1JLGA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
538
structure length
529
Chain Sequence
b'ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 132
structure length 529
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlgA05
3A2FA 3SQ1A 5HBMA 1CXQA 4CGHA 1JLGB 1RT6A 3OYBA 4JS4A 1NJYA 4CHZA 1I3AA 4YFUA 4TLRA 4FLUA 4K4ZA 3Q8PB 3HT3A 1RDDA 1GOCA 3I5AA 2BE2B 5FDLA 3KLIB 2B43A 2BR0A 1XR5A 1TK0A 3GIJA 3O3FA 4FM0A 3SQ0A 1IKYA 1TQLA 1ZYQA 4FJJA 3E51A 4KAIA 1VSDA 4DFJA 1JL2A 3M8PB 5KFXA 3PO4A 2QXFA 4IG3A 3NF6A 3HKWA 4ED3A 3TABA 3IAYA 1U09A 4QWBA 3T5HA 4WXOA 3WNFA 1TKXA 1VRTB 2YNHB 1BL3A 3ITHB 1VSIA 3OVNA 2J6UA 2OZSA 2VG5B 1LWEB 4PWDB 5FRMA 4O44A 2R2TA 4CIGA 3WNHA 1S6QA 3KLHB 4K4SA 3FSIA 2O4GA 2B6AB 2D3UA 3RB3A 3V6KA 1Q9XA 4K8ZA 2WCXA 5SWMA 2YKNB 1TV6A 4KO0A 4DL6A 1F21A 4GMJB 4G1QB 4KB7A 3D0PA 2C2RA 3OYDA 5J2NB 3BSAA 4WXWA 4FCYA 3ZT3A 3VA3A 4FZYA 1TL1A 4B3OA 4B9MA 3DRSA 2ZE2A 1TKTA 4B9TA 4DTPA 3QGHA 2F8EX 4W5NA 2XCAA 1QS4A 5DGAA 2W9BB 1JKHB 2FBXA 4CJKA 3PX6A 2XY6A 3KK1B 3HVAA 1RA6A 4KFBB 3V9SA 3DLEB 4DF8A 5KG0A 3RBDA 1K1QA 4FJIA 3RRGA 1ASVA 3DI6B 1QAJA 3JYTA 3VQSA 2KW4A 2AJQA 4CEBA 4BDPA 4DS4A 1REVB 1RBTA 1U47A 4IH6A 5C42B 2PZSA 1NNDA 4O4GB 5DQIA 4K8XA 5KTQA 3OYNA 3BQ1A 1RT7A 4DTUA 2D5RA 5JS1A 3IN5A 1IKWA 1SH2A 3SUOA 4M3UA 4DTNA 3RB4A 3G0ZA 2FVRA 3ZSVA 3D45A 4ZMMA 4E3SA 3PW7A 5KFOA 3BQ0A 4RW9B 3I5BA 2GC8A 4CEOA 4FJGA 2XY5A 1FKPA 1O1WA 4Y34A 3DYAA 1ZBFA 3BSCA 4HVJA 3NCIA 3V9XA 2BANA 3OL7A 4J2AA 1YVFA 1EKEA 1FK9A 1CSJA 1ZBIA 1ZTTA 1RTIB 4IFYA 1XR6A 1S6PB 1SH0A 5KGWA 5F8IA 4FVMA 2V0NA 1RNHA 1C0TA 4EZ9A 4WFXA 4TXSA 3RAXA 4CJFA 3EPIA 2R8IA 3HSTB 3BGRA 4LH4A 4ZHRB 4CK3A 4LQ3A 4DL7A 3KMQA 1LW2A 2XWYA 3LP2A 2BQ3A 4XPCA 3G10A 4OLBA 4FS2A 3SNNA 2OPPA 3OYAA 4KHRA 3NAEA 2VG7A 1C0UA 3OS1A 4LSLA 2HNYA 3KD1E 3DOKB 3L2VA 3K59A 2IAJA 4TY8A 3T5KA 1IKVA 3NBPB 1A5XA 2I1RA 1SL1A 4MK7A 4NCGA 3SV4A 4DFMA 1SH3A 3HK2A 3DLHA 4TN2A 4EO8A 4DL5A 4MIAA 4OGEA 2JC0A 1Q8IA 3L2WA 4YP3A 3C6TB 3TAGA 4M3TA 3DDKA 2WB4A 1BIZA 3G6VA 4CF8A 2V4RA 5DG9A 1KVCA 5E41A 3HJFA 4FXDA 1J53A 4CJPA 1UA1A 1B92A 4KHNA 4DSFA 4ICLB 2JGUA 4Q45A 3CJ5A 3CM5A 2IM0A 1IM4A 2LSNA 3KHGA 2E9TA 2DPJA 4Q44A 3H5XA 4WE1A 4FJ7A 1N6QA 3L2UA 3AVNA 5J2QB 4NLGA 1TKZA 4RW8B 2HWIA 4OKEA 3ZSRA 1U45A 2E6LA 4OKKA 1HPZB 4C8OA 2YNGA 1XHZA 3BREA 4ZP6A 1RT1B 1SUQB 3ZSQA 4AILC 3M8QA 3K5OA 3QEXA 3L3VA 4HCBA 1C1CA 4ECYA 1G15A 4YQWA 3CM6A 4J9QA 4H8KA 3QESA 1BGXT 3FDSA 1BI4B 4FW1A 4Z4FA 3AVCA 1RTJB 3LP0B 1DLOA 3G6YA 5L9XA 1HRHA 1RCHA 1DTTB 1LWFA 2C2EA 4LH5A 2ILZA 4K4YA 4E19A 5HRRA 4JRQA 2V4QA 2WTFA 5KFFA 2XCPA 4I7FA 2X74A 2A1SA 1KSPA 3MECA 3CJ0A 1ASWA 5F9LA 1YT3A 2KTQA 3MTKA 3RBEA 4I2QA 1QE1A 3KHLA 4M3XA 5F8LA 4IBNA 4J2DA 1X9MA 3QZ8A 3V4IB 3PR4A 2VA3A 5CZ2A 2G8IA 4RW6B 3CJ3A 4Q8FA 1S1TA 2HW3A 4CEZA 4URSA 2G8UA 2W9AA 3P83D 5CYMA 1GOAA 4K4XA 1S9FA 1U4BA 4CFAA 4F3OA 4CEDA 3AVLA 4DMNA 1I39A 3HP9A 4R8UA 5K14A 3LALA 5KFMA 4RG8A 3KLGA 3AVKA 3QLHB 4NLVA 5F9NA 3RAQA 5KT2A 3DLGA 3I0RB 5KFPA 1HQUA 1T3NA 1FXXA 5J2MB 2AGOA 3JSMA 3CDUA 4NLRA 2RDJA 4N5SA 4NRUA 4WYLA 3SYZA 5C25A 3SI8A 2D0BA 4DU3A 3KD5E 1S4FA 1BQMB 3MEEA 5C5JA 2X78A 4AHSA 1RDRA 3T5JA 2PY5A 4CJQA 4L8RB 4LD0A 3EPGA 3AVBA 5CYQA 3IS9B 3KHRA 3H08A 2KZMA 2P5GA 5KFRA 4CGIA 2YNFB 4EBCA 2FVPA 3PUFA 5F8GA 3LZIA 2W7OA 4LSNA 2CJQA 1K6YA 4CF9A 4J9RA 1JLQA 4CJWA 3H59A 5J2PA 1X1PA 4ECZA 2HHSA 3BSOA 4MK8A 2ILYA 4CESA 4O3SA 4FW2A 3Q8QB 1RBVA 2B4JA 5KG1A 4ECTA 4CEAA 2FBVA 3PW4A 1SV5A 5JS2A 3MR6A 2C22A 3H2LA 3TAMB 3KLVA 2IS3A 1RTDA 1JLAA 3MAQA 4E7LA 3MXMA 1RTHB 3LP1B 2BE2A 2GIQA 3KK3B 5HROB 3KLIA 3ULDA 5KFCA 1S1WA 1S1UB 1JXBA 4ZTFA 3T5LA 3MEDB 5KFHA 1FKOB 2HMIB 2W42A 3M8PA 3UR0A 1RBUA 4CEFA 2XO7A 1JLCB 3V9WA 1RBRA 2R8GA 4EBEA 3C6UA 3ITHA 3GV8B 3HVRA 3QEWA 3CYMA 5I3UB 4FK4A 2RKIA 4O55A 4PWDA 4IR1A 1QQCA 4FLZA 2JEJA 3KLHA 4W5QA 1RT4B 2Y1IA 1JXEA 1VSEA 1IKXA 4J9OA 4ED1A 5F8HA 3GIKA 1L3UA 3MR5A 3RR7A 3NAIA 4CCHA 2JEGA 5KG6A 4MKBA 1HYZA 3NDKA 3OLBA 2AWZA 4Y1DA 4FJKA 4ECXA 1NJZA 1VSKA 1K1SA 1A5WA 1N5YB 1KTQA 1UA0A 1KFSA 5HRNA 4FJ8A 4KB1A 1EXQA 4WYWA 1UAXA 4KI4A 1JX4A 1RT5B 3MEGB 4RNMA 4Y3CA 1TGOA 4CHNA 1JKHA 4ID1A 3KK1A 3NGDA 3BR9A 3RMAA 3V1QA 2EC0A 3NH1A 3FQLA 2FJVA 4QWCA 3PVXA 2ZQBA 3GILA 3DI6A 2DFFA 1HNIB 3V6DB 1WNSA 3I0SA 5KGXA 1GX6A 5KG3A 4K50A 4ZPAA 4F4XA 4DG1B 1NOYA 4IG0B 1REVA 4ELTA 5C42A 4I2PA 2HHTA 2IMWP 4O4GA 4MK9A 3K5LA 4H4MB 2D41A 4WZMA 4QW8A 2R2SA 4B9LA 4NLDA 4M95A 4O3NA 4CK1A 4DL4A 4OJRA 4HYKA 2I5JB 2HNDA 1HYSA 4PQUB 4DF4A 4ED0A 4J9LA 4Q0BB 2UVRA 3Q8RB 1TAQA 3RMCA 1NHUA 4J9SA 3NH2A 3OL8A 3CIZA 1MU2A 5EDWA 1EP4A 3CDWA 5KT5A 1LAVA 2JEFA 4R5PB 3ISNC 1N48A 5HLFB 4R0EA 2OH2A 1ZBLA 3V81A 2W9CA 1XWLA 3DMJA 1J54A 2F96A 4HTUA 4M94A 4CJEA 4FLYA 5J1EB 4F4YA 1TVRA 4YR3A 1NKEA 1BQNB 4JS5A 3UIQA 2QV6A 1S6PA 4PUOA 2IDOA 3OS2A 2FVSA 1HNVA 4RW4B 4JLHA 3AVIA 4FLTA 4ECUA 4IH7A 2XGQA 3HVTA 2IM2A 2E9RX 2C28A 2G8HA 4EO6A 4B8CA 4ZHRA 4ZPCA 4CJTA 3AA5X 3SJJA 3S3OA 2QE5A 1KCFA 3UDLA 4CGDA 1S97A 1DTQA 1QAIA 1UWBA 1WSGA 1KHVA 3H4BA 4IH5A 3DLKB 4JRPA 3TVKA 2HNZA 2ZKUA 4E1NA 3OYJA 4DSIA 4KHMA 2HVIA 4J9NA 1BISA 3T1AA 1T03B 5HP1B 4NLQA 2XGPA 3PJXA 2Z1GA 2KZZA 2KFNA 3KLFA 3SUNA 3T19A 1RT2B 4O3RA 4EP4A 3HYFA 2UUTA 4OPKA 4QCLA 4ED2A 2RF2B 3H5SA 3M9MB 4NLXA 1S9GA 3DLBA 2GIRA 4M45A 3VQQA 4ECQA 1BHLA 2WONB 4CFBA 2DPIA 4IKAA 4XIUA 3QINA 5HBMB 3RR8A 1RT6B 2OPQA 4RNFA 4CEEA 2ASJA 4FM2A 3OY9A 2XI3A 1JLFA 3SQ4A 4RNHA 3PV8A 5FDLB 4PA1A 1S10A 3NKYA 4QWEA 1IKYB 4FLVA 1J9AA 3HHKA 3ISND 3DRPA 2QK9A 1SUQA 4FBTA 3IRXB 4J2BA 3PW2A 2FLNA 1RAJA 4FZXC 3NFAA 2HB5A 4DL2A 4HUEA 2VWJA 1CZBA 4ZP8A 1ZBHA 2AX0A 1BI4A 4DSKA 3ZSWA 4Y2CA 3LP0A 5L1IA 1D9DA 2W8KA 4CJUA 3TAEA 3VQ9A 4O44B 4QAGA 2VG6A 4CJ5A 2OYQA 2F8SA 2IA6A 4FYDA 1KLMB 4F8RA 4DL3A 3QZ7A 4WFZA 4K4WA 2G8VA 4F50A 3ALYA 4Z4HA 3AO1A 1NK0A 3AVGA 3LPUA 1Z26A 2IM3A 1QSSA 1S1XB 2FLLA 3VQAA 2ZD1A 1KVBA 3CG7A 1VSLA 1LWCA 4F4KA 4HCCA 4NLWA 1TKDA 2IC3A 1RA7A 1C1AA 1RDCA 4I9LA 5CZ1A 4ID5A 3VQ7A 2B5JA 3OL6A 4N47A 1Q9YA 4FJXA 3O3HA 1TL1B 1RT3A 4J2EA 1JLEB 3DRSB 2ZE2B 3DLRA 4ED7A 4GW6A 1BCOA 3NHGA 2BRLA 3TI0A 1HMVA 1JLBA 2AGQA 3QGGA 2YHAA 4ED6A 1WNEA 3QEIA 3QLHA 3P1GA 3I0RA 3GV7B 4KHQA 3H5UA 4RUAA 4RNNA 1ZETA 3H98A 1NJXA 3FRZA 5JXSA 2ASLA 3NF9A 1HQEA 2OZMA 3QGIA 3JYTB 4KSEB 4JV2A 1TK5A 1BQMA 4EZ6A 4URQU 3PHEA 4NLYA 4FLWA 3RMDA 1GOBA 3PR5B 4CHYA 3CVKA 2YNFA 3SI6A 4KTWA 1D9FA 3LAKA 3I5CA 1W9HA 3O3GA 4QOZB 5T7BA 1QSYA 2OPRB 1KVAA 4KKOB 3E01A 5F8MA 2IBKA 5KFGA 2GUIA 4ECVA 3AVMA 2R8JA 2IOCA 4W5TA 1IO2A 2A1RA 1FKPB 2R8KA 4M3WA 1J5OA 3AA3A 5DGBA 2FLPA 4KHSA 3DYAB 5DK5A 3BQ2A 2BANB 3ZSOA 1FK9B 5KG2A 3TAMA 3KOAA 3TARA 3OHBA 4IFYB 2ETJA 1WSIA 4OGCA 5HROA 2IM1A 3NAHA 3SPZA 4KE5A 5D3GB 4WZQA 4NCBA 3ZSYA 3FFIA 4KV8B 1S9EA 3BGRB 4G3IA 4DEZA 1LW2B 3IGNA 4XPEA 4IR9A 3H40A 3OJSA 3KLEA 3AA4A 4F2SA 4O0JA 4FBUA 2OPPB 1Z25A 1QSLA 2VG7B 1T7PA 3V6HA 4LSLB 2HNYB 1RDAA 1S1VA 2IAJB 4TY8B 2WOMB 3KJVA 2IJFA 3NF7A 1IKVB 4KHYA 5KRTA 4MH8A 1VK0A 2DFEA 1TL3A 3AO3A 3L2RA 5KT3A 1SKWA 4IDKB 4IFVB 4RW7A 1RT4A 4ZP9A 4BDZA 4DFKA 1U04A 3PW5A 3O4NA 4BE2A 4E7IA 4AHTA 4EYHB 3AVJA 2X6NA 1SKSA 3ZT4A 5KFWA 3P5JA 5DLGA 4EEYA 4O0IA 2RN2A 3NF8A 4M41A 4MFBA 1D8YA 1R0AA 1NK8A 3KIOA 4ELVA 3U3YA 4KRFA 1N5YA 1Z4UA 4F4WA 1IG9A 4WE1B 3DM2A 3OL9A 2HHQA 2UVVA 4YNQA 4Y2AA 2Z1HA 4H54A 2UUWA 3IG1B 3V6JA 3C94A 3QO9B 3G6XA 4N76A 3DOLA 1GX5A 2GBZA 5I42B 2YNGB 1VRUB 3BSNA 3S3NA 3ZSXA 2OPSA 1RYSA 4HUGA 3QIPA 5FROA 1C1CB 4ECRA 3V1OA 1JL1A 1NK6A 1WSHA 2YNIB 1JLGA 2WRMA 4M3YA 1KRPA 1HNIA 3D5MA 2R2RA 2BQRA 5KT4A 1DLOB 1WAFA 4DG1A 4IG0A 4AHVA 3QEVA 4OL8A 4AHCA 3M9OB 4DLEA 5FRNA 1EETB 2FBYA 5DQGA 3PZPA 1C2PA 3Q8SB 3EZ5A 2HAIA 2XC9A 3L3UA 3SV3A 3V9ZA 3PO5A 4CF0A 2I5JA 1N56A 2D3ZA 4PQUA 1VRTA 3VQBA 4DSJA 2YNHA 1U49A 4Q0BA 5SZTA 3CWJA 4WFYA 4I2QB 1QE1B 4TQSA 4JV1A 2BGGA 3M8SA 5C24B 3NMAA 2HHVA 2VG5A 1LWEA 4CERA 4DU1A 3CFOA 3K57A 4TQRA 3K58A 1C1BB 4CHQA 5KFLA 2R8HA 1B9DA 2B6AA 3H4DA 2ALZA 5T14A 4NYNA 2YKNA 3MXIA 3WNGA 4MKAA 1NK5A 3KLGB 4RW4A 4AHUA 4G1QA 5HRPA 4M42A 1L3VA 5J2NA 3EYZA 3V9UA 4OKJA 4N56A 1HQUB 1X9WA 3OS0A 3JSMB 3S3MA 4IRKA 4FK0A 4ZPDA 4DQIA 1N4LA 3GIIA 2ATLA 4HKQA 3AVFA 2O4IA 3MEEB 2W9BA 5KFJA 2DFHA 3VQ8A 2G8WA 1QUVA 4KFBA 4LQ9A 3DLEA 3LPTA 3QYYA 1ZTWA 3OYLA 3BJYA 4RUCA 3VN5A 1JLQB 2E9ZA 1QHTA 5J2PB 2RF2A 2IGIA 4FJLA 4NLPA 4CHOA 4CE9A 4KTZA 1T05B 2WHOA 3BDPA 2WONA 1S0MA 4IOBA 5HRSA 2DY4A 4LY7A 5L1JA 3TAQA 1SV5B 4RNOA 1WSEA 1RTDB 4Z4IA 1JLAB 3GQCA 4ZVFA 2PYJA 5KFQA 4BACA 3LAMA 1S1WB 4DQRA 1BIUA 3GV5B 3PX0A 3DRRB 3NL0A 1SL2A 3KHHA 4CJVA 4DTOA 4FK2A 4RW9A 4H4OB 3SFUA 1B9FA 3D28A 4DTSA 2YKMB 4Q43A 3IRXA 3CJ4A 4XO0A 1CZ9A 3CDEA 2P51A 3MR3A 3C6UB 3VQCA 4FJHA 1RTIA 2JEIA 2XI2A 3KMSA 2CKWA 1I6JA 5DLFA 2E6MA 4CJLA 1LW0B 2RKIB 4CGGA 5DG7A 4OLAA 1KLMA 1WSJA 5KFTA 3SZ2A 1CLQA 1JXLA 4O3OA 1HYVA 1IKXB 2R7YA 3ZSZA 1S1XA 4DTJA 5KG7A 3RRHA 4O4RA 3DOKA 4KAZA 3NBPA 3HPGA 2E4LA 3V1RA 4B8AB 3KK2B 4HHTA 1JLEA 5L1KA 2KQ2A 4DQSA 1W0HA 5KFVA 5CY4A 3C6TA 4CEQA 1RYRA 1L5UA 5KT7A 2YV0X 4IRDA 1LV5A 3U6FA 4KHUA 4CFDA 3B6OA 2ITGA 3QERA 1Y97A 4ZPBA 2IJNA 4NYZA 1QTMA 4ZP7A 1RILA 1S48A 3GYNA 3F9KA 5DMRA 4BWMA 3VQPA 3KTQA 4ICLA 3OYKA 4O5BA 4MIBA 3N6NA 1BCMA 3LP3A 2QKBA 1HJRA 1ITGA 3EZUA 3TAFA 4EBDA 4E7JA 4RZRA 2C2DA 3M9NB 4BDYA 1D0EA 1KLNA 3I0SB 4EP5A 5J2QA 3AA2A 4OVLA 3OSNA 3RB6A 4QPXA 4RW8A 4QW9A 1S0NA 4C8LA 3NGIA 4KHWA 4N41A 3I8DA 1WAJA 1HARA 1HPZA 4I2PB 2V9WA 4CK2A 3AV9A 4O3PA 1RT1A 4IG3B 2ASDA 3PJWA 3MFIA 5KFZA 1NKCA 3HPOA 2RDIA 4E0DA 4QWAA 4GVMA 2HNDB 1HYSB 3PX4A 1TKXB 5EWEA 4KTQA 4DTMA 2OPRA 3S9HA 5KFKA 4KKOA 1RTJA 4E89A 2NUBA 2XHBA 1XC9A 3MFHA 1MU2B 4NYFA 1EP4B 5KFDA 4J9MA 1DTTA 3VA0A 3ZCMA 1S6QB 3V81B 2W9CB 5KG5A 3NE6A 3DMJB 2O5DA 2ATQA 2R2UA 4NLUA 4FJ5A 1U48A 3AVHA 3RWUA 1S5JA 3IGVA 1TVRB 3WNEA 1TV6B 4B9SA 4J9PA 4IKFA 4KO0B 2DTUA 4PUOB 3SCXA 1NK9A 5D3GA 5DG8A 1HNVB 3VQ4A 2AX1A 4KV8A 2FJXA 4DFPA 4DS5A 4YMEA 3HVTB 4MQ3A 3V4IA 3SUPA 5EUHA 5KFAA 1MMLA 3NGZA 1T94A 3RTVA 4KB0A 4NLSA 5KG4A 4RW6A 3VQEA 1KFDA 1DTQB 4B3OB 3NGYA 4U7CA 3TQ1A 1TKTB 2X6SA 1UWBB 2D0CA 2WOMA 2HNZB 2HHUA 4CJRA 4Q5VA 4IDKA 4NLTA 4CF2A 3PW0A 4ZVGA 3TANA 4IFVA 1XI1A 2EX3A 3SPYA 1L3SA 5L1LA 4HUFA 3KLFB 3NH0A 4CIFA 5J2MA 4NRTA 4AH9A 5KI6A 1IH7A 2G8FA 2XY8A 3QIOA 3H5YA 3LWMA 1S9GB 4J9KA 4UQGA 3AO5A 2HHWA 1YTAA 2OPQB 4CF1A 2JLEA 2UVWA 4B08A 2F8TA 3IS9A 3CFRA 3RB0A 1RT7B 1JLFB 1XHXA 2FVCA 4IQXA 1SKRA 1IKWB 3B6PA 3O4QA 3IG1A 3KNAA 3QO9A 5DQHA 4FZZA 5I42A 2BRKA 4U6PA 1VRUA 2YHBA 2VA2A 3DRPB 1VSJA 4OPJA 4BE1A 4TYBA 4JV0A 3K5MA 3SUQA 2FVQA 4K4VA 3UQSA 4Y1CA 3ZT1A 1OS5A 3C95A 2YNIA 3CO9A 3L2QA 1VSFA 1TK8A 2Z1IA 3LWLA 4KBIA 1NOZA 5KFNA 3PY8A 1RTHA 1NHVA 1A5VA 3LP1A 3KK3A 5KFSA 3OHAA 2Z1JA 4ECSA 3K2PA 1S1UA 4M3RA 3ASMA 1C0TB 2BDPA 2AQ4A 3MEDA 4TY9A 3QETA 3F73A 2VG6B 2AU0A 4YR0A 1SL0A 1FKOA 4C8NA 2HMIA 4C8KA 1EETA 3OYFA 4TYAA 3MF5A 1YTUA 4CIEA 4K4TA 4KREA 4DTXA 4Z4CA 3LP2B 1NJWA 3OYHA 4FJMA 1JLCA 2WK4A 3KKSA 1NK7A 2ZD1B 1WLJA 1VSMA 1C0UB 1LWCB 4EYIB 2IC3B 4KI6A 3SFGA 2XRIA 4BWJA 3OYCA 4ID5B 3OYGA 2B5JB 1T8EA 4NLOA 5C24A 4F2RA 4RU9A 2AGPA 5I3UA 3LDSA 1ZBUA 4Z4EA 4NCGB 4GC7A 4DSEA 4CECA 4IRCA 4F3TA 1WSFA 1C1BA 4Z4GA 1RT3B 2JC1A 4DWIA 3GIMA 2P1JA 3TWHA 4CGFA 2VWKA 4DU4A 2P5OA 1HMVB 2GV9A 2RPIA 1KHWA 4F4ZA 3OYEA 1JLBB 4Z0UA 3CFPA 4FJ9A 1C0MA 1S49A 2HWHA 2G8KA 3OJUA 3M8RA 4C8MA 4ZTJA 3QNNA 1S0OA 2PYLA 4PY5A 2D7SA 3QIDA 1N6QB 3MXJA 3VQ5A 1XR7A 2FC0A 4CGJA 4URGA 1HQEB 3N6MA 4DQPA 3HL8A 1RT5A 3MEGA 5KRSA 4CJ3A 4M3ZA 4ZVHA 1EX4A 3OYIA 1TKZB 3ICLA 3U3GA 4O3QA 2EHGA 4ECWA 4CHPA 2OA8A 2W8LA 2J6TA 3ZT2A 3G86A 4TSXA 1TP7A 3EY1A 3M8QB 1D5AA 2J6SA 4DTRA 1L3TA 4KPYA 1WN7A 2KFZA 3KKRA 3V6DA 3CQ8A 3E01B 4E7KA 5F8NA 1T05A 3OSPA 4E7HA 1C6VA 5EWGA 1NKBA 1LWFB 3HP6A 1J5OB 3SQ2A 4FJNA 3LZJA 3THVA 2D0AA 3HXMA 4K4UA 4H4MA 4GC6A 4I7FB 4AHRA 4W5RA 5EWFA 4JUZA 3MECB 5KFIA 4CFCA 3AVAA 5KFUA 4B9UA 4NZ0A 5KT6A 3DRRA 3FFIB 1S9EB 2UVUA 4H4OA 4FS1A 2FJWA 4B9VA 4X2BA 3HPHA 1VSHA 1TAUA 3AO2A 3N6LA 2QKKA 2YKMA 3OLAA 4R5PA 3VQ6A 1W25A 5HLFA 3KLEB 3ZT0A 4B9NA 1S1TB 3HO1A 3AO4A 3HVWA 5EU7A 5CYMB 1S1VB 2BQUA 1CXUA 4E1MA 5J1EA 1RBSA 3KJVB 3TR8A 4ELUA 1BQNA 2XY7A 3UPFA 1TL3B 1LW0A 4R8UB 5K14B 4YR2A 4BE0A 1ASUA 4W5OA 3FQKA 3K5NA 3QNOA 4RW7B 3DLGB 3RMBA 3HM9A 2Q3SA 1LAWA 1D1UA 4FLXA 4FM1A 4QWDA 2HVHA 5KFEA 1JIHA 3MR2A 3TAPA 5KFBA 1RDBA 5C25B 4I9QA 3LANA 3DLKA 3CJ2A 4CJ4A 1UOCA 2W7PA 5KFYA 4MFBB 1NK4A 1R0AB 4ZVEA 2HHXA 1YVUA 3VQDA 3KK2A 4Q8EA 5CYQB 2Y1JA 5JUMA 3DM2B 1T03A 1X9SA 5HP1A 4DSLA 4DLGA 3T3FA 4LSNB 1RT2A 3L8BA 2FBTA 3QEPA 3DOLB 4ED8A 4DQQA 4NCAA 5F8JA 4CJSA 2OPSB 3QIPB 3OYMA
chains in the Genus database with same CATH superfamily
2M8HA 5HBMA 3C66A 3OQ2A 1Z2ZA 2BOAA 4QPTA 2ZH5A 3ZETA 3EJMA 4TLRA 2FF6A 1OYDA 3HT3A 4A46A 4CZLA 1ILYA 4A2AA 3KLIB 2B43A 2J8SA 4YOXA 4LF7K 3LGHA 1GXLA 3DXKA 3M2RB 1TK0A 4IOXA 3SQ0A 1IKYA 1Q81O 1BD6A 4FOIA 3E51A 4C23A 3P38A 3TJ9A 1N34F 2QXFA 3NF6A 2A18A 1WOSA 3TABA 4LR9A 1U09A 4QWBA 4GVLA 4C3KA 4WXOA 3T5HA 3A13A 1DT9A 4HACA 3WHIA 4FZVA 2CDRB 2OZSA 1M5SA 2YWWA 2CJBA 3BGOP 2WVDA 5FRMA 4NA3A 2R2TA 5ADXA 3WNHA 5LMNF 4K4SA 3FSIA 4CQ1A 2NR0A 1V4TA 1RZMA 2BJEA 2WCXA 5SWMA 2YKNB 1YZ7A 2DKOB 3DXBA 4YEAA 4G1QB 2HOEA 3RRKA 4KB7A 2V2QA 1U1QA 4DV2K 3DU6A 1MW7A 1IBCB 3DRSA 2ZE2A 1OIAA 2HVEA 1WD6A 2XCAA 1GXTA 2PE8A 2O8DB 2W9BB 3D68A 2VBYA 2DR7A 4NZ6A 3OFFA 4J90A 2YX4A 2NLXA 3UKRB 2RU9A 3DLEB 1VQ8N 5KG0A 1ZAXA 1ATRA 1OKJA 3O44A 3ZC4A 1HNZK 2JVRA 1ZAWA 4IXCA 4RBTA 3RYLA 3VQSA 2ADCA 2KW4A 4X66K 2AJQA 5CCMA 4JI3F 3CGIA 1HLUA 1LNQA 1U47A 4IH6A 4KH5A 1NNDA 2ABYA 5KTQA 3JB9k 3M2UA 2D5RA 5JS1A 3IN5A 4BLGA 5AQUA 4DTNA 3TSPA 2GO9A 3DHXA 2GHWA 3D45A 7FD1A 1GTHA 4WFAL 4CO0A 3MMAB 2E44A 2QMWA 4F0MA 4USHA 2XMAA 2CJAA 4UW2A 2CVEA 1ZBFA 3V9XA 2BANA 3CC7S 4JK9A 1FK9A 5AR0A 3H25A 3R1HA 1RTIB 4IFYA 3I55S 3GFXA 1K73O 1WUUA 4F0KA 1P9QC 2FC9A 4NASA 4EZ9A 1VQ9N 4M5LA 3PRDA 3J81U 1HI8A 4DJBA 4B3MF 3HSTB 3BGRA 2MGZA 3KMQA 1LW2A 4AL5A 4XPCA 4JKDA 4LJMA 1FA0A 3TVYA 2D3OR 3OS1A 5IOLA 2HNYA 5B0CA 3K59A 4AL7A 3L2VA 2YHYA 3I9V9 4TY8A 3VOVA 3NBPB 2IA0A 4BC5A 4MK7A 3SV4A 1T9TA 3HK2A 5AQGA 1NBEB 5AQOA 2VQFF 1FD2A 3ET6A 4PXEA 3TAGA 2WB4A 4CF8A 4IOCQ 4QS9A 5DG9A 1J53A 1UETA 3O5TB 1NUEA 2V8PA 1FVSA 5GMKa 4ICLB 4DSFA 2JGUA 3Q86A 3I4PA 4PPZA 1IM4A 4OI4A 4A62A 4DUYK 1B64A 4N8OA 4UOHA 4WFBL 2AP6A 2D4WA 3N5BA 2E88A 2BJ8A 3JAMY 3SMPA 4DV3J 4NMLA 2NRTA 2HZVA 5JICA 1UZDA 1R8CA 1HPZB 5A0YA 1HNWK 3A5MC 3NNCA 4RWXA 3T41A 1SUQB 1WKLA 4AILC 3LL3A 1D9AA 1WSVA 4ILHA 1YLXA 4DL0C 3AVCA 3LP0B 2QA4G 1WC1A 3SBGA 2V69A 2C2EA 3ULHA 4LH5A 3TSQA 2ILZA 4ZS6A 2WTFA 1YJWS 4CO4A 1X4HA 2E5GA 2XCPA 1EJ7L 1OY6A 4IJAA 3KZBA 3NS5A 3CJ0A 4WFBQ 1YT3A 2Q97A 4UF4A 1EWRA 5AQXA 4I2QA 1IR0A 4M3XA 1X9MA 1FDNA 3QZ8A 3PR4A 2G0CA 4DN9A 2JOQA 1YVNA 1X9JA 2HW3A 3O8WA 4QR0A 4USUA 4QR1A 2YKOA 1GOAA 2D3O1 4DX7A 1U4BA 1REGX 5HVGA 3UCUP 3Q22A 3AVLA 1WTBA 2XSJA 2GS8A 2RD5C 4CD1A 2CZ4A 4ISFA 1LFPA 2UXDK 3J7A1 3I0RB 1S99A 4DR3K 3FZMA 4EHUA 3KWMA 4YOTA 1FJGK 2N7YA 2AGOA 3EUNA 1VQ4S 3SYZA 3SSSA 3AHPA 3SI8A 1WHWA 3KD5E 3BYRA 5E3AA 4LF2A 1BQMB 4DOZA 3RZAA 2ZGZA 3LGNA 2M0GB 2J9DE 2UUAJ 1RDRA 2PY5A 3AVBA 5CYQA 2O01C 2KJVA 4DN0A 3IBFB 5KFRA 1HNXJ 4P73A 1SJ1A 3PUFA 1DURA 3AJ1A 4CF9A 4J9RA 3WX8A 5KPRA 5CXTA 3MN6A 3BSOA 2XTJP 4I4BA 3CSKA 4FW2A 3HFVA 4ECTA 4I56A 4X4SA 3PW4A 1T9VA 3E9LA 5JS2A 3U7JA 3KLVA 1SJQA 2IS3A 1RTDA 4AM6A 4NXNJ 3MAQA 1HPMA 3H45C 3MXMA 2BE2A 5HROB 4YORA 1SQGA 2PEHA 1S1WA 1IBLJ 1HI1A 1JQGA 3OBWA 1KWMA 1XNRF 2Z30B 1FKOB 3EVOA 3N4QA 2W42A 3DNCA 2E1ZA 4LIWA 4ZCIA 5AQYA 1Y0HA 4CEFA 2N3LA 2LDIA 3UNGC 3V9WA 5HVFA 1YRTA 4CZCA 3O08A 1B99A 4YY3K 4BRCA 1O51A 2PFFB 1LKZA 4DMZA 1K9MO 4PG7A 2ZH6A 3C6UA 3Q2SC 3ITHA 5DDQC 3HFZB 2YQ0A 2H54B 2B8PA 3HHLA 4FK4A 2RKIA 4PKGA 2DNGA 3ISZA 4IR1A 3NCRA 4FLZA 2M7SA 3J7YI 4JD2B 2Y1IA 2E2QA 4M8LA 3L7UA 3RUBL 2VBZA 4X65F 2HBQB 1L3UA 3MR5A 3OV7A 3W2VB 4DR2F 2QZ8A 3EKSA 2J9CA 2XLIA 1J5EF 4OX6A 4JEPA 2AJFE 4JI8F 3CJ8A 2OTLS 4CCHA 2WBNA 4MKBA 3BGUA 2VU5A 4Y1DA 3A3OB 4FJKA 1ACMB 4ECXA 2CQHA 1K1SA 2C3UA 2UXBJ 2HZCA 5HRNA 1FERA 3NEKA 3JQKA 4PAAA 1EXQA 5BN8A 4WYWA 1NJIO 1G7CB 1JX4A 5GAEP 3FRYA 4RNMA 1HD0A 4Y3CA 1TGOA 3U4LA 1BOTO 4B3RJ 1YKWA 3NGDA 2OD4A 3BR9A 1BUXA 4YOYA 1YTYA 1Y5IB 2OO4A 5C7PA 4QWCA 1BA0A 2P9CA 5BRFA 5GIOA 3GILA 4LF4F 3UN3A 3THWA 2MZJA 4FF2A 1REVA 3J81Y 1F5AA 3PM9A 2WW8A 5ADXH 4O4GA 4WQ4C 1NMDA 4B1UB 4H4MB 2D41A 5AFUA 4NLDA 3AAPA 1S4EA 3BM7A 5J1NA 4OJRA 1RAGB 3CXCM 4DF4A 5HMZA 4J9LA 4GKJK 4Q0BB 2UVRA 1HBUB 3RMCA 4J9SA 4AXIA 5KT5A 2FZCB 4R5PB 1WBBA 5HQLA 1N48A 5THWA 4DPXA 5GMDA 1Q8KA 5C2DA 2OH2A 2OCEA 1ZBLA 2W9CA 1PCAA 3D54A 4K7QA 2QLJB 3F0NA 4FLYA 2GHPA 4LF1A 1NKEA 1Q1KA 2QV6A 1NM1A 1S6PA 2P9PA 3IUCA 4OI3A 3SQOP 5C15A 1VK8A 4RPFA 3FZHA 2C28A 3S7RA 3GZ7A 4B8CA 2HK2A 1KCFA 1R59O 1NGFA 2GO8A 3DRYA 1Q86T 1QAIA 3H4BA 4IH5A 4KGKA 3TZYA 4JI1J 1G1XA 2RAQA 1CJKB 4A8YA 2MKJA 3C19A 3R6GB 1RFQA 3QAUA 4J9NA 3V2UC 1N36K 3T1AA 4CZJA 1T03B 2CIMA 3NWRA 4WP8A 3AXMA 2RHQB 2XGPA 3DJCA 2Z1GA 3KLFA 2A2DA 3SUNA 3T19A 4O3RA 2B9XA 3HYFA 2UUTA 1PC4A 2ZOFA 1WORA 2RF2B 4C97A 2K7KA 4DV6J 3VQQA 2QMUB 1VC5A 2WFBA 4CFBA 1U25A 2DPIA 4XIUA 5HBMB 4ANCA 3PYFA 2OPQA 4B17A 4LBIA 3C16B 3ZETB 2KDOA 2XI3A 1JLFA 2LXUA 2VHGA 3SQ4A 4BQLA 5HMXA 3PV8A 2RNEA 2CJYB 3MM7A 3ZXWA 1TMJA 3DXKB 5B0DA 2E1RA 3NCQA 4QWEA 3TUPA 2VONA 1IKYB 3VTHA 1MWMA 1KVKA 4PRFA 5C2FA 5L46A 4F36A 1LWXA 2J5AA 3IRXB 3J7YU 1RAOA 4FZXC 2OIHA 2LQ8A 1HA1A 3CCZA 1UW4A 5HO4A 5LY3A 4IFEA 3UWTA 2ZVSA 4HACB 3HD2A 2R7VA 1F5CA 3EE8A 4J37A 4ZP8A 2AX0A 4DSKA 1BI4A 4WTOB 1YSJA 2ZGYA 4NXMK 4GVBB 4BRIA 1YITN 2KXHA 3OHRA 3QGPA 3VQ9A 1VDHA 2F8SA 2AYEA 4F8RA 4HVZA 1GMWD 4K4WA 2V2VA 4EGLA 2BE7D 3D0IE 1HBOA 3HI0A 2G1DA 1S1XB 2FLLA 2CJKA 4FPBA 2CJ9A 4F4KA 4NLWA 1NGBA 1AB8A 3QBWA 1RDCA 2CA9A 2CGJA 3CCRN 4FYWB 2XO6A 1N33J 4DR4F 1Q9YA 4L73A 3W66A 3UCZP 2VPZB 4J2EA 2W41A 3DRSB 2ZE2B 3DLRA 1CJTA 1V3RA 2EW9A 2VFUA 4GW6A 1BCOA 1BMQB 3W64A 1YX2A 3DDNA 1GFWB 3MAAA 3QGGA 2UV8G 3QEIA 5LT5A 3G6EN 4X62K 4OMFG 4LRDA 5A8KB 2FZGB 5LXRA 2DT9A 4CNZA 3SQGA 3H5UA 4RNNA 3BS9A 1HR0J 3SLCA 2EFGA 3JTPA 3QRQA 5GINA 5E2QA 1A7GE 4LF9F 1QAXA 1HQEA 1PBAA 4FVCA 1UEKA 3ILJA 4KSEB 1FRLA 4CO2A 3CC4S 2DXFA 5B08A 3OTOF 1VMBA 4JKBA 4URQU 1E6VB 1A6LA 2DTJA 4LR8A 1MMDA 3ATVA 3ZEUB 3CCQS 1A0OB 3M2UB 1W7WA 2DHSA 2YNFA 2P6TA 4W98A 1D9FA 3LAKA 2HSEB 3CTRA 1W9HA 2GEMA 4QU7A 4PQAA 1R6YA 2BV3A 2RT3A 4F9OA 2QWPA 3E01A 2IBKA 5KFGA 2GUIA 4FO0A 3PIPQ 2V94A 4MMOA 3GYGA 3I82A 5DGBA 2FLPA 4KHSA 2BANB 1ZA1B 3LDLA 1FK9B 3TAMA 5B0EA 1RCXB 4IFYB 2RVJA 4A57A 4JI7K 3GJSB 1ZPWX 4WK3A 4P52A 2EPIA 4WZQA 4YOWA 5HL7Q 4LF6F 3BGRB 3T7ZA 4DEZA 1LW2B 2BUPA 3OJSA 4O0JA 1XMOK 4FBUA 3BZQA 5DZ6A 1T7PA 2HNYB 4ZIVA 1VQ9S 2FYXA 4TY8B 2WUSA 4FF1A 3OFGA 4MYUA 1TL3A 5CAAA 5KT3A 1SKWA 1T6DA 3MX2A 4BR5A 2CPDA 3ET6B 2W1BA 3IBWA 2QFJA 4BDZA 4DFKA 3PW5A 5LMUK 4BE2A 4OYZA 4E7IA 3ILLA 3OBYA 4L6V3 1Q7YT 3R97A 2O3DA 1SJRA 2CH6A 3GPAA 3ZT4A 3T9ZA 5AQRA 4EEYA 3CJAA 1S0VA 4CI6A 4U8VA 1NK8A 3KIOA 4I6WA 3U3YA 3M4XA 1WF2A 4NWBA 3I31A 2HHQA 1VI7A 3IP0A 3A5NC 2YJEA 3V6JA 4DR6K 3D7SB 3SAFA 1C0GA 5I42B 5A0YB 1VRUB 2BZ2A 3TTDA 1NSKL 1RYSA 3QIPA 1VHIA 3LUYA 1NK6A 1JL1A 2W2PP 5BR8J 1JLGA 2XMMA 2XBPA 3C6AA 1DAXA 1IBKF 2LKZA 2BQRA 2BXJA 2ZEJA 4P9SA 1DZ5A 3I4HX 1XUPO 4A61A 4AHCA 4DLEA 1FI4A 1MWZA 1G4CA 3Q8SB 2HAIA 3L3UA 3GOIA 4LRAA 1N56A 1YI2S 4PQUA 2HHHK 1NMEB 1U49A 5AZJA 5CHCB 4I2QB 4P75A 3M8SA 2HHVA 2CQ4A 2VG5A 2VBWA 4LIRA 3WEEB 4TQRA 4L75A 2KHCA 3ELHA 3ZTQA 2VPXB 2GIFA 5KFLA 5B8HA 1NEEA 4KYZA 2B6AA 4FF3A 2CQ2A 3A3NB 3MCMA 3RU0A 5T14A 3R2CJ 4OYAA 4MKAA 1NK5A 4DV7J 4FPIA 5BXIA 4RW4A 4OZNA 5AXMA 5D0HA 5HRPA 2NUUG 3EYZA 4OJ1A 1D8ZA 5LJWA 1X9WA 4IUFA 4ZPDA 4M1KA 1N4LA 2CWXA 2QT7A 3BPDA 1CULA 2BX6A 2Z8QA 3WZ0A 4EFHA 2FPHX 4AL6A 1FDDA 1U02A 4YDDB 1ZM3A 4RUCA 1Y9OA 1HKAA 2CPJA 1WDTA 5K8MA 1SJFA 3WT0A 5IV3A 1QHTA 1BWFO 5IWAJ 2IGIA 4CE9A 2UXCK 4O8KA 1NZ8A 3RW7A 3X1LB 4IOBA 5E0OA 4NX9A 3O80A 1WG4A 1CJUA 1RTDB 4Z4IA 3TX0A 1KN6A 5HK4A 4WIQA 1RWVB 5KFQA 5GAEI 1DKGD 3LAMA 2N4CA 1S1WB 3C8YA 3GV5B 4GV3A 1SL2A 3WUHA 3NGUA 2KJWA 3D28A 5ETNA 4DTSA 3CJ4A 5CQGA 1CZ9A 4BRKA 1GLJO 2P51A 3AARA 4FWOA 3LGMA 3K8VA 3W5ZA 3C6UB 3H90A 2NS1B 1P1TA 3GL1A 4CJLA 1LW0B 1DHMA 2RKIB 1VQNN 5GIPA 4OX9J 4RBUA 4OLAA 3CERA 1KLMA 1OY9A 2YX6A 3QQCD 3SZ2A 1FRXA 1JXLA 4O3OA 1HYVA 5ETOA 3ZSZA 1KVJA 1KR4A 4XDDA 2C3OA 1U8WA 1U6BA 2VPWB 3VGSA 2PI4A 2XNQA 1XERA 2E4LA 3MI7X 4B8AB 2CRLA 2X1GA 5CY4A 4CEQA 5HANA 3U6FA 4KHUA 4CFDA 5GMEA 3SEOA 1KQFB 2ASOA 4LRBA 5EOYA 4ZP7A 4XH1A 3CPWM 2HKEA 1VOMA 1PYSB 2HQGA 3D3BJ 1XMQF 4BWMA 4USMA 4J9VA 4U8YA 3JTNA 3N6NA 2CDQA 3LP3A 1CZAN 3TAFA 3QT5A 2QW9A 1O5JA 4BDYA 2N7CA 2RILA 1YJ9N 4KY3A 1URNA 3AA2A 5CD4A 3HBTA 3THWB 1S0NA 1HARA 3G4SS 4OHYA 3AH6A 2VQEJ 2V9WA 4CK2A 2BJ9A 1F3FA 4IG3B 5LSRA 1VC0A 1JNZB 2EFQA 2L3MA 2OPRA 4OI0A 4KKOA 4E89A 1RSCA 4KGMA 1YWXA 3IRWP 2AHOB 3FEYB 1DTTA 3VA0A 3D9BA 4DV1K 2W9CB 1VLOA 1I5OB 1U48A 4JI5K 1R6VA 4JV5K 1VRQC 2ROEA 3KWGA 4B9SA 2A5XA 4NEYA 3AOAA 2DTUA 1YJ7A 1FRIA 1FNOA 4EIAA 2P9PB 3VQ4A 1PIEA 4KHPF 4B3SJ 3P39A 4MQ3A 4DCJB 1X5SA 4FSVA 4LF5F 3SUPA 3W3DA 5L9NA 4NLSA 4RW6A 3VQEA 5AXNA 1KONA 1TKTB 2D0CA 2HFNA 2Q6CA 2B9EA 4PZVA 2MQNA 4X4TA 4DX5A 4CJRA 4FP9A 2B9YA 3JS9A 3W8GA 2PEBA 4IDKA 2CPYA 3WQPA 3K9JA 2GELA 4WWSA 2EX3A 1UFWA 3O6QA 4ZLLA 1PKUA 4HUFA 3KLFB 3NH0A 5J2MA 2W2NP 5GAEU 4AH9A 5KI6A 3EXYA 1HLWA 3H5YA 3LWMA 1Y00A 2ZBQA 2YVSA 1VS3A 1VQLN 1S7IA 3AAQA 4B3TF 1YXQA 1YTAA 2OPQB 2JLEA 1QQNA 2IYIA 3VPZA 2F8TA 1RT7B 1JLFB 1TTHB 4Y0WA 2FVCA 1V5VA 5HMWA 1SKRA 2VUGA 4UY8T 3IG1A 5DQHA 4FZZA 4BC7A 1R0BG 3I56N 1S72N 2DEIA 2YHBA 1HKGA 4B1WB 4WP9A 3RVCA 5K8PA 4JV0A 2FVQA 2QA2A 3SCKE 2CQ1A 2QN6B 3UQSA 2V8VA 2YNIA 4P7VA 4ZIWA 1TK8A 1O13A 3LWLA 2Z1IA 4KBIA 3FBFA 4PXBA 2LLZA 1MA9B 2EEYA 2R9LA 3ASMA 2AQ4A 3CNQP 4I6MB 4YR0A 1UTAA 4C8NA 1P6TA 4C8KA 1EETA 1YTUA 4CIEA 3PXGa 3GFZA 5IM0B 5H9FJ 3MM6B 2DGWA 3PTWA 1NJWA 1JLCA 2WK4A 2NRVA 3FGVA 3O1WA 4QZVB 2QSWA 3GSIA 4MAKA 1B0VA 4P2FA 4EYIB 5C24A 2AGPA 5I3UA 1ZBUA 4A5AA 4DSEA 3HHNB 4K5RA 2ZH3A 1C1BA 4Z4GA 5IFMA 1JWWA 2WSEC 5IS2A 1RDUA 1CJTB 3NGRA 3GIMA 2ATCB 2QWNA 1OYEA 2RRBA 2VWKA 2GV9A 3I6PA 3H3OB 2CNLB 2BKOA 3BUZB 2IYGA 2OD6A 3MCPA 3R6MA 2C2MB 5JLHA 3SQGB 2HRYA 2P9UA 3TEHB 2PYLA 5ADZA 4C1NK 2FC0A 4URGA 1HQEB 5M1FA 3HL8A 3MEGA 4CJ3A 3KFWX 3IA0A 3LPEA 1TKZB 3ICLA 4BC3A 4OZ1A 1NLKL 4O3QA 4ECWA 1HX1A 1F2HA 1KP6A 2J6TA 4GO7X 3G86A 3DFEA 3GJTB 5DO2A 1D5AA 2DD8S 3CXCR 2PO4A 1L3TA 3TU5A 4GVEA 4C3LA 4KPYA 2KFZA 2M4MA 4CT8A 1Q81T 2E20A 3V6DA 2G13A 2G0JA 3E01B 2V5HG 5CHIA 2E1CA 1T05A 1FHTA 3W61A 3FK4A 4FJNA 3R2DJ 2B56A 3O9UA 2W2OP 3HXMA 3HF5A 3PNIA 1GLCG 1RHMB 3ETMA 4I7FB 5BPMA 2VFRA 1N32F 2OUGA 2R7QA 4JUZA 5KFIA 1GLBG 3MMVA 5KFUA 4B9UA 1Q8LA 3BGLA 4PG5A 2JJ4D 3VEXA 4H4OA 1AYEA 1NBWA 1OO0B 4B9VA 4HH1A 1U24A 1TAUA 2QKKA 3OLAA 3MN7A 4DV4K 1S7HA 3HO1A 3AO4A 5KQDA 5EU7A 3MTJA 3WIUA 2JWKA 3CPEA 4E1MA 2CXEA 3MM5A 1QY7A 3TTCA 4DV3K 4ELUA 1BQNA 1TL3B 1RE1B 2NRXA 1N8RO 1ROFA 3FQKA 2MQPA 3CJSA 3K5NA 3HCXA 2X1AA 1NSAA 4ZOSA 3RMBA 3HM9A 1S57A 1LAWA 2IDLA 4UZBA 3IR5B 3TYTA 2PIIA 3W5XA 1NH7A 3DLKA 3GCXP 4CZKA 4X4VA 1MNEA 1TL4A 3MWTA 3B8HA 3MMBA 4Z37A 4TU9A 1RBOB 3I33A 5IV4A 2WW4A 4BRMA 2FHJA 5HP1A 5F0XA 4RKUC 4BS2A 4LSNB 3ID8A 4X4UA 4JBCA 4NCAA 2EWSA 2UP1A 2O8FA 1XTZA 3P5TL 3QIPB 1YJTA 1XN9A 2RDDA 3CCMN 2W6LA 1C4CA 1JLGB 4MJKA 2M3DA 3OYBA 1NJYA 4CHZA 2BVZA 1I3AA 3TUIC 2MDAA 5HJYA 1GOCA 3HSDA 4RU2A 5AJ3F 3ENHA 4LFAF 3EGWB 2KHOA 4FM0A 1TQLA 1Q0NA 4I64A 1VSDA 2CQBA 1FT8A 1I94F 1ZPVA 5KFXA 3PSIA 3HKWA 4ED3A 4YB1P 3VEZA 3FZ2A 3MUMP 3QICA 2AV5A 2KKZA 2UU9K 5D4OA 5AZJB 5L8RC 1VSIA 4HWIA 3N4WA 3IFRA 3OVNA 2KL8A 2J6UA 2VG5B 3A3PB 3DRXA 1X8DA 4PWDB 5D4LA 2GUPA 1S6QA 3KLHB 3R5BA 2B6AB 2YWFA 4I0WA 2B0GA 4OYWA 5IQ6A 4FPAA 3FCWA 2QLFB 3VVUA 4JI4F 4KO0A 4DR7F 3AQPA 1RACB 4DL6A 2YKPA 1H72C 1D09B 3D0PA 2C2RA 3PG9A 4BRAA 3ZT3A 3VA3A 2Q66A 2CVIA 2PN6A 1TL1A 4B3OA 4B9MA 4ER8A 5I4MA 2QA1A 2F8EX 1CULB 4JYAF 1IBLK 1W2BM 5DGAA 4G9ZA 1JKHB 4CJKA 2XY6A 3W9JA 3KK1B 2JWNA 3WC2A 4P2MA 1UAWA 2EXUA 2XMJA 1U1PA 4Y6IA 2CQ3A 3THYA 1KC8O 2CH5A 4FJIA 1UW9A 3TSUA 1WOOA 2ZUGA 4OYXA 3DI6B 1KOOA 2M70A 1GLEG 4U67Q 1V5IB 1EO1A 3OT9A 5CYJA 2UUCJ 1FJ7A 4QOTA 4WU3A 4CEBA 3HSGA 4DS4A 1AXQA 4K5SA 3T1YF 1X0FA 1CJUB 3OYNA 3GLJA 1S79A 3BQ1A 4R79A 4USIA 1KAZA 1IKWA 1SH2A 1Q5YA 3SUOA 4M3UA 5AXKA 3RB4A 3G0ZA 2FVRA 3K7RA 2X1FA 4LF7F 4X64J 3PW7A 3VR1A 3CCJN 3BQ0A 1HIYA 4CEOA 2Y1RI 4A2BA 2UXDJ 4FJGA 3X3UA 1OWXA 2P2CB 3EE9A 3RG6A 3HTVA 2Q1LA 2EK1A 3UD3P 4JKGA 4HVJA 3NCIA 1YVFA 1RWWB 4TKTA 1LK5A 4OV1A 4DZ6A 2NYHA 1XR6A 4EAHD 2ZWPA 2VPYB 4IYQA 4FVMA 1C0TA 2LVWA 2DXEA 3RAXA 5M1OA 4A47A 3TZZA 2XWYA 3LP2A 3D6HB 2BQ3A 1FDAA 3UD5A 2QA4S 4FS2A 3NGTA 3E9OA 3TA0A 2C3YA 3NVMA 2XEXA 3OYAA 3NAEA 1C0UA 3OR2B 5ETRA 3O9TA 2H1YA 4O23A 1IKVA 3AA8A 2XM3A 4WIIA 2I1RA 4CLYA 5AZIA 4NCGA 1R31A 4DFMA 4DV2F 2DXDA 3DLHA 4DL5A 4NI2A 1ESVA 4OGEA 4BGAA 4I68A 2R3VA 4YP3A 3DLLL 4M3TA 3DDKA 3L7OA 1F9HA 3O3LA 4BBYA 4DI6A 3HJFA 2L48A 4FDFA 3UDEA 2G2OA 2ZM6J 1R27B 3VQTA 5ITHA 4DV5J 2XHCA 2IM0A 1NPPA 1YUWA 3M05A 4Q44A 3H5XA 4WE1A 1HNZF 2QIFA 4YY3J 3FMWA 4K0KK 2CQGA 4X66F 3ZSRA 3VAIA 4U95A 1U45A 4ILRA 2AJ4A 3HULA 2CJXB 4C8OA 2YNGA 4EUVA 3D7EO 3L09A 5D8HB 3BREA 4ZP6A 1V3SA 3M8QA 2D9OA 4IWVA 3QEXA 4HCBA 4ECYA 3EO3A 1G15A 2YXLA 1QD1A 1TUVA 4YQWA 4OJ3A 3CM6A 4N7TA 3DLLQ 2MQOA 4H8KA 1BGXT 3FDSA 3ZO7A 4FW1A 3MPVA 4HTJA 3H2UB 4PYDA 4BRQA 1U2VA 3FBBA 5CZXA 1HRHA 1RCHA 1DTTB 4WK1A 1LWFA 2RQCA 1K9MT 3A8YA 1E4FT 5JVHL 5M1NA 2A1SA 1KSPA 2YHWA 3WXIA 2DCUB 3MECA 3R9PA 2XMUA 4DV6K 1UFKA 3S8SA 3P4IA 2V9KA 5GADP 1WUAA 2VA3A 5IZHA 3D0GE 2WVEA 4RW6B 4QR2A 6FD1A 2JZ5A 1WG1A 3QMLA 2DO0A 4CEZA 2MEWA 3P83D 5CYMA 1RWMB 3IWNC 4PG4A 1S9FA 5AQNA 2YX1A 2C2NA 2E2PA 4DMNA 3U1NA 3GFYA 3CO0P 3NMUA 4R8UA 5KFMA 4WJBA 3Q8UA 5F2RA 1NJIT 4NLVA 4H5TA 4I6AA 4BR2A 4GKKF 5JVGL 5J2MB 1IUJA 2RDJA 3CDUA 5JVHQ 5IT9U 3J80U 4B02A 4DU7A 1H7WA 2W40A 1S4FA 3A12A 4JI0F 3D2FA 2IVYA 5C5JA 2HBMA 4AHSA 3DXSX 1EKRA 3THXA 2PMHA 4KH4A 5A8WB 3EPGA 4DUYF 3ZZUA 3F44A 2HFVA 2P5GA 4R0JA 4EBCA 2FVPA 5EXWA 1Y10A 2W7OA 1M5OC 1BC6A 2CJQA 1K6YA 3AA9A 1JLQA 1VQLS 1FTCA 4CJWA 5J2PA 5RUBA 4WPAA 4QQBA 1VBXA 2HHSA 1RI7A 1HNWF 1M1KO 2D1CA 5AT1B 5DDPC 3D1HA 1N34K 2BOPA 4YOEA 5KG1A 1SV5A 2C22A 3H46O 4LFBJ 2FSNA 3MDQA 3FSXA 1JLAA 5A8RB 4DDFA 2DY1A 1PSDA 3KLIA 3ULDA 3MCSA 1JXBA 3DGPA 1KQSR 3VETA 3VEVA 4DX8H 2GHVC 5KFHA 2MKIA 2K2PA 1RBUA 5LMNK 2OFHX 5GAHP 1JLCB 1WI8A 1EHWA 2EK6A 1QVGM 2IJRA 2JVOA 2DNOA 1WF1A 1RBRA 2E2OA 3LM9A 3G25A 3Q8VA 2KI2A 1SC4B 3GV8B 1Q18A 1Y5NB 2IHR1 2V63A 5I3UB 4AUKA 3LDNA 2YQ3A 3CT9A 4A5BA 2JEJA 4EK2A 2YH0A 3ZTOA 1JXEA 1OQ3A 1VSEA 3K89A 4ED1A 3ENWA 3LH2S 3CPWR 4RWTA 1ZOTA 1FRHA 1U1LA 3ULEB 3NAIA 1EAYC 1KQKA 1FXRA 1SQFA 2JEGA 1O0PA 2ZNZA 3OLBA 1HYZA 3NDKA 1JJHA 1RU1A 2Q79A 1NJZA 1VSKA 5HQMA 2P9UB 4DR3F 1A5WA 1N5YB 3Q8YA 5LOQA 4FJ8A 3O2IA 1FJGF 1QAYA 3MEGB 3OUYA 2LFVA 1Y3KA 4CHNA 2O8DA 2YWGA 4AD6A 3R7SB 3QJPA 1U6ZA 4JKAA 5I3QA 4FYXB 3V1QA 1GLFO 4H0TB 2ZQBA 2BM0A 2DNLA 5LL6d 3J8AA 1H7XA 5FPEA 3V6DB 3CMQA 1DRZA 4EMDA 1M1GA 4DG1B 1NOYA 5D78A 4ELTA 5B0FA 3PRBA 4I2PA 1X4FA 2K3IA 2HHTA 2IMWP 3CE8A 4KBOA 3K5LA 1SIWB 2QEXS 4HHHA 5G0RB 4CZEA 4B9LA 1VQ7N 4CK1A 3ZX2A 3CC7N 2I5JB 1HYSA 4UT4A 5IQQA 2ZBPA 1TAQA 1LXNA 2BA9A 3M6VA 3NH2A 3FZKA 3I55N 4X4OA 3M30B 1LAVA 2ZDOA 4M7XA 4M7YA 4NE9C 4KIAA 3VZIA 3V81A 1XWLA 3TPQA 3CJQA 1H74A 3DMJA 3AFGA 1J54A 2F96A 4M94A 4CJEA 3MM5B 5DETA 4F4YA 1TVRA 2D1KA 2BBEA 1RBLA 1BQNB 4JS5A 3I96A 1RWKB 1HNVA 4BGBA 3OBIA 3AVIA 4IH7A 1JMTA 1U7LA 1F9FA 2OSQA 2G8HA 4CJTA 2KT5A 2GX9A 5BR8K 1KOHA 3W63A 4IEIA 2HRTA 1S97A 1DTQA 3CJTA 3LW5C 2PC6A 1S22A 1WSGA 3NS7B 1NPKA 3DLKB 3WXLA 1RHUB 3PHTA 3TVKA 2ZH8A 2ZKUA 2X3GA 1IVZA 1DEJA 2HLTA 2P9GA 5M1PA 2HVIA 2U1AA 3MMBB 7FDRA 5HP1B 3OPKA 1UPPA 3H3NO 2KFNA 4YUDA 4DUZF 5F0UA 3T1HJ 1WC5A 1EKSA 4KC5A 2O8FB 3DDIA 1H98A 4FYYB 2MQ8A 5L38A 1BE4A 4RNFA 2HYIB 4CEEA 2MKHA 4FM2A 3OY9A 3LA0A 2YY3A 3B8AX 4PA1A 2HIYA 1S10A 4DV7K 2I7PA 1QQMA 3ZNJ1 4FLVA 1YJNS 3HHKA 3ISND 1UFLA 2BMBA 1SUQA 4OJHA 1LK7A 4J2BA 2KFYA 3WIVA 2FLNA 1RAJA 1NGAA 2HB5A 1F0XA 3FLCO 4P6QA 2FLOA 4DL2A 2H4YB 1YJWN 1CZBA 3WXMB 1ZBHA 3ZSWA 3S41A 2PI5A 3LP0A 1HBNA 2F1FA 1KNZA 4GKJF 5BPNA 1D9DA 3TAEA 2RB7A 1UVIA 2Z2YB 2VG6A 2OYQA 5FIIA 3UE5A 4F50A 3ALYA 3OTDA 1IQTA 4Z4HA 1NK0A 2IM3A 4ES3A 1FRJA 1O6XA 2VDHA 2V52B 1KVBA 4YOUA 5IWAK 5IT9Y 4KGZB 3J80Y 2R7XA 1KAXA 3CG7A 1LWCA 4DR6J 3FE1A 1AA1B 1X3MA 1RA7A 3IAS9 3F41A 2B5JA 3OL6A 3IM8A 4FN5A 3QSYB 1TL1B 2YX7A 2G2YA 3TA1A 2K1RA 3NHGA 2BRLA 3CCTA 3TI0A 1YZ6A 4CH1A 1H2TZ 3NOGA 1H3DA 1VQ4N 3G82B 4PKHA 2AGQA 1YAGA 2YHAA 4ED6A 2LP4A 2Y0SD 2X1BA 3HOTA 2LQBA 3P1GA 1N36F 3I0RA 2XNRA 1XBWA 1ZETA 3EEQA 1NJXA 2BTFA 2MLYA 3FNNA 2YKAA 2K7JA 4YB6A 2HHHJ 2WBMA 3CEDA 2DHGA 3OVSA 1TK5A 1BQMA 1N52B 3W5YA 2IVFB 1XNQJ 2HF4A 4OX9K 2ZNYA 3PHEA 1X5OA 2RQ4A 2XZWA 1VBKA 3CC2S 1GOBA 5DM7L 3FCVA 4JHDA 2DNHA 3S1TA 4KGXB 1TZ0A 1SJ4P 2AP1A 5FPDA 2YQ1A 5T7BA 1KVAA 2DGUA 5F8MA 1U8SA 2J7KA 1KD1O 4ZK7M 2I38A 2YJFA 3QBXA 4ANDA 4W5TA 3SK3A 2QTDA 2MLXA 2FQQB 3AA3A 4JKGB 1NU0A 1V9OA 2XG8A 5KG2A 1ULRA 1UJ6A 4JI6K 4NL5A 3OHBA 1W97L 2D74B 2ETJA 1VCTA 5HROA 1WC6A 4JKFA 5M2UA 3SPZA 4NXMF 5D3GB 3NS6A 1YHQS 3MN5A 3ZSYA 1B4SA 4J5OA 4KV8B 4KH0B 1H38A 4IQMA 2YPYA 3J7ZO 2H51B 4XPEA 5DM7Q 4IR9A 4F2SA 3AD9C 1Z25A 1QSLA 2WOMB 3HHEA 3NF7A 1IKVB 4IJNA 1VK0A 2DFEA 3L2RA 5AZIB 2HEKA 2OTLN 4CLSA 4Z94A 2VQEK 1R89A 4IFVB 3HX9A 4ZP9A 3CUNA 4JB8B 4QIEA 3LPYA 4AHTA 4HHJA 2M2BA 3O9RA 2DNZA 3WXKA 4EYHB 3AVJA 3IC1A 1X4EA 1SKSA 4FWRA 4CIOA 1GLDG 5DLGA 3NF8A 4X62F 4RTFD 1R0AA 4ELVA 2DGOA 4F4WA 1IG9A 4WE1B 3DM2A 3MZIA 3VGVA 2UVVA 3FZFA 4M5DA 4OX7A 4UOCA 1T6CA 4B1ZA 4E2FB 2F4VJ 1VK3A 2V51B 3G87A 3G6XA 2HFZA 3DOLA 1M5VC 4Y0FA 2YNGB 4JI2J 4B3SK 2RE2A 4I6YA 3BN7A 2OPSA 4C2MA 4OHWA 2NREA 4PEOA 3G8SA 2WRMA 2HSTA 3JQMA 3VALA 1VQ5S 4M3YA 2CPFA 2QG9B 3GIRA 5KT4A 1QQOA 1U2VB 3QEVA 2DY9A 2QWRA 3CMAS 3M9OB 3THPA 5DQGA 2XC9A 3A8JA 3V9ZA 3BO2A 3PO5A 4ZLNA 4BR9A 3A8EA 1ATNA 4JI7F 3VQBA 5GAGU 2B4PA 4F04B 2YNHA 4Q0BA 1HBUA 4WFYA 4PHTX 4TQSA 3NMAA 4KPCA 4TNOA 4PCQA 4CERA 2VASA 1EARA 3QATA 4ED4A 4JK8A 1W2BR 4WKRA 3P96A 1XQSC 3KWIA 1XMOF 3US5A 2ALZA 2DB1A 5D6GA 1WBDA 3TVZA 1QJHA 4NYNA 1KDNA 2LQJA 5A6PA 4BR4A 2X51A 4O0NA 4AHUA 1Q79A 2N3OA 1L3VA 2XYPB 3ZYYX 5J2NA 4RCHA 3DU5A 2RUGA 4N56A 4MO4A 5GAHI 1FXLA 4M5KA 2FY1A 3S3MA 4FK0A 5LMUF 3VEYA 3CW2C 4A8SA 4DQIA 2CUYA 3R5GA 3D2FB 2IDEA 3NWGA 2KG0A 3TO8A 1CJKA 5KFJA 2G8WA 4GV6A 2FHOB 3ILIA 4FWPA 5CA5A 5H9FK 4LQ9A 4DV1J 3LPTA 1IBMF 1RWNB 2FF3B 3VVTA 3VN5A 3GCWP 1H6KX 4ILJA 1GAOA 4JV5J 1JLQB 5FLXU 5J2PB 4DR1J 1R8HA 2RF2A 3GYXB 1DY3A 4FJLA 4NLPA 2HQFA 2YH1A 2GAHC 3K5PA 4F02A 1FCAA 3IMQJ 1S0MA 3DXMB 4CTAA 1NCLA 4C9DA 5L1JA 4YHHJ 1SV5B 4CZFA 3C16A 1JLAB 3GQCA 3O5BA 3EN9A 1X4AA 1RWOB 4BACA 3DGPB 4H0VB 5DM6Q 4DQRA 3L95X 2E7VA 1BIUA 2GQ2A 3NL0A 1JCFA 1PYOB 4CJVA 4DTOA 4FK2A 4RW9A 3MPDA 2NRZA 1PJ6A 3IRXA 2F7VA 2MSSA 5K8NA 3CMES 2VC1A 5BYRA 5ELZA 2HBLA 3RGIA 4UUWA 4FJHA 2DR6A 4MT1A 2JEIA 3KMSA 2CKWA 3UDVA 4GVBA 1Z05A 5DLFA 4Y00A 5M1QA 2KM8B 4YB5A 2VICA 1FX4A 1SIZA 3MGJA 1S1XA 2J0WA 2Z58B 2MZTA 2BUNA 3RRHA 3OR1A 2BJ3A 2DNNA 4CNYA 3O8MA 4Y65A 2DH9A 2HBZB 2QGFB 1GEHA 2IFXA 3KVGA 5DRKA 1YK9A 1U1OA 2KQ2A 4DQSA 1W0HA 2FHKA 3OUYB 5KFVA 3C6TA 2ZJPL 1RYRA 1L5UA 4LF9K 1WHYA 2IJNA 1QTMA 5C12A 3QRPA 1RILA 2M8DB 3CC4N 4IO1A 5E3RA 5DMRA 3VQPA 4PYAA 5A8KA 4MIBA 1BCMA 4QYRA 2UUBF 4E7JA 3CCLN 4B1XB 3R7BB 3CCQN 2ZC4A 1D0EA 1QTNB 1B7YB 5J2QA 3OSNA 3UI3A 3RB6A 2W7AA 1LQ9A 4RW8A 4GV9A 2UXCF 4KHWA 4N41A 4YS2A 1MWQA 1E6VA 4I2PB 1A9NB 2V6AA 4CO1A 1NB2A 3R8YA 3AV9A 2ASDA 3ZEUA 4V19S 3PJWA 4LBPA 5KFZA 1NKCA 3UDCA 4QS7A 2NPIA 1Z2LA 4DCPB 2RDIA 4PG6A 1HYSB 3PX4A 1TKXB 2ZJPQ 5EHHA 4CBWA 3S9HA 2NUBA 1XC9A 1T0TV 2AYGA 1W26A 3KUHA 2NCKL 2C2ZB 1E6YA 2FY8A 1UKUA 4DV0J 2J7UA 1VQ7S 2MQLA 3V81B 3IR7B 5GAHU 4WFNL 3NE6A 1YQHA 3DMJB 4M5IA 2J0QD 1ITPA 1M90T 4FJ5A 3AQOA 2KN4A 1TVRB 3LOUA 2D69A 1TV6B 2WVBA 4J9PA 4IKFA 3SCXA 3R5DA 1WEYA 5DG8A 1HNVB 2MKKA 4DFPA 4DS5A 2RS2A 2QI2A 3V4IA 1AUDA 2CNNB 1MMLA 4OYMA 2CNKB 4KB0A 2MY8A 4H0PA 1KFDA 1DTQB 3ONQA 4U7CA 2X6SA 5E3CA 1J27A 4C0BA 3GJRB 2ZOMA 4D3GA 2IVMA 4WFAQ 2EFOA 3IXQA 4LRCA 1YIJS 2ZJRL 4CF2A 3PW0A 4ZVGA 3TANA 4MLEA 1XI1A 5A2QO 1S6OA 2O8CA 4LFCJ 1L3SA 1WWHA 3QAEA 5L1LA 4CH0S 2KXNB 3UFCX 2NRWA 3BV8A 2XY8A 3QIOA 2RUSA 1CVJA 2EFNA 2HGNA 1GMWA 2WSFC 1FWPA 4UQGA 3Q24A 3AO5A 2HHWA 1V6HA 2ZWOA 1CJVA 2G0IA 4H5NA 2H3GX 2WZ1A 4CF1A 1T9WA 1BWVA 4DV4J 3IS9A 4HTLA 3CFRA 4IQXA 3TZWA 3LTOA 3B6PA 4ZKAA 1NGDA 5I42A 2RHKA 1VRUA 3ZX0A 2VA2A 3TRGA 1QVGR 4BE1A 4TYBA 1UVNA 4K4VA 4UQTA 3G8TA 1TUWA 3CO9A 5KPTA 3IWXA 1L3KA 1GMVA 3FC9A 3H0PA 1NOZA 4UTGA 4N77A 5KFNA 5ETVA 1HBNB 4JNEA 3KK3A 1Y7PA 3OHAA 2VGNA 1YI2N 4ECSA 1GNKA 1S1UA 2PGCA 3W7BA 4TY9A 3F73A 2VG6B 1DFDA 2VBXA 4TYAA 3MF5A 2I2YA 3GG1A 4ZVRB 1NZAA 4JI5F 1WLJA 2DCLA 3CCUS 4CZGA 4CH7A 2UUCK 3FEZA 1LWCB 4K41A 3MUVP 2XRIA 2QL7B 3OYCA 2B5JB 1HJOA 2DGSA 1VQMS 1VQPS 2PDAA 3BP8A 3DAWA 4IRCA 1WTFA 3WEEA 3B78A 3GB0A 4DR5J 4A8MP 5CABA 2FC8A 1UWAA 3TWHA 2K1RB 4CGFA 2VCPA 4DU4A 2P5OA 2RPIA 1KHWA 4F4ZA 3R5CA 1VR6A 5FLXY 3EGVA 3NRBA 4X64K 3OYEA 3NP5A 2IY5B 4Z0UA 1ICEB 4M5HA 2ERRA 2B9WA 1C0MA 1S49A 5AQPA 2DRBA 1YJVA 4ISEA 3CCSS 3M8RA 2IRXA 2GWJA 2DRDA 4OHZA 4C8MA 1M0SA 1ZBSA 4PY5A 2D7SA 1N6QB 1H1VA 3MXJA 3VQ5A 3ZZZA 4DPOA 4CGJA 2Y3YA 3N6MA 4M3ZA 2UU9J 3OYIA 2NZ4A 2MZRA 1ZM4A 3U3GA 1F2GA 2FJAB 2EHGA 2OA8A 2RHSB 3D66A 3G9CA 4JHDB 4WTYA 2J6SA 2F63A 2NRHA 3TOQA 4F7VA 1WN7A 4AQYJ 3KKRA 4K59A 4XEIA 1VJWA 2CQPA 5EWGA 1WC0A 1NKBA 4PXCA 3SQ2A 3LZJA 3R1XA 1SKUB 2HS3A 4W5RA 5E84A 2GJFA 3FR0A 1S77D 3AVAA 4ZVQB 2ZM6K 5KT6A 1O8BA 2UVUA 4DV5K 1U1NA 4USTA 1VSHA 3EICA 1W25A 1CQNA 1IQZA 1GT8A 1S1TB 3H1VX 1MMNA 2HGMA 4LRFA 4AT1B 1OJ4A 3UW1A 2KO1A 5J1EA 2HS4A 3WC0A 4RUBA 1LW0A 5K14B 5JJBA 1B3TA 4HT5A 4YR2A 2Q0RA 4BE0A 3H2VE 3QFHA 2IMOA 4N8NA 2X7IA 1IG8A 5AQFA 3GE1A 3V4MA 2ZH9A 1CS4A 3DLGB 2NXCA 4F67A 1I1GA 2VF3A 3QT7A 2XS2A 3KJNB 1JIHA 3MR2A 1Y3JA 1P27B 2ZJQL 5C25B 1Q16B 5EVZA 3LANA 1KC8T 4CJ4A 1RAFB 1UOCA 3Q89A 2KYZA 1U0HB 1NK4A 3VWSA 1XMQK 1R0AB 3QSIA 2ROPA 5ETLA 1YVUA 1Q7YO 4PWUA 3DM2B 3QJJA 4M5DB 4CD3A 4NYPA 5F1XA 1RT2A 7AT1B 5KQ8A 2FBTA 3QEPA 3DOLB 3VZHA 4DQQA 2DNPA 3J7AN 1BLUA 3FBEA 5F8JA 4J7CA 3PYEA 4RX6A 2OPSB 4USVA 4CJSA 2COLA 3MPWA 4PPDA 3OYMA 3G4SN 2DPNA 3SQ1A 1CXQA 4CGHA 1RT6A 4JS4A 3JS6A 2FDNA 4YFUA 2E5LJ 4FLUA 2LYVA 3Q8PB 1RDDA 3I5AA 1SC1B 3P5BP 2BR0A 3Q7BA 2ZJQQ 1WHXA 4UZCA 1EB0A 4DFJA 1H2VZ 1JL2A 3M8PB 5T41A 2FIUA 1VC6A 4IG3A 4I69A 2OANA 2EG2A 3IAYA 2AMCB 1OVQA 3WNFA 4KR0B 2YNHB 1BL3A 2F8MA 3EX7B 1JK9B 1U6FA 3R5AA 4HDHA 1RABB 1NM2A 4DHVA 5EX0A 3RB3A 3VAGA 3V6KA 4LC9B 3TUJC 2PMWA 4K0KJ 1HHTP 1GMUA 2ADBA 3CF5L 3FEXB 4DV3F 1F21A 2A41A 2DNKA 3CDBA 3P49B 2HZAA 2EKNA 2HFSA 3OYDA 5J2NB 3BSAA 5HVHA 5AQZA 5L39A 4FCYA 4U96A 4DPYA 2Y0BB 4LFBK 1HKBA 2QSFA 3CCVS 1TKTA 2EBGA 1VQOS 4DTPA 3QGHA 4BG8A 2PSZA 3E66A 3D6FB 1QS4A 3VEWA 1JCEA 2LXFA 4MLHA 2FBXA 3PX6A 5LSLA 2APOA 2HHPA 3LQVA 2AEFA 3IFEA 2U2FA 2QJ3A 3BKFA 4BROA 4DF8A 4FF4A 2ACMA 2E1MC 1Q7LB 3TTFA 2GX8A 2P8IA 1WOQA 3R6LB 1ASVA 3OXFA 1OPIA 2JDJA 5DZ7A 1I51B 3C0BA 3JYTA 5B0GA 4BDPA 1K47A 2NZTA 1HD1A 4FOEA 3ENOA 2F40A 1RBTA 5C42B 1FE4A 1HHSA 3NVKA 4CTAB 5DQIA 1P9YA 4BRFA 2V7ZA 1RT7A 3DHWC 4DTUA 3BF1A 4M63A 2GAGC 3O9QA 4ZMMA 1N0UA 4CRJA 3AGRA 5KFOA 4RW9B 3VMFB 3I5BA 2GVDB 1D4XA 3TR5A 1FKPA 4LF8J 3VGTA 3DYAA 3R3LA 3BSCA 3OL7A 4J2AA 1EKEA 3HSJA 3M1FA 1ZBIA 3TW0A 2Z0GA 2YWHA 2UU9F 2JRSA 5KGWA 1SH0A 3C7NA 1HW8A 4I6MA 2UUAF 2ZVIA 1MN9A 4CJFA 4CK3A 4LH4A 3M7VA 5IM0A 4ZHRB 1YBUA 4OPAA 4BRHA 4LQ3A 3MM6A 3GBTA 1APSA 2R7TA 3G10A 4OLBA 1HNXF 1SVDA 3ZNUA 3SNNA 3CHWA 2OPPA 3OR1B 4UY85 3KD1E 3O9SA 3RW6A 4A8KA 3QFUA 3T5KA 3OXGA 1RB0A 1QM9A 1SL1A 1YBAA 2FD2A 5A6WA 2RE1A 1JNRB 3FUYA 4K43A 1N34J 4NO7A 1NO8A 3L2WA 4NXNF 3C6TB 2QLBB 1WI6A 3EXCX 1BIZA 3G6VA 2V4RA 3G96A 5E41A 4OYBA 1IBLF 4FXDA 1UA1A 1B92A 4OZ2A 1X5PA 5ETTA 4KHNA 2QLWA 3MK6A 3CD5A 4Q45A 3CM5A 3QMQA 4NMXA 2NYIA 2W01A 3KHGA 5LMNJ 2E9TA 2DPJA 1UJ5A 3N4PA 4FJ7A 1FFWB 1RISA 5J2QB 1KTVA 4CZHA 1TKZA 4RW8B 2JFDA 2PBDA 4OKEA 3ILOA 4LR7A 4OI6A 3W1YC 3D2EA 1XHZA 3CCLS 3GFHA 3C65A 3K5OA 4TVAB 3L3VA 1C1CA 1ZS6A 3KJFB 3FVYA 2Z2LA 2Q0UA 1S76D 3QESA 2I8EA 4P2SA 2DGTA 3G6YA 5L9XA 1E6YB 5KOWA 3QPIA 4ZJQA 2UXBF 5GVQA 1RHRB 1XEZA 2V8DA 4JRQA 2V4QA 4QJVA 1HI0P 4I7FA 5AQVA 3EVWA 3Q23A 1XIQA 2V8GA 2VFTA 3T1HK 2LA4A 3MTKA 4B3RF 3RBEA 2VOPA 1QE1A 4JI3J 2KLAA 3V4IB 2V67A 2NXEA 3EE3A 3R7NB 1R43A 2IIHA 2DH8A 3CJ3A 1SC3B 4Q8FA 3CJ9A 5ETPA 4URSA 2G8UA 4K4XA 3H7HB 4CFAA 2Y9HA 1I39A 1UVJA 2DBBA 3HP9A 3LALA 5B7WA 4RG8A 3PCOB 1MSWD 3B4MA 3QLHB 1IN0A 5F9NA 3SDEA 5KT2A 4H5WA 2O8CB 2J9DA 3FZBA 4DPTA 4N5SA 1UVLA 4NRUA 4WYLA 2D0BA 2D9PA 1U26A 2NSCA 3MEEA 2E66A 1CJVB 1GH8A 2DHAA 2X78A 5DDRC 2DNRA 4ZVTB 2A6MA 3BN4A 1NXIA 3JSBA 3T5JA 4CJQA 4L8RB 4B3MJ 3IS9B 2QMXA 2DISA 5F8GA 3T69A 3LZIA 4LSNA 1MLAA 4ETZA 1X1PA 1TR0A 3M1VA 2HURA 2HLUA 2UYTA 2VC0A 4O3SA 2B4JA 2VQFJ 2IIRA 4CEAA 3GSDA 2MHEA 1OH5A 3MR6A 4DHYA 3H2LA 2DGVA 4E7LA 3QFPA 2M9KA 2XULA 4CW7B 2GIQA 1TUUA 3KK3B 3JAMO 2VIHA 4JI1F 1S1UB 2XHWA 4ES1A 3T5LA 1RHKB 1JJ2M 3BKUA 2GNKA 3O1LA 2A40A 2V4JA 2XO7A 3KNGA 1TMMA 2MKSA 4AFFA 4EBEA 4X4PA 4CYUA 1HHQA 1K44A 2ZH4A 3VHQA 3HKZD 1AUSL 4DR7K 1XNQK 4DV6F 1GK8A 3EDQB 1HBMA 3CYMA 2MJNA 1EQYA 4PWDA 1FJEB 1QQCA 1BU6O 3KLHA 5HN0A 2GJ2A 1RT4B 2ZC3A 3GIKA 1NNEA 3WQTA 1NSQA 4E98A 4CLUA 1HW9A 3W8PA 4IOAL 4EWTA 5K5MA 3CI5A 5KG6A 1FFSB 2RRNA 1RWUA 5FD1A 4ZCKA 4CI0B 1KFSA 4RUHA 4KB1A 3TEGA 3L3CA 4OQJA 2D0OA 1UAXA 4KI4A 4JAXA 1RAAB 2DRAA 2E7XA 4FWQA 1Z6RA 2GGPA 4RO0A 1SXLA 1JKHA 4UOFA 4NA1A 3KK1A 1ZZFA 1CQMA 2BJDA 1EZZB 2EC0A 3FQLA 3ADAC 4AF1A 4TU8A 1BO5O 2J76E 3T1YK 1N5VA 5AFUH 3DI6A 1MROA 1HNIB 3I0SA 5KGXA 1GX6A 5KG3A 4K50A 4IOAQ 4ZJLA 4IG0B 2DGQA 3VGUA 1N33F 3W2WB 1FD8A 1M1HA 4L3QA 4XTTA 1B7FA 3K0SA 3KYLA 4WZMA 2VL1A 4QW8A 4RLEA 2R2SA 1TL7A 2MKYA 3U02A 4M95A 4AXJA 4HYKA 1CLFA 1T44A 2L41A 4ED0A 4ZA1A 3PIOL 3Q8RB 3HT0A 3MUTP 5H1SQ 2X3DA 3CIZA 1PYTA 1X60A 3CCES 1GQEA 1G2EA 1EP4A 3CDWA 1V3ZA 4HT7A 5HOOA 8AT1B 3ISNC 4X4RA 4R0EA 1HR0F 3FCHA 4UOGA 5LM7E 2VYPA 4ENOA 1NDPA 2CQCA 3D0HE 2F4VK 5J1EB 2DIUA 2QA4N 4YR3A 2WVCA 2QWQA 4PUOA 2VH7A 3OS2A 2FVSA 4JI2K 2G2ZA 4JLHA 2K3KA 2P6SA 3G8QA 2XGQA 1CS4B 1EQMA 5AQLA 1VLYA 1OH8A 3AA5X 3JSRA 3FFKB 2QE5A 3UN2A 3UDLA 4OV6A 4FWSA 4CGDA 4ZITA 2R7WA 3J7AP 1RLCL 3OR2A 1KHVA 2GFFA 2HNZA 2DEJA 3PIOQ 3WQUA 1XNRJ 2LQ9A 1YRXA 5J1PA 2AD9A 1X7VA 3AD8C 4NLQA 2KZZA 4JI6J 2QXLA 1RT2B 4EP4A 4OPKA 4H0XB 3M9MB 4NLXA 1EIYB 3BDEA 5BYQA 5CZVA 3UKUB 3LF0A 4ECQA 1SI9A 1BHLA 2RMLA 4OPHA 2WONB 3P4UB 4IEEA 3RR8A 3QINA 1FNMA 3MWBA 1RT6B 2F9WA 1IV0A 3NY0A 4K2JA 3PEHA 1U2RA 1KD1T 2W6KA 4X65J 1F6TA 5JMNA 4W4MA 3DOMB 4BR7A 4DR2J 3AT1B 1NU4A 3Q83A 1J5EJ 4JI8J 1NAQA 1J9AA 1URRA 3DRPA 3PEJA 2ALYB 4QYZK 5FPNA 4CZIA 4JN4A 4IOCL 4HUEA 5JMVA 3R5JB 2KRBA 4Y2CA 3J7ZT 4BRDA 4C48A 1N54B 2W8KA 2JH3A 2F8HA 2LU1A 4CLFA 2J4RA 3J81O 4FYDA 2IA6A 4DL3A 2LEPA 1UP1A 2E7WA 1P8GA 1ZM2A 4W92B 3LPUA 2KYXA 1WELA 2FJBB 5ETQA 4DR1K 4LT6A 3TNVA 1R8AA 4LF4J 4ZPWR 2B51A 4CM0A 4I9LA 4ID5A 3VAFA 4USJC 4FJXA 4BY9C 3KHYA 2FXUA 3O3HA 1F9EB 5BR8F 4YHHK 1OMSA 2KG1A 1RT3A 3HLUA 3MHYA 1JLEB 1QVFM 2B7BB 2Q2RA 4GKKK 4MTPA 1LOUA 4ITSA 3C46A 4CDIA 2F4FA 2R7UA 1WNEA 3A5OC 2IBOA 1K0VA 2D0PA 4JI0K 3VF0B 3M2VB 5HQ8A 1FNXH 3GV7B 4FYVB 4BRGA 4RUAA 3CB4A 3FRZA 4QIWD 3BO3A 4C11A 5JXSA 2HFOA 2ASLA 3NF9A 3OTEA 2OZMA 3CIPA 3JYTB 5I9EB 4YN3B 4CVNE 3UNYA 1VQYA 2A3ZA 1DARA 3IR6B 3RMDA 1RCOB 5A8WA 1TL5A 3PR5B 4PWWA 4CHYA 4KTWA 3I5CA 3O3GA 3PLAA 1Q78A 2Z57B 4J91A 4DV7F 3BYPA 3BO4A 4LVNP 3U1MA 4ECVA 5LJ3Y 2ZHBA 2IOCA 1KAYA 2P9NB 4G1PA 1FKPB 4QIGA 1J5OA 1MWYA 3DYAB 4CBXA 4H0YB 3BQ2A 1S3XA 2KT3A 2KM8C 5A8RA 1LOTB 2CAJA 1WSIA 3FZLA 4OGCA 3M8ZA 4AE5A 1NH8A 3L6QA 4V1Ak 2ASPA 3C7NB 2HQ3A 1S9EA 2XQCA 2YBVA 3VENA 1HWIA 3T6BA 1S59A 3IGNA 1QUPA 4RBVA 2W4PA 3EVMA 3HDSA 3KLEA 3EM1A 4CLPA 2OPPB 2IVPA 4M5NA 3HMJG 2VJUA 5IWAF 1VQ6S 1RDAA 3U8XA 3KJVA 2IJFA 1NGCA 2O8EA 3MDFA 3OA9A 1E3MA 2Q43A 4OFZA 2BYCA 3VF4A 2XMKA 1BQXA 4BR0A 3ZTPA 2NUHA 2HBKA 1U04A 3FSYA 4K2XA 4QU6A 4ZCLA 1FESA 5DJBA 3ULEA 2DYAA 1U0SA 2XWXA 5KFWA 4FVUA 4O0IA 4M41A 1D8YA 4DV0K 5E26A 4J8FA 4KRFA 1N5YA 1Z4UA 2EG1A 4HEA9 4F3QA 3PKYA 1B0TA 4YNQA 1FKAF 4Y2AA 2BW2A 4MDBA 2C42A 2Z1HA 4H54A 3QO9B 3JXUA 4N76A 3D2EB 1GX5A 2GBZA 4C0OC 4OX9F 2MZ1A 3S3N