1JLGA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
538
structure length
529
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
total genus 132
structure length 529
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlgA05
3G6YA 1UA1A 4FJNA 1FKPA 2RF2A 5L1IA 3OHAA 1QUVA 2W9BB 5EWEA 4B8AB 3WNFA 2YNHB 4EEYA 2HVIA 2RN2A 3HPHA 1XR7A 4K4WA 1NK5A 1FXXA 1IKYA 1DTQB 4O44B 4J9KA 2YNIB 5HBMA 3QLHA 5C25B 4FJ7A 3V9WA 1RTHA 5KG4A 3MXIA 2B4JA 3QINA 1S1WA 2AQ4A 4B9UA 3VQSA 5CYMB 4DFKA 5KT5A 3OSPA 2OPPA 4CGGA 4O3SA 4CIEA 5FDLA 3RAQA 2F96A 4EBEA 3QERA 1RTIB 4CF0A 4O3QA 1EETA 4MKAA 1ASWA 1U47A 3CIZA 3MR5A 2X78A 3QIPB 4K4SA 2JEJA 3EZUA 1D0EA 4RNHA 4LSLB 2YNHA 3VQBA 1WSIA 4I9LA 3UQSA 1C0TB 4FZYA 1VRUA 4O44A 1DTQA 4HUGA 4IH7A 2YNIA 1NOYA 1IG9A 5C25A 3BGRB 2Q3SA 3U3YA 1B9FA 1S6QB 1W0HA 1VSIA 4CJTA 3DLRA 2AX1A 4ZTFA 5CYMA 3AO3A 3SZ2A 4MQ3A 4FS1A 2XI3A 5DGAA 1JLBB 3G6VA 2E9RX 2X6NA 1IKXB 3NF7A 2AGOA 3RB0A 1RTIA 4HHTA 3SPYA 3OYCA 2WTFA 3QIPA 3V9SA 2G8IA 3B6PA 4RW7B 4LSLA 2BE2B 1I39A 3DOLB 1S1TA 4DLGA 1N5YB 4TN2A 1C0TA 2BQ3A 1QAJA 1RA6A 3VA3A 4NLVA 4NYZA 2R8HA 4XPEA 3BGRA 4EBDA 3KJVB 1NHVA 4Y1CA 1S6PA 4PWDA 2FVCA 3K58A 5KGXA 5JXSA 3SCXA 3HYFA 1XC9A 4CEZA 3RBEA 4Y3CA 4UQGA 3QEIA 2RDJA 1RDAA 2D5RA 1JLBA 4DL2A 3KKRA 3PY8A 3NH1A 3SQ1A 4EO6A 1RBVA 1T7PA 1EXQA 3DLKB 1I3AA 2PY5A 4RW7A 3I5BA 5KFJA 2X74A 1IKVB 3E01B 1S9FA 1VRTA 3AVLA 4IG3B 2BE2A 3DOLA 4J9MA 5DG7A 1QQCA 1SKRA 4CECA 3UDLA 5KFPA 4Z4CA 4QWDA 4Y2AA 4O5BA 1S5JA 4XIUA 3KJVA 4ZVGA 3CDUA 1C0UB 3KLEA 1NK0A 3BQ0A 2ASJA 2HHUA 5KFWA 5I3UB 3VQDA 5F8HA 1WAFA 4DG1B 1WN7A 4KO0B 4E7HA 1NK4A 5KG6A 3DI6B 4JV0A 1ZYQA 3OYEA 2KW4A 4E19A 4ZVFA 3MR3A 1LW0A 1MMLA 3DLKA 2ALZA 1IKVA 3E01A 1BHLA 4IG3A 3HVWA 3LPTA 4DTXA 5KFNA 2IJNA 5JUMA 3MR6A 1SUQB 3OJSA 3SV4A 3F9KA 1RYRA 2VWKA 4CGFA 1C0UA 2ITGA 3RB3A 4KHSA 3OYKA 3PX4A 4ED7A 2FC0A 3HVAA 5KFEA 4RNFA 5I3UA 3KK1B 4DG1A 4KO0A 3DI6A 2FLPA 3AVHA 4YP3A 3CYMA 2XY8A 3ZT2A 3SQ4A 3MECB 1ZBIA 1JL2A 4ID5B 3GILA 4DL6A 1VSKA 4ZVHA 3RMAA 2YNGB 2NUBA 3M9MB 4C8MA 1SUQA 5KFYA 2V4RA 4G3IA 5DLFA 3PW2A 1HNIB 3IGNA 1BISA 2HNDB 4F3OA 3QYYA 3PX0A 2FVQA 4ECZA 5HRRA 1TK8A 4RZRA 3D28A 4KB7A 3DRPB 3CO9A 3A2FA 4OVLA 5KI6A 4BE2A 4WFXA 3KK1A 5KFUA 3I0RB 1R0AB 3G86A 2FBTA 1EP4B 3PJXA 4O3PA 4EP5A 4RUCA 3MECA 4K8ZA 5KFHA 2UUTA 3V1RA 3KTQA 1IO2A 4NLTA 3ZSVA 4O55A 3ALYA 2YNGA 3LPUA 3OS1A 4Q0BB 1HNIA 4M95A 2VA3A 1VSMA 5DK5A 2HNDA 4TLRA 3NGIA 1BQMB 4Z0UA 2FBYA 1QTMA 3SNNA 1U4BA 3ZT0A 4QWCA 3ZT4A 3AVNA 2UVVA 3DLGB 3SUOA 1CXUA 2E6MA 3I0RA 4B9VA 3O4NA 2C22A 3S3MA 2A1RA 1TKDA 1EP4A 2D0AA 4DQRA 4B9NA 3CFPA 2HNYB 2VWJA 1UWBB 2IC3A 4AHVA 1TL1B 4DTUA 2G8VA 2X6SA 2HWHA 1TKTB 3BJYA 5KFAA 1JLCB 3KLFB 4Q0BA 4FJHA 4RU9A 2Z1GA 1KLMB 3MEDB 2W9AA 3IAYA 2BRKA 3VQ6A 5KRTA 3V9XA 2HHSA 1S1XB 3CJ5A 4RG8A 1GOBA 4R0EA 5D3GB 4F2SA 3DLGA 5J2PA 1ZTTA 3GQCA 2V4QA 5KRSA 3KLIB 4KSEB 3N6LA 3GIMA 4Q5VA 4J9PA 3H4BA 2JEIA 3GV7B 2IAJB 3HO1A 1W9HA 2XC9A 2HNYA 4Q45A 1C0MA 3K5OA 1QSLA 1UWBA 3TI0A 4ELUA 4F4WA 4F2RA 4B08A 4ECUA 4IBNA 5KFXA 1DTTB 2IBKA 4LQ3A 4QWEA 4ELTA 3PR5B 4YFUA 1JLCA 3KLFA 5KFGA 4LSNB 1KLMA 2WCXA 4KI4A 4IG0B 4GC7A 1GX5A 1XR6A 3OY9A 4O0JA 4IKFA 1TAQA 1S1XA 2W42A 4IRCA 1TL3A 3CQ8A 3SYZA 5D3GA 4JRPA 1ZBHA 4Z4EA 3OLAA 1SKWA 4F4KA 2W7OA 2WRMA 4KHNA 3IRXA 2IM3A 4HUEA 2C2RA 3KLIA 4RW9B 5EDWA 4B8CA 2IAJA 3BSCA 1RT2A 2R2RA 5KT2A 2GV9A 2UUWA 4FLYA 4KPYA 2ZKUA 1RT3B 3LWLA 4H4MB 3LALA 1NJXA 4CF2A 1NKBA 1NKCA 1T03A 1DTTA 4O4GA 3C6TB 3LAMA 1CSJA 5L1LA 3AVKA 2C2DA 4LSNA 2R2SA 3QGGA 3ZCMA 4DU4A 4H8KA 4FYDA 2D3ZA 2R2TA 3N6NA 4EYIB 4IG0A 4ED3A 2GBZA 1S4FA 2W8KA 4GMJB 4OLBA 3JYTB 1KTQA 4BDPA 2YKMA 4ZTJA 4B9MA 3OLBA 2ATQA 2OZMA 4HYKA 3WNHA 4OL8A 4RW9A 4CEBA 3PW7A 2JEFA 3KD5E 1LWFA 4DFMA 2AU0A 1KVCA 3AA4A 4ED2A 3VQ4A 1A5XA 1RT3A 4H4MA 4CHPA 5K14B 4O4RA 1KFDA 3C6TA 4DQQA 4RNNA 2FJXA 3H5XA 4FJLA 3G10A 2HHTA 2VG6A 4RW6A 3EYZA 4CJEA 4MFBA 1RBRA 3Q8RB 3HVTB 3JYTA 1QHTA 2R2UA 1NJYA 2B43A 4O0IA 4NLSA 1IKYB 1VK0A 1RDBA 3OYLA 4KHWA 1JXLA 3VQ5A 4FJ9A 1T94A 2FVRA 1Q9YA 2JEGA 2FJVA 3I5CA 2GUIA 4KHMA 1JXEA 2BDPA 4DFPA 3OJUA 4OLAA 4HCCA 2OPPB 5K14A 5F8LA 1NKEA 4R5PB 4ECYA 5DQIA 4N41A 4H54A 4MH8A 1YVFA 4TQSA 4FLTA 3KKSA 4CJKA 4XO0A 3QETA 1S49A 1RT6A 2YNFA 3HVTA 4W5QA 4TYAA 3D5MA 2R8IA 5FROA 4F3TA 4CJRA 3EPIA 3S3NA 3PW4A 3OYHA 1VRUB 4CGIA 3S3OA 4FK2A 3BSAA 3ZSYA 2P51A 1Z4UA 3TANA 2F8TA 2EHGA 2P5OA 4ZMMA 1LAVA 2Z1IA 2HHVA 4TYBA 1KSPA 1B92A 2B5JB 2F8EX 2KZZA 3V6JA 4ELVA 4R5PA 1S1UA 4H4OB 1RTDB 4KAZA 2IM1A 4IDKA 1N4LA 2A1SA 4ZPAA 3D0PA 1RILA 3HPGA 4BWJA 1JKHB 3AVBA 4KKOB 4DF8A 4KREA 4C8LA 1S1TB 3RTVA 4CJUA 1KVAA 5HRSA 1RT7B 4E7JA 4B9LA 1UA0A 1QAIA 1BIZA 3QIOA 3FRZA 3IG1B 3PUFA 3KNAA 3TVKA 4U6PA 4DS4A 2XCPA 1S6PB 2AGQA 3NL0A 4PWDB 4CEAA 3HKWA 4FK0A 3DRSB 1Z25A 3TQ1A 3QNOA 2B5JA 2W8LA 3KHLA 2GIQA 4ECQA 1J54A 4H4OA 1BL3A 1G15A 2XY5A 3VN5A 3L2VA 1RTDA 3KHHA 2Y1JA 1YTUA 1EKEA 2J6UA 4TSXA 3QEWA 3P83D 3QNNA 4NLXA 2D41A 1JKHA 4KKOA 1RDDA 3CJ3A 1VRTB 4IFYB 4IRKA 3RMCA 4CFCA 4JRQA 2OZSA 3ZSZA 1U04A 1RT7A 2WONB 2FLLA 1HQUB 3V81B 2ZE2B 3IG1A 1QSSA 2YKNB 5L1KA 3L3VA 4F4XA 3T5JA 4AILC 1WSJA 1VSLA 4CEOA 1RT5A 3FFIB 3OHBA 3DRSA 3CJ2A 3KLEB 2AGPA 4NYNA 4M3UA 4QPXA 2FJWA 4GC6A 1L3SA 3KHGA 4E7KA 3AO5A 5F9LA 4AHTA 4DTMA 2G8FA 4O3OA 2J6SA 3EZ5A 4PA1A 4ICLB 3DDKA 4CJ4A 4LQ9A 3HT3A 2R8GA 4CJFA 4IFVB 2F8SA 1LW0B 4NLPA 5KFMA 3O3HA 3PVXA 1BQNA 3G6XA 4WE1B 5KG3A 3LP1B 1HNVB 2O5DA 4IFYA 4IOBA 3QZ7A 2WONA 1HQUA 3KK3B 3V81A 3AVMA 2VG5B 4KRFA 2ZE2A 1S9GB 5KG2A 3T5LA 4CEFA 2C28A 4WZQA 2C2EA 2YKNA 4JV1A 3P1GA 4IKAA 1VSHA 3FFIA 1DLOB 3AO2A 4CHOA 4J2DA 3SQ0A 1JIHA 3ZSRA 4XPCA 3HHKA 2XWYA 3T3FA 3QZ8A 1CZ9A 3ZSXA 3M9NB 3PHEA 2Z1JA 1L3UA 4ICLA 1N56A 5FRNA 5KFRA 4AHCA 3P5JA 2VA2A 4FVMA 4IFVA 4N76A 3LANA 2IOCA 4DSIA 3SJJA 2DFFA 4TY8B 4WE1A 3SQ2A 3DLEB 1HMVB 3LP1A 1HNVA 2XGPA 3SPZA 4M3WA 4BACA 1VSEA 3AV9A 4MIAA 3KLVA 3ITHB 3KK3A 2VG5A 4F50A 3NGYA 4KHQA 1A5VA 1S9GA 3QO9B 3LAKA 4M94A 3MXMA 1RTJB 4CGDA 4YR2A 1DLOA 4OKJA 4YMEA 3TAMA 3NDKA 2UVRA 4CCHA 3KLHB 4Y2CA 1RT1B 3C94A 4Y1DA 4DL4A 3MXJA 5J1EA 1GX6A 4RW8B 3CJ0A 1UOCA 4TY8A 1SL1A 2PYLA 3DLEA 1HMVA 4DTSA 1WNSA 4NLOA 3VQEA 1QE1B 3ITHA 4OJRA 4KTQA 2XGQA 5CYQB 3QO9A 2E9ZA 4FJIA 4BDYA 4E1MA 3NBPA 1RTJA 5KFCA 3ZT1A 3CM6A 2FBVA 1WSGA 1NK7A 3KLHA 1K1SA 1RT1A 1JLAB 3HL8A 1VSDA 4W5OA 3BR9A 2ASLA 4F4ZA 1BCMA 3NAIA 3HM9A 4RW8A 1C1CA 5KG5A 2IC3B 1X9WA 2QKKA 1HPZA 3NHGA 3OL8A 1REVB 1D8YA 2I5JA 3EY1A 4QCLA 1TAUA 1QE1A 1K1QA 2XY6A 3ZT3A 2HW3A 5CYQA 3JSMB 1TQLA 4Q8EA 4R8UB 3C6UB 1S0NA 1WAJA 1BIUA 4URSA 4YR0A 4FZZA 4DS5A 1C1BB 1TK5A 5C42B 1ZTWA 1U49A 5J2PB 4CJLA 2OYQA 4HTUA 1JLAA 1HYVA 3MEGB 4BE1A 5KTQA 3OSNA 4YQWA 1HARA 1Y97A 4DU1A 4NCBA 1NK8A 3TAEA 3MF5A 4J9QA 4E0DA 4FLVA 4JLHA 3Q8PB 3GIJA 1HRHA 1REVA 4BWMA 4CGHA 4DFJA 3QEVA 4CF9A 3V4IB 1ASUA 3UIQA 3ASMA 3TAPA 2KFZA 4E7LA 3JSMA 2HB5A 4IR9A 4OPJA 2IGIA 1RBSA 4RW4B 4R8UA 3VA0A 3C6UA 1C2PA 1UAXA 4FXDA 2YV0X 1TL3B 1C1BA 2UVUA 5C42A 4LD0A 1JLFA 4KBIA 4CEDA 3BQ2A 1D9FA 3MEGA 3IRXB 2GC8A 4CEQA 3CFRA 4MK9A 4MIBA 4ZPCA 3V6HA 3ZSQA 4F4YA 3HK2A 1BGXT 3VQAA 1RT2B 4URQU 4K4YA 1X1PA 2OH2A 1RBUA 3NFAA 1YT3A 2QK9A 4QWBA 4EBCA 3V4IA 1T03B 4O4GB 3UPFA 1RAJA 3D45A 4RUAA 4JS5A 4EO8A 3I5AA 4RW4A 3FSIA 5SZTA 4BDZA 5F8GA 2YKMB 3CWJA 5KT7A 1XWLA 1MU2A 3H2LA 4CF8A 3O4QA 3H5UA 1JXBA 4K4UA 4DL7A 1LWFB 4FJ5A 4IRDA 4J9LA 1F21A 5DQGA 5L9XA 2FLNA 4NCGB 5I42A 5HRPA 3ISND 1EX4A 2E4LA 1ZBLA 2DFEA 3O3GA 1CZBA 5KG7A 4C8OA 2VG6B 4RW6B 4N56A 2HWIA 2IMWP 4DMNA 4MFBB 3DOKA 4ECXA 2IS3A 2JGUA 3HJFA 4KAIA 1WSHA 2R8JA 1RCHA 2DTUA 3V1OA 1WLJA 4E1NA 4DLEA 3SFUA 3NH2A 2KTQA 5C24B 4X2BA 3AVGA 1KHVA 4W5TA 2W9CA 3M8RA 4M3YA 5F9NA 4FM1A 4Y34A 5KFTA 3MFIA 5T14A 2XO7A 3OYBA 4NCGA 3TABA 1KVBA 3OYGA 2P1JA 1XI1A 2OA8A 1GOCA 4IH5A 3RR7A 5KGWA 1IKWB 4HUFA 4TY9A 3NKYA 4FJJA 2RDIA 5EWGA 3PV8A 3NF6A 4DTJA 3VQ7A 3K5LA 1RT6B 4JV2A 2YNFB 4FLWA 2WB4A 2IM0A 4E89A 2BQUA 2HHWA 2HVHA 5F8JA 3GYNA 4ZP7A 3KIOA 3DM2B 3NMAA 1CLQA 5KFIA 1S9EA 2V9WA 4ECWA 2D0BA 3U6FA 1TGOA 3IGVA 5C24A 5KT4A 4NLQA 4CIFA 4NLDA 1WNEA 4CEEA 3T5KA 3CVKA 4YR3A 4NLRA 4I7FA 4Z4HA 3AVAA 4IH6A 1T05B 5HROB 5KT6A 1L3TA 1S1UB 4QW9A 3TARA 3K2PA 1LWEB 4IDKB 1IKWA 2XHBA 4W5RA 2D7SA 4FS2A 4DSFA 5DG9A 5F8IA 4ID1A 3KOAA 4CFAA 2ILZA 3KLGA 4DEZA 1GOAA 4DTRA 2O4IA 4WYWA 4CGJA 3SFGA 3V6KA 3DM2A 4ED1A 4Q8FA 3NAHA 3LZJA 1LV5A 2DPJA 1ITGA 1J9AA 5DG8A 1S97A 2G8HA 1RDRA 4ZPBA 3RMDA 4HCBA 2PZSA 5J2NA 3RRGA 2Y1IA 4DSJA 4QW8A 3M8QA 2DY4A 3L2QA 3MEEA 3IS9B 5HP1B 1T05A 5J2QB 5HROA 4K4ZA 2RKIB 1VSJA 2QKBA 2QV6A 3UR0A 2E6LA 1S48A 1LWEA 1NOZA 4QAGA 3AO1A 3THVA 2HAIA 5DGBA 3I8DA 3FQKA 4KHRA 4PUOB 2D3UA 5KFFA 4MK7A 3AVCA 3PZPA 3NF9A 5DQHA 4ED0A 3BSNA 1NK6A 4K8XA 4EP4A 4FZXC 4QOZB 3TAGA 3F73A 5KFLA 4EZ9A 4J2EA 1SH2A 2W9BA 3LDSA 1RT5B 4FJKA 3OL6A 4ECVA 3HSTB 3V9UA 5DMRA 4OGEA 3H40A 3IS9A 5HP1A 5J2QA 3L2WA 1ZBUA 3WNEA 2RKIA 1RDCA 2FBXA 4F8RA 4DSKA 2AJQA 2I1RA 3RMBA 1NHUA 4NLGA 5JS2A 3QGIA 2ASDA 3MAQA 3M8PB 2CJQA 4N47A 4PUOA 1S0MA 3C95A 4JS4A 2WK4A 1BQNB 1S0OA 4CF1A 1HYZA 4ZPDA 1T3NA 4FLUA 2KFNA 1D1UA 4WFZA 3DYAB 3OL9A 3LWMA 4DQIA 4EYHB 2QXFA 4OKKA 4CHQA 4ECRA 3NGZA 4I9QA 3VQ8A 4CJ5A 1WSEA 4FW2A 2ZD1B 4M3RA 4Q44A 2HHQA 4CESA 4KTZA 4DSLA 4ED6A 3HP6A 1YVUA 3AO4A 2Z1HA 4AH9A 3T5HA 5EUHA 3BREA 1TK0A 1FK9B 5HRNA 4KE5A 4IR1A 1T8EA 3OS0A 3RWUA 3M8PA 1S6QA 3OVNA 4TXSA 3RR8A 4Z4GA 2FVSA 3MFHA 2XY7A 3LP3A 4DF4A 3GV8B 3VQCA 1VSFA 4YNQA 2IJFA 1IKXA 2P5GA 3VQ9A 3DYAA 3OL7A 1ZETA 3L2RA 2ZD1A 1SL0A 1Z26A 4CJ3A 4M3TA 3DMJB 2DFHA 3OYJA 3L3UA 3TAMB 3OYFA 4HKQA 4CIGA 1YTAA 5C5JA 1N5YA 4ZP9A 2WHOA 3ZSWA 5KFSA 2JC1A 1WSFA 4DWIA 1TKXB 2IM2A 4W5NA 2HNZB 1FK9A 5J1EB 3NGDA 3PO5A 4KHYA 1Q9XA 2QE5A 3BSOA 3ULDA 1JLGB 4OPKA 4C8NA 4ECSA 4IQXA 3AVFA 5L1JA 3RB6A 5JS1A 4J9OA 4M3XA 4CJQA 3AA3A 4NRTA 5SWMA 3HVRA 3EPGA 3PX6A 3IN5A 2JLEA 3NBPB 4FJGA 1RT4B 2XI2A 3K5NA 3FDSA 2HHXA 4PQUB 3DMJA 4JUZA 3NF8A 1L5UA 1X9MA 1B9DA 1HQEB 5CZ1A 4B9TA 1N48A 1S10A 1I6JA 4MKBA 5F8NA 3CM5A 1U09A 3NE6A 1FKOB 1TKXA 4EZ6A 3PW0A 4CHNA 1NJWA 2HNZA 3PW5A 3CJ4A 4DL5A 1C1CB 4ZVEA 4AHRA 1JLGA 2ETJA 3SUQA 1HPZB 1SL2A 2BR0A 4WZMA 3HXMA 3DLHA 2I5JB 3E51A 4Z4IA 4FCYA 2DPIA 3T1AA 3RRHA 3QEPA 2BGGA 3G0ZA 3TR8A 1S1VB 3SI8A 3M9OB 1HYSB 3V9ZA 1RT4A 1KHWA 4PQUA 1JX4A 5KFQA 1Q8IA 2KQ2A 4FJXA 2B6AB 3OYIA 3PJWA 3S9HA 1HQEA 2ATLA 3KK2B 4N5SA 1XHXA 4CK2A 3TAQA 3LZIA 3AA2A 1FKOA 2CKWA 3K59A 1D9DA 5EWFA 3DLBA 4RNOA 2D0CA 4I2PB 1LWCB 4ED8A 1IM4A 2UVWA 3H5SA 3K5MA 3I0SB 4NZ0A 4WFYA 4J2AA 3KMQA 2V0NA 3OYDA 5DLGA 3QGHA 4M3ZA 5KFDA 4RNMA 5EU7A 3VQPA 1S1VA 1TKZB 5FRMA 1HYSA 4ID5A 5KFOA 4NYFA 4B3OB 4NLUA 3HPOA 3NCIA 3OS2A 1KFSA 2GIRA 4DTNA 3OYAA 1BI4B 3GV5B 2B6AA 1X9SA 1C1AA 3KK2A 1JLFB 4M42A 3NH0A 1LAWA 5J2MB 4ZHRB 1OS5A 1JLEB 3WNGA 3CFOA 4I2PA 1ASVA 1NK9A 4J9SA 3GIKA 1LWCA 3K57A 5KG0A 4ZP6A 3AA5X 3VQQA 3DRPA 3DRRB 2AX0A 3I0SA 3L2UA 1TV6B 3KD1E 4DQPA 4B9SA 4CJSA 4DTOA 1R0AA 5HLFB 1NNDA 1BCOA 3HP9A 2HMIB 4LH4A 2BRLA 4KHUA 4DQSA 1TKZA 4OGCA 4J2BA 4B3OA 3LP0B 3N6MA 2YHBA 3Q8SB 3ISNC 3TWHA 2OPSB 3RBDA 1BI4A 3TAFA 4KB1A 3NAEA 4I2QB 1RBTA 1MU2B 2J6TA 4CK1A 5J2MA 4ZHRA 1JLEA 1BQMA 2OPQB 3H4DA 2ZQBA 4WYLA 4GVMA 2G8KA 3SI6A 5KT3A 2R8KA 2XCAA 1SV5B 4K4XA 3RAXA 1IH7A 1QS4A 4FM2A 3FQLA 3DRRA 4AHSA 5I42B 3M8SA 4Q43A 1TV6A 4DSEA 4FW1A 1L3VA 4FBUA 2O4GA 5HLFA 2RPIA 2HMIA 2G8UA 4KV8B 3Q8QB 4K50A 3GIIA 4FLZA 4KI6A 1JL1A 1TVRB 3QESA 3DOKB 3LP2B 3QIDA 4CE9A 3LP0A 2WOMB 3CG7A 1TL1A 1SKSA 2OPSA 3H59A 4AHUA 4LY7A 2EX3A 1TKTA 3OYNA 4I2QA 2ILYA 3CDWA 4NRUA 4NCAA 1U48A 3MEDA 4KB0A 4CJPA 2W9CB 4E7IA 3BDPA 2OPQA 4CJVA 1C6VA 2PYJA 2OPRB 4C8KA 3ICLA 4CK3A 1O1WA 1KRPA 1SV5A 1D5AA 3ZSOA 4ECTA 4GW6A 1KLNA 5KFBA 4U7CA 3V1QA 4WXWA 3RB4A 3PR4A 4KV8A 1QSYA 1TVRA 3LP2A 1RYSA 1HJRA 3OYMA 2WOMA 4FJMA 2IA6A 4PY5A 1ZBFA 2XRIA 2BANB 4CFBA 3U3GA 1S9EB 5KFZA 3SV3A 4L8RB 1N6QB 1JLQB 3PO4A 3SUPA 3V6DB 4DL3A 2YHAA 2IDOA 4HVJA 4Z4FA 4FK4A 4J9NA 3SUNA 3L8BA 1A5WA 2OPRA 1XHZA 4I7FB 1SH3A 4FLXA 4BE0A 1SH0A 3MTKA 2VG7B 4FM0A 1RNHA 3H08A 4NLYA 5CY4A 3CDEA 4CHZA 4J9RA 4LH5A 4E3SA 5E41A 4ZP8A 1J5OB 1U45A 5F8MA 4G1QB 4DTPA 4KFBB 3MR2A 1XR5A 4TQRA 2G8WA 3B6OA 2KZMA 2FVPA 3KLGB 3H5YA 1LW2B 5KG1A 2JC0A 3AVIA 2BANA 5KFKA 4K4TA 4CHYA 1N6QA 1JLQA 5T7BA 3V6DA 2R7YA 1FKPB 2RF2B 4CFDA 4OKEA 5J2NB 1J53A 3M8QB 2AWZA 4O3RA 1TP7A 3AVJA 4O3NA 3MEEB 3BQ1A 2W7PA 4CJWA 1NJZA 2VG7A 5CZ2A 4FBTA 2E9TA 5HBMB 3QLHB 1RA7A 5KFVA 4WXOA 4K4VA 1J5OA 1RTHB 4URGA 3T19A 4G1QA 1CXQA 1W25A 4KTWA 4M45A 4KFBA 1S1WB 4MK8A 4DU3A 4FJ8A 3QEXA 3O3FA 1K6YA 2EC0A 3H98A 4NLWA 3KMSA 1LW2A 5FDLB 4QWAA 4CERA 1KCFA 3KHRA 2BQRA 2LSNA 1EETB 4M41A
chains in the Genus database with same CATH superfamily
1UA1A 5EWEA 4P2XA 3WNFA 1I94F 3BEGB 4DR5F 3B4DA 1YSJA 1ZPVA 3J8AA 1FDNA 1NK5A 3UN5A 3EO3A 3OD2A 1IKYA 1DTQB 1MMDA 2XYHB 3M2RA 2XZTB 3BYRA 2B4JA 3MXIA 1S6UA 3R1HA 3QINA 3PLAA 2QA4N 1KBRA 5KT5A 3GFXA 4OYWA 1M1KO 4NXNF 4CZHA 2GQQA 1TFYA 4XDCA 3RAQA 4EBEA 1HD0A 3QERA 1UKUA 3CI5A 5F0XA 3J81Y 3CIZA 2FJAB 1R8BA 3F44A 1WF1A 3WC0A 2W2NP 3W9HA 4LSLB 3AB2B 4A62A 5M1FA 3C46A 3BB5A 4C0BA 3UQSA 2CNOB 1X5TA 3VVTA 4O44A 3W2WB 1FRIA 1FWLA 4BRFA 2LQBA 2KXNB 3J7ZO 4CJTA 1QZ6A 1IBKF 5CYMA 5FIIA 3FKBA 4CVNE 1WBDA 1VK3A 4MQ3A 1JLBB 1IBLF 2X6NA 2AGOA 4L3QA 2D1KA 5D77A 2V4JA 3SPYA 4CYUA 1UFKA 3OYCA 5D0HA 2PN6A 2G8IA 2H3EB 2V2KA 2ZZMA 3B82A 4IXCA 1GEHA 3CQXA 3MCNA 2QA4S 4DLGA 1N5YB 3R2CJ 4TN2A 1C0TA 2IY5B 4LBPA 4ZDNA 1QAJA 1B7FA 4NLVA 1U0HA 4PEOA 2MQPA 2L9WA 2NXNA 4M5IA 3NLCA 4BRPA 2G0CA 5JXSA 2MZTA 4Z2XA 1XUPO 3RBEA 3G87A 4Y3CA 4FL9A 2HZCA 4PPZA 2RDJA 2O8BB 2RDDA 1RAGB 1QQMA 3WZ0A 3PY8A 2LLZA 4JKDA 3C2PA 3IBCB 1T7PA 4LT6A 4RW7A 3EXCX 4MKVA 4BR9A 2ZDPA 2HFUA 3E01B 1U6BA 4MLEA 2BE2A 4LF9F 3DOLA 4J9MA 1X4AA 1CJKA 1SKRA 4GKKJ 3UDLA 5LMUF 4QWDA 5IFMA 4DCJB 3LDOA 1S5JA 1B3TA 3OT9A 3Q8YA 2BM0A 5C2FA 2JRSA 1E6YB 1G2EA 5KFWA 5E0OA 3VQDA 2HF3A 1FI4A 2E5JA 2PE8A 2DR8A 5KG6A 3DI6B 2YWWA 2HQCA 3HHLA 2KW4A 4E19A 1NDCA 1MMLA 3A3OB 1RAAB 1BHLA 4PKDB 5CD4H 1YIJN 2KYXA 3LUYA 1T9XA 3M1VA 3GG1A 4K8RA 2VWKA 3GPAA 2NXJA 1C0UA 2ITGA 2FY1A 3TP2A 2W1BA 3RB3A 3OYKA 3D3CJ 3HVAA 5KFEA 3NS5A 3KK1B 3JTOA 4DG1A 1Q7YO 4KO0A 4MKYA 1WUAA 1JCFA 4CLUA 3ZC4A 1RTZA 3U1MA 2ZWPA 3SQ4A 1NDPA 1JJHA 2D9PA 4JI8J 2AJFE 4ZS6A 4DL6A 3CC7N 2YNGB 2WZ1A 4FWSA 4ANEA 5IM0B 4WF9L 1WC6A 2OSQA 4ZKAA 1YBAA 1YJNN 4G3IA 5DLFA 4FF4A 4JI2K 3G8QA 5HMXA 4I67A 3PX0A 1QJHA 2FVQA 5ETMA 2HBQB 2HVDA 4XTTA 3SCLE 2IHR1 4KB7A 3DRPB 1Y11A 2H48B 3CO9A 1HIYA 4K59A 5KI6A 2FZKB 5KFUA 3I0RB 3E66A 2DH9A 2D69A 1EP4B 4CTAA 1YIJS 5F1XA 3TZWA 3KDNA 4X4NA 2OD4A 5KFHA 2UUTA 3PYEA 3FZBA 4ZVPB 5FPEA 3NNAA 2CJKA 4BR5A 3OS1A 2V8PA 3EGWB 3IA0A 4BG8A 3OUYA 1URRA 2F1FA 1VSMA 2HNDA 4TLRA 1BQMB 1T0TV 1N32F 1U4BA 4V19X 3ZXWA 4QWCA 2RU9A 3ZT4A 3W0LA 3M3ZA 2DHSA 3CC7S 3DXKB 4M5HA 3FGUA 3O1LA 2NXCA 4C3KA 1YJNS 3S3MA 4B9NA 1UWBB 2IC3A 1WOPA 4AHVA 2X6SA 1HWJA 2YJFA 4ZVQB 1LEOA 2MQNA 5A0YB 3KG4A 5E3QA 3G8TA 2Z1GA 1KLMB 4Q2LA 2RUGA 2R3VA 3IAYA 3QATA 4JI7K 5ETQA 3VQ6A 3W62A 1A7GE 4OLOA 4HDHA 2Z30B 4R0EA 3E9LA 3GYXB 3BZCA 1FVSA 1YJRA 5GMEA 3OTEA 3T9ZA 5GAEI 2V4QA 5KRSA 4J9PA 2E2QA 3ZYYX 3VHQA 3GV7B 5EN1A 2XNQA 1EO1A 5K9FA 2HNYA 4Q45A 1RU2A 3FZFA 2L3MA 4F4WA 1UL3A 4RTFD 2MQQA 3AQPA 3H45C 2IRUA 1T9WA 4QWEA 1JLCA 3GJSB 4DCHA 2VF3A 3D66A 4G65A 2GJ2A 3JAMO 4KI4A 4IG0B 4EIAA 5L39A 4CT8A 2NUUG 2POKA 2BTFA 1NLKL 3OY9A 4CLFA 1TAQA 2KJWA 2ZBRA 3EGZA 1QVGM 4IRCA 5D3GA 3D2EB 1ZBHA 4Z4EA 4Z37A 5GADP 4JI6F 5C12A 2DO0A 5B0CA 1AT1B 2MZJA 4H0YB 1NNEA 3KLIA 5HQLA 4DHVA 4B8CA 1VBKA 4DPUA 2QTWA 3ELHA 2UUWA 1HFEL 3KFWX 3MOZA 4LF6F 2ZKUA 3B8AX 4BC5A 3LALA 2VL1A 2RHQB 1NKBA 3CCRS 4O4GA 4FNIA 3KUEA 2C2DA 2V67A 4LSNA 4DU4A 4H8KA 4FYDA 2D3ZA 4CRJA 4EYIB 5GAGI 2GBZA 1VI7A 2W8KA 2HQGA 5CH7B 1UFWA 2A6OA 4B9MA 4PRFA 1N33K 1SQFA 4IJAA 4LF1A 3O3LA 5A8WB 3U9DA 2XYGB 1RAIB 2CNLB 1M5KC 2DH8A 4DUTA 1LWFA 4DFMA 2KL8A 2AU0A 5AE3A 1ZM3A 4ED2A 3VQ4A 3DN9A 3M30B 1F2HA 1RT3A 2EC2A 1HQ2A 2RE1A 3W2VA 5K14B 4LFAJ 1U02A 3AARA 1S7HA 1DZ5A 1FEEA 1WB9A 3H5XA 1K0VA 3V4MA 2HHTA 3G10A 2VG6A 4KH4A 3TA0A 5FPDA 1OY6A 4CJEA 1XIQA 4C4WA 3C6AA 3MPWA 4PL8A 1XMQK 4LSZB 4FZVA 1FNOA 2B43A 4ZPVR 5DJBA 1M5HA 2V8VA 4NLSA 2QFJA 1IKYB 1VK0A 3ISZA 2RB7A 4KHWA 3VQ5A 3NMRA 4LF4F 3Q24A 4X4SA 1G99A 1Q9YA 2XSFA 5D4OA 2GCFA 2LFVA 2BDPA 4HCCA 1Q78A 1NKEA 4R5PB 5D78A 2OGUA 4YB1P 2YX6A 5DQIA 5M1QA 2ZGYA 3HM8A 4K7QA 1HLWA 4XO0A 1FDBA 1S49A 4ZLLA 3HVTA 1KOHA 3D5MA 4F3TA 1N54B 4CLLA 3LDLA 5LJ5Y 3S3NA 4DR2F 3OYHA 1M5VC 4AL7A 1EQMA 4CGIA 3S3OA 2KN4A 3D6TB 1HBMB 1RGIA 4QYZJ 4P75A 3BSAA 3TANA 2P51A 1LAVA 1UVNA 2Z1IA 2HHVA 1S22A 4DUZJ 2IMOA 4OFZA 2NSCA 4NLBA 1RTDB 2L41A 3FVYA 2NRRA 3OVBA 1N4LA 1ATNA 2V4JB 4BRNA 4ZPAA 3M8YA 4HL9A 4BWJA 3CERA 3AVBA 4KKOB 4KREA 1HNXJ 2A6MA 3UE5A 2L08A 1RT7B 1UA0A 1M0SA 4CLWA 1F60B 1Y3KA 3PUFA 2LQ8A 2P6TA 3TVKA 3VALA 4DS4A 3UFCX 4CEAA 3DRSB 4LC9B 2B5JA 2Y8WA 3GTYX 1J54A 1BL3A 1G15A 3DOMA 3KHHA 2LP4A 5K8NA 3WXLA 1NLVA 2J6UA 4F4AA 4RUHA 4B3TK 2HZAA 3KJFB 4TSXA 3QEWA 3QNNA 2D41A 1SIZA 2NYHA 2EXUA 5IT9U 3QFHA 3WEEA 1U8SA 2MPUA 4BS2A 3ZSZA 2ZM6J 1HQUB 1ZOTA 5CZXA 3VGLA 2AZ1A 3BV8A 5C2DA 5L1KA 4F4XA 3T5JA 2CPZA 2XMAA 1VSLA 3CD5A 4CEOA 3SAFA 1PCAA 4YOTA 2ZITA 2HQFA 2PI5A 2R7TA 1F5CA 4HT7A 5F9LA 3SMSA 4E8UA 1X7VA 2RILA 3EZ5A 3P39A 4PA1A 1H38A 3DDKA 4B3MF 4ANDA 4NLPA 1RHKB 2XTJP 3PVXA 1BQNA 3ILLA 4K0KJ 4YDUA 2GWKA 2VQFK 1PBUA 4IOBA 2NPFA 3R5JB 3V81A 2ZE2A 1S9GB 2FY8A 2IVMA 3BKTA 4QIGA 4W90B 4JB8B 4YORA 4HDGA 4WZQA 2C2EA 4OHVA 3P1GA 1DLOB 2VUGA 3AO2A 3VAHA 3O1WA 3MM6B 3R6GB 3EKSA 2GX9A 4B9QA 1CZ9A 2QLBB 3M9NB 2PO4A 2QYGA 4AFFA 1AFJA 3DLLL 1XMOK 4NX9A 5FRNA 4FWMA 4CQ1A 2YKAA 2VA2A 4IFVA 3LANA 3SJJA 4DV1K 1V4SA 4HLBA 3IWLA 1OIAA 3SQ2A 3DLEB 3NCRA 2PMWA 1HNVA 3BH6B 2KHCA 4F50A 4LFCK 1Y00A 2YHYA 3QBXA 3QO9B 3LAKA 2D74B 2GNKA 1WF0A 1GFWB 4DB3A 4M5NA 1RWWB 2DGUA 4JOUA 3WXKA 2JSXA 3ONQA 3NDKA 1JNRB 2GW8A 1HUXA 1TUGB 4DL4A 2MKHA 2LQJA 3CJ0A 4FDFA 4CLSA 4CT9A 2C2OB 3VQEA 4DV6F 1QE1B 4OJRA 4MO5A 1BUXA 3OUYB 1W97L 3HSJA 4BDYA 4JI1F 1SKUB 4E1MA 4Z7CA 3LDNA 5KFCA 5G4DA 1V5VA 3PNIA 3TX0A 3ZT1A 2W6KA 3CM6A 1KONA 1IR1A 1W26A 4ID8A 2CPHA 3VAIA 1RT1A 1JLAB 3BR9A 2PA3A 1BD6A 3NAIA 2VFTA 3TSPA 3T41A 3GBTA 4WCEL 3DGVA 1C1CA 2IC3B 1UJ4A 4GVBA 2QKKA 1RHMB 3NHGA 3OL8A 3GB0A 1REVB 1VQ5N 2YH0A 4QCLA 3R3LA 3T7ZA 5C2GA 5CYQA 3JSMB 3Q89A 5F2RA 1UW4A 4CIOA 4URSA 4FZZA 1EARA 1C1BB 1UTAA 3THTA 4UY8O 4DV5K 1S59A 1J5EK 4BE1A 5KTQA 3UKUB 3MF5A 3VR1A 1Q1KA 1RWKB 4CGHA 5HK4A 3ASMA 4J9VA 1HBOA 3M6UA 3OTCA 2LEAA 4E7LA 4LF8J 4R8UA 3DU6A 3RAMA 3CGIA 2Y3YA 3PYDA 1J27A 3KWGA 5IC4B 4BRHA 2UVUA 4JYAK 5BPLA 4KBIA 4CEDA 1VQ5S 3MEGA 4MYUA 2GC8A 4MK9A 2VH7A 4ZPCA 3V6HA 1BGXT 4CO5A 4K4YA 2VOOA 3VMFB 3HD1A 1Q0NA 2OH2A 3THYA 1IR2A 3EDQB 3W9JA 2QK9A 4EGLA 3HHDA 3V4IA 2MKJA 4O4GB 4YY3K 4A8MP 4YB7A 1DARA 3D45A 5K8OA 4RUAA 2J4RA 1I3OB 3J7A1 5I3PA 4BDZA 4P7VA 3CWJA 3B78A 4BRAA 2GZOA 4BC4A 1MU2A 4CF8A 3BY5A 5AFUA 4USKA 4USIA 4ZJQA 4FSVA 1VDHA 1LWFB 3QMQA 1F21A 4WQ5A 5L9XA 4NCGB 1GK8A 2CGKA 3KUGA 1EX4A 2J7KA 3VCDA 4WP8A 1RHRB 2DFEA 3A8KA 4PQAA 4C8OA 1ZM9A 2OP5A 1S0VA 5AZJA 2VG6B 4NA3A 2ZUAA 4ECXA 1NEEA 3L7PA 2YX4A 4ES1A 4CBWA 4PXBA 3L7UA 2Y0BB 2ZHOA 3NH2A 4UF4A 1R27B 1KHVA 2IFXA 3M8RA 4DR4J 5KFTA 5CQGA 5T14A 2CJXB 2QT7A 2XO7A 3OYBA 2QFIA 1NU4A 3SDEB 3D9BA 1KVBA 1HHQA 2QEXN 2P1JA 4H5RA 1GOCA 1QVGR 3W9IA 3RR7A 3ZETB 2MLXA 1IXKA 2Q0UA 4MLHA 1OMSA 4HUFA 4TY9A 5EWGA 3QJJA 4JV2A 2RMLA 4FLWA 1QVFM 3J81U 4ZCKA 1QDUB 2IM0A 5CCMA 1I94K 4DR5K 3PRVA 3KG1A 3KIOA 3SEOA 1IV0A 2V9WA 4ECWA 2UXBF 2VD3A 4RBVA 2GHWA 2V69A 4AQYF 4BGBA 4YR3A 4NLRA 1GT8A 4I7FA 3CCEN 2VKZG 4Z4HA 3CCJS 4QU7A 1OY8A 4JI2J 4RPFA 3ULHA 4PWWA 1L3TA 4NXNK 5I3QA 3UNGC 3QT6A 4FS2A 2ABYA 2AJ1A 1E4GT 2A3JA 1M90O 1M5SA 3VGMA 3SFGA 4CH7A 3H0PA 4OV6A 4A8FA 2QEXS 1Z2LA 3NAHA 3MAAB 2B4UA 2CH6A 2G8HA 1VJQA 2DISA 2VPZB 2MJUA 4DSJA 5MLCV 2QI2A 2OAUA 4P2MA 2BUNA 4DPYA 1ULRA 3IS9B 1T05A 1IBKK 2OUGA 1H2UX 3M8ZA 4K4ZA 2RKIB 1YG0A 1VSJA 5LJVA 4A8XA 2QKBA 2QV6A 3JAMY 1S48A 1NH7A 4CNYA 3A5MC 1MROB 3DOMB 1BC6A 1IBLK 4PWUA 5B0DA 1NOZA 1F2GA 3LA0A 2XYPB 5DGBA 3DLJA 4PUOB 2D3UA 1DKGD 3R6LB 2ROPA 3AVCA 1OO0B 3E2EA 4ED0A 1OKJA 3L4QA 4TNOA 4JHDA 2KG0A 3CCES 3MMAB 2P9UA 1XNRF 3G9CA 3F73A 2XMUA 2ZNYA 3CUNA 1SH2A 3R9PA 5KPRA 3VGUA 3HSTB 1FXLA 1LOTB 1VBXA 3CJBA 3H40A 2B8QA 4F8RA 4DR7F 1K8KA 4BC3A 3TU5A 2E1PA 1P6TA 4JI7J 3GWCA 3OW2R 3EZWA 2R7UA 2DB1A 3ENAA 3R6MA 2CJQA 1VQPN 1S0MA 4JS4A 1BQNB 1S0OA 3MX2A 5ITHA 4LF9K 1D09B 4CO3A 1N34J 2LEBA 2RVJA 3ILOA 2MHNA 3OL9A 1F9EB 5LMUK 4EYHB 4ECRA 2BJEA 4I9QA 3NVKA 2B7CB 4CJ5A 3B54A 4GNIA 2XEXA 1OY9A 1VRQC 2NREA 4M3RA 2HHQA 4KGMA 4KC5A 3HP6A 2YVSA 3JSBA 3CT9A 2O01C 4ILRA 3QGPA 2E5LF 5BYSA 4LRAA 3FGVA 1GMVA 2YHXA 1FK9B 5HRNA 4IR1A 4OJHA 2Q31A 3RWUA 3ZTRA 3M8PA 5EXWA 1MMNA 2W24A 3CO0P 1ZS6A 1F9FA 2B51A 4ZVSB 2FVSA 3D0IE 1CZAN 3OA9A 3VQCA 4MJKA 2P5GA 4F9OA 4OZ0A 5EX5A 4J7CA 1U0SA 3OL7A 4DX6A 1CC7A 4WF9Q 3IAM9 3L2RA 2ZD1A 1Z26A 3CD6N 1QHAA 4JEPA 1VIXA 1BE4A 4HKQA 5M2RA 1VQPS 5C0YA 3SQGB 4CM0A 3LOUA 2QA4G 1SVDA 1YJUA 1WSFA 1TKXB 4DCOB 4KH0B 1HBNA 2HNZB 5GAEP 3PO5A 1FJEB 1N33J 2HZVA 1CPZA 3QWUA 1FW6A 3AVFA 3CC2N 2DNNA 3F9MA 4UT4A 4J9OA 3HVRA 1Q8LA 3HFKA 4XH1A 3TO8A 2CJAA 2J0SD 2LECA 3WXIA 3A4TA 4FJGA 4PQUB 5B09A 3NF8A 3AD9C 2DR6A 4A2BA 1B9DA 3C7NA 1N48A 3HI0A 5FLXY 5F8NA 3NE6A 3PDNA 1XMQJ 4NOHA 2ZWHA 2DIUA 2CAJA 1H73A 2XWXA 2MZRA 1C1CB 4AHRA 2ETJA 4GVBB 4H0XB 4DPOA 3CD6S 4LREA 3ID6A 2EWHA 2DPIA 2P9LA 3SBTA 2P9SB 1YTYA 3TVYA 1S1VB 1KKHA 4KJIA 2VU5A 3V9ZA 1N32K 1RT4A 5GAGP 3CPWM 5H1SQ 4GO7X 1KHWA 5IQQA 5KFQA 5B8HA 3OYIA 3UWTA 1T95A 3S9HA 1HQEA 3KK2B 3CC2S 1FHTA 2YWFA 3KG0A 3AA2A 1FKOA 1D9DA 1P8ZA 1FJGF 4WQ4A 3KWMA 2DYAA 1NH8A 3OBWA 2QJ3A 2F65A 2HBMA 2VZ9A 1YI2N 2G2OA 3H5SA 2CNKB 4IDHA 3N79A 3B8HA 2CQHA 2RQMA 2HBJA 3I55N 1PKUA 5DLGA 1HBOB 5KFDA 2XS5A 2IRYA 4DKWA 1H7XA 3EE3A 4ID5A 4PG7A 4NYFA 2KYZA 1HX1A 2DHHA 1FE4A 1VBYA 1KFSA 2HEKA 4DTNA 3TTDA 1C1AA 3U27A 5I9EB 3W5ZA 3NH0A 5J2MB 2WB1D 4A8WA 2AKWB 3KZBA 3WNGA 3CFOA 4I2PA 3UNYA 5AQUA 3W63A 5KG0A 5HL7L 4ZP6A 3VQQA 3IR6B 3BF4A 3IBWA 4BC9A 2V7YA 3KD1E 1R0AA 2W41A 2O8EA 1NNDA 3HP9A 2RH3A 4LH4A 3BEXA 3KJNB 4X62F 4ENOA 4DQSA 3AHPA 3LPEA 2WUSA 1XK8A 3N6MA 1RSCA 4I6WA 3NAEA 1FFSB 1RBTA 1MU2B 1YI2S 2V8DA 4D3HA 4CK1A 4JI6K 4B3TJ 2BZ2A 4ZHRA 3I55S 1JLEA 3TVZA 3BGOP 5KT3A 2HVZA 1RWNB 1H2TZ 1U2FA 2XCAA 1X0FA 4RWWA 4LF6K 3G8SA 2FYXA 3DRRA 3M8SA 1UETA 1B70B 4FW1A 3VWSA 5AZJB 4FLZA 4KI6A 1FRKA 1PILA 1JL1A 1TVRB 1VOMA 5LM7E 3QESA 2ZUGA 3LP2B 4J90A 3S01A 4CE9A 1QM9A 2Q66A 1SKSA 1NGEA 1CLFA 1TKTA 4I2QA 2HRYA 2ILYA 1Y9OA 2HG4A 2VODA 2LU1A 2RT3A 3MEDA 4E2FB 3BDPA 1O5JA 4CJVA 4DUYF 4ETZA 2HOEA 2OPRB 4C8KA 2DNRA 1B0VA 1SV5A 4GW6A 3IR5B 2FQQB 4ZPWR 4FKXA 4U7CA 2Q3PA 3PR4A 1QSYA 4NEZA 2P9KA 1HJRA 1RWXB 1EAYC 2K3KA 4DV7F 1QAXA 1XMOJ 2BANB 4X64J 1N8RO 2WSEC 1JLQB 3IFEA 1RKIA 5GADU 3V6DB 4DV1J 1GNKA 3PIPL 2V2VA 4HVJA 4LF4K 4DBQA 4J9NA 4CI6A 1HWIA 4PXCA 1XHZA 4I7FB 2ZZTA 1SH3A 4LFCJ 5IV4A 1MN9A 1FTRA 3F2KA 1YBTA 4JI0F 2VQEF 4R0JA 3H08A 4I56A 4OYBA 1K47A 3CDEA 4J9RA 1N5SA 4K42A 3CMQA 5E41A 4CLPA 4TKTA 2JX2A 3GE1A 1XR5A 2H1YA 2QTDA 2G8WA 4A8SA 2FVPA 2QMXA 2AJ4A 1RWUA 2F9TA 2R9LA 2W2QP 5KG1A 2ZFHA 5ETRA 4DR2K 3EVOA 2ZC3A 5LSLA 5KFKA 3BO4A 4CHYA 3R5GA 2YWKA 3G82B 2R7YA 1FKPB 4CLKA 4CFDA 4CO2A 2G13A 4O3RA 1PYOB 4CLZA 3VAFA 4L3KA 3DHXA 2MKIA 3FFKB 1UEKA 2P9NB 4FBTA 4Y2KA 3K2YA 1J5OA 1RTHB 1A0OB 1X4FA 4G1QA 2I38A 2IRXA 1W25A 1T02A 3ETOA 4F02A 2F7TA 3QEXA 5MAOA 3SBGA 3H98A 1MWQA 1XQSC 1JQGA 4QWAA 1HKCA 4FWKA 2BQRA 4EMDA 2LSNA 4PL7A 1O8BA 3GCWP 4FJNA 1UEUA 1QUVA 1ACMB 2HURA 4NWBA 4B8AB 2X1AA 5HAOA 4EEYA 4OJ1A 4BHQA 2L48A 3HCXA 3U7JA 1IJFB 1QVFR 5K8MA 4F04B 3VF6A 1IJEB 3EL2A 4J9KA 2A42A 4HACA 3QLHA 5C25B 4FJ7A 3FMWA 2FDNA 5KG4A 3A8IA 4CZEA 3CCQN 2BVZA 1IBCB 3D2FA 4L74A 3H20A 4DV5J 2OPPA 4N77A 1J5EJ 2KI2A 1H1VA 5FDLA 5FD1A 3Q8UA 1RTIB 1EETA 4A8KA 2BX6A 1ASWA 9ATCB 3CHWA 3C6HA 4M63A 4RNHA 2NRVA 2RRNA 2YNHA 3FZ2A 3TSUA 2HBZB 2EG2A 4FZYA 5JICA 1VRUA 4HUGA 4IH7A 2YNIA 5LOQA 3U3YA 4GKJF 4B3MK 4JYAJ 3DLLQ 1VSIA 2AX1A 4EHUA 5DGAA 4OI4A 3MWBA 2WTFA 3QIPA 3V9SA 3CJSA 2V34A 2VOPA 3GLJA 2VPYB 2HHHF 1DGKN 5IS2A 1EQYA 1I39A 4MO4A 4Y65A 3FBEA 4I69A 3DXMA 4NYZA 2F4VF 3BGRA 2NNWA 2X51A 3KJVB 1NHVA 5JVGL 1HR0F 3QFWA 5KGXA 1NGAA 3QBWA 2DD8S 1XC9A 3HYFA 4BR4A 4CEZA 4OI2A 1GXLA 4UQGA 3QEIA 3I4PA 2MSSA 2L9DA 1G3OA 7FD1A 4CDIA 1EXQA 3DLKB 2PY5A 4JKEA 3I5BA 5KFJA 3TJAA 1IKVB 1S9FA 4M7YA 2O8DA 2Q6CA 3L3CA 1VRTA 4IG3B 3W64A 5DG7A 4LF7F 4OI0A 1QQCA 1HI8A 4Z4CA 1RUSA 4O5BA 3BUZB 4RWXA 2ZF5O 3C65A 4XH5A 3POTA 1Q95G 4FWLA 4H4KC 2IIHA 1AZSA 2EKYA 4DV6K 1NK4A 3JXUA 1ZYQA 2CZ9A 3EVWA 3OYEA 1OSDA 3TR5A 4U7UD 2ZVSA 2K06A 4OYPA 4JI1K 4GO5X 3LH2S 2YQ0A 3HVWA 4BCAA 3LPTA 4DTXA 4KT0C 3DKDA 5JUMA 1WWHA 1SUQB 3AFGA 1YJVA 3K8WA 3OJSA 4QS8A 2UP1A 1LK5A 1RYRA 1I94J 1VHFA 4DR5J 1T9VA 5AE1A 3HOSA 2HBLA 2RJZA 2FC0A 1JJ2M 5I3UA 3FMBA 4JKBA 1RHUB 1JK9B 2GFFA 5IWAJ 1GQEA 4YP3A 3AVHA 2J9CA 2WBMA 4ID5B 1PYSB 1VSKA 3RMAA 3ETMA 1HNWJ 1FXDA 3TNVA 3M9MB 4C8MA 4LF5F 1P90A 5KFYA 2V4RA 4MDBA 2A2CA 3PW2A 1HNIB 1BISA 3ZX0A 3IWXA 1WSRA 4GRSA 2M0GB 2UYTA 5G0RB 1G7CB 3L09A 1FEHA 1TK8A 2PD1A 1BXNA 4ZN1A 4NE9C 3A2FA 5HVFA 4OVLA 5AQHA 2W25A 3AY9A 1PYTA 1R0AB 2OFHX 2FBTA 4USJC 4O3PA 2XS7A 3MR7A 4EP5A 1IBKJ 3MECA 4K8ZA 2IA0A 3WHIA 3KTQA 2RQKA 5HI7A 3KDOA 3EKUA 2OHDA 4OZNA 3ALYA 1IBLJ 2DK2A 3LPUA 5F41A 2UV8G 2ROGA 5B0BA 1YXQA 4AD6A 2YWHA 4ZN3A 3ZT0A 3ATUA 3AVNA 1VLOA 1VR6A 4Q7AA 5TKWA 3DLGB 3SUOA 1CXUA 2WBNA 3CPWR 4G9ZA 1APSA 1S12A 3ZLJA 2G2YA 3MZIA 3CJ7A 2C22A 2M4MA 3O4NA 2FGCA 3QFUA 1RB0A 2A1RA 1KD1T 2D0AA 3UI3A 2EEYA 3CFPA 3T6JA 2VWJA 1U6FA 2E29A 4DV0F 3OTBA 2HWHA 1TKTB 1OSCA 4OLPA 2CGJA 3VESA 1U2VA 2BEFA 4Q0BA 3KLFB 5ETLA 5BN8A 5GIPA 4RU9A 3MEDB 2EK6A 4BVPA 2W9AA 1UPMB 1ILYA 1S1XB 1LFPA 3CJ5A 4LF9J 2NLWA 4F2SA 2ZH8A 1ZTTA 5LMUJ 4BG9A 5JMVA 2V7ZA 2RNEA 1CQNA 2MYFA 3JQMA 2AIRB 3NGSA 3HO1A 2BYCA 4NXMF 4R25A 1KOOA 1WC0A 1C0MA 2W40A 2DKOB 2QSWA 1CJUA 4ED4A 2UUBF 4ED5A 4LQ3A 2BXJA 4YFUA 1YRXA 2HSEB 3I32A 4EK2A 3LTOA 4NMLA 2E7XA 3GZ7A 1XR6A 1ITPA 3P5BP 2E1AA 3SYZA 4FVCA 3A8EA 5HANA 2D1CA 3OBIA 1SKWA 4KHNA 2WRMA 3F41A 4QU6A 4WIQA 3LGMA 4HTIA 4FWRA 1SQGA 2IAJA 2R2RA 2CQ0A 5KT2A 1VYAA 2R42A 2OEKA 4FLYA 2FGOA 1NJXA 4CF2A 1WC3A 1U2CA 1DTTA 3A5LC 3GL1A 3C6TB 3LAMA 2CQBA 2EI5A 3AVKA 1OH6A 2R2SA 3QGGA 2UXBK 4GMJB 1P9YA 4K25A 4OLBA 3MCSA 1S99A 2KG1A 1DY3A 4BDPA 4AQYK 2M88A 3HFZB 1RBLA 1RDUA 1U1MA 3OLBA 1N52B 3HDSA 1RWVB 1RU1A 3EN9A 5BREA 1V9OA 4RW9A 3MMCB 2R7QA 3JAMU 1RLDA 2C3PA 1CULA 4AL6A 4C6AA 2CGLA 4H4MA 1S77D 4U95A 4DV2F 5F3TA 1UEVA 1M1GA 4RNNA 2R7XA 4FJLA 5JJBA 4RW6A 2GMHA 4USTA 1ZAVA 3S41A 1NCLA 3HSCA 3JYTA 1QHTA 3IUCA 5HSPA 1A6LA 4O0IA 3HHEA 3H1QA 3O9UA 3THXA 3AB4B 1N32J 2GO9A 4H03B 1JXLA 2I7NA 1UMJA 3V2UC 4FJ9A 1P8GA 5U47A 2FVRA 4L75A 3IP0A 3RZAA 2JEGA 2C42A 1VS3A 3I5CA 4KHMA 1JXEA 3D2FB 4DFPA 2VYPA 3BF1A 5DDPC 1T11A 4OLAA 4A48A 3DCAA 2OPPB 2O66A 1AFIA 1KAXA 1XNRK 4BRCA 2XZDB 4ILJA 2BM1A 2JOQA 3KKSA 4CJKA 3QETA 1RT6A 2E5HA 2FJDB 1K8AT 3M6VA 2KB2A 5TKYA 4EI2A 2MEWA 3LQVA 3L7OA 4JI4F 3PW4A 3MEKA 1VRUB 1YJWN 3WC2A 1T9UA 4DR7K 1WHYA 2AW0A 2XS2A 2P5OA 2IDEA 1QTNB 2O67A 2F8EX 3ENOA 1X4CA 2KZZA 3V6JA 2CWXA 1S1UA 2LXUA 4HHJA 5D15A 3IM9A 2CG8A 1UJ5A 2VWBA 1X4BA 4IZ9A 4M1KA 4QIWD 3ZZOA 4IO1A 3HPGA 1JKHB 3OV7A 3H3NO 2P9PA 4CJUA 5HRSA 2RQ4A 3TPQA 3QIOA 4EFAC 3KNAA 2E5LK 1FRLA 4BR7A 1K9MO 1RBOB 3H25A 4EU0A 3HKWA 2M8HA 2EFNA 2PMHA 3L4BC 2W8LA 2N7YA 4JI6J 3SCJE 3W3DA 4XH4A 4ECQA 4H4OA 2XY5A 3EM1A 3MUVP 3L2VA 1YTUA 3E1YA 2LMIA 2CFXA 1YJWS 2Z8QA 2WAQD 2ADCA 3P83D 3U1NA 4BLGA 1RDDA 1ROFA 3CJ3A 1VRTB 2LXFA 1QLNA 3RMCA 4CFCA 4D3GA 4QR0A 4JRQA 2OZSA 3DGPB 5BR8J 1IM6A 2WONB 2QL9B 4KHPF 2F5GA 3IG1A 4Y28C 1QSSA 2YKNB 3L3VA 2ZOFA 4HTJA 5FLXU 3VZIA 4FVUA 4AILC 1RT5A 3OHBA 2A40A 4LUBA 2JHEA 4X65J 2W4PA 1L3SA 3IC1A 4E7KA 3HX9A 4DTMA 2G8FA 1AZSB 2GA7A 3FUYA 3ZZTA 4ICLB 1TUUA 3HT3A 2R8GA 3MM8A 2F8SA 3PJ9A 3L95X 5H9FK 2HAFA 2N7CA 4OYZA 4IFYA 3QZ7A 3KK3B 2VG5B 4KRFA 3T5LA 1MDUB 2OCEA 3BZQA 3FFIA 4BGAA 1R43A 4XPCA 2XWYA 3US5A 2EBGA 3ZSXA 4KGXB 3T69A 1L3UA 4LF4J 3M2UB 3HSDA 2HRTA 3CJRA 3HSZA 3MMVA 4ZIWA 3P5JA 4NA1A 4N76A 2IOCA 4ZCMA 4DSIA 5AZIA 4X4QA 2DFFA 4WFNL 4WE1A 1YKWA 2QL5B 3LP1A 4Y2IA 5HMYA 1GLDG 2QO3A 3SPZA 3D6MB 4OV1A 3KLVA 3ITHB 3IMXA 3P4UB 1A5VA 1R59O 2GJFA 2GJIA 2VFUA 4CBXA 1XBWA 1RTJB 5ADXA 1FJGK 1D8ZA 3EX7B 5GAEU 4LF2A 2E44A 4DR2J 2HGNA 4U7BA 2LA6A 2UVRA 2HS3A 2QA1A 3TA2A 3KLHB 1P9QC 1FA0A 2F9DA 3R5CA 5HL7Q 4DV3F 3G25A 4BQLA 3FK4A 2WW8A 1UCNA 1GH8A 1UOCA 3DXBA 1JJ4A 4TY8A 1SL1A 5LSOA 4WKRA 1HMVA 4HTLA 4DTSA 3IR7B 4PG5A 1R31A 3TJ8A 1Y5IB 1K44A 2XGQA 3JSYA 2PAVA 2E9ZA 5E33A 4J8FA 1Y5NB 3NBPA 2CQ1A 2G0JA 2GGPB 2QIFA 1WSGA 2FBVA 1NK7A 1ESVA 3JQJA 2HWTA 3O9QA 4FF2A 1EWQA 1VSDA 2XZWA 3QB0A 4C8YA 1BWFO 3HM9A 2VFRA 4RW8A 5K8PA 1QQOA 3U4LA 1CJTA 5KG5A 1BLUA 3T1HJ 2XB2D 3P45B 1R8PA 2ZGZA 4WTYA 5GAGU 5KOXA 2I5JA 1U2VB 2Z2ZA 1K1QA 2LXIA 1NZ8A 2HW3A 1JJ2R 1ZZFA 4PXEA 2UXDK 3C6UB 1BIUA 4YR0A 4DS5A 2RHSB 4FOIA 2YCHA 5DETA 1RLCL 2YKOA 1TK5A 1ZTWA 3W3SA 2CQCA 1X4EA 2N3LA 2JLFA 3HMJG 4HTUA 4YB5A 1FTCA 3AOBA 3H46O 3K89A 1HARA 1Y97A 2RE2A 3VF2A 3NNCA 1ZBSA 3MUTP 4TU9A 4E0DA 4HR2A 4BWMA 1HRHA 1ASUA 4IOAL 3D7SB 2C2NA 3TAPA 2QWRA 2FZGB 2YH1A 4B3MJ 2HB5A 4CZIA 2IGIA 4RW4B 1YVNA 4DUYK 4FXDA 4H5VA 3MN9A 3PIPQ 1RADB 1NPPA 5C42A 2VGNA 4YDDB 1JLFA 3BQ2A 4QR1A 5DM6L 1D9FA 1XMBA 3Q8VA 3ZSQA 4IFEA 4YUDA 4LR8A 3VQAA 3MMJA 3J7AP 1CS4A 3THPA 5GINA 1RBUA 2A6AA 4O5FA 1EJ7L 4DV7K 1UAWA 4EAHD 2OI2A 5ADXH 1ZBTA 3JTPA 1KS2A 1RAJA 3BBBA 1OVYA 2GVDB 3AAQA 4JS5A 4EO8A 3MM5A 3D2WA 3N4PA 5SZTA 3TUJC 3QBCA 5BRFA 3H2LA 3KKFA 2W7AA 3H5UA 1RK8A 4JI0K 1RHJB 1UZHA 2VQEK 4N8NA 2BJ1A 1NM2A 2J8AA 3A5NC 2KRRA 4OPAA 5DQGA 1X5SA 1YX2A 3WQTA 3J7YP 2LEPA 4DN9A 2HQDA 5I42A 2E4LA 3TZYA 4AYBD 4HVZA 1ZBLA 5GAHI 1NO8A 1CZBA 5KG7A 2DRAA 3NCQA 4RW6B 2IMWP 1NG9A 1N5QA 2V8GA 3WIVA 2KKHA 3BN7A 2CZ4A 2AF6A 3AGRA 4DV6J 4PG4A 4CH1A 3SFUA 3CB4A 5C24B 5D4NA 4X2BA 3VGSA 4JI1J 2UUCF 2XBPA 1MA9B 2W9CA 4KY3A 4M3YA 1WKLA 4FM1A 1ZC6A 2ACMA 2F7VA 4OI1A 1O13A 2G4BA 1NJIO 4PAAA 4K0KF 2XLKA 4IH5A 5E3PA 5KGWA 1NMNA 1IKWB 5A2QY 3G96A 3NKYA 5IV3A 3NF6A 4DTJA 3VQ7A 1X5PA 1RT6B 1HBUB 1UVLA 5BRDA 2D0PA 2BQUA 1YJ9N 5F8JA 5JVHL 3S8SA 1CLQA 1ZA1B 2D3O1 2XMVA 2D0BA 1L3KA 3U6FA 2NXUA 3I8BA 3IGVA 2XO6A 5KT4A 2XLJA 4NLQA 1YLXA 2UU9F 1NGFA 4NLDA 1WNEA 1RWPB 1WKJA 3THWB 5ETNA 4PPDA 1X5OA 1GMWA 2RSQA 3MDQA 1XQIA 5HROB 3SCKE 4I0WA 1S1UB 4H0VB 3K0JA 4OJ3A 4MTPA 1LWEB 3K2PA 3B6BA 5AE2A 1U6ZA 3SAHA 3H1VX 4DSFA 1BA0A 3KOAA 2WVBA 3R1XA 3JS6A 1YAGA 4DEZA 1X31C 4DTRA 2DHXA 2O4IA 3M2VA 1PJ6A 2VPXB 2P9PB 5E26A 3SMPA 3DM2A 4ED1A 1OVQA 3C14A 3ZEUA 3R7BB 2DPJA 1ITGA 1FNXH 1J9AA 4A4JA 3I87A 4ZPBA 4HCBA 2Y1IA 4QW8A 4ISFA 2DY4A 4C1NK 4GKJK 2RHKA 4IO9L 1OJ4A 1GTHA 3W65A 5IT9O 3B4MA 3MEEA 5JVGQ 5J2QB 4CLYA 1U1QA 2HLUA 1YJ9S 3MM9A 5ELZA 4K2JA 2YJEA 3QAEA 1GLJO 2OLWA 2J7UA 1YZ6A 2PDAA 4FF1A 4KHRA 4MK7A 3NF9A 5DQHA 2YXLA 2HHHK 3BSNA 8AT1B 1NK6A 4GY2B 1R6VA 1H0HB 1YBUA 1U1KA 5KFLA 1VQKN 2A10A 4EZ9A 1IBMF 3HJVA 4J2EA 3WXJA 2F4VK 2W9BA 1SJ4P 1RT5B 3IKMA 4ECVA 1FO1A 4QOTA 1HR0K 3MURP 5HP1A 3L2WA 1UFLA 1JB0C 2KT2A 2M70A 2BJ7A 2VDIA 2ZBIA 2FHMA 3FBFA 3AOAA 2ZJPL 1NHUA 1VQMN 1IR0A 2HSTA 3OR2A 4N47A 1AYEA 4A8OA 3C8YA 4FLUA 4LF7K 3U8XA 1D1UA 5DM7L 3LWMA 4DQIA 1ZA2B 1VQ4N 1VQNN 1E6VA 2ZBPA 2IVPA 3N4WA 4DI6A 4FW2A 3CCLN 1TL5A 4Q44A 3AT1B 2PGCA 4DSLA 2ZC4A 2CPFA 2Z1HA 3R1LA 3T5HA 3OXGA 1K73O 5EUHA 4NI2B 3BREA 2V2ZA 4C3MA 1UVIA 4KE5A 3CNQP 4LF8F 1V5IB 3OS0A 1VQKS 3OVNA 3SLCA 3ILIA 1T9TA 2ALYB 3NG8A 3LP3A 3GV8B 4YNQA 3DYAA 4WBFA 4OHXA 4CZFA 2Q0RA 2CXEA 1VQMS 2VJUA 3L3UA 3C15A 5DZ7A 1YTAA 1TL7B 2WHOA 1M1KT 1FJCA 5KFSA 2JC1A 4DR1J 4DWIA 4W5NA 1VC0A 2OANA 4KHYA 4AQYJ 1EX8A 2QE5A 4HWIA 2C3OA 2DNMA 1VQ4S 4RBUA 4M8LA 4F3QA 2V63A 2JNJA 7FDRA 3EVMA 4ISEA 3CCLS 4FWOA 5E7OB 1VLYA 1FFGB 4LF5K 3LL3A 1EKSA 3ZTSA 3AA3A 3PX6A 3IN5A 3NBPB 4NYOA 4C2MA 3J7ZT 5AQPA 1FVQA 3DMJA 1PAUB 3MM7B 1L5UA 1X9MA 5CZ1A 2YI1A 4Y2MA 1S10A 2R7RA 4QS9A 1KVIA 1TMJA 4DR6J 4EZ6A 3PW0A 1G1XA 4Y00A 3BPDA 3PW5A 3A3PB 3CJ4A 3QSIA 4LIWA 4ATNA 4DL5A 2NRTA 2HMPA 1CJTB 1JLGA 1SL2A 2Q36A 3HXMA 4WZMA 1LKZA 4Z94A 2I5JB 4LBHA 2HGMA 3QEPA 3BBCA 3N5BA 3TR8A 1HYSB 2AYGA 5E3CA 1LK7A 4DR4F 3ZO7A 3ENQA 1HHTP 1JX4A 3EMTA 1SJ3P 2ZHAA 1Q8IA 2KQ2A 4KQZA 1HLUA 2B6AB 1XNRJ 3LZIA 4HH0A 5AJ3F 2JL9A 5EWFA 3GR1A 2D9OA 2O1PA 3DLBA 2D0CA 2JJ4D 3J80O 2JZ5A 2AYEA 1LWCB 3Q7CA 2NCKL 4DV0K 2UVWA 3ZZZA 2A0FB 3I0SB 4NZ0A 3M32A 3OYDA 3QGHA 5D0GA 4KH1B 1E3MA 3GMGA 4RNMA 2YPYA 4J5OA 3VQPA 3AJDA 4JI3F 4B3OB 1BWEA 3OS2A 1IJJA 4KRWA 3HRGA 2JWKA 1X9SA 5C15A 1JLFB 3BF3A 4M42A 2DR7A 3S1TA 1OS5A 1FD8A 5B0FA 3PHTA 1NK9A 4J9SA 4L72B 4NXMK 3AA5X 2YKQA 1KC8O 1TMMA 4OYAA 1U7LA 3WBZA 2AX0A 3L2UA 3N5FA 1TV6B 2E5LJ 4B1YB 2UUBK 1JCEA 2DEIA 3ENWA 3MTJA 2BRLA 4KHUA 4JD2A 3MD3A 1TKZA 1AXQA 3LP0B 2GVZA 1N0VC 3RBDA 2HPUA 1BI4A 3BGLA 3M05A 2J6TA 4LRBA 1WUUA 4LRFA 5GVQA 2O8CB 1Q7YT 1RHQB 2UXCF 2OPQB 3H4DA 2H54B 5BPMA 3NGKA 2R8KA 3ZFVA 1NZAA 4K4XA 1QS4A 2KXHA 4AHSA 3EXYA 5I42B 3OTDA 1C4AA 2FHJD 2X1FA 1MN7A 3QT7A 2UV8A 2P9EA 5HLFA 1DURA 3A0IX 5T7LA 2HMIA 3DJCA 2G8UA 2OSRA 2RS8A 3GIIA 1WG4A 6FD1A 2GQ2A 1OYEA 2ASYA 3QIDA 4YB6A 3R8EA 2WOMB 2OPSA 2GIFA 4USHA 1CBKA 3ET6B 2GEMA 1FWKA 2BOAA 4NRUA 2V52B 4E98A 3W5XA 4KB0A 4CJPA 1ICEB 2MLZA 2E1CA 3EUNA 2W9CB 1C6VA 3AOCA 4M5GA 4WPAA 4OHWA 3ICLA 4QJVA 1F6TA 1KRPA 1O1WA 3DDNA 1KLNA 4P73A 5KFBA 4DV2K 3GE9A 3V1QA 3RB4A 2CQPA 1S7IA 4KV8A 1N34F 3GG4A 3DXSX 2DJWA 4F0HA 1M1HA 3BS9A 5EVZA 2DGQA 4FJMA 2IA6A 3P38A 4PY5A 1ZBFA 3JQKA 4IQMA 3MCPA 2XRIA 5KFZA 1H6KX 3EGNA 3D1HA 4DL3A 2YHAA 2B0GA 4Z4FA 5ETSA 4FK4A 3KK7A 2ZH1A 2XSJA 1GLLO 3E9PA 3NMUA 4FYYB 4TU7A 5AQLA 3FNNA 5B0GA 1N0UA 4FLXA 1PG5B 3SQOP 1RNHA 4O8UA 1YQHA 5CY4A 4JI5J 1O51A 3M1FA 4LH5A 4E3SA 2ZH9A 1RABB 2DTJA 2ERRA 1FCAA 5F8MA 4FWNA 3TJ9A 4DTPA 1VK8A 4KFBB 4TQRA 3B6OA 4YOWA 3M2VB 3TWZA 2PIIA 4YHHF 3F56A 2JC0A 4YS2A 4JI4K 3AVIA 4NPOA 3ZEUB 1GLCG 1N6QA 4NASA 1UP1A 1H2VZ 4NZ7A 4W98A 4JV5F 1BQXA 1F3FA 3D3BJ 1U1RA 1NMDA 3MEEB 3BQ1A 4CJWA 1NJZA 4JI8K 2VG7A 2WVEA 1OQ3A 5CZ2A 4J91A 1RA7A 3M2RB 2GAHC 3H7HB 2AA4A 3HFVA 2CVEA 4MK8A 5M1OA 4DU3A 4DPWA 4FJ8A 3KNGA 5ETOA 5HQ8A 2DY9A 2XULA 1LW2A 4NMXA 2U2FA 3CCMN 4O8KA 3D0GE 4BREA 4OX9F 3KHRA 1FFWB 4X62J 4CHOA 3G6YA 2RF2A 2QWMA 5A6WA 3PFEA 2BJ3A 3UD5A 2W9BB 1Q8BA 3BDEA 1SJ1A 3ENVA 3DRYA 1Q86O 1X0PA 2HVIA 2RN2A 5EX3A 3HPHA 2YQ3A 1GXUA 1YHQN 2H5JB 3OW2M 5BR9A 1PAEX 4O44B 4USUA 3K7RA 3TUPA 5HBMA 3WIUA 3V9WA 5BXIA 4NB4A 3UN3A 1T6CA 2QN6B 3D7EO 1S1WA 1WC1A 2PA8D 2AQ4A 4B9UA 3VQSA 5CYMB 1LWXA 3ENHA 1V3ZA 1PJ7A 4CGGA 5KOWA 1TELA 4O3SA 4CF0A 4O3QA 4MKAA 1U47A 3OFFA 4KHPK 2NPIA 4CYUB 3MR5A 3HZEA 1E6VB 4K4SA 2JEJA 5AXMA 4I6YA 3MPVA 4WP3A 4I9LA 4ZLPA 2M8DB 1VJWA 2P5VA 1C0TB 1TL4A 3K9KA 1DTQA 4OI3A 3CCMS 1U0HB 2X7IA 1NOYA 2HGLA 1IG9A 5KPZA 1Z1ZA 3QPIA 1B9FA 3O5TB 1W0HA 4IYQA 3DLRA 3AO3A 3SZ2A 4CLTA 4FS1A 3PEJA 3NF7A 4WFNQ 3R9LA 3RB0A 1YHQS 4G6VB 1PC5A 1UVMA 3GYGA 4LFBF 4HHTA 1SIWB 2KDOA 5IC6B 5HVHA 3B6PA 4DV7J 4RW7B 2ATCB 3CD0A 4LSLA 2BE2B 3DOLB 3C15B 1XNQF 1CJKB 3HHNB 2BQ3A 3QJLA 1RA6A 3W2WA 3VA3A 2V9KA 5IT4A 3BKFA 4A61A 5AQYA 2DRDA 1EKRA 4MYTA 2ZZNA 3PEHA 2FJEB 4N8OA 5AQQA 3FEYB 2BACA 2VQEJ 4YOVA 4ISGA 3CIPA 1NBEB 2D5RA 1JLBA 4DL2A 4LVOP 3BO2A 2K3IA 3KKRA 3HHLB 2Q79A 1I3AA 2X74A 3AVLA 5LMNF 1GTEA 1MLAA 2ZH5A 1SC1B 2CQGA 3HZGA 4DV3K 1VQON 4I68A 4Y2AA 1TTHB 4BC7A 3M1VB 4IEIA 2PFDA 4XIUA 1Q82O 4ZVGA 2P8IA 1C0UB 4C48A 3KLEA 1NK0A 5ETTA 3UDCA 1FE0A 4HH1A 2ASJA 2O8BA 2K8GA 1WAFA 3CULA 1NRKA 4DG1B 4KO0B 4E7HA 2JVRA 1ATRA 2M9KA 1SB6A 3GFZA 1FESA 4V19J 4UOGA 1P1LA 2ALZA 1HNZJ 2C3MA 3E01A 2VCPA 2IJNA 3MR6A 2Q1NA 4LRCA 1U26A 1S6OA 5BYRA 4P2FA 4DU8A 2ACYA 2HFZA 1FRHA 3SV4A 3ZZYA 3K17A 2QZ8A 4CGFA 1V6HA 3C19A 3D68A 3SSQA 3PX4A 4RNFA 3M32B 4U96A 1U1LA 2OTJN 4P6QA 1WC4A 3R2DJ 3DI6A 4X64F 2FLPA 5GAHP 4CTAB 2QGFB 2XY8A 1VHIA 1VQOS 1NSPA 4C0OC 1VBZA 3ZT2A 4X4UA 1JL2A 2NSBA 2B4VA 4ILHA 1KQFB 3M6XA 1VAZA 1S72N 1S3XA 3MGJA 1SQKA 4QYRA 2FSNA 1PSDA 3IGNA 1SC3B 3ZZPA 5GMDA 2HNDB 4F3OA 3QYYA 4K5SA 4ECZA 5DM6Q 1WEYA 1OH5A 2Y8YA 1LOUA 3KK1A 2PSZA 2DXDA 4GKJJ 4BC2A 4JD2B 1Q82T 2MKYA 1RISA 4U7UK 1BUPA 2LDYA 1IO2A 4NLTA 2LKZA 5H1SV 4O55A 3QRQA 2P6SA 2YNGA 5IM0A 1OQ6A 4PG8A 2IVNA 4M95A 2CH5A 2OTJS 3NGIA 1QTMA 2FBYA 1IN0A 3QDKA 3SNNA 4PKIA 2BMBA 2DIVA 2UVVA 5T41A 2RD5C 2VB6A 5E3RA 4UZCA 3I0RA 1S72S 3DFEA 3W5YA 2F4VJ 2VV5A 5T7LB 1TKDA 1TUYA 1EP4A 3ZTOA 1DQ9A 4V19S 4BVOA 1HR0J 2K7JA 4DX7A 2YWGA 2J7WA 4K5RA 3FLCO 2HNYB 3P8BB 2G8VA 4CD3A 1DEJA 2KJVA 2GMLA 4A8YA 3BJYA 1SBRA 1JLCB 2X3DA 4H4KA 4FJHA 4YOYA 1Q7LB 3CJ9A 2HYIB 3O2IA 2BRKA 5DRKA 2B4OA 5KRTA 2HHSA 4RG8A 1GOBA 3Q22A 2H65B 4LF7J 4P72A 5D3GB 3CD7A 4UW2A 5J2PA 2AJ0A 3L4IA 3DXKA 2XMTA 2VBWA 3KLIB 3GIMA 3N6LA 1NDLA 3H4BA 3VETA 2KM8B 5AQIA 2XC9A 3R7SB 4MAKA 1UWBA 3FC9A 5A2QU 3TI0A 2K1RA 5AQNA 2GWJA 1HWUA 4WP9A 2CJYB 4IBNA 2GUPA 2IBKA 4JNEA 5A0YA 1RWOB 3PR5B 3P96A 2E8AA 5KFGA 1QUPA 3N4QA 4LSNB 1KLMA 3VF4A 4GC7A 2UUCK 1GX5A 5JLHA 2CPIA 3Q86A 2W42A 4CO0A 3CQ8A 3OLAA 4K0KK 2IM3A 2JVOA 3MX5A 3IO1A 3SBMA 5EDWA 3KVGA 3MI7X 3BSCA 2XM3A 2J0QD 2GV9A 3WDOA 1NGGA 4KPYA 1BOTO 1RT3B 2BE9B 4KIAA 3W2VB 4OZ1A 4AF1A 3NY0A 5L1LA 4Z7YA 2VC0A 4UY8T 3J80Y 3ZCMA 2R2TA 3FR0A 4IG0A 2Y1LB 2UU9K 1KTQA 3UD4P 3TUZC 1R0CB 2IDLA 2YKMA 1W7WA 4ZTJA 3D2EA 3ZZUA 1V4TA 1RDWX 3J7YU 1WKKA 4IO9Q 3WNHA 1Q79A 3KD5E 3UD3P 3AA4A 2GTDA 1A5XA 5LL6d 4CHPA 4O4RA 5AR0A 1KFDA 4GVEA 2WVFA 2EFVA 4DQQA 4WFAL 2ZWOA 1U2RA 4RKUC 1YUWA 2P9CA 2A41A 4P10A 3EYZA 1RBRA 4DN0A 3M6GA 1ZPWX 3H42A 3HVTB 1Y7PA 2HFOA 1NJYA 5D0RA 2GHPA 2MY8A 3KHYA 2FIUA 3EEQA 1Z05A 3T6BA 1RDBA 1XTZA 3OYLA 1VQ9N 3A13A 1T94A 2O3DA 4H0PA 3M30A 2GUIA 2ZJPQ 4HEA9 3OJUA 2F4FA 5K14A 2F8HA 3AY0A 5F8LA 3CXCM 3PKYA 4ECYA 4CZKA 3AD7C 1S57A 2R7VA 4N41A 4H54A 4MH8A 3WQPA 2MKSA 4PZVA 4HHUA 2E1ZA 4FLTA 3RU0A 4DV0J 3TSQA 4QPTA 1IBMK 5DM7Q 5LXYA 3TUIC 2R8IA 4CJRA 4NL5A 3VTIA 1SPBP 3GSIA 3RSEA 2LVWA 4FK2A 2NXEA 1ZAWA 1Z4UA 5IWAF 3QFPA 5CD4A 4RU2A 2MMYA 4ZMMA 4TYBA 1KSPA 2B5JB 5JLFA 5AQOA 2V2QA 1RACB 3ULEA 4R5PA 1HNWF 4OPHA 4RLEA 2BV3A 1TZ0A 1B7YB 3EE9A 4IDKA 2DNGA 5LJWA 4NXMJ 5AFUH 3D0PA 1VQ9S 3RBZA 2Q2RA 1P1TA 4DPXA 4DF8A 2UUBJ 4C8LA 2PBDA 1TUWA 3RTVA 3WQUA 3UVJA 4PYAA 3WEEB 4E7JA 1YRUA 1BIZA 3PTWA 1HBMA 4JKFA 4HT5A 5D6GA 2IPOB 1RFQA 3H6EA 4F25A 3NL0A 4B1ZA 4LF8K 1Z25A 3KHLA 3JXOA 2GIQA 3TW0A 4DQ8A 1RTDA 2Y1JA 2PC6A 3G6EN 1EKEA 2JFDA 4AM7A 4C98A 1Y5LB 4NLXA 4GMKA 4KKOA 2F63A 1ZAXA 2C3YA 4IRKA 2Z4PA 5AXNA 1RT7A 3V81B 2FXUA 3AXMA 5KPTA 2ZE2B 4BRDA 3OTOF 3TRGA 2RRAA 1YF5L 4CI0B 1VQ8N 2LYVA 3GFHA 3GJTB 4FF3A 3DRSA 3KLEB 3CJ2A 4NYNA 4AT1B 4S0MA 4GV3A 2KFYA 4QPXA 3N01A 1M90T 2FJWA 4GC6A 3AO5A 1KNZA 2B9EA 4O3OA 4L3NA 1ATSA 2J6SA 3PFOA 1CQMA 4LQ9A 4NYPA 4IFVB 3EZOA 5KFMA 4PXDA 3MPYA 3G6XA 4DV2J 3H2UB 5KG3A 2CPJA 1HNVB 2O5DA 2ZOGA 4OX6A 3TA1A 1NPRA 1HQUA 4R79A 4BRMA 5KG2A 5FPMA 4CEFA 2C28A 2M7SA 4JV1A 4IKAA 3G6ES 1VSHA 3I31A 1KQSR 3LF0A 2NLXA 4J9UE 5LL6Z 4J2DA 3SQ0A 3X3UA 3CCVN 3A8JA 3T3FA 3FE1A 4B3SF 2Z1JA 6AT1B 3H8YA 4AHCA 2CDQA 3D6RA 3FZMA 4OZ3A 2VICA 3KXDA 4DR4K 1VQ8S 1DBDA 2HQIA 3O9SA 1J2VA 1EQ0A 4M3WA 4MIAA 3NGYA 1S9GA 1RAFB 4L76A 2J9DA 5AJ3K 2ZH3A 3QRRA 4CGDA 2YPZA 1DLOA 4JI4J 4BY9C 4YMEA 3TAMA 1KAYA 3MM6A 5H9EK 1RT1B 1WI6A 3CCTA 2IVFB 3C94A 4Y1DA 3MXJA 4JKCA 1NGIA 4OIXA 1BDGA 4JI3K 2E7WA 1W7AA 3O4WA 3DLEA 4FYXB 5A6PA 2CNNB 1Q5VA 1WNSA 4NLOA 4OI6A 1KAZA 3CCVS 4P9SA 5CYQB 3QO9A 3O6WA 5CAAA 2MZQA 4HHHA 4ZJLA 5FJ4A 2PT0A 1R89A 2PI4A 4FPIA 4LBIA 5AQJA 2ASLA 3FJ2A 3O8WA 4LVNP 2NRXA 4F4ZA 1WHWA 2CPDA 1WOSA 1KN6A 2JDJA 2WSFC 1X9WA 3TTFA 3D54A 3UW1A 4RO0A 1D8YA 5KAKA 1M5PC 1B0TA 3FBBA 4UOFA 2DNLA 3PSFA 1QE1A 2XY6A 4P2SA 1Y4ZB 1TQLA 4FOEA 4R8UB 4OO1J 2UXCK 4KYZA 4WFBL 1VQLN 2ZOMA 1WAJA 4ZIVA 2GAGC 3WT0A 4O23A 1KXPA 4CWBA 1U49A 5J2PB 1WG5A 2KRBA 4CJLA 2OYQA 4KHPJ 5D4PA 1JLAA 1HYVA 3MEGB 1RGVA 2M2BA 3FBCA 1YGYA 4BQZA 4F0KA 2QG9B 2K1RB 3THYB 4K43A 2CYYA 4J9QA 4JLHA 3Q8PB 3GIJA 4H0TB 2G0IA 2ASPA 1REVA 4DFJA 3R5DA 4CF9A 3V4IB 3HT0A 1S4EA 1HW8A 3MCMA 3TOQA 3JSMA 3BN4A 4IR9A 4OPJA 2CVIA 1RBSA 5D4LA 3VA0A 3SXLA 3T1YF 1HKBA 1S79A 4I6MA 4X4VA 3VGTA 2YV0X 1C1BA 3CCRN 2F8MA 2FLOA 2ZKTA 3D67A 3I4HX 3P49B 2Q6BA 5KQDA 2NRWA 1ZM2A 3NWGA 2H9ZA 4MIBA 3M7VA 2UXDF 4F4YA 2VC1A 1N34K 2BKNA 2VIHA 4URQU 1X1PA 3UKUA 1B0PA 5CXTA 2GV1A 2OFGX 3BR8A 1VQLS 4CP5A 4EBCA 1JNZB 4YN3B 1F5BA