1JLGA

Crystal structure of y188c mutant hiv-1 reverse transcriptase in complex with uc-781
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
538
structure length
529
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 132
structure length 529
sequence length 538
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlgA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlgA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jlgA05
3MFIA 4O4GA 2FJXA 4E7LA 4DTXA 2JLEA 4O3PA 1L3VA 1O1WA 5HRRA 2RN2A 4CEAA 5CYQB 5KFTA 4CFDA 5DMRA 4IG0A 3BDPA 4FM1A 4E19A 5KRSA 3L2UA 2E6LA 1FK9A 3QIDA 1VRUA 5L1KA 1RA6A 4ZVGA 3BGRA 3M8QA 3QETA 5J2MB 1RBRA 5KFDA 4DU4A 4CIFA 1S1XA 3I0RB 3LAMA 1DTTB 4E7JA 3IS9B 1C1BA 3GIMA 1T94A 5KG6A 3O3HA 3TI0A 1YVFA 1ZBUA 4MIBA 3TQ1A 4J9SA 2QK9A 2FLPA 1ITGA 4NCGA 4ZMMA 2X6NA 4FLXA 3OS2A 2C2RA 1HYSB 4CHNA 2IM0A 3DRPB 3GIJA 5KG4A 4O3OA 5HRNA 1JKHA 4ZVFA 4C8NA 4CK3A 2G8FA 3OL7A 3ZT1A 3HXMA 5HLFB 4B08A 4FS2A 1K6YA 1LW2A 5KFOA 3L3VA 4NLGA 4M3WA 3GV8B 3EZ5A 4LSLB 1LWCA 3AVGA 2DPJA 4KO0A 2C2EA 1TQLA 4CJQA 1HNVA 3QLHA 1QE1A 1RT2B 1DLOB 4B9SA 4CF9A 1C2PA 4LSNB 4IG0B 4N76A 4DTSA 1SUQA 3ZT4A 4F3OA 3P1GA 3PHEA 2KZMA 1TVRA 4CEQA 3PJXA 5KFHA 1Q9YA 3IG1B 1U47A 1JXEA 3V6JA 2IDOA 4LH5A 3RMDA 3DDKA 3SFUA 1J5OA 1VSFA 4H4MA 4CFCA 3EY1A 3DOLA 4Z4FA 1JLCA 3CIZA 1QAIA 2HB5A 2WOMB 4DG1B 2GIRA 4ECRA 3OSPA 3LWMA 4URGA 1JXLA 3O4QA 1OS5A 4IFYA 3PW5A 4W5TA 3SJJA 3RB3A 4K4ZA 3NF9A 4KHNA 2AX1A 3VQSA 5KFPA 2DFHA 4M42A 3DLEB 3KK2B 3VQBA 1LAWA 1R0AA 5J2NB 4I9QA 4CF2A 3AA3A 5KFNA 3FQKA 3K5OA 3H08A 4RNNA 1BISA 1Q9XA 5C5JA 2DFEA 4EZ9A 4DFPA 4KO0B 4FW2A 4N5SA 4DG1A 1BQNA 4OLAA 1RYRA 3HK2A 1QE1B 2YNGA 5J1EA 2IBKA 1XC9A 2V9WA 4ECYA 1YT3A 1T05A 1S1XB 2HNYA 2QV6A 2R8JA 2OPPB 2GV9A 3HKWA 1LWCB 3Q8RB 4QAGA 3V1QA 4RUAA 4O55A 1RBTA 4IKAA 4KFBB 3OSNA 1X9WA 4GC7A 2YNIB 4J9KA 1DTQA 4U7CA 1WNEA 3FRZA 4K4VA 5T14A 4F50A 1YVUA 4M3ZA 2RDJA 4EP5A 2R2SA 1U09A 4F4XA 1JLGA 2IJNA 1RTIA 4E3SA 1IKWA 1C0UB 2OPSA 2KQ2A 1EXQA 2LSNA 4DSJA 4M95A 1BI4A 4LSLA 2C2DA 3KOAA 2D0BA 3DLHA 4Z4GA 1RTDB 3F9KA 5D3GA 4CJFA 1CSJA 4BE2A 3T5KA 2HMIB 1SH0A 2ZD1B 4Y2CA 4CF1A 4IFVB 4EYIB 4WYWA 1D9DA 2YV0X 4DL2A 3L2QA 2B5JA 3TABA 4Z4IA 3CJ2A 1GOAA 1KTQA 2OZMA 4O4GB 2V4QA 4ELUA 2ZKUA 3KHGA 4CGFA 3MXMA 1HYSA 1NK6A 4DFJA 4EO8A 1JIHA 3LZIA 3C6TB 3BREA 3DI6B 3HHKA 4ZPBA 3ALYA 2KTQA 3RB0A 3OY9A 1HYZA 3MEDB 4CESA 3M9NB 3KKSA 3RAQA 4NLQA 5DLGA 1FXXA 3QEWA 2AWZA 1RILA 3QYYA 4FLZA 2HNYB 3RMBA 4PQUA 3M8SA 3SQ2A 4K4SA 4KTWA 4KB1A 4J9LA 1VK0A 4R0EA 1D0EA 4WZMA 4ZP7A 5KFQA 1IKXA 4FJGA 3A2FA 3GYNA 2G8UA 1NJYA 1C0TB 1EP4B 4KB7A 3HL8A 4DLEA 3KLGB 4KV8B 2E6MA 4QWDA 1JX4A 3WNHA 1KCFA 1D1UA 3KK1A 2HHSA 4MFBB 4NLRA 4FBTA 5KFIA 2Z1JA 4R8UA 3ZT2A 3PW0A 3OJUA 1MU2A 4ZVHA 3AO3A 4AHUA 3HP9A 1S10A 4JV0A 1S1WA 5I42B 5J2QA 4NYNA 4PUOA 4ID1A 1HMVB 2G8HA 1TKZB 3AVCA 5J2PB 4ECTA 4H4OA 2AU0A 4KKOB 4CFAA 3PW7A 4ZP8A 4NCAA 1ZBHA 3ITHB 5HRSA 3ITHA 5KG0A 1IKYB 1W9HA 3CJ0A 3CWJA 4JS5A 4QWCA 1S49A 4QW9A 1WSIA 2OYQA 2R2TA 3QIPB 4DSFA 4ZPAA 4LD0A 2IC3A 4UQGA 3CDUA 1LAVA 1YTUA 5J2NA 3V1OA 4F4WA 4G3IA 3DLEA 4J9NA 2D5RA 1XR7A 5KFKA 5KFYA 2R2UA 4M3YA 4PA1A 1JLQA 5KGWA 3FDSA 3K58A 1J54A 3H5XA 3U3GA 4OGEA 2CKWA 1TL1B 1RT6A 3ZCMA 3IS9A 4EZ6A 3QO9A 5C25A 5DLFA 1IKYA 4QCLA 4NLSA 3AVKA 2R2RA 2BANA 3DLGA 4NLUA 1UA1A 1TKTB 5L1IA 2IJFA 3AVMA 5JS1A 1QSSA 4MKAA 4Y2AA 3OYIA 3CFRA 1BL3A 2WHOA 5SWMA 3TAQA 4KAIA 4JRPA 2D7SA 3OYBA 3VQ4A 3DRPA 4CJ3A 1NK7A 4DL7A 4DSIA 1ZETA 3NCIA 4R8UB 3V9SA 5C24A 3CFOA 4ID5B 2FBTA 3V6HA 4TYAA 4MK9A 1S1UA 4XPCA 4XIUA 3HVTB 1RDCA 3OHAA 1VSKA 5HRPA 4CIEA 3QZ8A 3AVBA 1FKPA 2HWHA 1B9DA 4IOBA 1JLBA 2HNDA 1FK9B 1JLQB 5KFCA 1Z26A 3KMSA 4EBDA 3V6DA 3LP3A 3CDWA 1KVCA 4RG8A 2VG5B 3RB6A 4FM2A 3T5LA 1BCOA 1WSGA 4Z4HA 2AGOA 3E01B 3NBPB 2EX3A 3HT3A 5JUMA 3V9ZA 2XC9A 2JC1A 4DF8A 4YMEA 1N5YB 4J9PA 2Z1GA 2IGIA 5KGXA 3ZSQA 3QEXA 4GVMA 3QINA 4ICLA 3HVRA 4MKBA 2E9RX 3V9XA 4G1QA 3NF7A 4B9LA 1ZBIA 4E89A 5CYMA 1J9AA 4FLVA 5KT5A 1TK8A 4ZP6A 4HTUA 1TKXA 2XGPA 4TQSA 1G15A 4XPEA 1SL1A 2WOMA 4HYKA 1S6PA 4F8RA 2WK4A 4I2PB 4JV2A 2FVQA 3U6FA 3MECB 5CZ1A 2Q3SA 4C8OA 1N4LA 2VWJA 4YNQA 1VRTA 4CGIA 1ZTWA 1I3AA 1T03A 3AVJA 4EO6A 4ECZA 1JKHB 2BRKA 2VG5A 3IG1A 5EUHA 4OVLA 3KHLA 4DTMA 4LY7A 5L1LA 1KLNA 2Y1JA 1HMVA 3B6OA 5J2QB 5I42A 4J2DA 3KJVB 2E9TA 3MEEB 3U3YA 1C1CA 4CGDA 1KVAA 1U45A 1U49A 3JSMB 3KD5E 5J2MA 4QPXA 4E1NA 4K8XA 4WFZA 3LP1A 4B9NA 4I2PA 4Q45A 3P83D 4FVMA 3KLHA 1TKXB 1L3TA 3KHHA 3LZJA 1S1UB 3SZ2A 5I3UA 3AA5X 4L8RB 3LAKA 3OL9A 1IKVB 2XY5A 1HQEB 3SUNA 1HARA 3GILA 4C8LA 2WONB 1ASVA 4ED2A 3PO5A 2RF2A 4TSXA 4E7IA 4URSA 3QESA 4DSEA 3KLIA 4YP3A 4FJ8A 4NLPA 4FZZA 1KFDA 4YR2A 3G10A 1GX5A 3GQCA 2XCAA 3BR9A 3THVA 1QTMA 4HVJA 2UVWA 1RT4A 1HPZA 3NAIA 3TARA 2B43A 1JLFA 3H5SA 1S0NA 4CERA 1EX4A 4M3UA 1LW0B 3NH0A 4GMJB 2FVSA 1RCHA 3HPHA 3MECA 1WSFA 2BQRA 2OPQA 2DFFA 4FLUA 2IM2A 3CM6A 4CJ5A 2QXFA 3V81B 3RRGA 3V81A 2YNHA 5HP1B 3OYAA 4EBEA 4B9UA 3TAFA 1IH7A 3OHBA 1R0AB 2XI3A 3KJVA 4WZQA 1VSDA 2BGGA 3C95A 3UIQA 3QEPA 3G0ZA 4B9TA 3SQ4A 3HPGA 1SKRA 1RT1B 2JEFA 3C94A 3K5LA 4FJXA 4F2RA 4DMNA 4CJRA 3DM2B 1WNSA 1REVB 1TV6A 3PJWA 3VQ8A 3CJ4A 1NK9A 1RTJA 3VQ5A 1K1QA 4ZTFA 3M8PA 3DRSA 3DRSB 3ISNC 3QGHA 1HQEA 1D9FA 2F8EX 2R8IA 2D0CA 3ZT3A 2O4IA 1FKPB 3OL8A 5KFUA 1HNVB 5F8IA 3OS0A 4DWIA 4KBIA 3ZSOA 4KE5A 3NF6A 4CEFA 3H5YA 5CY4A 2WB4A 4PWDB 4J9OA 2XY7A 3T3FA 3EZUA 3RBEA 4DTPA 4H54A 4ELTA 2YNFB 1ZTTA 3DYAB 2D3UA 2VA2A 1UWBA 4NLTA 2ITGA 2HHQA 4K4XA 5DG9A 4O3QA 4DL6A 4LH4A 4B9VA 1RT5B 3BJYA 3DLBA 3LWLA 1S9EB 1S9EA 4FLYA 1UAXA 5DQHA 4KSEB 3RWUA 2J6SA 3I0SA 3VQPA 2E9ZA 3G86A 4NCGB 4WXWA 4M41A 1IKXB 4CJEA 2YHBA 3VA3A 4QWAA 1NJWA 2GUIA 4FK0A 2KFZA 2IS3A 4MIAA 1A5WA 1Q8IA 3MXIA 4Y1CA 4KTZA 2JEIA 4AHCA 4CEZA 3JYTB 4YR3A 3O3FA 3QERA 3JYTA 3DOKA 4WE1B 2XWYA 2BE2A 3PO4A 4I2QA 3M8RA 1TVRB 4DU1A 3AO5A 3OYDA 4W5RA 2FC0A 3F73A 1JL1A 2WCXA 3IGVA 1ZBLA 3DLRA 3RBDA 4HUFA 3SUOA 3LANA 3ULDA 2J6TA 4CGGA 2XO7A 1XHXA 5KG1A 3Q8SB 2HWIA 1BIUA 3T5HA 4EP4A 1SKSA 4DQSA 4IKFA 3TWHA 4O0IA 3MAQA 1EP4A 3L2RA 2A1SA 4CGHA 4CGJA 1RTDA 3KIOA 4DS5A 4KHQA 1SKWA 3TAMB 2HNZB 2ZD1A 1I6JA 5HP1A 5EWFA 3FSIA 4ECVA 3RR8A 4CF8A 2J6UA 3AO1A 4JRQA 1RA7A 1T3NA 1W25A 4KHWA 1TKDA 3NAEA 1LWEB 5HROA 4RW7B 4DS4A 4Z0UA 4F3TA 4E1MA 1KLMB 4RW8B 3KNAA 3TANA 4DFKA 4YR0A 2D41A 1JLFB 3D5MA 4FW1A 3MFHA 4EEYA 5KRTA 3OYNA 4N41A 4M3TA 2WTFA 2G8KA 3IAYA 3IRXB 2OPPA 2O5DA 1HNIA 5F8MA 1RYSA 2E4LA 3RRHA 1NKBA 5F9NA 5K14A 1DLOA 3LP0A 3ZSZA 4Q44A 3SCXA 1S6QB 3DLKB 2UVVA 2YKNB 3TAGA 1KVBA 4HCBA 2NUBA 1TKZA 4W5QA 1RTIB 4K4UA 2IM1A 4RZRA 1L3SA 1Z4UA 3PVXA 3CJ3A 1RT5A 4MH8A 3PR4A 1NJXA 2DPIA 4OKEA 3NAHA 2PYLA 3MEGB 3SPZA 1D5AA 2GC8A 3CO9A 1LW0A 1RT7A 1SH3A 3UQSA 2OPRA 5F8NA 5EWGA 5FRNA 1C1BB 3WNGA 1XWLA 1RAJA 5KT4A 3KKRA 1NKCA 4NZ0A 5KFSA 3NH2A 4KV8A 3T1AA 5C42B 4Y34A 1N6QB 1A5XA 3VQAA 1TAQA 1WSHA 1S6PB 3GV5B 4M3XA 4EYHB 2AQ4A 4KPYA 1HPZB 4XO0A 1Z25A 4MK7A 4O3NA 3OJSA 4FJMA 3O4NA 3V4IA 3SI6A 4B9MA 1QHTA 3BSOA 3I5CA 3VQ9A 2Z1IA 5KT3A 4KHYA 4KI4A 2G8VA 3GIIA 5DGAA 3Q8QB 3PZPA 1F21A 3AO2A 3LP0B 2ILYA 3WNEA 1S1VA 3G6YA 3AVLA 3S3MA 1RBVA 3OYMA 3SUQA 4DTOA 3DYAA 2G8IA 2ATQA 2CJQA 5KFZA 4IBNA 4LQ9A 1N48A 3TVKA 3BSAA 4WFXA 1MU2B 4CJUA 4DU3A 2EC0A 3CVKA 4Y3CA 4NLWA 5L1JA 4DLGA 1RT4B 5KT6A 1TL1A 5KG3A 3CDEA 1WSEA 2XCPA 3NKYA 3KLVA 1S1VB 4TLRA 4FJHA 3NGYA 4RW6B 2W9CA 4GC6A 5DGBA 4CEOA 3VQQA 2ETJA 5SZTA 4LSNA 4CJTA 3GIKA 2X78A 1RTHA 4O4RA 4J9QA 1REVA 4B8AB 2BR0A 2IM3A 5KT7A 1VRTB 4WE1A 2YNFA 1TAUA 5KFMA 3NH1A 5L9XA 1QSLA 3OS1A 5KFBA 4O5BA 3ICLA 1KRPA 3QGIA 4HCCA 3DLGB 1JLEA 4IG3A 1IM4A 4Z4CA 1S1WB 1WSJA 4QWBA 5F8HA 4DTNA 3VQEA 1SL0A 4O3SA 2HHVA 2BQUA 1C0UA 2OPSB 2GIQA 2KFNA 2XI2A 1KSPA 4X2BA 4OJRA 1LV5A 4F4KA 3PV8A 4FK4A 4NCBA 1ASUA 4KRFA 1NK5A 4KTQA 1WAFA 1RT1A 1BGXT 5KFXA 1T05B 1TGOA 2EHGA 3OYEA 1SV5A 3AO4A 4BDZA 3V1RA 3MR2A 4I7FB 1JLAA 3ZT0A 4BDYA 1NK8A 4H8KA 3I8DA 2BANB 1U04A 3H2LA 2YNHB 4CHOA 2XY6A 1S1TB 3V6KA 1NJZA 2OZSA 1RBSA 3T5JA 2FVCA 2HHWA 1JLGB 3M8QB 4IQXA 2IOCA 4CK1A 3JSMA 4BWMA 3KK3A 3H40A 4EBCA 1IG9A 5EU7A 1KHWA 1TP7A 4Q0BB 2R8HA 3WNFA 3TR8A 4YQWA 4FJLA 1TV6B 3NBPA 4DFMA 3QNNA 3V4IB 4ED0A 3QNOA 3CFPA 2OPRB 1BIZA 4Z4EA 1A5VA 2RKIA 3PW4A 1TL3B 2ZE2A 4IFVA 1JLCB 3NGZA 1CXUA 2B6AB 2HHUA 4HUEA 3OL6A 2YKNA 3QLHB 3SFGA 1MMLA 3SQ0A 1XR5A 3ASMA 2UUWA 3RR7A 1N6QA 3D28A 4RUCA 1S5JA 1I39A 4CHQA 1T7PA 2FLNA 1XHZA 3SQ1A 3NDKA 2VG6A 4CEDA 4ED7A 2QKBA 4KI6A 4CHYA 4E7KA 1NNDA 4PUOB 5D3GB 3IN5A 2B4JA 2W7PA 1KHVA 3BQ1A 4DF4A 4K4YA 3S9HA 3EPIA 4WFYA 1NHVA 4K8ZA 1BI4B 1RDAA 1HNIB 2R7YA 1BCMA 3NL0A 4MQ3A 1KLMA 4RW8A 2C22A 1ZBFA 3I0SB 2OH2A 4IRDA 4FK2A 2W7OA 4ED6A 2HHTA 1NK4A 1FKOB 3UR0A 2W8KA 1WN7A 3KHRA 5KFLA 4ZPDA 3SPYA 1C0TA 1S4FA 3I5AA 2ASLA 4RU9A 1IKVA 3PX4A 5DK5A 4FCYA 4CFBA 3AVNA 4OPJA 4BWJA 3M9MB 2G8WA 5K14B 4ZPCA 1X9MA 1QAJA 3I0RA 1S1TA 2W9AA 4RNOA 1EETB 1RT7B 5FDLB 2ALZA 3LPUA 4KHMA 4FJJA 3UPFA 2D3ZA 3NHGA 4CJKA 2A1RA 3VN5A 3I5BA 3MR6A 1S97A 2RDIA 4CK2A 4NLYA 3ZSYA 3B6PA 3KLGA 1RT3A 1RT2A 3PY8A 1DTTA 2QKKA 2JEJA 2BE2B 5I3UB 3LPTA 4ZHRB 4B8CA 2WRMA 4R5PA 4W5OA 2HNZA 2W8LA 3FQLA 1LWFA 4IG3B 5KFEA 1LWFB 1UWBB 3OLBA 4CHPA 1L5UA 1J5OB 1JLBB 4C8KA 1T8EA 4RNFA 5FDLA 4CJWA 2W9BA 5F8GA 3MXJA 3V9WA 4DTUA 2BDPA 1RDRA 1C1CB 1XI1A 5CYQA 1HQUA 3G6VA 4AHVA 3HYFA 2I1RA 4CJSA 5CYMB 4ZVEA 2HW3A 3IGNA 3CJ5A 4DQPA 2PY5A 3HM9A 5KFRA 1RDDA 5HLFA 4IR9A 1QQCA 3QIOA 1N5YA 3RMAA 3DRRB 4RW6A 2W9CB 4IDKA 3DRRA 4O0JA 4TXSA 4HUGA 3UDLA 4B3OA 5HBMA 1HJRA 3C6UA 3DMJB 4FBUA 3LALA 3PX6A 2VG7B 3H59A 1EKEA 1Y97A 4FXDA 3MTKA 2UVUA 4K4TA 3QIPA 2FBYA 4OLBA 5KFWA 1C1AA 5KI6A 4DTRA 1S6QA 3DLKA 3KD1E 4DL3A 3O3GA 5JXSA 1EETA 4FLTA 4BDPA 3LP2B 5C42A 3SI8A 1BQNB 1QSYA 4PWDA 1VRUB 5DG7A 4DQIA 4KKOA 4KAZA 2X6SA 3QZ7A 4J2AA 3BQ0A 4PY5A 2VG6B 3PX0A 1GX6A 2BRLA 3Q8PB 4CCHA 3KLEB 3DM2A 3E01A 3OYJA 5DQGA 4OKJA 4JUZA 4BE1A 1RT6B 4TY8A 3HVAA 4IH6A 4IR1A 3CG7A 2P5GA 2KW4A 4KFBA 4O44A 4WXOA 2RKIB 2VA3A 3KLFB 4OL8A 3HSTB 2B6AA 4E7HA 4F2SA 1B92A 1YTAA 4Q8EA 2X74A 2B5JB 2UUTA 3CQ8A 3KTQA 3AVFA 4FJNA 3EPGA 3CYMA 3L2VA 3RB4A 3FFIB 3QEVA 4OKKA 1B9FA 2F8TA 4AILC 3KMQA 3OYCA 3AA2A 3K57A 4YFUA 4N56A 3NMAA 2JGUA 4NLOA 5KT2A 2I5JB 3KLEA 5C24B 2JEGA 2I5JA 3SV3A 4N47A 5KG2A 3SNNA 3NF8A 1SL2A 4RW9A 3SV4A 1XR6A 3HVTA 4MK8A 2FVRA 3AVAA 2R8GA 2YHAA 4QOZB 2OPQB 1HYVA 3C6UB 3DMJA 4IRCA 4G1QB 4NLVA 1BQMA 1N56A 4CEBA 4O44B 4TQRA 4Y1DA 4CF0A 4URQU 3KLFA 2FBXA 1D8YA 5CZ2A 3L8BA 1X1PA 3EYZA 2YKMB 2IC3B 4DSKA 5HBMB 3N6NA 1GOBA 4DTJA 3DOKB 3NE6A 4WYLA 2OA8A 2RF2B 3V6DB 1IO2A 3KK3B 1TKTA 1VSLA 2FLLA 1WAJA 4M3RA 1J53A 1JLEB 4PQUB 3L3UA 4ECQA 4TY8B 1UA0A 4ELVA 4F4ZA 2ASDA 1S9GB 3HP6A 4KREA 4U6PA 5DG8A 3MEEA 4E0DA 1IKWB 3ISND 2QE5A 3AVHA 4Q43A 3LP1B 3ZSRA 4ECSA 1S48A 1TK0A 4RNHA 1JLAB 4I7FA 3RTVA 3HO1A 3OYKA 2V0NA 4ZTJA 3PW2A 4K50A 4C8MA 1SV5B 4MFBA 4IH5A 1NOYA 3OYLA 3C6TA 3AV9A 1K1SA 3QGGA 4RW4B 3K2PA 2DY4A 2O4GA 1L3UA 4F4YA 2IAJB 4Q8FA 4I2QB 3OLAA 3LP2A 3CM5A 4NLDA 4KHUA 1RBUA 1LW2B 4J2BA 1JXBA 1S9GA 2W9BB 5KFVA 5J2PA 3DOLB 3MR3A 2FJWA 3VQDA 4NYFA 1TK5A 1SH2A 5KFAA 1BHLA 4IH7A 1ASWA 4BE0A 4FZYA 3H4DA 4QWEA 2ATLA 3D0PA 2YKMA 1VSEA 4JV1A 5DQIA 4RW4A 1RT3B 3BQ2A 4FLWA 5EDWA 4CIGA 3AA4A 4DL4A 3OYHA 3BSCA 3N6LA 1UOCA 4R5PB 2DTUA 4TN2A 1NOZA 2P1JA 4CJVA 5F8LA 5KG5A 4Q5VA 3S3OA 3KK2A 3BSNA 2AGQA 4FJIA 3GV7B 4GW6A 2YNGB 5J1EB 1HQUB 3BGRB 5F8JA 4ED8A 3LDSA 3TAEA 4KB0A 4RNMA 2VWKA 4OPKA 4ID5A 4ECXA 4KHSA 1S0OA 3M9OB 4IFYB 1GOCA 1W0HA 2FVPA 1U4BA 3PUFA 3QO9B 1RTJB 2GBZA 4O3RA 3HVWA 4ZHRA 3QEIA 3SUPA 3IRXA 4M45A 2PZSA 3T19A 1WLJA 4I9LA 2HNDB 1X9SA 4TYBA 1CZBA 2V4RA 3OVNA 4CEEA 3TAPA 1NHUA 3ZSWA 4RW7A 2XHBA 5KTQA 4DQRA 3H5UA 2C28A 4DEZA 2IA6A 2AJQA 4AHSA 4CJPA 2HHXA 1ZYQA 4Q0BA 3D45A 4HHTA 1CLQA 3E51A 5F9LA 3G6XA 2XGQA 1VSJA 1CXQA 5C25B 4J9MA 2UVRA 2P5OA 4TY9A 4CJ4A 2HVHA 1KFSA 3MF5A 2HMIA 3M8PB 3MR5A 4M94A 3HPOA 2Y1IA 4ED3A 4FZXC 4CE9A 2W42A 4H4MB 4CHZA 3NGIA 3P5JA 1BQMB 2IMWP 4FJ9A 4FJ7A 1TL3A 3K59A 1DTQB 1NK0A 2ZE2B 2HVIA 3FFIA 4QW8A 2D0AA 2PYJA 2ASJA 1VSMA 2FBVA 3VQCA 3ZSXA 3NGDA 1SUQB 2HAIA 3OYGA 5KG7A 2AGPA 3OYFA 5FRMA 3ZSVA 4BACA 4AHTA 1HRHA 2YNIA 4W5NA 3SYZA 4AHRA 1CZ9A 1QUVA 4ZP9A 4FJ5A 2BQ3A 4JS4A 2IAJA 4FS1A 4AH9A 3HJFA 1S0MA 2P51A 3PR5B 3VQ7A 4H4OB 2ILZA 4DL5A 1JL2A 2F8SA 5JS2A 4NYZA 3H4BA 2Z1HA 5KFGA 2XY8A 4IRKA 1RTHB 4J2EA 2ZQBA 2F96A 4K4WA 1VSIA 5KFFA 3V9UA 1FKOA 1QS4A 3K5MA 4NRUA 3RMCA 4ECWA 3KK1B 4ED1A 4FJKA 4NRTA 3DI6A 4DQQA 3NFAA 2KZZA 5T7BA 4ECUA 1VSHA 4FYDA 3RAXA 4CECA 1RNHA 3MEDA 2AX0A 3VA0A 2WONA 5EWEA 4LQ3A 1T03B 3K5NA 4OGCA 1C6VA 2R8KA 3KLIB 4FM0A 1LWEA 4JLHA 4KHRA 3L2WA 4CJLA 2XRIA 3H98A 5HROB 5FROA 2FJVA 3AVIA 2JC0A 4J9RA 5E41A 4HKQA 1RDBA 4NLXA 3KLHB 2RPIA 1C0MA 4RW9B 5KFJA 3S3NA 1S9FA 4B3OB 3TAMA 4IDKB 3N6MA 4ICLB 3VQ6A 3MEGA 1U48A 1NKEA 4DSLA 2VG7A
chains in the Genus database with same CATH superfamily
4F3MA 2JJ4D 4DV1J 4LBIA 4NO7A 4DTXA 5BYQA 1L3VA 1O1WA 2RN2A 4CEAA 1VQ9N 1WF1A 4HL9A 3V4MA 3BDPA 4E19A 1RBLA 1VRUA 3AJDA 3JB9k 4ZVGA 1VQKS 3M8QA 4UOCA 3QETA 1NJIO 1RFQA 5KFDA 3G71N 2OO4A 3GE1A 1LKZA 3L7UA 3OBWA 1VBXA 3I0RB 3IMQJ 2D9PA 1XQIA 1DTTB 3H3OB 2CGJA 1CJKB 1U1OA 3DLLQ 1C1BA 3R97A 3GIMA 1N54B 2CJ9A 4JI1F 4CH1A 2A2CA 3TQ1A 3S41A 1RHQB 1YJTA 2EK1A 1X5SA 4ZMMA 3TX0A 4DR6F 2CGKA 4BRKA 2IM0A 3GIJA 2X1GA 4ZVFA 3UCUP 3GONA 2NRXA 1GLBG 1JCGA 5GINA 3ZT1A 4LFBJ 4WPAA 3G2XA 4DV6F 5AQQA 3SBGA 4LMZA 3EZ5A 2FB0A 1X3MA 1RHUB 3AVGA 4FF2A 5B7WA 1O0PA 3DOMA 2DPJA 5AE1A 4F25A 1TQLA 3QLHA 1GXLA 1C2PA 1JMTA 4GV9A 2DBBA 4E8UA 4BREA 1FEHA 2E1RA 3Q8YA 1SUQA 4F3OA 1O6XA 2EFNA 3P1GA 3BH6B 1AA1B 4UY8T 3WUHA 2XMMA 1OVYA 2AW0A 3VTHA 1JXEA 1OY8A 4DX7A 4LVOP 4LH5A 1VQ7S 1VSFA 4FP9A 4H4MA 4CFCA 4OHZA 4U7BA 4MT1A 2O8FB 3G6ES 3W65A 3RZAA 3SJHA 2KYXA 1AB8A 2I6WA 1QAIA 2WOMB 5CQGA 5E7OB 1R8PA 2AP6A 4GVLA 3O4QA 1OS5A 2BVZA 3H1QA 2E7XA 5U47A 3PSFA 5KOWA 3EJMA 3HD1A 4KHNA 2AX1A 3BZQA 4HDHA 4WFBQ 2DFHA 1R0AA 5FJ4A 3CJ9A 3AA3A 4B1VA 2F7TA 1HBUB 4P7TA 2VD3A 1Q9XA 4EZ9A 3TYTA 3MPDA 2VL1A 3O44A 4OZNA 4XDCA 5EX5A 5A2QO 3HK2A 5HQ8A 1UVLA 4JK8A 2V9WA 3MWBA 4ECYA 1YT3A 2LXFA 1T05A 1S1XB 2RIJA 3E2EA 2GV9A 3HKWA 2PIIA 2W40A 2L3MA 2WBRA 3Q8RB 4QAGA 4DR6K 3FMBA 3HFVA 4KFBB 2E66A 3ID8A 2YNIB 4OV1A 2DCUB 4DV3F 4DV7F 4X4PA 1FI4A 3FRZA 4BRDA 3VGMA 3CUNA 1CJUB 4K4VA 4EGLA 2DXDA 4JI0K 2R2SA 4RUHA 4F4XA 2R7RA 1RTIA 2AV5A 4LIRA 4L6V3 4B3SJ 2OPSA 2KQ2A 3R6MA 1X4CA 4JI4J 4BCAA 2C2DA 3KOAA 3DLHA 2FSNA 1TFYA 5BREA 3F9KA 4I64A 3JXUA 3N5BA 2FHJA 1FNXH 3CERA 4BRGA 1D9DA 2YV0X 1HWLA 4CLSA 3JSRA 2AYGA 2VONA 2I38A 4QU6A 5EX0A 3MGJA 5CD4H 3MXMA 1NK6A 2LXUA 4HH0A 3BREA 4DV6J 1A7GE 4BRLA 4KRWA 1U8WA 1U0HA 4FWRA 3ALYA 2KTQA 4KHPF 5K20B 3MEDB 4CESA 1Q82O 3KKSA 3L6QA 2QO3A 5HMWA 2KM8C 3ENAA 1ZAXA 3QEWA 1DQAA 3QYYA 4FLZA 1FRIA 3RMBA 2DEIA 5DM7L 4PQUA 1TTHB 4KTWA 3O5BA 1BWFO 1D0EA 3T9NA 3CNQP 5KFQA 4FJGA 1HBNB 3BKFA 1EKRA 3WIUA 2G8UA 2GS8A 3EDQB 1NJYA 4P73A 5A8RB 2FC8A 3KLGB 2BE9B 3CCES 2E6MA 3DWLA 2PGCA 3AGKA 3AB2B 2OANA 2Z1JA 3PW0A 2X3DA 3ISZA 4AXIA 4YDXA 3HP9A 1VQ6S 5J2QA 1FJGK 4NYNA 1TKZB 2M0GB 3GMGA 4TU7A 4ZP8A 3AQOA 4F4AA 3EUNA 5HRSA 3UR3C 4JI4K 1RHMB 4LBPA 2OEMA 3P45B 2OYQA 3M2UA 2HK2A 3BO2A 3BS9A 2E1AA 4EHUA 4ZPAA 2IC3A 1NB2A 2Z2MA 2KXNB 1DJ0A 2ZM6F 4WFNQ 4L73A 4DDFA 1IR1A 4NXNJ 2R2UA 4GO7X 5KGWA 2A3ZA 3HI9A 5GAGU 3K58A 3D3CJ 1J54A 3DU6A 1WD6A 3QMQA 2DVIA 1Z2LA 3H5XA 4B1ZA 3ZTSA 2CKWA 4KH4A 3ZCMA 3IS9A 1NRKA 5IWAK 2AEFA 2B56A 3LPEA 1IKYA 4DV4J 4I67A 3AVKA 3MM8A 2RE1A 3IR5B 3C3LA 4Y0WA 4NLUA 1X4EA 3OUYB 2ACMA 5L1IA 2GO9A 2IJFA 3O4WA 3OYIA 3CFRA 5SWMA 3TAQA 1TR0A 1ZA2B 1F0XA 4LRCA 3DRPA 1HBOB 3G9CA 3UCGA 4DSIA 2BJ7A 3X3UA 3E9OA 4HACB 3V9SA 3CFOA 3BGOP 1VQ5S 3IM9A 4TYAA 1FTRA 2DXFA 1P9YA 1S1UA 4RX6A 4XPCA 4CZIA 2M4MA 1CQNA 3OHAA 1VSKA 3MN7A 3QZ8A 3AA8A 4X65K 3EEQA 4LJMA 2F8MA 1UVKA 2VFSA 4H0VB 5GAEP 3ENVA 1EIYB 3PFEA 2LECA 4RG8A 3VEWA 2VG5B 1PJ5A 2CNKB 4YOTA 3V9ZA 4ZN1A 2JC1A 4FPRA 4YMEA 1N5YB 2Z1GA 3W66A 4QIWD 2RH3A 3PKYA 1ATSA 3CCQN 4ICLA 1QZ6A 3HVRA 1JB0C 4IQMA 2AKWB 3B78A 5D15A 2B4VA 3D2EA 1GMWA 3I32A 4E89A 1J9AA 4FLVA 1CJKA 3EO3A 3PEHA 2ZUAA 1TK8A 3BKTA 2XNRA 1XNRF 2GIFA 3P31A 4GV3A 2R9LA 1WSRA 2D9OA 2KHCA 2WOMA 3EVWA 4PPDA 2UXDK 4I2PB 5FPNA 3CB4A 1N32J 3MECB 1NGFA 5M1QA 4C8OA 1ZPWX 1OYEA 3VOVA 4CBXA 1ZTWA 1T03A 4N8OA 4A8SA 3IDHA 4ECZA 3GP9A 3U27A 3KHLA 1WHXA 4NWBA 2DEJA 2OD6A 5L1LA 1KLNA 2DPNA 2QA4N 1VYAA 5J2QB 3IC1A 2E5IA 1UJ5A 3MEEB 1R8HA 1WKKA 1C1CA 4CGDA 2KYZA 3JSMB 1RB0A 4PR6A 2PMHA 4M5NA 4WFZA 3LP1A 5CHIA 3TU5A 3U1LA 2PI4A 3MCNA 1PBAA 2MSTA 1DKGD 2XG8A 4FWSA 3SZ2A 3AA5X 4MKYA 2VJVA 2V9KA 2XY5A 2H51B 1HARA 3PG9A 4C8LA 2CQ4A 2PMWA 3CCMN 1ASVA 4JBCA 3NGRA 3PO5A 4F04B 4DSEA 4YP3A 4FJ8A 4FZZA 3X1LB 1QTNB 2QYCA 5B0EA 2XCAA 2E1MC 4HVJA 1RT4A 2JVRA 4OZ3A 2E5GA 3ZZPA 2ZH3A 3QRPA 1T9VA 2ZBCA 5F3ZA 3VAHA 2DY9A 4D3HA 3DC2A 1FEEA 3NH0A 3CF5L 1RCHA 3HPHA 2DFFA 2OPQA 3Q22A 3WC2A 4OHYA 4DCHA 3ILLA 3RRGA 1Y7PA 4W4MA 2QXFA 1H3DA 4BC2A 1FRLA 1RKJA 2RAQA 2PMZD 4GNIA 5I3PA 1NU0A 3OBIA 3CMES 1H98A 2MJNA 1R0AB 3CJCA 2QL5B 4CO2A 4U95A 1VSDA 2BGGA 3C95A 4BRIA 2CDRB 2HFNA 3AARA 2QMUB 4ZIVA 2JEFA 2EBGA 1XNRJ 1UCNA 4ISEA 4M5KA 3DM2B 4X4SA 1WNSA 3FSXA 4DHYA 1NK9A 1BMQB 3RW7A 1X4AA 4Z2XA 3R5DA 2PC6A 2VB6A 1H0HB 2PA8D 3ZT3A 4ILLA 3M6WA 6AT1B 3OL8A 2MKCA 3CC2N 3OS0A 4DB3A 4YDUC 3ZSOA 3NF6A 3K8VA 3IBWA 1FXRA 5IT9Y 1G99A 3H45C 3T3FA 1Q81T 4ED4A 2LP4A 4ELTA 1GT8A 1W2BM 2AT1B 1L3KA 3J81O 1UWBA 2X1AA 4K4XA 4O3QA 5IM0B 4B9VA 3TX8A 3BJYA 2VWBA 3LWLA 3OW2M 2FZGB 3RYLA 4ZJQA 3CCUS 1YJNN 1JJ4A 1HR0F 2MKSA 1Y11A 3VQPA 2Q97A 1GTEA 3GSIA 2YHBA 3TA0A 5HL7L 4QWAA 3MCMA 2KFZA 2IS3A 1Q8IA 1SBRA 1V3ZA 2NRVA 1ACMB 1T3OA 3JYTA 3DOKA 1CC7A 4DR7J 1CS4A 1N36J 4W5RA 3ZZOA 3F73A 2WCXA 3LA0A 3NGUA 3NGSA 3WX4A 4AQYJ 2XWXA 2NXUA 5AQTA 4ISFA 5BJRA 1YTYA 1UEKA 3LANA 4O23A 3TOQA 2OEJA 4JK9A 1NPKA 4XTTA 3BBBA 4WFAL 1NBWA 2U2FA 4JI7F 4DN9A 3BN4A 2YPZA 3PRDA 2BKOA 3L2RA 4TU8A 1E6VB 3W9JA 1IWGA 5K8OA 3THYA 1I6JA 3W62A 3VZHA 4DV2J 4ZLJA 1IVZA 3GE9A 3MWPA 5AQPA 1RA7A 4JB8B 3BO4A 1URRA 4LFAK 4M5JA 1VQMS 1WDTA 3NAEA 1ATNA 2EKYA 1LWEB 2IYIA 1NLKL 4Z0UA 4K0KF 3GCXP 4RW8B 5ETTA 4YN3B 1JLFB 4CM0A 4OI6A 2RQCA 2V4JB 4F0HA 4EEYA 3CCZA 4DU8A 3IR7B 2J9DA 2RILA 3D7EO 1HNIA 3HZGA 3BF4A 3OUYA 1RYSA 1VQPS 5F9NA 1YBTA 1DLOA 3DLKB 4M7XA 2UVVA 2VFRA 4BQZA 1KVBA 4JKFA 3IP0A 3QNWB 2DITA 3CE8A 1R43A 2IM1A 5FLXU 4CO0A 4LF9F 3CJ3A 4PZVA 4MH8A 2F63A 1EJ7L 1NJXA 4OKEA 2A6AA 2PYLA 1JJ2M 1D5AA 5C7PA 1K9MT 4LF8J 1TMJA 3C8YA 1RT7A 2I7PA 3FRYA 2W25A 4OX8A 1W97L 2EFQA 4AM6A 1NKCA 1QLNA 3C46A 1HBNA 2IRYA 3T1AA 2XZDB 4Y34A 5CCMA 5EVZA 4OO1J 1TAQA 1WSHA 3GV5B 2XULA 3A0IX 2WFBA 4K2JA 1HPZB 1NUEA 2D1KA 4MK7A 3OJSA 1LWXA 2ZHAA 3O4NA 3CT9A 2B9EA 4FN5A 3U1NA 3S8SA 1SJQA 2ZUGA 3VQ9A 5L46A 5KT3A 4KHYA 8ATCB 4A5BA 5IXUA 4J5OA 3GIIA 1HX1A 3AJ2A 2P9LA 3WNEA 3S01A 3CMQA 1TFWA 2RS8A 3AB4B 2ZBPA 1HNXF 3MUMP 4CT8A 1YGYA 1WOSA 1HI0P 3TQEA 4UT4A 5HL7Q 3R2DJ 1NDPA 1XIQA 4IEIA 1KVIA 2JFKA 4CJUA 3CJBA 4Y3CA 3NXZA 1NB7A 4DLGA 5L39A 2HFUA 3Q89A 2HRUA 2GNKA 1IBMK 3CDEA 5HJYA 3NKYA 3KLVA 1FJGJ 2UV8G 5LL6d 3HHLA 3VQQA 5SZTA 4LSNA 4RPFA 1RTHA 1REVA 4B3TK 4GKJF 2F9JA 2BR0A 4DPTA 5KT7A 2K1RA 3IM8A 4USWA 2KT5A 5B0GA 3WQPA 2ZZMA 2P6TA 3FCVA 3DXSX 3OS1A 3QFUA 1VK8A 1QAXA 4O5BA 2YX6A 2BJ9A 1GK8A 1JLEA 4LF4K 4IG3A 1M5KC 5A8WB 2MQPA 2O8BB 2ZZTA 1Y00A 2AJFE 1H38A 3I96A 2V50A 4KGZB 2A3JA 3OVAA 2MEWA 1B7YB 2J8AA 2XI2A 4X2BA 3RSEA 4OJRA 2IBOA 1LV5A 1GLEG 4F4KA 3FZKA 3NGTA 4KR0B 1QVFM 3KJFB 1RT1A 1BGXT 5FIIA 1VIOA 1TGOA 1SV5A 1F9EB 3W1YC 3AO4A 2B9WA 3ZT0A 3AT1B 4D3GA 4AQYF 3SMSA 5RUBA 4ZN3A 2Z58B 1XN9A 2M8HA 3EDRB 2NCKL 5CE3A 2VC0A 1F9FA 3MHYA 1XMBA 4Z94A 4AXJA 3WZ0A 1JLGB 3GDQA 4IQXA 1UETA 1LK5A 4JHDB 3KK3A 4BRNA 1IG9A 1KHWA 2YX1A 2MB0B 2WW4A 1CBKA 1TP7A 3M7VA 2R8HA 4OLOA 1XQSC 2WW8A 4ED0A 3N01A 4WKYA 1V5IB 2OPRB 3PIOL 1A5VA 2RKIA 1HWJA 2ZE2A 4IFVA 1TYQA 1CXUA 2HHUA 3VGVA 1LNQA 3OL6A 1KD1T 2YHYA 5M1KA 4KHPJ 5T7LA 4K0KK 1XNQF 4ERDA 4OX9F 2P6SA 1I39A 1T7PA 3BZCA 3SQ1A 4ED7A 4E7KA 2V67A 2UUAJ 4A8FA 2J9DE 3K9JA 4RWTA 1YX2A 1NGGA 3BQ1A 1KHVA 1O5JA 4EFAC 3AOBA 1RUSA 2FC9A 1UZDA 2R4FA 4K8ZA 2R7YA 2C22A 4CW7B 1B3TA 2HQ3A 4FK2A 5AQGA 3C16A 4ED6A 2HHTA 1FKOB 3UR0A 1IBMJ 4J9UE 5KFLA 4JOUA 4CZMA 1IXKA 2V69A 3KUEA 4HTLA 1FW6A 4LF8F 4BWJA 5EHHA 2HQGA 2G8WA 2JDJA 5K14B 3A4TA 2MY8A 3US5A 2UXBK 2MKYA 3EGWB 3LTOA 1BQXA 3ZX3A 1EETB 5ETPA 1DGKN 1HW8A 2E88A 3LPUA 2H3EB 4EI2A 2ASPA 2DNMA 1E4FT 4YB6A 2A1RA 3RRKA 2RU3A 3MR6A 1S97A 3ZEUA 3ZSYA 3B6PA 4P2XA 4AE5A 2Q0UA 3IWNC 3PY8A 1DTTA 2XMTA 3AAWB 1U6BA 3K7RA 4OFZA 3EM1A 2BE2B 1JCFA 5I3UB 3I6PA 3F41A 3QWPA 1YJ9S 2HRYA 2B7BB 3J81Y 4Q2LA 1LWFA 5CR4A 2O67A 2FHMA 4CHPA 2KRRA 1JLBB 2MDAA 5A2QY 4H5TA 4CJWA 5F8GA 4KC5A 2BDPA 4CZLA 1C1CB 3G82A 1HQUA 2XYGB 3HYFA 4CJSA 4C2MA 3AH6A 3ULEB 4ZA1A 2DY1A 1ZAVA 1OKJA 1UPPA 4IR9A 5HVFA 4ZKAA 3QIOA 3RMAA 4IDKA 3DRRA 4DR1J 4HUGA 3UDLA 3QWUA 1HJRA 3EE9A 2QMXA 3BY5A 4ANDA 3M30A 1I94F 2VG7B 3H59A 5D4NA 3MTKA 2UVUA 2LXIA 3HHLC 4ZLNA 4OLBA 4BRHA 1R59O 3IKMA 1S6QA 4M5DA 2HVDA 3LP2B 3EMTA 3SI8A 1BQNB 3D2FB 4DQIA 2UXDJ 1X7VA 1K8KB 4PL7A 3NY0A 4KAZA 2X6SA 3FEYB 4CJ7A 2HFSA 4J2AA 2VG6B 2D69A 3N4PA 2JRSA 4WWSA 4CCHA 3KLEB 4USKA 4OKJA 5E84A 2A18A 2LFVA 2DB1A 1U2VB 2DNNA 3THWA 4O44A 3QFPA 5KOXA 3AD8C 2B6AA 5LMNF 1RWOB 1S22A 2KN4A 2ZHBA 3D9BA 2OCEA 2Q79A 3CYMA 2UP1A 4ILRA 4YOYA 1FD8A 5AQVA 3QEVA 4OKKA 1B9FA 4YS2A 2IVNA 2MMYA 4Y28C 4YFUA 4N56A 3OV7A 1RBOB 1JCEA 1YBAA 4OPHA 1PSDA 2I5JB 2JEGA 1U1MA 2YPYA 3SV4A 1XR6A 2NPFA 3AVAA 2R8GA 3LDQA 2Y9HA 1YJRA 1HYVA 2HVEA 3M5RA 5ETSA 2ZOMA 1WTFA 2O8DB 1N56A 4CEBA 1BWEA 1ITPA 2MY7A 4TQRA 1ZH5A 3KLFA 3C15B 1KC8O 3SAFA 2OTJN 4NASA 3L8BA 1X1PA 2XSJA 3EYZA 2IC3B 2VFTA 1GOBA 4DV7K 3DOKB 2UU9K 2R7UA 1ESVA 2QFIA 4WYLA 2RF2B 3KK3B 1V9OA 4A8OA 3O1LA 3O3LA 4KGMA 1DZ5A 4DV1F 3EXCX 3Q83A 4JI2K 2P9IA 1WAJA 1RAEB 3CULA 5E3CA 4TY8B 2P9EA 5EGYA 1UA0A 4WK1A 2A6OA 2RS2A 2PFDA 5AJ3J 4JI2J 5DG8A 4FVUA 1RDUA 3UDEA 1FDNA 3AVHA 2VGMA 2XNQA 3ZSRA 3Q2SC 1TL7B 1H72C 2KVQE 1TK0A 4RNHA 3ZX0A 2ZOGA 5H1SV 2UUAF 3AD7C 2G2ZA 3HX9A 4C8MA 4L72B 3AV9A 3UCZP 5ETOA 5BYRA 3AOCA 3A3PB 2DY4A 2HS3A 2E1PA 4F4YA 1HKGA 1IJFB 4Q8FA 4I2QB 3N79A 3LP2A 4DR6J 4DL0C 1QQMA 3T1YJ 1JXBA 5HMZA 1RWXB 2W9BB 4LBHA 1Y10A 2GTDA 3MR3A 1IR0A 2QJ3A 4NYFA 4C1NI 2AJ4A 1TK5A 3LW5C 1Y9OA 2BEFA 2QLFB 3ETMA 4JI5F 2DGVA 3JSYA 3OTCA 4PG8A 2W41A 4FZYA 1RP5A 2H1YA 3EGVA 4LR8A 3M2RB 1X31C 4CIGA 2JX2A 3OYHA 3BSCA 4R5PB 3DRXA 3T1HJ 1XK8A 1F60B 2Z0GA 1NOZA 4LFAJ 3DGVA 3CDAA 4MYUA 4K2XA 5AQRA 3FMWA 2CFXA 1P6TA 2V8PA 3GV7B 4A8MP 4ED8A 3RVCA 4LRDA 4KB0A 2LQJA 2V2VA 4OPKA 4A4JA 4ECXA 1S0OA 2CPHA 2HRTA 4ZHRA 3QEIA 3SUPA 3MDFA 1RWWB 1XNQK 3I8BA 3VV2B 1MLAA 3PCOB 4ZPVR 1MWYA 3FZHA 4TYBA 2VQFF 2HHHF 2CWXA 1NHUA 2OTLN 4LRAA 4RW7A 2FY8A 4DQRA 3H5UA 2C28A 4DEZA 2AJQA 1CLQA 5F9LA 3J8AA 3RJMB 5C25B 3CJRA 2HVHA 3FZLA 1GXTA 1V5VA 3MF5A 3VGLA 4PYDA 4FZXC 3NG8A 2W42A 1W26A 2ROPA 3ZTRA 1GXUA 4HLBA 4FJ9A 1HUXA 4FJ7A 3K59A 3QGPA 3TTFA 2ZE2B 2W2QP 7FDRA 2HVIA 3P8BB 2V8DA 4BGAA 3E1YA 2PYJA 2ASJA 1VSMA 2MPUA 1MWZA 3NGDA 1NH7A 1RSCA 1TL4A 1X4BA 3QJPA 2XTJP 2RUSA 4M63C 4W5NA 3OHRA 3SYZA 4AL7A 4J37A 1U02A 4AHRA 1QUVA 3IWLA 1O51A 2ROGA 4RUBA 3L4QA 1M90T 1HPMA 3QDKA 1VJWA 2CPZA 2P51A 2C1EB 1SIWB 2XMAA 4H4OB 4DL5A 2VDHA 4L76A 3VAJA 3QT7A 3I56S 2LEAA 1KVKA 2Z1HA 2XY8A 4G1PA 3H1VX 1M5VC 1RTHB 5IC4B 4K4WA 4UUWA 5BN9A 4NE9C 3P4IA 1GLLO 3V9UA 2P9NA 1FKOA 5D0GA 5EN1A 4ECWA 2XMUA 2XM3A 2QGFB 3PKMA 4DQQA 4MYTA 3JXOA 2G4BA 1EARA 2ZJRQ 4WQ5C 4CECA 2WONA 3K5NA 4OGCA 4JLHA 4KHRA 3L2WA 4CJLA 2FJVA 3C14A 4J9RA 4ETZA 1NNEA 2W2NP 4C3KA 2ZH8A 5K5MA 1C0MA 1P90A 5KFJA 3CJKB 3I87A 2CXEA 4B3OB 1J27A 4OYXA 3VQ6A 4DSLA 4WCEQ 3D67A 2VG7A 2ZITA 2EFPA 4O4GA 4E7LA 1R8BA 2MTLA 4O3PA 1LQ9A 3HZEA 2GHPA 4LF9J 3P5BP 3PFOA 8AT1B 4FM1A 5KRSA 3L2UA 2BMBA 1FK9A 4DZ6A 1WG5A 1VQLS 3BGRA 3A3OB 1RBRA 4JV5F 1KAXA 2NZCA 3PRVA 5HMYA 4DCPB 1N8RT 1WUAA 2A2DA 3TVZA 3MPUB 1FESA 1XBWA 3MMBB 5C12A 2GW8A 5GADI 1OWXA 1T94A 2Q2RA 3ULHA 4MIBA 4J9SA 1R7IA 2QK9A 2EKNA 5BPLA 1ITGA 4NCGA 4PRFA 2X6NA 5HMXA 5JLFA 2CDQA 1HYSB 3W60A 1F5BA 3OTBA 4O3OA 1IN0A 3QSYB 5HRNA 3L0QA 4FWPA 1N32K 4OZ1A 2G8FA 3OL7A 3HXMA 4U8YA 4EIAA 5HLFB 1BWVA 2FTRA 1UJ4A 2JHEA 2FSKA 3L3VA 2XS2A 2ZJQQ 3GV8B 4LFAF 4LSLB 2GO8A 1GFWB 5IFMA 3CCSN 1GNKA 2JSXA 4LRFA 4B9SA 4ED5A 5DS7A 5BRFA 4FO0A 1VQON 1S59A 4FWQA 1PC5A 2SXLA 2QIFA 3DDIA 3ZT4A 5AZJA 2N7CA 2KZMA 1TVRA 3PJXA 1U2CA 5KFHA 1AT1B 4YUDA 1Q9YA 2NRTA 3UB5A 2FHJD 3V6JA 3VESA 3MURP 2NRHA 2YWWA 1J5OA 3MEKA 3UN5A 3EY1A 2KJVA 2L08A 4Z4FA 2BBEA 3O9QA 3WT0A 2L41A 4X64K 2GIRA 3OSPA 1KQGB 3ZZRA 2MZSA 1JXLA 2J7WA 3PW5A 4W5TA 5FLXY 1N5QA 4LR9A 3WHIA 3ZTQA 2GEMA 1PAUB 5KFPA 4CWBA 2UUBF 4I9QA 5AXLA 3FQKA 2VPWB 4FWOA 5F3TA 1FNMA 3CD5A 3OT9A 3G71S 2DFEA 4DFPA 5HOOA 3PYDA 4KO0B 4IO9Q 1S4EA 5GAEI 4N5SA 2BXJA 2KFYA 4OLAA 1NM1A 2KJWA 3FVYA 3T9ZA 4IOAL 4BGBA 3AAPA 1GAOA 2HBZB 4YB7A 4WCEL 4P6QA 2HNYA 1C0GA 3SBMA 4I6MA 5A2QU 1LWCB 3V1QA 1RGIA 2KVIA 4C9DA 5ETQA 4IKAA 1X9WA 1VQ8S 1GH8A 4J9KA 3FJ2A 5GAGP 4QQBA 1N88A 3OTDA 1R8CA 1BDGA 1N32F 4EP5A 1U09A 2PDAA 1K8KA 1RI7A 2MZRA 1VHIA 1EXQA 2OSRA 4HHJA 2RVJA 5J1PA 4M95A 4NYPA 2MXYA 1K8AO 2QN6B 3OVBA 5I9EB 1CSJA 3THYB 4Y2CA 5AXKA 2OKQA 1DHMA 4DL2A 4WKRA 3Q2TC 2B5JA 3E66A 3TABA 4Z4IA 1VR6A 3CJ2A 1GOAA 2OZMA 4F9OA 4NPOA 4ELUA 2ZWOA 2V2KA 2YJEA 1ZZFA 1Y5IB 2GQCA 1IUJA 2IIRA 3C6TB 1X4DA 3CCSS 2QEXS 5E3QA 2F4VK 3HSJA 4NB4A 3HHKA 4ZPBA 2UXCK 2QWMA 1HYZA 4ZVSB 1G2EA 4MMOA 5DZ6A 1DEJA 1FXXA 3AXKA 3EVOA 2BJDA 2R42A 1ULRA 3M8SA 3SQ2A 4JI3F 4K4SA 2ZEJA 2CQ2A 1HFEL 3HFKA 3C0BA 3DLJA 4BBYA 4WZMA 3KKFA 4Y6IA 1VLOA 4WJBA 1FJEB 3CCVN 2CPDA 5HO4A 3ZETB 3GFZA 4FWLA 4KB7A 5JMVA 1BXNA 4H0XB 1GLAG 1KP6A 1D1UA 1OVQA 4H0PA 4MFBB 3SSQA 3W63A 1UW9A 5KFIA 2LU1A 5A76A 2CVIA 2LU2A 1MU2A 2NYIA 4ZVHA 1TL5A 1UEVA 3VWSA 1NDLA 1AFJA 4OYBA 5I42B 1N0UA 1HMVB 3MMBA 2G8HA 3BO3A 5J2PB 3N0VA 1U1NA 4X4UA 4O0NA 1VQKN 1G3OA 2ADCA 1NMNA 4I4BA 3ITHA 5KG0A 3VGUA 1IKYB 3CJ0A 2W2MP 4FYVB 3FEXB 1KVJA 2R2TA 1PILA 3QIPB 2HLUA 1CEZA 4DSFA 3ZC4A 2QM1A 4LD0A 2I2YA 3A8IA 4HTIA 1LAVA 3VCDA 3V1OA 1XR7A 2ZBRA 4M3YA 4PA1A 1JLQA 1Q8BA 4YOVA 4PG6A 1V3RA 5AJ3F 1WBDA 2KI2A 3CC7S 3DXMB 1TL1B 1RT6A 3FC9A 2GV1A 4P74A 4EZ6A 5JVGQ 4N77A 2K06A 4OJGA 3TUJC 5DLFA 2DH8A 4EHTA 5C10A 2E2OA 4RBUA 4NLSA 3MPYA 4DMZA 2EXUA 1UA1A 5LMUJ 3AVMA 5JS1A 1QSSA 1T9UA 2RE2A 4DR3F 4PXCA 4JYAK 4RWXA 1R31A 2B51A 4DL7A 2HZAA 8RUCA 3MCSA 1ZETA 4RBVA 1VQ4N 4PEOA 4R8UB 2KDOA 4MAKA 5LY3A 4QS8A 5C24A 2ERRA 2FBTA 3UKRA 1MWQA 4C6AA 5AXNA 3V6HA 1ROFA 2QLWA 1MW7A 4XIUA 3HVTB 4UUXA 5AZIB 3OTEA 2GWJA 3E9PA 4CIEA 1FRJA 2MZQA 3CCEN 3DGPA 2V8GA 1JLBA 1SQFA 3DHWC 4WP9A 3V6DA 1KVCA 3RB6A 4FM2A 3T5LA 1QJHA 1WSGA 4Z4HA 3E01B 3ZX2A 3NBPB 3R27A 1N34J 3HT3A 4B1UB 1Q78A 4J9PA 1W2IA 2IGIA 1CJVB 3QEXA 1IG8A 3QINA 2J9CA 3ET6A 3MX2A 3V9XA 3UD5A 4G1QA 3HF5A 1ZBIA 2OI2A 5CYMA 3DGPB 3LDPA 1APSA 4OI0A 3QT6A 4OHVA 2XGPA 2YXLA 1G15A 2H65B 4JI7K 3CJ8A 4HYKA 1HNXJ 1S6PA 3A5OC 2WK4A 4JV2A 3EE3A 3U6FA 5CZ1A 4DV4F 2F9WA 1SAZA 2VWJA 4YNQA 1VRTA 2UUCF 4LREA 2FJAB 3J7Z5 2KH9A 2VOPA 5BR8F 2W6LA 2VG5A 5EUHA 4DCJB 4LY7A 4UTGA 2Y8YA 1VQNS 1B0PA 3S7RA 4X62F 4ALZA 3PYGA 4OZ5A 1BO5O 3SDEB 1U49A 4BS2A 3KD5E 4K8XA 4W98A 4B9NA 1IBLK 2B9YA 3KLHA 4FPAA 1Q1KA 1YRXA 3LZJA 4LSZB 1S1UB 1TUGB 2APOA 2CPEA 4XAKA 2KXFA 4L8RB 3LAKA 4P75A 3OTOF 3T1YF 1VQ5N 2WONB 5A0YA 1BY9A 4DXLA 3QESA 4E7IA 3CQXA 1XNQJ 1QHAA 1LOUA 4LFBF 2OUGA 2A5XA 3A12A 3NAIA 3TARA 5HVHA 3H5SA 2ZH1A 2HQFA 4CERA 1LW0B 1EO1A 3L4IA 3MX5A 1T9WA 1Z6RA 1BUXA 4ZITA 4K43A 4DR2F 3MECA 3N4WA 2BQRA 2LEPA 3D6RA 1D09B 3OFEA 2GAGC 1U1RA 2IM2A 5B09A 3CM6A 5DJBA 4CJ5A 3P49B 3GWCA 1KAYA 2X51A 3V81A 4ID8A 1DARA 2FD2A 2Z56B 2DRAA 4PQAA 3OYAA 1HWIA 2DNGA 2HS4A 1RWPB 2DGUA 1YWXA 3KJVA 2O8CA 1OSCA 3QEPA 1BLUA 3F0NA 3RAMA 3SQ4A 4AFFA 3HPGA 1SKRA 3C94A 3OXLA 3A13A 5LSOA 4F2RA 2DH7A 5LXYA 3CJ4A 3TEGA 4G65A 4ZPWR 2K2PA 1K1QA 5LJ5Y 1YVNA 5BN8A 3CPWR 3AODA 2M7SA 2IVFB 1R6YA 3DRSA 2M88A 3QGHA 4BC5A 1HQEA 2F8EX 2D0CA 3LM9A 1FKPB 3WDOA 1HNVB 5F8IA 4DWIA 1R8AA 3M4XA 4KBIA 3FK4A 3UE2A 4CEFA 4M5MA 1HKAA 5CY4A 2CQ3A 4PWDB 4OYZA 4DTPA 4K41A 3QATA 1SI9A 1Q0NA 4CZHA 4NLTA 2ITGA 3P5TL 2HHQA 2LDIA 4K59A 1WUUA 4DL6A 4WQ5A 1RT5B 2DNRA 4DZDA 1S9EA 1UAXA 4DR7F 3M2RA 4XEIA 2DIVA 3I0SA 2P9PB 2E9ZA 2PEBA 3G86A 4PXBA 4K25A 3CD6S 4CJEA 1Q86O 2DHGA 3DAWA 3CJ1A 3VA3A 3CC7N 3SMPA 4FK0A 1WEZA 3MXIA 1GLFO 4Y1CA 1VLYA 5IT9U 4DV3J 3M6GA 1QQNA 4YR3A 4WE1B 1DFDA 2BE2A 1HIYA 1VHXA 3CDBA 4I2QA 3M8RA 1YITN 2Z30B 2AJ0A 3K17A 2XLJA 2FC0A 4X65F 3BEXA 1HHSA 4ILGB 2EG2A 2QW9A 4HUFA 5IM0A 1T95A 2MLXA 2J6TA 4CGGA 4NA1A 3NS5A 3VEOA 2HWIA 1YF5L 1U1LA 1GMVA 4CQ1A 4EP4A 5AQUA 2MGZA 3GIRA 4DQSA 2RRAA 2F40A 4IOXA 1OQ3A 4DUZJ 4BHQA 3KIOA 4DS5A 4QIVA 4KHQA 1SKWA 4V19X 3MXHP 2ZD1A 2GVDA 2MYFA 3SQGB 4ECVA 4CF8A 4JRQA 4DR3K 3B54A 4KHWA 3M1VA 1Q79A 2HHHK 4QIGA 4P71A 4F3TA 3CC2S 3TANA 4DFKA 4YR0A 2Q3PA 4GVEA 4FW1A 3MFHA 4XK8C 3BN7A 1XMOF 4M3TA 4EWTA 1F2HA 1T3VA 4HI2A 1LXJA 2FGOA 5AR0A 2UXBF 1T02A 2VQEJ 2W24A 3CC4N 3HSCA 4DR3J 1NKBA 1AFIA 3LP0A 1S6QB 2HGMA 3M8WA 3FLCO 2YKNB 3TAGA 4HCBA 1MWMA 1CZAN 2MZJA 1M1KO 3SQOP 4W5QA 4K4UA 1B64A 4RZRA 1L3SA 1Z4UA 1VISA 1RT5A 3ZZYA 3M32B 3OD2A 2M70A 3W5ZA 1FNOA 1I3OB 4HACA 4JKGB 4BRMA 3CO9A 1LW0A 1MA9B 3BM7A 3UQSA 4DU7A 2ZGYA 1RAAB 4PWWA 3A8JA 3ZNJ1 4QYZJ 5KT4A 3JSBA 5A8RA 2BV3A 4B1YB 2R7WA 3ILOA 3AD9C 3TSQA 2JLGA 2BKNA 3MM9B 1T0TV 1S6PB 1N5TA 2WC9A 2KL8A 3SK3A 4K5SA 5DZ7A 4LR7A 4U8VA 4O3NA 4IO1A 4FJMA 2ZJPL 2P8IA 4M5IA 1HKBA 4B9MA 2QA1A 4PG4A 1QHTA 1RWMB 1YDLA 3NOGA 3I5CA 1LOTB 1R89A 3BGFA 3DN9A 5M2RA 5DGAA 1IJEB 3IWXA 3PZPA 2DO0A 2Y8WA 1VQMN 1F21A 3AO2A 1M1GA 2IMOA 3GBTA 5I4MA 3S3MA 2PBDA 1RBVA 3SUQA 4BC9A 3AY9A 4CO1A 2ATQA 5KFZA 4LQ9A 4PXDA 3M3ZA 5K8NA 2QWQA 3ID6A 4FVCA 2MSSA 3B4MA 1HBMA 4NLWA 2VBXA 5L1JA 1AXQA 3VGSA 4YHHK 2H5JB 4JNEA 1NH8A 2X1BA 4JI8K 3NGYA 4GC6A 2VCPA 3GG4A 2YKPA 2ETJA 2X78A 1BG3A 3FR0A 4CDIA 2IM3A 3CMAS 2X1FA 5LJVA 4LF6K 4C3LA 4NLCA 5KFMA 3NH1A 3D4JA 4LF7J 1QSLA 2C2OB 1Y0HA 3ICLA 4A57A 3QGIA 4LFBK 3F9MA 1IM4A 1S6OA 3L3CA 5L38A 4DTNA 3VQEA 2DR6A 4O3SA 4TVAB 2OPSB 2GIQA 3IMXA 1KSPA 1U25A 4DBQA 4R79A 1WAFA 5KFXA 4O8KA 3WXKA 3V1RA 3GCWP 3S1TA 2AF6A 3WEEA 2N4DA 4I7FB 1JLAA 4BDYA 1FT8A 2BTFA 1RDWX 3CD7A 1H2VZ 5AZIA 2ZGZA 2JOQA 2OD4A 3H2LA 4IOCQ 3G82B 5F0WA 5ITHA 3V6KA 4I56A 5KPTA 1RISA 3T5JA 2FVCA 4FKYA 1HL6A 1SJ3P 3NRBA 3FE1A 1RWKB 2IOCA 4CK1A 3JSMA 4PG7A 3H40A 5ETMA 4EBCA 5EU7A 1H6KX 4YQWA 3NBPA 5GIPA 5IC6B 1Q5YA 3W8PA 4JI5J 3QNOA 4WP8A 5A6PA 4KH0B 2PN6A 1VBZA 3GYXB 4EAHD 3PW4A 1M5OC 1TL3B 2DR7A 1VMBA 1JLCB 3NGZA 2Y0SD 4FL9A 5D77A 4IJAA 2MLYA 2YKNA 3VENA 2EFGA 3SQ0A 1XR5A 3EGNA 3RR7A 1VQ8N 2BA9A 1S5JA 3W3DA 5IZHA 2UUBK 2ZJPQ 1S57A 4CEDA 2MZ1A 4LF7K 4KI6A 3KJQB 1NGIA 5E0OA 5D3GB 1KQFB 1WC1A 3IN5A 2ATCB 2P2CB 1NGCA 3POTB 5C2DA 1BI4B 3FZMA 2VBWA 1BCMA 2AZ1A 4MLEA 3H20A 1WF0A 2HFVA 1S4FA 3I5AA 2ASLA 4NZ6A 2JNJA 1FVSA 4RU9A 3OR2B 3PX4A 3CXCM 2DNZA 5DK5A 4FCYA 3MD3A 5D0HA 4YORA 3M9MB 1X9MA 5M1FA 1CJTB 4UZBA 3T1HF 1Z2ZA 2RNEA 2W9AA 4RNOA 4JV5K 2E1YA 3OW2R 3NVMA 1FF2A 2O8FA 5H9EK 2D3ZA 2C3UA 4C4WA 1FRMA 3UI3A 3VGKA 1VQPN 5IWAF 3M32A 2RDIA 4CK2A 4OYWA 3EL2A 1RT2A 1RXOB 4BY9C 2QKKA 4JAXA 4CZGA 4ZS6A 3LPTA 4B8CA 2VH7A 3MPVA 4YOUA 1GLDG 4IG3B 5KFEA 3OLBA 1T8EA 1VOMA 4RNFA 2P9SA 5FDLA 3RBZA 2XYHB 4JI6K 3MXJA 3V9WA 4DTUA 4RU2A 5CYQA 4C1NK 2GJFA 4AHVA 1VIXA 1CULB 2I1RA 5CHCB 2VOOA 2NLWA 4FYWB 2HW3A 3R9PA 2C2MB 3CJ5A 3ZZ0A 2V4JA 3RU0A 2CQHA 4TXSA 4JYAF 3GLJA 1B0TA 2NXNA 2Q6BA 1X0PA 4QR2A 3LALA 2HBQB 4Y2MA 3R5AA 1ZM3A 4JV5J 3HFZB 4FXDA 1AZSA 3TZWA 2FBYA 4OJ3A 5KFWA 3H3NO 4F7VA 5KI6A 1EX8A 2E7VA 1P27B 3DLKA 3DHXA 3H46O 2MKHA 3O5TB 4L74A 1FRXA 3NMRA 1ZA1B 2EVZA 2MKJA 2VDIA 2E29A 3WQUA 3QZ7A 2GAHC 3QRRA 1MSWD 4PY5A 2FSJA 3F56A 2BRLA 3Q8PB 1KS2A 1RTZA 5DQGA 4JUZA 3SAGA 4TY8A 1X9JA 3OR1B 1I94J 1GEHA 5G0RA 3VAMA 3THWB 4KFBA 3KLFB 1WC6A 2R7SA 3GU0A 4HT5A 1Q4RA 2B5JB 2G1DA 3AVFA 2J0QD 3NGKA 3L2VA 5TKWA 3FFIB 3EGZA 5LMNK 2F8TA 4AILC 3PHTA 3HSDA 3AA2A 1P1LA 5DM6Q 3K57A 3HBTA 2P9IB 3Q8VA 1UJ6A 2JGUA 5KT2A 2I5JA 4N47A 1SL2A 3NF8A 4RW9A 1S7IA 2YWGA 2FZCB 1VQ7N 4P52A 1YRUA 1WKJA 2FVRA 4GVBA 2BH1A 5AQXA 2GMHA 4QOZB 2O66A 3R3TA 5CXTA 2E5LK 2B4OA 4DPXA 4R0JA 1MNEA 2HFOA 4O44B 4Y1DA 1C4CA 3AXMA 5CZ2A 1N8RO 3VPZA 2YKMB 4C48A 3IUCA 2Y3YA 1SJRA 1XMQJ 1E6YB 1NSPA 1WBBA 2PSZA 3DU5A 3NE6A 4H0YB 2FXUA 1TKTA 1VSLA 4UW2A 3KHYA 2FLLA 2H4WB 1ZBSA 2DHHA 2QA4G 4CH7A 2VFUA 4WTOB 1ZM2A 5DM7Q 4B3SF 3L3UA 3HD2A 3Q7CA 2C3YA 4X66F 4F4ZA 5B0CA 5LT5A 5CD4A 2VGNA 3HP6A 4KREA 4U6PA 1EWRA 1WC4A 1Q18A 1Q86T 4C23A 3TR5A 4GKKK 1IKWB 1WEXA 1S72S 4Q43A 2DRDA 4ECSA 3TPQA 2P9UA 3L95X 3OTOJ 3UNGC 5AQSA 1S48A 4JI3J 4ZLPA 2V0NA 4ZTJA 1WI8A 1TUVA 5EY4A 3D1OA 4X4NA 2F65A 3P6YC 3EE8A 2YQ1A 3CCWA 2FZKB 1CS4B 2PFFB 4LFCK 3CM5A 2E2PA 4J2BA 4BRFA 2YJFA 4H0OA 1IJJA 3SDEA 4Z7CA 2ZC4A 2IFXA 3ZFVA 5KFAA 1BHLA 5H1SQ 4IH7A 4BE0A 3B4DA 1KD1O 3D0PA 1VSEA 4CYUB 5DQIA 3MMCA 4RW4A 2GGPB 2AHOB 4LF9K 4DL4A 1PGZA 4OHWA 5H9FK 1GLCG 1OY9A 5F8LA 4BR4A 3IRWP 4BROA 5KG5A 4Q5VA 3S3OA 2AA4A 4G9ZA 4KPCA 4DX8H 3FBFA 2HZVA 4GW6A 1VRQC 2YNGB 5J1EB 1IWAA 3BGRB 1XMOK 5F2RA 3LOUA 1S76D 4X66K 1CJVA 4A5AA 3KNGA 2CPIA 5AQIA 3A5MC 1A0OB 4KHSA 3D2WA 3ET6B 3I31A 1VJQA 1W0HA 2LVWA 1U4BA 3PUFA 4U96A 2DJWA 2ZWPA 3R1XA 1FO1A 3NEKA 3ILIA 3WXLA 3CEDA 3IRXA 2YVSA 1Q7YT 2EI5A 4FDFA 3T19A 4DV5F 2VPYB 2HQDA 3M8YA 1CJUA 2GMJA 1WLJA 2RHKA 4OZLA 5AQLA 2DHSA 2X3GA 1BC6A 2KXHA 5AQOA 1TMMA 1CZBA 2HQIA 2V4RA 4DUZF 5D0RA 1KWMA 3HM8A 4DR4K 4BR5A 2VPXB 4OIXA 2HHXA 5BXIA 2G9OA 4ZK7M 3TTDA 2I9SA 2V7ZA 4ISGA 1CXQA 4J9MA 2UVRA 2P5OA 1EAYC 1MDUB 3M8PB 4M94A 3MAAA 5F0XA 4OLPA 2DT9A 1K9MO 4H4MB 2ZH7A 4J8FA 1YXQA 1BQMB 3M2VA 4DX5A 2V68A 4OJ1A 2CH5A 2EEYA 1TL3A 1DTQB 4MDAA 3TSUA 2Q0RA 4QW8A 4V19J 3CI5A 2W4DA 4F3QA 2O3DA 1NEEA 2PD1A 5AQMA 3VQCA 5DETA 3F44A 2HAIA 5KG7A 5IOLA 2ZH4A 1F6TA 5FRMA 3ZSVA 4JHDA 5C2CA 2YNIA 3R5GA 2YWKA 2MQOA 1JNRB 2B9XA 2NSCA 3K89A 1CZ9A 1YJ9N 4ZP9A 4GKKJ 2BQ3A 3NNCA 4WFBL 3TJ8A 1S0MA 1RCOB 1IR2A 2NREA 2QG9B 4NMLA 2B0GA 2H3GX 1H2TZ 5JS2A 5KFGA 4IRKA 3NNHA 3MCPA 1RHKB 3AQPA 5KFFA 5AFUH 3K2YA 2KKHA 3K5MA 3PSIA 1ATRA 2H4YB 1Q8KA 4DV1K 4HTJA 4ED1A 3ATUA 4FJKA 4ETXA 3DI6A 4MJKA 5K8MA 3UD3P 5T7BA 4LQ3A 4WIQA 2VQFJ 4BRAA 2HHPA 3O08A 3A8KA 2GQ2A 2J0XA 2P5VA 1FJ7A 3H98A 4A46A 2FIUA 2FDNA 3OQ2A 2F9DA 4FF1A 2JC0A 4X66J 3T1YK 3U9ZA 2DNKA 4NLXA 1HNWF 4JK7A 3IBCB 1S9FA 4WFNL 2ZZNA 6FD1A 4A2BA 1D4XA 4USHA 1Y64A 2P9PA 2WSCC 5G0RB 1DURA 4FNHA 1DBDA 1YG0A 2JLEA 3VQTA 5B8HA 1TUWA 4CFDA 2Q31A 4IG0A 4H4KC 2E6LA 3QIDA 2HZCA 2C42A 1RA6A 2OMLA 3DNCA 3N9UC 3T6BA 1KOHA 4DU4A 1T6CA 4CIFA 1D8ZA 2K7KA 4A61A 2CRLA 3TUPA 4MO5A 3LAMA 1WG4A 2BW7A 4E7JA 3IS9B 3FBCA 1YJVA 5KG6A 1YVFA 2CJXB 1WACA 2N7YA 1NGJA 2JWNA 1H7WA 2POKA 1VBYA 3KWMA 4FLXA 3C7NA 2J0WA 3OS2A 2F7VA 2C2RA 3M1VB 4CHNA 3H90A 3DRPB 1H74A 2KHDA 5KG4A 1PG5B 1GTHA 4C8NA 2CIMA 3VTIA 3PIOQ 3MM5A 2NSBA 1U7LA 1BHNA 4B08A 4FS2A 5D6GA 3MM6A 1YIJS 4F26A 1YJ7A 3SCIE 4NYOA 3J7AP 4JI1J 2W7AA 2UUCJ 1LWCA 4M8LA 2WTUA 2NRWA 4KO0A 4UF4A 2HMPA 3TNVA 2QWRA 1QE1A 4CF9A 4MKVA 4CO4A 3IAM9 1KR4A 2HAFA 4DR5J 2WUSA 4LSNB 4EUVA 4N76A 4DTSA 4FYYB 3L7OA 2E8AA 3PHEA 3TJAA 4CEQA 4FWNA 2VKZG 2P9CA 1FKAF 3MUVP 1U47A 3RMDA 3JTNA 3CJQA 2E5LJ 1XUPO 5GAHU 2HB5A 4DG1B 3J7YU 4ECRA 3LWMA 3DXKB 1WKLA 3DXBA 3SJJA 5LMNJ 3NVKA 2DGTA 1BA1A 2P9GA 3O80A 2QWPA 3NF9A 2VQFK 1M5SA 2LA4A 2WAQD 5GMEA 3GR1A 1H73A 4AQYK 2KLAA 4M42A 3DLEB 1RACB 1LAWA 4PPZA 3K5OA 3H08A 4RNNA 3HDSA 3JTOA 3ZLJA 1VS3A 3QBWA 2U1AA 4DG1A 4WU2A 3PRBA 3P4UB 2JH3A 4JI6J 1Q81O 1OH8A 1RYRA 4YOWA 2YNGA 5J1EA 1U2VA 2IBKA 1XC9A 2IRUA 3R6LB 2OGUA 2HYIB 4NI2B 2QV6A 2OPPB 1R6VA 1UTAA 2AYEA 4U7UD 3AFGA 4O55A 3OSNA 4GC7A 4BR2A 4JI0J 1DTQA 4U7CA 3JS6A 2IDEA 5LSRA 4B17A 4F50A 3KXDA 4M3ZA 3VZIA 2E2QA 3BEGB 2RDJA 3CD6N 1WORA 2IJNA 3LGHA 3DJCA 1MROA 1H7XA 3WX8A 1N52B 2CQPA 2LSNA 4DR7K 3LGNA 4USTA 2D0PA 4Z4GA 2VYPA 1VHFA 1P1TA 3CO0P 4OYMA 2ZD1B 4CF1A 4IFVB 1TYQB 4X4TA 2IPOB 4EYIB 3HHNB 3WEEB 2ZDPA 4MTPA 3ILJA 5AE2A 3Q0AA 1RWNB 4U9RA 4CLTA 2YCHA 4A8WA 2V4QA 3T6JA 3QICA 2W01A 3KHGA 4CGFA 4LF5K 4DFJA 1ZC6A 1JJHA 3Q8UA 4CO3A 1JIHA 2Q6CA 3LZIA 2ZVSA 4E1JA 1PBUA 3DI6B 1XJWB 5K8PA 3PJ9A 3DLLL 5DRKA 3SEOA 3RB0A 3OY9A 4WBFA 2OELA 3RAQA 4NLQA 5DLGA 2Q1LA 3W5XA 2DNQA 4JKCA 1QDUB 1PYOB 5H9EJ 2HNYB 1UMJA 2V6AA 4KB1A 4J9LA 2CADA 2YKAA 4ZP7A 1IKXA 2RJZA 3A2FA 1F1BB 2V2ZA 3BYPA 1U6ZA 5GAHI 2ZH9A 5FPEA 3MOZA 1C0TB 1EP4B 2CPFA 3HL8A 4NEYA 4KV8B 3MMAB 4QWDA 1KCFA 3KK1A 2HHSA 4Q2MA 2HBLA 4C0BA 4FBTA 5DDQC 1R3NA 4R8UA 3E9LA 3PYFA 2YH1A 1RAIB 4CLFA 3C19A 4CNZA 3AO3A 4AHUA 4S0MA 1WF2A 1S10A 4JV0A 1KDNA 2HBYB 4PUOA 2HEKA 4ID1A 3K8WA 2XS5A 3FUYA 4ECTA 4DPOA 4H4OA 2XS7A 4KKOB 3PW7A 2GX8A 1KQKA 4NCAA 1WB9A 4DN0A 3I55S 1VQ6N 3ITHB 1W9HA 1F5AA 1IBLJ 2BE7D 3GFXA 4A8QA 1S49A 2BZ2A 1I1GA 4QW9A 4B3MF 1JXVA 1FVQA 2RRNA 3I4PA 4UQGA 3CDUA 3BYRA 1QM9A 5J2NA 4F4WA 4G3IA 3DLEA 2ZC3A 2E44A 2BOPA 1WJ9A 4CI6A 3I82A 2YWFA 2ZNYA 3T41A 4OPAA 3FDSA 4DOZA 1YKWA 4EMDA 1DT9A 1WOQA 3U3GA 5IT0A 4OGEA 3GL1A 5C25A 2RHSB 4L3KA 2QFJA 5LL6Z 1SZ2A 1D3WA 1C0FA 4QCLA 2PEHA 4KGKA 1UFWA 4RR5A 3LUYA 3O6QA 4MKAA 2WHOA 4ZCLA 4KAIA 3MR7A 4QYZK 2D7SA 3OXGA 1S3XA 3OYBA 1X5TA 2R7OA 2CQ0A 4Q7AA 4GY2B 5AQNA 1KXPA 3DDNA 2AJ2A 4DX6A 1U2RA 5CH7B 2EWHA 2LQBA 4MK9A 3GYGA 2UXBJ 2QEXN 2JVOA 1RDCA 4HHHA 2M52A 5HRPA 2Z2YB 3C6HA 1QAYA 3DOMB 1I51B 3MTJA 1FK9B 1JLQB 2DNYA 4B3TJ 4BC4A 3KMSA 1HBOA 4OI2A 2CVEA 3LP3A 4C97A 3CDWA 3QPIA 1BCOA 4WP3A 1UFKA 1OMSA 2AEMA 2AGOA 5JUMA 2XC9A 5HATA 4DF8A 2ZH2A 3ZSQA 3GSDA 4GVMA 1S72N 1NBEB 3FSYA 3EXYA 1FFSB 2L9WA 4MKBA 2NXEA 2E9RX 4ZLLA 5BR8J 3NF7A 1W7AA 3LL3A 3CMEN 1FXLA 2FUG9 4ZP6A 2HHHJ 4HTUA 1VQLN 1ELOA 2K1RB 2ZH5A 4XPEA 2HGNA 2ZH6A 4OYIA 4F8RA 2FVQA 2LQ8A 2YTCA 2Q3SA 3PXGa 4BLGA 4CGIA 4DUZK 1I3AA 3GJTB 2FYXA 4EO6A 2B8QA 1Z1ZA 2BOAA 3IG1A 3P39A 4GRSA 5F41A 2DGXA 4P2FA 3F5TA 3UKRB 1HMVA 3B6OA 4J2DA 4GMKA 3KJVB 2E9TA 2GJ2A 1N34F 1YAGA 5HANA 3THPA 4X4RA 5AQFA 1KVAA 2VHGA 1TZ0A 2UZAA 2YKQA 5J2MA 4Y2IA 4QPXA 4E1NA 5AJ3K 4I2PA 4Q45A 4FVMA 1E6VA 1OSDA 1TKXB 3M6VA 4PKDB 1KTVA 3OL9A 1IKVB 3QQCD 1HQEB 2MJUA 3SUNA 4B9QA 4ED2A 4TSXA 1NLVA 4G1IA 1KFDA 2KKZA 3CSKA 4YR2A 1YZ7A 3G10A 1GX5A 2MLZA 3L4BC 5DDRC 2UVWA 1HPZA 3K0SA 1X60A 1S0NA 4PKHA 4M3UA 3OR1A 4GKJK 4NI2A 1MMNA 3JQJA 4HH1A 4GMJB 2WVBA 2YKOA 3CCRS 3V81B 5A8KA 3GJSB 2VKRA 2XZWA 4FSVA 2OP5A 5D4OA 4B9UA 3TAFA 1NDKA 5F1XA 4DI6A 1KONA 1DQ9A 4I0WA 2FF3B 3CTRA 4B9TA 2A40A 1RT1B 3K5LA 4RL1A 3JTPA 4DR2J 4PABA 1U0HB 3J7A1 4DMNA 3MDQA 1REVB 1TV6A 3J80Y 4DR2K 3T69A 3ZZZA 2XLKA 3VQ5A 3E8OA 2HPUA 1YJUA 4ZTFA 1GMUA 4DPWA 2UUCK 3DRSB 3IA0A 3ISNC 4QS9A 1D9FA 4ZCKA 2WBNA 5GADP 1RAHB 4WIIA 2A10A 2CPYA 3SBTA 2L48A 4B3RJ 3H5YA 2P9SB 5GMKa 2V63A 4J9OA 2UUBJ 3D2FA 3EZUA 3RBEA 4H54A 1FA0A 3H7HB 1RAFB 3IFRA 3SQGA 1ZTTA 3HSZA 2O8CB 2A1BA 4I69A 5DG9A 2UXCJ 1HNZK 5E3AA 3D68A 1S9EB 4ZVQB 4FOIA 2OEKA 3RWUA 3TTCA 3KWGA 4WTYA 2W1BA 3CCJS 4WXWA 1KNZA 2GUIA 1J2VA 2GZOA 4MIAA 3UD4P 2D3O1 1ICEB 4K5RA 1SC1B 4KTZA 2E7WA 1F5CA 1PAEX 4CEZA 3EICA 3MM5B 3O3FA 2XWYA 1MN9A 3CJSA 3PO4A 1TVRB 4HHUA 3AO5A 4DU1A 3OYDA 4USVA 3CCMS 4DKWA 1ZBLA 3DLRA 2DTJA 2PI5A 3W7BA 2BW2A 2L9DA 3F2KA 3ULDA 3KG4A 1PKUA 1UW4A 2IJRA 1REGX 2IIHA 3TWHA 5ETLA 4KGVB 2IY5B 4O0IA 3MAQA 3KK7A 4B3MJ 3GFYA 4CGHA 3VETA 4DUYJ 4KY3A 3TJ9A 1RTDA 2J7KA 3R2CJ 5GAHP 3A1YG 2EG1A 3LO3A 3FSIA 4NL5A 3ZYYX 2J6UA 5C2GA 3ENQA 2KG0A 1W25A 1ILYA 2XHWA 3LQVA 1VQYA 1HBUA 2YHXA 4DS4A 4E1MA 5GIOA 3KNAA 4C0HA 2D41A 3OPKA 3D5MA 2QZ8A 3R7NB 2K3KA 1FWLA 3H8YA 1Q16B 2VODA 5KRTA 3OYNA 2WTFA 4MIWA 1YHQN 3H6EA 3IAYA 3IRXB 2OPPA 1YUWA 1N0VC 2O5DA 2IVOA 1QVGM 1NU4A 2NQPA 5F8MA 3RRHA 5K14A 4DPUA 5KPZA 2DR8A 4Q44A 3SCXA 3BH7B 3GFHA 1SJ1A 3QBCA 2N4CA 1C4AA 4ZDNA 1X3NA 5EXWA 3VEVA 1RTIB 4PAAA 4PKGA 2HKEA 4CBWA 2BUPA 4NXMJ 3PVXA 2CYYA 4C8YA 3CIPA 2DPIA 3NAHA 3Q23A 3SPZA 3IAS9 4JKGA 2GC8A 3OFHA 3M30B 4JI5K 5F8NA 2YQ3A 5EWGA 1YITS 5FRNA 1C1BB 1U6FA 2E1CA 2Z57B 2NUUG 2MQ8A 2YH0A 4H0TB 3NH2A 5AQZA 3O1BA 3U02A 4ZCMA 3B6BA 1A5XA 2EPIA 1EKSA 3VQAA 1G6BA 4EYHB 4IFEA 1M90O 2RRBA 4RWWA 2ZDOA 1WHVA 1JJCB 1FRKA 3V4IA 4UY8O 2XSFA 3BBCA 5JJBA 3HOSA 4QS7A 3UO0A 2LYVA 2C3PA 3CXCR 1MN7A 4O5FA 1P8ZA 5BYSA 3MM7B 3LDNA 4HI1A 4KI4A 2NZ4A 2CZ9A 2G8VA 3MMVA 4X65J 2CJBA 3LP0B 1T11A 5THWA 1S1VA 3ZEUB 1X8DA 2RD5C 3L7PA 1UPMB 4QR1A 3CJAA 3OYMA 3MOJB 4LVNP 4DTOA 2JLFA 2UV8A 2G8IA 3KG1A 2GCFA 2CJQA 1FHTA 1N48A 2HBJA 3J81j 2CH6A 2ITMA 3VEYA 4NEZA 4WFXA 2HIQA 4DU3A 4M5DB 4I6YA 4R25A 1EQMA 1RT4B 3EWGA 1TL1A 5KG3A 3G8SA 1WSEA 4E98A 3UKUB 1S1VB 4TLRA 5HK4A 4FJHA 4RW6B 2W9CA 4CEOA 1SPBP 4RKUC 2HSTA 2BM0A 4CJTA 1HI1A 4J9QA 1VDHA