 2ZH2A 1WOQA 4LFAJ 4TU9A 3WHIA 4LFBK 5KFTA 5FRMA 2QEXS 3AAQA 2JWNA 3F56A 3CMES 4F7VA 2E7XA 2QSFA 4ED1A 2FLPA 4XK8C 3H5SA 5L1JA 2ZC3A 1TR0A 4DL0C 1D9DA 2E9ZA 2GQ2A 1NGJA 4DR6F 1RZMA 3CDWA 1YLXA 4MFBA 2UU9J 5GIPA 3GG0A 3CC7N 2V8DA 1XQIA 3CD7A 5KG0A 1OQ3A 1OIAA 1U0SA 4O8KA 4PXCA 4MFBB 3NS7B 3CJQA 1R8PA 4A5AA 2PA8D 1NK7A 5KRTA 1RXOB 3OYIA 1G1XA 2H4WB 1SL0A 2B9YA 1RBVA 1U1NA 5I3PA 5MLCV 3A1YG 3RVCA 3SSQA 1TTHB 4CGFA 3W61A 3CTRA 4DV5J 1VS3A 1O5JA 3CCSS 1K8AT 1WDTA 2QFIA 3C65A 4JI2K 4DV1K 4GMKA 4AH9A 2CJBA 2F1FA 3WIUA 4YR2A 3LPEA 4LY7A 4B8CA 4P2SA 2L9DA 3OBIA 3EVMA 7FDRA 1U8WA 2RF2A 3O2IA 1JXVA 1FW6A 4H0TB 3L2VA 3MX5A 3CJ9A 2QTWA 5EY4A 3PEJA 3S6EA 2LDYA 2NYIA 4IR9A 3EL2A 2R2UA 2MKCA 5AQMA 2MKKA 2BMBA 4YFUA 2RF2B 2ZM6K 3AA4A 3RSEA 4LSNA 4OYZA 1Z25A 1MG7A 4BRNA 4HYKA 2VCPA 2VDIA 1JCGA 1H6KX 2KRRA 2Q3SA 4Y2CA 3NNAA 2L9WA 3AOCA 5F3ZA 3T1YK 1K73T 4DX8H 3G8SA 3RSEB 4LSNB 1X8DA 3EGNA 4FPAA 1Y7PA 4P10A 5T14A 3OXLA 4OI1A 4CZKA 2Z2ZA 1WSRA 3PFOA 5DJBA 4LBIA 2VPYB 3EPGA 4DLEA 2ASOA 4C23A 4X64J 2UUWA 2XLJA 3DLRA 4JS5A 2ASDA 2X1GA 4EAHD 2AJ4A 1FD8A 2FBXA 1TKZA 1FESA 1YJ7A 4XH5A 2HFNA 1U6ZA 2AMCB 1TMMA 3WQPA 2P9SA 1ZBLA 3AGRA 1RHMB 4DV4J 2VICA 4Q8EA 4QW9A 3R1HA 1ZBTA 2GQCA 3WXIA 3TAQA 5AR0A 1TKZB 4DX6A 1DQ8A 2GJIA 4EEYA 1KAXA 1QD1A 4USUA 5ETRA 2YXLA 2EK6A 2P9SB 3K5MA 1YIJS 2HHHK 4MKYA 4TLRA 4LR9A 4K0KK 4GKKF 2V8VA 2BUNA 3M6XA 2BJDA 2OH2A 1FA0A 4I6MA 4LF6J 3RB3A 2HHXA 5J2QA 2X7IA 2QSWA 1TL7A 4IEIA 2R4FA 2HVIA 1KBRA 1WB9A 3U7JA 4I6MB 1C0MA 4IO9Q 2GCFA 3CC7S 2B43A 2DBBA 2OPQA 5J2QB 2JH3A 2AX1A 1TL7B 3WQTA 3L3UA 1HNXK 2YKNA 4KIAA 2E8AA 5AZJA 4ZLJA 4HVJA 3QT7A 3B54A 4H0XB 4D3HA 1RHJB 3RBXA 3G4SS 4CJTA 1KTVA 2QG9B 4DV7F 3RMAA 1VQ7N 5A2QO 3MCOA 2VU5A 2QLXA 1RGIA 2EHGA 2OPQB 3W64A 2WHOA 2YKNB 5AZJB 5ETMA 4O0NA 2LSNA 3A0IX 2FSKA 3EM1A 5KG4A 3TRGA 3L4QA 4FJJA 5RUBA 3KK7A 2OTLS 3UD4P 3OV7A 1WSFA 3S41A 1U1RA 4FWNA 4DWIA 1E6VA 1VIOA 2IVMA 3K2PA 2R8KA 4B1YB 1CQMA 2XY6A 4WKYA 1S9FA 4ILMA 4HT7A 1VQNN 3OVBA 1IXKA 3TVKA 2BJ3A 3BSAA 5KRSA 1TL1A 4IRCA 3L0QA 3AJDA 4WFBQ 3ZT1A 4ZPAA 1DEJA 5IQQA 5JUMA 1E6VB 1SC6A 3SJHA 2BX6A 4HUGA 4XAKA 4CJWA 5H9FJ 3WZ0A 1T94A 3UKRA 1IN0A 3VQCA 1ACMB 1TL1B 2FUG9 3HVRA 1RWNB 4YHHF 4USIA 3M3ZA 3IAM9 4FOIA 3OYDA 5EX3A 2X74A 1WKJA 4OI0A 1B0TA 1A7GE 3UKRB 3OSNA 3EWGA 3SLCA 2DR9A 3AVJA 2R7TA 4OPAA 1GOCA 1RKIA 3LM2A 2FF6A 3DHXA 4FVCA 3FFKB 1GNKA 3TQEA 1XMOF 1U8SA 4E7JA 3SEOA 4MYTA 5LSOA 4M63C 1IKVA 4FZXC 3HT0A 4CO4A 1CBKA 1IKXA 1HHSA 4LJMA 2FJVA 1UPPA 2EBGA 2GGPA 4H0YB 1IKVB 1Y97A 4FVMA 4DSIA 1EQMA 1NKCA 1IKXB 4WF9L 1WI8A 4CZEA 2ZDOA 2OCEA 1T9UA 2NUHA 1JIHA 4H54A 4KHQA 1BDGA 4H0PA 4CEEA 2GGPB 1P8ZA 1M1KO 4BRDA 3UWTA 1UVMA 2I7PA 2AZ1A 4CT9A 4RWTA 3QGIA 1WDDA 4G9ZA 1UVLA 1ZM3A 2CQGA 3CCRN 2IVNA 3CD5A 3R5BA 3T1HK 1F6TA 3GILA 4DMZA 4KB0A 2X78A 2XI3A 2OFGX 2QLJB 4A8YA 4MDAA 1HHQA 1JJ4A 1WEXA 4NLSA 2AGQA 1NGIA 4FKXA 2A6AA 3VEXA 3W60A 1VSKA 3G6YA 3ZZRA 5U47A 3AB4B 3KZBA 4WFAL 1XI1A 4NCBA 3TABA 3D1QA 2ZJRL 3A13A 2G1DA 4J8FA 4OX6A 4UOGA 2HVEA 2Y1IA 3DLLL 2GMHA 4WFYA 2H48B 1HD0A 5CZXA 3CJAA 5FLXY 2FF3B 3ICLA 1LFWA 4U95A 2VFTA 1Q8KA 3PTWA 2AJFE 4XDDA 4DHYA 3J81O 2NZ4A 5KGWA 4KO0A 2BKOA 4QR2A 3H90A 3MMVA 2CQ0A 1UKUA 1T9VA 3DCAA 2RSQA 4OYPA 3NKYA 1X5PA 4DR2J 2HSTA 2CJAA 4FM2A 1H98A 3VGLA 4P74A 4KE5A 4IDKA 4KO0B 2YQ3A 1F9HA 1AXQA 3OD2A 1F3VA 3KKRA 1VJWA 2LXUA 2LP4A 3V81A 3AJ1A 3KNAA 2ACYA 2KN4A 5DO2A 5K8OA 1XR7A 4WP3A 4AILC 1S9GA 1VQYA 2XMUA 4A2AA 2QM1A 4IDKB 2JLFA 4RJVA 5BXIA 4DKWA 3CJ0A 4DPUA 1YXQA 1RAHB 3M2RA 3V81B 3RRKA 4JI4F 3OTDA 4FPRA 4AL5A 3GJRB 1S9GB 1HJOA 1FD2A 2HK3A 1TMJA 4Z4FA 4WU3A 4AQYJ 3V4IA 1UZHA 3IWNC 4LF1A 5THWA 2DNKA 3M2RB 2ZH6A 1UVNA 3ZXWA 3KUHA 6AT1B 3PO5A 1N4LA 3W9JA 5AXNA 3R9LA 2VODA 1RBTA 5HL7Q 4Z0UA 3DN9A 2RQKA 2RRNA 1U1KA 2HBMA 3V4IB 3CI5A 4CHPA 1VQ5N 4K2XA 2CA9A 2UUBF 4X66J 4J5OA 1YRXA 3D3CJ 1QHAA 3PIOL 2Q3PA 1ZTWA 3TYTA 4M3WA 2WBNA 4KKOA 1IBCB 2HHQA 3HTVA 3KHRA 1PIEA 3T5LA 3L7PA 4NLQA 3SQ0A 1S99A 3AA2A 1K1SA 3CF5L 3ITHA 3KG0A 3MPYA 4OLBA 1KAZA 3W63A 5CY4A 4QOTA 2HQIA 2EKYA 2HHWA 2F8TA 4KKOB 2BJEA 4NLXA 3IN5A 3ALYA 1MN7A 4S0MA 2L48A 1TKXA 5SUHA 4I2QA 2CPZA 1N36F 4NOHA 2EW9A 4YP3A 3TAFA 1Z05A 1QDUB 4DV6K 1TELA 4KTQA 3ITHB 1BWVA 2FY1A 4DL5A 4NYNA 4QWDA 2D1CA 4FWSA 4F3TA 3E9PA 2V63A 3OXGA 2RILA 2IS3A 2F4FA 1U6FA 1TKXB 3UR3C 1EIYB 4I2QB 2O8BA 5DQIA 3HD1A 2EFNA 2VYPA 3P1GA 4X65F 2UUCJ 5KAKA 4KTZA 2RNEA 2JZ5A 3KWMA 2O8BB 2NCKL 2W41A 4FWLA 1QM9A 4JI0K 2UVWA 1IQTA 3LOUA 3D2WA 3G6ES 1S97A 1P1LA 3CIZA 5DM6Q 3J80U 4QWBA 3VALA 3BSNA 5A6PA 3Q24A 4PY5A 2ZNYA 4I56A 2IIHA 4NXNF 4DR4F 5M1FA 1YJNN 4WP9A 4DTPA 4XIUA 4LH4A 1ULRA 3CC2N 1Q9XA 4M42A 2JWKA 1IG9A 2NS1B 4CT8A 4M5LA 2R2TA 4JBCA 3C6AA 2MJNA 4N77A 5HJYA 3MK6A 4PABA 4MKAA 4M7XA 1QAYA 4NZ6A 4GC6A 1JLGA 2JRSA 3Q7CA 1WF2A 3F41A 1NM2A 1ZTTA 1P9QC 1U6BA 1LOUA 3ZTQA 2NZCA 4FBUA 1HNWF 1WHXA 3LH2S 3DOKA 3THWA 2D5RA 1JLGB 5D78A 4LREA 4CRJA 1ZBFA 5D0GA 4CZHA 2JOQA 3P49B 5KI6A 3AY0A 2B7BB 3EMTA 3DOKB 3THWB 1FEEA 2GV9A 2RJZA 5EOYA 3A8JA 1SI9A 3JSRA 3VF6A 3ZCMA 1IJFB 4OO1J 4YY3K 1LOTB 3AT1B 4PHTX 3TZYA 3OYJA 2AT1B 4J9OA 4Y2AA 1QS4A 4CBWA 4X4RA 1BMQB 2FYXA 3C6UB 1YVNA 4M5DA 1YAGA 3MMAB 4QJVA 3MMJA 1HR0J 4F25A 3O6QA 2ALYB 3HHDA 1RBSA 2IM0A 4HH0A 2C3OA 3I33A 3CDAA 3EGZA 3L4BC 4ZHRA 2FGCA 4Y0WA 1GMUA 3OYAA 1K1QA 3OYNA 4M5DB 5HMYA 1BWEA 1M5SA 4PQUA 1NK0A 1SJFA 3AV9A 5HRPA 2CNOB 2YY3A 5BR8J 2QL7B 4ZHRB 4BR5A 3BSOA 1D09B 3KJQB 3FUYA 3WXKA 3G8TA 3KD5E 3Q7BA 2XS7A 3C16A 4PQUB 4EGLA 1PBUA 2R8GA 1V3ZA 5AQLA 1RT7A 2ZE2A 2IJFA 5A2QY 3QICA 4Q44A 2QWRA 3C16B 2DTJA 3HOSA 5JVHL 3NMRA 5KFOA 5CHCB 1BO5O 1RT7B 2ZE2B 4NEYA 1WOPA 4WYBA 3H2VE 1JNRB 1NSPA 4UQTA 1N5TA 5EGYA 5AJ3K 3VPZA 2XMAA 3MXHP 4DSEA 4BRFA 1BHLA 2WBRA 1EB0A 3FRYA 3M9OB 3OVNA 5AXKA 3RYLA 3AQPA 1JJCB 2BGGA 1HI0P 4LF6F 4J9QA 2VKRA 3TTCA 1GLJO 3KHGA 1UOCA 4B3OA 3CULA 3QJLA 1EHWA 5LMUJ 4ZVQB 2KRBA 3H42A 4BBYA 3NCPA 4FJNA 3DDNA 4K5RA 5AQKA 2ZGZA 4MIWA 3HVAA 2QE5A 4Q2MA 4ILJA 3K0SA 4B3OB 4DI6A 1CQNA 2EI5A 1S6QA 4CH0S 2G8VA 4CD1A 3A5NC 1AT1B 4B3SJ 5HN0A 5IWAK 4P2XA 1D0EA 1EX8A 3R5DA 4H0OA 1WJ9A 4NPOA 4LF9J 1APSA 1L3SA 1NCLA 1SPBP 1S6QB 1N34F 3MCAB 5LJ5Y 2H5JB 7FD1A 1NNEA 4JKGA 1TUVA 3DWLA 2HS3A 3HJFA 2DT9A 4Z37A 1Y64A 4FJ7A 2LQ9A 2CPXA 3D54A 3QFPA 3OPKA 4PG6A 2FJAB 2OMOA 1C4CA 3QYYA 4JKGB 1VK3A 3NXZA 3EDQB 2D9PA 1I1GA 4NLGA 4C6AA 3LANA 3OFGA 1VLYA 4ILRA 1U49A 3M4XA 4M3XA 2LEAA 2C3YA 1XMQK 1OKJA 4MT1A 1TUWA 1QJHA 3OHRA 3HHLC 1G6BA 1Y4ZB 4ZPTR 4CNZA 3PEHA 5TKWA 3PSIA 1EKSA 2ZC4A 1NOYA 2HVDA 3GE1A 1K8KA 4B3RK 4F4ZA 4UZCA 1YHQN 3Q89A 4FWPA 1HWIA 3BV8A 2ZBQA 3K17A 4ZKAA 2RUSA 2VDHA 4KH6A 1K8KB 2OKQA 3S7RA 4CECA 2Y3YA 5GADP 1Y00A 3L2UA 1ICEB 3QEXA 4KI6A 2CQ2A 4OYBA 4YUDA 1X1PA 3HHEA 3FVYA 4QYZK 1FNOA 4J9KA 3NAEA 4NYOA 1RI7A 1HWKA 2DR6A 5IC6B 2PEBA 5KFCA 3TA0A 2JEFA 1M5KC 2FJDB 1YZ6A 5AQUA 5AQHA 2LMIA 5CHIA 4LF5K 3PKYA 3R6GB 3M8RA 4QS8A 3J81Y 4HACA 1J9AA 3W8PA 3SV3A 4GKJF 3N4QA 1QQOA 4OX9K 3ISZA 2FPHX 3MM9A 4DR3J 4BC5A 3V9XA 3OFEA 1UWBB 4ZCIA 3FZFA 3TUPA 2C2RA 3D0HE 3VTIA 4HACB 4NLVA 1NAQA 3PUFA 4BDYA 1HIYA 4KBIA 4CK3A 2DB1A 2R7QA 2XHBA 5FPDA 3MM9B 1M5HA 1HBOA 2B8PA 4RW4A 4K2JA 4ECYA 2AIRB 4LBPA 4KRWA 3B78A 2C3PA 3H40A 1MWKA 3UNYA 1UA1A 4CJQA 4GVEA 1HBOB 2QLWA 4RW4B 3PM9A 4B3MF 4CW7B 3WXLA 2R3VA 1MMNA 3NOCA 2ROGA 2W7AA 2F40A 2IJRA 1P6TA 4DL6A 2W24A 2J7UA 4DUYJ 2ASJA 2M70A 3MN6A 3O3FA 4BS2A 1OQ6A 3AB2B 1N32K 3EUNA 3KJNB 2DNPA 5LMNK 4DUTA 4JV2A 3L2WA 4Y65A 1HARA 5ADXH 3VGUA 3I5BA 2Q0RA 3WUHA 4IJAA 2VONA 3H3NO 4GO7X 3G6XA 3VEVA 4ZVHA 3DXKA 1S1VA 3KK2A 4ECWA 4IOAL 4ZJOA 1NU0A 2LYVA 2M2BA 4J9NA 1FFGB 4DV2K 2DXDA 3O9TA 3U9DA 1J53A 3HBTA 1XNQK 3MURP 4XEIA 1WNEA 3U27A 1FKAF 2D0BA 5LSRA 1HKCA 2D1KA 3DXKB 3N0VA 1S1VB 2JLGA 3KK2B 2GMJA 4A5BA 4JI6J 3NGZA 1KC8O 4JK8A 2X1BA 4N5SA 3X3UA 4CLWA 2GO9A 3P6YC 1W7WA 5ETNA 2F9WA 2FLLA 4MKBA 3ENBA 5L1KA 2E5IA 4AQYF 1OH5A 5LL6Z 3RG6A 4Y00A 1M90T 3L2RA 3W8GA 4FLUA 1FO1A 1BUPA 3PIPL 4OLAA 4IOBA 3J7AN 1JJ2R 5IT0A 2ZOMA 3Q83A 3I9ZA 1QVFM 5EVZA 2YPYA 3AHPA 4C3MA 1QQMA 2MZ1A 5IT9O 4IXCA 4ECZA 1URNA 1HWLA 5KQDA 1M0SA 1IKYA 4W5OA 1S0NA 5DM7Q 2P9KA 3FZLA 2CNKB 2A42A 3PNIA 2YH1A 1NB7A 5EX5A 5DG9A 1VHXA 3VF2A 3QBCA 1WTBA 1IKYB 4B3TK 1KRPA 3EGWB 2P9KB 3HJVA 5JS2A 2VV5A 1G3OA 2EFGA 2OSRA 5IZHA 1J5EF 2V2KA 5F8JA 2XMVA 4RG8A 2P5VA 4JV5F 5IOLA 4UF4A 1B70B 1S22A 4A8SA 2VIHA 2OEJA 3GIIA 2E5LF 1LXNA 2ILYA 5DDPC 4CYUA 2UXDF 5DGBA 1H2VZ 1C1AA 3N6MA 5GMDA 3UPFA 1R43A 4JKCA 4F4AA 2FJWA 1PJ7A 3DJCA 4BRCA 3NS5A 2ZJQQ 5JS1A 1KHVA 4C8KA 3OTOK 4HLBA 4CYUB 3Q86A 2XQCA 2E1RA 3ZYYX 4DSKA 3R5GA 1MWYA 3IR7B 2JLEA 2RE1A 3TAEA 3GR0A 1S1XA 2EBEA 4DPTA 2Q79A 1BIZA 3ENAA 3VZHA 4FJ8A 3LAKA 1HKBA 4MO4A 4BRKA 2B9WA 1HA1A 1S1XB 3D6FB 4LF7J 3VF4A 5FROA 1LWCA 1XTZA 4MYUA 3NGYA 4UT4A 2KJWA 4KYZA 3IM9A 5KPTA 1NRKA 4PR6A 2MMYA 4HTIA 1S79A 3RR7A 1CEZA 4ZVEA 1QQCA 1Q18A 1LWCB 1IBLF 2DH9A 3WNGA 2HIYA 5KT3A 1J2VA 2JFKA 1E4GT 1YG0A 2HSEB 3CJ8A 4ZMMA 1VHFA 3D2EA 3BBBA 3D1HA 3T9NA 4OI3A 2H65B 2OPRA 2ROEA 1URRA 1VC6A 3QERA 1WACA 4V19J 1KOOA 4U7CA 2DVIA 3D2EB 2E6LA 1N33J 4KREA 2D0OA 3SQ1A 2OPRB 4DEZA 1VBYA 1VQPN 2BQRA 2BJ9A 2L41A 4BQZA 2HW3A 2A1BA 5KPRA 5JXSA 1HNZK 1IJJA 3FR0A 5M2RA 2R7RA 1D4XA 3AH6A 4LF4F 4DU3A 1LK7A 1LV5A 1IBMF 3CEDA 4DPWA 2J6UA 1J27A 3L7UA 1DY3A 3PW0A 3LAMA 1YJWN 1XR5A 3OXFA 1X4GA 4JI3J 5JVGL 4OZJA 4O0JA 1D8ZA 2YHXA 4OZ3A 2HBLA 2B4UA 3R5CA 2A3JA 5HLFA 3M8WA 3V1QA 1U25A 4J9LA 1VQLN 4DR1K 5AFUA 1FT8A 3QQCD 3VAHA 4CJEA 4CO1A 2NSBA 1YBTA 3ZNJ1 4C1NK 3NGRA 1VQ4N 2N82B 2H9ZA 1GH8A 2VPXB 3TR5A 1JLFA 2E5JA 3C14A 4P73A 5H1SV 4W5NA 1NH7A 2F5GA 4L72B 5TKYA 3VEWA 1MDUB 1N5QA 3R6LB 1CVJA 2DFHA 1RHKB 1JLFB 1LW0A 3C14B 4YEAA 1HBUA 3FEXB 4LUBA 2DNRA 1PC4A 3JTOA 2QMWA 1NMEB 1LW0B 1HW8A 1DKGD 2HFUA 4OV1A 5HO4A 1HBUB 3CCZA 3HL8A 1X4BA 3R5AA 3ETOA 1B3TA 4IG0A 5A8WA 3AVKA 2PD1A 3GBTA 2ACMA 2P5GA 4BE1A 4CFAA 1WNSA 2ITMA 1PG5B 1M1GA 4IG0B 5A8WB 3R7NB 2NR0A 1G15A 1UAXA 2RHKA 3BP8A 5HRNA 3CCUS 1UVIA 5I42A 2QJ3A 3G6VA 3M2UA 2GIFA 4IOCL 1Q82O 3CXCM 2FJEB 3OL8A 5L9XA 1ZC6A 2X1FA 5KFFA 5AT1B 4MQ3A 5I42B 3VAJA 2I5JB 3HVWA 3G10A 2BEFA 1Y0HA 3M2UB 5KFHA 2YTCA 2ZHOA 4O3NA 2E4LA 4LFCF 5KG3A 1H73A 3HHLD 3B6PA 2YWKA 3PACA 5E0OA 1BOTO 4NYFA 4WPAA 5F8MA 3SQOP 1F21A 2J8SA 3IBFB 3ADAC 2IFXA 3GR1A 1L5UA 1N56A 3FFIA 1M5OC 4KH1B 3GCXP 2V8PA 1U2RA 1RT5A 4U7UD 2VQFK 1TAQA 3NY0A 4BRMA 4LFBJ 4R25A 4KFBA 4ED2A 3FFIB 4WZQA 2MQ8A 3D45A 3Q22A 1DTTA 1UEUA 3P5TL 1C0UA 5AQIA 1ATRA 2CJXB 5IXUA 1T95A 4GY2B 1I94J 4N8NA 4N7TA 3O1BA 3N79A 1X9JA 2XCPA 1AW0A 1RACB 4KFBB 4M3YA 2YKPA 2AWZA 1ZM2A 2C2ZB 1H2TZ 2W2OP 3N5BA 1DTTB 4HWIA 4E19A 1GT8A 4HHJA 4LQ9A 4BLGA 1F2GA 4MDBA 3M8PA 3G2XA 3LDQA 3GONA 4AXIA 1VQLS 3OR2A 1C0FA 2FVPA 4W4MA 3QNNA 3P31A 1OPIA 2XZTB 1Y5LB 3VQAA 2LFVA 2DHXA 3KKSA 2D41A 2UXCK 3M8PB 1VQ4S 1JLAA 2F7TA 3VAFA 3H7HB 4Y6IA 4RBVA 2Q36A 3D3BJ 3WC0A 1Q7LB 4DR7F 5EX0A 3I0RA 3G82A 3NEKA 4A8XA 3A5MC 1U0HA 4IEEA 1L3VA 2COLA 2HPUA 3V6KA 3KG4A 2OIHA 1JLAB 1B7FA 4DF4A 1S1UA 4AHTA 4FN5A 3NHGA 3MR6A 3VOVA 3I0RB 3G82B 4JI2J 2P9LA 1N48A 5D0EA 4ILLA 3ZTPA 3PXGa 3IUCA 4Q0BA 1VHIA 4LF8K 1QQNA 1S1UB 2HZCA 4IYQA 2D3OR 4CF1A 4BE2A 2V68A 1N0UA 1WSGA 1X5TA 2P9LB 3ZT3A 3JTNA 1VQKS 3ZZOA 2FSNA 4EZ6A 3DGPA 2UXBJ 1GXLA 5D77A 4Q0BB 1Y5NB 2YKOA 2AJQA 1T9YA 3KWGA 4Y2IA 4JD2A 4ZTJA 1W26A 4E7HA 4A47A 3FZHA 2EVZA 4WQ5A 4KPCA 2VJUA 4BC7A 3MPUB 1KDNA 4J91A 4KY3A 2K2PA 3DGPB 2W6KA 4CZIA 3VWSA 1AA1B 3N28A 4JD2B 4DU4A 2JVOA 2NSCA 1FERA 3SI8A 2NPFA 2IY5B 3VQSA 3ZX0A 4IG3A 2PI4A 1GX6A 3EKSA 3TPQA 4J7CA 3NS6A 4CGDA 3M9NB 3T7ZA 1TVRA 4DUYF 5DDQC 5F8LA 2YX1A 2W25A 3CJBA 2B4VA 4IG3B 4OI2A 4IO1A 5HRSA 3LTOA 3FBBA 3D6TB 4Y28C 2DD8S 4W5TA 3LP3A 1S6PA 1TVRB 4M5KA 3LZIA 3QZ7A 4CLTA 5IFMA 3W5ZA 4KGKA 2E66A 5IT9Y 4J2BA 4JKAA 3GFZA 1S76D 4JV0A 2CVIA 1D1UA 3KMSA 3QEPA 3V5RA 2AYEA 4Q45A 1S6PB 5HMWA 5E3CA 4TY8A 1VLOA 4CEOA 3M5RA 3VCDA 2G2OA 3IP0A 2G8FA 5J2NA 5D4OA 3BPSP 3VEYA 3MN5A 3QFWA 3DLBA 3RAMA 2ZWOA 4TY8B 1NK8A 1MLAA 4M3RA 4JI7F 1T9XA 5BRDA 1SKRA 4ID1A 4BCAA 1EQ0A 4GMJB 5J2NB 3VQQA 3MAHA 1AB8A 3SUNA 2WB1D 4CJFA 2EFOA 2NRXA 3T3FA 2XWYA 1IBKJ 4ISGA 4HKQA 1ZOTA 3IO1A 5KFVA 3O6WA 1F3FA 4UY8O 3ILLA 2P9PA 4AHSA 4TU8A 1Q86O 4BR4A 4X62K 2HFZA 2FQQB 4FYYB 4PL8A 1RTIA 1D9AA 4AD6A 3NGIA 4JEPA 1A5VA 2YKMA 2CG4A 2P9PB 3OVAA 2IYGA 2DGTA 3H4DA 4JI1F 1RTIB 3FQKA 5CYQA 4RUBA 5F9NA 1KQSM 1XNRJ 3JSMA 2YX4A 2YKMB 5E26A 3VMFB 1R0AA 1OS5A 1SQGA 3G86A 2YWHA 4DV0F 3MXJA 5CYQB 5FRNA 4WYWA 3JSMB 1SQKA 1N54B 1JWWA 1RU2A 3TWZA 1TFWA 4CK1A 4OYAA 5KFNA 4OHXA 1KKHA 1KC8T 1R0AB 3EE9A 2VC1A 1SQFA 4PG7A 2JHEA 5KQ8A 3DKDA 2YHWA 2W2NP 3KK1A 4LC9B 1HNVA 1S6UA 4CLKA 4JYAK 4RL1A 2LU2A 1N5VA 1ZZFA 5CAAA 4R5PA 3KK1B 5A76A 4DQPA 1YZ7A 2N7YA 4L6V3 5E3AA 4CCHA 4OPKA 1OJ4A 1HNVB 1NJIO 2HMIA 3DFEA 2ZUAA 4ECTA 3M7VA 3LL3A 1P8GA 2ZJRQ 2J9DE 4R5PB 5H1SQ 2QXFA 1YBUA 3DLLQ 1B7YB 4ZVRB 2HMIB 4K8XA 4KHUA 3FRZA 3OFFA 3J80Y 1MMLA 1FJGK 4FO0A 1FFWB 4YS2A 1CJKA 1U48A 2F8HA 4F04B 4C0HA 2WK4A 5D4NA 4AE5A 2F4VF 1SH0A 1IR2A 2QWMA 2E7VA 3AGKA 1ZAXA 3KK3A 3VEZA 3HOTA 4LF7F 1MWZA 1CJKB 2V4JA 4UOHA 5HMZA 3VQEA 5JJBA 4H5TA 4DX5A 2RPIA 4DR5F 2VFUA 3K7RA 3BGFA 2F7VA 3KK3B 5CCMA 1ASWA 3GU0A 1NOZA 2YWFA 3QWUA 3QBXA 4OHYA 5E3QA 3TANA 4NE9C 4NXMK 2V4JB 4HCCA 1U1MA 2FHJA 1RWKB 1T11A 1BQNA 3HP9A 2W7PA 3F9MA 3EEQA 1NPKA 2E6MA 3JAMO 3M6VA 3UN5A 3F2KA 4O3OA 3CQXA 1S5JA 4PAAA 3KMQA 1W9HA 3UVJA 3CD0A 3LF0A 4ZLPA 3LPUA 1BQNB 2HBKA 2LEPA 3IA0A 2UUTA 4NRUA 2E88A 4JI5F 2FVSA 1SCJB 4CJLA 4TVAB 3NOGA 2ZHAA 5DDRC 3CD6N 2J4RA 2IBOA 3UVJB 2BE7D 4K43A 2QLBB 4JAXA 2QW9A 3KLEA 4DV3K 2XWXA 3E9LA 4KHPF 2HFVA 4B9VA 3D7EO 2IIRA 1H3DA 4Y2MA 3N01A 1F60B 3OR1A 3SAHA 3N4PA 2FSJA 5KFJA 2ZD1A 5IQ6A 4DTJA 3PIOQ 3CFRA 3KLEB 2FZKB 3H2LA 3SQGA 2DEIA 5SZTA 3H4BA 2R8HA 3KWIA 4H4KC 1N6QB 3TUZC 2B6AA 3OR1B 3CSKA 1R27B 3OS0A 2HQFA 4CBUA 3LGMA 3PR5B 2ZD1B 2AJ1A 2BUPA 3CF5Q 4CM0A 2V51B 4J2EA 2ZGYA 4TXSA 1KVBA 5E2QA 3O1LA 4URGA 3SQGB 2UUAK 4DR6J 1RCOB 2DXFA 1NGEA 2BVZA 3J7ZO 2B6AB 4IH7A 3MXIA 4WP8A 1RWPB 1QVGR 1WEYA 3FZKA 3MECA 4AL7A 3EJMA 3R27A 4A8WA 3DLKA 3TOQA 4DFKA 1DQ9A 1SH3A 1X60A 3MECB 2IM3A 1V9OA 4K59A 3DLKB 2KHCA 1C4AA 4FM0A 2LA6A 2I6WA 4OZ1A 5KFRA 3EZWA 2CPEA 2HGLA 4OLPA 2RDJA 2M52A 4B17A 4YORA 2IRXA 4ED5A 1CJVA 2CUYA 2L9NA 1ZZNA 3MF5A 3QZ8A 5T7BA 3BN4A 2AGOA 3QMQA 1LEOA 3PJXA 4EP4A 1VSDA 3GP9A 2VGMA 1U1OA 1WN7A 3AA3A 2UV8A 1CJVB 4CNYA 4BG9A 3EO3A 5C7PA 1NSKL 5C24A 4ANDA 4QZVB 4U67L 3HSZA 1KEKA 2O4GA 4AUKA 4LFAK 4JI8F 3OS2A 1VSFA 3BUZB 3M6WA 3K5NA 4NWBA 5C24B 5HSPA 1RFQA 1VQOS 4BE0A 2XNRA 2LQ8A 1TL5A 3NLCA 2V7YA 3MR2A 2DR5A 3GZ7A 3TVYA 5F0XA 1HX1A 4DDFA 2UU9K 2H5IB 3SYZA 3C0BA 2CQCA 2OSQA 1T3OA 1OMSA 3BS9A 2Z1GA 3GIKA 1RBAA 3SCLE 4B1ZA 1HYZA 8RUCA 4BC3A 3GSDA 3EE3A 2IBKA 2MQPA 2MLXA 1BCMA 3GG4A 5KFIA 3SJJA 1SKSA 1JXBA 1PSDA 4RNHA 4A8FA 4C7QA 3VGVA 3CCLN 1YUWA 2FBYA 3IFEA 4B8AB 2K3KA 4A48A 3CD6S 1S6OA 4FM1A 4LFBF 4ECRA 2ETJA 3H5XA 3VGMA 4ZVGA 4DV5K 4CI6A 2V2ZA 4OKEA 4R8UA 1T03A 1W97L 1S49A 1WC6A 2A40A 3OYMA 4GKKJ 3QSYB 1Q82T 4WCEL 1VQ6S 3GE9A 3ATUA 3GV8B 1HBNA 2G8WA 4R8UB 1NGDA 5EHHA 3V9WA 5LJ3Y 1T03B 4YNQA 4B1VA 2AX0A 2VHGA 4B9NA 3WNHA 4PYAA 3G25A 4CF9A 4DTMA 4RW9A 4ELUA 5HBMA 1FVQA 5KFMA 3UFCX 1T8EA 4ICLA 2IYIA 4DF8A 3DRYA 2X3GA 1HBNB 2C2OB 1KCFA 2E9RX 1F5CA 1R8HA 2ABYA 2IGIA 2VUGA 2RQMA 4RW9B 3CCJN 4YOEA 4ED7A 4R0EA 1HW9A 4YQWA 2CQHA 4DV7J 1MW7A 4FWOA 4ICLB 4E1JA 2Z1JA 3VTHA 2AW0A 4OKJA 4WIQA 2XZWA 3DOLA 1S1WA 2W9CA 1N5SA 1VQ9N 4FF1A 4JI2F 4DV1F 5KFLA 3H0PA 4BRGA 4ECSA 4PCQA 4E89A 1QY7A 3PV8A 4X64K 1WAFA 3CM6A 3DOLB 1S1WB 2W9CB 3C7NA 5DG8A 2EWSA 1CC8A 1FDBA 4NO7A 1NNDA 1LQ9A 4LMZA 2Y1RI 5FDLA 3CCVS 4DV4K 2ZM6F 1RAAB 3C7NB 3CCQN 2WW8A 4L76A 2MSSA 3A3NB 4YHHJ 4CHNA 5FDLB 3FMWA 3HI9A 2A18A 1FRLA 4KHNA 3GFXA 3T1YF 2DO4A